4DSIA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, se-dgtp and calcium
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
581
structure length
581
Chain Sequence
GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 208
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsiA01
3MGHA 1TVAA 1LWFA 3H8SA 4KLGA 3PNCA 4CJTA 2R8JA 2KZ3A 3KLEA 4M3WA 4DQQA 4ECVA 4KLUA 5DQGA 2IAJA 2X6NA 4I2DA 1HYSA 4FM1A 2BGWA 3M9MB 5DDYA 2Y1IA 2VA2A 1T3NA 3C6TA 3PR4A 5C42A 8ICGA 4CJFA 9ICNA 5DG8A 2D0AA 5DGBA 3V1RA 3QIPA 1WSEA 4FJ9A 1MSWD 1HYZA 4NCGA 4E1MA 4CHQA 1JKHA 4PGYA 2OYQA 1F21A 3GILA 3KLFA 4X5VA 3HP9A 4O0IA 3JPQA 5FRMA 5DKWA 4UB3A 3SYZA 3QE9Y 4N47A 4Q45A 1KVCA 1WSFA 1S9FA 4IR9A 4CHPA 5KT4A 1TL3A 4CEEA 1RTDA 2G8FA 4CK3A 3ZT4A 4ECWA 1ZQCA 4M45A 3PUFA 4Y1CA 5CHGA 3KD1E 1C0MA 1ZQKA 4CESA 3E01A 2HNYA 3OYAA 3V4IA 2UVWA 4F5RA 2XY7A 3DRPA 5T7BA 4HVJA 4AHCA 7ICPA 2BKEA 1BGXT 3OYLA 3DOLA 1S1VA 4ELUA 1BQMA 4RUCA 2DFLA 4UB2A 4KLIA 4JUZA 3C95A 4DTNA 2D0CA 5KG3A 3NF8A 8ICPA 1JLGA 4LZDA 4DSJA 3GIIA 3RMBA 1C0TA 3TANA 3VQ9A 2BCQA 1LV5A 3QESA 1B9DA 3DLHA 1Y88A 4O9MA 5HRRA 4PA1A 5DG7A 3K59A 3DRRA 2YNIA 8ICXA 4M3RA 3IAYA 4FZZA 2ALZA 2D0BA 5DMRA 3CYMA 1C7YA 2DY4A 3MR6A 3GV5B 4M9JA 3K2PA 4OGCA 4CHYA 5C5JA 2Q0ZX 1JLAA 5J2QA 4NY8A 2O4GA 4N56A 3PW2A 1X9SA 2VWKA 1I39A 1JL2A 1XO1A 4CF1A 4KHYA 1A77A 4RNMA 3IHQB 1LWCA 3ETLA 4GXIA 1ZQOA 1RBUA 3CQ8A 1ZQRA 4EBEA 4BXOB 1SUQA 4RQ6A 3Q8SB 2XY5A 1GOBA 4DQRA 5EWEA 1BPEA 5IILA 3ALYA 4IQWA 7ICFA 1D9DA 3UXNA 1KLNA 5DB7A 3T3FA 1ZBLA 5KFUA 9ICTA 4QWAA 5L1KA 2E4LA 4RW8A 1S0VA 4KFBA 4FW2A 4W5OA 3ZDCA 2ZJAA 2C2DA 1J5OA 3L2UA 3LP2A 4RW7A 4Z4HA 3AVCA 3T19A 4DFKA 3E2EA 4LVSA 1ZQDA 5DG9A 4UAYA 3VQAA 2PYLA 3DLGA 1RDAA 4R65A 2FMPA 4Z6EA 2KFZA 1UT8A 1X1PA 1WCNA 1BPBA 8ICQA 4PPXA 3GV8B 1NK4A 1S76D 3RB3A 4DEZA 1ZQEA 4TSXA 4F91B 8ICAA 2GV9A 5EWGA 4DOCA 4JS4A 1JMSA 1IKVA 4I2QA 1RT7A 3VQCA 2Q3SA 5DGAA 1NKBA 1D9FA 1RNHA 4LH5A 8ICKA 1ZQYA 3CG7A 4PHPA 3PW4A 3AVMA 3SI8A 1Z26A 4GLXA 5IIMA 4FLTA 3CM5A 4W5QA 2JGUA 4YR2A 2G8UA 2IC3A 4IG0A 5KFNA 4R63A 3C1YA 3N4MB 1HUZA 1XI1A 2W9CB 3SNNA 5L9XA 3OHAA 2B5JA 4FCYA 3OYIA 1QSSA 3L2QA 1ZBIA 4CE9A 4C8MA 4CF9A 3GFKB 2OPRA 3VQ7A 4JWNA 4NM1A 4FJKA 3O3HA 1HNVA 3G6XA 2ZD1A 1YVUA 3ULDA 4YP3A 4DG1A 4B9MA 3NF6A 1C1AA 4O0JA 1TAUA 1B22A 9ICOA 4YQWA 4PHDA 4BACA 2ATQA 1ASVA 3U6FA 4ECRA 2KQ2A 4DFPA 1WLJA 4FJ5A 4CGHA 2J6UA 3MGIA 4KHWA 2RPIA 4OPKA 1VSFA 4R8UB 5FROA 1JX4A 9ICGA 5L1LA 4YR0A 2W8KA 3TQ1A 2XCPA 3ZT0A 3ZSYA 3QZ7A 1K1QA 2HNDA 1BPYA 1NK5A 2IBKA 5HMMA 1ZQWA 2OWOA 3MR2A 4J9MA 7ICSA 2F1HA 3KJVA 3CFOA 2ISOA 5KT5A 3DOKA 4XUSA 4C8KA 4ECTA 4KTQA 3IG1A 2HHTA 2AQ4A 3PO5A 3S3OA 2KZZA 3JPOA 4DF8A 9ICCA 1TFRA 3KHRA 4B9NA 1TV9A 8ICSA 5CR0A 2XC9A 2X78A 3RB0A 4J9SA 4B8AB 9ICUA 1TK5A 3QLHA 3C6UA 2A1JA 2A1RA 1S0NA 1TKXA 2F1JA 1L3SA 4E7JA 1N48A 4MEXA 4GXKA 3O4NA 3AVNA 3MBYA 3OS2A 1XS9D 4FLYA 2ASLA 2AGQA 4H8KA 2R8KA 4O3PA 3NF7A 3NH1A 3L8BA 1ZQLA 1L3VA 3MXMA 4CF2A 4ED3A 8ICWA 1RT4A 4HCBA 5J2IA 4F92B 2FBYA 1C6VA 2G8HA 4O3OA 4FK0A 4CHZA 1XSLA 3SCXA 3EPGA 4KLDA 4W5TA 3TI0A 3ISCA 4Z6DA 2ZJ8A 3LP1A 1EETA 4M47A 2W9AA 1WAJA 4YD1A 4UBCA 2BDPA 3AV9A 4RW6A 4DSLA 5KG7A 2Z1HA 2FLNA 3H4BA 4F8RA 2FBTA 5KI6A 1UAXA 4KLQA 5F9NA 2Z1JA 5SWMA 2ITGA 4FLUA 4TUQA 3GDXA 3AA4A 3VQDA 5J0OA 4O4GA 1HPZA 1U4BA 1GOCA 1ZQHA 2LYHA 2IDOA 1NOYA 4M3TA 2HHVA 3F9KA 3ISBA 3BQ2A 4N5SA 4WE1A 1CXUA 1Q9XA 5C25A 5CJ7A 2XO7A 5J2GA 1XSPA 1T7PA 3NF9A 3ZDBA 1L3UA 4NCBA 1DLOA 1BCOA 4RT3A 2BPGA 4DTMA 3AVLA 2OPPA 4IFVA 5D49A 3QEWA 1XHXA 4DQSA 4UQGA 5KT6A 3LPUA 5IIKA 2PY5A 2PFQA 3ITHA 3NAEA 2PYJA 3OGUA 2P5OA 4KI4A 1FKOA 4KMUA 1RT2A 3QINA 4LD0A 1ZQVA 1TVRA 3KIOA 3RAQA 3EW9A 4CJUA 3SUNA 2DTUA 4RW9A 8ICOA 4FM2A 4DTOA 3AUOA 2Z1GA 4CK2A 4M3XA 2RDJA 4EBDA 3SUQA 3HPGA 4BDYA 4QWEA 1MQ3A 4JK1A 1HUOA 5J1EA 1XHZA 4FBTA 8ICCA 3PVXA 2WTFA 4R8UA 5KFRA 5KFAA 4DQIA 4PH5A 3NFAA 3KK2A 4UAWA 1A5WA 3RJJA 3V1QA 