1WCNA

Nmr structure of the carboxyterminal domains of escherichia coli nusa
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
b'GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION ELONGATION PROTEIN NUSA
publication title The E. Coli Nusa Carboxy-Terminal Domains are Structurally Similar and Show Specific Rnap- and Lambdan Interactions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 19
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1wcnA01
5HHIA 4TQRA 4ED3A 4O9MA 3HX0A 4DOAA 2DPIA 3UXOA 3ETLA 7ICIA 5J0YA 4F2RA 4BXOB 4YCXA 5CHGA 2FMQA 1BPDA 3C5FA 3MR2A 4P2HA 4ECVA 2FPKA 5J29A 1NKEA 4KLSA 3PO4A 3RJGA 5J2IA 1S77D 9ICJA 2J6TA 4J9PA 4DL5A 8ICOA 2VANA 1D9FA 4MFAA 3RH5A 7ICMA 3V6KA 4YXJA 2PI5A 3IHQB 8ICQA 3JPOA 1ZQCA 4QWCA 5KFOA 5DQIA 1TAUA 3UQ2A 5HNKA 4KLUA 5DG9A 4R64A 4F4ZA 4EBCA 1X9SA 5DBCA 4FBTA 3PX6A 4Z6DA 4I2BA 5TZVA 9ICMA 3M9NB 4M47A 2NRXA 5J2AA 3TAPA 3M9MB 1NK7A 1T3NA 7ICNA 3T5LA 3GV7B 8ICRA 4QZEA 5KT7A 5HMMA 5KG4A 1JXEA 3ZDEA 1U4BA 7ICJA 5J2EA 1HUOA 5KFYA 4GXKA 4ECXA 2Y1JA 3T5HA 3KHLA 3TQ1A 4LVSA 3H40A 3OSPA 3MGIA 7ICUA 2FPMA 3PMNA 4ECUA 3Q8LA 3QEAZ 1ZQEA 4F93B 4R65A 4RQ4A 5DB6A 4TURA 2ZUCA 3BJYA 3RTVA 1KFSA 3MABA 3SV4A 8ICHA 5J0PA 1BPBA 4DL2A 4CCHA 1H38A 1Z00A 3QZ8A 4DWIA 1BPZA 4XA5A 2BCQA 4PH5A 8ICWA 3RB6A 4ED0A 4B9TA 3OGUA 8ICBA 3RRGA 5D46A 3ZDAA 9ICLA 5DG7A 2NRVA 4DOBA 5EOZA 3M8RA 4IRDA 9ICIA 2I1QA 4TQSA 4QZFA 1JMSA 2XO7A 3KTQA 4QWDA 2C28A 4QZGA 4IRCA 1D9DA 3RJIA 4PHAA 4O5EA 4BDPA 7ICPA 2W9CB 1TVAA 3OHBA 2PFQA 1SKRA 3E2EA 3BQ0A 4J9NA 3GIIA 2JEIA 3PR5B 1RXWA 1N56A 2J6SA 2HHQA 8ICSA 4KLIA 2PFPA 3C21A 4O3PA 2BHNA 9ICKA 9ICAA 4YD1A 3QEBZ 1ZQAA 2XCPA 3Q8MA 1LV5A 2HW3A 1A77A 3G6YA 4EZ6A 1AROP 4RPXA 2ZJAA 2AQ0A 3T3FA 4RQ8A 2P66A 2R8GA 2C2DA 2P6RA 2VA8A 4RNOA 2XCAA 3H4DA 5J2HA 4X5VA 7ICHA 3UXPA 3HT3A 3JPQA 2OWOA 2J6UA 1Y88A 1BPEA 4DFPA 1BVSA 3THVA 4P4PA 4UQGA 4DFMA 3NTUA 3N97B 2FMPA 4KLGA 1SL0A 3MFHA 4F5PA 4ED6A 3JPTA 4M6WA 4F4XA 5KFCA 5CA7A 4BGDA 4GLXA 1ZQOA 5C5JA 5KG0A 4YR3A 4FS2A 5J2KA 3JPSA 2IMWP 4ECRA 8ICZA 4NLGA 1XSNA 4KLOA 2A1JA 1ZQDA 3Q8RB 4C8NA 1DOQA 2ISOA 2I9GA 2HHTA 1COOA 4XRHA 5CWRA 9ICNA 3V6HA 5D4BA 2KTQA 4UAYA 3C2KA 3V6JA 7ICLA 5DGBA 4RT3A 2BCUA 5KFHA 5DG8A 3MGHA 3SV3A 1QTMA 4C8LA 4E0DA 2PFNA 3RAXA 2XC9A 5KT4A 5KFEA 4MFFA 4G3IA 8ICJA 4HYKA 3GFKB 3MR3A 4F5OA 1TK5A 5J0QA 5KFKA 4B9NA 1BGXT 5KFFA 4JWNA 1RYSA 4GC7A 3EPGA 5KTQA 4UAWA 3RB3A 5DKWA 5IIJA 1S0NA 2KZZA 4PHDA 1NK0A 3TFSA 9ICFA 4MF8A 4P4MA 3BQTA 1NK4A 1SL2A 1V9PA 2BPFA 3SYZA 4I2FA 4PHPA 5KFGA 4KLLA 5BOLA 5L1JA 4I27A 2PI4A 2VA2A 1Z3EB 5KT2A 4YQWA 2FLLA 5EWEA 3MR6A 3RB0A 4J9SA 2C2EA 1ZQQA 4J9LA 1JX4A 5J2DA 3HP6A 1QLNA 3RR7A 1ZETA 9ICQA 3GV5B 3ZDDA 4UB4A 4BWMA 4DL6A 1ZQVA 4I2GA 4NLKA 2F1IA 4NXZA 2NRTA 3GIMA 5KFTA 2V9WA 4JV1A 2RDJA 4JK1A 8ICKA 5J0RA 4ELTA 5CJ7A 4DQPA 9ICXA 9ICUA 5J0XA 8ICTA 2HHUA 8ICNA 3C23A 2FLPA 3MDAA 1TAQA 5DB9A 2W9CA 3MR5A 4NM2A 4TUPA 1SL1A 2P6UA 5DQGA 1KDHA 4MEXA 4KLEA 3RB4A 1XU4A 4EYHB 4EYIB 1TKDA 3GIKA 1T7PA 4P4OA 2JZBA 3RH4A 3QE9Y 3RR8A 5J0SA 4F3OA 9ICGA 4IQWA 2MUTB 1SKSA 2FLNA 2AGQA 3ZD9A 5IIOA 2VA3A 1UA1A 5L1KA 1HJPA 1S9FA 1S10A 4YVZA 3ISBA 4M9HA 5DLGA 3H8WA 2BDPA 2BCSA 4YN4A 4JV0A 4DLGA 4DSEA 3RH6A 2UVWA 4DQQA 2BKEA 2BCRA 1RYRA 1UT5A 5CP2A 2WTFA 1KLNA 2IA6A 4Q43A 4FO6A 2ASLA 4F2SA 1XO1A 7ICFA 1NOMA 2ATLA 3M9OB 4I2HA 5HMLA 4QW9A 5L1IA 3Q8KA 2IHNA 5KFAA 4F4YA 4QWBA 3C5GA 4J9OA 3N4MB 1MQ2A 1K1QA 4RUCA 1KTQA 1B43A 2NRWA 4DOCA 4ECTA 8ICUA 1WCLA 2ZTEA 3BDPA 5F9LA 4YD2A 3K4GA 3AU6A 4I29A 3PV8A 4R8UA 4O5CA 4F92B 1CUKA 4YR2A 3TARA 1SKWA 2LYHA 4F4KA 8ICFA 3TI0A 5DDYA 3QZ7A 3K75D 1ZQLA 4EZ9A 1QSYA 1ZQJA 4KTQA 4I2EA 2AGPA 4KLFA 3UXNA 7ICSA 4R66A 4J9MA 7ICGA 5DBAA 8ICCA 5KFRA 3RBDA 1UT8A 4DL3A 1LB2B 5KFWA 5KG1A 7ICTA 9ICBA 1ZQFA 2B21A 4YMNA 3ZDCA 4I28A 3GILA 1L3SA 2HHWA 4ECQA 4RQ6A 4DQSA 3EYZA 3RJKA 1D8LA 3PW0A 5KFXA 2R8IA 4O3SA 1XWLA 1N48A 2UVVA 4I2CA 2RDIA 4IR1A 4KLJA 4YMMA 5J2BA 3C2LA 5KFIA 2R8JA 4MFCA 4DFJA 7ICRA 2XGPA 1NJYA 8ICEA 4O3RA 4RNMA 2KN7A 4F5QA 4DLEA 4ED8A 7ICOA 1JN3A 5DQHA 3SZ2A 4F5NA 4ELVA 7ICEA 4JUZA 3T5KA 2ALZA 4BXOA 3JPRA 4IQUA 2DFLA 1U48A 5EWFA 4KLHA 2W9BB 3PMLA 8ICAA 7ICQA 4J9KA 3EZ5A 1KRPA 2C22A 1K1SA 2Q0ZX 4QZIA 4DQIA 2ASJA 1A76A 2KFZA 2ISPA 4DS5A 3H8SA 3C2MA 4C8MA 3H8JA 4B9UA 5KFQA 4IR9A 1L3UA 1RXVA 1X9MA 3EW9A 4RQ3A 3RBEA 5KT5A 1XS9D 5KFDA 2AQ4A 1TK8A 4KMUA 4J9QA 2JEFA 5BPCA 2UVUA 2HHSA 9ICOA 9ICWA 1Z00B 4KLMA 5IINA 3C1YA 4RQ1A 5KFPA 4O5KA 4NY8A 4DS4A 5KG7A 4Q45A 1DGSA 2ZTDA 7ICKA 2V4RA 1T8EA 4RQ7A 3OHAA 3KHRA 3AU2A 4YG2A 5L9XA 4EBEA 4DFKA 4Q8EA 5DDMA 4I2DA 1IXRA 4ECWA 5F9NA 3H7IA 2ASDA 1UA0A 4RT2A 1MSWD 2W8LA 2NRZA 3Q8SB 1X9WA 1L5UA 9ICTA 4RQ5A 1SZPA 4KN7A 4PGQA 3V7KA 4M0AA 1NK9A 4JWMA 1QSLA 2W9AA 3RJFA 5J0TA 3UQ0A 5CR0A 2IHMA 2BPGA 1HUZA 3V7JA 3G6VA 3PW4A 4XUSA 4Z6CA 3HWTA 3GIJA 3TANA 4O3QA 1KEJA 4UBCA 1MC8A 1S0VA 3ISCA 3HW8A 4IQTA 1ZQSA 1TV9A 4QZDA 3V72A 1ZJMA 1C7YA 4DEZA 1QSSA 1IM4A 5BOMA 3UPQA 1NJZA 1NKCA 5DGAA 4DSIA 4YXMA 3RJJA 3PX4A 4KLTA 2BQUA 9ICCA 1ZQIA 1NK6A 4IRKA 3PR4A 1S0MA 8ICPA 4M6WB 2XGQA 4DSLA 3ISDA 4UAZA 5L1LA 3OSNA 2FPLA 5EWGA 3KHHA 4UB5A 4GXJA 1ZQRA 1ZQZA 1ZQXA 4O3NA 4YFKA 4M9JA 2KFNA 8ICYA 4RPYA 4JV2A 4C8KA 3PO5A 5KFJA 1S76D 4ED2A 1CEZA 1B22A 4DF4A 1TFRA 2A1JB 1U9LA 4EBDA 3PW5A 5HP4A 4QZHA 4ECSA 5CB1A 4M04A 1ZQYA 3PW7A 1XSPA 9ICHA 4I2JA 4UB1A 3Q8PB 2AU0A 3LWMA 3BQ2A 2KZMA 2BPCA 2H5XA 5DBBA 4ECYA 4EEYA 4DL7A 1ZJNA 4O3OA 1ZQMA 1WCNA 1ZQPA 2PFOA 9ICPA 4QWAA 5KG5A 8ICLA 4QZ8A 1T4GA 4QZBA 1U45A 4ELUA 2BCVA 8ICMA 1ZYQA 4QWEA 3Q8QB 3OJSA 1NK5A 4C8OA 1RPLA 3PX0A 3RJEA 4GC6A 4Z6FA 1PZNA 3EWAA 3PW2A 3RJHA 4ZH4A 1BPYA 5KFSA 5KT3A 1ZQGA 3T5JA 1ZQKA 5IIIA 4NLNA 5HHHA 3ZDBA 2W9BA 3RAQA 4F5RA 1EXNA 1JIHA 2KZ3A 3B0YA 4RPZA 4FS1A 2BQ3A 4RZRA 2UVRA 1ZQWA 1KFDA 4XQ8A 2XY7A 4DSKA 3FDSA 4DL4A 4PHEA 3EPIA 3PNCA 1KSPA 2W8KA 1S0OA 4RUAA 4ED7A 4F91B 4F4WA 2HVHA 4PGYA 3ORYA 5JUMA 5DB7A 4UBBA 4TUSA 3GV8B 3TFRA 5IIMA 2XY6A 5KFBA 1NK8A 4K4HA 3FYHA 2IBKA 4M9LA 2F1JA 4NLZA 2M9NA 5IIKA 2HHXA 7ICVA 3B0XA 4B9MA 5KT6A 5DB8A 4PGXA 3AUOA 1TK0A 4QW8A 4J9RA 2HHVA 3GQCA 5IILA 3TAQA 4B9LA 3LWLA 5J2GA 2W9MA 3LK9A 1ZQHA 5KFZA 2AGOA 4Z6EA 1ZQBA 2JEGA 1XC9A 2V4QA 3MBYA 4QZCA 9ICRA 2ZJ8A 4F8RA 3OJUA 5J2FA 2BR0A 2JZBB 4GXIA 4O0IA 9ICEA 4YP3A 5D49A 4ED1A 4B9SA 4M9NA 2HVIA 4Q8FA 3PY8A 5DLFA 2MAXA 5KG3A 5KFUA 3H4BA 5J0WA 3NGDA 5KG6A 2Y1IA 2FMSA 4K4GA 4I2AA 4BWJA 2ZUDA 2F1HA 1MQ3A 4TUQA 4M9GA 5J2CA 2R8KA 5J0OA 4KN4A 3ZD8A 3JPNA 4KLDA 9ICVA 3C1ZA 4UB3A 1NJXA 1D8YA 3JPPA 1ZQUA 3BQ1A 3V7LA 2R8HA 4MEYA 3PVXA 5J2JA 4DF8A 2ZUBA 3SI8A 2DPJA 3HPOA 4DQRA 5KG2A 1L3TA 4DO9A 4Q44A 1BPXA 1KFTA 4RU9A 4B9VA 1NJWA 4NM1A 3G6XA 2BGWA 4R8UB 4F50A 8ICGA 4QZ9A 1L3VA 1NKBA 2JEJA 3IM1A 4K4IA 4IQVA 2ZTCA 4R63A 9ICSA 1ZQTA 4RNNA 1U49A 5KFNA 2ZJ5A 2MUTA 4KLQA 4LZGA 2PXIA 8ICIA 4MF2A 8ICVA 3MFIA 4KITB 3KHGA 1XSLA 1S97A 3GDXA 1JXLA 5J0UA 4YMOA 4QZAA 1ZQNA 4FBUA 4UB2A 5KFMA 1RZTA 2C2RA 1X2IA 1U47A 4DSFA 4ECZA 4DSJA 4RQ0A 4LZDA 3M8SA 5KFVA 2GWSA 4M2YA 4I2IA 4RQ2A 4YR0A 3LDAA 8ICXA 2AJQA 5KFLA 2BQRA 4PPXA 3MDCA 2XY5A 3RRHA
chains in the Genus database with same CATH superfamily
