2MUTB

Solution structure of the f231l mutant ercc1-xpf dimerization region
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
b'MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA excision repair protein ERCC-1
publication title The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 19
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2mutB00
1B43A 4EBCA 4EZ6A 5L1IA 4IQVA 5KFRA 2ISOA 3PVXA 2JEFA 2HHQA 8ICTA 2C28A 5IIJA 2VA2A 4YXMA 3V7KA 2A1JB 2AQ0A 4EYIB 3SYZA 9ICMA 4QWBA 3FYHA 4UAWA 4DEZA 1BGXT 4RQ7A 2UVWA 4RQ8A 4YR0A 2W9BB 2PFPA 5J2DA 2FPLA 2RDIA 3JPTA 1S9FA 5HHHA 1D9FA 4DSJA 4M9NA 4DOCA 1SKSA 1ZETA 4I2AA 1XSPA 4YP3A 4UAYA 3UPQA 2WTFA 2Y1JA 1QSLA 2W8LA 3UQ2A 4YCXA 3N97B 4I2EA 4LZGA 2HVIA 3OSPA 4UB1A 4KLIA 1RPLA 4ECSA 2NRZA 3ISDA 3QZ8A 4ED6A 4C8LA 5IINA 4F8RA 3RAXA 2KFZA 3HT3A 3RBDA 4FBUA 1L3SA 4I28A 3RJEA 3EW9A 3PO4A 4O3SA 3RH4A 5KFUA 5J0SA 4DOBA 4UBCA 3OHBA 5KFGA 4F5QA 4R65A 4XUSA 2OWOA 2DFLA 2FPMA 1WCNA 5KFJA 5DDYA 4NXZA 5J2HA 4KLFA 4ECQA 4RPZA 1ZQBA 1JX4A 4J9MA 4M47A 4QZGA 1T3NA 3OGUA 3H7IA 2V9WA 1ZYQA 4BWJA 4DFMA 4DSFA 1TK8A 5KG5A 7ICEA 2ZJ8A 4JUZA 5DDMA 2IHMA 2UVVA 3RR8A 4DF4A 4KLMA 4KLOA 4MF8A 1JXEA 2F1HA 5DLFA 4YR2A 1DGSA 9ICSA 1ZQGA 4P4MA 4X5VA 4ELUA 4C8MA 5C5JA 1ZQSA 4IQWA 4QZCA 3H8JA 1AROP 3ZDEA 3UXOA 4PH5A 7ICSA 1U48A 1JN3A 4B9VA 8ICHA 1ZQFA 5J2AA 3TFRA 1SL2A 4CCHA 2KZ3A 4ECZA 5L1KA 4Q8FA 1XSNA 3BDPA 1S97A 1KSPA 2BQ3A 3M9OB 3PW0A 1U45A 2R8JA 5DG9A 5BOMA 5KFNA 5KT5A 1NK7A 2BCRA 4F2RA 4C8OA 5HMMA 4YMOA 3RJFA 4DOAA 4KLLA 2BDPA 2XY6A 4XRHA 3MABA 1ZQZA 3TANA 4QZHA 4B9NA 4MFFA 4R63A 2MUTB 7ICFA 3T5HA 4YG2A 4QZBA 2BR0A 1UT5A 3C5FA 3RB6A 2UVUA 5KFLA 8ICJA 2PXIA 2ZUDA 3ORYA 3UQ0A 1N48A 3JPSA 1JXLA 4DSLA 3OHAA 4I2BA 4IRDA 9ICVA 2ZTEA 3IHQB 5BPCA 2FLPA 1B22A 5DKWA 1HJPA 4KLDA 4RUAA 4DS4A 9ICHA 4UB3A 4B9TA 5CP2A 4MFCA 1QTMA 4XA5A 2XY5A 1RYRA 4QZAA 3Q8SB 1L3UA 1NJZA 3AU6A 9ICQA 2BKEA 4IQUA 1NK8A 2PI4A 3B0YA 3GV7B 1Z00B 5KFIA 4EBEA 1EXNA 8ICAA 3PMLA 4O5KA 2W9AA 3QEAZ 4O3PA 5J0PA 4ED3A 1HUOA 1KFSA 1K1QA 1PZNA 1ZQXA 2V4RA 3GQCA 4J9QA 4HYKA 3MGIA 4DL5A 2IMWP 4BXOA 3C1YA 4R64A 4EBDA 8ICRA 2F1IA 4ECWA 4RT2A 3EWAA 4M9JA 4R8UB 4YVZA 2Q0ZX 3JPRA 5EOZA 1L3VA 5J2IA 4ECTA 3MFIA 2HHWA 4PHPA 2BPGA 4O3RA 4I2GA 3RJJA 9ICOA 2I1QA 2UVRA 4GXJA 1CUKA 5J2FA 1D8YA 4DLEA 5CHGA 1DOQA 4TQRA 2XCAA 4FS2A 2DPIA 4F4XA 7ICIA 4DL7A 1NK9A 1BPEA 5J0YA 4Z6CA 3ZDDA 2C2EA 1TK5A 4F5PA 1NJXA 2FLLA 3G6VA 3ZDCA 5KFDA 4F93B 4YQWA 4I2HA 4K4IA 4KLHA 3PW2A 4F4ZA 2V4QA 4RUCA 5KFKA 1ZQTA 2NRWA 4UB2A 4ELTA 1SKRA 2IA6A 3QEBZ 4QZ8A 4ECRA 3GDXA 3H8WA 4QWEA 3PNCA 4F91B 4RPYA 1SKWA 1COOA 2JZBA 1U9LA 3NTUA 4Q43A 2FPKA 3RRHA 3V72A 5J0UA 4DFKA 4RQ5A 1K1SA 3H40A 3BQ1A 4LZDA 3C2KA 1SL0A 1KRPA 3RB3A 2P66A 4DQRA 3ISCA 3THVA 1U4BA 8ICKA 3ZDBA 4KLJA 4J9NA 1BVSA 3PR4A 1MQ2A 1C7YA 3GIJA 2NRTA 4ED1A 5BOLA 2HHUA 3RBEA 4DL2A 4M0AA 2W9MA 1RXWA 4BDPA 3M9NB 2KZZA 1Z3EB 5J0WA 9ICKA 1X9MA 3HP6A 2W9CA 1QSSA 3MBYA 5DB8A 1NJWA 5D4BA 5KG6A 4O3OA 5J0QA 4ECYA 1ZJMA 1Y88A 9ICXA 3MR2A 5DB9A 2A1JA 4ZH4A 4GXIA 1S0MA 5TZVA 3MDAA 1U49A 1NJYA 5KFAA 4ED2A 4NLKA 9ICEA 8ICUA 4UB4A 3GFKB 1X2IA 4DQSA 3C2LA 3K4GA 4I29A 5KFXA 7ICNA 5DQHA 5IIKA 1HUZA 4Q8EA 5EWGA 4IR9A 4DL4A 5J2CA 4FO6A 2VANA 5F9LA 2BCQA 1S10A 1ZQQA 7ICJA 3MDCA 4B9MA 2BGWA 3N4MB 1S0NA 4NLZA 1X9WA 4M2YA 4I2DA 1QSYA 5J2JA 2LYHA 3Q8QB 4O5CA 5KT4A 4UAZA 4PGXA 2FMPA 5DG7A 8ICNA 9ICPA 4F5RA 3Q8LA 9ICCA 1X9SA 2XY7A 4B9SA 5J0XA 2XGQA 5KFPA 5CJ7A 3TAQA 4EEYA 8ICZA 1ZQVA 3H4BA 3H8SA 1KLNA 4DFPA 4QWCA 3KHHA 1ZQMA 5J2BA 5HMLA 4DL6A 8ICMA 3GIMA 2NRVA 4RNMA 4EYHB 3V6HA 7ICVA 4BGDA 1ZQCA 5DB6A 3RJIA 3QZ7A 4KN7A 3MR5A 3RJKA 5KFCA 4IRKA 7ICHA 4P4OA 1V9PA 5KFZA 4IQTA 5D49A 2ALZA 3E2EA 4GXKA 1NK5A 3ZD9A 1ZQLA 1ZQOA 3ZDAA 4FBTA 4QZDA 2P6RA 4LVSA 5KFVA 4YD1A 5J2KA 3EPGA 3UXPA 2HHTA 4UB5A 2IHNA 4F4YA 4J9LA 5DG8A 1XSLA 2BPFA 4YD2A 1ZQNA 5CB1A 5EWFA 2R8HA 2FMSA 3T3FA 3RJGA 2PFQA 5KFBA 4P4PA 3RAQA 3SV4A 4KLUA 7ICRA 1ZQWA 4KTQA 2JEJA 4DQPA 3GV5B 5L1LA 4DF8A 5J2GA 4QZ9A 4KITB 4RQ1A 4JWMA 9ICWA 2F1JA 5IILA 2KZMA 1TV9A 3RR7A 4QWDA 2AGPA 2GWSA 4GLXA 5L1JA 4ED7A 1JMSA 4ED0A 4C8NA 2PFNA 4YXJA 4I2CA 5DQIA 3G6YA 2RDJA 4F2SA 4Z6DA 3JPNA 5DBCA 8ICFA 3RB4A 4R66A 1ZJNA 1ZQYA 1KFTA 1LB2B 5DBBA 4DWIA 1RYSA 4DLGA 3SZ2A 1UT8A 4KN4A 8ICSA 7ICLA 1S77D 3ZD8A 3HPOA 3EYZA 3PW5A 1NKEA 3PW7A 1T8EA 2R8GA 4IR1A 4PGQA 5KFTA 3LK9A 1LV5A 1ZQHA 1NK4A 1D8LA 4RQ4A 1RZTA 5DLGA 3V7JA 3C1ZA 3PV8A 4P2HA 1S76D 4M6WA 4PGYA 2BQRA 2J6TA 7ICUA 3PX6A 3OJSA 2VA8A 3V6JA 8ICCA 4RT3A 8ICQA 2R8KA 2PI5A 3TFSA 2J6UA 4E0DA 3PY8A 2ZJAA 3Q8KA 1ZQKA 3RRGA 5DGAA 2BCUA 1JIHA 4KMUA 3H4DA 2P6UA 5KFYA 3RTVA 2AGOA 1A77A 3KTQA 8ICLA 2JZBB 2XGPA 1KDHA 2KFNA 1BPBA 4NM2A 4R8UA 8ICGA 1KFDA 2ZUBA 1XU4A 3C21A 8ICWA 7ICTA 2ASJA 8ICXA 3KHGA 4F4WA 4RNNA 1BPZA 3QE9Y 1TK0A 2BQUA 2AQ4A 4PHAA 4RNOA 3ISBA 1N56A 5KT3A 4O9MA 2ZTDA 3BQTA 4O0IA 5DBAA 3KHLA 3V7LA 4J9KA 3T5LA 4QWAA 2W9CB 3LWMA 1KTQA 5CWRA 5KG4A 2ATLA 2XC9A 1S0VA 4TQSA 4QZIA 1BPDA 1ZQUA 4K4HA 8ICIA 4UQGA 2ISPA 3PMNA 3Q8RB 1T7PA 2PFOA 4ELVA 5KFQA 3OSNA 3KHRA 4B9UA 4QZFA 5CR0A 4C8KA 5IIIA 3B0XA 5KT7A 4DSIA 1NK0A 2BCVA 3BQ2A 4TURA 4XQ8A 4MEYA 4O3NA 5IIOA 3BQ0A 3TARA 2AGQA 2W9BA 4ECVA 1SZPA 4F92B 4NY8A 9ICBA 5KFSA 5HHIA 3Q8MA 4GC7A 4J9OA 3C2MA 2C2DA 2JEGA 2XO7A 3OJUA 4FS1A 3SV3A 4TUSA 1ZQPA 4M04A 7ICGA 5D46A 5KFFA 1U47A 2VA3A 2C2RA 4J9RA 5KFEA 5JUMA 1XO1A 4DQQA 1RXVA 3NGDA 1L5UA 1ZQJA 3LDAA 1TKDA 2XCPA 3MR6A 4MEXA 2HHXA 4I2JA 4TUPA 2H5XA 4RQ0A 4O5EA 1L3TA 1S0OA 4I27A 8ICBA 9ICUA 5KG1A 5CA7A 1TFRA 3K75D 4ECXA 4ED8A 2Y1IA 3M9MB 3RB0A 2ASDA 1SL1A 5J0TA 2NRXA 2ZJ5A 5DB7A 4YR3A 3LWLA 4GC6A 2AU0A 1MQ3A 4YMNA 4RZRA 2AJQA 1UA1A 1BPXA 5DGBA 2M9NA 3HWTA 4I2FA 3RH6A 2KTQA 4DQIA 9ICFA 4O3QA 4KLEA 1NKCA 1TAQA 1CEZA 2DPJA 4KLTA 1TAUA 4I2IA 9ICIA 3JPQA 4DS5A 9ICAA 9ICRA 2ASLA 1IM4A 4RQ3A 1ZQIA 4NLGA 5J29A 2KN7A 2J6SA 5KT6A 5J0OA 4RU9A 4M9LA 5J0RA 3T5JA 3FDSA 1NK6A 7ICQA 4PPXA 3HX0A 4YN4A 4YFKA 3GIKA 4DL3A 1UA0A 7ICOA 3C5GA 9ICNA 2BCSA 5KG0A 4F5NA 4MFAA 4NLNA 4G3IA 1QLNA 1KEJA 1NOMA 2FMQA 5IIMA 2IBKA 4KLQA 4KLSA 3PX0A 3G6XA 5KG2A 3IM1A 7ICMA 2R8IA 4QW8A 4K4GA 9ICTA 3MFHA 4DO9A 4F3OA 4JV0A 4J9PA 4IRCA 2MUTA 1A76A 3V6KA 3TI0A 1D9DA 7ICPA 2MAXA 4Z6FA 1IXRA 3M8SA 5F9NA 3T5KA 4PHDA 3ETLA 3PR5B 4BXOB 4JV1A 5KTQA 2ZTCA 3PX4A 4RQ6A 4UBBA 2HHVA 1ZQEA 1ZQAA 5KG7A 4DSKA 2W8KA 2FLNA 4MF2A 2JEIA 4M6WB 3RJHA 4DFJA 9ICLA 3BJYA 2HVHA 1XC9A 3JPOA 3C23A 1BPYA 1ZQDA 4Q44A 4ECUA 5KG3A 1H38A 1WCLA 4KLGA 3TQ1A 4JK1A 2HW3A 3AU2A 3UXNA 4BWMA 5KT2A 1XWLA 2BHNA 4QW9A 4F5OA 4DSEA 4RQ2A 2HHSA 4F50A 7ICKA 3JPPA 1Z00A 9ICJA 2ZUCA 4J9SA 4JWNA 2B21A 3HW8A 4YMMA 2C22A 4B9LA 5KFMA 4EZ9A 4F4KA 4NM1A 1T4GA 3TAPA 8ICVA 1MSWD 8ICYA 5KFWA 8ICPA 3Q8PB 4Z6EA 3GV8B 8ICEA 5HNKA 3GIIA 2I9GA 4M9HA 3PO5A 5KFHA 3EPIA 5KFOA 4JV2A 4TUQA 8ICOA 3AUOA 4PHEA 4Q45A 1ZQRA 4M9GA 1TVAA 4RPXA 4QZEA 9ICGA 3MGHA 5DQGA 5EWEA 2BPCA 3M8RA 5J2EA 5L9XA 3MR3A 3EZ5A 3PW4A 3SI8A 5HP4A 3RH5A 3GILA 1NKBA 1MC8A 1XS9D
chains in the Genus database with same CATH superfamily
