2Y0SF

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 10
structure length 90
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2y0sF02
2Y0SF 2WAQF 2PMZF 4AYBF 3HKZF 2WB1F
chains in the Genus database with same CATH superfamily
5AK4A 1D8YA 4Y2SA 2ZTCA 4I2JA 3H0LB 1JALA 2DUYA 2G09A 4PZNA 2HHVA 4QZDA 1MQ3A 2OH2A 3OSNA 3K4GA 3THVA 1KFSA 3N7SC 3WKEA 4RPZA 4US8A 3BQ0A 2HOFA 1KEJA 2G0AA 2W11A 3NS1A 4EEYA 5KFJA 2IOFA 3UQ0A 1ZQHA 4O0IA 2EDUA 1X9SA 5AKXA 2K4HA 4FO6A 3UMGA 4B9LA 2Y9TA 4O3MA 1YZ6A 4TQSA 3JPOA 3RB4A 2P66A 4YR2A 4UARA 7ICLA 2WFAA 3VCBA 2HOIA 4WJ3B 1BPXA 3KFUF 3H8JA 1TFRA 4RUCA 3RBEA 2KHQA 4QZBA 2HDOA 4Y2XA 3G6YA 4RQNA 2KVCA 3OGUA 4UBCA 4DWIA 3UMBA 3O0FA 1B0XA 4Y2YA 5ALKA 4RQ7A 4F4XA 3QU2A 1ZQAA 1ZQGA 1BNPA 1F44A 2FPLA 5J0SA 1MA7A 2KZMA 3WK6A 4Y2RA 3F2DA 3OSPA 4ED0A 1BPYA 4DSJA 4JV0A 4P4MA 5AM3A 3T5JA 7ICOA 2MU2A 4DLGA 4K4IA 1SV4A 3MDAA 2CPRA 2AGQA 5IINA 1JXLA 4HAIA 2PFPA 4EEKA 3TAPA 2E8NA 3S6JA 4XQ8A 3PO5A 3E2EA 7ICNA 3K1ZA 1P7DA 5CRXA 5J0UA 1UA0A 9ICLA 4PHDA 5KFHA 2LKYA 5EE3A 2QB1A 3AN1A 2WTFA 1Q3VA 4NY8A 3QUBA 2KJ8A 3LVWA 4PHPA 2P35A 3AM9A 5DBCA 2GWSA 1NKEA 2PXIA 1VDVA 4MFFA 1N2XA 4I2BA 1ZD2P 2IOFK 5AI6A 4EX6A 1QH9A 2BCQA 1ZQEA 1ZQUA 2XI9A 4BX9C 1U9LA 1NKCA 2JR5A 4C4SA 4C0ZA 4UB1A 3T5LA 1U47A 2KD1A 7ICMA 4F2RA 3EWAA 5AKGA 4UB4A 5AK6A 1PVQA 3ISDA 4UAVA 2BCRA 3BDPA 3MC1A 4J9OA 1ZQOA 2RRDA 2M0NA 3AUOA 5KFBA 1ZQKA 3BS7A 4RQ2A 1NKBA 3PX6A 5CB1A 1QQ7A 2WF5A 1ZQRA 5TISU 4Y2TA 2E5SA 4IRCA 4R8UA 2NRTA 1X9MA 4ELVA 2R8GA 3GILA 1B22A 3M6KA 2H3ZA 5CJ7A 1UPHA 2RLTA 2W7OA 4M6WB 4F4WA 1WUDA 5AIAA 1L7NA 2BDPA 4ZOHC 2K8AA 3RF9A 3H0MB 4UAWA 3TARA 4X5VA 1L6NA 3GDXA 2JGAA 2YQEA 1K1QA 3PX4A 2LYBA 4TQRA 5KFPA 4GLXA 2ZTEA 1YT3A 3UQ2A 1ZQPA 2KFZA 1T4GA 2C2EA 3V7LA 5HNKA 1SKRA 3RFAA 4NLBA 1SZPA 3SYZA 2CN1A 1S0NA 2ODGA 3TKAA 1VLBA 5J29A 3JPSA 3AQEA 2F3NA 4A8EA 4FS2A 3ICXA 3M9OB 3WK5A 2PFNA 2KSOA 3V6KA 2OXOA 3TAQA 5GTHU 4F92B 3R9KA 2F44A 4YVZA 4TUPA 9ICUA 4F93B 2W9AA 4DFPA 5J2AA 3T3FA 5ALNA 3RB6A 1LKYB 5E79U 1BPBA 4I2EA 1Z1VA 2BCUA 2KZ3A 3NVVA 5DBBA 5JRTA 3QUCA 5D46A 4OJ6A 4Q8EA 3NVZA 4KLLA 3IG5A 4M9JA 9ICQA 4KTQA 2YTUA 3QU9A 2KMDA 3M7DA 4DCCA 5J0PA 3H4BA 4F5RA 2QKQA 1TK8A 1WWUA 3PSFA 5FP0A 1KBUA 1ZQFA 2GLEA 5EE9A 2XY5A 1DK3A 1RZTA 3GU3A 2E1FA 5KFOA 1L7OA 4UB5A 1NJYA 1TAQA 3RJIA 4KN4A 2HHWA 4KLUA 3C2LA 4O5EA 5KFYA 5DKWA 1UHUA 5JUMA 4RQ1A 4UBBA 2F8KA 9ICWA 1O08A 3MR3A 2XICA 2IOHA 3V7KA 3C28A 5KFMA 5KFKA 1X6IA 3HWTA 2DQNB 1SL0A 1KFDA 2YN4A 2KZZA 2IHMA 3BQ7A 2W3SA 4I2DA 1H38A 1PK1A 5F9LA 2F8LA 2FMSA 5J0WA 2AQ0A 2G07A 4MHVA 1WCLA 2ZXIA 1SGGA 1WWVA 2O6KA 1IXRA 1S97A 4F5OA 2VA2A 3V6JA 2W9BB 3RJHA 4F4YA 2W55A 5AICA 9ICSA 4LVSA 2EZXA 3EUB2 1S8OA 4EBEA 3TI0A 3H40A 4KLFA 3QZ7A 8ICLA 5AM1A 1SWWA 3I28A 5C5JA 4DL7A 3GZFA 4M2YA 5J0TA 7ICJA 3F5EA 5L9XA 3Q8LA 3UXPA 4ECWA 1U45A 3F2BA 1SB3C 1SKWA 5F9NA 5KFSA 4DQSA 2V4RA 4ECXA 4OJ5A 8ICWA 4MF8A 4I2CA 2HVIA 4NV0A 2Z7JA 1TK0A 5J2HA 5KFLA 1CUKA 3IHQB 5KFRA 2WF7A 1KL9A 3SQIA 4UATA 3QEBZ 4KLTA 4IR9A 3MGIA 4C8OA 5HMLA 5KFQA 1HJPA 1MQ2A 4YMNA 3ED5A 4B9MA 2K89A 3QYPA 3OHAA 5DDMA 1TV9A 1X9WA 3U26A 5DB7A 2OWOA 5JU5A 1NJZA 2DWQA 2LMRA 4M9NA 3GIJA 3J81j 2PFOA 4FS1A 4GIBA 5J2EA 1FFUA 2KFNA 2WF8A 5BOMA 3H8SA 1DRGA 4QZGA 1UQVA 1SL2A 4EYIB 2BCSA 2WAQC 3E58A 3UXNA 3PW4A 4BWMA 2DKXA 3IN5A 3F5AA 1FFVA 4LZGA 1C20A 4I2GA 4O3PA 3OJSA 9ICNA 4NLGA 3MGVA 3BS5A 1JXEA 4R8UB 2ZIVB 2W43A 2JV3A 2CRXA 9ICXA 3PMLA 1BPZA 4DEZA 1BVSA 2PMZC 1RXVA 4F5NA 4UAZA 4QWEA 2C2DA 4NLZA 3PSPA 5KT2A 7ICHA 1HEKA 2NRZA 2NRVA 1ZQTA 1DK2A 4Y2JA 1QSLA 2XY6A 5A0LA 5DQHA 2IMWP 1NK9A 3RRGA 4K4GA 5ALSA 4MF2A 1Z4NA 2IHNA 4YG2A 1ZXIA 4AYBC 8ICXA 3IDWA 3WKDA 1ED1A 4KLQA 4YD2A 2B6GA 5KFVA 2XCAA 3WK4A 7ICIA 1DGJA 2GOLA 3QNMA 4RUAA 4IRKA 2FLLA 4NL9A 1J2NA 2YMQA 1COOA 8ICHA 4XA5A 1X42A 1BPDA 3UM9A 9ICKA 2ASJA 4CRXA 2ZJAA 3UPQA 3SR6A 3WK9A 4OO1J 2YB1A 5J2FA 1Z19A 3IG8A 4B6JA 1L7PA 4DSIA 2FE9A 4QJFB 1L7MA 2EAMA 3ZDCA 3C5FA 2JHDA 4F2SA 2DKZA 4DL5A 2HHSA 4U7CA 5EWGA 2IBKA 1KSPA 5DQIA 2KVSA 1URJA 5L1LA 2BCVA 4PH5A 5HHHA 1J2MA 3QE9Y 4KLSA 4FZLA 2G08A 5AKYA 2F2AB 4UAUA 3UXOA 2KNJA 1AROP 2HBMA 3WKBA 2W9BA 8ICIA 4UASA 2WHEA 1NZPA 