5GTIU

Native xfel structure of photosystem ii (two flash dataset)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II D1 protein
total genus 30
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5gtiU01
2DUYA 5E79U 5GTHU 4IL6U 5B66U 1S5LU 3WU2U 2AXTU 5H2FU 5B5EU 5KAFU 4UB6U 5TISU 3KZIU 3A0BU 3A0HU 5KAIU 4UB8U 4PJ0U 5GTIU
chains in the Genus database with same CATH superfamily
2BQUA 5EWGA 5H2FU 2H3VA 4NY8A 2HVIA 1FEZA 3ETLA 5KFJA 4U7CA 3G6VA 2RLTA 7ICNA 2VANA 2YMLA 1JXEA 2J6SA 3ZDAA 1S77D 2Q4TA 2RHFA 1ZQVA 5AK6A 2W7OA 4BGDA 1L5UA 4YFKA 2VA8A 3LVWA 4ECVA 1BPZA 3WKEA 3AM9A 2Y1JA 3L4PA 1JIHA 1K1SA 3SQIA 1A77A 7ICOA 1RYRA 3PMLA 3WKDA 4QZEA 4NLBA 3F5AA 1ZJNA 4BUGA 3T79A 2YB4A 1MN8A 2BQ3A 3B0XA 4DQRA 4C80A 4ED1A 3PV8A 3QUTA 3TACB 4FS1A 2MAXA 1JI7A 5ALSA 4JK1A 2R8KA 4F5RA 2KKVA 3PW0A 2QB0B 1X42A 3AEVA 1RQNA 1SXDA 4QWEA 5ALHA 5AK3A 3C5GA 1U45A 4CF4A 5KFIA 5J2DA 3AMZA 4RPXA 3HW8A 4XRHA 2F2AB 1T94A 4NJ8A 4QZGA 4DOAA 5AIAA 3RAQA 5L1IA 4ED2A 3QUBA 4PHDA 3PSIA 4DQSA 1BPDA 4J9MA 3ZDDA 3M1YA 2OCEA 1SV0C 4ECTA 4YXJA 1RPLA 1T4GA 2PMZF 3Q8KA 3UMBA 2EZZA 3RJGA 5L1KA 8ICTA 2AGPA 3CRXA 2KN7A 1BPEA 4FBTA 2E1FA 1PK1A 3RF9A 5ALTA 4ECSA 1XSLA 3QE9Y 2WF8A 9ICLA 4Y2JA 3SZ2A 4B6JA 4C8KA 1N63A 5KG4A 2E8MA 4IRDA 1J97A 4LVSA 1AROP 4FFDA 5AM0A 2HHTA 5AKXA 4PGQA 1T3NA 3IG8A 4EYHB 4F5OA 1S9FA 2OYYA 3WU2U 4EBEA 1KFDA 3BZKA 4NL9A 1L7OA 1NZBA 5KT2A 2EH9A 1S8OA 3QNMA 1RXWA 1MC8A 3KHHA 1NNLA 5T14A 3IDWA 2F8KA 5J0TA 5KT7A 1BNPA 5KFLA 5CWRA 1QCKA 2YMQA 3E0FA 2BZFA 2ZJ5A 4CF5A 4RQ3A 2Y1IA 3MGVA 4UARA 2LYHA 2JH1A 4USAA 1SWWA 3Q8LA 3NS1A 2AJQA 9ICEA 4QW8A 2V4QA 3PX4A 2PFOA 2AU0A 3BQTA 2R18A 3FYHA 9ICHA 3C1YA 2C2RA 7ICFA 2GOLA 3F2CA 1N5XA 1XS9D 4P2HA 4RQ6A 4BJQA 4O3OA 3CW2C 1ZQBA 4QZDA 4NLKA 1SL2A 4DLGA 4I2HA 3IP4B 2VJ5A 2F1IA 3A0BU 2WF6A 4B9UA 5DLGA 4K4HA 3M8SA 4UB5A 5DQGA 1N60A 1N5WA 3QU7A 2G5IB 4Z6DA 3SV3A 7ICLA 5AI8A 2FJ6A 4I2BA 2MSNA 4M47A 5AK5A 4MFFA 3MGHA 5KFKA 4QNLA 5ALGA 2YQEA 4LZDA 4MFAA 5DB9A 2ZG6A 1ZQOA 2G5HB 4IQTA 2FMQA 4J03A 4KN4A 2D6FC 5JUMA 5KL8B 2KJ5A 5AKEA 5J0PA 3H8MA 4IC9A 3LWMA 2KD1A 4O5KA 3D6JA 9ICIA 2JR5A 3WKAA 4CE6A 7ICRA 5KFUA 4J9LA 3TARA 2DPIA 4J9SA 2HHSA 4JB3A 4Y2PA 2W7PA 4XQ8A 3K1ZA 1XO1A 1H38A 4DOBA 2RDJA 3THVA 2BDPA 5G5GA 3MFIA 2G07A 5KG7A 2G09A 3PSPA 3SR6A 1PVQA 4DQIA 5AM5A 1ZRNA 2K8CB 2Y0SF 1NJYA 3FM9A 3PX0A 3K75D 1X66A 2A1JA 4ECRA 5DBBA 7ICPA 1N2XA 4DF8A 4BDPA 4O3SA 9ICTA 4GXIA 1BVSA 5CR0A 3GZFA 2K4IA 3GIMA 3ZDCA 8ICNA 2KZ3A 4IL6U 3BQ1A 1Z19A 5IINA 3RBDA 4DWIA 5J2GA 3QU2A 2YY6A 1GO3F 2O6KA 3RB6A 2ASJA 3Q8MA 4G3IA 4J9NA 2K89A 4QJFB 3OJSA 1CRXA 4DQQA 2E8OA 1A6SA 5DBAA 4RQ0A 1KN5A 8ICWA 4EEKA 1JALA 4MHVA 4KLUA 2KEYA 2NO4A 4ACOA 4I2GA 2ZIUB 3PR5B 4DEZA 5C5JA 3EUB2 5J2BA 4JWMA 3Q8RB 3TI0A 3TADC 3F53A 2IOHA 3N4MB 3GIJA 4FZMA 4F93B 3RBEA 2E8PA 2JHDA 4YR0A 2KZZA 1PVPA 1D8BA 1B43A 1ZQNA 5AKKA 3GIIA 3TAPA 2K60A 1ZQAA 4O3RA 2JZBA 3LYSA 4UB2A 4RUAA 2DWQA 4KMUA 1Q8KA 1K5OA 1ECWA 5EE0A 3OHBA 4UAUA 5TISU 2F3NA 4F2RA 4M6WA 4M9HA 5D46A 4F71A 3RB0A 2ZXIA 4TUSA 2NV3A 4F3OA 3F2BA 1ZQHA 5KFCA 1QSYA 4PH5A 2VIXA 5J2EA 2ZIXB 1ZQ1C 1X9MA 4XUSA 2FPLA 2CXYA 4C0ZA 2ASDA 4EEYA 1NK4A 2LYAA 5HHIA 3KD3A 3HWTA 4IRCA 1OW5A 3AN1A 2V4RA 4HYKA 8ICBA 1TK8A 1DXSA 4P0QA 4Z6EA 5J2JA 3QU4A 3SV4A 3C1ZA 4P4MA 1KBUA 4C4TA 2L5YA 4IQUA 2JGAA 9ICFA 4ECWA 4NV0A 1F5SA 1VLBA 2F77X 4UAVA 5FP0A 3KHLA 1BPYA 2K4HA 4J9PA 4YQWA 1L7NA 2RP5A 4GC7A 2EZXA 3A0HU 3TADA 3PW4A 4MEXA 1D9FA 2YMPA 5ALVA 2M9NA 3IV6A 2PI5A 1U9LA 2MUTB 3PR4A 4JV0A 2W8LA 2I1QA 4F50A 4MEYA 3G6XA 2XICA 3N97B 7ICQA 1Z00B 3AQEA 2XO7A 4C4RA 3JPOA 1NKEA 4KLHA 4ECQA 5DDMA 4R63A 2KE7A 3CNHA 5ALOA 4Y2SA 5DQHA 4C7ZA 3GQCA 4X5VA 8ICCA 1SV0A 8ICSA 