1WCNA

Nmr structure of the carboxyterminal domains of escherichia coli nusa
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords TRANSCRIPTION ELONGATION PROTEIN NUSA
publication title The E. Coli Nusa Carboxy-Terminal Domains are Structurally Similar and Show Specific Rnap- and Lambdan Interactions
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1wcnA01
2AGOA 3EZ5A 1ZQAA 4ED1A 2IA6A 1Z3EB 1HUZA 5J0SA 2JEGA 9ICVA 3TQ1A 4K4GA 2PI5A 2I9GA 2ZUBA 1ZQCA 2XGQA 4IRCA 4F91B 2HVIA 4NXZA 4PHPA 4LZGA 4J9KA 9ICMA 4F5NA 2V4QA 9ICXA 4QWAA 8ICJA 4BWMA 2PFPA 1RYRA 2FMQA 3MFIA 1D9DA 4F5OA 4QWDA 3MBYA 4IQUA 2NRWA 4UBCA 3MGIA 5J0RA 5D49A 5L1JA 4ELTA 4O5EA 3TAQA 3T3FA 4MF8A 2BGWA 2LYHA 5KFFA 4RQ1A 7ICSA 2FLLA 3Q8KA 1UA1A 4M04A 1NK5A 4ECWA 1ZQMA 8ICAA 5J0OA 2BCVA 1L3SA 1NK9A 5DQHA 5DG7A 3RTVA 4DF8A 1S97A 2W9MA 5CR0A 4RPYA 1DGSA 2BPCA 4QZBA 3RRGA 4J9MA 4I2AA 5J29A 4C8NA 2BHNA 4F93B 3ETLA 2VANA 5CP2A 1S0MA 3PY8A 2J6TA 2XY7A 4KLOA 1V9PA 3UQ0A 1TK0A 4KLJA 2ZUCA 5KG6A 3PMLA 4QZCA 2W9CA 1SL0A 1ZQDA 2ASJA 3KHRA 2GWSA 3PO5A 2NRTA 2PXIA 3GV5B 1B22A 4RQ6A 4IQWA 1NJYA 4QW8A 7ICEA 5DDYA 4RQ2A 3BJYA 4DOCA 4HYKA 2BPGA 4IRKA 4G3IA 8ICTA 4KLMA 7ICRA 1X9SA 8ICCA 1U4BA 1S77D 4F8RA 2AQ4A 3GV8B 1NK7A 5DQGA 5KFRA 4RQ7A 8ICZA 4O0IA 3SZ2A 2C2DA 3ZD8A 4MEXA 3HT3A 3MR5A 3G6VA 2Y1JA 1IM4A 1S0VA 2F1JA 2PFOA 4PHAA 4J9NA 5KG0A 4F50A 1UT5A 3SV3A 3UQ2A 1NK4A 3RJJA 8ICEA 9ICFA 5KFHA 2W9CB 4BWJA 3RJEA 4XA5A 2HHVA 2UVRA 5IIKA 4JWNA 1U49A 5EWEA 9ICAA 3K75D 1ZQGA 4UB4A 3ZD9A 3MR2A 1L3VA 1S0OA 2M9NA 7ICMA 4KLQA 1NKCA 4JUZA 1QSLA 4RNNA 2KZMA 2FMSA 7ICUA 2KFNA 1ZJMA 2RDIA 3MDAA 5DGBA 2ASDA 4QWEA 5DBCA 3NTUA 4KLLA 5DKWA 4KLEA 3ZDAA 4I29A 1COOA 4I2DA 4M9JA 2HHUA 2I1QA 4QWCA 9ICHA 2W9BB 4DS5A 4TUSA 1UT8A 3KHGA 3H4DA 5IIMA 1Z00A 8ICNA 4I2JA 3RB3A 3RR7A 4YP3A 2V4RA 4YMOA 1NJWA 4F3OA 8ICFA 9ICNA 4R64A 4C8MA 1TK5A 4UB1A 1TAUA 5KFWA 1RYSA 3JPOA 5KFEA 4YXMA 2JEJA 2P6UA 4DFJA 1KFDA 2PFQA 4YQWA 1KTQA 5J2CA 4KLUA 9ICBA 9ICSA 4UAWA 2XGPA 4O3SA 1XU4A 4RU9A 7ICJA 2BPFA 3EWAA 2XY6A 1ZQLA 4BXOB 5DQIA 5DBBA 4UB2A 3GIJA 3C5FA 3TARA 2BDPA 8ICHA 1T4GA 2UVUA 4XUSA 3C2MA 3ORYA 4KN7A 5HP4A 2JZBA 4EBEA 4R8UA 1B43A 1XWLA 5IIJA 3M9MB 3GV7B 4J9SA 3ISCA 7ICQA 1ZETA 1Z00B 1U45A 4TUPA 1LB2B 2DFLA 9ICRA 3TI0A 4B9LA 1SKRA 4M2YA 2B21A 2HVHA 2J6UA 4QZ8A 2KN7A 3RAQA 2VA3A 4Q45A 2FPKA 3H8JA 1ZQYA 1MC8A 1KLNA 8ICBA 5J2AA 1NK6A 4KITB 4Q8EA 2J6SA 4YN4A 2AJQA 4YXJA 4I27A 5DB7A 5F9LA 5KFNA 5EWGA 4RUAA 2ZTCA 4UBBA 8ICMA 4DFMA 2JZBB 4F4WA 3BQ0A 4DOAA 4I2CA 3QEBZ 5KFIA 4R8UB 4ED8A 2HHQA 3JPRA 3PX4A 2JEFA 2R8KA 1KRPA 1NK0A 5J0XA 1C7YA 3PW5A 4RPXA 9ICLA 4GC6A 5KT7A 2C2EA 4LZDA 3HP6A 1ZJNA 2KZZA 4FS2A 9ICIA 4QWBA 4DEZA 1TFRA 4F2SA 1ZYQA 5DG9A 1S10A 2FPLA 4Q43A 5IINA 4O3NA 4PH5A 1SKWA 2IHNA 2BCUA 4R65A 2A1JA 8ICYA 5L9XA 3OGUA 3SI8A 4RQ5A 1L5UA 4EZ9A 3UXOA 2BCSA 3RH5A 5L1KA 3M8RA 1T7PA 2IBKA 4DL4A 5KFVA 1JXLA 1ZQFA 4DF4A 4ECVA 2H5XA 2XO7A 4QW9A 7ICIA 3PX0A 5KFJA 5DB6A 4EEYA 9ICCA 1DOQA 4EBCA 1XSNA 4DSEA 1XC9A 5J2GA 3RJFA 3RR8A 3GILA 8ICOA 8ICGA 9ICQA 4NY8A 2NRXA 5HNKA 4ECRA 4NLZA 3G6YA 4M9GA 3IM1A 2Q0ZX 7ICNA 4QZ9A 2F1HA 4PGXA 4YMNA 4R66A 4DFKA 2A1JB 1EXNA 4JV0A 3H4BA 3C21A 5J2IA 1ZQHA 3Q8LA 5DBAA 2W8KA 3B0XA 1SKSA 3H8SA 3UXNA 3MGHA 9ICKA 2KFZA 4J9PA 4UB5A 2C2RA 4J9LA 4ED0A 4PHDA 5J0UA 5KFUA 2W9BA 2BQUA 5KFMA 5J2FA 1ZQOA 4XRHA 2P6RA 4YCXA 4ECQA 4TUQA 5IIOA 2BCRA 4KTQA 8ICXA 3PR5B 3V72A 1X2IA 4F4YA 3ZDBA 3RAXA 3RB6A 4I28A 3PVXA 1WCNA 1NK8A 2XC9A 3ISDA 1TVAA 1RPLA 3Q8PB 1NKBA 5KT3A 2FMPA 5KFGA 4DO9A 2JEIA 9ICPA 1KEJA 3RJKA 1ZQVA 4TQSA 7ICPA 3MFHA 2VA8A 5J2DA 4BXOA 2HHXA 4ECSA 1BPBA 3ZDEA 2IHMA 3FYHA 1KSPA 1JIHA 4KLIA 3PW0A 1S76D 1MSWD 3V7KA 3RH4A 3HWTA 2XCAA 4O5KA 5KT4A 1BGXT 4J9RA 4F92B 1XO1A 3V7LA 2ASLA 4RQ0A 3HW8A 3RJIA 3UPQA 2AQ0A 4P4OA 4RNOA 3GQCA 3GFKB 1CEZA 4F2RA 4MFAA 3EPGA 2MUTA 5J0YA 3TFRA 4YR2A 2IMWP 3FDSA 4C8LA 5CJ7A 2R8HA 2ZTEA 4DSIA 2WTFA 5IILA 5EWFA 3GIMA 2DPJA 3OJSA 5L1IA 3RB0A 3BQ1A 3V6KA 1RZTA 3ZDDA 1K1SA 1U9LA 1LV5A 5J2BA 3RJHA 5L1LA 3ZDCA 4DQSA 5DB9A 3PMNA 4F4ZA 5J2KA 3LWLA 4ED7A 1XS9D 5J2EA 1N48A 1ZQJA 7ICFA 2ZUDA 4DQPA 8ICWA 1KFTA 1JMSA 2R8JA 4CCHA 5KG1A 1ZQKA 4ED6A 5KFXA 3PX6A 5HHIA 4JK1A 3AU2A 3M9NB 4DSKA 7ICOA 3LWMA 2UVWA 4B9VA 1KDHA 3OJUA 1ZQXA 3MR3A 2AGQA 2C22A 4DQRA 1ZQWA 4EZ6A 4F4KA 5KFKA 4EYHB 1MQ2A 2MUTB 3QEAZ 2C28A 3V6JA 4YD2A 4NM2A 5KG5A 9ICOA 3T5JA 5J0TA 3Q8RB 1TV9A 4DL3A 4KLSA 3MR6A 4F5RA 5KFSA 4DS4A 4ELUA 5KG2A 4RQ8A 3N4MB 4DLGA 1BPEA 3G6XA 2ALZA 1D8LA 1QSSA 5KFTA 4YR3A 4F4XA 1ZQSA 1D8YA 1S9FA 1T3NA 2PFNA 1TK8A 3MABA 4KN4A 2P66A 4M6WA 4DQQA 1JX4A 1CUKA 4JWMA 3IHQB 3RBDA 1SL1A 1BPZA 4KLTA 1L3UA 4O3QA 1U48A 4K4HA 4RPZA 4O5CA 4ECXA 5C5JA 8ICVA 5DG8A 5BOLA 1D9FA 3Q8QB 5DDMA 5J0QA 4ED2A 2ISPA 5IIIA 4ED3A 1MQ3A 3C1YA 1A76A 4DL6A 4IQVA 3Q8SB 4DL2A 2NRZA 2XCPA 4ECZA 2BQ3A 1UA0A 3JPPA 5KFLA 5KFDA 4KMUA 3EPIA 5HMLA 4QZGA 1X9WA 3SYZA 1SL2A 1PZNA 2ZJ8A 4UAYA 3PNCA 3PR4A 3T5KA 3OSPA 1RXVA 4B9SA 4QZEA 5TZVA 3LK9A 3K4GA 4J9OA 7ICVA 4BGDA 5KFQA 3JPNA 4M6WB 2VA2A 3EYZA 4P4MA 4M0AA 4GLXA 4I2EA 4Q44A 4TQRA 3M8SA 2XY5A 2FPMA 5KFPA 3ISBA 5KG3A 4QZFA 3GIKA 5HMMA 4RT3A 2BR0A 2Y1IA 3V7JA 5DLGA 5KT6A 2AGPA 4QZIA 4YFKA 3RBEA 3MDCA 3TFSA 4IR9A 5CWRA 4GXIA 2BQRA 3OSNA 1ZQIA 2ZJ5A 3C23A 4RZRA 3RH6A 5DLFA 1ZQEA 4IRDA 1S0NA 4JV1A 7ICLA 8ICIA 4I2FA 4RQ3A 4M9NA 3AU6A 5BOMA 3PO4A 5CB1A 4KLDA 3JPTA 1ZQRA 4M9LA 4O9MA 1HUOA 7ICKA 5KG4A 3NGDA 4ECYA 3AUOA 2R8GA 4K4IA 4NLNA 4NLKA 3E2EA 1ZQQA 2KTQA 2R8IA 4FBUA 4QZDA 1WCLA 8ICRA 7ICHA 2ZTDA 1H38A 4LVSA 3C2LA 3M9OB 1A77A 4GXJA 4PGYA 3QE9Y 1L3TA 3RJGA 7ICGA 2HW3A 5KTQA 5EOZA 3HPOA 4Q8FA 5KT2A 4DLEA 4O3RA 2KZ3A 9ICWA 2UVVA 2HHSA 4MEYA 4YD1A 1SZPA 1TAQA 2HHWA 3SV4A 4RQ4A 2PI4A 3C2KA 5BPCA 5D46A 2V9WA 3JPQA 5F9NA 2DPIA 5DB8A 4P4PA 4QZAA 5KFCA 3PV8A 1BPXA 3RB4A 3JPSA 4BDPA 2NRVA 4C8KA 1JXEA 4YVZA 4PHEA 3Q8MA 4YR0A 1BPYA 9ICTA 1JN3A 4NM1A 2MAXA 5KG7A 4ECTA 4E0DA 4Z6FA 3V6HA 4O3PA 1Y88A 4UB3A 4RUCA 1RXWA 4KLGA 5KFAA 4EBDA 1QLNA 9ICJA 9ICEA 1ZQZA 1ZQBA 3B0YA 2HHTA 5KFZA 4FS1A 9ICGA 4RNMA 3QZ8A 4GXKA 3N97B 4UQGA 1QSYA 2BKEA 8ICLA 1NJZA 4O3OA 4P2HA 8ICKA 4DSFA 4X5VA 3PW4A 2FLPA 2BCQA 4RT2A 4C8OA 4MFFA 1ZQUA 1XSLA 2W9AA 4XQ8A 3H40A 4IR1A 3T5LA 4Z6EA 1ZQNA 4Z6DA 4IQTA 4DOBA 2ATLA 3EW9A 4DL5A 4GC7A 1BVSA 4Z6CA 4DQIA 4I2GA 3LDAA 3KHLA 4QZHA 4F5PA 4B9NA 4M9HA 8ICQA 1U47A 1BPDA 3RRHA 4DSLA 3C5GA 4I2BA 1T8EA 1ZQTA 5HHHA 3HX0A 1NOMA 3BQTA 5DGAA 2RDJA 2AU0A 5KT5A 4YG2A 1ZQPA 4M47A 3TAPA 5KFYA 5J0WA 1XSPA 4B9TA 4MF2A 4UAZA 2OWOA 3KTQA 3C1ZA 4ZH4A 3BQ2A 4TURA 4I2HA 9ICUA 5D4BA 3GIIA 1AROP 3GDXA 3PW7A 1K1QA 5KFBA 3KHHA 1N56A 1TKDA 2ZJAA 4DFPA 5JUMA 4EYIB 7ICTA 4PGQA 3H8WA 1IXRA 3THVA 1QTMA 5J2HA 3T5HA 4B9UA 4MFCA 4FO6A 2FLNA 4ECUA 1NJXA 3PW2A 2ISOA 2F1IA 3OHAA 2W8LA 1KFSA 4YMMA 3H7IA 5KFOA 1X9MA 4DWIA 8ICSA 4JV2A 4R63A 5J0PA 5CHGA 4NLGA 4ELVA 5J2JA 1HJPA 4J9QA 4KLHA 4F5QA 1NKEA 4DSJA 4PPXA 3BDPA 8ICUA 3QZ7A 3OHBA 3TANA 4KLFA 5CA7A 4I2IA 8ICPA 3UXPA 4DL7A 4B9MA 4FBTA
chains in the Genus database with same CATH superfamily