4OLAA 1REVA 1Z00B 2J6TA 2FPMA 2BR0A 9ICAA 4CIGA 4KLEA 2HHSA 5IIJA 3OSNA 4XIUA 2KW4A 3O4QA 3VQ8A 1UOCA 4FJLA 3HX0A 2E6MA 1WCLA 2HB5A 3DLEA 2JLEA 2BCVA 1UA0A 4Z4CA 3OYCA 4O3RA 2I1QA 5K14A 2BE2A 1ZQUA 1NK9A 4CERA 4RQ4A 1VSHA 2W9BA 2R7YA 8ICUA 3KKRA 4F4XA 4B9SA 4I2EA 4R5PA 3RWUA 4IQTA 3BJYA 4EP5A 4I2JA 4Z4FA 2Y1JA 3QNNA 3H08A 4Q5VA 7ICNA 3T5JA 3EYZA 1QS4A 4DLGA 3LALA 7ICIA 1UWBA 2NRWA 1ZQMA 2A1SA 2IMWP 3TAMA 3V1OA 4F93B 4YXMA 4E19A 3VA3A 4RNOA 3M9NB 3V6JA 3BQ0A 1Z25A 8ICZA 4DFJA 1HMVA 2C2EA 2BPFA 4GXJA 4IR1A 4O5EA 2MUTA 4RQ1A 3DMJA 4QOZB 5BPCA 1WN7A 4AILC 1NOMA 3G10A 9ICSA 4CGJA 5J2FA 2FPKA 3HVTA 2IOCA 3HYFA 2PFOA 1BQNA 1I3AA 1NJYA 1Q9YA 4HTUA 2BQ3A 5KFXA 5J2MA 1S97A 1TKZA 2H5XA 4DTJA 4M3UA 5DBBA 3LDAA 4ECSA 3B6OA 1XC9A 2JEFA 3O3GA 4M3ZA 1D8LA 4I2FA 2W9MA 3C94A 4CEDA 4RPYA 5HHIA 2C22A 3LP3A 4OKJA 1LW2A 3RH6A 1ZETA 1SZPA 1DGSA 4M6WA 1XSNA 3SPYA 4R66A 2YHAA 4OJRA 2RN2A 4FO6A 5HP4A 2AQ0A 5HLFA 3L2WA 4DL6A 4ECUA 4LSLA 4CFBA 1RXVA 3ZSQA 1KLMA 2MUTB 3WNGA 9ICIA 3RMAA 2J6SA 3KD5E 1A76A 4K4HA 3OY9A 3SQ0A 1T03A 2ASDA 1ZQSA 1CEZA 5J0UA 3KK3A 5CY4A 9ICFA 3G6YA 2ZE2A 3HP6A 4ECZA 4O5KA 2WOMA 3G6VA 3K5MA 4IKFA 3MR3A 3B0XA 1COOA 2I9GA 2P6UA 1SL0A 7ICQA 4J9PA 4HUEA 4ECYA 1BPDA 3MAQA 5J0PA 1BIUA 2F96A 3HPOA 1RT3A 4J9RA 1W9HA 2FMSA 1J53A 1ZQJA 2ZUDA 3BQ1A 7ICOA 2VWJA 2BGGA 1RT1A 9ICVA 1S10A 3QEIA 4DFMA 4PGQA 4DL3A 1VSDA 2XHBA 9ICLA 3DM2A 4RQ3A 1V9PA 3BQTA 1T05A 3S9HA 4LSNA 4DL4A 4AHUA 4FYDA 4KLFA 2OPQA 4QZFA 4EYIB 4ED8A 3C2LA 3NTUA 3AVGA 4KTWA 4DSIA 1U48A 1BISA 3B6PA 4FZYA 4Q0BA 3NGDA 3RRHA 2OA8A 5HROA 4KHSA 1RPLA 4ELTA 3CFPA 4KLOA 3T5KA 1EKEA 3S3NA 5KFGA 2DFFA 1ASWA 3QETA 4RQ5A 4ZTJA 4F3TA 2FLLA 4FJJA 8ICFA 5SZTA 2BCUA 3AA3A 3ZSWA 4KLMA 4QZBA 3RJHA 1FXXA 3AVHA 2HVIA 4J9OA 5CWRA 2JZBB 1HNIA 4N41A 2PI5A 4Q8FA 1TKTA 8ICNA 4QZ9A 5KFZA 4E1NA 3NH2A 3AVKA 2JEGA 3LDSA 4M9NA 4CJ3A 4F4KA 4J2BA 3LP0A 2OPSA 4ECQA 1S6QA 1JL1A 3LPTA 4MQ3A 4HYKA 1S9GA 3RJIA 