2Y0SF

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
b'SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
total genus 10
structure length 90
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2y0sF02
2PMZF 3HKZF 2WB1F 2WAQF 2Y0SF 4AYBF
chains in the Genus database with same CATH superfamily
2W8KA 4YD2A 4RQ2A 3SAHA 2J6UA 2BPFA 3GFKB 1S8OA 4FZMA 4QZEA 3RAQA 2DUYA 1TK5A 2OXOA 4DOCA 2QARA 1PK1A 5G5GA 3H8MA 1ED1A 4P4MA 2FLPA 1H38A 2YMMA 4UAWA 5ALHA 4KMOB 1KFDA 4KN7A 4BWMA 2HBMA 3M6KA 2EANA 5KFMA 2Z7JA 2KHVA 1KL9A 2JRZA 2ZJAA 1KEJA 4UB1A 2WF5A 5ALTA 3HILA 5KT4A 1O08A 4M2YA 1RPLA 3ALRA 4EBCA 2M0NA 2ALZA 8ICTA 2OEHA 2F1JA 5HHIA 3F2BA 2RDJA 4KLTA 3SV4A 3QUBA 1J2NA 4Q8FA 3PSIA 3GQCA 1U9LA 2H3QA 4Y2VA 5HMLA 5L1LA 2V4RA 3GV5B 4ED8A 2GOLA 3ZDCA 4QWAA 4ECTA 3PMNA 3KTQA 5DGBA 3H0LB 5J2IA 4QIWC 1L3VA 1AROP 5TISU 5J0OA 5EOZA 4JV0A 1JRPA 3N28A 2P6RA 2OYYA 5ALNA 4BWJA 5DBCA 2W9AA 2MUTA 8ICCA 1TAMA 4IS7A 4O3OA 1BPXA 3TAQA 1WCNA 3MC1A 1XC9A 2P6UA 5KL8B 3L4PA 3MFIA 1ZQVA 2A19A 1NK6A 2E1EA 1QQ5A 5AI4A 4J9KA 3WKBA 1YZ6A 4DEZA 2G5HB 5AIBA 5AIAA 3RH4A 4F4ZA 4PL1A 3R9KA 5E79U 4PHPA 1Y88A 3MDCA 4KX3A 1SXDA 3MGIA 3BQ1A 1HUZA 2ISPA 2LM1A 2LHTA 2ZIXA 4TQRA 4F8RA 4ED6A 5J0UA 4TUPA 5F9LA 3TKAA 4KLJA 4IQWA 4F3OA 4K4IA 5AKXA 7ICTA 1F5SA 3C2LA 4FE3A 3KHGA 2I6XA 4MFCA 4J9PA 4KITB 4RQ6A 3V6HA 4RQ4A 5AKLA 1SV0A 4DS4A 1KFSA 2BHNA 1ZJNA 2ZXIA 4Y2TA 1ZRNA 3NVYA 1B4FA 3K1ZA 2PFOA 2LBOA 3RTVA 4KLMA 4RU9A 1QH9A 2DBYA 2E8NA 4ICAA 3QUQA 4QZIA 1DXSA 3UM9A 2I5HA 4ECQA 4UAVA 4CF3A 1PVRA 3JPSA 9ICWA 2RHFA 4I29A 3Q8KA 3V7KA 4EZ9A 5KFFA 2I9GA 4HYKA 4B9NA 2XICA 1MQ3A 2ASLA 3B0XA 4OO1J 4ED1A 4LJXA 2KKPA 3H8WA 3ETRA 2E8OA 5ALKA 5KFXA 5J0XA 2PI4A 1NJZA 4IL6U 2XCPA 1OW5A 2HW3A 2WF6A 3ED5A 4F50A 2ZIUB 4OJPA 4JWMA 2JR5A 4CF4A 3GU3A 2BQ3A 3PW2A 1UA1A 4I27A 2EZYA 4QWDA 4LVSA 2G06A 1X9SA 2JGAA 3EPGA 3K1RB 4R63A 2C28A 4UB6U 2W54A 5B5EU 2UVRA 9ICOA 9ICTA 1DOQA 2XC9A 4Y2RA 4QZCA 5J2CA 7ICLA 1N56A 1ZXIA 2A3VA 1UHUA 7ICPA 5DDYA 3KFUF 4PGXA 4KMUA 5J2BA 3HW8A 1HJPA 2LPEA 4UB5A 2JHDA 4ED7A 2ISOA 4DQIA 5AKGA 5ALDA 4DSJA 1NK5A 2N1RA 4QJFB 1SKSA 3B0YA 1N62A 5J0QA 5KFWA 5J2EA 5ALOA 1BPDA 2G09A 3OPXA 3M6ZA 4ECRA 3H0MB 1S0MA 4RQ1A 3PW5A 3LDAA 2Y1IA 5L1KA 4F5NA 1QLNA 2AQ0A 3SAGA 3ISCA 8ICAA 3C23A 1X6IA 2YB1A 1JXEA 3PW0A 2JEFA 2KOBA 1BNOA 3NVVA 3PX6A 3F53A 3E2EA 4DF8A 5J0RA 1KSPA 4C7YA 3TAPA 1ZQRA 2WAQC 1ZQHA 4KN4A 3PW4A 3T5KA 3PO4A 2G07A 1L8LA 1N60A 2Y0SC 2GO7A 2H3VA 4YVZA 4ECXA 4Y2SA 4O3RA 1YZ7A 3SV3A 2QLTA 2FMSA 1XU4A 2R8JA 5KFHA 5C5JA 2LI6A 4RT3A 3PR4A 4XA5A 2K8AA 2W3RA 4JB3A 4PGQA 1RXVA 4ECSA 2ZTCA 1ZQQA 3ZI4A 3M7DA 8ICJA 1ZQZA 2MRLA 5IILA 2EAMA 4UB4A 1T3QA 1ECWA 3IRUA 3C21A 4MFFA 1XS9D 4EENA 1MN8A 5DG8A 2JH7A 3ZDBA 1UT5A 3HT3A 1KRPA 3PO5A 2ZUCA 2NYVA 3K75D 1K5OA 3WU2U 2ZIUA 4CDGA 1P7DA 5DLGA 3BQTA 1LKYB 5EE0A 3E58A 3FC4A 9ICQA 4O9MA 3IP4B 3T5HA 3PX0A 3FYHA 3QU2A 3C2KA 8ICMA 5DG7A 5K4LA 2VA8A 4F92B 2KJ8A 5B66U 2GWSA 3H7IA 3V7LA 4EYIB 2WHEA 5KFDA 3UMBA 3IV6A 2K89A 3MFHA 1NK7A 1L7NA 3LK9A 7ICHA 5JTIA 3ZDEA 2G5IB 3U26A 4KLOA 3H8SA 1CUKA 1UT8A 3RBEA 3UQ0A 3THVA 3A0HU 3I1YA 4UAUA 5DQIA 5J0PA 3KZIU 1ZD4A 4NY8A 1ZQMA 2YMQA 3V6KA 3CRXA 2W8LA 4C8NA 5J2DA 2OWOA 2XY5A 2PMZC 2D8CA 3G6XA 2K8CB 4IQUA 4CCHA 5DB9A 1Q3UA 3BZCA 3MR2A 2W11A 1HUOA 1BPBA 8ICGA 2J6TA 2XGQA 4Q45A 4GXKA 4KX5A 4DF4A 1SL2A 8ICEA 1Q8KA 2F1IA 3EZ5A 3CW2C 2KHQA 4Z6FA 8ICIA 1V85A 1DGJA 2K4PA 2DKZA 2JEGA 1U48A 2G0AA 3OGUA 5EE9A 1B0XA 4UBBA 4DS5A 2KJ5A 4IRKA 3KHHA 4G3IA 3RR8A 3A0BU 1MQ2A 2F1HA 3PMLA 4Y2XA 4QZFA 1BPZA 3LWLA 1WUDA 3SAFA 1J97A 4BJQA 1U49A 4DQPA 1IV8A 4DSEA 2L5YA 1ZYQA 5KFCA 2KZ3A 4MF2A 5ALLA 1HEKA 1N2XA 5BOMA 4J9MA 2J6SA 1D8YA 1FFVA 4HAIA 5ALXA 4PHAA 5DLFA 1A0PA 1HIWA 9ICLA 4PHDA 2FMPA 4LZGA 3ONNA 2MU2A 3QYPA 2XY7A 5F3XB 1LKYA 1RQNA 3UQ2A 2YX8A 3RB0A 3SR6A 1L6NA 3JPNA 2FLNA 2EDUA 5ALQA 3SMVA 1V38A 3BQ2A 1OXJA 8ICZA 7ICEA 3TADC 1Z19A 9ICHA 5ALVA 1Q3VA 2BPCA 3QZ7A 2LYBA 2B6GA 4O5EA 3NGDA 5DBBA 1L7PA 2KFZA 4O3QA 3NS1A 3IHQB 1ZD2P 5IINA 4P0QB 4DL6A 4EZ6A 3QZ8A 3NRZA 3KHRA 3CYMA 2JZBB 3JPRA 3VCBA 2W03A 1Z4OA 4PZNA 2HSZA 2D6FC 4YCXA 1X40A 1L8OA 1IIPA 5J8YC 3QUCA 5GTHU 3IG5A 4I28A 