1WCNA

Nmr structure of the carboxyterminal domains of escherichia coli nusa
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The E. Coli Nusa Carboxy-Terminal Domains are Structurally Similar and Show Specific Rnap- and Lambdan Interactions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
molecule keywords TRANSCRIPTION ELONGATION PROTEIN NUSA
total genus 19
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1wcnA01
4R64A 3MABA 5KG1A 1RYRA 8ICFA 5KG2A 4F8RA 3MR6A 1KEJA 4QWEA 4F50A 4JWMA 2IMWP 1ZQKA 4DQQA 3N4MB 4B9MA 1X9MA 5DLGA 3MFIA 4GXIA 4PHPA 4RQ4A 1JXLA 2NRVA 3PX6A 3RJJA 2C2RA 2ISPA 4J9KA 9ICWA 4GXJA 7ICIA 2J6TA 5EWFA 4ED3A 1ZQLA 3UXOA 3RB4A 8ICUA 2ZTCA 3NTUA 4EBDA 4YMNA 1V9PA 1A77A 5CB1A 1L3UA 4F5RA 4Z6EA 1KLNA 4KLHA 8ICZA 1B22A 3H4BA 3IHQB 9ICAA 4RPZA 4F2RA 4TUPA 3C2LA 4XRHA 5CJ7A 5J0YA 4F4WA 4B9LA 1ZQYA 2BPCA 1ZQWA 1SZPA 4KMUA 2A1JB 7ICPA 2FPKA 3JPNA 5KG3A 3OSNA 5KFYA 4F93B 5KT3A 3RBEA 5DQHA 4F4KA 4KLTA 1D9DA 4DWIA 4PGXA 3EZ5A 4DOBA 2FLNA 3UQ2A 9ICNA 2PFNA 3BQ0A 5HHHA 1T8EA 1BPZA 4K4IA 1QSLA 2HVHA 4J9OA 3RJFA 1ZQJA 5DQGA 4BXOB 2V9WA 3OSPA 4QZAA 4KLSA 4EZ6A 2KFNA 2IA6A 3H4DA 2FLPA 4QZ8A 1BVSA 4Z6FA 4I2EA 1ZQFA 1D8YA 5F9LA 5DQIA 4QWDA 5KFLA 3V6HA 5DBBA 4M47A 2ZTDA 4PGQA 1S9FA 3K4GA 5DB6A 3B0XA 4J9MA 2C22A 1QTMA 2PI4A 4J9QA 9ICQA 4R8UB 2JEGA 8ICQA 3Q8SB 4K4GA 7ICHA 3RTVA 2R8GA 3KTQA 1IXRA 2HHTA 2PXIA 4DO9A 3KHHA 4PHEA 4I2CA 1JMSA 3RJEA 4ECUA 4M04A 8ICYA 8ICKA 1JN3A 5KFTA 5J2KA 3BJYA 8ICIA 1JXEA 5EWEA 3H8SA 4X5VA 5HMMA 4ED2A 1BPYA 2JEJA 4UB4A 3MBYA 8ICEA 2AJQA 3M8RA 3HP6A 4EBCA 2BPFA 5J2AA 4ELVA 8ICAA 4UAWA 4ECWA 7ICFA 3LK9A 4ECQA 1SL1A 2BCQA 2UVUA 3G6XA 1KTQA 3GFKB 2R8IA 4O9MA 5J2DA 4JV2A 7ICGA 4YG2A 5KFJA 3RJKA 1DGSA 5J0SA 3RR8A 4ELUA 5J0UA 4RQ0A 3GV8B 1TAUA 4NLKA 3H8WA 5KFQA 3MDAA 2NRWA 1ZQDA 4IR1A 2Y1IA 3M9NB 1U9LA 2J6UA 3MR2A 4DEZA 3GIIA 4LVSA 4P4OA 4HYKA 2FMSA 2W8LA 3C2MA 3ORYA 5J0TA 4RQ3A 4KN7A 4Q8FA 4GXKA 3C2KA 3V7LA 2LYHA 3SV4A 3ZDDA 5EWGA 3KHLA 2IBKA 3RRGA 5KG0A 2W9BB 5KFUA 4YR2A 2RDJA 4RT3A 4BWMA 3M9OB 5KFAA 3GV5B 3LDAA 1T3NA 2HHWA 4J9LA 3G6VA 3PV8A 1RZTA 5KFRA 4I2JA 4J9RA 2H5XA 1U49A 5KFBA 3ZDBA 5DB9A 5J2CA 2PFQA 2JZBB 5KFSA 3QZ8A 4F4XA 2AGQA 5KT7A 1TVAA 1TKDA 1U45A 5KFDA 4QZIA 4RNNA 3KHRA 4DQSA 1S0MA 4YFKA 4M0AA 4M9GA 2BQRA 2DFLA 4R63A 4B9NA 4O5CA 1ZQTA 4KN4A 4QZCA 1WCLA 2AQ0A 4ED7A 3PVXA 2GWSA 3ZDAA 4I2FA 1MC8A 4KLEA 9ICMA 4IQTA 5IIIA 4TUSA 4FBTA 1ZQNA 7ICOA 1N56A 9ICTA 4DOCA 1BGXT 5KT6A 3OHAA 1XSNA 4DF8A 2HVIA 4DL4A 1A76A 5J2JA 2BKEA 4DQIA 1K1SA 1NJZA 4F91B 3JPTA 4EYIB 5BPCA 4F5NA 5KFGA 8ICHA 4IQVA 4ED6A 5J2HA 4F5OA 3H40A 2BGWA 4M6WB 4Q45A 1NK5A 2VA3A 2KFZA 4XA5A 3OJSA 3GIMA 8ICXA 4RNMA 4C8MA 4ECZA 5L1IA 1NOMA 2ZJAA 4QZFA 4DF4A 5DKWA 3PX0A 3PO5A 4EZ9A 3C1ZA 3GILA 4Z6DA 1QSSA 4YD2A 3V6JA 2MAXA 1RPLA 4I2BA 1JX4A 3RH5A 3M8SA 1D9FA 9ICCA 7ICLA 4RUAA 4YXMA 3LWLA 1SKWA 3Q8LA 3GV7B 4GC7A 1XSLA 4YVZA 3TQ1A 4DLEA 4O3PA 3HT3A 4YMOA 4IR9A 1BPBA 9ICUA 1SL2A 3V7KA 3HW8A 3GQCA 3RH4A 1ZQBA 3UQ0A 2C2DA 2VA8A 3MR3A 4DFMA 7ICKA 7ICSA 4RUCA 5HP4A 5DGBA 2NRTA 3T3FA 3PW7A 4MEYA 2ZUBA 5EOZA 7ICQA 3RB6A 1UT5A 3ZD9A 4I2HA 4DFJA 5IIJA 4RQ2A 5KFOA 3JPSA 4JUZA 4ECXA 2ISOA 4NM1A 9ICHA 2I1QA 4CCHA 4J9SA 4I2AA 4MEXA 1LB2B 1ZYQA 5KG6A 3LWMA 1T7PA 2BHNA 3T5JA 5KFZA 4RNOA 2I9GA 3C23A 3MGHA 2HW3A 4FS2A 4ECYA 4ECVA 9ICRA 4ECSA 3ISBA 2VA2A 1UA1A 2AQ4A 1S76D 5KFKA 9ICSA 1ZQUA 4KITB 4BDPA 5CWRA 3Q8QB 2MUTB 3THVA 4M6WA 1DOQA 5DG9A 3Q8KA 3FDSA 1Z3EB 3MFHA 4KLQA 3QE9Y 3B0YA 2AU0A 4M9NA 1KRPA 1RXWA 4QZBA 5KFPA 1ZQPA 3OGUA 4JWNA 3PR5B 1ZQXA 4MFCA 1KSPA 4DSFA 4UBBA 4I2DA 4F92B 4RZRA 4YXJA 2ASJA 5HNKA 4KLFA 5CA7A 7ICVA 4M9LA 1D8LA 1ZQAA 4IRDA 5DBCA 4IRKA 3SYZA 7ICNA 3QZ7A 1NK9A 4J9PA 3V6KA 1CUKA 3TI0A 1ZQCA 1LV5A 1X9SA 8ICPA 1SL0A 5DB7A 2XCPA 4QZEA 3OJUA 5DG7A 1XWLA 3T5HA 2MUTA 1HUOA 4C8LA 5J0XA 2FMPA 3PNCA 4DSLA 2FPMA 4C8OA 8ICSA 5DBAA 1ZQZA 4I28A 4ECRA 3EYZA 5L9XA 4ECTA 4RQ1A 4FS1A 2ASDA 4KLIA 1X2IA 2XCAA 5TZVA 2F1JA 4P2HA 4I2GA 1NK6A 3JPPA 3EWAA 4YP3A 1B43A 5IILA 2ALZA 4TURA 2KZMA 3C21A 4PHAA 1HJPA 5KFNA 2FPLA 4O5KA 3NGDA 1BPDA 1S0VA 2BCSA 3EPIA 5J0OA 9ICEA 4UBCA 8ICMA 5DB8A 7ICTA 4DL6A 3PO4A 4YR0A 5J0QA 4NY8A 5KG7A 2IHMA 4F2SA 2JEIA 5DG8A 4LZDA 1ZQMA 5JUMA 2R8JA 4C8NA 2XGPA 1KFDA 3ISCA 4M2YA 7ICMA 4GLXA 5J0RA 3RAQA 2ATLA 1NK4A 4QWAA 3AU6A 1Z00B 1L5UA 2P66A 2M9NA 4QW8A 3TARA 8ICVA 8ICNA 2JZBA 2HHVA 4TQSA 4F4ZA 3HPOA 3GIKA 3V7JA 3Q8MA 1ZJNA 2PI5A 1C7YA 4O3RA 5CHGA 1TV9A 4EEYA 4Q8EA 4R66A 4YCXA 2Q0ZX 2JEFA 1AROP 3TFRA 1RXVA 4DS4A 5CP2A 3T5LA 1NJYA 3SI8A 1TFRA 3OHBA 3TANA 2C2EA 3C1YA 1ZQQA 5DDYA 4J9NA 9ICXA 4NXZA 4YR3A 4I2IA 4MFAA 1JIHA 3G6YA 2KZ3A 2XGQA 4DFPA 3RJHA 4JK1A 4KLGA 3QEBZ 5J0PA 3JPOA 4KLDA 3UXNA 4UAZA 3UPQA 1ZJMA 1U47A 1S0NA 2NRZA 3Q8PB 9ICPA 4XQ8A 3HWTA 1WCNA 4UB3A 4YN4A 3PY8A 8ICWA 4YMMA 4O5EA 4DOAA 3FYHA 3H8JA 5IIMA 1L3TA 5KTQA 4B9SA 2RDIA 4RU9A 3RB0A 4K4HA 1ZQSA 5J29A 4QZGA 4MF8A 1KFSA 3PW4A 2J6SA 2BCVA 4PGYA 1BPXA 4DS5A 2HHUA 2BDPA 5KG5A 4Z6CA 3RAXA 2BPGA 1NKEA 3TFSA 1RYSA 2W8KA 5J2IA 5KFCA 4F4YA 4F5QA 5KT5A 8ICJA 1S77D 2ZJ5A 3JPRA 2AGPA 2BQUA 2WTFA 5KFVA 2DPJA 4IQUA 4RQ8A 2BCRA 3RJIA 3QEAZ 1S10A 4DL3A 4EBEA 5HMLA 4DL7A 2ZTEA 8ICTA 2R8HA 4DQRA 2HHQA 1ZQIA 4KLJA 1X9WA 3KHGA 5KFWA 5DGAA 3MGIA 4B9TA 5IIKA 5J2GA 7ICUA 4JV0A 3BQTA 1MQ2A 3AU2A 4ELTA 4ZH4A 1XO1A 5IINA 1K1QA 4O3SA 3T5KA 2P6UA 3V72A 8ICLA 9ICOA 5D4BA 1IM4A 1QLNA 1CEZA 2F1IA 1UA0A 4F3OA 3N97B 4XUSA 3PR4A 1ZETA 3K75D 8ICRA 2NRXA 4O0IA 5DLFA 2BR0A 4DL5A 5J2EA 5KFIA 5J2BA 2BCUA 1MQ3A 4B9UA 2UVVA 1NK7A 3BQ2A 4JV1A 3SZ2A 1BPEA 5C5JA 9ICJA 2P6RA 4GC6A 4BWJA 1ZQRA 2A1JA 2ZUCA 4UB5A 4R65A 3BQ1A 4B9VA 3PW5A 5J2FA 2PFOA 3E2EA 4F5PA 4KLMA 3C5FA 5L1KA 4RPXA 4PPXA 4KLLA 3RRHA 9ICBA 9ICLA 3Q8RB 2W9AA 5KFHA 3HX0A 1KFTA 4QZDA 3RR7A 4RQ7A 4ED8A 1TK8A 4KTQA 4O3QA 1UT8A 5KFFA 2FLLA 4LZGA 4M9JA 5KT4A 2R8KA 1ZQVA 3IM1A 4UB1A 1ZQHA 1QSYA 3RJGA 3C5GA 4E0DA 5F9NA 5KT2A 2V4QA 4I27A 4NLNA 2XY5A 9ICVA 4QWBA 2XC9A 1U4BA 4TQRA 3MDCA 2VANA 1COOA 4ED1A 1TAQA 1NKBA 4QZ9A 3PMLA 4DLGA 4QZHA 5BOLA 1ZQOA 1HUZA 3EPGA 2IHNA 3BDPA 8ICCA 1ZQGA 5CR0A 4R8UA 2W9CB 2C28A 4FBUA 3GIJA 1MSWD 4DSIA 1XC9A 4NLZA 3ZD8A 4EYHB 4NLGA 1XU4A 5L1LA 2W9BA 3H7IA 3ZDEA 1NKCA 4KLOA 2PFPA 5HHIA 4DSJA 5IIOA 4UQGA 4O3NA 2XY7A 2KTQA 4TUQA 2XO7A 2KN7A 3RB3A 2V4RA 1PZNA 2AGOA 4DL2A 4G3IA 4RT2A 5J0WA 4BGDA 2ASLA 1XS9D 4BXOA 4Q43A 1SKSA 3ETLA 2UVWA 8ICOA 4UB2A 4QWCA 2HHSA 4RPYA 4ED0A 3PW2A 4DSKA 3ZDCA 4YQWA 4Q44A 1NJXA 1Y88A 4IQWA 8ICBA 3ISDA 2W9CA 2ZUDA 5KG4A 3M9MB 1EXNA 1S97A 9ICIA 7ICRA 3EW9A 4P4MA 2BQ3A 2B21A 1T4GA 1N48A 1TK5A 9ICFA 5D49A 4PHDA 4M9HA 1NK8A 1ZQEA 1U48A 1XSPA 3GDXA 4QW9A 1KDHA 2OWOA 4PH5A 5KFEA 5DDMA 1TK0A 4NM2A 4P4PA 3RBDA 7ICJA 2Y1JA 3PMNA 1SKRA 1NK0A 2UVRA 3TAQA 3JPQA 7ICEA 3RH6A 4RQ5A 3TAPA 4IRCA 5KFMA 5BOMA 4UAYA 4MF2A 2W9MA 9ICGA 4FO6A 1L3SA 1Z00A 5KFXA 2ZJ8A 4DFKA 4DQPA 5D46A 2HHXA 1S0OA 3UXPA 4KLUA 5L1JA 2F1HA 4RQ6A 1NJWA 4DSEA 3PX4A 4C8KA 1H38A 4O3OA 4I29A 3AUOA 8ICGA 3SV3A 2DPIA 2FMQA 2KZZA 9ICKA 3PW0A 2XY6A 4MFFA 4YD1A 3MR5A 1L3VA
chains in the Genus database with same CATH superfamily
