2MUTB

Solution structure of the f231l mutant ercc1-xpf dimerization region
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DNA excision repair protein ERCC-1
publication title The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2mutB00
4QZDA 4JWNA 9ICUA 5KFSA 1ZQAA 2C28A 4J9OA 4QWCA 2AGOA 3C21A 5KTQA 3K4GA 4DSIA 1X9SA 4RQ0A 4P4MA 4QZAA 1NKBA 2JEJA 4JV1A 4M6WA 1JXEA 4FBTA 5KFQA 5BPCA 4DOCA 7ICNA 2BHNA 4UB4A 3TAQA 2BKEA 4DFKA 1L5UA 4B9SA 5KT3A 1KFSA 2MUTA 3EW9A 2BPCA 4FBUA 1RXWA 1IM4A 4M9LA 2AGQA 3T5HA 2BQ3A 3PX6A 4QZEA 1IXRA 1NK0A 5J0SA 3RB6A 3TARA 1X9WA 3OHBA 3RBEA 3SI8A 5KG0A 4ECTA 4MF2A 1RXVA 5KFBA 3H8SA 4QZCA 1KSPA 1TAUA 1ZQUA 2JZBA 5KG7A 5DB8A 4I27A 4IR9A 1XSLA 5J2IA 1ZETA 5EWFA 2W8LA 3M8SA 1EXNA 1XWLA 2PXIA 3SYZA 4PHDA 3HT3A 3LK9A 8ICGA 4UQGA 1RPLA 9ICWA 4RQ7A 1X2IA 1SL1A 1ZQMA 1ZQFA 7ICFA 9ICBA 1TAQA 1D9FA 3PO5A 4Z6CA 1V9PA 4DS4A 3TANA 1L3SA 1ZQRA 2DPIA 3H8JA 4QWEA 1TK8A 4F8RA 1NJWA 5KFZA 2HW3A 9ICGA 3ZD8A 8ICUA 5DGBA 5J0UA 4M0AA 4YXMA 1NK8A 3EPIA 4RT3A 1NK6A 8ICPA 4IQTA 4F91B 2BCQA 8ICNA 3GFKB 4Z6EA 4YR3A 2AQ0A 3JPSA 2IHNA 3ZDCA 2B21A 2XGPA 9ICFA 3IHQB 3THVA 5CB1A 5D46A 4YCXA 2PFQA 2NRWA 4QWBA 5KT4A 3V7KA 4O5KA 5KFYA 5DKWA 4GXKA 3T5LA 2KZMA 4GXJA 2A1JB 1RZTA 1TFRA 1K1SA 4F5RA 1ZYQA 1H38A 4RPYA 5KFHA 3BQ2A 3QEAZ 1L3TA 5DBAA 4ED6A 5KFEA 2R8KA 8ICSA 3GILA 3SV3A 3FYHA 4J9MA 4ECXA 3G6XA 5KFAA 5J2HA 5J2JA 3RB3A 1NK9A 3RJHA 3H8WA 5KFLA 1ZQCA 2ZUCA 2BPFA 3RH5A 1D8LA 2UVVA 4NY8A 5EWGA 7ICEA 4EYHB 1K1QA 3QZ8A 1QSLA 1S9FA 4F2RA 4RZRA 4KLQA 5EWEA 3MR3A 2MAXA 1TV9A 2PFNA 4I2HA 5KG5A 1D9DA 3NTUA 5J2AA 3G6VA 1T3NA 2NRTA 3KHLA 4DSKA 3NGDA 4BXOA 5J2DA 4PGXA 3JPQA 3T3FA 4YP3A 1AROP 1MQ2A 4M04A 1LB2B 4IQVA 3N4MB 2ALZA 4KN4A 3JPNA 3BQ1A 1KFTA 2BCRA 3PW2A 4BGDA 1ZQPA 2R8GA 3HX0A 2Y1IA 4XRHA 3PMLA 3UQ0A 4M6WB 1N56A 4UBCA 3JPTA 4DEZA 4QW8A 4R64A 2WTFA 4IQUA 5DDMA 1Z3EB 2LYHA 3MFHA 3EWAA 4GC6A 4ECYA 3N97B 4TURA 1NKCA 4I2EA 4I2GA 4C8MA 5CA7A 4F5OA 1T4GA 2ZJAA 1Z00A 3QEBZ 2R8JA 2MUTB 4RPXA 9ICEA 2FMQA 1BPXA 8ICKA 1KEJA 3RH4A 4NLZA 2C2RA 1QLNA 1ZQZA 2I1QA 5J2KA 4DSEA 4RQ6A 5HMMA 1XC9A 5J2BA 1S0VA 1QSSA 1ZQNA 4DSLA 4YD1A 3LWLA 4NXZA 2P66A 8ICCA 4GXIA 2JZBB 4KLUA 3RB4A 5J0OA 2JEFA 1U47A 7ICOA 4QZ9A 5EOZA 3PVXA 3PW4A 4LZGA 5KFWA 5IIOA 2RDJA 5L9XA 4PHEA 8ICAA 4ECWA 5TZVA 4NM2A 2PFPA 4EEYA 4ECRA 1WCLA 1KFDA 1CUKA 5DDYA 4RNOA 3C5FA 2FLLA 2FLNA 4C8KA 4DOAA 4K4HA 4UAWA 5KFRA 9ICIA 4RNNA 1BPDA 5KT2A 2V4QA 5L1IA 7ICHA 1U9LA 2XY6A 3M8RA 4P4PA 2W8KA 4J9SA 4GLXA 4ECVA 2VA2A 4ELVA 9ICSA 3HPOA 3RAXA 3RJEA 5JUMA 4KLIA 8ICWA 4IRCA 3T5KA 3PMNA 4NLGA 2HHWA 4YR0A 4EZ9A 4J9KA 4I2IA 3V7JA 2GWSA 2H5XA 4EBCA 2FPLA 4Z6DA 4QZGA 5KT7A 2VA3A 4KLJA 3RJIA 4O3NA 5KFVA 2XY5A 4UB5A 4TQSA 9ICKA 1ZQSA 4DFPA 4ECQA 4X5VA 3RR7A 4F3OA 5DLGA 3UXNA 1JXLA 1JN3A 1C7YA 4Q8FA 8ICQA 4B9VA 2HHQA 2BCUA 2R8IA 4RNMA 4F4WA 5DGAA 1XSNA 3C23A 4O3RA 4KN7A 3V6HA 3M9NB 4UB1A 1NJZA 2KFZA 8ICLA 3PNCA 4BDPA 9ICNA 2AJQA 1ZQYA 3JPRA 3Q8PB 3MABA 4I2AA 9ICPA 4YFKA 1B22A 4F4ZA 4ED1A 4DQIA 4F5PA 3OHAA 2JEIA 1KTQA 4GC7A 4DQPA 3PR4A 5KG4A 4ED3A 4ZH4A 4E0DA 1SZPA 4F5NA 4ED7A 4CCHA 3MR6A 1L3VA 1TK0A 5KT6A 4BXOB 4Q45A 2ZTEA 2ZUDA 1RYSA 1ZQDA 4BWJA 4YD2A 3C2KA 1HUZA 2HHXA 4F92B 4K4GA 4FS2A 4YG2A 7ICRA 5CR0A 4PHAA 4J9RA 3SZ2A 4YXJA 7ICMA 2DFLA 4YVZA 3RJJA 5J2GA 5DBCA 3RH6A 3UXPA 1DGSA 1ZJNA 1ZQTA 1A76A 4UBBA 3ZDAA 4B9UA 8ICZA 1ZQHA 3BDPA 1WCNA 4YMMA 4JUZA 8ICHA 4ED0A 4LVSA 2KZ3A 1SKSA 4O3OA 4RQ5A 4RU9A 1KDHA 3RRGA 3RJFA 1BPZA 4DL3A 5J0TA 1UA1A 2NRZA 3T5JA 4O3PA 1Z00B 7ICUA 4RUAA 1MC8A 7ICIA 2C22A 4PGYA 5F9LA 4DOBA 1ZQWA 1COOA 1MSWD 1SL2A 3KHRA 2PFOA 3Q8LA 4RQ8A 5HNKA 2Q0ZX 3KHHA 5J0WA 2C2EA 4O5CA 1JIHA 4KLLA 3GIJA 2ZTDA 4BWMA 2ISPA 2FMPA 4B9LA 5CHGA 4JWMA 4KMUA 7ICKA 3UQ2A 4J9NA 1XU4A 5KFFA 3V6JA 8ICYA 4TUSA 9ICJA 5DG7A 1TVAA 4B9TA 1QSYA 2M9NA 5KFJA 5KFNA 4R8UB 2FMSA 5KG3A 5J2CA 4I2CA 4DQSA 4K4IA 4O0IA 5D4BA 4I29A 3IM1A 3GQCA 4KLMA 3C1YA 4XA5A 9ICAA 2HHVA 4O3QA 4UAZA 2UVUA 1X9MA 1NK5A 2ZJ8A 4DL2A 1NJYA 4FS1A 2KZZA 3C2MA 3ZD9A 4QZIA 3OSNA 4IRKA 3AU2A 5KFMA 2DPJA 1UT8A 4F4YA 3TFSA 5KG6A 4Q43A 3FDSA 4Z6FA 3JPPA 8ICTA 1KLNA 4DLEA 4QZHA 3RAQA 5L1LA 4JK1A 2W9CA 4YR2A 3M9OB 5C5JA 3C1ZA 4DFJA 9ICTA 2HVIA 2NRXA 5CWRA 3Q8MA 4XQ8A 1D8YA 5IIJA 5KFCA 4DWIA 4DSJA 1S76D 5KFDA 4I2FA 5DQIA 3RJGA 2HHSA 4QWAA 2F1HA 2JEGA 5HHHA 5DG9A 5BOLA 3GIIA 5DLFA 2VA8A 3ISDA 3PO4A 1XSPA 4NM1A 4QZFA 2W9BA 4DL5A 3PX0A 1S0OA 4PGQA 4ECUA 9ICQA 3BQ0A 4R8UA 5DBBA 3H4DA 1S0NA 3ORYA 4YN4A 3ETLA 7ICJA 1ZQLA 9ICVA 4F2SA 9ICLA 4M9NA 5IILA 1MQ3A 1TKDA 3TFRA 4QWDA 3PV8A 4KLDA 2V4RA 3RB0A 4QZBA 4KLHA 2FPKA 4O5EA 1U4BA 2J6UA 3PW0A 3GV8B 4KLSA 9ICXA 5DQGA 4F93B 2KFNA 8ICIA 3MDAA 4XUSA 2FLPA 1NK7A 3EYZA 4JV2A 4UB3A 3EPGA 4QZ8A 3Q8SB 2AU0A 8ICMA 1UA0A 4DL4A 4I2BA 4J9QA 4KLGA 2XC9A 5KFPA 2PI4A 4M9HA 1LV5A 3GV5B 3B0XA 2XO7A 5KFXA 3AU6A 1ZQQA 3GIKA 2KTQA 2UVRA 1Y88A 4MFAA 2IA6A 4G3IA 3PW5A 5J0PA 4ED8A 5IINA 1SL0A 4O3SA 4RUCA 5BOMA 3RBDA 3MBYA 3K75D 4MFFA 4IR1A 2BPGA 3PW7A 5DB7A 3HWTA 2ASLA 1NKEA 4DF4A 2ZTCA 4C8NA 1U45A 4M9GA 2ATLA 1ZQJA 7ICGA 4RQ1A 3OJSA 3PX4A 4DQQA 1HJPA 4QW9A 2BCVA 3PR5B 4DO9A 5KG2A 2BR0A 2BCSA 3ZDDA 3QE9Y 7ICVA 2IMWP 7ICQA 2BDPA 4ELTA 3ISCA 1S0MA 2PI5A 3TQ1A 1NOMA 1NJXA 4I28A 4PH5A 2P6RA 4KTQA 2W9AA 3V7LA 3HP6A 3EZ5A 1JX4A 4DSFA 2KN7A 3GDXA 4IQWA 5DB9A 3RJKA 3JPOA 9ICRA 4DL6A 1PZNA 2XCPA 4KITB 5J0RA 4B9MA 9ICHA 3AUOA 5CJ7A 2AQ4A 5L1KA 5KG1A 4HYKA 1A77A 4EZ6A 1U48A 8ICBA 2HHTA 4JV0A 3TAPA 4DF8A 4B9NA 2ZUBA 4TUPA 1NK4A 4KLOA 3OJUA 2UVWA 2IBKA 3ZDEA 2HHUA 3UXOA 1ZQIA 1BPYA 2W9CB 3ZDBA 1BPEA 4MFCA 3GIMA 2XGQA 4C8LA 1ZQEA 4F4KA 4FO6A 1ZQXA 4TUQA 4F5QA 5HHIA 4DL7A 1SKWA 3G6YA 1ZQOA 3C2LA 3UPQA 1BGXT 2I9GA 3ISBA 3GV7B 4EBEA 2C2DA 4RQ2A 7ICTA 5J0YA 1ZQVA 3Q8QB 4I2JA 4MEYA 4R63A 1T8EA 4M47A 2J6SA 4MEXA 3BJYA 2R8HA 1DOQA 3OSPA 5IIKA 3MR5A 4P2HA 4RQ3A 4YMNA 5KFKA 1U49A 4UB2A 5J2EA 3HW8A 5KFTA 5J29A 2W9BB 4ECZA 3V6KA 2ISOA 2AGPA 2ASJA 3MGHA 2IHMA 4M2YA 2F1IA 4MF8A 3QZ7A 5J0XA 1BVSA 2BQUA 2XCAA 4Q44A 1KRPA 2NRVA 3KTQA 8ICEA 4ED2A 2Y1JA 3KHGA 2BQRA 1S97A 8ICVA 2XY7A 4NLNA 5IIMA 4J9LA 3Q8RB 3MGIA 4KLTA 4M9JA 3RTVA 9ICMA 4O9MA 3LDAA 4Q8EA 2ASDA 5DQHA 8ICFA 7ICSA 1ZQBA 3PY8A 1TK5A 4EYIB 8ICOA 1ZJMA 4DS5A 9ICCA 2V9WA 2W9MA 4LZDA 2P6UA 3H4BA 1QTMA 2OWOA 3MDCA 4C8OA 5DB6A 4I2DA 1XS9D 4DFMA 4R66A 1UT5A 5F9NA 3RRHA 4KLFA 4TQRA 1ZQKA 9ICOA 4DQRA 5KFOA 3RR8A 2RDIA 4EBDA 5DG8A 4YMOA 5D49A 8ICXA 4P4OA 3C5GA 5KFUA 4IRDA 4PPXA 2A1JA 5HMLA 3M9MB 4F4XA 4R65A 1B43A 1N48A 1HUOA 8ICJA 1S77D 5J0QA 1L3UA 2J6TA 2FPMA 5IIIA 4RPZA 4ELUA 4NLKA 4YQWA 3B0YA 3OGUA 1ZQGA 3BQTA 3LWMA 4F50A 1SKRA 1CEZA 4RT2A 3Q8KA 4KLEA 8ICRA 3E2EA 1BPBA 2F1JA 1XO1A 4PHPA 1T7PA 1S10A 7ICPA 1RYRA 2HVHA 3H7IA 5KFIA 4ECSA 2ZJ5A 4RQ4A 3V72A 4UAYA 2VANA 4DLGA 1JMSA 4J9PA 2BGWA 7ICLA 5KT5A 3H40A 5HP4A 5L1JA 3SV4A 3MFIA 3TI0A 5J2FA 3MR2A 5KFGA 5CP2A
chains in the Genus database with same CATH superfamily
