4MHVA

Crystal structure of the pnt domain of human ets2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
AVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Protein C-ets-2
publication title Crystal structure of the PNT domain of human ETS2
rcsb
source organism Homo sapiens
total genus 30
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4mhvA00
5J8YC 2LMRA 2L5YA 1V85A 1F0MA 2Y9TA 1SXEA 1RG6A 4PZNA 1UQVA 2KE7A 5F3XB 2QARB 2KSOA 4MHVA 5J8YA 2E8MA 1LKYA 1B4FA 1SV4A 1PK1A 2JV3A 3BS5B 3BQ7A 2E8OA 2QB0A 1SGGA 2E8PA 1PK3A 2F3NA 3K1RB 5JRTA 1WWUA 1OXJA 2F8KA 1KW4A 1X9XA 2F44A 4RQMA 1WWVA 4NL9C 2EAOA 1SXDA 4IS7A 1OW5A 2KIVA 3SEIA 2EANA 2D3DA 1COKA 1PK1B 4NL9A 2Y9UA 1B0XA 2E8NA 2LPEA 2QB1A 3BS7A 2DKZA 1Z1VA 4RQNA 2ES6A 2B6GA 2DKXA 1SV0C 2EAPA 2KG5A 3SENA 3KKAC 4PZOA 3TACB 1X66A 2ESEA 2KSOB 1UCVA 2EAMA 3H8MA 4NJ8A 5JU5A 2FE9A 2QARA 2K60A 1LKYB 1SV0A 2D8CA 3IDWA 5L1MA 3TADC 3KKAA 2GLEA 5JTIA 1JI7A 2K4PA 2QB0B 1DXSA 3BS5A 1V38A 2DL0A 2QKQA 5KNIA 2KMDA 1X40A 2YTUA 3HILA 3TADA
chains in the Genus database with same CATH superfamily
1FO4A 4EX7A 5AI9A 2HDOA 3RH5A 4FBTA 2G5IB 4B9LA 3FDSA 3V6KA 5KFAA 5IIIA 3MGIA 3RB3A 2K4EA 2R8KA 2PXIA 3NRZA 1LKYA 2H3ZA 5EOZA 1ZQSA 1RDFA 1QQ5A 3HP6A 3UXPA 3ZDEA 3JPNA 3PV8A 3T5HA 1S0VA 2IHMA 4HYKA 3ZDAA 3PSFA 3NS1A 2H5XA 5ALUA 5A0LA 4Q8FA 5ALKA 5KFCA 4DFJA 4B9MA 2XY6A 4MFCA 4ED2A 1ZYQA 4KLSA 2Q4TA 1OW5A 5AM5A 2BQRA 4FO6A 2ZIXA 7ICSA 3H0LB 4EENA 2AQ4A 3SEIA 5KFDA 1PK1B 3V6JA 4Y2UA 4FBUA 5B5EU 1ZD4A 1WCNA 2M0NA 1D8LA 2BPFA 2QB1A 3WKDA 2V9WA 2FMQA 5ALIA 1PUZA 4FS1A 3E58A 2XCAA 3UXOA 4R8UB 1N61A 4FZLA 1U49A 9ICLA 1ZOLA 2K4IA 2V4RA 1ZQJA 4GC7A 4F4YA 1TAQA 3S6JA 2B21A 3CP8A 2Y0SC 5JTIA 4QWCA 3OSPA 2AJQA 4OCZA 4M2YA 1J2NA 2KJ5A 2KMDA 2E3TA 3NASA 4YFKA 1QSLA 5J8YC 5HNKA 2XI9A 3AU2A 4QZDA 3QNMA 1K5OA 2NO4A 5AKYA 4UB2A 2M9NA 4AP9A 5AKGA 4RQ7A 3B9JA 2GOLA 8ICPA 3PR5B 3AEVA 2I1QA 3Q8RB 2HBKA 9ICFA 4RQ8A 5KFRA 1Z4NA 2IOFK 2WF8A 5EE3A 5J0PA 3GQCA 3J81j 5G5GA 2LYHA 2ZUCA 2W8LA 1U9LA 2MUTB 1Q3VA 5J2KA 1BPZA 7ICLA 4KN7A 2OWOA 4YXMA 3V7KA 1ZQDA 1K1SA 1NKCA 5G5HA 2KJ8A 3CRXA 1DGJA 1O03A 5H2FU 3QUCA 3A0BU 1KFDA 2BCVA 4QWAA 1X9SA 2W9CB 5IIKA 1SKRA 2KD1A 1SL2A 1T3NA 2H3IA 5ALTA 1NJWA 3ED5A 3FAHA 3N7PD 1XO0A 5CHGA 1RQNA 1ZQCA 4F92B 2UVWA 3GV5B 2BCQA 1LB2B 8ICOA 4UQGA 4M9NA 1EXNA 1ZQKA 3TADC 1KEJA 4M9JA 3TAPA 1RM6C 4EELA 4Y2TA 4UARA 1V38A 5KNIA 2BKEA 3F5AA 4KLFA 3HILA 1C7YA 2XVTA 2KZZA 4ECSA 3KHGA 1ZQMA 5KT3A 5TZVA 4C8MA 4R8UA 4PZNA 1X6IA 3VCBA 1BPDA 2K8AA 1TAMA 4QIWF 4MHVA 2FI1A 4O3MA 9ICMA 1WYGA 2F76X 4P0QB 2NRTA 2FJ6A 3Q8QB 4ZH4A 1TAUA 4YMMA 3BS5B 4KLQA 5KFQA 1SZHA 2EQYA 1TFRA 1Y88A 5KG7A 3KHLA 3WKEA 5CEHA 4F5RA 5KL8B 1BVSA 4DL2A 4RUCA 1T7PA 2PMZC 4Z6DA 2EAOA 2BPGA 7ICVA 4XRHA 5KG6A 2KKPA 2ISOA 4F50A 3LK9A 3BZKA 4ED3A 4RNNA 2C2RA 2Y9UA 3GFKB 4IRKA 2P6UA 2R18A 2HSZA 3ISCA 1S0OA 2WF6A 3NVWA 2W7OA 2R8IA 4YQWA 2JXJA 4F3OA 4M0AA 4IC9A 4DSLA 3HKZF 4DL5A 4R63A 1X66A 2JZBB 3N4MB 3H8MA 4C8KA 4BWMA 3T79A 1ZQTA 3AQEA 1YZ6A 9ICJA 5ALSA 3AUOA 3QXGA 1JI7A 3EPIA 2I9GA 3NVVA 2EH9A 5AHXA 9ICNA 1ZXIA 3KZXA 7ICFA 4AYBF 4CF5A 2W9CA 4J9QA 1IIPA 3UQ0A 3AU6A 1ZQQA 4NLZA 2KN7A 3QEBZ 4EBCA 3T3FA 4B9VA 3RBDA 2HOIA 3SAGA 2ALZA 4QJFB 4QZGA 5AICA 2E8MA 3KHRA 5J2DA 1N2XA 3JPOA 3PW4A 5F9NA 2ZG6A 1X2IA 3Q8PB 1MQ2A 4TUSA 2A19A 3KBBA 2ISPA 2F3NA 3QU7A 2F44A 5HR6A 5J29A 1Z00B 4TUPA 3IHQB 3M9MB 1C20A 1BNPA 3LYSA 1VLBA 3PNCA 2RHFA 1S10A 2GO7A 3ZDCA 1ZQPA 2D6FC 4CGZA 5DG9A 4P0QA 1L5UA 1QH9A 4RQNA 5KFGA 2DPIA 5AM2A 1JUDA 2RDJA 1AROP 1HIWA 4G3IA 2MAXA 4PZOA 4UB3A 9ICCA 2JEIA 4DL3A 4RQ0A 5KG3A 3O0FA 2XCPA 2QARA 2FLPA 4ELTA 2P35A 4PH5A 1J2MA 2OH2A 5AM3A 2K4PA 2JH7A 5AI4A 7ICIA 4GIBA 1Z3EB 2DPJA 5KL1B 2QKQA 1X40A 4RPXA 3MGVA 2KVCA 4OJ5A 5DKWA 2JGAA 2H3VA 4RNOA 4PHAA 3KZIU 3H8SA 3HKZC 2W3SA 2XGQA 4DCCA 3C1YA 1XU4A 4XQ8A 8ICWA 2KZMA 2JZBA 2ZIVB 2ZIUB 1JX4A 1UT5A 5D46A 4RT2A 1RZTA 2JMGA 1FFUA 1B4FA 3C23A 3RJFA 1A76A 4QWEA 1ZD2P 2JV3A 2XY7A 2KV2A 3RFAA 3A0HU 2CPRA 4O3OA 4IQWA 1SGGA 2MA1A 3KFUF 2PFOA 9ICHA 2A1AA 