4MHVA

Crystal structure of the pnt domain of human ets2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
AVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein C-ets-2
publication title Crystal structure of the PNT domain of human ETS2
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4mhvA00
2KMDA 2L5YA 2QB0A 4RQNA 2F44A 2QARB 1OW5A 3TACB 2EANA 1UQVA 2E8MA 3BS5B 2K60A 4PZNA 1SGGA 2QKQA 1WWUA 4PZOA 1SXEA 2Y9UA 3BS5A 2E8PA 2Y9TA 1OXJA 1KW4A 2LMRA 2ES6A 2DL0A 5F3XB 5J8YA 2DKZA 1B4FA 2KIVA 2DKXA 2FE9A 1F0MA 1LKYB 2E8NA 2KE7A 1JI7A 5JRTA 1LKYA 1X40A 1V85A 1X9XA 4NJ8A 2EAMA 1DXSA 3K1RB 4NL9A 3BQ7A 1SV0A 2E8OA 3H8MA 5J8YC 5JTIA 1Z1VA 2QB1A 2B6GA 2LPEA 5KNIA 2F8KA 4RQMA 1WWVA 1SXDA 3SEIA 1PK1B 4NL9C 1PK1A 1B0XA 5JU5A 1SV0C 3SENA 5L1MA 4MHVA 2ESEA 3BS7A 2GLEA 1X66A 1PK3A 2KSOB 1SV4A 1UCVA 2D3DA 3HILA 2QARA 2EAPA 1COKA 2K4PA 2KSOA 1V38A 2D8CA 2KG5A 1RG6A 2JV3A 2EAOA 2YTUA 2F3NA 2QB0B 3IDWA 3KKAC 4IS7A 3TADC 3TADA 3KKAA
chains in the Genus database with same CATH superfamily
3PSPA 3RR7A 2W9MA 3ORYA 5DDYA 3ZD9A 5AK4A 1NK7A 1QSLA 5KT3A 2BR0A 4GIBA 3PMLA 3V6JA 2AQ0A 4EBEA 2VIXA 3KZIU 1BNOA 5AIAA 2FI1A 4YQWA 2RHFA 1WCLA 3ZDEA 4GFJA 4CE6A 4XUSA 4QZDA 2FMPA 1K1QA 1Z3EB 2PI4A 4DCCA 1A0PA 2W3SA 3KFUF 1AROP 1UA0A 3RRHA 2ZIXA 3B0YA 4Y2RA 4XRHA 4KX5A 3CW2C 4JV1A 3TARA 2K4HA 3UXOA 4JUZA 3RAXA 4JV0A 8ICKA 3WKBA 5EOZA 2VA2A 1Z4OA 4HYKA 3PO4A 1T3NA 3WU2U 5J2FA 4KLDA 4RNNA 1ZQKA 3NUQA 4QZFA 3UMCA 3LK9A 3H4BA 1S0MA 4M2YA 4P0PB 2FJ6A 1AQ6A 5J0WA 1S77D 5J2IA 3PV8A 2E1FA 2RDIA 3ICXA 3F5EA 2HHSA 4YR0A 4DFPA 2CRXA 4CF4A 1JUDA 7ICFA 4LZDA 2QARA 4PGYA 1RZTA 4O3RA 2KSOA 3E2EA 1T3QA 9ICFA 1A6SA 2JV3A 2EAOA 1RYSA 4B6JA 4PGXA 1L7OA 2LM1A 9ICQA 1D9FA 4BUGA 3JPPA 2A3VA 2VA8A 1KN5A 1DRGA 2YX8A 4R66A 3PSIA 1ZQLA 2R8GA 5IINA 1PZNA 2ATLA 4RNOA 1ZETA 4PHPA 7ICTA 3UXNA 2YMLA 4UBBA 5HP4A 1T7PA 1Q8KA 9ICXA 1SGGA 5CA7A 1TAQA 1N61A 1WWUA 2HCFA 1TVAA 4Y2QA 4DSFA 3OHAA 3O0FA 3R9KA 3A0HU 3RRGA 5EE3A 1RQNA 1UPHA 2RP5A 4ECXA 1MA7A 3SAGA 2G09A 4USAA 1LKYA 4GC6A 1SWWA 1TK8A 1L3SA 3ETLA 2MSNA 1XU4A 3I1YA 1N2XA 1Z4NA 1CEZA 2K4IA 3C2KA 2NYVA 2DFLA 1LB2B 4KLMA 4C8MA 2W8LA 2J6UA 4UAZA 2W9BB 2HDOA 5KFMA 5DLGA 4QZHA 1BNPA 4KX3A 3V7JA 1PVQA 3M1YA 2ESEA 3JPQA 3IRUA 1L3VA 2YN4A 2OWOA 4MFFA 4O3PA 2EAPA 3E0FA 2ASJA 5AK6A 7ICUA 4O0IA 3WKCA 2YMQA 1KFSA 1FFUA 3C2LA 4ED1A 4FBUA 4NLBA 4P0QA 1SIJA 2KN7A 5KG0A 5AKYA 4Q8FA 2G08A 2DWQA 5J2KA 1XSLA 4DFKA 2NRZA 4CGZA 3WK8A 3QNMA 5J0UA 2A19A 5DLFA 3C23A 4RU9A 3AN1A 4KLLA 2QKQA 3BQ0A 4YD2A 7ICJA 8ICVA 2KOBA 4DWIA 3QUQA 2ISOA 3T3FA 1JXLA 5DG7A 5DBCA 5KFBA 3AMZA 4KMUA 3M6ZA 3DEEA 3S6JA 3Q8LA 5AI5A 2CN1A 2A1JA 3HP6A 4JWNA 2ZIWB 1ZD5A 3Q8SB 1L8LA 3N7PD 4F2SA 3BQ1A 3SV3A 4YP3A 4DLGA 3SV4A 2DF4B 1FO4A 3RB6A 2KFNA 2C2EA 2FMSA 4J9SA 5KFJA 1WWVA 3VC8A 1ZXIA 3SEIA 5AK5A 5CEHA 2KICA 7ICIA 2GOLA 2JHDA 3FYHA 4F5RA 1VDVA 2ZUDA 3BS7A 5D4BA 4ELUA 3OHBA 3UQ2A 3V6HA 1KDHA 4DOAA 3SYZA 1BPBA 2OH2A 2QB0B 3TADC 4FO6A 3PW0A 2R18A 1K5OA 3GV5B 3LWLA 5DG9A 4J9QA 4QZBA 2DUYA 4KLEA 2Q0ZX 1S9FA 3PX0A 4NLKA 2JXJA 1OW5A 1KKXA 4I28A 4BX9C 5KFPA 4IQVA 4M47A 3H0MB 8ICXA 3AQEA 2K89A 1D8YA 4R65A 2Y9UA 4Y2TA 1NKEA 3PSTA 3RR8A 3IV6A 3MC1A 5ALXA 2UVWA 2LKYA 8ICBA 4C7YA 3UMGA 3IG5A 2KE7A 5JRTA 2F76X 1Z00A 3RH6A 1MSWD 2FDRA 2G06A 3EPGA 2D6FC 4UW9A 4I2EA 2R8JA 3V7KA 4QZ8A 2E8OA 3H8MA 3KD3A 7ICGA 4ACOA 2KZ3A 3QU4A 4F71A 2JR5A 5KG3A 4UB8U 1L3TA 3NVYA 3H8SA 3D2SA 1ZD4A 5ALYA 3ISDA 5F9LA 3WK6A 3TAPA 1DOQA 3RJEA 7ICSA 4FE3A 4ECRA 4QZGA 1QSSA 1C20A 1KFDA 4Y2SA 9ICIA 5J0SA 4QZ9A 2ZIVA 3J81j 4ECUA 2HI0A 2F1JA 3V72A 3C29A 3OSNA 2XICA 1RM6C 5FP0A 3K4GA 3E58A 4KITB 4NXZA 4C7ZA 3UPQA 4C0ZA 3NVWA 3GIMA 5AM2A 1SKWA 4R8UB 1V97A 2ZJAA 4C4SA 4AYBC 4RT2A 1ZYQA 5ALLA 3M9NB 4B9NA 3BZCA 1RQLA 1LV5A 7ICRA 2Y0SC 1ZQVA 2BDUA 9ICHA 5J0PA 8ICMA 2ASDA 5J2GA 4ED8A 1HUOA 2XGPA 3JPRA 1WCNA 8ICUA 1KEJA 3T5KA 2M0NA 4OJPA 4UAYA 1F44A 2PKEA 2JGAA 2GO7A 4J9RA 1RYRA 4I2FA 4C8LA 5ALJA 2N1RA 5L9XA 2KNJA 1J2MA 2XI9A 5J2BA 3K1RB 5IIMA 1URJA 4Q45A 1LVHA 1X6JA 4NM2A 