3THVA

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddatp-dt in closed conformation
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
total genus 201
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3thvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3thvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3thvA01
2FBVA 8ICAA 1S1TA 1KFTA 1RT6A 4KRFA 1BPEA 2V9WA 2ASJA 5KFTA 1G15A 3MDAA 3B6PA 4LSLA 5HROA 4C8OA 3VQEA 8ICMA 4TUSA 1NJZA 3ULDA 3VQDA 2B21A 1CUKA 4LVSA 1IH7A 3RJKA 3K2PA 3HM9A 2ZJ8A 3NGDA 5J0YA 3H40A 4PH5A 2BCUA 1J9AA 2GUIA 4DQQA 3DLRA 2XGQA 4YP3A 2DY4A 3ZDDA 4HUFA 3WNHA 4RPYA 1JLAA 3T5JA 5HMMA 1ZQSA 3AVIA 9ICHA 3OYJA 4DTJA 4Y1DA 3LWMA 3V7LA 3AVLA 4QZHA 4R8UA 1RTHA 2Z1GA 9ICMA 3F73A 5CYMA 3AVBA 5KFWA 3AA2A 1Y88A 3G10A 1TV6A 4UB3A 3HYFA 1JLBA 3HL8A 3AVHA 2XC9A 4OKJA 2IGIA 2ITGA 1ZQPA 4ECSA 3QEWA 4FJJA 3KKRA 4RW7A 1RDCA 4YMMA 5KG2A 4ECRA 2ZD1A 2OZSA 2BCRA 3Q8SB 5IINA 2VWKA 4ECZA 4F3TA 5SZTA 4K8XA 3PR5B 3ZT4A 2ETJA 2HB5A 3V81A 2QK9A 3AVNA 3NGZA 4E7HA 3AA5X 2VG5A 3V6DA 1X2IA 3ZSXA 1FKPA 4YN4A 1BI4B 4N56A 8ICVA 4KLTA 1S77D 5CWRA 4DFJA 4CHPA 3IM1A 2IS3A 4KLIA 3QEBZ 4NLGA 4GW6A 3VQ4A 4FS2A 4B8AB 4KREA 4TUPA 2VA3A 3NAEA 1Q8IA 1N5YA 1ZQDA 3TABA 2G8UA 4ECYA 5DLGA 3MR6A 4M3ZA 4UB1A 3RJEA 3RR7A 1GOAA 2XY8A 4E89A 2C28A 1JXBA 4F93B 3V6JA 4ZTFA 4TSXA 3P1GA 1RT5A 1S5JA 3OSPA 5CA7A 1L3UA 3SCXA 1ZBHA 1XWLA 1LWEA 5DKWA 4RU9A 4DTPA 2OPPA 4QOZB 1T3NA 2BGGA 4CGJA 3M9NB 1Q9YA 1IXRA 3CG7A 4JS5A 4FLUA 2Z1IA 3LP3A 1ZQCA 3AVKA 5C24A 1J54A 5J2EA 3OVNA 1TGOA 5KFGA 2FBTA 4F4KA 2RDJA 1T7PA 4I28A 4O9MA 3H8JA 3AUOA 4CJTA 4F50A 1NKBA 2DPIA 1JL2A 3O3HA 2PFQA 1SKSA 3F9KA 4GC7A 1RTIA 4JWNA 1NK0A 3Q8MA 3BJYA 3BQ0A 1BHLA 1CEZA 2W9MA 1S6QA 3T5KA 4K8ZA 3TFRA 8ICJA 5KG4A 4IR1A 1DTTA 4RPXA 5KFFA 1TL1A 4IFVA 1S0VA 4FCYA 4F92B 2A1RA 3G6YA 1BI4A 5HRNA 4B9NA 4DSKA 1YTAA 4C8KA 2P51A 1HUZA 1UA1A 1TK8A 3DRSA 1FXXA 2X6SA 4WE1A 4AHTA 4QZCA 4ED7A 4ECQA 2Y1IA 1ZQOA 1X9SA 2BCVA 3NH2A 3V4IA 3OYLA 4FS1A 2VG6A 1JXEA 3OHBA 5BOLA 1JLEA 3JYTA 5IIJA 5J0UA 1B43A 1Z00B 9ICWA 4QCLA 4FLWA 4K4HA 3N97B 2X74A 4ED3A 3I8DA 4UQGA 3V72A 3K57A 1S1UA 4CEZA 2VANA 3LAMA 4N76A 4NYNA 2B4JA 2B6AA 3SQ1A 4M3WA 4ECUA 3C1YA 4KHQA 3QEAZ 5CP2A 1HNIA 5I3UA 3O4NA 4B8CA 8ICGA 1KVBA 4KFBA 1A77A 4QWDA 3G6XA 2IMWP 4ELVA 2F8SA 4I2JA 4F4YA 2JEJA 1HQEA 3KLIA 1RXVA 9ICAA 2DFEA 2ASDA 1ZBLA 8ICRA 4CGGA 9ICEA 3GQCA 3ZDAA 4M3YA 2UVUA 4FYDA 4PGQA 4CHQA 8ICYA 3S3OA 2IOCA 1NKEA 3RBEA 1UAXA 4W5TA 4BDYA 3ZSRA 1S9EA 4HCBA 1BGXT 4GVMA 2E6LA 2IAJA 3QZ7A 1XU4A 4QWAA 1KVCA 4X5VA 4JLHA 5DDMA 4JV0A 3LANA 1JN3A 5EWFA 3ALYA 1RBRA 5KI6A 2ZUDA 5FRMA 3ZSZA 3RMDA 4JUZA 3PW4A 1ZQMA 5J0OA 1C7YA 1SUQA 2PYJA 2WTFA 1REVA 4J2AA 4I2EA 4GXKA 5KG3A 3H4DA 2HNZA 2BPGA 4CFAA 4KLHA 2DPJA 3K75D 5DBCA 3NDKA 4DU1A 4IDKA 4AHSA 3I0RA 2YNGA 1EXNA 4CJSA 3MAQA 4FJ5A 4Z4CA 1DOQA 3MEDA 1Z00A 5KG5A 4F5OA 1HYZA 3PX0A 4QZBA 1RBUA 5BPCA 4NCAA 3TAFA 2W9CB 5EOZA 1BISA 4YR2A 4PWDA 4QZ9A 2Z1HA 5KFHA 2G8HA 4KN4A 4DFPA 3ZT3A 1XSLA 3CFOA 4CGFA 8ICHA 2YNIA 2BCSA 4BDZA 1VSMA 3C5FA 4YCXA 1NK6A 3ZDEA 4DTSA 3OJSA 1JXLA 1IKXA 4DLGA 3KLHA 4YMOA 1X9MA 2GWSA 3L2QA 1Z25A 4FJIA 3C2LA 4R64A 1C1AA 4Z6CA 4GXJA 4CJ4A 1WNSA 4JV2A 5DQHA 3PMNA 2ZJ5A 5IIKA 3LDAA 4JV1A 2JLEA 3LALA 3NHGA 2ZE2A 4DTXA 5J2GA 7ICEA 3QLHA 4DL5A 5TZVA 4CCHA 1T03A 1C0MA 1ZBUA 2YNFA 1UT5A 5DBAA 3HPOA 4DU4A 4DSJA 4RW4A 3FDSA 3L3UA 2YKMA 3C5GA 1LWFA 3RJJA 4YR3A 3RH5A 8ICKA 4B08A 3AU2A 1JLFA 3HP9A 1XSPA 5KFAA 3KKSA 1X9WA 3T1AA 3AVMA 3PW7A 4KO0A 1BQMA 1ZBIA 1N6QA 3NFAA 3VQ8A 7ICJA 2W9CA 3DMJA 1TK0A 4UAYA 1VSDA 5KFQA 4OKKA 4IRCA 4RW6A 4JRQA 4FW1A 1WLJA 3T5LA 2J6UA 3BQ2A 2DTUA 4EP5A 2AJQA 3AVJA 3MGIA 4IQUA 1BQNA 2W8LA 2VG7A 3OYIA 2FBXA 4CGDA 3PVXA 3OYEA 5KG0A 3L2VA 1RDAA 2V4RA 1PZNA 1ASWA 1CZ9A 4KTQA 2PXIA 4NCGA 1HMVA 3SNNA 4QZ8A 1S1WA 3ISCA 2A1SA 5DMRA 1NKCA 1RNHA 4KHWA 1IM4A 2IBKA 1VRTA 2ZUBA 1WSEA 9ICJA 3RRGA 2XY5A 4EEYA 1RDDA 2W8KA 4CFBA 3UXOA 4M41A 2FLNA 3LAKA 1BCOA 4Z0UA 4KITB 4CIEA 3M8SA 1BPDA 1XI1A 3RBDA 3T3FA 4M9NA 4FBUA 3DRRA 2DFFA 2XRIA 3LPTA 4DQPA 4YXJA 4CEQA 3HO1A 3CM5A 4RQ1A 5C42A 2BR0A 4RQ2A 1ZQLA 4P2HA 2YNHA 1R0AA 3I0SA 3S9HA 1RBVA 2X6NA 4ELUA 4N41A 3LDSA 1NK5A 4O3RA 4EBCA 3RAQA 1RBSA 5J2AA 4DL6A 4CEAA 4CJWA 3IG1A 3V1RA 2UVRA 4ZTJA 5EWEA 1XS9D 4RNMA 3KK3A 3VQQA 4YD2A 3E2EA 2OZMA 4B9SA 3HK2A 3PO4A 4B9VA 3MFIA 4Y1CA 1BPXA 4BWMA 4KLLA 2NRTA 4NYFA 4ECTA 2PY5A 3AA3A 5KT6A 1U47A 5F9LA 5FROA 3V9SA 1CLQA 4MF2A 4O55A 5KT5A 3UPQA 4DSEA 3M8PA 3CM6A 4XQ8A 4CF8A 4GLXA 3NF9A 8ICOA 4DSLA 1B9DA 2RF2A 1ZQTA 3UXNA 4LY7A 1SKWA 2ATQA 1TAQA 3PX6A 4ED2A 3QEVA 5KFYA 4M2YA 3K5LA 4R63A 3A2FA 3VQPA 2BGWA 1VSJA 2KFNA 1ZQXA 4DL7A 4E7LA 3H8WA 2ALZA 3MXIA 1J5OA 3AO3A 4J9PA 5IIOA 1JMSA 3NF6A 2JZBA 4I27A 3M8QA 3IS9A 4FK2A 4Z4GA 3OYHA 5CY4A 4M04A 1HYSA 1NK4A 2R8IA 1HJRA 5KFCA 2QKKA 3E01A 1LB2B 4E0DA 1TKXA 4J9SA 3PW5A 4RNOA 3KIOA 1O1WA 4CJ5A 8ICFA 1TAUA 3Q8QB 2AU0A 4CECA 4RQ7A 1LAVA 2H5XA 4M9HA 3JPRA 4Z4HA 4H8KA 1N48A 5KFZA 4LZDA 3PR4A 3OYNA 4O5CA 3SQ0A 1ZQUA 4RUCA 1NJXA 2O4GA 1QLNA 