2Y0SF

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
total genus 10
structure length 90
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2y0sF02
4AYBF 2WAQF 2Y0SF 2WB1F 2PMZF 3HKZF
chains in the Genus database with same CATH superfamily
2W3RA 5J0PA 5CHGA 1DOQA 3QE9Y 2G07A 3I76A 1A6SA 2W9BA 3H8SA 4FZLA 3V7JA 3UXNA 3PW2A 2QB1A 1JMSA 1TE2A 7ICQA 1T3NA 4RQ3A 4NL9C 3NUQA 1XO0A 1X9XA 5GTIU 3EPIA 4J03A 7ICNA 1OXJA 1S5LU 1ZQXA 2FJ6A 4LJXA 4QZBA 4BWMA 1SZHA 4RQ8A 1ZD4A 3RBEA 7ICGA 4DL4A 2K8CB 1ZQ1C 3NASA 2LBOA 1LKYB 5AKKA 3GIKA 1QSSA 4NY8A 5F3XB 1WYGA 3BDPA 1F5SA 1K5OA 4J9NA 4DQQA 2JXJA 1X6JA 4PL2A 7ICJA 2FI1A 4YCXA 4PGXA 2LYHA 2Y9TA 2EH9A 1JN3A 3Q8PB 3DDHA 4F5PA 5ALWA 5ALPA 7ICPA 1X42A 3Q8RB 4ED0A 1XO1A 2HI0A 4DL2A 4DSKA 4DS5A 5DBBA 3ZDBA 3RB6A 3PR4A 2D6FC 4GFJA 1KQQA 2WHEA 2Q4TA 2E5SA 2ALZA 2OM6A 1FIQA 4YR2A 4F5OA 4BXOA 2N1RA 5KFJA 5EWEA 2KVSA 5EE1A 5DG7A 4F2RA 3NRZA 1ZQBA 4RNMA 3N97B 3DEEA 3ALRA 1MN8A 4C8NA 1CRXA 2GH1A 2ZUCA 4ZH4A 4C8LA 2BPCA 2XY5A 4QNLA 4J9MA 4DLEA 2G5IB 4AYBC 3SAGA 4F91B 4JV2A 4I2EA 5KFRA 4Q8FA 4U6PA 5IINA 4QWCA 2XO7A 2OCEA 2D3DA 3ZDCA 2EZYA 2D8CA 2PKEA 2FLPA 1QQ5A 3MR3A 4RNOA 3RB0A 2BDUA 3AN1A 1KDHA 5L1LA 1BPYA 1NOMA 4YG2A 3TADA 2W8KA 4Y2QA 5DKWA 9ICSA 4YXJA 1L3UA 3ISDA 3TAQA 2YX8A 3PO4A 2E8PA 4F93B 5EWFA 3MGHA 4M9HA 1NK9A 4B9SA 4PZNA 4PHAA 4RQMA 3OJUA 3WK7A 1N62A 4DLGA 5ALMA 4M2YA 3BQ2A 3HW8A 5KFGA 9ICTA 2EDUA 1NI3A 5BOMA 8ICJA 1O08A 3C28A 2KTQA 2BPFA 4XRHA 2ZIXB 3M9NB 3F2CA 1V85A 1DGSA 5AKHA 3GILA 3TFRA 2PFNA 5AI0A 4EBEA 1MQ3A 1TAMA 5DQHA 1KEJA 5TISU 1V97A 3KHGA 2Y9UA 4NLZA 4IQVA 3CW2C 2W03A 2Y0SC 3AUOA 4ICAA 5AM2A 2Z7JA 3WKBA 4Y2VA 1KFSA 5KG7A 4KLJA 1XWLA 3AMZA 5EE3A 5C5JA 4KLIA 2E8NA 4UASA 1XSLA 1RXVA 4YFKA 2AXTU 3RJFA 1JIHA 2KNJA 7ICOA 3CNHA 1IIPA 5HMMA 1RYSA 1ZQQA 5J0TA 3M8RA 3C2KA 1COOA 5J0SA 2LKYA 4Q45A 1GO3F 7ICRA 1Z4OA 8ICRA 4JWMA 1RQLA 1UHUA 1S0VA 4YXMA 1WCLA 3QUQA 4P4MA 3RJGA 4Y2PA 2F1JA 2HBKA 1JXEA 4I2BA 1N61A 1FFVA 1Z1BA 2PMZF 4RQ2A 4XA5A 3SQIA 3ETRA 4RPYA 1BPZA 3WKCA 4GC7A 1SGGA 1L8OA 1F0MA 4QZCA 3AQEA 3H7IA 1Q3VA 8ICLA 2W9MA 2VJ5A 1QSLA 5KFTA 2ISOA 4ED1A 3C2MA 5BPCA 3L4PA 5AKEA 4P0QB 3PMLA 2HOQA 5KAIU 9ICLA 1AROP 9ICQA 5DQGA 1CI4A 5ALEA 4QZ8A 5AKLA 9ICVA 4B9LA 2UVWA 2JEJA 3O0FA 2XY6A 1ZQHA 2ISPA 2V9WA 1ZJNA 1CUKA 2KK0A 3PX0A 3VCBA 1N5XA 8ICGA 3WK5A 2R8GA 4TQSA 5CA7A 4UATA 2W9AA 7ICFA 4DOCA 1SKWA 3SZ2A 3NVYA 1SKSA 3PNCA 1F44A 3QZ8A 1LV5A 1U9LA 2KEYA 1HIWA 2QLTA 4UAUA 3RR7A 2G5HB 4ECVA 1D8LA 2IMWP 1H38A 5KG3A 3PW0A 5J2GA 3LVWA 5ALIA 2ATLA 3H4DA 2HHSA 2A1AA 1IV8A 4ECRA 2BZFA 3ZD8A 2RLTA 2BDPA 2ESEA 5ALNA 9ICXA 2KV2A 2YB4A 5ALUA 1T4GA 4ECUA 2NYVA 1XSPA 2I1QA 4F5RA 8ICHA 4G3IA 3D6JA 2DF4B 3RR8A 2YMQA 3THVA 4KLOA 4RQNA 4MEYA 1JROA 4ECQA 1ZQPA 1SV0A 2EQYA 8ICPA 4OO1J 4F71A 4K4HA 3TACB 4P0PA 4GXIA 4I2AA 4FO6A 5DB8A 1BGXT 4UAYA 2CRXA 5D46A 2HSZA 4BXOB 1DK3A 1NKEA 4O3SA 4Y2XA 4EEKA 1VLBA 1FO4A 3BQ0A 4C8MA 4O3OA 5EWGA 2WF5A 2B21A 5ALZA 4QJFB 3KZXA 5ALRA 2J6UA 4YQWA 2WB1C 4UAZA 4OD0A 4NJ8A 3SYZA 5G5GA 3TANA 1NJWA 3MGIA 3C5FA 9ICCA 2LYAA 4GLXA 1S76D 1ZRMA 5HR7A 4C4TA 1DK2A 4PHDA 2W9CA 3KBBA 2Q0ZX 3QU5A 4ECSA 4Q8EA 3UQ2A 2OWOA 5J2JA 4Z6EA 3H8MA 5L1MA 4O0IA 4Y2YA 3UMCA 4KLHA 3WK4A 5ALTA 4F4KA 3RAXA 3V72A 3ISBA 3GQCA 4YMOA 5AK4A 1N60A 4UB5A 1KL9A 5IIJA 3SENA 1ZQCA 2HHWA 2FPLA 1QCKA 5AICA 4XUSA 4OJPA 4F8RA 7ICUA 1PUZA 4UARA 4QIWF 3F5EA 3ISCA 3QU2A 2JEIA 2LHTA 1SB3C 2HDOA 3UMGA 1L5UA 2WAQF 3TAPA 1NKCA 2EZXA 2KFNA 5J2FA 1YT3A 5J2KA 2PXIA 3EWAA 1SXEA 2NRZA 3MR6A 1SL1A 3PO5A 4F2SA 1L7MA 3MDAA 2OH2A 3ZDDA 3HJEA 3B0YA 3HILA 5D4BA 1T94A 4BX9C 4O3MA 4ELTA 1ZQVA 5D49A 5AI8A 1NJXA 3PSPA 4DWIA 1NZBA 4O5CA 3NGDA 1KTQA 2CPRA 4KN4A 3QNMA 4TUSA 2RRDA 2MAXA 3E2EA 1ZQNA 3H0MB 1J2NA 1UPHA 1N5WA 3KHRA 4JV1A 4FFDA 4P0QA 4I2IA 3VC8A 3K1ZA 1J97A 1L3SA 3SI8A 2BPGA 1BPBA 3H0LB 2JHDA 2BCUA 2QARA 2FE9A 4I2JA 1BPEA 2HHTA 4QWDA 3IDWA 4QWBA 4NM2A 3RF9A 2W8LA 4QW9A 9ICNA 2HW3A 3FC4A 4DQSA 3RB3A 5DB7A 4IRDA 2KHVA 4F72A 2E3TA 3BS7A 5EE9A 2A1JB 2VKQA 3GV5B 3NRWA 1V9PA 8ICEA 2XGQA 4X5VA 4DFDA 1TFRA 1UCVA 5DGBA 1SIJA 2C22A 1HEKA 4KMOB 3H40A 1JALA 5AK6A 2PI4A 4LVSA 4GIBA 2K4HA 1N56A 4RUCA 