2HSZA 1LKYA 2GO7A 5CHGA 1BPDA 1N5WA 1NKEA 9ICJA 4J9PA 3L5KA 5AI0A 4YXJA 1WWUA 4C0ZA 3UQ2A 2A1AA 2JH1A 4KLUA 1HIWA 1X9SA 1FFVA 5DBCA 2LYAA 2K4IA 4Z6DA 3L3FX 5AKKA 5TZVA 4M47A 1NK7A 3TAPA 4CGZA 7ICNA 5KG4A 4ZOHC 3BQ7A 1TE2A 4DCCA 1L8OA 2KP7A 3LVVA 3Q8LA 1ZQEA 5DB6A 4TURA 3BJYA 3MABA 2KSOA 5J0PA 4O3MA 1Z00A 1RDFA 4NLCA 4PH5A 8ICWA 8ICBA 4B9TA 4DOBA 5EOZA 3M8RA 4IRDA 1S5LU 4TQSA 1JMSA 4QWDA 2C28A 3WKEA 3RJIA 3UMCA 3GIIA 1N60A 2DUYA 3OPXA 3PR5B 3C21A 1V38A 1KKXA 4YD1A 2Q4TA 1LV5A 2HW3A 1A77A 2AQ0A 4EENA 2P35A 3TACB 2VA8A 4RNOA 3H4DA 7ICHA 4F72A 2E8PA 4P4PA 4DFMA 3B9JA 3NASA 1SL0A 4M6WA 4YR3A 5KG0A 4FS2A 3JPSA 3M7DA 2O6KA 3GZFA 2F8LA 4C8NA 5ALWA 2ISOA 3F2DA 4XRHA 2KTQA 7ICLA 5KFHA 3RAXA 2XC9A 3PSPA 2JMGA 4U6PA 1V97A 5KFKA 4B9NA 4GC7A 1S8OA 3IDWA 3RB3A 3NUQA 1S0NA 2KZZA 5ALTA 4P4MA 3BQTA 1SL2A 1V9PA 4I2FA 4KLLA 4LJXA 2VA2A 3IN5A 2FLLA 5EWEA 4KX5A 2C2EA 5J2DA 5AM1A 2QARB 4I2GA 4NLKA 5J0RA 9ICXA 5ALJA 4Y2QA 9ICUA 8ICNA 3MDAA 2W9CA 1SL1A 2P6UA 1T7PA 4EYHB 4EYIB 3PZPA 2WF9A 3QE9Y 4IQWA 2MUTB 2KK0A 3BS5B 2KICA 1S9FA 1HJPA 3ISBA 2BDPA 4DLGA 2HI0A 5B66U 4DQQA 2BKEA 1UT5A 3D2NA 2QLTA 5CP2A 1X66A 4FO6A 2ASLA 4F2SA 1NOMA 2D6FC 5HMLA 4UAUA 1MQ2A 1KTQA 4RUCA 1NI3A 2W04A 1WCLA 2HOFA 3BDPA 3PV8A 4O5CA 1ZQLA 3K75D 4EZ9A 2KJ5A 3O0FA 2MU2A 8ICCA 1UT8A 5KG1A 7ICTA 9ICBA 4I28A 3GILA 3SR6A 3AMZA 4UASA 1D8LA 4I2CA 3EUB2 4IR1A 4DFJA 1QQ6A 1NJYA 2DBYA 3QU7A 1JN3A 4Y2JA 3QUBA 4F5NA 2ZXIA 2ALZA 5ALLA 1U48A 8ICAA 4J9KA 3PSFA 2ASJA 1SV0C 4DS5A 4B6JA 5KL8B 3C2MA 4C8MA 4G9BA 5KFQA 4IR9A 3EW9A 4RQ3A 3M6ZA 2JEFA 5BPCA 4ACOA 3H8MA 2HHSA 2OH2A 4U7CA 4Q45A 2ZTDA 7ICKA 4F71A 4Q8EA 5AKLA 1IXRA 2EDUA 4RT2A 1Z19A 9ICTA 1BNPA 3SEIA 4RQ5A 4PGQA 5J0TA 2BPGA 5ALYA 1HUZA 1MA7A 3PW4A 4O3QA 1S0VA 3ISCA 5GTIU 3HW8A 2W03A 3PSIA 4IL6U 2LKYA 5AKZA 1QSSA 3QUCA 2M0NA 1NJZA 4OJLA 4KLTA 2ZXHA 3ICXA 1RYUA 4IRKA 8ICPA 5L1LA 4GXJA 5EWGA 2DWQA 2LMRA 5B5EU 8ICYA 4YFKA 3PO5A 1CEZA 1ZD4A 4DF4A 1TFRA 2W54A 4ECSA 3KKAA 5CB1A 4M04A 2FDRA 2I5HA 1ZQYA 3PW7A 9ICHA 3HJEA 4I2JA 2AU0A 4C4RA 3LWMA 3J81j 4ECYA 1ZJNA 4O3OA 4C4TA 4QWAA 5KG5A 8ICLA 3AQFA 8ICMA 2CN1A 3Q8QB 3OJSA 4CF3A 4RQNA 3PX0A 4GC6A 3RJHA 2HDOA 5KFSA 1ZQKA 2QKQA 1B0XA 1EXNA 1JIHA 2KZ3A 3B0YA 5CEHA 2BQ3A 4RZRA 4XQ8A 4OO1J 2XY7A 4DL4A 4PHEA 3EPIA 2W8KA 4PGYA 3ORYA 5JUMA 4UBBA 2XY6A 4K4HA 5AI5A 4M9LA 5ALDA 2LM1A 4NLZA 1IV8A 2HHXA 1JROA 5DB8A 5AKJA 4QW8A 1NNLA 2F2AB 4B9LA 4CNQA 2W9MA 1XC9A 9ICRA 4FFDA 2ZJ8A 3OJUA 4UB8U 3KBBA 3KOOA 9ICEA 4B9SA 4M9NA 4Q8FA 2AH5A 5DLFA 2MAXA 5KG3A 2Y1IA 3NGDA 4Y2YA 2ZUDA 1MQ3A 2QARA 9ICVA 5J0OA 2G09A 3H0LB 3C1ZA 1D8YA 3A0BU 2R8HA 5JRTA 3SI8A 5J2JA 3HPOA 4Q44A 1KFTA 4RU9A 4B9VA 4QNLA 1ZD5A 4F50A 1L3VA 2OYYA 2JEJA 2ZTCA 4R63A 2Z7JA 2DL0A 5KFNA 2MUTA 8ICIA 8ICVA 3BS5A 3MFIA 1S97A 1XSLA 2ODGA 1M6YA 5ALGA 2KVCA 5AK4A 4FBUA 1RZTA 4Y2XA 3DV9A 4LZDA 4RQ0A 5KFVA 3WK9A 2GWSA 4I2IA 3AN1A 8ICXA 2XY5A 1YZ7A 2KD1A 1X6JA 4AYBF 3HX0A 4DOAA 2DPIA 2VIXA 2H3ZA 2NV3A 3L4PA 2FMQA 2WHEA 4ECVA 5J29A 1SWVA 3PO4A 5J2IA 1PVPA 1S77D 4DL5A 3IV6A 2PI5A 8ICQA 3JPOA 1ZQCA 5KFOA 5DQIA 1WG8A 2ZIXB 4I2BA 2JH7A 9ICMA 2NRXA 3T5LA 3GV7B 8ICRA 5KT7A 4P0QA 3ZDEA 1U4BA 2GLEA 2Y0SF 1ZQ1C 5KFYA 1DK3A 3T5HA 2F3NA 5AK5A 3OSPA 2FPMA 4ECUA 1AQ6A 4KX3A 1BPBA 2BCQA 4XA5A 2KKVA 2DKZA 9ICIA 3KTQA 1Q8KA 4QZGA 1D9DA 4BDPA 2W9CB 1SKRA 5HR7A 4J9NA 1RXWA 1N56A 1SXDA 9ICAA 2XCPA 1F44A 4Y2PA 2YMPA 2P66A 2R8GA 2C2DA 2P6RA 4X5VA 2NO4A 1BVSA 3THVA 1Z1BA 3NTUA 2OXOA 4F5PA 4ED6A 4F4XA 5CA7A 3GU3A 3ONNA 4GLXA 3D2QA 3WKAA 8ICZA 4NLGA 1XSNA 4KLOA 2LPEA 1DOQA 2W3SA 3BZKA 5ALUA 1COOA 5D4BA 3C2KA 2BCUA 1QTMA 4E0DA 5KFEA 4MFFA 2ZIUB 4F5OA 5J0QA 1BGXT 4JWNA 5AM0A 1RYSA 2F77X 5DKWA 5IIJA 4PHDA 1NK0A 1SZHA 3QYPA 1VDVA 5ALIA 3FC4A 5L1JA 4I27A 1Z3EB 5KAIU 3MR6A 3RB0A 4J9SA 4EEKA 4CDGA 3VC8A 3RR7A 4DL6A 1ZQVA 4C80A 1NZBA 1N62A 3GIMA 5AK3A 2V9WA 2B0CA 4ELTA 2OCEA 5J0XA 2HMXA 8ICTA 3NVWA 3C23A 5KL1B 1TAQA 3MR5A 4NM2A 5DQGA 4KLEA 1TKDA 5H2FU 2R18A 3RFAA 5A0LA 4MHVA 3QUTA 3MC1A 2FLNA 2AGQA 3K1ZA 3ZD9A 1PK1B 2VA3A 1UA1A 5L1KA 5EE9A 2BCSA 2UVWA 4DSEA 2BCRA 1RYRA 5ALOA 1KW4A 4Q43A 2G07A 2ATLA 3M9OB 1P7DA 2IHNA 5KFAA 4F4YA 4J9OA 1B43A 4YD2A 4I29A 4F92B 4YR2A 1SKWA 2LYHA 4F4KA 4KTQA 1ZQJA 3IP4B 4R66A 3QU4A 4J9MA 5KFRA 1Q3UA 5KFWA 1ZQFA 4YMNA 2ZG6A 5AKYA 4ECQA 4DQSA 3EYZA 3RJKA 2R8IA 4KLJA 2R8JA 3CP8A 2WB1F 2XGPA 3F53A 2KMDA 4ELVA 1CI4A 3JPRA 4IQUA 4KLHA 5EWFA 2YMMA 5HR6A 3S6JA 7ICQA 4FE3A 2C22A 1K1SA 1A76A 5AKEA 2KFZA 3FM9A 4B9UA 3H8JA 2KIWA 1X9MA 5KT5A 1A6SA 5AIBA 4J9QA 9ICWA 5IINA 1WWVA 5KFPA 4O5KA 2KEYA 3ZI4A 3CRXA 2ZIXA 3KKAC 3OHAA 3AU2A 3AQEA 4YG2A 4DFKA 5ALQA 3F2CA 5F9NA 3H7IA 2W8LA 3Q8SB 4BUGA 1SZPA 4KN7A 3QXGA 4JWMA 2HBKA 3N28A 3BZCA 4USAA 3UQ0A 3G6VA 2EAOA 4XUSA 3HWTA 1SWWA 3QU2A 3TANA 3WKCA 2KG5A 2L5YA 3UMBA 4IQTA 1ZQSA 4DEZA 1IM4A 1O08A 3H0MB 3UPQA 9ICCA 2MA1A 1ZQIA 3PR4A 1S0MA 2XGQA 4DSLA 3WK7A 1ZQRA 2FPLA 4M9JA 1ZQZA 2ZIVB 5KFJA 4ED2A 2A1JB 3UMGA 4UW9A 5HP4A 2K8CB 1PK3A 3I28A 2KZMA 2YY6A 9ICPA 1ZQMA 1WCNA 2EAPA 1U45A 2BCVA 1ZYQA 3QU5A 5AKHA 2ESEA 1PZNA 1BPYA 1ZQGA 4NLNA 3ZDBA 4F5RA 4FS1A 2VKQA 2UVRA 4DSKA 1VLBA 1ZQWA 3FDSA 1KBUA 2RHFA 1S0OA 4CF5A 4ED7A 4F4WA 3GV8B 5KFBA 3FYHA 4PL2A 2F1JA 1YZ6A 5IIKA 2HOQA 2ZIUA 3M1YA 1KN5A 3AEVA 4PGXA 1TK0A 1ZOLA 3A0HU 2K89A 1ZQHA 5KFZA 1ZQBA 1OW5A 1N61A 2JEGA 2V4QA 3MBYA 2FE9A 4P0QB 4OJ5A 5D49A 1D8BA 5KG6A 2FMSA 4K4GA 2F1HA 1A0PA 4BX9C 4KLDA 3ZD8A 3JPNA 1NJXA 4Y2VA 5KAFU 3JPPA 2AXTU 4MEYA 4DQRA 5KG2A 1BPXA 2WF7A 2BGWA 8ICGA 4K4IA 4IQVA 1U49A 2IOFK 2PXIA 1PK1A 2K60A 5AI8A 5FP0A 4MF2A 1YT3A 1ZD2P 5G5GA 1JXLA 1ZQNA 4UB2A 1SIJA 5KFMA 1U47A 2W43A 4JB3A 3M8SA 2D8CA 4M2YA 3N7PD 1RQLA 3MDCA 5HHIA 4ED3A 1XO0A 3UXOA 3ETLA 7ICIA 4F2RA 2G5HB 4YCXA 4GIBA 3IRUA 1RQNA 3C5FA 1ECWA 1J2NA 2FPKA 2HBLA 3I1YA 4KLSA 3RJGA 1ZD3A 8ICOA 4MFAA 3RH5A 2WFAA 1DK2A 1TAUA 5HNKA 4R64A 2YQEA 4EBCA 1BNOA 3PX6A 2HBMA 2ES6A 1T3NA 1UCVA 5ALKA 1Z4NA 4QZEA 5HMMA 3HILA 7ICJA 5J2EA 2DQNB 1HUOA 3U26A 3KHLA 3MGIA 7ICUA 4AYBC 2RQ5A 3QEAZ 2PKEA 4F93B 4RQ4A 2ZUCA 3RTVA 1KFSA 4ICAA 8ICHA 4DL2A 4CCHA 2H3IA 1BPZA 4ED0A 3RRGA 3ZDAA 5E79U 5DG7A 3F5AA 2XIDA 3QUQA 4IRCA 4A8EA 4PHAA 4BJQA 1TVAA 1JALA 1QQ7A 3OHBA 3BQ0A 2JEIA 1J97A 4Y2RA 8ICSA 4KLIA 2PFPA 1L7OA 2VJ4A 4O3PA 2BHNA 9ICKA 3Q8MA 3NVZA 2XI9A 3SAGA 2ZIWB 4RPXA 3T3FA 2Y0SC 4RQ8A 3DEEA 5ALVA 5J2HA 3HT3A 3JPQA 2OWOA 1Y88A 1BPEA 4UB6U 4DFPA 3N97B 4UQGA 2FMPA 4US8A 3JPTA 4Y2SA 2JR5A 1DRGA 4ECRA 2ZIVA 1K5OA 2A1JA 2LBOA 2HHTA 2H3FA 9ICNA 3V6HA 2WF6A 4DFDA 2LI6A 5DGBA 3MGHA 1X42A 3SD7A 5EE3A 2KVSA 8ICJA 1L8LA 4HYKA 3GFKB 3MR3A 2G0AA 5ALNA 4CE6A 5KFFA 1QH9A 5KTQA 4UAWA 1WUDA 1J2MA 2YMQA 3TFSA 2A3VA 9ICFA 4QIWF 2EZYA 4MF8A 3SYZA 5BOLA 5KT2A 5K4LA 2K4PA 1ZQQA 2XVTA 2YX8A 1ZETA 9ICQA 3ZDDA 4UB4A 5AI4A 4OJOA 2NRTA 4JV1A 2RDJA 3N7RC 4DQPA 2FLPA 1IIPA 2KKPA 4TUPA 4MEXA 3RB4A 1XU4A 5AKIA 4P4OA 5ALFA 3RR8A 4F3OA 1ZXIA 9ICGA 2CRXA 4PL1A 1SKSA 2OM6A 5IIOA 4YVZA 5DLGA 3RH6A 4KMOB 2EQYA 1KLNA 2WTFA 4I2HA 4QW9A 5L1IA 3Q8KA 4QWBA 3C5GA 2J6UA 1X6IA 1K1QA 4DOCA 2ZTEA 5F9LA 3K4GA 5AHXA 1PVQA 3TI0A 5DDYA 2E8NA 1QSYA 2AGPA 5AICA 7ICGA 1LB2B 4EX6A 1X9XA 3LVWA 5ALZA 1L3SA 2HHWA 4RQ6A 1DXSA 5ALEA 3PW0A 5KFXA 1N48A 4OJPA 5J2BA 4MFCA 3R9KA 3IG5A 2KN7A 4F5QA 7ICOA 7ICEA 4JUZA 2WF8A 1URJA 1JUDA 3EZ5A 1KRPA 4RQMA 2Q0ZX 4DQIA 1N2XA 2ISPA 3H8SA 2W11A 3TKAA 1T3QA 1KL9A 1TK8A 5KFDA 2AQ4A 4KMUA 2OEHA 3C1YA 2AHOB 4NY8A 5KG7A 1DGSA 2V4RA 5DDMA 5ALHA 2ASDA 1MSWD 2JXJA 2NRZA 3V7KA 2WB1C 2CPRA 1QSLA 3RJFA 5CR0A 1Q3VA 2IHMA 5J8YA 3V7JA 4UATA 4Z6CA 4UBCA 1FIQA 1MC8A 2YB1A 1TV9A 3V72A 1ZJMA 5EE0A 5GTHU 1TAMA 5AM2A 2BDUA 5BOMA 1X40A 2WAQC 5AM4A 4DSIA 2EANA 2BQUA 2YN4A 2KE7A 2E8OA 3KHHA 3OSNA 4C8KA 1S76D 3PW5A 3T79A 3WK4A 5C0YA 1SGGA 1XSPA 2ZIWA 5JTIA 2BPCA 2H5XA 5DBBA 4C7ZA 1L6NA 4DL7A 2PFOA 3MGVA 3KZIU 2QB0B 1RG6A 1T4GA 4QZ8A 3CW2C 2IOFA 1UPHA 2YTUA 1RPLA 2RRDA 4C8OA 5AKGA 1QCKA 3EWAA 5AM3A 5KT3A 4EELA 3T5JA 3KD3A 2EZXA 2W9BA 3RAQA 1KFDA 4RUAA 2A19A 2XICA 3TFRA 3NVVA 5IIMA 2G06A 2IBKA 2DGZA 4Y2TA 3M6KA 2M9NA 3SENA 7ICVA 3B0XA 4B9MA 2F76X 1N63A 1RM6C 1SXEA 4CF4A 5KT6A 3AUOA 4J9RA 4QJFB 2HHVA 3NS1A 3GQCA 5J2GA 3LK9A 2AGOA 4Z6EA 5AIAA 2PMZF 4QZCA 4F8RA 2JZBB 4O0IA 4YP3A 4ED1A 3PY8A 3WK6A 5KFUA 3TADA 2DF4B 4M9GA 2WAQF 5J2CA 2R8KA 4KN4A 2FI1A 2KNJA 1DGJA 4UB3A 3V7LA 2Y9TA 3PVXA 2DPJA 1B4FA 3NRWA 1SB3C 1L3TA 4DO9A 3ALRA 2G5IB 3G6XA 1IG6A 1F0MA 4R8UB 3UM9A 3E0FA 3IM1A 3KFUF 1O03A 2F44A 