4FO6A 3O4QA 5D49A 4K4IA 4J2BA 3TARA 2P6UA 4I2DA 4W5QA 4RT3A 3VQ7A 1FK9A 3NF7A 4CJVA 3C2MA 4KLFA 1D8LA 4KLMA 5J2NA 2WONA 1S9GA 3DLKA 1CXUA 4CJKA 4P4OA 4DOAA 4I9QA 5KT2A 7ICUA 5D3GA 4KAZA 2F96A 2C2EA 4KMUA 2Z1JA 5CHGA 3V9UA 3RR8A 3SJJA 1BIUA 5DQIA 3SQ2A 4J9LA 1TKTA 3N4MB 4M3UA 4KTWA 4JRPA 2KW4A 2KQ2A 1ASUA 3L2WA 3AO2A 1RT2A 1C0UA 7ICGA 4CJUA 2YHAA 3VQ5A 4KHSA 4CE9A 4Q44A 3EPGA 5J0XA 2BPFA 3V9ZA 4ECXA 5HMLA 5DGBA 5CYQA 4CIGA 2R7YA 1EX4A 1A5XA 4CJQA 3OYMA 3QIOA 3OYKA 2O4IA 1S1VA 4KLJA 4FJLA 3HT3A 1XO1A 4J2DA 2HMIA 3ZT2A 5DB9A 5D46A 4O3QA 1RZTA 4FLZA 1U04A 3JPSA 4CHOA 7ICKA 3PW2A 5HP4A 2BHNA 4DU3A 5DGAA 3VQ9A 4Q43A 5KGWA 1JX4A 4E7IA 5E41A 3MEEA 4DTRA 3TAEA 1ZQRA 2UVWA 3QERA 4O3NA 1WSHA 2W42A 2M9NA 3HVRA 4IRDA 3C94A 4LH4A 1LW2A 3MR2A 3TI0A 3GILA 4FJXA 4BDPA 3VQCA 3ZSOA 2GBZA 5J2JA 4M9LA 4QZAA 3JPPA 2D5RA 1U45A 1NOZA 4FJKA 4O4GA 4JS4A 4F4XA 4Q0BA 2ZUCA 4DOBA 7ICRA 4O5KA 4CF0A 3C2KA 1WAFA 4KLEA 2BE2A 4MQ3A 3QEPA 1S6PA 1C1CA 2XO7A 5DLFA 4CEDA 3IAYA 1S9FA 5L1JA 3L2UA 3KHHA 1EETA 4GXIA 3C21A 2PI5A 4AHCA 4QZGA 1W9HA 2RDIA 3RJHA 2BDPA 5KG7A 4DSIA 5DB8A 4PY5A 3AU6A 4EBEA 3U3GA 5DDYA 4YVZA 4PHDA 1H38A 3TWHA 4M0AA 4M6WB 5I42A 1K1SA 5KG1A 3Q8LA 4W5RA 2R8JA 4KLUA 5HRRA 2AGPA 4CIFA 7ICPA 1J53A 3SI6A 3AVFA 3GV5B 3OJUA 5J2CA 5KGXA 3OYDA 3JPTA 3ETLA 9ICFA 7ICFA 4RQ0A 9ICUA 4CHYA 4R65A 4AILC 3MXMA 2XGPA 3P5JA 3KLGA 9ICTA 2HHWA 4ED1A 1WSIA 4OPKA 4FLTA 1ZJMA 3OYFA 4J9OA 2VA8A 2PFOA 9ICOA 3VA3A 2Q0ZX 4DTMA 1HQUA 3WNEA 1NJWA 4FVMA 3Q8PB 4I7FA 3T5HA 2QXFA 3OS2A 1TVAA 8ICLA 4UBBA 4QWBA 4FW2A 4KI6A 8ICBA 1QQCA 2C2DA 3THVA 3BQTA 1IKWA 2NRVA 5FDLA 4N47A 4AH9A 3RMBA 5J1EA 4IR9A 4IRKA 1COOA 4UBCA 7ICNA 2YV0X 4HCCA 2I5JA 2XCAA 4CK3A 4KI4A 1EP4A 1VSEA 3AO5A 3V1QA 4M3XA 4OVLA 3ZT1A 3ZSWA 3JPQA 5DG8A 5J0QA 5JS2A 1SL2A 5DB6A 5L1LA 1B9FA 4I2AA 4B9UA 1X1PA 5J2KA 4MEXA 4N5SA 4PHAA 3MEGA 4PUOA 1KEJA 2ISOA 3LP1A 4DQSA 2LSNA 4DOCA 3UQ2A 2BQRA 3C23A 3PY8A 3TR8A 3DLHA 4I2PA 1QSLA 2C22A 5KFJA 4DEZA 5DG9A 4PQUA 1QS4A 3PV8A 2HHXA 4CGIA 4ID1A 2BANA 4IQWA 1GOBA 3LP2A 3M8RA 1ZQIA 5CZ2A 4C8LA 3JPOA 2IA6A 2BCQA 7ICLA 3KHRA 1JIHA 3PNCA 5HBMA 2D0CA 5L1KA 1S76D 4FM0A 4O3PA 1ZQWA 5IILA 3T19A 1RTDA 2XY7A 4BXOB 2JEFA 2W9BB 1S97A 3KLEA 7ICTA 1F21A 1SZPA 8ICCA 3NH0A 1ZYQA 3TAPA 4FXDA 4KLGA 1BPBA 8ICSA 1JKHA 1KCFA 3GDXA 3LPUA 3O3FA 2FC0A 1ZQNA 5KFPA 4K4GA 7ICQA 4DS4A 4OJRA 4DL2A 1L3VA 5J2MA 4DL4A 4YD1A 3RAXA 4F5QA 1CXQA 4KB0A 3GIJA 3K4GA 4ZH4A 1HJPA 2F1JA 2HVIA 4J2EA 4DLEA 4KHNA 5KFIA 2ZTEA 4G3IA 1L3TA 1IKYA 3RMCA 3UIQA 1ZQBA 5JS1A 4XIUA 3FFIA 9ICIA 1SKRA 4F5NA 3EYZA 2YHBA 4KN7A 3RJIA 4H4MA 3NF8A 1Z3EB 3B0XA 4ED8A 1TKDA 4FM1A 4FJNA 2P5OA 1TVRA 3MABA 2GV9A 4FM2A 1RTJA 2X78A 4PA1A 3ZT0A 4O0JA 3DYAA 3Q8KA 2EX3A 2P5GA 4RQ5A 2PFPA 4E3SA 5KFVA 4UB2A 1DGSA 2Q3SA 3V7JA 1VRUA 5HRSA 1L3SA 4DTNA 4NXZA 3PUFA 4KLDA 9ICCA 4IQTA 4I2IA 1D5AA 2FLLA 1D9DA 3PO5A 4J9QA 5CZ1A 4HUEA 3BDPA 3H7IA 3ISDA 2RPIA 4IQVA 1ZQQA 3QNNA 1SL1A 4OGEA 3NBPA 3AVGA 3QNOA 1NOYA 1S0NA 3K5OA 2W9BA 4MFFA 5F9NA 3L3VA 4IBNA 4CHZA 5KG6A 1U48A 2KFZA 4HYKA 4M45A 4JWMA 3EY1A 4RW9A 4FK4A 4GC6A 2OA8A 3L2RA 2Y1JA 3OYGA 4YFUA 3V9XA 9ICSA 3KHLA 4TQSA 2FPLA 3BGRA 3RMAA 3FYHA 3RB6A 2ISPA 3SV3A 2AQ4A 2I1QA 3VQAA 3H8SA 4F8RA 3K5MA 4FZYA 1KVAA 5HLFA 2HHTA 2F8TA 4RPZA 2EHGA 1MQ3A 4XRHA 2HHSA 4NLZA 2P6RA 1HRHA 4DMNA 3RH6A 4W5NA 3AVCA 4YQWA 1WN7A 1K1QA 5J2QA 4BWJA 3PW0A 2J6TA 2OPQA 4FJGA 5CJ7A 3C6UA 4OLBA 1RXWA 1KSPA 2HHVA 3TAQA 3DLGA 8ICIA 2D0AA 2OWOA 2FBYA 2NRXA 3DM2A 3QO9A 1ZQGA 4DTOA 1MC8A 1VK0A 4FK0A 2R8GA 4LH5A 2VA2A 3K5NA 4BACA 2NUBA 3HXMA 4CEBA 4TURA 4KTZA 3LWLA 3CFRA 4RZRA 5EU7A 4P4PA 1VSKA 5BOMA 1WAJA 8ICNA 1WSFA 3SUQA 2ZQBA 3OY9A 3SUPA 3DLBA 1VSIA 1ZQZA 1ZJNA 1ZQYA 1D9FA 4DS5A 3MFHA 3KHGA 3C6TA 2IHNA 3V6HA 2MAXA 2FMSA 4Q8EA 3DRPA 1S0OA 4BE2A 4YXMA 4RT2A 4CJPA 1U9LA 4CFCA 7ICVA 3KTQA 2JGUA 3L8BA 1MSWD 5J2FA 4QWEA 3IRXA 3JSMA 3DOLA 5CR0A 2KZMA 2YKNA 3S3MA 5HRPA 3AVAA 4FBTA 4KPYA 3D45A 1QSYA 4EZ9A 1EXQA 1TV9A 2XCPA 4J9NA 2P66A 5KFEA 5DB7A 4DL3A 2AGOA 3IHQB 3UXPA 4EYIB 4FLVA 4O44A 4Z6DA 1A5VA 5J0WA 5KTQA 4CK1A 1K6YA 4CGHA 1Q9XA 2NRWA 5JUMA 1N56A 3ZDCA 1C6VA 1DLOA 4KLQA 3TQ1A 1S0MA 4DFKA 4YMNA 1L5UA 8ICTA 3NCIA 9ICGA 3SV4A 1LW0A 1RT4A 4B9LA 3EW9A 3C95A 2ZTCA 3RRHA 1U4BA 4Z6EA 3OS1A 1S10A 3EPIA 4E1NA 2E6MA 4LZGA 3TAMA 1TK5A 2PYLA 4E7KA 4KLSA 3VQ6A 1ZQVA 4ZHRA 5IIIA 4E7JA 3EZ5A 4EBDA 2F1HA 2RN2A 8ICWA 3V9WA 3P83D 1A76A 4RG8A 2PZSA 1TKZA 5DK5A 3ZD9A 5J29A 2ATLA 3QETA 5J2DA 4DSFA 3SPYA 4RQ6A 4B9MA 5KFOA 4B9TA 4DTUA 5L1IA 9ICLA 5KFXA 3JPNA 1RILA 3ITHA 4YR0A 1BPZA 5KRTA 3H4BA 3HSTB 4RNNA 3KD5E 4CEFA 1QE1A 3LZIA 1MU2A 4CJRA 1TFRA 5J0SA 3SI8A 2MUTB 2R8HA 3M9OB 4KB1A 2P1JA 3HX0A 2PI4A 1KTQA 4I2FA 3ZSVA 3KLFA 4L8RB 4CJ3A 7ICSA 4OGCA 1WSGA 3SQ4A 7ICOA 4NY8A 3V6KA 1Y97A 1HPZA 4F5RA 2OYQA 4QW9A 3DI6A 3KD1E 3OHAA 1T4GA 2AQ0A 4PHPA 4FLXA 5KT7A 2FPKA 4J9RA 1LV5A 5HP1A 2WOMA 8ICZA 4QZDA 5KFUA 4M9JA 7ICHA 1TL3A 3LK9A 4ECWA 3NGIA 4O5EA 1V9PA 2KTQA 4JK1A 4ED0A 1RYSA 4ID5A 3CYMA 3HPHA 4NM2A 1HUOA 4FJHA 1SV5A 3MDCA 4J9KA 2AGQA 2F1IA 1B92A 