5GTIU

Native xfel structure of photosystem ii (two flash dataset)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II D1 protein
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
total genus 30
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5gtiU01
5KAIU 5KAFU 2DUYA 3WU2U 5GTHU 4UB6U 5GTIU 5TISU 3KZIU 3A0BU 4PJ0U 5B5EU 1S5LU 2AXTU 3A0HU 5B66U 5E79U 5H2FU 4IL6U 4UB8U
chains in the Genus database with same CATH superfamily
3LYSA 2W9CA 4DFMA 2ALZA 2XCAA 4UBBA 4KX5A 1ZQFA 5DG7A 5J0WA 4J9LA 2EZZA 1XC9A 3NVYA 3SAFA 2WB1C 2HCFA 3PW0A 3C1ZA 1X9SA 1N5XA 1N63A 1NKCA 1A0PA 2GO7A 5ALOA 2BQUA 2P6UA 5ALKA 2BKEA 3C21A 4JUZA 5KFVA 2HOFA 2K4EA 4B9NA 3F2CA 4EBDA 2K60A 2EZXA 4C8NA 3PSTA 1AQ6A 2OHFA 5EWFA 1NK0A 1XO0A 1HJPA 2W11A 2AH5A 5AKIA 5AKZA 3KD3A 5C5JA 1RXWA 5KTQA 4EYIB 5DBAA 2BCRA 2BGWA 2Y1JA 1P7DA 1ZQRA 3QEAZ 8ICWA 2C2RA 2EQYA 4O3OA 5GTIU 1SKWA 3N7SC 1YZ7A 4UARA 5J2HA 1L6NA 5J29A 3SZ2A 3SMVA 1ZQJA 5AM3A 1Q8KA 5DB8A 5KFCA 4J9OA 1LVHA 1BPDA 2F1IA 3PMLA 3PX0A 3V72A 1PVRA 3B9JA 4JV0A 2PXIA 3PO4A 5AKYA 1DXSA 4MHVA 4M0AA 4PGQA 2PI5A 4C0ZA 1ZQPA 4RPZA 3GIMA 2KN7A 1TE2A 5KT4A 2WAQC 3RH5A 4PGYA 4QWCA 4P0QA 4DEZA 5J2CA 2FDRA 1IG6A 1COOA 3V7KA 2C22A 3TKAA 2FMQA 2DQNB 1ZQMA 3F5EA 4NLKA 3K75D 1HIWA 1NJWA 3OTQA 3BS5A 1ZQYA 4QWEA 2KZZA 2KIWA 4UB2A 4R8UB 3ISBA 3AQFA 3RB6A 2MRLA 1UCVA 2W9AA 5ALQA 2W3SA 5J0YA 3EYZA 1L7OA 5L1LA 3LVWA 1URJA 1TKDA 1ZQQA 4Y2QA 3ICXA 4FS2A 1QSLA 2KZMA 3BZCA 2VJ5A 3RR8A 5CRXA 4BUGA 4AP9A 9ICTA 1ZYQA 7ICUA 3H8SA 1RPLA 3TAQA 4MFCA 3M7DA 3IDWA 2ZJAA 9ICSA 1PVQA 5ALUA 2EAOA 3R9KA 4ED3A 5EWEA 1RYUA 4OJ5A 2FLLA 3HRDD 2ASJA 1SIJA 2G5IB 2ZIWA 2YB1A 4G9BA 5KFUA 1WCNA 3N28A 4NL9C 3UXNA 4GLXA 3QUBA 1U47A 3BS7A 3PX6A 4NY8A 2CRXA 2YMLA 9ICMA 3T5HA 7ICJA 3AU2A 7ICLA 3C23A 5J2EA 1T94A 2JV3A 4GXIA 1N56A 1MQ2A 1J2MA 2W7OA 2E8PA 3QEBZ 2ZXIA 2E1EA 3RJHA 2JHDA 1RZTA 3L4PA 1ZQKA 3ISDA 4DSFA 5JTIA 3RJGA 1D8LA 4F4YA 4F91B 2P66A 2ISPA 2HI0A 1TVAA 3JPSA 3HKZC 1H38A 1L5UA 4EYHB 1SXEA 3T5JA 4M47A 3SQIA 2H3ZA 3PW5A 3ZDAA 4C7ZA 5AKXA 1ZJMA 2K4IA 4FS1A 3WK5A 5DG8A 4DL7A 2ZIXB 3I28A 1TK0A 4DF8A 3PSFA 2VJ4A 1PK1A 5KT7A 3ZI4A 1WCLA 5HP4A 3ETRA 3D2SA 5J8YC 2OEHA 5KFSA 4NWIA 5KFPA 4XRHA 1OW5A 3Q8RB 3G6XA 2F1JA 8ICHA 4RT2A 4KN4A 2R8HA 2K8CB 4KLGA 1COKA 4R66A 3F2DA 4NLGA 5ALNA 2Q4TA 4RUCA 3MDCA 2H3IA 1S10A 4RPXA 4RU9A 3MR2A 5EE9A 5HMMA 2BQ3A 4DL3A 4PHAA 2Q0ZX 4QZ9A 1CUKA 5J0OA 2MUTB 1B4FA 3GIJA 5KG0A 1SL1A 2BDPA 4MFFA 4QW8A 2I1QA 1BNOA 2OCEA 2W43A 1KW4A 4UAYA 2NO5A 1V85A 4YR2A 3A0HU 2KJ9A 5D4BA 1BGXT 2W7PA 1TAUA 4DFPA 5ALFA 5KFXA 5IINA 3RTVA 2E5SA 2EH9A 5HR6A 2F76X 2PFQA 5DKWA 2ZXHA 4P4OA 4KLUA 3DDHA 5KL8B 4DOCA 3CW2C 2H3QA 2KMDA 2JEJA 3FAHA 5IIOA 9ICHA 2M9NA 2BHNA 3M6KA 1NZBA 1DK3A 1DGJA 4PL2A 1T4GA 4O9MA 3UMCA 2BR0A 5KFWA 2HHXA 4ELTA 5AK4A 3PNCA 3TI0A 2KJ5A 2JEIA 5AKGA 1LKYA 4ED2A 8ICJA 4ZH4A 1RQNA 3HW8A 1NZPA 3RAXA 4C8MA 4OJLA 5AHXA 3ONNA 3JPPA 1RQLA 4RQ4A 9ICCA 3NTUA 5ALRA 5J2AA 4YR0A 4O3NA 2QKQA 2NRTA 4B9VA 4I2FA 4DSIA 4OO1J 2R8JA 4LVSA 7ICSA 7ICPA 2GH1A 1MC8A 5EE3A 2K8BB 2LYHA 1MN8A 2NYVA 4K4HA 1ZQIA 8ICOA 2KE7A 3SD7A 4RNOA 2PMZC 3HJEA 4Y2TA 4Y2SA 1XNSA 4ECWA 3LVVA 2HVIA 4J9MA 3HPOA 5J2GA 3ZDCA 2C2DA 4UB4A 3HP6A 2HBJA 4FFDA 3DV9A 1KRPA 4JWMA 3KKAA 1L3TA 3GV8B 3H8WA 5ALSA 3M9OB 3T79A 1B22A 4J9RA 2QARA 3ALRA 5DBCA 1NI3A 3M9MB 1DOQA 3RRHA 5KFEA 2O6KA 1FIQA 2RLTA 5AKJA 2E3TA 5ALMA 3WKEA 5KG3A 1ZQEA 3PY8A 5KFDA 1ZETA 1UT8A 3QUQA 4QIWF 1NJZA 4I2HA 4QIWC 4DSEA 3VC8A 4R8UA 3H4BA 1QQ5A 1KFSA 2HHWA 3PO5A 1N2XA 9ICOA 5HNKA 5J2IA 4QZEA 4KLSA 4ED1A 9ICRA 4YVZA 5F9LA 1F5SA 5B5EU 1N60A 9ICUA 2WF6A 3NGDA 2J6TA 8ICKA 2A3VA 2KHVA 3MR3A 4DL6A 2Z7JA 3RJEA 1XWLA 2YMPA 3A0BU 5KFBA 5DQGA 