5GTIU

Native xfel structure of photosystem ii (two flash dataset)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II D1 protein
total genus 30
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5gtiU01
1S5LU 5TISU 5KAIU 4IL6U 5B5EU 3WU2U 4UB6U 5GTIU 4UB8U 5B66U 3KZIU 5KAFU 5GTHU 5H2FU 3A0HU 3A0BU 4PJ0U 5E79U 2AXTU 2DUYA
chains in the Genus database with same CATH superfamily
3JPPA 4BDPA 9ICRA 2CN1A 2JEGA 3QU2A 4P4PA 1LKYB 4R65A 3ALRA 2KIWA 2HCFA 2FMSA 3L4PA 1D9DA 2KD1A 2IOHA 2K4EA 5CEHA 2HHWA 2FLPA 2XGPA 2D6FC 4NLZA 3DEEA 1NK9A 5AICA 1D8LA 2OHFA 7ICLA 4UAYA 5F9LA 2BGWA 5DB6A 4RPZA 1L5UA 1SGGA 2ASDA 4KLHA 2DFLA 3N4MB 8ICBA 4YN4A 3UMGA 2IOFK 4KX5A 5KFOA 2NV3A 3ETRA 7ICFA 2HHXA 3SR6A 9ICQA 5JUMA 3KBBA 2OXOA 2HOQA 2KG5A 2K8CB 4TUQA 2UVWA 3N7RC 5ALXA 2WF9A 4UAWA 1DOQA 1ZQNA 2D3DA 1FO4A 1MSWD 1T3QA 1N63A 5C5JA 5KTQA 4YQWA 2VJ4A 3J81j 4C8MA 2FLLA 2W9BA 1ZQIA 2ZUDA 2KNJA 4FZLA 3RTVA 1LVHA 1QLNA 5IILA 4QJFB 3MGVA 1ZQXA 3H4BA 3RAXA 5HHHA 8ICFA 1K1QA 3CW2C 2E8MA 4QZ9A 1A0PA 2VA8A 3VCBA 1NK8A 4I29A 3PSIA 4I2IA 2ZJ8A 4MF2A 4IC9A 4RQ0A 5KL8B 5KFMA 7ICPA 4IR1A 5L1JA 4ACOA 4M04A 4F91B 1XO0A 2HI0A 2MAXA 2HBJA 4ECZA 3AU2A 1J97A 1U49A 8ICHA 4Q44A 1SL1A 2J6TA 4UB3A 2BZFA 2Y1IA 3SYZA 2E1FA 1O08A 9ICAA 2BCSA 5KT3A 2R8JA 3BQ0A 2DF4B 4KLDA 4J9QA 3NUQA 2HHTA 1X9SA 9ICKA 3MABA 1NOMA 4PL1A 2B6GA 2G08A 3LWLA 4CE6A 5KFPA 4UAVA 3N28A 1NI3A 3E0FA 5KFLA 4RQ4A 3BS5A 4M9LA 4C8NA 4IQUA 5AKIA 1ZRMA 1DGJA 4I2AA 2R8GA 2JGAA 9ICVA 2Y0SF 8ICWA 2AHOB 4UB8U 1RXVA 3KZIU 3FYHA 1HJPA 5J0OA 5ALVA 4DO9A 1N5WA 4ED8A 3ZDCA 2YMLA 4C0ZA 2JZBB 3C21A 4F4XA 2JEJA 9ICOA 5KT5A 2PMZC 4AYBF 3H8MA 4QZ8A 3BS5B 2EAPA 2Q0ZX 1JN3A 3SQIA 1ZQAA 4ECTA 4KX3A 5JRTA 1N48A 2OM6A 2OEHA 2ZIVB 1BPDA 2G5HB 2AH5A 3QX7A 2ZIXB 1L8LA 4XA5A 5L1LA 2KVCA 3KHHA 5DLFA 3KHRA 5J2EA 5J0QA 1L3VA 1ZQVA 2H3FA 2ES6A 1T7PA 1CEZA 4Z6DA 4FZMA 2DQNB 3OJSA 8ICLA 3ZDDA 1X9MA 7ICQA 2EZXA 3SAHA 3RJJA 1BPBA 2M0NA 4EZ6A 3M6ZA 4JV1A 4R64A 1RM6C 5HP4A 2RDJA 4MHVA 3RH4A 1L3TA 4RNMA 1ZQDA 2BCRA 5L1KA 3QXGA 2AQ0A 3HKZF 5KG3A 4YG2A 2HHUA 4GXKA 2P66A 4YD2A 4IRDA 3F5EA 2QB1A 3RB6A 1GO3F 1WYGA 3D2SA 4EYIB 1Q46A 3GILA 3KTQA 4CNQA 2YTUA 4I28A 4KLMA 4DFJA 4J9LA 1JALA 3C28A 3C2MA 5AKEA 4DQPA 1DXSA 4DF4A 5KAFU 3C5FA 3NVZA 5AI8A 1FIQA 3SI8A 1JXEA 1V85A 2V4RA 2ZIUA 4Y2UA 2K8AA 3D6JA 4O5KA 4P0QA 5G5HA 3T5JA 9ICFA 4DF8A 3H7IA 3UPQA 2G5IB 2K4PA 1X6JA 4GC7A 2C22A 4PGQA 2BQRA 1J2MA 1KTQA 2LBOA 4JV0A 2MSNA 4LJXA 2OCEA 1NJWA 2A1JB 2GO7A 3JPNA 4F72A 1NZPA 5J0UA 3G6XA 5AKHA 4O3MA 2D8CA 2GWSA 4IRKA 1V9PA 3BQ7A 5KFUA 9ICHA 4QZDA 1SIJA 5AM1A 2WB1C 1NJXA 1BPYA 1UHUA 4ECVA 2A19A 2PMZF 3BDPA 8ICGA 5AKKA 4F5NA 2W55A 3PW5A 1KFDA 4J9RA 4DL2A 5KT4A 4J9PA 4ELUA 1JI7A 1BPXA 3EPGA 1HEKA 1RYRA 1B0XA 5ALRA 3C2KA 5J2CA 5KG4A 2FPLA 3KKAA 4DQSA 2UVRA 8ICRA 1WWUA 1DRGA 3ISDA 3TFRA 1Q3UA 2W3RA 2A1JA 3AL0B 1RG6A 1KRPA 3QEAZ 1ZJMA 3GIKA 3PV8A 2XICA 3B9JA 9ICMA 2MRLA 2PFPA 4C80A 1F0MA 2V9WA 4ED6A 4ED7A 5HHIA 1NJYA 3T3FA 4GXIA 3QU5A 1IG6A 2W9CA 7ICRA 2KIVA 5CA7A 5J8YC 3V7LA 3GU3A 2PKEA 1U47A 3SAGA 4EBDA 2YMMA 5AKZA 4K4GA 2JZBA 3SMVA 2YMQA 3B0XA 4PH5A 1QH9A 2QARB 1XU4A 2DBYA 3GIIA 1RZTA 4DS4A 4P4OA 3V6KA 1HUOA 3TARA 2LKYA 1X2IA 1ZQFA 5KFBA 3WU2U 4EX6A 3KHLA 3M8RA 3TAPA 1UT8A 1BNOA 1TAMA 5EE0A 3SEIA 1T3NA 4F50A 1ZQBA 9ICUA 3JPRA 3TI0A 2KZ3A 4M47A 2AQ4A 2W8KA 4MFAA 8ICZA 3RJGA 2G0AA 1IV8A 2KOBA 5ALLA 5GTHU 4Y2YA 1MC8A 4AYBC 4K4IA 4FBTA 3M9MB 4UAZA 4MFFA 1URJA 1Z4NA 4Y2XA 4C7ZA 4DL6A 3PMNA 1DGSA 4YMMA 2WAQC 2EAMA 8ICNA 2FJ6A 2KSOA 2H3QA 2O6KA 3NRZA 4U6PA 4NL9A 2FMQA 2XVTA 1N61A 2KHQA 3FC4A 8ICIA 3NRWA 3EWAA 2KP7A 4OJPA 1N2XA 1S0OA 4C8LA 4YP3A 3MGIA 7ICSA 4J9SA 4O5CA 5KFJA 5ALDA 5J2GA 