3THVA

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddatp-dt in closed conformation
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
579
structure length
579
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 201
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3thvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3thvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3thvA01
3K5LA 1JX4A 1SUQA 3T5KA 2IHNA 2KZMA 4FVMA 1RBVA 2FLPA 4R66A 4OGCA 9ICCA 4GVMA 5C42A 2P6RA 3OJSA 2F8TA 4DTMA 3LP2A 4KLQA 3SUQA 5DQIA 2PFQA 4DTSA 3RJEA 5F9LA 1ZQPA 3V1OA 4FK2A 4KHYA 2D0CA 4I7FA 3T5LA 3FYHA 1RPLA 4KLHA 4W5OA 1D8YA 1W0HA 2FPLA 8ICSA 2IS3A 3SUPA 4IRCA 1RDAA 3B0YA 4QZBA 5KFJA 3IS9A 4IFVA 4OVLA 4Q44A 5HP4A 3K4GA 1RDBA 3AU6A 4Y1CA 3SQ2A 3SQ4A 1NJWA 5KFDA 1ZQDA 8ICZA 4QZCA 4XQ8A 3VQ5A 4CK3A 4KB1A 3RBDA 4F3OA 1J54A 3RBEA 4ELTA 3ZT4A 9ICIA 3TFRA 3O4QA 3U6FA 3OYAA 3QIOA 2NRTA 1BL3A 1JLBA 4RQ2A 1PZNA 4FXDA 2DFEA 3LWLA 9ICNA 4RW9A 4RQ4A 2O4GA 3PUFA 3RMBA 1TGOA 3DYAA 3MEDA 2R8HA 2XY5A 2C28A 4KLMA 3TAPA 2BKEA 2V9WA 4Z4EA 2BCSA 4KHSA 2KN7A 3BQTA 4QWCA 2OPQA 1VSFA 3EY1A 4KKOA 2PI5A 4OLBA 5CWRA 4FM1A 3B6OA 3MEGA 3C2LA 2XRIA 5KT6A 2HHQA 5J0SA 1SL0A 4CJEA 3RB0A 4GXKA 1TK0A 4E7LA 4ZTFA 3N97B 5J0WA 4CGFA 3DLEA 1EETA 5KFXA 4FYDA 4QZGA 2ATLA 5L9XA 1EP4A 2ITGA 1A76A 4R8UB 1UT8A 4OPJA 2FLNA 1XO1A 4BDZA 4IG0A 3AVIA 2P5OA 1BIUA 1IG9A 3OYJA 4F5PA 3AO2A 4R8UA 5DB8A 1XI1A 5CZ1A 9ICLA 4RQ5A 1ZQCA 4KRFA 4XRHA 3QEPA 3RJJA 2KZZA 4KTWA 3OYKA 9ICPA 3SYZA 1X2IA 5L1KA 3DRRA 3KLFA 4CJ4A 5DQHA 4B8CA 3OYBA 4DU4A 1ZQNA 7ICUA 5CHGA 4JK1A 4NY8A 1Z00B 4PA1A 1RTHA 2PFPA 7ICTA 2J6UA 1ZQQA 5KG2A 3PW7A 3OYEA 2ZD1A 1Z00A 1Z25A 4CK1A 4CHZA 2F1IA 3F9KA 8ICCA 3ZDBA 3RAXA 3LZIA 2DFFA 4KLUA 1ZQFA 5EWEA 8ICTA 2I9GA 1JLQA 3AVNA 4FZZA 4IDKA 4J9MA 4LVSA 4M9GA 4BE0A 7ICNA 3S3OA 3TFSA 2M9NA 4I2AA 2ISOA 3GIJA 5KFZA 3C2KA 2GV9A 1KEJA 5I3UA 3ALYA 4M3RA 4HCCA 1QE1A 3M9MB 3NF9A 2FMPA 2BQRA 9ICUA 1RNHA 3HVRA 3ZSQA 4DWIA 4FBTA 9ICRA 1BPZA 3IG1A 2ZQBA 3N4MB 2C22A 5IIMA 4PY5A 2B4JA 3AA2A 4FZYA 4NLNA 1UAXA 5DDYA 1ASVA 2JLEA 2X74A 3HT3A 3V1QA 1T4GA 4F8RA 2F96A 2ZE2A 3DOLA 4OJRA 4TSXA 3MDCA 4TUQA 2YKMA 4IFYA 3RH5A 3DLGA 4M3TA 4I2PA 2KFNA 1JXEA 1BQNA 3Q8RB 3BGRA 3OYCA 4FLXA 5J29A 4NLGA 4P4PA 3HW8A 3L2VA 1ZQOA 4BACA 3L2RA 3OYGA 4IQUA 4PWDA 3QERA 3UQ2A 2Z1JA 2VG7A 3TWHA 1A5VA 4CCHA 3P83D 2RKIA 1S0NA 2FBTA 2J6TA 4DQRA 3LALA 4RQ3A 9ICEA 1B92A 5DB6A 4F93B 4FM2A 4CJFA 3RTVA 4B9TA 5HLFA 3MAQA 2D0BA 3V7LA 3RJGA 4CJRA 5JS1A 4Z4HA 5SWMA 4HVJA 1S6QA 2IAJA 2YHBA 5C5JA 4DTXA 3UIQA 3ZT3A 2V4RA 3SPZA 3E2EA 4DG1A 4F2SA 5J0PA 1X1PA 3ISNC 4DSJA 1S0VA 3RJHA 3L3VA 4RQ7A 1IM4A 4DQQA 4CJLA 4MF8A 3PW0A 2BPFA 4QW8A 2GBZA 1Y97A 4I2HA 3MGHA 1TKTA 1RT4A 1GOAA 5FRMA 2R8GA 4O0JA 9ICOA 8ICQA 3DLBA 3ZSOA 1MSWD 3AO5A 1XSPA 1KCFA 2BCQA 5KTQA 4CJTA 2FMSA 3ZCMA 3ZSZA 3PR4A 2YNGA 4LD0A 3PY8A 3C1YA 3HVTA 4MFCA 4P2HA 3HXMA 4DQPA 3RWUA 4CJKA 1NK8A 3LANA 4OKJA 1ZQLA 4FJNA 1B9DA 3CM6A 4MF2A 4RW4A 4W5TA 1QS4A 1L5UA 1BPDA 2VA2A 3K2PA 2P51A 5KG5A 4ID1A 2KW4A 1S10A 5KG4A 1WCNA 4IKFA 5KFKA 5FDLA 3G0ZA 5IINA 4XA5A 2IA6A 1DLOA 1Z26A 3C6UA 1TFRA 4YFUA 5KFMA 3MDAA 3H4DA 4O5CA 5HROA 4UBBA 5SZTA 3MXJA 4FM0A 1ZBLA 1DGSA 3E01A 1YTUA 2MAXA 4DSIA 4Q43A 1NJYA 7ICSA 4KFBA 1ZQAA 3Q8LA 4ECVA 3ZDCA 3K5NA 4GLXA 5HNKA 4C8NA 5CJ7A 1NKBA 3GIKA 1ZQHA 4YR3A 1REVA 1KTQA 2Y1IA 4M9HA 1NJZA 3C23A 4RNMA 1U49A 4BWJA 3HL8A 1NJXA 2MUTB 4CEDA 2G8FA 1C1CA 3QZ7A 3AO1A 1BPBA 2DFHA 4I28A 4JS4A 2MUTA 4PHEA 4DTOA 2G8UA 4G3IA 5HMMA 4O3RA 1BCMA 5JS2A 3PX6A 2IGIA 3NTUA 4LZDA 4DQIA 4F91B 3LPTA 1X9WA 4BDPA 2BCVA 4LSNA 1WAFA 3GQCA 1VSDA 4BE1A 1L3VA 4FJMA 5DBAA 4F5OA 5KFYA 1ZQZA 4YP3A 1QSYA 4KLLA 2VG6A 1LWEA 4OKKA 4GXJA 4J2AA 3KHLA 3IRXA 5J0XA 3NF8A 4PGYA 2ALZA 4CHNA 1TKXA 2QKBA 5CA7A 4DO9A 3EYZA 3V9WA 4FO6A 3VQ8A 1XHZA 4J2BA 2W9BB 4FLZA 4QWBA 3M8QA 5KFLA 1HJRA 2W9BA 1RILA 3UXNA 1U04A 1ZQWA 4FZXC 3EWAA 1A5XA 1S9GA 3VQDA 5J2HA 1ZQEA 4QZDA 4UQGA 1RBSA 4LSLA 2B21A 4C8LA 4JRQA 5HHHA 2ZTDA 3ZSVA 3SZ2A 1ZQUA 9ICVA 3L2QA 3IHQB 1Q8IA 4JV0A 1KLNA 3QIPA 4G1QA 1BVSA 4JWNA 3QEVA 4QCLA 1RDDA 3THVA 1S9EA 1TK8A 4B3OA 4EP4A 4EP5A 4K4IA 1ZQGA 4Q8EA 3UXOA 4F4WA 2VA3A 4QWEA 2UVRA 2OWOA 4BWMA 3HPOA 4I2GA 4ECSA 4CECA 1L3TA 2PXIA 1ZQSA 4KHQA 7ICPA 2HNYA 2BQUA 1JLFA 5C25A 5KG6A 4M9NA 4DSEA 1QQCA 1WSJA 4ELVA 5DG8A 3CFPA 1C0MA 1JIHA 1TV6A 3JYTA 1C7YA 4KI6A 5DB7A 4J9NA 2XY6A 1D5AA 1JLEA 4RW8A 4ED2A 1RXWA 3ISCA 4E89A 4UB5A 3CYMA 2PI4A 2X78A 1N6QA 2ETJA 1RT1A 1BIZA 5J2MA 4IRDA 5J2QA 5DMRA 4O5KA 5KFPA 2P66A 1HYVA 1RYSA 3KHRA 2ASLA 4J9PA 3Q8QB 9ICFA 1B9FA 1NOMA 4MEYA 3PR5B 4K4HA 3QESA 2NRZA 4FJ8A 3L3UA 4DSFA 4RQ8A 9ICKA 4YD1A 1BQMA 4KN4A 2V4QA 4M3UA 1DOQA 4DTNA 3KD1E 3T5HA 3LP3A 2OA8A 3GILA 1KDHA 1D9FA 4PUOA 2XGPA 4N56A 1VK0A 9ICWA 1ZBFA 4NCGA 1YTAA 2P1JA 3C1ZA 4O3QA 1DTQA 4ELUA 4CEOA 3DM2A 3C94A 2E4LA 4E1MA 5KT7A 2HHTA 4CF8A 4M2YA 4M41A 3PX0A 3LDAA 4DU3A 2I5JA 1S1WA 8ICOA 5KGWA 3SV4A 2BDPA 9ICGA 4FLYA 2R7YA 5DQGA 3P5JA 4KLGA 5KFNA 2E6MA 3VQPA 3RR8A 1HYZA 1H38A 1RT2A 3BQ1A 4YFKA 3V81A 