2EZXA

Solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
publication title Solution structure of the cellular factor BAF responsible for protecting retroviral DNA from autointegration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 27
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2ezxA00
2EZYA 2EZZA 2BZFA 1QCKA 1CI4A 2ODGA 2EZXA
chains in the Genus database with same CATH superfamily
3SEIA 3PW7A 3UMBA 3UXNA 3KOOA 2AGQA 1ZQFA 1S0MA 2DQNB 2G5IB 4YCXA 5DG7A 4Y2QA 1VJ5A 1RXVA 8ICFA 4BWJA 2PFNA 2BPFA 4PZOA 2W04A 4BXOB 4J03A 1JI7A 2W9CA 2XO7A 5AKIA 3H0RB 3SV3A 4DSIA 3SAGA 2KFZA 1RG6A 3FM9A 3Q8PB 2D3DA 4Z6EA 4YQWA 3EPIA 4LZDA 3QUTA 3AEVA 1NK7A 5KFAA 4ECZA 4QW8A 1AQ6A 5DB8A 2FI1A 1Z4NA 2WF5A 5L1MA 3OTQA 4DO9A 5KFEA 1DK3A 1RYUA 4UB5A 1FO4A 4LVSA 3N7RC 8ICOA 2AH5A 2RP5A 1U49A 5AHXA 4PGYA 4NL9C 5DLFA 3E0FA 1D8YA 3N97B 4YXMA 2CN1A 4CCHA 1NJYA 4QZIA 2KIVA 2YY6A 2HBMA 3LVVA 3PNCA 3SQIA 4RQ0A 2KE7A 9ICTA 1ZQXA 5ALUA 2FPKA 4ED2A 1ZQSA 2LYHA 5DLGA 3WK9A 2RDIA 3H8MA 4ECSA 2YTUA 3D6JA 3C2LA 9ICPA 1SZHA 2WFAA 2J6SA 1ZRMA 3LWMA 4KLOA 4IR1A 2ZIXA 5KFXA 2F2AB 9ICFA 4Y2JA 1SWVA 1NK0A 4RNMA 1RXWA 3HKZF 7ICJA 4C0ZA 2G09A 1ZQHA 2EZZA 2PMZC 1QH9A 5KG4A 2JR5A 2E8NA 3QYPA 3RJKA 3ETRA 3CP8A 4UB2A 1AROP 3KZXA 2VA2A 4UW9A 5IIJA 3L4PA 4F5QA 2Q4TA 2ESEA 3PO4A 1SL2A 4F4KA 4RNNA 5AKLA 4B9VA 3H8SA 4I27A 3RB6A 3TANA 5EOZA 4RQ2A 2NV3A 7ICRA 3L3FX 1X9WA 3WU2U 4OJPA 1SL1A 3JPNA 2KP7A 2AHOB 3HJEA 3ISBA 1ZQJA 2J6TA 5AM5A 3NVZA 4M04A 3D2QA 1X6JA 1Y88A 4OJ6A 9ICVA 8ICQA 3TFRA 4F71A 4B9SA 1KSPA 1J2NA 3RJHA 1KL9A 2YMMA 1S10A 1OUQA 2ZJAA 4ECVA 2QARB 2BQ3A 2MUTB 2FE9A 2BQRA 1ZQDA 3UXPA 2WAQC 2K4PA 1BGXT 3KKAA 9ICXA 1N60A 3V7JA 5EE1A 2YQEA 2C2RA 5J0QA 5KFBA 4F4ZA 3IN5A 4IRDA 1U9LA 5KFJA 1TAQA 4BUGA 2AGPA 2KHVA 5ALYA 2H3FA 2GH1A 4RPXA 5D4BA 4I28A 3RJJA 3IG8A 3JPRA 4B9NA 2C2EA 7ICPA 1TFRA 3EYZA 8ICNA 4DS4A 3ZDAA 2YB4A 1Z00A 2VJ5A 2FPLA 4USAA 8ICYA 3TAPA 4O5CA 2ZJ8A 5CP2A 2CPRA 3F2CA 4O5EA 1ZQGA 2Q0ZX 1QQ6A 4F3OA 1NK8A 7ICUA 1KRPA 2JMGA 5L1KA 2IMWP 3HPOA 4ACOA 2FLLA 1KTQA 3KBBA 4DL3A 5J2GA 1ZQBA 3TADC 4DL5A 2BZFA 3B0XA 5AM3A 1BPXA 4KLLA 1PZNA 4FZNA 2ASDA 1FEZA 2EANA 2H5XA 2OH2A 2PFQA 4RQ6A 3ORYA 1ZQCA 4UB3A 1S9FA 2NRTA 4NL9A 2VANA 1CUKA 1WCNA 1NJWA 1T4GA 4O3OA 1ZQVA 3WK4A 2NO5A 2W9BB 8ICWA 4YMOA 1HIWA 5B5EU 3EWAA 2F3NA 2IHMA 4FZMA 3I1YA 3RFAA 2R8IA 1A0PA 2JHDA 3HILA 1UHUA 4IS7A 1L5UA 5KFUA 4GC6A 3DDHA 4RPYA 4QWCA 2A1AA 2WHEA 1S8OA 8ICXA 9ICSA 1KFDA 3BS7A 3C23A 3HRDD 8ICEA 3AQEA 3Q8KA 3M9OB 1SIJA 4KLDA 5TZVA 3DEEA 4DOAA 4P2HA 5ALDA 2UVWA 2OHFA 4IQUA 4PHPA 3AM9A 3F2DA 3C2KA 3H0MB 3L5KA 3QU7A 1TK0A 4Y2YA 1V38A 5E79U 1Q46A 1YT3A 3EUB2 4C8LA 4ECYA 2HHTA 2W3RA 2EH9A 3NVYA 2QB0A 2F44A 2W8KA 1SV0C 1PK1B 4Q43A 4TUSA 3MFHA 5DQHA 5CWRA 4PH5A 2UVUA 4RZRA 2ZIUB 5KT3A 3C1YA 1LKYB 3N7SC 3QUBA 5HNKA 1FIQA 1BPBA 3KZIU 4UB1A 4FBTA 9ICMA 3Q8LA 5KL8B 4UAZA 1XS9D 2KNJA 4C80A 7ICKA 1NJXA 4QZGA 2WB1C 3C28A 2LM4A 2HBLA 5KG6A 5ALNA 8ICMA 1ZQNA 2K4EA 4Y2RA 4QWBA 2DFLA 4OD0A 2E8PA 1ZQKA 2HHSA 2YMPA 2ZIWA 2I1QA 2LMRA 2E8OA 4AYBF 5J2DA 3BQ1A 4PHAA 4DQIA 1O03A 3AQFA 5DBCA 4K4HA 2W9MA 3BJYA 2CRXA 2IOFA 1X42A 3GQCA 3BDPA 4DL4A 2IHNA 1OXJA 5J0PA 1ZETA 1IG6A 2BCSA 4I2IA 1ZD2P 5DG9A 1A6SA 8ICKA 9ICOA 5AK3A 2VA8A 4UAVA 1CI4A 5KNIA 1X9SA 2P66A 2V4RA 2R8HA 3HW8A 1RQNA 2NYVA 5ALSA 1N61A 3RJIA 2BPCA 2NRVA 5EE9A 2NRWA 3ZDCA 3QE9Y 5DB9A 3MGHA 2XI9A 2KFNA 3PMNA 3MR3A 4QZEA 4RQNA 4EEKA 5HP4A 5KFWA 3QZ8A 1U4BA 3LDAA 4F72A 3FC4A 4FO6A 4MF2A 4R8UB 4EYHB 2FDRA 3C2MA 3M9MB 3BQTA 2UVRA 2K4IA 5HMLA 3Q8RB 1NK5A 1B43A 3RR8A 3GFKB 4US8A 5F3XB 2Y1JA 1COKA 5IIMA 3LVWA 2G0AA 3WKDA 3FDSA 5KG2A 5ALVA 