2Y0SF

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 10
structure length 90
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2y0sF02
2PMZF 2Y0SF 4AYBF 2WAQF 2WB1F 3HKZF
chains in the Genus database with same CATH superfamily
3JPQA 4UATA 2YMLA 1BNOA 3T79A 2AGPA 3GFKB 4ZH4A 2PMZC 4J03A 3GV8B 5J2HA 2JZBB 4EELA 4EBCA 1SKSA 1L7NA 4M6WA 5EWGA 2VJ5A 4DCCA 4ELVA 1O03A 5J2BA 8ICYA 2HVIA 5J2IA 4BJQA 3TANA 5KFWA 2KMDA 4UAUA 4GXIA 1GO3F 5T14A 3JPPA 3IP4B 2C2DA 2G0AA 1JALA 5G5HA 2NO5A 3RJJA 3WK4A 3RF9A 2B6GA 2NRXA 3B0YA 4PHDA 3SAHA 7ICOA 2W9AA 9ICUA 4C8MA 2Q4TA 4C80A 2AHOB 1WWVA 4BWMA 2ZTCA 3GIKA 4EBDA 8ICBA 1NOMA 8ICWA 4Q43A 4DFJA 2IMWP 2VA8A 4IQVA 3QEBZ 1MQ2A 2W8LA 3ICXA 2H3FA 4M9LA 1RM6C 4R8UB 1JIHA 3OTQA 4KLLA 2VIXA 1JMSA 3AM9A 4ED6A 1NK4A 1SL0A 1ZXIA 1JROA 2M9NA 3T3FA 1RZTA 4F71A 4ELUA 4DSEA 9ICOA 3IG8A 3KKAA 8ICOA 4KLTA 2WAQF 1FO4A 9ICMA 2JHDA 3EW9A 3OJUA 1D9DA 4Q44A 2M0NA 2KK0A 4IQWA 9ICGA 5B66U 1ZD3A 3BDPA 3WU2U 1PUZA 1ZJNA 2MU2A 5DG7A 2XCPA 2GOLA 5TZVA 2K4PA 4QZHA 4F8RA 3PR5B 2FLLA 1ZQAA 2ZTDA 1RYSA 2J6TA 2DGZA 1DK2A 4O5KA 5AKHA 2AQ4A 4Y2TA 1L3SA 2F44A 2A19A 5DLFA 1N56A 5KT6A 4O3OA 2ISPA 2D8CA 1S76D 1ZRNA 3C1ZA 1IIPA 2XCAA 2ZIWA 4EZ6A 2EZYA 2KZZA 3QU2A 1LKYB 2ES6A 2H3ZA 3EPIA 5KFVA 2XO7A 1Q8KA 4Q8EA 4WJ3B 4FO6A 1S0MA 3C28A 4Q45A 4DL6A 2ASLA 5J0OA 1X6JA 1Z00B 1ZQWA 2E8NA 3NRZA 3QU7A 2HHSA 3AU2A 3N7RC 2G5HB 9ICSA 2LBOA 4I2FA 4RQ2A 2DF4B 4YMNA 1JUDA 5KT7A 2WF7A 4GLXA 1X2IA 1U47A 4TURA 4PL1A 1UHUA 3HKZF 4QW9A 7ICIA 3OPXA 3QU9A 3M7DA 4BXOB 3H0RB 1ZOLA 4DLEA 2P66A 1U48A 3PO5A 4DSKA 1ZD4A 1CUKA 2DKZA 4RQ7A 4IR1A 2ESEA 4KN7A 2KD1A 4RT2A 1LV5A 4ECYA 4EX6A 4KLFA 3HKZC 3WK7A 2UVVA 1ZQBA 4F5OA 2XI9A 1B0XA 4RT3A 2W03A 3Q8SB 4DO9A 4O3NA 3O0FA 1A6SA 5AM5A 1TAQA 5J0QA 2HOIA 4FFDA 3WK8A 3T5HA 3TAQA 1BVSA 2A1JA 1X9XA 4JV0A 5KFNA 4YR0A 2PI4A 4PL2A 1SV0A 8ICZA 8ICIA 1S9FA 1FFVA 1DRGA 2MUTB 5KT4A 1HIWA 2J6SA 1SKWA 3M9MB 1U49A 4TQSA 4F5PA 3GV5B 2GLEA 2OWOA 3MR5A 4F4WA 4RNOA 4QWCA 3OHAA 3CW2C 2HHXA 2JR5A 3UQ2A 2R18A 4OD0A 4RQ0A 2BGWA 1ZQPA 3GU3A 2KTQA 3H4BA 1UPHA 5AKZA 5EE0A 3OHBA 4QWBA 3SAGA 4C8LA 1V85A 5J0WA 4YG2A 3JPNA 4O3PA 2CXYA 3IG5A 1NJZA 1LB2B 2Z7JA 1SWWA 3IDWA 4CRXA 4QZ9A 2W7OA 1NK7A 4OJ6A 5JRTA 2ASDA 3PV8A 2HCFA 2KVCA 4FZLA 5ALSA 4ECUA 2W04A 4KLQA 5EWEA 2KE7A 1XWLA 4IRDA 5AIAA 1NK5A 2G08A 4M9GA 4DQSA 4GC6A 4ED7A 2OCEA 4AP9A 3NVWA 9ICLA 3RJGA 1T8EA 5ALPA 3RAQA 3M6KA 3FM9A 1ZQUA 4UB8U 2JEIA 5KFCA 5BOLA 4UASA 5DKWA 5L1MA 5KFOA 3PSTA 4KX3A 3RB3A 2FE9A 3CRXA 8ICSA 3WK9A 1X9MA 5JUMA 5EOZA 5EE9A 5KTQA 2WF6A 4ED2A 3T5LA 3PY8A 5DB8A 5EWFA 5IIJA 2YB1A 1PVRA 4G3IA 2UVWA 3BQ7A 4R63A 1V9PA 1WCNA 2QKQA 2F77X 4I2HA 1K1SA 3H7IA 1XO1A 1S0VA 2MRLA 4E0DA 5AKLA 4DL3A 3IRUA 5J8YA 4KN4A 5F9LA 4NL9C 3V72A 1HUZA 2G09A 4DFPA 4ECWA 1V38A 1IV8A 5KFPA 4M2YA 5KFTA 2WF5A 5KAFU 3KHRA 2H5XA 2XC9A 3HX0A 4J9MA 4P0QB 3H8MA 4TUPA 4IR9A 4C8OA 1S8OA 1MA7A 2HSZA 2VA2A 4UB3A 2HBLA 1S0OA 8ICTA 1KFTA 1A0PA 1N48A 1N63A 4M04A 3T5JA 5J2KA 4F2SA 1JI7A 3B0XA 3SV3A 5DB6A 8ICFA 3F53A 5KFRA 1AROP 2V4RA 1L3UA 3CP8A 2F8LA 3H4DA 3C21A 4Y2PA 2O6KA 3ZDCA 2PKEA 2PFPA 2BHNA 1ZQ1C 1D9FA 5KFGA 2E8OA 4IRCA 2DUYA 1VDVA 3B9JA 2LM1A 1YZ6A 2HOFA 4MEXA 7ICVA 3QU5A 2A1JB 4XQ8A 2DFLA 4RUAA 4P4OA 3NGDA 2ASJA 1NK8A 4HAIA 2OH2A 1Z1VA 4I2AA 1ZQGA 1COKA 3RR7A 4QWDA 1QCKA 2KV2A 5CR0A 5CRXA 2XGPA 4UB4A 2VA3A 2W55A 5DBBA 4PGQA 2ZXHA 1BPYA 5B5EU 1Z1BA 1V97A 3Q8MA 1X9SA 4K4IA 2LYAA 2WTFA 4OCZA 3BZCA 4BX9C 4I27A 3UMGA 1X42A 3CNHA 3MR6A 3TQ1A 1BPEA 2EAOA 2QARA 4F2RA 2DWQA 2NRTA 3JPOA 3KZIU 2D3DA 9ICEA 4P4PA 3RB6A 1YT3A 5KFMA 3GIIA 5J0YA 3MC1A 4FS1A 4KLHA 4KMUA 2XVTA 3DEEA 3AL0B 3NTUA 1HEKA 4OJLA 1XSLA 3ZD9A 4QZAA 2N1RA 3H40A 5KG5A 1VJ5A 3M8RA 5CP2A 3MDAA 1SV0C 2DL0A 3BJYA 3PX6A 5DG8A 4F91B 1U9LA 4YQWA 2G5IB 5GTHU 4GXKA 4DQPA 4DF4A 4NLNA 3EYZA 4QJFB 3UXOA 2R8GA 3V6KA 4RUCA 4QZIA 1PK1B 3LK9A 1VLBA 4YR2A 5EE3A 5KFDA 1Q3VA 1QSYA 4NLZA 5ALGA 2R8HA 2EZXA 3L4PA 1NKEA 1L7MA 1KKXA 2CRXA 4MEYA 2FDRA 2EH9A 5AK5A 1SXEA 4EEKA 3BZKA 1XS9D 2ZIXB 2NO4A 4FE3A 2YN4A 2NYVA 8ICRA 4US8A 4ED8A 2FMQA 9ICTA 2P35A 3PVXA 2WB1F 3AQEA 1S10A 5D46A 5ALFA 4DQRA 2FJ6A 3C2KA 5J2DA 3RB4A 1RYUA 