5J2IA 3HP6A 5J0RA 1WSFA 2JEGA 4PGQA 3RRHA 3WNEA 4M3ZA 4ID5A 2J6SA 3G6VA 3QEWA 3TAGA 1S6PA 1HPZA 4RPZA 3MR2A 1S9FA 4UB2A 3WNGA 2PYLA 4PQUA 3OJUA 1TKDA 4KI4A 3AO4A 4R63A 3T1AA 1JLAA 4J2DA 1NKCA 4DSKA 4OKEA 1C1BA 4KLSA 4KLEA 2W9MA 4JS5A 5KFQA 4CEEA 1SV5A 4QZ8A 2C2RA 2OPSA 4ECYA 2Z1HA 3SNNA 3AVHA 1T03A 4QZAA 5C24A 5KFCA 1XU4A 4DOAA 4IQTA 2A1SA 1HQUA 4GXIA 4CF1A 5CP2A 1IH7A 2HW3A 2OYQA 3PV8A 3MR3A 2VWKA 3LPUA 4ECZA 4E1NA 1WLJA 3ZT2A 1G15A 2VWJA 2UVVA 4RPXA 3MFHA 4RZRA 3CG7A 3LP1A 4ED6A 5HP1A 3OYDA 2ZTCA 3H4BA 1BISA 1JLCA 3AVMA 4NM1A 4IR9A 4FLUA 5KFVA 2A1RA 3M9NB 1RZTA 2JEIA 4NCAA 1HRHA 3K59A 1S77D 3G6XA 5DKWA 1RTJA 3OYMA 4YN4A 1UT5A 4CGJA 5CYMA 8ICEA 3TAMA 4N5SA 4PHPA 3A2FA 4QZ9A 4UBCA 2ASDA 4I2QA 2XC9A 4BE2A 3QEAZ 4YVZA 4CESA 4RNOA 1X9SA 3TQ1A 3Q8PB 4TQRA 3C5GA 3BQ2A 3TAQA 4UAYA 3C5FA 5J1EA 3V9UA 4IRKA 4CE9A 2YNIA 4DEZA 1BCOA 4HUGA 1KRPA 3ULDA 1C1AA 1YVUA 1IKXA 2XY7A 2KFZA 3JPOA 2G8KA 5CYQA 1NOZA 1RDCA 4KV8A 5HRRA 5HRNA 3QNOA 1EKEA 3AUOA 3OYHA 3ZT1A 2XY8A 3GIIA 3M8PA 1B22A 2RF2A 4CIEA 4RUCA 1V9PA 5CZ2A 4ED0A 1S1XA 4PH5A 1VRUA 3LK9A 3OHAA 3V6KA 3I8DA 2R8KA 2BCUA 5J2BA 2BANA 2DTUA 3AVJA 3NFAA 4O3PA 5KFWA 4FJKA 2KTQA 4ED8A 2UVUA 8ICJA 1VSLA 3MABA 4CHOA 3OS0A 4I9QA 4CJWA 4Z4FA 3RJIA 1NK9A 1WSEA 4K8ZA 3HPHA 1ZBIA 3SV3A 4M0AA 2GUIA 4CEFA 1HMVA 4C8KA 4FJLA 4H4OA 3DLRA 3NGZA 4FLWA 4DL3A 4TUPA 2FLLA 3NF7A 3V7KA 2ISPA 5EWFA 3MEEA 4LZGA 4OPKA 3KJVA 1RYRA 1U45A 4DL6A 3FDSA 2E6LA 4CGHA 2XGQA 1VSMA 4E7IA 3PW2A 3S3NA 4B9LA 3EZ5A 9ICHA 9ICXA 1U48A 4KO0A 5DGBA 2G8HA 1TL1A 2QKKA 4ED3A 4QOZB 1VSJA 5D3GA 1CXQA 7ICGA 2OZSA 4JWMA 3NCIA 3TAFA 1MC8A 5KI6A 1O1WA 3B0XA 1XS9D 1RT7A 4O44A 2XCPA 1QHTA 1GOCA 2ATQA 4LY7A 5IIOA 4MFFA 2D0AA 3M8RA 2FBXA 3MXMA 1HQEA 5KFIA 1XC9A 5EU7A 4I27A 3CFRA 4CEQA 3SPYA 4YQWA 3VQ6A 3PX4A 1W9HA 2F1HA 4Z4CA 4CFAA 1T7PA 3G10A 3TANA 4E0DA 4RW7A 5J2DA 3H08A 1U47A 1XWLA 1S0OA 1LW0A 4RQ0A 4F4XA 2G8VA 4DTJA 1BHLA 4FW1A 3LDSA 2YNFA 1L3SA 3IM1A 3SI8A 3NF6A 2RDIA 4E7HA 4FJ7A 3BDPA 1MQ2A 3NHGA 4CF9A 4DLGA 3MFIA 4RNNA 1BPYA 4M3XA 4RU9A 1R0AA 1JMSA 4DOCA 1D9DA 4EZ6A 3KK2A 4QWDA 4FS1A 3AA3A 2G8IA 3V7JA 2I1QA 3BQ0A 2OZMA 4FJ5A 2W9AA 4X5VA 3QEBZ 4CGGA 4F92B 3CM5A 3SQ0A 4EBDA 2FPKA 1WSHA 3KLEA 2NRWA 4I2IA 4JRPA 5KT3A 2Q0ZX 1TV9A 2YNHA 2FPMA 3HX0A 3KLIA 1S5JA 1IXRA 4YR2A 1RCHA 1ASUA 4M6WB 3GIMA 4ECQA 4B9VA 3ZT0A 5L1IA 4R65A 1RXVA 1CZ9A 1VRTA 2Q3SA 4M6WA 3QO9A 3SUNA 3FFIA 4DQSA 2F1JA 3M8SA 8ICGA 4B9NA 1FKOA 4YXJA 2YKNA 2Z1IA 3H8WA 2EX3A 4KN7A 4TURA 3WNFA 4W5RA 4O0IA 3AV9A 1VSHA 8ICFA 2HVIA 4PHAA 5JUMA 2R8JA 3RMCA 8ICNA 4Z6FA 2HHUA 4ZHRA 1HNIA 2A1JB 3ZSXA 2IHMA 4CJ3A 3MR5A 3Q8SB 1I39A 2HNZA 4IQVA 4NM2A 4J9QA 3NGDA 1COOA 2NRXA 1NKEA 4M47A 2A1JA 2C2DA 1NK0A 4CJ5A 4ZTJA 4O4GA 4UB1A 4CEZA 4UB4A 4P4MA 4EYIB 4QWAA 3QLHA 4B9UA 1U9LA 2B6AA 4RQ1A 1ZJNA 4LH4A 3L2WA 1FKPA 5BOLA 3T5JA 1SZPA 1TKZA 3U3GA 4J2EA 4DFMA 4CHQA 5DDMA 1C0TA 3SJJA 5HHIA 1ZYQA 3AA4A 4CFDA 4K4GA 3O3HA 4F5RA 3K57A 3D0PA 4B9SA 4O3SA 2OPRA 2FC0A 3KIOA 3KKRA 4M45A 1WN7A 8ICWA 3OY9A 4DL5A 4M9LA 8ICAA 4CJQA 3JPQA 4DF4A 3OYFA 4KHNA 3IAYA 4E19A 5IIJA 1GOBA 4GC7A 5KFFA 1Z3EB 5J0OA 1J9AA 3RJKA 3ETLA 8ICUA 1ZETA 1VSIA 5KFUA 3SUOA 2ZTEA 1EXQA 4CEBA 2PZSA 4QZIA 1K1QA 2QK9A 2DFLA 4N47A 4C8OA 5FRNA 2C2EA 1RBTA 3HJFA 5J2KA 1RT5A 3QE9Y 3ORYA 5J0TA 2FMQA 3KTQA 1J53A 2HNDA 8ICKA 5KGXA 1TL3A 5J2EA 3KHHA 1KFSA 4ECRA 1CUKA 4F5QA 3ZSWA 2AGQA 7ICKA 1BI4B 1TVRA 1SL1A 1CLQA 3JPSA 4FLTA 2UVWA 5J2GA 3DLHA 4XIUA 1UOCA 1XSNA 3U3YA 3ITHA 4CERA 5L1JA 4MFBA 5TZVA 4F50A 3K58A 2PY5A 4Z6DA 1HUOA 4QW9A 4ECWA 4N41A 1TAUA 4RT2A 4KHWA 4CIGA 1ZQYA 1N48A 4IR1A 3KKSA 4DTUA 1CXUA 4DS4A 4GC6A 2BCRA 1EX4A 4B8AB 4YCXA 4FCYA 5J0QA 1A5WA 1IKVA 4W5NA 2X6SA 1MU2A 4I2BA 2FBYA 4ED1A 4KPYA 2PFOA 4W5QA 3H7IA 3V1RA 1HYSA 3T3FA 3ZD8A 4OGEA 4YD2A 4QZEA 1A77A 4K8XA 5DBBA 2ASJA 3AVBA 5T7BA 4CK2A 3WNHA 4B08A 5FROA 4Q0BA 3VQCA 3ZSRA 7ICVA 1IKWA 3PNCA 2FBVA 3KD5E 4PPXA 3RH6A 3AVKA 1LWCA 3NBPA 3MECA 3DRSA 4HTUA 9ICTA 3GV7B 1NK5A 7ICMA 3VQ7A 2BGWA 2HHVA 4IQWA 1SL2A 7ICEA 2NRVA 2G8WA 2AGOA 2AU0A 1WNSA 4AILC 4JLHA 3S9HA 5F9NA 5HBMA 1EXNA 3NGYA 3HO1A 1S1VA 5KFRA 4Z0UA 4KREA 2LYHA 1C6VA 1ZBUA 2D5RA 1KFDA 1ZQRA 4ICLA 5KFOA 2AGPA 1CZBA 3KK1A 3D45A 3VA3A 1NK7A 4AHSA 2JZBB 2BHNA 4FS2A 8ICMA 5CR0A 5J2JA 9ICQA 1F21A 3AA5X 1VSEA 1QSLA 2JZBA 5DLFA 3ZDDA 1QSSA 4O3OA 4KLTA 3C2MA 3LZJA 3RRGA 8ICYA 4WE1A 3QINA 3L8BA 4FJ9A 4M04A 5CY4A 3PO4A 8ICBA 4CIFA 4O55A 4NLZA 3I0SA 1JL2A 4AHUA 3OHBA 4Z6EA 3VQ9A 4QAGA 3JPTA 4ECTA 4Q5VA 7ICFA 4FJXA 5KFHA 1BPEA 3HM9A 5DG9A 2O4IA 4J9OA 3SQ1A 1FK9A 2ZJ5A 3GFKB 3PMNA 3V72A 3TABA 2VANA 4YMMA 1T8EA 4HUFA 3OYIA 4JUZA 8ICVA 3TR8A 5DG7A 3VQAA 3F73A 4OLAA 2DPJA 5HMLA 2P6UA 3TI0A 4J9RA 5J2PA 3VN5A 4KHUA 3MBYA 3RAQA 2ZUCA 2BQ3A 5KG3A 4JV2A 2P5GA 3NH0A 3JPPA 2Z1GA 3ZDEA 5KFTA 2WONA 3G6YA 4CF0A 4QZHA 4CJSA 3QEXA 1TK5A 1JKHA 3OSNA 2XCAA 2LSNA 9ICMA 1JXBA 2BPCA 5IIIA 4PHDA 3PW5A 5DB9A 2ZUDA 1KVCA 4F3TA 5KFGA 1VSKA 2JGUA 3H40A 3DRPA 2IMWP 2XO7A 2QXFA 1B43A 3GV8B 3RR7A 4AHRA 4Z4IA 4KTQA 3VA0A 3OYLA 1XHXA 4CJVA 2X6NA 1HNVA 3L2UA 