3THVA

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddatp-dt in closed conformation
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 201
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3thvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3thvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3thvA01
4F5NA 1EETA 3RBEA 1VSEA 4YP3A 4B9NA 4MEYA 2LSNA 9ICAA 4E19A 1YVUA 3NH2A 4I9QA 4FJNA 1KSPA 1S9FA 4J9KA 4KN4A 4DMNA 1YT3A 1CLQA 4DFJA 5J2IA 4XUSA 4CCHA 4QZEA 3LZJA 3D0PA 1BPZA 1JLQA 4F2SA 4RQ2A 1UA0A 3OYGA 1XS9D 3H4DA 2VA8A 4M9NA 1S1XA 3JYTA 1KLNA 4ED1A 2P5OA 3IS9A 1VSJA 3RJEA 3NGYA 4M2YA 1UA1A 3QEXA 3SI6A 5TZVA 3SPYA 2JGUA 4ZH4A 1TL3A 4KTWA 4CHOA 4EP5A 1Q9XA 4NCBA 3VQAA 5KI6A 3KJVA 5DQIA 2BANA 4BGDA 5HP1A 3ETLA 4EEYA 4YCXA 1WCLA 4CERA 3JSMA 3LWMA 4KKOA 4KI4A 4O9MA 2P66A 4CK2A 1S0VA 4FZYA 1JLAA 4J9OA 3LPUA 1JXEA 4DL2A 2C28A 3HPOA 3ZSVA 1Z25A 3OYFA 5DBAA 1C0MA 4M6WA 4J9QA 3RJHA 4KLEA 1EXNA 5L1KA 3TAPA 4XIUA 4CESA 2WOMA 1RCHA 8ICPA 3MEGA 4IRKA 3DRPA 5KFXA 3T5HA 2JEFA 2BPGA 3DLKA 1EX4A 2G8VA 3GIKA 4E7LA 4M3WA 1K6YA 2DFLA 1JLBA 8ICKA 1EP4A 4KAZA 3HO1A 1KFTA 4CGGA 1TKXA 1WSGA 3BQ1A 7ICNA 1ITGA 2C22A 2FPMA 3THVA 3G6VA 5D3GA 3MEEA 3L8BA 5KFZA 4DQSA 2HHSA 1RBRA 1QSSA 1BGXT 4B9VA 1AROP 3DM2A 8ICBA 1CZBA 4AHCA 1BI4B 3D45A 8ICIA 9ICGA 4R5PA 4JS5A 4DTXA 3K58A 3B0YA 1LWCA 5HLFA 1B22A 1A5WA 3K2PA 1ZQLA 1RBTA 4DOCA 4W5TA 3SJJA 4KLOA 4I2HA 4FLWA 2P6RA 1BCMA 4I2DA 9ICHA 4O3QA 3OYHA 3ZDCA 1GOBA 3EPGA 3QESA 1O1WA 2ZTEA 2UVWA 3PR4A 4DTOA 4HUFA 2DPJA 2G8WA 1SKSA 4I2GA 1ASVA 1HQEA 3M8PA 1MC8A 4C8NA 3OJSA 4CF1A 2FBVA 3U3YA 2IC3A 5KFGA 3OYBA 5KG3A 2ZQBA 4YMOA 1X9SA 3SQ4A 2HNDA 5KFSA 3IM1A 3M8SA 1ZQJA 5KGWA 1N5YA 4CHZA 4I2FA 1BISA 3EY1A 4LH4A 1I3AA 2Q0ZX 2E6LA 5CZ1A 3RMBA 4M9LA 4N56A 5HHIA 4YNQA 2XGQA 4GLXA 3H08A 1JMSA 3ZT1A 3ZSZA 4FJ5A 1W0HA 1RT6A 4KHWA 5HRSA 4M3RA 4F4XA 1Q8IA 4HYKA 4DTMA 4CJTA 3AVJA 4BXOB 4CEQA 1WSIA 2D0BA 2EHGA 3LANA 4OJRA 3OHBA 1NJYA 4NM1A 4YVZA 3VQCA 1S1TA 1NKEA 3WNHA 2LYHA 3JPSA 4N47A 5CWRA 5HMMA 4CF0A 4FM2A 2J6UA 4HTUA 4DL5A 4ECXA 1B9DA 5KG0A 5HBMA 4O3RA 4KPYA 2VANA 4ED7A 3K59A 3OVNA 5HP4A 2VWJA 3B6OA 2R8HA 4PPXA 1XC9A 3QE9Y 4RG8A 4CGDA 3UXNA 3MGHA 4W5OA 4WE1A 2W9CA 2W8LA 2P1JA 4UB1A 1RDDA 4LY7A 4F4KA 1Q9YA 3M9OB 4KTZA 3ZDEA 3NH1A 4DQPA 1RXWA 4PGYA 4M45A 2PYJA 3H8WA 1ZQXA 3AVMA 4ZTFA 2Z1IA 2QXFA 3C21A 3RH6A 4MFCA 3N97B 4MFBA 3HJFA 1ZQOA 1A77A 5KFEA 5KFLA 7ICTA 4FYDA 2Y1IA 9ICQA 4J9SA 3HXMA 1VSLA 4O5EA 2PY5A 1J5OA 3SUNA 2NRVA 5J0UA 1NK4A 1WSJA 1TV6A 2BCRA 4DU4A 2ZTCA 5F9LA 3HL8A 1U4BA 4NM2A 5DG9A 1HQUA 3G6XA 5IIIA 3NFAA 1FKOA 4DU3A 2OZSA 3RMDA 2PYLA 1C1CA 4ECUA 3OYLA 2FLNA 4H4MA 3LDAA 2BPCA 1ZQKA 3KLEA 2ITGA 1KFDA 1IKYA 3V81A 3OS1A 5EOZA 3A2FA 1ZQWA 3SI8A 3ZT3A 4YG2A 5CA7A 4QZGA 3RB6A 4RU9A 1L3TA 3UQ2A 1NK7A 4DL7A 3C2KA 1J54A 4CJKA 4BDYA 4YN4A 2HHVA 4FJLA 1ZQTA 7ICKA 4I2CA 2XO7A 1T8EA 3MR5A 1J9AA 4B9TA 3ISBA 2FLLA 7ICSA 4EBDA 2HNZA 1WCNA 2IS3A 4RQ7A 4I28A 1DTQA 5KRSA 4I2AA 4ZTJA 3K5MA 5KFQA 3EWAA 3LDSA 3RAXA 4RUAA 3LAMA 1B92A 4Q43A 2FPLA 3P5JA 8ICUA 4CJVA 3RR8A 3KLGA 1EXQA 3C6TA 3WNFA 4W5QA 4K4GA 2NRZA 3KHLA 3L2UA 2XY6A 4H8KA 2HMIA 1ZQZA 4DSLA 4RT3A 3LP2A 5HHHA 3ISDA 4DTJA 3PW7A 7ICOA 4Q45A 4F4ZA 1KDHA 4UAYA 1U9LA 3K75D 2PFOA 1KCFA 4Z0UA 1S76D 2ZJ5A 4DTSA 4LSLA 4ELTA 4F4YA 3OYAA 4CJPA 4GXJA 4NLNA 2VWKA 4CF2A 5EU7A 2FBTA 1L3SA 5KT7A 4KREA 1S1VA 3E2EA 3ISNC 4G1QA 4RW8A 4QZIA 4E3SA 4OLBA 4L8RB 1CXQA 3OYEA 4PGXA 2D0CA 2AQ4A 1IKWA 1SL1A 3ZSOA 3K57A 3OYCA 2MAXA 3ZT4A 5KFRA 4M9GA 5HRRA 5KFBA 1G15A 2X6SA 5HNKA 1TVRA 3RR7A 2ZD1A 4I9LA 3VQ7A 4F91B 2W42A 4F5OA 2XCPA 4DSJA 1RBSA 1HUOA 3PUFA 1BIUA 4CEDA 1JX4A 1ZQAA 3AVHA 5J2HA 3JPOA 4I2JA 4DSKA 5J1EA 7ICQA 3U6FA 4I29A 1UWBA 3NF6A 3P83D 3KD5E 8ICFA 2ISPA 3T5LA 3CM6A 3F73A 4CJUA 1EKEA 3G0ZA 4NLKA 4P4PA 2RF2A 4BDZA 3Q8RB 4FM0A 4ECSA 2HB5A 5DGBA 1HRHA 3KK2A 1WSHA 3HX0A 4CIGA 1VSHA 4QZHA 5SWMA 7ICJA 3DRRA 5J0RA 1ZJNA 2P51A 2GWSA 4FK0A 1HNIA 4B9LA 4E7JA 3VQDA 2ZUCA 4ELUA 4YR3A 1Y88A 4K4IA 5KGXA 3QEPA 1C6VA 3SCXA 3ZSRA 5EWEA 3PW2A 4O5KA 3VQBA 5JUMA 3ZT2A 4RQ5A 2BE2A 2NUBA 4RNNA 3H8JA 5KFIA 3S3MA 3AO1A 4CJSA 4O0JA 5KT2A 4KHUA 3V6KA 1DTTA 1Y97A 5IIMA 5IINA 3QEAZ 4CGIA 4RUCA 4HVJA 4FK2A 8ICRA 2MUTA 4M6WB 4R63A 2HHWA 3DYAA 4N41A 4PY5A 3AA2A 4QZ8A 4QW8A 3QEBZ 1S5JA 2F1HA 4KN7A 2BKEA 3T5KA 9ICKA 4K8ZA 9ICOA 4DF4A 4YR0A 4CECA 7ICHA 3M8RA 3SV4A 2B6AA 1TKTA 1A5XA 1IO2A 3NGZA 5DB6A 1BL3A 3PMLA 1LB2B 3KHHA 4AH9A 8ICTA 1C0TA 2W9AA 3SYZA 4I2PA 2MUTB 3C1YA 2A1JA 4IR9A 4KHYA 3OSPA 3NCIA 2NRWA 1CEZA 2WONA 4F50A 3LAKA 3LZIA 4BE0A 3V9UA 5KFDA 2F1IA 4NXZA 4ED2A 1MSWD 3AA5X 1QHTA 4O5CA 2FPKA 2RDIA 4Z6EA 2KN7A 1L3VA 1QLNA 1X9MA 4FZZA 4OKKA 4KLJA 4PUOA 4R65A 4FJIA 3NF8A 1RXVA 4MF2A 4YFUA 4DFKA 1LW0A 2HHUA 4OPKA 2KQ2A 4AHUA 3MEDA 3OYJA 3AVGA 4CE9A 1S1WA 4RT2A 3SUQA 2JZBB 2W9MA 3ZD8A 4Z4CA 2ASLA 3M8QA 2R8JA 3L3VA 3ZSQA 3QERA 1HMVA 4FJGA 3DRSA 3TABA 3NGDA 8ICNA 4ECQA 3V1RA 2G8KA 4Z6CA 3CFOA 5J2DA 1ZQDA 4JV1A 2IGIA 1IH7A 4NLGA 5K14A 3KLFA 4J9MA 1RYSA 1REVA 3CFPA 1DOQA 4PA1A 