5KG1A 4RNNA 3ZDBA 2KN7A 2NV3A 1XU4A 8ICPA 3I1YA 4J9SA 2KOBA 2R8KA 2FI1A 2C2EA 3QUCA 4B9VA 4Y2YA 4ECXA 2JGAA 2LYHA 4K4GA 1B4FA 4F3OA 5AI5A 5KG6A 4PGYA 2F8KA 4CF5A 4JV2A 3QZ7A 3HW8A 3MDCA 4MFCA 3V6HA 1FIQA 2HBJA 4EZ9A 4YN4A 1Q46A 1XC9A 1D8YA 5KT2A 2MAXA 4NLBA 2BDPA 2F1JA 2WHEA 3MR2A 9ICKA 1RYRA 3ZDDA 3MFIA 2LHTA 1DK3A 4UBCA 4OJ5A 5KFXA 2YQEA 3F2CA 4I2EA 4J9OA 4BUGA 5AK6A 5KT5A 3RR8A 3IHQB 4IRKA 3WK6A 3DDHA 3H0MB 2HBMA 5AI9A 4RPYA 1ZQCA 4NV0A 1ECWA 2VANA 8ICHA 1L7PA 4P2HA 4F5NA 5DDMA 5CHGA 1EXNA 2QARB 3E0FA 4UB2A 1XO0A 4DQIA 3QUTA 1RG6A 4C0ZA 2E1FA 2JXJA 3KKAC 3NVZA 7ICKA 1KN5A 4BWJA 1SZHA 2K8BB 5HP4A 4Y2JA 5ALIA 3C2MA 1C7YA 3ISDA 4UAZA 3EZ5A 4FZMA 1UT8A 2I6XA 2A3VA 4M6WB 1JRPA 1QSSA 4RNMA 1UT5A 2KZ3A 3Q8LA 1FFUA 3GIJA 2PXIA 4FZNA 3G6YA 4DSLA 2ZG6A 4FBTA 1SXDA 4CDGA 5IIMA 1TV9A 4KLEA 7ICUA 4F4XA 2BZFA 4Z6DA 1NK6A 4C8NA 4CE6A 1ZQSA 1CI4A 2K4HA 2PI5A 3QX7A 3H8JA 4KLDA 3SYZA 4KX5A 1PZNA 1M6YA 1URJA 2JRZA 2Q0ZX 4UB1A 4R65A 3I76A 4IL6U 9ICFA 2W7PA 3UPQA 1KDHA 2WAQC 2JMGA 3ZD8A 2HW3A 2KKPA 3SZ2A 5DG9A 4ED3A 3SD7A 4OJOA 5ALUA 1OUQA 2ZUBA 3M9NB 2IHNA 2H3IA 1ZQFA 2CPRA 3TACB 4M9JA 3KHLA 4UQGA 1DOQA 2XY5A 4B9TA 2R8IA 2FPKA 3RRGA 1MSWD 5AKKA 4OO1J 1IXRA 1WG8A 3QZ8A 3KHGA 2HI0A 4B9SA 2A1AA 3Q8QB 3MFHA 1Z4NA 3MGVA 1KTQA 2IA6A 4I2DA 3N7PD 3UM9A 1ZQQA 2OHFA 4P0QA 5KFSA 4A8EA 3C1YA 3LVWA 5AI8A 2ATLA 4I2IA 1F0MA 2Y9UA 1T94A 4Y2VA 4C4RA 2KKVA 5KFYA 3SV4A 3GDXA 3ORYA 1Q3UA 4R8UA 1S77D 4PH5A 5BPCA 5ALDA 2C22A 5ALYA 2Y9TA 4DL7A 4ELTA 4B9UA 4C4TA 3TAPA 4UBBA 3NVYA 3K75D 3SENA 1C20A 3F2DA 1SV4A 1IM4A 4LVSA 3OSPA 5J0SA 4KLIA 2YMPA 2LYBA 3GQCA 3I28A 3QXGA 1QH9A 4DFKA 2D6FC 2F76X 9ICWA 5HNKA 3JPTA 2ZUCA 3VCBA 5L1KA 1NNLA 2IBKA 1KBUA 1BPDA 5AI0A 3ZI4A 2E5SA 2QLTA 3KTQA 3V7KA 3PO4A 2KJ9A 1ZYQA 1BNPA 1ZQJA 1WWUA 1X6IA 3LYSA 1F44A 1HJPA 1BGXT 2E3TA 4I29A 1MQ3A 5AM2A 4P0PB 4UB5A 4KTQA 2BQUA 3KBBA 5DB7A 2MSNA 2VJ4A 2LKYA 4Q8FA 4CF3A 3PR4A 2ZIVA 4IS7A 3D2NA 1IG6A 7ICLA 2K89A 3IV6A 2W9BB 4YD1A 3C2LA 2YY6A 3FYHA 2LI6A 3CYMA 2HHWA 9ICPA 3BS7A 3RRHA 4U7CA 3ETLA 3GIMA 5J2EA 8ICAA 4DL4A 3PW5A 2RLTA 1JN3A 1JXEA 1KL9A 4BGDA 4B9MA 1X9WA 4RQNA 4DSIA 4PPXA 2YX8A 4QZGA 3DV9A 4YVZA 2YB4A 1T7PA 5ALTA 2XY6A 3MGIA 5AK4A 3UQ0A 4ICAA 4QWAA 1UCVA 4JB3A 4DSJA 5L1LA 4MHVA 3WKBA 4NY8A 3RJHA 3PW0A 2HHTA 1ZQMA 3N4MB 4OJPA 3BQ0A 4BXOA 5IIKA 3FC4A 1N61A 1RXWA 4GFJA 4Y2RA 4J9LA 2AJQA 2QB1A 3EWAA 3FAHA 4QIWC 3D2SA 1JXLA 1YZ7A 4YP3A 1U4BA 2KHQA 4YFKA 2IOHA 3NS1A 3V6JA 3HWTA 1P7DA 2F2AB 1AQ6A 4I28A 5KT3A 3TARA 4QZFA 4YR3A 5HHIA 4TUSA 4KLJA 4DFDA 3PZPA 5HMLA 3HILA 3ONNA 3NRWA 3L3FX 5G5GA 2LMRA 4EYHB 5TISU 3IN5A 5L1JA 2FLNA 7ICMA 1NZPA 2H3VA 2W9BA 3G6VA 9ICHA 2BCUA 4MF8A 4B9LA 2ODGA 4J9NA 1L3VA 7ICFA 8ICUA 1L8LA 2B21A 1RQNA 5KFLA 1DXSA 1HUOA 5KFEA 4Y2UA 4NXZA 2WF8A 1TFRA 1ZD5A 3PX4A 5J2AA 2YTUA 9ICBA 2EAPA 4F5RA 4O5CA 1B43A 5KFAA 4C7YA 2WF9A 7ICHA 2R8JA 2BCSA 2DKXA 2DPIA 4PHPA 2ZJ8A 1ZQHA 5HR6A 2DBYA 2KSOB 9ICIA 3V7LA 1BPXA 3K1ZA 1U45A 5K4LA 2G07A 2RDIA 9ICQA 5HMMA 4QZEA 2I1QA 3ISBA 2MA1A 5AK3A 4G9BA 1DGSA 3RH6A 1TAUA 4YXJA 3MABA 3ZDEA 2K8CB 5DGAA 4QNLA 4TQRA 3QE9Y 4C4SA 2JV3A 5KFFA 4J9PA 1BPBA 1ZQRA 2W8KA 3WKCA 2E8PA 3HRDD 4ECRA 5KG7A 3JPSA 4YXMA 5A0LA 5AI6A 1TK8A 4NLCA 4UB6U 2AU0A 2ZIUB 1X66A 1COOA 9ICXA 2W3RA 4DLGA 1UA0A 4PHAA 4M0AA 1ZQOA 3SQIA 4UAVA 1NJXA 2JH1A 1D8LA 3TFRA 2B0CA 1B22A 5ALHA 2UVRA 2KJ5A 4JWMA 3RJIA 3SI8A 5ALXA 3RBDA 5EE1A 4KLOA 1NJYA 2WFAA 2LM4A 3LWMA 2GWSA 3WK5A 4FS2A 5HR7A 1WCLA 3TADA 2Y1JA 5KFZA 4QZDA 4P4MA 5KNIA 1QQ6A 5C5JA 1NI3A 2K60A 3M9OB 4DS4A 3PSPA 4US9A 5D49A 4PZNA 2BPFA 3L5KA 2C28A 4JWNA 4DOBA 3A0BU 2KSOA 3QUQA 5C0YA 1NK9A 1TE2A 5ALWA 1Z19A 2AGQA 2W3SA 1L3TA 2KICA 5KFBA 4RQ3A 5CA7A 4MFFA 2IOFK 2Y1IA 4QW8A 2F1HA 5KAIU 1TKDA 3UMBA 4QZ8A 4F4YA 2PFNA 3F5EA 4ECTA 3D2QA 3BQ1A 1NK0A 2JZBA 2BR0A 4ED1A 4IQTA 2ZJAA 5HHHA 2XGQA 4FBUA 3HP6A 4PJ0U 3AQFA 2AH5A 4F4KA 5J29A 5KFIA 1QQ5A 3RAXA 4IC9A 5ALVA 4CGZA 4BDPA 3BS5B 1QLNA 4UW9A 4EENA 3TADC 4O9MA 3TI0A 5AKJA 2JEGA 1DGJA 4DOAA 2J6UA 2BQRA 4CCHA 9ICNA 5AKXA 4R66A 2AXTU 3MR3A 1L8OA 3MGHA 3WKAA 3QUBA 4CNQA 3KFUF 3TKAA 3J81j 1N2XA 3QU4A 2W9CB 4XRHA 4O3MA 5ALQA 4RPZA 5AM4A 3AN1A 