2MUTB

Solution structure of the f231l mutant ercc1-xpf dimerization region
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA excision repair protein ERCC-1
publication title The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 19
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2mutB00
5KT6A 4ED0A 2XY5A 4MEXA 4JUZA 8ICSA 5J0TA 5DG9A 2FPLA 4HYKA 2ATLA 4IQVA 1ZQPA 4MF2A 1SZPA 1HUOA 4YN4A 2R8GA 4KLEA 4O9MA 1ZQOA 4YXJA 4GC6A 3JPPA 2ZJAA 4Z6FA 5KT4A 2IHNA 5KFDA 4J9PA 4RQ6A 5KG0A 9ICJA 4UAZA 1HJPA 2C2EA 1TAUA 3PW5A 4IRDA 1ZQWA 2W9CB 1U49A 3SI8A 8ICMA 3RTVA 4ECQA 4KMUA 4JWNA 4IR9A 2FMSA 5L1LA 9ICBA 3M8RA 4J9RA 2BCRA 8ICRA 2ZTEA 4KLMA 3BQ0A 1NKCA 4M9LA 4DSKA 4TUQA 3EZ5A 1K1SA 4F4ZA 2IA6A 4F2SA 3SYZA 4I2IA 4KLJA 3MR5A 4PGXA 1RXVA 4X5VA 3V7KA 5KFAA 4R64A 4Q8FA 1CEZA 1ZQFA 4K4HA 3KTQA 4NLZA 1BVSA 5KFVA 4F5PA 5CJ7A 4IR1A 3RB0A 5CP2A 4PHAA 4PHPA 8ICKA 3JPSA 1B43A 5DKWA 4P4OA 3EPIA 8ICCA 1U47A 5DQGA 4EYHB 4RPYA 3HX0A 3TAPA 1S0MA 4DSLA 1H38A 9ICUA 3RAXA 2H5XA 1JMSA 1MC8A 4R65A 3AUOA 2BR0A 2HHUA 3GV5B 2NRXA 3H8WA 5KFUA 1ZQRA 5EWEA 1NJWA 4UQGA 5EWFA 2BPGA 5HP4A 5KFGA 1SKSA 1WCLA 1NKEA 4M9HA 4F91B 3LDAA 2ZUDA 1ZQKA 5DB6A 4ECWA 2KZZA 4B9SA 3K4GA 5J0QA 1N56A 4UAYA 5IILA 1ZQZA 2DFLA 3UXPA 1KFDA 4YMOA 4KLUA 1NJXA 1KRPA 1X2IA 2IMWP 8ICWA 4R63A 5IINA 3RR7A 5J0SA 7ICOA 2FPKA 5J2CA 3V7JA 4B9TA 4XUSA 5KFNA 4M04A 2C28A 8ICYA 4Z6CA 1D8LA 2M9NA 4ZH4A 4QW8A 4F4XA 3PX0A 1S0NA 5KFZA 3GILA 2AGQA 3OSPA 4B9UA 4ECZA 1ZQDA 5DG8A 2JEGA 3H40A 3GIJA 1L5UA 1ZQYA 4R8UA 4FBTA 4J9LA 4EYIB 2P66A 4KLQA 3ISBA 4PHEA 3RJHA 1KLNA 5KFFA 4M9JA 7ICNA 3PMLA 7ICLA 1XS9D 2ZJ5A 3EWAA 4KLFA 2MAXA 7ICMA 8ICLA 3RR8A 2JEIA 3LWLA 9ICHA 3C5FA 4C8LA 4GLXA 3FDSA 4BWJA 2NRWA 3K75D 1XC9A 4YCXA 3JPTA 1IM4A 5D4BA 3GV7B 5IIMA 1N48A 1XSPA 9ICVA 3RB6A 4RUCA 4I27A 8ICTA 1ZQUA 1TK5A 4I2EA 3GIMA 3QEBZ 2DPIA 4LVSA 4DL7A 4QWEA 3Q8MA 2R8KA 4M9GA 4O5EA 7ICGA 3JPNA 4YR0A 2DPJA 4Q8EA 2HHWA 8ICUA 4O3PA 3JPOA 1TFRA 3MABA 3NTUA 2BDPA 4CCHA 3RB4A 4J9MA 1UA0A 9ICKA 1LV5A 3C5GA 4FS2A 4RQ0A 1KFTA 3ZD8A 4RQ3A 2KTQA 5HHIA 3UXOA 2JZBA 5KT2A 5EWGA 1NK0A 1TV9A 7ICIA 9ICFA 5KG3A 1NJYA 4J9OA 1XWLA 1L3SA 1ZQBA 4C8NA 5L1KA 5CR0A 4QZAA 1CUKA 9ICNA 4UB1A 1JIHA 9ICAA 1PZNA 4C8KA 5L9XA 3NGDA 1JXLA 3PW4A 3PW2A 5KFJA 2W9AA 3OSNA 4DFMA 4JWMA 4NLNA 1UT8A 4DL6A 3RH6A 7ICKA 1S0OA 5KFPA 3KHGA 5KFRA 4DQSA 9ICLA 5C5JA 2AGPA 4M0AA 4NLGA 1S9FA 1SL0A 4P4MA 2XC9A 2IHMA 4B9MA 3TQ1A 4KN7A 5KT3A 2ZUCA 2BHNA 3ZDEA 1KEJA 8ICHA 2AU0A 5J0UA 4I29A 4FBUA 4KLHA 4DOBA 2PI5A 7ICJA 3UQ2A 4DL5A 1X9MA 4QZHA 3BQ2A 1HUZA 5BOLA 2B21A 1C7YA 4DLEA 2XGQA 1Z00A 5J2KA 3LK9A 3PMNA 1TK8A 1QTMA 2W9MA 4RQ8A 3ORYA 4IQUA 2GWSA 4EZ6A 4DFPA 2KFNA 4J9KA 3Q8SB 4EZ9A 3MGHA 3H4BA 4ECRA 4F3OA 1A76A 4GXJA 2FMPA 1AROP 4K4IA 3QEAZ 4PGQA 2A1JA 5J2FA 3MDCA 5KFOA 1NK7A 1Y88A 3C2MA 1D9FA 7ICQA 7ICPA 3BQTA 2MUTA 4RUAA 4YXMA 4UAWA 4XRHA 2KZ3A 4ED1A 7ICEA 1ZQSA 4ECSA 3T5LA 4J9NA 4YP3A 2XCAA 1BPXA 2V9WA 5BOMA 3HW8A 4BGDA 1K1QA 4YD1A 3RAQA 4ED7A 2IBKA 4QZCA 4UB5A 4QZEA 5KFIA 2FLLA 3B0YA 4IQTA 5HHHA 5DQHA 3IM1A 4K4GA 4BXOA 2LYHA 2UVWA 4NY8A 8ICZA 4ECVA 3IHQB 5IIOA 9ICMA 7ICRA 1D8YA 4JV0A 4DS5A 5KG1A 4BWMA 4BDPA 1L3VA 2V4RA 3KHLA 2ZTDA 3PNCA 1UT5A 4R66A 1ZETA 2KZMA 4P2HA 8ICEA 5L1IA 3ZDDA 5KFSA 4DFJA 2VA2A 4I2JA 4RQ5A 2HHTA 9ICCA 5J2EA 4DL4A 4YMMA 1BPEA 4I2GA 4MFFA 1RYSA 4KITB 3C21A 9ICWA 9ICOA 4YVZA 1KTQA 5KFMA 3HP6A 3TARA 4C8MA 4Z6EA 1NK4A 3ZDBA 1T3NA 9ICSA 5L1JA 1U48A 3THVA 3T3FA 4B9LA 2KFZA 2W9CA 2W8KA 3SV4A 3T5HA 3PX4A 3RJGA 4RU9A 3HT3A 5J0XA 4RT2A 3UQ0A 4QZBA 2Y1JA 2AQ4A 1BPYA 3RJEA 3PO4A 1NJZA 1S0VA 2HHQA 3MR6A 4MF8A 3MR2A 1RZTA 5KFLA 5KFHA 4PHDA 8ICFA 3GIIA 5DG7A 4O5CA 2XCPA 4KTQA 2NRVA 4UBCA 1WCNA 3V6HA 7ICVA 9ICEA 4DF8A 3H7IA 1ZQTA 4I2BA 3RH5A 2XY6A 4B9NA 3H4DA 3RBDA 1XSLA 1ZQGA 1ZQIA 3JPQA 4GXIA 4DQQA 3AU2A 4DQPA 1ZQMA 4JV1A 1T4GA 4M6WB 1DGSA 5KFCA 3GQCA 4DL3A 1ZQQA 3ZDCA 7ICHA 3PV8A 2NRZA 5J2AA 5KT7A 4O0IA 1Z3EB 1QSLA 1BGXT 5J2BA 3MFIA 2BPFA 4F4KA 5DLGA 3N97B 3PY8A 5DB9A 3V72A 7ICSA 4TURA 3OHBA 4JK1A 3OHAA 5BPCA 2W9BB 1U9LA 2R8JA 3OJUA 3GDXA 2AJQA 3G6XA 3JPRA 4F5NA 3RJIA 4DL2A 4MEYA 5J0OA 1TVAA 9ICRA 4IRCA 3QZ7A 8ICGA 1ZQHA 8ICOA 7ICFA 4Z6DA 3BJYA 4DSEA 2UVUA 2ISPA 2ZTCA 4UB4A 4QWBA 2C22A 4Q44A 2J6SA 4ED2A 4O3OA 4KLLA 2UVRA 4G3IA 2HW3A 2FLNA 2PFOA 4FO6A 1JXEA 8ICIA 9ICXA 5J2GA 2BCUA 8ICQA 3M8SA 5DB7A 3SZ2A 3Q8KA 9ICPA 1D9DA 5DBAA 2P6RA 4I2DA 5KTQA 3PW7A 4DQIA 1IXRA 4QZ9A 5KG7A 3OJSA 4RNOA 4C8OA 4KLGA 4TQRA 1ZJMA 3PO5A 4DOAA 3H8JA 2AGOA 5CA7A 4ECXA 4M47A 3TANA 2PFNA 2HVHA 2F1IA 4RZRA 4YQWA 2ALZA 1BPBA 4YFKA 1XU4A 3LWMA 3RBEA 1X9WA 1MQ3A 4P4PA 3EYZA 8ICVA 2XGPA 3V6KA 4EBCA 2WTFA 1A77A 1ZQNA 3C2LA 1S10A 5IIIA 4Q43A 2Y1IA 2ASJA 4O5KA 1XSNA 3UXNA 5DDYA 8ICPA 1QSYA 2FPMA 5DGBA 5DLFA 4EEYA 4QWCA 4M9NA 2HHSA 1MQ2A 4EBEA 5KG5A 3BDPA 3PR5B 1B22A 3V7LA 4IQWA 3C1YA 2R8HA 1ZYQA 5J29A 3Q8PB 4DSIA 3N4MB 1NK9A 3PX6A 4F93B 4I2AA 4UB2A 3C2KA 3QE9Y 1U45A 2BKEA 9ICTA 4YR2A 5F9NA 4F50A 4RT3A 4Q45A 4YR3A 3UPQA 2ZJ8A 4TQSA 4RPZA 3GFKB 1BPZA 4UB3A 3Q8RB 4ED8A 4O3SA 2ZUBA 1QLNA 5F9LA 4ELVA 5DGAA 2BQ3A 4I2FA 4RQ4A 8ICNA 5KFKA 1T7PA 8ICBA 5JUMA 4ECYA 1XO1A 4PGYA 5J2IA 3RJFA 4E0DA 2VA8A 5J2HA 4DF4A 3FYHA 3RJJA 4J9QA 4LZDA 2RDIA 3ZD9A 4KLSA 2RDJA 1EXNA 2FMQA 2JEJA 4R8UB 1ZJNA 2KN7A 5J0YA 4TUPA 5D46A 4KLDA 5DBCA 5J2JA 1NK5A 4KN4A 3PW0A 4JV2A 4ED6A 7ICUA 4YD2A 2UVVA 3TI0A 3RJKA 7ICTA 1JX4A 4UBBA 1QSSA 4KLTA 3C23A 1U4BA 4DFKA 2C2DA 2XY7A 4QW9A 4DWIA 2I9GA 4XA5A 1X9SA 2VA3A 1S77D 5KT5A 4RNMA 2VANA 1ZQLA 2J6UA 4DEZA 4ECTA 4IRKA 3OGUA 1MSWD 3PVXA 4RQ2A 4F4YA 2BCQA 3GIKA 3KHHA 5J2DA 4F5QA 3BQ1A 5HMMA 2R8IA 4QWDA 4MFAA 3M9NB 2BPCA 4DQRA 5DBBA 4EBDA 3HWTA 3ISCA 8ICJA 3RRGA 3EW9A 1TKDA 1SKWA 4RNNA 2Q0ZX 1ZQVA 3M9MB 2JZBB 2OWOA 4F8RA 3EPGA 5KFQA 3T5JA 4LZGA 4XQ8A 4DSFA 2PFQA 3RH4A 4I2HA 2BQRA 4KLOA 3C1ZA 1T8EA 4NXZA 3MFHA 2F1HA 5J0WA 2W8LA 5KFBA 5DB8A 4PH5A 1ZQAA 5KG6A 2JEFA 3RB3A 1S76D 4O3QA 1RPLA 3MGIA 4J9SA 4F5OA 4DS4A 5KFYA 4RQ7A 4QZ8A 2BGWA 2XO7A 4ELUA 9ICIA 4GC7A 1ZQCA 5KFTA 3E2EA 3GV8B 5KFXA 4FS1A 5CB1A 2BCVA 4DSJA 4ECUA 3V6JA 1SL1A 2PXIA 1ZQJA 5KG4A 3AU6A 3Q8LA 2ASLA 5IIJA 4O3NA 1V9PA 4GXKA 1JN3A 4QZDA 3MDAA 3RRHA 3T5KA 2BCSA 1L3TA 1ZQEA 2J6TA 1RXWA 9ICGA 5KFEA 3QZ8A 4RQ1A 2F1JA 2FLPA 2HHXA 3TFSA 4ELTA 3B0XA 3ZDAA 3G6VA 3SV3A 4QZGA 3HPOA 4NLKA 8ICXA 1KSPA 5J0RA 3ISDA 3Q8QB 1LB2B 1KFSA 1Z00B 1KDHA 3PR4A 8ICAA 5J0PA 4DLGA 5HNKA 4MFCA 4YG2A 5CWRA 2ISOA 2PI4A 4YMNA 5EOZA 3TAQA 2PFPA 2A1JB 5KFWA 4O3RA 1NK6A 2I1QA 4TUSA 2V4QA 2MUTB 2BQUA 1UA1A 1NK8A 3MBYA 9ICQA 1S97A 4F2RA 2AQ0A 4NM2A 5TZVA 1RYRA 4M2YA 4QZIA 1NKBA 3TFRA 4F5RA 2P6UA 1BPDA 5D49A 4DOCA 1ZQXA 2C2RA 3H8SA 4I28A 4QWAA 4F4WA 3G6YA 4M6WA 2HVIA 3M9OB 5HMLA 3MR3A 4BXOB 3KHRA 1TAQA 1COOA 4ED3A 1SKRA 1DOQA 4F92B 5CHGA 4DO9A 4NM1A 2HHVA 4B9VA 1NOMA 2NRTA 5IIKA 5DQIA 3ETLA 4RPXA 1TK0A 1SL2A 4I2CA 5DDMA 2W9BA 5KG2A 4PPXA 4QZFA 4KLIA 1L3UA 2ASDA
chains in the Genus database with same CATH superfamily