3PNCA 1BNOA 5DGAA 5AKHA 3FYHA 4YP3A 1T3QA 2XGPA 3EZ5A 4QIWC 4I2AA 5L1JA 4KLJA 1PVRA 2LHTA 1Q46A 2V9WA 5KFTA 4IS7A 3RB0A 5KG3A 3RH6A 3V7JA 3SAFA 3L3FX 2EANA 3LK9A 2KK0A 2VJ4A 9ICPA 4DLEA 2K8BB 2YY6A 1NK6A 1FIQA 4YCXA 4IQUA 4BXOB 4JV2A 2FMQA 4F72A 5ALYA 2D8CA 8ICVA 1Z00A 2R8IA 3M9MB 2C22A 1KN5A 4GXKA 4YFKA 1S9FA 3KKAA 3RBDA 4ICAA 4LJXA 3M9NB 1FEZA 4C8MA 3QZ8A 4RNOA 2K4PA 3Q8PB 1U4BA 1LVHA 4PZOA 3GV7B 3WK7A 3WKAA 4O3SA 1X40A 3RRHA 3PW7A 4B9TA 5J2JA 5H2FU 1K1SA 4KX3A 4J9LA 5KT6A 5AK5A 4F91B 3SD7A 2NYVA 5ALZA 3TADA 3JPQA 3ORYA 3C23A 1GO3F 8ICRA 3BQTA 3SMVA 4JV1A 5J0QA 2NO4A 1CI4A 2A1JB 3WKCA 5HMMA 3HW8A 3KZIU 2HBKA 3C5GA 1ZYQA 3TACB 2FDRA 5ALVA 3WK8A 2XC9A 4QZHA 2PI5A 2ZIXA 2XGQA 3GIIA 4M0AA 4CGZA 3SEIA 1WYGA 3C21A 3HPOA 8ICBA 5KFDA 3SAHA 3BZKA 2KG5A 3BS5B 1N5WA 5DB9A 4IQWA 4DOAA 3CP8A 4YXMA 4RQMA 1F5SA 1MSWD 9ICEA 5HR6A 3AEVA 2OEHA 5ALPA 2G5HB 1KQQA 2A19A 4YXJA 4OJOA 4YQWA 1HUOA 5IIIA 4ECYA 2GH1A 3IV6A 2UVUA 4R64A 4IR1A 3Q8SB 1ZQNA 2W54A 4R63A 3Q8KA 3RJKA 5KT3A 2Y0SC 5DG9A 3LDAA 2Y1JA 1T7PA 3TADC 2RDJA 4BWJA 1JIHA 2Y0SF 1ZQLA 2PKEA 5KFWA 1ZQVA 3HRDD 9ICCA 2EAPA 3C1YA 4ECUA 2JXJA 4BDPA 3G6XA 4NLCA 4J9SA 2JEIA 8ICQA 2H3IA 1KKXA 8ICJA 2XCPA 7ICGA 2HMXA 5DBAA 9ICVA 2MAXA 4Q8FA 2AHOB 4TURA 4DSLA 2DF4B 4RQ6A 4ECVA 2Q0ZX 2KP7A 8ICAA 5ALEA 1CRXA 5KT4A 3CRXA 4M9LA 4F4KA 5KG7A 4ECQA 3ZD8A 3RR8A 4ED8A 2I5HA 4MEXA 4YR3A 2HVHA 2DBYA 4DL6A 3ONNA 5AKKA 3MBYA 4UAYA 1X6JA 2E8MA 2KIVA 2K4EA 4NWIA 8ICTA 2HHTA 4GXIA 4ECSA 1X2IA 2V4QA 4ELUA 1A0PA 2W9CA 3ZDBA 2ZXHA 1XS9D 5TZVA 4KLDA 4JUZA 3RJEA 1ZETA 5BOLA 4RQ8A 1OW5A 4EELA 2VANA 2ZIWA 4DSFA 5ALOA 4Z6CA 7ICUA 2ZUDA 1L3UA 1ZJMA 3KHHA 1CEZA 2ZUBA 3RB3A 5EWEA 3I76A 3BQ2A 4ECZA 1D9DA 2PFQA 1BGXT 4BXOA 4QZIA 2KV2A 2E8PA 3NRWA 1N56A 4FBTA 5KG4A 1V9PA 3HT3A 4O3NA 1ZQBA 1SWVA 3HILA 1HUZA 3IRUA 5ALFA 3BZCA 4KITB 3K1RB 4PGYA 5CEHA 2JH1A 9ICRA 4KLIA 2KTQA 1Q3UA 5AI4A 1A77A 4RQ5A 4JB3A 4RZRA 3EPIA 1TAMA 2P6RA 4U6PA 5ALUA 2G5IB 1N61A 3N97B 5KFFA 4ZH4A 3PMNA 5J8YA 1Z00B 9ICGA 4FE3A 2ISPA 4P0PB 4LZDA 2H3VA 3RJGA 4J03A 1MC8A 3KHLA 7ICEA 5BPCA 4IQVA 4J9RA 1S10A 1ZOLA 2UVVA 1QLNA 5ALXA 1NK7A 4B9NA 2A1JA 1JUDA 1L8LA 2Y9UA 1L8OA 2HCFA 4UB6U 3SZ2A 4CF3A 2ZG6A 3ALRA 3PY8A 4RNMA 4QWBA 2P6UA 5L1KA 4RPXA 7ICQA 4DF8A 1TAUA 5DB6A 4BJQA 3Q8RB 3TANA 1Y88A 1XNSA 2UVWA 4F50A 3FC4A 1DOQA 3D2QA 1NK8A 3NUQA 2YB4A 2LBOA 3T79A 3HKZF 5AKEA 5J0OA 4I2FA 2W9MA 1FO4A 3ZD9A 3T5HA 1V38A 4QZ8A 5KFUA 1WG8A 1TKDA 4KLEA 2EH9A 4XUSA 1XO0A 3L4PA 3C2MA 4O5KA 4Y2VA 9ICFA 3NTUA 4DFKA 3ISCA 3RAXA 4KLGA 1NOMA 1PK3A 4NLKA 2A3VA 1U48A 1RXWA 3LWMA 2J6TA 2BZFA 2HHXA 1NI3A 3PR5B 3M6ZA 5AI9A 3PX0A 2LYHA 3PZPA 3LYSA 5IIMA 5G5GA 5ALLA 1XSPA 2W3RA 4CF5A 2L5YA 4K4HA 4GC7A 3PV8A 4USAA 5DLGA 2RDIA 3MR6A 1SV0A 4DQQA 2AJQA 4UW9A 4ECTA 2E1EA 2KKVA 3MFIA 3PW5A 4QZCA 3H7IA 2AGPA 3B0YA 5AM2A 9ICBA 1U49A 5KG6A 3D2SA 3RH4A 5EE1A 3F2CA 1X66A 2XVTA 2K60A 5JTIA 4PPXA 4PJ0U 1EXNA 4O9MA 2ISOA 3PSTA 3M1YA 2D6FC 2KJ9A 2LPEA 5CA7A 2BPGA 5J8YC 4JMUA 1S76D 1S5LU 2F1IA 4JK1A 2HBJA 3GIMA 9ICJA 4J9NA 2AXTU 2BR0A 1C7YA 2KE7A 1XSLA 4I2HA 1ZD5A 1ZQWA 4EENA 7ICSA 4DFDA 1N63A 1ZQMA 1S0VA 9ICAA 2ASLA 4CNQA 3TFSA 8ICFA 2WB1F 5KT7A 4P4PA 4EZ9A 3FAHA 2NRXA 3NVYA 5ALJA 9ICTA 1BPEA 1PK1B 1V97A 2OHFA 3RAQA 1Q8KA 3ETRA 4O3OA 4NM1A 1IM4A 1N60A 4O5CA 8ICCA 4RU9A 4PHEA 3RR7A 2ZIWB 8ICEA 5B66U 1ZD3A 5HHIA 2WAQF 5HP4A 2DPIA 2FMPA 2R8JA 4RQ4A 2LM1A 2EZYA 1K5OA 2NRWA 1ZRMA 5J0YA 2N1RA 1RYSA 2WF6A 3H4DA 3AL0B 1ZQQA 1Z1BA 3IP4B 4M47A 3A0HU 1WCNA 5AKIA 2KICA 2FI1A 3PO4A 3C29A 2C28A 3M8RA 4DQRA 4Z6DA 5KFEA 3E0FA 4C8NA 3WU2U 1L3SA 5KL8B 2XO7A 3BQ1A 1L3TA 2HI0A 4P4OA 2KOBA 1RDFA 4C7ZA 4FZMA 2H3FA 4R65A 2HSZA 8ICSA 1QQ5A 4MFAA 3MR2A 3N7PD 1UT5A 4KLMA 2JMGA 4RNNA 4KN7A 8ICNA 4Y2PA 5J2KA 2BGWA 1XC9A 7ICRA 1T94A 3AQFA 4DS4A 4RT3A 4UB8U 3EYZA 4P0PA 4DL2A 4QZ9A 2RHFA 2DGZA 1HIWA 4B9VA 2IA6A 5J0XA 3SENA 3I1YA 4RPYA 2J6UA 5AHXA 1T8EA 4OJPA 4ED1A 5IIKA 5ALQA 1ZQXA 1JX4A 1NJXA 9ICMA 7ICPA 3ZDAA 2ZTDA 5AK3A 1N48A 2VKQA 2YMMA 2RQ5A 4DS5A 3QEAZ 2DL0A 2ZJ8A 4NLNA 2VA3A 2LI6A 1DGSA 2KKPA 1ZQYA 1ZQDA 2F76X 3KBBA 2ZIVA 1QTMA 5KG5A 2HBLA 2AGOA 2YMLA 5KFZA 3OTQA 8ICMA 3C1ZA 3NRZA 