1WCNA

Nmr structure of the carboxyterminal domains of escherichia coli nusa
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION ELONGATION PROTEIN NUSA
publication title The E. Coli Nusa Carboxy-Terminal Domains are Structurally Similar and Show Specific Rnap- and Lambdan Interactions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 19
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1wcnA01
4Q43A 2PXIA 4QZHA 1QSSA 4DOCA 5J2GA 1ZQGA 1ZQRA 4ED7A 4PHPA 4MEYA 3NGDA 2XCPA 4I28A 4TURA 4DO9A 7ICGA 4BDPA 3M8SA 3OJUA 3BQ2A 1AROP 3H8SA 4J9QA 3TFRA 3BDPA 4KLFA 4M9GA 2R8KA 5BPCA 5KG0A 2BQUA 2RDJA 1NJZA 4F5OA 9ICQA 9ICKA 4F5QA 3TANA 2UVRA 1IXRA 2V9WA 4M9HA 7ICFA 9ICBA 4GLXA 4Q8EA 4RPZA 3SYZA 5KFEA 1S9FA 1NK4A 1ZQNA 4LZGA 1BPZA 3TFSA 4B9SA 2ZUCA 4PGXA 3T5JA 2V4RA 1QSLA 4IQUA 2KZ3A 3C1ZA 4MFAA 5J2JA 4DQSA 4C8OA 4DSIA 4IRKA 4KLSA 4YXJA 5KFDA 2FLPA 4JV1A 4KLLA 3MR3A 4B9UA 7ICKA 8ICBA 1TFRA 2LYHA 3MFIA 3RAQA 8ICUA 3UQ2A 4DSFA 5D4BA 3H40A 4BXOA 3QZ8A 5HHIA 1ZQBA 2WTFA 3GV5B 5DQHA 1ZQWA 3BQ0A 5KG3A 3TQ1A 2BR0A 3Q8QB 4MFFA 2W9MA 2FPLA 4IRCA 4GXJA 1XC9A 2W8KA 5J2IA 5DQIA 2J6TA 3HW8A 4UBBA 5KFJA 4QW8A 4RPYA 2ASDA 5KFGA 2ASJA 4P4OA 3N4MB 4J9OA 3EWAA 2HW3A 4M9JA 4PGQA 4DOAA 1NK7A 3PO4A 5J2AA 1TAUA 4RZRA 4NLKA 1CEZA 3AU2A 4RQ5A 4TUQA 3ZDEA 8ICWA 4KLUA 4YD2A 4UAZA 4R63A 1K1QA 3OSPA 2PFQA 9ICIA 5CA7A 8ICPA 2ZUBA 5KFSA 1RXVA 4QWBA 4IR9A 4P2HA 5KFUA 3SV3A 4DWIA 3RH6A 2Y1JA 4DFJA 4B9MA 5CHGA 4ED0A 8ICNA 4Z6FA 2R8JA 2NRZA 2VA2A 3RJKA 2C2EA 5KG5A 7ICIA 4F4KA 1ZQHA 1ZJMA 1ZQLA 2J6SA 3PO5A 3Q8KA 2W9AA 1SKRA 3GFKB 3T5KA 4DL2A 4FBTA 4PHAA 1XS9D 4M04A 3GIKA 3AUOA 4GXKA 2ZJ5A 3N97B 4RQ3A 4KLOA 1PZNA 2XY6A 8ICEA 1KFDA 2NRVA 1UA0A 1NK8A 1N56A 3TI0A 1WCNA 1S10A 4IRDA 1BGXT 5DBBA 4QWDA 3THVA 2Y1IA 1JXLA 3MGIA 2XCAA 4O3OA 2JZBB 1KEJA 1ZQZA 5KT7A 3MFHA 4P4MA 4ZH4A 3V6JA 5DDYA 2GWSA 4I29A 4KLHA 3V7JA 5KFTA 4UQGA 5DG8A 4F5PA 3OGUA 1XSPA 4F8RA 2KN7A 1TVAA 3QE9Y 5KFVA 3RB4A 4F5NA 4Z6EA 2UVWA 1ZQCA 4KLIA 4YMOA 4Z6CA 2C2RA 4K4GA 3MABA 3JPQA 2PFNA 2HHXA 5DLFA 3H4BA 4ECRA 2ZUDA 3C1YA 5CJ7A 2FLLA 1JXEA 5J2DA 4I2HA 2HVHA 3JPSA 8ICIA 4FS1A 4XRHA 2ZTDA 1T8EA 4G3IA 3ZD9A 4KMUA 1L5UA 4M2YA 3UPQA 4I2CA 1K1SA 2NRXA 3C5GA 7ICSA 1XWLA 8ICFA 2NRTA 4YG2A 1BPDA 3MR6A 4R8UA 1ZQYA 5J2HA 9ICXA 4DFKA 4UAWA 2BPFA 4YMNA 1X9WA 3MGHA 3BJYA 2I9GA 1X2IA 3PW0A 1ZQJA 1NK5A 9ICCA 3JPRA 5KFNA 3ZDBA 3HX0A 3RJIA 4RQ2A 3BQTA 4RT2A 4DQRA 3OHAA 3T3FA 4M6WA 5DQGA 4RUCA 4PHEA 1QTMA 5HP4A 9ICGA 3SI8A 7ICJA 3K4GA 4J9PA 4EYIB 4DQQA 5J29A 1EXNA 5KG6A 3G6YA 4DQIA 2XY7A 4MEXA 3C2LA 7ICEA 8ICQA 2JEFA 3GV7B 3RRHA 3TAQA 4DL7A 4ECQA 4I2JA 1ZJNA 4GXIA 4F3OA 1BPBA 4PPXA 8ICLA 5KFMA 5J2BA 2AGQA 1MQ2A 2XGQA 8ICOA 5TZVA 4E0DA 1D8LA 2NRWA 1TKDA 4MF2A 1T4GA 1Z00B 3PW4A 1KRPA 2F1IA 1KTQA 4J9SA 3PR5B 4DF4A 2P6RA 4DSKA 4UB3A 4QZGA 5IINA 4EEYA 4Q44A 3K75D 5IIIA 4QW9A 4KTQA 5KFWA 3GILA 1KDHA 1NK0A 1SKWA 2BCSA 5HNKA 1S0NA 4QZBA 4YXMA 4RUAA 1HUZA 3RB0A 1TAQA 7ICOA 3C23A 5L1LA 3PVXA 3EZ5A 1ZQAA 4KN4A 5D46A 3BQ1A 4ED1A 2BPCA 2ZJ8A 5L1KA 4ED6A 2OWOA 4C8LA 8ICGA 3PNCA 4NLGA 4NLZA 3PY8A 9ICUA 3KHGA 1BPEA 4F91B 2XY5A 1MC8A 2R8HA 2KZZA 2AJQA 2ZTCA 1ZQKA 4ED2A 1A77A 1XSNA 4TQRA 2P6UA 4J9LA 4EBCA 3RR8A 4J9NA 2W9BB 2KFNA 4YD1A 4RQ8A 4UB5A 4O0IA 4RQ6A 5IILA 4UB1A 3IHQB 4DS4A 5KG1A 2HHSA 3KTQA 3GIJA 3PR4A 1WCLA 2W9CB 2FMSA 4RQ4A 2F1HA 4ECSA 5J2CA 3SV4A 1S76D 2AGOA 2BCVA 3E2EA 1NKEA 1S0OA 3M9OB 1ZQEA 4DSJA 1V9PA 4QZ9A 3RH5A 5KG4A 2BGWA 2F1JA 4ECZA 4YN4A 1X9SA 8ICXA 5DG9A 3ISCA 1UT5A 1ZQQA 1TV9A 1BPYA 1Z3EB 2ATLA 4DL4A 1MSWD 2A1JA 4BWJA 4QZFA 4P4PA 5J2EA 4MF8A 2IHMA 3T5HA 1S77D 8ICVA 3Q8MA 4C8MA 4GC6A 3KHHA 3Q8LA 8ICYA 3PW5A 4O5CA 4J9KA 2BQRA 4O5KA 4NM1A 5CWRA 5J0WA 4DLEA 4DLGA 2C22A 5KFPA 1UT8A 2AQ4A 2AU0A 1U45A 9ICEA 4ED3A 4F2SA 1IM4A 4NY8A 4BGDA 5KFRA 2DPIA 4FO6A 5DKWA 2ISOA 8ICRA 1ZQPA 5IIJA 2KZMA 1KLNA 2VANA 3GV8B 1TK8A 2MUTA 4I2GA 2ISPA 2JEIA 5J0RA 3EYZA 7ICLA 5J0SA 2UVVA 1B22A 1NKBA 2JEGA 5KFZA 1TK5A 3GQCA 3QEBZ 4ELTA 3HPOA 3UXPA 4I2FA 4EBEA 3B0YA 4ECUA 3JPOA 2BKEA 1ZETA 2ALZA 2FPMA 4ED8A 7ICHA 2RDIA 5KTQA 3PX6A 5F9LA 5IIOA 1LV5A 5J2FA 5IIKA 4YFKA 2BQ3A 3RH4A 4MFCA 5KFKA 4F4WA 3MR2A 5KT2A 4QZCA 2HHVA 2KTQA 3M9MB 4YR0A 4ECWA 1MQ3A 2PFPA 3JPNA 1ZQVA 1ZQFA 2FLNA 8ICHA 3H4DA 3KHRA 4IQTA 1RYSA 4M0AA 4I2AA 4LVSA 3RJGA 3V7LA 2BPGA 4YP3A 2PI5A 5KFAA 4Q45A 1C7YA 1D9DA 3V6HA 9ICHA 2R8IA 1U47A 1U4BA 2W8LA 2XO7A 3FYHA 1KFTA 4RQ0A 2M9NA 4F93B 3T5LA 1ZQMA 5KG2A 4I2BA 3M8RA 4KLEA 3ZDDA 1JIHA 5KFHA 4TQSA 4PHDA 5KFFA 5HMMA 4DFPA 4C8NA 2V4QA 1Y88A 2ZJAA 4R65A 4DFMA 3RJEA 9ICLA 4NM2A 4JK1A 4NXZA 3TARA 4XQ8A 1ZQTA 1QLNA 5DB9A 5F9NA 1NJXA 5IIMA 4BWMA 3TAPA 3GIIA 4DL3A 4RQ1A 9ICNA 4FS2A 4RNOA 2IBKA 4KLGA 4DSLA 3PX4A 1ZQUA 4O3SA 3LWMA 3NTUA 5EWEA 4UBCA 1DOQA 4ECXA 2UVUA 2HHTA 3ZDCA 1JN3A 9ICSA 4QZIA 4QWEA 5KFLA 7ICQA 5DBCA 2JZBA 4KLTA 4QWAA 4J9MA 5EOZA 1B43A 4BXOB 3M9NB 4NLNA 5DG7A 1T7PA 2VA3A 8ICAA 8ICKA 1L3SA 3OJSA 2BHNA 4RQ7A 4O3QA 3EPGA 4JUZA 3FDSA 5HMLA 5KFXA 3OHBA 9ICOA 2HHUA 3JPPA 3C2KA 3PMNA 1XU4A 4C8KA 5DLGA 4KLQA 4XA5A 4PGYA 1S0VA 3GIMA 1HJPA 2JEJA 5KT3A 5KFIA 3UXOA 1ZQXA 3ORYA 5KT4A 3MDCA 1NJYA 4YR2A 4YQWA 3RBEA 4X5VA 2FPKA 4DOBA 3RR7A 2A1JB 4UB2A 5KFOA 3ZDAA 4QZ8A 5EWFA 3HT3A 2AGPA 4M9NA 7ICPA 3PX0A 8ICCA 3G6XA 1NK9A 2PI4A 4HYKA 4EZ9A 1ZQDA 9ICAA 4ECVA 3C21A 3RJFA 1U9LA 5KFYA 7ICNA 4I2IA 5D49A 2C2DA 1JX4A 3SZ2A 3H7IA 4F92B 3ETLA 1RPLA 4B9TA 2HHQA 4IQWA 1BVSA 5DB8A 5BOLA 4RNMA 3MR5A 3UQ0A 3V72A 4DL6A 2MUTB 9ICFA 2XGPA 5CP2A 4B9NA 2DFLA 1D8YA 1Z00A 4YCXA 4F4YA 3PV8A 3IM1A 3V6KA 1ZQSA 4ECYA 1JMSA 9ICJA 5CB1A 1KFSA 4JWMA 5C5JA 3H8WA 4DEZA 3JPTA 1SL1A 8ICSA 4F50A 5HHHA 7ICMA 3Q8RB 3KHLA 5DGAA 9ICPA 3G6VA 2I1QA 4R66A 3RJJA 4KN7A 1N48A 1H38A 1ZQIA 4ELVA 2KFZA 4F4XA 9ICTA 5DB7A 4KLJA 1A76A 1ZYQA 4EBDA 2IHNA 4B9VA 4K4IA 1S97A 4XUSA 3PMLA 4FBUA 3AU6A 9ICWA 1SL2A 4DQPA 4RT3A 2PFOA 4M9LA 1XO1A 3RTVA 1U48A 1RZTA 2MAXA 3LDAA 5KFQA 4QZAA 1SKSA 8ICJA 3MDAA 5DB6A 2W9BA 2AQ0A 5KT5A 5L1IA 1LB2B 4O3RA 1CUKA 4Q8FA 5J0QA 2IA6A 1RYRA 4LZDA 3UXNA 5J0OA 4M47A 4KLMA 4R8UB 3RJHA 5DDMA 5KFCA 8ICTA 4DL5A 2W9CA 4IR1A 4DF8A 4IQVA 2BDPA 2FMPA 4I2DA 1TK0A 4JWNA 1QSYA 2IMWP 4YVZA 4RU9A 4RNNA 4F5RA 2C28A 3H8JA 1L3VA 2BCQA 3OSNA 1COOA 4M6WB 4QZEA 1X9MA 4KITB 4RPXA 4QWCA 3LK9A 3GDXA 7ICVA 1SZPA 2HVIA 2BCRA 8ICZA 5DBAA 4TUPA 2B21A 1NOMA 3RBDA 3Q8SB 3MBYA 3RB6A 4CCHA 3ISBA 2VA8A 5DGBA 4R64A 4UAYA 3RB3A 5KG7A 4QZDA 1ZQOA 3RRGA 4K4HA 5J0PA 1RXWA 2HHWA 5JUMA 3PW2A 2P66A 4YMMA 1NK6A 2Q0ZX 3Q8PB 1T3NA 1L3UA 4B9LA 4I27A 2FMQA 2ZTEA 4O5EA 1DGSA 4ECTA 1U49A 2J6UA 1S0MA 1HUOA 4UB4A 3EW9A 4Z6DA 3QEAZ 4O9MA 3HWTA 4F2RA 1XSLA 4EYHB 2H5XA 8ICMA 9ICVA 5L1JA 5J0UA 5J0XA 1SL0A 2BCUA 4ELUA 7ICRA 4PH5A 5J0YA 5J2KA 2R8GA 5BOMA 7ICUA 3LWLA 3HP6A 4DS5A 3QZ7A 4F4ZA 4I2EA 7ICTA 4TUSA 4KLDA 1BPXA 1UA1A 3C2MA 3ZD8A 3ISDA 3V7KA 1NJWA 1NKCA 4YR3A 4O3NA 3B0XA 5KT6A 1KSPA 1L3TA 5KFBA 5EWGA 9ICMA 3EPIA 5L9XA 3C5FA 3RAXA 4JV0A 2XC9A 9ICRA 4O3PA 2DPJA 2ASLA 5J0TA 1D9FA 4JV2A 3PW7A 5CR0A 4EZ6A 4DSEA 4J9RA 4GC7A
chains in the Genus database with same CATH superfamily