3SEIA 2AXTU 4Q8FA 4KLOA 4HYKA 5DDYA 4XUSA 2KV2A 2G08A 3KHGA 4NLNA 3UMGA 1JXEA 1JUDA 4O3PA 1QQ7A 2BPGA 3T5KA 1S77D 3QZ8A 2FPMA 4FZMA 3L5KA 1LV5A 1QTMA 1ZQAA 5TZVA 1PK1B 5ALGA 3GV5B 5KFZA 3SAHA 2F2AB 4F4ZA 2D3DA 4UB3A 1WUDA 2HBLA 1U9LA 4DS4A 2YQEA 4Y2RA 2JR5A 3UMBA 3KOOA 4I27A 5FP0A 2HBMA 2FLNA 3Q8QB 9ICJA 1S5LU 4NLBA 1XS9D 3RF9A 4F93B 2GWSA 1NNLA 3PV8A 4KLDA 3ETLA 4J9PA 1BNPA 4BWMA 3NVVA 8ICUA 1JRPA 4M9GA 3VCBA 4Q8EA 5EE0A 3BQ1A 1Q3VA 2NRVA 7ICOA 2W03A 9ICIA 2JEFA 2LKYA 2ZIXA 4CDGA 1O08A 2RDJA 1UPHA 2PFNA 2C28A 4QWAA 4RQ3A 5AM4A 5KFAA 3V7LA 3OSNA 5CWRA 5C0YA 4U6PA 4O3RA 3N7RC 1QLNA 5JUMA 3WK7A 1T8EA 4FZNA 5AKHA 1MA7A 8ICYA 1NK8A 4KLFA 2FPKA 4Q44A 1NK4A 4C8OA 5AKLA 3GU3A 1OUQA 5L1IA 2KFZA 2MSNA 5E79U 1X9MA 4QJFB 4F8RA 1LKYB 2MUTA 4CF4A 1NK9A 3WK8A 4R65A 3SR6A 4IR1A 1KL9A 5J0SA 1MQ3A 4OJOA 5ALYA 3GILA 4PGXA 1KQQA 1SXDA 2HOQA 2P35A 5CEHA 2R8IA 3ZD8A 2NRZA 1BPEA 3IRUA 2I5HA 2PKEA 3AUOA 1B0XA 4KLQA 1L8OA 2KKVA 2R18A 4ZOHC 4CF3A 2LI6A 1Z4OA 1SB3C 4DFJA 4KLTA 4TUPA 2W9BB 4CRXA 4OJ6A 5AI5A 1NK6A 4RNMA 1KLNA 5AKEA 3NVWA 3WKAA 3GFKB 2XVTA 1N62A 1X6JA 1RXVA 4IL6U 3WKDA 2BZFA 1NK7A 3V6KA 1KBUA 2KK0A 2BPCA 4ECUA 3H8JA 4JV2A 1JROA 2UVUA 4NL9A 2XGPA 1L3VA 4ELUA 2HVHA 4J9NA 2EZYA 4LJXA 5ALHA 2QARB 3QU9A 8ICPA 5CA7A 4QWDA 5KFOA 3Q8LA 4DLEA 4CF5A 1Z1BA 1HUZA 4QZGA 4UQGA 1BPBA 1C20A 1NKEA 5J0PA 2DUYA 5ALZA 3ZDDA 4DFKA 3QU4A 5DB9A 5KFTA 3TADA 2V4RA 2W3RA 3H4DA 2ZTEA 5HR7A 8ICIA 2JH1A 1RYSA 2FMPA 1SV4A 1FEZA 1KSPA 4PHEA 4I29A 3M1YA 3EPGA 5EOZA 4CCHA 2FMSA 2IA6A 4GC6A 1DRGA 1U45A 3F2BA 4P2HA 4X5VA 3OPXA 2LBOA 1SL2A 4EEKA 4Z6EA 1X2IA 4UASA 8ICRA 2ZIVB 3F53A 4Q45A 5AK5A 3QU7A 3EPIA 3PW7A 1WYGA 4NLCA 4PH5A 5J8YA 2B21A 4DO9A 5ALXA 1PVPA 1JI7A 4UB6U 1ZQLA 4RQ5A 4I28A 4Z6CA 5KFIA 2J6UA 2KFNA 1BPYA 5J2BA 4Q43A 9ICVA 4M2YA 3C28A 2OYYA 3RJFA 1QH9A 4OJPA 3Q8PB 1T3QA 8ICFA 5J0RA 4C8KA 3E0FA 2HHUA 1U48A 1N61A 2DKXA 5DB7A 4BGDA 3TADC 1ZQGA 2KSOB 2PFOA 4YMNA 9ICBA 4FO6A 1ZQCA 4MFAA 3NASA 3TARA 3Q8KA 9ICFA 4XQ8A 4KLHA 4EELA 1ZXIA 2LMRA 3JPQA 5KFJA 5ALTA 3NS1A 1VLBA 8ICZA 3NUQA 4DOBA 5AK3A 1U4BA 3PSPA 2PI4A 2JRZA 5J2FA 3M8SA 3D6JA 2EAMA 5BOMA 4F3OA 4WJ3B 1ZD4A 1L3UA 5CB1A 3C2MA 4Z6FA 1TK5A 3HWTA 5GTHU 4GFJA 5KNIA 8ICGA 1ZQBA 1K5OA 3OSPA 4PZOA 1NOMA 5D49A 4KLEA 3TACB 2VA8A 2G5HB 4G3IA 3AM9A 7ICRA 1SZPA 2OH2A 2HHTA 9ICGA 4US9A 2G09A 1FFVA 3FC4A 1S97A 4C4SA 2XO7A 5ALWA 1CI4A 3QE9Y 3RJJA 2DPJA 1N5WA 2ESEA 4NXZA 5JRTA 4DOAA 1A76A 4KLMA 1S8OA 4KLIA 3ISCA 3Q8MA 2ZUCA 5DQHA 1L7MA 4ACOA 1N48A 3F5AA 1ZQ1C 4KX3A 4ECXA 4I2DA 4YG2A 4P4MA 2H3VA 3UPQA 2PFPA 4AYBF 5DLGA 4DCCA 3QUTA 4FZLA 5DGAA 2JMGA 3J81j 4MF8A 1Q3UA 1QSYA 3M8RA 4QZDA 3IG5A 4TURA 3M9NB 2E8NA 2RQ5A 2K89A 2ZG6A 5AM1A 2B6GA 3WK4A 2RDIA 4YN4A 5ALJA 2UVWA 4F50A 4ECYA 4C7YA 4GXKA 4PPXA 3C29A 4F5OA 4F92B 1ZQSA 5KFNA 9ICQA 1SL0A 1D8BA 9ICKA 2IOFA 3OJSA 5AI4A 5EE1A 3BJYA 5F9NA 3CP8A 8ICVA 3K1ZA 5KG7A 1JMSA 3KHLA 2K4HA 3V7JA 3KBBA 2WF9A 5KFGA 3KHHA 4F2SA 2W9BA 3UXOA 2DF4B 1KN5A 5ALVA 4MF2A 3WK6A 4FBTA 1NJYA 1RG6A 3MGVA 7ICNA 4EZ6A 3LDAA 2MU2A 5KAFU 3PW4A 4TUSA 1V38A 3H7IA 4RUAA 2ZUDA 4MEXA 9ICAA 3QU5A 1X66A 1ZQVA 3RB3A 2EAPA 2N1RA 1NJXA 5IILA 8ICBA 5IIIA 2KG5A 4F4WA 2W8LA 3QYPA 1TAQA 1V9PA 4F72A 2HHQA 5J0QA 4RT3A 4YD1A 2KTQA 1K1SA 3MGHA 7ICMA 2OWOA 2XCPA 1AROP 2CN1A 1X6IA 2WF7A 4A8EA 5JU5A 1U49A 4TQRA 2Y9UA 1KFDA 4UAUA 2ZTDA 2AQ4A 1Z00B 1XSLA 9ICPA 4TQSA 4PHDA 3IN5A 3BQ2A 1PK3A 1IM4A 2YB4A 3PR4A 4Y2JA 2IHNA 2Y9TA 4BJQA 3JPTA 2F1HA 1S0MA 3I1YA 5J0XA 5K4LA 4YXMA 2KP7A 1X40A 1BVSA 4R64A 2KVSA 5HMLA 5AIBA 4F5PA 1WG8A 1DGSA 2ZIVA 8ICCA 5KG6A 4O3SA 2BPFA 2HW3A 5L9XA 4K4IA 1JXLA 4M6WA 2RRDA 2W04A 3RR7A 4IQWA 2YN4A 2OXOA 5KG2A 5DQIA 9ICWA 1K1QA 1TAMA 5TISU 