8ICSA 2XY5A 4JUZA 2FPLA 1C20A 1GO3F 3WKDA 4MF2A 4IL6U 1PK1B 3NVWA 2IHNA 4J9PA 1HJPA 1TAUA 3PW5A 4KX3A 1A6SA 9ICBA 3M8RA 3GZFA 2JHDA 8ICRA 3SQIA 2HBJA 1SV0A 3R9KA 4Y2VA 2RLTA 4I2IA 4PGXA 4BJQA 1RXVA 3V7KA 4K4HA 3JPSA 2D3DA 2LHTA 1U47A 4RPYA 1QCKA 4F71A 3RAXA 3H8WA 2JXJA 1SKSA 4M9HA 2F76X 4F91B 2KZZA 2R18A 2ZUDA 1OW5A 4B9SA 4Y2TA 2DFLA 2I6XA 1N61A 2O6KA 4RQMA 1KRPA 5J0SA 7ICOA 5AI9A 4B9TA 5KFNA 4M04A 1YZ7A 8ICYA 1D8LA 5KFZA 3OSPA 1FFUA 1WYGA 2DGZA 3H40A 2G5IB 3RJHA 5KFFA 7ICLA 4KLFA 7ICMA 3LWLA 3C29A 2G09A 1XSPA 4RUCA 8ICTA 1D8BA 2DPIA 3FAHA 1DGJA 5GTIU 4Q8EA 2HHWA 4O3PA 2BDPA 3RB4A 2ZIXA 4FS2A 1KFTA 3KZXA 4RQ3A 5HHIA 2JZBA 5EWGA 5KNIA 3N7SC 1TV9A 5KG3A 1XWLA 5AI4A 5AM0A 9ICNA 1JIHA 1PZNA 1WWUA 1X6IA 5KFJA 5AM5A 2W9AA 2JH7A 2DUYA 4JWMA 4NV0A 4DL6A 3RH6A 1S0OA 2HSZA 5KFPA 2ZIUB 4PZOA 1SXDA 2AGPA 4M0AA 4B9MA 2W04A 5KT3A 2ZUCA 1ECWA 2MRLA 4A8EA 3KKAA 4U6PA 5BOLA 4DLEA 2XGQA 1Z00A 2GWSA 4IQUA 1RYUA 3MGHA 4K4IA 2FMPA 2DL0A 3QEAZ 5KFOA 5ALLA 5ALOA 4RUAA 4YXMA 4XRHA 4ED1A 1TAMA 1ZQSA 3T5LA 4J9NA 5AK5A 2QB0B 3AM9A 4QZCA 4K4GA 2JH1A 4ECVA 3IHQB 7ICRA 3WK5A 2HBKA 3PSPA 2CRXA 5KG1A 3KD3A 3KHLA 3PNCA 1UT5A 1ZRNA 3QX7A 2EAMA 2HHTA 4YMMA 2DWQA 4YVZA 3LVVA 2F8KA 3VC8A 4O3MA 3PSIA 1U48A 4C4RA 1SZHA 3PX4A 3SV4A 2YQEA 4RT2A 2Y1JA 1V38A 1RZTA 8ICFA 1FEZA 2NRVA 1WCNA 3WK4A 3H4DA 3RBDA 1ZQIA 1T94A 4GXIA 4DQQA 1ZQMA 4JV1A 4M6WB 4DL3A 1DGSA 1ZQQA 3GQCA 3PV8A 1QSLA 5J2AA 4O0IA 5AI0A 5J2BA 3PY8A 1KKXA 7ICSA 5DB9A 4JK1A 3OHAA 4P0PB 1U9LA 4AYBC 3OJUA 1KN5A 5AKHA 3RJIA 3DV9A 3ALRA 3QZ7A 1XO0A 4PL2A 1ZQHA 4Z6DA 1YZ6A 2G0AA 4UB4A 4Q44A 4KLLA 2UVRA 3DEEA 4FO6A 2XI9A 3M8SA 5DB7A 5KTQA 4DQIA 2QB1A 4QZ9A 1WWVA 5KG7A 3OJSA 4C8OA 3PO5A 4M47A 2F1IA 3H0LB 5E79U 1A0PA 5AK4A 1BPBA 4YFKA 1X9WA 3EYZA 3AQFA 4EBCA 2WTFA 1ZD5A 5IIIA 4Q43A 4O5KA 1XSNA 2KJ5A 2ZIVA 5DDYA 8ICPA 1QSYA 5DLFA 4QWCA 1MQ2A 4IQWA 3I1YA 3SAGA 3Q8PB 1L7PA 2KJ9A 4UW9A 4F93B 2KEYA 4I2AA 1U45A 2ZIWB 2PMZF 5F9NA 2ZJ8A 4TQSA 3GFKB 2W11A 4O3SA 4RQ4A 2PKEA 3RJFA 4PGYA 1IG6A 5ALZA 1SXEA 4J9QA 4C0ZA 4Y2QA 3QNMA 2ESEA 4R8UB 4KLDA 4US9A 5EE1A 3WK7A 1JUDA 3BS7A 4FFDA 2E1FA 2KVSA 3AL0B 4KLTA 3C23A 2C2DA 4XA5A 1S77D 4RNMA 2W54A 1VLBA 2WFAA 1O03A 2A19A 4RQ2A 3GIKA 3BQ1A 2ZG6A 5HMMA 1N5WA 8ICJA 3HWTA 3UMCA 1CRXA 2EAOA 2G08A 3M9MB 3EPGA 1J97A 2PFQA 4BX9C 2HCFA 2BQRA 3C1ZA 2Z7JA 2W8LA 5DB8A 4PH5A 2JEFA 2KKPA 1S76D 3MGIA 5KFYA 4GC7A 1ZQCA 3GV8B 3CYMA 2BCVA 1SWWA 3V6JA 2PXIA 1ZQJA 4GXKA 1JN3A 2HBLA 5AKKA 2BCSA 3NRWA 2J6TA 3TFSA 3ZDAA 3H0RB 1X42A 4QNLA 2EDUA 8ICXA 2IOFK 1KSPA 3ONNA 1LB2B 3PR4A 5J0PA 4MFCA 3SR6A 4B6JA 3ED5A 2PI4A 4YMNA 2A1JB 5CRXA 4O3RA 1NK6A 2I1QA 3PZPA 4G9BA 1NK8A 3IDWA 3MBYA 9ICQA 2GO7A 1BNPA 2E5SA 4NM2A 4F5RA 1BPDA 1ZQXA 3H8SA 4I28A 2HVIA 4UARA 3M9OB 2P35A 1XNSA 2WF9A 3MR3A 4BXOB 1IIPA 4NM1A 1SKRA 4F92B 4B9VA 4CE6A 4Y2JA 1MN8A 1TK0A 4I2CA 3QU2A 5DDMA 4ED0A 4MEXA 2G07A 2YB1A 5DG9A 2MA1A 3BS5A 4IQVA 1ZQPA 4YN4A 4F72A 2R8GA 1NZBA 1N62A 5ALHA 2K4PA 3JPPA 2ZJAA 2H3IA 5KT4A 5KG0A 3BQ7A 2C2EA 2WF6A 1ZQWA 1HIWA 1ZD3A 5G5HA 4OJ6A 3RTVA 4ECQA 2YX8A 2FMSA 5L1LA 1X6JA 4KLMA 4P0QA 4TUQA 1KL9A 2IA6A 4F2SA 4KLJA 2YB4A 3C28A 4R64A 4Q8FA 1CEZA 3KTQA 5CJ7A 5CP2A 4PHAA 4CRXA 4CNQA 3EPIA 8ICCA 3AEVA 4DSLA 3TAPA 2BR0A 1TE2A 1NJWA 2QLTA 4UQGA 5KFGA 1B4FA 4CGZA 3UXPA 4YMOA 2W7PA 3SD7A 4KLUA 1NJXA 5J8YC 3RR7A 2FPKA 5ALXA 4XUSA 3RF9A 4NL9C 2ODGA 1B0XA 2C28A 3PX0A 4ZH4A 2YN4A 3GILA 2AGQA 4B9UA 2LM4A 3NVYA 1X40A 4EYIB 3A0HU 3ISBA 3WK6A 2XIDA 2HBMA 3C5FA 4C8LA 4BWJA 2NRWA 1XC9A 4CF3A 3GV7B 1N48A 2W3RA 3RB6A 1TK5A 1IV8A 4I2EA 3GIMA 3QEBZ 4LVSA 3OTQA 4QWEA 7ICGA 3JPNA 2DPJA 3J81j 1TFRA 1UA0A 1FIQA 1LV5A 1Z1VA 5KT2A 2Y0SC 1UCVA 4J9OA 1ZQBA 4QZAA 1CUKA 4UB1A 2QKQA 5L9XA 2DKXA 1JXLA 1FO4A 3PW2A 4GIBA 3OSNA 3CRXA 3PSTA 3I76A 1UT8A 3KHGA 9ICLA 2EZYA 5C5JA 4NLGA 2EH9A 3T79A 1S9FA 1SL0A 2BHNA 5J0UA 4FZNA 4FBUA 4KLHA 3UQ2A 4DL5A 1O08A 2B21A 1C7YA 5J2KA 2W9MA 4RQ8A 1N60A 4DFPA 3UMGA 5AIBA 1UHUA 3TKAA 3MDCA 2WB1F 2MUTA 4NWIA 2LI6A 3HJEA 4UAWA 5ALGA 1JROA 2V9WA 2IBKA 5ALWA 4QZEA 5AM1A 5DQHA 4IQTA 2UVWA 8ICZA 9ICMA 1D8YA 4JV0A 4DS5A 4BWMA 5HR7A 2WB1C 2KZMA 4R66A 5KL8B 8ICEA 3ZDDA 5KFSA 2KSOA 4DFJA 1SWVA 4RQ5A 9ICCA 1JI7A 5EE3A 1BPEA 1NI3A 2EZXA 1RYSA 4FE3A 2IOFA 1DRGA 1F5SA 2BZFA 4Z6EA 1NK4A 2AXTU 3THVA 2KFZA 5ALPA 2W3SA 2W9CA 3HT3A 4QZBA 3PO4A 1BPYA 2F77X 1S0VA 4UATA 3MR2A 5KFLA 4O5CA 4WJ3B 3V6HA 1RQLA 9ICEA 1J2NA 2CXYA 3RH5A 3JPQA 3AU2A 1T4GA 5KFCA 1ZQ1C 1Z3EB 1BGXT 4NLBA 2BPFA 3N97B 2GOLA 3QYPA 2AJQA 3G6XA 4DL2A 4MEYA 2RP5A 5KL1B 7ICFA 4DSEA 2HW3A 2HMXA 5ALSA 2PFOA 1JXEA 5J2GA 3SZ2A 2P6RA 3PW7A 1IXRA 2MSNA 4RNOA 4KLGA 3H8JA 4OCZA 5CA7A 4ECXA 4C7YA 1S8OA 8ICVA 5G5GA 1A77A 5AKLA 1PK3A 1S10A 4C4TA 2KE7A 4EEYA 4M9NA 2HHSA 1B22A 4EBEA 3BDPA 1Z1BA 1ZYQA 3N4MB 1NK9A 3K1RB 4Y2PA 2BKEA 4YR2A 4YR3A 1ED1A 2N1RA 3QUTA 4RPZA 1QQ5A 4UB3A 3EUB2 1YT3A 3FM9A 5KAFU 3F2DA 2B6GA 5J8YA 1QLNA 1NZPA 2IOHA 5KFKA 4NL9A 4E0DA 4LZDA 4KLSA 1EXNA 2K8CB 1LKYA 3O0FA 2KN7A 4TUPA 5D46A 5DBCA 4IC9A 3PW0A 1L8LA 7ICUA 4YD2A 2UVVA 2JR5A 1KQQA 1JX4A 4UBBA 1U4BA 2XY7A 2I9GA 1K5OA 2VANA 4DEZA 4ECTA 2NYVA 4IRKA 4F4YA 3KHHA 3L3FX 4F5QA 2JMGA 4PJ0U 4DQRA 3ISCA 4ICAA 2ZIXB 3AQEA 4AYBF 1TKDA 1SKWA 4RNNA 2K60A 1ZQVA 2JZBB 1HEKA 2OWOA 4F8RA 4LZGA 1F0MA 4KLOA 2A1AA 3MFHA 1T8EA 5AM3A 3WKCA 1JALA 4J9SA 4F5OA 2OH2A 4NJ8A 3ETRA 2OM6A 4QZ8A 2XO7A 4ELUA 4ZOHC 5AM4A 4DSJA 1NNLA 2ASLA 1RDFA 3I28A 1L3TA 1OXJA 3ZI4A 1RXWA 2F1JA 4ELTA 5AKJA 3Q8QB 1Z00B 8ICAA 1CI4A 2H3ZA 3L4PA 5HNKA 1MA7A 3OPXA 5EOZA 3TAQA 1COKA 5AKIA 2E1EA 2KHVA 2KP7A 2BQUA 2AQ0A 5TZVA 1NKBA 5D49A 2C2RA 2D8CA 2E8PA 4QWAA 2F2AB 5HMLA 2CN1A 1COOA 1M6YA 4ED3A 2XVTA 2HHVA 5IIKA 5DQIA 3ETLA 4RPXA 1KW4A 2W9BA 2VJ5A 5AK3A 1Z19A 1SZPA 1SGGA 4O9MA 3E0FA 2KIWA 4GC6A 4HAIA 2ZXIA 2YMLA 4RQ6A 4J03A 2DKZA 1DK3A 4IRDA 2EAPA 3CW2C 3AN1A 4IR9A 2RRDA 3QU7A 2BCRA 2ZTEA 3BQ0A 2FE9A 1K1SA 3SYZA 3MR5A 1ZQFA 1Z4NA 4NLZA 1BVSA 5KFVA 4F5PA 4IR1A 5ALUA 4PHPA 1B43A 4CF4A 2OYYA 4EYHB 1S0MA 3H0MB 2H5XA 1JMSA 1MC8A 3GV5B 2NRXA 5KFUA 1ZQRA 5EWEA 5EWFA 3AMZA 5HP4A 1NKEA 1WCLA 4OJLA 3KFUF 1ZQKA 3K4GA 5ALTA 5J0QA 1N56A 3L5KA 3U26A 5IILA 4CDGA 2A3VA 8ICWA 4R63A 3IP4B 3VCBA 4F4XA 1QSSA 9ICFA 1S0NA 1SIJA 4ECZA 5DG8A 3GIJA 1L5UA 4KLQA 1URJA 1SV0C 4M9JA 7ICNA 2ZJ5A 3RR8A 4GLXA 3FDSA 3D2NA 3JPTA 1IM4A 5D4BA 5IIMA 2ZIVB 2ZXHA 4I27A 3SAHA 3IG5A 3Q8MA 4O5EA 4M9GA 4YR0A 2RHFA 3KOOA 3JPOA 3NS1A 2RQ5A 9ICKA 4OD0A 2KOBA 2F3NA 5EE0A 3UXOA 1NK0A 7ICIA 2CPRA 3M6ZA 2FDRA 4C8NA 5L1KA 5CR0A 2FI1A 2WAQF 4FZMA 9ICAA 4C8KA 3D2SA 3QUQA 3NGDA 2E8MA 3S6JA 5ALFA 4AP9A 4NLNA 7ICKA 4EENA 2YY6A 3UM9A 5KFRA 2IHMA 4P4MA 2XC9A 1Q8KA 4KN7A 8ICHA 1Q3VA 2WAQC 4I29A 4DOBA 5ALEA 4UASA 4QZHA 1VJ5A 3SMVA 4PPXA 3LK9A 1QTMA 3ORYA 4EZ6A 4J9KA 4USAA 4EZ9A 4F3OA 3H4BA 1A76A 1N63A 1AROP 3N7PD 4PGQA 1NK7A 1D9FA 7ICQA 3C2MA 3BQTA 2KZ3A 2K4IA 4ECSA 4YP3A 2XCAA 5JTIA 5C0YA 3HW8A 1PVPA 4UB5A 3F53A 5KFIA 2FLLA 1Q46A 3B0YA 5HHHA 3IM1A 1Z4OA 1P7DA 5IIOA 2QARA 2DQNB 2K8AA 4BDPA 1L3VA 2V4RA 5AIAA 2ZTDA 2K4HA 4MHVA 2W55A 2AH5A 2VA2A 4I2JA 3F5AA 4DL4A 1PK1A 3C21A 9ICWA 9ICOA 1KTQA 3HP6A 2DBYA 2VKQA 1FFVA 3KKAC 1VDVA 9ICSA 5L1JA 2YMQA 2W8KA 5CEHA 3RJGA 2FJ6A 3RJEA 5J0XA 2D6FC 2K8BB 5ALIA 2HHQA 1NJZA 2GH1A 4MF8A 4PHDA 5DG7A 4UBCA 4DF8A 3H7IA 2W7OA 1XSLA 1ZQGA 2OEHA 1DXSA 4DQPA 2Y0SF 2HDOA 3QU9A 7ICHA 5ALDA 5JU5A 2NRZA 2GLEA 3MFIA 4F4KA 5DLGA 4TURA 1V97A 3IG8A 3OHBA 5BPCA 1PVRA 1UQVA 3JPRA 4F5NA 3BS5B 5J0OA 1TVAA 3M7DA 2KHQA 8ICGA 8ICOA 4EX6A 4U7CA 3BJYA 2UVUA 2ISPA 4QWBA 2J6SA 4G3IA 2L5YA 9ICXA 8ICQA 5ALMA 5ALNA 4I2DA 2ES6A 2EANA 4TQRA 4UAVA 2AGOA 4PL1A 4RZRA 4P0QB 4QIWC 2NO5A 2ALZA 3LWMA 2NO4A 1XU4A 3RBEA 1MQ3A 2E3TA 3RFAA 2XGPA 2K4EA 5GTHU 3LYSA 1LVHA 2Y1IA 2ASJA 1L7NA 3UXNA 2EQYA 1QH9A 3M1YA 5DGBA 1RM6C 5ALVA 5L1MA 5KG5A 3V7LA 3C1YA 5J29A 4DSIA 5H2FU 4UB2A 3C2KA 3QE9Y 1JRPA 4Q45A 1BPZA 2Q4TA 3Q8RB 2LYBA 4NLCA 4ELVA 2BQ3A 8ICNA 1T7PA 3HILA 5JUMA 4ECYA 5J2IA 3RJJA 2HOIA 1S5LU 2RDIA 2RDJA 1ZJNA 5J0YA 5J2JA 1NK5A 5KAIU 2JRZA 2ZIUA 4KN4A 4JV2A 4ED6A 3NRZA 3TI0A 3RJKA 2W03A 3NVVA 3M6KA 3WKBA 4DWIA 2KK0A 2VA3A 5AK6A 1ZQLA 3OGUA 2BCQA 3F2BA 4GFJA 2BPCA 5DBBA 4EBDA 2KD1A 3RRGA 3T5JA 4XQ8A 4DSFA 4I2HA 2QB0A 2DF4B 3WKEA 5J0WA 5ALJA 4KX5A 5KG6A 3RB3A 4O3QA 1RPLA 4DS4A 4RQ7A 4UB8U 5KFTA 3E2EA 5KFXA 4FS1A 5CB1A 2YMPA 4ECUA 1SL1A 5KG4A 3AU6A 5IIJA 1V9PA 3T5KA 5KFEA 4RQ1A 2FLPA 3B0XA 3G6VA 4ACOA 3SV3A 3TADC 5AI5A 1KDHA 2G5HB 3F5EA 5CWRA 2ISOA 2PFPA 5KFWA 1ZRMA 4TUSA 2V4QA 2MUTB 4FZLA 4F2RA 2G06A 4M2YA 4QZIA 3TFRA 2P6UA 4DOCA 4OJ5A 1L7MA 4F4WA 