1X9WA 1NK4A 5L1JA 1KDHA 4DFPA 1X9XA 3IM1A 1A6SA 5DB7A 1TK0A 3IRUA 2ASJA 4ECRA 4RNMA 1WCLA 4KLLA 2DQNB 5ALZA 5ALPA 2BDUA 3BJYA 4QZ8A 4UB5A 4NL9A 2VANA 1DRGA 5KFBA 1QTMA 4P4OA 4LJXA 2BCUA 2A3VA 1MC8A 4DEZA 4HAIA 4DQIA 3GV8B 4O0IA 1L3TA 1L6NA 3V7LA 3EPGA 8ICBA 9ICWA 3GDXA 1NK6A 1N48A 3KTQA 4C80A 4NJ8A 3RB4A 3IG5A 4TQSA 1T4GA 3MR2A 5F9LA 1Z00A 7ICPA 4Q8EA 3KKAA 4FFDA 2WTFA 4WJ3B 2RRDA 5J2CA 8ICUA 3DV9A 9ICSA 9ICUA 3GZFA 3IV6A 2BR0A 1V9PA 5TISU 3RTVA 1CUKA 2HBMA 3F5EA 2LKYA 5T14A 3HWTA 2G09A 4O3SA 4BX9C 4NLNA 1ZQZA 4K4IA 2AU0A 3SR6A 5BPCA 2KEYA 3K75D 1L3VA 2HOFA 4NLCA 1X6JA 2CN1A 2E1FA 3ZD8A 1XSLA 1BPYA 5ALEA 2OEHA 1F5SA 2PI4A 4RQ1A 4F5OA 4R66A 4YR0A 1QLNA 4DFKA 1ZJNA 4MFFA 1S0MA 8ICTA 1OXJA 4C4RA 4I2HA 2KTQA 4KLGA 1WWVA 2KP7A 1H38A 5J2AA 9ICPA 1X9MA 2WB1C 5KG2A 4O5CA 4A8EA 1JRPA 3R9KA 3ETRA 5KFXA 3MBYA 4QZHA 1FEZA 5AK4A 2ZIVA 2ZIUA 1N5XA 5ALNA 2I6XA 4YP3A 4KLIA 1TK5A 7ICUA 4B9UA 7ICOA 8ICLA 1Q3UA 2RP5A 3NUQA 2B0CA 3QUQA 2MRLA 5HHIA 1ZD5A 5AI5A 4M47A 1ZD3A 4PHDA 2LYBA 1QCKA 1XSNA 2KHQA 1COOA 1KQQA 4FZNA 1AQ6A 4NV0A 5AK6A 5D4BA 3ONNA 2Y1IA 5J0SA 2K89A 8ICVA 2I5HA 1ZQGA 2VKQA 5GTHU 2QLTA 4F5QA 5EE0A 4JMUA 1UPHA 2YTUA 5ALJA 2J6UA 1WG8A 2W9BA 4GXKA 4YR3A 3RJKA 5KG1A 2W7PA 1NZBA 1ZQ1C 1GO3F 8ICIA 5KTQA 1SXEA 2Y1JA 3WK8A 2IA6A 8ICGA 9ICQA 4MFAA 4RPYA 4C8OA 1ZQVA 4QZEA 3BQ2A 1NI3A 5J8YA 1U4BA 2O6KA 4KMOB 4NLBA 4CNQA 9ICRA 4M9GA 2OXOA 1D8BA 4KITB 5K4LA 1Z4OA 4F72A 4F4KA 2VA8A 1NK7A 2FPMA 5HR7A 3ZI4A 7ICGA 4LZGA 4DS4A 2W54A 1J97A 3M1YA 1WWUA 5AM0A 2JEJA 3D2QA 3N7SC 4IS7A 4DSFA 5DQHA 2AH5A 3GIKA 4F4ZA 4ECXA 3C5FA 3IN5A 3ZD9A 4DL4A 5ALMA 4Y2SA 5E79U 1ZQOA 4PGYA 3D2NA 3SQIA 3SV3A 3OJSA 3M7DA 4YG2A 4EYIB 1ZQHA 4EX6A 3H8WA 8ICQA 5CB1A 2PI5A 2K60A 3UM9A 5KAIU 2FMPA 3RJHA 2HHXA 3JPQA 2UVRA 2GWSA 2GLEA 5DB8A 5KFEA 3G6XA 1BNOA 4ECVA 2BPCA 4QZFA 3PY8A 1NJYA 3G6YA 3ISBA 2MU2A 3TADA 5ALRA 1D9FA 2ZIWB 3HX0A 2J6SA 4DQSA 4P4PA 2OCEA 3UPQA 4DF8A 1B22A 4ECUA 4MEYA 4IRCA 4G9BA 4E0DA 2LBOA 4NWIA 4QW8A 2GH1A 2HVIA 4QZBA 2NYVA 2IOFA 5DQGA 2F1IA 1LVHA 2W11A 3SI8A 1TE2A 3H0MB 1N56A 3WKBA 4KTQA 2W43A 1SV4A 1ZQRA 1L3UA 9ICTA 5DGBA 1PK1A 3C2KA 1ZQEA 2ZTDA 4GC6A 4F71A 4Y2QA 4RQ4A 1ZQAA 4YN4A 2JEFA 1PK3A 4I27A 2NO5A 4J9RA 4QZAA 1KKXA 3SAHA 2XY5A 3V6HA 1CI4A 3LVWA 1D8YA 4YD2A 4BUGA 9ICKA 5DG8A 4I2GA 2IHNA 2KIVA 2RQ5A 4Q44A 4KLJA 1COKA 3E0FA 5KFTA 3L5KA 2KKVA 2HHWA 4LZDA 3GILA 1OUQA 4O3RA 3SMVA 3AQFA 3THVA 4BJQA 3K4GA 2H3QA 2IBKA 4I2CA 3H8JA 3EYZA 2G06A 3H7IA 2HHVA 4MF2A 1A0PA 4DWIA 4DQQA 4M6WB 3T5KA 2EAMA 7ICEA 3QEAZ 3LDAA 4JUZA 4C8LA 7ICHA 4QZCA 4R65A 2JEGA 2WFAA 4NXZA 2QB0B 4J9OA 1KBUA 2C28A 3TAQA 4EZ9A 3HRDD 2UVVA 4JK1A 3OSNA 4IR1A 2ZJ5A 2DUYA 4US9A 3RB6A 3PSTA 4I2DA 4UAVA 2EZXA 3ZDBA 3GU3A 2HOQA 4YR2A 2DGZA 2MUTA 5EE9A 3PX6A 1UA1A 1BGXT 1X42A 2KE7A 3WKCA 2LI6A 4KLEA 2UVUA 3LWMA 4Z6FA 7ICRA 1L7PA 1SWWA 3NVYA 3TFRA 3PSPA 2NRWA 1UA0A 1TV9A 9ICGA 1IV8A 5L9XA 4B9NA 2AHOB 5JRTA 1NZPA 8ICMA 4JV2A 4PJ0U 1ZJMA 3QX7A 4P4MA 2E1EA 2RLTA 2KJ9A 2ZIWA 3K1ZA 2W04A 3I1YA 2NRZA 5DQIA 4JV0A 4GXJA 5AKKA 1N62A 2WAQF 4DFDA 1DGSA 5GTIU 4ED6A 3AN1A 4IQVA 2KIWA 1PVPA 1HUZA 8ICXA 2EANA 4PGQA 1SB3C 1BPBA 4OO1J 4ECTA 1BPXA 3TANA 2PFNA 4DO9A 2E8NA 2P66A 3ICXA 3NTUA 2WHEA 2W55A 5EWEA 5AM4A 4BWJA 3T5JA 5FP0A 2MSNA 4F2SA 3RJEA 1TKDA 4DSIA 5EE1A 7ICJA 2YN4A 3M8SA 4QIWC 4QW9A 4CF4A 5JU5A 3QUBA 4KX5A 2G07A 5EWFA 1ZQLA 2HW3A 5IILA 5AK5A 3PMNA 5DLFA 3L4PA 2LYAA 1ZQNA 9ICIA 5ALXA 3UQ2A 5KFIA 1DXSA 3BS5A 1NK0A 4IR9A 2KHVA 3C2LA 4YD1A 3QE9Y 3I28A 2BDPA 5KFLA 5KFKA 5J0UA 1NK8A 4GFJA 4I2AA 4I2FA 1DK2A 4RU9A 2VA2A 2AGPA 4B6JA 4M6WA 4UBBA 3BQ1A 1D9DA 4PGXA 4ECQA 4JWNA 5KFZA 5KT6A 5J0OA 1ZRMA 3BQ7A 2NRXA 4YXJA 5L1LA 2W8KA 2QB0A 5DG7A 3OHAA 1RXVA 1CEZA 3Q8SB 2YMMA 2W9AA 1ZQFA 4PPXA 3BQ0A 4Z6EA 3C29A 4I28A 1JXEA 3PX4A 4UASA 9ICAA 1L7NA 1KFSA 1JXLA 4OJOA 1O08A 4ELVA 2C22A 1U48A 2K8BB 2FPLA 5J2EA 5KFUA 3H0RB 4Y2RA 4CCHA 4AYBC 1RYSA 2F1HA 4Y2JA 3GIJA 5J2FA 2LHTA 2HBLA 3RBEA 3BS7A 2DKZA 1Z1VA 4UB8U 4O5EA 4FS2A 1RPLA 3PSIA 4O3NA 2DKXA 4UB4A 3GV7B 3SENA 2BQ3A 2ESEA 