4IRKA 4F5RA 4ECZA 4GC7A 4O3MA 2HMXA 3U26A 5L1KA 2VANA 8ICXA 2HBKA 3OGUA 3HT3A 2UVVA 3AL0B 5G5GA 1L7NA 7ICTA 3H0LB 2KSOA 5DG9A 2IHMA 1S76D 7ICEA 3SI8A 2BCSA 4DFDA 5CHGA 3GV7B 3B0XA 5CJ7A 4PJ0U 1RDFA 3ED5A 2GLEA 2ASLA 4DQQA 2H3FA 1QQ6A 5KFMA 4M9LA 3WU2U 1SZHA 1O03A 3MC1A 4O5EA 2G0AA 1JN3A 3C2LA 3G6VA 8ICAA 3H0MB 3M6ZA 1Z1VA 1SWVA 5ALDA 3MBYA 2YMQA 1T7PA 1ED1A 3GIKA 3WK9A 2ZUBA 4RQ7A 1SKRA 5H2FU 3T3FA 1ZQNA 4R63A 9ICNA 1YT3A 2JH7A 3EZ5A 2E1FA 1S0VA 2KIVA 2XY7A 3THVA 4EX7A 3QNMA 3O0FA 3OHAA 4F4XA 2QLTA 3AQEA 4QW9A 4TUQA 3RJIA 1ZRNA 2ATLA 1UT5A 1JALA 4YFKA 4E0DA 3Q8SB 4I2BA 2XC9A 3RAQA 4Y2UA 1VJ5A 4IR9A 4RQ0A 2XGQA 5KFYA 1C7YA 4ECVA 2RHFA 2QB0B 1ZQDA 2FPLA 3ZDBA 5KFRA 4YCXA 2WB1F 4EZ9A 2J6SA 3FDSA 4DS5A 4XA5A 3C5GA 2I9GA 5AKKA 1WWVA 1ZQTA 2V4QA 4Y2XA 3K4GA 2XICA 2D6FC 2L5YA 4UB1A 3RRGA 8ICMA 4IRDA 1Z19A 2G07A 2JXJA 4P0PB 7ICFA 4F71A 2F8LA 5KT6A 5J2DA 4QZIA 3QU2A 2Y1IA 3CYMA 2B0CA 9ICEA 4DF4A 4CE6A 1V97A 2WFAA 3EUB2 4JK1A 5J0UA 2KEYA 4PL1A 4RNNA 5KG5A 3GDXA 4RQ8A 2WF5A 2AQ0A 1DK2A 2JGAA 5ALEA 4I2CA 1Y88A 2JZBA 2KHQA 1X9WA 4DSKA 4JV1A 3JPNA 5DB6A 1F44A 2BQRA 1M6YA 4UW9A 3ZDEA 3RBDA 4M9JA 1PUZA 1OXJA 4B9TA 4M9HA 4USAA 4LZGA 2WF8A 3RH4A 1XU4A 4ECSA 1T3NA 4RQNA 4QWBA 3SYZA 2EANA 3H40A 4DQSA 1S9FA 3IHQB 4FE3A 2D8CA 5AICA 4RPYA 1KDHA 4KLLA 3AMZA 1TK8A 4C4TA 1Z4NA 2WAQF 4F2RA 1A6SA 3HX0A 4QNLA 3IM1A 4RZRA 3JPRA 2HDOA 5AI9A 4K4GA 4J9QA 1RYRA 3FM9A 4JB3A 2YMMA 1BPXA 1VDVA 4ELVA 2ZTCA 4UAWA 5G5HA 1ZJNA 2BCVA 4RQ2A 1L8LA 2K8AA 1L7PA 3MFHA 3MGIA 4O5KA 1QCKA 4IQVA 4M6WB 1SGGA 2ZJ8A 4UAZA 2AHOB 3RB4A 3IG8A 4UB5A 4PHPA 2DL0A 3RBEA 7ICQA 4C80A 2W55A 1Z00A 3RB0A 3PVXA 4MEYA 2BCUA 4YXJA 2KZ3A 2KNJA 4YP3A 1UHUA 4J9SA 5IIJA 2E8OA 3WKBA 3S6JA 3V6JA 3UXPA 1HUOA 3TAPA 3N97B 1UA0A 4NM2A 3UM9A 1TV9A 2NRWA 5CR0A 3MR5A 2MAXA 5L1MA 7ICIA 2ZIUB 3GIIA 4EENA 3TFRA 3E58A 3MR6A 4FBUA 2UVRA 1YZ6A 9ICLA 4ED7A 2Y0SF 2DGZA 2Y0SC 3HILA 4DL4A 4Y2PA 2KOBA 3DEEA 3HKZF 4QZFA 4F5QA 1ZD5A 3RJKA 2A1JB 2EDUA 2V9WA 4YD2A 4QZHA 2ZJ5A 5ALPA 2M0NA 3C2KA 4QZAA 5KT5A 3UQ0A 4JWNA 4ED8A 3CRXA 2FI1A 4BDPA 3N7PD 2ISOA 1WWUA 4Z6DA 4EEYA 4RQMA 3QXGA 2LPEA 2F77X 2NO4A 4ED6A 1HEKA 4I2EA 4BXOB 4ED0A 3WKCA 2VIXA 3MABA 4P4PA 3I76A 4QZ8A 2FE9A 2XIDA 3PZPA 2I6XA 2F8KA 2LM4A 2OM6A 4DSLA 2IOFK 2W9CB 1X42A 2W9MA 5KT2A 1FO4A 4HAIA 2R8GA 3RFAA 1A77A 3BQ7A 2DPIA 3L3FX 1XO1A 4DWIA 1ECWA 4OCZA 3EWAA 3ORYA 4J03A 2KD1A 1LB2B 1ZQXA 2MA1A 4C4RA 8ICEA 1ZQHA 5AK6A 5AI6A 4B9LA 4AYBC 3SV3A 3C5FA 1JIHA 4IQTA 4YMOA 1IXRA 4EX6A 4EBCA 2P6RA 5AI8A 5ALLA 4ECQA 3OHBA 3BQ0A 3LWMA 5KFLA 4UAVA 3OJUA 1Q46A 4IQUA 5KFFA 3KZIU 2YX8A 5HHHA 2C2EA 7ICGA 3SENA 4PZNA 3EW9A 1NK5A 4F4KA 4O3QA 2JZBB 2HHSA 2QB0A 5B66U 3AN1A 4KTQA 4ECTA 4NLZA 5KG1A 1NKBA 4F5NA 3K1RB 4CGZA 4KN7A 5T14A 5KL1B 4DQIA 2HSZA 2K4PA 4P0PA 4QZCA 2DBYA 1PZNA 4P0QB 2A1AA 5KAIU 1QSSA 1IV8A 5AM2A 1ZQUA 4QZBA 3B0YA 4GIBA 4ECRA 4KMOB 5AM5A 4CNQA 1ZD3A 4B6JA 4LZDA 5F3XB 8ICQA 2AJQA 2IBKA 1KEJA 3H8MA 5KFKA 4YR3A 3BS5B 3SV4A 1GO3F 2XY5A 1BPZA 5J2KA 4C8LA 4RQ1A 2VA3A 5J0TA 4B9MA 1L3SA 3QUCA 2PMZF 3MFIA 1KFTA 4DL5A 4KMUA 1MSWD 4YMMA 2VKQA 3H0RB 4Y2YA 1S0NA 2WTFA 2DKZA 1FFUA 3JPOA 3G6YA 1D9DA 2CPRA 4BX9C 1ZQWA 4OD0A 4I2GA 4IS7A 5DDMA 4I2IA 4JMUA 5DBBA 3AEVA 3V6HA 4NJ8A 2NV3A 2KICA 3NRZA 2ODGA 2RP5A 2QB1A 3IV6A 3NVZA 5BOLA 3PW2A 3PX4A 2AGPA 5BPCA 4NM1A 8ICLA 2ZIWB 2LHTA 2F3NA 3C1YA 2HHVA 1ZQZA 1TFRA 5IIKA 3KFUF 2BCQA 5KG4A 2HOIA 4IRCA 1UQVA 4NV0A 1SKSA 4BWJA 3SAGA 3CNHA 4I2AA 2E8MA 4M04A 5IIMA 2CXYA 3PSIA 2KVCA 2XY6A 2GOLA 3N4MB 4B9UA 3BZKA 3QX7A 3GZFA 2DFLA 5L1JA 1KTQA 3GQCA 3KTQA 1ZD2P 2DWQA 2G06A 2NRXA 3D2NA 7ICVA 4RQ6A 4DL2A 2VA2A 1Z3EB 4DSJA 5D46A 2AU0A 3QZ7A 5DGBA 5DLFA 4O0IA 3PMNA 4YQWA 