2Y0SF

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
total genus 10
structure length 90
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2y0sF02
3HKZF 2PMZF 2WAQF 2WB1F 4AYBF 2Y0SF
chains in the Genus database with same CATH superfamily
5DBBA 5AIBA 1LKYA 2BCUA 2LYHA 1UPHA 4C4RA 3RH6A 2RDJA 1ZQXA 1COOA 4Z6DA 4UAVA 3GILA 5KFAA 3A0BU 3OGUA 4R8UB 5DQHA 5KFJA 3RR7A 2XY7A 1QSYA 3FM9A 2R8GA 1VLBA 1S0NA 5D4BA 1K1QA 5HR6A 4Z6EA 2KICA 5AIAA 4P0PB 8ICHA 3GV5B 7ICLA 5K4LA 2CRXA 4IL6U 5C5JA 2RDIA 5TZVA 2MUTB 1MQ2A 2DKXA 3QUCA 4QWBA 5IIMA 4QZHA 1M6YA 5ALRA 1WWVA 4KN7A 2AJQA 2JRZA 3OHBA 4CDGA 2GO7A 4GXIA 3NRWA 4CRXA 1NK6A 1TK5A 8ICRA 3C1ZA 7ICEA 4KLDA 1UA0A 4Y2RA 5AICA 4LJXA 4PHAA 4TUQA 1SL1A 2W43A 3SQIA 4M9GA 4FE3A 2XIDA 1RXWA 1X6JA 3RBEA 2UVWA 2ATLA 5D46A 4DL7A 3F2CA 1L5UA 5AKGA 1RQNA 2JV3A 4AYBC 3JPOA 3MDAA 3HP6A 4ELUA 3PR4A 5J2BA 5JU5A 5IINA 5J0XA 3QU4A 5JRTA 3RRGA 4PGQA 4PZNA 5J0QA 1S10A 5KFCA 3Q8RB 4MHVA 3MGVA 1TKDA 1CI4A 4DS5A 5AKJA 4OD0A 2ZIWB 4I2FA 3KKAC 4KX5A 5ALXA 1RDFA 2CXYA 3H0MB 1U9LA 3EYZA 1Z3EB 1S0MA 1ZQMA 5TISU 5J29A 3IHQB 4ICAA 1SWWA 1KBUA 2FJ6A 1JN3A 2G07A 4I2AA 4F92B 2ZIUB 4JV2A 4PHEA 4RPXA 3OJUA 1L3UA 3BQ2A 2HVHA 2Y9TA 2HHVA 3PNCA 2BCVA 4M47A 2VKQA 4I27A 5G5HA 4DL5A 3PO4A 4NL9C 2DKZA 3BS5B 4QNLA 4UATA 3EZ5A 3T3FA 4UB6U 2E5SA 3I1YA 2O6KA 2OXOA 2J6UA 1PVQA 9ICKA 5AI9A 2YB1A 4UAZA 2JEIA 1ZRMA 3QXGA 1HEKA 1S5LU 2F8KA 4DLEA 7ICNA 3SI8A 2NO5A 3FYHA 2Y9UA 1U47A 1ED1A 4R65A 4E0DA 2A19A 1NOMA 3LDAA 3MABA 4CF3A 1TAUA 2M9NA 3PMLA 4Y2QA 4F72A 1MA7A 5KFEA 2IOFK 1S9FA 3OSNA 1NKEA 3HWTA 4KX3A 3NVYA 1Q3VA 1ZQCA 3PSTA 1C20A 2MUTA 2LHTA 5KFYA 4IRCA 5DG9A 5ALOA 3TAQA 4QIWC 4DFJA 1B22A 3OHAA 1WYGA 4RZRA 3NVVA 4YXMA 5KFKA 4IC9A 1ZQSA 2XO7A 4IR9A 3UMCA 8ICNA 2AQ4A 1N48A 2OH2A 5KG5A 2F3NA 1LVHA 4DL6A 5ALDA 1SV4A 4Y2PA 4Q45A 3PX0A 5AM5A 4ACOA 3C5GA 5ALJA 1N60A 1MQ3A 1WG8A 3AQEA 2IMWP 5CHGA 1PK1B 3C21A 3H8JA 4F5RA 3D2QA 4OJLA 2NRZA 1B43A 5J2AA 1KSPA 4ELTA 2YX8A 4QZAA 1ZD5A 1X9MA 4BDPA 3MR6A 4PGXA 4OJOA 2ZIWA 5KFWA 3NUQA 4CF4A 1KKXA 9ICAA 4QZ9A 2QKQA 1RZTA 1SL2A 2ZIXA 3RF9A 1AROP 2AQ0A 4ED0A 5KAFU 3QUTA 9ICFA 4O5CA 3HILA 2XCPA 4DL2A 4Y2SA 2KOBA 2ZIUA 2NRTA 5AKYA 1NK8A 3SEIA 2W04A 3QUQA 5ALIA 1Y88A 3NASA 1A76A 1SL0A 1YZ6A 3BS7A 1F44A 1N56A 4G9BA 1RXVA 1UHUA 4YMOA 5AHXA 1DOQA 2W8LA 1KFDA 4RPYA 4R63A 3IM1A 3RJKA 3M1YA 1BPBA 3BS5A 2YTUA 4KLOA 5KFOA 4EX7A 2DBYA 4F2RA 3NVZA 1Z4NA 3K1ZA 4UB8U 2VJ5A 4BJQA 1L7MA 4C80A 4QWDA 5KFBA 4B6JA 3M9MB 3B0YA 2EZYA 1L7NA 4PH5A 4C7ZA 4JWNA 4FS2A 2RLTA 3RRHA 2DL0A 4DSEA 4US9A 1ZXIA 1T8EA 1RG6A 4NWIA 4QZDA 2GH1A 2WF6A 4I2DA 3ISCA 3L3FX 3PW2A 1ZQBA 8ICGA 3AU2A 3UQ2A 5KG4A 5J8YC 3G6YA 4M6WB 3M7DA 1X42A 4YFKA 3V72A 2IHMA 1ZD4A 1WCLA 8ICKA 1S77D 4ED7A 2XGPA 2JGAA 3SV4A 2ESEA 3OJSA 1ZQAA 1ZQQA 2R8IA 2I1QA 2LPEA 4KLJA 1DK3A 2JEFA 4MFFA 3DDHA 4F5NA 4CE6A 3G6XA 3T79A 2BCQA 4PL1A 3C5FA 3MR5A 2YQEA 2AH5A 1PVRA 1H38A 3T5LA 4M0AA 4NJ8A 5DDMA 1A6SA 3IN5A 5ALHA 4B9TA 4BUGA 7ICKA 1D9DA 1WCNA 4DOBA 1PK1A 5DQIA 3SENA 4U6PA 1L3VA 2ZUBA 4BGDA 4B9SA 1ZQHA 5ALVA 4Y2XA 4UB3A 4P2HA 4M04A 4C8KA 2HHQA 8ICAA 2J6SA 2PMZC 4GLXA 4RQ4A 1RYUA 4QZBA 3A0HU 1SKWA 4O3MA 2QB1A 7ICHA 2H3VA 1KRPA 4I2IA 1ZD3A 4NLZA 2KFNA 4P0QB 1ZQFA 1XSLA 3H7IA 1D9FA 3RJEA 5EE9A 3IP4B 2IBKA 3TACB 1ZQOA 2XY5A 3HJEA 9ICOA 4QZEA 5CRXA 5KAIU 4NY8A 2AGPA 3GDXA 4Q43A 1QSSA 4J9OA 4WJ3B 5HHHA 3F53A 5EE0A 3M9NB 3ALRA 4P4PA 3BQ7A 4EX6A 5DKWA 9ICXA 2JZBB 1JALA 3JPNA 4B9MA 4JB3A 3ETRA 4ED1A 1BNPA 5ALEA 5HMMA 1KN5A 5KG7A 4EZ6A 5DBAA 1BPYA 4RNNA 1NK7A 4R66A 4IRKA 1TE2A 4O5EA 2P6UA 1JMSA 1NKBA 1FFVA 4KLGA 4KLLA 2DWQA 3UXNA 5KL1B 4DOCA 5AK6A 5AKKA 5J2IA 1RYSA 2W9CB 2WHEA 5AM3A 5AM0A 3S6JA 4M6WA 2KVCA 4RUCA 1Z4OA 2W54A 1BGXT 2Q0ZX 2LYBA 1IXRA 3VCBA 2BDPA 2ZIVA 3B0XA 1RQLA 5DDYA 2FMPA 1NK0A 2XVTA 3ZD9A 3FDSA 3KBBA 1L8LA 4YQWA 4ECWA 5AI5A 4ZH4A 2B0CA 2ZTDA 3KZIU 1ZQJA 2HW3A 2H3QA 1NI3A 1DGSA 5KFLA 3E0FA 3AUOA 1LV5A 1SV0A 4UBBA 1PK3A 5J2GA 5H2FU 3PW0A 2C2DA 3BDPA 3RFAA 2ES6A 2ZTEA 5CB1A 1KFSA 9ICWA 1MSWD 9ICCA 2KKPA 5AI8A 3TI0A 1D8YA 4FBUA 4QWCA 8ICLA 2E1EA 5KT6A 1KW4A 3IG5A 1ZQZA 2V4QA 3T5KA 4PL2A 2P6RA 3JPTA 3AN1A 4KLMA 4EBDA 5ALYA 