3THVA

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddatp-dt in closed conformation
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 201
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3thvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3thvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3thvA01
4PWDA 4IRCA 3LP1A 2DFHA 1B43A 3LP3A 2VWKA 5DK5A 3DRSA 3RH4A 5I42A 4KHUA 4M3YA 3D45A 8ICCA 4KI4A 4IDKA 1J54A 8ICRA 5KG3A 2KQ2A 2BE2A 3BQ1A 2PFOA 4RNOA 3DMJA 4I2GA 2A1JA 3QEPA 5CHGA 3HPOA 3L2WA 3RJJA 2MUTB 1BIUA 3TFSA 1DTTA 4ZTFA 2RDIA 4BACA 4NCAA 3HVRA 1U45A 4FBUA 4OGCA 3QERA 1BIZA 3TFRA 1JX4A 4RPXA 4ELTA 4M9GA 3H8JA 1UAXA 1W9HA 5J2NA 2ZJ8A 3AO2A 2P6UA 2FPKA 1RXWA 3K5MA 3PO4A 3AUOA 3I0SA 3OYBA 2LYHA 5D46A 4LSLA 3TAFA 4BE0A 4M9NA 3ZT4A 5HP1A 3OGUA 3ZT2A 4CJLA 3ISCA 4ED8A 2XC9A 3UXPA 4KB0A 3NF9A 3C23A 1RDCA 3PX0A 4UAYA 4EP4A 5KFBA 4CEEA 2QKKA 4RQ6A 2NRTA 5IIOA 5DDMA 1RPLA 3UPQA 4CJKA 4DU4A 4ECZA 1C0TA 7ICQA 1MC8A 5KFVA 2FMPA 5EWEA 2YNIA 4B9NA 4M04A 4F4KA 4DF8A 1SL2A 3ZDEA 5KFQA 1UA0A 2HB5A 4YR0A 3RMAA 4KLGA 4AILC 3V6DA 4UBCA 3SV3A 4KLJA 5EOZA 9ICSA 5JS1A 4P4PA 3N97B 4OPKA 2RPIA 2PYLA 2FC0A 3B6PA 4I7FA 2BCSA 4W5TA 1TFRA 2PY5A 1FKOA 4YXMA 3MECA 4DTRA 1T03A 8ICXA 3TABA 5HP4A 4FJMA 4IBNA 9ICRA 3ETLA 4XUSA 5KFXA 2EX3A 3UQ2A 3AA3A 4J9SA 1CXQA 5KFNA 8ICKA 1CXUA 1HJRA 4DWIA 9ICTA 3U3GA 4CGFA 1JLEA 1WSHA 3H8WA 5KFDA 2ISOA 4DQIA 3ZD8A 5J2KA 1RBRA 2V4QA 3PV8A 5DKWA 3AA5X 3OJUA 3JSMA 1TKZA 4OJRA 4NYFA 4O3RA 2W9AA 2F1IA 1XSLA 4G3IA 3RR7A 4RQ5A 1EP4A 2OZMA 9ICPA 1RNHA 4YNQA 4B9SA 4YFUA 4LSNA 1LB2B 3OY9A 4KITB 1KRPA 1RT5A 4N41A 4FZYA 2JEGA 8ICHA 3HVTA 3DLHA 9ICVA 2G8HA 1VRTA 4KO0A 3NFAA 3OS1A 4H4OA 2P66A 2BCVA 1WSIA 1SKRA 4F50A 3SPZA 2A1JB 1IXRA 3HXMA 4J2DA 3PVXA 4ED6A 4FS2A 5L1IA 3GIJA 3RJHA 4UB1A 3SNNA 4Q43A 3ZT0A 4PGQA 4DFMA 4CESA 4FJIA 4TUPA 2FLPA 1NJWA 1WCNA 4KPYA 3KLEA 1B92A 4O9MA 3RBEA 1ZQRA 1B22A 3RJGA 3OJSA 3F9KA 4J9PA 3B6OA 2RN2A 4ECTA 2ZD1A 3VQQA 4E7JA 2JEIA 5KRTA 3BJYA 4UB4A 3I8DA 4FM2A 3QLHA 4B9UA 3FYHA 3AVLA 3LANA 1RBUA 4DL6A 3C1ZA 4QZ9A 3AO3A 1RYSA 3ZSXA 3IAYA 1L5UA 1RDBA 1HNIA 1NJXA 1ZQVA 5CZ2A 4NXZA 4Z6DA 4DFKA 4JUZA 3JPSA 1DLOA 2Y1IA 1T3NA 1N56A 2ZE2A 3KLFA 2D5RA 2W42A 3KD1E 2PFQA 4B9MA 2YKMA 5CJ7A 4FBTA 4F92B 1ZQKA 1IO2A 5J2DA 2B5JA 4ZHRA 5DG9A 4DSFA 4XQ8A 1X1PA 1X9WA 5HRRA 2P5GA 3GV8B 4M6WB 1QSSA 3MBYA 4CGHA 4NM1A 2BHNA 1N5YA 4Z4EA 5KGWA 4HHTA 3SI6A 1BQNA 3GIMA 4MFCA 3M8QA 4QWAA 5J0PA 4DLEA 4QWCA 4KAZA 5HROA 8ICQA 4DL2A 2GWSA 4YMOA 2XRIA 3ASMA 7ICNA 3O4QA 3MABA 4O0JA 4B8AB 3C5GA 4MEXA 4KLTA 5D49A 1X2IA 1NK9A 3P5JA 3LWLA 1T7PA 3GIKA 4GC6A 3TQ1A 4I9QA 9ICKA 4FXDA 3SUOA 4DTNA 3S9HA 4E3SA 5J2AA 5DQIA 3O4NA 4CF0A 4YFKA 3ZD9A 1ZBIA 1IKWA 4YR2A 3C5FA 1RDAA 4KN7A 3G10A 3HPHA 5CZ1A 4BXOB 4KLMA 5DG7A 4FLVA 7ICOA 5HBMA 1MQ2A 1D8YA 2BR0A 2RKIA 3RB0A 3RJFA 4JV1A 2DFLA 2X78A 3K59A 4L8RB 2IC3A 3DLKA 4GVMA 2LSNA 3V6JA 1H38A 3QESA 5IIKA 1BPEA 9ICAA 2MAXA 8ICNA 1ZQPA 3DLBA 2E4LA 5DGAA 4E19A 5C42A 2HNZA 4TUSA 3LP0A 4I2PA 3PW5A 3PO5A 3JPPA 4CIEA 4J2BA 1VSHA 3C6UA 3ISNC 4Q8FA 1FXXA 2EHGA 2G8FA 2XY6A 5E41A 4CF2A 1NK5A 3S3OA 3EPIA 1KVAA 1SUQA 2GBZA 4IQUA 3KHRA 1EXQA 3L8BA 3PX6A 4ED2A 2Q3SA 4YR3A 2ASLA 3OYDA 1ZQYA 4EBEA 4Z4FA 2Y1JA 2HVHA 4RW6A 1JXLA 4IQVA 2VG6A 2Z1HA 3PW0A 4CF1A 3N4MB 3S3NA 1S1XA 3ALYA 1C1BA 2D0CA 4P4MA 3HJFA 4FJHA 8ICAA 2XGQA 7ICMA 1AROP 4TSXA 4DL5A 5J0TA 4Z4IA 3VQ5A 2YHAA 3KK1A 4R5PA 3ISDA 1TVRA 3WNEA 3DLGA 4RQ7A 4KLDA 1GOCA 5I3UA 5KFIA 2Q0ZX 1X9SA 3WNFA 3QE9Y 3H7IA 2HHQA 4HCCA 3BQ0A 4DG1A 1BGXT 5KFUA 3K5OA 3VQBA 4IRDA 3V7KA 4E1NA 7ICVA 4ECRA 4RPZA 5HMMA 3TAEA 4CF8A 5KFYA 4F91B 3AO5A 4OGEA 5EWFA 1A77A 1S1TA 3NF7A 4HCBA 4FLWA 4HYKA 3SUPA 1RTDA 2DFEA 4FW1A 5KFFA 4CERA 3IG1A 3OYEA 2F1HA 3VQPA 5KFMA 4F2SA 3HK2A 2WTFA 4N47A 4QOZB 5EWGA 9ICOA 3AVNA 2JEJA 4DTXA 4ELVA 5JS2A 4F93B 4E89A 5FRMA 4M3ZA 1Z25A 4DU1A 3OYKA 4CJVA 3K58A 1RT1A 3OS0A 2W9CB 7ICTA 4M41A 5DBBA 1RYRA 3T3FA 1QE1A 3T5LA 1TV6A 4K8ZA 3VQ8A 3OYFA 4BDZA 3OYJA 3KLGA 4ECQA 4BDPA 2ZJ5A 1SL1A 1HJPA 4FLTA 4QW8A 2AJQA 3KKSA 4CJWA 4UB5A 1B9DA 1SKWA 4M3XA 2HHVA 4PH5A 9ICWA 3PY8A 1Z3EB 1JMSA 3RAXA 2B6AA 4FJXA 4FCYA 4GMJB 1C7YA 1KCFA 4HVJA 2F8SA 2HNYA 3KHLA 1BPDA 3ZDAA 4BGDA 4QZHA 3QO9A 4E7KA 1XU4A 4KLIA 1DTQA 1C6VA 8ICZA 1S76D 3V9ZA 2YNHA 3ZSOA 1S1UA 3QIPA 4B08A 2G8UA 4Z4GA 4KLEA 4RUCA 1C1CA 2BANA 1K1SA 3NGZA 4EBDA 3T5JA 3DRPA 4DQRA 1LW2A 4RUAA 1DGSA 1TK0A 2ZTCA 4Z4HA 3OYCA 3OYIA 1HNVA 4IKFA 3NDKA 3PW2A 4KLUA 4QZ8A 1VK0A 3QZ8A 1N48A 1LWEA 1Y88A 2PFNA 4CJUA 3NF8A 2ZUCA 3DLEA 1TKTA 1QHTA 1NK6A 4ED1A 2WOMA 2HMIA 1RTIA 1U4BA 1WSFA 8ICMA 3MEGA 3QEWA 3SQ1A 3LZJA 1RT4A 1KVBA 2AQ4A 3V1RA 3HYFA 2HHUA 2DTUA 4M3RA 1ZQOA 4LVSA 4M3WA 1HYVA 1S6PA 4JK1A 1KLNA 3KHHA 1BL3A 2V4RA 2P51A 3MFHA 4NY8A 4IRKA 1S9FA 1KFTA 3TWHA 7ICJA 5KG1A 1NK0A 3RMBA 2JGUA 4FJNA 4RT2A 3GDXA 3SYZA 1C0MA 5J0OA 1W0HA 1BQMA 1YTUA 4YVZA 4ECUA 4FJLA 4CJRA 3NF6A 4FM1A 2XCAA 2W8LA 4MF2A 3GILA 3IHQB 4KFBA 1IH7A 1HUOA 3TR8A 5HHIA 2H5XA 3KD5E 4FJJA 2FLLA 4DOCA 8ICOA 4QZIA 4LD0A 3V81A 