4RNNA 2ZJ5A 4LZGA 4AP9A 1FEZA 2Y9UA 2LYBA 3KHGA 4KITB 2GH1A 4YMOA 1C20A 3SQIA 2LM4A 2C2RA 4DSFA 2EAMA 4ECZA 4DSJA 3AM9A 1L7MA 3LDAA 2AJQA 2BQRA 3RRHA 4TQRA 5ALPA 2KIVA 4O9MA 5J0YA 4BXOB 2CXYA 3MR2A 2W7OA 3D6JA 4P2HA 4JMUA 2J6TA 2VANA 1D9FA 7ICMA 3V6KA 3IHQB 4QWCA 5DG9A 4F4ZA 4FBTA 1WYGA 2E8MA 3M9NB 5J2AA 3M9MB 3QU9A 1JXEA 2YB4A 1Q46A 2RLTA 4Y2UA 2EH9A 4GXKA 2Y1JA 4ECXA 3HKZC 3TQ1A 4LVSA 3H40A 3PMNA 5ALXA 4R65A 3SV4A 1H38A 3QZ8A 4DWIA 4C4SA 3RB6A 2E1FA 3OGUA 5D46A 9ICLA 2NRVA 3SAFA 2I1QA 2XO7A 4QZFA 7ICPA 4O5EA 2PFQA 3E2EA 2JGAA 3WU2U 2J6SA 2HHQA 3DDHA 4IC9A 2DKXA 3QEBZ 1ZQAA 3G6YA 4EZ6A 1AROP 1HEKA 2ZJAA 5ALMA 4NV0A 4EX7A 1UQVA 2XCAA 3UXPA 4KLGA 3K1RB 3MFHA 2D3DA 5KFCA 4BGDA 1ZQOA 5C5JA 1UHUA 3I76A 5J2KA 2IMWP 2HBJA 4OD0A 1ZQDA 3Q8RB 5CRXA 2I9GA 5CWRA 1F5SA 3F2BA 4UAYA 3V6JA 4OJ6A 4RT3A 5DG8A 3SV3A 4C8LA 2PFNA 5KT4A 2QB0A 4G3IA 1TK5A 1CRXA 3EPGA 4NL9C 1FO4A 3OTQA 1NK4A 3HKZF 2BPFA 3QNMA 4PHPA 5KFGA 1Z4OA 2VJ5A 2PI4A 4YQWA 4J9LA 3KZXA 1JX4A 3HP6A 1QLNA 1L7PA 3GV5B 4BWMA 3ED5A 2F1IA 4NXZA 5KFTA 8ICKA 4JK1A 1NZPA 5CJ7A 2HHUA 3WK5A 5DB9A 1KDHA 3CNHA 3GIKA 1FFUA 4HAIA 2JZBA 3RH4A 4NJ8A 2K4EA 5J0SA 4QIWC 3WKDA 5T14A 1S10A 4M9HA 3H8WA 4YN4A 4JV0A 4P0PB 2IA6A 7ICFA 1XO1A 1OXJA 5EE1A 1KQQA 3N4MB 2NRWA 3NRZA 4ECTA 8ICUA 1V85A 3AU6A 4PJ0U 1GO3F 4R8UA 1CUKA 3TARA 4PZOA 2K8BB 8ICFA 3QZ7A 5ALRA 5AK6A 7ICSA 1LKYB 4I2EA 4KLFA 3SAHA 3UXNA 2MSNA 5DBAA 3RBDA 2E1EA 4NWIA 2G08A 4DL3A 2B21A 3D2SA 3ZDCA 4FZNA 3C29A 1JRPA 3SMVA 1T94A 1L7NA 4PZNA 4O3SA 1XWLA 2UVVA 2K4HA 2RDIA 2YMLA 4UAVA 4YMMA 3C2LA 5J8YC 5KFIA 7ICRA 8ICEA 5L1MA 4O3RA 4RNMA 4DLEA 4ED8A 1LVHA 5DQHA 1MN8A 3SZ2A 2W55A 3T5KA 4BXOA 4J03A 2DFLA 1ED1A 2W9BB 3PMLA 2H3VA 3BS7A 4QZIA 2K8AA 5F3XB 5JU5A 3WK8A 1L3UA 1RXVA 3RBEA 1XS9D 2UVUA 2KSOB 9ICOA 1Z00B 3N7SC 4KLMA 4RQ1A 4DS4A 2KOBA 1ZRNA 1T8EA 3KHRA 4RQ7A 4EBEA 5L9XA 2RP5A 4I2DA 2W7PA 2JHDA 4ECWA 3WKBA 1UA0A 1XNSA 1L5UA 1X9WA 3HRDD 4NLBA 2N1RA 5AM5A 4M0AA 1NK9A 2W9AA 5KNIA 3RF9A 4OCZA 2KJ8A 2B6GA 3GIJA 3C28A 1KEJA 4FZMA 1COKA 3FAHA 4QZDA 1ZRMA 1C7YA 2E3TA 1NKCA 5DGAA 4YXMA 3RJJA 3PX4A 1SV0A 1PVRA 1NK6A 4M6WB 4WJ3B 2KHQA 5AI9A 3ISDA 4UAZA 1QQ5A 2KFNA 4UB5A 2KV2A 1ZQXA 4O3NA 1N5XA 4RPYA 4JV2A 1B22A 2W3RA 3AL0B 2GOLA 1U9LA 4EBDA 4QZHA 2WF5A 5AI6A 4UB1A 3Q8PB 3ETRA 4NL9A 3BQ2A 2F8KA 4CRXA 4EEYA 1ZQPA 4US9A 4QZBA 4ELUA 4QWEA 3PSTA 5ALSA 1NK5A 3RJEA 4Z6FA 2KJ9A 3TADC 3PW2A 4ZH4A 1Z1VA 3LYSA 5IIIA 5HHHA 2OHFA 4RPZA 3VCBA 3F5EA 3IG8A 3PNCA 1KSPA 2BZFA 4F91B 2HVHA 4GFJA 4TUSA 5DB7A 1NK8A 3E58A 5AKXA 2HOIA 2QB1A 2MRLA 5IILA 3TAQA 3LWLA 2HCFA 2I6XA 2KHVA 5J2FA 2EZZA 2H3QA 2BR0A 4GXIA 5G5HA 2HVIA 3H4BA 5J0WA 1OUQA 1VJ5A 4I2AA 4BWJA 3CYMA 4TUQA 4UARA 2LHTA 4IS7A 3QX7A 2NO5A 1ZQUA 3BQ1A 4DF8A 2ZUBA 1PUZA 1JI7A 4NM1A 1NJWA 3H0RB 4QZ9A 1NKBA 2JV3A 2NYVA 4C7YA 2IOHA 9ICSA 1ZQTA 4KLQA 2PMZC 3GDXA 4FZLA 2E5SA 5J0UA 1SV4A 4QZAA 4P0PA 1X2IA 2JRZA 4RQ2A 4YR0A 2FJ6A 5TISU 5KFLA 4PPXA 3NVYA
chains in the Genus database with same CATH topology
5HHIA 4TQRA 4ED3A 4O9MA 3HX0A 4DOAA 2DPIA 3UXOA 3ETLA 7ICIA 5J0YA 4F2RA 4BXOB 4YCXA 5CHGA 2FMQA 1BPDA 3C5FA 3MR2A 4P2HA 4ECVA 2FPKA 5J29A 1NKEA 4KLSA 3PO4A 3RJGA 5J2IA 1S77D 9ICJA 2J6TA 4J9PA 4DL5A 8ICOA 2VANA 1D9FA 4MFAA 3RH5A 7ICMA 3V6KA 4YXJA 2PI5A 3IHQB 8ICQA 3JPOA 1ZQCA 4QWCA 5KFOA 5DQIA 1TAUA 3UQ2A 5HNKA 4KLUA 5DG9A 4R64A 4F4ZA 4EBCA 1X9SA 5DBCA 4FBTA 3PX6A 4Z6DA 4I2BA 5TZVA 9ICMA 3M9NB 4M47A 2NRXA 5J2AA 3TAPA 3M9MB 1NK7A 1T3NA 7ICNA 3T5LA 3GV7B 8ICRA 4QZEA 5KT7A 5HMMA 5KG4A 1JXEA 3ZDEA 1U4BA 7ICJA 5J2EA 1HUOA 5KFYA 4GXKA 4ECXA 2Y1JA 3T5HA 3KHLA 3TQ1A 4LVSA 3H40A 3OSPA 3MGIA 7ICUA 2FPMA 3PMNA 4ECUA 3Q8LA 3QEAZ 1ZQEA 4F93B 4R65A 4RQ4A 5DB6A 4TURA 2ZUCA 3BJYA 3RTVA 1KFSA 3MABA 3SV4A 8ICHA 5J0PA 1BPBA 4DL2A 4CCHA 1H38A 1Z00A 3QZ8A 4DWIA 1BPZA 4XA5A 2BCQA 4PH5A 8ICWA 3RB6A 4ED0A 4B9TA 3OGUA 8ICBA 3RRGA 5D46A 3ZDAA 9ICLA 5DG7A 2NRVA 4DOBA 5EOZA 3M8RA 4IRDA 9ICIA 2I1QA 4TQSA 4QZFA 1JMSA 2XO7A 3KTQA 4QWDA 2C28A 4QZGA 4IRCA 1D9DA 3RJIA 4PHAA 4O5EA 4BDPA 7ICPA 2W9CB 1TVAA 3OHBA 2PFQA 1SKRA 3E2EA 3BQ0A 4J9NA 3GIIA 2JEIA 3PR5B 1RXWA 1N56A 2J6SA 2HHQA 8ICSA 4KLIA 2PFPA 3C21A 4O3PA 2BHNA 9ICKA 9ICAA 4YD1A 3QEBZ 1ZQAA 2XCPA 3Q8MA 1LV5A 2HW3A 1A77A 3G6YA 4EZ6A 1AROP 4RPXA 2ZJAA 2AQ0A 3T3FA 4RQ8A 2P66A 2R8GA 2C2DA 2P6RA 2VA8A 4RNOA 2XCAA 3H4DA 5J2HA 4X5VA 7ICHA 3UXPA 3HT3A 3JPQA 2OWOA 2J6UA 1Y88A 1BPEA 4DFPA 1BVSA 3THVA 4P4PA 4UQGA 4DFMA 3NTUA 3N97B 2FMPA 4KLGA 1SL0A 3MFHA 4F5PA 4ED6A 3JPTA 4M6WA 4F4XA 5KFCA 5CA7A 4BGDA 4GLXA 1ZQOA 5C5JA 5KG0A 4YR3A 4FS2A 5J2KA 3JPSA 2IMWP 4ECRA 8ICZA 4NLGA 1XSNA 4KLOA 2A1JA 1ZQDA 3Q8RB 4C8NA 1DOQA 2ISOA 2I9GA 2HHTA 1COOA 4XRHA 5CWRA 9ICNA 3V6HA 5D4BA 2KTQA 4UAYA 3C2KA 3V6JA 7ICLA 5DGBA 4RT3A 2BCUA 5KFHA 5DG8A 3MGHA 3SV3A 1QTMA 4C8LA 4E0DA 2PFNA 3RAXA 2XC9A 5KT4A 5KFEA 4MFFA 4G3IA 8ICJA 4HYKA 3GFKB 3MR3A 4F5OA 1TK5A 5J0QA 5KFKA 4B9NA 1BGXT 5KFFA 4JWNA 1RYSA 4GC7A 3EPGA 5KTQA 4UAWA 3RB3A 5DKWA 5IIJA 1S0NA 2KZZA 4PHDA 1NK0A 3TFSA 9ICFA 4MF8A 4P4MA 3BQTA 1NK4A 1SL2A 1V9PA 2BPFA 3SYZA 4I2FA 4PHPA 5KFGA 4KLLA 5BOLA 5L1JA 4I27A 2PI4A 2VA2A 1Z3EB 5KT2A 4YQWA 2FLLA 5EWEA 3MR6A 3RB0A 4J9SA 2C2EA 1ZQQA 4J9LA 1JX4A 5J2DA 3HP6A 1QLNA 3RR7A 1ZETA 9ICQA 3GV5B 3ZDDA 4UB4A 4BWMA 4DL6A 1ZQVA 4I2GA 4NLKA 2F1IA 4NXZA 2NRTA 3GIMA 5KFTA 2V9WA 4JV1A 2RDJA 4JK1A 8ICKA 5J0RA 4ELTA 5CJ7A 4DQPA 9ICXA 9ICUA 5J0XA 8ICTA 2HHUA 8ICNA 3C23A 2FLPA 3MDAA 1TAQA 5DB9A 2W9CA 3MR5A 4NM2A 4TUPA 1SL1A 2P6UA 5DQGA 1KDHA 4MEXA 4KLEA 3RB4A 1XU4A 4EYHB 4EYIB 1TKDA 3GIKA 1T7PA 4P4OA 2JZBA 3RH4A 3QE9Y 3RR8A 5J0SA 4F3OA 9ICGA 4IQWA 2MUTB 1SKSA 2FLNA 2AGQA 3ZD9A 5IIOA 2VA3A 1UA1A 5L1KA 1HJPA 1S9FA 1S10A 4YVZA 3ISBA 4M9HA 5DLGA 3H8WA 2BDPA 2BCSA 4YN4A 4JV0A 4DLGA 4DSEA 3RH6A 2UVWA 4DQQA 2BKEA 2BCRA 1RYRA 1UT5A 5CP2A 2WTFA 1KLNA 2IA6A 4Q43A 4FO6A 2ASLA 4F2SA 1XO1A 7ICFA 1NOMA 2ATLA 3M9OB 4I2HA 5HMLA 4QW9A 5L1IA 3Q8KA 2IHNA 5KFAA 4F4YA 4QWBA 3C5GA 4J9OA 3N4MB 1MQ2A 1K1QA 4RUCA 1KTQA 1B43A 2NRWA 4DOCA 4ECTA 8ICUA 1WCLA 2ZTEA 3BDPA 5F9LA 4YD2A 3K4GA 3AU6A 4I29A 3PV8A 4R8UA 4O5CA 4F92B 1CUKA 4YR2A 3TARA 1SKWA 2LYHA 4F4KA 8ICFA 3TI0A 5DDYA 3QZ7A 3K75D 1ZQLA 4EZ9A 1QSYA 1ZQJA 4KTQA 4I2EA 2AGPA 4KLFA 3UXNA 7ICSA 4R66A 4J9MA 7ICGA 5DBAA 8ICCA 5KFRA 3RBDA 1UT8A 4DL3A 1LB2B 5KFWA 5KG1A 7ICTA 9ICBA 1ZQFA 2B21A 4YMNA 3ZDCA 4I28A 3GILA 1L3SA 2HHWA 4ECQA 4RQ6A 4DQSA 3EYZA 3RJKA 1D8LA 3PW0A 5KFXA 2R8IA 4O3SA 1XWLA 1N48A 2UVVA 4I2CA 2RDIA 4IR1A 4KLJA 4YMMA 5J2BA 3C2LA 5KFIA 2R8JA 4MFCA 4DFJA 7ICRA 2XGPA 1NJYA 8ICEA 4O3RA 4RNMA 2KN7A 4F5QA 4DLEA 4ED8A 7ICOA 1JN3A 5DQHA 3SZ2A 4F5NA 4ELVA 7ICEA 4JUZA 3T5KA 2ALZA 4BXOA 3JPRA 4IQUA 2DFLA 1U48A 5EWFA 4KLHA 2W9BB 3PMLA 8ICAA 7ICQA 4J9KA 3EZ5A 1KRPA 2C22A 1K1SA 2Q0ZX 4QZIA 4DQIA 2ASJA 1A76A 2KFZA 2ISPA 4DS5A 3H8SA 3C2MA 4C8MA 3H8JA 4B9UA 5KFQA 4IR9A 1L3UA 1RXVA 1X9MA 3EW9A 4RQ3A 3RBEA 5KT5A 1XS9D 5KFDA 2AQ4A 1TK8A 4KMUA 4J9QA 2JEFA 5BPCA 2UVUA 2HHSA 9ICOA 9ICWA 1Z00B 4KLMA 5IINA 3C1YA 4RQ1A 5KFPA 4O5KA 4NY8A 4DS4A 5KG7A 4Q45A 1DGSA 2ZTDA 7ICKA 2V4RA 1T8EA 4RQ7A 3OHAA 3KHRA 3AU2A 4YG2A 5L9XA 4EBEA 4DFKA 4Q8EA 5DDMA 4I2DA 1IXRA 4ECWA 5F9NA 3H7IA 2ASDA 1UA0A 4RT2A 1MSWD 2W8LA 2NRZA 3Q8SB 1X9WA 1L5UA 9ICTA 4RQ5A 1SZPA 4KN7A 4PGQA 3V7KA 4M0AA 1NK9A 4JWMA 1QSLA 2W9AA 3RJFA 5J0TA 3UQ0A 5CR0A 2IHMA 2BPGA 1HUZA 3V7JA 3G6VA 3PW4A 4XUSA 4Z6CA 3HWTA 3GIJA 3TANA 4O3QA 1KEJA 4UBCA 1MC8A 1S0VA 3ISCA 3HW8A 4IQTA 1ZQSA 1TV9A 4QZDA 3V72A 1ZJMA 1C7YA 4DEZA 1QSSA 1IM4A 5BOMA 3UPQA 1NJZA 1NKCA 5DGAA 4DSIA 4YXMA 3RJJA 3PX4A 4KLTA 2BQUA 9ICCA 1ZQIA 1NK6A 4IRKA 3PR4A 1S0MA 8ICPA 4M6WB 2XGQA 4DSLA 3ISDA 4UAZA 5L1LA 3OSNA 2FPLA 5EWGA 3KHHA 4UB5A 4GXJA 1ZQRA 1ZQZA 1ZQXA 4O3NA 4YFKA 4M9JA 2KFNA 8ICYA 4RPYA 4JV2A 4C8KA 3PO5A 5KFJA 1S76D 4ED2A 1CEZA 1B22A 