4Q45A 7ICQA 3LAMA 2BE2A 4DOBA 1ZJMA 3RB4A 1RT3A 3H8JA 3UPQA 2VA8A 1CEZA 2ZJ8A 3H8SA 4FW2A 5D46A 3AVFA 2KZ3A 5J0YA 5K14A 4HUEA 2F8SA 3ZSYA 4ECUA 3NDKA 3LAKA 2DY4A 4FBUA 4DTRA 1BPXA 3HK2A 4CFBA 4RT3A 4JV1A 3QNNA 1AROP 4XUSA 4J9KA 4AH9A 2IDOA 3K75D 5KFSA 1KVAA 1K1SA 4NYNA 4DF8A 2W42A 3HSTB 4NCBA 1T3NA 4Z4GA 8ICLA 1WSGA 3AU2A 4RPYA 3AVGA 4YMNA 4CEAA 5IIKA 5BPCA 3AVAA 4KTZA 4O3NA 1ZQBA 4IG3A 4KLDA 4DFJA 4EYHB 5L1LA 3PMLA 3SI6A 3UXPA 5BOMA 4KMUA 1HUZA 4CGIA 3VQ4A 5D49A 5DK5A 5IILA 2PYJA 3DOKA 4DTPA 4I2CA 8ICXA 3KLHA 1IO2A 4KLOA 3HWTA 7ICRA 1ZQTA 1LAVA 4F2RA 4I29A 1T05A 4FJHA 4EBEA 3EPGA 4MFAA 3OYNA 2DPIA 4RUAA 4IBNA 5EWGA 4M3YA 3PW4A 3ZDAA 3QETA 4CHYA 8ICRA 4TQSA 1ZQJA 5KFBA 1ZQKA 4HHTA 1NOYA 2Y1JA 1L3UA 2KQ2A 3C21A 4N76A 3OS1A 1XSLA 4LH5A 5J2AA 1LW2A 4FK0A 5J0UA 2HHSA 3CFOA 5KT5A 3VQEA 4DMNA 4DL4A 4I9LA 4KB0A 1KFTA 4CJUA 3S3MA 4UAWA 3DI6A 3V6JA 3TAEA 3RJFA 3TARA 2RDJA 5J2NA 3NE6A 1ZQVA 3PVXA 2R8IA 4EEYA 4AHTA 3LP0A 3SCXA 4R64A 1FXXA 1N5YA 4DLEA 2IBKA 5KG1A 3RMAA 2WOMA 2HB5A 4E3SA 3EPIA 1S97A 4KLJA 4L8RB 4NYFA 1ZQIA 4GMJB 2RPIA 3RB3A 1LWFA 3ZD9A 1RT6A 5D4BA 2IC3A 4FLVA 5I42A 2ZJAA 4EBCA 4ED7A 4RG8A 5J2FA 4BXOB 7ICOA 2H5XA 2EHGA 2BPGA 3AVCA 3VQBA 3K5MA 4E7KA 4KLFA 5HRPA 5DBCA 3P1GA 4BXOA 3V9SA 3VQQA 1ZBHA 3DMJA 8ICPA 1D8LA 3PO5A 4P4OA 4NXZA 3V4IA 5E41A 3T19A 4HCBA 3KHGA 4CF2A 1S76D 1KLMA 2W9CB 3NGIA 1JL1A 3HPGA 2RN2A 4M9JA 5HRSA 1ASWA 4J9LA 4F4YA 1KVBA 1SKWA 7ICLA 7ICJA 1ZQMA 2W9CA 1ZQXA 1JXLA 5KT2A 3GDXA 4DFPA 4RW6A 3KK3A 4YG2A 3C6TA 4QZFA 1IKYA 4DL7A 4UAZA 4O5EA 4KITB 2HVHA 1WCLA 1X9MA 3V6HA 3LWMA 5KG0A 4MQ3A 1QLNA 3V9ZA 3OVNA 2ZUBA 4CGDA 3JPRA 3RH4A 2HMIA 1RBUA 4M3WA 1Q9XA 4O9MA 1LV5A 1NK6A 9ICAA 1LB2B 3KLGA 4UB3A 1WAJA 3AO3A 2JEFA 2GWSA 3I0RA 3Q8MA 2AJQA 3CQ8A 2NUBA 4DL2A 2BR0A 4C8MA 1ITGA 5KFEA 4DFKA 1UA1A 4Z6CA 1C0UA 1S1TA 5KT4A 3O4NA 4O5BA 3OGUA 1Y88A 3MR6A 1S0MA 4I2FA 1MQ3A 2OPPA 4KAZA 2XHBA 3RB6A 3O3GA 4FK4A 4FJIA 4FJGA 1K6YA 4YR0A 3MGIA 3BJYA 4F4KA 4H4MA 1LAWA 4CJPA 2IOCA 4I2JA 3C95A 3UQ0A 4BDYA 4MEXA 4M42A 4AHCA 4I2DA 5KFAA 2VG5A 4YNQA 3Q8KA 4CFCA 3V9XA 4DSLA 1N56A 1TAQA 3JSMA 1S1UA 4FJJA 1UWBA 5EOZA 3DLKA 2B5JA 5KRSA 1JN3A 1TVAA 4ECXA 1U4BA 9ICSA 4GW6A 3NAEA 3AVLA 3QEIA 2PFNA 9ICJA 4F5NA 3K5OA 4BGDA 4H8KA 5KRTA 1I3AA 4Q8FA 8ICIA 2WTFA 3QZ8A 1SKRA 3ASMA 4J9SA 1NK4A 3HYFA 3NH1A 1RTIA 1BGXT 4HYKA 2AQ4A 1DTTA 4YXMA 3ISBA 5J2CA 2HHWA 3M9OB 9ICBA 2YV0X 1SKSA 3GV5B 2W8LA 2BGGA 3B6PA 2HHXA 1J5OA 8ICHA 1HJPA 2W8KA 3RMDA 3OS2A 1YT3A 3HP9A 3O3FA 1Q9YA 4YMOA 4KLIA 5KG7A 4PGXA 1UA0A 5DGAA 3NH2A 1KSPA 1BI4A 2AQ0A 1QTMA 4F4ZA 4RQ6A 7ICIA 4DS5A 4CHPA 4R5PA 4NLKA 2YHAA 4I2EA 4E7JA 7ICHA 3MXIA 3JPNA 3OSPA 1RTDA 1JLGA 5CB1A 4EZ9A 3EW9A 4TUSA 3ISDA 2JEJA 4AHVA 5DLGA 4DU1A 4Y1DA 3V6DA 4ZH4A 4B9MA 1RBRA 1WSIA
chains in the Genus database with same CATH superfamily
3EUB2 3K5LA 5C2DA 1SUQA 2IHNA 1H1VA 2IM0A 1NWKA 5M1OA 5C42A 2DNLA 1PO6A 1ITPA 3N01A 4V1Ak 4CT9A 4TYBA 5GAEI 1D1UA 4FF4A 3GFZA 4P2MA 3GIRA 1S4EA 1VR6A 3UE2A 4A5BA 2KHDA 5DQIA 2FC8A 4DTSA 4XDDA 2C3UA 5IWAJ 1E6VA 3IS9B 2DHHA 2E5HA 4IFVB 4WFAQ 3AD9C 2FPLA 4K4SA 5H9EJ 3GJQB 2IS3A 3KWIA 3D6RA 4QYRA 3DNCA 2YQ1A 1HWUA 4KHRA 2KKHA 5HP4A 3SAGA 3BZQA 3MMVA 2CADA 2K8AA 5KFDA 5T41A 3VQ5A 4XQ8A 5FLXO 2E1ZA 4F3OA 3KHYA 3U6FA 1J5EK 2JC1A 3QIOA 4ZPAA 1PZNA 4BJQA 9ICNA 1FESA 2K8GA 4RQ4A 3D1HA 3D6HB 3W5ZA 2UV8G 3K9KA 3DYAA 2R8HA 1CC8A 2V34A 4B3TJ 3TAPA 1KVJA 2ASYA 3GPAA 4KT0C 2QO3A 4ID8A 2M52A 3T9NA 4KKOB 5B7WA 2HDOA 4CJ7A 4OIXA 3UD3P 3SFUA 3TW0A 3BZKA 1H7XA 4Y2XA 2OPQA 1VSFA 2VASA 5E0OA 5D4OA 3O6QA 4OLBA 4FM1A 5M1FA 2PN6A 3B6OA 2L9DA 3MEGA 2B3TB 3C2LA 2HQIA 3EM1A 2V6AA 2ZBRA 3GSDA 5J0SA 4UY8T 2FIUA 3IWNC 1X9JA 2E88A 4USHA 3RB0A 4GXKA 1EP4B 5GADI 3VALA 4DV0F 1FJEB 2GELA 4FYDA 4NXMJ 3W2WA 1FFWB 1UT8A 2QLXA 1CPZA 4BDZA 4IG0A 2P5OA 4NXNK 2MHEA 4O3MA 5DB8A 1IBKF 2WSCC 5CZ1A 9ICLA 1XI1A 4RQ5A 1VS3A 4YB6A 3IG8A 3OFGA 1NJIT 3KLFB 2MLYA 2GJFA 1OMSA 4NMLA 4OI3A 3IP0A 2YN4A 4Z7CA 1MMNA 2ZJQQ 4X2BA 1OVYA 3B4MA 4OYWA 2JJ4D 3ZLJA 4BRNA 4CLLA 4JK1A 2HS4A 5ALYA 2ZJPQ 3D6TB 2LM4A 5AJ3K 2CXYA 4L74A 5E26A 1Z25A 4M5IA 3S6JA 4CK1A 4CHZA 3CJ0A 1DXSA 5HP1B 2F1IA 5A0YA 5AQVA 5B0GA 4C80A 1OYDA 3LZIA 2J7UA 4JP8A 3MCNA 1I6JA 2I9GA 1JLQA 2KFYA 2DEIA 4FZZA 1RTJB 2V8HA 4TNOA 2UXBK 5IQQA 4LFAF 5ALVA 1YDLA 3IFEA 4ZP8A 1PAEX 2DGQA 3Q86A 1GLCG 2VJ5A 3C2KA 2GV9A 4LIRA 1UZDA 1Q1KA 1RLCL 3ALYA 5AQUA 3K1RB 5H9FJ 3NF9A 2CAJA 4DV5K 1NEEA 4GV6A 4DR6K 1TUVA 3J8AA 3MUVP 4BBYA 4C0HA 9ICUA 3QICA 1UVLA 1RNHA 1WB9A 3RGIA 3WQTA 2J9DA 4KIAA 1MMDA 3IG1A 5KNIA 4Y65A 1F9HA 4CD3A 5IIMA 2B4JA 4ZKAA 4FZYA 2CA9A 5B0AA 5AQRA 3CJSA 4UQTA 3DOLA 1U2FA 3GFHA 3W65A 1HUXA 2XQCA 2NZCA 2YKMA 4IFYA 3DLGA 1V3ZA 1QAIA 1DKGD 2KFNA 2LEAA 4GRSA 3BGRA 3P5TL 3OYCA 4FLXA 1OH8A 3W1YC 2KLAA 4P4PA 3Q7BA 4GVLA 1KQQA 3BP8A 5ALHA 3L2VA 1X9XA 4BACA 3OYGA 2M70A 4P72A 4K43A 2RKIB 3AOAA 3P4UB 1A5VA 4CCHA 5LJ3Y 3O1LA 4WJ3B 2C2OB 3ENBA 2H5EA 3EVWA 2Q36A 2J6TA 3LALA 4C4WA 4P7TA 1DJ0A 4RQ3A 9ICEA 4KHPF 5ALFA 4BRQA 4NB4A 4QR1A 4FM2A 2QWRA 4CYUB 1S6QB 4B9TA 3GU0A 