4R64A 3ALRA 2GOLA 3PZPA 5KG2A 2KVCA 5AKJA 3MR6A 4F50A 4WJ3B 2IMWP 1ZQKA 2E5SA 1WWVA 1IG6A 5DLGA 2I5HA 2FI1A 3PX6A 2C2RA 9ICWA 4GXJA 2J6TA 1V9PA 4F5RA 8ICZA 4ACOA 2FJ6A 5AKEA 3H4BA 7ICJA 4RPZA 2LMRA 4F4WA 5CJ7A 3TADA 4AP9A 4KMUA 7ICPA 3OSNA 4P0PB 4F93B 4F4KA 5ALEA 4PGXA 4DOBA 2AH5A 5ALIA 3UM9A 5HHHA 5ALOA 4J9OA 2KE7A 2DBYA 4BXOB 1S5LU 3H4DA 2IA6A 4QZ8A 4Z6FA 3SAHA 5ALGA 2DKXA 5F9LA 4QWDA 5KFLA 1OUQA 2ZTDA 5DB6A 2C22A 4J9QA 2E8PA 1LKYA 5ALFA 3RTVA 1YZ6A 5HR7A 3H8MA 1IXRA 4DO9A 3SQIA 4PHEA 4I2CA 1JMSA 8ICKA 4Y2RA 1JN3A 5KFTA 5EWEA 4X5VA 4ED2A 4EBCA 2BPFA 3QUCA 4ECQA 1SL1A 2UVUA 3L4PA 3RJKA 1DGSA 3RR8A 1TAUA 1N5WA 5ALSA 1NNLA 4UAVA 5KFQA 5ALHA 1U9LA 2ESEA 3CNHA 4P4OA 2W8LA 1UPHA 4UASA 5AKKA 1Q46A 4RQ3A 2XVTA 4C4SA 5EWGA 1WWUA 2RDJA 3M9OB 2HHWA 1FFVA 4J9LA 3PV8A 5J2CA 5KFSA 4F4XA 1S0MA 2JRZA 4R63A 4O5CA 5E79U 1PVPA 3D6JA 3LVWA 4I2FA 1MC8A 3OTQA 9ICTA 3OHAA 1FIQA 1XSNA 2HVIA 5AM3A 2WF9A 3JPTA 4F5NA 5KFGA 2HBKA 4XA5A 3OJSA 3GIMA 5AM2A 1NOMA 2K4HA 2ZJAA 4EZ9A 2HBJA 3C1ZA 3GILA 4Z6DA 1QSSA 2HMXA 1RPLA 3UMBA 3M8SA 3N7RC 1XSLA 4DLEA 2F2AB 4O3PA 1BPBA 9ICUA 3KZXA 2MU2A 3GQCA 1ZQBA 4DFMA 2ES6A 7ICSA 3T3FA 4C80A 3H0MB 4UB8U 7ICQA 3JPSA 4ECXA 1J2MA 4NM1A 9ICHA 2DWQA 4J9SA 1T7PA 2BZFA 3SEIA 3T5JA 2DUYA 4ECYA 3WKAA 1UA1A 3ONNA 2AQ4A 1ZQUA 4Y2PA 4KITB 3THVA 2VKQA 2W54A 3AMZA 3MFHA 1WUDA 2NV3A 3B0YA 2AU0A 1KRPA 2L5YA 2K89A 5T14A 3A0BU 2KNJA 3WK9A 1ZQPA 3OGUA 3WK4A 4I2DA 2B6GA 1UHUA 1D8LA 2O6KA 4IRKA 2YY6A 3SYZA 3V6KA 2KSOA 1ZQCA 2HBLA 5DB7A 2RQ5A 3M1YA 5A0LA 1Z1VA 5C0YA 4DSLA 8ICSA 1V97A 4ECRA 3EYZA 2MSNA 5EE0A 2W03A 3JPPA 3EWAA 1B43A 4PHAA 5KFNA 2FPLA 2BCSA 3EPIA 1TAMA 4UBCA 3I28A 5DB8A 2D8CA 2QARB 4YR0A 1KQQA 4NY8A 5KG7A 1ZQMA 4LZDA 2OYYA 4C8NA 2H3FA 1NK4A 1RQNA 1URJA 1L5UA 8ICNA 2M9NA 4QW8A 2OEHA 1X66A 2JZBA 3GIKA 1ZJNA 1C7YA 4Q8EA 5EE3A 3TFRA 2E1EA 5ALRA 1J97A 1SV4A 1V38A 3J81j 4J9NA 9ICXA 5ALKA 4YR3A 4I2IA 2KSOB 3IP4B 2KZ3A 4CF5A 3UXNA 4UAZA 3UPQA 2NRZA 9ICPA 3QX7A 2K60A 2EDUA 2HCFA 2BDPA 5KG5A 1HEKA 4Z6CA 3RAXA 1NKEA 3F2CA 3NS1A 1X40A 2Y0SF 2BQUA 5KFVA 2DPJA 5ALLA 3QEAZ 4EBEA 3MGIA 4B9TA 5J2GA 3QUQA 4ELTA 4ZH4A 3T5KA 3V72A 4ZOHC 2EANA 4OJOA 3IG8A 1ZETA 3K75D 8ICRA 1JI7A 5J2EA 5KFIA 2D6FC 5AK5A 3BQ2A 3IG5A 3DV9A 2P6RA 1DRGA 5AICA 2KOBA 2EAPA 4UB5A 3E2EA 5J2FA 4F5PA 1FFUA 4IS7A 2KG5A 3HILA 1N63A 3RRHA 9ICLA 2K8BB 3Q8RB 4OJLA 2ODGA 5KFFA 2FLLA 2WF7A 4UB1A 2R8GA 1OW5A 2QB0B 4TQRA 4ED1A 2VANA 1U4BA 3PSPA 5BOLA 2KJ8A 2RP5A 1ZQGA 1YZ7A 4R8UA 4FBUA 1VLBA 1XC9A 2Q4TA 3CW2C 2KD1A 3H7IA 2KTQA 2XY7A 4TUQA 2H3QA 3EUB2 4DFDA 3M6ZA 2XO7A 2V4RA 1PZNA 2AGOA 4G3IA 3N7SC 5ALYA 5J0WA 4BGDA 4Q43A 3QU2A 5ALUA 3N7PD 4ED0A 4JB3A 1JRPA 4NLCA 1S97A 3NVVA 1T4GA 3PSIA 4PHDA 5ALVA 1D8BA 1KDHA 5KFEA 3U26A 3I1YA 5J8YC 2CRXA 4FO6A 4MHVA 5KFXA 3ICXA 2JMGA 1X6JA 2DL0A 3PSTA 2Y9TA 4DSEA 3PX4A 4O3OA 4I29A 3SV3A 2DPIA 2KZZA 3PW0A 2XY6A 4I2AA 1L3VA 2HBMA 1RG6A 2DF4B 3N4MB 1X9MA 2FDRA 4C7YA 1SV0A 3UXOA 4EELA 1KLNA 3IHQB 3O0FA 3C2LA 4B9LA 1ZQYA 2ZIXA 4UARA 5AIAA 1ZD2P 1ZQWA 1SB3C 5KT3A 3RBEA 3EZ5A 3UQ2A 2WF8A 4QIWC 2G06A 2YMPA 3QUTA 3OSPA 4GFJA 4QZAA 2KFNA 2FLPA 4CNQA 2ZXHA 1BVSA 2NYVA 4I2EA 5DQIA 3V6HA 3K4GA 2JEGA 8ICQA 3KFUF 5AKXA 4P0PA 2PXIA 3RJEA 8ICIA 4NL9C 5J2KA 3H8SA 5AI6A 3SAGA 1BPYA 2XI9A 3HP6A 4ELVA 5J2AA 2KEYA 3LK9A 1N2XA 5K4LA 5J2DA 3IRUA 4B6JA 2E8MA 3H8WA 1RYUA 3MDAA 2DQNB 2Y1IA 5ALZA 2ZG6A 3MR2A 3GIIA 4HYKA 3C2MA 3ORYA 4Q8FA 2CN1A 4GXKA 4RQMA 5KAFU 5ALTA 3FC4A 5JTIA 3KBBA 3RRGA 2W9BB 5B66U 4YR2A 4BWMA 5KFAA 3GV5B 3G6VA 5KFRA 4J9RA 2H5XA 1U49A 2JZBB 3QZ8A 1TKDA 4QZIA 3KHRA 4M0AA 5ALMA 2DFLA 3WKEA 4B9NA 1ZQTA 4KN4A 4QZCA 2AQ0A 3M7DA 2GWSA 5IIIA 3IDWA 7ICOA 2WB1F 5KT6A 2BKEA 1N60A 1NJZA 4F91B 1SWVA 3H40A 4Q45A 2KFZA 3UMCA 3NVWA 4RNMA 5L1IA 4BX9C 3PX0A 5DKWA 3WKBA 4Y2SA 3RH5A 7ICLA 1SKWA 4GC7A 4IR9A 3HT3A 4YMOA 1SL2A 4Y2QA 3UQ0A 1KN5A 4RUCA 1IIPA 2NRTA 2F8KA 2ZUBA 5EOZA 2HOIA 1UT5A 3ZD9A 3CP8A 2ZIUB 5KFOA 3F2DA 2I1QA 3LWMA 2BHNA 3C23A 2G0AA 2KKVA 2WF6A 2VJ4A 4NLBA 5KFKA 1PK1B 3Q8QB 2MUTB 2G5IB 3Q8KA 3FDSA 3QE9Y 3OPXA 4M9NA 1SWWA 1RXWA 5KFPA 1WYGA 1KSPA 1JALA 7ICVA 4M9LA 5H2FU 4PZOA 5DBCA 1A6SA 2LYBA 1LV5A 1A0PA 8ICPA 1QH9A 4QZEA 3OJUA 5DG7A 3T5HA 1AQ6A 4C8LA 2FPMA 2HOFA 1ZQZA 4I28A 3AM9A 1PVQA 1PK1A 4ECTA 3WK8A 4EX7A 4FS1A 4P0QB 4KLIA 1QQ5A 4PZNA 1NK6A 4YP3A 4NJ8A 5IILA 4TURA 2JGAA 9ICEA 4KMOB 4EX6A 5J0OA 5ALPA 3NUQA 5HR6A 3PO4A 5J0QA 2NO4A 4BJQA 5JUMA 1ZQ1C 4M2YA 1XNSA 4GLXA 3RAQA 2ATLA 8ICVA 3TARA 2GLEA 4TQSA 4F4ZA 2PI5A 5CHGA 1TV9A 2K8AA 4YCXA 4R66A 5ALJA 2ZXIA 1JIHA 3E58A 2QLTA 2G5HB 1ZJMA 1S0NA 4YN4A 8ICWA 4YMMA 4O5EA 4DOAA 4B9SA 2RDIA 2IOFA 3RB0A 2YB1A 1ZQSA 4K4HA 5J29A 2J6SA 4PGYA 2HHUA 2BPGA 3E0FA 1RYSA 1L7NA 4CGZA 1S77D 4A8EA 2RRDA 3JPRA 1O03A 4IQUA 1PUZA 3RJIA 2BCRA 1S10A 1O08A 2ZTEA 3F53A 2HSZA 4DQRA 3WKCA 3KHGA 2GH1A 2KKPA 4JV0A 1SIJA 1K1QA 4O3SA 2P6UA 8ICLA 4QJFB 1HIWA 1CEZA 2HOQA 2F1IA 1UA0A 2JH1A 4F3OA 4OD0A 2ZIWA 4XUSA 3PR4A 2WAQC 1P7DA 2WF5A 5J2BA 2UVVA 2F3NA 3IN5A 2E8OA 4JV1A 1BPEA 4C7ZA 4GC6A 1ZQRA 1BNPA 3PW5A 2PFOA 4KLMA 5L1KA 4PPXA 2W9AA 3NASA 1F5SA 2EAMA 1TK8A 2A19A 5KT4A 4E0DA 3KOOA 2HI0A 4FFDA 1COOA 3MDCA 5AM0A 4NLZA 1NKCA 5HHIA 4DSJA 4UQGA 1Q8KA 5AM1A 1KKXA 1LVHA 4BXOA 3WK7A 2UVWA 4UB2A 3NVYA 5FP0A 1ED1A 4DSKA 3ZDCA 4YQWA 2KIWA 5GTIU 3ISDA 8ICBA 1EXNA 9ICIA 2G07A 1X6IA 2E1FA 3RBDA 2KP7A 2Y1JA 3JPQA 2BDUA 3AN1A 4HAIA 5CEHA 2OM6A 3BZCA 4OJPA 2W9MA 3D2QA 5AI4A 4UATA 2H3IA 1S0OA 1F44A 2CXYA 3PSFA 3QU4A 1WG8A 3AUOA 5AI9A 1SXEA 5AKGA 3MR5A 1RYRA 3MABA 4F8RA 2LBOA 2H3VA 1MA7A 3QU5A 3MFIA 4GXIA 4PHPA 4RQ4A 1JXLA 2NRVA 2W43A 2AXTU 3RJJA 2ISPA 4J9KA 7ICIA 5EWFA 4ED3A 1ZQLA 8ICUA 3NTUA 4EBDA 3CRXA 1L3UA 4Z6EA 9ICAA 4TUPA 4XRHA 2PMZF 1L7MA 1MN8A 4GIBA 3RFAA 5JRTA 2W7OA 2BPCA 1SZPA 2A1JB 2FPKA 5KL8B 1SZHA 1ZD5A 5KFYA 3BQ0A 5AKLA 5CRXA 4K4IA 1QSLA 2MRLA 2HVHA 3RJFA 2N1RA 4FE3A 1ZQJA 1UCVA 4KLSA 4KX3A 1KL9A 4M47A 4AYBF 1S9FA 2PI4A 1QTMA 2ZIVA 3Q8SB 4K4GA 2WFAA 3M6KA 4J03A 2VIXA 3KHHA 2F76X 4M04A 8ICYA 4ECUA 3BJYA 1ZD4A 4UB4A 3NRZA 2AJQA 3M8RA 4JMUA 4DCCA 2KMDA 4UAWA 7ICFA 2A1AA 2BCQA 4CDGA 3FAHA 1KTQA 3GFKB 4O9MA 4JV2A 4YG2A 2KHQA 5AKIA 5J0SA 3GV8B 2NRWA 5ALDA 3ED5A 1J2NA 2J6UA 2FMSA 5J0TA 2LYHA 5KFUA 2LYAA 4RT3A 3LDAA 2AHOB 3F5AA 4I2JA 5KFBA 2PFQA 2OHFA 5KT7A 4RNNA 2QB0A 2W7PA 3PVXA 1L6NA 1WCLA 4KLEA 5L1MA 3ZDAA 2F77X 4NL9A 9ICMA 2LM1A 2KK0A 4IQTA 4TUSA 4FBTA 1ZQNA 1N56A 4DOCA 1BGXT 4PL1A 4DF8A 1A76A 2YMLA 1K1SA 2W04A 4ED6A 4M6WB 5AI5A 8ICXA 4ECZA 4CF3A 2YB4A 4QZFA 4AYBC 1CRXA 4YD2A 3V6JA 9ICCA 3L3FX 4RUAA 4YXMA 3Q8LA 3TQ1A 4BUGA 4P2HA 3V7KA 3RH4A 2VA8A 3MR3A 1X42A 5HP4A 2WB1C 5DGBA 4OJ6A 3H0LB 4DFJA 5IIJA 4IC9A 1QCKA 4CCHA 3K1ZA 5KG6A 2KHVA 3WK6A 3MGHA 2HW3A 1T3QA 4ECVA 9ICRA 4ECSA 3AL0B 1S76D 9ICSA 2KVSA 4BDPA 4Y2JA 5CWRA 4M6WA 2JXJA 1Z3EB 4KLQA 2YN4A 4QZBA 2F44A 4JWNA 5ALXA 3PR5B 2W3RA 4MFCA 4DSFA 4RZRA 5HNKA 2NO5A 4IRDA 7ICNA 2LI6A 1NK9A 2HDOA 2RHFA 1X9SA 1SL0A 2XCPA 2DKZA 4Y2TA 2MUTA 1HUOA 2FMPA 3PNCA 4C8OA 5DBAA 2W55A 5L9XA 2F8LA 2ASDA 4KX5A 2KV2A 2YTUA 5AKYA 1Z1BA 1KW4A 1X2IA 4Y2VA 5TZVA 2F1JA 2KZMA 3C21A 4O5KA 1S0VA 3AQEA 1C20A 3WK5A 7ICTA 3BS5B 2IHMA 4F2SA 2JEIA 2R8JA 1KFDA 5J0RA 4QIWF 4QWAA 5AK4A 1Z00B 4LJXA 3H0RB 5J8YA 4EEYA 2Q0ZX 4CF4A 1AROP 1Z19A 1RXVA 1NJYA 3T5LA 1TFRA 3OHBA 3UMGA 2C2EA 4NXZA 3RJHA 4JK1A 3QEBZ 5J0PA 1U47A 2M0NA 3F2BA 3Q8PB 4XQ8A 3L5KA 3HWTA 4UB3A 3QNMA 3FYHA 5IIMA 5AM4A 5KTQA 1L3TA 4RU9A 2BCVA 1K5OA 1ZRNA 3WU2U 4FZLA 4F4YA 1GO3F 5J2IA 3SAFA 2EZYA 8ICJA 2AGPA 2LKYA 4RQ8A 1L7PA 4DL3A 5KNIA 4DL7A 8ICTA 2HHQA 1N5XA 1ZQIA 4KLJA 1X9WA 3NRWA 5IIKA 7ICUA 3TKAA 1B0XA 3BQTA 5F3XB 5KL1B 1XO1A 3GU3A 2RLTA 2MA1A 5TISU 3HKZC 1QLNA 2KJ5A 2NRXA 2BR0A 1MQ3A 4B9UA 1NK7A 4UAUA 5C5JA 4BWJA 2ZUCA 5G5GA 3C5FA 4RPXA 9ICBA 1Q3UA 1Q3VA 5AKZA 3HX0A 2ZIWB 4QZDA 4NV0A 4KTQA 4O3QA 4LZGA 4US9A 3RJGA 3C5GA 5KT2A 4I27A 2V4QA 2XC9A 1DK3A 3PMLA 4DLGA 4QZHA 1ZQOA 1HUZA 2IHNA 3BDPA 8ICCA 5ALNA 1Z4NA 2ZIXB 5CR0A 2W9CB 2C28A 4DSIA 3ZD8A 4EYHB 1XU4A 5L1LA 3ZDEA 2PFPA 4O3NA 2KN7A 3RB3A 4CE6A 1XS9D 4FZNA 5B5EU 2DGZA 3ETLA 2PKEA 4RPYA 1ZOLA 3PW2A 4P0QA 3N28A 4Q44A 1NJXA 1Y88A 1RM6C 5KG4A 3M9MB 7ICRA 3SENA 4P4MA 2BQ3A 2B21A 1N48A 5D49A 1ZQEA 4EEKA 3GDXA 2KJ9A 2OWOA 1TK0A 4P4PA 3KKAC 5JU5A 1SKRA 3TAQA 7ICEA 4RQNA 2IOHA 1ZXIA 2G09A 4IRCA 4UAYA 1L3SA 2EZXA 2OCEA 2ZJ8A 4DFKA 4DQPA 5ALQA 3UXPA 3LVVA 1VDVA 5L1JA 2F1HA 2K8CB 1SGGA 4FZMA 4C8KA 1H38A 2KICA 9ICKA 3SMVA 4MFFA 4YD1A 1SV0C 5KG1A 