3DV9A 1ZQRA 4O3PA 5AIAA 2PMZC 1OW5A 2HOFA 4KX5A 4I28A 8ICWA 3N7SC 1U4BA 2EZZA 3SAHA 4KLEA 4I2FA 1S10A 4HAIA 2YMLA 2JR5A 4BGDA 4Y2UA 3ZD9A 1NNLA 5KG0A 2WF7A 3JPTA 2ZIUA 4I2CA 4YMNA 3HX0A 4IR1A 5AKYA 4QWEA 1Y88A 4UB2A 3EZ5A 2W11A 3SR6A 4J9LA 4KLFA 5KFSA 4UAWA 4IC9A 4DL5A 3R9KA 2K4IA 2I9GA 2RHFA 5AK3A 3HP6A 5KFEA 1TKDA 4NL9A 4RPXA 4J9QA 2DKZA 2KN7A 3FAHA 4NLNA 1BPXA 4ED6A 4EYIB 4MHVA 5DG8A 5L1IA 2H3FA 4YD2A 1JXLA 1J2MA 5KFIA 5ALYA 1ZQFA 8ICOA 5L1JA 4IQUA 5KFCA 2JMGA 3GZFA 3NVZA 1TK8A 4C4RA 1TK5A 4ECYA 2PFOA 4J9KA 5DGAA 2MUTA 3QU9A 4US9A 2UVVA 2KJ5A 4OJLA 4PHEA 5EE0A 4O3QA 3NVVA 4EEYA 5AI9A 8ICMA 4J9SA 2ZUDA 1HJPA 2JV3A 1Q3UA 2KG5A 2ODGA 3C29A 2P6UA 1QLNA 4CE6A 5KNIA 3PMNA 4DS4A 4ELVA 3SD7A 2XCPA 4M9JA 2BQRA 3WK8A 4QZ9A 2G06A 4O5EA 5KG5A 4DL3A 5B66U 2B0CA 1M6YA 7ICEA 2YN4A 3MGVA 4KLMA 2UVRA 9ICUA 1ZQEA 2DL0A 4M6WB 5CB1A 4P0PB 3EPGA 2V4QA 2HVIA 1SWVA 4F92B 4B9VA 4C4SA 4Z6CA 3RAQA 7ICLA 4K4IA 2HHXA 5AK5A 1S0NA 2KJ9A 4R8UA 1ZOLA 2NRVA 5AIBA 3GV8B 1X9WA 5DB9A 3NTUA 2IOFK 3H8WA 1X66A 4O5KA 2ZJ8A 3MR2A 3H8JA 1X9MA 4CF5A 3PZPA 2DQNB 3G6XA 4DL6A 2J6SA 5J29A 2BR0A 5HHHA 4NV0A 5JRTA 1MQ2A 5AM5A 4YR3A 2RDJA 2DPJA 5F9NA 2W9CB 1O03A 3Q8LA 2AHOB 1WUDA 2ZXIA 3KKAC 5CJ7A 4F50A 1ZQTA 4BUGA 4ED8A 3BZKA 4PGQA 1D8YA 3V6JA 3HWTA 3ZDAA 1XS9D 4AP9A 5KAFU 1HUOA 1WG8A 1QSYA 3M8SA 4Z6FA 3E0FA 5DB6A 2MU2A 1JUDA 4DQIA 1XC9A 5KFZA 3H4BA 3RJEA 3F2DA 4J9RA 1UQVA 2O6KA 5J8YA 1ZRNA 2W3SA 3QU7A 4DCCA 3NVWA 3KFUF 2FPKA 4QZFA 3AM9A 2WAQC 1TVAA 7ICSA 4RT3A 3EUB2 5T14A 2ZIWA 3UQ0A 1NK7A 4MFAA 1PVPA 2A1JA 1KN5A 5AKIA 3V7KA 1N48A 4IL6U 5CP2A 2LMRA 1NZPA 1IG6A 4LZDA 3HPOA 4M04A 1Z00A 5J0YA 7ICMA 2IOFA 2RQ5A 2RP5A 3C1YA 4QZGA 4IRKA 3I28A 3TQ1A 9ICBA 4KX3A 4NWIA 2ASLA 2H5XA 1ZQZA 3OTQA 1QQ7A 2JZBA 1TAQA 1FFUA 4F4WA 3PX4A 3JPRA 2J6TA 1QTMA 4F4XA 4QZDA 4KMUA 2DFLA 5K4LA 4R65A 1NK0A 4DFKA 4BWJA 4KITB 7ICIA 4R66A 4Y2SA 3RJJA 2WF6A 4DFPA 3Q8KA 1KRPA 2F44A 5KT7A 2ZJ5A 3T5JA 2LI6A 2DGZA 4KLLA 3PY8A 2MRLA 2BKEA 4DOAA 2OEHA 2CN1A 2EAOA 5ALQA 2QARB 4ECXA 3PSFA 2P66A 4RQ0A 4F4YA 4QZAA 1L6NA 3QUBA 3IG5A 3G6YA 1N2XA 4RPZA 3N28A 3RJIA 2K4PA 4RZRA 1DXSA 8ICTA 5J2IA 2DUYA 3WKDA 3BZCA 3F5AA 5J2DA 2WF9A 1LB2B 2F76X 4KLQA 5J2EA 1EXNA 2HVHA 2KZMA 5IIKA 5L9XA 1U47A 3ICXA 3RFAA 2GWSA 8ICQA 1X40A 5A0LA 3D2QA 2H3QA 3CRXA 9ICAA 3HKZF 1ZQOA 4RQ7A 3PR5B 4RT2A 3PSTA 3Q8MA 4PL1A 2AGOA 5ALOA 1X6IA 4IS7A 2R8HA 4FBTA 4C7ZA 5DDYA 2NV3A 2EANA 1MSWD 1PVQA 5KFYA 3BS5B 3RBDA 3OHAA 3N7PD 3WKEA 1NK5A 3BQTA 9ICKA 5DBAA 2ZIUB 5KFMA 1ZQLA 2KOBA 5KT2A 2E1EA 2R8IA 4DEZA 4CNQA 2PFQA 4M6WA 4CDGA 5HNKA 1VJ5A 3F53A 1ZQGA 3Q8SB 4KN7A 1UA0A 3IRUA 2E1FA 5KT6A 3KHHA 3JPPA 1L7OA 2E8OA 4NLBA 1D8BA 1S0OA 2WTFA 1V38A 3C2LA 4C80A 3OSPA 3PV8A 3MC1A 1HUZA 4J9PA 3T5LA 2IHNA 9ICWA 4ACOA 4QZIA 2MUTB 4OCZA 4YD1A 1L7PA 3PW7A 3RB4A 1T7PA 4M9GA 2W43A 1TAUA 4M0AA 1PZNA 1XNSA 1Z3EB 4UQGA 4I2DA 1QH9A 3ED5A 4DSFA 4C8OA 3V6HA 4TUPA 2F2AB 4J9OA 5KT3A 2VJ4A 4DOBA 2BCRA 2KKPA 3GIIA 4TUQA 2FLNA 4C8KA 5KFKA 5ALJA 4NLGA 2LM4A 3HT3A 2IBKA 4NLKA 4KLDA 3L5KA 3QUTA 1L7NA 2BCVA 2PFPA 5KL8B 2VA3A 2WFAA 8ICCA 5G5HA 4Y2RA 5HR6A 4OJ6A 2IHMA 1NJZA 2ZTEA 3T5KA 2KP7A 1L3VA 4G9BA 1RZTA 1S8OA 1BPDA 4ED3A 4EENA 7ICTA 2AQ4A 4DFMA 1KSPA 4R8UB 5IIMA 1ZQUA 2H3VA 5DLGA 3V6KA 3M1YA 3RJHA 2YY6A 4CF3A 5JTIA 2LM1A 2F1IA 5L1KA 2ZXHA 3S6JA 2NO5A 4YVZA 2K8BB 3QXGA 4M9LA 2IA6A 4EX7A 1SKRA 5KFLA 2FMQA 3MFIA 1U49A 2P6RA 2NRTA 4K4GA 2NO4A 2LYBA 1AQ6A 5ALHA 2OXOA 5H2FU 3IV6A 5DLFA 2F8KA 9ICMA 4Q44A 2ZTDA 1S77D 4FE3A 2KJ8A 3FDSA 2EAMA 4DL7A 3NS1A 3JPOA 1ZQSA 2ZTCA 2RDIA 4MF8A 1X2IA 3ZDEA 3KOOA 4A8EA 2FDRA 8ICNA 9ICPA 5J0WA 1DGJA 1L8LA 1RDFA 2F77X 2XICA 3ETLA 3T5HA 2ZIWB 3WKAA 5HMLA 5EOZA 4C7YA 4YMMA 4RQ1A 5KT4A 3IN5A 4M47A 2WF8A 1Z00B 1VDVA 3RH6A 1ZQAA 2NRXA 4ECZA 2L5YA 5KFAA 4I2GA 3WK9A 5KFQA 4R64A 2XCAA 4I27A 4BJQA 3A0BU 5KFUA 3PX6A 5KG2A 3RJKA 4JMUA 7ICKA 2XY7A 2Y1JA 2JZBB 4USAA 5E79U 2KE7A 3N4MB 2C2EA 8ICSA 3MFHA 3WK6A 4TQRA 2VA2A 1Z1VA 3BS5A 1SL0A 8ICFA 5AI5A 2JEGA 3G6VA 3AU2A 4F5QA 1C7YA 1NKBA 9ICGA 1KFDA 8ICYA 2R8JA 3OPXA 5J2BA 3UXPA 4KLUA 4MFFA 4EYHB 1MC8A 3KD3A 3PSIA 2I5HA 1ZD2P 1ZJMA 5KFXA 4M9NA 4UB6U 4Z6DA 5CEHA 1NK4A 