1SUQA 3VQEA 5J2AA 1VK0A 4IG0A 4W5NA 3EZ5A 1Z00A 4M3TA 1BPDA 3AVAA 1TFRA 1SZPA 5KFHA 3B6PA 3T1AA 4FXDA 2A1SA 4CF9A 3S3OA 2HVHA 4DL3A 4QWDA 4W5RA 9ICRA 1S9EA 3N4MB 4AILC 3AUOA 3BQ0A 1IM4A 3DLBA 8ICWA 4UB3A 3DI6A 4B8AB 1ZQYA 5HMLA 1GOCA 1D9DA 7ICRA 3QINA 3SQ1A 4RQ6A 1DLOA 1ZQCA 3K5LA 1JLFA 2HHXA 4B3OA 4DLEA 1VSFA 2M9NA 1RT3A 3MR6A 7ICGA 4CFBA 9ICLA 2BQUA 2E6MA 1RT5A 2O4GA 2FLPA 8ICSA 4CK3A 1NOMA 1CZ9A 3I0SA 1JLGA 1NJXA 4PWDA 3AU2A 2KW4A 4QWBA 1UT8A 2YNGA 3KK1A 1KRPA 9ICUA 3S9HA 5SZTA 4FBUA 1ZBLA 4KB0A 5KT3A 3Q8PB 9ICXA 1SL0A 4FJ9A 3ISCA 1JL1A 3LP3A 4JWNA 4KLHA 4QAGA 5CHGA 3TAGA 4YD1A 4KI6A 5DMRA 3L2WA 3JPNA 1S1UA 4KHQA 5JS2A 1SKRA 3SNNA 3ASMA 4M3UA 4F3TA 1VSKA 3HP9A 4F93B 5FRMA 2XC9A 4DS5A 3PX0A 4M41A 5KRTA 4PHEA 3GDXA 4FJ7A 2XHBA 5DG8A 1RT7A 5J2GA 1S97A 3TAMA 4QW9A 2OWOA 5IIOA 4F4WA 2Z1GA 2YHAA 2PZSA 3SQ0A 4UB5A 3CYMA 3RH5A 3PMNA 3KHRA 4YD2A 4ID5A 5HRPA 1ZQIA 3MAQA 4BXOA 4KLTA 1TGOA 2ETJA 8ICMA 4ECZA 3B0XA 4ECTA 3MR2A 3LK9A 4F3OA 4R8UB 4UAWA 1U48A 9ICWA 4OGCA 4CFAA 5FDLA 3OY9A 4RQ1A 1C7YA 4K4HA 2BGGA 3HYFA 3V7KA 2B4JA 5J2JA 2ZJAA 4YR2A 4AHVA 1ZQPA 5DGAA 4FBTA 4GW6A 2FC0A 4MEXA 4FLYA 9ICNA 3NH0A 1NK0A 1UOCA 5C42A 5D49A 4CGFA 3V7LA 3MDCA 1BPEA 4RW4A 4H4OA 4KLIA 3O4NA 3H7IA 2JLEA 1T7PA 1A76A 1UT5A 1RTIA 2YNFA 3AO3A 3L2VA 4KMUA 2IA6A 4AHTA 4B08A 1RTHA 3IHQB 1GOAA 3HVTA 4Y1DA 1LAWA 2BHNA 4J9PA 3V7JA 1U45A 3PX6A 3VQ6A 2ASDA 4ECYA 2AQ0A 4DOAA 3OYNA 3SZ2A 3LP1A 8ICJA 4UQGA 7ICFA 5J2FA 3TR8A 3K5OA 4FS2A 5DBBA 4C8MA 4QWCA 3IG1A 5KFPA 2OPPA 3V1OA 3C2LA 3C95A 4JV0A 1TAQA 3AO2A 2V4RA 3RAQA 3KKSA 4CK1A 4FLZA 4NYFA 3AA3A 4MF8A 3UIQA 2ISOA 3V9SA 7ICLA 5DBCA 1S9GA 1UAXA 4Z4GA 4F8RA 1ASWA 1ZQUA 4FJ8A 4IBNA 7ICVA 4DQIA 4B8CA 4FJXA 3H8SA 1T4GA 8ICQA 1QSYA 3QNOA 4QOZB 5DDMA 1LV5A 5I42A 3OJUA 4QWEA 3RMCA 3OYKA 2AGQA 3Q8SB 4O3OA 1VSDA 4CEBA 5KFFA 1F21A 3PW0A 3DOLA 4YMNA 3OSNA 2HNYA 4FZXC 4DSIA 3KLIA 4KB1A 3CM5A 3H40A 3QEWA 4JWMA 4GXKA 3GV7B 5L1LA 2OPSA 2UVRA 3NF9A 3ZDBA 1RT4A 2OZMA 4J2AA 1KVCA 4CEOA 4OKEA 5DB7A 2RKIA 2OPRA 1PZNA 1C1BA 2B5JA 2HHQA 1XWLA 1WSEA 2PFPA 8ICZA 3ZD9A 4IRDA 2IAJA 5KFJA 3M9NB 2G8FA 2F8SA 2W9BB 4E1NA 1ZQRA 4IDKA 3GFKB 3O4QA 4E1MA 1S77D 4DFMA 3V9ZA 3BDPA 2X74A 4Z4FA 5KG6A 3UXPA 3HK2A 4UBCA 4P2HA 4TSXA 4Y1CA 4EZ9A 4O3SA 2KZZA 3NTUA 3OS0A 3WNGA 4QZAA 4E0DA 4RZRA 1BCOA 2B21A 2AU0A 4HUGA 2VA2A 4CEZA 1LWEA 1X2IA 3JPRA 3SQ2A 5IIJA 3GIIA 1T3NA 4AHSA 4O3NA 1NJZA 4I27A 3IRXA 2HVIA 3Q8LA 4Z4HA 4DL4A 4YQWA 1ZQBA 1RPLA 4RPYA 2W8KA 1HNVA 4P4MA 1S0MA 3KD1E 9ICPA 4E7IA 1HJPA 4FW1A 4XA5A 1TKDA 2G8UA 4BWMA 4KHNA 1HYVA 3NGIA 1NK6A 4KLFA 4CIEA 4OKJA 2ZUDA 4YXMA 5DQHA 5KT6A 3O3GA 1WSFA 4O55A 2C2RA 4CEEA 4O0IA 4Q44A 4PHDA 3OYDA 4PHPA 2XGPA 1KVBA 4GMJB 4CJFA 1RTJA 3AO5A 1LWFA 2BCUA 1WN7A 1SL2A 1HPZA 4M3XA 4DTUA 4CIFA 3VA0A 2YNIA 3PR5B 4FVMA 2PFQA 5KT5A 3RWUA 9ICCA 4DTNA 2OYQA 2NRTA 5DB8A 1NK5A 4DG1A 2QK9A 4E7HA 4DTRA 3V9WA 2ZTDA 4FK4A 1ZBFA 1TAUA 2BCQA 1ZQVA 4O3PA 5KTQA 1S0NA 5D46A 4NLZA 4BACA 4ID1A 5C25A 5BPCA 3VQPA 3TI0A 3NF7A 3QLHA 3DMJA 3ALYA 4TQRA 1NK8A 1RDCA 5KFOA 1TKZA 9ICTA 4HUEA 3ZDAA 5KFTA 3VA3A 3PVXA 3VQ5A 4KHSA 3EPIA 1J53A 5KG7A 4C8LA 2EX3A 3ITHA 4TUQA 3UQ0A 3PO5A 3AA4A 1BHLA 2OPQA 5DKWA 5CP2A 3C23A 3KKRA 5IILA 4GVMA 3OS2A 4J2BA 4EBEA 1HYZA 4DS4A 3F9KA 4TURA 3RJIA 2DPIA 3G6YA 3RTVA 1MU2A 5T7BA 2H5XA 1XSNA 4I2EA 2F96A 3CQ8A 2BGWA 3AVBA 1NK9A 1ZBIA 1LW2A 2V4QA 1MQ2A 2F8TA 4N5SA 1Z3EB 1JN3A 3KK3A 2DTUA 1S6QA 4KLUA 3PX4A 3NDKA 3PO4A 4KTQA 4O44A 2R8KA 1HJRA 5BOMA 2YKMA 3L2RA 1CXUA 3SUOA 2A1JB 3SPZA 2ALZA 5CR0A 4YXJA 4JRPA 4ZHRA 2IDOA 1NKBA 1ZQEA 1R0AA 4E7KA 5KFAA 5KFWA 1TK5A 2FMQA 4Q8FA 5CY4A 3PW5A 5J0QA 5L9XA 5KFUA 2YHBA 3AVNA 3LP0A 1IXRA 5J2EA 5F9NA 4C8OA 2BCVA 4LH5A 3ZDDA 3TQ1A 5DQGA 4B9SA 2FBYA 4F5RA 1WLJA 3LWLA 5J0WA 1JXLA 4RNOA 2AGPA 2FBXA 4MFFA 2JZBA 1JLCA 1D8YA 4QCLA 3T5JA 5DK5A 1SKWA 2ZE2A 4FLVA 4EZ6A 1BPYA 5DG7A 1XU4A 9ICIA 9ICVA 4G3IA 3V6JA 2RPIA 4IG3A 3HP6A 4RQ8A 4RW6A 4FLUA 4F92B 3QIOA 3FDSA 3NE6A 2QKBA 1BIZA 9ICFA 5HRNA 1RZTA 2VG6A 3PNCA 4HHTA 5J0YA 4X5VA 1BPXA 3ZCMA 4NY8A 3RRHA 2G8IA 4BE1A 1L3UA 5KFNA 4Q5VA 2BQRA 1ZQHA 9ICSA 1YTUA 1RT2A 4HCBA 3AVIA 3AV9A 1TV9A 4KLQA 3MFHA 3E01A 1JXBA 5J2BA 4DL6A 3CG7A 1N48A 3NBPA 4RPXA 3T3FA 2Y1JA 3SV3A 1IG9A 4FLTA 3RMAA 3V4IA 3OYIA 1U04A 3EW9A 1TK0A 4M3YA 5IIKA 5EWGA 2JEIA 4ECRA 5KT4A 4FM1A 4CHQA 4J9NA 4YFKA 4I2BA 4IQVA 1NOZA 3KHGA 3U3GA 3HVRA 3PV8A 4O4GA 3V1QA 1RYRA 3LALA 2IBKA 4ICLA 1WNSA 9ICBA 4M04A 4YMMA 5CYQA 4LZDA 4KLMA 1FK9A 4R8UA 1C1AA 3SUPA 3C2MA 2IHMA 3Q8KA 4NCAA 1XHXA 1IKVA 3LPTA 2D0AA 4C8KA 5C5JA 2DFFA 7ICPA 1BQNA 3ZT0A 1TL1A 5L1IA 3C5FA 4DU1A 5DLFA 4CHNA 1ZETA 4KLGA 3O3FA 4CEFA 4LD0A 2KFZA 1QQCA 4M9HA 4FJHA 2C2EA 1K1SA 1S10A 2C2DA 1L5UA 2GV9A 1RDBA 2ZUBA 3FFIA 2GBZA 4CJQA 4UB4A 4BWJA 2DY4A 4CJLA 1X1PA 1TVAA 4K8XA 1KFSA 4RPZA 1RTDA 4CFDA 3RJFA 4DO9A 2R7YA 3RB0A 1IKXA 1N56A 3T19A 1XI1A 1NOYA 2FMPA 2BR0A 2RDJA 4ELVA 3VQ9A 4QZ9A 3GIMA 3MABA 4LZGA 1TK8A 3AVFA 4PQUA 4M47A 4TUSA 4CF8A 3UPQA 1WAFA 4OLAA 4GC6A 4EYHB 2XY5A 1W9HA 1T03A 1CUKA 2GUIA 3HPGA 3MECA 