5GTIU

Native xfel structure of photosystem ii (two flash dataset)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II D1 protein
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 30
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5gtiU01
3WU2U 2DUYA 5TISU 3A0HU 3A0BU 5B66U 5GTHU 2AXTU 5GTIU 5KAIU 5KAFU 1S5LU 4UB6U 3KZIU 5E79U 4IL6U 5B5EU 4UB8U 5H2FU 4PJ0U
chains in the Genus database with same CATH superfamily
1T3NA 2JH7A 1Q3UA 2AGQA 1RG6A 2AJQA 8ICTA 3PW5A 2LBOA 4TQSA 2HHVA 2A1JB 4RQ3A 1U49A 4ECTA 2HHQA 2HSZA 3T3FA 1Q8KA 3L3FX 3RAXA 5F9NA 3QEBZ 2FPMA 2KOBA 4EZ6A 3H8WA 5ALMA 1F0MA 3H40A 4I29A 3C23A 5KFYA 2XI9A 5AIBA 2KIVA 2XY6A 3JPPA 2E8MA 1S0VA 5ALQA 1MC8A 2JMGA 9ICCA 3LVVA 4YVZA 2C22A 1U47A 4KLSA 1K1SA 2D6FC 5BOMA 4IQUA 1V38A 1LKYA 2EANA 2E5SA 5ALJA 4FO6A 1JN3A 1JUDA 4F5NA 1L5UA 3HX0A 3OSPA 4ED3A 3RB4A 5KFHA 2EAPA 1MQ3A 4DFDA 2Z7JA 4RPYA 3GIJA 1IG6A 2W54A 1S0NA 1Q3VA 3WK5A 4KLIA 4RT3A 4F4ZA 4ECQA 3C28A 4PPXA 1ZQLA 5CA7A 3K4GA 2YMPA 2KJ8A 2ES6A 4ELUA 9ICSA 1TAMA 4QWDA 2WTFA 3EW9A 4XQ8A 5ALDA 2ZIVB 2MRLA 4NWIA 4YR2A 3ICXA 4JK1A 3PY8A 4KLGA 1S8OA 1TKDA 3ETLA 2MSNA 4DS5A 3FM9A 4KN7A 1T94A 4UAZA 5AKHA 1ZQRA 1ZJNA 1BNOA 5ALLA 3KTQA 1Z3EB 1X9XA 3SV3A 4ECRA 1URJA 2QB0B 2FI1A 3JPOA 1BVSA 4F2RA 2AQ0A 1S77D 4DOCA 3OJUA 1NJZA 2Y9TA 2XY5A 1DK2A 9ICEA 3GU3A 2NRTA 3NTUA 1X9WA 4UAWA 1L3SA 1PK3A 4HYKA 4B9VA 1L3TA 3NRZA 4QW9A 1SZHA 3H0LB 4QIWF 2H3QA 8ICPA 2V9WA 2I1QA 2ZIUA 1Z1BA 4F2SA 4I2HA 3BQ2A 2WHEA 2ZJ8A 2R18A 2HVHA 4TUPA 5HR6A 5J0YA 3A0HU 2FLLA 2M9NA 1LB2B 3IDWA 3Q8MA 2AGPA 2IHNA 4UBBA 3M9NB 4DL4A 2ZJ5A 3GDXA 3Q8QB 8ICHA 5DG8A 1S97A 3SAHA 2VA2A 4OO1J 4ED1A 4ECWA 3Q8LA 2BQ3A 2HW3A 4AP9A 5KT5A 4KLQA 2WB1F 3HKZC 2RP5A 1ZQHA 4Y2VA 4FBUA 1LVHA 2OXOA 1Z19A 5IIKA 4GLXA 5ALFA 1C20A 4OJPA 1NZBA 4EBDA 4KMOB 2K89A 1COOA 4DOAA 2ISPA 3PR4A 1KRPA 1X40A 2W9MA 4RQ6A 4UB5A 4UQGA 5C0YA 3NASA 1CRXA 4B9NA 4YFKA 2HBMA 2YMQA 4OD0A 1ZQDA 4O0IA 4DQQA 2OWOA 2QB1A 5KFOA 3VCBA 4O3MA 1XSNA 3OHBA 4FS1A 2E8NA 4PZNA 4F4WA 3BS7A 2ZXHA 2KZMA 2K8BB 5CJ7A 3SAGA 1SV0A 1WUDA 5ALNA 3CNHA 5JRTA 3PW7A 5EE1A 3PVXA 3QXGA 2JZBB 3M1YA 4JV1A 5H2FU 3NVYA 4PH5A 7ICEA 3C2MA 1D8LA 5J0TA 2QARA 8ICSA 5EE9A 2FPLA 5AKJA 2R8IA 5AM2A 5DQGA 4UARA 2AXTU 1MA7A 2PFQA 3HWTA 2BPCA 1QQ6A 4Q43A 1PVQA 3PW4A 5HHHA 3SENA 3D2SA 4EEKA 1SL0A 4YN4A 1KDHA 3T79A 3UMGA 4QJFB 2BPGA 4NLBA 4EBEA 3LVWA 4GIBA 5F9LA 2ZIWB 1NJYA 8ICQA 5ALGA 2OM6A 3N7RC 3SAFA 2Y0SC 2Y1JA 1SKWA 2W9CB 3ZDEA 4J9NA 3IRUA 2MUTA 2J6TA 4K4IA 5AM0A 3B9JA 3MR3A 4KLHA 4BWJA 2ZIXA 4IQWA 2I6XA 3PX0A 4DL2A 2EZYA 1NK9A 1NKEA 2BDPA 4YQWA 7ICVA 2P35A 5KAIU 3PMLA 7ICNA 2Y9UA 4J9SA 3RB6A 5KFTA 1X66A 1T8EA 1ZQQA 5J0OA 1HEKA 5HNKA 2A1JA 3BQ0A 1ZQNA 3PSIA 3PV8A 1X6IA 4YXMA 5D4BA 4PGXA 3FC4A 4BXOB 4M47A 2XC9A 3RH5A 1RDFA 4IS7A 3GFKB 2ZUCA 4B9TA 5J0XA 1SGGA 7ICKA 1ZD4A 2FLPA 1S10A 2JRZA 7ICSA 2LYHA 9ICKA 3HRDD 1X42A 1QSLA 3IV6A 4C80A 3WKBA 3LYSA 9ICLA 2KJ5A 2JEGA 5AK3A 3KHGA 3H7IA 1ZYQA 2OH2A 8ICVA 1N62A 3RJFA 2KK0A 4UB2A 4M9NA 2JEJA 4F91B 5KFXA 1Z4NA 4F4XA 4CF4A 1V9PA 5DB9A 3LDAA 4J9LA 1KLNA 3QU2A 3KHRA 4EENA 4OJLA 5KFZA 4DSEA 2B21A 4GC7A 2FJ6A 9ICRA 2NRXA 2ZIVA 2V4RA 2VA8A 4YR0A 5J8YC 2KG5A 4IC9A 3TI0A 3N4MB 1ZRMA 5JU5A 5AM5A 3UQ2A 2LI6A 2W8KA 3G6VA 2ATLA 8ICXA 5ALYA 1RQLA 4UB8U 3SR6A 3ISBA 4QZIA 5AI5A 4YP3A 4EYIB 1WG8A 1DOQA 3EUB2 5AKIA 2YX8A 2R8JA 2N1RA 5KFSA 2QB0A 4AYBF 3MGIA 1NI3A 3TACB 4ECSA 4GXJA 4PHDA 4KLOA 3H0RB 3O0FA 8ICEA 2NYVA 1ZQMA 2GOLA 4PJ0U 1RPLA 5AM3A 2HBKA 4Y2JA 2KVCA 5L1JA 4RQNA 5L1MA 5BPCA 3E58A 5TZVA 3C2LA 2BDUA 2G5IB 1YT3A 3F2CA 2QLTA 4CF3A 5AKGA 4Y2PA 3CW2C 5ALEA 1DXSA 3SV4A 2E1FA 1YZ6A 5B5EU 4P4MA 4DO9A 4DSFA 3TFSA 3ZD8A 1XO0A 2KJ9A 4Q8EA 