5GTIU

Native xfel structure of photosystem ii (two flash dataset)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
b'LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II D1 protein
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 30
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5gtiU01
5GTIU 5B66U 3A0HU 5B5EU 4UB6U 4PJ0U 5TISU 5GTHU 3KZIU 1S5LU 2AXTU 3WU2U 2DUYA 5H2FU 5E79U 4IL6U 5KAIU 3A0BU 5KAFU 4UB8U
chains in the Genus database with same CATH superfamily
4I2DA 5EE9A 4RQ4A 5EWGA 1HEKA 2JMGA 4NLBA 5J2GA 2GOLA 3RJFA 4F71A 1KLNA 4I2IA 5AI9A 1SXEA 3ICXA 1MN8A 4C8NA 2AQ0A 3WU2U 1ZQBA 1RZTA 2A3VA 3AUOA 2BCRA 2LI6A 4DQRA 1COKA 4KLJA 1Y88A 4FZLA 2C2EA 3UXPA 2C22A 5IIMA 1K1QA 3E2EA 2AH5A 3MFIA 3PV8A 2IOFK 1U47A 2BCUA 1VJ5A 2KMDA 3PW5A 4PL2A 3PSFA 1IV8A 1MA7A 2A1JB 2KVSA 4NLKA 1KBUA 2KIWA 5D46A 4F5QA 1L3UA 4PL1A 2PFPA 5DQIA 3OSPA 7ICEA 1Z1VA 4Y2SA 4BWJA 8ICTA 1O03A 1BPXA 2WHEA 7ICGA 3TFSA 1CUKA 3BZCA 4GIBA 1S0NA 3T5HA 2J6TA 2KE7A 2GO7A 1Z4NA 2DBYA 5AM4A 5KL8B 1ZQEA 1C20A 5KG2A 4EBCA 5AM0A 1DK2A 8ICZA 2XIDA 4BX9C 4YP3A 5JUMA 4EX6A 4J9RA 3M8RA 3H8SA 4DL4A 1ZQTA 1MQ2A 5KFXA 3H40A 1NKEA 2JEIA 3C29A 4P0QB 4CF3A 4YCXA 2QLTA 3I76A 5KG3A 1Q3UA 2FMPA 4UB8U 5C5JA 3U26A 3MGHA 4MFFA 2ZG6A 2ASDA 8ICQA 4PPXA 4CE6A 1KFDA 3KKAC 4YFKA 1T94A 4BDPA 1S97A 3D2NA 4DSLA 4GC6A 3RJKA 1F5SA 2G5HB 5J0SA 2LHTA 3H0LB 4KLMA 2NRWA 1NZPA 2ZIVA 5ALGA 1BPZA 4PHPA 1UPHA 5KT5A 5KFFA 1TAUA 4KLUA 4FZMA 4R65A 3QZ8A 5AK5A 5HP4A 2E8PA 1S77D 3ZDEA 1KKXA 2HI0A 5KFQA 5IILA 3UXNA 2XGPA 4OO1J 1S5LU 2GLEA 1ZD4A 5AIBA 3ZI4A 7ICPA 3L4PA 2MU2A 3LVWA 9ICHA 3ISDA 4US9A 2PI4A 1RDFA 3NRZA 1NK9A 4RQ3A 4ICAA 2LYHA 3KZXA 3A0HU 3KHHA 4DSJA 4LJXA 3MGIA 3F5EA 2JEFA 1UA0A 4U6PA 1ZQCA 1V9PA 2D3DA 3KOOA 5DDYA 4RNNA 4ECZA 3MR3A 3BJYA 1ZQWA 2CPRA 2JGAA 2RDIA 4UAWA 2F8LA 1ZQFA 2PXIA 5AK4A 5ALEA 3TARA 2NYVA 4FFDA 2ISPA 5EWFA 3O0FA 5DB6A 2A1JA 2F2AB 4JMUA 3OJSA 1U45A 3FM9A 5AK3A 4Z6FA 2MUTA 4KMOB 1ZQXA 5KFAA 4RQ5A 3SENA 4DLGA 1NK7A 3WK9A 4QNLA 4P4PA 5KG4A 3Q8SB 1JUDA 2K4PA 1CEZA 1ZQVA 3AM9A 2D6FC 4QWEA 4ED7A 3F5AA 3H0MB 3CP8A 4OJOA 5J2AA 2HHWA 4F5OA 2BCSA 4RNOA 2KK0A 2V4QA 3F2CA 3QNMA 2NO5A 1TVAA 1PVPA 5AKKA 4R8UA 4YN4A 3WKDA 3H4DA 3RFAA 4P0QA 2KJ8A 3H8JA 1QH9A 1SWWA 4UBBA 1SL1A 1CI4A 5DDMA 2XVTA 4RQ8A 3T5JA 3TACB 2FLLA 4EENA 4B9SA 3M9MB 3OHAA 3H8WA 4DL5A 3SZ2A 2Q4TA 2P35A 3V7KA 7ICJA 1M6YA 1RPLA 2PFNA 1IM4A 1JMSA 3WKBA 3GV5B 3D6JA 3QXGA 4M9LA 4UB6U 2K8AA 1HJPA 2W9AA 5AHXA 4O3SA 4FO6A 1N48A 2DPJA 1MC8A 3ZDDA 3C5GA 3QEBZ 1F0MA 1X9MA 4KITB 2CRXA 2XY5A 5ALSA 1YZ7A 3F2BA 1B0XA 4PGYA 1NNLA 2HBKA 1N63A 3SMVA 1YZ6A 4OJ5A 5DG7A 5KG5A 4O5KA 3NASA 1S0OA 3K75D 5HHHA 1L3TA 2JR5A 3HP6A 9ICOA 1TK0A 1S0MA 1ZQJA 2BDPA 1X40A 2ESEA 4B9VA 2YN4A 3BS7A 2KSOA 3GQCA 1WWVA 9ICQA 3OJUA 2XY7A 1N60A 4AYBC 2HSZA 4DFPA 7ICTA 5CP2A 5AKXA 4GXJA 4C4TA 3Q8PB 2AGPA 3SR6A 2KVCA 2KZMA 4QWCA 4ACOA 2KD1A 5KFBA 4IS7A 3ED5A 2IMWP 3EZ5A 4M04A 4NXZA 2OHFA 1SXDA 4M6WB 5ALFA 4J9NA 2ASJA 2KN7A 1NJZA 3WKEA 3JPSA 2LBOA 1SL2A 3ORYA 3QU4A 3Q8KA 2YTUA 5KFZA 5KL1B 4P2HA 4PHEA 8ICJA 9ICNA 1A0PA 1L7OA 3PR5B 8ICXA 1KL9A 1JXLA 1NI3A 3F2DA 4DQSA 4NWIA 3UM9A 3RBEA 2R8IA 5EE3A 4Y2RA 1SB3C 4DFKA 1PVRA 5ALKA 4I2HA 1L7PA 4IR9A 3WKCA 2CXYA 5ALDA 4MEYA 4OD0A 1RYSA 4US8A 4K4HA 1LKYB 4R63A 5J2IA 2P6RA 3HJEA 1T4GA 1X2IA 1L3SA 4QZAA 2ZIUB 3RJHA 3SQIA 3V7JA 3WK4A 4KMUA 3MDCA 1T3QA 2L5YA 2JV3A 2W9BB 5CWRA 5JU5A 2LPEA 2G07A 3RR7A 4F2SA 4QZ8A 5DKWA 2W7PA 2E8NA 5DB8A 2K4EA 4PJ0U 2ES6A 2YQEA 9ICBA 2ZUCA 1DOQA 1XS9D 5D49A 3C23A 5F9LA 1NKBA 2JH1A 3WKAA 3CRXA 4M47A 4DCCA 4CCHA 1PUZA 1KQQA 2BCQA 2VJ5A 4FBTA 2G0AA 2KP7A 2PKEA 4P4MA 5ALUA 2V4RA 5KFRA 3KHGA 4GXIA 4MFCA 2I6XA 3I1YA 4F91B 