1WCNA

Nmr structure of the carboxyterminal domains of escherichia coli nusa
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The E. Coli Nusa Carboxy-Terminal Domains are Structurally Similar and Show Specific Rnap- and Lambdan Interactions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
molecule keywords TRANSCRIPTION ELONGATION PROTEIN NUSA
total genus 19
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1wcnA01
4BXOA 3MR6A 3Q8SB 4XUSA 4PHPA 1BPZA 4NY8A 3Q8RB 3JPPA 1HJPA 1XU4A 3OHAA 2ISPA 4FBUA 5KFGA 5DKWA 3SV3A 1KTQA 4IQUA 2XY7A 4QWDA 3Q8LA 4NLGA 2ZJ8A 2RDIA 5KFKA 4F8RA 2ZJAA 3M9MB 7ICSA 1WCNA 5KFQA 3H4DA 4DOAA 5CR0A 2HHVA 1X9MA 4ED8A 8ICVA 2FPMA 5J0YA 4J9RA 3PX6A 4GC6A 1S0MA 4YQWA 4NM2A 1RXWA 4Z6DA 4I2IA 1XSPA 1U48A 1TAQA 4HYKA 1N48A 3ZDCA 3UPQA 1ZQZA 1L3UA 1T4GA 1U45A 4I2EA 3HWTA 4J9PA 1SL1A 3N4MB 9ICNA 9ICHA 8ICEA 5F9NA 1RYRA 3RR7A 4I2AA 4M0AA 5J0QA 4DQIA 4NLKA 4ED6A 2IHNA 3UXPA 4DQPA 1QSLA 4M47A 3RH4A 2PFNA 4P4PA 1JMSA 9ICSA 8ICFA 4QZDA 4ELTA 3N97B 2F1IA 5KFVA 2I9GA 4K4IA 5KFPA 2BCQA 3GV5B 3V7LA 3MGIA 2ASDA 2RDJA 1NK4A 3E2EA 1S0VA 4KMUA 2AGOA 4R8UB 3MABA 1ZQBA 1ZETA 1DGSA 1D8YA 8ICBA 4F92B 5KT2A 3GDXA 4F5QA 3TANA 1NK8A 9ICEA 3T5JA 4M04A 4R8UA 1ZQYA 5CP2A 3ZD8A 1LB2B 4E0DA 5L1LA 5DGBA 2BCVA 4TQSA 3G6VA 3BQ1A 3PW4A 4NM1A 4Z6FA 4KLGA 5KG2A 1L3TA 3RRGA 4RQ8A 4ELVA 1JIHA 4Z6CA 4FO6A 7ICGA 3C23A 1CUKA 1NOMA 4EBDA 1D9DA 5KFDA 4FS1A 8ICQA 5KG3A 3ZD9A 4YR2A 4M9LA 7ICRA 4ECXA 2C2DA 2DPJA 4F2RA 4Z6EA 5KFMA 1NKBA 1L5UA 2V4RA 5DQGA 2ASLA 2ZUDA 1D8LA 4KLOA 3GV8B 9ICWA 2HHUA 4DSLA 4RT2A 2NRTA 2W9MA 5HHHA 2XCPA 3EYZA 4IR9A 7ICMA 3K4GA 3SZ2A 4XRHA 9ICAA 3RTVA 3RJIA 2W9BB 4KN4A 4YG2A 1TFRA 4QZCA 5KG0A 5KFHA 3SV4A 3OJUA 1KFDA 3QEAZ 1ZJMA 1UA1A 4B9LA 4YP3A 5IIIA 2W9CA 3FYHA 1SZPA 3C2KA 4QWCA 4F5PA 3PW0A 5J29A 1L3SA 3BQ0A 4RQ2A 5HMLA 3RJKA 4JK1A 1KDHA 5KFSA 5CA7A 2C2EA 4KLHA 2A1JB 5KT4A 3MDAA 2P66A 2ZTDA 8ICMA 3PMLA 5DLFA 4R66A 4DFKA 2BQ3A 4B9MA 3RB0A 1ZQAA 1T7PA 1ZQFA 1ZQXA 5DLGA 3HW8A 1V9PA 1QTMA 7ICJA 8ICTA 3RAXA 4F93B 2LYHA 4GXKA 3V7JA 4C8NA 2VA2A 3PY8A 3C1YA 4DL3A 5KTQA 5J0UA 4FS2A 4BDPA 3H8JA 5CB1A 3RR8A 5J2AA 2XO7A 3GILA 4C8LA 5HP4A 5KFBA 3EWAA 4QZHA 3HT3A 1ZQRA 3C2MA 2PFQA 4YFKA 1T3NA 4DOBA 2JEJA 4MFCA 2MUTA 3FDSA 5KFWA 3PW5A 2XCAA 4RQ5A 3C5GA 1XO1A 2PFPA 8ICKA 7ICVA 4F2SA 4RNNA 4TUSA 1JXEA 5J2IA 4KLQA 2KZMA 2NRVA 4YN4A 2C2RA 3RJGA 4YR0A 3V6HA 1MSWD 2A1JA 4RPYA 1Z00B 2B21A 3MFIA 4P2HA 4F5NA 3RB6A 2KN7A 5HNKA 4RNOA 1JN3A 2ISOA 1S10A 2Q0ZX 1UA0A 5L1IA 1X9WA 2PI5A 4QWBA 1KFTA 1XC9A 9ICXA 1A76A 5KG6A 5J0XA 1MC8A 4O3NA 2W9CB 4M6WB 3C21A 5DB6A 2Y1IA 4O5KA 4MEYA 2HHWA 4BWMA 3T5LA 2IHMA 5J2CA 1TK5A 4B9SA 1K1SA 4NXZA 4R64A 5KFTA 2R8IA 4O3SA 4J9MA 1EXNA 4QZ9A 3PX0A 3RAQA 2ZUBA 3C1ZA 3Q8PB 5EWEA 3H40A 4J9KA 4EBCA 4I2DA 4GC7A 4DS4A 5J0WA 1SKSA 4MEXA 3H8WA 1ZQHA 7ICLA 1COOA 4C8OA 9ICIA 3IHQB 1Y88A 4YMMA 4Q44A 5BOLA 1X9SA 1HUOA 2BQUA 1U4BA 1ZYQA 9ICRA 4IQTA 1X2IA 1NK0A 3NGDA 4KLEA 4DQRA 7ICEA 9ICTA 3PW7A 2C22A 4J9NA 4DFPA 4UB4A 4IQVA 3PR4A 4F50A 8ICHA 1NK9A 2VA3A 2W8KA 2KTQA 1ZQEA 3G6XA 4DF8A 5JUMA 1DOQA 5DQHA 1U49A 2ZTCA 1NJXA 3Q8QB 3GIJA 3UQ2A 1KLNA 5KT7A 2HW3A 3BJYA 9ICCA 4UAWA 3TI0A 1S9FA 4G3IA 4YVZA 4F4XA 3Q8KA 4P4MA 4F4KA 4EZ9A 2F1JA 5DB9A 4DWIA 4I29A 3T5KA 4IR1A 3MR3A 4MFAA 7ICTA 4ECYA 3ZDBA 4B9NA 8ICXA 3M9NB 4ECQA 2R8GA 5EOZA 2XC9A 3SI8A 1ZQMA 4DQSA 4I2JA 1TV9A 3RJHA 2KZ3A 5KFOA 5L1JA 4F5OA 2UVRA 8ICAA 4UB2A 4K4GA 3RH5A 2AQ0A 1U9LA 1TK0A 4XA5A 8ICRA 3PR5B 2HVHA 1PZNA 3MGHA 4LZGA 1H38A 9ICKA 4F5RA 3TFRA 4UB5A 5HHIA 5C5JA 2NRXA 5J2GA 2W8LA 2MAXA 4RQ1A 4F4ZA 5J0OA 3SYZA 3PO5A 4QZGA 4ED3A 5KG5A 4ELUA 2P6UA 4ECZA 2F1HA 3MDCA 2UVVA 3ISDA 4F4WA 1B43A 5J0PA 1TK8A 5KFIA 7ICOA 3OGUA 5F9LA 1ZQQA 1NKCA 2R8HA 4PHAA 2M9NA 4QWEA 9ICGA 3QE9Y 4YD1A 5DG9A 3V6KA 2Y1JA 5IIMA 4ED0A 3PX4A 8ICJA 1BGXT 2DFLA 3HPOA 3RBDA 2VANA 4MFFA 2HVIA 1D9FA 3QEBZ 2BR0A 1RZTA 5DB8A 3OSNA 2HHTA 9ICLA 5KT3A 3GFKB 4KLUA 2ALZA 8ICIA 2W9AA 1N56A 4KLMA 4B9VA 2ATLA 1S0NA 1S0OA 4UQGA 1QLNA 7ICKA 4RQ6A 3Q8MA 1XSNA 1ZQOA 2ZUCA 3ETLA 5DBBA 9ICMA 9ICBA 5HMMA 1HUZA 4UAYA 1ZQUA 2ZTEA 4IQWA 3M8SA 1ZQIA 3ZDDA 5CJ7A 4PGXA 3LWMA 1ZQNA 4I2BA 5EWFA 1A77A 4C8KA 1KSPA 4DFMA 4MF2A 4YXJA 2OWOA 1XS9D 3NTUA 2BCSA 1RYSA 7ICUA 4YXMA 2XY6A 3TAQA 8ICYA 5DG8A 4F91B 3MBYA 3GQCA 1ZJNA 5J2KA 1IM4A 1RPLA 4GXIA 4PHEA 3LWLA 4DSEA 1ZQCA 3TARA 1T8EA 4DL4A 4J9SA 4YD2A 1KFSA 5KFYA 4JV0A 3ZDAA 4DOCA 3IM1A 4DSFA 4DF4A 5L1KA 1UT8A 3OJSA 4QZEA 4RQ0A 4BGDA 4DL6A 1KEJA 4KLJA 4DL2A 4QZIA 4RZRA 3PMNA 4EBEA 5KFJA 4UBBA 5DB7A 3EPGA 4J9LA 2HHQA 2FMQA 8ICGA 2FPKA 4DFJA 5KFUA 4DL7A 5D4BA 5IINA 8ICZA 3GIIA 4YMNA 5KFFA 3PNCA 2AGPA 9ICQA 4RUAA 1ZQLA 2J6SA 3TFSA 2J6TA 3B0XA 4RPXA 4O0IA 4J9OA 3TQ1A 4NLZA 4UAZA 5DDMA 5DDYA 3M8RA 1SKRA 8ICLA 3RH6A 8ICNA 4TUPA 4PHDA 4RNMA 3C2LA 2GWSA 4O5CA 7ICPA 4JUZA 3H8SA 4DSJA 5DQIA 4FBTA 4R63A 4KN7A 4KTQA 5IIKA 4DS5A 3RJFA 4DSIA 4PPXA 1S77D 4O9MA 5J2BA 4C8MA 4KLLA 1B22A 2KFNA 5D49A 5KG1A 4ED7A 3OSPA 1BPBA 1ZQPA 4O5EA 3ORYA 5TZVA 3RB3A 2H5XA 4YMOA 4O3OA 5EWGA 3AUOA 1K1QA 2NRZA 1MQ3A 2V9WA 4EEYA 3LK9A 4O3RA 4EYHB 1Z3EB 4M9GA 8ICOA 4M6WA 5L9XA 2AGQA 1ZQKA 4ECTA 4P4OA 3K75D 1NK7A 5KFEA 4ECRA 2C28A 4ECVA 3RJEA 4UBCA 3V6JA 4I2GA 3QZ7A 5J2EA 3PVXA 3JPSA 2UVUA 2BHNA 4RPZA 4XQ8A 4DO9A 2FLNA 2FPLA 2JEGA 4JWNA 4KLDA 5J2FA 5IILA 4TUQA 3MR2A 4B9UA 3C5FA 3JPQA 4RUCA 4QWAA 4Q43A 4RQ4A 3HX0A 3ISBA 2ASJA 2ZJ5A 1WCLA 5KFXA 4BXOB 7ICIA 3M9OB 5DBAA 2IA6A 5J2JA 2MUTB 3PW2A 4ZH4A 8ICSA 1TVAA 5CHGA 2FMSA 1QSYA 4QW8A 2UVWA 4EZ6A 4RQ3A 5J0SA 2R8KA 4UB1A 4I2FA 7ICNA 4F4YA 5DG7A 4IRDA 5KG7A 4DLEA 1NJWA 1NKEA 4F3OA 5IIOA 9ICJA 4KITB 5KT5A 2FLLA 3KTQA 2XGQA 7ICFA 2AQ4A 3JPOA 2XGPA 9ICOA 2J6UA 4K4HA 1RXVA 4M9NA 2BPCA 3MR5A 5J2DA 1ZQVA 4J9QA 1SKWA 4M9HA 1ZQTA 2JZBA 2KFZA 4ECWA 1ZQDA 4YCXA 4DL5A 5IIJA 2I1QA 2XY5A 4RU9A 4BWJA 4ECUA 4M9JA 3UQ0A 2BDPA 2VA8A 4O3QA 3KHHA 4Q45A 4GLXA 3T3FA 2HHSA 4QW9A 3B0YA 5KFRA 1JX4A 3KHRA 1TAUA 8ICPA 3EPIA 4KLFA 3AU2A 1JXLA 4I2CA 4TURA 3AU6A 1NJYA 5CWRA 8ICWA 3OHBA 2W9BA 3PV8A 4I2HA 4LVSA 4KLSA 9ICUA 4Q8EA 3PO4A 4ED2A 1BPDA 1IXRA 2AU0A 4KLTA 2JEIA 4M2YA 4I27A 8ICUA 1KRPA 2BKEA 3LDAA 4TQRA 3RBEA 2NRWA 1NK5A 4JV1A 3BQ2A 4RT3A 2DPIA 1S76D 1MQ2A 2BGWA 2BPFA 2IMWP 1BPEA 5KFZA 1BPXA 5J0TA 3MFHA 4ED1A 3BDPA 1CEZA 3THVA 8ICCA 5BPCA 7ICHA 3T5HA 3UXNA 3H7IA 3GV7B 1S97A 3GIMA 1BVSA 4YR3A 4GXJA 5J2HA 1C7YA 1NJZA 2BCUA 4RQ7A 5KFLA 4QZ8A 5BOMA 3TAPA 3RB4A 1ZQGA 4IRKA 9ICFA 4PGQA 1SL0A 5D46A 4NLNA 3JPRA 4JV2A 4DEZA 3EZ5A 3JPNA 2BQRA 1ZQJA 3KHLA 1ZQWA 2IBKA 2PXIA 1TKDA 1LV5A 3V72A 4PGYA 3JPTA 3KHGA 5J0RA 4QZFA 1Z00A 4DQQA 1AROP 1XWLA 4LZDA 2JZBB 4PH5A 3GIKA 4EYIB 1L3VA 1BPYA 2R8JA 4R65A 1XSLA 2FMPA 4Q8FA 4DLGA 2AJQA 1ZQSA 4KLIA 2KZZA 4X5VA 2PFOA 4B9TA 2PI4A 3ZDEA 1NK6A 2JEFA 4O3PA 2V4QA 3BQTA 3G6YA 9ICVA 7ICQA 3RRHA 4JWMA 2HHXA 2P6RA 4IRCA 5DBCA 4MF8A 4ECSA 4QZBA 1UT5A 3UXOA 3HP6A 3ISCA 3V7KA 1QSSA 3RJJA 1SL2A 4CCHA 4I28A 5KFNA 9ICPA 5KT6A 4QZAA 2WTFA 2FLPA 5KFAA 5KFCA 2BPGA 3EW9A 4DSKA 3QZ8A 5DGAA 4UB3A 2BCRA 5KG4A 1U47A 3H4BA
chains in the Genus database with same CATH superfamily