1SV0A 1UA1A 5HHIA 1IIPA 3E2EA 2F44A 2KJ8A 5J2JA 2YY6A 5CP2A 1XSPA 4U7CA 4US8A 1CRXA 1D9FA 3KHRA 3IP4B 4UB8U 4J9KA 1B43A 9ICXA 4UATA 3KKAC 3TFSA 2IMWP 3NRWA 8ICNA 2ES6A 2FLPA 2A19A 2WHEA 1RM6C 4Y2VA 3MDAA 1F0MA 4IC9A 3LWLA 4EBEA 1D8YA 2AGQA 1J97A 4UBCA 3AU6A 4M9NA 2LYAA 4ICAA 4B9SA 7ICKA 7ICHA 2ZIUA 1CEZA 2R8KA 1EXNA 2LYBA 2JEGA 2KKPA 1ZQOA 4KITB 1KKXA 5KFQA 1XSNA 2H5XA 3FYHA 4O5CA 2YTUA 3RH6A 1X9XA 3BDPA 4DQRA 2BDUA 5AIAA 5A0LA 1ZRMA 2A1JA 3KZXA 2ASDA 1S0OA 4DQPA 2W8KA 3UQ2A 3T5LA 4I2JA 3TANA 5AM0A 4GXJA 2FJ6A 5KT3A 1JX4A 4KLJA 4DLGA 3TQ1A 2W54A 3BQTA 5EWGA 1ZOLA 2AGOA 8ICSA 4BXOA 2XI9A 3LK9A 5KFHA 1J2NA 3PR5B 8ICTA 5AI0A 3ZD9A 2LM1A 3D2QA 5ALIA 1SV0C 1SWWA 2IOHA
chains in the Genus database with same CATH topology
5KAIU 5KAFU 2DUYA 3WU2U 5GTHU 4UB6U 5GTIU 5TISU 3KZIU 3A0BU 4PJ0U 5B5EU 1S5LU 2AXTU 3A0HU 5B66U 5E79U 5H2FU 4IL6U 4UB8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI U;  5KAF U;  2DUY A;  3WU2 U;  5GTH U;  4UB6 U;  5GTI U;  5TIS U;  3KZI U;  3A0B U;  4PJ0 U;  5B5E U;  1S5L U;  2AXT U;  3A0H U;  5B66 U;  5E79 U;  5H2F U;  4IL6 U;  4UB8 U; 
#chains in the Genus database with same CATH topology
 3LYS A;  2W9C A;  4DFM A;  2ALZ A;  2XCA A;  4UBB A;  4KX5 A;  1ZQF A;  5DG7 A;  5J0W A;  4J9L A;  2EZZ A;  1XC9 A;  3NVY A;  3SAF A;  2WB1 C;  2HCF A;  3PW0 A;  3C1Z A;  1X9S A;  1N5X A;  1N63 A;  1NKC A;  1A0P A;  2GO7 A;  5ALO A;  2BQU A;  2P6U A;  5ALK A;  2BKE A;  3C21 A;  4JUZ A;  5KFV A;  2HOF A;  2K4E A;  4B9N A;  3F2C A;  4EBD A;  2K60 A;  2EZX A;  4C8N A;  3PST A;  1AQ6 A;  2OHF A;  5EWF A;  1NK0 A;  1XO0 A;  1HJP A;  2W11 A;  2AH5 A;  5AKI A;  5AKZ A;  3KD3 A;  5C5J A;  1RXW A;  5KTQ A;  4EYI B;  5DBA A;  2BCR A;  2BGW A;  2Y1J A;  1P7D A;  1ZQR A;  3QEA Z;  8ICW A;  2C2R A;  2EQY A;  4O3O A;  5GTI U;  1SKW A;  3N7S C;  1YZ7 A;  4UAR A;  5J2H A;  1L6N A;  5J29 A;  3SZ2 A;  3SMV A;  1ZQJ A;  5AM3 A;  1Q8K A;  5DB8 A;  5KFC A;  4J9O A;  1LVH A;  1BPD A;  2F1I A;  3PML A;  3PX0 A;  3V72 A;  1PVR A;  3B9J A;  4JV0 A;  2PXI A;  3PO4 A;  5AKY A;  1DXS A;  4MHV A;  4M0A A;  4PGQ A;  2PI5 A;  4C0Z A;  1ZQP A;  4RPZ A;  3GIM A;  2KN7 A;  1TE2 A;  5KT4 A;  2WAQ C;  3RH5 A;  4PGY A;  4QWC A;  4P0Q A;  4DEZ A;  5J2C A;  2FDR A;  1IG6 A;  1COO A;  3V7K A;  2C22 A;  3TKA A;  2FMQ A;  2DQN B;  1ZQM A;  3F5E A;  4NLK A;  3K75 D;  1HIW A;  1NJW A;  3OTQ A;  3BS5 A;  1ZQY A;  4QWE A;  2KZZ A;  2KIW A;  4UB2 A;  4R8U B;  3ISB A;  3AQF A;  3RB6 A;  2MRL A;  1UCV A;  2W9A A;  5ALQ A;  2W3S A;  5J0Y A;  3EYZ A;  1L7O A;  5L1L A;  3LVW A;  1URJ A;  1TKD A;  1ZQQ A;  4Y2Q A;  3ICX A;  4FS2 A;  1QSL A;  2KZM A;  3BZC A;  2VJ5 A;  3RR8 A;  5CRX A;  4BUG A;  4AP9 A;  9ICT A;  1ZYQ A;  7ICU A;  3H8S A;  1RPL A;  3TAQ A;  4MFC A;  3M7D A;  3IDW A;  2ZJA A;  9ICS A;  1PVQ A;  5ALU A;  2EAO A;  3R9K A;  4ED3 A;  5EWE A;  1RYU A;  4OJ5 A;  2FLL A;  3HRD D;  2ASJ A;  1SIJ A;  2G5I B;  2ZIW A;  2YB1 A;  4G9B A;  5KFU A;  1WCN A;  3N28 A;  4NL9 C;  3UXN A;  4GLX A;  3QUB A;  1U47 A;  3BS7 A;  3PX6 A;  4NY8 A;  2CRX A;  2YML A;  9ICM A;  3T5H A;  7ICJ A;  3AU2 A;  7ICL A;  3C23 A;  5J2E A;  1T94 A;  2JV3 A;  4GXI A;  1N56 A;  1MQ2 A;  1J2M A;  2W7O A;  2E8P A;  3QEB Z;  2ZXI A;  2E1E A;  3RJH A;  2JHD A;  1RZT A;  3L4P A;  1ZQK A;  3ISD A;  4DSF A;  5JTI A;  3RJG A;  1D8L A;  4F4Y A;  4F91 B;  2P66 A;  2ISP A;  2HI0 A;  1TVA A;  3JPS A;  3HKZ C;  1H38 A;  1L5U A;  4EYH B;  1SXE A;  3T5J A;  4M47 A;  3SQI A;  2H3Z A;  3PW5 A;  3ZDA A;  4C7Z A;  5AKX A;  1ZJM A;  2K4I A;  4FS1 A;  3WK5 A;  5DG8 A;  4DL7 A;  2ZIX B;  3I28 A;  1TK0 A;  4DF8 A;  3PSF A;  2VJ4 A;  1PK1 A;  5KT7 