3IGVA 5FLXU 2HOEA 2G5IB 2E3TA 2Q0RA 3TSQA 2NV3A 3JSBA 1U1NA 5SWMA 2IAJA 2GGPB 3HHDA 3SQGB 2CKWA 4FF2A 1JJ4A 5KL8B 4DG1B 3OV7A 3UIQA 3O4WA 3MTKA 1Y64A 2HZVA 2LCWA 4CO5A 2BTFA 2QWOA 1FDNA 3CVKA 3G71S 5E84A 5J0PA 2NPIA 3OLAA 3G9CA 1X1PA 3NVVA 3RJHA 3L3VA 4AM6A 1VC0A 1SJ3P 4Y2UA 4JK8A 3D2EB 3PW0A 1V4TA 3FCHA 1RWWB 3FGVA 4LVOP 3DLBA 2MLXA 3ZSOA 2OJ3A 4QIGA 2PA8D 2AJ0A 3HVTB 2FHOB 3AO5A 2BCQA 4CJTA 2FDNA 2A6MA 4BVPA 4TY9A 1P8ZA 1QZ6A 3ZCMA 4FOIA 4LD0A 3CNQP 2P9UA 3HKZF 5ETSA 4NEZA 4CJKA 1RQLA 5L46A 3LANA 4UZBA 3OR2B 4JV5F 4FJNA 1V9OA 3A3NB 1RWOB 4CH7A 3CM6A 3CJQA 4MF2A 5B09A 4MIBA 3O5BA 2ZUAA 3CNHA 1Z2ZA 3C66A 5FDLB 2MHNA 2P51A 4ID1A 4RR5A 2OEJA 5KG4A 2M9KA 3HM8A 1SQFA 1JUDA 1SH3A 5KFKA 2D9OA 3MN5A 4X84A 5HROB 3UDEA 2RP5A 1Z26A 1DLOA 3C6UA 5CZVA 3FZFA 4K59A 5KFMA 3MDAA 3E01B 4A8FA 3J7Z5 3H4DA 2ROPA 5LM7E 3MXJA 1ZBLA 1DGSA 2B9EA 3SFGA 1YTUA 2MAXA 4PZOA 1EB0A 5CD4A 5MLCV 2HHHJ 4KFBA 2ZGYA 1REVB 2Z57B 4GVEA 2QRRA 2J7WA 4DUZF 2JWNA 3SBGA 1HNWF 1ZQHA 2MQLA 1BC6A 2Y1IA 1ZRNA 4BGAA 5CZXA 3HD2A 2HQCA 4A46A 3N7SC 1G1XA 2BVZA 4PAAA 2PC6A 3HD1A 3MPYA 1C1CA 4NLDA 2DFHA 2GMJA 4EK2A 4LSNB 4MK9A 2G8UA 4G3IA 3Q24A 5H9EK 4TLRA 5ETNA 5HMZA 4JKHA 4FZNA 2VFRA 1JNRB 1X9WA 1IBMF 4AF1A 2VQFJ 4IYQA 1VSDA 2NXCA 3BR8A 2DIUA 4FJMA 5DBAA 3IKMA 1U0SA 2EQYA 3IRXB 1QSYA 4WZQA 4KJIA 1TQLA 1LWEA 3BR9A 5A6PA 2MJNA 5T7LA 3GZ7A 3LM2A 4L3NA 2IRUA 1W2IA 1HNZF 4CHNA 5ETKA 3FEYB 1T44A 3V9WA 2CQ4A 4HACA 1V5VA 2W9BB 3RSEB 2DF4B 3VVTA 1VAZA 4IDHA 4BRCA 4B3TK 2VKRA 4QYZJ 1S9GB 2IVPA 3FK4A 1X40A 1WI8A 5AR0A 3QAEA 1ZQWA 2LKZA 3R9PA 4I6WA 1RBSA 4L6V3 1X4CA 4CH1A 2LYAA 3QMLA 3SZ2A 2AF6A 2DNZA 1SC1B 1UCVA 5CCLA 1S9EB 1O08A 3L2QA 1VJWA 4QCLA 2UUAJ 1RYUA 4B3OA 4BR2A 2XMTA 2F8MA 2FJVA 2V94A 4NXMK 4CRJA 1ZQGA 4K4IA 2Q31A 4BWMA 1JCGA 1V5IB 1PUZA 5ALMA 4DL0C 5C25B 5D15A 1LKYB 1L3TA 3TJ9A 3QQCD 4WF9Q 2UP1A 4MTPA 3JYTB 4DR4J 4AL6A 1QQ5A 1VBZA 4WKRA 5KG6A 4M9NA 3TX0A 4BRAA 4RW8B 3V4MA 1QQCA 1KQSM 4ELVA 2CQCA 3CFPA 1TV6A 1WORA 2KJ5A 2XY6A 2QV6A 4A8WA 2LXUA 1RT1B 1RWNB 3ISCA 4E89A 4UB5A 4CLSA 2MYFA 4M95A 2ETJA 5J2MA 2AX0A 4LF4J 5J2QA 5DMRA 4O5KA 4U8VA 1HA1A 4BR7A 1HYVA 2ZH3A 2ZITA 4JKCA 3J81j 2WB4A 3VCDA 4BRDA 4Y2VA 1BQMB 5C2GA 3GL1A 3QFHA 3D3BJ 2YHWA 2GS8A 4FPBA 4TXSA 4MEYA 2IOHA 3QESA 1IIPA 1Y3KA 3L3UA 1WI6A 4DSFA 4ES2A 3CCWA 4KN4A 1VDVA 1UVNA 3NGKA 3LP3A 2GWJA 4NCGB 4WFBL 3KKFA 3H0PA 3PRBA 4Q2MA 1DTQB 3I6PA 4ZVOB 1RHRB 1FD8A 1VK0A 1ZBFA 2F8HA 4C4RA 3DLLL 3RW6A 2XB2D 2NXEA 4IC9A 2E4LA 1I3OB 4E1MA 4LFBF 1S1WB 2FB0A 2HHTA 2HQFA 2ZDPA 3MM5B 4M2YA 4M41A 3PYDA 3LDAA 4JMUA 2R7TA 3JQJA 5H9FK 2R7SA 3ILOA 3T6BA 1SIZA 5KGWA 2BDPA 1VQNS 3V81B 2VB6A 2DGUA 4F36A 3P5JA 1NMDA 2E6MA 4AM7A 3VQPA 3RR8A 1TZ0A 1RT2A 4ICLB 3BQ1A 3MAAA 5GAGI 5J0RA 4DMZA 1WSFA 5AZIB 3BEXA 3MMCA 1FNMA 1HPZB 5LSRA 4NLUA 4M3ZA 2J6SA 2CPZA 1S6PA 1FRIA 3Q8UA 5CA5A 2HF4A 4RTFD 1Y3JA 4MYUA 4PQUA 1JLAB 4OJPA 4MKVA 1RAEB 3BKFA 3T1AA 2J7KA 1GFWB 1U8SA 3OL9A 4H5VA 3MPVA 3RU0A 3D3CJ 2YH1A 2YCHA 1KL9A 4OKEA 4ZPVR 4YMEA 1JCFA 1HLUA 2Q43A 5KFQA 4CEEA 1T03B 3W5YA 4ECYA 2Z1HA 3PHEA 3AVHA 1HQUB 1XR5A 4EELA 2W2OP 3THWA 4DOAA 2KG0A 3CP8A 2O8CA 5BJRA 4B3RF 4P52A 4WFYA 2W55A 2QA4S 4ZJQA 3CULA 2FSNA 2P5VA 3QNWB 1FVQA 1N33K 3LPUA 2POKA 2F5GA 2GUPA 1WUAA 5LMUF 2QTWA 3DXKB 1KKHA 4RPXA 4ZVEA 4BR5A 4RZRA 1YVNA 1M5VC 3LP1A 5E3QA 5JU5A 3C3LA 1JLCA 4AQYK 5U47A 4CF4A 4MK7A 3CJ1A 3D4JA 2PKEA 4DX5A 1MDUB 2HYIB 3PEJA 5AM4A 2LI6A 4DPWA 4NCAA 3QJLA 4A47A 1PYSB 1SJ4P 3K59A 3E58A 2W54A 3IP4B 1BWEA 5M1KA 4QZ9A 3R1HA 3DXSX 4I2QA 4DCJB 3LA0A 1T0TV 3DXMB 2XC9A 1RG6A 4CESA 3AJDA 1DGJA 1RADB 1FRHA 3TQ1A 1NB2A 3LM9A 4BC7A 1CJUA 3M1YA 4UAYA 1SQEA 5J1EA 3V9UA 2OANA 1ZRMA 4CE9A 1BCOA 2CQGA 2OFGX 4DR3F 3FC4A 4IL6U 2G4BA 1XR6A 1VK3A 1GK8A 3HSCA 2IOFK 4TN2A 2B0CA 2UUCF 1C1AA 1YVUA 1HWLA 4FPRA 1UQVA 2XY7A 2KFZA 1PKUA 2VOOA 3NAIA 1NOZA 3PKMA 1RCOB 5HRRA 2HHHK 2FY1A 3ZT1A 2PT0A 3O1WA 1S1XB 1HR0F 3ILJA 4ZPCA 3S7RA 2RF2A 2G08A 4WK3A 5AQIA 4C48A 5M1PA 3WK4A 3I8DA 3PZPA 2BCUA 3HHLA 2F3NA 3AMZA 2RRNA 3BB5A 1PGZA 1EJ7L 1NGAA 1TUYA 3OFHA 1TL5A 2CG8A 4H5NA 3ICLA 3A0IX 3G6ES 2V7YA 4B1YB 4UOCA 3WXJA 8ICJA 4JI6F 1X4EA 1VSLA 1FF2A 4CHOA 1FHTA 2F63A 2FZCB 4EGLA 1T94A 3DGPA 3CJ7A 1N62A 1WSEA 1H2TZ 3SV3A 2VQFK 5JJBA 3A5NC 1N32J 3KJVB 2KDOA 2G0JA 2IFXA 5HI7A 2KJ9A 3NGZA 3U9DA 3H8MA 2D0OA 3IBWA 3M32B 3MEEA 4LZGA 3AAQA 4DL6A 3FDSA 3D54A 2WSFC 2XGQA 2GO9A 3PW2A 2M8DB 2HGNA 1TL1B 5D3GB 3HHKA 4Y2KA 3ENWA 1RWMB 2HWTA 2MZRA 5BPLA 3FSXA 4LBIA 2G0CA 3WXLA 4WXWA 5DGBA 4CNQA 2J9DE 2ZJRL 1RT7B 3HILA 4ED3A 2MKYA 4QOZB 3ET6B 4K2XA 4PPZA 3DRYA 3I28A 4WFXA 4LMZA 1HQEB 1AFIA 2OELA 3R6GB 4O44A 2N4DA 3SDEA 1GOCA 5KL1B 2MQPA 4LFCF 1SB6A 5IIOA 2OI2A 3M8RA 2ZNZA 3MDFA 5KFIA 1XC9A 5B66U 2XULA 2YB1A 3PX4A 2MZJA 4NLYA 1RAAB 9RUBA 1LW0B 2A2DA 5HATA 2UUAK 3G10A 1QCKA 4CE6A 2QZ8A 3OTCA 2D4WA 2IIRA 4DTJA 3SLCA 4FW1A 3LDSA 2WTUA 1R59O 2YNFA 3IM1A 2ITMA 3C16B 3IRWP 4DR4K 1SWWA 2OTJS 4CF9A 8RUCA 4IQXA 3L6QA 4DLGA 2D69A 2HVEA 4RNNA 5LMNJ 1S7HA 4DOCA 3KK2A 2EI5A 2QL5B 3VGMA 3NMAA 4QS7A 3PSFA 4C8ZA 4FJ5A 4W90B 