3JPRA 2K8CB 2BQ3A 4OJ6A 2O6KA 4YMNA 2NRTA 1T3NA 4QWDA 3QYPA 2FE9A 2W54A 3I28A 1O08A 3AU2A 4F8RA 3V6HA 2JZBB 2DKZA 2MRLA 3V72A 2XI9A 2KOBA 1PK1A 5E79U 1ZQOA 8ICGA 9ICMA 5AKZA 4IRKA 5JRTA 4QWAA 1ZQYA 4JV0A 1SWVA 1PZNA 2JRZA 4M6WA 1XNSA 5KFKA 1HUOA 2IHNA 3NVWA 2DFLA 1D8LA 4I2GA 3PW7A 4UB4A 1ZYQA 5HR6A 5J8YC 4UBCA 2ZIWA 3ONNA 7ICFA 2EH9A 8ICNA 2DL0A 4RUAA 3C2KA 4I2BA 4QZBA 3PSIA 1NJXA 2GH1A 2OH2A 5L1JA 3HILA 5DGBA 4RPYA 3THVA 3ISCA 2W9CB 4HYKA 7ICIA 3IN5A 2OXOA 1ZQIA 7ICVA 2ZUDA 4P0PB 3Q8LA 2F3NA 2MSNA 4DOBA 4I2FA 9ICLA 5HMLA 2RDJA 2G06A 4I2AA 3RAXA 1WG8A 4EYIB 4QZEA 2VKQA 2LM4A 1PVQA 4UATA 4YR0A 3VCBA 4DO9A 7ICQA 4MFAA 1ED1A 2EAMA 5KAIU 1S8OA 3N7PD 9ICSA 3SEIA 2ZTEA 4RU9A 1KFSA 4KLFA 4Y2PA 4G3IA 4WJ3B 1Q46A 3TADA 5J0TA 4EEKA 4YXMA 4KLSA 3OGUA 1CRXA 2DPIA 4XA5A 4TUSA 4DS4A 2EQYA 4JV2A 5AKYA 2M0NA 2DKXA 8ICFA 5KT2A 2DF4B 4USAA 1FFVA 1L8LA 2IOFA 4YR2A 8ICMA 3AQFA 4F4WA 3IG5A 4IQTA 1PK3A 3QUTA 1ZQDA 1ZQLA 2HBMA 5KFIA 2V9WA 3V6KA 2I9GA 8ICSA 4J9QA 3LYSA 2W8KA 4BXOA 2WB1C 4GC7A 4LZDA 1B4FA 4C7YA 1VLBA 1TAQA 4NJ8A 3PW4A 2YMMA 2BPFA 7ICLA 1Z00A 3OHBA 3BQ1A 4IR1A 4YD2A 1JIHA 5H2FU 3RTVA 3M6ZA 2ZXIA 9ICXA 3GILA 1S10A 3IRUA 3HW8A 3C1ZA 5JTIA 5GTIU 1X6JA 2YB1A 1JROA 2OCEA 5J0OA 2JZBA 3RB0A 3Q8QB 5A0LA 1YT3A 1J2MA 4F3OA 2ZJ5A 3IDWA 4P4OA 2P66A 9ICAA 2AU0A 3B9JA 3TKAA 4J9PA 1H38A 5KT4A 4O3OA 2IA6A 8ICOA 4NV0A 3SV4A 2RQ5A 1Z4OA 3FDSA 4F5PA 1TK8A 5CA7A 3AU6A 2EZZA 4MEXA 3IHQB 3T3FA 3PZPA 3SYZA 3FC4A 2ZIXB 5AM5A 4RPXA 2W9MA 3H0RB 5KFVA 5D4BA 4EEYA 2HHSA 3SAHA 4JUZA 3PX0A 1SGGA 3N4MB 2F1IA 1XSNA 1N2XA 1ZQKA 2B6GA 5DLGA 5ALVA 3N7RC 1ZQPA 2WF9A 4B9MA 4RQ6A 2WF5A 4DL6A 4YMMA 3FYHA 3PX4A 2W55A 1AQ6A 4RQMA 1ZQSA 1IXRA 4EX7A 5KFSA 3UMBA 1ZJNA 4ELTA 1U9LA 4ED3A 2UVVA 5J2CA 3GIIA 3GV8B 1MQ3A 1XSPA 4JWMA 4DQIA 4DF8A 1SZHA 2EANA 5L1MA 4NM2A 5L9XA 2KIVA 1SKSA 3MABA 2EZXA 7ICKA 3UXOA 2AQ4A 1L5UA 5KAFU 5KFLA 9ICKA 2KZZA 2FPMA 2E8OA 3N97B 4B9TA 2LKYA 3EW9A 2PI5A 4Q8EA 3BS5B 4QIWC 2QARB 3KHRA 1URJA 4C0ZA 4RQ1A 2JXJA 4C7ZA 3VC8A 3WK6A 9ICEA 1ZQUA 4Y2JA 1K5OA 2FJ6A 1DGJA 4F5RA 5AKIA 3SAFA 2E1EA 2KJ5A 2H3IA 4TUQA 1T7PA 2Y9TA 1SV0A 1N5XA 3N7SC 2HCFA 4Z6DA 4YQWA 3PY8A 4EBDA 3RJIA 4C8LA 1XC9A 5KT7A 2QB0B 4C80A 4F92B 1DXSA 4NLNA 2W11A 1AROP 5J0RA 3V6JA 2WB1F 2J6UA 4F4KA 2KV2A 1U48A 3MR2A 2FPLA 4OJPA 1SKRA 4ECRA 3BQ2A 1BPEA 4F5NA 3PNCA 3G6YA 4X5VA 3LK9A 1QQ6A 3QU5A 4MHVA 4UB3A 2W43A 3D2SA 2M9NA 5HHIA 2J6SA 3BZKA 4DOCA 2WAQF 5CB1A 3DEEA 2UVWA 4O3MA 4R66A 5AK6A 5G5HA 3BQ7A 4Y2UA 1KSPA 7ICRA 1S9FA 4ECVA 3LWMA 4C8KA 4TQSA 2KKVA 2NRXA 5AI0A 2E5SA 4CDGA 5HNKA 3JPPA 1X66A 8ICUA 4ZOHC 1RXWA 2P6UA 5J0PA 3FAHA 2F1HA 5KG1A 2IOHA 1WUDA 7ICOA 4O3PA 3SI8A 4RZRA 3QZ7A 4M2YA 2DGZA 5KFHA 1P7DA 4O5CA 4UAYA 1S76D 5CEHA 5ALNA 2VA8A 5DGAA 4ELUA 1V97A 3G6XA 4UW9A 5EE1A 2K89A 1WYGA 4K4IA 1DK3A 5L1KA 3NRWA 4RQ2A 3HKZC 4JB3A 4FBUA 4ED0A 1KFTA 2FDRA 3GIJA 1KW4A 4ECTA 4F2RA 1J97A 3T5LA 1VDVA 3K1RB 4FE3A 5AKLA 1N56A 1QCKA 1TV9A 4Z6EA 3GV7B 4J9KA 7ICHA 4R64A 2LM1A 3MFHA 4XUSA 3BQTA 3NVYA 4DSFA 3RR8A 2D8CA 3A0BU 1D8YA 2EDUA 8ICBA 1V38A 1FEZA 3ISBA 2W3RA 2YMQA 4O0IA 4ELVA 3C2LA 3B0YA 4I29A 2VA3A 4QIWF 2VA2A 2YMPA 2AHOB 3D2QA 4Q44A 2OEHA 2KHVA 4K4GA 8ICKA 5KFJA 3RRHA 3M8SA 1UHUA 1KRPA 2NRVA 4PZNA 3ETRA 1NK8A 4ECQA 2ZJ8A 4PH5A 1TKDA 1RYUA 4IL6U 2R8GA 4Q45A 4QW9A 3MGVA 2KZ3A 3NUQA 4DQPA 4BJQA 1BVSA 2FI1A 4YD1A 4JK1A 5EE0A 3EPGA 5DG9A 4KLLA 3PMNA 1X6IA 3H7IA 2NV3A 2B21A 2F77X 3AN1A 2FMSA 1B43A 8ICLA 2QB1A 4NL9A 3GU3A 4QZIA 3IP4B 5C0YA 3LWLA 1SV0C 1QSLA 1S0VA 3RJJA 2H5XA 5L1LA 2UVUA 9ICJA 1NK6A 1K1SA 3RH6A 5ALYA 3NS1A 2KFZA 4KN7A 2MAXA 2YB4A 2I5HA 4IC9A 2AGQA 4PZOA 2C2RA 5KG6A 4QZDA 3L5KA 4QZFA 4CNQA 5J2JA 1BNPA 3DV9A 1Q3VA 1HIWA 