4QAGA 1BL3A 4RUAA 3PX4A 4DF4A 3CFPA 1NK9A 1CZBA 3U6FA 9ICKA 1BVSA 5J0RA 3OYAA 2G8VA 4CF9A 4NLKA 2J6SA 2IC3A 1IG9A 1AROP 3OSNA 5KFKA 4FJ8A 2JEIA 5HHHA 4W5OA 1NK7A 4Z4IA 3V7KA 2KZ3A 1VSLA 3WNGA 2MUTA 4HUGA 2KN7A 3RB3A 3QINA 5CB1A 1RT7A 3QIPA 3WNFA 4C8NA 4MEYA 1SL0A 1I3AA 4NM1A 4F4WA 3V1OA 4ICLA 2QKBA 1RDBA 4CFDA 2R8KA 2ASLA 3AO1A 4MFAA 8ICEA 1LAWA 1RYRA 3TANA 4DG1A 4IG0A 2HNDA 5C5JA 4ELTA 1ASVA 4O3OA 3ZD8A 5J0PA 4I2GA 1HNVA 1NOMA 3VN5A 2D0BA 4AHVA 3MR5A 4KLOA 4TQRA 3RH4A 1WSJA 1QTMA 5L9XA 4AHRA 5FRNA 1T05A 2ZJAA 1BPYA 4I2CA 1KDHA 1XC9A 3BQ1A 5T7BA 2FLPA 4F2RA 5DBBA 3GIKA 1IO2A 3ISBA 4Q45A 4O0IA 2HHQA 5D4BA 4F4ZA 3HJFA 2BQ3A 4CESA 4ECVA 4RQ4A 3MECA 2FMQA 2C2RA 3QE9Y 4G1QA 2V4QA 3RB4A 1XHZA 4KHYA 3G0ZA 3M9MB 4Z6FA 3ZSYA 2RKIA 3TAGA 3AV9A 2NRZA 4J9MA 3OGUA 1KFSA 2DFHA 4B3OA 3HW8A 3EWAA 2G8KA 2FMPA 4CEEA 4M6WA 4Q8FA 1XHXA 1UOCA 4GMJB 1ZQJA 5HNKA 4E19A 4I2HA 5KFDA 4H4OA 3UQ0A 2XHBA 4R5PA 3B0YA 4KHUA 4CERA 4Q5VA 3NH1A 2VWJA 1JLCA 1QSSA 3Q8RB 2HVHA 2HNYA 2A1JB 4DO9A 4EYHB 3RB0A 5KT3A 1UA0A 5KFMA 1A5WA 3MGHA 3DOKA 4I29A 4AHUA 4CF2A 4E1MA 4BGDA 4IFYA 4I2BA 4OPJA 1ZQKA 3H08A 5DG7A 1ZQFA 3SYZA 3ZSQA 3MR3A 4MFBA 4O3SA 7ICIA 8ICUA 2G8WA 5J2BA 2ZTDA 3C1ZA 4PGYA 4M3RA 4FZZA 4F2SA 1ZQAA 2G8FA 2HHUA 4QW8A 4DWIA 4M42A 4MFCA 4M9GA 4F91B 4I2QA 1YTUA 5J0TA 2E4LA 2PFNA 3SPZA 2UVVA 5HHIA 9ICRA 3VA0A 5K14A 1D8YA 3KK1A 4CEOA 4F3OA 3S3NA 4QWCA 4EZ6A 1HYVA 4FJMA 3ASMA 4UB4A 3QZ8A 9ICVA 5EWGA 4PPXA 4HHTA 3MBYA 4XUSA 9ICBA 1RT3A 4NCBA 8ICPA 3GFKB 4YFKA 1XSNA 1S1XA 3DLEA 2KZZA 3QEIA 3GIMA 1LWCA 2OPSA 2BPCA 4P4MA 1ITGA 1T8EA 3RTVA 1FKOA 1I39A 9ICPA 1UT8A 3QEXA 4IG3A 1C0TA 4CJFA 1VSFA 3ISNC 5SWMA 4UB5A 4RQ8A 2A1JA 1KRPA 4O5BA 4FJ7A 3D0PA 5C25A 2OPRA 4KKOA 2IHMA 5KRSA 3K58A 5KFBA 3GV8B 1UWBA 1RPLA 4M47A 8ICQA 1JL1A 4KV8A 3K59A 4OKEA 3OYCA 4PGXA 2XY6A 5J2HA 3TFSA 1ZQHA 5IIMA 3B6OA 1ZQEA 1EKEA 4FLYA 5KFNA 4CF1A 4YG2A 4IKFA 3O3GA 3GV7B 4R66A 3CQ8A 1YVUA 4BXOA 1BCMA 3RJFA 1C1BA 1WCNA 1NK8A 4C8MA 3KK2A 3QESA 3KJVA 5J2PA 1RBTA 3NGYA 4DF8A 2BKEA 1ZBFA 4MF8A 1QHTA 4EP4A 5KT4A 2BQUA 4DQIA 5KFRA 4FJ9A 4Z4EA 3AA4A 4QZIA 4LD0A 4CK2A 3HPGA 1IKVA 4ED6A 1NJYA 4QZFA 7ICMA 3ORYA 4BE1A 1DTQA 2LYHA 4RQ3A 3ZDBA 3SZ2A 4Z4FA 3GIIA 4UAZA 4PHEA 2G8IA 3SUNA 1KLMA 2IDOA 5J2IA 1WCLA 4NLNA 4M3TA 4HTUA 3HVTA 4OLAA 1U49A 8ICXA 3LZJA 4TUQA 4LSNA 2JEGA 2JZBB 3G6VA 1GOCA 3LP0A 4DFMA 3SUOA 4FZXC 1VSHA 5DQGA 5KFSA 1JLGA 2HW3A 1KLNA 4UAWA 3MXJA 4R8UB 3OYBA 1MQ2A 3ZCMA 3NTUA 3AO4A 4HVJA 4XA5A 2DFLA 2FPMA 2B5JA 4QZEA 9ICXA 1BIZA 4CHNA 5KFLA 3RWUA 9ICNA 1RCHA 1W0HA 3OS0A 4CJEA 4I9LA 1B22A 1ZETA 4BE0A 3VQBA 1YT3A 4CJLA 3U3YA 3HWTA 1Z26A 3NE6A 3RJGA 4YNQA 4DQRA 2W9AA 4F5PA 3PMLA 2I9GA 1RT1A 3HP6A 9ICQA 1KFDA 1JLQA 4RW8A
chains in the Genus database with same CATH superfamily
3A5OC 2HWIA 3VTIA 4JI4J 1KFTA 1DFDA 1YHQN 2QI2A 1BPEA 2V9WA 2ASJA 3MC1A 4DPOA 1G15A 2AEMA 3H0MB 1S5ZA 4OX6A 1GLEG 5HK4A 3UVJA 2CQ2A 3FEXB 3CW2C 1TKTB 1HR0K 3NVZA 3VQDA 1CUKA 3DJCA 3CQXA 1IH7A 3RJKA 1KQSM 3QGHA 2ZJ8A 1S4EA 2D69A 4X4NA 1J9AA 2CPZA 4DQQA 1CBKA 1UZDA 2PDAA 2DY4A 4HUFA 1SB3C 2X1AA 4EFAC 2K1RB 4RPYA 2WAQF 5AICA 9ICHA 3OL8A 2X7IA 4CZEA 4Z7YA 4Y1DA 2I8EA 2VDHA 2IJNA 1WORA 1WG8A 2IRYA 2CGKA 9ICMA 4DR5K 5CYMA 2G0AA 5C24B 1LFPA 1MMDA 3HYFA 2FUG9 4IDHA 1IVZA 2XC9A 4ZVFA 2IGIA 3K2YA 4DZ6A 1ZQPA 4ECSA 3AODA 5A8WA 2HKEA 3QEWA 4JI0F 1YLXA 4UY8O 4JI7J 1RDCA 4ECRA 5KG2A 2NSBA 2W3SA 2VWKA 3MMCA 2Q79A 2ROPA 2BABA 3EUB2 3ZT4A 3NVKA 4RNFA 4OCZA 3Q2TC 2W1BA 5DDOC 3NS6A 4P73A 1Z05A 4E7HA 4FYYB 1FEZA 2MRLA 5ALPA 2VG5A 4G65A 2Y8WA 1VBXA 2F63A 2HS4A 4YN4A 5F0WA 1YSJA 2ZITA 4CTAB 1DJ0A 1S77D 4DFJA 3VQ4A 1C1CB 1HA1A 5SUHA 4ZVGA 4TUPA 4ERDA 2M0NA 1XNQK 3CDWA 1KQQA 2YX4A 1ZQDA 2ZJPQ 3V4IB 2G8UA 1CJKB 5DLGA 3MR6A 5F3XB 4KSEB 2N3OA 2HQFA 1SC3B 3I8BA 2YQ3A 2A6MA 2Z4PA 2QWLA 5C12A 2OLWA 3PYDA 4NLUA 4A4JA 2LQJA 1RP5A 3B4DA 1NPRA 4K8RA 1NGIA 3Q2SC 4O23A 1CJTA 3PXGa 2DISA 2L9NA 2VPZB 5D8HB 2CPHA 4RU9A 3HULA 4QOZB 2B6AB 1VQ7N 2BGGA 5AQFA 3VEOA 1Q9YA 4U7UK 1IXRA 2QYCA 4KHMA 4KFBB 3MMVA 5AR0A 3WKAA 3CCWA 3HJEA 3EDRB 2CA9A 3OVNA 2O8BB 3CCLN 1FFGB 1T7PA 4I28A 4ZA1A 2XS7A 3MM6B 3H8JA 2GMLA 4NYPA 4Y3CA 1AFIA 3G4SS 2PFQA 3MM9B 1RAEB 3ULEA 1D8BA 1NK0A 3BJYA 3BQ0A 1Q46A 1RISA 2W9MA 5ETTA 3T5KA 4K8ZA 3R5GA 8ICJA 3R5DA 4IR1A 3SBTA 4RPXA 2QLXA 1F5AA 2M0GB 2M70A 5ALZA 3G6YA 2JZ5A 5ALKA 1OY8A 5B0FA 4MO4A 3QICA 2WK4A 4NLWA 1HUZA 1EP4B 1REVB 4CZHA 2FPHX 1UA1A 2DUYA 1TK8A 2UXCK 4G9BA 4WE1A 3M32B 2X6SA 4QZCA 4ED7A 1D4XA 2Y1IA 3TUIC 3QMQA 1X9SA 1QTNB 1TFWA 4K41A 1Q7LB 2E1CA 1JXEA 2KH9A 3OHBA 2CJ9A 3M2VB 3JYTA 2QL9B 4CP5A 2FF6A 1RZMA 5C15A 2EBEA 4K4HA 4ED3A 3V72A 1YQHA 1DQ8A 4LFAJ 2UV8A 5TISU 3DGPB 2B4JA 3SQ1A 3DHXA 2DNYA 2ZDPA 4DV6J 2KJ5A 4A46A 3D0GE 4BJQA 1HNIA 2QMUB 2OFHX 4F04B 4B8CA 3NL0A 4F26A 4QWDA 1GK8A 2PD1A 1MW7A 2LYAA 4F4YA 2JEJA 2CJXB 1HQEA 1SXEA 1IUJA 2N3LA 5C7PA 1HUXA 3U9ZA 1RWXB 4ZPCA 3T1YK 3KJNB 4BX9C 1FNXH 5HI7A 5BXIA 2GWJA 4IH5A 9ICEA 1YXQA 1CVJA 1VQKS 5J8YA 2YWHA 3R9LA 3T7ZA 4DJBA 4CHQA 8ICYA 2KB2A 4N77A 3SSQA 1NKEA 1J5EK 