5DB7A 2FMSA 8ICHA 3SEIA 1DGJA 2B0CA 2UVVA 5ALJA 2AGOA 1NJWA 2K8BB 5HMMA 2ESEA 5L1MA 3QZ8A 2Y0SC 4DS4A 4DSJA 4FZNA 1NJXA 1ZQDA 2IOFK 3GIKA 3C21A 2RRDA 2ZIWB 3OHAA 1WWUA 1NKCA 8ICXA 4AYBF 1L3SA 5AKYA 5IIKA 4KN7A 3RR8A 5ALDA 2HBMA 5J2AA 1X6JA 2JRZA 2BCSA 4HAIA 2LMRA 5HHHA 3Q8QB 4RQ8A 1UT5A 1KW4A 3C28A 3SAHA 5KFZA 1QSLA 3UQ0A 2HHUA 2EAPA 2VA2A 3V7JA 5J8YC 2BKEA 1MSWD 5K4LA 3H4DA 3L3FX 2HBKA 3TFSA 1BPBA 2IMWP 3RRHA 4O0IA 5AKLA 4E0DA 4DL3A 1QSSA 4RT2A 3V6HA 4UQGA 2UVUA 1QQ6A 3BS5A 2C22A 4UAYA 2CPRA 4PL2A 3PSFA 1S97A 5CP2A 2H3ZA 1ZQXA 5GTIU 3O0FA 2WF5A 1SGGA 5KT5A 8ICMA 2AQ0A 2KV2A 3NVZA 2PFPA 2OEHA 3PW5A 4F4KA 5HNKA 1BGXT 7ICSA 3SD7A 3M9OB 1U4BA 2YMMA 3EPIA 2FLNA 2KVSA 1DOQA 2ES6A 1Z1BA 4NLCA 5JU5A 1B22A 1UA0A 2LKYA 3GV8B 4Y2QA 2BPFA 2EDUA 1FIQA 2DQNB 1KQQA 8ICAA 2RQ5A 9ICPA 2WF9A 4KX3A 5ALIA 4UB8U 2YN4A 4DSIA 5EE9A 4YVZA 5EOZA 5CJ7A 4IR9A 4RQMA 4NLNA 4IQWA 2ASLA 2HBJA 4LZGA 4C8NA 1X6IA 1S5LU 2FMPA 2AH5A 1Q3VA 1IV8A 3UMCA 7ICVA 4BXOB 3KKAA 1RZTA 3OSPA 4IRKA 3KZXA 1K1QA 5EE1A 9ICCA 2NRWA 2HCFA 5AKIA 4Q44A 4MF8A 1QQ5A 5J8YA 2HHQA 3D2NA 5CHGA 3NVYA 1MQ2A 2YTUA 2GH1A 4QZHA 4ZOHC 3V7KA 2F1JA 1JROA 4TQRA 9ICMA 4GC6A 1ZQFA 3ONNA 5ALXA 1KFSA 4O9MA 4KLLA 8ICQA 2PMZC 9ICVA 3D2QA 1HUOA 3C2LA 3HKZC 5DG9A 4I2AA 4JV1A 3Q8SB 5KFPA 5J2HA 3PW7A 1KEJA 4CRXA 4OJ5A 4P0PB 4I2IA 1OUQA 2CN1A 3C23A 4I28A 1SIJA 2ZIVA 4EBCA 1SXEA 9ICRA 2KIWA 3H4BA 4ZH4A 5BPCA 5J0RA 2WAQC 3OSNA 3N7SC 1NK8A 4F5QA 5JTIA 3NTUA 2GWSA 2XGQA 5IIIA 2NRXA 3NRWA 4O3PA 4R8UA 3H7IA 3ZDBA 2KJ9A 2JXJA 4KLEA 4JMUA 1CI4A 2W55A 3WK5A 4Y2RA 3WKBA 3QEAZ 4DSKA 1T3QA 2H3QA 5KFTA 5KT4A 3D2SA 3B9JA 2W11A 4EENA 3JPSA 4EELA 1JUDA 3PY8A 1TE2A 5KFMA 1ZD5A 3KHRA 2AQ4A 2NRVA 2LM4A 1SZPA 2FLLA 4F4XA 5A0LA 4US8A 5L1LA 1ZQGA 3I28A 5ALFA 5ALRA 5ALZA 2HOFA 2H3IA 3E58A 3QZ7A 2EQYA 3RR7A 4R66A 4DOCA 3I1YA 3UXPA 4NM1A 1NK9A 2FE9A 2WB1C 4QZBA 3C2MA 4KTQA 2HHWA 3JPRA 4QWAA 2LYBA 4Z6FA 5IIOA 3QU9A 2A1AA 4EBDA 4PHEA 2Y9UA 4KLDA 3LVVA 2YB1A 1ZD4A 4MFCA 5J0XA 5G5HA 3WK7A 1LKYA 3KBBA 2IHNA 4GIBA 3JPQA 1SV4A 2W9BB 3HX0A 2OWOA 8ICUA 1URJA 2PFQA 5AI6A 5HMLA 4A8EA 2W8KA 3BQ2A 2KSOB 2VA3A 4EX7A 3H0RB 1C7YA 1Z4OA 3R9KA 5KG5A 3ALRA 7ICGA 4YG2A 4ELTA 4UB1A 2R8IA 3RFAA 3BJYA 1RQLA 4P4OA 3MR6A 2PKEA 1KRPA 3RJJA 2K4EA 2W9MA 2WAQF 2K4PA 4TUPA 4OD0A 4YMNA 2E1EA 3U26A 1J2NA 1V97A 2KHQA 2EAOA 1T7PA 2MU2A 7ICJA 1TVAA 2G0AA 5AI4A 3NRZA 3T5LA 3HKZF 3V6KA 4O5EA 2HW3A 4UAWA 2PFNA 3RJIA 4K4GA 1F0MA 4O5CA 4F92B 4XA5A 3PX6A 5KAIU 4DL4A 3RAXA 1RYSA 2DUYA 3NVVA 4I27A 1XNSA 4DFPA 4QIWF 3OTQA 4M9GA 5ALMA 2C2DA 3KFUF 4ECXA 4IR1A 4DL7A 4YMOA 3T5HA 1Z4NA 4DS5A 1KTQA 1NK0A 5KT6A 4QZFA 4PGXA 4GXKA 2OM6A 1DK2A 4DL2A 5KG2A 4KX5A 3S6JA 4YR3A 1MA7A 5ALQA 1ZQKA 2LM1A 1ZQLA 4G9BA 3CYMA 2KVCA 2KICA 4Y2VA 4O3NA 3KZIU 3BQ7A 2D3DA 1HJPA 3RJKA 3H8WA 2FLPA 1UPHA 2BDUA 4JV2A 3PZPA 2W03A 1X9WA 3H0MB 3QUQA 8ICGA 4EZ6A 1N56A 2W9CA 3UXNA 1S0OA 5DGAA 7ICHA 1SB3C 5E79U 1L3UA 4NL9C 5ALUA 5AICA 5AIBA 5DB8A 3JPNA 2BCUA 3F5EA 5J2IA 4YN4A 2KMDA 2QARB 4I2JA 2G06A 9ICQA 5KFQA 3SMVA 3HT3A 1ZQWA 4CDGA 3JPPA 2AGQA 4PJ0U 4RQNA 3NVWA 1J2MA 8ICKA 1NK5A 3CP8A 2NO5A 2W54A 1LVHA 1RG6A 3H0LB 2ALZA 2JH7A 2M0NA 2NYVA 2VJ4A 5AKHA 3VC8A 4C4SA 2XGPA 2MA1A 2Y9TA 4RQ5A 1UHUA 4BX9C 2JMGA 5KFGA 3WKCA 1A0PA 2LPEA 4ECYA 4I2EA 1B4FA 3IRUA 1Q46A 4I2CA 2E5SA 3AU2A 2PI4A 3MBYA 5CA7A 1NOMA 2P6UA 4B9MA 3UM9A 9ICWA 2KHVA 4J9OA 2UVRA 2MRLA 2KFZA 4UB3A 3RJEA 2ZTEA 2QB1A 3QX7A 3DDHA 5KFDA 3BZCA 2V9WA 2EAMA 4UATA 2KK0A 4DFMA 2RDIA 2H5XA 5J2KA 4K4IA 3LWLA 1YZ6A 2XIDA 4F4ZA 1SZHA 3AU6A 1IXRA 1ZD2P 1BNOA 2W3SA 4IQVA 3PO4A 3BQ0A 3T5JA 2BQRA 3H8SA 4DSLA 3ISCA 2B21A 8ICPA 1WCLA 2QB0A 1UA1A 2F44A 4RNNA 5KL1B 1AQ6A 3ZD8A 2KJ8A 2ZXHA 