3CFOA 4MEYA 2R8KA 3C2LA 4RNMA 1NKBA 4F4XA 1S77D 3OS2A 4F4ZA 1D9FA 4IG3A 7ICEA 2NRVA 3VA3A 3AVGA 1JL1A 4F3TA 8ICPA 5IIMA 5L1KA 3V6KA 5L1LA 4ECSA 2IDOA 2RF2A 3V72A 3AU2A 1QQCA 4MFAA 4FJKA 3HW8A 2KZMA 4Q5VA 4E1MA 1U48A 4GXJA 3HP6A 5HNKA 1U04A 1WN7A 1D9DA 3VA0A 2BGWA 1MQ3A 3RB6A 1BPXA 1MSWD 2KTQA 1YVUA 1VSLA 4E7HA 4DSLA 4BWMA 5KFWA 5JUMA 1TKXA 5CWRA 2QXFA 4NM2A 4KRFA 1U47A 4BXOA 4J2AA 1C0UA 4KN4A 3H4DA 5J0UA 1WSGA 3AO1A 3QEIA 4RQ8A 3K2PA 4KV8A 4M3UA 2DY4A 4CEFA 2C2DA 4DQSA 3OSPA 2YHBA 5FROA 3UXNA 4K4GA 3DLRA 1RBTA 5KG0A 4QZBA 3VN5A 3JPRA 5IIIA 2J6TA 4UB3A 4CEZA 1ZQDA 3K57A 2OPQA 4CGGA 2YNGA 5J1EA 4ECYA 2IAJA 4K4IA 4IFYA 3EY1A 4DTPA 5EU7A 4Q8EA 4EEYA 5KT3A 8ICLA 5C25A 1L3UA 1ZQFA 1RCHA 2OYQA 1ASUA 1TAQA 3MEDA 3RB4A 2IMWP 1TVAA 4RW7A 5CA7A 4CGIA 2F96A 2PI5A 1XHZA 4O5EA 2NRXA 1TKDA 4CE9A 1FK9A 2AU0A 2BGGA 1NK4A 5J2GA 2Z1JA 4EBCA 1ZQCA 1L3TA 5J2CA 4DL7A 3RJKA 1LWFA 4KHWA 4RQ2A 3AVBA 1HMVA 3A2FA 4R8UA 3C1YA 3OYLA 1ZQZA 4I9LA 3MR2A 4CCHA 2FBTA 4DF4A 3C6TA 3C21A 4ECXA 4KHNA 3VQ7A 4CIFA 3K5LA 1IG9A 3E2EA 5KFTA 2BPFA 4QW9A 2X6SA 4UBBA 3JPTA 4QCLA 2NUBA 1JIHA 3SCXA 4N56A 3VQCA 4O5BA 3MDAA 7ICLA 2FLNA 1YTAA 3TI0A 3HWTA 5DQGA 2KZ3A 8ICBA 3L3UA 2QKBA 3CQ8A 4AHCA 1A76A 1NOYA 9ICJA 5J2FA 1XHXA 1ZQAA 3FFIA 1COOA 4AHUA 4PHAA 1SZPA 1RT7A 2R7YA 1REVA 3C2MA 4AHSA 1NJYA 2PXIA 3D0PA 4PGXA 4J2EA 4NYNA 4K4HA 5J2EA 4C8OA 1JLCA 2UVRA 1HYSA 4FJ5A 1ZQNA 2RDJA 4W5QA 3QEBZ 4CEDA 1QSLA 4OVLA 2R8HA 4C8KA 4JWMA 4CEBA 3V9WA 3EPGA 1KFSA 4KTQA 3NGIA 4I2JA 1WAJA 3Q8LA 4PPXA 4W5RA 4CHNA 3LPTA 1ZQHA 2ATQA 2R8JA 4CJQA 1Z00B 4ED7A 3HT3A 4I2EA 4YQWA 3MR5A 1Q8IA 4EZ6A 3RWUA 5KT6A 3SPYA 4H8KA 4EYIB 2YKNA 4LZDA 4DQPA 1HUZA 4KTZA 1BPBA 3PNCA 5BOLA 4C8NA 3ZSZA 2OWOA 4KLOA 3WNHA 4CECA 3ZT1A 2A1RA 2ITGA 2OZSA 4O44A 3KLIA 4TURA 4M42A 4O4GA 1S0VA 1X9MA 1HQEA 1B9FA 3AVKA 1JN3A 5BPCA 4NLKA 3M8SA 4KLQA 1S97A 4HUGA 4Z6FA 2HVIA 4FW2A 5KG6A 4J9QA 1CUKA 9ICGA 3HM9A 5DLFA 4QZFA 3Q8KA 2GV9A 5KG7A 4M9LA 5FDLA 4CHZA 2E6LA 2PFPA 2BQ3A 5CP2A 4K8XA 5FRNA 3SQ0A 4MFBA 4N76A 5DB6A 3OYGA 7ICGA 1N6QA 4RW4A 2IHMA 3O3HA 3TAPA 1HRHA 4B3OA 2FBVA 3TARA 4FK2A 4NLGA 3AVHA 3DI6A 4LH4A 1XWLA 3AU6A 4H4MA 4I29A 1JXEA 5CY4A 4E0DA 1J53A 2I9GA 9ICQA 1HYZA 1BISA 3DYAA 4ED0A 1S0MA 1C1AA 4R63A 2HHTA 2UVUA 1ZQLA 4G1QA 1HQUA 2AGQA 4MF8A 4FYDA 4QZCA 3RR8A 5J0QA 3MR6A 1RT3A 3UIQA 7ICPA 3OVNA 3LWMA 4DTMA 4M0AA 5J29A 5HRSA 2XCPA 3U6FA 4O0IA 4Z4CA 4NLZA 3I0RA 4FLZA 3Q8MA 1ZQMA 4BE2A 4CHQA 1ZQQA 2VG7A 4CK2A 4F4WA 4RQ4A 3G6YA 4CFDA 4LY7A 1JLAA 4YD2A 4YP3A 4RQ3A 5IIJA 1EXNA 3MAQA 4FO6A 2IOCA 4CFBA 2X74A 3RRGA 5J0RA 1ZBHA 3ULDA 3LDSA 4IFVA 3ZDDA 4DOBA 4FZZA 4F5QA 3UXOA 4KREA 3KK3A 3H8SA 3SQ4A 1ZYQA 5J2JA 1RTJA 3BQ2A 1S0OA 4MFFA 4YD1A 5KFLA 3NBPA 1UWBA 4CF9A 1XSPA 1ZJNA 3CFRA 1SKSA 4DSJA 4QZGA 2G8WA 4FLXA 1IKYA 3L2VA 4R8UB 3KLHA 2YNFA 1RBSA 4MQ3A 4FVMA 3B0XA 4TQRA 4OKKA 4O55A 3ZSYA 4JLHA 4YN4A 2ZUDA 4JRQA 5KFHA 3RJEA 3EZ5A 1XC9A 1NOZA 4I2AA 3KHGA 1JLFA 4TUQA 2AGOA 3KKRA 4ID1A 1CLQA 4AHTA 1WCLA 3QEXA 8ICJA 3E01A 1MU2A 1WLJA 3AVCA 3OYHA 3GIIA 4DMNA 3PW4A 2W9MA 1VSMA 3ZSRA 3K5NA 2VA8A 1RT2A 3VQAA 2W8KA 4IQTA 3HL8A 1PZNA 5KFJA 1CEZA 1LAWA 3QEAZ 2HNDA 5CB1A 2ETJA 2BPGA 2ZTEA 1BVSA 2HW3A 1NJZA 1S10A 4I2QA 2F8TA 1GOAA 2MUTA 2VANA 3RH5A 3ZSQA 3H4BA 4F8RA 5T7BA 1I3AA 1A5XA 2B21A 4RU9A 3M8PA 5DMRA 5DBAA 3B0YA 3BGRA 3ITHA 4GLXA 1KFDA 1XS9D 5L9XA 1VRUA 2VG5A 4CJEA 4DTSA 4FLYA 1ZQXA 3MDCA 4DEZA 2I1QA 3DOKA 4RZRA 3ZDCA 4O5CA 5CYQA 1S9GA 1VSFA 5C5JA 2ISPA 3U3YA 3SQ2A 1KTQA 3NCIA 2PZSA 5DBCA 3MGHA 5J0YA 3CM5A 1J9AA 1QSYA 4DSKA 4RPYA 1JKHA 4RNNA 3RAQA 4W5NA 2JEFA 1ASVA 1JL2A 1NKCA 1TGOA 1UT8A 4CEAA 2Z1GA 4N5SA 1TK8A 1ASWA 3VQ6A 4NLNA 4B9VA 4DSEA 3V9SA 3LDAA 1RTHA 4CJ3A 5KFPA 1WSEA 3LALA 4CJSA 2P1JA 3M9MB 1S5JA 3HPGA 4LH5A 2OPRA 3NTUA 4QZDA 2P5OA 5J2HA 4J9MA 2HHSA 4F4YA 4CJTA 9ICNA 2C22A 3Q8RB 5KT7A 1ZQUA 4CJFA 1Q9XA 5DB7A 3EW9A 5HHHA 3O3FA 8ICGA 4KB1A 4I2IA 2NRWA 3EWAA 4ECWA 3MGIA 4CHYA 3CFPA 3T19A 3P1GA 4O3NA 1GOBA 2KN7A 3SI8A 4I2BA 1QLNA 3KK2A 4ZTJA 4E7IA 1TV9A 4CHPA 4DQQA 3V7LA 5DLGA 4CEQA 4BE1A 5DGBA 5KFAA 3KTQA 1U49A 3RRHA 1RT6A 4F2RA 3AVJA 3CYMA 2IGIA 2NRZA 1S1WA 8ICWA 4DOAA 2ZJAA 8ICVA 3C2KA 1KSPA 2IBKA 1XO1A 4DSIA 1IM4A 2FMSA 1KVCA 3QEVA 4ID5A 4KHQA 2FBYA 4J9RA 3SV4A 2J6SA 3HX0A 3V1QA 3AO4A 3JPOA 1VSKA 4AH9A 1QTMA 2G8IA 2BCRA 4FM0A 4JRPA 4FLUA 3UQ0A 1UOCA 3AVAA 1LW0A 4DTUA 2D0BA 2O4IA 5KT2A 5F9NA 2GUIA 1NK8A 4RQ0A 4KLSA 3OYNA 4KTWA 1S9EA 1I39A 4CEOA 4FJGA 3OSNA 1ZQGA 8ICYA 5J2MA 1WNSA 4DS5A 4OKEA 4J9OA 1XI1A 5DQHA 3ZSVA 3AVMA 1T8EA 5KT5A 3V7JA 1ZQBA 2IHNA 3M9OB 1JLQA 4M45A 1DOQA 4DU3A 4CGDA 7ICSA 5KRSA 1NOMA 5BOMA 3MXIA 1ZQTA 4CGJA 3MXMA 3MR3A 4UAZA 2W9BA 4CK3A 3C95A 3L2QA 3GV5B 4PHDA 2OA8A 1S1VA 1EKEA 3TAQA 2F1JA 1KDHA 3LK9A 4P4OA 4J9KA 3L3VA 4I2FA 4GXKA 7ICKA 3H40A 1L3SA 2DPIA 3H08A 3T1AA 1G15A 4EZ9A 2XHBA 1HPZA 1BCOA 4ED3A 4RG8A 4JV2A 2FBXA 2BCUA 4Z0UA 2R8IA 3OYAA 3V6HA 9ICEA 4XRHA 9ICIA 2UVVA 4RT3A 5C24A 3NAEA 4Z6CA 2C2RA 4W5OA 1TL1A 3V9XA 4GXIA 4PA1A 3KJVA 5KFSA 4FZXC 4E7LA 3PMNA 5KG4A 4YXJA 3PR5B 