4PJ0U 3QZ7A 2C2EA 3GIJA 1ZQMA 2QKQA 5J0XA 5IIJA 4F4WA 2K4HA 1NKBA 4GIBA 2HW3A 2KSOB 5KFHA 2DPIA 2KFZA 4DQIA 4ED2A 2RHFA 7ICMA 4F93B 5D49A 5KFGA 5KG6A 5H2FU 2HMXA 3ISCA 5CR0A 4UB2A 2NYVA 4IQVA 4PHDA 4B9NA 3RJKA 2E5SA 3TACB 5F9NA 1ED1A 2EANA 2RP5A 3LDAA 2KHVA 2R18A 2Y9TA 5DDMA 1TKDA 5DB7A 3BQ2A 2PFQA 3TANA 8ICTA 4O3NA 4DSLA 2ZIWA 4R8UA 3F2BA 2NO5A 3PSFA 3F53A 2PXIA 1BPEA 5DG7A 1HUZA 5EE1A 4I2EA 4KLOA 1KDHA 1MN8A 1RDFA 2NRZA 1SV4A 3THVA 8ICQA 2MA1A 3AM9A 3E58A 1KFSA 4O0IA 5CJ7A 9ICWA 4KLTA 2WF5A 1QSYA 4TQRA 2OYYA 5AKYA 1XC9A 1TE2A 2ESEA 1TAQA 4QWBA 1MQ3A 5J29A 2Y9UA 4EELA 3GQCA 1SKWA 2IOFA 5KFRA 2F8KA 4RQ6A 1VLBA 4QW9A 5KAIU 4UBBA 3MDAA 1F5SA 4KLFA 4EEYA 3ETLA 2HBLA 1XO1A 4KMUA 5KT6A 3K1RB 4DFKA 3T5LA 1PZNA 5J2DA 4RT2A 1A77A 4BJQA 4F3OA 2A1AA 4FFDA 2ZUBA 4NWIA 4JWMA 3O0FA 2RLTA 1KN5A 5J2AA 3JPTA 3NVYA 5J2HA 9ICEA 2DKZA 1BPZA 1HIWA 2DWQA 3F5AA 1TK8A 3HX0A 4MEYA 2ZIUB 3V6HA 3RFAA 2JEFA 2HBMA 5G5GA 2KZMA 4P0QB 3WKCA 1EXNA 4RUAA 3T5KA 3PY8A 4O3OA 3LWMA 4OD0A 4M9JA 1T94A 3OHBA 4ED3A 3Q8KA 3EZ5A 4BWMA 2H5XA 1VDVA 4DS5A 3F2DA 1NJZA 1QSLA 5AI0A 3MR2A 3G6YA 2KE7A 1KKXA 1XWLA 2FE9A 2JH1A 4UW9A 5ALYA 4M9GA 3H8JA 3RH6A 2KICA 2NRTA 5KFZA 4F5PA 3QU7A 4C8KA 3IP4B 3A0HU 3WKBA 1IIPA 5F3XB 3TADA 4I2BA 3H4DA 1LKYA 1X42A 5AM2A 2HHVA 2VANA 3QUQA 2ZIVA 4ELVA 4CF5A 1L6NA 5ALMA 8ICJA 5B5EU 9ICPA 3QYPA 2DL0A 1ZQSA 2AU0A 3WK9A 1X6IA 1PVQA 4KLJA 4PPXA 2ASLA 3V72A 1TFRA 5DKWA 1WUDA 1Z19A 4F8RA 5IINA 1ZQRA 5KG1A 3V7JA 9ICTA 4BUGA 3SD7A 5CP2A 1JMSA 1TAUA 8ICPA 3UXOA 1ZQQA 2R8HA 4Y2SA 3QZ8A 1VJ5A 3K4GA 5AI4A 1JROA 1QSSA 4Y2VA 5E79U 2XCPA 4YMNA 2DGZA 4YVZA 4QZEA 1IM4A 3UM9A 3PR4A 2C2DA 2PFNA 4CCHA 4NLNA 1NK6A 2KTQA 2WAQF 2W11A 1S76D 2FPKA 1P7DA 3PZPA 2VA2A 1A6SA 5J2KA 4I2HA 2BHNA 2MUTA 4Z6FA 3EUB2 4G3IA 1M6YA 1NK5A 1Q8KA 4F4ZA 2KJ8A 3I76A 3PX0A 1S10A 5CWRA 4RQ5A 1ZQ1C 4QWEA 4YR3A 5ALWA 3NASA 3MR6A 4P0PB 4DEZA 2KJ9A 3RBEA 4JUZA 5AM4A 1ZQTA 2LHTA 5AK6A 2HBKA 4EX7A 2BCVA 4RQ2A 3PO5A 3WK4A 4PHPA 4UARA 2B0CA 4DQQA 5ALGA 3E2EA 4O5EA 1FEZA 5KFAA 4NJ8A 3ZDEA 2BKEA 1BNPA 4Y2RA 3BQTA 4B6JA 3C1ZA 2W9AA 2KVSA 4DSJA 3OGUA 1ZQUA 3HP6A 4ICAA 3D2QA 4CDGA 2YMPA 4ECQA 2AXTU 3BZCA 2ZTCA 2VA3A 3LVWA 4P4MA 1S77D 4PHEA 3BQ1A 4FS2A 7ICTA 2KMDA 5KG0A 4RT3A 4DSKA 3TFSA 3MFIA 3QNMA 4KLQA 2W43A 4NM1A 2DUYA 2F1HA 4NXZA 5HMMA 1B4FA 3M7DA 1RYSA 2F44A 3T79A 4DQRA 4CF3A 2W9BB 3TAQA 4Q8EA 1ZQZA 3Q8SB 4M6WA 3UMBA 8ICUA 4QNLA 4GC6A 3A0BU 4RQNA 4B9SA 3WKAA 5ALUA 2KJ5A 5AM3A 5KG2A 4EZ9A 4QIWF 2ASJA 4BWJA 1WWVA 4JB3A 1ZOLA 2HVHA 3WKDA 5JTIA 2XGQA 5J0SA 2UVVA 1N60A 4RQMA 5BOLA 2CRXA 4O3QA 1O03A 8ICOA 2HOFA 1ZQOA 4F4KA 5ALZA 2IHNA 4F5RA 4ED0A 5KG7A 3NVWA 4J03A 5KT2A 9ICLA 5DDYA 4DCCA 2ZIXA 1QQ6A 1MQ2A 1U45A 2YB4A 5KFKA 3N7SC 2XY6A 4CRXA 2ZIWB 3BS7A 5J8YA 3PW2A 4UATA 1S0VA 4Q8FA 2GOLA 3IN5A 4PZNA 4NL9C 3CP8A 4KLIA 1RPLA 1UT5A 4NY8A 2AJQA 2ZXHA 2F1JA 8ICYA 4F4YA 4YXJA 1TK0A 4DOCA 2AGOA 8ICAA 5DBAA 3GIMA 1S0NA 2EZZA 2F2AB 3DV9A 1SWVA 2Y0SC 4UB4A 3QE9Y 3HILA 2UVUA 1JX4A 2IMWP 2JEIA 3GV5B 2YQEA 4ZOHC 5EE3A 1Z4OA 2F1IA 1KEJA 4P2HA 1K5OA 4UB6U 4ELTA 7ICIA 4DSEA 4MFCA 2HOIA 2EZYA 3AQEA 4USAA 5DBCA 4RQ1A 1X9XA 4FO6A 3SV4A 1KBUA 2W9MA 1ZD2P 3QU9A 3EW9A 4E0DA 2XY5A 2MUTB 3M8SA 2J6SA 2BCUA 2E8NA 4CF4A 4UB5A 3WK8A 5KFWA 7ICGA 2NRXA 1CRXA 1PK3A 4QZAA 1YT3A 2LYAA 1SL2A 1KLNA 7ICUA 3KKAC 1XNSA 4UB1A 1RXWA 4HYKA 5K4LA 5KFTA 4NLKA 3FM9A 5KFIA 2W7OA 4EYHB 4ECWA 3WK5A 2YN4A 1U9LA 3BZKA 1ECWA 3GV8B 3Q8QB 3PW7A 4KLEA 4AP9A 4EBEA 1C7YA 5CRXA 3HPOA 4MF8A 4DSFA 1L7MA 1C20A 3ZDAA 1DK3A 1DK2A 3ZI4A 3ISBA 3UQ0A 2MU2A 4UAUA 2OH2A 1L3UA 4RQ7A 5C0YA 4G9BA 2K8BB 9ICBA 3OJUA 5JU5A 4HAIA 4B9MA 2K60A 5ALSA 1NZBA 2JV3A 5J2FA 3S6JA 5J0WA 3RH5A 3PO4A 4KLUA 