2G06A 3ISBA 1IG6A 3RJJA 1JMSA 2QB0A 4ELTA 1ZRNA 4DOBA 1Z3EB 5KTQA 1ECWA 1NNLA 2MRLA 5KFXA 4F3OA 1SIJA 4OD0A 2D3DA 3B9JA 4C8LA 4I2IA 2FLPA 2JH7A 4QZAA 3HKZC 3GV8B 4M9HA 5KG1A 2DFLA 1LB2B 2BHNA 3V6HA 5J0RA 4F5PA 2H3QA 1Z4OA 1A6SA 4J9PA 1AQ6A 2HOQA 4IQTA 1D8BA 3H8WA 1RQLA 1KDHA 2EAOA 1NK5A 4J9MA 1ZQ1C 4ED2A 4Q43A 2R8HA 2W03A 5KG2A 4Q44A 1JN3A 3GV5B 5DB8A 2KIWA 3MGHA 5ALDA 4TUSA 4QW9A 4C8KA 1QQ6A 3KHGA 5DGBA 2W7PA 4ED7A 2B21A 1KFTA 1SZHA 1QSSA 8ICKA 4QZEA 1M6YA 2WB1C 3ZI4A 3IM1A 5L1IA 3SI8A 2ZIUA 2LM4A 3QU5A 3MDCA 1B43A 5AM5A 2EZZA 4DOCA 8ICGA 4BUGA 1PZNA 1F0MA 2QB0B 4EX7A 4DFMA 2JEJA 3LWLA 1NK4A 4NXZA 1YZ7A 3ZDEA 2K8CB 2ZIXB 2M9NA 2BKEA 2J6SA 3AMZA 4BGDA 7ICKA 5EE0A 3K75D 1D8LA 2RP5A 9ICHA 3KD3A 5AM0A 2OYYA 1QSYA 2BQRA 3ZDDA 3SV4A 2ASDA 4HYKA 1XWLA 2BPCA 5KL1B 3JPPA 5B5EU 5J2IA 3Q8QB 1O03A 4DL3A 8ICOA 2BQ3A 1ZD4A 2VIXA 3DDHA 5D4BA 1LKYA 4XRHA 2QLTA 1UA1A 3DV9A 1ZJNA 4O3RA 2KN7A 3RH5A 3KKAC 1TVAA 1SXDA 4Z6FA 1RYRA 4F5QA 1X9XA 4DFJA 2KSOB 1RG6A 1VJ5A 3PW2A 2ES6A 4P0QB 2FJ6A 4P2HA 3C2KA 1IV8A 1JRPA 2BQUA 5ALMA 1J97A 2MSNA 2EQYA 2W04A 5AI5A 2ZIUB 1LV5A 4E0DA 2E8OA 1RM6C 4MEYA 4I29A 5CHGA 4Y2QA 2ATLA 5ALRA 2ZJ5A 3D2NA 4QZFA 2CXYA 2I9GA 4GFJA 5DG7A 4I27A 4JWMA 2FPMA 7ICFA 2OM6A 2W9CB 3L5KA 3EPGA 1OXJA 1KTQA 2JEFA 4G9BA 5J2BA 4TUQA 4PL2A 1JROA 2QARB 3OPXA 4PGXA 5J2GA 7ICTA 4EBCA 8ICUA 1OUQA 4CF4A 2FPKA 5IILA 3ETLA 1KRPA 1ZQZA 2AH5A 1ZQJA 4QWDA 3QUQA 1ZQCA 4FZNA 3PW0A 3A0BU 4PL1A 2JEGA 3JPRA 4PHAA 5K4LA 5AKZA 3SV3A 4NM2A 5IIOA 4DQPA 4NL9C 2MUTB 4DL4A 5KAFU 1A76A 5DDYA 4IC9A 5KFNA 2JRZA 4J9KA 5KAIU 1S77D 4Q45A 1N5XA 4CDGA 2JZBB 3JPNA 5CP2A 1COKA 5AIBA 2W8KA 3PVXA 4YR0A 5ALIA 2F1JA 4KLOA 3HX0A 2BPFA 3FM9A 2Q4TA 2KEYA 1ZQSA 8ICPA 2HW3A 1UCVA 3TQ1A 4CCHA 4KMOB 3DEEA 2KHVA 3HJEA 5HR7A 2XY7A 4EYHB 3NVWA 3N7RC 5ALHA 3MFHA 2H5XA 4KLHA 3UMCA 2A1AA 2XIDA 5KNIA 1TK5A 3VC8A 1NK0A 4YD1A 5T14A 4CE6A 2QARA 3RTVA 1V85A 3CYMA 3AU2A 3GQCA 1JI7A 3LVVA 4C7YA 4M04A 4OJLA 3H0RB 3KZXA 2E3TA 4ED3A 3N4MB 4B9UA 5C0YA 1NZBA 5J2DA 4M9GA 2VJ5A 1SXEA 3B0XA 4F4ZA 5AKLA 4GC6A 2ESEA 4QNLA 3G6VA 2FLNA 3TFRA 4Z6EA 5ALWA 4RT2A 1RYUA 2JZBA 2I1QA 2R18A 1XU4A 4OCZA 5ALGA 4US9A 4C80A 2NO5A 2I6XA 5DG8A 3PSIA 4AP9A 5DQGA 2VA8A 4O3QA 2YMPA 3QU7A 5EWFA 4G3IA 1NJWA 1SKSA 5AM4A 2HHQA 1ZQIA 3OJUA 1TE2A 1DXSA 2F77X 4QWAA 4EBDA 4FBUA 2GO7A 2KJ5A 2B0CA 1S0MA 3CNHA 4I28A 2OCEA 2AQ4A 4F8RA 4EZ6A 1N62A 3OHBA 5EOZA 1L3VA 3QUTA 2NV3A 4UB3A 1KLNA 4YMMA 4KMUA 4ECRA 1RQNA 4AYBF 3KHRA 3JPTA 2Y1IA 3GIKA 2K4IA 5DLFA 4DF4A 5KFAA 3RJFA 4DO9A 1QCKA 2F1HA 4ACOA 5AI0A 4NJ8A 5KFCA 4RQ0A 4UB2A 8ICYA 5KG0A 2PMZF 2W8LA 5AI8A 5G5HA 2YX8A 3NASA 4UQGA 4DQIA 2MA1A 4M6WA 3QU4A 2UVRA 5D49A 1B4FA 3QXGA 4DSKA 3PR4A 3N28A 3D6JA 2R8KA 5GTIU 1XSNA 1UT8A 3NGDA 9ICIA 3HP6A 4QIWF 4FFDA 5L1MA 5ALTA 4C4TA 4ED6A 5AKJA 1IIPA 4QWCA 3AU6A 5KT5A 5J2CA 3CW2C 4PGQA 3T5KA 5F3XB 4YN4A 1L5UA 4Y2UA 4YMOA 5KFIA 3M8SA 5IIJA 2PI4A 4B9SA 1SL1A 9ICOA 2LYAA 3V72A 4IRDA 3F53A 1XO1A 4GXJA 2ALZA 2C2RA 3GFKB 4F71A 4P0QA 1MN8A 3H8MA 2ZUCA 3KOOA 4R66A 4QW8A 1PVPA 4KX5A 4JWNA 1KW4A 3FDSA 2WF9A 1T3NA 4J9QA 3Q8MA 2BDUA 2HHUA 5KFGA 3BJYA 8ICZA 1PUZA 2DPJA 7ICVA 1RPLA 5CWRA 3QX7A 3KTQA 4DSEA 1SV0C 4RQ3A 1D9FA 3MR5A 3SAGA 4MFCA 2MUTA 3EW9A 4IL6U 2AU0A 3MABA 4C4RA 5CR0A 1S0OA
chains in the Genus database with same CATH topology
2ZG6A 2KJ9A 4P0QB 3ALRA 2H3QA 2K8BB 3C28A 1A6SA 3N7PD 1A0PA 4ACOA 4CRXA 2DQNB 2JMGA 3H0LB 2G09A 3N7RC 2HOQA 3CP8A 3K1ZA 1P7DA 4JMUA 5CRXA 1D8BA 1YT3A 2ZXHA 2OH2A 4OO1J 5HR6A 1DRGA 2HBJA 2W04A 2YB1A 4BJQA 1Q3VA 2LKYA 2G5HB 2XIDA 3IG8A 1T94A 1Z19A 2ZIUB 2PMZF 3RFAA 1XNSA 3VC8A 3N7SC 4NLBA 2YX8A 2F8LA 1ZQ1C 3AQFA 2MA1A 4OJOA 2WAQC 2CN1A 2G07A 2ZIWA 5T14A 2HOFA 4QJFB 3D2QA 2G0AA 4ICAA 4P0PA 2W03A 2GH1A 2RHFA 3NUQA 2YB4A 3AQEA 2DGZA 2LBOA 1HIWA 3CYMA 2ZXIA 3D2NA 3F5AA 2KJ8A 3HKZF 2JHDA 3LVWA 3IN5A 4A8EA 2KIWA 2K4HA 5C0YA 3ICXA 4GFJA 3LVVA 2WB1F 2W7PA 4OJPA 2Y0SC 4U7CA 3MGVA 4O3MA 4QIWF 4OJLA 3H0RB 3KZXA 2OXOA 1SZHA 1IIPA 2OM6A 2KV2A 2WB1C 2ZIVB 3VCBA 1NZBA 2Y0SF 1XO0A 2HOIA 1URJA 3NRWA 2CRXA 2VJ5A 4WJ3B 2ZIUA 4KX3A 3KFUF 4QNLA 2XI9A 2VKQA 4BX9C 2PMZC 4PL2A 2ZIWB 4C0ZA 2KHQA 2KD1A 