8ICFA 2E8NA 1XO0A 1KEJA 4QWEA 1DK2A 4JWMA 2JH7A 4DQQA 4B9MA 2I6XA 3DEEA 2A3VA 3KD3A 3RB4A 2ZTCA 4YMNA 1A77A 5CB1A 4KLHA 5EE9A 1B22A 5AI0A 4F2RA 5J0YA 2LM4A 2QB1A 2R18A 5KG3A 3JPNA 5DQHA 4KLTA 1D9DA 4DWIA 2FLNA 1LKYB 9ICNA 2PFNA 1T8EA 1BPZA 1FEZA 2YMQA 5DQGA 1B4FA 2V9WA 4EZ6A 3LYSA 2EZZA 1ZQFA 1D8YA 2YMMA 5DBBA 4PGQA 4C0ZA 3B0XA 4J9MA 9ICQA 4R8UB 7ICHA 3B9JA 2EAOA 3KTQA 2HHTA 2ZIUA 4OJ5A 1RDFA 1BNOA 1JXEA 5HMMA 2JEJA 3MBYA 8ICEA 8ICAA 1VJ5A 4ECWA 3G6XA 2R8IA 7ICGA 5KFJA 1RQLA 2K4PA 4ELUA 3R9KA 5J0UA 4RQ0A 4NLKA 1L8LA 1T94A 1ZQDA 4IR1A 3M9NB 4DEZA 4LVSA 1OXJA 4KN7A 2QKQA 3C2KA 3MC1A 3V7LA 3SV4A 3ZDDA 1IV8A 2EQYA 1TE2A 3KHLA 2IBKA 2OH2A 5KG0A 2H3ZA 4Y2XA 1T3NA 1RZTA 3ZDBA 5DB9A 1TVAA 4PL2A 3C29A 2AGQA 1U45A 5KFDA 4DQSA 4YFKA 4M9GA 2BQRA 4G9BA 3I76A 4ED7A 5AIBA 1FO4A 1N62A 4DL4A 5KAIU 2KIVA 5J2JA 4DQIA 4EYIB 8ICHA 5BPCA 4IQVA 5J2HA 4F5OA 1S8OA 2BGWA 1NK5A 2VA3A 2IOFK 4C8MA 3PO5A 4DF4A 4ICAA 3F5EA 2MAXA 3TACB 4I2BA 1JX4A 1D9FA 1L8OA 3D2NA 3LWLA 3GV7B 4YVZA 3NVZA 3HW8A 2C2DA 7ICKA 1N61A 3PW7A 4MEYA 2XICA 3RB6A 4I2HA 2ISOA 4RQ2A 4JUZA 1X9XA 1NI3A 4MEXA 3QU7A 1ZYQA 1LB2B 5KFZA 4RNOA 2I9GA 4FS2A 2VA2A 3ISBA 4Y2UA 1DOQA 5DG9A 3KKAA 1F0MA 3HKZF 1ZQXA 2E3TA 3S6JA 4CRXA 4UBBA 4F92B 4YXJA 2ASJA 4USAA 4KLFA 5CA7A 1ZQAA 3VC8A 5AK3A 3QZ7A 4J9PA 2XIDA 4U6PA 2WAQF 1CUKA 5ALWA 3TI0A 2LPEA 3MGVA 2QARA 4QNLA 3FM9A 1XWLA 2EH9A 2Z7JA 5J0XA 3SR6A 5AK6A 3BZKA 4RQ1A 1KBUA 2LHTA 2D3DA 1ECWA 2XCAA 4I2GA 2ALZA 1HJPA 1L7OA 3NGDA 1BPDA 2FE9A 2WHEA 8ICMA 4DL6A 3BQ7A 5DG8A 2XGPA 2GO7A 3ISCA 7ICMA 1SXDA 3AU6A 2P66A 5AHXA 2HHVA 3HPOA 1NZPA 3V7JA 3Q8MA 4O3RA 2PMZC 2JEFA 1JUDA 4DS4A 1M6YA 2YX8A 5CP2A 5AM5A 3SI8A 3TANA 1ZQQA 3C1YA 4EENA 5DDYA 3BS5A 4MFAA 2JR5A 3AQFA 3D2SA 3G6YA 4KLGA 4DFPA 2XGQA 2K4IA 1COKA 3JPOA 4KLDA 3ZI4A 3QU9A 1WCNA 3PY8A 3GZFA 3H8JA 4UB6U 4QZGA 4MF8A 1KFSA 3PW4A 3BS7A 1BPXA 4DS5A 4U7CA 3TFSA 2JV3A 2W8KA 5KFCA 1DGJA 4F5QA 5KT5A 2ZJ5A 5G5HA 2WTFA 2VJ5A 1CI4A 2P35A 4F72A 4Y2YA 5HMLA 2K4EA 2R8HA 5DGAA 5KFWA 3T79A 1MQ2A 3AU2A 5IINA 2OXOA 9ICOA 5D4BA 1IM4A 3HRDD 2CPRA 3N97B 3VCBA 2Y9UA 4F71A 4C4TA 5DLFA 4O0IA 4DL5A 4OCZA 2BCUA 4O3MA 3SZ2A 9ICJA 1V85A 1PK3A 2A1JA 3BQ1A 4R65A 4B9VA 5AI8A 3IV6A 4UW9A 1ZRMA 1DXSA 4KLLA 2Y0SC 4US8A 3TADC 5KFHA 1Z4OA 3SD7A 1KFTA 3RR7A 4RQ7A 1JROA 3ETRA 4NWIA 4ED8A 1UT8A 1PVRA 4M9JA 1QQ6A 2R8KA 1ZQVA 3IM1A 1ZQHA 1QSYA 9ICVA 5F9NA 4NLNA 2XY5A 4QWBA 1NKBA 1TAQA 5AKHA 4QZ9A 3EPGA 3GIJA 1MSWD 2ZIVB 4NLGA 1UQVA 2W9BA 4KLOA 5IIOA 4PJ0U 4DL2A 5GTHU 4RT2A 2ASLA 3QUBA 1SKSA 8ICOA 3DDHA 4QWCA 4OO1J 2HHSA 4IL6U 3QXGA 4C4RA 4IQWA 2W9CA 2JHDA 2ZUDA 1ZD3A 3HJEA 3EW9A 1TK5A 9ICFA 4M9HA 1NK8A 1U48A 1XSPA 4QW9A 4PH5A 5DDMA 3RF9A 3C28A 2W11A 2G08A 4NM2A 2B0CA 3PMNA 1NK0A 2UVRA 1QQ7A 3RH6A 4RQ5A 3TAPA 5KFMA 5BOMA 4MF2A 3A0HU 9ICGA 2W3SA 3KZIU 1NZBA 1Z00A 3AEVA 3K1RB 5D46A 2HHXA 1YT3A 4KLUA 3CYMA 1NJWA 4RQ6A 2YQEA 3WKDA 8ICGA 2FMQA 3QYPA 5EE1A
chains in the Genus database with same CATH topology
4R64A 3MABA 5KG1A 1RYRA 8ICFA 5KG2A 4F8RA 3MR6A 1KEJA 4QWEA 4F50A 4JWMA 2IMWP 1ZQKA 4DQQA 3N4MB 4B9MA 1X9MA 5DLGA 3MFIA 4GXIA 4PHPA 4RQ4A 1JXLA 2NRVA 3PX6A 3RJJA 2C2RA 2ISPA 4J9KA 9ICWA 4GXJA 7ICIA 2J6TA 5EWFA 4ED3A 1ZQLA 3UXOA 3RB4A 8ICUA 2ZTCA 3NTUA 4EBDA 4YMNA 1V9PA 1A77A 5CB1A 1L3UA 4F5RA 4Z6EA 1KLNA 4KLHA 8ICZA 1B22A 3H4BA 3IHQB 9ICAA 4RPZA 4F2RA 4TUPA 3C2LA 4XRHA 5CJ7A 5J0YA 4F4WA 4B9LA 1ZQYA 2BPCA 1ZQWA 1SZPA 4KMUA 2A1JB 7ICPA 2FPKA 3JPNA 5KG3A 3OSNA 5KFYA 4F93B 5KT3A 3RBEA 5DQHA 4F4KA 4KLTA 1D9DA 4DWIA 4PGXA 3EZ5A 4DOBA 2FLNA 3UQ2A 9ICNA 2PFNA 3BQ0A 5HHHA 1T8EA 1BPZA 4K4IA 1QSLA 2HVHA 4J9OA 3RJFA 1ZQJA 5DQGA 4BXOB 2V9WA 3OSPA 4QZAA 4KLSA 4EZ6A 2KFNA 2IA6A 3H4DA 2FLPA 4QZ8A 1BVSA 4Z6FA 4I2EA 1ZQFA 1D8YA 5F9LA 5DQIA 4QWDA 5KFLA 3V6HA 5DBBA 4M47A 2ZTDA 4PGQA 1S9FA 3K4GA 5DB6A 3B0XA 4J9MA 2C22A 1QTMA 2PI4A 4J9QA 9ICQA 4R8UB 2JEGA 8ICQA 3Q8SB 4K4GA 7ICHA 3RTVA 2R8GA 3KTQA 1IXRA 2HHTA 2PXIA 4DO9A 3KHHA 4PHEA 4I2CA 1JMSA 3RJEA 4ECUA 4M04A 8ICYA 8ICKA 1JN3A 5KFTA 5J2KA 3BJYA 8ICIA 1JXEA 5EWEA 3H8SA 4X5VA 5HMMA 4ED2A 1BPYA 2JEJA 4UB4A 3MBYA 8ICEA 2AJQA 3M8RA 3HP6A 4EBCA 2BPFA 5J2AA 4ELVA 8ICAA 4UAWA 4ECWA 7ICFA 3LK9A 4ECQA 1SL1A 2BCQA 2UVUA 3G6XA 1KTQA 3GFKB 2R8IA 4O9MA 5J2DA 4JV2A 7ICGA 4YG2A 5KFJA 3RJKA 1DGSA 5J0SA 3RR8A 4ELUA 5J0UA 4RQ0A 3GV8B 1TAUA 4NLKA 3H8WA 5KFQA 3MDAA 2NRWA 1ZQDA 4IR1A 2Y1IA 3M9NB 1U9LA 2J6UA 3MR2A 4DEZA 3GIIA 4LVSA 4P4OA 4HYKA 2FMSA 2W8LA 3C2MA 3ORYA 5J0TA 4RQ3A 4KN7A 4Q8FA 4GXKA 3C2KA 3V7LA 2LYHA 3SV4A 3ZDDA 5EWGA 3KHLA 2IBKA 3RRGA 5KG0A 2W9BB 5KFUA 4YR2A 2RDJA 4RT3A 4BWMA 3M9OB 5KFAA 3GV5B 3LDAA 1T3NA 2HHWA 4J9LA 3G6VA 3PV8A 1RZTA 5KFRA 4I2JA 4J9RA 2H5XA 1U49A 5KFBA 3ZDBA 5DB9A 5J2CA 2PFQA 2JZBB 5KFSA 3QZ8A 4F4XA 2AGQA 5KT7A 1TVAA 1TKDA 1U45A 5KFDA 4QZIA 4RNNA 3KHRA 4DQSA 1S0MA 4YFKA 4M0AA 4M9GA 2BQRA 2DFLA 4R63A 4B9NA 4O5CA 1ZQTA 4KN4A 4QZCA 1WCLA 2AQ0A 4ED7A 3PVXA 2GWSA 3ZDAA 4I2FA 1MC8A 4KLEA 9ICMA 4IQTA 5IIIA 4TUSA 4FBTA 1ZQNA 7ICOA 1N56A 9ICTA 4DOCA 1BGXT 5KT6A 3OHAA 1XSNA 4DF8A 2HVIA 4DL4A 1A76A 5J2JA 2BKEA 4DQIA 1K1SA 1NJZA 4F91B 3JPTA 4EYIB 5BPCA 4F5NA 5KFGA 8ICHA 4IQVA 4ED6A 5J2HA 4F5OA 3H40A 2BGWA 4M6WB 4Q45A 1NK5A 2VA3A 2KFZA 4XA5A 3OJSA 3GIMA 8ICXA 4RNMA 4C8MA 4ECZA 5L1IA 1NOMA 2ZJAA 4QZFA 4DF4A 5DKWA 3PX0A 3PO5A 4EZ9A 3C1ZA 3GILA 4Z6DA 1QSSA 4YD2A 3V6JA 2MAXA 1RPLA 4I2BA 1JX4A 3RH5A 3M8SA 1D9FA 9ICCA 7ICLA 4RUAA 4YXMA 3LWLA 1SKWA 3Q8LA 3GV7B 4GC7A 1XSLA 4YVZA 3TQ1A 4DLEA 4O3PA 3HT3A 4YMOA 4IR9A 1BPBA 9ICUA 1SL2A 3V7KA 3HW8A 3GQCA 3RH4A 1ZQBA 3UQ0A 2C2DA 2VA8A 3MR3A 4DFMA 7ICKA 7ICSA 4RUCA 5HP4A 5DGBA 2NRTA 3T3FA 3PW7A 4MEYA 2ZUBA 5EOZA 7ICQA 3RB6A 1UT5A 3ZD9A 4I2HA 4DFJA 5IIJA 4RQ2A 5KFOA 3JPSA 4JUZA 4ECXA 2ISOA 4NM1A 9ICHA 2I1QA 4CCHA 4J9SA 4I2AA 4MEXA 1LB2B 1ZYQA 5KG6A 3LWMA 1T7PA 2BHNA 3T5JA 5KFZA 4RNOA 2I9GA 3C23A 3MGHA 2HW3A 4FS2A 4ECYA 4ECVA 9ICRA 4ECSA 3ISBA 2VA2A 1UA1A 2AQ4A 1S76D 5KFKA 9ICSA 1ZQUA 4KITB 4BDPA 5CWRA 3Q8QB 2MUTB 3THVA 4M6WA 1DOQA 5DG9A 3Q8KA 3FDSA 1Z3EB 3MFHA 4KLQA 3QE9Y 3B0YA 2AU0A 4M9NA 1KRPA 1RXWA 4QZBA 5KFPA 1ZQPA 3OGUA 4JWNA 3PR5B 1ZQXA 4MFCA 1KSPA 4DSFA 4UBBA 4I2DA 4F92B 4RZRA 4YXJA 2ASJA 5HNKA 4KLFA 5CA7A 7ICVA 4M9LA 1D8LA 1ZQAA 4IRDA 5DBCA 4IRKA 3SYZA 7ICNA 3QZ7A 1NK9A 4J9PA 3V6KA 1CUKA 3TI0A 1ZQCA 1LV5A 1X9SA 8ICPA 1SL0A 5DB7A 2XCPA 4QZEA 3OJUA 5DG7A 1XWLA 3T5HA 2MUTA 1HUOA 4C8LA 5J0XA 2FMPA 3PNCA 4DSLA 2FPMA 4C8OA 8ICSA 5DBAA 1ZQZA 4I28A 4ECRA 3EYZA 5L9XA 4ECTA 4RQ1A 4FS1A 2ASDA 4KLIA 1X2IA 2XCAA 5TZVA 2F1JA 4P2HA 4I2GA 1NK6A 3JPPA 3EWAA 4YP3A 1B43A 5IILA 2ALZA 4TURA 2KZMA 3C21A 4PHAA 1HJPA 5KFNA 2FPLA 4O5KA 3NGDA 1BPDA 1S0VA 2BCSA 3EPIA 5J0OA 9ICEA 4UBCA 8ICMA 5DB8A 7ICTA 4DL6A 3PO4A 4YR0A 5J0QA 4NY8A 5KG7A 2IHMA 4F2SA 2JEIA 5DG8A 4LZDA 1ZQMA 5JUMA 2R8JA 4C8NA 2XGPA 1KFDA 3ISCA 4M2YA 7ICMA 4GLXA 5J0RA 3RAQA 2ATLA 1NK4A 4QWAA 3AU6A 1Z00B 1L5UA 2P66A 2M9NA 4QW8A 3TARA 8ICVA 8ICNA 2JZBA 2HHVA 4TQSA 4F4ZA 3HPOA 3GIKA 3V7JA 3Q8MA 1ZJNA 2PI5A 1C7YA 4O3RA 5CHGA 1TV9A 4EEYA 4Q8EA 4R66A 4YCXA 2Q0ZX 2JEFA 1AROP 3TFRA 1RXVA 4DS4A 5CP2A 3T5LA 1NJYA 3SI8A 1TFRA 3OHBA 3TANA 2C2EA 3C1YA 1ZQQA 5DDYA 4J9NA 9ICXA 4NXZA 4YR3A 4I2IA 4MFAA 1JIHA 3G6YA 2KZ3A 2XGQA 4DFPA 3RJHA 4JK1A 4KLGA 3QEBZ 5J0PA 3JPOA 4KLDA 3UXNA 4UAZA 3UPQA 1ZJMA 1U47A 1S0NA 2NRZA 3Q8PB 9ICPA 4XQ8A 3HWTA 1WCNA 4UB3A 4YN4A 3PY8A 8ICWA 4YMMA 4O5EA 4DOAA 3FYHA 3H8JA 5IIMA 1L3TA 5KTQA 4B9SA 2RDIA 4RU9A 3RB0A 4K4HA 1ZQSA 5J29A 4QZGA 4MF8A 1KFSA 3PW4A 2J6SA 2BCVA 4PGYA 1BPXA 4DS5A 2HHUA 2BDPA 5KG5A 4Z6CA 3RAXA 2BPGA 1NKEA 3TFSA 1RYSA 2W8KA 5J2IA 5KFCA 4F4YA 4F5QA 5KT5A 8ICJA 1S77D 2ZJ5A 3JPRA 2AGPA 2BQUA 2WTFA 5KFVA 2DPJA 4IQUA 4RQ8A 2BCRA 3RJIA 3QEAZ 1S10A 4DL3A 4EBEA 5HMLA 4DL7A 2ZTEA 8ICTA 2R8HA 4DQRA 2HHQA 1ZQIA 4KLJA 1X9WA 