1ZQCA 4DL5A 4ECZA 5BOLA 2XY5A 1PVRA 3TKAA 4ECSA 2CPRA 9ICMA 5EE1A 3ZDCA 5TISU 3SR6A 5KT6A 2H3ZA 2V9WA 3QYPA 4P4MA 5BOMA 5HMMA 4OD0A 7ICHA 4F4KA 1CRXA 4LVSA 4DSIA 4E0DA 3QE9Y 1QQ7A 1PK1A 1ZOLA 2Y1IA 5D49A 1MQ2A 5KFLA 2XC9A 3MR6A 4MHVA 4Y2YA 2BPFA 5HNKA 9ICJA 2IOFK 3NRWA 1BVSA 4RQ7A 2D3DA 1M6YA 1JN3A 4KLJA 1U45A 2JZBA 2AHOB 4OCZA 4R63A 4RQ1A 4MF2A 3I28A 2I6XA 3AUOA 5JUMA 3TADA 5DB9A 3JPNA 4Y2JA 4RUCA 3SAHA 1NZPA 3OJSA 2RLTA 4G9BA 7ICLA 4C8NA 2W03A 3PR4A 4UARA 4O3NA 1UQVA 3F53A 3RBDA 1FEZA 2IA6A 2ZXIA 3BJYA 3M8RA 3BS5A 4I2AA 2JEFA 2PFPA 2DL0A 2AGQA 2ZXHA 2MUTB 5KFKA 5L1JA 2HOQA 4DQRA 4RT3A 3MDCA 2E8NA 2KP7A 2W43A 3ONNA 1X9XA 3AU6A 2YB4A 2IOFA 4NL9A 4I2JA 2HBMA 3PMNA 2ZIUB 1Q46A 2BCRA 1SV0A 4P0PA 2ZUCA 3K1ZA 4TQSA 5D46A 5IIOA 4O3OA 4M9LA 2B6GA 2LPEA 2G5IB 4JV2A 2WAQC 2F8KA 8ICGA 2KHVA 2DPIA 4RQ3A 2ZG6A 4YN4A 1NKCA 3LVWA 2FPMA 3SAFA 1TK5A 1N56A 2XY6A 3UQ0A 1CUKA 4C4RA 4QZAA 3NS1A 1U49A 1SL2A 4DQQA 4DQSA 4IRKA 5T14A 4B9SA 2LBOA 1TAUA 4F8RA 5AKXA 4DLEA 1Q3VA 3FDSA 4FZLA 5IIIA 5ALMA 4TUPA 1NJZA 4MF8A 2FPLA 4K4IA 1WUDA 4KLHA 4OO1J 2EQYA 1N5WA 5ALIA 4X5VA 2F1IA 2I1QA 4O9MA 2HMXA 9ICAA 3L3FX 1QH9A 4QNLA 5AIBA 1S0VA 2HHUA 5DBAA 2ZTDA 3TAQA 3UMBA 5CRXA 5CB1A 4KLSA 1S0OA 2XY7A 1QSYA 4U6PA 4GC7A 1UA1A 4PHDA 1KFTA 3QUCA 9ICKA 4O3MA 3L5KA 2Y1JA 3Q8KA 1KW4A 5AKJA 3VCBA 3PW7A 5J8YA 1MN8A 1ZQAA 5ALVA 1B4FA 5H2FU 2EZXA 1Z1BA 2ZIXB 3SD7A 5KFIA 1L5UA 2WHEA 2MU2A 1X6IA 2RRDA 4J9PA 4NM1A 3G6YA 4A8EA 2W9BA 2HHVA 2VJ5A 2LYBA 1ECWA 4OJLA 5ALZA 1ZQFA 4YFKA 3GIKA 5AKLA 5ALEA 1ZQUA 5J0YA 3TFSA 1U47A 1U4BA 1NNLA 2K8AA 3CYMA 2HVIA 2H3QA 2NO4A 1S10A 4IQUA 3OSPA 3F2BA 4YXMA 4HAIA 5AI6A 4EBDA 4B9VA 2RQ5A 8ICOA 8ICCA 2AU0A 5JU5A 3SENA 5L1MA 3RFAA 4KLOA 2PFOA 2KSOB 3C28A 5EWFA 3K75D 4BXOB 1DK2A 5KFUA 3V6KA 1XO0A 2D8CA 2W8KA 2KG5A 3PX6A 4UBCA 3SMVA 1QQ5A 2NRWA 4EYHB 3PVXA 1FFVA 3GU3A 4RQMA 1Z19A 9ICOA 4KLFA 2BQ3A 1UHUA 3QUTA 3JPSA 4ZOHC 2H5XA 3N4MB 4I2GA 4Q43A 2F77X 4EEYA 5KFDA 5AI9A 2VANA 1ZQNA 3AEVA 3KHLA 1OUQA 1N62A 2AXTU 1ZQ1C 5C5JA 3OGUA 5GTIU 5DGAA 2KKVA 5KFSA 3RB0A 3WKAA 4C8OA 2OEHA 5AM3A 2ZIWA 4R64A 2AGOA 3ZDBA 3HX0A 4GXJA 3N7SC 2JEJA 1RPLA 1LKYB 2R8IA 2C28A 5ALGA 2WB1C 2PXIA 4QWBA 2PI5A 4J9MA 4CF3A 1IXRA 3PX4A 2NRTA 1SZHA 3MGHA 1T94A 2IOHA 5ALQA 8ICEA 5DB8A 1ZQEA 3GQCA 3RJKA 2KZZA 4F2RA 2BZFA 9ICCA 1YZ6A 1H38A 5ALHA 3ZDDA 1L6NA 2G0AA 4C4TA 1SXDA 2FLLA 1S8OA 4F4XA 4FFDA 2HBLA 5AKZA 4JK1A 5DBBA 3KTQA 3ZI4A 2PMZC 5KL8B 3RB4A 4ICAA 3H40A 2W04A 1KQQA 9ICVA 2F8LA 3RH5A 1JRPA 4RNMA 1UCVA 3MBYA 2XCAA 4EX7A 3WK5A 5KT5A 1ZQIA 1COOA 1KL9A 4Z6DA 4TUQA 4QZIA 4P0QB 3B9JA 3RBEA 5KAIU 2EH9A 1JX4A 2ALZA 1N60A 4IQWA 5KG2A 5TZVA 8ICNA 4KLUA 5KFZA 1Y88A 2VJ4A 2V4QA 2HW3A 4NLCA 4UB3A 4M04A 1JMSA 5B5EU 3LDAA 4PZOA 2YMPA 4O5KA 4O3QA 1TKDA 3NVVA 4QW9A 3RJHA 4FBTA 2KJ5A 3QXGA 4DS4A 3KBBA 2MA1A 1ZQTA 3NGDA 8ICQA 2XVTA 1Q3UA 4DL3A 3B0XA 4K4GA 3D2QA 5J29A 1JI7A 2W11A 1JALA 3H8JA 1VLBA 5ALRA 3ZD8A 2WF9A 2JH1A 2H3FA 2HBJA 3PW4A 3HWTA 4YMOA 5J0RA 2HHQA 1J2NA 3MR5A 3D6JA 2KJ9A 5KG5A 1ZQWA 4ELVA 3DDHA 2W7PA 2XO7A 3RJGA 4O5EA 1N63A 9ICLA 3QU9A 1NKBA 4I29A 7ICEA 2AGPA 4NL9C 5ALTA 1SV0C 2YMMA 4R8UA 3BQTA 1KTQA 2GLEA 5AM0A 3C5GA 2K8CB 4LJXA 4UATA 2ZJ5A 3GV7B 3MFHA 2P6UA 3HILA 4F4ZA 4GXKA 8ICAA 2MAXA 1HUZA 5ALDA 2XGQA 4IL6U 2YTUA 2BHNA 5ALSA 2KMDA 3HT3A 1X9WA 5DDMA 1XWLA 4EENA 3T5HA 2ODGA 5DQIA 3L4PA 5J2JA 2BDPA 4F4WA 4NLZA 2OM6A 4DO9A 4YR3A 2JEIA 5KTQA 4Q8EA 2C22A 1RYUA 4AYBF 3UXPA 1NK8A 1J97A 3AU2A 2Y0SF 5J0QA 1NK6A 4DFMA 4O5CA 1IG6A 1Z00B 2ZJ8A 5K4LA 1BGXT 4Z6EA 3QEAZ 1KBUA 4EEKA 1NK0A 2DGZA 1ZQHA 1IM4A 4DOBA 2XIDA 4ED0A 5J8YC 1WYGA 1MQ3A 2HSZA 1XSPA 2W9CB 5KFAA 4KN4A 5B66U 2NO5A 3KHGA 5KG1A 4QZCA 4EELA 1YZ7A 4F5PA 4BGDA 4DFJA 1GO3F 2ZTEA 3LWMA 5CJ7A 5KG7A 3MGIA 1TE2A 3PSFA 2I9GA 1DK3A 4M9NA 2OCEA 4Y2VA 1C7YA 4QJFB 3Q8QB 3I76A 2A1AA 1NJXA 4YR2A 3JPTA 1WG8A 1S5LU 3F5AA 3M9OB 2Q4TA 2RDJA 1V38A 4ECVA 3EWAA 2V4RA 3HKZC 4DEZA 4YD1A 3Q8RB 4B9MA 4ZH4A 5J2AA 1BPZA 3GIJA 4KLQA 2J6SA 4I2CA 4AP9A 4RQNA 5IIKA 1X42A 4BDPA 5C0YA 3V7LA 1U48A 3D2NA 