1S0NA 3OSNA 2G06A 5CB1A 2AQ0A 3UXNA 1SL1A 4PZOA 4F72A 3K1RB 5ALLA 1A76A 5ALRA 5DBCA 2NRVA 1OW5A 3THVA 4TUQA 2XY7A 1ZQYA 1ZQLA 2HHUA 1D8BA 2L5YA 2KHVA 5AI4A 1PVQA 4JV1A 4J9RA 1ZD2P 1ZQZA 1KW4A 4DS5A 2JH7A 5KFUA 2UVUA 2E8MA 2HHQA 4EEYA 3AUOA 2BCQA 2KVSA 3SEIA 5DBAA 4O5EA 8ICQA 3HT3A 1LKYA 3ZDAA 5DQHA 1ZQTA 3M6ZA 5J0TA 2EDUA 3PSFA 8ICLA 4F92B 2FMSA 1KRPA 4RPXA 8ICCA 4NJ8A 3PX0A 8ICXA 1FEZA 1KFSA 5AKYA 2W9MA 2RQ5A 4B9NA 3PNCA 4O3QA 3Q8KA 2ZIXA 4DQQA 4YMMA 4Z6CA 3RH4A 7ICTA 2BPCA 4M9HA 3KOOA 4Y2XA 3AMZA 3EUB2 1ZJMA 3TFSA 4RQ8A 1PK1A 3KZXA 3HPOA 5F9NA 2Y0SF 2LPEA 4O3RA 8ICJA 2GO7A 4KLGA 4GC7A 2QB0A 5DB9A 2ZUDA 3MBYA 1ZQNA 2KEYA 5IIOA 2MUTA 7ICSA 4Z6EA 4Y2QA 1N5XA 2ZJ5A 2Y0SC 2DQNB 5IINA 4F50A 3PMNA 3F5AA 7ICRA 2K4EA 1BPZA 3QNMA 4NL9A 2FPLA 8ICVA 1SB3C 4R64A 3SMVA 5DDYA 4PHEA 3RJEA 5J0UA 3BQTA 1CRXA 5AKEA 3AEVA 4LZDA 1KEJA 4ACOA 3ISCA 4DOCA 1SIJA 2HOQA 1SZPA 8ICMA 3R9KA 4AYBC 5KFKA 5AM0A 4O3SA 2K4IA 2K8AA 3GZFA 1X40A 1RPLA 2I9GA 5AICA 4U6PA 1N5WA 4LJXA 3RFAA 5AKGA 2IOFA 2F1IA 3QEAZ 5CEHA 2W43A 2RP5A 3WKEA 4F93B 3C5FA 2P6UA 2HVHA 1WUDA 2VKQA 1SKRA 3N7SC 5KFHA 4C7ZA 5CJ7A 4EBEA 2W54A 4CF4A 5DGBA 4F5QA 3RBEA 1KQQA 3PW2A 4IQUA 4NM2A 5DQIA 4YCXA 9ICCA 3S6JA 1NJWA 2ALZA 4DL2A 2EANA 2EZZA 5J2GA 3G6XA 4JUZA 5ALKA 4ECZA 2XICA 2P6RA 2KZMA 3A0HU 2WB1C 1XNSA 3OJSA 4K4HA 8ICEA 1Z00A 2KG5A 2KJ8A 2KIWA 5J2JA 3HJEA 3H8WA 4F4ZA 4USAA 7ICEA 3IM1A 3BQ2A 2JEFA 4I2BA 2CN1A 2HHVA 4MF2A 3FDSA 2ZXIA 3SAFA 3LWLA 4RQ1A 2ZIWB 5KL8B 1ZQVA 3LVVA 4X5VA 2C2RA 5CWRA 1T4GA 4GXJA 1ZQIA 4I2JA 3ALRA 4UAYA 2YMQA 5JTIA 5AHXA 5H2FU 3F2BA 4Y2SA 4M47A 1S5LU 4LZGA 5J0XA 3UXPA 5ALEA 5KG4A 3D6JA 4I2GA 4RQ5A 3NVVA 1ED1A 2FLPA 1KFDA 2EAMA 1J97A 2V4QA 5L1IA 1SGGA 5IIIA 2KFZA 4YMOA 3Q8RB 4JMUA 4HYKA 3N28A 3GILA 4RQMA 4GIBA 7ICNA 1XSPA 4B6JA 3ETRA 5DLGA 1QSLA 9ICAA 4KITB 3KHHA 2HBKA 1T3QA 3U26A 1NKCA 2F3NA 5AM1A 2AGOA 2OXOA 1CEZA 1RXVA 3LDAA 3JPRA 5L9XA 2ZIUA 5JU5A 8ICGA 1TVAA 1UA1A 4RQ6A 5ALOA 2YMMA 2JEJA 1XSNA 1TK0A 4RZRA 1N62A 3Q8PB 3V7JA 1K1QA 4EX7A 4RQ4A 4QWEA 5DQGA 2QB0B 1Z4OA 3RJFA 2BPGA 1MC8A 2HDOA 4ZOHC 1L5UA 2NRWA 4XA5A 3WKDA 4XUSA 4KLUA 2ZIVB 3RB0A 2RRDA 3C23A 4O0IA 1UQVA 1TK5A 5KG2A 4I2CA 5AM3A 5FP0A 7ICJA 4MFAA 3H8SA 4QIWF 2BCRA 3C29A 4P0PA 3PMLA 3PW7A 1RQLA 1ZQEA 5J2CA 3T5KA 4KLMA 1S97A 2PFQA 4NLKA 2FPMA 4ECQA 5KG0A 2OM6A 3M1YA 3UMCA 2DPJA 7ICGA 3OGUA 4NLGA 3E2EA 5D4BA 2RHFA 5KFJA 5IILA 3AU6A 3RJKA 4C8KA 2IHMA 2OYYA 1F5SA 1MN8A 4ECSA 2ISOA 1KSPA 4UARA 4DWIA 5J8YC 1PVPA 4DL5A 4RU9A 5J0PA 4NM1A 5ALNA 2BQ3A 1ZQKA 4AYBF 1J2NA 5KL1B 5AKIA 5ALJA 3PSIA 7ICPA 9ICRA 2XIDA 3C5GA 2KFNA 1KLNA 8ICKA 1RDFA 3RH5A 2OEHA 1OXJA 1ZETA 4ED0A 3N97B 4NWIA 2PFOA 1LVHA 2BDUA 2I5HA 5F3XB 3SR6A 1ZQDA 4J9KA 1Y88A 2KIVA 5J0RA 3PW4A 5BOMA 3ED5A 2BKEA 5E79U 3NASA 3KD3A 3NUQA 4EYIB 2E1EA 5ALMA 3RTVA 2ZTEA 1PK3A 3M8SA 1K5OA 1QTMA 4QZCA 5J2FA 1TAMA 9ICVA 4UAWA 5KG3A 3H0LB 2W9CA 4KMOB 1A77A 1SL2A 2BCVA 2EQYA 1NZBA 4M9NA 4DFMA 1ZQXA 3GV7B 1NKBA 1L7OA 4KLSA 4Z6FA 1SWVA 2NRZA 4PGXA 1ZRMA 3E58A 2GH1A 5ALZA 1H38A 1N60A 2KP7A 2RDJA 3QYPA 2FMPA 1O08A 5AIBA 4J9QA 8ICNA 2W11A 4ECVA 5GTIU 1T3NA 4JK1A 1JX4A 1QQ7A 1Z3EB 5KFQA 2PMZF 7ICQA 4YD2A 1WYGA 4DSFA 2V9WA 1L6NA 3EPGA 3BS5A 9ICJA 4QZBA 4DF8A 2HMXA 1J2MA 3VC8A 2H3QA 2KNJA 3K4GA 4DEZA
chains in the Genus database with same CATH topology
2G5IB 5KL1B 2F8LA 3T79A 2ZIXA 4OO1J 2M0NA 2OXOA 3PZPA 3HKZC 2PMZC 3PSIA 3M6KA 3ONNA 3AL0B 3NRWA 2VJ4A 2LKYA 1PVQA 3SQIA 2XI9A 2HBMA 2XIDA 3H0MB 4QJFB 3L3FX 2ZIVA 4NV0A 2ZIUA 3D2NA 1ECWA 2JH1A 2VJ5A 2K89A 3MGVA 3IN5A 1ZQ1C 2XICA 2W03A 3PSTA 1Q3VA 2WB1C 2H3VA 3N7PD 3O0FA 3KZXA 4KX3A 2GOLA 3E0FA 4P0QA 2KJ5A 4A8EA 4BUGA 3CYMA 2Y0SF 3LVWA 2KJ8A 1XO0A 4BJQA 3CRXA 2KIWA 2CRXA 3KFUF 4NWIA 2HOIA 1T94A 4C0ZA 2BDUA 2HOFA 2KKVA 1XNSA 2DGZA 4U7CA 2E1FA 2ZIXB 2OH2A 4FE3A 1Q3UA 4O3MA 1SZHA 2K8BB 1GO3F 5HR7A 5T14A 2CN1A 2KV2A 3IP4B 2G06A 5CRXA 2KEYA 4PL2A 2YB1A 2ZXIA 3SAFA 3NUQA 4FZMA 2E1EA 2G0AA 2ZIWB 2WB1F 1PVRA 3AQEA 3PSPA 5KL8B 1IIPA 2Y0SC 2ZIVB 2ZXHA 2A3VA 3LVVA 2DQNB 1DRGA 1Z1BA 2RRDA 1A6SA 2F77X 2ZIWA 1HIWA 3F5AA 2YX8A 3RF9A 2K4EA 2YB4A 1TAMA 3ALRA 3F2DA 2MRLA 1D8BA 3SAHA 2LYAA 4FZNA 