3THVA

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddatp-dt in closed conformation
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 201
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3thvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3thvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3thvA01
5HNKA 1U48A 4QW9A 1S1TA 4CECA 3AO4A 2HVHA 4ECUA 2G8HA 3RB6A 4PY5A 1B9DA 5J2MA 4P4MA 1RPLA 9ICCA 3QETA 5EWEA 4TQSA 1S9EA 3OYAA 8ICPA 4OGEA 1BI4A 3H7IA 1HMVA 1Z3EB 4CGDA 1TV9A 4IKFA 1VSKA 8ICBA 3CG7A 4FK0A 4PWDA 1T8EA 3K5NA 5KFTA 4ECWA 3OYJA 2AQ4A 2BGWA 4RPXA 4KLUA 4N47A 1DOQA 3M9OB 4HCBA 3QIPA 3SUPA 5J2GA 4K4IA 2JZBA 2G8KA 3TWHA 3TAFA 2ZTCA 1GOBA 1ZJNA 4AHRA 5DKWA 1IKXA 4M6WB 1RBRA 5K14A 2JEGA 4MFFA 2IAJA 2LSNA 8ICWA 1RT4A 5J0SA 1Z00B 1Q8IA 4CEZA 4M9GA 4BE1A 3V9UA 4CK1A 4LZGA 5KRTA 1U45A 4CJTA 1QSLA 4ZTFA 4XRHA 4YD2A 2PYLA 5J0YA 4E1MA 5KFKA 1BPBA 3RWUA 4AHTA 2GUIA 3H40A 3V7JA 4KB1A 4FJHA 2RF2A 4ED7A 1TV6A 3GDXA 3RJIA 1NOMA 1ZQCA 3F73A 4FJ9A 3MABA 2W9CB 3ZT1A 1HPZA 1MQ3A 1NKCA 4OJRA 5J2DA 9ICOA 9ICUA 1RDCA 3RMCA 3KLHA 4W5RA 4DU4A 3V81A 3MEDA 4C8OA 4LH5A 3K59A 2F8SA 4RQ4A 4ZH4A 2XY7A 3ZSZA 1N6QA 3Q8SB 2UVVA 3WNHA 3K5MA 5JS2A 4Q43A 4QZ9A 3TFSA 7ICQA 3OHAA 4PGYA 4M0AA 2YV0X 2FC0A 3JPPA 1L3VA 3RB3A 4UBCA 1IM4A 1KTQA 3B6PA 1UT5A 4CF0A 5DBBA 2G8VA 2NRTA 4KLOA 3PR4A 5KFPA 4P4OA 3KK3A 2KZ3A 4FLUA 1HNVA 2ETJA 4EZ6A 4ID1A 3PUFA 8ICUA 3V1RA 5KG0A 1YTUA 1DTQA 2PFNA 4NLNA 1SUQA 4FVMA 4CHNA 4ED0A 3KLGA 4QZFA 3H8SA 5J2FA 4DO9A 4ECRA 3VQDA 1S6PA 5KFFA 1QS4A 4N5SA 1N48A 2VG5A 1TKDA 4UB4A 3BQTA 2BCSA 2IA6A 4NM2A 4IRDA 1KVCA 2RKIA 2GV9A 1RXVA 4M2YA 1EKEA 3OSPA 5J2QA 4JV0A 4UQGA 3C2MA 3AVAA 3VQQA 3KHRA 5FDLA 3TFRA 3CFOA 4Z6DA 5HMLA 5KFXA 1HUOA 2HNYA 1UA1A 4J2AA 1RT1A 3LANA 3LWLA 4F8RA 4RZRA 3K5LA 2WONA 2XCAA 5D3GA 4F4YA 1D9FA 3AVNA 2NRVA 5KTQA 4ELVA 2I9GA 1FKOA 3JPNA 5CWRA 1S1UA 2YNHA 3G6XA 4O3RA 1BPXA 5J2NA 2ZUCA 4LSNA 4NXZA 2OPSA 3UPQA 4AHCA 1SKSA 4YN4A 1JLQA 4FLZA 3O3FA 3QE9Y 3M8PA 2R8JA 2DFEA 1UWBA 4KAZA 1SZPA 3DOKA 1L5UA 3SYZA 3CFRA 3L2UA 2IOCA 4KLMA 2BGGA 4NLKA 4IR9A 4KHYA 4CHQA 2RDIA 4CJFA 3NGIA 3QEVA 1J5OA 3NAEA 4I2IA 4BXOB 4DTSA 4FS1A 2PZSA 3LP1A 3GV5B 4CJEA 3RAQA 1XC9A 1MSWD 3UXOA 1XI1A 5EOZA 4QZGA 1WSJA 2DFFA 4QCLA 4YVZA 4JV1A 5J2BA 1L3UA 2G8WA 4R8UA 1Z25A 3CYMA 1KFSA 8ICZA 3JYTA 4AHSA 3KKRA 5L1LA 1R0AA 4CJQA 2XY5A 3KKSA 1REVA 3QINA 4X5VA 3GIJA 4E3SA 3OVNA 1NK8A 5KFUA 3HP6A 1MC8A 4UAWA 5D4BA 1ZBIA 1ZQJA 3DLGA 4E7JA 3C6UA 8ICRA 2FLLA 2X6SA 2W9MA 5DLGA 2P6UA 4DSEA 4FW2A 1BHLA 3HPOA 2NUBA 4M9LA 2X78A 3IM1A 4ED2A 1VSIA 2I5JA 2HHQA 5DB7A 3RTVA 4Z0UA 3OYEA 5C25A 1NOYA 4RQ7A 3TAQA 3Q8RB 8ICXA 1ZQFA 1ZQTA 3C1YA 2Y1IA 2ATQA 1ZQOA 1C6VA 5C24A 3AO3A 2PXIA 1HJRA 3ZDCA 4O4GA 4E89A 1TKTA 1TK8A 4HVJA 3C23A 5HHHA 4TUQA 3OYMA 4YXMA 2DFLA 4KLGA 4M04A 2DY4A 9ICFA 1NOZA 4Z6EA 4MF2A 3DLRA 4GW6A 3AO2A 7ICJA 4EBCA 4I29A 2LYHA 7ICUA 3C95A 1ZQRA 2AQ0A 5KFEA 3IHQB 1CXQA 4I2BA 4ED1A 4ECVA 1T3NA 1C0TA 1K6YA 4DOBA 1RXWA 4LVSA 4JS5A 5KFAA 5KG3A 3I0SA 5CZ1A 5CB1A 3T5JA 3ZT0A 4FLVA 2KTQA 3OS2A 3HO1A 2ZUDA 2B21A 3BDPA 5J2HA 2XC9A 4J9NA 2R8KA 2Z1IA 4RQ3A 3U6FA 2XY8A 2NRZA 9ICXA 1U9LA 4RQ0A 4CK3A 4AILC 2V4QA 3WNGA 4JV2A 3NF6A 1A5XA 1C1AA 3ZDDA 1XWLA 1WCLA 3WNEA 2HB5A 4CK2A 3ZSWA 4PHAA 5KFLA 4OPKA 4I9LA 4ECYA 4XQ8A 5DQGA 4PGQA 3QIOA 4M41A 3AVLA 3WNFA 4DTXA 2HNDA 1TFRA 4DFKA 3MEGA 7ICMA 4Z4FA 5KGXA 1ZQYA 4Z6CA 5F9NA 3ZSVA 3ITHA 4DG1A 3AVBA 9ICSA 4F5RA 4QZEA 5CYMA 2C2RA 2HVIA 3G0ZA 2F8TA 3G6YA 2MAXA 2IBKA 4DF4A 4I2HA 2VWJA 3LP3A 2IMWP 3KTQA 1AROP 1VRTA 3PX4A 4F5NA 2Q3SA 4CF9A 4ED8A 2J6TA 2PFQA 2M9NA 1RYSA 9ICBA 5CA7A 3UXNA 4FBTA 4Z6FA 1ITGA 5FRNA 4KV8A 2IHMA 4KHUA 3V9XA 2OA8A 2D0AA 3QZ8A 1VK0A 4CEEA 4CGGA 1C7YA 5C42A 5DGBA 2PFOA 2PI5A 3IAYA 4E7KA 1XS9D 3ISNC 5J2KA 3V9ZA 5IIKA 1UAXA 1B92A 2BE2A 3SV4A 3MDCA 4RQ2A 4CIGA 3AVIA 4KHWA 4O3QA 1HJPA 3PW2A 4JWMA 4K4GA 4F4ZA 3ORYA 4CJRA 4Z4GA 4M3TA 4YMMA 4IQWA 4GVMA 4CFBA 2F1IA 4OPJA 3C5GA 3V7KA 1B9FA 4PHDA 3GV8B 3ZSRA 1VRUA 4M3RA 4NCAA 3VQ5A 4KO0A 4R64A 2HHUA 4PHPA 3OYHA 2XY6A 4KMUA 3PX0A 1VSMA 1ZYQA 1S1XA 3KD1E 4BDYA 4FCYA 3MDAA 1IKYA 4TQRA 1ZQMA 4J9OA 5HRPA 4CF2A 2ZUBA 4ID5A 4DOCA 3BJYA 3JSMA 2UVWA 1B22A 2AGOA 4RNOA 2YKMA 1S9FA 5KG7A 2VA3A 1J54A 4DMNA 3EZ5A 8ICLA 7ICGA 4DQPA 3DI6A 5D46A 2P66A 4J2BA 4GC6A 1ZBUA 4HTUA 3JPRA 1LV5A 4KLQA 5J2CA 4F5PA 2F96A 5HP1A 3MGIA 5KFJA 1ZQDA 1S1VA 1JXLA 2BCUA 1A76A 4CIFA 5J0PA 4HUEA 2ZD1A 3M9NB 5KFYA 4NCGA 4QAGA 3V1QA 4DFPA 4KLHA 1RBVA 7ICLA 3LK9A 2O4IA 4M9NA 3AVFA 5KFSA 1S10A 3Q8PB 2OZSA 1WNSA 1TL1A 4FLWA 1N56A 4YG2A 3EPGA 2A1RA 5I3UA 3OS1A 4IFVA 1C1CA 4FZYA 1WSIA 4KPYA 4UB1A 3DRRA 4DTUA 5KT7A 3VA3A 2A1JB 5DG9A 4DTOA 3NF8A 3PW4A 5BOMA 4FLYA 2ZJAA 4RU9A 4RNNA 3LP2A 3MAQA 1QSYA 3QNNA 3OYKA 4OKEA 1KLMA 2YHAA 1BCOA 1RT2A 3VQBA 5KG5A 3B0YA 3F9KA 1SKWA 2R7YA 3TAEA 3KK1A 3PV8A 1S77D 4DTPA 4O3NA 5J2EA 3DMJA 3C2LA 2MUTB 3AVKA 4M6WA 3QERA 2ZJ8A 4QWBA 4QZDA 3TAMA 5FROA 3A2FA 3SI6A 1Z00A 4B8CA 1QSSA 2FMSA 4F3OA 3PMNA 4EP5A 1JLAA 4KRFA 3H4DA 4DL2A 3EW9A 1X2IA 