2EZZA 4YMMA 3SQIA 2XCPA 1VJ5A 3QZ7A 1XSNA 1NI3A 2B21A 1ZQDA 2M9NA 5BPCA 1QCKA 1BPEA 3GV8B 5F3XB 3BDPA 2AJQA 1NJYA 4P4PA 3WK7A 3QU7A 2F1HA 4DL6A 5KL1B 1UT5A 2KFZA 3HRDD 4RPXA 2EZYA 5L1KA 1S97A 4NJ8A 4B9LA 4UAWA 5G5HA 1NZBA 2KTQA 1ZQRA 3H0LB 2E1EA 3KHRA 2E3TA 4ECWA 5DQHA 1BPDA 1JROA 2IHMA 4DF4A 2LYAA 4PL1A 3G6XA 4PHAA 2YQEA 4I27A 5KFGA 4XA5A 1PK1B 2IBKA 2UVVA 3HW8A 4TUSA 3IM1A 1N48A 2OXOA 3GDXA 3C1YA 1BPXA 4QZEA 1ZRMA 3QEBZ 3ISBA 3PO5A 7ICQA 3GIIA 3PNCA 1EXNA 1SL1A 3OJUA 8ICIA 2WAQF 2K8BB 2JZBB 1K1SA 3RJFA 3KOOA 1QTMA 4P2HA 4M6WB 5ALOA 1A76A 4YXJA 3Q8MA 4RQ6A 2K4EA 3ED5A 1NK4A 4BJQA 4NLNA 5AM5A 4M9GA 8ICWA 4F5NA 2NV3A 2P66A 4EYIB 4PH5A 4UB2A 1MC8A 4DSEA 4RUAA 2B0CA 5AKKA 5KG6A 3BS5B 2K60A 4F4YA 5AM1A 3KZXA 4JB3A 4Y2PA 9ICWA 2LHTA 4I2HA 4NWIA 3F2DA 2E8PA 5AM4A 5ALUA 3AM9A 8ICHA 2LMRA 1D9DA 2JEGA 4UASA 4MEYA 1JXEA 1L3UA 2KZMA 4FZNA 1XNSA 4CCHA 3CP8A 4MEXA 7ICNA 4P4OA 4GXIA 3N7RC 4J9OA 5AI8A 4IRDA 3C2MA 2BGWA 2W54A 2ZUBA 3MABA 4OJOA 2BKEA 4F92B 5HMLA 3ETRA 4F5OA 3H7IA 3M9MB 5KNIA 5KFXA 3PW5A 5AK3A 4G3IA 2KV2A 5KT4A 4B9TA 4BXOA 2VA3A 2BPGA 3EZ5A 4DS5A 3IN5A 4O3SA 5KFYA 4M9JA 3WKDA 4M9HA 1ZD3A 4RZRA 2HBKA 4WJ3B 2ZTCA 8ICTA 3IG8A 4PGQA 3C5FA 3M6KA 1L7PA 3ALRA 4CNQA 4EZ9A 1XS9D 4PPXA 3MR3A 2QLTA 5KG4A 2BCSA 4RQ8A 4FS2A 3IDWA 4QIWF 9ICUA 4US9A 5KT7A 4PJ0U 4YG2A 3A0BU 4ED2A 4DL2A 4NY8A 3ISCA 2HOIA 4QIWC 5CP2A 4UAVA 1ZQQA 5ALFA 2E5SA 2QARB 3TACB 4NLGA 2KVCA 7ICOA 1L7NA 2DPJA 4Q44A 4PZNA 3WK9A 3TFRA 3RAQA 3SZ2A 1ZQZA 4M0AA 2DQNB 5DQGA 2GH1A 2BCVA 1OXJA 1DGJA 3WKEA 2FLPA 4IC9A 2OYYA 5KFEA 2UVUA 2DKZA 1SKSA 1O08A 4Z6CA 2PFNA 1JIHA 2J6TA 2KJ8A 3RJJA 5ALWA 5KFHA 4Z6FA 2JRZA 3U26A 2LYHA 1QQ6A 3THVA 3AL0B 9ICEA 3BQ7A 2PFQA 1A77A 8ICLA 2JMGA 2W3RA 5JTIA 5J2HA 2LM4A 1L8OA 2WB1F 3T79A 1NK5A 1D8LA 8ICZA 1ED1A 2WFAA 3ZDAA 3OPXA 9ICGA 1ZQXA 4JMUA 5KFRA 1XC9A 4CDGA 4C80A 2FPKA 3NVZA 4ECTA 3BZKA 4RQ5A 3G6VA 4LZGA 2WF6A 1RXVA 1ZQGA 5A0LA 3RJIA 4J9NA 3RH4A 9ICSA 3OTQA 4XQ8A 1ZD2P 3QX7A 5AKEA 3NTUA 4RPYA 1SL0A 8ICRA 1S0NA 1PUZA 2HHWA 2W7OA 4OJ6A 2ISPA 3C1ZA 2KIWA 3NASA 4PL2A 3MGVA 2WF5A 2PMZF 1ZJNA 1B22A 1KSPA 3N97B 4UB5A 3TQ1A 5L1IA 4I2DA 1RDFA 4IR9A 2H3IA 2NRXA 2QB0A 8ICSA 8ICJA 4ELTA 5J2DA 3H8WA 2EANA 8ICFA 3C21A 5L1LA 4J03A 3DV9A 2G5HB 2HOFA 2LI6A 4J9LA 2ASLA 3JPOA 1SXEA 5J0OA 2H3VA 1IIPA 1NK9A 4QWDA 3AQFA 4F72A 4ED3A 4F91B 2WF8A 4DSLA 4JWMA 2Z7JA 1X40A 1ZQPA 3BQ2A 3PY8A 3FM9A 5AKGA 4Y2XA 1DXSA 1ZQOA 5J2EA 2HVHA 4KN7A 5F9NA 3MFIA 2KVSA 5DB6A 2BCQA 9ICPA 1L7MA 1NJWA 1TK0A 5EWGA 1SB3C 4DL7A 2A1JB 3HJEA 3NRZA 3Q8PB 4YMNA 8ICPA 2BQRA 3M8SA 4MFAA 5KFFA 2WTFA 4Y2UA 4F93B 1X66A 2F2AB 2O6KA 2KKPA 3PZPA 4F5QA 3N28A 4TURA 4DQPA 3T5LA 1ZJMA 1DGSA 2K4PA 2KEYA 8ICYA 2DBYA 1RG6A 2IMWP 4RQ0A 3KKAC 1N5XA 2CXYA 5CWRA 4K4HA 2G07A 5E79U 1O03A 5AICA 4CRXA 2L5YA 2BPCA 5G5GA 2F44A 2C2RA 4FS1A 3PW2A 1T4GA 2JH7A 3GZFA 2MRLA 1U9LA 1D8BA 5J0TA 1UT8A 5KFCA 4ECQA 1CI4A 2ES6A 4FZMA 2YB1A 2EDUA 4ED6A 5ALPA 1F0MA 2FMQA 3RF9A 3HPOA 3RTVA 2AH5A 2W9CA 1ZRNA 2GWSA 1V85A 4UB1A 4DOCA 1PVPA 4GLXA 5DG8A 2EAMA 3KHHA 5KAFU 4DSJA 1NOMA 5KFTA 4RQ2A 4TQRA 4MFCA 4IRCA 5AKHA 1SZPA 4ECYA 1KLNA 7ICMA 5EE0A 4KTQA 1ZQBA 4BWJA 5DB7A 1FIQA 5HHIA 2FLNA 1KRPA 4F3OA 4KLIA 3FAHA 5ALNA 1HIWA 4UAUA 1BPYA 2R8KA 3UM9A 1T8EA 3IHQB 5J0XA 9ICNA 3WK4A 2UVRA 5KFOA 3QU2A 2KK0A 3LYSA 1ZQSA 4KLGA 1X9MA 4DFDA 2HHXA 5GTHU 1TV9A 4UB6U 4QW8A 2I5HA 4EBCA 3EW9A 4IR1A 4DL4A 1COKA 4OJ5A 5KFNA 4QWAA 3SI8A 2F3NA 4IS7A 3RB3A 4UQGA 3EYZA 1RXWA 2ZIVB 2YY6A 4CF5A 4EZ6A 4KLTA 1TAMA 4B9UA 1HEKA 2W55A 4YVZA 1SKRA 1ZQYA 3LVVA 2E8MA 1X9SA 2BCUA 3HKZF 1IV8A 1V9PA 3MDAA 1XO1A 2Y9TA 4NV0A 3MR2A 3M7DA 7ICVA 5HR7A 5AHXA 1YT3A 1X2IA 2KIVA 2DKXA 2NRVA 5DKWA 1ZQMA 2FE9A 3CNHA 7ICKA 9ICTA 5KFVA 4BWMA 4I2IA 2MUTA 1SWVA 1F5SA 5EWEA 5KFWA 2IHNA 4RQ4A 5CR0A 4J9KA 9ICBA 2P35A 1HJPA 4KMOB 4I2BA 2KD1A 5CHGA 5HHHA 3GFKB 2W9AA 5KFQA 5AKIA 1TFRA 4C8KA 4IQTA 5AI4A 2ZIUA 1P7DA 4DF8A 3QZ8A 5EE9A 1Z1VA 4EX6A 1B43A 5HR6A 2QB1A 5IILA 2VKQA 2BQUA 4QWEA 3EPIA 4M6WA 3IP4B 5IIJA 3EUB2 3TI0A 4QWCA 2P6RA 1QLNA 3GILA 4DSKA 2R8HA 3CRXA 5AI0A 5ALKA 1B0XA 3H0RB 4DQIA 3FC4A 2KHQA 3QU5A 4YCXA 1ZQJA 3QUBA 3H4DA 4ED7A 2WF7A 2HHTA 2AQ4A 5KT2A 3TANA 1PK3A 3F2CA 2OHFA 1SV4A 2C2DA 3PR5B 7ICPA 9ICRA 5J2CA 4U7CA 1S76D 4RPZA 4UB4A 3T5JA 5DGBA 4US8A 4F50A 3KKAA 4PHEA