5IIIA 3OJUA 4C4TA 1WYGA 1NI3A 8ICXA 2WTFA 1BVSA 7ICJA 4DL5A 9ICAA 3NRWA 2UVUA 5IIOA 4JV2A 1CI4A 2IHMA 2AGQA 1F44A 4UBCA 2PFNA 3FM9A 4UARA 4NV0A 3PSPA 4C4RA 3PZPA 2KSOB 2AGOA 3F5EA 2GH1A 2BR0A 5FP0A 3H4BA 2JV3A 3MBYA 3MGVA 4DSKA 2BCSA 3M8RA 2NV3A 4O5CA 1JROA 1DGSA 2DFLA 1ZD5A 3T3FA 2CN1A 1QCKA 1T4GA 3S6JA 1S0VA 3DEEA 2VANA 4I2GA 2CPRA 4ECUA 2XGPA 5KL1B 5J2AA 5DB8A 2HHXA 4DL3A 4EBEA 4FS1A 9ICMA 5AK3A 3WK9A 4DOAA 2IBKA 2AH5A 8ICBA 2KMDA 4FBUA 3KBBA 1J2MA 5KG3A 4XQ8A 3H8JA 1S10A 5EE3A 1LB2B 2BCVA 4BGDA 4J9QA 3C1ZA 1UQVA 4A8EA 3UXNA 5DQGA 5ALSA 1NZPA 2DF4B 5ALJA 1ZQUA 4PZOA 4Z6EA 3H0RB 1VJ5A 2IMWP 4F4WA 2NRVA 4KLHA 1DK3A 4KLIA 2JXJA 1OUQA 4RUAA 3RJJA 4FS2A 1YT3A 4OD0A 1XWLA 1ZQJA 4KLQA 4QIWF 1CEZA 3MR3A 2KIVA 5AKIA 2RQ5A 3SD7A 2JEIA 1SL0A 3RRGA 3Q8LA 5AK6A 1ZQKA 8ICVA 1A76A 4LZDA 2BDUA 2H5XA 2I1QA 4YMOA 4RNOA 4TQSA 2QKQA 4J9SA 5J2FA 1X9WA 1Z1BA 4P0QA 7ICSA 3NVWA 8ICHA 4DSIA 1CRXA 2YTUA 2BDPA 2JZBA 3AUOA 3TACB 1N61A 2F76X 5IIKA 2KVSA 4Q8EA 4IQTA 3OTQA 4DOBA 5KFSA 3I28A 3O0FA 4YMNA 2HCFA 2DPJA 5JUMA 2BCRA 5HNKA 2DL0A 9ICFA 5HMMA 5A0LA 4DSFA 1N5WA 4M0AA 2E8PA 7ICFA 3RF9A 3SQIA 5ALZA 4DLGA 2DPIA 4F4KA 1O03A 1IG6A 4ED0A 3PVXA 3ISDA 4F2RA 3T79A 7ICVA 4NWIA 2F8LA 4RPXA 4B9SA 5KFBA 4BUGA 1BPYA 1SKWA 4YXJA 2HHVA 2KSOA 1PZNA 4FFDA 4MF8A 3IG8A 2KN7A 2AXTU 4J9RA 4AYBC 3KD3A 1RQLA 2IOFK 4M47A 2R18A 2IHNA 2HVIA 4RQ8A 4F91B 3QX7A 4I2DA 4IQVA 4Y2QA 3WK4A 3ZD8A 4C80A 4CRXA 9ICJA 3D2NA 1SV0C 4ZH4A 1NJXA 5AHXA 2XIDA 4QZ9A 4IRDA 3ZDDA 4TURA 2ZUDA 4TUQA 2XI9A 2Q0ZX 9ICIA 3TI0A 5KAFU 2RRDA 4JV1A 3OHAA 3PY8A 3Q8SB 4OJLA 4O3SA 4JUZA 3EYZA 3PNCA 4WJ3B 3PV8A 4NLNA 5ALMA 4RZRA 4KLLA 3QNMA 4CE6A 1T3NA 1SL1A 7ICMA 3J81j 2W3SA 2R8IA 1PUZA 4O5KA 2YMPA 1KW4A 4E0DA 5KFOA 1S0NA 2YN4A 3RR7A 4BX9C 2K8BB 1XSLA 3BDPA 4GXJA 1L7OA 3KKAA 3F2CA 1RXWA 1ZQDA 1D8BA 3BS7A 3NASA 1L7MA 4FZNA 4F5RA 2VKQA 1ZQCA 4F72A 5KFUA 4FZLA 2ATLA 4YR3A 1M6YA 1Q46A 2KICA 4Z6DA 4DQRA 1KKXA 3SYZA 1KFTA 3ZDAA 9ICKA 2MSNA 8ICYA 5AI0A 3NUQA 4TUSA 1Z4NA 5J2KA 3MABA 1T94A 1B22A 3V6JA 1KQQA 2Y9UA 4Q44A 3AEVA 5C0YA 2OH2A 5EWFA 3OSNA 1T7PA 2FE9A 4R66A 1T8EA 5J0WA 4DQSA 2QB0B 2WF8A 5EE1A 5ALFA 4QZAA 1S5LU 4RQ7A 3QXGA 5GTIU 1S97A 4U7CA 3M8SA 4Y2UA 3HKZC 1SXEA 4ECVA 2BKEA 3QU5A 5KFIA 2EZXA 2FPKA 1K1SA 3KKAC 2WAQF 3BQ0A 5CB1A 3QU4A 5L1IA 2K4EA 3UMGA 4I2AA 1S0OA 5KG6A 4Q43A 1KLNA 2XO7A 2Y0SF 2MAXA 1LVHA 2BQUA 2F77X 4P2HA 4EYHB 3WKCA 4KLGA 4O0IA 2W04A 3RB3A 1K1QA 1U47A 4CGZA 3AQEA 3GV7B 5J2GA 1JUDA 4NL9A 3LWMA 2C22A 1FFUA 2A1JB 2HHSA 2PFQA 2ZIWB 2FLLA 9ICRA 2W9BB 5AM1A 3BJYA 4DFPA 3GZFA 3VC8A 1NKCA 7ICOA 5AM5A 3QEAZ 2D3DA 4R65A 4B6JA 4ECWA 1X66A 4F5PA 5KT3A 5JU5A 4M04A 5CRXA 3PW7A 2KKVA 3JPPA 2O6KA 1LV5A 4Y2JA 5ALRA 1L3SA 2XVTA 1SWWA 1XO0A 2V4QA 2KZZA 3QEBZ 3AN1A 2VIXA 5AKHA 4J9OA 4C8LA 2F3NA 3BQ7A 2WFAA 1QQ7A 5AK5A 1JALA 9ICCA 3HWTA 3NTUA 4PL2A 2IOFA 1JIHA 2OM6A 5J29A 3N4MB 1NZBA 3PR5B 8ICSA 9ICPA 2ZXHA 3GIIA 2ZG6A 3TFRA 3G6VA 4BXOB 3QE9Y 4I2EA 2LKYA 4G9BA 4R64A 4BDPA 3D6JA 5HR6A 5ALUA 3RJHA 2NRTA 4OJ5A 5KT6A 3RBDA 5H2FU 4O3NA 2QB0A 2KIWA 3TARA 2C2DA 1QSSA 4QWBA 4YFKA 4OJOA 2FMQA 2WB1F 5ALWA 2QB1A 3TQ1A 3GDXA 1COKA 3WK8A 3WKDA 2ODGA 2BCQA 4PGYA 5EWEA 3T5JA 4M6WB 1Z00B 3E0FA 3SI8A 4GC6A 2M9NA 2ESEA 5KAIU 3EW9A 3N7RC 3KHLA 4UATA 4DSLA 1ZETA 2PXIA 7ICKA 3TANA 3AMZA 2R8KA 2KG5A 1URJA 1VDVA 3UXPA 5ALPA 2HHUA 4DL2A 4RPYA 2AU0A 3QU9A 3DV9A 2OCEA 2WF9A 1ZQ1C 4XUSA 5KG5A 2AQ4A 4AP9A 2BQRA 2R8GA 4JMUA 2A1JA 5AM4A 7ICGA 1ZRMA 2NO5A 5KFZA 5KFLA 2ZIWA 5AM2A 5T14A 2W9BA 1QSYA 2AJQA 4JWNA 2FPMA 1TAQA 3N7PD 4QNLA 1TK8A 2UVWA 4FBTA 1ZQIA 2V9WA 1DK2A 4M9LA 4KLEA 7ICRA 3HX0A 1RYUA 4MFAA 4CNQA 4NLGA 1PK3A 3KZXA 4EBDA 2UVVA 3Q8PB 4ED2A 3M1YA 5KFEA 5KT2A 2HOIA 2LYHA 5KG0A 5CA7A 2KVCA 4RNNA 5L1JA 4ELUA 4EX6A 3GIKA 4J9LA 1ZQAA 2PFPA 1S9FA 5DKWA 4IR1A 3RJFA 4DCCA 4UAYA 1QTMA 3AL0B 3CP8A 2K4HA 4NXZA 1A77A 4GXIA 4Y2PA 1UCVA 3NVZA 1L5UA 4P0PB 1ZQGA 4B9VA 4BXOA 3C28A 9ICGA 3HPOA 4M9NA 5AM0A 2W9CB 1JX4A 4ZOHC 3RH6A 5ALGA 3MDAA 4K4HA 1RG6A 1VLBA 4P4PA 3UXOA 8ICQA 4I2HA 2JMGA 4F2SA 2EZZA 1S77D 5KFQA 4DFDA 2RP5A 4OCZA 5TZVA 4I2IA 5J0TA 2B21A 2FPLA 1NK9A 4ECYA 4RQNA 3B9JA 1XO1A 3RJGA 2ZTDA 3V72A 7ICQA 