3HP9A 1EP4A 9ICAA 2JZBB 4F2RA 4M3ZA 5J0XA 2G8IA 4ICLA 4DQRA 3JPSA 4GMJB 1ASUA 4K8ZA 5J0OA 3AVMA 8ICTA 3KJVA 1JL1A 4I28A 5F9LA 2R8IA 4KLTA 3JPQA 3E01A 2WOMA 3NCIA 3OYCA 3KHGA 1ZJMA 4M3YA 4JRQA 3P5JA 4MFBA 3RJEA 4IG0A 4O3PA 2W9CA 1ZQBA 3IS9A 4QZBA 3M8RA 4CFAA 1IH7A 4ED3A 3MXJA 5J2AA 3HPGA 3O4QA 2GWSA 1QQCA 3VQ4A 1LWCA 4CHOA 2XCPA 5IILA 1KEJA 5KFCA 7ICEA 3ZCMA 2P6RA 3GILA 4ZTJA 1QE1A 1ZQLA 4KN4A 2IDOA 1Y97A 4LD0A 1I39A 3TAGA 2YNGA 2IGIA 3B6OA 5L1IA 3RB0A 5KG4A 2V9WA 3L2WA 3ZT3A 4JS4A 4OLBA 3V6HA 3K4GA 1RZTA 2OZMA 3V6KA 3UQ0A 1NK6A 4Y1CA 1T03A 3KLEA 8ICAA 3RMAA 4CEQA 4EBDA 4N56A 1Z26A 1HQUA 1RTIA 1X1PA 4E1NA 2BCRA 5KG2A 3QEBZ 4CJ5A 4F4WA 2HNZA 2FPKA 4FJIA 1CUKA 3NGDA 1C0UA 4YNQA 2W42A 1XHZA 1XU4A 4M3UA 4E7HA 1RTDA 4DS5A 5EWFA 1D5AA 3RH4A 4XUSA 2OPQA 3I0RA 2HHWA 4EEYA 4DTRA 4CGJA 3OYNA 4Q8EA 4F92B 3NDKA 3AU6A 4MQ3A 4F91B 4RPZA 3OYFA 3Q8QB 3SUOA 1H38A 3CM6A 3V4IA 3BQ1A 3NBPA 4C8NA 2W9AA 5KI6A 2HMIA 4RW4A 3EY1A 2F1JA 2ZQBA 2VG6A 4ECTA 1T7PA 3Q8MA 1PZNA 4J9QA 4QWDA 5DLFA 2VG7A 1C0MA 1HQEA 4DQIA 1NKBA 1HNIA 2DTUA 3C21A 1JLGA 1T4GA 4KKOA 4O0JA 4G1QA 5HRRA 4KFBA 4UB3A 2I1QA 1RT5A 4CJSA 3FDSA 2AJQA 4IDKA 1JLCA 1KCFA 1ZQNA 4Q5VA 3THVA 4BDPA 3L3UA 2IHNA 2VA2A 3BGRA 4FJ5A 3HVRA 4RT3A 4CJ3A 4H4OA 3E2EA 2FLPA 3RBDA 2FBTA 5KT2A 2P5OA 4DOAA 4IRKA 4J9PA 1NKEA 9ICTA 5C5JA 2DFHA 2P5GA 1BCMA 1NJYA 3QLHA 2E6LA 1K1SA 1LAWA 5KFDA 3IG1A 3LZJA 3V6JA 1S76D 8ICHA 4UAYA 8ICJA 4NY8A 4KN7A 3LP0A 4C8KA 3K5OA 3ALYA 5DK5A 2ISOA 1KSPA 1EXNA 5HHIA 4TUSA 4KI4A 3PY8A 4O5EA 4IQVA 5KT3A 4F5OA 3V72A 1XSNA 3KIOA 3C5FA 5HRSA 2FMPA 4KHQA 4BGDA 3HSTB 4I2DA 5J0UA 4B9LA 4FZXC 3KLIA 3GQCA 1GOCA 4FJKA 4QWEA 4JRPA 2FPLA 3T5LA 1BPDA 4N41A 3G6VA 1L3TA 4EYHB 9ICNA 4DQQA 4DTNA 1ZBFA 4B3OA 1NK0A 4B8AB 4F50A 4CERA 2C2DA 1VSFA 3RR8A 2KZZA 4W5NA 4GXIA 4W5QA 4MF8A 1TVRA 1WAFA 4J9MA 3AO5A 4EP4A 2DPJA 3CQ8A 2HHVA 3O4NA 3NFAA 4P2HA 2QKBA 1VSJA 5TZVA 3KHHA 1WSGA 3AA4A 4FJ8A 5KFIA 3TI0A 2P51A 4DSLA 1BIUA 3LPUA 1VSDA 4PQUA 5IIIA 4DSFA 1S0NA 4YXJA 1G15A 2KZMA 1COOA 2FMQA 3MFHA 3T3FA 3S3OA 1XSPA 3S3MA 1JKHA 3L2QA 3VQEA 4FXDA 1A77A 3QEPA 3RMDA 4YMNA 4Q0BA 2VANA 2ISPA 1S97A 3QEWA 1RT7A 1WAJA 3N4MB 4OVLA 4J9KA 3V7LA 5CJ7A 5KFNA 1FKPA 2H5XA 1IO2A 1WSFA 3M8QA 3HT3A 3BQ2A 2OPPA 4B9TA 4H4MA 4DSKA 4KREA 1FK9A 1SKRA 4AHVA 4RW8A 3ULDA 2BANA 4FJLA 4QWCA 3AO1A 3MXMA 2FBXA 3H8WA 4PGXA 3QNOA 4CF8A 3OHBA 4DS4A 2Q0ZX 5CHGA 1TVAA 1RDAA 3ISDA 3ZDEA 5HROA 5HP4A 3ZDBA 4BDZA 1RBTA 1NK4A 4M42A 1MU2A 4GXJA 4I7FA 3GFKB 2D0CA 4IFYA 3HK2A 3IRXA 4QZIA 1RBSA 4YFUA 1YTAA 4I2JA 3TAPA 2Z1GA 3OYIA 2BHNA 3VQ6A 4F3TA 4DQSA 4CEOA 5HLFA 4DSIA 5KFVA 2Y1JA 4HUGA 1UT8A 3OYBA 1LWEA 3SQ4A 1ASVA 4FW1A 4OKKA 4I2CA 1TKXA 4GC7A 1EETA 3VQ7A 1FXXA 3VQ8A 4ZHRA 1DGSA 1W9HA 1WN7A 3QO9A 7ICFA 4E19A 1S5JA 1N5YA 2X6NA 9ICJA 5BPCA 5L9XA 3SV3A 2ASLA 4B08A 4IR1A 2KQ2A 5J2IA 1WCNA 3QZ7A 3PMLA 4J9RA 1RTJA 2W8KA 1RCHA 2W9BB 3HX0A 1BPEA 3VQPA 5E41A 4J9SA 2BQ3A 3AU2A 5L1KA 4I2QA 3PW0A 4ECZA 3KK2A 5KG6A 2QK9A 4DL4A 3RB4A 3OSNA 3SQ0A 4ELUA 4DLGA 2IS3A 3C6TA 1QLNA 2KN7A 8ICCA 4CHYA 4LH4A 3QESA 3K2PA 4F4KA 3GIMA 1CZ9A 3OYGA 4CHZA 5CR0A 2OWOA 4O3OA 2E6MA 3JPOA 4HYKA 2PI4A 2ASJA 1ZQUA 1BPZA 1QHTA 5J29A 3K75D 2HW3A 3PR5B 2ZJ5A 1JMSA 1XHXA 4NLGA 1RYRA 2OPRA 1ZQVA 3MR6A 2R8GA 3AV9A 3UXPA 4KHNA 2E4LA 4QOZB 4O55A 4FLTA 3ZD9A 4YMOA 4I27A 1HYSA 4I2EA 3JPTA 2NRWA 4DEZA 3Q8KA 3SZ2A 3ZSXA 3ZSYA 4ECQA 4CJKA 1BQNA 3B0XA 1YT3A 3C2KA 1VSHA 3RJGA 3VA0A 4Z4CA 2BR0A 3RH5A 2QKKA 2UVRA 3L3VA 4FM0A 3H4BA 3DYAA 1Q9XA 5L1JA 3QEXA 5DBAA 2Z1HA 3AVJA 2JEFA 3PO5A 3L2RA 9ICWA 5KFRA 4M45A 3EPIA 4BE2A 4RT2A 4CJVA 5BOLA 2C28A 3LAKA 1TAUA 7ICVA 1V9PA 3G10A 4IG3A 4QZHA 4IRCA 1X9MA 5KRSA 1K1QA 3DM2A 4UBBA 3EWAA 4CGHA 3TARA 2BQUA 1U04A 3ASMA 3NGZA 4QZ8A 1U49A 5IIJA 4FK4A 4M47A 9ICEA 1RILA 8ICKA 1ZQHA 2A1JA 3BQ0A 3OJUA 1JN3A 1Q9YA 4UAZA 3OJSA 4FJNA 2AGPA 4CCHA 4XA5A 1ZETA 5DMRA 4PA1A 3NF7A 5KFGA 9ICQA 4YR2A 3FFIA 4RQ8A 1NJXA 3DLHA 4AHUA 3GIIA 2MUTA 3RJJA 4Q8FA 3H08A 3DOLA 1BI4B 1KLNA 5HBMA 4FYDA 1ZQIA 1IKWA 4FJ7A 1ASWA 3KD5E 4M9HA 2JEIA 4RW6A 5IINA 3GIKA 8ICVA 3PO4A 4CE9A 4RG8A 3FYHA 3SUNA 2GBZA 1WSHA 4IBNA 4FJXA 1GOAA 7ICKA 4CEDA 4NYFA 5DQIA 4FZZA 1JL2A 5KT5A 8ICIA 5CP2A 4RUAA 2FLNA 4CJUA 2KFNA 3MR2A 1ZBHA 3NH1A 3SJJA 4K8XA 2VWKA 3VQ9A 4UB2A 1JX4A 4RPYA 3CM5A 3VN5A 4B9MA 3T5KA 4DU1A 1JIHA 5KFQA 3HM9A 3MBYA 4RW7A 4F4XA 4N76A 1EX4A 5DB8A 3PX6A 4FK2A 1JXBA 4I2FA 3DRPA 2V4RA 3C94A 1TAQA 1NK5A 3KLFA 3O3GA 2YNIA 4CJWA 2G8FA 4YQWA 3HXMA 1TK0A 4FJJA 1VSEA 3D0PA 5KFHA 4JK1A 4J2DA 3AA3A 5DB6A 1JLFA 3MEEA 5J0RA 4Q45A 3TANA 8ICEA 4KI6A 1NJWA 3DLEA 4DFMA 2B5JA 4ED6A 1HYVA 7ICNA 1ZQXA 3UQ2A 2JLEA 1LAVA 1EXQA 3U3YA 3VQCA 1RT6A 8ICGA 4E0DA 4L8RB 3L2VA 4UB5A 4O5KA 5KFWA 4F5QA 9ICKA 2O4GA 2VA8A 1U4BA 2KW4A 3LDSA 2YNFA 5DDYA 1S1WA 1XO1A 5KT6A 4M3WA 4FLXA 4FBUA 3RMBA 4RQ5A 5T7BA 4FJGA 3HVTA 1S6QA 1SL0A 4J9LA 8ICYA 1BQMA 5DG8A 4E7IA 4RW9A 4RQ1A 3TQ1A 4QZCA 3ZT2A 4KTZA 1BIZA 2C2EA 4HCCA 5J1EA 4TSXA 4DLEA 2X74A 1D8LA 4XIUA 2P1JA 4PPXA 4Z4IA 4ELTA 1XSLA 1D8YA 3S3NA 1HUZA 1TK5A 7ICRA 