3H8SA 5KFAA 2KKPA 2F1HA 1PZNA 3L4PA 1SKRA 3H4BA 5IIMA 8ICZA 3L5KA 4K4GA 5AM1A 5F3XB 2GH1A 2LM1A 1SB3C 1L3VA 2CRXA 1ZD3A 3R9KA 4DFMA 1V97A 3OTQA 4Z6EA 2XO7A 1N61A 2JH1A 1KFSA 2DUYA 3MDCA 5ALUA 3GILA 4JB3A 4QWEA 4DF4A 1TK8A 1ZQVA 2R8HA 1SL1A 4MF8A 3Q8RB 3AL0B 2DBYA 2E8OA 1ZQFA 4FFDA 4DLEA 4BX9C 5L1KA 3OGUA 1Z4OA 4ZOHC 2EH9A 4P4PA 4RU9A 4P0PB 5ALIA 2G5HB 2XCPA 3MR6A 3UQ0A 2A1AA 3ZD9A 4J9QA 4DL5A 3EZ5A 2VIXA 3RFAA 2BCRA 1Q46A 5KFQA 2XIDA 4C4RA 2Q0ZX 1KTQA 4DL6A 5AKXA 3FAHA 3RRHA 3QU5A 2GLEA 3MR2A 2BGWA 2JZBA 2YB1A 4F3OA 5HHIA 3TAPA 4DQPA 2XICA 4NLCA 3BZKA 1PVRA 2LPEA 2MA1A 3D2QA 5KFBA 4ELTA 1NOMA 3OJSA 3ZI4A 4MEYA 2BQUA 4F4YA 4DSIA 4DSJA 4KLJA 4RQ8A 2NV3A 3BQ7A 4QZGA 4FS2A 2JXJA 3SD7A 3IHQB 1NK6A 2IMWP 2EAMA 1X9MA 3HW8A 1QCKA 4FZLA 4PL1A 5DLGA 3RRGA 4CCHA 1WWUA 2A19A 1UA1A 3C1ZA 3QUQA 1UHUA 3BQTA 2E3TA 2KIWA 2W9CA 4US9A 2EZXA 2W3SA 4TQRA 2IOFA 5A0LA 3AU2A 1XSLA 1NK8A 1ECWA 2KP7A 5AK6A 2LHTA 4HAIA 5C5JA 3H8JA 5KT3A 3PZPA 3T5KA 2KNJA 4G3IA 3AEVA 5J0RA 3QUBA 4QZHA 5ALPA 5KL1B 1OW5A 3NS1A 2HMXA 4UAVA 4Q44A 4DLGA 1HJPA 4M0AA 3KZIU 1TAUA 4IR1A 3QE9Y 5CP2A 1RXWA 5KFCA 3A0BU 1ZQKA 3ETRA 4BXOA 7ICMA 3DDHA 3AM9A 5DQHA 4F92B 1RZTA 3UMBA 4P0QB 4EZ9A 4JV2A 4B9LA 4ECYA 2UVUA 3E2EA 4RQMA 4I2DA 4C8KA 3V7KA 5HR7A 1ZXIA 2H3IA 4DSKA 4Y2QA 2W55A 7ICTA 5J0SA 9ICFA 2G06A 3RBEA 2ZUBA 5KG2A 2NO5A 2ZG6A 1X9SA 4NLNA 2LM4A 4NL9A 1JXLA 4XUSA 4PGQA 4I2EA 1IM4A 1JRPA 4J9PA 5JTIA 5DG9A 5CHGA 5AM4A 3F2BA 4KLTA 1U9LA 2WAQF 1CI4A 1QH9A 3HT3A 3AU6A 2VANA 5J2IA 2BKEA 5GTHU 5J2FA 1PK1B 3S6JA 2YMMA 2NO4A 5ALSA 2D3DA 2W43A 4PHPA 1TK5A 2HOQA 3B0XA 1RQNA 1L7PA 1UCVA 1GO3F 4OJ6A 9ICMA 2VJ4A 3AQFA 2WF5A 3WU2U 3WKEA 1B4FA 2UVVA 1IXRA 4J9OA 2H5XA 4NL9C 1BPDA 2RRDA 2RQ5A 2ZTDA 3OHAA 2AHOB 4R63A 2DKXA 5L9XA 4BDPA 4RZRA 3QU7A 1KN5A 2F44A 4FBTA 4O3NA 3QUCA 4DOBA 4LZGA 4QWCA 4JMUA 5KAFU 3BZCA 2RLTA 4Y2RA 1DK3A 4KLUA 1ZQIA 1ZD2P 1J2MA 4MFFA 3SQIA 4QZAA 3ZDBA 2DL0A 3VC8A 2PKEA 2FDRA 4I2BA 5IILA 5J2CA 4RQ2A 3IM1A 4I2AA 1XWLA 2W04A 3SYZA 3MGVA 1QSSA 2B0CA 2Y1IA 2HHUA 1K5OA 1JX4A 2H3VA 5KG4A 1TAQA 4FE3A 4MF2A 2RDJA 3MC1A 2DF4B 3D2NA 1WCNA 4YXJA 5D46A 3QU4A 3BQ1A 4I2JA 1WCLA 3RF9A 5B66U 3LWLA 5DG7A 4Z6FA 3RJGA 3PMNA 4ED6A 4M04A 5DGAA 4O3OA 4R8UB 5J2JA 2DKZA 2MAXA 2ESEA 2PFPA 3M9MB 2G07A 2KZ3A 2NRZA 5CEHA 5DQIA 3RH4A 2B6GA 3UMCA 4DFKA 5KT4A 4RNNA 4EX7A 4UAUA 2WF7A 3MFHA 2C2RA 1QLNA 5DBBA 5AKKA 3KKAA 1TE2A 4F8RA 1ZQSA 5KFIA 9ICHA 9ICVA 4UB6U 2CN1A 8ICYA 5J2DA 2M0NA 1DGJA 4M9JA 2R8KA 1ZD5A 4OJOA 2I9GA 2J6UA 1RYRA 2ZUDA 4YCXA 5ALVA 5CB1A 3JPQA 4OCZA 3AMZA 4F72A 2CPRA 4C7YA 2F76X 4QZ8A 3N28A 4ECUA 8ICIA 2XVTA 1M6YA 1VJ5A 5CRXA 5T14A 9ICTA 2RDIA 1SIJA 4RUAA 2OHFA 5ALTA 3BJYA 2EZZA 2K8CB 2W9BB 4XA5A 1N5XA 1XO1A 1L7OA 1S0MA 4P0PA 3KKAC 1AQ6A 4PZOA 1A76A 2KSOB 4B6JA 1T7PA 9ICIA 3HP6A 1U4BA 1NK4A 2A3VA 8ICWA 4PHEA 4DWIA 3T5HA 3GIMA 2KV2A 9ICJA 2KFZA 4QZ9A 4C4TA 9ICOA 5KFVA 4QIWC 4ICAA 5GTIU 3K1ZA 2BPFA 3PSPA 1SWVA 1ZQOA 5J8YA 2O6KA 5EWEA 4KN4A 4M2YA 3Q8KA 1D8YA 4YG2A 4DEZA 2DGZA 2ZIUB 5KFFA 3V6HA 2C2EA 1MQ2A 3OPXA 3JPNA 2HBLA 3UM9A 4ACOA 4KLLA 2K60A 3IP4B 4NV0A 3M6KA 1A77A 3RR8A 2FPKA 4KX5A 2BCQA 4J9RA 2WAQC 5ALZA 4UW9A 1PUZA 4KLDA 4M9LA 3ISDA 2WB1C 4DCCA 3MFIA 4JV0A 4ED2A 1COKA 1RXVA 3M7DA 2JR5A 2KHVA 2JV3A 5KT2A 4Z6DA 1K1QA 3WKDA 8ICAA 4M6WB 3BS5B 5KG7A 9ICAA 3THVA 4O9MA 2XGQA 3F5AA 2ISOA 1BPYA 2LKYA 4IR9A 5EWGA 4DFJA 2NRVA 3WK7A 3KD3A 4DL3A 4QZDA 5AIAA 2LYAA 3MABA 2W9AA 4P2HA 4LZDA 5AK4A 4CGZA 9ICNA 1U48A 4Q8FA 3BDPA 4C0ZA 4BGDA 2PXIA 1RM6C 2ZTCA 4G9BA 4PHAA 1T4GA 2W11A 4Y2SA 4CE6A 1XSPA 5KTQA 4F4KA 1YZ7A 3FYHA 1SXEA 4XRHA 4P0QA 5KFUA 1DGSA 1CUKA 2ASLA 3ORYA 3M6ZA 3OSNA 8ICUA 3CRXA 4KLEA 5AKZA 2CXYA 3JPSA 3KFUF 