2EZXA

Solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
publication title Solution structure of the cellular factor BAF responsible for protecting retroviral DNA from autointegration.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2ezxA00
1QCKA 2EZYA 1CI4A 2ODGA 2BZFA 2EZZA 2EZXA
chains in the Genus database with same CATH superfamily
3F2CA 8ICYA 4WJ3B 1JXLA 2DUYA 1UPHA 4IS7A 1T7PA 1JALA 4E0DA 4ECQA 4DL6A 9ICQA 4MFAA 5KFDA 2F77X 2AGPA 2AXTU 2OCEA 1T3QA 2L5YA 1LV5A 1SIJA 2P6UA 5DKWA 2CXYA 3T5LA 3N4MB 1T94A 1NJWA 2ZTDA 1F0MA 2K60A 4P0PA 1WCLA 2H3VA 1JMSA 4NL9A 1C20A 5J0YA 5DBAA 1AROP 4NLKA 3DV9A 4C8MA 8ICKA 2IOFA 4DQSA 4Q8FA 5KG1A 4NLNA 4FFDA 4RT2A 4BGDA 2Z7JA 5ALVA 5IIIA 4P4OA 4I28A 1RYSA 1SL2A 2LBOA 2IMWP 3LYSA 4TQRA 4EEKA 3AM9A 4KLLA 4QIWC 5B66U 2KTQA 2GLEA 1K1SA 2BQRA 1V85A 1X6JA 3RRGA 2ODGA 2W9BB 1T3NA 2OWOA 4UAVA 4DL2A 5KFGA 5AI6A 4RPZA 5DB9A 3RB0A 3BJYA 1JRPA 4AP9A 3HKZF 4OCZA 8ICLA 4UB4A 2FE9A 3M9NB 4ED1A 4GXKA 4P2HA 2FPKA 1KFDA 4UB3A 1KLNA 2BZFA 4IQUA 1T4GA 4NWIA 2F76X 4DOBA 2WB1C 3T3FA 2DGZA 4I2BA 4IQWA 1L7MA 4Z6FA 2EZZA 3F2BA 4RUAA 4Y2VA 2DWQA 4JV2A 3BQ7A 1UCVA 4DQIA 2NRVA 1WWVA 2NYVA 2OYYA 7ICQA 2P66A 3MR5A 3ISDA 4PHPA 3CRXA 7ICTA 4J9NA 5J0RA 5KNIA 1B22A 2KFNA 5CP2A 5KFWA 2E1FA 2HSZA 3ZD8A 3OPXA 2W55A 1M6YA 2FPMA 1WYGA 4CRXA 1XO1A 4B9UA 5ALQA 1L5UA 1CRXA 5F9LA 5KFTA 1B4FA 4ED6A 2F8KA 4R63A 1X9MA 4BWJA 5AM2A 2A1JB 3B9JA 3C1ZA 2PMZC 3HRDD 2KZZA 4NLGA 2N1RA 9ICBA 4HYKA 2Y9TA 2K89A 2R8KA 3D2NA 1LVHA 2W03A 1CI4A 4DQPA 3KHRA 1RM6C 1SV4A 3HT3A 1SKRA 9ICGA 2XGQA 2ZXIA 1IM4A 4LZGA 3MABA 3SR6A 4B9SA 4TUQA 2M0NA 2AQ4A 5KFJA 3K1ZA 2XO7A 1N63A 1KKXA 2YQEA 2EH9A 1A76A 3I1YA 3TQ1A 2W7OA 5AKLA 4M9HA 4QZ8A 2RQ5A 4YXJA 9ICMA 4M0AA 5HHIA 2NRZA 4ZOHC 3GDXA 8ICFA 4OJOA 2EZYA 4F5PA 8ICSA 3GV7B 4BWMA 1NJXA 2PKEA 4ZH4A 5K4LA 4I2DA 5L1MA 4Q43A 3UQ0A 3WK6A 4RNOA 2Y0SC 3OGUA 2BQUA 2RRDA 2WF9A 9ICAA 1SV0C 3ZDEA 5JUMA 3WKBA 2ZIVB 3QU5A 2H3QA 2W8KA 4QZ9A 2FJ6A 5J2DA 4O3SA 1SL0A 3NS1A 1YZ7A 2W43A 1S77D 5KTQA 3QUCA 2OHFA 5HMMA 5AKEA 4JV1A 3QZ8A 2M9NA 5B5EU 3HILA 4XRHA 2YN4A 2KHQA 5ALLA 3ZDBA 4KLGA 3H4BA 2V9WA 5KFKA 4C4SA 2DKZA 4UB2A 1DXSA 1IV8A 1DGJA 2PXIA 4R8UB 5KAIU 2K4EA 4C7ZA 5KFNA 2FI1A 1J97A 4Y2TA 4CNQA 1SKWA 2F3NA 2IOFK 1S8OA 3BS5A 3F5EA 5KFPA 2B6GA 3OHBA 4J9QA 4K4IA 4Y2SA 2AH5A 2ZXHA 3ZDAA 3QX7A 5KL8B 3GIKA 5HMLA 3L4PA 4O3MA 3Q8QB 4UAUA 2C2RA 4DL7A 3WKAA 4G9BA 1ED1A 2GWSA 2JEIA 4O5CA 2JEGA 1ZQAA 3MDCA 4I2AA 2AQ0A 2BHNA 1KL9A 4C4RA 4M04A 2KZMA 3GZFA 3QU4A 4DFMA 4P4PA 1UT5A 5KT6A 1ZQTA 5ALDA 5JTIA 1U48A 4QZDA 2V4QA 3TANA 3MGHA 3IG8A 5ALMA 1COOA 2KIWA 4F4YA 3SV4A 2NRXA 3PW0A 2VJ4A 4YR0A 4NM2A 4BUGA 1XSLA 4RPXA 2ASLA 3DEEA 5G5GA 2LYHA 3F2DA 2K8BB 3H8SA 5KG5A 3WK8A 3GILA 1XO0A 2MU2A 4BJQA 1Z00A 4ED7A 9ICVA 4CF4A 2VANA 3M8SA 2GH1A 5KFUA 4PHDA 3PSTA 5J29A 4ELVA 4YP3A 1ZQBA 3KTQA 3NGDA 4PH5A 2P35A 4UQGA 1QQ7A 4GLXA 1URJA 4KMOB 3QYPA 4QJFB 5KT5A 2ZIUB 8ICAA 1MN8A 4IC9A 1EXNA 3Q8LA 2KJ9A 2JXJA 3N28A 4YR2A 2BR0A 1TKDA 3H8JA 3JPQA 4NLZA 3DDHA 5J0QA 3JPSA 1SGGA 2HMXA 3KHGA 4FZLA 4USAA 2PFPA 4B9NA 7ICGA 1DOQA 3JPTA 2CPRA 4LZDA 1ZRNA 1A77A 1ZQZA 2ASDA 2W11A 2NV3A 4DO9A 1JIHA 4YG2A 4FO6A 8ICHA 1LKYB 4B9TA 1XC9A 3U26A 3LVVA 3WK4A 4ECTA 4IR1A 3ICXA 2HVHA 2K4PA 4I27A 2KSOB 5ALTA 2G0AA 4B9LA 1J2NA 2DKXA 4KLDA 5DG7A 1ZQRA 1ZXIA 5AKIA 3V6HA 2JV3A 4CCHA 2W8LA 3EZ5A 2OEHA 5DB6A 1O03A 2FLNA 4QW8A 2DPIA 1K1QA 5ALOA 2HBKA 1V38A 1D9FA 1ZQNA 2HBMA 5AKYA 4Y2PA 4LVSA 1ZETA 3SI8A 4RT3A 4Q44A 2KKPA 2E8NA 5KFCA 3RB6A 2KKVA 3RAQA 5J2EA 2KV2A 5AIAA 3AQEA 3NRZA 1FO4A 1CEZA 3BS7A 3JPNA 1WCNA 4RQNA 1ZQPA 4KLOA 3CNHA 3HJEA 4IQTA 4ECYA 3IDWA 