3OPXA 4BUGA 4FZLA 2G08A 2WAQF 3GZFA 3PSPA 2A3VA 1OUQA 1PVQA 2F2AB 1HEKA 4NLCA 2KNJA 2KVCA 2LYAA 2R18A 3F5EA 3F53A 2K8CB 2ZIXB 4OJ6A 2H3IA 1GO3F 2RRDA 2M0NA 4FZNA 2HBMA 2KKPA 3IG5A 3M6ZA 2F76X 2HMXA 2JH1A 2RP5A 3O0FA 3PSIA 4PL1A 5A0LA 3F2BA 2ZIVA 3SMVA 2OYYA 2N1RA 3LYSA 3PZPA 1Q3UA 2HBLA 3M7DA 4P0QA 2DF4B 3AL0B 1Z1BA 2E5SA 4AYBC 3IP4B 1TAMA 1PVPA 3PSFA 2HBKA 4OJ5A 2G5IB 5KL1B 4U6PA 1F44A 4KX5A 1KBUA 2G06A 1CRXA 1MA7A 4IC9A 2D6FC 2KICA 2F77X 3CRXA 2BDUA 4QIWC 1ED1A 2KJ5A 3M6KA 2E1EA 2KKVA 4NV0A 4CDGA 3F2DA 2Z7JA 2H3ZA 3C29A 1UPHA 3GU3A 2VIXA 2E1FA 2ZIXA 2W7OA 4FE3A 1PVRA 2LHTA 1ECWA 1WUDA 3E0FA 2MRLA 2GOLA 4CGZA 2H3VA 3SQIA 4P0PB 2NV3A 2Q4TA 2K8AA 5KL8B 3RF9A 3ONNA 2KEYA 3H0MB 3D2SA 2CPRA 4AYBF 2KOBA 2JH7A 3F2CA 3T79A 1L6NA 2K4EA 2H3FA 3HKZC 4FZMA 2XVTA 4NWIA 3SAFA 3SAHA 3L3FX 2K4IA 3SAGA 2JGAA 4KMOB 2VJ4A 2K89A 3DEEA 2KHVA 3PSTA 5HR7A 2LYBA 2XICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S F;  2WAQ F;  2PMZ F;  4AYB F;  3HKZ F;  2WB1 F; 
#chains in the Genus database with same CATH topology
 5AK4 A;  1D8Y A;  4Y2S A;  2ZTC A;  4I2J A;  3H0L B;  1JAL A;  2DUY A;  2G09 A;  4PZN A;  2HHV A;  4QZD A;  1MQ3 A;  2OH2 A;  3OSN A;  3K4G A;  3THV A;  1KFS A;  3N7S C;  3WKE A;  4RPZ A;  4US8 A;  3BQ0 A;  2HOF A;  1KEJ A;  2G0A A;  2W11 A;  3NS1 A;  4EEY A;  5KFJ A;  2IOF A;  3UQ0 A;  1ZQH A;  4O0I A;  2EDU A;  1X9S A;  5AKX A;  2K4H A;  4FO6 A;  3UMG A;  4B9L A;  2Y9T A;  4O3M A;  1YZ6 A;  4TQS A;  3JPO A;  3RB4 A;  2P66 A;  4YR2 A;  4UAR A;  7ICL A;  2WFA A;  3VCB A;  2HOI A;  4WJ3 B;  1BPX A;  3KFU F;  3H8J A;  1TFR A;  4RUC A;  3RBE A;  2KHQ A;  4QZB A;  2HDO A;  4Y2X A;  3G6Y A;  4RQN A;  2KVC A;  3OGU A;  4UBC A;  4DWI A;  3UMB A;  3O0F A;  1B0X A;  4Y2Y A;  5ALK A;  4RQ7 A;  4F4X A;  3QU2 A;  1ZQA A;  1ZQG A;  1BNP A;  1F44 A;  2FPL A;  5J0S A;  1MA7 A;  2KZM A;  3WK6 A;  4Y2R A;  3F2D A;  3OSP A;  4ED0 A;  1BPY A;  4DSJ A;  4JV0 A;  4P4M A;  5AM3 A;  3T5J A;  7ICO A;  2MU2 A;  4DLG A;  4K4I A;  1SV4 A;  3MDA A;  2CPR A;  2AGQ A;  5IIN A;  1JXL A;  4HAI A;  2PFP A;  4EEK A;  3TAP A;  2E8N A;  3S6J A;  4XQ8 A;  3PO5 A;  3E2E A;  7ICN A;  3K1Z A;  1P7D A;  5CRX A;  5J0U A;  1UA0 A;  9ICL A;  4PHD A;  5KFH A;  2LKY A;  5EE3 A;  2QB1 A;  3AN1 A;  2WTF A;  1Q3V A;  4NY8 A;  3QUB A;  2KJ8 A;  3LVW A;  4PHP A;  2P35 A;  3AM9 A;  5DBC A;  2GWS A;  1NKE A;  2PXI A;  1VDV A;  4MFF A;  1N2X A;  4I2B A;  1ZD2 P;  2IOF K;  5AI6 A;  4EX6 A;  1QH9 A;  2BCQ A;  1ZQE A;  1ZQU A;  2XI9 A;  4BX9 C;  1U9L A;  1NKC A;  2JR5 A;  4C4S A;  4C0Z A;  4UB1 A;  3T5L A;  1U47 A;  2KD1 A;  7ICM A;  4F2R A;  3EWA A;  5AKG A;  4UB4 A;  5AK6 A;  1PVQ A;  3ISD A;  4UAV A;  2BCR A;  3BDP A;  3MC1 A;  4J9O A;  1ZQO A;  2RRD A;  2M0N A;  3AUO A;  5KFB A;  1ZQK A;  3BS7 A;  4RQ2 A;  1NKB A;  3PX6 A;  5CB1 A;  1QQ7 A;  2WF5 A;  1ZQR A;  5TIS U;  4Y2T A;  2E5S A;  4IRC A;  4R8U A;  2NRT A;  1X9M A;  4ELV A;  2R8G A;  3GIL A;  1B22 A;  3M6K A;  2H3Z A;  5CJ7 A;  1UPH A;  2RLT A;  2W7O A;  4M6W B;  4F4W A;  1WUD A;  5AIA A;  1L7N A;  2BDP A;  4ZOH C;  2K8A A;  3RF9 A;  3H0M B;  4UAW A;  3TAR A;  4X5V A;  1L6N A;  3GDX A;  2JGA A;  2YQE A;  1K1Q A;  3PX4 A;  2LYB A;  4TQR A;  5KFP A;  4GLX A;  2ZTE A;  1YT3 A;  3UQ2 A;  1ZQP A;  2KFZ A;  1T4G A;  2C2E A;  3V7L A;  5HNK A;  1SKR A;  3RFA A;  4NLB A;  1SZP A;  3SYZ A;  2CN1 A;  1S0N A;  2ODG A;  3TKA A;  1VLB A;  5J29 A;  3JPS A;  3AQE A;  2F3N A;  4A8E A;  4FS2 A;  3ICX A;  3M9O B;  3WK5 A;  2PFN A;  2KSO A;  3V6K A;  2OXO A;  3TAQ A;  5GTH U;  4F92 B;  3R9K A;  2F44 A;  4YVZ A;  4TUP A;  9ICU A;  4F93 B;  2W9A A;  4DFP A;  5J2A A;  3T3F A;  5ALN A;  3RB6 A;  1LKY B;  5E79 U;  1BPB A;  4I2E A;  1Z1V A;  2BCU A;  2KZ3 A;  3NVV A;  5DBB A;  5JRT A;  3QUC A;  5D46 A;  4OJ6 A;  4Q8E A;  3NVZ A;  4KLL A;  3IG5 A;  4M9J A;  9ICQ A;  4KTQ A;  2YTU A;  3QU9 A;  2KMD A;  3M7D A;  4DCC A;  5J0P A;  3H4B A;  4F5R A;  2QKQ A;  1TK8 A;  1WWU A;  3PSF A;  5FP0 A;  1KBU A;  1ZQF A;  2GLE A;  5EE9 A;  2XY5 A;  1DK3 A;  1RZT A;  3GU3 A;  2E1F A;  5KFO A;  1L7O A;  4UB5 A;  1NJY A;  