3G6YA 4OJOA 4M6WA 1PVQA 3LVWA 5K4LA 1DOQA 4DO9A 1NOMA 3QU4A 2WF8A 1SL2A 4P0PA 5KG2A 4QZFA 2KNJA 1L3UA 2ASDA 5B5EU 5KT6A 5J0TA 2KSOB 4HYKA 2ATLA 4Y2SA 1HUOA 4KLEA 2KV2A 3TACB 1ZQOA 4YXJA 4IS7A 3IRUA 4Z6FA 5AM2A 5KFDA 2E8OA 9ICJA 4UAZA 4DCCA 1RG6A 4JMUA 2W9CB 1U49A 3SI8A 8ICMA 4Y2UA 4KMUA 5TISU 4JWNA 5ALKA 4J9RA 1NKCA 4M9LA 4DSKA 4C4SA 3EZ5A 4F4ZA 1N2XA 3N28A 1ZD2P 4X5VA 2WF5A 5KFAA 2VIXA 3SAFA 5AKZA 3HRDD 3RB0A 8ICKA 5DKWA 4P4OA 5DQGA 9ICUA 1H38A 4R65A 3AUOA 2HHUA 2BPGA 5FP0A 2Y9UA 3LDAA 5DB6A 4ECWA 2ZIWA 3KZIU 4UAYA 1ZQZA 1KFDA 5T14A 1SB3C 1X2IA 2IMWP 3HKZF 5IINA 5J2CA 3V7JA 3WKAA 4Z6CA 2M9NA 4QW8A 1L6NA 1ZQDA 3BZCA 2JEGA 4Y2XA 1ZQYA 4R8UA 2LKYA 4FBTA 4J9LA 2P66A 4PHEA 1KLNA 3PMLA 1XS9D 3EWAA 1ZD4A 2MAXA 8ICLA 3UMBA 3HKZC 2JEIA 9ICHA 2VJ4A 1RQNA 3K75D 4YCXA 2I5HA 3QUCA 9ICVA 1ZQUA 4EEKA 4KMOB 4DL7A 2YTUA 2R8KA 2F44A 8ICUA 3MABA 3NTUA 4BUGA 4CCHA 4J9MA 3C5GA 4RQ0A 3ZD8A 2KTQA 5AKYA 1NJYA 1L3SA 3IV6A 2JV3A 2LYAA 3PW4A 4EELA 4DFMA 1LKYB 3WK8A 3DDHA 5ALQA 4DQSA 3QUBA 1UPHA 3TQ1A 3ZDEA 1KEJA 2AU0A 3K1ZA 1T3QA 2LM1A 2F8LA 2PI5A 7ICJA 5AKXA 1X9MA 3BQ2A 3GU3A 1HUZA 1X66A 1AQ6A 1X9XA 4OJPA 2H3QA 1TK8A 3PMNA 1WG8A 1WUDA 5AICA 3Q8SB 4ECRA 4GXJA 2A1JA 5J2FA 1Y88A 2AHOB 7ICPA 3NVZA 7ICEA 1BPXA 2LBOA 3E58A 5BOMA 4BGDA 1K1QA 4YD1A 3RAQA 4ED7A 4BXOA 2LYHA 4NY8A 2HI0A 2PMZC 1ZETA 4OO1J 3MGVA 4P2HA 5L1IA 1L7OA 1SV4A 2KG5A 3BZKA 5J2EA 4I2GA 1PUZA 4MFFA 4KITB 1ZOLA 4JB3A 2M0NA 5KFMA 4Y2YA 3TARA 2NV3A 4C8MA 3ZDBA 1T3NA 3TADA 2HOFA 3T3FA 4B9LA 4UAUA 3T5HA 4RU9A 3UQ0A 2AQ4A 3MR6A 3NUQA 5KFHA 3PSFA 3GIIA 1V85A 2KIVA 2XCPA 4KTQA 7ICVA 1ZQTA 4I2BA 4UB6U 2XY6A 5B66U 4B9NA 4Y2RA 3ZDCA 2WHEA 3QU5A 5KT7A 1F44A 5AKEA 3H8MA 4CF5A 4QJFB 3V72A 2LMRA 2W9BB 5AHXA 2R8JA 3GDXA 3ICXA 9ICRA 4IRCA 2H3FA 2EZZA 4EX7A 2ZTCA 2Y9TA 1KBUA 2C22A 4ED2A 3NASA 4O3OA 2FLNA 8ICIA 2BCUA 3Q8KA 2B0CA 9ICPA 5DBAA 1ZJMA 4DOAA 2HVHA 3TANA 2PFNA 4YQWA 2OHFA 2JGAA 2WF7A 3WU2U 5AKGA 4P4PA 3V6KA 2KVCA 1ZQNA 3C2LA 3FC4A 5AI8A 4LJXA 2FPMA 3PR5B 2R8HA 2H3VA 3PX6A 9ICTA 4F50A 4RT3A 2OCEA 3UPQA 3CNHA 3N7RC 4ED8A 4C80A 2ZUBA 5F3XB 2XICA 5F9LA 5DGAA 4I2FA 8ICBA 2KJ8A 1XO1A 2VA8A 5J2HA 4DF4A 3FYHA 5HR6A 3ZD9A 2FMQA 2JEJA 1QQ7A 5ALRA 3D2QA 3D6JA 5A0LA 4RQNA 5JRTA 7ICTA 3WK9A 1L8OA 4DFDA 4DFKA 4QW9A 2W43A 1DK2A 1X9SA 5KT5A 2J6UA 1MSWD 1N5XA 4C7ZA 3PVXA 5J2DA 2R8IA 4QWDA 4MFAA 3B9JA 3M9NB 2LPEA 3EW9A 2Q0ZX 5KFQA 3RH4A 1ZXIA 2BDUA 4NXZA 2F1HA 3SENA 5KFBA 1ZQAA 3IN5A 5EE9A 2OXOA 2HOQA 2BGWA 1Q3UA 9ICIA 1BNOA 2E8NA 3MC1A 3F2CA 3Q8LA 4O3NA 3MDAA 4QZDA 3RRHA 1ZQEA 4QIWF 9ICGA 2KICA 3QZ8A 4PZNA 2HHXA 4QZGA 3HPOA 4NLKA 3A0BU 2YMMA 5J0RA 3KBBA 3ISDA 1QQ6A 1KFSA 4DLGA 2KKVA 1J2MA 4YG2A 1UA1A 1S97A 1RYRA 2KMDA 3SEIA 3QXGA 1OUQA 2MU2A 3CP8A 4US8A 3KHRA 1TAQA 5CHGA 2QARB 2NRTA 5AI6A 2K89A 3HX0A 5ALYA 1D9DA 4KLIA 2KFNA
chains in the Genus database with same CATH topology
5KT6A 4ED0A 2XY5A 4MEXA 4JUZA 8ICSA 5J0TA 5DG9A 2FPLA 4HYKA 2ATLA 4IQVA 1ZQPA 4MF2A 1SZPA 1HUOA 4YN4A 2R8GA 4KLEA 4O9MA 1ZQOA 4YXJA 4GC6A 3JPPA 2ZJAA 4Z6FA 5KT4A 2IHNA 5KFDA 4J9PA 4RQ6A 5KG0A 9ICJA 4UAZA 1HJPA 2C2EA 1TAUA 3PW5A 4IRDA 1ZQWA 2W9CB 1U49A 3SI8A 8ICMA 3RTVA 4ECQA 4KMUA 4JWNA 4IR9A 2FMSA 5L1LA 9ICBA 3M8RA 4J9RA 2BCRA 8ICRA 2ZTEA 4KLMA 3BQ0A 1NKCA 4M9LA 4DSKA 4TUQA 3EZ5A 1K1SA 4F4ZA 2IA6A 4F2SA 3SYZA 4I2IA 4KLJA 3MR5A 4PGXA 1RXVA 4X5VA 3V7KA 5KFAA 4R64A 4Q8FA 1CEZA 1ZQFA 4K4HA 3KTQA 4NLZA 1BVSA 5KFVA 4F5PA 5CJ7A 4IR1A 3RB0A 5CP2A 4PHAA 4PHPA 8ICKA 3JPSA 1B43A 5DKWA 4P4OA 3EPIA 8ICCA 1U47A 5DQGA 4EYHB 4RPYA 3HX0A 3TAPA 1S0MA 4DSLA 1H38A 9ICUA 3RAXA 2H5XA 1JMSA 1MC8A 4R65A 3AUOA 2BR0A 2HHUA 3GV5B 2NRXA 3H8WA 5KFUA 1ZQRA 5EWEA 1NJWA 4UQGA 5EWFA 2BPGA 5HP4A 5KFGA 1SKSA 1WCLA 1NKEA 4M9HA 4F91B 3LDAA 2ZUDA 1ZQKA 5DB6A 4ECWA 2KZZA 4B9SA 3K4GA 5J0QA 1N56A 4UAYA 5IILA 1ZQZA 2DFLA 3UXPA 1KFDA 4YMOA 4KLUA 1NJXA 1KRPA 1X2IA 2IMWP 8ICWA 4R63A 5IINA 3RR7A 5J0SA 7ICOA 2FPKA 5J2CA 3V7JA 4B9TA 4XUSA 5KFNA 4M04A 2C28A 8ICYA 4Z6CA 1D8LA 2M9NA 4ZH4A 4QW8A 4F4XA 3PX0A 1S0NA 5KFZA 3GILA 2AGQA 3OSPA 4B9UA 4ECZA 1ZQDA 5DG8A 2JEGA 3H40A 3GIJA 1L5UA 1ZQYA 4R8UA 4FBTA 4J9LA 4EYIB 2P66A 4KLQA 3ISBA 4PHEA 3RJHA 1KLNA 5KFFA 4M9JA 7ICNA 3PMLA 7ICLA 1XS9D 2ZJ5A 3EWAA 4KLFA 2MAXA 7ICMA 8ICLA 3RR8A 2JEIA 3LWLA 9ICHA 3C5FA 4C8LA 4GLXA 3FDSA 4BWJA 2NRWA 3K75D 1XC9A 4YCXA 3JPTA 1IM4A 5D4BA 3GV7B 5IIMA 1N48A 1XSPA 9ICVA 3RB6A 4RUCA 4I27A 8ICTA 1ZQUA 1TK5A 4I2EA 3GIMA 3QEBZ 2DPIA 4LVSA 4DL7A 4QWEA 3Q8MA 2R8KA 4M9GA 4O5EA 7ICGA 3JPNA 4YR0A 2DPJA 4Q8EA 2HHWA 8ICUA 4O3PA 3JPOA 1TFRA 3MABA 3NTUA 2BDPA 4CCHA 3RB4A 4J9MA 1UA0A 9ICKA 1LV5A 3C5GA 4FS2A 4RQ0A 1KFTA 3ZD8A 4RQ3A 2KTQA 5HHIA 3UXOA 2JZBA 5KT2A 5EWGA 1NK0A 1TV9A 7ICIA 9ICFA 5KG3A 1NJYA 4J9OA 1XWLA 1L3SA 1ZQBA 4C8NA 5L1KA 5CR0A 4QZAA 1CUKA 9ICNA 4UB1A 1JIHA 9ICAA 1PZNA 4C8KA 5L9XA 3NGDA 1JXLA 3PW4A 3PW2A 5KFJA 2W9AA 3OSNA 4DFMA 4JWMA 4NLNA 1UT8A 4DL6A 3RH6A 7ICKA 1S0OA 5KFPA 3KHGA 5KFRA 4DQSA 9ICLA 5C5JA 2AGPA 4M0AA 4NLGA 1S9FA 1SL0A 4P4MA 2XC9A 2IHMA 4B9MA 3TQ1A 4KN7A 5KT3A 2ZUCA 2BHNA 3ZDEA 1KEJA 8ICHA 2AU0A 5J0UA 4I29A 4FBUA 4KLHA 4DOBA 2PI5A 7ICJA 3UQ2A 4DL5A 1X9MA 4QZHA 3BQ2A 1HUZA 5BOLA 2B21A 1C7YA 4DLEA 2XGQA 1Z00A 5J2KA 3LK9A 3PMNA 1TK8A 1QTMA 2W9MA 4RQ8A 3ORYA 4IQUA 2GWSA 4EZ6A 4DFPA 2KFNA 4J9KA 3Q8SB 4EZ9A 3MGHA 3H4BA 4ECRA 4F3OA 1A76A 4GXJA 2FMPA 1AROP 4K4IA 3QEAZ 4PGQA 2A1JA 5J2FA 3MDCA 5KFOA 1NK7A 1Y88A 3C2MA 1D9FA 7ICQA 7ICPA 3BQTA 2MUTA 4RUAA 4YXMA 4UAWA 4XRHA 2KZ3A 4ED1A 7ICEA 1ZQSA 4ECSA 3T5LA 4J9NA 4YP3A 2XCAA 1BPXA 2V9WA 5BOMA 3HW8A 4BGDA 1K1QA 4YD1A 3RAQA 4ED7A 2IBKA 4QZCA 4UB5A 4QZEA 5KFIA 2FLLA 3B0YA 4IQTA 5HHHA 5DQHA 3IM1A 4K4GA 4BXOA 2LYHA 2UVWA 4NY8A 8ICZA 4ECVA 3IHQB 5IIOA 9ICMA 7ICRA 1D8YA 4JV0A 4DS5A 5KG1A 4BWMA 4BDPA 1L3VA 2V4RA 3KHLA 2ZTDA 3PNCA 1UT5A 4R66A 1ZETA 2KZMA 4P2HA 8ICEA 5L1IA 3ZDDA 5KFSA 4DFJA 2VA2A 4I2JA 4RQ5A 2HHTA 9ICCA 5J2EA 4DL4A 4YMMA 1BPEA 4I2GA 4MFFA 1RYSA 4KITB 3C21A 9ICWA 9ICOA 4YVZA 1KTQA 5KFMA 3HP6A 3TARA 4C8MA 4Z6EA 1NK4A 3ZDBA 1T3NA 9ICSA 5L1JA 1U48A 3THVA 3T3FA 4B9LA 2KFZA 2W9CA 2W8KA 3SV4A 3T5HA 3PX4A 3RJGA 4RU9A 3HT3A 5J0XA 4RT2A 3UQ0A 4QZBA 2Y1JA 2AQ4A 1BPYA 3RJEA 3PO4A 1NJZA 1S0VA 2HHQA 3MR6A 4MF8A 3MR2A 1RZTA 5KFLA 5KFHA 4PHDA 8ICFA 3GIIA 5DG7A 4O5CA 2XCPA 4KTQA 2NRVA 4UBCA 1WCNA 3V6HA 7ICVA 9ICEA 4DF8A 3H7IA 1ZQTA 4I2BA 3RH5A 2XY6A 4B9NA 3H4DA 3RBDA 1XSLA 1ZQGA 1ZQIA 3JPQA 4GXIA 4DQQA 3AU2A 4DQPA 1ZQMA 4JV1A 1T4GA 4M6WB 1DGSA 5KFCA 3GQCA 4DL3A 1ZQQA 3ZDCA 7ICHA 3PV8A 2NRZA 5J2AA 5KT7A 4O0IA 1Z3EB 1QSLA 1BGXT 5J2BA 3MFIA 2BPFA 4F4KA 5DLGA 3N97B 3PY8A 5DB9A 3V72A 7ICSA 4TURA 3OHBA 4JK1A 3OHAA 5BPCA 2W9BB 1U9LA 2R8JA 3OJUA 3GDXA 2AJQA 3G6XA 3JPRA 4F5NA 3RJIA 4DL2A 4MEYA 5J0OA 1TVAA 9ICRA 4IRCA 3QZ7A 8ICGA 1ZQHA 8ICOA 7ICFA 4Z6DA 3BJYA 4DSEA 2UVUA 2ISPA 2ZTCA 4UB4A 4QWBA 2C22A 4Q44A 2J6SA 4ED2A 4O3OA 4KLLA 2UVRA 4G3IA 2HW3A 2FLNA 2PFOA 4FO6A 1JXEA 8ICIA 9ICXA 5J2GA 2BCUA 8ICQA 3M8SA 5DB7A 3SZ2A 3Q8KA 9ICPA 1D9DA 5DBAA 2P6RA 4I2DA 5KTQA 3PW7A 4DQIA 1IXRA 4QZ9A 5KG7A 3OJSA 4RNOA 4C8OA 4KLGA 4TQRA 1ZJMA 3PO5A 4DOAA 3H8JA 2AGOA 5CA7A 4ECXA 4M47A 3TANA 2PFNA 2HVHA 2F1IA 4RZRA 4YQWA 2ALZA 1BPBA 4YFKA 1XU4A 3LWMA 3RBEA 1X9WA 1MQ3A 4P4PA 3EYZA 8ICVA 2XGPA 3V6KA 4EBCA 2WTFA 1A77A 1ZQNA 3C2LA 1S10A 5IIIA 4Q43A 2Y1IA 2ASJA 4O5KA 1XSNA 3UXNA 5DDYA 8ICPA 1QSYA 2FPMA 5DGBA 5DLFA 4EEYA 4QWCA 4M9NA 2HHSA 1MQ2A 4EBEA 5KG5A 3BDPA 3PR5B 1B22A 3V7LA 4IQWA 3C1YA 2R8HA 1ZYQA 5J29A 3Q8PB 4DSIA 3N4MB 1NK9A 3PX6A 4F93B 4I2AA 4UB2A 3C2KA 3QE9Y 1U45A 2BKEA 9ICTA 4YR2A 5F9NA 4F50A 4RT3A 4Q45A 4YR3A 3UPQA 2ZJ8A 4TQSA 4RPZA 3GFKB 1BPZA 4UB3A 3Q8RB 4ED8A 4O3SA 2ZUBA 1QLNA 5F9LA 4ELVA 5DGAA 2BQ3A 4I2FA 4RQ4A 8ICNA 5KFKA 1T7PA 8ICBA 5JUMA 4ECYA 1XO1A 4PGYA 5J2IA 3RJFA 4E0DA 2VA8A 