3RJHA 4ZH4A 4CF5A 2Q4TA 4BUGA 3E0FA 1V85A 2YN4A 2K8AA 5KFJA 2DQNB 5DLFA 3C5GA 1ZQTA 1XU4A 2UVWA 4TUSA 2KE7A 5ALKA 2KD1A 5KL8B 1OXJA 4ECZA 3KZXA 2JHDA 4IRCA 1ZQWA 4M9HA 2FMSA 1KFDA 3EWAA 1BPXA 8ICGA 1MN8A 2KN7A 5G5GA 3MR5A 2KMDA 1PK1A 1N63A 1ED1A 4UAYA 1RYUA 3N97B 1XNSA 2FLNA 4Y2YA 1B0XA 1HUZA 1ZQXA 3PW2A 2P6RA 3RJKA 5DB8A 3M8SA 4MEXA 4ELVA 4NLGA 1O03A 4CNQA 2HOIA 5KFGA 4C8OA 4QWAA 7ICQA 1ZRNA 3ONNA 1X6JA 5HP4A 5KG6A 2DPJA 2DFLA 3LK9A 3QUTA 4GXIA 2P66A 1FFUA 1S9FA 4UB1A 4I27A 3IN5A 1UQVA 3QZ7A 4RPXA 3RTVA 5CWRA 3C29A 2BCVA 1VDVA 5AI0A 2OYYA 2IOHA 7ICJA 4F93B 4O5KA 3H0MB 4ED0A 1SZPA 2KFNA 4UB3A 2L5YA 2HHWA 5KFEA 1N2XA 1ZQ1C 2JEFA 1UT8A 2K4EA 1RYSA 5KFWA 3C1YA 3HJEA 2HVIA 3I76A 4B9MA 4US8A 3KHHA 1ZQAA 2EAOA 3K75D 3TAQA 2F77X 4O3PA 5BOLA 2YTUA 1ZQPA 4DS4A 3DEEA 3F2DA 4RT2A 5KFDA 4R8UA 1J97A 1ZOLA 2LYBA 4MHVA 5ALOA 1NK5A 1LV5A 3V7JA 4NLKA 1ZQBA 4EBCA 3F5EA 1QSYA 2KKVA 5J2HA 1TVAA 2V4QA 3QZ8A 3MGHA 2VJ5A 3GV5B 2I5HA 4EX6A 4F5OA 3NGDA 2ASJA 3QYPA 3ZDAA 2ZIWA 1IIPA 5G5HA 8ICKA 4KX3A 1NKCA 4F50A 1CEZA 4NJ8A 1HUOA 7ICGA 1L6NA 1N48A 1FO4A 3DV9A 4KITB 4PL2A 5KG0A 5J0QA 3TQ1A 2XY7A 3WK4A 2Y0SF 2IA6A 5KFPA 2H3ZA 4YMNA 1Z00B 3N7PD 3QU9A 2W7OA 3PX4A 3RJEA 3GV7B 5J2KA 2W8LA 2W03A 7ICFA 5HMMA 2AU0A 2WF8A 5KG1A 4WJ3B 2HBJA 4RQ4A 2BQRA 4UATA 1ZQZA 1NJWA 7ICUA 4QZFA 1ZQCA 1KEJA 2W9BA 5KT6A 1P7DA 3PSTA 2FE9A 4JWNA 1KSPA 3RJIA 2KSOA 1BNPA 4F5QA 4Z6CA 4AYBC 3H8MA 2PMZF 4GC6A 1SKSA 2G09A 5KG3A 1UPHA 1FFVA 2W7PA 5AI8A 4QW8A 5FP0A 2EDUA 1ZJMA 7ICLA 3C2KA 4EELA 3RB3A 4NM1A 3WKAA 2HI0A 2PFNA 5ALHA 5ALRA 4DF8A 2F8KA 4ED8A 5DDYA 4RQ5A 2HHXA 2MU2A 4ECXA 4J03A 3D6JA 3KOOA 4CRXA 4C8NA 4GFJA 4PGYA 4E0DA 4LJXA 5KFMA 5DBAA 2F3NA 2LMRA 4BWMA 1PVPA 2KZZA 5ALXA 3PR5B 3EYZA 3RH6A 5J2GA 7ICRA 2UVRA 4YMOA 5J0WA 4X5VA 3JPRA 5KFKA 3UXPA 2KHQA 4F5PA 4KLMA 1B22A 3NRWA 1DRGA 1FEZA 1L8OA 2DPIA 2PFOA 3V6JA 1SV4A 4RUCA 3GIIA 2BCSA 5EOZA 2GO7A 4YD1A 1JIHA 5IIOA 2IOFK 1T3QA 4M6WA 3BS5A 4I2IA 4CDGA 1ZQEA 8ICCA 8ICMA 4IRDA 1ZQUA 4KTQA 1J2NA 8ICRA 4C8LA 4F71A 3GIKA 4B9UA 4K4HA 4UB4A 5CR0A 1N56A 4QWBA 1AROP 3H4DA 4Y2UA 4I2CA 4I2GA 3G6YA 4UASA 4NLZA 5DDMA 1JALA 1L8LA 3NVWA 2VA3A 4FZNA 2F2AB 9ICPA 1NKBA 1UA0A 2ZXIA 2GWSA 1KW4A 1D8BA 1S5LU 2ODGA 5EE3A 2KEYA 4DSLA 2BR0A 4A8EA 1F5SA 2YY6A 5KFLA 3V72A 2OEHA 1SL2A 3AN1A 4IQVA 4RQ7A 1SXDA 1BPBA 1ZQYA 4Y2XA 5KNIA 1NK7A 5D49A 3Q8PB 7ICOA 4MFAA 2ZJAA 4O3SA 2AQ4A 2YQEA 3ALRA 1WYGA 1C7YA 1KKXA 4C8MA 5AI6A 4RPZA 3EPGA 4GXKA 4MFCA 3UXOA 4EYHB 3TADA 3FDSA 3I1YA 2IHMA 4TURA 1NZPA 1LKYB 2ASDA 4J9MA 4YR3A 1TFRA 4FZMA 5DKWA 4F5RA 7ICIA 3V7LA 3JPTA 4U7CA 2FMPA 1XC9A 1KFTA 2K4HA 1ZQJA 1UT5A 4J9KA 4OJ5A 4DL7A 3IG5A 1SV0C 3RB0A 2PI4A 3HILA 4ED7A 5L1LA 3SMVA 5AI4A 3SZ2A 1TK0A 4U6PA 1TV9A 3TADC 1H38A 5J2EA 5AKLA 4Q45A 3RR7A 2E8PA 2DWQA 1QTMA 4I2FA 2NRWA 5AI9A 1B43A 2F8LA 1Z1VA 2C2DA 2XGPA 4Y2TA 1D9DA 3ED5A 5DB7A 4P4OA 1BPEA 5L1IA 2WF6A 4C7ZA 2KVSA 2F1JA 3NUQA 7ICHA 4NXZA 2YB4A 5J2AA 4RQ1A 1ZQGA 3ISCA 1JXEA 4KLFA 2P6UA 4IQTA 3TANA 3Q8SB 2PMZC 4QZEA 1O08A 3PX6A 1JROA 1OUQA 7ICPA 3PW0A 4C4SA 2HHTA 3TARA 3HPOA 3F53A 2ALZA 3NVVA 4O5EA 4JWMA 3SEIA 3I28A 5J0UA 2K4PA 8ICJA 3QNMA 5AKEA 5E79U 3PO5A 2YMLA 2OCEA 5TISU 4RNMA 1NJXA 4RNOA 3RAQA 4EEYA 5EE0A 4O5CA 2ZTEA 4QZCA 3CP8A 2K4IA 4RQ0A 1KL9A 3M8RA 4TUQA 2D8CA 3QEAZ 2W3RA 1KQQA 1NK0A 9ICQA 5KFNA 5DB6A 2XCAA 3TKAA 3V6KA 4R65A 1IV8A 3QX7A 1N5WA 4BJQA 2H3FA 5KG5A 1ZETA 1Z00A 3RBDA 1A6SA 1BPZA 9ICWA 1SWWA 3AQEA 5AKYA 1D9FA 4QZBA 1VLBA 3NVZA 4UBCA 9ICGA 3IG8A 8ICNA 4B9SA 1L7MA 5ALWA 2J6SA 2WFAA 3MDAA 1S76D 5JUMA 2F1IA 2E1EA 2AH5A 4IRKA 5DGBA 3PO4A 3KBBA 3GV8B 2EQYA 3WK6A 2IBKA 1L3UA 4DFPA 3GQCA 5AICA 1WWVA 9ICUA 1F44A 1QQ5A 5IINA 1L7NA 4O3RA 3KHLA 