4EX6A 4QZHA 1QSSA 2KVSA 5J2GA 3BS5A 3WK6A 2ZIXA 3NGDA 2XCPA 4I28A 2K8CB 7ICGA 4BDPA 4CF3A 3BQ2A 4J9QA 4KLFA 5ALYA 5BPCA 5KG0A 5ALNA 1B4FA 9ICBA 3NVVA 2ZXHA 2YTUA 5KFEA 1ZQNA 5KL8B 1QSLA 4DSIA 2EAOA 2LM4A 2FLPA 5ALUA 4KLLA 3MR3A 1TFRA 8ICUA 3UQ2A 4DSFA 1URJA 2D3DA 2I5HA 3E58A 3WKCA 3TQ1A 2WB1C 2JR5A 1XC9A 2J6TA 4UBBA 4RPYA 2ASDA 2E8OA 1SWVA 5AKJA 3N4MB 4J9OA 4PGQA 5J2AA 4NLKA 1J2NA 2OHFA 4YD2A 3WKBA 2KJ8A 9ICIA 2FDRA 2E3TA 5CA7A 5ALLA 3SR6A 1RXVA 4IR9A 4DWIA 3SV3A 2H3IA 3RH6A 1D8BA 5CHGA 4IL6U 3CNHA 2VA2A 2C2EA 3AEVA 1ZJMA 4FFDA 2AXTU 2KIVA 3GFKB 4NWIA 4DL2A 4FBTA 4C80A 3FM9A 3ALRA 8ICEA 1KFDA 1N56A 1S10A 4Y2XA 1BGXT 1X66A 1JXLA 2XCAA 2ODGA 3MFHA 3V6JA 4I29A 4UQGA 1QCKA 2KN7A 2W03A 3QE9Y 3RB4A 4F5NA 4YMOA 4Z6CA 3D2NA 1X42A 2H3FA 2XI9A 3MABA 8ICIA 3JPSA 4G3IA 3MGVA 4KMUA 4I2CA 1ZQYA 4UAWA 2BPFA 1X9WA 3MGHA 1X2IA 1NK5A 3ZDBA 3HX0A 3RJIA 4RQ2A 4DQRA 4PHEA 5AM3A 3SI8A 5J29A 3G6YA 2ZG6A 4DQIA 4MEXA 3CRXA 3GV7B 4G9BA 4ECQA 1BPBA 3GZFA 4CE6A 3HILA 4MF2A 1TKDA 1P7DA 1T4GA 3IG8A 3PW4A 1CI4A 2F1IA 2O6KA 4J9SA 4DF4A 3PR5B 1KRPA 2P6RA 4DFDA 5ALFA 4QZGA 5AM1A 4QW9A 2ZIVB 5IIIA 1KDHA 3SENA 1SKWA 3BQ7A 5L1LA 2H3QA 3BQ1A 1VDVA 4NLGA 4UW9A 9ICUA 3KHGA 1BPEA 2R8HA 1ZQKA 1XSNA 3QU5A 5AI9A 1F0MA 4O0IA 2VKQA 4DS4A 3KTQA 2K4PA 3PR4A 2F1HA 3CW2C 5J2CA 2G09A 3RH5A 4QZ9A 4ECZA 3AN1A 8ICXA 1TV9A 1N61A 4BWJA 4MF8A 2XVTA 1S77D 4IS7A 4C8MA 8ICYA 4O5CA 2BQRA 4O5KA 5A0LA 4C0ZA 1F44A 1UT8A 2WF8A 2AU0A 3F53A 1U45A 2RLTA 4NY8A 4EEKA 2LPEA 2ISOA 2VANA 3GV8B 3B9JA 1B22A 2UVVA 2EH9A 2JEGA 1Z19A 2JH7A 4BX9C 1RQLA 4FE3A 2ALZA 1QQ5A 3WKEA 4YFKA 2QARA 3GU3A 5B5EU 2CRXA 5AK6A 3M9MB 3ICXA 3F5AA 3H4DA 5GTIU 4IQTA 1RYSA 3C29A 2W7PA 4Q45A 3BS5B 9ICHA 1U4BA 2ZIXB 2XO7A 4RQ0A 4R65A 3RJEA 5EE9A 5T14A 1QLNA 4KMOB 5DB9A 1NJXA 4QIWC 5IIMA 1PVRA 1J2MA 1NI3A 4DL3A 4RQ1A 1KL9A 1ZQUA 4O3SA 3NTUA 1NZPA 1TAMA 4UBCA 2KSOB 3ZDCA 1JN3A 3N7RC 5KFLA 1KKXA 4KLTA 4BUGA 4J9MA 1B43A 3M9NB 3SAGA 3OJSA 5ALOA 1ZD2P 1S5LU 2DKXA 9ICOA 3NS1A 2E5SA 5KAFU 1NZBA 4C7YA 4KLQA 4XA5A 3GIMA 2Y0SF 5ALIA 2HBKA 4X5VA 2A1JB 5AK5A 4QZ8A 7ICPA 3G6XA 2HBMA 2WF6A 2KEYA 4ECVA 5KFYA 1L7MA 2RQ5A 1RM6C 5AKKA 3SZ2A 4F92B 1JX4A 3C28A 3CP8A 2I6XA 5ALTA 1BVSA 2MA1A 1D8YA 5ALDA 2DKZA 3IM1A 4P0PA 9ICJA 1SL1A 1S8OA 7ICMA 9ICPA 2HCFA 2I1QA 4R66A 1N48A 2KFZA 5DB7A 2CXYA 2IHNA 5AI8A 1OUQA 3AU6A 1WG8A 3RTVA 3NVZA 2F44A 1RZTA 1SKSA 8ICJA 5DB6A 5KT5A 3HKZF 2YQEA 4Y2YA 3SEIA 4LZDA 4M47A 3IDWA 8ICTA 4DL5A 2W9CA 4IR1A 2HDOA 4JWNA 2IMWP 2NV3A 2N1RA 1ECWA 1L3VA 3OSNA 4KITB 2WAQC 1COKA 3CYMA 3IRUA 2G0AA 7ICVA 2KD1A 2B21A 3RB6A 3NVYA 2HBLA 3ISBA 2VA8A 5DGBA 4R64A 3RB3A 1ZQOA 2G5IB 2Q0ZX 3Q8PB 1T3NA 2FMQA 3H0MB 1DGSA 1U49A 1L7NA 2IOHA 3QEAZ 4Z6DA 2G5HB 1L7OA 4F2RA 5GTHU 4DCCA 2LI6A 5L1JA 5J0XA 5J2KA 5BOMA 7ICTA 3QZ7A 3TKAA 4KLDA 1NJWA 3QUBA 4CF4A 5KFBA 2HMXA 4O3PA 1RDFA 2E8NA 4JV2A 4C4RA 4Q43A 4DOCA 3AQFA 2E1EA 1L8LA 4ED7A 1ZRNA 3S6JA 2KKPA 4DO9A 3M8SA 3OJUA 1AROP 3BDPA 2AH5A 4AYBC 2RDJA 1NJZA 4F5OA 9ICQA 1N63A 5AM4A 7ICFA 4EENA 4GLXA 2WF5A 4Q8EA 3SYZA 1NK4A 4LZGA 3DDHA 3TFSA 2ZUCA 4OD0A 2OM6A 3T79A 4KTQA 2LKYA 2KZ3A 3C1ZA 5J2JA 4JV1A 1T3QA 4KX3A 4P0QB 4HAIA 8ICBA 3MFIA 3RAQA 5D4BA 3H40A 5HHIA 1ZQBA 2WTFA 3GV5B 5DQHA 1ZQWA 3BQ0A 3Q8QB 1UPHA 2W9MA 4IRCA 4A8EA 3FC4A 2W8KA 1Q8KA 5DQIA 4ACOA 2QARB 5KFJA 4FZNA 1JUDA 1UCVA 2K4HA 1QQ6A 1TE2A 2HW3A 1TAUA 1KBUA 1Q3UA 1CEZA 1ZQ1C 3L4PA 4KLUA 2F2AB 2QKQA 4US8A 4R63A 2KMDA 4Y2JA 2MSNA 3OSPA 3WK9A 2P35A 5KFSA 3PSTA 4DFJA 4B9MA 2K8AA 2YX8A 5KG5A 1ZQLA 2J6SA 3Q8KA 5AKLA 5JTIA 2GH1A 2H3ZA 2QLTA 5J8YC 2F3NA 4PHAA 3GIKA 2JXJA 3N97B 1K5OA 2XY6A 2NRVA 2B0CA 1UA0A 3TI0A 3I28A 2KHQA 5DBBA 3THVA 2HSZA 4O3OA 1KEJA 3WU2U 5DDYA 2WHEA 2VIXA 3QU7A 5DG8A 4F5PA 3OGUA 1IG6A 1SWWA 4RQNA 4OO1J 4KLIA 2C2RA 3H4BA 4ECRA 4FS1A 2ZTDA 1T8EA 5JRTA 1OW5A 2NRXA 3C5GA 1XWLA 4YG2A 1L8OA 2K89A 3BJYA 2DQNB 3T3FA 3OHAA 5ALSA 3K4GA 4J9PA 3SAFA 2XY7A 3TAQA 4I2JA 4UAUA 4PPXA 2ZIWA 4NLCA 4E0DA 1KN5A 1D8LA 2NRWA 5ALEA 3I1YA 1KTQA 4DSKA 4C4SA 2LMRA 3QUQA 4P0PB 5IINA 1NK0A 2BCSA 3PVXA 1ZQAA 2KSOA 3PNCA 1MC8A 1A77A 3FAHA 2P6UA 2KFNA 4J9NA 4YD1A 4UB5A 1ZOLA 4UB8U 4JMUA 3IHQB 5KG1A 2HHSA 2DWQA 3GIJA 1WCLA 2W9CB 2FMSA 4ECSA 3LVVA 2BCVA 1NKEA 2KK0A 1V9PA 4YN4A 3ISCA 1UT5A 4OJOA 1ZQQA 3IP4B 2A1JA 2CPRA 3HKZC 8ICVA 3Q8MA 3Q8LA 3PW5A 4J9KA 1LVHA 5AKGA 5CWRA 5KFPA 9ICEA 4F2SA 1MA7A 1JI7A 4FO6A 5DKWA 2Q4TA 8ICRA 1ZQPA 5IIJA 4I2GA 1TK8A 2JEIA 3EYZA 1NKBA 1ZXIA 2KVCA 2LBOA 4I2FA 4EBEA 3B0YA 3E0FA 3JPOA 2BKEA 1N2XA 1ZETA 2BQ3A 3BS7A 2YMQA 1ZD5A 2KTQA 4ECWA 3QU9A 2PFPA 3JPNA 1ZQVA 8ICHA 3QU4A 5KFAA 1D9DA 2W8LA 3FYHA 1KFTA 2M9NA 2YN4A 4UB6U 3T5LA 3ZDDA 5HMMA 1Y88A 2ZJAA 3LVWA 3KKAA 4NM2A 4NXZA 2XICA 4XQ8A 5KNIA 1T94A 5F9NA 3TAPA 3GIIA 3AQEA 2IBKA 4DSLA 1DOQA 4QWEA 3KOOA 7ICQA 1DGJA 2JZBA 1WWVA 1JROA 5HR6A 5EOZA 5DG7A 2Y9TA 8ICKA 1Z4OA 2BHNA 4O3QA 3EPGA 3QYPA 5HMLA 5KFXA 3JPPA 1HIWA 4PGYA 2VJ5A 5KFIA 1ZQXA 3MDCA 4YQWA 2FPKA 4DOBA 3UMCA 2EAMA 4OJ5A 4UB2A 3ZDAA 3HT3A 2LHTA 2G06A 5AKHA 2PI4A 2DL0A 3L5KA 1ZQDA 1X40A 9ICAA 3C21A 7ICNA 5D49A 2C2DA 2PMZC 4B9TA 2HHQA 4IQWA 3MR5A 5DB8A 3V72A 1N5XA 5CP2A 3D2SA 2DFLA 1Z00A 4YCXA 5CEHA 4F4YA 5KL1B 3V6KA 4ECYA 1FFUA 4DEZA 4F50A 5KAIU 3Q8RB 3KHLA 3G6VA 4F4XA 1L7PA 1ZYQA 4B9VA 4K4IA 2W04A 1S97A 5HR7A 4P0QA 3SD7A 4DQPA 1U48A 4NV0A 3LDAA 4Y2RA 3MDAA 2AQ0A 4O3RA 1CUKA 3KKAC 5J0QA 4Q8FA 4IC9A 2LYAA 5ALZA 5DDMA 4DF8A 1SIJA 1QSYA 3ETRA 4RU9A 2RRDA 2C28A 1COOA 1SZPA 8ICZA 2NO4A 4CCHA 2ZIWB 4K4HA 2HHWA 4PJ0U 5KG7A 5JUMA 3PW2A 2K8BB 1L3UA 4B9LA 4I27A 4O5EA 4ECTA 2EDUA 2H5XA 9ICVA 2BCUA 4ELUA 7ICRA 5J0YA 4I2EA 4F4ZA 1FO4A 1VJ5A 3ZD8A 4O3NA 3B0XA 1KSPA 2W55A 1YT3A 1V38A 2JHDA 2ASLA 5J0TA 4NLBA 5CR0A 4GC7A 5AM5A 2Y9UA 1ZQRA 4MEYA 4B6JA 3D2QA 2W7OA 4TURA 1PK3A 5ALPA 2BQUA 4C4TA 1LKYA 2VJ4A 1V97A 2HBJA 2UVRA 2WFAA 1BPZA 2E8PA 3WK7A 4B9SA 2K4EA 3T5JA 2V4RA 4MFAA 4C8OA 3OPXA 4QNLA 4YXJA 5KFDA 3O0FA 4B9UA 7ICKA 2LYHA 4BXOA 3LYSA 5KG3A 2BR0A 1QQ7A 2FPLA 5J2IA 4UASA 2D6FC 1DRGA 4QW8A 4P4OA 1IIPA 2K4IA 2EZZA 3PO4A 4RZRA 3N7PD 1Z1VA 1ED1A 3WKAA 4UAZA 2KKVA 2PFQA 5F3XB 2AHOB 4ZOHC 2DGZA 2WB1F 4P2HA 4OJ6A 2GOLA 3PSFA 2Y1JA 2HI0A 2KV2A 8ICNA 4CNQA 4F4KA 3UMGA 1SKRA 3T5KA 2ZIUA 1XS9D 3AUOA 4GXKA 2ZJ5A 4RQ3A 4KLOA 1NK8A 3RF9A 2Y1IA 2JMGA 3MGIA 2JZBB 1ZQZA 3MC1A 5KT7A 5CRXA 4ZH4A 3V7JA 3PSIA 1FEZA 5E79U 5KFVA 4Z6EA 2EAPA 4ICAA 5DLFA 1N5WA 2FLLA 4I2HA 1JXEA 5ALGA 4XRHA 2IOFK 4Y2PA 4M2YA 8ICFA 2NRTA 1BPDA 3MR6A 4R8UA 4NJ8A 5J2HA 5AKEA 9ICXA 1PK1B 2I9GA 1ZQJA 3JPRA 5KFNA 4RT2A 4PL1A 4RUCA 1QTMA 7ICJA 2FE9A 4EYIB 1S76D 8ICMA 9ICGA 1EXNA 5KG6A 7ICEA 2JEFA 3H8MA 3RRHA 4DL7A 2MRLA 2M0NA 4F3OA 4GFJA 1SGGA 5KFMA 8ICOA 2XGQA 5TZVA 1Z00B 5AI0A 3H0RB 2QB0A 4EEYA 2KE7A 3AMZA 3K75D 4Q44A 5KFWA 3GILA 2NO5A 2GO7A 1S0NA 3ONNA 4YXMA 1HUZA 3K1ZA 3RB0A 3IG5A 7ICOA 3EZ5A 3AL0B 5D46A 4ED1A 5FP0A 5L1KA 4C8LA 8ICGA 4NLZA 3PY8A 2XY5A 2KZZA 2AJQA 2ZTCA 4ED2A 4TQRA 4J9LA 2FJ6A 2KOBA 4RQ8A 3KFUF 1VLBA 4RQ6A 5IILA 3SV4A 1S0OA 3M9OB 1ZQEA 2BGWA 1X9SA 2F1JA 5DG9A 5ALMA 5AKZA 1MSWD 2ATLA 4DL4A 4QZFA 2HOFA 3IV6A 3T5HA 1J97A 3KHHA 4NM1A 4DLGA 4DLEA 2HOIA 1DK3A 2OEHA 2AQ4A 4ED3A 5ALRA 2YB4A 5KFRA 5AKIA 2DPIA 2DF4B 2EZYA 2KZMA 5J0RA 5J0SA 4KX5A 3GQCA 1N60A 4Y2VA 4O3MA 3VC8A 2KICA 4ED8A 2W43A 5KTQA 3PX6A 5F9LA 5IIOA 1LV5A 5J2FA 5IIKA 5AM0A 3RH4A 5KFKA 4F4WA 3MR2A 2HHVA 4YR0A 1MQ3A 2YMMA 3F2BA 1ZQFA 3F5EA 3KHRA 4M0AA 4I2AA 3NUQA 2OCEA 3V7LA 2W3SA 2BPGA 2PI5A 1C7YA 2R8IA 5AI6A 3KD3A 4F93B 1ZQMA 5KG2A 4I2BA 3RFAA 3U26A 1JIHA 5KFHA 4TQSA 5KFFA 4DFPA 4C8NA 2V4QA 1LKYB 1IV8A 4JK1A 3TARA 2D8CA 4Y2QA 4BWMA 9ICNA 2Y0SC 4RNOA 4KLGA 5AICA 9ICSA 2YMPA 4ECXA 2HHTA 4QZIA 2DBYA 4BXOB 3TACB 1T7PA 2VA3A 1L3SA 3UMBA 4RQ7A 4JUZA 5ALQA 1KW4A 3OHBA 2HHUA 1Z1BA 1XU4A 4QIWF 5EE3A 1S0VA 3TADA 1HJPA 2A1AA 5KT3A 3UXOA 5KT4A 1NJYA 4UATA 3RBEA 1V85A 4QJFB 2ES6A 2AGPA 5AHXA 4U6PA 1BNPA 4Y2TA 8ICCA 1JRPA 3UM9A 4HYKA 4FZLA 2EZXA 4I2IA 3H7IA 3ETLA 1RPLA 1RQNA 3UQ0A 5BOLA 4RNMA 2MUTB 2ZIUB 2KHVA 9ICFA 4B9NA 3PV8A 5AK3A 1ZQSA 2YMLA 2KG5A 4JWMA 3JPTA 5HHHA 2KIWA 5DGAA 3RJJA 4KN7A 4ELVA 9ICTA 3KBBA 4OCZA 4KLJA 1OXJA 1A76A 4EBDA 4XUSA 3PMLA 4M9LA 4RT3A 2PFOA 4CRXA 3NVWA 1M6YA 5KFQA 4QZAA 2W9BA 2F77X 1RYRA 3UXNA 5J0OA 2NYVA 4R8UB 3RJHA 5KFCA 4IQVA 2FMPA 3D6JA 2G07A 4RNNA 3H8JA 2G08A 1X9MA 1SV0A 4QWCA 3LK9A 2BCRA 5G5GA 1JALA 1NOMA 1A0PA 2LYBA 3Q8SB 2KNJA 4UAYA 5J0PA 1RXWA 3OTQA 4YMMA 1NK6A 5EE0A 2QB0B 3M6ZA 2F8LA 1HUOA 4UB4A 4PL2A 4EYHB 5AI5A 3TADC 3NRZA 