1WCNA

Nmr structure of the carboxyterminal domains of escherichia coli nusa
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION ELONGATION PROTEIN NUSA
publication title The E. Coli Nusa Carboxy-Terminal Domains are Structurally Similar and Show Specific Rnap- and Lambdan Interactions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 19
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1wcnA01
3ETLA 4DL2A 2BHNA 3TFSA 1JN3A 2ISOA 4M9HA 8ICFA 3JPQA 2IA6A 5J0OA 3V6HA 3HX0A 4QWBA 4M9LA 4JV1A 3TAPA 1WCNA 1WCLA 3MR3A 3KHRA 4YFKA 3QE9Y 4RQ0A 3KHGA 3H7IA 1ZQFA 2B21A 8ICJA 1A77A 4QZHA 5DQGA 8ICZA 3T3FA 4QWDA 5BPCA 3RAXA 3ZDAA 9ICQA 3IHQB 2XO7A 3EPGA 5L9XA 3Q8LA 9ICKA 3HP6A 5KG3A 3OHBA 5DQIA 2W9BA 4MFFA 9ICUA 1D8YA 4P4PA 2BCSA 1S77D 5IIJA 5DG7A 2C28A 1SKRA 4O3NA 9ICAA 5DBAA 3TARA 1T8EA 3LWMA 8ICIA 1UA0A 3B0YA 9ICSA 3KHHA 4R65A 3GDXA 4K4HA 1BPXA 5CP2A 5DBBA 4EYHB 2ZUDA 1QTMA 4ED7A 1PZNA 4M9NA 2DFLA 1XWLA 4YP3A 2UVRA 1U48A 3EYZA 4IR1A 3TANA 4BXOB 4RU9A 1ZQVA 4UB1A 2HHUA 4DSLA 1X9MA 1TK8A 2AGPA 1RYRA 1NOMA 1COOA 2XCAA 4FS1A 3PX6A 1JX4A 4UB2A 4KLJA 1ZQEA 3GIJA 5J29A 5L1JA 3MGIA 4F93B 1QSYA 1ZQTA 2M9NA 4O0IA 3G6XA 2BPFA 5KFQA 4F50A 4NM2A 8ICWA 3UQ0A 9ICHA 3H4BA 3C2LA 2FPLA 1Z00B 4F91B 4DLGA 4IRCA 2IHNA 4TQSA 4KLHA 4QWEA 3SV3A 4DLEA 3RJJA 1JXEA 7ICIA 3H40A 8ICHA 4R8UA 4I2HA 4RQ3A 5JUMA 2ZTDA 4O3SA 1NK4A 4BWJA 2MAXA 1ZETA 1ZQAA 4O3PA 4ECWA 3ZDCA 4FS2A 5HHIA 4F4ZA 3RJHA 8ICCA 1SKSA 4C8OA 7ICHA 1KSPA 5KT6A 1L5UA 1ZQQA 1N48A 2RDIA 5J0RA 2BCRA 5KG6A 1UT8A 3JPPA 2BR0A 1H38A 7ICTA 8ICRA 4UAYA 4O9MA 4KLEA 4MEYA 4P2HA 4F5PA 4DL6A 7ICNA 1T3NA 2DPJA 1NK0A 4F3OA 4J9QA 2AGQA 4CCHA 4O3RA 8ICAA 4DL7A 1BPBA 4PH5A 4UB5A 4DQQA 3NTUA 3MR2A 2NRZA 1ZQZA 3PR5B 3GQCA 4RNOA 2P6RA 4KITB 4XQ8A 2XY7A 2F1JA 3V6KA 4EBEA 1MQ3A 4I27A 8ICOA 2IMWP 4O3QA 1JIHA 2ZJ5A 4RT3A 4RNMA 2HVHA 3H8WA 5IILA 1S0MA 3PNCA 3PW7A 4JWNA 4IQWA 5CWRA 4EEYA 1XSPA 2KZ3A 4TUQA 4KLQA 3RH5A 1ZQLA 1L3SA 4DFKA 9ICRA 4ECUA 4KLDA 3PO5A 2KN7A 3RB6A 8ICNA 4ED3A 3OSPA 4YMNA 5L1LA 3Q8KA 1RYSA 2MUTA 2C2RA 3B0XA 2J6UA 4XUSA 2NRXA 5KT2A 3G6YA 8ICXA 2W9CA 4DO9A 3KTQA 2XY5A 1SKWA 2FPKA 2I1QA 4RQ4A 4LVSA 1XC9A 3C5FA 4RQ8A 5DG8A 4XRHA 4RPYA 5EWFA 4B9VA 9ICBA 1KFDA 3TI0A 5J0YA 3BQ0A 1SL2A 4KLOA 4RUAA 8ICPA 4DOBA 4J9SA 3AU6A 1SL0A 1ZQCA 4DF4A 4DOAA 3Q8RB 4J9NA 5KFGA 4UBCA 4C8NA 4F4XA 1NJZA 1NK9A 1ZQIA 4Z6EA 3RR7A 4QWCA 4KLFA 4Q8FA 5KFMA 3GV8B 2BPGA 4KLSA 3OGUA 3T5HA 3PX0A 2BQUA 2WTFA 4O5CA 1S10A 4F5OA 1AROP 5CJ7A 4M6WA 2HHQA 5DB7A 4DS5A 3QEBZ 4DSJA 4DQIA 4KN4A 2FPMA 3GILA 4MFCA 3BQ2A 3QZ7A 4P4OA 5J0TA 1ZQKA 4M9GA 4YR0A 1ZQSA 4KLMA 2BQ3A 4UAZA 3UQ2A 5DB6A 4DFPA 2ZTEA 4DQSA 1S97A 7ICFA 1IXRA 3RH6A 4JK1A 9ICLA 3PR4A 2UVVA 3RRGA 1XSLA 5DGBA 4PHAA 1ZJMA 3RJIA 4G3IA 2P66A 3Q8QB 2R8HA 3AUOA 1ZQNA 1MSWD 9ICVA 4QZGA 2ZUCA 5J2KA 4GXKA 1ZJNA 4YR2A 4Z6CA 4YR3A 2ZTCA 4I29A 2FLLA 4RQ5A 4KLIA 3RH4A 3RB0A 3H8JA 3ZDBA 5EWEA 3C1YA 1ZQOA 2AGOA 4RQ7A 4RPZA 1JXLA 5KTQA 1TK5A 4ELTA 2ZUBA 2VA3A 2H5XA 3ISBA 1KLNA 2BDPA 4Q8EA 4J9MA 2HVIA 3RRHA 3T5LA 1C7YA 2FLPA 1KDHA 2JEFA 3FYHA 3TFRA 3MGHA 4YQWA 3BJYA 3Q8SB 9ICGA 4I2FA 2BQRA 4I2IA 4DQRA 5EOZA 2PXIA 8ICYA 4DSFA 2JEGA 5C5JA 2HW3A 3MR6A 2KFZA 3HT3A 3RB4A 2JEJA 1TFRA 5KFYA 5KG7A 5KG4A 4MF8A 3RJGA 5KFIA 5KFUA 5KG2A 4R64A 4ED6A 3MBYA 4GXIA 4X5VA 2BCUA 2VA2A 1QLNA 4F4WA 4I28A 4F2RA 5J0UA 3PO4A 7ICGA 5IIOA 2BGWA 4NLGA 4F4KA 4B9LA 3SYZA 4YD1A 1U45A 4Z6DA 1U47A 1ZQUA 7ICSA 5DG9A 3T5JA 3K75D 4PHDA 4F5RA 5KFSA 3BQ1A 1A76A 1BPDA 1JMSA 4RT2A 2W9BB 4I2AA 4J9OA 4M9JA 4PGYA 3RTVA 2OWOA 1XSNA 4ED8A 4NXZA 5DB8A 3HWTA 1B43A 5DBCA 1U9LA 3K4GA 4EZ6A 9ICXA 4KMUA 2VANA 4QZAA 2NRVA 4KLUA 2A1JA 5L1KA 1BVSA 3PMNA 3C1ZA 4B9TA 5J2AA 1RXVA 4QWAA 5CHGA 5DQHA 1X9SA 4M2YA 5CB1A 5KT3A 4BDPA 3EWAA 4F8RA 2HHSA 4XA5A 3MDCA 3GV7B 4DS4A 3THVA 2C22A 4PHEA 2FMQA 4B9UA 4P4MA 2UVUA 4J9KA 4F92B 5J0QA 3RJEA 1CUKA 4UBBA 4DL5A 5KFBA 1NJYA 2FMSA 2JZBA 9ICIA 8ICKA 3ZD9A 1TAUA 9ICMA 2ASJA 5J2EA 5L1IA 4MEXA 1ZQBA 4JWMA 1S0VA 5DLFA 4NLZA 3G6VA 4TQRA 2BCVA 2PFNA 3PV8A 5J0XA 2ZJAA 4DFMA 1RXWA 1UT5A 3JPOA 2XGPA 3N4MB 4R8UB 1SL1A 3GIIA 1T7PA 5J2HA 9ICFA 3MR5A 1L3VA 3JPSA 8ICEA 3UXNA 2ZJ8A 4Q43A 4FO6A 7ICJA 4ECVA 2ALZA 1DGSA 9ICJA 1U49A 1D8LA 4ZH4A 3M9OB 2V4QA 1QSSA 4C8MA 5IIMA 1V9PA 2Q0ZX 3KHLA 3C5GA 2IBKA 8ICQA 3ISDA 3M9MB 1DOQA 4I2BA 2J6SA 5DDMA 3M9NB 3ISCA 1TKDA 4I2EA 4MF2A 4DL4A 4QZEA 3GIKA 9ICOA 4NM1A 5KFEA 1BPZA 5KG5A 4RNNA 4UB3A 1HJPA 4YXMA 5TZVA 4F5QA 3PVXA 5D49A 3Q8MA 1ZQYA 2Y1JA 4QZCA 1L3TA 5J2BA 1KTQA 1ZQMA 2XC9A 5DGAA 1XS9D 5KFKA 1SZPA 1Z3EB 1K1QA 4R63A 1Y88A 1HUZA 4J9PA 3C2MA 3SI8A 1NK7A 4JUZA 3RBEA 5J0PA 1L3UA 4NY8A 9ICTA 2KZZA 3QZ8A 1MQ2A 3C21A 2AJQA 2MUTB 3RBDA 2V4RA 2PFPA 3GFKB 5KFHA 2V9WA 2HHXA 2HHTA 4QW9A 2VA8A 3RJKA 7ICKA 2W9CB 7ICUA 3TAQA 7ICPA 1RPLA 5J2FA 4I2DA 4RQ2A 4J9RA 5KFVA 4BXOA 4QZIA 4PGQA 5DKWA 3RAQA 4QZBA 4ED2A 3OJUA 4DSEA 2PI5A 4O5KA 2HHWA 2F1HA 3PX4A 4KTQA 4NLKA 4IQUA 3FDSA 1D9DA 3PW0A 4TUSA 4ED0A 3RB3A 5J2IA 3PMLA 4FBTA 7ICVA 4F5NA 8ICBA 1XU4A 3LDAA 5IIIA 1BPEA 3OSNA 5IIKA 4PGXA 2XCPA 3UXPA 2I9GA 3ZDDA 3V7KA 3H4DA 5KFJA 1Z00A 3OJSA 2AU0A 3TQ1A 1S76D 3JPRA 3QEAZ 5J0SA 4TUPA 1S0OA 4YMOA 3C23A 4LZGA 5HP4A 1KRPA 9ICCA 4M6WB 2R8GA 3PW2A 2RDJA 1ZQJA 4HYKA 3OHAA 1MC8A 4YCXA 2NRTA 3GIMA 1ZQHA 4IQTA 4C8KA 4PHPA 4UAWA 1NJXA 1HUOA 4FBUA 5J2GA 4ECSA 3RJFA 5DDYA 4JV0A 3HPOA 3PW5A 1ZYQA 2FLNA 2PFQA 5CA7A 1XO1A 4DQPA 5HMMA 5DLGA 3RR8A 1IM4A 5KG0A 3HW8A 4KLTA 4NLNA 2KTQA 2F1IA 4RZRA 2NRWA 4YD2A 4Z6FA 1S9FA 4YVZA 4EBCA 4Q45A 4LZDA 3V6JA 2ASDA 3SV4A 4ECYA 5D4BA 1TV9A 1X9WA 2BPCA 7ICQA 4B9SA 4KLGA 2W8KA 1S0NA 1B22A 4R66A 5KFPA 4F4YA 5J2CA 2IHMA 2HHVA 5BOMA 5KFOA 4BWMA 3NGDA 4DEZA 1D9FA 4DWIA 1NKBA 9ICPA 1TK0A 5D46A 3MFIA 4QZ9A 1KEJA 4RQ6A 1RZTA 8ICMA 5KT4A 4K4GA 3M8RA 3LWLA 1NK5A 1NK6A 4I2GA 4UB4A 3N97B 1T4GA 2ASLA 5BOLA 4DSIA 3PW4A 4O3OA 4QZ8A 3T5KA 5KT5A 2W8LA 4KN7A 8ICGA 4ECXA 1ZQXA 1ZQWA 4I2CA 5KFWA 3V7JA 4DOCA 5J2DA 4BGDA 1ZQPA 4M04A 5HNKA 5HHHA 4DFJA 1BPYA 1LB2B 4DL3A 4IQVA 1LV5A 2PFOA 1EXNA 3UPQA 4KLLA 4GLXA 5J0WA 1BGXT 5J2JA 8ICSA 1NK8A 9ICNA 4ELVA 4UQGA 4O5EA 9ICEA 4YN4A 3JPNA 4ECQA 2W9AA 4DF8A 3UXOA 1KFTA 3GV5B 2AQ0A 2UVWA 2PI4A 2KFNA 2J6TA 4PPXA 1K1SA 3JPTA 1ZQRA 3MDAA 4EBDA 3BDPA 1U4BA 5KFCA 4C8LA 3EW9A 3V7LA 4ECTA 4ELUA 3IM1A 4E0DA 1TAQA 2R8JA 3H8SA 1NKCA 7ICEA 1N56A 1ZQDA 4EZ9A 3SZ2A 4QZDA 1QSLA 4GXJA 5HMLA 3V72A 1UA1A 5KFAA 3M8SA 4B9MA 2A1JB 4RQ1A 5KFTA 4Q44A 2BKEA 5F9NA 4EYIB 4IRDA 4QZFA 2JEIA 7ICMA 5KFFA 2LYHA 4F2SA 3E2EA 4ED1A 4M47A 3LK9A 2XY6A 4ECRA 5KT7A 3AU2A 3MFHA 2XGQA 2C2EA 8ICUA 1NKEA 4YXJA 5IINA 3C2KA 1ZQGA 3Q8PB 2C2DA 4DSKA 3MABA 4I2JA 4RUCA 5CR0A 2KZMA 7ICLA 2JZBB 5KFDA 2W9MA 3ZDEA 4QW8A 4RPXA 4J9LA 2R8KA 4IR9A 4IRKA 5F9LA 1CEZA 4ECZA 2ISPA 9ICWA 5DB9A 3EPIA 3BQTA 5KG1A 2BCQA 5KFNA 2FMPA 4K4IA 7ICRA 2DPIA 5KFRA 1KFSA 4YG2A 3PY8A 3ORYA 5KFXA 4TURA 2P6UA 1NJWA 3EZ5A 7ICOA 4MFAA 2R8IA 4GC7A 2ATLA 1X2IA 2Y1IA 4YMMA 4M0AA 8ICVA 8ICLA 4B9NA 5KFZA 5EWGA 2AQ4A 3ZD8A 4GC6A 4JV2A 8ICTA 2GWSA 5KFLA 1TVAA
chains in the Genus database with same CATH superfamily