1WG8A 1NK0A 3N97B 2PI4A 3SENA 5HMLA 4XUSA 4UBCA 1SXEA 4LVSA 8ICVA 4PHAA 2N1RA 4YFKA 1X9WA 5DLGA 2W03A 2FI1A 2IBKA 4ECSA 2P6RA 4Y2QA 1JXLA 2F8LA 7ICJA 5IIMA 2H3IA 3NS1A 3K1ZA 4O3PA 1B22A 3H0LB 3M9NB 3C5GA 8ICEA 4DFMA 2HDOA 4QZBA 1XSNA 2KFNA 3BJYA 3L3FX 4YMOA 4R8UB 3NGDA 2AGPA 4Z6CA 2R8IA 5ALFA 2WFAA 5AM0A 1B43A 4EBCA 5EE9A 2BR0A 3T5HA 4BXOB 4RQ8A 3QUBA 1ZRNA 3NVVA 2ALZA 2KKPA 3OTQA 2LI6A 1KSPA 5KFQA 1N56A 4IL6U 1YZ6A 1AQ6A 2I6XA 3PX6A 1Y88A 3I1YA 1SL0A 4B9VA 3D2NA 1COKA 2LM4A 3V6JA 3AQFA 4C7YA 2E8OA 4O9MA 2HHQA 5DGBA 1Z1VA 3PSPA 3OHAA 1CI4A 3IV6A 4Q43A 3I28A 4KLSA 3Q8RB 1WCNA 1SWWA 2NRWA 4I2DA 4I27A 4M2YA 1RQLA 2YB1A 4QZIA 3GDXA 3JPOA 2NO4A 4JV2A 4YCXA 3KFUF 4FS1A 1ZYQA 4KN4A 9ICIA 1ZQEA 1XSLA 3TADC 3H0MB 4QZFA 3RJHA 1PVRA 3OPXA 3RAQA 2I1QA 4BXOA 5ALNA 5DB8A 4RNOA 2KZZA 4TUPA 1NNLA 4ECXA 4RUCA 5CHGA 2JXJA 1S0MA 1LV5A 1PK1A 3M9OB 1LB2B 1ZQGA 3PNCA 4ECYA 3GFKB 5T14A 1ZQLA 8ICSA 8ICMA 9ICXA 4GFJA 1NK7A 2BQ3A 5AK5A 4J9NA 1OXJA 4QIWC 5ALJA 3FAHA 4UASA 2OWOA 2E8PA 2XI9A 3IRUA 4C4SA 2WTFA 2ISPA 1X66A 2IA6A 5TISU 1XS9D 3IG8A 2ZTEA 1BVSA 4KTQA 4O3SA 5BPCA 2P6UA 3EYZA 1NKCA 5AIBA 5A0LA 4YR2A 4NV0A 4GXJA 4TQSA 2BDPA 3SZ2A 5AM5A 4F2RA 4Z6EA 2L5YA 4EENA 2C2RA 3QEBZ 2E1EA 4DL3A 2JHDA 4OCZA 2DPJA 4DL4A 2FPMA 1Z00A 4QWCA 4XQ8A 1RYUA 2F76X 2ZTDA 1ZQHA 4XRHA 1S97A 5D4BA 5HR6A 2ZJAA 5AKGA 3WK7A 5GTIU 2P35A 5DBBA 2B21A 3ICXA 3AMZA 1T4GA 5DB9A 4KITB 4ECRA 3UMCA 5KL1B 3LK9A 1JIHA 2KK0A 2AGQA 4TUSA 4FBUA 9ICNA 3G6VA 3C1YA 4YXMA 5ALHA 1U48A 4Y2TA 4GLXA 2BQUA 5J2JA 9ICJA 2WF8A 1UCVA 3M1YA 2QLTA 5AI6A 3F2CA 4C4TA 3RB3A 3RB0A 3NTUA 3Q8PB 2ZJ5A 2XCAA 8ICCA 4JWNA 4KN7A 2HHSA 9ICCA 4K4HA 2ODGA 2WHEA 2XIDA 2ZG6A 2E3TA 3K75D 4JK1A 4RNNA 1U4BA 3RJFA 3ORYA 2KEYA 2XO7A 3GV7B 5FP0A 1FFVA 3RRHA 3N7PD 3HT3A 4DLGA 5EWFA 1N62A 1UA1A 3RR8A 1QQ5A 4I2FA 2F3NA 1KW4A 2VJ5A 2YY6A 3RJEA 5DQIA 9ICSA 4CGZA 4ECUA 2K89A 2QARA 5AKJA 3C2LA 5ALTA 2WB1F 4IRCA 4J9KA 2FLNA 3AU6A 3C23A 1RQNA 5AK3A 2BPFA 5KFNA 1WCLA 3PVXA 3UXNA 5DG9A 7ICEA 2GLEA 1XSPA 4BGDA 2R8KA 3IHQB 4F92B 3ED5A 1SZPA 3AEVA 5ALEA 2FDRA 4US8A 1FFUA 3ZD8A 5EWGA 4QWDA 5KFVA 4NLGA 5HNKA 1NK4A 3SV3A 3EPIA 1S9FA 7ICHA 4A8EA 3MFHA 7ICKA 4OJ5A 2BPGA 5DGAA 5ALIA 2K4IA 2VKQA 5BOMA 1SKRA 1TV9A 4YD1A 1ZQYA 1ZJNA 3CRXA 3RR7A 1SXDA 1COOA 2RRDA 3PW4A 5KFFA 3KD3A 4YR0A 2EH9A 4OJ6A 4I2JA 1QCKA 3HJEA 1ZD4A 2LPEA 4B9TA 2Z7JA 5DG8A 1OUQA 2KKVA 5IIKA 3MC1A 3H8WA 5AI5A 4QW8A 4F5OA 4U7CA 4NM2A 2Y1JA 5AI9A 4DOAA 2KN7A 5B66U 4IR9A 2W8LA 1ZQKA 3AN1A 1ZD3A 5AKXA 5DQGA 5KFSA 4F71A 1L7NA 5KT7A 1K1SA 2W54A 2ZUCA 2RQ5A 3H8SA 4Y2PA 4RQ3A 4PGXA 1ZD5A 5ALKA 5TZVA 2V4QA 4US9A 4P0PA 1Q3VA 1S8OA 5HR7A 4RPYA 4PZOA 1AROP 3QUCA 1OW5A 3LYSA 4FE3A 7ICOA 5D46A 2ISOA 1UPHA 1Z3EB 2VIXA 8ICXA 1PUZA 2EAOA 3KHGA 3OSNA 1Z1BA 3IDWA 3JPQA 1IXRA 4PL2A 4C8OA 4QZCA 7ICNA 3UQ2A 4B9UA 2JMGA 4O3RA 3MR3A 1SB3C 2HVIA 2JR5A 2NRVA 4PGYA 1KQQA 3B0YA 4R63A 4BX9C 1ZETA 1JUDA 3HW8A 3ZD9A 4OO1J 3PR5B 4DL7A 3L5KA 2W9CB 5ALQA 5J0TA 3V7KA 1ZXIA 5DQHA 5ALOA 4RZRA 4F5QA 3R9KA 2EDUA 2PFOA 5L1MA 1KL9A 2GH1A 3MBYA 3Q8MA 3HKZC 3HWTA 1H38A 3RB4A 1SV0A 2WF6A 1V38A 1SZHA 3FDSA 2LMRA 4I2GA 5J0YA 5AKLA 4IQWA 3RF9A 1UQVA 2XY7A 1ZQPA 4DFPA 3PSTA 2C28A 5L1IA 5KG5A 3IG5A 2WF7A 1PK1B 5IIOA 1SV0C 3ZDBA 1V97A 2IHMA 2LYBA 2H3ZA 2ATLA 4IS7A 2F77X 2KV2A 4R66A 4KLGA 1L8OA 3KZXA 3ONNA 4KLLA 4Y2JA 4Q45A 3PMLA 5J0RA 4DSIA 5KNIA 3RJIA 2XC9A 1A76A 1X40A 3RBDA 5AHXA 3JPSA 5L9XA 4FZNA 3LVVA 2FMPA 3CNHA 3AUOA 5KFYA 1SKSA 1ZQJA 4DWIA 2J6UA 5KFEA 4DOBA 3QUTA 1TK5A 1MA7A 3H0RB 1S5LU 1D9FA 5AK4A 1TVAA 2BPCA 4LZDA 1JRPA 4NLBA 2CPRA 4IQTA 5EOZA 4ZH4A 2I5HA 4F2SA 4B9LA 1ZQWA 3CYMA 1NKEA 4QWAA 1D8YA 2EQYA 2DKXA 2W04A 4TURA 2W3SA 1QQ7A 