4QWBA 1TK5A 1EX4A 4WE1A 1O1WA 4CFCA 2QK9A 2KZZA 3PX4A 1FKPA 5KFOA 9ICHA 1WAFA 2J6UA 2XGPA 4ICLA 9ICBA 1IKXA 3RMCA 3TAMA 4NCBA 5J2IA 4C8LA 1VSIA 4KHSA 3PMLA 7ICUA 1KEJA 4I2DA 5F9LA 4F5PA 2IA6A 3ZDBA 1Y97A 4F5RA 4CJ5A 4IQWA 2VWJA 4FS1A 1ZQIA 3RMDA 4O5KA 4ZH4A 3AA4A 2PYJA 1YT3A 2DFFA 4PGYA 3VQ9A 3IS9A 2AGPA 9ICUA 5SZTA 2JZBB 4I2CA 2YV0X 2X6NA 3LZIA 4M47A 4Q0BA 3G6VA 4CJ4A 1JLBA 3T5HA 4FK4A 3LPUA 5CYMA 4CJPA 4FK0A 3QNOA 2ATLA 3PR4A 1VSDA 3NH2A 3S3MA 3SUNA 4PHPA 4QZAA 3QETA 3AA2A 4GC7A 4UB2A 5KG2A 1CZ9A 2A1SA 5KTQA 3AVFA 4KHYA 3V1OA 4QZEA 3TAGA 2ALZA 4M6WA 3NH1A 3RB3A 5K14A 5J0XA 4AHVA 4JWNA 3Q8SB 8ICSA 4RW8A 2XY5A 3KIOA 5IILA 1ZBFA 1BHLA 3THVA 1K6YA 3IRXA 1S6QA 1S0NA 1LWCA 5HRPA 3NE6A 1ZQEA 4Z6EA 4I28A 4DFPA 1R0AA 4DS4A 2W9CA 5J0WA 3M9NB 4PUOA 4NCGA 3MEEA 8ICFA 1ZBUA 4YG2A 4KLHA 4XA5A 2W9BB 4Q44A 4R65A 2XY8A 4JS4A 1T05A 3RBDA 9ICCA 4M9HA 1ZQJA 1QS4A 4EP5A 4KLLA 4P2HA 3LAKA 4R66A 4KI6A 4YMMA 4R64A 3GV7B 1BCMA 2ZQBA 4F5OA 1CZBA 1V9PA 4IG0A 3VQDA 2WONA 4TQSA 4O3PA 3IM1A 5L1JA 2KFZA 3GQCA 2P6RA 4OLAA 3OHAA 1RBVA 2BDPA 4JS5A 1F21A 3Q8PB 4YCXA 3PUFA 1ZJMA 4ELUA 5KGXA 1ZETA 4JV0A 3ZSWA 4CK1A 3ZCMA 2D0AA 4YMNA 2OPSA 3QZ7A 4XIUA 5J0SA 4FJ7A 5DG8A 1RXVA 4BWJA 5DB8A 1JXBA 2BPCA 3NH0A 3JPNA 3HO1A 3DRRA 1VSEA 1A5VA 3QINA 3BQTA 3K4GA 9ICXA 4PHEA 2R8GA 4O3SA 1WSJA 1RDDA 2V9WA 4IR1A 1ZBLA 1RILA 8ICUA 1ZQWA 1IKVA 2Z1IA 3LP2A 7ICHA 4PQUA 5IINA 1SL0A 3ZT3A 5SWMA 4F5NA 2VA2A 1LV5A 3WNGA 4X5VA 2G8KA 1BI4A 5KFGA 8ICIA 1UT5A 4FJ9A 2BKEA 1T4GA 5KFRA 2M9NA 2IS3A 3FDSA 3GFKB 3G6XA 8ICEA 4J9NA 2ZTDA 1NKEA 2HHXA 5KT4A 4ECVA 4M3TA 5KI6A 2O4GA 3AV9A 2FMQA 4OLBA 4Y1CA 5HLFA 3RJIA 2KW4A 2PI4A 3TANA 2BCQA 5DB9A 5J2PA 5DDYA 3CG7A 4DTJA 2JZBA 2G8VA 3T5KA 3MFIA 3OYMA 5TZVA 4IR9A 3MXJA 4B9TA 4QWEA 4B9LA 8ICTA 4AHRA 5KFEA 4UQGA 3EYZA 3NGDA 4DFJA 4HTUA 1U9LA 4KLFA 5D4BA 2B4JA 2FPLA 3QNNA 4Q45A 5KFZA 4C8MA 1RZTA 3PW7A 3M8RA 3G0ZA 1L3VA 4DLGA 1TAUA 7ICIA 5HMLA 3ISBA 1TL3A 4GW6A 3HP9A 5J2BA 1SV5A 3V9UA 2KFNA 2I5JA 1UA1A 3P83D 4QWDA 2XY7A 3DM2A 2ZUBA 2BQRA 4F3OA 2ASJA 2OPPA 3NHGA 1Q9YA 3AVIA 3K75D 2HHWA 3HSTB 1BI4B 4QAGA 2VA3A 2C28A 4RQ1A 3BDPA 4BDYA 4KKOA 5KG5A 4KMUA 3RH6A 2UVWA 2AQ0A 1Z00A 9ICMA 2XO7A 1BPYA 4M2YA 5HRNA 4OKJA 3LAMA 5J2QA 3JYTA 3OHBA 1K1QA 3DOLA 1LAVA 1J5OA 3CM6A 2FPMA 7ICFA 3L2RA 1ZQSA 2ASDA 4CIGA 2JLEA 3ORYA 5KFKA 4J9LA 4HUFA 1NK7A 4M9JA 3SZ2A 4CHOA 1EETA 1VSJA 3QIOA 4DL3A 4Y1DA 3O3GA 1A5WA 9ICLA 2C2EA 3VQ4A 1D5AA 1XSNA 3JPQA 1BPZA 2DPJA 4PY5A 4OPJA 3C94A 3V4IA 4I27A 4CFAA 3SUQA 4RW9A 4DL4A 2BQUA 3RTVA 4UAWA 4O3OA 1KLMA 3VQEA 4O3QA 7ICRA 9ICFA 3SJJA 4DTOA 3Q8QB 2E6MA 3L2UA 1JLGA 1ITGA 4FJ8A 5KFCA 4B8CA 4DO9A 1Z26A 1D8LA 4LZGA 3F73A 5CR0A 4EYHB 4I2HA 3NGYA 4HUEA 5D3GA
chains in the Genus database with same CATH superfamily
4JHDB 1MWKA 1S99A 5DK5A 3OL7A 4KHUA 4Y2PA 3SEOA 1LCUA 3CCWA 3IR5B 1IJEB 3J81O 3D45A 4KI4A 1C4CA 1YAGA 8ICRA 1NGDA 2AEMA 4GIBA 3PTWA 3DMJA 3ZZTA 2IM1A 2QLTA 4BS2A 4LRCA 1MMLA 3OR1B 5B5EU 2F4VJ 3DN9A 3L2WA 2DNNA 2VKRA 4ZTFA 2R7RA 3CCLS 4BACA 1REVB 2KVIA 4X62J 5K8PA 1NU0A 3PSPA 4OGCA 3R6MA 1JX4A 1DGJA 4RPXA 3WEEA 4ELTA 4M9GA 1PK1B 1KP6A 4OZ2A 4HH0A 1U2RA 3TSPA 3AO2A 3K5MA 2P9LB 3KKFA 3AUOA 1HBOB 5GAGI 1IXKA 2QLFB 2N3OA 3P96A 5AQXA 3H0MB 3ZT4A 3QGHA 3AARA 3ZT2A 4ED8A 4RL1A 4ANEA 3AT1B 2ZH6A 3UXPA 4PWDB 5HR7A 1DXSA 5B0EA 1RDCA 2FJBB 3T69A 3CCLN 2ZEJA 3MEGB 4X62F 2UU9F 1XBWA 4CLWA 3OBWA 2ROEA 3DLJA 2QKKA 4RQ6A 3ZFVA 1RPLA 1EP4B 3UPQA 2MGZA 1IR0A 4CM0A 7ICQA 4RU2A 1FNMA 5KFVA 2FMPA 1FFGB 3AA8A 2W6LA 4B9NA 4M04A 3C14A 5BN9A 4HDGA 1YBTA 4HHJA 1SL2A 2B7BB 5KFQA 3JAMU 1WEYA 4AILC 1Q1KA 2C3MA 2OPRB 5EOZA 1DTTB 1ZPVA 9ICSA 4JI8K 2ZZMA 4K5SA 3N97B 3I56N 2RPIA 3S6JA 4P2SA 3O5BA 3DDKA 3QUQA 4I7FA 2BCSA 2HBLA 1LVHA 5A2QO 2W01A 4WQ4A 3I31A 8ICXA 5KOXA 1QH9A 2QLBB 1SVDA 3DHXA 3OBIA 4X66J 2ZHAA 2Y0SD 3FZKA 4IJNA 4KGXB 3M8PB 3UQ2A 1XMQF 1N54B 3WX4A 1KAYA 2X1FA 1YJ9N 3U3GA 1IBLJ 2E9RX 4F26A 2I6XA 4DBQA 1JLEA 3MOJB 3E9OA 4WP8A 1KR4A 4CJ7A 3ZD8A 5B0FA 1RBRA 1VQ8S 2CNNB 3D2NA 1WF1A 2ZZTA 3AA5X 3JSMA 1TKZA 3MGJA 4UQTA 1DQ9A 5HLFB 4R5PB 3NGTA 1T02A 1KRPA 2W4PA 2B0GA 4FZYA 2JEGA 3UPFA 3ALRA 4H4OA 2BCVA 1WSIA 2YWFA 3SPZA 3CJ2A 4PYDA 5IS2A 2DB1A 2YHXA 1FDDA 1Q5VA 3ZEUB 2A0FB 2MQOA 3OL6A 3QT7A 4BRKA 1MDUB 3CCSS 4KT0C 2PEBA 2UXDK 1UJ5A 1WG8A 3O9SA 3PFEA 2ZH3A 4KPYA 1EHWA 3KNAA 1NGFA 4MK7A 1X9XA 2J8AA 4CLTA 2J0SD 2KJWA 2OMLA 2IYIA 1F9FA 4JI0J 5T14A 2RN2A 1ZTWA 2V2QA 1ULRA 2CNOB 1B0TA 3KZIU 1EIYB 2VASA 1SZ2A 4X2BA 4Y2YA 2XYPB 3AQOA 1P6TA 2DNGA 4ZCKA 4ZA1A 1HMVB 3AY0A 2UUTA 4A61A 4JI7J 3CJ9A 1K8AT 1U6BA 4FM2A 2RH3A 4L6V3 2EC2A 2G0AA 3ICXA 4B9UA 3I8BA 7FDRA 3NAIA 2BE2B 1CC7A 4OV1A 4Y34A 2M7SA 1WKJA 4RWWA 4KBOA 1BQMB 1ZQVA 3BPSP 4FPIA 5CZVA 5DM7Q 4JUZA 2XSFA 2EXUA 4LFBF 3UKRB 2AJ4A 4TY9A 3KLFA 2D5RA 3KD1E 2BJ7A 4F92B 2B5JA 4BRQA 4LR8A 3HRDD 5DG9A 2NXNA 4XQ8A 1R3NA 4ZPCA 1X1PA 2WMMA 1XR7A 4DI6A 2EG1A 2CYYA 2YVSA 1YRXA 4M6WB 3MBYA 4NM1A 3K1RB 4O3MA 5A8KB 5IT0A 5BPLA 3CGIA 4BR5A 3J7AP 4I56A 3SCKE 2VYPA 5HP1B 4O5FA 4QWCA 1Q7YT 3HBTA 8ICQA 2GWSA 