3ETLA 4DL2A 4M9HA 2LKYA 1WYGA 4QIWC 5T14A 1WCNA 3MR3A 2QARA 3H7IA 2B21A 2YB4A 2RP5A 1A77A 4QZHA 5DQGA 3FC4A 3TADC 9ICQA 3IHQB 3SAGA 3Q8LA 1N2XA 2GO7A 3IG8A 4MFFA 2H3ZA 5IIJA 4UAVA 3HKZF 4O3NA 2QKQA 1UA0A 3KHHA 4R65A 3GDXA 4U6PA 1YZ6A 4EYHB 2ZUDA 3WK9A 2NO4A 2KSOA 2UVRA 1U48A 2CXYA 2KNJA 4UB1A 2HHUA 3NVVA 2XCAA 4UARA 2RQ5A 4UB2A 3L5KA 3H0MB 5KFQA 4F50A 9ICHA 3UQ0A 2LM1A 2FPLA 2IHNA 4TQSA 3QU5A 2DWQA 1JXEA 4I2HA 4O3SA 4FZMA 2MAXA 4AYBC 2OH2A 7ICHA 5KT6A 1L5UA 3JPPA 4KLEA 4MEYA 4F5PA 1SV0A 1SV4A 4DL6A 7ICNA 2F3NA 4CCHA 5KAFU 4UB5A 1ZQZA 2N1RA 1IIPA 4I27A 5H2FU 1L7MA 2KMDA 3H0LB 4RT3A 3BS5A 5IILA 1S0MA 3PNCA 3ED5A 4IQWA 1XSPA 5ALIA 2W7OA 4CF5A 4YMNA 1RYSA 2C2RA 3B0XA 4XUSA 3G6YA 3QUCA 3KKAA 3IP4B 3A0BU 2I1QA 4LVSA 4RQ8A 5DG8A 3TI0A 1RQLA 2PMZC 5ALKA 8ICPA 2KOBA 4DF4A 3Q8RB 2JV3A 4C8NA 2A1AA 3RR7A 4FE3A 2ZIVA 1S10A 5CJ7A 4M6WA 5B5EU 2GLEA 5DB7A 4DQIA 4KN4A 4OCZA 3BQ2A 5L1MA 4YR0A 4UAZA 3UQ2A 2CRXA 2YMPA 1IXRA 2KICA 3PR4A 3RRGA 1XSLA 3AN1A 1ZJMA 5EE9A 1ZQNA 9ICVA 2ZUCA 4U7CA 4YR2A 2F76X 1X42A 4YR3A 4UW9A 3ETRA 5TISU 4RQ7A 4RPZA 1L7PA 1TK5A 4ELTA 2ZUBA 1LKYA 1KLNA 2BDPA 4Q8EA 3T5LA 2D8CA 4NWIA 4DQRA 2HW3A 2KFZA 1O08A 1TFRA 3F2BA 5KFYA 4P0PA 4R64A 1QLNA 4ED6A 3MBYA 4X5VA 2BCUA 5ALPA 4I28A 2H3VA 1NZPA 4F2RA 7ICGA 5IIOA 1ZQ1C 3SD7A 5ALSA 4NLGA 4F4KA 1U45A 2NV3A 1U47A 2HBJA 3BQ1A 1BPDA 2W9BB 4PGYA 1XSNA 4ED8A 2K8CB 4C80A 3HWTA 3RFAA 3AEVA 4EX6A 1B43A 2ODGA 9ICXA 1U9LA 4KMUA 4UAUA 1J97A 2NRVA 1SIJA 3DV9A 5L1KA 2W11A 2ZXIA 3WK4A 5J2AA 5EE3A 5CHGA 5ALXA 4BDPA 3MDCA 3GV7B 2C22A 4PHEA 4PL2A 1FFUA 1ZOLA 3RJEA 2JZBA 9ICMA 1UCVA 5J2EA 5L1IA 4MEXA 5DLFA 1MA7A 3G6VA 2BCVA 2PFNA 2ZJAA 4DFMA 1RDFA 1T7PA 3MR5A 5ALDA 2XVTA 5ALWA 4FO6A 2LHTA 2ALZA 3MGVA 1U49A 3M9OB 4C4RA 4C8MA 3KHLA 1V85A 2JGAA 8ICQA 3ISDA 1DOQA 1V97A 5DDMA 3ISCA 3RF9A 1TKDA 4MF2A 4QZEA 3GIKA 1SWVA 4C0ZA 4YXMA 5D49A 1ZQYA 3WKEA 5J2BA 5AK6A 1ZQMA 4CF3A 2XC9A 5DGAA 2WF8A 1K1QA 2QB0B 4JUZA 3RBEA 2KZZA 2KJ8A 5AIAA 1MQ2A 2MUTB 1OW5A 3GFKB 2HHXA 5GTIU 2W54A 2YMQA 7ICPA 5J2FA 4PGQA 3QUBA 4QZBA 3OJUA 2F1HA 3PX4A 4IQUA 1D9DA 4TUSA 3RB3A 4FBTA 3CNHA 4F5NA 1XU4A 3OSNA 4QJFB 3ZDDA 2DF4B 3I76A 5KFJA 3TQ1A 5HP4A 3SAHA 2RDJA 4HYKA 3WKDA 4YCXA 1PVPA 1NZBA 5DDYA 1ZYQA 3QYPA 2E8OA 2KTQA 2NYVA 1SXDA 4LZDA 3V6JA 4B9SA 5AICA 2KV2A 5BOMA 2DUYA 4DWIA 5D46A 2KP7A 3F5AA 5AM2A 5ALJA 2EAMA 4RQ6A 8ICMA 2YN4A 1RYUA 5BOLA 4DSIA 3PW4A 3T5KA 2G09A 4I2CA 4M04A 5HNKA 2K4PA 2HI0A 4IQVA 4KLLA 8ICSA 4UQGA 4O5EA 9ICEA 4ECQA 2W9AA 4BJQA 2PI4A 4PPXA 2K8AA 2E5SA 3A0HU 5J8YC 1PK3A 3WK6A 3EW9A 3IM1A 1JUDA 3MC1A 1N56A 2FE9A 5KFAA 1OUQA 4IRDA 2JEIA 3LK9A 3SAFA 2XGQA 4YXJA 2GOLA 5CR0A 7ICLA 2MU2A 5KFDA 1XNSA 3ZDEA 4IR9A 4CNQA 4IRKA 4EX7A 1JRPA 5F9LA 2ISPA 9ICWA 3EPIA 5KG1A 2BCQA 7ICRA 1KFSA 2FI1A 2JMGA 5AKYA 7ICOA 4MFAA 2R8IA 4GC7A 1X2IA 8ICVA 5KFZA 3L4PA 4DCCA 2BHNA 2IOFA 3TFSA 5KNIA 1JN3A 8ICFA 2IA6A 5J0OA 3HX0A 4CDGA 4JV1A 3TAPA 1WCLA 5AKJA 3TACB 4RQ0A 8ICJA 2ZIXA 2Y0SF 8ICZA 1Q46A 2XO7A 2ZIWA 3EPGA 9ICKA 3HP6A 3E58A 2OEHA 2HBMA 4Y2XA 3TKAA 2C28A 1SKRA 9ICAA 3TARA 1T8EA 3B0YA 5CP2A 1ZD2P 4ED7A 4YP3A 5EE0A 2Q4TA 4IR1A 3TANA 1ZQVA 3WK8A 1V38A 4DSLA 1TK8A 1JX4A 5EE1A 3OTQA 3GIJA 2E8NA 5L1JA 3MGIA 4F93B 4O0IA 2BPFA 2Z7JA 1ZRNA 4OJ6A 4QIWF 4IRCA 1YT3A 4QWEA 3SV3A 3RJJA 1PK1B 4R8UA 4RQ3A 4BWJA 2KKVA 4OJ5A 4FS2A 8ICCA 1RM6C 4F4ZA 2KHVA 1KSPA 1N48A 5J0RA 1UT8A 2KJ9A 4UAYA 3KZIU 4O9MA 4P2HA 1SV0C 1T3NA 1CI4A 4PH5A 4DQQA 3NTUA 2NRZA 2P6RA 4KITB 4XQ8A 4IC9A 3V6KA 4EBEA 1MQ3A 8ICOA 2KVCA 5ALFA 2IMWP 4O3QA 4WJ3B 2H3IA 5JRTA 3RH5A 4F72A 1ZQLA 1ZXIA 5AKZA 9ICRA 4ECUA 2KN7A 4ED3A 1JALA 5L1LA 3Q8KA 1BNPA 4AYBF 4DO9A 4US8A 2XY5A 2FPKA 3B9JA 3C5FA 9ICBA 5J0YA 2H3QA 3NVWA 1SL2A 4RUAA 2G0AA 2G07A 3AU6A 1SL0A 4J9NA 1NJZA 1ZQIA 2BPGA 3GV8B 4KLSA 2BQUA 5AKKA 1COKA 1DK3A 4EEKA 4F5OA 4DSJA 4P0QB 4MFCA 3BS7A 5J0TA 4M9GA 2MRLA 2BQ3A 1S97A 4DFPA 3RH6A 9ICLA 3PZPA 1X6IA 1VJ5A 5DGBA 4EELA 4Y2QA 3NVZA 4DFDA 1ZJNA 2ZTCA 2FLLA 4KLIA 3RH4A 3H8JA 4BX9C 1N63A 4NL9C 2AGOA 2PMZF 3AQEA 2VA3A 2HVIA 1WWUA 3VCBA 3TFRA 2D6FC 2BQRA 1HEKA 5EOZA 2PXIA 8ICYA 1AQ6A 3HT3A 3RB4A 3RJGA 5KG2A 2BZFA 4KX5A 3T79A 3AL0B 1S5LU 2E8MA 4Z6DA 3WU2U 4F5RA 1JMSA 4I2AA 1Q8KA 3K4GA 2YMMA 4QZAA 4KLUA 2E3TA 3PMNA 4B9TA 3AM9A 1QQ6A 4QWAA 1X9SA 5AK3A 4M2YA 4CGZA 4F8RA 1KQQA 4XA5A 1PVQA 2KEYA 4B9UA 4P4MA 2UVUA 4J9KA 2W55A 4UBBA 1NJYA 1K5OA 9ICIA 8ICKA 3VC8A 2ASJA 1S0VA 2KHQA 1RXWA 4FZNA 3JPOA 3N4MB 1L3VA 4ECVA 1SXEA 9ICJA 3H8MA 4ZH4A 1QSSA 2V4QA 5IIMA 2QB1A 3C5GA 5HR7A 2W04A 1L8OA 1BPZA 4RNNA 3D6JA 1HJPA 5TZVA 4OJPA 1KTQA 5KFKA 4R63A 4J9PA 3C2MA 2P35A 5J0PA 1L3UA 1ZD3A 9ICTA 1Z4OA 3QX7A 2V4RA 5KFHA 2W9CB 3TAQA 5AI8A 1VDVA 4RQ2A 2QLTA 5KFVA 3RAQA 4ED2A 4O5KA 2LM4A 2LYAA 7ICVA 2XCPA 3UXPA 5IIKA 1O03A 2EAOA 3JPRA 3TADA 1S0OA 4LZGA 2DL0A 3PW2A 1X40A 1ZQJA 3OHAA 2NRTA 3GIMA 1ZQHA 1C20A 4IQTA 4C8KA 3BZKA 5J2GA 4J03A 2FLNA 4MHVA 3HW8A 4KLTA 5AKIA 3M7DA 4RZRA 2NRWA 4YD2A 4Z6FA 4YVZA 2ASDA 4ECYA 1TV9A 1X9WA 4KLGA 3C28A 5JU5A 4US9A 4R66A 2IHMA 5ALVA 4BWMA 9ICPA 4IL6U 1TK0A 2W7PA 3LWLA 1T4GA 2ASLA 5KAIU 4EENA 4QZ8A 5KFWA 3V7JA 1ZQPA 5J2DA 2W03A 4DL3A 2PFOA 1QH9A 1UPHA 4GFJA 2DKZA 5J0WA 5AM1A 2LI6A 1N5WA 3UMCA 2WF9A 3NUQA 2F44A 3UXOA 2UVWA 2WAQC 4ICAA 1ZQRA 2Y9UA 3BDPA 5ALYA 4C8LA 4ECTA 4NLCA 1TAQA 1ZQDA 4EZ9A 4QZDA 2JXJA 5HMLA 3V72A 1Z1VA 4B9MA 2A1JB 4RQ1A 2BKEA 2M0NA 4F2SA 2LYHA 4M47A 3IDWA 1VLBA 2XY6A 4ECRA 1L7NA 2C2EA 5IINA 3Q8PB 1WG8A 2C2DA 3MABA 3UMBA 2XIDA 4RPXA 4J9LA 2K4IA 2G08A 4ECZA 3UM9A 4CE6A 3BQTA 2FMPA 1NI3A 2MSNA 5KFRA 3ORYA 1NJWA 2Y1IA 3IV6A 4JV2A 1TVAA 1SL1A 3WKBA 1N62A 2ISOA 3JPQA 1ZD4A 1F0MA 5ALTA 3KHRA 4YFKA 3ICXA 5C0YA 3T3FA 1QQ7A 2JH7A 1QQ5A 5KG3A 3OHBA 5DQIA 2W9BA 2F77X 9ICUA 2BCSA 2DBYA 4NLBA 5DG7A 1DGJA 5DBAA 3LWMA 8ICIA 2KVSA 4K4HA 2RLTA 4M9NA 2K4HA 2WB1C 2VJ5A 4BXOB 3NRZA 1X9MA 3SMVA 2AGPA 1NOMA 1COOA 4KLJA 1ZQEA 1X66A 2E1EA 4UB6U 5J29A 1ZQTA 2IOHA 8ICWA 2K89A 2LYBA 1Z00B 4F91B 2MA1A 4KLHA 1MN8A 7ICIA 4DLEA 8ICHA 5AKXA 5JUMA 1NK4A 1ZQAA 1ZETA 3PSTA 1N60A 4C8OA 2RDIA 1H38A 8ICRA 5AI0A 1NK0A 4J9QA 2AGQA 2ZG6A 1B0XA 5E79U 2E1FA 4RNOA 3SEIA 5AM5A 2F1JA 5AKEA 4KMOB 4UASA 1ECWA 4RNMA 2ZJ5A 2HVHA 4C4TA 4JWNA 4EEYA 2KZ3A 4KLQA 2QB0A 3N7SC 3IN5A 3OSPA 2MUTA 2J6UA 5KT2A 1S8OA 8ICXA 3WK7A 3NASA 3KTQA 1L7OA 1SKWA 2KIVA 1ZD5A 3ALRA 1HIWA 4XRHA 4RPYA 4B9VA 5ALLA 4DOBA 4J9SA 3C29A 2BDUA 4DOAA 3QNMA 4UBCA 4F4XA 1NK9A 4Z6EA 4QWCA 2WTFA 2DQNB 2KE7A 2EAPA 2OCEA 2LMRA 1AROP 2HHQA 3QEBZ 5B66U 2FPMA 3GILA 2ZIUB 4P4OA 1ZQKA 1ED1A 3K1RB 3D2SA 7ICFA 5DB6A 4DQSA 4Y2TA 1TE2A 2B6GA 2GH1A 4IS7A 1KW4A 4PHAA 3RJIA 2P66A 3Q8QB 2R8HA 3AUOA 4QZGA 2Y9TA 2WF7A 4I29A 2DKXA 3ZDBA 5EWEA 2B0CA 4OJLA 3RRHA 1C7YA 3OPXA 1KDHA 2FLPA 3MGHA 4YQWA 4I2FA 4I2IA 3LYSA 2EQYA 2JEGA 3H0RB 5C5JA 3CRXA 1CRXA 1RQNA 3MR6A 2OYYA 3NS1A 5KFIA 5KFUA 3M6KA 4GXIA 4F4WA 5J0UA 3PO4A 2QARB 3DDHA 4B9LA 3SYZA 4YD1A 1X9XA 3K75D 4PHDA 5KFSA 5KL1B 2OHFA 4J9OA 4M9JA 3RTVA 2KIWA 5DB8A 3N7PD 1ZRMA 2EZXA 4Y2YA 2OXOA 2R18A 3LVWA 5ALUA 2KSOB 5DQHA 1QCKA 3KD3A 2HHSA 4DS4A 3THVA 5AM4A 2FMQA 5AK4A 4F92B 5J0QA 4DL5A 5KFBA 3O0FA 1Q3VA 3ZD9A 2YTUA 1ZQBA 4NLZA 2F8LA 4TQRA 4OD0A 3D2NA 3GIIA 5J2HA 3JPSA 1UHUA 8ICEA 3UXNA 2ZXHA 3KKAC 4RQMA 1D8LA 3N28A 1V9PA 4NV0A 3F5EA 2ZIUA 1LVHA 4I2BA 4RQNA 2AH5A 3M9NB 9ICOA 5KFEA 3PSIA 3QU2A 3S6JA 4F5QA 3PVXA 3Q8MA 3BS5B 2Y1JA 4QZCA 1L3TA 5AI9A 4C4SA 2VJ4A 1XS9D 1N5XA 4AP9A 1Y88A 2FJ6A 1NK7A 2F8KA 1PUZA 4NY8A 2F2AB 3QZ8A 2AJQA 3RBDA 2PFPA 2V9WA 2HHTA 4QW9A 2VA8A 4OO1J 5HR6A 5AK5A 4I2DA 2EDUA 4J9RA 1FO4A 4QZIA 5DKWA 2PI5A 2HHWA 1T3QA 4KTQA 4KX3A 4ED0A 5J2IA 3PMLA 3LDAA 5IIIA 3QXGA 4PGXA 3SR6A 1KN5A 1KL9A 2ZIVB 5AI4A 5ALEA 1Z1BA 1PK1A 4TUPA 4YMOA 3C23A 2O6KA 3L3FX 1KRPA 4M6WB 4JB3A 4ZOHC 2A3VA 3QU7A 5ALGA 4UAWA 1HUOA 4JV0A 3HPOA 4DQPA 5HMMA 5DLGA 3RR8A 1IM4A 2F1IA 2DGZA 5FP0A 7ICQA 3SV4A 2BPCA 3SQIA 1DK2A 5KFPA 3F2DA 2HHVA 5KFOA 1M6YA 4DEZA 1D9FA 3UMGA 1LKYB 3WK5A 1Q3UA 4JMUA 4QZ9A 1RZTA 5KT4A 3M8RA 1NK6A 3N97B 4LJXA 4Y2SA 5KT5A 2W8LA 4KN7A 3M1YA 2JRZA 8ICGA 3ONNA 3QU9A 4ECXA 1J2NA 1ZQWA 1PVRA 4DOCA 5CRXA 5HHHA 5ALQA 4DFJA 4P0PB 1J2MA 1LV5A 1EXNA 2FDRA 2CPRA 4GLXA 5J2JA 1NK8A 4ELVA 3AMZA 3KOOA 3JPNA 4DF8A 1URJA 3GV5B 3QUQA 2J6TA 1K1SA 3JPTA 3CYMA 4EBDA 1U4BA 5KFCA 2YX8A 3V7LA 4ELUA 7ICEA 2R8JA 3H8SA 1NKCA 7ICTA 5ALRA 3SZ2A 4GXJA 4P0QA 3M8SA 5KFTA 4Q44A 4EYIB 2W3SA 7ICMA 3E2EA 3KFUF 3AU2A 3MFHA 4FZLA 2CN1A 1ZQGA 4DSKA 2VIXA 2KZMA 2JZBB 3KBBA 2R8KA 4QW8A 3HKZC 3GZFA 