1TAQ A;  3RJI A;  4KN4 A;  2HHW A;  4KLU A;  3C2L A;  4O5E A;  5KFY A;  5DKW A;  1UHU A;  5JUM A;  4RQ1 A;  4UBB A;  2F8K A;  9ICW A;  1O08 A;  3MR3 A;  2XIC A;  2IOH A;  3V7K A;  3C28 A;  5KFM A;  5KFK A;  1X6I A;  3HWT A;  2DQN B;  1SL0 A;  1KFD A;  2YN4 A;  2KZZ A;  2IHM A;  3BQ7 A;  2W3S A;  4I2D A;  1H38 A;  1PK1 A;  5F9L A;  2F8L A;  2FMS A;  5J0W A;  2AQ0 A;  2G07 A;  4MHV A;  1WCL A;  2ZXI A;  1SGG A;  1WWV A;  2O6K A;  1IXR A;  1S97 A;  4F5O A;  2VA2 A;  3V6J A;  2W9B B;  3RJH A;  4F4Y A;  2W55 A;  5AIC A;  9ICS A;  4LVS A;  2EZX A;  3EUB 2;  1S8O A;  4EBE A;  3TI0 A;  3H40 A;  4KLF A;  3QZ7 A;  8ICL A;  5AM1 A;  1SWW A;  3I28 A;  5C5J A;  4DL7 A;  3GZF A;  4M2Y A;  5J0T A;  7ICJ A;  3F5E A;  5L9X A;  3Q8L A;  3UXP A;  4ECW A;  1U45 A;  3F2B A;  1SB3 C;  1SKW A;  5F9N A;  5KFS A;  4DQS A;  2V4R A;  4ECX A;  4OJ5 A;  8ICW A;  4MF8 A;  4I2C A;  2HVI A;  4NV0 A;  2Z7J A;  1TK0 A;  5J2H A;  5KFL A;  1CUK A;  3IHQ B;  5KFR A;  2WF7 A;  1KL9 A;  3SQI A;  4UAT A;  3QEB Z;  4KLT A;  4IR9 A;  3MGI A;  4C8O A;  5HML A;  5KFQ A;  1HJP A;  1MQ2 A;  4YMN A;  3ED5 A;  4B9M A;  2K89 A;  3QYP A;  3OHA A;  5DDM A;  1TV9 A;  1X9W A;  3U26 A;  5DB7 A;  2OWO A;  5JU5 A;  1NJZ A;  2DWQ A;  2LMR A;  4M9N A;  3GIJ A;  3J81 j;  2PFO A;  4FS1 A;  4GIB A;  5J2E A;  1FFU A;  2KFN A;  2WF8 A;  5BOM A;  3H8S A;  1DRG A;  4QZG A;  1UQV A;  1SL2 A;  4EYI B;  2BCS A;  2WAQ C;  3E58 A;  3UXN A;  3PW4 A;  4BWM A;  2DKX A;  3IN5 A;  3F5A A;  1FFV A;  4LZG A;  1C20 A;  4I2G A;  4O3P A;  3OJS A;  9ICN A;  4NLG A;  3MGV A;  3BS5 A;  1JXE A;  4R8U B;  2ZIV B;  2W43 A;  2JV3 A;  2CRX A;  9ICX A;  3PML A;  1BPZ A;  4DEZ A;  1BVS A;  2PMZ C;  1RXV A;  4F5N A;  4UAZ A;  4QWE A;  2C2D A;  4NLZ A;  3PSP A;  5KT2 A;  7ICH A;  1HEK A;  2NRZ A;  2NRV A;  1ZQT A;  1DK2 A;  4Y2J A;  1QSL A;  2XY6 A;  5A0L A;  5DQH A;  2IMW P;  1NK9 A;  3RRG A;  4K4G A;  5ALS A;  4MF2 A;  1Z4N A;  2IHN A;  4YG2 A;  1ZXI A;  4AYB C;  8ICX A;  3IDW A;  3WKD A;  1ED1 A;  4KLQ A;  4YD2 A;  2B6G A;  5KFV A;  2XCA A;  3WK4 A;  7ICI A;  1DGJ A;  2GOL A;  3QNM A;  4RUA A;  4IRK A;  2FLL A;  4NL9 A;  1J2N A;  2YMQ A;  1COO A;  8ICH A;  4XA5 A;  1X42 A;  1BPD A;  3UM9 A;  9ICK A;  2ASJ A;  4CRX A;  2ZJA A;  3UPQ A;  3SR6 A;  3WK9 A;  4OO1 J;  2YB1 A;  5J2F A;  1Z19 A;  3IG8 A;  4B6J A;  1L7P A;  4DSI A;  2FE9 A;  4QJF B;  1L7M A;  2EAM A;  3ZDC A;  3C5F A;  2JHD A;  4F2S A;  2DKZ A;  4DL5 A;  2HHS A;  4U7C A;  5EWG A;  2IBK A;  1KSP A;  5DQI A;  2KVS A;  1URJ A;  5L1L A;  2BCV A;  4PH5 A;  5HHH A;  1J2M A;  3QE9 Y;  4KLS A;  4FZL A;  2G08 A;  5AKY A;  2F2A B;  4UAU A;  3UXO A;  2KNJ A;  1ARO P;  2HBM A;  3WKB A;  2W9B A;  8ICI A;  4UAS A;  2WHE A;  1NZP A;  3PNC A;  1BNO A;  5DGA A;  5AKH A;  3FYH A;  4YP3 A;  1T3Q A;  2XGP A;  3EZ5 A;  4QIW C;  4I2A A;  5L1J A;  4KLJ A;  1PVR A;  2LHT A;  1Q46 A;  2V9W A;  5KFT A;  4IS7 A;  3RB0 A;  5KG3 A;  3RH6 A;  3V7J A;  3SAF A;  3L3F X;  2EAN A;  3LK9 A;  2KK0 A;  2VJ4 A;  9ICP A;  4DLE A;  2K8B B;  2YY6 A;  1NK6 A;  1FIQ A;  4YCX A;  4IQU A;  4BXO B;  4JV2 A;  2FMQ A;  4F72 A;  5ALY A;  2D8C A;  8ICV A;  1Z00 A;  2R8I A;  3M9M B;  2C22 A;  1KN5 A;  4GXK A;  4YFK A;  1S9F A;  3KKA A;  3RBD A;  4ICA A;  4LJX A;  3M9N B;  1FEZ A;  4C8M A;  3QZ8 A;  4RNO A;  2K4P A;  3Q8P B;  1U4B A;  1LVH A;  4PZO A;  3GV7 B;  3WK7 A;  3WKA A;  4O3S A;  1X40 A;  3RRH A;  3PW7 A;  4B9T A;  5J2J A;  5H2F U;  1K1S A;  4KX3 A;  4J9L A;  5KT6 A;  5AK5 A;  4F91 B;  3SD7 A;  2NYV A;  5ALZ A;  3TAD A;  3JPQ A;  3ORY A;  3C23 A;  1GO3 F;  8ICR A;  3BQT A;  3SMV A;  4JV1 A;  5J0Q A;  2NO4 A;  1CI4 A;  2A1J B;  3WKC A;  5HMM A;  3HW8 A;  3KZI U;  2HBK A;  3C5G A;  1ZYQ A;  3TAC B;  2FDR A;  5ALV A;  3WK8 A;  2XC9 A;  4QZH A;  2PI5 A;  2ZIX A;  2XGQ A;  3GII A;  4M0A A;  4CGZ A;  3SEI A;  1WYG A;  3C21 A;  3HPO A;  8ICB A;  5KFD A;  3SAH A;  3BZK A;  2KG5 A;  3BS5 B;  1N5W A;  5DB9 A;  4IQW A;  4DOA A;  3CP8 A;  4YXM A;  4RQM A;  1F5S A;  1MSW D;  9ICE A;  5HR6 A;  3AEV A;  2OEH A;  5ALP A;  2G5H B;  1KQQ A;  2A19 A;  4YXJ A;  4OJO