4DF4A 1TFRA 2A1JB 1U9LA 4EBDA 3PW5A 5HP4A 4QZHA 4ECSA 5CB1A 4M04A 1ZQYA 3PW7A 1XSPA 9ICHA 4I2JA 4UB1A 3Q8PB 2AU0A 3LWMA 3BQ2A 2KZMA 2BPCA 2H5XA 5DBBA 4ECYA 4EEYA 4DL7A 1ZJNA 4O3OA 1ZQMA 1WCNA 1ZQPA 2PFOA 9ICPA 4QWAA 5KG5A 8ICLA 4QZ8A 1T4GA 4QZBA 1U45A 4ELUA 2BCVA 8ICMA 1ZYQA 4QWEA 3Q8QB 3OJSA 1NK5A 4C8OA 1RPLA 3PX0A 3RJEA 4GC6A 4Z6FA 1PZNA 3EWAA 3PW2A 3RJHA 4ZH4A 1BPYA 5KFSA 5KT3A 1ZQGA 3T5JA 1ZQKA 5IIIA 4NLNA 5HHHA 3ZDBA 2W9BA 3RAQA 4F5RA 1EXNA 1JIHA 2KZ3A 3B0YA 4RPZA 4FS1A 2BQ3A 4RZRA 2UVRA 1ZQWA 1KFDA 4XQ8A 2XY7A 4DSKA 3FDSA 4DL4A 4PHEA 3EPIA 3PNCA 1KSPA 2W8KA 1S0OA 4RUAA 4ED7A 4F91B 4F4WA 2HVHA 4PGYA 3ORYA 5JUMA 5DB7A 4UBBA 4TUSA 3GV8B 3TFRA 5IIMA 2XY6A 5KFBA 1NK8A 4K4HA 3FYHA 2IBKA 4M9LA 2F1JA 4NLZA 2M9NA 5IIKA 2HHXA 7ICVA 3B0XA 4B9MA 5KT6A 5DB8A 4PGXA 3AUOA 1TK0A 4QW8A 4J9RA 2HHVA 3GQCA 5IILA 3TAQA 4B9LA 3LWLA 5J2GA 2W9MA 3LK9A 1ZQHA 5KFZA 2AGOA 4Z6EA 1ZQBA 2JEGA 1XC9A 2V4QA 3MBYA 4QZCA 9ICRA 2ZJ8A 4F8RA 3OJUA 5J2FA 2BR0A 2JZBB 4GXIA 4O0IA 9ICEA 4YP3A 5D49A 4ED1A 4B9SA 4M9NA 2HVIA 4Q8FA 3PY8A 5DLFA 2MAXA 5KG3A 5KFUA 3H4BA 5J0WA 3NGDA 5KG6A 2Y1IA 2FMSA 4K4GA 4I2AA 4BWJA 2ZUDA 2F1HA 1MQ3A 4TUQA 4M9GA 5J2CA 2R8KA 5J0OA 4KN4A 3ZD8A 3JPNA 4KLDA 9ICVA 3C1ZA 4UB3A 1NJXA 1D8YA 3JPPA 1ZQUA 3BQ1A 3V7LA 2R8HA 4MEYA 3PVXA 5J2JA 4DF8A 2ZUBA 3SI8A 2DPJA 3HPOA 4DQRA 5KG2A 1L3TA 4DO9A 4Q44A 1BPXA 1KFTA 4RU9A 4B9VA 1NJWA 4NM1A 3G6XA 2BGWA 4R8UB 4F50A 8ICGA 4QZ9A 1L3VA 1NKBA 2JEJA 3IM1A 4K4IA 4IQVA 2ZTCA 4R63A 9ICSA 1ZQTA 4RNNA 1U49A 5KFNA 2ZJ5A 2MUTA 4KLQA 4LZGA 2PXIA 8ICIA 4MF2A 8ICVA 3MFIA 4KITB 3KHGA 1XSLA 1S97A 3GDXA 1JXLA 5J0UA 4YMOA 4QZAA 1ZQNA 4FBUA 4UB2A 5KFMA 1RZTA 2C2RA 1X2IA 1U47A 4DSFA 4ECZA 4DSJA 4RQ0A 4LZDA 3M8SA 5KFVA 2GWSA 4M2YA 4I2IA 4RQ2A 4YR0A 3LDAA 8ICXA 2AJQA 5KFLA 2BQRA 4PPXA 3MDCA 2XY5A 3RRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HHI A;  4TQR A;  4ED3 A;  4O9M A;  3HX0 A;  4DOA A;  2DPI A;  3UXO A;  3ETL A;  7ICI A;  5J0Y A;  4F2R A;  4BXO B;  4YCX A;  5CHG A;  2FMQ A;  1BPD A;  3C5F A;  3MR2 A;  4P2H A;  4ECV A;  2FPK A;  5J29 A;  1NKE A;  4KLS A;  3PO4 A;  3RJG A;  5J2I A;  1S77 D;  9ICJ A;  2J6T A;  4J9P A;  4DL5 A;  8ICO A;  2VAN A;  1D9F A;  4MFA A;  3RH5 A;  7ICM A;  3V6K A;  4YXJ A;  2PI5 A;  3IHQ B;  8ICQ A;  3JPO A;  1ZQC A;  4QWC A;  5KFO A;  5DQI A;  1TAU A;  3UQ2 A;  5HNK A;  4KLU A;  5DG9 A;  4R64 A;  4F4Z A;  4EBC A;  1X9S A;  5DBC A;  4FBT A;  3PX6 A;  4Z6D A;  4I2B A;  5TZV A;  9ICM A;  3M9N B;  4M47 A;  2NRX A;  5J2A A;  3TAP A;  3M9M B;  1NK7 A;  1T3N A;  7ICN A;  3T5L A;  3GV7 B;  8ICR A;  4QZE A;  5KT7 A;  5HMM A;  5KG4 A;  1JXE A;  3ZDE A;  1U4B A;  7ICJ A;  5J2E A;  1HUO A;  5KFY A;  4GXK A;  4ECX A;  2Y1J A;  3T5H A;  3KHL A;  3TQ1 A;  4LVS A;  3H40 A;  3OSP A;  3MGI A;  7ICU A;  2FPM A;  3PMN A;  4ECU A;  3Q8L A;  3QEA Z;  1ZQE A;  4F93 B;  4R65 A;  4RQ4 A;  5DB6 A;  4TUR A;  2ZUC A;  3BJY A;  3RTV A;  1KFS A;  3MAB A;  3SV4 A;  8ICH A;  5J0P A;  1BPB A;  4DL2 A;  4CCH A;  1H38 A;  1Z00 A;  3QZ8 A;  4DWI A;  1BPZ A;  4XA5 A;  2BCQ A;  4PH5 A;  8ICW A;  3RB6 A;  4ED0 A;  4B9T A;  3OGU A;  8ICB A;  3RRG A;  5D46 A;  3ZDA A;  9ICL A;  5DG7 A;  2NRV A;  4DOB A;  5EOZ A;  3M8R A;  4IRD A;  9ICI A;  2I1Q A;  4TQS A;  4QZF A;  1JMS A;  2XO7 A;  3KTQ A;  4QWD A;  2C28 A;  4QZG A;  4IRC A;  1D9D A;  3RJI A;  4PHA A;  4O5E A;  4BDP A;  7ICP A;  2W9C B;  1TVA A;  3OHB A;  2PFQ A;  1SKR A;  3E2E A;  3BQ0 A;  4J9N A;  3GII A;  2JEI A;  3PR5 B;  1RXW A;  1N56 A;  2J6S A;  2HHQ A;  8ICS A;  4KLI A;  2PFP A;  3C21 A;  4O3P A;  2BHN A;  9ICK A;  9ICA A;  4YD1 A;  3QEB Z;  1ZQA A;  2XCP A;  3Q8M A;  1LV5 A;  2HW3 A;  1A77 A;  3G6Y A;  4EZ6 A;  1ARO P;  4RPX A;  2ZJA A;  2AQ0 A;  3T3F A;  4RQ8 A;  2P66 A;  2R8G A;  2C2D A;  2P6R A;  2VA8 A;  4RNO A;  2XCA A;  3H4D A;  5J2H A;  4X5V A;  7ICH A;  3UXP A;  3HT3 A;  3JPQ A;  2OWO A;  2J6U A;  1Y88 A;  1BPE A;  4DFP A;  1BVS A;  3THV A;  4P4P A;  4UQG A;  4DFM A;  3NTU A;  3N97 B;  2FMP A;  4KLG A;  1SL0 A;  3MFH A;  4F5P A;  4ED6 A;  3JPT A;  4M6W A;  4F4X A;  5KFC A;  5CA7 A;  4BGD A;  4GLX A;  1ZQO A;  5C5J A;  5KG0 A;  4YR3 A;  4FS2 A;  5J2K A;  3JPS A;  2IMW P;  4ECR A;  8ICZ A;  4NLG A;  1XSN A;  4KLO A;  2A1J A;  1ZQD A;  3Q8R B;  4C8N A;  1DOQ A;  2ISO A;  2I9G A;  2HHT A;  1COO A;  4XRH A;  5CWR A;  9ICN A;  3V6H A;  5D4B A;  2KTQ A;  4UAY A;  3C2K A;  3V6J A;  7ICL A;  5DGB A;  4RT3 A;  2BCU A;  5KFH A;  5DG8 A;  3MGH A;  3SV3 A;  1QTM A;  4C8L A;  4E0D A;  2PFN A;  3RAX A;  2XC9 A;  5KT4 A;  5KFE A;  4MFF A;  4G3I A;  8ICJ A;  4HYK A;  3GFK B;  3MR3 A;  4F5O A;  1TK5 A;  5J0Q A;  5KFK A;  4B9N A;  1BGX T;  5KFF A;  4JWN A;  1RYS A;  4GC7 A;  3EPG A;  5KTQ A;  4UAW A;  3RB3 A;  5DKW A;  5IIJ A;  1S0N A;  2KZZ A;  4PHD A;  1NK0 A;  3TFS A;  9ICF A;  4MF8 A;  4P4M A;  3BQT A;  1NK4 A;  1SL2 A;  1V9P A;  2BPF A;  3SYZ A;  4I2F A;  4PHP A;  5KFG A;  4KLL A;  5BOL A;  5L1J A;  4I27 A;  2PI4 A;  2VA2 A;  1Z3E B;  5KT2 A;  4YQW A;  2FLL A;  5EWE A;  3MR6 A;  3RB0 A;  4J9S A;  2C2E A;  1ZQQ A;  4J9L A;  1JX4 A;  5J2D A;  3HP6 A;  1QLN A;  3RR7 A;  1ZET A;  9ICQ A;  3GV5 B;  3ZDD A;  4UB4 A;  4BWM A;  4DL6 A;  1ZQV A;  4I2G A;  4NLK A;  2F1I A;  4NXZ A;  2NRT A;  3GIM A;  5KFT A;  2V9W A;  4JV1 A;  2RDJ A;  4JK1 A;  8ICK A;  5J0R A;  4ELT A;  5CJ7 A;  4DQP A;  9ICX A;  9ICU A;  5J0X A;  8ICT A;  2HHU A;  8ICN A;  3C23 A;  2FLP A;  3MDA A;  1TAQ A;  5DB9 A;  2W9C A;  3MR5 A;  4NM2 A;  4TUP A;  1SL1 A;  2P6U A;  5DQG A;  1KDH A;  4MEX A;  4KLE A;  3RB4 A;  1XU4 A;  4EYH B;  4EYI B;  1TKD A;  3GIK A;  1T7P A;  4P4O A;  2JZB A;  3RH4 A;  3QE9 Y;  3RR8 A;  5J0S A;  4F3O A;  9ICG A;  4IQW A;  2MUT B;  1SKS A;  2FLN A;  2AGQ A;  3ZD9 A;  5IIO A;  2VA3 A;  1UA1 A;  5L1K A;  1HJP A;  1S9F A;  1S10 A;  4YVZ A;  3ISB A;  4M9H A;  5DLG A;  3H8W A;  2BDP A;  2BCS A;  4YN4 A;  4JV0 A;  4DLG A;  4DSE A;  3RH6 A;  2UVW A;  4DQQ A;  2BKE A;  2BCR A;  1RYR A;  1UT5 A;  5CP2 A;  2WTF A;  1KLN A;  2IA6 A;  4Q43 A;  4FO6 A;  2ASL A;  4F2S A;  1XO1 A;  7ICF A;  1NOM A;  2ATL A;  3M9O B;  4I2H A;  5HML A;  4QW9 A;  5L1I A;  3Q8K A;  2IHN A;  5KFA A;  4F4Y A;  4QWB A;  3C5G A;  4J9O A;  3N4M B;  1MQ2 A;  1K1Q A;  4RUC A;  1KTQ A;  1B43 A;  2NRW A;  4DOC A;  4ECT A;  8ICU A;  1WCL A;  2ZTE A;  3BDP A;  5F9L A;  4YD2 A;  3K4G A;  3AU6 A;  4I29 A;  3PV8 A;  4R8U A;  4O5C A;  4F92 B;  1CUK A;  4YR2 A;  3TAR A;  1SKW A;  2LYH A;  4F4K A;  8ICF A;  3TI0 A;  5DDY A;  3QZ7 A;  3K75 D;  1ZQL A;  4EZ9 A;  1QSY A;  1ZQJ A;  4KTQ A;  4I2E A;  2AGP A;  4KLF A;  3UXN A;  7ICS A;  4R66 A;  4J9M A;  7ICG A;  5DBA A;  8ICC A;  5KFR A;  3RBD A;  1UT8 A;  4DL3 A;  1LB2 B;  5KFW A;  5KG1 A;  7ICT A;  9ICB A;  1ZQF A;  2B21 A;  4YMN A;  3ZDC A;  4I28 A;  3GIL A;  1L3S A;  2HHW A;  4ECQ A;  4RQ6 A;  4DQS A;  3EYZ A;  3RJK A;  1D8L A;  3PW0 A;  5KFX A;  2R8I A;  4O3S A;  1XWL A;  1N48 A;  2UVV A;  4I2C A;  2RDI A;  4IR1 A;  4KLJ A;  4YMM A;  5J2B A;  3C2L A;  5KFI A;  2R8J A;  4MFC A;  4DFJ A;  7ICR A;  2XGP A;  1NJY A;  8ICE A;  4O3R A;  4RNM A;  2KN7 A;  4F5Q A;  4DLE A;  4ED8 A;  7ICO A;  1JN3 A;  5DQH A;  3SZ2 A;  4F5N A;  4ELV A;  7ICE A;  4JUZ A;  3T5K A;  2ALZ A;  4BXO A;  3JPR A;  4IQU A;  2DFL A;  1U48 A;  5EWF A;  4KLH A;  2W9B B;  3PML A;  8ICA A;  7ICQ A;  4J9K A;  3EZ5 A;  1KRP A;  2C22 A;  1K1S A;  2Q0Z X;  4QZI A;  4DQI A;  2ASJ A;  1A76 A;  2KFZ A;  2ISP A;  4DS5 A;  3H8S A;  3C2M A;  4C8M A;  3H8J A;  4B9U A;  5KFQ A;  4IR9 A;  1L3U A;  1RXV A;  1X9M A;  3EW9 A;  4RQ3 A;  3RBE A;  5KT5 A;  1XS9 D;  5KFD A;  2AQ4 A;  1TK8 A;  4KMU A;  4J9Q A;  2JEF A;  5BPC A;  2UVU A;  2HHS A;  9ICO