3SV4A 1FFVA 9ICEA 4RPZA 3C1ZA 3V7JA 1T94A 1JROA 4EEKA 2ZIXB 5DB6A 5ALLA 5J0XA 1FIQA 2EDUA 5L1IA 3DDHA 3MR6A 4J9SA 4KN4A 3EWAA 5J0RA 2YB1A 1TVAA 2VJ4A 4TUQA 5CWRA 4M9LA 4M9HA 5DBBA 3OJUA 3SYZA 1MQ3A 4GXIA 3F2CA 5KFNA 1PVRA 4RQ5A 2OYYA 3BQTA 3CYMA 4J03A 3AMZA 4DF4A 4BDPA 5ALDA 1QQ7A 2Y0SF 2JH1A 2JHDA 2JR5A 3IG8A 4C7YA 8ICRA 4PHEA 2LM1A 4J9MA 1V97A 5AKXA 4DOCA 5AK3A 4PL1A 1KRPA 1BPEA 2HHSA 2YX8A 3TKAA 2YMLA 4Y2YA 2R8JA 4UAYA 3MFIA 4PHPA 3Q8MA 2D3DA 5KFWA 2R8GA 4K4GA 5BOLA 3KD3A 2HHUA 3OTQA 1B0XA 4CF3A 4UAZA 2NV3A 4US8A 1SV0C 2YQEA 5KFJA 1N63A 5IIMA 4UW9A 4F2RA 3DEEA 2WF9A 3RJJA 4U6PA 4ED1A 4J9KA 5KFYA 1UCVA 4QZ9A 1S97A 3BZCA 5J2GA 4ICAA 3JPSA 5L1MA 5JUMA 5KFOA 2G5HB 3TFSA 1L7MA 4DS5A 3SD7A 4K4HA 1NJXA 4RZRA 2IOHA 3FC4A 4DOBA 1S77D 1PVQA 3D6JA 3H4DA 3QZ8A 3OHBA 4IQUA 5ALYA 2AGOA 1U47A 4QNLA 2H3FA 2LMRA 5AM1A 1L8LA 1SL0A 2VA3A 5HP4A 1V85A 1KSPA 1RG6A 3WKAA 1KFTA 2G0AA 3QYPA 1UQVA 1SL1A 3PX0A 2VIXA 1DOQA 4O5KA 3HW8A 4KLMA 2W9MA 4B9SA 4RUAA 4JWMA 3QU2A 2FDRA 4NM2A 2NRVA 5ALGA 2E5SA 4I2JA 1RYRA 9ICVA 5ALVA 2F8KA 1KW4A 5KAFU 5HMLA 2EZZA 3N97B 4I2BA 2ODGA 8ICHA 3HJEA 5J2IA 5DDYA 3M6KA 4F8RA 4NY8A 3IP4B 3JPPA 1B43A 4O9MA 2HI0A 5IIOA 4P0PB 4EBDA 2C2EA 3F53A 1NKBA 3MR5A 5HMMA 1K1QA 2F77X 3RR7A 2XO7A 2F1JA 2K4HA 1QQ6A 2B6GA 4JV1A 4KLDA 5AKEA 4F91B 3G6VA 3RR8A 2OHFA 1U45A 3C28A 3HPOA 3RH6A 3F2DA 3IDWA 1XSPA 3CW2C 5ALOA 2PMZF 7ICQA 1NK9A 4BXOB 3M9OB 1WUDA 3MDAA 2EZYA 2WF7A 2PKEA 5KFVA 1XC9A 9ICXA 1ECWA 4U7CA 2HVHA 4F5PA 4MEXA 2A1JB 4UAWA 8ICEA 2YB4A 1KN5A 1S8OA 2Y9TA 1NNLA 4DQRA 3MC1A 5EWGA 1XO1A 2BCSA 3QU4A 5KFMA 3PW0A 5F3XB 2P6RA 1M6YA 1MN8A 3WU2U 4DFMA 8ICJA 2G08A 3QU5A 3Q8KA 2CRXA 3PR4A 1HEKA 5B66U 3GIIA 4C4TA 5J2JA 3UMGA 3H40A 3TARA 2KK0A 3ALRA 3K1RB 4ED8A 5AKLA 3BDPA 4Y2VA 3ZDDA 2BQUA 2CXYA 4OJLA 1SKWA 1DK3A 4F5NA 2KNJA 4C4SA 1SWVA 4Q45A 5DGAA 2W3RA 3PW7A 4KLHA 2RDIA 1SKSA 2FLLA 3TQ1A 2DFLA 1ZQBA 1Z1BA 1T8EA 1URJA 1ED1A 3ISDA 2XC9A 3OPXA 4USAA 3E2EA 2ES6A 2PFPA 3UMCA 5DLGA 4O3PA 4B9TA 2EAPA 5DBCA 4X5VA 1S9FA 1Z19A 5J0TA 1L8OA 3B0YA 2F2AB 3EZ5A 3C2MA 2D8CA 4BGDA 1KL9A 4DLGA 2WF5A 2BCRA 5C0YA 1N60A 1P7DA 2IMWP 4IQTA 3UXNA 4RQ6A 4P0PA 2DBYA 4P2HA 2HHQA 4M04A 4NLKA 5IIJA 1NK5A 1SIJA 4RT3A 3FYHA 4Q43A 1F0MA 2JRZA 2YMPA 4O3QA 1HJPA 1JMSA 3M6ZA 2KICA 3EUB2 4J9LA 2QARB 5KFSA 4OJPA 1RQLA 5ALFA 9ICBA 2BGWA 4Y2PA 3RRGA 8ICCA 4TURA 3UMBA 4RQ3A 2XGPA 3WK7A 3JPTA 4KX3A 1L7OA 4J9PA 4DL6A 5KFHA 1ZETA 4CE6A 3AL0B 4BXOA 2YMQA 2E8PA 3WK5A 4DL7A 4EZ6A 3M8RA 3PZPA 5BOMA 3SAFA 2XICA 4UBCA 4KLUA 3QU9A 2ZJAA 1XNSA 4Z6CA 1XWLA 5J0YA 3NVZA 2A1JA 3Q8LA 4RQMA 1S0NA 2ZTEA 5L1KA 4ELUA 1SXDA 3KHHA 2KFNA 8ICNA 2W03A 3NRWA 3V72A 1A77A 5AIAA 3WK4A 3RB0A 2ASDA 3MDCA 3LWLA 5AKZA 4EYHB 1VJ5A 2KZ3A 4ACOA 5DBAA 4LVSA 3RF9A 3PVXA 4QWDA 2FPKA 5AI8A 4ECYA 3ETLA 4ECWA 5CA7A 2KOBA 3RH4A 4ED7A 2KG5A 3QUTA 2VJ5A 1VDVA 2KSOB 4EEYA 2KVSA 3AM9A 2FE9A 7ICKA 4CDGA 5KG0A 1NOMA 4DSKA 4OJ6A 4UATA 2ATLA 5AI0A 2HCFA 4YMOA 5KT2A 2ZUBA 2DF4B 2BZFA 1KTQA 4JB3A 2HBJA 4DSEA 3F2BA 2ZUDA 5AIBA 5DDMA 4IL6U 1S76D 4RQ2A 5AKJA 3T5LA 3MABA 3N7RC 2L5YA 4CRXA 9ICOA 3GIMA 3C21A 5C5JA 4ED0A 4YMNA 5KFPA 1F44A 2KFZA 5AKHA 1HUOA 5KG5A 8ICZA 1ZQIA 4Y2XA 4UB6U 4YCXA 2ZXIA 4OD0A 3PO5A 3TI0A 1KLNA 2J6TA 5KG4A 4ECZA 4C7ZA 8ICKA 2Z7JA 1L3SA 5ALWA 1N5WA 2DWQA 3C5GA 7ICMA 4C0ZA 8ICYA 4QZIA 3OGUA 4IRDA 4FZMA 3D2SA 3PMLA 5CJ7A 3EW9A 3FM9A 2OM6A 5IINA 4F4WA 1Q46A 4DOAA 4F4XA 1CRXA 4YVZA 7ICTA 5DB9A 1NJZA 1IM4A 7ICNA 4DQPA 4I2IA 4NM1A 1ZQWA 1ZQUA 1PZNA 3KOOA 3VC8A 3U26A 1T3QA 3MGHA 3PW2A 4DSJA 4F93B 1JIHA 1MSWD 2K8CB 2BHNA 1UHUA 1IXRA 2F8LA 5ALQA 4FE3A 5KT5A 4KLTA 1ZRNA 4MF8A 3M9NB 8ICFA 2YY6A 1YZ7A 3MFHA 5CRXA 1LKYB 1ZQXA 2R8HA 3RRHA 1QSSA 3N28A 5J0WA 2WB1F 4TQRA 3HT3A 3PW5A 5ALHA 2ASLA 1S5LU 2DL0A 3CNHA 3SZ2A 5AI6A 3I76A 3H4BA 4DLEA 5CR0A 3RAXA 2WAQC 2FLNA 1XS9D 4NLGA 4XA5A 4J9NA 3NGDA 5KT7A 2KSOA 3RJIA 5J2HA 1TK8A 1UT8A 1NKEA 1Q8KA 3ORYA 3MR3A 3RJGA 3WK9A 4KLOA 4R64A 2ZJ8A 3B0XA 4QWBA 2E8OA 5D49A 2AXTU 1RYUA 2Q0ZX 4XUSA 2LM4A 8ICAA 1ZQYA 2W9BB 4EBEA 3RAQA 5AKIA 4I2EA 1YT3A 3L3FX 4ZOHC 4NL9C 2AQ0A 2N1RA 4KMUA 1QSYA 3PO4A 2FMSA 4I29A 2C2DA 1RXWA 4C8NA 1SZPA 2XIDA 2LPEA 5HHHA 4PL2A 3KKAC 3WK6A 1JALA 2ZTCA 5J0QA 3QZ7A 3TACB 8ICSA 2V4QA 5CP2A 2HHTA 1JN3A 5KT4A 2HMXA 1SV0A 1IG6A 3JPRA 1LV5A 2PFQA 4UAUA 3LVVA 2AGQA 2ZXHA 4UB1A 5KFFA 5J2BA 1MA7A 4GLXA