4JP8A 2BW7A 2L9DA 2HVZA 2DVIA 7ICNA 4C11B 4B8AB 2KE7A 3C5GA 4OHYA 3PZPA 1BY9A 4GKKJ 5M1KA 2B7CB 3GIKA 3W9JA 3VALA 4M8LA 1NGHA 3QU7A 3S9HA 1HD1A 3DCAA 3O4NA 2G0IA 4YFKA 4Q7AA 4YR2A 3P4UB 1YJNS 1ZA2B 1JNRB 2CRLA 2GNKA 5ALGA 4KLMA 2ZVSA 5ELZA 1NM2A 2UXCJ 2DGZA 3RF9A 3AHPA 1AUDA 3FFKB 3OTCA 2ADBA 3N9UC 4JV1A 3WC2A 3K59A 5HATA 4L8RB 3DLKA 5A8RB 1HNWF 2G06A 1H38A 3NXZA 1I3OB 4C1NK 3QESA 3G8SA 9ICAA 2MAXA 1Q8LA 4ZLJA 3JPPA 5AQRA 3MCOA 2AF6A 3Q23A 2QGFB 1HLUA 3J80U 3ISNC 1CC8A 2MZSA 3THYB 4LVOP 1KVAA 2GX9A 3M30A 4J9VA 1SUQA 5MAOA 2CUYA 1EXQA 3DM2B 4ED2A 2ZJPL 4YR3A 3OYDA 2ASYA 2Y1JA 2HVHA 1JXLA 1WC5A 2VG6A 4UUWA 2CN1A 4PG8A 4IOXA 2LU2A 4IO8A 1OQ3A 1S1XA 3ALYA 1YJNN 2HBKA 1C1BA 4AUKA 5GAEP 1RHMB 3HJFA 1TE2A 3MCPA 4WIQA 5BYQA 1G1XA 1AROP 1LXJA 5J0TA 5T7LB 4Z4IA 3VQ5A 1YI2N 2YHAA 2HBJA 2B43A 3W2VB 3ISDA 1HFEL 1NDPA 3UD3P 1X7VA 2V8GA 1LOTB 4X64F 2NZTA 2C2OB 2D69A 2PDAA 5I3UA 2Q0ZX 3M6XA 1X9SA 1UPPA 3QE9Y 1Y64A 4JI5K 4WBFA 3H7IA 2PBDA 1L6NA 1ZOTA 2HQDA 4GO5X 3J81U 3VQBA 4IRDA 3V7KA 2QYGA 1OXJA 3FBFA 2Q1NA 3C15A 4TY8B 5KFYA 4DU8A 1HNXJ 2E88A 5AQQA 4RUHA 4OGEA 1U1KA 2PSZA 3CMAS 3UMBA 2V51B 3ET6B 4Z2XA 1RAHB 4H0TB 4FLWA 3M6ZA 3SUPA 1RTDA 3R5DA 3O8MA 1FHTA 3BEGB 1T3QA 1QVFM 2F1HA 4RTFD 5KFMA 1RZMA 3VQPA 4N47A 4QOZB 3SAHA 3M3ZA 4RKUC 9ICOA 3F2BA 3HM8A 2JGAA 2JEJA 4DTXA 1UFKA 3KK3B 4F93B 3D68A 4OYXA 4M3ZA 4DU1A 2O6KA 4DHYA 2PAVA 4JI2K 2EFGA 7ICTA 3T3FA 1S1VB 4PKGA 2XMAA 3TR5A 3VQ8A 4LR7A 3RW6A 4NASA 3N7RC 1FK9B 1RDWX 2ZJ5A 5BN8A 4A8WA 1LWFB 2H3IA 3US5A 1B9DA 4A2BA 4DV3J 5TISU 3MDQA 2HHVA 3OD2A 2UXBF 1Z3EB 1JMSA 5K20B 3I87A 4FCYA 1M5HA 1C7YA 3ZX3A 1KCFA 2FHMA 2RQCA 2DNKA 3ZDAA 2M0GB 2O8CB 2QI2A 4FZVA 1IBLF 1H0HB 4UB8U 4FE3A 2YNGB 3QIPA 3KJNB 1F5BA 1KTVA 4I69A 2BANA 5JVHQ 3H90A 3NGZA 4EBDA 4OJ3A 3DRPA 1WSRA 1TU0B 1VGYA 3Q8YA 1DGSA 5AK6A 3D1QA 2N4CA 3OYIA 2CFXA 1RBAA 3SFUA 2CPZA 3PW2A 3NDKA 1XMQK 2CQPA 3X1LB 2AX1A 3CQXA 1FJ7A 3M32B 3RUBL 2J9DE 5H1SQ 2VG5B 1FFUA 1NK6A 3N01A 3R5JB 3HVWA 4ED1A 4KB7A 2K3IA 4DN9A 1FXDA 5J2QB 1EQMA 3LZJA 1RT4A 2AQ4A 2NLWA 3VCBA 2GS8A 2LVWA 5K4LA 1Q86T 5GAEI 1HYVA 3C6HA 4JK1A 4P2XA 3GZ7A 3MFHA 5FD1A 4IRKA 3AOCA 2UV8A 1S9FA 2DYAA 1KFTA 5HR6A 1RLDA 7ICJA 1UCNA 1D09B 2OAUA 3GDXA 1BQMA 1YTUA 5JICA 5AFUA 5F0UA 4FJLA 4FYVB 4CJRA 3ILIA 2UXCF 3KG4A 4I64A 3PIOQ 4JKGB 2VPYB 4OX9K 3I56S 2H5XA 3BH7B 4DOCA 1VRQC 4QZIA 3ZXWA 3V81A 4QJVA 3CFOA 3PRVA 2JOQA 4LRDA 1NKBA 1MG7A 3TUZC 4F4XA 5BR8F 3OS2A 2XI2A 3VF0B 3IRUA 4IO1A 5CHCB 3T1YJ 4A5AA 4PHTX 3Q22A 3AVGA 2A2CA 4F3TA 4DV1J 8ICPA 3HDSA 1TQLA 2IDOA 1RAEB 3AU2A 4MFAA 4E1MA 4GXJA 1FJCA 7FD1A 3EZUA 1U04A 1WN7A 3CSKA 4MMOA 3CO9A 3H5UA 1WD6A 3VA0A 1MQ3A 3HKWA 1MSWD 1S6PB 1VSLA 4DSLA 5JUMA 5CWRA 2QXFA 2ASMA 4LSNB 4KRFA 3OT9A 4DX5A 1G99A 2KI2A 3DEEA 1IBCB 5A6WA 3L4IA 4KN4A 2GW8A 3A1YG 3L09A 3Q89A 4P73A 2YX8A 3CJKB 4K0KF 4O8UA 4N8OA 4FOEA 3ZX2A 1RBTA 5KG0A 3L0QA 1OPZA 3QFPA 4QIEA 3JPRA 2WF7A 4UB3A 2IVFB 2JDJA 1WC6A 2HQFA 3DRRB 5J1EA 1PBAA 3C66A 1YVNA 4M95A 4DTPA 5EU7A 1VHXA 2GIRA 4WU3A 3PXGa 3HHNB 1RKIA 3IC1A 1EWRA 1PVRA 4NYPA 3MPDA 3I33A 2VFSA 1EB0A 3HSZA 1X60A 2NYVA 2FVQA 1VC5A 4DV1K 4RW7A 2F96A 2PI5A 3WQPA 5GADU 2AU0A 3T1YK 1NK4A 2Y0SF 3LO3A 4R79A 1QQOA 1S1XB 2IBOA 1ATRA 1CJUA 5C12A 4DL7A 3JQMA 1C1BB 4BRHA 2GX8A 4R8UA 4W90B 3C1YA 4DF4A 2KG0A 3C6TA 2XHCA 3C21A 2IY5B 1KVIA 1GLLO 4CIFA 2D3ZA 3K5LA 4I6MA 3E2EA 5KFTA 3FM9A 2GMHA 3W2VA 2X6SA 5AJ3F 3K9KA 2XLKA 4QCLA 4CLKA 2AEJA 2I7PA 2KVCA 4NLPA 1WG5A 3NEKA 2D3O1 4O5BA 1RI7A 3CJ7A 2F9DA 3O9UA 2FLNA 3DDHA 4EHUA 3DDNA 4ILGB 5M1QA 2O8BB 1NWKA 1OPIA 5J2FA 3OV7A 2ZH5A 1XHXA 5ETLA 2GIQA 4XH5A 1HQEB 3BF3A 1F1BB 5G0RA 1NJIT 3VTIA 3PG9A 2MZ1A 1J97A 2HAIA 5ALRA 3E51A 4C8ZA 4WQ4C 3OPKA 1N5YB 3EGVA 3D0PA 4PGXA 2E2OA 1SC4B 3W3SA 3KUHA 4C8OA 1JLCA 2JNJA 4NEZA 4C7QA 2CRXA 1ZQNA 4DV6F 4W5QA 3QEBZ 3IR7B 4OVLA 2A5XA 5HK4A 4MFBB 4Y2TA 1T94A 3G82A 4KH4A 2BZ2A 5GTHU 2R8HA 1N33J 1RM6C 2ZKTA 3EPGA 1ATNA 3DAWA 1WAJA 2ZWOA 4W5RA 2XB2D 4LF5J 4CHNA 3UKUA 4I1TA 1SXDA 1V97A 2ATQA 3OTOK 4MN4C 1Q8IA 4HACB 5F1XA 2AZ3A 2HSEB 3WZ0A 4BLGA 2NNWA 2PA8D 3WK9A 3EICA 2OFGX 2V8DA 2AEFA 4NLRA 1BPBA 1EKSA 3K8VA 2OWOA 3WNHA 1TYQA 2XMTA 5LT5A 4QU7A 1YDLA 2P9CA 6FDRA 3MMBB 1S9EB 4O44A 3TEGA 3B4DA 3VAFA 1BE4A 4DCCA 5BPCA 1X4DA 5IC4B 3MUTP 4ZS6A 1TL4A 3TSQA 4CW7B 4Z6FA 4FW2A 2NV3A 3QFWA 9ICGA 2MSTA 3HM9A 3THWA 4EUVA 4M63A 4NMLA 1IVZA 2KV2A 2GV9A 1RHQB 3RVCA 5KG7A 4BR2A 2E6LA 4EX7A 4GKJJ 5DJBA 7AT1B 7ICGA 2POKA 3HFKA 3IO1A 3N6MA 1N6QA 2Q36A 2HQIA 2Q97A 1NPPA 2YKQA 4RW4A 2IHMA 3O3HA 4AQYK 5AZJA 2NO5A 2HHHF 3TAPA 2E7VA 3G86A 2EPIA 2BM1A 2CPXA 3DKDA 3MM5B 3AVHA 3NL0A 1HQ2A 1F3FA 1TR0A 3AU6A 1JXEA 2LFVA 4ES2A 1U25A 3MD3A 2B6GA 9ICQA 3WIVA 4ED0A 1C1AA 2HHTA 2UVUA 3ZTPA 4JOUA 1VR6A 2AGQA 3WK8A 4MF8A 4QZCA 1S57A 5J0QA 3MR6A 5HSPA 5G4DA 3UIQA 4UZBA 4BG8A 2P9KB 1NLKL 1H7XA 4M0AA 2ZHOA 2KFYA 1X5SA 5HRSA 1ZS6A 2IM2A 2ZIWA 4NLZA 1J5OB 3I0RA 4NRTA 2H51B 4U7UD 1ZQQA 1ZA1B 4CK2A 4RQ4A 4LY7A 1JLAA 4KHPF 4AL7A 2VCPA 4RQ3A 4NO7A 5IIJA 5AFUH 3P45B 3EVWA 4USTA 1RGIA 3KVGA 4FO6A 4DZ6A 3KYLA 