5J2HA 4DF4A 3FYHA 3RJJA 4J9QA 4LZDA 2RDIA 3ZD9A 4KLSA 2RDJA 1EXNA 2FMQA 2JEJA 4R8UB 1ZJNA 2KN7A 5J0YA 4TUPA 5D46A 4KLDA 5DBCA 5J2JA 1NK5A 4KN4A 3PW0A 4JV2A 4ED6A 7ICUA 4YD2A 2UVVA 3TI0A 3RJKA 7ICTA 1JX4A 4UBBA 1QSSA 4KLTA 3C23A 1U4BA 4DFKA 2C2DA 2XY7A 4QW9A 4DWIA 2I9GA 4XA5A 1X9SA 2VA3A 1S77D 5KT5A 4RNMA 2VANA 1ZQLA 2J6UA 4DEZA 4ECTA 4IRKA 3OGUA 1MSWD 3PVXA 4RQ2A 4F4YA 2BCQA 3GIKA 3KHHA 5J2DA 4F5QA 3BQ1A 5HMMA 2R8IA 4QWDA 4MFAA 3M9NB 2BPCA 4DQRA 5DBBA 4EBDA 3HWTA 3ISCA 8ICJA 3RRGA 3EW9A 1TKDA 1SKWA 4RNNA 2Q0ZX 1ZQVA 3M9MB 2JZBB 2OWOA 4F8RA 3EPGA 5KFQA 3T5JA 4LZGA 4XQ8A 4DSFA 2PFQA 3RH4A 4I2HA 2BQRA 4KLOA 3C1ZA 1T8EA 4NXZA 3MFHA 2F1HA 5J0WA 2W8LA 5KFBA 5DB8A 4PH5A 1ZQAA 5KG6A 2JEFA 3RB3A 1S76D 4O3QA 1RPLA 3MGIA 4J9SA 4F5OA 4DS4A 5KFYA 4RQ7A 4QZ8A 2BGWA 2XO7A 4ELUA 9ICIA 4GC7A 1ZQCA 5KFTA 3E2EA 3GV8B 5KFXA 4FS1A 5CB1A 2BCVA 4DSJA 4ECUA 3V6JA 1SL1A 2PXIA 1ZQJA 5KG4A 3AU6A 3Q8LA 2ASLA 5IIJA 4O3NA 1V9PA 4GXKA 1JN3A 4QZDA 3MDAA 3RRHA 3T5KA 2BCSA 1L3TA 1ZQEA 2J6TA 1RXWA 9ICGA 5KFEA 3QZ8A 4RQ1A 2F1JA 2FLPA 2HHXA 3TFSA 4ELTA 3B0XA 3ZDAA 3G6VA 3SV3A 4QZGA 3HPOA 4NLKA 8ICXA 1KSPA 5J0RA 3ISDA 3Q8QB 1LB2B 1KFSA 1Z00B 1KDHA 3PR4A 8ICAA 5J0PA 4DLGA 5HNKA 4MFCA 4YG2A 5CWRA 2ISOA 2PI4A 4YMNA 5EOZA 3TAQA 2PFPA 2A1JB 5KFWA 4O3RA 1NK6A 2I1QA 4TUSA 2V4QA 2MUTB 2BQUA 1UA1A 1NK8A 3MBYA 9ICQA 1S97A 4F2RA 2AQ0A 4NM2A 5TZVA 1RYRA 4M2YA 4QZIA 1NKBA 3TFRA 4F5RA 2P6UA 1BPDA 5D49A 4DOCA 1ZQXA 2C2RA 3H8SA 4I28A 4QWAA 4F4WA 3G6YA 4M6WA 2HVIA 3M9OB 5HMLA 3MR3A 4BXOB 3KHRA 1TAQA 1COOA 4ED3A 1SKRA 1DOQA 4F92B 5CHGA 4DO9A 4NM1A 2HHVA 4B9VA 1NOMA 2NRTA 5IIKA 5DQIA 3ETLA 4RPXA 1TK0A 1SL2A 4I2CA 5DDMA 2W9BA 5KG2A 4PPXA 4QZFA 4KLIA 1L3UA 2ASDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KT6 A;  4ED0 A;  2XY5 A;  4MEX A;  4JUZ A;  8ICS A;  5J0T A;  5DG9 A;  2FPL A;  4HYK A;  2ATL A;  4IQV A;  1ZQP A;  4MF2 A;  1SZP A;  1HUO A;  4YN4 A;  2R8G A;  4KLE A;  4O9M A;  1ZQO A;  4YXJ A;  4GC6 A;  3JPP A;  2ZJA A;  4Z6F A;  5KT4 A;  2IHN A;  5KFD A;  4J9P A;  4RQ6 A;  5KG0 A;  9ICJ A;  4UAZ A;  1HJP A;  2C2E A;  1TAU A;  3PW5 A;  4IRD A;  1ZQW A;  2W9C B;  1U49 A;  3SI8 A;  8ICM A;  3RTV A;  4ECQ A;  4KMU A;  4JWN A;  4IR9 A;  2FMS A;  5L1L A;  9ICB A;  3M8R A;  4J9R A;  2BCR A;  8ICR A;  2ZTE A;  4KLM A;  3BQ0 A;  1NKC A;  4M9L A;  4DSK A;  4TUQ A;  3EZ5 A;  1K1S A;  4F4Z A;  2IA6 A;  4F2S A;  3SYZ A;  4I2I A;  4KLJ A;  3MR5 A;  4PGX A;  1RXV A;  4X5V A;  3V7K A;  5KFA A;  4R64 A;  4Q8F A;  1CEZ A;  1ZQF A;  4K4H A;  3KTQ A;  4NLZ A;  1BVS A;  5KFV A;  4F5P A;  5CJ7 A;  4IR1 A;  3RB0 A;  5CP2 A;  4PHA A;  4PHP A;  8ICK A;  3JPS A;  1B43 A;  5DKW A;  4P4O A;  3EPI A;  8ICC A;  1U47 A;  5DQG A;  4EYH B;  4RPY A;  3HX0 A;  3TAP A;  1S0M A;  4DSL A;  1H38 A;  9ICU A;  3RAX A;  2H5X A;  1JMS A;  1MC8 A;  4R65 A;  3AUO A;  2BR0 A;  2HHU A;  3GV5 B;  2NRX A;  3H8W A;  5KFU A;  1ZQR A;  5EWE A;  1NJW A;  4UQG A;  5EWF A;  2BPG A;  5HP4 A;  5KFG A;  1SKS A;  1WCL A;  1NKE A;  4M9H A;  4F91 B;  3LDA A;  2ZUD A;  1ZQK A;  5DB6 A;  4ECW A;  2KZZ A;  4B9S A;  3K4G A;  5J0Q A;  1N56 A;  4UAY A;  5IIL A;  1ZQZ A;  2DFL A;  3UXP A;  1KFD A;  4YMO A;  4KLU A;  1NJX A;  1KRP A;  1X2I A;  2IMW P;  8ICW A;  4R63 A;  5IIN A;  3RR7 A;  5J0S A;  7ICO A;  2FPK A;  5J2C A;  3V7J A;  4B9T A;  4XUS A;  5KFN A;  4M04 A;  2C28 A;  8ICY A;  4Z6C A;  1D8L A;  2M9N A;  4ZH4 A;  4QW8 A;  4F4X A;  3PX0 A;  1S0N A;  5KFZ A;  3GIL A;  2AGQ A;  3OSP A;  4B9U A;  4ECZ A;  1ZQD A;  5DG8 A;  2JEG A;  3H40 A;  3GIJ A;  1L5U A;  1ZQY A;  4R8U A;  4FBT A;  4J9L A;  4EYI B;  2P66 A;  4KLQ A;  3ISB A;  4PHE A;  3RJH A;  1KLN A;  5KFF A;  4M9J A;  7ICN A;  3PML A;  7ICL A;  1XS9 D;  2ZJ5 A;  3EWA A;  4KLF A;  2MAX A;  7ICM A;  8ICL A;  3RR8 A;  2JEI A;  3LWL A;  9ICH A;  3C5F A;  4C8L A;  4GLX A;  3FDS A;  4BWJ A;  2NRW A;  3K75 D;  1XC9 A;  4YCX A;  3JPT A;  1IM4 A;  5D4B A;  3GV7 B;  5IIM A;  1N48 A;  1XSP A;  9ICV A;  3RB6 A;  4RUC A;  4I27 A;  8ICT A;  1ZQU A;  1TK5 A;  4I2E A;  3GIM A;  3QEB Z;  2DPI A;  4LVS A;  4DL7 A;  4QWE A;  3Q8M A;  2R8K A;  4M9G A;  4O5E A;  7ICG A;  3JPN A;  4YR0 A;  2DPJ A;  4Q8E A;  2HHW A;  8ICU A;  4O3P A;  3JPO A;  1TFR A;  3MAB A;  3NTU A;  2BDP A;  4CCH A;  3RB4 A;  4J9M A;  1UA0 A;  9ICK A;  1LV5 A;  3C5G A;  4FS2 A;  4RQ0 A;  1KFT A;  3ZD8 A;  4RQ3 A;  2KTQ A;  5HHI A;  3UXO A;  2JZB A;  5KT2 A;  5EWG A;  1NK0 A;  1TV9 A;  7ICI A;  9ICF A;  5KG3 A;  1NJY A;  4J9O A;  1XWL A;  1L3S A;  1ZQB A;  4C8N A;  5L1K A;  5CR0 A;  4QZA A;  1CUK A;  9ICN A;  4UB1 A;  1JIH A;  9ICA A;  1PZN A;  4C8K A;  5L9X A;  3NGD A;  1JXL A;  3PW4 A;  3PW2 A;  5KFJ A;  2W9A A;  3OSN A;  4DFM A;  4JWM A;  4NLN A;  1UT8 A;  4DL6 A;  3RH6 A;  7ICK A;  1S0O A;  5KFP A;  3KHG A;  5KFR A;  4DQS A;  9ICL A;  5C5J A;  2AGP A;  4M0A A;  4NLG A;  1S9F A;  1SL0 A;  4P4M A;  2XC9 A;  2IHM A;  4B9M A;  3TQ1 A;  4KN7 A;  5KT3 A;  2ZUC A;  2BHN A;  3ZDE A;  1KEJ A;  8ICH A;  2AU0 A;  5J0U A;  4I29 A;  4FBU A;  4KLH A;  4DOB A;  2PI5 A;  7ICJ A;  3UQ2 A;  4DL5 A;  1X9M A;  4QZH A;  3BQ2 A;  1HUZ A;  5BOL A;  2B21 A;  1C7Y A;  4DLE A;  2XGQ A;  1Z00 A;  5J2K A;  3LK9 A;  3PMN A;  1TK8 A;  1QTM A;  2W9M A;  4RQ8 A;  3ORY A;  4IQU A;  2GWS A;  4EZ6 A;  4DFP A;  2KFN A;  4J9K A;  3Q8S B;  4EZ9 A;  3MGH A;  3H4B A;  4ECR A;  4F3O A;  1A76 A;  4GXJ A;  2FMP A;  1ARO P;  4K4I A;  3QEA Z;  4PGQ A;  2A1J A;  5J2F A;  3MDC A;  5KFO A;  1NK7 A;  1Y88 A;  3C2M A;  1D9F A;  7ICQ A;  7ICP A;  3BQT A;  2MUT A;  4RUA A;  4YXM A;  4UAW A;  4XRH A;  2KZ3 A;  4ED1 A;  7ICE A;  1ZQS A;  4ECS A;  3T5L A;  4J9N A;  4YP3 A;  2XCA A;  1BPX A;  2V9W A;  5BOM A;  3HW8 A;  4BGD A;  1K1Q A;  4YD1 A;  3RAQ A;  4ED7 A;  2IBK A;  4QZC A;  4UB5 A;  4QZE A;  5KFI A;  2FLL A;  3B0Y A;  4IQT A;  5HHH A;  5DQH A;  3IM1 A;  4K4G A;  4BXO A;  2LYH A;  2UVW A;  4NY8 A;  8ICZ A;  4ECV A;  3IHQ B;  5IIO A;  9ICM A;  7ICR A;  1D8Y A;  4JV0 A;  4DS5 A;  5KG1 A;  4BWM A;  4BDP A;  1L3V A;  2V4R A;  3KHL A;  2ZTD A;  3PNC A;  1UT5 A;  4R66 A;  1ZET A;  2KZM A;  4P2H A;  8ICE A;  5L1I A;  3ZDD A;  5KFS A;  4DFJ A;  2VA2 A;  4I2J A;  4RQ5 A;  2HHT A;  9ICC A;  5J2E A;  4DL4 A;  4YMM A;  1BPE A;  4I2G A;  4MFF A;  1RYS A;  4KIT B;  3C21 A;  9ICW A;  9ICO A;  4YVZ A;  1KTQ A;  5KFM A;  3HP6 A;  3TAR A;  4C8M A;  4Z6E A;  1NK4 A;  3ZDB A;  1T3N A;  9ICS A;  5L1J A;  1U48 A;  3THV A;  3T3F A;  4B9L A;  2KFZ A;  2W9C A;  2W8K A;  3SV4 A;  3T5H A;  3PX4 A;  3RJG A;  4RU9 A;  3HT3 A;  5J0X A;  4RT2 A;  3UQ0 A;  4QZB A;  2Y1J A;  2AQ4 A;  1BPY A;  3RJE A;  3PO4 A;  1NJZ A;  1S0V A;  2HHQ A;  3MR6 A;  4MF8 A;  3MR2 A;  1RZT A;  5KFL A;  5KFH A;  4PHD A;  8ICF A;  3GII A;  5DG7 A;  4O5C A;  2XCP A;  4KTQ A;  2NRV A;  4UBC A;  1WCN A;  3V6H A;  7ICV A;  9ICE A;  4DF8 A;  3H7I A;  1ZQT A;  4I2B A;  3RH5 A;  2XY6 A;  4B9N A;  3H4D A;  3RBD A;  1XSL A;  1ZQG A;  1ZQI A;  3JPQ A;  4GXI A;  4DQQ A;  3AU2 A;  4DQP A;  1ZQM A;  4JV1 A;  1T4G A;  4M6W B;  1DGS A;  5KFC A;  3GQC A;  4DL3 A;  1ZQQ A;  3ZDC A;  7ICH A;  3PV8 A;  2NRZ A;  5J2A A;  5KT7 A;  4O0I A;  1Z3E B;  1QSL A;  1BGX T;  5J2B A;  3MFI A;  2BPF A;  4F4K A;  5DLG A;  3N97 B;  3PY8 A;  5DB9 A;  3V72 A;  7ICS A;  4TUR A;  3OHB A;  4JK1 A;  3OHA A;  5BPC A;  2W9B B;  1U9L A;  2R8J A;  3OJU A;  3GDX A;  2AJQ A;  3G6X A;  3JPR A;  4F5N A;  3RJI A;  4DL2 A;  4MEY A;  5J0O A;  1TVA A;  9ICR A;  4IRC A;  3QZ7 A;  8ICG A;  1ZQH A;  8ICO A;  7ICF A;  4Z6D A;  3BJY A;  4DSE A;  2UVU A;  2ISP A;  2ZTC A;  4UB4 A;  4QWB A;  2C22 A;  4Q44 A;  2J6S A;  4ED2 A;  4O3O A;  4KLL A;  2UVR A;  4G3I A;  2HW3 A;  2FLN