1B43A 1Z19A 2JEFA 5ALGA 2A1JB 4EYIB 2LYBA 2UVWA 5HHHA 1ZETA 4I2AA 4RQMA 4YP3A 1VDVA 3FC4A 1CRXA 4I2EA 4UB1A 1RPLA 5FP0A 4ED6A 1V97A 3HT3A 1L3SA 4OJLA 3RF9A 4DOBA 5E79U 5KFGA 1SV0C 3WK6A 1NNLA 5KFJA 4NXZA 5AIBA 3HKZF 4KLFA 4ECQA 4RPZA 2E5SA 1T3NA 1RYUA 3R9KA 2PKEA 1TK8A 7ICEA 2IHMA 3RR8A 3SMVA 1JXEA 3LVWA 4YR2A 5DLFA 2K8CB 4C0ZA 1SZHA 3WK5A 5C5JA 1U48A 1JN3A 8ICHA 1ZQFA 4NL9C 2KIWA 3M9OB 1NK7A 5KFNA 1Z4OA 2BCRA 2HI0A 5JTIA 2BDPA 2KVSA 5AK3A 2YMQA 4R63A 4QZBA 2WHEA 8ICJA 1X9XA 3UQ0A 2EDUA 1N48A 2DUYA 5EE1A 2G07A 2FLPA 4BUGA 2JRZA 5ALQA 3DDHA 3PSIA 3SR6A 4XA5A 2A3VA 3TADC 5AM0A 4IQUA 3B0YA 5KFIA 4Y2RA 4ED3A 1HUOA 2IMWP 1ZQXA 3GQCA 4HYKA 1BNOA 4R64A 4ECWA 4RT2A 4M9JA 4O3MA 2WF5A 1SGGA 5J2IA 2PMZC 1MN8A 2BPGA 4O3RA 9ICOA 2QARB 3RJJA 2UVRA 5ALIA 1DOQA 2XCAA 1XO0A 5AK5A 3E0FA 1NJXA 4KLHA 3G6VA 5KFDA 4F4ZA 1SKRA 3QEBZ 4ECRA 4UATA 3PNCA 1SKWA 3V72A 3H40A 4B9LA 3RB3A 8ICKA 3ISCA 3ZDBA 4J9NA 1C7YA 3GIJA 1IIPA 4ED1A 2HHUA 4DL2A 1Z3EB 2WAQC 1X9MA 3KOOA 2OHFA 9ICXA 1Y88A 3MR2A 4ACOA 1N2XA 4DQSA 4GFJA 3QUCA 1UQVA 1X6JA 5DQHA 5IIKA 2ZIUA 4Q8EA 2VJ5A 2MSNA 1S10A 3KBBA 3MDCA 1ZRMA 3F2BA 3D6JA 4O5CA 4UAZA 2FMPA 9ICCA 1PVPA 2XY7A 5CRXA 2G06A 8ICZA 1MA7A 2WFAA 3QU9A 4DFPA 1ZQMA 1S5LU 2NRVA 4RNMA 7ICVA 4BGDA 3RJIA 2KP7A 4KN7A 4IRKA 2EZZA 4PZOA 4P4OA 2G09A 4UARA 1NK5A 3B9JA 3ZD9A 4QZDA 5KFVA 4YD1A 2YMLA 3EPGA 2JHDA 4UB5A 2IHNA 1XSLA 1ZQNA 1B22A 2FMSA 4KLUA 2EAOA 3T3FA 3RAQA 3SV4A 5AKIA 1N61A 4QJFB 4KITB 2LI6A 4JWMA 2KZMA 3U26A 4QWDA 4NWIA 3F2CA 4PL2A 4C8NA 1J2NA 3G6YA 3JPNA 2DGZA 5DBCA 8ICFA 1ZJNA 3SZ2A 1UT8A 3NS1A 4KMOB 3PW5A 3EYZA 3CNHA 2HMXA 3LK9A 1DK3A 1Z1BA 4AYBF 4CGZA 2BQRA 7ICUA 8ICCA 2VA8A 3V6JA 2R8KA 2WF9A 4ICAA 3PY8A 3Q8KA 3QUTA 3BS7A 5DGAA 2BCUA 4U6PA 4KMUA 4WJ3B 2EAPA 1A77A 1B0XA 3KTQA 1F5SA 8ICLA 1SXEA 1KFDA 1XU4A 3KHGA 5ALPA 2BQUA 5AIAA 1N56A 2EZXA 4O9MA 2DKZA 1KTQA 2XC9A 1S0VA 1BPDA 1ZQUA 4K4HA 8ICIA 4UQGA 1FFUA 5AM2A 3Q8RB 2ISPA 2QB0A 5KT7A 4DSIA 2BCVA 2AGQA 4F92B 2ZIUB 5KFSA 3C2MA 2JEGA 3OJUA 7ICGA 1ZQPA 4OJOA 2C2RA 4J9RA 5KFEA 1WUDA 2GLEA 3QU5A 1L5UA 1ZQJA 1NZBA 1SWVA 4I2JA 4RQ0A 9ICUA 3SEIA 4ED8A 4KX5A 3RB0A 4GC6A 5J0TA 2HCFA 2OH2A 1MQ3A 3KKAC 3O0FA 1UA1A 2CRXA 2GH1A 3HWTA 1L6NA 1CEZA 1NKCA 2DPJA 1TAUA 1BNPA 2F8LA 5ALKA 2RLTA 2YB1A 2ASLA 5J29A 2KN7A 2G5HB 5J0OA 5EE0A 1NK6A 7ICQA 3N7PD 3PSFA 4OO1J 2ZXIA 3HX0A 4YN4A 4DL3A 5AM4A 4G3IA 2LBOA 1NOMA 3IM1A 1N62A 2R8IA 1ZQ1C 4QW8A 2G5IB 4DO9A 4F3OA 4JV0A 2WB1C 1XNSA 4Z6FA 2YMMA 1SV0A 1C20A 4BXOB 4JV1A 1ZQEA 3WK4A 2FLNA 4Y2TA 3RJHA 2OEHA 5AKHA 9ICLA 2HVHA 3SENA 5ALDA 4Q44A 1WCLA 3WK9A 4JK1A 5KT2A 2BHNA 4QW9A 4F5OA 2HHSA 7ICKA 9ICJA 2ZUCA 4J9SA 4YMMA 3TAPA 4NL9A 4NV0A 3LVVA 8ICPA 4PZNA 8ICEA 5AI9A 5KFHA 3QUQA 8ICOA 3AUOA 9ICGA 4QZEA 3MGHA 5EWEA 5HP4A 3H0RB 3C28A 1MC8A 5L1IA 4CE6A 5G5HA 5KFRA 2ISOA 1X66A 3I1YA 3UMCA 3PVXA 1DGJA 4CF3A 1OXJA 2VA2A 2AQ0A 5GTHU 1BGXT 2DBYA 4YR0A 2ZIXA 2PFPA 1D9FA 3TADA 3AQFA 2YTUA 3UQ2A 2HVIA 3OSPA 3CRXA 4ECSA 2NRZA 4B6JA 4F8RA 3F5AA 2D3DA 3L5KA 4FFDA 1QQ7A 3DV9A 1P7DA 3RH4A 5J0SA 2OXOA 2A19A 3NVVA 3OHBA 2P35A 2FPMA 5DDYA 5J2HA 3TACB 1ZD3A 3H7IA 2V9WA 5KG5A 5K4LA 2ZJ8A 4JUZA 5DDMA 1O03A 4DF4A 5AM1A 9ICSA 1L7MA 3QYPA 2AHOB 1ZQSA 4QZCA 3H8JA 4HAIA 4PH5A 4PJ0U 2DF4B 4CCHA 5AI5A 4ECZA 5L1KA 4OD0A 1VLBA 1S97A 1KSPA 2BQ3A 4F2RA 5BOMA 2H3IA 3RJFA 2VIXA 4XRHA 4QZHA 4MFFA 7ICFA 1HEKA 3T5HA 5KAIU 5C0YA 1YZ6A 1CI4A 2QB1A 5KFLA 2UVUA 2VJ4A 1JXLA 2YMPA 3OHAA 4DSLA 2K4IA 4IRDA 5BPCA 5DKWA 1L7NA 4KLDA 4RUAA 3UMBA 5CP2A 1JUDA 2A1AA 1RYRA 2KG5A 3WKEA 4QZAA 3Q8SB 1NJZA 3IRUA 2XVTA 3CYMA 9ICQA 3WKAA 1NK8A 3GV7B 2WF7A 5AM5A 1K1QA 2K4PA 4J9QA 1B4FA 2VKQA 2KOBA 2F1IA 1Q3UA 2KV2A 3ZI4A 1DXSA 2WF8A 4R8UB 1L3VA 3MFIA 1QH9A 4I2GA 4GXJA 4DLEA 5AM3A 4TQRA 2ZIWA 4F4XA 2ODGA 2FLLA 3ZDCA 4F93B 4K4IA 2KHVA 5KFKA 5AHXA 4UB2A 4ELTA 3QU7A 1ZD5A 4RPYA 3TKAA 4Q43A 2ZIXB 5J0UA 1F44A 4DFKA 1K1SA 2KSOA 4LZDA 1KRPA 2NRTA 5BOLA 1RXWA 4BDPA 2KZZA 3MBYA 2G08A 5DB8A 2PMZF 5J0QA 3C29A 4ECYA 4ZH4A 4GXIA 1S0MA 4NLKA 3GU3A 1U49A 1NJYA 4ED2A 9ICEA 8ICUA 4UB4A 3K4GA 4I29A 2D6FC 7ICNA 5ALMA 3WU2U 4IR9A 4DL4A 5F9LA 7ICJA 3AEVA 1S0NA 4F72A 2LYHA 2IOFA 8ICNA 1UPHA 3CP8A 4PGXA 9ICPA 3M6ZA 1X9SA 4B9SA 5J0XA 1L7PA 5CJ7A 3TAQA 1KLNA 4QWCA 2F77X 3V6HA 4Y2YA 1X6IA 5DB6A 2KKPA 2OCEA 7ICHA 4IQTA 4DFDA 4P0PA 1ZQOA 2HSZA 1J97A 2P6RA 2LM1A 5J2KA 1UCVA 2K4EA 4F4YA 5DG8A 5CB1A 5KFBA 4P4PA 2KJ8A 1ZQWA 5ALEA 3GV5B 4DF8A 5KNIA 4CF4A 5J2GA 2HBJA 9ICWA 2F1JA 5IILA 1TV9A 4C7ZA 5G5GA 2AGPA 2GWSA 4GLXA 3L3FX 4ED0A 1JMSA 2PFNA 4YXJA 4F2SA 5AI6A 4Z6DA 1ZQYA 4DWIA 3KFUF 1RG6A 4USAA 1RYSA 1TAMA 1D8BA 2N1RA 3HPOA 3PW7A 1PK1A 4UB8U 1LV5A 3KKAA 1NK4A 2HBKA 3MGVA 3IDWA 3V7JA 4AP9A 3PV8A 1X42A 4P2HA 4M6WA 4PGYA 3SAFA 2E1EA 5AKLA 4RT3A 8ICQA 3TFSA 2J6UA 3HILA 5EE9A 5AK6A 5ALVA 5AK4A 2P6UA 3RTVA 2AGOA 3BQ7A 2XGPA 2HBMA 2ZUBA 2ASJA 3BS5A 1N5XA 3BQTA 4J9KA 2K8AA 4BJQA 3HKZC 4QZIA 5AI0A 3OSNA 4B9UA 4EEKA 2PFQA 4MEYA 5IIOA 2W9BA 1KQQA 2JR5A 5ALNA 1COKA 4FS1A 3SV3A 4TUSA 5D46A 4IS7A 2VA3A 5JUMA 4P0QA 3PZPA 1Q8KA 5CEHA 2XCPA 3MR6A 2HHXA 3RFAA 2Y0SF 4TUPA 1DK2A 2H5XA 4C4SA 2W7OA 4O5EA 1S0OA 5KG1A 5CA7A 1TFRA 2ASDA 1SL1A 4YR3A 2E8OA 3SQIA 2AJQA 5B5EU 4LJXA 5DGBA 4DQIA 9ICFA 4O3QA 4CF5A 4Y2VA 4KLTA 9ICIA 4DS5A 2J6SA 5KT6A 4NLBA 4PPXA 2W04A 7ICOA 3C5GA 2KD1A 5AICA 2BCSA 1K5OA 1OUQA 4KLQA 1N5WA 2KIVA 7ICMA 3L4PA 9ICTA 4J9PA 4IRCA 3V6KA 2MAXA 1IXRA 5ALRA 4C7YA 4PHDA 1PK1B 3PR5B 4C4RA 2ZIVA 5KTQA 4RQ6A 2F44A 4DSKA 4MF2A 4M6WB 5KL1B 2I5HA 4DFJA 3GZFA 3BJYA 2LPEA 2AH5A 2HW3A 3AU2A 3UXNA 1XWLA 3JPPA 4JWNA 3UM9A 2B21A 1YZ7A 4EZ9A 4F4KA 1T4GA 4EENA 5KFWA 3Q8PB 4Z6EA 3GV8B 2I9GA 3EPIA 3BS5B 4JV2A 4TUQA 4PHEA 4Q45A 1ZQRA 2KVCA 1TVAA 8ICBA 2BPCA 3RH5A 5J2EA 3M1YA 5B66U 4EZ6A 3WKDA 2JMGA 2F76X 2ZG6A 2E3TA 3SAHA 2C28A 4CNQA 5IIJA 4YXMA 3V7KA 4ZOHC 9ICMA 4QWBA 4UAWA 4DEZA 4RQ7A 1PUZA 2RHFA 2W9BB 2F2AB 5J2DA 5ALJA 2I6XA 4DSJA 2KJ5A 5JU5A 1XSPA 2EQYA 3UPQA 4QIWF 4IC9A 3HRDD 4KLIA 4C8LA 3ISDA 4JMUA 2KFZA 3WK7A 4FBUA 4I28A 2KHQA 3RJEA 3EW9A 4O3SA 1DRGA 4UBCA 5JRTA 4DCCA 3K1RB 4XUSA 2OWOA 1PVRA 2DFLA 1ZD2P 1WCNA 5ALYA 1ZQBA 1JX4A 4J9MA 4M47A 2XICA 4DSFA 3D2NA 2F1HA 2B0CA 1DGSA 1ZQGA 3PSTA 4ELUA 1N63A 2JGAA 3ZDEA 2H3FA 3D2SA 4B9VA 3CW2C 3TFRA 3J81j 3QUBA 4Q8FA 5HR6A 1XSNA 3BDPA 2M0NA 5KT5A 4C8OA 5HMMA 4AYBC 4KLLA 1RM6C 3MABA 5ALLA 4Y2UA 3C5FA 2ZIVB 2ZUDA 3WK8A 1N60A 1RQNA 3E58A 2HOFA 4I2BA 2HOIA 2ZTEA 1FFVA 3IHQB 2L5YA 1HJPA 9ICHA 1O08A 4B9TA 1WWUA 1L3UA 2BKEA 5GTIU 2F8KA 2PI4A 1EXNA 3QEAZ 4O3PA 1PZNA 4DL5A 2V4RA 3MGIA 4FZNA 3C1YA 4EBDA 3EWAA 4Y2QA 4YVZA 3JPRA 5EOZA 2HHWA 2HOQA 2I1QA 5J2FA 2Z7JA 4FS2A 2DPIA 4DL7A 1NK9A 1BPEA 4Z6CA 4F5PA 3QU4A 2AXTU 4I2HA 1L8LA 2V4QA 4RUCA 5KAFU 3H0LB 2NRWA 2IA6A 1QQ6A 4QZ8A 3GDXA 2QB0B 1COOA 2JZBA 2D8CA 3NTUA 1SL0A 3BQ1A 8ICYA 1T94A 1U4BA 4KX3A 1BVSA 2K8BB 5AKZA 2W9MA 3M9NB 3ETRA 5J0WA 9ICKA 3HP6A 2YQEA 5ALTA 3A0BU 2DQNB 1NJWA 2NO5A 3K1ZA 4O3OA 5KG6A 1ZJMA 5DB9A 2A1JA 5KFAA 1JI7A 4IL6U 1X2IA 3SD7A 1HUZA 3QX7A 2ZXHA 3NASA 5J2CA 2VANA 2W3SA 1ZQQA 2BGWA 3N4MB 1QSYA 5J2JA 2JV3A 2IOFK 4F5RA 4JB3A 1V85A 5KFPA 4EELA 2O6KA 4Y2SA 5J2BA 5ALUA 5HMLA 3QZ7A 3MR5A 3RJKA 5KFCA 5KFZA 5D49A 1ZQLA 3ZDAA 1GO3F 2HHTA 4UW9A 4J9LA 2BPFA 2R8HA 3RJGA 1Z4NA 7ICRA 2W3RA 4KTQA 1FIQA 1LKYA 2JEJA 2RRDA 3RR7A 3AQEA 4ED7A 4I2CA 2JXJA 3NRWA 1KFTA 1KN5A 1LB2B 3F5EA 4DLGA 2QLTA 4KN4A 1LVHA 3DEEA 2R8GA 4IR1A 4PGQA 1ZQHA 1HIWA 1D8LA 4RQ4A 1RZTA 3C1ZA 1S76D 1NZPA 3PX6A 3OJSA 2E8MA 4E0DA 4OCZA 2CXYA 1ZQKA 3H4DA 2CN1A 3WKCA 2JZBB 4FZLA 4UB6U 3ED5A 2F3NA 2EH9A 3C21A 7ICTA 4RNNA 4RQNA 1BPZA 3QE9Y 3NUQA 1TK0A 3VC8A 4PHAA 5KT3A 2KNJA 5DBAA 4O0IA 3KHLA 1QQ5A 3I76A 3AL0B 2ATLA 4TQSA 3M6KA 3KHRA 4QZFA 5CR0A 4C8KA 4O3NA 3BQ0A 1SZPA 9ICBA 5HHIA 4GC7A 2H3ZA 2W11A 1NI3A 4M04A 5KFFA 1U47A 1XO1A 4DQQA 3NGDA 5AKEA 3LDAA 3SAGA 1TKDA 2DKXA 1VJ5A 1L3TA 4I27A 3K75D 4ECXA 3LYSA 5A0LA 2Y1IA 3M9MB 5DB7A 3F2DA 1SXDA 4U7CA 1ZOLA 2WAQF 2BZFA 1V38A 1BPXA 2KTQA 4I2FA 5ALOA 1TAQA 3EUB2 4I2IA 1WWVA 9ICAA 4RQ3A 1ZQIA 4NLGA 3I28A 4RU9A 5J0RA 3T5JA 1A6SA 5J8YC 1PK3A 3FDSA 1LKYB 1SV4A 4YFKA 3GIKA 9ICNA 5KG0A 4F5NA 4NLNA 1KEJA 2FMQA 5IIMA 3PX0A 2OYYA 5KG2A 3H8MA 2W7PA 4Y2XA 3AM9A 2QKQA 2MUTA 1A0PA 1D9DA 4PL1A 5F9NA 3ETLA 4C4TA 2ZTCA 2K89A 2HHVA 5KG7A 5F3XB 3N28A 2EAMA 3C23A 3N7RC 1BPYA 3VCBA 5KG3A 1H38A 3TQ1A 4BWMA 2ZIWB 3ONNA 1WG8A 4FE3A 4RQ2A 1Z00A 1JRPA 2C22A 5KFMA 2DL0A 3QU2A 3AMZA 2Q4TA 4OJ5A 4US8A 3N7SC 5HNKA 4M9HA 3PO5A 3HJEA 2KSOB 4RPXA 5H2FU 5DQGA 3M8RA 3SI8A 5L9XA 3PW4A 