2HF4A 2ZH3A 1RQ0A 4FL9A 2D3OR 5B8HA 2E6LA 2VL1A 2AYGA 2W7AA 4B3RF 2E2PA 5B5EU 2Q31A 1JN3A 1V4SA 4LF7J 4P7VA 2ZUDA 3SXLA 2MHEA 3ZSZA 2OM6A 1H0HB 3PW4A 1Y5LB 1VHIA 1C7YA 3UCGA 2DNQA 1IBKJ 2PYJA 4M7XA 2W11A 4I2EA 1U25A 3PDNA 2HNZA 1CJUB 4ANDA 2RRNA 2XI2A 5DBCA 3KYLA 4IDKA 3D2EA 2CXEA 2C2NA 2ZVSA 1YBTA 4FJ5A 1NZPA 2H3GX 5FIIA 4Z4CA 5KG5A 5AI0A 3JQKA 2RS8A 2ZG6A 1WC0A 4GKKJ 1RTJB 2J4RA 4QOTA 2A1BA 4QZBA 1RBUA 3MZIA 4NCAA 3EZWA 2W9CB 3NVYA 3AAPA 1WDTA 5GMEA 3CFOA 4C3KA 2YNIA 4CO5A 1VRUB 1VJWA 1VSMA 3J81Y 2W4DA 2ZEJA 3BZQA 3SENA 3G8TA 2EXUA 5I3PA 1JXLA 3W9HA 5JJBA 4ZLJA 3IBFB 3W1YC 3FUYA 3H45C 4NL9A 1Y10A 4Z6CA 4GXJA 2LYVA 4FWSA 2F1FA 4UUXA 2WW8A 2QARA 2WVEA 3GU3A 2W4CA 4RW9B 4ZCKA 5J2GA 7ICEA 1VRTB 4FE3A 3S6JA 2JHEA 1YI2S 5CHCB 1JJ4A 3BN4A 4KHPJ 1HARA 4BC7A 3TZYA 1ZBUA 1N4LA 2E9RX 5AQMA 1UT5A 4DU4A 4DSJA 1HD0A 1ATRA 2RQMA 4ZPBA 1XMQF 3C5GA 4YR3A 4HH1A 3RH5A 4USKA 5BR9A 1JLFA 4WU3A 4IOAL 5C42B 2OCEA 5ALNA 1XSPA 5KFAA 3PW7A 2KDOA 4KO0A 1U1QA 1ZBIA 3LM2A 1VQPN 5GAEI 3CDEA 1UPHA 3EX7B 3EL2A 4OIXA 2PC6A 3DMJA 3THXA 4EI2A 1PC4A 1VSDA 3SQIA 4TY9A 1ZS6A 1QQNA 2LI6A 4MIAA 2W43A 4BC4A 3HBTA 5ETRA 3KK3B 5F8NA 3PSPA 3ID8A 1E4GT 2AJQA 3AVJA 1EAYC 4IQUA 2VCPA 2O8FA 3UD4P 2FBXA 3PVXA 1IQZA 2P9NB 2ZXIA 1RDAA 2V4RA 4ZKAA 4A62A 1CZ9A 1VC0A 2PEBA 3VV2B 3FNNA 2N7CA 2E7XA 1HMVA 1S59A 3ET6A 2RF2B 1LOTB 5DMRA 1IM4A 3BN7A 4NLSA 2IBKA 4IKAA 5ALTA 3B8HA 3VGVA 3UCUP 9ICJA 2V7YA 1RDDA 2V8PA 3J7A1 4CFBA 2VPYB 3W3DA 3M8WA 4M5JA 2DNMA 1XI1A 4JI2K 1JI7A 1G1XA 3QPIA 4DR6J 3B4MA 3P31A 3DRRA 1SCJB 1Y4ZB 2BR0A 5AJ3F 4J7CA 1HYSB 4NRUA 4FYWB 4JV5J 4B3MJ 1TYQA 4AL7A 1R0AA 4GNIA 3E01B 4F36A 1V97A 4N41A 4ELUA 3RU0A 1TKXB 4QIVA 4WFBL 3LDSA 2C42A 1Z1BA 4QZVB 1RBSA 5J2AA 4DL6A 4CJWA 2NRHA 5HANA 1RTZA 2J7WA 4CH7A 4LF9K 4PABA 4HTLA 3V1RA 2CADA 5H9EJ 3GP9A 4HHUA 1PYSB 1X60A 1S8OA 5T7LB 3GSIA 4CM0A 1XS9D 4RNMA 3WC2A 3BDEA 2LKYA 4YD2A 4BR5A 1RWPB 4X66K 2DGUA 3LPYA 3HK2A 2QA2A 1WG4A 4MAKA 4KLLA 2NRTA 4DR1K 5I3QA 2GAGC 2E8NA 1HPMA 1CLQA 2YQEA 3C7NB 1FJCA 1CSJA 4BVOA 5TKWA 1Q3UA 3ILOA 1KN5A 4XQ8A 1GXUA 5H1SV 2XB2D 3O5BA 1GMVA 3WXLA 4ZOSA 4DSLA 3OR2B 1OIAA 1GLAG 3UXNA 4WTOB 4NZ7A 2HBRB 2QWQA 5LXYA 3PX6A 2G07A 4WQ4A 3F53A 4EGLA 4M2YA 1L7OA 3RSEA 2CQHA 2Z2MA 2KFNA 1ZQXA 4WQ5C 1KD1O 1M1GA 5LMUK 1J5OA 4FO0A 3BF4A 3DEEA 4FK2A 4Z4GA 1NJIT 4WWSA 4DV0F 2M8HA 1WUDA 5KFCA 5E3AA 1X4CA 3NVWA 3M7DA 4RNOA 3NCRA 1YITN 1TAUA 2AU0A 1Y11A 1QAJA 2CH5A 5ALGA 4EX7A 2OTLS 1N48A 4R0EA 3QMLA 5KFZA 2BA9A 3NVMA 4LZDA 1CJVA 2RUGA 2KYZA 2Y0SC 5L8RC 4HACB 1HJOA 2WFAA 1IBLJ 6FDRA 4J2BA 4AL6A 1IIPA 1X9JA 3NF7A 4M63A 1OH8A 3P38A 2HBZB 4OJ1A 3ZETB 1S9GA 1PC5A 4DOAA 1E6VB 1TMMA 4I9QA 4BR7A 3O1BA 4BCAA 3V9UA 1WEYA 3SJJA 1Y0HA 2LM1A 5DQIA 3JB9k 3THWA 2A0FB 4PYDA 3AARA 1TKTA 2K7KA 1YJNN 3VAMA 4KGMA 4JKAA 2ZNZA 3EO3A 3IG8A 2YKOA 3NGRA 2KW4A 1RCXB 1BQXA 1YIJN 1MDUB 4HT7A 2P6SA 3AO2A 7ICGA 5KPTA 3WZ0A 4IO1A 4KHSA 2W4PA 4USHA 4Q44A 1GH8A 2VBZA 4YY3J 3V9ZA 5HMLA 1WKKA 1X40A 3VEZA 2E9TA 5GINA 5DGBA 2K1RA 4OX9K 1WWVA 1EX4A 3QIOA 3OYKA 3MDFA 1H74A 1IWGA 4P52A 4GKJJ 1P8GA 4J2DA 5DB9A 2K4HA 3GJQB 3GE9A 1U04A 1RWUA 2HS3A 5HP4A 2BHNA 4DU3A 3GJSB 3SAGA 3RW7A 5DGAA 2BKPA 3CCVS 4Q43A 5KGWA 5M2RA 2DNOA 5LXRA 5CAAA 3ALRA 4C11A 3KUGA 2W7OA 2DVIA 1KL9A 2UVWA 2HNDB 4O3NA 4OJGA 3PHEA 2W42A 2WF6A 2NREA 4IRDA 3MF5A 3DXKB 5F8IA 3UD3P 4Y2MA 2JC0A 3VHQA 2GQCA 2KT3A 2VKRA 4LUBA 3VQCA 2RVJA 2GBZA 5F3TA 4M9LA 3L4QA 4QZAA 4WFAQ 1RHMB 4FJKA 4H5TA 2FJAB 4F4XA 1IM6A 3DRYA 5F3ZA 2VIXA 3GJTB 4DOBA 2DRBA 5FDLB 4O5KA 3JSBA 1L7MA 1NZ8A 5J1EB 3C2KA 4CF0A 1WAFA 4KLEA 4MQ3A 4G1QB 3QEPA 4UOCA 3TSPA 3HKZC 4IOBA 3DOMA 4B17A 1C1CA 1HWUA 2JDJA 4CEDA 3IAYA 2LEBA 3L2UA 2VJUA 2VBXA 4GXIA 2QXLA 2J0WA 4YMEA 3RJHA 1CJKA 2O8DB 3AU6A 4B3OB 4YVZA 4DUZJ 1WUAA 5E7OB 4K0KF 4MO5A 3NGTA 1N32F 1K1SA 5KG1A 3IR6B 2VQFF 5K8MA 5DZ6A 3Q8YA 3L7UA 2NUHA 4KLUA 5HRRA 2AGPA 1HBUB 1T9WA 1U1PA 1J53A 3SI6A 2HQDA 3AVFA 3GV5B 4DV2F 1N33J 5KGXA 2RSQA 3UPFA 3BH7B 3UE5A 3OYDA 2CGJA 2YHYA 2E66A 2R7OA 9ICFA 4RQ0A 4CHYA 4R65A 3MM6A 3H5SA 2KLAA 9ICTA 3L3CA 3L5KA 2BM0A 4RWWA 5AM2A 1WSIA 1RAOA 3LF0A 3FGVA 2OKQA 1HW9A 3MM9A 2PFOA 2V8DA 3VA3A 4FPIA 4C7ZA 1RTDB 1HQUA 3BYPA 4Z7CA 4CF4A 3Q8PB 2KIVA 3T5HA 3OS2A 4LRAA 3KUEA 3HRGA 3N4WA 1G6BA 4KI6A 8ICBA 3OBYA 4HH0A 2CG8A 3BF1A 1YJWN 5IWAJ 3CDBA 3DU6A 1X31C 1AUSL 3QT6A 2VHGA 4LF8J 4IR9A 3C66A 1COOA 1I3OB 5DM6L 2YV0X 1EP4A 3CT9A 1BC6A 1VSEA 2HMPA 1SIJA 3H1VX 3LPEA 1N34F 3O9QA 3ZSWA 3WT0A 3JPQA 4ZPVR 5J0QA 4C1NI 5LSLA 1FWKA 1LWCB 4RUHA 4I2AA 4XH1A 1A6SA 3U27A 1FW6A 4PHAA 1KOHA 3SCLE 3MEGA 1TVRB 2CUYA 3H2LA 1VLYA 3PY8A 2BJ7A 4DPUA 3NCQA 1FX4A 4KGVB 4MT1A 2PEHA 4RCHA 1EHWA 1SV0A 2PA3A 2HHXA 1SJ1A 1Z4UA 4AM7A 2AZ3A 3JS9A 2I1RA 2LU2A 5A8RB 2UXBK 2CH6A 2MZTA 5EVZA 4F72A 2D0CA 1S76D 3KMQA 3KZIU 1BG3A 4ZCIA 3CRXA 3ICXA 2K3IA 1WC3A 1C1BB 2D3DA 1GEHA 2W9BB 3C8YA 4EX6A 3KLEA 8ICCA 3Q7CA 5ETQA 5AIBA 3NH0A 1ZYQA 4I6YA 3CJ0A 1JKHA 3AY0A 3GDXA 3IKMA 3O3FA 2FC0A 3H1QA 4XDCA 7ICQA 1DK3A 2O8CA 2UUBJ 2KG5A 2JR5A 5A2QU 4DUYK 1SXDA 2LQ9A 1CXQA 4KB0A 3GIJA 