1ZQAA 2C28A 4QWCA 2MA1A 4RQ0A 2JEJA 3ETRA 1XNSA 1JXEA 5KNIA 7ICNA 5BPCA 1A6SA 2CPRA 1KFSA 2MRLA 2BPCA 1WYGA 1IM4A 1NK0A 3I76A 3PSTA 5KG0A 5EE0A 4ECTA 4MF2A 1KSPA 2JZBA 5DB8A 3D2SA 3M8SA 1XWLA 2EH9A 1X2IA 2Y0SF 3PO5A 1L3SA 2DPIA 2DBYA 1NJWA 3SAFA 4IQTA 4F91B 8ICNA 5AM0A 5AK5A 2XGPA 9ICFA 5ALTA 4YCXA 2W54A 3T5LA 2OEHA 1TFRA 2FJ6A 1ZYQA 3BQ2A 2R8KA 3IN5A 3SENA 3G6XA 3RB3A 5J2HA 5J2JA 5KFLA 3RH5A 1D8LA 5EWGA 4EYHB 2L5YA 4RZRA 3MR3A 1JUDA 1D9DA 2F3NA 3FM9A 2NYVA 1YZ7A 3OPXA 5FP0A 3N4MB 2W7PA 3BQ1A 3PW2A 2Y1IA 4OD0A 3JPTA 2RP5A 4GC6A 1Z3EB 5DDMA 3EWAA 4ECYA 4I2GA 1Z00A 3CNHA 2KE7A 3NVYA 2R8JA 4RPXA 2FMQA 8ICKA 1KEJA 2C2RA 3L5KA 1XC9A 5KL1B 2YMQA 1QH9A 4KLUA 3RB4A 2JEFA 2QB0B 7ICOA 4QZ9A 2EQYA 3PSIA 2MU2A 2ZG6A 5L9XA 4PHEA 4NM2A 1KFDA 3C5FA 4C8KA 1KN5A 5AKEA 4RNNA 1U9LA 2XY6A 3M8RA 4P4PA 4J9SA 4KLIA 2KHVA 8ICWA 5CEHA 3PMNA 2HHWA 4EZ9A 2EZXA 4I2IA 2LM4A 2XI9A 4Z6DA 5KT7A 4KLJA 4Y2VA 4UB5A 9ICKA 1CRXA 2DF4B 5ALGA 4C7ZA 2KV2A 2HHQA 2BCUA 5DGAA 4KN7A 3V6HA 2KFZA 1SWVA 4UB1A 2AJQA 5ALUA 2H3IA 3Q8PB 4I2AA 4ED1A 4DQIA 2JEIA 3NVVA 1KTQA 4GC7A 4DQPA 3PR4A 5KG4A 4E0DA 1Q8KA 1SZPA 4ED7A 3QUBA 3MR6A 2ZUDA 1V38A 3C2KA 2YN4A 2HBKA 1F5SA 2K8BB 2DFLA 3F5EA 5J2GA 5DBCA 1ZQHA 3E0FA 1CI4A 8ICHA 3SAHA 4O3OA 4RQ5A 3RJFA 1WWUA 5J0TA 3CRXA 3N7PD 3BS5A 3N7RC 2H3ZA 4DOBA 1ZQWA 1PVQA 1COOA 3KHRA 5AKGA 3Q8LA 5HNKA 2Q0ZX 4O5CA 1JIHA 2ZIXA 4IC9A 4BWMA 1B4FA 4JWMA 7ICKA 4UB8U 3UQ2A 1XU4A 5AI6A 3NVZA 2M9NA 1FFVA 5KFJA 5KG3A 5ALNA 1J97A 4I2CA 5D4BA 3QU4A 9ICAA 1NZBA 4O3QA 1X9MA 3D2NA 1NK5A 2ZJ8A 3KKAA 2KZZA 3AU2A 2DPJA 1UT8A 4QZHA 4OJ5A 2LHTA 2NRXA 5CWRA 2ZIWA 5IIJA 3H0MB 1RYUA 4P0PA 4I2FA 1KKXA 4QWAA 2OCEA 5JU5A 3D6JA 3GIIA 1ZQ1C 3ISDA 3PO4A 5C0YA 3PX0A 3N7SC 1ZQLA 2E8PA 5IILA 3TFRA 3PV8A 3SEIA 2V4RA 2JRZA 4QZBA 4KLHA 2FPKA 4O5EA 1U4BA 2J6UA 4OCZA 4XUSA 3F2CA 2E1EA 3AMZA 3O0FA 2AU0A 1L7PA 3HRDD 5KFPA 3M7DA 3AU6A 4RUCA 3MBYA 4MFFA 5EE1A 1VDVA 4C8NA 7ICGA 1ZQJA 3ALRA 4DQQA 2KKVA 1KQQA 2KP7A 5ALYA 2BDPA 3ISCA 2OH2A 3HP6A 3EZ5A 4UAUA 3NS1A 2DL0A 4DL6A 3IP4B 3QU9A 3DEEA 5AK3A 4B9MA 9ICHA 2AQ4A 5CJ7A 2ZUBA 4KLOA 1ZQIA 2XGQA 1N62A 3RFAA 1WG8A 4TUQA 5HHIA 4DL7A 1OW5A 2I9GA 3C29A 1JROA 2C2DA 1ZQVA 3Q8QB 1V85A 1T8EA 2AH5A 3OSPA 4RQ3A 4UB2A 3HW8A 2W9BB 1ZD3A 1UQVA 4M2YA 3SR6A 1N61A 4MF8A 5J0XA 4Q44A 1IV8A 1KRPA 8ICEA 3KHGA 1ZRNA 2I6XA 4J9LA 3Q8RB 4Q8EA 3GZFA 8ICFA 2D8CA 3SAGA 3H4BA 1NNLA 5DB6A 2XICA 4I2DA 2JH1A 4KLFA 3KZIU 4YMOA 2RRDA 3M9MB 1N48A 5J0QA 4RPZA 5IIIA 4NL9A 4C4SA 4KLEA 2K8AA 1QQ7A 2WF8A 2BDUA 1A0PA 4RQ4A 5AI8A 1Q3UA 2KJ5A 5G5HA 4UAYA 3ZI4A 3ED5A 4DLGA 5ALKA 1QQ6A 3H40A 5HP4A 3SV4A 5J2FA 2G5HB 5KFGA 2BHNA 1QTMA 1O08A 9ICUA 2EZYA 3C21A 3AM9A 1NKBA 1Z1VA 4UB4A 1P7DA 2BKEA 2VIXA 4DFKA 5AICA 4B9SA 4Y2YA 2MUTA 3EW9A 3CP8A 4ACOA 2B6GA 2BQ3A 1IXRA 3RB6A 2E8OA 1X9WA 4ZOHC 3OHBA 3RBEA 5CRXA 1RXVA 3MGVA 1TAMA 4KMOB 3CYMA 1XSLA 5J2IA 1ZETA 1VLBA 1EXNA 3HT3A 3LK9A 4UQGA 2W04A 2OHFA 1ZQMA 1ZQFA 7ICFA 9ICBA 3ONNA 3SD7A 4Z6CA 4F8RA 3ZD8A 3KKAC 2KEYA 4M0AA 4RT3A 2IOFA 1ZD2P 4Z6EA 2HSZA 3QNMA 4JMUA 3THVA 3R9KA 5KT4A 4O5KA 3L4PA 4GXJA 5AIAA 1RZTA 2E5SA 1K1SA 1ZD5A 1H38A 2AHOB 3QEAZ 2CRXA 5DBAA 4ED6A 5KFEA 3FYHA 4ECXA 1NK9A 2UVVA 9ICSA 2ZUCA 3AL0B 4NY8A 7ICEA 1S9FA 5EWEA 1TV9A 1C20A 5ALLA 3NTUA 3NGDA 4BXOA 5J2DA 4PGXA 3JPQA 3T3FA 2W11A 4YP3A 1SB3C 4IQVA 5AK4A 3HX0A 4USAA 4XRHA 3UQ0A 4M6WB 1YT3A 4UBCA 2HOIA 1X66A 2WTFA 2LYHA 5ALWA 2WF9A 4TURA 4C8MA 2Z7JA 3QEBZ 3LYSA 9ICEA 2P35A 1BPXA 1QLNA 2WF7A 2DQNB 5GTHU 2O6KA 3CW2C 5J2BA 2JHDA 2H3QA 3U26A 1U47A 1JALA 5AK6A 5KFWA 4F71A 3ICXA 1ZXIA 5AHXA 1LKYA 5K4LA 1PK3A 4EEYA 1CUKA 2FLNA 4K4HA 4UAWA 5KT2A 5L1IA 7ICHA 2W8KA 3RJEA 2A19A 5ALJA 3V7JA 2GWSA 2H5XA 4EEKA 2QARB 2FPLA 4QZGA 2VA3A 3RJIA 5KFVA 2PKEA 1ZQSA 4DFPA 3RR7A 5DLGA 3UXNA 5J8YA 3NRWA 2YY6A 1JN3A 1C7YA 4Q8FA 8ICQA 2F8LA 1N5XA 4RNMA 4F4WA 3C23A 4O3RA 3M9NB 1NJZA 4BDPA 4GIBA 9ICNA 2NO4A 1ZQYA 3JPRA 9ICPA 4YFKA 4F4ZA 2N1RA 4F5PA 2ZIUB 4ED3A 5AM3A 1ZOLA 2GOLA 2ESEA 1L3VA 5ALZA 1UHUA 4BWJA 1J2MA 4YG2A 2ES6A 5CR0A 4NLCA 1F0MA 1ZJNA 1RDFA 3BDPA 4ED0A 4LVSA 1SKSA 3F2BA 3I28A 1KDHA 1BPZA 2WB1F 2NRZA 3T5JA 4O3PA 2IOHA 4LJXA 5F9LA 1LVHA 4RQ8A 2C2EA 4P0PB 1T94A 4KLLA 2ISPA 2FMPA 4KMUA 4NL9C 2M0NA 4J9NA 3KOOA 2K4EA 4B9TA 3C28A 4FE3A 2FMSA 3PSFA 4K4IA 4I29A 3GQCA 8ICYA 2WFAA 2UVUA 2K89A 4QZIA 3OSNA 5ALEA 1MN8A 4F4YA 3FDSA 8ICTA 3AEVA 1KLNA 4DLEA 4P0QA 5L1LA 4JK1A 2HOQA 3C1ZA 3WK4A 4DFDA 4DFJA 1SV4A 4AYBC 4UW9A 1S76D 5KFDA 2YMMA 3RJGA 2HHSA 2JEGA 3F53A 1X42A 2K8CB 3UMGA 3PZPA 4DL5A 1S0OA 1Z4OA 4PGQA 4ECUA 4R8UA 5DBBA 3H4DA 1S0NA 3ORYA 2F2AB 4YN4A 1PK1A 9ICVA 2FI1A 9ICLA 4QWDA 4KLDA 3PW0A 9ICXA 5ALVA 3MDAA 2I5HA 4BJQA 1NK7A 4UARA 4JV2A 5ALMA 3EPGA 3IDWA 3FC4A 2ZIVA 1UA0A 4DL4A 5AKIA 2XC9A 4M9HA 1L7OA 3GIKA 4PJ0U 4Y2QA 5G5GA 2DGZA 4C0ZA 5BOMA 4IR1A 5AI5A 2Q4TA 1DRGA 3PX4A 2KKPA 4QW9A 4DO9A 5AI9A 3M1YA 2G5IB 3F5AA 1OUQA 3WKCA 1NJXA 4I28A 4C4TA 2KJ8A 4PH5A 2W9AA 3V7LA 2KN7A 4IQWA 9ICRA 1PZNA 5J0RA 4EZ6A 4HYKA 1U48A 3H0LB 3TACB 3OJUA 2HOFA 2W9CB 2XIDA 3ZDBA 2QLTA 1ZQEA 4FO6A 2EDUA 1SKWA 4IL6U 1ZQOA 3UPQA 1BGXT 3ISBA 3GV7B 4RQ2A 7ICTA 1ECWA 1X6IA 4MEYA 3TKAA 4R63A 3BJYA 1DOQA 4P2HA 5AM5A 5J2EA 1N63A 2ISOA 4ECZA 2F1IA 5AIBA 3HILA 2YQEA 2XCAA 3KTQA 4ED2A 1BNOA 1S97A 8ICVA 2KSOB 5IIMA 4KLTA 1SZHA 9ICMA 2E8NA 3LDAA 4CF3A 1ZQBA 1TK5A 4EYIB 3F2DA 1ZJMA 9ICCA 2V9WA 4LZDA 1UPHA 2P6UA 2G07A 2OWOA 3MDCA 4BUGA 4J03A 4C8OA 1S8OA 3E58A 1XS9D 4R66A 1YZ6A 1XO0A 3NASA 1Q3VA 1ZQKA 3NUQA 2ZXHA 4EBDA 2HBMA 4AYBF 5J8YC 2CN1A 4PPXA 1B43A 8ICJA 5GTIU 4NLKA 2PMZC 3B0YA 3BQTA 2EZZA 3MC1A 2GO7A 3J81j 2F8KA 8ICRA 1BPBA 1XO1A 1T7PA 1S10A 1RYRA 3H7IA 2AXTU 2KVSA 3RF9A 2VANA 4G9BA 4CF4A 3RR8A 3MR2A 5ALFA 4JWNA 5KFSA 4J9OA 5KTQA 1V97A 4P4MA 4FBTA 2K4HA 5KFQA 2WF5A 2GLEA 3TAQA 3IG5A 1SIJA 1RXWA 1RQNA 3PX6A 4QZEA 2RQ5A 3SI8A 3H8SA 4QZCA 5KFBA 1ZQUA 5KG7A 4I27A 4IR9A 2QB0A 4NV0A 2PXIA 4PHDA 8ICGA 1RPLA 1ED1A 4RQ7A 3QX7A 2KK0A 2KHQA 1TAQA 1V9PA 1GO3F 3TANA 1ZQRA 5KFZA 8ICUA 5ALDA 4YXMA 3EPIA 1NK6A 5B66U 8ICPA 4PZOA 3GFKB 3ZDCA 2B21A 3QXGA 1MA7A 5CB1A 5TISU 4QWBA 2JGAA 2A1JB 3WKBA 1N2XA 4US8A 4DCCA 4F5RA 1L3TA 1Z1BA 3GILA 5KAFU 3SV3A 3WKAA 4J9MA 5KFAA 3H8WA 4QJFB 1K1QA 3QZ8A 4KLQA 5KG5A 5J2AA 3KBBA 4EX7A 1T3NA 3KHLA 4DSKA 4AP9A 3SQIA 1LB2B 3QYPA 2ALZA 1HEKA 3JPNA 1KFTA 2BCRA 1ZQPA 1O03A 3PMLA 1N56A 4DEZA 2QKQA 4QW8A 4IQUA 3MFHA 1NKCA 4I2EA 3N97B 4NJ8A 2GH1A 4NLZA 1ZQZA 5J2KA 5HMMA 3IG8A 4EX6A 1QSSA 4YD1A 3LWLA 4NXZA 1FIQA 1FFUA 2JZBB 5J0OA 3QU7A 3PW4A 3PVXA 1S5LU 2PMZF 4LZGA 5AI4A 4ECWA 2EAOA 4CRXA 4KLSA 1WCLA 2V4QA 5E79U 2LYBA 5ALRA 4ECVA 3HPOA 3RAXA 2KVCA 4NLGA 4YR0A 4J9KA 3QU5A 4EBCA 2F44A 1M6YA 1SXDA 4ECQA 4F3OA 3A0HU 1PUZA 1JXLA 4B9VA 2A1AA 7ICSA 1XSNA 4UAVA 1K5OA 4EENA 5JTIA 1HIWA 4NWIA 4ZH4A 1T3QA 4F5NA 1RYSA 2ZTEA 4C7YA 1UCVA 4YD2A 4K4GA 7ICRA 3SZ2A 4J9RA 4YXJA 3RJJA 4M04A 3UXPA 1DGSA 1ZQTA 1QQ5A 4B9UA 1WCNA 4YMMA 5AKYA 5H2FU 4RU9A 4DL3A 1UA1A 1L7MA 7ICUA 1Z00B 5ALHA 4RUAA 2H3VA 2W3SA 2LYAA 4PGYA 2G06A 2C22A 4Y2TA 3QUTA 1QCKA 4PL1A 4B9LA 5AKKA 4Y2RA 9ICJA 2KICA 5DG7A 1TVAA 2JMGA 4R8UB 4PL2A 2ZXIA 1BNPA 2W43A 3WKDA 4XA5A 4UAZA 1URJA 2OYYA 4DL2A 4FS1A 3ZD9A 2E3TA 3TFSA 5KG6A 4Q43A 3HKZC 3JPPA 4Y2PA 3DV9A 2G08A 5KFCA 4DWIA 4DSJA 2KOBA 1TE2A 5HHHA 2VKQA 3WK5A 5DG9A 3BS7A 4NM1A 2W9BA 9ICQA 3BQ0A 7ICJA 4F2SA 4M9NA 2VJ5A 1TKDA 3NVWA 3RB0A 3D2QA 2R18A 2K4IA 3GV8B 4F93B 1VJ5A 2KFNA 8ICIA 1D8BA 3EYZA 4UB3A 4QZ8A 1L6NA 4I2BA 4J9QA 4KLGA 3B0XA 5KFXA 1ZQQA 2IA6A 3PW5A 1L8OA 3BS5B 4HAIA 4O3SA 2KD1A 3RBDA 3K75D 2DKZA 3PW7A 2BPGA 1F44A 4DF4A 3KZXA 1U45A 4M9GA 2JR5A 2LKYA 2WF6A 2KJ9A 2ZIXB 2BCVA 2LPEA 2HCFA 2BR0A 2BCSA 1PVRA 2DUYA 1WWVA 4CNQA 1S0MA 3TQ1A 2RLTA 2P6RA 4KTQA 4DSFA 3GDXA 2XCPA 2YMLA 3LVWA 5KAIU 5L1KA 2HMXA 1A77A 1FO4A 4TUPA 1NK4A 2UVWA 2IBKA 3ZDEA 3UXOA 1L8LA 3UMBA 4MFCA 3GIMA 1Z4NA 4US9A 2ZIWB 3G6YA 1N60A 2JXJA 2E8MA 4EBEA 1COKA 5J0YA 5ALSA 4I2JA 4O3MA 4ICAA 3MR5A 5KFKA 4YMNA 2E1FA 2KIVA 3V6KA 3MGHA 2IHMA 3QZ7A 1BVSA 2BQUA 3L3FX 3A0BU 5AKXA 2Y1JA 2BQRA 4NLNA 1FEZA 2NV3A 3MGIA 4CGZA 3RTVA 3K1ZA 2KG5A 5DQHA 2G09A 1X6JA 3PY8A 2EAPA 2YB4A 2A3VA 3M6KA 4DFMA 2NO5A 3HKZF 5F9NA 3RRHA 5KFOA 1ZD4A 5KFUA 4OO1J 5HMLA 4F4XA 2YX8A 3B9JA 2J6TA 4ELUA 3LWMA 3Q8KA 3E2EA 4PHPA 2ZJ5A 5AM4A 1ZRMA 2CXYA 2YB1A 5KT5A 5L1JA 3MFIA 3TI0A 4QZDA 5EE9A 2AGOA 2W3RA 3K4GA 1Q46A 4DSIA 1X9SA 4QZAA 3SMVA 4JV1A 4M6WA 4DOCA 4CE6A 4MHVA 3VC8A 5JRTA 1L5UA 5KT3A 4FBUA 1IG6A 4M9LA 2AGQA 3T5HA 5J0SA 3TARA 2KIWA 2DKXA 3FAHA 1TAUA 5HR7A 4U7CA 1DK3A 5EWFA 2W8LA 3SYZA 1KBUA 9ICWA 2W55A 1SL1A 2YTUA 1D9FA 1KW4A 4DS4A 3H8JA 4QWEA 