1SKSA 4ICAA 2C2EA 3RTVA 1UT8A 2J6UA 4O3QA 1CUKA 5IILA 2D8CA 5ALYA 5HP4A 3WK9A 4B9TA 4RU9A 1D9DA 2LI6A 3KTQA 8ICOA 2NRZA 3H40A 1QQ7A 3EW9A 1Y88A 4BWMA 2LBOA 1S0NA 1TKDA 2R8GA 4J9KA 2IOFA 4KLQA 1PK1B 5KFHA 1X2IA 2KTQA 3M6ZA 9ICGA 2HHVA 4KLOA 4FBUA 3ISBA 3NGDA 2W43A 2XY5A 4ED8A 4UBCA 1JXLA 4QWCA 1V85A 4B9SA 2WFAA 5DLFA 4OJOA 5ALLA 5DQIA 1TV9A 5AK4A 3ZD9A 4Z6CA 4C8OA 1KL9A 2OH2A 4TQSA 5KT3A 3K4GA 3EPGA 2J6TA 3E2EA 4RPZA 1VDVA 2XY6A 4J9QA 1Z3EB 4OJPA 3HP6A 4DSFA 3HRDD 4M9JA 4QW9A 5KNIA 3OPXA 1IG6A 7ICUA 5J2FA 3TQ1A 4PPXA 4Q45A 2A19A 3GV5B 2K8AA 2DBYA 3M6KA 1CEZA 4QZ8A 2HI0A 2QKQA 3MR5A 8ICIA 1L3VA 3OGUA 3L5KA 2XCPA 2DKXA 5DKWA 4EYIB 5KFAA 7ICEA 5BOLA 2ZJ8A 4QWBA 1S10A 4RZRA 3HJEA 3PSTA 5IIMA 1ZQYA 4GFJA 1DRGA 5GTHU 1UCVA 1QH9A 1SL0A 5CB1A 3N7RC 3NUQA 2JZBB 1L6NA 1WG8A 3RH6A 5BOMA 2DL0A 1NZPA 5J0SA 4KLMA 4FZLA 4Y2YA 5JRTA 3FAHA 4M6WB 4CNQA 1SL1A 3SAFA 1YT3A 1FFUA 4Y2UA 4FE3A 5HR7A 1IIPA 1L7PA 5KG1A 5C0YA 1KFTA 2ZIXA 4QZ9A 2KIVA 3KHGA 3EYZA 4PHPA 3MDAA 1ZQUA 4QZCA 1HUZA 4FS2A 2KOBA 1XWLA 3MDCA 4EX6A 9ICOA 1N48A 5KFSA 1TK0A 5EE3A 1ZJMA 3NASA 5TZVA 2E8NA 4YD1A 4R65A 3I76A 2HDOA 1YZ7A 4NLGA 7ICIA 3PVXA 2WHEA 1XU4A 8ICRA 3SENA 5B66U 4I2DA 2HMXA 4QZAA 4CCHA 2XVTA 4QWDA 3K1RB 1U49A 2ISPA 5KTQA 2W04A 4UW9A 2A1JB 3N7PD 2OXOA 3C29A 4DCCA 2KZMA 5KG3A 3ZI4A 4CF3A 2BPGA 8ICYA 3EZ5A 2P66A 3F2DA 4TUQA 4OCZA 7ICKA 2KKPA 2KG5A 5L9XA 5J2CA 2MUTA 4KLIA 1ZQSA 4ED7A 4F8RA 4F5PA 4PL1A 4KLFA 5J0OA 5ALPA 8ICVA 4CGZA 2FPMA 1Z00A 5CRXA 4KITB 5KFVA 4QZIA 1JRPA 5DG8A 5AM4A 4DFKA 4O3MA 3AL0B 1ZRMA 4UB4A 2DF4B 3Q8PB 1ZXIA 3QEBZ 4IS7A 3M7DA 2EANA 1L7MA 5AKZA 1MQ3A 1ZQQA 2ZIUA 1ZQTA 3T5KA 2I6XA 2DFLA 2JEGA 1QLNA 2F76X 2JEFA 9ICAA 4C8LA 4RPYA 1ZQPA 2CRXA 5D4BA 3PMNA 2ZUDA 4RQ1A 5F9LA 5AI9A 2ISOA 2GLEA 2BHNA 1TAQA 1PVRA 2ZIWA 8ICZA 3V7LA 3AUOA 5AHXA 1TAMA 5AM3A 3BDPA 1PK3A 4R64A 1OXJA 1RDFA 4KMOB 2VKQA 3HPOA 4Q43A 5J0QA 1S0MA 5J29A 4YP3A 5ALNA 2P35A 4DFJA 4M9NA 5L1JA 2WB1F 4QIWC 4AP9A 3TKAA 3C5FA 1ZQRA 3M9NB 4F4YA 3B0YA 2JEIA 1P7DA 5AM2A 1NK7A 1B0XA 1L3TA 4DLEA 5KFFA 4NXZA 8ICEA 1SKRA 1N62A 4J9RA 1D8LA 4PGYA 4ED3A 1ZETA 2ZUCA 1N61A 4Y2XA 1NK6A 3ICXA 3JPTA 3M9MB 1WYGA 3ETRA 2EZYA 2KFNA 3RJFA 5DBCA 1HIWA 3RH5A 4YD2A 1DK3A 1BPXA 4P0QB 2YX8A 3DV9A 2WTFA 9ICUA 4F91B 4F2SA 4I2FA 3RB4A 5KG0A 5AKGA 2DPJA 1COKA 5KFOA 2ZTCA 3KOOA 2A3VA 2AXTU 5HR6A 1EXNA 4RQ2A 1KDHA 5F3XB 3ZDEA 4AYBC 3IN5A 3RRGA 9ICKA 3GDXA 5KFEA 1HEKA 2HOIA 3C2KA 1WUDA 3TFRA 2OHFA 1ZQIA 5KFRA 4F72A 2XC9A 7ICMA 2XY7A 3GU3A 1S0VA 9ICBA 5CEHA 3WK6A 2FPKA 8ICFA 1T8EA 1KSPA 2JV3A 4FO6A 8ICLA 5KFWA 2LHTA 5AKJA 1ZOLA 4MF2A 4NLZA 4BXOA 4B9NA 1M6YA 5DGBA 1X40A 2XCAA 1ZQEA 4I29A 3SAGA 3IM1A 1COOA 3LK9A 2KNJA 3J81j 3RB3A 8ICJA 5ALKA 2R8JA 1FO4A 2KP7A 3AQFA 1RYUA 2ZTDA 2C28A 5J0WA 1D8YA 1JMSA 4P0PA 3VCBA 2ZJAA 3GV7B 4RNMA 3ISDA 2ZIVB 4KLSA 1NKBA 1SKWA 5AM1A 3ORYA 2DKZA 4U6PA 4YR2A 4NWIA 2F8LA 4JUZA 1XC9A 1O08A 2IA6A 3GFKB 1ZQCA 2BGWA 4PHAA 2GO7A 3V6JA 3UQ2A 3BS5B 4US9A 3PNCA 3T3FA 5EWFA 4UASA 4GXJA 1L8LA 2E3TA 3IHQB 4RQ4A 4JWNA 2HHXA 4LJXA 4DO9A 2BCVA 4ED0A 4EZ9A 5DG7A 4UBBA 4M0AA 1WCNA 2FDRA 1L8OA 1DGSA 3FC4A 1LV5A 1PUZA 1JX4A 2HVHA 3RJHA 1ZQJA 4DFDA 2ODGA 5ALEA 5KFXA 3MFHA 4DQPA 4P4PA 2AHOB 1PZNA 1RXVA 2I9GA 1O03A 3BS7A 3OJUA 3PO5A 4RNOA 4BWJA 2B6GA 3TAQA 5DB6A 4YCXA 4WJ3B 5AI5A 2H3FA 2R8HA 3IG5A 2FI1A 5EWEA 4F5NA 4ELVA 4Q8EA 4ECZA 1RM6C 2PXIA 3QU5A 4M9LA 3EWAA 9ICJA 1LKYB 5J0YA 1V9PA 3MC1A 3UXOA 2P6RA 4NM2A 3M8RA 2W9BA 1IM4A 1JN3A 1Q3UA 2KSOA 2HBLA 2UVWA 3RH4A 4KLTA 1ED1A 5F9NA 1ZQMA 4F4WA 5AI0A 5KFBA 4YMMA 1S76D 1TAUA 1TFRA 1NI3A 1XSPA 3H8JA 1F44A 3HILA 2N1RA 2BCRA 3QXGA 4YXMA 2ATLA 2IHMA 2WF7A 9ICNA 3UPQA 4Y2TA 2I5HA 2BR0A 2DGZA 