1UQVA 1X9MA 1D8LA 5AI8A 8ICLA 2W11A 1Q8KA 2XY5A 4RQ7A 5DKWA 2EQYA 9ICHA 4DL6A 1MC8A 3QNMA 4I2GA 1KLNA 1A77A 2C22A 3VC8A 2XCPA 1GO3F 1L6NA 3RBEA 2ZUBA 1SKRA 3N4MB 1SKWA 2EAOA 4C4RA 4RUCA 4KMOB 1Z1VA 4J9QA 4F50A 2FLPA 4DQQA 5KAIU 3KD3A 5KFGA 2LM1A 1DRGA 4ZH4A 3H40A 7ICTA 3H7IA 3PX4A 1ZQTA 8ICJA 1RYSA 5KFRA 3RH6A 4O5KA 4NM1A 4NV0A 2PXIA 4F5OA 4K4IA 1FFVA 3LYSA 2JEIA 2BGWA 2N1RA 1N5WA 2LBOA 3B0YA 4FS2A 5IINA 2ASLA 3JPSA 2IOHA 1H38A 4RQ1A 1JMSA 3V7LA 4GXJA 4DSFA 4J9OA 5CA7A 1L3SA 4DF8A 9ICBA 2LPEA 2A1JB 5D49A 4QZ9A 4KLTA 3M8RA 3E58A 2QLTA 1NK6A 1X2IA 4PL1A 4MEXA 2OWOA 1A76A 4ECWA 2CXYA 2LYBA 5HR6A 1ZQ1C 4ED7A 1XSPA 2UVVA 5IIKA 1QLNA 5L1LA 4QIWF 7ICMA 4DFJA 1JIHA 4LZGA 5BPCA 2HOIA 2BCVA 4MFAA 3H8JA 2P6RA 2VIXA 4M2YA 1Z4OA 1B4FA 1IM4A 4RQ5A 8ICCA 2F1IA 4TQRA 2DWQA 5AM2A 1N5XA 4DCCA 3JPPA 2R8KA 1TAMA 4KLIA 5D46A 5AM1A 5J2KA 4CDGA 3PW4A 4FS1A 2JH1A 2K60A 2ZIVA 1T94A 1LV5A 3SENA 4CE6A 5DDMA 8ICSA 2ZTCA 1RM6C 1QQ7A 1PUZA 3UXOA 3G6VA 4NLZA 5AKJA 2W55A 5KT2A 2A3VA 4IRCA 4UB8U 3WK6A 5EWEA 2BCUA 1KEJA 1N56A 3ZDBA 1JROA 4AP9A 2D6FC 4M6WA 1ZD5A 2NRZA 1BPZA 4GLXA 2R8GA 5EWGA 2AQ0A 1LVHA 5KFIA 2C28A 3TACB 2XY6A 2BKEA 3Q8MA 2IA6A 1L3VA 4QWDA 5GTHU 1L8OA 2EZXA 4YD1A 3EZ5A 5J8YA 3O0FA 4ICAA 5J0SA 5AICA 2H3VA 5KG0A 4UBBA 3ZD8A 2AU0A 8ICTA 2KD1A 5KL1B 2O6KA 8ICUA 4F2SA 3BQ7A 1ZQZA 2W9CB 5HR7A 2JZBA 4IL6U 2JEGA 4KLGA 7ICEA 1ZQYA 2F76X 2LHTA 1FFUA 3BZCA 5BOLA 4UAWA 1TKDA 2A19A 4OJOA 1L7NA 3PR4A 2QB1A 1WYGA 5KG5A 5HHIA 3QU5A 4PZNA 4EBDA 2M9NA 3UPQA 1DGJA 1NZPA 1L7OA 4KTQA 1ZRNA 1V97A 5ALKA 3G6YA 1IXRA 3E2EA 5KFVA 2Y9TA 3WKEA 3RH5A 1MSWD 4UASA 4FBUA 2W54A 2FMSA 5ALWA 3D2NA 1ZQPA 3C21A 1F0MA 3PSFA 4OO1J 4DS5A 3A0HU 1IIPA 2Y9UA 2R18A 4M9HA 4QW9A 5AKEA 4DOCA 3ZD9A 5KFKA 4DSJA 4U6PA 3RR7A 5KFOA 3QEAZ 4QZHA 1MN8A 2ZG6A 2KZ3A 4WJ3B 4O3PA 4CNQA 4KLMA 2D8CA 4NLBA 2RLTA 2FPMA 3GZFA 3SV4A 1HJPA 4O3MA 3K1RB 5J2FA 4DEZA 4UATA 3T5KA 4HAIA 3AU2A 2ZIXB 4K4GA 3QXGA 3SAHA 9ICEA 1TK8A 2RHFA 4YR0A 5AK4A 1F5SA 1XSNA 3S6JA 4YXJA 4Q8FA 7ICSA 1Q3UA 4KLSA 2AXTU 2H3IA 2DF4B 3I76A 2AGOA 4IQWA 1TVAA 3IV6A 2VKQA 2NO4A 5BOMA 4TUPA 4YR2A 4GXIA 3UMGA 3N28A 4YN4A 1SZPA 1LB2B 5DBBA 4KLUA 2KEYA 4I29A 5J2EA 4P0PA 4KITB 4BDPA 3CW2C 2KSOA 2JEJA 2HVHA 2G08A 3RH4A 2JH7A 5KAFU 1MA7A 4J9KA 3DV9A 4PJ0U 2P6UA 5AIBA 2ISOA 1ZQQA 4Z6DA 5J2HA 2P35A 5CB1A 3RAXA 3GILA 2E1FA 1ZJMA 4FFDA 4RT3A 4M47A 3PZPA 2HHVA 3OJUA 3EW9A 2ISPA 3GIKA 3R9KA 2F1JA 3V6KA 4DLGA 5JU5A 4DF4A 1X6IA 3PO5A 4DFPA 5ALLA 2EAMA 4M9GA 4LJXA 3RJFA 2WF7A 4F2RA 4J9SA 2MU2A 2KHQA 4Y2XA 1TK5A 1BPYA 3SMVA 4O3SA 5J0RA 2Y0SC 2HVIA 1TE2A 5C5JA 1MQ3A 2I6XA 3M9NB 4ECTA 4ED3A 4G9BA 3OJSA 1RZTA 1L3TA 1QCKA 2YB1A 3AMZA 1COOA 3MABA 2BDPA 4Q8EA 3V72A 4EZ9A 3WKAA 4Y2SA 5AIAA 1S0VA 4XUSA 4ED8A 2KK0A 4P0QA 2JEFA 2ZTEA 5CRXA 2Z7JA 1XU4A 4EX6A 4G3IA 1SV4A 4B9UA 2EDUA 4PL2A 3ISCA 4XA5A 4MF8A 3RRHA 2RRDA 1Z00B 4I2CA 4O3QA 2H3ZA 2HBKA 5ALIA 3MR6A 2GO7A 5IIOA 4F5PA 5ALGA 3BS5A 2PFPA 3M6KA 2G5HB 3ED5A 4I2FA 4A8EA 2ODGA 7ICQA 3ZI4A 4Y2UA 4J9RA 4F91B 4NJ8A 1NJZA 3TI0A 4QZBA 5G5HA 3AU6A 4TUQA 4NLGA 2G07A 2YX8A 3U26A 3PR5B 5ALEA 4OCZA 3HT3A 1D9FA 3TAQA 3SR6A 5AK5A 3M1YA 3UQ2A 4RQ3A 4M0AA 5HHHA 2KMDA 5KFNA 5DGAA 1YZ7A 1L3UA 7ICIA 2ZJ5A 2F8KA 3Q8QB 1C20A 3QU9A 4O3RA 3ISDA 5CR0A 4B6JA 2KZMA 5AI6A 1ZQUA 4B9MA 8ICIA 3TQ1A 1JRPA 1UCVA 2HHQA 5AI9A 2BHNA 5L1IA 4PHDA 2YMLA 3WKBA 4YMNA 3M8SA 4QZDA 2E1EA 4RUAA 3H8WA 2BPGA 4M9LA 5L9XA 5IILA 5AKKA 1UT8A 4QWEA 4CF5A 4UQGA 2DUYA 1TAUA 3MC1A 3TKAA 4J9LA 5AKYA 3RB0A 2K89A 2KICA 1NKEA 3GIMA 5KT4A 1S0NA 5F9NA 3K75D 3UMCA 3JPQA 8ICRA 5KT6A 4RNOA 3ALRA 1JXLA 2PFOA 5ALZA 1BVSA 2QB0B 4MHVA 3PW0A 5AKHA 2JXJA 1SXEA 