1TK8A 2F77X 2HW3A 9ICGA 5DGBA 3WU2U 3H0RB 5J0UA 5AKLA 1NK8A 2JV3A 2QARA 2BCQA 4YR3A 2IHNA 2AQ0A 3JPSA 5T14A 3IV6A 3IHQB 3T79A 5D46A 3M6ZA 2PFQA 2NRWA 3V7KA 5KFYA 5DKWA 2FDRA 3VCBA 1J2NA 4GXKA 2KZMA 2KMDA 3AQEA 1SWWA 4RPYA 5KFHA 8ICSA 5AKZA 3RJHA 3H8MA 5F3XB 8ICLA 3BZKA 1ZQCA 4WJ3B 2BPFA 1QSLA 4F2RA 2D6FC 4I2HA 1SV0A 2MAXA 2ZIUA 2PFNA 3G6VA 2NRTA 1RM6C 4QNLA 1AROP 1MQ2A 3DDHA 3QUQA 3QU2A 4KN4A 2LBOA 2EAMA 4BGDA 2R8GA 2DWQA 4R64A 2MSNA 1N5WA 4UB6U 5CA7A 4F5OA 1T4GA 2ZJAA 2MUTB 3RH4A 2I1QA 4DSEA 4RQ6A 1S0VA 1ZQNA 4DSLA 4QIWC 4NLBA 2P66A 5A0LA 4GXIA 8ICCA 4OJPA 5EOZA 2RDJA 5IIOA 4C4RA 8ICAA 1OXJA 5TZVA 2PFPA 4ECRA 5DDYA 4RNOA 2FLLA 2HHXA 9ICIA 4DOAA 5KFRA 1BPDA 4GLXA 4ELVA 2Y9TA 2VA2A 4B6JA 5JUMA 4IRCA 3T5KA 1NZPA 2HBLA 3PSPA 4O3NA 2XY5A 4TQSA 4X5VA 3TADA 1AQ6A 2R8IA 2WAQC 3PNCA 2YMPA 3MABA 4FFDA 1B22A 5KL8B 3OHAA 1JI7A 4CCHA 1TK0A 5KT6A 4BXOB 4Q45A 1ZQDA 1HUZA 4F92B 2H3FA 2HDOA 4FS2A 4PHAA 7ICMA 1SXEA 4YVZA 7ICQA 3RH6A 2VJ4A 3ZDAA 2QB1A 1A76A 4UBBA 4PZNA 8ICZA 4JUZA 2KZ3A 3RRGA 5AM1A 5AI0A 5B5EU 2HBJA 2W7OA 5ALOA 2JH7A 1MC8A 7ICIA 4FZMA 1MSWD 1SL2A 3GU3A 2PFOA 4FZNA 5ALIA 2LMRA 1Z19A 3KHHA 1X9XA 5J0WA 4GFJA 2D3DA 3KD3A 3GIJA 4RQMA 2ZTDA 3WKEA 5CHGA 3WK7A 3V6JA 5KFFA 3BQ7A 4TUSA 5AKJA 1QSYA 1LKYB 5KFNA 5J2CA 1IIPA 4DQSA 4Y2UA 4O0IA 3IM1A 4KLMA 1CEZA 3C1YA 2HHVA 5AKHA 1NJYA 3C2MA 4CDGA 4IRKA 4CF5A 1WUDA 5KFMA 5HR6A 4Z6FA 4RQNA 3RAQA 2W9CA 4YR2A 3M9OB 5C5JA 9ICTA 2EANA 3OTQA 2HVIA 3Q8MA 4XQ8A 2LM1A 1D8YA 2HI0A 2BZFA 5ALQA 5DQIA 2F1HA 5BOLA 5DLFA 2VA8A 1XSPA 2LI6A 4QZFA 4Y2XA 3ETLA 4QIWF 1MQ3A 2KSOA 2OXOA 5DQGA 3BZCA 3HJEA 1X40A 2FLPA 1KL9A 3AN1A 1DXSA 4IS7A 3Q8SB 8ICMA 1DK2A 2Y9UA 2PI4A 1LV5A 3GV5B 2XO7A 2KTQA 5ALXA 4U6PA 2UVRA 1Y88A 4MFAA 3LVVA 2G0AA 2XVTA 5L1MA 5J0PA 4G3IA 2WHEA 4ED8A 5IINA 1SL0A 5DB7A 3HWTA 2ASLA 4EELA 1NKEA 2RHFA 2ZTCA 3N28A 2W03A 2ATLA 4RQ1A 3OJSA 4Y2SA 1HJPA 3PR5B 5KG2A 1PVPA 2WAQF 3ZDDA 3QE9Y 5AM2A 7ICVA 2IMWP 4ELTA 1JRPA 2PI5A 5EE3A 1NOMA 2Y0SC 1RG6A 3EUB2 1SV0C 2K4PA 3NRZA 4Y2JA 1JX4A 5DB9A 4KX3A 3RJKA 3JPOA 4KITB 2IOFK 4OJLA 3AUOA 2HHTA 5KG1A 8ICBA 4JV0A 3TAPA 4DF8A 4B9NA 4P0QB 4UATA 2HHUA 1BPYA 1BPEA 4C8LA 4F4KA 1ZQXA 4F5QA 2WB1C 3C2LA 1NI3A 4JB3A 3UM9A 4OJOA 5ALPA 4M47A 2J6SA 4MEXA 2R8HA 1RQLA 5IIKA 3WK8A 1U49A 3QUCA 5KFTA 5J29A 2AGPA 2ASJA 3KFUF 1PK1B 2F76X 2FE9A 2NRVA 4FZLA 2XY7A 3K1RB 3IRUA 4M9JA 4O9MA 2ASDA 8ICOA 4DS5A 2W9MA 2ZIVB 1UT5A 2B0CA 9ICOA 4TQRA 3S6JA 1L7NA 4DQRA 2RDIA 3AQFA 5DG8A 5D49A 8ICXA 3C5GA 4P4OA 4A8EA 3WK6A 4BX9C 4IRDA 2A1JA 4C80A 2ODGA 3TADC 4R65A 1HUOA 1S77D 3I1YA 1L3UA 2K60A 2FPMA 4YQWA 3OGUA 1DGJA 1ZQGA 4F50A 4KX5A 1SGGA 1SKRA 4RT2A 4OJ6A 2F1JA 7ICPA 2HVHA 3WK9A 5KFIA 4ECSA 1B0XA 3V72A 4UASA 3UMCA 1JMSA 2OM6A 4F72A 4J9PA 2BGWA 7ICLA 2KNJA 5CP2A
chains in the Genus database with same CATH topology
4QZDA 4JWNA 9ICUA 5KFSA 1ZQAA 2C28A 4J9OA 4QWCA 2AGOA 3C21A 5KTQA 3K4GA 4DSIA 1X9SA 4RQ0A 4P4MA 4QZAA 1NKBA 2JEJA 4JV1A 4M6WA 1JXEA 4FBTA 5KFQA 5BPCA 4DOCA 7ICNA 2BHNA 4UB4A 3TAQA 2BKEA 4DFKA 1L5UA 4B9SA 5KT3A 1KFSA 2MUTA 3EW9A 2BPCA 4FBUA 1RXWA 1IM4A 4M9LA 2AGQA 3T5HA 2BQ3A 3PX6A 4QZEA 1IXRA 1NK0A 5J0SA 3RB6A 3TARA 1X9WA 3OHBA 3RBEA 3SI8A 5KG0A 4ECTA 4MF2A 1RXVA 5KFBA 3H8SA 4QZCA 1KSPA 1TAUA 1ZQUA 2JZBA 5KG7A 5DB8A 4I27A 4IR9A 1XSLA 5J2IA 1ZETA 5EWFA 2W8LA 3M8SA 1EXNA 1XWLA 2PXIA 3SYZA 4PHDA 3HT3A 3LK9A 8ICGA 4UQGA 1RPLA 9ICWA 4RQ7A 1X2IA 1SL1A 1ZQMA 1ZQFA 7ICFA 9ICBA 1TAQA 1D9FA 3PO5A 4Z6CA 1V9PA 4DS4A 3TANA 1L3SA 1ZQRA 2DPIA 3H8JA 4QWEA 1TK8A 4F8RA 1NJWA 5KFZA 2HW3A 9ICGA 3ZD8A 8ICUA 5DGBA 5J0UA 4M0AA 4YXMA 1NK8A 3EPIA 4RT3A 1NK6A 8ICPA 4IQTA 4F91B 2BCQA 8ICNA 3GFKB 4Z6EA 4YR3A 2AQ0A 3JPSA 2IHNA 3ZDCA 2B21A 2XGPA 9ICFA 3IHQB 3THVA 5CB1A 5D46A 4YCXA 2PFQA 2NRWA 4QWBA 5KT4A 3V7KA 4O5KA 5KFYA 5DKWA 4GXKA 3T5LA 2KZMA 4GXJA 2A1JB 1RZTA 1TFRA 1K1SA 4F5RA 1ZYQA 1H38A 4RPYA 5KFHA 3BQ2A 3QEAZ 1L3TA 5DBAA 4ED6A 5KFEA 2R8KA 8ICSA 3GILA 3SV3A 3FYHA 4J9MA 4ECXA 3G6XA 5KFAA 5J2HA 5J2JA 3RB3A 1NK9A 3RJHA 3H8WA 5KFLA 1ZQCA 2ZUCA 2BPFA 3RH5A 1D8LA 2UVVA 4NY8A 5EWGA 7ICEA 4EYHB 1K1QA 3QZ8A 1QSLA 1S9FA 4F2RA 4RZRA 4KLQA 5EWEA 3MR3A 2MAXA 1TV9A 2PFNA 4I2HA 5KG5A 1D9DA 3NTUA 5J2AA 3G6VA 1T3NA 2NRTA 3KHLA 4DSKA 3NGDA 4BXOA 5J2DA 4PGXA 3JPQA 3T3FA 4YP3A 1AROP 1MQ2A 4M04A 1LB2B 4IQVA 3N4MB 2ALZA 4KN4A 3JPNA 3BQ1A 1KFTA 2BCRA 3PW2A 4BGDA 1ZQPA 2R8GA 3HX0A 2Y1IA 4XRHA 3PMLA 3UQ0A 4M6WB 1N56A 4UBCA 3JPTA 4DEZA 4QW8A 4R64A 2WTFA 4IQUA 5DDMA 1Z3EB 2LYHA 3MFHA 3EWAA 4GC6A 4ECYA 3N97B 4TURA 1NKCA 4I2EA 4I2GA 4C8MA 5CA7A 4F5OA 1T4GA 2ZJAA 1Z00A 3QEBZ 2R8JA 2MUTB 4RPXA 9ICEA 2FMQA 1BPXA 8ICKA 1KEJA 3RH4A 4NLZA 2C2RA 1QLNA 1ZQZA 2I1QA 5J2KA 4DSEA 4RQ6A 5HMMA 1XC9A 5J2BA 1S0VA 1QSSA 1ZQNA 4DSLA 4YD1A 3LWLA 4NXZA 2P66A 8ICCA 4GXIA 2JZBB 4KLUA 3RB4A 5J0OA 2JEFA 1U47A 7ICOA 4QZ9A 5EOZA 3PVXA 3PW4A 4LZGA 5KFWA 5IIOA 2RDJA 5L9XA 4PHEA 8ICAA 4ECWA 5TZVA 4NM2A 2PFPA 4EEYA 4ECRA 1WCLA 1KFDA 1CUKA 5DDYA 4RNOA 3C5FA 2FLLA 2FLNA 4C8KA 4DOAA 4K4HA 4UAWA 5KFRA 9ICIA 4RNNA 1BPDA 5KT2A 2V4QA 5L1IA 7ICHA 1U9LA 2XY6A 3M8RA 4P4PA 2W8KA 4J9SA 4GLXA 4ECVA 2VA2A 4ELVA 9ICSA 3HPOA 3RAXA 3RJEA 5JUMA 4KLIA 8ICWA 4IRCA 3T5KA 3PMNA 4NLGA 2HHWA 4YR0A 4EZ9A 4J9KA 4I2IA 3V7JA 2GWSA 2H5XA 4EBCA 2FPLA 4Z6DA 4QZGA 5KT7A 2VA3A 4KLJA 3RJIA 4O3NA 5KFVA 2XY5A 4UB5A 4TQSA 9ICKA 1ZQSA 4DFPA 4ECQA 4X5VA 3RR7A 4F3OA 5DLGA 3UXNA 1JXLA 1JN3A 1C7YA 4Q8FA 8ICQA 4B9VA 2HHQA 2BCUA 2R8IA 4RNMA 4F4WA 5DGAA 1XSNA 3C23A 4O3RA 4KN7A 3V6HA 3M9NB 4UB1A 1NJZA 2KFZA 8ICLA 3PNCA 4BDPA 9ICNA 2AJQA 1ZQYA 3JPRA 3Q8PB 3MABA 4I2AA 9ICPA 4YFKA 1B22A 4F4ZA 4ED1A 4DQIA 4F5PA 3OHAA 2JEIA 1KTQA 4GC7A 4DQPA 3PR4A 5KG4A 4ED3A 4ZH4A 4E0DA 1SZPA 4F5NA 4ED7A 4CCHA 3MR6A 1L3VA 1TK0A 5KT6A 4BXOB 4Q45A 2ZTEA 2ZUDA 1RYSA 1ZQDA 4BWJA 4YD2A 3C2KA 1HUZA 2HHXA 4F92B 4K4GA 4FS2A 4YG2A 7ICRA 5CR0A 4PHAA 4J9RA 3SZ2A 4YXJA 7ICMA 2DFLA 4YVZA 3RJJA 5J2GA 5DBCA 3RH6A 3UXPA 1DGSA 1ZJNA 1ZQTA 1A76A 4UBBA 3ZDAA 4B9UA 8ICZA 1ZQHA 3BDPA 1WCNA 4YMMA 4JUZA 8ICHA 4ED0A 4LVSA 2KZ3A 1SKSA 4O3OA 4RQ5A 4RU9A 1KDHA 3RRGA 3RJFA 1BPZA 4DL3A 5J0TA 1UA1A 2NRZA 3T5JA 4O3PA 1Z00B 7ICUA 4RUAA 1MC8A 7ICIA 2C22A 4PGYA 5F9LA 4DOBA 1ZQWA 1COOA 1MSWD 1SL2A 3KHRA 2PFOA 3Q8LA 4RQ8A 5HNKA 2Q0ZX 3KHHA 5J0WA 2C2EA 4O5CA 1JIHA 4KLLA 3GIJA 2ZTDA 4BWMA 2ISPA 2FMPA 4B9LA 5CHGA 4JWMA 4KMUA 7ICKA 3UQ2A 4J9NA 1XU4A 5KFFA 3V6JA 8ICYA 4TUSA 9ICJA 5DG7A 1TVAA 4B9TA 1QSYA 2M9NA 5KFJA 5KFNA 4R8UB 2FMSA 5KG3A 5J2CA 4I2CA 4DQSA 4K4IA 4O0IA 5D4BA 4I29A 3IM1A 3GQCA 4KLMA 3C1YA 4XA5A 9ICAA 2HHVA 4O3QA 4UAZA 2UVUA 1X9MA 1NK5A 2ZJ8A 4DL2A 1NJYA 4FS1A 2KZZA 3C2MA 3ZD9A 4QZIA 3OSNA 4IRKA 3AU2A 5KFMA 2DPJA 1UT8A 4F4YA 3TFSA 5KG6A 4Q43A 3FDSA 4Z6FA 3JPPA 8ICTA 1KLNA 4DLEA 4QZHA 3RAQA 5L1LA 4JK1A 2W9CA 4YR2A 3M9OB 5C5JA 3C1ZA 4DFJA 9ICTA 2HVIA 2NRXA 5CWRA 3Q8MA 4XQ8A 1D8YA 5IIJA 5KFCA 4DWIA 4DSJA 1S76D 5KFDA 4I2FA 5DQIA 3RJGA 2HHSA 4QWAA 2F1HA 2JEGA 5HHHA 5DG9A 5BOLA 3GIIA 5DLFA 2VA8A 3ISDA 3PO4A 1XSPA 4NM1A 4QZFA 2W9BA 4DL5A 3PX0A 1S0OA 4PGQA 4ECUA 9ICQA 3BQ0A 4R8UA 5DBBA 3H4DA 1S0NA 3ORYA 4YN4A 3ETLA 7ICJA 1ZQLA 9ICVA 4F2SA 9ICLA 4M9NA 5IILA 1MQ3A 1TKDA 3TFRA 4QWDA 3PV8A 4KLDA 2V4RA 3RB0A 4QZBA 4KLHA 2FPKA 4O5EA 1U4BA 2J6UA 3PW0A 3GV8B 4KLSA 9ICXA 5DQGA 4F93B 2KFNA 8ICIA 3MDAA 4XUSA 2FLPA 1NK7A 3EYZA 4JV2A 4UB3A 3EPGA 4QZ8A 3Q8SB 2AU0A 8ICMA 1UA0A 4DL4A 4I2BA 4J9QA 4KLGA 2XC9A 5KFPA 2PI4A 4M9HA 1LV5A 3GV5B 3B0XA 2XO7A 5KFXA 3AU6A 1ZQQA 3GIKA 2KTQA 2UVRA 1Y88A 4MFAA 2IA6A 4G3IA 3PW5A 5J0PA 4ED8A 5IINA 1SL0A 4O3SA 4RUCA 5BOMA 3RBDA 3MBYA 3K75D 4MFFA 4IR1A 2BPGA 3PW7A 5DB7A 3HWTA 2ASLA 1NKEA 4DF4A 2ZTCA 4C8NA 1U45A 4M9GA 2ATLA 1ZQJA 7ICGA 4RQ1A 3OJSA 3PX4A 4DQQA 1HJPA 4QW9A 2BCVA 3PR5B 4DO9A 5KG2A 2BR0A 2BCSA 3ZDDA 3QE9Y 7ICVA 2IMWP 