1KKXA 4K4IA 2JHDA 4HAIA 5CEHA 2DPIA 2JH1A 5KFXA 2WAQF 2P6UA 3R9KA 1FEZA 4Y2JA 8ICLA 4M0AA 2ATLA 4YMMA 8ICTA 1DXSA 5KFLA 1DRGA 3V6HA 1IG6A 4QWBA 4M9LA 3IG5A 1NNLA 3QE9Y 1ZQFA 3KHGA 1WUDA 2K60A 3ZDAA 4QWDA 5BPCA 3RAXA 2YQEA 5L9XA 1Z4NA 1D8YA 2IOFK 4P4PA 3K1ZA 1S77D 4NL9A 2WHEA 9ICSA 1BPXA 5JTIA 5DBBA 1QTMA 1PZNA 2DFLA 1XWLA 3EYZA 4B6JA 4RU9A 4PZOA 1RYRA 3I1YA 4FS1A 3PX6A 4UB8U 4Y2PA 1QSYA 2M9NA 3G6XA 4BUGA 4NM2A 3H4BA 3C2LA 2G06A 4DLGA 2KKPA 2KK0A 3H40A 2ZTDA 4O3PA 4ECWA 3ZDCA 3RJHA 5HHIA 2WF6A 1SKSA 1ZQQA 3PSFA 2BCRA 5KG6A 2BR0A 4Y2UA 1JROA 1F44A 2DPJA 4F3OA 4O3RA 8ICAA 4DL7A 1BPBA 3MR2A 3PR5B 3GQCA 1FFVA 2XY7A 2WB1F 4PL1A 1JIHA 3H8WA 2LBOA 5AM3A 3PW7A 5CWRA 3HJEA 4TUQA 1OXJA 2XI9A 2JR5A 1L3SA 4O3MA 2G5IB 4DFKA 4KLDA 5ALOA 3PO5A 3RB6A 8ICNA 2K4EA 1A6SA 2HBKA 2NRXA 2W9CA 3CW2C 2HOFA 4RQ4A 1XC9A 5AM0A 5EWFA 1KFDA 2L5YA 3BQ0A 4KLOA 3GU3A 4OJOA 1ZQCA 2I5HA 5KFGA 1D8BA 4ACOA 4KLFA 4Q8FA 5KFMA 3OGUA 3BZCA 3T5HA 3PX0A 4O5CA 2RHFA 3QUTA 2HOIA 4NJ8A 2I6XA 4DS5A 4CRXA 3PSPA 3F53A 3QZ7A 4KLMA 1ZQSA 2ZTEA 4JK1A 2UVVA 3NVYA 4G3IA 1MSWD 5J2KA 4GXKA 1BNOA 1FIQA 1IV8A 4Z6CA 4RQ5A 3RB0A 2HBLA 3C1YA 2ES6A 1ZQOA 2HDOA 5AIBA 1JXLA 5KTQA 2H5XA 2WFAA 3ISBA 4J9MA 5F3XB 1SB3C 1SWWA 2JEFA 3FYHA 1SGGA 3BJYA 3Q8SB 9ICGA 4DSFA 3U26A 2JEJA 5KG7A 5KG4A 4MF8A 2VA2A 3ZI4A 2BGWA 3N7RC 2ZIXB 3WKAA 1A0PA 3AQFA 1ZQUA 2ZIWB 5KL8B 5DG9A 3T5JA 7ICSA 1A76A 4RT2A 2OWOA 4NXZA 2W43A 5DBCA 2E8PA 4EZ6A 2VANA 4C7YA 2A1JA 2OM6A 1YZ7A 1BVSA 3C1ZA 4G9BA 3D2QA 1RXVA 1TAMA 5ALZA 4GIBA 5CB1A 5KT3A 4PJ0U 2YMLA 3EWAA 3NRWA 2WF5A 3FM9A 2RRDA 1CUKA 2FMSA 4QNLA 5AKLA 2KJ5A 1TAUA 4JWMA 3PV8A 5J0XA 1UT5A 2XGPA 4R8UB 1SZHA 1Z19A 9ICFA 4A8EA 2KD1A 3CP8A 4Y2VA 4Q43A 2ZJ8A 7ICJA 1DGSA 3KZXA 2YY6A 1B4FA 2Q0ZX 1L8LA 3FAHA 2IBKA 4PZNA 3M9MB 2W3RA 1L6NA 2J6SA 4I2EA 4DL4A 4NM1A 4CF4A 5KG5A 1F5SA 4UB3A 1SZPA 1Z3EB 2H3FA 1HUZA 3SI8A 2G5HB 5G5GA 3C21A 2LPEA 3HRDD 3RJKA 7ICKA 7ICUA 5AKHA 1RPLA 4BXOA 1WWVA 4FFDA 2EZZA 4DSEA 3E0FA 3IRUA 4NLKA 3FDSA 3PW0A 1XO0A 8ICBA 1T94A 5AI5A 1BPEA 2I9GA 5ALHA 3V7KA 2YB1A 3H4DA 1Z00A 3OJSA 3F2CA 2AU0A 1S76D 3QEAZ 3M6ZA 5J0SA 2HOQA 3J81j 9ICCA 2R8GA 1MC8A 1RG6A 4PHPA 1NJXA 4FBUA 4ECSA 3RJFA 3PW5A 5G5HA 2PFQA 5CA7A 1XO1A 1N61A 5KG0A 4NLNA 3WKCA 1S9FA 4EBCA 4Q45A 5D4BA 2K8BB 2W8KA 1S0NA 1B22A 4F4YA 5J2CA 3HILA 3NGDA 1NKBA 2AHOB 3MFIA 2HSZA 1KEJA 4F71A 4K4GA 4I2GA 1NK5A 4UB4A 5AHXA 4O3OA 3SENA 1UQVA 5A0LA 5GTHU 1ZQXA 4BGDA 3EUB2 1BPYA 1LB2B 3UPQA 2KG5A 2HCFA 2EZYA 1BGXT 9ICNA 4YN4A 2PKEA 3I28A 3QU4A 4C7ZA 1GO3F 1KFTA 2AQ0A 2KFNA 2NO5A 3MDAA 5J8YA 4Y2RA 4E0DA 1QSLA 1UA1A 5ALMA 1X6JA 1P7DA 5F9NA 4QZFA 2ESEA 5KFFA 2EH9A 4ED1A 2D3DA 2Y0SC 5KT7A 8ICUA 2VKQA 1NKEA 1KBUA 3C2KA 2EANA 4I2JA 4RUCA 2XICA 2HMXA 2W9MA 2A19A 1CEZA 3LVVA 5DB9A 5KFNA 5AKGA 1JI7A 4USAA 2AXTU 3DEEA 4YG2A 5K4LA 3PY8A 4TURA 5AI6A 5ALNA 3BQ7A 3EZ5A 4B9NA 5EWGA 2AQ4A 3ZD8A 4GC6A 4UATA 2GWSA
chains in the Genus database with same CATH topology
3ETLA 4DL2A 2BHNA 3TFSA 1JN3A 2ISOA 4M9HA 8ICFA 3JPQA 2IA6A 5J0OA 3V6HA 3HX0A 4QWBA 4M9LA 4JV1A 3TAPA 1WCNA 1WCLA 3MR3A 3KHRA 4YFKA 3QE9Y 4RQ0A 3KHGA 3H7IA 1ZQFA 2B21A 8ICJA 1A77A 4QZHA 5DQGA 8ICZA 3T3FA 4QWDA 5BPCA 3RAXA 3ZDAA 9ICQA 3IHQB 2XO7A 3EPGA 5L9XA 3Q8LA 9ICKA 3HP6A 5KG3A 3OHBA 5DQIA 2W9BA 4MFFA 9ICUA 1D8YA 4P4PA 2BCSA 1S77D 5IIJA 5DG7A 2C28A 1SKRA 4O3NA 9ICAA 5DBAA 3TARA 1T8EA 3LWMA 8ICIA 1UA0A 3B0YA 9ICSA 3KHHA 4R65A 3GDXA 4K4HA 1BPXA 5CP2A 5DBBA 4EYHB 2ZUDA 1QTMA 4ED7A 1PZNA 4M9NA 2DFLA 1XWLA 4YP3A 2UVRA 1U48A 3EYZA 4IR1A 3TANA 4BXOB 4RU9A 1ZQVA 4UB1A 2HHUA 4DSLA 1X9MA 1TK8A 2AGPA 1RYRA 1NOMA 1COOA 2XCAA 4FS1A 3PX6A 1JX4A 4UB2A 4KLJA 1ZQEA 3GIJA 5J29A 5L1JA 3MGIA 4F93B 1QSYA 1ZQTA 2M9NA 4O0IA 3G6XA 2BPFA 5KFQA 4F50A 4NM2A 8ICWA 3UQ0A 9ICHA 3H4BA 3C2LA 2FPLA 1Z00B 4F91B 4DLGA 4IRCA 2IHNA 4TQSA 4KLHA 4QWEA 3SV3A 4DLEA 3RJJA 1JXEA 7ICIA 3H40A 8ICHA 4R8UA 4I2HA 4RQ3A 5JUMA 2ZTDA 4O3SA 1NK4A 4BWJA 2MAXA 1ZETA 1ZQAA 4O3PA 4ECWA 3ZDCA 4FS2A 5HHIA 4F4ZA 3RJHA 8ICCA 1SKSA 4C8OA 7ICHA 1KSPA 5KT6A 1L5UA 1ZQQA 1N48A 2RDIA 5J0RA 2BCRA 5KG6A 1UT8A 3JPPA 2BR0A 1H38A 7ICTA 8ICRA 4UAYA 4O9MA 4KLEA 4MEYA 4P2HA 4F5PA 4DL6A 7ICNA 1T3NA 2DPJA 1NK0A 4F3OA 4J9QA 2AGQA 4CCHA 4O3RA 8ICAA 4DL7A 1BPBA 4PH5A 4UB5A 4DQQA 3NTUA 3MR2A 2NRZA 1ZQZA 3PR5B 3GQCA 4RNOA 2P6RA 4KITB 4XQ8A 2XY7A 2F1JA 3V6KA 4EBEA 1MQ3A 4I27A 8ICOA 2IMWP 4O3QA 1JIHA 2ZJ5A 4RT3A 4RNMA 2HVHA 3H8WA 5IILA 1S0MA 3PNCA 3PW7A 4JWNA 4IQWA 5CWRA 4EEYA 1XSPA 2KZ3A 4TUQA 4KLQA 3RH5A 1ZQLA 1L3SA 4DFKA 9ICRA 4ECUA 4KLDA 3PO5A 2KN7A 3RB6A 8ICNA 4ED3A 3OSPA 4YMNA 5L1LA 3Q8KA 1RYSA 2MUTA 2C2RA 3B0XA 2J6UA 4XUSA 2NRXA 5KT2A 3G6YA 8ICXA 2W9CA 4DO9A 3KTQA 2XY5A 1SKWA 2FPKA 2I1QA 4RQ4A 4LVSA 1XC9A 3C5FA 4RQ8A 5DG8A 4XRHA 4RPYA 5EWFA 4B9VA 9ICBA 1KFDA 3TI0A 5J0YA 3BQ0A 1SL2A 4KLOA 4RUAA 8ICPA 4DOBA 4J9SA 3AU6A 1SL0A 1ZQCA 4DF4A 4DOAA 3Q8RB 4J9NA 5KFGA 4UBCA 4C8NA 4F4XA 1NJZA 1NK9A 1ZQIA 4Z6EA 3RR7A 4QWCA 4KLFA 4Q8FA 5KFMA 3GV8B 2BPGA 4KLSA 3OGUA 3T5HA 3PX0A 2BQUA 2WTFA 4O5CA 1S10A 4F5OA 1AROP 5CJ7A 4M6WA 2HHQA 5DB7A 4DS5A 3QEBZ 4DSJA 4DQIA 4KN4A 2FPMA 3GILA 4MFCA 3BQ2A 3QZ7A 4P4OA 5J0TA 1ZQKA 4M9GA 4YR0A 1ZQSA 4KLMA 2BQ3A 4UAZA 3UQ2A 5DB6A 4DFPA 2ZTEA 4DQSA 1S97A 7ICFA 1IXRA 3RH6A 4JK1A 9ICLA 3PR4A 2UVVA 3RRGA 1XSLA 5DGBA 4PHAA 1ZJMA 3RJIA 4G3IA 2P66A 3Q8QB 2R8HA 3AUOA 1ZQNA 1MSWD 9ICVA 4QZGA 2ZUCA 5J2KA 4GXKA 1ZJNA 4YR2A 4Z6CA 4YR3A 2ZTCA 4I29A 2FLLA 4RQ5A 4KLIA 3RH4A 3RB0A 3H8JA 3ZDBA 5EWEA 3C1YA 1ZQOA 2AGOA 4RQ7A 4RPZA 1JXLA 5KTQA 1TK5A 4ELTA 2ZUBA 2VA3A 2H5XA 3ISBA 1KLNA 2BDPA 4Q8EA 4J9MA 2HVIA 3RRHA 3T5LA 1C7YA 2FLPA 1KDHA 2JEFA 3FYHA 3TFRA 3MGHA 4YQWA 3BJYA 3Q8SB 9ICGA 4I2FA 2BQRA 4I2IA 4DQRA 5EOZA 2PXIA 8ICYA 4DSFA 2JEGA 5C5JA 2HW3A 3MR6A 2KFZA 3HT3A 3RB4A 2JEJA 1TFRA 5KFYA 5KG7A 5KG4A 4MF8A 3RJGA 5KFIA 5KFUA 5KG2A 4R64A 4ED6A 3MBYA 4GXIA 4X5VA 2BCUA 2VA2A 1QLNA 4F4WA 4I28A 4F2RA 5J0UA 3PO4A 7ICGA 5IIOA 2BGWA 4NLGA 4F4KA 4B9LA 3SYZA 4YD1A 1U45A 4Z6DA 1U47A 1ZQUA 7ICSA 5DG9A 3T5JA 3K75D 4PHDA 4F5RA 5KFSA 3BQ1A 1A76A 1BPDA 1JMSA 4RT2A 2W9BB 4I2AA 4J9OA 4M9JA 4PGYA 3RTVA 2OWOA 1XSNA 4ED8A 4NXZA 5DB8A 3HWTA 1B43A 5DBCA 1U9LA 3K4GA 4EZ6A 9ICXA 4KMUA 2VANA 4QZAA 2NRVA 4KLUA 2A1JA 5L1KA 1BVSA 3PMNA 3C1ZA 4B9TA 5J2AA 1RXVA 4QWAA 5CHGA 5DQHA 1X9SA 4M2YA 5CB1A 5KT3A 4BDPA 3EWAA 4F8RA 2HHSA 4XA5A 3MDCA 3GV7B 4DS4A 3THVA 2C22A 4PHEA 2FMQA 4B9UA 4P4MA 2UVUA 4J9KA 4F92B 5J0QA 3RJEA 1CUKA 4UBBA 4DL5A 5KFBA 1NJYA 2FMSA 2JZBA 9ICIA 8ICKA 3ZD9A 1TAUA 9ICMA 2ASJA 5J2EA 5L1IA 4MEXA 1ZQBA 4JWMA 1S0VA 5DLFA 4NLZA 3G6VA 4TQRA 2BCVA 2PFNA 3PV8A 5J0XA 2ZJAA 4DFMA 1RXWA 1UT5A 3JPOA 2XGPA 3N4MB 4R8UB 1SL1A 3GIIA 1T7PA 5J2HA 9ICFA 3MR5A 1L3VA 3JPSA 8ICEA 3UXNA 2ZJ8A 4Q43A 4FO6A 7ICJA 4ECVA 2ALZA 1DGSA 9ICJA 1U49A 1D8LA 4ZH4A 3M9OB 2V4QA 1QSSA 4C8MA 5IIMA 1V9PA 2Q0ZX 3KHLA 3C5GA 2IBKA 8ICQA 3ISDA 3M9MB 1DOQA 4I2BA 2J6SA 5DDMA 3M9NB 3ISCA 1TKDA 4I2EA 4MF2A 4DL4A 4QZEA 3GIKA 9ICOA 4NM1A 5KFEA 1BPZA 5KG5A 4RNNA 4UB3A 1HJPA 4YXMA 5TZVA 4F5QA 3PVXA 5D49A 3Q8MA 1ZQYA 2Y1JA 4QZCA 1L3TA 5J2BA 1KTQA 1ZQMA 2XC9A 5DGAA 1XS9D 5KFKA 1SZPA 1Z3EB 1K1QA 4R63A 1Y88A 1HUZA 4J9PA 3C2MA 3SI8A 1NK7A 4JUZA 3RBEA 5J0PA 1L3UA 4NY8A 9ICTA 2KZZA 3QZ8A 1MQ2A 3C21A 2AJQA 2MUTB 3RBDA 2V4RA 2PFPA 3GFKB 5KFHA 2V9WA 2HHXA 2HHTA 4QW9A 2VA8A 3RJKA 7ICKA 2W9CB 7ICUA 3TAQA 7ICPA 1RPLA 5J2FA 4I2DA 4RQ2A 4J9RA 5KFVA 4BXOA 4QZIA 4PGQA 5DKWA 3RAQA 4QZBA 4ED2A 3OJUA 4DSEA 2PI5A 4O5KA 2HHWA 2F1HA 3PX4A 4KTQA 4NLKA 4IQUA 3FDSA 1D9DA 3PW0A 4TUSA 4ED0A 3RB3A 5J2IA 3PMLA 4FBTA 7ICVA 4F5NA 8ICBA 1XU4A 3LDAA 5IIIA 1BPEA 3OSNA 5IIKA 4PGXA 2XCPA 3UXPA 2I9GA 3ZDDA 3V7KA 3H4DA 5KFJA 1Z00A 3OJSA 2AU0A 3TQ1A 1S76D 3JPRA 3QEAZ 5J0SA 4TUPA 1S0OA 4YMOA 3C23A 4LZGA 5HP4A 1KRPA 9ICCA 4M6WB 2R8GA 3PW2A 2RDJA 