chains in the Genus database with same CATH topology
5J8YC 2LMRA 2L5YA 1V85A 1F0MA 2Y9TA 1SXEA 1RG6A 4PZNA 1UQVA 2KE7A 5F3XB 2QARB 2KSOA 4MHVA 5J8YA 2E8MA 1LKYA 1B4FA 1SV4A 1PK1A 2JV3A 3BS5B 3BQ7A 2E8OA 2QB0A 1SGGA 2E8PA 1PK3A 2F3NA 3K1RB 5JRTA 1WWUA 1OXJA 2F8KA 1KW4A 1X9XA 2F44A 4RQMA 1WWVA 4NL9C 2EAOA 1SXDA 4IS7A 1OW5A 2KIVA 3SEIA 2EANA 2D3DA 1COKA 1PK1B 4NL9A 2Y9UA 1B0XA 2E8NA 2LPEA 2QB1A 3BS7A 2DKZA 1Z1VA 4RQNA 2ES6A 2B6GA 2DKXA 1SV0C 2EAPA 2KG5A 3SENA 3KKAC 4PZOA 3TACB 1X66A 2ESEA 2KSOB 1UCVA 2EAMA 3H8MA 4NJ8A 5JU5A 2FE9A 2QARA 2K60A 1LKYB 1SV0A 2D8CA 3IDWA 5L1MA 3TADC 3KKAA 2GLEA 5JTIA 1JI7A 2K4PA 2QB0B 1DXSA 3BS5A 1V38A 2DL0A 2QKQA 5KNIA 2KMDA 1X40A 2YTUA 3HILA 3TADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8Y C;  2LMR A;  2L5Y A;  1V85 A;  1F0M A;  2Y9T A;  1SXE A;  1RG6 A;  4PZN A;  1UQV A;  2KE7 A;  5F3X B;  2QAR B;  2KSO A;  4MHV A;  5J8Y A;  2E8M A;  1LKY A;  1B4F A;  1SV4 A;  1PK1 A;  2JV3 A;  3BS5 B;  3BQ7 A;  2E8O A;  2QB0 A;  1SGG A;  2E8P A;  1PK3 A;  2F3N A;  3K1R B;  5JRT A;  1WWU A;  1OXJ A;  2F8K A;  1KW4 A;  1X9X A;  2F44 A;  4RQM A;  1WWV A;  4NL9 C;  2EAO A;  1SXD A;  4IS7 A;  1OW5 A;  2KIV A;  3SEI A;  2EAN A;  2D3D A;  1COK A;  1PK1 B;  4NL9 A;  2Y9U A;  1B0X A;  2E8N A;  2LPE A;  2QB1 A;  3BS7 A;  2DKZ A;  1Z1V A;  4RQN A;  2ES6 A;  2B6G A;  2DKX A;  1SV0 C;  2EAP A;  2KG5 A;  3SEN A;  3KKA C;  4PZO A;  3TAC B;  1X66 A;  2ESE A;  2KSO B;  1UCV A;  2EAM A;  3H8M A;  4NJ8 A;  5JU5 A;  2FE9 A;  2QAR A;  2K60 A;  1LKY B;  1SV0 A;  2D8C A;  3IDW A;  5L1M A;  3TAD C;  3KKA A;  2GLE A;  5JTI A;  1JI7 A;  2K4P A;  2QB0 B;  1DXS A;  3BS5 A;  1V38 A;  2DL0 A;  2QKQ A;  5KNI A;  2KMD A;  1X40 A;  2YTU A;  3HIL A;  3TAD A; 
#chains in the Genus database with same CATH topology
 1FO4 A;  4EX7 A;  5AI9 A;  2HDO A;  3RH5 A;  4FBT A;  2G5I B;  4B9L A;  3FDS A;  3V6K A;  5KFA A;  5III A;  3MGI A;  3RB3 A;  2K4E A;  2R8K A;  2PXI A;  3NRZ A;  1LKY A;  2H3Z A;  5EOZ A;  1ZQS A;  1RDF A;  1QQ5 A;  3HP6 A;  3UXP A;  3ZDE A;  3JPN A;  3PV8 A;  3T5H A;  1S0V A;  2IHM A;  4HYK A;  3ZDA A;  3PSF A;  3NS1 A;  2H5X A;  5ALU A;  5A0L A;  4Q8F A;  5ALK A;  5KFC A;  4DFJ A;  4B9M A;  2XY6 A;  4MFC A;  4ED2 A;  1ZYQ A;  4KLS A;  2Q4T A;  1OW5 A;  5AM5 A;  2BQR A;  4FO6 A;  2ZIX A;  7ICS A;  3H0L B;  4EEN A;  2AQ4 A;  3SEI A;  5KFD A;  1PK1 B;  3V6J A;  4Y2U A;  4FBU A;  5B5E U;  1ZD4 A;  1WCN A;  2M0N A;  1D8L A;  2BPF A;  2QB1 A;  3WKD A;  2V9W A;  2FMQ A;  5ALI A;  1PUZ A;  4FS1 A;  3E58 A;  2XCA A;  3UXO A;  4R8U B;  1N61 A;  4FZL A;  1U49 A;  9ICL A;  1ZOL A;  2K4I A;  2V4R A;  1ZQJ A;  4GC7 A;  4F4Y A;  1TAQ A;  3S6J A;  2B21 A;  3CP8 A;  2Y0S C;  5JTI A;  4QWC A;  3OSP A;  2AJQ A;  4OCZ A;  4M2Y A;  1J2N A;  2KJ5 A;  2KMD A;  2E3T A;  3NAS A;  4YFK A;  1QSL A;  5J8Y C;  5HNK A;  2XI9 A;  3AU2 A;  4QZD A;  3QNM A;  1K5O A;  2NO4 A;  5AKY A;  4UB2 A;  2M9N A;  4AP9 A;  5AKG A;  4RQ7 A;  3B9J A;  2GOL A;  8ICP A;  3PR5 B;  3AEV A;  2I1Q A;  3Q8R B;  2HBK A;  9ICF A;  4RQ8 A;  5KFR A;  1Z4N A;  2IOF K;  2WF8 A;  5EE3 A;  5J0P A;  3GQC A;  3J81 j;  5G5G A;  2LYH A;  2ZUC A;  2W8L A;  1U9L A;  2MUT B;  1Q3V A;  5J2K A;  1BPZ A;  7ICL A;  4KN7 A;  2OWO A;  4YXM A;  3V7K A;  1ZQD A;  1K1S A;  1NKC A;  5G5H A;  2KJ8 A;  3CRX A;  1DGJ A;  1O03 A;  5H2F U;  3QUC A;  3A0B U;  1KFD A;  2BCV A;  4QWA A;  1X9S A;  2W9C B;  5IIK A;  1SKR A;  2KD1 A;  1SL2 A;  1T3N A;  2H3I A;  5ALT A;  1NJW A;  3ED5 A;  3FAH A;  3N7P D;  1XO0 A;  5CHG A;  1RQN A;  1ZQC A;  4F92 B;  2UVW A;  3GV5 B;  2BCQ A;  1LB2 B;  8ICO A;  4UQG A;  4M9N A;  1EXN A;  1ZQK A;  3TAD C;  1KEJ A;  4M9J A;  3TAP A;  1RM6 C;  4EEL A;  