1NK0A 2K60A 4C4RA 2BQRA 4IQUA 2ZUBA 2ISOA 8ICRA 4RNMA 2JEGA 1QLNA 2K4HA 2N1RA 3EWAA 4ED8A 2E1FA 2XO7A 4EYHB 1KTQA 3AQEA 5ALQA 1UQVA 4J9LA 1EXNA 4C8OA 1ZQAA 1Z1BA 2BPCA 2KTQA 1ZJMA 2EZYA 5DB9A 3KHLA 5AM2A 1FIQA 1ZQQA 5KFUA 5TZVA 3V7LA 2ZIVB 3TAQA 4A8EA 1N62A 1QSYA 2NO4A 2VANA 2LYBA 3HKZF 2W8LA 5BOLA 2BDUA 5J2KA 5L1IA 1B22A 1A76A 4RQNA 1GO3F 5ALRA 4F4XA 1ZQRA 3M1YA 4QWBA 5J0YA 1UCVA 4EZ9A 3PO4A 5AKHA 1L6NA 5BOMA 2PFQA 2HOIA 5AI6A 4J9OA 1LKYA 5IIOA 2HVIA 2H3QA 2VJ4A 3RJEA 1UT5A 2ZIUA 4QZ9A 3MDAA 1KDHA 4DSIA 3S6JA 2JEJA 3RRGA 4KLOA 2RRDA 3NVZA 3ZD8A 4ECWA 2I1QA 3CW2C 1MSWD 2W9BA 1C7YA 8ICCA 3BQ0A 5HR7A 3NVVA 4RT3A 2WFAA 1ZXIA 3ZDBA 3OPXA 4O3QA 2AGOA 1LB2B 8ICEA 2KFNA 3C2MA 4Y2XA 1BNOA 5KG7A 4RQ7A 4DL2A 1BPDA 1TK5A 1XWLA 2B0CA 2HMXA 3QU7A 4GFJA 1SZPA 4O9MA 1SIJA 3QUBA 5AI5A 2GWSA 4QZCA 3AEVA 2W7OA 2BZFA 2H3ZA 5AKJA 2MUTB 5AKEA 3PW2A 3RBDA 4O3NA 4DSKA 4IRDA 3MC1A 4I2EA 3AL0B 4KTQA 4LVSA 1RM6C 2JH7A 3JPNA 3KZIU 1QQ7A 5ALOA 3IM1A 2W3SA 4DOAA 2EAOA 4CF4A 5KFDA 1L7NA 1TE2A 1OXJA 4J9SA 2G09A 2OYYA 4Q43A 1Q8KA 3MR6A 1XU4A 3H8MA 4TUPA 1LVHA 5G5GA 2WAQC 1NJWA 5AICA 5ALZA 3CNHA 2IHMA 2KKPA 3UMGA 3OTQA 5FP0A 4R8UB 4ED2A 1BPYA 4F72A 1NKCA 2AJQA 1TFRA 2BGWA 3K1ZA 3LDAA 4IRCA 4AP9A 5KFTA 9ICVA 5KFPA 2IBKA 1WCLA 4RUCA 4KLHA 2OWOA 4F50A 1ZRMA 5ALIA 2E8MA 4UAUA 4FS1A 9ICRA 4UAZA 1L3VA 2BR0A 1COOA 1V85A 2WF6A 1ZQZA 1ZD2P 2R8KA 1UA1A 2A1AA 4NM1A 5IINA 5J2FA 2AXTU 2YMLA 5CR0A 3CYMA 5ALPA 4M0AA 2W9CA 4YG2A 4UAVA 2Y0SC 5J2DA 3QUQA 4DFDA 5EOZA 4DFJA 3ALRA 2XGQA 4P0PA 1IG6A 3WK8A 4NL9C 1ZETA 2F8KA 8ICWA 3JPOA 1OUQA 2PMZC 2EAPA 1ZQ1C 3WK5A 1NJYA 9ICPA 3EPIA 3C5FA 3RF9A 3EYZA 4I27A 3PR4A 4F4YA 4BUGA 3G6VA 2C2DA 4EZ6A 5AIAA 5EWEA 1IIPA 5KT3A 4EBEA 5J0WA 3TI0A 5F3XB 1T8EA 2DWQA 3BDPA 1NOMA 5ALMA 5B5EU 2Y1IA 2KJ9A 3HWTA 3EUB2 2W04A 2KNJA 4J9MA 1A6SA 2CN1A 5KT6A 5CHGA 3GIMA 2FLNA 1F44A 3QX7A 4M9JA 2WF8A 2LYAA 2BKEA 2DUYA 1SL0A 7ICSA 1KEJA 1RG6A 4IQWA 2KSOB 1JX4A 4ED1A 2HHXA 3HRDD 7ICNA 1U49A 4DFMA 4DF4A 1ZQGA 1QSSA 5AM1A 5KFCA 4UQGA 9ICTA 3JPTA 5IIIA 4C4SA 4PHDA 5T14A 1OW5A 1X42A 3QE9Y 2HBLA 3RAQA 3OSNA 1XO0A 5ALTA 2ODGA 5B66U 4KX5A 2R8HA 4B9LA 3R9KA 3PSTA 8ICAA 2WTFA 1RXVA 3LVVA 3L3FX 4I2CA 2K8BB 3M6KA 4JWNA 4QZGA 5KFNA 3Q8RB 5J2HA 3IV6A 4KLEA 5J2BA 3M7DA 1JXEA 4OJLA 3TANA 4UASA 2G08A 4F4ZA 3QUCA 3NGDA 2ZJAA 3KTQA 2H3FA 5DBBA 5IIJA 2JHDA 4DL7A 4B6JA 5AI4A 5DBCA 3RB4A 5ALJA 4NLZA 3M9NB 3WK7A 2C28A 1N61A 1JN3A 3TADC 3Q8MA 1UT8A 4TQRA 4DWIA 2Y1JA 2F44A 4GXKA 4DLEA 2MA1A 1A77A 3RJGA 2ALZA 3AMZA 2ZIXA 3GFKB 5DLFA 4IQVA 1BGXT 8ICPA 2RP5A 5KFMA 4NLCA 4KLQA 4YXJA 5IIKA 5J8YA 9ICIA 1U4BA 3TQ1A 4HAIA 2F1JA 3TAPA 1RYRA 1XSLA 1RQLA 4KLTA 3MR5A 3UMCA 2A19A 2KICA 5CJ7A 3QEAZ 4B9UA 2ZXHA 4ECSA 2YY6A 8ICHA 3N28A 1XO1A 2FPKA 3J81j 3C28A 4O5EA 2YX8A 3RB3A 5KFEA 3ETLA 2Y0SF 1KN5A 1SV4A 9ICGA 3ZDAA 2G5IB 4ZH4A 5BPCA 5KFOA 1QQ5A 3PVXA 2PMZF 5KFGA 3ZDCA 1DGSA 2KHQA 2RLTA 3SAGA 5J0QA 1SKWA 3T79A 1ZQNA 3KBBA 3HPOA 2XC9A 3C1YA 4Y2QA 4ED6A 2HHVA 3PX6A 4UARA 2HDOA 4YR3A 2NRZA 3BS5A 2QARA 7ICUA 4CF5A 2HHTA 2XY6A 3DDHA 4FZNA 1D9FA 4KLIA 2VIXA 3F53A 3PSPA 1PK1B 4JV1A 2HW3A 1DRGA 2KEYA 3JPQA 2BCVA 1ZD5A 5J29A 4OCZA 4I28A 4O3RA 4BGDA 2BPGA 4ECUA 4PHAA 5F9NA 2ZIWB 5HMMA 4DL3A 4KX3A 4NLGA 4M9NA 3K4GA 5ALHA 5J0UA 4RQ0A 4KN4A 2Z7JA 2QB0A 1D9DA 1X9XA 4NY8A 1NZBA 4DSEA 4RPZA 3T5KA 2DQNB 5DB7A 2FLPA 4U7CA 1JI7A 4F93B 2UVRA 1NK4A 3PO5A 4DQQA 3E0FA 2PFOA 4XQ8A 2WF7A 1BPBA 4EELA 3SV3A 1L8OA 4BWMA 5J0XA 3KD3A 3GZFA 3SD7A 2E3TA 4YVZA 1N5WA 4FS2A 4I2JA 4ECYA 4J03A 4MF8A 1ZQMA 1ZRNA 5J2EA 3M9OB 5AM3A 2HOQA 2K4IA 2W03A 1D8BA 1ECWA 4M9HA 2HOFA 1ZQHA 3QU9A 2HVHA 3MBYA 3TFRA 3HT3A 1ZOLA 5KFYA 1ZD3A 3KKAA 4UB5A 5DQHA 4Z6CA 8ICYA 3E58A 5K4LA 