4C4TA 4YCXA 5AK3A 4RQ3A 4P0QA 5KFQA 2R8KA 3C2KA 2RP5A 3F5AA 3T5JA 3EW9A 5EWGA 1QQ7A 4QZGA 4O3RA 3TKAA 5IIIA 7ICQA 3SV3A 2LM4A 2BGWA 3O0FA 2HHWA 3IRUA 1TK8A 1ZJMA 2Y1IA 4DFKA 3TAPA 2JHDA 2BPFA 2P66A 3AEVA 1BPXA 2NRWA 2E8NA 4F5QA 1KQQA 4JK1A 2PFQA 1TV9A 2DUYA 4F2SA 4DFPA 1OUQA 5J2KA 2G0AA 1EXNA 1PZNA 2GOLA 4ECRA 1ZQWA 8ICPA 3AU6A 2BQUA 3RH5A 1COKA 3Q8MA 5DLFA 2A1AA 3WKBA 2PXIA 2ZTCA 9ICHA 1T7PA 2EAMA 3AL0B 4GFJA 4F50A 2Y0SC 2KKVA 3RJFA 8ICMA 3V6KA 4O3SA 1SZPA 2W9MA 1ZD2P 3GIMA 4DFDA 2VA8A 4QZFA 1D8LA 2W9CA 1A0PA 4YD1A 3K1RB 4O3OA 2W9BA 1XO0A 2QLTA 4KLTA 4ZOHC 2BPGA 1KFTA 3THVA 2XI9A 2BDUA 1ZQUA 4DL3A 4C0ZA 5AKZA 2A1JA 2KFZA 3R9KA 4IQUA 4UASA 3M6KA 1JIHA 3M8SA 2YMQA 3Q8LA 4I2HA 4J9LA 3RB4A 3PO5A 1XWLA 5IIKA 3C1YA 3OPXA 4IQWA 2W3SA 4DQPA 4O0IA 2CPRA 1SXEA 5L1IA 2ASJA 2AGQA 3OTQA 7ICSA 2I5HA 2OCEA 3CP8A 4KLFA 4M9LA 4RU9A 2E8MA 2KIWA 2HHSA 3PSPA 4TUSA 2KHQA 3SD7A 3BJYA 1HJPA 4ED2A 2YMLA 5KFGA 2J6TA 5ALQA 4QJFB 1S97A 3KHLA 4RPZA 5KFMA 4CGZA 4F4XA 1ZQ1C 2H3FA 2E8PA 4YN4A 1T3QA 1A77A 4JV0A 9ICNA 3LVWA 7ICMA 5KG1A 2PFPA 5J2CA 3V7JA 1BPEA 3C28A 4DF8A 3HT3A 4B9VA 2JR5A 1FO4A 3N7RC 1U4BA 4R8UA 4TURA 3RB3A 3L4PA 5KFPA 1QQ6A 2EZXA 4O3PA 1ZQDA 4P0PA 4DWIA 4C4SA 4UB4A 5DQGA 2BPCA 5HMLA 2FMSA 2K89A 2EANA 3GFKB 1J2MA 4I2EA 4PPXA 1NK4A 3TANA 4IS7A 4Y2YA 1T3NA 3ORYA 4B9NA 4NLKA 3MR2A 4U7CA 1V9PA 4FFDA 8ICOA 3KD3A 1URJA 2ZXIA 4F5OA 5J2DA 1XS9D 7ICGA 2KVSA 1QTMA 1KDHA 7ICIA 2ALZA 2AGOA 2MA1A 1QCKA 1HIWA 4KITB 4KLIA 2WB1F 2KMDA 2FLNA 2DF4B 4J9KA 5J2FA 3WKDA 5EE3A 4RQ1A 2IOHA 5DGBA 2ASLA 3HKZF 2BQ3A 4I28A 2KV2A 3V6HA 8ICCA 3ZDAA 3CYMA 4ECSA 2E1FA 5ALTA 4TQSA 5BOLA 2HI0A 1QQ5A 3I28A 2W7PA 2F1HA 2PFOA 5CP2A 3IDWA 2XICA 1F5SA 5B5EU 3WU2U 2ISOA 2W55A 3PW7A 3J81j 3EPIA 3H0LB 1JUDA 3WK5A 2EQYA 4XA5A 2BCSA 4M9NA 2WFAA 4OJPA 2C22A 2HCFA 2GWSA 3K4GA 3BQTA 4YXJA 4UB1A 8ICSA 2LM1A 3N7PD 2YMPA 2KSOB 4DSIA 1ZQRA 1BVSA 2K8AA 2OYYA 2KHVA 4EEKA 4F5PA 2VJ4A 2K4HA 1U49A 1ZQYA 1O03A 2KEYA 1N63A 3QYPA 3PX6A 1PUZA 9ICRA 2G5HB 1IM4A 3F2DA 2HOFA 9ICPA 3T5HA 2IHNA 2MSNA 3H8SA 2ZXHA 1JXEA 4ECYA 2F76X 5BPCA 1RPLA 5IIOA 7ICFA 3LVVA 4J9SA 2HMXA 5KTQA 5B66U 3IG8A 3FC4A 3MGIA 3I76A 1XSNA 3H0RB 7ICJA 2WF8A 3PV8A 2W9AA 2AHOB 2EZZA 8ICUA 3C2MA 5KFRA 4PZOA 1NKCA 2M0NA 2K8BB 3PY8A 3QU7A 4ECVA 2R18A 2C2RA 2K4PA 4DQIA 4NM1A 2V9WA 5J0PA 4Y2TA 2UVVA 1XO1A 2FI1A 2I6XA 1IV8A 2W8KA 4C7YA 4YR2A 4ED3A 4YMNA 4J9QA 1NJZA 3SAHA 1JRPA 2I9GA 2JXJA 3H4DA 2KJ9A 2AU0A 3QEAZ 2MAXA 3UMBA 5AM2A 3PMNA 1XC9A 5KG3A 4PHDA 4EBCA 1ZQLA 2KZMA 2P35A 1ZQPA 4C8LA 1SV0C 5HR7A 4Q8EA 8ICQA 2H3ZA 4MEXA 3RJJA 5J0OA 8ICXA 2WAQF 1B4FA 2KN7A 3ZD8A 4XQ8A 1ZJNA 1X40A 3BZKA 2C28A 1DRGA 5DB9A 2F1IA 2DPIA 2Y1JA 2HDOA 2N1RA 1F0MA 4LZGA 5ALFA 5DB6A 3SYZA 4QWEA 1NK9A 1O08A 3ISBA 8ICEA 2XY6A 5AKHA 4MF8A 2KJ5A 1LKYB 2E3TA 3UXOA 1NNLA 2HBJA 5FP0A 2E8OA 4UB5A 2D3DA 5J0UA 5ALKA 5L9XA 5DBCA 3BQ0A 1JX4A 4OJ6A 3JPPA 2G5IB 2HSZA 2YN4A 2KSOA 3LWMA 4NLCA 9ICLA 2BKEA 2ZUCA 3RAXA 5DLGA 5J2EA 2KD1A 1ZQKA 4EEYA 4YP3A 3V7LA 5KL8B 4DLGA 4FS1A 4NM2A 2HBLA 2KIVA 3KTQA 9ICMA 1NJWA 1IIPA 4Z6CA 2F77X 4YR3A 1JXLA 4IR1A 1J97A 1SB3C 1L6NA 4M9JA 3WK8A 2W7OA 1FEZA 5E79U 1X9WA 4EYHB 7ICVA 3QU5A 1MC8A 1U45A 1TFRA 5DGAA 5F9LA 4DOAA 3RAQA 1YZ7A 3MFHA 2NV3A 1IG6A 4A8EA 1HUZA 2WAQC 2ZJ8A 5T14A 4KLQA 5L1JA 2JH7A 3H8WA 4YMMA 3FAHA 1N5WA 3PX4A 1Z1BA 4O5KA 1S8OA 2BCRA 3NTUA 4DEZA 4DQSA 4J9MA 1RM6C 4FZNA 5KFDA 2V4RA 5L1LA 1GO3F 1BPZA 4YD2A 4IQTA 5KFIA 2HOQA 4NXZA 2VA3A 8ICIA 2DPJA 2KK0A 5KG2A 4TQRA 1Z19A 7ICUA 1VDVA 1ZQIA 2K8CB 5AKEA 2YMMA 3N97B 4B9UA 2DQNB 5DB7A 2BZFA 1XNSA 5AM4A 4GC6A 4CCHA 5HNKA 2Q4TA 3WKEA 5KFHA 2W11A 1Q8KA 8ICFA 4F8RA 4P4OA 4AYBF 1HUOA 3VC8A 5L1KA 1UA1A 2HHUA 4NLBA 5ALUA 3TARA 3E58A 3C23A 5DG8A 5KT3A 4B9LA 2JMGA 3AMZA 3MDCA 9ICTA 1BNOA 3ISDA 3QZ8A 2PI4A 5CEHA 4RQ2A 4JUZA 4CF5A 3KHRA 2YY6A 4IQVA 3UQ0A 3CRXA 5C0YA 4K4GA 9ICEA 2KZZA 1KL9A 2C2EA 9ICQA 2Z7JA 2EH9A 4BWMA 3RB0A 3RH4A 3BQ1A 3BZCA 2UVUA 3RJHA 1ZOLA 1CUKA 3JPQA 5EOZA 3CW2C 3PW4A 1L8OA 2ZUDA 4RT3A 2JZBA 1DXSA 2CN1A 3QU2A 4P4MA 4OJ5A 3QE9Y 2RRDA 3MFIA 1SXDA 2FPKA 1OW5A 2NRXA 2G08A 4RQ0A 1JROA 2BHNA 1ZETA 8ICYA 9ICIA 3WK7A 2LKYA 2KZ3A 5ALZA 