4Y2T A;  4UAR A;  1V38 A;  5KNI A;  2BKE A;  3F5A A;  4KLF A;  3HIL A;  1C7Y A;  2XVT A;  2KZZ A;  4ECS A;  3KHG A;  1ZQM A;  5KT3 A;  5TZV A;  4C8M A;  4R8U A;  4PZN A;  1X6I A;  3VCB A;  1BPD A;  2K8A A;  1TAM A;  4QIW F;  4MHV A;  2FI1 A;  4O3M A;  9ICM A;  1WYG A;  2F76 X;  4P0Q B;  2NRT A;  2FJ6 A;  3Q8Q B;  4ZH4 A;  1TAU A;  4YMM A;  3BS5 B;  4KLQ A;  5KFQ A;  1SZH A;  2EQY A;  1TFR A;  1Y88 A;  5KG7 A;  3KHL A;  3WKE A;  5CEH A;  4F5R A;  5KL8 B;  1BVS A;  4DL2 A;  4RUC A;  1T7P A;  2PMZ C;  4Z6D A;  2EAO A;  2BPG A;  7ICV A;  4XRH A;  5KG6 A;  2KKP A;  2ISO A;  4F50 A;  3LK9 A;  3BZK A;  4ED3 A;  4RNN A;  2C2R A;  2Y9U A;  3GFK B;  4IRK A;  2P6U A;  2R18 A;  2HSZ A;  3ISC A;  1S0O A;  2WF6 A;  3NVW A;  2W7O A;  2R8I A;  4YQW A;  2JXJ A;  4F3O A;  4M0A A;  4IC9 A;  4DSL A;  3HKZ F;  4DL5 A;  4R63 A;  1X66 A;  2JZB B;  3N4M B;  3H8M A;  4C8K A;  4BWM A;  3T79 A;  1ZQT A;  3AQE A;  1YZ6 A;  9ICJ A;  5ALS A;  3AUO A;  3QXG A;  1JI7 A;  3EPI A;  2I9G A;  3NVV A;  2EH9 A;  5AHX A;  9ICN A;  1ZXI A;  3KZX A;  7ICF A;  4AYB F;  4CF5 A;  2W9C A;  4J9Q A;  1IIP A;  3UQ0 A;  3AU6 A;  1ZQQ A;  4NLZ A;  2KN7 A;  3QEB Z;  4EBC A;  3T3F A;  4B9V A;  3RBD A;  2HOI A;  3SAG A;  2ALZ A;  4QJF B;  4QZG A;  5AIC A;  2E8M A;  3KHR A;  5J2D A;  1N2X A;  3JPO A;  3PW4 A;  5F9N A;  2ZG6 A;  1X2I A;  3Q8P B;  1MQ2 A;  4TUS A;  2A19 A;  3KBB A;  2ISP A;  2F3N A;  3QU7 A;  2F44 A;  5HR6 A;  5J29 A;  1Z00 B;  4TUP A;  3IHQ B;  3M9M B;  1C20 A;  1BNP A;  3LYS A;  1VLB A;  3PNC A;  2RHF A;  1S10 A;  2GO7 A;  3ZDC A;  1ZQP A;  2D6F C;  4CGZ A;  5DG9 A;  4P0Q A;  1L5U A;  1QH9 A;  4RQN A;  5KFG A;  2DPI A;  5AM2 A;  1JUD A;  2RDJ A;  1ARO P;  1HIW A;  4G3I A;  2MAX A;  4PZO A;  4UB3 A;  9ICC A;  2JEI A;  4DL3 A;  4RQ0 A;  5KG3 A;  3O0F A;  2XCP A;  2QAR A;  2FLP A;  4ELT A;  2P35 A;  4PH5 A;  1J2M A;  2OH2 A;  5AM3 A;  2K4P A;  2JH7 A;  5AI4 A;  7ICI A;  4GIB A;  1Z3E B;  2DPJ A;  5KL1 B;  2QKQ A;  1X40 A;  4RPX A;  3MGV A;  2KVC A;  4OJ5 A;  5DKW A;  2JGA A;  2H3V A;  4RNO A;  4PHA A;  3KZI U;  3H8S A;  3HKZ C;  2W3S A;  2XGQ A;  4DCC A;  3C1Y A;  1XU4 A;  4XQ8 A;  8ICW A;  2KZM A;  2JZB A;  2ZIV B;  2ZIU B;  1JX4 A;  1UT5 A;  5D46 A;  4RT2 A;  1RZT A;  2JMG A;  1FFU A;  1B4F A;  3C23 A;  3RJF A;  1A76 A;  4QWE A;  1ZD2 P;  2JV3 A;  2XY7 A;  2KV2 A;  3RFA A;  3A0H U;  2CPR A;  4O3O A;  4IQW A;  1SGG A;  2MA1 A;  3KFU F;  2PFO A;  9ICH A;  2A1A A;  1X9W A;  1NK4 A;  5L1J A;  1KDH A;  4DFP A;  1X9X A;  3IM1 A;  1A6S A;  5DB7 A;  1TK0 A;  3IRU A;  2ASJ A;  4ECR A;  4RNM A;  1WCL A;  4KLL A;  2DQN B;  5ALZ A;  5ALP A;  2BDU A;  3BJY A;  4QZ8 A;  4UB5 A;  4NL9 A;  2VAN A;  1DRG A;  5KFB A;  1QTM A;  4P4O A;  4LJX A;  2BCU A;  2A3V A;  1MC8 A;  4DEZ A;  4HAI A;  4DQI A;  3GV8 B;  4O0I A;  1L3T A;  1L6N A;  3V7L A;  3EPG A;  8ICB A;  9ICW A;  3GDX A;  1NK6 A;  1N48 A;  3KTQ A;  4C80 A;  4NJ8 A;  3RB4 A;  3IG5 A;  4TQS A;  1T4G A;  3MR2 A;  5F9L A;  1Z00 A;  7ICP A;  4Q8E A;  3KKA A;  4FFD A;  2WTF A;  4WJ3 B;  2RRD A;  5J2C A;  8ICU A;  3DV9 A;  9ICS A;  9ICU A;  3GZF A;  3IV6 A;  2BR0 A;  1V9P A;  5TIS U;  3RTV A;  1CUK A;  2HBM A;  3F5E A;  2LKY A;  5T14 A;  3HWT A;  2G09 A;  4O3S A;  4BX9 C;  4NLN A;  1ZQZ A;  4K4I A;  2AU0 A;  3SR6 A;  5BPC A;  2KEY A;  3K75 D;  1L3V A;  2HOF A;  4NLC A;  1X6J A;  2CN1 A;  2E1F A;  3ZD8 A;  1XSL A;  1BPY A;  5ALE A;  2OEH A;  1F5S A;  2PI4 A;  4RQ1 A;  4F5O A;  4R66 A;  4YR0 A;  1QLN A;  4DFK A;  1ZJN A;  4MFF A;  1S0M A;  8ICT A;  1OXJ A;  4C4R A;  4I2H A;  2KTQ A;  4KLG A;  1WWV A;  2KP7 A;  1H38 A;  5J2A A;  9ICP A;  1X9M A;  2WB1 C;  5KG2 A;  4O5C A;  4A8E A;  1JRP A;  3R9K A;  3ETR A;  5KFX A;  3MBY A;  4QZH A;  1FEZ A;  5AK4 A;  2ZIV A;  2ZIU A;  1N5X A;  5ALN A;  2I6X A;  4YP3 A;  4KLI A;  1TK5 A;  7ICU A;  4B9U A;  7ICO A;  8ICL A;  1Q3U A;  2RP5 A;  3NUQ A;  2B0C A;  3QUQ A;  2MRL A;  5HHI A;  1ZD5 A;  5AI5 A;  4M47 A;  1ZD3 A;  4PHD A;  2LYB A;  1QCK A;  1XSN