5C0YA 5HR6A 2ZG6A 2H3ZA 4BX9C 2KHVA 3F2BA 3H0LB 4ICAA 4QIWF 2G09A 2Q4TA 4KMOB 3SMVA 4CDGA 3C29A 1Z19A 4P0PA 2NV3A 1CRXA 1NZBA 2JH7A 2KICA 2KOBA 2LYBA 4WJ3B 3K1ZA 3C28A 2D6FC 2R18A 2K4HA 2F76X 3GU3A 2G07A 4OJPA 4KX5A 1UPHA 4ACOA 4P0QB 1URJA 2MA1A 3D2SA 1ED1A 2GH1A 2JGAA 3SAGA 2HOQA 3N7RC 1MA7A 1YT3A 2OM6A 3VCBA 2G5HB 2W7PA 1KBUA 4AYBC 2LBOA 2WAQC 2JMGA 4GFJA 2DF4B 3ICXA 2HBLA 2H3FA 3F5EA 3IG5A 2Z7JA 3D2QA 2K4IA 2K8AA 2K8CB 2RHFA 4CRXA 3GZFA 4QIWC 4QNLA 2XVTA 2E5SA 2VIXA 3DEEA 2HBJA 4U6PA 2W7OA 3RFAA 4PL1A 2KKPA 4JMUA 1A0PA 3M6ZA 4OJ6A 3HKZF 2OYYA 2PMZF 2KJ9A 3OPXA 4OJOA 3M7DA 3PSFA 4NLBA 1OUQA 3H0RB 2KHQA 2KVCA 1HEKA 2RP5A 4FZLA 3AQFA 1L6NA 2W04A 4OJLA 5A0LA 1PVPA 1WUDA 2VKQA 3LYSA 2F2AB 2N1RA 3N7SC 1P7DA 1F44A 2H3IA 4NLCA 2HBKA 2LHTA 2CPRA 3IG8A 4IC9A 4CGZA 4OJ5A 2HMXA 3F53A 2G08A 2WAQF 2ZIUB 4AYBF 2KD1A 3VC8A 4P0PB 2H3QA 3F2CA 2KNJA 2JHDA 3CP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ F;  2Y0S F;  4AYB F;  2WAQ F;  2WB1 F;  3HKZ F; 
#chains in the Genus database with same CATH topology
 3JPQ A;  4UAT A;  2YML A;  1BNO A;  3T79 A;  2AGP A;  3GFK B;  4ZH4 A;  2PMZ C;  4J03 A;  3GV8 B;  5J2H A;  2JZB B;  4EEL A;  4EBC A;  1SKS A;  1L7N A;  4M6W A;  5EWG A;  2VJ5 A;  4DCC A;  4ELV A;  1O03 A;  5J2B A;  8ICY A;  2HVI A;  5J2I A;  4BJQ A;  3TAN A;  5KFW A;  2KMD A;  4UAU A;  4GXI A;  1GO3 F;  5T14 A;  3JPP A;  3IP4 B;  2C2D A;  2G0A A;  1JAL A;  5G5H A;  2NO5 A;  3RJJ A;  3WK4 A;  3RF9 A;  2B6G A;  2NRX A;  3B0Y A;  4PHD A;  3SAH A;  7ICO A;  2W9A A;  9ICU A;  4C8M A;  2Q4T A;  4C80 A;  2AHO B;  1WWV A;  4BWM A;  2ZTC A;  3GIK A;  4EBD A;  8ICB A;  1NOM A;  8ICW A;  4Q43 A;  4DFJ A;  2IMW P;  2VA8 A;  4IQV A;  3QEB Z;  1MQ2 A;  2W8L A;  3ICX A;  2H3F A;  4M9L A;  1RM6 C;  4R8U B;  1JIH A;  3OTQ A;  4KLL A;  2VIX A;  1JMS A;  3AM9 A;  4ED6 A;  1NK4 A;  1SL0 A;  1ZXI A;  1JRO A;  2M9N A;  3T3F A;  1RZT A;  4F71 A;  4ELU A;  4DSE A;  9ICO A;  3IG8 A;  3KKA A;  8ICO A;  4KLT A;  2WAQ F;  1FO4 A;  9ICM A;  2JHD A;  3EW9 A;  3OJU A;  1D9D A;  4Q44 A;  2M0N A;  2KK0 A;  4IQW A;  9ICG A;  5B66 U;  1ZD3 A;  3BDP A;  3WU2 U;  1PUZ A;  1ZJN A;  2MU2 A;  5DG7 A;  2XCP A;  2GOL A;  5TZV A;  2K4P A;  4QZH A;  4F8R A;  3PR5 B;  2FLL A;  1ZQA A;  2ZTD A;  1RYS A;  2J6T A;  2DGZ A;  1DK2 A;  4O5K A;  5AKH A;  2AQ4 A;  4Y2T A;  1L3S A;  2F44 A;  2A19 A;  5DLF A;  1N56 A;  5KT6 A;  4O3O A;  2ISP A;  2D8C A;  1S76 D;  1ZRN A;  3C1Z A;  1IIP A;  2XCA A;  2ZIW A;  4EZ6 A;  2EZY A;  2KZZ A;  3QU2 A;  1LKY B;  2ES6 A;  2H3Z A;  3EPI A;  5KFV A;  2XO7 A;  1Q8K A;  4Q8E A;  4WJ3 B;  4FO6 A;  1S0M A;  3C28 A;  4Q45 A;  4DL6 A;  2ASL A;  5J0O A;  1X6J A;  1Z00 B;  1ZQW A;  2E8N A;  3NRZ A;  3QU7 A;  2HHS A;  3AU2 A;  3N7R C;  2G5H B;  9ICS A;  2LBO A;  4I2F A;  4RQ2 A;  2DF4 B;  4YMN A;  1JUD A;  5KT7 A;  2WF7 A;  4GLX A;  1X2I A;  1U47 A;  4TUR A;  4PL1 A;  1UHU A;  3HKZ F;  4QW9 A;  7ICI A;  3OPX A;  3QU9 A;  3M7D A;  4BXO B;  3H0R B;  1ZOL A;  4DLE A;  2P66 A;  1U48 A;  3PO5 A;  4DSK A;  1ZD4 A;  1CUK A;  2DKZ A;  4RQ7 A;  4IR1 A;  2ESE A;  4KN7 A;  2KD1 A;  4RT2 A;  1LV5 A;  4ECY A;  4EX6 A;  4KLF A;  3HKZ C;  3WK7 A;  2UVV A;  1ZQB A;  4F5O A;  2XI9 A;  1B0X A;  4RT3 A;  2W03 A;  3Q8S B;  4DO9 A;  4O3N A;  3O0F A;  1A6S A;  5AM5 A;  1TAQ A;  5J0Q A;  2HOI A;  4FFD A;  3WK8 A;  3T5H A;  3TAQ A;  1BVS A;  2A1J A;  1X9X A;  4JV0 A;  5KFN A;  4YR0 A;  2PI4 A;  4PL2 A;  1SV0 A;  8ICZ A;  8ICI A;  1S9F A;  1FFV A;  1DRG A;  2MUT B;  5KT4 A;  1HIW A;  2J6S A;  1SKW A;  3M9M B;  1U49 A;  4TQS A;  4F5P A;  3GV5 B;  2GLE A;  2OWO A;  3MR5 A;  4F4W A;  4RNO A;  4QWC A;  3OHA A;  3CW2 C;  2HHX A;  2JR5 A;  3UQ2 A;  2R18 A;  4OD0 A;  4RQ0 A;  2BGW A;  1ZQP A;  3GU3 A;  2KTQ A;  3H4B A;  1UPH A;  5AKZ A;  5EE0 A;  3OHB A;  4QWB A;  3SAG A;  4C8L A;  1V85 A;  5J0W A;  4YG2 A;  3JPN A;  4O3P A;  2CXY A;  3IG5 A;  1NJZ A;  1LB2 B;  2Z7J A;  1SWW A;  3IDW A;  4CRX A;  4QZ9 A;  2W7O A;  1NK7 A;  4OJ6 A;  5JRT A;  2ASD A;  3PV8 A;  2HCF A;  2KVC A;  4FZL A;  5ALS A;  4ECU A;  2W04 A;  4KLQ A;  5EWE A;  2KE7 A;  