2KNJA 1SZHA 3ED5A 4FZLA 1TK0A 4ELVA 3WK9A 3PW5A 4I2GA 4OCZA 1S0VA 5AKXA 3NGDA 5KFUA 4F91B 2MRLA 3AQFA 4YR0A 4IRDA 3JPSA 7ICOA 1NZBA 4YG2A 1SIJA 5KFFA 1T94A 3D2SA 5J0SA 1ZQVA 4KLSA 5DB8A 3L5KA 2ZIXB 2KJ8A 1ZQTA 1OXJA 3M8RA 3SR6A 2NYVA 1FIQA 4QIWF 2ASDA 2R8JA 1UCVA 4RT2A 2PI5A 3N28A 4UAUA 3E2EA 1N61A 3U26A 1N2XA 3MC1A 5KFVA 5IIJA 1L3TA 4KTQA 1Z00B 3TADC 3V7KA 1L7PA 3Q8QB 2K60A 2K4EA 4PHPA 3HW8A 2JEJA 3GV7B 1ECWA 3KZXA 1PVPA 4UAWA 1D8BA 2A3VA 2BQRA 4O3QA 4GIBA 4RQ6A 3NS1A 3HPOA 3Q8KA 3H40A 4DSJA 4Z6FA 4EELA 1XU4A 4I29A 4MF2A 5EWEA 2PKEA 2F8LA 3M9OB 4KLHA 4DSFA 2FMQA 2FPMA 1NJXA 1UT5A 2FLPA 1TAMA 4MFCA 3QUBA 1N5XA 1CRXA 2WF7A 3SAGA 2ZJ5A 4HYKA 5CA7A 1NJYA 1NZPA 4USAA 1N62A 2LBOA 1J2NA 5KFTA 2XCAA 4UQGA 2H3IA 3RTVA 5D49A 5AKIA 1CEZA 1XSPA 4K4IA 2FE9A 3QX7A 4KMUA 4MFAA 1LB2B 2ZJAA 5ALLA 4DO9A 4FBTA 3GIIA 4RQNA 3MGHA 3LWLA 4DCCA 4QW8A 5KT5A 2F1JA 2ZG6A 4KLEA 1ZQNA 5AM1A 4QW9A 4FZMA 3MBYA 5KFXA 1L3SA 5ALWA 5ALNA 4DL4A 4PGYA 3Q8PB 1X9XA 1S0OA 8ICWA 3ZDBA 2KG5A 5BOMA 5ALSA 1KEJA 7ICPA 2KTQA 4J03A 5AK5A 4EBEA 3C2LA 2H5XA 2D8CA 1WWUA 1WUDA 4MEYA 8ICJA 3QU9A 3QEBZ 3ZI4A 4ECZA 3KOOA 2F2AB 4Y2JA 4C8NA 4R64A 3RBDA 5A0LA 3H8MA 3SZ2A 2HVIA 1Z1VA 3KKAA 3WKAA 4K4HA 3B9JA 3QNMA 5KG6A 1SKSA 3TFRA 4M2YA 4KMOB 3UMGA 3UM9A 3ZDEA 2KP7A 3RJGA 1ZQGA 3TFSA 4XRHA 4RQ8A 1VJ5A 3EWAA 5F9NA 4BXOB 4F71A 4QZIA 3RJIA 1BPDA 2FLLA 3ICXA 4DF4A 3GU3A 3TADA 3NRZA 5HP4A 3D2NA 5GTIU 4RNMA 1Z00A 3KFUF 2W3RA 4FO6A 2OEHA 4AP9A 4KN4A 3GZFA 3WKCA 2OWOA 1V97A 4UAYA 3G6VA 4NL9A 4BWJA 2OM6A 1SWVA 5KG0A 2HBKA 2L5YA 2WB1C 3AM9A 5F3XB 1UQVA 4J9RA 4XUSA 5J0RA 5ALMA 4Y2VA 5J0YA 3PR5B 2G09A 3HKZC 3PSIA 2LI6A 4DQQA 2XGQA 5KT2A 2WF9A 3ETLA 2PMZF 2ISPA 2HOIA 8ICVA 4F93B 1C7YA 4F4WA 3KHGA 2LYAA 5L1MA 5JTIA 4GXJA 3WK4A 5HHIA 4CNQA 4DSKA 2FDRA 4J9PA 9ICSA 2IA6A 5J2JA 1QLNA 3SAFA 4ECQA 3ZDDA 3RB6A 5KT7A 4TUPA 3GV8B 1K1SA 2VIXA 2G06A 9ICUA 5AI4A 2K4IA 7ICTA 1TVAA 2LMRA 4OO1J 4Y2UA 2JEGA 2RQ5A 2NRVA 2ZIVB 4RQ5A 2ODGA 2QARB 2F44A 1QSLA 5GTHU 4F4KA 4ED6A 4F4ZA 1SKRA 4EYIB 1TAQA 1Q46A 5EE1A 5CR0A 3ZDCA 2JH1A 2KE7A 5ALPA 2QB0B 1SGGA 5ALGA 4NLNA 2NO4A 3MR3A 4X5VA 3OSPA 4ED8A 2MU2A 2BR0A 4UBCA 4C8MA 9ICGA 1YT3A 1AQ6A 4J9NA 1NK5A 1MN8A 3LYSA 1V85A 3EUB2 4ECUA 5J2HA 2D6FC 9ICJA 1DGJA 1JI7A 4F3OA 3M6ZA 4RUAA 3HRDD 5KNIA 3Q8SB 4BX9C 3GIJA 1K5OA 5DG7A 4RNOA 1T4GA 1X9SA 4UARA 3PZPA 5KFNA 2GLEA 3IV6A 4BXOA 4DQRA 3D6JA 1X2IA 4JWMA 3UPQA 4O9MA 5J0WA 4HAIA 5AK4A 1KLNA 4Q44A 2YB4A 4PJ0U 4GC7A 4I2CA 9ICBA 2IOFA 4NLGA 3K75D 8ICTA 3QZ7A 5AI0A 4UB2A 3EPGA 3JPRA 4LZDA 1FFUA 2B21A 1X6IA 1UT8A 2WF5A 1ZRNA 2W03A 4JV1A 2HHTA 4EZ9A 3LK9A 3UXPA 1S76D 4YVZA 8ICBA 1KTQA 3ONNA 3SMVA 2EDUA 4C8OA 1P7DA 5G5GA 4ECTA 2VANA 2FPLA 3WK6A 3RR8A 2WTFA 5IILA 1L7OA 3V6JA 3F5EA 3H4BA 1B0XA 4LVSA 2UVRA 3TQ1A 4QZCA 4ECXA 1V38A 1U48A 1QH9A 4KLUA 5KFZA 1Q3UA 3GIKA 2EAOA 2PFNA 3NVWA 5KT4A 4RQ7A 5J8YA 4I2JA 4GXKA 5KFSA 7ICRA 4DFMA 4UW9A 2W9BB 3KHHA 8ICZA 3GQCA 3C29A 2HBMA 4DSLA 4EENA 1ZQEA 2AXTU 2OHFA 1X66A 4NV0A 2EAPA 3DV9A 3DEEA 5CWRA 1DK2A 4F4YA 2A1JB 2QARA 2XC9A 2VA2A 5J0TA 4QWAA 2DFLA 2RHFA 5CJ7A 4US8A 5AI6A 9ICVA 4G3IA 3PSFA 4M9HA 3F2BA 3CNHA 2HHXA 5EWFA 2QB0A 1RYRA 4O3NA 2B6GA 1ZYQA 3PVXA 4Q8FA 2DGZA 2Y0SF 3N7SC 4DS4A 4I2BA 5JUMA 3N4MB 4QZ8A 3HX0A 2R8HA 4RQMA 4JMUA 5AKLA
chains in the Genus database with same CATH topology
3AL0B 2A3VA 2VIXA 1Z1BA 4GFJA 2G06A 3ONNA 4ICAA 2WAQF 2K8AA 1KBUA 2K89A 2K4IA 2OYYA 1UPHA 2CN1A 2KHVA 3IP4B 2G07A 2VJ4A 2K4HA 2Y0SC 2KKVA 4OJ5A 4KMOB 3SMVA 2OH2A 4OO1J 2H3QA 2KEYA 2ZIVB 2ZIUB 1P7DA 4FZNA 3E0FA 2RRDA 1DRGA 5CRXA 2G5HB 3F2DA 4ACOA 4U7CA 2F8LA 1GO3F 2HOFA 2G08A 2N1RA 1URJA 4WJ3B 1A0PA 3RFAA 3AQEA 3F53A 2ZXIA 4NWIA 2ZXHA 2HOQA 2GH1A 5HR6A 1TAMA 2VKQA 2F76X 2LKYA 3L3FX 1XO0A 2KICA 3D2QA 3ALRA 3LVVA 1CRXA 3F5EA 2KNJA 4OJLA 4P0PB 3SAGA 2HMXA 1SZHA 4FZLA 2JH1A 2KJ5A 3ICXA 1Z19A 3M7DA 2CRXA 2KKPA 3GU3A 2HBJA 2K8CB 2YX8A 3IG8A 2XI9A 2MA1A 2LBOA 2BDUA 1HIWA 3D2NA 2E1EA 4QNLA 2H3IA 4OJOA 4C0ZA 2ZIWA 2DQNB 3NUQA 2JGAA 2WB1F 1XNSA 1Q3UA 2E5SA 2OXOA 3IG5A 3KFUF 2DF4B 3H0RB 2ZIXA 2Q4TA 1YT3A 3GZFA 4PL2A 3M6KA 3RF9A 4CDGA 1PVQA 3NRWA 4CRXA 4OJ6A 2G5IB 2MRLA 3HKZF 