3THVA

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddatp-dt in closed conformation
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 201
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3thvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3thvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3thvA01
4M0AA 8ICLA 5KG5A 2UVWA 1VSDA 1KDHA 3IS9A 4CIGA 4ID5A 5HROA 4CF0A 3CM5A 3NF9A 2RPIA 4I9QA 2XY8A 2PZSA 3JSMA 2OZSA 4W5QA 2HVIA 3C2KA 5KT7A 3LZIA 4FJNA 5KGWA 5J0WA 1FXXA 3JPSA 5HRPA 5KFGA 4BE0A 2X6NA 4RQ3A 3MFIA 3AU6A 1YVUA 2P6RA 1JLEA 4W5OA 1ZQUA 3RB3A 1EP4A 5CZ2A 4PHDA 2AQ4A 4DSJA 3HW8A 4NLZA 3M9NB 4CEZA 4CGIA 4CEOA 2FPKA 5KT4A 1I39A 4UAYA 3SPYA 1S97A 2R8GA 4KLLA 1EX4A 3HXMA 2ETJA 4NXZA 3ZSZA 4FS2A 4FBTA 5J2KA 5JUMA 3MGIA 4PY5A 4O0JA 4JRPA 3AVBA 2F8TA 4DMNA 2NRXA 3V81A 1ZQSA 1Z26A 4KN4A 4J9PA 1HNVA 2A1SA 3GIKA 3DLRA 7ICTA 9ICUA 3WNHA 3MECA 1JXEA 1ZQRA 4M3RA 7ICVA 1ZJNA 5KT2A 3RMDA 5DDYA 2BCUA 1NKEA 1D9DA 3DLHA 4CJ3A 2HW3A 1ZJMA 4IQWA 3IRXA 4J2DA 1AROP 1L3TA 3ZT4A 3B0YA 1Y88A 5DG7A 5FRMA 3QEIA 1SL2A 4R8UB 3ISDA 1ZBLA 5KFUA 1IKWA 9ICIA 3OYAA 8ICRA 2ISOA 1TFRA 1SKRA 4NYFA 3KJVA 2JEFA 4RPYA 4I28A 3ZCMA 3OS2A 1XWLA 1U49A 1NK4A 4QAGA 4CIFA 3OYFA 4LVSA 8ICHA 4IFVA 1MU2A 3KLIA 3OYDA 4FO6A 4KB1A 1T8EA 3ZT0A 3PMNA 3MR2A 1L5UA 4XIUA 4ELUA 4ZTJA 4JV1A 3HSTB 3JPTA 4W5TA 2ZJAA 3DOKA 2X74A 2P5OA 5IILA 2WOMA 4ED8A 5DKWA 1WSIA 9ICCA 3SQ2A 2YHBA 4BXOB 2HHQA 1S1UA 1BPZA 3LAKA 4O55A 4AHRA 7ICJA 2M9NA 5KG6A 2PFOA 1S0NA 3QESA 3VQBA 4Y1DA 5HRSA 2F8SA 5KT5A 2OZMA 4Z4GA 1FK9A 3OS0A 1J5OA 1NOZA 1S0OA 3RMCA 2DTUA 4YG2A 2HHSA 5DG9A 4YR0A 1KVAA 4WE1A 4AHTA 4KTZA 4UBBA 1NK6A 1F21A 8ICEA 3OHAA 3FFIA 3V6DA 4YNQA 3KLFA 1HJPA 3OSNA 4IRKA 4ECUA 4YXMA 3RAQA 4DWIA 4FS1A 2MUTB 5KFNA 5CY4A 4CEBA 4FJXA 2QK9A 4YCXA 4FLZA 5IIIA 2PFPA 5HHIA 4RW8A 2HHVA 1C1BA 4O3RA 3TAPA 4QWBA 5BPCA 2Z1IA 8ICAA 1ZQXA 4GXIA 1ZQBA 3HPGA 4CFAA 4LSLA 5KI6A 3HJFA 3RJJA 1LW2A 9ICJA 1I3AA 1ZQYA 2BGWA 4MEYA 3RRGA 3UPQA 4F5QA 1BVSA 1X9WA 3PUFA 5D4BA 3OJUA 3V1QA 4N41A 5HBMA 2W9BA 4CIEA 8ICJA 3TQ1A 4Z4EA 2R8JA 4B8AB 4JUZA 5DGAA 3H4DA 1XHXA 3OYHA 1A77A 3OJSA 5BOLA 4FW1A 4KLOA 1IKYA 4YFUA 3EPIA 2ALZA 4KHYA 4MQ3A 8ICSA 1BHLA 1CXQA 5JS2A 3QNOA 4UB2A 4CK2A 1SKSA 8ICUA 3ITHA 4B8CA 4PHPA 2W9CB 4EP4A 3OY9A 4FJLA 1BQMA 3F9KA 1L3VA 1JLFA 3HVTA 1S1VA 1ZQTA 2W42A 4ECRA 3RBDA 3HL8A 1SL0A 9ICBA 3PX4A 3PR5B 3ISBA 2KTQA 1HYVA 3KLEA 1SV5A 2HMIA 3TAMA 3V9UA 4PHEA 4ZH4A 4CHOA 1X9MA 3NE6A 2AU0A 4DSKA 3L8BA 1WNSA 9ICFA 1LAWA 9ICWA 4UBCA 4KITB 3O4NA 1CEZA 4QZ8A 1KVCA 4Z4CA 5L1JA 1RDAA 4PWDA 1Z3EB 1D8YA 1JLAA 4HVJA 3ZDBA 4FJ8A 4FVMA 4K8XA 3TABA 3CQ8A 3OHBA 1ZBUA 3O4QA 1RTHA 9ICLA 4KLFA 4O0IA 1D9FA 1S1WA 1TKZA 4PQUA 3OGUA 3M9OB 4Q45A 4IQTA 2G8WA 3AVGA 4DLEA 8ICPA 1A5VA 3AVMA 2VWJA 4OJRA 4FK0A 2IDOA 5JS1A 2JEIA 3AV9A 5J0QA 4DTOA 3OYCA 4OVLA 1ZQHA 4KHUA 2EHGA 4RT2A 1JN3A 4DTNA 3QO9A 3MR5A 4CERA 4KMUA 3JYTA 3RJHA 3OYLA 4FLXA 3MEDA 3T5JA 4KHNA 2ZUBA 4F92B 3RB0A 5KFJA 1C0TA 3HWTA 4F5OA 3G10A 1WSEA 1S9EA 2XO7A 4LZDA 4ECZA 3TANA 3RH6A 3PR4A 1U48A 3SNNA 3GV5B 4FJ7A 5EU7A 5DB7A 4I2IA 1TAQA 3VQQA 2I1QA 4DTMA 4FM0A 5J2BA 5DK5A 3OYBA 1IXRA 1S77D 7ICUA 1XU4A 4AH9A 2FLLA 4B9TA 1RTJA 4YD2A 2HHWA 4JWNA 5KFTA 2C28A 1HUOA 4JV0A 1TKXA 5KFXA 5HHHA 3MDCA 3HP6A 2ATQA 4F5NA 3E01A 4DL2A 1IO2A 3IHQB 2PYLA 2Y1JA 3GFKB 2FBXA 4GC6A 5J2DA 4FM1A 3L2QA 2ZTCA 1TL3A 2DPIA 2GWSA 1BPBA 5KFPA 4M3ZA 4UAZA 3AO3A 2QKBA 3OVNA 4Q43A 4TQRA 5KFQA 4I2CA 1QTMA 4MFCA 7ICFA 4F4YA 3RJKA 3NHGA 4E7JA 2G8IA 4FK4A 3EPGA 2BCVA 1QQCA 4IBNA 3C6TA 4YMMA 4BWJA 4ECVA 4E7KA 4LZGA 5D49A 1VRUA 1RDCA 1KRPA 4RQ8A 3SPZA 4NYNA 4HCCA 4KLSA 2PI4A 8ICIA 2V9WA 1Z00B 4KLJA 2ASLA 5L1IA 3KHLA 4GXKA 5KFHA 4HYKA 7ICOA 3L3UA 3V9XA 3UXOA 2X6SA 3D0PA 4OKKA 4J9QA 3HM9A 4E1MA 8ICVA 1B22A 1XSNA 4RW9A 3NBPA 4AHSA 2NRZA 4DSEA 4N47A 5CR0A 4CGGA 2JZBB 4J9KA 3M9MB 1WSJA 4RG8A 4FXDA 3BQTA 4DL4A 5KFRA 1VSHA 4OGEA 4NLNA 4I2EA 3WNFA 4Z6FA 1WCLA 2XGQA 4QZBA 2FPMA 3S3MA 3RJEA 1JIHA 2BQUA 1NJZA 3QEPA 4IFYA 1RT3A 3NF7A 4DTUA 1ZQOA 1UT8A 3BQ2A 4CEAA 5DQHA 4C8NA 3KHGA 4ZTFA 2PFQA 1ZBFA 3KLGA 4E3SA 3KD5E 3MDAA 1KCFA 1DTTA 4NCAA 3KD1E 3Q8SB 9ICPA 1JLGA 4CJRA 1MQ3A 1ASVA 5J0PA 5CWRA 3ZDCA 1C1CA 5J2AA 1T03A 4RNNA 3H8JA 3DMJA 2XY6A 4ED2A 4QZDA 4KO0A 7ICHA 1VSKA 5CZ1A 1NK0A 3PW4A 4Z4FA 4DOCA 3L2UA 2FBTA 2BDPA 3QINA 2AGQA 1RILA 4FJJA 1IM4A 4K4HA 3VQ8A 1TKDA 9ICGA 3MAQA 4B9SA 3S3OA 1NJXA 4CJPA 4CF1A 1MSWD 4CE9A 4UB3A 5DQIA 3AVFA 3SZ2A 2UVUA 4B08A 3VN5A 4EZ9A 5K14A 3SQ0A 4O3OA 4IKFA 1C7YA 4P2HA 4KPYA 4DEZA 3DLKA 2ZTDA 3T5HA 5KFWA 4KLTA 4TQSA 3RTVA 4FM2A 1RT1A 3GDXA 3UQ0A 4ED6A 4DO9A 9ICSA 4M47A 2BANA 3A2FA 3DM2A 3SV3A 2D0AA 4R65A 2G8VA 4DQRA 1ZQJA 3GV7B 2Q3SA 1RXWA 4CHNA 3SUNA 3AA2A 3RH5A 2G8HA 3RBEA 3M8RA 1C6VA 4DFMA 3DOLA 3QERA 3LANA 4RU9A 4ELVA 3V1OA 4XQ8A 5D46A 1K6YA 8ICBA 4KLGA 3IM1A 3AVNA 2VG7A 2QKKA 5KFVA 1HQEA 4M9JA 3O3FA 2XRIA 4M9HA 3ZT2A 4FK2A 4ED3A 4BDZA 5DG8A 3GQCA 3PMLA 4OPKA 1UAXA 5KG4A 2AQ0A 1SUQA 1ZQDA 4CJUA 3K5NA 1TL1A 2FPLA 7ICPA 1BPXA 1RBRA 3VQ4A 1KTQA 