7ICQA 2BDPA 4ELTA 3ISCA 1S0MA 2PI5A 3TQ1A 1NOMA 1NJXA 4I28A 4PH5A 2P6RA 4KTQA 2W9AA 3V7LA 3HP6A 3EZ5A 1JX4A 4DSFA 2KN7A 3GDXA 4IQWA 5DB9A 3RJKA 3JPOA 9ICRA 4DL6A 1PZNA 2XCPA 4KITB 5J0RA 4B9MA 9ICHA 3AUOA 5CJ7A 2AQ4A 5L1KA 5KG1A 4HYKA 1A77A 4EZ6A 1U48A 8ICBA 2HHTA 4JV0A 3TAPA 4DF8A 4B9NA 2ZUBA 4TUPA 1NK4A 4KLOA 3OJUA 2UVWA 2IBKA 3ZDEA 2HHUA 3UXOA 1ZQIA 1BPYA 2W9CB 3ZDBA 1BPEA 4MFCA 3GIMA 2XGQA 4C8LA 1ZQEA 4F4KA 4FO6A 1ZQXA 4TUQA 4F5QA 5HHIA 4DL7A 1SKWA 3G6YA 1ZQOA 3C2LA 3UPQA 1BGXT 2I9GA 3ISBA 3GV7B 4EBEA 2C2DA 4RQ2A 7ICTA 5J0YA 1ZQVA 3Q8QB 4I2JA 4MEYA 4R63A 1T8EA 4M47A 2J6SA 4MEXA 3BJYA 2R8HA 1DOQA 3OSPA 5IIKA 3MR5A 4P2HA 4RQ3A 4YMNA 5KFKA 1U49A 4UB2A 5J2EA 3HW8A 5KFTA 5J29A 2W9BB 4ECZA 3V6KA 2ISOA 2AGPA 2ASJA 3MGHA 2IHMA 4M2YA 2F1IA 4MF8A 3QZ7A 5J0XA 1BVSA 2BQUA 2XCAA 4Q44A 1KRPA 2NRVA 3KTQA 8ICEA 4ED2A 2Y1JA 3KHGA 2BQRA 1S97A 8ICVA 2XY7A 4NLNA 5IIMA 4J9LA 3Q8RB 3MGIA 4KLTA 4M9JA 3RTVA 9ICMA 4O9MA 3LDAA 4Q8EA 2ASDA 5DQHA 8ICFA 7ICSA 1ZQBA 3PY8A 1TK5A 4EYIB 8ICOA 1ZJMA 4DS5A 9ICCA 2V9WA 2W9MA 4LZDA 2P6UA 3H4BA 1QTMA 2OWOA 3MDCA 4C8OA 5DB6A 4I2DA 1XS9D 4DFMA 4R66A 1UT5A 5F9NA 3RRHA 4KLFA 4TQRA 1ZQKA 9ICOA 4DQRA 5KFOA 3RR8A 2RDIA 4EBDA 5DG8A 4YMOA 5D49A 8ICXA 4P4OA 3C5GA 5KFUA 4IRDA 4PPXA 2A1JA 5HMLA 3M9MB 4F4XA 4R65A 1B43A 1N48A 1HUOA 8ICJA 1S77D 5J0QA 1L3UA 2J6TA 2FPMA 5IIIA 4RPZA 4ELUA 4NLKA 4YQWA 3B0YA 3OGUA 1ZQGA 3BQTA 3LWMA 4F50A 1SKRA 1CEZA 4RT2A 3Q8KA 4KLEA 8ICRA 3E2EA 1BPBA 2F1JA 1XO1A 4PHPA 1T7PA 1S10A 7ICPA 1RYRA 2HVHA 3H7IA 5KFIA 4ECSA 2ZJ5A 4RQ4A 3V72A 4UAYA 2VANA 4DLGA 1JMSA 4J9PA 2BGWA 7ICLA 5KT5A 3H40A 5HP4A 5L1JA 3SV4A 3MFIA 3TI0A 5J2FA 3MR2A 5KFGA 5CP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZD A;  4JWN A;  9ICU A;  5KFS A;  1ZQA A;  2C28 A;  4J9O A;  4QWC A;  2AGO A;  3C21 A;  5KTQ A;  3K4G A;  4DSI A;  1X9S A;  4RQ0 A;  4P4M A;  4QZA A;  1NKB A;  2JEJ A;  4JV1 A;  4M6W A;  1JXE A;  4FBT A;  5KFQ A;  5BPC A;  4DOC A;  7ICN A;  2BHN A;  4UB4 A;  3TAQ A;  2BKE A;  4DFK A;  1L5U A;  4B9S A;  5KT3 A;  1KFS A;  2MUT A;  3EW9 A;  2BPC A;  4FBU A;  1RXW A;  1IM4 A;  4M9L A;  2AGQ A;  3T5H A;  2BQ3 A;  3PX6 A;  4QZE A;  1IXR A;  1NK0 A;  5J0S A;  3RB6 A;  3TAR A;  1X9W A;  3OHB A;  3RBE A;  3SI8 A;  5KG0 A;  4ECT A;  4MF2 A;  1RXV A;  5KFB A;  3H8S A;  4QZC A;  1KSP A;  1TAU A;  1ZQU A;  2JZB A;  5KG7 A;  5DB8 A;  4I27 A;  4IR9 A;  1XSL A;  5J2I A;  1ZET A;  5EWF A;  2W8L A;  3M8S A;  1EXN A;  1XWL A;  2PXI A;  3SYZ A;  4PHD A;  3HT3 A;  3LK9 A;  8ICG A;  4UQG A;  1RPL A;  9ICW A;  4RQ7 A;  1X2I A;  1SL1 A;  1ZQM A;  1ZQF A;  7ICF A;  9ICB A;  1TAQ A;  1D9F A;  3PO5 A;  4Z6C A;  1V9P A;  4DS4 A;  3TAN A;  1L3S A;  1ZQR A;  2DPI A;  3H8J A;  4QWE A;  1TK8 A;  4F8R A;  1NJW A;  5KFZ A;  2HW3 A;  9ICG A;  3ZD8 A;  8ICU A;  5DGB A;  5J0U A;  4M0A A;  4YXM A;  1NK8 A;  3EPI A;  4RT3 A;  1NK6 A;  8ICP A;  4IQT A;  4F91 B;  2BCQ A;  8ICN A;  3GFK B;  4Z6E A;  4YR3 A;  2AQ0 A;  3JPS A;  2IHN A;  3ZDC A;  2B21 A;  2XGP A;  9ICF A;  3IHQ B;  3THV A;  5CB1 A;  5D46 A;  4YCX A;  2PFQ A;  2NRW A;  4QWB A;  5KT4 A;  3V7K A;  4O5K A;  5KFY A;  5DKW A;  4GXK A;  3T5L A;  2KZM A;  4GXJ A;  2A1J B;  1RZT A;  1TFR A;  1K1S A;  4F5R A;  1ZYQ A;  1H38 A;  4RPY A;  5KFH A;  3BQ2 A;  3QEA Z;  1L3T A;  5DBA A;  4ED6 A;  5KFE A;  2R8K A;  8ICS A;  3GIL A;  3SV3 A;  3FYH A;  4J9M A;  4ECX A;  3G6X A;  5KFA A;  5J2H A;  5J2J A;  3RB3 A;  1NK9 A;  3RJH A;  3H8W A;  5KFL A;  1ZQC A;  2ZUC A;  2BPF A;  3RH5 A;  1D8L A;  2UVV A;  4NY8 A;  5EWG A;  7ICE A;  4EYH B;  1K1Q A;  3QZ8 A;  1QSL A;  1S9F A;  4F2R A;  4RZR A;  4KLQ A;  5EWE A;  3MR3 A;  2MAX A;  1TV9 A;  2PFN A;  4I2H A;  5KG5 A;  1D9D A;  3NTU A;  5J2A A;  3G6V A;  1T3N A;  2NRT A;  3KHL A;  4DSK A;  3NGD A;  4BXO A;  5J2D A;  4PGX A;  3JPQ A;  3T3F A;  4YP3 A;  1ARO P;  1MQ2 A;  4M04 A;  1LB2 B;  4IQV A;  3N4M B;  2ALZ A;  4KN4 A;  3JPN A;  3BQ1 A;  1KFT A;  2BCR A;  3PW2 A;  4BGD A;  1ZQP A;  2R8G A;  3HX0 A;  2Y1I A;  4XRH A;  3PML A;  3UQ0 A;  4M6W B;  1N56 A;  4UBC A;  3JPT A;  4DEZ A;  4QW8 A;  4R64 A;  2WTF A;  4IQU A;  5DDM A;  1Z3E B;  2LYH A;  3MFH A;  3EWA A;  4GC6 A;  4ECY A;  3N97 B;  4TUR A;  1NKC A;  4I2E A;  4I2G A;  4C8M A;  5CA7 A;  4F5O A;  1T4G A;  2ZJA A;  1Z00 A;  3QEB Z;  2R8J A;  2MUT B;  4RPX A;  9ICE A;  2FMQ A;  1BPX A;  8ICK A;  1KEJ A;  3RH4 A;  4NLZ A;  2C2R A;  1QLN A;  1ZQZ A;  2I1Q A;  5J2K A;  4DSE A;  4RQ6 A;  5HMM A;  1XC9 A;  5J2B A;  1S0V A;  1QSS A;  1ZQN A;  4DSL A;  4YD1 A;  3LWL A;  4NXZ A;  2P66 A;  8ICC A;  4GXI A;  2JZB B;  4KLU A;  3RB4 A;  5J0O A;  2JEF A;  1U47 A;  7ICO A;  4QZ9 A;  5EOZ A;  3PVX A;  3PW4 A;  4LZG A;  5KFW A;  5IIO A;  2RDJ A;  5L9X A;  4PHE A;  8ICA A;  4ECW A;  5TZV A;  4NM2 A;  2PFP A;  4EEY A;  4ECR A;  1WCL A;  1KFD A;  1CUK A;  5DDY A;  4RNO A;  3C5F A;  2FLL A;  2FLN A;  4C8K A;  4DOA A;  4K4H A;  4UAW A;  5KFR A;  9ICI A;  4RNN A;  1BPD A;  5KT2 A;  2V4Q A;  5L1I A;  7ICH A;  1U9L A;  2XY6 A;  3M8R A;  4P4P A;  2W8K A;  4J9S A;  4GLX A;  4ECV A;  2VA2 A;  4ELV A;  9ICS A;  3HPO A;  3RAX A;  3RJE A;  5JUM A;  4KLI A;  8ICW A;  4IRC A;  3T5K A;  3PMN A;  4NLG A;  2HHW A;  4YR0 A;  4EZ9 A;  4J9K A;  4I2I A;  3V7J A;  2GWS A;  2H5X A;  4EBC A;  2FPL A;  4Z6D A;  4QZG A;  5KT7 A;  2VA3 A;  4KLJ A;  3RJI A;  4O3N A;  5KFV A;  2XY5 A;  4UB5 A;  4TQS A;  9ICK A;  1ZQS A;  4DFP A;  4ECQ A;  4X5V A;  3RR7 A;  4F3O A;  5DLG A;  3UXN A;  1JXL A;  1JN3 A;  1C7Y A;  4Q8F A;  8ICQ A;  4B9V A;  2HHQ A;  2BCU A;  2R8I A;  4RNM A;  4F4W A;  5DGA A;  1XSN A;  3C23 A;  4O3R A;  4KN7 A;  3V6H A;  3M9N B;  4UB1 A;  1NJZ A;  2KFZ A;  8ICL A;  3PNC A;  4BDP A;  9ICN A;  2AJQ A;  1ZQY A;  3JPR A;  3Q8P B;  3MAB A;  4I2A A;  9ICP A;  4YFK A;  1B22 A;  4F4Z A;  4ED1 A;  4DQI A;  4F5P A;  3OHA A;  2JEI A;  1KTQ A;  4GC7 A;  4DQP A;  3PR4 A;  5KG4 A;  4ED3 A;  4ZH4 A;  4E0D A;  1SZP A;  4F5N A;  4ED7 A;  4CCH A;  3MR6 A;  1L3V A;  1TK0 A;  5KT6 A;  4BXO B;  4Q45 A;  2ZTE A;  2ZUD A;  1RYS A;  1ZQD A;  4BWJ A;  4YD2 A;  3C2K A;  1HUZ A;  2HHX A;  4F92 B;  4K4G A;  4FS2 A;  4YG2 A;  7ICR A;  5CR0 A;  4PHA A;  4J9R A;  3SZ2 A;  4YXJ A;  7ICM A;  2DFL A;  4YVZ A;  3RJJ A;  5J2G A;  5DBC A;  3RH6 A;  3UXP A;  1DGS A;  1ZJN A;  1ZQT A;  1A76 A;  4UBB A;  3ZDA A;  4B9U A;  8ICZ A;  1ZQH A;  3BDP A;  1WCN A;  4YMM A;  4JUZ A;  8ICH A;  4ED0 A;  4LVS A;  2KZ3 A;  1SKS A;  4O3O A;  4RQ5 A;  4RU9 A;  1KDH A;  3RRG A;  3RJF A;  1BPZ A;  4DL3 A;  5J0T A;  1UA1 A;  2NRZ A;  3T5J A;  4O3P A;  1Z00 B;  7ICU A;  4RUA A;  1MC8 A;  7ICI A;  2C22 A;  4PGY A;  5F9L A;  4DOB A;  1ZQW A;  1COO A;  1MSW D;  1SL2 A;  3KHR A;  2PFO A;  3Q8L A;  4RQ8 A;  5HNK A;  2Q0Z X;  3KHH A;  5J0W A;  2C2E A;  4O5C A;  1JIH A;  4KLL A;  3GIJ A;  2ZTD A;  4BWM A;  2ISP A;  2FMP A;  4B9L A;  5CHG A;  4JWM A;  4KMU A;  7ICK A;  3UQ2 A;  4J9N A;  1XU4 A;  5KFF A;  3V6J A;  8ICY A;  4TUS A;  9ICJ A;  5DG7 A;  1TVA A;  4B9T A;  1QSY A;  2M9N A;  5KFJ A;  5KFN A;  4R8U B;  2FMS A;  5KG3 A;  5J2C A;  4I2C A;  4DQS A;  4K4I A;  4O0I A;  5D4B A;  4I29 A;  3IM1 A;  3GQC A;  4KLM A;  3C1Y A;  4XA5 A;  9ICA A;  2HHV A;  4O3Q A;  4UAZ A;  2UVU A;  1X9M A;  1NK5 A;  2ZJ8 A;  4DL2 A;  1NJY A;  4FS1 A;  2KZZ A;  3C2M A;  3ZD9 A;  4QZI A;  3OSN A;  4IRK A;  3AU2 A;  5KFM A;  2DPJ A;  1UT8 A;  4F4Y A;  3TFS A;  5KG6 A;  4Q43 A;  3FDS A;  4Z6F A;  3JPP A;  8ICT A;  1KLN A;  4DLE A;  4QZH A;  3RAQ A;  5L1L A;  4JK1 A;  2W9C A;  4YR2 A;  3M9O B;  5C5J A;  3C1Z A;  4DFJ A;  9ICT A;  2HVI A;  2NRX A;  5CWR A;  3Q8M A;  4XQ8 A;  1D8Y A;  5IIJ A;  5KFC A;  4DWI A;  4DSJ A;  1S76 D;  5KFD A;  4I2F A;  5DQI A;  3RJG A;  2HHS A;  4QWA A;  2F1H A;  2JEG A;  5HHH A;  5DG9 A;  5BOL A;  3GII A;  5DLF A;  2VA8 A;  3ISD A;  3PO4 A;  1XSP A;  4NM1 A;  4QZF A;  2W9B A;  4DL5 A;  3PX0 A;  1S0O A;  4PGQ A;  4ECU A;  9ICQ A;  3BQ0 A;  4R8U A;  5DBB A;  3H4D A;  1S0N A;  3ORY A;  4YN4 A;  3ETL A;  7ICJ A;  1ZQL A;  9ICV A;  4F2S A;  9ICL A;  4M9N A;  5IIL A;  1MQ3 A;  1TKD A;  3TFR A;  4QWD A;  3PV8 A;  4KLD A;  2V4R A;  3RB0 A;  4QZB A;  4KLH A;  2FPK A;  4O5E A;  1U4B A;  2J6U A;  3PW0 A;  3GV8 B;  4KLS A;  9ICX A;  5DQG A;  4F93 B;  2KFN A;  8ICI A;  3MDA A;  4XUS A;  2FLP A;  1NK7 A;  3EYZ A;  4JV2 A;  4UB3 A;  3EPG A;  4QZ8 A;  3Q8S B;  2AU0 A;  8ICM A;  1UA0 A;  4DL4 A;  4I2B A;  4J9Q A;  4KLG A;  2XC9 A;  5KFP A;  2PI4 A;  4M9H A;  1LV5 A;  3GV5 B;  3B0X A;  2XO7 A;  5KFX A;  3AU6 A;  1ZQQ A;  3GIK A;  2KTQ A;  2UVR A;  1Y88 A;  4MFA A;  2IA6 A;  4G3I A;  3PW5 A;  5J0P A;  4ED8 A;  5IIN A;  1SL0 A;  4O3S A;  4RUC A;  5BOM A;  3RBD A;  3MBY A;  3K75 D;  4MFF A;  4IR1 A;  2BPG A;  3PW7 A;  5DB7 A;  3HWT A;  2ASL A;  1NKE A;  4DF4 A;  2ZTC A;  4C8N A;  1U45 A;  4M9G A;  2ATL A;  1ZQJ A;  7ICG A;  4RQ1 A;  3OJS A;  3PX4 A;  4DQQ A;  1HJP A;  4QW9 A;  2BCV A;  3PR5 B;  4DO9 A;  5KG2 A;  2BR0 A;  2BCS A;  3ZDD A;  3QE9 Y;  7ICV A;  2IMW P;  7ICQ A;  2BDP A;  4ELT A;  3ISC A;  1S0M A;  2PI5 A;  3TQ1 A;  1NOM A;  1NJX A;  4I28 A;  4PH5 A;  2P6R A;  4KTQ A;  2W9A A;  3V7L A;  3HP6 A;  3EZ5 A;  1JX4 A;  4DSF A;  2KN7 A;  3GDX A;  4IQW A;  5DB9 A;  3RJK A;  3JPO A;  9ICR A;  4DL6 A;  1PZN A;  2XCP A;  4KIT B;  5J0R A;  4B9M A;  9ICH A;  3AUO A;  5CJ7 A;  2AQ4 A;  5L1K A;  5KG1 A;  4HYK A;  1A77 A;  4EZ6 A;  1U48 A;  8ICB A;  2HHT A;  4JV0 A;  3TAP A;  4DF8 A;  4B9N A;  2ZUB A;  4TUP A;  1NK4 A;  4KLO A;  3OJU A;  2UVW A;  2IBK A;  3ZDE A;  2HHU A;  3UXO A;  1ZQI A;  1BPY A;  2W9C B;  3ZDB A;  1BPE A;  4MFC A;  3GIM A;  2XGQ A;  4C8L A;  1ZQE A;  4F4K A;  4FO6 A;  1ZQX A;  4TUQ A;  4F5Q A;  5HHI A;  4DL7 A;  1SKW A;  3G6Y A;  1ZQO A;  3C2L A;  3UPQ A;  1BGX T;  2I9G A;  3ISB A;  3GV7 B;  4EBE A;  2C2D A;  4RQ2 A;  7ICT A;  5J0Y A;  1ZQV A;  3Q8Q B;  4I2J A;  4MEY A;  4R63 A;  1T8E A;  4M47 A;  2J6S A;  4MEX A;  3BJY A;  2R8H A;  1DOQ A;  3OSP A;  5IIK A;  3MR5 A;  4P2H A;  4RQ3 A;  4YMN A;  5KFK A;  1U49 A;  4UB2 A;  5J2E A;  3HW8 A;  5KFT A;  5J29 A;  2W9B B;  4ECZ A;  3V6K A;  2ISO A;  2AGP A;  2ASJ A;  3MGH A;  2IHM A;  4M2Y A;  2F1I A;  4MF8 A;  3QZ7 A;  5J0X A;  1BVS A;  2BQU A;  2XCA A;  4Q44 A;  1KRP A;  2NRV A;  3KTQ A;  8ICE A;  4ED2 A;  2Y1J A;  3KHG A;  2BQR A;  1S97 A;  8ICV A;  2XY7 A;  4NLN A;  5IIM A;  4J9L A;  3Q8R B;  3MGI A;  4KLT A;  4M9J A;  3RTV A;  9ICM A;  4O9M A;  3LDA A;  4Q8E A;  2ASD A;  5DQH A;  8ICF A;  7ICS A;  1ZQB A;  3PY8 A;  1TK5 A;  4EYI B;  8ICO A;  1ZJM A;  4DS5 A;  9ICC A;  2V9W A;  2W9M A;  4LZD A;  2P6U A;  3H4B A;  1QTM A;  2OWO A;  3MDC A;  4C8O A;  5DB6 A;  4I2D A;  1XS9 D;  4DFM A;  4R66 A;  1UT5 A;  5F9N A;  3RRH A;  4KLF A;  4TQR A;  1ZQK A;  9ICO A;  4DQR A;  5KFO A;  3RR8 A;  2RDI A;  4EBD A;  5DG8 A;  4YMO A;  5D49 A;  8ICX A;  4P4O A;  3C5G A;  5KFU A;  4IRD A;  4PPX A;  2A1J A;  5HML A;  3M9M B;  4F4X A;  4R65 A;  1B43 A;  1N48 A;  1HUO A;  8ICJ A;  1S77 D;  5J0Q A;  1L3U A;  2J6T A;  2FPM A;  5III A;  4RPZ A;  4ELU A;  4NLK A;  4YQW A;  3B0Y A;  3OGU A;  1ZQG A;  3BQT A;  3LWM A;  4F50 A;  1SKR A;  1CEZ A;  4RT2 A;  3Q8K A;  4KLE A;  8ICR A;  3E2E A;  1BPB A;  2F1J A;  1XO1 A;  4PHP A;  1T7P A;  1S10 A;  7ICP A;  1RYR A;  2HVH A;  3H7I A;  5KFI A;  4ECS A;  2ZJ5 A;  4RQ4 A;  3V72 A;  4UAY A;  2VAN A;  4DLG A;  1JMS A;  4J9P A;  2BGW A;  7ICL A;  5KT5 A;  3H40 A;  5HP4 A;  5L1J A;  3SV4 A;  3MFI A;  3TI0 A;  5J2F A;  3MR2 A;  5KFG A;  5CP2 A; 
#chains in the Genus database with same CATH topology
 1ZQA A;  2C28 A;  4QWC A;  2MA1 A;  4RQ0 A;  2JEJ A;  3ETR A;  1XNS A;  1JXE A;  5KNI A;  7ICN A;  5BPC A;  1A6S A;  2CPR A;  1KFS A;  2MRL A;  2BPC A;  1WYG A;  1IM4 A;  1NK0 A;  3I76 A;  3PST A;  5KG0 A;  5EE0 A;  4ECT A;  4MF2 A;  1KSP A;  2JZB A;  5DB8 A;  3D2S A;  3M8S A;  1XWL A;  2EH9 A;  1X2I A;  2Y0S F;  3PO5 A;  1L3S A;  2DPI A;  2DBY A;  1NJW A;  3SAF A;  4IQT A;  4F91 B;  8ICN A;  5AM0 A;  5AK5 A;  2XGP A;  9ICF A;  5ALT A;  4YCX A;  2W54 A;  3T5L A;  2OEH A;  1TFR A;  2FJ6 A;  1ZYQ A;  3BQ2 A;  2R8K A;  3IN5 A;  3SEN A;  3G6X A;  3RB3 A;  5J2H A;  5J2J A;  5KFL A;  3RH5 A;  1D8L A;  5EWG A;  4EYH B;  2L5Y A;  4RZR A;  3MR3 A;  1JUD A;  1D9D A;  2F3N A;  3FM9 A;  2NYV A;  1YZ7 A;  3OPX A;  5FP0 A;  3N4M B;  2W7P A;  3BQ1 A;  3PW2 A;  2Y1I A;  4OD0 A;  3JPT A;  2RP5 A;  4GC6 A;  1Z3E B;  5DDM A;  3EWA A;  4ECY A;  4I2G A;  1Z00 A;  3CNH A;  2KE7 A;  3NVY A;  2R8J A;  4RPX A;  2FMQ A;  8ICK A;  1KEJ A;  2C2R A;  3L5K A;  1XC9 A;  5KL1 B;  2YMQ A;  1QH9 A;  4KLU A;  3RB4 A;  2JEF A;  2QB0 B;  7ICO A;  4QZ9 A;  2EQY A;  3PSI A;  2MU2 A;  2ZG6 A;  5L9X A;  4PHE A;  4NM2 A;  1KFD A;  3C5F A;  4C8K A;  1KN5 A;  5AKE A;  4RNN A;  1U9L A;  2XY6 A;  3M8R A;  4P4P A;  4J9S A;  4KLI A;  2KHV A;  8ICW A;  5CEH A;  3PMN A;  2HHW A;  4EZ9 A;  2EZX A;  4I2I A;  2LM4 A;  2XI9 A;  4Z6D A;  5KT7 A;  4KLJ A;  4Y2V A;  4UB5 A;  9ICK A;  1CRX A;  2DF4 B;  5ALG A;  4C7Z A;  2KV2 A;  2HHQ A;  2BCU A;  5DGA A;  4KN7 A;  3V6H A;  2KFZ A;  1SWV A;  4UB1 A;  2AJQ A;  5ALU A;  2H3I A;  3Q8P B;  4I2A A;  4ED1 A;  4DQI A;  2JEI A;  3NVV A;  1KTQ A;  4GC7 A;  4DQP A;  3PR4 A;  5KG4 A;  4E0D A;  1Q8K A;  1SZP A;  4ED7 A;  3QUB A;  3MR6 A;  2ZUD A;  1V38 A;  3C2K A;  2YN4 A;  2HBK A;  1F5S A;  2K8B B;  2DFL A;  3F5E A;  5J2G A;  5DBC A;  1ZQH A;  3E0F A;  1CI4 A;  8ICH A;  3SAH A;  4O3O A;  4RQ5 A;  3RJF A;  1WWU A;  5J0T A;  3CRX A;  3N7P D;  3BS5 A;  3N7R C;  2H3Z A;  4DOB A;  1ZQW A;  1PVQ A;  1COO A;  3KHR A;  5AKG A;  3Q8L A;  5HNK A;  2Q0Z X;  4O5C A;  1JIH A;  2ZIX A;  4IC9 A;  4BWM A;  1B4F A;  4JWM A;  7ICK A;  4UB8 U;  3UQ2 A;  1XU4 A;  5AI6 A;  3NVZ A;  2M9N A;  1FFV A;  5KFJ A;  5KG3 A;  5ALN A;  1J97 A;  4I2C A;  5D4B A;  3QU4 A;  9ICA A;  1NZB A;  4O3Q A;  1X9M A;  3D2N A;  1NK5 A;  2ZJ8 A;  3KKA A;  2KZZ A;  3AU2 A;  2DPJ A;  1UT8 A;  4QZH A;  4OJ5 A;  2LHT A;  2NRX A;  5CWR A;  2ZIW A;  5IIJ A;  3H0M B;  1RYU A;  4P0P A;  4I2F A;  1KKX A;  4QWA A;  2OCE A;  5JU5 A;  3D6J A;  3GII A;  1ZQ1 C;  3ISD A;  3PO4 A;  5C0Y A;  3PX0 A;  3N7S C;  1ZQL A;  2E8P A;  5IIL A;  3TFR A;  3PV8 A;  3SEI A;  2V4R A;  2JRZ A;  4QZB A;  4KLH A;  2FPK A;  4O5E A;  1U4B A;  2J6U A;  4OCZ A;  4XUS A;  3F2C A;  2E1E A;  3AMZ A;  3O0F A;  2AU0 A;  1L7P A;  3HRD D;  5KFP A;  3M7D A;  3AU6 A;  4RUC A;  3MBY A;  4MFF A;  5EE1 A;  1VDV A;  4C8N A;  7ICG A;  1ZQJ A;  3ALR A;  4DQQ A;  2KKV A;  1KQQ A;  2KP7 A;  5ALY A;  2BDP A;  3ISC A;  2OH2 A;  3HP6 A;  3EZ5 A;  4UAU A;  3NS1 A;  2DL0 A;  4DL6 A;  3IP4 B;  3QU9 A;  3DEE A;  5AK3 A;  4B9M A;  9ICH A;  2AQ4 A;  5CJ7 A;  2ZUB A;  4KLO A;  1ZQI A;  2XGQ A;  1N62 A;  3RFA A;  1WG8 A;  4TUQ A;  5HHI A;  4DL7 A;  1OW5 A;  2I9G A;  3C29 A;  1JRO A;  2C2D A;  1ZQV A;  3Q8Q B;  1V85 A;  1T8E A;  2AH5 A;  3OSP A;  4RQ3 A;  4UB2 A;  3HW8 A;  2W9B B;  1ZD3 A;  1UQV A;  4M2Y A;  3SR6 A;  1N61 A;  4MF8 A;  5J0X A;  4Q44 A;  1IV8 A;  1KRP A;  8ICE A;  3KHG A;  1ZRN A;  2I6X A;  4J9L A;  3Q8R B;  4Q8E A;  3GZF A;  8ICF A;  2D8C A;  3SAG A;  3H4B A;  1NNL A;  5DB6 A;  2XIC A;  4I2D A;  2JH1 A;  4KLF A;  3KZI U;  4YMO A;  2RRD A;  3M9M B;  1N48 A;  5J0Q A;  4RPZ A;  5III A;  4NL9 A;  4C4S A;  4KLE A;  2K8A A;  1QQ7 A;  2WF8 A;  2BDU A;  1A0P A;  