4X5VA 5IIIA 3U26A 4C4RA 1CUKA 4OJLA 5J2IA 3DDHA 4EEKA 4M9NA 5KFCA 2W7PA 4ED1A 1L7PA 4J9MA 4OJOA 1Z00B 1ZQCA 3VC8A 4DL5A 8ICKA 4MEXA 2G06A 5AIAA 1QTMA 9ICGA 2Q4TA 1YZ7A 2ZXIA 3MDCA 5J0PA 3GZFA 1BGXT 3IM1A 3KOOA 2PI5A 3TQ1A 4DLEA 4M6WB 1PVPA 4M9HA 4I2CA 3MGHA 2M9NA 4KMOB 1KFTA 3M6KA 2JRZA 5KFDA 4WJ3B 1J2NA 2G07A 5EWEA 1UA0A 4M0AA 2JH7A 3WK6A 2QB0A 2BDUA 5J2BA 2LYHA 4J9OA 3HRDD 4RU9A 2H3VA 3TKAA 4QZHA 2I9GA 1D8BA 5CB1A 3MR5A 3Q8LA 3OSPA 2G09A 3PW0A 2LM1A 4LZGA 4QZGA 4UQGA 3RRGA 3QU4A 3UXPA 2BCQA 3PX4A 4JMUA 1L3SA 4RPXA 3SAFA 1N5XA 1L7OA 3C29A 2HSZA 3H40A 5KFXA 2CXYA 1T8EA 2RDIA 2A3VA 1F44A 2QB0B 3WKEA 4NLCA 4DFDA 7ICVA 5ALPA 2YX8A
chains in the Genus database with same CATH topology
1S5LU 5TISU 5KAIU 4IL6U 5B5EU 3WU2U 4UB6U 5GTIU 4UB8U 5B66U 3KZIU 5KAFU 5GTHU 5H2FU 3A0HU 3A0BU 4PJ0U 5E79U 2AXTU 2DUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L U;  5TIS U;  5KAI U;  4IL6 U;  5B5E U;  3WU2 U;  4UB6 U;  5GTI U;  4UB8 U;  5B66 U;  3KZI U;  5KAF U;  5GTH U;  5H2F U;  3A0H U;  3A0B U;  4PJ0 U;  5E79 U;  2AXT U;  2DUY A; 
#chains in the Genus database with same CATH topology
 3JPP A;  4BDP A;  9ICR A;  2CN1 A;  2JEG A;  3QU2 A;  4P4P A;  1LKY B;  4R65 A;  3ALR A;  2KIW A;  2HCF A;  2FMS A;  3L4P A;  1D9D A;  2KD1 A;  2IOH A;  2K4E A;  5CEH A;  2HHW A;  2FLP A;  2XGP A;  2D6F C;  4NLZ A;  3DEE A;  1NK9 A;  5AIC A;  1D8L A;  2OHF A;  7ICL A;  4UAY A;  5F9L A;  2BGW A;  5DB6 A;  4RPZ A;  1L5U A;  1SGG A;  2ASD A;  4KLH A;  2DFL A;  3N4M B;  8ICB A;  4YN4 A;  3UMG A;  2IOF K;  4KX5 A;  5KFO A;  2NV3 A;  3ETR A;  7ICF A;  2HHX A;  3SR6 A;  9ICQ A;  5JUM A;  3KBB A;  2OXO A;  2HOQ A;  2KG5 A;  2K8C B;  4TUQ A;  2UVW A;  3N7R C;  5ALX A;  2WF9 A;  4UAW A;  1DOQ A;  1ZQN A;  2D3D A;  1FO4 A;  1MSW D;  1T3Q A;  1N63 A;  5C5J A;  5KTQ A;  4YQW A;  2VJ4 A;  3J81 j;  4C8M A;  2FLL A;  2W9B A;  1ZQI A;  2ZUD A;  2KNJ A;  4FZL A;  3RTV A;  1LVH A;  1QLN A;  5IIL A;  4QJF B;  3MGV A;  1ZQX A;  3H4B A;  3RAX A;  5HHH A;  8ICF A;  1K1Q A;  3CW2 C;  2E8M A;  4QZ9 A;  1A0P A;  2VA8 A;  3VCB A;  1NK8 A;  4I29 A;  3PSI A;  4I2I A;  2ZJ8 A;  4MF2 A;  4IC9 A;  4RQ0 A;  5KL8 B;  5KFM A;  7ICP A;  4IR1 A;  5L1J A;  4ACO A;  4M04 A;  4F91 B;  1XO0 A;  2HI0 A;  2MAX A;  2HBJ A;  4ECZ A;  3AU2 A;  1J97 A;  1U49 A;  8ICH A;  4Q44 A;  1SL1 A;  2J6T A;  4UB3 A;  2BZF A;  2Y1I A;  3SYZ A;  2E1F A;  1O08 A;  9ICA A;  2BCS A;  5KT3 A;  2R8J A;  3BQ0 A;  2DF4 B;  4KLD A;  4J9Q A;  3NUQ A;  2HHT A;  1X9S A;  9ICK A;  3MAB A;  1NOM A;  4PL1 A;  2B6G A;  2G08 A;  3LWL A;  4CE6 A;  5KFP A;  4UAV A;  3N28 A;  1NI3 A;  3E0F A;  5KFL A;  4RQ4 A;  3BS5 A;  4M9L A;  4C8N A;  4IQU A;  5AKI A;  1ZRM A;  1DGJ A;  4I2A A;  2R8G A;  2JGA A;  9ICV A;  2Y0S F;  8ICW A;  2AHO B;  4UB8 U;  1RXV A;  3KZI U;  3FYH A;  1HJP A;  5J0O A;  5ALV A;  4DO9 A;  1N5W A;  4ED8 A;  3ZDC A;  2YML A;  4C0Z A;  2JZB B;  3C21 A;  4F4X A;  2JEJ A;  9ICO A;  5KT5 A;  2PMZ C;  4AYB F;  3H8M A;  4QZ8 A;  3BS5 B;  2EAP A;  2Q0Z X;  1JN3 A;  3SQI A;  1ZQA A;  4ECT A;  4KX3 A;  5JRT A;  1N48 A;  2OM6 A;  2OEH A;  2ZIV B;  1BPD A;  2G5H B;  2AH5 A;  3QX7 A;  2ZIX B;  1L8L A;  4XA5 A;  5L1L A;  2KVC A;  3KHH A;  5DLF A;  3KHR A;  5J2E A;  5J0Q A;  1L3V A;  1ZQV A;  2H3F A;  2ES6 A;  1T7P A;  1CEZ A;  4Z6D A;  4FZM A;  2DQN B;  3OJS A;  8ICL A;  3ZDD A;  1X9M A;  7ICQ A;  2EZX A;  3SAH A;  3RJJ A;  1BPB A;  2M0N A;  4EZ6 A;  3M6Z A;  4JV1 A;  4R64 A;  1RM6 C;  5HP4 A;  2RDJ A;  4MHV A;  3RH4 A;  1L3T A;  4RNM A;  1ZQD A;  2BCR A;  5L1K A;  3QXG A;  2AQ0 A;  3HKZ F;  5KG3 A;  4YG2 A;  2HHU A;  4GXK A;  2P66 A;  4YD2 A;  4IRD