chains in the Genus database with same CATH topology
2KMDA 2L5YA 2QB0A 4RQNA 2F44A 2QARB 1OW5A 3TACB 2EANA 1UQVA 2E8MA 3BS5B 2K60A 4PZNA 1SGGA 2QKQA 1WWUA 4PZOA 1SXEA 2Y9UA 3BS5A 2E8PA 2Y9TA 1OXJA 1KW4A 2LMRA 2ES6A 2DL0A 5F3XB 5J8YA 2DKZA 1B4FA 2KIVA 2DKXA 2FE9A 1F0MA 1LKYB 2E8NA 2KE7A 1JI7A 5JRTA 1LKYA 1X40A 1V85A 1X9XA 4NJ8A 2EAMA 1DXSA 3K1RB 4NL9A 3BQ7A 1SV0A 2E8OA 3H8MA 5J8YC 5JTIA 1Z1VA 2QB1A 2B6GA 2LPEA 5KNIA 2F8KA 4RQMA 1WWVA 1SXDA 3SEIA 1PK1B 4NL9C 1PK1A 1B0XA 5JU5A 1SV0C 3SENA 5L1MA 4MHVA 2ESEA 3BS7A 2GLEA 1X66A 1PK3A 2KSOB 1SV4A 1UCVA 2D3DA 3HILA 2QARA 2EAPA 1COKA 2K4PA 2KSOA 1V38A 2D8CA 2KG5A 1RG6A 2JV3A 2EAOA 2YTUA 2F3NA 2QB0B 3IDWA 3KKAC 4IS7A 3TADC 3TADA 3KKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMD A;  2L5Y A;  2QB0 A;  4RQN A;  2F44 A;  2QAR B;  1OW5 A;  3TAC B;  2EAN A;  1UQV A;  2E8M A;  3BS5 B;  2K60 A;  4PZN A;  1SGG A;  2QKQ A;  1WWU A;  4PZO A;  1SXE A;  2Y9U A;  3BS5 A;  2E8P A;  2Y9T A;  1OXJ A;  1KW4 A;  2LMR A;  2ES6 A;  2DL0 A;  5F3X B;  5J8Y A;  2DKZ A;  1B4F A;  2KIV A;  2DKX A;  2FE9 A;  1F0M A;  1LKY B;  2E8N A;  2KE7 A;  1JI7 A;  5JRT A;  1LKY A;  1X40 A;  1V85 A;  1X9X A;  4NJ8 A;  2EAM A;  1DXS A;  3K1R B;  4NL9 A;  3BQ7 A;  1SV0 A;  2E8O A;  3H8M A;  5J8Y C;  5JTI A;  1Z1V A;  2QB1 A;  2B6G A;  2LPE A;  5KNI A;  2F8K A;  4RQM A;  1WWV A;  1SXD A;  3SEI A;  1PK1 B;  4NL9 C;  1PK1 A;  1B0X A;  5JU5 A;  1SV0 C;  3SEN A;  5L1M A;  4MHV A;  2ESE A;  3BS7 A;  2GLE A;  1X66 A;  1PK3 A;  2KSO B;  1SV4 A;  1UCV A;  2D3D A;  3HIL A;  2QAR A;  2EAP A;  1COK A;  2K4P A;  2KSO A;  1V38 A;  2D8C A;  2KG5 A;  1RG6 A;  2JV3 A;  2EAO A;  2YTU A;  2F3N A;  2QB0 B;  3IDW A;  3KKA C;  4IS7 A;  3TAD C;  3TAD A;  3KKA A; 
#chains in the Genus database with same CATH topology
 3PSP A;  3RR7 A;  2W9M A;  3ORY A;  5DDY A;  3ZD9 A;  5AK4 A;  1NK7 A;  1QSL A;  5KT3 A;  2BR0 A;  4GIB A;  3PML A;  3V6J A;  2AQ0 A;  4EBE A;  2VIX A;  3KZI U;  1BNO A;  5AIA A;  2FI1 A;  4YQW A;  2RHF A;  1WCL A;  3ZDE A;  4GFJ A;  4CE6 A;  4XUS A;  4QZD A;  2FMP A;  1K1Q A;  1Z3E B;  2PI4 A;  4DCC A;  1A0P A;  2W3S A;  3KFU F;  1ARO P;  1UA0 A;  3RRH A;  2ZIX A;  3B0Y A;  4Y2R A;  4XRH A;  4KX5 A;  3CW2 C;  4JV1 A;  3TAR A;  2K4H A;  3UXO A;  4JUZ A;  3RAX A;  4JV0 A;  8ICK A;  3WKB A;  5EOZ A;  2VA2 A;  1Z4O A;  4HYK A;  3PO4 A;  1T3N A;  3WU2 U;  5J2F A;  4KLD A;  4RNN A;  1ZQK A;  3NUQ A;  4QZF A;  3UMC A;  3LK9 A;  3H4B A;  1S0M A;  4M2Y A;  4P0P B;  2FJ6 A;  1AQ6 A;  5J0W A;  1S77 D;  5J2I A;  3PV8 A;  2E1F A;  2RDI A;  3ICX A;  3F5E A;  2HHS A;  4YR0 A;  4DFP A;  2CRX A;  4CF4 A;  1JUD A;  7ICF A;  4LZD A;  2QAR A;  4PGY A;  1RZT A;  4O3R A;  2KSO A;  3E2E A;  1T3Q A;  9ICF A;  1A6S A;  2JV3 A;  2EAO A;  1RYS A;  4B6J A;  4PGX A;  1L7O A;  2LM1 A;  9ICQ A;  1D9F A;  4BUG A;  3JPP A;  2A3V A;  2VA8 A;  1KN5 A;  1DRG A;  2YX8 A;  4R66 A;  3PSI A;  1ZQL A;  2R8G A;  5IIN A;  1PZN A;  2ATL A;  4RNO A;  1ZET A;  4PHP A;  7ICT A;  3UXN A;  2YML A;  4UBB A;  5HP4 A;  1T7P A;  1Q8K A;  9ICX A;  1SGG A;  5CA7 A;  1TAQ A;  1N61 A;  1WWU A;  2HCF A;  1TVA A;  4Y2Q A;  4DSF A;  3OHA A;  3O0F A;  3R9K A;  3A0H U;  3RRG A;  5EE3 A;  1RQN A;  1UPH A;  2RP5 A;  4ECX A;  1MA7 A;  3SAG A;  2G09 A;  4USA A;  1LKY A;  4GC6 A;  1SWW A;  1TK8 A;  1L3S A;  3ETL A;  2MSN A;  1XU4 A;  3I1Y A;  1N2X A;  1Z4N A;  1CEZ A;  2K4I A;  3C2K A;  2NYV A;  2DFL A;  1LB2 B;  4KLM A;  4C8M A;  2W8L A;  2J6U A;  4UAZ A;  2W9B B;  2HDO A;  5KFM A;  5DLG A;  4QZH A;  1BNP A;  4KX3 A;  3V7J A;  1PVQ A;  3M1Y A;  2ESE A;  3JPQ A;  3IRU A;  1L3V A;  2YN4 A;  2OWO A;  4MFF A;  4O3P A;  2EAP A;  3E0F A;  2ASJ A;  5AK6 A;  7ICU A;  4O0I A;  3WKC A;  2YMQ A;  