5B5EU 5KAFU 1ZQZA 1WWVA 1U47A 4RT3A 2ZUBA 1KLNA 4KLJA 1KKXA 3N28A 3KKAC 2Q0ZX 4DL5A 2F1HA 1ZD3A 4ECUA 5IIJA 5D49A 2XI9A 3DEEA 2Z7JA 3UMGA 1V38A 4RQ7A 4C7YA 3QUCA 4GLXA 1NJZA 3G6YA 4OJLA 3WK4A 4RUCA 5ALWA 1U48A 2G08A 2BCQA 4ED6A 3FDSA 4M04A 2W3RA 1VJ5A 5J0UA 1XSNA 5KFNA 1C20A 4R8UB 4C8MA 4DL6A 9ICSA 5KG6A 4KLGA 3TANA 4PZOA 2IBKA 5DDYA 1XO0A 3ED5A 1ZYQA 1UQVA 7ICTA 4DF4A 2JEJA 4M2YA 3SYZA 1X9XA 1A76A 1Z1VA 2QLTA 3MGIA 1X9SA 4DSEA 4UAZA 4B9VA 3GILA 3MABA 3MR3A 2HSZA 2W9AA 5KFYA 4Q8FA 3PW2A 2BPCA 3MR2A 2W9CB 3V72A 4UB6U 1FFVA 4PZNA 2HOQA 4OO1J 3WK8A 3LDAA 1LB2B 4TURA 1TK5A 1QTMA 3SI8A 2NRTA 9ICXA 2QARA 4ELUA 4OJ6A 4B9LA 3QYPA 1SWVA
chains in the Genus database with same CATH topology
2DUYA 5E79U 5GTHU 4IL6U 5B66U 1S5LU 3WU2U 2AXTU 5H2FU 5B5EU 5KAFU 4UB6U 5TISU 3KZIU 3A0BU 3A0HU 5KAIU 4UB8U 4PJ0U 5GTIU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DUY A;  5E79 U;  5GTH U;  4IL6 U;  5B66 U;  1S5L U;  3WU2 U;  2AXT U;  5H2F U;  5B5E U;  5KAF U;  4UB6 U;  5TIS U;  3KZI U;  3A0B U;  3A0H U;  5KAI U;  4UB8 U;  4PJ0 U;  5GTI U; 
#chains in the Genus database with same CATH topology
 2BQU A;  5EWG A;  5H2F U;  2H3V A;  4NY8 A;  2HVI A;  1FEZ A;  3ETL A;  5KFJ A;  4U7C A;  3G6V A;  2RLT A;  7ICN A;  2VAN A;  2YML A;  1JXE A;  2J6S A;  3ZDA A;  1S77 D;  2Q4T A;  2RHF A;  1ZQV A;  5AK6 A;  2W7O A;  4BGD A;  1L5U A;  4YFK A;  2VA8 A;  3LVW A;  4ECV A;  1BPZ A;  3WKE A;  3AM9 A;  2Y1J A;  3L4P A;  1JIH A;  1K1S A;  3SQI A;  1A77 A;  7ICO A;  1RYR A;  3PML A;  3WKD A;  4QZE A;  4NLB A;  3F5A A;  1ZJN A;  4BUG A;  3T79 A;  2YB4 A;  1MN8 A;  2BQ3 A;  3B0X A;  4DQR A;  4C80 A;  4ED1 A;  3PV8 A;  3QUT A;  3TAC B;  4FS1 A;  2MAX A;  1JI7 A;  5ALS A;  4JK1 A;  2R8K A;  4F5R A;  2KKV A;  3PW0 A;  2QB0 B;  1X42 A;  3AEV A;  1RQN A;  1SXD A;  4QWE A;  5ALH A;  5AK3 A;  3C5G A;  1U45 A;  4CF4 A;  5KFI A;  5J2D A;  3AMZ A;  4RPX A;  3HW8 A;  4XRH A;  2F2A B;  1T94 A;  4NJ8 A;  4QZG A;  4DOA A;  5AIA A;  3RAQ A;  5L1I A;  4ED2 A;  3QUB A;  4PHD A;  3PSI A;  4DQS A;  1BPD A;  4J9M A;  3ZDD A;  3M1Y A;  2OCE A;  1SV0 C;  4ECT A;  4YXJ A;  1RPL A;  1T4G A;  2PMZ F;  3Q8K A;  3UMB A;  2EZZ A;  3RJG A;  5L1K A;  8ICT A;  2AGP A;  3CRX A;  2KN7 A;  1BPE A;  4FBT A;  2E1F A;  1PK1 A;  3RF9 A;  5ALT A;  4ECS A;  1XSL A;  3QE9 Y;  2WF8 A;  9ICL A;  4Y2J A;  3SZ2 A;  4B6J A;  4C8K A;  1N63 A;  5KG4 A;  2E8M A;  4IRD A;  1J97 A;  4LVS A;  1ARO P;  4FFD A;  5AM0 A;  2HHT A;  5AKX A;  4PGQ A;  1T3N A;  3IG8 A;  4EYH B;  4F5O A;  1S9F A;  2OYY A;  3WU2 U;  4EBE A;  1KFD A;  3BZK A;  4NL9 A;  1L7O A;  1NZB A;  5KT2 A;  2EH9 A;  1S8O A;  3QNM A;  1RXW A;  1MC8 A;  3KHH A;  1NNL A;  5T14 A;  3IDW A;  2F8K A;  5J0T A;  5KT7 A;  1BNP A;  5KFL A;  5CWR A;  1QCK A;  2YMQ A;  3E0F A;  2BZF A;  2ZJ5 A;  4CF5 A;  4RQ3 A;  2Y1I A;  3MGV A;  4UAR A;  2LYH A;  2JH1 A;  4USA A;  1SWW A;  3Q8L A;  3NS1 A;  2AJQ A;  9ICE A;  4QW8 A;  2V4Q A;  3PX4 A;  2PFO A;  2AU0 A;  3BQT A;  2R18 A;  3FYH A;  9ICH A;  3C1Y A;  2C2R A;  7ICF A;  2GOL A;  3F2C A;  1N5X A;  1XS9 D;  4P2H A;  4RQ6 A;  4BJQ A;  4O3O A;  3CW2 C;  1ZQB A;  4QZD A;  4NLK A;  1SL2 A;  4DLG A;  4I2H A;  3IP4 B;  2VJ5 A;  2F1I A;  3A0B U;  2WF6 A;  4B9U A;  5DLG A;  4K4H A;  3M8S A;  4UB5 A;  5DQG A;  1N60 A;  1N5W A;  3QU7 A;  2G5I B;  4Z6D A;  3SV3 A;  7ICL A;  5AI8 A;  2FJ6 A;  4I2B A;  2MSN A;  4M47 A;  5AK5 A;  4MFF A;  3MGH A;  5KFK A;  4QNL A;  5ALG A;  2YQE A;  4LZD A;  4MFA A;  5DB9 A;  2ZG6 A;  1ZQO A;  2G5H B;  4IQT A;  2FMQ A;  4J03 A;  4KN4 A;  2D6F C;  5JUM A;  5KL8 B;  2KJ5 A;  5AKE A;  5J0P A;  3H8M A;  4IC9 A;  3LWM A;  