2HHXA 4AHVA 4KHNA 4I2BA 1ZQAA 3U3YA 2P1JA 4ID1A 1YTUA 2QK9A 3MECA 3ISNC 1NJXA 4B9UA 5CB1A 4QZHA 3QIOA 4KB1A 1EXNA 1IH7A 4NLKA 4FJ8A 3HM9A 2XCAA 2R8IA 3HO1A 4E0DA 3V9SA 3KHLA 1BI4B 2ETJA 1N56A 3AO1A 3RMDA 1MU2A 2M9NA 3NGZA 2VA8A 4TUPA 4CECA 3V9WA 2V4RA 5J2PA 2LSNA 3OYNA 3HXMA 3HT3A 4QZCA 3KHHA 1IG9A 3AVBA 3H8JA 4NCAA 3AU6A 4PWDA 1MQ2A 1HQEA 4NYFA 2BCRA 5KFDA 1RCHA 1U49A 4NYNA 4M0AA 4Q8EA 4F4YA 3RJEA 3P1GA 3UQ0A 1T8EA 1BI4A 2ZTDA 3ORYA 2RF2A 3G0ZA 1SKSA 4O3SA 4Y1DA 5KFFA 5L1JA 8ICJA 1W0HA 3HPHA 2HVHA 2BANA 4CEBA 5HHHA 3NBPA 3ZT3A 1JLQA 1QSLA 4EBCA 4FLWA 2WONA 4ED7A 1RTIA 4I29A 4M9HA 3T1AA 3RJKA 3TR8A 3NGYA 3PW7A 4CJVA 4CEAA 5CZ1A 9ICQA 3ZDDA 3DLRA 5KT7A 1JLFA 1BCMA 1VSKA 2ASJA 3VQQA 4H4OA 2YKNA 3OYGA 3U3GA 5D46A 1K1SA 1YTAA 4BE2A 3RH5A 5I42A 8ICIA 4I2AA 4IBNA 5E41A 1LAVA 4RNNA 3V6DA 2P66A 4DTUA 4FLVA 8ICMA 1ZQTA 5KFEA 3AO5A 1XU4A 4GMJB 1HJRA 4JRQA 4DTRA 7ICLA 5HP1A 3CFRA 4O3NA 3C2KA 3EPIA 2NRZA 1KFDA 3MXJA 3B0YA 1IO2A 4C8LA 3IM1A 9ICKA 4O55A 1VSJA 3H4DA 1XWLA 1ZYQA 4DWIA 4EYHB 2IHNA 2BQUA 4E7KA 3V6KA 4BXOA 3AO4A 4CEQA 5KFPA 1VSEA 2ZUCA 4Q43A 1B9FA 3MEDA 1AROP 3HL8A 4CJSA 4DLEA 3RBDA 4DSFA 4HUFA 4RPXA 2P5GA 5HRSA 3RH4A 4CJPA 5J0QA 3SQ1A 4J2DA 2P51A 4B9TA 1ASUA 4EEYA 3M8PA 4W5NA 1FKPA 3TFSA 8ICVA 4GVMA 4DTPA 9ICWA 4P4MA 3I8DA 3V9XA 5J2KA 1S5JA 4PUOA 7ICMA 4MF8A 3JPSA 4FW1A 4I2IA 1MC8A 2HW3A 4CEFA 3Q8QB 4Z0UA 4BE1A 1L5UA 1NJZA 1CXQA 3CM6A 1U47A 4FJ7A 4F2RA 3D0PA 4UBBA 4FK2A 1Q8IA 5KFKA 1BL3A 3HVRA 1ZQBA 1CZBA 4KLSA 3KTQA 3WNHA 4QZIA 5DQHA 1RXWA 4PY5A 3VQ6A 3ASMA 2HNZA 1PZNA 8ICYA 5CP2A 2AJQA 4CHOA 5J0SA 4E7LA 4XRHA 4QZGA 2GBZA 5CA7A 2D5RA 1G15A 2C2RA 3ISDA 5EOZA 4F5OA 3KKSA 4CK1A 2F1IA 1QSYA 4CHNA 4PQUA 1WSJA 2GWSA 3I0SA 4KI6A 3PY8A 4YVZA 1JXLA 4CGDA 5DB8A 5C24A 4JV2A 4DTXA 5JS2A 2JZBA 1LAWA 3RTVA 1SKWA 4OPJA 1KVAA 2PXIA 5JS1A 1ZQXA 1RDBA 3WNFA 4KTZA 3JPPA 2XY8A 3RMCA 4Q44A 3RAXA 9ICPA 5J2NA 2C28A 1T4GA 1HRHA 1RBVA 4CFCA 1TL1A 