2AGOA 2IA6A 1Z3EB 3TQ1A 4K4GA 2OCEA 2ZUBA 4IRCA 2KHQA 4Y2TA 3DDHA 3UMBA 4PHPA 5AKZA 4JMUA 3QUBA 1D9DA 1L8LA 1UCVA 3MGIA 4ELTA 2KV2A 4Y2SA 3KZIU 2FLLA 8ICAA 1JROA 5H2FU 2BCVA 4UAUA 2EAOA 1Q3VA 2W9MA 5CR0A 1RYUA 5J29A 4F93B 5CP2A 4CF3A 4KLOA 2ZUCA 4C4RA 1UHUA 3A0HU 2DGZA 1ECWA 3BZCA 2KICA 1NJYA 1JALA 8ICTA 7ICRA 4HYKA 3U26A 8ICCA 2AQ4A 3M1YA 5AK5A 2AXTU 3WKBA 4PZNA 1UPHA 3ZD8A 1MA7A 2Y1JA 9ICFA 3RJJA 4AYBC 1X6JA 2W3SA 2H3VA 4XA5A 9ICAA 1U49A 2Y0SF 1QCKA 1S0OA 2MA1A 3VCBA 1QSLA 2R18A 2KZMA 1LKYA 2RDIA 5DGBA 5ALOA 5DBCA 3NTUA 5DKWA 4KLEA 2H3IA 2I1QA 9ICHA 4Y2RA 5FP0A 4DS5A 1PVPA 1NNLA 1Z00A 4I2JA 3RB3A 1F44A 4F3OA 4C8MA 1S8OA 1RYSA 2JEJA 4US8A 4YQWA 5GTHU 1LKYB 5J2CA 3D6JA 4O3SA 1XU4A 2YB4A 3OPXA 2BPFA 1S5LU 3TACB 1B43A 3ISCA 1Z00B 5ALYA 4TUPA 1DGJA 3QUQA 1ZRMA 4M2YA 1VLBA 2DQNB 2B21A 4Q45A 3H8JA 3UMGA 1J2MA 3F5EA 2J6SA 2NYVA 3KKAA 4LJXA 2E5SA 3VC8A 5KFNA 4RUAA 4UBBA 3QUCA 2K4EA 2DKZA 4ED8A 3JPRA 3PX4A 2R8KA 3HKZF 1N2XA 1N5XA 1V97A 2W7PA 2KZZA 9ICIA 4QWBA 2YMQA 2AH5A 1TFRA 1ZYQA 1S10A 1KW4A 1SKWA 4Q43A 4PH5A 2BCUA 8ICYA 5L9XA 2OH2A 3OGUA 3UXOA 3RH5A 5L1KA 4DL4A 5KFVA 1JXLA 4CDGA 3AMZA 2H5XA 5KFJA 3WKCA 4EEYA 2BDUA 5J2GA 3RR8A 2W11A 1KN5A 2RHFA 2Q0ZX 7ICNA 4NL9A 4YMNA 2KEYA 3HRDD 1L7OA 2YX8A 3C21A 1RQLA 4ZOHC 2E8PA 3H8SA 3MGHA 5AM1A 3AQFA 4UB5A 4J9LA 4ED0A 2BQUA 5KFMA 2P35A 4ECQA 4TUQA 4B6JA 8ICXA 3H8MA 3D2NA 2RP5A 1TAMA 3ISDA 1WWUA 5AIAA 1NKBA 3Q8PB 9ICPA 1ZD2P 1ZQVA 4C7ZA 5J2DA 2EAMA 3H0MB 2OYYA 3ZDEA 4KLIA 1S76D 3V7KA 3HILA 3HWTA 3V7LA 4CGZA 2ASLA 4MFAA 2MUTA 2IMWP 4C8LA 5CJ7A 2WTFA 5AM3A 3ZDCA 3RJHA 5L1LA 4F4ZA 3LWLA 8ICWA 1KFTA 4CCHA 3PX6A 2WB1F 3KZXA 2VJ5A 3LWMA 4B9VA 2AGQA 4F4KA 2C22A 2KE7A 4EYHB 2MUTB 3QEAZ 2C28A 3V6JA 4NM2A 3ETRA 2E1EA 3Q8RB 4DLGA 1BPEA 4F4XA 2PFNA 1ZQSA 4I27A 2P66A 3MABA 3SAFA 4JWMA 3IHQB 4EX7A 3RBDA 4O5CA 4ECXA 2LYAA 5IIIA 4ED3A 1MQ3A 5AKIA 2NRZA 4ECZA 2BQ3A 1UA0A 5KFDA 1X9WA 1KKXA 3PNCA 5TZVA 2W54A 1ED1A 4M0AA 4Q44A 4TQRA 3M8SA 3GIKA 5ALUA 2GOLA 4BUGA 3KOOA 5DLGA 2AGPA 4YFKA 4IR9A 5EE9A 5CWRA 4GXIA 2HSZA 2BQRA 3OSNA 3RH6A 5DLFA 2PMZF 1S0NA 5ALJA 4M9NA 4P0PB 4KLDA 1ZQRA 2LI6A 2ZIXA 2MU2A 3AUOA 4NLNA 4NLKA 3E2EA 1ZQQA 5G5GA 1FFUA 4LVSA 1HIWA 3M9OB 1A77A 4PGYA 1C20A 2HHSA 4MEYA 1TAQA 3SV4A 3C2KA 2V9WA 2G07A 1ZXIA 1CI4A 1BPXA 2L5YA 4YR0A 5KFAA 3H0LB 2DKXA 3R9KA 1SXEA 1QSYA 1NJZA 4P2HA 3CW2C 4DSFA 3PW4A 2FLPA 2BCQA 2K4HA 1B4FA 3H40A 4Z6EA 1BVSA 1K5OA 1L8OA 3NRZA 5KL8B 3LDAA 2HDOA 1ZQTA 5ALVA 3SAHA 4M47A 3TAPA 4UAZA 3C1ZA 3GIIA 3WK9A 5KFBA 1N56A 3FAHA 2ZJAA 2KIWA 3T5HA 1NJXA 2KVCA 3H7IA 4YMMA 1X9MA 5ALGA 5J0PA 5ALQA 5J2JA 4ACOA 4DSJA 5AM5A 4PPXA 2EZYA 8ICUA 3QZ7A 4Y2UA 2ZIUB 3OHBA 4KLFA 5CA7A 8ICPA 3UXPA 4USAA 3AEVA 4B9MA 5EE3A 3QU2A 4FBTA 3WK4A 1HUZA 2JEGA 5J0SA 1ZQCA 2XGQA 4F91B 4LZGA 4F5NA 3M6ZA 2KJ5A 2FDRA 3ED5A 2FI1A 4UBCA 4OCZA 2QKQA 2BGWA 2LYHA 7ICSA 3B9JA 1WUDA 1NK9A 2CXYA 3IG5A 4DF8A 5AKHA 4EENA 3N7PD 2BPCA 2LKYA 3NRWA 4J9MA 3ETLA 3PY8A 2XY7A 1V9PA 3UQ0A 5KG6A 4QZCA 2W9CA 1ZQDA 2GWSA 3PO5A 2PXIA 1B22A 4DOCA 1SWVA 4KX3A 3GV8B 1NK7A 1X66A 2IOFK 5DQGA 4RQ7A 8ICZA 4O0IA 2C2DA 1JI7A 2ES6A 3HT3A 4ICAA 3G6VA 2F1JA 4J9NA 5KG0A 3SV3A 1NK4A 8ICEA 2W9CB 1N60A 5ALFA 5IIKA 4JWNA 1ZQGA 4UB4A 3MR2A 2RQ5A 1L3VA 1NKCA 4RQNA 2A1AA 2JHDA 1SWWA 4DFDA 1B0XA 2KFNA 1YZ7A 2ASDA 2HBKA 4KLLA 2NO4A 4I29A 1COOA 2JH7A 4QWCA 3H4DA 2G5IB 2Y0SC 3GZFA 4YP3A 2V4RA 4YMOA 1NJWA 1TK5A 1TAUA 4YXMA 2P6UA 4DFJA 1F5SA 4KLUA 2A3VA 9ICSA 1F0MA 4UAWA 2XGPA 5AHXA 4DCCA 2EH9A 3EWAA 5AI6A 2XY6A 4BXOB 4UB6U 1X40A 4BX9C 1T4GA 3C2MA 1ZD4A 3LYSA 2RLTA 3GV7B 1L7PA 3GU3A 5ALMA 2DBYA 5EE0A 2DFLA 3N7RC 3NVWA 3TI0A 9ICRA 1QQ6A 2HVHA 2J6UA 2DWQA 2VA3A 1ZQYA 1MC8A 8ICBA 4Q8EA 4YXJA 3KKAC 5DB7A 4KMOB 3J81j 4F4WA 3BQ0A 3QEBZ 2CPRA 3IDWA 2PKEA 1KRPA 2HBMA 2I5HA 2WF7A 4GC6A 2C2EA 4LZDA 1ZJNA 2B0CA 2FPLA 5IINA 1N5WA 4O3NA 3SENA 4R65A 2EZXA 4RQ5A 4EZ9A 2XO7A 3TADA 7ICIA 2KJ9A 1XSNA 2ZXHA 3RJFA 3HKZC 4OJ5A 9ICQA 5ALNA 4ECRA 3NASA 4M9GA 2W7OA 2XI9A 4PGXA 4DFKA 4JV0A 1EXNA 1P7DA 3NVYA 4NL9C 3L5KA 2KFZA 2F3NA 4UATA 1ZQOA 2F8KA 2P6RA 3V72A 1X2IA 3RB6A 1WCNA 1L6NA 4OD0A 2YQEA 4NLCA 2XICA 1TVAA 3KFUF 4J03A 1KEJA 3OTQA 4TQSA 7ICPA 3MFHA 5AKXA 2A19A 1KSPA 1JIHA 5KAFU 3PW0A 1MSWD 2KK0A 3QYPA 1XO0A 2ZIVB 3IG8A 1BGXT 3QX7A 4F92B 2HMXA 3RJIA 3UPQA 4P4OA 1CEZA 1XNSA 4F2RA 4NWIA 2YB1A 3AM9A 2ZTEA 3GIMA 2DPJA 3OJSA 5L1IA 4F72A 3BQ1A 3ZDDA 1N48A 1XS9D 4ED7A 3ZI4A 1ZQJA 4EZ6A 5J2EA 4DQPA 1QQ5A 4ED6A 3LVWA 2E1FA 1DRGA 4OO1J 3CP8A 1WYGA 3M9NB 7ICOA 1KDHA 1PK3A 4UB8U 4YD2A 3T5JA 4Y2XA 2HCFA 4F71A 5KFSA 2F2AB 4FFDA 1QSSA 2VJ4A 3SEIA 5KFTA 1S9FA 1TK8A 4JB3A 4KN4A 1IV8A 1JX4A 2WB1C 4EX6A 2JXJA 1URJA 4K4HA 2KKVA 2QLTA 5ALXA 5ALHA 5C5JA 4O3MA 5DG8A 5DDMA 5J0QA 2I6XA 4ED2A 1LVHA 2Y9TA 1A76A 4KMUA 3EPIA 3SYZA 2ZJ8A 3T5KA 3OSPA 4B9SA 1OXJA 4J9OA 4BGDA 5KFQA 3RF9A 2FPMA 3ISBA 4RT3A 3V7JA 3C28A 4JV1A 4RQ3A 5BOMA 4M9LA 2EDUA 5ALPA 4ECYA 4K4IA 3DV9A 7ICHA 1SV0C 4C4TA 1H38A 3QU7A 5T14A 3RJGA 5KTQA 5EOZA 4Q8FA 1SGGA 4DLEA 5BPCA 2WAQF 5AK6A 2PMZC 5F9NA 2DPIA 5DB8A 1IIPA 5KFCA 3ICXA 3JPSA 4YVZA 1JN3A 4NM1A 4ECTA 4E0DA 3V6HA 1X6IA 5AI0A 1Y88A 4EBDA 1ZQZA 2JGAA 4FS1A 9ICGA 4RNMA 2D3DA 3QZ8A 1PK1A 2BKEA 1MN8A 4RT2A 2BZFA 2LHTA 1ZQUA 4XQ8A 3FC4A 3T5LA 1FEZA 3I76A 4Z6DA 2NO5A 3EW9A 3F2BA 5F3XB 2B6GA 4B9NA 1BPDA 4DSLA 5HHHA 3HX0A 5DGAA 5KT5A 2QARB 2F77X 2E8NA 5J0WA 4B9TA 1L7NA 1PK1B 4PL2A 3BQ2A 5D4BA 4UAVA 3QNMA 3KHHA 2ZIWB 1TKDA 3QU5A 3HJEA 3KD3A 4MFCA 1V38A 2ISOA 4C8OA 3N7SC 2F1IA 3OHAA 2W8LA 1KFSA 5KFOA 4DWIA 2OXOA 2JRZA 4JV2A 2G0AA 1OUQA 1NKEA 3QU9A 3TANA 3K1RB 4I2IA 3BQ7A 1ZQAA 4ED1A 1VJ5A 2I9GA 9ICMA 4J9KA 2G09A 2V4QA 4QWAA 8ICJA 1YZ6A 1RYRA 2FMQA 4Y2QA 3MFIA 4F5OA 4P0PA 4IQUA 3L4PA 2NRWA 2KOBA 3QU4A 5L1JA 1SB3C 4O5EA 3T3FA 4FZMA 4MF8A 4RQ1A 3Q8KA 4M04A 1NK5A 1ZQMA 5DQHA 3RTVA 3MGVA 4CF5A 3DEEA 4RPYA 1DGSA 5AKLA 3WU2U 4QZBA 3RRGA 4I2AA 4C8NA 1X42A 1S0MA 4QJFB 2WFAA 4CRXA 3PMLA 1SL0A 3KHRA 2MRLA 1SV0A 4OJPA 5DDYA 4NLBA 4RQ2A 3BJYA 4G3IA 3RFAA 1U4BA 1S77D 4F8RA 3UM9A 3SZ2A 2KKPA 1S0VA 1IM4A 4PHAA 4F50A 1UT5A 5KFHA 3RJEA 3NS1A 2HHVA 2UVRA 5EWEA 3K75D 3ZD9A 4KLQA 4JUZA 2LPEA 4HAIA 3WKAA 1NZBA 1BNOA 5ALRA 1ZJMA 3MDAA 2FJ6A 2OEHA 5AI9A 4I2DA 4M9JA 2HHUA 5ALWA 2W9BB 4TUSA 3N28A 2H3QA 2HBLA 3KHGA 1UQVA 3RR7A 5K4LA 2ZIUA 8ICFA 9ICNA 4R64A 5GTIU 3JPOA 5KFEA 4EELA 2PFQA 1KTQA 1M6YA 3QXGA 5C0YA 3NVZA 3L3FX 3CRXA 1ZQLA 5DQIA 3C5FA 3TARA 2BDPA 2UVUA 3ORYA 4KN7A 2JZBA 4EBEA 3M9MB 5IIJA 7ICQA 1U45A 1LB2B 4P0QA 1J97A 2JR5A 1ZRNA 1SKRA 5EE1A 5ALZA 4QZ8A 2KN7A 2FPKA 3AL0B 1AQ6A 2D8CA 1D8BA 2F76X 1KLNA 4KITB 2AJQA 5F9LA 5EWGA 2YMPA 2F8LA 8ICMA 4DFMA 2E8OA 2JZBB 4I2CA 5KFIA 3E58A 2JEFA 5A0LA 5J0XA 4P0QB 1J2NA 2E3TA 1N63A 3HP6A 4F2SA 3WK5A 5DG9A 2IHNA 2JH1A 2QB0A 3SI8A 4IS7A 3TKAA 1L5UA 5TISU 3M8RA 2IBKA 1QQ7A 4DF4A 3BS5B 4QW9A 3PX0A 1FFVA 5DB6A 3TADC 1Z19A 2EANA 4EBCA 2WF9A 3WK8A 2W3RA 3GILA 8ICOA 8ICGA 4NY8A 5HNKA 4EEKA 5AICA 5J2IA 2QB0B 3Q8LA 3B0XA 3UXNA 3ONNA 9ICKA 5HR7A 4PHDA 5J0UA 4NJ8A 5KFUA 5J2FA 4XRHA 3ALRA 3WKEA 5IIOA 4KTQA 3ZDBA 3RAXA 4I28A 1NK8A 3M6KA 1RPLA 2FE9A 4Y2JA 5AKYA 5KFGA 4DO9A 2JEIA 4NV0A 4FE3A 3MC1A 4BXOA 3FYHA 2G06A 3RH4A 2XCAA 5KT4A 4J9RA 1JRPA 4RQ0A 2AQ0A 4Y2VA 4RNOA 3GFKB 2WHEA 4UW9A 2M0NA 1ZOLA 2R8HA 5G5HA 4OJ6A 1SIJA 3F53A 1PVQA 3O0FA 3RB0A 1RZTA 1U9LA 1LV5A 4DQSA 5DB9A 4IC9A 3PMNA 5J2KA 8ICHA 2DL0A 1JMSA 5KG1A 1ZQKA 2ODGA 4JK1A 2UVWA 3OJUA 1ZQXA 2EZZA 3IN5A 4FZLA 1MQ2A 2ESEA 4U7CA 3EUB2 5J0TA 1RG6A 1TV9A 4KLSA 3MR6A 4F5RA 5B5EU 2KVSA 4DS4A 4ELUA 5KG2A 4BJQA 3N4MB 3G6XA 1D8LA 2GH1A 4YR3A 1D8YA 3E0FA 4MHVA 4M6WA 1O03A 4DQQA 1CUKA 2E8MA 2HI0A 2K4IA 1SL1A 1L3UA 4O3QA 4RPZA 2W55A 3S6JA 8ICVA 3Q8QB 1SZHA 4CF4A 3C1YA 4C7YA 2GLEA 3FM9A 4DL6A 2YY6A 2LMRA 4DL2A 2XCPA 3JPPA 2K8CB 4QZGA 1PZNA 4UAYA 3PR4A 1RXVA 3LK9A 7ICVA 4M6WB 3EYZA 4P4MA 4GLXA 4I2EA 1N61A 2XY5A 5KFPA 5KG3A 2BR0A 2IOFA 5KT6A 4QZIA 3MDCA 3I28A 2HOFA 3IV6A 3C23A 4RZRA 5AI8A 4IRDA 1HEKA 7ICLA 8ICIA 4I2FA 3AU6A 3JPTA 4QNLA 1HUOA 3AN1A 2ZIVA 1Q8KA 5KG4A 2R8GA 2KTQA 4PZOA 2R8IA 8ICRA 3F5AA 2WF6A 2ZTDA 1O08A 3C2LA 3QE9Y 4GXJA 2HW3A 1L3TA 7ICGA 2KIVA 3HPOA 5AM4A 1KBUA 5KT2A 9ICWA 4YD1A 1SZPA 3PSPA 4RQ4A 2PI4A 3SAGA 2HBJA 4CNQA 5D46A 1PVRA 4P4PA 3PV8A 4QZAA 3RB4A 1JXEA 3Q8MA 4PHEA 4Z6FA 1KQQA 4KLGA 9ICEA 1ZQBA 3B0YA 1FO4A 2HHTA 5KL1B 2AHOB 4UQGA 4PJ0U 8ICLA 4O3OA 4X5VA 2WAQC 4IR1A 1ZQNA 1ZD3A 4IQTA 2ATLA 4DL5A 5ALSA 2QB1A 3KHLA 4M9HA 1U47A 3RRHA 4I2BA 1NOMA 3BQTA 2RDJA 3PSTA 4G9BA 4YG2A 1ZQPA 5J8YA 2DF4B 