3LYSA 2D6FC 4P0QA 2OM6A 3AQFA 2YB1A 2ZG6A 3T79A 4NLCA 2RP5A 4PL1A 2HBKA 3F5AA 2M0NA 4AYBF 2K8BB 1NZBA 3VC8A 1HEKA 2KV2A 3OPXA 4FZMA 3C29A 2R18A 2WB1C 3M6ZA 2CPRA 2HBMA 3CYMA 3SQIA 2KD1A 4FE3A 2KOBA 4NLBA 1PVRA 2XIDA 2ZIUA 4NV0A 2E1FA 4BX9C 1T94A 3DEEA 3D2SA 1A6SA 3IN5A 2W04A 3CP8A 5KL8B 5KL1B 1ED1A 2G09A 2HBLA 3HKZC 3PSIA 4BUGA 3O0FA 3F2CA 3PZPA 2KIWA 2JMGA 2W7PA 2ZIXB 3PSPA 2KHQA 2KJ8A 1F44A 2XICA 4AYBC 2RHFA 2JHDA 1MA7A 3SAHA 1IIPA 2PMZF 4QIWF 4QJFB 2F77X 4U6PA 4CGZA 2HOIA 3PSFA 1L6NA 1ZQ1C 3F2BA 2H3FA 2YB4A 4KX3A 2KVCA 2W7OA 2KJ9A 1Q3VA 3PSTA 2LYAA 3LVWA 2LYBA 3VCBA 2LHTA 3MGVA 1OUQA 3C28A 3H0LB 2G0AA 2ZIVA 1WUDA 3CRXA 2GOLA 5C0YA 1D8BA 2ZIWB 2DGZA 4KX5A 2XVTA 2Y0SF 3N7SC 2PMZC 3N7RC 4QIWC 2Z7JA 2F2AB 4OJPA 2W03A 2NV3A 2K4EA 3H0MB 3K1ZA 2VJ5A 5A0LA 4A8EA 4BJQA 2WAQC 4O3MA 5T14A 1ECWA 2H3VA 3KZXA 3SAFA 4IC9A 1PVPA 3N7PD 5HR7A 2JH7A 4P0QB 2H3ZA 4JMUA 4P0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ F;  2PMZ F;  2WAQ F;  2WB1 F;  4AYB F;  2Y0S F; 
#chains in the Genus database with same CATH topology
 5DBB A;  5AIB A;  1LKY A;  2BCU A;  2LYH A;  1UPH A;  4C4R A;  3RH6 A;  2RDJ A;  1ZQX A;  1COO A;  4Z6D A;  4UAV A;  3GIL A;  5KFA A;  3A0B U;  3OGU A;  4R8U B;  5DQH A;  5KFJ A;  3RR7 A;  2XY7 A;  1QSY A;  3FM9 A;  2R8G A;  1VLB A;  1S0N A;  5D4B A;  1K1Q A;  5HR6 A;  4Z6E A;  2KIC A;  5AIA A;  4P0P B;  8ICH A;  3GV5 B;  7ICL A;  5K4L A;  2CRX A;  4IL6 U;  5C5J A;  2RDI A;  5TZV A;  2MUT B;  1MQ2 A;  2DKX A;  3QUC A;  4QWB A;  5IIM A;  4QZH A;  1M6Y A;  5ALR A;  1WWV A;  4KN7 A;  2AJQ A;  2JRZ A;  3OHB A;  4CDG A;  2GO7 A;  4GXI A;  3NRW A;  4CRX A;  1NK6 A;  1TK5 A;  8ICR A;  3C1Z A;  7ICE A;  4KLD A;  1UA0 A;  4Y2R A;  5AIC A;  4LJX A;  4PHA A;  4TUQ A;  1SL1 A;  2W43 A;  3SQI A;  4M9G A;  4FE3 A;  2XID A;  1RXW A;  1X6J A;  3RBE A;  2UVW A;  2ATL A;  5D46 A;  4DL7 A;  3F2C A;  1L5U A;  5AKG A;  1RQN A;  2JV3 A;  4AYB C;  3JPO A;  3MDA A;  3HP6 A;  4ELU A;  3PR4 A;  5J2B A;  5JU5 A;  5IIN A;  5J0X A;  3QU4 A;  5JRT A;  3RRG A;  4PGQ A;  4PZN A;  5J0Q A;  1S10 A;  5KFC A;  3Q8R B;  4MHV A;  3MGV A;  1TKD A;  1CI4 A;  4DS5 A;  5AKJ A;  4OD0 A;  2ZIW B;  4I2F A;  3KKA C;  4KX5 A;  5ALX A;  1RDF A;  2CXY A;  3H0M B;  1U9L A;  3EYZ A;  1Z3E B;  1S0M A;  1ZQM A;  5TIS U;  5J29 A;  3IHQ B;  4ICA A;  1SWW A;  1KBU A;  2FJ6 A;  1JN3 A;  2G07 A;  4I2A A;  4F92 B;  2ZIU B;  4JV2 A;  4PHE A;  4RPX A;  3OJU A;  1L3U A;  3BQ2 A;  2HVH A;  2Y9T A;  2HHV A;  3PNC A;  2BCV A;  4M47 A;  2VKQ A;  4I27 A;  5G5H A;  4DL5 A;  3PO4 A;  4NL9 C;  2DKZ A;  3BS5 B;  4QNL A;  4UAT A;  3EZ5 A;  3T3F A;  4UB6 U;  2E5S A;  3I1Y A;  2O6K A;  2OXO A;  2J6U A;  1PVQ A;  9ICK A;  5AI9 A;  2YB1 A;  4UAZ A;  2JEI A;  1ZRM A;  3QXG A;  1HEK A;  1S5L U;  2F8K A;  4DLE A;  7ICN A;  3SI8 A;  2NO5 A;  3FYH A;  2Y9U A;  1U47 A;  1ED1 A;  4R65 A;  4E0D A;  2A19 A;  1NOM A;  3LDA A;  3MAB A;  4CF3 A;  1TAU A;  2M9N A;  3PML A;  4Y2Q A;  4F72 A;  1MA7 A;  5KFE A;  2IOF K;  1S9F A;  3OSN A;  1NKE A;  3HWT A;  4KX3 A;  3NVY A;  1Q3V A;  1ZQC A;  3PST A;  1C20 A;  2MUT A;  2LHT A;  5KFY A;  4IRC A;  5DG9 A;  5ALO A;  3TAQ A;  4QIW C;  4DFJ A;  1B22 A;  3OHA A;  1WYG A;  4RZR A;  3NVV A;  4YXM A;  5KFK A;  4IC9 A;  1ZQS A;  2XO7 A;  4IR9 A;  3UMC A;  8ICN A;  2AQ4 A;  1N48 A;  2OH2 A;  5KG5 A;  2F3N A;  1LVH A;  4DL6 A;  5ALD A;  1SV4 A;  4Y2P A;  4Q45 A;  3PX0 A;  5AM5 A;  4ACO A;  3C5G A;  5ALJ A;  1N60 A;  1MQ3 A;  1WG8 A;  3AQE A;  2IMW P;  5CHG A;  1PK1 B;  3C21 A;  3H8J A;  4F5R A;  3D2Q A;  4OJL A;  2NRZ A;  1B43 A;  5J2A A;  1KSP A;  4ELT A;  2YX8 A;  4QZA A;  1ZD5 A;  1X9M A;  4BDP A;  3MR6 A;  4PGX A;  4OJO A;  2ZIW A;  5KFW A;  3NUQ A;  4CF4 A;  1KKX A;  9ICA A;  4QZ9 A;  2QKQ A;  1RZT A;  1SL2 A;  2ZIX A;  3RF9 A;  1ARO P;  2AQ0 A;  4ED0 A;  5KAF U;  3QUT A;  9ICF A;  4O5C A;  3HIL A;  2XCP A;  4DL2 A;  4Y2S A;  2KOB A;  2ZIU A;  2NRT A;  5AKY A;  1NK8 A;  3SEI A;  2W04 A;  3QUQ A;  5ALI A;  1Y88 A;  3NAS A;  1A76 A;  1SL0 A;  1YZ6 A;  3BS7 A;  1F44 A;  1N56 A;  4G9B A;  1RXV A;  1UHU A;  4YMO A;  5AHX A;  