5CHGA 2UVVA 4DFPA 4KHSA 1S9GA 4CJWA 2B4JA 1TKTA 3JPRA 1HJRA 4C8KA 4W5RA 1DLOA 4FJHA 5IINA 4OGCA 4ICLA 3M8PA 3ALYA 3IAYA 3RJGA 1RBTA 5KG2A 4CJ5A 3V6JA 3NH0A 3FYHA 3UXNA 4EBCA 1TV6A 3H8WA 3AVKA 4F8RA 5J0TA 3S9HA 2BPCA 1S10A 2NRWA 3LP1A 2BE2A 4DTSA 4ED0A 4GLXA 2D5RA 4J2AA 1NJYA 4M9NA 2IAJA 2UVRA 4DTRA 3VQ5A 3TAQA 3RJIA 3SCXA 2ISPA 3HYFA 8ICMA 1H38A 4UAWA 1UA0A 4DQQA 2BR0A 4ECQA 4F3OA 4KLMA 4JS4A 5DB9A 1BISA 5CYQA 3C95A 5I3UA 4CCHA 4RUAA 2Z1HA 1CXUA 2IMWP 5J2MA 5T7BA 3C21A 2GV9A 2WONA 3ZSVA 1JLQA 3ETLA 4YP3A 2A1JB 4KRFA 1RT7A 2ZJ5A 4DSFA 2Z1JA 4CJTA 1YTAA 4E19A 1CUKA 4R8UA 3E2EA 3VQDA 5J2PA 4HCBA 1DTQA 4RQ1A 3VQAA 1JL1A 4Z0UA 2VANA 5KRSA 2DFFA 4J9MA 3MFHA 2HNDA 3P1GA 2IS3A 3DYAA 5DGBA 2AGPA 4FJMA 1RTDA 3HVRA 5KG0A 5EWEA 2F1JA 4NCGA 3QIPA 4FZZA 4NM1A 4QZ9A 4YQWA 4RZRA 7ICNA 4F4ZA 3DLGA 1R0AA 4X5VA 3LZJA 3WNGA 4FLWA 1NK5A 1ZETA 2C2DA 4ID1A 2NRVA 4CJKA 3DRRA 2OYQA 4O5EA 3RWUA 3CFPA 1QHTA 5J2EA 2YNGA 3TI0A 3V72A 5SZTA 4O3NA 5KTQA 4Q8FA 4QZIA 2XY5A 2RN2A 4BXOA 1WAFA 1VSLA 4I27A 3Q8RB 5J0XA 3AO2A 4QZFA 3ZSRA 4H4MA 7ICRA 1Z25A 3KHRA 3SQ1A 1UA1A 1TVAA 1S6PA 2DFEA 3AVIA 3L2WA 3CFRA 2IHNA 4DU4A 4F4WA 3ZSXA 5J0RA 1EETA 2DFHA 4KTWA 4AHVA 5J2JA 7ICKA 2B5JA 3KKRA 4CGFA 4PGQA 4KB0A 1ZYQA 3U3GA 4NY8A 3I0SA 2FMSA 5KFLA 3NFAA 3NCIA 1DOQA 4MFAA 3N97B 4KREA 1ASUA 4TURA 3HP9A 5KGXA 3ISNC 1KSPA 2ZD1A 1HYZA 5CYMA 1VSMA 3KHHA 2KFZA 1N6QA 1FKOA 2BPGA 3EW9A 2VG5A 1RT6A 5KG7A 3KTQA 4IRDA 1RT2A 5HRNA 4P4OA 1DGSA 1VRTA 3EWAA 5J2NA 1XI1A 2MAXA 7ICIA 4OLAA 3ZT3A 2FMQA 2ATLA 4G1QA 3H40A 4CJ4A 1S6QA 2A1RA 3LWLA 2VA2A 4RQ6A 3H4BA 3D45A 4FJIA 1T7PA 2XY7A 4AILC 4EP5A 3CM6A 3T3FA 2ZE2A 1W0HA 2IBKA 4KLEA 5J2GA 5C5JA 2R8KA 4O4GA 4Z4HA 4F4XA 4PGYA 3Q8PB 1UT5A 3V6KA 2ASDA 1U04A 2FBYA 1TK5A 3MR3A 2HB5A 1JLBA 3G6VA 1BI4B 4O44A 2OWOA 4Z6EA 3OYMA 3P83D 2BKEA 1ZQCA 1U47A 2E4LA 9ICEA 4DS5A 5KFMA 2KFNA 4RPZA 5KG1A 1Q9YA 1G15A 5L1KA 3SQ4A 7ICSA 2PI5A 4F2RA 1REVA 3DRPA 5KFDA 4B3OA 4L8RB 4O5BA 4N56A 1QSLA 3B0XA 4CHYA 2XCAA 5F9NA 2V4RA 2PXIA 3OSPA 1GOCA 1XSLA 3IG1A 4KFBA 4FLYA 8ICCA 4I2DA 4TSXA 5F9LA 1Q8IA 2NUBA 3C23A 4IQVA 5J2HA 3L3VA 2XCPA 3ZSYA 3VQCA 5DB6A 3DRSA 2YNFA 3LALA 1BPYA 4XRHA 5DBAA 2DY4A 3AVJA 3MXIA 5DLFA 1ZBIA 3GIMA 3I8DA 4QZCA 4KAZA 2P5GA 4EYHB 1NK7A 3RB6A 4I2QA 3QEAZ 2R7YA 9ICHA 4IDKA 2C2EA 4HUGA 3MABA 5C42A 1CLQA 4CFDA 3AO1A 3NF8A 3NGYA 3GV8B 8ICWA 4HUEA 9ICXA 1CZBA 5CP2A 5C25A 4F93B 5J0SA 1EXQA 3LAMA 3ZT1A 1WCNA 2P66A 1J53A 2PYJA 1NJWA 3U3YA 4KLUA 3THVA 4DL6A 5KFIA 4ECXA 4RPXA 2OA8A 3PW2A 2GUIA 2W9MA 1HMVA 3AO5A 4HUFA 4M3UA 4N5SA 2O4IA 3LP0A 4DU3A 9ICKA 4CGJA 1W9HA 4NCBA 3C2MA 1TK8A 4FLUA 4FLVA 1HQUA 4ED1A 2OPQA 2B21A 5EWFA 4I9LA 1TK0A 1S9FA 3VA3A 3RAXA 4UB1A 3NTUA 5J2CA 3RB4A 3Q8LA 1RDDA 4I2FA 4BDPA 1PZNA 2IGIA 3C94A 4QCLA 1O1WA 3QNNA 3EYZA 5KFAA 4B9LA 4LY7A 4PHAA 4DL7A 2IA6A 1B9FA 2JGUA 2XGPA 2BPFA 3L2VA 3U6FA 1T3NA 4K4IA 4MEXA 8ICTA 3PX6A 4JK1A 1KLNA 3NF6A 1TGOA 3ZSOA 2BQRA 4NLKA 4YFKA 5HMLA 3TFRA 5I42A 1NK9A 4M6WA 5J2IA 8ICGA 2NRTA 4FW2A 2IHMA 1ITGA 3DLEA 4N76A 1LWCA 4ECWA 3K2PA 1VSEA 2BCQA 5IIKA 5L1LA 4M3YA 2I9GA 2WTFA 1HUZA 1A5WA 1BL3A 3TR8A 4CEDA 3G6XA 3CG7A 8ICOA 3WNEA 3G0ZA 3MXMA 2JZBA 5KFOA 4YMNA 5KFKA 4P4MA 1BCOA 5FDLA 4KN7A 7ICQA 4M3XA 3VQ7A 2DPJA 1LV5A 3AVCA 2KZMA 4QZHA 4CHZA 3T19A 3AVAA 4YXJA 3ASMA 4UB4A 4I2AA 2B6AA 1RBUA 2KZ3A 4CK1A 1BCMA 3QZ7A 5IIMA 1RZTA 3V9ZA 8ICKA 4EYIB 1FKPA 4OKEA 3V1RA 5J2QA 4Z6DA 1Y97A 1BPDA 4R66A 4E7IA 3NGDA 3Q8KA 1MC8A 4RQ7A 4AHCA 1HNIA 3K5LA 5KFZA 4UB5A 2VG6A 4CECA 4CFBA 2P51A 2XHBA 2BHNA 2BGGA 2C2RA 2Y1IA 4Q8EA 3RH4A 4CJEA 4RW4A 5DBBA 3NGIA 4CJSA 3PW5A 2W8KA 4JS5A 4J9LA 2KQ2A 4CHPA 1YTUA 4E7LA 4DF4A 3KKSA 5SWMA 1ZQGA 2E6MA 4I29A 3TWHA 3MR6A 9ICVA 1B9DA 3HPHA 1XS9D 7ICMA 4LSNA 4Q0BA 4XUSA 4GW6A 4H8KA 4QWEA 2KZZA 9ICRA 4RUCA 4BGDA 1QE1A 1VSJA 3ZD8A 1N5YA 3TARA 3PNCA 5KFSA 5J0OA 3M8SA 4Z6CA 1X9SA 3TAGA 4CF8A 8ICXA 2BCSA 4F91B 4R5PA 2F96A 4PPXA 3N4MB 4J2BA 3K5MA 4O5CA 4B9VA 3SUPA 4DF8A 5HP4A 3DLBA 3QEXA 2AJQA 4IG3A 4GC7A 3KK3A 4DG1A 4RNOA 3V7LA 1WSHA 5KT6A 5HMMA 4DTPA 1BIUA 2FBVA 1ZQKA 1KFDA 4GXJA 1S76D 4KI6A 3GILA 3BDPA 1T4GA 4R63A 4IR9A 2FLNA 1RNHA 2I5JA 4Q44A 1ASWA 1RBSA 3AA4A 1J54A 2KW4A 4QW9A 3QEVA 3AVLA 4QWCA 1XO1A 2F1IA 8ICFA 3EZ5A 5IIOA 1C0UA 5J29A 7ICEA 4ZHRA 3KLHA 3CYMA 1V9PA 4DFKA 3LPUA 5J1EA 2GBZA 4E1NA 3K4GA 5J0YA 3LPTA 4FJGA 2VA3A 3GIJA 5HNKA 2YKNA 4O3PA 4YMOA 4EEYA 1N48A 5TZVA 4R64A 1N56A 3KK1A 1JX4A 3HK2A 4Q5VA 4ED7A 4EBEA 3DI6A 2W9AA 1U4BA 1KFSA 4JRQA 3SYZA 1ZQLA 3C6UA 4J2EA 2J6UA 4KLHA 2RDIA 1X2IA 1SZPA 2HVHA 3HO1A 4CJQA 4K4GA 2ZUDA 3SUQA 4QW8A 3QIOA 3RR7A 3LK9A 3KK2A 3ZD9A 4RW7A 3OYJA 3F73A 3JPNA 4LH4A 3NAEA 1SKWA 2H5XA 4I2PA 4KLQA 4HTUA 3P5JA 1XSPA 3T5LA 1C0MA 4DL3A 1LAVA 8ICYA 3H08A 4H4OA 3NGZA 4M42A 2KN7A 1WN7A 4C8MA 4FJ5A 1BGXT 2O4GA 2RF2A 4M2YA 1RYRA 3H8SA 3O3GA 3JPQA 4XA5A 3OYKA 3ZSWA 4LD0A 4W5NA 3AUOA 1SL1A 2YHAA 3OYIA 4QWDA 1MQ2A 3TAEA 3CFOA 7ICLA 3SI6A 3B6PA 4F50A 4I2JA 1TV9A 3JPOA 1ZBHA 5KFBA 3S3NA 4RQ2A 1EXNA 1B92A 4BDYA 4M9GA 4Y1CA 4MFFA 1IH7A 3T1AA 2DFLA 1LWEA 