5J0PA 1JI7A 3TFRA 2WF9A 1XS9D 5IIJA 5EWFA 4YMMA 3M9OB 2G0AA 4DQIA 3WK8A 4I28A 5J29A 2RHFA 2HHSA 2G08A 4USAA 3J81j 3LWMA 4R64A 1HIWA 3EPIA 2HDOA 5K4LA 4M9GA 3CYMA 5KT7A 3B0YA 8ICFA 2BCUA 4DQRA 3MBYA 1S0OA 2QKQA 2JEIA 1NNLA 1A0PA 2QARB 3PSFA 2PI5A 3ZDDA 8ICBA 4NY8A 8ICLA 4LVSA 3ZDCA 9ICXA 5J2BA 3RJJA 2JGAA 2VKQA 2BHNA 2FMQA 3C21A 3WKCA 3WK9A 1QQ7A 4DQSA 5AHXA 4YD2A 2R8GA 1EXNA 4KMUA 5AK5A 4JUZA 4O3QA 3SI8A 3HKZF 1X2IA 3K1RB 2AGOA 3T5LA 1MSWD 4IL6U 5DBCA 1JMSA 4R66A 4NM2A 5HMLA 3AUOA 2MUTB 3G6XA 2C28A 2BZFA 9ICBA 3C5FA 1FIQA 2HOFA 2HCFA 3GZFA 3T5JA 1N60A 5KFRA 2ZIXB 1BGXT 8ICOA 3PNCA 3U26A 2KTQA 5IIIA 1KBUA 3N7SC 1U45A 4QNLA 2KICA 1Y88A 3UPQA 4ECVA 3UXNA
chains in the Genus database with same CATH topology
3WU2U 2DUYA 5TISU 3A0HU 3A0BU 5B66U 5GTHU 2AXTU 5GTIU 5KAIU 5KAFU 1S5LU 4UB6U 3KZIU 5E79U 4IL6U 5B5EU 4UB8U 5H2FU 4PJ0U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 U;  2DUY A;  5TIS U;  3A0H U;  3A0B U;  5B66 U;  5GTH U;  2AXT U;  5GTI U;  5KAI U;  5KAF U;  1S5L U;  4UB6 U;  3KZI U;  5E79 U;  4IL6 U;  5B5E U;  4UB8 U;  5H2F U;  4PJ0 U; 
#chains in the Genus database with same CATH topology
 1T3N A;  2JH7 A;  1Q3U A;  2AGQ A;  1RG6 A;  2AJQ A;  8ICT A;  3PW5 A;  2LBO A;  4TQS A;  2HHV A;  2A1J B;  4RQ3 A;  1U49 A;  4ECT A;  2HHQ A;  2HSZ A;  3T3F A;  1Q8K A;  3L3F X;  3RAX A;  5F9N A;  3QEB Z;  2FPM A;  2KOB A;  4EZ6 A;  3H8W A;  5ALM A;  1F0M A;  3H40 A;  4I29 A;  3C23 A;  5KFY A;  2XI9 A;  5AIB A;  2KIV A;  2XY6 A;  3JPP A;  2E8M A;  1S0V A;  5ALQ A;  1MC8 A;  2JMG A;  9ICC A;  3LVV A;  4YVZ A;  2C22 A;  1U47 A;  4KLS A;  1K1S A;  2D6F C;  5BOM A;  4IQU A;  1V38 A;  1LKY A;  2EAN A;  2E5S A;  5ALJ A;  4FO6 A;  1JN3 A;  1JUD A;  4F5N A;  1L5U A;  3HX0 A;  3OSP A;  4ED3 A;  3RB4 A;  5KFH A;  2EAP A;  1MQ3 A;  4DFD A;  2Z7J A;  4RPY A;  3GIJ A;  1IG6 A;  2W54 A;  1S0N A;  1Q3V A;  3WK5 A;  4KLI A;  4RT3 A;  4F4Z A;  4ECQ A;  3C28 A;  4PPX A;  1ZQL A;  5CA7 A;  3K4G A;  2YMP A;  2KJ8 A;  2ES6 A;  4ELU A;  9ICS A;  1TAM A;  4QWD A;  2WTF A;  3EW9 A;  4XQ8 A;  5ALD A;  2ZIV B;  2MRL A;  4NWI A;  4YR2 A;  3ICX A;  4JK1 A;  3PY8 A;  4KLG A;  1S8O A;  1TKD A;  3ETL A;  2MSN A;  4DS5 A;  3FM9 A;  4KN7 A;  1T94 A;  4UAZ A;  5AKH A;  1ZQR A;  1ZJN A;  1BNO A;  5ALL A;  3KTQ A;  1Z3E B;  1X9X A;  3SV3 A;  4ECR A;  1URJ A;  2QB0 B;  2FI1 A;  3JPO A;  1BVS A;  4F2R A;  2AQ0 A;  1S77 D;  4DOC A;  3OJU A;  1NJZ A;  2Y9T A;  2XY5 A;  1DK2 A;  9ICE A;  3GU3 A;  2NRT A;  3NTU A;  1X9W A;  4UAW A;  1L3S A;  1PK3 A;  4HYK A;  4B9V A;  1L3T A;  3NRZ A;  4QW9 A;  1SZH A;  3H0L B;  4QIW F;  2H3Q A;  8ICP A;  2V9W A;  2I1Q A;  2ZIU A;  1Z1B A;  4F2S A;  4I2H A;  3BQ2 A;  2WHE A;  2ZJ8 A;  2R18 A;  2HVH A;  4TUP A;  5HR6 A;  5J0Y A;  3A0H U;  2FLL A;  2M9N A;  1LB2 B;  3IDW A;  3Q8M A;  2AGP A;  2IHN A;  4UBB A;  3M9N B;  4DL4 A;  2ZJ5 A;  3GDX A;  3Q8Q B;  8ICH A;  5DG8 A;  1S97 A;  3SAH A;  2VA2 A;  4OO1 J;  4ED1 A;  4ECW A;  3Q8L A;  2BQ3 A;  2HW3 A;  4AP9 A;  5KT5 A;  4KLQ A;  2WB1 F;  3HKZ C;  2RP5 A;  1ZQH A;  4Y2V A;  4FBU A;  1LVH A;  2OXO A;  1Z19 A;  5IIK A;  4GLX A;  5ALF A;  1C20 A;  4OJP A;  1NZB A;  4EBD A;  4KMO B;  2K89 A;  1COO A;  4DOA A;  2ISP A;  3PR4 A;  1KRP A;  1X40 A;  2W9M A;  4RQ6 A;  4UB5 A;  4UQG A;  5C0Y A;  3NAS A;  1CRX A;  4B9N A;  4YFK A;  2HBM A;  2YMQ A;  4OD0 A;  1ZQD A;  4O0I A;  4DQQ A;  2OWO A;  2QB1 A;  5KFO A;  3VCB A;  4O3M A;  1XSN A;  3OHB A;  4FS1 A;  2E8N A;  4PZN A;  4F4W A;  3BS7 A;  2ZXH A;  2KZM A;  2K8B B;  5CJ7 A;  3SAG A;  1SV0 A;  1WUD A;  5ALN A;  3CNH A;  5JRT A;  3PW7 A;  5EE1 A;  3PVX A;  3QXG A;  2JZB B;  