3LZJA 4MEYA 3SUPA 1A5XA 1NJWA 5KFQA 4O44A 2FLPA 4BE0A 1VRTA 4KN4A 1TK8A 5KT2A 4JV0A 2PI4A 1GOAA 4ID5A 4JV1A 4OKEA 4PHEA 3TWHA 2VG7A 5TZVA 4IQVA 1X9WA 3IRXA 4PGXA 1O1WA 5CYQA 3Q8RB 5BOMA 3M8RA 3LAMA 4E7IA 3WNEA 4YFUA 3OYEA 2NRVA 4F5NA 4M04A 4R64A 4RQ8A 5IIIA 4K8XA 4M2YA 2B6AA 3DRSA 1CLQA 3S3MA 4JLHA 4I2CA 9ICXA 1DOQA 1KTQA 2FPLA 4C8OA 4ED1A 1ZQQA 9ICEA 3VQ4A 1JIHA 2ZUBA 3UXOA 3TAGA 4EZ9A 1J54A 4DL5A 5KFOA 4IRDA 3MDCA 3NHGA 4AHSA 3L3VA 4CIEA 4CCHA 4NLZA 3QEVA 4YMNA 4RUAA 1LWEA 3HK2A 4O3QA 3KLGA 4IG3A 9ICHA 5KG4A 4FZXC 3T5LA 1QQCA 5EWFA 2B21A 1X9MA 1JLEA 4PHAA 3K5LA 4RQ0A 1RTJA 4EZ6A 4ED6A 4NLGA 4YXJA 1ZQIA 2ZTEA 4Z4EA 3UQ2A 3QZ8A 2VA3A 3HW8A 4DL2A 2W8LA 4M9LA 4MFFA 1SV5A 4TUSA 2X6SA 4TQRA 3L2RA 4KO0A 3MEEA 2JEIA 1RYRA 4DS4A 4KV8A 3MXIA 2IA6A 2R8GA 1HYVA 4O5CA 3NGIA 3NE6A 4ZTFA 3RB4A 2I5JA 3RBEA 4W5RA 5KFIA 4CJLA 4O5BA 3SI6A 2F8SA 4I2HA 3MDAA 3AVJA 3V6HA 2NUBA 3Q8LA 3KHGA 3UXPA 3C5GA 3A2FA 4FLZA 3OJUA 4CFAA 1NK7A 1S9EA 4FLXA 5KFMA 4F2SA 4HCCA 3V81A 3HJFA 2X74A 4M3YA 2HHQA 4YMOA 4LZGA 7ICKA 4DTSA 3V7LA 4CEOA 1K6YA 1Z3EB 4CIFA 4TURA 5KG6A 4FVMA 1QHTA 3RB6A 3AO3A 3VQ5A 3OYDA 1TAQA 8ICLA 1N5YA 3PV8A 4EP4A 3K57A 1IKXA 1RTHA 5DDMA 3SPZA 2HHUA 4MF2A 4ZHRA 2AGOA 5DLFA 4BWJA 2W42A 2DFHA 5KG2A 2BQRA 4RQ7A 1B92A 1HJPA 4OGEA 2OZSA 4ELVA 2EHGA 3PW5A 2W9BB 3OYFA 3QEXA 4GW6A 5EU7A 2IS3A 3K5NA 3V9UA 4QW8A 4I9QA 5KFYA 1ZJNA 4FJGA 4F5QA 2JEJA 4DF4A 3OHBA 1NK8A 2PFNA 4QAGA 4RG8A 2EX3A 4RQ2A 1SL2A 4F5PA 7ICHA 4YG2A 4YD2A 4QZEA 1BVSA 3TAQA 4G3IA 2KZMA 8ICEA 3TAPA 3PW0A 4P4PA 5KRTA 5KRSA 4XA5A 1WAFA 4MFBA 4DU4A 2G8WA 5IINA 2A1JB 3AA2A 4M6WB 2UVVA 1NK6A 4Z6CA 4I7FA 4CGFA 1LW0A 2G8IA 5DB6A 1S1WA 2ZJ5A 3PO4A 4KLHA 3PX6A 8ICRA 3DLKA 7ICGA 4YCXA 4QZ8A 4B3OA 4E89A 3FFIA 3H40A 2XRIA 5KTQA 1KRPA 3BGRA 4CJWA 5KFJA 4AH9A 4CJ5A 1EX4A 2GUIA 3Q8KA 4CGIA 5KFLA 3ZT1A 4KN7A 3VA0A 3TABA 3PX4A 3DYAA 4H4MA 3ZCMA 1Y97A 4G1QA 3TAEA 1H38A 1S77D 4CJKA 4FJNA 5HBMA 4QCLA 