A;  2PFO A;  4FO6 A;  1JXE A;  8ICI A;  9ICX A;  5J2G A;  2BCU A;  8ICQ A;  3M8S A;  5DB7 A;  3SZ2 A;  3Q8K A;  9ICP A;  1D9D A;  5DBA A;  2P6R A;  4I2D A;  5KTQ A;  3PW7 A;  4DQI A;  1IXR A;  4QZ9 A;  5KG7 A;  3OJS A;  4RNO A;  4C8O A;  4KLG A;  4TQR A;  1ZJM A;  3PO5 A;  4DOA A;  3H8J A;  2AGO A;  5CA7 A;  4ECX A;  4M47 A;  3TAN A;  2PFN A;  2HVH A;  2F1I A;  4RZR A;  4YQW A;  2ALZ A;  1BPB A;  4YFK A;  1XU4 A;  3LWM A;  3RBE A;  1X9W A;  1MQ3 A;  4P4P A;  3EYZ A;  8ICV A;  2XGP A;  3V6K A;  4EBC A;  2WTF A;  1A77 A;  1ZQN A;  3C2L A;  1S10 A;  5III A;  4Q43 A;  2Y1I A;  2ASJ A;  4O5K A;  1XSN A;  3UXN A;  5DDY A;  8ICP A;  1QSY A;  2FPM A;  5DGB A;  5DLF A;  4EEY A;  4QWC A;  4M9N A;  2HHS A;  1MQ2 A;  4EBE A;  5KG5 A;  3BDP A;  3PR5 B;  1B22 A;  3V7L A;  4IQW A;  3C1Y A;  2R8H A;  1ZYQ A;  5J29 A;  3Q8P B;  4DSI A;  3N4M B;  1NK9 A;  3PX6 A;  4F93 B;  4I2A A;  4UB2 A;  3C2K A;  3QE9 Y;  1U45 A;  2BKE A;  9ICT A;  4YR2 A;  5F9N A;  4F50 A;  4RT3 A;  4Q45 A;  4YR3 A;  3UPQ A;  2ZJ8 A;  4TQS A;  4RPZ A;  3GFK B;  1BPZ A;  4UB3 A;  3Q8R B;  4ED8 A;  4O3S A;  2ZUB A;  1QLN A;  5F9L A;  4ELV A;  5DGA A;  2BQ3 A;  4I2F A;  4RQ4 A;  8ICN A;  5KFK A;  1T7P A;  8ICB A;  5JUM A;  4ECY A;  1XO1 A;  4PGY A;  5J2I A;  3RJF A;  4E0D A;  2VA8 A;  5J2H A;  4DF4 A;  3FYH A;  3RJJ A;  4J9Q A;  4LZD A;  2RDI A;  3ZD9 A;  4KLS A;  2RDJ A;  1EXN A;  2FMQ A;  2JEJ A;  4R8U B;  1ZJN A;  2KN7 A;  5J0Y A;  4TUP A;  5D46 A;  4KLD A;  5DBC A;  5J2J A;  1NK5 A;  4KN4 A;  3PW0 A;  4JV2 A;  4ED6 A;  7ICU A;  4YD2 A;  2UVV A;  3TI0 A;  3RJK A;  7ICT A;  1JX4 A;  4UBB A;  1QSS A;  4KLT A;  3C23 A;  1U4B A;  4DFK A;  2C2D A;  2XY7 A;  4QW9 A;  4DWI A;  2I9G A;  4XA5 A;  1X9S A;  2VA3 A;  1S77 D;  5KT5 A;  4RNM A;  2VAN A;  1ZQL A;  2J6U A;  4DEZ A;  4ECT A;  4IRK A;  3OGU A;  1MSW D;  3PVX A;  4RQ2 A;  4F4Y A;  2BCQ A;  3GIK A;  3KHH A;  5J2D A;  4F5Q A;  3BQ1 A;  5HMM A;  2R8I A;  4QWD A;  4MFA A;  3M9N B;  2BPC A;  4DQR A;  5DBB A;  4EBD A;  3HWT A;  3ISC A;  8ICJ A;  3RRG A;  3EW9 A;  1TKD A;  1SKW A;  4RNN A;  2Q0Z X;  1ZQV A;  3M9M B;  2JZB B;  2OWO A;  4F8R A;  3EPG A;  5KFQ A;  3T5J A;  4LZG A;  4XQ8 A;  4DSF A;  2PFQ A;  3RH4 A;  4I2H A;  2BQR A;  4KLO A;  3C1Z A;  1T8E A;  4NXZ A;  3MFH A;  2F1H A;  5J0W A;  2W8L A;  5KFB A;  5DB8 A;  4PH5 A;  1ZQA A;  5KG6 A;  2JEF A;  3RB3 A;  1S76 D;  4O3Q A;  1RPL A;  3MGI A;  4J9S A;  4F5O A;  4DS4 A;  5KFY A;  4RQ7 A;  4QZ8 A;  2BGW A;  2XO7 A;  4ELU A;  9ICI A;  4GC7 A;  1ZQC A;  5KFT A;  3E2E A;  3GV8 B;  5KFX A;  4FS1 A;  5CB1 A;  2BCV A;  4DSJ A;  4ECU A;  3V6J A;  1SL1 A;  2PXI A;  1ZQJ A;  5KG4 A;  3AU6 A;  3Q8L A;  2ASL A;  5IIJ A;  4O3N A;  1V9P A;  4GXK A;  1JN3 A;  4QZD A;  3MDA A;  3RRH A;  3T5K A;  2BCS A;  1L3T A;  1ZQE A;  2J6T A;  1RXW A;  9ICG A;  5KFE A;  3QZ8 A;  4RQ1 A;  2F1J A;  2FLP A;  2HHX A;  3TFS A;  4ELT A;  3B0X A;  3ZDA A;  3G6V A;  3SV3 A;  4QZG A;  3HPO A;  4NLK A;  8ICX A;  1KSP A;  5J0R A;  3ISD A;  3Q8Q B;  1LB2 B;  1KFS A;  1Z00 B;  1KDH A;  3PR4 A;  8ICA A;  5J0P A;  4DLG A;  5HNK A;  4MFC A;  4YG2 A;  5CWR A;  2ISO A;  2PI4 A;  4YMN A;  5EOZ A;  3TAQ A;  2PFP A;  2A1J B;  5KFW A;  4O3R A;  1NK6 A;  2I1Q A;  4TUS A;  2V4Q A;  2MUT B;  2BQU A;  1UA1 A;  1NK8 A;  3MBY A;  9ICQ A;  1S97 A;  4F2R A;  2AQ0 A;  4NM2 A;  5TZV A;  1RYR A;  4M2Y A;  4QZI A;  1NKB A;  3TFR A;  4F5R A;  2P6U A;  1BPD A;  5D49 A;  4DOC A;  1ZQX A;  2C2R A;  3H8S A;  4I28 A;  4QWA A;  4F4W A;  3G6Y A;  4M6W A;  2HVI A;  3M9O B;  5HML A;  3MR3 A;  4BXO B;  3KHR A;  1TAQ A;  1COO A;  4ED3 A;  1SKR A;  1DOQ A;  4F92 B;  5CHG A;  4DO9 A;  4NM1 A;  2HHV A;  4B9V A;  1NOM A;  2NRT A;  5IIK A;  5DQI A;  3ETL A;  4RPX A;  1TK0 A;  1SL2 A;  4I2C A;  5DDM A;  2W9B A;  5KG2 A;  4PPX A;  4QZF A;  4KLI A;  1L3U A;  2ASD A; 
#chains in the Genus database with same CATH topology
 8ICS A;  2XY5 A;  4JUZ A;  2FPL A;  1C20 A;  1GO3 F;  3WKD A;  4MF2 A;  4IL6 U;  1PK1 B;  3NVW A;  2IHN A;  4J9P A;  1HJP A;  1TAU A;  3PW5 A;  4KX3 A;  1A6S A;  9ICB A;  3M8R A;  3GZF A;  2JHD A;  8ICR A;  3SQI A;  2HBJ A;  1SV0 A;  3R9K A;  4Y2V A;  2RLT A;  4I2I A;  4PGX A;  4BJQ A;  1RXV A;  3V7K A;  4K4H A;  3JPS A;  2D3D A;  2LHT A;  1U47 A;  4RPY A;  1QCK A;  4F71 A;  3RAX A;  3H8W A;  2JXJ A;  1SKS A;  4M9H A;  2F76 X;  4F91 B;  2KZZ A;  2R18 A;  2ZUD A;  1OW5 A;  4B9S A;  4Y2T A;  2DFL A;  2I6X A;  1N61 A;  2O6K A;  4RQM A;  1KRP A;  5J0S A;  7ICO A;  5AI9 A;  4B9T A;  5KFN A;  4M04 A;  1YZ7 A;  8ICY A;  1D8L A;  5KFZ A;  3OSP A;  1FFU A;  1WYG A;  2DGZ A;  3H40 A;  2G5I B;  3RJH A;  5KFF A;  7ICL A;  4KLF A;  7ICM A;  3LWL A;  3C29 A;  2G09 A;  1XSP A;  4RUC A;  8ICT A;  1D8B A;  2DPI A;  3FAH A;  1DGJ A;  5GTI U;  4Q8E A;  2HHW A;  4O3P A;  2BDP A;  3RB4 A;  2ZIX A;  4FS2 A;  1KFT A;  3KZX A;  4RQ3 A;  5HHI A;  2JZB A;  5EWG A;  5KNI A;  3N7S C;  1TV9 A;  5KG3 A;  1XWL A;  5AI4 A;  5AM0 A;  9ICN A;  1JIH A;  1PZN A;  1WWU A;  1X6I A;  5KFJ A;  5AM5 A;  2W9A A;  2JH7 A;  2DUY A;  4JWM A;  4NV0 A;  4DL6 A;  3RH6 A;  1S0O A;  2HSZ A;  5KFP A;  2ZIU B;  4PZO A;  1SXD A;  2AGP A;  4M0A A;  4B9M A;  2W04 A;  5KT3 A;  2ZUC A;  1ECW A;  2MRL A;  4A8E A;  3KKA A;  4U6P A;  5BOL A;  4DLE A;  2XGQ A;  1Z00 A;  2GWS A;  4IQU A;  1RYU A;  3MGH A;  4K4I A;  2FMP A;  2DL0 A;  3QEA Z;  5KFO A;  5ALL A;  5ALO A;  4RUA A;  4YXM A;  4XRH A;  4ED1 A;  1TAM A;  1ZQS A;  3T5L A;  4J9N A;  5AK5 A;  2QB0 B;  3AM9 A;  4QZC A;  4K4G A;  2JH1 A;  4ECV A;  3IHQ B;  7ICR A;  3WK5 A;  2HBK A;  3PSP A;  2CRX A;  5KG1 A;  3KD3 A;  3KHL A;  3PNC A;  1UT5 A;  1ZRN A;  3QX7 A;  2EAM A;  2HHT A;  4YMM A;  2DWQ A;  4YVZ A;  3LVV A;  2F8K A;  3VC8 A;  4O3M A;  3PSI A;  1U48 A;  4C4R A;  1SZH A;  3PX4 A;  3SV4 A;  2YQE A;  4RT2 A;  2Y1J A;  1V38 A;  1RZT A;  8ICF A;  1FEZ A;  2NRV A;  1WCN A;  3WK4 A;  3H4D A;  3RBD A;  1ZQI A;  1T94 A;  4GXI A;  4DQQ A;  1ZQM A;  4JV1 A;  4M6W B;  4DL3 A;  1DGS A;  1ZQQ A;  3GQC A;  3PV8 A;  1QSL A;  5J2A A;  4O0I A;  5AI0 A;  5J2B A;  3PY8 A;  1KKX A;  7ICS A;  5DB9 A;  4JK1 A;  3OHA A;  4P0P B;  1U9L A;  4AYB C;  3OJU A;  1KN5 A;  5AKH A;  3RJI A;  3DV9 A;  3ALR A;  3QZ7 A;  1XO0 A;  4PL2 A;  1ZQH A;  4Z6D A;  1YZ6 A;  2G0A A;  4UB4 A;  4Q44 A;  4KLL A;  2UVR A;  3DEE A;  4FO6 A;  2XI9 A;  3M8S A;  5DB7 A;  5KTQ A;  4DQI A;  2QB1 A;  4QZ9 A;  1WWV A;  5KG7 A;  3OJS A;  4C8O A;  3PO5 A;  4M47 A;  2F1I A;  3H0L B;  5E79 U;  1A0P A;  5AK4 A;  1BPB A;  4YFK A;  1X9W A;  3EYZ A;  3AQF A;  4EBC A;  2WTF A;  1ZD5 A;  5III A;  4Q43 A;  4O5K A;  1XSN A;  2KJ5 A;  2ZIV A;  5DDY A;  8ICP A;  1QSY A;  5DLF A;  4QWC A;  1MQ2 A;  4IQW A;  3I1Y A;  3SAG A;  3Q8P B;  1L7P A;  2KJ9 A;  4UW9 A;  4F93 B;  2KEY A;  4I2A A;  1U45 A;  2ZIW B;  2PMZ F;  5F9N A;  2ZJ8 A;  4TQS A;  3GFK B;  2W11 A;  4O3S A;  4RQ4 A;  2PKE A;  3RJF A;  4PGY A;  1IG6 A;  5ALZ A;  1SXE A;  4J9Q A;  4C0Z A;  4Y2Q A;  3QNM A;  2ESE A;  4R8U B;  4KLD A;  4US9 A;  5EE1 A;  3WK7 A;  1JUD A;  3BS7 A;  4FFD A;  2E1F A;  2KVS A;  3AL0 B;  4KLT A;  3C23 A;  2C2D A;  4XA5 A;  1S77 D;  4RNM A;  2W54 A;  1VLB A;  2WFA A;  1O03 A;  2A19 A;  4RQ2 A;  3GIK A;  3BQ1 A;  2ZG6 A;  5HMM A;  1N5W A;  8ICJ A;  3HWT A;  3UMC A;  1CRX A;  2EAO A;  2G08 A;  3M9M B;  3EPG A;  1J97 A;  2PFQ A;  4BX9 C;  2HCF A;  2BQR A;  3C1Z A;  2Z7J A;  2W8L A;  5DB8 A;  4PH5 A;  2JEF A;  2KKP A;  1S76 D;  3MGI A;  5KFY A;  4GC7 A;  1ZQC A;  3GV8 B;  3CYM A;  2BCV A;  1SWW A;  3V6J A;  2PXI A;  1ZQJ A;  4GXK A;  1JN3 A;  2HBL A;  5AKK A;  2BCS A;  3NRW A;  2J6T A;  3TFS A;  3ZDA A;  3H0R B;  1X42 