2VJ4A 4XUSA 1XU4A 2ISPA 4FBUA 1KTQA 4IQUA 4NLGA 1N62A 2RDIA 8ICVA 2FPMA 3LVWA 3PX6A 1UCVA 4AYBC 1RXWA 4A8EA 5AK3A 1XSPA 1JALA 3R9KA 4HYKA 1Q3UA 1MA7A 1U45A 4I2EA 4J9PA 3N4MB 9ICHA 1Q8KA 8ICEA 1RYRA 4M0AA 2KKPA 5J0QA 4ED6A 2IHNA 1QSLA 2KKVA 2O6KA 4P4PA 4CNQA 4ELTA 4K4IA 4UB6U 4UARA 1DGSA 4F92B 4Y2PA 3GDXA 4F5QA 9ICEA 2PMZC 1ZQYA 1LB2B 5L1LA 4ZOHC 1V97A 4ELVA 1NOMA 4EBDA 1D9DA 3QNMA 4IC9A 5KG3A 3IDWA 1URJA 2E8MA 1L5UA 1J2MA 2ZUDA 5H2FU 4KLOA 3N28A 5ALWA 2HOIA 2DBYA 2MSNA 4RT2A 2W9MA 5HHHA 3EYZA 7ICMA 5KL1B 1SV0A 2W9BB 1KFDA 4YP3A 3BQ7A 3AEVA 3J81j 2KHQA 1WG8A 5HMLA 3RJKA 5KT4A 8ICMA 3PMLA 5DLFA 4B9MA 2NV3A 1ZQAA 1T7PA 1ZQFA 4O3MA 3HW8A 2LYHA 2LYAA 3V7JA 2VA2A 5J0UA 4BDPA 3H8JA 3CRXA 5HP4A 4QZHA 2KSOB 5KL8B 3C2MA 2DWQA 4CF4A 2JEJA 4DOBA 1L7MA 2DKZA 4RQ5A 2PFPA 7ICVA 4TUSA 1JXEA 5J2IA 2KZMA 2C2RA 4YR0A 3V6HA 4RPYA 1Z00B 2KN7A 2OCEA 5HNKA 4RNOA 1S10A 1V85A 1UA0A 2F44A 5L1IA 2PI5A 3F2BA 1A76A 5KG6A 1MC8A 2EDUA 2W9CB 4M6WB 1UQVA 2VIXA 3PSFA 4BWMA 2QB0A 3T5LA 1TK5A 4B9SA 1K1SA 2DQNB 2JMGA 4O3SA 4J03A 3PX0A 3RAQA 3C1ZA 4EBCA 5EWEA 4MEXA 1B4FA 2G08A 1Y88A 2JH7A 1X9SA 1HUOA 1U4BA 3KZIU 4C4SA 9ICRA 2JV3A 3S6JA 1SXDA 3NGDA 9ICTA 4DFPA 1KW4A 2HBLA 3PR4A 1NK9A 1ZQEA 5JUMA 5DQHA 2EAPA 2W55A 2ZTCA 1LVHA 2HDOA 3H0LB 1NJXA 3UQ2A 9ICCA 5KNIA 1IIPA 4F4XA 2HOQA 1X66A 3H0MB 8ICXA 1NNLA 4ECYA 3M9NB 3SI8A 2R18A 3RJHA 4F5OA 5KFOA 2ES6A 2QB1A 4UB2A 3H0RB 3RH5A 1U9LA 2Z7JA 8ICRA 2HVHA 4LZGA 9ICKA 2W8LA 5AIBA 2KMDA 4ELUA 4ECZA 1SWWA 1WWVA 1QH9A 3ALRA 4PHAA 5AI9A 5IIMA 4ED0A 2W3SA 2ZIWA 8ICJA 3HPOA 3RBDA 2HHTA 3GFKB 4KLUA 2W9AA 1N61A 1QLNA 1XSNA 1FFVA 1ZQOA 3ETLA 5DBBA 2YMPA 4PGXA 3LWMA 2QLTA 3TAQA 3QUCA 1ZJNA 3GQCA 1IM4A 2LM1A 4PHEA 2KHVA 2YN4A 2F2AB 1UT8A 4DL6A 4KLJA 3NUQA 4DL2A 1N60A 1X9XA 3IN5A 2K4HA 2FMQA 2JXJA 5KFUA 4KMOB 4DL7A 5E79U 2E1EA 4RUAA 4OO1J 2J6SA 3B0XA 4AYBF 2LI6A 3RH6A 3C2LA 4R63A 3RJFA 4DSIA 4PZNA 4KLLA 1B22A 5KG1A 3OSPA 4O5EA 2HMXA 1MQ3A 1Z3EB 2YB4A 1ZQKA 4ECTA 1KQQA 3BS5B 4UBCA 3V6JA 1CRXA 4G9BA 5KAIU 3PVXA 4XQ8A 4DO9A 2E3TA 2JRZA 3C5FA 4PL1A 4RUCA 4Q43A 7ICIA 3M9OB 5DBAA 1PK1A 4F72A 4QW8A 4RQ3A 2HCFA 3PSIA 2AXTU 2K4IA 5DG7A 5KG7A 4DLEA 3SAGA 3D2NA 2XGQA 7ICFA 1RXVA 5FP0A 3TADA 5J2DA 2KFZA 4ECWA 2WAQC 4ACOA 1FEZA 5ALLA 2QKQA 3UQ0A 4O3QA 3KHHA 1ZXIA 2L5YA 4GIBA 1N2XA 5AKJA 4GLXA 4QW9A 3KKAC 3KHRA 5ALOA 3EPIA 1ZD2P 1JXLA 1NJYA 4I2HA 4LVSA 2LBOA 4ED2A 1BPDA 2AU0A 3GZFA 1M6YA 4P0PA 3L5KA 4RT3A 5AI4A 1S76D 5KAFU 1MQ2A 2BPFA 1BPEA 8ICCA 5BPCA 2F76X 2DKXA 3GIMA 1BVSA 1NJZA 2BCUA 5BOMA 5KFLA 4QZ8A 5AKIA 3TAPA 4PGQA 5D46A 2N1RA 4NLNA 2HI0A 3L3FX 1ZQWA 1TKDA 1LV5A 1F44A 4QZFA 1Z00A 4PH5A 2GO7A 1XSLA 3IG8A 4DLGA 2YMLA 4EX7A 1ZQSA 4B9TA 1ZQ1C 2JEFA 4O3PA 3BQTA 2K8AA 4QZBA 1QSSA 5ALMA 2AHOB 4FZNA 4I28A 9ICPA 5KT6A 2WTFA 1PVQA 4DSKA 1L7OA 2KVSA 2W43A 4C4RA 4UB3A 3SMVA 1O08A 3H4BA 3MR6A 5ALQA 3Q8RB 5AIAA 3WKDA 5JTIA 5AKEA 5KFGA 3SV3A 3B9JA 3QU7A 2KP7A 4F8RA 3M1YA 1WCNA 1Z1BA 5AM2A 1J2NA 2HHVA 1X9MA 2FE9A 4J9RA 4YQWA 3WKAA 3AL0B 5AI6A 4Z6DA 1U48A 1TAQA 4EEKA 1F5SA 5B5EU 1ZQZA 4I2AA 2XVTA 2I5HA 4DQIA 4C4TA 4DQPA 3D2SA 3UXPA 3RH4A 9ICSA 4NLCA 3N97B 2D8CA 2F1IA 5KFVA 2I9GA 5KFPA 3DV9A 3V7LA 2RDJA 2KJ8A 3E2EA 4KMUA 1ZQBA 1D8YA 8ICBA 2RP5A 2K4PA 3WKEA 2LPEA 2AH5A 2LKYA 5CP2A 4E0DA 4TQSA 4NM1A 5EE1A 4RQ8A 3RRGA 1JIHA 3QYPA 4Z6CA 4FO6A 1CUKA 4JMUA 4FS1A 3N7SC 5AKLA 1RQLA 2DPJA 1D8BA 4ICAA 1SIJA 2V4RA 1D8LA 3GV8B 4CE6A 2NRTA 2XCPA 3K4GA 4XRHA 3MC1A 4KN4A 2WF8A 4YG2A 1U47A 5KFHA 5KG0A 4B9LA 3BZKA 3QEAZ 2W9CA 3FYHA 3KZXA 3C2KA 4QWCA 4NV0A 1L3SA 5EE9A 1KDHA 2A1JB 3MDAA 2B6GA 2NO5A 4DFKA 3F2CA 1Z4OA 4Y2UA 1ZQXA 5DLGA 1P7DA 4GXKA 3PY8A 2KSOA 4FZLA 5J2AA 2XO7A 3EWAA 1ZQRA 1DK2A 2PFQA 4YFKA 1T3NA 2MUTA 4Y2YA 1XO1A 4F2SA 4RNNA 2HSZA 2NRVA 3PSPA 1JN3A 3N7RC 4QWBA 1KFTA 1XC9A 5J0XA 2EQYA 1BNPA 3C21A 2WB1F 4MEYA 2IHMA 4R64A 3LYSA 2IOHA 4J9MA 1EXNA 5ALPA 2JH1A 2HW3A 4J9KA 4GC7A 1COOA 4Q44A 2BQUA 2G0AA 5T14A 2QB0B 4IQVA 4OJLA 4F50A 3IV6A 3D6JA 3G6XA 4DF8A 1DOQA 1DRGA 1U49A 3Q8QB 1SB3C 3GIJA 3BJYA 4UAWA 1S9FA 2MU2A 4P4MA 4EZ9A 2F1JA 4DWIA 3MR3A 3ZDBA 3NVWA 2R8GA 1ZQMA 3F5AA 1TV9A 3D2QA 4NJ8A 2UVRA 4K4GA 2AQ0A 2YB1A 3PR5B 3WK8A 4F5RA 4UB5A 2NRXA 2MAXA 2W11A 3A0HU 4RQ1A 1ED1A 3PO5A 2KIVA 4F4WA 5AKZA 3SEIA 5KFIA 7ICOA 3OGUA 2R8HA 2RQ5A 2CXYA 3QE9Y 5DG9A 2ESEA 4B6JA 3CW2C 3AQEA 2ALZA 2W7PA 5AM1A 1S0OA 4MHVA 3LVVA 4RQ6A 1BNOA 5HMMA 2ZTEA 1ZQIA 3ZDDA 5EWFA 4C8KA 1KSPA 4Y2RA 4DFMA 4MF2A 4YXJA 2OWOA 5ALHA 2W03A 1RYSA 2XY6A 8ICYA 1N5WA 4F91B 5J2KA 1RPLA 2BPGA 4US9A 4DSEA 2XIDA 4DL4A 1T8EA 4DOCA 2LMRA 3IM1A 5L1KA 2LHTA 4QZEA 1KEJA 2XICA 4QIWF 2F8LA 8ICGA 2FPKA 2YTUA 1N5XA 3GIIA 5KFFA 1ZQLA 4RPXA 1NI3A 5DDYA 2Y9TA 4TUPA 4PHDA 4O5CA 2GWSA 4JUZA 4DSJA 4KN7A 4KTQA 4DS5A 1S77D 4O9MA 4C8MA 4ED7A 3ORYA 5TZVA 4YMOA 5EWGA 3UMBA 3BZCA 1K1QA 3C28A 4O3RA 1S5LU 4P4OA 2KE7A 4ECRA 4ECVA 3RJEA 4I2GA 4IS7A 3QZ7A 4QIWC 3KOOA 1ZRMA 2OYYA 4RPZA 2FPLA 4KLDA 5J2FA 3JPQA 4QWAA 3ISBA 1WCLA 4DCCA 2IA6A 5J2JA 3PW2A 1B0XA 4Y2XA 4I2FA 1VDVA 1SXEA 4F3OA 5IIOA 5KT5A 5ALDA 3DEEA 3JPOA 2AQ4A 2XGPA 5G5HA 4J9QA 4DL5A 2P35A 2D3DA 5IIJA 4ECUA 4BWJA 2BDPA 2VA8A 4Q45A 3QU9A 2Y0SF 3H8MA 3TKAA 5KFRA 1OXJA 4KLFA 3AU2A 4I2CA 3AU6A 2W9BA 3PV8A 2K8BB 5AM0A 4KLTA 1IXRA 1L8OA 1KBUA 2JEIA 1VJ5A 2BKEA 4CF5A 3BQ2A 2DPIA 2BGWA 5KFZA 3MFHA 4ED1A 5AM5A 2YQEA 3THVA 2KK0A 3T5HA 3GV7B 1S97A 4YR3A 5J2HA 3VCBA 1ZQGA 3MGVA 3NRZA 1ZRNA 2CN1A 2E8OA 3EUB2 1SL0A 3JPRA 4DEZA 1ZQJA 2G06A 1BPYA 4LZDA 4EYIB 1UPHA 2R8JA 4Q8FA 4X5VA 2JR5A 1OUQA 1HEKA 7ICQA 2VJ5A 5DBCA 4ECSA 1UT5A 3AM9A 1ZOLA 2FLPA 3VC8A 4P0QB 2BCRA 5KG4A 3Q8SB 4PHPA 1BPZA 4NY8A 1HJPA 3OHAA 3WKBA 1FFUA 4QWDA 5AICA 7ICSA 5KFQA 1OW5A 4DOAA 4ED8A 5TISU 4JB3A 4GC6A 1S0MA 4OD0A 4NM2A 1A0PA 5EE3A 1N48A 3ZDCA 1SL1A 5F9NA 1XO0A 1SGGA 4NLKA 2W04A 4EX6A 2E1FA 5AKXA 4QZDA 2JGAA 4BUGA 2WB1C 3E0FA 2OM6A 2BCQA 2ASDA 1YZ7A 1S0VA 4R8UB 3MABA 2NO4A 2QARB 5B66U 1NK8A 3T5JA 5ALGA 5ALNA 1L8LA 3G6VA 3BQ1A 3PW4A 4Z6FA 5KG2A 3WU2U 2ZIUA 4UATA 2A1AA 3WK5A 4CDGA 3ZD9A 4M9LA 2C2DA 4Z6EA 5KFMA 1NKBA 2ASLA 2OHFA 5K4LA 9ICWA 2HHUA 4DSLA 2KVCA 2DGZA 4US8A 1DK3A 5ALIA 9ICAA 3RTVA 4QZCA 1TFRA 3SV4A 5IIIA 3QXGA 3N7PD 4NLBA 4F5PA 3PW0A 5A0LA 3IP4B 5J29A 3BQ0A 5KFSA 1L7PA 5AI5A 2P66A 5AK6A 2ZTDA 4U6PA 3RB0A 7ICJA 3RAXA 4F93B 4C8NA 4RQNA 5KTQA 4FS2A 1RQNA 3OPXA 3GILA 4C8LA 2G5HB 1MN8A 4MFCA 3PW5A 3FDSA 5KFWA 2XCAA 3FM9A 8ICKA 2KICA 2E5SA 3QU4A 1MSWD 2A1JA 3MFIA 1PVPA 4P2HA 4F5NA 1HIWA 2Q0ZX 2RRDA 1X9WA 3QX7A 3NS1A 4O3NA 4NWIA 4O5KA 1A6SA 4NXZA 1LKYB 5KFTA 4QZ9A 5AKKA 3H40A 4I2DA 7ICLA 4P0PB 2A19A 9ICIA 3IRUA 2IOFK 1ZYQA 5ALZA 4KLEA 4DQRA 3SQIA 3PW7A 4J9NA 4UB4A 3U26A 1L7NA 2W8KA 2CRXA 5ALFA 5HR6A 5ALKA 5KT7A 3Q8KA 3M6ZA 3PZPA 4F4KA 5ALVA 2ODGA 3CP8A 7ICTA 4B9NA 5ALJA 2ZIXB 4UB8U 3K1ZA 8ICAA 2YX8A 1TK0A 1PZNA 3MGHA 1H38A 3TFRA 5HHIA 4F4ZA 5J0OA 3KD3A 4QZGA 4ED3A 5KG5A 5AKHA 4HAIA 1Z4NA 4OJOA 5J0PA 1TK8A 5F9LA 2CPRA 1ZQQA 2M9NA 2DF4B 9ICGA 4YD1A 3V6KA 1KKXA 2Y1JA 5L1MA 1BGXT 4MFFA 2VANA 4FZMA 2HVIA 1D9FA 1RZTA 3HRDD 5KT3A 1N56A 2W54A 4KLMA 4B9VA 1PUZA 4UQGA 1Q3VA 3ICXA 4CGZA 2ZUCA 9ICMA 9ICBA 1HUZA 4UAYA 3M8SA 2YMMA 1WUDA 1XS9D 1TE2A 4YXMA 5DG8A 3MBYA 2HHQA 3LWLA 5EE0A 3TARA 4J9SA 5KFYA 1JUDA 2M0NA 4DSFA 4DF4A 3OJSA 4Y2JA 2B0CA 4RQ0A 4BGDA 4CRXA 2BDUA 4EBEA 4UBBA 3EPGA 3KBBA 3SR6A 5CRXA 2K8CB 5IINA 8ICZA 3FC4A 2KOBA 3PNCA 9ICQA 2J6TA 4O0IA 5DDMA 3RF9A 4OJPA 1SKRA 8ICLA 8ICNA 3H8SA 4FBTA 4BX9C 1X42A 4PPXA 2KV2A 3ONNA 2KFNA 5D49A 1WWUA 1BPBA 4Y2VA 4NL9C 5AM3A 1IV8A 2NRZA 4QNLA 2V9WA 3LK9A 1AQ6A 4EYHB 5J8YA 8ICOA 2AGQA 2ZG6A 2C28A 5GTHU 2UVUA 2BHNA 2FLNA 3F2DA 5IILA 4TUQA 4B9UA 2K89A 4RQ4A 3SAFA 2ASJA 2MA1A 5AK4A 5KFXA 4BXOB 2Y0SC 2VKQA 2MUTB 3QU2A 4FFDA 3NVYA 3O0FA 4ZH4A 1QQ6A 2FMSA 2UVWA 5JU5A 4UB1A 3SAHA 4QJFB 2G07A 4F4YA 2XI9A 1NJWA 1NKEA 9ICJA 4KITB 2FLLA 3KTQA 5AKYA 9ICOA 4K4HA 1ZQVA 1SKWA 2JZBA 1ZQDA 4YCXA 5ALTA 4GFJA 2I1QA 2XY5A 4RU9A 4U7CA 4C80A 2Y9UA 2F3NA 3BS5A 3T3FA 2HHSA 1TAUA 4KLSA 9ICUA 4Q8EA 5ALUA 3BS7A 2GH1A 4M2YA 4I27A 8ICUA 1KRPA 3RBEA 2NRWA 2Q4TA 3QU5A 1LKYA 1CEZA 2H3IA 4GXJA 5ALXA 4IRKA 4USAA 3EZ5A 3JPNA 3KHLA 2IBKA 1X6JA 4PGYA 3AN1A 5ALSA 1ZD3A 4DQQA 2D6FC 9ICLA 2JZBB 1FO4A 2F8KA 4LJXA 3ED5A 4R65A 2H3VA 2A3VA 2KEYA 3OTQA 2PI4A 2V4QA 3G6YA 4C0ZA 3RRHA 4JWMA 2KJ9A 2KD1A 2PMZF 5AI0A 4MF8A 3ISCA 3V7KA 3I28A 5KFNA 5KFCA 3QZ8A 3F53A 5DGAA 2ZIVA 2LM4A 4BXOA 1F0MA 3JPPA 1NZBA 5DKWA 5HR7A 3UM9A 2FDRA 2XY7A 3Q8LA 2ZIWB 2H3FA 