5AKHA 2MA1A 2MUTB 2W3SA 4U6PA 3SYZA 3KOOA 1XSNA 2F1IA 4NJ8A 2E1EA 5IIKA 1N5XA 1NNLA 9ICKA 5HR6A 4FZMA 5ALWA 1TK0A 1ECWA 5C0YA 4IL6U 2VA8A 4K4HA 5KFYA 3R9KA 2BPCA 4OJPA 1NK8A 1NK4A 1ZD4A 1ZQ1C 3RAXA 4C0ZA 4RU9A 1UA1A 2JEFA 1N5WA 1L7NA 3QXGA 2KSOA 1BVSA 1ZQXA 2AJQA 5AI9A 3BQ1A 1X9WA 1D8LA 4GIBA 4EYHB 2ZJAA 3TAQA 2BKEA 8ICBA 3GFKB 5J2KA 5KG2A 2BCUA 4FBTA 2FDRA 9ICCA 3Q8PB 5AM0A 4Q45A 1V97A 5J0TA 4DFPA 1VLBA 1NKBA 3N97B 3IV6A 5L1JA 2NRWA 3FM9A 3WK7A 2ISOA 3ZI4A 5DB8A 1U47A 3T5HA 5KAFU 4YR3A 1N48A 2HHTA 2K8AA 3C2MA 5G5HA 3H8MA 5E79U 4O3QA 2HHVA 2LYAA 1P7DA 2C2DA 4RNMA 4KLUA 1ZQEA 8ICIA 4M6WA 3M6KA 4F5QA 1Z4OA 3MR6A 1JI7A 4U7CA 3JPRA 5AICA 4RQMA 3LK9A 1RYUA 3OSNA 1Z1VA 2YB1A 4UW9A 4UASA 3BQ2A 3UPQA 4O0IA 4EEYA 3I76A 7ICKA 7ICEA 2R8HA 3KHLA 1NOMA 2YB4A 3C21A 2G09A 2ZJ8A 2ZJ5A 4J9KA 4C8OA 5A0LA 5EOZA 1ZQYA 5J0WA 4QZAA 4YMNA 5AK5A 5AK3A 2HOIA 4A8EA 1OUQA 3WU2U 2BDPA 3PW7A 3Q8RB 2EAMA 4MF8A 2E5SA 4PGQA 2KEYA 3QUBA 3QU2A 2JHDA 1AQ6A 2UVVA 3KKAA 5DQGA 3PW2A 1JXEA 1D8YA 3QE9Y 5KG7A 2RP5A 5ALJA 4Z6CA 5J2CA 4QZEA 2HOFA 8ICJA 3ISBA 4Y2YA 4X5VA 1ZQQA 1NK0A 3OJUA 3RJKA 1N62A 2H5XA 4US8A 4PGYA 3D2SA 4M9JA 2F1JA 2RLTA 3UMCA 4PZOA 4F4WA 4F8RA 1L3SA 4ICAA 1Y88A 4ED2A 2QKQA 5KG3A 2KN7A 3BZKA 3EUB2 3PR4A 5KFFA 4DLEA 2NO5A 3WKEA 4I2JA 2HHUA 3Q8SB 1V9PA 4KLTA 3VC8A 3H40A 9ICNA 1U45A 3WKCA 3TFRA 2KD1A 4C7YA 1ZQHA 4I2GA 3RB3A 3M7DA 3UMGA 3G6XA 5DGAA 4DEZA 8ICTA 4RQ1A 4RQ6A 2JEJA 2FMQA 4G3IA 2ZUDA 1FEZA 4K4GA 3MR3A 3TARA 8ICXA 4DOCA 4JK1A 3LDAA 3B0XA 4DFJA 4F5OA 2YY6A 1ZQWA 5AKZA 1BPBA 4F5RA 3UMBA 2QB0B 4EZ9A 8ICPA 5KL1B 3PR5B 5AHXA 1N2XA 2LMRA 4EENA 3UXNA 2W9BA 8ICGA 4O3RA 3IHQB 3NVZA 2C2EA 2UVWA 3E2EA 5T14A 1XSPA 4P4MA 3PNCA 4PHAA 4I29A 5J0UA 2I5HA 4F2RA 1TE2A 3C1YA 7ICIA 3NRWA 4TUPA 3IN5A 3GIIA 3K75D 4KN7A 2OM6A 3T5KA 4UB6U 2P6RA 4QNLA 2LHTA 1DK2A 4BXOB 1OW5A 2W9CB 3PX0A 4IQVA 4R64A 2HBLA 1H38A 3PSFA 4YFKA 3H7IA 4ECXA 2I6XA 3CYMA 3TADC 3NVVA 2PI5A 8ICUA 7ICSA 3HX0A 2HHQA 3RJEA 2V4RA 3C28A 1ZD2P 3WKDA 5ALKA 5JU5A 1XU4A 3ZD9A 4ECZA 5CB1A 4FZNA 1ZJNA 4Y2QA 4NXZA 3UM9A 3BQTA 2A1JA 9ICHA 7ICNA 3SMVA 2MSNA 2O6KA 1RXWA 3OSPA 1ZQCA 7ICUA 1ZQLA 1NK9A 2KVCA 3D6JA 3AL0B 3KFUF 4EX7A 1L3TA 5F3XB 2HHSA 4F71A 2HHWA 2Y1JA 4CF5A 5HP4A 2QLTA 1L7PA 4YVZA 4DSIA 9ICOA 4J9RA 2EQYA 4BXOA 1MC8A 5KFBA 9ICTA 3THVA 2G07A 1S97A 4FS1A 2LKYA 1BPZA 5AM5A 1JUDA 3J81j 1Q46A 3NTUA 2JMGA 3BQ0A 4DF4A 2W7PA 4J9MA 5HR7A 3ISCA 3PV8A 3A0BU 4CDGA 3LVWA 2MAXA 1SV0A 5ALRA 1KFTA 2J6UA 1Z1BA 5EWEA 4EBEA 4GXIA 4C8KA 2ZIVA 5F9NA 1J2MA 1S0OA 2NO4A 1COKA 5DQIA 8ICOA 2H3FA 2RHFA 1CUKA 3ZDCA 5DBBA 5L1KA 3GIMA 3FC4A 2JR5A 1S76D 5KFHA 4RQ8A 1RZTA 1A6SA 4QZFA 4DS4A 4NY8A 4P0QB 2KIVA 1FFVA 4R66A 3TFSA 2JZBB 1KBUA 1VJ5A 1U49A 5DBCA 5DG8A 4QWAA 5ALZA 2DQNB 3ETLA 4RZRA 5J0PA 1NK7A 3ORYA 3GV5B 4R8UA 7ICFA 2E8OA 2ZIWB 5KFMA 3KHHA 2HBJA 1ZYQA 2W54A 2G08A 1HIWA 1PVQA 1B0XA 1S9FA 1SXEA 4OO1J 2EAPA 1S0VA 5AI8A 3MFIA 4QWDA 2A19A 4J9PA 1A0PA 3MGIA 1VDVA 3RH4A 2I9GA 4IRCA 2B21A 2FLPA 2PFOA 2Y9UA 1ZQUA 5TZVA 3UQ2A 1ZQDA 4DFKA 9ICWA 3MBYA 5J8YC 4C8NA 3SV3A 2RDIA 1BNOA 5KT2A 3RBEA 2W04A 7ICPA 8ICEA 5L1IA 4UB8U 5KFOA 2ALZA 4QZGA 4YD2A 3QEAZ 3RTVA 1PK1B 5KT7A 1DGSA 4R65A 8ICMA 5AK6A 4OJLA 4P0QA 1BPDA 1IG6A 1QSYA 1IIPA 2G5IB 2JZBA 2KHVA 3T5JA 4RNNA 3JPOA 4PZNA 3FYHA 3B0YA 1WWUA 1X6IA 1KW4A 1TVAA 4MFCA 2Y1IA 3D2QA 4AYBF 5KFQA 9ICIA 3RR8A 2ZIWA 3MC1A 1QCKA 1LB2B 3V72A 3QU9A 5J2AA 1QH9A 2KJ5A 1QLNA 2ZIUA 3L3FX 1KQQA 4O3OA 3BZCA 3HW8A 1O08A 3C29A 5HHHA 5D46A 3PO5A 4HAIA 3ZDDA 3JPPA 3PY8A 5J8YA 3PVXA 1Q3VA 8ICRA 5ALUA 4YQWA 4NV0A 2YMPA 1X42A 4OJ5A 1RQLA 4PJ0U 2R8JA 5FP0A 1PVRA 2K8CB 1PK1A 2XC9A 1LKYA 