4RQ4 A;  5AI8 A;  1Q3U A;  2KJ5 A;  5G5H A;  4UAY A;  3ZI4 A;  3ED5 A;  4DLG A;  5ALK A;  1QQ6 A;  3H40 A;  5HP4 A;  3SV4 A;  5J2F A;  2G5H B;  5KFG A;  2BHN A;  1QTM A;  1O08 A;  9ICU A;  2EZY A;  3C21 A;  3AM9 A;  1NKB A;  1Z1V A;  4UB4 A;  1P7D A;  2BKE A;  2VIX A;  4DFK A;  5AIC A;  4B9S A;  4Y2Y A;  2MUT A;  3EW9 A;  3CP8 A;  4ACO A;  2B6G A;  2BQ3 A;  1IXR A;  3RB6 A;  2E8O A;  1X9W A;  4ZOH C;  3OHB A;  3RBE A;  5CRX A;  1RXV A;  3MGV A;  1TAM A;  4KMO B;  3CYM A;  1XSL A;  5J2I A;  1ZET A;  1VLB A;  1EXN A;  3HT3 A;  3LK9 A;  4UQG A;  2W04 A;  2OHF A;  1ZQM A;  1ZQF A;  7ICF A;  9ICB A;  3ONN A;  3SD7 A;  4Z6C A;  4F8R A;  3ZD8 A;  3KKA C;  2KEY A;  4M0A A;  4RT3 A;  2IOF A;  1ZD2 P;  4Z6E A;  2HSZ A;  3QNM A;  4JMU A;  3THV A;  3R9K A;  5KT4 A;  4O5K A;  3L4P A;  4GXJ A;  5AIA A;  1RZT A;  2E5S A;  1K1S A;  1ZD5 A;  1H38 A;  2AHO B;  3QEA Z;  2CRX A;  5DBA A;  4ED6 A;  5KFE A;  3FYH A;  4ECX A;  1NK9 A;  2UVV A;  9ICS A;  2ZUC A;  3AL0 B;  4NY8 A;  7ICE A;  1S9F A;  5EWE A;  1TV9 A;  1C20 A;  5ALL A;  3NTU A;  3NGD A;  4BXO A;  5J2D A;  4PGX A;  3JPQ A;  3T3F A;  2W11 A;  4YP3 A;  1SB3 C;  4IQV A;  5AK4 A;  3HX0 A;  4USA A;  4XRH A;  3UQ0 A;  4M6W B;  1YT3 A;  4UBC A;  2HOI A;  1X66 A;  2WTF A;  2LYH A;  5ALW A;  2WF9 A;  4TUR A;  4C8M A;  2Z7J A;  3QEB Z;  3LYS A;  9ICE A;  2P35 A;  1BPX A;  1QLN A;  2WF7 A;  2DQN B;  5GTH U;  2O6K A;  3CW2 C;  5J2B A;  2JHD A;  2H3Q A;  3U26 A;  1U47 A;  1JAL A;  5AK6 A;  5KFW A;  4F71 A;  3ICX A;  1ZXI A;  5AHX A;  1LKY A;  5K4L A;  1PK3 A;  4EEY A;  1CUK A;  2FLN A;  4K4H A;  4UAW A;  5KT2 A;  5L1I A;  7ICH A;  2W8K A;  3RJE A;  2A19 A;  5ALJ A;  3V7J A;  2GWS A;  2H5X A;  4EEK A;  2QAR B;  2FPL A;  4QZG A;  2VA3 A;  3RJI A;  5KFV A;  2PKE A;  1ZQS A;  4DFP A;  3RR7 A;  5DLG A;  3UXN A;  5J8Y A;  3NRW A;  2YY6 A;  1JN3 A;  1C7Y A;  4Q8F A;  8ICQ A;  2F8L A;  1N5X A;  4RNM A;  4F4W A;  3C23 A;  4O3R A;  3M9N B;  1NJZ A;  4BDP A;  4GIB A;  9ICN A;  2NO4 A;  1ZQY A;  3JPR A;  9ICP A;  4YFK A;  4F4Z A;  2N1R A;  4F5P A;  2ZIU B;  4ED3 A;  5AM3 A;  1ZOL A;  2GOL A;  2ESE A;  1L3V A;  5ALZ A;  1UHU A;  4BWJ A;  1J2M A;  4YG2 A;  2ES6 A;  5CR0 A;  4NLC A;  1F0M A;  1ZJN A;  1RDF A;  3BDP A;  4ED0 A;  4LVS A;  1SKS A;  3F2B A;  3I28 A;  1KDH A;  1BPZ A;  2WB1 F;  2NRZ A;  3T5J A;  4O3P A;  2IOH A;  4LJX A;  5F9L A;  1LVH A;  4RQ8 A;  2C2E A;  4P0P B;  1T94 A;  4KLL A;  2ISP A;  2FMP A;  4KMU A;  4NL9 C;  2M0N A;  4J9N A;  3KOO A;  2K4E A;  4B9T A;  3C28 A;  4FE3 A;  2FMS A;  3PSF A;  4K4I A;  4I29 A;  3GQC A;  8ICY A;  2WFA A;  2UVU A;  2K89 A;  4QZI A;  3OSN A;  5ALE A;  1MN8 A;  4F4Y A;  3FDS A;  8ICT A;  3AEV A;  1KLN A;  4DLE A;  4P0Q A;  5L1L A;  4JK1 A;  2HOQ A;  3C1Z A;  3WK4 A;  4DFD A;  4DFJ A;  1SV4 A;  4AYB C;  4UW9 A;  1S76 D;  5KFD A;  2YMM A;  3RJG A;  2HHS A;  2JEG A;  3F53 A;  1X42 A;  2K8C B;  3UMG A;  3PZP A;  4DL5 A;  1S0O A;  1Z4O A;  4PGQ A;  4ECU A;  4R8U A;  5DBB A;  3H4D A;  1S0N A;  3ORY A;  2F2A B;  4YN4 A;  1PK1 A;  9ICV A;  2FI1 A;  9ICL A;  4QWD A;  4KLD A;  3PW0 A;  9ICX A;  5ALV A;  3MDA A;  2I5H A;  4BJQ A;  1NK7 A;  4UAR A;  4JV2 A;  5ALM A;  3EPG A;  3IDW A;  3FC4 A;  2ZIV A;  1UA0 A;  4DL4 A;  5AKI A;  2XC9 A;  4M9H A;  1L7O A;  3GIK A;  4PJ0 U;  4Y2Q A;  5G5G A;  2DGZ A;  4C0Z A;  5BOM A;  4IR1 A;  5AI5 A;  2Q4T A;  1DRG A;  3PX4 A;  2KKP A;  4QW9 A;  4DO9 A;  5AI9 A;  3M1Y A;  2G5I B;  3F5A A;  1OUQ A;  3WKC A;  1NJX A;  4I28 A;  4C4T A;  2KJ8 A;  4PH5 A;  2W9A A;  3V7L A;  2KN7 A;  4IQW A;  9ICR A;  1PZN A;  5J0R A;  4EZ6 A;  4HYK A;  1U48 A;  3H0L B;  3TAC B;  3OJU A;  2HOF A;  2W9C B;  2XID A;  3ZDB A;  2QLT A;  1ZQE A;  4FO6 A;  2EDU A;  1SKW A;  4IL6 U;  1ZQO A;  3UPQ A;  1BGX T;  3ISB A;  3GV7 B;  4RQ2 A;  7ICT A;  1ECW A;  1X6I A;  4MEY A;  3TKA A;  4R63 A;  3BJY A;  1DOQ A;  4P2H A;  5AM5 A;  5J2E A;  1N63 A;  2ISO A;  4ECZ A;  2F1I A;  5AIB A;  3HIL A;  2YQE A;  2XCA A;  3KTQ A;  4ED2 A;  1BNO A;  1S97 A;  8ICV A;  2KSO B;  5IIM A;  4KLT A;  1SZH A;  9ICM A;  2E8N A;  3LDA A;  4CF3 A;  1ZQB A;  1TK5 A;  4EYI B;  3F2D A;  1ZJM A;  9ICC A;  2V9W A;  4LZD A;  1UPH A;  2P6U A;  2G07 A;  2OWO A;  3MDC A;  4BUG A;  4J03 A;  4C8O A;  1S8O A;  3E58 A;  1XS9 D;  4R66 A;  1YZ6 A;  1XO0 A;  3NAS A;  1Q3V A;  1ZQK A;  3NUQ A;  2ZXH A;  4EBD A;  2HBM A;  4AYB F;  5J8Y C;  2CN1 A;  4PPX A;  1B43 A;  8ICJ A;  5GTI U;  4NLK A;  2PMZ C;  3B0Y A;  3BQT A;  2EZZ A;  3MC1 A;  2GO7 A;  3J81 j;  2F8K A;  8ICR A;  1BPB A;  1XO1 A;  1T7P A;  1S10 A;  1RYR A;  3H7I A;  2AXT U;  2KVS A;  3RF9 A;  2VAN A;  4G9B A;  4CF4 A;  3RR8 A;  3MR2 A;  5ALF A;  4JWN A;  5KFS A;  4J9O A;  5KTQ A;  1V97 A;  4P4M A;  4FBT A;  2K4H A;  5KFQ A;  2WF5 A;  2GLE A;  3TAQ A;  3IG5 A;  1SIJ A;  1RXW A;  1RQN A;  3PX6 A;  4QZE A;  2RQ5 A;  3SI8 A;  3H8S A;  4QZC A;  5KFB A;  1ZQU A;  5KG7 A;  4I27 A;  4IR9 A;  2QB0 A;  4NV0 A;  2PXI A;  4PHD A;  8ICG A;  1RPL A;  1ED1 A;  4RQ7 A;  3QX7 A;  2KK0 A;  2KHQ A;  1TAQ A;  1V9P A;  1GO3 F;  3TAN A;  1ZQR A;  5KFZ A;  8ICU A;  5ALD A;  4YXM A;  3EPI A;  1NK6 A;  5B66 U;  8ICP A;  4PZO A;  3GFK B;  3ZDC A;  2B21 A;  3QXG A;  1MA7 A;  5CB1 A;  5TIS U;  4QWB A;  2JGA A;  2A1J B;  3WKB A;  1N2X A;  4US8 A;  4DCC A;  4F5R A;  1L3T A;  1Z1B A;  3GIL A;  5KAF U;  3SV3 A;  3WKA A;  4J9M A;  5KFA A;  3H8W A;  4QJF B;  1K1Q A;  3QZ8 A;  4KLQ A;  5KG5 A;  5J2A A;  3KBB A;  4EX7 A;  1T3N A;  3KHL A;  4DSK A;  4AP9 A;  3SQI A;  1LB2 B;  3QYP A;  2ALZ A;  1HEK A;  3JPN A;  1KFT A;  2BCR A;  1ZQP A;  1O03 A;  3PML A;  1N56 A;  4DEZ A;  2QKQ A;  4QW8 A;  4IQU A;  3MFH A;  1NKC A;  4I2E A;  3N97 B;  4NJ8 A;  2GH1 A;  4NLZ A;  1ZQZ A;  5J2K A;  5HMM A;  3IG8 A;  4EX6 A;  1QSS A;  4YD1 A;  3LWL A;  4NXZ A;  1FIQ A;  1FFU A;  2JZB B;  5J0O A;  3QU7 A;  3PW4 A;  3PVX A;  1S5L U;  2PMZ F;  4LZG A;  5AI4 A;  4ECW A;  2EAO A;  4CRX A;  4KLS A;  1WCL A;  2V4Q A;  5E79 U;  2LYB A;  5ALR A;  4ECV A;  3HPO A;  3RAX A;  2KVC A;  4NLG A;  4YR0 A;  4J9K A;  3QU5 A;  4EBC A;  2F44 A;  1M6Y A;  1SXD A;  4ECQ A;  4F3O A;  3A0H U;  1PUZ A;  1JXL A;  4B9V A;  2A1A A;  7ICS A;  1XSN A;  4UAV A;  1K5O A;  4EEN A;  5JTI A;  1HIW A;  4NWI A;  4ZH4 A;  1T3Q A;  4F5N A;  1RYS A;  2ZTE A;  4C7Y A;  1UCV A;  4YD2 A;  4K4G A;  7ICR A;  3SZ2 A;  4J9R A;  4YXJ A;  3RJJ A;  4M04 A;  3UXP A;  1DGS A;  1ZQT A;  1QQ5 A;  4B9U A;  1WCN A;  4YMM A;  5AKY A;  5H2F U;  4RU9 A;  4DL3 A;  1UA1 A;  1L7M A;  7ICU A;  1Z00 B;  5ALH A;  4RUA A;  2H3V A;  2W3S A;  2LYA A;  4PGY A;  2G06 A;  2C22 A;  4Y2T A;  3QUT A;  1QCK A;  4PL1 A;  4B9L A;  5AKK A;  4Y2R A;  9ICJ A;  2KIC A;  5DG7 A;  1TVA A;  2JMG A;  4R8U B;  4PL2 A;  2ZXI A;  1BNP A;  2W43 A;  3WKD A;  4XA5 A;  4UAZ A;  1URJ A;  2OYY A;  4DL2 A;  4FS1 A;  3ZD9 A;  2E3T A;  3TFS A;  5KG6 A;  4Q43 A;  3HKZ C;  3JPP A;  4Y2P A;  3DV9 A;  2G08 A;  5KFC A;  4DWI A;  4DSJ A;  2KOB A;  1TE2 A;  5HHH A;  2VKQ A;  3WK5 A;  5DG9 A;  3BS7 A;  4NM1 A;  2W9B A;  9ICQ A;  3BQ0 A;  7ICJ A;  4F2S A;  4M9N A;  2VJ5 A;  1TKD A;  3NVW A;  3RB0 A;  3D2Q A;  2R18 A;  2K4I A;  3GV8 B;  4F93 B;  1VJ5 A;  2KFN A;  8ICI A;  1D8B A;  3EYZ A;  4UB3 A;  4QZ8 A;  1L6N A;  4I2B A;  4J9Q A;  4KLG A;  3B0X A;  5KFX A;  1ZQQ A;  2IA6 A;  3PW5 A;  1L8O A;  3BS5 B;  4HAI A;  4O3S A;  2KD1 A;  3RBD A;  3K75 D;  2DKZ A;  3PW7 A;  2BPG A;  1F44 A;  4DF4 A;  3KZX A;  1U45 A;  4M9G A;  2JR5 A;  2LKY A;  2WF6 A;  2KJ9 A;  2ZIX B;  2BCV A;  2LPE A;  2HCF A;  2BR0 A;  2BCS A;  1PVR A;  2DUY A;  1WWV A;  4CNQ A;  1S0M A;  3TQ1 A;  2RLT A;  2P6R A;  4KTQ A;  4DSF A;  3GDX