5KFOA 5KG6A 3I1YA 4Q43A 2C2DA 2E8MA 1A77A 2P35A 2F3NA 3TADC 3C23A 4ED2A 2KHQA 5AKGA 4QW8A 3QUCA 3A0HU 3K4GA 4U7CA 4C0ZA 3QEBZ 3UPQA 2C2RA 2YQEA 5ALVA 3EYZA 1NK6A 4KLSA 2R8KA 4EBCA 1SXDA 4IQWA 3BJYA 3HKZC 4DSEA 5F9LA 1P7DA 2WB1F 8ICAA 3V7LA 3LYSA 4US8A 3N7RC 3OGUA 3H0RB 3BQ7A 5J2AA 4FBUA 1NK8A 4P2HA 3UXOA 5ALLA 2KSOB 4DFJA 1ZQKA 5AI6A 2BCSA 3GIJA 1KW4A 4F3OA 5IILA 3KZIU 2HBJA 3MBYA 1Q46A 3ZI4A 2DWQA 2R18A 1N63A 3GU3A 4JB3A 5J0XA 4HYKA 2JGAA 1RQNA 2KICA 1SWWA 4RQ5A 3LWMA 5KL1B 8ICBA 3IP4B 7ICVA 1ZQDA 4BDPA 5HP4A 7ICHA 3WU2U 4RQ4A 1KKXA 2ES6A 4EX6A 2M0NA 1ZYQA 5KG4A 2VIXA 1URJA 4YP3A 2KMDA 5J0OA 4OJ5A 3C1ZA 4DF8A 3MR5A 4ZOHC 4WJ3B 4PH5A 5J8YC 1WCNA 3CYMA 2FLLA 4CRXA 4XQ8A 3LK9A 5TZVA 3IG8A 1RYRA 5AHXA 3EW9A 1A76A 2ZUBA 3JPSA 4DSJA 3D2NA 1PK3A 3QEAZ 3IM1A 3FYHA 5ALGA 2KFZA 3M9MB 2A19A 4GXJA 4Y2JA 4F4ZA 1B0XA 4P4PA 1KBUA 2AJQA 4RNNA 3KHLA 3OHBA 2XIDA 3ONNA 4MFCA 2GOLA 2H3IA 1COKA 2QB0B 3HRDD 1K1QA 1BNOA 5KTQA 4B6JA 5KFNA 4DO9A 5AM1A 1T3QA 2A3VA 4IR9A 9ICFA 5KG1A 4Y2TA 4UB3A 3SV3A 4UB1A 5AI4A 4I29A 4TURA 2XGPA 3OJSA 3AEVA 4QIWC 4GXKA 3B9JA 2W04A 4RQ6A 3RH4A 5DQIA 1S0MA 2F1HA 4DQRA 1SZPA 5JU5A 1ED1A 3B0XA 2W54A 5AM4A 4F5NA 2NRWA 3SEIA 4O3RA 4MEXA 5AM0A 2KZ3A 3RRHA 5KFWA 1PK1B 4YR0A 2H3ZA 4NXZA 1KFTA 4GC6A 2B6GA 5B5EU 1PVRA 2KVCA 3AQFA 1S9FA 3TI0A 1IM4A 2FMPA 8ICKA 2BGWA 1BNPA 3KKAA 3AU6A 2QKQA 2BCQA 3PW4A 1XU4A 2XC9A 2ZIVB 1JX4A 3GFKB 2FMSA 3MDCA 2DKXA 3UMBA 4EZ6A 2Y1IA 1K1SA 9ICIA 2C28A 4IRCA 4ECWA 1B22A 2YTUA 4UBBA 1D9FA 4CCHA 5AKJA 3M7DA 4QWAA 1B43A 1LKYA 4UAVA 4UBCA 3PVXA 4QZHA 5DG9A 1RYUA 1ZD5A 1JI7A 3LVVA 4B9NA 4PZOA 5KFPA 3BQ1A 1OUQA 5KFVA 2KIVA 9ICOA 4P4OA 8ICIA 2VANA 5ALKA 3RH5A 4OJOA 4UB8U 5KT5A 3JPNA 1MA7A 5IIOA 8ICXA 1NJYA 5ALDA 5GTHU 9ICRA 1Z4NA 1SV0C 2OYYA 1S97A 1CEZA 5ALSA 2OHFA 4NM1A 2W9BB 1XSNA 5CWRA 5JUMA 1RXWA 1D9DA 2AGQA 3C21A 2YMMA 1ZQWA 1X9SA 2YB1A 2JRZA 2W55A 2HHVA 3U26A 3IHQB 3QX7A 5KFDA 4UW9A 2GO7A 4FZMA 3GDXA 2JH7A 2K89A 3Q8QB 2GLEA 2EAPA 4E0DA 4JV0A 4EBDA 2CXYA 2KSOA 5CR0A 9ICJA 5J0QA 4AYBF 2F8LA 4DSIA 1ZETA 2XI9A 1RM6C 4PJ0U 4RUAA 4RU9A 4B9UA 3SMVA 3T79A 4ECTA 2UVUA 2DBYA 4KLTA 2KD1A 2BQUA 2AH5A 1JRPA 2K8AA 3M9OB 2HMXA 9ICHA 2HOIA 4FS1A 1SL2A 3SV4A 3QYPA 5J2CA 2ZG6A 2HCFA 5C0YA 1WWUA 4DQPA 5ALFA 5KFHA 5HHIA 2AQ0A 4B9MA 3SAFA 1U48A 2W7PA 2PI5A 3F2BA 5AKXA 5KFFA 1T8EA 2W7OA 3J81j 1ZXIA 3CP8A 1YZ7A 3QU4A 5FP0A 4YN4A 4FZNA 1ECWA 3T3FA 2K60A 2JEFA 3RRGA 4LZGA 8ICUA 2KZZA 4FS2A 4EZ9A 5J2HA 2MA1A 2ASDA 5AM3A 3AL0B 4MF2A 4I2HA 3ORYA 1ZQIA 1FEZA 4UB4A 4JWNA 1Z19A 1TK0A 1UT8A 4JK1A 1LVHA 2XVTA 1YZ6A 2G09A 2LPEA 4ELUA 2ZIXA 3MABA 1SV4A 1ZD3A 3RTVA 3K1RB 2HBLA 2IOHA 2QB0A 1UA1A 5J0RA 1BVSA 2AGPA 3TARA 2Y0SF 9ICEA 2AU0A 3LDAA 5KFBA 2KIWA 2ASJA 3L3FX 2JH1A 2HBMA 4DF4A 2K4EA 1Q8KA 8ICVA 3TFSA 1B4FA 2ZJAA 1U45A 3GV7B 1L3TA 2I6XA 1ZQMA 2MSNA 5IIIA 4O9MA 3JPQA 1PK1A 3K75D 3M6KA 4QZEA 3OSNA 5ALXA 4KTQA 1KLNA 5AKZA 4PHPA 5CRXA 1WWVA 4EELA 4CF4A 3LWLA 4PPXA 2ZIVA 2G08A 4B9TA 1IXRA 4JUZA 2FPMA 1TV9A 1RG6A 8ICZA 2HHUA 2M9NA 5DDMA 2BQ3A 3UM9A 1ZQJA 1A0PA 3M6ZA 4O3NA 1UT5A 2BHNA 3E58A 2V4RA 1ZQYA 3C5GA 2KKVA 4CGZA 3FM9A 1DRGA 4R63A 4DSLA 1C20A 1QQ6A 4NLCA 5DBCA 3GIMA 3TKAA 5J0UA 2YMPA 3QZ7A 4ED7A 2HHQA 2VA8A 3PW5A 4PGYA 1RPLA 5BOLA 4IQTA 4KLGA 2DPIA 2G0AA 3D2SA 3KTQA
chains in the Genus database with same CATH topology
4BX9C 4QJFB 4O3MA 2H3VA 2ZIUB 3KZXA 1CRXA 2KOBA 2GH1A 4JMUA 4FZMA 4P0QB 2E1EA 2HOQA 3GU3A 2JH7A 2WB1C 3PSPA 4CDGA 2K89A 2W03A 2JGAA 2KICA 2Y0SF 4IC9A 4QNLA 2G07A 2Y0SC 2K4IA 1NZBA 5KL1B 1A6SA 2H3ZA 2CPRA 2KIWA 2G5IB 3O0FA 3F53A 4FZLA 3IP4B 4AYBF 2RHFA 2F8LA 4AYBC 2RRDA 4ICAA 2ZXHA 3SAGA 3PZPA 2DQNB 3VCBA 2XI9A 2Z7JA 2JH1A 2E1FA 2HBMA 2KVCA 3AQFA 2LYAA 3H0MB 2K8BB 1PVRA 2K4EA 4U6PA 3SMVA 3T79A 4NV0A 4NLBA 1UPHA 5HR7A 2M0NA 3NUQA 2KD1A 1D8BA 1XO0A 2H3FA 3L3FX 4P0QA 2K8AA 2VIXA 1URJA 2HMXA 1F44A 3VC8A 2ZIVB 3K1ZA 1WUDA 3OPXA 2HOIA 4BJQA 2KEYA 2ZXIA 3H0LB 4OJ5A 2DGZA 4BUGA 1HIWA 2JMGA 2G5HB 2JHDA 2MRLA 3GZFA 1SZHA 2ZG6A 3PSIA 4WJ3B 3M6KA 2LYBA 5C0YA 2CN1A 2KNJA 2BDUA 2OXOA 3CYMA 3M7DA 1IIPA 4ACOA 4CRXA 3PSFA 2K8CB 1ZQ1C 3RF9A 3SAFA 3LVWA 2LBOA 5CRXA 3IG8A 2W7PA 2KJ5A 4OJLA 