2HW3A 4IQUA 1COOA 5J2NA 1ZBUA 4RW9A 5KG4A 2A1RA 3K4GA 2FMSA 4NYNA 3ULDA 4FJMA 3RJGA 4CGHA 1JLEA 2UVUA 4IFVA 4KLSA 7ICUA 3ORYA 3HPHA 2WTFA 1FXXA 4I2QA 4FW2A 5J0SA 4DQQA 4BE2A 2XY7A 3DLGA 2BCSA 4CJRA 3MFIA 2W9BA 3QIPA 1D8LA 4JK1A 3KIOA 4CJEA 3DOKA 1XSPA 3AVCA 3OHAA 1KEJA 3PY8A 5I3UA 1X9WA 2BQ3A 1BQMA 5KFVA 1A5VA 3ZSWA 3PW4A 2XCAA 3BJYA 1K1QA 8ICVA 4Q8EA 3BGRA 8ICHA 2RN2A 3RB4A 4Z4EA 8ICYA 8ICOA 4F5PA 8ICGA 3V6HA 3TAFA 1S6PA 2G8HA 4RNMA 3V9XA 4I7FA 4JUZA 2PI4A 3RRGA 4NCGA 5EWFA 1VSIA 1QTMA 3QO9A 2D5RA 5J0PA 1H38A 2F1JA 2KZMA 2PXIA 4KV8A 3L3UA 1QS4A 5KFKA 3DLEA 4DLGA 4CHYA 4IKFA 4DTPA 1KTQA 8ICEA 1RNHA 4R64A 3MXJA 4ECVA 4PGQA 2BPFA 1VRTA 3RH4A 1B9FA 3C5GA 4DOBA 4B9UA 2W9CB 3HW8A 2UVVA 4CJWA 2Q3SA 3L2QA 2QKKA 3VN5A 4JV2A 5L1JA 1SV5A 1WAJA 1VRUA 2P5GA 2KTQA 5HROA 3H4BA 1B43A 3MBYA 5DDYA 1V9PA 1DGSA 2XRIA 2O4IA 4DFPA 4JS4A 5CYMA 1ZQFA 3GV8B 3TFSA 3RJJA 2KFNA 4IRCA 4HCCA 5CZ2A 4OVLA 4KRFA 5DB9A 3DLRA 4O5BA 2ASJA 2JEJA 4QZFA 3QETA 4EP4A 4PHAA 4IQWA 3HT3A 4XRHA 2R8IA 3QNNA 4UBBA 4Q0BA 1ZQGA 4DEZA 2J6SA 4OPJA 4PH5A 3O3HA 5J0OA 2YNHA 2NRXA 4M42A 5J2QA 4CEAA 1T05A 3QZ8A 2YKNA 2I1QA 4BDPA 3WNEA 3FYHA 3AVKA 5CJ7A 5CB1A 4FJJA 4ECWA 4FJKA 1QE1A 4JLHA 4LVSA 4QZBA 1XHZA 3HM9A 1VSMA 3C1ZA 2X78A 1BVSA 1NKCA 4CJ4A 2DFEA 5KFYA 3UXOA 4UAZA 4Z6DA 3MGIA 2VA3A 1D9FA 5KG5A 3RJKA 3IAYA 4P4OA 1KLMA 2X6NA 1ZQMA 5KFMA 2PFNA 3RB3A 4DF8A 2IMWP 3GV5B 4Z4IA 4N76A 9ICJA 4ED6A 4E89A 5JS1A 5KFCA 3JPPA 1I39A 3V72A 4RQ3A 3I8DA 3ZSXA 4CFCA 4QZCA 4DQRA 4IFYA 3TAEA 7ICIA 3S3NA 8ICCA 4IQTA 9ICEA 5KG1A 4KITB 3P1GA 3AO4A 4KLDA 3TFRA 1ZJMA 3MR3A 2P6UA 3C94A 3TWHA 5E41A 1ZYQA 4J2EA 3OGUA 2OA8A 5D4BA 4QZDA 3TANA 4FO6A 3QEVA 4EBCA 1BPBA 4F5QA 4DSEA 4GC7A 3JPQA 1Z00B 1YTAA 2HHTA 4J9RA 2R8GA 8ICXA 1ZQNA 4M9JA 2ATLA 3HWTA 3AU6A 4Z6FA 3GQCA 5FRNA 3K5NA 4IR1A 4ED8A 2XY8A 3MDAA 5KG2A 4ED3A 4FCYA 4DWIA 2IOCA 3NHGA 5J2CA 4RQ0A 3EYZA 3RBDA 4J9LA 3KLHA 1KVAA 4CJ3A 5DLGA 3DLHA 4FS1A 2I9GA 7ICEA 1U47A 1C0UA 3QZ7A 4GXIA 3M9MB 3Q8MA 4QWAA 4UB2A 4JRQA 1RILA 4I2IA 2ATQA 4LSNA 5FROA 3OYMA 5J2MA 1U49A 1HYSA 4RQ4A 4MQ3A 1ASUA 5J2PA 1D5AA 2V9WA 5C24A 3V6DA 1ZQSA 3VQQA 3G10A 4ED0A 1FKPA 1XO1A 3AVLA 5J29A 3VQ4A 2Z1HA 4F2RA 3JPTA 3I0RA 4DSFA 3Q8QB 3MXMA 1BI4A 1MQ3A 1HUZA 1RT1A 4TUPA 2IHNA 2E4LA 1ZBHA 2AGOA 4M3ZA 4CJ5A 4CHPA 2YV0X 4KO0A 4KLLA 4EYIB 2DFHA 4CGJA 3GILA 1JIHA 4J2DA 1N6QA 2JEGA 3GIJA 3BQ2A 1S0OA 3KTQA 3QEIA 4AHRA 3C6UA 2KZ3A 5J0TA 5J2KA 9ICMA 4M0AA 1Z26A 3MXIA 4OGEA 3BQTA 4TQSA 1LAVA 1JL2A 3VQ8A 4KFBA 3TARA 1RBUA 5BOLA 1JKHA 1XSLA 2VG5A 2BDPA 1RDAA 5J0XA 1RBVA 2PI5A 7ICMA 3HSTB 1NJWA 2J6TA 1ZQQA 3CFRA 2VG7A 2AJQA 4XQ8A 3TAQA 2ZJ8A 8ICAA 8ICLA 4MFAA 2Z1JA 3ZSYA 4B9MA 2I5JA 1QSLA 3NAEA 4RW7A 4R66A 4FLXA
chains in the Genus database with same CATH superfamily
2I0XA 5E7OB 4A8QA 2EW9A 2CYYA 2DUYA 3QT8A 2OTLN 2LDIA 4WK1A 4MEYA 2WB1C 1S5LU 1HNWJ 4FOIA 4E19A 2QEXN 3GCWP 2UV8G 1KDNA 1MWYA 1C0FA 1S9FA 5I3QA 1YT3A 2K7KA 2CFXA 2JXJA 2LVWA 2A1BA 3LZJA 2NYHA 4LF5J 4AFFA 2RB7A 4RQ2A 3I82A 3R3LA 5K9FA 3MCOA 1KLNA 1SWWA 1YJVA 1VSJA 2GGPB 3C65A 2JGUA 3E0FA 2L48A 5K20B 2KHOA 4EP5A 4NCBA 3VQAA 1DURA 5KI6A 5DQIA 3VALA 2BANA 4X4TA 2VOOA 4BGDA 2EFPA 1KC8T 4CERA 4YCXA 2VQEJ 3PSFA 3DRSB 1DXSA 3M2UB 4KKOA 3D1HA 4KI4A 5ETRA 2W01A 4KGVB 1Z4NA 4CK2A 1S0VA 4FYVB 4BC9A 1DGKN 5HVGA 1NB7A 3UMBA 1VQ6S 2RHFA 5HMYA 1SQEA 3HI9A 1OQ6A 1VMBA 4LFAJ 2C28A 2XM3A 3HPOA 3ZSVA 2FVSA 1Z25A 2GUPA 5DBAA 2OEMA 4KLEA 2ILZA 3QGHA 2FSKA 2WOMA 2BX6A 1RCHA 3MEGA 2PFFB 2DJWA 1DFDA 1IKVB 4IRKA 3U8XA 5F0WA 2BPGA 3OFEA 3TVKA 2G8VA 4F36A 2DFLA 4J8FA 2RE2A 3FSXA 4NLXA 1EP4A 4QIWD 1NNEA 3KDOA 2ROGA 3SFUA 1VHIA 1KFTA 3BO3A 4HEA9 3CDAA 1XNQF 4OYIA 3AJ1A 3K8WA 1TKXA 1WSGA 3BQ1A 3CJ7A 1XR5A 4C7ZA 1Q81O 5BPNA 3MEEA 1ZZNA 5KFZA 5ALWA 3CCUS 1QSSA 3GIRA 5GVQA 3SQOP 4LUBA 3ZX3A 4TU8A 2QMUB 1PC4A 4OJPA 4EEKA 4NRTA 2RAQA 5DM6Q 3UMGA 3KG4A 3GZ7A 1BI4B 8ICIA 1HWKA 4YOXA 3A0BU 3BQ7A 3B0YA 3D28A 3H6EA 3K2PA 4B02A 1YITN 2R18A 1ZQLA 3QFWA 4DOCA 4YDUA 3ZTOA 4FLWA 1BCMA 4LF5K 1F0XA 2OI2A 9ICHA 2DRAA 4O3QA 1IBMJ 4DX7A 2ZTEA 2CPIA 3SMPA 2LYAA 1NZPA 2DPJA 4HUFA 2G8WA 4P0QB 2I8EA 4C8NA 2IC3A 1HBOB 3OYBA 5KG3A 3O9RA 3JAMU 3SQ4A 3EKUA 2ROPA 2JWKA 2HNDA 3CHWA 3M8SA 5KGWA 3DXKB 2V6AA 2X1AA 1N5YA 1BUPA 2DB1A 5J2PB 3IMQJ 5A8RA 3BN7A 4WCEQ 1I51B 4Q7AA 2E1FA 3EY1A 2Q0ZX 2E6LA 1K8AO 4OV6A 3RMBA 4M9LA 3TAMB 4N56A 2YWFA 1JMSA 5AKYA 4IH5A 1FXLA 2DNKA 3UCGA 4XH4A 3ZSZA 1RHQB 3THYA 4CVNE 2CVEA 3LL3A 4DCCA 4B3TK 4RJVA 2LU1A 2DF4B 2ZH8A 4NLYA 3U27A 1Z2ZA 1XQSC 3VQCA 1S1TA 1NKEA 1NPRA 1Q46A 4BC2A 1NPKA 4FM2A 2G2ZA 4GVEA 5KG0A 4HT5A 4XH5A 4I67A 4EUVA 3K59A 3WK6A 3M30A 1XC9A 2F8EX 4DV6F 1C0GA 3MGHA 4W5OA 2ZH4A 2W9CA 4F4KA 4GNIA 1Q9YA 3M1VB 4DQPA 4A5AA 1RWNB 4DX8H 4PGYA 4USHA 2PYJA 4ZTFA 2Z1IA 4MFCA 3I9V9 4X64J 1A77A 5KFEA 5KFLA 4FYDA 4JI3J 2Y1IA 4J9SA 3HXMA 1VSLA 2BACA 1J5OA 5HL7L 1YBAA 5J0UA 4WCEL 1IBLJ 3GFZA 2GA7A 3K1RB 3AAQA 1X31C 3EUNA 2ZTCA 3KXDA 3ZX2A 5DJBA 4NM2A 4JI1J 5L46A 5DG9A 3MURP 3G6XA 1Q8LA 1FKOA 2PYLA 2HNZB 3OYLA 3LM2A 4CO4A 2FIUA 1VK3A 4JI5K 