A;  2XCP A;  2YML A;  3LVW A;  5KAI U;  5L1K A;  2HMX A;  1A77 A;  1FO4 A;  4TUP A;  1NK4 A;  2UVW A;  2IBK A;  3ZDE A;  3UXO A;  1L8L A;  3UMB A;  4MFC A;  3GIM A;  1Z4N A;  4US9 A;  2ZIW B;  3G6Y A;  1N60 A;  2JXJ A;  2E8M A;  4EBE A;  1COK A;  5J0Y A;  5ALS A;  4I2J A;  4O3M A;  4ICA A;  3MR5 A;  5KFK A;  4YMN A;  2E1F A;  2KIV A;  3V6K A;  3MGH A;  2IHM A;  3QZ7 A;  1BVS A;  2BQU A;  3L3F X;  3A0B U;  5AKX A;  2Y1J A;  2BQR A;  4NLN A;  1FEZ A;  2NV3 A;  3MGI A;  4CGZ A;  3RTV A;  3K1Z A;  2KG5 A;  5DQH A;  2G09 A;  1X6J A;  3PY8 A;  2EAP A;  2YB4 A;  2A3V A;  3M6K A;  4DFM A;  2NO5 A;  3HKZ F;  5F9N A;  3RRH A;  5KFO A;  1ZD4 A;  5KFU A;  4OO1 J;  5HML A;  4F4X A;  2YX8 A;  3B9J A;  2J6T A;  4ELU A;  3LWM A;  3Q8K A;  3E2E A;  4PHP A;  2ZJ5 A;  5AM4 A;  1ZRM A;  2CXY A;  2YB1 A;  5KT5 A;  5L1J A;  3MFI A;  3TI0 A;  4QZD A;  5EE9 A;  2AGO A;  2W3R A;  3K4G A;  1Q46 A;  4DSI A;  1X9S A;  4QZA A;  3SMV A;  4JV1 A;  4M6W A;  4DOC A;  4CE6 A;  4MHV A;  3VC8 A;  5JRT A;  1L5U A;  5KT3 A;  4FBU A;  1IG6 A;  4M9L A;  2AGQ A;  3T5H A;  5J0S A;  3TAR A;  2KIW A;  2DKX A;  3FAH A;  1TAU A;  5HR7 A;  4U7C A;  1DK3 A;  5EWF A;  2W8L A;  3SYZ A;  1KBU A;  9ICW A;  2W55 A;  1SL1 A;  2YTU A;  1D9F A;  1KW4 A;  4DS4 A;  3H8J A;  4QWE A;  1TK8 A;  2F77 X;  2HW3 A;  9ICG A;  5DGB A;  3WU2 U;  3H0R B;  5J0U A;  5AKL A;  1NK8 A;  2JV3 A;  2QAR A;  2BCQ A;  4YR3 A;  2IHN A;  2AQ0 A;  3JPS A;  5T14 A;  3IV6 A;  3IHQ B;  3T79 A;  5D46 A;  3M6Z A;  2PFQ A;  2NRW A;  3V7K A;  5KFY A;  5DKW A;  2FDR A;  3VCB A;  1J2N A;  4GXK A;  2KZM A;  2KMD A;  3AQE A;  1SWW A;  4RPY A;  5KFH A;  8ICS A;  5AKZ A;  3RJH A;  3H8M A;  5F3X B;  8ICL A;  3BZK A;  1ZQC A;  4WJ3 B;  2BPF A;  1QSL A;  4F2R A;  2D6F C;  4I2H A;  1SV0 A;  2MAX A;  2ZIU A;  2PFN A;  3G6V A;  2NRT A;  1RM6 C;  4QNL A;  1ARO P;  1MQ2 A;  3DDH A;  3QUQ A;  3QU2 A;  4KN4 A;  2LBO A;  2EAM A;  4BGD A;  2R8G A;  2DWQ A;  4R64 A;  2MSN A;  1N5W A;  4UB6 U;  5CA7 A;  4F5O A;  1T4G A;  2ZJA A;  2MUT B;  3RH4 A;  2I1Q A;  4DSE A;  4RQ6 A;  1S0V A;  1ZQN A;  4DSL A;  4QIW C;  4NLB A;  2P66 A;  5A0L A;  4GXI A;  8ICC A;  4OJP A;  5EOZ A;  2RDJ A;  5IIO A;  4C4R A;  8ICA A;  1OXJ A;  5TZV A;  2PFP A;  4ECR A;  5DDY A;  4RNO A;  2FLL A;  2HHX A;  9ICI A;  4DOA A;  5KFR A;  1BPD A;  4GLX A;  4ELV A;  2Y9T A;  2VA2 A;  4B6J A;  5JUM A;  4IRC A;  3T5K A;  1NZP A;  2HBL A;  3PSP A;  4O3N A;  2XY5 A;  4TQS A;  4X5V A;  3TAD A;  1AQ6 A;  2R8I A;  2WAQ C;  3PNC A;  2YMP A;  3MAB A;  4FFD A;  1B22 A;  5KL8 B;  3OHA A;  1JI7 A;  4CCH A;  1TK0 A;  5KT6 A;  4BXO B;  4Q45 A;  1ZQD A;  1HUZ A;  4F92 B;  2H3F A;  2HDO A;  4FS2 A;  4PHA A;  7ICM A;  1SXE A;  4YVZ A;  7ICQ A;  3RH6 A;  2VJ4 A;  3ZDA A;  2QB1 A;  1A76 A;  4UBB A;  4PZN A;  8ICZ A;  4JUZ A;  2KZ3 A;  3RRG A;  5AM1 A;  5AI0 A;  5B5E U;  2HBJ A;  2W7O A;  5ALO A;  2JH7 A;  1MC8 A;  7ICI A;  4FZM A;  1MSW D;  1SL2 A;  3GU3 A;  2PFO A;  4FZN A;  5ALI A;  2LMR A;  1Z19 A;  3KHH A;  1X9X A;  5J0W A;  4GFJ A;  2D3D A;  3KD3 A;  3GIJ A;  4RQM A;  2ZTD A;  3WKE A;  5CHG A;  3WK7 A;  3V6J A;  5KFF A;  3BQ7 A;  4TUS A;  5AKJ A;  1QSY A;  1LKY B;  5KFN A;  5J2C A;  1IIP A;  4DQS A;  4Y2U A;  4O0I A;  3IM1 A;  4KLM A;  1CEZ A;  3C1Y A;  2HHV A;  5AKH A;  1NJY A;  3C2M A;  4CDG A;  4IRK A;  4CF5 A;  1WUD A;  5KFM A;  5HR6 A;  4Z6F A;  4RQN A;  3RAQ A;  2W9C A;  4YR2 A;  3M9O B;  5C5J A;  9ICT A;  2EAN A;  3OTQ A;  2HVI A;  3Q8M A;  4XQ8 A;  2LM1 A;  1D8Y A;  2HI0 A;  2BZF A;  5ALQ A;  5DQI A;  2F1H A;  5BOL A;  5DLF A;  2VA8 A;  1XSP A;  2LI6 A;  4QZF A;  4Y2X A;  3ETL A;  4QIW F;  1MQ3 A;  2KSO A;  2OXO A;  5DQG A;  3BZC A;  3HJE A;  1X40 A;  2FLP A;  1KL9 A;  3AN1 A;  1DXS A;  4IS7 A;  3Q8S B;  8ICM A;  1DK2 A;  2Y9U A;  2PI4 A;  1LV5 A;  3GV5 B;  2XO7 A;  2KTQ A;  5ALX A;  4U6P A;  2UVR A;  1Y88 A;  4MFA A;  3LVV A;  2G0A A;  2XVT A;  5L1M A;  5J0P A;  4G3I A;  2WHE A;  4ED8 A;  5IIN A;  1SL0 A;  5DB7 A;  3HWT A;  2ASL A;  4EEL A;  1NKE A;  2RHF A;  2ZTC A;  3N28 A;  2W03 A;  2ATL A;  4RQ1 A;  3OJS A;  4Y2S A;  1HJP A;  3PR5 B;  5KG2 A;  1PVP A;  2WAQ F;  3ZDD A;  3QE9 Y;  5AM2 A;  7ICV A;  2IMW P;  4ELT A;  1JRP A;  2PI5 A;  5EE3 A;  1NOM A;  2Y0S C;  1RG6 A;  3EUB 2;  1SV0 C;  2K4P A;  3NRZ A;  4Y2J A;  1JX4 A;  5DB9 A;  4KX3 A;  3RJK A;  3JPO A;  4KIT B;  2IOF K;  4OJL A;  3AUO A;  2HHT A;  5KG1 A;  8ICB A;  4JV0 A;  3TAP A;  4DF8 A;  4B9N A;  4P0Q B;  4UAT A;  2HHU A;  1BPY A;  1BPE A;  4C8L A;  4F4K A;  1ZQX A;  4F5Q A;  2WB1 C;  3C2L A;  1NI3 A;  4JB3 A;  3UM9 A;  4OJO A;  5ALP A;  4M47 A;  2J6S A;  4MEX A;  2R8H A;  1RQL A;  5IIK A;  3WK8 A;  1U49 A;  3QUC A;  5KFT A;  5J29 A;  2AGP A;  2ASJ A;  3KFU F;  1PK1 B;  2F76 X;  2FE9 A;  2NRV A;  4FZL A;  2XY7 A;  3K1R B;  3IRU A;  4M9J A;  4O9M A;  2ASD A;  8ICO A;  4DS5 A;  2W9M A;  2ZIV B;  1UT5 A;  2B0C A;  9ICO A;  4TQR A;  3S6J A;  1L7N A;  4DQR A;  2RDI A;  3AQF A;  5DG8 A;  5D49 A;  8ICX A;  3C5G A;  4P4O A;  4A8E A;  3WK6 A;  4BX9 C;  4IRD A;  2A1J A;  4C80 A;  2ODG A;  3TAD C;  4R65 A;  1HUO A;  1S77 D;  3I1Y A;  1L3U A;  2K60 A;  2FPM A;  4YQW A;  3OGU A;  1DGJ A;  1ZQG A;  4F50 A;  4KX5 A;  1SGG A;  1SKR A;  4RT2 A;  4OJ6 A;  2F1J A;  7ICP A;  2HVH A;  3WK9 A;  5KFI A;  4ECS A;  1B0X A;  3V72 A;  4UAS A;  3UMC A;  1JMS A;  2OM6 A;  4F72 A;  4J9P A;  2BGW A;  7ICL A;  2KNJ A;  5CP2 A; 
#chains in the Genus database with same CATH homology
 4QZD A;  4JWN A;  9ICU A;  5KFS A;  1ZQA A;  2C28 A;  4J9O A;  4QWC A;  2AGO A;  3C21 A;  5KTQ A;  3K4G A;  4DSI A;  1X9S A;  4RQ0 A;  4P4M A;  4QZA A;  1NKB A;  2JEJ A;  4JV1 A;  4M6W A;  1JXE A;  4FBT A;  5KFQ A;  5BPC A;  4DOC A;  7ICN A;  2BHN A;  4UB4 A;  3TAQ A;  2BKE A;  4DFK A;  1L5U A;  4B9S A;  5KT3 A;  1KFS A;  2MUT A;  3EW9 A;  2BPC A;  4FBU A;  1RXW A;  1IM4 A;  4M9L A;  2AGQ A;  3T5H A;  2BQ3 A;  3PX6 A;  4QZE A;  1IXR A;  1NK0 A;  5J0S A;  3RB6 A;  3TAR A;  1X9W A;  3OHB A;  3RBE A;  3SI8 A;  5KG0 A;  4ECT A;  4MF2 A;  1RXV A;  5KFB A;  3H8S A;  4QZC A;  1KSP A;  1TAU A;  1ZQU A;  2JZB A;  5KG7 A;  5DB8 A;  4I27 A;  4IR9 A;  1XSL A;  5J2I A;  1ZET A;  5EWF A;  2W8L A;  3M8S A;  1EXN A;  1XWL A;  2PXI A;  3SYZ A;  4PHD A;  3HT3 A;  3LK9 A;  8ICG A;  4UQG A;  1RPL A;  9ICW A;  4RQ7 A;  1X2I A;  1SL1 A;  1ZQM A;  1ZQF A;  7ICF A;  9ICB A;  1TAQ A;  1D9F A;  3PO5 A;  4Z6C A;  1V9P A;  4DS4 A;  3TAN A;  1L3S A;  1ZQR A;  2DPI A;  3H8J A;  4QWE A;  1TK8 A;  4F8R A;  1NJW A;  5KFZ A;  2HW3 A;  9ICG A;  3ZD8 A;  8ICU A;  5DGB A;  5J0U A;  4M0A A;  4YXM A;  1NK8 A;  3EPI A;  4RT3 A;  1NK6 A;  8ICP A;  4IQT A;  4F91 B;  2BCQ A;  8ICN A;  3GFK B;  4Z6E A;  4YR3 A;  2AQ0 A;  3JPS A;  2IHN A;  3ZDC A;  2B21 A;  2XGP A;  9ICF A;  3IHQ B;  3THV A;  5CB1 A;  5D46 A;  4YCX A;  2PFQ A;  2NRW A;  4QWB A;  5KT4 A;  3V7K A;  4O5K A;  5KFY A;  5DKW A;  4GXK A;  3T5L A;  2KZM A;  4GXJ A;  2A1J B;  1RZT A;  1TFR A;  1K1S A;  4F5R A;  1ZYQ A;  1H38 A;  4RPY A;  5KFH A;  3BQ2 A;  3QEA Z;  1L3T A;  5DBA A;  4ED6 A;  5KFE A;  2R8K A;  8ICS A;  3GIL A;  3SV3 A;  3FYH A;  4J9M A;  4ECX A;  3G6X A;  5KFA A;  5J2H A;  5J2J A;  3RB3 A;  1NK9 A;  3RJH A;  3H8W A;  5KFL A;  1ZQC A;  2ZUC A;  2BPF A;  3RH5 A;  1D8L A;  2UVV A;  4NY8 A;  5EWG A;  7ICE A;  4EYH B;  1K1Q A;  3QZ8 A;  1QSL A;  1S9F A;  4F2R A;  4RZR A;  4KLQ A;  5EWE A;  3MR3 A;  2MAX A;  1TV9 A;  2PFN A;  4I2H A;  5KG5 A;  1D9D A;  3NTU A;  5J2A A;  3G6V A;  1T3N A;  2NRT A;  3KHL A;  4DSK A;  3NGD A;  4BXO A;  5J2D A;  4PGX A;  3JPQ A;  3T3F A;  4YP3 A;  1ARO P;  1MQ2 A;  4M04 A;  1LB2 B;  4IQV A;  