3PO4A 1KDHA 3HPOA 2XCAA 4NLCA 2LM1A 4BX9C 4KLHA 2AGQA 4DF8A 3PMLA 1BPXA 1YT3A 2GO7A 2D6FC 1ZQKA 5KG0A 1Z4NA 4DSJA 4IR9A 2NRTA 2H3ZA 3V6JA 4I2IA 4F4XA 2JRZA 9ICLA 2G5HB 2XGPA 1BPYA 4O5KA 2DFLA 3TI0A 3PSIA 1WG8A 2Q4TA 5DG9A 4KN4A 1B43A 4DSLA 2WHEA 4MEXA 2R8GA 4KLEA 4KX5A 4ED3A 2ZTCA 5KFAA 4QZHA 5L1LA 2W3RA 4EBCA 5HNKA 5ALIA 1BNPA 2KZ3A 1PVPA 5EE0A 4GXJA 3AQFA 1RXVA 5D49A 2A3VA 1NZPA 2MUTA 2R8IA 1L6NA 2DPJA 4MEYA 3SQIA 4I2FA 4DWIA 7ICLA 3LWLA 4Q8EA 4FE3A 3FAHA 2EZXA 2XVTA 1KEJA 4B9MA 5DQHA 4QWBA 1X9SA 3AU2A 4Y2JA 1QTMA 9ICEA 1SXDA 5ALHA 2YX8A 2WTFA 2IOHA 2DF4B 5J2GA 3F5AA 4M2YA 2K4HA 4O3PA 4F4ZA 2ESEA 7ICMA 2YMLA 8ICWA 2BQ3A 3EPIA 5KFIA 2WF6A 1ZJMA 1D9DA 3PMNA 3SAHA 4US9A 2FMSA 1Z19A 2J6TA 2WAQF 4DFDA 1ZQIA 4MHVA 1ZQMA 4DL5A 3QZ7A 1X40A 2LM4A 1JROA 2ZIXB 4RQ3A 2ASJA 4IRKA 3F53A 3O0FA 1ZRMA 8ICQA 5J2FA 2AGOA 5ALSA 4TURA 4DS5A 1TAUA 1RPLA 4YD1A 9ICRA 5IILA 2IBKA 8ICZA 1L8LA 1X2IA 3S6JA 5KFLA 3IP4B 3H0RB 4OD0A 3SAGA 2LI6A 1XNSA 2HCFA 1NI3A 3E0FA 2CN1A 4NLBA 4XUSA 5KFEA 4JMUA 3HP6A 4DQQA 4ELTA 1SB3C 8ICCA 1ZQFA 2XIDA 4RQ7A 3EPGA 3AU6A 3IRUA 2KJ8A 3ED5A 4C4TA 2MRLA 5L9XA 4JWMA 1ZOLA 4F91B 3IM1A 5BOMA 4YXMA 1MQ3A 1HUOA 4EX6A 4AYBC 5JRTA 2LPEA 1NZBA 4EZ6A 5D4BA 4DCCA 2KMDA 1S0MA 2BCQA 3I28A 5EWFA 2YTUA 5ALXA 5BOLA 2ZIXA 3RH6A 4C80A 1S0NA 3G6VA 3EYZA 3GIJA 3A0HU 1Z3EB 1PZNA 5CRXA 5IIMA 9ICFA 1N56A 5AI0A 3VCBA 2PFQA 3RBDA 3OHAA 2D3DA 5AKGA 2VKQA 3M6ZA 5IINA 1OXJA 4EBDA 1L3VA 3FDSA 1ZQVA 4QZIA 4ECUA 2E8MA 1JN3A 4OJ6A 4XA5A 2FMPA 2UVRA 3NVWA 3K4GA 5DDMA 2XY7A 4JB3A 2CRXA 4UAZA 4GC7A 1KSPA 4M9NA 5TISU 5EE3A 3Q8MA 1SKSA 4F72A 3KBBA 4KMUA 2KVSA 4Y2UA 4UARA 2KOBA 3SEIA 3M9MB 3GV8B 2LYBA 3C2KA 1UQVA 1TFRA 4RQ0A 4J9SA 4KLMA 1SZPA 4KITB 5AKXA 8ICNA 3RR7A 4GC6A 5BPCA 3H0LB 2PI4A 2GOLA 3OTQA 4ECSA 2H3IA 2E3TA 1NJYA 1NKEA 3C23A 3NUQA 2F8LA 3L5KA 5IIOA 1S5LU 1HEKA 2DL0A 5EE1A 4EYIB 5AI5A 4F93B 2KFZA 1T8EA 5EWGA 1ZQSA 4FBUA 2F1HA 1PK3A 2AU0A 5J2BA 2BCSA 2YMMA 2XICA 2G06A 4UBBA 3PZPA 4UBCA 3RB4A 3T79A 2YMQA 5J2JA 1YZ6A 5IIJA 1MA7A 2QB0A 3RJJA 3BDPA 5H2FU 1TK5A 5AM4A 5KT3A 2XY5A 3BS5B 1L7OA 1KTQA 4PHEA 3TKAA 4TUSA 4B9VA 4JUZA 2WF5A 1QQ6A 1DRGA 3PX4A 4IRDA 1HUZA 3PX6A 2BPFA 4O5EA 2HVIA 7ICRA 1TAQA 1N60A 3ONNA 4Z6DA 2WAQC 1QSLA 3PW5A 5ALYA 5AM1A 1IXRA 3EW9A 2OXOA 1KRPA 4DOAA 1NK5A 4MFFA 1F44A 2D8CA 3ETRA 5KFSA 5CEHA 4KLFA 4ELUA 2JGAA 4XQ8A 2W9CA 5AIBA 2XY6A 1N61A 3AMZA 1TK8A 5CJ7A 3PW4A 3TADA 3K1RB 5AI4A 3CW2C 2HW3A 2HHXA 2ISPA 5AM3A 1Z00B 1BPEA 5DLFA 1RQNA 2KE7A 4GFJA 4ECRA 1UA0A 2IHNA 1U4BA 1QQ5A 1WUDA 5CR0A 4DLGA 2VJ5A 5KFRA 3H4DA 4KLSA 4RQ4A 1SZHA 5KFZA 3V7LA 4Z6EA 3RF9A 5CHGA 4J9OA 4QZBA 1TV9A 3KD3A 2J6SA 2JH7A 4QWCA 1SWWA 7ICHA 2HI0A 3V6KA 5J0XA 4ED8A 2WF8A 2HOQA 4YN4A 5AKKA 2QARB 4RUCA 1L3UA 5J2HA 9ICPA 1UT8A 2WFAA 4BDPA 2C28A 4DSEA 3IG5A 4F2SA 4KX3A 3HKZC 4B6JA 3RRHA 4M9GA 3TACB 3G6YA 1L8OA 5J2IA 3H8WA 3MR2A 5DLGA 9ICXA 1HJPA 2UVUA 4QZCA 5ALEA 2BCRA 3RH5A 2W9MA 4F3OA 2ZUCA 4DQRA 4QW9A 7ICJA 2B0CA 1ZQOA 3C2LA 4M9LA 2EAOA 5ALGA 3QUQA 1BGXT 3M8RA 9ICSA 4MF2A 2W9AA 5C5JA 1D8BA 1RYRA 2WF7A 4F92B 4F5NA 4CF3A 2IA6A 3C5GA 3M9OB 4YMOA 3NASA 2XCPA 3M1YA 4YCXA 3EWAA 4RQ5A 1ZD3A 2BDUA 4Y2XA 2VA2A 2QARA 5J0OA 4UATA 2KICA 2KP7A 4FS2A 2OH2A 3V7KA 2C22A 2ZG6A 3RJIA 1QSSA 5EE9A 1JX4A 1X66A 3GU3A 2KK0A 4RPYA 4QWEA 1RDFA 4TQSA 3CP8A 3KZXA 1MQ2A 3GQCA 4I2HA 3RJHA 4F50A 3NVYA 2ATLA 2BPGA 5ALPA 1ZD5A 4QIWF 3AN1A 2AHOB 4M47A 3QNMA 3MFHA 4PL1A 2R18A 3MDAA 4ED0A 3QU7A 2EDUA 5J0SA 3AUOA 5KFVA 5DGBA 4ACOA 3RJGA 4EELA 4JV0A 3RJFA 2QB1A 4PL2A 1RG6A 3WK5A 3QUTA 1S10A 4ECWA 2WB1F 4J03A 1C7YA 1F5SA 1FFUA 2XI9A 4DL4A 3Q8KA 3SZ2A 4I2EA 2HDOA 4F4KA 5ALFA 