4PH5A 2WAQF 2R8GA 7ICUA 3LWLA 3HP6A 4WJ3B 2YB1A 3DEEA 4TUSA 1HEKA 2BDUA 1BPXA 1O03A 2Z7JA 1UA1A 2OH2A 3V7KA 1NKCA 4YR3A 4GIBA 1UQVA 1L3TA 3EPIA 3RAXA 4JV0A 2XC9A 2JGAA 2OYYA 4RQMA 1D9FA 1SB3C 4EZ6A 4J9RA 3KZXA 4USAA 3QNMA 2PXIA 2H3VA 1ZQGA 4PHPA 3N7SC 2HOQA 3TFRA 3H8SA 4M9GA 2R8KA 1C20A 9ICKA 1SXEA 4F5QA 3TANA 1IXRA 5EE1A 1PK1A 3BZKA 3HRDD 3M7DA 2V9WA 4M9HA 4RPZA 2WF9A 1S9FA 2QB1A 4PGXA 4IRKA 4IQUA 4DQSA 4KLSA 1X6JA 1PVQA 5ALXA 4CDGA 4AYBF 3QZ8A 3KZIU 3EUB2 4MFFA 1XNSA 4GXJA 2L5YA 3HW8A 1A6SA 5KFGA 2ASJA 1FFVA 3L3FX 3QX7A 3EWAA 1SV0C 4M9JA 4DOAA 1NK7A 3AU2A 4RQ5A 4TUQA 3ZDEA 8ICWA 1BNOA 2OXOA 1K1QA 1WUDA 2F8KA 8ICPA 4Y2SA 1YZ7A 2EANA 2ZUBA 1GO3F 4QWBA 4U7CA 5KFUA 5AIAA 3BZCA 2JH1A 4ED0A 4Z6FA 2R8JA 2NRZA 3RJKA 7ICIA 1ZQHA 3PO5A 4AP9A 4NL9A 2W9AA 2F76X 4M04A 1ZRMA 4UAVA 1PZNA 1WCNA 5AKXA 4IRDA 4QWDA 2MU2A 2A3VA 4P4MA 4KLHA 2GWSA 5KFTA 1XSPA 4F8RA 1TVAA 2UVWA 1ZQCA 2E8MA 4K4GA 3JPQA 3PSPA 3QU2A 2PFNA 2HVHA 2HHXA 2ZUDA 3C1YA 5CJ7A 5J2DA 3A0HU 3M6KA 3F2CA 3ZD9A 1SV4A 1L5UA 3UPQA 1K1SA 7ICSA 2GLEA 5ALWA 2CN1A 4DFKA 4YMNA 2FI1A 3N28A 3PW0A 9ICCA 3SAHA 3BQTA 1F5SA 4M6WA 5DQGA 3ZI4A 5ALJA 5HP4A 3K1RB 3NASA 4DQQA 1SXDA 5AM2A 3C2LA 8ICQA 5AIBA 1ZJNA 4GXIA 8ICLA 5J2BA 2AGQA 1MQ2A 1AQ6A 1WWUA 3PZPA 4UB3A 2ZXIA 1N62A 4OJPA 5HNKA 4QZBA 4RUAA 1TAQA 3C23A 4EX7A 4KN4A 2BPCA 2ZJ8A 2OWOA 4ED6A 2EQYA 3WK4A 4F91B 1XO0A 2PKEA 5L1MA 3IN5A 3RR8A 4EBCA 2W9BB 4JB3A 1QH9A 4UB1A 2RHFA 4NL9C 4RQ4A 2AGOA 3E2EA 4DSJA 5ALHA 1RYUA 5KG4A 3QXGA 2JV3A 3ED5A 4UARA 1BPYA 1Z3EB 4P4PA 1CRXA 5J2EA 2IHMA 4LJXA 3SQIA 4GC6A 4F71A 3H0LB 5J0WA 2C22A 1ZD4A 1IM4A 4BGDA 1YZ6A 2BZFA 2KP7A 1KLNA 1Q3VA 2MUTA 2ISPA 1X9XA 1ZD3A 7ICLA 5KFZA 1TK5A 2W3RA 3QEBZ 2RP5A 4PZNA 3HPOA 3UXPA 4ELTA 4ECUA 2FPMA 1O08A 7ICHA 2RDIA 1RG6A 3HJEA 4Y2UA 4MFCA 5KT2A 2E1FA 4QZCA 1Z4NA 5JU5A 1DK2A 2FLNA 1PVPA 4LVSA 4C7ZA 3RJGA 4YP3A 3V6HA 1U47A 3SMVA 3M8RA 4KLEA 3A0BU 3R9KA 4PHDA 3J81j 4DFMA 1MN8A 5H2FU 4PZOA 9ICLA 2XIDA 2JRZA 3WK8A 1ZQTA 2LM1A 2DUYA 3AM9A 1X6IA 4FS2A 5J8YA 3PX4A 5AI4A 3LWMA 5EWEA 2UVUA 2W54A 1NNLA 5DBCA 4QWAA 4NLNA 5ALVA 1UHUA 2R18A 8ICAA 3WKDA 3FDSA 3C2KA 3PMNA 4CF5A 4C8KA 5DLGA 2JEJA 3ORYA 4YR2A 4EELA 2ESEA 1B0XA 3RR7A 5KFOA 5EWFA 4M9NA 5AKYA 3PX0A 1NK9A 1SZHA 4EZ9A 3F2DA 4FZMA 3RJFA 1U9LA 4F72A 1Q46A 2KJ5A 1DXSA 4DL6A 2XGPA 4CGZA 5TISU 5C0YA 1PUZA 1JMSA 5CB1A 1KFSA 5C5JA 2ZIVA 3H8WA 8ICSA 2WF7A 3VCBA 1H38A 1ZQIA 2PMZF 4FBUA 9ICWA 1SL2A 1XO1A 2MAXA 1L6NA 1WYGA 4MHVA 2K60A 5L1IA 1LB2B 2IA6A 5ALKA 4KLMA 3DV9A 4J03A 2BDPA 4I2DA 1TK0A 1FIQA 2A19A 4YVZA 4F5RA 3NRWA 2BCQA 4M6WB 4QZEA 3M1YA 4RPXA 3GDXA 4US9A 2HVIA 5K4LA 5DBAA 4TUPA 3RBDA 3MBYA 2YY6A 5B66U 4QZDA 3RRGA 2P66A 2KJ9A 3QUCA 2ZTEA 2J6UA 1S0MA 3EW9A 2IOFA 4O9MA 3HWTA 1XSLA 1KQQA 3I76A 3QUTA 5J0UA 1SL0A 4OJLA 4DS5A 4BJQA 3WK5A 2B6GA 5AK4A 3C2MA 3ISDA 5KT6A 5G5HA 5EWGA 9ICMA 3C5FA 5L9XA 9ICRA 2DPJA 2W11A 3PW7A 4DSEA
chains in the Genus database with same CATH topology
4Q43A 2PXIA 4QZHA 1QSSA 4DOCA 5J2GA 1ZQGA 1ZQRA 4ED7A 4PHPA 4MEYA 3NGDA 2XCPA 4I28A 4TURA 4DO9A 7ICGA 4BDPA 3M8SA 3OJUA 3BQ2A 1AROP 3H8SA 4J9QA 3TFRA 3BDPA 4KLFA 4M9GA 2R8KA 5BPCA 5KG0A 2BQUA 2RDJA 1NJZA 4F5OA 9ICQA 9ICKA 4F5QA 3TANA 2UVRA 1IXRA 2V9WA 4M9HA 7ICFA 9ICBA 4GLXA 4Q8EA 4RPZA 3SYZA 5KFEA 1S9FA 1NK4A 1ZQNA 4LZGA 1BPZA 3TFSA 4B9SA 2ZUCA 4PGXA 3T5JA 2V4RA 1QSLA 4IQUA 2KZ3A 3C1ZA 4MFAA 5J2JA 4DQSA 4C8OA 4DSIA 4IRKA 4KLSA 4YXJA 5KFDA 2FLPA 4JV1A 4KLLA 3MR3A 4B9UA 7ICKA 8ICBA 1TFRA 2LYHA 3MFIA 3RAQA 8ICUA 3UQ2A 4DSFA 5D4BA 3H40A 4BXOA 3QZ8A 5HHIA 1ZQBA 2WTFA 3GV5B 5DQHA 1ZQWA 3BQ0A 5KG3A 3TQ1A 2BR0A 3Q8QB 4MFFA 2W9MA 2FPLA 4IRCA 4GXJA 1XC9A 2W8KA 5J2IA 5DQIA 2J6TA 3HW8A 4UBBA 5KFJA 4QW8A 4RPYA 2ASDA 5KFGA 2ASJA 4P4OA 3N4MB 4J9OA 3EWAA 2HW3A 4M9JA 4PGQA 4DOAA 1NK7A 3PO4A 5J2AA 1TAUA 4RZRA 4NLKA 1CEZA 3AU2A 4RQ5A 4TUQA 3ZDEA 8ICWA 4KLUA 4YD2A 4UAZA 4R63A 1K1QA 3OSPA 2PFQA 9ICIA 5CA7A 8ICPA 2ZUBA 5KFSA 1RXVA 4QWBA 4IR9A 4P2HA 5KFUA 3SV3A 4DWIA 3RH6A 2Y1JA 4DFJA 4B9MA 5CHGA 4ED0A 8ICNA 4Z6FA 2R8JA 2NRZA 2VA2A 3RJKA 2C2EA 5KG5A 7ICIA 4F4KA 1ZQHA 1ZJMA 1ZQLA 2J6SA 3PO5A 3Q8KA 2W9AA 1SKRA 3GFKB 3T5KA 4DL2A 4FBTA 4PHAA 1XS9D 4M04A 3GIKA 3AUOA 4GXKA 2ZJ5A 3N97B 4RQ3A 4KLOA 1PZNA 2XY6A 8ICEA 1KFDA 2NRVA 1UA0A 1NK8A 1N56A 3TI0A 1WCNA 1S10A 4IRDA 1BGXT 5DBBA 4QWDA 3THVA 2Y1IA 1JXLA 3MGIA 2XCAA 4O3OA 2JZBB 1KEJA 1ZQZA 5KT7A 3MFHA 4P4MA 4ZH4A 3V6JA 5DDYA 2GWSA 4I29A 4KLHA 3V7JA 5KFTA 4UQGA 5DG8A 4F5PA 3OGUA 1XSPA 4F8RA 2KN7A 1TVAA 3QE9Y 5KFVA 3RB4A 4F5NA 4Z6EA 2UVWA 1ZQCA 4KLIA 4YMOA 4Z6CA 2C2RA 4K4GA 3MABA 3JPQA 2PFNA 2HHXA 5DLFA 3H4BA 4ECRA 2ZUDA 3C1YA 5CJ7A 2FLLA 1JXEA 5J2DA 4I2HA 2HVHA 3JPSA 8ICIA 4FS1A 4XRHA 2ZTDA 1T8EA 4G3IA 3ZD9A 4KMUA 1L5UA 4M2YA 3UPQA 4I2CA 1K1SA 2NRXA 3C5GA 7ICSA 1XWLA 8ICFA 2NRTA 4YG2A 1BPDA 3MR6A 4R8UA 1ZQYA 5J2HA 9ICXA 4DFKA 4UAWA 2BPFA 4YMNA 1X9WA 3MGHA 3BJYA 2I9GA 1X2IA 3PW0A 1ZQJA 1NK5A 9ICCA 3JPRA 5KFNA 3ZDBA 3HX0A 3RJIA 4RQ2A 3BQTA 4RT2A 4DQRA 3OHAA 3T3FA 4M6WA 5DQGA 4RUCA 4PHEA 1QTMA 5HP4A 9ICGA 3SI8A 7ICJA 3K4GA 4J9PA 4EYIB 4DQQA 5J29A 1EXNA 5KG6A 3G6YA 4DQIA 2XY7A 4MEXA 3C2LA 7ICEA 8ICQA 2JEFA 3GV7B 3RRHA 3TAQA 4DL7A 4ECQA 4I2JA 1ZJNA 4GXIA 4F3OA 1BPBA 4PPXA 8ICLA 5KFMA 5J2BA 2AGQA 1MQ2A 2XGQA 8ICOA 5TZVA 4E0DA 1D8LA 2NRWA 1TKDA 4MF2A 1T4GA 1Z00B 3PW4A 1KRPA 2F1IA 1KTQA 4J9SA 3PR5B 4DF4A 2P6RA 4DSKA 4UB3A 4QZGA 5IINA 4EEYA 4Q44A 3K75D 5IIIA 4QW9A 4KTQA 5KFWA 3GILA 1KDHA 1NK0A 1SKWA 2BCSA 5HNKA 1S0NA 4QZBA 4YXMA 4RUAA 1HUZA 3RB0A 1TAQA 7ICOA 3C23A 5L1LA 3PVXA 3EZ5A 1ZQAA 4KN4A 5D46A 3BQ1A 4ED1A 2BPCA 2ZJ8A 5L1KA 4ED6A 2OWOA 4C8LA 8ICGA 3PNCA 4NLGA 4NLZA 3PY8A 9ICUA 3KHGA 1BPEA 4F91B 2XY5A 1MC8A 2R8HA 2KZZA 2AJQA 2ZTCA 1ZQKA 4ED2A 1A77A 1XSNA 4TQRA 2P6UA 4J9LA 4EBCA 3RR8A 4J9NA 2W9BB 2KFNA 4YD1A 4RQ8A 4UB5A 4O0IA 4RQ6A 5IILA 4UB1A 3IHQB 4DS4A 5KG1A 2HHSA 3KTQA 3GIJA 3PR4A 1WCLA 2W9CB 2FMSA 4RQ4A 2F1HA 4ECSA 5J2CA 3SV4A 1S76D 2AGOA 2BCVA 3E2EA 1NKEA 1S0OA 3M9OB 1ZQEA 4DSJA 1V9PA 4QZ9A 3RH5A 5KG4A 2BGWA 2F1JA 4ECZA 4YN4A 1X9SA 8ICXA 5DG9A 3ISCA 1UT5A 1ZQQA 1TV9A 1BPYA 1Z3EB 2ATLA 4DL4A 1MSWD 2A1JA 4BWJA 4QZFA 4P4PA 5J2EA 4MF8A 2IHMA 3T5HA 1S77D 8ICVA 3Q8MA 4C8MA 4GC6A 3KHHA 3Q8LA 8ICYA 3PW5A 4O5CA 4J9KA 2BQRA 4O5KA 4NM1A 5CWRA 5J0WA 4DLEA 4DLGA 2C22A 5KFPA 1UT8A 2AQ4A 2AU0A 1U45A 9ICEA 4ED3A 4F2SA 1IM4A 4NY8A 4BGDA 5KFRA 2DPIA 4FO6A 5DKWA 2ISOA 8ICRA 1ZQPA 5IIJA 2KZMA 1KLNA 2VANA 3GV8B 1TK8A 2MUTA 4I2GA 2ISPA 2JEIA 5J0RA 3EYZA 7ICLA 5J0SA 2UVVA 1B22A 1NKBA 2JEGA 5KFZA 1TK5A 3GQCA 3QEBZ 4ELTA 3HPOA 3UXPA 4I2FA 4EBEA 3B0YA 4ECUA 3JPOA 2BKEA 1ZETA 2ALZA 2FPMA 4ED8A 7ICHA 2RDIA 5KTQA 3PX6A 5F9LA 5IIOA 1LV5A 5J2FA 5IIKA 4YFKA 2BQ3A 3RH4A 4MFCA 5KFKA 4F4WA 3MR2A 5KT2A 4QZCA 2HHVA 2KTQA 3M9MB 4YR0A 4ECWA 1MQ3A 2PFPA 3JPNA 1ZQVA 1ZQFA 2FLNA 8ICHA 3H4DA 3KHRA 4IQTA 1RYSA 4M0AA 4I2AA 4LVSA 3RJGA 3V7LA 2BPGA 4YP3A 2PI5A 5KFAA 4Q45A 1C7YA 1D9DA 3V6HA 9ICHA 2R8IA 1U47A 1U4BA 2W8LA 2XO7A 3FYHA 1KFTA 4RQ0A 2M9NA 4F93B 3T5LA 1ZQMA 5KG2A 4I2BA 3M8RA 4KLEA 3ZDDA 1JIHA 5KFHA 4TQSA 4PHDA 5KFFA 5HMMA 4DFPA 4C8NA 2V4QA 1Y88A 2ZJAA 4R65A 4DFMA 3RJEA 9ICLA 4NM2A 4JK1A 4NXZA 3TARA 4XQ8A 1ZQTA 1QLNA 5DB9A 5F9NA 1NJXA 5IIMA 4BWMA 3TAPA 3GIIA 4DL3A 4RQ1A 9ICNA 4FS2A 4RNOA 2IBKA 4KLGA 4DSLA 3PX4A 1ZQUA 4O3SA 3LWMA 3NTUA 5EWEA 4UBCA 1DOQA 4ECXA 2UVUA 2HHTA 3ZDCA 1JN3A 9ICSA 4QZIA 4QWEA 5KFLA 7ICQA 5DBCA 2JZBA 4KLTA 4QWAA 4J9MA 5EOZA 1B43A 4BXOB 3M9NB 4NLNA 5DG7A 1T7PA 2VA3A 8ICAA 8ICKA 1L3SA 3OJSA 2BHNA 4RQ7A 4O3QA 3EPGA 4JUZA 3FDSA 5HMLA 5KFXA 3OHBA 9ICOA 2HHUA 3JPPA 3C2KA 3PMNA 1XU4A 4C8KA 5DLGA 4KLQA 4XA5A 4PGYA 1S0VA 3GIMA 1HJPA 2JEJA 5KT3A 5KFIA 3UXOA 1ZQXA 3ORYA 5KT4A 3MDCA 1NJYA 4YR2A 4YQWA 3RBEA 4X5VA 2FPKA 4DOBA 3RR7A 2A1JB 4UB2A 5KFOA 3ZDAA 4QZ8A 5EWFA 3HT3A 