1ZQJA 4HYKA 3OHAA 1MC8A 4YCXA 2NRTA 3GIMA 1ZQHA 4IQTA 4C8KA 4PHPA 4UAWA 1NJXA 1HUOA 4FBUA 5J2GA 4ECSA 3RJFA 5DDYA 4JV0A 3HPOA 3PW5A 1ZYQA 2FLNA 2PFQA 5CA7A 1XO1A 4DQPA 5HMMA 5DLGA 3RR8A 1IM4A 5KG0A 3HW8A 4KLTA 4NLNA 2KTQA 2F1IA 4RZRA 2NRWA 4YD2A 4Z6FA 1S9FA 4YVZA 4EBCA 4Q45A 4LZDA 3V6JA 2ASDA 3SV4A 4ECYA 5D4BA 1TV9A 1X9WA 2BPCA 7ICQA 4B9SA 4KLGA 2W8KA 1S0NA 1B22A 4R66A 5KFPA 4F4YA 5J2CA 2IHMA 2HHVA 5BOMA 5KFOA 4BWMA 3NGDA 4DEZA 1D9FA 4DWIA 1NKBA 9ICPA 1TK0A 5D46A 3MFIA 4QZ9A 1KEJA 4RQ6A 1RZTA 8ICMA 5KT4A 4K4GA 3M8RA 3LWLA 1NK5A 1NK6A 4I2GA 4UB4A 3N97B 1T4GA 2ASLA 5BOLA 4DSIA 3PW4A 4O3OA 4QZ8A 3T5KA 5KT5A 2W8LA 4KN7A 8ICGA 4ECXA 1ZQXA 1ZQWA 4I2CA 5KFWA 3V7JA 4DOCA 5J2DA 4BGDA 1ZQPA 4M04A 5HNKA 5HHHA 4DFJA 1BPYA 1LB2B 4DL3A 4IQVA 1LV5A 2PFOA 1EXNA 3UPQA 4KLLA 4GLXA 5J0WA 1BGXT 5J2JA 8ICSA 1NK8A 9ICNA 4ELVA 4UQGA 4O5EA 9ICEA 4YN4A 3JPNA 4ECQA 2W9AA 4DF8A 3UXOA 1KFTA 3GV5B 2AQ0A 2UVWA 2PI4A 2KFNA 2J6TA 4PPXA 1K1SA 3JPTA 1ZQRA 3MDAA 4EBDA 3BDPA 1U4BA 5KFCA 4C8LA 3EW9A 3V7LA 4ECTA 4ELUA 3IM1A 4E0DA 1TAQA 2R8JA 3H8SA 1NKCA 7ICEA 1N56A 1ZQDA 4EZ9A 3SZ2A 4QZDA 1QSLA 4GXJA 5HMLA 3V72A 1UA1A 5KFAA 3M8SA 4B9MA 2A1JB 4RQ1A 5KFTA 4Q44A 2BKEA 5F9NA 4EYIB 4IRDA 4QZFA 2JEIA 7ICMA 5KFFA 2LYHA 4F2SA 3E2EA 4ED1A 4M47A 3LK9A 2XY6A 4ECRA 5KT7A 3AU2A 3MFHA 2XGQA 2C2EA 8ICUA 1NKEA 4YXJA 5IINA 3C2KA 1ZQGA 3Q8PB 2C2DA 4DSKA 3MABA 4I2JA 4RUCA 5CR0A 2KZMA 7ICLA 2JZBB 5KFDA 2W9MA 3ZDEA 4QW8A 4RPXA 4J9LA 2R8KA 4IR9A 4IRKA 5F9LA 1CEZA 4ECZA 2ISPA 9ICWA 5DB9A 3EPIA 3BQTA 5KG1A 2BCQA 5KFNA 2FMPA 4K4IA 7ICRA 2DPIA 5KFRA 1KFSA 4YG2A 3PY8A 3ORYA 5KFXA 4TURA 2P6UA 1NJWA 3EZ5A 7ICOA 4MFAA 2R8IA 4GC7A 2ATLA 1X2IA 2Y1IA 4YMMA 4M0AA 8ICVA 8ICLA 4B9NA 5KFZA 5EWGA 2AQ4A 3ZD8A 4GC6A 4JV2A 8ICTA 2GWSA 5KFLA 1TVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ETL A;  4DL2 A;  2BHN A;  3TFS A;  1JN3 A;  2ISO A;  4M9H A;  8ICF A;  3JPQ A;  2IA6 A;  5J0O A;  3V6H A;  3HX0 A;  4QWB A;  4M9L A;  4JV1 A;  3TAP A;  1WCN A;  1WCL A;  3MR3 A;  3KHR A;  4YFK A;  3QE9 Y;  4RQ0 A;  3KHG A;  3H7I A;  1ZQF A;  2B21 A;  8ICJ A;  1A77 A;  4QZH A;  5DQG A;  8ICZ A;  3T3F A;  4QWD A;  5BPC A;  3RAX A;  3ZDA A;  9ICQ A;  3IHQ B;  2XO7 A;  3EPG A;  5L9X A;  3Q8L A;  9ICK A;  3HP6 A;  5KG3 A;  3OHB A;  5DQI A;  2W9B A;  4MFF A;  9ICU A;  1D8Y A;  4P4P A;  2BCS A;  1S77 D;  5IIJ A;  5DG7 A;  2C28 A;  1SKR A;  4O3N A;  9ICA A;  5DBA A;  3TAR A;  1T8E A;  3LWM A;  8ICI A;  1UA0 A;  3B0Y A;  9ICS A;  3KHH A;  4R65 A;  3GDX A;  4K4H A;  1BPX A;  5CP2 A;  5DBB A;  4EYH B;  2ZUD A;  1QTM A;  4ED7 A;  1PZN A;  4M9N A;  2DFL A;  1XWL A;  4YP3 A;  2UVR A;  1U48 A;  3EYZ A;  4IR1 A;  3TAN A;  4BXO B;  4RU9 A;  1ZQV A;  4UB1 A;  2HHU A;  4DSL A;  1X9M A;  1TK8 A;  2AGP A;  1RYR A;  1NOM A;  1COO A;  2XCA A;  4FS1 A;  3PX6 A;  1JX4 A;  4UB2 A;  4KLJ A;  1ZQE A;  3GIJ A;  5J29 A;  5L1J A;  3MGI A;  4F93 B;  1QSY A;  1ZQT A;  2M9N A;  4O0I A;  3G6X A;  2BPF A;  5KFQ A;  4F50 A;  4NM2 A;  8ICW A;  3UQ0 A;  9ICH A;  3H4B A;  3C2L A;  2FPL A;  1Z00 B;  4F91 B;  4DLG A;  4IRC A;  2IHN A;  4TQS A;  4KLH A;  4QWE A;  3SV3 A;  4DLE A;  3RJJ A;  1JXE A;  7ICI A;  3H40 A;  8ICH A;  4R8U A;  4I2H A;  4RQ3 A;  5JUM A;  2ZTD A;  4O3S A;  1NK4 A;  4BWJ A;  2MAX A;  1ZET A;  1ZQA A;  4O3P A;  4ECW A;  3ZDC A;  4FS2 A;  5HHI A;  4F4Z A;  3RJH A;  8ICC A;  1SKS A;  4C8O A;  7ICH A;  1KSP A;  5KT6 A;  1L5U A;  1ZQQ A;  1N48 A;  2RDI A;  5J0R A;  2BCR A;  5KG6 A;  1UT8 A;  3JPP A;  2BR0 A;  1H38 A;  7ICT A;  8ICR A;  4UAY A;  4O9M A;  4KLE A;  4MEY A;  4P2H A;  4F5P A;  4DL6 A;  7ICN A;  1T3N A;  2DPJ A;  1NK0 A;  4F3O A;  4J9Q A;  2AGQ A;  4CCH A;  4O3R A;  8ICA A;  4DL7 A;  1BPB A;  4PH5 A;  4UB5 A;  4DQQ A;  3NTU A;  3MR2 A;  2NRZ A;  1ZQZ A;  3PR5 B;  3GQC A;  4RNO A;  2P6R A;  4KIT B;  4XQ8 A;  2XY7 A;  2F1J A;  3V6K A;  4EBE A;  1MQ3 A;  4I27 A;  8ICO A;  2IMW P;  4O3Q A;  1JIH A;  2ZJ5 A;  4RT3 A;  4RNM A;  2HVH A;  3H8W A;  5IIL A;  1S0M A;  3PNC A;  3PW7 A;  4JWN A;  4IQW A;  5CWR A;  4EEY A;  1XSP A;  2KZ3 A;  4TUQ A;  4KLQ A;  3RH5 A;  1ZQL A;  1L3S A;  4DFK A;  9ICR A;  4ECU A;  4KLD A;  3PO5 A;  2KN7 A;  3RB6 A;  8ICN A;  4ED3 A;  3OSP A;  4YMN A;  5L1L A;  3Q8K A;  1RYS A;  2MUT A;  2C2R A;  3B0X A;  2J6U A;  4XUS A;  2NRX A;  5KT2 A;  3G6Y A;  8ICX A;  2W9C A;  4DO9 A;  3KTQ A;  2XY5 A;  1SKW A;  2FPK A;  2I1Q A;  4RQ4 A;  4LVS A;  1XC9 A;  3C5F A;  4RQ8 A;  5DG8 A;  4XRH A;  4RPY A;  5EWF A;  4B9V A;  9ICB A;  1KFD A;  3TI0 A;  5J0Y A;  3BQ0 A;  1SL2 A;  4KLO A;  4RUA A;  8ICP A;  4DOB A;  4J9S A;  3AU6 A;  1SL0 A;  1ZQC A;  4DF4 A;  4DOA A;  3Q8R B;  4J9N A;  5KFG A;  4UBC A;  4C8N A;  4F4X A;  1NJZ A;  1NK9 A;  1ZQI A;  4Z6E A;  3RR7 A;  4QWC A;  4KLF A;  4Q8F A;  5KFM A;  3GV8 B;  2BPG A;  4KLS A;  3OGU A;  3T5H A;  3PX0 A;  2BQU A;  2WTF A;  4O5C A;  1S10 A;  4F5O A;  1ARO P;  5CJ7 A;  4M6W A;  2HHQ A;  5DB7 A;  4DS5 A;  3QEB Z;  4DSJ A;  4DQI A;  4KN4 A;  2FPM A;  3GIL A;  4MFC A;  3BQ2 A;  3QZ7 A;  4P4O A;  5J0T A;  1ZQK A;  4M9G A;  4YR0 A;  1ZQS A;  4KLM A;  2BQ3 A;  4UAZ A;  3UQ2 A;  5DB6 A;  4DFP A;  2ZTE A;  4DQS A;  1S97 A;  7ICF A;  1IXR A;  3RH6 A;  4JK1 A;  9ICL A;  3PR4 A;  2UVV A;  3RRG A;  1XSL A;  5DGB A;  4PHA A;  1ZJM A;  3RJI A;  4G3I A;  2P66 A;  3Q8Q B;  2R8H A;  3AUO A;  1ZQN A;  1MSW D;  9ICV A;  4QZG A;  2ZUC A;  5J2K A;  4GXK A;  1ZJN A;  4YR2 A;  4Z6C A;  4YR3 A;  2ZTC A;  4I29 A;  2FLL A;  4RQ5 A;  4KLI A;  3RH4 A;  3RB0 A;  3H8J A;  3ZDB A;  5EWE A;  3C1Y A;  1ZQO A;  2AGO A;  4RQ7 A;  4RPZ A;  1JXL A;  5KTQ A;  1TK5 A;  4ELT A;  2ZUB A;  2VA3 A;  2H5X A;  3ISB A;  1KLN A;  2BDP A;  4Q8E A;  4J9M A;  2HVI A;  3RRH A;  3T5L A;  1C7Y A;  2FLP A;  1KDH A;  2JEF A;  3FYH A;  3TFR A;  3MGH A;  4YQW A;  3BJY A;  3Q8S B;  9ICG A;  4I2F A;  2BQR A;  4I2I A;  4DQR A;  5EOZ A;  2PXI A;  8ICY A;  4DSF A;  2JEG A;  5C5J A;  2HW3 A;  3MR6 A;  2KFZ A;  3HT3 A;  3RB4 A;  2JEJ A;  1TFR A;  5KFY A;  5KG7 A;  5KG4 A;  4MF8 A;  3RJG A;  5KFI A;  5KFU A;  5KG2 A;  4R64 A;  4ED6 A;  3MBY A;  4GXI A;  4X5V A;  2BCU A;  2VA2 A;  1QLN A;  4F4W A;  4I28 A;  4F2R A;  5J0U A;  3PO4 A;  7ICG A;  5IIO A;  2BGW A;  4NLG A;  4F4K A;  4B9L A;  3SYZ A;  4YD1 A;  1U45 A;  4Z6D A;  1U47 A;  1ZQU A;  7ICS A;  5DG9 A;  3T5J A;  3K75 D;  4PHD A;  4F5R A;  5KFS A;  3BQ1 A;  1A76 A;  1BPD A;  1JMS A;  4RT2 A;  2W9B B;  4I2A A;  4J9O A;  4M9J A;  4PGY A;  3RTV A;  2OWO A;  1XSN A;  4ED8 A;  4NXZ A;  5DB8 A;  3HWT A;  1B43 A;  5DBC A;  1U9L A;  3K4G A;  4EZ6 A;  9ICX A;  4KMU A;  2VAN A;  4QZA A;  2NRV A;  4KLU A;  2A1J A;  5L1K A;  1BVS A;  3PMN A;  3C1Z A;  4B9T A;  5J2A A;  1RXV A;  4QWA A;  5CHG A;  5DQH A;  1X9S A;  4M2Y A;  5CB1 A;  5KT3 A;  4BDP A;  3EWA A;  4F8R A;  2HHS A;  4XA5 A;  3MDC A;  3GV7 B;  4DS4 A;  3THV A;  2C22 A;  4PHE A;  2FMQ A;  4B9U A;  4P4M A;  2UVU A;  4J9K A;  4F92 B;  5J0Q A;  3RJE A;  1CUK A;  4UBB A;  4DL5 A;  5KFB A;  1NJY A;  2FMS A;  2JZB A;  9ICI A;  8ICK A;  3ZD9 A;  1TAU A;  9ICM A;  2ASJ A;  5J2E A;  5L1I A;  4MEX A;  1ZQB A;  4JWM A;  1S0V A;  5DLF A;  4NLZ A;  3G6V A;  4TQR A;  2BCV A;  2PFN A;  3PV8 A;  5J0X A;  2ZJA A;  4DFM A;  1RXW A;  1UT5 A;  3JPO A;  2XGP A;  3N4M B;  4R8U B;  1SL1 A;  3GII A;  1T7P A;  5J2H A;  9ICF A;  3MR5 A;  1L3V A;  3JPS A;  8ICE A;  3UXN A;  2ZJ8 A;  4Q43 A;  4FO6 A;  7ICJ A;  4ECV A;  2ALZ A;  1DGS A;  9ICJ A;  1U49 A;  1D8L A;  4ZH4 A;  3M9O B;  2V4Q A;  1QSS A;  4C8M A;  5IIM A;  1V9P A;  2Q0Z X;  3KHL A;  3C5G A;  2IBK A;  8ICQ A;  3ISD A;  3M9M B;  1DOQ A;  4I2B A;  2J6S A;  5DDM A;  3M9N B;  3ISC A;  1TKD A;  4I2E A;  4MF2 A;  4DL4 