A;  2KHQ A;  1COO A;  1KQQ A;  4FZN A;  1AQ6 A;  4NV0 A;  5AK6 A;  5D4B A;  3ONN A;  2Y1I A;  5J0S A;  2K89 A;  8ICV A;  2I5H A;  1ZQG A;  2VKQ A;  5GTH U;  2QLT A;  4F5Q A;  5EE0 A;  4JMU A;  1UPH A;  2YTU A;  5ALJ A;  2J6U A;  1WG8 A;  2W9B A;  4GXK A;  4YR3 A;  3RJK A;  5KG1 A;  2W7P A;  1NZB A;  1ZQ1 C;  1GO3 F;  8ICI A;  5KTQ A;  1SXE A;  2Y1J A;  3WK8 A;  2IA6 A;  8ICG A;  9ICQ A;  4MFA A;  4RPY A;  4C8O A;  1ZQV A;  4QZE A;  3BQ2 A;  1NI3 A;  5J8Y A;  1U4B A;  2O6K A;  4KMO B;  4NLB A;  4CNQ A;  9ICR A;  4M9G A;  2OXO A;  1D8B A;  4KIT B;  5K4L A;  1Z4O A;  4F72 A;  4F4K A;  2VA8 A;  1NK7 A;  2FPM A;  5HR7 A;  3ZI4 A;  7ICG A;  4LZG A;  4DS4 A;  2W54 A;  1J97 A;  3M1Y A;  1WWU A;  5AM0 A;  2JEJ A;  3D2Q A;  3N7S C;  4IS7 A;  4DSF A;  5DQH A;  2AH5 A;  3GIK A;  4F4Z A;  4ECX A;  3C5F A;  3IN5 A;  3ZD9 A;  4DL4 A;  5ALM A;  4Y2S A;  5E79 U;  1ZQO A;  4PGY A;  3D2N A;  3SQI A;  3SV3 A;  3OJS A;  3M7D A;  4YG2 A;  4EYI B;  1ZQH A;  4EX6 A;  3H8W A;  8ICQ A;  5CB1 A;  2PI5 A;  2K60 A;  3UM9 A;  5KAI U;  2FMP A;  3RJH A;  2HHX A;  3JPQ A;  2UVR A;  2GWS A;  2GLE A;  5DB8 A;  5KFE A;  3G6X A;  1BNO A;  4ECV A;  2BPC A;  4QZF A;  3PY8 A;  1NJY A;  3G6Y A;  3ISB A;  2MU2 A;  3TAD A;  5ALR A;  1D9F A;  2ZIW B;  3HX0 A;  2J6S A;  4DQS A;  4P4P A;  2OCE A;  3UPQ A;  4DF8 A;  1B22 A;  4ECU A;  4MEY A;  4IRC A;  4G9B A;  4E0D A;  2LBO A;  4NWI A;  4QW8 A;  2GH1 A;  2HVI A;  4QZB A;  2NYV A;  2IOF A;  5DQG A;  2F1I A;  1LVH A;  2W11 A;  3SI8 A;  1TE2 A;  3H0M B;  1N56 A;  3WKB A;  4KTQ A;  2W43 A;  1SV4 A;  1ZQR A;  1L3U A;  9ICT A;  5DGB A;  1PK1 A;  3C2K A;  1ZQE A;  2ZTD A;  4GC6 A;  4F71 A;  4Y2Q A;  4RQ4 A;  1ZQA A;  4YN4 A;  2JEF A;  1PK3 A;  4I27 A;  2NO5 A;  4J9R A;  4QZA A;  1KKX A;  3SAH A;  2XY5 A;  3V6H A;  1CI4 A;  3LVW A;  1D8Y A;  4YD2 A;  4BUG A;  9ICK A;  5DG8 A;  4I2G A;  2IHN A;  2KIV A;  2RQ5 A;  4Q44 A;  4KLJ A;  1COK A;  3E0F A;  5KFT A;  3L5K A;  2KKV A;  2HHW A;  4LZD A;  3GIL A;  1OUQ A;  4O3R A;  3SMV A;  3AQF A;  3THV A;  4BJQ A;  3K4G A;  2H3Q A;  2IBK A;  4I2C A;  3H8J A;  3EYZ A;  2G06 A;  3H7I A;  2HHV A;  4MF2 A;  1A0P A;  4DWI A;  4DQQ A;  4M6W B;  3T5K A;  2EAM A;  7ICE A;  3QEA Z;  3LDA A;  4JUZ A;  4C8L A;  7ICH A;  4QZC A;  4R65 A;  2JEG A;  2WFA A;  4NXZ A;  2QB0 B;  4J9O A;  1KBU A;  2C28 A;  3TAQ A;  4EZ9 A;  3HRD D;  2UVV A;  4JK1 A;  3OSN A;  4IR1 A;  2ZJ5 A;  2DUY A;  4US9 A;  3RB6 A;  3PST A;  4I2D A;  4UAV A;  2EZX A;  3ZDB A;  3GU3 A;  2HOQ A;  4YR2 A;  2DGZ A;  2MUT A;  5EE9 A;  3PX6 A;  1UA1 A;  1BGX T;  1X42 A;  2KE7 A;  3WKC A;  2LI6 A;  4KLE A;  2UVU A;  3LWM A;  4Z6F A;  7ICR A;  1L7P A;  1SWW A;  3NVY A;  3TFR A;  3PSP A;  2NRW A;  1UA0 A;  1TV9 A;  9ICG A;  1IV8 A;  5L9X A;  4B9N A;  2AHO B;  5JRT A;  1NZP A;  8ICM A;  4JV2 A;  4PJ0 U;  1ZJM A;  3QX7 A;  4P4M A;  2E1E A;  2RLT A;  2KJ9 A;  2ZIW A;  3K1Z A;  2W04 A;  3I1Y A;  2NRZ A;  5DQI A;  4JV0 A;  4GXJ A;  5AKK A;  1N62 A;  2WAQ F;  4DFD A;  1DGS A;  5GTI U;  4ED6 A;  3AN1 A;  4IQV A;  2KIW A;  1PVP A;  1HUZ A;  8ICX A;  2EAN A;  4PGQ A;  1SB3 C;  1BPB A;  4OO1 J;  4ECT A;  1BPX A;  3TAN A;  2PFN A;  4DO9 A;  2E8N A;  2P66 A;  3ICX A;  3NTU A;  2WHE A;  2W55 A;  5EWE A;  5AM4 A;  4BWJ A;  3T5J A;  5FP0 A;  2MSN A;  4F2S A;  3RJE A;  1TKD A;  4DSI A;  5EE1 A;  7ICJ A;  2YN4 A;  3M8S A;  4QIW C;  4QW9 A;  4CF4 A;  5JU5 A;  3QUB A;  4KX5 A;  2G07 A;  5EWF A;  1ZQL A;  2HW3 A;  5IIL A;  5AK5 A;  3PMN A;  5DLF A;  3L4P A;  2LYA A;  1ZQN A;  9ICI A;  5ALX A;  3UQ2 A;  5KFI A;  1DXS A;  3BS5 A;  1NK0 A;  4IR9 A;  2KHV A;  3C2L A;  4YD1 A;  3QE9 Y;  3I28 A;  2BDP A;  5KFL A;  5KFK A;  5J0U A;  1NK8 A;  4GFJ A;  4I2A A;  4I2F A;  1DK2 A;  4RU9 A;  2VA2 A;  2AGP A;  4B6J A;  4M6W A;  4UBB A;  3BQ1 A;  1D9D A;  4PGX A;  4ECQ A;  4JWN A;  5KFZ A;  5KT6 A;  5J0O A;  1ZRM A;  3BQ7 A;  2NRX A;  4YXJ A;  5L1L A;  2W8K A;  2QB0 A;  5DG7 A;  3OHA A;  1RXV A;  1CEZ A;  3Q8S B;  2YMM A;  2W9A