2KD1 A;  4O5K A;  3D6J A;  9ICI A;  2JR5 A;  3WKA A;  4CE6 A;  7ICR A;  5KFU A;  4J9L A;  3TAR A;  2DPI A;  4J9S A;  2HHS A;  4JB3 A;  4Y2P A;  2W7P A;  4XQ8 A;  3K1Z A;  1XO1 A;  1H38 A;  4DOB A;  2RDJ A;  3THV A;  2BDP A;  5G5G A;  3MFI A;  2G07 A;  5KG7 A;  2G09 A;  3PSP A;  3SR6 A;  1PVQ A;  4DQI A;  5AM5 A;  1ZRN A;  2K8C B;  2Y0S F;  1NJY A;  3FM9 A;  3PX0 A;  3K75 D;  1X66 A;  2A1J A;  4ECR A;  5DBB A;  7ICP A;  1N2X A;  4DF8 A;  4BDP A;  4O3S A;  9ICT A;  4GXI A;  1BVS A;  5CR0 A;  3GZF A;  2K4I A;  3GIM A;  3ZDC A;  8ICN A;  2KZ3 A;  4IL6 U;  3BQ1 A;  1Z19 A;  5IIN A;  3RBD A;  4DWI A;  5J2G A;  3QU2 A;  2YY6 A;  1GO3 F;  2O6K A;  3RB6 A;  2ASJ A;  3Q8M A;  4G3I A;  4J9N A;  2K89 A;  4QJF B;  3OJS A;  1CRX A;  4DQQ A;  2E8O A;  1A6S A;  5DBA A;  4RQ0 A;  1KN5 A;  8ICW A;  4EEK A;  1JAL A;  4MHV A;  4KLU A;  2KEY A;  2NO4 A;  4ACO A;  4I2G A;  2ZIU B;  3PR5 B;  4DEZ A;  5C5J A;  3EUB 2;  5J2B A;  4JWM A;  3Q8R B;  3TI0 A;  3TAD C;  3F53 A;  2IOH A;  3N4M B;  3GIJ A;  4FZM A;  4F93 B;  3RBE A;  2E8P A;  2JHD A;  4YR0 A;  2KZZ A;  1PVP A;  1D8B A;  1B43 A;  1ZQN A;  5AKK A;  3GII A;  3TAP A;  2K60 A;  1ZQA A;  4O3R A;  2JZB A;  3LYS A;  4UB2 A;  4RUA A;  2DWQ A;  4KMU A;  1Q8K A;  1K5O A;  1ECW A;  5EE0 A;  3OHB A;  4UAU A;  5TIS U;  2F3N A;  4F2R A;  4M6W A;  4M9H A;  5D46 A;  4F71 A;  3RB0 A;  2ZXI A;  4TUS A;  2NV3 A;  4F3O A;  3F2B A;  1ZQH A;  5KFC A;  1QSY A;  4PH5 A;  2VIX A;  5J2E A;  2ZIX B;  1ZQ1 C;  1X9M A;  4XUS A;  2FPL A;  2CXY A;  4C0Z A;  2ASD A;  4EEY A;  1NK4 A;  2LYA A;  5HHI A;  3KD3 A;  3HWT A;  4IRC A;  1OW5 A;  3AN1 A;  2V4R A;  4HYK A;  8ICB A;  1TK8 A;  1DXS A;  4P0Q A;  4Z6E A;  5J2J A;  3QU4 A;  3SV4 A;  3C1Z A;  4P4M A;  1KBU A;  4C4T A;  2L5Y A;  4IQU A;  2JGA A;  9ICF A;  4ECW A;  4NV0 A;  1F5S A;  1VLB A;  2F77 X;  4UAV A;  5FP0 A;  3KHL A;  1BPY A;  2K4H A;  4J9P A;  4YQW A;  1L7N A;  2RP5 A;  4GC7 A;  2EZX A;  3A0H U;  3TAD A;  3PW4 A;  4MEX A;  1D9F A;  2YMP A;  5ALV A;  2M9N A;  3IV6 A;  2PI5 A;  1U9L A;  2MUT B;  3PR4 A;  4JV0 A;  2W8L A;  2I1Q A;  4F50 A;  4MEY A;  3G6X A;  2XIC A;  3N97 B;  7ICQ A;  1Z00 B;  3AQE A;  2XO7 A;  4C4R A;  3JPO A;  1NKE A;  4KLH A;  4ECQ A;  5DDM A;  4R63 A;  2KE7 A;  3CNH A;  5ALO A;  4Y2S A;  5DQH A;  4C7Z A;  3GQC A;  4X5V A;  8ICC A;  1SV0 A;  8ICS A;  5DB7 A;  2FMS A;  8ICH A;  3SEI A;  1DGJ A;  2B0C A;  2UVV A;  5ALJ A;  2AGO A;  1NJW A;  2K8B B;  5HMM A;  2ESE A;  5L1M A;  3QZ8 A;  2Y0S C;  4DS4 A;  4DSJ A;  4FZN A;  1NJX A;  1ZQD A;  2IOF K;  3GIK A;  3C21 A;  2RRD A;  2ZIW B;  3OHA A;  1WWU A;  1NKC A;  8ICX A;  4AYB F;  1L3S A;  5AKY A;  5IIK A;  4KN7 A;  3RR8 A;  5ALD A;  2HBM A;  5J2A A;  1X6J A;  2JRZ A;  2BCS A;  4HAI A;  2LMR A;  5HHH A;  3Q8Q B;  4RQ8 A;  1UT5 A;  1KW4 A;  3C28 A;  3SAH A;  5KFZ A;  1QSL A;  3UQ0 A;  2HHU A;  2EAP A;  2VA2 A;  3V7J A;  5J8Y C;  2BKE A;  1MSW D;  5K4L A;  3H4D A;  3L3F X;  2HBK A;  3TFS A;  1BPB A;  2IMW P;  3RRH A;  4O0I A;  5AKL A;  4E0D A;  4DL3 A;  1QSS A;  4RT2 A;  3V6H A;  4UQG A;  2UVU A;  1QQ6 A;  3BS5 A;  2C22 A;  4UAY A;  2CPR A;  4PL2 A;  3PSF A;  1S97 A;  5CP2 A;  2H3Z A;  1ZQX A;  5GTI U;  3O0F A;  2WF5 A;  1SGG A;  5KT5 A;  8ICM A;  2AQ0 A;  2KV2 A;  3NVZ A;  2PFP A;  2OEH A;  3PW5 A;  4F4K A;  5HNK A;  1BGX T;  7ICS A;  3SD7 A;  3M9O B;  1U4B A;  2YMM A;  3EPI A;  2FLN A;  2KVS A;  1DOQ A;  2ES6 A;  1Z1B A;  4NLC A;  5JU5 A;  1B22 A;  1UA0 A;  2LKY A;  3GV8 B;  4Y2Q A;  2BPF A;  2EDU A;  1FIQ A;  2DQN B;  1KQQ A;  8ICA A;  2RQ5 A;  9ICP A;  2WF9 A;  4KX3 A;  5ALI A;  4UB8 U;  2YN4 A;  4DSI A;  5EE9 A;  4YVZ A;  