2AGPA 4M9NA 7ICPA 3PX0A 8ICCA 3G6XA 1NK9A 2PI4A 4HYKA 4EZ9A 1ZQDA 9ICAA 4ECVA 3C21A 3RJFA 1U9LA 5KFYA 7ICNA 4I2IA 5D49A 2C2DA 1JX4A 3SZ2A 3H7IA 4F92B 3ETLA 1RPLA 4B9TA 2HHQA 4IQWA 1BVSA 5DB8A 5BOLA 4RNMA 3MR5A 3UQ0A 3V72A 4DL6A 2MUTB 9ICFA 2XGPA 5CP2A 4B9NA 2DFLA 1D8YA 1Z00A 4YCXA 4F4YA 3PV8A 3IM1A 3V6KA 1ZQSA 4ECYA 1JMSA 9ICJA 5CB1A 1KFSA 4JWMA 5C5JA 3H8WA 4DEZA 3JPTA 1SL1A 8ICSA 4F50A 5HHHA 7ICMA 3Q8RB 3KHLA 5DGAA 9ICPA 3G6VA 2I1QA 4R66A 3RJJA 4KN7A 1N48A 1H38A 1ZQIA 4ELVA 2KFZA 4F4XA 9ICTA 5DB7A 4KLJA 1A76A 1ZYQA 4EBDA 2IHNA 4B9VA 4K4IA 1S97A 4XUSA 3PMLA 4FBUA 3AU6A 9ICWA 1SL2A 4DQPA 4RT3A 2PFOA 4M9LA 1XO1A 3RTVA 1U48A 1RZTA 2MAXA 3LDAA 5KFQA 4QZAA 1SKSA 8ICJA 3MDAA 5DB6A 2W9BA 2AQ0A 5KT5A 5L1IA 1LB2B 4O3RA 1CUKA 4Q8FA 5J0QA 2IA6A 1RYRA 4LZDA 3UXNA 5J0OA 4M47A 4KLMA 4R8UB 3RJHA 5DDMA 5KFCA 8ICTA 4DL5A 2W9CA 4IR1A 4DF8A 4IQVA 2BDPA 2FMPA 4I2DA 1TK0A 4JWNA 1QSYA 2IMWP 4YVZA 4RU9A 4RNNA 4F5RA 2C28A 3H8JA 1L3VA 2BCQA 3OSNA 1COOA 4M6WB 4QZEA 1X9MA 4KITB 4RPXA 4QWCA 3LK9A 3GDXA 7ICVA 1SZPA 2HVIA 2BCRA 8ICZA 5DBAA 4TUPA 2B21A 1NOMA 3RBDA 3Q8SB 3MBYA 3RB6A 4CCHA 3ISBA 2VA8A 5DGBA 4R64A 4UAYA 3RB3A 5KG7A 4QZDA 1ZQOA 3RRGA 4K4HA 5J0PA 1RXWA 2HHWA 5JUMA 3PW2A 2P66A 4YMMA 1NK6A 2Q0ZX 3Q8PB 1T3NA 1L3UA 4B9LA 4I27A 2FMQA 2ZTEA 4O5EA 1DGSA 4ECTA 1U49A 2J6UA 1S0MA 1HUOA 4UB4A 3EW9A 4Z6DA 3QEAZ 4O9MA 3HWTA 4F2RA 1XSLA 4EYHB 2H5XA 8ICMA 9ICVA 5L1JA 5J0UA 5J0XA 1SL0A 2BCUA 4ELUA 7ICRA 4PH5A 5J0YA 5J2KA 2R8GA 5BOMA 7ICUA 3LWLA 3HP6A 4DS5A 3QZ7A 4F4ZA 4I2EA 7ICTA 4TUSA 4KLDA 1BPXA 1UA1A 3C2MA 3ZD8A 3ISDA 3V7KA 1NJWA 1NKCA 4YR3A 4O3NA 3B0XA 5KT6A 1KSPA 1L3TA 5KFBA 5EWGA 9ICMA 3EPIA 5L9XA 3C5FA 3RAXA 4JV0A 2XC9A 9ICRA 4O3PA 2DPJA 2ASLA 5J0TA 1D9FA 4JV2A 3PW7A 5CR0A 4EZ6A 4DSEA 4J9RA 4GC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q43 A;  2PXI A;  4QZH A;  1QSS A;  4DOC A;  5J2G A;  1ZQG A;  1ZQR A;  4ED7 A;  4PHP A;  4MEY A;  3NGD A;  2XCP A;  4I28 A;  4TUR A;  4DO9 A;  7ICG A;  4BDP A;  3M8S A;  3OJU A;  3BQ2 A;  1ARO P;  3H8S A;  4J9Q A;  3TFR A;  3BDP A;  4KLF A;  4M9G A;  2R8K A;  5BPC A;  5KG0 A;  2BQU A;  2RDJ A;  1NJZ A;  4F5O A;  9ICQ A;  9ICK A;  4F5Q A;  3TAN A;  2UVR A;  1IXR A;  2V9W A;  4M9H A;  7ICF A;  9ICB A;  4GLX A;  4Q8E A;  4RPZ A;  3SYZ A;  5KFE A;  1S9F A;  1NK4 A;  1ZQN A;  4LZG A;  1BPZ A;  3TFS A;  4B9S A;  2ZUC A;  4PGX A;  3T5J A;  2V4R A;  1QSL A;  4IQU A;  2KZ3 A;  3C1Z A;  4MFA A;  5J2J A;  4DQS A;  4C8O A;  4DSI A;  4IRK A;  4KLS A;  4YXJ A;  5KFD A;  2FLP A;  4JV1 A;  4KLL A;  3MR3 A;  4B9U A;  7ICK A;  8ICB A;  1TFR A;  2LYH A;  3MFI A;  3RAQ A;  8ICU A;  3UQ2 A;  4DSF A;  5D4B A;  3H40 A;  4BXO A;  3QZ8 A;  5HHI A;  1ZQB A;  2WTF A;  3GV5 B;  5DQH A;  1ZQW A;  3BQ0 A;  5KG3 A;  3TQ1 A;  2BR0 A;  3Q8Q B;  4MFF A;  2W9M A;  2FPL A;  4IRC A;  4GXJ A;  1XC9 A;  2W8K A;  5J2I A;  5DQI A;  2J6T A;  3HW8 A;  4UBB A;  5KFJ A;  4QW8 A;  4RPY A;  2ASD A;  5KFG A;  2ASJ A;  4P4O A;  3N4M B;  4J9O A;  3EWA A;  2HW3 A;  4M9J A;  4PGQ A;  4DOA A;  1NK7 A;  3PO4 A;  5J2A A;  1TAU A;  4RZR A;  4NLK A;  1CEZ A;  3AU2 A;  4RQ5 A;  4TUQ A;  3ZDE A;  8ICW A;  4KLU A;  4YD2 A;  4UAZ A;  4R63 A;  1K1Q A;  3OSP A;  2PFQ A;  9ICI A;  5CA7 A;  8ICP A;  2ZUB A;  5KFS A;  1RXV A;  4QWB A;  4IR9 A;  4P2H A;  5KFU A;  3SV3 A;  4DWI A;  3RH6 A;  2Y1J A;  4DFJ A;  4B9M A;  5CHG A;  4ED0 A;  8ICN A;  4Z6F A;  2R8J A;  2NRZ A;  2VA2 A;  3RJK A;  2C2E A;  5KG5 A;  7ICI A;  4F4K A;  1ZQH A;  1ZJM A;  1ZQL A;  2J6S A;  3PO5 A;  3Q8K A;  2W9A A;  1SKR A;  3GFK B;  3T5K A;  4DL2 A;  4FBT A;  4PHA A;  1XS9 D;  4M04 A;  3GIK A;  3AUO A;  4GXK A;  2ZJ5 A;  3N97 B;  4RQ3 A;  4KLO A;  1PZN A;  2XY6 A;  8ICE A;  1KFD A;  2NRV A;  1UA0 A;  1NK8 A;  1N56 A;  3TI0 A;  1WCN A;  1S10 A;  4IRD A;  1BGX T;  5DBB A;  4QWD A;  3THV A;  2Y1I A;  1JXL A;  3MGI A;  2XCA A;  4O3O A;  2JZB B;  1KEJ A;  1ZQZ A;  5KT7 A;  3MFH A;  4P4M A;  4ZH4 A;  3V6J A;  5DDY A;  2GWS A;  4I29 A;  4KLH A;  3V7J A;  5KFT A;  4UQG A;  5DG8 A;  4F5P A;  3OGU A;  1XSP A;  4F8R A;  2KN7 A;  1TVA A;  3QE9 Y;  5KFV A;  3RB4 A;  4F5N A;  4Z6E A;  2UVW A;  1ZQC A;  4KLI A;  4YMO A;  4Z6C A;  2C2R A;  4K4G A;  3MAB A;  3JPQ A;  2PFN A;  2HHX A;  5DLF A;  3H4B A;  4ECR A;  2ZUD A;  3C1Y A;  5CJ7 A;  2FLL A;  1JXE A;  5J2D A;  4I2H A;  2HVH A;  3JPS A;  8ICI A;  4FS1 A;  4XRH A;  2ZTD A;  1T8E A;  4G3I A;  3ZD9 A;  4KMU A;  1L5U A;  4M2Y A;  3UPQ A;  4I2C A;  1K1S A;  2NRX A;  3C5G A;  7ICS A;  1XWL A;  8ICF A;  2NRT A;  4YG2 A;  1BPD A;  3MR6 A;  4R8U A;  1ZQY A;  5J2H A;  9ICX A;  4DFK A;  4UAW A;  2BPF A;  4YMN A;  1X9W A;  3MGH A;  3BJY A;  2I9G A;  1X2I A;  3PW0 A;  1ZQJ A;  1NK5 A;  9ICC A;  3JPR A;  5KFN A;  3ZDB A;  3HX0 A;  3RJI A;  4RQ2 A;  3BQT A;  4RT2 A;  4DQR A;  3OHA A;  3T3F A;  4M6W A;  5DQG A;  4RUC A;  4PHE A;  1QTM A;  5HP4 A;  9ICG A;  3SI8 A;  7ICJ A;  3K4G A;  4J9P A;  4EYI B;  4DQQ A;  5J29 A;  1EXN A;  5KG6 A;  3G6Y A;  4DQI A;  2XY7 A;  4MEX A;  3C2L A;  7ICE A;  8ICQ A;  2JEF A;  3GV7 B;  3RRH A;  3TAQ A;  4DL7 A;  4ECQ A;  4I2J A;  1ZJN A;  4GXI A;  4F3O A;  1BPB A;  4PPX A;  8ICL A;  5KFM A;  5J2B A;  2AGQ A;  1MQ2 A;  2XGQ A;  8ICO A;  5TZV A;  4E0D A;  1D8L A;  2NRW A;  1TKD A;  4MF2 A;  1T4G A;  1Z00 B;  3PW4 A;  1KRP A;  2F1I A;  1KTQ A;  4J9S A;  3PR5 B;  4DF4 A;  2P6R A;  4DSK A;  4UB3 A;  4QZG A;  5IIN A;  4EEY A;  4Q44 A;  3K75 D;  5III A;  4QW9 A;  4KTQ A;  5KFW A;  3GIL A;  1KDH A;  1NK0 A;  1SKW A;  2BCS A;  5HNK A;  1S0N A;  4QZB A;  4YXM A;  4RUA A;  1HUZ A;  3RB0 A;  1TAQ A;  7ICO A;  3C23 A;  5L1L A;  3PVX A;  3EZ5 A;  1ZQA A;  4KN4 A;  5D46 A;  3BQ1 A;  4ED1 A;  2BPC A;  2ZJ8 A;  5L1K A;  4ED6 A;  2OWO A;  4C8L A;  8ICG A;  3PNC A;  4NLG A;  4NLZ A;  3PY8 A;  9ICU A;  3KHG A;  1BPE A;  4F91 B;  2XY5 A;  1MC8 A;  2R8H A;  2KZZ A;  2AJQ A;  2ZTC A;  1ZQK A;  4ED2 A;  1A77 A;  1XSN A;  4TQR A;  2P6U A;  4J9L A;  4EBC A;  3RR8 A;  4J9N A;  2W9B B;  2KFN A;  4YD1 A;  4RQ8 A;  4UB5 A;  4O0I A;  4RQ6 A;  5IIL A;  4UB1 A;  3IHQ B;  4DS4 A;  5KG1 A;  2HHS A;  3KTQ A;  3GIJ A;  3PR4 A;  1WCL A;  2W9C B;  2FMS A;  4RQ4 A;  2F1H A;  4ECS A;  5J2C A;  3SV4 A;  1S76 D;  2AGO A;  2BCV A;  3E2E A;  1NKE A;  1S0O A;  3M9O B;  1ZQE A;  4DSJ A;  1V9P A;  4QZ9 A;  3RH5 A;  5KG4 A;  2BGW A;  2F1J A;  4ECZ A;  4YN4 A;  1X9S A;  8ICX A;  5DG9 A;  3ISC A;  1UT5 A;  1ZQQ A;  1TV9 A;  1BPY A;  1Z3E B;  2ATL A;  4DL4 A;  1MSW D;  2A1J A;  4BWJ A;  4QZF A;  4P4P A;  5J2E A;  4MF8 A;  2IHM A;  3T5H A;  1S77 D;  8ICV A;  3Q8M A;  4C8M A;  4GC6 A;  3KHH A;  3Q8L A;  8ICY A;  3PW5 A;  4O5C A;  4J9K A;  2BQR A;  4O5K A;  4NM1 A;  5CWR A;  5J0W A;  4DLE A;  4DLG A;  2C22 A;  5KFP A;  1UT8 A;  2AQ4 A;  2AU0 A;  1U45 A;  9ICE A;  4ED3 A;  4F2S A;  1IM4 A;  4NY8 A;  4BGD A;  5KFR A;  2DPI A;  4FO6 A;  5DKW A;  2ISO A;  8ICR A;  1ZQP A;  5IIJ A;  2KZM A;  1KLN A;  2VAN A;  3GV8 B;  1TK8 A;  2MUT A;  4I2G A;  2ISP A;  2JEI A;  5J0R A;  3EYZ A;  7ICL A;  5J0S A;  2UVV A;  1B22 A;  1NKB A;  2JEG A;  5KFZ A;  1TK5 A;  3GQC A;  3QEB Z;  4ELT A;  3HPO A;  3UXP A;  4I2F A;  4EBE A;  3B0Y A;  4ECU A;  3JPO A;  2BKE A;  1ZET A;  2ALZ A;  2FPM A;  4ED8 A;  7ICH A;  2RDI A;  5KTQ A;  3PX6 A;  5F9L A;  5IIO A;  1LV5 A;  5J2F A;  5IIK A;  4YFK A;  2BQ3 A;  3RH4 A;  4MFC A;  5KFK A;  4F4W A;  3MR2 A;  5KT2 A;  4QZC A;  2HHV A;  2KTQ A;  3M9M B;  4YR0 A;  4ECW A;  1MQ3 A;  2PFP A;  3JPN A;  1ZQV A;  1ZQF A;  2FLN A;  8ICH A;  3H4D A;  3KHR A;  4IQT A;  1RYS A;  4M0A A;  4I2A A;  4LVS A;  3RJG A;  3V7L A;  2BPG A;  4YP3 A;  2PI5 A;  5KFA A;  4Q45 A;  1C7Y A;  1D9D A;  3V6H A;  9ICH A;  2R8I