1WSIA 1S1TA 2YNFA 4FM0A 1BPZA 3EZ5A 3BDPA 3JSMA 3RRGA 2V4QA 4UB1A 2QKKA 4DU1A 7ICUA 1RZTA 1IM4A 4Z6FA 1VSIA 3ZDAA 3PX0A 1X2IA 2DPIA 2FMQA 3JPTA 3OYJA 1RYSA 2ZTCA 1EP4A 4UB4A 3ZSRA 4UAZA 4QWDA 1SKRA 1JXBA 3C5FA 4NLNA 4B08A 3TFRA 5HRNA 4M9GA 3C1ZA 4FS2A 2AU0A 2PFPA 2B4JA 3VQBA 5KG1A 3TARA 1WSGA 1QTMA 1BHLA 3ZSVA 4Z4GA 4QWCA 2PZSA 3UIQA 4CF0A 3JPNA 5DB9A 4ED2A 4IRCA 1KVBA 1ZQZA 2UVUA 1JN3A 1DTTA 3ZDEA 2KTQA 4IQUA 4KHQA 2YNGA 3NCIA 2BHNA 4J9NA 3HSTB 4KB0A 3Q8MA 5KFHA 2O4IA 2ISPA 3DI6A 4KLLA 3AU2A 4KHUA 2DPJA 5J0WA 4OKKA 4LH4A 5DBCA 3L3UA 5D4BA 4UB5A 3N97B 1CZ9A 1D8YA 1NKCA 4IFYA 2IHMA 4F3OA 4XQ8A 4BDPA 8ICBA 3AO2A 4KITB 4JRPA 5IIOA 5KT3A 1C1BA 1UA1A 1HQUA 3PMNA 2Z1IA 4FS1A 1BPXA 5KG5A 1CUKA 4QW9A 1C1CA 5DK5A 3MR5A 2V9WA 3LZIA 2VANA 3QNOA 5KFCA 2R8HA 4DOBA 3QEPA 4FJHA 4YFKA 3EWAA 5D3GA 4FJMA 3QEAZ 1ZQPA 4CEZA 2FBXA 4E3SA 5J0XA 3HWTA 4CFDA 5KFTA 4I28A 1QE1A 4ICLA 5J2HA 3I0RA 3UPQA 3JYTA 9ICRA 5I3UA 4OLBA 3TAFA 3K75D 1U9LA 3M9OB 3GIJA 2DFEA 4BDZA 1RT6A 4CGGA 4CJQA 3KLHA 1JXEA 4YR3A 1RDCA 5KGWA 3RJFA 3OS1A 1TK0A 1ZBHA 4YNQA 1RT5A 3C2MA 5J0TA 1L3TA 1ZBFA 3NDKA 3VN5A 4DOAA 1ZQFA 5BOLA 4GC7A 4NM2A 4DSKA 2KN7A 5CZ2A 5CYMA 2E6LA 1LB2B 1S6PA 1RILA 2NRXA 8ICTA 3K5OA 4J9LA 4ED0A 4M42A 3GQCA 3AA5X 4OVLA 4M41A 3FYHA 9ICJA 3AVAA 1ZQGA 2HHWA 5J2AA 2BPCA 1S1XA 3M8QA 4E7HA 4KRFA 1BIZA 5KFSA 7ICRA 4B9LA 5DQIA 1B43A 4J2AA 2HMIA 4RW4A 3MABA 1VSMA 1KDHA 4B8CA 4BWMA 3P5JA 1KCFA 1WNSA 1RBSA 5J2JA 3KK1A 3MFIA 2XGQA 1RDDA 1NKEA 4FXDA 3OSPA 1ZBUA 3H8WA 4KPYA 1ZQNA 3RR7A 2G8KA 4I2GA 2F8TA 4RZRA 3OYMA 4HHTA 1KFSA 4DL7A 1UT5A 3ZSXA 1TKDA 2KFNA 1N6QA 2QKBA 1IKWA 8ICHA 4K4IA 4ZH4A 3SUOA 5J29A 3ZD8A 5DLGA 2QXFA 4DU3A 4CJEA 1S1UA 4DO9A 4QZAA 3M8SA 3QERA 4LY7A 3V9ZA 1EXQA 3O3FA 3ZD9A 2RDIA 2ATLA 3OYHA 1ZJMA 4TQSA 1WSHA 4L8RB 4GC6A 3OYKA 4I2PA 5J2DA 9ICBA 4MFAA 3SZ2A 2FC0A 4YN4A 3GV7B 3VQPA 2XY6A 7ICEA 2OZMA 4IRKA 4QZDA 5HNKA 5FRNA 3AVFA 3ZT2A 1QLNA 3FDSA 3LWLA 