2XIDA 4I2HA 1NZPA 9ICUA 3CYMA 5CEHA 3IRUA 5AM0A 1AROP 3PW7A 1K1QA 1IXRA 2FLNA 4ECUA 3PW2A 1BNPA 3WKDA 4NLGA 2RRDA 4J9QA 4KLHA 3BDPA 2GO7A 2OM6A 3EZ5A 1Z4OA 9ICVA 2PI5A 1WWVA 3BZKA 2HVIA 4NXZA 3UMCA 9ICXA 4BWMA 2PFPA 5ALLA 4QWDA 3MBYA 5J0RA 5D49A 3TAQA 5KFFA 5ALIA 1UA1A 4ECWA 5J0OA 5DG7A 1S97A 2KG5A 2Q4TA 2YN4A 2BHNA 4QIWC 2VANA 2J6TA 4KLJA 1TK0A 5ALTA 1JUDA 4AYBF 2ASJA 2NRTA 1DXSA 3GV5B 4RQ6A 4IQWA 5AI5A 4QW8A 7ICEA 1OW5A 5AK3A 3SMVA 2BPGA 4IRKA 4KLMA 1X9SA 2NV3A 3K1ZA 1T94A 4Y2PA 5KFRA 5E79U 4MEXA 3BS7A 3MR5A 2PFOA 3UQ2A 4BWJA 2LYBA 2QARA 2M9NA 2G08A 7ICMA 3PSFA 5AM2A 4RNNA 2FMSA 4GFJA 2ZIWA 7ICUA 1X9XA 1IG6A 4QWEA 3ZDAA 4CE6A 1GO3F 5AKEA 1A0PA 1UT8A 5IIMA 5CRXA 8ICNA 5L1MA 4UB1A 5KFWA 2ZXIA 4C80A 1KFDA 1RM6C 2MSNA 9ICBA 3SD7A 4RU9A 3AQEA 7ICJA 5DBBA 4UB2A 3GIJA 4XUSA 2DUYA 5HP4A 3H0RB 4R8UA 1XWLA 4J9SA 1ZETA 4B9LA 2CRXA 2Z7JA 5KAIU 3RAQA 4PL1A 1WG8A 1Z4NA 5J2AA 1NK6A 4YN4A 4QIWF 4C4SA 4U6PA 2KSOA 1L7MA 2ZTCA 1YT3A 3C29A 1KL9A 4DOAA 4R8UB 2HHQA 2CN1A 4UASA 1NK0A 1C7YA 3PW5A 4RPXA 9ICLA 5KT7A 4FS2A 2EQYA 4DEZA 3I1YA 3F2DA 3WK6A 2A1JA 1NI3A 2VKQA 2BCSA 1T7PA 2ZG6A 1ZQFA 4ECVA 2KSOB 5AKGA 2KD1A 3SQIA 9ICCA 1DOQA 4DSEA 1XC9A 5AI4A 5JU5A 2NRXA 2O6KA 4NLZA 3G6YA 3SR6A 3IM1A 3QUTA 4QZ9A 2F1HA 5JRTA 1Z1VA 4R66A 3H4BA 2A1JB 1ZQHA 2LBOA 5ALEA 5DBAA 2W8KA 1SKSA 2F44A 4J9PA 3T79A 2C2RA 2W9BA 3D2SA 4YCXA 2W43A 2BCRA 3PR5B 3IP4B 2KP7A 4F4YA 3PVXA 2H3ZA 2XC9A 5KT3A 2FMPA 5JTIA 3RJKA 2KHVA 2VA8A 2KJ8A 2HHXA 4C0ZA 4ECSA 1BPBA 2IHMA 2ZIXB 4O5KA 2Y9UA 1ZQ1C 1XO1A 3HW8A 1RDFA 3GQCA 3EPGA 5J0YA 3TFRA 4YR2A 3FDSA 4DSIA 5IILA 5EWFA 1PUZA 3V6KA 1K1SA 5J2BA 1L3SA 7ICFA 2YMMA 2ZUDA 2R8JA 5KFXA 5HHIA 4KX5A 3AU2A 4DSKA 3NUQA 3MR3A 2IOHA 4DQRA 1ZQWA 5KFKA 5AIBA 9ICOA 5KG5A 1ZD5A 3WK7A 2K89A 4DL3A 3NVVA 5AK4A 4US9A 4RQ8A 2ALZA 3BS5A 1T3NA 3D2QA 1DK3A 1BPZA 4KLTA 1U48A 4IL6U 5KNIA 5BOLA 1D9FA 2ISPA 4OJOA 2HOQA 4IQVA 4A8EA 3Q8SB 5KFLA 1DK2A 2W03A 5HMLA 1SL2A 2WF8A 2K4PA 4QZEA 4WJ3B 3K4GA 3JPNA 3M7DA 2VA2A 5AKKA 3CNHA 4QZFA 5HMMA 2Y1IA 3RBEA 3TFSA 5ALDA 1ZQIA 2ZJ5A 4Y2YA 1Q3UA 1ZQEA 1VDVA 4GIBA 3PO4A 1N62A 5CB1A 4O9MA 1CRXA 7ICKA 3NGDA 1TE2A 1FIQA 1V85A 1QH9A 4FBUA 4QZDA 1WCLA 3LVVA 2H3FA 5B66U 5HR6A 2LM4A 2EAPA 2JMGA 2KNJA 4O3RA 2KZ3A 2UVVA 2HHWA 1A6SA 3A0BU 2K8AA 1RQNA 3JPQA 4BDPA 2NRVA 4C8KA 4FZNA 1BPYA 9ICTA 2VIXA 2MAXA 5KG7A 3PSIA 1Z1BA 2K8BB 4O3PA 4UB3A 4RUCA 1RXWA 1QLNA 9ICJA 4RQMA 5KFZA 4OJLA 1Q46A 2G5HB 4GXKA 3N97B 8ICKA 2KMDA 2LM1A 3F2CA 4MFFA 1XSLA 2XVTA 2W9AA 2N1RA 2YMLA 4DOBA 4DQIA 2YTUA 4GC7A 5AKJA 4Z6CA 4I2GA 4AP9A 4QZHA 4F5PA 5ALKA 8ICQA 3C5GA 1T8EA 3PZPA 1SV4A 2AU0A 1COKA 5KFYA 1XSPA 4MF2A 5J8YC 2OWOA 3KTQA 4ZH4A 4TURA 3GDXA 4UARA 2K60A 2HOIA 2W04A 4DFPA 5JUMA 4EYIB 7ICTA 4PGQA 3H8WA 3THVA 1QTMA 5J2HA 4B9UA 3KBBA 4FO6A 2OHFA 2WF5A 2D6FC 8ICSA 1SXDA 2JV3A 4R63A 5CHGA 4ELVA 1HJPA 4F5QA 1T3QA 4DL7A
chains in the Genus database with same CATH topology
2AGOA 3EZ5A 1ZQAA 4ED1A 2IA6A 1Z3EB 1HUZA 5J0SA 2JEGA 9ICVA 3TQ1A 4K4GA 2PI5A 2I9GA 2ZUBA 1ZQCA 2XGQA 4IRCA 4F91B 2HVIA 4NXZA 4PHPA 4LZGA 4J9KA 9ICMA 4F5NA 2V4QA 9ICXA 4QWAA 8ICJA 4BWMA 2PFPA 1RYRA 2FMQA 3MFIA 1D9DA 4F5OA 4QWDA 3MBYA 4IQUA 2NRWA 4UBCA 3MGIA 5J0RA 5D49A 5L1JA 4ELTA 4O5EA 3TAQA 3T3FA 4MF8A 2BGWA 2LYHA 5KFFA 4RQ1A 7ICSA 2FLLA 3Q8KA 1UA1A 4M04A 1NK5A 4ECWA 1ZQMA 8ICAA 5J0OA 2BCVA 1L3SA 1NK9A 5DQHA 5DG7A 3RTVA 4DF8A 1S97A 2W9MA 5CR0A 4RPYA 1DGSA 2BPCA 4QZBA 3RRGA 4J9MA 4I2AA 5J29A 4C8NA 2BHNA 4F93B 3ETLA 2VANA 5CP2A 1S0MA 3PY8A 2J6TA 2XY7A 4KLOA 1V9PA 3UQ0A 1TK0A 4KLJA 2ZUCA 5KG6A 3PMLA 4QZCA 2W9CA 1SL0A 1ZQDA 2ASJA 3KHRA 2GWSA 3PO5A 2NRTA 2PXIA 3GV5B 1B22A 4RQ6A 4IQWA 1NJYA 4QW8A 7ICEA 5DDYA 4RQ2A 3BJYA 4DOCA 4HYKA 2BPGA 4IRKA 4G3IA 8ICTA 4KLMA 7ICRA 1X9SA 8ICCA 1U4BA 1S77D 4F8RA 2AQ4A 3GV8B 1NK7A 5DQGA 5KFRA 4RQ7A 8ICZA 4O0IA 3SZ2A 2C2DA 3ZD8A 4MEXA 3HT3A 3MR5A 3G6VA 2Y1JA 1IM4A 1S0VA 2F1JA 2PFOA 4PHAA 4J9NA 5KG0A 4F50A 1UT5A 3SV3A 3UQ2A 1NK4A 3RJJA 8ICEA 9ICFA 5KFHA 2W9CB 4BWJA 3RJEA 4XA5A 2HHVA 2UVRA 5IIKA 4JWNA 1U49A 5EWEA 9ICAA 3K75D 1ZQGA 4UB4A 3ZD9A 3MR2A 1L3VA 1S0OA 2M9NA 7ICMA 4KLQA 1NKCA 4JUZA 1QSLA 4RNNA 2KZMA 2FMSA 7ICUA 2KFNA 1ZJMA 2RDIA 3MDAA 5DGBA 2ASDA 4QWEA 5DBCA 3NTUA 4KLLA 5DKWA 4KLEA 3ZDAA 4I29A 1COOA 4I2DA 4M9JA 2HHUA 2I1QA 4QWCA 9ICHA 2W9BB 4DS5A 4TUSA 1UT8A 3KHGA 3H4DA 5IIMA 1Z00A 8ICNA 4I2JA 3RB3A 3RR7A 4YP3A 2V4RA 4YMOA 1NJWA 4F3OA 8ICFA 9ICNA 4R64A 4C8MA 1TK5A 4UB1A 1TAUA 5KFWA 1RYSA 3JPOA 5KFEA 4YXMA 2JEJA 2P6UA 4DFJA 1KFDA 2PFQA 4YQWA 1KTQA 5J2CA 4KLUA 9ICBA 9ICSA 4UAWA 2XGPA 4O3SA 1XU4A 4RU9A 7ICJA 2BPFA 3EWAA 2XY6A 1ZQLA 4BXOB 5DQIA 5DBBA 4UB2A 3GIJA 3C5FA 3TARA 2BDPA 8ICHA 1T4GA 2UVUA 4XUSA 3C2MA 3ORYA 4KN7A 5HP4A 2JZBA 4EBEA 4R8UA 1B43A 1XWLA 5IIJA 3M9MB 3GV7B 4J9SA 3ISCA 7ICQA 1ZETA 1Z00B 1U45A 4TUPA 1LB2B 2DFLA 9ICRA 3TI0A 4B9LA 1SKRA 4M2YA 2B21A 2HVHA 2J6UA 4QZ8A 2KN7A 3RAQA 2VA3A 4Q45A 2FPKA 3H8JA 1ZQYA 1MC8A 1KLNA 8ICBA 5J2AA 1NK6A 4KITB 4Q8EA 2J6SA 4YN4A 2AJQA 4YXJA 4I27A 5DB7A 5F9LA 5KFNA 5EWGA 4RUAA 2ZTCA 4UBBA 8ICMA 4DFMA 2JZBB 4F4WA 3BQ0A 4DOAA 4I2CA 3QEBZ 5KFIA 4R8UB 4ED8A 2HHQA 3JPRA 3PX4A 2JEFA 2R8KA 1KRPA 1NK0A 5J0XA 1C7YA 3PW5A 4RPXA 9ICLA 4GC6A 5KT7A 2C2EA 4LZDA 3HP6A 1ZJNA 2KZZA 4FS2A 9ICIA 4QWBA 4DEZA 1TFRA 4F2SA 1ZYQA 5DG9A 1S10A 2FPLA 4Q43A 5IINA 4O3NA 4PH5A 1SKWA 2IHNA 2BCUA 4R65A 2A1JA 8ICYA 5L9XA 3OGUA 3SI8A 4RQ5A 1L5UA 4EZ9A 3UXOA 2BCSA 3RH5A 5L1KA 3M8RA 1T7PA 2IBKA 4DL4A 5KFVA 1JXLA 1ZQFA 4DF4A 4ECVA 2H5XA 2XO7A 4QW9A 7ICIA 3PX0A 5KFJA 5DB6A 4EEYA 9ICCA 1DOQA 4EBCA 1XSNA 4DSEA 1XC9A 5J2GA 3RJFA 3RR8A 3GILA 8ICOA 8ICGA 9ICQA 4NY8A 2NRXA 5HNKA 4ECRA 4NLZA 3G6YA 4M9GA 3IM1A 2Q0ZX 7ICNA 4QZ9A 2F1HA 4PGXA 4YMNA 4R66A 4DFKA 2A1JB 1EXNA 4JV0A 3H4BA 3C21A 5J2IA 1ZQHA 3Q8LA 5DBAA 2W8KA 3B0XA 1SKSA 3H8SA 3UXNA 3MGHA 9ICKA 2KFZA 4J9PA 4UB5A 2C2RA 4J9LA 4ED0A 4PHDA 5J0UA 5KFUA 2W9BA 2BQUA 5KFMA 5J2FA 1ZQOA 4XRHA 2P6RA 4YCXA 4ECQA 4TUQA 5IIOA 2BCRA 4KTQA 8ICXA 3PR5B 3V72A 1X2IA 4F4YA 3ZDBA 3RAXA 3RB6A 4I28A 3PVXA 1WCNA 1NK8A 2XC9A 3ISDA 1TVAA 1RPLA 3Q8PB 1NKBA 5KT3A 2FMPA 5KFGA 4DO9A 2JEIA 9ICPA 1KEJA 3RJKA 1ZQVA 4TQSA 7ICPA 3MFHA 2VA8A 5J2DA 4BXOA 2HHXA 4ECSA 1BPBA 3ZDEA 2IHMA 3FYHA 1KSPA 1JIHA 4KLIA 3PW0A 1S76D 1MSWD 3V7KA 3RH4A 3HWTA 2XCAA 4O5KA 5KT4A 1BGXT 4J9RA 4F92B 1XO1A 3V7LA 2ASLA 4RQ0A 3HW8A 3RJIA 3UPQA 2AQ0A 4P4OA 4RNOA 3GQCA 3GFKB 1CEZA 4F2RA 4MFAA 3EPGA 2MUTA 5J0YA 3TFRA 4YR2A 2IMWP 3FDSA 4C8LA 5CJ7A 2R8HA 2ZTEA 4DSIA 2WTFA 5IILA 5EWFA 3GIMA 2DPJA 3OJSA 5L1IA 3RB0A 3BQ1A 3V6KA 1RZTA 3ZDDA 1K1SA 1U9LA 1LV5A 5J2BA 3RJHA 5L1LA 3ZDCA 4DQSA 5DB9A 3PMNA 4F4ZA 5J2KA 3LWLA 4ED7A 1XS9D 5J2EA 1N48A 1ZQJA 7ICFA 2ZUDA 4DQPA 8ICWA 1KFTA 1JMSA 2R8JA 4CCHA 5KG1A 1ZQKA 4ED6A 5KFXA 3PX6A 5HHIA 4JK1A 3AU2A 3M9NB 4DSKA 7ICOA 3LWMA 2UVWA 4B9VA 1KDHA 3OJUA 1ZQXA 3MR3A 2AGQA 2C22A 4DQRA 1ZQWA 4EZ6A 4F4KA 5KFKA 4EYHB 1MQ2A 2MUTB 3QEAZ 2C28A 3V6JA 4YD2A 4NM2A 5KG5A 9ICOA 3T5JA 5J0TA 3Q8RB 1TV9A 4DL3A 4KLSA 3MR6A 4F5RA 5KFSA 4DS4A 4ELUA 5KG2A 4RQ8A 3N4MB 4DLGA 1BPEA 3G6XA 2ALZA 1D8LA 1QSSA 5KFTA 4YR3A 4F4XA 1ZQSA 1D8YA 1S9FA 1T3NA 2PFNA 1TK8A 3MABA 4KN4A 2P66A 4M6WA 4DQQA 1JX4A 1CUKA 4JWMA 3IHQB 3RBDA 1SL1A 1BPZA 4KLTA 1L3UA 4O3QA 1U48A 4K4HA 4RPZA 4O5CA 4ECXA 5C5JA 8ICVA 5DG8A 5BOLA 1D9FA 3Q8QB 5DDMA 5J0QA 4ED2A 2ISPA 5IIIA 4ED3A 1MQ3A 3C1YA 1A76A 4DL6A 4IQVA 3Q8SB 4DL2A 2NRZA 2XCPA 4ECZA 2BQ3A 1UA0A 3JPPA 5KFLA 5KFDA 4KMUA 3EPIA 5HMLA 4QZGA 1X9WA 3SYZA 1SL2A 1PZNA 2ZJ8A 4UAYA 3PNCA 3PR4A 3T5KA 3OSPA 1RXVA 4B9SA 4QZEA 5TZVA 3LK9A 3K4GA 4J9OA 7ICVA 4BGDA 5KFQA 3JPNA 4M6WB 2VA2A 3EYZA 4P4MA 4M0AA 4GLXA 4I2EA 4Q44A 4TQRA 3M8SA 2XY5A 2FPMA 5KFPA 3ISBA 5KG3A 4QZFA 3GIKA 5HMMA 4RT3A 2BR0A 2Y1IA 3V7JA 5DLGA 5KT6A 2AGPA 4QZIA 4YFKA 3RBEA 3MDCA 3TFSA 