A;  1U47 A;  1U4B A;  2W8L A;  2XO7 A;  3FYH A;  1KFT A;  4RQ0 A;  2M9N A;  4F93 B;  3T5L A;  1ZQM A;  5KG2 A;  4I2B A;  3M8R A;  4KLE A;  3ZDD A;  1JIH A;  5KFH A;  4TQS A;  4PHD A;  5KFF A;  5HMM A;  4DFP A;  4C8N A;  2V4Q A;  1Y88 A;  2ZJA A;  4R65 A;  4DFM A;  3RJE A;  9ICL A;  4NM2 A;  4JK1 A;  4NXZ A;  3TAR A;  4XQ8 A;  1ZQT A;  1QLN A;  5DB9 A;  5F9N A;  1NJX A;  5IIM A;  4BWM A;  3TAP A;  3GII A;  4DL3 A;  4RQ1 A;  9ICN A;  4FS2 A;  4RNO A;  2IBK A;  4KLG A;  4DSL A;  3PX4 A;  1ZQU A;  4O3S A;  3LWM A;  3NTU A;  5EWE A;  4UBC A;  1DOQ A;  4ECX A;  2UVU A;  2HHT A;  3ZDC A;  1JN3 A;  9ICS A;  4QZI A;  4QWE A;  5KFL A;  7ICQ A;  5DBC A;  2JZB A;  4KLT A;  4QWA A;  4J9M A;  5EOZ A;  1B43 A;  4BXO B;  3M9N B;  4NLN A;  5DG7 A;  1T7P A;  2VA3 A;  8ICA A;  8ICK A;  1L3S A;  3OJS A;  2BHN A;  4RQ7 A;  4O3Q A;  3EPG A;  4JUZ A;  3FDS A;  5HML A;  5KFX A;  3OHB A;  9ICO A;  2HHU A;  3JPP A;  3C2K A;  3PMN A;  1XU4 A;  4C8K A;  5DLG A;  4KLQ A;  4XA5 A;  4PGY A;  1S0V A;  3GIM A;  1HJP A;  2JEJ A;  5KT3 A;  5KFI A;  3UXO A;  1ZQX A;  3ORY A;  5KT4 A;  3MDC A;  1NJY A;  4YR2 A;  4YQW A;  3RBE A;  4X5V A;  2FPK A;  4DOB A;  3RR7 A;  2A1J B;  4UB2 A;  5KFO A;  3ZDA A;  4QZ8 A;  5EWF A;  3HT3 A;  2AGP A;  4M9N A;  7ICP A;  3PX0 A;  8ICC A;  3G6X A;  1NK9 A;  2PI4 A;  4HYK A;  4EZ9 A;  1ZQD A;  9ICA A;  4ECV A;  3C21 A;  3RJF A;  1U9L A;  5KFY A;  7ICN A;  4I2I A;  5D49 A;  2C2D A;  1JX4 A;  3SZ2 A;  3H7I A;  4F92 B;  3ETL A;  1RPL A;  4B9T A;  2HHQ A;  4IQW A;  1BVS A;  5DB8 A;  5BOL A;  4RNM A;  3MR5 A;  3UQ0 A;  3V72 A;  4DL6 A;  2MUT B;  9ICF A;  2XGP A;  5CP2 A;  4B9N A;  2DFL A;  1D8Y A;  1Z00 A;  4YCX A;  4F4Y A;  3PV8 A;  3IM1 A;  3V6K A;  1ZQS A;  4ECY A;  1JMS A;  9ICJ A;  5CB1 A;  1KFS A;  4JWM A;  5C5J A;  3H8W A;  4DEZ A;  3JPT A;  1SL1 A;  8ICS A;  4F50 A;  5HHH A;  7ICM A;  3Q8R B;  3KHL A;  5DGA A;  9ICP A;  3G6V A;  2I1Q A;  4R66 A;  3RJJ A;  4KN7 A;  1N48 A;  1H38 A;  1ZQI A;  4ELV A;  2KFZ A;  4F4X A;  9ICT A;  5DB7 A;  4KLJ A;  1A76 A;  1ZYQ A;  4EBD A;  2IHN A;  4B9V A;  4K4I A;  1S97 A;  4XUS A;  3PML A;  4FBU A;  3AU6 A;  9ICW A;  1SL2 A;  4DQP A;  4RT3 A;  2PFO A;  4M9L A;  1XO1 A;  3RTV A;  1U48 A;  1RZT A;  2MAX A;  3LDA A;  5KFQ A;  4QZA A;  1SKS A;  8ICJ A;  3MDA A;  5DB6 A;  2W9B A;  2AQ0 A;  5KT5 A;  5L1I A;  1LB2 B;  4O3R A;  1CUK A;  4Q8F A;  5J0Q A;  2IA6 A;  1RYR A;  4LZD A;  3UXN A;  5J0O A;  4M47 A;  4KLM A;  4R8U B;  3RJH A;  5DDM A;  5KFC A;  8ICT A;  4DL5 A;  2W9C A;  4IR1 A;  4DF8 A;  4IQV A;  2BDP A;  2FMP A;  4I2D A;  1TK0 A;  4JWN A;  1QSY A;  2IMW P;  4YVZ A;  4RU9 A;  4RNN A;  4F5R A;  2C28 A;  3H8J A;  1L3V A;  2BCQ A;  3OSN A;  1COO A;  4M6W B;  4QZE A;  1X9M A;  4KIT B;  4RPX A;  4QWC A;  3LK9 A;  3GDX A;  7ICV A;  1SZP A;  2HVI A;  2BCR A;  8ICZ A;  5DBA A;  4TUP A;  2B21 A;  1NOM A;  3RBD A;  3Q8S B;  3MBY A;  3RB6 A;  4CCH A;  3ISB A;  2VA8 A;  5DGB A;  4R64 A;  4UAY A;  3RB3 A;  5KG7 A;  4QZD A;  1ZQO A;  3RRG A;  4K4H A;  5J0P A;  1RXW A;  2HHW A;  5JUM A;  3PW2 A;  2P66 A;  4YMM A;  1NK6 A;  2Q0Z X;  3Q8P B;  1T3N A;  1L3U A;  4B9L A;  4I27 A;  2FMQ A;  2ZTE A;  4O5E A;  1DGS A;  4ECT A;  1U49 A;  2J6U A;  1S0M A;  1HUO A;  4UB4 A;  3EW9 A;  4Z6D A;  3QEA Z;  4O9M A;  3HWT A;  4F2R A;  1XSL A;  4EYH B;  2H5X A;  8ICM A;  9ICV A;  5L1J A;  5J0U A;  5J0X A;  1SL0 A;  2BCU A;  4ELU A;  7ICR A;  4PH5 A;  5J0Y A;  5J2K A;  2R8G A;  5BOM A;  7ICU A;  3LWL A;  3HP6 A;  4DS5 A;  3QZ7 A;  4F4Z A;  4I2E A;  7ICT A;  4TUS A;  4KLD A;  1BPX A;  1UA1 A;  3C2M A;  3ZD8 A;  3ISD A;  3V7K A;  1NJW A;  1NKC A;  4YR3 A;  4O3N A;  3B0X A;  5KT6 A;  1KSP A;  1L3T A;  5KFB A;  5EWG A;  9ICM A;  3EPI A;  5L9X A;  3C5F A;  3RAX A;  4JV0 A;  2XC9 A;  9ICR A;  4O3P A;  2DPJ A;  2ASL A;  5J0T A;  1D9F A;  4JV2 A;  3PW7 A;  5CR0 A;  4EZ6 A;  4DSE A;  4J9R A;  4GC7 A; 
#chains in the Genus database with same CATH topology
 4EX6 A;  4QZH A;  1QSS A;  2KVS A;  5J2G A;  3BS5 A;  3WK6 A;  2ZIX A;  3NGD A;  2XCP A;  4I28 A;  2K8C B;  7ICG A;  4BDP A;  4CF3 A;  3BQ2 A;  4J9Q A;  4KLF A;  5ALY A;  5BPC A;  5KG0 A;  5ALN A;  1B4F A;  9ICB A;  3NVV A;  2ZXH A;  2YTU A;  5KFE A;  1ZQN A;  5KL8 B;  1QSL A;  4DSI A;  2EAO A;  2LM4 A;  2FLP A;  5ALU A;  4KLL A;  3MR3 A;  1TFR A;  8ICU A;  3UQ2 A;  4DSF A;  1URJ A;  2D3D A;  2I5H A;  3E58 A;  3WKC A;  3TQ1 A;  2WB1 C;  2JR5 A;  1XC9 A;  2J6T A;  4UBB A;  4RPY A;  2ASD A;  2E8O A;  1SWV A;  5AKJ A;  3N4M B;  4J9O A;  4PGQ A;  5J2A A;  4NLK A;  1J2N A;  2OHF A;  4YD2 A;  3WKB A;  2KJ8 A;  9ICI A;  2FDR A;  2E3T A;  5CA7 A;  5ALL A;  3SR6 A;  1RXV A;  4IR9 A;  4DWI A;  3SV3 A;  2H3I A;  3RH6 A;  1D8B A;  5CHG A;  4IL6 U;  3CNH A;  2VA2 A;  2C2E A;  3AEV A;  1ZJM A;  4FFD A;  2AXT U;  2KIV A;  3GFK B;  4NWI A;  4DL2 A;  4FBT A;  4C80 A;  3FM9 A;  3ALR A;  8ICE A;  1KFD A;  1N56 A;  1S10 A;  4Y2X A;  1BGX T;  1X66 A;  1JXL A;  2XCA A;  2ODG A;  3MFH A;  3V6J A;  4I29 A;  4UQG A;  1QCK A;  2KN7 A;  2W03 A;  3QE9 Y;  3RB4 A;  4F5N A;  4YMO A;  4Z6C A;  3D2N A;  1X42 A;  2H3F A;  2XI9 A;  3MAB A;  8ICI A;  3JPS A;  4G3I A;  3MGV A;  4KMU A;  4I2C A;  1ZQY A;  4UAW A;  2BPF A;  1X9W A;  3MGH A;  1X2I A;  1NK5 A;  3ZDB A;  3HX0 A;  3RJI A;  4RQ2 A;  4DQR A;  4PHE A;  5AM3 A;  3SI8 A;  5J29 A;  3G6Y A;  2ZG6 A;  4DQI A;  4MEX A;  3CRX A;  3GV7 B;  4G9B A;  4ECQ A;  1BPB A;  3GZF A;  4CE6 A;  3HIL A;  4MF2 A;  1TKD A;  1P7D A;  1T4G A;  3IG8 A;  3PW4 A;  1CI4 A;  2F1I A;  2O6K A;  4J9S A;  4DF4 A;  3PR5 B;  1KRP A;  2P6R A;  4DFD A;  5ALF A;  4QZG A;  5AM1 A;  4QW9 A;  2ZIV B;  5III A;  1KDH A;  3SEN A;  1SKW A;  3BQ7 A;  5L1L A;  2H3Q A;  3BQ1 A;  1VDV A;  4NLG A;  4UW9 A;  9ICU A;  3KHG A;  1BPE A;  2R8H A;  1ZQK A;  1XSN A;  3QU5 A;  5AI9 A;  1F0M A;  4O0I A;  2VKQ A;  4DS4 A;  3KTQ A;  2K4P A;  3PR4 A;  2F1H A;  3CW2 C;  5J2C A;  2G09 A;  3RH5 A;  4QZ9 A;  4ECZ A;  3AN1 A;  8ICX A;  1TV9 A;  1N61 A;  4BWJ A;  4MF8 A;  2XVT A;  1S77 D;  4IS7 A;  4C8M A;  8ICY A;  4O5C A;  2BQR A;  4O5K A;  5A0L A;  4C0Z A;  1F44 A;  1UT8 A;  2WF8 A;  2AU0 A;  3F53 A;  1U45 A;  2RLT A;  4NY8 A;  4EEK A;  2LPE A;  2ISO A;  2VAN A;  3GV8 B;  3B9J A;  1B22 A;  2UVV A;  2EH9 A;  2JEG A;  1Z19 A;  2JH7 A;  4BX9 C;  1RQL A;  4FE3 A;  2ALZ A;  1QQ5 A;  3WKE A;  4YFK A;  2QAR A;  3GU3 A;  5B5E U;  2CRX A;  5AK6 A;  3M9M B;  3ICX A;  3F5A A;  3H4D A;  5GTI U;  4IQT A;  1RYS A;  3C29 A;  2W7P A;  4Q45 A;  3BS5 B;  9ICH A;  1U4B A;  2ZIX B;  2XO7 A;  4RQ0 A;  4R65 A;  3RJE A;  5EE9 A;  5T14 A;  1QLN A;  4KMO B;  5DB9 A;  1NJX A;  4QIW C;  5IIM A;  1PVR A;  1J2M A;  1NI3 A;  4DL3 A;  4RQ1 A;  1KL9 A;  1ZQU A;  4O3S A;  3NTU A;  1NZP A;  1TAM A;  4UBC A;  2KSO B;  3ZDC A;  1JN3 A;  3N7R C;  5KFL A;  1KKX A;  4KLT A;  4BUG A;  4J9M A;  1B43 A;  3M9N B;  3SAG A;  3OJS A;  5ALO A;  1ZD2 P;  1S5L U;  2DKX A;  9ICO A;  3NS1 A;  2E5S A;  5KAF U;  1NZB A;  4C7Y A;  4KLQ A;  4XA5 A;  3GIM A;  2Y0S F;  5ALI A;  2HBK A;  4X5V A;  2A1J B;  5AK5 A;  4QZ8 A;  7ICP A;  3G6X A;  2HBM A;  2WF6 A;  2KEY A;  4ECV A;  5KFY A;  1L7M A;  2RQ5 A;  1RM6 C;  5AKK A;  3SZ2 A;  4F92 B;  1JX4 A;  3C28 A;  3CP8 A;  2I6X A;  5ALT A;  1BVS A;  2MA1 A;  1D8Y A;  5ALD A;  2DKZ A;  3IM1 A;  4P0P A;  9ICJ A;  1SL1 A;  1S8O A;  7ICM A;  9ICP A;  2HCF A;  2I1Q A;  4R66 A;  1N48 A;  2KFZ A;  5DB7 A;  2CXY A;  2IHN A;  5AI8 A;  1OUQ A;  3AU6 A;  1WG8 A;  3RTV A;  3NVZ A;  2F44 A;  1RZT A;  1SKS A;  8ICJ A;  5DB6 A;  5KT5 A;  3HKZ F;  2YQE A;  4Y2Y A;  3SEI A;  4LZD A;  4M47 A;  3IDW A;  8ICT A;  4DL5 A;  2W9C A;  4IR1 A;  2HDO A;  4JWN A;  