A;  3F5E A;  2QB1 A;  3RB6 A;  1GO3 F;  1WYG A;  3D2S A;  4EYI B;  1Q46 A;  3GIL A;  3KTQ A;  4CNQ A;  2YTU A;  4I28 A;  4KLM A;  4DFJ A;  4J9L A;  1JAL A;  3C28 A;  3C2M A;  5AKE A;  4DQP A;  1DXS A;  4DF4 A;  5KAF U;  3C5F A;  3NVZ A;  5AI8 A;  1FIQ A;  3SI8 A;  1JXE A;  1V85 A;  2V4R A;  2ZIU A;  4Y2U A;  2K8A A;  3D6J A;  4O5K A;  4P0Q A;  5G5H A;  3T5J A;  9ICF A;  4DF8 A;  3H7I A;  3UPQ A;  2G5I B;  2K4P A;  1X6J A;  4GC7 A;  2C22 A;  4PGQ A;  2BQR A;  1J2M A;  1KTQ A;  2LBO A;  4JV0 A;  2MSN A;  4LJX A;  2OCE A;  1NJW A;  2A1J B;  2GO7 A;  3JPN A;  4F72 A;  1NZP A;  5J0U A;  3G6X A;  5AKH A;  4O3M A;  2D8C A;  2GWS A;  4IRK A;  1V9P A;  3BQ7 A;  5KFU A;  9ICH A;  4QZD A;  1SIJ A;  5AM1 A;  2WB1 C;  1NJX A;  1BPY A;  1UHU A;  4ECV A;  2A19 A;  2PMZ F;  3BDP A;  8ICG A;  5AKK A;  4F5N A;  2W55 A;  3PW5 A;  1KFD A;  4J9R A;  4DL2 A;  5KT4 A;  4J9P A;  4ELU A;  1JI7 A;  1BPX A;  3EPG A;  1HEK A;  1RYR A;  1B0X A;  5ALR A;  3C2K A;  5J2C A;  5KG4 A;  2FPL A;  3KKA A;  4DQS A;  2UVR A;  8ICR A;  1WWU A;  1DRG A;  3ISD A;  3TFR A;  1Q3U A;  2W3R A;  2A1J A;  3AL0 B;  1RG6 A;  1KRP A;  3QEA Z;  1ZJM A;  3GIK A;  3PV8 A;  2XIC A;  3B9J A;  9ICM A;  2MRL A;  2PFP A;  4C80 A;  1F0M A;  2V9W A;  4ED6 A;  4ED7 A;  5HHI A;  1NJY A;  3T3F A;  4GXI A;  3QU5 A;  1IG6 A;  2W9C A;  7ICR A;  2KIV A;  5CA7 A;  5J8Y C;  3V7L A;  3GU3 A;  2PKE A;  1U47 A;  3SAG A;  4EBD A;  2YMM A;  5AKZ A;  4K4G A;  2JZB A;  3SMV A;  2YMQ A;  3B0X A;  4PH5 A;  1QH9 A;  2QAR B;  1XU4 A;  2DBY A;  3GII A;  1RZT A;  4DS4 A;  4P4O A;  3V6K A;  1HUO A;  3TAR A;  2LKY A;  1X2I A;  1ZQF A;  5KFB A;  3WU2 U;  4EX6 A;  3KHL A;  3M8R A;  3TAP A;  1UT8 A;  1BNO A;  1TAM A;  5EE0 A;  3SEI A;  1T3N A;  4F50 A;  1ZQB A;  9ICU A;  3JPR A;  3TI0 A;  2KZ3 A;  4M47 A;  2AQ4 A;  2W8K A;  4MFA A;  8ICZ A;  3RJG A;  2G0A A;  1IV8 A;  2KOB A;  5ALL A;  5GTH U;  4Y2Y A;  1MC8 A;  4AYB C;  4K4I A;  4FBT A;  3M9M B;  4UAZ A;  4MFF A;  1URJ A;  1Z4N A;  4Y2X A;  4C7Z A;  4DL6 A;  3PMN A;  1DGS A;  4YMM A;  2WAQ C;  2EAM A;  8ICN A;  2FJ6 A;  2KSO A;  2H3Q A;  2O6K A;  3NRZ A;  4U6P A;  4NL9 A;  2FMQ A;  2XVT A;  1N61 A;  2KHQ A;  3FC4 A;  8ICI A;  3NRW A;  3EWA A;  2KP7 A;  4OJP A;  1N2X A;  1S0O A;  4C8L A;  4YP3 A;  3MGI A;  7ICS A;  4J9S A;  4O5C A;  5KFJ A;  5ALD A;  5J2G A;  4PJ0 U;  3QZ7 A;  2C2E A;  3GIJ A;  1ZQM A;  2QKQ A;  5J0X A;  5IIJ A;  4F4W A;  2K4H A;  1NKB A;  4GIB A;  2HW3 A;  2KSO B;  5KFH A;  2DPI A;  2KFZ A;  4DQI A;  4ED2 A;  2RHF A;  7ICM A;  4F93 B;  5D49 A;  5KFG A;  5KG6 A;  5H2F U;  2HMX A;  3ISC A;  5CR0 A;  4UB2 A;  2NYV A;  4IQV A;  4PHD A;  4B9N A;  3RJK A;  2E5S A;  3TAC B;  5F9N A;  1ED1 A;  2EAN A;  2RP5 A;  3LDA A;  2KHV A;  2R18 A;  2Y9T A;  5DDM A;  1TKD A;  5DB7 A;  3BQ2 A;  2PFQ A;  3TAN A;  8ICT A;  4O3N A;  4DSL A;  2ZIW A;  4R8U A;  3F2B A;  2NO5 A;  3PSF A;  3F53 A;  2PXI A;  1BPE A;  5DG7 A;  1HUZ A;  5EE1 A;  4I2E A;  4KLO A;  1KDH A;  1MN8 A;  1RDF A;  2NRZ A;  1SV4 A;  3THV A;  8ICQ A;  2MA1 A;  3AM9 A;  3E58 A;  1KFS A;  4O0I A;  5CJ7 A;  9ICW A;  4KLT A;  2WF5 A;  1QSY A;  4TQR A;  2OYY A;  5AKY A;  1XC9 A;  1TE2 A;  2ESE A;  1TAQ A;  4QWB A;  1MQ3 A;  5J29 A;  2Y9U A;  4EEL A;  3GQC A;  1SKW A;  2IOF A;  5KFR A;  2F8K A;  4RQ6 A;  1VLB A;  4QW9 A;  5KAI U;  4UBB A;  3MDA A;  1F5S A;  4KLF A;  4EEY A;  3ETL A;  2HBL A;  1XO1 A;  4KMU A;  5KT6 A;  3K1R B;  4DFK A;  3T5L A;  1PZN A;  5J2D A;  4RT2 A;  1A77 A;  4BJQ A;  4F3O A;  2A1A A;  4FFD A;  2ZUB A;  4NWI A;  4JWM A;  3O0F A;  2RLT A;  1KN5 A;  5J2A A;  3JPT A;  3NVY A;  5J2H A;  9ICE A;  2DKZ A;  