2KG5A 3HWTA 4ECVA 3QEBZ 1FIQA 2EANA 7ICOA 5DDYA 3PSPA 1GO3F 2K4IA 5CA7A 1NJZA 4KLIA 1ZQJA 1XWLA 1ZQGA 4DL3A 3SD7A 9ICUA 2FPLA 7ICVA 1NK6A 2E8PA 1K5OA 4UAYA 2BGWA 3N7RC 5KT4A 3UXOA 4KTQA 5CWRA 4Y2RA 4M6WB 4RQ2A 3OJSA 1UHUA 2A1AA 5AK4A 4CGZA 4J9LA 3C5FA 1TAMA 5KG4A 5AKJA 2IHMA 1KFSA 2Q0ZX 1SWVA 1Q3UA 2ZUBA 3N7SC 2PMZF 4O9MA 3V7JA 2JH1A 3N7PD 4KLJA 5KFXA 1U9LA 3ALRA 5GTHU 2DBYA 2ES6A 2RDJA 2F44A 5GTIU 4NM1A 2VIXA 1XS9D 2PFNA 1SL1A 3MGVA 2ZTEA 3SENA 2KNJA 3E58A 4P0PB 1PUZA 4PGXA 4O3NA 8ICVA 2FLLA 3AEVA 1KN5A 4LJXA 2I1QA 4CE6A 5ALNA 4NL9C 4UB1A 5KG6A 4YMMA 3LWMA 4I2CA 4UB5A 3TAPA 2F2AB 3SAFA 3KKAC 4DSFA 2VA3A 2BCVA 4DSKA 3KZIU 3H0MB 1DK3A 4KLQA 1MSWD 9ICJA 3RFAA 4JWNA 3WK9A 1Q8KA 1NKCA 4C8LA 1X9XA 4PPXA 2Y0SF 5DB7A 4UAWA 3UXPA
chains in the Genus database with same CATH topology
1QCKA 2EZYA 1CI4A 2ODGA 2BZFA 2EZZA 2EZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCK A;  2EZY A;  1CI4 A;  2ODG A;  2BZF A;  2EZZ A;  2EZX A; 
#chains in the Genus database with same CATH topology
 3F2C A;  8ICY A;  4WJ3 B;  1JXL A;  2DUY A;  1UPH A;  4IS7 A;  1T7P A;  1JAL A;  4E0D A;  4ECQ A;  4DL6 A;  9ICQ A;  4MFA A;  5KFD A;  2F77 X;  2AGP A;  2AXT U;  2OCE A;  1T3Q A;  2L5Y A;  1LV5 A;  1SIJ A;  2P6U A;  5DKW A;  2CXY A;  3T5L A;  3N4M B;  1T94 A;  1NJW A;  2ZTD A;  1F0M A;  2K60 A;  4P0P A;  1WCL A;  2H3V A;  1JMS A;  4NL9 A;  1C20 A;  5J0Y A;  5DBA A;  1ARO P;  4NLK A;  3DV9 A;  4C8M A;  8ICK A;  2IOF A;  4DQS A;  4Q8F A;  5KG1 A;  4NLN A;  4FFD A;  4RT2 A;  4BGD A;  2Z7J A;  5ALV A;  5III A;  4P4O A;  4I28 A;  1RYS A;  1SL2 A;  2LBO A;  2IMW P;  3LYS A;  4TQR A;  4EEK A;  3AM9 A;  4KLL A;  4QIW C;  5B66 U;  2KTQ A;  2GLE A;  1K1S A;  2BQR A;  1V85 A;  1X6J A;  3RRG A;  2ODG A;  2W9B B;  1T3N A;  2OWO A;  4UAV A;  4DL2 A;  5KFG A;  5AI6 A;  4RPZ A;  5DB9 A;  3RB0 A;  3BJY A;  1JRP A;  4AP9 A;  3HKZ F;  4OCZ A;  8ICL A;  4UB4 A;  2FE9 A;  3M9N B;  4ED1 A;  4GXK A;  4P2H A;  2FPK A;  1KFD A;  4UB3 A;  1KLN A;  2BZF A;  4IQU A;  1T4G A;  4NWI A;  2F76 X;  4DOB A;  2WB1 C;  3T3F A;  2DGZ A;  4I2B A;  4IQW A;  1L7M A;  4Z6F A;  2EZZ A;  3F2B A;  4RUA A;  4Y2V A;  2DWQ A;  4JV2 A;  3BQ7 A;  1UCV A;  4DQI A;  2NRV A;  1WWV A;  2NYV A;  2OYY A;  7ICQ A;  2P66 A;  3MR5 A;  3ISD A;  4PHP A;  3CRX A;  7ICT A;  4J9N A;  5J0R A;  5KNI A;  1B22 A;  2KFN A;  5CP2 A;  5KFW A;  2E1F A;  2HSZ A;  3ZD8 A;  3OPX A;  2W55 A;  1M6Y A;  2FPM A;  1WYG A;  4CRX A;  1XO1 A;  4B9U A;  5ALQ A;  1L5U A;  1CRX A;  5F9L A;  5KFT A;  1B4F A;  4ED6 A;  2F8K A;  4R63 A;  1X9M A;  4BWJ A;  5AM2 A;  2A1J B;  3B9J A;  3C1Z A;  2PMZ C;  3HRD D;  2KZZ A;  4NLG A;  2N1R A;  9ICB A;  4HYK A;  2Y9T A;  2K89 A;  2R8K A;  3D2N A;  1LVH A;  2W03 A;  1CI4 A;  4DQP A;  3KHR A;  1RM6 C;  1SV4 A;  3HT3 A;  1SKR A;  9ICG A;  2XGQ A;  2ZXI A;  1IM4 A;  4LZG A;  3MAB A;  3SR6 A;  4B9S A;  4TUQ A;  2M0N A;  2AQ4 A;  5KFJ A;  3K1Z A;  2XO7 A;  1N63 A;  1KKX A;  2YQE A;  2EH9 A;  1A76 A;  3I1Y A;  3TQ1 A;  2W7O A;  5AKL A;  4M9H A;  4QZ8 A;  2RQ5 A;  4YXJ A;  9ICM A;  4M0A A;  5HHI A;  2NRZ A;  4ZOH C;  3GDX A;  8ICF A;  4OJO A;  2EZY A;  4F5P A;  8ICS A;  3GV7 B;  4BWM A;  1NJX A;  2PKE A;  4ZH4 A;  5K4L A;  4I2D A;  5L1M A;  4Q43 A;  3UQ0 A;  3WK6 A;  4RNO A;  2Y0S C;  3OGU A;  2BQU A;  2RRD A;  2WF9 A;  9ICA A;  1SV0 C;  3ZDE A;  5JUM A;  3WKB A;  2ZIV B;  3QU5 A;  2H3Q A;  2W8K A;  4QZ9 A;  2FJ6 A;  5J2D A;  4O3S A;  1SL0 A;  3NS1 A;  1YZ7 A;  2W43 A;  1S77 D;  5KTQ A;  3QUC A;  2OHF A;  5HMM A;  5AKE A;  4JV1 A;  3QZ8 A;  2M9N A;  5B5E U;  3HIL A;  4XRH A;  2YN4 