1RYRA 7ICOA 2EAPA 2KJ8A 4ELTA 2I5HA 4F8RA 1ZXIA 2W43A 3BQ2A 8ICBA 2DPIA 9ICLA 5GTIU 4KX3A 1BPDA 3NVVA 1KQQA 4QNLA 1MQ2A 1X9XA 2A1JA 3NRWA 1L7MA 5CJ7A 2RDJA 1C7YA 2GWSA 1T8EA 1CRXA 2E8MA 3J81j 3KHHA 3T5HA 4F4XA 2PI5A 4AYBC 1WUDA 3C29A 4DWIA 1B22A 1NKCA 1XNSA 3T5JA 1U45A 1ZQIA 4F5NA 3PVXA 4I2BA 9ICWA 4KN4A 3TADA 1BPEA 4BXOA 4UB4A 3KFUF 3F53A 4US9A 2ZIWB 4QZFA 2VJ4A 2V9WA 9ICRA 1BNOA 1PVQA 3NGDA 2JV3A 2ASJA 1ZD3A 4JK1A 2HMXA 3GV5B 4EBEA 2BQUA 5AKZA 9ICKA 4DL2A 4FZLA 3C5FA 4GXKA 5ALQA 1D8BA 1N63A 1EXNA 3RB3A 2E3TA 4GFJA 1SXDA 2XICA 4UAYA 4B9TA 1ZQMA 1S76D 5CHGA 1DXSA 2ZTDA 3PX0A 3TARA 1JX4A 3NVWA 3THVA 4C8NA 4YMMA 1UT5A 5KG7A 1ZQEA 2HHXA 2DBYA 2IBKA 2KV2A 3SI8A 3GV8B 5J0UA 1K1SA 9ICCA 4PHEA 9ICIA 5J2JA 3SZ2A 3OHBA 3HX0A 1V85A 2I9GA 1VLBA 2JGAA 1ECWA 4R63A 3KTQA 4Q44A 5J0WA 3MGVA 4MFFA 2ALZA 4CF4A 2OEHA 1SV0A 4F4WA 2W7OA 5CEHA 5KTQA 3GDXA 3WKCA 1S97A 4CRXA 4E0DA 3V6JA 4YVZA 2BDUA 4DFKA 2KZZA 2OYYA 4ECRA 5J0YA 3D2SA 4DSLA 3RRGA 2M0NA 2E5SA 4EZ6A 3PW2A 4GIBA 4DQPA 4EYIB 4RPZA 3MR2A 2YN4A 1ZQLA 1NK9A 8ICHA 3I28A 2OXOA 3MDAA 5KG1A 4KX5A 3OSPA 4C8MA 2AQ4A 3M6ZA 4NXZA 2FMPA 4JMUA 5HMMA 5DBAA 4MFCA 8ICPA 9ICNA 1JALA 5ALXA 5T14A 1Q3VA 2B6GA 2XCAA 5ALMA 5JRTA 1J2MA 3NUQA 2KVSA 4JV1A 3WK5A 3F5AA 4NLCA 7ICGA 4ECXA 1N48A 3H0LB 5ALJA 5J2IA 2PMZF 1QQ5A 2LYAA 5DDYA 4BGDA 1QSYA 3PMLA 4C8OA 4XRHA 8ICGA 5J0XA 4M9JA 4YD2A 4Y2PA 2KG5A 5AM0A 1OW5A 4I2HA 1RPLA 3CNHA 3ZDEA 5KT7A 1DOQA 5KFDA 5J2AA 1KN5A 3GIJA 4ED1A 4QIWC 3MBYA 1B0XA 4BJQA 3JPOA 4KLQA 4RT2A 3NTUA 5J0OA 4UARA 3IHQB 4MEYA 3H4DA 3EPGA 1KFSA 4NWIA 2XGPA 2HHUA 2DGZA 3MFIA 4CF3A 4KLEA 3C1ZA 4ECUA 4O0IA 3RBDA 2L5YA 3BQ0A 5DB6A 4C4TA 2W7PA 2QARA 4I2JA 2KOBA 3KHGA 2MUTA 2ZUCA 1N62A 3KHLA 3H4BA 5AK6A 4DSEA 1DGSA 2BCQA 5K4LA 1XWLA 1T7PA 4DQSA 2WAQF 4QZAA 5AI4A 2YMQA 2KVCA 3T3FA 1KKXA 3WK7A 2DPJA 1KDHA 2ZIVB 5KFZA 4JV2A 4Z6CA 3QZ7A 2BCRA 3GU3A 2KIWA 4JUZA 4IQTA 3VCBA 2GLEA 8ICAA 5JTIA 1F44A 1NKBA 2OM6A 3PSTA 2KKPA 4J9NA 4KLJA 5B66U 4JV0A 1JN3A 2W8LA 1PVPA 4M6WB 4TURA 4M9NA 1WWVA 3SAFA 5DQGA 2XIDA 2ATLA 5KFCA 2WTFA 3IG5A 7ICHA 1WG8A 2K8CB 3HKZC 1RDFA 2GOLA 4I2DA 4Y2VA 2HOQA 3BZKA 2AJQA 4UB6U 4KLFA 4DFMA 4ED6A 3CRXA 4OJ5A 4P4PA 2W9AA 2W9BA 2JZBB 1U47A 4EEYA 5J2CA 5J0TA 3C5GA 2K4HA 3AN1A 1ED1A 4QZ8A 2R8JA 1Z3EB 1SGGA 4UAUA 3IDWA 2MRLA 2B0CA 2HHWA 3V6HA 5TISU 3PY8A 2F8LA 2W03A 1XC9A 4DSKA 5KFFA 4DFDA 3AUOA 4NLKA 4KMUA 4Y2TA 1ZQWA 2Y0SF 2HDOA 2NRXA 1Z19A 3NS1A 2FLNA 4ELVA 5J2BA 3UQ0A 4EX7A 5AI0A 1SKSA 9ICGA 4EELA 3RAQA 5EE3A 4R64A 1K1QA 2W3SA 1L7PA 4Q45A 2HW3A 1PK1A 3B9JA 2HOFA 1ZJNA 3IP4B 1RQLA 2ZIUA 1L8LA 4F5RA 2QKQA 3TFSA 1LKYA 4HYKA 4DOBA 2DKXA 2KJ5A 2KN7A 3A0BU 1SL0A 5DQIA 1HUOA 3KHRA 3G6XA 1URJA 5A0LA 2K8AA 4C4SA 2WF6A 3RTVA 1CEZA 3ONNA 5DB7A 5AKGA 3GIIA 3GV7B 3LWLA 5ALTA 3CYMA 2B21A 4BWMA 1Z1BA 4NY8A 4JWMA 4DQRA 4U7CA 4DLEA 5EE0A 1KFTA 3K4GA 5H2FU 2LI6A 2WB1F 4ECQA 1U48A 3FYHA 3MR5A 2JRZA 1K5OA 3K1ZA 1JUDA 4P4MA 1VDVA 4P0PB 1QTMA 4O3NA 4B9LA 1TV9A 4EBCA 7ICNA 2ZXHA 5KT5A 1WWUA 5AI5A 5J29A 2J6UA 2KSOB 4QWAA 3M7DA 5DGBA 1S77D 3IRUA 3HWTA 4ED0A 3PV8A 5KFYA 1NK4A 5KFHA 2XY7A 3AL0B 1DK2A 4YP3A 4R65A 3QUQA 4YG2A 7ICLA 9ICJA 4XQ8A 5ALRA 1QSLA 1NNLA 4R8UA 1XSLA 5KFQA 5ALOA 3QX7A 5ALHA 3PX6A 4KN7A 1XO0A 7ICVA 4O9MA 1SB3C 2HBJA 1ZQRA 4PPXA 4J9PA 4F93B 1UPHA 2HI0A 1SWWA 4YR3A 1NI3A 1YZ6A 1KW4A 3OHAA 2F77X 1D9DA 3WK8A 5AM4A 2ES6A 1ZQOA 4PGXA 1T3QA 9ICAA 5KFTA 2DL0A 2BR0A 4J9MA 1S0OA 4PGQA 4FE3A 4BX9C 3PSPA 1BNPA 4RU9A 2MSNA 5C0YA 3QU2A 4NM2A 1ZQAA 2F1HA 2RQ5A 4YFKA 3HP6A 3N7PD 3QUCA 1WCLA 4QZCA 9ICUA 2FJ6A 2ZXIA 4IRKA 4CGZA 1T3NA 1XO1A 4NLNA 4OJLA 4ELUA 4KLHA 4P0QB 2MA1A 3NRZA 5KFPA 4ZOHC 