2ZJ8A 1UHUA 1DXSA 5KFKA 2ZJAA 3M9MB 3WK9A 3KKAA 3H4DA 2ZXIA 5CR0A 5J0YA 4NL9A 1FIQA 4I2IA 2WF7A 3UPQA 1L3UA 1T4GA 4EELA 3HWTA 2ZIVB 9ICNA 3RR7A 4M47A 2PFNA 4BJQA 1JMSA 8ICFA 4Y2SA 5ALRA 2ZIUB 5ALYA 2HOFA 4Y2TA 3FAHA 4F71A 3GV5B 3MGIA 1NK4A 2I6XA 2IOFA 2EANA 1PK3A 2AGOA 2JHDA 1PVRA 5F3XB 1QQ5A 1ZETA 5KT2A 3TANA 1Q46A 3NASA 4M04A 4R8UA 5G5GA 2LYBA 3ZD8A 5DGBA 2BCVA 3HILA 4KLGA 1Z1VA 1L3TA 7ICGA 3C23A 3I76A 5KFDA 1DGJA 8ICQA 4YR2A 7ICRA 4ECXA 2W7OA 3NVZA 4F2RA 5AHXA 4FE3A 5DQGA 2MRLA 1NZPA 4UW9A 4IR9A 5AKGA 3SZ2A 5AM4A 3RJIA 2KIWA 3UMCA 1WYGA 2FI1A 3DDHA 1UA1A 3OJUA 1ZJMA 3QUQA 1SZPA 2ZXHA 4Y2QA 5AK5A 5J8YC 2K60A 4RQ2A 1RDFA 4PL2A 4JK1A 5CA7A 2C2EA 1ZD4A 4KLHA 3M7DA 2NYVA 2OH2A 4R66A 2BQ3A 1QTMA 3TADC 1V9PA 8ICTA 2EZZA 3HJEA 3C1YA 3A0BU 4DL3A 1L6NA 5CB1A 3RR8A 2HBJA 5KFBA 3HT3A 3CNHA 3NVVA 2ZIXA 1PK1B 2WFAA 3C5GA 2EZYA 1S8OA 3AQFA 4KLQA 4YN4A 3RJGA 2WHEA 2B21A 3QUTA 3RB6A 4DFDA 2ISOA 2YY6A 4C7ZA 9ICXA 5DB6A 2Y1IA 1T3QA 2HHWA 5J2CA 2R8IA 2ZUBA 3Q8PB 4DS4A 1SKSA 1ZQHA 5J0WA 3H8WA 4C8OA 3IHQB 4YMMA 4RQMA 5BOLA 4OJ5A 2KNJA 3UMGA 2GOLA 4IQTA 1X2IA 1NK0A 1N63A 3F5EA 7ICEA 2C22A 4KX5A 8ICHA 2VA3A 4OCZA 2KTQA 2EAMA 3SENA 2F77X 1KLNA 2RLTA 3TI0A 2QARA 4G3IA 4YVZA 1IG6A 1SZHA 5DB9A 4I29A 3T5KA 4IR1A 4MFAA 4ECQA 5EOZA 2XC9A 4UASA 2E8NA 4DQSA 4I2JA 2KZ3A 1X6IA 1YZ6A 5L1JA 3QUBA 2BZFA 3I1YA 4XA5A 3WK4A 5JRTA 2KG5A 5C5JA 1QCKA 5J2GA 3GU3A 2H3ZA 3SYZA 2P6UA 2F1HA 1JROA 3MDCA 2UVVA 3ISDA 4IL6U 1B43A 1TAMA 4CF3A 1NKCA 5C0YA 1JRPA 4QWEA 2EH9A 2G09A 1RG6A 1YT3A 3PX4A 1RM6C 2DFLA 5AI8A 3QEBZ 2BR0A 5DB8A 3OSNA 8ICIA 2ATLA 1S0NA 1GO3F 1C20A 7ICKA 3RFAA 3Q8MA 2GLEA 2WF5A 3ZI4A 1ZQUA 4P0QA 4IQWA 5GTIU 5CJ7A 1KL9A 2H3QA 1ZQNA 4I2BA 1A77A 1ECWA 3NTUA 2BCSA 4WJ3B 7ICUA 4GXIA 4IRDA 1ZQCA 1KFSA 3HKZF 4YD2A 4JV0A 3ZDAA 3PSTA 1COKA 3WK7A 2OXOA 3L4PA 4QZIA 4AP9A 4RZRA 3PMNA 5KFJA 5DB7A 4J9LA 4DFJA 2RHFA 5D4BA 4YMNA 2AGPA 3C29A 3TFSA 4UAUA 2WF6A 4J9OA 3TQ1A 4NLZA 4UAZA 1SV0C 3M8RA 4RNMA 7ICPA 1RYUA 5DQIA 5IIKA 5J2BA 1ZQPA 4PZOA 3RB3A 2H5XA 3E58A 4O3OA 3AUOA 2HBKA 2DUYA 4EEYA 2G5IB 4KX3A 4M9GA 4M6WA 5L9XA 3K75D 1NK7A 2YMQA 3CYMA 5KFEA 4PJ0U 3WKCA 3K1RB 2EZXA 5J2EA 1VLBA 3JPSA 2JEGA 1QQ7A 1J97A 2WF9A 4JWNA 3MR2A 3HX0A 2ZJ5A 2K4EA 8ICSA 1TVAA 5CHGA 1QSYA 4EZ6A 5J0SA 2R8KA 2DL0A 7ICNA 2KJ5A 2J6UA 4M9NA 2BPCA 3MR5A 4M9HA 1ZQTA 4M9JA 4EENA 2PKEA 3HKZC 3B0YA 1JX4A 3TACB 1XNSA 8ICPA 4TURA 5CWRA 8ICWA 4C7YA 3OHBA 1SWVA 3PO4A 1SV4A 3LDAA 4UAVA 4TQRA 1NK5A 4JV1A 2FJ6A 2IMWP 1BPXA 3NRWA 5J0TA 1V38A 3BDPA 1JI7A 1CI4A 1Z19A 7ICHA 2WAQF 1O03A 3UXNA 1X40A 3H7IA 1C7YA 1KN5A 4RQ7A 3RB4A 3AMZA 9ICFA 4JV2A 2BQRA 5CEHA 2PXIA 3V72A 3IG5A 3JPTA 3KHGA 5J0RA 2HBMA 1AROP 1XWLA 1L3VA 3GIKA 3SD7A 3KFUF 1T94A 5ALEA 2OEHA 2FMPA 2AJQA 1ZD5A 4KLIA 2KZZA 2PFOA 3ZDEA 3T79A 1NK6A 9ICVA 3ETRA 2HHXA 2P6RA 4IRCA 3UXOA 1K5OA 2E8PA 3HP6A 3RJJA 3WK6A 1SL2A 4CCHA 2EAOA 4OJ6A 4QZAA 5KFAA 3EW9A 2W3RA 3M6KA
chains in the Genus database with same CATH topology
4BXOA 3MR6A 3Q8SB 4XUSA 4PHPA 1BPZA 4NY8A 3Q8RB 3JPPA 1HJPA 1XU4A 3OHAA 2ISPA 4FBUA 5KFGA 5DKWA 3SV3A 1KTQA 4IQUA 2XY7A 4QWDA 3Q8LA 4NLGA 2ZJ8A 2RDIA 5KFKA 4F8RA 2ZJAA 3M9MB 7ICSA 1WCNA 5KFQA 3H4DA 4DOAA 5CR0A 2HHVA 1X9MA 4ED8A 8ICVA 2FPMA 5J0YA 4J9RA 3PX6A 4GC6A 1S0MA 4YQWA 4NM2A 1RXWA 4Z6DA 4I2IA 1XSPA 1U48A 1TAQA 4HYKA 1N48A 3ZDCA 3UPQA 1ZQZA 1L3UA 1T4GA 1U45A 4I2EA 3HWTA 4J9PA 1SL1A 3N4MB 9ICNA 9ICHA 8ICEA 5F9NA 1RYRA 3RR7A 4I2AA 4M0AA 5J0QA 4DQIA 4NLKA 4ED6A 2IHNA 3UXPA 4DQPA 1QSLA 4M47A 3RH4A 2PFNA 4P4PA 1JMSA 9ICSA 8ICFA 4QZDA 4ELTA 3N97B 2F1IA 5KFVA 2I9GA 4K4IA 5KFPA 2BCQA 3GV5B 3V7LA 3MGIA 2ASDA 2RDJA 1NK4A 3E2EA 1S0VA 4KMUA 2AGOA 4R8UB 3MABA 1ZQBA 1ZETA 1DGSA 1D8YA 8ICBA 4F92B 5KT2A 3GDXA 4F5QA 3TANA 1NK8A 9ICEA 3T5JA 4M04A 4R8UA 1ZQYA 5CP2A 3ZD8A 1LB2B 4E0DA 5L1LA 5DGBA 2BCVA 4TQSA 3G6VA 3BQ1A 3PW4A 4NM1A 4Z6FA 4KLGA 5KG2A 1L3TA 3RRGA 4RQ8A 4ELVA 1JIHA 4Z6CA 4FO6A 7ICGA 3C23A 1CUKA 1NOMA 4EBDA 1D9DA 5KFDA 4FS1A 8ICQA 5KG3A 3ZD9A 4YR2A 4M9LA 7ICRA 4ECXA 2C2DA 2DPJA 4F2RA 4Z6EA 5KFMA 1NKBA 1L5UA 2V4RA 5DQGA 2ASLA 2ZUDA 1D8LA 4KLOA 3GV8B 9ICWA 2HHUA 4DSLA 4RT2A 2NRTA 2W9MA 5HHHA 2XCPA 3EYZA 4IR9A 7ICMA 3K4GA 3SZ2A 4XRHA 9ICAA 3RTVA 3RJIA 2W9BB 4KN4A 4YG2A 1TFRA 4QZCA 5KG0A 5KFHA 3SV4A 3OJUA 1KFDA 3QEAZ 1ZJMA 1UA1A 4B9LA 4YP3A 5IIIA 2W9CA 3FYHA 1SZPA 3C2KA 4QWCA 4F5PA 3PW0A 5J29A 1L3SA 3BQ0A 4RQ2A 5HMLA 3RJKA 4JK1A 1KDHA 5KFSA 5CA7A 2C2EA 4KLHA 2A1JB 5KT4A 3MDAA 2P66A 2ZTDA 8ICMA 3PMLA 5DLFA 4R66A 4DFKA 2BQ3A 4B9MA 3RB0A 1ZQAA 1T7PA 1ZQFA 1ZQXA 5DLGA 3HW8A 1V9PA 1QTMA 7ICJA 8ICTA 3RAXA 4F93B 2LYHA 4GXKA 3V7JA 4C8NA 2VA2A 3PY8A 3C1YA 4DL3A 5KTQA 5J0UA 4FS2A 4BDPA 3H8JA 5CB1A 3RR8A 5J2AA 2XO7A 3GILA 4C8LA 5HP4A 5KFBA 3EWAA 4QZHA 3HT3A 1ZQRA 3C2MA 2PFQA 4YFKA 1T3NA 4DOBA 2JEJA 4MFCA 2MUTA 3FDSA 5KFWA 3PW5A 2XCAA 4RQ5A 3C5GA 1XO1A 2PFPA 8ICKA 7ICVA 4F2SA 4RNNA 4TUSA 1JXEA 5J2IA 4KLQA 2KZMA 2NRVA 4YN4A 2C2RA 3RJGA 4YR0A 3V6HA 1MSWD 2A1JA 4RPYA 1Z00B 2B21A 3MFIA 4P2HA 4F5NA 3RB6A 2KN7A 5HNKA 4RNOA 1JN3A 2ISOA 1S10A 2Q0ZX 1UA0A 5L1IA 1X9WA 2PI5A 4QWBA 1KFTA 1XC9A 9ICXA 1A76A 5KG6A 5J0XA 1MC8A 4O3NA 2W9CB 4M6WB 3C21A 5DB6A 2Y1IA 4O5KA 4MEYA 2HHWA 4BWMA 3T5LA 2IHMA 5J2CA 1TK5A 4B9SA 1K1SA 4NXZA 4R64A 5KFTA 2R8IA 4O3SA 4J9MA 1EXNA 4QZ9A 3PX0A 3RAQA 2ZUBA 3C1ZA 3Q8PB 5EWEA 3H40A 4J9KA 4EBCA 4I2DA 4GC7A 4DS4A 5J0WA 1SKSA 4MEXA 3H8WA 1ZQHA 7ICLA 1COOA 4C8OA 9ICIA 3IHQB 1Y88A 4YMMA 4Q44A 5BOLA 1X9SA 1HUOA 2BQUA 1U4BA 1ZYQA 9ICRA 4IQTA 1X2IA 1NK0A 3NGDA 4KLEA 4DQRA 7ICEA 9ICTA 3PW7A 2C22A 4J9NA 4DFPA 4UB4A 4IQVA 3PR4A 4F50A 8ICHA 1NK9A 2VA3A 2W8KA 2KTQA 1ZQEA 3G6XA 4DF8A 5JUMA 1DOQA 5DQHA 1U49A 2ZTCA 1NJXA 3Q8QB 3GIJA 3UQ2A 1KLNA 5KT7A 2HW3A 3BJYA 9ICCA 4UAWA 3TI0A 1S9FA 4G3IA 4YVZA 4F4XA 3Q8KA 4P4MA 4F4KA 4EZ9A 2F1JA 5DB9A 4DWIA 4I29A 3T5KA 4IR1A 3MR3A 4MFAA 7ICTA 4ECYA 3ZDBA 4B9NA 8ICXA 3M9NB 4ECQA 2R8GA 5EOZA 2XC9A 3SI8A 1ZQMA 4DQSA 4I2JA 1TV9A 3RJHA 2KZ3A 5KFOA 5L1JA 4F5OA 2UVRA 8ICAA 4UB2A 4K4GA 3RH5A 2AQ0A 1U9LA 1TK0A 4XA5A 8ICRA 3PR5B 2HVHA 1PZNA 3MGHA 4LZGA 1H38A 9ICKA 4F5RA 3TFRA 4UB5A 5HHIA 5C5JA 2NRXA 5J2GA 2W8LA 2MAXA 4RQ1A 4F4ZA 5J0OA 3SYZA 3PO5A 4QZGA 4ED3A 5KG5A 4ELUA 2P6UA 4ECZA 2F1HA 3MDCA 2UVVA 3ISDA 4F4WA 1B43A 5J0PA 1TK8A 5KFIA 7ICOA 3OGUA 5F9LA 1ZQQA 1NKCA 2R8HA 4PHAA 2M9NA 4QWEA 9ICGA 3QE9Y 4YD1A 5DG9A 3V6KA 2Y1JA 5IIMA 4ED0A 3PX4A 8ICJA 1BGXT 2DFLA 3HPOA 3RBDA 2VANA 4MFFA 2HVIA 1D9FA 3QEBZ 2BR0A 1RZTA 5DB8A 3OSNA 2HHTA 9ICLA 5KT3A 3GFKB 4KLUA 2ALZA 8ICIA 2W9AA 1N56A 4KLMA 4B9VA 2ATLA 1S0NA 1S0OA 4UQGA 1QLNA 7ICKA 4RQ6A 3Q8MA 1XSNA 1ZQOA 2ZUCA 3ETLA 5DBBA 9ICMA 9ICBA 5HMMA 1HUZA 4UAYA 1ZQUA 2ZTEA 4IQWA 3M8SA 1ZQIA 3ZDDA 5CJ7A 4PGXA 3LWMA 1ZQNA 4I2BA 5EWFA 1A77A 4C8KA 1KSPA 4DFMA 4MF2A 4YXJA 2OWOA 1XS9D 3NTUA 2BCSA 1RYSA 7ICUA 4YXMA 2XY6A 3TAQA 8ICYA 5DG8A 4F91B 3MBYA 3GQCA 1ZJNA 5J2KA 1IM4A 1RPLA 4GXIA 4PHEA 3LWLA 4DSEA 1ZQCA 3TARA 1T8EA 4DL4A 4J9SA 4YD2A 1KFSA 5KFYA 4JV0A 3ZDAA 4DOCA 3IM1A 4DSFA 4DF4A 5L1KA 1UT8A 3OJSA 4QZEA 4RQ0A 4BGDA 4DL6A 1KEJA 4KLJA 4DL2A 4QZIA 4RZRA 3PMNA 4EBEA 5KFJA 4UBBA 5DB7A 3EPGA 4J9LA 2HHQA 2FMQA 8ICGA 2FPKA 4DFJA 5KFUA 4DL7A 5D4BA 5IINA 8ICZA 3GIIA 4YMNA 5KFFA 3PNCA 2AGPA 9ICQA 4RUAA 1ZQLA 2J6SA 3TFSA 2J6TA 3B0XA 4RPXA 4O0IA 4J9OA 3TQ1A 4NLZA 4UAZA 5DDMA 5DDYA 3M8RA 1SKRA 8ICLA 3RH6A 8ICNA 4TUPA 4PHDA 4RNMA 3C2LA 2GWSA 4O5CA 7ICPA 4JUZA 3H8SA 4DSJA 5DQIA 4FBTA 4R63A 4KN7A 4KTQA 5IIKA 4DS5A 3RJFA 4DSIA 4PPXA 1S77D 4O9MA 5J2BA 4C8MA 4KLLA 1B22A 2KFNA 5D49A 5KG1A 4ED7A 3OSPA 1BPBA 1ZQPA 4O5EA 3ORYA 5TZVA 3RB3A 2H5XA 4YMOA 4O3OA 5EWGA 3AUOA 1K1QA 2NRZA 1MQ3A 2V9WA 4EEYA 3LK9A 4O3RA 4EYHB 1Z3EB 4M9GA 8ICOA 4M6WA 5L9XA 2AGQA 1ZQKA 4ECTA 4P4OA 3K75D 1NK7A 5KFEA 4ECRA 2C28A 4ECVA 3RJEA 4UBCA 3V6JA 4I2GA 3QZ7A 