3C1YA 1NK8A 3D2SA 3QU7A 3T5LA 1RYRA 4XRHA 5AKZA 4YG2A 3HP6A 1NJWA 2EH9A 4QZDA 2LYAA 2YY6A 2K60A 5AICA 2FDRA 3RB6A 4YQWA 2RLTA 4J9NA 5KT7A 1JXLA 5CEHA 4M6WA 3RRHA 1Z00A 1V97A 1SGGA 3AU2A 2ASDA 4MHVA 4YN4A 2KE7A 5ALIA 1U45A 2C2EA 4UQGA 4IRCA 4UASA 3WKEA 4ELVA 3MR5A 5ALEA 1N5XA 5DB7A 1RDFA 2W43A 3Q8RB 5L1MA 3JPTA 4DO9A 2B0CA 2KD1A 5AKYA 1JN3A 1SWVA 2BGWA 3Q8MA 1RZTA 4O3PA 1PVPA 2AHOB 4I2JA 4QZ8A 4JK1A 2JH1A 1JI7A 2W7OA 5DQHA 1NKBA 4F93B 4USAA 4PH5A 2VA3A 4UB8U 2DGZA 3G6YA 4US9A 2EAPA 1IXRA 4X5VA 4NLBA 2E1FA 3BS5B 4RT2A 4C8KA 4F5QA 4MEXA 3JPOA 3N97B 4M9JA 1WG8A 4K4GA 2P35A 2Q4TA 5AI5A 4DL7A 3F2DA 1ZD3A 2ZTEA 3HJEA 4GLXA 1TE2A 3L3FX 2HOFA 2HHTA 1EXNA 4PHEA 2HBLA 3MR6A 3V7JA 4QZGA 2PKEA 1TKDA 4M9HA 4DL4A 3QUTA 3OSPA 5D4BA 8ICOA 4P0PA 3WK5A 3PSFA 2G08A 2H3FA 3M9MB 4MEYA 2W9CA 3DDHA 2ZIVB 8ICLA 5AI8A 9ICBA 4RUCA 3PX4A 4NM1A 4OJ6A 1ZQWA 5JRTA 3EUB2 2AGPA 3N7SC 2HBKA 3UMCA 1C20A 5KG2A 3K4GA 5HP4A 2HI0A 3EWAA 3F5AA 1N48A 8ICFA 2KNJA 5KTQA 5KG1A 4RQMA 3GIMA 1COOA 5KFPA 5KFRA 4KLSA 3GIJA 7ICUA 4UB2A 2ZJ8A 4PJ0U 9ICVA 4P4OA 4NJ8A 3WK7A 2W55A 1X6JA 5KFGA 4DFKA 2FI1A 1D9DA 1BNPA 2K4IA 4FO6A 5KNIA 4YR2A 5IIMA 1C7YA 5AI9A 8ICKA 1RM6C 1NK4A 5DG9A 1KTQA 5AI6A 1FO4A 2F44A 5KT5A 2Y1JA 1ZJMA 2RDIA 1ZQFA 3ORYA 5KFKA 1Z1VA 2F8KA 7ICNA 3IDWA 4Z6CA 2PI5A 4AYBF 2NRZA 4EX7A 4EELA 5BOLA 4B9TA 5G5HA 1U4BA 9ICSA 9ICNA 1ZQBA 4NLKA 2KK0A 5CWRA 2R8HA 1FEZA 4C0ZA 3H40A 2KP7A 4C7ZA 3UPQA 2BZFA 5CHGA 3IM1A 1GO3F 4C8MA 3SENA 4YD1A 2A1AA 2C2RA 4QWCA 5HR7A 1Z3EB 4B9UA 3BS5A 4F71A 4F4XA 2KFNA 2FJ6A 5AKJA 9ICUA 1KN5A 1ZQEA 5AK4A 1UA0A 5CP2A 3M9NB 1ZQNA 5DGAA 3WK6A 5J2HA 1WCLA 5AKEA 2CXYA 4GC7A 1NK0A 1NKEA 4Y2YA 5DDMA 2VJ4A 4RQ5A 2DWQA 1A6SA 5DBAA 2YB4A 4RQ0A 2F2AB 1XSPA 4I2CA 1XSNA 9ICEA 5D49A 1MA7A 1WWVA 2W7PA 2ZIVA 4I2BA 1IM4A 1QSLA 4ECZA 2HOQA 1TK0A 3ETLA 2KZMA 3LYSA 3ISBA 3GV8B 2DQNB 4B9LA 3RJIA 5J2JA 4YP3A 3RAXA 1JMSA 4NLZA 3FAHA 4KTQA 4DWIA 2KJ9A 4US8A 3H4DA 4DQQA 4R8UB 2HHQA 1ZQLA 4ED3A 4ACOA 5J0YA 4GFJA 5CR0A 1N63A 3AM9A 3I76A 3L5KA 5AKKA 4QZBA 3LVVA 3EPIA 4M9GA 2VA2A 1X42A 1NNLA 1B43A 3HKZF 3KOOA 4RPZA 2HHWA 2EAOA 1TFRA 3C2MA 1L3TA 5CJ7A 2KV2A 1SKRA 4NLCA 4KLFA 2XCAA 3ZD9A 4DLEA 2HDOA 1DRGA 2GLEA 5L9XA 1FIQA 3D2QA 2KTQA 3AQFA 4DFMA 5J0SA 1KBUA 7ICIA 5KFYA 2VJ5A 5ALYA 3PSTA 2IA6A 5KFVA 4YXMA 2XY6A 4EEYA 2KEYA 2ES6A 2YMLA 1X9XA 4J03A 8ICWA 1SIJA 4QW8A 2WB1C 2QARB 1PK1B 1MC8A 4NL9C 5IIJA 1SB3C 1V9PA 4QZHA 4YR0A 2EQYA 1D8LA 2Y9TA 2LMRA 4YMMA 3M9OB 4QWEA 2MA1A 4GIBA 1NOMA 5DB6A 2JEJA 4IC9A 1ZQYA 3CNHA 3OJSA 5F9NA 1L3UA 5KG4A 1X9MA 4UAZA 2BCUA 3HRDD 2OHFA 1KDHA 1NJYA 2E3TA 3BZKA 5KG7A 4RQ3A 4O3MA 3TADA 2NO4A 4EEKA 3RB4A 4PPXA 4RNMA 5D46A 1SZHA 2PMZF 5BPCA 1F0MA 2H3IA 5EWGA 1MSWD 8ICNA 4KLDA 3GILA 2ZJ5A 1S76D 3RJKA 3SZ2A 1UPHA 2DKXA 2HBJA 2P66A 1ZQXA 3OHBA 2NRWA 1AQ6A 2E8MA 2H3ZA 2BPGA 8ICRA 4ELTA 2WF7A 3C29A 5KFNA 4QW9A 1RYSA 2IOHA 2HVHA 4R8UA 3C5GA 2LM4A 1ZQSA 4KLUA 4C8OA 8ICPA 2ZUBA 3LVWA 2MUTB 1D9FA 1BPEA 5KFAA 2HMXA 8ICUA 5J8YA 3FDSA 2E5SA 3ICXA 1SZPA 5KFTA 4F5OA 3AU6A 1TV9A 1TVAA 1XNSA 1WWUA 1ZOLA 4UB3A 3JPQA 1PVQA 3RH5A 1SV4A 4I2FA 3RJEA 4CF5A 5KFJA 5HHHA 3IN5A 1X2IA 9ICXA 4B9MA 1ZQTA 2W9MA 4UW9A 4F4YA 1TAUA 2NRXA 2ASJA 1ZQOA 3MGHA 4DFJA 4C4SA 2ZIXB 5AM3A 3Q8QB 2CRXA 3TFSA 4IR9A 3C5FA 1ZQPA 4U6PA 3RFAA 2YQEA 1QQ6A 1BGXT 3SEIA 3WKAA 4NM2A
chains in the Genus database with same CATH topology
4FZLA 2JMGA 4OJPA 3N7RC 5CRXA 3GU3A 2KICA 4ACOA 1Z19A 4GFJA 2E1EA 2RP5A 4AYBF 2CN1A 2KKVA 2Q4TA 3DEEA 3SAHA 1Q3VA 2CPRA 4FZMA 3F2DA 2G06A 3T79A 3CRXA 5KL1B 2JGAA 3NUQA 2G5HB 4NWIA 2OXOA 3L3FX 4O3MA 1URJA 2F8LA 2XVTA 2K8AA 3LVVA 2HOFA 2LYBA 1XO0A 1ED1A 2HBLA 2PMZC 4PL1A 4C0ZA 4BUGA 1T94A 2K8CB 3D2SA 1SZHA 2PMZF 2VIXA 3M7DA 3HKZF 1Q3UA 2MRLA 2H3IA 4KX3A 1ZQ1C 5C0YA 2OH2A 1ECWA 3IG8A 4KMOB 2LYAA 2LHTA 2ZIXA 4KX5A 4AYBC 1UPHA 4P0PA 2HBJA 2HBMA 3PSFA 4JMUA 4A8EA 2A3VA 2KV2A 3M6KA 1GO3F 2G08A 2JH7A 2R18A 2H3ZA 2DF4B 2H3FA 4P0QB 4NLCA 4PL2A 3KFUF 2ZIWA 2KHQA 3C29A 2Z7JA 2ZIVB 5T14A 5HR7A 2OM6A 3H0RB 3CYMA 2KHVA 4OJ6A 1DRGA 1NZBA 4CRXA 2JHDA 3D2NA 4U7CA 2ZIUA 3VCBA 4CDGA 3N7PD 4QNLA 2W03A 3HKZC 1OUQA 1P7DA 3D2QA 2N1RA 2XIDA 3ALRA 2D6FC 4FE3A 