2IMW P;  2NV3 A;  2N1R A;  1ECW A;  1L3V A;  3OSN A;  4KIT B;  2WAQ C;  1COK A;  3CYM A;  3IRU A;  2G0A A;  7ICV A;  2KD1 A;  2B21 A;  3RB6 A;  3NVY A;  2HBL A;  3ISB A;  2VA8 A;  5DGB A;  4R64 A;  3RB3 A;  1ZQO A;  2G5I B;  2Q0Z X;  3Q8P B;  1T3N A;  2FMQ A;  3H0M B;  1DGS A;  1U49 A;  1L7N A;  2IOH A;  3QEA Z;  4Z6D A;  2G5H B;  1L7O A;  4F2R A;  5GTH U;  4DCC A;  2LI6 A;  5L1J A;  5J0X A;  5J2K A;  5BOM A;  7ICT A;  3QZ7 A;  3TKA A;  4KLD A;  1NJW A;  3QUB A;  4CF4 A;  5KFB A;  2HMX A;  4O3P A;  1RDF A;  2E8N A;  4JV2 A;  4C4R A;  4Q43 A;  4DOC A;  3AQF A;  2E1E A;  1L8L A;  4ED7 A;  1ZRN A;  3S6J A;  2KKP A;  4DO9 A;  3M8S A;  3OJU A;  1ARO P;  3BDP A;  2AH5 A;  4AYB C;  2RDJ A;  1NJZ A;  4F5O A;  9ICQ A;  1N63 A;  5AM4 A;  7ICF A;  4EEN A;  4GLX A;  2WF5 A;  4Q8E A;  3SYZ A;  1NK4 A;  4LZG A;  3DDH A;  3TFS A;  2ZUC A;  4OD0 A;  2OM6 A;  3T79 A;  4KTQ A;  2LKY A;  2KZ3 A;  3C1Z A;  5J2J A;  4JV1 A;  1T3Q A;  4KX3 A;  4P0Q B;  4HAI A;  8ICB A;  3MFI A;  3RAQ A;  5D4B A;  3H40 A;  5HHI A;  1ZQB A;  2WTF A;  3GV5 B;  5DQH A;  1ZQW A;  3BQ0 A;  3Q8Q B;  1UPH A;  2W9M A;  4IRC A;  4A8E A;  3FC4 A;  2W8K A;  1Q8K A;  5DQI A;  4ACO A;  2QAR B;  5KFJ A;  4FZN A;  1JUD A;  1UCV A;  2K4H A;  1QQ6 A;  1TE2 A;  2HW3 A;  1TAU A;  1KBU A;  1Q3U A;  1CEZ A;  1ZQ1 C;  3L4P A;  4KLU A;  2F2A B;  2QKQ A;  4US8 A;  4R63 A;  2KMD A;  4Y2J A;  2MSN A;  3OSP A;  3WK9 A;  2P35 A;  5KFS A;  3PST A;  4DFJ A;  4B9M A;  2K8A A;  2YX8 A;  5KG5 A;  1ZQL A;  2J6S A;  3Q8K A;  5AKL A;  5JTI A;  2GH1 A;  2H3Z A;  2QLT A;  5J8Y C;  2F3N A;  4PHA A;  3GIK A;  2JXJ A;  3N97 B;  1K5O A;  2XY6 A;  2NRV A;  2B0C A;  1UA0 A;  3TI0 A;  3I28 A;  2KHQ A;  5DBB A;  3THV A;  2HSZ A;  4O3O A;  1KEJ A;  3WU2 U;  5DDY A;  2WHE A;  2VIX A;  3QU7 A;  5DG8 A;  4F5P A;  3OGU A;  1IG6 A;  1SWW A;  4RQN A;  4OO1 J;  4KLI A;  2C2R A;  3H4B A;  4ECR A;  4FS1 A;  2ZTD A;  1T8E A;  5JRT A;  1OW5 A;  2NRX A;  3C5G A;  1XWL A;  4YG2 A;  1L8O A;  2K89 A;  3BJY A;  2DQN B;  3T3F A;  3OHA A;  5ALS A;  3K4G A;  4J9P A;  3SAF A;  2XY7 A;  3TAQ A;  4I2J A;  4UAU A;  4PPX A;  2ZIW A;  4NLC A;  4E0D A;  1KN5 A;  1D8L A;  2NRW A;  5ALE A;  3I1Y A;  1KTQ A;  4DSK A;  4C4S A;  2LMR A;  3QUQ A;  4P0P B;  5IIN A;  1NK0 A;  2BCS A;  3PVX A;  1ZQA A;  2KSO A;  3PNC A;  1MC8 A;  1A77 A;  3FAH A;  2P6U A;  2KFN A;  4J9N A;  4YD1 A;  4UB5 A;  1ZOL A;  4UB8 U;  4JMU A;  3IHQ B;  5KG1 A;  2HHS A;  2DWQ A;  3GIJ A;  1WCL A;  2W9C B;  2FMS A;  4ECS A;  3LVV A;  2BCV A;  1NKE A;  2KK0 A;  1V9P A;  4YN4 A;  3ISC A;  1UT5 A;  4OJO A;  1ZQQ A;  3IP4 B;  2A1J A;  2CPR A;  3HKZ C;  8ICV A;  3Q8M A;  3Q8L A;  3PW5 A;  4J9K A;  1LVH A;  5AKG A;  5CWR A;  5KFP A;  9ICE A;  4F2S A;  1MA7 A;  1JI7 A;  4FO6 A;  5DKW A;  2Q4T A;  8ICR A;  1ZQP A;  5IIJ A;  4I2G A;  1TK8 A;  2JEI A;  3EYZ A;  1NKB A;  1ZXI A;  2KVC A;  2LBO A;  4I2F A;  4EBE A;  3B0Y A;  3E0F A;  3JPO A;  2BKE A;  1N2X A;  1ZET A;  2BQ3 A;  3BS7 A;  2YMQ A;  1ZD5 A;  2KTQ A;  4ECW A;  3QU9 A;  2PFP A;  3JPN A;  1ZQV A;  8ICH A;  3QU4 A;  5KFA A;  1D9D A;  2W8L A;  3FYH A;  1KFT A;  2M9N A;  2YN4 A;  4UB6 U;  3T5L A;  3ZDD A;  5HMM A;  1Y88 A;  2ZJA A;  3LVW A;  3KKA A;  4NM2 A;  4NXZ A;  2XIC A;  4XQ8 A;  5KNI A;  1T94 A;  5F9N A;  3TAP A;  3GII A;  3AQE A;  2IBK A;  4DSL A;  1DOQ A;  4QWE A;  3KOO A;  7ICQ A;  1DGJ A;  2JZB A;  1WWV A;  1JRO A;  5HR6 A;  5EOZ A;  5DG7 A;  2Y9T A;  8ICK A;  1Z4O A;  2BHN A;  4O3Q A;  3EPG A;  3QYP A;  5HML A;  5KFX A;  3JPP A;  1HIW A;  4PGY A;  2VJ5 A;  5KFI A;  1ZQX A;  3MDC A;  4YQW A;  2FPK A;  4DOB A;  3UMC A;  2EAM A;  4OJ5 A;  4UB2 A;  3ZDA A;  3HT3 A;  2LHT A;  2G06 A;  5AKH A;  2PI4 A;  2DL0 A;  3L5K A;  1ZQD A;  1X40 A;  9ICA A;  3C21 A;  7ICN A;  5D49 A;  2C2D A;  2PMZ C;  4B9T A;  2HHQ A;  4IQW A;  3MR5 A;  5DB8 A;  3V72 A;  1N5X A;  5CP2 A;  3D2S A;  2DFL A;  1Z00 A;  4YCX A;  5CEH A;  4F4Y A;  5KL1 B;  3V6K A;  4ECY A;  1FFU A;  4DEZ A;  4F50 A;  5KAI U;  3Q8R B;  3KHL A;  3G6V A;  4F4X A;  1L7P A;  1ZYQ A;  4B9V A;  4K4I A;  2W04 A;  1S97 A;  5HR7 A;  4P0Q A;  3SD7 A;  4DQP A;  1U48 A;  4NV0 A;  3LDA A;  4Y2R A;  3MDA A;  2AQ0 A;  4O3R A;  1CUK A;  3KKA C;  5J0Q A;  4Q8F A;  4IC9 A;  2LYA A;  5ALZ A;  5DDM A;  4DF8 A;  1SIJ A;  1QSY A;  3ETR A;  4RU9 A;  2RRD A;  2C28 A;  1COO A;  1SZP A;  8ICZ A;  2NO4 A;  4CCH A;  2ZIW B;  4K4H A;  2HHW A;  4PJ0 U;  5KG7 A;  5JUM A;  3PW2 A;  2K8B B;  1L3U A;  4B9L A;  4I27 A;  4O5E A;  4ECT A;  2EDU A;  2H5X A;  9ICV A;  2BCU A;  4ELU A;  7ICR A;  5J0Y A;  4I2E A;  4F4Z A;  1FO4 A;  1VJ5 A;  3ZD8 A;  4O3N A;  3B0X A;  1KSP A;  2W55 A;  1YT3 A;  1V38 A;  2JHD A;  2ASL A;  5J0T A;  4NLB A;  5CR0 A;  4GC7 A;  5AM5 A;  2Y9U A;  1ZQR A;  4MEY A;  4B6J A;  3D2Q A;  2W7O A;  4TUR A;  1PK3 A;  5ALP A;  2BQU A;  4C4T A;  1LKY A;  2VJ4 A;  1V97 A;  2HBJ A;  2UVR A;  2WFA A;  1BPZ A;  2E8P A;  3WK7 A;  4B9S A;  2K4E A;  3T5J A;  2V4R A;  4MFA A;  4C8O A;  3OPX A;  4QNL A;  4YXJ A;  5KFD A;  3O0F A;  4B9U A;  7ICK A;  2LYH A;  4BXO A;  3LYS A;  5KG3 A;  2BR0 A;  1QQ7 A;  2FPL A;  5J2I A;  4UAS A;  2D6F C;  1DRG A;  4QW8 A;  4P4O A;  1IIP A;  2K4I A;  2EZZ A;  3PO4 A;  4RZR A;  3N7P D;  1Z1V A;  1ED1 A;  3WKA A;  4UAZ A;  2KKV A;  2PFQ A;  5F3X B;  2AHO B;  4ZOH C;  2DGZ A;  2WB1 F;  4P2H A;  4OJ6 A;  2GOL A;  3PSF A;  2Y1J A;  2HI0 A;  2KV2 A;  8ICN A;  4CNQ A;  4F4K A;  3UMG A;  1SKR A;  3T5K A;  2ZIU A;  1XS9 D;  3AUO A;  4GXK A;  2ZJ5 A;  4RQ3 A;  4KLO A;  1NK8 A;  3RF9 A;  2Y1I A;  2JMG A;  3MGI A;  2JZB B;  1ZQZ A;  3MC1 A;  5KT7 A;  5CRX A;  4ZH4 A;  3V7J A;  3PSI A;  1FEZ A;  5E79 U;  5KFV A;  4Z6E A;  2EAP A;  4ICA A;  5DLF A;  1N5W A;  2FLL A;  4I2H A;  1JXE A;  5ALG A;  4XRH A;  2IOF K;  4Y2P A;  4M2Y A;  8ICF A;  2NRT A;  1BPD A;  3MR6 A;  4R8U A;  4NJ8 A;  5J2H A;  5AKE A;  9ICX A;  1PK1 B;  2I9G A;  1ZQJ A;  3JPR A;  5KFN A;  4RT2 A;  4PL1 A;  4RUC A;  1QTM A;  7ICJ A;  2FE9 A;  4EYI B;  1S76 D;  8ICM A;  9ICG A;  1EXN A;  5KG6 A;  7ICE A;  2JEF A;  3H8M A;  3RRH A;  4DL7 A;  2MRL A;  2M0N A;  4F3O A;  4GFJ A;  1SGG A;  5KFM A;  8ICO A;  2XGQ A;  5TZV A;  1Z00 B;  5AI0 A;  3H0R B;  2QB0 A;  4EEY A;  2KE7 A;  3AMZ A;  3K75 D;  4Q44 A;  5KFW A;  3GIL A;  2NO5 A;  2GO7 A;  1S0N A;  3ONN A;  4YXM A;  1HUZ A;  3K1Z A;  3RB0 A;  3IG5 A;  7ICO A;  3EZ5 A;  3AL0 B;  5D46 A;  4ED1 A;  5FP0 A;  5L1K A;  4C8L A;  8ICG A;  4NLZ A;  3PY8 A;  2XY5 A;  2KZZ A;  2AJQ A;  2ZTC A;  4ED2 A;  4TQR A;  4J9L A;  2FJ6 A;  2KOB A;  4RQ8 A;  3KFU F;  1VLB A;  4RQ6 A;  5IIL A;  3SV4 A;  1S0O A;  3M9O B;  1ZQE A;  2BGW A;  1X9S A;  2F1J A;  5DG9 A;  5ALM A;  5AKZ A;  1MSW D;  2ATL A;  4DL4 A;  4QZF A;  2HOF A;  3IV6 A;  3T5H A;  1J97 A;  3KHH A;  4NM1 A;  4DLG A;  4DLE A;  2HOI A;  1DK3 A;  2OEH A;  2AQ4 A;  4ED3 A;  5ALR A;  2YB4 A;  5KFR A;  5AKI A;  2DPI A;  2DF4 B;  2EZY A;  2KZM A;  5J0R A;  5J0S A;  4KX5 A;  3GQC A;  1N60 A;  4Y2V A;  4O3M A;  3VC8 A;  2KIC A;  4ED8 A;  2W43 A;  5KTQ A;  3PX6 A;  5F9L A;  5IIO A;  1LV5 A;  5J2F A;  5IIK A;  5AM0 A;  3RH4 A;  5KFK A;  4F4W A;  3MR2 A;  2HHV A;  4YR0 A;  1MQ3 A;  2YMM A;  3F2B A;  1ZQF A;  3F5E A;  3KHR A;  4M0A A;  4I2A A;  3NUQ A;  2OCE A;  3V7L A;  2W3S A;  2BPG A;  2PI5 A;  1C7Y A;  2R8I A;  5AI6 A;  3KD3 A;  4F93 B;  1ZQM A;  5KG2 A;  4I2B A;  3RFA A;  3U26 A;  1JIH A;  5KFH A;  4TQS A;  5KFF A;  4DFP A;  4C8N A;  2V4Q A;  1LKY B;  1IV8 A;  4JK1 A;  3TAR A;  2D8C A;  4Y2Q A;  4BWM A;  9ICN A;  2Y0S C;  4RNO A;  4KLG A;  5AIC A;  9ICS A;  2YMP A;  4ECX A;  2HHT A;  4QZI A;  2DBY A;  4BXO B;  3TAC B;  1T7P A;  2VA3 A;  1L3S A;  