2KG5A 2H3VA 2HHQA 4G9BA 9ICUA 1L7MA 2F76X 4Q8FA 1RQNA 2OM6A 1WWUA 4CGZA 4UB1A 5CRXA 5KG0A 4QJFB 2XCPA 4QZHA 2RHFA 4B9NA 1J2NA 3UPQA 4KLDA 5ALXA 1X9SA 1FO4A 2Y9UA 5DG8A 3UQ0A 3RB6A 2LMRA 4BXOB 2BQUA 8ICVA 4E0DA 2R18A 4YMOA 2XCAA 3HX0A 5TISU 3GDXA 2HBJA 4ECXA 3RH4A 1Z00B 3PMLA 5AKGA 2FMQA 2ATLA 3KFUF 4DS5A 2Q0ZX 5ALWA 2BHNA 4GLXA 4TURA 3PW0A 4XRHA 5ALLA 1WCNA 2QKQA 1NK5A 3UQ2A 3RH5A 9ICWA 5GTHU 4UB2A 5KTQA 4KLGA 2HHUA 4MF2A 5KNIA 1QTMA 3NTUA 8ICIA 3ZD9A 1Z19A 2ZTDA 3B0XA 4PGQA 1LV5A 5AI8A 4DEZA 4M9GA 1Z3EB 1X9WA 4Y2YA 4LZGA 2XICA 3H4BA 4CRXA 9ICFA 4AYBF 7ICMA 4RT2A 3IG8A 1FFUA 3QU2A 1TAMA 4C8MA 3C21A 4Y2TA 4PGXA 9ICCA 5DQGA 1JALA 4QW8A 1HUZA 2R8JA 2ZTCA 5KFWA 4Y2VA 5DBAA 1JRPA 3GIKA 2ASLA
chains in the Genus database with same CATH topology
5GTIU 5B66U 3A0HU 5B5EU 4UB6U 4PJ0U 5TISU 5GTHU 3KZIU 1S5LU 2AXTU 3WU2U 2DUYA 5H2FU 5E79U 4IL6U 5KAIU 3A0BU 5KAFU 4UB8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI U;  5B66 U;  3A0H U;  5B5E U;  4UB6 U;  4PJ0 U;  5TIS U;  5GTH U;  3KZI U;  1S5L U;  2AXT U;  3WU2 U;  2DUY A;  5H2F U;  5E79 U;  4IL6 U;  5KAI U;  3A0B U;  5KAF U;  4UB8 U; 
#chains in the Genus database with same CATH topology
 4I2D A;  5EE9 A;  4RQ4 A;  5EWG A;  1HEK A;  2JMG A;  4NLB A;  5J2G A;  2GOL A;  3RJF A;  4F71 A;  1KLN A;  4I2I A;  5AI9 A;  1SXE A;  3ICX A;  1MN8 A;  4C8N A;  2AQ0 A;  3WU2 U;  1ZQB A;  1RZT A;  2A3V A;  3AUO A;  2BCR A;  2LI6 A;  4DQR A;  1COK A;  4KLJ A;  1Y88 A;  4FZL A;  2C2E A;  3UXP A;  2C22 A;  5IIM A;  1K1Q A;  3E2E A;  2AH5 A;  3MFI A;  3PV8 A;  2IOF K;  1U47 A;  2BCU A;  1VJ5 A;  2KMD A;  3PW5 A;  4PL2 A;  3PSF A;  1IV8 A;  1MA7 A;  2A1J B;  2KVS A;  4NLK A;  1KBU A;  2KIW A;  5D46 A;  4F5Q A;  1L3U A;  4PL1 A;  2PFP A;  5DQI A;  3OSP A;  7ICE A;  1Z1V A;  4Y2S A;  4BWJ A;  8ICT A;  1O03 A;  1BPX A;  2WHE A;  7ICG A;  3TFS A;  1CUK A;  3BZC A;  4GIB A;  1S0N A;  3T5H A;  2J6T A;  2KE7 A;  2GO7 A;  1Z4N A;  2DBY A;  5AM4 A;  5KL8 B;  1ZQE A;  1C20 A;  5KG2 A;  4EBC A;  5AM0 A;  1DK2 A;  8ICZ A;  2XID A;  4BX9 C;  4YP3 A;  5JUM A;  4EX6 A;  4J9R A;  3M8R A;  3H8S A;  4DL4 A;  1ZQT A;  1MQ2 A;  5KFX A;  3H40 A;  1NKE A;  2JEI A;  3C29 A;  4P0Q B;  4CF3 A;  4YCX A;  2QLT A;  3I76 A;  5KG3 A;  1Q3U A;  2FMP A;  4UB8 U;  5C5J A;  3U26 A;  3MGH A;  4MFF A;  2ZG6 A;  2ASD A;  8ICQ A;  4PPX A;  4CE6 A;  1KFD A;  3KKA C;  4YFK A;  1T94 A;  4BDP A;  1S97 A;  3D2N A;  4DSL A;  4GC6 A;  3RJK A;  1F5S A;  2G5H B;  5J0S A;  2LHT A;  3H0L B;  4KLM A;  2NRW A;  1NZP A;  2ZIV A;  5ALG A;  1BPZ A;  4PHP A;  1UPH A;  5KT5 A;  5KFF A;  1TAU A;  4KLU A;  4FZM A;  4R65 A;  3QZ8 A;  5AK5 A;  5HP4 A;  2E8P A;  1S77 D;  3ZDE A;  1KKX A;  2HI0 A;  5KFQ A;  5IIL A;  3UXN A;  2XGP A;  4OO1 J;  1S5L U;  2GLE A;  1ZD4 A;  5AIB A;  3ZI4 A;  7ICP A;  3L4P A;  2MU2 A;  3LVW A;  9ICH A;  3ISD A;  4US9 A;  2PI4 A;  1RDF A;  3NRZ A;  1NK9 A;  4RQ3 A;  4ICA A;  2LYH A;  3KZX A;  3A0H U;  3KHH A;  4DSJ A;  4LJX A;  3MGI A;  3F5E A;  2JEF A;  1UA0 A;  4U6P A;  1ZQC A;  1V9P A;  2D3D A;  3KOO A;  5DDY A;  4RNN A;  4ECZ A;  3MR3 A;  3BJY A;  1ZQW A;  2CPR A;  2JGA A;  2RDI A;  4UAW A;  2F8L A;  1ZQF A;  2PXI A;  5AK4 A;  5ALE A;  3TAR A;  2NYV A;  4FFD A;  2ISP A;  5EWF A;  3O0F A;  5DB6 A;  2A1J A;  2F2A B;  4JMU A;  3OJS A;  1U45 A;  3FM9 A;  5AK3 A;  4Z6F A;  2MUT A;  4KMO B;  1ZQX A;  5KFA A;  4RQ5 A;  3SEN A;  4DLG A;  1NK7 A;  3WK9 A;  4QNL A;  4P4P A;  5KG4 A;  3Q8S B;  1JUD A;  2K4P A;  1CEZ A;  1ZQV A;  3AM9 A;  2D6F C;  4QWE A;  4ED7 A;  3F5A A;  3H0M B;  3CP8 A;  4OJO A;  5J2A A;  2HHW A;  4F5O A;  2BCS A;  4RNO A;  2KK0 A;  2V4Q A;  3F2C A;  