1L6NA 3E0FA 3IG5A 4FE3A 2LKYA 3F2BA 2KJ8A 2W7OA 3CP8A 2KHVA 3D2NA 2KHQA 2ZIVA 2G08A 3LVVA 2YX8A 1XNSA 1Q3UA 3F2DA 4PL2A 2VKQA 1GO3F 4A8EA 3F5AA 2KV2A 2YB4A 3NRWA 4OJPA 1OUQA 2F76X 3C29A 4FZNA 4U7CA 2F2AB 4C0ZA 2VJ4A 2DF4B 1KBUA 1ECWA 3F5EA 4QIWF 2KKPA 1HEKA 4KMOB 3ICXA 2LHTA 1A0PA 4OJOA 3RFAA 2XIDA 3ONNA 3KFUF 5A0LA 3M6ZA 2F77X 3D2QA 2WAQF 2GOLA 2H3QA 2G06A 2H3IA 2WAQC 1MA7A 2XICA 3CRXA 2HBKA 2K4HA 2MA1A 2KKVA 3HKZF 4CGZA 5T14A 2ZIWA 3HKZC 1DRGA 5KL8B 4OO1J 1PVPA 1Z1BA 3AL0B 2D6FC 1P7DA 2ZIWB 4GFJA 2WB1F 2OYYA 3MGVA 2PMZF 2A3VA 2PMZC 3LYSA 3PSTA 3N7RC 1YT3A 2Q4TA 4NLCA 4PL1A 4KX5A 3H0RB 3SQIA 2HOFA 4P0PA 1Z19A 2E5SA 3N7SC 2OM6A 3SAHA 4P0PB 5HR6A 4OJ6A 2XVTA 2G09A 2N1RA 3IN5A 2NV3A 3C28A 2RP5A 2ZIXA 3AQEA 4QIWC 1Q3VA 2W04A 2CRXA 1PVQA 2ZIXB 2VJ5A 3F2CA 2HBLA 2OH2A 2YB1A 2HBJA 2KJ9A 4KX3A 1ED1A 2G0AA 1T94A 2ZIUA 3N7PD 4NWIA 3D2SA 3DEEA 2R18A 3ALRA 1TAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB F;  2WAQ F;  2Y0S F;  2WB1 F;  2PMZ F;  3HKZ F; 
#chains in the Genus database with same CATH topology
 2W3R A;  5J0P A;  5CHG A;  1DOQ A;  3QE9 Y;  2G07 A;  3I76 A;  1A6S A;  2W9B A;  3H8S A;  4FZL A;  3V7J A;  3UXN A;  3PW2 A;  2QB1 A;  1JMS A;  1TE2 A;  7ICQ A;  1T3N A;  4RQ3 A;  4NL9 C;  3NUQ A;  1XO0 A;  1X9X A;  5GTI U;  3EPI A;  4J03 A;  7ICN A;  1OXJ A;  1S5L U;  1ZQX A;  2FJ6 A;  4LJX A;  4QZB A;  4BWM A;  1SZH A;  4RQ8 A;  1ZD4 A;  3RBE A;  7ICG A;  4DL4 A;  2K8C B;  1ZQ1 C;  3NAS A;  2LBO A;  1LKY B;  5AKK A;  3GIK A;  1QSS A;  4NY8 A;  5F3X B;  1WYG A;  3BDP A;  1F5S A;  1K5O A;  4J9N A;  4DQQ A;  2JXJ A;  1X6J A;  4PL2 A;  7ICJ A;  2FI1 A;  4YCX A;  4PGX A;  2LYH A;  2Y9T A;  2EH9 A;  1JN3 A;  3Q8P B;  3DDH A;  4F5P A;  5ALW A;  5ALP A;  7ICP A;  1X42 A;  3Q8R B;  4ED0 A;  1XO1 A;  2HI0 A;  4DL2 A;  4DSK A;  4DS5 A;  5DBB A;  3ZDB A;  3RB6 A;  3PR4 A;  2D6F C;  4GFJ A;  1KQQ A;  2WHE A;  2Q4T A;  2E5S A;  2ALZ A;  2OM6 A;  1FIQ A;  4YR2 A;  4F5O A;  4BXO A;  2N1R A;  5KFJ A;  5EWE A;  2KVS A;  5EE1 A;  5DG7 A;  4F2R A;  3NRZ A;  1ZQB A;  4RNM A;  3N97 B;  3DEE A;  3ALR A;  1MN8 A;  4C8N A;  1CRX A;  2GH1 A;  2ZUC A;  4ZH4 A;  4C8L A;  2BPC A;  2XY5 A;  4QNL A;  4J9M A;  4DLE A;  2G5I B;  4AYB C;  3SAG A;  4F91 B;  4JV2 A;  4I2E A;  5KFR A;  4Q8F A;  4U6P A;  5IIN A;  4QWC A;  2XO7 A;  2OCE A;  2D3D A;  3ZDC A;  2EZY A;  2D8C A;  2PKE A;  2FLP A;  1QQ5 A;  3MR3 A;  4RNO A;  3RB0 A;  2BDU A;  3AN1 A;  1KDH A;  5L1L A;  1BPY A;  1NOM A;  4YG2 A;  3TAD A;  2W8K A;  4Y2Q A;  5DKW A;  9ICS A;  4YXJ A;  1L3U A;  3ISD A;  3TAQ A;  2YX8 A;  3PO4 A;  2E8P A;  4F93 B;  5EWF A;  3MGH A;  4M9H A;  1NK9 A;  4B9S A;  4PZN A;  4PHA A;  4RQM A;  3OJU A;  3WK7 A;  1N62 A;  4DLG A;  5ALM A;  4M2Y A;  3BQ2 A;  3HW8 A;  5KFG A;  9ICT A;  2EDU A;  1NI3 A;  5BOM A;  8ICJ A;  1O08 A;  3C28 A;  2KTQ A;  2BPF A;  4XRH A;  2ZIX B;  3M9N B;  3F2C A;  1V85 A;  1DGS A;  5AKH A;  3GIL A;  3TFR A;  2PFN A;  5AI0 A;  4EBE A;  1MQ3 A;  1TAM A;  5DQH A;  1KEJ A;  5TIS U;  1V97 A;  3KHG A;  2Y9U A;  4NLZ A;  4IQV A;  3CW2 C;  2W03 A;  2Y0S C;  3AUO A;  4ICA A;  5AM2 A;  2Z7J A;  3WKB A;  4Y2V A;  1KFS A;  5KG7 A;  4KLJ A;  1XWL A;  3AMZ A;  5EE3 A;  5C5J A;  4KLI A;  2E8N A;  4UAS A;  1XSL A;  1RXV A;  4YFK A;  2AXT U;  3RJF A;  1JIH A;  2KNJ A;  7ICO A;  3CNH A;  1IIP A;  5HMM A;  1RYS A;  1ZQQ A;  5J0T A;  3M8R A;  3C2K A;  1COO A;  5J0S A;  2LKY A;  4Q45 A;  1GO3 F;  7ICR A;  1Z4O A;  8ICR A;  4JWM A;  1RQL A;  1UHU A;  1S0V A;  4YXM A;  1WCL A;  3QUQ A;  4P4M A;  3RJG A;  4Y2P A;  2F1J A;  2HBK A;  1JXE A;  4I2B A;  1N61 A;  1FFV A;  1Z1B A;  2PMZ F;  4RQ2 A;  4XA5 A;  3SQI A;  3ETR A;  4RPY A;  1BPZ A;  3WKC A;  4GC7 A;  1SGG A;  1L8O A;  1F0M A;  4QZC A;  3AQE A;  3H7I A;  1Q3V A;  8ICL A;  2W9M A;  2VJ5 A;  1QSL A;  5KFT A;  2ISO A;  4ED1 A;  3C2M A;  5BPC A;  3L4P A;  5AKE A;  4P0Q B;  3PML A;  2HOQ A;  5KAI U;  9ICL A;  1ARO P;  9ICQ A;  5DQG A;  1CI4 A;  5ALE A;  4QZ8 A;  5AKL A;  9ICV A;  4B9L A;  2UVW A;  2JEJ A;  3O0F A;  2XY6 A;  1ZQH A;  2ISP A;  2V9W A;  1ZJN A;  1CUK A;  2KK0 A;  