1ZQTA 4J03A 2Y9UA 1ZXIA 4EBCA 1URJA 4IQVA 2KK0A 2HHQA 2G0AA 8ICTA 1X40A 5AKJA 3SYZA 3FYHA 5ALZA 4GIBA 4OJPA 4RQ8A 2FPLA 2RDIA 3JPTA 3IG8A 1S9FA 4M9NA 4DOCA 1SKSA 4UAYA 2WTFA 1OW5A 1QCKA 2Y1JA 3H0MB 1QSLA 2W8LA 4YCXA 3N97B 4LZGA 4BX9C 3QZ8A 1S8OA 5IINA 3RAXA 1YT3A 3RBDA 3PO4A 5KFUA 4F5QA 4R65A 4US9A 2KICA 3WKBA 4CDGA 4QZGA 5AI4A 3OGUA 1RDFA 1ZYQA 3FAHA 4BWJA 4DFMA 2UVVA 2NV3A 4KLMA 4KLOA 4P0PB 4MF8A 2JH1A 4P4MA 4X5VA 4C8MA 2E8NA 4IQWA 1AROP 3S6JA 3UXOA 1FO4A 7ICSA 2LKYA 5J2AA 1SL2A 2KZ3A 4A8EA 2EZYA 1U45A 3PW0A 2R8JA 5DG9A 5L1MA 5EE3A 4YMOA 5ALSA 4DOAA 2XY6A 1TE2A 1ZQZA 3OPXA 3TANA 3AN1A 4B9NA 3IN5A 2MUTB 4YG2A 1RQLA 2BR0A 1UT5A 3RB6A 2PXIA 3ORYA 3JPSA 9ICVA 1ZD4A 5ALWA 4DS4A 4G9BA 4UB3A 4MFCA 1QTMA 2XY5A 3AU6A 3OTQA 1Z00B 4EBEA 8ICAA 4UAUA 3PMLA 2W9AA 4O5KA 4NLCA 5J0PA 3A0HU 1KFSA 4B9MA 4BXOA 1Z1VA 2K4HA 8ICRA 2W43A 1JROA 4QNLA 2WB1F 2Q0ZX 2YY6A 5AI8A 4ECTA 4PHPA 1CUKA 1D8YA 5CHGA 7ICIA 5J0YA 3ZDDA 2NO4A 2C2EA 1TK5A 1IV8A 4YQWA 3PW2A 3KZIU 3NVYA 3H8WA 2XI9A 4QWEA 2R18A 4F91B 3BZCA 1U9LA 2FPKA 3RRHA 2HBLA 4RQ5A 2P66A 3C2KA 2Y0SC 4F71A 2EANA 1Q3VA 4EX7A 4DQRA 3THVA 4KLJA 3ICXA 3PR4A 1MQ2A 3M7DA 2FE9A 3RBEA 4M0AA 2ESEA 4P0QB 1QSSA 2W9CA 1IG6A 5D4BA 2FDRA 4CRXA 3D2QA 5TZVA 3MDAA 2W03A 3GFKB 3C2LA 5KFXA 5EWGA 2BDUA 4FO6A 2BCQA 3ALRA 2E1FA 4NLZA 4C80A 1X9WA 3IP4B 4M2YA 4I2DA 3F53A 1ECWA 3Q8QB 2CPRA 5KT4A 5DG7A 3Q8LA 2LMRA 2LM4A 2XGQA 2W54A 4EEYA 1ZQVA 3H4BA 3H8SA 1SIJA 8ICMA 3KHHA 1WYGA 4DL6A 3GIMA 4EYHB 1ZQCA 1KW4A 1V9PA 3FM9A 2ALZA 3E2EA 4GXKA 4FBTA 4OJ6A 4LVSA 2KE7A 3UXPA 1SB3C 4YD2A 2H3QA 5EWFA 3MC1A 1J2MA 4DQPA 2DWQA 5L1LA 2LYAA 4QZ9A 4RQ1A 2FI1A 2JH7A 2HDOA 5L1JA 5DQIA 2RDJA 3RB4A 4R66A 5DBBA 2KKVA 8ICSA 7ICLA 5T14A 1S77D 3ZD8A 1NKEA 1T8EA 5KFTA 3PSPA 2KMDA 2OM6A 3QNMA 4Y2JA 5DLGA 1L7OA 2J6TA 2FJ6A 3KD3A 2PI5A 2ZJAA 3RRGA 5HR7A 2LHTA 1JIHA 2ES6A 3IV6A 5J8YA 5KFYA 2XIDA 2GOLA 1T3QA 1KDHA 2KFNA 1BPBA 4QIWC 4NM2A 4R8UA 8ICGA 8ICWA 8ICXA 4F4WA 2IOHA 2AQ4A 3ISBA 4RNOA 1PVQA 2ZTDA 2K60A 2KJ9A 3V7LA 3T5LA 4QWAA 2W9CB 3LWMA 5CWRA 3IG5A 5KG4A 3NRZA 1Q46A 2RP5A 3PMNA 1T7PA 2PFOA 4ELVA 4EX6A 5KFQA 5AKKA 3T79A 5IIIA 3B0XA 5ALXA 1NK0A 3BQ2A 4TURA 4XQ8A 3TARA 4ECVA 4NY8A 2E8PA 5TISU 3Q8MA 4J9OA 2C2DA 3UMGA 2XO7A 1SWWA 1RXVA 1JALA 2WF6A 4MEXA 5KL8B 1M6YA 2IBKA 3NVZA 2NRXA 2YX8A 2ZJ5A 3LWLA 2AU0A 2KEYA 4YMNA 4RZRA 2M9NA 3RH6A 4KLEA 1ZRNA 3JPQA 9ICRA 5AKYA 1IM4A 1ED1A 4M9LA 5AKXA 1UHUA 1UA0A 2NYVA 4MFAA 4UAVA 1QLNA 4FZMA 4KLSA 5AKGA 3G6XA 4NJ8A 4K4GA 3MFHA 2RQ5A 1F0MA 1A76A 3TI0A 2MU2A 7ICPA 1KL9A 3M8SA 3T5KA 2B6GA 4Y2PA 3BZKA 3PX4A 4UBBA 1ZQAA 1KBUA 2Y9TA 3KZXA 1AQ6A 3NVWA 5ALFA 2W8KA 1KKXA 2JEIA 1FEZA 1XC9A 3JPOA 1ZQDA 4ECUA 3QXGA 5ALHA 2YB4A 4KLGA 4MHVA 2H3VA 4DSEA 4F50A 3HW8A 4NM1A 2MRLA 8ICVA 2MA1A 2YN4A 1MSWD 3GIIA 2GO7A 5KFOA 1L8OA 4M9GA 2W55A 2QARA 3EZ5A 3MR3A 1NKBA 3GILA 4UASA 1XS9D
chains in the Genus database with same CATH topology
1B43A 4EBCA 4EZ6A 5L1IA 4IQVA 5KFRA 2ISOA 3PVXA 2JEFA 2HHQA 8ICTA 2C28A 5IIJA 2VA2A 4YXMA 3V7KA 2A1JB 2AQ0A 4EYIB 3SYZA 9ICMA 4QWBA 3FYHA 4UAWA 4DEZA 1BGXT 4RQ7A 2UVWA 4RQ8A 4YR0A 2W9BB 2PFPA 5J2DA 2FPLA 2RDIA 3JPTA 1S9FA 5HHHA 1D9FA 4DSJA 4M9NA 4DOCA 1SKSA 1ZETA 4I2AA 1XSPA 4YP3A 4UAYA 3UPQA 2WTFA 2Y1JA 1QSLA 2W8LA 3UQ2A 4YCXA 3N97B 4I2EA 4LZGA 2HVIA 3OSPA 4UB1A 4KLIA 1RPLA 4ECSA 2NRZA 3ISDA 3QZ8A 4ED6A 4C8LA 5IINA 4F8RA 3RAXA 2KFZA 3HT3A 3RBDA 4FBUA 1L3SA 4I28A 3RJEA 3EW9A 3PO4A 4O3SA 3RH4A 5KFUA 5J0SA 4DOBA 4UBCA 3OHBA 5KFGA 4F5QA 4R65A 4XUSA 2OWOA 2DFLA 2FPMA 1WCNA 5KFJA 5DDYA 4NXZA 5J2HA 4KLFA 4ECQA 4RPZA 1ZQBA 1JX4A 4J9MA 4M47A 4QZGA 1T3NA 3OGUA 3H7IA 2V9WA 1ZYQA 4BWJA 4DFMA 4DSFA 1TK8A 5KG5A 7ICEA 2ZJ8A 4JUZA 5DDMA 2IHMA 2UVVA 3RR8A 4DF4A 4KLMA 4KLOA 4MF8A 1JXEA 2F1HA 5DLFA 4YR2A 1DGSA 9ICSA 1ZQGA 4P4MA 4X5VA 4ELUA 4C8MA 5C5JA 1ZQSA 4IQWA 4QZCA 3H8JA 1AROP 3ZDEA 3UXOA 4PH5A 7ICSA 1U48A 1JN3A 4B9VA 8ICHA 1ZQFA 5J2AA 3TFRA 1SL2A 4CCHA 2KZ3A 4ECZA 5L1KA 4Q8FA 1XSNA 3BDPA 1S97A 1KSPA 2BQ3A 3M9OB 3PW0A 1U45A 2R8JA 5DG9A 5BOMA 5KFNA 5KT5A 1NK7A 2BCRA 4F2RA 4C8OA 5HMMA 4YMOA 3RJFA 4DOAA 4KLLA 2BDPA 2XY6A 4XRHA 3MABA 1ZQZA 3TANA 4QZHA 4B9NA 4MFFA 4R63A 2MUTB 7ICFA 3T5HA 4YG2A 4QZBA 2BR0A 1UT5A 3C5FA 3RB6A 2UVUA 5KFLA 8ICJA 2PXIA 2ZUDA 3ORYA 3UQ0A 1N48A 3JPSA 1JXLA 4DSLA 3OHAA 4I2BA 4IRDA 9ICVA 2ZTEA 3IHQB 5BPCA 2FLPA 1B22A 5DKWA 1HJPA 4KLDA 4RUAA 4DS4A 9ICHA 4UB3A 4B9TA 5CP2A 4MFCA 1QTMA 4XA5A 2XY5A 1RYRA 4QZAA 3Q8SB 1L3UA 1NJZA 3AU6A 9ICQA 2BKEA 4IQUA 1NK8A 2PI4A 3B0YA 3GV7B 1Z00B 5KFIA 4EBEA 1EXNA 8ICAA 3PMLA 4O5KA 2W9AA 3QEAZ 4O3PA 5J0PA 4ED3A 1HUOA 1KFSA 1K1QA 1PZNA 1ZQXA 2V4RA 3GQCA 4J9QA 4HYKA 3MGIA 4DL5A 2IMWP 4BXOA 3C1YA 4R64A 4EBDA 8ICRA 2F1IA 4ECWA 4RT2A 3EWAA 4M9JA 4R8UB 4YVZA 2Q0ZX 3JPRA 5EOZA 1L3VA 5J2IA 4ECTA 3MFIA 2HHWA 4PHPA 2BPGA 4O3RA 4I2GA 3RJJA 9ICOA 2I1QA 2UVRA 4GXJA 1CUKA 5J2FA 1D8YA 4DLEA 5CHGA 1DOQA 4TQRA 2XCAA 4FS2A 2DPIA 4F4XA 7ICIA 4DL7A 1NK9A 1BPEA 5J0YA 4Z6CA 3ZDDA 2C2EA 1TK5A 4F5PA 1NJXA 2FLLA 3G6VA 3ZDCA 5KFDA 4F93B 4YQWA 4I2HA 4K4IA 4KLHA 3PW2A 4F4ZA 2V4QA 4RUCA 5KFKA 1ZQTA 2NRWA 4UB2A 4ELTA 1SKRA 2IA6A 3QEBZ 4QZ8A 4ECRA 3GDXA 3H8WA 4QWEA 3PNCA 4F91B 4RPYA 1SKWA 1COOA 2JZBA 1U9LA 3NTUA 4Q43A 2FPKA 3RRHA 3V72A 5J0UA 4DFKA 4RQ5A 1K1SA 3H40A 3BQ1A 4LZDA 3C2KA 1SL0A 1KRPA 3RB3A 2P66A 4DQRA 3ISCA 3THVA 1U4BA 8ICKA 3ZDBA 4KLJA 4J9NA 1BVSA 3PR4A 1MQ2A 1C7YA 3GIJA 2NRTA 4ED1A 5BOLA 2HHUA 3RBEA 4DL2A 4M0AA 2W9MA 1RXWA 4BDPA 3M9NB 2KZZA 1Z3EB 5J0WA 9ICKA 1X9MA 3HP6A 2W9CA 1QSSA 3MBYA 5DB8A 1NJWA 5D4BA 5KG6A 4O3OA 5J0QA 4ECYA 1ZJMA 1Y88A 9ICXA 3MR2A 5DB9A 2A1JA 4ZH4A 4GXIA 1S0MA 5TZVA 3MDAA 1U49A 1NJYA 5KFAA 4ED2A 4NLKA 9ICEA 8ICUA 4UB4A 3GFKB 1X2IA 4DQSA 3C2LA 3K4GA 4I29A 5KFXA 7ICNA 5DQHA 5IIKA 1HUZA 4Q8EA 5EWGA 4IR9A 4DL4A 5J2CA 4FO6A 2VANA 5F9LA 2BCQA 1S10A 1ZQQA 7ICJA 3MDCA 4B9MA 2BGWA 3N4MB 1S0NA 4NLZA 1X9WA 4M2YA 4I2DA 1QSYA 5J2JA 2LYHA 3Q8QB 4O5CA 5KT4A 4UAZA 4PGXA 2FMPA 5DG7A 8ICNA 9ICPA 4F5RA 3Q8LA 9ICCA 1X9SA 2XY7A 4B9SA 5J0XA 2XGQA 5KFPA 5CJ7A 3TAQA 4EEYA 8ICZA 1ZQVA 3H4BA 3H8SA 1KLNA 4DFPA 4QWCA 3KHHA 1ZQMA 5J2BA 5HMLA 4DL6A 8ICMA 3GIMA 2NRVA 4RNMA 4EYHB 3V6HA 7ICVA 4BGDA 1ZQCA 5DB6A 3RJIA 3QZ7A 4KN7A 3MR5A 3RJKA 5KFCA 4IRKA 7ICHA 4P4OA 1V9PA 5KFZA 4IQTA 5D49A 2ALZA 3E2EA 4GXKA 1NK5A 3ZD9A 1ZQLA 1ZQOA 3ZDAA 4FBTA 4QZDA 2P6RA 4LVSA 5KFVA 4YD1A 5J2KA 3EPGA 3UXPA 2HHTA 4UB5A 2IHNA 4F4YA 4J9LA 5DG8A 1XSLA 2BPFA 4YD2A 1ZQNA 5CB1A 5EWFA 2R8HA 2FMSA 3T3FA 3RJGA 2PFQA 5KFBA 4P4PA 3RAQA 3SV4A 4KLUA 7ICRA 1ZQWA 4KTQA 2JEJA 4DQPA 3GV5B 5L1LA 4DF8A 5J2GA 4QZ9A 4KITB 4RQ1A 4JWMA 9ICWA 2F1JA 5IILA 2KZMA 1TV9A 3RR7A 4QWDA 2AGPA 2GWSA 4GLXA 5L1JA 4ED7A 1JMSA 4ED0A 4C8NA 2PFNA 4YXJA 4I2CA 5DQIA 3G6YA 2RDJA 4F2SA 4Z6DA 3JPNA 5DBCA 8ICFA 3RB4A 4R66A 1ZJNA 1ZQYA 1KFTA 1LB2B 5DBBA 4DWIA 1RYSA 4DLGA 3SZ2A 1UT8A 4KN4A 8ICSA 7ICLA 1S77D 3ZD8A 3HPOA 3EYZA 3PW5A 1NKEA 3PW7A 1T8EA 2R8GA 4IR1A 4PGQA 5KFTA 3LK9A 1LV5A 1ZQHA 1NK4A 1D8LA 4RQ4A 1RZTA 5DLGA 3V7JA 3C1ZA 3PV8A 4P2HA 1S76D 4M6WA 4PGYA 2BQRA 2J6TA 7ICUA 3PX6A 3OJSA 2VA8A 3V6JA 8ICCA 4RT3A 8ICQA 2R8KA 2PI5A 3TFSA 2J6UA 4E0DA 3PY8A 2ZJAA 3Q8KA 1ZQKA 3RRGA 5DGAA 2BCUA 1JIHA 4KMUA 3H4DA 2P6UA 5KFYA 3RTVA 2AGOA 1A77A 3KTQA 8ICLA 2JZBB 2XGPA 1KDHA 2KFNA 1BPBA 4NM2A 4R8UA 8ICGA 1KFDA 2ZUBA 1XU4A 3C21A 8ICWA 7ICTA 2ASJA 8ICXA 3KHGA 4F4WA 4RNNA 1BPZA 3QE9Y 1TK0A 2BQUA 2AQ4A 4PHAA 4RNOA 3ISBA 1N56A 5KT3A 4O9MA 2ZTDA 3BQTA 4O0IA 5DBAA 3KHLA 3V7LA 4J9KA 3T5LA 4QWAA 2W9CB 3LWMA 1KTQA 5CWRA 5KG4A 2ATLA 2XC9A 1S0VA 4TQSA 4QZIA 1BPDA 1ZQUA 4K4HA 8ICIA 4UQGA 2ISPA 3PMNA 3Q8RB 1T7PA 2PFOA 4ELVA 5KFQA 3OSNA 3KHRA 4B9UA 4QZFA 5CR0A 4C8KA 5IIIA 3B0XA 5KT7A 4DSIA 1NK0A 2BCVA 3BQ2A 4TURA 4XQ8A 4MEYA 4O3NA 5IIOA 3BQ0A 3TARA 2AGQA 2W9BA 4ECVA 1SZPA 4F92B 