4IR9A 5CWRA 4GXIA 2BQRA 3OSNA 1ZQIA 2ZJ5A 3C23A 4RZRA 3RH6A 5DLFA 1ZQEA 4IRDA 1S0NA 4JV1A 7ICLA 8ICIA 4I2FA 4RQ3A 4M9NA 3AU6A 5BOMA 3PO4A 5CB1A 4KLDA 3JPTA 1ZQRA 4M9LA 4O9MA 1HUOA 7ICKA 5KG4A 3NGDA 4ECYA 3AUOA 2R8GA 4K4IA 4NLNA 4NLKA 3E2EA 1ZQQA 2KTQA 2R8IA 4FBUA 4QZDA 1WCLA 8ICRA 7ICHA 2ZTDA 1H38A 4LVSA 3C2LA 3M9OB 1A77A 4GXJA 4PGYA 3QE9Y 1L3TA 3RJGA 7ICGA 2HW3A 5KTQA 5EOZA 3HPOA 4Q8FA 5KT2A 4DLEA 4O3RA 2KZ3A 9ICWA 2UVVA 2HHSA 4MEYA 4YD1A 1SZPA 1TAQA 2HHWA 3SV4A 4RQ4A 2PI4A 3C2KA 5BPCA 5D46A 2V9WA 3JPQA 5F9NA 2DPIA 5DB8A 4P4PA 4QZAA 5KFCA 3PV8A 1BPXA 3RB4A 3JPSA 4BDPA 2NRVA 4C8KA 1JXEA 4YVZA 4PHEA 3Q8MA 4YR0A 1BPYA 9ICTA 1JN3A 4NM1A 2MAXA 5KG7A 4ECTA 4E0DA 4Z6FA 3V6HA 4O3PA 1Y88A 4UB3A 4RUCA 1RXWA 4KLGA 5KFAA 4EBDA 1QLNA 9ICJA 9ICEA 1ZQZA 1ZQBA 3B0YA 2HHTA 5KFZA 4FS1A 9ICGA 4RNMA 3QZ8A 4GXKA 3N97B 4UQGA 1QSYA 2BKEA 8ICLA 1NJZA 4O3OA 4P2HA 8ICKA 4DSFA 4X5VA 3PW4A 2FLPA 2BCQA 4RT2A 4C8OA 4MFFA 1ZQUA 1XSLA 2W9AA 4XQ8A 3H40A 4IR1A 3T5LA 4Z6EA 1ZQNA 4Z6DA 4IQTA 4DOBA 2ATLA 3EW9A 4DL5A 4GC7A 1BVSA 4Z6CA 4DQIA 4I2GA 3LDAA 3KHLA 4QZHA 4F5PA 4B9NA 4M9HA 8ICQA 1U47A 1BPDA 3RRHA 4DSLA 3C5GA 4I2BA 1T8EA 1ZQTA 5HHHA 3HX0A 1NOMA 3BQTA 5DGAA 2RDJA 2AU0A 5KT5A 4YG2A 1ZQPA 4M47A 3TAPA 5KFYA 5J0WA 1XSPA 4B9TA 4MF2A 4UAZA 2OWOA 3KTQA 3C1ZA 4ZH4A 3BQ2A 4TURA 4I2HA 9ICUA 5D4BA 3GIIA 1AROP 3GDXA 3PW7A 1K1QA 5KFBA 3KHHA 1N56A 1TKDA 2ZJAA 4DFPA 5JUMA 4EYIB 7ICTA 4PGQA 3H8WA 1IXRA 3THVA 1QTMA 5J2HA 3T5HA 4B9UA 4MFCA 4FO6A 2FLNA 4ECUA 1NJXA 3PW2A 2ISOA 2F1IA 3OHAA 2W8LA 1KFSA 4YMMA 3H7IA 5KFOA 1X9MA 4DWIA 8ICSA 4JV2A 4R63A 5J0PA 5CHGA 4NLGA 4ELVA 5J2JA 1HJPA 4J9QA 4KLHA 4F5QA 1NKEA 4DSJA 4PPXA 3BDPA 8ICUA 3QZ7A 3OHBA 3TANA 4KLFA 5CA7A 4I2IA 8ICPA 3UXPA 4DL7A 4B9MA 4FBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGO A;  3EZ5 A;  1ZQA A;  4ED1 A;  2IA6 A;  1Z3E B;  1HUZ A;  5J0S A;  2JEG A;  9ICV A;  3TQ1 A;  4K4G A;  2PI5 A;  2I9G A;  2ZUB A;  1ZQC A;  2XGQ A;  4IRC A;  4F91 B;  2HVI A;  4NXZ A;  4PHP A;  4LZG A;  4J9K A;  9ICM A;  4F5N A;  2V4Q A;  9ICX A;  4QWA A;  8ICJ A;  4BWM A;  2PFP A;  1RYR A;  2FMQ A;  3MFI A;  1D9D A;  4F5O A;  4QWD A;  3MBY A;  4IQU A;  2NRW A;  4UBC A;  3MGI A;  5J0R A;  5D49 A;  5L1J A;  4ELT A;  4O5E A;  3TAQ A;  3T3F A;  4MF8 A;  2BGW A;  2LYH A;  5KFF A;  4RQ1 A;  7ICS A;  2FLL A;  3Q8K A;  1UA1 A;  4M04 A;  1NK5 A;  4ECW A;  1ZQM A;  8ICA A;  5J0O A;  2BCV A;  1L3S A;  1NK9 A;  5DQH A;  5DG7 A;  3RTV A;  4DF8 A;  1S97 A;  2W9M A;  5CR0 A;  4RPY A;  1DGS A;  2BPC A;  4QZB A;  3RRG A;  4J9M A;  4I2A A;  5J29 A;  4C8N A;  2BHN A;  4F93 B;  3ETL A;  2VAN A;  5CP2 A;  1S0M A;  3PY8 A;  2J6T A;  2XY7 A;  4KLO A;  1V9P A;  3UQ0 A;  1TK0 A;  4KLJ A;  2ZUC A;  5KG6 A;  3PML A;  4QZC A;  2W9C A;  1SL0 A;  1ZQD A;  2ASJ A;  3KHR A;  2GWS A;  3PO5 A;  2NRT A;  2PXI A;  3GV5 B;  1B22 A;  4RQ6 A;  4IQW A;  1NJY A;  4QW8 A;  7ICE A;  5DDY A;  4RQ2 A;  3BJY A;  4DOC A;  4HYK A;  2BPG A;  4IRK A;  4G3I A;  8ICT A;  4KLM A;  7ICR A;  1X9S A;  8ICC A;  1U4B A;  1S77 D;  4F8R A;  2AQ4 A;  3GV8 B;  1NK7 A;  5DQG A;  5KFR A;  4RQ7 A;  8ICZ A;  4O0I A;  3SZ2 A;  2C2D A;  3ZD8 A;  4MEX A;  3HT3 A;  3MR5 A;  3G6V A;  2Y1J A;  1IM4 A;  1S0V A;  2F1J A;  2PFO A;  4PHA A;  4J9N A;  5KG0 A;  4F50 A;  1UT5 A;  3SV3 A;  3UQ2 A;  1NK4 A;  3RJJ A;  8ICE A;  9ICF A;  5KFH A;  2W9C B;  4BWJ A;  3RJE A;  4XA5 A;  2HHV A;  2UVR A;  5IIK A;  4JWN A;  1U49 A;  5EWE A;  9ICA A;  3K75 D;  1ZQG A;  4UB4 A;  3ZD9 A;  3MR2 A;  1L3V A;  1S0O A;  2M9N A;  7ICM A;  4KLQ A;  1NKC A;  4JUZ A;  1QSL A;  4RNN A;  2KZM A;  2FMS A;  7ICU A;  2KFN A;  1ZJM A;  2RDI A;  3MDA A;  5DGB A;  2ASD A;  4QWE A;  5DBC A;  3NTU A;  4KLL A;  5DKW A;  4KLE A;  3ZDA A;  4I29 A;  1COO A;  4I2D A;  4M9J A;  2HHU A;  2I1Q A;  4QWC A;  9ICH A;  2W9B B;  4DS5 A;  4TUS A;  1UT8 A;  3KHG A;  3H4D A;  5IIM A;  1Z00 A;  8ICN A;  4I2J A;  3RB3 A;  3RR7 A;  4YP3 A;  2V4R A;  4YMO A;  1NJW A;  4F3O A;  8ICF A;  9ICN A;  4R64 A;  4C8M A;  1TK5 A;  4UB1 A;  1TAU A;  5KFW A;  1RYS A;  3JPO A;  5KFE A;  4YXM A;  2JEJ A;  2P6U A;  4DFJ A;  1KFD A;  2PFQ A;  4YQW A;  1KTQ A;  5J2C A;  4KLU A;  9ICB A;  9ICS A;  4UAW A;  2XGP A;  4O3S A;  1XU4 A;  4RU9 A;  7ICJ A;  2BPF A;  3EWA A;  2XY6 A;  1ZQL A;  4BXO B;  5DQI A;  5DBB A;  4UB2 A;  3GIJ A;  3C5F A;  3TAR A;  2BDP A;  8ICH A;  1T4G A;  2UVU A;  4XUS A;  3C2M A;  3ORY A;  4KN7 A;  5HP4 A;  2JZB A;  4EBE A;  4R8U A;  1B43 A;  1XWL A;  5IIJ A;  3M9M B;  3GV7 B;  4J9S A;  3ISC A;  7ICQ A;  1ZET A;  1Z00 B;  1U45 A;  4TUP A;  1LB2 B;  2DFL A;  9ICR A;  3TI0 A;  4B9L A;  1SKR A;  4M2Y A;  2B21 A;  2HVH A;  2J6U A;  4QZ8 A;  2KN7 A;  3RAQ A;  2VA3 A;  4Q45 A;  2FPK A;  3H8J A;  1ZQY A;  1MC8 A;  1KLN A;  8ICB A;  5J2A A;  1NK6 A;  4KIT B;  4Q8E A;  2J6S A;  4YN4 A;  2AJQ A;  4YXJ A;  4I27 A;  5DB7 A;  5F9L A;  5KFN A;  5EWG A;  4RUA A;  2ZTC A;  4UBB A;  8ICM A;  4DFM A;  2JZB B;  4F4W A;  3BQ0 A;  4DOA A;  4I2C A;  3QEB Z;  5KFI A;  4R8U B;  4ED8 A;  2HHQ A;  3JPR A;  3PX4 A;  2JEF A;  2R8K A;  1KRP A;  1NK0 A;  5J0X A;  1C7Y A;  3PW5 A;  4RPX A;  9ICL A;  4GC6 A;  5KT7 A;  2C2E A;  4LZD A;  3HP6 A;  1ZJN A;  2KZZ A;  4FS2 A;  9ICI A;  4QWB A;  4DEZ A;  1TFR A;  4F2S A;  1ZYQ A;  5DG9 A;  1S10 A;  2FPL A;  4Q43 A;  5IIN A;  4O3N A;  4PH5 A;  1SKW A;  2IHN A;  2BCU A;  4R65 A;  2A1J A;  8ICY A;  5L9X A;  3OGU A;  3SI8 A;  4RQ5 A;  1L5U A;  4EZ9 A;  3UXO A;  2BCS A;  3RH5 A;  5L1K A;  3M8R A;  1T7P A;  2IBK A;  4DL4 A;  5KFV A;  1JXL A;  1ZQF A;  4DF4 A;  4ECV A;  2H5X A;  2XO7 A;  4QW9 A;  7ICI A;  3PX0 A;  5KFJ A;  5DB6 A;  4EEY A;  9ICC A;  1DOQ A;  4EBC A;  1XSN A;  4DSE A;  1XC9 A;  5J2G A;  3RJF A;  3RR8 A;  3GIL A;  8ICO A;  8ICG A;  9ICQ A;  4NY8 A;  2NRX A;  5HNK A;  4ECR A;  4NLZ A;  3G6Y A;  4M9G A;  3IM1 A;  2Q0Z X;  7ICN A;  4QZ9 A;  2F1H A;  4PGX A;  4YMN A;  4R66 A;  4DFK A;  2A1J B;  1EXN A;  4JV0 A;  3H4B A;  3C21 A;  5J2I A;  1ZQH A;  3Q8L A;  5DBA A;  2W8K A;  3B0X A;  1SKS A;  3H8S A;  3UXN A;  3MGH A;  9ICK A;  2KFZ A;  4J9P A;  4UB5 A;  2C2R A;  4J9L A;  4ED0 A;  4PHD A;  5J0U A;  5KFU A;  2W9B A;  2BQU A;  5KFM A;  5J2F A;  1ZQO A;  4XRH A;  2P6R A;  4YCX A;  4ECQ A;  4TUQ A;  5IIO A;  2BCR A;  4KTQ A;  8ICX A;  3PR5 B;  3V72 A;  1X2I A;  4F4Y A;  3ZDB A;  3RAX A;  3RB6 A;  4I28 A;  3PVX A;  1WCN A;  1NK8 A;  2XC9 A;  3ISD A;  1TVA A;  1RPL A;  3Q8P B;  1NKB A;  5KT3 A;  2FMP A;  5KFG A;  4DO9 A;  2JEI A;  9ICP A;  1KEJ A;  3RJK A;  1ZQV A;  4TQS A;  7ICP A;  3MFH A;  2VA8 A;  5J2D A;  4BXO A;  2HHX A;  4ECS A;  1BPB A;  3ZDE A;  2IHM A;  3FYH A;  1KSP A;  1JIH A;  4KLI A;  3PW0 A;  1S76 D;  1MSW D;  3V7K A;  3RH4 A;  3HWT A;  2XCA A;  4O5K A;  5KT4 A;  1BGX T;  4J9R A;  4F92 B;  1XO1 A;  3V7L A;  2ASL A;  4RQ0 A;  3HW8 A;  3RJI A;  3UPQ A;  2AQ0 A;  4P4O A;  4RNO A;  3GQC A;  3GFK B;  1CEZ A;  4F2R A;  4MFA A;  3EPG A;  2MUT A;  5J0Y A;  3TFR A;  4YR2 A;  2IMW P;  3FDS A;  4C8L A;  5CJ7 A;  2R8H A;  2ZTE A;  4DSI A;  2WTF A;  5IIL A;  5EWF A;  3GIM A;  2DPJ A;  3OJS A;  5L1I A;  3RB0 A;  3BQ1 A;  3V6K A;  1RZT A;  3ZDD A;  1K1S A;  1U9L A;  1LV5 A;  5J2B A;  3RJH A;  5L1L A;  3ZDC A;  4DQS A;  5DB9 A;  3PMN A;  4F4Z A;  5J2K A;  3LWL A;  4ED7 A;  1XS9 D;  5J2E A;  1N48 A;  1ZQJ A;  7ICF A;  2ZUD A;  4DQP A;  8ICW A;  1KFT A;  1JMS A;  2R8J A;  4CCH A;  5KG1 A;  1ZQK A;  4ED6 A;  5KFX A;  3PX6 A;  5HHI A;  4JK1 A;  3AU2 A;  3M9N B;  4DSK A;  7ICO A;  3LWM A;  2UVW A;  4B9V A;  1KDH A;  3OJU A;  1ZQX A;  3MR3 A;  2AGQ A;  2C22 A;  4DQR A;  1ZQW A;  4EZ6 A;  4F4K A;  5KFK A;  4EYH B;  1MQ2 A;  2MUT B;  3QEA Z;  2C28 A;  