5J2EA 3PVXA 3JPSA 2UVUA 2BHNA 4RPZA 4XQ8A 4DO9A 2FLNA 2FPLA 2JEGA 4JWNA 4KLDA 5J2FA 5IILA 4TUQA 3MR2A 4B9UA 3C5FA 3JPQA 4RUCA 4QWAA 4Q43A 4RQ4A 3HX0A 3ISBA 2ASJA 2ZJ5A 1WCLA 5KFXA 4BXOB 7ICIA 3M9OB 5DBAA 2IA6A 5J2JA 2MUTB 3PW2A 4ZH4A 8ICSA 1TVAA 5CHGA 2FMSA 1QSYA 4QW8A 2UVWA 4EZ6A 4RQ3A 5J0SA 2R8KA 4UB1A 4I2FA 7ICNA 4F4YA 5DG7A 4IRDA 5KG7A 4DLEA 1NJWA 1NKEA 4F3OA 5IIOA 9ICJA 4KITB 5KT5A 2FLLA 3KTQA 2XGQA 7ICFA 2AQ4A 3JPOA 2XGPA 9ICOA 2J6UA 4K4HA 1RXVA 4M9NA 2BPCA 3MR5A 5J2DA 1ZQVA 4J9QA 1SKWA 4M9HA 1ZQTA 2JZBA 2KFZA 4ECWA 1ZQDA 4YCXA 4DL5A 5IIJA 2I1QA 2XY5A 4RU9A 4BWJA 4ECUA 4M9JA 3UQ0A 2BDPA 2VA8A 4O3QA 3KHHA 4Q45A 4GLXA 3T3FA 2HHSA 4QW9A 3B0YA 5KFRA 1JX4A 3KHRA 1TAUA 8ICPA 3EPIA 4KLFA 3AU2A 1JXLA 4I2CA 4TURA 3AU6A 1NJYA 5CWRA 8ICWA 3OHBA 2W9BA 3PV8A 4I2HA 4LVSA 4KLSA 9ICUA 4Q8EA 3PO4A 4ED2A 1BPDA 1IXRA 2AU0A 4KLTA 2JEIA 4M2YA 4I27A 8ICUA 1KRPA 2BKEA 3LDAA 4TQRA 3RBEA 2NRWA 1NK5A 4JV1A 3BQ2A 4RT3A 2DPIA 1S76D 1MQ2A 2BGWA 2BPFA 2IMWP 1BPEA 5KFZA 1BPXA 5J0TA 3MFHA 4ED1A 3BDPA 1CEZA 3THVA 8ICCA 5BPCA 7ICHA 3T5HA 3UXNA 3H7IA 3GV7B 1S97A 3GIMA 1BVSA 4YR3A 4GXJA 5J2HA 1C7YA 1NJZA 2BCUA 4RQ7A 5KFLA 4QZ8A 5BOMA 3TAPA 3RB4A 1ZQGA 4IRKA 9ICFA 4PGQA 1SL0A 5D46A 4NLNA 3JPRA 4JV2A 4DEZA 3EZ5A 3JPNA 2BQRA 1ZQJA 3KHLA 1ZQWA 2IBKA 2PXIA 1TKDA 1LV5A 3V72A 4PGYA 3JPTA 3KHGA 5J0RA 4QZFA 1Z00A 4DQQA 1AROP 1XWLA 4LZDA 2JZBB 4PH5A 3GIKA 4EYIB 1L3VA 1BPYA 2R8JA 4R65A 1XSLA 2FMPA 4Q8FA 4DLGA 2AJQA 1ZQSA 4KLIA 2KZZA 4X5VA 2PFOA 4B9TA 2PI4A 3ZDEA 1NK6A 2JEFA 4O3PA 2V4QA 3BQTA 3G6YA 9ICVA 7ICQA 3RRHA 4JWMA 2HHXA 2P6RA 4IRCA 5DBCA 4MF8A 4ECSA 4QZBA 1UT5A 3UXOA 3HP6A 3ISCA 3V7KA 1QSSA 3RJJA 1SL2A 4CCHA 4I28A 5KFNA 9ICPA 5KT6A 4QZAA 2WTFA 2FLPA 5KFAA 5KFCA 2BPGA 3EW9A 4DSKA 3QZ8A 5DGAA 4UB3A 2BCRA 5KG4A 1U47A 3H4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXO A;  3MR6 A;  3Q8S B;  4XUS A;  4PHP A;  1BPZ A;  4NY8 A;  3Q8R B;  3JPP A;  1HJP A;  1XU4 A;  3OHA A;  2ISP A;  4FBU A;  5KFG A;  5DKW A;  3SV3 A;  1KTQ A;  4IQU A;  2XY7 A;  4QWD A;  3Q8L A;  4NLG A;  2ZJ8 A;  2RDI A;  5KFK A;  4F8R A;  2ZJA A;  3M9M B;  7ICS A;  1WCN A;  5KFQ A;  3H4D A;  4DOA A;  5CR0 A;  2HHV A;  1X9M A;  4ED8 A;  8ICV A;  2FPM A;  5J0Y A;  4J9R A;  3PX6 A;  4GC6 A;  1S0M A;  4YQW A;  4NM2 A;  1RXW A;  4Z6D A;  4I2I A;  1XSP A;  1U48 A;  1TAQ A;  4HYK A;  1N48 A;  3ZDC A;  3UPQ A;  1ZQZ A;  1L3U A;  1T4G A;  1U45 A;  4I2E A;  3HWT A;  4J9P A;  1SL1 A;  3N4M B;  9ICN A;  9ICH A;  8ICE A;  5F9N A;  1RYR A;  3RR7 A;  4I2A A;  4M0A A;  5J0Q A;  4DQI A;  4NLK A;  4ED6 A;  2IHN A;  3UXP A;  4DQP A;  1QSL A;  4M47 A;  3RH4 A;  2PFN A;  4P4P A;  1JMS A;  9ICS A;  8ICF A;  4QZD A;  4ELT A;  3N97 B;  2F1I A;  5KFV A;  2I9G A;  4K4I A;  5KFP A;  2BCQ A;  3GV5 B;  3V7L A;  3MGI A;  2ASD A;  2RDJ A;  1NK4 A;  3E2E A;  1S0V A;  4KMU A;  2AGO A;  4R8U B;  3MAB A;  1ZQB A;  1ZET A;  1DGS A;  1D8Y A;  8ICB A;  4F92 B;  5KT2 A;  3GDX A;  4F5Q A;  3TAN A;  1NK8 A;  9ICE A;  3T5J A;  4M04 A;  4R8U A;  1ZQY A;  5CP2 A;  3ZD8 A;  1LB2 B;  4E0D A;  5L1L A;  5DGB A;  2BCV A;  4TQS A;  3G6V A;  3BQ1 A;  3PW4 A;  4NM1 A;  4Z6F A;  4KLG A;  5KG2 A;  1L3T A;  3RRG A;  4RQ8 A;  4ELV A;  1JIH A;  4Z6C A;  4FO6 A;  7ICG A;  3C23 A;  1CUK A;  1NOM A;  4EBD A;  1D9D A;  5KFD A;  4FS1 A;  8ICQ A;  5KG3 A;  3ZD9 A;  4YR2 A;  4M9L A;  7ICR A;  4ECX A;  2C2D A;  2DPJ A;  4F2R A;  4Z6E A;  5KFM A;  1NKB A;  1L5U A;  2V4R A;  5DQG A;  2ASL A;  2ZUD A;  1D8L A;  4KLO A;  3GV8 B;  9ICW A;  2HHU A;  4DSL A;  4RT2 A;  2NRT A;  2W9M A;  5HHH A;  2XCP A;  3EYZ A;  4IR9 A;  7ICM A;  3K4G A;  3SZ2 A;  4XRH A;  9ICA A;  3RTV A;  3RJI A;  2W9B B;  4KN4 A;  4YG2 A;  1TFR A;  4QZC A;  5KG0 A;  5KFH A;  3SV4 A;  3OJU A;  1KFD A;  3QEA Z;  1ZJM A;  1UA1 A;  4B9L A;  4YP3 A;  5III A;  2W9C A;  3FYH A;  1SZP A;  3C2K A;  4QWC A;  4F5P A;  3PW0 A;  5J29 A;  1L3S A;  3BQ0 A;  4RQ2 A;  5HML A;  3RJK A;  4JK1 A;  1KDH A;  5KFS A;  5CA7 A;  2C2E A;  4KLH A;  2A1J B;  5KT4 A;  3MDA A;  2P66 A;  2ZTD A;  8ICM A;  3PML A;  5DLF A;  4R66 A;  4DFK A;  2BQ3 A;  4B9M A;  3RB0 A;  1ZQA A;  1T7P A;  1ZQF A;  1ZQX A;  5DLG A;  3HW8 A;  1V9P A;  1QTM A;  7ICJ A;  8ICT A;  3RAX A;  4F93 B;  2LYH A;  4GXK A;  3V7J A;  4C8N A;  2VA2 A;  3PY8 A;  3C1Y A;  4DL3 A;  5KTQ A;  5J0U A;  4FS2 A;  4BDP A;  3H8J A;  5CB1 A;  3RR8 A;  5J2A A;  2XO7 A;  3GIL A;  4C8L A;  5HP4 A;  5KFB A;  3EWA A;  4QZH A;  3HT3 A;  1ZQR A;  3C2M A;  2PFQ A;  4YFK A;  1T3N A;  4DOB A;  2JEJ A;  4MFC A;  2MUT A;  3FDS A;  5KFW A;  3PW5 A;  2XCA A;  4RQ5 A;  3C5G A;  1XO1 A;  2PFP A;  8ICK A;  7ICV A;  4F2S A;  4RNN A;  4TUS A;  1JXE A;  5J2I A;  4KLQ A;  2KZM A;  2NRV A;  4YN4 A;  2C2R A;  3RJG A;  4YR0 A;  3V6H A;  1MSW D;  2A1J A;  4RPY A;  1Z00 B;  2B21 A;  3MFI A;  4P2H A;  4F5N A;  3RB6 A;  2KN7 A;  5HNK A;  4RNO A;  1JN3 A;  2ISO A;  1S10 A;  2Q0Z X;  1UA0 A;  5L1I A;  1X9W A;  2PI5 A;  4QWB A;  1KFT A;  1XC9 A;  9ICX A;  1A76 A;  5KG6 A;  5J0X A;  1MC8 A;  4O3N A;  2W9C B;  4M6W B;  3C21 A;  5DB6 A;  2Y1I A;  4O5K A;  4MEY A;  2HHW A;  4BWM A;  3T5L A;  2IHM A;  5J2C A;  1TK5 A;  4B9S A;  1K1S A;  4NXZ A;  4R64 A;  5KFT A;  2R8I A;  4O3S A;  4J9M A;  1EXN A;  4QZ9 A;  3PX0 A;  3RAQ A;  2ZUB A;  3C1Z A;  3Q8P B;  5EWE A;  3H40 A;  4J9K A;  4EBC A;  4I2D A;  4GC7 A;  4DS4 A;  5J0W A;  1SKS A;  4MEX A;  3H8W A;  1ZQH A;  7ICL A;  1COO A;  4C8O A;  9ICI A;  3IHQ B;  1Y88 A;  4YMM A;  4Q44 A;  5BOL A;  1X9S A;  1HUO A;  2BQU A;  1U4B A;  1ZYQ A;  9ICR A;  4IQT A;  1X2I A;  1NK0 A;  3NGD A;  4KLE A;  4DQR A;  7ICE A;  9ICT A;  3PW7 A;  2C22 A;  4J9N A;  4DFP A;  4UB4 A;  4IQV A;  3PR4 A;  4F50 A;  8ICH A;  1NK9 A;  2VA3 A;  2W8K A;  2KTQ A;  1ZQE A;  3G6X A;  4DF8 A;  5JUM A;  1DOQ A;  5DQH A;  1U49 A;  2ZTC A;  1NJX A;  3Q8Q B;  3GIJ A;  3UQ2 A;  1KLN A;  5KT7 A;  2HW3 A;  3BJY A;  9ICC A;  4UAW A;  3TI0 A;  1S9F A;  4G3I A;  4YVZ A;  4F4X A;  3Q8K A;  4P4M A;  4F4K A;  4EZ9 A;  2F1J A;  5DB9 A;  4DWI A;  4I29 A;  3T5K A;  4IR1 A;  3MR3 A;  4MFA A;  7ICT A;  4ECY A;  3ZDB A;  4B9N A;  8ICX A;  3M9N B;  4ECQ A;  2R8G A;  5EOZ A;  2XC9 A;  3SI8 A;  1ZQM A;  4DQS A;  4I2J A;  1TV9 A;  3RJH A;  2KZ3 A;  5KFO A;  5L1J A;  4F5O A;  2UVR A;  8ICA A;  4UB2 A;  4K4G A;  3RH5 A;  2AQ0 A;  1U9L A;  1TK0 A;  4XA5 A;  8ICR A;  3PR5 B;  2HVH A;  1PZN A;  3MGH A;  4LZG A;  1H38 A;  9ICK A;  4F5R A;  3TFR A;  4UB5 A;  5HHI A;  5C5J A;  2NRX A;  5J2G A;  2W8L A;  2MAX A;  4RQ1 A;  4F4Z A;  5J0O A;  3SYZ A;  3PO5 A;  4QZG A;  4ED3 A;  5KG5 A;  4ELU A;  2P6U A;  4ECZ A;  2F1H A;  3MDC A;  2UVV A;  3ISD A;  4F4W A;  1B43 A;  5J0P A;  1TK8 A;  5KFI A;  7ICO A;  3OGU A;  5F9L A;  1ZQQ A;  1NKC A;  2R8H A;  4PHA A;  2M9N A;  4QWE A;  9ICG A;  3QE9 Y;  4YD1 A;  5DG9 A;  3V6K A;  2Y1J A;  5IIM A;  4ED0 A;  3PX4 A;  8ICJ A;  1BGX T;  2DFL A;  3HPO A;  3RBD A;  2VAN A;  4MFF A;  2HVI A;  1D9F A;  3QEB Z;  2BR0 A;  1RZT A;  5DB8 A;  3OSN A;  2HHT A;  9ICL A;  5KT3 A;  3GFK B;  4KLU A;  2ALZ A;  8ICI A;  2W9A A;  1N56 A;  4KLM A;  4B9V A;  2ATL A;  1S0N A;  1S0O A;  4UQG A;  1QLN A;  7ICK A;  4RQ6 A;  3Q8M A;  1XSN A;  1ZQO A;  2ZUC A;  3ETL A;  5DBB A;  9ICM A;  9ICB A;  5HMM A;  1HUZ A;  4UAY A;  1ZQU A;  2ZTE A;  4IQW A;  3M8S A;  1ZQI A;  3ZDD A;  5CJ7 A;  4PGX A;  3LWM A;  1ZQN A;  4I2B A;  5EWF A;  1A77 A;  4C8K A;  1KSP A;  4DFM A;  4MF2 A;  4YXJ A;  2OWO A;  1XS9 D;  3NTU A;  2BCS A;  1RYS A;  7ICU A;  4YXM A;  2XY6 A;  3TAQ A;  8ICY A;  5DG8 A;  4F91 B;  3MBY A;  3GQC A;  1ZJN A;  5J2K A;  1IM4 A;  1RPL A;  4GXI A;  4PHE A;  3LWL A;  4DSE A;  1ZQC A;  3TAR A;  1T8E A;  4DL4 A;  4J9S A;  4YD2 