A;  3ZI4 A;  1WCL A;  5HP4 A;  3ETR A;  3D2S A;  5J8Y C;  2OEH A;  5KFS A;  4NWI A;  5KFP A;  4XRH A;  1OW5 A;  3Q8R B;  3G6X A;  2F1J A;  8ICH A;  4RT2 A;  4KN4 A;  2R8H A;  2K8C B;  4KLG A;  1COK A;  4R66 A;  3F2D A;  4NLG A;  5ALN A;  2Q4T A;  4RUC A;  3MDC A;  2H3I A;  1S10 A;  4RPX A;  4RU9 A;  3MR2 A;  5EE9 A;  5HMM A;  2BQ3 A;  4DL3 A;  4PHA A;  2Q0Z X;  4QZ9 A;  1CUK A;  5J0O A;  2MUT B;  1B4F A;  3GIJ A;  5KG0 A;  1SL1 A;  2BDP A;  4MFF A;  4QW8 A;  2I1Q A;  1BNO A;  2OCE A;  2W43 A;  1KW4 A;  4UAY A;  2NO5 A;  1V85 A;  4YR2 A;  3A0H U;  2KJ9 A;  5D4B A;  1BGX T;  2W7P A;  1TAU A;  4DFP A;  5ALF A;  5KFX A;  5IIN A;  3RTV A;  2E5S A;  2EH9 A;  5HR6 A;  2F76 X;  2PFQ A;  5DKW A;  2ZXH A;  4P4O A;  4KLU A;  3DDH A;  5KL8 B;  4DOC A;  3CW2 C;  2H3Q A;  2KMD A;  2JEJ A;  3FAH A;  5IIO A;  9ICH A;  2M9N A;  2BHN A;  3M6K A;  1NZB A;  1DK3 A;  1DGJ A;  4PL2 A;  1T4G A;  4O9M A;  3UMC A;  2BR0 A;  5KFW A;  2HHX A;  4ELT A;  5AK4 A;  3PNC A;  3TI0 A;  2KJ5 A;  2JEI A;  5AKG A;  1LKY A;  4ED2 A;  8ICJ A;  4ZH4 A;  1RQN A;  3HW8 A;  1NZP A;  3RAX A;  4C8M A;  4OJL A;  5AHX A;  3ONN A;  3JPP A;  1RQL A;  4RQ4 A;  9ICC A;  3NTU A;  5ALR A;  5J2A A;  4YR0 A;  4O3N A;  2QKQ A;  2NRT A;  4B9V A;  4I2F A;  4DSI A;  4OO1 J;  2R8J A;  4LVS A;  7ICS A;  7ICP A;  2GH1 A;  1MC8 A;  5EE3 A;  2K8B B;  2LYH A;  1MN8 A;  2NYV A;  4K4H A;  1ZQI A;  8ICO A;  2KE7 A;  3SD7 A;  4RNO A;  2PMZ C;  3HJE A;  4Y2T A;  4Y2S A;  1XNS A;  4ECW A;  3LVV A;  2HVI A;  4J9M A;  3HPO A;  5J2G A;  3ZDC A;  2C2D A;  4UB4 A;  3HP6 A;  2HBJ A;  4FFD A;  3DV9 A;  1KRP A;  4JWM A;  3KKA A;  1L3T A;  3GV8 B;  3H8W A;  5ALS A;  3M9O B;  3T79 A;  1B22 A;  4J9R A;  2QAR A;  3ALR A;  5DBC A;  1NI3 A;  3M9M B;  1DOQ A;  3RRH A;  5KFE A;  2O6K A;  1FIQ A;  2RLT A;  5AKJ A;  2E3T A;  5ALM A;  3WKE A;  5KG3 A;  1ZQE A;  3PY8 A;  5KFD A;  1ZET A;  1UT8 A;  3QUQ A;  4QIW F;  1NJZ A;  4I2H A;  4QIW C;  4DSE A;  3VC8 A;  4R8U A;  3H4B A;  1QQ5 A;  1KFS A;  2HHW A;  3PO5 A;  1N2X A;  9ICO A;  5HNK A;  5J2I A;  4QZE A;  4KLS A;  4ED1 A;  9ICR A;  4YVZ A;  5F9L A;  1F5S A;  5B5E U;  1N60 A;  9ICU A;  2WF6 A;  3NGD A;  2J6T A;  8ICK A;  2A3V A;  2KHV A;  3MR3 A;  4DL6 A;  2Z7J A;  3RJE A;  1XWL A;  2YMP A;  3A0B U;  5KFB A;  5DQG A;  3SEI A;  2AXT U;  4Q8F A;  4KLO A;  4HYK A;  5DDY A;  4XUS A;  2KV2 A;  2G08 A;  3KHG A;  4NLN A;  3UMG A;  1JXE A;  1JUD A;  4O3P A;  1QQ7 A;  2BPG A;  3T5K A;  1S77 D;  3QZ8 A;  2FPM A;  4FZM A;  3L5K A;  1LV5 A;  1QTM A;  1ZQA A;  5TZV A;  1PK1 B;  5ALG A;  3GV5 B;  5KFZ A;  3SAH A;  2F2A B;  4F4Z A;  2D3D A;  4UB3 A;  1WUD A;  2HBL A;  1U9L A;  4DS4 A;  2YQE A;  4Y2R A;  2JR5 A;  3UMB A;  3KOO A;  4I27 A;  5FP0 A;  2HBM A;  2FLN A;  3Q8Q B;  9ICJ A;  1S5L U;  4NLB A;  1XS9 D;  3RF9 A;  4F93 B;  2GWS A;  1NNL A;  3PV8 A;  4KLD A;  3ETL A;  4J9P A;  1BNP A;  4BWM A;  3NVV A;  8ICU A;  1JRP A;  4M9G A;  3VCB A;  4Q8E A;  5EE0 A;  3BQ1 A;  1Q3V A;  2NRV A;  7ICO A;  2W03 A;  9ICI A;  2JEF A;  2LKY A;  2ZIX A;  4CDG A;  1O08 A;  2RDJ A;  1UPH A;  2PFN A;  2C28 A;  4QWA A;  4RQ3 A;  5AM4 A;  5KFA A;  3V7L A;  3OSN A;  5CWR A;  5C0Y A;  4U6P A;  4O3R A;  3N7R C;  1QLN A;  5JUM A;  3WK7 A;  1T8E A;  4FZN A;  5AKH A;  1MA7 A;  8ICY A;  1NK8 A;  4KLF A;  2FPK A;  4Q44 A;  1NK4 A;  4C8O A;  5AKL A;  3GU3 A;  1OUQ A;  5L1I A;  2KFZ A;  2MSN A;  5E79 U;  1X9M A;  4QJF B;  4F8R A;  1LKY B;  2MUT A;  4CF4 A;  1NK9 A;  3WK8 A;  4R65 A;  3SR6 A;  4IR1 A;  1KL9 A;  5J0S A;  1MQ3 A;  4OJO A;  5ALY A;  3GIL A;  4PGX A;  1KQQ A;  1SXD A;  2HOQ A;  2P35 A;  5CEH A;  2R8I A;  3ZD8 A;  2NRZ A;  1BPE A;  3IRU A;  2I5H A;  2PKE A;  3AUO A;  1B0X A;  4KLQ A;  1L8O A;  2KKV A;  2R18 A;  4ZOH C;  4CF3 A;  2LI6 A;  1Z4O A;  1SB3 C;  4DFJ A;  4KLT A;  4TUP A;  2W9B B;  4CRX A;  4OJ6 A;  5AI5 A;  1NK6 A;  4RNM A;  1KLN A;  5AKE A;  3NVW A;  3WKA A;  3GFK B;  2XVT A;  1N62 A;  1X6J A;  1RXV A;  4IL6 U;  3WKD A;  2BZF A;  1NK7 A;  3V6K A;  1KBU A;  2KK0 A;  2BPC A;  4ECU A;  3H8J A;  4JV2 A;  1JRO A;  2UVU A;  4NL9 A;  2XGP A;  1L3V A;  4ELU A;  2HVH A;  4J9N A;  2EZY A;  4LJX A;  5ALH A;  2QAR B;  3QU9 A;  8ICP A;  5CA7 A;  4QWD A;  5KFO A;  3Q8L A;  4DLE A;  4CF5 A;  1Z1B A;  1HUZ A;  4QZG A;  4UQG A;  1BPB A;  1C20 A;  1NKE A;  5J0P A;  2DUY A;  5ALZ A;  3ZDD A;  4DFK A;  3QU4 A;  5DB9 A;  5KFT A;  3TAD A;  2V4R A;  2W3R A;  3H4D A;  2ZTE A;  5HR7 A;  8ICI A;  2JH1 A;  1RYS A;  2FMP A;  1SV4 A;  1FEZ A;  1KSP A;  4PHE A;  4I29 A;  3M1Y A;  3EPG A;  5EOZ A;  4CCH A;  2FMS A;  2IA6 A;  4GC6 A;  1DRG A;  1U45 A;  3F2B A;  4P2H A;  4X5V A;  3OPX A;  2LBO A;  1SL2 A;  4EEK A;  4Z6E A;  1X2I A;  4UAS A;  8ICR A;  2ZIV B;  3F53 A;  4Q45 A;  5AK5 A;  3QU7 A;  3EPI A;  3PW7 A;  1WYG A;  4NLC A;  4PH5 A;  5J8Y A;  2B21 A;  4DO9 A;  5ALX A;  1PVP A;  1JI7 A;  4UB6 U;  1ZQL A;  4RQ5 A;  4I28 A;  4Z6C A;  5KFI A;  2J6U A;  2KFN A;  1BPY A;  5J2B A;  4Q43 A;  9ICV A;  4M2Y A;  3C28 A;  2OYY A;  3RJF A;  1QH9 A;  4OJP A;  3Q8P B;  1T3Q A;  8ICF A;  5J0R A;  4C8K A;  3E0F A;  2HHU A;  1U48 A;  1N61 A;  2DKX A;  5DB7 A;  4BGD A;  3TAD C;  1ZQG A;  2KSO B;  2PFO A;  4YMN A;  9ICB A;  4FO6 A;  1ZQC A;  4MFA A;  3NAS A;  3TAR A;  3Q8K A;  9ICF A;  4XQ8 A;  4KLH A;  4EEL A;  1ZXI A;  2LMR A;  3JPQ A;  5KFJ A;  5ALT A;  3NS1 A;  1VLB A;  8ICZ A;  3NUQ A;  4DOB A;  5AK3 A;  1U4B A;  3PSP A;  2PI4 A;  2JRZ A;  5J2F A;  3M8S A;  3D6J A;  2EAM A;  5BOM A;  4F3O A;  4WJ3 B;  1ZD4 A;  1L3U A;  5CB1 A;  3C2M A;  4Z6F A;  1TK5 A;  3HWT A;  5GTH U;  4GFJ A;  5KNI A;  8ICG A;  1ZQB A;  1K5O A;  3OSP A;  4PZO A;  1NOM A;  5D49 A;  4KLE A;  3TAC B;  2VA8 A;  2G5H B;  4G3I A;  3AM9 A;  7ICR A;  1SZP A;  2OH2 A;  2HHT A;  9ICG A;  4US9 A;  2G09 A;  1FFV A;  3FC4 A;  1S97 A;  4C4S A;  2XO7 A;  5ALW A;  1CI4 A;  3QE9 Y;  3RJJ A;  2DPJ A;  1N5W A;  2ESE A;  4NXZ A;  5JRT A;  4DOA A;  1A76 A;  4KLM A;  1S8O A;  4KLI A;  3ISC A;  3Q8M A;  2ZUC A;  5DQH A;  1L7M A;  4ACO A;  1N48 A;  3F5A A;  1ZQ1 C;  4KX3 A;  4ECX A;  4I2D A;  4YG2 A;  4P4M A;  2H3V A;  3UPQ A;  2PFP A;  4AYB F;  5DLG A;  4DCC A;  3QUT A;  4FZL A;  5DGA A;  2JMG A;  3J81 j;  4MF8 A;  1Q3U A;  1QSY A;  3M8R A;  4QZD A;  3IG5 A;  4TUR A;  3M9N B;  2E8N A;  2RQ5 A;  2K89 A;  2ZG6 A;  5AM1 A;  2B6G A;  3WK4 A;  2RDI A;  4YN4 A;  5ALJ A;  2UVW A;  4F50 A;  4ECY A;  4C7Y A;  4GXK A;  4PPX A;  3C29 A;  4F5O A;  4F92 B;  1ZQS A;  5KFN A;  9ICQ A;  1SL0 A;  1D8B A;  9ICK A;  2IOF A;  3OJS A;  5AI4 A;  5EE1 A;  3BJY A;  5F9N A;  3CP8 A;  8ICV A;  3K1Z A;  5KG7 A;  1JMS A;  3KHL A;  2K4H A;  3V7J A;  3KBB A;  2WF9 A;  5KFG A;  3KHH A;  4F2S A;  2W9B A;  3UXO A;  2DF4 B;  1KN5 A;  5ALV A;  4MF2 A;  3WK6 A;  4FBT A;  1NJY A;  1RG6 A;  3MGV A;  7ICN A;  4EZ6 A;  3LDA A;  2MU2 A;  5KAF U;  3PW4 A;  4TUS A;  1V38 A;  3H7I A;  4RUA A;  2ZUD A;  4MEX A;  9ICA A;  3QU5 A;  1X66 A;  1ZQV A;  3RB3 A;  2EAP A;  2N1R A;  1NJX A;  5IIL A;  8ICB A;  5III A;  2KG5 A;  4F4W A;  2W8L A;  3QYP A;  1TAQ A;  1V9P A;  4F72 A;  2HHQ A;  5J0Q A;  4RT3 A;  4YD1 A;  2KTQ A;  1K1S A;  3MGH A;  7ICM A;  2OWO A;  2XCP A;  1ARO P;  2CN1 A;  1X6I A;  2WF7 A;  4A8E A;  5JU5 A;  1U49 A;  4TQR A;  2Y9U A;  1KFD A;  4UAU A;  2ZTD A;  2AQ4 A;  1Z00 B;  1XSL A;  