3SQ2A 1KVAA 4J2EA 5KGWA 2BCVA 4B9VA 2HHTA 3LWMA 1T05A 5DQHA 1LWFA 1IKVA 4Z4EA 4OKJA 3AA2A 1BL3A 4O5CA 3QEAZ 1VSLA 3NH2A 4LSLA 4Z4HA 4DSJA 3K58A 9ICMA 1L3SA 2RDJA 5KFZA 1TKZA 8ICSA 4C8LA 3RRHA 1RT3A 4RQ6A 1U47A 1W0HA 4FJMA 2EHGA 5KFOA 1ZQZA 3ISCA 2BKEA 1A5WA 2XO7A 3MR5A 3ZSQA 4HUFA 3VQAA 3PNCA 5J0WA 2BPFA 4OLAA 5FRMA 4QW8A 3OY9A 4BXOA 1X9WA 4OGCA 3ZDAA 4KTWA 5DBCA 3RRGA 4MFCA 4HHTA 4M3XA 3AA5X 2J6SA 4LZDA 4CF1A 4KB0A 4DF8A 2AGQA 1BISA 4I2AA 1JXEA 4KLLA 3HL8A 3T1AA 3L8BA 3KHLA 3M9MB 2C22A 1UA0A 1S9GA 5HRNA 4I9QA 2HHXA 1CZBA 4R66A 3SI8A 2XGQA 1ZQEA 4G3IA 4H8KA 4BACA 1NK9A 3LAMA 3RJFA 1ZQQA 1ZBLA 9ICVA 2XGPA 4B9SA 4O3SA 3SPZA 3U3GA 3S9HA 3M8SA 4I2PA 3DLKA 4DU3A 7ICPA 1J9AA 1JLBA 3LALA 4O44A 1CXUA 4EZ9A 3Q8LA 3NTUA 4EBEA 3TABA 4DL3A 5KG1A 2PYJA 3ISBA 5KT4A 4R8UB 2RN2A 4P4PA 1I3AA 3RJHA 4ECSA 4KTQA 3NH0A 2R8HA 5JUMA 2W8LA 4Q44A 3QEIA 2PY5A 4YFKA 3MR3A 1TGOA 1BGXT 2ITGA 4ECXA 1IXRA 1NK7A 3RJKA 3MGHA 7ICOA 4QWAA 4MEXA 4CGIA 9ICHA 1DTTA 2BPGA 4JUZA 4B9UA 2B6AA 2DPIA 4BE0A 1KFDA 3ZD8A 3LDAA 4JWNA 5DGAA 2D5RA 4YP3A 3P83D 5CY4A 2HHSA 4CJ4A 5J2JA 4KLJA 3SUQA 3N97B 4FS2A 1RBUA 1KVBA 4Y1DA 2ALZA 1B43A 7ICTA 2FBYA 4YR0A 5EU7A 4EYIB 4DFJA 1ZQSA 3SNNA 3PVXA 2XRIA 2B4JA 4KLSA 2ZTDA 4MEYA 9ICPA 4FM2A 5CYQA 3HWTA 2EX3A 4YCXA 4O9MA 4TURA 4CFCA 5SWMA 1CLQA 4MFAA 9ICLA 7ICHA 2YHBA 5EWGA 1RDDA 3EYZA 1RNHA 5KFMA 2PFPA 3OGUA 4NYNA 1D9DA 4CGFA 2A1SA 3HJFA 4F2SA 4CIEA 1SL1A 4KLEA 1WLJA 9ICGA 3T5HA 8ICQA 4RUCA 3GV7B 3RAXA 1SL2A 3C1ZA 3D45A 4RNMA 1RDBA 4GXKA 3DRSA 3SPYA 3UIQA 5CZ2A 4K4HA 4CHPA 2NRXA 5KFBA 3MECA 1HYZA 4R63A 4I2GA 1ZQPA 4W5TA 8ICOA 1X9SA 3LPTA 4IQTA 3HPHA 1ZQGA 5IIMA 3PW5A 4PH5A 4B9NA 2IC3A 4DL5A 4NCBA 4KITB 2BQRA 3SCXA 5D49A 1NJZA 2ZE2A 1CEZA 4KHSA 3DLBA 1S0OA 4CEBA 4YD1A 8ICFA 4CESA 2BDPA 3AVGA 3NGYA 1YVUA 3OYLA 2KFZA 1S0VA 4FM1A 5I42A 5IIOA 9ICIA 1KRPA 2JEJA 4O5BA 4WE1A 4KLIA 3RBEA 4KLDA 1ZQKA 2RPIA 4QZAA 3HYFA 2W9BA 4AH9A 4DWIA 4KLFA 1F21A 4DTMA 3TR8A 1Y88A 3CFPA 1SV5A 5J0TA 8ICMA 2ASDA 4R65A 1J53A 2ATLA 1ZQAA 4NM1A 1LB2B 4E7LA 1ZQWA 3OS0A 4PHEA 1RTHA 2J6UA 1UOCA 4CFDA 2FPMA 1KDHA 3T19A 1DLOA 2YKNA 1QTMA 3ZT4A 3OYDA 4JLHA 2Z1JA 1WSEA 3K57A 2BPCA 3AUOA 4DL7A 4PUOA 2AU0A 3O3HA 4GLXA 3ETLA 1BVSA 1C1BA 3PW7A 3SQ1A 4W5OA 4F93B 4O0IA 3MFIA 3V9WA 1A5VA 3ZSOA 4DL6A 2WTFA 3LZIA 4IQUA 7ICSA 3V1OA 3NF9A 4NLZA 1HRHA 1KFTA 4CEFA 2ZTEA 5DG7A 3RH6A 2OYQA 1JLEA 4BWJA 3H8JA 3NHGA 1S0MA 1BPYA 1O1WA 2FBVA 1LW2A 4C8MA 3NE6A 3AVCA 4LY7A 4R5PA 4YR3A 5HMMA 3V9SA 3MXIA 2XHBA 5JS1A 5SZTA 4CJLA 5DB9A 4M9JA 3RR7A 2UVUA 4TUPA 5J2PA 9ICRA 4CJPA 4DTJA 3AVHA 2G8UA 7ICIA 1TL3A 3P1GA 4FO6A 5DDMA 2F1HA 3V6DA 3HW8A 2BCQA 4BWMA 1MQ2A 8ICNA 2QXFA 4CEAA 1LW0A 5J0QA 1IG9A 2D0BA 3I8DA 2JGUA
chains in the Genus database with same CATH superfamily
3TADC 2DIUA 3G8QA 1ACMB 4QW9A 2IOFA 1T9VA 4CECA 2A2CA 4JI7K 1LWXA 4HHHA 3O2IA 9ICCA 1K44A 1WSRA 2C2NA 3F2DA 2QZ8A 4BRCA 4TQSA 1MA9B 2HVZA 2MJNA 4HT5A 5AKEA 2IJFA 4CO4A 3RZAA 4RWWA 3ZX0A 1TV9A 3GTYX 3KMSA 4US9A 4ZP6A 4JYAJ 3CG7A 4PWDA 2W03A 1T8EA 3B4MA 3OYJA 2AZ1A 4N47A 4HCBA 2EZZA 2N1RA 3QIPA 1FFVA 1HW9A 2XNQA 1NPPA 4IEIA 2AKWB 3LGNA 3UWTA 3TAFA 4M95A 1IKXA 4DQ8A 5EX0A 5K14A 4OL8A 4ZIVA 2X3GA 3D2FA 2YX4A 4BQZA 2QW9A 1YJNS 4RW6B 4JI7J 1Q8IA 3O9TA 1Q86O 4CEZA 4JAXA 4M9GA 3W66A 4AM6A 1NH7A 5ETNA 2DGUA 3MM5B 1U45A 1QSLA 4ZTFA 5TKWA 3CMQA 2HQGA 3SMVA 4E1MA 1EP4B 5TKYA 3M32B 1QM9A 3KJVB 3A0IX 1JNRB 2QWMA 1JNZB 2HHPA 3MN9A 5CE3A 1UTAA 2BJ1A 1SWWA 1ZQCA 3O4WA 2LEBA 4J9VA 2GH1A 3E9PA 3OBYA 1XC3A 2G5IB 4OJRA 2GCFA 1SJRA 2B4PA 1Q0NA 4YY3K 4W5RA 1FJCA 2ZDPA 3SEIA 4JKFA 3MEEB 1GAOA 3J7AP 2W2NP 1N6QA 2VJVA 4QPTA 5D77A 1YITN 2FQQB 2H3GX 1CRXA 4ILGB 1HIYA 1VHXA 1Z1ZA 4YY3F 2YV0X 3JPPA 4YEAA 2I5HA 5AZIA 2AYGA 3CQYA 4PG5A 3B6PA 1UT5A 3M1YA 5DBBA 2G8VA 3ZC4A 4KLOA 1ZZNA 3QT6A 2R2TA 1OY6A 3KWIA 3KK3A 1XMOJ 1HNVA 5DM6Q 2YNFB 3VQSA 4BX9C 1E6YB 1YTUA 1DTQA 1F0MA 4DZ6A 2RU3A 5E79U 4CF4A 4ED0A 4EWTA 2DB1A 4DO9A 5J2FA 1GX6A 1GMWA 2P6SA 1MN9A 3VQDA 1OYDA 2R3VA 2R7VA 3J81j 1Q16B 1YLXA 4N5SA 1N48A 5BRHA 2BCSA 2MA1A 2DCUB 4NM2A 2AJ2A 1KVCA 3CDWA 2HFZA 2RKIA 2GV9A 4F26A 4M2YA 1XBWA 1VS3A 5M2PA 2QV6A 5J2QA 4RW9B 3C2MA 3D66A 4BRQA 2XHCA 4K5RA 2GS8A 2HZVA 3CFOA 4PKGA 1SQFA 2WW8A 3GJRB 1Y5NB 5L46A 3I5CA 1RT1A 4ANCA 3RBXA 3NRZA 4LRBA 2HMIB 3CMEN 4F3MA 1R0CB 4ELVA 3BF1A 1IKVB 3FKBA 2YNHA 5CWRA 1S1UA 2DGQA 5HL7Q 3G6XA 4LSLB 4JI6J 2KYXA 5J2NA 3VF4A 3IFEA 5DM7L 5GAGU 2OPSA 4YN4A 4FLZA 1IG8A 4OHWA 2R8JA 2DFEA 2JWNA 1UVKA 3AAWB 3SYZA 2QTDA 4IFEA 5L1MA 4KLMA 1NSAA 1SC3B 4IR9A 4KHYA 4DI6A 4DV2J 1VQ7N 3LL3A 3W9IA 3NAEA 2YH0A 5IT9U 1NJIO 4I2IA 1VQNN 4LVOP 4BXOB 4DTSA 4K5SA 2PZSA 3E3XA 1W7WA 3UXOA 5EOZA 3JAMU 3M7VA 2DFFA 4QCLA 1AW0A 1N36J 2DH7A 2BUNA 4IL6U 1VQLS 4R8UA 4LRFA 3CYMA 3TP2A 1VQ6S 4P52A 1LXJA 1ZAVA 4PPZA 4OX9J 4CIOA 2XY5A 3QINA 1DGJA 1EJ7L 3ILOA 3PHTA 2DR7A 1NK8A 4B1UB 3POTB 2MQQA 4HTIA 2NZ4A 1MC8A 4UAWA 3MMJA 4OHXA 1Q8KA 3C6UA 1H7XA 3THWA 3PRVA 2QM1A 3I4PA 1FFUA 4C9DA 3KLIB 1WC5A 2ACYA 1KQKA 1BHLA 3HPOA 3NUQA 1LFWA 1T6DA 1VQ9N 3DDNA 5FJ4A 2I5JA 2A1AA 3CCES 3G6ES 3KKAC 3OYEA 4Z0UA 3QFHA 3TEGA 1NOYA 4RQ7A 3TAQA 2QE5A 3MMCA 4USVA 1CQNA 4PYAA 4WU2A 1UVNA 8ICXA 2PMWA 1XUPO 4CJ7A 2HEKA 4PWWA 3GIRA 4LFCK 4M1KA 3SSRA 1HJRA 4WFAL 2FI1A 2P9KB 4PPDA 2E5LJ 3C7NA 1HBOA 3C14A 2H3EB 1SVDA 7FDRA 1TKTA 4E89A 1TK8A 1LXNA 2DNPA 3EE3A 2F40A 4WFBL 4YXMA 1NGGA 1CJKA 2DFLA 4KLGA 2YTCA 4RTFD 2DBBA 4WTYA 1N4LA 1NOZA 3DLRA 4MF2A 1HD1A 1FNOA 4GW6A 2BOPA 4LFCF 1H3DA 3TSPA 2ZOMA 1VLOA 3C95A 2R7TA 4FSVA 3EE9A 1RAJA 1CXQA 4ED1A 2X1GA 1T3NA 1EIYB 4DOBA 4JS5A 2D3OR 2ZNYA 3I0SA 5CB1A 2G1DA 3G2XA 3T5JA 5B08A 3OS2A 2ZUDA 1FX2A 5J2HA 3OFFA 1DXSA 3U6FA 5AZJA 4LR9A 9ICXA 4RQ0A 2V4QA 3TTCA 3WNGA 3WKCA 2E5SA 1C1AA 1HUXA 1TAMA 3ZDDA 3F9MA 2WBNA 2HB5A 5KFLA 4OPKA 4I9LA 1UEVA 1X5SA 4XQ8A 3WUHA 4IFYB 3UD4P 1ULRA 4M41A 5JLFA 3VOVA 3W2VA 1RWPB 2AMCB 2QT7A 4HI2A 2V4JA 3IR5B 3MECB 1CVJA 5KGXA 3BSCA 3F2BA 1YX2A 4YOEA 3OUYA 2BJEA 1FXDA 3HDSA 5HLFB 1UCNA 3D2EB 4ZP7A 4K50A 3DXBA 3W2WB 4QZEA 5CYMA 2C2RA 3IV6A 2HVIA 3A8IA 3UN2A 3G0ZA 1TKXB 3W64A 1EETB 2K2PA 4P0QA 2QWRA 3MR7A 3VCDA 2IBKA 3AD7C 1T44A 2E8NA 4IYQA 5FLXY 2DT9A 5I42B 2IMWP 2MY7A 4F5NA 1H7WA 2R7QA 3FSXA 2KVCA 4X4VA 3MN6A 1RYSA 2M52A 1YJ9N 3R1LA 4FBTA 1N54B 1T02A 4L76A 4Z6FA 3MDQA 5FRNA 4PL1A 4KV8A 3GPAA 3T69A 2OA8A 2D0AA 3QZ8A 1K47A 1VK0A 4CGGA 3CCRN 2JGAA 2G09A 4E7KA 1XS9D 3ISNC 5J2KA 3UKUB 4M8LA 3ZZOA 4OCZA 2WVBA 2XSJA 3C6TB 3AVIA 4O3QA 2BA9A 1KQFB 1HJPA 3PW2A 1WHYA 1NGHA 2ESEA 3PM9A 2R7RA 5E3AA 1VI7A 4U96A 5M2UA 4GVMA 2PDAA 1NMNA 1ZS6A 4H4KC 3C5GA 1B9FA 2LKZA 3IGVA 4EENA 4PHDA 2GJIA 4LF9J 1VRUA 1I94K 4PUOB 4CBWA 2BJ7A 1Z2ZA 3VQ5A 3LGMA 3VVTA 1ZYQA 4NXMK 4A59A 2HOIA 4ID5A 4DOCA 2KM8C 1U2CA 1I94F 2YKMA 1UPPA 3WDOA 2RSQA 2Q1LA 2HF4A 1KR4A 1ZXOA 3EZ5A 3AA9A 1BQNB 4HHUA 4WYLA 5B0EA 1ZBUA 4NXMF 1OW5A 3WEEA 5ALMA 5E7OB 2RS2A 4BGAA 2FJVA 5KFJA 1ZQDA 3RF9A 3P3DA 1JXLA 3HHLA 2AJFE 4C4RA 5J0PA 4CIFA 1RI7A 1NLVA 1OPIA 3MAAB 4KLHA 3OTCA 7ICLA 4BC7A 3QGHA 4M9NA 2HS0A 4IG3B 3QB0A 4K4UA 3PYDA 4A47A 4BC3A 5ETOA 3MCSA 4NXMJ 4FWQA 3J7Z5 4TY8B 2KKVA 1RAIB 4KPYA 3VTIA 3QU5A 3DRRA 4DTUA 2DO0A 1F3VA 4EO8A 3PW4A 2YKQA 3FZFA 4DUYJ 3G82B 3LP2A 3MAQA 1QSYA 3OYKA 1RWVB 4TYBA 3C16A 4FWSA 3F9KA 4DV1K 1SKWA 4HT7A 2R9LA 3TAEA 1FE4A 3KK1A 2HZCA 4BVOA 2IFXA 2CN1A 4YDDB 2VC0A 1A7GE 3VEYA 4M6WA 2YWKA 4YOXA 2ZJ8A 1J5EK 1CJUB 4UUXA 3A5NC 4ZMMA 1EKRA 3O9UA 2W4PA 2DGTA 1SIWB 1XTZA 3TAMA 4DV1F 4HDHA 4B8CA 2FMSA 4F3OA 3OL6A 4FDFA 4KRFA 3H4DA 3SQGB 1GMWD 1FXLA 1IR1A 2GC8A 9ICAA 2QB0A 2I7NA 2E2NA 1J5EF 4ZLNA 2GGPA 1ASUA 4F9OA 1CSJA 3I82A 2I6XA 3ENWA 1P27B 4PXBA 5F9LA 2B51A 1NGEA 3E01A 2VU5A 1IVZA 4M3YA 1H2TZ 4QR2A 5CEHA 2MB0B 4IG0A 4ISEA 1BA0A 4O3PA 4C7ZA 3IS9A 4Z7YA 3M8RA 1G3OA 1U8SA 2QWPA 4C2MA 1VIXA 1T3VA 3KFUF 4DR3K 3UN5A 2JJ4D 2WF9A 2A10A 4ES2A 1MW7A 3THTA 5LMNJ 1RHKB 3U7JA 3DLEB 3FBCA 1N5QA 4LD0A 2YNGA 4DR3F 3N79A 3DKDA 2BM0A 2IGIA 3B6OA 1S22A 3FZKA 2LBOA 3TWZA 4I56A 4JS4A 1K8KB 4OI3A 1ZM3A 3AGKA 2F65A 1RQNA 1KBRA 1N0UA 3SDEB 3V81B 4PL8A 1JJ2R 3QRRA 1Q1KA 1CG2A 2PMZC 5RUBA 2NS1B 4V19J 3WK5A 4H0YB 3MUVP 1A6SA 1RTIA 3QWUA 2QMXA 2BCRA 3MI7X 5KG2A 1YG0A 3EDRB 4FJIA 4YNQA 1WB9A 3AL0B 1XHZA 2UXCK 4FXWA 1VQ4N 2K89A 4E7HA 5LJWA 1NNDA 2ZG6A 4DS5A 3RH4A 2OPQA 3I0RA 3HVTB 4GV6A 3QU9A 4AXJA 3H2VE 4Q8EA 4F92B 3AU6A 5B0FA 2DR9A 1H98A 1Z6RA 1N5SA 1TYQB 1TFWA 2UXCF 2L9WA 5JLHA 5AQZA 1PG5B 1K73O 2W9AA 4K4XA 2XTJP 4CLUA 3WK6A 1VMBA 2DNQA 4RW4A 4H5WA 2ZQBA 4ECTA 1VBKA 2E1ZA 4J9QA 4QWDA 4QIGA 4DQIA 2WAQD 4K4SA 2DTUA 2NO4A 4G1QA 4FF4A 4DCOB 5FDLB 4ZK7M 3IR6B 3KWGA 3IBWA 4GNIA 4Q5VA 3U02A 1W26A 3QRPA 4CZFA 3C66A 4BDPA 3MEKA 3A3OB 2IHNA 3W3SA 1RHJB 3HVRA 2W7PA 3M4XA 2M88A 1G7CB 2QFIA 4GMKA 1EWRA 2FLPA 4CF3A 2BX6A 3W5XA 2VASA 4LT6A 4HL9A 4Y34A 5KT2A 2J9DA 3MMAB 3TOQA 4ZOSA 3BN4A 1RWMB 1NKEA 9ICTA 1GXTA 2UXDJ 5AKZA 2P5GA 4RO0A 1BCMA 4IS7A 1NI3A 2G08A 2E88A 2EEYA 1K1SA 1LAWA 5ALWA 1P8GA 3IG1A 1OH7A 3V6JA 1S76D 8ICJA 4NY8A 2CPEA 4CO0A 3CC7S 4C4WA 1KSPA 4KI4A 1XNQJ 4IQVA 4K2XA 3TZWA 3DLKB 3C5FA 1V9OA 1Z4UA 4DCJB 2KIVA 3EXYA 4ZLJA 4I2DA 4O44B 2GVZB 1HBMB 4FZXC 5C0YA 1M0SA 2XS7A 3GQCA 4FJKA 4JRPA 1P90A 2E5HA 3KWMA 2DGZA 3H1VX 1S8OA 4DQQA 4BCAA 4DTNA 2XMAA 3ETRA 1Y0HA 2OM6A 2GEMA 1REVB 2ZWHA 4B8AB 3VZIA 3VESA 4GXIA 3QPIA 5J8YC 4J9MA 4EP4A 4URGA 2WTUA 3QX7A 3HULA 2DPJA 3N7RC 3O4NA 4RLEA 5F3XB 2AYEA 1NLKL 1WSGA 4FJ8A 1NB2A 1IJJA 3SBMA 4DSLA 4YXJA 2KZMA 2FMQA 1DRZA 1U1RA 3S3OA 1XSPA 2KHQA 3HZEA 1CLFA 4B17A 1JKHA 2PAVA 2FC8A 3CIZA 5AQXA 2HK3A 1XR7A 1S97A 5HN0A 2O8BA 2KVSA 4V19S 1WAJA 4LQ9A 5H1SQ 2A18A 2ZIXB 4J9KA 1PYSB 3M8QA 4A4JA 3M1FA 2GA7A 3NVKA 1G6BA 3PIPL 2OEMA 3AO1A 3CT9A 1N8RO 1NJIT 4PR6A 4H03B 5AI6A 4DR7J 2CDRB 3O5TB 3DXMA 3K7RA 5G5HA 3CO0P 5HROA 1BO5O 1JJHA 1NK4A 1C0TB 1FFGB 2P9EA 4GXJA 4I7FA 2F76X 2D0CA 4PRFA 5E5NA 3HKZC 2E20A 3IRXA 5IV3A 4R79A 1CS4A 4QZIA 4YFUA 3BR9A 5AXLA 3ZZPA 4ZVOB 4XPCA 4MIBA 4DFDA 1YGYA 1YXQA 4DQSA 3EDQB 2Y1JA 1KXPA 4HUGA 1UT8A 2U2FA 1LWEA 4Y2KA 1ASVA 4YORA 4FW1A 4OKKA 2XVTA 3ENHA 2BW7A 2XLIA 5FPNA 1FEEA 4UT4A 4ZPCA 1YJWN 2M8HA 4MLEA 4WYWA 3QAUA 2YWEA 3VQ8A 2DKOB 