2G07A 1CJKB 4X5VA 2I6WA 3ZO7A 1ZD4A 2UZAA 2Q6BA 2LA4A 5GADU 1GLBG 3AQEA 4JRPA 4NZ0A 3SIPB 2VFSA 1NSQA 3GG1A 2VONA 1YJVA 1VRTB 3DEEA 1RCHA 4H5RA 2V8PA 3NKYA 3CJ3A 5LJ5Y 1QQMA 4U96A 4JI7F 4AXIA 4CD1A 5F1XA 3R97A 5KOWA 1KW4A 4NOHA 3EGZA 2CQHA 3L3CA 4EI2A 4DQSA 1S59A 4LSZB 2YKNA 4I6YA 5FPDA 2P9LB 2N1RA 4KN7A 3WNFA 1KVKA 4O0IA 1TR0A 1VSHA 8ICFA 2HVIA 1PAUB 5JUMA 2AEJA 4PWWA 2HHUA 4E1JA 4ZHRA 3CE8A 3PCOB 5A8KA 3QB0A 4CTAB 2W03A 4IO9Q 2B6AB 2HNZA 4RQMA 4IQVA 3KG0A 4NL5A 4J9QA 4M47A 3FBCA 3CCQN 4O4GA 4TU8A 4P4MA 4EYIB 1U1OA 1XNQF 4RQ1A 1ZJNA 3AQFA 4LH4A 4WFNL 3J7YU 5BOLA 3BSCA 4FWLA 2OPRB 5HHIA 4ICAA 4L75A 2D41A 1ZOTA 4K4GA 2DJWA 5ALGA 4F5RA 2AWZA 3K57A 3W2VB 4B9SA 4A8YA 1K73T 1WD6A 4CLUA 1FFGB 4X64F 2DR8A 4DL5A 4M9LA 8ICAA 3H42A 3JPQA 1BG3A 2R4FA 2DKZA 1VQ9S 1FXRA 3OYFA 4OYPA 3IAYA 3UKUB 5IIJA 4ZN3A 4GC7A 1DTTB 1WBDA 1RAGB 5HANA 5KFUA 5HAOA 2ZTEA 4CEBA 4QZIA 3CC2N 3HFKA 3SMVA 4USVA 2DFLA 3MK6A 3KOOA 3OBYA 1PVRA 1X31C 1RT5A 2VDIA 2QEXN 3ORYA 2FMQA 3TA2A 1TVRB 2HNDA 4YB5A 1J53A 5KGXA 4UW2A 1TL3A 3KHHA 2OKQA 1CUKA 1XIQA 2HSTA 2ZH1A 1VJ5A 3LDOA 2AXTU 4FLTA 1NGHA 2UVWA 5AFUH 3CRXA 4XIUA 5LL6d 3FR0A 2BJ3A 4EHUA 5L1JA 1RUSA 5F8JA 4DV6F 5BXIA 1VQPS 1SC4B 4X66J 3VF0B 2UU9J 4N41A 3BSAA 4KHWA 4B9QA 3KKSA 3I8BA 1H0HB 1FDBA 3WC0A 3DHXA 5J0QA 1A5WA 3OR1A 5I3PA 5K8OA 2GIFA 2VF3A 2X6SA 3T41A 3UI3A 2FBYA 1P27B 3QJJA 4PXCA 4W5QA 1HBMA 3CC4S 3ZZ0A 2AZ3A 3FZBA 2Y3YA 2RHQB 3ZD8A 4QZEA 4KH1B 5F8GA 1WWVA 1VMBA 2E1AA 5T7BA 4CK2A 3WNHA 1LWCB 1M90T 4Q0BA 3MECB 3VQCA 2W7PA 3ZSRA 7ICVA 3PNCA 2JH7A 1ZM4A 5F8HA 2P9KB 3E9LA 4ZP9A 1NK5A 7ICMA 1YX2A 5HBMB 3ZXWA 4CZJA 4OX6A 5E3PA 4IQWA 1S1VB 1YHQS 4OX9F 7ICEA 2NRVA 2G8WA 3BGLA 3PTWA 1NBWA 3SAHA 1EXNA 1H6KX 2H3GX 4CQ1A 3HO1A 2HSEB 2HFNA 2H3EB 1KBUA 5KFRA 3C2PA 4Z0UA 5J1NA 2LYHA 2HIYA 3PFEA 3BKUA 3PRVA 1C6VA 1FRKA 3QBXA 3FZMA 3KK1A 2VFTA 3VA3A 4GKJF 1NK7A 3UKRB 2WB1D 2AJ1A 5H1SV 5HR6A 2GQ2A 4HTJA 1XN9A 3DN9A 1F21A 1VSEA 1QSLA 5KPZA 4MKAA 3I55S 4BQZA 1IV8A 4EENA 1QSSA 3BF4A 3LZJA 2A1BA 3L8BA 4M04A 5CY4A 3PO4A 5B0BA 4CIFA 1LCUA 4AHUA 3SSRA 2IYGA 3VQ9A 1FK9B 2ZIXB 1R31A 3JPTA 2ZKTA 1N0VC 3X3UA 2F7TA 1ZTTA 2KKPA 2BBEA 5DG9A 3C6AA 2E1YA 4J9OA 4FKYA 4CW7B 3PMNA 5MAOA 2VANA 2BRKA 3NVZA 5A2QY 2Z30B 5J2PB 2GH1A 2FVCA 1YJ9N 3TR8A 4KGKA 4JI0J 1YJWS 2V51B 3TI0A 2BABA 2O8BA 2M0NA 4OI1A 1SS6A 2KO1A 5KG3A 1AW0A 4JV2A 1VIXA 2Y0SF 1KS2A 2M7SA 3O1BA 3NH0A 4FPAA 3ZDEA 2LKYA 4MMOA 1RJJA 3VQTA 3PW5A 5DB9A 2ZUDA 2YKAA 2JR5A 2WSEC 1KVCA 3ZETA 4JYAJ 2WVFA 3U7JA 3DXBA 2XO7A 1YK9A 4K5SA 3ID8A 5F2RA 3H2VE 2XNRA 3KMQA 1UMJA 1DRZA 3WXMB 3EVMA 2QL9B 4Z4IA 2DNKA 2VPWB 2X6NA 1I94F 1DT9A 5BRFA 7ICQA 2CFXA 3CO0P 1QM9A 2HBKA 1JJCB 4PG6A 1YSJA 2ZJ8A 3KJQB 3ZZPA 3AVFA 3TTFA 2KZ3A 5K14A 1YVFA 2RUGA 4HUEA 1D9AA 1HD0A 1UWAA 1TFWA 2MKIA 3W7BA 4Y28C 1H98A 1J27A 2ROEA 4PPDA 1RAFB 2FXUA 4D3HA 4RT3A 4XUSA 4ACOA 4JKGA 1XMOJ 3ED5A 4AH9A 3K75D 1NNDA 5EE0A 2ZM6J 1WOQA 4NYNA 2W42A 4NCBA 3HSTB 3TX8A 8ICLA 1V6HA 2J8AA 1NGGA 4JI4J 5IIKA 3OTOJ 5BPCA 5LMNK 3AVAA 2QKQA 1J97A 3MM6B 3GJTB 2RNEA 3KLHB 1R6VA 2XLKA 2PFDA 2EFGA 3K1ZA 3DDNA 1N63A 4X4VA 3NVMA 2V2VA 4O4RA 3UPFA 5DO2A 5IILA 4QIWC 5IT4A 4DTPA 2YWKA 1IO2A 3AGKA 3HSDA 2O8EB 4RWXA 2GVDA 5D8HB 1GLJO 4F2RA 4I29A 1T05A 2B4VA 3NOGA 3EPGA 5HMYA 4OZJA 3VV2B 4IBNA 4H0PA 3QETA 2W2NP 1G4CA 1O03A 2IDLA 1NOYA 5AQPA 1JXVA 1LW2B 1N36K 4M5LA 3NCRA 4BC5A 2C2MB 1XSLA 3HSGA 3CJKB 2HHSA 2UXDJ 1JWWA 5D77A 1RK8A 3DI6B 2QA4G 1DQAA 3SSQA 4JK9A 1VQ8N 1T9VA 4DL4A 1O51A 2V0NA 4I9LA 3VHQA 4F4AA 3S3MA 4FWPA 1BXNA 3TAEA 2HLUA 1WKKA 1ZQVA 1RE1B 2BXJA 3LP0A 5FLXY 1N5YA 1Q3UA 3BGFA 4DLEA 1UPHA 2H3VA 2ASOA 2CNLB 1HHSA 1IWGA 3VOVA 2HB5A 3CCMN 2MKHA 3BO3A 5IQ6A 4RBTA 2ZOFA 4A8XA 4KBOA 4GMJB 3DU6A 1RT6B 3UE5A 2K3IA 3MF5A 1RBLA 2RPIA 4F9OA 3C28A 2YH0A 3GJSB 1UEUA 3IXQA 2DY9A 3CXCR 5D4BA 2FPHX 3NNHA 3V5RA 4K0KK 1VQ7S 2I8EA 4BXOB 7ICOA 1OS5A 1RAIB 2BPGA 3AVCA 1QUVA 4AXJA 3TTDA 2A3VA 1N88A 2Z4PA 1D4XA 5DBCA 2OD6A 3PXGa 3P1GA 7AT1B 3VQQA 1N5WA 1N8RT 5EE3A 1FWKA 4WP8A 4GV3A 2E20A 4NXZA 1AUDA 5AK3A 1MWMA 1NXIA 4CF2A 2W9CB 3T1YK 3Q22A 4QIWD 5T14A 5HRSA 2RQ5A 4RW6A 3KK3A 3MM8B 4YG2A 4YN3B 3L4QA 4DL7A 3CCLN 3VC8A 3EXYA 1URJA 3KUGA 2HVHA 1SQGA 4HI1A 3EL2A 1NGJA 1I1GA 1YBTA 1U0HA 1YJRA 3DRXA 1J2NA 5DDRC 1ZZNA 4NA1A 1UKUA 2IY5B 4X66K 3RF9A 4O9MA 1LV5A 2ZH9A 4ZCLA 2FI1A 3KLGA 1YBAA 4UB3A 3QT8A 2JEFA 2C2ZB 1YI2S 4KAIA 3CQ8A 4C8MA 2O8FA 4PL7A 4L73A 4X62K 2NS1B 1FWPA 2DBBA 3JTNA 1S1TA 2LU1A 1BD6A 3O4NA 2YJEA 3CCJS 1FFSB 4DR2F 1QVFM 1LK7A 4JAXA 2GNKA 4FWSA 4KAZA 8ATCB 4DV0J 2XHBA 2N3LA 3RB6A 3O3GA 2RDDA 1N34F 4FJIA 4FJGA 4DX8H 3CB4A 3MGIA 2B9YA 1F1BB 2QC3A 4XO0A 2F9TA 2Q3PA 3KJFB 4CJPA 3D68A 3HI9A 2VG5B 3F2CA 3C7NB 2K4EA 2IRXA 4I2JA 1IBKJ 3CCTA 2F9DA 4AE5A 3C95A 3CPEA 2EAOA 3FZKA 1M5OC 5KFAA 4U7BA 3EVOA 4JI5F 5FD1A 5CHIA 2Y0SC 3RYLA 1N56A 2QJ3A 3MAHA 3J7AN 2B5JA 1JN3A 3IWXA 4ECXA 5KOXA 3R7NB 1HLWA 3IA0A 1BLUA 2UUBK 4LRCA 3K5OA 4BGDA 1I3AA 4Q8FA 2ZWHA 2BM0A 4IO1A 4FWQA 2B43A 2ZXHA 1K0TA 3HYFA 3NH1A 1BGXT 1U6FA 4I6MB 4RL1A 1AB8A 3M9OB 1P1LA 3WQPA 1FFVA 