2G0AA 2HBKA 2ZXHA 3N7SC 4QJFB 2ZG6A 2M0NA 2KJ5A 1IIPA 3AQFA 1YT3A 3LVWA 3IP4B 2XI9A 1KBUA 2G09A 3F5AA 3IG5A 3OPXA 4QIWF 3F2BA 2ZXIA 2WAQF 3M6ZA 2LKYA 2RRDA 2VJ5A 2HMXA 2KNJA 3PSIA 2K4EA 3H0MB 3K1ZA 3KZXA 2LBOA 2H3QA 3SMVA 2VJ4A 5HR6A 1WUDA 3PSTA 2KD1A 3SAFA 4BJQA 4OJLA 1A6SA 2BDUA 2GOLA 4ICAA 3SAGA 2E5SA 2KJ8A 2YB4A 3ICXA 2HOIA 4OJ5A 2YB1A 4WJ3B 2KEYA 2Y0SF 2F2AB 2KVCA 3NRWA 2KOBA 2F77X 1XNSA 1PVQA 3F53A 1Z1BA 2KIWA 1HEKA 4P0QA 1F44A 1PVPA 2WB1C 3H0LB 4QIWC 1PVRA 1MA7A 2K89A 2W04A 2W7PA 2RHFA 2WAQC 2ZIVA 3IN5A 1CRXA 2JH1A 4NV0A 2W7OA 3AL0B 3CP8A 2K4HA 2HOQA 2WB1F 4OJOA 4CGZA 3PSPA 3AQEA 2K4IA 1A0PA 1HIWA 3LYSA 3PZPA 2G5IB 2DQNB 2F76X 3ONNA 3F5EA 2GH1A 2G07A 4BX9C 2K8BB 2XICA 2ZIXB 2CRXA 4P0PB 2DGZA 2MA1A 2OYYA 2Y0SC 3O0FA 5KL8B 3F2CA 4OO1J 3C28A 1D8BA 2KKPA 4NLBA 4IC9A 4U6PA 2ZIWB 3MGVA 2H3VA 2YX8A 3RFAA 2KJ9A 2E1FA 1TAMA 5A0LA 4FZNA 3E0FA 2NV3A 3GZFA 3VC8A 1L6NA 2VKQA 2ZIUB 3RF9A 3SQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ F;  3HKZ F;  2WB1 F;  2WAQ F;  2Y0S F;  4AYB F; 
#chains in the Genus database with same CATH topology
 2W8K A;  4YD2 A;  4RQ2 A;  3SAH A;  2J6U A;  2BPF A;  3GFK B;  1S8O A;  4FZM A;  4QZE A;  3RAQ A;  2DUY A;  1TK5 A;  2OXO A;  4DOC A;  2QAR A;  1PK1 A;  5G5G A;  3H8M A;  1ED1 A;  4P4M A;  2FLP A;  1H38 A;  2YMM A;  4UAW A;  5ALH A;  4KMO B;  1KFD A;  4KN7 A;  4BWM A;  2HBM A;  3M6K A;  2EAN A;  5KFM A;  2Z7J A;  2KHV A;  1KL9 A;  2JRZ A;  2ZJA A;  1KEJ A;  4UB1 A;  2WF5 A;  5ALT A;  3HIL A;  5KT4 A;  1O08 A;  4M2Y A;  1RPL A;  3ALR A;  4EBC A;  2M0N A;  2ALZ A;  8ICT A;  2OEH A;  2F1J A;  5HHI A;  3F2B A;  2RDJ A;  4KLT A;  3SV4 A;  3QUB A;  1J2N A;  4Q8F A;  3PSI A;  3GQC A;  1U9L A;  2H3Q A;  4Y2V A;  5HML A;  5L1L A;  2V4R A;  3GV5 B;  4ED8 A;  2GOL A;  3ZDC A;  4QWA A;  4ECT A;  3PMN A;  3KTQ A;  5DGB A;  3H0L B;  5J2I A;  4QIW C;  1L3V A;  1ARO P;  5TIS U;  5J0O A;  5EOZ A;  4JV0 A;  1JRP A;  3N28 A;  2P6R A;  2OYY A;  5ALN A;  4BWJ A;  5DBC A;  2W9A A;  2MUT A;  8ICC A;  1TAM A;  4IS7 A;  4O3O A;  1BPX A;  3TAQ A;  1WCN A;  3MC1 A;  1XC9 A;  2P6U A;  5KL8 B;  3L4P A;  3MFI A;  1ZQV A;  2A19 A;  1NK6 A;  2E1E A;  1QQ5 A;  5AI4 A;  4J9K A;  3WKB A;  1YZ6 A;  4DEZ A;  2G5H B;  5AIB A;  5AIA A;  3RH4 A;  4F4Z A;  4PL1 A;  3R9K A;  5E79 U;  4PHP A;  1Y88 A;  3MDC A;  4KX3 A;  1SXD A;  3MGI A;  3BQ1 A;  1HUZ A;  2ISP A;  2LM1 A;  2LHT A;  2ZIX A;  4TQR A;  4F8R A;  4ED6 A;  5J0U A;  4TUP A;  5F9L A;  3TKA A;  4KLJ A;  4IQW A;  4F3O A;  4K4I A;  5AKX A;  7ICT A;  1F5S A;  3C2L A;  4FE3 A;  3KHG A;  2I6X A;  4MFC A;  4J9P A;  4KIT B;  4RQ6 A;  3V6H A;  4RQ4 A;  5AKL A;  1SV0 A;  4DS4 A;  1KFS A;  2BHN A;  1ZJN A;  2ZXI A;  4Y2T A;  1ZRN A;  3NVY A;  1B4F A;  3K1Z A;  2PFO A;  2LBO A;  3RTV A;  4KLM A;  4RU9 A;  1QH9 A;  2DBY A;  2E8N A;  4ICA A;  3QUQ A;  4QZI A;  1DXS A;  3UM9 A;  2I5H A;  4ECQ A;  4UAV A;  4CF3 A;  1PVR A;  3JPS A;  9ICW A;  2RHF A;  4I29 A;  3Q8K A;  3V7K A;  4EZ9 A;  5KFF A;  2I9G A;  4HYK A;  4B9N A;  2XIC A;  1MQ3 A;  2ASL A;  3B0X A;  4OO1 J;  4ED1 A;  4LJX A;  2KKP A;  3H8W A;  3ETR A;  2E8O A;  5ALK A;  5KFX A;  5J0X A;  2PI4 A;  1NJZ A;  4IL6 U;  2XCP A;  1OW5 A;  2HW3 A;  2WF6 A;  3ED5 A;  4F50 A;  2ZIU B;  4OJP A;  4JWM A;  2JR5 A;  4CF4 A;  3GU3 A;  2BQ3 A;  3PW2 A;  1UA1 A;  4I27 A;  2EZY A;  4QWD A;  4LVS A;  2G06 A;  1X9S A;  2JGA A;  3EPG A;  3K1R B;  4R63 A;  2C28 A;  4UB6 U;  2W54 A;  5B5E U;  2UVR A;  9ICO A;  9ICT A;  1DOQ A;  2XC9 A;  4Y2R A;  4QZC A;  5J2C A;  7ICL A;  1N56 A;  1ZXI A;  2A3V A;  1UHU A;  7ICP A;  5DDY A;  3KFU F;  4PGX A;  4KMU A;  5J2B A;  3HW8 A;  1HJP A;  2LPE A;  4UB5 A;  2JHD A;  4ED7 A;  2ISO A;  4DQI A;  5AKG A;  5ALD A;  4DSJ A;  1NK5 A;  2N1R A;  4QJF B;  1SKS A;  3B0Y A;  1N62 A;  5J0Q A;  5KFW A;  5J2E A;  5ALO A;  1BPD A;  2G09 A;  3OPX A;  3M6Z A;  4ECR A;  3H0M B;  1S0M A;  4RQ1 A;  3PW5 A;  3LDA A;  2Y1I A;  5L1K A;  4F5N A;  1QLN A;  2AQ0 A;  3SAG A;  3ISC A;  8ICA A;  3C23 A;  1X6I A;  2YB1 A;  1JXE A;  3PW0 A;  2JEF A;  2KOB A;  1BNO A;  3NVV A;  3PX6 A;  3F53 A;  3E2E A;  