1DQ8A 4L3QA 4ZHRA 1DGSA 2XLKA 2IJRA 1W9HA 1WN7A 3MEGB 1XNRJ 2QSFA 4ZCKA 3VEWA 2CNKB 2X6NA 4NRUA 2ASLA 1SV0C 4A57A 3EVMA 1CC7A 1IQZA 2LMRA 5B7WA 4J9RA 5ALRA 1MLAA 2W9BB 1SKUB 1EZZB 1KW4A 5FIIA 4J9SA 5L1KA 2O5DA 2O8DA 4I2QA 3CJ1A 2RILA 3L9ZA 3RB4A 3OSNA 1SJFA 4DLGA 3TUIC 3QT8A 5LSOA 3HD2A 3GIMA 4CHZA 3VGKA 2ASJA 1VQON 3SJHA 1ZQUA 1BPZA 3DOMB 3CGIA 1QHTA 5J29A 4KSEB 2ZJ5A 1FRLA 3ZFVA 1JMSA 1CJTB 3GR1A 5C42B 2W24A 2EAMA 3AV9A 4XO0A 3N5FA 3UCZP 1NUEA 3DDIA 4M7XA 2IOHA 5AIBA 2LPEA 1GX5A 2ZIWB 8ATCB 1BU6O 4QOZB 2JFDA 4PZOA 2DNZA 3HLUA 4FLTA 3N6LA 4I27A 3FSYA 2J9DE 4I2EA 4JK8A 2MMYA 3U8XA 3AMZA 2V94A 2NRWA 3Q8KA 3SZ2A 4WQ5A 3MD3A 1VSHA 3VA0A 2Y0SD 1FRIA 2C2KB 2MDAA 2MGZA 4Z4CA 4XDCA 1X40A 3L3VA 2QLBB 5ALUA 1LCUA 5A76A 3ET6A 3CERA 2FZKB 2AP1A 1D0EA 2CQBA 3PSTA 3KVGA 2CZVC 3PSIA 7ICVA 1V9PA 3G10A 2ODGA 3J81Y 4QZHA 1KN5A 1K1QA 4WQ4C 3BYPA 5J2PB 1HHSA 2LDYA 2XI9A 3Q83A 4IOAQ 1VQ8N 1U04A 3ASMA 5IIJA 4FK4A 2W25A 4AYBD 2FSNA 1R8PA 8ICKA 2HCFA 2LM4A 1VRQC 2A1JA 2P9SB 4FNIA 1MWYA 2F3NA 1HW8A 4FJNA 4CH7A 4XA5A 3RGIA 3LTOA 2EFVA 1A0PA 3NVVA 4YR2A 4AHUA 5GAGP 2MUTA 1IUJA 4HH0A 3RJJA 1W97L 4J5OA 2FJXA 3H25A 1K9MO 5HBMA 4WXWA 5AXNA 1ZQIA 1IQTA 4WFYA 4M9HA 1FRKA 3L6QA 1SJQA 2VCPA 1UMJA 1KLMB 2GW8A 4JI3J 3BBCA 1DBDA 1YIJS 3GIKA 4MLHA 8ICVA 1O0PA 1X3MA 3QMQA 4RG8A 4FE3A 2OP5A 1WSHA 3WZ0A 2PKEA 4DMZA 3S41A 5F8IA 4Y65A 4LMZA 2E5JA 1JL2A 3QIPB 8ICIA 5CP2A 3WX8A 3NNAA 2J9EA 1PC4A 2VV5A 1OJ4A 5EHHA 3VQ9A 1IKXB 1RAGB 5K14B 4B9MA 1R6VA 5KFQA 5ELZA 3HM9A 2V0NA 3NS1A 4IUFA 2AYMA 4NEYA 3OTDA 1PAUB 3O1WA 2IVPA 3C94A 1TAQA 3KLFA 3O3GA 1N32K 2G8FA 1Q18A 1BG3A 4FJJA 4BRLA 4LREA 4ZVFA 2MU2A 4J2DA 4QIWC 3AA3A 1JLFA 2QA2A 3KDOA 5AM2A 1FI4A 1VK3A 4MFBB 1QVGM 3H2LA 1N32F 2F2AB 1PVRA 4CYUB 7ICNA 1U0HB 2JLEA 3FVYA 4P75A 2GJ2A 3VQCA 1XN9A 2G2OA 4L8RB 5ETMA 1NDKA 3L2VA 4Z2XA 2QMWA 1LWCB 2NYIA 4U67Q 2P9UA 3R7SB 2O8EB 2E1EA 2DHAA 2GQ2A 4Z94A 2KNJA 4CF5A 4OJLA 3NGUA 3BO2A 2DGOA 3RMBA 2C2OB 4UB6U 1RWNB 5AZIB 3ZNUA 2FD2A 2KVIA 1S6QA 4P7TA 2QRRA 3GL1A 3ZZYA 1PK1A 3SFGA 1BQMA 1OY8A 3B8AX 5ALNA 1HNVB 4O4RA 1NPKA 4RQ1A 4KTZA 3QUBA 4P71A 4C1NK 2C2EA 3KNAA 4HCCA 5J1EA 3T1YJ 3FJ2A 3H3NO 2B43A 3MOZA 1RHRB 1W2IA 3PHEA 4ICAA 3HF5A 2OEHA 2KJWA 3IXQA 2NZCA 4G1PA 1TK5A 7ICRA 2J8AA 4X62J 3QAEA 1QJHA 3F2KA 3G8SA 2HIQA 2RKIB 1LWFA 3CE8A 4OKJA 5J2QB 1KQGB 3QEAZ 2ZH7A 1RWUA 3A0HU 2KDOA 4CLLA 2FVSA 5L8RC 3Q8YA 1N63A 1RT1B 2JC1A 5EDWA 4U7BA 4RQ6A 3O0FA 4B3SK 2CPIA 5HAOA 2WSFC 2VZ9A 1KTVA 2ZEJA 2XO7A 1JLGB 4KKOB 2PA3A 4HUFA 1GTHA 2AWZA 3L95X 1T94A 2WB1D 3LDNA 2YNHB 1JLCB 5FRMA 5IQQA 1X4HA 2P9NB 1X9WA 5ALDA 1D3WA 2LYAA 3VF2A 4B3SF 4Y2CA 2OPSB 3ZDAA 3P5BP 1J2MA 5DBCA 3BSAA 2OTJS 2FB0A 4MFCA 4M3XA 3LVVA 2LLZA 4Y2MA 4NLXA 4LF7K 2AGQA 1UVLA 1NMDA 1JXEA 4QIVA 3L8BA 1FTRA 2RIJA 3CMAS 4HEA9 3DXKA 4I9QA 2HHXA 5B0DA 2XGQA 4H8KA 1U6BA 2M2BA 1ZQQA 1ZBLA 9ICVA 2XGPA 3U3GA 4BLGA 3S9HA 3M8SA 4NZ6A 4C23A 7ICPA 3THYB 4BROA 2OHDA 1WUAA 4LF7F 3AQEA 3LALA 3CCZA 2HPUA 4GY2B 3KK7A 3D0GE 3GJSB 4EBEA 2PYJA 1M1GA 4R8UB 1NHKL 4JP8A 1I3AA 4ECSA 4KTQA 5HMYA 1L7PA 1WYGA 4DR2J 1NEEA 2BZ2A 3AB4B 3DLJA 3NCPA 2BMBA 2C3YA 3WKAA 1OQ3A 4KB7A 4R0JA 3RJKA 2G0IA 3C6UB 1T95A 2E9TA 4C4TA 2BVZA 4QYZK 3THWB 3H5SA 4QYRA 2B9EA 4O0NA 2V63A 3MURP 1YDLA 3V4MA 1WG1A 4YHHJ 1WG8A 4USIA 5FPMA 2DPIA 1PAEX 1HD0A 2KL8A 5DGAA 3DEEA 2OO4A 2KKHA 5CY4A 3SCJE 1E6VB 4ZPVR 2I1RA 2Y9TA 1Q8BA 2EWHA 2XS2A 2W11A 3OXFA 1TVRB 1RBUA 3KKFA 1I6JA 1URNA 5FPDA 3SENA 5AT1B 2GIQA 7ICTA 3IG8A 2YN4A 4DFJA 1ZQSA 2ZDOA 3PVXA 2LDIA 4MEYA 4OYPA 3FGUA 4FM2A 2PT0A 2JMGA 3FZMA 2W43A 2EX3A 4O9MA 1TKTB 2U1AA 4PQUB 5D15A 3MPUB 2LVWA 3LPEA 5AQNA 3FC9A 7ICHA 1JI7A 3TQEA 2JLFA 4NYNA 1D9DA 4DR1K 4USUA 2A1SA 2RDDA 4F2SA 2G07A 3FRYA 5BR9A 4RWTA 3D6FB 8ICQA 4RUCA 2ZF5O 2BRLA 4EX6A 1YK9A 5ALOA 3TA2A 5IWAJ 3I0SB 2VDIA 4K0KJ 3SPYA 5F8HA 2NYVA 4DR1F 2HQDA 2LQ5A 5ALSA 4XK8C 4I2GA 1X9SA 2GMLA 4IQTA 4JV5J 2JX2A 1XJWB 5IIMA 4CZEA 5SUHA 3TVYA 1QVFM 3W65A 5CAAA 1GO3F 2R2RA 2P9PB 4B9NA 4FVUA 2OJ3A 3UB5A 5CRXA 3U4LA 2H54B 2XMWA 3NCQA 4CRJA 4KHSA 3DLBA 1S0OA 2FJBB 3QBXA 3VERA 2RD5C 8ICFA 2IM0A 2P9CA 4RUHA 4MJKA 4OX8A 3OYLA 2DKZA 2HAFA 4FM1A 5IIOA 3BH6B 1FNXH 1DT9A 1KRPA 2V4JB 3C0BA 4DR1J 2OSQA 4O5BA 1AXQA 4GKJK 2HQ3A 4KLIA 2F4VK 4AH9A 3PJ9A 5B5EU 5CYMB 2MZSA 4DTMA 4NLWA 3CFPA 3QIDA 2LQJA 8ICMA 1KQSM 3MGVA 1RWWB 5D78A 3D7EO 1N5YB 4GKJF 2DNLA 4E7LA 2DH8A 2LCWA 3NXZA 4PHEA 2F4VF 3I56N 2YY6A 4CFDA 2KD1A 5EE1A 2FPMA 2BW2A 3JSBA 1QD1A 3WKEA 2FLOA 3RBZA 3IWNC 1DLOA 2ZJQQ 5AQLA 4QR1A 1HI0P 4AT1B 1WBBA 4KV8B 1LVHA 4JLHA 4DUTA 4F25A 1LOTB 4WPAA 2B8PA 4OYZA 3AUOA 1VQYA 1HNXK 4YOTA 1NGAA 4CNYA 4GLXA 2XSJB 2EFNA 2K8BB 2CZ4A 5FPEA 3PW7A 1IJFB 3SQ1A 3D6MB 2ZUGA 3MFIA 2SXLA 1YRXA 2OLWA 2WW4A 4JEPA 3LZIA 1COKA 1ROFA 3CC2S 1HNXF 1S72N 4Q7AA 3V1OA 3J80O 1VQPN 4QJVA 3KJQB 3J7AN 5DG7A 3OVAA 3RH6A 2GIFA 4KYZA 4OIXA 4USHA 1OIAA 1KQQA 1KC8T 1S0MA 1O1WA 3AQFA 4JN4A 3A8YA 1X5PA 5HR7A 2M5YA 3NE6A 1IBKK 2F8MA 1PYOB 1VQKN 2W6LA 2IA0A 3MXIA 5JS1A 5AI5A 2IY5B 1RDUA 4M9JA 2YKMB 3C19A 3VALA 5HO4A 2UVUA 