3NXZA 5C2FA 2YV0X 2WRMA 1SKSA 4EIAA 4F3QA 3GV5B 1HIYA 4LFAJ 2K1RB 2MJUA 1J5OA 1HNXF 3QYYA 1VC5A 4OZ0A 2AP6A 3R2CJ 3FAHA 1YT3A 5IT0A 4YMOA 4X4OA 3D6JA 4KLIA 2B4OA 4R5PB 2V8DA 1NGEA 4QS9A 2W43A 2ZUGA 2QMWA 3SQIA 1U1MA 5CXTA 7ICIA 2IA0A 2R42A 2MXYA 4I2EA 2ZIWB 3JPNA 4RWTA 3V6DB 3BBBA 4NLSA 1L7OA 3NWGA 1RTDA 1ZQ1C 3O0FA 3M6GA 3JXUA 5IM0A 5EGYA 5AQWA 2JEJA 1SUQB 4LF1A 4X4NA 5JVHL 4V19X 4B9MA 1WSIA 3KJNB 5C42B 1SQKA 2JLGA 2ZIVA 3IG5A 3T5KA 1H3DA 2ZVIA 5GAHP 3HOSA 1RBVA 2MKSA 3PIOQ 4OGCA 4RBVA 1YKWA 2FF3B 1KAXA 1RFQA 4IOAQ 2WF7A 3OJSA 2D0PA 3PRDA 2KT3A 2KVCA 2F8TA 1VLOA 2QL7B 3R5AA 1F2HA 3GJRB 1E6VB 5L38A 5IXUA 1GLEG 2I7NA 2Y0SD 3EDQB 4KHYA 3ZX0A 2DH9A 4I7FA 2D0CA 3FYHA 2NLXA 3M6UA 4P6QA 1W0HA 4KHPJ 1OH5A 4C3MA 4QZBA 5KFJA 2FJXA 4WFZA 5CYJA 1KTVA 2BW7A 1XMOK 5IT9Y 3AU6A 4Y1CA 4EU0A 3NLCA 5ITHA 6AT1B 1ZQDA 8ICZA 3WK7A 5BRHA 4CK3A 4KB1A 3OTOK 1ZZFA 1IN0A 9ICIA 3TFRA 2QLJB 2QE5A 3WX4A 1SV4A 3FUYA 3UMBA 4HHHA 4MLEA 3LW5C 3DYAB 4RKUC 4DR1F 4KHMA 3UD5A 4FXDA 2NNWA 4H5TA 4RW9A 1TUGB 5I9EB 3IBCB 2G5HB 3RMBA 2KJ8A 2C28A 2YMPA 4MKYA 2OPQB 2V9WA 4P2FA 2DGXA 4CZIA 3SENA 2KN7A 4J03A 4QWCA 3QBWA 3EY1A 5GAEP 3M8ZA 2XI9A 2XRIA 1RGVA 1AT1B 3N7PD 3HDSA 2HHQA 2HBQB 2AW0A 5KAIU 1X5TA 1SL0A 1NU4A 4CJEA 4JV5J 3N97B 3PIPL 3S01A 4QNLA 1NSPA 2XLIA 4IG0B 2ATLA 3ONNA 3BEGB 5L9XA 1SB3C 1C4AA 4OPJA 3R5JB 1BIUA 2HAFA 1IG9A 3T9ZA 5ETPA 3AO2A 1ZQCA 4XRHA 3OYKA 2E8NA 2K7KA 3OT9A 3JSYA 3SBMA 4ANCA 3QPIA 1NBEB 1X2IA 4CZCA 4ZJOA 2FJWA 1RWKB 3W62A 1RTHA 3FE1A 2HBYB 5A0YB 4LJMA 2J6UA 4DUZJ 1Z00A 1A0OB 2A6AA 1JLQB 3F9KA 3TSUA 4CP5A 1K8KA 2C1EB 4I4BA 3NS1A 4MH8A 2DFFA 4KLUA 3AAWB 1X66A 4QJFB 3FJ2A 3A8IA 2ZZMA 3AVNA 2B6GA 4IDKA 2W4CA 1XEZA 2C2KB 7ICNA 3TFSA 3QRPA 3M6VA 3CQYA 1XNRF 2E66A 1Y10A 1IBMJ 1D3WA 1SXLA 3F2KA 1K8AO 4YDUC 3GIJA 4Y2CA 2XHWA 8AT1B 3QMQA 1MN8A 2GO7A 1JQGA 5I3UA 1RWUA 1W7WA 4M3RA 2AEMA 1U26A 2CDQA 1OPIA 3BF3A 4DV1F 4LR7A 3SJHA 2IMOA 2DK2A 2EC2A 1U02A 2BQRA 2ATCB 2FDRA 1ZBTA 3IG1B 2ASMA 4K2JA 1A0PA 1HNZJ 1Q5VA 4FO0A 4FBTA 2NCKL 2ILYA 2DITA 3FM9A 2RHKA 3HVWA 2YJFA 5BN8A 1ILYA 3N4MB 1CJTA 4K8RA 3DOLB 3M8YA 3AA2A 2D1CA 5DDYA 2YKMB 3A3PB 2GJ2A 4IFYB 3DLGB 1ASVA 2X74A 1P8GA 4ETXA 3HT3A 3BGRB 3V1QA 1N61A 1HJOA 4ANDA 3MDCA 4TUQA 4B17A 4Y2AA 3RH5A 4I2PA 4DCOB 2O5DA 5J8YC 2O1PA 1RKIA 2C3MA 3JXOA 3FBEA 3MCPA 4RWWA 2ZC3A 4KC5A 4PWDA 3QERA 3ULHA 4O8UA 1QDUB 2VG7A 1D8ZA 1X3NA 2NO5A 3G8QA 2L5YA 3HI0A 5F8NA 1KDNA 2GO8A 4PR6A 3KYLA 2FBTA 2FE9A 4JI1F 4YHHF 1B92A 1KP6A 3MCOA 4F93B 4CJFA 2IAJB 2D0BA 3ETRA 5DM7L 4CJRA 1RHMB 2HVDA 1RTZA 3SEIA 4HVJA 3J7A1 1SJFA 2BKOA 5HL7Q 1WKJA 1OY9A 3ZTRA 3SPZA 2L9WA 2YY6A 1Z4NA 2X1BA 4F2SA 4K50A 1GTHA 1S6UA 4LBPA 4UATA 4DSJA 3L09A 4ZPBA 4G6VB 2FSJA 1IM4A 5E3RA 3UFCX 3EMTA 3MMBA 4BRGA 4MF8A 1Q86O 4QW8A 1Y97A 3NVWA 4I2HA 1TKTA 2B9XA 1RT4A 4DV4F 5FRMA 2R8GA 2VIXA 3FZ2A 1NPKA 3MPWA 2CJXB 3GYNA 2DR9A 3I4HX 2JDJA 2FMSA 2VJVA 1RDUA 3OTQA 3ZSZA 3PR4A 2YNGA 5HVFA 3ZZOA 3QWPA 3C1YA 1YUWA 4MFCA 3FMWA 4P2HA 3HXMA 3NUQA 5AI9A 1U2VA 4OKJA 4HT5A 1F9FA 1V3SA 3T1HK 4RW4A 1RBAA 3M2RA 2D7SA 2XMUA 2HF3A 3HOTA 2O6KA 2LQJA 4LFBJ 2V4JA 1Q79A 1PYTA 1BPDA 1HARA 2R7QA 5KQDA 2A42A 2LDIA 2D3DA 2MSTA 2IPOB 2I5HA 2GW8A 3N9UC 3R9KA 5KG5A 1DLOB 3C6UB 2KW4A 4A5AA 1WCNA 4IKFA 5IS2A 4XA5A 2IA6A 2VKQA 4YFUA 1NGCA 4X65F 5DDPC 3QU7A 2ZOMA 4KFBB 2Q2RA 3WQUA 4C23A 2CQ2A 2J0XA 2DT9A 4QPXA 2YX8A 3C6HA 1VISA 2ABYA 3Q8LA 2DBYA 2CQIA 4AYBF 1PBAA 1YGYA 3AJ2A 4C8NA 5CJ7A 3GIKA 1X4AA 1IWAA 3QT5A 1NUEA 5LJVA 2CRXA 3C23A 3PSTA 4RNMA 1U49A 3TVKA 4DB3A 4URSA 1C1CB 3QO9B 1SJQA 1HEKA 2JZ5A 1C2PA 2ZHBA 3CJ8A 1IVZA 1N4LA 1OSDA 3KKAC 4GNIA 4OFZA 4CEDA 3AO1A 2CPIA 3KDOA 1NDKA 1IR2A 4JS4A 2MUTA 2DD8S 4DTOA 1L7NA 1QAXA 4O3RA 5JS2A 4C7ZA 4LZDA 4F91B 3LPTA 3AFGA 2BCVA 5DRKA 2ZVSA 3GQCA 2NZ4A 4CBWA 4BE1A 4Y2MA 1L3VA 5JVGQ 1LWEB 2JVOA 3EUNA 2V5HG 1PG5B 2CQ1A 3ZI4A 4U9RA 5T7LB 1C4CA 1W26A 2CPXA 4B3RJ 1Q81O 2XMMA 1GXLA 4J2AA 3KHLA 1MROA 5AFUA 5AQSA 3ZYYX 4HACB 2VQEF 1HFEL 3NF8A 2ALZA 1TKXA 2QKBA 5K8MA 2ZH4A 1BOTO 5H2FU 2IVNA 4FO6A 4NV0A 4Y34A 4J2BA 5BYRA 1F5CA 2YMQA 3VAFA 2FVQA 5KFLA 2W6LA 4TY8B 2ZEJA 1S6OA 2HK2A 3WK9A 1PJ6A 3OLBA 1U04A 1DBDA 2MRLA 1A5XA 3VQDA 4QZDA 4UQGA 1MA7A 2BDUA 4LSLA 2PEHA 4F0HA 1OVQA 4C8LA 3WBZA 2V69A 2FGOA 3CW2C 1PBUA 1FERA 2VC0A 4ZCIA 3CF5Q 9ICVA 3IHQB 1RHQB 4B3OB 1KLNA 3QIPA 1BVSA 3R6LB 2HWIA 3ZZRA 1RXOB 1BA0A 4QIFA 1NRKA 2LXFA 4HI2A 4WQ5C 2VA3A 4IH6A 4QWEA 3C15A 4ILGB 3HKWA 2F1FA 4NXNF 2PXIA 2DXEA 1ZQSA 2E1FA 1APSA 3R6MA 3Q83A 4NLXA 3BO4A 1TV6B 1JLFA 3BH6B 3UW1A 4DSEA 1ZS6A 1UL3A 1GLDG 3EGNA 4DR3J 1P9QC 4LRAA 1C0MA 4F25A 1D5AA 1JLEA 5HR7A 4ED2A 2UUCJ 5J2MB 5J2QB 3BKTA 4K4YA 5F41A 3R5CA 1L7PA 1N6QA 5AJ3F 1BIZA 2P9EA 1HR0J 2P66A 5AKKA 4NL9A 3RRKA 1ZPVA 1RYSA 4DUZK 2IJFA 2NSBA 1TAMA 3F9MA 2Z56B 3TUIC 1B9FA 1NOMA 3MWBA 3WK5A 3FNNA 9ICKA 1B4FA 4B1VA 4M3UA 3KD1E 3T5HA 3TP2A 1KQSR 4LF9F 2FJBB 2LA6A 4C0OC 4PUOA 3DDHA 4JI6J 2DIVA 5E7OB 3J81Y 1XO0A 4A8MP 1YTAA 2P1JA 3C1ZA 3K0JA 4LRFA 2GC8A 1MG7A 3TR5A 4CEOA 3DM2A 3SEOA 5KT7A 1I5OB 4URQU 3CDEA 2Q66A 4A61A 4DU3A 3NNAA 