1ZQKA 4B1XB 1K73T 2UP1A 3LW5C 3CW2C 3ZT3A 2O67A 1NO8A 4NI2A 2QSFA 4RW4B 4F0KA 4QZVB 3NGUA 3MR7A 3L4PA 3ILJA 4FZMA 2E5LJ 4DR3F 1VQ7S 7ICKA 1VR6A 2KDOA 1T8EA 3MR5A 3FCVA 1J9AA 3DHWC 1FJGF 1RHRB 4C6AA 3HCXA 2DXFA 4MAKA 1VRQC 2IS3A 5KRSA 3C16A 4FKYA 3M6GA 3MPYA 5TKWA 2Y0SC 4ZTJA 3ZFVA 3TUJC 3WKDA 4OYBA 5E79U 3LDSA 3RAXA 4RUAA 4KO0B 3TWZA 1B92A 3DM2B 4Q43A 1FHTA 1U0SA 1EXQA 3PZPA 4EFHA 2XZTB 3C6TA 2NXJA 4KGMA 4W5QA 4K4GA 2ZEJA 2NRZA 3P4UB 2CQCA 3LP2A 3WIUA 4FKXA 3MX2A 3VAMA 5D0HA 4PXBA 2CQHA 2P9LA 2MJNA 3QJLA 1TL7B 3T1HJ 2KKHA 3UN2A 2JV3A 4ELTA 4F4YA 3OYAA 4AL7A 4BRHA 4NLNA 5EU7A 2WBMA 1XUPO 3JQJA 1HI0P 3UVJA 3FEYB 2GS8A 3KLGB 3ISNC 5HR6A 4G1QA 1NGBA 2FJWA 4L8RB 3OYEA 4CF3A 3EZUA 4NYZA 3NY0A 4A8YA 2D0CA 2YMPA 1VQNN 1U8SA 3M1FA 3KLIB 3R1LA 3I32A 4TU7A 4JHDA 4YORA 1TUWA 3MM5A 2CJAA 2IRYA 5JMNA 4DPUA 1NU0A 4RKUC 5KFBA 3H0PA 1XN9A 1F2GA 2QL5B 5I4MA 3OBIA 2BM0A 1Q3VA 3EDQB 3VQ7A 4F91B 1B7YB 2CGKA 4KRWA 2XCPA 1N34K 4C3KA 1E6VA 1RBSA 3QYYA 3PUFA 1S72S 1JX4A 1ZQAA 3L7OA 2FJDB 1TYQA 4NA3A 3JPOA 5J2QB 3GYGA 2E7XA 2ZVIA 5GINA 2HZVA 5AM2A 3NGKA 4AYBC 5H9FK 4BRNA 3PJWA 2ISPA 3TJ9A 3US5A 3CM6A 3J7YU 5LJ5Y 3NAHA 3WXJA 1WWUA 4NO7A 2GVZA 4QIWC 2HGLA 5DGBA 5EE0A 5ETQA 3R5AA 4RUBA 2W41A 5LM7E 3KK2A 5FIIA 3HX0A 1HBMA 3FM9A 5J0RA 1UVNA 2P51A 5J1EB 4ZVOB 2WVFA 3N6NA 3D2FA 4JB8B 3OPKA 3ULEB 3WKEA 3V4MA 4K4IA 1C6VA 5ALXA 2VG7B 3PW2A 4O5KA 5JXSA 3MGVA 2NUBA 4RNNA 4LMZA 4BY9C 5KFIA 4LF8J 2DR6A 1ZOLA 3OTDA 3R9KA 4NLRA 1C4AA 1QQMA 2G9OA 2KXHA 3QEAZ 4EELA 4RUCA 2MUTA 3ZI4A 4BGBA 3DYAA 4PY5A 4KH0B 2HQIA 3JSMB 3T5KA 3WK7A 2DGSA 4K8ZA 4DF4A 3TKAA 4CECA 1RZMA 4CO5A 4MK7A 2IOFA 4X4NA 1S72N 1U1NA 1NNDA 4B1VA 2XI3A 2W9AA 3JYTB 2NRWA 1CEZA 4LT6A 3TNVA 4F50A 4DV3J 2MQ8A 3LAKA 4LRBA 2ZHOA 5F0XA 3R8YA 1FK9B 1PO6A 3BSCA 3ZNJ1 4ZP7A 1MSWD 4OZ3A 5M1NA 3O9UA 1NEEA 2FPKA 3J8AA 2KN7A 4TKTA 1X9MA 4ZVGA 2IM1A 2FF3B 1NMNA 2LPEA 2Q0RA 3NF8A 1F1BB 3ALRA 4F25A 1QJHA 3E1YA 1LW0A 3JS9A 3BR9A 4OPKA 2XS5A 2KQ2A 4O44B 2EH9A 4OHYA 1KOHA 3TA1A 5HMXA 4AHUA 4JI1F 4DR1F 3SAFA 2GFFA 4I6YA 4LBIA 3R1HA 1AFJA 4DV1F 5AKEA 1QQ5A 4RT2A 1TL4A 1ZZFA 1K9MO 3DRXA 3C16B 3ZSQA 2WRMA 4WQ5A 3C29A 1KONA 4Y2YA 3DRSA 4K4YA 3TABA 5JVHL 4UT4A 3NGDA 8ICNA 2RHSB 2D9PA 3DU5A 5LT5A 3V1RA 5KAFU 4Z6CA 3CFOA 4JV1A 2SXLA 5DDPC 4OQJA 2UUCJ 2MKIA 3DOKB 2JVRA 3OHRA 4CGZA 1DOQA 3HRGA 4PA1A 3IGNA 4Z7CA 4JI5F 1WUUA 4M3TA 1RLCL 4FXDA 3DC2A 3B6PA 2HWHA 1QAIA 4NLTA 2HG4A 2NNWA 3N0VA 4DL3A 4QWDA 4W5RA 2NYIA 3AUOA 5A0YB 3DLBA 3MM7A 4OZ5A 5BJRA 3THWA 1MU2B 2ZIXA 2D0PA 7ICRA 3LF0A 2RQCA 2HHXA 4B3OA 2HEKA 2W6KA 1GMUA 3H90A 1KQGB 1DRZA 3KZBA 3MR6A 2OHFA 9ICLA 2BQUA 2KFYA 3VEYA 2IIHA 4FPAA 1RT5A 4CK3A 1NOMA 3I0SA 1JLGA 3AU2A 4YOTA 5I9EB 3DI6B 2YNGA 2F4VK 1X9JA 1RQ0A 1XMQJ 1ZBLA 3VAFA 2BJ7A 3MMVA 5LXRA 1E6VB 5HMWA 3LP3A 4QAGA 2JH1A 1S1UA 3ASMA 1U0HA 4M3UA 4RW6B 1VSKA 4F3TA 1JK9B 2QRRA 2H5IB 1DKGD 3F2CA 3SD7A 3UDLA 4DS5A 4B3SK 4N8OA 4GV6A 4QR1A 2YQ1A 5H9EK 3PKMA 1RT7A 3RJMB 1Q1KA 1HLUA 5IIOA 2K3KA 5CYMB 5F8JA 2RU9A 2OAUA 3PIOL 3K0SA 5EGYA 4JB3A 1ZTTA 3IGVA 1YI2S 4EIAA 4YD2A 5FPNA 4WE1B 4BXOA 2ETJA 3MAHA 4ECZA 2RRDA 2UUAF 3QMQA 2YWGA 5CZVA 1YIJS 4RQ1A 3IBWA 1C7YA 4BRDA 3VPZA 4AM6A 1VQOS 3UPFA 4NASA 2HFVA 5DGAA 2CG8A 5FP0A 4KYZA 4C8ZA 4MEXA 9ICNA 4TVAB 4HKQA 4CGFA 1ATRA 2E9TA 4F04B 1BPEA 1H7XA 3D68A 2NUHA 3OXFA 5JLFA 2OANA 1RTIA 3BN4A 3DXMA 1SAZA 3L2VA 2KHVA 2NZ4A 4M5JA 1GOAA 5GADU 1LAWA 2B8PA 4Y1DA 4J9PA 1PKUA 4ZMMA 3PX6A 3UR0A 3HOTA 4MIWA 4DR3K 2P2CB 4CH0S 1ROFA 3DOLB 3MGJA 3OYNA 5J2FA 3K5OA 5DBBA 3N6LA 4C8MA 2MA1A 1WHXA 2FDRA 4LC9B 4G6VB 3C95A 3AO2A 3HFZB 3KKSA 4LF9K 4CK1A 5K8NA 1BHNA 4FLZA 2LEPA 3WUHA 3AA3A 3D54A 1J5EF 7ICLA 1ZA1B 1HKGA 1Q7YO 1ZQUA 4FJ8A 4DQIA 2XVTA 2GX8A 3H8SA 2H3EB 3QU2A 4ZVQB 4PYDA 2N3LA 3QUQA 3CJ5A 2HZAA 3RFAA 3NP5A 5I42A 4PXDA 2XICA 4QWEA 3GSDA 3RMCA 4JI6J 2AGQA 4O3OA 2PEHA 1VSDA 2QGFB 4CEBA 4JI2J 5IWAK 3B9JA 3HHLD 5KFFA 3DOMA 5LSOA 1F21A 1FXDA 3M6KA 3I4HX 2ZBRA 3DOLA 5AI4A 1IR1A 2YQ0A 1IKWB 2KE7A 2LYVA 2VQEF 1HWLA 4ZP8A 1SCJB 5IT9O 2MKHA 2G2YA 2HHHF 2Q4TA 4GXKA 4C7YA 2I9SA 3NF9A 1JXVA 1C4CA 2V69A 4NJ8A 1YF5L 1AZSA 4DBQA 4ZOHC 2FHOB 1W25A 1R3NA 1XWLA 3KJNB 1WSEA 3ZD9A 5AQUA 3T1HK 4IRDA 2POKA 4DCHA 2N3OA 1FTRA 1FESA 1ZQRA 2LA4A 3HHLC 2KM8C 3O4QA 4K25A 4LF4K 5IWAJ 3BDPA 4JI2K 3V9ZA 3BYRA 1U2FA 2EBGA 1BLUA 4CNYA 4UBCA 3NWGA 2WFBA 4TSXA 2OPSB 4O3SA 3NTUA 3OS0A 2QLBB 3D2NA 1H2VZ 2A10A 2CPDA 2B21A 2YB1A 4M5NA 4ZIVA 4HHUA 1YJ9N 2VA2A 5CE3A 2K8BB 5IIJA 3GIIA 1T3NA 5J2NB 2GJIA 3I0RB 4HHJA 2W7PA 3HKWA 1OSDA 3BY5A 1ZQBA 2IRUA 5F8LA 2W2PP 3G87A 2PC6A 4P4MA 2MKKA 2R7VA 3R6MA 9ICPA 4MO5A 4E7IA 4C1NI 5AQKA 1FA0A 5AK5A 5M2UA 1IG8A 1B3TA 4HACA 4ZCMA 4B3RK 3AD8C 3H2UB 3L6QA 3WX4A 4OD0A 5DQHA 4Y2IA 1RTZA 1NZ8A 4KSEB 4CEEA 4Q44A 3M6XA 3ZZPA 2XGPA 4GMJB 4NLPA 3UKUA 4ZPTR 2KYXA 3POTB 1SL2A 4CIFA 2YNIA 2HBJA 4HI2A 1EB0A 4O3MA 1UZDA 3MMAA 1DTTB 4KGZB 4ZP9A 2NRTA 3NOGA 3TZWA 5DB8A 2QN6B 4GMKA 1NK5A 4DG1A 4BG8A 2CKWA 3WK9A 2IIRA 4H5VA 4CW7B 2O6KA 3KWIA 3M30B 5DDRC 1A0PA 1FRJA 2E5JA 4RLEA 1H0HB 1ZQVA 4O3PA 3UNYA 