3QNM A;  2NO5 A;  1TVA A;  1PVP A;  5AKK A;  4R8U A;  4YN4 A;  3WKD A;  3H4D A;  3RFA A;  4P0Q A;  2KJ8 A;  3H8J A;  1QH9 A;  1SWW A;  4UBB A;  1SL1 A;  1CI4 A;  5DDM A;  2XVT A;  4RQ8 A;  3T5J A;  3TAC B;  2FLL A;  4EEN A;  4B9S A;  3M9M B;  3OHA A;  3H8W A;  4DL5 A;  3SZ2 A;  2Q4T A;  2P35 A;  3V7K A;  7ICJ A;  1M6Y A;  1RPL A;  2PFN A;  1IM4 A;  1JMS A;  3WKB A;  3GV5 B;  3D6J A;  3QXG A;  4M9L A;  4UB6 U;  2K8A A;  1HJP A;  2W9A A;  5AHX A;  4O3S A;  4FO6 A;  1N48 A;  2DPJ A;  1MC8 A;  3ZDD A;  3C5G A;  3QEB Z;  1F0M A;  1X9M A;  4KIT B;  2CRX A;  2XY5 A;  5ALS A;  1YZ7 A;  3F2B A;  1B0X A;  4PGY A;  1NNL A;  2HBK A;  1N63 A;  3SMV A;  1YZ6 A;  4OJ5 A;  5DG7 A;  5KG5 A;  4O5K A;  3NAS A;  1S0O A;  3K75 D;  5HHH A;  1L3T A;  2JR5 A;  3HP6 A;  9ICO A;  1TK0 A;  1S0M A;  1ZQJ A;  2BDP A;  1X40 A;  2ESE A;  4B9V A;  2YN4 A;  3BS7 A;  2KSO A;  3GQC A;  1WWV A;  9ICQ A;  3OJU A;  2XY7 A;  1N60 A;  4AYB C;  2HSZ A;  4DFP A;  7ICT A;  5CP2 A;  5AKX A;  4GXJ A;  4C4T A;  3Q8P B;  2AGP A;  3SR6 A;  2KVC A;  2KZM A;  4QWC A;  4ACO A;  2KD1 A;  5KFB A;  4IS7 A;  3ED5 A;  2IMW P;  3EZ5 A;  4M04 A;  4NXZ A;  2OHF A;  1SXD A;  4M6W B;  5ALF A;  4J9N A;  2ASJ A;  2KN7 A;  1NJZ A;  3WKE A;  3JPS A;  2LBO A;  1SL2 A;  3ORY A;  3QU4 A;  3Q8K A;  2YTU A;  5KFZ A;  5KL1 B;  4P2H A;  4PHE A;  8ICJ A;  9ICN A;  1A0P A;  1L7O A;  3PR5 B;  8ICX A;  1KL9 A;  1JXL A;  1NI3 A;  3F2D A;  4DQS A;  4NWI A;  3UM9 A;  3RBE A;  2R8I A;  5EE3 A;  4Y2R A;  1SB3 C;  4DFK A;  1PVR A;  5ALK A;  4I2H A;  1L7P A;  4IR9 A;  3WKC A;  2CXY A;  5ALD A;  4MEY A;  4OD0 A;  1RYS A;  4US8 A;  4K4H A;  1LKY B;  4R63 A;  5J2I A;  2P6R A;  3HJE A;  1T4G A;  1X2I A;  1L3S A;  4QZA A;  2ZIU B;  3RJH A;  3SQI A;  3V7J A;  3WK4 A;  4KMU A;  3MDC A;  1T3Q A;  2L5Y A;  2JV3 A;  2W9B B;  5CWR A;  5JU5 A;  2LPE A;  2G07 A;  3RR7 A;  4F2S A;  4QZ8 A;  5DKW A;  2W7P A;  2E8N A;  5DB8 A;  2K4E A;  4PJ0 U;  2ES6 A;  2YQE A;  9ICB A;  2ZUC A;  1DOQ A;  1XS9 D;  5D49 A;  3C23 A;  5F9L A;  1NKB A;  2JH1 A;  3WKA A;  3CRX A;  4M47 A;  4DCC A;  4CCH A;  1PUZ A;  1KQQ A;  2BCQ A;  2VJ5 A;  4FBT A;  2G0A A;  2KP7 A;  2PKE A;  4P4M A;  5ALU A;  2V4R A;  5KFR A;  3KHG A;  4GXI A;  4MFC A;  2I6X A;  3I1Y A;  4F91 B;  3JPR A;  2K8C B;  2BQ3 A;  4OJ6 A;  2O6K A;  4YMN A;  2NRT A;  1T3N A;  4QWD A;  3QYP A;  2FE9 A;  2W54 A;  3I28 A;  1O08 A;  3AU2 A;  4F8R A;  3V6H A;  2JZB B;  2DKZ A;  2MRL A;  3V72 A;  2XI9 A;  2KOB A;  1PK1 A;  5E79 U;  1ZQO A;  8ICG A;  9ICM A;  5AKZ A;  4IRK A;  5JRT A;  4QWA A;  1ZQY A;  4JV0 A;  1SWV A;  1PZN A;  2JRZ A;  4M6W A;  1XNS A;  5KFK A;  1HUO A;  2IHN A;  3NVW A;  2DFL A;  1D8L A;  4I2G A;  3PW7 A;  4UB4 A;  1ZYQ A;  5HR6 A;  5J8Y C;  4UBC A;  2ZIW A;  3ONN A;  7ICF A;  2EH9 A;  8ICN A;  2DL0 A;  4RUA A;  3C2K A;  4I2B A;  4QZB A;  3PSI A;  1NJX A;  2GH1 A;  2OH2 A;  5L1J A;  3HIL A;  5DGB A;  4RPY A;  3THV A;  3ISC A;  2W9C B;  4HYK A;  7ICI A;  3IN5 A;  2OXO A;  1ZQI A;  7ICV A;  2ZUD A;  4P0P B;  3Q8L A;  2F3N A;  2MSN A;  4DOB A;  4I2F A;  9ICL A;  5HML A;  2RDJ A;  2G06 A;  4I2A A;  3RAX A;  1WG8 A;  4EYI B;  4QZE A;  2VKQ A;  2LM4 A;  1PVQ A;  4UAT A;  4YR0 A;  3VCB A;  4DO9 A;  7ICQ A;  4MFA A;  1ED1 A;  2EAM A;  5KAI U;  1S8O A;  3N7P D;  9ICS A;  3SEI A;  2ZTE A;  4RU9 A;  1KFS A;  4KLF A;  4Y2P A;  4G3I A;  4WJ3 B;  1Q46 A;  3TAD A;  5J0T A;  4EEK A;  4YXM A;  4KLS A;  3OGU A;  1CRX A;  2DPI A;  4XA5 A;  4TUS A;  4DS4 A;  2EQY A;  4JV2 A;  5AKY A;  2M0N A;  2DKX A;  8ICF A;  5KT2 A;  2DF4 B;  4USA A;  1FFV A;  1L8L A;  2IOF A;  4YR2 A;  8ICM A;  3AQF A;  4F4W A;  3IG5 A;  4IQT A;  