3KHGA 5KFWA 5DGAA 3MGIA 4B9TA 5IIKA 5J2GA 7ICUA 4JV0A 3BQTA 1MQ2A 3AU2A 4ELTA 4ZH4A 1XO1A 5IINA 1K1QA 4O3SA 3T5KA 2P6UA 3V72A 8ICLA 9ICOA 5D4BA 1IM4A 1QLNA 1CEZA 2F1IA 1UA0A 4F3OA 3N97B 4XUSA 3PR4A 1ZETA 3K75D 8ICRA 2NRXA 4O0IA 5DLFA 2BR0A 4DL5A 5J2EA 5KFIA 5J2BA 2BCUA 1MQ3A 4B9UA 2UVVA 1NK7A 3BQ2A 4JV1A 3SZ2A 1BPEA 5C5JA 9ICJA 2P6RA 4GC6A 4BWJA 1ZQRA 2A1JA 2ZUCA 4UB5A 4R65A 3BQ1A 4B9VA 3PW5A 5J2FA 2PFOA 3E2EA 4F5PA 4KLMA 3C5FA 5L1KA 4RPXA 4PPXA 4KLLA 3RRHA 9ICBA 9ICLA 3Q8RB 2W9AA 5KFHA 3HX0A 1KFTA 4QZDA 3RR7A 4RQ7A 4ED8A 1TK8A 4KTQA 4O3QA 1UT8A 5KFFA 2FLLA 4LZGA 4M9JA 5KT4A 2R8KA 1ZQVA 3IM1A 4UB1A 1ZQHA 1QSYA 3RJGA 3C5GA 4E0DA 5F9NA 5KT2A 2V4QA 4I27A 4NLNA 2XY5A 9ICVA 4QWBA 2XC9A 1U4BA 4TQRA 3MDCA 2VANA 1COOA 4ED1A 1TAQA 1NKBA 4QZ9A 3PMLA 4DLGA 4QZHA 5BOLA 1ZQOA 1HUZA 3EPGA 2IHNA 3BDPA 8ICCA 1ZQGA 5CR0A 4R8UA 2W9CB 2C28A 4FBUA 3GIJA 1MSWD 4DSIA 1XC9A 4NLZA 3ZD8A 4EYHB 4NLGA 1XU4A 5L1LA 2W9BA 3H7IA 3ZDEA 1NKCA 4KLOA 2PFPA 5HHIA 4DSJA 5IIOA 4UQGA 4O3NA 2XY7A 2KTQA 4TUQA 2XO7A 2KN7A 3RB3A 2V4RA 1PZNA 2AGOA 4DL2A 4G3IA 4RT2A 5J0WA 4BGDA 2ASLA 1XS9D 4BXOA 4Q43A 1SKSA 3ETLA 2UVWA 8ICOA 4UB2A 4QWCA 2HHSA 4RPYA 4ED0A 3PW2A 4DSKA 3ZDCA 4YQWA 4Q44A 1NJXA 1Y88A 4IQWA 8ICBA 3ISDA 2W9CA 2ZUDA 5KG4A 3M9MB 1EXNA 1S97A 9ICIA 7ICRA 3EW9A 4P4MA 2BQ3A 2B21A 1T4GA 1N48A 1TK5A 9ICFA 5D49A 4PHDA 4M9HA 1NK8A 1ZQEA 1U48A 1XSPA 3GDXA 4QW9A 1KDHA 2OWOA 4PH5A 5KFEA 5DDMA 1TK0A 4NM2A 4P4PA 3RBDA 7ICJA 2Y1JA 3PMNA 1SKRA 1NK0A 2UVRA 3TAQA 3JPQA 7ICEA 3RH6A 4RQ5A 3TAPA 4IRCA 5KFMA 5BOMA 4UAYA 4MF2A 2W9MA 9ICGA 4FO6A 1L3SA 1Z00A 5KFXA 2ZJ8A 4DFKA 4DQPA 5D46A 2HHXA 1S0OA 3UXPA 4KLUA 5L1JA 2F1HA 4RQ6A 1NJWA 4DSEA 3PX4A 4C8KA 1H38A 4O3OA 4I29A 3AUOA 8ICGA 3SV3A 2DPIA 2FMQA 2KZZA 9ICKA 3PW0A 2XY6A 4MFFA 4YD1A 3MR5A 1L3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R64 A;  3MAB A;  5KG1 A;  1RYR A;  8ICF A;  5KG2 A;  4F8R A;  3MR6 A;  1KEJ A;  4QWE A;  4F50 A;  4JWM A;  2IMW P;  1ZQK A;  4DQQ A;  3N4M B;  4B9M A;  1X9M A;  5DLG A;  3MFI A;  4GXI A;  4PHP A;  4RQ4 A;  1JXL A;  2NRV A;  3PX6 A;  3RJJ A;  2C2R A;  2ISP A;  4J9K A;  9ICW A;  4GXJ A;  7ICI A;  2J6T A;  5EWF A;  4ED3 A;  1ZQL A;  3UXO A;  3RB4 A;  8ICU A;  2ZTC A;  3NTU A;  4EBD A;  4YMN A;  1V9P A;  1A77 A;  5CB1 A;  1L3U A;  4F5R A;  4Z6E A;  1KLN A;  4KLH A;  8ICZ A;  1B22 A;  3H4B A;  3IHQ B;  9ICA A;  4RPZ A;  4F2R A;  4TUP A;  3C2L A;  4XRH A;  5CJ7 A;  5J0Y A;  4F4W A;  4B9L A;  1ZQY A;  2BPC A;  1ZQW A;  1SZP A;  4KMU A;  2A1J B;  7ICP A;  2FPK A;  3JPN A;  5KG3 A;  3OSN A;  5KFY A;  4F93 B;  5KT3 A;  3RBE A;  5DQH A;  4F4K A;  4KLT A;  1D9D A;  4DWI A;  4PGX A;  3EZ5 A;  4DOB A;  2FLN A;  3UQ2 A;  9ICN A;  2PFN A;  3BQ0 A;  5HHH A;  1T8E A;  1BPZ A;  4K4I A;  1QSL A;  2HVH A;  4J9O A;  3RJF A;  1ZQJ A;  5DQG A;  4BXO B;  2V9W A;  3OSP A;  4QZA A;  4KLS A;  4EZ6 A;  2KFN A;  2IA6 A;  3H4D A;  2FLP A;  4QZ8 A;  1BVS A;  4Z6F A;  4I2E A;  1ZQF A;  1D8Y A;  5F9L A;  5DQI A;  4QWD A;  5KFL A;  3V6H A;  5DBB A;  4M47 A;  2ZTD A;  4PGQ A;  1S9F A;  3K4G A;  5DB6 A;  3B0X A;  4J9M A;  2C22 A;  1QTM A;  2PI4 A;  4J9Q A;  9ICQ A;  4R8U B;  2JEG A;  8ICQ A;  3Q8S B;  4K4G A;  7ICH A;  3RTV A;  2R8G A;  3KTQ A;  1IXR A;  2HHT A;  2PXI A;  4DO9 A;  3KHH A;  4PHE A;  4I2C A;  1JMS A;  3RJE A;  4ECU A;  4M04 A;  8ICY A;  8ICK A;  1JN3 A;  5KFT A;  5J2K A;  3BJY A;  8ICI A;  1JXE A;  5EWE A;  3H8S A;  4X5V A;  5HMM A;  4ED2 A;  1BPY A;  2JEJ A;  4UB4 A;  3MBY A;  8ICE A;  2AJQ A;  3M8R A;  3HP6 A;  4EBC A;  2BPF A;  5J2A A;  4ELV A;  8ICA A;  4UAW A;  4ECW A;  7ICF A;  3LK9 A;  4ECQ A;  1SL1 A;  2BCQ A;  2UVU A;  3G6X A;  1KTQ A;  3GFK B;  2R8I A;  4O9M A;  5J2D A;  4JV2 A;  7ICG A;  4YG2 A;  5KFJ A;  3RJK A;  1DGS A;  5J0S A;  3RR8 A;  4ELU A;  5J0U A;  4RQ0 A;  3GV8 B;  1TAU A;  4NLK A;  3H8W A;  5KFQ A;  3MDA A;  2NRW A;  1ZQD A;  4IR1 A;  2Y1I A;  3M9N B;  1U9L A;  2J6U A;  3MR2 A;  4DEZ A;  3GII A;  4LVS A;  4P4O A;  4HYK A;  2FMS A;  2W8L A;  3C2M A;  3ORY A;  5J0T A;  4RQ3 A;  4KN7 A;  4Q8F A;  4GXK A;  3C2K A;  3V7L A;  2LYH A;  3SV4 A;  3ZDD A;  5EWG A;  3KHL A;  2IBK A;  3RRG A;  5KG0 A;  2W9B B;  5KFU A;  4YR2 A;  2RDJ A;  4RT3 A;  4BWM A;  3M9O B;  5KFA A;  3GV5 B;  3LDA A;  1T3N A;  2HHW A;  4J9L A;  3G6V A;  3PV8 A;  1RZT A;  5KFR A;  4I2J A;  4J9R A;  2H5X A;  1U49 A;  5KFB A;  3ZDB A;  5DB9 A;  5J2C A;  2PFQ A;  2JZB B;  5KFS A;  3QZ8 A;  4F4X A;  2AGQ A;  5KT7 A;  1TVA A;  1TKD A;  1U45 A;  5KFD A;  4QZI A;  4RNN A;  3KHR A;  4DQS A;  1S0M A;  4YFK A;  4M0A A;  4M9G A;  2BQR A;  2DFL A;  4R63 A;  4B9N A;  4O5C A;  1ZQT A;  4KN4 A;  4QZC A;  1WCL A;  2AQ0 A;  4ED7 A;  3PVX A;  2GWS A;  3ZDA A;  4I2F A;  1MC8 A;  4KLE A;  9ICM A;  4IQT A;  5III A;  4TUS A;  4FBT A;  1ZQN A;  7ICO A;  1N56 A;  9ICT A;  4DOC A;  1BGX T;  5KT6 A;  3OHA A;  1XSN A;  4DF8 A;  2HVI A;  4DL4 A;  1A76 A;  5J2J A;  2BKE A;  4DQI A;  1K1S A;  1NJZ A;  4F91 B;  3JPT A;  4EYI B;  5BPC A;  4F5N A;  5KFG A;  8ICH A;  4IQV A;  4ED6 A;  5J2H A;  4F5O A;  3H40 A;  2BGW A;  4M6W B;  4Q45 A;  1NK5 A;  2VA3 A;  2KFZ A;  4XA5 A;  3OJS A;  3GIM A;  8ICX A;  4RNM A;  4C8M A;  4ECZ A;  5L1I A;  1NOM A;  2ZJA A;  4QZF A;  4DF4 A;  5DKW A;  3PX0 A;  3PO5 A;  4EZ9 A;  3C1Z A;  3GIL A;  4Z6D A;  1QSS A;  4YD2 A;  3V6J A;  2MAX A;  1RPL A;  4I2B A;  1JX4 A;  3RH5 A;  3M8S A;  1D9F A;  9ICC A;  7ICL A;  4RUA A;  4YXM A;  3LWL A;  1SKW A;  3Q8L A;  3GV7 B;  4GC7 A;  1XSL A;  4YVZ A;  3TQ1 A;  4DLE A;  4O3P A;  3HT3 A;  4YMO A;  4IR9 A;  1BPB A;  9ICU A;  1SL2 A;  3V7K A;  3HW8 A;  3GQC A;  3RH4 A;  1ZQB A;  3UQ0 A;  2C2D A;  2VA8 A;  3MR3 A;  4DFM A;  7ICK A;  7ICS A;  4RUC A;  5HP4 A;  5DGB A;  2NRT A;  3T3F A;  3PW7 A;  4MEY A;  2ZUB A;  5EOZ A;  7ICQ A;  3RB6 A;  1UT5 A;  3ZD9 A;  4I2H A;  4DFJ A;  5IIJ A;  4RQ2 A;  5KFO A;  3JPS A;  4JUZ A;  4ECX A;  2ISO A;  4NM1 A;  9ICH A;  2I1Q A;  4CCH A;  4J9S A;  4I2A A;  4MEX A;  1LB2 B;  1ZYQ A;  5KG6 A;  3LWM A;  1T7P A;  2BHN A;  3T5J A;  5KFZ A;  4RNO A;  2I9G A;  3C23 A;  3MGH A;  2HW3 A;  4FS2 A;  4ECY A;  4ECV A;  9ICR A;  4ECS A;  3ISB A;  2VA2 A;  1UA1 A;  2AQ4 A;  1S76 D;  5KFK A;  9ICS A;  1ZQU A;  4KIT B;  4BDP A;  5CWR A;  3Q8Q B;  2MUT B;  3THV A;  4M6W A;  1DOQ A;  5DG9 A;  3Q8K A;  3FDS A;  1Z3E B;  3MFH A;  4KLQ A;  3QE9 Y;  3B0Y A;  2AU0 A;  4M9N A;  1KRP A;  1RXW A;  4QZB A;  5KFP A;  1ZQP A;  3OGU A;  4JWN A;  3PR5 B;  1ZQX A;  4MFC A;  1KSP A;  4DSF A;  4UBB A;  4I2D A;  4F92 B;  4RZR A;  4YXJ A;  2ASJ A;  5HNK A;  4KLF A;  5CA7 A;  7ICV A;  4M9L A;  1D8L A;  1ZQA A;  4IRD A;  5DBC A;  4IRK A;  3SYZ A;  7ICN A;  3QZ7 A;  1NK9 A;  4J9P A;  3V6K A;  1CUK A;  3TI0 A;  1ZQC A;  1LV5 A;  1X9S A;  8ICP A;  1SL0 A;  5DB7 A;  2XCP A;  4QZE A;  3OJU A;  5DG7 A;  1XWL A;  3T5H A;  2MUT A;  1HUO A;  4C8L A;  5J0X A;  2FMP A;  3PNC A;  4DSL A;  2FPM A;  4C8O A;  8ICS A;  5DBA A;  1ZQZ A;  4I28 A;  4ECR A;  3EYZ A;  5L9X A;  4ECT A;  4RQ1 A;  4FS1 A;  2ASD A;  4KLI A;  1X2I A;  2XCA A;  5TZV A;  2F1J A;  4P2H A;  4I2G A;  1NK6 A;  3JPP A;  3EWA A;  4YP3 A;  1B43 A;  5IIL A;  2ALZ A;  4TUR A;  2KZM A;  3C21 A;  4PHA A;  1HJP A;  5KFN A;  2FPL A;  4O5K A;  3NGD A;  1BPD A;  1S0V A;  2BCS A;  3EPI A;  5J0O A;  9ICE A;  4UBC A;  8ICM A;  5DB8 A;  7ICT A;  4DL6 A;  3PO4 A;  4YR0 A;  5J0Q A;  4NY8 A;  5KG7 A;  2IHM A;  4F2S A;  2JEI A;  5DG8 A;  4LZD A;  1ZQM A;  5JUM A;  2R8J A;  4C8N A;  2XGP A;  1KFD A;  3ISC A;  4M2Y A;  7ICM A;  4GLX A;  5J0R A;  3RAQ A;  2ATL A;  1NK4 A;  4QWA A;  3AU6 A;  1Z00 B;  1L5U A;  2P66 A;  2M9N A;  4QW8 A;  3TAR A;  8ICV A;  8ICN A;  2JZB A;  2HHV A;  4TQS