4NY8A 9ICBA 5KFSA 5HHIA 3Q8MA 4GC7A 4J9OA 3C2MA 2C2DA 2JEGA 2XO7A 3OJUA 4FS1A 3SV3A 4TUSA 1ZQPA 4M04A 7ICGA 5D46A 5KFFA 1U47A 2VA3A 2C2RA 4J9RA 5KFEA 5JUMA 1XO1A 4DQQA 1RXVA 3NGDA 1L5UA 1ZQJA 3LDAA 1TKDA 2XCPA 3MR6A 4MEXA 2HHXA 4I2JA 4TUPA 2H5XA 4RQ0A 4O5EA 1L3TA 1S0OA 4I27A 8ICBA 9ICUA 5KG1A 5CA7A 1TFRA 3K75D 4ECXA 4ED8A 2Y1IA 3M9MB 3RB0A 2ASDA 1SL1A 5J0TA 2NRXA 2ZJ5A 5DB7A 4YR3A 3LWLA 4GC6A 2AU0A 1MQ3A 4YMNA 4RZRA 2AJQA 1UA1A 1BPXA 5DGBA 2M9NA 3HWTA 4I2FA 3RH6A 2KTQA 4DQIA 9ICFA 4O3QA 4KLEA 1NKCA 1TAQA 1CEZA 2DPJA 4KLTA 1TAUA 4I2IA 9ICIA 3JPQA 4DS5A 9ICAA 9ICRA 2ASLA 1IM4A 4RQ3A 1ZQIA 4NLGA 5J29A 2KN7A 2J6SA 5KT6A 5J0OA 4RU9A 4M9LA 5J0RA 3T5JA 3FDSA 1NK6A 7ICQA 4PPXA 3HX0A 4YN4A 4YFKA 3GIKA 4DL3A 1UA0A 7ICOA 3C5GA 9ICNA 2BCSA 5KG0A 4F5NA 4MFAA 4NLNA 4G3IA 1QLNA 1KEJA 1NOMA 2FMQA 5IIMA 2IBKA 4KLQA 4KLSA 3PX0A 3G6XA 5KG2A 3IM1A 7ICMA 2R8IA 4QW8A 4K4GA 9ICTA 3MFHA 4DO9A 4F3OA 4JV0A 4J9PA 4IRCA 2MUTA 1A76A 3V6KA 3TI0A 1D9DA 7ICPA 2MAXA 4Z6FA 1IXRA 3M8SA 5F9NA 3T5KA 4PHDA 3ETLA 3PR5B 4BXOB 4JV1A 5KTQA 2ZTCA 3PX4A 4RQ6A 4UBBA 2HHVA 1ZQEA 1ZQAA 5KG7A 4DSKA 2W8KA 2FLNA 4MF2A 2JEIA 4M6WB 3RJHA 4DFJA 9ICLA 3BJYA 2HVHA 1XC9A 3JPOA 3C23A 1BPYA 1ZQDA 4Q44A 4ECUA 5KG3A 1H38A 1WCLA 4KLGA 3TQ1A 4JK1A 2HW3A 3AU2A 3UXNA 4BWMA 5KT2A 1XWLA 2BHNA 4QW9A 4F5OA 4DSEA 4RQ2A 2HHSA 4F50A 7ICKA 3JPPA 1Z00A 9ICJA 2ZUCA 4J9SA 4JWNA 2B21A 3HW8A 4YMMA 2C22A 4B9LA 5KFMA 4EZ9A 4F4KA 4NM1A 1T4GA 3TAPA 8ICVA 1MSWD 8ICYA 5KFWA 8ICPA 3Q8PB 4Z6EA 3GV8B 8ICEA 5HNKA 3GIIA 2I9GA 4M9HA 3PO5A 5KFHA 3EPIA 5KFOA 4JV2A 4TUQA 8ICOA 3AUOA 4PHEA 4Q45A 1ZQRA 4M9GA 1TVAA 4RPXA 4QZEA 9ICGA 3MGHA 5DQGA 5EWEA 2BPCA 3M8RA 5J2EA 5L9XA 3MR3A 3EZ5A 3PW4A 3SI8A 5HP4A 3RH5A 3GILA 1NKBA 1MC8A 1XS9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B43 A;  4EBC A;  4EZ6 A;  5L1I A;  4IQV A;  5KFR A;  2ISO A;  3PVX A;  2JEF A;  2HHQ A;  8ICT A;  2C28 A;  5IIJ A;  2VA2 A;  4YXM A;  3V7K A;  2A1J B;  2AQ0 A;  4EYI B;  3SYZ A;  9ICM A;  4QWB A;  3FYH A;  4UAW A;  4DEZ A;  1BGX T;  4RQ7 A;  2UVW A;  4RQ8 A;  4YR0 A;  2W9B B;  2PFP A;  5J2D A;  2FPL A;  2RDI A;  3JPT A;  1S9F A;  5HHH A;  1D9F A;  4DSJ A;  4M9N A;  4DOC A;  1SKS A;  1ZET A;  4I2A A;  1XSP A;  4YP3 A;  4UAY A;  3UPQ A;  2WTF A;  2Y1J A;  1QSL A;  2W8L A;  3UQ2 A;  4YCX A;  3N97 B;  4I2E A;  4LZG A;  2HVI A;  3OSP A;  4UB1 A;  4KLI A;  1RPL A;  4ECS A;  2NRZ A;  3ISD A;  3QZ8 A;  4ED6 A;  4C8L A;  5IIN A;  4F8R A;  3RAX A;  2KFZ A;  3HT3 A;  3RBD A;  4FBU A;  1L3S A;  4I28 A;  3RJE A;  3EW9 A;  3PO4 A;  4O3S A;  3RH4 A;  5KFU A;  5J0S A;  4DOB A;  4UBC A;  3OHB A;  5KFG A;  4F5Q A;  4R65 A;  4XUS A;  2OWO A;  2DFL A;  2FPM A;  1WCN A;  5KFJ A;  5DDY A;  4NXZ A;  5J2H A;  4KLF A;  4ECQ A;  4RPZ A;  1ZQB A;  1JX4 A;  4J9M A;  4M47 A;  4QZG A;  1T3N A;  3OGU A;  3H7I A;  2V9W A;  1ZYQ A;  4BWJ A;  4DFM A;  4DSF A;  1TK8 A;  5KG5 A;  7ICE A;  2ZJ8 A;  4JUZ A;  5DDM A;  2IHM A;  2UVV A;  3RR8 A;  4DF4 A;  4KLM A;  4KLO A;  4MF8 A;  1JXE A;  2F1H A;  5DLF A;  4YR2 A;  1DGS A;  9ICS A;  1ZQG A;  4P4M A;  4X5V A;  4ELU A;  4C8M A;  5C5J A;  1ZQS A;  4IQW A;  4QZC A;  3H8J A;  1ARO P;  3ZDE A;  3UXO A;  4PH5 A;  7ICS A;  1U48 A;  1JN3 A;  4B9V A;  8ICH A;  1ZQF A;  5J2A A;  3TFR A;  1SL2 A;  4CCH A;  2KZ3 A;  4ECZ A;  5L1K A;  4Q8F A;  1XSN A;  3BDP A;  1S97 A;  1KSP A;  2BQ3 A;  3M9O B;  3PW0 A;  1U45 A;  2R8J A;  5DG9 A;  5BOM A;  5KFN A;  5KT5 A;  1NK7 A;  2BCR A;  4F2R A;  4C8O A;  5HMM A;  4YMO A;  3RJF A;  4DOA A;  4KLL A;  2BDP A;  2XY6 A;  4XRH A;  3MAB A;  1ZQZ A;  3TAN A;  4QZH A;  4B9N A;  4MFF A;  4R63 A;  2MUT B;  7ICF A;  3T5H A;  4YG2 A;  4QZB A;  2BR0 A;  1UT5 A;  3C5F A;  3RB6 A;  2UVU A;  5KFL A;  8ICJ A;  2PXI A;  2ZUD A;  3ORY A;  3UQ0 A;  1N48 A;  3JPS A;  1JXL A;  4DSL A;  3OHA A;  4I2B A;  4IRD A;  9ICV A;  2ZTE A;  3IHQ B;  5BPC A;  2FLP A;  1B22 A;  5DKW A;  1HJP A;  4KLD A;  4RUA A;  4DS4 A;  9ICH A;  4UB3 A;  4B9T A;  5CP2 A;  4MFC A;  1QTM A;  4XA5 A;  2XY5 A;  1RYR A;  4QZA A;  3Q8S B;  1L3U A;  1NJZ A;  3AU6 A;  9ICQ A;  2BKE A;  4IQU A;  1NK8 A;  2PI4 A;  3B0Y A;  3GV7 B;  1Z00 B;  5KFI A;  4EBE A;  1EXN A;  8ICA A;  3PML A;  4O5K A;  2W9A A;  3QEA Z;  4O3P A;  5J0P A;  4ED3 A;  1HUO A;  1KFS A;  1K1Q A;  1PZN A;  1ZQX A;  2V4R A;  3GQC A;  4J9Q A;  4HYK A;  3MGI A;  4DL5 A;  2IMW P;  4BXO A;  3C1Y A;  4R64 A;  4EBD A;  8ICR A;  2F1I A;  4ECW A;  4RT2 A;  3EWA A;  4M9J A;  4R8U B;  4YVZ A;  2Q0Z X;  3JPR A;  5EOZ A;  1L3V A;  5J2I A;  4ECT A;  3MFI A;  2HHW A;  4PHP A;  2BPG A;  4O3R A;  4I2G A;  3RJJ A;  9ICO A;  2I1Q A;  2UVR A;  4GXJ A;  1CUK A;  5J2F A;  1D8Y A;  4DLE A;  5CHG A;  1DOQ A;  4TQR A;  2XCA A;  4FS2 A;  2DPI A;  4F4X A;  7ICI A;  4DL7 A;  1NK9 A;  1BPE A;  5J0Y A;  4Z6C A;  3ZDD A;  2C2E A;  1TK5 A;  4F5P A;  1NJX A;  2FLL A;  3G6V A;  3ZDC A;  5KFD A;  4F93 B;  4YQW A;  4I2H A;  4K4I A;  4KLH A;  3PW2 A;  4F4Z A;  2V4Q A;  4RUC A;  5KFK A;  1ZQT A;  2NRW A;  4UB2 A;  4ELT A;  1SKR A;  2IA6 A;  3QEB Z;  4QZ8 A;  4ECR A;  3GDX A;  3H8W A;  4QWE A;  3PNC A;  4F91 B;  4RPY A;  1SKW A;  1COO A;  2JZB A;  1U9L A;  3NTU A;  4Q43 A;  2FPK A;  3RRH A;  3V72 A;  5J0U A;  4DFK A;  4RQ5 A;  1K1S A;  3H40 A;  3BQ1 A;  4LZD A;  3C2K A;  1SL0 A;  1KRP A;  3RB3 A;  2P66 A;  4DQR A;  3ISC A;  3THV A;  1U4B A;  8ICK A;  3ZDB A;  4KLJ A;  4J9N A;  1BVS A;  3PR4 A;  1MQ2 A;  1C7Y A;  3GIJ A;  2NRT A;  4ED1 A;  5BOL A;  2HHU A;  3RBE A;  4DL2 A;  4M0A A;  2W9M A;  1RXW A;  4BDP A;  3M9N B;  2KZZ A;  1Z3E B;  5J0W A;  9ICK A;  1X9M A;  3HP6 A;  2W9C A;  1QSS A;  3MBY A;  5DB8 A;  1NJW A;  5D4B A;  5KG6 A;  4O3O A;  5J0Q A;  4ECY A;  1ZJM A;  1Y88 A;  9ICX A;  3MR2 A;  5DB9 A;  2A1J A;  4ZH4 A;  4GXI A;  1S0M A;  5TZV A;  3MDA A;  1U49 A;  1NJY A;  5KFA A;  4ED2 A;  4NLK A;  9ICE A;  8ICU A;  4UB4 A;  3GFK B;  1X2I A;  4DQS A;  3C2L A;  3K4G A;  4I29 A;  5KFX A;  7ICN A;  5DQH A;  5IIK A;  1HUZ A;  4Q8E A;  5EWG A;  4IR9 A;  4DL4 A;  5J2C A;  4FO6 A;  2VAN A;  5F9L A;  2BCQ A;  1S10 A;  1ZQQ A;  7ICJ A;  3MDC A;  4B9M A;  2BGW A;  3N4M B;  1S0N A;  4NLZ A;  1X9W A;  4M2Y A;  4I2D A;  1QSY A;  5J2J A;  2LYH A;  3Q8Q B;  4O5C A;  5KT4 A;  4UAZ A;  4PGX A;  2FMP A;  5DG7 A;  8ICN A;  9ICP A;  4F5R A;  3Q8L A;  9ICC A;  1X9S A;  2XY7 A;  4B9S A;  5J0X A;  2XGQ A;  5KFP A;  5CJ7 A;  3TAQ A;  4EEY A;  8ICZ A;  1ZQV A;  3H4B A;  3H8S A;  1KLN A;  4DFP A;  4QWC A;  3KHH A;  1ZQM A;  5J2B A;  5HML A;  4DL6 A;  8ICM A;  3GIM A;  2NRV A;  4RNM A;  4EYH B;  3V6H A;  7ICV A;  4BGD A;  1ZQC A;  5DB6 A;  3RJI A;  3QZ7 A;  4KN7 A;  3MR5 A;  3RJK A;  5KFC A;  4IRK A;  7ICH A;  4P4O A;  1V9P A;  5KFZ A;  4IQT A;  5D49 A;  2ALZ A;  3E2E A;  4GXK A;  1NK5 A;  3ZD9 A;  1ZQL A;  1ZQO A;  3ZDA A;  4FBT A;  4QZD A;  2P6R A;  4LVS A;  5KFV A;  4YD1 A;  5J2K A;  3EPG A;  3UXP A;  2HHT A;  4UB5 A;  2IHN A;  4F4Y A;  4J9L A;  5DG8 A;  1XSL A;  2BPF A;  4YD2 A;  1ZQN A;  5CB1 A;  5EWF A;  2R8H A;  2FMS A;  3T3F A;  3RJG A;  2PFQ A;  5KFB A;  4P4P A;  3RAQ A;  3SV4 A;  4KLU A;  7ICR A;  1ZQW A;  4KTQ A;  2JEJ A;  4DQP A;  3GV5 B;  5L1L A;  4DF8 A;  5J2G A;  4QZ9 A;  4KIT B;  4RQ1 A;  4JWM A;  9ICW A;  2F1J A;  5IIL A;  2KZM A;  1TV9 A;  3RR7 A;  4QWD A;  2AGP A;  2GWS A;  4GLX A;  5L1J A;  4ED7 A;  1JMS A;  4ED0 A;  4C8N A;  2PFN A;  4YXJ A;  4I2C A;  5DQI A;  3G6Y A;  2RDJ A;  4F2S A;  4Z6D A;  3JPN A;  5DBC A;  8ICF A;  3RB4 A;  4R66 A;  1ZJN A;  1ZQY A;  1KFT A;  1LB2 B;  5DBB A;  4DWI A;  1RYS A;  4DLG A;  3SZ2 A;  1UT8 A;  4KN4 A;  8ICS A;  7ICL A;  1S77 D;  3ZD8 A;  3HPO A;  3EYZ A;  3PW5 A;  1NKE A;  3PW7 A;  1T8E A;  2R8G