A;  4QZE A;  3GIK A;  9ICO A;  4NM1 A;  5KFE A;  1BPZ A;  5KG5 A;  4RNN A;  4UB3 A;  1HJP A;  4YXM A;  5TZV A;  4F5Q A;  3PVX A;  5D49 A;  3Q8M A;  1ZQY A;  2Y1J A;  4QZC A;  1L3T A;  5J2B A;  1KTQ A;  1ZQM A;  2XC9 A;  5DGA A;  1XS9 D;  5KFK A;  1SZP A;  1Z3E B;  1K1Q A;  4R63 A;  1Y88 A;  1HUZ A;  4J9P A;  3C2M A;  3SI8 A;  1NK7 A;  4JUZ A;  3RBE A;  5J0P A;  1L3U A;  4NY8 A;  9ICT A;  2KZZ A;  3QZ8 A;  1MQ2 A;  3C21 A;  2AJQ A;  2MUT B;  3RBD A;  2V4R A;  2PFP A;  3GFK B;  5KFH A;  2V9W A;  2HHX A;  2HHT A;  4QW9 A;  2VA8 A;  3RJK A;  7ICK A;  2W9C B;  7ICU A;  3TAQ A;  7ICP A;  1RPL A;  5J2F A;  4I2D A;  4RQ2 A;  4J9R A;  5KFV A;  4BXO A;  4QZI A;  4PGQ A;  5DKW A;  3RAQ A;  4QZB A;  4ED2 A;  3OJU A;  4DSE A;  2PI5 A;  4O5K A;  2HHW A;  2F1H A;  3PX4 A;  4KTQ A;  4NLK A;  4IQU A;  3FDS A;  1D9D A;  3PW0 A;  4TUS A;  4ED0 A;  3RB3 A;  5J2I A;  3PML A;  4FBT A;  7ICV A;  4F5N A;  8ICB A;  1XU4 A;  3LDA A;  5III A;  1BPE A;  3OSN A;  5IIK A;  4PGX A;  2XCP A;  3UXP A;  2I9G A;  3ZDD A;  3V7K A;  3H4D A;  5KFJ A;  1Z00 A;  3OJS A;  2AU0 A;  3TQ1 A;  1S76 D;  3JPR A;  3QEA Z;  5J0S A;  4TUP A;  1S0O A;  4YMO A;  3C23 A;  4LZG A;  5HP4 A;  1KRP A;  9ICC A;  4M6W B;  2R8G A;  3PW2 A;  2RDJ A;  1ZQJ A;  4HYK A;  3OHA A;  1MC8 A;  4YCX A;  2NRT A;  3GIM A;  1ZQH A;  4IQT A;  4C8K A;  4PHP A;  4UAW A;  1NJX A;  1HUO A;  4FBU A;  5J2G A;  4ECS A;  3RJF A;  5DDY A;  4JV0 A;  3HPO A;  3PW5 A;  1ZYQ A;  2FLN A;  2PFQ A;  5CA7 A;  1XO1 A;  4DQP A;  5HMM A;  5DLG A;  3RR8 A;  1IM4 A;  5KG0 A;  3HW8 A;  4KLT A;  4NLN A;  2KTQ A;  2F1I A;  4RZR A;  2NRW A;  4YD2 A;  4Z6F A;  1S9F A;  4YVZ A;  4EBC A;  4Q45 A;  4LZD A;  3V6J A;  2ASD A;  3SV4 A;  4ECY A;  5D4B A;  1TV9 A;  1X9W A;  2BPC A;  7ICQ A;  4B9S A;  4KLG A;  2W8K A;  1S0N A;  1B22 A;  4R66 A;  5KFP A;  4F4Y A;  5J2C A;  2IHM A;  2HHV A;  5BOM A;  5KFO A;  4BWM A;  3NGD A;  4DEZ A;  1D9F A;  4DWI A;  1NKB A;  9ICP A;  1TK0 A;  5D46 A;  3MFI A;  4QZ9 A;  1KEJ A;  4RQ6 A;  1RZT A;  8ICM A;  5KT4 A;  4K4G A;  3M8R A;  3LWL A;  1NK5 A;  1NK6 A;  4I2G A;  4UB4 A;  3N97 B;  1T4G A;  2ASL A;  5BOL A;  4DSI A;  3PW4 A;  4O3O A;  4QZ8 A;  3T5K A;  5KT5 A;  2W8L A;  4KN7 A;  8ICG A;  4ECX A;  1ZQX A;  1ZQW A;  4I2C A;  5KFW A;  3V7J A;  4DOC A;  5J2D A;  4BGD A;  1ZQP A;  4M04 A;  5HNK A;  5HHH A;  4DFJ A;  1BPY A;  1LB2 B;  4DL3 A;  4IQV A;  1LV5 A;  2PFO A;  1EXN A;  3UPQ A;  4KLL A;  4GLX A;  5J0W A;  1BGX T;  5J2J A;  8ICS A;  1NK8 A;  9ICN A;  4ELV A;  4UQG A;  4O5E A;  9ICE A;  4YN4 A;  3JPN A;  4ECQ A;  2W9A A;  4DF8 A;  3UXO A;  1KFT A;  3GV5 B;  2AQ0 A;  2UVW A;  2PI4 A;  2KFN A;  2J6T A;  4PPX A;  1K1S A;  3JPT A;  1ZQR A;  3MDA A;  4EBD A;  3BDP A;  1U4B A;  5KFC A;  4C8L A;  3EW9 A;  3V7L A;  4ECT A;  4ELU A;  3IM1 A;  4E0D A;  1TAQ A;  2R8J A;  3H8S A;  1NKC A;  7ICE A;  1N56 A;  1ZQD A;  4EZ9 A;  3SZ2 A;  4QZD A;  1QSL A;  4GXJ A;  5HML A;  3V72 A;  1UA1 A;  5KFA A;  3M8S A;  4B9M A;  2A1J B;  4RQ1 A;  5KFT A;  4Q44 A;  2BKE A;  5F9N A;  4EYI B;  4IRD A;  4QZF A;  2JEI A;  7ICM A;  5KFF A;  2LYH A;  4F2S A;  3E2E A;  4ED1 A;  4M47 A;  3LK9 A;  2XY6 A;  4ECR A;  5KT7 A;  3AU2 A;  3MFH A;  2XGQ A;  2C2E A;  8ICU A;  1NKE A;  4YXJ A;  5IIN A;  3C2K A;  1ZQG A;  3Q8P B;  2C2D A;  4DSK A;  3MAB A;  4I2J A;  4RUC A;  5CR0 A;  2KZM A;  7ICL A;  2JZB B;  5KFD A;  2W9M A;  3ZDE A;  4QW8 A;  4RPX A;  4J9L A;  2R8K A;  4IR9 A;  4IRK A;  5F9L A;  1CEZ A;  4ECZ A;  2ISP A;  9ICW A;  5DB9 A;  3EPI A;  3BQT A;  5KG1 A;  2BCQ A;  5KFN A;  2FMP A;  4K4I A;  7ICR A;  2DPI A;  5KFR A;  1KFS A;  4YG2 A;  3PY8 A;  3ORY A;  5KFX A;  4TUR A;  2P6U A;  1NJW A;  3EZ5 A;  7ICO A;  4MFA A;  2R8I A;  4GC7 A;  2ATL A;  1X2I A;  2Y1I A;  4YMM A;  4M0A A;  8ICV A;  8ICL A;  4B9N A;  5KFZ A;  5EWG A;  2AQ4 A;  3ZD8 A;  4GC6 A;  4JV2 A;  8ICT A;  2GWS A;  5KFL A;  1TVA A; 
#chains in the Genus database with same CATH topology
 3ETL A;  4DL2 A;  4M9H A;  2LKY A;  1WYG A;  4QIW C;  5T14 A;  1WCN A;  3MR3 A;  2QAR A;  3H7I A;  2B21 A;  2YB4 A;  2RP5 A;  1A77 A;  4QZH A;  5DQG A;  3FC4 A;  3TAD C;  9ICQ A;  3IHQ B;  3SAG A;  3Q8L A;  1N2X A;  2GO7 A;  3IG8 A;  4MFF A;  2H3Z A;  5IIJ A;  4UAV A;  3HKZ F;  4O3N A;  2QKQ A;  1UA0 A;  3KHH A;  4R65 A;  3GDX A;  4U6P A;  1YZ6 A;  4EYH B;  2ZUD A;  3WK9 A;  2NO4 A;  2KSO A;  2UVR A;  1U48 A;  2CXY A;  2KNJ A;  4UB1 A;  2HHU A;  3NVV A;  2XCA A;  4UAR A;  2RQ5 A;  4UB2 A;  3L5K A;  3H0M B;  5KFQ A;  4F50 A;  9ICH A;  3UQ0 A;  2LM1 A;  2FPL A;  2IHN A;  4TQS A;  3QU5 A;  2DWQ A;  1JXE A;  4I2H A;  4O3S A;  4FZM A;  2MAX A;  4AYB C;  2OH2 A;  7ICH A;  5KT6 A;  1L5U A;  3JPP A;  4KLE A;  4MEY A;  4F5P A;  1SV0 A;  1SV4 A;  4DL6 A;  7ICN A;  2F3N A;  4CCH A;  5KAF U;  4UB5 A;  1ZQZ A;  2N1R A;  1IIP A;  4I27 A;  5H2F U;  1L7M A;  2KMD A;  3H0L B;  4RT3 A;  3BS5 A;  5IIL A;  1S0M A;  3PNC A;  3ED5 A;  4IQW A;  1XSP A;  5ALI A;  2W7O A;  4CF5 A;  4YMN A;  1RYS A;  2C2R A;  3B0X A;  4XUS A;  3G6Y A;  3QUC A;  3KKA A;  3IP4 B;  3A0B U;  2I1Q A;  4LVS A;  4RQ8 A;  5DG8 A;  3TI0 A;  1RQL A;  2PMZ C;  5ALK A;  8ICP A;  2KOB A;  4DF4 A;  3Q8R B;  2JV3 A;  4C8N A;  2A1A A;  3RR7 A;  4FE3 A;  2ZIV A;  1S10 A;  5CJ7 A;  4M6W A;  5B5E U;  2GLE A;  5DB7 A;  4DQI A;  4KN4 A;  4OCZ A;  3BQ2 A;  5L1M A;  4YR0 A;  4UAZ A;  3UQ2 A;  2CRX A;  2YMP A;  1IXR A;  2KIC A;  3PR4 A;  3RRG A;  1XSL A;  3AN1 A;  1ZJM A;  5EE9 A;  1ZQN A;  9ICV A;  2ZUC A;  4U7C A;  4YR2 A;  2F76 X;  1X42 A;  4YR3 A;  4UW9 A;  3ETR A;  5TIS U;  4RQ7 A;  4RPZ A;  1L7P A;  1TK5 A;  4ELT A;  2ZUB A;  1LKY A;  1KLN A;  2BDP A;  4Q8E A;  3T5L A;  2D8C A;  4NWI A;  4DQR A;  2HW3 A;  2KFZ A;  1O08 A;  1TFR A;  3F2B A;  5KFY A;  4P0P A;  4R64 A;  1QLN A;  4ED6 A;  3MBY A;  4X5V A;  2BCU A;  5ALP A;  4I28 A;  2H3V A;  1NZP A;  4F2R A;  7ICG A;  5IIO A;  1ZQ1 C;  3SD7 A;  5ALS A;  4NLG A;  4F4K A;  1U45 A;  2NV3 A;  1U47 A;  2HBJ A;  3BQ1 A;  1BPD A;  2W9B B;  4PGY A;  1XSN A;  4ED8 A;  2K8C B;  4C80 A;  3HWT A;  3RFA A;  3AEV A;  4EX6 A;  1B43 A;  2ODG A;  9ICX A;  1U9L A;  4KMU A;  4UAU A;  1J97 A;  2NRV A;  1SIJ A;  3DV9 A;  5L1K A;  2W11 A;  2ZXI A;  3WK4 A;  5J2A A;  5EE3 A;  5CHG A;  5ALX A;  4BDP A;  3MDC A;  3GV7 B;  2C22 A;  4PHE A;  4PL2 A;  1FFU A;  1ZOL A;  3RJE A;  2JZB A;  9ICM A;  1UCV A;  5J2E A;  5L1I A;  4MEX A;  5DLF A;  1MA7 A;  3G6V A;  2BCV A;  2PFN A;  2ZJA A;  4DFM A;  1RDF A;  1T7P A;  3MR5 A;  5ALD A;  2XVT A;  5ALW A;  4FO6 A;  2LHT A;  2ALZ A;  3MGV A;  1U49 A;  3M9O B;  4C4R A;  4C8M A;  3KHL A;  1V85 A;  2JGA A;  8ICQ A;  3ISD A;  1DOQ A;  1V97 A;  5DDM A;  3ISC A;  3RF9 A;  1TKD A;  4MF2 A;  4QZE A;  3GIK A;  1SWV A;  4C0Z A;  4YXM A;  5D49 A;  1ZQY A;  3WKE A;  5J2B A;  5AK6 A;  1ZQM A;  4CF3 A;  2XC9 A;  5DGA A;  2WF8 A;  1K1Q A;  2QB0 B;  4JUZ A;  3RBE A;  2KZZ A;  2KJ8 A;  5AIA A;  1MQ2 A;  2MUT B;  1OW5 A;  3GFK B;  2HHX A;  5GTI U;  2W54 A;  2YMQ A;  7ICP A;  5J2F A;  4PGQ A;  3QUB A;  4QZB A;  3OJU A;  2F1H A;  3PX4 A;  4IQU A;  1D9D A;  4TUS A;  3RB3 A;  4FBT A;  3CNH A;  4F5N A;  1XU4 A;  3OSN A;  4QJF B;  3ZDD A;  2DF4 B;  3I76 A;  5KFJ A;  3TQ1 A;  5HP4 A;  3SAH A;  2RDJ A;  4HYK A;  3WKD A;  4YCX A;  1PVP A;  1NZB A;  5DDY A;  1ZYQ A;  3QYP A;  2E8O A;  2KTQ A;  2NYV A;  1SXD A;  4LZD A;  3V6J A;  4B9S A;  5AIC A;  2KV2 A;  5BOM A;  2DUY A;  4DWI A;  5D46 A;  2KP7 A;  3F5A A;  5AM2 A;  5ALJ A;  2EAM A;  4RQ6 A;  8ICM A;  2YN4 A;  1RYU A;  5BOL A;  4DSI A;  3PW4 A;  3T5K A;  2G09 A;  4I2C A;  4M04 A;  5HNK A;  2K4P A;  2HI0 A;  4IQV A;  4KLL A;  8ICS A;  4UQG A;  4O5E A;  9ICE A;  