3M1Y A;  4JV1 A;  5H2F U;  3NVY A;  4PH5 A;  7ICE A;  3C2M A;  1D8L A;  5J0T A;  2QAR A;  8ICS A;  5EE9 A;  2FPL A;  5AKJ A;  2R8I A;  5AM2 A;  5DQG A;  4UAR A;  2AXT U;  1MA7 A;  2PFQ A;  3HWT A;  2BPC A;  1QQ6 A;  4Q43 A;  1PVQ A;  3PW4 A;  5HHH A;  3SEN A;  3D2S A;  4EEK A;  1SL0 A;  4YN4 A;  1KDH A;  3T79 A;  3UMG A;  4QJF B;  2BPG A;  4NLB A;  4EBE A;  3LVW A;  4GIB A;  5F9L A;  2ZIW B;  1NJY A;  8ICQ A;  5ALG A;  2OM6 A;  3N7R C;  3SAF A;  2Y0S C;  2Y1J A;  1SKW A;  2W9C B;  3ZDE A;  4J9N A;  3IRU A;  2MUT A;  2J6T A;  4K4I A;  5AM0 A;  3B9J A;  3MR3 A;  4KLH A;  4BWJ A;  2ZIX A;  4IQW A;  2I6X A;  3PX0 A;  4DL2 A;  2EZY A;  1NK9 A;  1NKE A;  2BDP A;  4YQW A;  7ICV A;  2P35 A;  5KAI U;  3PML A;  7ICN A;  2Y9U A;  4J9S A;  3RB6 A;  5KFT A;  1X66 A;  1T8E A;  1ZQQ A;  5J0O A;  1HEK A;  5HNK A;  2A1J A;  3BQ0 A;  1ZQN A;  3PSI A;  3PV8 A;  1X6I A;  4YXM A;  5D4B A;  4PGX A;  3FC4 A;  4BXO B;  4M47 A;  2XC9 A;  3RH5 A;  1RDF A;  4IS7 A;  3GFK B;  2ZUC A;  4B9T A;  5J0X A;  1SGG A;  7ICK A;  1ZD4 A;  2FLP A;  1S10 A;  2JRZ A;  7ICS A;  2LYH A;  9ICK A;  3HRD D;  1X42 A;  1QSL A;  3IV6 A;  4C80 A;  3WKB A;  3LYS A;  9ICL A;  2KJ5 A;  2JEG A;  5AK3 A;  3KHG A;  3H7I A;  1ZYQ A;  2OH2 A;  8ICV A;  1N62 A;  3RJF A;  2KK0 A;  4UB2 A;  4M9N A;  2JEJ A;  4F91 B;  5KFX A;  1Z4N A;  4F4X A;  4CF4 A;  1V9P A;  5DB9 A;  3LDA A;  4J9L A;  1KLN A;  3QU2 A;  3KHR A;  4EEN A;  4OJL A;  5KFZ A;  4DSE A;  2B21 A;  4GC7 A;  2FJ6 A;  9ICR A;  2NRX A;  2ZIV A;  2V4R A;  2VA8 A;  4YR0 A;  5J8Y C;  2KG5 A;  4IC9 A;  3TI0 A;  3N4M B;  1ZRM A;  5JU5 A;  5AM5 A;  3UQ2 A;  2LI6 A;  2W8K A;  3G6V A;  2ATL A;  8ICX A;  5ALY A;  1RQL A;  4UB8 U;  3SR6 A;  3ISB A;  4QZI A;  5AI5 A;  4YP3 A;  4EYI B;  1WG8 A;  1DOQ A;  3EUB 2;  5AKI A;  2YX8 A;  2R8J A;  2N1R A;  5KFS A;  2QB0 A;  4AYB F;  3MGI A;  1NI3 A;  3TAC B;  4ECS A;  4GXJ A;  4PHD A;  4KLO A;  3H0R B;  3O0F A;  8ICE A;  2NYV A;  1ZQM A;  2GOL A;  4PJ0 U;  1RPL A;  5AM3 A;  2HBK A;  4Y2J A;  2KVC A;  5L1J A;  4RQN A;  5L1M A;  5BPC A;  3E58 A;  5TZV A;  3C2L A;  2BDU A;  2G5I B;  1YT3 A;  3F2C A;  2QLT A;  4CF3 A;  5AKG A;  4Y2P A;  3CW2 C;  5ALE A;  1DXS A;  3SV4 A;  2E1F A;  1YZ6 A;  5B5E U;  4P4M A;  4DO9 A;  4DSF A;  3TFS A;  3ZD8 A;  1XO0 A;  2KJ9 A;  4Q8E A;  3H8S A;  5KFA A;  2KKP A;  2F1H A;  1PZN A;  3L4P A;  1SKR A;  3H4B A;  5IIM A;  8ICZ A;  3L5K A;  4K4G A;  5AM1 A;  5F3X B;  2GH1 A;  2LM1 A;  1SB3 C;  1L3V A;  2CRX A;  1ZD3 A;  3R9K A;  4DFM A;  1V97 A;  3OTQ A;  4Z6E A;  2XO7 A;  1N61 A;  2JH1 A;  1KFS A;  2DUY A;  3MDC A;  5ALU A;  3GIL A;  4JB3 A;  4QWE A;  4DF4 A;  1TK8 A;  1ZQV A;  2R8H A;  1SL1 A;  4MF8 A;  3Q8R B;  3AL0 B;  2DBY A;  2E8O A;  1ZQF A;  4FFD A;  4DLE A;  4BX9 C;  5L1K A;  3OGU A;  1Z4O A;  4ZOH C;  2EH9 A;  4P4P A;  4RU9 A;  4P0P B;  5ALI A;  2G5H B;  2XCP A;  3MR6 A;  3UQ0 A;  2A1A A;  3ZD9 A;  4J9Q A;  4DL5 A;  3EZ5 A;  2VIX A;  3RFA A;  2BCR A;  1Q46 A;  5KFQ A;  2XID A;  4C4R A;  2Q0Z X;  1KTQ A;  4DL6 A;  5AKX A;  3FAH A;  3RRH A;  3QU5 A;  2GLE A;  3MR2 A;  2BGW A;  2JZB A;  2YB1 A;  4F3O A;  5HHI A;  3TAP A;  4DQP A;  2XIC A;  4NLC A;  3BZK A;  1PVR A;  2LPE A;  2MA1 A;  3D2Q A;  5KFB A;  4ELT A;  1NOM A;  3OJS A;  3ZI4 A;  4MEY A;  2BQU A;  4F4Y A;  4DSI A;  4DSJ A;  4KLJ A;  4RQ8 A;  2NV3 A;  3BQ7 A;  4QZG A;  4FS2 A;  2JXJ A;  3SD7 A;  3IHQ B;  1NK6 A;  2IMW P;  2EAM A;  1X9M A;  3HW8 A;  1QCK A;  4FZL A;  4PL1 A;  5DLG A;  3RRG A;  4CCH A;  1WWU A;  2A19 A;  1UA1 A;  3C1Z A;  3QUQ A;  1UHU A;  3BQT A;  2E3T A;  2KIW A;  2W9C A;  4US9 A;  2EZX A;  2W3S A;  4TQR A;  2IOF A;  