A;  4F4Z A;  3HPO A;  3GIK A;  3V7J A;  3Q8M A;  1ZJN A;  2PI5 A;  1C7Y A;  4O3R A;  5CHG A;  1TV9 A;  4EEY A;  4Q8E A;  4R66 A;  4YCX A;  2Q0Z X;  2JEF A;  1ARO P;  3TFR A;  1RXV A;  4DS4 A;  5CP2 A;  3T5L A;  1NJY A;  3SI8 A;  1TFR A;  3OHB A;  3TAN A;  2C2E A;  3C1Y A;  1ZQQ A;  5DDY A;  4J9N A;  9ICX A;  4NXZ A;  4YR3 A;  4I2I A;  4MFA A;  1JIH A;  3G6Y A;  2KZ3 A;  2XGQ A;  4DFP A;  3RJH A;  4JK1 A;  4KLG A;  3QEB Z;  5J0P A;  3JPO A;  4KLD A;  3UXN A;  4UAZ A;  3UPQ A;  1ZJM A;  1U47 A;  1S0N A;  2NRZ A;  3Q8P B;  9ICP A;  4XQ8 A;  3HWT A;  1WCN A;  4UB3 A;  4YN4 A;  3PY8 A;  8ICW A;  4YMM A;  4O5E A;  4DOA A;  3FYH A;  3H8J A;  5IIM A;  1L3T A;  5KTQ A;  4B9S A;  2RDI A;  4RU9 A;  3RB0 A;  4K4H A;  1ZQS A;  5J29 A;  4QZG A;  4MF8 A;  1KFS A;  3PW4 A;  2J6S A;  2BCV A;  4PGY A;  1BPX A;  4DS5 A;  2HHU A;  2BDP A;  5KG5 A;  4Z6C A;  3RAX A;  2BPG A;  1NKE A;  3TFS A;  1RYS A;  2W8K A;  5J2I A;  5KFC A;  4F4Y A;  4F5Q A;  5KT5 A;  8ICJ A;  1S77 D;  2ZJ5 A;  3JPR A;  2AGP A;  2BQU A;  2WTF A;  5KFV A;  2DPJ A;  4IQU A;  4RQ8 A;  2BCR A;  3RJI A;  3QEA Z;  1S10 A;  4DL3 A;  4EBE A;  5HML A;  4DL7 A;  2ZTE A;  8ICT A;  2R8H A;  4DQR A;  2HHQ A;  1ZQI A;  4KLJ A;  1X9W A;  3KHG A;  5KFW A;  5DGA A;  3MGI A;  4B9T A;  5IIK A;  5J2G A;  7ICU A;  4JV0 A;  3BQT A;  1MQ2 A;  3AU2 A;  4ELT A;  4ZH4 A;  1XO1 A;  5IIN A;  1K1Q A;  4O3S A;  3T5K A;  2P6U A;  3V72 A;  8ICL A;  9ICO A;  5D4B A;  1IM4 A;  1QLN A;  1CEZ A;  2F1I A;  1UA0 A;  4F3O A;  3N97 B;  4XUS A;  3PR4 A;  1ZET A;  3K75 D;  8ICR A;  2NRX A;  4O0I A;  5DLF A;  2BR0 A;  4DL5 A;  5J2E A;  5KFI A;  5J2B A;  2BCU A;  1MQ3 A;  4B9U A;  2UVV A;  1NK7 A;  3BQ2 A;  4JV1 A;  3SZ2 A;  1BPE A;  5C5J A;  9ICJ A;  2P6R A;  4GC6 A;  4BWJ A;  1ZQR A;  2A1J A;  2ZUC A;  4UB5 A;  4R65 A;  3BQ1 A;  4B9V A;  3PW5 A;  5J2F A;  2PFO A;  3E2E A;  4F5P A;  4KLM A;  3C5F A;  5L1K A;  4RPX A;  4PPX A;  4KLL A;  3RRH A;  9ICB A;  9ICL A;  3Q8R B;  2W9A A;  5KFH A;  3HX0 A;  1KFT A;  4QZD A;  3RR7 A;  4RQ7 A;  4ED8 A;  1TK8 A;  4KTQ A;  4O3Q A;  1UT8 A;  5KFF A;  2FLL A;  4LZG A;  4M9J A;  5KT4 A;  2R8K A;  1ZQV A;  3IM1 A;  4UB1 A;  1ZQH A;  1QSY A;  3RJG A;  3C5G A;  4E0D A;  5F9N A;  5KT2 A;  2V4Q A;  4I27 A;  4NLN A;  2XY5 A;  9ICV A;  4QWB A;  2XC9 A;  1U4B A;  4TQR A;  3MDC A;  2VAN A;  1COO A;  4ED1 A;  1TAQ A;  1NKB A;  4QZ9 A;  3PML A;  4DLG A;  4QZH A;  5BOL A;  1ZQO A;  1HUZ A;  3EPG A;  2IHN A;  3BDP A;  8ICC A;  1ZQG A;  5CR0 A;  4R8U A;  2W9C B;  2C28 A;  4FBU A;  3GIJ A;  1MSW D;  4DSI A;  1XC9 A;  4NLZ A;  3ZD8 A;  4EYH B;  4NLG A;  1XU4 A;  5L1L A;  2W9B A;  3H7I A;  3ZDE A;  1NKC A;  4KLO A;  2PFP A;  5HHI A;  4DSJ A;  5IIO A;  4UQG A;  4O3N A;  2XY7 A;  2KTQ A;  4TUQ A;  2XO7 A;  2KN7 A;  3RB3 A;  2V4R A;  1PZN A;  2AGO A;  4DL2 A;  4G3I A;  4RT2 A;  5J0W A;  4BGD A;  2ASL A;  1XS9 D;  4BXO A;  4Q43 A;  1SKS A;  3ETL A;  2UVW A;  8ICO A;  4UB2 A;  4QWC A;  2HHS A;  4RPY A;  4ED0 A;  3PW2 A;  4DSK A;  3ZDC A;  4YQW A;  4Q44 A;  1NJX A;  1Y88 A;  4IQW A;  8ICB A;  3ISD A;  2W9C A;  2ZUD A;  5KG4 A;  3M9M B;  1EXN A;  1S97 A;  9ICI A;  7ICR A;  3EW9 A;  4P4M A;  2BQ3 A;  2B21 A;  1T4G A;  1N48 A;  1TK5 A;  9ICF A;  5D49 A;  4PHD A;  4M9H A;  1NK8 A;  1ZQE A;  1U48 A;  1XSP A;  3GDX A;  4QW9 A;  1KDH A;  2OWO A;  4PH5 A;  5KFE A;  5DDM A;  1TK0 A;  4NM2 A;  4P4P A;  3RBD A;  7ICJ A;  2Y1J A;  3PMN A;  1SKR A;  1NK0 A;  2UVR A;  3TAQ A;  3JPQ A;  7ICE A;  3RH6 A;  4RQ5 A;  3TAP A;  4IRC A;  5KFM A;  5BOM A;  4UAY A;  4MF2 A;  2W9M A;  9ICG A;  4FO6 A;  1L3S A;  1Z00 A;  5KFX A;  2ZJ8 A;  4DFK A;  4DQP A;  5D46 A;  2HHX A;  1S0O A;  3UXP A;  4KLU A;  5L1J A;  2F1H A;  4RQ6 A;  1NJW A;  4DSE A;  3PX4 A;  4C8K A;  1H38 A;  4O3O A;  4I29 A;  3AUO A;  8ICG A;  3SV3 A;  2DPI A;  2FMQ A;  2KZZ A;  9ICK A;  3PW0 A;  2XY6 A;  4MFF A;  4YD1 A;  3MR5 A;  1L3V A; 
#chains in the Genus database with same CATH topology
 4R64 A;  3ALR A;  2GOL A;  3PZP A;  5KG2 A;  2KVC A;  5AKJ A;  3MR6 A;  4F50 A;  4WJ3 B;  2IMW P;  1ZQK A;  2E5S A;  1WWV A;  1IG6 A;  5DLG A;  2I5H A;  2FI1 A;  3PX6 A;  2C2R A;  9ICW A;  4GXJ A;  2J6T A;  1V9P A;  4F5R A;  8ICZ A;  4ACO A;  2FJ6 A;  5AKE A;  3H4B A;  7ICJ A;  4RPZ A;  2LMR A;  4F4W A;  5CJ7 A;  3TAD A;  4AP9 A;  4KMU A;  7ICP A;  3OSN A;  4P0P B;  4F93 B;  4F4K A;  5ALE A;  4PGX A;  4DOB A;  2AH5 A;  5ALI A;  3UM9 A;  5HHH A;  5ALO A;  4J9O A;  2KE7 A;  2DBY A;  4BXO B;  1S5L U;  3H4D A;  2IA6 A;  4QZ8 A;  4Z6F A;  3SAH A;  5ALG A;  2DKX A;  5F9L A;  4QWD A;  5KFL A;  1OUQ A;  2ZTD A;  5DB6 A;  2C22 A;  4J9Q A;  2E8P A;  1LKY A;  5ALF A;  3RTV A;  1YZ6 A;  5HR7 A;  3H8M A;  1IXR A;  4DO9 A;  3SQI A;  4PHE A;  4I2C A;  1JMS A;  8ICK A;  4Y2R A;  1JN3 A;  5KFT A;  5EWE A;  4X5V A;  4ED2 A;  4EBC A;  2BPF A;  3QUC A;  4ECQ A;  1SL1 A;  2UVU A;  3L4P A;  3RJK A;  1DGS A;  3RR8 A;  1TAU A;  1N5W A;  5ALS A;  1NNL A;  4UAV A;  5KFQ A;  5ALH A;  1U9L A;  2ESE A;  3CNH A;  4P4O A;  2W8L A;  1UPH A;  4UAS A;  5AKK A;  1Q46 A;  4RQ3 A;  2XVT A;  4C4S A;  5EWG A;  1WWU A;  2RDJ A;  3M9O B;  2HHW A;  1FFV A;  4J9L A;  3PV8 A;  5J2C A;  5KFS A;  4F4X A;  1S0M A;  2JRZ A;  4R63 A;  4O5C A;  5E79 U;  1PVP A;  3D6J A;  3LVW A;  4I2F A;  1MC8 A;  3OTQ A;  9ICT A;  3OHA A;  1FIQ A;  1XSN A;  2HVI A;  5AM3 A;  2WF9 A;  3JPT A;  4F5N A;  5KFG A;  2HBK A;  4XA5 A;  3OJS A;  3GIM A;  5AM2 A;  1NOM A;  2K4H A;  2ZJA A;  4EZ9 A;  2HBJ A;  3C1Z A;  3GIL A;  4Z6D A;  1QSS A;  2HMX A;  1RPL A;  3UMB A;  3M8S A;  3N7R C;  1XSL A;  4DLE A;  2F2A B;  4O3P A;  1BPB A;  9ICU A;  3KZX A;  2MU2 A;  3GQC A;  1ZQB A;  4DFM A;  2ES6 A;  7ICS A;  3T3F A;  4C80 A;  3H0M B;  4UB8 U;  7ICQ A;  3JPS A;  4ECX A;  1J2M A;  4NM1 A;  9ICH A;  2DWQ A;  4J9S A;  1T7P A;  2BZF A;  3SEI A;  3T5J A;  2DUY A;  4ECY A;  3WKA A;  1UA1 A;  3ONN A;  2AQ4 A;  1ZQU A;  4Y2P A;  4KIT B;  3THV A;  2VKQ A;  2W54 A;  3AMZ A;  3MFH A;  1WUD A;  2NV3 A;  3B0Y A;  2AU0 A;  1KRP A;  2L5Y A;  2K89 A;  5T14 A;  3A0B U;  2KNJ A;  3WK9 A;  1ZQP A;  3OGU A;  3WK4 A;  4I2D A;  2B6G A;  1UHU A;  1D8L A;  2O6K A;  4IRK A;  2YY6 A;  3SYZ A;  3V6K A;  2KSO A;  1ZQC A;  2HBL A;  5DB7 A;  2RQ5 A;  3M1Y A;  5A0L A;  1Z1V A;  5C0Y A;  4DSL A;  8ICS A;  1V97 A;  4ECR A;  3EYZ A;  2MSN A;  5EE0 A;  2W03 A;  3JPP A;  3EWA A;  1B43 A;  4PHA A;  5KFN A;  2FPL A;  2BCS A;  3EPI A;  1TAM A;  4UBC A;  3I28 A;  5DB8 A;  2D8C A;  2QAR B;  4YR0 A;  1KQQ A;  4NY8 A;  5KG7 A;  1ZQM A;  4LZD A;  2OYY A;  4C8N A;  2H3F A;  1NK4 A;  1RQN A;  1URJ A;  1L5U A;  8ICN A;  2M9N A;  4QW8 A;  2OEH A;  1X66 A;  2JZB A;  3GIK A;  1ZJN A;  1C7Y A;  4Q8E A;  5EE3 A;  3TFR A;  2E1E A;  5ALR A;  1J97 A;  1SV4 A;  1V38 A;  3J81 j;  4J9N A;  9ICX A;  5ALK A;  4YR3 A;  4I2I A;  2KSO B;  3IP4 B;  2KZ3 A;  4CF5 A;  3UXN A;  4UAZ A;  3UPQ A;  2NRZ A;  9ICP A;  3QX7 A;  2K60 A;  2EDU A;  2HCF A;  2BDP A;  5KG5 A;  1HEK A;  4Z6C A;  3RAX A;  1NKE A;  3F2C A;  3NS1 A;  1X40 A;  2Y0S F;  2BQU A;  5KFV A;  2DPJ A;  5ALL A;  3QEA Z;  4EBE A;  3MGI A;  4B9T A;  5J2G A;  3QUQ A;  4ELT A;  4ZH4 A;  3T5K A;  3V72 A;  4ZOH C;  2EAN A;  4OJO A;  3IG8 A;  1ZET A;  3K75 D;  8ICR A;  1JI7 A;  5J2E A;  5KFI A;  2D6F C;  5AK5 A;  3BQ2 A;  3IG5 A;  3DV9 A;  2P6R A;  1DRG A;  5AIC A;  2KOB A;  2EAP A;  4UB5 A;  3E2E A;  5J2F A;  4F5P A;  1FFU A;  4IS7 A;  2KG5 A;  3HIL A;  1N63 A;  3RRH A;  9ICL A;  2K8B B;  3Q8R B;  4OJL A;  2ODG A;  5KFF A;  2FLL A;  2WF7 A;  4UB1 A;  2R8G A;  1OW5 A;  2QB0 B;  4TQR A;  4ED1 A;  2VAN A;  1U4B A;  3PSP A;  5BOL A;  2KJ8 A;  2RP5 A;  1ZQG A;  1YZ7 A;  4R8U