3V6J A;  4YD2 A;  4NM2 A;  5KG5 A;  9ICO A;  3T5J A;  5J0T A;  3Q8R B;  1TV9 A;  4DL3 A;  4KLS A;  3MR6 A;  4F5R A;  5KFS A;  4DS4 A;  4ELU A;  5KG2 A;  4RQ8 A;  3N4M B;  4DLG A;  1BPE A;  3G6X A;  2ALZ A;  1D8L A;  1QSS A;  5KFT A;  4YR3 A;  4F4X A;  1ZQS A;  1D8Y A;  1S9F A;  1T3N A;  2PFN A;  1TK8 A;  3MAB A;  4KN4 A;  2P66 A;  4M6W A;  4DQQ A;  1JX4 A;  1CUK A;  4JWM A;  3IHQ B;  3RBD A;  1SL1 A;  1BPZ A;  4KLT A;  1L3U A;  4O3Q A;  1U48 A;  4K4H A;  4RPZ A;  4O5C A;  4ECX A;  5C5J A;  8ICV A;  5DG8 A;  5BOL A;  1D9F A;  3Q8Q B;  5DDM A;  5J0Q A;  4ED2 A;  2ISP A;  5III A;  4ED3 A;  1MQ3 A;  3C1Y A;  1A76 A;  4DL6 A;  4IQV A;  3Q8S B;  4DL2 A;  2NRZ A;  2XCP A;  4ECZ A;  2BQ3 A;  1UA0 A;  3JPP A;  5KFL A;  5KFD A;  4KMU A;  3EPI A;  5HML A;  4QZG A;  1X9W A;  3SYZ A;  1SL2 A;  1PZN A;  2ZJ8 A;  4UAY A;  3PNC A;  3PR4 A;  3T5K A;  3OSP A;  1RXV A;  4B9S A;  4QZE A;  5TZV A;  3LK9 A;  3K4G A;  4J9O A;  7ICV A;  4BGD A;  5KFQ A;  3JPN A;  4M6W B;  2VA2 A;  3EYZ A;  4P4M A;  4M0A A;  4GLX A;  4I2E A;  4Q44 A;  4TQR A;  3M8S A;  2XY5 A;  2FPM A;  5KFP A;  3ISB A;  5KG3 A;  4QZF A;  3GIK A;  5HMM A;  4RT3 A;  2BR0 A;  2Y1I A;  3V7J A;  5DLG A;  5KT6 A;  2AGP A;  4QZI A;  4YFK A;  3RBE A;  3MDC A;  3TFS A;  4IR9 A;  5CWR A;  4GXI A;  2BQR A;  3OSN A;  1ZQI A;  2ZJ5 A;  3C23 A;  4RZR A;  3RH6 A;  5DLF A;  1ZQE A;  4IRD A;  1S0N A;  4JV1 A;  7ICL A;  8ICI A;  4I2F A;  4RQ3 A;  4M9N A;  3AU6 A;  5BOM A;  3PO4 A;  5CB1 A;  4KLD A;  3JPT A;  1ZQR A;  4M9L A;  4O9M A;  1HUO A;  7ICK A;  5KG4 A;  3NGD A;  4ECY A;  3AUO A;  2R8G A;  4K4I A;  4NLN A;  4NLK A;  3E2E A;  1ZQQ A;  2KTQ A;  2R8I A;  4FBU A;  4QZD A;  1WCL A;  8ICR A;  7ICH A;  2ZTD A;  1H38 A;  4LVS A;  3C2L A;  3M9O B;  1A77 A;  4GXJ A;  4PGY A;  3QE9 Y;  1L3T A;  3RJG A;  7ICG A;  2HW3 A;  5KTQ A;  5EOZ A;  3HPO A;  4Q8F A;  5KT2 A;  4DLE A;  4O3R A;  2KZ3 A;  9ICW A;  2UVV A;  2HHS A;  4MEY A;  4YD1 A;  1SZP A;  1TAQ A;  2HHW A;  3SV4 A;  4RQ4 A;  2PI4 A;  3C2K A;  5BPC A;  5D46 A;  2V9W A;  3JPQ A;  5F9N A;  2DPI A;  5DB8 A;  4P4P A;  4QZA A;  5KFC A;  3PV8 A;  1BPX A;  3RB4 A;  3JPS A;  4BDP A;  2NRV A;  4C8K A;  1JXE A;  4YVZ A;  4PHE A;  3Q8M A;  4YR0 A;  1BPY A;  9ICT A;  1JN3 A;  4NM1 A;  2MAX A;  5KG7 A;  4ECT A;  4E0D A;  4Z6F A;  3V6H A;  4O3P A;  1Y88 A;  4UB3 A;  4RUC A;  1RXW A;  4KLG A;  5KFA A;  4EBD A;  1QLN A;  9ICJ A;  9ICE A;  1ZQZ A;  1ZQB A;  3B0Y A;  2HHT A;  5KFZ A;  4FS1 A;  9ICG A;  4RNM A;  3QZ8 A;  4GXK A;  3N97 B;  4UQG A;  1QSY A;  2BKE A;  8ICL A;  1NJZ A;  4O3O A;  4P2H A;  8ICK A;  4DSF A;  4X5V A;  3PW4 A;  2FLP A;  2BCQ A;  4RT2 A;  4C8O A;  4MFF A;  1ZQU A;  1XSL A;  2W9A A;  4XQ8 A;  3H40 A;  4IR1 A;  3T5L A;  4Z6E A;  1ZQN A;  4Z6D A;  4IQT A;  4DOB A;  2ATL A;  3EW9 A;  4DL5 A;  4GC7 A;  1BVS A;  4Z6C A;  4DQI A;  4I2G A;  3LDA A;  3KHL A;  4QZH A;  4F5P A;  4B9N A;  4M9H A;  8ICQ A;  1U47 A;  1BPD A;  3RRH A;  4DSL A;  3C5G A;  4I2B A;  1T8E A;  1ZQT A;  5HHH A;  3HX0 A;  1NOM A;  3BQT A;  5DGA A;  2RDJ A;  2AU0 A;  5KT5 A;  4YG2 A;  1ZQP A;  4M47 A;  3TAP A;  5KFY A;  5J0W A;  1XSP A;  4B9T A;  4MF2 A;  4UAZ A;  2OWO A;  3KTQ A;  3C1Z A;  4ZH4 A;  3BQ2 A;  4TUR A;  4I2H A;  9ICU A;  5D4B A;  3GII A;  1ARO P;  3GDX A;  3PW7 A;  1K1Q A;  5KFB A;  3KHH A;  1N56 A;  1TKD A;  2ZJA A;  4DFP A;  5JUM A;  4EYI B;  7ICT A;  4PGQ A;  3H8W A;  1IXR A;  3THV A;  1QTM A;  5J2H A;  3T5H A;  4B9U A;  4MFC A;  4FO6 A;  2FLN A;  4ECU A;  1NJX A;  3PW2 A;  2ISO A;  2F1I A;  3OHA A;  2W8L A;  1KFS A;  4YMM A;  3H7I A;  5KFO A;  1X9M A;  4DWI A;  8ICS A;  4JV2 A;  4R63 A;  5J0P A;  5CHG A;  4NLG A;  4ELV A;  5J2J A;  1HJP A;  4J9Q A;  4KLH A;  4F5Q A;  1NKE A;  4DSJ A;  4PPX A;  3BDP A;  8ICU A;  3QZ7 A;  3OHB A;  3TAN A;  4KLF A;  5CA7 A;  4I2I A;  8ICP A;  3UXP A;  4DL7 A;  4B9M A;  4FBT A; 
#chains in the Genus database with same CATH topology
 2AGO A;  2IA6 A;  1Z3E B;  3TQ1 A;  4K4G A;  2OCE A;  2ZUB A;  4IRC A;  2KHQ A;  4Y2T A;  3DDH A;  3UMB A;  4PHP A;  5AKZ A;  4JMU A;  3QUB A;  1D9D A;  1L8L A;  1UCV A;  3MGI A;  4ELT A;  2KV2 A;  4Y2S A;  3KZI U;  2FLL A;  8ICA A;  1JRO A;  5H2F U;  2BCV A;  4UAU A;  2EAO A;  1Q3V A;  2W9M A;  5CR0 A;  1RYU A;  5J29 A;  4F93 B;  5CP2 A;  4CF3 A;  4KLO A;  2ZUC A;  4C4R A;  1UHU A;  3A0H U;  2DGZ A;  1ECW A;  3BZC A;  2KIC A;  1NJY A;  1JAL A;  8ICT A;  7ICR A;  4HYK A;  3U26 A;  8ICC A;  2AQ4 A;  3M1Y A;  5AK5 A;  2AXT U;  3WKB A;  4PZN A;  1UPH A;  3ZD8 A;  1MA7 A;  2Y1J A;  9ICF A;  3RJJ A;  4AYB C;  1X6J A;  2W3S A;  2H3V A;  4XA5 A;  9ICA A;  1U49 A;  2Y0S F;  1QCK A;  1S0O A;  2MA1 A;  3VCB A;  1QSL A;  2R18 A;  2KZM A;  1LKY A;  2RDI A;  5DGB A;  5ALO A;  5DBC A;  3NTU A;  5DKW A;  4KLE A;  2H3I A;  2I1Q A;  9ICH A;  4Y2R A;  5FP0 A;  4DS5 A;  1PVP A;  1NNL A;  1Z00 A;  4I2J A;  3RB3 A;  1F44 A;  4F3O A;  4C8M A;  1S8O A;  1RYS A;  2JEJ A;  4US8 A;  4YQW A;  5GTH U;  1LKY B;  5J2C A;  3D6J A;  4O3S A;  1XU4 A;  2YB4 A;  3OPX A;  2BPF A;  1S5L U;  3TAC B;  1B43 A;  3ISC A;  1Z00 B;  5ALY A;  4TUP A;  1DGJ A;  3QUQ A;  1ZRM A;  4M2Y A;  1VLB A;  2DQN B;  2B21 A;  4Q45 A;  3H8J A;  3UMG A;  1J2M A;  3F5E A;  2J6S A;  2NYV A;  3KKA A;  4LJX A;  2E5S A;  3VC8 A;  5KFN A;  4RUA A;  4UBB A;  3QUC A;  2K4E A;  2DKZ A;  4ED8 A;  3JPR A;  3PX4 A;  2R8K A;  3HKZ F;  1N2X A;  1N5X A;  1V97 A;  2W7P A;  2KZZ A;  9ICI A;  4QWB A;  2YMQ A;  2AH5 A;  1TFR A;  1ZYQ A;  1S10 A;  1KW4 A;  1SKW A;  4Q43 A;  4PH5 A;  2BCU A;  8ICY A;  5L9X A;  2OH2 A;  3OGU A;  3UXO A;  3RH5 A;  5L1K A;  4DL4 A;  5KFV A;  1JXL A;  4CDG A;  3AMZ A;  2H5X A;  5KFJ A;  3WKC A;  4EEY A;  2BDU A;  5J2G A;  3RR8 A;  2W11 A;  1KN5 A;  2RHF A;  2Q0Z X;  7ICN A;  4NL9 A;  4YMN A;  2KEY A;  3HRD D;  1L7O A;  2YX8 A;  3C21 A;  1RQL A;  4ZOH C;  2E8P A;  3H8S A;  3MGH A;  5AM1 A;  3AQF A;  4UB5 A;  4J9L A;  4ED0 A;  2BQU A;  5KFM A;  2P35 A;  4ECQ A;  4TUQ A;  4B6J A;  8ICX A;  3H8M A;  3D2N A;  2RP5 A;  1TAM A;  3ISD A;  1WWU A;  5AIA A;  1NKB A;  3Q8P B;  9ICP A;  1ZD2 P;  1ZQV A;  4C7Z A;  5J2D A;  2EAM A;  3H0M B;  2OYY A;  3ZDE A;  4KLI A;  1S76 D;  3V7K A;  3HIL A;  3HWT A;  3V7L A;  4CGZ A;  2ASL A;  4MFA A;  2MUT A;  2IMW P;  4C8L A;  5CJ7 A;  2WTF A;  5AM3 A;  3ZDC A;  3RJH A;  5L1L A;  4F4Z A;  3LWL A;  8ICW A;  1KFT A;  4CCH A;  3PX6 A;  2WB1 F;  3KZX A;  2VJ5 A;  3LWM A;  4B9V A;  2AGQ A;  4F4K A;  2C22 A;  2KE7 A;  4EYH B;  2MUT B;  3QEA Z;  2C28 A;  3V6J A;  4NM2 A;  3ETR A;  2E1E A;  3Q8R B;  4DLG A;  1BPE A;  4F4X A;  2PFN A;  1ZQS A;  4I27 A;  2P66 A;  3MAB A;  3SAF A;  4JWM A;  3IHQ B;  4EX7 A;  3RBD A;  4O5C A;  4ECX A;  2LYA A;  5III A;  4ED3 A;  1MQ3 A;  5AKI A;  2NRZ A;  4ECZ A;  2BQ3 A;  1UA0 A;  5KFD A;  1X9W A;  1KKX A;  3PNC A;  5TZV A;  2W54 A;  1ED1 A;  4M0A A;  4Q44 A;  4TQR A;  3M8S A;  3GIK A;  5ALU A;  2GOL A;  4BUG A;  3KOO A;  5DLG A;  2AGP A;  4YFK A;  4IR9 A;  5EE9 A;  5CWR A;  4GXI A;  2HSZ A;  2BQR A;  3OSN A;  3RH6 A;  5DLF A;  2PMZ F;  1S0N A;  5ALJ A;  4M9N A;  4P0P B;  4KLD A;  1ZQR A;  2LI6 A;  2ZIX A;  2MU2 A;  3AUO A;  4NLN A;  4NLK A;  3E2E A;  1ZQQ A;  5G5G A;  1FFU A;  4LVS A;  1HIW A;  3M9O B;  1A77 A;  4PGY A;  1C20 A;  2HHS A;  4MEY A;  1TAQ A;  3SV4 A;  3C2K A;  2V9W A;  2G07 A;  1ZXI A;  1CI4 A;  1BPX A;  2L5Y A;  4YR0 A;  5KFA A;  3H0L B;  2DKX A;  3R9K A;  1SXE A;  1QSY A;  1NJZ A;  4P2H A;  3CW2 C;  4DSF A;  3PW4 A;  2FLP A;  2BCQ A;  2K4H A;  1B4F A;  3H40 A;  4Z6E A;  1BVS A;  1K5O A;  1L8O A;  3NRZ A;  5KL8 B;  3LDA A;  2HDO A;  1ZQT A;  5ALV A;  3SAH A;  4M47 A;  3TAP A;  4UAZ A;  