A;  4YQW A;  1HUO A;  5III A;  4ECY A;  2GH1 A;  3IV6 A;  2UVU A;  4R64 A;  4IR1 A;  3Q8S B;  1ZQN A;  2W54 A;  4R63 A;  3Q8K A;  3RJK A;  5KT3 A;  2Y0S C;  5DG9 A;  3LDA A;  2Y1J A;  1T7P A;  3TAD C;  2RDJ A;  4BWJ A;  1JIH A;  2Y0S F;  1ZQL A;  2PKE A;  5KFW A;  1ZQV A;  3HRD D;  9ICC A;  2EAP A;  3C1Y A;  4ECU A;  2JXJ A;  4BDP A;  3G6X A;  4NLC A;  4J9S A;  2JEI A;  8ICQ A;  2H3I A;  1KKX A;  8ICJ A;  2XCP A;  7ICG A;  2HMX A;  5DBA A;  9ICV A;  2MAX A;  4Q8F A;  2AHO B;  4TUR A;  4DSL A;  2DF4 B;  4RQ6 A;  4ECV A;  2Q0Z X;  2KP7 A;  8ICA A;  5ALE A;  1CRX A;  5KT4 A;  3CRX A;  4M9L A;  4F4K A;  5KG7 A;  4ECQ A;  3ZD8 A;  3RR8 A;  4ED8 A;  2I5H A;  4MEX A;  4YR3 A;  2HVH A;  2DBY A;  4DL6 A;  3ONN A;  5AKK A;  3MBY A;  4UAY A;  1X6J A;  2E8M A;  2KIV A;  2K4E A;  4NWI A;  8ICT A;  2HHT A;  4GXI A;  4ECS A;  1X2I A;  2V4Q A;  4ELU A;  1A0P A;  2W9C A;  3ZDB A;  2ZXH A;  1XS9 D;  5TZV A;  4KLD A;  4JUZ A;  3RJE A;  1ZET A;  5BOL A;  4RQ8 A;  1OW5 A;  4EEL A;  2VAN A;  2ZIW A;  4DSF A;  5ALO A;  4Z6C A;  7ICU A;  2ZUD A;  1L3U A;  1ZJM A;  3KHH A;  1CEZ A;  2ZUB A;  3RB3 A;  5EWE A;  3I76 A;  3BQ2 A;  4ECZ A;  1D9D A;  2PFQ A;  1BGX T;  4BXO A;  4QZI A;  2KV2 A;  2E8P A;  3NRW A;  1N56 A;  4FBT A;  5KG4 A;  1V9P A;  3HT3 A;  4O3N A;  1ZQB A;  1SWV A;  3HIL A;  1HUZ A;  3IRU A;  5ALF A;  3BZC A;  4KIT B;  3K1R B;  4PGY A;  5CEH A;  2JH1 A;  9ICR A;  4KLI A;  2KTQ A;  1Q3U A;  5AI4 A;  1A77 A;  4RQ5 A;  4JB3 A;  4RZR A;  3EPI A;  1TAM A;  2P6R A;  4U6P A;  5ALU A;  2G5I B;  1N61 A;  3N97 B;  5KFF A;  4ZH4 A;  3PMN A;  5J8Y A;  1Z00 B;  9ICG A;  4FE3 A;  2ISP A;  4P0P B;  4LZD A;  2H3V A;  3RJG A;  4J03 A;  1MC8 A;  3KHL A;  7ICE A;  5BPC A;  4IQV A;  4J9R A;  1S10 A;  1ZOL A;  2UVV A;  1QLN A;  5ALX A;  1NK7 A;  4B9N A;  2A1J A;  1JUD A;  1L8L A;  2Y9U A;  1L8O A;  2HCF A;  4UB6 U;  3SZ2 A;  4CF3 A;  2ZG6 A;  3ALR A;  3PY8 A;  4RNM A;  4QWB A;  2P6U A;  5L1K A;  4RPX A;  7ICQ A;  4DF8 A;  1TAU A;  5DB6 A;  4BJQ A;  3Q8R B;  3TAN A;  1Y88 A;  1XNS A;  2UVW A;  4F50 A;  3FC4 A;  1DOQ A;  3D2Q A;  1NK8 A;  3NUQ A;  2YB4 A;  2LBO A;  3T79 A;  3HKZ F;  5AKE A;  5J0O A;  4I2F A;  2W9M A;  1FO4 A;  3ZD9 A;  3T5H A;  1V38 A;  4QZ8 A;  5KFU A;  1WG8 A;  1TKD A;  4KLE A;  2EH9 A;  4XUS A;  1XO0 A;  3L4P A;  3C2M A;  4O5K A;  4Y2V A;  9ICF A;  3NTU A;  4DFK A;  3ISC A;  3RAX A;  4KLG A;  1NOM A;  1PK3 A;  4NLK A;  2A3V A;  1U48 A;  1RXW A;  3LWM A;  2J6T A;  2BZF A;  2HHX A;  1NI3 A;  3PR5 B;  3M6Z A;  5AI9 A;  3PX0 A;  2LYH A;  3PZP A;  3LYS A;  5IIM A;  5G5G A;  5ALL A;  1XSP A;  2W3R A;  4CF5 A;  2L5Y A;  4K4H A;  4GC7 A;  3PV8 A;  4USA A;  5DLG A;  2RDI A;  3MR6 A;  1SV0 A;  4DQQ A;  2AJQ A;  4UW9 A;  4ECT A;  2E1E A;  2KKV A;  3MFI A;  3PW5 A;  4QZC A;  3H7I A;  2AGP A;  3B0Y A;  5AM2 A;  9ICB A;  1U49 A;  5KG6 A;  3D2S A;  3RH4 A;  5EE1 A;  3F2C A;  1X66 A;  2XVT A;  2K60 A;  5JTI A;  4PPX A;  4PJ0 U;  1EXN A;  4O9M A;  2ISO A;  3PST A;  3M1Y A;  2D6F C;  2KJ9 A;  2LPE A;  5CA7 A;  2BPG A;  5J8Y C;  4JMU A;  1S76 D;  1S5L U;  2F1I A;  4JK1 A;  2HBJ A;  3GIM A;  9ICJ A;  4J9N A;  2AXT U;  2BR0 A;  1C7Y A;  2KE7 A;  1XSL A;  4I2H A;  1ZD5 A;  1ZQW A;  4EEN A;  7ICS A;  4DFD A;  1N63 A;  1ZQM A;  1S0V A;  9ICA A;  2ASL A;  4CNQ A;  3TFS A;  8ICF A;  2WB1 F;  5KT7 A;  4P4P A;  4EZ9 A;  3FAH A;  2NRX A;  3NVY A;  5ALJ A;  9ICT A;  1BPE A;  1PK1 B;  1V97 A;  2OHF A;  3RAQ A;  1Q8K A;  3ETR A;  4O3O A;  4NM1 A;  1IM4 A;  1N60 A;  4O5C A;  8ICC A;  4RU9 A;  4PHE A;  3RR7 A;  2ZIW B;  8ICE A;  5B66 U;  1ZD3 A;  5HHI A;  2WAQ F;  5HP4 A;  2DPI A;  2FMP A;  2R8J A;  4RQ4 A;  2LM1 A;  2EZY A;  1K5O A;  2NRW A;  1ZRM A;  5J0Y A;  2N1R A;  1RYS A;  2WF6 A;  3H4D A;  3AL0 B;  1ZQQ A;  1Z1B A;  3IP4 B;  4M47 A;  3A0H U;  1WCN A;  5AKI A;  2KIC A;  2FI1 A;  3PO4 A;  3C29 A;  2C28 A;  3M8R A;  4DQR A;  4Z6D A;  5KFE A;  3E0F A;  4C8N A;  3WU2 U;  1L3S A;  5KL8 B;  2XO7 A;  3BQ1 A;  1L3T A;  2HI0 A;  4P4O A;  2KOB A;  1RDF A;  4C7Z A;  4FZM A;  2H3F A;  4R65 A;  2HSZ A;  8ICS A;  1QQ5 A;  4MFA A;  