3PX0 A;  3VCB A;  1N5X A;  8ICG A;  3WK5 A;  2R8G A;  4TQS A;  5CA7 A;  4UAT A;  2W9A A;  7ICF A;  4DOC A;  1SKW A;  3SZ2 A;  3NVY A;  1SKS A;  3PNC A;  1F44 A;  3QZ8 A;  1LV5 A;  1U9L A;  2KEY A;  1HIW A;  2QLT A;  4UAU A;  3RR7 A;  2G5H B;  4ECV A;  1D8L A;  2IMW P;  1H38 A;  5KG3 A;  3PW0 A;  5J2G A;  3LVW A;  5ALI A;  2ATL A;  3H4D A;  2HHS A;  2A1A A;  1IV8 A;  4ECR A;  2BZF A;  3ZD8 A;  2RLT A;  2BDP A;  2ESE A;  5ALN A;  9ICX A;  2KV2 A;  2YB4 A;  5ALU A;  1T4G A;  4ECU A;  2NYV A;  1XSP A;  2I1Q A;  4F5R A;  8ICH A;  4G3I A;  3D6J A;  2DF4 B;  3RR8 A;  2YMQ A;  3THV A;  4KLO A;  4RQN A;  4MEY A;  1JRO A;  4ECQ A;  1ZQP A;  1SV0 A;  2EQY A;  8ICP A;  4OO1 J;  4F71 A;  4K4H A;  3TAC B;  4P0P A;  4GXI A;  4I2A A;  4FO6 A;  5DB8 A;  1BGX T;  4UAY A;  2CRX A;  5D46 A;  2HSZ A;  4BXO B;  1DK3 A;  1NKE A;  4O3S A;  4Y2X A;  4EEK A;  1VLB A;  1FO4 A;  3BQ0 A;  4C8M A;  4O3O A;  5EWG A;  2WF5 A;  2B21 A;  5ALZ A;  4QJF B;  3KZX A;  5ALR A;  2J6U A;  4YQW A;  2WB1 C;  4UAZ A;  4OD0 A;  4NJ8 A;  3SYZ A;  5G5G A;  3TAN A;  1NJW A;  3MGI A;  3C5F A;  9ICC A;  2LYA A;  4GLX A;  1S76 D;  1ZRM A;  5HR7 A;  4C4T A;  1DK2 A;  4PHD A;  2W9C A;  3KBB A;  2Q0Z X;  3QU5 A;  4ECS A;  4Q8E A;  3UQ2 A;  2OWO A;  5J2J A;  4Z6E A;  3H8M A;  5L1M A;  4O0I A;  4Y2Y A;  3UMC A;  4KLH A;  3WK4 A;  5ALT A;  4F4K A;  3RAX A;  3V72 A;  3ISB A;  3GQC A;  4YMO A;  5AK4 A;  1N60 A;  4UB5 A;  1KL9 A;  5IIJ A;  3SEN A;  1ZQC A;  2HHW A;  2FPL A;  1QCK A;  5AIC A;  4XUS A;  4OJP A;  4F8R A;  7ICU A;  1PUZ A;  4UAR A;  4QIW F;  3F5E A;  3ISC A;  3QU2 A;  2JEI A;  2LHT A;  1SB3 C;  2HDO A;  3UMG A;  1L5U A;  2WAQ F;  3TAP A;  1NKC A;  2EZX A;  2KFN A;  5J2F A;  1YT3 A;  5J2K A;  2PXI A;  3EWA A;  1SXE A;  2NRZ A;  3MR6 A;  1SL1 A;  3PO5 A;  4F2S A;  1L7M A;  3MDA A;  2OH2 A;  3ZDD A;  3HJE A;  3B0Y A;  3HIL A;  5D4B A;  1T94 A;  4BX9 C;  4O3M A;  4ELT A;  1ZQV A;  5D49 A;  5AI8 A;  1NJX A;  3PSP A;  4DWI A;  1NZB A;  4O5C A;  3NGD A;  1KTQ A;  2CPR A;  4KN4 A;  3QNM A;  4TUS A;  2RRD A;  2MAX A;  3E2E A;  1ZQN A;  3H0M B;  1J2N A;  1UPH A;  1N5W A;  3KHR A;  4JV1 A;  4FFD A;  4P0Q A;  4I2I A;  3VC8 A;  3K1Z A;  1J97 A;  1L3S A;  3SI8 A;  2BPG A;  1BPB A;  3H0L B;  2JHD A;  2BCU A;  2QAR A;  2FE9 A;  4I2J A;  1BPE A;  2HHT A;  4QWD A;  3IDW A;  4QWB A;  4NM2 A;  3RF9 A;  2W8L A;  4QW9 A;  9ICN A;  2HW3 A;  3FC4 A;  4DQS A;  3RB3 A;  5DB7 A;  4IRD A;  2KHV A;  4F72 A;  2E3T A;  3BS7 A;  5EE9 A;  2A1J B;  2VKQ A;  3GV5 B;  3NRW A;  1V9P A;  8ICE A;  2XGQ A;  4X5V A;  4DFD A;  1TFR A;  1UCV A;  5DGB A;  1SIJ A;  2C22 A;  1HEK A;  4KMO B;  3H40 A;  1JAL A;  5AK6 A;  2PI4 A;  4LVS A;  4GIB A;  2K4H A;  1N56 A;  4RUC A;  3DV9 A;  1ZQR A;  4O3P A;  5AIA A;  2PMZ C;  1OW5 A;  2HOF A;  4KX5 A;  4I28 A;  8ICW A;  3N7S C;  1U4B A;  2EZZ A;  3SAH A;  4KLE A;  4I2F A;  1S10 A;  4HAI A;  2YML A;  2JR5 A;  4BGD A;  4Y2U A;  3ZD9 A;  1NNL A;  5KG0 A;  2WF7 A;  3JPT A;  2ZIU A;  4I2C A;  4YMN A;  3HX0 A;  4IR1 A;  5AKY A;  4QWE A;  1Y88 A;  4UB2 A;  3EZ5 A;  2W11 A;  3SR6 A;  4J9L A;  4KLF A;  5KFS A;  4UAW A;  4IC9 A;  4DL5 A;  3R9K A;  2K4I A;  2I9G A;  2RHF A;  5AK3 A;  3HP6 A;  5KFE A;  1TKD A;  4NL9 A;  4RPX A;  4J9Q A;  2DKZ A;  2KN7 A;  3FAH A;  4NLN A;  1BPX A;  4ED6 A;  4EYI B;  4MHV A;  5DG8 A;  5L1I A;  2H3F A;  4YD2 A;  1JXL A;  1J2M A;  5KFI A;  5ALY A;  1ZQF A;  8ICO A;  5L1J A;  4IQU A;  5KFC A;  2JMG A;  3GZF A;  3NVZ A;  1TK8 A;  4C4R A;  1TK5 A;  4ECY A;  2PFO A;  4J9K A;  5DGA A;  2MUT A;  3QU9 A;  4US9 A;  2UVV A;  2KJ5 A;  4OJL A;  4PHE A;  5EE0 A;  4O3Q A;  3NVV A;  4EEY A;  5AI9 A;  8ICM A;  4J9S A;  2ZUD A;  1HJP A;  2JV3 A;  1Q3U A;  2KG5 A;  2ODG A;  3C29 A;  2P6U A;  1QLN A;  4CE6 A;  5KNI A;  3PMN A;  4DS4 A;  4ELV A;  3SD7 A;  2XCP A;  4M9J A;  2BQR A;  3WK8 A;  4QZ9 A;  2G06 A;  4O5E A;  5KG5 A;  4DL3 A;  5B66 U;  2B0C A;  1M6Y A;  7ICE A;  2YN4 A;  3MGV A;  4KLM A;  2UVR A;  9ICU A;  1ZQE A;  2DL0 A;  4M6W B;  5CB1 A;  4P0P B;  3EPG A;  2V4Q A;  2HVI A;  1SWV A;  4F92 B;  4B9V A;  4C4S A;  4Z6C A;  