A;  1KFS A;  5KFY A;  4JV0 A;  3ZDA A;  4DOC A;  3IM1 A;  4DSF A;  4DF4 A;  5L1K A;  1UT8 A;  3OJS A;  4QZE A;  4RQ0 A;  4BGD A;  4DL6 A;  1KEJ A;  4KLJ A;  4DL2 A;  4QZI A;  4RZR A;  3PMN A;  4EBE A;  5KFJ A;  4UBB A;  5DB7 A;  3EPG A;  4J9L A;  2HHQ A;  2FMQ A;  8ICG A;  2FPK A;  4DFJ A;  5KFU A;  4DL7 A;  5D4B A;  5IIN A;  8ICZ A;  3GII A;  4YMN A;  5KFF A;  3PNC A;  2AGP A;  9ICQ A;  4RUA A;  1ZQL A;  2J6S A;  3TFS A;  2J6T A;  3B0X A;  4RPX A;  4O0I A;  4J9O A;  3TQ1 A;  4NLZ A;  4UAZ A;  5DDM A;  5DDY A;  3M8R A;  1SKR A;  8ICL A;  3RH6 A;  8ICN A;  4TUP A;  4PHD A;  4RNM A;  3C2L A;  2GWS A;  4O5C A;  7ICP A;  4JUZ A;  3H8S A;  4DSJ A;  5DQI A;  4FBT A;  4R63 A;  4KN7 A;  4KTQ A;  5IIK A;  4DS5 A;  3RJF A;  4DSI A;  4PPX A;  1S77 D;  4O9M A;  5J2B A;  4C8M A;  4KLL A;  1B22 A;  2KFN A;  5D49 A;  5KG1 A;  4ED7 A;  3OSP A;  1BPB A;  1ZQP A;  4O5E A;  3ORY A;  5TZV A;  3RB3 A;  2H5X A;  4YMO A;  4O3O A;  5EWG A;  3AUO A;  1K1Q A;  2NRZ A;  1MQ3 A;  2V9W A;  4EEY A;  3LK9 A;  4O3R A;  4EYH B;  1Z3E B;  4M9G A;  8ICO A;  4M6W A;  5L9X A;  2AGQ A;  1ZQK A;  4ECT A;  4P4O A;  3K75 D;  1NK7 A;  5KFE A;  4ECR A;  2C28 A;  4ECV A;  3RJE A;  4UBC A;  3V6J A;  4I2G A;  3QZ7 A;  5J2E A;  3PVX A;  3JPS A;  2UVU A;  2BHN A;  4RPZ A;  4XQ8 A;  4DO9 A;  2FLN A;  2FPL A;  2JEG A;  4JWN A;  4KLD A;  5J2F A;  5IIL A;  4TUQ A;  3MR2 A;  4B9U A;  3C5F A;  3JPQ A;  4RUC A;  4QWA A;  4Q43 A;  4RQ4 A;  3HX0 A;  3ISB A;  2ASJ A;  2ZJ5 A;  1WCL A;  5KFX A;  4BXO B;  7ICI A;  3M9O B;  5DBA A;  2IA6 A;  5J2J A;  2MUT B;  3PW2 A;  4ZH4 A;  8ICS A;  1TVA A;  5CHG A;  2FMS A;  1QSY A;  4QW8 A;  2UVW A;  4EZ6 A;  4RQ3 A;  5J0S A;  2R8K A;  4UB1 A;  4I2F A;  7ICN A;  4F4Y A;  5DG7 A;  4IRD A;  5KG7 A;  4DLE A;  1NJW A;  1NKE A;  4F3O A;  5IIO A;  9ICJ A;  4KIT B;  5KT5 A;  2FLL A;  3KTQ A;  2XGQ A;  7ICF A;  2AQ4 A;  3JPO A;  2XGP A;  9ICO A;  2J6U A;  4K4H A;  1RXV A;  4M9N A;  2BPC A;  3MR5 A;  5J2D A;  1ZQV A;  4J9Q A;  1SKW A;  4M9H A;  1ZQT A;  2JZB A;  2KFZ A;  4ECW A;  1ZQD A;  4YCX A;  4DL5 A;  5IIJ A;  2I1Q A;  2XY5 A;  4RU9 A;  4BWJ A;  4ECU A;  4M9J A;  3UQ0 A;  2BDP A;  2VA8 A;  4O3Q A;  3KHH A;  4Q45 A;  4GLX A;  3T3F A;  2HHS A;  4QW9 A;  3B0Y A;  5KFR A;  1JX4 A;  3KHR A;  1TAU A;  8ICP A;  3EPI A;  4KLF A;  3AU2 A;  1JXL A;  4I2C A;  4TUR A;  3AU6 A;  1NJY A;  5CWR A;  8ICW A;  3OHB A;  2W9B A;  3PV8 A;  4I2H A;  4LVS A;  4KLS A;  9ICU A;  4Q8E A;  3PO4 A;  4ED2 A;  1BPD A;  1IXR A;  2AU0 A;  4KLT A;  2JEI A;  4M2Y A;  4I27 A;  8ICU A;  1KRP A;  2BKE A;  3LDA A;  4TQR A;  3RBE A;  2NRW A;  1NK5 A;  4JV1 A;  3BQ2 A;  4RT3 A;  2DPI A;  1S76 D;  1MQ2 A;  2BGW A;  2BPF A;  2IMW P;  1BPE A;  5KFZ A;  1BPX A;  5J0T A;  3MFH A;  4ED1 A;  3BDP A;  1CEZ A;  3THV A;  8ICC A;  5BPC A;  7ICH A;  3T5H A;  3UXN A;  3H7I A;  3GV7 B;  1S97 A;  3GIM A;  1BVS A;  4YR3 A;  4GXJ A;  5J2H A;  1C7Y A;  1NJZ A;  2BCU A;  4RQ7 A;  5KFL A;  4QZ8 A;  5BOM A;  3TAP A;  3RB4 A;  1ZQG A;  4IRK A;  9ICF A;  4PGQ A;  1SL0 A;  5D46 A;  4NLN A;  3JPR A;  4JV2 A;  4DEZ A;  3EZ5 A;  3JPN A;  2BQR A;  1ZQJ A;  3KHL A;  1ZQW A;  2IBK A;  2PXI A;  1TKD A;  1LV5 A;  3V72 A;  4PGY A;  3JPT A;  3KHG A;  5J0R A;  4QZF A;  1Z00 A;  4DQQ A;  1ARO P;  1XWL A;  4LZD A;  2JZB B;  4PH5 A;  3GIK A;  4EYI B;  1L3V A;  1BPY A;  2R8J A;  4R65 A;  1XSL A;  2FMP A;  4Q8F A;  4DLG A;  2AJQ A;  1ZQS A;  4KLI A;  2KZZ A;  4X5V A;  2PFO A;  4B9T A;  2PI4 A;  3ZDE A;  1NK6 A;  2JEF A;  4O3P A;  2V4Q A;  3BQT A;  3G6Y A;  9ICV A;  7ICQ A;  3RRH A;  4JWM A;  2HHX A;  2P6R A;  4IRC A;  5DBC A;  4MF8 A;  4ECS A;  4QZB A;  1UT5 A;  3UXO A;  3HP6 A;  3ISC A;  3V7K A;  1QSS A;  3RJJ A;  1SL2 A;  4CCH A;  4I28 A;  5KFN A;  9ICP A;  5KT6 A;  4QZA A;  2WTF A;  2FLP A;  5KFA A;  5KFC A;  2BPG A;  3EW9 A;  4DSK A;  3QZ8 A;  5DGA A;  4UB3 A;  2BCR A;  5KG4 A;  1U47 A;  3H4B A; 
#chains in the Genus database with same CATH topology
 2VJ4 A;  4XUS A;  1XU4 A;  2ISP A;  4FBU A;  1KTQ A;  4IQU A;  4NLG A;  1N62 A;  2RDI A;  8ICV A;  2FPM A;  3LVW A;  3PX6 A;  1UCV A;  4AYB C;  1RXW A;  4A8E A;  5AK3 A;  1XSP A;  1JAL A;  3R9K A;  4HYK A;  1Q3U A;  1MA7 A;  1U45 A;  4I2E A;  4J9P A;  3N4M B;  9ICH A;  1Q8K A;  8ICE A;  1RYR A;  4M0A A;  2KKP A;  5J0Q A;  4ED6 A;  2IHN A;  1QSL A;  2KKV A;  2O6K A;  4P4P A;  4CNQ A;  4ELT A;  4K4I A;  4UB6 U;  4UAR A;  1DGS A;  4F92 B;  4Y2P A;  3GDX A;  4F5Q A;  9ICE A;  2PMZ C;  1ZQY A;  1LB2 B;  5L1L A;  4ZOH C;  1V97 A;  4ELV A;  1NOM A;  4EBD A;  1D9D A;  3QNM A;  4IC9 A;  5KG3 A;  3IDW A;  1URJ A;  2E8M A;  1L5U A;  1J2M A;  2ZUD A;  5H2F U;  4KLO A;  3N28 A;  5ALW A;  2HOI A;  2DBY A;  2MSN A;  4RT2 A;  2W9M A;  5HHH A;  3EYZ A;  7ICM A;  5KL1 B;  1SV0 A;  2W9B B;  1KFD A;  4YP3 A;  3BQ7 A;  3AEV A;  3J81 j;  2KHQ A;  1WG8 A;  5HML A;  3RJK A;  5KT4 A;  8ICM A;  3PML A;  5DLF A;  4B9M A;  2NV3 A;  1ZQA A;  1T7P A;  1ZQF A;  4O3M A;  3HW8 A;  2LYH A;  2LYA A;  3V7J A;  2VA2 A;  5J0U A;  4BDP A;  3H8J A;  3CRX A;  5HP4 A;  4QZH A;  2KSO B;  5KL8 B;  3C2M A;  2DWQ A;  4CF4 A;  2JEJ A;  4DOB A;  1L7M A;  2DKZ A;  4RQ5 A;  2PFP A;  7ICV A;  4TUS A;  1JXE A;  5J2I A;  2KZM A;  2C2R A;  4YR0 A;  3V6H A;  4RPY A;  1Z00 B;  2KN7 A;  2OCE A;  5HNK A;  4RNO A;  1S10 A;  1V85 A;  1UA0 A;  2F44 A;  5L1I A;  2PI5 A;  3F2B A;  1A76 A;  5KG6 A;  1MC8 A;  2EDU A;  2W9C B;  4M6W B;  1UQV A;  2VIX A;  3PSF A;  4BWM A;  2QB0 A;  3T5L A;  1TK5 A;  4B9S A;  1K1S A;  2DQN B;  2JMG A;  4O3S A;  4J03 A;  3PX0 A;  3RAQ A;  3C1Z A;  4EBC A;  5EWE A;  4MEX A;  1B4F A;  2G08 A;  1Y88 A;  2JH7 A;  1X9S A;  1HUO A;  1U4B A;  3KZI U;  4C4S A;  9ICR A;  2JV3 A;  3S6J A;  1SXD A;  3NGD A;  9ICT A;  4DFP A;  1KW4 A;  2HBL A;  3PR4 A;  1NK9 A;  1ZQE A;  5JUM A;  5DQH A;  2EAP A;  2W55 A;  2ZTC A;  1LVH A;  2HDO A;  3H0L B;  1NJX A;  3UQ2 A;  9ICC A;  5KNI A;  1IIP A;  4F4X A;  2HOQ A;  1X66 A;  3H0M B;  8ICX A;  1NNL A;  4ECY A;  3M9N B;  3SI8 A;  2R18 A;  3RJH A;  4F5O A;  5KFO A;  2ES6 A;  2QB1 A;  4UB2 A;  3H0R B;  3RH5 A;  1U9L A;  2Z7J A;  8ICR A;  2HVH A;  4LZG A;  9ICK A;  2W8L A;  5AIB A;  2KMD A;  4ELU A;  4ECZ A;  1SWW A;  1WWV A;  1QH9 A;  3ALR A;  4PHA A;  5AI9 A;  5IIM A;  4ED0 A;  2W3S A;  2ZIW A;  8ICJ A;  3HPO A;  3RBD A;  2HHT A;  3GFK B;  4KLU A;  2W9A A;  1N61 A;  1QLN A;  1XSN A;  1FFV A;  1ZQO A;  3ETL A;  5DBB A;  2YMP A;  4PGX A;  3LWM A;  2QLT A;  3TAQ A;  3QUC A;  1ZJN A;  3GQC A;  1IM4 A;  2LM1 A;  4PHE A;  2KHV A;  2YN4 A;  2F2A B;  1UT8 A;  4DL6 A;  4KLJ A;  3NUQ A;  4DL2 A;  1N60 A;  1X9X A;  3IN5 A;  2K4H A;  2FMQ A;  2JXJ A;  5KFU A;  4KMO B;  4DL7 A;  5E79 U;  2E1E A;  4RUA A;  4OO1 J;  2J6S A;  3B0X A;  4AYB F;  2LI6 A;  3RH6 A;  3C2L A;  4R63 A;  3RJF A;  4DSI A;  4PZN A;  4KLL A;  1B22 A;  5KG1 A;  3OSP A;  4O5E A;  2HMX A;  1MQ3 A;  1Z3E B;  2YB4 A;  1ZQK A;  4ECT A;  1KQQ A;  3BS5 B;  4UBC A;  3V6J A;  1CRX A;  4G9B A;  5KAI U;  3PVX A;  4XQ8 A;  4DO9 A;  2E3T A;  2JRZ A;  3C5F A;  4PL1 A;  4RUC A;  4Q43 A;  7ICI A;  3M9O B;  5DBA A;  1PK1 A;  4F72 A;  4QW8 A;  4RQ3 A;  2HCF A;  3PSI A;  2AXT U;  2K4I A;  5DG7 A;  5KG7 A;  4DLE A;  3SAG A;  3D2N A;  2XGQ A;  7ICF A;  1RXV A;  5FP0 A;  3TAD A;  5J2D A;  2KFZ A;  4ECW A;  2WAQ C;  4ACO A;  1FEZ A;  5ALL A;  2QKQ A;  3UQ0 A;  4O3Q A;  3KHH A;  1ZXI A;  2L5Y A;  4GIB A;  1N2X A;  5AKJ A;  4GLX A;  4QW9 A;  3KKA C;  3KHR A;  5ALO A;  3EPI A;  1ZD2 P;  1JXL A;  1NJY A;  4I2H A;  4LVS A;  2LBO A;  4ED2 A;  1BPD A;  2AU0 A;  3GZF A;  1M6Y A;  4P0P A;  3L5K A;  4RT3 A;  5AI4 A;  1S76 D;  5KAF U;  1MQ2 A;  2BPF A;  1BPE A;  8ICC