1BPZ A;  1HIW A;  2DWQ A;  3F5A A;  1TK8 A;  3HX0 A;  4MEY A;  2ZIU B;  3V6H A;  3RFA A;  2JEF A;  2HBM A;  5G5G A;  2KZM A;  4P0Q B;  3WKC A;  1EXN A;  4RUA A;  3T5K A;  3PY8 A;  4O3O A;  3LWM A;  4OD0 A;  4M9J A;  1T94 A;  3OHB A;  4ED3 A;  3Q8K A;  3EZ5 A;  4BWM A;  2H5X A;  1VDV A;  4DS5 A;  3F2D A;  1NJZ A;  1QSL A;  5AI0 A;  3MR2 A;  3G6Y A;  2KE7 A;  1KKX A;  1XWL A;  2FE9 A;  2JH1 A;  4UW9 A;  5ALY A;  4M9G A;  3H8J A;  3RH6 A;  2KIC A;  2NRT A;  5KFZ A;  4F5P A;  3QU7 A;  4C8K A;  3IP4 B;  3A0H U;  3WKB A;  1IIP A;  5F3X B;  3TAD A;  4I2B A;  3H4D A;  1LKY A;  1X42 A;  5AM2 A;  2HHV A;  2VAN A;  3QUQ A;  2ZIV A;  4ELV A;  4CF5 A;  1L6N A;  5ALM A;  8ICJ A;  5B5E U;  9ICP A;  3QYP A;  2DL0 A;  1ZQS A;  2AU0 A;  3WK9 A;  1X6I A;  1PVQ A;  4KLJ A;  4PPX A;  2ASL A;  3V72 A;  1TFR A;  5DKW A;  1WUD A;  1Z19 A;  4F8R A;  5IIN A;  1ZQR A;  5KG1 A;  3V7J A;  9ICT A;  4BUG A;  3SD7 A;  5CP2 A;  1JMS A;  1TAU A;  8ICP A;  3UXO A;  1ZQQ A;  2R8H A;  4Y2S A;  3QZ8 A;  1VJ5 A;  3K4G A;  5AI4 A;  1JRO A;  1QSS A;  4Y2V A;  5E79 U;  2XCP A;  4YMN A;  2DGZ A;  4YVZ A;  4QZE A;  1IM4 A;  3UM9 A;  3PR4 A;  2C2D A;  2PFN A;  4CCH A;  4NLN A;  1NK6 A;  2KTQ A;  2WAQ F;  2W11 A;  1S76 D;  2FPK A;  1P7D A;  3PZP A;  2VA2 A;  1A6S A;  5J2K A;  4I2H A;  2BHN A;  2MUT A;  4Z6F A;  3EUB 2;  4G3I A;  1M6Y A;  1NK5 A;  1Q8K A;  4F4Z A;  2KJ8 A;  3I76 A;  3PX0 A;  1S10 A;  5CWR A;  4RQ5 A;  1ZQ1 C;  4QWE A;  4YR3 A;  5ALW A;  3NAS A;  3MR6 A;  4P0P B;  4DEZ A;  2KJ9 A;  3RBE A;  4JUZ A;  5AM4 A;  1ZQT A;  2LHT A;  5AK6 A;  2HBK A;  4EX7 A;  2BCV A;  4RQ2 A;  3PO5 A;  3WK4 A;  4PHP A;  4UAR A;  2B0C A;  4DQQ A;  5ALG A;  3E2E A;  4O5E A;  1FEZ A;  5KFA A;  4NJ8 A;  3ZDE A;  2BKE A;  1BNP A;  4Y2R A;  3BQT A;  4B6J A;  3C1Z A;  2W9A A;  2KVS A;  4DSJ A;  3OGU A;  1ZQU A;  3HP6 A;  4ICA A;  3D2Q A;  4CDG A;  2YMP A;  4ECQ A;  2AXT U;  3BZC A;  2ZTC A;  2VA3 A;  3LVW A;  4P4M A;  1S77 D;  4PHE A;  3BQ1 A;  4FS2 A;  7ICT A;  2KMD A;  5KG0 A;  4RT3 A;  4DSK A;  3TFS A;  3MFI A;  3QNM A;  4KLQ A;  2W43 A;  4NM1 A;  2DUY A;  2F1H A;  4NXZ A;  5HMM A;  1B4F A;  3M7D A;  1RYS A;  2F44 A;  3T79 A;  4DQR A;  4CF3 A;  2W9B B;  3TAQ A;  4Q8E A;  1ZQZ A;  3Q8S B;  4M6W A;  3UMB A;  8ICU A;  4QNL A;  4GC6 A;  3A0B U;  4RQN A;  4B9S A;  3WKA A;  5ALU A;  2KJ5 A;  5AM3 A;  5KG2 A;  4EZ9 A;  4QIW F;  2ASJ A;  4BWJ A;  1WWV A;  4JB3 A;  1ZOL A;  2HVH A;  3WKD A;  5JTI A;  2XGQ A;  5J0S A;  2UVV A;  1N60 A;  4RQM A;  5BOL A;  2CRX A;  4O3Q A;  1O03 A;  8ICO A;  2HOF A;  1ZQO A;  4F4K A;  5ALZ A;  2IHN A;  4F5R A;  4ED0 A;  5KG7 A;  3NVW A;  4J03 A;  5KT2 A;  9ICL A;  5DDY A;  4DCC A;  2ZIX A;  1QQ6 A;  1MQ2 A;  1U45 A;  2YB4 A;  5KFK A;  3N7S C;  2XY6 A;  4CRX A;  2ZIW B;  3BS7 A;  5J8Y A;  3PW2 A;  4UAT A;  1S0V A;  4Q8F A;  2GOL A;  3IN5 A;  4PZN A;  4NL9 C;  3CP8 A;  4KLI A;  1RPL A;  1UT5 A;  4NY8 A;  2AJQ A;  2ZXH A;  2F1J A;  8ICY A;  4F4Y A;  4YXJ A;  1TK0 A;  4DOC A;  2AGO A;  8ICA A;  5DBA A;  3GIM A;  1S0N A;  2EZZ A;  2F2A B;  3DV9 A;  1SWV A;  2Y0S C;  4UB4 A;  3QE9 Y;  3HIL A;  2UVU A;  1JX4 A;  2IMW P;  2JEI A;  3GV5 B;  2YQE A;  4ZOH C;  5EE3 A;  1Z4O A;  2F1I A;  1KEJ A;  4P2H A;  1K5O A;  4UB6 U;  4ELT A;  7ICI A;  4DSE A;  4MFC A;  2HOI A;  2EZY A;  3AQE A;  4USA A;  5DBC A;  4RQ1 A;  1X9X A;  4FO6 A;  3SV4 A;  1KBU A;  2W9M A;  1ZD2 P;  3QU9 A;  3EW9 A;  4E0D A;  2XY5 A;  2MUT B;  3M8S A;  2J6S A;  2BCU A;  2E8N A;  4CF4 A;  4UB5 A;  3WK8 A;  5KFW A;  7ICG A;  2NRX A;  1CRX A;  1PK3 A;  4QZA A;  1YT3 A;  2LYA A;  1SL2 A;  1KLN A;  7ICU A;  3KKA C;  1XNS A;  4UB1 