1KFS A;  1FFU A;  3C2L A;  4ED1 A;  4FBU A;  4NLB A;  4P0Q A;  1SIJ A;  2KN7 A;  5KG0 A;  5AKY A;  4Q8F A;  2G08 A;  2DWQ A;  5J2K A;  1XSL A;  4DFK A;  2NRZ A;  4CGZ A;  3WK8 A;  3QNM A;  5J0U A;  2A19 A;  5DLF A;  3C23 A;  4RU9 A;  3AN1 A;  4KLL A;  2QKQ A;  3BQ0 A;  4YD2 A;  7ICJ A;  8ICV A;  2KOB A;  4DWI A;  3QUQ A;  2ISO A;  3T3F A;  1JXL A;  5DG7 A;  5DBC A;  5KFB A;  3AMZ A;  4KMU A;  3M6Z A;  3DEE A;  3S6J A;  3Q8L A;  5AI5 A;  2CN1 A;  2A1J A;  3HP6 A;  4JWN A;  2ZIW B;  1ZD5 A;  3Q8S B;  1L8L A;  3N7P D;  4F2S A;  3BQ1 A;  3SV3 A;  4YP3 A;  4DLG A;  3SV4 A;  2DF4 B;  1FO4 A;  3RB6 A;  2KFN A;  2C2E A;  2FMS A;  4J9S A;  5KFJ A;  1WWV A;  3VC8 A;  1ZXI A;  3SEI A;  5AK5 A;  5CEH A;  2KIC A;  7ICI A;  2GOL A;  2JHD A;  3FYH A;  4F5R A;  1VDV A;  2ZUD A;  3BS7 A;  5D4B A;  4ELU A;  3OHB A;  3UQ2 A;  3V6H A;  1KDH A;  4DOA A;  3SYZ A;  1BPB A;  2OH2 A;  2QB0 B;  3TAD C;  4FO6 A;  3PW0 A;  2R18 A;  1K5O A;  3GV5 B;  3LWL A;  5DG9 A;  4J9Q A;  4QZB A;  2DUY A;  4KLE A;  2Q0Z X;  1S9F A;  3PX0 A;  4NLK A;  2JXJ A;  1OW5 A;  1KKX A;  4I28 A;  4BX9 C;  5KFP A;  4IQV A;  4M47 A;  3H0M B;  8ICX A;  3AQE A;  2K89 A;  1D8Y A;  4R65 A;  2Y9U A;  4Y2T A;  1NKE A;  3PST A;  3RR8 A;  3IV6 A;  3MC1 A;  5ALX A;  2UVW A;  2LKY A;  8ICB A;  4C7Y A;  3UMG A;  3IG5 A;  2KE7 A;  5JRT A;  2F76 X;  1Z00 A;  3RH6 A;  1MSW D;  2FDR A;  2G06 A;  3EPG A;  2D6F C;  4UW9 A;  4I2E A;  2R8J A;  3V7K A;  4QZ8 A;  2E8O A;  3H8M A;  3KD3 A;  7ICG A;  4ACO A;  2KZ3 A;  3QU4 A;  4F71 A;  2JR5 A;  5KG3 A;  4UB8 U;  1L3T A;  3NVY A;  3H8S A;  3D2S A;  1ZD4 A;  5ALY A;  3ISD A;  5F9L A;  3WK6 A;  3TAP A;  1DOQ A;  3RJE A;  7ICS A;  4FE3 A;  4ECR A;  4QZG A;  1QSS A;  1C20 A;  1KFD A;  4Y2S A;  9ICI A;  5J0S A;  4QZ9 A;  2ZIV A;  3J81 j;  4ECU A;  2HI0 A;  2F1J A;  3V72 A;  3C29 A;  3OSN A;  2XIC A;  1RM6 C;  5FP0 A;  3K4G A;  3E58 A;  4KIT B;  4NXZ A;  4C7Z A;  3UPQ A;  4C0Z A;  3NVW A;  3GIM A;  5AM2 A;  1SKW A;  4R8U B;  1V97 A;  2ZJA A;  4C4S A;  4AYB C;  4RT2 A;  1ZYQ A;  5ALL A;  3M9N B;  4B9N A;  3BZC A;  1RQL A;  1LV5 A;  7ICR A;  2Y0S C;  1ZQV A;  2BDU A;  9ICH A;  5J0P A;  8ICM A;  2ASD A;  5J2G A;  4ED8 A;  1HUO A;  2XGP A;  3JPR A;  1WCN A;  8ICU A;  1KEJ A;  3T5K A;  2M0N A;  4OJP A;  4UAY A;  1F44 A;  2PKE A;  2JGA A;  2GO7 A;  4J9R A;  1RYR A;  4I2F A;  4C8L A;  5ALJ A;  2N1R A;  5L9X A;  2KNJ A;  1J2M A;  2XI9 A;  5J2B A;  3K1R B;  5IIM A;  1URJ A;  4Q45 A;  1LVH A;  1X6J A;  4NM2 A;  1ZQC A;  4DL5 A;  4ECZ A;  5BOL A;  2XY5 A;  1PVR A;  3TKA A;  4ECS A;  2CPR A;  9ICM A;  5EE1 A;  3ZDC A;  5TIS U;  3SR6 A;  5KT6 A;  2H3Z A;  2V9W A;  3QYP A;  4P4M A;  5BOM A;  5HMM A;  4OD0 A;  7ICH A;  4F4K A;  1CRX A;  4LVS A;  4DSI A;  4E0D A;  3QE9 Y;  1QQ7 A;  1PK1 A;  1ZOL A;  2Y1I A;  5D49 A;  1MQ2 A;  5KFL A;  2XC9 A;  3MR6 A;  4MHV A;  4Y2Y A;  2BPF A;  5HNK A;  9ICJ A;  2IOF K;  3NRW A;  1BVS A;  4RQ7 A;  2D3D A;  1M6Y A;  1JN3 A;  4KLJ A;  1U45 A;  2JZB A;  2AHO B;  4OCZ A;  4R63 A;  4RQ1 A;  4MF2 A;  3I28 A;  2I6X A;  3AUO A;  5JUM A;  3TAD A;  5DB9 A;  3JPN A;  4Y2J A;  4RUC A;  3SAH A;  1NZP A;  3OJS A;  2RLT A;  4G9B A;  7ICL A;  4C8N A;  2W03 A;  3PR4 A;  4UAR A;  4O3N A;  1UQV A;  3F53 A;  3RBD A;  1FEZ A;  2IA6 A;  2ZXI A;  3BJY A;  3M8R A;  3BS5 A;  4I2A A;  2JEF A;  2PFP A;  2DL0 A;  2AGQ A;  2ZXH A;  2MUT B;  5KFK A;  5L1J A;  2HOQ A;  4DQR A;  4RT3 A;  3MDC A;  2E8N A;  2KP7 A;  2W43 A;  3ONN A;  1X9X A;  3AU6 A;  2YB4 A;  2IOF A;  4NL9 A;  4I2J A;  2HBM A;  3PMN A;  2ZIU B;  1Q46 A;  2BCR A;  1SV0 A;  4P0P A;  2ZUC A;  3K1Z A;  4TQS A;  5D46 A;  5IIO A;  4O3O A;  4M9L A;  2B6G A;  2LPE A;  2G5I B;  4JV2 A;  2WAQ C;  2F8K A;  8ICG A;  2KHV A;  2DPI A;  4RQ3 A;  2ZG6 A;  4YN4 A;  1NKC A;  3LVW A;  2FPM A;  3SAF A;  1TK5 A;  1N56 A;  2XY6 A;  3UQ0 A;  1CUK A;  4C4R A;  4QZA A;  3NS1 A;  1U49 A;  1SL2 A;  4DQQ A;  4DQS A;  4IRK A;  5T14 A;  4B9S A;  2LBO A;  1TAU A;  4F8R A;  5AKX