A;  5BPC A;  2F76 X;  2DKX A;  3GIM A;  1BVS A;  1NJZ A;  2BCU A;  5BOM A;  5KFL A;  4QZ8 A;  5AKI A;  3TAP A;  4PGQ A;  5D46 A;  2N1R A;  4NLN A;  2HI0 A;  3L3F X;  1ZQW A;  1TKD A;  1LV5 A;  1F44 A;  4QZF A;  1Z00 A;  4PH5 A;  2GO7 A;  1XSL A;  3IG8 A;  4DLG A;  2YML A;  4EX7 A;  1ZQS A;  4B9T A;  1ZQ1 C;  2JEF A;  4O3P A;  3BQT A;  2K8A A;  4QZB A;  1QSS A;  5ALM A;  2AHO B;  4FZN A;  4I28 A;  9ICP A;  5KT6 A;  2WTF A;  1PVQ A;  4DSK A;  1L7O A;  2KVS A;  2W43 A;  4C4R A;  4UB3 A;  3SMV A;  1O08 A;  3H4B A;  3MR6 A;  5ALQ A;  3Q8R B;  5AIA A;  3WKD A;  5JTI A;  5AKE A;  5KFG A;  3SV3 A;  3B9J A;  3QU7 A;  2KP7 A;  4F8R A;  3M1Y A;  1WCN A;  1Z1B A;  5AM2 A;  1J2N A;  2HHV A;  1X9M A;  2FE9 A;  4J9R A;  4YQW A;  3WKA A;  3AL0 B;  5AI6 A;  4Z6D A;  1U48 A;  1TAQ A;  4EEK A;  1F5S A;  5B5E U;  1ZQZ A;  4I2A A;  2XVT A;  2I5H A;  4DQI A;  4C4T A;  4DQP A;  3D2S A;  3UXP A;  3RH4 A;  9ICS A;  4NLC A;  3N97 B;  2D8C A;  2F1I A;  5KFV A;  2I9G A;  5KFP A;  3DV9 A;  3V7L A;  2RDJ A;  2KJ8 A;  3E2E A;  4KMU A;  1ZQB A;  1D8Y A;  8ICB A;  2RP5 A;  2K4P A;  3WKE A;  2LPE A;  2AH5 A;  2LKY A;  5CP2 A;  4E0D A;  4TQS A;  4NM1 A;  5EE1 A;  4RQ8 A;  3RRG A;  1JIH A;  3QYP A;  4Z6C A;  4FO6 A;  1CUK A;  4JMU A;  4FS1 A;  3N7S C;  5AKL A;  1RQL A;  2DPJ A;  1D8B A;  4ICA A;  1SIJ A;  2V4R A;  1D8L A;  3GV8 B;  4CE6 A;  2NRT A;  2XCP A;  3K4G A;  4XRH A;  3MC1 A;  4KN4 A;  2WF8 A;  4YG2 A;  1U47 A;  5KFH A;  5KG0 A;  4B9L A;  3BZK A;  3QEA Z;  2W9C A;  3FYH A;  3KZX A;  3C2K A;  4QWC A;  4NV0 A;  1L3S A;  5EE9 A;  1KDH A;  2A1J B;  3MDA A;  2B6G A;  2NO5 A;  4DFK A;  3F2C A;  1Z4O A;  4Y2U A;  1ZQX A;  5DLG A;  1P7D A;  4GXK A;  3PY8 A;  2KSO A;  4FZL A;  5J2A A;  2XO7 A;  3EWA A;  1ZQR A;  1DK2 A;  2PFQ A;  4YFK A;  1T3N A;  2MUT A;  4Y2Y A;  1XO1 A;  4F2S A;  4RNN A;  2HSZ A;  2NRV A;  3PSP A;  1JN3 A;  3N7R C;  4QWB A;  1KFT A;  1XC9 A;  5J0X A;  2EQY A;  1BNP A;  3C21 A;  2WB1 F;  4MEY A;  2IHM A;  4R64 A;  3LYS A;  2IOH A;  4J9M A;  1EXN A;  5ALP A;  2JH1 A;  2HW3 A;  4J9K A;  4GC7 A;  1COO A;  4Q44 A;  2BQU A;  2G0A A;  5T14 A;  2QB0 B;  4IQV A;  4OJL A;  4F50 A;  3IV6 A;  3D6J A;  3G6X A;  4DF8 A;  1DOQ A;  1DRG A;  1U49 A;  3Q8Q B;  1SB3 C;  3GIJ A;  3BJY A;  4UAW A;  1S9F A;  2MU2 A;  4P4M A;  4EZ9 A;  2F1J A;  4DWI A;  3MR3 A;  3ZDB A;  3NVW A;  2R8G A;  1ZQM A;  3F5A A;  1TV9 A;  3D2Q A;  4NJ8 A;  2UVR A;  4K4G A;  2AQ0 A;  2YB1 A;  3PR5 B;  3WK8 A;  4F5R A;  4UB5 A;  2NRX A;  2MAX A;  2W11 A;  3A0H U;  4RQ1 A;  1ED1 A;  3PO5 A;  2KIV A;  4F4W A;  5AKZ A;  3SEI A;  5KFI A;  7ICO A;  3OGU A;  2R8H A;  2RQ5 A;  2CXY A;  3QE9 Y;  5DG9 A;  2ESE A;  4B6J A;  3CW2 C;  3AQE A;  2ALZ A;  2W7P A;  5AM1 A;  1S0O A;  4MHV A;  3LVV A;  4RQ6 A;  1BNO A;  5HMM A;  2ZTE A;  1ZQI A;  3ZDD A;  5EWF A;  4C8K A;  1KSP A;  4Y2R A;  4DFM A;  4MF2 A;  4YXJ A;  2OWO A;  5ALH A;  2W03 A;  1RYS A;  2XY6 A;  8ICY A;  1N5W A;  4F91 B;  5J2K A;  1RPL A;  2BPG A;  4US9 A;  4DSE A;  2XID A;  4DL4 A;  1T8E A;  4DOC A;  2LMR A;  3IM1 A;  5L1K A;  2LHT A;  4QZE A;  1KEJ A;  2XIC A;  4QIW F;  2F8L A;  8ICG A;  2FPK A;  2YTU A;  1N5X A;  3GII A;  5KFF A;  1ZQL A;  4RPX A;  1NI3 A;  5DDY A;  2Y9T A;  4TUP A;  4PHD A;  4O5C A;  2GWS A;  4JUZ A;  4DSJ A;  4KN7 A;  4KTQ A;  4DS5 A;  1S77 D;  4O9M A;  4C8M A;  4ED7 A;  3ORY A;  5TZV A;  4YMO A;  5EWG A;  3UMB A;  3BZC A;  1K1Q A;  3C28 A;  4O3R A;  1S5L U;  4P4O A;  2KE7 A;  4ECR A;  4ECV A;  3RJE A;  4I2G A;  4IS7 A;  3QZ7 A;  4QIW C;  3KOO A;  1ZRM A;  2OYY A;  4RPZ A;  2FPL A;  4KLD A;  5J2F A;  3JPQ A;  4QWA A;  3ISB A;  1WCL A;  4DCC A;  2IA6 A;  5J2J A;  3PW2 A;  1B0X A;  4Y2X A;  4I2F A;  1VDV A;  1SXE A;  4F3O A;  5IIO A;  5KT5 A;  5ALD A;  3DEE A;  3JPO A;  2AQ4 A;  2XGP A;  5G5H A;  4J9Q A;  4DL5 A;  2P35 A;  2D3D A;  5IIJ A;  4ECU A;  4BWJ A;  2BDP A;  2VA8 A;  4Q45 A;  3QU9 A;  2Y0S F;  3H8M A;  3TKA A;  5KFR A;  1OXJ A;  4KLF A;  3AU2 A;  4I2C A;  3AU6 A;  2W9B A;  3PV8 A;  2K8B B;  5AM0 A;  4KLT A;  1IXR A;  1L8O A;  1KBU A;  2JEI A;  1VJ5 A;  2BKE A;  4CF5 A;  3BQ2 A;  2DPI A;  2BGW A;  5KFZ A;  3MFH A;  4ED1 A;  5AM5 A;  2YQE A;  3THV A;  2KK0 A;  3T5H A;  3GV7 B;  1S97 A;  4YR3 A;  5J2H A;  3VCB A;  1ZQG A;  3MGV A;  3NRZ A;  1ZRN A;  2CN1 A;  2E8O A;  3EUB 2;  1SL0 A;  3JPR A;  4DEZ A;  1ZQJ A;  2G06 A;  1BPY A;  4LZD A;  4EYI B;  1UPH A;  2R8J A;  4Q8F A;  4X5V A;  2JR5 A;  1OUQ A;  1HEK A;  7ICQ A;  2VJ5 A;  5DBC A;  4ECS A;  1UT5 A;  3AM9 A;  1ZOL A;  2FLP A;  3VC8 A;  4P0Q B;  2BCR A;  5KG4 A;  3Q8S B;  4PHP A;  1BPZ A;  4NY8 A;  1HJP A;  3OHA A;  3WKB A;  1FFU A;  4QWD A;  5AIC A;  7ICS A;  5KFQ A;  1OW5 A;  4DOA A;  4ED8 A;  5TIS U;  4JB3 A;  4GC6 A;  1S0M A;  4OD0 A;  4NM2 A;  1A0P A;  5EE3 A;  1N48 A;  3ZDC A;  1SL1 A;  5F9N A;  1XO0 A;  1SGG A;  4NLK A;  2W04 A;  4EX6 A;  2E1F A;  5AKX A;  4QZD A;  2JGA A;  4BUG A;  2WB1 C;  3E0F A;  2OM6 A;  2BCQ A;  2ASD A;  1YZ7 A;  1S0V A;  4R8U B;  3MAB A;  2NO4 A;  2QAR B;  5B66 U;  1NK8 A;  3T5J A;  5ALG A;  5ALN A;  1L8L A;  3G6V A;  3BQ1 A;  3PW4 A;  4Z6F A;  5KG2 A;  3WU2 U;  2ZIU A;  4UAT A;  2A1A A;  3WK5 A;  4CDG A;  3ZD9 A;  4M9L A;  2C2D A;  4Z6E A;  5KFM A;  1NKB A;  2ASL A;  2OHF A;  5K4L A;  9ICW A;  2HHU A;  4DSL A;  2KVC A;  2DGZ A;  4US8 A;  1DK3 A;  5ALI A;  9ICA A;  3RTV A;  4QZC A;  1TFR A;  3SV4 A;  5III A;  3QXG A;  3N7P D;  4NLB A;  4F5P A;  3PW0 A;  5A0L A;  3IP4 B;  5J29 A;  3BQ0 A;  5KFS A;  1L7P A;  5AI5 A;  2P66 A;  5AK6 A;  2ZTD A;  4U6P A;  3RB0 A;  7ICJ A;  3RAX A;  4F93 B;  4C8N A;  4RQN A;  5KTQ A;  4FS2 A;  1RQN A;  3OPX A;  3GIL A;  4C8L A;  2G5H B;  1MN8 A;  4MFC A;  3PW5 A;  3FDS A;  5KFW A;  2XCA A;  3FM9 A;  8ICK A;  2KIC A;  2E5S A;  3QU4 A;  1MSW D;  2A1J A;  3MFI A;  1PVP A;  4P2H A;  4F5N A;  1HIW A;  2Q0Z X;  2RRD A;  1X9W A;  3QX7 A;  3NS1 A;  4O3N A;  4NWI A;  4O5K A;  1A6S A;  4NXZ A;  1LKY B;  5KFT A;  4QZ9 A;  5AKK A;  3H40 A;  4I2D A;  7ICL A;  4P0P B;  2A19 A;  9ICI A;  3IRU A;  2IOF K;  1ZYQ A;  5ALZ A;  4KLE A;  4DQR A;  3SQI A;  3PW7 A;  4J9N A;  4UB4 A;  3U26 A;  1L7N A;  2W8K A;  2CRX A;  5ALF A;  5HR6 A;  5ALK A;  5KT7 A;  3Q8K A;  3M6Z A;  3PZP A;  4F4K A;  5ALV A;  2ODG A;  3CP8 A;  7ICT A;  4B9N A;  5ALJ A;  2ZIX B;  4UB8 U;  3K1Z A;  8ICA A;  2YX8 A;  1TK0 A;  1PZN A;  3MGH A;  1H38 A;  3TFR A;  5HHI A;  4F4Z A;  5J0O A;  3KD3 A;  4QZG A;  4ED3 A;  5KG5 A;  5AKH A;  4HAI A;  1Z4N A;  4OJO A;  5J0P A;  1TK8 A;  5F9L A;  2CPR A;  1ZQQ A;  2M9N A;  2DF4 B;  9ICG A;  4YD1 A;  3V6K A;  1KKX A;  2Y1J A;  5L1M A;  1BGX T;  4MFF A;  2VAN A;  4FZM A;  2HVI A;  1D9F A;  1RZT A;  3HRD D;  5KT3 A;  1N56 A;  2W54 A;  4KLM A;  4B9V A;  1PUZ A;  4UQG A;  1Q3V A;  3ICX A;  4CGZ A;  2ZUC A;  9ICM A;  9ICB A;  1HUZ A;  4UAY A;  3M8S A;  2YMM A;  1WUD A;  1XS9 D;  1TE2 A;  4YXM A;  5DG8 A;  3MBY A;  2HHQ A;  3LWL A;  5EE0 A;  3TAR A;  4J9S A;  5KFY A;  1JUD A;  2M0N A;  4DSF A;  4DF4 A;  3OJS A;  4Y2J A;  2B0C A;  4RQ0 A;  4BGD A;  4CRX A;  2BDU A;  4EBE A;  4UBB A;  3EPG A;  3KBB A;  3SR6 A;  5CRX A;  2K8C B;  5IIN A;  8ICZ A;  3FC4 A;  2KOB A;  3PNC A;  9ICQ A;  2J6T A;  4O0I A;  5DDM A;  3RF9 A;  4OJP A;  1SKR A;  8ICL A;  8ICN A;  3H8S A;  4FBT A;  4BX9 C;  1X42 A;  4PPX A;  2KV2 A;  3ONN A;  2KFN A;  5D49 A;  1WWU A;  1BPB A;  4Y2V A;  4NL9 C;  5AM3 A;  1IV8 A;  2NRZ A;  4QNL A;  2V9W A;  3LK9 A;  1AQ6 A;  4EYH B;  5J8Y A;  8ICO A;  2AGQ A;  2ZG6 A;  2C28 A;  5GTH U;  2UVU A;  2BHN A;  2FLN A;  3F2D A;  5IIL A;  4TUQ A;  4B9U A;  2K89 A;  4RQ4 A;  3SAF A;  2ASJ A;  2MA1 A;  5AK4 A;  5KFX A;  4BXO B;  2Y0S