4DL7A 3RJGA 5KFMA 5JUMA 2OCEA 4RQMA 1NZBA 2G06A 1KBUA 1J97A 3LK9A 3BS5B 2HCFA 5DG8A 4QJFB 4RQ4A 1ZOLA 1HEKA 2Y1IA 3F5EA 4UBCA 5J8YC 8ICVA 3UM9A 8ICZA 3QEBZ 2PKEA 3OGUA 2FMQA 1ZD4A 4F4YA 5KFLA 4EENA 1UA0A 7ICFA 5G5GA 2EZYA 4IR9A 2KKVA 4C8KA 4F92B 2LKYA 2WF8A 2PI4A 4GC7A 2DKZA 1V9PA 2VA3A 3NASA 5ALPA 1X66A 2HSZA 3OPXA 3T79A 3OSNA 2H3QA 5F9LA 1JXEA 4I2AA 3IM1A 4IQVA 5AKXA 2XC9A 1HUZA 2MAXA 3MDCA 4RQ8A 3ZDDA 4IC9A 2KJ9A 3RB4A 1QSSA 3ICXA 1N2XA 1S5LU 4JWNA 4C7YA 3SD7A 1PVRA 1NOMA 1P7DA 5ALFA 9ICQA 2ZUDA 5EWFA 3PSIA 1ZYQA 4I2EA 3QU4A 4Z6FA 2XVTA 3Q8SB 2K8BB 3T5LA 3JPTA 3FAHA 5IIIA 5KG3A 5KFSA 4P4OA 3RF9A 3MGIA 4TQSA 2XGQA 1UA1A 4R66A 3V7KA 1X40A 3F2BA 3PW5A 2WF9A 5L1JA 1PK3A 3ETLA 2IOFK 3RJEA 2C2DA 4JB3A 1O08A 3KKAC 4X5VA 1M6YA 1IV8A 3SYZA 2V4QA 2KTQA 4C7ZA 5FP0A
chains in the Genus database with same CATH topology
2EZYA 2EZZA 2BZFA 1QCKA 1CI4A 2ODGA 2EZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZY A;  2EZZ A;  2BZF A;  1QCK A;  1CI4 A;  2ODG A;  2EZX A; 
#chains in the Genus database with same CATH topology
 3SEI A;  3PW7 A;  3UMB A;  3UXN A;  3KOO A;  2AGQ A;  1ZQF A;  1S0M A;  2DQN B;  2G5I B;  4YCX A;  5DG7 A;  4Y2Q A;  1VJ5 A;  1RXV A;  8ICF A;  4BWJ A;  2PFN A;  2BPF A;  4PZO A;  2W04 A;  4BXO B;  4J03 A;  1JI7 A;  2W9C A;  2XO7 A;  5AKI A;  3H0R B;  3SV3 A;  4DSI A;  3SAG A;  2KFZ A;  1RG6 A;  3FM9 A;  3Q8P B;  2D3D A;  4Z6E A;  4YQW A;  3EPI A;  4LZD A;  3QUT A;  3AEV A;  1NK7 A;  5KFA A;  4ECZ A;  4QW8 A;  1AQ6 A;  5DB8 A;  2FI1 A;  1Z4N A;  2WF5 A;  5L1M A;  3OTQ A;  4DO9 A;  5KFE A;  1DK3 A;  1RYU A;  4UB5 A;  1FO4 A;  4LVS A;  3N7R C;  8ICO A;  2AH5 A;  2RP5 A;  1U49 A;  5AHX A;  4PGY A;  4NL9 C;  5DLF A;  3E0F A;  1D8Y A;  3N97 B;  4YXM A;  2CN1 A;  4CCH A;  1NJY A;  4QZI A;  2KIV A;  2YY6 A;  2HBM A;  3LVV A;  3PNC A;  3SQI A;  4RQ0 A;  2KE7 A;  9ICT A;  1ZQX A;  5ALU A;  2FPK A;  4ED2 A;  1ZQS A;  2LYH A;  5DLG A;  3WK9 A;  2RDI A;  3H8M A;  4ECS A;  2YTU A;  3D6J A;  3C2L A;  9ICP A;  1SZH A;  2WFA A;  2J6S A;  1ZRM A;  3LWM A;  4KLO A;  4IR1 A;  2ZIX A;  5KFX A;  2F2A B;  9ICF A;  4Y2J A;  1SWV A;  1NK0 A;  4RNM A;  1RXW A;  3HKZ F;  7ICJ A;  4C0Z A;  2G09 A;  1ZQH A;  2EZZ A;  2PMZ C;  1QH9 A;  5KG4 A;  2JR5 A;  2E8N A;  3QYP A;  3RJK A;  3ETR A;  3CP8 A;  4UB2 A;  1ARO P;  3KZX A;  2VA2 A;  4UW9 A;  5IIJ A;  3L4P A;  4F5Q A;  2Q4T A;  2ESE A;  3PO4 A;  1SL2 A;  4F4K A;  4RNN A;  5AKL A;  4B9V A;  3H8S A;  4I27 A;  3RB6 A;  3TAN A;  5EOZ A;  4RQ2 A;  2NV3 A;  7ICR A;  3L3F X;  1X9W A;  3WU2 U;  4OJP A;  1SL1 A;  3JPN A;  2KP7 A;  2AHO B;  3HJE A;  3ISB A;  1ZQJ A;  2J6T A;  5AM5 A;  3NVZ A;  4M04 A;  3D2Q A;  1X6J A;  1Y88 A;  4OJ6 A;  9ICV A;  8ICQ A;  3TFR A;  4F71 A;  4B9S A;  1KSP A;  1J2N A;  3RJH A;  1KL9 A;  2YMM A;  1S10 A;  1OUQ A;  2ZJA A;  4ECV A;  2QAR B;  2BQ3 A;  2MUT B;  2FE9 A;  2BQR A;  1ZQD A;  3UXP A;  2WAQ C;  2K4P A;  1BGX T;  3KKA A;  9ICX A;  1N60 A;  3V7J A;  5EE1 A;  2YQE A;  2C2R A;  5J0Q A;  5KFB A;  4F4Z A;  3IN5 A;  4IRD A;  1U9L A;  5KFJ A;  1TAQ A;  4BUG A;  2AGP A;  2KHV A;  5ALY A;  2H3F A;  2GH1 A;  4RPX A;  5D4B A;  4I28 A;  3RJJ A;  3IG8 A;  3JPR A;  4B9N A;  2C2E A;  7ICP A;  1TFR A;  3EYZ A;  8ICN A;  4DS4 A;  3ZDA A;  2YB4 A;  1Z00 A;  2VJ5 A;  2FPL A;  4USA A;  8ICY A;  3TAP A;  4O5C A;  2ZJ8 A;  5CP2 A;  2CPR A;  3F2C A;  4O5E A;  1ZQG A;  2Q0Z X;  1QQ6 A;  4F3O A;  1NK8 A;  7ICU A;  1KRP A;  2JMG A;  5L1K A;  2IMW P;  3HPO A;  4ACO A;  2FLL A;  1KTQ A;  3KBB A;  4DL3 A;  5J2G A;  1ZQB A;  3TAD C;  4DL5 A;  2BZF A;  3B0X A;  5AM3 A;  1BPX A;  4KLL