1PK3 A;  3QUT A;  1ZQD A;  1ZQL A;  2HBM A;  5KFI A;  2V9W A;  3V6K A;  2I9G A;  8ICS A;  4J9Q A;  3LYS A;  2W8K A;  4BXO A;  2WB1 C;  4GC7 A;  4LZD A;  1B4F A;  4C7Y A;  1VLB A;  1TAQ A;  4NJ8 A;  3PW4 A;  2YMM A;  2BPF A;  7ICL A;  1Z00 A;  3OHB A;  3BQ1 A;  4IR1 A;  4YD2 A;  1JIH A;  5H2F U;  3RTV A;  3M6Z A;  2ZXI A;  9ICX A;  3GIL A;  1S10 A;  3IRU A;  3HW8 A;  3C1Z A;  5JTI A;  5GTI U;  1X6J A;  2YB1 A;  1JRO A;  2OCE A;  5J0O A;  2JZB A;  3RB0 A;  3Q8Q B;  5A0L A;  1YT3 A;  1J2M A;  4F3O A;  2ZJ5 A;  3IDW A;  4P4O A;  2P66 A;  9ICA A;  2AU0 A;  3B9J A;  3TKA A;  4J9P A;  1H38 A;  5KT4 A;  4O3O A;  2IA6 A;  8ICO A;  4NV0 A;  3SV4 A;  2RQ5 A;  1Z4O A;  3FDS A;  4F5P A;  1TK8 A;  5CA7 A;  3AU6 A;  2EZZ A;  4MEX A;  3IHQ B;  3T3F A;  3PZP A;  3SYZ A;  3FC4 A;  2ZIX B;  5AM5 A;  4RPX A;  2W9M A;  3H0R B;  5KFV A;  5D4B A;  4EEY A;  2HHS A;  3SAH A;  4JUZ A;  3PX0 A;  1SGG A;  3N4M B;  2F1I A;  1XSN A;  1N2X A;  1ZQK A;  2B6G A;  5DLG A;  5ALV A;  3N7R C;  1ZQP A;  2WF9 A;  4B9M A;  4RQ6 A;  2WF5 A;  4DL6 A;  4YMM A;  3FYH A;  3PX4 A;  2W55 A;  1AQ6 A;  4RQM A;  1ZQS A;  1IXR A;  4EX7 A;  5KFS A;  3UMB A;  1ZJN A;  4ELT A;  1U9L A;  4ED3 A;  2UVV A;  5J2C A;  3GII A;  3GV8 B;  1MQ3 A;  1XSP A;  4JWM A;  4DQI A;  4DF8 A;  1SZH A;  2EAN A;  5L1M A;  4NM2 A;  5L9X A;  2KIV A;  1SKS A;  3MAB A;  2EZX A;  7ICK A;  3UXO A;  2AQ4 A;  1L5U A;  5KAF U;  5KFL A;  9ICK A;  2KZZ A;  2FPM A;  2E8O A;  3N97 B;  4B9T A;  2LKY A;  3EW9 A;  2PI5 A;  4Q8E A;  3BS5 B;  4QIW C;  2QAR B;  3KHR A;  1URJ A;  4C0Z A;  4RQ1 A;  2JXJ A;  4C7Z A;  3VC8 A;  3WK6 A;  9ICE A;  1ZQU A;  4Y2J A;  1K5O A;  2FJ6 A;  1DGJ A;  4F5R A;  5AKI A;  3SAF A;  2E1E A;  2KJ5 A;  2H3I A;  4TUQ A;  1T7P A;  2Y9T A;  1SV0 A;  1N5X A;  3N7S C;  2HCF A;  4Z6D A;  4YQW A;  3PY8 A;  4EBD A;  3RJI A;  4C8L A;  1XC9 A;  5KT7 A;  2QB0 B;  4C80 A;  4F92 B;  1DXS A;  4NLN A;  2W11 A;  1ARO P;  5J0R A;  3V6J A;  2WB1 F;  2J6U A;  4F4K A;  2KV2 A;  1U48 A;  3MR2 A;  2FPL A;  4OJP A;  1SKR A;  4ECR A;  3BQ2 A;  1BPE A;  4F5N A;  3PNC A;  3G6Y A;  4X5V A;  3LK9 A;  1QQ6 A;  3QU5 A;  4MHV A;  4UB3 A;  2W43 A;  3D2S A;  2M9N A;  5HHI A;  2J6S A;  3BZK A;  4DOC A;  2WAQ F;  5CB1 A;  3DEE A;  2UVW A;  4O3M A;  4R66 A;  5AK6 A;  5G5H A;  3BQ7 A;  4Y2U A;  1KSP A;  7ICR A;  1S9F A;  4ECV A;  3LWM A;  4C8K A;  4TQS A;  2KKV A;  2NRX A;  5AI0 A;  2E5S A;  4CDG A;  5HNK A;  3JPP A;  1X66 A;  8ICU A;  4ZOH C;  1RXW A;  2P6U A;  5J0P A;  3FAH A;  2F1H A;  5KG1 A;  2IOH A;  1WUD A;  7ICO A;  4O3P A;  3SI8 A;  4RZR A;  3QZ7 A;  4M2Y A;  2DGZ A;  5KFH A;  1P7D A;  4O5C A;  4UAY A;  1S76 D;  5CEH A;  5ALN A;  2VA8 A;  5DGA A;  4ELU A;  1V97 A;  3G6X A;  4UW9 A;  5EE1 A;  2K89 A;  1WYG A;  4K4I A;  1DK3 A;  5L1K A;  3NRW A;  4RQ2 A;  3HKZ C;  4JB3 A;  4FBU A;  4ED0 A;  1KFT A;  2FDR A;  3GIJ A;  1KW4 A;  4ECT A;  4F2R A;  1J97 A;  3T5L A;  1VDV A;  3K1R B;  4FE3 A;  5AKL A;  1N56 A;  1QCK A;  1TV9 A;  4Z6E A;  3GV7 B;  4J9K A;  7ICH A;  4R64 A;  2LM1 A;  3MFH A;  4XUS A;  3BQT A;  3NVY A;  4DSF A;  3RR8 A;  2D8C A;  3A0B U;  1D8Y A;  2EDU A;  8ICB A;  1V38 A;  1FEZ A;  3ISB A;  2W3R A;  2YMQ A;  4O0I A;  4ELV A;  3C2L A;  3B0Y A;  4I29 A;  2VA3 A;  4QIW F;  2VA2 A;  2YMP A;  2AHO B;  3D2Q A;  4Q44 A;  2OEH A;  2KHV A;  4K4G A;  8ICK A;  5KFJ A;  3RRH A;  3M8S A;  1UHU A;  1KRP A;  2NRV A;  4PZN A;  3ETR A;  1NK8 A;  4ECQ A;  2ZJ8 A;  4PH5 A;  1TKD A;  1RYU A;  4IL6 U;  2R8G A;  4Q45 A;  4QW9 A;  3MGV A;  2KZ3 A;  3NUQ A;  4DQP A;  4BJQ A;  1BVS A;  2FI1 A;  4YD1 A;  4JK1 A;  5EE0 A;  3EPG A;  5DG9 A;  4KLL A;  3PMN A;  1X6I A;  