A;  4FBU A;  1VLB A;  1XC9 A;  2Q4T A;  3CW2 C;  2KD1 A;  3H7I A;  2KTQ A;  2XY7 A;  4TUQ A;  2H3Q A;  3EUB 2;  4DFD A;  3M6Z A;  2XO7 A;  2V4R A;  1PZN A;  2AGO A;  4G3I A;  3N7S C;  5ALY A;  5J0W A;  4BGD A;  4Q43 A;  3QU2 A;  5ALU A;  3N7P D;  4ED0 A;  4JB3 A;  1JRP A;  4NLC A;  1S97 A;  3NVV A;  1T4G A;  3PSI A;  4PHD A;  5ALV A;  1D8B A;  1KDH A;  5KFE A;  3U26 A;  3I1Y A;  5J8Y C;  2CRX A;  4FO6 A;  4MHV A;  5KFX A;  3ICX A;  2JMG A;  1X6J A;  2DL0 A;  3PST A;  2Y9T A;  4DSE A;  3PX4 A;  4O3O A;  4I29 A;  3SV3 A;  2DPI A;  2KZZ A;  3PW0 A;  2XY6 A;  4I2A A;  1L3V A;  2HBM A;  1RG6 A;  2DF4 B;  3N4M B;  1X9M A;  2FDR A;  4C7Y A;  1SV0 A;  3UXO A;  4EEL A;  1KLN A;  3IHQ B;  3O0F A;  3C2L A;  4B9L A;  1ZQY A;  2ZIX A;  4UAR A;  5AIA A;  1ZD2 P;  1ZQW A;  1SB3 C;  5KT3 A;  3RBE A;  3EZ5 A;  3UQ2 A;  2WF8 A;  4QIW C;  2G06 A;  2YMP A;  3QUT A;  3OSP A;  4GFJ A;  4QZA A;  2KFN A;  2FLP A;  4CNQ A;  2ZXH A;  1BVS A;  2NYV A;  4I2E A;  5DQI A;  3V6H A;  3K4G A;  2JEG A;  8ICQ A;  3KFU F;  5AKX A;  4P0P A;  2PXI A;  3RJE A;  8ICI A;  4NL9 C;  5J2K A;  3H8S A;  5AI6 A;  3SAG A;  1BPY A;  2XI9 A;  3HP6 A;  4ELV A;  5J2A A;  2KEY A;  3LK9 A;  1N2X A;  5K4L A;  5J2D A;  3IRU A;  4B6J A;  2E8M A;  3H8W A;  1RYU A;  3MDA A;  2DQN B;  2Y1I A;  5ALZ A;  2ZG6 A;  3MR2 A;  3GII A;  4HYK A;  3C2M A;  3ORY A;  4Q8F A;  2CN1 A;  4GXK A;  4RQM A;  5KAF U;  5ALT A;  3FC4 A;  5JTI A;  3KBB A;  3RRG A;  2W9B B;  5B66 U;  4YR2 A;  4BWM A;  5KFA A;  3GV5 B;  3G6V A;  5KFR A;  4J9R A;  2H5X A;  1U49 A;  2JZB B;  3QZ8 A;  1TKD A;  4QZI A;  3KHR A;  4M0A A;  5ALM A;  2DFL A;  3WKE A;  4B9N A;  1ZQT A;  4KN4 A;  4QZC A;  2AQ0 A;  3M7D A;  2GWS A;  5III A;  3IDW A;  7ICO A;  2WB1 F;  5KT6 A;  2BKE A;  1N60 A;  1NJZ A;  4F91 B;  1SWV A;  3H40 A;  4Q45 A;  2KFZ A;  3UMC A;  3NVW A;  4RNM A;  5L1I A;  4BX9 C;  3PX0 A;  5DKW A;  3WKB A;  4Y2S A;  3RH5 A;  7ICL A;  1SKW A;  4GC7 A;  4IR9 A;  3HT3 A;  4YMO A;  1SL2 A;  4Y2Q A;  3UQ0 A;  1KN5 A;  4RUC A;  1IIP A;  2NRT A;  2F8K A;  2ZUB A;  5EOZ A;  2HOI A;  1UT5 A;  3ZD9 A;  3CP8 A;  2ZIU B;  5KFO A;  3F2D A;  2I1Q A;  3LWM A;  2BHN A;  3C23 A;  2G0A A;  2KKV A;  2WF6 A;  2VJ4 A;  4NLB A;  5KFK A;  1PK1 B;  3Q8Q B;  2MUT B;  2G5I B;  3Q8K A;  3FDS A;  3QE9 Y;  3OPX A;  4M9N A;  1SWW A;  1RXW A;  5KFP A;  1WYG A;  1KSP A;  1JAL A;  7ICV A;  4M9L A;  5H2F U;  4PZO A;  5DBC A;  1A6S A;  2LYB A;  1LV5 A;  1A0P A;  8ICP A;  1QH9 A;  4QZE A;  3OJU A;  5DG7 A;  3T5H A;  1AQ6 A;  4C8L A;  2FPM A;  2HOF A;  1ZQZ A;  4I28 A;  3AM9 A;  1PVQ A;  1PK1 A;  4ECT A;  3WK8 A;  4EX7 A;  4FS1 A;  4P0Q B;  4KLI A;  1QQ5 A;  4PZN A;  1NK6 A;  4YP3 A;  4NJ8 A;  5IIL A;  4TUR A;  2JGA A;  9ICE A;  4KMO B;  4EX6 A;  5J0O A;  5ALP A;  3NUQ A;  5HR6 A;  3PO4 A;  5J0Q A;  2NO4 A;  4BJQ A;  5JUM A;  1ZQ1 C;  4M2Y A;  1XNS A;  4GLX A;  3RAQ A;  2ATL A;  8ICV A;  3TAR A;  2GLE A;  4TQS A;  4F4Z A;  2PI5 A;  5CHG A;  1TV9 A;  2K8A A;  4YCX A;  4R66 A;  5ALJ A;  2ZXI A;  1JIH A;  3E58 A;  2QLT A;  2G5H B;  1ZJM A;  1S0N A;  4YN4 A;  8ICW A;  4YMM A;  4O5E A;  4DOA A;  4B9S A;  2RDI A;  2IOF A;  3RB0 A;  2YB1 A;  1ZQS A;  4K4H A;  5J29 A;  2J6S A;  4PGY A;  2HHU A;  2BPG A;  3E0F A;  1RYS A;  1L7N A;  4CGZ A;  1S77 D;  4A8E A;  2RRD A;  3JPR A;  1O03 A;  4IQU A;  1PUZ A;  3RJI A;  2BCR A;  1S10 A;  1O08 A;  2ZTE A;  3F53 A;  2HSZ A;  4DQR A;  3WKC A;  3KHG A;  2GH1 A;  2KKP A;  4JV0 A;  1SIJ A;  1K1Q A;  4O3S A;  2P6U A;  8ICL A;  4QJF B;  1HIW A;  1CEZ A;  2HOQ A;  2F1I A;  1UA0 A;  2JH1 A;  4F3O A;  4OD0 A;  2ZIW A;  4XUS A;  3PR4 A;  2WAQ C;  1P7D A;  2WF5 A;  5J2B A;  2UVV A;  2F3N A;  3IN5 A;  2E8O A;  4JV1 A;  1BPE A;  4C7Z A;  4GC6 A;  1ZQR A;  1BNP A;  3PW5 A;  2PFO A;  4KLM A;  5L1K A;  4PPX A;  2W9A A;  3NAS A;  1F5S A;  2EAM A;  1TK8 A;  2A19 A;  5KT4 A;  4E0D A;  3KOO A;  2HI0 A;  4FFD A;  1COO A;  3MDC A;  5AM0 A;  4NLZ A;  1NKC A;  5HHI A;  4DSJ A;  4UQG A;  1Q8K A;  5AM1 A;  1KKX A;  1LVH A;  4BXO A;  3WK7 A;  2UVW A;  4UB2 A;  3NVY A;  5FP0 A;  1ED1 A;  4DSK A;  3ZDC A;  4YQW A;  2KIW A;  5GTI U;  3ISD A;  8ICB A;  1EXN A;  9ICI A;  2G07 A;  1X6I A;  2E1F A;  3RBD A;  2KP7 A;  2Y1J A;  3JPQ A;  2BDU A;  3AN1 A;  4HAI A;  5CEH A;  2OM6 A;  3BZC A;  4OJP A;  2W9M A;  3D2Q A;  5AI4 A;  4UAT A;  2H3I A;  1S0O A;  1F44 A;  2CXY A;  3PSF A;  3QU4 A;  1WG8 A;  3AUO A;  5AI9 A;  1SXE A;  5AKG A;  3MR5 A;  1RYR A;  3MAB A;  4F8R A;  2LBO A;  2H3V A;  1MA7 A;  3QU5 A;  3MFI A;  4GXI A;  4PHP A;  4RQ4 A;  1JXL A;  2NRV A;  2W43 A;  2AXT U;  3RJJ A;  2ISP A;  4J9K A;  7ICI A;  5EWF A;  4ED3 A;  1ZQL A;  8ICU A;  3NTU A;  4EBD A;  3CRX A;  1L3U A;  4Z6E A;  9ICA A;  4TUP A;  4XRH A;  2PMZ F;  1L7M A;  1MN8 A;  4GIB A;  3RFA A;  5JRT A;  2W7O A;  2BPC A;  1SZP A;  2A1J B;  2FPK A;  5KL8 B;  1SZH A;  1ZD5 A;  5KFY A;  3BQ0 A;  5AKL A;  5CRX A;  4K4I A;  1QSL A;  2MRL A;  2HVH A;  3RJF A;  2N1R A;  4FE3 A;  1ZQJ A;  1UCV A;  4KLS A;  4KX3 A;  1KL9 A;  4M47 A;  4AYB F;  1S9F A;  2PI4 A;  1QTM A;  2ZIV A;  3Q8S B;  4K4G A;  2WFA A;  3M6K A;  4J03 A;  2VIX A;  3KHH A;  2F76 X;  4M04 A;  8ICY A;  4ECU A;  3BJY A;  1ZD4 A;  4UB4 A;  3NRZ A;  2AJQ A;  3M8R A;  4JMU A;  4DCC A;  2KMD A;  4UAW A;  7ICF A;  2A1A A;  2BCQ A;  4CDG A;  3FAH A;  1KTQ A;  3GFK B;  4O9M A;  4JV2 A;  4YG2 A;  2KHQ A;  5AKI A;  5J0S A;  3GV8 B;  2NRW A;  5ALD A;  3ED5 A;  1J2N A;  2J6U A;  2FMS A;  5J0T A;  2LYH A;  5KFU A;  2LYA A;  4RT3 A;  3LDA A;  2AHO B;  3F5A A;  4I2J A;  5KFB A;  2PFQ A;  2OHF A;  5KT7 A;  4RNN A;  2QB0 A;  2W7P A;  3PVX A;  1L6N A;  1WCL A;  4KLE A;  5L1M A;  3ZDA A;  2F77 X;  4NL9 A;  9ICM A;  2LM1 A;  2KK0 A;  4IQT A;  4TUS A;  4FBT A;  1ZQN A;  1N56 A;  4DOC A;  1BGX T;  4PL1 A;  4DF8 A;  1A76 A;  2YML A;  1K1S A;  2W04 A;  4ED6 A;  4M6W B;  5AI5 A;  8ICX A;  4ECZ A;  4CF3 A;  2YB4 A;  4QZF A;  4AYB C;  1CRX A;  4YD2 A;  3V6J A;  9ICC A;  3L3F X;  4RUA A;  4YXM A;  3Q8L A;  3TQ1 A;  4BUG A;  4P2H A;  3V7K A;  3RH4 A;  2VA8 A;  3MR3 A;  1X42 A;  5HP4 A;  2WB1 C;  5DGB A;  4OJ6 A;  3H0L B;  4DFJ A;  5IIJ A;  4IC9 A;  1QCK A;  4CCH A;  3K1Z A;  5KG6 A;  2KHV A;  3WK6 A;  3MGH A;  2HW3 A;  1T3Q A;  4ECV A;  9ICR A;  4ECS A;  3AL0 B;  1S76 D;  9ICS A;  2KVS A;  4BDP A;  4Y2J A;  5CWR A;  4M6W A;  2JXJ A;  1Z3E B;  4KLQ A;  2YN4 A;  4QZB A;  2F44 A;  4JWN A;  5ALX A;  3PR5 B;  2W3R A;  4MFC A;  4DSF A;  4RZR A;  5HNK A;  2NO5 A;  4IRD A;  7ICN A;  2LI6 A;  1NK9 A;  2HDO A;  2RHF A;  1X9S A;  1SL0 A;  2XCP A;  2DKZ A;  4Y2T A;  2MUT A;  1HUO A;  2FMP A;  3PNC A;  4C8O A;  5DBA A;  2W55 A;  5L9X A;  2F8L A;  2ASD A;  4KX5 A;  2KV2 A;  2YTU A;  5AKY A;  1Z1B A;  1KW4 A;  1X2I A;  4Y2V A;  5TZV A;  2F1J A;  2KZM A;  3C21 A;  4O5K A;  1S0V A;  3AQE A;  1C20 A;  3WK5 A;  7ICT A;  3BS5 B;  2IHM A;  4F2S A;  2JEI A;  2R8J A;  1KFD A;  5J0R A;  4QIW F;  4QWA A;  5AK4 A;  1Z00 B;  4LJX A;  3H0R B;  5J8Y A;  4EEY A;  2Q0Z X;  4CF4 A;  1ARO P;  1Z19 A;  1RXV A;  1NJY A;  3T5L A;  1TFR A;  3OHB A;  3UMG A;  2C2E A;  4NXZ A;  3RJH A;  4JK1 A;  3QEB Z;  5J0P A;  1U47 A;  2M0N A;  3F2B A;  3Q8P B;  4XQ8 A;  3L5K A;  3HWT A;  4UB3 A;  3QNM A;  3FYH A;  5IIM A;  5AM4 A;  5KTQ A;  1L3T A;  4RU9 A;  2BCV A;  1K5O A;  1ZRN A;  3WU2 U;  4FZL A;  4F4Y A;  1GO3 F;  5J2I A;  3SAF A;  2EZY A;  8ICJ A;  2AGP A;  2LKY A;  4RQ8 A;  1L7P A;  4DL3 A;  5KNI A;  4DL7 A;  8ICT A;  2HHQ A;  1N5X A;  1ZQI A;  4KLJ A;  1X9W A;  3NRW A;  5IIK A;  7ICU A;  3TKA A;  1B0X A;  3BQT A;  5F3X B;  5KL1 B;  1XO1 A;  3GU3 A;  2RLT A;  2MA1 A;  5TIS U;  3HKZ C;  1QLN A;  2KJ5 A;  2NRX A;  2BR0 