2HAFA 2IOCA 3BGUA 3RRGA 5J0RA 2GCFA 2HS0A 3N79A 1QQNA 4XO0A 3M8YA 2H3ZA 5LJWA 4JI7F 5DDQC 2GMLA 5F8GA 1YVFA 2DR5A 2E9ZA 4FZZA 1FDBA 3UXOA 2DEJA 2LPEA 3CC2N 3ZETB 3SQ4A 1FVQA 4UW2A 5L1MA 1RTJA 1S0OA 1FO1A 4MKAA 4CF9A 5D0GA 4QZGA 4FLXA 5DZ6A 1IKYA 3L2VA 2F3JA 2XM3A 1S49A 4HT7A 3H5XA 3O5TB 3D3CJ 2KVSA 3ZSYA 1Z1ZA 3ZZRA 1U2CA 4JRQA 3ONQA 1F44A 2ZITA 4WKRA 1UZHA 1NOZA 4G1QB 4Y0WA 1RWVB 3KKRA 4PRFA 1DRZA 2KSOB 3AQEA 2IPOB 3RG6A 2VBZA 2OCEA 1UVNA 1MU2A 4V19J 3C14B 5BRDA 3OYHA 2EBGA 3GB0A 3IWXA 1KQGB 2PA3A 1H2UX 5AXKA 5J8YA 3ZSRA 4NZ7A 2VBWA 1RT2A 4AQYF 1HBUB 3VQAA 3MMJA 4OZNA 1K8KB 3OTOJ 1TMJA 4RQNA 1LAWA 3QEAZ 4QIVA 3CJ5A 5HO4A 2HW3A 4X84A 5GAGP 2F8TA 1GOAA 4RBTA 5ALOA 1N33K 1HR0J 2LQ9A 3OLAA 3P38A 5T7BA 1A5XA 1S4FA 4OZ3A 4RU9A 2MY8A 3M8PA 5DMRA 3ETOA 3KHYA 4USUA 2J8SA 4PPZA 4GLXA 1TUWA 3C16B 2PKEA 1DT9A 3QXGA 2NZCA 4X4TA 3MDCA 1F9HA 1NJIO 4DEZA 3ZDCA 2W43A 3U3YA 4Z94A 1KTQA 2HK3A 4P74A 2HPUA 1TUGB 3R7SB 1O0PA 2PZSA 5DBCA 3B8AX 4YOUA 5FPMA 2CQ0A 3CM5A 2WF6A 3PIOL 1N0UA 4I6MB 4RPYA 2Y1RI 3O6QA 4JYAK 3RAQA 4W5NA 2QB1A 4YY3J 2GTDA 3R3TA 1JL2A 1NKCA 4IH7A 4CEAA 1X4HA 4Y2RA 4FZMA 2FJWA 3V9SA 2VF3A 3LDAA 3LTOA 1RTHA 3J7A1 1NNEA 5KFPA 1WSEA 2P1JA 3W60A 4MDAA 4JI6J 1S5JA 2AYGA 1Z4OA 3HPGA 2AXTU 4NXMJ 1QVFR 5J2MB 2OPRA 4QZDA 4CNYA 3NGSA 4URSA 9ICNA 2C22A 4CJFA 1P9QC 4PKDB 3AJ1A 4FYYB 5DB7A 5AQPA 1PYOB 1Y5LB 3H25A 2V4JA 4LF7J 3QB0A 4KB1A 2ZDPA 2NRWA 3EWAA 5EXWA 3MGIA 3P1GA 4O3NA 2V34A 3I9V9 2KN7A 3SI8A 3A8EA 3MPVA 2GHPA 2WVEA 3KK2A 1U1QA 3CRXA 5DLGA 1GXUA 3NKYA 3CIPA 4JD2B 1U49A 3CMQA 3RRHA 1RT6A 3ISND 1HQUB 4WJ3B 4I6YA 4K4ZA 8ICWA 4KR0B 3M6WA 3PFOA 3SAFA 1TKXB 5AHXA 4OJ1A 4DSIA 4S0MA 2FMSA 4KHQA 2FBYA 4J9RA 2DXEA 4IEEA 3V1QA 2A18A 3AO4A 3T79A 1QZ5A 3QO9B 4AH9A 5A0LA 3I82A 1JJ2M 2VGMA 3CCRS 5IXUA 4FLUA 2J7WA 1U6FA 1JJHA 2OJ3A 4WJBA 2O4IA 5F9NA 2VQEF 1CJVB 1S9EA 5BPMA 3D6HB 2AH5A 2XQCA 4JI8F 3DRYA 3OPXA 4LF7F 4DS5A 3ZC4A 4OKEA 4YDUA 2EEYA 3BB5A 4KFBB 1XI1A 5C25B 3CDWA 4X66F 4CGDA 1YIJN 2COLA 2W55A 3R9LA 1ZQTA 3MXMA 5AKYA 3P8BB 3QGGA 2V52B 4DZDA 1DURA 3L2QA 2OA8A 1Q16B 3M2RB 1WBBA 1OSCA 3QMQA 3HCXA 1FFVA 1KDHA 1RACB 3A12A 4P4OA 2ZWPA 4IOBA 1Q7LB 1N61A 1YKWA 1U7LA 1SV0A 1BO5O 2A3ZA 2KB2A 1RHUB 3JYTB 2EZYA 5B0BA 4QBUA 3AGKA 2E2QA 3O08A 4TYBA 3CDBA 2XHBA 4JI8J 3MPUB 2DNYA 1YHQN 1VAZA 2BCUA 1N5XA 2DF4B 1MROB 3OYAA 4IQXA 1VLBA 2UVVA 5C24A 1OQ6A 2HNDB 1XN9A 4C1NI 2WFBA 2AJ1A 2X1GA 1TL1A 4W5OA 3Q8VA 2RE1A 2N82B 3KMSA 3UKRA 3V9XA 1ZXIA 4OYOA 2KKVA 3PMNA 5ALSA 4TLRA 4OX9F 2QO3A 3PR5B 1RHRB 3X3UA 3DXKB 2DGWA 4CFCA 3BGRB 3G6EN 3D7EO 2KJVA 3F41A 5CAAA 3PX4A 5FIIA 9ICHA 2FTRA 4BHQA 1GEHA 1GTHA 1KAZA 3SSRA 3RMCA 3MUMP 2VG6B 1BLUA 2K1RB 1HWKA 3CI5A 3QNWB 1VQMS 4CM2A 5J2IA 2BKNA 2F4VF 4MYTA 1VSIA 4KHSA 1Q18A 4LJMA 4NLYA 1VQYA 4JK8A 4I2DA 3GYGA 2IA6A 2MZJA 1Y97A 4PXEA 4CJ5A 4IQWA 1Q86O 2OM6A 1WHYA 4RO0A 4EFAC 2UUBF 4IOCQ 2MKIA 3PHTA 1HW8A 4PGYA 1NI3A 2DH8A 4HDHA 3IS9A 1VC0A 2YV0X 1T9UA 2VB6A 4WFXA 4Q0BA 2ZH1A 4CJ4A 1JLBA 2FI1A 4IL6U 1W25A 4H4KA 4FK0A 3QNOA 2ATLA 2V2ZA 4DV3K 3SFGA 4ZKAA 3PR4A 5EVZA 3IAM9 3NH2A 4PZNA 3A5NC 4AD6A 3GFZA 2GZOA 1S5LU 3QETA 1RT2B 3AA2A 2NXCA 1CZ9A 4DV2J 1A0OB 2Q66A 3V1OA 2O8DB 2ALZA 1J2NA 3WKEA 4WCEL 4M5GA 5KQDA 3NCPA 5K14A 4K7QA 4OJLA 2ILZA 1B70B 3M8QB 2JC0A 5EX3A 2MQPA 5IILA 2CQ4A 5T41A 1S6QA 1S0NA 2IVNA 3D2EB 3RBXA 3VETA 2CH6A 1GFWB 1ED1A 1RWUA 3O3LA 4Z6EA 3M30B 2IHR1 1R0AA 2LYBA 3ELHA 3M9NB 4JN4A 3UCGA 3IDWA 8ICFA 1BOTO 1PC4A 4USJC 2JWLA 2E3TA 2RAQA 1W2IA 2Y0SC 3H0RB 4XA5A 2VQFJ 4FWMA 5EGYA 4JS4A 4M9HA 1QS4A 4QU6A 3LAKA 4WFNL 5AXNA 1WKKA 3GL1A 4ID5B 5U47A 5M1OA 2YX1A 4R64A 4F5OA 5BYRA 1Y9OA 4I6AA 2PN6A 2NSBA 2DITA 3VQDA 2ABYA 5AKGA 2VIXA 1RJJA 3IM1A 2KFZA 2SXLA 1KQSM 3UW1A 3GCWP 5GMEA 4OLAA 3O44A 3OR2B 4YCXA 1ZJMA 2H3FA 3FAHA 2FGCA 4HVZA 3ZZ0A 1ZETA 3ZSWA 1UP1A 2ZOMA 3M2UB 2W54A 2OPSA 3QZ7A 2Z57B 5HMWA 4NLTA 4Y2XA 2RRAA 3ID8A 4DV2K 1RXVA 4BWJA 1JXBA 2V69A 4KBIA 3SJHA 4GVBA 4C6AA 1VQ6S 4BRCA 2DNOA 3F5AA 4ZPVR 3K4GA 2D74B 4H0PA 8RUCA 1I51B 2R8GA 3VAIA 4DPUA 2CVEA 4O3SA 2VQFF 2V9WA 3V4MA 4NYOA 4U67Q 8ICUA 2HLUA 1IKVA 2Q3PA 3QU4A 4PQUA 4Y65A 3BO3A 3PJ9A 2QSFA 2OANA 3ZT3A 5SWMA 4F5NA 4Y3CA 4X5VA 1BI4A 3CCUN 5KFGA 3NMUA 1UT5A 1T4GA 1U26A 3GJRB 3FDSA 2IS3A 4JD2A 4J9NA 1DJ0A 4UY85 4DPTA 1VQPN 3W5YA 5KT4A 5KI6A 5D0HA 3AV9A 2FMQA 3KDNA 1WI6A 3RJIA 2C1EB 2FC9A 4X64J 2PI4A 3BDEA 2QIFA 3H2VE 2EBEA 2VFRA 5EOYA 5GAGU 1ZPWX 4LF8K 2A6MA 3MFIA 1M0SA 4CO3A 3CJ0A 4B9TA 3OHRA 4B9LA 4DR6J 4L76A 4AHRA 4UQGA 3EYZA 4M5LA 2G1DA 3CB4A 2H48B 3CCQS 1U9LA 2QX0A 3AQPA 2IVMA 1DK3A 4USWA 2O8CA 2FPLA 4OV6A 5BRFA 1J27A 3I76A 5DDRC 3O9RA 3PW7A 4X65F 2G0JA 4R0EA 2LDYA 3SBTA 2WF9A 5FDLB 4CBUA 3CNQP 5HMLA 1FKOB 3ISBA 1TL3A 4ICLB 2Y8YA 1T03B 5J2BA 3R97A 4RW9B 2XICA 2KFNA 1PCAA 1Q78A 4DR4J 1YUWA 2QMUB 1X8DA 2CGKA 4MLEA 2FJDB 3H8YA 4H4MB 2HHWA 2GJ2A 3BKFA 2C28A 4RQ1A 3BDPA 1FDNA 2WRMA 1N8RT 3GFXA 4ZN1A 5KG5A 4J03A 3RH6A 1Z00A 1K47A 2XO7A 1BPYA 1V38A 4M2YA 1CI4A 1VQON 2BW2A 2XYGB 5J2QA 3JYTA 1H98A 3RBZA 3H2UB 3DOLA 4CF3A 1LAVA 2QA4G 4MKYA 