A;  4DLE A;  1Q3V A;  3FDS A;  4FZL A;  5III A;  5ALM A;  4TUP A;  1NJZ A;  4MF8 A;  2FPL A;  4K4I A;  1WUD A;  4KLH A;  4OO1 J;  2EQY A;  1N5W A;  5ALI A;  4X5V A;  2F1I A;  2I1Q A;  4O9M A;  2HMX A;  9ICA A;  3L3F X;  1QH9 A;  4QNL A;  5AIB A;  1S0V A;  2HHU A;  5DBA A;  2ZTD A;  3TAQ A;  3UMB A;  5CRX A;  5CB1 A;  4KLS A;  1S0O A;  2XY7 A;  1QSY A;  4U6P A;  4GC7 A;  1UA1 A;  4PHD A;  1KFT A;  3QUC A;  9ICK A;  4O3M A;  3L5K A;  2Y1J A;  3Q8K A;  1KW4 A;  5AKJ A;  3VCB A;  3PW7 A;  5J8Y A;  1MN8 A;  1ZQA A;  5ALV A;  1B4F A;  5H2F U;  2EZX A;  1Z1B A;  2ZIX B;  3SD7 A;  5KFI A;  1L5U A;  2WHE A;  2MU2 A;  1X6I A;  2RRD A;  4J9P A;  4NM1 A;  3G6Y A;  4A8E A;  2W9B A;  2HHV A;  2VJ5 A;  2LYB A;  1ECW A;  4OJL A;  5ALZ A;  1ZQF A;  4YFK A;  3GIK A;  5AKL A;  5ALE A;  1ZQU A;  5J0Y A;  3TFS A;  1U47 A;  1U4B A;  1NNL A;  2K8A A;  3CYM A;  2HVI A;  2H3Q A;  2NO4 A;  1S10 A;  4IQU A;  3OSP A;  3F2B A;  4YXM A;  4HAI A;  5AI6 A;  4EBD A;  4B9V A;  2RQ5 A;  8ICO A;  8ICC A;  2AU0 A;  5JU5 A;  3SEN A;  5L1M A;  3RFA A;  4KLO A;  2PFO A;  2KSO B;  3C28 A;  5EWF A;  3K75 D;  4BXO B;  1DK2 A;  5KFU A;  3V6K A;  1XO0 A;  2D8C A;  2W8K A;  2KG5 A;  3PX6 A;  4UBC A;  3SMV A;  1QQ5 A;  2NRW A;  4EYH B;  3PVX A;  1FFV A;  3GU3 A;  4RQM A;  1Z19 A;  9ICO A;  4KLF A;  2BQ3 A;  1UHU A;  3QUT A;  3JPS A;  4ZOH C;  2H5X A;  3N4M B;  4I2G A;  4Q43 A;  2F77 X;  4EEY A;  5KFD A;  5AI9 A;  2VAN A;  1ZQN A;  3AEV A;  3KHL A;  1OUQ A;  1N62 A;  2AXT U;  1ZQ1 C;  5C5J A;  3OGU A;  5GTI U;  5DGA A;  2KKV A;  5KFS A;  3RB0 A;  3WKA A;  4C8O A;  2OEH A;  5AM3 A;  2ZIW A;  4R64 A;  2AGO A;  3ZDB A;  3HX0 A;  4GXJ A;  3N7S C;  2JEJ A;  1RPL A;  1LKY B;  2R8I A;  2C28 A;  5ALG A;  2WB1 C;  2PXI A;  4QWB A;  2PI5 A;  4J9M A;  4CF3 A;  1IXR A;  3PX4 A;  2NRT A;  1SZH A;  3MGH A;  1T94 A;  2IOH A;  5ALQ A;  8ICE A;  5DB8 A;  1ZQE A;  3GQC A;  3RJK A;  2KZZ A;  4F2R A;  2BZF A;  9ICC A;  1YZ6 A;  1H38 A;  5ALH A;  3ZDD A;  1L6N A;  2G0A A;  4C4T A;  1SXD A;  2FLL A;  1S8O A;  4F4X A;  4FFD A;  2HBL A;  5AKZ A;  4JK1 A;  5DBB A;  3KTQ A;  3ZI4 A;  2PMZ C;  5KL8 B;  3RB4 A;  4ICA A;  3H40 A;  2W04 A;  1KQQ A;  9ICV A;  2F8L A;  3RH5 A;  1JRP A;  4RNM A;  1UCV A;  3MBY A;  2XCA A;  4EX7 A;  3WK5 A;  5KT5 A;  1ZQI A;  1COO A;  1KL9 A;  4Z6D A;  4TUQ A;  4QZI A;  4P0Q B;  3B9J A;  3RBE A;  5KAI U;  2EH9 A;  1JX4 A;  2ALZ A;  1N60 A;  4IQW A;  5KG2 A;  5TZV A;  8ICN A;  4KLU A;  5KFZ A;  1Y88 A;  2VJ4 A;  2V4Q A;  2HW3 A;  4NLC A;  4UB3 A;  4M04 A;  1JMS A;  5B5E U;  3LDA A;  4PZO A;  2YMP A;  4O5K A;  4O3Q A;  1TKD A;  3NVV A;  4QW9 A;  3RJH A;  4FBT A;  2KJ5 A;  3QXG A;  4DS4 A;  3KBB A;  2MA1 A;  1ZQT A;  3NGD A;  8ICQ A;  2XVT A;  1Q3U A;  4DL3 A;  3B0X A;  4K4G A;  3D2Q A;  5J29 A;  1JI7 A;  2W11 A;  1JAL A;  3H8J A;  1VLB A;  5ALR A;  3ZD8 A;  2WF9 A;  2JH1 A;  2H3F A;  2HBJ A;  3PW4 A;  3HWT A;  4YMO A;  5J0R A;  2HHQ A;  1J2N A;  3MR5 A;  3D6J A;  2KJ9 A;  5KG5 A;  1ZQW A;  4ELV A;  3DDH A;  2W7P A;  2XO7 A;  3RJG A;  4O5E A;  1N63 A;  9ICL A;  3QU9 A;  1NKB A;  4I29 A;  7ICE A;  2AGP A;  4NL9 C;  5ALT A;  1SV0 C;  2YMM A;  4R8U A;  3BQT A;  1KTQ A;  2GLE A;  5AM0 A;  3C5G A;  2K8C B;  4LJX A;  4UAT A;  2ZJ5 A;  3GV7 B;  3MFH A;  2P6U A;  3HIL A;  4F4Z A;  4GXK A;  8ICA A;  2MAX A;  1HUZ A;  5ALD A;  2XGQ A;  4IL6 U;  2YTU A;  2BHN A;  5ALS A;  2KMD A;  3HT3 A;  1X9W A;  5DDM A;  1XWL A;  4EEN A;  3T5H A;  2ODG A;  5DQI A;  3L4P A;  5J2J A;  2BDP A;  4F4W A;  4NLZ A;  2OM6 A;  4DO9 A;  4YR3 A;  2JEI A;  5KTQ A;  4Q8E A;  2C22 A;  1RYU A;  4AYB F;  3UXP A;  1NK8 A;  1J97 A;  3AU2 A;  2Y0S F;  5J0Q A;  1NK6 A;  4DFM A;  4O5C A;  1IG6 A;  1Z00 B;  2ZJ8 A;  5K4L A;  1BGX T;  4Z6E A;  3QEA Z;  1KBU A;  4EEK A;  1NK0 A;  2DGZ A;  1ZQH A;  1IM4 A;  4DOB A;  2XID A;  4ED0 A;  5J8Y C;  1WYG A;  1MQ3 A;  2HSZ A;  1XSP A;  2W9C B;  5KFA A;  4KN4 A;  5B66 U;  2NO5 A;  3KHG A;  5KG1 A;  4QZC A;  4EEL A;  1YZ7 A;  