2AWZA 3BGRB 2HVIA 4DLEA 1IJFB 5KFIA 4X65F 1RGVA 2QYGA 4G3IA 3D68A 3C29A 9ICIA 2DPNA 2QSFA 4ETXA 4F5NA 2ZIVB 3EYZA 3C6HA 3NF8A 5B0BA 3MWPA 1Z3EB 3B0XA 4ED8A 1PVQA 1TKDA 4FJNA 2RD5C 2MYFA 2P5OA 1RTJA 4BRIA 2ALYB 2EX3A 1R31A 2PFPA 2B8QA 1QAIA 2NS1B 3ZZPA 1VRUA 1DGKN 3R9PA 2LQBA 4ZVEA 1RK8A 4PZOA 4XPCA 3QO9B 4JKEA 1D5AA 2FLLA 2E9ZA 1IQTA 1NBWA 1D9DA 1QVGR 3PO5A 3OPKA 4J9QA 4KH6A 1KN6A 4HUEA 4FZVA 4P2FA 3H7IA 3I96A 2RPIA 3AAWB 1SL1A 4RQMA 3IRWP 4BRQA 2CQCA 4DBQA 2UXDF 1COKA 4CD3A 2Z30B 3C6TB 4BR9A 2E5SA 3OA9A 1FIQA 4HYKA 2HHHJ 2DT9A 4RW9A 4IEEA 2OA8A 3K8WA 2WF8A 2Y1JA 3OYGA 3CXCR 4GO7X 3LDQA 4PKIA 3JSMB 3W8GA 3RMAA 4DR5J 3FYHA 4CGZA 1NHVA 2ISPA 1I1GA 3FR0A 2ZJPL 4E2FB 1U2RA 4F8RA 3H2UB 3OXFA 4GY2B 3SR6A 2QMXA 5BRHA 4YB6A 1HWIA 2CQBA 1KC8T 2HHSA 2H5IB 1MWKA 4AUKA 1Q81T 2MJUA 4NEYA 4YQWA 4K2XA 5J2QA 2GX8A 2CPYA 1RDRA 2O6KA 2FB0A 2VJ4A 1RDWX 2NYIA 5AQXA 3C28A 2FHJD 3DLGA 3C19A 2GO7A 3WKDA 4OYXA 1VK0A 5E79U 1CULA 3CCLS 2V9KA 3BGFA 3GPAA 4ID8A 2ZZMA 2NUBA 2DR7A 4CEBA 2R7QA 3OVSA 2GTDA 3CFRA 2ADCA 2QSWA 2Q36A 5BOMA 3DDIA 8ICNA 3SUQA 1TTHB 3M1YA 3DLBA 1CRXA 2MKYA 2X1BA 1VGYA 3CVKA 4CLUA 2OP5A 1ZJNA 3NNAA 5IC4B 3MUVP 1IWAA 3V6HA 2ZIUB 2FMSA 1ELOA 4ZHRB 2ZWPA 3MMJA 4UQTA 1NH7A 4NEZA 3FAHA 1URRA 1RHRB 4BE2A 3VOVA 4RT2A 4IWVA 4BY9C 3VENA 1TKZB 1X4FA 3RUBL 1TL7B 5ALUA 3D1QA 2W25A 2PE8A 2D6FC 2DGQA 2XMAA 5E3QA 4QIGA 2ASOA 2V6AA 2EG2A 1B0XA 1W2BR 1N36J 1VBKA 3R5CA 4KPYA 3D45A 2IM0A 3VERA 1R8BA 5GIOA 2FI1A 4BROA 2L9DA 3AAQA 2YB1A 4EZ9A 2ASMA 1LXJA 5IFMA 2XCPA 5IT9U 1FJGF 1ZZFA 4USVA 1WKLA 4DL3A 2AGOA 2EEYA 2AXTU 3NMUA 3U9DA 4EYIB 4AD6A 4OZJA 2VOPA 3CJRA 1GX6A 1Q9XA 2NRWA 2XZWA 4RBVA 3H90A 3F2CA 3DI6B 3ZDCA 1C6VA 2KL8A 5CR4A 3MCPA 5T7LA 3ZZ0A 1L5UA 2D0OA 1NLVA 5A0LA 1U7LA 5JLHA 4JI5F 2H48B 2NXJA 2UXCJ 2CJKA 2PBDA 5T14A 3C95A 2LMRA 5GAEU 1UEVA 4AYBC 4YUDA 4C80A 3FZMA 5ALEA 4P10A 1X9XA 2PYLA 2E5LF 4KLSA 3VQ6A 2XSFA 4PKDB 1R59O 5IIIA 2F44A 2G2ZA 1P7DA 2F1HA 1SV5B 5ETSA 4RG8A 1UETA 4I56A 2PZSA 2ATLA 4DV5F 5J2DA 2ZJQQ 2WSEC 4P71A 1KKXA 3SPYA 2DR5A 4RQ6A 1O13A 1X8DA 2MY7A 4B9TA 4DTUA 9ICLA 1VQ8S 2D0PA 2EFPA 3JPNA 3GSDA 3EE3A 4OI1A 3H4BA 3OLBA 4BUGA 3ILJA 3KD5E 4CEFA 5AZJA 1X4BA 4F0KA 1MU2A 4XTTA 4CJRA 1QQ7A 1O5JA 2WAQC 3HHDA 4NLBA 3G87A 2P1JA 2CDQA 3QU7A 2PFFB 4C4SA 1KTQA 4I2FA 1BA0A 7ICSA 1J5EJ 3I56S 1NGDA 4NY8A 2XI9A 3V6KA 1YVNA 1DZ5A 4ICLB 1QVGM 4KX5A 2QG9B 4MK9A 2P9KA 4JI8F 1ZPWX 1NSKL 3MN5A 4PHPA 2LEAA 2FPKA 3O80A 4A5AA 4J91A 4DR3F 4K42A 3NVVA 4TU9A 1NWKA 2IRXA 5KFUA 7ICHA 2W2PP 3CJ7A 4JI1K 3NGIA 3UB5A 5GAHI 1XQIA 1V9PA 3LL3A 3CXCM 3R7BB 5HOOA 4YS2A 3J7Z5 4JK1A 4UT4A 4C4RA 3HPHA 1UVNA 3MM8A 2FD2A 1HUOA 3UE2A 4ATNA 2DNLA 2AGQA 2RKIB 3VGUA 3PX4A 3HKWA 2W54A 3CERA 3U6FA 2R2UA 2R9LA 5J0RA 3MR7A 4PYAA 2WB1F 4NLKA 3G71N 4F0HA 4ZVTB 1RADB 3GG1A 2IC3A 1N8RO 1AROP 2JEIA 1R3NA 1NK7A 1N0UA 3BH6B 2KZ3A 2YQ1A 4W92B 3CCUN 4R5PB 1VSLA 5ALQA 3WNGA 4ZP9A 3F5EA 5AE2A 5ALYA 5IT9Y 3NRWA 2MQ8A 3WNFA 4UASA 4OHVA 2MQPA 1IJEB 5AI6A 2Y9UA 2LP4A 3M6WA 2QKBA 4TXSA 1RDBA 2ASLA 1QJHA 1LAWA 4DR4F 2R2TA 3WX8A 2F4VJ 4JN4A 4IG0A 2HNDA 5C5JA 4ELTA 1DHMA 1XMQK 2GVDA 3ZD8A 1ASVA 1NOMA 3MR5A 4CLWA 4IH7A 4TQRA 3RH4A 4AHRA 9RUBA 4NB4A 2ZH1A 3H7HB 4PAAA 1M5HA 3VVTA 4F2RA 1YZ7A 2DTJA 1IO2A 2P9UA 4O0IA 3JAMO 1IKXB 3HJFA 4ED4A 4BRGA 3Q83A 3GBTA 1Y5IB 3T79A 5LJ5Y 3AFGA 2FMQA 1VS3A 2C2RA 1O6XA 4A8KA 3K0JA 4G1QA 1XHZA 4CZCA 3IA0A 1F1BB 1IR1A 3KFUF 1U1MA 3LA0A 3G0ZA 4JK9A 1MWQA 4LR7A 5AQPA 1NAQA 1W2BM 5K20B 1Q82T 4LFBF 3KLVA 1CI4A 3P4IA 4B3OA 2G8KA 2YPYA 3DLEB 2GHWA 4Q8FA 3R8YA 4NO7A 3IP4B 2IOFA 1UOCA 2D1KA 4I2HA 3ENWA 4JEPA 3QIDA 3E3XA 3U1LA 2XHBA 3BPDA 1C0TB 4Y2VA 2B4UA 1HBUA 3MD1A 1QSSA 4CD1A 4ZMMA 2COLA 2ZFHA 1UA0A 1F2HA 3MGHA 2Q6BA 4I29A 1FFWB 2EANA 3ETRA 4UAVA 4IFYA 4OPJA 4C98A 3H08A 4K50A 1E3MA 4ZLNA 1KEKA 4HHHA 4KPCA 4PGYA 4QR1A 4M3RA 1FFUA 1VIOA 3B82A 1OQ6A 1XEZA 5KPZA 2AEJA 3C15B 4D3GA 3D2NA 4HI2A 4JI2J 5J2PB 1DQ9A 5AKKA 1MLAA 2XNRA 5K14A 4CLPA 4F3OA 1F6TA 4S0MA 2LHTA 2MKCA 4CYUB 4QWCA 4EZ6A 2QB1A 3X1LB 1HYVA 3ASMA 1T9UA 4UB4A 9ICVA 5EWGA 1Q4RA 4IEIA 3H42A 2QC3A 2F9WA 1FT8A 1RACB 2ABYA 4LF9J 3WXKA 2YWEA 1VQ6N 2J9CA 1RKJA 1LWCA 4P2SA 1FKOA 4A61A 4X66J 2LPEA 2YKQA 1Q8BA 1S22A 3G9CA 4CJFA 1JALA 2FHMA 1G99A 3ISNC 3D2SA 3LP0B 2E5IA 1KRPA 4O5BA 5ALHA 3I0SB 3K58A 5KFBA 4M47A 5BR8F 8ICQA 1A0OB 3K59A 5A8RA 3QATA 1RCOB 4WYWA 5IV4A 4DKWA 1FNMA 5IM0A 4ILRA 4OLOA 1NH8A 2FZGB 3OLAA 3GV7B 2DD8S 1BU6O 1ED1A 1JK9B 3TQEA 1BCMA 3RJFA 1C1BA 3A12A 1Y9OA 1HNZF 4YEAA 3GCWP 2CQ1A 3KK2A 2QA4N 3SEIA 3W3SA 4DV0K 2GGPA 3PYFA 2HBJA 3AJDA 1RBTA 3NGYA 4K43A 3K9KA 2G08A 2LM4A 5L39A 1ZBFA 1QHTA 3VF0B 2BQUA 4V19X 3GYNA 1YF5L 5GVQA 1JB0C 2KD1A 5FLXO 3AA4A 1SH3A 1S1TB 2KIWA 1RT6B 2JH7A 4B3TJ 3R3LA 1X7VA 1NJYA 2MQNA 3GIRA 2ZBCA 3T1HK 1GLLO 1DTQA 2LYHA 4Z4FA 1U26A 3QU4A 2K8AA 4UAZA 4AQYJ 4PHEA 4DPYA 2G8IA 4QIWD 1YIJS 2B51A 4Y0FA 5EE0A 4M1KA 4NLNA 2E1FA 1Y3KA 2KKZA 3VCBA 5AQGA 4C2MA 8ICXA 2DQNB 2F76X 4H5NA 3NXZA 2YH0A 2QX0A 2JEGA 2OSQA 2J9DE 2FF3B 2L08A 1GOCA 1XNRJ 5JXSA 4YB1P 2K8CB 1JLAB 