3C1Z A;  3GII A;  3WK9 A;  5KFB A;  1N56 A;  3FAH A;  2ZJA A;  2KIW A;  3T5H A;  1NJX A;  2KVC A;  3H7I A;  4YMM A;  1X9M A;  5ALG A;  5J0P A;  5ALQ A;  5J2J A;  4ACO A;  4DSJ A;  5AM5 A;  4PPX A;  2EZY A;  8ICU A;  3QZ7 A;  4Y2U A;  2ZIU B;  3OHB A;  4KLF A;  5CA7 A;  8ICP A;  3UXP A;  4USA A;  3AEV A;  4B9M A;  5EE3 A;  3QU2 A;  4FBT A;  3WK4 A;  1HUZ A;  2JEG A;  5J0S A;  1ZQC A;  2XGQ A;  4F91 B;  4LZG A;  4F5N A;  3M6Z A;  2KJ5 A;  2FDR A;  3ED5 A;  2FI1 A;  4UBC A;  4OCZ A;  2QKQ A;  2BGW A;  2LYH A;  7ICS A;  3B9J A;  1WUD A;  1NK9 A;  2CXY A;  3IG5 A;  4DF8 A;  5AKH A;  4EEN A;  3N7P D;  2BPC A;  2LKY A;  3NRW A;  4J9M A;  3ETL A;  3PY8 A;  2XY7 A;  1V9P A;  3UQ0 A;  5KG6 A;  4QZC A;  2W9C A;  1ZQD A;  2GWS A;  3PO5 A;  2PXI A;  1B22 A;  4DOC A;  1SWV A;  4KX3 A;  3GV8 B;  1NK7 A;  1X66 A;  2IOF K;  5DQG A;  4RQ7 A;  8ICZ A;  4O0I A;  2C2D A;  1JI7 A;  2ES6 A;  3HT3 A;  4ICA A;  3G6V A;  2F1J A;  4J9N A;  5KG0 A;  3SV3 A;  1NK4 A;  8ICE A;  2W9C B;  1N60 A;  5ALF A;  5IIK A;  4JWN A;  1ZQG A;  4UB4 A;  3MR2 A;  2RQ5 A;  1L3V A;  1NKC A;  4RQN A;  2A1A A;  2JHD A;  1SWW A;  4DFD A;  1B0X A;  2KFN A;  1YZ7 A;  2ASD A;  2HBK A;  4KLL A;  2NO4 A;  4I29 A;  1COO A;  2JH7 A;  4QWC A;  3H4D A;  2G5I B;  2Y0S C;  3GZF A;  4YP3 A;  2V4R A;  4YMO A;  1NJW A;  1TK5 A;  1TAU A;  4YXM A;  2P6U A;  4DFJ A;  1F5S A;  4KLU A;  2A3V A;  9ICS A;  1F0M A;  4UAW A;  2XGP A;  5AHX A;  4DCC A;  2EH9 A;  3EWA A;  5AI6 A;  2XY6 A;  4BXO B;  4UB6 U;  1X40 A;  4BX9 C;  1T4G A;  3C2M A;  1ZD4 A;  3LYS A;  2RLT A;  3GV7 B;  1L7P A;  3GU3 A;  5ALM A;  2DBY A;  5EE0 A;  2DFL A;  3N7R C;  3NVW A;  3TI0 A;  9ICR A;  1QQ6 A;  2HVH A;  2J6U A;  2DWQ A;  2VA3 A;  1ZQY A;  1MC8 A;  8ICB A;  4Q8E A;  4YXJ A;  3KKA C;  5DB7 A;  4KMO B;  3J81 j;  4F4W A;  3BQ0 A;  3QEB Z;  2CPR A;  3IDW A;  2PKE A;  1KRP A;  2HBM A;  2I5H A;  2WF7 A;  4GC6 A;  2C2E A;  4LZD A;  1ZJN A;  2B0C A;  2FPL A;  5IIN A;  1N5W A;  4O3N A;  3SEN A;  4R65 A;  2EZX A;  4RQ5 A;  4EZ9 A;  2XO7 A;  3TAD A;  7ICI A;  2KJ9 A;  1XSN A;  2ZXH A;  3RJF A;  3HKZ C;  4OJ5 A;  9ICQ A;  5ALN A;  4ECR A;  3NAS A;  4M9G A;  2W7O A;  2XI9 A;  4PGX A;  4DFK A;  4JV0 A;  1EXN A;  1P7D A;  3NVY A;  4NL9 C;  3L5K A;  2KFZ A;  2F3N A;  4UAT A;  1ZQO A;  2F8K A;  2P6R A;  3V72 A;  1X2I A;  3RB6 A;  1WCN A;  1L6N A;  4OD0 A;  2YQE A;  4NLC A;  2XIC A;  1TVA A;  3KFU F;  4J03 A;  1KEJ A;  3OTQ A;  4TQS A;  7ICP A;  3MFH A;  5AKX A;  2A19 A;  1KSP A;  1JIH A;  5KAF U;  3PW0 A;  1MSW D;  2KK0 A;  3QYP A;  1XO0 A;  2ZIV B;  3IG8 A;  1BGX T;  3QX7 A;  4F92 B;  2HMX A;  3RJI A;  3UPQ A;  4P4O A;  1CEZ A;  1XNS A;  4F2R A;  4NWI A;  2YB1 A;  3AM9 A;  2ZTE A;  3GIM A;  2DPJ A;  3OJS A;  5L1I A;  4F72 A;  3BQ1 A;  3ZDD A;  1N48 A;  1XS9 D;  4ED7 A;  3ZI4 A;  1ZQJ A;  4EZ6 A;  5J2E A;  4DQP A;  1QQ5 A;  4ED6 A;  3LVW A;  2E1F A;  1DRG A;  4OO1 J;  3CP8 A;  1WYG A;  3M9N B;  7ICO A;  1KDH A;  1PK3 A;  4UB8 U;  4YD2 A;  3T5J A;  4Y2X A;  2HCF A;  4F71 A;  5KFS A;  2F2A B;  4FFD A;  1QSS A;  2VJ4 A;  3SEI A;  5KFT A;  1S9F A;  1TK8 A;  4JB3 A;  4KN4 A;  1IV8 A;  1JX4 A;  2WB1 C;  4EX6 A;  2JXJ A;  1URJ A;  4K4H A;  2KKV A;  2QLT A;  5ALX A;  5ALH A;  5C5J A;  4O3M A;  5DG8 A;  5DDM A;  5J0Q A;  2I6X A;  4ED2 A;  1LVH A;  2Y9T A;  1A76 A;  4KMU A;  3EPI A;  3SYZ A;  2ZJ8 A;  3T5K A;  3OSP A;  4B9S A;  1OXJ A;  4J9O A;  4BGD A;  5KFQ A;  3RF9 A;  2FPM A;  3ISB A;  4RT3 A;  3V7J A;  3C28 A;  4JV1 A;  4RQ3 A;  5BOM A;  4M9L A;  2EDU A;  5ALP A;  4ECY A;  4K4I A;  3DV9 A;  7ICH A;  1SV0 C;  4C4T A;  1H38 A;  3QU7 A;  5T14 A;  3RJG A;  5KTQ A;  5EOZ A;  4Q8F A;  1SGG A;  4DLE A;  5BPC A;  2WAQ F;  5AK6 A;  2PMZ C;  5F9N A;  2DPI A;  5DB8 A;  1IIP A;  5KFC A;  3ICX A;  3JPS A;  4YVZ A;  1JN3 A;  4NM1 A;  4ECT A;  4E0D A;  3V6H A;  1X6I A;  5AI0 A;  1Y88 A;  4EBD A;  1ZQZ A;  2JGA A;  4FS1 A;  9ICG A;  4RNM A;  2D3D A;  3QZ8 A;  1PK1 A;  2BKE A;  1MN8 A;  4RT2 A;  2BZF A;  2LHT A;  1ZQU A;  4XQ8 A;  3FC4 A;  3T5L A;  1FEZ A;  3I76 A;  4Z6D A;  2NO5 A;  3EW9 A;  3F2B A;  5F3X B;  2B6G A;  4B9N A;  1BPD A;  4DSL A;  5HHH A;  3HX0 A;  5DGA A;  5KT5 A;  2QAR B;  2F77 X;  2E8N A;  5J0W A;  4B9T A;  1L7N A;  1PK1 B;  4PL2 A;  3BQ2 A;  5D4B A;  4UAV A;  3QNM A;  3KHH A;  2ZIW B;  1TKD A;  3QU5 A;  3HJE A;  3KD3 A;  4MFC A;  1V38 A;  2ISO A;  4C8O A;  3N7S C;  2F1I A;  3OHA A;  2W8L A;  1KFS A;  5KFO A;  4DWI A;  2OXO A;  2JRZ A;  4JV2 A;  2G0A A;  1OUQ A;  1NKE A;  3QU9 A;  3TAN A;  3K1R B;  4I2I A;  3BQ7 A;  1ZQA A;  4ED1 A;  1VJ5 A;  2I9G A;  9ICM A;  4J9K A;  2G09 A;  2V4Q A;  4QWA A;  8ICJ A;  1YZ6 A;  1RYR A;  2FMQ A;  4Y2Q A;  3MFI A;  4F5O A;  4P0P A;  4IQU A;  3L4P A;  2NRW A;  2KOB A;  3QU4 A;  5L1J A;  1SB3 C;  4O5E A;  3T3F A;  4FZM A;  4MF8 A;  4RQ1 A;  3Q8K A;  4M04 A;  1NK5 A;  1ZQM A;  5DQH A;  3RTV A;  3MGV A;  4CF5 A;  3DEE A;  4RPY A;  1DGS A;  5AKL A;  3WU2 U;  4QZB A;  3RRG A;  4I2A A;  4C8N A;  1X42 A;  1S0M A;  4QJF B;  2WFA A;  4CRX A;  3PML A;  1SL0 A;  3KHR A;  2MRL A;  1SV0 A;  4OJP A;  5DDY A;  4NLB A;  4RQ2 A;  3BJY A;  4G3I A;  3RFA A;  1U4B A;  1S77 D;  4F8R A;  3UM9 A;  3SZ2 A;  2KKP A;  1S0V A;  1IM4 A;  4PHA A;  4F50 A;  1UT5 A;  5KFH A;  3RJE A;  3NS1 A;  2HHV A;  2UVR A;  5EWE A;  3K75 D;  3ZD9 A;  4KLQ A;  4JUZ A;  2LPE A;  4HAI A;  3WKA A;  1NZB A;  1BNO A;  5ALR A;  1ZJM A;  3MDA A;  2FJ6 A;  2OEH A;  5AI9 A;  4I2D A;  4M9J A;  2HHU A;  5ALW A;  2W9B B;  4TUS A;  3N28 A;  2H3Q A;  2HBL A;  3KHG A;  1UQV A;  3RR7 A;  5K4L A;  2ZIU A;  8ICF A;  9ICN A;  4R64 A;  5GTI U;  3JPO A;  5KFE A;  4EEL A;  2PFQ A;  1KTQ A;  1M6Y A;  3QXG A;  5C0Y A;  3NVZ A;  3L3F X;  3CRX A;  1ZQL A;  5DQI A;  3C5F A;  3TAR A;  2BDP A;  2UVU A;  3ORY A;  4KN7 A;  2JZB A;  4EBE A;  3M9M B;  5IIJ A;  7ICQ A;  1U45 A;  1LB2 B;  4P0Q A;  1J97 A;  2JR5 A;  1ZRN A;  1SKR A;  5EE1 A;  5ALZ A;  4QZ8 A;  2KN7 A;  2FPK A;  3AL0 B;  1AQ6 A;  2D8C A;  1D8B A;  2F76 X;  1KLN A;  4KIT B;  2AJQ A;  5F9L A;  5EWG A;  2YMP A;  2F8L A;  8ICM A;  4DFM A;  2E8O A;  2JZB B;  4I2C A;  5KFI A;  3E58 A;  2JEF A;  5A0L A;  5J0X A;  4P0Q B;  1J2N A;  2E3T A;  1N63 A;  3HP6 A;  4F2S A;  3WK5 A;  5DG9 A;  2IHN A;  2JH1 A;  2QB0 A;  3SI8 A;  4IS7 A;  3TKA A;  1L5U A;  5TIS U;  3M8R A;  2IBK A;  1QQ7 A;  4DF4 A;  3BS5 B;  4QW9 A;  3PX0 A;  1FFV A;  5DB6 A;  3TAD C;  1Z19 A;  2EAN A;  4EBC A;  2WF9 A;  3WK8 A;  2W3R A;  3GIL A;  8ICO A;  8ICG A;  4NY8 A;  5HNK A;  4EEK A;  5AIC A;  5J2I A;  2QB0 B;  3Q8L A;  3B0X A;  3UXN A;  3ONN A;  9ICK A;  5HR7 A;  4PHD A;  5J0U A;  4NJ8 A;  5KFU A;  5J2F A;  4XRH A;  3ALR A;  3WKE A;  5IIO A;  4KTQ A;  3ZDB A;  3RAX A;  4I28 A;  1NK8 A;  3M6K A;  1RPL A;  2FE9 A;  4Y2J A;  5AKY A;  5KFG A;  4DO9 A;  2JEI A;  4NV0 A;  4FE3 A;  3MC1 A;  4BXO A;  3FYH A;  2G06 A;  3RH4 A;  2XCA A;  5KT4 A;  4J9R A;  1JRP A;  4RQ0 A;  2AQ0 A;  4Y2V A;  4RNO A;  3GFK B;  2WHE A;  4UW9 A;  2M0N A;  1ZOL A;  2R8H A;  5G5H A;  4OJ6 A;  1SIJ A;  3F53 A;  1PVQ A;  3O0F A;  3RB0 A;  1RZT A;  1U9L A;  1LV5 A;  4DQS A;  5DB9 A;  4IC9 A;  3PMN A;  5J2K A;  8ICH A;  2DL0 A;  1JMS A;  5KG1 A;  1ZQK A;  2ODG A;  4JK1 A;  2UVW A;  3OJU A;  1ZQX A;  2EZZ A;  3IN5 A;  4FZL A;  1MQ2 A;  2ESE A;  4U7C A;  3EUB 2;  5J0T A;  1RG6 A;  1TV9 A;  4KLS A;  3MR6 A;  4F5R A;  5B5E U;  2KVS A;  4DS4 A;  4ELU A;  5KG2 A;  4BJQ A;  3N4M B;  3G6X A;  1D8L A;  2GH1 A;  4YR3 A;  1D8Y A;  3E0F A;  4MHV A;  4M6W A;  1O03 A;  4DQQ A;  1CUK A;  2E8M A;  2HI0 A;  2K4I A;  1SL1 A;  1L3U A;  4O3Q A;  4RPZ A;  2W55 A;  3S6J A;  8ICV A;  3Q8Q B;  1SZH A;  4CF4 A;  