1XWL A;  4IRD A;  5AIA A;  1NK5 A;  2G08 A;  4M9G A;  4DQS A;  4GC6 A;  4ED7 A;  2OCE A;  4AP9 A;  3NVW A;  9ICL A;  3RJG A;  1T8E A;  5ALP A;  3RAQ A;  3M6K A;  3FM9 A;  1ZQU A;  4UB8 U;  2JEI A;  5KFC A;  5BOL A;  4UAS A;  5DKW A;  5L1M A;  5KFO A;  3PST A;  4KX3 A;  3RB3 A;  2FE9 A;  3CRX A;  8ICS A;  3WK9 A;  1X9M A;  5JUM A;  5EOZ A;  5EE9 A;  5KTQ A;  2WF6 A;  4ED2 A;  3T5L A;  3PY8 A;  5DB8 A;  5EWF A;  5IIJ A;  2YB1 A;  1PVR A;  4G3I A;  2UVW A;  3BQ7 A;  4R63 A;  1V9P A;  1WCN A;  2QKQ A;  2F77 X;  4I2H A;  1K1S A;  3H7I A;  1XO1 A;  1S0V A;  2MRL A;  4E0D A;  5AKL A;  4DL3 A;  3IRU A;  5J8Y A;  4KN4 A;  5F9L A;  4NL9 C;  3V72 A;  1HUZ A;  2G09 A;  4DFP A;  4ECW A;  1V38 A;  1IV8 A;  5KFP A;  4M2Y A;  5KFT A;  2WF5 A;  5KAF U;  3KHR A;  2H5X A;  2XC9 A;  3HX0 A;  4J9M A;  4P0Q B;  3H8M A;  4TUP A;  4IR9 A;  4C8O A;  1S8O A;  1MA7 A;  2HSZ A;  2VA2 A;  4UB3 A;  2HBL A;  1S0O A;  8ICT A;  1KFT A;  1A0P A;  1N48 A;  1N63 A;  4M04 A;  3T5J A;  5J2K A;  4F2S A;  1JI7 A;  3B0X A;  3SV3 A;  5DB6 A;  8ICF A;  3F53 A;  5KFR A;  1ARO P;  2V4R A;  1L3U A;  3CP8 A;  2F8L A;  3H4D A;  3C21 A;  4Y2P A;  2O6K A;  3ZDC A;  2PKE A;  2PFP A;  2BHN A;  1ZQ1 C;  1D9F A;  5KFG A;  2E8O A;  4IRC A;  2DUY A;  1VDV A;  3B9J A;  2LM1 A;  1YZ6 A;  2HOF A;  4MEX A;  7ICV A;  3QU5 A;  2A1J B;  4XQ8 A;  2DFL A;  4RUA A;  4P4O A;  3NGD A;  2ASJ A;  1NK8 A;  4HAI A;  2OH2 A;  1Z1V A;  4I2A A;  1ZQG A;  1COK A;  3RR7 A;  4QWD A;  1QCK A;  2KV2 A;  5CR0 A;  5CRX A;  2XGP A;  4UB4 A;  2VA3 A;  2W55 A;  5DBB A;  4PGQ A;  2ZXH A;  1BPY A;  5B5E U;  1Z1B A;  1V97 A;  3Q8M A;  1X9S A;  4K4I A;  2LYA A;  2WTF A;  4OCZ A;  3BZC A;  4BX9 C;  4I27 A;  3UMG A;  1X42 A;  3CNH A;  3MR6 A;  3TQ1 A;  1BPE A;  2EAO A;  2QAR A;  4F2R A;  2DWQ A;  2NRT A;  3JPO A;  3KZI U;  2D3D A;  9ICE A;  4P4P A;  3RB6 A;  1YT3 A;  5KFM A;  3GII A;  5J0Y A;  3MC1 A;  4FS1 A;  4KLH A;  4KMU A;  2XVT A;  3DEE A;  3AL0 B;  3NTU A;  1HEK A;  4OJL A;  1XSL A;  3ZD9 A;  4QZA A;  2N1R A;  3H40 A;  5KG5 A;  1VJ5 A;  3M8R A;  5CP2 A;  3MDA A;  1SV0 C;  2DL0 A;  3BJY A;  3PX6 A;  5DG8 A;  4F91 B;  1U9L A;  4YQW A;  2G5I B;  5GTH U;  4GXK A;  4DQP A;  4DF4 A;  4NLN A;  3EYZ A;  4QJF B;  3UXO A;  2R8G A;  3V6K A;  4RUC A;  4QZI A;  1PK1 B;  3LK9 A;  1VLB A;  4YR2 A;  5EE3 A;  5KFD A;  1Q3V A;  1QSY A;  4NLZ A;  5ALG A;  2R8H A;  2EZX A;  3L4P A;  1NKE A;  1L7M A;  1KKX A;  2CRX A;  4MEY A;  2FDR A;  2EH9 A;  5AK5 A;  1SXE A;  4EEK A;  3BZK A;  1XS9 D;  2ZIX B;  2NO4 A;  4FE3 A;  2YN4 A;  2NYV A;  8ICR A;  4US8 A;  4ED8 A;  2FMQ A;  9ICT A;  2P35 A;  3PVX A;  2WB1 F;  3AQE A;  1S10 A;  5D46 A;  5ALF A;  4DQR A;  2FJ6 A;  3C2K A;  5J2D A;  3RB4 A;  1RYU A;  5KG1 A;  4RNN A;  3ZDB A;  2KN7 A;  2NV3 A;  1XU4 A;  8ICP A;  3I1Y A;  4J9S A;  2KOB A;  2R8K A;  2FI1 A;  2C2E A;  3QUC A;  4B9V A;  4Y2Y A;  4ECX A;  2JGA A;  2LYH A;  4K4G A;  1B4F A;  4F3O A;  5AI5 A;  5KG6 A;  4PGY A;  2F8K A;  4CF5 A;  4JV2 A;  3QZ7 A;  3HW8 A;  3MDC A;  4MFC A;  3V6H A;  1FIQ A;  2HBJ A;  4EZ9 A;  4YN4 A;  1Q46 A;  1XC9 A;  1D8Y A;  5KT2 A;  2MAX A;  4NLB A;  2BDP A;  2F1J A;  2WHE A;  3MR2 A;  9ICK A;  1RYR A;  3ZDD A;  3MFI A;  2LHT A;  1DK3 A;  4UBC A;  4OJ5 A;  5KFX A;  2YQE A;  3F2C A;  4I2E A;  4J9O A;  4BUG A;  5AK6 A;  5KT5 A;  3RR8 A;  3IHQ B;  4IRK A;  3WK6 A;  3DDH A;  3H0M B;  2HBM A;  5AI9 A;  4RPY A;  1ZQC A;  4NV0 A;  1ECW A;  2VAN A;  8ICH A;  1L7P A;  4P2H A;  4F5N A;  5DDM A;  5CHG A;  1EXN A;  2QAR B;  3E0F A;  4UB2 A;  1XO0 A;  4DQI A;  3QUT A;  1RG6 A;  4C0Z A;  2E1F A;  2JXJ A;  3KKA C;  3NVZ A;  7ICK A;  1KN5 A;  4BWJ A;  1SZH A;  2K8B B;  5HP4 A;  4Y2J A;  5ALI A;  3C2M A;  1C7Y A;  3ISD A;  4UAZ A;  3EZ5 A;  4FZM A;  1UT8 A;  2I6X A;  2A3V A;  4M6W B;  1JRP A;  1QSS A;  4RNM A;  1UT5 A;  2KZ3 A;  3Q8L A;  1FFU A;  3GIJ A;  2PXI A;  4FZN A;  3G6Y A;  4DSL A;  2ZG6 A;  4FBT A;  1SXD A;  4CDG A;  5IIM A;  1TV9 A;  4KLE A;  7ICU A;  4F4X A;  2BZF A;  4Z6D A;  1NK6 A;  4C8N A;  4CE6 A;  1ZQS A;  1CI4 A;  2K4H A;  2PI5 A;  3QX7 A;  3H8J A;  4KLD