3H7I A;  2NV3 A;  2B21 A;  2F77 X;  3AN1 A;  2FMS A;  1B43 A;  8ICL A;  2QB1 A;  4NL9 A;  3GU3 A;  4QZI A;  3IP4 B;  5C0Y A;  3LWL A;  1SV0 C;  1QSL A;  1S0V A;  3RJJ A;  2H5X A;  5L1L A;  2UVU A;  9ICJ A;  1NK6 A;  1K1S A;  3RH6 A;  5ALY A;  3NS1 A;  2KFZ A;  4KN7 A;  2MAX A;  2YB4 A;  2I5H A;  4IC9 A;  2AGQ A;  4PZO A;  2C2R A;  5KG6 A;  4QZD A;  3L5K A;  4QZF A;  4CNQ A;  5J2J A;  1BNP A;  3DV9 A;  1Q3V A;  1HIW A;  1NK0 A;  2K60 A;  4C4R A;  2BQR A;  4IQU A;  2ZUB A;  2ISO A;  8ICR A;  4RNM A;  2JEG A;  1QLN A;  2K4H A;  2N1R A;  3EWA A;  4ED8 A;  2E1F A;  2XO7 A;  4EYH B;  1KTQ A;  3AQE A;  5ALQ A;  1UQV A;  4J9L A;  1EXN A;  4C8O A;  1ZQA A;  1Z1B A;  2BPC A;  2KTQ A;  1ZJM A;  2EZY A;  5DB9 A;  3KHL A;  5AM2 A;  1FIQ A;  1ZQQ A;  5KFU A;  5TZV A;  3V7L A;  2ZIV B;  3TAQ A;  4A8E A;  1N62 A;  1QSY A;  2NO4 A;  2VAN A;  2LYB A;  3HKZ F;  2W8L A;  5BOL A;  2BDU A;  5J2K A;  5L1I A;  1B22 A;  1A76 A;  4RQN A;  1GO3 F;  5ALR A;  4F4X A;  1ZQR A;  3M1Y A;  4QWB A;  5J0Y A;  1UCV A;  4EZ9 A;  3PO4 A;  5AKH A;  1L6N A;  5BOM A;  2PFQ A;  2HOI A;  5AI6 A;  4J9O A;  1LKY A;  5IIO A;  2HVI A;  2H3Q A;  2VJ4 A;  3RJE A;  1UT5 A;  2ZIU A;  4QZ9 A;  3MDA A;  1KDH A;  4DSI A;  3S6J A;  2JEJ A;  3RRG A;  4KLO A;  2RRD A;  3NVZ A;  3ZD8 A;  4ECW A;  2I1Q A;  3CW2 C;  1MSW D;  2W9B A;  1C7Y A;  8ICC A;  3BQ0 A;  5HR7 A;  3NVV A;  4RT3 A;  2WFA A;  1ZXI A;  3ZDB A;  3OPX A;  4O3Q A;  2AGO A;  1LB2 B;  8ICE A;  2KFN A;  3C2M A;  4Y2X A;  1BNO A;  5KG7 A;  4RQ7 A;  4DL2 A;  1BPD A;  1TK5 A;  1XWL A;  2B0C A;  2HMX A;  3QU7 A;  4GFJ A;  1SZP A;  4O9M A;  1SIJ A;  3QUB A;  5AI5 A;  2GWS A;  4QZC A;  3AEV A;  2W7O A;  2BZF A;  2H3Z A;  5AKJ A;  2MUT B;  5AKE A;  3PW2 A;  3RBD A;  4O3N A;  4DSK A;  4IRD A;  3MC1 A;  4I2E A;  3AL0 B;  4KTQ A;  4LVS A;  1RM6 C;  2JH7 A;  3JPN A;  3KZI U;  1QQ7 A;  5ALO A;  3IM1 A;  2W3S A;  4DOA A;  2EAO A;  4CF4 A;  5KFD A;  1L7N A;  1TE2 A;  1OXJ A;  4J9S A;  2G09 A;  2OYY A;  4Q43 A;  1Q8K A;  3MR6 A;  1XU4 A;  3H8M A;  4TUP A;  1LVH A;  5G5G A;  2WAQ C;  1NJW A;  5AIC A;  5ALZ A;  3CNH A;  2IHM A;  2KKP A;  3UMG A;  3OTQ A;  5FP0 A;  4R8U B;  4ED2 A;  1BPY A;  4F72 A;  1NKC A;  2AJQ A;  1TFR A;  2BGW A;  3K1Z A;  3LDA A;  4IRC A;  4AP9 A;  5KFT A;  9ICV A;  5KFP A;  2IBK A;  1WCL A;  4RUC A;  4KLH A;  2OWO A;  4F50 A;  1ZRM A;  5ALI A;  2E8M A;  4UAU A;  4FS1 A;  9ICR A;  4UAZ A;  1L3V A;  2BR0 A;  1COO A;  1V85 A;  2WF6 A;  1ZQZ A;  1ZD2 P;  2R8K A;  1UA1 A;  2A1A A;  4NM1 A;  5IIN A;  5J2F A;  2AXT U;  2YML A;  5CR0 A;  3CYM A;  5ALP A;  4M0A A;  2W9C A;  4YG2 A;  4UAV A;  2Y0S C;  5J2D A;  3QUQ A;  4DFD A;  5EOZ A;  4DFJ A;  3ALR A;  2XGQ A;  4P0P A;  1IG6 A;  3WK8 A;  4NL9 C;  1ZET A;  2F8K A;  8ICW A;  3JPO A;  1OUQ A;  2PMZ C;  2EAP A;  1ZQ1 C;  3WK5 A;  1NJY A;  9ICP A;  3EPI A;  3C5F A;  3RF9 A;  3EYZ A;  4I27 A;  3PR4 A;  4F4Y A;  4BUG A;  3G6V A;  2C2D A;  4EZ6 A;  5AIA A;  5EWE A;  1IIP A;  5KT3 A;  4EBE A;  5J0W A;  3TI0 A;  5F3X B;  1T8E A;  2DWQ A;  3BDP A;  1NOM A;  5ALM A;  5B5E U;  2Y1I A;  2KJ9 A;  3HWT A;  3EUB 2;  2W04 A;  2KNJ A;  4J9M A;  1A6S A;  2CN1 A;  5KT6 A;  5CHG A;  3GIM A;  2FLN A;  1F44 A;  3QX7 A;  4M9J A;  2WF8 A;  2LYA A;  2BKE A;  2DUY A;  1SL0 A;  7ICS A;  1KEJ A;  1RG6 A;  4IQW A;  2KSO B;  1JX4 A;  4ED1 A;  2HHX A;  3HRD D;  7ICN A;  1U49 A;  4DFM A;  4DF4 A;  1ZQG A;  1QSS A;  5AM1 A;  5KFC A;  4UQG A;  9ICT A;  3JPT A;  5III A;  4C4S A;  4PHD A;  5T14 A;  1OW5 A;  1X42 A;  3QE9 Y;  2HBL A;  3RAQ A;  3OSN A;  1XO0 A;  5ALT A;  2ODG A;  5B66 U;  4KX5 A;  2R8H A;  4B9L A;  3R9K A;  3PST A;  8ICA A;  