5EOZ A;  5CJ7 A;  4IR9 A;  4RQM A;  4NLN A;  4IQW A;  2ASL A;  2HBJ A;  4LZG A;  4C8N A;  1X6I A;  1S5L U;  2FMP A;  2AH5 A;  1Q3V A;  1IV8 A;  3UMC A;  7ICV A;  4BXO B;  3KKA A;  1RZT A;  3OSP A;  4IRK A;  3KZX A;  1K1Q A;  5EE1 A;  9ICC A;  2NRW A;  2HCF A;  5AKI A;  4Q44 A;  4MF8 A;  1QQ5 A;  5J8Y A;  2HHQ A;  3D2N A;  5CHG A;  3NVY A;  1MQ2 A;  2YTU A;  2GH1 A;  4QZH A;  4ZOH C;  3V7K A;  2F1J A;  1JRO A;  4TQR A;  9ICM A;  4GC6 A;  1ZQF A;  3ONN A;  5ALX A;  1KFS A;  4O9M A;  4KLL A;  8ICQ A;  2PMZ C;  9ICV A;  3D2Q A;  1HUO A;  3C2L A;  3HKZ C;  5DG9 A;  4I2A A;  4JV1 A;  3Q8S B;  5KFP A;  5J2H A;  3PW7 A;  1KEJ A;  4CRX A;  4OJ5 A;  4P0P B;  4I2I A;  1OUQ A;  2CN1 A;  3C23 A;  4I28 A;  1SIJ A;  2ZIV A;  4EBC A;  1SXE A;  9ICR A;  2KIW A;  3H4B A;  4ZH4 A;  5BPC A;  5J0R A;  2WAQ C;  3OSN A;  3N7S C;  1NK8 A;  4F5Q A;  5JTI A;  3NTU A;  2GWS A;  2XGQ A;  5III A;  2NRX A;  3NRW A;  4O3P A;  4R8U A;  3H7I A;  3ZDB A;  2KJ9 A;  2JXJ A;  4KLE A;  4JMU A;  1CI4 A;  2W55 A;  3WK5 A;  4Y2R A;  3WKB A;  3QEA Z;  4DSK A;  1T3Q A;  2H3Q A;  5KFT A;  5KT4 A;  3D2S A;  3B9J A;  2W11 A;  4EEN A;  3JPS A;  4EEL A;  1JUD A;  3PY8 A;  1TE2 A;  5KFM A;  1ZD5 A;  3KHR A;  2AQ4 A;  2NRV A;  2LM4 A;  1SZP A;  2FLL A;  4F4X A;  5A0L A;  4US8 A;  5L1L A;  1ZQG A;  3I28 A;  5ALF A;  5ALR A;  5ALZ A;  2HOF A;  2H3I A;  3E58 A;  3QZ7 A;  2EQY A;  3RR7 A;  4R66 A;  4DOC A;  3I1Y A;  3UXP A;  4NM1 A;  1NK9 A;  2FE9 A;  2WB1 C;  4QZB A;  3C2M A;  4KTQ A;  2HHW A;  3JPR A;  4QWA A;  2LYB A;  4Z6F A;  5IIO A;  3QU9 A;  2A1A A;  4EBD A;  4PHE A;  2Y9U A;  4KLD A;  3LVV A;  2YB1 A;  1ZD4 A;  4MFC A;  5J0X A;  5G5H A;  3WK7 A;  1LKY A;  3KBB A;  2IHN A;  4GIB A;  3JPQ A;  1SV4 A;  2W9B B;  3HX0 A;  2OWO A;  8ICU A;  1URJ A;  2PFQ A;  5AI6 A;  5HML A;  4A8E A;  2W8K A;  3BQ2 A;  2KSO B;  2VA3 A;  4EX7 A;  3H0R B;  1C7Y A;  1Z4O A;  3R9K A;  5KG5 A;  3ALR A;  7ICG A;  4YG2 A;  4ELT A;  4UB1 A;  2R8I A;  3RFA A;  3BJY A;  1RQL A;  4P4O A;  3MR6 A;  2PKE A;  1KRP A;  3RJJ A;  2K4E A;  2W9M A;  2WAQ F;  2K4P A;  4TUP A;  4OD0 A;  4YMN A;  2E1E A;  3U26 A;  1J2N A;  1V97 A;  2KHQ A;  2EAO A;  1T7P A;  2MU2 A;  7ICJ A;  1TVA A;  2G0A A;  5AI4 A;  3NRZ A;  3T5L A;  3HKZ F;  3V6K A;  4O5E A;  2HW3 A;  4UAW A;  2PFN A;  3RJI A;  4K4G A;  1F0M A;  4O5C A;  4F92 B;  4XA5 A;  3PX6 A;  5KAI U;  4DL4 A;  3RAX A;  1RYS A;  2DUY A;  3NVV A;  4I27 A;  1XNS A;  4DFP A;  4QIW F;  3OTQ A;  4M9G A;  5ALM A;  2C2D A;  3KFU F;  4ECX A;  4IR1 A;  4DL7 A;  4YMO A;  3T5H A;  1Z4N A;  4DS5 A;  1KTQ A;  1NK0 A;  5KT6 A;  4QZF A;  4PGX A;  4GXK A;  2OM6 A;  1DK2 A;  4DL2 A;  5KG2 A;  4KX5 A;  3S6J A;  4YR3 A;  1MA7 A;  5ALQ A;  1ZQK A;  2LM1 A;  1ZQL A;  4G9B A;  3CYM A;  2KVC A;  2KIC A;  4Y2V A;  4O3N A;  3KZI U;  3BQ7 A;  2D3D A;  1HJP A;  3RJK A;  3H8W A;  2FLP A;  1UPH A;  2BDU A;  4JV2 A;  3PZP A;  2W03 A;  1X9W A;  3H0M B;  3QUQ A;  8ICG A;  4EZ6 A;  1N56 A;  2W9C A;  3UXN A;  1S0O A;  5DGA A;  7ICH A;  1SB3 C;  5E79 U;  1L3U A;  4NL9 C;  5ALU A;  5AIC A;  5AIB A;  5DB8 A;  3JPN A;  2BCU A;  3F5E A;  5J2I A;  4YN4 A;  2KMD A;  2QAR B;  4I2J A;  2G06 A;  9ICQ A;  5KFQ A;  3SMV A;  3HT3 A;  1ZQW A;  4CDG A;  3JPP A;  2AGQ A;  4PJ0 U;  4RQN A;  3NVW A;  1J2M A;  8ICK A;  1NK5 A;  3CP8 A;  2NO5 A;  2W54 A;  1LVH A;  1RG6 A;  3H0L B;  2ALZ A;  2JH7 A;  2M0N A;  2NYV A;  2VJ4 A;  5AKH A;  3VC8 A;  4C4S A;  2XGP A;  2MA1 A;  2Y9T A;  4RQ5 A;  1UHU A;  4BX9 C;  2JMG A;  5KFG A;  3WKC A;  1A0P A;  2LPE A;  4ECY A;  4I2E A;  1B4F A;  3IRU A;  1Q46 A;  4I2C A;  2E5S A;  3AU2 A;  2PI4 A;  3MBY A;  5CA7 