4ECQ A;  2W9A A;  4BJQ A;  2PI4 A;  4PPX A;  2K8A A;  2E5S A;  3A0H U;  5J8Y C;  1PK3 A;  3WK6 A;  3EW9 A;  3IM1 A;  1JUD A;  3MC1 A;  1N56 A;  2FE9 A;  5KFA A;  1OUQ A;  4IRD A;  2JEI A;  3LK9 A;  3SAF A;  2XGQ A;  4YXJ A;  2GOL A;  5CR0 A;  7ICL A;  2MU2 A;  5KFD A;  1XNS A;  3ZDE A;  4IR9 A;  4CNQ A;  4IRK A;  4EX7 A;  1JRP A;  5F9L A;  2ISP A;  9ICW A;  3EPI A;  5KG1 A;  2BCQ A;  7ICR A;  1KFS A;  2FI1 A;  2JMG A;  5AKY A;  7ICO A;  4MFA A;  2R8I A;  4GC7 A;  1X2I A;  8ICV A;  5KFZ A;  3L4P A;  4DCC A;  2BHN A;  2IOF A;  3TFS A;  5KNI A;  1JN3 A;  8ICF A;  2IA6 A;  5J0O A;  3HX0 A;  4CDG A;  4JV1 A;  3TAP A;  1WCL A;  5AKJ A;  3TAC B;  4RQ0 A;  8ICJ A;  2ZIX A;  2Y0S F;  8ICZ A;  1Q46 A;  2XO7 A;  2ZIW A;  3EPG A;  9ICK A;  3HP6 A;  3E58 A;  2OEH A;  2HBM A;  4Y2X A;  3TKA A;  2C28 A;  1SKR A;  9ICA A;  3TAR A;  1T8E A;  3B0Y A;  5CP2 A;  1ZD2 P;  4ED7 A;  4YP3 A;  5EE0 A;  2Q4T A;  4IR1 A;  3TAN A;  1ZQV A;  3WK8 A;  1V38 A;  4DSL A;  1TK8 A;  1JX4 A;  5EE1 A;  3OTQ A;  3GIJ A;  2E8N A;  5L1J A;  3MGI A;  4F93 B;  4O0I A;  2BPF A;  2Z7J A;  1ZRN A;  4OJ6 A;  4QIW F;  4IRC A;  1YT3 A;  4QWE A;  3SV3 A;  3RJJ A;  1PK1 B;  4R8U A;  4RQ3 A;  4BWJ A;  2KKV A;  4OJ5 A;  4FS2 A;  8ICC A;  1RM6 C;  4F4Z A;  2KHV A;  1KSP A;  1N48 A;  5J0R A;  1UT8 A;  2KJ9 A;  4UAY A;  3KZI U;  4O9M A;  4P2H A;  1SV0 C;  1T3N A;  1CI4 A;  4PH5 A;  4DQQ A;  3NTU A;  2NRZ A;  2P6R A;  4KIT B;  4XQ8 A;  4IC9 A;  3V6K A;  4EBE A;  1MQ3 A;  8ICO A;  2KVC A;  5ALF A;  2IMW P;  4O3Q A;  4WJ3 B;  2H3I A;  5JRT A;  3RH5 A;  4F72 A;  1ZQL A;  1ZXI A;  5AKZ A;  9ICR A;  4ECU A;  2KN7 A;  4ED3 A;  1JAL A;  5L1L A;  3Q8K A;  1BNP A;  4AYB F;  4DO9 A;  4US8 A;  2XY5 A;  2FPK A;  3B9J A;  3C5F A;  9ICB A;  5J0Y A;  2H3Q A;  3NVW A;  1SL2 A;  4RUA A;  2G0A A;  2G07 A;  3AU6 A;  1SL0 A;  4J9N A;  1NJZ A;  1ZQI A;  2BPG A;  3GV8 B;  4KLS A;  2BQU A;  5AKK A;  1COK A;  1DK3 A;  4EEK A;  4F5O A;  4DSJ A;  4P0Q B;  4MFC A;  3BS7 A;  5J0T A;  4M9G A;  2MRL A;  2BQ3 A;  1S97 A;  4DFP A;  3RH6 A;  9ICL A;  3PZP A;  1X6I A;  1VJ5 A;  5DGB A;  4EEL A;  4Y2Q A;  3NVZ A;  4DFD A;  1ZJN A;  2ZTC A;  2FLL A;  4KLI A;  3RH4 A;  3H8J A;  4BX9 C;  1N63 A;  4NL9 C;  2AGO A;  2PMZ F;  3AQE A;  2VA3 A;  2HVI A;  1WWU A;  3VCB A;  3TFR A;  2D6F C;  2BQR A;  1HEK A;  5EOZ A;  2PXI A;  8ICY A;  1AQ6 A;  3HT3 A;  3RB4 A;  3RJG A;  5KG2 A;  2BZF A;  4KX5 A;  3T79 A;  3AL0 B;  1S5L U;  2E8M A;  4Z6D A;  3WU2 U;  4F5R A;  1JMS A;  4I2A A;  1Q8K A;  3K4G A;  2YMM A;  4QZA A;  4KLU A;  2E3T A;  3PMN A;  4B9T A;  3AM9 A;  1QQ6 A;  4QWA A;  1X9S A;  5AK3 A;  4M2Y A;  4CGZ A;  4F8R A;  1KQQ A;  4XA5 A;  1PVQ A;  2KEY A;  4B9U A;  4P4M A;  2UVU A;  4J9K A;  2W55 A;  4UBB A;  1NJY A;  1K5O A;  9ICI A;  8ICK A;  3VC8 A;  2ASJ A;  1S0V A;  2KHQ A;  1RXW A;  4FZN A;  3JPO A;  3N4M B;  1L3V A;  4ECV A;  1SXE A;  9ICJ A;  3H8M A;  4ZH4 A;  1QSS A;  2V4Q A;  5IIM A;  2QB1 A;  3C5G A;  5HR7 A;  2W04 A;  1L8O A;  1BPZ A;  4RNN A;  3D6J A;  1HJP A;  5TZV A;  4OJP A;  1KTQ A;  5KFK A;  4R63 A;  4J9P A;  3C2M A;  2P35 A;  5J0P A;  1L3U A;  1ZD3 A;  9ICT A;  1Z4O A;  3QX7 A;  2V4R A;  5KFH A;  2W9C B;  3TAQ A;  5AI8 A;  1VDV A;  4RQ2 A;  2QLT A;  5KFV A;  3RAQ A;  4ED2 A;  4O5K A;  2LM4 A;  2LYA A;  7ICV A;  2XCP A;  3UXP A;  5IIK A;  1O03 A;  2EAO A;  3JPR A;  3TAD A;  1S0O A;  4LZG A;  2DL0 A;  3PW2 A;  1X40 A;  1ZQJ A;  3OHA A;  2NRT A;  3GIM A;  1ZQH A;  1C20 A;  4IQT A;  4C8K A;  3BZK A;  5J2G A;  4J03 A;  2FLN A;  4MHV A;  3HW8 A;  4KLT A;  5AKI A;  3M7D A;  4RZR A;  2NRW A;  4YD2 A;  4Z6F A;  4YVZ A;  2ASD A;  4ECY A;  1TV9 A;  1X9W A;  4KLG A;  3C28 A;  5JU5 A;  4US9 A;  4R66 A;  2IHM A;  5ALV A;  4BWM A;  9ICP A;  4IL6 U;  1TK0 A;  2W7P A;  3LWL A;  1T4G A;  2ASL A;  5KAI U;  4EEN A;  4QZ8 A;  5KFW A;  3V7J A;  1ZQP A;  5J2D A;  2W03 A;  4DL3 A;  2PFO A;  1QH9 A;  1UPH A;  4GFJ A;  2DKZ A;  5J0W A;  5AM1 A;  2LI6 A;  1N5W A;  3UMC A;  2WF9 A;  3NUQ A;  2F44 A;  3UXO A;  2UVW A;  2WAQ C;  4ICA A;  1ZQR A;  2Y9U A;  3BDP A;  5ALY A;  4C8L A;  4ECT A;  4NLC A;  1TAQ A;  1ZQD A;  4EZ9 A;  4QZD A;  2JXJ A;  5HML A;  3V72 A;  1Z1V A;  4B9M A;  2A1J B;  4RQ1 A;  2BKE A;  2M0N A;  4F2S A;  2LYH A;  4M47 A;  3IDW A;  1VLB A;  2XY6 A;  4ECR A;  1L7N A;  2C2E A;  5IIN A;  3Q8P B;  1WG8 A;  2C2D A;  3MAB A;  3UMB A;  2XID A;  4RPX A;  4J9L A;  2K4I A;  2G08 A;  4ECZ A;  3UM9 A;  4CE6 A;  3BQT A;  2FMP A;  1NI3 A;  2MSN A;  5KFR A;  3ORY A;  1NJW A;  2Y1I A;  3IV6 A;  4JV2 A;  1TVA A;  1SL1 A;  3WKB A;  1N62 A;  2ISO A;  3JPQ A;  1ZD4 A;  1F0M A;  5ALT A;  3KHR A;  4YFK A;  3ICX A;  5C0Y A;  3T3F A;  1QQ7 A;  2JH7 A;  1QQ5 A;  5KG3 A;  3OHB A;  5DQI A;  2W9B A;  2F77 X;  9ICU A;  2BCS A;  2DBY A;  4NLB A;  5DG7 A;  1DGJ A;  5DBA A;  3LWM A;  8ICI A;  2KVS A;  4K4H A;  2RLT A;  4M9N A;  2K4H A;  2WB1 C;  2VJ5 A;  4BXO B;  3NRZ A;  1X9M A;  3SMV A;  2AGP A;  1NOM A;  1COO A;  4KLJ A;  1ZQE A;  1X66 A;  2E1E A;  4UB6 U;  5J29 A;  1ZQT A;  2IOH A;  8ICW A;  2K89 A;  2LYB A;  1Z00 B;  4F91 B;  2MA1 A;  4KLH A;  1MN8 A;  7ICI A;  4DLE A;  8ICH A;  5AKX A;  5JUM A;  1NK4 A;  1ZQA A;  1ZET A;  3PST A;  1N60 A;  4C8O A;  2RDI A;  1H38 A;  8ICR A;  5AI0 A;  1NK0 A;  4J9Q A;  2AGQ A;  2ZG6 A;  1B0X A;  5E79 U;  2E1F A;  4RNO A;  3SEI A;  5AM5 A;  2F1J A;  5AKE A;  4KMO B;  4UAS A;  1ECW A;  4RNM A;  2ZJ5 A;  2HVH A;  4C4T A;  4JWN A;  4EEY A;  2KZ3 A;  4KLQ A;  2QB0 A;  3N7S C;  3IN5 A;  3OSP A;  2MUT A;  2J6U A;  5KT2 A;  1S8O A;  8ICX A;  3WK7 A;  3NAS A;  3KTQ A;  1L7O A;  1SKW A;  2KIV A;  1ZD5 A;  3ALR A;  1HIW A;  4XRH A;  4RPY A;  4B9V A;  5ALL A;  4DOB A;  4J9S A;  3C29 A;  2BDU A;  4DOA A;  3QNM A;  4UBC A;  4F4X A;  1NK9 A;  4Z6E A;  4QWC A;  2WTF A;  2DQN B;  2KE7 A;  2EAP A;  2OCE A;  2LMR A;  1ARO P;  2HHQ A;  3QEB Z;  5B66 U;  2FPM A;  3GIL A;  2ZIU B;  4P4O A;  1ZQK A;  1ED1 A;  3K1R B;  3D2S A;  7ICF A;  5DB6 A;  4DQS A;  4Y2T A;  1TE2 A;  2B6G A;  2GH1 A;  4IS7 A;  1KW4 A;  4PHA A;  3RJI A;  2P66 A;  3Q8Q B;  2R8H A;  3AUO A;  4QZG A;  2Y9T A;  2WF7 A;  4I29 A;  2DKX A;  3ZDB A;  5EWE A;  2B0C A;  4OJL A;  3RRH A;  1C7Y A;  3OPX A;  1KDH A;  2FLP A;  3MGH A;  4YQW A;  4I2F A;  4I2I A;  3LYS A;  2EQY A;  2JEG A;  3H0R B;  5C5J A;  3CRX A;  1CRX A;  1RQN A;  3MR6 A;  2OYY A;  3NS1 A;  5KFI A;  5KFU A;  3M6K A;  4GXI A;  4F4W A;  5J0U A;  3PO4 A;  2QAR B;  3DDH A;  4B9L A;  3SYZ A;  4YD1 A;  1X9X A;  3K75 D;  4PHD A;  5KFS A;  5KL1 B;  2OHF A;  4J9O A;  4M9J A;  3RTV A;  2KIW A;  5DB8 A;  3N7P D;  1ZRM A;  2EZX A;  4Y2Y A;  2OXO A;  2R18 A;  3LVW A;  5ALU A;  2KSO B;  5DQH A;  1QCK A;  3KD3 A;  2HHS A;  4DS4 A;  3THV A;  5AM4 A;  2FMQ A;  5AK4 A;  4F92 B;  5J0Q A;  4DL5 A;  5KFB A;  3O0F A;  1Q3V A;  3ZD9 A;  2YTU A;  1ZQB A;  4NLZ A;  2F8L A;  4TQR A;  4OD0 A;  3D2N A;  3GII A;  5J2H A;  3JPS A;  1UHU A;  8ICE A;  3UXN A;  2ZXH A;  3KKA C;  4RQM A;  1D8L A;  3N28 A;  1V9P A;  4NV0 A;  3F5E A;  2ZIU A;  1LVH A;  4I2B A;  4RQN A;  2AH5 A;  3M9N B;  9ICO A;  5KFE A;  3PSI A;  3QU2 A;  3S6J A;  4F5Q A;  3PVX A;  3Q8M A;  3BS5 B;  2Y1J A;  4QZC A;  1L3T A;  5AI9 A;  4C4S A;  2VJ4 A;  1XS9 D;  1N5X A;  4AP9 A;  1Y88 A;  2FJ6 A;  1NK7 A;  2F8K A;  1PUZ A;  4NY8 A;  2F2A B;  3QZ8 A;  2AJQ A;  3RBD A;  2PFP A;  2V9W A;  2HHT A;  4QW9 A;  2VA8 A;  4OO1 J;  5HR6 A;  5AK5 A;  4I2D A;  2EDU A;  4J9R A;  1FO4 A;  4QZI A;  5DKW A;  2PI5 A;  2HHW A;  1T3Q A;  4KTQ A;  4KX3 A;  4ED0 A;  5J2I A;  3PML A;  3LDA A;  5III A;  3QXG A;  4PGX A;  3SR6 A;  1KN5 A;  1KL9 A;  2ZIV B;  5AI4 A;  5ALE A;  1Z1B A;  1PK1 A;  4TUP A;  