2WTF A;  1RXV A;  3LVV A;  3L3F X;  4I2C A;  2K8B B;  3M6K A;  4JWN A;  4QZG A;  5KFN A;  3Q8R B;  5J2H A;  3IV6 A;  4KLE A;  5J2B A;  3M7D A;  1JXE A;  4OJL A;  3TAN A;  4UAS A;  2G08 A;  4F4Z A;  3QUC A;  3NGD A;  2ZJA A;  3KTQ A;  2H3F A;  5DBB A;  5IIJ A;  2JHD A;  4DL7 A;  4B6J A;  5AI4 A;  5DBC A;  3RB4 A;  5ALJ A;  4NLZ A;  3M9N B;  3WK7 A;  2C28 A;  1N61 A;  1JN3 A;  3TAD C;  3Q8M A;  1UT8 A;  4TQR A;  4DWI A;  2Y1J A;  2F44 A;  4GXK A;  4DLE A;  2MA1 A;  1A77 A;  3RJG A;  2ALZ A;  3AMZ A;  2ZIX A;  3GFK B;  5DLF A;  4IQV A;  1BGX T;  8ICP A;  2RP5 A;  5KFM A;  4NLC A;  4KLQ A;  4YXJ A;  5IIK A;  5J8Y A;  9ICI A;  1U4B A;  3TQ1 A;  4HAI A;  2F1J A;  3TAP A;  1RYR A;  1XSL A;  1RQL A;  4KLT A;  3MR5 A;  3UMC A;  2A19 A;  2KIC A;  5CJ7 A;  3QEA Z;  4B9U A;  2ZXH A;  4ECS A;  2YY6 A;  8ICH A;  3N28 A;  1XO1 A;  2FPK A;  3J81 j;  3C28 A;  4O5E A;  2YX8 A;  3RB3 A;  5KFE A;  3ETL A;  2Y0S F;  1KN5 A;  1SV4 A;  9ICG A;  3ZDA A;  2G5I B;  4ZH4 A;  5BPC A;  5KFO A;  1QQ5 A;  3PVX A;  2PMZ F;  5KFG A;  3ZDC A;  1DGS A;  2KHQ A;  2RLT A;  3SAG A;  5J0Q A;  1SKW A;  3T79 A;  1ZQN A;  3KBB A;  3HPO A;  2XC9 A;  3C1Y A;  4Y2Q A;  4ED6 A;  2HHV A;  3PX6 A;  4UAR A;  2HDO A;  4YR3 A;  2NRZ A;  3BS5 A;  2QAR A;  7ICU A;  4CF5 A;  2HHT A;  2XY6 A;  3DDH A;  4FZN A;  1D9F A;  4KLI A;  2VIX A;  3F53 A;  3PSP A;  1PK1 B;  4JV1 A;  2HW3 A;  1DRG A;  2KEY A;  3JPQ A;  2BCV A;  1ZD5 A;  5J29 A;  4OCZ A;  4I28 A;  4O3R A;  4BGD A;  2BPG A;  4ECU A;  4PHA A;  5F9N A;  2ZIW B;  5HMM A;  4DL3 A;  4KX3 A;  4NLG A;  4M9N A;  3K4G A;  5ALH A;  5J0U A;  4RQ0 A;  4KN4 A;  2Z7J A;  2QB0 A;  1D9D A;  1X9X A;  4NY8 A;  1NZB A;  4DSE A;  4RPZ A;  3T5K A;  2DQN B;  5DB7 A;  2FLP A;  4U7C A;  1JI7 A;  4F93 B;  2UVR A;  1NK4 A;  3PO5 A;  4DQQ A;  3E0F A;  2PFO A;  4XQ8 A;  2WF7 A;  1BPB A;  4EEL A;  3SV3 A;  1L8O A;  4BWM A;  5J0X A;  3KD3 A;  3GZF A;  3SD7 A;  2E3T A;  4YVZ A;  1N5W A;  4FS2 A;  4I2J A;  4ECY A;  4J03 A;  4MF8 A;  1ZQM A;  1ZRN A;  5J2E A;  3M9O B;  5AM3 A;  2HOQ A;  2K4I A;  2W03 A;  1D8B A;  1ECW A;  4M9H A;  2HOF A;  1ZQH A;  3QU9 A;  2HVH A;  3MBY A;  3TFR A;  3HT3 A;  1ZOL A;  5KFY A;  1ZD3 A;  3KKA A;  4UB5 A;  5DQH A;  4Z6C A;  8ICY A;  3E58 A;  5K4L A;  2KG5 A;  2H3V A;  2HHQ A;  4G9B A;  9ICU A;  1L7M A;  2F76 X;  4Q8F A;  1RQN A;  2OM6 A;  1WWU A;  4CGZ A;  4UB1 A;  5CRX A;  5KG0 A;  4QJF B;  2XCP A;  4QZH A;  2RHF A;  4B9N A;  1J2N A;  3UPQ A;  4KLD A;  5ALX A;  1X9S A;  1FO4 A;  2Y9U A;  5DG8 A;  3UQ0 A;  3RB6 A;  2LMR A;  4BXO B;  2BQU A;  8ICV A;  4E0D A;  2R18 A;  4YMO A;  2XCA A;  3HX0 A;  5TIS U;  3GDX A;  2HBJ A;  4ECX A;  3RH4 A;  1Z00 B;  3PML A;  5AKG A;  2FMQ A;  2ATL A;  3KFU F;  4DS5 A;  2Q0Z X;  5ALW A;  2BHN A;  4GLX A;  4TUR A;  3PW0 A;  4XRH A;  5ALL A;  1WCN A;  2QKQ A;  1NK5 A;  3UQ2 A;  3RH5 A;  9ICW A;  5GTH U;  4UB2 A;  5KTQ A;  4KLG A;  2HHU A;  4MF2 A;  5KNI A;  1QTM A;  3NTU A;  8ICI A;  3ZD9 A;  1Z19 A;  2ZTD A;  3B0X A;  4PGQ A;  1LV5 A;  5AI8 A;  4DEZ A;  4M9G A;  1Z3E B;  1X9W A;  4Y2Y A;  4LZG A;  2XIC A;  3H4B A;  4CRX A;  9ICF A;  4AYB F;  7ICM A;  4RT2 A;  3IG8 A;  1FFU A;  3QU2 A;  1TAM A;  4C8M A;  3C21 A;  4Y2T A;  4PGX A;  9ICC A;  5DQG A;  1JAL A;  4QW8 A;  1HUZ A;  2R8J A;  2ZTC A;  5KFW A;  4Y2V A;  5DBA A;  1JRP A;  3GIK A;  2ASL A; 
#chains in the Genus database with same CATH homology
 5GTI U;  5B66 U;  3A0H U;  5B5E U;  4UB6 U;  4PJ0 U;  5TIS U;  5GTH U;  3KZI U;  1S5L U;  2AXT U;  3WU2 U;  2DUY A;  5H2F U;  5E79 U;  4IL6 U;  5KAI U;  3A0B U;  5KAF U;  4UB8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...