A;  1NOM A;  2P6U A;  4B9M A;  3UM9 A;  9ICW A;  2KHV A;  4J9O A;  2UVR A;  2MRL A;  2KFZ A;  4UB3 A;  3RJE A;  2ZTE A;  2QB1 A;  3QX7 A;  3DDH A;  5KFD A;  3BZC A;  2V9W A;  2EAM A;  4UAT A;  2KK0 A;  4DFM A;  2RDI A;  2H5X A;  5J2K A;  4K4I A;  3LWL A;  1YZ6 A;  2XID A;  4F4Z A;  1SZH A;  3AU6 A;  1IXR A;  1ZD2 P;  1BNO A;  2W3S A;  4IQV A;  3PO4 A;  3BQ0 A;  3T5J A;  2BQR A;  3H8S A;  4DSL A;  3ISC A;  2B21 A;  8ICP A;  1WCL A;  2QB0 A;  1UA1 A;  2F44 A;  4RNN A;  5KL1 B;  1AQ6 A;  3ZD8 A;  2KJ8 A;  2ZXH A;  1SKS A;  4ICA A;  2C2E A;  3RTV A;  1UT8 A;  2J6U A;  4O3Q A;  1CUK A;  5IIL A;  2D8C A;  5ALY A;  5HP4 A;  3WK9 A;  4B9T A;  4RU9 A;  1D9D A;  2LI6 A;  3KTQ A;  8ICO A;  2NRZ A;  3H40 A;  1QQ7 A;  3EW9 A;  1Y88 A;  4BWM A;  2LBO A;  1S0N A;  1TKD A;  2R8G A;  4J9K A;  2IOF A;  4KLQ A;  1PK1 B;  5KFH A;  1X2I A;  2KTQ A;  3M6Z A;  9ICG A;  2HHV A;  4KLO A;  4FBU A;  3ISB A;  3NGD A;  2W43 A;  2XY5 A;  4ED8 A;  4UBC A;  1JXL A;  4QWC A;  1V85 A;  4B9S A;  2WFA A;  5DLF A;  4OJO A;  5ALL A;  5DQI A;  1TV9 A;  5AK4 A;  3ZD9 A;  4Z6C A;  4C8O A;  1KL9 A;  2OH2 A;  4TQS A;  5KT3 A;  3K4G A;  3EPG A;  2J6T A;  3E2E A;  4RPZ A;  1VDV A;  2XY6 A;  4J9Q A;  1Z3E B;  4OJP A;  3HP6 A;  4DSF A;  3HRD D;  4M9J A;  4QW9 A;  5KNI A;  3OPX A;  1IG6 A;  7ICU A;  5J2F A;  3TQ1 A;  4PPX A;  4Q45 A;  2A19 A;  3GV5 B;  2K8A A;  2DBY A;  3M6K A;  1CEZ A;  4QZ8 A;  2HI0 A;  2QKQ A;  3MR5 A;  8ICI A;  1L3V A;  3OGU A;  3L5K A;  2XCP A;  2DKX A;  5DKW A;  4EYI B;  5KFA A;  7ICE A;  5BOL A;  2ZJ8 A;  4QWB A;  1S10 A;  4RZR A;  3HJE A;  3PST A;  5IIM A;  1ZQY A;  4GFJ A;  1DRG A;  5GTH U;  1UCV A;  1QH9 A;  1SL0 A;  5CB1 A;  3N7R C;  3NUQ A;  2JZB B;  1L6N A;  1WG8 A;  3RH6 A;  5BOM A;  2DL0 A;  1NZP A;  5J0S A;  4KLM A;  4FZL A;  4Y2Y A;  5JRT A;  3FAH A;  4M6W B;  4CNQ A;  1SL1 A;  3SAF A;  1YT3 A;  1FFU A;  4Y2U A;  4FE3 A;  5HR7 A;  1IIP A;  1L7P A;  5KG1 A;  5C0Y A;  1KFT A;  2ZIX A;  4QZ9 A;  2KIV A;  3KHG A;  3EYZ A;  4PHP A;  3MDA A;  1ZQU A;  4QZC A;  1HUZ A;  4FS2 A;  2KOB A;  1XWL A;  3MDC A;  4EX6 A;  9ICO A;  1N48 A;  5KFS A;  1TK0 A;  5EE3 A;  1ZJM A;  3NAS A;  5TZV A;  2E8N A;  4YD1 A;  4R65 A;  3I76 A;  2HDO A;  1YZ7 A;  4NLG A;  7ICI A;  3PVX A;  2WHE A;  1XU4 A;  8ICR A;  3SEN A;  5B66 U;  4I2D A;  2HMX A;  4QZA A;  4CCH A;  2XVT A;  4QWD A;  3K1R B;  1U49 A;  2ISP A;  5KTQ A;  2W04 A;  4UW9 A;  2A1J B;  3N7P D;  2OXO A;  3C29 A;  4DCC A;  2KZM A;  5KG3 A;  3ZI4 A;  4CF3 A;  2BPG A;  8ICY A;  3EZ5 A;  2P66 A;  3F2D A;  4TUQ A;  4OCZ A;  7ICK A;  2KKP A;  2KG5 A;  5L9X A;  5J2C A;  2MUT A;  4KLI A;  1ZQS A;  4ED7 A;  4F8R A;  4F5P A;  4PL1 A;  4KLF A;  5J0O A;  5ALP A;  8ICV A;  4CGZ A;  2FPM A;  1Z00 A;  5CRX A;  4KIT B;  5KFV A;  4QZI A;  1JRP A;  5DG8 A;  5AM4 A;  4DFK A;  4O3M A;  3AL0 B;  1ZRM A;  4UB4 A;  2DF4 B;  3Q8P B;  1ZXI A;  3QEB Z;  4IS7 A;  3M7D A;  2EAN A;  1L7M A;  5AKZ A;  1MQ3 A;  1ZQQ A;  2ZIU A;  1ZQT A;  3T5K A;  2I6X A;  2DFL A;  2JEG A;  1QLN A;  2F76 X;  2JEF A;  9ICA A;  4C8L A;  4RPY A;  1ZQP A;  2CRX A;  5D4B A;  3PMN A;  2ZUD A;  4RQ1 A;  5F9L A;  5AI9 A;  2ISO A;  2GLE A;  2BHN A;  1TAQ A;  1PVR A;  2ZIW A;  8ICZ A;  3V7L A;  3AUO A;  5AHX A;  1TAM A;  5AM3 A;  3BDP A;  1PK3 A;  4R64 A;  1OXJ A;  1RDF A;  4KMO B;  2VKQ A;  3HPO A;  4Q43 A;  5J0Q A;  1S0M A;  5J29 A;  4YP3 A;  5ALN A;  2P35 A;  4DFJ A;  4M9N A;  5L1J A;  2WB1 F;  4QIW C;  4AP9 A;  3TKA A;  3C5F A;  1ZQR A;  3M9N B;  4F4Y A;  3B0Y A;  2JEI A;  1P7D A;  5AM2 A;  1NK7 A;  1B0X A;  1L3T A;  4DLE A;  5KFF A;  4NXZ A;  8ICE A;  1SKR A;  1N62 A;  4J9R A;  1D8L