2E9RX 3FQKA 4JK8A 3W2WA 4ZVTB 1GH8A 5AKIA 4USMA 1J2NA 3NF7A 1MLAA 3QLHA 1HEKA 3DMJA 3ED5A 5KFOA 4OI3A 4ISFA 2B4PA 4OI6A 3ZDAA 3PVXA 3DRYA 2ZZNA 3VQ5A 3D1OA 5LMUJ 4OZ1A 2EFGA 2KHQA 5KG7A 3ITHA 1T11A 1GMVA 4TUQA 5LJVA 2EG2A 4X4RA 2F3JA 4H5TA 3UR3C 3KKRA 5IILA 4GVMA 3GR1A 4TURA 3RJIA 3PDNA 2MKSA 2K1RA 1XSNA 1SXEA 2BGWA 3AVBA 1FEEA 1ZBIA 3DGPB 1F5BA 2QKQA 2EKNA 2V4QA 4MIBA 4UUWA 2CH5A 5KOWA 1Q95G 3HOSA 4GV3A 1B4SA 3C46A 2HLUA 3KK3A 1S6QA 4KLUA 3PX4A 3NDKA 2FF6A 3QJPA 2YNFB 3D4JA 1U1RA 1N62A 2R8KA 3M2RA 4CBWA 2VPWB 1PAEX 3AY0A 1LK7A 2E5LF 2HQCA 4PWWA 4JRPA 3P5TL 2IDOA 4GKJK 3DLKB 2X1FA 2IPOB 4M5IA 2FMQA 1X60A 4K4WA 5CY4A 4JI6K 5L9XA 3CJ4A 2KVQE 1EJ7L 1JMTA 3AVNA 3WXIA 4XEIA 2D3ZA 5IM0A 3GFHA 2XMUA 3MM6B 2P9LB 2ZBCA 5DQGA 4F71A 4OYPA 4FP9A 3HHDA 1VI7A 1G1XA 4F5RA 1WDDA 5H1SV 1WLJA 4ILJA 3LWLA 5D3GB 2AGPA 3IRUA 2CQGA 4ILLA 3MECB 2JZBA 1APSA 1WBDA 2ZVSA 3T5JA 1OJ4A 2W25A 1Z05A 4FLVA 1AQ6A 1BPYA 4LF9J 1XU4A 4WXWA 2DCUB 5AQVA 4I4BA 4G3IA 2E2PA 4CI6A 5A2QU 1VQKS 1TP7A 4KJIA 1WOQA 4RW6A 4DFDA 2PE8A 4LR9A 4FLUA 4QJVA 2D1CA 4JI6F 2E1AA 2H4YB 4OHWA 9ICFA 4RNFA 1JUDA 2WSFC 4OFZA 1Q86O 1FJGJ 3PNCA 5J0YA 4X5VA 1CS4A 1KKHA 3NMAA 2G8IA 4BE1A 1B0VA 1HNVB 1CSJA 1PJ7A 1JKHB 2G0IA 4ZLNA 4LREA 4QPTA 4A8MP 1VC6A 2UUBJ 4W90B 4HCBA 3AVIA 1X6IA 3MEEB 3O8WA 5CABA 3MFHA 1TYQB 1RQLA 3BKUA 2HAIA 4WQ5C 3T3FA 2EANA 1YRUA 3SV3A 1IG9A 2D3DA 4UY8T 1FD2A 1YVFA 3TEGA 2IM2A 4A5BA 3QQCD 3ZTQA 2GO7A 2B51A 2E1ZA 5ETNA 4LBHA 4OI1A 2W7OA 1J6ZA 1YGYA 2V8HA 4FM1A 2C3YA 4J9NA 4IQVA 3KHGA 4IL6U 4J37A 4RPFA 3THPA 2MJUA 4GVLA 2BBEA 3POTA 1ZBSA 2IBKA 1VQMS 5G0RA 2NLXA 1H6KX 9ICBA 3LO3A 1WC0A 1KL9A 3LYSA 2HOEA 4X62K 2HMPA 6FDRA 2FHJA 2B56A 1SJQA 3IR6B 4J9UE 1WOSA 4DPWA 3D2EB 3J7YP 3KJVB 5AQPA 1Y9OA 4FYXB 3N4PA 4NZ6A 3C2MA 2IHMA 4OX9F 1T05B 4TY8A 4RUHA 2GWKA 4LVOP 3H59A 4NCAA 1RU1A 3LPTA 3ZZZA 2D0AA 4C8KA 5HATA 3U02A 4USWA 4MK8A 1QH9A 1BQNA 3CB4A 3ZT0A 1CULA 4CO0A 4B3SF 4CHNA 1RDUA 1ZETA 5E2QA 1WELA 3MCAB 2KFZA 2B43A 1WHVA 2KKZA 2PMWA 1NDCA 3QJJA 1ZAVA 5ALMA 1SV0A 1MW7A 1OVQA 3FSYA 2C2DA 2GV9A 2ZUBA 4CJQA 3KMSA 2XNRA 2A6OA 4A59A 4UY85 2XIDA 4ES3A 3AGKA 1FIQA 4A62A 3Q8UA 2WHEA 3NASA 1VK8A 2I6WA 4BR7A 4KKOB 4FF2A 3C2PA 3GJSB 1CPZA 2LMRA 3DDIA 3NGTA 1AUSL 1JCFA 4IZ9A 2BW2A 1CI4A 4GVBB 3RSEB 1HNWK 1SGGA 1WC6A 3OTOK 1UVMA 1Y4ZB 2BR0A 4DN9A 3HHLB 4CLFA 3VQ9A 4QZ9A 2AJ4A 2IY5B 3CCES 4AD6A 2EAMA 3SEIA 3ADAC 3CCWA 4X65J 3MF5A 3PYEA 2VFSA 4EYHB 1L7NA 1XC3A 3CC7S 1REVB 3KNAA 2BJ3A 1GEHA 5B0AA 3EE8A 2KIVA 4RW9A 1AFIA 3K4GA 4C0OC 2HI0A 3EVWA 3CDUA 2UVUA 4KLSA 2K89A 5ETVA 3ZZYA 4FO0A 4NLOA 1HNWF 1FXXA 5B0FA 1IVZA 4DQQA 4BE2A 4KAIA 1T03B 2BZFA 2C3UA 1N4LA 4JK1A 3AVCA 5ETTA 1M5KC 1Q3UA 3MM6A 4X64F 2VQFK 4N77A 1GK8A 2QLXA 1BQMA 1A5VA 3ZSWA 4DDFA 3PG9A 1L3KA 3AMZA 2EZYA 4P9SA 8ICHA 3M2VB 8ICYA 2W11A 1VHXA 5J1NA 4F5PA 3PIPQ 2UXBF 1W2BM 3VEXA 4JKHA 1RT6B 4ILGB 1EO1A 1YBUA 1MMDA 1QTMA 1T44A 2V2ZA 1QAJA 2IJRA 5J0PA 2HNDB 2F1JA 4KV8A 3R1XA 3BZKA 2YQ3A 5C10A 4UY8O 4LFCK 1F5AA 4DR4J 3CPEA 4DLGA 4IKFA 4DR6K 3GR0A 1Z4OA 2JH3A 3MXJA 4ECVA 2R9LA 4B1ZA 4B9UA 2W9CB 4S0MA 3HW8A 1KQSR 4NCGB 1GLFO 3L2QA 2ZIVA 4HH1A 1IBKJ 1IM6A 1SV5A 1X0PA 3CCMS 4KB7A 4PXCA 2J7WA 1URJA 2JLFA 2GW8A 2KTQA 1X4FA 5ALVA 3MBYA 2H5EA 1VQ9S 2C3MA 2Z2MA 4Y2PA 2VV5A 1TQLA 1QHAA 4HHHA 5CYMA 1RK8A 1SC3B 3UDEA 1WWHA 3ILOA 2VG5B 1IBCB 4WYBA 1RKJA 4B3MJ 4IRCA 4ZVRB 4HCCA 1HD0A 1BUXA 1AB8A 3DLJA 4QZFA 3QETA 4EP4A 4PHAA 3PNIA 3FGUA 2KRRA 4IQWA 2V67A 4UBBA 1ZQGA 4DEZA 1N33K 1Q81T 1A6LA 3BSOA 4PH5A 3RW6A 2W2QP 4A61A 4DCPB 3UKRB 2V8PA 2YNHA 2P9SA 5J2QA 3D0HE 1T05A 1KHWA 3BH7B 4MJKA 3ZETB 4LF6F 2G0CA 2HLTA 3OPXA 2PBDA 5CB1A 2KT5A 2KT3A 5DZ6A 3NG8A 3SQGB 1COKA 4C80A 2PD1A 3IUCA 1PK1B 1QVFM 1BVSA 4IG0B 4DL0C 2I2YA 4OI0A 1QD1A 5KFYA 4AUKA 3EZOA 2O8EA 4IOAL 5B0DA 2VA3A 1U8WA 2VJVA 2QT7A 4AP9A 2V9KA 2Y0SD 5GTIU 1SC6A 4FYYB 3UO0A 3EUB2 1C20A 1ZQMA 2PFNA 3NVWA 4N76A 4X62F 1P9QC 5KFCA 3JPPA 3FNNA 3FC4A 4FWRA 2Z0GA 5AHXA 2MSTA 3MD1A 4K4ZA 2HFUA 4IFYA 3IDWA 3CXCR 4DV2F 1NLVA 3TAEA 3UFCX 7ICIA 1VQLN 2B3TB 2ZIWA 4OX9K 2DHAA 4IQTA 1J27A 4US9A 4CT9A 4CH7A 2MHNA 5KG1A 4KITB 1CVJA 3EGNA 3LDOA 3TFRA 1ZJMA 4WFBQ 2ZH2A 3TWHA 1NDKA 3HZEA 3MI7X 5M1KA 4J2EA 1J5EK 4IS7A 1RT2B 2VCPA 1S59A 2Y1RI 5J2MB 3TANA 4FPIA 1FJEB 1VOMA 3QEVA 2CQ3A 1BPBA 3QPIA 1NDLA 4GC7A 1Z00B 3FZ2A 2R8GA 4DR2K 2A0FB 8ICXA 1NH7A 1XR7A 3I87A 1RAGB 3EXCX 2JX2A 3UB5A 4QIFA 3BBBA 4Z6FA 5FRNA 1GQEA 4IR1A 5F3TA 2VFTA 3BEGB 1N5TA 1HBOA 4WKRA 4PQAA 1MROB 4LIRA 5D4NA 4DR3J 4LSNB 5J2CA 5GAHP 3BGUA 2FLOA 4ZOSA 4J9LA 3KLHA 1KVAA 2YHWA 3VVUA 3NS1A 4KH6A 1XTZA 1FDNA 4ZHRB 7ICEA 4JI3F 2V63A 1C0UA 4CYUA 4MKAA 5AQWA 3SK3A 3TJ8A 2XQCA 4I2IA 4GKJF 4OLOA 5AKJA 4FPBA 2DGWA 5J2MA 1WF0A 2EC2A 4MQ3A 1ASUA 5HQLA 2BKPA 2A19A 5L1MA 1VAZA 1WKKA 1KAZA 4ZVHA 3GB0A 1K0TA 3VQ4A 2A41A 3FAHA 3Q8QB 3VQTA 2DKXA 3Q24A 1VQ8N 4TUPA 2E4LA 1YUWA 2Q1LA 5GAGP 4CJ5A 4KLLA 2QE5A 1K8AT 3O3LA 2ROEA 3KTQA 5IWAF 2K7JA 3BEXA 2E8NA 5THWA 3AHPA 4ZPAA 3J81Y 5J0TA 2ZZTA 4M0AA 3V4IB 2VFVA 2BA9A 4OGEA 4EHTA 2K4HA 2JRSA 1DHMA 