9ICP A;  4TQS A;  4PHD A;  3IN5 A;  3BQ2 A;  1PK3 A;  1IM4 A;  2YB4 A;  3PR4 A;  4Y2J A;  2IHN A;  2Y9T A;  4BJQ A;  3JPT A;  2F1H A;  1S0M A;  3I1Y A;  5J0X A;  5K4L A;  4YXM A;  2KP7 A;  1X40 A;  1BVS A;  4R64 A;  2KVS A;  5HML A;  5AIB A;  4F5P A;  1WG8 A;  1DGS A;  2ZIV A;  8ICC A;  5KG6 A;  4O3S A;  2BPF A;  2HW3 A;  5L9X A;  4K4I A;  1JXL A;  4M6W A;  2RRD A;  2W04 A;  3RR7 A;  4IQW A;  2YN4 A;  2OXO A;  5KG2 A;  5DQI A;  9ICW A;  1K1Q A;  1TAM A;  5TIS U;  4IRK A;  4F5R A;  4ECZ A;  4GC7 A;  4O3M A;  2HMX A;  3U26 A;  5L1K A;  2VAN A;  8ICX A;  2HBK A;  3OGU A;  3HT3 A;  2UVV A;  3AL0 B;  5G5G A;  1L7N A;  7ICT A;  3H0L B;  2KSO A;  5DG9 A;  2IHM A;  1S76 D;  7ICE A;  3SI8 A;  2BCS A;  4DFD A;  5CHG A;  3GV7 B;  3B0X A;  5CJ7 A;  4PJ0 U;  1RDF A;  3ED5 A;  2GLE A;  2ASL A;  4DQQ A;  2H3F A;  1QQ6 A;  5KFM A;  4M9L A;  3WU2 U;  1SZH A;  1O03 A;  3MC1 A;  4O5E A;  2G0A A;  1JN3 A;  3C2L A;  3G6V A;  8ICA A;  3H0M B;  3M6Z A;  1Z1V A;  1SWV A;  5ALD A;  3MBY A;  2YMQ A;  1T7P A;  1ED1 A;  3GIK A;  3WK9 A;  2ZUB A;  4RQ7 A;  1SKR A;  5H2F U;  3T3F A;  1ZQN A;  4R63 A;  9ICN A;  1YT3 A;  2JH7 A;  3EZ5 A;  2E1F A;  1S0V A;  2KIV A;  2XY7 A;  3THV A;  4EX7 A;  3QNM A;  3O0F A;  3OHA A;  4F4X A;  2QLT A;  3AQE A;  4QW9 A;  4TUQ A;  3RJI A;  1ZRN A;  2ATL A;  1UT5 A;  1JAL A;  4YFK A;  4E0D A;  3Q8S B;  4I2B A;  2XC9 A;  3RAQ A;  4Y2U A;  1VJ5 A;  4IR9 A;  4RQ0 A;  2XGQ A;  5KFY A;  1C7Y A;  4ECV A;  2RHF A;  2QB0 B;  1ZQD A;  2FPL A;  3ZDB A;  5KFR A;  4YCX A;  2WB1 F;  4EZ9 A;  2J6S A;  3FDS A;  4DS5 A;  4XA5 A;  3C5G A;  2I9G A;  5AKK A;  1WWV A;  1ZQT A;  2V4Q A;  4Y2X A;  3K4G A;  2XIC A;  2D6F C;  2L5Y A;  4UB1 A;  3RRG A;  8ICM A;  4IRD A;  1Z19 A;  2G07 A;  2JXJ A;  4P0P B;  7ICF A;  4F71 A;  2F8L A;  5KT6 A;  5J2D A;  4QZI A;  3QU2 A;  2Y1I A;  3CYM A;  2B0C A;  9ICE A;  4DF4 A;  4CE6 A;  1V97 A;  2WFA A;  3EUB 2;  4JK1 A;  5J0U A;  2KEY A;  4PL1 A;  4RNN A;  5KG5 A;  3GDX A;  4RQ8 A;  2WF5 A;  2AQ0 A;  1DK2 A;  2JGA A;  5ALE A;  4I2C A;  1Y88 A;  2JZB A;  2KHQ A;  1X9W A;  4DSK A;  4JV1 A;  3JPN A;  5DB6 A;  1F44 A;  2BQR A;  1M6Y A;  4UW9 A;  3ZDE A;  3RBD A;  4M9J A;  1PUZ A;  1OXJ A;  4B9T A;  4M9H A;  4USA A;  4LZG A;  2WF8 A;  3RH4 A;  1XU4 A;  4ECS A;  1T3N A;  4RQN A;  4QWB A;  3SYZ A;  2EAN A;  3H40 A;  4DQS A;  1S9F A;  3IHQ B;  4FE3 A;  2D8C A;  5AIC A;  4RPY A;  1KDH A;  4KLL A;  3AMZ A;  1TK8 A;  4C4T A;  1Z4N A;  2WAQ F;  4F2R A;  1A6S A;  3HX0 A;  4QNL A;  3IM1 A;  4RZR A;  3JPR A;  2HDO A;  5AI9 A;  4K4G A;  4J9Q A;  1RYR A;  3FM9 A;  4JB3 A;  2YMM A;  1BPX A;  1VDV A;  4ELV A;  2ZTC A;  4UAW A;  5G5H A;  1ZJN A;  2BCV A;  4RQ2 A;  1L8L A;  2K8A A;  1L7P A;  3MFH A;  3MGI A;  4O5K A;  1QCK A;  4IQV A;  4M6W B;  1SGG A;  2ZJ8 A;  4UAZ A;  2AHO B;  3RB4 A;  3IG8 A;  4UB5 A;  4PHP A;  2DL0 A;  3RBE A;  7ICQ A;  4C80 A;  2W55 A;  1Z00 A;  3RB0 A;  3PVX A;  4MEY A;  2BCU A;  4YXJ A;  2KZ3 A;  2KNJ A;  4YP3 A;  1UHU A;  4J9S A;  5IIJ A;  2E8O A;  3WKB A;  3S6J A;  3V6J A;  3UXP A;  1HUO A;  3TAP A;  3N97 B;  1UA0 A;  4NM2 A;  3UM9 A;  1TV9 A;  2NRW A;  5CR0 A;  3MR5 A;  2MAX A;  5L1M A;  7ICI A;  2ZIU B;  3GII A;  4EEN A;  3TFR A;  3E58 A;  3MR6 A;  4FBU A;  2UVR A;  1YZ6 A;  9ICL A;  4ED7 A;  2Y0S F;  2DGZ A;  2Y0S C;  3HIL A;  4DL4 A;  4Y2P A;  2KOB A;  3DEE A;  3HKZ F;  4QZF A;  4F5Q A;  1ZD5 A;  3RJK A;  2A1J B;  2EDU A;  2V9W A;  4YD2 A;  4QZH A;  2ZJ5 A;  5ALP A;  2M0N A;  3C2K A;  4QZA A;  5KT5 A;  3UQ0 A;  4JWN A;  4ED8 A;  3CRX A;  2FI1 A;  4BDP A;  3N7P D;  2ISO A;  1WWU A;  4Z6D A;  4EEY A;  4RQM A;  3QXG A;  2LPE A;  2F77 