A;  9ICW A;  1Z00 B;  4KLM A;  5IIN A;  3C1Y A;  4RQ1 A;  5KFP A;  4O5K A;  4NY8 A;  4DS4 A;  5KG7 A;  4Q45 A;  1DGS A;  2ZTD A;  7ICK A;  2V4R A;  1T8E A;  4RQ7 A;  3OHA A;  3KHR A;  3AU2 A;  4YG2 A;  5L9X A;  4EBE A;  4DFK A;  4Q8E A;  5DDM A;  4I2D A;  1IXR A;  4ECW A;  5F9N A;  3H7I A;  2ASD A;  1UA0 A;  4RT2 A;  1MSW D;  2W8L A;  2NRZ A;  3Q8S B;  1X9W A;  1L5U A;  9ICT A;  4RQ5 A;  1SZP A;  4KN7 A;  4PGQ A;  3V7K A;  4M0A A;  1NK9 A;  4JWM A;  1QSL A;  2W9A A;  3RJF A;  5J0T A;  3UQ0 A;  5CR0 A;  2IHM A;  2BPG A;  1HUZ A;  3V7J A;  3G6V A;  3PW4 A;  4XUS A;  4Z6C A;  3HWT A;  3GIJ A;  3TAN A;  4O3Q A;  1KEJ A;  4UBC A;  1MC8 A;  1S0V A;  3ISC A;  3HW8 A;  4IQT A;  1ZQS A;  1TV9 A;  4QZD A;  3V72 A;  1ZJM A;  1C7Y A;  4DEZ A;  1QSS A;  1IM4 A;  5BOM A;  3UPQ A;  1NJZ A;  1NKC A;  5DGA A;  4DSI A;  4YXM A;  3RJJ A;  3PX4 A;  4KLT A;  2BQU A;  9ICC A;  1ZQI A;  1NK6 A;  4IRK A;  3PR4 A;  1S0M A;  8ICP A;  4M6W B;  2XGQ A;  4DSL A;  3ISD A;  4UAZ A;  5L1L A;  3OSN A;  2FPL A;  5EWG A;  3KHH A;  4UB5 A;  4GXJ A;  1ZQR A;  1ZQZ A;  1ZQX A;  4O3N A;  4YFK A;  4M9J A;  2KFN A;  8ICY A;  4RPY A;  4JV2 A;  4C8K A;  3PO5 A;  5KFJ A;  1S76 D;  4ED2 A;  1CEZ A;  1B22 A;  4DF4 A;  1TFR A;  2A1J B;  1U9L A;  4EBD A;  3PW5 A;  5HP4 A;  4QZH A;  4ECS A;  5CB1 A;  4M04 A;  1ZQY A;  3PW7 A;  1XSP A;  9ICH A;  4I2J A;  4UB1 A;  3Q8P B;  2AU0 A;  3LWM A;  3BQ2 A;  2KZM A;  2BPC A;  2H5X A;  5DBB A;  4ECY A;  4EEY A;  4DL7 A;  1ZJN A;  4O3O A;  1ZQM A;  1WCN A;  1ZQP A;  2PFO A;  9ICP A;  4QWA A;  5KG5 A;  8ICL A;  4QZ8 A;  1T4G A;  4QZB A;  1U45 A;  4ELU A;  2BCV A;  8ICM A;  1ZYQ A;  4QWE A;  3Q8Q B;  3OJS A;  1NK5 A;  4C8O A;  1RPL A;  3PX0 A;  3RJE A;  4GC6 A;  4Z6F A;  1PZN A;  3EWA A;  3PW2 A;  3RJH A;  4ZH4 A;  1BPY A;  5KFS A;  5KT3 A;  1ZQG A;  3T5J A;  1ZQK A;  5III A;  4NLN A;  5HHH A;  3ZDB A;  2W9B A;  3RAQ A;  4F5R A;  1EXN A;  1JIH A;  2KZ3 A;  3B0Y A;  4RPZ A;  4FS1 A;  2BQ3 A;  4RZR A;  2UVR A;  1ZQW A;  1KFD A;  4XQ8 A;  2XY7 A;  4DSK A;  3FDS A;  4DL4 A;  4PHE A;  3EPI A;  3PNC A;  1KSP A;  2W8K A;  1S0O A;  4RUA A;  4ED7 A;  4F91 B;  4F4W A;  2HVH A;  4PGY A;  3ORY A;  5JUM A;  5DB7 A;  4UBB A;  4TUS A;  3GV8 B;  3TFR A;  5IIM A;  2XY6 A;  5KFB A;  1NK8 A;  4K4H A;  3FYH A;  2IBK A;  4M9L A;  2F1J A;  4NLZ A;  2M9N A;  5IIK A;  2HHX A;  7ICV A;  3B0X A;  4B9M A;  5KT6 A;  5DB8 A;  4PGX A;  3AUO A;  1TK0 A;  4QW8 A;  4J9R A;  2HHV A;  3GQC A;  5IIL A;  3TAQ A;  4B9L A;  3LWL A;  5J2G A;  2W9M A;  3LK9 A;  1ZQH A;  5KFZ A;  2AGO A;  4Z6E A;  1ZQB A;  2JEG A;  1XC9 A;  2V4Q A;  3MBY A;  4QZC A;  9ICR A;  2ZJ8 A;  4F8R A;  3OJU A;  5J2F A;  2BR0 A;  2JZB B;  4GXI A;  4O0I A;  9ICE A;  4YP3 A;  5D49 A;  4ED1 A;  4B9S A;  4M9N A;  2HVI A;  4Q8F A;  3PY8 A;  5DLF A;  2MAX A;  5KG3 A;  5KFU A;  3H4B A;  5J0W A;  3NGD A;  5KG6 A;  2Y1I A;  2FMS A;  4K4G A;  4I2A A;  4BWJ A;  2ZUD A;  2F1H A;  1MQ3 A;  4TUQ A;  4M9G A;  5J2C A;  2R8K A;  5J0O A;  4KN4 A;  3ZD8 A;  3JPN A;  4KLD A;  9ICV A;  3C1Z A;  4UB3 A;  1NJX A;  1D8Y A;  3JPP A;  1ZQU A;  3BQ1 A;  3V7L A;  2R8H A;  4MEY A;  3PVX A;  5J2J A;  4DF8 A;  2ZUB A;  3SI8 A;  2DPJ A;  3HPO A;  4DQR A;  5KG2 A;  1L3T A;  4DO9 A;  4Q44 A;  1BPX A;  1KFT A;  4RU9 A;  4B9V A;  1NJW A;  4NM1 A;  3G6X A;  2BGW A;  4R8U B;  4F50 A;  8ICG A;  4QZ9 A;  1L3V A;  1NKB A;  2JEJ A;  3IM1 A;  4K4I A;  4IQV A;  2ZTC A;  4R63 A;  9ICS A;  1ZQT A;  4RNN A;  1U49 A;  5KFN A;  2ZJ5 A;  2MUT A;  4KLQ A;  4LZG A;  2PXI A;  8ICI A;  4MF2 A;  8ICV A;  3MFI A;  4KIT B;  3KHG A;  1XSL A;  1S97 A;  3GDX A;  1JXL A;  5J0U A;  4YMO A;  4QZA A;  1ZQN A;  4FBU A;  4UB2 A;  5KFM A;  1RZT A;  2C2R A;  1X2I A;  1U47 A;  4DSF A;  4ECZ A;  4DSJ A;  4RQ0 A;  4LZD A;  3M8S A;  5KFV A;  2GWS A;  4M2Y A;  4I2I A;  4RQ2 A;  4YR0 A;  3LDA A;  8ICX A;  2AJQ A;  5KFL A;  2BQR A;  4PPX A;  3MDC A;  2XY5 A;  3RRH A; 
#chains in the Genus database with same CATH topology
 2HSZ A;  1LKY A;  2GO7 A;  5CHG A;  1BPD A;  1N5W A;  1NKE A;  9ICJ A;  4J9P A;  3L5K A;  5AI0 A;  4YXJ A;  1WWU A;  4C0Z A;  3UQ2 A;  2A1A A;  2JH1 A;  4KLU A;  1HIW A;  1X9S A;  1FFV A;  5DBC A;  2LYA A;  2K4I A;  4Z6D A;  3L3F X;  5AKK A;  5TZV A;  4M47 A;  1NK7 A;  3TAP A;  4CGZ A;  7ICN A;  5KG4 A;  4ZOH C;  3BQ7 A;  1TE2 A;  4DCC A;  1L8O A;  2KP7 A;  3LVV A;  3Q8L A;  1ZQE A;  5DB6 A;  4TUR A;  3BJY A;  3MAB A;  2KSO A;  5J0P A;  4O3M A;  1Z00 A;  1RDF A;  4NLC A;  4PH5 A;  8ICW A;  8ICB A;  4B9T A;  4DOB A;  5EOZ A;  3M8R A;  4IRD A;  1S5L U;  4TQS A;  1JMS A;  4QWD A;  2C28 A;  3WKE A;  3RJI A;  3UMC A;  3GII A;  1N60 A;  2DUY A;  3OPX A;  3PR5 B;  3C21 A;  1V38 A;  1KKX A;  4YD1 A;  2Q4T A;  1LV5 A;  2HW3 A;  1A77 A;  2AQ0 A;  4EEN A;  2P35 A;  3TAC B;  2VA8 A;  4RNO A;  3H4D A;  7ICH A;  4F72 A;  2E8P A;  4P4P A;  4DFM A;  3B9J A;  3NAS A;  1SL0 A;  4M6W A;  4YR3 A;  5KG0 A;  4FS2 A;  3JPS A;  3M7D A;  2O6K A;  3GZF A;  2F8L A;  4C8N A;  5ALW A;  2ISO A;  3F2D A;  4XRH A;  2KTQ A;  7ICL A;  5KFH A;  3RAX A;  2XC9 A;  3PSP A;  2JMG A;  4U6P A;  1V97 A;  5KFK A;  4B9N A;  4GC7 A;  1S8O A;  3IDW A;  3RB3 A;  3NUQ A;  1S0N A;  2KZZ A;  5ALT A;  4P4M A;  3BQT A;  1SL2 A;  1V9P A;  4I2F A;  4KLL A;  4LJX A;  2VA2 A;  3IN5 A;  2FLL A;  5EWE A;  4KX5 A;  2C2E A;  5J2D A;  5AM1 A;  2QAR B;  4I2G A;  4NLK A;  5J0R A;  9ICX A;  5ALJ A;  4Y2Q A;  9ICU A;  8ICN A;  3MDA A;  2W9C A;  1SL1 A;  2P6U A;  1T7P A;  4EYH B;  4EYI B;  3PZP A;  2WF9 A;  3QE9 Y;  4IQW A;  2MUT B;  2KK0 A;  3BS5 B;  2KIC A;  1S9F A;  1HJP A;  3ISB A;  2BDP A;  4DLG A;  2HI0 A;  5B66 U;  4DQQ A;  2BKE A;  1UT5 A;  3D2N A;  2QLT A;  5CP2 A;  1X66 A;  4FO6 A;  2ASL A;  4F2S A;  1NOM A;  2D6F C;  5HML A;  4UAU A;  1MQ2 A;  1KTQ A;  4RUC A;  1NI3 A;  2W04 A;  1WCL A;  2HOF A;  3BDP A;  3PV8 A;  4O5C A;  1ZQL A;  3K75 D;  4EZ9 A;  2KJ5 A;  3O0F A;  2MU2 A;  8ICC A;  1UT8 A;  5KG1 A;  7ICT A;  9ICB A;  4I28 A;  3GIL A;  3SR6 A;  3AMZ A;  4UAS A;  1D8L A;  4I2C A;  3EUB 2;  4IR1 A;  4DFJ A;  1QQ6 A;  1NJY A;  2DBY A;  3QU7 A;  1JN3 A;  4Y2J A;  3QUB A;  4F5N A;  2ZXI A;  2ALZ A;  5ALL A;  1U48 A;  8ICA A;  4J9K A;  3PSF A;  2ASJ A;  1SV0 C;  4DS5 A;  4B6J A;  5KL8 B;  3C2M A;  4C8M A;  4G9B A;  5KFQ A;  4IR9 A;  3EW9 A;  4RQ3 A;  3M6Z A;  2JEF A;  5BPC A;  4ACO A;  3H8M A;  2HHS A;  2OH2 A;  4U7C A;  4Q45 A;  2ZTD A;  7ICK A;  4F71 A;  4Q8E A;  5AKL A;  1IXR A;  2EDU A;  4RT2 A;  1Z19 A;  9ICT A;  1BNP A;  3SEI A;  4RQ5 A;  4PGQ A;  5J0T A;  2BPG A;  5ALY A;  1HUZ A;  1MA7 A;  3PW4 A;  4O3Q A;  1S0V A;  3ISC A;  5GTI U;  3HW8 A;  2W03 A;  3PSI A;  4IL6 U;  2LKY A;  5AKZ A;  1QSS A;  3QUC A;  2M0N A;  1NJZ A;  4OJL A;  4KLT A;  2ZXH A;  3ICX A;  1RYU A;  4IRK A;  8ICP A;  5L1L A;  4GXJ A;  5EWG A;  2DWQ A;  2LMR A;  5B5E U;  8ICY A;  4YFK A;  3PO5 A;  1CEZ A;  1ZD4 A;  4DF4 A;  1TFR A;  2W54 A;  4ECS A;  3KKA A;  5CB1 A;  4M04 A;  2FDR A;  2I5H A;  1ZQY A;  3PW7 A;  9ICH A;  3HJE A;  4I2J A;  2AU0 A;  4C4R A;  3LWM A;  3J81 j;  4ECY A;  1ZJN A;  4O3O A;  4C4T A;  4QWA A;  5KG5 A;  8ICL A;  3AQF A;  8ICM A;  2CN1 A;  3Q8Q B;  3OJS A;  4CF3 A;  4RQN A;  3PX0 A;  4GC6 A;  3RJH A;  2HDO A;  5KFS A;  1ZQK A;  2QKQ A;  1B0X A;  1EXN A;  1JIH A;  2KZ3 A;  3B0Y A;  5CEH A;  2BQ3 A;  4RZR A;  4XQ8 A;  4OO1 J;  2XY7 A;  4DL4 A;  4PHE A;  3EPI A;  2W8K A;  4PGY A;  3ORY A;  5JUM A;  4UBB A;  2XY6 A;  4K4H A;  5AI5 A;  4M9L A;  5ALD A;  2LM1 A;  4NLZ A;  1IV8 A;  2HHX A;  1JRO A;  5DB8 A;  5AKJ A;  4QW8 A;  1NNL A;  2F2A B;  4B9L A;  4CNQ A;  2W9M A;  1XC9 A;  9ICR A;  4FFD A;  2ZJ8 A;  3OJU A;  4UB8 U;  3KBB A;  