1DOQ A;  2W8L A;  1KFD A;  4RPY A;  4R63 A;  3IM1 A;  3RJK A;  3M1Y A;  1BPB A;  3BS5 A;  2YTU A;  4KLO A;  5KFO A;  4EX7 A;  2DBY A;  4F2R A;  3NVZ A;  1Z4N A;  3K1Z A;  4UB8 U;  2VJ5 A;  4BJQ A;  1L7M A;  4C80 A;  4QWD A;  5KFB A;  4B6J A;  3M9M B;  3B0Y A;  2EZY A;  1L7N A;  4PH5 A;  4C7Z A;  4JWN A;  4FS2 A;  2RLT A;  3RRH A;  2DL0 A;  4DSE A;  4US9 A;  1ZXI A;  1T8E A;  1RG6 A;  4NWI A;  4QZD A;  2GH1 A;  2WF6 A;  4I2D A;  3ISC A;  3L3F X;  3PW2 A;  1ZQB A;  8ICG A;  3AU2 A;  3UQ2 A;  5KG4 A;  5J8Y C;  3G6Y A;  4M6W B;  3M7D A;  1X42 A;  4YFK A;  3V72 A;  2IHM A;  1ZD4 A;  1WCL A;  8ICK A;  1S77 D;  4ED7 A;  2XGP A;  2JGA A;  3SV4 A;  2ESE A;  3OJS A;  1ZQA A;  1ZQQ A;  2R8I A;  2I1Q A;  2LPE A;  4KLJ A;  1DK3 A;  2JEF A;  4MFF A;  3DDH A;  4F5N A;  4CE6 A;  3G6X A;  3T79 A;  2BCQ A;  4PL1 A;  3C5F A;  3MR5 A;  2YQE A;  2AH5 A;  1PVR A;  1H38 A;  3T5L A;  4M0A A;  4NJ8 A;  5DDM A;  1A6S A;  3IN5 A;  5ALH A;  4B9T A;  4BUG A;  7ICK A;  1D9D A;  1WCN A;  4DOB A;  1PK1 A;  5DQI A;  3SEN A;  4U6P A;  1L3V A;  2ZUB A;  4BGD A;  4B9S A;  1ZQH A;  5ALV A;  4Y2X A;  4UB3 A;  4P2H A;  4M04 A;  4C8K A;  2HHQ A;  8ICA A;  2J6S A;  2PMZ C;  4GLX A;  4RQ4 A;  1RYU A;  4QZB A;  3A0H U;  1SKW A;  4O3M A;  2QB1 A;  7ICH A;  2H3V A;  1KRP A;  4I2I A;  1ZD3 A;  4NLZ A;  2KFN A;  4P0Q B;  1ZQF A;  1XSL A;  3H7I A;  1D9F A;  3RJE A;  5EE9 A;  3IP4 B;  2IBK A;  3TAC B;  1ZQO A;  2XY5 A;  3HJE A;  9ICO A;  4QZE A;  5CRX A;  5KAI U;  4NY8 A;  2AGP A;  3GDX A;  4Q43 A;  1QSS A;  4J9O A;  4WJ3 B;  5HHH A;  3F53 A;  5EE0 A;  3M9N B;  3ALR A;  4P4P A;  3BQ7 A;  4EX6 A;  5DKW A;  9ICX A;  2JZB B;  1JAL A;  3JPN A;  4B9M A;  4JB3 A;  3ETR A;  4ED1 A;  1BNP A;  5ALE A;  5HMM A;  1KN5 A;  5KG7 A;  4EZ6 A;  5DBA A;  1BPY A;  4RNN A;  1NK7 A;  4R66 A;  4IRK A;  1TE2 A;  4O5E A;  2P6U A;  1JMS A;  1NKB A;  1FFV A;  4KLG A;  4KLL A;  2DWQ A;  3UXN A;  5KL1 B;  4DOC A;  5AK6 A;  5AKK A;  5J2I A;  1RYS A;  2W9C B;  2WHE A;  5AM3 A;  5AM0 A;  3S6J A;  4M6W A;  2KVC A;  4RUC A;  1Z4O A;  2W54 A;  1BGX T;  2Q0Z X;  2LYB A;  1IXR A;  3VCB A;  2BDP A;  2ZIV A;  3B0X A;  1RQL A;  5DDY A;  2FMP A;  1NK0 A;  2XVT A;  3ZD9 A;  3FDS A;  3KBB A;  1L8L A;  4YQW A;  4ECW A;  5AI5 A;  4ZH4 A;  2B0C A;  2ZTD A;  3KZI U;  1ZQJ A;  2HW3 A;  2H3Q A;  1NI3 A;  1DGS A;  5KFL A;  3E0F A;  3AUO A;  1LV5 A;  1SV0 A;  4UBB A;  1PK3 A;  5J2G A;  5H2F U;  3PW0 A;  2C2D A;  3BDP A;  3RFA A;  2ES6 A;  2ZTE A;  5CB1 A;  1KFS A;  9ICW A;  1MSW D;  9ICC A;  2KKP A;  5AI8 A;  3TI0 A;  1D8Y A;  4FBU A;  4QWC A;  8ICL A;  2E1E A;  5KT6 A;  1KW4 A;  3IG5 A;  1ZQZ A;  2V4Q A;  3T5K A;  4PL2 A;  2P6R A;  3JPT A;  3AN1 A;  4KLM A;  4EBD A;  5ALY A;  4C4T A;  4YCX A;  5AK3 A;  4RQ3 A;  4P0Q A;  5KFQ A;  2R8K A;  3C2K A;  2RP5 A;  3F5A A;  3T5J A;  3EW9 A;  5EWG A;  1QQ7 A;  4QZG A;  4O3R A;  3TKA A;  5III A;  7ICQ A;  3SV3 A;  2LM4 A;  2BGW A;  3O0F A;  2HHW A;  3IRU A;  1TK8 A;  1ZJM A;  2Y1I A;  4DFK A;  3TAP A;  2JHD A;  2BPF A;  2P66 A;  3AEV A;  1BPX A;  2NRW A;  2E8N A;  4F5Q A;  1KQQ A;  4JK1 A;  2PFQ A;  1TV9 A;  2DUY A;  4F2S A;  4DFP A;  1OUQ A;  5J2K A;  2G0A A;  1EXN A;  1PZN A;  2GOL A;  4ECR A;  1ZQW A;  8ICP A;  3AU6 A;  2BQU A;  3RH5 A;  1COK A;  3Q8M A;  5DLF A;  2A1A A;  3WKB A;  2PXI A;  2ZTC A;  9ICH A;  1T7P A;  2EAM A;  3AL0 B;  4GFJ A;  4F50 A;  2Y0S C;  2KKV A;  3RJF A;  8ICM A;  3V6K A;  4O3S A;  1SZP A;  2W9M A;  1ZD2 P;  3GIM A;  4DFD A;  2VA8 A;  4QZF A;  1D8L A;  2W9C A;  1A0P A;  4YD1 A;  3K1R B;  4O3O A;  2W9B A;  1XO0 A;  2QLT A;  4KLT A;  4ZOH C;  2BPG A;  1KFT A;  3THV A;  2XI9 A;  2BDU A;  1ZQU A;  4DL3 A;  4C0Z A;  5AKZ A;  2A1J A;  2KFZ A;  3R9K A;  4IQU A;  4UAS A;  3M6K A;  1JIH A;  3M8S A;  2YMQ A;  3Q8L A;  4I2H A;  4J9L A;  3RB4 A;  3PO5 A;  1XWL A;  5IIK A;  3C1Y A;  3OPX A;  4IQW A;  2W3S A;  4DQP A;  4O0I A;  2CPR A;  1SXE A;  5L1I A;  2ASJ A;  2AGQ A;  3OTQ A;  7ICS A;  2I5H A;  2OCE A;  3CP8 A;  4KLF A;  4M9L A;  4RU9 A;  2E8M A;  2KIW A;  2HHS A;  3PSP A;  4TUS A;  2KHQ A;  3SD7 A;  3BJY A;  1HJP A;  