A;  1PZN A;  4FZN A;  2ASD A;  1FEZ A;  2EAN A;  2H5X A;  2OH2 A;  2PFQ A;  4RQ6 A;  3ORY A;  1ZQC A;  4UB3 A;  1S9F A;  2NRT A;  4NL9 A;  2VAN A;  1CUK A;  1WCN A;  1NJW A;  1T4G A;  4O3O A;  1ZQV A;  3WK4 A;  2NO5 A;  2W9B B;  8ICW A;  4YMO A;  1HIW A;  5B5E U;  3EWA A;  2F3N A;  2IHM A;  4FZM A;  3I1Y A;  3RFA A;  2R8I A;  1A0P A;  2JHD A;  3HIL A;  1UHU A;  4IS7 A;  1L5U A;  5KFU A;  4GC6 A;  3DDH A;  4RPY A;  4QWC A;  2A1A A;  2WHE A;  1S8O A;  8ICX A;  9ICS A;  1KFD A;  3BS7 A;  3C23 A;  3HRD D;  8ICE A;  3AQE A;  3Q8K A;  3M9O B;  1SIJ A;  4KLD A;  5TZV A;  3DEE A;  4DOA A;  4P2H A;  5ALD A;  2UVW A;  2OHF A;  4IQU A;  4PHP A;  3AM9 A;  3F2D A;  3C2K A;  3H0M B;  3L5K A;  3QU7 A;  1TK0 A;  4Y2Y A;  1V38 A;  5E79 U;  1Q46 A;  1YT3 A;  3EUB 2;  4C8L A;  4ECY A;  2HHT A;  2W3R A;  2EH9 A;  3NVY A;  2QB0 A;  2F44 A;  2W8K A;  1SV0 C;  1PK1 B;  4Q43 A;  4TUS A;  3MFH A;  5DQH A;  5CWR A;  4PH5 A;  2UVU A;  4RZR A;  2ZIU B;  5KT3 A;  3C1Y A;  1LKY B;  3N7S C;  3QUB A;  5HNK A;  1FIQ A;  1BPB A;  3KZI U;  4UB1 A;  4FBT A;  9ICM A;  3Q8L A;  5KL8 B;  4UAZ A;  1XS9 D;  2KNJ A;  4C80 A;  7ICK A;  1NJX A;  4QZG A;  2WB1 C;  3C28 A;  2LM4 A;  2HBL A;  5KG6 A;  5ALN A;  8ICM A;  1ZQN A;  2K4E A;  4Y2R A;  4QWB A;  2DFL A;  4OD0 A;  2E8P A;  1ZQK A;  2HHS A;  2YMP A;  2ZIW A;  2I1Q A;  2LMR A;  2E8O A;  4AYB F;  5J2D A;  3BQ1 A;  4PHA A;  4DQI A;  1O03 A;  3AQF A;  5DBC A;  4K4H A;  2W9M A;  3BJY A;  2CRX A;  2IOF A;  1X42 A;  3GQC A;  3BDP A;  4DL4 A;  2IHN A;  1OXJ A;  5J0P A;  1ZET A;  1IG6 A;  2BCS A;  4I2I A;  1ZD2 P;  5DG9 A;  1A6S A;  8ICK A;  9ICO A;  5AK3 A;  2VA8 A;  4UAV A;  1CI4 A;  5KNI A;  1X9S A;  2P66 A;  2V4R A;  2R8H A;  3HW8 A;  1RQN A;  2NYV A;  5ALS A;  1N61 A;  3RJI A;  2BPC A;  2NRV A;  5EE9 A;  2NRW A;  3ZDC A;  3QE9 Y;  5DB9 A;  3MGH A;  2XI9 A;  2KFN A;  3PMN A;  3MR3 A;  4QZE A;  4RQN A;  4EEK A;  5HP4 A;  5KFW A;  3QZ8 A;  1U4B A;  3LDA A;  4F72 A;  3FC4 A;  4FO6 A;  4MF2 A;  4R8U B;  4EYH B;  2FDR A;  3C2M A;  3M9M B;  3BQT A;  2UVR A;  2K4I A;  5HML A;  3Q8R B;  1NK5 A;  1B43 A;  3RR8 A;  3GFK B;  4US8 A;  5F3X B;  2Y1J A;  1COK A;  5IIM A;  3LVW A;  2G0A A;  3WKD A;  3FDS A;  5KG2 A;  5ALV A;  1UQV A;  1X9M A;  1D8L A;  5AI8 A;  8ICL A;  2W11 A;  1Q8K A;  2XY5 A;  4RQ7 A;  5DKW A;  2EQY A;  9ICH A;  4DL6 A;  1MC8 A;  3QNM A;  4I2G A;  1KLN A;  1A77 A;  2C22 A;  3VC8 A;  2XCP A;  1GO3 F;  1L6N A;  3RBE A;  2ZUB A;  1SKR A;  3N4M B;  1SKW A;  2EAO A;  4C4R A;  4RUC A;  4KMO B;  1Z1V A;  4J9Q A;  4F50 A;  2FLP A;  4DQQ A;  5KAI U;  3KD3 A;  5KFG A;  2LM1 A;  1DRG A;  4ZH4 A;  3H40 A;  7ICT A;  3H7I A;  3PX4 A;  1ZQT A;  8ICJ A;  1RYS A;  5KFR A;  3RH6 A;  4O5K A;  4NM1 A;  4NV0 A;  2PXI A;  4F5O A;  4K4I A;  1FFV A;  3LYS A;  2JEI A;  2BGW A;  2N1R A;  1N5W A;  2LBO A;  3B0Y A;  4FS2 A;  5IIN A;  2ASL A;  3JPS A;  2IOH A;  1H38 A;  4RQ1 A;  1JMS A;  3V7L A;  4GXJ A;  4DSF A;  4J9O A;  5CA7 A;  1L3S A;  4DF8 A;  9ICB A;  2LPE A;  2A1J B;  5D49 A;  4QZ9 A;  4KLT A;  3M8R A;  3E58 A;  2QLT A;  1NK6 A;  1X2I A;  4PL1 A;  4MEX A;  2OWO A;  1A76 A;  4ECW A;  2CXY A;  2LYB A;  5HR6 A;  1ZQ1 C;  4ED7 A;  1XSP A;  2UVV A;  5IIK A;  1QLN A;  5L1L A;  4QIW F;  7ICM A;  4DFJ A;  1JIH A;  4LZG A;  5BPC A;  2HOI A;  2BCV A;  4MFA A;  3H8J A;  2P6R A;  2VIX A;  4M2Y A;  1Z4O A;  1B4F A;  1IM4 A;  4RQ5 A;  8ICC A;  2F1I A;  4TQR A;  2DWQ A;  5AM2 A;  1N5X A;  4DCC A;  3JPP A;  2R8K A;  1TAM A;  4KLI A;  5D46 A;  5AM1 A;  5J2K A;  4CDG A;  3PW4 A;  4FS1 A;  2JH1 A;  2K60 A;  2ZIV A;  1T94 A;  1LV5 A;  