A;  4IR1 A;  4PGQ A;  5KFT A;  3LK9 A;  1LV5 A;  1ZQH A;  1NK4 A;  1D8L A;  4RQ4 A;  1RZT A;  5DLG A;  3V7J A;  3C1Z A;  3PV8 A;  4P2H A;  1S76 D;  4M6W A;  4PGY A;  2BQR A;  2J6T A;  7ICU A;  3PX6 A;  3OJS A;  2VA8 A;  3V6J A;  8ICC A;  4RT3 A;  8ICQ A;  2R8K A;  2PI5 A;  3TFS A;  2J6U A;  4E0D A;  3PY8 A;  2ZJA A;  3Q8K A;  1ZQK A;  3RRG A;  5DGA A;  2BCU A;  1JIH A;  4KMU A;  3H4D A;  2P6U A;  5KFY A;  3RTV A;  2AGO A;  1A77 A;  3KTQ A;  8ICL A;  2JZB B;  2XGP A;  1KDH A;  2KFN A;  1BPB A;  4NM2 A;  4R8U A;  8ICG A;  1KFD A;  2ZUB A;  1XU4 A;  3C21 A;  8ICW A;  7ICT A;  2ASJ A;  8ICX A;  3KHG A;  4F4W A;  4RNN A;  1BPZ A;  3QE9 Y;  1TK0 A;  2BQU A;  2AQ4 A;  4PHA A;  4RNO A;  3ISB A;  1N56 A;  5KT3 A;  4O9M A;  2ZTD A;  3BQT A;  4O0I A;  5DBA A;  3KHL A;  3V7L A;  4J9K A;  3T5L A;  4QWA A;  2W9C B;  3LWM A;  1KTQ A;  5CWR A;  5KG4 A;  2ATL A;  2XC9 A;  1S0V A;  4TQS A;  4QZI A;  1BPD A;  1ZQU A;  4K4H A;  8ICI A;  4UQG A;  2ISP A;  3PMN A;  3Q8R B;  1T7P A;  2PFO A;  4ELV A;  5KFQ A;  3OSN A;  3KHR A;  4B9U A;  4QZF A;  5CR0 A;  4C8K A;  5III A;  3B0X A;  5KT7 A;  4DSI A;  1NK0 A;  2BCV A;  3BQ2 A;  4TUR A;  4XQ8 A;  4MEY A;  4O3N A;  5IIO A;  3BQ0 A;  3TAR A;  2AGQ A;  2W9B A;  4ECV A;  1SZP A;  4F92 B;  4NY8 A;  9ICB A;  5KFS A;  5HHI A;  3Q8M A;  4GC7 A;  4J9O A;  3C2M A;  2C2D A;  2JEG A;  2XO7 A;  3OJU A;  4FS1 A;  3SV3 A;  4TUS A;  1ZQP A;  4M04 A;  7ICG A;  5D46 A;  5KFF A;  1U47 A;  2VA3 A;  2C2R A;  4J9R A;  5KFE A;  5JUM A;  1XO1 A;  4DQQ A;  1RXV A;  3NGD A;  1L5U A;  1ZQJ A;  3LDA A;  1TKD A;  2XCP A;  3MR6 A;  4MEX A;  2HHX A;  4I2J A;  4TUP A;  2H5X A;  4RQ0 A;  4O5E A;  1L3T A;  1S0O A;  4I27 A;  8ICB A;  9ICU A;  5KG1 A;  5CA7 A;  1TFR A;  3K75 D;  4ECX A;  4ED8 A;  2Y1I A;  3M9M B;  3RB0 A;  2ASD A;  1SL1 A;  5J0T A;  2NRX A;  2ZJ5 A;  5DB7 A;  4YR3 A;  3LWL A;  4GC6 A;  2AU0 A;  1MQ3 A;  4YMN A;  4RZR A;  2AJQ A;  1UA1 A;  1BPX A;  5DGB A;  2M9N A;  3HWT A;  4I2F A;  3RH6 A;  2KTQ A;  4DQI A;  9ICF A;  4O3Q A;  4KLE A;  1NKC A;  1TAQ A;  1CEZ A;  2DPJ A;  4KLT A;  1TAU A;  4I2I A;  9ICI A;  3JPQ A;  4DS5 A;  9ICA A;  9ICR A;  2ASL A;  1IM4 A;  4RQ3 A;  1ZQI A;  4NLG A;  5J29 A;  2KN7 A;  2J6S A;  5KT6 A;  5J0O A;  4RU9 A;  4M9L A;  5J0R A;  3T5J A;  3FDS A;  1NK6 A;  7ICQ A;  4PPX A;  3HX0 A;  4YN4 A;  4YFK A;  3GIK A;  4DL3 A;  1UA0 A;  7ICO A;  3C5G A;  9ICN A;  2BCS A;  5KG0 A;  4F5N A;  4MFA A;  4NLN A;  4G3I A;  1QLN A;  1KEJ A;  1NOM A;  2FMQ A;  5IIM A;  2IBK A;  4KLQ A;  4KLS A;  3PX0 A;  3G6X A;  5KG2 A;  3IM1 A;  7ICM A;  2R8I A;  4QW8 A;  4K4G A;  9ICT A;  3MFH A;  4DO9 A;  4F3O A;  4JV0 A;  4J9P A;  4IRC A;  2MUT A;  1A76 A;  3V6K A;  3TI0 A;  1D9D A;  7ICP A;  2MAX A;  4Z6F A;  1IXR A;  3M8S A;  5F9N A;  3T5K A;  4PHD A;  3ETL A;  3PR5 B;  4BXO B;  4JV1 A;  5KTQ A;  2ZTC A;  3PX4 A;  4RQ6 A;  4UBB A;  2HHV A;  1ZQE A;  1ZQA A;  5KG7 A;  4DSK A;  2W8K A;  2FLN A;  4MF2 A;  2JEI A;  4M6W B;  3RJH A;  4DFJ A;  9ICL A;  3BJY A;  2HVH A;  1XC9 A;  3JPO A;  3C23 A;  1BPY A;  1ZQD A;  4Q44 A;  4ECU A;  5KG3 A;  1H38 A;  1WCL A;  4KLG A;  3TQ1 A;  4JK1 A;  2HW3 A;  3AU2 A;  3UXN A;  4BWM A;  5KT2 A;  1XWL A;  2BHN A;  4QW9 A;  4F5O A;  4DSE A;  4RQ2 A;  2HHS A;  4F50 A;  7ICK A;  3JPP A;  1Z00 A;  9ICJ A;  2ZUC A;  4J9S A;  4JWN A;  2B21 A;  3HW8 A;  4YMM A;  2C22 A;  4B9L A;  5KFM A;  4EZ9 A;  4F4K A;  4NM1 A;  1T4G A;  3TAP A;  8ICV A;  1MSW D;  8ICY A;  5KFW A;  8ICP A;  3Q8P B;  4Z6E A;  3GV8 B;  8ICE A;  5HNK A;  3GII A;  2I9G A;  4M9H A;  3PO5 A;  5KFH A;  3EPI A;  5KFO A;  4JV2 A;  4TUQ A;  8ICO A;  3AUO A;  4PHE A;  4Q45 A;  1ZQR A;  4M9G A;  1TVA A;  4RPX A;  4QZE A;  9ICG A;  3MGH A;  5DQG A;  5EWE A;  2BPC A;  3M8R A;  5J2E A;  5L9X A;  3MR3 A;  3EZ5 A;  3PW4 A;  3SI8 A;  5HP4 A;  3RH5 A;  3GIL A;  1NKB A;  1MC8 A;  1XS9 D; 
#chains in the Genus database with same CATH topology
 1B43 A;  1Z19 A;  2JEF A;  5ALG A;  2A1J B;  4EYI B;  2LYB A;  2UVW A;  5HHH A;  1ZET A;  4I2A A;  4RQM A;  4YP3 A;  1VDV A;  3FC4 A;  1CRX A;  4I2E A;  4UB1 A;  1RPL A;  5FP0 A;  4ED6 A;  1V97 A;  3HT3 A;  1L3S A;  4OJL A;  3RF9 A;  4DOB A;  5E79 U;  5KFG A;  1SV0 C;  3WK6 A;  1NNL A;  5KFJ A;  4NXZ A;  5AIB A;  3HKZ F;  4KLF A;  4ECQ A;  4RPZ A;  2E5S A;  1T3N A;  1RYU A;  3R9K A;  2PKE A;  1TK8 A;  7ICE A;  2IHM A;  3RR8 A;  3SMV A;  1JXE A;  3LVW A;  4YR2 A;  5DLF A;  2K8C B;  4C0Z A;  1SZH A;  3WK5 A;  5C5J A;  1U48 A;  1JN3 A;  8ICH A;  1ZQF A;  4NL9 C;  2KIW A;  3M9O B;  1NK7 A;  5KFN A;  1Z4O A;  2BCR A;  2HI0 A;  5JTI A;  2BDP A;  2KVS A;  5AK3 A;  2YMQ A;  4R63 A;  4QZB A;  2WHE A;  8ICJ A;  1X9X A;  3UQ0 A;  2EDU A;  1N48 A;  2DUY A;  5EE1 A;  2G07 A;  2FLP A;  4BUG A;  2JRZ A;  5ALQ A;  3DDH A;  3PSI A;  3SR6 A;  4XA5 A;  2A3V A;  3TAD C;  5AM0 A;  4IQU A;  3B0Y A;  5KFI A;  4Y2R A;  4ED3 A;  1HUO A;  2IMW P;  1ZQX A;  3GQC A;  4HYK A;  1BNO A;  4R64 A;  4ECW A;  4RT2 A;  4M9J A;  4O3M A;  2WF5 A;  1SGG A;  5J2I A;  2PMZ C;  1MN8 A;  2BPG A;  4O3R A;  9ICO A;  2QAR B;  3RJJ A;  2UVR A;  5ALI A;  1DOQ A;  2XCA A;  1XO0 A;  5AK5 A;  3E0F A;  1NJX A;  4KLH A;  3G6V A;  5KFD A;  4F4Z A;  1SKR A;  3QEB Z;  4ECR A;  4UAT A;  3PNC A;  1SKW A;  3V72 A;  3H40 A;  4B9L A;  3RB3 A;  8ICK A;  3ISC A;  3ZDB A;  4J9N A;  1C7Y A;  3GIJ A;  1IIP A;  4ED1 A;  2HHU A;  4DL2 A;  1Z3E B;  2WAQ C;  1X9M A;  3KOO A;  2OHF A;  9ICX A;  1Y88 A;  3MR2 A;  4ACO A;  1N2X A;  4DQS A;  4GFJ A;  3QUC A;  1UQV A;  1X6J A;  5DQH A;  5IIK A;  2ZIU A;  4Q8E A;  2VJ5 A;  2MSN A;  1S10 A;  3KBB A;  3MDC A;  1ZRM A;  3F2B A;  3D6J A;  4O5C A;  4UAZ A;  2FMP A;  9ICC A;  1PVP A;  2XY7 A;  5CRX A;  2G06 A;  8ICZ A;  1MA7 A;  2WFA A;  3QU9 A;  4DFP A;  1ZQM A;  1S5L U;  2NRV A;  4RNM A;  7ICV A;  4BGD A;  3RJI A;  2KP7 A;  4KN7 A;  4IRK A;  2EZZ A;  4PZO A;  4P4O A;  2G09 A;  4UAR A;  1NK5 A;  3B9J A;  3ZD9 A;  4QZD A;  5KFV A;  4YD1 A;  2YML A;  3EPG A;  2JHD A;  4UB5 A;  2IHN A;  1XSL A;  1ZQN A;  1B22 A;  2FMS A;  4KLU A;  2EAO A;  3T3F A;  3RAQ A;  3SV4 A;  5AKI A;  1N61 A;  4QJF B;  4KIT B;  2LI6 A;  4JWM A;  2KZM A;  3U26 A;  4QWD A;  4NWI A;  3F2C A;  4PL2 A;  4C8N A;  1J2N A;  3G6Y A;  3JPN A;  2DGZ A;  5DBC A;  8ICF A;  1ZJN A;  3SZ2 A;  1UT8 A;  3NS1 A;  4KMO B;  3PW5 A;  3EYZ A;  3CNH A;  2HMX A;  3LK9 A;  1DK3 A;  1Z1B A;  4AYB F;  4CGZ A;  2BQR A;  7ICU A;  8ICC A;  2VA8 A;  3V6J A;  2R8K A;  2WF9 A;  4ICA A;  3PY8 A;  3Q8K A;  3QUT A;  3BS7 A;  5DGA A;  2BCU A;  4U6P A;  4KMU A;  4WJ3 B;  2EAP A;  1A77 A;  1B0X A;  3KTQ A;  1F5S A;  8ICL A;  1SXE A;  1KFD A;  1XU4 A;  3KHG A;  5ALP A;  2BQU A;  5AIA A;  1N56 A;  2EZX A;  4O9M A;  2DKZ A;  1KTQ A;  2XC9 A;  1S0V A;  1BPD A;  1ZQU A;  4K4H A;  8ICI A;  4UQG A;  1FFU A;  5AM2 A;  3Q8R B;  2ISP A;  2QB0 A;  5KT7 A;  4DSI A;  2BCV A;  2AGQ A;  4F92 B;  2ZIU B;  5KFS A;  3C2M A;  2JEG A;  3OJU A;  7ICG A;  1ZQP A;  4OJO A;  2C2R A;  4J9R A;  5KFE A;  1WUD A;  2GLE A;  3QU5 A;  1L5U A;  1ZQJ A;  1NZB A;  1SWV A;  4I2J A;  4RQ0 A;  9ICU A;  3SEI A;  4ED8 A;  4KX5 A;  3RB0 A;  4GC6 A;  5J0T A;  2HCF A;  2OH2 A;  1MQ3 A;  3KKA C;  3O0F A;  1UA1 A;  2CRX A;  2GH1 A;  3HWT A;  1L6N A;  1CEZ A;  1NKC A;  2DPJ A;  1TAU A;  1BNP A;  2F8L A;  5ALK A;  2RLT A;  2YB1 A;  2ASL A;  5J29 A;  2KN7 A;  2G5H B;  5J0O A;  5EE0 A;  1NK6 A;  7ICQ A;  3N7P D;  3PSF A;  4OO1 J;  2ZXI A;  3HX0 A;  4YN4 A;  4DL3 A;  5AM4 A;  4G3I A;  2LBO A;  1NOM A;  3IM1 A;  1N62 A;  2R8I A;  1ZQ1 C;  4QW8 A;  2G5I B;  4DO9 A;  4F3O A;  4JV0 A;  2WB1 C;  1XNS A;  4Z6F A;  2YMM A;  1SV0 A;  1C20 A;  4BXO B;  4JV1 