4DV5F 2ZH7A 1QQ7A 5ALNA 3NMUA 1RT2B 3UO0A 2HFUA 3W9IA 4ZMMA 2R7YA 2CRLA 1HNZK 2WBMA 1H38A 4YFKA 3MMCB 4Y2PA 1IV0A 3HP6A 3IR7B 3CD6N 4TU7A 2RQ4A 3H8YA 2OMOA 5L8RC 3VF2A 4J37A 4ID5A 1WC1A 3VPZA 3QEWA 5G5GA 3TAGA 2NZTA 4PQUB 1FI4A 3WU2U 2GFFA 3MR2A 4MKBA 4LFCJ 3U9ZA 2FGCA 2MSNA 3AO4A 4R63A 4K42A 4NI2A 4BVOA 4KE5A 5ALOA 4J2DA 1H7WA 1RHJB 3P38A 1O5JA 2NQPA 4KLSA 2VDHA 5TKWA 5C12A 2W9MA 1P1TA 1SV5A 1X6JA 3THWB 3SNNA 5F0XA 2EBEA 1M5SA 2O8CB 1ATRA 3BF1A 4QZAA 4NYPA 2KU7A 1CLFA 1XU4A 1EHWA 3KNAA 4IQTA 4K4UA 1ZXOA 2WVBA 2A1SA 2DGWA 3F53A 1RB0A 5BR8K 2QFIA 3MWTA 2NUHA 1IH7A 1ICEB 4HDGA 1FCAA 3IV6A 2HW3A 4K4XA 3WKBA 1RWVB 4MO4A 3MR3A 2VWKA 1RQ0A 1HWIA 2D3ZA 3R9LA 3E3XA 2F76X 2F40A 4AYBC 3LP1B 2ZBPA 2XTJP 1WLJA 1GMUA 3ZT2A 2A0FB 3US5A 1JLCB 3TOQA 3LQVA 4FKXA 1LQ9A 5HP1A 4JI7J 1BISA 5AK6A 5GIPA 2XO6A 1NAQA 5AHXA 4PG4A 4IR9A 4FLUA 5KFVA 2A1RA 1RZTA 2LMIA 2JEIA 1F5AA 3Q23A 4IOCL 3H3NO 4NLOA 1S77D 3VGSA 3A5OC 5DKWA 1RTJA 1VIOA 5CYMA 3NAHA 3AM9A 3TAMA 2H3FA 1GX6A 4UBCA 1RABB 5B0FA 4LFBK 3DC2A 3JAMO 3QEAZ 1CJUB 5FPEA 5J1EB 4HL9A 4RNOA 2CZ9A 3HSZA 3K89A 1VK8A 2XMKA 4DV3F 3Q8PB 3N4PA 4TQRA 4BRHA 3QUCA 2A19A 2YWHA 1NDPA 3UDLA 4PJ0U 4IRKA 2YNIA 4OJ5A 4CNYA 3UN2A 1U24A 3E66A 5JMVA 1XNQJ 1K44A 4MDBA 1F60B 3HTVA 1H72C 3MEKA 1MN9A 4JHDA 3PFOA 4JNEA 1IKXA 1OIAA 3AXKA 3CJTA 1IBLK 1WOSA 5CYQA 3TUPA 4J5OA 1RDCA 3M7VA 4KV8A 2P9IA 2Q97A 5HRNA 3JTOA 3AUOA 3MX2A 3OHRA 2CN1A 2XIDA 2RF2B 4DI6A 3S1TA 1UVJA 4X64J 1DQ9A 1NZ8A 3HHLB 3M8PA 4NA3A 4CIEA 2G0AA 1B0XA 2DGZA 1X60A 3LK9A 1VRUA 3A8YA 3OHAA 2F2AB 5J2BA 4ILJA 3W66A 3FCVA 3AVJA 1WC6A 5FIIA 2P9PA 3NFAA 1WHVA 5KFWA 4KH4A 3DGPB 4ED8A 5EN1A 2W25A 3MABA 3DJCA 4I9QA 4Z4FA 2VH7A 4AL7A 4CZHA 5L9NA 5EDWA 4K8ZA 3HPHA 4LF5F 4CO3A 4GKKF 4PG5A 3MEEB 3VF6A 4FLWA 3D0GE 2HOIA 1KWMA 4TUPA 3NF7A 2P8IA 4TKTA 2XMVA 1RYRA 1WSVA 3IWLA 2CZ4A 5HMXA 1HKBA 4DV6J 1YRXA 3BH7B 2VIHA 2E2PA 5GMEA 4E7IA 4B6JA 4WP3A 1K0VA 4FWOA 2KHQA 2YBVA 9ICHA 2WZ1A 9ICXA 4KO0A 1SH2A 3OFFA 5EX5A 4O44B 2KE7A 3FSIA 4XDCA 3SDEB 2OEMA 1YRUA 4FPIA 4XTTA 3NCIA 1MC8A 3GR0A 1C0GA 3AJ1A 1O1WA 1XS9D 2HURA 3I33A 5ADXH 1GXUA 4X4UA 1GMVA 4RBUA 4LY7A 4A62A 2D0AA 4K5RA 3CFRA 2W11A 3CCQS 4I27A 4ETZA 1RQNA 4YQWA 1PYOB 2CQ3A 2KKZA 2UXCF 1Z1VA 2KG1A 4CFAA 3D1OA 4OJGA 3EX7B 2G0IA 1V4SA 5AT1B 4ZP6A 3TANA 2A18A 2E1RA 4E0DA 4RW7A 2YNFB 5J2DA 3OR2A 1T11A 1XWLA 1VQ4N 1S0OA 3A0BU 4F4XA 1OH6A 1BHLA 2JFDA 4LF7F 4TYAA 4OHYA 4PRFA 3LPEA 3OXFA 1QTNB 5D78A 3SI8A 3NF6A 4OX9J 3IUCA 3C6TB 2B7CB 2KRBA 4EX7A 1MN7A 4OZ2A 2KXHA 3KK2B 4WQ5A 3LVVA 2BJ7A 2EAPA 2DWQA 1ZD3A 1BPYA 1HW9A 4QZVB 4M3XA 1N0UA 4RU9A 1R0AA 1D9DA 4EZ6A 2KH9A 3SCJE 4QWDA 3CCUN 2G8IA 3V7JA 5ALWA 1M0SA 2OZMA 3UDCA 2UUCK 1KQKA 1ZA1B 3CC2S 4GKJJ 2EFVA 4F92B 4UF4A 4LREA 3OXGA 3MTJA 2WBNA 1FRXA 4USJC 3KLEA 4I2IA 3HRDD 1FEEA 4ZPTR 2QEXS 4DPTA 2FPMA 3HX0A 2CWXA 2JWKA 4OYIA 1IXRA 1N5QA 3M7DA 2QARB 5L39A 1Y0HA 3QATA 1ASUA 3QU9A 3ZT0A 1XTZA 4R65A 2XSJA 3ATVA 2JH3A 4OV1A 3TVZA 4M6WA 3BO2A 2YKNB 2DXFA 3AQPA 4YS2A 2D3O1 2AD9A 2PFFB 1ZXIA 1BDGA 3SUNA 1H2UX 2CPFA 3BPDA 2KV2A 3EEQA 2WF9A 1FKOA 2NYIA 4JI6K 3H8WA 1T95A 3EGWB 2EX3A 5JTIA 1SIWB 1FW6A 4TURA 4OJ6A 4W5RA 4ZHRB 3QUQA 3ZTQA 4M5GA 5A8KB 1WTFA 2R2TA 2NO4A 2HNZB 2HWHA 4KR0B 4A59A 4CJ3A 3N6MA 4O4GB 1AUSL 3H1VX 2HKEA 4NM2A 2U1AA 2G2ZA 3NGDA 4WYWA 2A1JA 1NK0A 3I96A 3AY9A 4UB1A 1P6TA 2E8MA 3MD3A 3KVGA 5SUHA 2YQ0A 4YDXA 2E9RX 4NZ7A 3L2WA 3QRQA 4J2EA 1SZPA 3F41A 4CHQA 5DDMA 4FDFA 1C0TA 1ZYQA 3AA4A 2VODA 4K4ZA 2GV1A 3D0PA 4O3SA 3KIOA 2FC0A 5E3AA 4FWRA 3PJXA 2LU2A 8ICWA 3OY9A 3FZLA 4CJQA 3CCRN 4MYTA 5GAHI 4Y2IA 3LGNA 2D3OR 4LFCK 1I51B 5AQMA 1GOBA 1I94J 5CEHA 4XEIA 5KFFA 1Z3EB 5AKXA 2KN4A 3RJKA 2DNHA 3M30A 4X4QA 3ETLA 3M05A 5G4DA 2XZDB 1JB0C 4C9DA 3RBXA 3C0BA 1LNQA 1X4FA 2QK9A 4C3LA 2HNDB 1LFPA 3POTA 1RA7A 5F8MA 1RBTA 1TL3B 2B0GA 2E29A 4KY3A 4P7VA 3CDWA 1YBUA 3QE9Y 5DM6L 3CWJA 3KTQA 8ICKA 1U1PA 1KFSA 3KK7A 5ALKA 1BE4A 3ZSWA 4OYXA 4M7YA 3JPSA 4OI2A 3Q2SC 2PO4A 5D4PA 2DNQA 4KQZA 2R2UA 5ALEA 2RHFA 4ZK7M 5AQXA 4MFBA 2EFQA 4F50A 1N33F 3EWGA 2VU5A 5C2CA 2PY5A 1PK1A 1HUOA 2B51A 3HFZB 1TAUA 2FZGB 2A40A 3O3LA 3OR1B 5AKZA 4DS4A 2BCRA 4G9BA 2LQBA 1U09A 2PMWA 1YJ9S 4FCYA 1Z6RA 1HBMB 2GQCA 3W9JA 1XMBA 1FWLA 3EKUA 2F44A 2V2ZA 1IQZA 1MU2A 4I2BA 4AQYF 1RU1A 4JI7K 2PFOA 2BKNA 1X5SA 4C1NK 4ITSA 4Q0BB 2WW8A 4OGEA 2WF8A 3HJVA 1K9MO 5AQJA 4ZPDA 3TQEA 2FYXA 1OKJA 4B08A 4USTA 3KWGA 3RJMB 5FROA 4HTLA 3KD5E 2FBVA 4PPXA 2IVYA 2JRZA 1RBOB 3NBPA 3JQKA 5K4LA 4HTUA 5ALLA 4GMKA 4OJLA 3W8PA 1OYEA 3MM5A 5A8RA 1CQNA 1SL2A 3IFRA 2AGOA 4IZ9A 3WUHA 4CWBA 2CGKA 2D1KA 3S9HA 1DRGA 2VPXB 3EE8A 3ZTOA 1QQNA 3I9V9 3ZNJ1 3DWLA 3KK1B 2HOQA 4ZN1A 4RNFA 2QW9A 3VZIA 2D5RA 2DGSA 1VQMN 4ICLA 5KFOA 2AGPA 1Z19A 2BE7D 2HHHF 2XWXA 2K2PA 2OSQA 2BHNA 1JJHA 2PGCA 5AM3A 2G2YA 5CR0A 5AICA 3PEHA 1WACA 2A1AA 2JZBA 5DLFA 3ZDDA 2ZBQA 4O3OA 4WE1A 5JLFA 2LQ5A 3OUYA 3VAGA 3R7BB 4PG7A 3IRUA 3O2IA 8ICBA 1NU0A 5F3TA 1R43A 3I0SA 4Z6EA 3D6MB 1B70B 5KFHA 2QMXA 2MMYA 1UAWA 3MWPA 4X4RA 3SQ1A 2ZJ5A 1EZZB 2OP5A 4FNHA 1VOMA 1NSKL 3P6YC 2O8BB 2G1HA 3TPQA 