3RAQ A;  7ICL A;  4K4I A;  2HHX A;  5AK5 A;  1S0N A;  2KJ9 A;  4R8U A;  1ZOL A;  2NRV A;  5AIB A;  3GV8 B;  1X9W A;  5DB9 A;  3NTU A;  2IOF K;  3H8W A;  1X66 A;  4O5K A;  2ZJ8 A;  3MR2 A;  3H8J A;  1X9M A;  4CF5 A;  3PZP A;  2DQN B;  3G6X A;  4DL6 A;  2J6S A;  5J29 A;  2BR0 A;  5HHH A;  4NV0 A;  5JRT A;  1MQ2 A;  5AM5 A;  4YR3 A;  2RDJ A;  2DPJ A;  5F9N A;  2W9C B;  1O03 A;  3Q8L A;  2AHO B;  1WUD A;  2ZXI A;  3KKA C;  5CJ7 A;  4F50 A;  1ZQT A;  4BUG A;  4ED8 A;  3BZK A;  4PGQ A;  1D8Y A;  3V6J A;  3HWT A;  3ZDA A;  1XS9 D;  4AP9 A;  5KAF U;  1HUO A;  1WG8 A;  1QSY A;  3M8S A;  4Z6F A;  3E0F A;  5DB6 A;  2MU2 A;  1JUD A;  4DQI A;  1XC9 A;  5KFZ A;  3H4B A;  3RJE A;  3F2D A;  4J9R A;  1UQV A;  2O6K A;  5J8Y A;  1ZRN A;  2W3S A;  3QU7 A;  4DCC A;  3NVW A;  3KFU F;  2FPK A;  4QZF A;  3AM9 A;  2WAQ C;  1TVA A;  7ICS A;  4RT3 A;  3EUB 2;  5T14 A;  2ZIW A;  3UQ0 A;  1NK7 A;  4MFA A;  1PVP A;  2A1J A;  1KN5 A;  5AKI A;  3V7K A;  1N48 A;  4IL6 U;  5CP2 A;  2LMR A;  1NZP A;  1IG6 A;  4LZD A;  3HPO A;  4M04 A;  1Z00 A;  5J0Y A;  7ICM A;  2IOF A;  2RQ5 A;  2RP5 A;  3C1Y A;  4QZG A;  4IRK A;  3I28 A;  3TQ1 A;  9ICB A;  4KX3 A;  4NWI A;  2ASL A;  2H5X A;  1ZQZ A;  3OTQ A;  1QQ7 A;  2JZB A;  1TAQ A;  1FFU A;  4F4W A;  3PX4 A;  3JPR A;  2J6T A;  1QTM A;  4F4X A;  4QZD A;  4KMU A;  2DFL A;  5K4L A;  4R65 A;  1NK0 A;  4DFK A;  4BWJ A;  4KIT B;  7ICI A;  4R66 A;  4Y2S A;  3RJJ A;  2WF6 A;  4DFP A;  3Q8K A;  1KRP A;  2F44 A;  5KT7 A;  2ZJ5 A;  3T5J A;  2LI6 A;  2DGZ A;  4KLL A;  3PY8 A;  2MRL A;  2BKE A;  4DOA A;  2OEH A;  2CN1 A;  2EAO A;  5ALQ A;  2QAR B;  4ECX A;  3PSF A;  2P66 A;  4RQ0 A;  4F4Y A;  4QZA A;  1L6N A;  3QUB A;  3IG5 A;  3G6Y A;  1N2X A;  4RPZ A;  3N28 A;  3RJI A;  2K4P A;  4RZR A;  1DXS A;  8ICT A;  5J2I A;  2DUY A;  3WKD A;  3BZC A;  3F5A A;  5J2D A;  2WF9 A;  1LB2 B;  2F76 X;  4KLQ A;  5J2E A;  1EXN A;  2HVH A;  2KZM A;  5IIK A;  5L9X A;  1U47 A;  3ICX A;  3RFA A;  2GWS A;  8ICQ A;  1X40 A;  5A0L A;  3D2Q A;  2H3Q A;  3CRX A;  9ICA A;  3HKZ F;  1ZQO A;  4RQ7 A;  3PR5 B;  4RT2 A;  3PST A;  3Q8M A;  4PL1 A;  2AGO A;  5ALO A;  1X6I A;  4IS7 A;  2R8H A;  4FBT A;  4C7Z A;  5DDY A;  2NV3 A;  2EAN A;  1MSW D;  1PVQ A;  5KFY A;  3BS5 B;  3RBD A;  3OHA A;  3N7P D;  3WKE A;  1NK5 A;  3BQT A;  9ICK A;  5DBA A;  2ZIU B;  5KFM A;  1ZQL A;  2KOB A;  5KT2 A;  2E1E A;  2R8I A;  4DEZ A;  4CNQ A;  2PFQ A;  4M6W A;  4CDG A;  5HNK A;  1VJ5 A;  3F53 A;  1ZQG A;  3Q8S B;  4KN7 A;  1UA0 A;  3IRU A;  2E1F A;  5KT6 A;  3KHH A;  3JPP A;  1L7O A;  2E8O A;  4NLB A;  1D8B A;  1S0O A;  2WTF A;  1V38 A;  3C2L A;  4C80 A;  3OSP A;  3PV8 A;  3MC1 A;  1HUZ A;  4J9P A;  3T5L A;  2IHN A;  9ICW A;  4ACO A;  4QZI A;  2MUT B;  4OCZ A;  4YD1 A;  1L7P A;  3PW7 A;  3RB4 A;  1T7P A;  4M9G A;  2W43 A;  1TAU A;  4M0A A;  1PZN A;  1XNS A;  1Z3E B;  4UQG A;  4I2D A;  1QH9 A;  3ED5 A;  4DSF A;  4C8O A;  3V6H A;  4TUP A;  2F2A B;  4J9O A;  5KT3 A;  2VJ4 A;  4DOB A;  2BCR A;  2KKP A;  3GII A;  4TUQ A;  2FLN A;  4C8K A;  5KFK A;  5ALJ A;  4NLG A;  2LM4 A;  3HT3 A;  2IBK A;  4NLK A;  4KLD A;  3L5K A;  3QUT A;  1L7N A;  2BCV A;  2PFP A;  5KL8 B;  2VA3 A;  2WFA A;  8ICC A;  5G5H A;  4Y2R A;  5HR6 A;  4OJ6 A;  2IHM A;  1NJZ A;  2ZTE A;  3T5K A;  2KP7 A;  1L3V A;  4G9B A;  1RZT A;  1S8O A;  1BPD A;  4ED3 A;  4EEN A;  7ICT A;  2AQ4 A;  4DFM A;  1KSP A;  4R8U B;  5IIM A;  1ZQU A;  2H3V A;  5DLG A;  3V6K A;  3M1Y A;  3RJH A;  2YY6 A;  4CF3 A;  5JTI A;  2LM1 A;  2F1I A;  5L1K A;  2ZXH A;  3S6J A;  2NO5 A;  4YVZ A;  2K8B B;  3QXG A;  4M9L A;  2IA6 A;  4EX7 A;  1SKR A;  5KFL A;  2FMQ A;  3MFI A;  1U49 A;  2P6R A;  2NRT A;  4K4G A;  2NO4 A;  2LYB A;  1AQ6 A;  5ALH A;  2OXO A;  5H2F U;  3IV6 A;  5DLF A;  2F8K A;  9ICM A;  4Q44 A;  2ZTD A;  1S77 D;  4FE3 A;  2KJ8 A;  3FDS A;  2EAM A;  4DL7 A;  3NS1 A;  3JPO A;  1ZQS A;  2ZTC A;  2RDI A;  4MF8 A;  1X2I A;  3ZDE A;  3KOO A;  4A8E A;  2FDR A;  8ICN A;  9ICP A;  5J0W A;  1DGJ A;  1L8L A;  1RDF A;  2F77 X;  2XIC A;  3ETL A;  3T5H A;  2ZIW B;  3WKA A;  5HML A;  5EOZ A;  4C7Y A;  4YMM A;  4RQ1 A;  