2YB4A 4W92B 1YJRA 4TYAA 2CKWA 1HKCA 4CIGA 1IQZA 5ALNA 4JK7A 3JQJA 3A13A 1WB9A 4ES1A 4J9LA 1I94J 3TADA 2VH7A 3FZBA 4XAKA 3KLIB 3R5AA 2IVPA 2BM0A 1EETA 5D78A 4CD1A 1M1KT 3O3GA 4YDUC 2UUCJ 4CDGA 5AQUA 3R9PA 1BPZA 2DPJA 3C94A 3V4IA 2ZVIA 3IXQA 3M6VA 3SUQA 3VMFB 2W11A 3NVKA 3RTVA 1XIQA 4O3OA 3VQEA 2C3PA 4BX9C 1Q82T 4K50A 5LMUK 5IT9Y 3ZX0A 5FPDA 2E5SA 1WG4A 7ICRA 5JJBA 2B4PA 3L9ZA 3ENWA 4HHUA 2WFAA 5AQYA 4XEIA 2R2RA 1ITGA 1VQKS 2B3TB 5KFCA 4BRLA 3BPDA 2Y9UA 4KX5A 4FSVA 4KKOB 2RHSB 2DNRA 4ZMMA 4PWDA 3T1HF 1HI0P 1B43A 3WDOA 4BC3A 3HT0A 3N7SC 4B3SF 4M3YA 4FPRA 4LFBJ 4H5WA 2Z4PA 8ICCA 4HI2A 3NOCA 2QA4S 2ERRA 4DR3J 2QB0B 3QU5A 2PFOA 5F0XA 4RNOA 1RAOA 2VOPA 4IO9L 3QEPA 2W40A 2ZIVA 2B4OA 2H3VA 1FW6A 1DTQB 2DBYA 3RJJA 2MUTB 1BIUA 1DTTA 3DLLQ 2JC1A 3A3PB 4NCAA 3I55N 1U45A 5C15A 2E1AA 4KH6A 3QERA 4CWBA 3TFRA 1PIEA 4KGZB 1MWMA 1RABB 1O08A 1BWEA 1UAXA 2E7XA 1V5VA 2BABA 2P6UA 3BH6B 1RXWA 4ITSA 2DO4A 3AH6A 1F3VA 3I0SA 1R8CA 4GNIA 2YMLA 5AQFA 2WB1D 1KQSR 4GO7X 1SV4A 3OGUA 2HFZA 2LA6A 3CCZA 4CJLA 3IWLA 2AP6A 2CZ4A 2CQ1A 4BR9A 2XC9A 3W63A 3QT5A 3JS9A 4KB0A 2M8DB 3C23A 2P9IB 3CWJA 2CQBA 2XS5A 2W1BA 3TA2A 1TKZB 2JVOA 1WSVA 3FBEA 3M05A 4CEEA 2NRTA 5DDMA 3C8YA 4DU4A 5EWEA 2CQ2A 4US9A 2QEXS 1AW0A 4F4KA 2FXUA 2AA4A 2HB5A 4KLGA 4YOYA 1FESA 3SQOP 3MX5A 3L3FX 5JS1A 2WBMA 4NLOA 3W65A 3PEJA 5A6PA 1NH8A 2FC0A 4M5IA 1RG6A 2GEMA 2PY5A 2WBNA 4YXMA 3MECA 4CI6A 2MLXA 5HP4A 4ZP8A 5G0RB 1FKPB 3MI7X 4NL5A 4LFCK 1A6SA 4XUSA 5KFXA 3HHLB 4X4SA 3AA3A 1FRKA 4J9SA 1M1GA 1RQLA 2HBQB 3L4QA 3L7OA 1WWUA 4DWIA 2HCFA 5JLHA 9ICTA 4ID8A 4CGFA 4RW6B 4KJIA 5GADP 4ZPTR 4MO5A 1FCAA 5CYQB 5KFDA 4JV5J 2FVRA 3CCMS 2VKZG 1GLBG 2AV5A 4AYBF 1WF2A 4O3RA 4NYFA 2DCUB 2YMQA 2F1IA 1XSLA 2G4BA 1RNHA 4YNQA 5EDWA 3CP8A 2YX6A 4YFUA 2LXIA 2YTCA 5I42B 3ZTSA 2UXDF 2OFHX 4KITB 3CTRA 1PKUA 3JAMO 1LQ9A 2VU5A 2NRRA 1O51A 4B02A 3HD2A 1VQ7S 4N41A 1FEHA 3LM9A 8ICHA 3HVTA 4JV5K 9ICVA 3N4WA 5LJ5Y 5KPZA 3NFAA 3OS1A 1UJ4A 4JI2J 2M2BA 3KBBA 3N28A 4F50A 1BG3A 1I1GA 2A1JB 3WQUA 1I5OB 2B8PA 1RISA 2JH3A 3RJHA 2ZJQL 1HNZF 2BJ1A 4OJOA 1W26A 4LFCJ 2HRYA 2UUBK 4CESA 2K06A 2FLPA 1NJWA 1OY9A 3M7VA 4EU0A 4NLDA 4XH1A 4MK9A 5A8KA 3RBEA 4H4KC 1RTJB 3PIPL 5AE3A 4L73A 5LSRA 1B64A 2FHKA 3DGPA 2JH7A 3F9KA 3AL0B 2ATCB 2DHSA 2QLXA 5HJYA 1FRJA 4E7JA 3FZFA 3TQEA 1VQ4S 1OJ4A 5KRTA 3BJYA 3IAS9 2CVIA 4CF4A 4YB1P 4UB4A 4AQYJ 5IM0A 4USKA 4IS7A 3FYHA 4CYUB 4LFCF 3U1NA 3J81j 4DL6A 4MLHA 2QN6B 3SQGB 3C1ZA 4QZ9A 3AO3A 4X4UA 2LEPA 3C3LA 3DMJB 3NVWA 1RYSA 4OHXA 1KBUA 1RDBA 1HNIA 3W2WB 2BUNA 3NS1A 2YNIB 4Z6DA 4DFKA 2ZE2A 5HL7L 8ATCB 2XZDB 3KJQB 1ZQKA 5J2DA 5AQJA 4EO8A 4DSFA 3UM9A 2P5GA 1QSSA 1N52B 2IDLA 1TAMA 4Z4EA 3SI6A 3B82A 3CJAA 2YKOA 4MFCA 3GR1A 2BJ8A 3R8EA 4PZOA 2KYXA 2YKAA 4KAZA 2W41A 2EZXA 4DL2A 2EQYA 2HIYA 3FEZA 3ASMA 5AI9A 3FZ2A 2XZTB 5LL6Z 3O4QA 3MABA 4MEXA 1X2IA 4AM6A 4WTYA 1K0TA 3LWLA 4C7YA 3P49B 9ICKA 3I5CA 2J0WA 1V3ZA 1VQNS 2F65A 4KSEB 5DQIA 3ZD9A 1IKWA 2HSTA 1T05B 1SB6A 2KVQE 4U7BA 3IBFB 4Z7CA 1U2VB 4WFBQ 2VWBA 1IBKJ 1HBMB 5D4NA 3FEXB 2E5GA 3DDIA 3ENAA 2R9LA 4URQU 2FZGB 2DFLA 1GXLA 2B9YA 2MKCA 3C65A 2ZM6J 4GVMA 4DV0J 4MHVA 3V6JA 4B1ZA 3WK6A 1APSA 3UDCA 1VRTB 5IIKA 1BPEA 8ICNA 1ZQPA 1K8KA 5DGAA 2E4LA 2MB0B 4I2PA 4A8MP 3PW5A 4LF4J 3PO5A 4XPEA 4J2BA 1VSHA 5LSOA 1FXXA 3OXLA 2R7VA 1K73T 3VEZA 2G8FA 2NPIA 2HQ3A 3KMQA 3S3OA 4CQ1A 3D28A 2V50A 3KHRA 2GVDA 1U1MA 1IBKF 3L8BA 3MZIA 4BRFA 2R7WA 2M52A 2KMDA 1ZQYA 2L5YA 4EBEA 3M1VA 4ZVGA 2DR7A 1LFPA 2Z1HA 2HOIA 2VD3A 4CF1A 3S3NA 3FCWA 2A3JA 1HPMA 1GK8A 3BF1A 3LP2B 4B3OB 3NY0A 2D0CA 1XMOF 4L3NA 4Y2AA 1T0TV 2GMJA 2XGQA 1FE0A 4DL5A 4KYZA 4BUGA 2AD9A 4EHTA 4R5PA 5LMNJ 5I3PA 4EWTA 1TVRA 1KHVA 4JEPA 3DLGA 2KT2A 4I67A 1MA9B 3WNFA 2BEFA 3BQ0A 2M4MA 3FRYA 1IN0A 4WIIA 3K5OA 4E1NA 1AFIA 4IDHA 3SENA 3G4SN 1GQEA 2MYFA 2PEHA 4XDDA 4OO1J 4JKHA 4RPZA 5B66U 1VQLS 3S1TA 5E84A 2W3SA 2I38A 5EWFA 2IIHA 4NZ0A 5AE1A 3I1YA 1I6JA 3EJMA 3VAHA 2DFEA 3OYEA 2H3EB 3HK2A 4OCZA 2YXLA 1RAIB 2VJUA 2VGNA 2IIRA 2CWXA 3AVNA 1OVQA 4A8YA 1J5EJ 5EE1A 1FA0A 3BKTA 5JS2A 2EFPA 5FRMA 2WVBA 4MKBA 3GMGA 4CJVA 3K58A 1N5WA 3OS0A 3NBPB 4OIXA 1S9GB 4M41A 3E3XA 4AXJA 3TOQA 4EIAA 3UNYA 1KVJA 3OYJA 2Q6CA 2E44A 4KAIA 3F2DA 3GSIA 2XNRA 1XNRJ 4ZIVA 4FLTA 2AJQA 4CP5A 2HQCA 2ZH2A 1Z4NA 2XLIA 3M8WA 2XNQA 4NLSA 1GH8A 4M3XA 3WXJA 2FYXA 9ICWA 3RAXA 2B6AA 4F4AA 2YCHA 4FJXA 3JQKA 4QPXA 4HVJA 1IR2A 5B8HA 3VGTA 1BPDA 2E7WA 2OD4A 3GR0A 3QO9A 4E7KA 2XMJA 2Q2RA 5AM0A 2DBBA 4KLIA 4WFAQ 8ICZA 3V9ZA 1FRIA 4B08A 1QQMA 3HVAA 4C4WA 1MA7A 2W6KA 1C1CA 1WOOA 1N36J 2HS4A 3BUZB 3D0HE 3T5JA 4BVPA 4DQRA 3SSQA 4Z4HA 2MSSA 3L5KA 1R0BG 3MAHA 3NMRA 4QZ8A 3FMWA 3QZ8A 2DL0A 2BV3A 1LKZA 1XNRF 3BS9A 2YQ0A 1HYSB 2Q0RA 3E8OA 3ONNA 3FC9A 3J81Y 1QHTA 2HHHJ 1YJWS 4KPCA 3LDOA 1WSFA 1GLDG 5F3TA 3IG8A 3SQ1A 4K4UA 1KVBA 3HYFA 2R4FA 2HHUA 2FB0A 4M3RA 1ZQOA 2CG4A 3VWSA 3IS9B 1S6PA 4WP3A 3KHHA 1BL3A 2V4RA 1X9JA 2ODGA 2DCLA 5FLXY 4IOAQ 3SQGA 4AE5A 1IWGA 1NK0A 3BY5A 3JB9k 4FJNA 3SYZA 4ILRA 1C0MA 3DXMB 3D1HA 4YVZA 4ECUA 2FSJA 5AK3A 5IZHA 4XTTA 3TZXA 1VYAA 1S1UB 3JXUA 