2B7BB 4BRQA 4X64K 1LAVA 1JL2A 2Y9HA 2LQ5A 3ZZOA 5BOLA 3VERA 1RABB 1XSLA 2ZIXB 3AA9A 1RBVA 5GAEI 2E8OA 2PI5A 4URGA 3HSTB 4JI4J 2J6TA 2Z30B 1ZQQA 2ZC4A 1Y3KA 1G7CB 2YJFA 4B9MA 2HCFA 1QSLA 1RDRA 1MMLA 3DXMB 2MHEA 3RBEA 1PK3A 1OY8A 3NS5A 3ATUA 4BC5A 1RYUA 3MMAB 1NSPA 2ZOGA 1RWVB 2PO4A 1YVUA 4P2SA 3NH2A 5M2RA 1TR0A 4FJNA 1NJIT 1KSPA 3NNCA 1V3RA 4DPXA 5J2IA 4CCHA 5JMVA 1Q8BA 4QZEA 4CNQA 4CLLA 1JLQA 1UA0A 5LY3A 5KAIU 2WBNA 3OYGA 4KHPF 2VA8A 4WFNQ 3JYTA 3ZETA 4KH4A 2CPEA 3RJEA 2R2UA 3NGYA 1UA1A 5AKXA 5GADI 3SPYA 2YY3A 4ZH4A 1OH6A 4KTWA 3L4BC 3NGRA 4IYQA 1Q9XA 4OPAA 3HJVA 1N32K 2EVZA 3OFHA 5HJYA 1YZ6A 3ETLA 3IR7B 1WCLA 3JSMA 2R7SA 4BCAA 1SIWB 4O9MA 2KV2A 2WONB 3THXB 2E8AA 5AQMA 1B70B 3NAIA 3AN1A 1ZQ1C 1WD6A 3N4QA 2EFQA 2P9KA 1NG9A 4B17A 3NCRA 5AZIA 1C0MA 4M6WA 4NYPA 3AT1B 2VH7A 5L1KA 1AXQA 4PG5A 3SAHA 1GXTA 3QAUA 8ICPA 2MQNA 3KK3B 3BF1A 3T5HA 3NL0A 1EX4A 4BJQA 2K8AA 1N88A 1K6YA 2RUGA 8ICKA 1GLEG 5DETA 4ZCKA 5ALRA 3AD7C 3RG6A 3GLJA 1DTQB 1JRPA 2CRXA 2C22A 5ALGA 3L8BA 4LJMA 1JLBB 2BJ1A 2VIXA 4DQSA 3SFGA 2MU2A 4M5MA 3B8HA 2W40A 3CJ1A 4JI0J 2DGUA 3EGWB 9ICGA 3NXZA 4DTXA 5AFUH 4ETZA 1I1GA 5HLFA 3J81O 1Y3JA 4TY9A 1RWXB 4ISEA 1H2TZ 3D9BA 3ENVA 1NM1A 1RBTA 4W5TA 4KLOA 1LWEB 4I2HA 4JV5F 4I2DA 5AM4A 3CC4N 2NYVA 4YOEA 3EPGA 4WFYA 5KPTA 4WP3A 2FXUA 3M8PA 1VGYA 4QU6A 3MEDB 2RRNA 2QB0A 2MKJA 2GX9A 3IM1A 1ZQJA 4RQMA 2W43A 4CHZA 1HBNB 4MO4A 1I3AA 3TSQA 1N5YB 5B66U 2RQ4A 4GLXA 5AT1B 3H08A 3QBXA 3D1QA 1S22A 4CZIA 4FJ5A 5IXUA 2Q79A 3JAMO 1W0HA 2HVEA 4F4XA 4HYKA 3AVJA 3WQUA 4CEQA 3AM9A 2KI2A 1VC5A 2DR5A 3O9SA 1RT1B 1YJUA 3G8QA 4QS8A 3R7BB 4DV0F 2DT9A 3IC1A 3UNGC 3CCUN 4K42A 3GSIA 4UTGA 2RE1A 4CBUA 5CWRA 4CF0A 3CJ0A 1D09B 4ECXA 5HBMA 4O3RA 4KPYA 2ALYB 2VANA 4ED7A 2VWJA 5HP4A 2QWLA 3B6OA 5C2DA 1N33F 3QE9Y 4RG8A 1M90O 4WE1A 4AXJA 2E29A 1OWXA 3F44A 4USTA 4LY7A 3M9OB 1UEKA 2ZKUA 3DRRB 3NH1A 1RCXB 1TV6B 1N60A 1HNXK 1RSCA 4LJXA 1QUPA 2HQ3A 2XSJA 3IBCB 3RH6A 4MFBA 1GLJO 3HJFA 4PAAA 3OL7A 1GMWA 4IDHA 4JI4F 1VQ4N 3CC4S 1J2MA 4DUTA 4O5EA 3IRWP 2W04A 3JSYA 4NL9C 5L9NA 3BZQA 5F9LA 4CRXA 2R7QA 1JROA 2MRLA 2AP1A 3EM1A 2RH3A 5IIIA 5A2QY 3AOAA 3OR1B 2HK2A 2JVOA 3RMDA 1C1CA 3I55N 8AT1B 4H4MA 1X6JA 1VISA 2EFNA 2YWHA 4HI1A 3LDAA 4H5RA 3W9HA 4ZJLA 3J80O 1X4GA 2DBYA 1OH5A 1S7HA 4P0PA 1XK8A 2WF7A 4NMXA 3M6ZA 3LGNA 1GLDG 4QZGA 1L3TA 1FDDA 3W65A 1KS2A 2C3OA 2J5AA 3H42A 4DL7A 1M5SA 5IT0A 3C2KA 3VVTA 1J54A 3K2YA 3FZFA 4FJLA 3F41A 4ZP6A 2XO7A 4B9TA 3ISBA 2JFDA 4K0KK 5M2PA 2MZSA 4EBDA 2VODA 1K47A 1F9EB 1WCNA 3VTIA 4CDIA 4I2AA 4DV6J 2W55A 4KBIA 2XMWA 3NVYA 3LAMA 3VZHA 1AZSB 3P5JA 2FPLA 4CO2A 5JVGQ 3VEWA 1N32F 3KLGA 1RWOB 3PACA 1PJ5A 2C1EB 2ZBPA 4A46A 3KHLA 3L2UA 3OTQA 2HMIA 3OV7A 2ATCB 3DJCA 2AH5A 3R97A 4RT3A 3J81U 4JI0F 1WEYA 5HHHA 1SJ1A 1VQLS 1BWVA 2CJQA 3PW7A 2BE9B 4QYRA 2ZGYA 2X3DA 7ICOA 3NCPA 4Q45A 3E66A 1KDHA 1VQMN 4UAYA 1U9LA 1PAUB 1VQ4S 3BO4A 3VZIA 3MWTA 2PFOA 4FOEA 4Z0UA 5F41A 4BG9A 3TUIC 4LSLA 2QO3A 3TSPA 1URNA 4CF2A 3MEKA 2VWKA 3CDBA 2K60A 1N5VA 2G1DA 3V5RA 4XO0A 1UP1A 5KT7A 1S1VA 3E2EA 2VQFF 2XSFA 4QZIA 4XPCA 4MT1A 4E3SA 1YJNN 1CXQA 3C14B 4PGXA 5CCLA 1W97L 2Q66A 3I55S 4DR7J 4G9BA 3MMCA 1DQAA 2AQ4A 3A1YG 1Y5NB 1SL1A 3ZSOA 1PYSB 4GKKF 2MAXA 1CBKA 3ZT4A 3UWTA 3EGVA 2DH9A 4I6WA 4OJGA 2W6LA 5G5HA 4BROA 5HNKA 4FXWA 2YMLA 1TVRA 2EWHA 1XNQK 3ZYYX 1ZD3A 3HSCA 1FE4A 2Q36A 2E1EA 3O5BA 3W62A 2W42A 4F5OA 4WTOB 3KJFB 2VDHA 1YQHA 2OSRA 3OL9A 5EHHA 5J1EA 2ERRA 2QWPA 2VKQA 5B0CA 1UWBA 2UU9F 1AW0A 3P83D 1J5EJ 1H72C 8ICFA 3T5LA 4RW7B 4CJUA 1EKEA 3G0ZA 4P71A 2L5YA 8ATCB 3W7BA 3G8TA 4NLKA 3PYDA 6AT1B 4BDZA 3MDFA 3Q8RB 1K8KA 2HB5A 4JK9A 4C7QA 4CIGA 5AKHA 4PL1A 4QZHA 3A8IA 5SWMA 1YKWA 4HACB 3QYPA 1R89A 4UOFA 2PKEA 2GWSA 2HPUA 5E3QA 2RHQB 3CMAS 2LECA 3DYAB 1NGCA 3I8BA 1GLAG 4B9LA 2O8BB 3W5YA 4Y2SA 1HHSA 2DNRA 5A0LA 1SXDA 3L9ZA 4OZNA 3VQDA 2CZVC 1CC7A 4NL9A 4YR3A 1QZ5A 5KGXA 4JMUA 3SCXA 3ZSRA 1TMJA 5EWEA 1HBUB 2P9UB 5EX3A 5HOOA 2LKZA 4CJSA 4MYUA 2OTLS 5KT2A 2NUUG 4KHUA 1TFWA 3A8KA 5HR7A 1Y97A 5GIPA 4DR6F 5IIMA 3G2XA 3TW0A 5IINA 3GYNA 5BXIA 4BR5A 1WC4A 1HI8A 1VQYA 2AXTU 3IWLA 4CGIA 3SDEB 8ICRA 3A8YA 4R63A 2HHWA 3H3OB 4QW8A 1S5JA 2F1HA 4KN7A 2BKEA 4A57A 9ICKA 4P2XA 3M8RA 2B6AA 1YI2N 1N33J 1TKTA 2QA2A 1IO2A 3NGZA 4U7BA 1L8OA 1BL3A 2G0AA 2L08A 3TA2A 3UDVA 1C0TA 1O5JA 3SYZA 4I2PA 3C1YA 3IFEA 3A4TA 4IR9A 4KHYA 3OSPA 5E3AA 4KPCA 3NCIA 2NREA 4BE0A 4A8EA 1X4AA 3K89A 4F4AA 4ED2A 3AA5X 4V1Ak 2RDIA 1QLNA 1UCNA 3IAS9 2P9UA 1WOOA 5C2FA 4B3MF 5KNIA 4R65A 3DGVA 3PRBA 4NLDA 2M88A 4CO3A 4WFAQ 2HBQB 1RAAB 1P1LA 3OYJA 3AVGA 2LQBA 2H9ZA 4CZJA 4CE9A 1S1WA 4A8XA 2VJUA 2JZBB 3ZD8A 2XTJP 4HH0A 3M8QA 4CJ7A 5AQLA 3QERA 1HMVA 3UI3A 2G06A 2LM4A 3H8MA 2ZWPA 2H3QA 3IBFB 1T3VA 2N7CA 1YHQN 3OT9A 1ZQDA 3FZKA 4LFCJ 2IGIA 1ZOTA 1MDUB 5J2AA 3CDWA 1Z00A 5HI7A 1TFRA 1YSJA 3UCZP 2HRYA 3WU2U 2RT3A 2XWXA 4CF9A 1EIYB 3N4MB 3VGVA 4M5DA 1EWRA 3DI6A 3P96A 4B8AB 1ZQYA 3VAKA 2R2TA 2HBKA 4CYUB 2ZDOA 3AJ2A 4UZCA 1GOCA 1JLFA 1IQTA 5AKLA 5A76A 2D0OA 3KLHB 4K0KF 4UOGA 4WZQA 2W4CA 2M9NA 4DI6A 5IC6B 1X40A 1R8HA 7ICGA 