4DSEA 3C23A 4C8NA 4K4GA 4F4ZA 4JS5A 7ICTA 2BCSA 1S0OA 5KG0A 4RT2A 4DS5A 4IDKA 1U45A 4KLTA 5HRPA 5HMLA 4CJ4A 1ITGA 4N76A 1TV6A 4MFCA 1NK0A 4P2HA 2VG6A 4K8ZA 3SJJA 2YHBA 3NH0A 2IGIA 4YMMA 4J9QA 1RBRA 3OS0A 9ICMA 3C21A 3PR5B 3GIMA 4AHTA 3LWMA 1YT3A 3SV3A 1J9AA 2VG5A 3VQEA 2YV0X 5KFWA 4KAZA 2AGPA 1RBTA 4ECXA 4RPZA 1KFTA 3LAKA 4KREA 3OJSA 3K58A 3MFHA 1VRUA 5J2BA 4KKOA 5J2EA 3V7KA 1JLCA 3DLBA 5JUMA 3AVIA 5J2CA 3THVA 7ICVA 1DTQA 1FK9A 3SQ2A 1Z00A 3RJGA 3GIKA 3SV4A 3T5HA 2YNHA 1D5AA 4JWMA 3SQ4A 2MAXA 5J0RA 4I9LA 4BGDA 3V72A 1S0MA 2FBVA 1R0AA 4CF8A 5KFBA 4AHRA 4QWBA 5KFVA 3P83D 2UVRA 2XGPA 1U04A 5FDLA 4J9KA 4FBUA 4FJIA 4B9VA 3MEGA 3JPRA 1VK0A 3Q8PB 3K4GA 3LK9A 7ICJA 2RKIA 1A5VA 4I27A 4Z4IA 5L1IA 4FJXA 1TGOA 3LANA 3PMLA 5J0YA 4DMNA 3EY1A 5F9LA 4DQPA 3KLIA 2P6RA 1IXRA 2NRTA 3F73A 3ZSZA 1KEJA 3IS9A 4HUGA 3H7IA 1NOZA 3ZSOA 4RU9A 4NXZA 3L2VA 3D45A 3RR8A 5DBAA 5KGXA 3V7JA 2ZQBA 1IKYA 2G8VA 4KLJA 4FK4A 4F4WA 1SL1A 1JLBA 4CJRA 4P4OA 1C0UA 1VSLA 3OVNA 2YKMA 4J2EA 4F50A 3QO9A 1KSPA 3OYBA 2W9CA 3QEBZ
chains in the Genus database with same CATH superfamily
1GNKA 2CQPA 2O8BA 2QWNA 1TVAA 2JXJA 1LWFA 3H8SA 3PNCA 1H2UX 1M5OC 1WSVA 3KLEA 2I9SA 4DR6K 3WHIA 4ECVA 2X6NA 3W64A 4I2DA 1IVZA 4FM1A 3I9ZA 3E9LA 5AZJA 1T3NA 1WG8A 3MX2A 3C6TA 4LF6F 3I4PA 5ETRA 4JYAF 3MMVA 1UW9A 5FJ4A 5DG8A 2RRDA 2K4EA 3SAGA 3GWCA 3QIPA 3V1RA 4FJ9A 1MLAA 1OXJA 3PJWA 3L9ZA 4E1MA 1XQIA 4CHQA 2DD8S 3PFEA 1ECWA 1F21A 3MECB 2FF3B 4NL9A 2PMZF 3GILA 4O0IA 5FRMA 3OR2A 5DKWA 3VC8A 3SYZA 3QE9Y 4N47A 5JRTA 1KLMB 3Q23A 4PZOA 4CEEA 1SJQA 1RTDA 4I6MB 3W2VB 2P9SB 3L7OA 2H3QA 1NPPA 5AI0A 1ZQCA 3B4DA 2WB1F 4WXWA 2RU3A 3PUFA 2AJ0A 1PVRA 2JL9A 4X4PA 1WG4A 4LF7J 3V4IA 1Z05A 2WVBA 4RW8B 1EX8A 5LMUJ 3QMLA 4DCPB 1Q79A 1X42A 5CH7B 4U9RA 1JNRB 1YHQN 1HWUA 2X3DA 1FFWB 4AHCA 4A8QA 2DRAA 3CW2C 1GXTA 2I5JB 1BGXT 2IVPA 3LUYA 4DV3F 2DFLA 2CJKA 4TYBA 3EO3A 3VGSA 4JUZA 1WNEA 4BR2A 5KG3A 3KNGA 1QD1A 1M1KO 4IS7A 