2A1JA 1BQNA 4OPJA 4O3SA 1JMSA 3TFSA 4CF2A 3PO5A 5DQGA 1ZQVA 1QSSA 1VSFA 2YNIA 2W9BB 3MEEA 2LSNA 2HHUA 1LB2B 3VQEA 3QEBZ 3LDAA 4OKJA 1XHZA 1JLCA 2LYHA 4TUPA 1JKHA 9ICNA 4TUQA 3BQ1A 3PW7A 3C1YA 3HX0A 4J9NA 3ORYA 3ZSQA 5BOMA 3K75D 2OPPA 3OYNA 2BQ3A 2F1HA 3VA0A 4I2HA 1QSYA 1NOMA 1GOAA 4CF9A 3LDSA 3L2RA 5KRTA 2IOCA 3T5KA 2JEGA 1WAJA 5EOZA 1KVBA 3RMBA 4DS4A 4DQIA 3SI8A 3V9WA 5D3GA 2RDJA 1RXVA 4DFJA 4DQSA 4RW6A 1NKCA 4F5RA 4QZEA 3SV4A 1U9LA 2MUTA 4KTQA 3UXPA 2XC9A 1ZQZA 4IRCA 1ZQWA 1Q9XA 2P6UA 2X78A 4K8ZA 3UQ2A 1NOYA 4DU1A 1ZQMA 1UWBA 3I0RA 2EX3A 3FDSA 4J9SA 3SUOA 4G3IA 4DSLA 1KEJA 4CGHA 2BCRA 4I7FA 2YKMA 4DQPA 1RDBA 4ECYA 5FROA 4E0DA 2HHXA 4B9MA 5C24A 4RQ0A 1D5AA 3G6YA 3GIIA 4JLHA 1ZQNA 4DLGA 1JL2A 2QXFA 2FLPA 3LP3A 5KT3A 2ITGA 3PX0A 1L3UA 2FC0A 2D0CA 3QLHA 2E6LA 4FYDA 1HRHA 2V4QA 1LW0A 4NLGA 1ZQQA 4CJLA 4MFBA 4M9LA 1RBVA 3K58A 4YR3A 1IG9A 2G8KA 3NH2A 4QZAA 2OPSA 2W9CA 4B9UA 3K5OA 3LP2A 3VQ9A 1J9AA 1COOA 4KKOA 1TVRA 4PUOA 4PGXA 4DSIA 3PVXA 2ZJ8A 4C8LA 3EY1A 4F5PA 1S0VA 4O9MA 4YN4A 4CK3A 3OS1A 1K1QA 1S5JA 3JPPA 1ZQEA 2R8HA 4F2SA 1RTIA 4B9NA 4KV8A 4CJFA 1ZQIA 2Z1GA 2OPRA 1L3SA 5HP1A 4QOZB 3RR8A 1KFTA 5KFYA 4MF8A 4YVZA 4RQ4A 3QETA 4ELTA 1C1AA 4JV2A 2D0BA 2J6TA 8ICNA 4DTXA 2IC3A 1BI4A 3OYGA 4NM2A 1D8LA 3H7IA 4RQ5A 5E41A 5CA7A 1JXBA 5CB1A 1CZ9A 1WSGA 3C5GA 4O5KA 2AGOA 4RNMA 4J9RA 2W8LA 4PH5A 1YT3A 4ECTA 9ICAA 5KFEA 4EZ6A 4M41A 1ZQAA 4M3WA 3BJYA 3SJJA 3PV8A 3NDKA 5DBCA 1RPLA 2ASJA 1RT4A 4DOBA 4M3TA 1NK8A 4I2BA 4IR1A 2G8FA 3TAFA 4CEEA 4O3QA 4F4KA 4IG0A 4FJ9A 4QZGA 2Q0ZX 3AA3A 3QEWA 3BQ0A 5DLGA 5DMRA 3PO4A 5IIJA 4PA1A 2PFNA 4BWMA 1U45A 3AU2A 5L9XA 3RJFA 1WSFA 4GVMA 3B6OA 3AO4A 3PW0A 4YD1A 4DOAA 4I2GA 9ICTA 4Z4IA 4HHTA 3RMAA 5HLFA 4KLDA 3MXJA 3VQ6A 4AHUA 3V9SA 4KI4A 4EBDA 1LWFA 3ULDA 4RT3A 4YR2A 4P4PA 4ECSA 3RRHA 1UOCA 4E7HA 3MGHA 4J9OA 2HNYA 3O3HA 2ZQBA 4M6WB 3V7JA 4KHWA 3VQPA 4FCYA 5CJ7A 5DDMA 4TUSA 3NH1A 4FLTA 5J2FA 4FZYA 1GOBA 2PY5A 2VA8A 2G8UA 4M04A 5EWGA 4IQUA 4C8OA 1RYSA 4DTJA 2JEJA 4OLBA 5KFFA 1WLJA 4UQGA 3AA5X 1A5XA 2J6SA 4F3TA 1KLMA 5FRNA 9ICOA 1QS4A 3HPOA 1HYSA 3UIQA 2FMPA 4KLIA 1X1PA 3BGRA 1Z00A 2RKIA 1B43A 5DB8A 4CEFA 4BE1A 4QWAA 3OYEA 1BIZA 4E89A 1TAUA 1IKVA 2R8IA 3C1ZA 1EKEA 1HPZA 3KIOA 2VWKA 1XC9A 4M45A 3Q8QB 3LWMA 3ZDAA 3AVHA 1S1TA 1ZQPA 3ZDDA 1NKBA 4CHQA 1VSIA 3V6HA 3C5FA 3ZDEA 3QZ8A 9ICMA 1QLNA 8ICZA 1BPEA 3PY8A 4FJKA 2P1JA 1RCHA 4GMJB 3K57A 4CEQA 3MEGA 7ICGA 2YV0X 3QE9Y 2HHTA 1IKXA 3ISCA 2HNZA 2ZTEA 1ZQFA 5J0UA 4DL5A 3Q8MA 3K59A 3MBYA 5KG3A 4CESA 2JLEA 1T05A 9ICQA 4JWMA 4MF2A 3V7KA 4BACA 1K1SA 3C2LA 8ICQA 2C22A 1S1XA 4CFCA 4LH5A 2ZUCA 2YNHA 4FZXC 1RT5A 4FBUA 4CGDA 4CJVA 3V4IA 3M8QA 1A76A 4BE2A 1S0MA 1JXLA 1VK0A 4KHQA 5HRRA 3HT3A 5KFCA
chains in the Genus database with same CATH superfamily
3CDWA 4M0AA 4LFAK 1KAYA 4LF7J 3U8XA 3MZIA 1H2VZ 2X1FA 3W65A 1VSDA 5H9FK 4AD6A 2HVEA 2NLWA 2XM3A 2RPIA 4I9QA 3PEJA 3HMJG 4A8SA 2UU9K 3BZCA 1V9OA 4A8YA 1P90A 2HQIA 5KT7A 4IOBA 4DR4K 2CN1A 1XNRJ 3MX5A 1NB2A 3AM9A 1TKTB 3BREA 2LKZA 1G6BA 3HDSA 4OX9J 2Q0RA 4XO0A 1ZQUA 2KNJA 3KMQA 1UVIA 1R0BG 3L4IA 1SQEA 3CC4S 3UD3P 4MN4C 2HQDA 3TOQA 2FY1A 1SJFA 3M9NB 2DVIA 3A13A 4CLKA 1NLKL 2XZDB 4CEOA 2H65B 2ROPA 1KEKA 2HBZB 1CJUB 4HI2A 4L75A 5GMKa 1FRMA 2DD8S 2JRSA 2ETJA 4FWQA 3O6WA 4FBTA 2MZTA 2W2OP 4ZVGA 2F40A 2GWJA 4O0JA 3ULEA 4JRPA 2JV3A 4QIVA 5L38A 4ILHA 4P72A 1VBXA 1Z26A 2QLJB 4ZCMA 1HNVA 2QM1A 2A1SA 3ED5A 3OVSA 3DLRA 9ICUA 3WNHA 4FFDA 4RTFD 1FFSB 5J2MB 2E8PA 1X5SA 5KT2A 2YX8A 3GU3A 1NKEA 4CJ3A 1H7WA 2DGUA 1AROP 5LXRA 3S7RA 4ZLLA 3IDHA 5DG7A 2I2YA 2JMGA 4V19X 1RHUB 5J2PB 4RQNA 3MAAB 1FDAA 1ZBLA 5KFUA 1IKWA 9ICIA 2ISOA 2QFIA 1TFRA 3UKUB 4MIWA 2F4VK 1FNXH 4DU7A 2YMPA 2HNDB 1NK4A 1FF2A 4QAGA 4CIFA 4LF8J 2C1EB 2Z7JA 4XH5A 1Y4ZB 3THPA 1QTNB 1LKYB 1BE4A 2E2PA 2IM1A 2K8AA 4NCGB 2Y1LB 1T8EA 2G1HA 1UFWA 1YI2N 3MR2A 1L5UA 4JKHA 4F67A 2E2NA 3TADC 4FWSA 4H4KA 1YZ6A 3NLCA 2BJ7A 2COLA 3A3PB 3HSTB 4W5TA 4DU8A 2ZWOA 3JSYA 2E20A 3IAM9 3U1NA 1LWEB 2I7PA 2P5OA 1R8BA 1U6ZA 4ED8A 3NNHA 4DCHA 2KKZA 2BJ8A 2FJDB 2GNKA 4GV6A 5BJRA 3FUYA 3SQ2A 4FVCA 2ESEA 5AI0A 2G13A 2E7WA 2YHBA 5F8MA 1ZRMA 4HR2A 2M9NA 2J4RA 2E1PA 1IV0A 2FVSA 5KQDA 1ZD2P 5D4PA 4BCAA 2KE7A 3NMAA 3EKSA 2RRDA 3QFHA 2Z8QA 2PBDA 1FK9A 5AQQA 4FDFA 3KUEA 3QB0A 3RFAA 1KNZA 2CJKA 1M5OC 1NPKA 2B5JB 4PL2A 4UBBA 3L7UA 3TX0A 2B43A 4DR5K 3FFIA 3V6DA 3R1HA 3CMAN 3SEIA 4YNQA 2M70A 1WG8A 4X4VA 1H98A 4GVBA 3I0SB 4LBIA 1YBTA 1FRIA 2MKIA 4PG8A 1OPIA 4ETXA 3N6MA 4FS1A 5KFNA 5A0LA 1OWXA 4FJXA 4YCXA 2V69A 5IIIA 4FLZA 2HHVA 4N8OA 3DRYA 4O3RA 1C1BA 4OJ3A 4QWBA 2Z1IA 1ZQBA 4CFAA 2CUYA 4EUVA 3HJFA 4GV9A 1RAAB 1R89A 4DCJB 1HNWK 1VQKS 5EUHA 3JXUA 2KU7A 1RLDA 4PG6A 3JTPA 4MTPA 5EOYA 1H2UX 5AQXA 1AB8A 3U9ZA 4F5QA 1X9WA 1S3XA 3CCMS 3QWUA 4U67Q 3V1QA 2O6KA 5I3QA 2OJ3A 2R8JA 3W3SA 4JUZA 4BLGA 2RS8A 2VZ9A 3NGKA 4NLTA 4UOHA 1VQMN 4C9DA 3OJSA 5BOLA 1RAGB 1A0OB 1CS4B 4FOEA 3EPIA 2VONA 4FZVA 4MQ3A 8ICSA 1BHLA 2AHOB 4NLDA 2D41A 5HQLA 3ITHA 4B8CA 5K5MA 2BTFA 2W9CB 4EP4A 3OY9A 1FNOA 4FJLA 1N88A 3VR1A 1SC6A 5AKKA 5IM0B 