3LTOA 4P2XA 1FRMA 3MXJA 1RTHB 2CWKA 5D78A 2DXFA 3NTUA 3NAIA 4HVJA 4XA5A 4QPTA 1TV6B 5AXLA 1JLBB 1A0PA 2QN6B 1VIXA 2O8EB 5G0RB 1JUDA 9ICNA 2ESEA 1W0HA 4I9LA 2VFVA 1ZETA 2NXEA 5AK5A 4PPZA 3TA2A 2XI3A 4CO4A 3VQBA 1RI7A 4CJLA 3HWTA 1R8HA 2UU9K 3NE6A 1RWNB 4WFAL 3PMLA 1GFWB 2MPUA 4JYAK 1TUWA 3NRZA 1FK9B 1KFDA 1HFEL 2DK2A 1SWWA 4OX9J 1HI8A 2F8HA 3V6DB 2FBVA 3KKAA 1CS4B 1HBOA 2Y3YA 3OL6A 1HWKA 1FKPB 3PEJA 2XLJA 3WK8A 3OBIA 3M6VA 3U1NA 4LSLA 2UZAA 5HROA 5JVGQ 3LGNA 3J81j 3AMZA 2KKVA 3A3PB 4A8MP 1X3NA 4LVSA 3TOQA 1EWQA 3K2PA 3TJ8A 3HM9A 3W62A 5AXMA 4YHHF 3NGDA 4OZ2A 1G2EA 3K8VA 1E6YA 1QHAA 4K4ZA 5AM3A 4L73A 3TO8A 5FPEA 1RAGB 3TRGA 5GAGI 3ZDDA 4BC9A 2ZH6A 4GV9A 4C23A 3ZEUB 4DTJA 2CRXA 3RYLA 1DXSA 3V7LA 4OJLA 4R8UA 3O6QA 4FWRA 4I4BA 1NDLA 1RFQA 1XUPO 4MDAA 5H2FU 3G10A 2P9EA 4OKJA 5DM7L 3DNCA 1N32K 4Y28C 2VQFK 3ETOA 2V68A 4RW7A 4YMMA 2OZSA 5AI8A 4Y2SA 3Q8SB 3IWXA 3PR5B 1ZXIA 4OPHA 2BJDA 2UUTA 1UVKA 2ETJA 3SSRA 2QEXS 4DV2K 2M9KA 4LF1A 1YJWS 2R7XA 2BRLA 1TL7A 1ITPA 3U4LA 2KKPA 1FDNA 3D1OA 1CLFA 5CABA 2J0SD 4IFVB 1X2IA 4A8SA 5LJVA 4I6WA 5CQGA 4CHPA 3N7SC 5CWRA 2IM2A 1M5SA 4WFNQ 3BBCA 4KREA 2CNKB 3BB5A 1HI0P 2VA3A 3NAEA 1Q8IA 1N5YA 2IFXA 3G82A 4M3ZA 4UB1A 2VG6B 4WP9A 3RJEA 1GOAA 2IJFA 3GFYA 2XWXA 2C28A 4DPTA 2LEPA 3DFEA 4F93B 2ZKTA 4ZTFA 2W2QP 2AJFE 2WF9A 4P75A 4LF4F 3P1GA 1RT5A 1S5JA 1V3ZA 5CA7A 4GVLA 1FXRA 3OFFA 1LWEA 4PWUA 1T3QA 3RGIA 1XMOK 4DCHA 5HSPA 2OPPA 2E2NA 1T3NA 4RTFD 4LJMA 1ZC6A 1RM6C 2WVDA 4NWBA 3CJ5A 4FLUA 4DU7A 1N34K 4OJPA 2Z1IA 3E9LA 2HOFA 1HKAA 2A6OA 2ODGA 5J2EA 4QPXA 1TGOA 5AKYA 3DRXA 3RBZA 2FBTA 1S72N 5LMNK 4F4KA 2RDJA 4CLFA 2A1AA 1WOSA 1NNEA 4F50A 2AHOB 1JL2A 5D4OA 3W7BA 3O3HA 2MGZA 1UWAA 3F9KA 4GC7A 4C97A 1RTIA 2DGXA 3R1XA 1JWWA 3UW1A 3Q8MA 1BHLA 3BBBA 1KW4A 1S6QA 1K73T 3OL9A 1S9EB 3MM5B 4Y2PA 5KG4A 2AP6A 3QNWB 2V4JA 3NGUA 1DTTA 1VQ5S 4NA3A 4Y0WA 2B9EA 2FJVA 4X62F 2ZM6F 1S0VA 2CQIA 4F92B 4P6QA 4FCYA 2A1RA 1BI4A 1MWMA 1GX5A 1O0PA 1KAZA 2DIUA 1N5WA 5D0GA 3KZBA 1T0TV 1FXXA 1LEOA 4AHTA 1GMWA 1ZQOA 1FERA 2YMPA 2BCVA 4JOUA 4FS1A 1OWXA 2KHDA 5IIJA 4ILHA 3L4BC 4PKHA 3MEDB 9ICWA 4QCLA 2XNQA 2X74A 3LP1B 5DETA 1JJCB 4NYNA 4I2PB 2UUCF 4M3WA 4ECUA 3C1YA 4KHQA 2Z56B 2VFTA 5CP2A 4PWDB 5C2GA 1KVBA 4X65K 1HNWK 3HZ6A 1RYUA 4LF5K 4PG5A 3HZEA 4ELVA 3QWPA 5JICA 1TQLA 1TFYA 3EGWB 9ICAA 2RE2A 2OI2A 2XIDA 3QQCD 2ITMA 4CGGA 3QFPA 2I7NA 3GQCA 4M3YA 4DR7F 4Q2MA 2GIQA 2KT2A 4NXMF 3MWTA 3RBEA 2B7BB 4F9OA 4BDYA 1KOOA 4FKXA 4CT8A 2LDIA 2IAJA 3QZ7A 3MAAA 4JI4F 1EKRA 3ZO7A 3CSKA 5THWA 4JLHA 4U67Q 1QAXA 2J9DA 1OYEA 2ZE2B 1WNEA 2MKSA 4NLVA 1T03B 5FRMA 4GO5X 1KXPA 5J0OA 2MSSA 1F5BA 1KQGB 3ZTSA 2PMZC 4J90A 3CE8A 4RW4B 1QZ6A 3IRUA 2YKMB 1Y7PA 3JTNA 4CFAA 3WKBA 2DPJA 4HI1A 3K75D 2UXDK 3IR7B 3WK7A 3DGVA 3R97A 3THYB 2YNGA 4M5KA 3DAWA 3MAQA 2VC1A 1YJ9S 2BJ1A 4A8WA 4YOUA 1Z00A 2V5HG 5A0YA 2FSNA 8RUCA 5K5MA 1BQMB 1N6QB 1DQAA 2QLWA 2RS2A 1XIQA 4QS7A 3PX0A 4WYLA 5J8YC 3O9UA 5BPCA 4I69A 4KC5A 5EOZA 1BISA 1NNLA 4QZ9A 5AQUA 2K3KA 4KN4A 4RW6B 1D3WA 1YRXA 4U8YA 4YCXA 2K4PA 2HFVA 3D6FB 4JI7F 4KH1B 1BQNB 1IKXA 2F3JA 1ZD3A 2MZSA 2VG7B 2K4EA 1UVJA 2HBQB 1NBEB 3L2QA 1Z25A 2BXJA 3G4SN 1PK1B 2ZIXB 3C2LA 4NWIA 1C1AA 4L75A 4BS2A 4CJ4A 1WNSA 2BRKA 1SBRA 5DQHA 2ZJ5A 2BYCA 1QQMA 4ZCLA 4JNEA 3O9RA 4ZP8A 5D0HA 3LALA 2KT5A 5ELZA 4DOZA 2Y1RI 3ULHA 1DEJA 4DL5A 3ENQA 3AD7C 1C0MA 2YNFA 2KNJA 1VC6A 5DBAA 1TUYA 2Z7JA 3D2FA 2F8EX 4B1YB 2ACMA 4CZGA 1Q5VA 4BG9A 1Z2LA 3SDEB 2CPIA 4ER8A 3L0QA 8ICKA 3EMTA 3OVBA 1PUZA 3HP9A 1H2TZ 3T1AA 5GMKa 2HG4A 2YNHB 2HGNA 3EVMA 5AQQA 1OUQA 2Z0GA 2IVYA 4I67A 4NL9C 1LNQA 4UAYA 1N54B 3C14B 4Y34A 4NPOA 3HFZB 4C48A 4JRQA 1EARA 2DEJA 5F41A 5IT0A 1WLJA 1JCGA 1RLCL 3DM2B 3T5LA 4Y2TA 4EP5A 5D4PA 2F4FA 1FJGK 2W8LA 2HAIA 3PSIA 4CGDA 3IWLA 3OYEA 5KG0A 4KIAA 4KE5A 1VQKN 4CYUA 4CI0B 4J9UE 2PXIA 4NCGA 3M8PB 1U1LA 2YWKA 1WC6A 4HR2A 5L9NA 2BE9B 2A1SA 4KHWA 2VWBA 4JKFA 2BOPA 4Y2XA 2DY1A 3CC4S 2ZUBA 1WSEA 2CQPA 1W97L 2W8KA 4NLQA 4NX9A 1PBUA 1YBUA 2FLNA 3DOLB 2O5DA 4Z0UA 2Q0UA 1SJFA 2E5LK 1S12A 2K7JA 3M8QB 3BSOA 4YXJA 3PLAA 2FXUA 4N7TA 4RQ2A 1ZQLA 2DYAA 4LFAF 1U1KA 5LJ3Y 3I0SA 1S49A 3FCVA 4DV6F 4DV5K 1RBVA 3ZZOA 5DRKA 1V3RA 5AQOA 2ZBIA 5BN9A 4CWBA 4O3RA 4EBCA 3AY9A 3RAQA 1I6JA 4CEAA 3DC2A 2P9GA 3IG1A 4NI2A 2O01C 1DLOB 4ZTJA 3TKAA 1LVHA 1WHVA 3IWNC 5EWEA 1QQ6A 3AT1B 2XEXA 2A6AA 2C2ZB 5CEHA 4IC9A 3HHLA 4B9VA 1OH7A 5HMYA 4BWMA 2DBYA 4EO6A 2FJEB 2PY5A 3AA3A 5KT6A 1U47A 3GOIA 1GO3F 1ZAXA 3V9SA 4MF2A 3EGVA 5F8GA 4DCCA 4FWKA 2F7VA 3CM6A 1M1KO 2EK6A 1GMUA 1WSRA 4LRDA 4JI8K 5D3GB 1REGX 3NF9A 1B9DA 4LF7F 3FRYA 1SIZA 4LT6A 1ZQTA 3Q7BA 2GS8A 4LY7A 1SKWA 2PSZA 1IBKF 3CQYA 4ED2A 1W7WA 1Q79A 4DR3K 3MMAA 2GUPA 1YI2N 2HFOA 3CCRS 1T11A 3H8WA 2FVRA 2ALZA 3MXIA 1RT2B 1EQ0A 4J9PA 2BACA 1JMSA 3NG8A 4DV4J 2O1PA 3VESA 4JI1J 4RJVA 3NF6A 5EUHA 1FI4A 3ZI4A 3OYHA 3JTOA 1QUVA 3NNHA 1NK4A 2ZH2A 5CYQB 4GKKF 1HJRA 3CC7S 2QKKA 1PO6A 2R2RA 4E0DA 3KLFB 3PW5A 1C2PA 1O1WA 4CJ5A 2JC1A 1MA9B 1N5TA 2W6KA 1EQMA 5CXTA 1HPZB 8ATCB 3EDQB 4M9HA 3OTQA 4H8KA 2O8EA 4PKGA 1ZOTA 3MEEB 3R5BA 3OYNA 1SJ4P 