A;  4PGY A;  4ED3 A;  1ZET A;  2ZUC A;  1N61 A;  4Y2X A;  1NK6 A;  3ICX A;  3JPT A;  3M9M B;  1WYG A;  3ETR A;  2EZY A;  2KFN A;  3RJF A;  5DBC A;  1HIW A;  3RH5 A;  4YD2 A;  1DK3 A;  1BPX A;  4P0Q B;  2YX8 A;  3DV9 A;  2WTF A;  9ICU A;  4F91 B;  4F2S A;  4I2F A;  3RB4 A;  5KG0 A;  5AKG A;  2DPJ A;  1COK A;  5KFO A;  2ZTC A;  3KOO A;  2A3V A;  2AXT U;  5HR6 A;  1EXN A;  4RQ2 A;  1KDH A;  5F3X B;  3ZDE A;  4AYB C;  3IN5 A;  3RRG A;  9ICK A;  3GDX A;  5KFE A;  1HEK A;  2HOI A;  3C2K A;  1WUD A;  3TFR A;  2OHF A;  1ZQI A;  5KFR A;  4F72 A;  2XC9 A;  7ICM A;  2XY7 A;  3GU3 A;  1S0V A;  9ICB A;  5CEH A;  3WK6 A;  2FPK A;  8ICF A;  1T8E A;  1KSP A;  2JV3 A;  4FO6 A;  8ICL A;  5KFW A;  2LHT A;  5AKJ A;  1ZOL A;  4MF2 A;  4NLZ A;  4BXO A;  4B9N A;  1M6Y A;  5DGB A;  1X40 A;  2XCA A;  1ZQE A;  4I29 A;  3SAG A;  3IM1 A;  1COO A;  3LK9 A;  2KNJ A;  3J81 j;  3RB3 A;  8ICJ A;  5ALK A;  2R8J A;  1FO4 A;  2KP7 A;  3AQF A;  1RYU A;  2ZTD A;  2C28 A;  5J0W A;  1D8Y A;  1JMS A;  4P0P A;  3VCB A;  2ZJA A;  3GV7 B;  4RNM A;  3ISD A;  2ZIV B;  4KLS A;  1NKB A;  1SKW A;  5AM1 A;  3ORY A;  2DKZ A;  4U6P A;  4YR2 A;  4NWI A;  2F8L A;  4JUZ A;  1XC9 A;  1O08 A;  2IA6 A;  3GFK B;  1ZQC A;  2BGW A;  4PHA A;  2GO7 A;  3V6J A;  3UQ2 A;  3BS5 B;  4US9 A;  3PNC A;  3T3F A;  5EWF A;  4UAS A;  4GXJ A;  1L8L A;  2E3T A;  3IHQ B;  4RQ4 A;  4JWN A;  2HHX A;  4LJX A;  4DO9 A;  2BCV A;  4ED0 A;  4EZ9 A;  5DG7 A;  4UBB A;  4M0A A;  1WCN A;  2FDR A;  1L8O A;  1DGS A;  3FC4 A;  1LV5 A;  1PUZ A;  1JX4 A;  2HVH A;  3RJH A;  1ZQJ A;  4DFD A;  2ODG A;  5ALE A;  5KFX A;  3MFH A;  4DQP A;  4P4P A;  2AHO B;  1PZN A;  1RXV A;  2I9G A;  1O03 A;  3BS7 A;  3OJU A;  3PO5 A;  4RNO A;  4BWJ A;  2B6G A;  3TAQ A;  5DB6 A;  4YCX A;  4WJ3 B;  5AI5 A;  2H3F A;  2R8H A;  3IG5 A;  2FI1 A;  5EWE A;  4F5N A;  4ELV A;  4Q8E A;  4ECZ A;  1RM6 C;  2PXI A;  3QU5 A;  4M9L A;  3EWA A;  9ICJ A;  1LKY B;  5J0Y A;  1V9P A;  3MC1 A;  3UXO A;  2P6R A;  4NM2 A;  3M8R A;  2W9B A;  1IM4 A;  1JN3 A;  1Q3U A;  2KSO A;  2HBL A;  2UVW A;  3RH4 A;  4KLT A;  1ED1 A;  5F9N A;  1ZQM A;  4F4W A;  5AI0 A;  5KFB A;  4YMM A;  1S76 D;  1TAU A;  1TFR A;  1NI3 A;  1XSP A;  3H8J A;  1F44 A;  3HIL A;  2N1R A;  2BCR A;  3QXG A;  4YXM A;  2ATL A;  2IHM A;  2WF7 A;  9ICN A;  3UPQ A;  4Y2T A;  2I5H A;  2BR0 A;  2DGZ A;  5B5E U;  5KAF U;  1ZQZ A;  1WWV A;  1U47 A;  4RT3 A;  2ZUB A;  1KLN A;  4KLJ A;  1KKX A;  3N28 A;  3KKA C;  2Q0Z X;  4DL5 A;  2F1H A;  1ZD3 A;  4ECU A;  5IIJ A;  5D49 A;  2XI9 A;  3DEE A;  2Z7J A;  3UMG A;  1V38 A;  4RQ7 A;  4C7Y A;  3QUC A;  4GLX A;  1NJZ A;  3G6Y A;  4OJL A;  3WK4 A;  4RUC A;  5ALW A;  1U48 A;  2G08 A;  2BCQ A;  4ED6 A;  3FDS A;  4M04 A;  2W3R A;  1VJ5 A;  5J0U A;  1XSN A;  5KFN A;  1C20 A;  4R8U B;  4C8M A;  4DL6 A;  9ICS A;  5KG6 A;  4KLG A;  3TAN A;  4PZO A;  2IBK A;  5DDY A;  1XO0 A;  3ED5 A;  1ZYQ A;  1UQV A;  7ICT A;  4DF4 A;  2JEJ A;  4M2Y A;  3SYZ A;  1X9X A;  1A76 A;  1Z1V A;  2QLT A;  3MGI A;  1X9S A;  4DSE A;  4UAZ A;  4B9V A;  3GIL A;  3MAB A;  3MR3 A;  2HSZ A;  2W9A A;  5KFY A;  4Q8F A;  3PW2 A;  2BPC A;  3MR2 A;  2W9C B;  3V72 A;  4UB6 U;  1FFV A;  4PZN A;  2HOQ A;  4OO1 J;  3WK8 A;  3LDA A;  1LB2 B;  4TUR A;  1TK5 A;  1QTM A;  3SI8 A;  2NRT A;  9ICX A;  2QAR A;  4ELU A;  4OJ6 A;  4B9L A;  3QYP A;  1SWV A; 
#chains in the Genus database with same CATH homology
 2DUY A;  5E79 U;  5GTH U;  4IL6 U;  5B66 U;  1S5L U;  3WU2 U;  2AXT U;  5H2F U;  5B5E U;  5KAF U;  4UB6 U;  5TIS U;  3KZI U;  3A0B U;  3A0H U;  5KAI U;  4UB8 U;  4PJ0 U;  5GTI U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...