A;  3SYZ A;  4KX5 A;  1PZN A;  1M6Y A;  1URJ A;  2JRZ A;  2Q0Z X;  4UB1 A;  4R65 A;  3I76 A;  4IL6 U;  9ICF A;  2W7P A;  3UPQ A;  1KDH A;  2WAQ C;  2JMG A;  3ZD8 A;  2HW3 A;  2KKP A;  3SZ2 A;  5DG9 A;  4ED3 A;  3SD7 A;  4OJO A;  5ALU A;  1OUQ A;  2ZUB A;  3M9N B;  2IHN A;  2H3I A;  1ZQF A;  2CPR A;  3TAC B;  4M9J A;  3KHL A;  4UQG A;  1DOQ A;  2XY5 A;  4B9T A;  2R8I A;  2FPK A;  3RRG A;  1MSW D;  5AKK A;  4OO1 J;  1IXR A;  1WG8 A;  3QZ8 A;  3KHG A;  2HI0 A;  4B9S A;  2A1A A;  3Q8Q B;  3MFH A;  1Z4N A;  3MGV A;  1KTQ A;  2IA6 A;  4I2D A;  3N7P D;  3UM9 A;  1ZQQ A;  2OHF A;  4P0Q A;  5KFS A;  4A8E A;  3C1Y A;  3LVW A;  5AI8 A;  2ATL A;  4I2I A;  1F0M A;  2Y9U A;  1T94 A;  4Y2V A;  4C4R A;  2KKV A;  5KFY A;  3SV4 A;  3GDX A;  3ORY A;  1Q3U A;  4R8U A;  1S77 D;  4PH5 A;  5BPC A;  5ALD A;  2C22 A;  5ALY A;  2Y9T A;  4DL7 A;  4ELT A;  4B9U A;  4C4T A;  3TAP A;  4UBB A;  3NVY A;  3K75 D;  3SEN A;  1C20 A;  3F2D A;  1SV4 A;  1IM4 A;  4LVS A;  3OSP A;  5J0S A;  4KLI A;  2YMP A;  2LYB A;  3GQC A;  3I28 A;  3QXG A;  1QH9 A;  4DFK A;  2D6F C;  2F76 X;  9ICW A;  5HNK A;  3JPT A;  2ZUC A;  3VCB A;  5L1K A;  1NNL A;  2IBK A;  1KBU A;  1BPD A;  5AI0 A;  3ZI4 A;  2E5S A;  2QLT A;  3KTQ A;  3V7K A;  3PO4 A;  2KJ9 A;  1ZYQ A;  1BNP A;  1ZQJ A;  1WWU A;  1X6I A;  3LYS A;  1F44 A;  1HJP A;  1BGX T;  2E3T A;  4I29 A;  1MQ3 A;  5AM2 A;  4P0P B;  4UB5 A;  4KTQ A;  2BQU A;  3KBB A;  5DB7 A;  2MSN A;  2VJ4 A;  2LKY A;  4Q8F A;  4CF3 A;  3PR4 A;  2ZIV A;  4IS7 A;  3D2N A;  1IG6 A;  7ICL A;  2K89 A;  3IV6 A;  2W9B B;  4YD1 A;  3C2L A;  2YY6 A;  3FYH A;  2LI6 A;  3CYM A;  2HHW A;  9ICP A;  3BS7 A;  3RRH A;  4U7C A;  3ETL A;  3GIM A;  5J2E A;  8ICA A;  4DL4 A;  3PW5 A;  2RLT A;  1JN3 A;  1JXE A;  1KL9 A;  4BGD A;  4B9M A;  1X9W A;  4RQN A;  4DSI A;  4PPX A;  2YX8 A;  4QZG A;  3DV9 A;  4YVZ A;  2YB4 A;  1T7P A;  5ALT A;  2XY6 A;  3MGI A;  5AK4 A;  3UQ0 A;  4ICA A;  4QWA A;  1UCV A;  4JB3 A;  4DSJ A;  5L1L A;  4MHV A;  3WKB A;  4NY8 A;  3RJH A;  3PW0 A;  2HHT A;  1ZQM A;  3N4M B;  4OJP A;  3BQ0 A;  4BXO A;  5IIK A;  3FC4 A;  1N61 A;  1RXW A;  4GFJ A;  4Y2R A;  4J9L A;  2AJQ A;  2QB1 A;  3EWA A;  3FAH A;  4QIW C;  3D2S A;  1JXL A;  1YZ7 A;  4YP3 A;  1U4B A;  2KHQ A;  4YFK A;  2IOH A;  3NS1 A;  3V6J A;  3HWT A;  1P7D A;  2F2A B;  1AQ6 A;  4I28 A;  5KT3 A;  3TAR A;  4QZF A;  4YR3 A;  5HHI A;  4TUS A;  4KLJ A;  4DFD A;  3PZP A;  5HML A;  3HIL A;  3ONN A;  3NRW A;  3L3F X;  5G5G A;  2LMR A;  4EYH B;  5TIS U;  3IN5 A;  5L1J A;  2FLN A;  7ICM A;  1NZP A;  2H3V A;  2W9B A;  3G6V A;  9ICH A;  2BCU A;  4MF8 A;  4B9L A;  2ODG A;  4J9N A;  1L3V A;  7ICF A;  8ICU A;  1L8L A;  2B21 A;  1RQN A;  5KFL A;  1DXS A;  1HUO A;  5KFE A;  4Y2U A;  4NXZ A;  2WF8 A;  1TFR A;  1ZD5 A;  3PX4 A;  5J2A A;  2YTU A;  9ICB A;  2EAP A;  4F5R A;  4O5C A;  1B43 A;  5KFA A;  4C7Y A;  2WF9 A;  7ICH A;  2R8J A;  2BCS A;  2DKX A;  2DPI A;  4PHP A;  2ZJ8 A;  1ZQH A;  5HR6 A;  2DBY A;  2KSO B;  9ICI A;  3V7L A;  1BPX A;  3K1Z A;  1U45 A;  5K4L A;  2G07 A;  2RDI A;  9ICQ A;  5HMM A;  4QZE A;  2I1Q A;  3ISB A;  2MA1 A;  5AK3 A;  4G9B A;  1DGS A;  3RH6 A;  1TAU A;  4YXJ A;  3MAB A;  3ZDE A;  2K8C B;  5DGA A;  4QNL A;  4TQR A;  3QE9 Y;  4C4S A;  2JV3 A;  5KFF A;  4J9P A;  1BPB A;  1ZQR A;  2W8K A;  3WKC A;  2E8P A;  3HRD D;  4ECR A;  5KG7 A;  3JPS A;  4YXM A;  5A0L A;  5AI6 A;  1TK8 A;  4NLC A;  4UB6 U;  2AU0 A;  2ZIU B;  1X66 A;  1COO A;  9ICX A;  2W3R A;  4DLG A;  1UA0 A;  4PHA A;  4M0A A;  1ZQO A;  3SQI A;  4UAV A;  1NJX A;  2JH1 A;  1D8L A;  3TFR A;  2B0C A;  1B22 A;  5ALH A;  2UVR A;  2KJ5 A;  4JWM A;  3RJI A;  3SI8 A;  5ALX A;  3RBD A;  5EE1 A;  4KLO A;  1NJY A;  2WFA A;  2LM4 A;  3LWM A;  2GWS A;  3WK5 A;  4FS2 A;  5HR7 A;  1WCL A;  3TAD A;  2Y1J A;  5KFZ A;  4QZD A;  4P4M A;  5KNI A;  1QQ6 A;  5C5J A;  1NI3 A;  2K60 A;  3M9O B;  4DS4 A;  3PSP A;  4US9 A;  5D49 A;  4PZN A;  2BPF A;  3L5K A;  2C28 A;  4JWN A;  4DOB A;  3A0B U;  2KSO A;  3QUQ A;  5C0Y A;  1NK9 A;  1TE2 A;  5ALW A;  1Z19 A;  2AGQ A;  2W3S A;  1L3T A;  2KIC A;  5KFB A;  4RQ3 A;  5CA7 