3C1Y A;  4C7Y A;  2GLE A;  3FM9 A;  4DL6 A;  2YY6 A;  2LMR A;  4DL2 A;  2XCP A;  3JPP A;  2K8C B;  4QZG A;  1PZN A;  4UAY A;  3PR4 A;  1RXV A;  3LK9 A;  7ICV A;  4M6W B;  3EYZ A;  4P4M A;  4GLX A;  4I2E A;  1N61 A;  2XY5 A;  5KFP A;  5KG3 A;  2BR0 A;  2IOF A;  5KT6 A;  4QZI A;  3MDC A;  3I28 A;  2HOF A;  3IV6 A;  3C23 A;  4RZR A;  5AI8 A;  4IRD A;  1HEK A;  7ICL A;  8ICI A;  4I2F A;  3AU6 A;  3JPT A;  4QNL A;  1HUO A;  3AN1 A;  2ZIV A;  1Q8K A;  5KG4 A;  2R8G A;  2KTQ A;  4PZO A;  2R8I A;  8ICR A;  3F5A A;  2WF6 A;  2ZTD A;  1O08 A;  3C2L A;  3QE9 Y;  4GXJ A;  2HW3 A;  1L3T A;  7ICG A;  2KIV A;  3HPO A;  5AM4 A;  1KBU A;  5KT2 A;  9ICW A;  4YD1 A;  1SZP A;  3PSP A;  4RQ4 A;  2PI4 A;  3SAG A;  2HBJ A;  4CNQ A;  5D46 A;  1PVR A;  4P4P A;  3PV8 A;  4QZA A;  3RB4 A;  1JXE A;  3Q8M A;  4PHE A;  4Z6F A;  1KQQ A;  4KLG A;  9ICE A;  1ZQB A;  3B0Y A;  1FO4 A;  2HHT A;  5KL1 B;  2AHO B;  4UQG A;  4PJ0 U;  8ICL A;  4O3O A;  4X5V A;  2WAQ C;  4IR1 A;  1ZQN A;  1ZD3 A;  4IQT A;  2ATL A;  4DL5 A;  5ALS A;  2QB1 A;  3KHL A;  4M9H A;  1U47 A;  3RRH A;  4I2B A;  1NOM A;  3BQT A;  2RDJ A;  3PST A;  4G9B A;  4YG2 A;  1ZQP A;  5J8Y A;  2DF4 B;  2XID A;  4I2H A;  1NZP A;  9ICU A;  3CYM A;  5CEH A;  3IRU A;  5AM0 A;  1ARO P;  3PW7 A;  1K1Q A;  1IXR A;  2FLN A;  4ECU A;  3PW2 A;  1BNP A;  3WKD A;  4NLG A;  2RRD A;  4J9Q A;  4KLH A;  3BDP A;  2GO7 A;  2OM6 A;  3EZ5 A;  1Z4O A;  9ICV A;  2PI5 A;  1WWV A;  3BZK A;  2HVI A;  4NXZ A;  3UMC A;  9ICX A;  4BWM A;  2PFP A;  5ALL A;  4QWD A;  3MBY A;  5J0R A;  5D49 A;  3TAQ A;  5KFF A;  5ALI A;  1UA1 A;  4ECW A;  5J0O A;  5DG7 A;  1S97 A;  2KG5 A;  2Q4T A;  2YN4 A;  2BHN A;  4QIW C;  2VAN A;  2J6T A;  4KLJ A;  1TK0 A;  5ALT A;  1JUD A;  4AYB F;  2ASJ A;  2NRT A;  1DXS A;  3GV5 B;  4RQ6 A;  4IQW A;  5AI5 A;  4QW8 A;  7ICE A;  1OW5 A;  5AK3 A;  3SMV A;  2BPG A;  4IRK A;  4KLM A;  1X9S A;  2NV3 A;  3K1Z A;  1T94 A;  4Y2P A;  5KFR A;  5E79 U;  4MEX A;  3BS7 A;  3MR5 A;  2PFO A;  3UQ2 A;  4BWJ A;  2LYB A;  2QAR A;  2M9N A;  2G08 A;  7ICM A;  3PSF A;  5AM2 A;  4RNN A;  2FMS A;  4GFJ A;  2ZIW A;  7ICU A;  1X9X A;  1IG6 A;  4QWE A;  3ZDA A;  4CE6 A;  1GO3 F;  5AKE A;  1A0P A;  1UT8 A;  5IIM A;  5CRX A;  8ICN A;  5L1M A;  4UB1 A;  5KFW A;  2ZXI A;  4C80 A;  1KFD A;  1RM6 C;  2MSN A;  9ICB A;  3SD7 A;  4RU9 A;  3AQE A;  7ICJ A;  5DBB A;  4UB2 A;  3GIJ A;  4XUS A;  2DUY A;  5HP4 A;  3H0R B;  4R8U A;  1XWL A;  4J9S A;  1ZET A;  4B9L A;  2CRX A;  2Z7J A;  5KAI U;  3RAQ A;  4PL1 A;  1WG8 A;  1Z4N A;  5J2A A;  1NK6 A;  4YN4 A;  4QIW F;  4C4S A;  4U6P A;  2KSO A;  1L7M A;  2ZTC A;  1YT3 A;  3C29 A;  1KL9 A;  4DOA A;  4R8U B;  2HHQ A;  2CN1 A;  4UAS A;  1NK0 A;  1C7Y A;  3PW5 A;  4RPX A;  9ICL A;  5KT7 A;  4FS2 A;  2EQY A;  4DEZ A;  3I1Y A;  3F2D A;  3WK6 A;  2A1J A;  1NI3 A;  2VKQ A;  2BCS A;  1T7P A;  2ZG6 A;  1ZQF A;  4ECV A;  2KSO B;  5AKG A;  2KD1 A;  3SQI A;  9ICC A;  1DOQ A;  4DSE A;  1XC9 A;  5AI4 A;  5JU5 A;  2NRX A;  2O6K A;  4NLZ A;  3G6Y A;  3SR6 A;  3IM1 A;  3QUT A;  4QZ9 A;  2F1H A;  5JRT A;  1Z1V A;  4R66 A;  3H4B A;  2A1J B;  1ZQH A;  2LBO A;  5ALE A;  5DBA A;  2W8K A;  1SKS A;  2F44 A;  4J9P A;  3T79 A;  2C2R A;  2W9B A;  3D2S A;  4YCX A;  2W43 A;  2BCR A;  3PR5 B;  3IP4 B;  2KP7 A;  4F4Y A;  3PVX A;  2H3Z A;  2XC9 A;  5KT3 A;  2FMP A;  5JTI A;  3RJK A;  2KHV A;  2VA8 A;  2KJ8 A;  2HHX A;  4C0Z A;  4ECS A;  1BPB A;  2IHM A;  2ZIX B;  4O5K A;  2Y9U A;  1ZQ1 C;  1XO1 A;  3HW8 A;  1RDF A;  3GQC A;  3EPG A;  5J0Y A;  3TFR A;  4YR2 A;  3FDS A;  4DSI A;  5IIL A;  5EWF A;  1PUZ A;  3V6K A;  1K1S A;  5J2B A;  1L3S A;  7ICF A;  2YMM A;  2ZUD A;  2R8J A;  5KFX A;  5HHI A;  4KX5 A;  3AU2 A;  4DSK A;  3NUQ A;  3MR3 A;  2IOH A;  4DQR A;  1ZQW A;  5KFK A;  5AIB A;  9ICO A;  5KG5 A;  1ZD5 A;  3WK7 A;  2K89 A;  4DL3 A;  3NVV A;  5AK4 A;  4US9 A;  4RQ8 A;  2ALZ A;  3BS5 A;  1T3N A;  3D2Q A;  1DK3 A;  1BPZ A;  4KLT A;  1U48 A;  4IL6 U;  5KNI A;  5BOL A;  1D9F A;  2ISP A;  4OJO A;  2HOQ A;  4IQV A;  4A8E A;  3Q8S B;  5KFL A;  1DK2 A;  2W03 A;  5HML A;  1SL2 A;  2WF8 A;  2K4P A;  4QZE A;  4WJ3 B;  3K4G A;  3JPN A;  3M7D A;  2VA2 A;  5AKK A;  3CNH A;  4QZF A;  5HMM A;  2Y1I A;  3RBE A;  3TFS A;  5ALD A;  1ZQI A;  2ZJ5 A;  4Y2Y A;  1Q3U A;  1ZQE A;  1VDV A;  4GIB A;  3PO4 A;  1N62 A;  5CB1 A;  4O9M A;  1CRX A;  7ICK A;  3NGD A;  1TE2 A;  1FIQ A;  1V85 A;  1QH9 A;  4FBU A;  4QZD A;  1WCL A;  3LVV A;  2H3F A;  5B66 U;  5HR6 A;  2LM4 A;  2EAP A;  2JMG A;  2KNJ A;  4O3R A;  2KZ3 A;  2UVV A;  2HHW A;  1A6S A;  3A0B U;  2K8A A;  1RQN A;  3JPQ A;  4BDP A;  2NRV A;  4C8K A;  4FZN A;  1BPY A;  9ICT A;  2VIX A;  2MAX A;  5KG7 A;  3PSI A;  1Z1B A;  2K8B B;  4O3P A;  4UB3 A;  4RUC A;  1RXW A;  1QLN A;  9ICJ A;  4RQM A;  5KFZ A;  4OJL A;  1Q46 A;  2G5H B;  4GXK A;  3N97 B;  8ICK A;  2KMD A;  2LM1 A;  3F2C A;  4MFF A;  1XSL A;  2XVT A;  2W9A A;  2N1R A;  2YML A;  4DOB A;  4DQI A;  2YTU A;  4GC7 A;  5AKJ A;  4Z6C A;  4I2G A;  4AP9 A;  4QZH A;  4F5P A;  5ALK A;  8ICQ A;  3C5G A;  1T8E A;  3PZP A;  1SV4 A;  2AU0 A;  1COK A;  5KFY A;  1XSP A;  4MF2 A;  5J8Y C;  2OWO A;  3KTQ A;  4ZH4 A;  4TUR A;  3GDX A;  4UAR A;  2K60 A;  2HOI A;  2W04 A;  4DFP A;  5JUM A;  4EYI B;  7ICT A;  4PGQ A;  3H8W A;  3THV A;  1QTM A;  5J2H A;  4B9U A;  3KBB A;  4FO6 A;  2OHF A;  2WF5 A;  2D6F C;  8ICS A;  1SXD A;  2JV3 A;  4R63 A;  5CHG A;  4ELV A;  1HJP A;  4F5Q A;  1T3Q A;  4DL7 A; 
#chains in the Genus database with same CATH homology
 2AGO A;  3EZ5 A;  1ZQA A;  4ED1 A;  2IA6 A;  1Z3E B;  1HUZ A;  5J0S A;  2JEG A;  9ICV A;  3TQ1 A;  4K4G A;  2PI5 A;  2I9G A;  2ZUB A;  1ZQC A;  2XGQ A;  4IRC A;  4F91 B;  2HVI A;  4NXZ A;  4PHP A;  4LZG A;  4J9K A;  9ICM A;  4F5N A;  2V4Q A;  9ICX A;  4QWA A;  8ICJ A;  4BWM A;  2PFP A;  1RYR A;  2FMQ A;  3MFI A;  1D9D A;  4F5O A;  4QWD A;  3MBY A;  4IQU A;  2NRW A;  4UBC A;  3MGI A;  5J0R A;  5D49 A;  5L1J A;  4ELT A;  4O5E A;  3TAQ A;  3T3F A;  4MF8 A;  2BGW A;  2LYH A;  5KFF A;  4RQ1 A;  7ICS A;  2FLL A;  3Q8K A;  1UA1 A;  4M04 A;  1NK5 A;  4ECW A;  1ZQM A;  8ICA A;  5J0O A;  2BCV A;  1L3S A;  1NK9 A;  5DQH A;  5DG7 A;  3RTV A;  4DF8 A;  1S97 A;  2W9M A;  5CR0 A;  4RPY A;  1DGS A;  2BPC A;  4QZB A;  3RRG A;  4J9M A;  4I2A A;  5J29 A;  4C8N A;  2BHN A;  4F93 B;  3ETL A;  2VAN A;  5CP2 A;  1S0M A;  3PY8 A;  2J6T A;  2XY7 A;  4KLO A;  1V9P A;  3UQ0 A;  1TK0 A;  4KLJ A;  2ZUC A;  5KG6 A;  3PML A;  4QZC A;  2W9C A;  1SL0 A;  1ZQD A;  2ASJ A;  3KHR A;  2GWS A;  3PO5 A;  2NRT A;  2PXI A;  3GV5 B;  1B22 A;  4RQ6 A;  4IQW A;  1NJY A;  4QW8 A;  7ICE A;  5DDY A;  4RQ2 A;  3BJY A;  4DOC A;  4HYK A;  2BPG A;  4IRK A;  4G3I A;  8ICT A;  4KLM A;  7ICR A;  1X9S A;  8ICC A;  1U4B A;  1S77 D;  4F8R A;  2AQ4 A;  3GV8 B;  1NK7 A;  5DQG A;  5KFR A;  4RQ7 A;  8ICZ A;  4O0I A;  3SZ2 A;  2C2D A;  3ZD8 A;  4MEX A;  3HT3 A;  3MR5 A;  3G6V A;  2Y1J A;  1IM4 A;  1S0V A;  2F1J A;  2PFO A;  4PHA A;  4J9N A;  5KG0 A;  4F50 A;  1UT5 A;  3SV3 A;  3UQ2 A;  1NK4 A;  3RJJ A;  8ICE A;  9ICF A;  5KFH A;  2W9C B;  4BWJ A;  3RJE A;  4XA5 A;  2HHV A;  2UVR A;  5IIK A;  4JWN A;  1U49 A;  5EWE A;  9ICA A;  3K75 D;  1ZQG A;  4UB4 A;  3ZD9 A;  3MR2 A;  1L3V A;  1S0O A;  2M9N A;  7ICM A;  4KLQ A;  1NKC A;  4JUZ A;  1QSL A;  4RNN A;  2KZM A;  2FMS A;  7ICU A;  2KFN A;  1ZJM A;  2RDI A;  3MDA A;  5DGB A;  2ASD A;  4QWE A;  5DBC A;  3NTU A;  4KLL A;  5DKW A;  4KLE A;  3ZDA A;  4I29 A;  1COO A;  4I2D A;  4M9J A;  2HHU A;  2I1Q A;  4QWC A;  9ICH A;  2W9B B;  4DS5 A;  4TUS A;  1UT8 A;  3KHG A;  3H4D A;  5IIM A;  1Z00 A;  8ICN A;  4I2J A;  3RB3 A;  3RR7 A;  4YP3 A;  2V4R A;  4YMO