3MR2 A;  3N7P D;  1UT5 A;  4KLM A;  2JMG A;  4RNN A;  4KN7 A;  8ICN A;  4Y2P A;  5J2K A;  2BGW A;  1XC9 A;  7ICR A;  1T94 A;  3AQF A;  4DS4 A;  4RT3 A;  4UB8 U;  3EYZ A;  4P0P A;  4DL2 A;  4QZ9 A;  2RHF A;  2DGZ A;  1HIW A;  4B9V A;  2IA6 A;  5J0X A;  3SEN A;  3I1Y A;  4RPY A;  2J6U A;  5AHX A;  1T8E A;  4OJP A;  4ED1 A;  5IIK A;  5ALQ A;  1ZQX A;  1JX4 A;  1NJX A;  9ICM A;  7ICP A;  3ZDA A;  2ZTD A;  5AK3 A;  1N48 A;  2VKQ A;  2YMM A;  2RQ5 A;  4DS5 A;  3QEA Z;  2DL0 A;  2ZJ8 A;  4NLN A;  2VA3 A;  2LI6 A;  1DGS A;  2KKP A;  1ZQY A;  1ZQD A;  2F76 X;  3KBB A;  2ZIV A;  1QTM A;  5KG5 A;  2HBL A;  2AGO A;  2YML A;  5KFZ A;  3OTQ A;  8ICM A;  3C1Z A;  3NRZ A;  2G06 A;  3ISB A;  1IG6 A;  3RJJ A;  1JMS A;  2QB0 A;  4ELT A;  1ZRN A;  4DOB A;  1Z3E B;  5KTQ A;  1ECW A;  1NNL A;  2MRL A;  5KFX A;  4F3O A;  1SIJ A;  4OD0 A;  2D3D A;  3B9J A;  4C8L A;  4I2I A;  2FLP A;  2JH7 A;  4QZA A;  3HKZ C;  3GV8 B;  4M9H A;  5KG1 A;  2DFL A;  1LB2 B;  2BHN A;  3V6H A;  5J0R A;  4F5P A;  2H3Q A;  1Z4O A;  1A6S A;  4J9P A;  1AQ6 A;  2HOQ A;  4IQT A;  1D8B A;  3H8W A;  1RQL A;  1KDH A;  2EAO A;  1NK5 A;  4J9M A;  1ZQ1 C;  4ED2 A;  4Q43 A;  2R8H A;  2W03 A;  5KG2 A;  4Q44 A;  1JN3 A;  3GV5 B;  5DB8 A;  2KIW A;  3MGH A;  5ALD A;  4TUS A;  4QW9 A;  4C8K A;  1QQ6 A;  3KHG A;  5DGB A;  2W7P A;  4ED7 A;  2B21 A;  1KFT A;  1SZH A;  1QSS A;  8ICK A;  4QZE A;  1M6Y A;  2WB1 C;  3ZI4 A;  3IM1 A;  5L1I A;  3SI8 A;  2ZIU A;  2LM4 A;  3QU5 A;  3MDC A;  1B43 A;  5AM5 A;  2EZZ A;  4DOC A;  8ICG A;  4BUG A;  1PZN A;  1F0M A;  2QB0 B;  4EX7 A;  4DFM A;  2JEJ A;  3LWL A;  1NK4 A;  4NXZ A;  1YZ7 A;  3ZDE A;  2K8C B;  2ZIX B;  2M9N A;  2BKE A;  2J6S A;  3AMZ A;  4BGD A;  7ICK A;  5EE0 A;  3K75 D;  1D8L A;  2RP5 A;  9ICH A;  3KD3 A;  5AM0 A;  2OYY A;  1QSY A;  2BQR A;  3ZDD A;  3SV4 A;  2ASD A;  4HYK A;  1XWL A;  2BPC A;  5KL1 B;  3JPP A;  5B5E U;  5J2I A;  3Q8Q B;  1O03 A;  4DL3 A;  8ICO A;  2BQ3 A;  1ZD4 A;  2VIX A;  3DDH A;  5D4B A;  1LKY A;  4XRH A;  2QLT A;  1UA1 A;  3DV9 A;  1ZJN A;  4O3R A;  2KN7 A;  3RH5 A;  3KKA C;  1TVA A;  1SXD A;  4Z6F A;  1RYR A;  4F5Q A;  1X9X A;  4DFJ A;  2KSO B;  1RG6 A;  1VJ5 A;  3PW2 A;  2ES6 A;  4P0Q B;  2FJ6 A;  4P2H A;  3C2K A;  1IV8 A;  1JRP A;  2BQU A;  5ALM A;  1J97 A;  2MSN A;  2EQY A;  2W04 A;  5AI5 A;  2ZIU B;  1LV5 A;  4E0D A;  2E8O A;  1RM6 C;  4MEY A;  4I29 A;  5CHG A;  4Y2Q A;  2ATL A;  5ALR A;  2ZJ5 A;  3D2N A;  4QZF A;  2CXY A;  2I9G A;  4GFJ A;  5DG7 A;  4I27 A;  4JWM A;  2FPM A;  7ICF A;  2OM6 A;  2W9C B;  3L5K A;  3EPG A;  1OXJ A;  1KTQ A;  2JEF A;  4G9B A;  5J2B A;  4TUQ A;  4PL2 A;  1JRO A;  2QAR B;  3OPX A;  4PGX A;  5J2G A;  7ICT A;  4EBC A;  8ICU A;  1OUQ A;  4CF4 A;  2FPK A;  5IIL A;  3ETL A;  1KRP A;  1ZQZ A;  2AH5 A;  1ZQJ A;  4QWD A;  3QUQ A;  1ZQC A;  4FZN A;  3PW0 A;  3A0B U;  4PL1 A;  2JEG A;  3JPR A;  4PHA A;  5K4L A;  5AKZ A;  3SV3 A;  4NM2 A;  5IIO A;  4DQP A;  4NL9 C;  2MUT B;  4DL4 A;  5KAF U;  1A76 A;  5DDY A;  4IC9 A;  5KFN A;  2JRZ A;  4J9K A;  5KAI U;  1S77 D;  4Q45 A;  1N5X A;  4CDG A;  2JZB B;  3JPN A;  5CP2 A;  1COK A;  5AIB A;  2W8K A;  3PVX A;  4YR0 A;  5ALI A;  2F1J A;  4KLO A;  3HX0 A;  2BPF A;  3FM9 A;  2Q4T A;  2KEY A;  1ZQS A;  8ICP A;  2HW3 A;  1UCV A;  3TQ1 A;  4CCH A;  4KMO B;  3DEE A;  2KHV A;  3HJE A;  5HR7 A;  2XY7 A;  4EYH B;  3NVW A;  3N7R C;  5ALH A;  3MFH A;  2H5X A;  4KLH A;  3UMC A;  2A1A A;  2XID A;  5KNI A;  1TK5 A;  3VC8 A;  1NK0 A;  4YD1 A;  5T14 A;  4CE6 A;  2QAR A;  3RTV A;  1V85 A;  3CYM A;  3AU2 A;  3GQC A;  1JI7 A;  3LVV A;  4C7Y A;  4M04 A;  4OJL A;  3H0R B;  3KZX A;  2E3T A;  4ED3 A;  3N4M B;  4B9U A;  5C0Y A;  1NZB A;  5J2D A;  4M9G A;  2VJ5 A;  1SXE A;  3B0X A;  4F4Z A;  5AKL A;  4GC6 A;  2ESE A;  4QNL A;  3G6V A;  2FLN A;  3TFR A;  4Z6E A;  5ALW A;  4RT2 A;  1RYU A;  2JZB A;  2I1Q A;  2R18 A;  1XU4 A;  4OCZ A;  5ALG A;  4US9 A;  4C80 A;  2NO5 A;  2I6X A;  5DG8 A;  3PSI A;  4AP9 A;  5DQG A;  2VA8 A;  4O3Q A;  2YMP A;  3QU7 A;  5EWF A;  4G3I A;  1NJW A;  1SKS A;  5AM4 A;  2HHQ A;  1ZQI A;  3OJU A;  1TE2 A;  1DXS A;  