A;  2KHQ A;  5ALL A;  3ZDB A;  4KLG A;  3H4B A;  2V9W A;  5KFK A;  4C4S A;  2DKZ A;  4UB2 A;  1DXS A;  1IV8 A;  1DGJ A;  2PXI A;  4R8U B;  5KAI U;  2K4E A;  4C7Z A;  5KFN A;  2FI1 A;  1J97 A;  4Y2T A;  4CNQ A;  1SKW A;  2F3N A;  2IOF K;  1S8O A;  3BS5 A;  3F5E A;  5KFP A;  2B6G A;  3OHB A;  4J9Q A;  4K4I A;  4Y2S A;  2AH5 A;  2ZXH A;  3ZDA A;  3QX7 A;  5KL8 B;  3GIK A;  5HML A;  3L4P A;  4O3M A;  3Q8Q B;  4UAU A;  2C2R A;  4DL7 A;  3WKA A;  4G9B A;  1ED1 A;  2GWS A;  2JEI A;  4O5C A;  2JEG A;  1ZQA A;  3MDC A;  4I2A A;  2AQ0 A;  2BHN A;  1KL9 A;  4C4R A;  4M04 A;  2KZM A;  3GZF A;  3QU4 A;  4DFM A;  4P4P A;  1UT5 A;  5KT6 A;  1ZQT A;  5ALD A;  5JTI A;  1U48 A;  4QZD A;  2V4Q A;  3TAN A;  3MGH A;  3IG8 A;  5ALM A;  1COO A;  2KIW A;  4F4Y A;  3SV4 A;  2NRX A;  3PW0 A;  2VJ4 A;  4YR0 A;  4NM2 A;  4BUG A;  1XSL A;  4RPX A;  2ASL A;  3DEE A;  5G5G A;  2LYH A;  3F2D A;  2K8B B;  3H8S A;  5KG5 A;  3WK8 A;  3GIL A;  1XO0 A;  2MU2 A;  4BJQ A;  1Z00 A;  4ED7 A;  9ICV A;  4CF4 A;  2VAN A;  3M8S A;  2GH1 A;  5KFU A;  4PHD A;  3PST A;  5J29 A;  4ELV A;  4YP3 A;  1ZQB A;  3KTQ A;  3NGD A;  4PH5 A;  2P35 A;  4UQG A;  1QQ7 A;  4GLX A;  1URJ A;  4KMO B;  3QYP A;  4QJF B;  5KT5 A;  2ZIU B;  8ICA A;  1MN8 A;  4IC9 A;  1EXN A;  3Q8L A;  2KJ9 A;  2JXJ A;  3N28 A;  4YR2 A;  2BR0 A;  1TKD A;  3H8J A;  3JPQ A;  4NLZ A;  3DDH A;  5J0Q A;  3JPS A;  1SGG A;  2HMX A;  3KHG A;  4FZL A;  4USA A;  2PFP A;  4B9N A;  7ICG A;  1DOQ A;  3JPT A;  2CPR A;  4LZD A;  1ZRN A;  1A77 A;  1ZQZ A;  2ASD A;  2W11 A;  2NV3 A;  4DO9 A;  1JIH A;  4YG2 A;  4FO6 A;  8ICH A;  1LKY B;  4B9T A;  1XC9 A;  3U26 A;  3LVV A;  3WK4 A;  4ECT A;  4IR1 A;  3ICX A;  2HVH A;  2K4P A;  4I27 A;  2KSO B;  5ALT A;  2G0A A;  4B9L A;  1J2N A;  2DKX A;  4KLD A;  5DG7 A;  1ZQR A;  1ZXI A;  5AKI A;  3V6H A;  2JV3 A;  4CCH A;  2W8L A;  3EZ5 A;  2OEH A;  5DB6 A;  1O03 A;  2FLN A;  4QW8 A;  2DPI A;  1K1Q A;  5ALO A;  2HBK A;  1V38 A;  1D9F A;  1ZQN A;  2HBM A;  5AKY A;  4Y2P A;  4LVS A;  1ZET A;  3SI8 A;  4RT3 A;  4Q44 A;  2KKP A;  2E8N A;  5KFC A;  3RB6 A;  2KKV A;  3RAQ A;  5J2E A;  2KV2 A;  5AIA A;  3AQE A;  3NRZ A;  1FO4 A;  1CEZ A;  3BS7 A;  3JPN A;  1WCN A;  4RQN A;  1ZQP A;  4KLO A;  3CNH A;  3HJE A;  4IQT A;  4ECY A;  3IDW A;  5AKH A;  2MA1 A;  2MUT B;  2W3S A;  4U6P A;  3SYZ A;  3KOO A;  1XSN A;  2F1I A;  4NJ8 A;  2E1E A;  5IIK A;  1N5X A;  1NNL A;  9ICK A;  5HR6 A;  4FZM A;  5ALW A;  1TK0 A;  1ECW A;  5C0Y A;  4IL6 U;  2VA8 A;  4K4H A;  5KFY A;  3R9K A;  2BPC A;  4OJP A;  1NK8 A;  1NK4 A;  1ZD4 A;  1ZQ1 C;  3RAX A;  4C0Z A;  4RU9 A;  1UA1 A;  2JEF A;  1N5W A;  1L7N A;  3QXG A;  2KSO A;  1BVS A;  1ZQX A;  2AJQ A;  5AI9 A;  3BQ1 A;  1X9W A;  1D8L A;  4GIB A;  4EYH B;  2ZJA A;  3TAQ A;  2BKE A;  8ICB A;  3GFK B;  5J2K A;  5KG2 A;  2BCU A;  4FBT A;  2FDR A;  9ICC A;  3Q8P B;  5AM0 A;  4Q45 A;  1V97 A;  5J0T A;  4DFP A;  1VLB A;  1NKB A;  3N97 B;  3IV6 A;  5L1J A;  2NRW A;  3FM9 A;  3WK7 A;  2ISO A;  3ZI4 A;  5DB8 A;  1U47 A;  3T5H A;  5KAF U;  4YR3 A;  1N48 A;  2HHT A;  2K8A A;  3C2M A;  5G5H A;  3H8M A;  5E79 U;  4O3Q A;  2HHV A;  2LYA A;  1P7D A;  2C2D A;  4RNM A;  4KLU A;  1ZQE A;  8ICI A;  4M6W A;  3M6K A;  4F5Q A;  1Z4O A;  3MR6 A;  1JI7 A;  4U7C A;  3JPR A;  5AIC A;  4RQM A;  3LK9 A;  1RYU A;  3OSN A;  1Z1V A;  2YB1 A;  4UW9 A;  4UAS A;  3BQ2 A;  3UPQ A;  4O0I A;  4EEY A;  3I76 A;  7ICK A;  7ICE A;  2R8H A;  3KHL A;  1NOM A;  2YB4 A;  3C21 A;  2G09 A;  2ZJ8 A;  2ZJ5 A;  4J9K A;  4C8O A;  5A0L A;  5EOZ A;  1ZQY A;  5J0W A;  4QZA A;  4YMN A;  5AK5 A;  5AK3 A;  2HOI