A;  1MQ3 A;  4B9U A;  1NK7 A;  4UAU A;  5C5J A;  4BWJ A;  2ZUC A;  5G5G A;  3C5F A;  4RPX A;  9ICB A;  1Q3U A;  1Q3V A;  5AKZ A;  3HX0 A;  2ZIW B;  4QZD A;  4NV0 A;  4KTQ A;  4O3Q A;  4LZG A;  4US9 A;  3RJG A;  3C5G A;  5KT2 A;  4I27 A;  2V4Q A;  2XC9 A;  1DK3 A;  3PML A;  4DLG A;  4QZH A;  1ZQO A;  1HUZ A;  2IHN A;  3BDP A;  8ICC A;  5ALN A;  1Z4N A;  2ZIX B;  5CR0 A;  2W9C B;  2C28 A;  4DSI A;  3ZD8 A;  4EYH B;  1XU4 A;  5L1L A;  3ZDE A;  2PFP A;  4O3N A;  2KN7 A;  3RB3 A;  4CE6 A;  1XS9 D;  4FZN A;  5B5E U;  2DGZ A;  3ETL A;  2PKE A;  4RPY A;  1ZOL A;  3PW2 A;  4P0Q A;  3N28 A;  4Q44 A;  1NJX A;  1Y88 A;  1RM6 C;  5KG4 A;  3M9M B;  7ICR A;  3SEN A;  4P4M A;  2BQ3 A;  2B21 A;  1N48 A;  5D49 A;  1ZQE A;  4EEK A;  3GDX A;  2KJ9 A;  2OWO A;  1TK0 A;  4P4P A;  3KKA C;  5JU5 A;  1SKR A;  3TAQ A;  7ICE A;  4RQN A;  2IOH A;  1ZXI A;  2G09 A;  4IRC A;  4UAY A;  1L3S A;  2EZX A;  2OCE A;  2ZJ8 A;  4DFK A;  4DQP A;  5ALQ A;  3UXP A;  3LVV A;  1VDV A;  5L1J A;  2F1H A;  2K8C B;  1SGG A;  4FZM A;  4C8K A;  1H38 A;  2KIC A;  9ICK A;  3SMV A;  4MFF A;  4YD1 A;  1SV0 C;  5KG1 A;  8ICF A;  2E8N A;  1XO0 A;  1KEJ A;  4QWE A;  1DK2 A;  4JWM A;  2JH7 A;  4DQQ A;  4B9M A;  2I6X A;  3DEE A;  2A3V A;  3KD3 A;  3RB4 A;  2ZTC A;  4YMN A;  1A77 A;  5CB1 A;  4KLH A;  5EE9 A;  1B22 A;  5AI0 A;  4F2R A;  5J0Y A;  2LM4 A;  2QB1 A;  2R18 A;  5KG3 A;  3JPN A;  5DQH A;  4KLT A;  1D9D A;  4DWI A;  2FLN A;  1LKY B;  9ICN A;  2PFN A;  1T8E A;  1BPZ A;  1FEZ A;  2YMQ A;  5DQG A;  1B4F A;  2V9W A;  4EZ6 A;  3LYS A;  2EZZ A;  1ZQF A;  1D8Y A;  2YMM A;  5DBB A;  4PGQ A;  4C0Z A;  3B0X A;  4J9M A;  9ICQ A;  4R8U B;  7ICH A;  3B9J A;  2EAO A;  3KTQ A;  2HHT A;  2ZIU A;  4OJ5 A;  1RDF A;  1BNO A;  1JXE A;  5HMM A;  2JEJ A;  3MBY A;  8ICE A;  8ICA A;  1VJ5 A;  4ECW A;  3G6X A;  2R8I A;  7ICG A;  5KFJ A;  1RQL A;  2K4P A;  4ELU A;  3R9K A;  5J0U A;  4RQ0 A;  4NLK A;  1L8L A;  1T94 A;  1ZQD A;  4IR1 A;  3M9N B;  4DEZ A;  4LVS A;  1OXJ A;  4KN7 A;  2QKQ A;  3C2K A;  3MC1 A;  3V7L A;  3SV4 A;  3ZDD A;  1IV8 A;  2EQY A;  1TE2 A;  3KHL A;  2IBK A;  2OH2 A;  5KG0 A;  2H3Z A;  4Y2X A;  1T3N A;  1RZT A;  3ZDB A;  5DB9 A;  1TVA A;  4PL2 A;  3C29 A;  2AGQ A;  1U45 A;  5KFD A;  4DQS A;  4YFK A;  4M9G A;  2BQR A;  4G9B A;  3I76 A;  4ED7 A;  5AIB A;  1FO4 A;  1N62 A;  4DL4 A;  5KAI U;  2KIV A;  5J2J A;  4DQI A;  4EYI B;  8ICH A;  5BPC A;  4IQV A;  5J2H A;  4F5O A;  1S8O A;  2BGW A;  1NK5 A;  2VA3 A;  2IOF K;  4C8M A;  3PO5 A;  4DF4 A;  4ICA A;  3F5E A;  2MAX A;  3TAC B;  4I2B A;  1JX4 A;  1D9F A;  1L8O A;  3D2N A;  3LWL A;  3GV7 B;  4YVZ A;  3NVZ A;  3HW8 A;  2C2D A;  7ICK A;  1N61 A;  3PW7 A;  4MEY A;  2XIC A;  3RB6 A;  4I2H A;  2ISO A;  4RQ2 A;  4JUZ A;  1X9X A;  1NI3 A;  4MEX A;  3QU7 A;  1ZYQ A;  1LB2 B;  5KFZ A;  4RNO A;  2I9G A;  4FS2 A;  2VA2 A;  3ISB A;  4Y2U A;  1DOQ A;  5DG9 A;  3KKA A;  1F0M A;  3HKZ F;  1ZQX A;  2E3T A;  3S6J A;  4CRX A;  4UBB A;  4F92 B;  4YXJ A;  2ASJ A;  4USA A;  4KLF A;  5CA7 A;  1ZQA A;  3VC8 A;  5AK3 A;  3QZ7 A;  4J9P A;  2XID A;  4U6P A;  2WAQ F;  1CUK A;  5ALW A;  3TI0 A;  2LPE A;  3MGV A;  2QAR A;  4QNL A;  3FM9 A;  1XWL A;  2EH9 A;  2Z7J A;  5J0X A;  3SR6 A;  5AK6 A;  3BZK A;  4RQ1 A;  1KBU A;  2LHT A;  2D3D A;  1ECW A;  2XCA A;  4I2G A;  2ALZ A;  1HJP A;  1L7O A;  3NGD A;  1BPD A;  2FE9 A;  2WHE A;  8ICM A;  4DL6 A;  3BQ7 A;  5DG8 A;  2XGP A;  2GO7 A;  3ISC A;  7ICM A;  1SXD A;  3AU6 A;  2P66 A;  5AHX A;  2HHV A;  3HPO A;  1NZP A;  3V7J A;  3Q8M A;  4O3R A;  2PMZ C;  2JEF A;  1JUD A;  4DS4 A;  1M6Y A;  2YX8 A;  5CP2 A;  5AM5 A;  3SI8 A;  3TAN A;  1ZQQ A;  3C1Y A;  4EEN A;  5DDY A;  3BS5 A;  4MFA A;  2JR5 A;  3AQF A;  3D2S A;  3G6Y A;  4KLG A;  4DFP A;  2XGQ A;  2K4I A;  1COK A;  3JPO A;  4KLD A;  3ZI4 A;  3QU9 A;  1WCN A;  3PY8 A;  3GZF A;  3H8J A;  4UB6 U;  4QZG A;  4MF8 A;  1KFS A;  3PW4 A;  3BS7 A;  1BPX A;  4DS5 A;  4U7C A;  3TFS A;  2JV3 A;  2W8K A;  5KFC A;  1DGJ A;  4F5Q A;  5KT5 A;  2ZJ5 A;  5G5H A;  2WTF A;  2VJ5 A;  1CI4 A;  2P35 A;  4F72 A;  4Y2Y A;  5HML A;  2K4E A;  2R8H A;  5DGA A;  5KFW A;  3T79 A;  1MQ2 A;  3AU2 A;  5IIN A;  2OXO A;  9ICO A;  5D4B A;  1IM4 A;  3HRD D;  2CPR A;  3N97 B;  3VCB A;  2Y9U A;  4F71 A;  4C4T A;  5DLF A;  4O0I A;  4DL5 A;  4OCZ A;  2BCU A;  4O3M A;  3SZ2 A;  9ICJ A;  1V85 A;  1PK3 A;  2A1J A;  3BQ1 A;  4R65 A;  4B9V A;  5AI8 A;  3IV6 A;  4UW9 A;  1ZRM A;  1DXS A;  4KLL A;  2Y0S C;  4US8 A;  3TAD C;  5KFH A;  1Z4O A;  3SD7 A;  1KFT A;  3RR7 A;  4RQ7 A;  1JRO A;  3ETR A;  4NWI A;  4ED8 A;  1UT8 A;  1PVR A;  4M9J A;  1QQ6 A;  2R8K A;  1ZQV A;  3IM1 A;  1ZQH A;  1QSY A;  9ICV A;  5F9N A;  4NLN A;  2XY5 A;  4QWB A;  1NKB A;  1TAQ A;  5AKH A;  4QZ9 A;  3EPG A;  3GIJ A;  1MSW D;  2ZIV B;  4NLG A;  1UQV A;  2W9B A;  4KLO A;  5IIO A;  4PJ0 U;  4DL2 A;  5GTH U;  4RT2 A;  2ASL A;  3QUB A;  1SKS A;  8ICO A;  3DDH A;  4QWC A;  4OO1 J;  2HHS A;  4IL6 U;  3QXG A;  4C4R A;  4IQW A;  2W9C A;  2JHD A;  2ZUD A;  1ZD3 A;  3HJE A;  3EW9 A;  1TK5 A;  9ICF A;  4M9H A;  1NK8 A;  1U48 A;  1XSP A;  4QW9 A;  4PH5 A;  5DDM A;  3RF9 A;  3C28 A;  2W11 A;  2G08 A;  4NM2 A;  2B0C A;  3PMN A;  1NK0 A;  2UVR A;  1QQ7 A;  3RH6 A;  4RQ5 A;  3TAP A;  5KFM A;  5BOM A;  4MF2 A;  3A0H U;  9ICG A;  2W3S A;  3KZI U;  1NZB A;  1Z00 A;  3AEV A;  3K1R B;  5D46 A;  2HHX A;  1YT3 A;  4KLU A;  3CYM A;  1NJW A;  4RQ6 A;  2YQE A;  3WKD A;  8ICG A;  2FMQ A;  3QYP A;  5EE1 A; 
#chains in the Genus database with same CATH homology
 4R64 A;  3MAB A;  5KG1 A;  1RYR A;  8ICF A;  5KG2 A;  4F8R A;  3MR6 A;  1KEJ A;  4QWE A;  4F50 A;  4JWM A;  2IMW P;  1ZQK A;  4DQQ A;  3N4M B;  4B9M A;  1X9M A;  5DLG A;  3MFI A;  4GXI A;  4PHP A;  4RQ4 A;  1JXL A;  2NRV A;  3PX6 A;  3RJJ A;  2C2R A;  2ISP A;  4J9K A;  9ICW A;  4GXJ A;  7ICI A;  2J6T A;  5EWF A;  4ED3 A;  1ZQL A;  3UXO A;  3RB4 A;  8ICU A;  2ZTC A;  3NTU A;  4EBD A;  4YMN A;  1V9P A;  1A77 A;  5CB1 A;  1L3U A;  4F5R A;  4Z6E A;  1KLN A;  4KLH A;  8ICZ A;  1B22 A;  3H4B A;  3IHQ B;  9ICA A;  4RPZ A;  4F2R A;  4TUP A;  3C2L A;  4XRH A;  5CJ7 A;  5J0Y A;  4F4W A;  4B9L A;  1ZQY A;  2BPC A;  1ZQW A;  1SZP A;  4KMU A;  2A1J B;  7ICP A;  2FPK A;  3JPN A;  5KG3 A;  3OSN A;  5KFY A;  4F93 B;  5KT3 A;  3RBE A;  5DQH A;  4F4K A;  4KLT A;  1D9D A;  4DWI A;  4PGX A;  3EZ5 A;  4DOB A;  2FLN A;  3UQ2 A;  9ICN A;  2PFN A;  3BQ0 A;  5HHH A;  1T8E A;  1BPZ A;  4K4I A;  1QSL A;  2HVH A;  4J9O A;  3RJF A;  1ZQJ A;  5DQG A;  4BXO B;  2V9W A;  3OSP A;  4QZA A;  4KLS A;  4EZ6 A;  2KFN A;  2IA6 A;  3H4D A;  2FLP A;  4QZ8 A;  1BVS A;  4Z6F A;  4I2E A;  1ZQF A;  1D8Y A;  5F9L A;  5DQI A;  4QWD A;  5KFL A;  3V6H A;  5DBB A;  4M47 A;  2ZTD A;  4PGQ A;  1S9F A;  3K4G A;  5DB6 A;  3B0X A;  4J9M A;  2C22 A;  1QTM A;  2PI4 A;  4J9Q A;  9ICQ A;  4R8U B;  2JEG A;  8ICQ A;  3Q8S B;  4K4G A;  7ICH A;  3RTV A;  2R8G A;  3KTQ A;  1IXR A;  2HHT A;  2PXI A;  4DO9 A;  3KHH A;  4PHE A;  4I2C A;  1JMS A;  3RJE A;  4ECU A;  4M04 A;  8ICY A;  8ICK A;  1JN3 A;  5KFT A;  5J2K A;  3BJY A;  8ICI A;  1JXE A;  5EWE A;  3H8S A;  4X5V A;  5HMM A;  4ED2 A;  1BPY A;  2JEJ A;  4UB4 A;  3MBY A;  8ICE A;  2AJQ A;  3M8R A;  3HP6 A;  4EBC A;  2BPF A;  5J2A A;  4ELV A;  8ICA A;  4UAW A;  4ECW A;  7ICF A;  3LK9 A;  4ECQ A;  1SL1 A;  2BCQ A;  2UVU A;  3G6X A;  1KTQ A;  3GFK B;  2R8I A;  4O9M A;  5J2D A;  4JV2 A;  7ICG A;  4YG2 A;  5KFJ A;  3RJK A;  1DGS A;  5J0S A;  3RR8 A;  4ELU A;  5J0U A;  4RQ0 A;  3GV8 B;  1TAU A;  4NLK A;  3H8W A;  5KFQ A;  3MDA A;  2NRW A;  1ZQD A;  4IR1 A;  2Y1I A;  3M9N B;  1U9L A;  2J6U A;  3MR2 A;  4DEZ A;  3GII A;  4LVS A;  4P4O A;  4HYK