3UMB A;  4RQ7 A;  4JUZ A;  5ALQ A;  1KW4 A;  3OHB A;  2HHU A;  1Z1B A;  1XU4 A;  4QIW F;  5EE3 A;  1S0V A;  3TAD A;  1HJP A;  2A1A A;  5KT3 A;  3UXO A;  5KT4 A;  1NJY A;  4UAT A;  3RBE A;  1V85 A;  4QJF B;  2ES6 A;  2AGP A;  5AHX A;  4U6P A;  1BNP A;  4Y2T A;  8ICC A;  1JRP A;  3UM9 A;  4HYK A;  4FZL A;  2EZX A;  4I2I A;  3H7I A;  3ETL A;  1RPL A;  1RQN A;  3UQ0 A;  5BOL A;  4RNM A;  2MUT B;  2ZIU B;  2KHV A;  9ICF A;  4B9N A;  3PV8 A;  5AK3 A;  1ZQS A;  2YML A;  2KG5 A;  4JWM A;  3JPT A;  5HHH A;  2KIW A;  5DGA A;  3RJJ A;  4KN7 A;  4ELV A;  9ICT A;  3KBB A;  4OCZ A;  4KLJ A;  1OXJ A;  1A76 A;  4EBD A;  4XUS A;  3PML A;  4M9L A;  4RT3 A;  2PFO A;  4CRX A;  3NVW A;  1M6Y A;  5KFQ A;  4QZA A;  2W9B A;  2F77 X;  1RYR A;  3UXN A;  5J0O A;  2NYV A;  4R8U B;  3RJH A;  5KFC A;  4IQV A;  2FMP A;  3D6J A;  2G07 A;  4RNN A;  3H8J A;  2G08 A;  1X9M A;  1SV0 A;  4QWC A;  3LK9 A;  2BCR A;  5G5G A;  1JAL A;  1NOM A;  1A0P A;  2LYB A;  3Q8S B;  2KNJ A;  4UAY A;  5J0P A;  1RXW A;  3OTQ A;  4YMM A;  1NK6 A;  5EE0 A;  2QB0 B;  3M6Z A;  2F8L A;  1HUO A;  4UB4 A;  4PL2 A;  4EYH B;  5AI5 A;  3TAD C;  3NRZ A;  4PH5 A;  2WAQ F;  2R8G A;  7ICU A;  3LWL A;  3HP6 A;  4WJ3 B;  2YB1 A;  3DEE A;  4TUS A;  1HEK A;  2BDU A;  1BPX A;  1O03 A;  2Z7J A;  1UA1 A;  2OH2 A;  3V7K A;  1NKC A;  4YR3 A;  4GIB A;  1UQV A;  1L3T A;  3EPI A;  3RAX A;  4JV0 A;  2XC9 A;  2JGA A;  2OYY A;  4RQM A;  1D9F A;  1SB3 C;  4EZ6 A;  4J9R A;  3KZX A;  4USA A;  3QNM A;  2PXI A;  2H3V A;  1ZQG A;  4PHP A;  3N7S C;  2HOQ A;  3TFR A;  3H8S A;  4M9G A;  2R8K A;  1C20 A;  9ICK A;  1SXE A;  4F5Q A;  3TAN A;  1IXR A;  5EE1 A;  1PK1 A;  3BZK A;  3HRD D;  3M7D A;  2V9W A;  4M9H A;  4RPZ A;  2WF9 A;  1S9F A;  2QB1 A;  4PGX A;  4IRK A;  4IQU A;  4DQS A;  4KLS A;  1X6J A;  1PVQ A;  5ALX A;  4CDG A;  4AYB F;  3QZ8 A;  3KZI U;  3EUB 2;  4MFF A;  1XNS A;  4GXJ A;  2L5Y A;  3HW8 A;  1A6S A;  5KFG A;  2ASJ A;  1FFV A;  3L3F X;  3QX7 A;  3EWA A;  1SV0 C;  4M9J A;  4DOA A;  1NK7 A;  3AU2 A;  4RQ5 A;  4TUQ A;  3ZDE A;  8ICW A;  1BNO A;  2OXO A;  1K1Q A;  1WUD A;  2F8K A;  8ICP A;  4Y2S A;  1YZ7 A;  2EAN A;  2ZUB A;  1GO3 F;  4QWB A;  4U7C A;  5KFU A;  5AIA A;  3BZC A;  2JH1 A;  4ED0 A;  4Z6F A;  2R8J A;  2NRZ A;  3RJK A;  7ICI A;  1ZQH A;  3PO5 A;  4AP9 A;  4NL9 A;  2W9A A;  2F76 X;  4M04 A;  1ZRM A;  4UAV A;  1PZN A;  1WCN A;  5AKX A;  4IRD A;  4QWD A;  2MU2 A;  2A3V A;  4P4M A;  4KLH A;  2GWS A;  5KFT A;  1XSP A;  4F8R A;  1TVA A;  2UVW A;  1ZQC A;  2E8M A;  4K4G A;  3JPQ A;  3PSP A;  3QU2 A;  2PFN A;  2HVH A;  2HHX A;  2ZUD A;  3C1Y A;  5CJ7 A;  5J2D A;  3A0H U;  3M6K A;  3F2C A;  3ZD9 A;  1SV4 A;  1L5U A;  3UPQ A;  1K1S A;  7ICS A;  2GLE A;  5ALW A;  2CN1 A;  4DFK A;  4YMN A;  2FI1 A;  3N28 A;  3PW0 A;  9ICC A;  3SAH A;  3BQT A;  1F5S A;  4M6W A;  5DQG A;  3ZI4 A;  5ALJ A;  5HP4 A;  3K1R B;  3NAS A;  4DQQ A;  1SXD A;  5AM2 A;  3C2L A;  8ICQ A;  5AIB A;  1ZJN A;  4GXI A;  8ICL A;  5J2B A;  2AGQ A;  1MQ2 A;  1AQ6 A;  1WWU A;  3PZP A;  4UB3 A;  2ZXI A;  1N62 A;  4OJP A;  5HNK A;  4QZB A;  4RUA A;  1TAQ A;  3C23 A;  4EX7 A;  4KN4 A;  2BPC A;  2ZJ8 A;  2OWO A;  4ED6 A;  2EQY A;  3WK4 A;  4F91 B;  1XO0 A;  2PKE A;  5L1M A;  3IN5 A;  3RR8 A;  4EBC A;  2W9B B;  4JB3 A;  1QH9 A;  4UB1 A;  2RHF A;  4NL9 C;  4RQ4 A;  2AGO A;  3E2E A;  4DSJ A;  5ALH A;  1RYU A;  5KG4 A;  3QXG A;  2JV3 A;  3ED5 A;  4UAR A;  1BPY A;  1Z3E B;  4P4P A;  1CRX A;  5J2E A;  2IHM A;  4LJX A;  3SQI A;  4GC6 A;  4F71 A;  3H0L B;  5J0W A;  2C22 A;  1ZD4 A;  1IM4 A;  4BGD A;  1YZ6 A;  2BZF A;  2KP7 A;  1KLN A;  1Q3V A;  2MUT A;  2ISP A;  1X9X A;  1ZD3 A;  7ICL A;  5KFZ A;  1TK5 A;  2W3R A;  3QEB Z;  2RP5 A;  4PZN A;  3HPO A;  3UXP A;  4ELT A;  4ECU A;  2FPM A;  1O08 A;  7ICH A;  2RDI A;  1RG6 A;  3HJE A;  4Y2U A;  4MFC A;  5KT2 A;  2E1F A;  4QZC A;  1Z4N A;  5JU5 A;  1DK2 A;  2FLN A;  1PVP A;  4LVS A;  4C7Z A;  3RJG A;  4YP3 A;  3V6H A;  1U47 A;  3SMV A;  3M8R A;  4KLE A;  3A0B U;  3R9K A;  4PHD A;  3J81 j;  4DFM A;  1MN8 A;  5H2F U;  4PZO A;  9ICL A;  2XID A;  2JRZ A;  3WK8 A;  1ZQT A;  2LM1 A;  2DUY A;  3AM9 A;  1X6I A;  4FS2 A;  5J8Y A;  3PX4 A;  5AI4 A;  3LWM A;  5EWE A;  2UVU A;  2W54 A;  1NNL A;  5DBC A;  4QWA A;  4NLN A;  5ALV A;  1UHU A;  2R18 A;  8ICA A;  3WKD A;  3FDS A;  3C2K A;  3PMN A;  4CF5 A;  4C8K A;  5DLG A;  2JEJ A;  3ORY A;  4YR2 A;  4EEL A;  2ESE A;  1B0X A;  3RR7 A;  5KFO A;  5EWF A;  4M9N A;  5AKY A;  3PX0 A;  1NK9 A;  1SZH A;  4EZ9 A;  3F2D A;  4FZM A;  3RJF A;  1U9L A;  4F72 A;  1Q46 A;  2KJ5 A;  1DXS A;  4DL6 A;  2XGP A;  4CGZ A;  5TIS U;  5C0Y A;  1PUZ A;  1JMS A;  5CB1 A;  1KFS A;  5C5J A;  2ZIV A;  3H8W A;  8ICS A;  2WF7 A;  3VCB A;  1H38 A;  1ZQI A;  2PMZ F;  4FBU A;  9ICW A;  1SL2 A;  1XO1 A;  2MAX A;  1L6N A;  1WYG A;  4MHV A;  2K60 A;  5L1I A;  1LB2 B;  2IA6 A;  5ALK A;  4KLM A;  3DV9 A;  4J03 A;  2BDP A;  4I2D A;  1TK0 A;  1FIQ A;  2A19 A;  4YVZ A;  4F5R A;  3NRW A;  2BCQ A;  4M6W B;  4QZE A;  3M1Y A;  4RPX A;  3GDX A;  4US9 A;  2HVI A;  5K4L A;  5DBA A;  4TUP A;  3RBD A;  3MBY A;  2YY6 A;  5B66 U;  4QZD A;  3RRG A;  2P66 A;  2KJ9 A;  3QUC A;  2ZTE A;  2J6U A;  1S0M A;  3EW9 A;  2IOF A;  4O9M A;  3HWT A;  1XSL A;  1KQQ A;  3I76 A;  3QUT A;  5J0U A;  1SL0 A;  4OJL A;  4DS5 A;  4BJQ A;  3WK5 A;  2B6G A;  5AK4 A;  3C2M A;  3ISD A;  5KT6 A;  5G5H A;  5EWG A;  9ICM A;  3C5F A;  5L9X A;  9ICR A;  2DPJ A;  2W11 A;  3PW7 A;  4DSE A; 
#chains in the Genus database with same CATH homology
 4Q43 A;  2PXI A;  4QZH A;  1QSS A;  4DOC A;  5J2G A;  1ZQG A;  1ZQR A;  4ED7 A;  4PHP A;  4MEY A;  3NGD A;  2XCP A;  4I28 A;  4TUR A;  4DO9 A;  7ICG A;  4BDP A;  3M8S A;  3OJU A;  3BQ2 A;  1ARO P;  3H8S A;  4J9Q A;  3TFR A;  3BDP A;  4KLF A;  4M9G A;  2R8K A;  5BPC A;  5KG0 A;  2BQU A;  2RDJ A;  1NJZ A;  4F5O A;  9ICQ A;  9ICK A;  4F5Q A;  3TAN A;  2UVR A;  1IXR A;  2V9W A;  4M9H A;  7ICF A;  9ICB A;  4GLX A;  4Q8E A;  4RPZ A;  3SYZ A;  5KFE A;  1S9F A;  1NK4 A;  1ZQN A;  4LZG A;  1BPZ A;  3TFS A;  4B9S A;  2ZUC A;  4PGX A;  3T5J A;  2V4R A;  1QSL A;  4IQU A;  2KZ3 A;  3C1Z A;  4MFA A;  5J2J A;  4DQS A;  4C8O A;  4DSI A;  4IRK A;  4KLS A;  4YXJ A;  5KFD A;  2FLP A;  4JV1 A;  4KLL A;  3MR3 A;  4B9U A;  7ICK A;  8ICB A;  1TFR A;  2LYH A;  3MFI A;  3RAQ A;  8ICU A;  3UQ2 A;  4DSF A;  5D4B A;  3H40 A;  4BXO A;  3QZ8 A;  5HHI A;  1ZQB A;  2WTF A;  3GV5 B;  5DQH A;  1ZQW A;  3BQ0 A;  5KG3 A;  3TQ1 A;  2BR0 A;  3Q8Q B;  4MFF A;  2W9M A;  2FPL A;  4IRC A;  4GXJ A;  1XC9 A;  2W8K A;  5J2I A;  5DQI A;  2J6T A;  3HW8 A;  4UBB A;  5KFJ A;  4QW8 A;  4RPY A;  2ASD A;  5KFG A;  2ASJ A;  4P4O A;  3N4M B;  4J9O A;  3EWA A;  2HW3 A;  4M9J A;  4PGQ A;  4DOA A;  1NK7 A;  3PO4 A;  5J2A A;  1TAU A;  4RZR A;  4NLK A;  1CEZ A;  3AU2 A;  4RQ5 A;  4TUQ A;  3ZDE A;  8ICW A;  4KLU A;  4YD2 A;  4UAZ A;  4R63 A;  1K1Q A;  3OSP A;  2PFQ A;  9ICI A;  5CA7 A;  8ICP A;  2ZUB A;  5KFS A;  1RXV A;  4QWB A;  4IR9 A;  4P2H A;  5KFU A;  3SV3 A;  4DWI A;  3RH6 A;  2Y1J A;  4DFJ A;  4B9M A;  5CHG A;  4ED0 A;  8ICN A;  4Z6F A;  2R8J A;  2NRZ A;  2VA2 A;  3RJK A;  2C2E A;  5KG5 A;  7ICI A;  4F4K A;  1ZQH A;  1ZJM A;  1ZQL A;  2J6S A;  3PO5 A;  3Q8K A;  2W9A A;  1SKR A;  3GFK B;  3T5K A;  4DL2 A;  4FBT A;  4PHA A;  1XS9 D;  4M04 A;  3GIK A;  3AUO A;  4GXK A;  2ZJ5 A;  3N97 B;  4RQ3 A;  4KLO A;  1PZN A;  2XY6 A;  8ICE A;  1KFD A;  2NRV A;  1UA0 A;  1NK8 A;  1N56 A;  3TI0 A;  1WCN A;  1S10 A;  4IRD A;  1BGX T;  5DBB A;  4QWD A;  3THV A;  2Y1I A;  1JXL A;  3MGI A;  2XCA A;  4O3O A;  2JZB B;  1KEJ A;  1ZQZ A;  5KT7 A;  3MFH A;  4P4M A;  4ZH4 A;  3V6J A;  5DDY A;  2GWS