A;  1RXW A;  4HYK A;  5K4L A;  5KFT A;  4NLK A;  3FM9 A;  5KFI A;  2W7O A;  4EYH B;  4ECW A;  3WK5 A;  2YN4 A;  1U9L A;  3BZK A;  1ECW A;  3GV8 B;  3Q8Q B;  3PW7 A;  4KLE A;  4AP9 A;  4EBE A;  1C7Y A;  5CRX A;  3HPO A;  4MF8 A;  4DSF A;  1L7M A;  1C20 A;  3ZDA A;  1DK3 A;  1DK2 A;  3ZI4 A;  3ISB A;  3UQ0 A;  2MU2 A;  4UAU A;  2OH2 A;  1L3U A;  4RQ7 A;  5C0Y A;  4G9B A;  2K8B B;  9ICB A;  3OJU A;  5JU5 A;  4HAI A;  4B9M A;  2K60 A;  5ALS A;  1NZB A;  2JV3 A;  5J2F A;  3S6J A;  5J0W A;  3RH5 A;  3PO4 A;  4KLU A;  1WG8 A;  1NK0 A;  3N97 B;  2PI4 A;  3SEN A;  5HML A;  4XUS A;  4UBC A;  1SXE A;  4LVS A;  8ICV A;  4PHA A;  2N1R A;  4YFK A;  1X9W A;  5DLG A;  2W03 A;  2FI1 A;  2IBK A;  4ECS A;  2P6R A;  4Y2Q A;  1JXL A;  2F8L A;  7ICJ A;  5IIM A;  2H3I A;  3NS1 A;  3K1Z A;  4O3P A;  1B22 A;  3H0L B;  3M9N B;  3C5G A;  8ICE A;  4DFM A;  2HDO A;  4QZB A;  1XSN A;  2KFN A;  3BJY A;  3L3F X;  4YMO A;  4R8U B;  3NGD A;  2AGP A;  4Z6C A;  2R8I A;  5ALF A;  2WFA A;  5AM0 A;  1B43 A;  4EBC A;  5EE9 A;  2BR0 A;  3T5H A;  4BXO B;  4RQ8 A;  3QUB A;  1ZRN A;  3NVV A;  2ALZ A;  2KKP A;  3OTQ A;  2LI6 A;  1KSP A;  5KFQ A;  1N56 A;  4IL6 U;  1YZ6 A;  1AQ6 A;  2I6X A;  3PX6 A;  1Y88 A;  3I1Y A;  1SL0 A;  4B9V A;  3D2N A;  1COK A;  2LM4 A;  3V6J A;  3AQF A;  4C7Y A;  2E8O A;  4O9M A;  2HHQ A;  5DGB A;  1Z1V A;  3PSP A;  3OHA A;  1CI4 A;  3IV6 A;  4Q43 A;  3I28 A;  4KLS A;  3Q8R B;  1WCN A;  1SWW A;  2NRW A;  4I2D A;  4I27 A;  4M2Y A;  1RQL A;  2YB1 A;  4QZI A;  3GDX A;  3JPO A;  2NO4 A;  4JV2 A;  4YCX A;  3KFU F;  4FS1 A;  1ZYQ A;  4KN4 A;  9ICI A;  1ZQE A;  1XSL A;  3TAD C;  3H0M B;  4QZF A;  3RJH A;  1PVR A;  3OPX A;  3RAQ A;  2I1Q A;  4BXO A;  5ALN A;  5DB8 A;  4RNO A;  2KZZ A;  4TUP A;  1NNL A;  4ECX A;  4RUC A;  5CHG A;  2JXJ A;  1S0M A;  1LV5 A;  1PK1 A;  3M9O B;  1LB2 B;  1ZQG A;  3PNC A;  4ECY A;  3GFK B;  5T14 A;  1ZQL A;  8ICS A;  8ICM A;  9ICX A;  4GFJ A;  1NK7 A;  2BQ3 A;  5AK5 A;  4J9N A;  1OXJ A;  4QIW C;  5ALJ A;  3FAH A;  4UAS A;  2OWO A;  2E8P A;  2XI9 A;  3IRU A;  4C4S A;  2WTF A;  2ISP A;  1X66 A;  2IA6 A;  5TIS U;  1XS9 D;  3IG8 A;  2ZTE A;  1BVS A;  4KTQ A;  4O3S A;  5BPC A;  2P6U A;  3EYZ A;  1NKC A;  5AIB A;  5A0L A;  4YR2 A;  4NV0 A;  4GXJ A;  4TQS A;  2BDP A;  3SZ2 A;  5AM5 A;  4F2R A;  4Z6E A;  2L5Y A;  4EEN A;  2C2R A;  3QEB Z;  2E1E A;  4DL3 A;  2JHD A;  4OCZ A;  2DPJ A;  4DL4 A;  2FPM A;  1Z00 A;  4QWC A;  4XQ8 A;  1RYU A;  2F76 X;  2ZTD A;  1ZQH A;  4XRH A;  1S97 A;  5D4B A;  5HR6 A;  2ZJA A;  5AKG A;  3WK7 A;  5GTI U;  2P35 A;  5DBB A;  2B21 A;  3ICX A;  3AMZ A;  1T4G A;  5DB9 A;  4KIT B;  4ECR A;  3UMC A;  5KL1 B;  3LK9 A;  1JIH A;  2KK0 A;  2AGQ A;  4TUS A;  4FBU A;  9ICN A;  3G6V A;  3C1Y A;  4YXM A;  5ALH A;  1U48 A;  4Y2T A;  4GLX A;  2BQU A;  5J2J A;  9ICJ A;  2WF8 A;  1UCV A;  3M1Y A;  2QLT A;  5AI6 A;  3F2C A;  4C4T A;  3RB3 A;  3RB0 A;  3NTU A;  3Q8P B;  2ZJ5 A;  2XCA A;  8ICC A;  4JWN A;  4KN7 A;  2HHS A;  9ICC A;  4K4H A;  2ODG A;  2WHE A;  2XID A;  2ZG6 A;  2E3T A;  3K75 D;  4JK1 A;  4RNN A;  1U4B A;  3RJF A;  3ORY A;  2KEY A;  2XO7 A;  3GV7 B;  5FP0 A;  1FFV A;  3RRH A;  3N7P D;  3HT3 A;  4DLG A;  5EWF A;  1N62 A;  1UA1 A;  3RR8 A;  1QQ5 A;  4I2F A;  2F3N A;  1KW4 A;  2VJ5 A;  2YY6 A;  3RJE A;  5DQI A;  9ICS A;  4CGZ A;  4ECU A;  2K89 A;  2QAR A;  5AKJ A;  3C2L A;  5ALT A;  2WB1 F;  4IRC A;  4J9K A;  2FLN A;  3AU6 A;  3C23 A;  1RQN A;  5AK3 A;  2BPF A;  5KFN A;  1WCL A;  3PVX A;  3UXN A;  5DG9 A;  7ICE A;  2GLE A;  1XSP A;  4BGD A;  2R8K A;  3IHQ B;  4F92 B;  3ED5 A;  1SZP A;  3AEV A;  5ALE A;  2FDR A;  4US8 A;  1FFU A;  