3N4M B;  2ALZ A;  4KN4 A;  3JPN A;  3BQ1 A;  1KFT A;  2BCR A;  3PW2 A;  4BGD A;  1ZQP A;  2R8G A;  3HX0 A;  2Y1I A;  4XRH A;  3PML A;  3UQ0 A;  4M6W B;  1N56 A;  4UBC A;  3JPT A;  4DEZ A;  4QW8 A;  4R64 A;  2WTF A;  4IQU A;  5DDM A;  1Z3E B;  2LYH A;  3MFH A;  3EWA A;  4GC6 A;  4ECY A;  3N97 B;  4TUR A;  1NKC A;  4I2E A;  4I2G A;  4C8M A;  5CA7 A;  4F5O A;  1T4G A;  2ZJA A;  1Z00 A;  3QEB Z;  2R8J A;  2MUT B;  4RPX A;  9ICE A;  2FMQ A;  1BPX A;  8ICK A;  1KEJ A;  3RH4 A;  4NLZ A;  2C2R A;  1QLN A;  1ZQZ A;  2I1Q A;  5J2K A;  4DSE A;  4RQ6 A;  5HMM A;  1XC9 A;  5J2B A;  1S0V A;  1QSS A;  1ZQN A;  4DSL A;  4YD1 A;  3LWL A;  4NXZ A;  2P66 A;  8ICC A;  4GXI A;  2JZB B;  4KLU A;  3RB4 A;  5J0O A;  2JEF A;  1U47 A;  7ICO A;  4QZ9 A;  5EOZ A;  3PVX A;  3PW4 A;  4LZG A;  5KFW A;  5IIO A;  2RDJ A;  5L9X A;  4PHE A;  8ICA A;  4ECW A;  5TZV A;  4NM2 A;  2PFP A;  4EEY A;  4ECR A;  1WCL A;  1KFD A;  1CUK A;  5DDY A;  4RNO A;  3C5F A;  2FLL A;  2FLN A;  4C8K A;  4DOA A;  4K4H A;  4UAW A;  5KFR A;  9ICI A;  4RNN A;  1BPD A;  5KT2 A;  2V4Q A;  5L1I A;  7ICH A;  1U9L A;  2XY6 A;  3M8R A;  4P4P A;  2W8K A;  4J9S A;  4GLX A;  4ECV A;  2VA2 A;  4ELV A;  9ICS A;  3HPO A;  3RAX A;  3RJE A;  5JUM A;  4KLI A;  8ICW A;  4IRC A;  3T5K A;  3PMN A;  4NLG A;  2HHW A;  4YR0 A;  4EZ9 A;  4J9K A;  4I2I A;  3V7J A;  2GWS A;  2H5X A;  4EBC A;  2FPL A;  4Z6D A;  4QZG A;  5KT7 A;  2VA3 A;  4KLJ A;  3RJI A;  4O3N A;  5KFV A;  2XY5 A;  4UB5 A;  4TQS A;  9ICK A;  1ZQS A;  4DFP A;  4ECQ A;  4X5V A;  3RR7 A;  4F3O A;  5DLG A;  3UXN A;  1JXL A;  1JN3 A;  1C7Y A;  4Q8F A;  8ICQ A;  4B9V A;  2HHQ A;  2BCU A;  2R8I A;  4RNM A;  4F4W A;  5DGA A;  1XSN A;  3C23 A;  4O3R A;  4KN7 A;  3V6H A;  3M9N B;  4UB1 A;  1NJZ A;  2KFZ A;  8ICL A;  3PNC A;  4BDP A;  9ICN A;  2AJQ A;  1ZQY A;  3JPR A;  3Q8P B;  3MAB A;  4I2A A;  9ICP A;  4YFK A;  1B22 A;  4F4Z A;  4ED1 A;  4DQI A;  4F5P A;  3OHA A;  2JEI A;  1KTQ A;  4GC7 A;  4DQP A;  3PR4 A;  5KG4 A;  4ED3 A;  4ZH4 A;  4E0D A;  1SZP A;  4F5N A;  4ED7 A;  4CCH A;  3MR6 A;  1L3V A;  1TK0 A;  5KT6 A;  4BXO B;  4Q45 A;  2ZTE A;  2ZUD A;  1RYS A;  1ZQD A;  4BWJ A;  4YD2 A;  3C2K A;  1HUZ A;  2HHX A;  4F92 B;  4K4G A;  4FS2 A;  4YG2 A;  7ICR A;  5CR0 A;  4PHA A;  4J9R A;  3SZ2 A;  4YXJ A;  7ICM A;  2DFL A;  4YVZ A;  3RJJ A;  5J2G A;  5DBC A;  3RH6 A;  3UXP A;  1DGS A;  1ZJN A;  1ZQT A;  1A76 A;  4UBB A;  3ZDA A;  4B9U A;  8ICZ A;  1ZQH A;  3BDP A;  1WCN A;  4YMM A;  4JUZ A;  8ICH A;  4ED0 A;  4LVS A;  2KZ3 A;  1SKS A;  4O3O A;  4RQ5 A;  4RU9 A;  1KDH A;  3RRG A;  3RJF A;  1BPZ A;  4DL3 A;  5J0T A;  1UA1 A;  2NRZ A;  3T5J A;  4O3P A;  1Z00 B;  7ICU A;  4RUA A;  1MC8 A;  7ICI A;  2C22 A;  4PGY A;  5F9L A;  4DOB A;  1ZQW A;  1COO A;  1MSW D;  1SL2 A;  3KHR A;  2PFO A;  3Q8L A;  4RQ8 A;  5HNK A;  2Q0Z X;  3KHH A;  5J0W A;  2C2E A;  4O5C A;  1JIH A;  4KLL A;  3GIJ A;  2ZTD A;  4BWM A;  2ISP A;  2FMP A;  4B9L A;  5CHG A;  4JWM A;  4KMU A;  7ICK A;  3UQ2 A;  4J9N A;  1XU4 A;  5KFF A;  3V6J A;  8ICY A;  4TUS A;  9ICJ A;  5DG7 A;  1TVA A;  4B9T A;  1QSY A;  2M9N A;  5KFJ A;  5KFN A;  4R8U B;  2FMS A;  5KG3 A;  5J2C A;  4I2C A;  4DQS A;  4K4I A;  4O0I A;  5D4B A;  4I29 A;  3IM1 A;  3GQC A;  4KLM A;  3C1Y A;  4XA5 A;  9ICA A;  2HHV A;  4O3Q A;  4UAZ A;  2UVU A;  1X9M A;  1NK5 A;  2ZJ8 A;  4DL2 A;  1NJY A;  4FS1 A;  2KZZ A;  3C2M A;  3ZD9 A;  4QZI A;  3OSN A;  4IRK A;  3AU2 A;  5KFM A;  2DPJ A;  1UT8 A;  4F4Y A;  3TFS A;  5KG6 A;  4Q43 A;  3FDS A;  4Z6F A;  3JPP A;  8ICT A;  1KLN A;  4DLE A;  4QZH A;  3RAQ A;  5L1L A;  4JK1 A;  2W9C A;  4YR2 A;  3M9O B;  5C5J A;  3C1Z A;  4DFJ A;  9ICT A;  2HVI A;  2NRX A;  5CWR A;  3Q8M A;  4XQ8 A;  1D8Y A;  5IIJ A;  5KFC A;  4DWI A;  4DSJ A;  1S76 D;  5KFD A;  4I2F A;  5DQI A;  3RJG A;  2HHS A;  4QWA A;  2F1H A;  2JEG A;  5HHH A;  5DG9 A;  5BOL A;  3GII A;  5DLF A;  2VA8 A;  3ISD A;  3PO4 A;  1XSP A;  4NM1 A;  4QZF A;  2W9B A;  4DL5 A;  3PX0 A;  1S0O A;  4PGQ A;  4ECU A;  9ICQ A;  3BQ0 A;  4R8U A;  5DBB A;  3H4D A;  1S0N A;  3ORY A;  4YN4 A;  3ETL A;  7ICJ A;  1ZQL A;  9ICV A;  4F2S A;  9ICL A;  4M9N A;  5IIL A;  1MQ3 A;  1TKD A;  3TFR A;  4QWD A;  3PV8 A;  4KLD A;  2V4R A;  3RB0 A;  4QZB A;  4KLH A;  2FPK A;  4O5E A;  1U4B A;  2J6U A;  3PW0 A;  3GV8 B;  4KLS A;  9ICX A;  5DQG A;  4F93 B;  2KFN A;  8ICI A;  3MDA A;  4XUS A;  2FLP A;  1NK7 A;  3EYZ A;  4JV2 A;  4UB3 A;  3EPG A;  4QZ8 A;  3Q8S B;  2AU0 A;  8ICM A;  1UA0 A;  4DL4 A;  4I2B A;  4J9Q A;  4KLG A;  2XC9 A;  5KFP A;  2PI4 A;  4M9H A;  1LV5 A;  3GV5 B;  3B0X A;  2XO7 A;  5KFX A;  3AU6 A;  1ZQQ A;  3GIK A;  2KTQ A;  2UVR A;  1Y88 A;  4MFA A;  2IA6 A;  4G3I A;  3PW5 A;  5J0P A;  4ED8 A;  5IIN A;  1SL0 A;  4O3S A;  4RUC A;  5BOM A;  3RBD A;  3MBY A;  3K75 D;  4MFF A;  4IR1 A;  2BPG A;  3PW7 A;  5DB7 A;  3HWT A;  2ASL A;  1NKE A;  4DF4 A;  2ZTC A;  4C8N A;  1U45 A;  4M9G A;  2ATL A;  1ZQJ A;  7ICG A;  4RQ1 A;  3OJS A;  3PX4 A;  4DQQ A;  1HJP A;  4QW9 A;  2BCV A;  3PR5 B;  4DO9 A;  5KG2 A;  2BR0 A;  2BCS A;  3ZDD A;  3QE9 Y;  7ICV A;  2IMW P;  7ICQ A;  2BDP A;  4ELT A;  3ISC A;  1S0M A;  2PI5 A;  3TQ1 A;  1NOM A;  1NJX A;  4I28 A;  4PH5 A;  2P6R A;  4KTQ A;  2W9A A;  3V7L A;  3HP6 A;  3EZ5 A;  1JX4 A;  4DSF A;  2KN7 A;  3GDX A;  4IQW A;  5DB9 A;  3RJK A;  3JPO A;  9ICR A;  4DL6 A;  1PZN A;  2XCP A;  4KIT B;  5J0R A;  4B9M A;  9ICH A;  3AUO A;  5CJ7 A;  2AQ4 A;  5L1K A;  5KG1 A;  4HYK A;  1A77 A;  4EZ6 A;  1U48 A;  8ICB A;  2HHT A;  4JV0 A;  3TAP A;  4DF8 A;  4B9N A;  2ZUB A;  4TUP A;  1NK4 A;  4KLO A;  3OJU A;  2UVW A;  2IBK A;  3ZDE A;  2HHU A;  3UXO A;  1ZQI A;  1BPY A;  2W9C B;  3ZDB A;  1BPE A;  4MFC A;  3GIM A;  2XGQ A;  4C8L A;  1ZQE A;  4F4K A;  4FO6 A;  1ZQX A;  4TUQ A;  4F5Q A;  5HHI A;  4DL7 A;  1SKW A;  3G6Y A;  1ZQO A;  3C2L A;  3UPQ A;  1BGX T;  2I9G A;  3ISB A;  3GV7 B;  4EBE A;  2C2D A;  4RQ2 A;  7ICT A;  5J0Y A;  1ZQV A;  3Q8Q B;  4I2J A;  4MEY A;  4R63 A;  1T8E A;  4M47 A;  2J6S A;  4MEX A;  3BJY A;  2R8H A;  1DOQ A;  3OSP A;  5IIK A;  3MR5 A;  4P2H A;  4RQ3 A;  4YMN A;  5KFK A;  1U49 A;  4UB2 A;  5J2E A;  3HW8 A;  5KFT A;  5J29 A;  2W9B B;  4ECZ A;  3V6K A;  2ISO A;  2AGP A;  2ASJ A;  3MGH A;  2IHM A;  4M2Y A;  2F1I A;  4MF8 A;  3QZ7 A;  5J0X A;  1BVS A;  2BQU A;  2XCA A;  4Q44 A;  1KRP A;  2NRV A;  3KTQ A;  8ICE A;  4ED2 A;  2Y1J A;  3KHG A;  2BQR A;  1S97 A;  8ICV A;  2XY7 A;  4NLN A;  5IIM A;  4J9L A;  3Q8R B;  3MGI A;  4KLT A;  4M9J A;  3RTV A;  9ICM A;  4O9M A;  3LDA A;  4Q8E A;  2ASD A;  5DQH A;  8ICF A;  7ICS A;  1ZQB A;  3PY8 A;  1TK5 A;  4EYI B;  8ICO A;  1ZJM A;  4DS5 A;  9ICC A;  2V9W A;  2W9M A;  4LZD A;  2P6U A;  3H4B A;  1QTM A;  2OWO A;  3MDC A;  4C8O A;  5DB6 A;  4I2D A;  1XS9 D;  4DFM A;  4R66 A;  1UT5 A;  5F9N A;  3RRH A;  4KLF A;  4TQR A;  1ZQK A;  9ICO A;  4DQR A;  5KFO A;  3RR8 A;  2RDI A;  4EBD A;  5DG8 A;  4YMO A;  5D49 A;  8ICX A;  4P4O A;  3C5G A;  5KFU A;  4IRD A;  4PPX A;  2A1J A;  5HML A;  3M9M B;  4F4X A;  4R65 A;  1B43 A;  1N48 A;  1HUO A;  8ICJ A;  1S77 D;  5J0Q A;  1L3U A;  2J6T A;  2FPM A;  5III A;  4RPZ A;  4ELU A;  4NLK A;  4YQW A;  3B0Y A;  3OGU A;  1ZQG A;  3BQT A;  3LWM A;  4F50 A;  1SKR A;  1CEZ A;  4RT2 A;  3Q8K A;  4KLE A;  8ICR A;  3E2E A;  1BPB A;  2F1J A;  1XO1 A;  4PHP A;  1T7P A;  1S10 A;  7ICP A;  1RYR A;  2HVH A;  3H7I A;  5KFI A;  4ECS A;  2ZJ5 A;  4RQ4 A;  3V72 A;  4UAY A;  2VAN A;  4DLG A;  1JMS A;  4J9P A;  2BGW A;  7ICL A;  5KT5 A;  3H40 A;  5HP4 A;  5L1J A;  3SV4 A;  3MFI A;  3TI0 A;  5J2F A;  3MR2 A;  5KFG A;  5CP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...