3SEN A;  4CE6 A;  5DDM A;  8ICS A;  2ZTC A;  1RM6 C;  1QQ7 A;  1PUZ A;  3UXO A;  3G6V A;  4NLZ A;  5AKJ A;  2W55 A;  5KT2 A;  2A3V A;  4IRC A;  4UB8 U;  3WK6 A;  5EWE A;  2BCU A;  1KEJ A;  1N56 A;  3ZDB A;  1JRO A;  4AP9 A;  2D6F C;  4M6W A;  1ZD5 A;  2NRZ A;  1BPZ A;  4GLX A;  2R8G A;  5EWG A;  2AQ0 A;  1LVH A;  5KFI A;  2C28 A;  3TAC B;  2XY6 A;  2BKE A;  3Q8M A;  2IA6 A;  1L3V A;  4QWD A;  5GTH U;  1L8O A;  2EZX A;  4YD1 A;  3EZ5 A;  5J8Y A;  3O0F A;  4ICA A;  5J0S A;  5AIC A;  2H3V A;  5KG0 A;  4UBB A;  3ZD8 A;  2AU0 A;  8ICT A;  2KD1 A;  5KL1 B;  2O6K A;  8ICU A;  4F2S A;  3BQ7 A;  1ZQZ A;  2W9C B;  5HR7 A;  2JZB A;  4IL6 U;  2JEG A;  4KLG A;  7ICE A;  1ZQY A;  2F76 X;  2LHT A;  1FFU A;  3BZC A;  5BOL A;  4UAW A;  1TKD A;  2A19 A;  4OJO A;  1L7N A;  3PR4 A;  2QB1 A;  1WYG A;  5KG5 A;  5HHI A;  3QU5 A;  4PZN A;  4EBD A;  2M9N A;  3UPQ A;  1DGJ A;  1NZP A;  1L7O A;  4KTQ A;  1ZRN A;  1V97 A;  5ALK A;  3G6Y A;  1IXR A;  3E2E A;  5KFV A;  2Y9T A;  3WKE A;  3RH5 A;  1MSW D;  4UAS A;  4FBU A;  2W54 A;  2FMS A;  5ALW A;  3D2N A;  1ZQP A;  3C21 A;  1F0M A;  3PSF A;  4OO1 J;  4DS5 A;  3A0H U;  1IIP A;  2Y9U A;  2R18 A;  4M9H A;  4QW9 A;  5AKE A;  4DOC A;  3ZD9 A;  5KFK A;  4DSJ A;  4U6P A;  3RR7 A;  5KFO A;  3QEA Z;  4QZH A;  1MN8 A;  2ZG6 A;  2KZ3 A;  4WJ3 B;  4O3P A;  4CNQ A;  4KLM A;  2D8C A;  4NLB A;  2RLT A;  2FPM A;  3GZF A;  3SV4 A;  1HJP A;  4O3M A;  3K1R B;  5J2F A;  4DEZ A;  4UAT A;  3T5K A;  4HAI A;  3AU2 A;  2ZIX B;  4K4G A;  3QXG A;  3SAH A;  9ICE A;  1TK8 A;  2RHF A;  4YR0 A;  5AK4 A;  1F5S A;  1XSN A;  3S6J A;  4YXJ A;  4Q8F A;  7ICS A;  1Q3U A;  4KLS A;  2AXT U;  2H3I A;  2DF4 B;  3I76 A;  2AGO A;  4IQW A;  1TVA A;  3IV6 A;  2VKQ A;  2NO4 A;  5BOM A;  4TUP A;  4YR2 A;  4GXI A;  3UMG A;  3N28 A;  4YN4 A;  1SZP A;  1LB2 B;  5DBB A;  4KLU A;  2KEY A;  4I29 A;  5J2E A;  4P0P A;  4KIT B;  4BDP A;  3CW2 C;  2KSO A;  2JEJ A;  2HVH A;  2G08 A;  3RH4 A;  2JH7 A;  5KAF U;  1MA7 A;  4J9K A;  3DV9 A;  4PJ0 U;  2P6U A;  5AIB A;  2ISO A;  1ZQQ A;  4Z6D A;  5J2H A;  2P35 A;  5CB1 A;  3RAX A;  3GIL A;  2E1F A;  1ZJM A;  4FFD A;  4RT3 A;  4M47 A;  3PZP A;  2HHV A;  3OJU A;  3EW9 A;  2ISP A;  3GIK A;  3R9K A;  2F1J A;  3V6K A;  4DLG A;  5JU5 A;  4DF4 A;  1X6I A;  3PO5 A;  4DFP A;  5ALL A;  2EAM A;  4M9G A;  4LJX A;  3RJF A;  2WF7 A;  4F2R A;  4J9S A;  2MU2 A;  2KHQ A;  4Y2X A;  1TK5 A;  1BPY A;  3SMV A;  4O3S A;  5J0R A;  2Y0S C;  2HVI A;  1TE2 A;  5C5J A;  1MQ3 A;  2I6X A;  3M9N B;  4ECT A;  4ED3 A;  4G9B A;  3OJS A;  1RZT A;  1L3T A;  1QCK A;  2YB1 A;  3AMZ A;  1COO A;  3MAB A;  2BDP A;  4Q8E A;  3V72 A;  4EZ9 A;  3WKA A;  4Y2S A;  5AIA A;  1S0V A;  4XUS A;  4ED8 A;  2KK0 A;  4P0Q A;  2JEF A;  2ZTE A;  5CRX A;  2Z7J A;  1XU4 A;  4EX6 A;  4G3I A;  1SV4 A;  4B9U A;  2EDU A;  4PL2 A;  3ISC A;  4XA5 A;  4MF8 A;  3RRH A;  2RRD A;  1Z00 B;  4I2C A;  4O3Q A;  2H3Z A;  2HBK A;  5ALI A;  3MR6 A;  2GO7 A;  5IIO A;  4F5P A;  5ALG A;  3BS5 A;  2PFP A;  3M6K A;  2G5H B;  3ED5 A;  4I2F A;  4A8E A;  2ODG A;  7ICQ A;  3ZI4 A;  4Y2U A;  4J9R A;  4F91 B;  4NJ8 A;  1NJZ A;  3TI0 A;  4QZB A;  5G5H A;  3AU6 A;  4TUQ A;  4NLG A;  2G07 A;  2YX8 A;  3U26 A;  3PR5 B;  5ALE A;  4OCZ A;  3HT3 A;  1D9F A;  3TAQ A;  3SR6 A;  5AK5 A;  3M1Y A;  3UQ2 A;  4RQ3 A;  4M0A A;  5HHH A;  2KMD A;  5KFN A;  5DGA A;  1YZ7 A;  1L3U A;  7ICI A;  2ZJ5 A;  2F8K A;  3Q8Q B;  1C20 A;  3QU9 A;  4O3R A;  3ISD A;  5CR0 A;  4B6J A;  2KZM A;  5AI6 A;  1ZQU A;  4B9M A;  8ICI A;  3TQ1 A;  1JRP A;  1UCV A;  2HHQ A;  5AI9 A;  2BHN A;  5L1I A;  4PHD A;  2YML A;  3WKB