2PBDA 2YX7A 4ZPWR 4BS2A 4RJVA 1M5PC 1TL3A 1IBKF 3HHKA 5DDMA 2F1HA 4KGZB 1E3MA 2DHGA 1XQSC 2GHPA 2QXFA 4RNHA 5C2DA 2QLWA 4Y28C 3HHLB 4BRIA 2D0BA 2OMLA 3OL7A 2JGUA 5HNKA 2VIHA 1U48A 3H46O 1Y64A 1YF5L 1S1TA 3MM8A 1RDWX 3AO4A 2HVHA 3RB6A 2WVFA 3GBTA 9ATCB 3NVWA 3QETA 3THPA 2WHOA 1AUDA 1S9EA 3CQXA 2J4RA 3ICXA 2RQ4A 3DRRB 3I9ZA 3H7IA 4BRHA 1HMVA 1Z3EB 3R5BA 4DV5K 1PVPA 4CGDA 2MRLA 4IKFA 3LP2B 8ICBA 3K5NA 5KFTA 3FZLA 2AQ4A 3UR3C 1N0VC 1S5ZA 4KLUA 1DOQA 3M9OB 3C16B 4I1TA 4K25A 1AFJA 1O51A 2GVDB 1GOBA 1ZJNA 4DV5F 4OJOA 4LIRA 4JKEA 5DKWA 1MWMA 4M6WB 1MMNA 5AQPA 5D6GA 2BJDA 8ICWA 3TAMB 1RT4A 1CZAN 4EX7A 1TU0B 3THXA 3I31A 4PZVA 3R3LA 3TTFA 4N7TA 3CC4S 4DR6J 1TL5A 3OFGA 2F9WA 4XRHA 5GMEA 2B9WA 5J0YA 1ATSA 1BPBA 2QB0B 4CZJA 3RWUA 3MM7A 3F5TA 4M5MA 2QO3A 1VCTA 4PXEA 3P38A 2W3RA 2ZZNA 1MROA 1OSCA 3E01B 1TV6A 2E5GA 4F02A 3RJIA 2EAPA 3ZEUA 2F8HA 4FJ9A 4P2SA 3IS9B 2V8PA 9ICOA 2VFUA 1Y11A 3WT0A 3BEXA 2VB6A 2NR0A 5LT5A 4P72A 3RMCA 3IG5A 3KLHA 3IA0A 2ZH1A 3MEDA 1RDRA 3K59A 4LH5A 4F0HA 3EEQA 4ZH4A 2XY7A 3Q8SB 4DPOA 3WNHA 4QIFA 3K5MA 1VBYA 2KG1A 5JS2A 1NSQA 1IBLJ 2DNHA 1PJ7A 2RHFA 4O8UA 3P4IA 4UBCA 4NEZA 2YWFA 3IAS9 4WCEQ 1RT6B 4DR4J 3PR4A 5E3QA 1KWMA 5ALHA 4KE5A 3UI3A 4ID1A 3PUFA 2ADBA 2ZBPA 4JHDA 2ROGA 4OZ0A 5CCLA 4MDBA 4QPXA 2PFNA 2UYTA 1S1WB 2O8FB 3VAJA 2G06A 2AHOB 4FVMA 4CHNA 1Q5VA 2C2ZB 3KLGA 3H8SA 4KX3A 4P73A 3VEZA 1S6PA 5F8JA 5KFFA 2E2OA 4DX5A 4CBUA 4DPWA 4K43A 2VG5A 1TKDA 1RHUB 4RBTA 4UB4A 2OTLN 2IA6A 2HGMA 2MZ1A 5AKKA 2OPQB 3I0RB 1EKEA 5CHIA 3KMQA 1H1VA 3ULEA 1QQOA 3VGMA 3CPEA 2K7KA 5MAOA 5KOWA 2W7AA 4Z6DA 5BYRA 2QA4S 5HMLA 1UA1A 5HK4A 4J2AA 1WHXA 2H5IB 1PGZA 5LMUK 1TE2A 4B3RK 3Q7BA 4F8RA 2WONA 2D6FC 5AJ3J 4N77A 2XCAA 2W2QP 3ENVA 2B4UA 2Q1NA 3AVNA 3HT0A 4WXOA 1PUZA 2MKCA 2MSSA 3WIVA 2I9GA 2A42A 1TFYA 1SJ1A 3R1XA 5LMUF 3BS5A 1PSDA 2ZUCA 4B3RF 4DPUA 4X2BA 4MDAA 4FFDA 3K8WA 1JMTA 1JLQA 2LXIA 1FEHA 3O3FA 5J1NA 2ITMA 2LEPA 1ZAXA 3ZTRA 3G4SN 3R97A 1SZPA 3DOKA 1L5UA 3HZGA 3O80A 5KAIU 4LRDA 2ZUAA 2IOCA 3H59A 3Q24A 5AM3A 2PFFB 1JXVA 1GLJO 2Q97A 1J5OA 4U6PA 2F9DA 4DL0C 1YZ6A 3GG0A 3RYLA 2VBWA 3GU0A 4BC5A 2VKZG 3GV5B 4LVNP 2A1BA 3RAQA 2UUAK 4WWSA 3BB5A 4QZGA 1FKAF 1JJCB 2R18A 3OFEA 1QVGR 1NGIA 4YVZA 4CLYA 1S9GB 2G8WA 5JXSA 1Z25A 3WXKA 3J7YU 3ETOA 4DV7J 1KFSA 4GO7X 1REGX 1S4FA 1URRA 2VPXB 2YMQA 4AHSA 5JVGQ 1P1LA 1WOSA 1VQMS 1HNWJ 3KKSA 2UUAF 3SAFA 4QNLA 3K1RB 1JLBB 1PC5A 2ZJRQ 1RAEB 2R7WA 5K4LA 3BY5A 3RG6A 1ZQJA 4AL5A 3SK3A 1ZBIA 3MAHA 3MM9A 3M2RA 3UNYA 4KMOB 2FLLA 2X6SA 2DXDA 4FW2A 4PG7A 2VL1A 4H4KA 4NYPA 2X78A 3QT5A 4WIIA 4PXDA 3CF5Q 2HHQA 1LKZA 3RTVA 2DBYA 2CAJA 4CD3A 2B4VA 3VMFB 2WBMA 1ZQFA 2Y1IA 4S0MA 1C6VA 5C24A 1DTTB 2Q0UA 3H45C 4DJBA 3PIOL 4MT1A 4G6VB 4ED4A 5IV4A 2Q2RA 2WSEC 3C23A 4NB4A 2V50A 2IPOB 1PJ5A 3GYXB 3CCLN 4M04A 4JD2A 2IVMA 1PO6A 5A2QY 1ZTWA 2Z58B 1XMQK 3AO2A 1JKHB 4HTLA 4CH0S 2R4FA 2LYHA 3A12A 4C97A 3J7YI 2O8BB 4EFHA 3IHQB 4I2BA 2EH9A 1K6YA 1RXWA 1QQ5A 4LVSA 5KFAA 3ICLA 5KG3A 3OR1B 3M8QB 5CZ1A 3ZT0A 2KTQA 2DY1A 1XMQF 3AB2B 1TQLA 2OD4A 1N5XA 2D3ZA 2Z1IA 3TU5A 3LF0A 1GLAG 1F9FA 2JRZA 1FO1A 3EXCX 1U9LA 4X84A 3P31A 1SB3C 4LFBJ 1WG5A 4JV2A 2VJ5A 1XMBA 5IM0A 2FJDB 1ZBSA 2W1BA 3LA0A 1XWLA 3WNEA 1X4FA 1N60A 4BR5A 2HSZA 4DDFA 3T1HJ 1XQIA 4ECYA 4I7FB 4KX5A 1TUUA 4DTXA 2HNDA 2V8VA 4UY8O 1TFRA 2FGCA 2ZBCA 1ZM4A 1KHWA 4X4PA 3TR5A 3OTOK 3ZTQA 7ICMA 4Z6CA 3CRXA 1YAGA 2APOA 3ITHA 1M5KC 3A5LC 4FWNA 2IBOA 3R6GB 4F5RA 4PXCA 1YJNN 3G6YA 2OI2A 4Y2AA 1RCXB 2DNYA 3OTOF 5K5MA 2OEJA 1RZMA 3R5GA 4ZHRB 4I2HA 3W8PA 2VWJA 3EJMA 2WHEA 1HIWA 1VRTA 5K8PA 3VAFA 2VGMA 4X64K 1VQ7S 4CF9A 4WE1B 3PTWA 5H9FJ 1RHQB 3AOCA 1YTYA 2I38A 4C0HA 2CQCA 2L41A 2CGKA 1ITGA 2DIVA 1LKYA 2IHMA 4CEEA 2PFOA 5AICA 3EM1A 3IAYA 1MN8A 1WWHA 3MTKA 3GE1A 4X64F 4USTA 4YB5A 1B92A 3SV4A 1FERA 4MO4A 1NZ8A 2F3JA 2KICA 4WBFA 3SMSA 4FXVA 3HFKA 4NI2B 2YI1A 3CXCM 2O8CA 4CJRA 4IQWA 2YXLA 3RVCA 4CFBA 4ERDA 3UNGC 4K4WA 3ZSRA 1PVQA 3PYGA 2HZAA 3MF5A 1WC4A 2QL9B 3VAGA 2CYYA 1WHVA 1MMDA 4KMUA 1ITPA 4Y2UA 3PX0A 1VSMA 1VHIA 1IKYA 2A3JA 4TQRA 1ZBTA 1EARA 1FNMA 4CF2A 3BPSP 3JSMA 2UVWA 3UKRA 2Z7JA 3CJKA 3UCGA 5KG7A 4K59A 2VA3A 1CJVB 4DMNA 2MLYA 3QUCA 2NLXA 4GC6A 3T9NA 4X4SA 4UARA 1LV5A 1SH2A 2HFVA 5HP1A 2DO4A 4Y2VA 1JCGA 3M8YA 3J81O 4R5PB 1RP5A 3U1LA 1C0FA 2ADCA 4HUEA 2ZD1A 2MZRA 4B1VA 2XBPA 2J0QD 2MQLA 2BACA 3LK9A 2B0GA 3M2UA 4CZHA 3TVKA 3AVFA 1S10A 1MG7A 1QVFR 2OZSA 1OWXA 2K4HA 1V4SA 1WNSA 5CYJA 2RRNA 1DRGA 3N6MA 4BRFA 3L4IA 2E1MC 4YG2A 3MM6B 2OMOA 1R8AA 5I3UA 1H72C 1RK8A 3OS1A 1GQEA 4IFVA 2RJZA 1C1CA 2VONA 1RYUA 4FZYA 4NLDA 1NPRA 4UB1A 2IM2A 2XZWA 5BRDA 2H5EA 2A1JB 5DG9A 4FYYB 4KBOA 4DTOA 4WK1A 4FLYA 4RU9A 2LKYA 2C42A 4P0PA 2AEJA 4CO5A 4JB3A 5F0UA 3CCUS 4OKEA 4DV6K 1BCOA 1RT2A 1Z4NA 1N62A 3B0YA 2FTRA 4IO1A 2ZZMA 1BHNA 5FLXU 2AJ1A 5H9EJ 2R7YA 3PV8A 1S77D 1Y5IB 2QKQA 4O3NA 3DMJA 1P9QC 2MUTB 4D3GA 1KQSR 2CXEA 3CD0A 1RAFB 3HSCA 3E51A 3G71S 4QWBA 4QZDA 4DV6F 5C12A 4JI4J 5ALKA 4LSZB 5FROA 4M5DA 4AFFA 1UPHA 3KJNB 1RA6A 2O3DA 2GFFA 4EP5A 1JLAA 2V2KA 3KLVA 3VHQA 5GAHU 4DL2A 1X2IA 5GMKa 