4ED2 A;  2YML A;  5KFG A;  2J6T A;  5ALQ A;  4QJF B;  1S97 A;  3KHL A;  4RPZ A;  5KFM A;  4CGZ A;  4F4X A;  1ZQ1 C;  2H3F A;  2E8P A;  4YN4 A;  1T3Q A;  1A77 A;  4JV0 A;  9ICN A;  3LVW A;  7ICM A;  5KG1 A;  2PFP A;  5J2C A;  3V7J A;  1BPE A;  3C28 A;  4DF8 A;  3HT3 A;  4B9V A;  2JR5 A;  1FO4 A;  3N7R C;  1U4B A;  4R8U A;  4TUR A;  3RB3 A;  3L4P A;  5KFP A;  1QQ6 A;  2EZX A;  4O3P A;  1ZQD A;  4P0P A;  4DWI A;  4C4S A;  4UB4 A;  5DQG A;  2BPC A;  5HML A;  2FMS A;  2K89 A;  2EAN A;  3GFK B;  1J2M A;  4I2E A;  4PPX A;  1NK4 A;  3TAN A;  4IS7 A;  4Y2Y A;  1T3N A;  3ORY A;  4B9N A;  4NLK A;  3MR2 A;  4U7C A;  1V9P A;  4FFD A;  8ICO A;  3KD3 A;  1URJ A;  2ZXI A;  4F5O A;  5J2D A;  1XS9 D;  7ICG A;  2KVS A;  1QTM A;  1KDH A;  7ICI A;  2ALZ A;  2AGO A;  2MA1 A;  1QCK A;  1HIW A;  4KIT B;  4KLI A;  2WB1 F;  2KMD A;  2FLN A;  2DF4 B;  4J9K A;  5J2F A;  3WKD A;  5EE3 A;  4RQ1 A;  2IOH A;  5DGB A;  2ASL A;  3HKZ F;  2BQ3 A;  4I28 A;  2KV2 A;  3V6H A;  8ICC A;  3ZDA A;  3CYM A;  4ECS A;  2E1F A;  5ALT A;  4TQS A;  5BOL A;  2HI0 A;  1QQ5 A;  3I28 A;  2W7P A;  2F1H A;  2PFO A;  5CP2 A;  3IDW A;  2XIC A;  1F5S A;  5B5E U;  3WU2 U;  2ISO A;  2W55 A;  3PW7 A;  3J81 j;  3EPI A;  3H0L B;  1JUD A;  3WK5 A;  2EQY A;  4XA5 A;  2BCS A;  4M9N A;  2WFA A;  4OJP A;  2C22 A;  2HCF A;  2GWS A;  3K4G A;  3BQT A;  4YXJ A;  4UB1 A;  8ICS A;  2LM1 A;  3N7P D;  2YMP A;  2KSO B;  4DSI A;  1ZQR A;  1BVS A;  2K8A A;  2OYY A;  2KHV A;  4EEK A;  4F5P A;  2VJ4 A;  2K4H A;  1U49 A;  1ZQY A;  1O03 A;  2KEY A;  1N63 A;  3QYP A;  3PX6 A;  1PUZ A;  9ICR A;  2G5H B;  1IM4 A;  3F2D A;  2HOF A;  9ICP A;  3T5H A;  2IHN A;  2MSN A;  3H8S A;  2ZXH A;  1JXE A;  4ECY A;  2F76 X;  5BPC A;  1RPL A;  5IIO A;  7ICF A;  3LVV A;  4J9S A;  2HMX A;  5KTQ A;  5B66 U;  3IG8 A;  3FC4 A;  3MGI A;  3I76 A;  1XSN A;  3H0R B;  7ICJ A;  2WF8 A;  3PV8 A;  2W9A A;  2AHO B;  2EZZ A;  8ICU A;  3C2M A;  5KFR A;  4PZO A;  1NKC A;  2M0N A;  2K8B B;  3PY8 A;  3QU7 A;  4ECV A;  2R18 A;  2C2R A;  2K4P A;  4DQI A;  4NM1 A;  2V9W A;  5J0P A;  4Y2T A;  2UVV A;  1XO1 A;  2FI1 A;  2I6X A;  1IV8 A;  2W8K A;  4C7Y A;  4YR2 A;  4ED3 A;  4YMN A;  4J9Q A;  1NJZ A;  3SAH A;  1JRP A;  2I9G A;  2JXJ A;  3H4D A;  2KJ9 A;  2AU0 A;  3QEA Z;  2MAX A;  3UMB A;  5AM2 A;  3PMN A;  1XC9 A;  5KG3 A;  4PHD A;  4EBC A;  1ZQL A;  2KZM A;  2P35 A;  1ZQP A;  4C8L A;  1SV0 C;  5HR7 A;  4Q8E A;  8ICQ A;  2H3Z A;  4MEX A;  3RJJ A;  5J0O A;  8ICX A;  2WAQ F;  1B4F A;  2KN7 A;  3ZD8 A;  4XQ8 A;  1ZJN A;  1X40 A;  3BZK A;  2C28 A;  1DRG A;  5DB9 A;  2F1I A;  2DPI A;  2Y1J A;  2HDO A;  2N1R A;  1F0M A;  4LZG A;  5ALF A;  5DB6 A;  3SYZ A;  4QWE A;  1NK9 A;  1O08 A;  3ISB A;  8ICE A;  2XY6 A;  5AKH A;  4MF8 A;  2KJ5 A;  1LKY B;  2E3T A;  3UXO A;  1NNL A;  2HBJ A;  5FP0 A;  2E8O A;  4UB5 A;  2D3D A;  5J0U A;  5ALK A;  5L9X A;  5DBC A;  3BQ0 A;  1JX4 A;  4OJ6 A;  3JPP A;  2G5I B;  2HSZ A;  2YN4 A;  2KSO A;  3LWM A;  4NLC A;  9ICL A;  2BKE A;  2ZUC A;  3RAX A;  5DLG A;  5J2E A;  2KD1 A;  1ZQK A;  4EEY A;  4YP3 A;  3V7L A;  5KL8 B;  4DLG A;  4FS1 A;  4NM2 A;  2HBL A;  2KIV A;  3KTQ A;  9ICM A;  1NJW A;  1IIP A;  4Z6C A;  2F77 X;  4YR3 A;  1JXL A;  4IR1 A;  1J97 A;  1SB3 C;  1L6N A;  4M9J A;  3WK8 A;  2W7O A;  1FEZ A;  5E79 U;  1X9W A;  4EYH B;  7ICV A;  3QU5 A;  1MC8 A;  1U45 A;  1TFR A;  5DGA A;  5F9L A;  4DOA A;  3RAQ A;  1YZ7 A;  3MFH A;  2NV3 A;  1IG6 A;  4A8E A;  1HUZ A;  2WAQ C;  2ZJ8 A;  5T14 A;  4KLQ A;  5L1J A;  2JH7 A;  3H8W A;  4YMM A;  3FAH A;  1N5W A;  3PX4 A;  1Z1B A;  4O5K A;  1S8O A;  2BCR A;  3NTU A;  4DEZ A;  4DQS A;  4J9M A;  1RM6 C;  4FZN A;  5KFD A;  2V4R A;  5L1L A;  1GO3 F;  1BPZ A;  4YD2 A;  4IQT A;  5KFI A;  2HOQ A;  4NXZ A;  2VA3 A;  8ICI A;  2DPJ A;  2KK0 A;  5KG2 A;  4TQR A;  1Z19 A;  7ICU A;  1VDV A;  1ZQI A;  2K8C B;  5AKE A;  2YMM A;  3N97 B;  4B9U A;  2DQN B;  5DB7 A;  2BZF A;  1XNS A;  5AM4 A;  4GC6 A;  4CCH A;  5HNK A;  2Q4T A;  3WKE A;  5KFH A;  2W11 A;  1Q8K A;  8ICF A;  4F8R A;  4P4O A;  4AYB F;  1HUO A;  3VC8 A;  5L1K A;  1UA1 A;  2HHU A;  4NLB A;  5ALU A;  