A;  1ZQF A;  4PPX A;  3BQ0 A;  4Z6E A;  3C29 A;  4I28 A;  1JXE A;  3PX4 A;  4UAS A;  9ICA A;  1L7N A;  1KFS A;  1JXL A;  4OJO A;  1O08 A;  4ELV A;  2C22 A;  1U48 A;  2K8B B;  2FPL A;  5J2E A;  5KFU A;  3H0R B;  4Y2R A;  4CCH A;  4AYB C;  1RYS A;  2F1H A;  4Y2J A;  3GIJ A;  5J2F A;  2LHT A;  2HBL A;  3RBE A;  3BS7 A;  2DKZ A;  1Z1V A;  4UB8 U;  4O5E A;  4FS2 A;  1RPL A;  3PSI A;  4O3N A;  2DKX A;  4UB4 A;  3GV7 B;  3SEN A;  2BQ3 A;  2ESE A;  3SV4 A;  1FFV A;  9ICE A;  4RPZ A;  3C1Z A;  3V7J A;  1T94 A;  1JRO A;  4EEK A;  2ZIX B;  5DB6 A;  5ALL A;  5J0X A;  1FIQ A;  2EDU A;  5L1I A;  3DDH A;  3MR6 A;  4J9S A;  4KN4 A;  3EWA A;  5J0R A;  2YB1 A;  1TVA A;  2VJ4 A;  4TUQ A;  5CWR A;  4M9L A;  4M9H A;  5DBB A;  3OJU A;  3SYZ A;  1MQ3 A;  4GXI A;  3F2C A;  5KFN A;  1PVR A;  4RQ5 A;  2OYY A;  3BQT A;  3CYM A;  4J03 A;  3AMZ A;  4DF4 A;  4BDP A;  5ALD A;  1QQ7 A;  2Y0S F;  2JH1 A;  2JHD A;  2JR5 A;  3IG8 A;  4C7Y A;  8ICR A;  4PHE A;  2LM1 A;  4J9M A;  1V97 A;  5AKX A;  4DOC A;  5AK3 A;  4PL1 A;  1KRP A;  1BPE A;  2HHS A;  2YX8 A;  3TKA A;  2YML A;  4Y2Y A;  2R8J A;  4UAY A;  3MFI A;  4PHP A;  3Q8M A;  2D3D A;  5KFW A;  2R8G A;  4K4G A;  5BOL A;  3KD3 A;  2HHU A;  3OTQ A;  1B0X A;  4CF3 A;  4UAZ A;  2NV3 A;  4US8 A;  1SV0 C;  2YQE A;  5KFJ A;  1N63 A;  5IIM A;  4UW9 A;  4F2R A;  3DEE A;  2WF9 A;  3RJJ A;  4U6P A;  4ED1 A;  4J9K A;  5KFY A;  1UCV A;  4QZ9 A;  1S97 A;  3BZC A;  5J2G A;  4ICA A;  3JPS A;  5L1M A;  5JUM A;  5KFO A;  2G5H B;  3TFS A;  1L7M A;  4DS5 A;  3SD7 A;  4K4H A;  1NJX A;  4RZR A;  2IOH A;  3FC4 A;  4DOB A;  1S77 D;  1PVQ A;  3D6J A;  3H4D A;  3QZ8 A;  3OHB A;  4IQU A;  5ALY A;  2AGO A;  1U47 A;  4QNL A;  2H3F A;  2LMR A;  5AM1 A;  1L8L A;  1SL0 A;  2VA3 A;  5HP4 A;  1V85 A;  1KSP A;  1RG6 A;  3WKA A;  1KFT A;  2G0A A;  3QYP A;  1UQV A;  1SL1 A;  3PX0 A;  2VIX A;  1DOQ A;  4O5K A;  3HW8 A;  4KLM A;  2W9M A;  4B9S A;  4RUA A;  4JWM A;  3QU2 A;  2FDR A;  4NM2 A;  2NRV A;  5ALG A;  2E5S A;  4I2J A;  1RYR A;  9ICV A;  5ALV A;  2F8K A;  1KW4 A;  5KAF U;  5HML A;  2EZZ A;  3N97 B;  4I2B A;  2ODG A;  8ICH A;  3HJE A;  5J2I A;  5DDY A;  3M6K A;  4F8R A;  4NY8 A;  3IP4 B;  3JPP A;  1B43 A;  4O9M A;  2HI0 A;  5IIO A;  4P0P B;  4EBD A;  2C2E A;  3F53 A;  1NKB A;  3MR5 A;  5HMM A;  1K1Q A;  2F77 X;  3RR7 A;  2XO7 A;  2F1J A;  2K4H A;  1QQ6 A;  2B6G A;  4JV1 A;  4KLD A;  5AKE A;  4F91 B;  3G6V A;  3RR8 A;  2OHF A;  1U45 A;  3C28 A;  3HPO A;  3RH6 A;  3F2D A;  3IDW A;  1XSP A;  3CW2 C;  5ALO A;  2PMZ F;  7ICQ A;  1NK9 A;  4BXO B;  3M9O B;  1WUD A;  3MDA A;  2EZY A;  2WF7 A;  2PKE A;  5KFV A;  1XC9 A;  9ICX A;  1ECW A;  4U7C A;  2HVH A;  4F5P A;  4MEX A;  2A1J B;  4UAW A;  8ICE A;  2YB4 A;  1KN5 A;  1S8O A;  2Y9T A;  1NNL A;  4DQR A;  3MC1 A;  5EWG A;  1XO1 A;  2BCS A;  3QU4 A;  5KFM A;  3PW0 A;  5F3X B;  2P6R A;  1M6Y A;  1MN8 A;  3WU2 U;  4DFM A;  8ICJ A;  2G08 A;  3QU5 A;  3Q8K A;  2CRX A;  3PR4 A;  1HEK A;  5B66 U;  3GII A;  4C4T A;  5J2J A;  3UMG A;  3H40 A;  3TAR A;  2KK0 A;  3ALR A;  3K1R B;  4ED8 A;  5AKL A;  3BDP A;  4Y2V A;  3ZDD A;  2BQU A;  2CXY A;  4OJL A;  1SKW A;  1DK3 A;  4F5N A;  2KNJ A;  4C4S A;  1SWV A;  4Q45 A;  5DGA A;  2W3R A;  3PW7 A;  4KLH A;  2RDI A;  1SKS A;  2FLL A;  3TQ1 A;  2DFL A;  1ZQB A;  1Z1B A;  1T8E A;  1URJ A;  1ED1 A;  3ISD A;  2XC9 A;  3OPX A;  4USA A;  3E2E A;  2ES6 A;  2PFP A;  3UMC A;  5DLG A;  4O3P A;  4B9T A;  2EAP A;  5DBC A;  4X5V A;  1S9F A;  1Z19 A;  5J0T A;  1L8O A;  3B0Y A;  2F2A B;  3EZ5 A;  3C2M A;  2D8C A;  4BGD A;  1KL9 A;  4DLG A;  2WF5 A;  2BCR A;  5C0Y A;  1N60 A;  1P7D A;  2IMW P;  4IQT A;  3UXN A;  4RQ6 A;  4P0P A;  2DBY A;  4P2H A;  2HHQ A;  4M04 A;  4NLK A;  5IIJ A;  1NK5 A;  1SIJ A;  4RT3 A;  3FYH A;  4Q43 A;  1F0M A;  2JRZ A;  2YMP A;  4O3Q A;  1HJP A;  1JMS A;  3M6Z A;  2KIC A;  3EUB 2;  4J9L A;  2QAR B;  5KFS A;  4OJP A;  1RQL A;  5ALF A;  9ICB A;  2BGW A;  4Y2P A;  3RRG A;  8ICC A;  4TUR A;  3UMB A;  4RQ3 A;  2XGP