2HSTA 4DV7K 3SQ0A 5E5NA 4YOXA 1NJXA 2JSXA 1N5QA 2Z58B 4WQ4C 5E0OA 1D0EA 4K4IA 1QCKA 3H5UA 4W5QA 3UD5A 3VQ7A 3UN2A 1FK9A 1RUSA 2L5YA 3C2MA 2W2MP 1D8LA 1ZA1B 3VGMA 3POTA 4ANCA 4Q0BB 2VUGA 1CXUA 1CS4A 4P4OA 4NLDA 1MG7A 3CGIA 4MK7A 5KT2A 1NU4A 4KAZA 3VTHA 4V19J 2C2EA 5CHGA 2JH1A 4Z2XA 4KHPF 2J5AA 1BIUA 2EDUA 4J9LA 1Y00A 2HEKA 3IM8A 5RUBA 1Q18A 4JRPA 4URSA 3SCJE 2KQ2A 4KH4A 1FE0A 3T69A 1C0UA 1APSA 4OZ5A 4CJUA 3A0HU 2JVOA 2CQDA 5U47A 2FY8A 2BPFA 4ECXA 3PG9A 3FBFA 1OSCA 4ZN1A 4CJQA 2O4IA 3ZEUA 1S1VA 5HQMA 3OV7A 2OD4A 4FJLA 1XO1A 3C0BA 1YJRA 1GQEA 2HMIA 4M63C 3FBCA 1RXOB 4TY8B 4OO1J 1K5OA 1V4TA 4A8QA 4A2BA 3W2WA 4WFBQ 4L6V3 4LSZB 4EHUA 3KLGB 1WWUA 1K8KA 5E41A 4DTRA 3CCES 2CAJA 3OR1B 5BYSA 4FYXB 3C94A 3US5A 1HNVB 2WBMA 2VGNA 4I7FB 3GILA 2XO6A 4ILGB 2P35A 3UKUA 2D5RA 1U45A 3IBCB 2HZAA 3M4XA 3EJMA 3MECB 7ICRA 1RE1B 3RBXA 1VLBA 3CC2S 4FPBA 2Q3PA 1PVRA 1JCEA 1WTFA 1OW5A 3QFHA 3KHHA 2LU1A 2PI5A 3OUYB 1W9HA 4CIOA 3VQSA 5AM4A 2BDPA 5KG7A 4DSIA 5AFUH 5DB8A 5CD4H 4EBEA 3U3GA 5DDYA 1Q86O 2GAHC 5AQVA 2ZH4A 4DR6F 3KXDA 3P4UB 4M0AA 3ENAA 3ATUA 3HTVA 3TWHA 4P0QB 2EPIA 4L3NA 1WELA 5I42A 5D4LA 2JOQA 2B4VA 3Q8LA 3VAIA 4JV5F 4B3MF 4PUOB 4H4OB 3DDKA 1HBMB 2DIVA 3F5TA 1S57A 1QDUB 2OHFA 7ICPA 3T9NA 4CIFA 2G2OA 2RRBA 2CPJA 3OJUA 5AZIA 3L9ZA 2BMBA 3G8QA 4LVNP 4C6AA 1ZPVA 1M5PC 4RL1A 2MEWA 7ICFA 9ICUA 4KMOB 2GQ2A 4ED1A 2B56A 3VCDA 3VETA 4OPKA 3FQKA 4TNOA 1ZJMA 5HBMB 3OYFA 2CIMA 2R2SA 2Q0ZX 2VPXB 2CJQA 1BLUA 5ALXA 1NJWA 1WHYA 1L7PA 3LOUA 2IVNA 2NCKL 3BEXA 3MM5A 1TELA 1J6ZA 2HMXA 2M8DB 3A3OB 3IMXA 4IL6U 1KD1T 1FJEB 4X4UA 3C3LA 2E2QA 1RHUB 2WB1C 5HAOA 4UBCA 2LECA 3Q89A 1B0PA 2I5JA 4CK3A 3KNGA 1U0SA 1OJ4A 3LGMA 1F9HA 4LQ3A 3BREA 2DH7A 5CRXA 3BBFA 4ZPTR 3NMRA 3DV9A 1RB0A 1DBDA 2LQ8A 3LP1A 4DQSA 4DV0J 2LSNA 1OY6A 3DYAB 3DLHA 4I2PA 2HSEB 3TU5A 1RSCA 3KG1A 4I6AA 2VU5A 2FVCA 3ZTPA 4ES1A 1N5VA 3HSGA 3LP2A 4ICAA 3T1HJ 3M8RA 1Q8LA 3NWRA 1K44A 3HSZA 3I4PA 4FWQA 3CCVN 3P96A 2N7YA 3GZ7A 3P5TL 1V3SA 4CLLA 3PNCA 1IBLF 4MMOA 5L1KA 4Y65A 4QIEA 1ZQWA 3T19A 2B6GA 2RHKA 3EKUA 4BXOB 5GADI 2YJEA 2G13A 1F21A 3U02A 4K4XA 4F3MA 1MMNA 3IFRA 3UDVA 1PAUB 2GWKA 3TAPA 3QFWA 8ICSA 3FZ2A 2Q43A 4K4GA 4DL2A 1BWFO 5J2MA 2IVFB 3K4GA 1RWMB 1ZA2B 5JVGL 2AMCB 2F1JA 2DGVA 1SV0C 2ZTEA 1J2NA 1L3TA 3RMCA 5AKLA 4XIUA 3FFIA 1N88A 5HLFB 3ZX2A 2YHBA 3RJIA 4TU8A 4YY3F 1NMDA 2UU9J 3MABA 4FM2A 3ZT0A 4GKJF 4JYAJ 1NGBA 1N61A 4K4SA 2GJFA 5KFVA 9ATCB 3C6UB 4QR2A 1DGSA 2NNWA 5HO4A 3HMJG 2F40A 3ADAC 3EZOA 5HRSA 2F65A 1FESA 2NZ4A 4DTNA 4NXZA 1GXLA 3PUFA 3J7YP 9ICCA 3O8WA 3GG4A 4FF2A 4ZN3A 3MCMA 2CXYA 1Q7YO 5DO2A 5K8PA 1SGGA 2QB0A 3BDPA 5K8OA 1M5VC 2WVFA 1HIYA 3QNNA 2V0NA 4FWLA 4OGEA 1NOYA 3KMSA 3UI3A 4FP9A 2MMYA 4ZVOB 5KQDA 3UM9A 5HQLA 5F9NA 4NLCA 4G1IA 3FMWA 2OFGX 4JWMA 3D3CJ 1XC3A 3J8AA 3Q8VA 4Q7AA 4YFUA 5E3RA 3HHNB 1AW0A 4K25A 1CG2A 2EAPA 4WFNL 3OTDA 2KVCA 4FVCA 2HIYA 4DUZF 2H1YA 2YKNB 5A2QO 4QYZK 3B6BA 3GG0A 5A8KB 1FKAF 4AE5A 2JWNA 3H3OB 3KDNA 1KVAA 4H0YB 4RPZA 2OAUA 1MQ3A 2LKZA 2P6RA 1HRHA 1U2VB 2GC8A 2KJ9A 3Q86A 4BRHA 1PILA 4P74A 1K1QA 2ZJRQ 3PW0A 4CI6A 2J6TA 2OPQA 1N33F 1X5SA 5CJ7A 2FGOA 3O4WA 5C0YA 1Q53A 1M5KC 2P9SB 4G6VB 2ZHAA 2W2OP 2HHVA 1OXJA 3TAQA 3R2DJ 3NCPA 4P0PA 2FBYA 2E1EA 4L74A 3D6JA 2OD6A 2YWWA 3DM2A 5F2RA 1MC8A 4OI2A 2R8GA 1TUGB 2FHKA 4Y2RA 3QT7A 2EWSA 3HXMA 2KJWA 1WHXA 3EWGA 1VBYA 2QWMA 1K0TA 5EU7A 4P4PA 2QL7B 1WSFA 2E20A 2ZQBA 2ZIWB 1X4HA 1XNSA 4EFHA 1YBAA 2X51A 3MMBB 4JKGB 4LF4K 3D0HE 1ZQYA 1D9FA 4QBUA 4DS5A 4NXNK 1IXKA 2CRLA 2QT7A 5IWAF 2Y9HA 4Q8EA 3DRPA 1PVPA 1V5VA 5B0AA 1S0OA 2ZUGA 2RRDA 4IYQA 4LF8F 3G96A 1RA7A 1X6JA 3D6HB 3MCAB 1I94K 4CJPA 1U9LA 5HATA 4CFCA 5G5HA 1L8LA 2XWYA 2JGUA 1XMOJ 5AFUA 5CD4A 4AYBF 3P5BP 2Y0SD 3QYYA 4QWEA 3IRXA 2YMQA 4FN5A 4UOFA 3L4IA 3DOLA 2RRAA 3ITHB 5LMNJ 3L7OA 3ZZTA 4LFCJ 2XMWA 1QE1B 5KOXA 4CRXA 2QWRA 1QSYA 2Y0BB 2E88A 3KVGA 5KFEA 2VKZG 3AOCA 3W2VA 3CMQA 5DB7A 3ZZZA 3H46O 4JI3J 1TP7A 4BR0A 2ZWHA 3P8BB 4FLVA 2G5HB 4X62K 2ZM6K 1K6YA 2XBPA 4CGHA 4OJHA 1HIWA 2HLUA 1E4FT 3QU5A 4LRCA 1BD6A 5JUMA 1N56A 1DLOA 5CCLA 3O0FA 2CZ4A 3WEEB 8ICTA 3SV4A 4IOCQ 1SJRA 2E44A 5HP1B 3CI5A 2DCLA 3NP5A 3QJPA 4WK3A 3I4HX 3BR8A 4ZK7M 1RGIA 3TP2A 3CULA 4KB7A 4TYBA 1HNXJ 4B3SJ 2HK2A 4E1NA 3BS9A 3TAMA 1D8ZA 1SWVA 2NYHA 3D9BA 1ZQVA 4IXCA 4BBYA 4I6MB 2UUCK 1YWXA 3WBZA 2F77X 4EBDA 2QW9A 2RN2A 4U67L 1YAGA 3V9WA 3OTCA 1XR7A 3WK6A 2UUBF 4K4WA 5DK5A 2XLKA 5J29A 2V2VA 5BYQA 1B99A 1NPKA 3RJMB 1FRJA 1TL1B 3E8OA 4X65J 1HNWJ 3E58A 4LF5J 2HWTA 3MAHA 3QUTA 2QTWA 2DCUB 1ZZNA 2MU2A 2R7TA 1N52B 4NOHA 4RNNA 4DR7K 1IN0A 1AUDA 3VGSA 4NXMK 1P6TA 2MUTB 4KB1A 3HKZD 1U8SA 3KLFA 1RT7B 3QIPB 4OZ3A 2GHPA 4L8RB 4MKVA 3NOCA 4CJ3A 3CJAA 5DZ7A 3CF5Q 2WMMA 3EE8A 1PYOB 1HPZA 4LF6K 3UDLA 4B6JA 3OHAA 4DG1B 3R8EA 3TX0A 1QQOA 5IQQA 1UW4A 3I28A 4X4QA 2KHCA 2K2PA 2UUAJ 2G06A 3J81U 4ZVRB 3W5YA 1LKYA 1V38A 5LSRA 1TL3A 1T05B 4MK8A 3LK9A 3VEXA 4ECWA 4X64K 4V19S 2IDEA 3MGVA 3R6MA 3NS5A 3KLIB 1RAHB 2EKNA 4HWIA 2JXJA 1WEXA 2HHHF 1RYSA 4K4UA 2DITA 2MDAA 1AZSA 4F4AA 1X5PA 3HD2A 2F1IA 2HIQA 7FD1A 2KICA 1B92A 