4KKOB 1P1TA 4IH5A 3RBDA 4FPAA 5LXYA 3U1MA 1MN8A 2Z57B 4OZ2A 3KLEA 2BM1A 2HMIA 4C6AA 3TAMA 1FJEB 2GAHC 3IBCB 4UZBA 5AIBA 2L08A 3I82A 1WWUA 1HARA 1YJUA 3L8BA 4KV8B 3L6QA 9ICFA 5ALVA 1LAWA 4CLWA 1DEJA 1U1PA 3O4NA 1CEZA 2QFJA 2QA2A 5L1JA 1D8YA 1JLAA 2FUG9 4LQ3A 2VD3A 4BRCA 3OHBA 4RLEA 1F60B 2HZAA 3EKUA 4JI5K 1VQON 4A8FA 1Z05A 4C4WA 2R9LA 2A2DA 4O0IA 2KT3A 2P9KA 4YHHF 1EQYA 5K20B 2D4WA 3CD6N 4PQUA 1VQ9N 3AVGA 3O3LA 4DLEA 1OMSA 8ICPA 3DXMA 3ZNJ1 5I4MA 3CHWA 1CZAN 1XEZA 2IDOA 2H1YA 5J0QA 4DTOA 3OYCA 4OVLA 4RT2A 3BBFA 4C23A 2VV5A 4IDKB 4CERA 3NS6A 2LMRA 4KMUA 1B0PA 3OTEA 5C42B 3AHPA 1NGHA 4FLXA 3E3XA 4LUBA 3QGPA 2CDQA 3POTB 2UYTA 4GVLA 1PVRA 3HWTA 1UTAA 1WSEA 3RH6A 2Z2YB 1U48A 4M94A 3WXJA 2MZQA 1Q8KA 4I2IA 4WFAL 2P9LB 3ZFVA 3AOCA 3BO3A 1URJA 4FM0A 5J2BA 4Y2XA 1ZC6A 4MDBA 3OYBA 7ICUA 4AH9A 1ZBTA 4OHVA 4JWNA 2CPYA 2N4CA 2FY8A 3P8BB 4PZVA 3ZETA 1OO0B 3BGLA 4F36A 1XMOF 3S41A 1VFJA 2ATQA 2B56A 1OJ4A 1IO2A 4CW7B 4Y2JA 4AM7A 1Q81O 4X4NA 4B3RF 4EAHD 2Y1JA 5E0OA 4AM6A 2VHGA 1RWWB 4DR3K 3GFKB 2MKKA 3AOAA 4GC6A 1HWLA 4HH0A 2NZ4A 5ELZA 3A5MC 4UAZA 4M3ZA 1KTVA 4PABA 2ZIXB 3ISND 3TUPA 1S7HA 2K7JA 4TQRA 4Y2UA 5KFQA 2A2CA 2PEHA 1QAIA 3P49B 4LC9B 1S12A 3RJKA 3NHGA 1I1GA 4E7JA 2G8IA 2F8EX 2XLKA 2D0PA 3EPGA 2XMWA 4OZ0A 3HHLA 1W2BR 4OZNA 3C6TA 2N1RA 4YMMA 1XMQF 5I42B 2OEMA 2NZTA 1RDCA 1KRPA 3D2WA 2FIUA 8ICIA 3MR7A 1K9MT 1Z00B 4KLJA 2RKIB 3DLEB 5C7PA 1FD2A 2ASLA 1NZBA 3HHNB 4GXKA 4HYKA 7ICOA 1NMEB 3V9XA 3CETA 5FP0A 1WOPA 3IR7B 4RW9A 3NBPA 1H73A 2KOBA 2C42A 5ALNA 3THYB 2B4UA 3DFEA 4DR6K 5ALWA 2CDRB 1TP7A 4JV5F 2JZBB 4J9KA 2QMUB 5SUHA 4A47A 3O9TA 2A6MA 3TSUA 5FDLB 2E1AA 3G6ES 4HL9A 1QAJA 4CO0A 4Z6FA 1RWMB 3ZZOA 1RA6A 5ALLA 1FVQA 3SCIE 3S3MA 2QLTA 3W5YA 3RJEA 5JMVA 5HO4A 5GAEU 1TFYA 3EICA 1JIHA 5KOWA 1NJZA 4IFYA 1PC4A 1UVJA 1VQ8N 6FD1A 3BQ2A 3FC4A 5DQHA 4A8XA 1N5TA 2CNKB 4ZTFA 2PFQA 1ZBFA 4E3SA 3KD5E 5JVGQ 1U26A 4NCAA 2WW4A 3KD1E 3BEXA 2L9NA 2WCXA 2FHJA 1A7GE 3UPFA 4CJRA 2ROEA 3GIRA 1MQ3A 1HNIB 3QAUA 3HD1A 3CC7N 5AQOA 3U7JA 2VQFF 4PRFA 1UCVA 4YOWA 3NGSA 2HPUA 2HHHF 2IM2A 4RNNA 3ELHA 4RW4B 3DMJA 3GBTA 5GAGP 3TUJC 2QTDA 1KONA 1VSKA 3AL0B 3FJ2A 5AJ3K 3PZPA 4Z37A 3B78A 3QRQA 4AQYK 3PLAA 1ZXIA 2BYCA 3CP8A 2DUYA 3B4MA 3VQ8A 4P0PA 3MAQA 4YHHJ 1NJXA 1N5YB 4CF1A 2B3TB 4KR0B 4CE9A 4UB3A 3AVFA 2UUBK 4JYAK 4TY9A 3VN5A 5K14A 3WXMB 4IKFA 1C7YA 4P2HA 3T5HA 4KLTA 1WJ9A 3THXA 4TQSA 3FSXA 3CNQP 3KWMA 2QV6A 4FM2A 4AYBF 3UQ0A 3VMFB 4DO9A 3CCWA 9ICSA 3W1YC 2V34A 5KAFU 1RISA 4LF4J 4R65A 2G8VA 5A76A 3GV7B 2Q3SA 3JAMO 4CHNA 3AA2A 2RUSA 2FZKB 1IQTA 3UKRB 1VHFA 4GKKJ 2OP5A 3W2WA 4PJ0U 4K4VA 4RU9A 4PWWA 3V1OA 3VEXA 3ATVA 5AI6A 3B4DA 3P96A 1GTEA 3MPWA 3AVNA 4L74A 3IR6B 4UY8O 5C12A 2QKKA 2CXYA 5KFVA 5LJVA 2HBYB 3O3FA 4M9HA 2Y8YA 1ZA1B 4ED3A 3ID6A 3CMEN 2WF9A 3PMLA 3UCGA 3BO4A 1S59A 2NSBA 1ZOTA 1SUQA 3I9V9 4CJUA 4B3RJ 2ZH2A 3W0LA 7ICPA 1RBRA 3W5ZA 1RQNA 1XR6A 3VAFA 2J0WA 1IKWB 1V85A 1FEHA 2B4JA 1A0PA 4LVNP 2W24A 4W5RA 1NNLA 4FJHA 2NR0A 5IT4A 1VQYA 4ICLA 3CD6S 2HGMA 3H7HB 3M8PA 3ALYA 2OFHX 3IC1A 1BU6O 2HWTA 1FT8A 2OYYA 3M2UB 3ZTOA 4JEPA 2VC1A 4NRTA 2KVQE 1DKGD 2LQ9A 2JVOA 2ZJQQ 2W03A 5ALMA 3PFEA 2BPCA 1S10A 3WK6A 2CQIA 4A4JA 1I3OB 1F2GA 4DTSA 1XMQJ 3VC8A 3PRVA 1HI1A 4BG9A 4M9NA 2NSCA 4KMOB 2RF2B 3VWSA 2P6SA 2ISPA 1FCAA 1NBWA 4K4YA 4UAWA 4DQQA 2KYXA 2PMZF 4ECQA 2BR0A 4X4PA 2UZAA 1KC8O 1M1HA 3C95A 3BV8A 4RUAA 2MLXA 1CXUA 2F3NA 1RYUA 2IMWP 4EFAC 3FE1A 5ETKA 5L46A 1FO1A 1TUUA 2VDHA 3FZLA 1Q86T 3MMCB 3ZSVA 1JLQA 3NS7B 4YP3A 1BQNB 4CO4A 1FK9B 1RT7A 3G4SN 3VGKA 4DSFA 4DN9A 3LYSA 2YB4A 1YTAA 3MEEB 5ALJA 4R8UA 1XC3A 2RU3A 4K42A 1ZD5A 1DTQA 4HT5A 3H25A 3OUYB 4Y6IA 5AQHA 3V6DB 3KLVA 1JKHB 1SJ3P 2LMIA 4J7CA 4PPZA 2DGTA 3P1GA 4PKIA 5DGBA 1WYGA 4K8RA 4C0ZA 3TJAA 4FJMA 1RTDA 2QWLA 3WEEB 2OXOA 2YH1A 3C16A 1YQHA 2VQFJ 2XWXA 4CBXA 1FTRA 2HHHJ 4X4TA 2UV8A 4YQWA 3J7ZO 2WAQD 5A8WB 1R0AA 4CTAA 4X5VA 4J9VA 5LJ3Y 3LZJA 2VPZB 2GEMA 4CO3A 4OJ5A 3OTDA 3KYLA 1SH0A 3DRRA 4O5EA 2JHEA 1KP6A 2DGVA 3ILLA 2QT7A 3HTVA 3IFEA 3TI0A 4WFNL 4O3NA 3R6LB 4Q8FA 2RN2A 2Q43A 4L3QA 4BXOA 1HR0F 1VSLA 2RHKA 1WEXA 2FJWA 1Y0HA 1YBAA 2DNRA 1Z25A 2H4YB 2IJNA 3ITHB 2DGWA 3AB2B 3L2WA 1T6DA 3CFRA 4USAA 5K8PA 2IHNA 4DU4A 2CQHA 2B0GA 2OELA 4KTWA 4NX9A 1NM2A 3E1YA 4R0JA 3NL0A 2KSOA 7ICKA 2M4MA 2QTWA 3FNNA 3QLHB 4FXVA 1L7OA 2C3YA 2FF6A 3U3GA 2Z58B 3WK9A 1DOQA 3AQOA 4FYVB 3DGVA 1SKUB 1ASUA 4KREA 5KGXA 3ISNC 5AHXA 2ZBPA 3KHHA 2IIHA 1TMMA 1VISA 4I6MB 1HBOB 1FKOA 1U2VA 2X3DA 3QRPA 3EW9A 1TVRB 1JLAB 2W4DA 1C0GA 2K4PA 2VG5A 4Y2CA 5KG7A 4IRDA 2F77X 5CZXA 1VRTA 4ZLNA 3IXQA 2MAXA 5AM4A 3F53A 3KZBA 3ZT3A 2J8SA 4G1QA 2Y9HA 2PC6A 3GJTB 1TL5A 2FLOA 2ZKUA 2XEXA 4RQ6A 1X40A 2XY7A 1CSJA 3R1LA 3DXMB 4HTJA 4B17A 1KVJA 4TLRA 3TTDA 2LBOA 2Q97A 2E7VA 4BVPA 2W4CA 2OPRB 1RBAA 3X3UA 4BUGA 3T69A 3J81Y 5C5JA 4FZNA 1PVPA 5ALPA 4F4XA 3IDWA 3PNIA 3WKBA 4F3QA 3DDNA 2OKQA 2OUGA 4JI0F 1DT9A 2D9PA 1BNOA 1S6OA 2IC3B 3U26A 4I69A 4MK9A 4P74A 1RZMA 3Q8VA 3P6YC 1WKJA 1ZXOA 4LR7A 2E4LA 2ZG6A 4DS5A 5A8RB 4RX6A 5AQNA 1ROFA 5KFMA 2V63A 5HVGA 4QU7A 3IGVA 3A0HU 