1IH7A 3BSAA 3K2YA 4AM7A 2RHFA 3FBCA 2C3OA 3NAHA 4IJAA 3LW5C 2ZH9A 2XMVA 5J1EB 1W97L 2BACA 2R8KA 3C2LA 4RNMA 3NGKA 3TZWA 3D2EA 2EAMA 1D9FA 4IG3A 2NRVA 1PK1A 3VA3A 3OVAA 4KIAA 5IIMA 1XNSA 3AEVA 1N8RO 3GZFA 4CH1A 4ACOA 2RF2A 1F2HA 2IFXA 1IQTA 1QQCA 2PE8A 4RNFA 4RNHA 5E79U 3A0IX 5CCLA 2AW0A 2BGWA 1R59O 1BPXA 5A0YB 3RRKA 4BWMA 4CZGA 5AKXA 3EO3A 2HWHA 1U47A 4WPAA 1C0UA 3D66A 1HBMA 1WSGA 2QG9B 3CW2C 3LDLA 2FJXA 4ZVTB 3UVJB 4XK8C 2A6AA 1DAXA 2ZM6F 2Q4TA 4O4GB 3LQVA 3IBWA 2C2DA 2WUSA 3OSPA 2YHBA 2OPSB 2HBMA 4K4GA 3D0IE 2OTJN 1CJKB 2Z30B 5ETKA 1HJOA 1S48A 5IIIA 4NB4A 3GJTB 5F8LA 2IAJA 3EY1A 1R7IA 3QAUA 4OI0A 8ICLA 2HQGA 5CD4A 2FHJA 4P6QA 4GRSA 5M1FA 2GOLA 5AI8A 1RCHA 1HIYA 2X3DA 1F6TA 4JKBA 5AJ3K 1QQ5A 4M5DA 1LK5A 4PQUB 4QNLA 1C4AA 4K25A 4F04B 4YHHF 4CGIA 4DR2J 4O5EA 2NRXA 1TKDA 1VQ5N 2QWPA 1FK9A 5C0YA 2ZD1B 4ES3A 2Z1JA 5EHHA 1M6YA 1L3TA 5J2CA 3RJKA 1LWFA 1TFWA 3HFZB 3VR1A 4RQ2A 1IJFB 3FSXA 4OI2A 1IG8A 4NJ8A 1ZQZA 1N0VC 4ZP9A 4Z7YA 4GMKA 2WW4A 3CJTA 1RP5A 2WAQD 5GAHI 3SCXA 4N56A 2CJ9A 1QUVA 1WDDA 2FGOA 2BMBA 2OMOA 2R7UA 1LKYA 3NGRA 4BQZA 3MDAA 4KH1B 2CQ3A 1E6YB 3TI0A 3HWTA 5DQGA 3HMJG 2MRLA 3RU0A 4P52A 2MSNA 4K41A 3CQ8A 2QKBA 2GJIA 2I8EA 9ICJA 3N7PD 3OR2A 4CT9A 3KOOA 4JAXA 4H4OB 2LYVA 3FFIA 4AHUA 1Y00A 4PHAA 1Z4UA 3FQKA 5K9FA 3A5OC 2R7YA 1A6LA 3TP2A 3M6GA 1NJYA 1CULA 2GELA 3CCVN 3TZYA 4IH5A 1ZD3A 5J2EA 2HGMA 1SH2A 4DCJB 2RNEA 4RLEA 1QSLA 5JRTA 1VLYA 2Y0BB 2RRDA 4OI4A 1VHIA 5GAHU 3WU2U 3QFHA 5IQQA 4JWMA 1KFSA 3NRBA 1S72S 4KTQA 3NGIA 1K5OA 4E98A 5E3AA 3HHEA 3H5YA 1HKAA 1OY6A 3MM5A 4QS9A 5HQLA 1SBRA 1WOPA 5AM4A 1Z00B 4ED7A 4I2EA 3MR5A 1SZHA 3RWUA 4EZ6A 4EK2A 1ZD2P 5KT6A 3UN3A 4AP9A 3DXBA 4DCPB 3A8YA 2I7NA 2UUWA 4H8KA 4JI4J 2YKNA 2YX4A 3KKAA 2G2ZA 2P9KA 4B1VA 2FJ6A 4DV5K 1ACMB 3PRBA 5CYMB 5ETTA 1JUDA 2B56A 4C8NA 4CECA 4QS8A 3ZO7A 3KLIA 1ECWA 2GHVC 4TURA 4M42A 2DJWA 2AKWB 4PXDA 2WAQC 3TSUA 2YKPA 2BDUA 3UO0A 3M8SA 4KLQA 2HZAA 3BBBA 4WU2A 3F0NA 2CGLA 4HUGA 2HVIA 3S7RA 1DQ8A 5KG6A 3R5CA 4CZIA 2YWHA 4CZCA 4RBUA 5DLFA 3IBCB 4AYBC 1YTYA 1H6KX 2KL8A 4M9LA 5FDLA 1KOOA 5AQMA 4K8XA 3SQ0A 3TEHB 4N76A 4P2FA 1WDTA 4QYZJ 2CZVC 3VCDA 1HRHA 2FBVA 3SMVA 3TARA 1VQSA 4FK2A 3MMCA 1S6UA 5AKIA 4H4MA 2Y9HA 2LU1A 5CY4A 4ZP7A 4OX9J 2UUAK 1L8LA 4R63A 1ZQLA 4G1QA 1UQVA 1R8BA 2IJFA 1KQQA 3LWMA 4X4QA 4O0IA 1WTBA 4Z4CA 3RSEB 3SSSA 1CLFA 3SD7A 3NGUA 2YWWA 2YKMB 2ZIVB 3EXYA 1Q95G 2LCWA 3F2KA 5I9EB 4YD2A 3CD6S 4H0XB 4MO4A 4CFBA 2VDIA 3BSNA 5F8HA 4BR7A 3M1FA 4OZ0A 1GXTA 3LDSA 4IFVA 3ZDDA 3RGIA 5C7PA 1UETA 2E5HA 3AM9A 4DOBA 3TA1A 4FOIA 4KREA 4KHMA 4TKTA 2DKOB 3FK4A 1D9AA 1PC5A 2QT7A 3RW7A 4DR6K 4CT8A 2J4RA 2F8KA 2YWEA 2LYAA 1UWBA 2ACMA 4FWNA 4ISFA 2G8WA 4WWSA 3KWMA 4R8UB 4H03B 4A47A 4FVMA 4TQRA 3C46A 4O55A 4C23A 4JLHA 5ALXA 2EWSA 2ZUDA 4WFYA 3EZ5A 2VV5A 1JLFA 1F9EB 1ZBSA 1IV0A 2CQDA 4AXIA 1WORA 1CLQA 1V6HA 2KM8C 3QEXA 4R0JA 4OL8A 1WLJA 4ZJOA 3AVCA 3VERA 2AJ0A 4DMNA 1LW0B 2FJVA 2HF4A 3D6FB 1VSMA 4HAIA 3AXMA 3K5NA 1S59A 2VA8A 4X4OA 5DRKA 3HL8A 1TUYA 1SIWB 3UD4P 4CBXA 2KJ8A 5CB1A 1BDGA 1FRHA 1B7YB 2ETJA 4TY8A 2ZTEA 6AT1B 1VISA 3MECB 2EKYA 2QWQA 2MUTA 3ATUA 1JLCB 4F8RA 4USIA 3IRXB 2ZIUB 4UATA 2EFQA 3ITHA 4JYAF 2HMPA 1FTCA 3ILJA 1W7AA 2C3UA 1XS9D 1NSAA 1VRUA 4LRAA 3T9ZA 3I0SB 2ZFHA 4CJEA 1KQKA 4J37A 4DTSA 3KK2B 2Y8WA 4JI3F 5HI7A 5CYQA 1MW7A 3VEXA 8AT1B 3LGNA 2ISPA 3EDRB 2XTJP 1X4CA 4LMZA 2QXLA 3HSGA 2ZUAA 4QZVB 3BV8A 2V8VA 3W3DA 1J9AA 1HA1A 2QFIA 1QSYA 3MCMA 1M90O 1RXOB 2FY1A 4LR9A 4RNNA 3TJ8A 3DC2A 3CC4S 2H3GX 1RT3B 1V9OA 1ASVA 5ALZA 2FQQB 1TGOA 1UT8A 1S5ZA 4N5SA 2Z1GA 1TK8A 3IMQJ 4NLNA 4B9VA 1BA1A 2ZH8A 5LMNF 1KW4A 1PG5B 2N7YA 3EKSA 3KJVB 4CJ3A 4YDDB 1RYUA 3LALA 1DRGA 1EWQA 4NE9C 2BXJA 2G07A 3THWB 4LH5A 3VF4A 2JLGA 3BZKA 1CG2A 5F2RA 3NTUA 3VEWA 4UOHA 5J2HA 1BD6A 4F4YA 4CJTA 2WVFA 3G71N 3Q8RB 5AM5A 1OYEA 4P2MA 1Q9XA 3IN5A 3EW9A 3MAAA 8ICGA 3H6EA 1DEJA 1REGX 4A48A 4ICAA 4WP9A 2Y3YA 4JKEA 4ECWA 1WUDA 4CHYA 2KIWA 3WHIA 1B0VA 3T19A 3EUNA 1GOBA 4CLPA 2M70A 1N5SA 2IYGA 2CA9A 2VUGA 1WTFA 5FPEA 2JFDA 4E7IA 4DX8H 1TV9A 2DR8A 4DQQA 4L75A 2DNLA 2F9WA 3CD7A 5F41A 2NLXA 1NG9A 2VJ4A 2KRBA 2WB1C 1S1WA 4CO0A 3TKAA 2ZJAA 4OJHA 8ICVA 5F3XB 1HARA 1XO0A 2ACYA 5KAFU 3P5TL 5GAHP 4LBPA 3SBGA 2FSNA 3PIPQ 3L3CA 4A2AA 3QEVA 2CPDA 4DXLA 4H5VA 4FDFA 4F3MA 3SV4A 2J6SA 3OXFA 1KL9A 3JPOA 4QJFB 3CJRA 1YBAA 1QTMA 3CJ1A 2OXOA 4ZJLA 4JRPA 2YNHB 1URNA 2GO7A 3AVAA 1UPMB 2BKOA 2RJZA 4OI1A 5CHIA 3NLCA 1ZQGA 3NCQA 3RJMB 3WKAA 5G5GA 1TELA 2NXEA 3CDEA 2D4WA 4GVLA 2BTFA 2A3VA 1BNOA 2AWZA 1ZQBA 2IHNA 4M45A 1YITN 4ANCA 2YMMA 2FDNA 2FJEB 2KU7A 2RS8A 5KRSA 3O2IA 4WXWA 1UVJA 4L74A 1N36F 2P9UB 4CGJA 2CPHA 3R7BB 2FE9A 3FCHA 3MR3A 3MCSA 2W9BA 4BRNA 4PHDA 1QE1B 2QLWA 3QIDA 2BOAA 3LK9A 2XYHB 3T9NA 4J9KA 1PVQA 4NLUA 1WHWA 1S22A 7ICKA 4IKAA 1X31C 2HHPA 3DOKB 1WC1A 1UEKA 2CJBA 3H40A 4KX3A 2HMXA 2WHEA 4U67L 1G15A 4EZ9A 5DM6Q 1YBUA 3PM9A 1VQ9S 4FF3A 1RSCA 2QC3A 4Z0UA 3TW0A 3KD3A 2DT9A 3V6HA 5LL6d 2XLJA 1FFWB 4Z6CA 1HNIB 1U1PA 3CDUA 5IOLA 4NMXA 3AN1A 3DOMA 1SC6A 4NV0A 5ETSA 5H9FJ 2W2OP 1Q46A 4FZXC 4A8OA 3PRDA 