4YMO A;  3C23 A;  2O6K A;  3L3F X;  1KRP A;  4M6W B;  4JB3 A;  4ZOH C;  2A3V A;  3QU7 A;  5ALG A;  4UAW A;  1HUO A;  4JV0 A;  3HPO A;  4DQP A;  5HMM A;  5DLG A;  3RR8 A;  1IM4 A;  2F1I A;  2DGZ A;  5FP0 A;  7ICQ A;  3SV4 A;  2BPC A;  3SQI A;  1DK2 A;  5KFP A;  3F2D A;  2HHV A;  5KFO A;  1M6Y A;  4DEZ A;  1D9F A;  3UMG A;  1LKY B;  3WK5 A;  1Q3U A;  4JMU A;  4QZ9 A;  1RZT A;  5KT4 A;  3M8R A;  1NK6 A;  3N97 B;  4LJX A;  4Y2S A;  5KT5 A;  2W8L A;  4KN7 A;  3M1Y A;  2JRZ A;  8ICG A;  3ONN A;  3QU9 A;  4ECX A;  1J2N A;  1ZQW A;  1PVR A;  4DOC A;  5CRX A;  5HHH A;  5ALQ A;  4DFJ A;  4P0P B;  1J2M A;  1LV5 A;  1EXN A;  2FDR A;  2CPR A;  4GLX A;  5J2J A;  1NK8 A;  4ELV A;  3AMZ A;  3KOO A;  3JPN A;  4DF8 A;  1URJ A;  3GV5 B;  3QUQ A;  2J6T A;  1K1S A;  3JPT A;  3CYM A;  4EBD A;  1U4B A;  5KFC A;  2YX8 A;  3V7L A;  4ELU A;  7ICE A;  2R8J A;  3H8S A;  1NKC A;  7ICT A;  5ALR A;  3SZ2 A;  4GXJ A;  4P0Q A;  3M8S A;  5KFT A;  4Q44 A;  4EYI B;  2W3S A;  7ICM A;  3E2E A;  3KFU F;  3AU2 A;  3MFH A;  4FZL A;  2CN1 A;  1ZQG A;  4DSK A;  2VIX A;  2KZM A;  2JZB B;  3KBB A;  2R8K A;  4QW8 A;  3HKZ C;  3GZF A;  1KKX A;  4K4I A;  2JHD A;  4HAI A;  5CEH A;  2DPI A;  2JH1 A;  5KFX A;  2WAQ F;  2P6U A;  3R9K A;  1FEZ A;  4Y2J A;  8ICL A;  4M0A A;  2ATL A;  4YMM A;  8ICT A;  1DXS A;  5KFL A;  1DRG A;  3V6H A;  1IG6 A;  4QWB A;  4M9L A;  3IG5 A;  1NNL A;  3QE9 Y;  1ZQF A;  3KHG A;  1WUD A;  2K60 A;  3ZDA A;  4QWD A;  5BPC A;  3RAX A;  2YQE A;  5L9X A;  1Z4N A;  1D8Y A;  2IOF K;  4P4P A;  3K1Z A;  1S77 D;  4NL9 A;  2WHE A;  9ICS A;  1BPX A;  5JTI A;  5DBB A;  1QTM A;  1PZN A;  2DFL A;  1XWL A;  3EYZ A;  4B6J A;  4RU9 A;  4PZO A;  1RYR A;  3I1Y A;  4FS1 A;  3PX6 A;  4UB8 U;  4Y2P A;  1QSY A;  2M9N A;  3G6X A;  4BUG A;  4NM2 A;  3H4B A;  3C2L A;  2G06 A;  4DLG A;  2KKP A;  2KK0 A;  3H40 A;  2ZTD A;  4O3P A;  4ECW A;  3ZDC A;  3RJH A;  5HHI A;  2WF6 A;  1SKS A;  1ZQQ A;  3PSF A;  2BCR A;  5KG6 A;  2BR0 A;  4Y2U A;  1JRO A;  1F44 A;  2DPJ A;  4F3O A;  4O3R A;  8ICA A;  4DL7 A;  1BPB A;  3MR2 A;  3PR5 B;  3GQC A;  1FFV A;  2XY7 A;  2WB1 F;  4PL1 A;  1JIH A;  3H8W A;  2LBO A;  5AM3 A;  3PW7 A;  5CWR A;  3HJE A;  4TUQ A;  1OXJ A;  2XI9 A;  2JR5 A;  1L3S A;  4O3M A;  2G5I B;  4DFK A;  4KLD A;  5ALO A;  3PO5 A;  3RB6 A;  8ICN A;  2K4E A;  1A6S A;  2HBK A;  2NRX A;  2W9C A;  3CW2 C;  2HOF A;  4RQ4 A;  1XC9 A;  5AM0 A;  5EWF A;  1KFD A;  2L5Y A;  3BQ0 A;  4KLO A;  3GU3 A;  4OJO A;  1ZQC A;  2I5H A;  5KFG A;  1D8B A;  4ACO A;  4KLF A;  4Q8F A;  5KFM A;  3OGU A;  3BZC A;  3T5H A;  3PX0 A;  4O5C A;  2RHF A;  3QUT A;  2HOI A;  4NJ8 A;  2I6X A;  4DS5 A;  4CRX A;  3PSP A;  3F53 A;  3QZ7 A;  4KLM A;  1ZQS A;  2ZTE A;  4JK1 A;  2UVV A;  3NVY A;  4G3I A;  1MSW D;  5J2K A;  4GXK A;  1BNO A;  1FIQ A;  1IV8 A;  4Z6C A;  4RQ5 A;  3RB0 A;  2HBL A;  3C1Y A;  2ES6 A;  1ZQO A;  2HDO A;  5AIB A;  1JXL A;  5KTQ A;  2H5X A;  2WFA A;  3ISB A;  4J9M A;  5F3X B;  1SB3 C;  1SWW A;  2JEF A;  3FYH A;  1SGG A;  3BJY A;  3Q8S B;  9ICG A;  4DSF A;  3U26 A;  2JEJ A;  5KG7 A;  5KG4 A;  4MF8 A;  2VA2 A;  3ZI4 A;  2BGW A;  3N7R C;  2ZIX B;  3WKA A;  1A0P A;  3AQF A;  1ZQU A;  2ZIW B;  5KL8 B;  5DG9 A;  3T5J A;  7ICS A;  1A76 A;  4RT2 A;  2OWO A;  4NXZ A;  2W43 A;  5DBC A;  2E8P A;  4EZ6 A;  2VAN A;  4C7Y A;  2A1J A;  2OM6 A;  1YZ7 A;  1BVS A;  3C1Z A;  4G9B A;  3D2Q A;  1RXV A;  1TAM A;  5ALZ A;  4GIB A;  5CB1 A;  5KT3 A;  4PJ0 U;  2YML A;  3EWA A;  3NRW A;  2WF5 A;  3FM9 A;  2RRD A;  1CUK A;  2FMS A;  4QNL A;  5AKL A;  2KJ5 A;  1TAU A;  4JWM A;  3PV8 A;  5J0X A;  1UT5 A;  2XGP A;  4R8U B;  1SZH A;  1Z19 A;  9ICF A;  4A8E A;  2KD1 A;  3CP8 A;  4Y2V A;  4Q43 A;  2ZJ8 A;  7ICJ A;  1DGS A;  3KZX A;  2YY6 A;  1B4F A;  2Q0Z X;  1L8L A;  3FAH A;  2IBK A;  4PZN A;  3M9M B;  2W3R A;  1L6N A;  2J6S A;  4I2E A;  4DL4 A;  4NM1 A;  4CF4 A;  5KG5 A;  1F5S A;  4UB3 A;  1SZP A;  1Z3E B;  2H3F A;  1HUZ A;  3SI8 A;  2G5H B;  5G5G A;  3C21 A;  2LPE A;  3HRD D;  3RJK A;  7ICK A;  7ICU A;  5AKH A;  1RPL A;  4BXO A;  1WWV A;  4FFD A;  2EZZ A;  4DSE A;  3E0F A;  3IRU A;  4NLK A;  3FDS A;  3PW0 A;  1XO0 A;  8ICB A;  1T94 A;  5AI5 A;  1BPE A;  2I9G A;  5ALH A;  3V7K A;  2YB1 A;  3H4D A;  1Z00 A;  3OJS A;  3F2C A;  2AU0 A;  1S76 D;  3QEA Z;  3M6Z A;  5J0S A;  2HOQ A;  3J81 j;  9ICC A;  2R8G A;  1MC8 A;  1RG6 A;  4PHP A;  1NJX A;  4FBU A;  4ECS A;  3RJF A;  3PW5 A;  5G5H A;  2PFQ A;  5CA7 A;  1XO1 A;  1N61 A;  5KG0 A;  4NLN A;  3WKC A;  1S9F A;  4EBC A;  4Q45 A;  5D4B A;  2K8B B;  2W8K A;  1S0N A;  1B22 A;  4F4Y A;  5J2C A;  3HIL A;  3NGD A;  1NKB A;  2AHO B;  3MFI A;  2HSZ A;  1KEJ A;  4F71 A;  4K4G A;  4I2G A;  1NK5 A;  4UB4 A;  5AHX A;  4O3O A;  3SEN A;  1UQV A;  5A0L A;  5GTH U;  1ZQX A;  4BGD A;  3EUB 2;  1BPY A;  1LB2 B;  3UPQ A;  2KG5 A;  2HCF A;  2EZY A;  1BGX T;  9ICN A;  4YN4 A;  2PKE A;  3I28 A;  3QU4 A;  4C7Z A;  1GO3 F;  1KFT A;  2AQ0 A;  2KFN A;  2NO5 A;  3MDA A;  5J8Y A;  4Y2R A;  4E0D A;  1QSL A;  1UA1 A;  5ALM A;  1X6J A;  1P7D A;  5F9N A;  4QZF A;  2ESE A;  5KFF A;  2EH9 A;  4ED1 A;  2D3D A;  2Y0S C;  5KT7 A;  8ICU A;  2VKQ A;  1NKE A;  1KBU A;  3C2K A;  2EAN A;  4I2J A;  4RUC A;  2XIC A;  2HMX A;  2W9M A;  2A19 A;  1CEZ A;  3LVV A;  5DB9 A;  5KFN A;  5AKG A;  1JI7 A;  4USA A;  2AXT U;  3DEE A;  4YG2 A;  5K4L A;  3PY8 A;  4TUR A;  5AI6 A;  5ALN A;  3BQ7 A;  3EZ5 A;  4B9N A;  5EWG A;  2AQ4 A;  3ZD8 A;  4GC6 A;  4UAT A;  2GWS A; 
#chains in the Genus database with same CATH homology
 3ETL A;  4DL2 A;  2BHN A;  3TFS A;  1JN3 A;  2ISO A;  4M9H A;  8ICF A;  3JPQ A;  2IA6 A;  5J0O A;  3V6H A;  3HX0 A;  4QWB A;  4M9L A;  4JV1 A;  3TAP A;  1WCN A;  1WCL A;  3MR3 A;  3KHR A;  4YFK A;  3QE9 Y;  4RQ0 A;  3KHG A;  3H7I A;  1ZQF A;  2B21 A;  8ICJ A;  1A77 A;  4QZH A;  5DQG A;  8ICZ A;  3T3F A;  4QWD A;  5BPC A;  3RAX A;  3ZDA A;  9ICQ A;  3IHQ B;  2XO7 A;  3EPG A;  5L9X A;  3Q8L A;  9ICK A;  3HP6 A;  5KG3 A;  3OHB A;  5DQI A;  2W9B A;  4MFF A;  9ICU A;  1D8Y A;  4P4P A;  2BCS A;  1S77 D;  5IIJ A;  5DG7 A;  2C28 A;  1SKR A;  4O3N A;  9ICA A;  5DBA A;  3TAR A;  1T8E A;  3LWM A;  8ICI A;  1UA0 A;  3B0Y A;  9ICS A;  3KHH A;  4R65 A;  3GDX A;  4K4H A;  1BPX A;  5CP2 A;  5DBB A;  4EYH B;  2ZUD A;  1QTM A;  4ED7 A;  1PZN A;  4M9N A;  2DFL A;  1XWL A;  4YP3 A;  2UVR A;  1U48 A;  3EYZ A;  4IR1 A;  3TAN A;  4BXO B;  4RU9 A;  1ZQV A;  4UB1 A;  2HHU A;  4DSL A;  1X9M A;  1TK8 A;  2AGP A;  1RYR A;  1NOM A;  1COO A;  2XCA A;  4FS1 A;  3PX6 A;  1JX4 A;  4UB2 A;  4KLJ A;  1ZQE A;  3GIJ A;  5J29 A;  5L1J A;  3MGI A;  4F93 B;  1QSY A;  1ZQT A;  2M9N A;  4O0I A;  3G6X A;  2BPF A;  5KFQ A;  4F50 A;  4NM2 A;  8ICW A;  3UQ0 A;  9ICH A;  3H4B A;  3C2L A;  2FPL A;  1Z00 B;  4F91 B;  4DLG A;  4IRC A;  2IHN A;  4TQS A;  4KLH A;  4QWE A;  3SV3 A;  4DLE A;  3RJJ A;  1JXE A;  7ICI A;  3H40 A;  8ICH A;  4R8U A;  4I2H A;  4RQ3 A;  5JUM A;  2ZTD A;  4O3S A;  1NK4 A;  4BWJ A;  2MAX A;  1ZET A;  1ZQA A;  4O3P A;  4ECW A;  3ZDC A;  4FS2 A;  5HHI A;  4F4Z A;  3RJH A;  8ICC A;  1SKS A;  4C8O A;  7ICH A;  1KSP A;  5KT6 A;  1L5U A;  1ZQQ A;  1N48 A;  2RDI A;  5J0R A;  2BCR A;  5KG6 A;  1UT8 A;  3JPP A;  2BR0 A;  1H38 A;  7ICT A;  8ICR A;  4UAY A;  4O9M A;  4KLE A;  4MEY A;  4P2H A;  4F5P A;  4DL6 A;  7ICN A;  1T3N A;  2DPJ A;  1NK0 A;  4F3O A;  4J9Q A;  2AGQ A;  4CCH A;  4O3R A;  8ICA A;  4DL7 A;  1BPB A;  4PH5 A;  4UB5 A;  4DQQ A;  3NTU A;  3MR2 A;  2NRZ A;  1ZQZ A;  3PR5 B;  3GQC A;  4RNO A;  2P6R A;  4KIT B;  4XQ8 A;  2XY7 A;  2F1J A;  3V6K A;  4EBE A;  1MQ3 A;  4I27 A;  8ICO A;  2IMW P;  4O3Q A;  1JIH A;  2ZJ5 A;  4RT3 A;  4RNM A;  2HVH A;  3H8W