1Q9YA 4CE6A 4A2AA 3M2RB 1V4SA 2Z2ZA 2RSQA 4KHPF 1XR7A 2HZCA 2UUCK 3DRPA 4NOHA 4G1PA 4C7YA 1AT1B 4B3OA 2XSFA 2H9ZA 1Q81T 1QSLA 2UXDF 1SV4A 4CHYA 3M8WA 1N5VA 1L8OA 1U1LA 1UJ6A 2V4RA 4NPOA 2PXIA 4UF4A 4IG0B 5FD1A 2MQMA 2P5VA 4EWTA 4LF9K 3SBMA 3FKBA 3M30A 2ADBA 5F9LA 3O1LA 3CCQS 4WU2A 1JROA 1NDKA 2DXFA 2W3SA 4IQVA 3THWA 4ZA1A 4DHVA 1FXLA 3ZSYA 5DB6A 2OO4A 3DRSA 4YB7A 4Y3CA 1WF2A 3WIVA 1FDNA 1VQ4S 1BPYA 2IMOA 3C29A 5F0UA 2DY4A 4TU9A 1GAOA 3TTCA 1MMLA 2ZIWB 3ZZZA 2D3OR 1NM1A 4NLSA 3QU4A 1XIQA 3QWPA 3RB6A 5AXLA 4USWA 4EEKA 5HLFB 4KC5A 2W7OA 1N34J 2QI2A 4BC3A 4CFDA 2Q4TA 3M6XA 3OLBA 1BWEA 3NGYA 2AYGA 3G87A 3NGTA 4HUEA 1B3TA 1ZA2B 4KJIA 5CP2A 5LY3A 2D7SA 3KJNB 3CIMA 4RNFA 3W8PA 2ZM6J 3LAMA 3ZT1A 5RUBA 2J0SD 1WCNA 2P66A 1J53A 2PYJA 3QT8A 1NJWA 2CWKA 2ZOFA 3U3YA 3THVA 1D1UA 4WK3A 1JJCB 2GUIA 2W9MA 4DV4J 5HR7A 1HMVA 3AO5A 4HUFA 3A0BU 4M3UA 1Z1BA 1PYOB 2O4IA 4BGAA 2HGNA 7FDRA 9ICKA 3BGFA 2DH7A 2CZ4A 1IJEB 3EZUA 5EE9A 2M5YA 2WBNA 2NXNA 2HOFA 2XI2A 3AD8C 3CC2N 2B21A 1RLCL 3D28A 2ROGA 4OYWA 3J80O 1FA0A 3OR1A 1T44A 3LDNA 1DQ8A 2M3DA 4EMDA 3SSSA 3D6RA 4M7YA 1HI0P 3VEVA 1HPZB 5K8MA 2IGIA 4NWBA 4K4TA 1O1WA 4ACOA 2E8OA 2MQNA 2NO5A 4PHAA 4DL7A 1EKRA 1NUEA 2RQMA 3VETA 4KB7A 3D2QA 4DR7F 3JSRA 5ALUA 1H6KX 3H5SA 1WORA 4DPOA 5DM7L 1TGOA 1QUVA 2XYHB 1SC4B 5HMLA 4R79A 2GZOA 2WVCA 3TFRA 3EEQA 3J7AP 3H0MB 2IRUA 4M6WA 1XNQK 4BRMA 2VJ5A 4F04B 4YOUA 2NRTA 5K8NA 4FW2A 3V4IB 3CO0P 1WF0A 4NLXA 4DV7F 3K2PA 3WK5A 1GMVA 2B7CB 5HMWA 4P0PB 1A5WA 3TPQA 3CG7A 4BR0A 8ICOA 3WNEA 2AMCB 3MUVP 3G0ZA 3IS9B 5HROB 4CLFA 1UAWA 2MGZB 1N32K 1M5SA 2K3KA 2KLAA 2VOOA 4Z94A 4UY85 3MK6A 3ASMA 4NA2A 3HKZD 2EFPA 1RBUA 4JI0J 1X4EA 2KIVA 5IIMA 1SBRA 4MJKA 3BR9A 4FZMA 1FKPA 4OKEA 2XYGB 3W2WB 3MMAA 4UY8T 1BPDA 2O8FA 1MC8A 1FX4A 4ZVTB 5IQ6A 4X4UA 2P51A 4KHPJ 4EX6A 1OQ3A 5BR8K 3WBZA 2UXDJ 1FDDA 4UQTA 4DV6F 2ZJRQ 4NLRA 1RHKB 2KQ2A 4OJLA 3EGVA 3KKSA 1ZQGA 3G25A 2RRAA 1LNQA 2OEJA 2WAQC 9ICVA 2W43A 2UU9F 3KG0A 2HI0A 1HBUA 4LSNA 4Q0BA 2JH7A 4DR4F 4CDGA 5G0RA 3KG1A 4GW6A 4H8KA 2GAGC 2KZZA 1TTHB 2R2SA 4ICLB 2FTRA 3DGPB 1E6YB 2ZOMA 3I76A 1RKJA 1C4AA 5J0OA 4EK2A 2I0XA 1X9SA 2BCSA 4R5PA 1LWXA 2GVDB 3K5MA 2UXBK 2GJFA 1QQMA 1WG5A 4OYMA 3SUPA 3N79A 3T6JA 1IBCB 4DG1A 1B4SA 5KT6A 2L9WA 5JVHQ 3KKFA 4DTPA 1BIUA 2GIFA 2FBVA 1N52B 1RNHA 1KC8T 2I5JA 4Q44A 3AA4A 2DNHA 1J54A 2E5LK 4OPHA 4IFVB 1MU2B 3AVLA 2KL8A 3UE2A 1CULB 4I6AA 1XO1A 5IIOA 1FFGB 3QPIA 1NH8A 2KHVA 5J29A 3KLHA 4OFZA 5GIOA 4MYTA 4OYAA 4E1NA 2EZZA 3K4GA 5J0YA 5KPRA 2AJ4A 2A6AA 4DUYF 3BS7A 5B09A 2VA3A 1GT8A 4MK8A 2WOMB 3GOIA 2ZJPQ 2OGUA 4BR9A 2FC8A 2XSJA 3J7Z5 4IKAA 3KXDA 1KS2A 1S1UB 1Y7PA 4ZLPA 4JRQA 5AI9A 2H3FA 3QUBA 3CJBA 1ZQLA 3C6UA 4J2EA 5TISU 2J6UA 2LPEA 2I7NA 1AXQA 3RRKA 3EN9A 2F4VF 2HVHA 3HO1A 4XDDA 4QS9A 4DR7J 4LFCK 4UAVA 5L8RC 2IM0A 3TWZA 3J7ZT 2NUUG 1XK8A 3NP5A 4DL0C 3LK9A 5GADU 2MQOA 2BJ9A 3F73A 3HHLD 1SKWA 2E1CA 4WE1B 2BKOA 4HTUA 3MCAB 3P5JA 1ZZNA 1C0MA 1ZBSA 1QD1A 3T1HK 3KLFB 4M42A 1P6TA 4PG7A 2KN7A 3RSEA 2WUSA 4TYBA 4RUBA 2W1BA 3DRRB 2AP1A 2O4GA 4J03A 4DV7J 3PCOB 2YHAA 1WUDA 2DGZA 2YQ3A 2D3ZA 3WXIA 7ICLA 4UOGA 3B6PA 1PK1A 2E1ZA 4I2JA 1BWVA 3QATA 5KFBA 4RQ2A 1B92A 3VEYA 4M9GA 1QZ6A 1IH7A 2GGPA 3CCSN 1KOHA 1QSSA 3CVKA 3Q83A 4WKRA 2EDUA 1NSKL 2QEXS 3VQEA 3QEBZ 3LDAA 4NZ7A 3NASA 1R59O 1BA0A 3BQ1A 2G0JA 4YB5A 1IKYB 4RNHA 5F8HA 4K43A 3C15B 3QFPA 1FEEA 4DR5F 3AQFA 2HRUA 2PKEA 3K75D 2OPPA 2EC2A 2QWNA 4I2HA 3LDSA 4X4RA 3C7NB 1BQMB 3FZKA 3QNMA 3KVGA 1JLFB 1URRA 4TU8A 2ZGYA 1FKOB 3A5NC 2P2CB 2YWEA 4IJAA 2DNZA 1U24A 1R8PA 1VRTB 4LFAJ 3V9WA 5AKIA 5D3GA 2IOFA 4DFJA 5AQPA 1HNWF 4BGBA 5H9FJ 2ILZA 3SV4A 4HHUA 3VAKA 1HBMA 4KTQA 3MXHP 3UXPA 2B8QA 2UU9J 1WKKA 4H4KC 4IRCA 2NO4A 4DR4J 1NU0A 3CDBA 4N77A 1RU1A 4P6QA 3OPKA 5DM6Q 1ZQMA 1UWBA 3HFVA 3I0RA 3FDSA 8RUCA 1KDNA 4G3IA 4DSLA 1WC1A 1NH7A 2BCRA 1YJRA 2P8IA 2YKMA 1RTHB 1WSVA 1Q4RA 1UPMB 4ECYA 1S1WB 4DV5K 2BUPA 3PYDA 1BHNA 4JKFA 5IWAK 4XH4A 5C24A 1D5AA 2HBQB 3CCES 4JLHA 2KV2A 4DLGA 2XG8A 3M8ZA 4KIAA 1FJGF 4P71A 4JB3A 2QXFA 4IO9L 1F5CA 1RAEB 1U02A 5IT9Y 4UW2A 3ZI4A 5MAOA 4DX6A 5JU5A 3GFZA 2AP6A 3T9NA 2CYYA 5M1KA 5BRFA 3I8BA 2GLEA 5AQIA 4MFBA 2LI6A 3JYTB 2XMUA 3MOZA 1XNSA 2G8KA 4ES1A 1FKAF 1RG6A 3CEDA 3AMZA 2BABA 3IWLA 5BYRA 2HWIA 3PIPQ 4YS2A 4UOFA 4TVAB 4OI4A 4BJQA 3PVXA 2CJBA 4QYZK 1HKGA 4C8LA 2E5GA 2RRNA 3THWB 1VQPN 1UFKA 1VBYA 5BRHA 5KAKA 4QR0A 4JI5F 3JPPA 1SH3A 2R8HA 1TKXB 4QU6A 3UB5A 1ZAWA 2IDEA 4IO1A 4CJFA 3E01B 1ZQIA 3ETRA 2Y3YA 4MAKA 2ODGA 3KKAA 1N4LA 2Z1GA 4QOZB 4DX8H 1HX1A 1ECWA 4MYUA 3GTYX 2RAQA 3D1HA 3CCRN 1ZD3A 1FE0A 2CAJA 2F4VJ 2A42A 3MN6A 1NNEA 4JV2A 1UJ4A 3TRGA 1VDHA 2O8EA 2D0BA 3RAMA 4X64K 2A5XA 1BI4A 5AQMA 3OYGA 4RQ5A 4RR5A 3BH6B 1JXBA 1MWKA 5CB1A 1T9UA 1CZ9A 1WSGA 4URQU 4PH5A 4W92B 3RW6A 1YT3A 4H5VA 4QJVA 1NGBA 1FVSA 3F0NA 3L0QA 3OTCA 5KFEA 2J7WA 2MSNA 5LMUK 3UW1A 2CPIA 3CJ7A 2Q36A 3PV8A 2QZ8A 3NDKA 3PYGA 4G6VB 2ASJA 3O44A 3MTJA 1VRUB 2D8CA 2DGXA 3DLJA 3L09A 3N9UC 3TAFA 4CEEA 2KKPA 4F4KA 4B6JA 1V5VA 1T9TA 1Q46A 4NXMK 3V4MA 2XYPB 4PA1A 2VDIA 2H4WB 4CZMA 5GAEP 