1BL3A 4RUAA 4F71A 2V94A 1Q3VA 3CJ1A 5CZXA 4DR5F 1ATSA 1B7FA 2DGZA 1BVSA 1L6NA 3NMAA 4CF9A 2VKQA 4JI7K 2EBGA 2JLFA 5KFKA 1WDDA 4K4TA 4W5OA 4GV3A 3M1VA 4Z4IA 2Z2ZA 2OMOA 4EU0A 1HKBA 2KN7A 1JLCB 3HSJA 3I0RB 3QINA 3GDQA 4CNQA 2KHVA 3D6TB 1TUUA 2L9WA 4C8NA 4MEYA 3BSNA 3CTRA 4F4WA 4TY8A 1NGGA 3V1OA 3DOKB 2EKYA 3VC8A 1NXIA 2IPOB 4MFAA 1RYRA 3TANA 2LQ5A 3MCSA 3NS1A 3W8PA 3PIOL 1ZOLA 1X3MA 2IJRA 4UAUA 4I2GA 4WPAA 1EO1A 1HNVA 1D1UA 5ALMA 2C3OA 5MAOA 5L9XA 5FRNA 2ZJAA 2CJBA 1KDHA 4BRKA 4WBFA 1NB2A 3GIKA 4DI6A 1FA0A 1RLDA 2HHQA 2BW2A 2BQ3A 4PL8A 2A3VA 4ECVA 2KM8C 2Q1NA 3MECA 2IYGA 2K06A 4GVBA 2XS2A 3QE9Y 2V4QA 1YGYA 1U6BA 3SSSA 2J7UA 4JI6K 2RDDA 1VDHA 1K9MT 3AV9A 1ZRNA 4DR2J 1KFSA 3DKDA 1HX1A 3EWAA 2W55A 1N36F 4CEEA 2OPSB 3UO0A 1XHXA 3M6ZA 1AXQA 1P1TA 1ZQJA 5HNKA 4CLZA 3EM1A 1VQ8N 1C4AA 5KFDA 3QFUA 4H4OA 2KJ8A 3AJ2A 2WC9A 4KHUA 4CERA 2HZVA 1GLBG 2BM1A 4Q5VA 3LDPA 1H3DA 2EI5A 2MHNA 3PYEA 3P39A 1T9XA 4EYHB 5KT3A 2I9SA 2OPRB 4M5GA 4KKOB 1VBZA 5KFMA 3B9JA 4AHUA 3PJWA 5ALFA 3I56N 2MKJA 4BGDA 2D3ZA 3J7AN 4EEKA 2FC9A 2QRRA 4LR9A 1ZQFA 4WIQA 3SYZA 3TEHB 5KOWA 2AX1A 2UXCF 4B1VA 3GYGA 2BDUA 2GVZB 2MA1A 2RILA 1ZQAA 1WF0A 2IA0A 3SCKE 2G8FA 4DWIA 4HTJA 2RH3A 4M42A 2EFNA 1YX2A 4M9GA 4OX8A 1WF2A 3HT0A 2OUGA 1VJQA 5J0TA 2E4LA 2LA4A 3QGPA 2DH8A 2RUSA 4F25A 4CE6A 4JKHA 3SPZA 3QRRA 3M6KA 9ICRA 4DV6K 3HX9A 3KK1A 2LFVA 4OHWA 1O51A 2CQ3A 4MYTA 2HAFA 4MDBA 3J7YI 3A3NB 3QZ8A 2QMWA 3CJCA 1IKVB 1S1WB 3ZLJA 2H54B 2AJ2A 4NCBA 3TUZC 5I9EB 2P9LA 1Q5YA 8AT1B 1XSNA 4X4PA 3KKFA 1KLMB 2KZZA 1RDFA 2LBOA 2LLZA 4J03A 1T8EA 4FF1A 3PRVA 9ICPA 5EX0A 1Q78A 1J5EF 4U6PA 2GH1A 1NRKA 4UB5A 3H3NO 4RQ8A 2A1JA 1RHQB 2N4CA 4LF7K 2XSJB 2FTRA 5C25A 5M2UA 1URJA 3MD3A 4DV3K 5KRSA 3D6RA 3GV8B 1UWBA 1JL1A 1WHWA 4DCOB 1GTHA 3J80U 2XY6A 1RWWB 3TFSA 1ZQEA 5HMWA 1WOPA 1N2XA 4OI3A 4CF1A 2D9PA 3E1YA 1AT1B 3O3GA 4IO9Q 2LXIA 3CQ8A 1YVUA 5FP0A 4BXOA 3E9PA 2JRZA 5AKIA 1WCNA 3QESA 3HOSA 3KJVA 2VH7A 4GKKK 1UZHA 3IAS9 1N8RT 2QWOA 1JNRB 4MF8A 5HMXA 2GNKA 3THTA 4DQIA 3QB0A 1N0VC 4RW8B 3SBGA 4Z4EA 5AXKA 2WF5A 4LD0A 4CK2A 3LYSA 3F2DA 4DV1K 2F8LA 2WW4A 1U2FA 3SZ2A 1WSVA 2O3DA 3GIIA 1VQSA 2RQCA 4KRWA 3UVJB 3SUNA 3U7JA 2F2AB 2ASYA 4DV7J 4HTUA 4ZVPB 1U49A 3SFUA 4F02A 1L3KA 4LSNA 3QBXA 2G0IA 4FYVB 3BYRA 3SUOA 2HVEA 3VEYA 4KHPK 2WCXA 1JLGA 1KLNA 2F4VF 2QM1A 2Q1LA 4UAWA 4H03B 3H25A 5CYMB 3ZCMA 4EAHD 3FK4A 2BVZA 1T95A 3MUTP 3N79A 2MB0B 4QZEA 1KVIA 3F5AA 1YTYA 1NGEA 1RCHA 3OS0A 5A8WB 2J7KA 2XMJA 3KD3A 3AN1A 3MCNA 1FF2A 4O8KA 4L72B 1BY9A 3RJGA 3MMCB 1G7CB 2OO4A 2MSNA 2W9AA 4MIWA 2I9GA 1RT1A 2VJVA 1EJ7L 5J2NB 2NO4A 2Y1LB 4ISEA 2VG5B 2DBBA 8ICAA 3VAGA 4KRFA 2U1AA 3ONQA 2B4OA 1WYGA 4AYBD 5GADU 2D4WA 2MZQA 4WKRA 3B6PA 5BJRA 4WP3A 4C8OA 4MIBA 1OY9A 3VQEA 8ICMA 3Q22A 4TUSA 2HURA 1GLFO 4YB5A 2ILZA 3MWBA 1GT8A 1FJ7A 3LH2S 4YDXA 5EHHA 3I5CA 2CJAA 5J0YA 3H40A 4PH5A 2BCUA 3OTOK 2GUIA 2GW8A 4RO0A 2XGQA 2YX7A 1YVFA 5E3CA 3WKCA 4ZVHA 2M52A 1CJTB 4O5FA 1ESVA 3T5JA 3FKBA 3AVIA 3VAJA 3LWMA 3AVLA 4QZHA 1R8CA 4RBUA 2Z1GA 5EE3A 5AK6A 3F73A 2NRRA 3AVBA 5KFWA 2AJ0A 3AA2A 1Y88A 3J80Y 2G2YA 1UTAA 4UB3A 3BSCA 2WAQD 1EWRA 4DR6K 3KKAC 2RIJA 3HL8A 3AVHA 2DXDA 2VONA 2CQ4A 2V2ZA 3CIZA 4DQ8A 2P9CA 3BQ7A 2MQMA 5JLFA 3QGIA 2A2CA 2Z8QA 4JI2F 4B3MK 2NXNA 3ULEB 3K7RA 2BCRA 5IINA 2VFSA 4ECZA 1LW2B 2AX0A 3LDLA 4F3TA 5SZTA 2H3IA 2QKQA 5K4LA 2KHQA 4OHXA 3CUNA 2QK9A 1TU0B 3IP0A 4HEA9 4ZJOA 3VMFB 3AQPA 2H3QA 4O4GB 5H9EK 4C4WA 3PJ9A 3QNMA 2NXCA 1YUWA 1HWJA 3CD5A 4Y2KA 3ZSXA 3O2IA 3IM1A 4LF9F 4KLIA 3QEBZ 4NLGA 4GW6A 3N01A 4FS2A 1H1VA 1NI3A 1D9AA 4USJC 3TADA 4WE1B 3PIPQ 1PK3A 3MPVA 3AXMA 4X66F 4ECYA 2EWHA 4OYIA 2GMHA 1AYEA 3JYTB 2GIFA 2IRUA 1JXBA 3SD7A 3ENBA 4ZDNA 2EFQA 4TSXA 2VB6A 2BEFA 2ATCB 4H4KA 1RAFB 4BG8A 1ZBHA 4OYWA 3KOOA 4DTPA 2OIHA 2I0XA 4ILLA 3V2UC 4J5OA 4CGJA 1HNIB 3WEEA 3M9NB 4JS5A 4ZJLA 2KVSA 4ZOHC 5D6GA 2ZOFA 5C24A 2MXYA 2W3RA 1HQEB 4U8VA 4AP9A 4P9SA 4O9MA 2OEKA 2VFUA 3CCSS 1T6DA 2H51B 4CJTA 2OXOA 2DPIA 3PJXA 1QAYA 1KVKA 1FRKA 4NLRA 2IVOA 3FSXA 3TSUA 4JWNA 1R8PA 4G1PA 3M5RA 1CEZA 1OPZA 2CPXA 2DR6A 5AQKA 1YDLA 2VIHA 4IOXA 4WP8A 3N6NA 4B3TF 2BTFA 5KFFA 4A47A 4C3MA 1TL1A 3D28A 1IKWB 1UEUA 2ZBRA 4X84A 4CTAA 4FWNA 4BGAA 4DSKA 5HRNA 1YTAA 3SMPA 3NASA 1T02A 4AQYF 1SC4B 4C8KA 1ILYA 1LFWA 2P51A 5AQSA 3HLUA 4OYPA 2F8KA 5K9FA 2E7VA 2HNZB 4CVNE 4ECQA 4UY85 1TL5A 3CPWR 3SIPB 3V4IA 1PYTA 3OYLA 4IDKB 5GTIU 1NNDA 4C3LA 4X4VA 4FOEA 2KG0A 5J0UA 1B43A 1XNRF 3VPZA 4IJAA 3N97B 3WXMB 2D8CA 3I8DA 3HVAA 3K0SA 2PMZF 4CEZA 3LAMA 1B0TA 4N76A 2B6AA 4NLYA 2ZH5A 3MTKA 5BPMA 3CCJN 3QEAZ 4EK2A 4KFBA 3F2KA 1R6YA 2AIRB 2YNIB 3A8EA 3QWUA 2BANB 1IBMK 2IMWP 2O8BA 4C8ZA 2F8SA 4I2JA 1T3VA 3KLIA 1RXVA 4CZLA 1RBLA 4LREA 8ICRA 2ZC4A 5T41A 3R7SB 2UVUA 2QTDA 3BZKA 5DM7Q 4PGQA 1DURA 2IOCA 2PAVA 4W5TA 4IS7A 3ZZRA 4OX9F 3NAHA 2NPIA 1XU4A 4QWAA 2QARB 3CP8A 2MJNA 3BGOP 2QEXN 3CMAN 3S1TA 5DDMA 3FEZA 1NMNA 3ALYA 5EGYA 1RBRA 1V6HA 1NSAA 1OO0B 4OLPA 3RMDA 2GHVC 1REVA 4J2AA 4I0WA 5KG3A 3H4DA 3M32A 4DCPB 4MKYA 3FC9A 3NDKA 3I9V9 3PRDA 1F0XA 4DU1A 1IKYB 4AHSA 3I0RA 2DO0A 2R7UA