5A0L A;  3AU2 A;  1XSL A;  1NK8 A;  1ECW A;  2KP7 A;  5AK6 A;  2LHT A;  4HAI A;  5C5J A;  3H8J A;  5KT3 A;  3PZP A;  3T5K A;  2KNJ A;  4G3I A;  3AEV A;  5J0R A;  3QUB A;  4QZH A;  5ALP A;  5KL1 B;  1OW5 A;  3NS1 A;  2HMX A;  4UAV A;  4Q44 A;  4DLG A;  1HJP A;  4M0A A;  3KZI U;  1TAU A;  4IR1 A;  3QE9 Y;  5CP2 A;  1RXW A;  5KFC A;  3A0B U;  1ZQK A;  3ETR A;  4BXO A;  7ICM A;  3DDH A;  3AM9 A;  5DQH A;  4F92 B;  1RZT A;  3UMB A;  4P0Q B;  4EZ9 A;  4JV2 A;  4B9L A;  4ECY A;  2UVU A;  3E2E A;  4RQM A;  4I2D A;  4C8K A;  3V7K A;  5HR7 A;  1ZXI A;  2H3I A;  4DSK A;  4Y2Q A;  2W55 A;  7ICT A;  5J0S A;  9ICF A;  2G06 A;  3RBE A;  2ZUB A;  5KG2 A;  2NO5 A;  2ZG6 A;  1X9S A;  4NLN A;  2LM4 A;  4NL9 A;  1JXL A;  4XUS A;  4PGQ A;  4I2E A;  1IM4 A;  1JRP A;  4J9P A;  5JTI A;  5DG9 A;  5CHG A;  5AM4 A;  3F2B A;  4KLT A;  1U9L A;  2WAQ F;  1CI4 A;  1QH9 A;  3HT3 A;  3AU6 A;  2VAN A;  5J2I A;  2BKE A;  5GTH U;  5J2F A;  1PK1 B;  3S6J A;  2YMM A;  2NO4 A;  5ALS A;  2D3D A;  2W43 A;  4PHP A;  1TK5 A;  2HOQ A;  3B0X A;  1RQN A;  1L7P A;  1UCV A;  1GO3 F;  4OJ6 A;  9ICM A;  2VJ4 A;  3AQF A;  2WF5 A;  3WU2 U;  3WKE A;  1B4F A;  2UVV A;  1IXR A;  4J9O A;  2H5X A;  4NL9 C;  1BPD A;  2RRD A;  2RQ5 A;  2ZTD A;  3OHA A;  2AHO B;  4R63 A;  2DKX A;  5L9X A;  4BDP A;  4RZR A;  3QU7 A;  1KN5 A;  2F44 A;  4FBT A;  4O3N A;  3QUC A;  4DOB A;  4LZG A;  4QWC A;  4JMU A;  5KAF U;  3BZC A;  2RLT A;  4Y2R A;  1DK3 A;  4KLU A;  1ZQI A;  1ZD2 P;  1J2M A;  4MFF A;  3SQI A;  4QZA A;  3ZDB A;  2DL0 A;  3VC8 A;  2PKE A;  2FDR A;  4I2B A;  5IIL A;  5J2C A;  4RQ2 A;  3IM1 A;  4I2A A;  1XWL A;  2W04 A;  3SYZ A;  3MGV A;  1QSS A;  2B0C A;  2Y1I A;  2HHU A;  1K5O A;  1JX4 A;  2H3V A;  5KG4 A;  1TAQ A;  4FE3 A;  4MF2 A;  2RDJ A;  3MC1 A;  2DF4 B;  3D2N A;  1WCN A;  4YXJ A;  5D46 A;  3QU4 A;  3BQ1 A;  4I2J A;  1WCL A;  3RF9 A;  5B66 U;  3LWL A;  5DG7 A;  4Z6F A;  3RJG A;  3PMN A;  4ED6 A;  4M04 A;  5DGA A;  4O3O A;  4R8U B;  5J2J A;  2DKZ A;  2MAX A;  2ESE A;  2PFP A;  3M9M B;  2G07 A;  2KZ3 A;  2NRZ A;  5CEH A;  5DQI A;  3RH4 A;  2B6G A;  3UMC A;  4DFK A;  5KT4 A;  4RNN A;  4EX7 A;  4UAU A;  2WF7 A;  3MFH A;  2C2R A;  1QLN A;  5DBB A;  5AKK A;  3KKA A;  1TE2 A;  4F8R A;  1ZQS A;  5KFI A;  9ICH A;  9ICV A;  4UB6 U;  2CN1 A;  8ICY A;  5J2D A;  2M0N A;  1DGJ A;  4M9J A;  2R8K A;  1ZD5 A;  4OJO A;  2I9G A;  2J6U A;  1RYR A;  2ZUD A;  4YCX A;  5ALV A;  5CB1 A;  3JPQ A;  4OCZ A;  3AMZ A;  4F72 A;  2CPR A;  4C7Y A;  2F76 X;  4QZ8 A;  3N28 A;  4ECU A;  8ICI A;  2XVT A;  1M6Y A;  1VJ5 A;  5CRX A;  5T14 A;  9ICT A;  2RDI A;  1SIJ A;  4RUA A;  2OHF A;  5ALT A;  3BJY A;  2EZZ A;  2K8C B;  2W9B B;  4XA5 A;  1N5X A;  1XO1 A;  1L7O A;  1S0M A;  4P0P A;  3KKA C;  1AQ6 A;  4PZO A;  1A76 A;  2KSO B;  4B6J A;  1T7P A;  9ICI A;  3HP6 A;  1U4B A;  1NK4 A;  2A3V A;  8ICW A;  4PHE A;  4DWI A;  3T5H A;  3GIM A;  2KV2 A;  9ICJ A;  2KFZ A;  4QZ9 A;  4C4T A;  9ICO A;  5KFV A;  4QIW C;  4ICA A;  5GTI U;  3K1Z A;  2BPF A;  3PSP A;  1SWV A;  1ZQO A;  5J8Y A;  2O6K A;  5EWE A;  4KN4 A;  4M2Y A;  3Q8K A;  1D8Y A;  4YG2 A;  4DEZ A;  2DGZ A;  2ZIU B;  5KFF A;  3V6H A;  2C2E A;  1MQ2 A;  3OPX A;  3JPN A;  2HBL A;  3UM9 A;  4ACO A;  4KLL A;  2K60 A;  3IP4 B;  4NV0 A;  3M6K A;  1A77 A;  3RR8 A;  2FPK A;  4KX5 A;  2BCQ A;  4J9R A;  2WAQ C;  5ALZ A;  4UW9 A;  1PUZ A;  4KLD A;  4M9L A;  3ISD A;  2WB1 C;  4DCC A;  3MFI A;  4JV0 A;  4ED2 A;  1COK A;  1RXV A;  3M7D A;  2JR5 A;  2KHV A;  2JV3 A;  5KT2 A;  4Z6D A;  1K1Q A;  3WKD A;  8ICA A;  4M6W B;  3BS5 B;  5KG7 A;  9ICA A;  3THV A;  4O9M A;  2XGQ A;  3F5A A;  2ISO A;  1BPY A;  2LKY A;  4IR9 