3KOO A;  9ICE A;  4B9S A;  4M9N A;  4Q8F A;  2AH5 A;  5DLF A;  2MAX A;  5KG3 A;  2Y1I A;  3NGD A;  4Y2Y A;  2ZUD A;  1MQ3 A;  2QAR A;  9ICV A;  5J0O A;  2G09 A;  3H0L B;  3C1Z A;  1D8Y A;  3A0B U;  2R8H A;  5JRT A;  3SI8 A;  5J2J A;  3HPO A;  4Q44 A;  1KFT A;  4RU9 A;  4B9V A;  4QNL A;  1ZD5 A;  4F50 A;  1L3V A;  2OYY A;  2JEJ A;  2ZTC A;  4R63 A;  2Z7J A;  2DL0 A;  5KFN A;  2MUT A;  8ICI A;  8ICV A;  3BS5 A;  3MFI A;  1S97 A;  1XSL A;  2ODG A;  1M6Y A;  5ALG A;  2KVC A;  5AK4 A;  4FBU A;  1RZT A;  4Y2X A;  3DV9 A;  4LZD A;  4RQ0 A;  5KFV A;  3WK9 A;  2GWS A;  4I2I A;  3AN1 A;  8ICX A;  2XY5 A;  1YZ7 A;  2KD1 A;  1X6J A;  4AYB F;  3HX0 A;  4DOA A;  2DPI A;  2VIX A;  2H3Z A;  2NV3 A;  3L4P A;  2FMQ A;  2WHE A;  4ECV A;  5J29 A;  1SWV A;  3PO4 A;  5J2I A;  1PVP A;  1S77 D;  4DL5 A;  3IV6 A;  2PI5 A;  8ICQ A;  3JPO A;  1ZQC A;  5KFO A;  5DQI A;  1WG8 A;  2ZIX B;  4I2B A;  2JH7 A;  9ICM A;  2NRX A;  3T5L A;  3GV7 B;  8ICR A;  5KT7 A;  4P0Q A;  3ZDE A;  1U4B A;  2GLE A;  2Y0S F;  1ZQ1 C;  5KFY A;  1DK3 A;  3T5H A;  2F3N A;  5AK5 A;  3OSP A;  2FPM A;  4ECU A;  1AQ6 A;  4KX3 A;  1BPB A;  2BCQ A;  4XA5 A;  2KKV A;  2DKZ A;  9ICI A;  3KTQ A;  1Q8K A;  4QZG A;  1D9D A;  4BDP A;  2W9C B;  1SKR A;  5HR7 A;  4J9N A;  1RXW A;  1N56 A;  1SXD A;  9ICA A;  2XCP A;  1F44 A;  4Y2P A;  2YMP A;  2P66 A;  2R8G A;  2C2D A;  2P6R A;  4X5V A;  2NO4 A;  1BVS A;  3THV A;  1Z1B A;  3NTU A;  2OXO A;  4F5P A;  4ED6 A;  4F4X A;  5CA7 A;  3GU3 A;  3ONN A;  4GLX A;  3D2Q A;  3WKA A;  8ICZ A;  4NLG A;  1XSN A;  4KLO A;  2LPE A;  1DOQ A;  2W3S A;  3BZK A;  5ALU A;  1COO A;  5D4B A;  3C2K A;  2BCU A;  1QTM A;  4E0D A;  5KFE A;  4MFF A;  2ZIU B;  4F5O A;  5J0Q A;  1BGX T;  4JWN A;  5AM0 A;  1RYS A;  2F77 X;  5DKW A;  5IIJ A;  4PHD A;  1NK0 A;  1SZH A;  3QYP A;  1VDV A;  5ALI A;  3FC4 A;  5L1J A;  4I27 A;  1Z3E B;  5KAI U;  3MR6 A;  3RB0 A;  4J9S A;  4EEK A;  4CDG A;  3VC8 A;  3RR7 A;  4DL6 A;  1ZQV A;  4C80 A;  1NZB A;  1N62 A;  3GIM A;  5AK3 A;  2V9W A;  2B0C A;  4ELT A;  2OCE A;  5J0X A;  2HMX A;  8ICT A;  3NVW A;  3C23 A;  5KL1 B;  1TAQ A;  3MR5 A;  4NM2 A;  5DQG A;  4KLE A;  1TKD A;  5H2F U;  2R18 A;  3RFA A;  5A0L A;  4MHV A;  3QUT A;  3MC1 A;  2FLN A;  2AGQ A;  3K1Z A;  3ZD9 A;  1PK1 B;  2VA3 A;  1UA1 A;  5L1K A;  5EE9 A;  2BCS A;  2UVW A;  4DSE A;  2BCR A;  1RYR A;  5ALO A;  1KW4 A;  4Q43 A;  2G07 A;  2ATL A;  3M9O B;  1P7D A;  2IHN A;  5KFA A;  4F4Y A;  4J9O A;  1B43 A;  4YD2 A;  4I29 A;  4F92 B;  4YR2 A;  1SKW A;  2LYH A;  4F4K A;  4KTQ A;  1ZQJ A;  3IP4 B;  4R66 A;  3QU4 A;  4J9M A;  5KFR A;  1Q3U A;  5KFW A;  1ZQF A;  4YMN A;  2ZG6 A;  5AKY A;  4ECQ A;  4DQS A;  3EYZ A;  3RJK A;  2R8I A;  4KLJ A;  2R8J A;  3CP8 A;  2WB1 F;  2XGP A;  3F53 A;  2KMD A;  4ELV A;  1CI4 A;  3JPR A;  4IQU A;  4KLH A;  5EWF A;  2YMM A;  5HR6 A;  3S6J A;  7ICQ A;  4FE3 A;  2C22 A;  1K1S A;  1A76 A;  5AKE A;  2KFZ A;  3FM9 A;  4B9U A;  3H8J A;  2KIW A;  1X9M A;  5KT5 A;  1A6S A;  5AIB A;  4J9Q A;  9ICW A;  5IIN A;  1WWV A;  5KFP A;  4O5K A;  2KEY A;  3ZI4 A;  3CRX A;  2ZIX A;  3KKA C;  3OHA A;  3AU2 A;  3AQE A;  4YG2 A;  4DFK A;  5ALQ A;  3F2C A;  5F9N A;  3H7I A;  2W8L A;  3Q8S B;  4BUG A;  1SZP A;  4KN7 A;  3QXG A;  4JWM A;  2HBK A;  3N28 A;  3BZC A;  4USA A;  3UQ0 A;  3G6V A;  2EAO A;  4XUS A;  3HWT A;  1SWW A;  3QU2 A;  3TAN A;  3WKC A;  2KG5 A;  2L5Y A;  3UMB A;  4IQT A;  1ZQS A;  4DEZ A;  1IM4 A;  1O08 A;  3H0M B;  3UPQ A;  9ICC A;  2MA1 A;  1ZQI A;  3PR4 A;  1S0M A;  2XGQ A;  4DSL A;  3WK7 A;  1ZQR A;  2FPL A;  4M9J A;  1ZQZ A;  2ZIV B;  5KFJ A;  4ED2 A;  2A1J B;  3UMG A;  4UW9 A;  5HP4 A;  2K8C B;  1PK3 A;  3I28 A;  2KZM A;  2YY6 A;  9ICP A;  1ZQM A;  1WCN A;  2EAP A;  1U45 A;  2BCV A;  1ZYQ A;  3QU5 A;  5AKH A;  2ESE A;  1PZN A;  1BPY A;  1ZQG A;  4NLN A;  3ZDB A;  4F5R A;  4FS1 A;  2VKQ A;  2UVR A;  4DSK A;  1VLB A;  1ZQW A;  3FDS A;  1KBU A;  2RHF A;  1S0O A;  4CF5 A;  4ED7 A;  4F4W A;  3GV8 B;  5KFB A;  3FYH A;  4PL2 A;  2F1J A;  1YZ6 A;  5IIK A;  2HOQ A;  2ZIU A;  3M1Y A;  1KN5 A;  3AEV A;  4PGX A;  1TK0 A;  1ZOL A;  3A0H U;  2K89 A;  1ZQH A;  5KFZ A;  1ZQB A;  1OW5 A;  1N61 A;  2JEG A;  2V4Q A;  3MBY A;  2FE9 A;  4P0Q B;  4OJ5 A;  5D49 A;  1D8B A;  5KG6 A;  2FMS A;  4K4G A;  2F1H A;  1A0P A;  4BX9 C;  4KLD A;  3ZD8 A;  3JPN A;  1NJX A;  4Y2V A;  5KAF U;  3JPP A;  2AXT U;  4MEY A;  4DQR A;  5KG2 A;  1BPX A;  2WF7 A;  2BGW A;  8ICG A;  4K4I A;  4IQV A;  1U49 A;  2IOF K;  2PXI A;  1PK1 A;  2K60 A;  5AI8 A;  5FP0 A;  4MF2 A;  1YT3 A;  1ZD2 P;  5G5G A;  1JXL A;  1ZQN A;  4UB2 A;  1SIJ A;  5KFM A;  1U47 A;  2W43 A;  4JB3 A;  3M8S A;  2D8C A;  4M2Y A;  3N7P D;  1RQL A;  3MDC A;  5HHI A;  4ED3 A;  1XO0 A;  3UXO A;  3ETL A;  7ICI A;  4F2R A;  2G5H B;  4YCX A;  4GIB A;  3IRU A;  1RQN A;  3C5F A;  1ECW A;  1J2N A;  2FPK A;  2HBL A;  3I1Y A;  4KLS A;  3RJG A;  1ZD3 A;  8ICO A;  4MFA A;  3RH5 A;  2WFA A;  1DK2 A;  1TAU A;  5HNK A;  4R64 A;  2YQE A;  4EBC A;  1BNO A;  3PX6 A;  2HBM A;  2ES6 A;  1T3N A;  1UCV A;  5ALK A;  1Z4N A;  4QZE A;  5HMM A;  3HIL A;  7ICJ A;  5J2E A;  2DQN B;  1HUO A;  3U26 A;  3KHL A;  3MGI A;  7ICU A;  4AYB C;  2RQ5 A;  3QEA Z;  2PKE A;  4F93 B;  4RQ4 A;  2ZUC A;  3RTV A;  1KFS A;  4ICA A;  8ICH A;  4DL2 A;  4CCH A;  2H3I A;  1BPZ A;  4ED0 A;  3RRG A;  3ZDA A;  5E79 U;  5DG7 A;  3F5A A;  2XID A;  3QUQ A;  4IRC A;  4A8E A;  4PHA A;  4BJQ A;  1TVA A;  1JAL A;  1QQ7 A;  3OHB A;  3BQ0 A;  2JEI A;  1J97 A;  4Y2R A;  8ICS A;  4KLI A;  2PFP A;  1L7O A;  2VJ4 A;  4O3P A;  2BHN A;  9ICK A;  3Q8M A;  3NVZ A;  2XI9 A;  3SAG A;  2ZIW B;  4RPX A;  3T3F A;  2Y0S C;  4RQ8 A;  3DEE A;  5ALV A;  5J2H A;  3HT3 A;  3JPQ A;  2OWO A;  1Y88 A;  1BPE A;  4UB6 U;  4DFP A;  3N97 B;  4UQG A;  2FMP A;  4US8 A;  3JPT A;  4Y2S A;  2JR5 A;  1DRG A;  4ECR A;  2ZIV A;  1K5O A;  2A1J A;  2LBO A;  2HHT A;  2H3F A;  9ICN A;  3V6H A;  2WF6 A;  4DFD A;  2LI6 A;  5DGB A;  3MGH A;  1X42 A;  3SD7 A;  5EE3 A;  2KVS A;  8ICJ A;  1L8L A;  4HYK A;  3GFK B;  3MR3 A;  2G0A A;  5ALN A;  4CE6 A;  5KFF A;  1QH9 A;  5KTQ A;  4UAW A;  1WUD A;  1J2M A;  2YMQ A;  3TFS A;  2A3V A;  9ICF A;  4QIW F;  2EZY A;  4MF8 A;  3SYZ A;  5BOL A;  5KT2 A;  5K4L A;  2K4P A;  1ZQQ A;  2XVT A;  2YX8 A;  1ZET A;  9ICQ A;  3ZDD A;  4UB4 A;  5AI4 A;  4OJO A;  2NRT A;  4JV1 A;  2RDJ A;  3N7R C;  4DQP A;  2FLP A;  1IIP A;  2KKP A;  4TUP A;  4MEX A;  3RB4 A;  1XU4 A;  5AKI A;  4P4O A;  5ALF A;  3RR8 A;  4F3O A;  1ZXI A;  9ICG A;  2CRX A;  4PL1 A;  1SKS A;  2OM6 A;  5IIO A;  4YVZ A;  5DLG A;  3RH6 A;  4KMO B;  2EQY A;  1KLN A;  2WTF A;  4I2H A;  4QW9 A;  5L1I A;  3Q8K A;  4QWB A;  3C5G A;  2J6U A;  1X6I A;  1K1Q A;  4DOC A;  2ZTE A;  5F9L A;  3K4G A;  5AHX A;  1PVQ A;  3TI0 A;  5DDY A;  2E8N A;  1QSY A;  2AGP A;  5AIC A;  7ICG A;  1LB2 B;  4EX6 A;  1X9X A;  3LVW A;  5ALZ A;  1L3S A;  2HHW A;  4RQ6 A;  1DXS A;  5ALE A;  3PW0 A;  5KFX A;  1N48 A;  4OJP A;  5J2B A;  4MFC A;  3R9K A;  3IG5 A;  2KN7 A;  4F5Q A;  7ICO A;  7ICE A;  4JUZ A;  2WF8 A;  1URJ A;  1JUD A;  3EZ5 A;  1KRP A;  4RQM A;  2Q0Z X;  4DQI A;  1N2X A;  2ISP A;  3H8S A;  2W11 A;  3TKA A;  1T3Q A;  1KL9 A;  1TK8 A;  5KFD A;  2AQ4 A;  4KMU A;  2OEH A;  3C1Y A;  2AHO B;  4NY8 A;  5KG7 A;  1DGS A;  2V4R A;  5DDM A;  5ALH A;  2ASD A;  1MSW D;  2JXJ A;  2NRZ A;  3V7K A;  2WB1 C;  2CPR A;  1QSL A;  3RJF A;  5CR0 A;  1Q3V A;  2IHM A;  5J8Y A;  3V7J A;  4UAT A;  4Z6C A;  4UBC A;  1FIQ A;  1MC8 A;  2YB1 A;  1TV9 A;  3V72 A;  1ZJM A;  5EE0 A;  5GTH U;  1TAM A;  5AM2 A;  2BDU A;  5BOM A;  1X40 A;  2WAQ C;  5AM4 A;  4DSI A;  2EAN A;  2BQU A;  2YN4 A;  2KE7 A;  2E8O A;  3KHH A;  3OSN A;  4C8K A;  1S76 D;  3PW5 A;  3T79 A;  3WK4 A;  5C0Y A;  1SGG A;  1XSP A;  2ZIW A;  5JTI A;  2BPC A;  2H5X A;  5DBB A;  4C7Z A;  1L6N A;  4DL7 A;  2PFO A;  3MGV A;  3KZI U;  2QB0 B;  1RG6 A;  1T4G A;  4QZ8 A;  3CW2 C;  2IOF A;  1UPH A;  2YTU A;  1RPL A;  2RRD A;  4C8O A;  5AKG A;  1QCK A;  3EWA A;  5AM3 A;  5KT3 A;  4EEL A;  3T5J A;  3KD3 A;  2EZX A;  2W9B A;  3RAQ A;  1KFD A;  4RUA A;  2A19 A;  2XIC A;  3TFR A;  3NVV A;  5IIM A;  2G06 A;  2IBK A;  2DGZ A;  4Y2T A;  3M6K A;  2M9N A;  3SEN A;  7ICV A;  3B0X A;  4B9M A;  2F76 X;  1N63 A;  1RM6 C;  1SXE A;  4CF4 A;  5KT6 A;  3AUO A;  4J9R A;  4QJF B;  2HHV A;  3NS1 A;  3GQC A;  5J2G A;  3LK9 A;  2AGO A;  4Z6E A;  5AIA A;  2PMZ F;  4QZC A;  4F8R A;  2JZB B;  4O0I A;  4YP3 A;  4ED1 A;  3PY8 A;  3WK6 A;  5KFU A;  3TAD A;  2DF4 B;  4M9G A;  2WAQ F;  5J2C A;  2R8K A;  4KN4 A;  2FI1 A;  2KNJ A;  1DGJ A;  4UB3 A;  3V7L A;  2Y9T A;  3PVX A;  2DPJ A;  1B4F A;  3NRW A;  1SB3 C;  1L3T A;  4DO9 A;  3ALR A;  2G5I B;  3G6X A;  1IG6 A;  1F0M A;  4R8U B;  3UM9 A;  3E0F A;  3IM1 A;  3KFU F;  1O03 A;  2F44 A;  4RNN A;  2ZJ5 A;  4LZG A;  4AP9 A;  1FEZ A;  2Y9U A;  2LYB A;  3KHG A;  4KIT B;  2GH1 A;  4YMO A;  1C20 A;  3SQI A;  2LM4 A;  2C2R A;  4DSF A;  2EAM A;  4ECZ A;  4DSJ A;  3AM9 A;  1L7M A;  3LDA A;  2AJQ A;  2BQR A;  3RRH A;  4TQR A;  5ALP A;  2KIV A;  4O9M A;  5J0Y A;  4BXO B;  2CXY A;  3MR2 A;  2W7O A;  3D6J A;  4P2H A;  4JMU A;  2J6T A;  2VAN A;  1D9F A;  7ICM A;  3V6K A;  3IHQ B;  4QWC A;  5DG9 A;  4F4Z A;  4FBT A;  1WYG A;  2E8M A;  3M9N B;  5J2A A;  3M9M B;  3QU9 A;  1JXE A;  2YB4 A;  1Q46 A;  2RLT A;  4Y2U A;  2EH9 A;  4GXK A;  2Y1J A;  4ECX A;  3HKZ C;  3TQ1 A;  4LVS A;  3H40 A;  3PMN A;  5ALX A;  4R65 A;  3SV4 A;  1H38 A;  3QZ8 A;  4DWI A;  4C4S A;  3RB6 A;  2E1F A;  3OGU A;  5D46 A;  9ICL A;  2NRV A;  3SAF A;  2I1Q A;  2XO7 A;  4QZF A;  7ICP A;  4O5E A;  2PFQ A;  3E2E A;  2JGA A;  3WU2 U;  2J6S A;  2HHQ A;  3DDH A;  4IC9 A;  2DKX A;  3QEB Z;  1ZQA A;  3G6Y A;  4EZ6 A;  1ARO P;  1HEK A;  2ZJA A;  5ALM A;  4NV0 A;  4EX7 A;  1UQV A;  2XCA A;  3UXP A;  4KLG A;  3K1R B;  3MFH A;  2D3D A;  5KFC A;  4BGD A;  1ZQO A;  5C5J A;  1UHU A;  3I76 A;  5J2K A;  2IMW P;  2HBJ A;  4OD0 A;  1ZQD A;  3Q8R B;  5CRX A;  2I9G A;  5CWR A;  1F5S A;  3F2B A;  4UAY A;  3V6J A;  4OJ6 A;  4RT3 A;  5DG8 A;  3SV3 A;  4C8L A;  2PFN A;  5KT4 A;  2QB0 A;  4G3I A;  1TK5 A;  1CRX A;  3EPG A;  4NL9 C;  1FO4 A;  3OTQ A;  1NK4 A;  3HKZ F;  2BPF A;  3QNM A;  4PHP A;  5KFG A;  1Z4O A;  2VJ5 A;  2PI4 A;  4YQW A;  4J9L A;  3KZX A;  1JX4 A;  3HP6 A;  1QLN A;  1L7P A;  3GV5 B;  4BWM A;  3ED5 A;  2F1I A;  4NXZ A;  5KFT A;  8ICK A;  4JK1 A;  1NZP A;  5CJ7 A;  2HHU A;  3WK5 A;  5DB9 A;  1KDH A;  3CNH A;  3GIK A;  1FFU A;  4HAI A;  2JZB A;  3RH4 A;  4NJ8 A;  2K4E A;  5J0S A;  4QIW C;  3WKD A;  5T14 A;  1S10 A;  4M9H A;  3H8W A;  4YN4 A;  4JV0 A;  4P0P B;  2IA6 A;  7ICF A;  1XO1 A;  1OXJ A;  5EE1 A;  1KQQ A;  3N4M B;  2NRW A;  3NRZ A;  4ECT A;  8ICU A;  1V85 A;  3AU6 A;  4PJ0 U;  1GO3 F;  4R8U A;  1CUK A;  3TAR A;  4PZO A;  2K8B B;  8ICF A;  3QZ7 A;  5ALR A;  5AK6 A;  7ICS A;  1LKY B;  4I2E A;  4KLF A;  3SAH A;  3UXN A;  2MSN A;  5DBA A;  3RBD A;  2E1E A;  4NWI A;  2G08 A;  4DL3 A;  2B21 A;  3D2S A;  3ZDC A;  4FZN A;  3C29 A;  1JRP A;  3SMV A;  1T94 A;  1L7N A;  4PZN A;  4O3S A;  1XWL A;  2UVV A;  2K4H A;  2RDI A;  2YML A;  4UAV A;  4YMM A;  3C2L A;  5J8Y C;  5KFI A;  7ICR A;  8ICE A;  5L1M A;  4O3R A;  4RNM A;  4DLE A;  4ED8 A;  1LVH A;  5DQH A;  1MN8 A;  3SZ2 A;  2W55 A;  3T5K A;  4BXO A;  4J03 A;  2DFL A;  1ED1 A;  2W9B B;  3PML A;  2H3V A;  3BS7 A;  4QZI A;  2K8A A;  5F3X B;  5JU5 A;  3WK8 A;  1L3U A;  1RXV A;  3RBE A;  1XS9 D;  2UVU A;  2KSO B;  9ICO A;  1Z00 B;  3N7S C;  4KLM A;  4RQ1 A;  4DS4 A;  2KOB A;  1ZRN A;  1T8E A;  3KHR A;  4RQ7 A;  4EBE A;  5L9X A;  2RP5 A;  4I2D A;  2W7P A;  2JHD A;  4ECW A;  3WKB A;  1UA0 A;  1XNS A;  1L5U A;  1X9W A;  3HRD D;  4NLB A;  2N1R A;  5AM5 A;  4M0A A;  1NK9 A;  2W9A A;  5KNI A;  3RF9 A;  4OCZ A;  2KJ8 A;  2B6G A;  3GIJ A;  3C28 A;  1KEJ A;  4FZM A;  1COK A;  3FAH A;  4QZD A;  1ZRM A;  1C7Y A;  2E3T A;  1NKC A;  5DGA A;  4YXM A;  3RJJ A;  3PX4 A;  1SV0 A;  1PVR A;  1NK6 A;  4M6W B;  4WJ3 B;  2KHQ A;  5AI9 A;  3ISD A;  4UAZ A;  1QQ5 A;  2KFN A;  4UB5 A;  2KV2 A;  1ZQX A;  4O3N A;  1N5X A;  4RPY A;  4JV2 A;  1B22 A;  2W3R A;  3AL0 B;  2GOL A;  1U9L A;  4EBD A;  4QZH A;  2WF5 A;  5AI6 A;  4UB1 A;  3Q8P B;  3ETR A;  4NL9 A;  3BQ2 A;  2F8K A;  4CRX A;  4EEY A;  1ZQP A;  4US9 A;  4QZB A;  4ELU A;  4QWE A;  3PST A;  5ALS A;  1NK5 A;  3RJE A;  4Z6F A;  2KJ9 A;  3TAD C;  3PW2 A;  4ZH4 A;  1Z1V A;  3LYS A;  5III A;  5HHH A;  2OHF A;  4RPZ A;  3VCB A;  3F5E A;  3IG8 A;  3PNC A;  1KSP A;  2BZF A;  4F91 B;  2HVH A;  4GFJ A;  4TUS A;  5DB7 A;  1NK8 A;  3E58 A;  5AKX A;  2HOI A;  2QB1 A;  2MRL A;  5IIL A;  3TAQ A;  3LWL A;  2HCF A;  2I6X A;  2KHV A;  5J2F A;  2EZZ A;  2H3Q A;  2BR0 A;  4GXI A;  5G5H A;  2HVI A;  3H4B A;  5J0W A;  1OUQ A;  1VJ5 A;  4I2A A;  4BWJ A;  3CYM A;  4TUQ A;  4UAR A;  2LHT A;  4IS7 A;  3QX7 A;  2NO5 A;  1ZQU A;  3BQ1 A;  4DF8 A;  2ZUB A;  1PUZ A;  1JI7 A;  4NM1 A;  1NJW A;  3H0R B;  4QZ9 A;  1NKB A;  2JV3 A;  2NYV A;  4C7Y A;  2IOH A;  9ICS A;  1ZQT A;  4KLQ A;  2PMZ C;  3GDX A;  4FZL A;  2E5S A;  5J0U A;  1SV4 A;  4QZA A;  4P0P A;  1X2I A;  2JRZ A;  4RQ2 A;  4YR0 A;  2FJ6 A;  5TIS U;  5KFL A;  4PPX A;  3NVY A; 
#chains in the Genus database with same CATH homology
 5HHI A;  4TQR A;  4ED3 A;  4O9M A;  3HX0 A;  4DOA A;  2DPI A;  3UXO A;  3ETL A;  7ICI A;  5J0Y A;  4F2R A;  4BXO B;  4YCX A;  5CHG A;  2FMQ A;  1BPD A;  3C5F A;  3MR2 A;  4P2H A;  4ECV A;  2FPK A;  5J29 A;  1NKE A;  4KLS A;  3PO4 A;  3RJG A;  5J2I A;  1S77 D;  9ICJ A;  2J6T A;  4J9P A;  4DL5 A;  8ICO A;  2VAN A;  1D9F A;  4MFA A;  3RH5 A;  7ICM A;  3V6K A;  4YXJ A;  2PI5 A;  3IHQ B;  8ICQ A;  3JPO A;  1ZQC A;  4QWC A;  5KFO A;  5DQI A;  1TAU A;  3UQ2 A;  5HNK A;  4KLU A;  5DG9 A;  4R64 A;  4F4Z A;  4EBC A;  1X9S A;  5DBC A;  4FBT A;  3PX6 A;  4Z6D A;  4I2B A;  5TZV A;  9ICM A;  3M9N B;  4M47 A;  2NRX A;  5J2A A;  3TAP A;  3M9M B;  1NK7 A;  1T3N A;  7ICN A;  3T5L A;  3GV7 B;  8ICR A;  4QZE A;  5KT7 A;  5HMM A;  5KG4 A;  1JXE A;  3ZDE A;  1U4B A;  7ICJ A;  5J2E A;  1HUO A;  5KFY A;  4GXK A;  4ECX A;  2Y1J A;  3T5H A;  3KHL A;  3TQ1 A;  4LVS A;  3H40 A;  3OSP A;  3MGI A;  7ICU A;  2FPM A;  3PMN A;  4ECU A;  3Q8L A;  3QEA Z;  1ZQE A;  4F93 B;  4R65 A;  4RQ4 A;  5DB6 A;  4TUR A;  2ZUC A;  3BJY A;  3RTV A;  1KFS A;  3MAB A;  3SV4 A;  8ICH A;  5J0P A;  1BPB A;  4DL2 A;  4CCH A;  1H38 A;  1Z00 A;  3QZ8 A;  4DWI A;  1BPZ A;  4XA5 A;  2BCQ A;  4PH5 A;  8ICW A;  3RB6 A;  4ED0 A;  4B9T A;  3OGU A;  8ICB A;  3RRG A;  5D46 A;  3ZDA A;  9ICL A;  5DG7 A;  2NRV A;  4DOB A;  5EOZ A;  3M8R A;  4IRD A;  9ICI A;  2I1Q A;  4TQS A;  4QZF A;  1JMS A;  2XO7 A;  3KTQ A;  4QWD A;  2C28 A;  4QZG A;  4IRC A;  1D9D A;  3RJI A;  4PHA A;  4O5E A;  4BDP A;  7ICP A;  2W9C B;  1TVA A;  3OHB A;  2PFQ A;  1SKR A;  3E2E A;  3BQ0 A;  4J9N A;  3GII A;  2JEI A;  3PR5 B;  1RXW A;  1N56 A;  2J6S A;  2HHQ A;  8ICS A;  4KLI A;  2PFP A;  3C21 A;  4O3P A;  2BHN A;  9ICK A;  9ICA A;  4YD1 A;  3QEB Z;  1ZQA A;  2XCP A;  3Q8M A;  1LV5 A;  2HW3 A;  1A77 A;  3G6Y A;  4EZ6 A;  1ARO P;  4RPX A;  2ZJA A;  2AQ0 A;  3T3F A;  4RQ8 A;  2P66 A;  2R8G A;  2C2D A;  2P6R A;  2VA8 A;  4RNO A;  2XCA A;  3H4D A;  5J2H A;  4X5V A;  7ICH A;  3UXP A;  3HT3 A;  3JPQ A;  2OWO A;  2J6U A;  1Y88 A;  1BPE A;  4DFP A;  1BVS A;  3THV A;  4P4P A;  4UQG A;  4DFM A;  3NTU A;  3N97 B;  2FMP A;  