2KB2A 2JZBB 2GHWA 4CO3A 4M3ZA 2G8IA 4DQRA 3JPSA 5AQHA 1VQ6N 2EDUA 1EWQA 4G65A 1RQLA 5EY4A 4KLTA 1NU0A 2IAJB 2WOMA 1HI8A 4IWVA 1YJ9S 2IYGA 3TACB 3P5JA 4KC5A 5KL1B 2W9CA 1M90T 1RB0A 2KXNB 4NLRA 2KE7A 2DGWA 4TLRA 3ZZ0A 4ED3A 4WP8A 2VPYB 3JAMY 4B6JA 3J80U 2FHKA 5ETVA 3MXJA 5K9FA 4X65J 4ZCLA 2ZIVB 4RWXA 3CCEN 3G6EN 2JVOA 4CHOA 2XCPA 2ZC4A 5IILA 3D2SA 1JLFB 2RF2B 3MWPA 5KFCA 7ICEA 5CABA 2P6RA 3W9JA 3BZKA 1VYAA 4YB7A 2GO9A 1Y97A 2QWLA 1HHTP 5L1IA 5J8YA 3L2WA 2Y9HA 3K4GA 1H0HB 1RE1B 2CPJA 3V6KA 1I1GA 1APSA 1OH6A 2EK6A 5C7PA 1U1NA 3MCNA 3KLEA 8ICAA 3CD6N 4EIAA 5C2FA 1S6OA 4EBDA 4N56A 2OGUA 2HBMA 2VBZA 3F56A 1HQUA 2P9UB 3FNNA 3AA8A 1RBAA 3QEBZ 5B0CA 1S3XA 2HNZA 2BE7D 2CQ4A 1C0UA 2W42A 2EW9A 1XU4A 1GLLO 4MKBA 4M3UA 4F4AA 2DQNB 2E7VA 1RTDA 2HI0A 2C3MA 2W4DA 1S6QB 1Q5YA 2GV1A 2GO7A 4CGJA 1BQMB 1C4AA 3NS6A 1RA7A 1TL7A 1SB6A 3OYFA 1SUQB 4FPBA 2VBYA 5IT0A 3TZZA 2CWKA 2OCEA 3V4IA 1FVSA 3NBPA 2CPXA 2DUYA 4C8NA 1X4AA 1Q78A 2X51A 4AQYJ 2X1FA 5KI6A 3G87A 4QIEA 3C2PA 2F1JA 1FJGK 5DDQC 4JBCA 2VG7A 2E5IA 3UO0A 1HQEA 4C4SA 1HNIA 3C21A 1T4GA 3AJ2A 4WZQA 4J8FA 1YVFA 4KH6A 4UB3A 2I1QA 1RT5A 3TSUA 1ZM9A 1LWFB 4NPOA 2AJQA 1NBWA 1VOMA 4OZJA 4LF2A 2QLJB 3Q0AA 4JKHA 3THVA 3AT1B 4ZP8A 1FJGF 2V52B 4CJ3A 1DARA 1Q3UA 3E2EA 5D3GB 3RBDA 3TJ8A 5CR4A 5LOQA 3SXLA 5D0EA 3NNHA 2WBRA 2P5OA 4IRKA 5T41A 2G9OA 5C5JA 2DD8S 3K89A 4A8XA 3QLHA 3TZYA 3D6RA 2E6LA 1SV0A 3DJCA 4YOWA 3NGRA 4FPAA 1X42A 1RM6C 3PG9A 4PJ0U 5JVHQ 3BEGB 3K5OA 3DXKB 2ISOA 3CB4A 2HSTA 5AKLA 4O5EA 4J03A 3Q7CA 1RU1A 5HJXA 3LP1B 4I0WA 3PFEA 1I3OB 4EEKA 5HRSA 4KHQA 4F36A 1FWPA 5J0UA 2NXJA 2HRTA 4QWEA 2ROPA 1WTFA 2FPLA 3T5LA 1BPDA 1NB7A 3G6VA 4N41A 4EYHB 4KHPJ 1QTNB 4JI2K 1R0AB 1ZBFA 4B3OA 2Q0RA 5DDPC 2C2DA 3RR8A 3ULHA 4W5NA 3VQTA 2BKOA 1WAFA 4BBYA 3AO5A 4QQBA 2VHGA 2XQCA 3L5KA 3DLGB 2HHVA 4JMUA 3NFAA 4P2HA 5AK3A 1HNZK 3KHHA 2RUGA 4JI5J 4MO5A 3AA4A 2D3O1 2WVCA 4JI2F 4JI0J 2F7TA 2P51A 1SXLA 2B9XA 2E44A 1COOA 1WKKA 3LUYA 3T3FA 5C25B 2M0GB 4H0VB 2NXUA 3IRUA 3M3ZA 1HNZF 1YBTA 4A62A 4Q0BA 3IWLA 2ISPA 1T6CA 4K4ZA 1S7IA 3FEZA 4F71A 2HLUA 4OVLA 5KFNA 1FKPA 2H5XA 1IO2A 1WSFA 1U6ZA 4JI2J 4L72B 5HJYA 4H4MA 4KREA 4CP5A 1F2GA 1MMLA 3ONNA 4ID8A 3ULDA 1R27B 2BANA 2KKZA 3PEJA 1K8AT 4FPIA 3GZFA 1P1TA 1YKWA 4CF8A 4DS4A 4FZNA 2Q0ZX 1TVAA 4ITSA 4Y2TA 3ISDA 5ALIA 1ELOA 1LNQA 4BR9A 1RBTA 5A8RA 2F44A 5A8KA 1MU2A 5KQDA 3GFKB 5ETLA 2EBGA 1FCAA 1SC4B 2GTDA 3GLJA 4ES1A 5CQGA 2HWTA 4ED5A 2Z1GA 5AQVA 2N7YA 1UKUA 4ZVTB 3IC1A 1HBUA 2RHSB 4XDDA 2B8QA 1B99A 4ETXA 2YQEA 4DV4K 4JK7A 2QYCA 3FZ2A 4GC7A 2E1AA 5AM4A 1U2FA 4K2JA 4M94A 2PMZD 4DV0J 4NV0A 1UVJA 3VV2B 3QO9A 1SC6A 1BE4A 2B9YA 3MMVA 2LQ9A 1Q79A 2AYBA 2EQYA 3UMBA 2D1CA 2IVYA 4DV4F 4Y2XA 3TUPA 4BRGA 2HS4A 3M2VA 4XTTA 2ZH8A 2C3PA 1QUPA 1WCNA 5IC6B 4PWUA 1RTJA 2WB4A 3P49B 3CJAA 1RCHA 3VQPA 5E41A 2O67A 2BQ3A 1VAZA 3AU2A 5KG6A 2QK9A 2OFGX 1FDNA 4OJ6A 4XH4A 2KN7A 8ICCA 4CHYA 2DNKA 4LH4A 3K2PA 5IFMA 2KXFA 5DRKA 3OD2A 3BPDA 3HVAA 8AT1B 2OWOA 2MQOA 2XNRA 4O3OA 2E6MA 4M5GA 2CPDA 3K75D 3PR5B 3VAMA 1GEHA 4NLGA 1H74A 4NWIA 2K1RB 1RYRA 2OPRA 1SQGA 2R8GA 3E1YA 1NZAA 1TL4A 3UXPA 3DNCA 3JQJA 5AXKA 4CE6A 3UFCX 3EL2A 2CPHA 5LL6d 2UZAA 2AT1B 3HRDD 1VIOA 2Y9UA 3ZD9A 2P9IB 2UXBK 4ZVUB 2DRAA 3JPTA 5IQ6A 1B0PA 4GKKJ 3BYRA 4DEZA 3CJTA 2KOBA 2UUBJ 3ZSYA 5ALFA 4FWRA 3MWBA 3OFHA 3B0XA 3EKUA 3C2KA 3RJGA 3R1HA 2PEBA 9RUBA 3BGFA 1DFDA 4UY8T 2QWOA 5L1JA 2UXBF 2UU9K 3QYPA 3CNQP 1HBNA 5KFRA 4P9SA 4FNHA 4USMA 4RT2A 4CJVA 3HSZA 4MH8A 2DY9A 1XR5A 1NGDA 1FESA 1X9MA 3S01A 3DI6B 1WHWA 4OLOA 3WK9A 3SMZA 3NMRA 2LQ8A 5HOOA 4ZCIA 3CCWA 1V97A 2UU9F 4QZ8A 1U49A 4LF4K 3OPKA 4M47A 9ICEA 1RILA 3I55S 1ZQHA 4ILMA 2QN6B 1VDHA 1IWGA 1TUGB 7FD1A 3JXOA 3DHXA 2HWIA 2E8AA 4NCGB 2BKNA 2ERRA 2XYPB 1FA0A 2Q66A 5ALPA 4UAZA 5DM6L 3UMGA 3AN1A 2AGPA 3UE2A 4CCHA 4HACA 4CTAA 2XWXA 4NL5A 1S1TB 3MM8B 4LF4F 5ALLA 2CRXA 2VYPA 3DC2A 5KFGA 4DHVA 3FFIA 4RQ8A 3DLHA 2FF6A 2CNOB 3FCHA 2RE1A 4Y6IA 2QB1A 4Q8FA 2ZGZA 1S9EB 2J0SD 3H08A 3DOLA 1Y10A 4LF5J 4MHVA 1U25A 2YBVA 1F44A 1HMVB 1DZ5A 5ALGA 1M5VC 4K4VA 4BR4A 3FCWA 2ZKTA 4IOCQ 4CZMA 3PEHA 3KD3A 4RW6A 5IINA 2ZVIA 5IC4B 3LW5C 4CM2A 3PO4A 3FEXB 3FYHA 2VJUA 3MM5A 1YI2N 4NYFA 1BDGA 4RBUA 4FZZA 5CD4H 2JXJA 3CC7N 3SJJA 3EVOA 3M32A 4K8XA 2VWKA 1I5OB 2KJ5A 4RPYA 1NAQA 3CM5A 4DU1A 5HL7L 2PA8D 3CJSA 1JIHA 3MBYA 4RW7A 3MGJA 1RT4B 3J7YP 2D9PA 3CXCR 4N76A 3QSYB 3THXB 3N4PA 3VAIA 2D7SA 5D0RA 3MWTA 2QLXA 2YNIA 1KVJA 2Z2MA 1YBAA 4ICLB 1Z4OA 5D4NA 5L9NA 3MM7B 4IOBA 2BKPA 1YQHA 3D0PA 5KFHA 1OKJA 5BRFA 3ZYYX 3MEEA 2HVEA 5J0RA 1XEZA 3TANA 1MROB 3W5YA 1FFWB 4JKAA 1NJWA 1AT1B 4ED6A 2J0WA 1RJJA 4LF8K 1MA7A 4FWOA 2D69A 1WELA 4M63C 3U3YA 4U7UK 4PG4A 3KLHB 3OHRA 3L3CA 4PKIA 5KFWA 3D1HA 9ICKA 3MEDB 3H0LB 1NGBA 1U4BA 1WKLA 2KW4A 3J81U 2YNFA 3NS5A 1E6YA 4LF8F 2YJEA 2XG8A 4M3WA 1K5OA 1AZSB 4C1NI 3A8KA 5K8NA 2QL5B 4OJ3A 3HHLC 4AP9A 4FJGA 4JNEA 3I33A 5FD1A 4J9LA 2QWQA 3G25A 4KBIA 3UDLA 4RW9A 4W98A 3TQ1A 1NG9A 1NXIA 4C8YA 2E1YA 1GT8A 2CDQA 3W1YC 4TSXA 1Q53A 3MPVA 4XIUA 2LM1A 4NL9A 3KLGB 3LDQA 2P1JA 2QC3A 4YY3J 1S6PB 2YWWA 