A;  4A8E A;  1OUQ A;  3WU2 U;  2BDP A;  3PW7 A;  3Q8R B;  2EAM A;  4MF8 A;  2E5S A;  4PGQ A;  2KEY A;  3QUB A;  3QU2 A;  2JHD A;  1AQ6 A;  2UVV A;  3KKA A;  5DQG A;  3PW2 A;  1JXE A;  1D8Y A;  3QE9 Y;  5KG7 A;  2RP5 A;  5ALJ A;  4Z6C A;  5J2C A;  4QZE A;  2HOF A;  8ICJ A;  3ISB A;  4Y2Y A;  4X5V A;  1ZQQ A;  1NK0 A;  3OJU A;  3RJK A;  1N62 A;  2H5X A;  4US8 A;  4PGY A;  3D2S A;  4M9J A;  2F1J A;  2RLT A;  3UMC A;  4PZO A;  4F4W A;  4F8R A;  1L3S A;  4ICA A;  1Y88 A;  4ED2 A;  2QKQ A;  5KG3 A;  2KN7 A;  3BZK A;  3EUB 2;  3PR4 A;  5KFF A;  4DLE A;  2NO5 A;  3WKE A;  4I2J A;  2HHU A;  3Q8S B;  1V9P A;  4KLT A;  3VC8 A;  3H40 A;  9ICN A;  1U45 A;  3WKC A;  3TFR A;  2KD1 A;  4C7Y A;  1ZQH A;  4I2G A;  3RB3 A;  3M7D A;  3UMG A;  3G6X A;  5DGA A;  4DEZ A;  8ICT A;  4RQ1 A;  4RQ6 A;  2JEJ A;  2FMQ A;  4G3I A;  2ZUD A;  1FEZ A;  4K4G A;  3MR3 A;  3TAR A;  8ICX A;  4DOC A;  4JK1 A;  3LDA A;  3B0X A;  4DFJ A;  4F5O A;  2YY6 A;  1ZQW A;  5AKZ A;  1BPB A;  4F5R A;  3UMB A;  2QB0 B;  4EZ9 A;  8ICP A;  5KL1 B;  3PR5 B;  5AHX A;  1N2X A;  2LMR A;  4EEN A;  3UXN A;  2W9B A;  8ICG A;  4O3R A;  3IHQ B;  3NVZ A;  2C2E A;  2UVW A;  3E2E A;  5T14 A;  1XSP A;  4P4M A;  3PNC A;  4PHA A;  4I29 A;  5J0U A;  2I5H A;  4F2R A;  1TE2 A;  3C1Y A;  7ICI A;  3NRW A;  4TUP A;  3IN5 A;  3GII A;  3K75 D;  4KN7 A;  2OM6 A;  3T5K A;  4UB6 U;  2P6R A;  4QNL A;  2LHT A;  1DK2 A;  4BXO B;  1OW5 A;  2W9C B;  3PX0 A;  4IQV A;  4R64 A;  2HBL A;  1H38 A;  3PSF A;  4YFK A;  3H7I A;  4ECX A;  2I6X A;  3CYM A;  3TAD C;  3NVV A;  2PI5 A;  8ICU A;  7ICS A;  3HX0 A;  2HHQ A;  3RJE A;  2V4R A;  3C28 A;  1ZD2 P;  3WKD A;  5ALK A;  5JU5 A;  1XU4 A;  3ZD9 A;  4ECZ A;  5CB1 A;  4FZN A;  1ZJN A;  4Y2Q A;  4NXZ A;  3UM9 A;  3BQT A;  2A1J A;  9ICH A;  7ICN A;  3SMV A;  2MSN A;  2O6K A;  1RXW A;  3OSP A;  1ZQC A;  7ICU A;  1ZQL A;  1NK9 A;  2KVC A;  3D6J A;  3AL0 B;  3KFU F;  4EX7 A;  1L3T A;  5F3X B;  2HHS A;  4F71 A;  2HHW A;  2Y1J A;  4CF5 A;  5HP4 A;  2QLT A;  1L7P A;  4YVZ A;  4DSI A;  9ICO A;  4J9R A;  2EQY A;  4BXO A;  1MC8 A;  5KFB A;  9ICT A;  3THV A;  2G07 A;  1S97 A;  4FS1 A;  2LKY A;  1BPZ A;  5AM5 A;  1JUD A;  3J81 j;  1Q46 A;  3NTU A;  2JMG A;  3BQ0 A;  4DF4 A;  2W7P A;  4J9M A;  5HR7 A;  3ISC A;  3PV8 A;  3A0B U;  4CDG A;  3LVW A;  2MAX A;  1SV0 A;  5ALR A;  1KFT A;  2J6U A;  1Z1B A;  5EWE A;  4EBE A;  4GXI A;  4C8K A;  2ZIV A;  5F9N A;  1J2M A;  1S0O A;  2NO4 A;  1COK A;  5DQI A;  8ICO A;  2H3F A;  2RHF A;  1CUK A;  3ZDC A;  5DBB A;  5L1K A;  3GIM A;  3FC4 A;  2JR5 A;  1S76 D;  5KFH A;  4RQ8 A;  1RZT A;  1A6S A;  4QZF A;  4DS4 A;  4NY8 A;  4P0Q B;  2KIV A;  1FFV A;  4R66 A;  3TFS A;  2JZB B;  1KBU A;  1VJ5 A;  1U49 A;  5DBC A;  5DG8 A;  4QWA A;  5ALZ A;  2DQN B;  3ETL A;  4RZR A;  5J0P A;  1NK7 A;  3ORY A;  3GV5 B;  4R8U A;  7ICF A;  2E8O A;  2ZIW B;  5KFM A;  3KHH A;  2HBJ A;  1ZYQ A;  2W54 A;  2G08 A;  1HIW A;  1PVQ A;  1B0X A;  1S9F A;  1SXE A;  4OO1 J;  2EAP A;  1S0V A;  5AI8 A;  3MFI A;  4QWD A;  2A19 A;  4J9P A;  1A0P A;  3MGI A;  1VDV A;  3RH4 A;  2I9G A;  4IRC A;  2B21 A;  2FLP A;  2PFO A;  2Y9U A;  1ZQU A;  5TZV A;  3UQ2 A;  1ZQD A;  4DFK A;  9ICW A;  3MBY A;  5J8Y C;  4C8N A;  3SV3 A;  2RDI A;  1BNO A;  5KT2 A;  3RBE A;  2W04 A;  7ICP A;  8ICE A;  5L1I A;  4UB8 U;  5KFO A;  2ALZ A;  4QZG A;  4YD2 A;  3QEA Z;  3RTV A;  1PK1 B;  5KT7 A;  1DGS A;  4R65 A;  8ICM A;  5AK6 A;  4OJL A;  4P0Q A;  1BPD A;  1IG6 A;  1QSY A;  1IIP A;  2G5I B;  2JZB A;  2KHV A;  3T5J A;  4RNN A;  3JPO A;  4PZN A;  3FYH A;  3B0Y A;  1WWU A;  1X6I A;  1KW4 A;  