2F77 X;  4QWA A;  4EBD A;  4FBU A;  2GO7 A;  2KJ5 A;  2B0C A;  1S0M A;  3CNH A;  4I28 A;  2OCE A;  2AQ4 A;  4F8R A;  4EZ6 A;  1N62 A;  3OHB A;  5EOZ A;  1L3V A;  3QUT A;  2NV3 A;  4UB3 A;  1KLN A;  4YMM A;  4KMU A;  4ECR A;  1RQN A;  4AYB F;  3KHR A;  3JPT A;  2Y1I A;  3GIK A;  2K4I A;  5DLF A;  4DF4 A;  5KFA A;  3RJF A;  4DO9 A;  1QCK A;  2F1H A;  4ACO A;  5AI0 A;  4NJ8 A;  5KFC A;  4RQ0 A;  4UB2 A;  8ICY A;  5KG0 A;  2PMZ F;  2W8L A;  5AI8 A;  5G5H A;  2YX8 A;  3NAS A;  4UQG A;  4DQI A;  2MA1 A;  4M6W A;  3QU4 A;  2UVR A;  5D49 A;  1B4F A;  3QXG A;  4DSK A;  3PR4 A;  3N28 A;  3D6J A;  2R8K A;  5GTI U;  1XSN A;  1UT8 A;  3NGD A;  9ICI A;  3HP6 A;  4QIW F;  4FFD A;  5L1M A;  5ALT A;  4C4T A;  4ED6 A;  5AKJ A;  1IIP A;  4QWC A;  3AU6 A;  5KT5 A;  5J2C A;  3CW2 C;  4PGQ A;  3T5K A;  5F3X B;  4YN4 A;  1L5U A;  4Y2U A;  4YMO A;  5KFI A;  3M8S A;  5IIJ A;  2PI4 A;  4B9S A;  1SL1 A;  9ICO A;  2LYA A;  3V72 A;  4IRD A;  3F53 A;  1XO1 A;  4GXJ A;  2ALZ A;  2C2R A;  3GFK B;  4F71 A;  4P0Q A;  1MN8 A;  3H8M A;  2ZUC A;  3KOO A;  4R66 A;  4QW8 A;  1PVP A;  4KX5 A;  4JWN A;  1KW4 A;  3FDS A;  2WF9 A;  1T3N A;  4J9Q A;  3Q8M A;  2BDU A;  2HHU A;  5KFG A;  3BJY A;  8ICZ A;  1PUZ A;  2DPJ A;  7ICV A;  1RPL A;  5CWR A;  3QX7 A;  3KTQ A;  4DSE A;  1SV0 C;  4RQ3 A;  1D9F A;  3MR5 A;  3SAG A;  4MFC A;  2MUT A;  3EW9 A;  4IL6 U;  2AU0 A;  3MAB A;  4C4R A;  5CR0 A;  1S0O A; 
#chains in the Genus database with same CATH homology
 2ZG6 A;  2KJ9 A;  4P0Q B;  3ALR A;  2H3Q A;  2K8B B;  3C28 A;  1A6S A;  3N7P D;  1A0P A;  4ACO A;  4CRX A;  2DQN B;  2JMG A;  3H0L B;  2G09 A;  3N7R C;  2HOQ A;  3CP8 A;  3K1Z A;  1P7D A;  4JMU A;  5CRX A;  1D8B A;  1YT3 A;  2ZXH A;  2OH2 A;  4OO1 J;  5HR6 A;  1DRG A;  2HBJ A;  2W04 A;  2YB1 A;  4BJQ A;  1Q3V A;  2LKY A;  2G5H B;  2XID A;  3IG8 A;  1T94 A;  1Z19 A;  2ZIU B;  2PMZ F;  3RFA A;  1XNS A;  3VC8 A;  3N7S C;  4NLB A;  2YX8 A;  2F8L A;  1ZQ1 C;  3AQF A;  2MA1 A;  4OJO A;  2WAQ C;  2CN1 A;  2G07 A;  2ZIW A;  5T14 A;  2HOF A;  4QJF B;  3D2Q A;  2G0A A;  4ICA A;  4P0P A;  2W03 A;  2GH1 A;  2RHF A;  3NUQ A;  2YB4 A;  3AQE A;  2DGZ A;  2LBO A;  1HIW A;  3CYM A;  2ZXI A;  3D2N A;  3F5A A;  2KJ8 A;  3HKZ F;  2JHD A;  3LVW A;  3IN5 A;  4A8E A;  2KIW A;  2K4H A;  5C0Y A;  3ICX A;  4GFJ A;  3LVV A;  2WB1 F;  2W7P A;  4OJP A;  2Y0S C;  4U7C A;  3MGV A;  4O3M A;  4QIW F;  4OJL A;  3H0R B;  3KZX A;  2OXO A;  1SZH A;  1IIP A;  2OM6 A;  2KV2 A;  2WB1 C;  2ZIV B;  3VCB A;  1NZB A;  2Y0S F;  1XO0 A;  2HOI A;  1URJ A;  3NRW A;  2CRX A;  2VJ5 A;  4WJ3 B;  2ZIU A;  4KX3 A;  3KFU F;  4QNL A;  2XI9 A;  2VKQ A;  4BX9 C;  2PMZ C;  4PL2 A;  2ZIW B;  4C0Z A;  2KHQ A;  2KD1 A;  3OPX A;  4BUG A;  4FZL A;  2G08 A;  2WAQ F;  3GZF A;  3PSP A;  2A3V A;  1OUQ A;  1PVQ A;  2F2A B;  1HEK A;  4NLC A;  2KNJ A;  2KVC A;  2LYA A;  2R18 A;  3F5E A;  3F53 A;  2K8C B;  2ZIX B;  4OJ6 A;  2H3I A;  1GO3 F;  2RRD A;  2M0N A;  4FZN A;  2HBM A;  2KKP A;  3IG5 A;  3M6Z A;  2F76 X;  2HMX A;  2JH1 A;  2RP5 A;  3O0F A;  3PSI A;  4PL1 A;  5A0L A;  3F2B A;  2ZIV A;  3SMV A;  2OYY A;  2N1R A;  3LYS A;  3PZP A;  1Q3U A;  2HBL A;  3M7D A;  4P0Q A;  2DF4 B;  3AL0 B;  1Z1B A;  2E5S A;  4AYB C;  3IP4 B;  1TAM A;  1PVP A;  3PSF A;  2HBK A;  4OJ5 A;  2G5I B;  5KL1 B;  4U6P A;  1F44 A;  4KX5 A;  1KBU A;  2G06 A;  1CRX A;  1MA7 A;  4IC9 A;  2D6F C;  2KIC A;  2F77 X;  3CRX A;  2BDU A;  4QIW C;  1ED1 A;  2KJ5 A;  3M6K A;  2E1E A;  2KKV A;  4NV0 A;  4CDG A;  3F2D A;  2Z7J A;  2H3Z A;  3C29 A;  1UPH A;  3GU3 A;  2VIX A;  2E1F A;  2ZIX A;  2W7O A;  4FE3 A;  1PVR A;  2LHT A;  1ECW A;  1WUD A;  3E0F A;  2MRL A;  2GOL A;  4CGZ A;  2H3V A;  3SQI A;  4P0P B;  2NV3 A;  2Q4T A;  2K8A A;  5KL8 B;  3RF9 A;  3ONN A;  2KEY A;  3H0M B;  3D2S A;  2CPR A;  4AYB F;  2KOB A;  2JH7 A;  3F2C A;  3T79 A;  1L6N A;  2K4E A;  2H3F A;  3HKZ C;  4FZM A;  2XVT A;  4NWI A;  3SAF A;  3SAH A;  3L3F X;  2K4I A;  3SAG A;  2JGA A;  4KMO B;  2VJ4 A;  2K89 A;  3DEE A;  2KHV A;  3PST A;  5HR7 A;  2LYB A;  2XIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...