4DF8 A;  5J0R A;  1KSP A;  4C7Y A;  3TAP A;  1ZQR A;  2WAQ C;  1ZQH A;  4KN4 A;  3PW4 A;  3T5K A;  3PO4 A;  2G07 A;  1L8L A;  1N60 A;  2Y0S C;  2GO7 A;  2H3V A;  4YVZ A;  4ECX A;  4Y2S A;  4O3R A;  1YZ7 A;  3SV3 A;  2QLT A;  2FMS A;  1XU4 A;  2R8J A;  5KFH A;  5C5J A;  2LI6 A;  4RT3 A;  3PR4 A;  4XA5 A;  2K8A A;  2W3R A;  4JB3 A;  4PGQ A;  1RXV A;  4ECS A;  2ZTC A;  1ZQQ A;  3ZI4 A;  3M7D A;  8ICJ A;  1ZQZ A;  2MRL A;  5IIL A;  2EAM A;  4UB4 A;  1T3Q A;  1ECW A;  3IRU A;  3C21 A;  4MFF A;  1XS9 D;  4EEN A;  1MN8 A;  5DG8 A;  2JH7 A;  3ZDB A;  1UT5 A;  3HT3 A;  1KRP A;  3PO5 A;  2ZUC A;  2NYV A;  3K75 D;  1K5O A;  3WU2 U;  2ZIU A;  4CDG A;  1P7D A;  5DLG A;  3BQT A;  1LKY B;  5EE0 A;  3E58 A;  3FC4 A;  9ICQ A;  4O9M A;  3IP4 B;  3T5H A;  3PX0 A;  3FYH A;  3QU2 A;  3C2K A;  8ICM A;  5DG7 A;  5K4L A;  2VA8 A;  4F92 B;  2KJ8 A;  5B66 U;  2GWS A;  3H7I A;  3V7L A;  4EYI B;  2WHE A;  5KFD A;  3UMB A;  3IV6 A;  2K89 A;  3MFH A;  1NK7 A;  1L7N A;  3LK9 A;  7ICH A;  5JTI A;  3ZDE A;  2G5I B;  3U26 A;  4KLO A;  3H8S A;  1CUK A;  1UT8 A;  3RBE A;  3UQ0 A;  3THV A;  3A0H U;  3I1Y A;  4UAU A;  5DQI A;  5J0P A;  3KZI U;  1ZD4 A;  4NY8 A;  1ZQM A;  2YMQ A;  3V6K A;  3CRX A;  2W8L A;  4C8N A;  5J2D A;  2OWO A;  2XY5 A;  2PMZ C;  2D8C A;  3G6X A;  2K8C B;  4IQU A;  4CCH A;  5DB9 A;  1Q3U A;  3BZC A;  3MR2 A;  2W11 A;  1HUO A;  1BPB A;  8ICG A;  2J6T A;  2XGQ A;  4Q45 A;  4GXK A;  4KX5 A;  4DF4 A;  1SL2 A;  8ICE A;  1Q8K A;  2F1I A;  3EZ5 A;  3CW2 C;  2KHQ A;  4Z6F A;  8ICI A;  1V85 A;  1DGJ A;  2K4P A;  2DKZ A;  2JEG A;  1U48 A;  2G0A A;  3OGU A;  5EE9 A;  1B0X A;  4UBB A;  4DS5 A;  2KJ5 A;  4IRK A;  3KHH A;  4G3I A;  3RR8 A;  3A0B U;  1MQ2 A;  2F1H A;  3PML A;  4Y2X A;  4QZF A;  1BPZ A;  3LWL A;  1WUD A;  3SAF A;  1J97 A;  4BJQ A;  1U49 A;  4DQP A;  1IV8 A;  4DSE A;  2L5Y A;  1ZYQ A;  5KFC A;  2KZ3 A;  4MF2 A;  5ALL A;  1HEK A;  1N2X A;  5BOM A;  4J9M A;  2J6S A;  1D8Y A;  1FFV A;  4HAI A;  5ALX A;  4PHA A;  5DLF A;  1A0P A;  1HIW A;  9ICL A;  4PHD A;  2FMP A;  4LZG A;  3ONN A;  2MU2 A;  3QYP A;  2XY7 A;  5F3X B;  1LKY A;  1RQN A;  3UQ2 A;  2YX8 A;  3RB0 A;  3SR6 A;  1L6N A;  3JPN A;  2FLN A;  2EDU A;  5ALQ A;  3SMV A;  1V38 A;  3BQ2 A;  1OXJ A;  8ICZ A;  7ICE A;  3TAD C;  1Z19 A;  9ICH A;  5ALV A;  1Q3V A;  2BPC A;  3QZ7 A;  2LYB A;  2B6G A;  4O5E A;  3NGD A;  5DBB A;  1L7P A;  2KFZ A;  4O3Q A;  3NS1 A;  3IHQ B;  1ZD2 P;  5IIN A;  4P0Q B;  4DL6 A;  4EZ6 A;  3QZ8 A;  3NRZ A;  3KHR A;  3CYM A;  2JZB B;  3JPR A;  3VCB A;  2W03 A;  1Z4O A;  4PZN A;  2HSZ A;  2D6F C;  4YCX A;  1X40 A;  1L8O A;  1IIP A;  5J8Y C;  3QUC A;  5GTH U;  3IG5 A;  4I28 A;  5III A;  3OJU A;  4C4T A;  1WYG A;  1NI3 A;  8ICX A;  2WTF A;  1BVS A;  7ICJ A;  4DL5 A;  9ICA A;  3NRW A;  2UVU A;  5IIO A;  4JV2 A;  1CI4 A;  2IHM A;  2AGQ A;  1F44 A;  4UBC A;  2PFN A;  3FM9 A;  4UAR A;  4NV0 A;  3PSP A;  4C4R A;  3PZP A;  2KSO B;  2AGO A;  3F5E A;  2GH1 A;  2BR0 A;  5FP0 A;  3H4B A;  2JV3 A;  3MBY A;  3MGV A;  4DSK A;  2BCS A;  3M8R A;  2NV3 A;  4O5C A;  1JRO A;  1DGS A;  2DFL A;  1ZD5 A;  3T3F A;  2CN1 A;  1QCK A;  1T4G A;  3S6J A;  1S0V A;  3DEE A;  2VAN A;  4I2G A;  2CPR A;  4ECU A;  2XGP A;  5KL1 B;  5J2A A;  5DB8 A;  2HHX A;  4DL3 A;  4EBE A;  4FS1 A;  9ICM A;  5AK3 A;  3WK9 A;  4DOA A;  2IBK A;  2AH5 A;  8ICB A;  2KMD A;  4FBU A;  3KBB A;  1J2M A;  5KG3 A;  4XQ8 A;  3H8J A;  1S10 A;  5EE3 A;  1LB2 B;  2BCV A;  4BGD A;  4J9Q A;  3C1Z A;  1UQV A;  4A8E A;  3UXN A;  5DQG A;  5ALS A;  1NZP A;  2DF4 B;  5ALJ A;  1ZQU A;  4PZO A;  4Z6E A;  3H0R B;  1VJ5 A;  2IMW P;  4F4W A;  2NRV A;  4KLH A;  1DK3 A;  4KLI A;  2JXJ A;  1OUQ A;  4RUA A;  3RJJ A;  4FS2 A;  1YT3 A;  4OD0 A;  1XWL A;  1ZQJ A;  4KLQ A;  4QIW F;  1CEZ A;  3MR3 A;  2KIV A;  5AKI A;  2RQ5 A;  3SD7 A;  2JEI A;  1SL0 A;  3RRG A;  3Q8L A;  5AK6 A;  1ZQK A;  8ICV A;  1A76 A;  4LZD A;  2BDU A;  2H5X A;  2I1Q A;  4YMO A;  4RNO A;  4TQS A;  2QKQ A;  4J9S A;  5J2F A;  1X9W A;  1Z1B A;  4P0Q A;  7ICS A;  3NVW A;  8ICH A;  4DSI A;  1CRX A;  2YTU A;  2BDP A;  2JZB A;  3AUO A;  3TAC B;  1N61 