4FN5A 2KIWA 4OJOA 4FZLA 2O4GA 2FLPA 1CS4B 1UVLA 1UT8A 3Q2SC 3KK1A 3H0LB 1R7IA 5SZTA 5F3ZA 1HNZK 4KB0A 5AKGA 4YS2A 3QDKA 2ZWOA 5DM7Q 2FQQB 4JK7A 3T9NA 4CDGA 3HSZA 4P72A 1IXKA 2LDYA 2P9PB 1B0XA 1UJ6A 4KI6A 5DMRA 3I5AA 2KVSA 1F2HA 1KWMA 5JS2A 4KHQA 3SNNA 4JV5K 4F93B 2WW4A 4TNOA 3VF2A 2D6FC 2E5SA 1TMMA 3PX0A 3GDQA 1K0VA 2B4VA 3M32B 4PHEA 3GDXA 3W2WB 5CCMA 3MPWA 3R5BA 5B08A 4F0MA 3G4SS 2P9IA 1S97A 1SJ4P 4QW9A 1ATNA 3FFIB 3A5OC 4F4WA 2Z1GA 4BR2A 1CJTA 4UB5A 3L95X 2N4DA 5GAEP 3CYMA 1H1VA 2LLZA 3MM5B 1NGDA 5HRPA 2HMXA 3M6VA 1T0TV 4KLTA 3CULA 3B0XA 4F3OA 3MR2A 3LK9A 4P10A 4UAWA 2A6AA 3Q86A 4OGCA 4CFAA 3M2UA 1X0FA 1RP5A 1UKUA 4G1PA 2O8BA 2F8KA 1SIZA 3HYFA 3ONNA 2ZJAA 1T02A 1ZQPA 3TQEA 4NXMJ 4GW6A 2B9XA 3OLAA 3UQSA 4FLYA 3H1VX 2Q0UA 2JC0A 2O1PA 3S8SA 1XMOJ 3GBTA 5F0UA 3BUZB 4KHPK 4B1WB 2ZJPL 4RW4A 4FWMA 3FR0A 4KLIA 1KVKA 4EO6A 2KH9A 4I6MA 3FBBA 3MM8A 1IKYB 1A76A 3V81B 4WJ3B 1WKJA 2YNFA 2XO6A 2CQDA 2X7IA 3FVYA 3SMZA 4F0HA 3AO3A 4J90A 3CEDA 2O01C 3MN5A 1NSAA 4I0WA 1RBAA 4B08A 2AZ3A 3HVTA 2BHNA 1MN9A 4ED4A 5CZXA 1U45A 4IEEA 1BWFO 1VJWA 2QWQA 3GCXP 2FUG9 2VYPA 3LP1A 5LJWA 1LKYA 7ICFA 4XPEA 4J7CA 2B8QA 5ETSA 2IVOA 2OTJN 4NEZA 3VTHA 1E6YB 5KFPA 2ZNYA 2GCFA 3CJKA 1TAQA 2IVPA 2V4RA 1VYAA 3N7PD 5HVHA 3TUZC 4NYFA 1FFVA 2XLJA 3UIQA 2VDIA 1QVFR 3V9SA 3N5BA 4Y34A 5AQZA 5DBCA 2KK0A 4F8RA 2QL7B 2KD1A 3R7SB 1NWKA 1NLKL 4NZ7A 2OXOA 1KC8O 2GMJA 5DDMA 4CLYA 1NBEB 4JI0K 3OLBA 3BM7A 3O5TB 1C1CB 2R7XA 3OJUA 1OW5A 5HMZA 4YB6A 3H3NO 1WACA 2KM8B 2VJ5A 2W54A 2CZ9A 3TZZA 1PVPA 4WF9L 4FZXC 1OPIA 4O8KA 3KLIA 4DV5J 1S79A 1XMBA 3BKFA 1C2PA 4BRPA 1FJGK 3VGUA 2BW7A 2OPSA 2QMWA 1ZXOA 3H25A 3IG8A 1YJRA 3P8BB 2GMHA 4J2AA 2OP5A 5T7LA 3CMQA 1VLOA 4C8YA 1YJWS 4E8UA 1EX8A 2M70A 2ZKTA 4C2MA 3WC2A 3M9NB 3UVJB 4CH1A 2E20A 3PHTA 5ETLA 3GG4A 3A0HU 2W9BB 5C7PA 2B7CB 2Z58B 4JYAK 1SPBP 4ES1A 4E1MA 1S77D 3M8PB 2VU5A 2X74A 3O1BA 1FERA 4B6JA 1V6HA 4Y1CA 1VQ9N 2BRKA 2XEXA 3CNQP 3WNGA 4QZAA 1URRA 2M4MA 2XMJA 1X2IA 2RKIB 3FKBA 4DV3F 4USVA 2HVIA 1CJKB 1PBAA 5AJ3F 3SXLA 4JAXA 4YQWA 2N82B 5ALOA 2P9PA 5B8HA 2QL9B 2JSXA 5A6WA 1LFPA 1S0MA 3GU3A 2DNYA 3CIPA 1UJ4A 4KV8B 3GG0A 3TZXA 4F9OA 4XA5A 4A8KA 2QG9B 4U8VA 4UF4A 4X65F 3K17A 3NGIA 2ADCA 2ZUDA 2FE9A 3S1TA 4DJBA 1WSFA 2C2RA 3JTNA 1NMEB 2HHHJ 3WXKA 4PHDA 1KVBA 2P9GA 1X42A 2NO4A 2CQBA 3FZLA 1RAEB 3WIVA 2OCEA 1KTVA 1PCAA 4Y6IA 3ZX0A 1HPZA 3SLCA 2VWBA 2WVBA 4H0TB 1QCKA 2LP4A 1RISA 3RWUA 2P6TA 3FBEA 1HW9A 2OYQA 1I5OB 3HZGA 5K5MA 1XMOF 4BVPA 3HRDD 1D9AA 1YJWN 1R59O 2Q31A 5GADP 2OLWA 5KTQA 3CUNA 4BACA 5C25A 5BPCA 1YVNA 3VQPA 2YTCA 2ITMA 1R0CB 4ZS6A 1NK8A 2G13A 3OR2B 1BC6A 1RDCA 4NEYA 2HK3A 3LDPA 1KP6A 1D1UA 2IHR1 2GO8A 1PVRA 4HUEA 2CXEA 3BP8A 1O6XA 2HWIA 2L3MA 3CMAN 2ZITA 4BRIA 2EX3A 3GE9A 4TLQA 3T6JA 2CJKA 1U2VA 3PO5A 4X4OA 1Q7LB 4U67L 4WXOA 2OPQA 3LQVA 5CP2A 1FJ7A 1KQFB 3PIPL 4J2BA 2E1CA 1HYZA 3RTVA 1S5ZA 4LRDA 5ALLA 5T7BA 1NSKL 2CIMA 1FKOB 3R9PA 2F96A 3CQ8A 1NK9A 2J0SD 4IO9L 3ID8A 1FRIA 2F4VF 3O9TA 1M6YA 3ILLA 4IOBA 2F8TA 1RT3B 4LSZB 1AYEA 4FVUA 5ALNA 3M05A 1MWQA 1RHKB 2NXNA 4BGAA 2YKMA 1CXUA 2A1JB 2Y9TA 5C2CA 2FJVA 3MN7A 5FLXO 2AV5A 4RL1A 2CPXA 3LA0A 4NYOA 4ZHRA 2XLKA 4C4WA 4CM2A 5A8WB 4E7KA 5KFAA 1TK5A 4QIWF 2V8DA 4Y2TA 2QLTA 3CDEA 5J0QA 1WG1A 5HO4A 2G08A 4XH1A 3HKZC 4BS2A 3MMJA 4DR2F 1Q16B 2N7YA 3ZDDA 4B9SA 1HR0K 4MK9A 3D7EO 4LF4J 4RNOA 3NUQA 4FF3A 4Y2KA 5K8PA 4ISGA 2K8CB 4MFFA 5SUHA 1VRUB 5DK5A 3BO2A 2ZE2A 1I6JA 4DUYJ 9ICVA 2XHWA 3J7AP 3V6JA 4YHHF 1OKJA 3AXKA 4WBFA 4LQ3A 3TUPA 1WC3A 3OBYA 3QIOA 3FDSA 2HBYB 3CJCA 4OX9J 3E3XA 3K9JA 3SAGA 2V51B 3C7NA 4JKAA 3D6TB 1PYOB 3WXLA 2OGUA 3RRHA 2DNLA 2CJBA 1L3UA 5KFNA 2KJVA 4Q5VA 2BZ2A 2HS3A 1ZQHA 3HSDA 1YTUA 3CP8A 3VGSA 3MAAB 3MUVP 1CJKA 4P0QA 2QA4N 3MN9A 2UUAJ 3E01A 2F63A 3CG7A 2PT0A 1N48A 3NBPA 2Y1JA 4ENOA 3CCEN 4A8OA 1VBXA 3V4IA 4KE5A 1U04A 4M3YA 1SWVA 1RA7A 2JEIA 3SCKE 2A1AA 1NH8A 4RO0A 4CHQA 5JU5A 2K2PA 4K50A 3P39A 3PV8A 4O4GA 2LYBA 4NLQA 3WEEB 4NXNJ 4KFBB 4ZPDA 4RWTA 2IJNA 4DV5K 4AL5A 1Q7YT 1RT7B 3BYPA 3AQFA 4JI2F 1SV0C 1EQ0A 4CRJA 4FWSA 5EE3A 4PKGA 3HKZF 3HF5A 3WQPA 5KOXA 2QIFA 2AW0A 2AYBA 2F9WA 3AJDA 3O4WA 3CCRS 2FB0A 4USJC 3HLUA 4J91A 2BMBA 2YHYA 3Q8VA 4OJ6A 4CLSA 2OM6A 4KX3A 5C5JA 4I69A 2DFFA 5L1IA 4DU1A 1ZTWA 2KSOB 2NSCA 3CCSS 2LFVA 5EX5A 4YY3K 1U1LA 3VCBA 2RDDA 4J03A 2EC0A 4FJHA 2C2EA 2K8GA 4MDAA 3SMSA 1GLBG 2A42A 3J7AN 2WCXA 1S10A 3T1HF 1RDBA 4DR6J 1ZM9A 4YEAA 1U26A 3FFIA 4K5RA 4DV4J 1YJNS 1BWEA 1G4CA 2MYFA 4BWJA 1QE1B 3EEQA 2CG4A 3KUGA 5EX0A 4JI7F 2PMZD 5GAGI 2DHHA 1R6YA 5AI9A 1C1BB 4K8XA 2EAOA 4DO9A 1T3OA 1FKAF 1S9GB 2KJ9A 3RB0A 1N56A 1XI1A 3R9LA 2FMPA 1XNSA 4BHQA 3GYXB 4DX6A 4PKIA 3P6YC 4ELVA 1TL3B 1SC4B 3AD9C 1YWXA 4LZGA 1TK8A 3AVFA 2H3VA 4M47A 1S12A 3UPQA 4OLAA 2FY1A 4YUDA 2E8MA 4GC6A 3D67A 1LW2B 3FZMA 4ZJOA 1RDWX 4KHMA 3DLGB 2KNJA 1CUKA 4EGLA 3H5XA 3MECA 2HW3A 3C15A 5CXTA 4MLHA 4IQUA 1COOA 3H5SA 4ZLJA 2XB2D 3NMUA 1HL6A 4L6V3 4GFJA 4MLEA 4NYNA 3A8EA 4HDHA 1ECWA 4DX5A 2KT2A 1B99A 1ACMB 3OTEA 1VBKA 3W64A 3K7RA 4DU8A 4E1JA 2WTFA 3OXGA 4JKBA 2CPHA 1IJFB 2F4VJ 2ZUGA 