C;  2VKQ A;  2MUT B;  3QU2 A;  4FFD A;  3NVY A;  3O0F A;  4ZH4 A;  1QQ6 A;  2FMS A;  2UVW A;  5JU5 A;  4UB1 A;  3SAH A;  4QJF B;  2G07 A;  4F4Y A;  2XI9 A;  1NJW A;  1NKE A;  9ICJ A;  4KIT B;  2FLL A;  3KTQ A;  5AKY A;  9ICO A;  4K4H A;  1ZQV A;  1SKW A;  2JZB A;  1ZQD A;  4YCX A;  5ALT A;  4GFJ A;  2I1Q A;  2XY5 A;  4RU9 A;  4U7C A;  4C80 A;  2Y9U A;  2F3N A;  3BS5 A;  3T3F A;  2HHS A;  1TAU A;  4KLS A;  9ICU A;  4Q8E A;  5ALU A;  3BS7 A;  2GH1 A;  4M2Y A;  4I27 A;  8ICU A;  1KRP A;  3RBE A;  2NRW A;  2Q4T A;  3QU5 A;  1LKY A;  1CEZ A;  2H3I A;  4GXJ A;  5ALX A;  4IRK A;  4USA A;  3EZ5 A;  3JPN A;  3KHL A;  2IBK A;  1X6J A;  4PGY A;  3AN1 A;  5ALS A;  1ZD3 A;  4DQQ A;  2D6F C;  9ICL A;  2JZB B;  1FO4 A;  2F8K A;  4LJX A;  3ED5 A;  4R65 A;  2H3V A;  2A3V A;  2KEY A;  3OTQ A;  2PI4 A;  2V4Q A;  3G6Y A;  4C0Z A;  3RRH A;  4JWM A;  2KJ9 A;  2KD1 A;  2PMZ F;  5AI0 A;  4MF8 A;  3ISC A;  3V7K A;  3I28 A;  5KFN A;  5KFC A;  3QZ8 A;  3F53 A;  5DGA A;  2ZIV A;  2LM4 A;  4BXO A;  1F0M A;  3JPP A;  1NZB A;  5DKW A;  5HR7 A;  3UM9 A;  2FDR A;  2XY7 A;  3Q8L A;  2ZIW B;  2H3F A;  2ZJ8 A;  1UHU A;  1DXS A;  5KFK A;  2ZJA A;  3M9M B;  3WK9 A;  3KKA A;  3H4D A;  2ZXI A;  5CR0 A;  5J0Y A;  4NL9 A;  1FIQ A;  4I2I A;  2WF7 A;  3UPQ A;  1L3U A;  1T4G A;  4EEL A;  3HWT A;  2ZIV B;  9ICN A;  3RR7 A;  4M47 A;  2PFN A;  4BJQ A;  1JMS A;  8ICF A;  4Y2S A;  5ALR A;  2ZIU B;  5ALY A;  2HOF A;  4Y2T A;  3FAH A;  4F71 A;  3GV5 B;  3MGI A;  1NK4 A;  2I6X A;  2IOF A;  2EAN A;  1PK3 A;  2AGO A;  2JHD A;  1PVR A;  5F3X B;  1QQ5 A;  1ZET A;  5KT2 A;  3TAN A;  1Q46 A;  3NAS A;  4M04 A;  4R8U A;  5G5G A;  2LYB A;  3ZD8 A;  5DGB A;  2BCV A;  3HIL A;  4KLG A;  1Z1V A;  1L3T A;  7ICG A;  3C23 A;  3I76 A;  5KFD A;  1DGJ A;  8ICQ A;  4YR2 A;  7ICR A;  4ECX A;  2W7O A;  3NVZ A;  4F2R A;  5AHX A;  4FE3 A;  5DQG A;  2MRL A;  1NZP A;  4UW9 A;  4IR9 A;  5AKG A;  3SZ2 A;  5AM4 A;  3RJI A;  2KIW A;  3UMC A;  1WYG A;  2FI1 A;  3DDH A;  1UA1 A;  3OJU A;  1ZJM A;  3QUQ A;  1SZP A;  2ZXH A;  4Y2Q A;  5AK5 A;  5J8Y C;  2K60 A;  4RQ2 A;  1RDF A;  4PL2 A;  4JK1 A;  5CA7 A;  2C2E A;  1ZD4 A;  4KLH A;  3M7D A;  2NYV A;  2OH2 A;  4R66 A;  2BQ3 A;  1QTM A;  3TAD C;  1V9P A;  8ICT A;  2EZZ A;  3HJE A;  3C1Y A;  3A0B U;  4DL3 A;  1L6N A;  5CB1 A;  3RR8 A;  2HBJ A;  5KFB A;  3HT3 A;  3CNH A;  3NVV A;  2ZIX A;  1PK1 B;  2WFA A;  3C5G A;  2EZY A;  1S8O A;  3AQF A;  4KLQ A;  4YN4 A;  3RJG A;  2WHE A;  2B21 A;  3QUT A;  3RB6 A;  4DFD A;  2ISO A;  2YY6 A;  4C7Z A;  9ICX A;  5DB6 A;  2Y1I A;  1T3Q A;  2HHW A;  5J2C A;  2R8I A;  2ZUB A;  3Q8P B;  4DS4 A;  1SKS A;  1ZQH A;  5J0W A;  3H8W A;  4C8O A;  3IHQ B;  4YMM A;  4RQM A;  5BOL A;  4OJ5 A;  2KNJ A;  3UMG A;  2GOL A;  4IQT A;  1X2I A;  1NK0 A;  1N63 A;  3F5E A;  7ICE A;  2C22 A;  4KX5 A;  8ICH A;  2VA3 A;  4OCZ A;  2KTQ A;  2EAM A;  3SEN A;  2F77 X;  1KLN A;  2RLT A;  3TI0 A;  2QAR A;  4G3I A;  4YVZ A;  1IG6 A;  1SZH A;  5DB9 A;  4I29 A;  3T5K A;  4IR1 A;  4MFA A;  4ECQ A;  5EOZ A;  2XC9 A;  4UAS A;  2E8N A;  4DQS A;  4I2J A;  2KZ3 A;  1X6I A;  1YZ6 A;  5L1J A;  3QUB A;  2BZF A;  3I1Y A;  4XA5 A;  3WK4 A;  5JRT A;  2KG5 A;  5C5J A;  1QCK A;  5J2G A;  3GU3 A;  2H3Z A;  3SYZ A;  2P6U A;  2F1H A;  1JRO A;  3MDC A;  2UVV A;  3ISD A;  4IL6 U;  1B43 A;  1TAM A;  4CF3 A;  1NKC A;  5C0Y A;  1JRP A;  4QWE A;  2EH9 A;  2G09 A;  1RG6 A;  1YT3 A;  3PX4 A;  1RM6 C;  2DFL A;  5AI8 A;  3QEB Z;  2BR0 A;  5DB8 A;  3OSN A;  8ICI A;  2ATL A;  1S0N A;  1GO3 F;  1C20 A;  7ICK A;  3RFA A;  3Q8M A;  2GLE A;  2WF5 A;  3ZI4 A;  1ZQU A;  4P0Q A;  4IQW A;  5GTI U;  5CJ7 A;  1KL9 A;  2H3Q A;  1ZQN A;  4I2B A;  1A77 A;  1ECW A;  3NTU A;  2BCS A;  4WJ3 B;  7ICU A;  4GXI A;  4IRD A;  1ZQC A;  1KFS A;  3HKZ F;  4YD2 A;  4JV0 A;  3ZDA A;  3PST A;  1COK A;  3WK7 A;  2OXO A;  3L4P A;  4QZI A;  4AP9 A;  4RZR A;  3PMN A;  5KFJ A;  5DB7 A;  4J9L A;  4DFJ A;  2RHF A;  5D4B A;  4YMN A;  2AGP A;  3C29 A;  3TFS A;  4UAU A;  2WF6 A;  4J9O A;  3TQ1 A;  4NLZ A;  4UAZ A;  1SV0 C;  3M8R A;  4RNM A;  7ICP A;  1RYU A;  5DQI A;  5IIK A;  5J2B A;  1ZQP A;  4PZO A;  3RB3 A;  2H5X A;  3E58 A;  4O3O A;  3AUO A;  2HBK A;  2DUY A;  4EEY A;  2G5I B;  4KX3 A;  4M9G A;  4M6W A;  5L9X A;  3K75 D;  1NK7 A;  2YMQ A;  3CYM A;  5KFE A;  4PJ0 U;  3WKC A;  3K1R B;  2EZX A;  5J2E A;  1VLB A;  3JPS A;  2JEG A;  1QQ7 A;  1J97 A;  2WF9 A;  4JWN A;  3MR2 A;  3HX0 A;  2ZJ5 A;  2K4E A;  8ICS A;  1TVA A;  5CHG A;  1QSY A;  4EZ6 A;  5J0S A;  2R8K A;  2DL0 A;  7ICN A;  2KJ5 A;  2J6U A;  4M9N A;  2BPC A;  3MR5 A;  4M9H A;  1ZQT A;  4M9J A;  4EEN A;  2PKE A;  3HKZ C;  3B0Y A;  1JX4 A;  3TAC B;  1XNS A;  8ICP A;  4TUR A;  5CWR A;  8ICW A;  4C7Y A;  3OHB A;  1SWV A;  3PO4 A;  1SV4 A;  3LDA A;  4UAV A;  4TQR A;  1NK5 A;  4JV1 A;  2FJ6 A;  2IMW P;  1BPX A;  3NRW A;  5J0T A;  1V38 A;  3BDP A;  1JI7 A;  1CI4 A;  1Z19 A;  7ICH A;  2WAQ F;  1O03 A;  3UXN A;  1X40 A;  3H7I A;  1C7Y A;  1KN5 A;  4RQ7 A;  3RB4 A;  3AMZ A;  9ICF A;  4JV2 A;  2BQR A;  5CEH A;  2PXI A;  3V72 A;  3IG5 A;  3JPT A;  3KHG A;  5J0R A;  2HBM A;  1ARO P;  1XWL A;  1L3V A;  3GIK A;  3SD7 A;  3KFU F;  1T94 A;  5ALE A;  2OEH A;  2FMP A;  2AJQ A;  1ZD5 A;  4KLI A;  2KZZ A;  2PFO A;  3ZDE A;  3T79 A;  1NK6 A;  9ICV A;  3ETR A;  2HHX A;  2P6R A;  4IRC A;  3UXO A;  1K5O A;  2E8P A;  3HP6 A;  3RJJ A;  3WK6 A;  1SL2 A;  4CCH A;  2EAO A;  4OJ6 A;  4QZA A;  5KFA A;  3EW9 A;  2W3R A;  3M6K A; 
#chains in the Genus database with same CATH homology
 4BXO A;  3MR6 A;  3Q8S B;  4XUS A;  4PHP A;  1BPZ A;  4NY8 A;  3Q8R B;  3JPP A;  1HJP A;  1XU4 A;  3OHA A;  2ISP A;  4FBU A;  5KFG A;  5DKW A;  3SV3 A;  1KTQ A;  4IQU A;  2XY7 A;  4QWD A;  3Q8L A;  4NLG A;  2ZJ8 A;  2RDI A;  5KFK A;  4F8R A;  2ZJA A;  3M9M B;  7ICS A;  1WCN A;  5KFQ A;  3H4D A;  4DOA A;  5CR0 A;  2HHV A;  1X9M A;  4ED8 A;  8ICV A;  2FPM A;  5J0Y A;  4J9R A;  3PX6 A;  4GC6 A;  1S0M A;  4YQW A;  4NM2 A;  1RXW A;  4Z6D A;  4I2I A;  1XSP A;  1U48 A;  1TAQ A;  4HYK A;  1N48 A;  3ZDC A;  3UPQ A;  1ZQZ A;  1L3U A;  1T4G A;  1U45 A;  4I2E A;  3HWT A;  4J9P A;  1SL1 A;  3N4M B;  9ICN A;  9ICH A;  8ICE A;  5F9N A;  1RYR A;  3RR7 A;  4I2A A;  4M0A A;  5J0Q A;  4DQI A;  4NLK A;  4ED6 A;  2IHN A;  3UXP A;  4DQP A;  1QSL A;  4M47 A;  3RH4 A;  2PFN A;  4P4P A;  1JMS A;  9ICS A;  8ICF A;  4QZD A;  4ELT A;  3N97 B;  2F1I A;  5KFV A;  2I9G A;  4K4I A;  5KFP A;  2BCQ A;  3GV5 B;  3V7L A;  3MGI A;  2ASD A;  2RDJ A;  1NK4 A;  3E2E A;  1S0V A;  4KMU A;  2AGO A;  4R8U B;  3MAB A;  1ZQB A;  1ZET A;  1DGS A;  1D8Y A;  8ICB A;  4F92 B;  5KT2 A;  3GDX A;  4F5Q A;  3TAN A;  1NK8 A;  9ICE A;  3T5J A;  4M04 A;  4R8U A;  1ZQY A;  5CP2 A;  3ZD8 A;  1LB2 B;  4E0D A;  5L1L A;  5DGB A;  2BCV A;  4TQS A;  3G6V A;  3BQ1 A;  3PW4 A;  4NM1 A;  4Z6F A;  4KLG A;  5KG2 A;  1L3T A;  3RRG A;  4RQ8 A;  4ELV A;  1JIH A;  4Z6C A;  4FO6 A;  7ICG A;  3C23 A;  1CUK A;  1NOM A;  4EBD A;  1D9D A;  5KFD A;  4FS1 A;  8ICQ A;  5KG3 A;  3ZD9 A;  4YR2 A;  4M9L A;  7ICR A;  4ECX A;  2C2D A;  2DPJ A;  4F2R A;  4Z6E A;  5KFM A;  1NKB A;  1L5U A;  2V4R A;  5DQG A;  2ASL A;  2ZUD A;  1D8L A;  4KLO A;  3GV8 B;  9ICW A;  2HHU A;  4DSL A;  4RT2 A;  2NRT A;  2W9M A;  5HHH A;  2XCP A;  3EYZ A;  4IR9 A;  7ICM A;  3K4G A;  3SZ2 A;  4XRH A;  9ICA A;  3RTV A;  3RJI A;  2W9B B;  4KN4 A;  4YG2 A;  1TFR A;  4QZC A;  5KG0 A;  5KFH A;  3SV4 A;  3OJU A;  1KFD A;  3QEA Z;  1ZJM A;  1UA1 A;  4B9L A;  4YP3 A;  5III A;  2W9C A;  3FYH A;  1SZP A;  3C2K A;  4QWC A;  4F5P A;  3PW0 A;  5J29 A;  1L3S A;  3BQ0 A;  4RQ2 A;  5HML A;  3RJK A;  4JK1 A;  1KDH A;  5KFS A;  5CA7 A;  2C2E A;  4KLH