4F5P A;  4BGD A;  4DFJ A;  1GO3 F;  2ZTE A;  3LWM A;  5CJ7 A;  5KG7 A;  3MGI A;  1TE2 A;  3PSF A;  2I9G A;  1DK3 A;  4M9N A;  2OCE A;  4Y2V A;  1C7Y A;  4QJF B;  3Q8Q B;  3I76 A;  2A1A A;  1NJX A;  4YR2 A;  3JPT A;  1WG8 A;  1S5L U;  3F5A A;  3M9O B;  2Q4T A;  2RDJ A;  1V38 A;  4ECV A;  3EWA A;  2V4R A;  3HKZ C;  4DEZ A;  4YD1 A;  3Q8R B;  4B9M A;  4ZH4 A;  5J2A A;  1BPZ A;  3GIJ A;  4KLQ A;  2J6S A;  4I2C A;  4AP9 A;  4RQN A;  5IIK A;  1X42 A;  4BDP A;  5C0Y A;  3V7L A;  1U48 A;  3D2N A;  2EZZ A;  4YMM A;  3SQI A;  2XCP A;  1VJ5 A;  3QZ7 A;  1XSN A;  1NI3 A;  2B21 A;  1ZQD A;  2M9N A;  5BPC A;  1QCK A;  1BPE A;  3GV8 B;  5F3X B;  3BDP A;  2AJQ A;  1NJY A;  4P4P A;  3WK7 A;  3QU7 A;  2F1H A;  4DL6 A;  5KL1 B;  1UT5 A;  2KFZ A;  3HRD D;  4RPX A;  2EZY A;  5L1K A;  1S97 A;  4NJ8 A;  4B9L A;  4UAW A;  5G5H A;  1NZB A;  2KTQ A;  1ZQR A;  3H0L B;  2E1E A;  3KHR A;  2E3T A;  4ECW A;  5DQH A;  1BPD A;  1JRO A;  2IHM A;  4DF4 A;  2LYA A;  4PL1 A;  3G6X A;  4PHA A;  2YQE A;  4I27 A;  5KFG A;  4XA5 A;  1PK1 B;  2IBK A;  2UVV A;  3HW8 A;  4TUS A;  3IM1 A;  1N48 A;  2OXO A;  3GDX A;  3C1Y A;  1BPX A;  4QZE A;  1ZRM A;  3QEB Z;  3ISB A;  3PO5 A;  7ICQ A;  3GII A;  3PNC A;  1EXN A;  1SL1 A;  3OJU A;  8ICI A;  2WAQ F;  2K8B B;  2JZB B;  1K1S A;  3RJF A;  3KOO A;  1QTM A;  4P2H A;  4M6W B;  5ALO A;  1A76 A;  4YXJ A;  3Q8M A;  4RQ6 A;  2K4E A;  3ED5 A;  1NK4 A;  4BJQ A;  4NLN A;  5AM5 A;  4M9G A;  8ICW A;  4F5N A;  2NV3 A;  2P66 A;  4EYI B;  4PH5 A;  4UB2 A;  1MC8 A;  4DSE A;  4RUA A;  2B0C A;  5AKK A;  5KG6 A;  3BS5 B;  2K60 A;  4F4Y A;  5AM1 A;  3KZX A;  4JB3 A;  4Y2P A;  9ICW A;  2LHT A;  4I2H A;  4NWI A;  3F2D A;  2E8P A;  5AM4 A;  5ALU A;  3AM9 A;  8ICH A;  2LMR A;  1D9D A;  2JEG A;  4UAS A;  4MEY A;  1JXE A;  1L3U A;  2KZM A;  4FZN A;  1XNS A;  4CCH A;  3CP8 A;  4MEX A;  7ICN A;  4P4O A;  4GXI A;  3N7R C;  4J9O A;  5AI8 A;  4IRD A;  3C2M A;  2BGW A;  2W54 A;  2ZUB A;  3MAB A;  4OJO A;  2BKE A;  4F92 B;  5HML A;  3ETR A;  4F5O A;  3H7I A;  3M9M B;  5KNI A;  5KFX A;  3PW5 A;  5AK3 A;  4G3I A;  2KV2 A;  5KT4 A;  4B9T A;  4BXO A;  2VA3 A;  2BPG A;  3EZ5 A;  4DS5 A;  3IN5 A;  4O3S A;  5KFY A;  4M9J A;  3WKD A;  4M9H A;  1ZD3 A;  4RZR A;  2HBK A;  4WJ3 B;  2ZTC A;  8ICT A;  3IG8 A;  4PGQ A;  3C5F A;  3M6K A;  1L7P A;  3ALR A;  4CNQ A;  4EZ9 A;  1XS9 D;  4PPX A;  3MR3 A;  2QLT A;  5KG4 A;  2BCS A;  4RQ8 A;  4FS2 A;  3IDW A;  4QIW F;  9ICU A;  4US9 A;  5KT7 A;  4PJ0 U;  4YG2 A;  3A0B U;  4ED2 A;  4DL2 A;  4NY8 A;  3ISC A;  2HOI A;  4QIW C;  5CP2 A;  4UAV A;  1ZQQ A;  5ALF A;  2E5S A;  2QAR B;  3TAC B;  4NLG A;  2KVC A;  7ICO A;  1L7N A;  2DPJ A;  4Q44 A;  4PZN A;  3WK9 A;  3TFR A;  3RAQ A;  3SZ2 A;  1ZQZ A;  4M0A A;  2DQN B;  5DQG A;  2GH1 A;  2BCV A;  1OXJ A;  1DGJ A;  3WKE A;  2FLP A;  4IC9 A;  2OYY A;  5KFE A;  2UVU A;  2DKZ A;  1SKS A;  1O08 A;  4Z6C A;  2PFN A;  1JIH A;  2J6T A;  2KJ8 A;  3RJJ A;  5ALW A;  5KFH A;  4Z6F A;  2JRZ A;  3U26 A;  2LYH A;  1QQ6 A;  3THV A;  3AL0 B;  9ICE A;  3BQ7 A;  2PFQ A;  1A77 A;  8ICL A;  2JMG A;  2W3R A;  5JTI A;  5J2H A;  2LM4 A;  1L8O A;  2WB1 F;  3T79 A;  1NK5 A;  1D8L A;  8ICZ A;  1ED1 A;  2WFA A;  3ZDA A;  3OPX A;  9ICG A;  1ZQX A;  4JMU A;  5KFR A;  1XC9 A;  4CDG A;  4C80 A;  2FPK A;  3NVZ A;  4ECT A;  3BZK A;  4RQ5 A;  3G6V A;  4LZG A;  2WF6 A;  1RXV A;  1ZQG A;  5A0L A;  3RJI A;  4J9N A;  3RH4 A;  9ICS A;  3OTQ A;  4XQ8 A;  1ZD2 P;  3QX7 A;  5AKE A;  3NTU A;  4RPY A;  1SL0 A;  8ICR A;  1S0N A;  1PUZ A;  2HHW A;  2W7O A;  4OJ6 A;  2ISP A;  3C1Z A;  2KIW A;  3NAS A;  4PL2 A;  3MGV A;  2WF5 A;  2PMZ F;  1ZJN A;  1B22 A;  1KSP A;  3N97 B;  4UB5 A;  3TQ1 A;  5L1I A;  4I2D A;  1RDF A;  4IR9 A;  2H3I A;  2NRX A;  2QB0 A;  8ICS A;  8ICJ A;  4ELT A;  5J2D A;  3H8W A;  2EAN A;  8ICF A;  3C21 A;  5L1L A;  4J03 A;  3DV9 A;  2G5H B;  2HOF A;  2LI6 A;  4J9L A;  2ASL A;  3JPO A;  1SXE A;  5J0O A;  2H3V A;  1IIP A;  1NK9 A;  4QWD A;  3AQF A;  4F72 A;  4ED3 