A;  5IIL A;  1S0M A;  3PNC A;  3PW7 A;  4JWN A;  4IQW A;  5CWR A;  4EEY A;  1XSP A;  2KZ3 A;  4TUQ A;  4KLQ A;  3RH5 A;  1ZQL A;  1L3S A;  4DFK A;  9ICR A;  4ECU A;  4KLD A;  3PO5 A;  2KN7 A;  3RB6 A;  8ICN A;  4ED3 A;  3OSP A;  4YMN A;  5L1L A;  3Q8K A;  1RYS A;  2MUT A;  2C2R A;  3B0X A;  2J6U A;  4XUS A;  2NRX A;  5KT2 A;  3G6Y A;  8ICX A;  2W9C A;  4DO9 A;  3KTQ A;  2XY5 A;  1SKW A;  2FPK A;  2I1Q A;  4RQ4 A;  4LVS A;  1XC9 A;  3C5F A;  4RQ8 A;  5DG8 A;  4XRH A;  4RPY A;  5EWF A;  4B9V A;  9ICB A;  1KFD A;  3TI0 A;  5J0Y A;  3BQ0 A;  1SL2 A;  4KLO A;  4RUA A;  8ICP A;  4DOB A;  4J9S A;  3AU6 A;  1SL0 A;  1ZQC A;  4DF4 A;  4DOA A;  3Q8R B;  4J9N A;  5KFG A;  4UBC A;  4C8N A;  4F4X A;  1NJZ A;  1NK9 A;  1ZQI A;  4Z6E A;  3RR7 A;  4QWC A;  4KLF A;  4Q8F A;  5KFM A;  3GV8 B;  2BPG A;  4KLS A;  3OGU A;  3T5H A;  3PX0 A;  2BQU A;  2WTF A;  4O5C A;  1S10 A;  4F5O A;  1ARO P;  5CJ7 A;  4M6W A;  2HHQ A;  5DB7 A;  4DS5 A;  3QEB Z;  4DSJ A;  4DQI A;  4KN4 A;  2FPM A;  3GIL A;  4MFC A;  3BQ2 A;  3QZ7 A;  4P4O A;  5J0T A;  1ZQK A;  4M9G A;  4YR0 A;  1ZQS A;  4KLM A;  2BQ3 A;  4UAZ A;  3UQ2 A;  5DB6 A;  4DFP A;  2ZTE A;  4DQS A;  1S97 A;  7ICF A;  1IXR A;  3RH6 A;  4JK1 A;  9ICL A;  3PR4 A;  2UVV A;  3RRG A;  1XSL A;  5DGB A;  4PHA A;  1ZJM A;  3RJI A;  4G3I A;  2P66 A;  3Q8Q B;  2R8H A;  3AUO A;  1ZQN A;  1MSW D;  9ICV A;  4QZG A;  2ZUC A;  5J2K A;  4GXK A;  1ZJN A;  4YR2 A;  4Z6C A;  4YR3 A;  2ZTC A;  4I29 A;  2FLL A;  4RQ5 A;  4KLI A;  3RH4 A;  3RB0 A;  3H8J A;  3ZDB A;  5EWE A;  3C1Y A;  1ZQO A;  2AGO A;  4RQ7 A;  4RPZ A;  1JXL A;  5KTQ A;  1TK5 A;  4ELT A;  2ZUB A;  2VA3 A;  2H5X A;  3ISB A;  1KLN A;  2BDP A;  4Q8E A;  4J9M A;  2HVI A;  3RRH A;  3T5L A;  1C7Y A;  2FLP A;  1KDH A;  2JEF A;  3FYH A;  3TFR A;  3MGH A;  4YQW A;  3BJY A;  3Q8S B;  9ICG A;  4I2F A;  2BQR A;  4I2I A;  4DQR A;  5EOZ A;  2PXI A;  8ICY A;  4DSF A;  2JEG A;  5C5J A;  2HW3 A;  3MR6 A;  2KFZ A;  3HT3 A;  3RB4 A;  2JEJ A;  1TFR A;  5KFY A;  5KG7 A;  5KG4 A;  4MF8 A;  3RJG A;  5KFI A;  5KFU A;  5KG2 A;  4R64 A;  4ED6 A;  3MBY A;  4GXI A;  4X5V A;  2BCU A;  2VA2 A;  1QLN A;  4F4W A;  4I28 A;  4F2R A;  5J0U A;  3PO4 A;  7ICG A;  5IIO A;  2BGW A;  4NLG A;  4F4K A;  4B9L A;  3SYZ A;  4YD1 A;  1U45 A;  4Z6D A;  1U47 A;  1ZQU A;  7ICS A;  5DG9 A;  3T5J A;  3K75 D;  4PHD A;  4F5R A;  5KFS A;  3BQ1 A;  1A76 A;  1BPD A;  1JMS A;  4RT2 A;  2W9B B;  4I2A A;  4J9O A;  4M9J A;  4PGY A;  3RTV A;  2OWO A;  1XSN A;  4ED8 A;  4NXZ A;  5DB8 A;  3HWT A;  1B43 A;  5DBC A;  1U9L A;  3K4G A;  4EZ6 A;  9ICX A;  4KMU A;  2VAN A;  4QZA A;  2NRV A;  4KLU A;  2A1J A;  5L1K A;  1BVS A;  3PMN A;  3C1Z A;  4B9T A;  5J2A A;  1RXV A;  4QWA A;  5CHG A;  5DQH A;  1X9S A;  4M2Y A;  5CB1 A;  5KT3 A;  4BDP A;  3EWA A;  4F8R A;  2HHS A;  4XA5 A;  3MDC A;  3GV7 B;  4DS4 A;  3THV A;  2C22 A;  4PHE A;  2FMQ A;  4B9U A;  4P4M A;  2UVU A;  4J9K A;  4F92 B;  5J0Q A;  3RJE A;  1CUK A;  4UBB A;  4DL5 A;  5KFB A;  1NJY A;  2FMS A;  2JZB A;  9ICI A;  8ICK A;  3ZD9 A;  1TAU A;  9ICM A;  2ASJ A;  5J2E A;  5L1I A;  4MEX A;  1ZQB A;  4JWM A;  1S0V A;  5DLF A;  4NLZ A;  3G6V A;  4TQR A;  2BCV A;  2PFN A;  3PV8 A;  5J0X A;  2ZJA A;  4DFM A;  1RXW A;  1UT5 A;  3JPO A;  2XGP A;  3N4M B;  4R8U B;  1SL1 A;  3GII A;  1T7P A;  5J2H A;  9ICF A;  3MR5 A;  1L3V A;  3JPS A;  8ICE A;  3UXN A;  2ZJ8 A;  4Q43 A;  4FO6 A;  7ICJ A;  4ECV A;  2ALZ A;  1DGS A;  9ICJ A;  1U49 A;  1D8L A;  4ZH4 A;  3M9O B;  2V4Q A;  1QSS A;  4C8M A;  5IIM A;  1V9P A;  2Q0Z X;  3KHL A;  3C5G A;  2IBK A;  8ICQ A;  3ISD A;  3M9M B;  1DOQ A;  4I2B A;  2J6S A;  5DDM A;  3M9N B;  3ISC A;  1TKD A;  4I2E A;  4MF2 A;  4DL4 A;  4QZE A;  3GIK A;  9ICO A;  4NM1 A;  5KFE A;  1BPZ A;  5KG5 A;  4RNN A;  4UB3 A;  1HJP A;  4YXM A;  5TZV A;  4F5Q A;  3PVX A;  5D49 A;  3Q8M A;  1ZQY A;  2Y1J A;  4QZC A;  1L3T A;  5J2B A;  1KTQ A;  1ZQM A;  2XC9 A;  5DGA A;  1XS9 D;  5KFK A;  1SZP A;  1Z3E B;  1K1Q A;  4R63 A;  1Y88 A;  1HUZ A;  4J9P A;  3C2M A;  3SI8 A;  1NK7 A;  4JUZ A;  3RBE A;  5J0P A;  1L3U A;  4NY8 A;  9ICT A;  2KZZ A;  3QZ8 A;  1MQ2 A;  3C21 A;  2AJQ A;  2MUT B;  3RBD A;  2V4R A;  2PFP A;  3GFK B;  5KFH A;  2V9W A;  2HHX A;  2HHT A;  4QW9 A;  2VA8 A;  3RJK A;  7ICK A;  2W9C B;  7ICU A;  3TAQ A;  7ICP A;  1RPL A;  5J2F A;  4I2D A;  4RQ2 A;  4J9R A;  5KFV A;  4BXO A;  4QZI A;  4PGQ A;  5DKW A;  3RAQ A;  4QZB A;  4ED2 A;  3OJU A;  4DSE A;  2PI5 A;  4O5K A;  2HHW A;  2F1H A;  3PX4 A;  4KTQ A;  4NLK A;  4IQU A;  3FDS A;  1D9D A;  3PW0 A;  4TUS A;  4ED0 A;  3RB3 A;  5J2I A;  3PML A;  4FBT A;  7ICV A;  4F5N A;  8ICB A;  1XU4 A;  3LDA A;  5III A;  1BPE A;  3OSN A;  5IIK A;  4PGX A;  2XCP A;  3UXP A;  2I9G A;  3ZDD A;  3V7K A;  3H4D A;  5KFJ A;  1Z00 A;  3OJS A;  2AU0 A;  3TQ1 A;  1S76 D;  3JPR A;  3QEA Z;  5J0S A;  4TUP A;  1S0O A;  4YMO A;  3C23 A;  4LZG A;  5HP4 A;  1KRP A;  9ICC A;  4M6W B;  2R8G A;  3PW2 A;  2RDJ A;  1ZQJ A;  4HYK A;  3OHA A;  1MC8 A;  4YCX A;  2NRT A;  3GIM A;  1ZQH A;  4IQT A;  4C8K A;  4PHP A;  4UAW A;  1NJX A;  1HUO A;  4FBU A;  5J2G A;  4ECS A;  3RJF A;  5DDY A;  4JV0 A;  3HPO A;  3PW5 A;  1ZYQ A;  2FLN A;  2PFQ A;  5CA7 A;  1XO1 A;  4DQP A;  5HMM A;  5DLG A;  3RR8 A;  1IM4 A;  5KG0 A;  3HW8 A;  4KLT A;  4NLN A;  2KTQ A;  2F1I A;  4RZR A;  2NRW A;  4YD2 A;  4Z6F A;  1S9F A;  4YVZ A;  4EBC A;  4Q45 A;  4LZD A;  3V6J A;  2ASD A;  3SV4 A;  4ECY A;  5D4B A;  1TV9 A;  1X9W A;  2BPC A;  7ICQ A;  4B9S A;  4KLG A;  2W8K A;  1S0N A;  1B22 A;  4R66 A;  5KFP A;  4F4Y A;  5J2C A;  2IHM A;  2HHV A;  5BOM A;  5KFO A;  4BWM A;  3NGD A;  4DEZ A;  1D9F A;  4DWI A;  1NKB A;  9ICP A;  1TK0 A;  5D46 A;  3MFI A;  4QZ9 A;  1KEJ A;  4RQ6 A;  1RZT A;  8ICM A;  5KT4 A;  4K4G A;  3M8R A;  3LWL A;  1NK5 A;  1NK6 A;  4I2G A;  4UB4 A;  3N97 B;  1T4G A;  2ASL A;  5BOL A;  4DSI A;  3PW4 A;  4O3O A;  4QZ8 A;  3T5K A;  5KT5 A;  2W8L A;  4KN7 A;  8ICG A;  4ECX A;  1ZQX A;  1ZQW A;  4I2C A;  5KFW A;  3V7J A;  4DOC A;  5J2D A;  4BGD A;  1ZQP A;  4M04 A;  5HNK A;  5HHH A;  4DFJ A;  1BPY A;  1LB2 B;  4DL3 A;  4IQV A;  1LV5 A;  2PFO A;  1EXN A;  3UPQ A;  4KLL A;  4GLX A;  5J0W A;  1BGX T;  5J2J A;  8ICS A;  1NK8 A;  9ICN A;  4ELV A;  4UQG A;  4O5E A;  9ICE A;  4YN4 A;  3JPN A;  4ECQ A;  2W9A A;  4DF8 A;  3UXO A;  1KFT A;  3GV5 B;  2AQ0 A;  2UVW A;  2PI4 A;  2KFN A;  2J6T A;  4PPX A;  1K1S A;  3JPT A;  1ZQR A;  3MDA A;  4EBD A;  3BDP A;  1U4B A;  5KFC A;  4C8L A;  3EW9 A;  3V7L A;  4ECT A;  4ELU A;  3IM1 A;  4E0D A;  1TAQ A;  2R8J A;  3H8S A;  1NKC A;  7ICE A;  1N56 A;  1ZQD A;  4EZ9 A;  3SZ2 A;  4QZD A;  1QSL A;  4GXJ A;  5HML A;  3V72 A;  1UA1 A;  5KFA A;  3M8S A;  4B9M A;  2A1J B;  4RQ1 A;  5KFT A;  4Q44 A;  2BKE A;  5F9N A;  4EYI B;  4IRD A;  4QZF A;  2JEI A;  7ICM A;  5KFF A;  2LYH A;  4F2S A;  3E2E A;  4ED1 A;  4M47 A;  3LK9 A;  2XY6 A;  4ECR A;  5KT7 A;  3AU2 A;  3MFH A;  2XGQ A;  2C2E A;  8ICU A;  1NKE A;  4YXJ A;  5IIN A;  3C2K A;  1ZQG A;  3Q8P B;  2C2D A;  4DSK A;  3MAB A;  4I2J A;  4RUC A;  5CR0 A;  2KZM A;  7ICL A;  2JZB B;  5KFD A;  2W9M A;  3ZDE A;  4QW8 A;  4RPX A;  4J9L A;  2R8K A;  4IR9 A;  4IRK A;  5F9L A;  1CEZ A;  4ECZ A;  2ISP A;  9ICW A;  5DB9 A;  3EPI A;  3BQT A;  5KG1 A;  2BCQ A;  5KFN A;  2FMP A;  4K4I A;  7ICR A;  2DPI A;  5KFR A;  1KFS A;  4YG2 A;  3PY8 A;  3ORY A;  5KFX A;  4TUR A;  2P6U A;  1NJW A;  3EZ5 A;  7ICO A;  4MFA A;  2R8I A;  4GC7 A;  2ATL A;  1X2I A;  2Y1I A;  4YMM A;  4M0A A;  8ICV A;  8ICL A;  4B9N A;  5KFZ A;  5EWG A;  2AQ4 A;  3ZD8 A;  4GC6 A;  4JV2 A;  8ICT A;  2GWS A;  5KFL A;  1TVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...