A;  1ZQE A;  3WK4 A;  2FLN A;  4Y2T A;  3RJH A;  2OEH A;  5AKH A;  9ICL A;  2HVH A;  3SEN A;  5ALD A;  4Q44 A;  1WCL A;  3WK9 A;  4JK1 A;  5KT2 A;  2BHN A;  4QW9 A;  4F5O A;  2HHS A;  7ICK A;  9ICJ A;  2ZUC A;  4J9S A;  4YMM A;  3TAP A;  4NL9 A;  4NV0 A;  3LVV A;  8ICP A;  4PZN A;  8ICE A;  5AI9 A;  5KFH A;  3QUQ A;  8ICO A;  3AUO A;  9ICG A;  4QZE A;  3MGH A;  5EWE A;  5HP4 A;  3H0R B;  3C28 A;  1MC8 A;  5L1I A;  4CE6 A;  5G5H A;  5KFR A;  2ISO A;  1X66 A;  3I1Y A;  3UMC A;  3PVX A;  1DGJ A;  4CF3 A;  1OXJ A;  2VA2 A;  2AQ0 A;  5GTH U;  1BGX T;  2DBY A;  4YR0 A;  2ZIX A;  2PFP A;  1D9F A;  3TAD A;  3AQF A;  2YTU A;  3UQ2 A;  2HVI A;  3OSP A;  3CRX A;  4ECS A;  2NRZ A;  4B6J A;  4F8R A;  3F5A A;  2D3D A;  3L5K A;  4FFD A;  1QQ7 A;  3DV9 A;  1P7D A;  3RH4 A;  5J0S A;  2OXO A;  2A19 A;  3NVV A;  3OHB A;  2P35 A;  2FPM A;  5DDY A;  5J2H A;  3TAC B;  1ZD3 A;  3H7I A;  2V9W A;  5KG5 A;  5K4L A;  2ZJ8 A;  4JUZ A;  5DDM A;  1O03 A;  4DF4 A;  5AM1 A;  9ICS A;  1L7M A;  3QYP A;  2AHO B;  1ZQS A;  4QZC A;  3H8J A;  4HAI A;  4PH5 A;  4PJ0 U;  2DF4 B;  4CCH A;  5AI5 A;  4ECZ A;  5L1K A;  4OD0 A;  1VLB A;  1S97 A;  1KSP A;  2BQ3 A;  4F2R A;  5BOM A;  2H3I A;  3RJF A;  2VIX A;  4XRH A;  4QZH A;  4MFF A;  7ICF A;  1HEK A;  3T5H A;  5KAI U;  5C0Y A;  1YZ6 A;  1CI4 A;  2QB1 A;  5KFL A;  2UVU A;  2VJ4 A;  1JXL A;  2YMP A;  3OHA A;  4DSL A;  2K4I A;  4IRD A;  5BPC A;  5DKW A;  1L7N A;  4KLD A;  4RUA A;  3UMB A;  5CP2 A;  1JUD A;  2A1A A;  1RYR A;  2KG5 A;  3WKE A;  4QZA A;  3Q8S B;  1NJZ A;  3IRU A;  2XVT A;  3CYM A;  9ICQ A;  3WKA A;  1NK8 A;  3GV7 B;  2WF7 A;  5AM5 A;  1K1Q A;  2K4P A;  4J9Q A;  1B4F A;  2VKQ A;  2KOB A;  2F1I A;  1Q3U A;  2KV2 A;  3ZI4 A;  1DXS A;  2WF8 A;  4R8U B;  1L3V A;  3MFI A;  1QH9 A;  4I2G A;  4GXJ A;  4DLE A;  5AM3 A;  4TQR A;  2ZIW A;  4F4X A;  2ODG A;  2FLL A;  3ZDC A;  4F93 B;  4K4I A;  2KHV A;  5KFK A;  5AHX A;  4UB2 A;  4ELT A;  3QU7 A;  1ZD5 A;  4RPY A;  3TKA A;  4Q43 A;  2ZIX B;  5J0U A;  1F44 A;  4DFK A;  1K1S A;  2KSO A;  4LZD A;  1KRP A;  2NRT A;  5BOL A;  1RXW A;  4BDP A;  2KZZ A;  3MBY A;  2G08 A;  5DB8 A;  2PMZ F;  5J0Q A;  3C29 A;  4ECY A;  4ZH4 A;  4GXI A;  1S0M A;  4NLK A;  3GU3 A;  1U49 A;  1NJY A;  4ED2 A;  9ICE A;  8ICU A;  4UB4 A;  3K4G A;  4I29 A;  2D6F C;  7ICN A;  5ALM A;  3WU2 U;  4IR9 A;  4DL4 A;  5F9L A;  7ICJ A;  3AEV A;  1S0N A;  4F72 A;  2LYH A;  2IOF A;  8ICN A;  1UPH A;  3CP8 A;  4PGX A;  9ICP A;  3M6Z A;  1X9S A;  4B9S A;  5J0X A;  1L7P A;  5CJ7 A;  3TAQ A;  1KLN A;  4QWC A;  2F77 X;  3V6H A;  4Y2Y A;  1X6I A;  5DB6 A;  2KKP A;  2OCE A;  7ICH A;  4IQT A;  4DFD A;  4P0P A;  1ZQO A;  2HSZ A;  1J97 A;  2P6R A;  2LM1 A;  5J2K A;  1UCV A;  2K4E A;  4F4Y A;  5DG8 A;  5CB1 A;  5KFB A;  4P4P A;  2KJ8 A;  1ZQW A;  5ALE A;  3GV5 B;  4DF8 A;  5KNI A;  4CF4 A;  5J2G A;  2HBJ A;  9ICW A;  2F1J A;  5IIL A;  1TV9 A;  4C7Z A;  5G5G A;  2AGP A;  2GWS A;  4GLX A;  3L3F X;  4ED0 A;  1JMS A;  2PFN A;  4YXJ A;  4F2S A;  5AI6 A;  4Z6D A;  1ZQY A;  4DWI A;  3KFU F;  1RG6 A;  4USA A;  1RYS A;  1TAM A;  1D8B A;  2N1R A;  3HPO A;  3PW7 A;  1PK1 A;  4UB8 U;  1LV5 A;  3KKA A;  1NK4 A;  2HBK A;  3MGV A;  3IDW A;  3V7J A;  4AP9 A;  3PV8 A;  1X42 A;  4P2H A;  4M6W A;  4PGY A;  3SAF A;  2E1E A;  5AKL A;  4RT3 A;  8ICQ A;  3TFS A;  2J6U A;  3HIL A;  5EE9 A;  5AK6 A;  5ALV A;  5AK4 A;  2P6U A;  3RTV A;  2AGO A;  3BQ7 A;  2XGP A;  2HBM A;  2ZUB A;  2ASJ A;  3BS5 A;  1N5X A;  3BQT A;  4J9K A;  2K8A A;  4BJQ A;  3HKZ C;  4QZI A;  5AI0 A;  3OSN A;  4B9U A;  4EEK A;  2PFQ A;  4MEY A;  5IIO A;  2W9B A;  1KQQ A;  2JR5 A;  5ALN A;  1COK A;  4FS1 A;  3SV3 A;  4TUS A;  5D46 A;  4IS7 A;  2VA3 A;  5JUM A;  4P0Q A;  3PZP A;  1Q8K A;  5CEH A;  2XCP A;  3MR6 A;  2HHX A;  3RFA A;  2Y0S F;  4TUP A;  1DK2 A;  2H5X A;  4C4S A;  2W7O A;  4O5E A;  1S0O A;  5KG1 A;  5CA7 A;  1TFR A;  2ASD A;  1SL1 A;  4YR3 A;  2E8O A;  3SQI A;  2AJQ A;  5B5E U;  4LJX A;  5DGB A;  4DQI A;  9ICF A;  4O3Q A;  4CF5 A;  4Y2V A;  4KLT A;  9ICI A;  4DS5 A;  2J6S A;  5KT6 A;  4NLB A;  4PPX A;  2W04 A;  7ICO A;  3C5G A;  2KD1 A;  5AIC A;  2BCS A;  1K5O A;  1OUQ A;  4KLQ A;  1N5W A;  2KIV A;  7ICM A;  3L4P A;  9ICT A;  4J9P A;  4IRC A;  3V6K A;  2MAX A;  1IXR A;  5ALR A;  4C7Y A;  4PHD A;  1PK1 B;  3PR5 B;  4C4R A;  2ZIV A;  5KTQ A;  4RQ6 A;  2F44 A;  4DSK A;  4MF2 A;  4M6W B;  5KL1 B;  2I5H A;  4DFJ A;  3GZF A;  3BJY A;  2LPE A;  2AH5 A;  2HW3 A;  3AU2 A;  3UXN A;  1XWL A;  3JPP A;  4JWN A;  3UM9 A;  2B21 A;  1YZ7 A;  4EZ9 A;  4F4K A;  1T4G A;  4EEN A;  5KFW A;  3Q8P B;  4Z6E A;  3GV8 B;  2I9G A;  3EPI A;  3BS5 B;  4JV2 A;  4TUQ A;  4PHE A;  4Q45 A;  1ZQR A;  2KVC A;  1TVA A;  8ICB A;  2BPC A;  3RH5 A;  5J2E A;  3M1Y A;  5B66 U;  4EZ6 A;  3WKD A;  2JMG A;  2F76 X;  2ZG6 A;  2E3T A;  3SAH A;  2C28 A;  4CNQ A;  5IIJ A;  4YXM A;  3V7K A;  4ZOH C;  9ICM A;  4QWB A;  4UAW A;  4DEZ A;  4RQ7 A;  1PUZ A;  2RHF A;  2W9B B;  2F2A B;  5J2D A;  5ALJ A;  2I6X A;  4DSJ A;  2KJ5 A;  5JU5 A;  1XSP A;  2EQY A;  3UPQ A;  4QIW F;  4IC9 A;  3HRD D;  4KLI A;  4C8L A;  3ISD A;  4JMU A;  2KFZ A;  3WK7 A;  4FBU A;  4I28 A;  2KHQ A;  3RJE A;  3EW9 A;  4O3S A;  1DRG A;  4UBC A;  5JRT A;  4DCC A;  3K1R B;  4XUS A;  2OWO A;  1PVR A;  2DFL A;  1ZD2 P;  1WCN A;  5ALY A;  1ZQB A;  1JX4 A;  4J9M A;  4M47 A;  2XIC A;  4DSF A;  3D2N A;  2F1H A;  2B0C A;  1DGS A;  1ZQG A;  3PST A;  4ELU A;  1N63 A;  2JGA A;  3ZDE A;  2H3F A;  3D2S A;  4B9V A;  3CW2 C;  3TFR A;  3J81 j;  3QUB A;  4Q8F A;  5HR6 A;  1XSN A;  3BDP A;  2M0N A;  5KT5 A;  4C8O A;  5HMM A;  4AYB C;  4KLL A;  1RM6 C;  3MAB A;  5ALL A;  4Y2U A;  3C5F A;  2ZIV B;  2ZUD A;  3WK8 A;  1N60 A;  1RQN A;  3E58 A;  2HOF A;  4I2B A;  2HOI A;  2ZTE A;  1FFV A;  3IHQ B;  2L5Y A;  1HJP A;  9ICH A;  1O08 A;  4B9T A;  1WWU A;  1L3U A;  2BKE A;  5GTI U;  2F8K A;  2PI4 A;  1EXN A;  3QEA Z;  4O3P A;  1PZN A;  4DL5 A;  2V4R A;  3MGI A;  4FZN A;  3C1Y A;  4EBD A;  3EWA A;  4Y2Q A;  4YVZ A;  3JPR A;  5EOZ A;  2HHW A;  2HOQ A;  2I1Q A;  5J2F A;  2Z7J A;  4FS2 A;  2DPI A;  4DL7 A;  1NK9 A;  1BPE A;  4Z6C A;  4F5P A;  3QU4 A;  2AXT U;  4I2H A;  1L8L A;  2V4Q A;  4RUC A;  5KAF U;  3H0L B;  2NRW A;  2IA6 A;  1QQ6 A;  4QZ8 A;  3GDX A;  2QB0 B;  1COO A;  2JZB A;  2D8C A;  3NTU A;  1SL0 A;  3BQ1 A;  8ICY A;  1T94 A;  1U4B A;  4KX3 A;  1BVS A;  2K8B B;  5AKZ A;  2W9M A;  3M9N B;  3ETR A;  5J0W A;  9ICK A;  3HP6 A;  2YQE A;  5ALT A;  3A0B U;  2DQN B;  1NJW A;  2NO5 A;  3K1Z A;  4O3O A;  5KG6 A;  1ZJM A;  5DB9 A;  2A1J A;  5KFA A;  1JI7 A;  4IL6 U;  1X2I A;  3SD7 A;  1HUZ A;  3QX7 A;  2ZXH A;  3NAS A;  5J2C A;  2VAN A;  2W3S A;  1ZQQ A;  2BGW A;  3N4M B;  1QSY A;  5J2J A;  2JV3 A;  2IOF K;  4F5R A;  4JB3 A;  1V85 A;  5KFP A;  4EEL A;  2O6K A;  4Y2S A;  5J2B A;  5ALU A;  5HML A;  3QZ7 A;  3MR5 A;  3RJK A;  5KFC A;  5KFZ A;  5D49 A;  1ZQL A;  3ZDA A;  1GO3 F;  2HHT A;  4UW9 A;  4J9L A;  2BPF A;  2R8H A;  3RJG A;  1Z4N A;  7ICR A;  2W3R A;  4KTQ A;  1FIQ A;  1LKY A;  2JEJ A;  2RRD A;  3RR7 A;  3AQE A;  4ED7 A;  4I2C A;  2JXJ A;  3NRW A;  1KFT A;  1KN5 A;  1LB2 B;  3F5E A;  4DLG A;  2QLT A;  4KN4 A;  1LVH A;  3DEE A;  2R8G A;  4IR1 A;  4PGQ A;  1ZQH A;  1HIW A;  1D8L A;  4RQ4 A;  1RZT A;  3C1Z A;  1S76 D;  1NZP A;  3PX6 A;  3OJS A;  2E8M A;  4E0D A;  4OCZ A;  2CXY A;  1ZQK A;  3H4D A;  2CN1 A;  3WKC A;  2JZB B;  4FZL A;  4UB6 U;  3ED5 A;  2F3N A;  2EH9 A;  3C21 A;  7ICT A;  4RNN A;  4RQN A;  1BPZ A;  3QE9 Y;  3NUQ A;  1TK0 A;  3VC8 A;  4PHA A;  5KT3 A;  2KNJ A;  5DBA A;  4O0I A;  3KHL A;  1QQ5 A;  3I76 A;  3AL0 B;  2ATL A;  4TQS A;  3M6K A;  3KHR A;  4QZF A;  5CR0 