A;  5EWG A;  4DFJ A;  2NRV A;  3WK7 A;  3KD3 A;  4DL3 A;  4QZD A;  5AIA A;  2LYA A;  3MAB A;  2W9A A;  4P2H A;  4LZD A;  5AK4 A;  4CGZ A;  9ICN A;  1U48 A;  4Q8F A;  3BDP A;  4C0Z A;  4BGD A;  2PXI A;  1RM6 C;  2ZTC A;  4G9B A;  4PHA A;  1T4G A;  2W11 A;  4Y2S A;  4CE6 A;  1XSP A;  5KTQ A;  4F4K A;  1YZ7 A;  3FYH A;  1SXE A;  4XRH A;  4P0Q A;  5KFU A;  1DGS A;  1CUK A;  2ASL A;  3ORY A;  3M6Z A;  3OSN A;  8ICU A;  3CRX A;  4KLE A;  5AKZ A;  2CXY A;  3JPS A;  3KFU F;  3RJH A;  4ZH4 A;  4CF5 A;  2Q4T A;  4BUG A;  3E0F A;  1V85 A;  2YN4 A;  2K8A A;  5KFJ A;  2DQN B;  5DLF A;  3C5G A;  1ZQT A;  1XU4 A;  2UVW A;  4TUS A;  2KE7 A;  5ALK A;  2KD1 A;  5KL8 B;  1OXJ A;  4ECZ A;  3KZX A;  2JHD A;  4IRC A;  1ZQW A;  4M9H A;  2FMS A;  1KFD A;  3EWA A;  1BPX A;  8ICG A;  1MN8 A;  2KN7 A;  5G5G A;  3MR5 A;  2KMD A;  1PK1 A;  1N63 A;  1ED1 A;  4UAY A;  1RYU A;  3N97 B;  1XNS A;  2FLN A;  4Y2Y A;  1B0X A;  1HUZ A;  1ZQX A;  3PW2 A;  2P6R A;  3RJK A;  5DB8 A;  3M8S A;  4MEX A;  4ELV A;  4NLG A;  1O03 A;  4CNQ A;  2HOI A;  5KFG A;  4C8O A;  4QWA A;  7ICQ A;  1ZRN A;  3ONN A;  1X6J A;  5HP4 A;  5KG6 A;  2DPJ A;  2DFL A;  3LK9 A;  3QUT A;  4GXI A;  2P66 A;  1FFU A;  1S9F A;  4UB1 A;  4I27 A;  3IN5 A;  1UQV A;  3QZ7 A;  4RPX A;  3RTV A;  5CWR A;  3C29 A;  2BCV A;  1VDV A;  5AI0 A;  2OYY A;  2IOH A;  7ICJ A;  4F93 B;  4O5K A;  3H0M B;  4ED0 A;  1SZP A;  2KFN A;  4UB3 A;  2L5Y A;  2HHW A;  5KFE A;  1N2X A;  1ZQ1 C;  2JEF A;  1UT8 A;  2K4E A;  1RYS A;  5KFW A;  3C1Y A;  3HJE A;  2HVI A;  3I76 A;  4B9M A;  4US8 A;  3KHH A;  1ZQA A;  2EAO A;  3K75 D;  3TAQ A;  2F77 X;  4O3P A;  5BOL A;  2YTU A;  1ZQP A;  4DS4 A;  3DEE A;  3F2D A;  4RT2 A;  5KFD A;  4R8U A;  1J97 A;  1ZOL A;  2LYB A;  4MHV A;  5ALO A;  1NK5 A;  1LV5 A;  3V7J A;  4NLK A;  1ZQB A;  4EBC A;  3F5E A;  1QSY A;  2KKV A;  5J2H A;  1TVA A;  2V4Q A;  3QZ8 A;  3MGH A;  2VJ5 A;  3GV5 B;  2I5H A;  4EX6 A;  4F5O A;  3NGD A;  2ASJ A;  3QYP A;  3ZDA A;  2ZIW A;  1IIP A;  5G5H A;  8ICK A;  4KX3 A;  1NKC A;  4F50 A;  1CEZ A;  4NJ8 A;  1HUO A;  7ICG A;  1L6N A;  1N48 A;  1FO4 A;  3DV9 A;  4KIT B;  4PL2 A;  5KG0 A;  5J0Q A;  3TQ1 A;  2XY7 A;  3WK4 A;  2Y0S F;  2IA6 A;  5KFP A;  2H3Z A;  4YMN A;  1Z00 B;  3N7P D;  3QU9 A;  2W7O A;  3PX4 A;  3RJE A;  3GV7 B;  5J2K A;  2W8L A;  2W03 A;  7ICF A;  5HMM A;  2AU0 A;  2WF8 A;  5KG1 A;  4WJ3 B;  2HBJ A;  4RQ4 A;  2BQR A;  4UAT A;  1ZQZ A;  1NJW A;  7ICU A;  4QZF A;  1ZQC A;  1KEJ A;  2W9B A;  5KT6 A;  1P7D A;  3PST A;  2FE9 A;  4JWN A;  1KSP A;  3RJI A;  2KSO A;  1BNP A;  4F5Q A;  4Z6C A;  4AYB C;  3H8M A;  2PMZ F;  4GC6 A;  1SKS A;  2G09 A;  5KG3 A;  1UPH A;  1FFV A;  2W7P A;  5AI8 A;  4QW8 A;  5FP0 A;  2EDU A;  1ZJM A;  7ICL A;  3C2K A;  4EEL A;  3RB3 A;  4NM1 A;  3WKA A;  2HI0 A;  2PFN A;  5ALH A;  5ALR A;  4DF8 A;  2F8K A;  4ED8 A;  5DDY A;  4RQ5 A;  2HHX A;  2MU2 A;  4ECX A;  4J03 A;  3D6J A;  3KOO A;  4CRX A;  4C8N A;  4GFJ A;  4PGY A;  4E0D A;  4LJX A;  5KFM A;  5DBA A;  2F3N A;  2LMR A;  4BWM A;  1PVP A;  2KZZ A;  5ALX A;  3PR5 B;  3EYZ A;  3RH6 A;  5J2G A;  7ICR A;  2UVR A;  4YMO A;  5J0W A;  4X5V A;  3JPR A;  5KFK A;  3UXP A;  2KHQ A;  4F5P A;  4KLM A;  1B22 A;  3NRW A;  1DRG A;  1FEZ A;  1L8O A;  2DPI A;  2PFO A;  3V6J A;  1SV4 A;  4RUC A;  3GII A;  2BCS A;  5EOZ A;  2GO7 A;  4YD1 A;  1JIH A;  5IIO A;  2IOF K;  1T3Q A;  4M6W A;  3BS5 A;  4I2I A;  4CDG A;  1ZQE A;  8ICC A;  8ICM A;  4IRD A;  1ZQU A;  4KTQ A;  1J2N A;  8ICR A;  4C8L A;  4F71 A;  3GIK A;  4B9U A;  4K4H A;  4UB4 A;  5CR0 A;  1N56 A;  4QWB A;  1ARO P;  3H4D A;  4Y2U A;  4I2C A;  4I2G A;  3G6Y A;  4UAS A;  4NLZ A;  5DDM A;  1JAL A;  1L8L A;  3NVW A;  2VA3 A;  4FZN A;  2F2A B;  9ICP A;  1NKB A;  1UA0 A;  2ZXI A;  2GWS A;  1KW4 A;  1D8B A;  1S5L U;  2ODG A;  5EE3 A;  2KEY A;  4DSL A;  2BR0 A;  4A8E A;  1F5S A;  2YY6 A;  5KFL A;  3V72 A;  2OEH A;  1SL2 A;  3AN1 A;  4IQV A;  4RQ7 A;  1SXD A;  1BPB A;  1ZQY A;  4Y2X A;  5KNI A;  1NK7 A;  5D49 A;  3Q8P B;  7ICO A;  4MFA A;  2ZJA A;  4O3S A;  2AQ4 A;  2YQE A;  3ALR A;  1WYG A;  1C7Y A;  1KKX A;  4C8M A;  5AI6 A;  4RPZ A;  3EPG A;  4GXK A;  4MFC A;  3UXO A;  4EYH B;  3TAD A;  3FDS A;  3I1Y A;  2IHM A;  4TUR A;  1NZP A;  1LKY B;  2ASD A;  4J9M A;  4YR3 A;  1TFR A;  4FZM A;  5DKW A;  4F5R A;  7ICI A;  3V7L A;  3JPT A;  4U7C A;  2FMP A;  1XC9 A;  1KFT A;  2K4H A;  1ZQJ A;  1UT5 A;  4J9K A;  4OJ5 A;  4DL7 A;  3IG5 A;  1SV0 C;  3RB0 A;  2PI4 A;  3HIL A;  4ED7 A;  5L1L A;  3SMV A;  5AI4 A;  3SZ2 A;  1TK0 A;  4U6P A;  1TV9 A;  3TAD C;  1H38 A;  5J2E A;  5AKL A;  4Q45 A;  3RR7 A;  2E8P A;  2DWQ A;  1QTM A;  4I2F A;  2NRW A;  5AI9 A;  1B43 A;  2F8L A;  1Z1V A;  2C2D A;  2XGP A;  4Y2T A;  1D9D A;  3ED5 A;  5DB7 A;  4P4O A;  1BPE A;  5L1I A;  2WF6 A;  4C7Z A;  2KVS A;  2F1J A;  3NUQ A;  7ICH A;  4NXZ A;  2YB4 A;  5J2A A;  4RQ1 A;  1ZQG A;  3ISC A;  1JXE A;  4KLF A;  2P6U A;  4IQT A;  3TAN A;  3Q8S B;  2PMZ C;  4QZE A;  1O08 A;  3PX6 A;  1JRO A;  1OUQ A;  7ICP A;  3PW0 A;  4C4S A;  2HHT A;  3TAR A;  3HPO A;  3F53 A;  2ALZ A;  3NVV A;  4O5E A;  4JWM A;  3SEI A;  3I28 A;  5J0U A;  2K4P A;  8ICJ A;  3QNM A;  5AKE A;  5E79 U;  3PO5 A;  2YML A;  2OCE A;  5TIS U;  4RNM A;  1NJX A;  4RNO A;  3RAQ A;  4EEY A;  5EE0 A;  4O5C A;  2ZTE A;  4QZC A;  3CP8 A;  2K4I A;  4RQ0 A;  1KL9 A;  3M8R A;  4TUQ A;  2D8C A;  3QEA Z;  2W3R A;  1KQQ A;  1NK0 A;  9ICQ A;  5KFN A;  5DB6 A;  2XCA A;  3TKA A;  3V6K A;  4R65 A;  1IV8 A;  3QX7 A;  1N5W A;  4BJQ A;  2H3F A;  5KG5 A;  1ZET A;  1Z00 A;  3RBD A;  1A6S A;  1BPZ A;  9ICW A;  1SWW A;  3AQE A;  5AKY A;  1D9F A;  4QZB A;  1VLB A;  3NVZ A;  4UBC A;  9ICG A;  3IG8 A;  8ICN A;  4B9S A;  1L7M A;  5ALW A;  2J6S A;  2WFA A;  3MDA A;  1S76 D;  5JUM A;  2F1I A;  2E1E A;  2AH5 A;  4IRK A;  5DGB A;  3PO4 A;  3KBB A;  3GV8 B;  2EQY A;  3WK6 A;  2IBK A;  1L3U A;  4DFP A;  3GQC A;  5AIC A;  1WWV A;  9ICU A;  1F44 A;  1QQ5 A;  5IIN A;  1L7N A;  4O3R A;  3KHL A;  5J0P A;  1JI7 A;  3TFR A;  2WF9 A;  1XS9 D;  5IIJ A;  5EWF A;  4YMM A;  3M9O B;  2G0A A;  4DQI A;  3WK8 A;  4I28 A;  5J29 A;  2RHF A;  2HHS A;  2G08 A;  4USA A;  3J81 j;  3LWM A;  4R64 A;  1HIW A;  3EPI A;  2HDO A;  5K4L A;  4M9G A;  3CYM A;  5KT7 A;  3B0Y A;  8ICF A;  2BCU A;  4DQR A;  3MBY A;  1S0O A;  2QKQ A;  2JEI A;  1NNL A;  1A0P A;  2QAR B;  3PSF A;  2PI5 A;  3ZDD A;  8ICB A;  4NY8 A;  8ICL A;  4LVS A;  3ZDC A;  9ICX A;  5J2B A;  3RJJ A;  2JGA A;  2VKQ A;  2BHN A;  2FMQ A;  3C21 A;  3WKC A;  3WK9 A;  1QQ7 A;  4DQS A;  5AHX A;  4YD2 A;  2R8G A;  1EXN A;  4KMU A;  5AK5 A;  4JUZ A;  4O3Q A;  3SI8 A;  3HKZ F;  1X2I A;  3K1R B;  2AGO A;  3T5L A;  1MSW D;  4IL6 U;  5DBC A;  1JMS A;  4R66 A;  4NM2 A;  5HML A;  3AUO A;  2MUT B;  3G6X A;  2C28 A;  2BZF A;  9ICB A;  3C5F A;  1FIQ A;  2HOF A;  2HCF A;  3GZF A;  3T5J A;  1N60 A;  5KFR A;  2ZIX B;  1BGX T;  8ICO A;  3PNC A;  3U26 A;  2KTQ A;  5III A;  1KBU A;  3N7S C;  1U45 A;  4QNL A;  2KIC A;  1Y88 A;  3UPQ A;  4ECV A;  3UXN A; 
#chains in the Genus database with same CATH homology
 3WU2 U;  2DUY A;  5TIS U;  3A0H U;  3A0B U;  5B66 U;  5GTH U;  2AXT U;  5GTI U;  5KAI U;  5KAF U;  1S5L U;  4UB6 U;  3KZI U;  5E79 U;  4IL6 U;  5B5E U;  4UB8 U;  5H2F U;  4PJ0 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...