A;  4QNL A;  2EDU A;  8ICX A;  2IOF K;  1KSP A;  3ONN A;  1LB2 B;  3PR4 A;  5J0P A;  4MFC A;  3SR6 A;  4B6J A;  3ED5 A;  2PI4 A;  4YMN A;  2A1J B;  5CRX A;  4O3R A;  1NK6 A;  2I1Q A;  3PZP A;  4G9B A;  1NK8 A;  3IDW A;  3MBY A;  9ICQ A;  2GO7 A;  1BNP A;  2E5S A;  4NM2 A;  4F5R A;  1BPD A;  1ZQX A;  3H8S A;  4I28 A;  2HVI A;  4UAR A;  3M9O B;  2P35 A;  1XNS A;  2WF9 A;  3MR3 A;  4BXO B;  1IIP A;  4NM1 A;  1SKR A;  4F92 B;  4B9V A;  4CE6 A;  4Y2J A;  1MN8 A;  1TK0 A;  4I2C A;  3QU2 A;  5DDM A;  4ED0 A;  4MEX A;  2G07 A;  2YB1 A;  5DG9 A;  2MA1 A;  3BS5 A;  4IQV A;  1ZQP A;  4YN4 A;  4F72 A;  2R8G A;  1NZB A;  1N62 A;  5ALH A;  2K4P A;  3JPP A;  2ZJA A;  2H3I A;  5KT4 A;  5KG0 A;  3BQ7 A;  2C2E A;  2WF6 A;  1ZQW A;  1HIW A;  1ZD3 A;  5G5H A;  4OJ6 A;  3RTV A;  4ECQ A;  2YX8 A;  2FMS A;  5L1L A;  1X6J A;  4KLM A;  4P0Q A;  4TUQ A;  1KL9 A;  2IA6 A;  4F2S A;  4KLJ A;  2YB4 A;  3C28 A;  4R64 A;  4Q8F A;  1CEZ A;  3KTQ A;  5CJ7 A;  5CP2 A;  4PHA A;  4CRX A;  4CNQ A;  3EPI A;  8ICC A;  3AEV A;  4DSL A;  3TAP A;  2BR0 A;  1TE2 A;  1NJW A;  2QLT A;  4UQG A;  5KFG A;  1B4F A;  4CGZ A;  3UXP A;  4YMO A;  2W7P A;  3SD7 A;  4KLU A;  1NJX A;  5J8Y C;  3RR7 A;  2FPK A;  5ALX A;  4XUS A;  3RF9 A;  4NL9 C;  2ODG A;  1B0X A;  2C28 A;  3PX0 A;  4ZH4 A;  2YN4 A;  3GIL A;  2AGQ A;  4B9U A;  2LM4 A;  3NVY A;  1X40 A;  4EYI B;  3A0H U;  3ISB A;  3WK6 A;  2XID A;  2HBM A;  3C5F A;  4C8L A;  4BWJ A;  2NRW A;  1XC9 A;  4CF3 A;  3GV7 B;  1N48 A;  2W3R A;  3RB6 A;  1TK5 A;  1IV8 A;  4I2E A;  3GIM A;  3QEB Z;  4LVS A;  3OTQ A;  4QWE A;  7ICG A;  3JPN A;  2DPJ A;  3J81 j;  1TFR A;  1UA0 A;  1FIQ A;  1LV5 A;  1Z1V A;  5KT2 A;  2Y0S C;  1UCV A;  4J9O A;  1ZQB A;  4QZA A;  1CUK A;  4UB1 A;  2QKQ A;  5L9X A;  2DKX A;  1JXL A;  1FO4 A;  3PW2 A;  4GIB A;  3OSN A;  3CRX A;  3PST A;  3I76 A;  1UT8 A;  3KHG A;  9ICL A;  2EZY A;  5C5J A;  4NLG A;  2EH9 A;  3T79 A;  1S9F A;  1SL0 A;  2BHN A;  5J0U A;  4FZN A;  4FBU A;  4KLH A;  3UQ2 A;  4DL5 A;  1O08 A;  2B21 A;  1C7Y A;  5J2K A;  2W9M A;  4RQ8 A;  1N60 A;  4DFP A;  3UMG A;  5AIB A;  1UHU A;  3TKA A;  3MDC A;  2WB1 F;  2MUT A;  4NWI A;  2LI6 A;  3HJE A;  4UAW A;  5ALG A;  1JRO A;  2V9W A;  2IBK A;  5ALW A;  4QZE A;  5AM1 A;  5DQH A;  4IQT A;  2UVW A;  8ICZ A;  9ICM A;  1D8Y A;  4JV0 A;  4DS5 A;  4BWM A;  5HR7 A;  2WB1 C;  2KZM A;  4R66 A;  5KL8 B;  8ICE A;  3ZDD A;  5KFS A;  2KSO A;  4DFJ A;  1SWV A;  4RQ5 A;  9ICC A;  1JI7 A;  5EE3 A;  1BPE A;  1NI3 A;  2EZX A;  1RYS A;  4FE3 A;  2IOF A;  1DRG A;  1F5S A;  2BZF A;  4Z6E A;  1NK4 A;  2AXT U;  3THV A;  2KFZ A;  5ALP A;  2W3S A;  2W9C A;  3HT3 A;  4QZB A;  3PO4 A;  1BPY A;  2F77 X;  1S0V A;  4UAT A;  3MR2 A;  5KFL A;  4O5C A;  4WJ3 B;  3V6H A;  1RQL A;  9ICE A;  1J2N A;  2CXY A;  3RH5 A;  3JPQ A;  3AU2 A;  1T4G A;  5KFC A;  1ZQ1 C;  1Z3E B;  1BGX T;  4NLB A;  2BPF A;  3N97 B;  2GOL A;  3QYP A;  2AJQ A;  3G6X A;  4DL2 A;  4MEY A;  2RP5 A;  5KL1 B;  7ICF A;  4DSE A;  2HW3 A;  2HMX A;  5ALS A;  2PFO A;  1JXE A;  5J2G A;  3SZ2 A;  2P6R A;  3PW7 A;  1IXR A;  2MSN A;  4RNO A;  4KLG A;  3H8J A;  4OCZ A;  5CA7 A;  4ECX A;  4C7Y A;  1S8O A;  8ICV A;  5G5G A;  1A77 A;  5AKL A;  1PK3 A;  1S10 A;  4C4T A;  2KE7 A;  4EEY A;  4M9N A;  2HHS A;  1B22 A;  4EBE A;  3BDP A;  1Z1B A;  1ZYQ A;  3N4M B;  1NK9 A;  3K1R B;  4Y2P A;  2BKE A;  4YR2 A;  4YR3 A;  1ED1 A;  2N1R A;  3QUT A;  4RPZ A;  1QQ5 A;  4UB3 A;  3EUB 2;  1YT3 A;  3FM9 A;  5KAF U;  3F2D A;  2B6G A;  5J8Y A;  1QLN A;  1NZP A;  2IOH A;  5KFK A;  4NL9 A;  4E0D A;  4LZD A;  4KLS A;  1EXN A;  2K8C B;  1LKY A;  3O0F A;  2KN7 A;  4TUP A;  5D46 A;  5DBC A;  4IC9 A;  3PW0 A;  1L8L A;  7ICU A;  4YD2 A;  2UVV A;  2JR5 A;  1KQQ A;  1JX4 A;  4UBB A;  1U4B A;  2XY7 A;  2I9G A;  1K5O A;  2VAN A;  4DEZ A;  4ECT A;  2NYV A;  4IRK A;  4F4Y A;  3KHH A;  3L3F X;  4F5Q A;  2JMG A;  4PJ0 U;  4DQR A;  3ISC A;  4ICA A;  2ZIX B;  3AQE A;  4AYB F;  1TKD A;  1SKW A;  4RNN A;  2K60 A;  1ZQV A;  2JZB B;  1HEK A;  2OWO A;  4F8R A;  4LZG A;  1F0M A;  4KLO A;  2A1A A;  3MFH A;  1T8E A;  5AM3 A;  3WKC A;  1JAL A;  4J9S A;  4F5O A;  2OH2 A;  4NJ8 A;  3ETR A;  2OM6 A;  4QZ8 A;  2XO7 A;  4ELU A;  4ZOH C;  5AM4 A;  4DSJ A;  1NNL A;  2ASL A;  1RDF A;  3I28 A;  1L3T A;  1OXJ A;  3ZI4 A;  1RXW A;  2F1J A;  4ELT A;  5AKJ A;  3Q8Q B;  1Z00 B;  8ICA A;  1CI4 A;  2H3Z A;  3L4P A;  5HNK A;  1MA7 A;  3OPX A;  5EOZ A;  3TAQ A;  1COK A;  5AKI A;  2E1E A;  2KHV A;  2KP7 A;  2BQU A;  2AQ0 A;  5TZV A;  1NKB A;  5D49 A;  2C2R A;  2D8C A;  2E8P A;  4QWA A;  2F2A B;  5HML A;  2CN1 A;  1COO A;  1M6Y A;  4ED3 A;  2XVT A;  2HHV A;  5IIK A;  5DQI A;  3ETL A;  4RPX A;  1KW4 A;  2W9B A;  2VJ5 A;  5AK3 A;  1Z19 A;  1SZP A;  1SGG A;  4O9M A;  3E0F A;  2KIW A;  4GC6 A;  4HAI A;  2ZXI A;  2YML A;  4RQ6 A;  4J03 A;  2DKZ A;  1DK3 A;  4IRD A;  2EAP A;  3CW2 C;  3AN1 A;  4IR9 A;  2RRD A;  3QU7 A;  2BCR A;  2ZTE A;  3BQ0 A;  2FE9 A;  1K1S A;  3SYZ A;  3MR5 A;  1ZQF A;  1Z4N A;  4NLZ A;  1BVS A;  5KFV A;  4F5P A;  4IR1 A;  5ALU A;  4PHP A;  1B43 A;  4CF4 A;  2OYY A;  4EYH B;  1S0M A;  3H0M B;  2H5X A;  1JMS A;  1MC8 A;  3GV5 B;  2NRX A;  5KFU A;  1ZQR A;  5EWE A;  5EWF A;  3AMZ A;  5HP4 A;  1NKE A;  1WCL A;  4OJL A;  3KFU F;  1ZQK A;  3K4G A;  5ALT A;  5J0Q A;  1N56 A;  3L5K A;  3U26 A;  5IIL A;  4CDG A;  2A3V A;  8ICW A;  4R63 A;  3IP4 B;  3VCB A;  4F4X A;  1QSS A;  9ICF A;  1S0N A;  1SIJ A;  4ECZ A;  5DG8 A;  3GIJ A;  1L5U A;  4KLQ A;  1URJ A;  1SV0 C;  4M9J A;  7ICN A;  2ZJ5 A;  3RR8 A;  4GLX A;  3FDS A;  3D2N A;  3JPT A;  1IM4 A;  5D4B A;  5IIM A;  2ZIV B;  2ZXH A;  4I27 A;  3SAH A;  3IG5 A;  3Q8M A;  4O5E A;  4M9G A;  4YR0 A;  2RHF A;  3KOO A;  3JPO A;  3NS1 A;  2RQ5 A;  9ICK A;  4OD0 A;  2KOB A;  2F3N A;  5EE0 A;  3UXO A;  1NK0 A;  7ICI A;  2CPR A;  3M6Z A;  2FDR A;  4C8N A;  5L1K A;  5CR0 A;  2FI1 A;  2WAQ F;  4FZM A;  9ICA A;  4C8K A;  3D2S A;  3QUQ A;  3NGD A;  2E8M A;  3S6J A;  5ALF A;  4AP9 A;  4NLN A;  7ICK A;  4EEN A;  2YY6 A;  3UM9 A;  5KFR A;  2IHM A;  4P4M A;  2XC9 A;  1Q8K A;  4KN7 A;  8ICH A;  1Q3V A;  2WAQ C;  4I29 A;  4DOB A;  5ALE A;  4UAS A;  4QZH A;  1VJ5 A;  3SMV A;  4PPX A;  3LK9 A;  1QTM A;  3ORY A;  4EZ6 A;  4J9K A;  4USA A;  4EZ9 A;  4F3O A;  3H4B A;  1A76 A;  1N63 A;  1ARO P;  3N7P D;  4PGQ A;  1NK7 A;  1D9F A;  7ICQ A;  3C2M A;  3BQT A;  2KZ3 A;  2K4I A;  4ECS A;  4YP3 A;  2XCA A;  5JTI A;  5C0Y A;  3HW8 A;  1PVP A;  4UB5 A;  3F53 A;  5KFI A;  2FLL A;  1Q46 A;  3B0Y A;  5HHH A;  3IM1 A;  1Z4O A;  1P7D A;  5IIO A;  2QAR A;  2DQN B;  2K8A A;  4BDP A;  1L3V A;  2V4R A;  5AIA A;  2ZTD A;  2K4H A;  4MHV A;  2W55 A;  2AH5 A;  2VA2 A;  4I2J A;  3F5A A;  4DL4 A;  1PK1 A;  3C21 A;  9ICW A;  9ICO A;  1KTQ A;  3HP6 A;  2DBY A;  2VKQ A;  1FFV A;  3KKA C;  1VDV A;  9ICS A;  5L1J A;  2YMQ A;  2W8K A;  5CEH A;  3RJG A;  2FJ6 A;  3RJE A;  5J0X A;  2D6F C;  2K8B B;  5ALI A;  2HHQ A;  1NJZ A;  2GH1 A;  4MF8 A;  4PHD A;  5DG7 A;  4UBC A;  4DF8 A;  3H7I A;  2W7O A;  1XSL A;  1ZQG A;  2OEH A;  1DXS A;  4DQP A;  2Y0S F;  2HDO A;  3QU9 A;  7ICH A;  5ALD A;  5JU5 A;  2NRZ A;  2GLE A;  3MFI A;  4F4K A;  5DLG A;  4TUR A;  1V97 A;  3IG8 A;  3OHB A;  5BPC A;  1PVR A;  1UQV A;  3JPR A;  4F5N A;  3BS5 B;  5J0O A;  1TVA A;  3M7D A;  2KHQ A;  8ICG A;  8ICO A;  4EX6 A;  4U7C A;  3BJY A;  2UVU A;  2ISP A;  4QWB A;  2J6S A;  4G3I A;  2L5Y A;  9ICX A;  8ICQ A;  5ALM A;  5ALN A;  4I2D A;  2ES6 A;  2EAN A;  4TQR A;  4UAV A;  2AGO A;  4PL1 A;  4RZR A;  4P0Q B;  4QIW C;  2NO5 A;  2ALZ A;  3LWM A;  2NO4 A;  1XU4 A;  3RBE A;  1MQ3 A;  2E3T A;  3RFA A;  2XGP A;  2K4E A;  5GTH U;  3LYS A;  