X;  2NO4 A;  4ED6 A;  1HEK A;  4I2E A;  4BXO B;  4ED0 A;  3WKC A;  2VIX A;  3MAB A;  4P4P A;  3I76 A;  4QZ8 A;  2FE9 A;  2XID A;  3PZP A;  2I6X A;  2F8K A;  2LM4 A;  2OM6 A;  4DSL A;  2IOF K;  2W9C B;  1X42 A;  2W9M A;  5KT2 A;  1FO4 A;  4HAI A;  2R8G A;  3RFA A;  1A77 A;  3BQ7 A;  2DPI A;  3L3F X;  1XO1 A;  4DWI A;  1ECW A;  4OCZ A;  3EWA A;  3ORY A;  4J03 A;  2KD1 A;  1LB2 B;  1ZQX A;  2MA1 A;  4C4R A;  8ICE A;  1ZQH A;  5AK6 A;  5AI6 A;  4B9L A;  4AYB C;  3SV3 A;  3C5F A;  1JIH A;  4IQT A;  4YMO A;  1IXR A;  4EX6 A;  4EBC A;  2P6R A;  5AI8 A;  5ALL A;  4ECQ A;  3OHB A;  3BQ0 A;  3LWM A;  5KFL A;  4UAV A;  3OJU A;  1Q46 A;  4IQU A;  5KFF A;  3KZI U;  2YX8 A;  5HHH A;  2C2E A;  7ICG A;  3SEN A;  4PZN A;  3EW9 A;  1NK5 A;  4F4K A;  4O3Q A;  2JZB B;  2HHS A;  2QB0 A;  5B66 U;  3AN1 A;  4KTQ A;  4ECT A;  4NLZ A;  5KG1 A;  1NKB A;  4F5N A;  3K1R B;  4CGZ A;  4KN7 A;  5T14 A;  5KL1 B;  4DQI A;  2HSZ A;  2K4P A;  4P0P A;  4QZC A;  2DBY A;  1PZN A;  4P0Q B;  2A1A A;  5KAI U;  1QSS A;  1IV8 A;  5AM2 A;  1ZQU A;  4QZB A;  3B0Y A;  4GIB A;  4ECR A;  4KMO B;  5AM5 A;  4CNQ A;  1ZD3 A;  4B6J A;  4LZD A;  5F3X B;  8ICQ A;  2AJQ A;  2IBK A;  1KEJ A;  3H8M A;  5KFK A;  4YR3 A;  3BS5 B;  3SV4 A;  1GO3 F;  2XY5 A;  1BPZ A;  5J2K A;  4C8L A;  4RQ1 A;  2VA3 A;  5J0T A;  4B9M A;  1L3S A;  3QUC A;  2PMZ F;  3MFI A;  1KFT A;  4DL5 A;  4KMU A;  1MSW D;  4YMM A;  2VKQ A;  3H0R B;  4Y2Y A;  1S0N A;  2WTF A;  2DKZ A;  1FFU A;  3JPO A;  3G6Y A;  1D9D A;  2CPR A;  4BX9 C;  1ZQW A;  4OD0 A;  4I2G A;  4IS7 A;  5DDM A;  4I2I A;  4JMU A;  5DBB A;  3AEV A;  3V6H A;  4NJ8 A;  2NV3 A;  2KIC A;  3NRZ A;  2ODG A;  2RP5 A;  2QB1 A;  3IV6 A;  3NVZ A;  5BOL A;  3PW2 A;  3PX4 A;  2AGP A;  5BPC A;  4NM1 A;  8ICL A;  2ZIW B;  2LHT A;  2F3N A;  3C1Y A;  2HHV A;  1ZQZ A;  1TFR A;  5IIK A;  3KFU F;  2BCQ A;  5KG4 A;  2HOI A;  4IRC A;  1UQV A;  4NV0 A;  1SKS A;  4BWJ A;  3SAG A;  3CNH A;  4I2A A;  2E8M A;  4M04 A;  5IIM A;  2CXY A;  3PSI A;  2KVC A;  2XY6 A;  2GOL A;  3N4M B;  4B9U A;  3BZK A;  3QX7 A;  3GZF A;  2DFL A;  5L1J A;  1KTQ A;  3GQC A;  3KTQ A;  1ZD2 P;  2DWQ A;  2G06 A;  2NRX A;  3D2N A;  7ICV A;  4RQ6 A;  4DL2 A;  2VA2 A;  1Z3E B;  4DSJ A;  5D46 A;  2AU0 A;  3QZ7 A;  5DGB A;  5DLF A;  4O0I A;  3PMN A;  4YQW A;  1SV0 A;  1UA1 A;  5HHI A;  1IIP A;  3E2E A;  2F44 A;  2KJ8 A;  5J2J A;  2YY6 A;  5CP2 A;  1XSP A;  4U7C A;  4US8 A;  1CRX A;  1D9F A;  3KHR A;  3IP4 B;  4UB8 U;  4J9K A;  1B43 A;  9ICX A;  4UAT A;  3KKA C;  3TFS A;  2IMW P;  3NRW A;  8ICN A;  2ES6 A;  2FLP A;  2A19 A;  2WHE A;  1RM6 C;  4Y2V A;  3MDA A;  1F0M A;  4IC9 A;  3LWL A;  4EBE A;  1D8Y A;  2AGQ A;  1J97 A;  4UBC A;  3AU6 A;  4M9N A;  2LYA A;  4ICA A;  4B9S A;  7ICK A;  7ICH A;  2ZIU A;  1CEZ A;  2R8K A;  1EXN A;  2LYB A;  2JEG A;  2KKP A;  1ZQO A;  4KIT B;  1KKX A;  5KFQ A;  1XSN A;  2H5X A;  3FYH A;  4O5C A;  2YTU A;  3RH6 A;  1X9X A;  3BDP A;  4DQR A;  2BDU A;  5AIA A;  5A0L A;  1ZRM A;  2A1J A;  3KZX A;  2ASD A;  1S0O A;  4DQP A;  2W8K A;  3UQ2 A;  3T5L A;  4I2J A;  3TAN A;  5AM0 A;  4GXJ A;  2FJ6 A;  5KT3 A;  1JX4 A;  4KLJ A;  4DLG A;  3TQ1 A;  2W54 A;  3BQT A;  5EWG A;  1ZOL A;  2AGO A;  8ICS A;  4BXO A;  2XI9 A;  3LK9 A;  5KFH A;  1J2N A;  3PR5 B;  8ICT A;  5AI0 A;  3ZD9 A;  2LM1 A;  3D2Q A;  5ALI A;  1SV0 C;  1SWW A;  2IOH A; 
#chains in the Genus database with same CATH homology
 5KAI U;  5KAF U;  2DUY A;  3WU2 U;  5GTH U;  4UB6 U;  5GTI U;  5TIS U;  3KZI U;  3A0B U;  4PJ0 U;  5B5E U;  1S5L U;  2AXT U;  3A0H U;  5B66 U;  5E79 U;  5H2F U;  4IL6 U;  4UB8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...