A;  4F91 B;  2WF8 A;  4DSL A;  4JWM A;  2Z7J A;  1X40 A;  1ZQP A;  3BQ2 A;  3PY8 A;  3FM9 A;  5AKG A;  4Y2X A;  1DXS A;  1ZQO A;  5J2E A;  2HVH A;  4KN7 A;  5F9N A;  3MFI A;  2KVS A;  5DB6 A;  2BCQ A;  9ICP A;  1L7M A;  1NJW A;  1TK0 A;  5EWG A;  1SB3 C;  4DL7 A;  2A1J B;  3HJE A;  3NRZ A;  3Q8P B;  4YMN A;  8ICP A;  2BQR A;  3M8S A;  4MFA A;  5KFF A;  2WTF A;  4Y2U A;  4F93 B;  1X66 A;  2F2A B;  2O6K A;  2KKP A;  3PZP A;  4F5Q A;  3N28 A;  4TUR A;  4DQP A;  3T5L A;  1ZJM A;  1DGS A;  2K4P A;  2KEY A;  8ICY A;  2DBY A;  1RG6 A;  2IMW P;  4RQ0 A;  3KKA C;  1N5X A;  2CXY A;  5CWR A;  4K4H A;  2G07 A;  5E79 U;  1O03 A;  5AIC A;  4CRX A;  2L5Y A;  2BPC A;  5G5G A;  2F44 A;  2C2R A;  4FS1 A;  3PW2 A;  1T4G A;  2JH7 A;  3GZF A;  2MRL A;  1U9L A;  1D8B A;  5J0T A;  1UT8 A;  5KFC A;  4ECQ A;  1CI4 A;  2ES6 A;  4FZM A;  2YB1 A;  2EDU A;  4ED6 A;  5ALP A;  1F0M A;  2FMQ A;  3RF9 A;  3HPO A;  3RTV A;  2AH5 A;  2W9C A;  1ZRN A;  2GWS A;  1V85 A;  4UB1 A;  4DOC A;  1PVP A;  4GLX A;  5DG8 A;  2EAM A;  3KHH A;  5KAF U;  4DSJ A;  1NOM A;  5KFT A;  4RQ2 A;  4TQR A;  4MFC A;  4IRC A;  5AKH A;  1SZP A;  4ECY A;  1KLN A;  7ICM A;  5EE0 A;  4KTQ A;  1ZQB A;  4BWJ A;  5DB7 A;  1FIQ A;  5HHI A;  2FLN A;  1KRP A;  4F3O A;  4KLI A;  3FAH A;  5ALN A;  1HIW A;  4UAU A;  1BPY A;  2R8K A;  3UM9 A;  1T8E A;  3IHQ B;  5J0X A;  9ICN A;  3WK4 A;  2UVR A;  5KFO A;  3QU2 A;  2KK0 A;  3LYS A;  1ZQS A;  4KLG A;  1X9M A;  4DFD A;  2HHX A;  5GTH U;  1TV9 A;  4UB6 U;  4QW8 A;  2I5H A;  4EBC A;  3EW9 A;  4IR1 A;  4DL4 A;  1COK A;  4OJ5 A;  5KFN A;  4QWA A;  3SI8 A;  2F3N A;  4IS7 A;  3RB3 A;  4UQG A;  3EYZ A;  1RXW A;  2ZIV B;  2YY6 A;  4CF5 A;  4EZ6 A;  4KLT A;  1TAM A;  4B9U A;  1HEK A;  2W55 A;  4YVZ A;  1SKR A;  1ZQY A;  3LVV A;  2E8M A;  1X9S A;  2BCU A;  3HKZ F;  1IV8 A;  1V9P A;  3MDA A;  1XO1 A;  2Y9T A;  4NV0 A;  3MR2 A;  3M7D A;  7ICV A;  5HR7 A;  5AHX A;  1YT3 A;  1X2I A;  2KIV A;  2DKX A;  2NRV A;  5DKW A;  1ZQM A;  2FE9 A;  3CNH A;  7ICK A;  9ICT A;  5KFV A;  4BWM A;  4I2I A;  2MUT A;  1SWV A;  1F5S A;  5EWE A;  5KFW A;  2IHN A;  4RQ4 A;  5CR0 A;  4J9K A;  9ICB A;  2P35 A;  1HJP A;  4KMO B;  4I2B A;  2KD1 A;  5CHG A;  5HHH A;  3GFK B;  2W9A A;  5KFQ A;  5AKI A;  1TFR A;  4C8K A;  4IQT A;  5AI4 A;  2ZIU A;  1P7D A;  4DF8 A;  3QZ8 A;  5EE9 A;  1Z1V A;  4EX6 A;  1B43 A;  5HR6 A;  2QB1 A;  5IIL A;  2VKQ A;  2BQU A;  4QWE A;  3EPI A;  4M6W A;  3IP4 B;  5IIJ A;  3EUB 2;  3TI0 A;  4QWC A;  2P6R A;  1QLN A;  3GIL A;  4DSK A;  2R8H A;  3CRX A;  5AI0 A;  5ALK A;  1B0X A;  3H0R B;  4DQI A;  3FC4 A;  2KHQ A;  3QU5 A;  4YCX A;  1ZQJ A;  3QUB A;  3H4D A;  4ED7 A;  2WF7 A;  2HHT A;  2AQ4 A;  5KT2 A;  3TAN A;  1PK3 A;  3F2C A;  2OHF A;  1SV4 A;  2C2D A;  3PR5 B;  7ICP A;  9ICR A;  5J2C A;  4U7C A;  1S76 D;  4RPZ A;  4UB4 A;  3T5J A;  5DGB A;  4US8 A;  4F50 A;  3KKA A;  4PHE A; 
#chains in the Genus database with same CATH homology
 2KMD A;  2L5Y A;  2QB0 A;  4RQN A;  2F44 A;  2QAR B;  1OW5 A;  3TAC B;  2EAN A;  1UQV A;  2E8M A;  3BS5 B;  2K60 A;  4PZN A;  1SGG A;  2QKQ A;  1WWU A;  4PZO A;  1SXE A;  2Y9U A;  3BS5 A;  2E8P A;  2Y9T A;  1OXJ A;  1KW4 A;  2LMR A;  2ES6 A;  2DL0 A;  5F3X B;  5J8Y A;  2DKZ A;  1B4F A;  2KIV A;  2DKX A;  2FE9 A;  1F0M A;  1LKY B;  2E8N A;  2KE7 A;  1JI7 A;  5JRT A;  1LKY A;  1X40 A;  1V85 A;  1X9X A;  4NJ8 A;  2EAM A;  1DXS A;  3K1R B;  4NL9 A;  3BQ7 A;  1SV0 A;  2E8O A;  3H8M A;  5J8Y C;  5JTI A;  1Z1V A;  2QB1 A;  2B6G A;  2LPE A;  5KNI A;  2F8K A;  4RQM A;  1WWV A;  1SXD A;  3SEI A;  1PK1 B;  4NL9 C;  1PK1 A;  1B0X A;  5JU5 A;  1SV0 C;  3SEN A;  5L1M A;  4MHV A;  2ESE A;  3BS7 A;  2GLE A;  1X66 A;  1PK3 A;  2KSO B;  1SV4 A;  1UCV A;  2D3D A;  3HIL A;  2QAR A;  2EAP A;  1COK A;  2K4P A;  2KSO A;  1V38 A;  2D8C A;  2KG5 A;  1RG6 A;  2JV3 A;  2EAO A;  2YTU A;  2F3N A;  2QB0 B;  3IDW A;  3KKA C;  4IS7 A;  3TAD C;  3TAD A;  3KKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...