A;  2F76 X;  5IIK A;  2KVS A;  4Q8E A;  4IQT A;  3OTQ A;  4DOB A;  5KFS A;  3I28 A;  3O0F A;  4YMN A;  2HCF A;  2DPJ A;  5JUM A;  2BCR A;  5HNK A;  2DL0 A;  9ICF A;  5HMM A;  5A0L A;  4DSF A;  1N5W A;  4M0A A;  2E8P A;  7ICF A;  3RF9 A;  3SQI A;  5ALZ A;  4DLG A;  2DPI A;  4F4K A;  1O03 A;  1IG6 A;  4ED0 A;  3PVX A;  3ISD A;  4F2R A;  3T79 A;  7ICV A;  4NWI A;  2F8L A;  4RPX A;  4B9S A;  5KFB A;  4BUG A;  1BPY A;  1SKW A;  4YXJ A;  2HHV A;  2KSO A;  1PZN A;  4FFD A;  4MF8 A;  3IG8 A;  2KN7 A;  2AXT U;  4J9R A;  4AYB C;  3KD3 A;  1RQL A;  2IOF K;  4M47 A;  2R18 A;  2IHN A;  2HVI A;  4RQ8 A;  4F91 B;  3QX7 A;  4I2D A;  4IQV A;  4Y2Q A;  3WK4 A;  3ZD8 A;  4C80 A;  4CRX A;  9ICJ A;  3D2N A;  1SV0 C;  4ZH4 A;  1NJX A;  5AHX A;  2XID A;  4QZ9 A;  4IRD A;  3ZDD A;  4TUR A;  2ZUD A;  4TUQ A;  2XI9 A;  2Q0Z X;  9ICI A;  3TI0 A;  5KAF U;  2RRD A;  4JV1 A;  3OHA A;  3PY8 A;  3Q8S B;  4OJL A;  4O3S A;  4JUZ A;  3EYZ A;  3PNC A;  4WJ3 B;  3PV8 A;  4NLN A;  5ALM A;  4RZR A;  4KLL A;  3QNM A;  4CE6 A;  1T3N A;  1SL1 A;  7ICM A;  3J81 j;  2W3S A;  2R8I A;  1PUZ A;  4O5K A;  2YMP A;  1KW4 A;  4E0D A;  5KFO A;  1S0N A;  2YN4 A;  3RR7 A;  4BX9 C;  2K8B B;  1XSL A;  3BDP A;  4GXJ A;  1L7O A;  3KKA A;  3F2C A;  1RXW A;  1ZQD A;  1D8B A;  3BS7 A;  3NAS A;  1L7M A;  4FZN A;  4F5R A;  2VKQ A;  1ZQC A;  4F72 A;  5KFU A;  4FZL A;  2ATL A;  4YR3 A;  1M6Y A;  1Q46 A;  2KIC A;  4Z6D A;  4DQR A;  1KKX A;  3SYZ A;  1KFT A;  3ZDA A;  9ICK A;  2MSN A;  8ICY A;  5AI0 A;  3NUQ A;  4TUS A;  1Z4N A;  5J2K A;  3MAB A;  1T94 A;  1B22 A;  3V6J A;  1KQQ A;  2Y9U A;  4Q44 A;  3AEV A;  5C0Y A;  2OH2 A;  5EWF A;  3OSN A;  1T7P A;  2FE9 A;  4R66 A;  1T8E A;  5J0W A;  4DQS A;  2QB0 B;  2WF8 A;  5EE1 A;  5ALF A;  4QZA A;  1S5L U;  4RQ7 A;  3QXG A;  5GTI U;  1S97 A;  4U7C A;  3M8S A;  4Y2U A;  3HKZ C;  1SXE A;  4ECV A;  2BKE A;  3QU5 A;  5KFI A;  2EZX A;  2FPK A;  1K1S A;  3KKA C;  2WAQ F;  3BQ0 A;  5CB1 A;  3QU4 A;  5L1I A;  2K4E A;  3UMG A;  4I2A A;  1S0O A;  5KG6 A;  4Q43 A;  1KLN A;  2XO7 A;  2Y0S F;  2MAX A;  1LVH A;  2BQU A;  2F77 X;  4P2H A;  4EYH B;  3WKC A;  4KLG A;  4O0I A;  2W04 A;  3RB3 A;  1K1Q A;  1U47 A;  4CGZ A;  3AQE A;  3GV7 B;  5J2G A;  1JUD A;  4NL9 A;  3LWM A;  2C22 A;  1FFU A;  2A1J B;  2HHS A;  2PFQ A;  2ZIW B;  2FLL A;  9ICR A;  2W9B B;  5AM1 A;  3BJY A;  4DFP A;  3GZF A;  3VC8 A;  1NKC A;  7ICO A;  5AM5 A;  3QEA Z;  2D3D A;  4R65 A;  4B6J A;  4ECW A;  1X66 A;  4F5P A;  5KT3 A;  5JU5 A;  4M04 A;  5CRX A;  3PW7 A;  2KKV A;  3JPP A;  2O6K A;  1LV5 A;  4Y2J A;  5ALR A;  1L3S A;  2XVT A;  1SWW A;  1XO0 A;  2V4Q A;  2KZZ A;  3QEB Z;  3AN1 A;  2VIX A;  5AKH A;  4J9O A;  4C8L A;  2F3N A;  3BQ7 A;  2WFA A;  1QQ7 A;  5AK5 A;  1JAL A;  9ICC A;  3HWT A;  3NTU A;  4PL2 A;  2IOF A;  1JIH A;  2OM6 A;  5J29 A;  3N4M B;  1NZB A;  3PR5 B;  8ICS A;  9ICP A;  2ZXH A;  3GII A;  2ZG6 A;  3TFR A;  3G6V A;  4BXO B;  3QE9 Y;  4I2E A;  2LKY A;  4G9B A;  4R64 A;  4BDP A;  3D6J A;  5HR6 A;  5ALU A;  3RJH A;  2NRT A;  4OJ5 A;  5KT6 A;  3RBD A;  5H2F U;  4O3N A;  2QB0 A;  2KIW A;  3TAR A;  2C2D A;  1QSS A;  4QWB A;  4YFK A;  4OJO A;  2FMQ A;  2WB1 F;  5ALW A;  2QB1 A;  3TQ1 A;  3GDX A;  1COK A;  3WK8 A;  3WKD A;  2ODG A;  2BCQ A;  4PGY A;  5EWE A;  3T5J A;  4M6W B;  1Z00 B;  3E0F A;  3SI8 A;  4GC6 A;  2M9N A;  2ESE A;  5KAI U;  3EW9 A;  3N7R C;  3KHL A;  4UAT A;  4DSL A;  1ZET A;  2PXI A;  7ICK A;  3TAN A;  3AMZ A;  2R8K A;  2KG5 A;  1URJ A;  1VDV A;  3UXP A;  5ALP A;  2HHU A;  4DL2 A;  4RPY A;  2AU0 A;  3QU9 A;  3DV9 A;  2OCE A;  2WF9 A;  1ZQ1 C;  4XUS A;  5KG5 A;  2AQ4 A;  4AP9 A;  2BQR A;  2R8G A;  4JMU A;  2A1J A;  5AM4 A;  7ICG A;  1ZRM A;  2NO5 A;  5KFZ A;  5KFL A;  2ZIW A;  5AM2 A;  5T14 A;  2W9B A;  1QSY A;  2AJQ A;  4JWN A;  2FPM A;  1TAQ A;  3N7P D;  4QNL A;  1TK8 A;  2UVW A;  4FBT A;  1ZQI A;  2V9W A;  1DK2 A;  4M9L A;  4KLE A;  7ICR A;  3HX0 A;  1RYU A;  4MFA A;  4CNQ A;  4NLG A;  1PK3 A;  3KZX A;  4EBD A;  2UVV A;  3Q8P B;  4ED2 A;  3M1Y A;  5KFE A;  5KT2 A;  2HOI A;  2LYH A;  5KG0 A;  5CA7 A;  2KVC A;  4RNN A;  5L1J A;  4ELU