A;  4MFF A;  2IOF K;  2Y1I A;  4QW8 A;  2F1H A;  5KAI U;  1TKD A;  3UMB A;  4QZ8 A;  4F4Y A;  2PFN A;  3F5E A;  4ECT A;  3D2Q A;  3BQ1 A;  1NK0 A;  2JZB A;  2BR0 A;  4ED1 A;  4IQT A;  2ZJA A;  5HHH A;  2XGQ A;  4FBU A;  3HP6 A;  4PJ0 U;  3AQF A;  2AH5 A;  4F4K A;  5J29 A;  5KFI A;  1QQ5 A;  3RAX A;  4IC9 A;  5ALV A;  4CGZ A;  4BDP A;  3BS5 B;  1QLN A;  4UW9 A;  4EEN A;  3TAD C;  4O9M A;  3TI0 A;  5AKJ A;  2JEG A;  1DGJ A;  4DOA A;  2J6U A;  2BQR A;  4CCH A;  9ICN A;  5AKX A;  4R66 A;  2AXT U;  3MR3 A;  1L8O A;  3MGH A;  3WKA A;  3QUB A;  4CNQ A;  3KFU F;  3TKA A;  3J81 j;  1N2X A;  3QU4 A;  2W9C B;  4XRH A;  4O3M A;  5ALQ A;  4RPZ A;  5AM4 A;  3AN1 A;  1S0N A;  3OSN A;  2G06 A;  5CB1 A;  2AQ0 A;  3UXN A;  1SL1 A;  4PZO A;  4F72 A;  3K1R B;  5ALL A;  1A76 A;  5ALR A;  5DBC A;  2NRV A;  1OW5 A;  3THV A;  4TUQ A;  2XY7 A;  1ZQY A;  1ZQL A;  2HHU A;  1D8B A;  2L5Y A;  2KHV A;  5AI4 A;  1PVQ A;  4JV1 A;  4J9R A;  1ZD2 P;  1ZQZ A;  1KW4 A;  4DS5 A;  2JH7 A;  5KFU A;  2UVU A;  2E8M A;  2HHQ A;  4EEY A;  3AUO A;  2BCQ A;  2KVS A;  3SEI A;  5DBA A;  4O5E A;  8ICQ A;  3HT3 A;  1LKY A;  3ZDA A;  5DQH A;  1ZQT A;  3M6Z A;  5J0T A;  2EDU A;  3PSF A;  8ICL A;  4F92 B;  2FMS A;  1KRP A;  4RPX A;  8ICC A;  4NJ8 A;  3PX0 A;  8ICX A;  1FEZ A;  1KFS A;  5AKY A;  2W9M A;  2RQ5 A;  4B9N A;  3PNC A;  4O3Q A;  3Q8K A;  2ZIX A;  4DQQ A;  4YMM A;  4Z6C A;  3RH4 A;  7ICT A;  2BPC A;  4M9H A;  3KOO A;  4Y2X A;  3AMZ A;  3EUB 2;  1ZJM A;  3TFS A;  4RQ8 A;  1PK1 A;  3KZX A;  3HPO A;  5F9N A;  2Y0S F;  2LPE A;  4O3R A;  8ICJ A;  2GO7 A;  4KLG A;  4GC7 A;  2QB0 A;  5DB9 A;  2ZUD A;  3MBY A;  1ZQN A;  2KEY A;  5IIO A;  2MUT A;  7ICS A;  4Z6E A;  4Y2Q A;  1N5X A;  2ZJ5 A;  2Y0S C;  2DQN B;  5IIN A;  4F50 A;  3PMN A;  3F5A A;  7ICR A;  2K4E A;  1BPZ A;  3QNM A;  4NL9 A;  2FPL A;  8ICV A;  1SB3 C;  4R64 A;  3SMV A;  5DDY A;  4PHE A;  3RJE A;  5J0U A;  3BQT A;  1CRX A;  5AKE A;  3AEV A;  4LZD A;  1KEJ A;  4ACO A;  3ISC A;  4DOC A;  1SIJ A;  2HOQ A;  1SZP A;  8ICM A;  3R9K A;  4AYB C;  5KFK A;  5AM0 A;  4O3S A;  2K4I A;  2K8A A;  3GZF A;  1X40 A;  1RPL A;  2I9G A;  5AIC A;  4U6P A;  1N5W A;  4LJX A;  3RFA A;  5AKG A;  2IOF A;  2F1I A;  3QEA Z;  5CEH A;  2W43 A;  2RP5 A;  3WKE A;  4F93 B;  3C5F A;  2P6U A;  2HVH A;  1WUD A;  2VKQ A;  1SKR A;  3N7S C;  5KFH A;  4C7Z A;  5CJ7 A;  4EBE A;  2W54 A;  4CF4 A;  5DGB A;  4F5Q A;  3RBE A;  1KQQ A;  3PW2 A;  4IQU A;  4NM2 A;  5DQI A;  4YCX A;  9ICC A;  3S6J A;  1NJW A;  2ALZ A;  4DL2 A;  2EAN A;  2EZZ A;  5J2G A;  3G6X A;  4JUZ A;  5ALK A;  4ECZ A;  2XIC A;  2P6R A;  2KZM A;  3A0H U;  2WB1 C;  1XNS A;  3OJS A;  4K4H A;  8ICE A;  1Z00 A;  2KG5 A;  2KJ8 A;  2KIW A;  5J2J A;  3HJE A;  3H8W A;  4F4Z A;  4USA A;  7ICE A;  3IM1 A;  3BQ2 A;  2JEF A;  4I2B A;  2CN1 A;  2HHV A;  4MF2 A;  3FDS A;  2ZXI A;  3SAF A;  3LWL A;  4RQ1 A;  2ZIW B;  5KL8 B;  1ZQV A;  3LVV A;  4X5V A;  2C2R A;  5CWR A;  1T4G A;  4GXJ A;  1ZQI A;  4I2J A;  3ALR A;  4UAY A;  2YMQ A;  5JTI A;  5AHX A;  5H2F U;  3F2B A;  4Y2S A;  4M47 A;  1S5L U;  4LZG A;  5J0X A;  3UXP A;  5ALE A;  5KG4 A;  3D6J A;  4I2G A;  4RQ5 A;  3NVV A;  1ED1 A;  2FLP A;  1KFD A;  2EAM A;  1J97 A;  2V4Q A;  5L1I A;  1SGG A;  5III A;  2KFZ A;  4YMO A;  3Q8R B;  4JMU A;  4HYK A;  3N28 A;  3GIL A;  4RQM A;  4GIB A;  7ICN A;  1XSP A;  4B6J A;  3ETR A;  5DLG A;  1QSL A;  9ICA A;  4KIT B;  3KHH A;  2HBK A;  1T3Q A;  3U26 A;  1NKC A;  2F3N A;  5AM1 A;  2AGO A;  2OXO A;  1CEZ A;  1RXV A;  3LDA A;  3JPR A;  5L9X A;  2ZIU A;  5JU5 A;  8ICG A;  1TVA A;  1UA1 A;  4RQ6 A;  5ALO A;  2YMM A;  2JEJ A;  1XSN A;  1TK0 A;  4RZR A;  1N62 A;  3Q8P B;  3V7J A;  1K1Q A;  4EX7 A;  4RQ4 A;  4QWE A;  5DQG A;  2QB0 B;  1Z4O A;  3RJF A;  2BPG A;  1MC8 A;  2HDO A;  4ZOH C;  1L5U A;  2NRW A;  4XA5 A;  3WKD A;  4XUS A;  4KLU A;  2ZIV B;  3RB0 A;  2RRD A;  3C23 A;  4O0I A;  1UQV A;  1TK5 A;  5KG2 A;  4I2C A;  5AM3 A;  5FP0 A;  7ICJ A;  4MFA A;  3H8S A;  4QIW F;  2BCR A;  3C29 A;  4P0P A;  3PML A;  3PW7 A;  1RQL A;  1ZQE A;  5J2C A;  3T5K A;  4KLM A;  1S97 A;  2PFQ A;  