1LVH A;  2Y1I A;  2ASJ A;  1L7N A;  3UXN A;  2EQY A;  1QH9 A;  3M1Y A;  5DGB A;  1RM6 C;  5ALV A;  5L1M A;  5KG5 A;  3V7L A;  3C1Y A;  5J29 A;  4DSI A;  5H2F U;  4UB2 A;  3C2K A;  3QE9 Y;  1JRP A;  4Q45 A;  1BPZ A;  2Q4T A;  3Q8R B;  2LYB A;  4NLC A;  4ELV A;  2BQ3 A;  8ICN A;  1T7P A;  3HIL A;  5JUM A;  4ECY A;  5J2I A;  3RJJ A;  2HOI A;  1S5L U;  2RDI A;  2RDJ A;  1ZJN A;  5J0Y A;  5J2J A;  1NK5 A;  5KAI U;  2JRZ A;  2ZIU A;  4KN4 A;  4JV2 A;  4ED6 A;  3NRZ A;  3TI0 A;  3RJK A;  2W03 A;  3NVV A;  3M6K A;  3WKB A;  4DWI A;  2KK0 A;  2VA3 A;  5AK6 A;  1ZQL A;  3OGU A;  2BCQ A;  3F2B A;  4GFJ A;  2BPC A;  5DBB A;  4EBD A;  2KD1 A;  3RRG A;  3T5J A;  4XQ8 A;  4DSF A;  4I2H A;  2QB0 A;  2DF4 B;  3WKE A;  5J0W A;  5ALJ A;  4KX5 A;  5KG6 A;  3RB3 A;  4O3Q A;  1RPL A;  4DS4 A;  4RQ7 A;  4UB8 U;  5KFT A;  3E2E A;  5KFX A;  4FS1 A;  5CB1 A;  2YMP A;  4ECU A;  1SL1 A;  5KG4 A;  3AU6 A;  5IIJ A;  1V9P A;  3T5K A;  5KFE A;  4RQ1 A;  2FLP A;  3B0X A;  3G6V A;  4ACO A;  3SV3 A;  3TAD C;  5AI5 A;  1KDH A;  2G5H B;  3F5E A;  5CWR A;  2ISO A;  2PFP A;  5KFW A;  1ZRM A;  4TUS A;  2V4Q A;  2MUT B;  4FZL A;  4F2R A;  2G06 A;  4M2Y A;  4QZI A;  3TFR A;  2P6U A;  4DOC A;  4OJ5 A;  1L7M A;  4F4W A;  3G6Y A;  4OJO A;  4M6W A;  1PVQ A;  3LVW A;  5K4L A;  1DOQ A;  4DO9 A;  1NOM A;  3QU4 A;  2WF8 A;  1SL2 A;  4P0P A;  5KG2 A;  4QZF A;  2KNJ A;  1L3U A;  2ASD A;  5B5E U;  5KT6 A;  5J0T A;  2KSO B;  4HYK A;  2ATL A;  4Y2S A;  1HUO A;  4KLE A;  2KV2 A;  3TAC B;  1ZQO A;  4YXJ A;  4IS7 A;  3IRU A;  4Z6F A;  5AM2 A;  5KFD A;  2E8O A;  9ICJ A;  4UAZ A;  4DCC A;  1RG6 A;  4JMU A;  2W9C B;  1U49 A;  3SI8 A;  8ICM A;  4Y2U A;  4KMU A;  5TIS U;  4JWN A;  5ALK A;  4J9R A;  1NKC A;  4M9L A;  4DSK A;  4C4S A;  3EZ5 A;  4F4Z A;  1N2X A;  3N28 A;  1ZD2 P;  4X5V A;  2WF5 A;  5KFA A;  2VIX A;  3SAF A;  5AKZ A;  3HRD D;  3RB0 A;  8ICK A;  5DKW A;  4P4O A;  5DQG A;  9ICU A;  1H38 A;  4R65 A;  3AUO A;  2HHU A;  2BPG A;  5FP0 A;  2Y9U A;  3LDA A;  5DB6 A;  4ECW A;  2ZIW A;  3KZI U;  4UAY A;  1ZQZ A;  1KFD A;  5T14 A;  1SB3 C;  1X2I A;  2IMW P;  3HKZ F;  5IIN A;  5J2C A;  3V7J A;  3WKA A;  4Z6C A;  2M9N A;  4QW8 A;  1L6N A;  1ZQD A;  3BZC A;  2JEG A;  4Y2X A;  1ZQY A;  4R8U A;  2LKY A;  4FBT A;  4J9L A;  2P66 A;  4PHE A;  1KLN A;  3PML A;  1XS9 D;  3EWA A;  1ZD4 A;  2MAX A;  8ICL A;  3UMB A;  3HKZ C;  2JEI A;  9ICH A;  2VJ4 A;  1RQN A;  3K75 D;  4YCX A;  2I5H A;  3QUC A;  9ICV A;  1ZQU A;  4EEK A;  4KMO B;  4DL7 A;  2YTU A;  2R8K A;  2F44 A;  8ICU A;  3MAB A;  3NTU A;  4BUG A;  4CCH A;  4J9M A;  3C5G A;  4RQ0 A;  3ZD8 A;  2KTQ A;  5AKY A;  1NJY A;  1L3S A;  3IV6 A;  2JV3 A;  2LYA A;  3PW4 A;  4EEL A;  4DFM A;  1LKY B;  3WK8 A;  3DDH A;  5ALQ A;  4DQS A;  3QUB A;  1UPH A;  3TQ1 A;  3ZDE A;  1KEJ A;  2AU0 A;  3K1Z A;  1T3Q A;  2LM1 A;  2F8L A;  2PI5 A;  7ICJ A;  5AKX A;  1X9M A;  3BQ2 A;  3GU3 A;  1HUZ A;  1X66 A;  1AQ6 A;  1X9X A;  4OJP A;  2H3Q A;  1TK8 A;  3PMN A;  1WG8 A;  1WUD A;  5AIC A;  3Q8S B;  4ECR A;  4GXJ A;  2A1J A;  5J2F A;  1Y88 A;  2AHO B;  7ICP A;  3NVZ A;  7ICE A;  1BPX A;  2LBO A;  3E58 A;  5BOM A;  4BGD A;  1K1Q A;  4YD1 A;  3RAQ A;  4ED7 A;  4BXO A;  2LYH A;  4NY8 A;  2HI0 A;  2PMZ C;  1ZET A;  4OO1 J;  3MGV A;  4P2H A;  5L1I A;  1L7O A;  1SV4 A;  2KG5 A;  3BZK A;  5J2E A;  4I2G A;  1PUZ A;  4MFF A;  4KIT B;  1ZOL A;  4JB3 A;  2M0N A;  5KFM A;  4Y2Y A;  3TAR A;  2NV3 A;  4C8M A;  3ZDB A;  1T3N A;  3TAD A;  2HOF A;  3T3F A;  4B9L A;  4UAU A;  3T5H A;  4RU9 A;  3UQ0 A;  2AQ4 A;  3MR6 A;  3NUQ A;  5KFH A;  3PSF A;  3GII A;  1V85 A;  2KIV A;  2XCP A;  4KTQ A;  7ICV A;  1ZQT A;  4I2B A;  4UB6 U;  2XY6 A;  5B66 U;  4B9N A;  4Y2R A;  3ZDC A;  2WHE A;  3QU5 A;  5KT7 A;  1F44 A;  5AKE A;  3H8M A;  4CF5 A;  4QJF B;  3V72 A;  2LMR A;  2W9B B;  5AHX A;  2R8J A;  3GDX A;  3ICX A;  9ICR A;  4IRC A;  2H3F A;  2EZZ A;  4EX7 A;  2ZTC A;  2Y9T A;  1KBU A;  2C22 A;  4ED2 A;  3NAS A;  4O3O A;  2FLN A;  8ICI A;  2BCU A;  3Q8K A;  2B0C A;  9ICP A;  5DBA A;  1ZJM A;  4DOA A;  2HVH A;  3TAN A;  2PFN A;  4YQW A;  2OHF A;  2JGA A;  2WF7 A;  3WU2 U;  5AKG A;  4P4P A;  3V6K A;  2KVC A;  1ZQN A;  3C2L A;  3FC4 A;  5AI8 A;  4LJX A;  2FPM A;  3PR5 B;  2R8H A;  2H3V A;  3PX6 A;  9ICT A;  4F50 A;  4RT3 A;  2OCE A;  3UPQ A;  3CNH A;  3N7R C;  4ED8 A;  4C80 A;  2ZUB A;  5F3X B;  2XIC A;  5F9L A;  5DGA A;  4I2F A;  8ICB A;  2KJ8 A;  1XO1 A;  2VA8 A;  5J2H A;  4DF4 A;  3FYH A;  5HR6 A;  3ZD9 A;  2FMQ A;  2JEJ A;  1QQ7 A;  5ALR A;  3D2Q A;  3D6J A;  5A0L A;  4RQN A;  5JRT A;  7ICT A;  3WK9 A;  1L8O A;  4DFD A;  4DFK A;  4QW9 A;  2W43 A;  1DK2 A;  1X9S A;  5KT5 A;  2J6U A;  1MSW D;  1N5X A;  4C7Z A;  3PVX A;  5J2D A;  2R8I A;  4QWD A;  4MFA A;  3B9J A;  3M9N B;  2LPE A;  3EW9 A;  2Q0Z X;  5KFQ A;  3RH4 A;  1ZXI A;  2BDU A;  4NXZ A;  2F1H A;  3SEN A;  5KFB A;  1ZQA A;  3IN5 A;  5EE9 A;  2OXO A;  2HOQ A;  2BGW A;  1Q3U A;  9ICI A;  1BNO A;  2E8N A;  3MC1 A;  3F2C A;  3Q8L A;  4O3N A;  3MDA A;  4QZD A;  3RRH A;  1ZQE A;  4QIW F;  9ICG A;  2KIC A;  3QZ8 A;  4PZN A;  2HHX A;  4QZG A;  3HPO A;  4NLK A;  3A0B U;  2YMM A;  5J0R A;  3KBB A;  3ISD A;  1QQ6 A;  1KFS A;  4DLG A;  2KKV A;  1J2M A;  4YG2 A;  1UA1 A;  1S97 A;  1RYR A;  2KMD A;  3SEI A;  3QXG A;  1OUQ A;  2MU2 A;  3CP8 A;  4US8 A;  3KHR A;  1TAQ A;  5CHG A;  2QAR B;  2NRT A;  5AI6 A;  2K89 A;  3HX0 A;  5ALY A;  1D9D A;  4KLI A;  2KFN A; 
#chains in the Genus database with same CATH homology
 5KT6 A;  4ED0 A;  2XY5 A;  4MEX A;  4JUZ A;  8ICS A;  5J0T A;  5DG9 A;  2FPL A;  4HYK A;  2ATL A;  4IQV A;  1ZQP A;  4MF2 A;  1SZP A;  1HUO A;  4YN4 A;  2R8G A;  4KLE A;  4O9M A;  1ZQO A;  4YXJ A;  4GC6 A;  3JPP A;  2ZJA A;  4Z6F A;  5KT4 A;  2IHN A;  5KFD A;  4J9P A;  4RQ6 A;  5KG0 A;  9ICJ A;  4UAZ A;  1HJP A;  2C2E A;  1TAU A;  3PW5 A;  4IRD A;  1ZQW A;  2W9C B;  1U49 A;  3SI8 A;  8ICM A;  3RTV A;  4ECQ A;  4KMU A;  4JWN A;  4IR9 A;  2FMS A;  5L1L A;  9ICB A;  3M8R A;  4J9R A;  2BCR A;  8ICR A;  2ZTE A;  4KLM A;  3BQ0 A;  1NKC A;  4M9L A;  4DSK A;  4TUQ A;  3EZ5 A;  1K1S A;  4F4Z A;  2IA6 A;  4F2S A;  3SYZ A;  4I2I A;  4KLJ A;  3MR5 A;  4PGX A;  1RXV A;  4X5V A;  3V7K A;  5KFA A;  4R64 A;  4Q8F A;  1CEZ A;  1ZQF A;  4K4H A;  3KTQ A;  4NLZ A;  1BVS A;  5KFV A;  4F5P A;  5CJ7 A;  4IR1 A;  3RB0 A;  5CP2 A;  4PHA A;  4PHP A;  8ICK A;  3JPS A;  1B43 A;  5DKW A;  4P4O A;  3EPI A;  8ICC A;  1U47 A;  5DQG A;  4EYH B;  4RPY A;  3HX0 A;  3TAP A;  1S0M A;  4DSL A;  1H38 A;  9ICU A;  3RAX A;  2H5X A;  1JMS A;  1MC8 A;  4R65 A;  3AUO A;  2BR0 A;  2HHU A;  3GV5 B;  2NRX A;  3H8W A;  5KFU A;  1ZQR A;  5EWE A;  1NJW A;  4UQG A;  5EWF A;  2BPG A;  5HP4 A;  5KFG A;  1SKS A;  1WCL A;  1NKE A;  4M9H A;  4F91 B;  3LDA A;  2ZUD A;  1ZQK A;  5DB6 A;  4ECW A;  2KZZ A;  4B9S A;  3K4G A;  5J0Q A;  1N56 A;  4UAY A;  5IIL A;  1ZQZ A;  2DFL A;  3UXP A;  1KFD A;  4YMO A;  4KLU A;  1NJX A;  1KRP A;  1X2I A;  2IMW P;  8ICW A;  4R63 A;  5IIN A;  3RR7 A;  5J0S A;  7ICO A;  2FPK A;  5J2C A;  3V7J A;  4B9T A;  4XUS A;  5KFN A;  4M04 A;  2C28 A;  8ICY A;  4Z6C A;  1D8L A;  2M9N A;  4ZH4 A;  4QW8 A;  4F4X A;  3PX0 A;  1S0N A;  5KFZ A;  3GIL A;  2AGQ A;  3OSP A;  4B9U A;  4ECZ A;  1ZQD A;  5DG8 A;  2JEG A;  3H40 A;  3GIJ A;  1L5U A;  1ZQY A;  4R8U A;  4FBT A;  4J9L A;  4EYI B;  2P66 A;  4KLQ A;  3ISB A;  4PHE A;  3RJH A;  1KLN A;  5KFF A;  4M9J A;  7ICN A;  3PML A;  7ICL A;  1XS9 D;  2ZJ5 A;  3EWA A;  4KLF A;  2MAX A;  7ICM A;  8ICL A;  3RR8 A;  2JEI A;  3LWL A;  9ICH A;  3C5F A;  4C8L A;  4GLX A;  3FDS A;  4BWJ A;  2NRW A;  3K75 D;  1XC9 A;  4YCX A;  3JPT A;  1IM4 A;  5D4B