3ZD8 A;  5EWG A;  4QWD A;  5KFV A;  4NLG A;  5HNK A;  1NK4 A;  3SV3 A;  3EPI A;  1S9F A;  7ICH A;  4A8E A;  3MFH A;  7ICK A;  4OJ5 A;  2BPG A;  5DGA A;  5ALI A;  2K4I A;  2VKQ A;  5BOM A;  1SKR A;  1TV9 A;  4YD1 A;  1ZQY A;  1ZJN A;  3CRX A;  3RR7 A;  1SXD A;  1COO A;  2RRD A;  3PW4 A;  5KFF A;  3KD3 A;  4YR0 A;  2EH9 A;  4OJ6 A;  4I2J A;  1QCK A;  3HJE A;  1ZD4 A;  2LPE A;  4B9T A;  2Z7J A;  5DG8 A;  1OUQ A;  2KKV A;  5IIK A;  3MC1 A;  3H8W A;  5AI5 A;  4QW8 A;  4F5O A;  4U7C A;  4NM2 A;  2Y1J A;  5AI9 A;  4DOA A;  2KN7 A;  5B66 U;  4IR9 A;  2W8L A;  1ZQK A;  3AN1 A;  1ZD3 A;  5AKX A;  5DQG A;  5KFS A;  4F71 A;  1L7N A;  5KT7 A;  1K1S A;  2W54 A;  2ZUC A;  2RQ5 A;  3H8S A;  4Y2P A;  4RQ3 A;  4PGX A;  1ZD5 A;  5ALK A;  5TZV A;  2V4Q A;  4US9 A;  4P0P A;  1Q3V A;  1S8O A;  5HR7 A;  4RPY A;  4PZO A;  1ARO P;  3QUC A;  1OW5 A;  3LYS A;  4FE3 A;  7ICO A;  5D46 A;  2ISO A;  1UPH A;  1Z3E B;  2VIX A;  8ICX A;  1PUZ A;  2EAO A;  3KHG A;  3OSN A;  1Z1B A;  3IDW A;  3JPQ A;  1IXR A;  4PL2 A;  4C8O A;  4QZC A;  7ICN A;  3UQ2 A;  4B9U A;  2JMG A;  4O3R A;  3MR3 A;  1SB3 C;  2HVI A;  2JR5 A;  2NRV A;  4PGY A;  1KQQ A;  3B0Y A;  4R63 A;  4BX9 C;  1ZET A;  1JUD A;  3HW8 A;  3ZD9 A;  4OO1 J;  3PR5 B;  4DL7 A;  3L5K A;  2W9C B;  5ALQ A;  5J0T A;  3V7K A;  1ZXI A;  5DQH A;  5ALO A;  4RZR A;  4F5Q A;  3R9K A;  2EDU A;  2PFO A;  5L1M A;  1KL9 A;  2GH1 A;  3MBY A;  3Q8M A;  3HKZ C;  3HWT A;  1H38 A;  3RB4 A;  1SV0 A;  2WF6 A;  1V38 A;  1SZH A;  3FDS A;  2LMR A;  4I2G A;  5J0Y A;  5AKL A;  4IQW A;  3RF9 A;  1UQV A;  2XY7 A;  1ZQP A;  4DFP A;  3PST A;  2C28 A;  5L1I A;  5KG5 A;  3IG5 A;  2WF7 A;  1PK1 B;  5IIO A;  1SV0 C;  3ZDB A;  1V97 A;  2IHM A;  2LYB A;  2H3Z A;  2ATL A;  4IS7 A;  2F77 X;  2KV2 A;  4R66 A;  4KLG A;  1L8O A;  3KZX A;  3ONN A;  4KLL A;  4Y2J A;  4Q45 A;  3PML A;  5J0R A;  4DSI A;  5KNI A;  3RJI A;  2XC9 A;  1A76 A;  1X40 A;  3RBD A;  5AHX A;  3JPS A;  5L9X A;  4FZN A;  3LVV A;  2FMP A;  3CNH A;  3AUO A;  5KFY A;  1SKS A;  1ZQJ A;  4DWI A;  2J6U A;  5KFE A;  4DOB A;  3QUT A;  1TK5 A;  1MA7 A;  3H0R B;  1S5L U;  1D9F A;  5AK4 A;  1TVA A;  2BPC A;  4LZD A;  1JRP A;  4NLB A;  2CPR A;  4IQT A;  5EOZ A;  4ZH4 A;  2I5H A;  4F2S A;  4B9L A;  1ZQW A;  3CYM A;  1NKE A;  4QWA A;  1D8Y A;  2EQY A;  2DKX A;  2W04 A;  4TUR A;  2W3S A;  1QQ7 A;  4X5V A;  5III A;  3U26 A;  4C4R A;  1CUK A;  4OJL A;  5J2I A;  3DDH A;  4EEK A;  4M9N A;  5KFC A;  2W7P A;  4ED1 A;  1L7P A;  4J9M A;  4OJO A;  1Z00 B;  1ZQC A;  3VC8 A;  4DL5 A;  8ICK A;  4MEX A;  2G06 A;  5AIA A;  1QTM A;  9ICG A;  2Q4T A;  1YZ7 A;  2ZXI A;  3MDC A;  5J0P A;  3GZF A;  1BGX T;  3IM1 A;  3KOO A;  2PI5 A;  3TQ1 A;  4DLE A;  4M6W B;  1PVP A;  4M9H A;  4I2C A;  3MGH A;  2M9N A;  4KMO B;  1KFT A;  3M6K A;  2JRZ A;  5KFD A;  4WJ3 B;  1J2N A;  2G07 A;  5EWE A;  1UA0 A;  4M0A A;  2JH7 A;  3WK6 A;  2QB0 A;  2BDU A;  5J2B A;  2LYH A;  4J9O A;  3HRD D;  4RU9 A;  2H3V A;  3TKA A;  4QZH A;  2I9G A;  1D8B A;  5CB1 A;  3MR5 A;  3Q8L A;  3OSP A;  2G09 A;  3PW0 A;  2LM1 A;  4LZG A;  4QZG A;  4UQG A;  3RRG A;  3QU4 A;  3UXP A;  2BCQ A;  3PX4 A;  4JMU A;  1L3S A;  4RPX A;  3SAF A;  1N5X A;  1L7O A;  3C29 A;  2HSZ A;  3H40 A;  5KFX A;  2CXY A;  1T8E A;  2RDI A;  2A3V A;  1F44 A;  2QB0 B;  3WKE A;  4NLC A;  4DFD A;  7ICV A;  5ALP A;  2YX8 A; 
#chains in the Genus database with same CATH homology
 1S5L U;  5TIS U;  5KAI U;  4IL6 U;  5B5E U;  3WU2 U;  4UB6 U;  5GTI U;  4UB8 U;  5B66 U;  3KZI U;  5KAF U;  5GTH U;  5H2F U;  3A0H U;  3A0B U;  4PJ0 U;  5E79 U;  2AXT U;  2DUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...