A;  4YMN A;  3M8S A;  4QZD A;  2E1E A;  4RUA A;  3H8W A;  2BPG A;  4M9L A;  5L9X A;  5IIL A;  5AKK A;  1UT8 A;  4QWE A;  4CF5 A;  4UQG A;  2DUY A;  1TAU A;  3MC1 A;  3TKA A;  4J9L A;  5AKY A;  3RB0 A;  2K89 A;  2KIC A;  1NKE A;  3GIM A;  5KT4 A;  1S0N A;  5F9N A;  3K75 D;  3UMC A;  3JPQ A;  8ICR A;  5KT6 A;  4RNO A;  3ALR A;  1JXL A;  2PFO A;  5ALZ A;  1BVS A;  2QB0 B;  4MHV A;  3PW0 A;  5AKH A;  2JXJ A;  1SXE A;  1RYR A;  7ICO A;  2EAP A;  2KJ8 A;  4ELT A;  2I5H A;  4F8R A;  1ZXI A;  2W43 A;  3BQ2 A;  8ICB A;  2DPI A;  9ICL A;  5GTI U;  4KX3 A;  1BPD A;  3NVV A;  1KQQ A;  4QNL A;  1MQ2 A;  1X9X A;  2A1J A;  3NRW A;  1L7M A;  5CJ7 A;  2RDJ A;  1C7Y A;  2GWS A;  1T8E A;  1CRX A;  2E8M A;  3J81 j;  3KHH A;  3T5H A;  4F4X A;  2PI5 A;  4AYB C;  1WUD A;  3C29 A;  4DWI A;  1B22 A;  1NKC A;  1XNS A;  3T5J A;  1U45 A;  1ZQI A;  4F5N A;  3PVX A;  4I2B A;  9ICW A;  4KN4 A;  3TAD A;  1BPE A;  4BXO A;  4UB4 A;  3KFU F;  3F53 A;  4US9 A;  2ZIW B;  4QZF A;  2VJ4 A;  2V9W A;  9ICR A;  1BNO A;  1PVQ A;  3NGD A;  2JV3 A;  2ASJ A;  1ZD3 A;  4JK1 A;  2HMX A;  3GV5 B;  4EBE A;  2BQU A;  5AKZ A;  9ICK A;  4DL2 A;  4FZL A;  3C5F A;  4GXK A;  5ALQ A;  1D8B A;  1N63 A;  1EXN A;  3RB3 A;  2E3T A;  4GFJ A;  1SXD A;  2XIC A;  4UAY A;  4B9T A;  1ZQM A;  1S76 D;  5CHG A;  1DXS A;  2ZTD A;  3PX0 A;  3TAR A;  1JX4 A;  3NVW A;  3THV A;  4C8N A;  4YMM A;  1UT5 A;  5KG7 A;  1ZQE A;  2HHX A;  2DBY A;  2IBK A;  2KV2 A;  3SI8 A;  3GV8 B;  5J0U A;  1K1S A;  9ICC A;  4PHE A;  9ICI A;  5J2J A;  3SZ2 A;  3OHB A;  3HX0 A;  1V85 A;  2I9G A;  1VLB A;  2JGA A;  1ECW A;  4R63 A;  3KTQ A;  4Q44 A;  5J0W A;  3MGV A;  4MFF A;  2ALZ A;  4CF4 A;  2OEH A;  1SV0 A;  4F4W A;  2W7O A;  5CEH A;  5KTQ A;  3GDX A;  3WKC A;  1S97 A;  4CRX A;  4E0D A;  3V6J A;  4YVZ A;  2BDU A;  4DFK A;  2KZZ A;  2OYY A;  4ECR A;  5J0Y A;  3D2S A;  4DSL A;  3RRG A;  2M0N A;  2E5S A;  4EZ6 A;  3PW2 A;  4GIB A;  4DQP A;  4EYI B;  4RPZ A;  3MR2 A;  2YN4 A;  1ZQL A;  1NK9 A;  8ICH A;  3I28 A;  2OXO A;  3MDA A;  5KG1 A;  4KX5 A;  3OSP A;  4C8M A;  2AQ4 A;  3M6Z A;  4NXZ A;  2FMP A;  4JMU A;  5HMM A;  5DBA A;  4MFC A;  8ICP A;  9ICN A;  1JAL A;  5ALX A;  5T14 A;  1Q3V A;  2B6G A;  2XCA A;  5ALM A;  5JRT A;  1J2M A;  3NUQ A;  2KVS A;  4JV1 A;  3WK5 A;  3F5A A;  4NLC A;  7ICG A;  4ECX A;  1N48 A;  3H0L B;  5ALJ A;  5J2I A;  2PMZ F;  1QQ5 A;  2LYA A;  5DDY A;  4BGD A;  1QSY A;  3PML A;  4C8O A;  4XRH A;  8ICG A;  5J0X A;  4M9J A;  4YD2 A;  4Y2P A;  2KG5 A;  5AM0 A;  1OW5 A;  4I2H A;  1RPL A;  3CNH A;  3ZDE A;  5KT7 A;  1DOQ A;  5KFD A;  5J2A A;  1KN5 A;  3GIJ A;  4ED1 A;  4QIW C;  3MBY A;  1B0X A;  4BJQ A;  3JPO A;  4KLQ A;  4RT2 A;  3NTU A;  5J0O A;  4UAR A;  3IHQ B;  4MEY A;  3H4D A;  3EPG A;  1KFS A;  4NWI A;  2XGP A;  2HHU A;  2DGZ A;  3MFI A;  4CF3 A;  4KLE A;  3C1Z A;  4ECU A;  4O0I A;  3RBD A;  2L5Y A;  3BQ0 A;  5DB6 A;  4C4T A;  2W7P A;  2QAR A;  4I2J A;  2KOB A;  3KHG A;  2MUT A;  2ZUC A;  1N62 A;  3KHL A;  3H4B A;  5AK6 A;  4DSE A;  1DGS A;  2BCQ A;  5K4L A;  1XWL A;  1T7P A;  4DQS A;  2WAQ F;  4QZA A;  5AI4 A;  2YMQ A;  2KVC A;  3T3F A;  1KKX A;  3WK7 A;  2DPJ A;  1KDH A;  2ZIV B;  5KFZ A;  4JV2 A;  4Z6C A;  3QZ7 A;  2BCR A;  3GU3 A;  2KIW A;  4JUZ A;  4IQT A;  3VCB A;  2GLE A;  8ICA A;  5JTI A;  1F44 A;  1NKB A;  2OM6 A;  3PST A;  2KKP A;  4J9N A;  4KLJ A;  5B66 U;  4JV0 A;  1JN3 A;  2W8L A;  1PVP A;  4M6W B;  4TUR A;  4M9N A;  1WWV A;  3SAF A;  5DQG A;  2XID A;  2ATL A;  5KFC A;  2WTF A;  3IG5 A;  7ICH A;  1WG8 A;  2K8C B;  3HKZ C;  1RDF A;  2GOL A;  4I2D A;  4Y2V A;  2HOQ A;  