A;  3GV7 B;  5IIM A;  1N48 A;  1XSP A;  9ICV A;  3RB6 A;  4RUC A;  4I27 A;  8ICT A;  1ZQU A;  1TK5 A;  4I2E A;  3GIM A;  3QEB Z;  2DPI A;  4LVS A;  4DL7 A;  4QWE A;  3Q8M A;  2R8K A;  4M9G A;  4O5E A;  7ICG A;  3JPN A;  4YR0 A;  2DPJ A;  4Q8E A;  2HHW A;  8ICU A;  4O3P A;  3JPO A;  1TFR A;  3MAB A;  3NTU A;  2BDP A;  4CCH A;  3RB4 A;  4J9M A;  1UA0 A;  9ICK A;  1LV5 A;  3C5G A;  4FS2 A;  4RQ0 A;  1KFT A;  3ZD8 A;  4RQ3 A;  2KTQ A;  5HHI A;  3UXO A;  2JZB A;  5KT2 A;  5EWG A;  1NK0 A;  1TV9 A;  7ICI A;  9ICF A;  5KG3 A;  1NJY A;  4J9O A;  1XWL A;  1L3S A;  1ZQB A;  4C8N A;  5L1K A;  5CR0 A;  4QZA A;  1CUK A;  9ICN A;  4UB1 A;  1JIH A;  9ICA A;  1PZN A;  4C8K A;  5L9X A;  3NGD A;  1JXL A;  3PW4 A;  3PW2 A;  5KFJ A;  2W9A A;  3OSN A;  4DFM A;  4JWM A;  4NLN A;  1UT8 A;  4DL6 A;  3RH6 A;  7ICK A;  1S0O A;  5KFP A;  3KHG A;  5KFR A;  4DQS A;  9ICL A;  5C5J A;  2AGP A;  4M0A A;  4NLG A;  1S9F A;  1SL0 A;  4P4M A;  2XC9 A;  2IHM A;  4B9M A;  3TQ1 A;  4KN7 A;  5KT3 A;  2ZUC A;  2BHN A;  3ZDE A;  1KEJ A;  8ICH A;  2AU0 A;  5J0U A;  4I29 A;  4FBU A;  4KLH A;  4DOB A;  2PI5 A;  7ICJ A;  3UQ2 A;  4DL5 A;  1X9M A;  4QZH A;  3BQ2 A;  1HUZ A;  5BOL A;  2B21 A;  1C7Y A;  4DLE A;  2XGQ A;  1Z00 A;  5J2K A;  3LK9 A;  3PMN A;  1TK8 A;  1QTM A;  2W9M A;  4RQ8 A;  3ORY A;  4IQU A;  2GWS A;  4EZ6 A;  4DFP A;  2KFN A;  4J9K A;  3Q8S B;  4EZ9 A;  3MGH A;  3H4B A;  4ECR A;  4F3O A;  1A76 A;  4GXJ A;  2FMP A;  1ARO P;  4K4I A;  3QEA Z;  4PGQ A;  2A1J A;  5J2F A;  3MDC A;  5KFO A;  1NK7 A;  1Y88 A;  3C2M A;  1D9F A;  7ICQ A;  7ICP A;  3BQT A;  2MUT A;  4RUA A;  4YXM A;  4UAW A;  4XRH A;  2KZ3 A;  4ED1 A;  7ICE A;  1ZQS A;  4ECS A;  3T5L A;  4J9N A;  4YP3 A;  2XCA A;  1BPX A;  2V9W A;  5BOM A;  3HW8 A;  4BGD A;  1K1Q A;  4YD1 A;  3RAQ A;  4ED7 A;  2IBK A;  4QZC A;  4UB5 A;  4QZE A;  5KFI A;  2FLL A;  3B0Y A;  4IQT A;  5HHH A;  5DQH A;  3IM1 A;  4K4G A;  4BXO A;  2LYH A;  2UVW A;  4NY8 A;  8ICZ A;  4ECV A;  3IHQ B;  5IIO A;  9ICM A;  7ICR A;  1D8Y A;  4JV0 A;  4DS5 A;  5KG1 A;  4BWM A;  4BDP A;  1L3V A;  2V4R A;  3KHL A;  2ZTD A;  3PNC A;  1UT5 A;  4R66 A;  1ZET A;  2KZM A;  4P2H A;  8ICE A;  5L1I A;  3ZDD A;  5KFS A;  4DFJ A;  2VA2 A;  4I2J A;  4RQ5 A;  2HHT A;  9ICC A;  5J2E A;  4DL4 A;  4YMM A;  1BPE A;  4I2G A;  4MFF A;  1RYS A;  4KIT B;  3C21 A;  9ICW A;  9ICO A;  4YVZ A;  1KTQ A;  5KFM A;  3HP6 A;  3TAR A;  4C8M A;  4Z6E A;  1NK4 A;  3ZDB A;  1T3N A;  9ICS A;  5L1J A;  1U48 A;  3THV A;  3T3F A;  4B9L A;  2KFZ A;  2W9C A;  2W8K A;  3SV4 A;  3T5H A;  3PX4 A;  3RJG A;  4RU9 A;  3HT3 A;  5J0X A;  4RT2 A;  3UQ0 A;  4QZB A;  2Y1J A;  2AQ4 A;  1BPY A;  3RJE A;  3PO4 A;  1NJZ A;  1S0V A;  2HHQ A;  3MR6 A;  4MF8 A;  3MR2 A;  1RZT A;  5KFL A;  5KFH A;  4PHD A;  8ICF A;  3GII A;  5DG7 A;  4O5C A;  2XCP A;  4KTQ A;  2NRV A;  4UBC A;  1WCN A;  3V6H A;  7ICV A;  9ICE A;  4DF8 A;  3H7I A;  1ZQT A;  4I2B A;  3RH5 A;  2XY6 A;  4B9N A;  3H4D A;  3RBD A;  1XSL A;  1ZQG A;  1ZQI A;  3JPQ A;  4GXI A;  4DQQ A;  3AU2 A;  4DQP A;  1ZQM A;  4JV1 A;  1T4G A;  4M6W B;  1DGS A;  5KFC A;  3GQC A;  4DL3 A;  1ZQQ A;  3ZDC A;  7ICH A;  3PV8 A;  2NRZ A;  5J2A A;  5KT7 A;  4O0I A;  1Z3E B;  1QSL A;  1BGX T;  5J2B A;  3MFI A;  2BPF A;  4F4K A;  5DLG A;  3N97 B;  3PY8 A;  5DB9 A;  3V72 A;  7ICS A;  4TUR A;  3OHB A;  4JK1 A;  3OHA A;  5BPC A;  2W9B B;  1U9L A;  2R8J A;  3OJU A;  3GDX A;  2AJQ A;  3G6X A;  3JPR A;  4F5N A;  3RJI A;  4DL2 A;  4MEY A;  5J0O A;  1TVA A;  9ICR A;  4IRC A;  3QZ7 A;  8ICG A;  1ZQH A;  8ICO A;  7ICF A;  4Z6D A;  3BJY A;  4DSE A;  2UVU A;  2ISP A;  2ZTC A;  4UB4 A;  4QWB A;  2C22 A;  4Q44 A;  2J6S A;  4ED2 A;  4O3O A;  4KLL A;  2UVR A;  4G3I A;  2HW3 A;  2FLN A;  2PFO A;  4FO6 A;  1JXE A;  8ICI A;  9ICX A;  5J2G A;  2BCU A;  8ICQ A;  3M8S A;  5DB7 A;  3SZ2 A;  3Q8K A;  9ICP A;  1D9D A;  5DBA A;  2P6R A;  4I2D A;  5KTQ A;  3PW7 A;  4DQI A;  1IXR A;  4QZ9 A;  5KG7 A;  3OJS A;  4RNO A;  4C8O A;  4KLG A;  4TQR A;  1ZJM A;  3PO5 A;  4DOA A;  3H8J A;  2AGO A;  5CA7 A;  4ECX A;  4M47 A;  3TAN A;  2PFN A;  2HVH A;  2F1I A;  4RZR A;  4YQW A;  2ALZ A;  1BPB A;  4YFK A;  1XU4 A;  3LWM A;  3RBE A;  1X9W A;  1MQ3 A;  4P4P A;  3EYZ A;  8ICV A;  2XGP A;  3V6K A;  4EBC A;  2WTF A;  1A77 A;  1ZQN A;  3C2L A;  1S10 A;  5III A;  4Q43 A;  2Y1I A;  2ASJ A;  4O5K A;  1XSN A;  3UXN A;  5DDY A;  8ICP A;  1QSY A;  2FPM A;  5DGB A;  5DLF A;  4EEY A;  4QWC A;  4M9N A;  2HHS A;  1MQ2 A;  4EBE A;  5KG5 A;  3BDP A;  3PR5 B;  1B22 A;  3V7L A;  4IQW A;  3C1Y A;  2R8H A;  1ZYQ A;  5J29 A;  3Q8P B;  4DSI A;  3N4M B;  1NK9 A;  3PX6 A;  4F93 B;  4I2A A;  4UB2 A;  3C2K A;  3QE9 Y;  1U45 A;  2BKE A;  9ICT A;  4YR2 A;  5F9N A;  4F50 A;  4RT3 A;  4Q45 A;  4YR3 A;  3UPQ A;  2ZJ8 A;  4TQS A;  4RPZ A;  3GFK B;  1BPZ A;  4UB3 A;  3Q8R B;  4ED8 A;  4O3S A;  2ZUB A;  1QLN A;  5F9L A;  4ELV A;  5DGA A;  2BQ3 A;  4I2F A;  4RQ4 A;  8ICN A;  5KFK A;  1T7P A;  8ICB A;  5JUM A;  4ECY A;  1XO1 A;  4PGY A;  5J2I A;  3RJF A;  4E0D A;  2VA8 A;  5J2H A;  4DF4 A;  3FYH A;  3RJJ A;  4J9Q A;  4LZD A;  2RDI A;  3ZD9 A;  4KLS A;  2RDJ A;  1EXN A;  2FMQ A;  2JEJ A;  4R8U B;  1ZJN A;  2KN7 A;  5J0Y A;  4TUP A;  5D46 A;  4KLD A;  5DBC A;  5J2J A;  1NK5 A;  4KN4 A;  3PW0 A;  4JV2 A;  4ED6 A;  7ICU A;  4YD2 A;  2UVV A;  3TI0 A;  3RJK A;  7ICT A;  1JX4 A;  4UBB A;  1QSS A;  4KLT A;  3C23 A;  1U4B A;  4DFK A;  2C2D A;  2XY7 A;  4QW9 A;  4DWI A;  2I9G A;  4XA5 A;  1X9S A;  2VA3 A;  1S77 D;  5KT5 A;  4RNM A;  2VAN A;  1ZQL A;  2J6U A;  4DEZ A;  4ECT A;  4IRK A;  3OGU A;  1MSW D;  3PVX A;  4RQ2 A;  4F4Y A;  2BCQ A;  3GIK A;  3KHH A;  5J2D A;  4F5Q A;  3BQ1 A;  5HMM A;  2R8I A;  4QWD A;  4MFA A;  3M9N B;  2BPC A;  4DQR A;  5DBB A;  4EBD A;  3HWT A;  3ISC A;  8ICJ A;  3RRG A;  3EW9 A;  1TKD A;  1SKW A;  4RNN A;  2Q0Z X;  1ZQV A;  3M9M B;  2JZB B;  2OWO A;  4F8R A;  3EPG A;  5KFQ A;  3T5J A;  4LZG A;  4XQ8 A;  4DSF A;  2PFQ A;  3RH4 A;  4I2H A;  2BQR A;  4KLO A;  3C1Z A;  1T8E A;  4NXZ A;  3MFH A;  2F1H A;  5J0W A;  2W8L A;  5KFB A;  5DB8 A;  4PH5 A;  1ZQA A;  5KG6 A;  2JEF A;  3RB3 A;  1S76 D;  4O3Q A;  1RPL A;  3MGI A;  4J9S A;  4F5O A;  4DS4 A;  5KFY A;  4RQ7 A;  4QZ8 A;  2BGW A;  2XO7 A;  4ELU A;  9ICI A;  4GC7 A;  1ZQC A;  5KFT A;  3E2E A;  3GV8 B;  5KFX A;  4FS1 A;  5CB1 A;  2BCV A;  4DSJ A;  4ECU A;  3V6J A;  1SL1 A;  2PXI A;  1ZQJ A;  5KG4 A;  3AU6 A;  3Q8L A;  2ASL A;  5IIJ A;  4O3N A;  1V9P A;  4GXK A;  1JN3 A;  4QZD A;  3MDA A;  3RRH A;  3T5K A;  2BCS A;  1L3T A;  1ZQE A;  2J6T A;  1RXW A;  9ICG A;  5KFE A;  3QZ8 A;  4RQ1 A;  2F1J A;  2FLP A;  2HHX A;  3TFS A;  4ELT A;  3B0X A;  3ZDA A;  3G6V A;  3SV3 A;  4QZG A;  3HPO A;  4NLK A;  8ICX A;  1KSP A;  5J0R A;  3ISD A;  3Q8Q B;  1LB2 B;  1KFS A;  1Z00 B;  1KDH A;  3PR4 A;  8ICA A;  5J0P A;  4DLG A;  5HNK A;  4MFC A;  4YG2 A;  5CWR A;  2ISO A;  2PI4 A;  4YMN A;  5EOZ A;  3TAQ A;  2PFP A;  2A1J B;  5KFW A;  4O3R A;  1NK6 A;  2I1Q A;  4TUS A;  2V4Q A;  2MUT B;  2BQU A;  1UA1 A;  1NK8 A;  3MBY A;  9ICQ A;  1S97 A;  4F2R A;  2AQ0 A;  4NM2 A;  5TZV A;  1RYR A;  4M2Y A;  4QZI A;  1NKB A;  3TFR A;  4F5R A;  2P6U A;  1BPD A;  5D49 A;  4DOC A;  1ZQX A;  2C2R A;  3H8S A;  4I28 A;  4QWA A;  4F4W A;  3G6Y A;  4M6W A;  2HVI A;  3M9O B;  5HML A;  3MR3 A;  4BXO B;  3KHR A;  1TAQ A;  1COO A;  4ED3 A;  1SKR A;  1DOQ A;  4F92 B;  5CHG A;  4DO9 A;  4NM1 A;  2HHV A;  4B9V A;  1NOM A;  2NRT A;  5IIK A;  5DQI A;  3ETL A;  4RPX A;  1TK0 A;  1SL2 A;  4I2C A;  5DDM A;  2W9B A;  5KG2 A;  4PPX A;  4QZF A;  4KLI A;  1L3U A;  2ASD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...