5DG7A 4OLAA 4CDIA 2QB1A 5HMLA 2P6UA 4GV9A 5K8NA 4HKQA 3VN5A 4KHUA 3MBYA 2ZUCA 4KH0B 2QYCA 1U8WA 3J7AP 1CJVA 2AA4A 3IM8A 4FE3A 1KD1O 2P5GA 1U1LA 2PBDA 3JPPA 2HBRB 5B5EU 5HJYA 3ZETB 4FFDA 2WMMA 2WONA 3G6YA 1JKHA 1JXBA 4CGZA 2BPCA 4PHDA 3GTYX 1SCJB 1AA1B 1VQ8S 3G8TA 3H40A 3DRPA 1KHWA 3HHNB 2WW4A 2BJ9A 3GV8B 3BPSP 4AHRA 2ILZA 3CUNA 5EE9A 5BPMA 2YWGA 4ZLNA 1X0PA 4CJVA 4DR2J 1HNVA 4OI0A 1VJQA 4Z7YA 2ZOGA 3LAMA 4DOBA 3M6WA 5K14B 3RB4A 4OZ5A 1RT3A 3CMEN 3H8JA 2VA8A 2GJIA 3L4BC 3CCMS 1N34J 2FJEB 1HWJA 4DR5K 5AKHA 1GLAG 3ZSYA 4ECUA 4JKGB 3NDKA 1TP7A 3LAKA 2DY4A 2D3UA 3A13A 4FBUA 4DTRA 4NA2A 4DR7F 4CFBA 2G9OA 4JV1A 3QNNA 1AROP 1HBNA 2GLEA 4QR0A 3PDNA 2IDOA 3WT0A 3SMSA 3L0QA 2D9PA 1WSGA 4JI5J 4ILLA 4UB8U 4YMNA 1LVHA 4O3NA 4IG3A 2WK4A 3P31A 4Y00A 4YOWA 2BH1A 1CULA 3JS6A 3MOJB 1TFYA 2GVDB 1TL4A 3KUHA 3TNVA 4KMUA 2KJWA 5D49A 5DK5A 3DOKA 1T05B 4I2CA 8ICXA 1ZQTA 1BMQB 3ENAA 4FJHA 2CGJA 2YKPA 1QHAA 2B56A 3J7YP 4MFAA 3CCLS 1CZAN 3ZZZA 4M3YA 3PW4A 4EWTA 3IR5B 4Y2QA 3QNMA 4YOTA 4TQSA 4ATNA 2Y1JA 3I5CA 1X4GA 2CPYA 4N76A 1HNXJ 2KHCA 5GIOA 1Q7YT 5IZHA 3P3DA 3MURP 4ZPWR 4A8QA 3HX9A 5HLFB 1KFTA 5AE2A 3LP0B 3V6JA 1N5YB 2WAQF 1S57A 1KVIA 3PVXA 2EZZA 3TKAA 3OBWA 4EEYA 2JV3A 1T9XA 2QX0A 2IBKA 4DPYA 4FWKA 5KG1A 4QQBA 5AQGA 4JKBA 2CNKB 4YOEA 2HS0A 2RS2A 3DLLQ 4NYFA 1ZD2P 2FHJA 2Q1LA 5AXLA 2PEBA 3CMAN 3DCAA 3ET6A 3ZD9A 4EAHD 3ISZA 1DAXA 1C0FA 2KT5A 3UNYA 1SXEA 1I94K 3VQBA 4HH0A 3K5MA 3I5AA 4L72B 4FWNA 1JRPA 3V9SA 1ZBHA 3DMJA 3M6ZA 4OMFG 2D8CA 8ICPA 2QWMA 4P4OA 3N5FA 2OCEA 5E41A 4QPTA 4CO4A 1L8LA 4HCBA 2HPUA 4NLQA 2KOBA 4RW6B 4U95A 3KK3B 4F4YA 2FLOA 1SKWA 7ICLA 1Q8KA 1ZQMA 4WCEL 3GDXA 2MEWA 1U0HB 4O5EA 4KITB 2FJAB 1KC8T 3N0VA 2Z58B 2VC1A 4H0VB 4MQ3A 1QLNA 2J0QD 4DR1J 3RH4A 2JL9A 2QIFA 3KLGB 1U1KA 4M3WA 2ES6A 1X7VA 1Q9XA 5H1SQ 3GYXB 3VEWA 5HVHA 2ROGA 4F04B 2LBOA 1WF2A 3AO3A 2XNQA 3I0RA 1S1TB 3HHLC 2JVRA 1N54B 3D66A 2NUBA 1ITGA 5KFEA 4FNIA 3SK3A 4DFKA 3ETOA 1C0UA 5KT4A 3TU5A 2FSKA 2VPYB 3QXGA 3D2WA 2Y1LB 5AIAA 1S0MA 1UPPA 2OSRA 5AZJA 4Y2SA 2OPPA 1QH9A 1VDHA 3A5MC 1RWPB 4FK4A 3GYGA 1K6YA 5IWAK 5AQZA 3BJYA 3ZTSA 4PQAA 2WC9A 4I6AA 4B3MF 2IM1A 3G8SA 1LAWA 2CH6A 3OA9A 4L3QA 3GG0A 4MEXA 5DETA 4KBIA 4AHCA 2MZSA 4YNQA 2Q0UA 1G6BA 2GX9A 2B5JB 4BRPA 1GEHA 5AXMA 2XM3A 4A2AA 1TAQA 1S1UA 1X8DA 1UWBA 3U27A 1SJRA 5KRSA 1QVFR 3KOAA 4ZVGA 1HBUA 2XYPB 4CO2A 5A0LA 3AVLA 3L9ZA 3QEIA 3I56N 2PFNA 3THPA 1NCLA 4YOVA 2HMPA 5GTHU 1BUXA 3UDVA 2J0SD 3NWRA 5AK5A 1SKRA 3DHWC 1BA1A 1UVIA 4I56A 4HYKA 1DTTA 2ZC4A 2HHWA 5J2CA 2QTDA 1SWVA 2Y9UA 1J5OB 1URNA 3OTBA 3VESA 1GXTA 3J80Y 2ACYA 2ZBIA 1XMQF 1HJPA 4KB7A 3JTPA 2RLTA 1URRA 3O3FA 1Q9YA 2YQ3A 5HK4A 2ZWOA 1FIQA 2HNYB 4QIVA 4U7UD 4Y2RA 3HHLD 3O9QA 5DGAA 3NH2A 4DV1J 2AQ0A 1QTMA 4Y2TA 1U2CA 2I2YA 4RQ6A 4A4JA 3TA1A 5IM0B 2YHAA 4E7JA 1UVKA 1HHTP 1NDCA 2A5XA 3OSPA 1M6YA 4C0ZA 5CB1A 3RG6A 3GZFA 4ZH4A 2E2QA 2QGFB 2DHAA 3EZOA 3NVYA 3QUTA 3IBFB 1JK9B 2G09A 2KZMA 6FD1A 3N4QA 4XK8C 6FDRA 2DXDA 3WDOA 3J7ZT 2GX8A 5KAKA 1FE4A 3QYPA 1CSJA 2EBGA 2V68A 3LP2A 4DR2K 4I7FB 3SUQA 2ZNYA 3EDRB 4LT6A 3RJEA 5F9LA 4PABA 4OLPA 3V1OA 2KVSA 1N34K 4UZCA 3CCVN 2I6XA 1IUJA 1D8YA 3FCWA 2LPEA 4JI1J 4YHHJ 8ICSA 3I1YA 3LUYA 4IRCA 1UFLA 1RDAA 3B0YA 1S7IA 4OVLA 3SMZA 3BS5A 3TTCA 3ONQA 3K4GA 1WOOA 1RDBA 1XUPO 2HFZA 3SQ2A 4DX6A 4UARA 1NJWA 3E9PA 4EHTA 4JI5K 3GMGA 3FRZA 3RBDA 2ZKUA 3C8YA 3M2UA 4ELTA 3ZT4A 4M1KA 4RW9B 2JHDA 4J8FA 2DYAA 2NRTA 4HLBA 1JLBA 2A41A 4RQ2A 3THXA 1GAOA 3RAMA 3PUFA 1TGOA 3MEDA 3UKRA 2XY5A 3KUEA 1HL6A 1UEVA 2BKEA 4DV4J 4Z4EA 3AN1A 4AUKA 2BCSA 3NS6A 4KHSA 4U8YA 3D7SB 3I5BA 3BQTA 3VETA 3VTIA 2CQ0A 4HT7A 3VAHA 4YOXA 1NPRA 4OPAA 5AE3A 5FP0A 5CWRA 1BWVA 3CSKA 1N36F 5KT6A 3CJ4A 4ISFA 2L08A 5BYSA 3HKZC 3CD7A 4LF8J 4ZTFA 1HNXK 3BGOP 4FF3A 5C0YA 4CGFA 3DLEA 1EETA 2W2MP 4QZGA 2BEFA 2JOQA 1VRQC 2XS5A 1A76A 1TMMA 1N5XA 2FLNA 2XZWA 1K5OA 1XO1A 1HIWA 3ETMA 1B7YB 3AVIA 4G1IA 4UUXA 1YJ7A 2B8PA 4F5PA 1KR4A 4R8UA 1TMJA 2ZIUA 3MX5A 4KRFA 4MIAA 3GG4A 5C15A 3QBCA 4X65J 4JN4A 4WPAA 4FXVA 9ICPA 3SYZA 1HX1A 2MY8A 2UYTA 3AD7C 3DRRA 2HHPA 3AH6A 3H5SA 1NZPA 1FJCA 1RTHB 2RU9A 5CHCB 2XS7A 1Q8LA 1T6CA 5DQHA 3GB0A 4U67L 2M0GB 3OYBA 4DU4A 1ZQNA 1R3NA 1IM6A 1Y5NB 3QRRA 4UB6U 1Z00B 4ZP7A 4PA1A 4ZVPB 3G4SN 2RAQA 4UW9A 3RFAA 4MK8A 1ZQQA 1K8KB 5KG2A 2GMHA 5BR9A 4CZLA 3OYEA 2ZD1A 2MTLA 2R2SA 1RCXB 4K0KF 3NRWA 3B78A 4P0PB 2XLJA 3ZDBA 3RAXA 5KPTA 4IDKB 1ZQFA 5EWEA 3HZEA 3TRGA 4LF6F 4X4TA 1WYGA 2OYYA 4WFNQ 3PJ9A 2R2RA 4J9MA 5ALTA 4LVSA 4M9GA 3C19A 1NDLA 3BBCA 3S3OA 3T1YF 2M9NA 3V2UC 4I2AA 2AMCB 1WG8A 2DNYA 4G1PA 5I3UB 2F4VF 2WUSA 1DFDA 2AEFA 2HEKA 1KEJA 1GTEA 4HCCA 1QE1A 1DHMA 4C4SA 5GAHU 1VC6A 3M9MB 2QMUB 4JEPA 3OPKA 4UASA 1UFKA 5HOOA 2Z2YB 4ES1A 1OY6A 2VQEJ 3U02A 4DR1K 4DU7A 1CJTB 3ZSQA 2KYXA 2LFVA 1BPZA 3HKZD 2VBXA 1T3VA 4PY5A 4NLNA 1UAXA 2B4UA 1EWQA 5C7PA 2JLEA 2F9JA 3KG1A 1T4GA 4J9VA 2ZE2A 4X62F 5AM0A 4OJRA 4UOHA 2CG4A 2KVQE 1BQNA 4PWDB 3Q8RB 2K89A 5J29A 4NLGA 2VG7B 5HO4A 5ADXA 2NR0A 3L2RA 3A8EA 4IQUA 3UQ2A 3CJBA 3TWHA 1FRJA 4LIWA 4DV7F 4DQRA 4OHZA 4FYWB 1SH0A 5A76A 2PD1A 4NXNJ