4KLG A;  1SL0 A;  3MFH A;  4F5P A;  4ED6 A;  3JPT A;  4M6W A;  4F4X A;  5KFC A;  5CA7 A;  4BGD A;  4GLX A;  1ZQO A;  5C5J A;  5KG0 A;  4YR3 A;  4FS2 A;  5J2K A;  3JPS A;  2IMW P;  4ECR A;  8ICZ A;  4NLG A;  1XSN A;  4KLO A;  2A1J A;  1ZQD A;  3Q8R B;  4C8N A;  1DOQ A;  2ISO A;  2I9G A;  2HHT A;  1COO A;  4XRH A;  5CWR A;  9ICN A;  3V6H A;  5D4B A;  2KTQ A;  4UAY A;  3C2K A;  3V6J A;  7ICL A;  5DGB A;  4RT3 A;  2BCU A;  5KFH A;  5DG8 A;  3MGH A;  3SV3 A;  1QTM A;  4C8L A;  4E0D A;  2PFN A;  3RAX A;  2XC9 A;  5KT4 A;  5KFE A;  4MFF A;  4G3I A;  8ICJ A;  4HYK A;  3GFK B;  3MR3 A;  4F5O A;  1TK5 A;  5J0Q A;  5KFK A;  4B9N A;  1BGX T;  5KFF A;  4JWN A;  1RYS A;  4GC7 A;  3EPG A;  5KTQ A;  4UAW A;  3RB3 A;  5DKW A;  5IIJ A;  1S0N A;  2KZZ A;  4PHD A;  1NK0 A;  3TFS A;  9ICF A;  4MF8 A;  4P4M A;  3BQT A;  1NK4 A;  1SL2 A;  1V9P A;  2BPF A;  3SYZ A;  4I2F A;  4PHP A;  5KFG A;  4KLL A;  5BOL A;  5L1J A;  4I27 A;  2PI4 A;  2VA2 A;  1Z3E B;  5KT2 A;  4YQW A;  2FLL A;  5EWE A;  3MR6 A;  3RB0 A;  4J9S A;  2C2E A;  1ZQQ A;  4J9L A;  1JX4 A;  5J2D A;  3HP6 A;  1QLN A;  3RR7 A;  1ZET A;  9ICQ A;  3GV5 B;  3ZDD A;  4UB4 A;  4BWM A;  4DL6 A;  1ZQV A;  4I2G A;  4NLK A;  2F1I A;  4NXZ A;  2NRT A;  3GIM A;  5KFT A;  2V9W A;  4JV1 A;  2RDJ A;  4JK1 A;  8ICK A;  5J0R A;  4ELT A;  5CJ7 A;  4DQP A;  9ICX A;  9ICU A;  5J0X A;  8ICT A;  2HHU A;  8ICN A;  3C23 A;  2FLP A;  3MDA A;  1TAQ A;  5DB9 A;  2W9C A;  3MR5 A;  4NM2 A;  4TUP A;  1SL1 A;  2P6U A;  5DQG A;  1KDH A;  4MEX A;  4KLE A;  3RB4 A;  1XU4 A;  4EYH B;  4EYI B;  1TKD A;  3GIK A;  1T7P A;  4P4O A;  2JZB A;  3RH4 A;  3QE9 Y;  3RR8 A;  5J0S A;  4F3O A;  9ICG A;  4IQW A;  2MUT B;  1SKS A;  2FLN A;  2AGQ A;  3ZD9 A;  5IIO A;  2VA3 A;  1UA1 A;  5L1K A;  1HJP A;  1S9F A;  1S10 A;  4YVZ A;  3ISB A;  4M9H A;  5DLG A;  3H8W A;  2BDP A;  2BCS A;  4YN4 A;  4JV0 A;  4DLG A;  4DSE A;  3RH6 A;  2UVW A;  4DQQ A;  2BKE A;  2BCR A;  1RYR A;  1UT5 A;  5CP2 A;  2WTF A;  1KLN A;  2IA6 A;  4Q43 A;  4FO6 A;  2ASL A;  4F2S A;  1XO1 A;  7ICF A;  1NOM A;  2ATL A;  3M9O B;  4I2H A;  5HML A;  4QW9 A;  5L1I A;  3Q8K A;  2IHN A;  5KFA A;  4F4Y A;  4QWB A;  3C5G A;  4J9O A;  3N4M B;  1MQ2 A;  1K1Q A;  4RUC A;  1KTQ A;  1B43 A;  2NRW A;  4DOC A;  4ECT A;  8ICU A;  1WCL A;  2ZTE A;  3BDP A;  5F9L A;  4YD2 A;  3K4G A;  3AU6 A;  4I29 A;  3PV8 A;  4R8U A;  4O5C A;  4F92 B;  1CUK A;  4YR2 A;  3TAR A;  1SKW A;  2LYH A;  4F4K A;  8ICF A;  3TI0 A;  5DDY A;  3QZ7 A;  3K75 D;  1ZQL A;  4EZ9 A;  1QSY A;  1ZQJ A;  4KTQ A;  4I2E A;  2AGP A;  4KLF A;  3UXN A;  7ICS A;  4R66 A;  4J9M A;  7ICG A;  5DBA A;  8ICC A;  5KFR A;  3RBD A;  1UT8 A;  4DL3 A;  1LB2 B;  5KFW A;  5KG1 A;  7ICT A;  9ICB A;  1ZQF A;  2B21 A;  4YMN A;  3ZDC A;  4I28 A;  3GIL A;  1L3S A;  2HHW A;  4ECQ A;  4RQ6 A;  4DQS A;  3EYZ A;  3RJK A;  1D8L A;  3PW0 A;  5KFX A;  2R8I A;  4O3S A;  1XWL A;  1N48 A;  2UVV A;  4I2C A;  2RDI A;  4IR1 A;  4KLJ A;  4YMM A;  5J2B A;  3C2L A;  5KFI A;  2R8J A;  4MFC A;  4DFJ A;  7ICR A;  2XGP A;  1NJY A;  8ICE A;  4O3R A;  4RNM A;  2KN7 A;  4F5Q A;  4DLE A;  4ED8 A;  7ICO A;  1JN3 A;  5DQH A;  3SZ2 A;  4F5N A;  4ELV A;  7ICE A;  4JUZ A;  3T5K A;  2ALZ A;  4BXO A;  3JPR A;  4IQU A;  2DFL A;  1U48 A;  5EWF A;  4KLH A;  2W9B B;  3PML A;  8ICA A;  7ICQ A;  4J9K A;  3EZ5 A;  1KRP A;  2C22 A;  1K1S A;  2Q0Z X;  4QZI A;  4DQI A;  2ASJ A;  1A76 A;  2KFZ A;  2ISP A;  4DS5 A;  3H8S A;  3C2M A;  4C8M A;  3H8J A;  4B9U A;  5KFQ A;  4IR9 A;  1L3U A;  1RXV A;  1X9M A;  3EW9 A;  4RQ3 A;  3RBE A;  5KT5 A;  1XS9 D;  5KFD A;  2AQ4 A;  1TK8 A;  4KMU A;  4J9Q A;  2JEF A;  5BPC A;  2UVU A;  2HHS A;  9ICO A;  9ICW A;  1Z00 B;  4KLM A;  5IIN A;  3C1Y A;  4RQ1 A;  5KFP A;  4O5K A;  4NY8 A;  4DS4 A;  5KG7 A;  4Q45 A;  1DGS A;  2ZTD A;  7ICK A;  2V4R A;  1T8E A;  4RQ7 A;  3OHA A;  3KHR A;  3AU2 A;  4YG2 A;  5L9X A;  4EBE A;  4DFK A;  4Q8E A;  5DDM A;  4I2D A;  1IXR A;  4ECW A;  5F9N A;  3H7I A;  2ASD A;  1UA0 A;  4RT2 A;  1MSW D;  2W8L A;  2NRZ A;  3Q8S B;  1X9W A;  1L5U A;  9ICT A;  4RQ5 A;  1SZP A;  4KN7 A;  4PGQ A;  3V7K A;  4M0A A;  1NK9 A;  4JWM A;  1QSL A;  2W9A A;  3RJF A;  5J0T A;  3UQ0 A;  5CR0 A;  2IHM A;  2BPG A;  1HUZ A;  3V7J A;  3G6V A;  3PW4 A;  4XUS A;  4Z6C A;  3HWT A;  3GIJ A;  3TAN A;  4O3Q A;  1KEJ A;  4UBC A;  1MC8 A;  1S0V A;  3ISC A;  3HW8 A;  4IQT A;  1ZQS A;  1TV9 A;  4QZD A;  3V72 A;  1ZJM A;  1C7Y A;  4DEZ A;  1QSS A;  1IM4 A;  5BOM A;  3UPQ A;  1NJZ A;  1NKC A;  5DGA A;  4DSI A;  4YXM A;  3RJJ A;  3PX4 A;  4KLT A;  2BQU A;  9ICC A;  1ZQI A;  1NK6 A;  4IRK A;  3PR4 A;  1S0M A;  8ICP A;  4M6W B;  2XGQ A;  4DSL A;  3ISD A;  4UAZ A;  5L1L A;  3OSN A;  2FPL A;  5EWG A;  3KHH A;  4UB5 A;  4GXJ A;  1ZQR A;  1ZQZ A;  1ZQX A;  4O3N A;  4YFK A;  4M9J A;  2KFN A;  8ICY A;  4RPY A;  4JV2 A;  4C8K A;  3PO5 A;  5KFJ A;  1S76 D;  4ED2 A;  1CEZ A;  1B22 A;  4DF4 A;  1TFR A;  2A1J B;  1U9L A;  4EBD A;  3PW5 A;  5HP4 A;  4QZH A;  4ECS A;  5CB1 A;  4M04 A;  1ZQY A;  3PW7 A;  1XSP A;  9ICH A;  4I2J A;  4UB1 A;  3Q8P B;  2AU0 A;  3LWM A;  3BQ2 A;  2KZM A;  2BPC A;  2H5X A;  5DBB A;  4ECY A;  4EEY A;  4DL7 A;  1ZJN A;  4O3O A;  1ZQM A;  1WCN A;  1ZQP A;  2PFO A;  9ICP A;  4QWA A;  5KG5 A;  8ICL A;  4QZ8 A;  1T4G A;  4QZB A;  1U45 A;  4ELU A;  2BCV A;  8ICM A;  1ZYQ A;  4QWE A;  3Q8Q B;  3OJS A;  1NK5 A;  4C8O A;  1RPL A;  3PX0 A;  3RJE A;  4GC6 A;  4Z6F A;  1PZN A;  3EWA A;  3PW2 A;  3RJH A;  4ZH4 A;  1BPY A;  5KFS A;  5KT3 A;  1ZQG A;  3T5J A;  1ZQK A;  5III A;  4NLN A;  5HHH A;  3ZDB A;  2W9B A;  3RAQ A;  4F5R A;  1EXN A;  1JIH A;  2KZ3 A;  3B0Y A;  4RPZ A;  4FS1 A;  2BQ3 A;  4RZR A;  2UVR A;  1ZQW A;  1KFD A;  4XQ8 A;  2XY7 A;  4DSK A;  3FDS A;  4DL4 A;  4PHE A;  3EPI A;  3PNC A;  1KSP A;  2W8K A;  1S0O A;  4RUA A;  4ED7 A;  4F91 B;  4F4W A;  2HVH A;  4PGY A;  3ORY A;  5JUM A;  5DB7 A;  4UBB A;  4TUS A;  3GV8 B;  3TFR A;  5IIM A;  2XY6 A;  5KFB A;  1NK8 A;  4K4H A;  3FYH A;  2IBK A;  4M9L A;  2F1J A;  4NLZ A;  2M9N A;  5IIK A;  2HHX A;  7ICV A;  3B0X A;  4B9M A;  5KT6 A;  5DB8 A;  4PGX A;  3AUO A;  1TK0 A;  4QW8 A;  4J9R A;  2HHV A;  3GQC A;  5IIL A;  3TAQ A;  4B9L A;  3LWL A;  5J2G A;  2W9M A;  3LK9 A;  1ZQH A;  5KFZ A;  2AGO A;  4Z6E A;  1ZQB A;  2JEG A;  1XC9 A;  2V4Q A;  3MBY A;  4QZC A;  9ICR A;  2ZJ8 A;  4F8R A;  3OJU A;  5J2F A;  2BR0 A;  2JZB B;  4GXI A;  4O0I A;  9ICE A;  4YP3 A;  5D49 A;  4ED1 A;  4B9S A;  4M9N A;  2HVI A;  4Q8F A;  3PY8 A;  5DLF A;  2MAX A;  5KG3 A;  5KFU A;  3H4B A;  5J0W A;  3NGD A;  5KG6 A;  2Y1I A;  2FMS A;  4K4G A;  4I2A A;  4BWJ A;  2ZUD A;  2F1H A;  1MQ3 A;  4TUQ A;  4M9G A;  5J2C A;  2R8K A;  5J0O A;  4KN4 A;  3ZD8 A;  3JPN A;  4KLD A;  9ICV A;  3C1Z A;  4UB3 A;  1NJX A;  1D8Y A;  3JPP A;  1ZQU A;  3BQ1 A;  3V7L A;  2R8H A;  4MEY A;  3PVX A;  5J2J A;  4DF8 A;  2ZUB A;  3SI8 A;  2DPJ A;  3HPO A;  4DQR A;  5KG2 A;  1L3T A;  4DO9 A;  4Q44 A;  1BPX A;  1KFT A;  4RU9 A;  4B9V A;  1NJW A;  4NM1 A;  3G6X A;  2BGW A;  4R8U B;  4F50 A;  8ICG A;  4QZ9 A;  1L3V A;  1NKB A;  2JEJ A;  3IM1 A;  4K4I A;  4IQV A;  2ZTC A;  4R63 A;  9ICS A;  1ZQT A;  4RNN A;  1U49 A;  5KFN A;  2ZJ5 A;  2MUT A;  4KLQ A;  4LZG A;  2PXI A;  8ICI A;  4MF2 A;  8ICV A;  3MFI A;  4KIT B;  3KHG A;  1XSL A;  1S97 A;  3GDX A;  1JXL A;  5J0U A;  4YMO A;  4QZA A;  1ZQN A;  4FBU A;  4UB2 A;  5KFM A;  1RZT A;  2C2R A;  1X2I A;  1U47 A;  4DSF A;  4ECZ A;  4DSJ A;  4RQ0 A;  4LZD A;  3M8S A;  5KFV A;  2GWS A;  4M2Y A;  4I2I A;  4RQ2 A;  4YR0 A;  3LDA A;  8ICX A;  2AJQ A;  5KFL A;  2BQR A;  4PPX A;  3MDC A;  2XY5 A;  3RRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...