5KT4 A;  3IN5 A;  4M47 A;  2WF8 A;  1Z00 B;  1VDV A;  3RH6 A;  1ZQA A;  2NRX A;  4ECZ A;  2L5Y A;  5KFA A;  4I2G A;  3WK9 A;  5KFQ A;  4R64 A;  2XCA A;  4I27 A;  4BJQ A;  3A0B U;  5KFU A;  3PX6 A;  5KG2 A;  3RJK A;  4JMU A;  7ICK A;  2XY7 A;  2Y1J A;  2JZB B;  4USA A;  5E79 U;  2KE7 A;  3N4M B;  2C2E A;  8ICS A;  3MFH A;  3WK6 A;  4TQR A;  2VA2 A;  1Z1V A;  3BS5 A;  1SL0 A;  8ICF A;  5AI5 A;  2JEG A;  3G6V A;  3AU2 A;  4F5Q A;  1C7Y A;  1NKB A;  9ICG A;  1KFD A;  8ICY A;  2R8J A;  3OPX A;  5J2B A;  3UXP A;  4KLU A;  4MFF A;  4EYH B;  1MC8 A;  3KD3 A;  3PSI A;  2I5H A;  1ZD2 P;  1ZJM A;  5KFX A;  4M9N A;  4UB6 U;  4Z6D A;  5CEH A;  1NK4 A;  5KFO A;  5KG6 A;  3I1Y A;  4Q43 A;  2C2D A;  2E8M A;  1A77 A;  2P35 A;  2F3N A;  3TAD C;  3C23 A;  4ED2 A;  2KHQ A;  5AKG A;  4QW8 A;  3QUC A;  3A0H U;  3K4G A;  4U7C A;  4C0Z A;  3QEB Z;  3UPQ A;  2C2R A;  2YQE A;  5ALV A;  3EYZ A;  1NK6 A;  4KLS A;  2R8K A;  4EBC A;  1SXD A;  4IQW A;  3BJY A;  3HKZ C;  4DSE A;  5F9L A;  1P7D A;  2WB1 F;  8ICA A;  3V7L A;  3LYS A;  4US8 A;  3N7R C;  3OGU A;  3H0R B;  3BQ7 A;  5J2A A;  4FBU A;  1NK8 A;  4P2H A;  3UXO A;  5ALL A;  2KSO B;  4DFJ A;  1ZQK A;  5AI6 A;  2BCS A;  3GIJ A;  1KW4 A;  4F3O A;  5IIL A;  3KZI U;  2HBJ A;  3MBY A;  1Q46 A;  3ZI4 A;  2DWQ A;  2R18 A;  1N63 A;  3GU3 A;  4JB3 A;  5J0X A;  4HYK A;  2JGA A;  1RQN A;  2KIC A;  1SWW A;  4RQ5 A;  3LWM A;  5KL1 B;  8ICB A;  3IP4 B;  7ICV A;  1ZQD A;  4BDP A;  5HP4 A;  7ICH A;  3WU2 U;  4RQ4 A;  1KKX A;  2ES6 A;  4EX6 A;  2M0N A;  1ZYQ A;  5KG4 A;  2VIX A;  1URJ A;  4YP3 A;  2KMD A;  5J0O A;  4OJ5 A;  3C1Z A;  4DF8 A;  3MR5 A;  4ZOH C;  4WJ3 B;  4PH5 A;  5J8Y C;  1WCN A;  3CYM A;  2FLL A;  4CRX A;  4XQ8 A;  3LK9 A;  5TZV A;  3IG8 A;  1RYR A;  5AHX A;  3EW9 A;  1A76 A;  2ZUB A;  3JPS A;  4DSJ A;  3D2N A;  1PK3 A;  3QEA Z;  3IM1 A;  3FYH A;  5ALG A;  2KFZ A;  3M9M B;  2A19 A;  4GXJ A;  4Y2J A;  4F4Z A;  1B0X A;  4P4P A;  1KBU A;  2AJQ A;  4RNN A;  3KHL A;  3OHB A;  2XID A;  3ONN A;  4MFC A;  2GOL A;  2H3I A;  1COK A;  2QB0 B;  3HRD D;  1K1Q A;  1BNO A;  5KTQ A;  4B6J A;  5KFN A;  4DO9 A;  5AM1 A;  1T3Q A;  2A3V A;  4IR9 A;  9ICF A;  5KG1 A;  4Y2T A;  4UB3 A;  3SV3 A;  4UB1 A;  5AI4 A;  4I29 A;  4TUR A;  2XGP A;  3OJS A;  3AEV A;  4QIW C;  4GXK A;  3B9J A;  2W04 A;  4RQ6 A;  3RH4 A;  5DQI A;  1S0M A;  2F1H A;  4DQR A;  1SZP A;  5JU5 A;  1ED1 A;  3B0X A;  2W54 A;  5AM4 A;  4F5N A;  2NRW A;  3SEI A;  4O3R A;  4MEX A;  5AM0 A;  2KZ3 A;  3RRH A;  5KFW A;  1PK1 B;  4YR0 A;  2H3Z A;  4NXZ A;  1KFT A;  4GC6 A;  2B6G A;  5B5E U;  1PVR A;  2KVC A;  3AQF A;  1S9F A;  3TI0 A;  1IM4 A;  2FMP A;  8ICK A;  2BGW A;  1BNP A;  3KKA A;  3AU6 A;  2QKQ A;  2BCQ A;  3PW4 A;  1XU4 A;  2XC9 A;  2ZIV B;  1JX4 A;  3GFK B;  2FMS A;  3MDC A;  2DKX A;  3UMB A;  4EZ6 A;  2Y1I A;  1K1S A;  9ICI A;  2C28 A;  4IRC A;  4ECW A;  1B22 A;  2YTU A;  4UBB A;  1D9F A;  4CCH A;  5AKJ A;  3M7D A;  4QWA A;  1B43 A;  1LKY A;  4UAV A;  4UBC A;  3PVX A;  4QZH A;  5DG9 A;  1RYU A;  1ZD5 A;  1JI7 A;  3LVV A;  4B9N A;  4PZO A;  5KFP A;  3BQ1 A;  1OUQ A;  5KFV A;  2KIV A;  9ICO A;  4P4O A;  8ICI A;  2VAN A;  5ALK A;  3RH5 A;  4OJO A;  4UB8 U;  5KT5 A;  3JPN A;  1MA7 A;  5IIO A;  8ICX A;  1NJY A;  5ALD A;  5GTH U;  9ICR A;  1Z4N A;  1SV0 C;  2OYY A;  1S97 A;  1CEZ A;  5ALS A;  2OHF A;  4NM1 A;  2W9B B;  1XSN A;  5CWR A;  5JUM A;  1RXW A;  1D9D A;  2AGQ A;  3C21 A;  2YMM A;  1ZQW A;  1X9S A;  2YB1 A;  2JRZ A;  2W55 A;  2HHV A;  3U26 A;  3IHQ B;  3QX7 A;  5KFD A;  4UW9 A;  2GO7 A;  4FZM A;  3GDX A;  2JH7 A;  2K89 A;  3Q8Q B;  2GLE A;  2EAP A;  4E0D A;  4JV0 A;  4EBD A;  2CXY A;  2KSO A;  5CR0 A;  9ICJ A;  5J0Q A;  4AYB F;  2F8L A;  4DSI A;  1ZET A;  2XI9 A;  1RM6 C;  4PJ0 U;  4RUA A;  4RU9 A;  4B9U A;  3SMV A;  3T79 A;  4ECT A;  2UVU A;  2DBY A;  4KLT A;  2KD1 A;  2BQU A;  2AH5 A;  1JRP A;  2K8A A;  3M9O B;  2HMX A;  9ICH A;  2HOI A;  4FS1 A;  1SL2 A;  3SV4 A;  3QYP A;  5J2C A;  2ZG6 A;  2HCF A;  5C0Y A;  1WWU A;  4DQP A;  5ALF A;  5KFH A;  5HHI A;  2AQ0 A;  4B9M A;  3SAF A;  1U48 A;  2W7P A;  2PI5 A;  