A;  1NJW A;  4F3O A;  8ICF A;  9ICN A;  4R64 A;  4C8M A;  1TK5 A;  4UB1 A;  1TAU A;  5KFW A;  1RYS A;  3JPO A;  5KFE A;  4YXM A;  2JEJ A;  2P6U A;  4DFJ A;  1KFD A;  2PFQ A;  4YQW A;  1KTQ A;  5J2C A;  4KLU A;  9ICB A;  9ICS A;  4UAW A;  2XGP A;  4O3S A;  1XU4 A;  4RU9 A;  7ICJ A;  2BPF A;  3EWA A;  2XY6 A;  1ZQL A;  4BXO B;  5DQI A;  5DBB A;  4UB2 A;  3GIJ A;  3C5F A;  3TAR A;  2BDP A;  8ICH A;  1T4G A;  2UVU A;  4XUS A;  3C2M A;  3ORY A;  4KN7 A;  5HP4 A;  2JZB A;  4EBE A;  4R8U A;  1B43 A;  1XWL A;  5IIJ A;  3M9M B;  3GV7 B;  4J9S A;  3ISC A;  7ICQ A;  1ZET A;  1Z00 B;  1U45 A;  4TUP A;  1LB2 B;  2DFL A;  9ICR A;  3TI0 A;  4B9L A;  1SKR A;  4M2Y A;  2B21 A;  2HVH A;  2J6U A;  4QZ8 A;  2KN7 A;  3RAQ A;  2VA3 A;  4Q45 A;  2FPK A;  3H8J A;  1ZQY A;  1MC8 A;  1KLN A;  8ICB A;  5J2A A;  1NK6 A;  4KIT B;  4Q8E A;  2J6S A;  4YN4 A;  2AJQ A;  4YXJ A;  4I27 A;  5DB7 A;  5F9L A;  5KFN A;  5EWG A;  4RUA A;  2ZTC A;  4UBB A;  8ICM A;  4DFM A;  2JZB B;  4F4W A;  3BQ0 A;  4DOA A;  4I2C A;  3QEB Z;  5KFI A;  4R8U B;  4ED8 A;  2HHQ A;  3JPR A;  3PX4 A;  2JEF A;  2R8K A;  1KRP A;  1NK0 A;  5J0X A;  1C7Y A;  3PW5 A;  4RPX A;  9ICL A;  4GC6 A;  5KT7 A;  2C2E A;  4LZD A;  3HP6 A;  1ZJN A;  2KZZ A;  4FS2 A;  9ICI A;  4QWB A;  4DEZ A;  1TFR A;  4F2S A;  1ZYQ A;  5DG9 A;  1S10 A;  2FPL A;  4Q43 A;  5IIN A;  4O3N A;  4PH5 A;  1SKW A;  2IHN A;  2BCU A;  4R65 A;  2A1J A;  8ICY A;  5L9X A;  3OGU A;  3SI8 A;  4RQ5 A;  1L5U A;  4EZ9 A;  3UXO A;  2BCS A;  3RH5 A;  5L1K A;  3M8R A;  1T7P A;  2IBK A;  4DL4 A;  5KFV A;  1JXL A;  1ZQF A;  4DF4 A;  4ECV A;  2H5X A;  2XO7 A;  4QW9 A;  7ICI A;  3PX0 A;  5KFJ A;  5DB6 A;  4EEY A;  9ICC A;  1DOQ A;  4EBC A;  1XSN A;  4DSE A;  1XC9 A;  5J2G A;  3RJF A;  3RR8 A;  3GIL A;  8ICO A;  8ICG A;  9ICQ A;  4NY8 A;  2NRX A;  5HNK A;  4ECR A;  4NLZ A;  3G6Y A;  4M9G A;  3IM1 A;  2Q0Z X;  7ICN A;  4QZ9 A;  2F1H A;  4PGX A;  4YMN A;  4R66 A;  4DFK A;  2A1J B;  1EXN A;  4JV0 A;  3H4B A;  3C21 A;  5J2I A;  1ZQH A;  3Q8L A;  5DBA A;  2W8K A;  3B0X A;  1SKS A;  3H8S A;  3UXN A;  3MGH A;  9ICK A;  2KFZ A;  4J9P A;  4UB5 A;  2C2R A;  4J9L A;  4ED0 A;  4PHD A;  5J0U A;  5KFU A;  2W9B A;  2BQU A;  5KFM A;  5J2F A;  1ZQO A;  4XRH A;  2P6R A;  4YCX A;  4ECQ A;  4TUQ A;  5IIO A;  2BCR A;  4KTQ A;  8ICX A;  3PR5 B;  3V72 A;  1X2I A;  4F4Y A;  3ZDB A;  3RAX A;  3RB6 A;  4I28 A;  3PVX A;  1WCN A;  1NK8 A;  2XC9 A;  3ISD A;  1TVA A;  1RPL A;  3Q8P B;  1NKB A;  5KT3 A;  2FMP A;  5KFG A;  4DO9 A;  2JEI A;  9ICP A;  1KEJ A;  3RJK A;  1ZQV A;  4TQS A;  7ICP A;  3MFH A;  2VA8 A;  5J2D A;  4BXO A;  2HHX A;  4ECS A;  1BPB A;  3ZDE A;  2IHM A;  3FYH A;  1KSP A;  1JIH A;  4KLI A;  3PW0 A;  1S76 D;  1MSW D;  3V7K A;  3RH4 A;  3HWT A;  2XCA A;  4O5K A;  5KT4 A;  1BGX T;  4J9R A;  4F92 B;  1XO1 A;  3V7L A;  2ASL A;  4RQ0 A;  3HW8 A;  3RJI A;  3UPQ A;  2AQ0 A;  4P4O A;  4RNO A;  3GQC A;  3GFK B;  1CEZ A;  4F2R A;  4MFA A;  3EPG A;  2MUT A;  5J0Y A;  3TFR A;  4YR2 A;  2IMW P;  3FDS A;  4C8L A;  5CJ7 A;  2R8H A;  2ZTE A;  4DSI A;  2WTF A;  5IIL A;  5EWF A;  3GIM A;  2DPJ A;  3OJS A;  5L1I A;  3RB0 A;  3BQ1 A;  3V6K A;  1RZT A;  3ZDD A;  1K1S A;  1U9L A;  1LV5 A;  5J2B A;  3RJH A;  5L1L A;  3ZDC A;  4DQS A;  5DB9 A;  3PMN A;  4F4Z A;  5J2K A;  3LWL A;  4ED7 A;  1XS9 D;  5J2E A;  1N48 A;  1ZQJ A;  7ICF A;  2ZUD A;  4DQP A;  8ICW A;  1KFT A;  1JMS A;  2R8J A;  4CCH A;  5KG1 A;  1ZQK A;  4ED6 A;  5KFX A;  3PX6 A;  5HHI A;  4JK1 A;  3AU2 A;  3M9N B;  4DSK A;  7ICO A;  3LWM A;  2UVW A;  4B9V A;  1KDH A;  3OJU A;  1ZQX A;  3MR3 A;  2AGQ A;  2C22 A;  4DQR A;  1ZQW A;  4EZ6 A;  4F4K A;  5KFK A;  4EYH B;  1MQ2 A;  2MUT B;  3QEA Z;  2C28 A;  3V6J A;  4YD2 A;  4NM2 A;  5KG5 A;  9ICO A;  3T5J A;  5J0T A;  3Q8R B;  1TV9 A;  4DL3 A;  4KLS A;  3MR6 A;  4F5R A;  5KFS A;  4DS4 A;  4ELU A;  5KG2 A;  4RQ8 A;  3N4M B;  4DLG A;  1BPE A;  3G6X A;  2ALZ A;  1D8L A;  1QSS A;  5KFT A;  4YR3 A;  4F4X A;  1ZQS A;  1D8Y A;  1S9F A;  1T3N A;  2PFN A;  1TK8 A;  3MAB A;  4KN4 A;  2P66 A;  4M6W A;  4DQQ A;  1JX4 A;  1CUK A;  4JWM A;  3IHQ B;  3RBD A;  1SL1 A;  1BPZ A;  4KLT A;  1L3U A;  4O3Q A;  1U48 A;  4K4H A;  4RPZ A;  4O5C A;  4ECX A;  5C5J A;  8ICV A;  5DG8 A;  5BOL A;  1D9F A;  3Q8Q B;  5DDM A;  5J0Q A;  4ED2 A;  2ISP A;  5III A;  4ED3 A;  1MQ3 A;  3C1Y A;  1A76 A;  4DL6 A;  4IQV A;  3Q8S B;  4DL2 A;  2NRZ A;  2XCP A;  4ECZ A;  2BQ3 A;  1UA0 A;  3JPP A;  5KFL A;  5KFD A;  4KMU A;  3EPI A;  5HML A;  4QZG A;  1X9W A;  3SYZ A;  1SL2 A;  1PZN A;  2ZJ8 A;  4UAY A;  3PNC A;  3PR4 A;  3T5K A;  3OSP A;  1RXV A;  4B9S A;  4QZE A;  5TZV A;  3LK9 A;  3K4G A;  4J9O A;  7ICV A;  4BGD A;  5KFQ A;  3JPN A;  4M6W B;  2VA2 A;  3EYZ A;  4P4M A;  4M0A A;  4GLX A;  4I2E A;  4Q44 A;  4TQR A;  3M8S A;  2XY5 A;  2FPM A;  5KFP A;  3ISB A;  5KG3 A;  4QZF A;  3GIK A;  5HMM A;  4RT3 A;  2BR0 A;  2Y1I A;  3V7J A;  5DLG A;  5KT6 A;  2AGP A;  4QZI A;  4YFK A;  3RBE A;  3MDC A;  3TFS A;  4IR9 A;  5CWR A;  4GXI A;  2BQR A;  3OSN A;  1ZQI A;  2ZJ5 A;  3C23 A;  4RZR A;  3RH6 A;  5DLF A;  1ZQE A;  4IRD A;  1S0N A;  4JV1 A;  7ICL A;  8ICI A;  4I2F A;  4RQ3 A;  4M9N A;  3AU6 A;  5BOM A;  3PO4 A;  5CB1 A;  4KLD A;  3JPT A;  1ZQR A;  4M9L A;  4O9M A;  1HUO A;  7ICK A;  5KG4 A;  3NGD A;  4ECY A;  3AUO A;  2R8G A;  4K4I A;  4NLN A;  4NLK A;  3E2E A;  1ZQQ A;  2KTQ A;  2R8I A;  4FBU A;  4QZD A;  1WCL A;  8ICR A;  7ICH A;  2ZTD A;  1H38 A;  4LVS A;  3C2L A;  3M9O B;  1A77 A;  4GXJ A;  4PGY A;  3QE9 Y;  1L3T A;  3RJG A;  7ICG A;  2HW3 A;  5KTQ A;  5EOZ A;  3HPO A;  4Q8F A;  5KT2 A;  4DLE A;  4O3R A;  2KZ3 A;  9ICW A;  2UVV A;  2HHS A;  4MEY A;  4YD1 A;  1SZP A;  1TAQ A;  2HHW A;  3SV4 A;  4RQ4 A;  2PI4 A;  3C2K A;  5BPC A;  5D46 A;  2V9W A;  3JPQ A;  5F9N A;  2DPI A;  5DB8 A;  4P4P A;  4QZA A;  5KFC A;  3PV8 A;  1BPX A;  3RB4 A;  3JPS A;  4BDP A;  2NRV A;  4C8K A;  1JXE A;  4YVZ A;  4PHE A;  3Q8M A;  4YR0 A;  1BPY A;  9ICT A;  1JN3 A;  4NM1 A;  2MAX A;  5KG7 A;  4ECT A;  4E0D A;  4Z6F A;  3V6H A;  4O3P A;  1Y88 A;  4UB3 A;  4RUC A;  1RXW A;  4KLG A;  5KFA A;  4EBD A;  1QLN A;  9ICJ A;  9ICE A;  1ZQZ A;  1ZQB A;  3B0Y A;  2HHT A;  5KFZ A;  4FS1 A;  9ICG A;  4RNM A;  3QZ8 A;  4GXK A;  3N97 B;  4UQG A;  1QSY A;  2BKE A;  8ICL A;  1NJZ A;  4O3O A;  4P2H A;  8ICK A;  4DSF A;  4X5V A;  3PW4 A;  2FLP A;  2BCQ A;  4RT2 A;  4C8O A;  4MFF A;  1ZQU A;  1XSL A;  2W9A A;  4XQ8 A;  3H40 A;  4IR1 A;  3T5L A;  4Z6E A;  1ZQN A;  4Z6D A;  4IQT A;  4DOB A;  2ATL A;  3EW9 A;  4DL5 A;  4GC7 A;  1BVS A;  4Z6C A;  4DQI A;  4I2G A;  3LDA A;  3KHL A;  4QZH A;  4F5P A;  4B9N A;  4M9H A;  8ICQ A;  1U47 A;  1BPD A;  3RRH A;  4DSL A;  3C5G A;  4I2B A;  1T8E A;  1ZQT A;  5HHH A;  3HX0 A;  1NOM A;  3BQT A;  5DGA A;  2RDJ A;  2AU0 A;  5KT5 A;  4YG2 A;  1ZQP A;  4M47 A;  3TAP A;  5KFY A;  5J0W A;  1XSP A;  4B9T A;  4MF2 A;  4UAZ A;  2OWO A;  3KTQ A;  3C1Z A;  4ZH4 A;  3BQ2 A;  4TUR A;  4I2H A;  9ICU A;  5D4B A;  3GII A;  1ARO P;  3GDX A;  3PW7 A;  1K1Q A;  5KFB A;  3KHH A;  1N56 A;  1TKD A;  2ZJA A;  4DFP A;  5JUM A;  4EYI B;  7ICT A;  4PGQ A;  3H8W A;  1IXR A;  3THV A;  1QTM A;  5J2H A;  3T5H A;  4B9U A;  4MFC A;  4FO6 A;  2FLN A;  4ECU A;  1NJX A;  3PW2 A;  2ISO A;  2F1I A;  3OHA A;  2W8L A;  1KFS A;  4YMM A;  3H7I A;  5KFO A;  1X9M A;  4DWI A;  8ICS A;  4JV2 A;  4R63 A;  5J0P A;  5CHG A;  4NLG A;  4ELV A;  5J2J A;  1HJP A;  4J9Q A;  4KLH A;  4F5Q A;  1NKE A;  4DSJ A;  4PPX A;  3BDP A;  8ICU A;  3QZ7 A;  3OHB A;  3TAN A;  4KLF A;  5CA7 A;  4I2I A;  8ICP A;  3UXP A;  4DL7 A;  4B9M A;  4FBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...