1TVA A;  4MFC A;  2Y1I A;  3D2Q A;  4AYB F;  5KFQ A;  9ICI A;  3RR8 A;  2ZIW A;  3MC1 A;  1QCK A;  1LB2 B;  3V72 A;  3QU9 A;  5J2A A;  1QH9 A;  2KJ5 A;  1QLN A;  2ZIU A;  3L3F X;  1KQQ A;  4O3O A;  3BZC A;  3HW8 A;  1O08 A;  3C29 A;  5HHH A;  5D46 A;  3PO5 A;  4HAI A;  3ZDD A;  3JPP A;  3PY8 A;  5J8Y A;  3PVX A;  1Q3V A;  8ICR A;  5ALU A;  4YQW A;  4NV0 A;  2YMP A;  1X42 A;  4OJ5 A;  1RQL A;  4PJ0 U;  2R8J A;  5FP0 A;  1PVR A;  2K8C B;  1PK1 A;  2XC9 A;  1LKY A;  3PO4 A;  1KDH A;  3HPO A;  2XCA A;  4NLC A;  2LM1 A;  4BX9 C;  4KLH A;  2AGQ A;  4DF8 A;  3PML A;  1BPX A;  1YT3 A;  2GO7 A;  2D6F C;  1ZQK A;  5KG0 A;  1Z4N A;  4DSJ A;  4IR9 A;  2NRT A;  2H3Z A;  3V6J A;  4I2I A;  4F4X A;  2JRZ A;  9ICL A;  2G5H B;  2XGP A;  1BPY A;  4O5K A;  2DFL A;  3TI0 A;  3PSI A;  1WG8 A;  2Q4T A;  5DG9 A;  4KN4 A;  1B43 A;  4DSL A;  2WHE A;  4MEX A;  2R8G A;  4KLE A;  4KX5 A;  4ED3 A;  2ZTC A;  5KFA A;  4QZH A;  5L1L A;  2W3R A;  4EBC A;  5HNK A;  5ALI A;  1BNP A;  2KZ3 A;  1PVP A;  5EE0 A;  4GXJ A;  3AQF A;  1RXV A;  5D49 A;  2A3V A;  1NZP A;  2MUT A;  2R8I A;  1L6N A;  2DPJ A;  4MEY A;  3SQI A;  4I2F A;  4DWI A;  7ICL A;  3LWL A;  4Q8E A;  4FE3 A;  3FAH A;  2EZX A;  2XVT A;  1KEJ A;  4B9M A;  5DQH A;  4QWB A;  1X9S A;  3AU2 A;  4Y2J A;  1QTM A;  9ICE A;  1SXD A;  5ALH A;  2YX8 A;  2WTF A;  2IOH A;  2DF4 B;  5J2G A;  3F5A A;  4M2Y A;  2K4H A;  4O3P A;  4F4Z A;  2ESE A;  7ICM A;  2YML A;  8ICW A;  2BQ3 A;  3EPI A;  5KFI A;  2WF6 A;  1ZJM A;  1D9D A;  3PMN A;  3SAH A;  4US9 A;  2FMS A;  1Z19 A;  2J6T A;  2WAQ F;  4DFD A;  1ZQI A;  4MHV A;  1ZQM A;  4DL5 A;  3QZ7 A;  1X40 A;  2LM4 A;  1JRO A;  2ZIX B;  4RQ3 A;  2ASJ A;  4IRK A;  3F53 A;  3O0F A;  1ZRM A;  8ICQ A;  5J2F A;  2AGO A;  5ALS A;  4TUR A;  4DS5 A;  1TAU A;  1RPL A;  4YD1 A;  9ICR A;  5IIL A;  2IBK A;  8ICZ A;  1L8L A;  1X2I A;  3S6J A;  5KFL A;  3IP4 B;  3H0R B;  4OD0 A;  3SAG A;  2LI6 A;  1XNS A;  2HCF A;  1NI3 A;  3E0F A;  2CN1 A;  4NLB A;  4XUS A;  5KFE A;  4JMU A;  3HP6 A;  4DQQ A;  4ELT A;  1SB3 C;  8ICC A;  1ZQF A;  2XID A;  4RQ7 A;  3EPG A;  3AU6 A;  3IRU A;  2KJ8 A;  3ED5 A;  4C4T A;  2MRL A;  5L9X A;  4JWM A;  1ZOL A;  4F91 B;  3IM1 A;  5BOM A;  4YXM A;  1MQ3 A;  1HUO A;  4EX6 A;  4AYB C;  5JRT A;  2LPE A;  1NZB A;  4EZ6 A;  5D4B A;  4DCC A;  2KMD A;  1S0M A;  2BCQ A;  3I28 A;  5EWF A;  2YTU A;  5ALX A;  5BOL A;  2ZIX A;  3RH6 A;  4C80 A;  1S0N A;  3G6V A;  3EYZ A;  3GIJ A;  3A0H U;  1Z3E B;  1PZN A;  5CRX A;  5IIM A;  9ICF A;  1N56 A;  5AI0 A;  3VCB A;  2PFQ A;  3RBD A;  3OHA A;  2D3D A;  5AKG A;  2VKQ A;  3M6Z A;  5IIN A;  1OXJ A;  4EBD A;  1L3V A;  3FDS A;  1ZQV A;  4QZI A;  4ECU A;  2E8M A;  1JN3 A;  4OJ6 A;  4XA5 A;  2FMP A;  2UVR A;  3NVW A;  3K4G A;  5DDM A;  2XY7 A;  4JB3 A;  2CRX A;  4UAZ A;  4GC7 A;  1KSP A;  4M9N A;  5TIS U;  5EE3 A;  3Q8M A;  1SKS A;  4F72 A;  3KBB A;  4KMU A;  2KVS A;  4Y2U A;  4UAR A;  2KOB A;  3SEI A;  3M9M B;  3GV8 B;  2LYB A;  3C2K A;  1UQV A;  1TFR A;  4RQ0 A;  4J9S A;  4KLM A;  1SZP A;  4KIT B;  5AKX A;  8ICN A;  3RR7 A;  4GC6 A;  5BPC A;  3H0L B;  2PI4 A;  2GOL A;  3OTQ A;  4ECS A;  2H3I A;  2E3T A;  1NJY A;  1NKE A;  3C23 A;  3NUQ A;  2F8L A;  3L5K A;  5IIO A;  1S5L U;  1HEK A;  2DL0 A;  5EE1 A;  4EYI B;  5AI5 A;  4F93 B;  2KFZ A;  1T8E A;  5EWG A;  1ZQS A;  4FBU A;  2F1H A;  1PK3 A;  2AU0 A;  5J2B A;  2BCS A;  2YMM A;  2XIC A;  2G06 A;  4UBB A;  3PZP A;  4UBC A;  3RB4 A;  3T79 A;  2YMQ A;  5J2J A;  1YZ6 A;  5IIJ A;  1MA7 A;  2QB0 A;  3RJJ A;  3BDP A;  5H2F U;  1TK5 A;  5AM4 A;  5KT3 A;  2XY5 A;  3BS5 B;  1L7O A;  