A;  4I29 A;  4KLH A;  3V7J A;  5KFT A;  4UQG A;  5DG8 A;  4F5P A;  3OGU A;  1XSP A;  4F8R A;  2KN7 A;  1TVA A;  3QE9 Y;  5KFV A;  3RB4 A;  4F5N A;  4Z6E A;  2UVW A;  1ZQC A;  4KLI A;  4YMO A;  4Z6C A;  2C2R A;  4K4G A;  3MAB A;  3JPQ A;  2PFN A;  2HHX A;  5DLF A;  3H4B A;  4ECR A;  2ZUD A;  3C1Y A;  5CJ7 A;  2FLL A;  1JXE A;  5J2D A;  4I2H A;  2HVH A;  3JPS A;  8ICI A;  4FS1 A;  4XRH A;  2ZTD A;  1T8E A;  4G3I A;  3ZD9 A;  4KMU A;  1L5U A;  4M2Y A;  3UPQ A;  4I2C A;  1K1S A;  2NRX A;  3C5G A;  7ICS A;  1XWL A;  8ICF A;  2NRT A;  4YG2 A;  1BPD A;  3MR6 A;  4R8U A;  1ZQY A;  5J2H A;  9ICX A;  4DFK A;  4UAW A;  2BPF A;  4YMN A;  1X9W A;  3MGH A;  3BJY A;  2I9G A;  1X2I A;  3PW0 A;  1ZQJ A;  1NK5 A;  9ICC A;  3JPR A;  5KFN A;  3ZDB A;  3HX0 A;  3RJI A;  4RQ2 A;  3BQT A;  4RT2 A;  4DQR A;  3OHA A;  3T3F A;  4M6W A;  5DQG A;  4RUC A;  4PHE A;  1QTM A;  5HP4 A;  9ICG A;  3SI8 A;  7ICJ A;  3K4G A;  4J9P A;  4EYI B;  4DQQ A;  5J29 A;  1EXN A;  5KG6 A;  3G6Y A;  4DQI A;  2XY7 A;  4MEX A;  3C2L A;  7ICE A;  8ICQ A;  2JEF A;  3GV7 B;  3RRH A;  3TAQ A;  4DL7 A;  4ECQ A;  4I2J A;  1ZJN A;  4GXI A;  4F3O A;  1BPB A;  4PPX A;  8ICL A;  5KFM A;  5J2B A;  2AGQ A;  1MQ2 A;  2XGQ A;  8ICO A;  5TZV A;  4E0D A;  1D8L A;  2NRW A;  1TKD A;  4MF2 A;  1T4G A;  1Z00 B;  3PW4 A;  1KRP A;  2F1I A;  1KTQ A;  4J9S A;  3PR5 B;  4DF4 A;  2P6R A;  4DSK A;  4UB3 A;  4QZG A;  5IIN A;  4EEY A;  4Q44 A;  3K75 D;  5III A;  4QW9 A;  4KTQ A;  5KFW A;  3GIL A;  1KDH A;  1NK0 A;  1SKW A;  2BCS A;  5HNK A;  1S0N A;  4QZB A;  4YXM A;  4RUA A;  1HUZ A;  3RB0 A;  1TAQ A;  7ICO A;  3C23 A;  5L1L A;  3PVX A;  3EZ5 A;  1ZQA A;  4KN4 A;  5D46 A;  3BQ1 A;  4ED1 A;  2BPC A;  2ZJ8 A;  5L1K A;  4ED6 A;  2OWO A;  4C8L A;  8ICG A;  3PNC A;  4NLG A;  4NLZ A;  3PY8 A;  9ICU A;  3KHG A;  1BPE A;  4F91 B;  2XY5 A;  1MC8 A;  2R8H A;  2KZZ A;  2AJQ A;  2ZTC A;  1ZQK A;  4ED2 A;  1A77 A;  1XSN A;  4TQR A;  2P6U A;  4J9L A;  4EBC A;  3RR8 A;  4J9N A;  2W9B B;  2KFN A;  4YD1 A;  4RQ8 A;  4UB5 A;  4O0I A;  4RQ6 A;  5IIL A;  4UB1 A;  3IHQ B;  4DS4 A;  5KG1 A;  2HHS A;  3KTQ A;  3GIJ A;  3PR4 A;  1WCL A;  2W9C B;  2FMS A;  4RQ4 A;  2F1H A;  4ECS A;  5J2C A;  3SV4 A;  1S76 D;  2AGO A;  2BCV A;  3E2E A;  1NKE A;  1S0O A;  3M9O B;  1ZQE A;  4DSJ A;  1V9P A;  4QZ9 A;  3RH5 A;  5KG4 A;  2BGW A;  2F1J A;  4ECZ A;  4YN4 A;  1X9S A;  8ICX A;  5DG9 A;  3ISC A;  1UT5 A;  1ZQQ A;  1TV9 A;  1BPY A;  1Z3E B;  2ATL A;  4DL4 A;  1MSW D;  2A1J A;  4BWJ A;  4QZF A;  4P4P A;  5J2E A;  4MF8 A;  2IHM A;  3T5H A;  1S77 D;  8ICV A;  3Q8M A;  4C8M A;  4GC6 A;  3KHH A;  3Q8L A;  8ICY A;  3PW5 A;  4O5C A;  4J9K A;  2BQR A;  4O5K A;  4NM1 A;  5CWR A;  5J0W A;  4DLE A;  4DLG A;  2C22 A;  5KFP A;  1UT8 A;  2AQ4 A;  2AU0 A;  1U45 A;  9ICE A;  4ED3 A;  4F2S A;  1IM4 A;  4NY8 A;  4BGD A;  5KFR A;  2DPI A;  4FO6 A;  5DKW A;  2ISO A;  8ICR A;  1ZQP A;  5IIJ A;  2KZM A;  1KLN A;  2VAN A;  3GV8 B;  1TK8 A;  2MUT A;  4I2G A;  2ISP A;  2JEI A;  5J0R A;  3EYZ A;  7ICL A;  5J0S A;  2UVV A;  1B22 A;  1NKB A;  2JEG A;  5KFZ A;  1TK5 A;  3GQC A;  3QEB Z;  4ELT A;  3HPO A;  3UXP A;  4I2F A;  4EBE A;  3B0Y A;  4ECU A;  3JPO A;  2BKE A;  1ZET A;  2ALZ A;  2FPM A;  4ED8 A;  7ICH A;  2RDI A;  5KTQ A;  3PX6 A;  5F9L A;  5IIO A;  1LV5 A;  5J2F A;  5IIK A;  4YFK A;  2BQ3 A;  3RH4 A;  4MFC A;  5KFK A;  4F4W A;  3MR2 A;  5KT2 A;  4QZC A;  2HHV A;  2KTQ A;  3M9M B;  4YR0 A;  4ECW A;  1MQ3 A;  2PFP A;  3JPN A;  1ZQV A;  1ZQF A;  2FLN A;  8ICH A;  3H4D A;  3KHR A;  4IQT A;  1RYS A;  4M0A A;  4I2A A;  4LVS A;  3RJG A;  3V7L A;  2BPG A;  4YP3 A;  2PI5 A;  5KFA A;  4Q45 A;  1C7Y A;  1D9D A;  3V6H A;  9ICH A;  2R8I A;  1U47 A;  1U4B A;  2W8L A;  2XO7 A;  3FYH A;  1KFT A;  4RQ0 A;  2M9N A;  4F93 B;  3T5L A;  1ZQM A;  5KG2 A;  4I2B A;  3M8R A;  4KLE A;  3ZDD A;  1JIH A;  5KFH A;  4TQS A;  4PHD A;  5KFF A;  5HMM A;  4DFP A;  4C8N A;  2V4Q A;  1Y88 A;  2ZJA A;  4R65 A;  4DFM A;  3RJE A;  9ICL A;  4NM2 A;  4JK1 A;  4NXZ A;  3TAR A;  4XQ8 A;  1ZQT A;  1QLN A;  5DB9 A;  5F9N A;  1NJX A;  5IIM A;  4BWM A;  3TAP A;  3GII A;  4DL3 A;  4RQ1 A;  9ICN A;  4FS2 A;  4RNO A;  2IBK A;  4KLG A;  4DSL A;  3PX4 A;  1ZQU A;  4O3S A;  3LWM A;  3NTU A;  5EWE A;  4UBC A;  1DOQ A;  4ECX A;  2UVU A;  2HHT A;  3ZDC A;  1JN3 A;  9ICS A;  4QZI A;  4QWE A;  5KFL A;  7ICQ A;  5DBC A;  2JZB A;  4KLT A;  4QWA A;  4J9M A;  5EOZ A;  1B43 A;  4BXO B;  3M9N B;  4NLN A;  5DG7 A;  1T7P A;  2VA3 A;  8ICA A;  8ICK A;  1L3S A;  3OJS A;  2BHN A;  4RQ7 A;  4O3Q A;  3EPG A;  4JUZ A;  3FDS A;  5HML A;  5KFX A;  3OHB A;  9ICO A;  2HHU A;  3JPP A;  3C2K A;  3PMN A;  1XU4 A;  4C8K A;  5DLG A;  4KLQ A;  4XA5 A;  4PGY A;  1S0V A;  3GIM A;  1HJP A;  2JEJ A;  5KT3 A;  5KFI A;  3UXO A;  1ZQX A;  3ORY A;  5KT4 A;  3MDC A;  1NJY A;  4YR2 A;  4YQW A;  3RBE A;  4X5V A;  2FPK A;  4DOB A;  3RR7 A;  2A1J B;  4UB2 A;  5KFO A;  3ZDA A;  4QZ8 A;  5EWF A;  3HT3 A;  2AGP A;  4M9N A;  7ICP A;  3PX0 A;  8ICC A;  3G6X A;  1NK9 A;  2PI4 A;  4HYK A;  4EZ9 A;  1ZQD A;  9ICA A;  4ECV A;  3C21 A;  3RJF A;  1U9L A;  5KFY A;  7ICN A;  4I2I A;  5D49 A;  2C2D A;  1JX4 A;  3SZ2 A;  3H7I A;  4F92 B;  3ETL A;  1RPL A;  4B9T A;  2HHQ A;  4IQW A;  1BVS A;  5DB8 A;  5BOL A;  4RNM A;  3MR5 A;  3UQ0 A;  3V72 A;  4DL6 A;  2MUT B;  9ICF A;  2XGP A;  5CP2 A;  4B9N A;  2DFL A;  1D8Y A;  1Z00 A;  4YCX A;  4F4Y A;  3PV8 A;  3IM1 A;  3V6K A;  1ZQS A;  4ECY A;  1JMS A;  9ICJ A;  5CB1 A;  1KFS A;  4JWM A;  5C5J A;  3H8W A;  4DEZ A;  3JPT A;  1SL1 A;  8ICS A;  4F50 A;  5HHH A;  7ICM A;  3Q8R B;  3KHL A;  5DGA A;  9ICP A;  3G6V A;  2I1Q A;  4R66 A;  3RJJ A;  4KN7 A;  1N48 A;  1H38 A;  1ZQI A;  4ELV A;  2KFZ A;  4F4X A;  9ICT A;  5DB7 A;  4KLJ A;  1A76 A;  1ZYQ A;  4EBD A;  2IHN A;  4B9V A;  4K4I A;  1S97 A;  4XUS A;  3PML A;  4FBU A;  3AU6 A;  9ICW A;  1SL2 A;  4DQP A;  4RT3 A;  2PFO A;  4M9L A;  1XO1 A;  3RTV A;  1U48 A;  1RZT A;  2MAX A;  3LDA A;  5KFQ A;  4QZA A;  1SKS A;  8ICJ A;  3MDA A;  5DB6 A;  2W9B A;  2AQ0 A;  5KT5 A;  5L1I A;  1LB2 B;  4O3R A;  1CUK A;  4Q8F A;  5J0Q A;  2IA6 A;  1RYR A;  4LZD A;  3UXN A;  5J0O A;  4M47 A;  4KLM A;  4R8U B;  3RJH A;  5DDM A;  5KFC A;  8ICT A;  4DL5 A;  2W9C A;  4IR1 A;  4DF8 A;  4IQV A;  2BDP A;  2FMP A;  4I2D A;  1TK0 A;  4JWN A;  1QSY A;  2IMW P;  4YVZ A;  4RU9 A;  4RNN A;  4F5R A;  2C28 A;  3H8J A;  1L3V A;  2BCQ A;  3OSN A;  1COO A;  4M6W B;  4QZE A;  1X9M A;  4KIT B;  4RPX A;  4QWC A;  3LK9 A;  3GDX A;  7ICV A;  1SZP A;  2HVI A;  2BCR A;  8ICZ A;  5DBA A;  4TUP A;  2B21 A;  1NOM A;  3RBD A;  3Q8S B;  3MBY A;  3RB6 A;  4CCH A;  3ISB A;  2VA8 A;  5DGB A;  4R64 A;  4UAY A;  3RB3 A;  5KG7 A;  4QZD A;  1ZQO A;  3RRG A;  4K4H A;  5J0P A;  1RXW A;  2HHW A;  5JUM A;  3PW2 A;  2P66 A;  4YMM A;  1NK6 A;  2Q0Z X;  3Q8P B;  1T3N A;  1L3U A;  4B9L A;  4I27 A;  2FMQ A;  2ZTE A;  4O5E A;  1DGS A;  4ECT A;  1U49 A;  2J6U A;  1S0M A;  1HUO A;  4UB4 A;  3EW9 A;  4Z6D A;  3QEA Z;  4O9M A;  3HWT A;  4F2R A;  1XSL A;  4EYH B;  2H5X A;  8ICM A;  9ICV A;  5L1J A;  5J0U A;  5J0X A;  1SL0 A;  2BCU A;  4ELU A;  7ICR A;  4PH5 A;  5J0Y A;  5J2K A;  2R8G A;  5BOM A;  7ICU A;  3LWL A;  3HP6 A;  4DS5 A;  3QZ7 A;  4F4Z A;  4I2E A;  7ICT A;  4TUS A;  4KLD A;  1BPX A;  1UA1 A;  3C2M A;  3ZD8 A;  3ISD A;  3V7K A;  1NJW A;  1NKC A;  4YR3 A;  4O3N A;  3B0X A;  5KT6 A;  1KSP A;  1L3T A;  5KFB A;  5EWG A;  9ICM A;  3EPI A;  5L9X A;  3C5F A;  3RAX A;  4JV0 A;  2XC9 A;  9ICR A;  4O3P A;  2DPJ A;  2ASL A;  5J0T A;  1D9F A;  4JV2 A;  3PW7 A;  5CR0 A;  4EZ6 A;  4DSE A;  4J9R A;  4GC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...