A;  4C8K A;  4O3N A;  3BQ0 A;  1SZP A;  9ICB A;  5HHI A;  4GC7 A;  2H3Z A;  2W11 A;  1NI3 A;  4M04 A;  5KFF A;  1U47 A;  1XO1 A;  4DQQ A;  3NGD A;  5AKE A;  3LDA A;  3SAG A;  1TKD A;  2DKX A;  1VJ5 A;  1L3T A;  4I27 A;  3K75 D;  4ECX A;  3LYS A;  5A0L A;  2Y1I A;  3M9M B;  5DB7 A;  3F2D A;  1SXD A;  4U7C A;  1ZOL A;  2WAQ F;  2BZF A;  1V38 A;  1BPX A;  2KTQ A;  4I2F A;  5ALO A;  1TAQ A;  3EUB 2;  4I2I A;  1WWV A;  9ICA A;  4RQ3 A;  1ZQI A;  4NLG A;  3I28 A;  4RU9 A;  5J0R A;  3T5J A;  1A6S A;  5J8Y C;  1PK3 A;  3FDS A;  1LKY B;  1SV4 A;  4YFK A;  3GIK A;  9ICN A;  5KG0 A;  4F5N A;  4NLN A;  1KEJ A;  2FMQ A;  5IIM A;  3PX0 A;  2OYY A;  5KG2 A;  3H8M A;  2W7P A;  4Y2X A;  3AM9 A;  2QKQ A;  2MUT A;  1A0P A;  1D9D A;  4PL1 A;  5F9N A;  3ETL A;  4C4T A;  2ZTC A;  2K89 A;  2HHV A;  5KG7 A;  5F3X B;  3N28 A;  2EAM A;  3C23 A;  3N7R C;  1BPY A;  3VCB A;  5KG3 A;  1H38 A;  3TQ1 A;  4BWM A;  2ZIW B;  3ONN A;  1WG8 A;  4FE3 A;  4RQ2 A;  1Z00 A;  1JRP A;  2C22 A;  5KFM A;  2DL0 A;  3QU2 A;  3AMZ A;  2Q4T A;  4OJ5 A;  4US8 A;  3N7S C;  5HNK A;  4M9H A;  3PO5 A;  3HJE A;  2KSO B;  4RPX A;  5H2F U;  5DQG A;  3M8R A;  3SI8 A;  5L9X A;  3PW4 A;  1ZQT A;  4J03 A;  2Y9U A;  1ZXI A;  4EBC A;  1URJ A;  4IQV A;  2KK0 A;  2HHQ A;  2G0A A;  8ICT A;  1X40 A;  5AKJ A;  3SYZ A;  3FYH A;  5ALZ A;  4GIB A;  4OJP A;  4RQ8 A;  2FPL A;  2RDI A;  3JPT A;  3IG8 A;  1S9F A;  4M9N A;  4DOC A;  1SKS A;  4UAY A;  2WTF A;  1OW5 A;  1QCK A;  2Y1J A;  3H0M B;  1QSL A;  2W8L A;  4YCX A;  3N97 B;  4LZG A;  4BX9 C;  3QZ8 A;  1S8O A;  5IIN A;  3RAX A;  1YT3 A;  3RBD A;  3PO4 A;  5KFU A;  4F5Q A;  4R65 A;  4US9 A;  2KIC A;  3WKB A;  4CDG A;  4QZG A;  5AI4 A;  3OGU A;  1RDF A;  1ZYQ A;  3FAH A;  4BWJ A;  4DFM A;  2UVV A;  2NV3 A;  4KLM A;  4KLO A;  4P0P B;  4MF8 A;  2JH1 A;  4P4M A;  4X5V A;  4C8M A;  2E8N A;  4IQW A;  1ARO P;  3S6J A;  3UXO A;  1FO4 A;  7ICS A;  2LKY A;  5J2A A;  1SL2 A;  2KZ3 A;  4A8E A;  2EZY A;  1U45 A;  3PW0 A;  2R8J A;  5DG9 A;  5L1M A;  5EE3 A;  4YMO A;  5ALS A;  4DOA A;  2XY6 A;  1TE2 A;  1ZQZ A;  3OPX A;  3TAN A;  3AN1 A;  4B9N A;  3IN5 A;  2MUT B;  4YG2 A;  1RQL A;  2BR0 A;  1UT5 A;  3RB6 A;  2PXI A;  3ORY A;  3JPS A;  9ICV A;  1ZD4 A;  5ALW A;  4DS4 A;  4G9B A;  4UB3 A;  4MFC A;  1QTM A;  2XY5 A;  3AU6 A;  3OTQ A;  1Z00 B;  4EBE A;  8ICA A;  4UAU A;  3PML A;  2W9A A;  4O5K A;  4NLC A;  5J0P A;  3A0H U;  1KFS A;  4B9M A;  4BXO A;  1Z1V A;  2K4H A;  8ICR A;  2W43 A;  1JRO A;  4QNL A;  2WB1 F;  2Q0Z X;  2YY6 A;  5AI8 A;  4ECT A;  4PHP A;  1CUK A;  1D8Y A;  5CHG A;  7ICI A;  5J0Y A;  3ZDD A;  2NO4 A;  2C2E A;  1TK5 A;  1IV8 A;  4YQW A;  3PW2 A;  3KZI U;  3NVY A;  3H8W A;  2XI9 A;  4QWE A;  2R18 A;  4F91 B;  3BZC A;  1U9L A;  2FPK A;  3RRH A;  2HBL A;  4RQ5 A;  2P66 A;  3C2K A;  2Y0S C;  4F71 A;  2EAN A;  1Q3V A;  4EX7 A;  4DQR A;  3THV A;  4KLJ A;  3ICX A;  3PR4 A;  1MQ2 A;  3M7D A;  2FE9 A;  3RBE A;  4M0A A;  2ESE A;  4P0Q B;  1QSS A;  2W9C A;  1IG6 A;  5D4B A;  2FDR A;  4CRX A;  3D2Q A;  5TZV A;  3MDA A;  2W03 A;  3GFK B;  3C2L A;  5KFX A;  5EWG A;  2BDU A;  4FO6 A;  2BCQ A;  3ALR A;  2E1F A;  4NLZ A;  4C80 A;  1X9W A;  3IP4 B;  4M2Y A;  4I2D A;  3F53 A;  1ECW A;  3Q8Q B;  2CPR A;  5KT4 A;  5DG7 A;  3Q8L A;  2LMR A;  2LM4 A;  2XGQ A;  2W54 A;  4EEY A;  1ZQV A;  3H4B A;  3H8S A;  1SIJ A;  8ICM A;  3KHH A;  1WYG A;  4DL6 A;  3GIM A;  4EYH B;  1ZQC A;  1KW4 A;  1V9P A;  3FM9 A;  2ALZ A;  3E2E A;  4GXK A;  4FBT A;  4OJ6 A;  4LVS A;  2KE7 A;  3UXP A;  1SB3 C;  4YD2 A;  2H3Q A;  5EWF A;  3MC1 A;  1J2M A;  4DQP A;  2DWQ A;  5L1L A;  2LYA A;  4QZ9 A;  4RQ1 A;  2FI1 A;  2JH7 A;  2HDO A;  5L1J A;  5DQI A;  2RDJ A;  3RB4 A;  4R66 A;  5DBB A;  2KKV A;  8ICS A;  7ICL A;  5T14 A;  1S77 D;  3ZD8 A;  1NKE A;  1T8E A;  5KFT A;  3PSP A;  2KMD A;  2OM6 A;  3QNM A;  4Y2J A;  5DLG A;  1L7O A;  2J6T A;  2FJ6 A;  3KD3 A;  2PI5 A;  2ZJA A;  3RRG A;  5HR7 A;  2LHT A;  1JIH A;  2ES6 A;  3IV6 A;  5J8Y A;  5KFY A;  2XID A;  2GOL A;  1T3Q A;  1KDH A;  2KFN A;  1BPB A;  4QIW C;  4NM2 A;  4R8U A;  8ICG A;  8ICW A;  8ICX A;  4F4W A;  2IOH A;  2AQ4 A;  3ISB A;  4RNO A;  1PVQ A;  2ZTD A;  2K60 A;  2KJ9 A;  3V7L A;  3T5L A;  4QWA A;  2W9C B;  3LWM A;  5CWR A;  3IG5 A;  5KG4 A;  3NRZ A;  1Q46 A;  2RP5 A;  3PMN A;  1T7P A;  2PFO A;  4ELV A;  4EX6 A;  5KFQ A;  5AKK A;  3T79 A;  5III A;  3B0X A;  5ALX A;  1NK0 A;  3BQ2 A;  4TUR A;  4XQ8 A;  3TAR A;  4ECV A;  4NY8 A;  2E8P A;  5TIS U;  3Q8M A;  4J9O A;  2C2D A;  3UMG A;  2XO7 A;  1SWW A;  1RXV A;  1JAL A;  2WF6 A;  4MEX A;  5KL8 B;  1M6Y A;  2IBK A;  3NVZ A;  2NRX A;  2YX8 A;  2ZJ5 A;  3LWL A;  2AU0 A;  2KEY A;  4YMN A;  4RZR A;  2M9N A;  3RH6 A;  4KLE A;  1ZRN A;  3JPQ A;  9ICR A;  5AKY A;  1IM4 A;  1ED1 A;  4M9L A;  5AKX A;  1UHU A;  1UA0 A;  2NYV A;  4MFA A;  4UAV A;  1QLN A;  4FZM A;  4KLS A;  5AKG A;  3G6X A;  4NJ8 A;  4K4G A;  3MFH A;  2RQ5 A;  1F0M A;  1A76 A;  3TI0 A;  2MU2 A;  7ICP A;  1KL9 A;  3M8S A;  3T5K A;  2B6G A;  4Y2P A;  3BZK A;  3PX4 A;  4UBB A;  1ZQA A;  1KBU A;  2Y9T A;  3KZX A;  1AQ6 A;  3NVW A;  5ALF A;  2W8K A;  1KKX A;  2JEI A;  1FEZ A;  1XC9 A;  3JPO A;  1ZQD A;  4ECU A;  3QXG A;  5ALH A;  2YB4 A;  4KLG A;  4MHV A;  2H3V A;  4DSE A;  4F50 A;  3HW8 A;  4NM1 A;  2MRL A;  8ICV A;  2MA1 A;  2YN4 A;  1MSW D;  3GII A;  2GO7 A;  5KFO A;  1L8O A;  4M9G A;  2W55 A;  2QAR A;  3EZ5 A;  3MR3 A;  1NKB A;  3GIL A;  4UAS A;  1XS9 D; 
#chains in the Genus database with same CATH homology
 1B43 A;  4EBC A;  4EZ6 A;  5L1I A;  4IQV A;  5KFR A;  2ISO A;  3PVX A;  2JEF A;  2HHQ A;  8ICT A;  2C28 A;  5IIJ A;  2VA2 A;  4YXM A;  3V7K A;  2A1J B;  2AQ0 A;  4EYI B;  3SYZ A;  9ICM A;  4QWB A;  3FYH A;  4UAW A;  4DEZ A;  1BGX T;  4RQ7 A;  2UVW A;  4RQ8 A;  4YR0 A;  2W9B B;  2PFP A;  5J2D A;  2FPL A;  2RDI A;  3JPT A;  1S9F A;  5HHH A;  1D9F A;  4DSJ A;  4M9N A;  4DOC A;  1SKS A;  1ZET A;  4I2A A;  1XSP A;  4YP3 A;  4UAY A;  3UPQ A;  2WTF A;  2Y1J A;  1QSL A;  2W8L A;  3UQ2 A;  4YCX A;  3N97 B;  4I2E A;  4LZG A;  2HVI A;  3OSP A;  4UB1 A;  4KLI A;  1RPL A;  4ECS A;  2NRZ A;  3ISD A;  3QZ8 A;  4ED6 A;  4C8L A;  5IIN A;  4F8R A;  3RAX A;  2KFZ A;  3HT3 A;  3RBD A;  4FBU A;  1L3S A;  4I28 A;  3RJE A;  3EW9 A;  3PO4 A;  4O3S A;  3RH4 A;  5KFU A;  5J0S A;  4DOB A;  4UBC A;  3OHB A;  5KFG A;  4F5Q A;  4R65 A;  4XUS A;  2OWO A;  2DFL A;  2FPM A;  1WCN A;  5KFJ A;  5DDY A;  4NXZ A;  5J2H A;  4KLF A;  4ECQ A;  4RPZ A;  1ZQB A;  1JX4 A;  4J9M A;  4M47 A;  4QZG A;  1T3N A;  3OGU A;  3H7I A;  2V9W A;  1ZYQ A;  4BWJ A;  4DFM A;  4DSF A;  1TK8 A;  5KG5 A;  7ICE A;  2ZJ8 A;  4JUZ A;  5DDM A;  2IHM A;  2UVV A;  3RR8 A;  4DF4 A;  4KLM A;  4KLO A;  4MF8 A;  1JXE A;  2F1H A;  5DLF A;  4YR2 A;  1DGS A;  9ICS A;  1ZQG A;  4P4M A;  4X5V A;  4ELU A;  4C8M A;  5C5J A;  1ZQS A;  4IQW A;  4QZC A;  3H8J A;  1ARO P;  3ZDE A;  3UXO A;  4PH5 A;  7ICS A;  1U48 A;  1JN3 A;  4B9V A;  8ICH A;  1ZQF A;  5J2A A;  3TFR A;  1SL2 A;  4CCH A;  2KZ3 A;  4ECZ A;  5L1K A;  4Q8F A;  1XSN A;  3BDP A;  1S97 A;  1KSP A;  2BQ3 A;  3M9O B;  3PW0 A;  1U45 A;  2R8J A;  5DG9 A;  5BOM A;  5KFN A;  5KT5 A;  1NK7 A;  2BCR A;  4F2R A;  4C8O A;  5HMM A;  4YMO A;  3RJF A;  4DOA A;  4KLL A;  2BDP A;  2XY6 A;  4XRH A;  3MAB A;  1ZQZ A;  3TAN A;  4QZH A;  4B9N A;  4MFF A;  4R63 A;  2MUT B;  7ICF A;  3T5H A;  4YG2 A;  4QZB A;  2BR0 A;  1UT5 A;  3C5F A;  3RB6 A;  2UVU A;  5KFL A;  8ICJ A;  2PXI A;  2ZUD A;  3ORY A;  3UQ0 A;  1N48 A;  3JPS A;  1JXL A;  4DSL A;  3OHA A;  4I2B A;  4IRD A;  9ICV A;  2ZTE A;  3IHQ B;  5BPC A;  2FLP A;  1B22 A;  5DKW A;  1HJP A;  4KLD A;  4RUA A;  4DS4 A;  9ICH