A;  4EX6 A;  3GIK A;  4J9L A;  1ZQA A;  2PFP A;  1S9F A;  5DKW A;  4IR1 A;  3RJF A;  4DCC A;  4UAY A;  1QTM A;  3AL0 B;  3CP8 A;  2K4H A;  4NXZ A;  1A77 A;  4GXI A;  4Y2P A;  1UCV A;  3NVZ A;  1L5U A;  4P0P B;  1ZQG A;  4B9V A;  4BXO A;  3C28 A;  9ICG A;  3HPO A;  4M9N A;  5AM0 A;  2W9C B;  1JX4 A;  4ZOH C;  3RH6 A;  5ALG A;  3MDA A;  4K4H A;  1RG6 A;  1VLB A;  4P4P A;  3UXO A;  8ICQ A;  4I2H A;  2JMG A;  4F2S A;  2EZZ A;  1S77 D;  5KFQ A;  4DFD A;  2RP5 A;  4OCZ A;  5TZV A;  4I2I A;  5J0T A;  2B21 A;  2FPL A;  1NK9 A;  4ECY A;  4RQN A;  3B9J A;  1XO1 A;  3RJG A;  2ZTD A;  3V72 A;  7ICQ A;  3C1Y A;  1NK8 A;  3D2S A;  3QU7 A;  3T5L A;  1RYR A;  4XRH A;  5AKZ A;  4YG2 A;  3HP6 A;  1NJW A;  2EH9 A;  4QZD A;  2LYA A;  2YY6 A;  2K60 A;  5AIC A;  2FDR A;  3RB6 A;  4YQW A;  2RLT A;  4J9N A;  5KT7 A;  1JXL A;  5CEH A;  4M6W A;  3RRH A;  1Z00 A;  1V97 A;  1SGG A;  3AU2 A;  2ASD A;  4MHV A;  4YN4 A;  2KE7 A;  5ALI A;  1U45 A;  2C2E A;  4UQG A;  4IRC A;  4UAS A;  3WKE A;  4ELV A;  3MR5 A;  5ALE A;  1N5X A;  5DB7 A;  1RDF A;  2W43 A;  3Q8R B;  5L1M A;  3JPT A;  4DO9 A;  2B0C A;  2KD1 A;  5AKY A;  1JN3 A;  1SWV A;  2BGW A;  3Q8M A;  1RZT A;  4O3P A;  1PVP A;  2AHO B;  4I2J A;  4QZ8 A;  4JK1 A;  2JH1 A;  1JI7 A;  2W7O A;  5DQH A;  1NKB A;  4F93 B;  4USA A;  4PH5 A;  2VA3 A;  4UB8 U;  2DGZ A;  3G6Y A;  4US9 A;  2EAP A;  1IXR A;  4X5V A;  4NLB A;  2E1F A;  3BS5 B;  4RT2 A;  4C8K A;  4F5Q A;  4MEX A;  3JPO A;  3N97 B;  4M9J A;  1WG8 A;  4K4G A;  2P35 A;  2Q4T A;  5AI5 A;  4DL7 A;  3F2D A;  1ZD3 A;  2ZTE A;  3HJE A;  4GLX A;  1TE2 A;  3L3F X;  2HOF A;  2HHT A;  1EXN A;  4PHE A;  2HBL A;  3MR6 A;  3V7J A;  4QZG A;  2PKE A;  1TKD A;  4M9H A;  4DL4 A;  3QUT A;  3OSP A;  5D4B A;  8ICO A;  4P0P A;  3WK5 A;  3PSF A;  2G08 A;  2H3F A;  3M9M B;  4MEY A;  2W9C A;  3DDH A;  2ZIV B;  8ICL A;  5AI8 A;  9ICB A;  4RUC A;  3PX4 A;  4NM1 A;  4OJ6 A;  1ZQW A;  5JRT A;  3EUB 2;  2AGP A;  3N7S C;  2HBK A;  3UMC A;  1C20 A;  5KG2 A;  3K4G A;  5HP4 A;  2HI0 A;  3EWA A;  3F5A A;  1N48 A;  8ICF A;  2KNJ A;  5KTQ A;  5KG1 A;  4RQM A;  3GIM A;  1COO A;  5KFP A;  5KFR A;  4KLS A;  3GIJ A;  7ICU A;  4UB2 A;  2ZJ8 A;  4PJ0 U;  9ICV A;  4P4O A;  4NJ8 A;  3WK7 A;  2W55 A;  1X6J A;  5KFG A;  4DFK A;  2FI1 A;  1D9D A;  1BNP A;  2K4I A;  4FO6 A;  5KNI A;  4YR2 A;  5IIM A;  1C7Y A;  5AI9 A;  8ICK A;  1RM6 C;  1NK4 A;  5DG9 A;  1KTQ A;  5AI6 A;  1FO4 A;  2F44 A;  5KT5 A;  2Y1J A;  1ZJM A;  2RDI A;  1ZQF A;  3ORY A;  5KFK A;  1Z1V A;  2F8K A;  7ICN A;  3IDW A;  4Z6C A;  2PI5 A;  4AYB F;  2NRZ A;  4EX7 A;  4EEL A;  5BOL A;  4B9T A;  5G5H A;  1U4B A;  9ICS A;  9ICN A;  1ZQB A;  4NLK A;  2KK0 A;  5CWR A;  2R8H A;  1FEZ A;  4C0Z A;  3H40 A;  2KP7 A;  4C7Z A;  3UPQ A;  2BZF A;  5CHG A;  3IM1 A;  1GO3 F;  4C8M A;  3SEN A;  4YD1 A;  2A1A A;  2C2R A;  4QWC A;  5HR7 A;  1Z3E B;  4B9U A;  3BS5 A;  4F71 A;  4F4X A;  2KFN A;  2FJ6 A;  5AKJ A;  9ICU A;  1KN5 A;  1ZQE A;  5AK4 A;  1UA0 A;  5CP2 A;  3M9N B;  1ZQN A;  5DGA A;  3WK6 A;  5J2H A;  1WCL A;  5AKE A;  2CXY A;  4GC7 A;  1NK0 A;  1NKE A;  4Y2Y A;  5DDM A;  2VJ4 A;  4RQ5 A;  2DWQ A;  1A6S A;  5DBA A;  2YB4 A;  4RQ0 A;  2F2A B;  1XSP A;  4I2C A;  1XSN A;  9ICE A;  5D49 A;  1MA7 A;  1WWV A;  2W7P A;  2ZIV A;  4I2B A;  1IM4 A;  1QSL A;  4ECZ A;  2HOQ A;  1TK0 A;  3ETL A;  2KZM A;  3LYS A;  3ISB A;  3GV8 B;  2DQN B;  4B9L A;  3RJI A;  5J2J A;  4YP3 A;  3RAX A;  1JMS A;  4NLZ A;  3FAH A;  4KTQ A;  4DWI A;  2KJ9 A;  4US8 A;  3H4D A;  4DQQ A;  4R8U B;  2HHQ A;  1ZQL A;  4ED3 A;  4ACO A;  5J0Y A;  4GFJ A;  5CR0 A;  1N63 A;  3AM9 A;  3I76 A;  3L5K A;  5AKK A;  4QZB A;  3LVV A;  3EPI A;  4M9G A;  2VA2 A;  1X42 A;  1NNL A;  1B43 A;  3HKZ F;  3KOO A;  4RPZ A;  2HHW A;  2EAO A;  1TFR A;  3C2M A;  1L3T A;  5CJ7 A;  2KV2 A;  1SKR A;  4NLC A;  4KLF A;  2XCA A;  3ZD9 A;  4DLE A;  2HDO A;  1DRG A;  2GLE A;  5L9X A;  1FIQ A;  3D2Q A;  2KTQ A;  3AQF A;  4DFM A;  5J0S A;  1KBU A;  7ICI A;  5KFY A;  2VJ5 A;  5ALY A;  3PST A;  2IA6 A;  5KFV A;  4YXM A;  2XY6 A;  4EEY A;  2KEY A;  2ES6 A;  2YML A;  1X9X A;  4J03 A;  