3BZK A;  2AJQ A;  4UB6 U;  4KLF A;  4DFM A;  4ED6 A;  3CRX A;  4OJ5 A;  4P4P A;  2W9A A;  2W9B A;  2JZB B;  1U47 A;  4EEY A;  5J2C A;  5J0T A;  3C5G A;  2K4H A;  3AN1 A;  1ED1 A;  4QZ8 A;  2R8J A;  1Z3E B;  1SGG A;  4UAU A;  3IDW A;  2MRL A;  2B0C A;  2HHW A;  3V6H A;  5TIS U;  3PY8 A;  2F8L A;  2W03 A;  1XC9 A;  4DSK A;  5KFF A;  4DFD A;  3AUO A;  4NLK A;  4KMU A;  4Y2T A;  1ZQW A;  2Y0S F;  2HDO A;  2NRX A;  1Z19 A;  3NS1 A;  2FLN A;  4ELV A;  5J2B A;  3UQ0 A;  4EX7 A;  5AI0 A;  1SKS A;  9ICG A;  4EEL A;  3RAQ A;  5EE3 A;  4R64 A;  1K1Q A;  2W3S A;  1L7P A;  4Q45 A;  2HW3 A;  1PK1 A;  3B9J A;  2HOF A;  1ZJN A;  3IP4 B;  1RQL A;  2ZIU A;  1L8L A;  4F5R A;  2QKQ A;  3TFS A;  1LKY A;  4HYK A;  4DOB A;  2DKX A;  2KJ5 A;  2KN7 A;  3A0B U;  1SL0 A;  5DQI A;  1HUO A;  3KHR A;  3G6X A;  1URJ A;  5A0L A;  2K8A A;  4C4S A;  2WF6 A;  3RTV A;  1CEZ A;  3ONN A;  5DB7 A;  5AKG A;  3GII A;  3GV7 B;  3LWL A;  5ALT A;  3CYM A;  2B21 A;  4BWM A;  1Z1B A;  4NY8 A;  4JWM A;  4DQR A;  4U7C A;  4DLE A;  5EE0 A;  1KFT A;  3K4G A;  5H2F U;  2LI6 A;  2WB1 F;  4ECQ A;  1U48 A;  3FYH A;  3MR5 A;  2JRZ A;  1K5O A;  3K1Z A;  1JUD A;  4P4M A;  1VDV A;  4P0P B;  1QTM A;  4O3N A;  4B9L A;  1TV9 A;  4EBC A;  7ICN A;  2ZXH A;  5KT5 A;  1WWU A;  5AI5 A;  5J29 A;  2J6U A;  2KSO B;  4QWA A;  3M7D A;  5DGB A;  1S77 D;  3IRU A;  3HWT A;  4ED0 A;  3PV8 A;  5KFY A;  1NK4 A;  5KFH A;  2XY7 A;  3AL0 B;  1DK2 A;  4YP3 A;  4R65 A;  3QUQ A;  4YG2 A;  7ICL A;  9ICJ A;  4XQ8 A;  5ALR A;  1QSL A;  1NNL A;  4R8U A;  1XSL A;  5KFQ A;  5ALO A;  3QX7 A;  5ALH A;  3PX6 A;  4KN7 A;  1XO0 A;  7ICV A;  4O9M A;  1SB3 C;  2HBJ A;  1ZQR A;  4PPX A;  4J9P A;  4F93 B;  1UPH A;  2HI0 A;  1SWW A;  4YR3 A;  1NI3 A;  1YZ6 A;  1KW4 A;  3OHA A;  2F77 X;  1D9D A;  3WK8 A;  5AM4 A;  2ES6 A;  1ZQO A;  4PGX A;  1T3Q A;  9ICA A;  5KFT A;  2DL0 A;  2BR0 A;  4J9M A;  1S0O A;  4PGQ A;  4FE3 A;  4BX9 C;  3PSP A;  1BNP A;  4RU9 A;  2MSN A;  5C0Y A;  3QU2 A;  4NM2 A;  1ZQA A;  2F1H A;  2RQ5 A;  4YFK A;  3HP6 A;  3N7P D;  3QUC A;  1WCL A;  4QZC A;  9ICU A;  2FJ6 A;  2ZXI A;  4IRK A;  4CGZ A;  1T3N A;  1XO1 A;  4NLN A;  4OJL A;  4ELU A;  4KLH A;  4P0Q B;  2MA1 A;  3NRZ A;  5KFP A;  4ZOH C;  4DL7 A;  3RJG A;  5KFM A;  5JUM A;  2OCE A;  4RQM A;  1NZB A;  2G06 A;  1KBU A;  1J97 A;  3LK9 A;  3BS5 B;  2HCF A;  5DG8 A;  4QJF B;  4RQ4 A;  1ZOL A;  1HEK A;  2Y1I A;  3F5E A;  4UBC A;  5J8Y C;  8ICV A;  3UM9 A;  8ICZ A;  3QEB Z;  2PKE A;  3OGU A;  2FMQ A;  1ZD4 A;  4F4Y A;  5KFL A;  4EEN A;  1UA0 A;  7ICF A;  5G5G A;  2EZY A;  4IR9 A;  2KKV A;  4C8K A;  4F92 B;  2LKY A;  2WF8 A;  2PI4 A;  4GC7 A;  2DKZ A;  1V9P A;  2VA3 A;  3NAS A;  5ALP A;  1X66 A;  2HSZ A;  3OPX A;  3T79 A;  3OSN A;  2H3Q A;  5F9L A;  1JXE A;  4I2A A;  3IM1 A;  4IQV A;  5AKX A;  2XC9 A;  1HUZ A;  2MAX A;  3MDC A;  4RQ8 A;  3ZDD A;  4IC9 A;  2KJ9 A;  3RB4 A;  1QSS A;  3ICX A;  1N2X A;  1S5L U;  4JWN A;  4C7Y A;  3SD7 A;  1PVR A;  1NOM A;  1P7D A;  5ALF A;  9ICQ A;  2ZUD A;  5EWF A;  3PSI A;  1ZYQ A;  4I2E A;  3QU4 A;  4Z6F A;  2XVT A;  3Q8S B;  2K8B B;  3T5L A;  3JPT A;  3FAH A;  5III A;  5KG3 A;  5KFS A;  4P4O A;  3RF9 A;  3MGI A;  4TQS A;  2XGQ A;  1UA1 A;  4R66 A;  3V7K A;  1X40 A;  3F2B A;  3PW5 A;  2WF9 A;  5L1J A;  1PK3 A;  3ETL A;  2IOF K;  3RJE A;  2C2D A;  4JB3 A;  1O08 A;  3KKA C;  4X5V A;  1M6Y A;  1IV8 A;  3SYZ A;  2V4Q A;  2KTQ A;  4C7Z A;  5FP0 A; 
#chains in the Genus database with same CATH homology
 2EZY A;  2EZZ A;  2BZF A;  1QCK A;  1CI4 A;  2ODG A;  2EZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...