1JJ2M 3K8VA 4QYZK 3KWMA 2HBLA 1LEOA 2F7VA 2GVDB 4TYBA 1GLCG 5IV4A 1X5PA 3KIOA 4CJEA 3DOKA 3JQKA 1T9WA 4Z94A 3HDSA 1JLGB 2J0WA 1HFEL 3LP0B 3CJ2A 3PY8A 1JNRB 1HKAA 2BQ3A 3CMES 2HVZA 4BRFA 2ZH1A 3N6MA 2XCAA 1K1QA 2W03A 3CE8A 2QLJB 3OL8A 5HROB 5T14A 3RB4A 4PG8A 1X4EA 2VPYB 8ICOA 4OYOA 3TAFA 4MTPA 2MKYA 4KHRA 2VC1A 4I7FA 5DS7A 5LL6d 2PI4A 3FQLA 2DEIA 2KZMA 4K2XA 3ZXWA 2PXIA 1LNQA 4DV7F 2AP6A 4WF9Q 5CR4A 5ETKA 5IOLA 4G65A 1KVJA 4DTPA 3W2VA 1KTQA 8ICEA 5LJ3Y 5LMNK 2IVFB 2RQKA 1KD1T 5AXMA 3MOZA 4KT0C 5CEHA 2Q3SA 4CZMA 4R0EA 3RBXA 2XMKA 3VN5A 2QKKA 1WWVA 5A8RB 1S6PB 3CI5A 3I5CA 2NPIA 4O4GB 4F67A 4X62J 1WAJA 1VLYA 2GAHC 2KU7A 2G2OA 1UEVA 5HROA 2AJ1A 1DZ5A 5DDYA 4P6QA 3FSIA 4A8SA 4ZVPB 4LFBJ 5BR8J 3W66A 4O4RA 2ZJQL 5L38A 3QLHB 3RJJA 1HI1A 4OZ2A 4DV3K 2I5HA 3W60A 5CZ2A 4C9DA 1P8ZA 4OVLA 5AJ3K 4KRFA 5DB9A 3D0IE 4O5BA 2DNPA 4NE9C 3BS9A 3P45B 3MK6A 1V5VA 4ZLLA 1ZXIA 3CVKA 1YRXA 3EVOA 4LFAF 4OPJA 1HHQA 1Y64A 2PMZF 3O3HA 2X1BA 1NZBA 5J0OA 3AY9A 4DR5F 5DDOC 4EAHD 4CEAA 2VKZG 3QZ8A 4PR6A 2I1QA 5H9EJ 2P6SA 1N52B 2NRHA 2LEBA 2D9OA 2UYTA 4ZPBA 4CLPA 1FE0A 3AVKA 5CJ7A 2M5YA 4FJJA 5BR8K 3ONQA 3IO1A 3DMJB 2FSJA 4QZBA 1FNOA 1LCUA 1M5HA 3SQGA 1ESVA 1NKCA 2XMVA 2M2BA 2MZJA 3UXOA 2FVPA 2EZXA 3MC1A 2RIJA 3MGIA 1LXNA 3GL1A 2NXEA 3IAYA 5KG5A 4AT1B 1MA7A 4ANCA 5ELZA 4P4OA 4X4UA 3H1QA 4DF8A 2KICA 1KW4A 2IMWP 3W5XA 4Z4IA 2CADA 5JS1A 3V72A 4RQ3A 4CZCA 1RQNA 3IG5A 3CJKB 4CBXA 5HQMA 2APOA 4QPXA 2GHVC 2VUGA 3BR8A 2UUAK 3S3NA 2NXCA 1R0AB 9ICEA 4PL7A 4O5FA 2GTDA 3AO4A 2ZIWB 4DB3A 2P6UA 5E41A 3EL2A 3OGUA 2NXUA 2WOMB 2OA8A 3TYTA 5D4BA 1S6OA 2QWRA 3TX0A 4CT8A 4ERDA 4FO6A 4EBCA 1U7LA 4UOHA 3ZLJA 1X7VA 3GPAA 3JPQA 4UARA 4DCOB 2K06A 4J9RA 2CAJA 3I76A 1ZQNA 9ATCB 1VQKN 2A3JA 2ATLA 5K14B 3AU6A 3WKCA 2QSWA 1RT4B 2GVDA 4ED8A 1NAQA 2AA4A 2OD4A 2O8CA 4PL8A 4YMEA 1BG3A 1WTBA 2RS8A 4QYZJ 4RQ0A 3KK7A 4DUZJ 2XWYA 2ASOA 4LSLB 3BGRB 4YDUC 4L3KA 1U47A 3QZ7A 3Q8MA 2QYCA 2D41A 2Z8QA 4QWAA 4UB2A 1Y7PA 5AXNA 3G71S 5A0YA 2ZHBA 1RILA 4CZEA 1YTYA 2ATQA 4LSNA 2Q1NA 4RQ4A 5J2PA 1P7DA 4DKWA 5E5NA 2XLIA 1RA6A 1ZH5A 3CRXA 3HZ6A 4YDXA 2FJEB 5C24A 2RU3A 3AA8A 3QWUA 2L9DA 3VQQA 4ED0A 1WTFA 2DHXA 5D0RA 1XO1A 2U1AA 4ZN1A 4F2RA 3JPTA 2Z1HA 4DV7J 2WVCA 3D7SB 3KDNA 3S6EA 1CJUA 3MXMA 2CZ4A 4RBTA 1HUZA 1RT1A 2IHNA 1SKUB 2OPRB 4OI2A 1GTHA 2F9JA 2ACMA 1HR0F 2YV0X 3U9DA 4KO0A 2DK2A 1OVYA 1JIHA 3HILA 1N6QA 2GEMA 1IWGA 2GVZB 3M4XA 4M5GA 3K1ZA 3JXUA 4I1TA 2Z56B 3C6UA 9ICMA 3RVCA 2M0GB 3BQTA 4GO7X 4TQSA 2IAJB 1UWBB 4AE5A 2WB1F 1S3XA 3FCHA 2BDPA 2C2NA 5J0XA 4U7UK 2PFUA 4IQXA 1T9YA 1NJWA 3CFRA 1AT1B 1DGJA 2VG7A 4MMOA 4GKKJ 3VENA 4Y2UA 1HIYA 8ICAA 8ICLA 1V38A 4Y2AA 4YY3J 2I5JA 4KX5A 1NJIO 2O8DB 4R66A 3QFPA 3OW2M 3FC9A 2DR8A 1VSEA 3ICLA 2C3PA 4B9NA 1JALA 1WI8A 4XDCA 1ZPVA 4I9QA 3C66A 2CQPA 4DMNA 3SR6A 4DFJA 1UMJA 1I94K 3OL6A 1BPZA 1VQSA 4F3QA 4F2SA 1RLDA 2EKYA 4NZ0A 1XS9D 4M9NA 1S1XA 3RU0A 4RU2A 2P5OA 3IS9A 1LWXA 2MY8A 5TZVA 3HBTA 2LKYA 1TL3A 4CHOA 3QICA 1CQNA 2OTJS 4NXNK 5BREA 4DZ6A 2ZHAA 4WFAL 3A5NC 3N79A 4CZFA 5HP1A 5H9FJ 4EEYA 4OJHA 2DGXA 4CD1A 1S6QB 2RRBA 4ETXA 3ENBA 2M8HA 2P66A 1UQVA 3OTCA 2ZH5A 3J80U 2UXBJ 3M2RB 4FZYA 1JLAA 2DKZA 4W98A 1Q5YA 4ZK7M 2BH1A 1KBRA 4J9OA 5J8YA 4M5HA 3LPUA 4DL2A 4RTFD 2QA1A 3CQYA 4ZITA 3OYFA 1TKTB 3NVMA 2JFKA 4WFBL 4CLZA 2DIVA 1R8CA 2WSCC 3L7PA 4LQ9A 3AGRA 4AYBF 3DRPA 2CNLB 4M63A 4FDFA 1ICEB 2VD3A 1DQ9A 2W1BA 2G1HA 5E0OA 2R4FA 4FNHA 1YRTA 1FFGB 5C2GA 4M3WA 4ZVSB 3VC8A 2LXIA 2DNNA 3HO1A 2NO5A 2YKMB 5HLFB 2YXLA 1HNXJ 3IG1B 5AIAA 1NGJA 4CGGA 4NPOA 3Q0AA 3TJAA 2J0QD 1ITGA 3W5ZA 1RCOB 3THVA 3BV8A 4RW9B 4W4MA 5AE3A 2UV8A 3PSTA 1O0PA 2CQ0A 5JVHQ 5I3UB 1Y5LB 1BGXT 4B9VA 2QZ8A 3DM2A 2CPZA 1CZBA 4F02A 2XBPA 3QATA 1FFSB 2ASYA 4JS5A 5LOQA 2ZE2B 3CCVN 1LWCA 1A5WA 1V3SA 4H0XB 2IVNA 4G1IA 4LF6J 2F65A 3SJJA 3GWCA 4ILMA 1OXJA 5I3PA 3BSNA 1MN8A 1NGAA 3OYHA 3GFXA 3F56A 1GOBA 1T9UA 4KH1B 3B82A 3PR4A 2DKOB 1WHYA 4I2GA 1HQEA 1ASVA 1MC8A 3OJSA 4CF1A 2NSBA 2E5LK 5KFGA 2UXCJ 2YMQA 1GTEA 1OQ3A 2G4BA 2ZQBA 2KVIA 2J7UA 2MSSA 1P6TA 4OHXA 4JNEA 4MKBA 4HL9A 2OELA 2JNJA 3GMGA 2M0NA 5GMKa 5D15A 1QTNB 1R31A 1BISA 4OPHA 1UPPA 1P90A 2YCHA 4RW8B 2QWOA 2R7TA 1ZAXA 5HQ8A 5HHIA 2XGQA 2GAGC 5G4DA 3DAWA 4KHWA 5HRSA 4M3RA 4X4SA 3Q7BA 4CJTA 2VPZB 4BXOB 1ZD4A 1NSQA 1WSIA 4FXVA 2D0BA 1FEHA 3LANA 4OJRA 2KKVA 3OHBA 2EFOA 3FGVA 1S1UB 1KXPA 3RUBL 1QM9A 4N47A 5EOYA 1KKXA 5HMMA 2J6UA 4HTUA 2JH7A 4DL5A 4UW9A 4KY3A 3CCMN 4DV7K 3QU7A 4PZVA 2R8HA 4PPXA 2DL0A 4DV5F 4LFAK 1H2UX 2P9IB 4TXSA 1X8DA 1XMOK 4USIA 1KQKA 2OUGA 2P1JA 4UB1A 1RDDA 5GMEA 4NA1A 2VF3A 5TISU 1V9OA 4M45A 3AVMA 1OY6A 3IS9B 1IR2A 2DR9A 2EQYA 4RCHA 7ICTA 9ICQA 1HKBA 2PY5A 1BDGA 3D66A 3SUNA 5F3XB 2NRVA 1VHFA 4HDGA 2DO0A 1WSJA 1IWAA 2BCRA 2RRAA 1U4BA 1XIQA 2MLYA 3DGPA 4IQMA 2H3FA 2I38A 3CCQS 1MA9B 4CLUA 2GGPA 4JKEA 3QU5A 3K9KA 3MDQA 2B6GA 2C42A 5GAEU 2BPCA 3KLEA 2Y0SF 2AYEA 2P9NB 1IKYA 3MM8B 3V81A 2DQNB 5ALDA 2RHKA 3A2FA 3CCLN 3SI8A 4CF4A 3A13A 4YG2A 4E98A 5CA7A 1DK2A 1FRHA 3E8OA 5H1SQ 3UQ2A 2E1PA 1JCGA 3OR1A 1NK7A 3MCMA 4KGKA 1M0SA 3J7YI 4CJKA