4NLK A;  2FPM A;  4ECQ A;  5KG0 A;  2OM6 A;  3M1Y A;  3UMC A;  2DPJ A;  7ICG A;  3OGU A;  4NLG A;  3E2E A;  5D4B A;  2RHF A;  5KFJ A;  5IIL A;  3AU6 A;  3RJK A;  4C8K A;  2IHM A;  2OYY A;  1F5S A;  1MN8 A;  4ECS A;  2ISO A;  1KSP A;  4UAR A;  4DWI A;  5J8Y C;  1PVP A;  4DL5 A;  4RU9 A;  5J0P A;  4NM1 A;  5ALN A;  2BQ3 A;  1ZQK A;  4AYB F;  1J2N A;  5KL1 B;  5AKI A;  5ALJ A;  3PSI A;  7ICP A;  9ICR A;  2XID A;  3C5G A;  2KFN A;  1KLN A;  8ICK A;  1RDF A;  3RH5 A;  2OEH A;  1OXJ A;  1ZET A;  4ED0 A;  3N97 B;  4NWI A;  2PFO A;  1LVH A;  2BDU A;  2I5H A;  5F3X B;  3SR6 A;  1ZQD A;  4J9K A;  1Y88 A;  2KIV A;  5J0R A;  3PW4 A;  5BOM A;  3ED5 A;  2BKE A;  5E79 U;  3NAS A;  3KD3 A;  3NUQ A;  4EYI B;  2E1E A;  5ALM A;  3RTV A;  2ZTE A;  1PK3 A;  3M8S A;  1K5O A;  1QTM A;  4QZC A;  5J2F A;  1TAM A;  9ICV A;  4UAW A;  5KG3 A;  3H0L B;  2W9C A;  4KMO B;  1A77 A;  1SL2 A;  2BCV A;  2EQY A;  1NZB A;  4M9N A;  4DFM A;  1ZQX A;  3GV7 B;  1NKB A;  1L7O A;  4KLS A;  4Z6F A;  1SWV A;  2NRZ A;  4PGX A;  1ZRM A;  3E58 A;  2GH1 A;  5ALZ A;  1H38 A;  1N60 A;  2KP7 A;  2RDJ A;  3QYP A;  2FMP A;  1O08 A;  5AIB A;  4J9Q A;  8ICN A;  2W11 A;  4ECV A;  5GTI U;  1T3N A;  4JK1 A;  1JX4 A;  1QQ7 A;  1Z3E B;  5KFQ A;  2PMZ F;  7ICQ A;  4YD2 A;  1WYG A;  4DSF A;  2V9W A;  1L6N A;  3EPG A;  3BS5 A;  9ICJ A;  4QZB A;  4DF8 A;  2HMX A;  1J2M A;  3VC8 A;  2H3Q A;  2KNJ A;  3K4G A;  4DEZ A; 
#chains in the Genus database with same CATH homology
 2G5I B;  5KL1 B;  2F8L A;  3T79 A;  2ZIX A;  4OO1 J;  2M0N A;  2OXO A;  3PZP A;  3HKZ C;  2PMZ C;  3PSI A;  3M6K A;  3ONN A;  3AL0 B;  3NRW A;  2VJ4 A;  2LKY A;  1PVQ A;  3SQI A;  2XI9 A;  2HBM A;  2XID A;  3H0M B;  4QJF B;  3L3F X;  2ZIV A;  4NV0 A;  2ZIU A;  3D2N A;  1ECW A;  2JH1 A;  2VJ5 A;  2K89 A;  3MGV A;  3IN5 A;  1ZQ1 C;  2XIC A;  2W03 A;  3PST A;  1Q3V A;  2WB1 C;  2H3V A;  3N7P D;  3O0F A;  3KZX A;  4KX3 A;  2GOL A;  3E0F A;  4P0Q A;  2KJ5 A;  4A8E A;  4BUG A;  3CYM A;  2Y0S F;  3LVW A;  2KJ8 A;  1XO0 A;  4BJQ A;  3CRX A;  2KIW A;  2CRX A;  3KFU F;  4NWI A;  2HOI A;  1T94 A;  4C0Z A;  2BDU A;  2HOF A;  2KKV A;  1XNS A;  2DGZ A;  4U7C A;  2E1F A;  2ZIX B;  2OH2 A;  4FE3 A;  1Q3U A;  4O3M A;  1SZH A;  2K8B B;  1GO3 F;  5HR7 A;  5T14 A;  2CN1 A;  2KV2 A;  3IP4 B;  2G06 A;  5CRX A;  2KEY A;  4PL2 A;  2YB1 A;  2ZXI A;  3SAF A;  3NUQ A;  4FZM A;  2E1E A;  2G0A A;  2ZIW B;  2WB1 F;  1PVR A;  3AQE A;  3PSP A;  5KL8 B;  1IIP A;  2Y0S C;  2ZIV B;  2ZXH A;  2A3V A;  3LVV A;  2DQN B;  1DRG A;  1Z1B A;  2RRD A;  1A6S A;  2F77 X;  2ZIW A;  1HIW A;  3F5A A;  2YX8 A;  3RF9 A;  2K4E A;  2YB4 A;  1TAM A;  3ALR A;  3F2D A;  2MRL A;  1D8B A;  3SAH A;  2LYA A;  4FZN A;  5C0Y A;  5HR6 A;  2ZG6 A;  2H3Z A;  4BX9 C;  2KHV A;  3F2B A;  3H0L B;  4ICA A;  4QIW F;  2G09 A;  2Q4T A;  4KMO B;  3SMV A;  4CDG A;  3C29 A;  1Z19 A;  4P0P A;  2NV3 A;  1CRX A;  1NZB A;  2JH7 A;  2KIC A;  2KOB A;  2LYB A;  4WJ3 B;  3K1Z A;  3C28 A;  2D6F C;  2R18 A;  2K4H A;  2F76 X;  3GU3 A;  2G07 A;  4OJP A;  4KX5 A;  1UPH A;  4ACO A;  4P0Q B;  1URJ A;  2MA1 A;  3D2S A;  1ED1 A;  2GH1 A;  2JGA A;  3SAG A;  2HOQ A;  3N7R C;  1MA7 A;  1YT3 A;  2OM6 A;  3VCB A;  2G5H B;  2W7P A;  1KBU A;  4AYB C;  2LBO A;  2WAQ C;  2JMG A;  4GFJ A;  2DF4 B;  3ICX A;  2HBL A;  2H3F A;  3F5E A;  3IG5 A;  2Z7J A;  3D2Q A;  2K4I A;  2K8A A;  2K8C B;  2RHF A;  4CRX A;  3GZF A;  4QIW C;  4QNL A;  2XVT A;  2E5S A;  2VIX A;  3DEE A;  2HBJ A;  4U6P A;  2W7O A;  3RFA A;  4PL1 A;  2KKP A;  4JMU A;  1A0P A;  3M6Z A;  4OJ6 A;  3HKZ F;  2OYY A;  2PMZ F;  2KJ9 A;  3OPX A;  4OJO A;  3M7D A;  3PSF A;  4NLB A;  1OUQ A;  3H0R B;  2KHQ A;  2KVC A;  1HEK A;  2RP5 A;  4FZL A;  3AQF A;  1L6N A;  2W04 A;  4OJL A;  5A0L A;  1PVP A;  1WUD A;  2VKQ A;  3LYS A;  2F2A B;  2N1R A;  3N7S C;  1P7D A;  1F44 A;  2H3I A;  4NLC A;  2HBK A;  2LHT A;  2CPR A;  3IG8 A;  4IC9 A;  4CGZ A;  4OJ5 A;  2HMX A;  3F53 A;  2G08 A;  2WAQ F;  2ZIU B;  4AYB F;  2KD1 A;  3VC8 A;  4P0P B;  2H3Q A;  3F2C A;  2KNJ A;  2JHD A;  3CP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...