3OW2R 5BPMA 2VG5B 5DZ7A 1XSLA 5AFUA 4ANDA 3S3NA 1HUZA 3ZNJ1 3SQ2A 1ZRMA 1UL3A 3MPDA 1KVAA 4J2EA 2BCVA 2CIMA 4B9VA 1F5AA 3MDFA 2D3DA 1QQ6A 1IKVA 4Z4EA 1D1UA 3AA2A 1H2VZ 4LSLA 5A0LA 4LBHA 9ICMA 2CVEA 2JHDA 1TKZA 1AFIA 8ICSA 1U47A 3M8ZA 1HEKA 3R3TA 1B0VA 2EHGA 4NLCA 5KFOA 2VG6B 4OZ1A 4C11A 1A5WA 4I68A 3MR5A 2GNKA 2DITA 4KFBB 3VQAA 1GMVA 3LQVA 3BH7B 4OLAA 3CEDA 4USWA 2P2CB 2L9DA 4QW8A 2GX8A 2Y0SC 4BXOA 1R59O 1HPMA 4OGCA 2W3SA 2IIRA 4DUZK 3D2NA 1JLQB 1NZPA 1FT8A 4LZDA 2GAHC 3MD1A 1Q7LB 1IXKA 2V51B 4I2AA 1HKGA 1YJRA 3HL8A 4NZ7A 3DOKB 4A8SA 3M9MB 4WFNQ 5KQ8A 4I6MA 1CZBA 4ZLLA 4R66A 3SI8A 1ZQEA 2JNJA 4CO1A 4G3IA 1NM1A 1NK9A 2QI2A 3LAMA 3RJFA 3M7DA 1J5OB 2HFNA 4B9SA 3BSNA 4ANEA 4DUZF 4Q2MA 4KPCA 5F3TA 4MIAA 5F8LA 3POTA 4B1XB 3OPXA 4ZPAA 2FZGB 4EZ9A 3Q8LA 3NTUA 3MMBB 1RHMB 3GG1A 1HHQA 3U27A 6FD1A 4DL3A 1NMEB 3LP0B 1CI4A 5KT4A 3W0LA 2E3TA 4A2AA 4P4PA 3ZXWA 2PO4A 3QGIA 3QEIA 1ATRA 4F0KA 3CCQS 5AQYA 2RB7A 1TGOA 1BGXT 5T7LB 4Z7CA 2ITGA 1FFSB 1IXRA 2VPZB 1NK7A 4QWAA 2H65B 1T9UA 2NPIA 4CGIA 4H0TB 3M2RB 4MKAA 3D28A 3WQTA 2P9KA 1OS5A 2W4CA 4OLPA 5GAGI 1TR0A 3KYLA 2KRRA 2JOQA 4NX9A 2CJBA 5EX5A 5BR8K 3D6JA 2KKPA 1X7VA 2A0FB 1Q81O 3OL8A 4FS2A 5LXYA 1KVBA 4Y1DA 4CLKA 2NRRA 4A8WA 2ALZA 5BN9A 3D2WA 4KY3A 2WFAA 3H5UA 5EU7A 4ZCMA 5C24B 2XRIA 2AA4A 1R7IA 3PACA 5BPNA 3E8OA 2ZTDA 1R43A 2DXEA 9ICPA 2BRKA 3C15A 5BR8F 2CPFA 5ETSA 2V69A 1HJOA 2NNWA 4CT8A 3AOAA 4IXCA 4CFCA 4WTOB 3CHWA 2RMLA 1CLQA 4FO0A 2YHBA 4JD2B 2RRDA 1RDDA 3EYZA 4TY9A 4TXSA 1WF0A 1RNHA 5KFMA 4OFZA 2W2OP 3OGUA 1DURA 3D3CJ 2ZJPQ 1F9HA 4UOFA 1U1QA 1SL1A 1RKIA 1RT7B 2RVJA 3T5HA 4FN5A 4ZVQB 3CJ0A 1M1KO 3GV7B 3BDEA 1SL2A 1WOOA 3C3LA 4QIWD 2OPPB 4KQZA 1NSPA 1QAIA 2AJ4A 1FK9B 3DRSA 1XO0A 4RW8B 5CZ2A 3UIQA 1QZ6A 4CHPA 4B3TK 2NRXA 1ZQ1C 3MECA 1HYZA 5AQKA 1T3OA 8ICOA 2L08A 4ZIWA 1SQEA 4LFCJ 5G4DA 1ZQGA 2G2YA 1Z1VA 2AF6A 2L3MA 3PW5A 2Q31A 1K0VA 2BQRA 1YIJN 2BJ8A 2ZBIA 1NJZA 4CZIA 4YD1A 4B3TF 2FDRA 3HFVA 1UCVA 4C0BA 5F0XA 3NGYA 2Q6CA 2E2PA 4DZDA 2CUYA 2HNDB 4UZCA 5I42A 2FZCB 9ICIA 3ZI4A 2JEJA 2G2ZA 2RU9A 1OQ6A 5GAHP 3ITHB 3AY0A 2ZXHA 4KLDA 3MN7A 5CXTA 4NLPA 1T3QA 1WD6A 5ITHA 1HLUA 4DWIA 4KLFA 1HWIA 1BY9A 4NA2A 3TR8A 2HG4A 4B3MK 2FC9A 2KT5A 1SV5A 3VAHA 2W04A 3AARA 3ZTSA 2B7CB 2ASDA 4R65A 2OHFA 1J53A 4B3TJ 2C2MB 4U95A 2ATLA 4WFZA 4EFAC 4NM1A 1LB2B 1ZQWA 1RTHA 2J6UA 2HIYA 1UOCA 3VC8A 2Q6BA 4B3MF 2CADA 4AD6A 3T19A 4JI8K 5ETPA 3ZT4A 1J97A 1LKYB 2Z1JA 4OO1J 3US5A 3KK2B 4PUOA 2AU0A 3ETLA 2R7SA 1BVSA 3C28A 3QJLA 4JI8F 4O0IA 3V9WA 5IZHA 4OMFG 2O8CB 1DGKN 3R5CA 4DL6A 1KAXA 3AQPA 2WTFA 2IHR1 2AJ0A 1DY3A 2DTJA 4IO9Q 1HRHA 4IZ9A 2ASYA 2Q36A 4DX6A 2WB1C 1B3TA 1F5BA 3H8JA 3NHGA 3VVUA 1BPYA 4C8MA 1X9XA 1M5SA 4JI1K 3AVCA 4UUWA 4DCPB 5AQGA 4I6YA 4GV3A 1HYSB 2KVQE 2A5XA 4J9UE 4WF9Q 3I9V9 4C6AA 3UKRB 1OMSA 2OKQA 4TUPA 3NOGA 3SSSA 4FF2A 1F0XA 3NG8A 4J7CA 2MKKA 3M8WA 7ICIA 4JI1F 3S6EA 3P1GA 2VJ4A 3G9CA 1XIQA 3DYAB 4K7QA 1KN6A 2N4CA 2RUSA 5HP1B 3AODA 2CQ2A 2BCQA 4BWMA 4CW7B 3C6AA 2NV3A 3GFHA 2YH1A 3PYEA 1LW0A 1IG9A 2ZD1B 4QU6A 1WBDA 3EO3A 1I94J 3DGVA 3M2UB 5DZ6A 1PBAA 2Z56B 3ENOA 1B9DA 1RPLA 4ZVPB 4RPFA 4H0XB 5AI9A 5ADZA 1Y00A 3H42A 3OTEA 2LFVA 4IFVB 4ZDNA 3KJFB 3OYAA 8ICPA 4OGEA 3CNHA 3GU3A 4NA3A 1A0OB 4FK0A 3FQKA 1X8DA 3M05A 2IVFB 2OTJN 4RPXA 3EGVA 4C7YA 5D8HB 5J2GA 4K4IA 3CMAN 3TWHA 2ZTCA 4AHRA 3O1LA 1ZRNA 3B82A 1RBRA 2M70A 2EFQA 1IKWB 4NLUA 4I4BA 4MFFA 2I8EA 3F53A 1T9TA 2KYZA 3KOAA 2X7IA 3PZPA 2GX9A 3CETA 2HVDA 4BE1A 4LRAA 3NVMA 2HAIA 3R27A 4FYWB 1WSVA 4BRDA 4CJTA 5KFKA 1U1MA 2GUIA 3K9JA 4DR5K 3H40A 5A6WA 1AYEA 2Q3PA 2O6KA 4BR7A 4ZN1A 2EC2A 3B6BA 4KB1A 5KOXA 3ONQA 1NGCA 4FJHA 1A6LA 2WOMB 2ABYA 4DV1J 4ED7A 1KD1T 1U1KA 1KVIA 3DRPB 2W9CB 5IT4A 2P35A 3IN5A 1HPZA 1MQ3A 1GTEA 1NKCA 4DR5F 1VHFA 5J2DA 5ETKA 9ICUA 5U47A 3N0VA 2V8DA 1K8KA 1J5EJ 1BD6A 2FPHX 4CI0B 3P6YC 4DU4A 1O08A 4M5NA 3SDEA 3V81A 1WI8A 4H54A 2NXNA 4C8OA 3SSQA 1UJ6A 4WQ5C 4HAIA 3VAKA 3GSIA 4UB8U 1QQ7A 3RSEB 2B5JB 4L3NA 2E1RA 4QZ9A 3U9DA 4WIQA 2F8EX 4PGYA 2FC0A 2HKEA 1L3VA 1VQPS 3T7ZA 1KTQA 1LK7A 1WF2A 2RQCA 1C4CA 2BE9B 1Q8LA 4P2MA 3DLLQ 1UPMB 2EFPA 4OYBA 3GCWP 3TUZC 1FTCA 4FLUA 2ETJA 1KAYA 2KG5A 2OELA 3KLEB 4EZ6A 1UW9A 1NBEB 3V1RA 4YOVA 2NCKL 5DETA 4LFAK 2IOFK 3LDLA 1C2PA 3ZTPA 2CPZA 4J90A 4ECRA 1RAAB 3JTOA 4DR3J 1QS4A 3BQTA 1FDBA 4PL2A 4OI6A 1MNEA 1G1XA 4IRDA 3R8EA 2JRSA 1JK9B 1RXVA 4LFAF 3SBTA 3OSPA 1VBZA 1R8HA 1R31A 5EE9A 4UQGA 3VQQA 1A9NB 5FDLA 2MKJA 3TFRA 1TL7B 5HSPA 4UOGA 1Q86T 1RABB 3V4IB 2EFOA 4MYUA 4RZRA 2W7OA 2EZXA 1X4EA 4HTJA 1BNOA 1OH8A 2KEYA 4F4YA 4OV6A 2YQ0A 1N33K 1HQEB 2NRVA 1T05B 1HNIB 5KTQA 4U7CA 4PHTX 4CI6A 2BUPA 3E0FA 1M6YA 2FIUA 1FEZA 3WC2A 4LSNA 4IOXA 3TJ9A 4NXZA 3UPQA 1SKSA 2UXCJ 2EG2A 1RT3B 3QGPA 3QE9Y 4X66K 3M8PA 3CPWM 1FVQA 1RBOB 1N33F 4KAZA 3WK4A 3OBWA 3L2UA 4UOCA 3OXLA 4GRSA 2RHQB 2BGGA 3BKTA 4CHQA 2RDIA 1Y5LB 4CJFA 3NGIA 1WC3A 4CO2A 4IO8A 2VIXA 2WUSA 5D0GA 4X66F 4FS1A 2XMUA 5CZVA 4XAKA 4YDUA 4CJEA 4A8OA 1RWKB 3NVZA 2HOEA 1X9JA 2BH1A 3QLHB 2W2MP 2RE2A 2QL7B 3Q2TC 1FX4A 2MTLA 1HBMA 1WSJA 1U2VA 3T9ZA 1RFQA