3TAR A;  3E58 A;  3C23 A;  5DG8 A;  5KT3 A;  4B9L A;  2JMG A;  3AMZ A;  3MDC A;  9ICT A;  1BNO A;  3ISD A;  3QZ8 A;  2PI4 A;  5CEH A;  4RQ2 A;  4JUZ A;  4CF5 A;  3KHR A;  2YY6 A;  4IQV A;  3UQ0 A;  3CRX A;  5C0Y A;  4K4G A;  9ICE A;  2KZZ A;  1KL9 A;  2C2E A;  9ICQ A;  2Z7J A;  2EH9 A;  4BWM A;  3RB0 A;  3RH4 A;  3BQ1 A;  3BZC A;  2UVU A;  3RJH A;  1ZOL A;  1CUK A;  3JPQ A;  5EOZ A;  3CW2 C;  3PW4 A;  1L8O A;  2ZUD A;  4RT3 A;  2JZB A;  1DXS A;  2CN1 A;  3QU2 A;  4P4M A;  4OJ5 A;  3QE9 Y;  2RRD A;  3MFI A;  1SXD A;  2FPK A;  1OW5 A;  2NRX A;  2G08 A;  4RQ0 A;  1JRO A;  2BHN A;  1ZET A;  8ICY A;  9ICI A;  3WK7 A;  2LKY A;  2KZ3 A;  5ALZ A;  2KNJ A;  1SZH A;  3ED5 A;  4FZL A;  1TK0 A;  4ELV A;  3WK9 A;  3PW5 A;  4I2G A;  4OCZ A;  1S0V A;  5AKX A;  3NGD A;  5KFU A;  4F91 B;  2MRL A;  3AQF A;  4YR0 A;  4IRD A;  3JPS A;  7ICO A;  1NZB A;  4YG2 A;  1SIJ A;  5KFF A;  1T94 A;  3D2S A;  5J0S A;  1ZQV A;  4KLS A;  5DB8 A;  3L5K A;  2ZIX B;  2KJ8 A;  1ZQT A;  1OXJ A;  3M8R A;  3SR6 A;  2NYV A;  1FIQ A;  4QIW F;  2ASD A;  2R8J A;  1UCV A;  4RT2 A;  2PI5 A;  3N28 A;  4UAU A;  3E2E A;  1N61 A;  3U26 A;  1N2X A;  3MC1 A;  5KFV A;  5IIJ A;  1L3T A;  4KTQ A;  1Z00 B;  3TAD C;  3V7K A;  1L7P A;  3Q8Q B;  2K60 A;  2K4E A;  4PHP A;  3HW8 A;  2JEJ A;  3GV7 B;  1ECW A;  3KZX A;  1PVP A;  4UAW A;  1D8B A;  2A3V A;  2BQR A;  4O3Q A;  4GIB A;  4RQ6 A;  3NS1 A;  3HPO A;  3Q8K A;  3H40 A;  4DSJ A;  4Z6F A;  4EEL A;  1XU4 A;  4I29 A;  4MF2 A;  5EWE A;  2PKE A;  2F8L A;  3M9O B;  4KLH A;  4DSF A;  2FMQ A;  2FPM A;  1NJX A;  1UT5 A;  2FLP A;  1TAM A;  4MFC A;  3QUB A;  1N5X A;  1CRX A;  2WF7 A;  3SAG A;  2ZJ5 A;  4HYK A;  5CA7 A;  1NJY A;  1NZP A;  4USA A;  1N62 A;  2LBO A;  1J2N A;  5KFT A;  2XCA A;  4UQG A;  2H3I A;  3RTV A;  5D49 A;  5AKI A;  1CEZ A;  1XSP A;  4K4I A;  2FE9 A;  3QX7 A;  4KMU A;  4MFA A;  1LB2 B;  2ZJA A;  5ALL A;  4DO9 A;  4FBT A;  3GII A;  4RQN A;  3MGH A;  3LWL A;  4DCC A;  4QW8 A;  5KT5 A;  2F1J A;  2ZG6 A;  4KLE A;  1ZQN A;  5AM1 A;  4QW9 A;  4FZM A;  3MBY A;  5KFX A;  1L3S A;  5ALW A;  5ALN A;  4DL4 A;  4PGY A;  3Q8P B;  1X9X A;  1S0O A;  8ICW A;  3ZDB A;  2KG5 A;  5BOM A;  5ALS A;  1KEJ A;  7ICP A;  2KTQ A;  4J03 A;  5AK5 A;  4EBE A;  3C2L A;  2H5X A;  2D8C A;  1WWU A;  1WUD A;  4MEY A;  8ICJ A;  3QU9 A;  3QEB Z;  3ZI4 A;  4ECZ A;  3KOO A;  2F2A B;  4Y2J A;  4C8N A;  4R64 A;  3RBD A;  5A0L A;  3H8M A;  3SZ2 A;  2HVI A;  1Z1V A;  3KKA A;  3WKA A;  4K4H A;  3B9J A;  3QNM A;  5KG6 A;  1SKS A;  3TFR A;  4M2Y A;  4KMO B;  3UMG A;  3UM9 A;  3ZDE A;  2KP7 A;  3RJG A;  1ZQG A;  3TFS A;  4XRH A;  4RQ8 A;  1VJ5 A;  3EWA A;  5F9N A;  4BXO B;  4F71 A;  4QZI A;  3RJI A;  1BPD A;  2FLL A;  3ICX A;  4DF4 A;  3GU3 A;  3TAD A;  3NRZ A;  5HP4 A;  3D2N A;  5GTI U;  4RNM A;  1Z00 A;  3KFU F;  2W3R A;  4FO6 A;  2OEH A;  4AP9 A;  4KN4 A;  3GZF A;  3WKC A;  2OWO A;  1V97 A;  4UAY A;  3G6V A;  4NL9 A;  4BWJ A;  2OM6 A;  1SWV A;  5KG0 A;  2HBK A;  2L5Y A;  2WB1 C;  3AM9 A;  5F3X B;  1UQV A;  4J9R A;  4XUS A;  5J0R A;  5ALM A;  4Y2V A;  5J0Y A;  3PR5 B;  2G09 A;  3HKZ C;  3PSI A;  2LI6 A;  4DQQ A;  2XGQ A;  5KT2 A;  2WF9 A;  3ETL A;  2PMZ F;  2ISP A;  2HOI A;  8ICV A;  4F93 B;  1C7Y A;  4F4W A;  3KHG A;  2LYA A;  5L1M A;  5JTI A;  4GXJ A;  3WK4 A;  5HHI A;  4CNQ A;  4DSK A;  2FDR A;  4J9P A;  9ICS A;  2IA6 A;  5J2J A;  1QLN A;  3SAF A;  4ECQ A;  3ZDD A;  3RB6 A;  5KT7 A;  4TUP A;  3GV8 B;  1K1S A;  2VIX A;  2G06 A;  9ICU A;  5AI4 A;  2K4I A;  7ICT A;  1TVA A;  2LMR A;  4OO1 J;  4Y2U A;  2JEG A;  2RQ5 A;  2NRV A;  2ZIV B;  4RQ5 A;  2ODG A;  2QAR B;  2F44 A;  1QSL A;  5GTH U;  4F4K A;  4ED6 A;  4F4Z A;  1SKR A;  4EYI B;  1TAQ A;  1Q46 A;  5EE1 A;  5CR0 A;  3ZDC A;  2JH1 A;  2KE7 A;  5ALP A;  2QB0 B;  1SGG A;  5ALG A;  4NLN A;  2NO4 A;  3MR3 A;  4X5V A;  3OSP A;  4ED8 A;  2MU2 A;  2BR0 A;  4UBC A;  4C8M A;  9ICG A;  1YT3 A;  1AQ6 A;  4J9N A;  1NK5 A;  1MN8 A;  3LYS A;  1V85 A;  3EUB 2;  4ECU A;  5J2H A;  2D6F C;  9ICJ A;  1DGJ A;  1JI7 A;  4F3O A;  3M6Z A;  4RUA A;  3HRD D;  5KNI A;  3Q8S B;  4BX9 C;  3GIJ A;  