8ICW A;  1SIJ A;  4QW8 A;  2WB1 C;  2QAR B;  1PK1 B;  1MC8 A;  4NL9 C;  5IIJ A;  1SB3 C;  1V9P A;  4QZH A;  4YR0 A;  2EQY A;  1D8L A;  2Y9T A;  2LMR A;  4YMM A;  3M9O B;  4QWE A;  2MA1 A;  4GIB A;  1NOM A;  5DB6 A;  2JEJ A;  4IC9 A;  1ZQY A;  3CNH A;  3OJS A;  5F9N A;  1L3U A;  5KG4 A;  1X9M A;  4UAZ A;  2BCU A;  3HRD D;  2OHF A;  1KDH A;  1NJY A;  2E3T A;  3BZK A;  5KG7 A;  4RQ3 A;  4O3M A;  3TAD A;  2NO4 A;  4EEK A;  3RB4 A;  4PPX A;  4RNM A;  5D46 A;  1SZH A;  2PMZ F;  5BPC A;  1F0M A;  2H3I A;  5EWG A;  1MSW D;  8ICN A;  4KLD A;  3GIL A;  2ZJ5 A;  1S76 D;  3RJK A;  3SZ2 A;  1UPH A;  2DKX A;  2HBJ A;  2P66 A;  1ZQX A;  3OHB A;  2NRW A;  1AQ6 A;  2E8M A;  2H3Z A;  2BPG A;  8ICR A;  4ELT A;  2WF7 A;  3C29 A;  5KFN A;  4QW9 A;  1RYS A;  2IOH A;  2HVH A;  4R8U A;  3C5G A;  2LM4 A;  1ZQS A;  4KLU A;  4C8O A;  8ICP A;  2ZUB A;  3LVW A;  2MUT B;  1D9F A;  1BPE A;  5KFA A;  2HMX A;  8ICU A;  5J8Y A;  3FDS A;  2E5S A;  3ICX A;  1SZP A;  5KFT A;  4F5O A;  3AU6 A;  1TV9 A;  1TVA A;  1XNS A;  1WWU A;  1ZOL A;  4UB3 A;  3JPQ A;  1PVQ A;  3RH5 A;  1SV4 A;  4I2F A;  3RJE A;  4CF5 A;  5KFJ A;  5HHH A;  3IN5 A;  1X2I A;  9ICX A;  4B9M A;  1ZQT A;  2W9M A;  4UW9 A;  4F4Y A;  1TAU A;  2NRX A;  2ASJ A;  1ZQO A;  3MGH A;  4DFJ A;  4C4S A;  2ZIX B;  5AM3 A;  3Q8Q B;  2CRX A;  3TFS A;  4IR9 A;  3C5F A;  1ZQP A;  4U6P A;  3RFA A;  2YQE A;  1QQ6 A;  1BGX T;  3SEI A;  3WKA A;  4NM2 A; 
#chains in the Genus database with same CATH homology
 4FZL A;  2JMG A;  4OJP A;  3N7R C;  5CRX A;  3GU3 A;  2KIC A;  4ACO A;  1Z19 A;  4GFJ A;  2E1E A;  2RP5 A;  4AYB F;  2CN1 A;  2KKV A;  2Q4T A;  3DEE A;  3SAH A;  1Q3V A;  2CPR A;  4FZM A;  3F2D A;  2G06 A;  3T79 A;  3CRX A;  5KL1 B;  2JGA A;  3NUQ A;  2G5H B;  4NWI A;  2OXO A;  3L3F X;  4O3M A;  1URJ A;  2F8L A;  2XVT A;  2K8A A;  3LVV A;  2HOF A;  2LYB A;  1XO0 A;  1ED1 A;  2HBL A;  2PMZ C;  4PL1 A;  4C0Z A;  4BUG A;  1T94 A;  2K8C B;  3D2S A;  1SZH A;  2PMZ F;  2VIX A;  3M7D A;  3HKZ F;  1Q3U A;  2MRL A;  2H3I A;  4KX3 A;  1ZQ1 C;  5C0Y A;  2OH2 A;  1ECW A;  3IG8 A;  4KMO B;  2LYA A;  2LHT A;  2ZIX A;  4KX5 A;  4AYB C;  1UPH A;  4P0P A;  2HBJ A;  2HBM A;  3PSF A;  4JMU A;  4A8E A;  2A3V A;  2KV2 A;  3M6K A;  1GO3 F;  2G08 A;  2JH7 A;  2R18 A;  2H3Z A;  2DF4 B;  2H3F A;  4P0Q B;  4NLC A;  4PL2 A;  3KFU F;  2ZIW A;  2KHQ A;  3C29 A;  2Z7J A;  2ZIV B;  5T14 A;  5HR7 A;  2OM6 A;  3H0R B;  3CYM A;  2KHV A;  4OJ6 A;  1DRG A;  1NZB A;  4CRX A;  2JHD A;  3D2N A;  4U7C A;  2ZIU A;  3VCB A;  4CDG A;  3N7P D;  4QNL A;  2W03 A;  3HKZ C;  1OUQ A;  1P7D A;  3D2Q A;  2N1R A;  2XID A;  3ALR A;  2D6F C;  4FE3 A;  2G0A A;  2HBK A;  2ZXH A;  3N7S C;  4QJF B;  2ZG6 A;  2M0N A;  2KJ5 A;  1IIP A;  3AQF A;  1YT3 A;  3LVW A;  3IP4 B;  2XI9 A;  1KBU A;  2G09 A;  3F5A A;  3IG5 A;  3OPX A;  4QIW F;  3F2B A;  2ZXI A;  2WAQ F;  3M6Z A;  2LKY A;  2RRD A;  2VJ5 A;  2HMX A;  2KNJ A;  3PSI A;  2K4E A;  3H0M B;  3K1Z A;  3KZX A;  2LBO A;  2H3Q A;  3SMV A;  2VJ4 A;  5HR6 A;  1WUD A;  3PST A;  2KD1 A;  3SAF A;  4BJQ A;  4OJL A;  1A6S A;  2BDU A;  2GOL A;  4ICA A;  3SAG A;  2E5S A;  2KJ8 A;  2YB4 A;  3ICX A;  2HOI A;  4OJ5 A;  2YB1 A;  4WJ3 B;  2KEY A;  2Y0S F;  2F2A B;  2KVC A;  3NRW A;  2KOB A;  2F77 X;  1XNS A;  1PVQ A;  3F53 A;  1Z1B A;  2KIW A;  1HEK A;  4P0Q A;  1F44 A;  1PVP A;  2WB1 C;  3H0L B;  4QIW C;  1PVR A;  1MA7 A;  2K89 A;  2W04 A;  2W7P A;  2RHF A;  2WAQ C;  2ZIV A;  3IN5 A;  1CRX A;  2JH1 A;  4NV0 A;  2W7O A;  3AL0 B;  3CP8 A;  2K4H A;  2HOQ A;  2WB1 F;  4OJO A;  4CGZ A;  3PSP A;  3AQE A;  2K4I A;  1A0P A;  1HIW A;  3LYS A;  3PZP A;  2G5I B;  2DQN B;  2F76 X;  3ONN A;  3F5E A;  2GH1 A;  2G07 A;  4BX9 C;  2K8B B;  2XIC A;  2ZIX B;  2CRX A;  4P0P B;  2DGZ A;  2MA1 A;  2OYY A;  2Y0S C;  3O0F A;  5KL8 B;  3F2C A;  4OO1 J;  3C28 A;  1D8B A;  2KKP A;  4NLB A;  4IC9 A;  4U6P A;  2ZIW B;  3MGV A;  2H3V A;  2YX8 A;  3RFA A;  2KJ9 A;  2E1F A;  1TAM A;  5A0L A;  4FZN A;  3E0F A;  2NV3 A;  3GZF A;  3VC8 A;  1L6N A;  2VKQ A;  2ZIU B;  3RF9 A;  3SQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...