1KTQ A;  4PHE A;  3TKA A;  4TUS A;  4B9V A;  4JUZ A;  2WF5 A;  1QQ6 A;  1DRG A;  3PX4 A;  4IRD A;  1HUZ A;  3PX6 A;  2BPF A;  4O5E A;  2HVI A;  7ICR A;  1TAQ A;  1N60 A;  3ONN A;  4Z6D A;  2WAQ C;  1QSL A;  3PW5 A;  5ALY A;  5AM1 A;  1IXR A;  3EW9 A;  2OXO A;  1KRP A;  4DOA A;  1NK5 A;  4MFF A;  1F44 A;  2D8C A;  3ETR A;  5KFS A;  5CEH A;  4KLF A;  4ELU A;  2JGA A;  4XQ8 A;  2W9C A;  5AIB A;  2XY6 A;  1N61 A;  3AMZ A;  1TK8 A;  5CJ7 A;  3PW4 A;  3TAD A;  3K1R B;  5AI4 A;  3CW2 C;  2HW3 A;  2HHX A;  2ISP A;  5AM3 A;  1Z00 B;  1BPE A;  5DLF A;  1RQN A;  2KE7 A;  4GFJ A;  4ECR A;  1UA0 A;  2IHN A;  1U4B A;  1QQ5 A;  1WUD A;  5CR0 A;  4DLG A;  2VJ5 A;  5KFR A;  3H4D A;  4KLS A;  4RQ4 A;  1SZH A;  5KFZ A;  3V7L A;  4Z6E A;  3RF9 A;  5CHG A;  4J9O A;  4QZB A;  1TV9 A;  3KD3 A;  2J6S A;  2JH7 A;  4QWC A;  1SWW A;  7ICH A;  2HI0 A;  3V6K A;  5J0X A;  4ED8 A;  2WF8 A;  2HOQ A;  4YN4 A;  5AKK A;  2QAR B;  4RUC A;  1L3U A;  5J2H A;  9ICP A;  1UT8 A;  2WFA A;  4BDP A;  2C28 A;  4DSE A;  3IG5 A;  4F2S A;  4KX3 A;  3HKZ C;  4B6J A;  3RRH A;  4M9G A;  3TAC B;  3G6Y A;  1L8O A;  5J2I A;  3H8W A;  3MR2 A;  5DLG A;  9ICX A;  1HJP A;  2UVU A;  4QZC A;  5ALE A;  2BCR A;  3RH5 A;  2W9M A;  4F3O A;  2ZUC A;  4DQR A;  4QW9 A;  7ICJ A;  2B0C A;  1ZQO A;  3C2L A;  4M9L A;  2EAO A;  5ALG A;  3QUQ A;  1BGX T;  3M8R A;  9ICS A;  4MF2 A;  2W9A A;  5C5J A;  1D8B A;  1RYR A;  2WF7 A;  4F92 B;  4F5N A;  4CF3 A;  2IA6 A;  3C5G A;  3M9O B;  4YMO A;  3NAS A;  2XCP A;  3M1Y A;  4YCX A;  3EWA A;  4RQ5 A;  1ZD3 A;  2BDU A;  4Y2X A;  2VA2 A;  2QAR A;  5J0O A;  4UAT A;  2KIC A;  2KP7 A;  4FS2 A;  2OH2 A;  3V7K A;  2C22 A;  2ZG6 A;  3RJI A;  1QSS A;  5EE9 A;  1JX4 A;  1X66 A;  3GU3 A;  2KK0 A;  4RPY A;  4QWE A;  1RDF A;  4TQS A;  3CP8 A;  3KZX A;  1MQ2 A;  3GQC A;  4I2H A;  3RJH A;  4F50 A;  3NVY A;  2ATL A;  2BPG A;  5ALP A;  1ZD5 A;  4QIW F;  3AN1 A;  2AHO B;  4M47 A;  3QNM A;  3MFH A;  4PL1 A;  2R18 A;  3MDA A;  4ED0 A;  3QU7 A;  2EDU A;  5J0S A;  3AUO A;  5KFV A;  5DGB A;  4ACO A;  3RJG A;  4EEL A;  4JV0 A;  3RJF A;  2QB1 A;  4PL2 A;  1RG6 A;  3WK5 A;  3QUT A;  1S10 A;  4ECW A;  2WB1 F;  4J03 A;  1C7Y A;  1F5S A;  1FFU A;  2XI9 A;  4DL4 A;  3Q8K A;  3SZ2 A;  4I2E A;  2HDO A;  4F4K A;  5ALF A;  2KG5 A;  3HWT A;  4ECV A;  3QEB Z;  1FIQ A;  2EAN A;  7ICO A;  5DDY A;  3PSP A;  1GO3 F;  2K4I A;  5CA7 A;  1NJZ A;  4KLI A;  1ZQJ A;  1XWL A;  1ZQG A;  4DL3 A;  3SD7 A;  9ICU A;  2FPL A;  7ICV A;  1NK6 A;  2E8P A;  1K5O A;  4UAY A;  2BGW A;  3N7R C;  5KT4 A;  3UXO A;  4KTQ A;  5CWR A;  4Y2R A;  4M6W B;  4RQ2 A;  3OJS A;  1UHU A;  2A1A A;  5AK4 A;  4CGZ A;  4J9L A;  3C5F A;  1TAM A;  5KG4 A;  5AKJ A;  2IHM A;  1KFS A;  2Q0Z X;  1SWV A;  1Q3U A;  2ZUB A;  3N7S C;  2PMZ F;  4O9M A;  3V7J A;  2JH1 A;  3N7P D;  4KLJ A;  5KFX A;  1U9L A;  3ALR A;  5GTH U;  2DBY A;  2ES6 A;  2RDJ A;  2F44 A;  5GTI U;  4NM1 A;  2VIX A;  1XS9 D;  2PFN A;  1SL1 A;  3MGV A;  2ZTE A;  3SEN A;  2KNJ A;  3E58 A;  4P0P B;  1PUZ A;  4PGX A;  4O3N A;  8ICV A;  2FLL A;  3AEV A;  1KN5 A;  4LJX A;  2I1Q A;  4CE6 A;  5ALN A;  4NL9 C;  4UB1 A;  5KG6 A;  4YMM A;  3LWM A;  4I2C A;  4UB5 A;  3TAP A;  2F2A B;  3SAF A;  3KKA C;  4DSF A;  2VA3 A;  2BCV A;  4DSK A;  3KZI U;  3H0M B;  1DK3 A;  4KLQ A;  1MSW D;  9ICJ A;  3RFA A;  4JWN A;  3WK9 A;  1Q8K A;  1NKC A;  4C8L A;  1X9X A;  4PPX A;  2Y0S F;  5DB7 A;  4UAW A;  3UXP A; 
#chains in the Genus database with same CATH homology
 1QCK A;  2EZY A;  1CI4 A;  2ODG A;  2BZF A;  2EZZ A;  2EZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...