1K5O A;  5DG7 A;  4RNO A;  1T4G A;  1X9S A;  4UAR A;  3PZP A;  5KFN A;  2GLE A;  3IV6 A;  4BXO A;  4DQR A;  3D6J A;  1X2I A;  4JWM A;  3UPQ A;  4O9M A;  5J0W A;  4HAI A;  5AK4 A;  1KLN A;  4Q44 A;  2YB4 A;  4PJ0 U;  4GC7 A;  4I2C A;  9ICB A;  2IOF A;  4NLG A;  3K75 D;  8ICT A;  3QZ7 A;  5AI0 A;  4UB2 A;  3EPG A;  3JPR A;  4LZD A;  1FFU A;  2B21 A;  1X6I A;  1UT8 A;  2WF5 A;  1ZRN A;  2W03 A;  4JV1 A;  2HHT A;  4EZ9 A;  3LK9 A;  3UXP A;  1S76 D;  4YVZ A;  8ICB A;  1KTQ A;  3ONN A;  3SMV A;  2EDU A;  4C8O A;  1P7D A;  5G5G A;  4ECT A;  2VAN A;  2FPL A;  3WK6 A;  3RR8 A;  2WTF A;  5IIL A;  1L7O A;  3V6J A;  3F5E A;  3H4B A;  1B0X A;  4LVS A;  2UVR A;  3TQ1 A;  4QZC A;  4ECX A;  1V38 A;  1U48 A;  1QH9 A;  4KLU A;  5KFZ A;  1Q3U A;  3GIK A;  2EAO A;  2PFN A;  3NVW A;  5KT4 A;  4RQ7 A;  5J8Y A;  4I2J A;  4GXK A;  5KFS A;  7ICR A;  4DFM A;  4UW9 A;  2W9B B;  3KHH A;  8ICZ A;  3GQC A;  3C29 A;  2HBM A;  4DSL A;  4EEN A;  1ZQE A;  2AXT U;  2OHF A;  1X66 A;  4NV0 A;  2EAP A;  3DV9 A;  3DEE A;  5CWR A;  1DK2 A;  4F4Y A;  2A1J B;  2QAR A;  2XC9 A;  2VA2 A;  5J0T A;  4QWA A;  2DFL A;  2RHF A;  5CJ7 A;  4US8 A;  5AI6 A;  9ICV A;  4G3I A;  3PSF A;  4M9H A;  3F2B A;  3CNH A;  2HHX A;  5EWF A;  2QB0 A;  1RYR A;  4O3N A;  2B6G A;  1ZYQ A;  3PVX A;  4Q8F A;  2DGZ A;  2Y0S F;  3N7S C;  4DS4 A;  4I2B A;  5JUM A;  3N4M B;  4QZ8 A;  3HX0 A;  2R8H A;  4RQM A;  4JMU A;  5AKL A; 
#chains in the Genus database with same CATH homology
 3AL0 B;  2A3V A;  2VIX A;  1Z1B A;  4GFJ A;  2G06 A;  3ONN A;  4ICA A;  2WAQ F;  2K8A A;  1KBU A;  2K89 A;  2K4I A;  2OYY A;  1UPH A;  2CN1 A;  2KHV A;  3IP4 B;  2G07 A;  2VJ4 A;  2K4H A;  2Y0S C;  2KKV A;  4OJ5 A;  4KMO B;  3SMV A;  2OH2 A;  4OO1 J;  2H3Q A;  2KEY A;  2ZIV B;  2ZIU B;  1P7D A;  4FZN A;  3E0F A;  2RRD A;  1DRG A;  5CRX A;  2G5H B;  3F2D A;  4ACO A;  4U7C A;  2F8L A;  1GO3 F;  2HOF A;  2G08 A;  2N1R A;  1URJ A;  4WJ3 B;  1A0P A;  3RFA A;  3AQE A;  3F53 A;  2ZXI A;  4NWI A;  2ZXH A;  2HOQ A;  2GH1 A;  5HR6 A;  1TAM A;  2VKQ A;  2F76 X;  2LKY A;  3L3F X;  1XO0 A;  2KIC A;  3D2Q A;  3ALR A;  3LVV A;  1CRX A;  3F5E A;  2KNJ A;  4OJL A;  4P0P B;  3SAG A;  2HMX A;  1SZH A;  4FZL A;  2JH1 A;  2KJ5 A;  3ICX A;  1Z19 A;  3M7D A;  2CRX A;  2KKP A;  3GU3 A;  2HBJ A;  2K8C B;  2YX8 A;  3IG8 A;  2XI9 A;  2MA1 A;  2LBO A;  2BDU A;  1HIW A;  3D2N A;  2E1E A;  4QNL A;  2H3I A;  4OJO A;  4C0Z A;  2ZIW A;  2DQN B;  3NUQ A;  2JGA A;  2WB1 F;  1XNS A;  1Q3U A;  2E5S A;  2OXO A;  3IG5 A;  3KFU F;  2DF4 B;  3H0R B;  2ZIX A;  2Q4T A;  1YT3 A;  3GZF A;  4PL2 A;  3M6K A;  3RF9 A;  4CDG A;  1PVQ A;  3NRW A;  4CRX A;  4OJ6 A;  2G5I B;  2MRL A;  3HKZ F;  3LYS A;  2D6F C;  4P0Q A;  2OM6 A;  3AQF A;  2YB1 A;  2ZG6 A;  3T79 A;  4NLC A;  2RP5 A;  4PL1 A;  2HBK A;  3F5A A;  2M0N A;  4AYB F;  2K8B B;  1NZB A;  3VC8 A;  1HEK A;  2KV2 A;  3OPX A;  4FZM A;  3C29 A;  2R18 A;  2WB1 C;  3M6Z A;  2CPR A;  2HBM A;  3CYM A;  3SQI A;  2KD1 A;  4FE3 A;  2KOB A;  4NLB A;  1PVR A;  2XID A;  2ZIU A;  4NV0 A;  2E1F A;  4BX9 C;  1T94 A;  3DEE A;  3D2S A;  1A6S A;  3IN5 A;  2W04 A;  3CP8 A;  5KL8 B;  5KL1 B;  1ED1 A;  2G09 A;  2HBL A;  3HKZ C;  3PSI A;  4BUG A;  3O0F A;  3F2C A;  3PZP A;  2KIW A;  2JMG A;  2W7P A;  2ZIX B;  3PSP A;  2KHQ A;  2KJ8 A;  1F44 A;  2XIC A;  4AYB C;  2RHF A;  2JHD A;  1MA7 A;  3SAH A;  1IIP A;  2PMZ F;  4QIW F;  4QJF B;  2F77 X;  4U6P A;  4CGZ A;  2HOI A;  3PSF A;  1L6N A;  1ZQ1 C;  3F2B A;  2H3F A;  2YB4 A;  4KX3 A;  2KVC A;  2W7O A;  2KJ9 A;  1Q3V A;  3PST A;  2LYA A;  3LVW A;  2LYB A;  3VCB A;  2LHT A;  3MGV A;  1OUQ A;  3C28 A;  3H0L B;  2G0A A;  2ZIV A;  1WUD A;  3CRX A;  2GOL A;  5C0Y A;  1D8B A;  2ZIW B;  2DGZ A;  4KX5 A;  2XVT A;  2Y0S F;  3N7S C;  2PMZ C;  3N7R C;  4QIW C;  2Z7J A;  2F2A B;  4OJP A;  2W03 A;  2NV3 A;  2K4E A;  3H0M B;  3K1Z A;  2VJ5 A;  5A0L A;  4A8E A;  4BJQ A;  2WAQ C;  4O3M A;  5T14 A;  1ECW A;  2H3V A;  3KZX A;  3SAF A;  4IC9 A;  1PVP A;  3N7P D;  5HR7 A;  2JH7 A;  4P0Q B;  2H3Z A;  4JMU A;  4P0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...