4DR3F 2MZ1A 4JBCA 2CPZA 2QYCA 3TEGA 3JQJA 4FKXA 4WYLA 3M3ZA 3AO4A 2H3VA 3I6PA 2MQ8A 2EANA 3FCWA 2DIVA 3SCLE 1QCKA 3QDKA 2YTUA 4FWNA 4TN2A 1PC5A 4DR5J 4EBDA 1LWFA 1O5JA 5AM0A 4M5IA 4ECSA 3RRHA 2XULA 2IIRA 5D4LA 4M6WB 2NXEA 4ILRA 4LF6K 3OPXA 2BXJA 3CI5A 4FLTA 5GAHI 4HH1A 1JLGB 2PY5A 4JI3F 2HFUA 4ZITA 3TZWA 2Y1RI 2CG4A 3UO0A 2CPJA 1TMJA 1HNWJ 2JEJA 1F2HA 4C3MA 5ALIA 3T7ZA 2ZH3A 3BSAA 1A5XA 2J6SA 5FRNA 4MDAA 4DR6F 2IRYA 1BO5O 1QS4A 3HPOA 1HYSA 2LM1A 4OJ1A 3OD2A 2CRLA 1X1PA 4BC2A 1HKAA 3NNAA 1XR5A 3OTOK 4QWAA 2ILYA 4H5RA 4KX3A 1IKVA 1XTZA 3KIOA 3LWMA 3ZDAA 2PFDA 1ZQPA 1MNEA 4G65A 4JHDA 3V6HA 3ZDEA 2YY3A 1QLNA 1FKPB 4AF1A 3QRRA 1D8ZA 3R1XA 1F9FA 1FJGJ 4FJKA 4QIGA 4YY3K 2HHTA 3HJVA 1RT1B 2HNZA 3W3DA 1ZQFA 3CQYA 2CNLB 4ZJOA 3K59A 3DM2B 5KG3A 2BBEA 4K4XA 5EGYA 4JWMA 4BACA 1ZZFA 1K1SA 1U0HA 3EX7B 3UR3C 3OFFA 1S1XA 2YNHA 4CGDA 2CKWA 2CQ4A 4A8EA 4YUDA 2PFUA 3M8QA 3CJKB 3HHLC 3I5CA 5F0XA 1D9AA 1RK8A 4A8MP 2EI5A 1HBUB 4LSNB 5AJ3F 3TYTA 1S0MA 1VK0A 1Z6RA 5G0RB 3B54A 1DY3A 2DIUA 1AZSB 3P45B 1S5LU 2RQKA 4AQYF 3TVYA 3SMSA 4JI5J 3SQOP 2DR9A 2UVWA 2YWGA 1J6ZA 2GA7A 2DKZA 3KUGA 3HD2A 3C2PA 3CM5A 1E4FT 2HQFA 4LFBK 1UWAA 3JSMA 2OZSA 2CG8A 5CCMA 4W5QA 4M5NA 4IOAQ 4PKGA 2HVIA 3C2KA 4MK7A 2QA1A 5J0WA 3N5BA 2EK6A 5HRPA 3UE5A 2Y0SD 4HACB 2IM3A 4JKBA 5HMYA 5HMZA 5F8LA 3T1YK 3MFIA 1DLOB 2OTLN 3F2DA 2JLFA 3AY0A 3DHXA 3OVBA 5AQJA 1V4TA 4W5OA 2KRRA 2I5JB 2LQ5A 1EP4A 2VJVA 3R9PA 4PHDA 3PXGa 3BSNA 4CH7A 4WK1A 1I94F 3GFYA 1U2RA 5KT4A 1I39A 1UEUA 4UAYA 2Y8WA 3KLHB 2R8GA 3H1VX 2D9OA 4KLLA 2RMLA 1YIJS 3R6MA 4ZJLA 1EX4A 1FWKA 4NXZA 1SXDA 4YORA 5JUMA 4RBVA 4U8VA 3MGIA 3H5YA 2ASOA 1PYSB 4DMNA 5AKEA 5ETQA 2NRXA 3V81A 1YJNS 4J9PA 4DR3J 2VF3A 7ICTA 2GX9A 3MECA 1WDTA 4ZVFA 4M3RA 2OIHA 1IV8A 7ICVA 3M4XA 2WONB 1ZJNA 3RMDA 2BCUA 3DLHA 1BQXA 2HW3A 1ZAVA 2QW9A 2C3MA 3P39A 3IRXA 3SQGA 5DZ6A 4J2DA 4QJFB 4OX7A 4CD1A 3B0YA 1Y88A 3IUCA 1O08A 3QEIA 3NS1A 3JQKA 1X0PA 1P27B 8ICRA 3FBBA 1SKRA 4NYFA 3KJVA 3BF4A 3N6LA 4RPYA 4I28A 2QGFB 1X5OA 3AY9A 3OS2A 2B9XA 2KG1A 3DYAB 4M63A 4QIWF 2EG1A 8ICHA 1HUXA 5E79U 4CO1A 2LQ8A 1NXIA 3GJSB 2QMWA 2EAPA 2BM0A 1G99A 4MHVA 3DLGB 3SCKE 3FZFA 3D2EB 4XIUA 4W98A 4ELUA 4P0QA 2WBMA 3EO3A 4DR6J 1F0MA 1NDPA 3DOKA 1PCAA 5IILA 4OHZA 1IBMF 1SQFA 2ZC4A 1F3FA 2XZTB 2PAVA 2P9SA 1IG6A 4BRHA 2MSTA 3OFHA 3S6JA 2E9RX 4RWWA 3NUQA 2YXLA 3U02A 2HQ3A 3Q86A 1BPZA 3ZX2A 7ICJA 4M5DB 1SAZA 2F1FA 3NVZA 4HDGA 4K2XA 4USUA 4BC4A 5KT5A 1D4XA 3FSIA 3BQ7A 1J5OA 1NOZA 4B3TK 2DTUA 1GLJO 3CQXA 3FGVA 4YR0A 2RHSB 2H3GX 3QICA 1NK6A 5AM5A 3I1YA 3BPSP 5CYJA 4BRFA 1QQ7A 2QA4N 3CJTA 2NLXA 2E5SA 4EELA 4PQAA 5B0EA 4YXMA 1H7XA 4B1UB 2XMKA 3RYLA 4ED4A 1WHWA 5CYMB 4RW8A 4MH8A 5AJ3J 2V67A 2UUAK 2YH0A 1MWQA 1CQMA 3TAPA 1N6QB 8ICAA 1ZQXA 4CVNE 1OUQA 4WF9L 1GX6A 2OSQA 4LSLA 4AQYJ 1PAUB 1RT6B 3RJJA 9ICJA 2DY1A 4MIBA 3I56S 5J2NB 3EE8A 1IBKK 4JI8K 3ZTQA 4C7QA 3OBIA 4CNYA 1KQKA 2UUBJ 4JYAJ 3PUFA 1S49A 1S6QB 1VLBA 2KVSA 3OJUA 1RXOB 4N41A 4CJ7A 2W9BA 3HILA 4B8AB 4Y2SA 2E8NA 5DGAA 3FRYA 3AD9C 2C2ZB 2HWHA 4XEIA 2MY7A 3PACA 3VF2A 4FW1A 1RACB 4JKEA 2CRXA 2F9WA 1QQOA 3FLCO 2ALZA 3CULA 2E7XA 3QNOA 3NCRA 5IFMA 2ZKTA 1SKSA 2OTJS 4PHPA 1FNMA 4O44B 4U8YA 1UZHA 1TU0B 3DOMA 4ICAA 3GP9A 4MLHA 2PDAA 4BBYA 3PR5B 3ISBA 2FHOB 1HYVA 2OH2A 2K8CB 3BS5A 1NPRA 2PA3A 4DN0A 1REVB 4ZH4A 4CHOA 3MCMA 2AU0A 4GO7X 1WNSA 9ICWA 3DDKA 4KITB 3VENA 1CC7A 4Z4CA 2XBPA 1RDAA 4PWDA 4Q2MA 3WX8A 1ZTTA 4J9UE 2JJ4D 4HVJA 3QT7A 3NVWA 3HM8A 4K8XA 2W4PA 3CQ8A 1ZBUA 3GSIA 1NCLA 2A3ZA 3HFKA 3A8EA 3MGJA 2V0NA 1WTBA 2YNFB 4ZOSA 3BZQA 2XWYA 2G8WA 1W7WA 2POKA 3KDNA 3M2VB 1A5VA 3AVMA 3AV9A 3EVWA 2FDRA 1M0SA 5EVZA 5F41A 2K1RB 5K4LA 4URGA 1P7DA 2WW8A 3CJQA 3LGHA 2X7IA 5E33A 1BWFO 3OYLA 2O8DB 4YDDB 4KHNA 3CD7A 5ALYA 3AGKA 4X84A 2UUCF 2ZUBA 2MU2A 1C0TA 4ILLA 4F72A 1S9EA 3OLAA 4ECZA 3TANA 3BSOA 1X4BA 3GV5B 2VOPA 4JI4K 2GHVC 3SFGA 2V7ZA 3BZKA 5DB7A 5AE2A 1N60A 2HLTA 1WC4A 4IUFA 2QJ3A 5DK5A 2M7SA 2FLLA 2HBJA 2DGQA 4BRKA 2HHWA 3LP0B 3B8AX 3SR6A 1MA9B 2YCHA 5KFTA 1VQ5N 4GVEA 1HQUB 5KFXA 3SLCA 1CRXA 4ISEA 1GTHA 3WU2U 4CYUB 2MKHA 2PYLA 4JI2K 1M1GA 4CDIA 4P10A 2VJUA 2YHWA 3L2QA 1TL3A 3H8YA 2DPIA 1Y5LB 3ONQA 2QG9B 2FI1A 3THTA 5A8KA 3SDEA 2IFXA 1M90O 1NDLA 3NAHA 4Y2QA 4UB6U 1PILA 2QKBA 3OVNA 5B8HA 2D1CA 4Q43A 4I2CA 2Y0SC 2GJIA 1QTMA 2PN6A 4NI2A 2GVZA 2Q79A 3H0LB 2H3QA 3MN7A 3PJWA 2EBEA 1Q5VA 3QQCD 3HKZF 5AKYA 3UDEA 5D49A 9RUBA 3SPZA 4NYNA 4HCCA 4BR5A 5LM7E 1H2TZ 1G1XA 5L1IA 1AFIA 5KFHA 2DNMA 2X6SA 5KL1B 8ICVA 3DKDA 2NRZA 3U1LA 2IOHA 2FJBB 4HEA9 4N47A 1I5OB 5E7OB 4NB4A 1WOSA 4IFEA 1N5QA 1X6IA 5G4DA 4WP8A 4KPCA 1U1MA 3BQTA 1D09B 4NASA 4NLNA 2LU1A 4I2EA 3WNFA 1RCOB 1J5EK 3D1QA 5HR6A 2B6AB 3W60A 2N82B 1RT3A 1W2IA 1ZQOA 1UT8A 5AK6A 3NY0A 4CEAA 3G86A 2C3OA 3KHGA 2B4VA 2E5HA 3KLGA 3MDAA 1S1XB 1KCFA 2N4DA 1QQ5A 3D7SB 1SV0A 1XNQF 4NA3A 2P9IB 5CWRA 2VG6B 1JWWA 3HVAA 4ZJQA 2GHWA 1PAEX 4BC7A 3O4WA 5KQ8A 1KL9A 2XY6A 2HOEA 4QZDA 4KO0A 1RI7A 4FYXB 5D6GA 2V9KA 3MM6B 2D1KA 5HATA 4DOCA 3B6BA 3L2UA 3IM8A 2ZBQA 4K41A 4Y2IA 2BDPA 5GVQA 1N32F 3DHWC 3QINA 2QARA 