A;  3WK7 A;  3JPT A;  4KX3 A;  1L7O A;  4J9P A;  4DL6 A;  5KFH A;  1ZET A;  4CE6 A;  3AL0 B;  4BXO A;  2YMQ A;  2E8P A;  3WK5 A;  4DL7 A;  4EZ6 A;  3M8R A;  3PZP A;  5BOM A;  3SAF A;  2XIC A;  4UBC A;  4KLU A;  3QU9 A;  2ZJA A;  1XNS A;  4Z6C A;  1XWL A;  5J0Y A;  3NVZ A;  2A1J A;  3Q8L A;  4RQM A;  1S0N A;  2ZTE A;  5L1K A;  4ELU A;  1SXD A;  3KHH A;  2KFN A;  8ICN A;  2W03 A;  3NRW A;  3V72 A;  1A77 A;  5AIA A;  3WK4 A;  3RB0 A;  2ASD A;  3MDC A;  3LWL A;  5AKZ A;  4EYH B;  1VJ5 A;  2KZ3 A;  4ACO A;  5DBA A;  4LVS A;  3RF9 A;  3PVX A;  4QWD A;  2FPK A;  5AI8 A;  4ECY A;  3ETL A;  4ECW A;  5CA7 A;  2KOB A;  3RH4 A;  4ED7 A;  2KG5 A;  3QUT A;  2VJ5 A;  1VDV A;  2KSO B;  4EEY A;  2KVS A;  3AM9 A;  2FE9 A;  7ICK A;  4CDG A;  5KG0 A;  1NOM A;  4DSK A;  4OJ6 A;  4UAT A;  2ATL A;  5AI0 A;  2HCF A;  4YMO A;  5KT2 A;  2ZUB A;  2DF4 B;  2BZF A;  1KTQ A;  4JB3 A;  2HBJ A;  4DSE A;  3F2B A;  2ZUD A;  5AIB A;  5DDM A;  4IL6 U;  1S76 D;  4RQ2 A;  5AKJ A;  3T5L A;  3MAB A;  3N7R C;  2L5Y A;  4CRX A;  9ICO A;  3GIM A;  3C21 A;  5C5J A;  4ED0 A;  4YMN A;  5KFP A;  1F44 A;  2KFZ A;  5AKH A;  1HUO A;  5KG5 A;  8ICZ A;  1ZQI A;  4Y2X A;  4UB6 U;  4YCX A;  2ZXI A;  4OD0 A;  3PO5 A;  3TI0 A;  1KLN A;  2J6T A;  5KG4 A;  4ECZ A;  4C7Z A;  8ICK A;  2Z7J A;  1L3S A;  5ALW A;  1N5W A;  2DWQ A;  3C5G A;  7ICM A;  4C0Z A;  8ICY A;  4QZI A;  3OGU A;  4IRD A;  4FZM A;  3D2S A;  3PML A;  5CJ7 A;  3EW9 A;  3FM9 A;  2OM6 A;  5IIN A;  4F4W A;  1Q46 A;  4DOA A;  4F4X A;  1CRX A;  4YVZ A;  7ICT A;  5DB9 A;  1NJZ A;  1IM4 A;  7ICN A;  4DQP A;  4I2I A;  4NM1 A;  1ZQW A;  1ZQU A;  1PZN A;  3KOO A;  3VC8 A;  3U26 A;  1T3Q A;  3MGH A;  3PW2 A;  4DSJ A;  4F93 B;  1JIH A;  1MSW D;  2K8C B;  2BHN A;  1UHU A;  1IXR A;  2F8L A;  5ALQ A;  4FE3 A;  5KT5 A;  4KLT A;  1ZRN A;  4MF8 A;  3M9N B;  8ICF A;  2YY6 A;  1YZ7 A;  3MFH A;  5CRX A;  1LKY B;  1ZQX A;  2R8H A;  3RRH A;  1QSS A;  3N28 A;  5J0W A;  2WB1 F;  4TQR A;  3HT3 A;  3PW5 A;  5ALH A;  2ASL A;  1S5L U;  2DL0 A;  3CNH A;  3SZ2 A;  5AI6 A;  3I76 A;  3H4B A;  4DLE A;  5CR0 A;  3RAX A;  2WAQ C;  2FLN A;  1XS9 D;  4NLG A;  4XA5 A;  4J9N A;  3NGD A;  5KT7 A;  2KSO A;  3RJI A;  5J2H A;  1TK8 A;  1UT8 A;  1NKE A;  1Q8K A;  3ORY A;  3MR3 A;  3RJG A;  3WK9 A;  4KLO A;  4R64 A;  2ZJ8 A;  3B0X A;  4QWB A;  2E8O A;  5D49 A;  2AXT U;  1RYU A;  2Q0Z X;  4XUS A;  2LM4 A;  8ICA A;  1ZQY A;  2W9B B;  4EBE A;  3RAQ A;  5AKI A;  4I2E A;  1YT3 A;  3L3F X;  4ZOH C;  4NL9 C;  2AQ0 A;  2N1R A;  4KMU A;  1QSY A;  3PO4 A;  2FMS A;  4I29 A;  2C2D A;  1RXW A;  4C8N A;  1SZP A;  2XID A;  2LPE A;  5HHH A;  4PL2 A;  3KKA C;  3WK6 A;  1JAL A;  2ZTC A;  5J0Q A;  3QZ7 A;  3TAC B;  8ICS A;  2V4Q A;  5CP2 A;  2HHT A;  1JN3 A;  5KT4 A;  2HMX A;  1SV0 A;  1IG6 A;  3JPR A;  1LV5 A;  2PFQ A;  4UAU A;  3LVV A;  2AGQ A;  2ZXH A;  4UB1 A;  5KFF A;  5J2B A;  1MA7 A;  4GLX A; 
#chains in the Genus database with same CATH homology
 5J8Y C;  2LMR A;  2L5Y A;  1V85 A;  1F0M A;  2Y9T A;  1SXE A;  1RG6 A;  4PZN A;  1UQV A;  2KE7 A;  5F3X B;  2QAR B;  2KSO A;  4MHV A;  5J8Y A;  2E8M A;  1LKY A;  1B4F A;  1SV4 A;  1PK1 A;  2JV3 A;  3BS5 B;  3BQ7 A;  2E8O A;  2QB0 A;  1SGG A;  2E8P A;  1PK3 A;  2F3N A;  3K1R B;  5JRT A;  1WWU A;  1OXJ A;  2F8K A;  1KW4 A;  1X9X A;  2F44 A;  4RQM A;  1WWV A;  4NL9 C;  2EAO A;  1SXD A;  4IS7 A;  1OW5 A;  2KIV A;  3SEI A;  2EAN A;  2D3D A;  1COK A;  1PK1 B;  4NL9 A;  2Y9U A;  1B0X A;  2E8N A;  2LPE A;  2QB1 A;  3BS7 A;  2DKZ A;  1Z1V A;  4RQN A;  2ES6 A;  2B6G A;  2DKX A;  1SV0 C;  2EAP A;  2KG5 A;  3SEN A;  3KKA C;  4PZO A;  3TAC B;  1X66 A;  2ESE A;  2KSO B;  1UCV A;  2EAM A;  3H8M A;  4NJ8 A;  5JU5 A;  2FE9 A;  2QAR A;  2K60 A;  1LKY B;  1SV0 A;  2D8C A;  3IDW A;  5L1M A;  3TAD C;  3KKA A;  2GLE A;  5JTI A;  1JI7 A;  2K4P A;  2QB0 B;  1DXS A;  3BS5 A;  1V38 A;  2DL0 A;  2QKQ A;  5KNI A;  2KMD A;  1X40 A;  2YTU A;  3HIL A;  3TAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...