3F2B A;  5AKX A;  5KFF A;  1T8E A;  2W7O A;  3J81 j;  1ZXI A;  3CP8 A;  1YZ7 A;  3QU4 A;  5FP0 A;  4YN4 A;  4FZN A;  1ECW A;  3T3F A;  2K60 A;  2JEF A;  3RRG A;  4LZG A;  8ICU A;  2KZZ A;  4FS2 A;  4EZ9 A;  5J2H A;  2MA1 A;  2ASD A;  5AM3 A;  3AL0 B;  4MF2 A;  4I2H A;  3ORY A;  1ZQI A;  1FEZ A;  4UB4 A;  4JWN A;  1Z19 A;  1TK0 A;  1UT8 A;  4JK1 A;  1LVH A;  2XVT A;  1YZ6 A;  2G09 A;  2LPE A;  4ELU A;  2ZIX A;  3MAB A;  1SV4 A;  1ZD3 A;  3RTV A;  3K1R B;  2HBL A;  2IOH A;  2QB0 A;  1UA1 A;  5J0R A;  1BVS A;  2AGP A;  3TAR A;  2Y0S F;  9ICE A;  2AU0 A;  3LDA A;  5KFB A;  2KIW A;  2ASJ A;  3L3F X;  2JH1 A;  2HBM A;  4DF4 A;  2K4E A;  1Q8K A;  8ICV A;  3TFS A;  1B4F A;  2ZJA A;  1U45 A;  3GV7 B;  1L3T A;  2I6X A;  1ZQM A;  2MSN A;  5III A;  4O9M A;  3JPQ A;  1PK1 A;  3K75 D;  3M6K A;  4QZE A;  3OSN A;  5ALX A;  4KTQ A;  1KLN A;  5AKZ A;  4PHP A;  5CRX A;  1WWV A;  4EEL A;  4CF4 A;  3LWL A;  4PPX A;  2ZIV A;  2G08 A;  4B9T A;  1IXR A;  4JUZ A;  2FPM A;  1TV9 A;  1RG6 A;  8ICZ A;  2HHU A;  2M9N A;  5DDM A;  2BQ3 A;  3UM9 A;  1ZQJ A;  1A0P A;  3M6Z A;  4O3N A;  1UT5 A;  2BHN A;  3E58 A;  2V4R A;  1ZQY A;  3C5G A;  2KKV A;  4CGZ A;  3FM9 A;  1DRG A;  4R63 A;  4DSL A;  1C20 A;  1QQ6 A;  4NLC A;  5DBC A;  3GIM A;  3TKA A;  5J0U A;  2YMP A;  3QZ7 A;  4ED7 A;  2HHQ A;  2VA8 A;  3PW5 A;  4PGY A;  1RPL A;  5BOL A;  4IQT A;  4KLG A;  2DPI A;  2G0A A;  3D2S A;  3KTQ A; 
#chains in the Genus database with same CATH homology
 4BX9 C;  4QJF B;  4O3M A;  2H3V A;  2ZIU B;  3KZX A;  1CRX A;  2KOB A;  2GH1 A;  4JMU A;  4FZM A;  4P0Q B;  2E1E A;  2HOQ A;  3GU3 A;  2JH7 A;  2WB1 C;  3PSP A;  4CDG A;  2K89 A;  2W03 A;  2JGA A;  2KIC A;  2Y0S F;  4IC9 A;  4QNL A;  2G07 A;  2Y0S C;  2K4I A;  1NZB A;  5KL1 B;  1A6S A;  2H3Z A;  2CPR A;  2KIW A;  2G5I B;  3O0F A;  3F53 A;  4FZL A;  3IP4 B;  4AYB F;  2RHF A;  2F8L A;  4AYB C;  2RRD A;  4ICA A;  2ZXH A;  3SAG A;  3PZP A;  2DQN B;  3VCB A;  2XI9 A;  2Z7J A;  2JH1 A;  2E1F A;  2HBM A;  2KVC A;  3AQF A;  2LYA A;  3H0M B;  2K8B B;  1PVR A;  2K4E A;  4U6P A;  3SMV A;  3T79 A;  4NV0 A;  4NLB A;  1UPH A;  5HR7 A;  2M0N A;  3NUQ A;  2KD1 A;  1D8B A;  1XO0 A;  2H3F A;  3L3F X;  4P0Q A;  2K8A A;  2VIX A;  1URJ A;  2HMX A;  1F44 A;  3VC8 A;  2ZIV B;  3K1Z A;  1WUD A;  3OPX A;  2HOI A;  4BJQ A;  2KEY A;  2ZXI A;  3H0L B;  4OJ5 A;  2DGZ A;  4BUG A;  1HIW A;  2JMG A;  2G5H B;  2JHD A;  2MRL A;  3GZF A;  1SZH A;  2ZG6 A;  3PSI A;  4WJ3 B;  3M6K A;  2LYB A;  5C0Y A;  2CN1 A;  2KNJ A;  2BDU A;  2OXO A;  3CYM A;  3M7D A;  1IIP A;  4ACO A;  4CRX A;  3PSF A;  2K8C B;  1ZQ1 C;  3RF9 A;  3SAF A;  3LVW A;  2LBO A;  5CRX A;  3IG8 A;  2W7P A;  2KJ5 A;  4OJL A;  1L6N A;  3E0F A;  3IG5 A;  4FE3 A;  2LKY A;  3F2B A;  2KJ8 A;  2W7O A;  3CP8 A;  2KHV A;  3D2N A;  2KHQ A;  2ZIV A;  2G08 A;  3LVV A;  2YX8 A;  1XNS A;  1Q3U A;  3F2D A;  4PL2 A;  2VKQ A;  1GO3 F;  4A8E A;  3F5A A;  2KV2 A;  2YB4 A;  3NRW A;  4OJP A;  1OUQ A;  2F76 X;  3C29 A;  4FZN A;  4U7C A;  2F2A B;  4C0Z A;  2VJ4 A;  2DF4 B;  1KBU A;  1ECW A;  3F5E A;  4QIW F;  2KKP A;  1HEK A;  4KMO B;  3ICX A;  2LHT A;  1A0P A;  4OJO A;  3RFA A;  2XID A;  3ONN A;  3KFU F;  5A0L A;  3M6Z A;  2F77 X;  3D2Q A;  2WAQ F;  2GOL A;  2H3Q A;  2G06 A;  2H3I A;  2WAQ C;  1MA7 A;  2XIC A;  3CRX A;  2HBK A;  2K4H A;  2MA1 A;  2KKV A;  3HKZ F;  4CGZ A;  5T14 A;  2ZIW A;  3HKZ C;  1DRG A;  5KL8 B;  4OO1 J;  1PVP A;  1Z1B A;  3AL0 B;  2D6F C;  1P7D A;  2ZIW B;  4GFJ A;  2WB1 F;  2OYY A;  3MGV A;  2PMZ F;  2A3V A;  2PMZ C;  3LYS A;  3PST A;  3N7R C;  1YT3 A;  2Q4T A;  4NLC A;  4PL1 A;  4KX5 A;  3H0R B;  3SQI A;  2HOF A;  4P0P A;  1Z19 A;  2E5S A;  3N7S C;  2OM6 A;  3SAH A;  4P0P B;  5HR6 A;  4OJ6 A;  2XVT A;  2G09 A;  2N1R A;  3IN5 A;  2NV3 A;  3C28 A;  2RP5 A;  2ZIX A;  3AQE A;  4QIW C;  1Q3V A;  2W04 A;  2CRX A;  1PVQ A;  2ZIX B;  2VJ5 A;  3F2C A;  2HBL A;  2OH2 A;  2YB1 A;  2HBJ A;  2KJ9 A;  4KX3 A;  1ED1 A;  2G0A A;  1T94 A;  2ZIU A;  3N7P D;  4NWI A;  3D2S A;  3DEE A;  2R18 A;  3ALR A;  1TAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...