2AGQA 3CO9A 2F9DA 3LDPA 2CPDA 1TFWA 1QQ6A 1Q5YA 2LEAA 4C0BA 1QE1B 1KQFB 2BJDA 4I1TA 5BPMA 5DQIA 3SZ2A 3UMGA 3G82A 4PHTX 3DLKA 4ZIVA 4FL9A 3VAMA 3C3LA 3GDXA 3TQEA 4S0MA 3KK3B 2DNGA 2BANA 1NSPA 3A2FA 3SV3A 1UW4A 2K06A 4BRNA 4DQRA 1ZQJA 3EVOA 4I0WA 3O2IA 2UUCJ 2DRDA 2G8HA 3M8RA 2K8GA 1X4HA 2YHYA 3DOLA 2J7KA 3LANA 3AD7C 1AUSL 4ELVA 2JWNA 4JKGA 1MLAA 8ICBA 4JKAA 1C0UB 5M2RA 4FWRA 4F0KA 4M9JA 1WG1A 3ZT2A 1UEKA 5DJBA 3H6EA 4FK2A 1KWMA 1VQLN 2AZ3A 5KG4A 1RFQA 3IRXB 3UNYA 1N0UA 2KK0A 4PCQA 1W25A 1HNXK 1HFEL 3UCZP 2NRRA 3HZGA 2FPLA 5HANA 1BPXA 3VQ4A 3K2YA 5CHGA 3KK1B 5GADP 2UXBF 3NKYA 3SENA 1GXTA 4DFPA 3ILJA 4KHSA 3SBGA 1NMNA 4CJWA 2EAOA 1TKTA 1QVFR 3H45C 1WSRA 7FD1A 5IINA 4B9QA 4WYWA 5AZJA 1C2PA 4A62A 5KG2A 3MCPA 2EWSA 4WCEL 3P5BP 4MKYA 4CJ5A 1PJ6A 3FYHA 3UXNA 3VF6A 2D3UA 5AQYA 4F7VA 5AKXA 3H8WA 1WI6A 3KK2B 3D3BJ 1Y5NB 5D0GA 2E5LF 3SMZA 4F8RA 5J0TA 1CJUA 2WSCC 1HL6A 4B3SK 2XHWA 3LTOA 4ED0A 4P0QB 3GCXP 5CCLA 2HQCA 4H4OB 1XBWA 2UVRA 3I28A 1OSDA 2E1EA 3TAQA 3RJIA 3F5TA 3SCXA 3CCUN 4J5OA 8ICMA 4FVUA 4KLMA 4F3OA 5D77A 2MQQA 3FZHA 4C3KA 1BISA 1WBDA 4CCHA 1S79A 1U7LA 1BDGA 2DNOA 2Z1HA 1T95A 3PDNA 4Y0FA 3EDRB 5J2MA 3SJHA 3DXKB 5T7BA 4OHWA 2GO7A 3BBCA 3WXKA 4CLSA 2V2KA 3MD1A 3GR1A 3W9HA 1ZD4A 3TTFA 2DO4A 2HGLA 5D78A 2J9DA 2Z1JA 2QWPA 4CJTA 2YNIB 1WBBA 4LFCF 1Q95G 3E2EA 5IXUA 3VQDA 5J2PA 3MAAA 5B7WA 2MZJA 3VQAA 5ALZA 4FF3A 3CCLN 2BRLA 3A3OB 3D6JA 3CUNA 3UKUA 4Z0UA 3BR8A 5AQSA 1B7YB 5KRSA 4J9MA 3MFHA 2HNDA 2KKHA 3T1HF 1KQQA 1XNQJ 1MMNA 4FPIA 3WK4A 1LKYA 4K4UA 2F1JA 4NCGA 4WZMA 2CWXA 1U1QA 7ICNA 4N8NA 3KDOA 1VIXA 3ZX0A 1P8GA 2OMLA 5B0GA 3OTQA 2N3OA 4XK8C 3K7RA 1ZETA 3R9KA 4ID1A 4RW6B 2NRVA 1JCFA 4L76A 1A6LA 1CG2A 2Q6BA 3RWUA 2RT3A 3G8SA 5J2EA 4TXSA 1N32J 3FM9A 4NE9C 4I27A 3ZEUB 1HEKA 5J0XA 4QZFA 2E9TA 3KOOA 5FPMA 3KHRA 3O6QA 3BF3A 1S6PA 5ALKA 3VGVA 1F3VA 3GG1A 3Q22A 1SXEA 3QU9A 5J0RA 2DFHA 2JGAA 3LW5C 3DOMB 3H90A 4LRCA 2B5JA 5AKHA 4ZCKA 2WF7A 1OYEA 2V52B 2PMHA 1ZYQA 2W3RA 1CI4A 3GYXB 1YLXA 5BR8J 4NY8A 1LW0B 3I0SA 3GCWP 1F9HA 3NFAA 4HLBA 3HSDA 5E3QA 2OPSB 2ZD1A 1HYZA 1VSMA 3LP2B 1OH5A 3K9KA 2KFZA 2BPGA 2V5HG 4JKDA 4KH1B 3DN9A 3MAHA 4JK8A 2KICA 2ZHOA 4A8OA 2R7WA 2ZVIA 1DGSA 3EWAA 4DZDA 1RABB 4OLAA 4CZJA 2ATLA 3VZHA 3LVWA 4CJ4A 2IJRA 3H4BA 3D45A 2F3JA 3M7VA 3CC4N 2UXBJ 3CM6A 5ETRA 3FMWA 5IWAF 4ID8A 2ZE2A 1W0HA 4CI6A 2IBKA 5M2PA 3O0FA 2ERRA 2R8KA 1JNZB 3Q8PB 2ZBRA 4NL5A 5I9EB 3V6KA 2ASDA 1U04A 2FBYA 1TK5A 2VBYA 2HB5A 2GIRA 1JLBA 4PPDA 3G6VA 4Z6EA 4DR1K 2ZWHA 5AQFA 1C0TB 3P83D 2BKEA 3FEXB 2E5LJ 5IM0A 1T94A 2KXHA 3A8YA 4ES3A 4WP3A 4M5KA 2KFNA 4RBUA 3VVTA 1G15A 2O8CB 1FFVA 1O6XA 3UFCX 2QWQA 3MWTA 7ICSA 2ASYA 3QMQA 1UJ5A 2KP7A 2RU9A 4DQ8A 1X60A 3AAPA 3B0XA 2WFBA 3I55S 1N33K 1CVJA 5F9NA 1GLFO 2C2MB 1P9QC 3VAHA 1NGGA 3OSPA 2NXJA 2RHQB 3LM2A 1B99A 3O8WA 1XNRF 2CJQA 1TL3B 2CH6A 2YI1A 2J5AA 1WACA 2P9PB 1ZM4A 1JNRB 1X3MA 3A8IA 4DXLA 2WB1D 1EQ0A 5DBAA 4LFCJ 3NWRA 1ZBIA 3GIMA 4X64F 2XMJA 2HAIA 2MJNA 1OH7A 3BUZB 3JAMY 1N61A 2QC3A 1PBAA 2C3PA 5C15A 9ICHA 4IDKA 2C2EA 4CQ1A 1HLUA 5C42A 3T1HJ 5AE1A 1PG5B 2MLZA 4B1WB 3NF8A 2YKOA 3QSYB 4QPXA 2DCLA 1DARA 3UD5A 3BYPA 3POTA 4M8LA 2BUNA 1EXQA 3TUIC 4YOYA 2XZWA 3F9MA 4KLUA 4NLOA 2P9LA 3CPWR 3NEKA 4RPXA 3JTNA 4WFYA 3RJMB 1QM9A 1URNA 1ICEB 4N5SA 4XAKA 4DOZA 4DU3A 4NXMF 3DNCA 4KH4A 3PIOQ 1KLMB 4FLVA 4IH7A 3WX4A 3R7BB 2YTCA 2CQ1A 4I9LA 1ZPVA 3OVAA 2F8LA 3BGRB 4I68A 5L39A 3FZ2A 3RB4A 2F65A 4NLCA 2DY9A 3NCQA 1RDDA 2QB0A 4BDPA 3SXLA 3CSKA 4QCLA 2O1PA 3I4HX 3C94A 1OH6A 3EYZA 5KFAA 4LY7A 1JK9B 2XGPA 3HVWA 2ZIXA 3VTHA 4LF8F 3MEGB 4HAIA 1L3KA 1IKXB 3L2VA 4K4IA 1J2VA 2GHPA 2KHQA 2VIXA 3NF6A 2BACA 3ZSOA 4LF1A 1JALA 2BQRA 1VQKN 3I96A 1T05B 2MMYA 1X8DA 4KO0B 5I42A 1NK9A 3J81O 2VL1A 3DU5A 5BN8A 2OD4A 3W5XA 5FJ4A 3CCMN 3DLEA 3NCPA 1E6VB 2MB0B 1VSEA 2BCQA 5IIKA 5L1LA 1K9MO 2QWRA 1V6HA 4A5AA 3THYA 1BL3A 5AM1A 1GXUA 3TR8A 4ID5B 2JZBA 4GIBA 1IUJA 5KFOA 2DH9A 5KFKA 4P4MA 4DV5J 5FDLA 5IWAJ 4M3XA 4USMA 5CEHA 3MM8B 2J9EA 4LF2A 3VQ7A 1TQLA 2K8BB 2DPJA 2KZMA 2QIFA 2BANB 4NLQA 4ZPWR 4YY3F 2KZ3A 4CK1A 3QZ7A 4C1NI 4OPAA 1JLEB 1SGGA 3PYFA 8ICKA 4M95A 1BUXA 4KGKA 1GFWB 3DOLB 5J2QA 2GFFA 2W7AA 1YXQA 4JNEA 4R66A 3Q8KA 4JKGB 4RQ7A 4PZNA 3F44A 3KK7A 1HNIA 2XMVA 3MDQA 4LBPA 2R7OA 1MN9A 4UB5A 4WU3A 4C0OC 4CECA 2YBVA 2QSWA 2BHNA 2V51B 2C2RA 4BR7A 1VC5A 4QYZJ 1U2FA 4RW4A 5DBBA 1YRXA 1EQMA 3ICXA 3NGIA 4CRJA 4P2FA 3C6HA 4CHPA 1YTUA 3K1ZA 4DF4A 5SWMA 4I29A 4IL6U 3NRZA 1B0XA 3TWHA 4OCZA 4UT4A 4K4SA 3R97A 4XUSA 4P73A 3FSYA 2B6GA 4PAAA 2AEJA 4QWEA 2AJFE 2CPHA 4BGDA 1VS3A 5E3RA 1N5YA 5AZJB 5EE1A 5L9NA 1P8ZA 3M8SA 4X64J 8ICXA 4F91B 4PPXA 2E44A 3W2VB 1JCEA 5HP4A 1WB9A 3QEXA 1HW8A 4ZVOB 3P5TL 4RNOA 4OMFG 4JMUA 1R8CA 3VERA 5HMMA 1VR6A 5LMUJ 4EI2A 3MMJA 2L48A 3H98A 4GXJA 1S76D 2L3MA 4ZCLA 2AYEA 4KI6A 3E51A 3BDPA 4BR2A 3UKRA 1KHWA 1ASWA 3GLJA 3EL2A 1RBSA 4O8UA 2HF3A 4QW9A 3KLIB 5HJXA 5BYQA 2F1IA 5L1MA 4W90B 3I5BA 4CZFA 3A1YG 7ICEA 4NXMJ 3CYMA 3R3TA 4DFKA 2YQ1A 2GBZA 2J7UA 4H0XB 2BA9A 3LPTA 4ZP6A 3IRWP 1OXJA 1M5PC 4V19J 1WI8A 2JZ5A 2VBWA 2CIMA 3LO3A 