A;  2A1J B;  5KT4 A;  3MDA A;  2P66 A;  2ZTD A;  8ICM A;  3PML A;  5DLF A;  4R66 A;  4DFK A;  2BQ3 A;  4B9M A;  3RB0 A;  1ZQA A;  1T7P A;  1ZQF A;  1ZQX A;  5DLG A;  3HW8 A;  1V9P A;  1QTM A;  7ICJ A;  8ICT A;  3RAX A;  4F93 B;  2LYH A;  4GXK A;  3V7J A;  4C8N A;  2VA2 A;  3PY8 A;  3C1Y A;  4DL3 A;  5KTQ A;  5J0U A;  4FS2 A;  4BDP A;  3H8J A;  5CB1 A;  3RR8 A;  5J2A A;  2XO7 A;  3GIL A;  4C8L A;  5HP4 A;  5KFB A;  3EWA A;  4QZH A;  3HT3 A;  1ZQR A;  3C2M A;  2PFQ A;  4YFK A;  1T3N A;  4DOB A;  2JEJ A;  4MFC A;  2MUT A;  3FDS A;  5KFW A;  3PW5 A;  2XCA A;  4RQ5 A;  3C5G A;  1XO1 A;  2PFP A;  8ICK A;  7ICV A;  4F2S A;  4RNN A;  4TUS A;  1JXE A;  5J2I A;  4KLQ A;  2KZM A;  2NRV A;  4YN4 A;  2C2R A;  3RJG A;  4YR0 A;  3V6H A;  1MSW D;  2A1J A;  4RPY A;  1Z00 B;  2B21 A;  3MFI A;  4P2H A;  4F5N A;  3RB6 A;  2KN7 A;  5HNK A;  4RNO A;  1JN3 A;  2ISO A;  1S10 A;  2Q0Z X;  1UA0 A;  5L1I A;  1X9W A;  2PI5 A;  4QWB A;  1KFT A;  1XC9 A;  9ICX A;  1A76 A;  5KG6 A;  5J0X A;  1MC8 A;  4O3N A;  2W9C B;  4M6W B;  3C21 A;  5DB6 A;  2Y1I A;  4O5K A;  4MEY A;  2HHW A;  4BWM A;  3T5L A;  2IHM A;  5J2C A;  1TK5 A;  4B9S A;  1K1S A;  4NXZ A;  4R64 A;  5KFT A;  2R8I A;  4O3S A;  4J9M A;  1EXN A;  4QZ9 A;  3PX0 A;  3RAQ A;  2ZUB A;  3C1Z A;  3Q8P B;  5EWE A;  3H40 A;  4J9K A;  4EBC A;  4I2D A;  4GC7 A;  4DS4 A;  5J0W A;  1SKS A;  4MEX A;  3H8W A;  1ZQH A;  7ICL A;  1COO A;  4C8O A;  9ICI A;  3IHQ B;  1Y88 A;  4YMM A;  4Q44 A;  5BOL A;  1X9S A;  1HUO A;  2BQU A;  1U4B A;  1ZYQ A;  9ICR A;  4IQT A;  1X2I A;  1NK0 A;  3NGD A;  4KLE A;  4DQR A;  7ICE A;  9ICT A;  3PW7 A;  2C22 A;  4J9N A;  4DFP A;  4UB4 A;  4IQV A;  3PR4 A;  4F50 A;  8ICH A;  1NK9 A;  2VA3 A;  2W8K A;  2KTQ A;  1ZQE A;  3G6X A;  4DF8 A;  5JUM A;  1DOQ A;  5DQH A;  1U49 A;  2ZTC A;  1NJX A;  3Q8Q B;  3GIJ A;  3UQ2 A;  1KLN A;  5KT7 A;  2HW3 A;  3BJY A;  9ICC A;  4UAW A;  3TI0 A;  1S9F A;  4G3I A;  4YVZ A;  4F4X A;  3Q8K A;  4P4M A;  4F4K A;  4EZ9 A;  2F1J A;  5DB9 A;  4DWI A;  4I29 A;  3T5K A;  4IR1 A;  3MR3 A;  4MFA A;  7ICT A;  4ECY A;  3ZDB A;  4B9N A;  8ICX A;  3M9N B;  4ECQ A;  2R8G A;  5EOZ A;  2XC9 A;  3SI8 A;  1ZQM A;  4DQS A;  4I2J A;  1TV9 A;  3RJH A;  2KZ3 A;  5KFO A;  5L1J A;  4F5O A;  2UVR A;  8ICA A;  4UB2 A;  4K4G A;  3RH5 A;  2AQ0 A;  1U9L A;  1TK0 A;  4XA5 A;  8ICR A;  3PR5 B;  2HVH A;  1PZN A;  3MGH A;  4LZG A;  1H38 A;  9ICK A;  4F5R A;  3TFR A;  4UB5 A;  5HHI A;  5C5J A;  2NRX A;  5J2G A;  2W8L A;  2MAX A;  4RQ1 A;  4F4Z A;  5J0O A;  3SYZ A;  3PO5 A;  4QZG A;  4ED3 A;  5KG5 A;  4ELU A;  2P6U A;  4ECZ A;  2F1H A;  3MDC A;  2UVV A;  3ISD A;  4F4W A;  1B43 A;  5J0P A;  1TK8 A;  5KFI A;  7ICO A;  3OGU A;  5F9L A;  1ZQQ A;  1NKC A;  2R8H A;  4PHA A;  2M9N A;  4QWE A;  9ICG A;  3QE9 Y;  4YD1 A;  5DG9 A;  3V6K A;  2Y1J A;  5IIM A;  4ED0 A;  3PX4 A;  8ICJ A;  1BGX T;  2DFL A;  3HPO A;  3RBD A;  2VAN A;  4MFF A;  2HVI A;  1D9F A;  3QEB Z;  2BR0 A;  1RZT A;  5DB8 A;  3OSN A;  2HHT A;  9ICL A;  5KT3 A;  3GFK B;  4KLU A;  2ALZ A;  8ICI A;  2W9A A;  1N56 A;  4KLM A;  4B9V A;  2ATL A;  1S0N A;  1S0O A;  4UQG A;  1QLN A;  7ICK A;  4RQ6 A;  3Q8M A;  1XSN A;  1ZQO A;  2ZUC A;  3ETL A;  5DBB A;  9ICM A;  9ICB A;  5HMM A;  1HUZ A;  4UAY A;  1ZQU A;  2ZTE A;  4IQW A;  3M8S A;  1ZQI A;  3ZDD A;  5CJ7 A;  4PGX A;  3LWM A;  1ZQN A;  4I2B A;  5EWF A;  1A77 A;  4C8K A;  1KSP A;  4DFM A;  4MF2 A;  4YXJ A;  2OWO A;  1XS9 D;  3NTU A;  2BCS A;  1RYS A;  7ICU A;  4YXM A;  2XY6 A;  3TAQ A;  8ICY A;  5DG8 A;  4F91 B;  3MBY A;  3GQC A;  1ZJN A;  5J2K A;  1IM4 A;  1RPL A;  4GXI A;  4PHE A;  3LWL A;  4DSE A;  1ZQC A;  3TAR A;  1T8E A;  4DL4 A;  4J9S A;  4YD2 A;  1KFS A;  5KFY A;  4JV0 A;  3ZDA A;  4DOC A;  3IM1 A;  4DSF A;  4DF4 A;  5L1K A;  1UT8 A;  3OJS A;  4QZE A;  4RQ0 A;  4BGD A;  4DL6 A;  1KEJ A;  4KLJ A;  4DL2 A;  4QZI A;  4RZR A;  3PMN A;  4EBE A;  5KFJ A;  4UBB A;  5DB7 A;  3EPG A;  4J9L A;  2HHQ A;  2FMQ A;  8ICG A;  2FPK A;  4DFJ A;  5KFU A;  4DL7 A;  5D4B A;  5IIN A;  8ICZ A;  3GII A;  4YMN A;  5KFF A;  3PNC A;  2AGP A;  9ICQ A;  4RUA A;  1ZQL A;  2J6S A;  3TFS A;  2J6T A;  3B0X A;  4RPX A;  4O0I A;  4J9O A;  3TQ1 A;  4NLZ A;  4UAZ A;  5DDM A;  5DDY A;  3M8R A;  1SKR A;  8ICL A;  3RH6 A;  8ICN A;  4TUP A;  4PHD A;  4RNM A;  3C2L A;  2GWS A;  4O5C A;  7ICP A;  4JUZ A;  3H8S A;  4DSJ A;  5DQI A;  4FBT A;  4R63 A;  4KN7 A;  4KTQ A;  5IIK A;  4DS5 A;  3RJF A;  4DSI A;  4PPX A;  1S77 D;  4O9M A;  5J2B A;  4C8M A;  4KLL A;  1B22 A;  2KFN A;  5D49 A;  5KG1 A;  4ED7 A;  3OSP A;  1BPB A;  1ZQP A;  4O5E A;  3ORY A;  5TZV A;  3RB3 A;  2H5X A;  4YMO A;  4O3O A;  5EWG A;  3AUO A;  1K1Q A;  2NRZ A;  1MQ3 A;  2V9W A;  4EEY A;  3LK9 A;  4O3R A;  4EYH B;  1Z3E B;  4M9G A;  8ICO A;  4M6W A;  5L9X A;  2AGQ A;  1ZQK A;  4ECT A;  4P4O A;  3K75 D;  1NK7 A;  5KFE A;  4ECR A;  2C28 A;  4ECV A;  3RJE A;  4UBC A;  3V6J A;  4I2G A;  3QZ7 A;  5J2E A;  3PVX A;  3JPS A;  2UVU A;  2BHN A;  4RPZ A;  4XQ8 A;  4DO9 A;  2FLN A;  2FPL A;  2JEG A;  4JWN A;  4KLD A;  5J2F A;  5IIL A;  4TUQ A;  3MR2 A;  4B9U A;  3C5F A;  3JPQ A;  4RUC A;  4QWA A;  4Q43 A;  4RQ4 A;  3HX0 A;  3ISB A;  2ASJ A;  2ZJ5 A;  1WCL A;  5KFX A;  4BXO B;  7ICI A;  3M9O B;  5DBA A;  2IA6 A;  5J2J A;  2MUT B;  3PW2 A;  4ZH4 A;  8ICS A;  1TVA A;  5CHG A;  2FMS A;  1QSY A;  4QW8 A;  2UVW A;  4EZ6 A;  4RQ3 A;  5J0S A;  2R8K A;  4UB1 A;  4I2F A;  7ICN A;  4F4Y A;  5DG7 A;  4IRD A;  5KG7 A;  4DLE A;  1NJW A;  1NKE A;  4F3O A;  5IIO A;  9ICJ A;  4KIT B;  5KT5 A;  2FLL A;  3KTQ A;  2XGQ A;  7ICF A;  2AQ4 A;  3JPO A;  2XGP A;  9ICO A;  2J6U A;  4K4H A;  1RXV A;  4M9N A;  2BPC A;  3MR5 A;  5J2D A;  1ZQV A;  4J9Q A;  1SKW A;  4M9H A;  1ZQT A;  2JZB A;  2KFZ A;  4ECW A;  1ZQD A;  4YCX A;  4DL5 A;  5IIJ A;  2I1Q A;  2XY5 A;  4RU9 A;  4BWJ A;  4ECU A;  4M9J A;  3UQ0 A;  2BDP A;  2VA8 A;  4O3Q A;  3KHH A;  4Q45 A;  4GLX A;  3T3F A;  2HHS A;  4QW9 A;  3B0Y A;  5KFR A;  1JX4 A;  3KHR A;  1TAU A;  8ICP A;  3EPI A;  4KLF A;  3AU2 A;  1JXL A;  4I2C A;  4TUR A;  3AU6 A;  1NJY A;  5CWR A;  8ICW A;  3OHB A;  2W9B A;  3PV8 A;  4I2H A;  4LVS A;  4KLS A;  9ICU A;  4Q8E A;  3PO4 A;  4ED2 A;  1BPD A;  1IXR A;  2AU0 A;  4KLT A;  2JEI A;  4M2Y A;  4I27 A;  8ICU A;  1KRP A;  2BKE A;  3LDA A;  4TQR A;  3RBE A;  2NRW A;  1NK5 A;  4JV1 A;  3BQ2 A;  4RT3 A;  2DPI A;  1S76 D;  1MQ2 A;  2BGW A;  2BPF A;  2IMW P;  1BPE A;  5KFZ A;  1BPX A;  5J0T A;  3MFH A;  4ED1 A;  3BDP A;  1CEZ A;  3THV A;  8ICC A;  5BPC A;  7ICH A;  3T5H A;  3UXN A;  3H7I A;  3GV7 B;  1S97 A;  3GIM A;  1BVS A;  4YR3 A;  4GXJ A;  5J2H A;  1C7Y A;  1NJZ A;  2BCU A;  4RQ7 A;  5KFL A;  4QZ8 A;  5BOM A;  3TAP A;  3RB4 A;  1ZQG A;  4IRK A;  9ICF A;  4PGQ A;  1SL0 A;  5D46 A;  4NLN A;  3JPR A;  4JV2 A;  4DEZ A;  3EZ5 A;  3JPN A;  2BQR A;  1ZQJ A;  3KHL A;  1ZQW A;  2IBK A;  2PXI A;  1TKD A;  1LV5 A;  3V72 A;  4PGY A;  3JPT A;  3KHG A;  5J0R A;  4QZF A;  1Z00 A;  4DQQ A;  1ARO P;  1XWL A;  4LZD A;  2JZB B;  4PH5 A;  3GIK A;  4EYI B;  1L3V A;  1BPY A;  2R8J A;  4R65 A;  1XSL A;  2FMP A;  4Q8F A;  4DLG A;  2AJQ A;  1ZQS A;  4KLI A;  2KZZ A;  4X5V A;  2PFO A;  4B9T A;  2PI4 A;  3ZDE A;  1NK6 A;  2JEF A;  4O3P A;  2V4Q A;  3BQT A;  3G6Y A;  9ICV A;  7ICQ A;  3RRH A;  4JWM A;  2HHX A;  2P6R A;  4IRC A;  5DBC A;  4MF8 A;  4ECS A;  4QZB A;  1UT5 A;  3UXO A;  3HP6 A;  3ISC A;  3V7K A;  1QSS A;  3RJJ A;  1SL2 A;  4CCH A;  4I28 A;  5KFN A;  9ICP A;  5KT6 A;  4QZA A;  2WTF A;  2FLP A;  5KFA A;  5KFC A;  2BPG A;  3EW9 A;  4DSK A;  3QZ8 A;  5DGA A;  4UB3 A;  2BCR A;  5KG4 A;  1U47 A;  3H4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...