A;  4UB3 A;  4B9T A;  5CP2 A;  4MFC A;  1QTM A;  4XA5 A;  2XY5 A;  1RYR A;  4QZA A;  3Q8S B;  1L3U A;  1NJZ A;  3AU6 A;  9ICQ A;  2BKE A;  4IQU A;  1NK8 A;  2PI4 A;  3B0Y A;  3GV7 B;  1Z00 B;  5KFI A;  4EBE A;  1EXN A;  8ICA A;  3PML A;  4O5K A;  2W9A A;  3QEA Z;  4O3P A;  5J0P A;  4ED3 A;  1HUO A;  1KFS A;  1K1Q A;  1PZN A;  1ZQX A;  2V4R A;  3GQC A;  4J9Q A;  4HYK A;  3MGI A;  4DL5 A;  2IMW P;  4BXO A;  3C1Y A;  4R64 A;  4EBD A;  8ICR A;  2F1I A;  4ECW A;  4RT2 A;  3EWA A;  4M9J A;  4R8U B;  4YVZ A;  2Q0Z X;  3JPR A;  5EOZ A;  1L3V A;  5J2I A;  4ECT A;  3MFI A;  2HHW A;  4PHP A;  2BPG A;  4O3R A;  4I2G A;  3RJJ A;  9ICO A;  2I1Q A;  2UVR A;  4GXJ A;  1CUK A;  5J2F A;  1D8Y A;  4DLE A;  5CHG A;  1DOQ A;  4TQR A;  2XCA A;  4FS2 A;  2DPI A;  4F4X A;  7ICI A;  4DL7 A;  1NK9 A;  1BPE A;  5J0Y A;  4Z6C A;  3ZDD A;  2C2E A;  1TK5 A;  4F5P A;  1NJX A;  2FLL A;  3G6V A;  3ZDC A;  5KFD A;  4F93 B;  4YQW A;  4I2H A;  4K4I A;  4KLH A;  3PW2 A;  4F4Z A;  2V4Q A;  4RUC A;  5KFK A;  1ZQT A;  2NRW A;  4UB2 A;  4ELT A;  1SKR A;  2IA6 A;  3QEB Z;  4QZ8 A;  4ECR A;  3GDX A;  3H8W A;  4QWE A;  3PNC A;  4F91 B;  4RPY A;  1SKW A;  1COO A;  2JZB A;  1U9L A;  3NTU A;  4Q43 A;  2FPK A;  3RRH A;  3V72 A;  5J0U A;  4DFK A;  4RQ5 A;  1K1S A;  3H40 A;  3BQ1 A;  4LZD A;  3C2K A;  1SL0 A;  1KRP A;  3RB3 A;  2P66 A;  4DQR A;  3ISC A;  3THV A;  1U4B A;  8ICK A;  3ZDB A;  4KLJ A;  4J9N A;  1BVS A;  3PR4 A;  1MQ2 A;  1C7Y A;  3GIJ A;  2NRT A;  4ED1 A;  5BOL A;  2HHU A;  3RBE A;  4DL2 A;  4M0A A;  2W9M A;  1RXW A;  4BDP A;  3M9N B;  2KZZ A;  1Z3E B;  5J0W A;  9ICK A;  1X9M A;  3HP6 A;  2W9C A;  1QSS A;  3MBY A;  5DB8 A;  1NJW A;  5D4B A;  5KG6 A;  4O3O A;  5J0Q A;  4ECY A;  1ZJM A;  1Y88 A;  9ICX A;  3MR2 A;  5DB9 A;  2A1J A;  4ZH4 A;  4GXI A;  1S0M A;  5TZV A;  3MDA A;  1U49 A;  1NJY A;  5KFA A;  4ED2 A;  4NLK A;  9ICE A;  8ICU A;  4UB4 A;  3GFK B;  1X2I A;  4DQS A;  3C2L A;  3K4G A;  4I29 A;  5KFX A;  7ICN A;  5DQH A;  5IIK A;  1HUZ A;  4Q8E A;  5EWG A;  4IR9 A;  4DL4 A;  5J2C A;  4FO6 A;  2VAN A;  5F9L A;  2BCQ A;  1S10 A;  1ZQQ A;  7ICJ A;  3MDC A;  4B9M A;  2BGW A;  3N4M B;  1S0N A;  4NLZ A;  1X9W A;  4M2Y A;  4I2D A;  1QSY A;  5J2J A;  2LYH A;  3Q8Q B;  4O5C A;  5KT4 A;  4UAZ A;  4PGX A;  2FMP A;  5DG7 A;  8ICN A;  9ICP A;  4F5R A;  3Q8L A;  9ICC A;  1X9S A;  2XY7 A;  4B9S A;  5J0X A;  2XGQ A;  5KFP A;  5CJ7 A;  3TAQ A;  4EEY A;  8ICZ A;  1ZQV A;  3H4B A;  3H8S A;  1KLN A;  4DFP A;  4QWC A;  3KHH A;  1ZQM A;  5J2B A;  5HML A;  4DL6 A;  8ICM A;  3GIM A;  2NRV A;  4RNM A;  4EYH B;  3V6H A;  7ICV A;  4BGD A;  1ZQC A;  5DB6 A;  3RJI A;  3QZ7 A;  4KN7 A;  3MR5 A;  3RJK A;  5KFC A;  4IRK A;  7ICH A;  4P4O A;  1V9P A;  5KFZ A;  4IQT A;  5D49 A;  2ALZ A;  3E2E A;  4GXK A;  1NK5 A;  3ZD9 A;  1ZQL A;  1ZQO A;  3ZDA A;  4FBT A;  4QZD A;  2P6R A;  4LVS A;  5KFV A;  4YD1 A;  5J2K A;  3EPG A;  3UXP A;  2HHT A;  4UB5 A;  2IHN A;  4F4Y A;  4J9L A;  5DG8 A;  1XSL A;  2BPF A;  4YD2 A;  1ZQN A;  5CB1 A;  5EWF A;  2R8H A;  2FMS A;  3T3F A;  3RJG A;  2PFQ A;  5KFB A;  4P4P A;  3RAQ A;  3SV4 A;  4KLU A;  7ICR A;  1ZQW A;  4KTQ A;  2JEJ A;  4DQP A;  3GV5 B;  5L1L A;  4DF8 A;  5J2G A;  4QZ9 A;  4KIT B;  4RQ1 A;  4JWM A;  9ICW A;  2F1J A;  5IIL A;  2KZM A;  1TV9 A;  3RR7 A;  4QWD A;  2AGP A;  2GWS A;  4GLX A;  5L1J A;  4ED7 A;  1JMS A;  4ED0 A;  4C8N A;  2PFN A;  4YXJ A;  4I2C A;  5DQI A;  3G6Y A;  2RDJ A;  4F2S A;  4Z6D A;  3JPN A;  5DBC A;  8ICF A;  3RB4 A;  4R66 A;  1ZJN A;  1ZQY A;  1KFT A;  1LB2 B;  5DBB A;  4DWI A;  1RYS A;  4DLG A;  3SZ2 A;  1UT8 A;  4KN4 A;  8ICS A;  7ICL A;  1S77 D;  3ZD8 A;  3HPO A;  3EYZ A;  3PW5 A;  1NKE A;  3PW7 A;  1T8E A;  2R8G A;  4IR1 A;  4PGQ A;  5KFT A;  3LK9 A;  1LV5 A;  1ZQH A;  1NK4 A;  1D8L A;  4RQ4 A;  1RZT A;  5DLG A;  3V7J A;  3C1Z A;  3PV8 A;  4P2H A;  1S76 D;  4M6W A;  4PGY A;  2BQR A;  2J6T A;  7ICU A;  3PX6 A;  3OJS A;  2VA8 A;  3V6J A;  8ICC A;  4RT3 A;  8ICQ A;  2R8K A;  2PI5 A;  3TFS A;  2J6U A;  4E0D A;  3PY8 A;  2ZJA A;  3Q8K A;  1ZQK A;  3RRG A;  5DGA A;  2BCU A;  1JIH A;  4KMU A;  3H4D A;  2P6U A;  5KFY A;  3RTV A;  2AGO A;  1A77 A;  3KTQ A;  8ICL A;  2JZB B;  2XGP A;  1KDH A;  2KFN A;  1BPB A;  4NM2 A;  4R8U A;  8ICG A;  1KFD A;  2ZUB A;  1XU4 A;  3C21 A;  8ICW A;  7ICT A;  2ASJ A;  8ICX A;  3KHG A;  4F4W A;  4RNN A;  1BPZ A;  3QE9 Y;  1TK0 A;  2BQU A;  2AQ4 A;  4PHA A;  4RNO A;  3ISB A;  1N56 A;  5KT3 A;  4O9M A;  2ZTD A;  3BQT A;  4O0I A;  5DBA A;  3KHL A;  3V7L A;  4J9K A;  3T5L A;  4QWA A;  2W9C B;  3LWM A;  1KTQ A;  5CWR A;  5KG4 A;  2ATL A;  2XC9 A;  1S0V A;  4TQS A;  4QZI A;  1BPD A;  1ZQU A;  4K4H A;  8ICI A;  4UQG A;  2ISP A;  3PMN A;  3Q8R B;  1T7P A;  2PFO A;  4ELV A;  5KFQ A;  3OSN A;  3KHR A;  4B9U A;  4QZF A;  5CR0 A;  4C8K A;  5III A;  3B0X A;  5KT7 A;  4DSI A;  1NK0 A;  2BCV A;  3BQ2 A;  4TUR A;  4XQ8 A;  4MEY A;  4O3N A;  5IIO A;  3BQ0 A;  3TAR A;  2AGQ A;  2W9B A;  4ECV A;  1SZP A;  4F92 B;  4NY8 A;  9ICB A;  5KFS A;  5HHI A;  3Q8M A;  4GC7 A;  4J9O A;  3C2M A;  2C2D A;  2JEG A;  2XO7 A;  3OJU A;  4FS1 A;  3SV3 A;  4TUS A;  1ZQP A;  4M04 A;  7ICG A;  5D46 A;  5KFF A;  1U47 A;  2VA3 A;  2C2R A;  4J9R A;  5KFE A;  5JUM A;  1XO1 A;  4DQQ A;  1RXV A;  3NGD A;  1L5U A;  1ZQJ A;  3LDA A;  1TKD A;  2XCP A;  3MR6 A;  4MEX A;  2HHX A;  4I2J A;  4TUP A;  2H5X A;  4RQ0 A;  4O5E A;  1L3T A;  1S0O A;  4I27 A;  8ICB A;  9ICU A;  5KG1 A;  5CA7 A;  1TFR A;  3K75 D;  4ECX A;  4ED8 A;  2Y1I A;  3M9M B;  3RB0 A;  2ASD A;  1SL1 A;  5J0T A;  2NRX A;  2ZJ5 A;  5DB7 A;  4YR3 A;  3LWL A;  4GC6 A;  2AU0 A;  1MQ3 A;  4YMN A;  4RZR A;  2AJQ A;  1UA1 A;  1BPX A;  5DGB A;  2M9N A;  3HWT A;  4I2F A;  3RH6 A;  2KTQ A;  4DQI A;  9ICF A;  4O3Q A;  4KLE A;  1NKC A;  1TAQ A;  1CEZ A;  2DPJ A;  4KLT A;  1TAU A;  4I2I A;  9ICI A;  3JPQ A;  4DS5 A;  9ICA A;  9ICR A;  2ASL A;  1IM4 A;  4RQ3 A;  1ZQI A;  4NLG A;  5J29 A;  2KN7 A;  2J6S A;  5KT6 A;  5J0O A;  4RU9 A;  4M9L A;  5J0R A;  3T5J A;  3FDS A;  1NK6 A;  7ICQ A;  4PPX A;  3HX0 A;  4YN4 A;  4YFK A;  3GIK A;  4DL3 A;  1UA0 A;  7ICO A;  3C5G A;  9ICN A;  2BCS A;  5KG0 A;  4F5N A;  4MFA A;  4NLN A;  4G3I A;  1QLN A;  1KEJ A;  1NOM A;  2FMQ A;  5IIM A;  2IBK A;  4KLQ A;  4KLS A;  3PX0 A;  3G6X A;  5KG2 A;  3IM1 A;  7ICM A;  2R8I A;  4QW8 A;  4K4G A;  9ICT A;  3MFH A;  4DO9 A;  4F3O A;  4JV0 A;  4J9P A;  4IRC A;  2MUT A;  1A76 A;  3V6K A;  3TI0 A;  1D9D A;  7ICP A;  2MAX A;  4Z6F A;  1IXR A;  3M8S A;  5F9N A;  3T5K A;  4PHD A;  3ETL A;  3PR5 B;  4BXO B;  4JV1 A;  5KTQ A;  2ZTC A;  3PX4 A;  4RQ6 A;  4UBB A;  2HHV A;  1ZQE A;  1ZQA A;  5KG7 A;  4DSK A;  2W8K A;  2FLN A;  4MF2 A;  2JEI A;  4M6W B;  3RJH A;  4DFJ A;  9ICL A;  3BJY A;  2HVH A;  1XC9 A;  3JPO A;  3C23 A;  1BPY A;  1ZQD A;  4Q44 A;  4ECU A;  5KG3 A;  1H38 A;  1WCL A;  4KLG A;  3TQ1 A;  4JK1 A;  2HW3 A;  3AU2 A;  3UXN A;  4BWM A;  5KT2 A;  1XWL A;  2BHN A;  4QW9 A;  4F5O A;  4DSE A;  4RQ2 A;  2HHS A;  4F50 A;  7ICK A;  3JPP A;  1Z00 A;  9ICJ A;  2ZUC A;  4J9S A;  4JWN A;  2B21 A;  3HW8 A;  4YMM A;  2C22 A;  4B9L A;  5KFM A;  4EZ9 A;  4F4K A;  4NM1 A;  1T4G A;  3TAP A;  8ICV A;  1MSW D;  8ICY A;  5KFW A;  8ICP A;  3Q8P B;  4Z6E A;  3GV8 B;  8ICE A;  5HNK A;  3GII A;  2I9G A;  4M9H A;  3PO5 A;  5KFH A;  3EPI A;  5KFO A;  4JV2 A;  4TUQ A;  8ICO A;  3AUO A;  4PHE A;  4Q45 A;  1ZQR A;  4M9G A;  1TVA A;  4RPX A;  4QZE A;  9ICG A;  3MGH A;  5DQG A;  5EWE A;  2BPC A;  3M8R A;  5J2E A;  5L9X A;  3MR3 A;  3EZ5 A;  3PW4 A;  3SI8 A;  5HP4 A;  3RH5 A;  3GIL A;  1NKB A;  1MC8 A;  1XS9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...