5AQVA 2E88A 1X4GA 2YKNA 4YMEA 2D3O1 2HBLA 4O3PA 4YMOA 2BZ2A 4EEYA 2CH5A 1JX4A 4ED7A 2YB1A 3DI6A 2W9AA 4FWKA 5IC4B 1B64A 1U4BA 5DETA 3RF9A 1SZPA 3M2UA 4LF6J 2EEYA 4K4GA 1R6YA 4QZVB 3SUQA 3UNGC 4QW8A 3RR7A 5CAAA 3QJLA 3J80U 4JI1F 3QJPA 4DV3K 3OYJA 3GFXA 5IQQA 5GMEA 1H74A 1VK3A 1XSPA 3MM9B 2AJ0A 3DDIA 2R42A 2RE1A 8ICYA 3H08A 2R7VA 4CLYA 3HT0A 2WMMA 3ALRA 1KAXA 5B0FA 2RF2A 4DFDA 1WUUA 1RYRA 1GLDG 2YWHA 3O3GA 4XA5A 2V2QA 4RO0A 1WNEA 5IV4A 4W5NA 4U67L 1SL1A 2C2OB 2Z4PA 4K7QA 3VTIA 5IV3A 2R2UA 3G6EN 3CFOA 4KQZA 1IG8A 2H3ZA 3OTOJ 1SQKA 1TV9A 1VQ6S 4KH0B 4JI7F 1LW2B 3DLLQ 3J81j 1UMJA 4V19S 3EMTA 3MMCA 1LCUA 1S6PB 3T1AA 1WOOA 4US9A 2QA4G 1BQNA 3PSTA 4OPJA 1JMSA 4CF2A 1IXKA 1V97A 3N6NA 4ZVSB 1Q86O 3FCHA 3NVVA 1WC6A 3MEEA 4IOCQ 3AGRA 2CPEA 2HHUA 4YY3J 1LB2B 4P52A 4BQZA 5CA5A 4B3TF 1Y3KA 1S7IA 3OUYA 4Z2XA 3MMVA 1ZM2A 2CZ9A 3ZZPA 4TUPA 1JKHA 1HPMA 3PW7A 3C1YA 1GEHA 1Y3JA 4EENA 3GG0A 2DISA 2CXEA 2WB1C 3ZSQA 1NJIO 3G9CA 3VA0A 2ZD1B 1GOAA 1NOMA 2UUTA 2KRBA 3WEEA 3L2RA 3Q7BA 4CZEA 4PZOA 3HVTB 3NWGA 1O13A 3QU2A 1S1VB 2E1YA 3T5KA 3Q24A 2W7PA 5A8WA 1WAJA 5FIIA 5EOZA 4M63C 4PKDB 3AEVA 2GQ2A 3BF1A 3L4BC 4DS4A 4DQIA 3NVKA 1RE1B 1NBEB 2IBOA 3HSJA 2RDJA 1RXVA 2AH5A 1FI4A 4AP9A 3NVYA 4DQSA 2QL5B 3J80Y 4F25A 4LFBJ 1IBKF 2MUTA 1ZPWX 5H9EK 1X31C 2BKPA 1ZQZA 2ZE2B 3U9DA 3LQVA 3AFGA 4WIIA 1JJHA 3CDAA 2EX3A 4X66K 3SUOA 2O8BB 1VQ7S 3A3NB 1KEJA 4CGHA 3T1YJ 4DX5A 1SB6A 4NL9C 5DDRC 1JLBB 2K60A 3F56A 1TKZB 2HHXA 4JN4A 1P1LA 3GIIA 4I67A 1ZQNA 4FF2A 1PIEA 4UAUA 2FLPA 5KT3A 3PX0A 1TL7A 2BH1A 3QLHA 2E6LA 1BOTO 2IHR1 3TZYA 3QO9B 2OCEA 4EO6A 4CJLA 1YJ9S 1RBVA 2KVIA 3IO1A 3VVUA 2Q31A 1COOA 4I6MA 1HBOA 4UOCA 3H0RB 1TVRA 1T9YA 3Q8YA 4U95A 3CT9A 1YG0A 5D4OA 4QYRA 3EY1A 4F5PA 5ALXA 4O9MA 1S0VA 1U2CA 4BS2A 4YN4A 2XMMA 4CK3A 1FWLA 1RTJB 5JMNA 1QZ5A 5TKWA 1K1QA 3PKMA 4F2SA 4DV1K 2EQYA 1WF1A 1UQVA 4WQ5A 4Y2RA 2OPRA 1ULRA 1L3SA 1RWVB 2ZIVB 1HW9A 1S57A 2DRAA 4MF8A 3N7PD 2CGJA 4RQ4A 4PEOA 2G06A 4LF4F 4DTXA 1XMOK 2IC3A 4FYYB 4NM2A 4JI1J 3J7YI 1Q79A 2HEKA 2AGOA 1FHTA 4GKKF 4BX9C 5A8RA 5AXNA 4C3LA 2RNEA 1U6BA 3M2RA 2DHSA 4M3WA 2HBKA 1BA1A 3OR2B 5DBCA 3MGVA 2BEFA 2QYGA 2HURA 4ZPDA 1NK8A 2DXEA 2EZXA 4FWMA 1KQGB 3KWGA 2XB2D 4FF1A 3CCTA 2F7TA 4IG0A 2KM8C 4FJ9A 2Q0ZX 3QEWA 4U9RA 3IM9A 4JI7J 2BZFA 3BQ0A 5DLGA 2WF5A 1K0TA 5DMRA 1QUPA 2QB0B 1AA1B 2OEKA 4JI2F 2P9NB 4A48A 3AU2A 4OV6A 1Y64A 2WF6A 2SXLA 2F2AB 2CA9A 3GL1A 5JVGL 2W04A 5CR4A 2ZIWA 2CQCA 4B3TJ 5CD4A 2MJUA 5AQRA 4Z4IA 3N5FA 3RMAA 5HLFA 4KLDA 4F9OA 1SH2A 3VQ6A 1FFWB 3MWBA 5GIPA 2MRLA 3V9SA 3VEZA 1NEEA 4AL6A 4CT8A 3ULDA 4RT3A 4YR2A 3L7PA 3O1BA 4P4PA 4JV5K 2WFAA 3MGHA 2HNYA 2WBRA 3O3HA 3V7JA 1RWPB 1YJ7A 5T7LB 1VRQC 2BOAA 1Q53A 1Q0NA 3HF5A 2QWMA 5DDMA 2IVMA 3NH1A 4J90A 3O1WA 3O5TB 4XPEA 2G8UA 5EWGA 3BN7A 4DZ6A 3NNCA 1C1CB 3MDFA 3HBTA 4OLBA 2DBBA 2YWFA 1HHSA 3O08A 1F1BB 1ZRNA 3AA5X 1IBKJ 4JI8J 2EG2A 1G7CB 4F3TA 5IT9O 3N01A 4LR9A 2B7BB 1RJJA 4C8ZA 2LXIA 2D3DA 3ILOA 4A8KA 3OYEA 4CLTA 4ERDA 3CJRA 3C1ZA 1HPZA 3Q8QB 4NA1A 1NWKA 2MKYA 4M5JA 4OV1A 1S1TA 3AVHA 3ZDDA 3UMBA 1VSIA 2YMQA 2F63A 3QZ8A 9ICMA 4I4BA 5J2QB 3PY8A 2DEIA 2P1JA 1RCHA 3O80A 4GMJB 3T6BA 1F5BA 3S6EA 3K57A 4YEAA 4C48A 3QE9Y 4F4AA 1T3VA 3ISCA 4K4ZA 2ZTEA 4LSZB 3IV6A 3OHRA 1QVFM 4CNZA 2JLEA 4MF2A 4FNHA 3HSCA 1SQGA 5AM3A 8ICQA 5ADXA 1N5XA 2ZUCA 4LH5A 2OLWA 3V4IA 1SCJB 2CPXA 2CQ3A 3KJQB 3CJ1A 4BE2A 1YRUA 2VG7B 2VANA 3SK3A 1HQEB 4K25A 8ICLA 1KDHA 4B3MK 5HAOA 3IS9A 4CIGA 5HROA 4CF0A 2VASA 3HSGA 3SAFA 2XY8A 1KQSR 3ID8A 2MGZA 4FO0A 2C2KB 3CXCM 3H0PA 3LZIA 4FJNA 2ZJQL 1FXXA 3VAGA 5KFGA 4BE0A 1S9GB 2Q3PA 4E8UA 2IVNA 1YVUA 3IP0A 2OANA 2NYIA 4DR2K 5HSPA 5CZ2A 2AQ4A 4DSJA 1UVKA 4CO2A 3HW8A 4NLZA 5A2QO 4CEZA 1TV6B 4J37A 3CNHA 4JI4J 1Q7LB 3SPYA 1S97A 2E2OA 3MOJB 5C0YA 1IJFB 3P4UB 3HXMA 1SV0C 3CCQN 3ZSZA 2V4JA 3HX9A 1YUWA 2KD1A 3TUZC 3HOTA 5J2KA 4K0KK 2YKNB 3K0SA 4PY5A 2DR7A 1VQ4N 2F8TA 1NLVA 4ZDNA 1ZQSA 5CYQB 4KN4A 4JI2J 3TA2A 3DI6B 5I3UB 3JS6A 3GIKA 3D2FA 4HTIA 1QH9A 3HCXA 3AXMA 4CZIA 1HI8A 3DGPA 1E6YA 3PHEA 4QPTA 1YHQS 4MT1A 5DDYA 5D8HB 1D9DA 3LL3A 3O5BA 1ZJMA 2FSJA 4AYBD 4IQWA 5K9FA 2H5EA 2ZH7A 4RJVA 2GVDA 2JLGA 3ZX3A 5AK3A 3CJ0A 1N62A 3NAIA 3M7DA 1J27A 2EFNA 3OYAA 3SMVA 1HNZK 1HIYA 4GRSA 3DJCA 2VB6A 5GTHU 4CM2A 4B3SF 1XWLA 2RH3A 2GUPA 4OZLA 2G5IB 5JRTA 4IFVA 2AXTU 1MU2A 3BEGB 1RDRA 3F2CA 2KYZA 3FC9A 3VF0B 1CULA 2ZGZA 3QMLA 4FNIA 1IN0A 3QIPB 3ZT0A 2B9YA 3FK4A 3R5JB 1IVZA 1Q18A 4ZTJA 3A5LC 4JV1A 3T79A 3JPTA 1OY9A 3IWNC 2ZH1A 2BOPA 2ZJAA 3F41A 4ILGB 4AXJA 1MMDA 1FWPA 1QY7A 2WOMA 4OJPA 3A8JA 5DKWA 2ZZNA 2YNGB 1Q3VA 1YRTA 2B9EA 3QUTA 1RUSA 2YWKA 5F2RA 1J5EJ 5E3CA 1S1UA 3LAKA 1RBLA 3M32B 5IZHA 4AHRA 1NJIT 1S0NA 4HTLA 3VQBA 4PL8A 2RP5A 2V8HA 3AN1A 4Q2LA 4RBTA 4ENOA 5HRSA 1N34F 4UTGA 2X1BA 2J76E 2HFZA 1DQAA 4WFBQ 2BE7D 3TACB 2OZMA 4RU2A 4Z4GA 5ALQA 3OS0A 4EHUA 1Z4NA 3RMCA 4YG2A 1UFLA 1FERA 1MA7A 2HHSA 2ZM6F 2HHPA 1HR0K 4AHTA 4WE1A 4KTZA 3UDVA 1F21A 8ICEA 3OHAA 2B9WA 1TUGB 3I32A 4JK9A 3KLFA 4G9BA 3I4PA 4DV4F 4HVZA 1HJPA 4IRKA 5HJYA 4F0MA 4ECUA 3RAQA 4DWIA 3VEWA 2MUTB