A;  2FMS A;  2W8L A;  3C2M A;  3ORY A;  5J0T A;  4RQ3 A;  4KN7 A;  4Q8F A;  4GXK A;  3C2K A;  3V7L A;  2LYH A;  3SV4 A;  3ZDD A;  5EWG A;  3KHL A;  2IBK A;  3RRG A;  5KG0 A;  2W9B B;  5KFU A;  4YR2 A;  2RDJ A;  4RT3 A;  4BWM A;  3M9O B;  5KFA A;  3GV5 B;  3LDA A;  1T3N A;  2HHW A;  4J9L A;  3G6V A;  3PV8 A;  1RZT A;  5KFR A;  4I2J A;  4J9R A;  2H5X A;  1U49 A;  5KFB A;  3ZDB A;  5DB9 A;  5J2C A;  2PFQ A;  2JZB B;  5KFS A;  3QZ8 A;  4F4X A;  2AGQ A;  5KT7 A;  1TVA A;  1TKD A;  1U45 A;  5KFD A;  4QZI A;  4RNN A;  3KHR A;  4DQS A;  1S0M A;  4YFK A;  4M0A A;  4M9G A;  2BQR A;  2DFL A;  4R63 A;  4B9N A;  4O5C A;  1ZQT A;  4KN4 A;  4QZC A;  1WCL A;  2AQ0 A;  4ED7 A;  3PVX A;  2GWS A;  3ZDA A;  4I2F A;  1MC8 A;  4KLE A;  9ICM A;  4IQT A;  5III A;  4TUS A;  4FBT A;  1ZQN A;  7ICO A;  1N56 A;  9ICT A;  4DOC A;  1BGX T;  5KT6 A;  3OHA A;  1XSN A;  4DF8 A;  2HVI A;  4DL4 A;  1A76 A;  5J2J A;  2BKE A;  4DQI A;  1K1S A;  1NJZ A;  4F91 B;  3JPT A;  4EYI B;  5BPC A;  4F5N A;  5KFG A;  8ICH A;  4IQV A;  4ED6 A;  5J2H A;  4F5O A;  3H40 A;  2BGW A;  4M6W B;  4Q45 A;  1NK5 A;  2VA3 A;  2KFZ A;  4XA5 A;  3OJS A;  3GIM A;  8ICX A;  4RNM A;  4C8M A;  4ECZ A;  5L1I A;  1NOM A;  2ZJA A;  4QZF A;  4DF4 A;  5DKW A;  3PX0 A;  3PO5 A;  4EZ9 A;  3C1Z A;  3GIL A;  4Z6D A;  1QSS A;  4YD2 A;  3V6J A;  2MAX A;  1RPL A;  4I2B A;  1JX4 A;  3RH5 A;  3M8S A;  1D9F A;  9ICC A;  7ICL A;  4RUA A;  4YXM A;  3LWL A;  1SKW A;  3Q8L A;  3GV7 B;  4GC7 A;  1XSL A;  4YVZ A;  3TQ1 A;  4DLE A;  4O3P A;  3HT3 A;  4YMO A;  4IR9 A;  1BPB A;  9ICU A;  1SL2 A;  3V7K A;  3HW8 A;  3GQC A;  3RH4 A;  1ZQB A;  3UQ0 A;  2C2D A;  2VA8 A;  3MR3 A;  4DFM A;  7ICK A;  7ICS A;  4RUC A;  5HP4 A;  5DGB A;  2NRT A;  3T3F A;  3PW7 A;  4MEY A;  2ZUB A;  5EOZ A;  7ICQ A;  3RB6 A;  1UT5 A;  3ZD9 A;  4I2H A;  4DFJ A;  5IIJ A;  4RQ2 A;  5KFO A;  3JPS A;  4JUZ A;  4ECX A;  2ISO A;  4NM1 A;  9ICH A;  2I1Q A;  4CCH A;  4J9S A;  4I2A A;  4MEX A;  1LB2 B;  1ZYQ A;  5KG6 A;  3LWM A;  1T7P A;  2BHN A;  3T5J A;  5KFZ A;  4RNO A;  2I9G A;  3C23 A;  3MGH A;  2HW3 A;  4FS2 A;  4ECY A;  4ECV A;  9ICR A;  4ECS A;  3ISB A;  2VA2 A;  1UA1 A;  2AQ4 A;  1S76 D;  5KFK A;  9ICS A;  1ZQU A;  4KIT B;  4BDP A;  5CWR A;  3Q8Q B;  2MUT B;  3THV A;  4M6W A;  1DOQ A;  5DG9 A;  3Q8K A;  3FDS A;  1Z3E B;  3MFH A;  4KLQ A;  3QE9 Y;  3B0Y A;  2AU0 A;  4M9N A;  1KRP A;  1RXW A;  4QZB A;  5KFP A;  1ZQP A;  3OGU A;  4JWN A;  3PR5 B;  1ZQX A;  4MFC A;  1KSP A;  4DSF A;  4UBB A;  4I2D A;  4F92 B;  4RZR A;  4YXJ A;  2ASJ A;  5HNK A;  4KLF A;  5CA7 A;  7ICV A;  4M9L A;  1D8L A;  1ZQA A;  4IRD A;  5DBC A;  4IRK A;  3SYZ A;  7ICN A;  3QZ7 A;  1NK9 A;  4J9P A;  3V6K A;  1CUK A;  3TI0 A;  1ZQC A;  1LV5 A;  1X9S A;  8ICP A;  1SL0 A;  5DB7 A;  2XCP A;  4QZE A;  3OJU A;  5DG7 A;  1XWL A;  3T5H A;  2MUT A;  1HUO A;  4C8L A;  5J0X A;  2FMP A;  3PNC A;  4DSL A;  2FPM A;  4C8O A;  8ICS A;  5DBA A;  1ZQZ A;  4I28 A;  4ECR A;  3EYZ A;  5L9X A;  4ECT A;  4RQ1 A;  4FS1 A;  2ASD A;  4KLI A;  1X2I A;  2XCA A;  5TZV A;  2F1J A;  4P2H A;  4I2G A;  1NK6 A;  3JPP A;  3EWA A;  4YP3 A;  1B43 A;  5IIL A;  2ALZ A;  4TUR A;  2KZM A;  3C21 A;  4PHA A;  1HJP A;  5KFN A;  2FPL A;  4O5K A;  3NGD A;  1BPD A;  1S0V A;  2BCS A;  3EPI A;  5J0O A;  9ICE A;  4UBC A;  8ICM A;  5DB8 A;  7ICT A;  4DL6 A;  3PO4 A;  4YR0 A;  5J0Q A;  4NY8 A;  5KG7 A;  2IHM A;  4F2S A;  2JEI A;  5DG8 A;  4LZD A;  1ZQM A;  5JUM A;  2R8J A;  4C8N A;  2XGP A;  1KFD A;  3ISC A;  4M2Y A;  7ICM A;  4GLX A;  5J0R A;  3RAQ A;  2ATL A;  1NK4 A;  4QWA A;  3AU6 A;  1Z00 B;  1L5U A;  2P66 A;  2M9N A;  4QW8 A;  3TAR A;  8ICV A;  8ICN A;  2JZB A;  2HHV A;  4TQS A;  4F4Z A;  3HPO A;  3GIK A;  3V7J A;  3Q8M A;  1ZJN A;  2PI5 A;  1C7Y A;  4O3R A;  5CHG A;  1TV9 A;  4EEY A;  4Q8E A;  4R66 A;  4YCX A;  2Q0Z X;  2JEF A;  1ARO P;  3TFR A;  1RXV A;  4DS4 A;  5CP2 A;  3T5L A;  1NJY A;  3SI8 A;  1TFR A;  3OHB A;  3TAN A;  2C2E A;  3C1Y A;  1ZQQ A;  5DDY A;  4J9N A;  9ICX A;  4NXZ A;  4YR3 A;  4I2I A;  4MFA A;  1JIH A;  3G6Y A;  2KZ3 A;  2XGQ A;  4DFP A;  3RJH A;  4JK1 A;  4KLG A;  3QEB Z;  5J0P A;  3JPO A;  4KLD A;  3UXN A;  4UAZ A;  3UPQ A;  1ZJM A;  1U47 A;  1S0N A;  2NRZ A;  3Q8P B;  9ICP A;  4XQ8 A;  3HWT A;  1WCN A;  4UB3 A;  4YN4 A;  3PY8 A;  8ICW A;  4YMM A;  4O5E A;  4DOA A;  3FYH A;  3H8J A;  5IIM A;  1L3T A;  5KTQ A;  4B9S A;  2RDI A;  4RU9 A;  3RB0 A;  4K4H A;  1ZQS A;  5J29 A;  4QZG A;  4MF8 A;  1KFS A;  3PW4 A;  2J6S A;  2BCV A;  4PGY A;  1BPX A;  4DS5 A;  2HHU A;  2BDP A;  5KG5 A;  4Z6C A;  3RAX A;  2BPG A;  1NKE A;  3TFS A;  1RYS A;  2W8K A;  5J2I A;  5KFC A;  4F4Y A;  4F5Q A;  5KT5 A;  8ICJ A;  1S77 D;  2ZJ5 A;  3JPR A;  2AGP A;  2BQU A;  2WTF A;  5KFV A;  2DPJ A;  4IQU A;  4RQ8 A;  2BCR A;  3RJI A;  3QEA Z;  1S10 A;  4DL3 A;  4EBE A;  5HML A;  4DL7 A;  2ZTE A;  8ICT A;  2R8H A;  4DQR A;  2HHQ A;  1ZQI A;  4KLJ A;  1X9W A;  3KHG A;  5KFW A;  5DGA A;  3MGI A;  4B9T A;  5IIK A;  5J2G A;  7ICU A;  4JV0 A;  3BQT A;  1MQ2 A;  3AU2 A;  4ELT A;  4ZH4 A;  1XO1 A;  5IIN A;  1K1Q A;  4O3S A;  3T5K A;  2P6U A;  3V72 A;  8ICL A;  9ICO A;  5D4B A;  1IM4 A;  1QLN A;  1CEZ A;  2F1I A;  1UA0 A;  4F3O A;  3N97 B;  4XUS A;  3PR4 A;  1ZET A;  3K75 D;  8ICR A;  2NRX A;  4O0I A;  5DLF A;  2BR0 A;  4DL5 A;  5J2E A;  5KFI A;  5J2B A;  2BCU A;  1MQ3 A;  4B9U A;  2UVV A;  1NK7 A;  3BQ2 A;  4JV1 A;  3SZ2 A;  1BPE A;  5C5J A;  9ICJ A;  2P6R A;  4GC6 A;  4BWJ A;  1ZQR A;  2A1J A;  2ZUC A;  4UB5 A;  4R65 A;  3BQ1 A;  4B9V A;  3PW5 A;  5J2F A;  2PFO A;  3E2E A;  4F5P A;  4KLM A;  3C5F A;  5L1K A;  4RPX A;  4PPX A;  4KLL A;  3RRH A;  9ICB A;  9ICL A;  3Q8R B;  2W9A A;  5KFH A;  3HX0 A;  1KFT A;  4QZD A;  3RR7 A;  4RQ7 A;  4ED8 A;  1TK8 A;  4KTQ A;  4O3Q A;  1UT8 A;  5KFF A;  2FLL A;  4LZG A;  4M9J A;  5KT4 A;  2R8K A;  1ZQV A;  3IM1 A;  4UB1 A;  1ZQH A;  1QSY A;  3RJG A;  3C5G A;  4E0D A;  5F9N A;  5KT2 A;  2V4Q A;  4I27 A;  4NLN A;  2XY5 A;  9ICV A;  4QWB A;  2XC9 A;  1U4B A;  4TQR A;  3MDC A;  2VAN A;  1COO A;  4ED1 A;  1TAQ A;  1NKB A;  4QZ9 A;  3PML A;  4DLG A;  4QZH A;  5BOL A;  1ZQO A;  1HUZ A;  3EPG A;  2IHN A;  3BDP A;  8ICC A;  1ZQG A;  5CR0 A;  4R8U A;  2W9C B;  2C28 A;  4FBU A;  3GIJ A;  1MSW D;  4DSI A;  1XC9 A;  4NLZ A;  3ZD8 A;  4EYH B;  4NLG A;  1XU4 A;  5L1L A;  2W9B A;  3H7I A;  3ZDE A;  1NKC A;  4KLO A;  2PFP A;  5HHI A;  4DSJ A;  5IIO A;  4UQG A;  4O3N A;  2XY7 A;  2KTQ A;  4TUQ A;  2XO7 A;  2KN7 A;  3RB3 A;  2V4R A;  1PZN A;  2AGO A;  4DL2 A;  4G3I A;  4RT2 A;  5J0W A;  4BGD A;  2ASL A;  1XS9 D;  4BXO A;  4Q43 A;  1SKS A;  3ETL A;  2UVW A;  8ICO A;  4UB2 A;  4QWC A;  2HHS A;  4RPY A;  4ED0 A;  3PW2 A;  4DSK A;  3ZDC A;  4YQW A;  4Q44 A;  1NJX A;  1Y88 A;  4IQW A;  8ICB A;  3ISD A;  2W9C A;  2ZUD A;  5KG4 A;  3M9M B;  1EXN A;  1S97 A;  9ICI A;  7ICR A;  3EW9 A;  4P4M A;  2BQ3 A;  2B21 A;  1T4G A;  1N48 A;  1TK5 A;  9ICF A;  5D49 A;  4PHD A;  4M9H A;  1NK8 A;  1ZQE A;  1U48 A;  1XSP A;  3GDX A;  4QW9 A;  1KDH A;  2OWO A;  4PH5 A;  5KFE A;  5DDM A;  1TK0 A;  4NM2 A;  4P4P A;  3RBD A;  7ICJ A;  2Y1J A;  3PMN A;  1SKR A;  1NK0 A;  2UVR A;  3TAQ A;  3JPQ A;  7ICE A;  3RH6 A;  4RQ5 A;  3TAP A;  4IRC A;  5KFM A;  5BOM A;  4UAY A;  4MF2 A;  2W9M A;  9ICG A;  4FO6 A;  1L3S A;  1Z00 A;  5KFX A;  2ZJ8 A;  4DFK A;  4DQP A;  5D46 A;  2HHX A;  1S0O A;  3UXP A;  4KLU A;  5L1J A;  2F1H A;  4RQ6 A;  1NJW A;  4DSE A;  3PX4 A;  4C8K A;  1H38 A;  4O3O A;  4I29 A;  3AUO A;  8ICG A;  3SV3 A;  2DPI A;  2FMQ A;  2KZZ A;  9ICK A;  3PW0 A;  2XY6 A;  4MFF A;  4YD1 A;  3MR5 A;  1L3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...