5K14B 4JI1K 4IFVB 4YXJA 2X1AA 2ZH4A 4Y2IA 3CCVS 3C7NB 3C28A 1Y5IB 4P7TA 2QW9A 4JI0K 4RX6A 3W66A 4FYWB 1SI9A 3GWCA 3QSYB 2XGPA 9ICBA 1WC3A 2QE5A 2MHNA 1H2TZ 3ENHA 3Q0AA 3TAMA 2DGXA 4C8LA 3LGMA 3KWGA 1Q79A 5ITHA 2DIVA 5IWAF 3PMLA 4F5PA 3CCJS 3HHDA 1SIZA 4F5RA 1JLEB 4LVNP 5AZIB 1X5TA 3RMDA 4O5KA 2H5JB 5LJVA 4ZH4A 3HILA 2QWRA 3JSMB 1X4AA 1Q82O 2ZBQA 3TADC 2B8QA 3OL9A 9ICUA 2JZBB 4I2CA 3AB4B 4M1KA 2WBRA 3LZIA 3J7YI 4RWTA 1U8SA 3D2SA 2BOPA 4CGZA 1VSDA 1P27B 1P7DA 1RTHB 3SUNA 4GFJA 3VGVA 1YZ6A 2JL9A 5HVGA 2YHWA 2DHGA 3W62A 4DB3A 1RB0A 3ZNJ1 4DV5J 4E2FB 1RDUA 4QR0A 5C2FA 4KHYA 4C98A 3J80Y 3TAGA 3R2DJ 4U8VA 5SUHA 4DJBA 1T11A 2VPWB 4OQJA 3FNNA 4AHVA 3CMEN 3Q8SB 8ICSA 4RW8A 2J76E 4ISGA 5H9EK 3SQIA 1ZBFA 1BHLA 3THVA 3IRXA 2F2AB 1VDVA 2KICA 4JI6F 3O8WA 2QARB 2W7AA 3TPQA 4JKAA 1W7WA 5HRPA 4LSLB 5K8OA 1ZQEA 4O8KA 4I28A 2DH7A 3WC0A 4M5KA 5CR4A 2D0OA 4HHHA 1ZC6A 4PUOA 2HZVA 1VI7A 1ZBUA 3DI6B 3G82B 4GKKF 4YDXA 3BO4A 4R65A 1ZQJA 4Y2CA 4MTPA 4KI6A 4QPTA 2KG5A 3CF5Q 5HBMB 4MH8A 2CQHA 3FGVA 2HLTA 1V9PA 4IG0A 3IGVA 2B6AB 2LI6A 4TQSA 1NH7A 1SH3A 2H5EA 4ANDA 3OHAA 4DX7A 1K0VA 1RBVA 2BDPA 2XO6A 1CJVA 4F25A 1F21A 3Q8PB 1PBUA 1XJWB 2QWLA 1RAGB 3PUFA 4IFEA 5KGXA 3CCES 4CK1A 4I6WA 3ZCMA 5CCMA 2FD2A 4YMNA 4FJ7A 1C1CB 2RD5C 3KLFB 5DG8A 2VQEK 2PMZF 5G5HA 2DTJA 3UE5A 1PJ6A 2M0NA 1IM6A 2L41A 2YWGA 4OLPA 2BPCA 1F5CA 4BR4A 2A1BA 2J9EA 2ZBPA 2NS1B 4HL9A 4LQ9A 3DHWC 3B6BA 3BQTA 2LECA 5A2QU 4PHEA 2EH9A 5ALFA 3W7BA 1WSJA 1NDCA 2MJNA 2P9GA 1KNZA 1RILA 1ZQWA 4Y2MA 1ZM3A 3B78A 3DLLL 5HMZA 2QWOA 4DV3F 4EENA 3TWZA 2OH2A 1PYSB 3WNGA 4C9DA 4NL9A 2BKEA 1SIJA 3GFKB 4ZVOB 5E0OA 5DDPC 1WNEA 1TL5A 5ETRA 1Y3JA 3TO8A 5IQ6A 4Q2LA 2HHXA 3OVBA 2LM1A 3H2LA 3PKMA 1ZRNA 2R2SA 2KW4A 5E3CA 3TANA 2BCQA 3WXLA 2WVDA 2OLWA 3FMBA 4DR4F 2BBEA 3T5KA 4CLFA 4IR9A 4CRXA 4QWEA 5AQZA 3O1BA 1VK3A 4CZFA 4RQMA 1RUSA 2EAOA 2XMUA 2B4JA 3I4HX 3QSIA 2M3DA 3SIPB 5KFZA 3M8RA 5ETMA 3EXCX 1L3VA 4DLGA 1FXRA 2AMCB 3KLEB 2DHHA 2VC1A 2I5JA 4YN3B 1UA1A 3P83D 3LPYA 4G65A 3TJ9A 3DM2A 4CTAA 1HWJA 2ZUBA 4JV5F 5KPTA 4F3OA 4CLUA 2OPPA 4A8XA 2QZ8A 4P72A 4C7ZA 2DRAA 3G9CA 5ALMA 4P9SA 4F02A 2VA3A 3MX2A 1A0PA 4BDYA 1X42A 2K8BB 4KKOA 3H0LB 4M5MA 4XPCA 3UDVA 1IBMF 2HEKA 1QVGM 1RWKB 3LAMA 1HBNA 3OHBA 1R6YA 4PG4A 3QATA 2NZ4A 1YK9A 4OJ5A 3LH2S 1IIPA 3OA9A 5JU5A 7ICFA 3L2RA 5I3UB 1ZQSA 3N0VA 4F3QA 3HX9A 4EO6A 4LFAK 1UMJA 5ADXH 3ORYA 2DXDA 5KFKA 1O6XA 3CCEN 2K4HA 3S41A 1SGGA 5D0EA 1XQIA 4JKCA 4FFDA 1DHMA 4QR1A 3DXMA 4YOVA 2CJXB 2ZG6A 1RE1B 3SZ2A 3Q7BA 4DL3A 3MDFA 1A5WA 3CC7S 2OELA 1M5SA 3VQ4A 1VS3A 1VK8A 2OKQA 4PY5A 1S6QB 4I27A 4QIGA 3ID6A 4CFAA 4H5TA 2XI9A 2DRBA 1FNOA 4BC4A 2KIVA 3P6YC 3UB5A 3B54A 1Y11A 1AFJA 2X51A 2Q79A 4O3QA 2F40A 3SJJA 1JQGA 4DTOA 1M1HA 2E6MA 3G4SS 4UOGA 4BREA 1JLGA 3S01A 3O9TA 4B8CA 3AAQA 4L72B 1Z26A 1D8LA 2JRSA 4LIWA 4U96A 4LZGA 3F73A 3QBCA 5D3GA 2NPFA 3T1YF 2DFHA 3LP3A 2HFSA 1FRMA 2VWKA 1S72N 1VBZA 2O1PA 1NAQA 3KNGA 2IRYA 1VQ6N 4HKQA 2F8HA 4OD0A 4M63C 1WACA 3W9IA 1MN8A 3BR9A 4IDKA 1J54A 2G2YA 5KG3A 1OYDA 2KQ2A 3LOUA 4ZVPB 4BQLA 2I2YA 1HI8A 3ZYYX 4I2GA 2MZTA 4O0NA 3MTJA 3UN2A 1U02A 1VQ5S 2VICA 4CDIA 4GKKK 2RVJA 3HPOA 2BZFA 2CJAA 1ZM2A 2DKXA 2HOQA 1U09A 4KH5A 2DD8S 3OFHA 1OUQA 4JI1F 3HVRA 4BVOA 4FBUA 1N33F 1BIZA 3BM7A 2ZXHA 3H8JA 2H9ZA 1W9HA 3BP8A 2QWNA 4FWSA 4PL8A 3W5XA 1UL3A 3PO4A 3DU5A 3OLBA 2WVCA 5AIAA 2LYHA 4B3TJ 3T1HJ 1JWWA 5DM6L 4LSLA 4JK9A 1S3XA 1GNKA 1SJ4P 2UZAA 1UVMA 1HNXF 4LUBA 3ISCA 3PCOB 3CMES 5THWA 5B0DA 3U7JA 1B4FA 3KWIA 4ED4A 4EX6A 3NF9A 1D1UA 2OEHA 1T9VA 1UAWA 2QA1A 1JJ4A 4AL5A 2KDOA 5KFBA 3AAPA 1RT4B 2MQMA 3ILOA 1PVPA 1MNEA 4AT1B 3NS6A 3F56A 1H72C 5IIOA 5AK4A 2E1PA 4CJKA 3UCUP 1C0TA 2JHEA 4A8KA 4WYWA 1VQNN 1WOQA 5A8WB 5EUHA 4DF8A 3ZDEA 3AB2B 5M2PA 1UA0A 3H42A 3RMAA 3V6DA 4UBCA 3IM9A 2NXJA 3SV3A 1RADB 3M6UA 4KLJA 1G2EA 5BREA 4Y2KA 4OPKA 4FXVA 3B6PA 4H54A 4JKGA 3CCJN 1VQ9N 3CEDA 2JWNA 4UAUA 4GVEA 4ISEA 1FKOA 3GIRA 4W5TA 3VEYA 2RRBA 4I2QB 1T03A 2YN4A 5C42B 4DTRA 3CULA 1JMTA 4WQ5A 3TABA 4YB6A 3BEXA 2VC0A 9ICRA 1CJTA 2UXDJ 4NWBA 4DU7A 3PNIA 4A59A 2DGUA 4C3MA 3GFHA 4LF1A 1CXQA 2P9PA 5F0WA 3THPA 8ICKA 1CXUA 5AXLA 1H2VZ 3ENVA 2V8PA 4A46A 1KWMA 1WSHA 3H8WA 5AICA 4B1WB 2V4QA 1XR5A 5DKWA 3F5EA 4OI3A 3HSDA 4K4WA 3R3LA 2W9AA 3BS5A 2JRZA 5I3QA 3RR7A 2OZMA 4D3GA 4KHPJ 2DHAA 3Q7CA 1FFSB 2F8EX 4LSNA 4CLYA 1LB2B 2F3NA 3OY9A 4UTGA 1HNZK 4K0KK 3HD1A 4K2XA 1RT5A 1VQ4N 4DV0K 2HKEA 2U2FA 1S12A 3GJSB 4JI0F 3VAKA 2G8HA 4YS2A 1KXPA 2P66A 1YXQA 2JVRA 3EX7B 2FF3B 2YH1A 2O8EA 4NXNK 3ZI4A 1IXRA 3S6EA 5FLXO 4J2DA 3OR1A 3BSOA 3IR6B 3T6BA 1E4FT 3V4IB 1AZSB 1KN6A 4FS2A 3NVZA 2JHDA 4WTOB 1FX4A 3SNNA 4Q43A 4PGQA 4FJIA 2BRKA 4TUPA 4X66K 3QMLA 3KLEA 1B92A 1SKUB 5AKKA 4O9MA 1ZQRA 1B22A 3RJGA 1NNDA 5LMUF 1NEEA 3TUJC 1YITS 1TKTB 1TUVA 3MN9A 1J5EK 3AQFA 1SJ3P 1QM9A 3K89A 3GG1A 3O9QA 1RT1B 1VIXA 1MWZA 3GBTA 3EWGA 3BGOP 3AAWB 3GPAA 5LMUJ 1N60A 1L7PA 3MEKA 1QCKA 4B3MJ 3I8DA 3QLHA 3RZAA 4PL7A 2DISA 3LANA 3AVLA 3HRGA 4B3TK 2QTDA 1BUXA 3CCMN 3NOGA 2N3LA 5L8RC 3PEHA 1NO8A 3ZSXA 1L5UA 1V4TA 3C2PA 4WK3A 1VJQA