3GIIA 3RMBA 2ZEJA 1PG5B 2G0IA 1HNXF 1LV5A 2WC9A 1B9DA 4O9MA 1S8OA 3K59A 2PEHA 2YNIA 8ICXA 3IAYA 5AZIA 3HI0A 2CNNB 3MTKA 4FWSA 5DMRA 5BPMA 2DY4A 5E3CA 3GV5B 2V2QA 3DGPA 3MPYA 2EBEA 3HZGA 2ZJRQ 1EWRA 4IDKB 3V81B 2VG5B 1XNSA 3G82B 3MD1A 4JI4F 1QTNB 2O4GA 1R27B 4OX7A 2VWKA 5B09A 1XO1A 4CF1A 4KHYA 1OKJA 1R31A 3SEOA 4LFAK 1BDGA 4ZCKA 3UDCA 2DH8A 4GXIA 1ZQOA 1RP5A 1N32K 1HD0A 1RBUA 3C6HA 3CQ8A 4PAAA 2HWIA 4OJ6A 1ZQRA 2BXJA 2V4JB 4J7CA 3D2FB 4CF3A 4TY8A 3HOTA 1GOBA 3CHWA 3FGVA 2LYVA 2MQQA 4BR9A 2A2CA 3AODA 1BPEA 4CZLA 3ALYA 1D9DA 4DR7J 5CQGA 2QWMA 3EX7B 3UXNA 2Z56B 3QT8A 4M7YA 1ZBLA 5KFUA 1VDHA 1QQ6A 4RR5A 1DT9A 4QWAA 2BEFA 2VOPA 4IXCA 2CIMA 2E4LA 2RLTA 4WF9Q 3N4PA 1N34J 4KFBA 5AE2A 3QWPA 3P49B 1M5KC 4YOEA 1T9VA 4ILGB 3ZDCA 1RBOB 1SXLA 1X60A 3L2UA 1B0TA 3NOGA 4BROA 1C1CB 4AUKA 3NS5A 4WIQA 3SBGA 3BGUA 3BS9A 2VBXA 3CDEA 2ZH4A 3KJFB 5HP1B 2HBLA 2FMPA 1JLQB 1VLBA 3CJ5A 1TKXB 1WCNA 8ICQA 3A4TA 2FJAB 2DNYA 5HVFA 4JI5J 1FRLA 4P73A 3RB3A 4FDFA 2F3JA 3NXZA 1MROB 1D9AA 1FE0A 1HLWA 4TSXA 4PEOA 1IBMK 2JFDA 4YOXA 3D68A 5AM2A 1RT7A 3MEKA 5B0AA 3QGPA 2F4VJ 1NJIO 2LXUA 4RBVA 1E4FT 4CLWA 3D2WA 3FUYA 4PHPA 4FYXB 4W98A 4LF5F 2DXEA 2RHFA 3T1YK 2MLZA 4QPTA 5E7OB 5IIMA 2MGZB 3QBCA 2JGUA 2I38A 3H0PA 2A1AA 5F8MA 1FT8A 2HFOA 2G8UA 5BN9A 2FI1A 2W9CB 3O1BA 3MMAB 3C46A 3U8XA 2VFVA 1QSSA 2VBWA 2HGNA 4CF9A 1ZD2P 1WWHA 3NMAA 3VERA 4NM1A 3KJNB 4F72A 1HNVA 3CD7A 3F0NA 4JI3K 4RW6B 1YVUA 2ZWHA 5BRFA 5HOOA 3NF6A 4LR8A 2MKJA 2A40A 1VQ9N 2UXBF 2PA8D 1RM6C 2OUGA 2ATQA 2IFXA 3NKYA 4DFPA 3GPAA 4JK8A 3KLHB 3TZZA 4CGHA 2J6UA 1GX6A 3FRZA 2W2QP 2YNIB 3HRGA 5FROA 1X9JA 4KX3A 5GADU 3H7HB 3ZZRA 4CLZA 2ZFHA 3ZT0A 4X4VA 1K1QA 2Z2YB 3MCOA 3EZWA 1YTYA 1ZQWA 4DR5K 4JKBA 2ZZTA 1TP7A 3OTOF 2F1HA 3CFOA 3NASA 8AT1B 2KP7A 2W3SA 1QVFM 4XUSA 1QVFR 1CULB 2XLIA 4ECTA 1CS4A 1T02A 2G06A 2KZZA 2IVFB 4C11A 1YJUA 4LF8J 1TFRA 3CDWA 8ICSA 4OYBA 2UU9F 4CZJA 4J9SA 3B78A 5M2RA 2F8EX 1FXDA 2A1JA 3N7SC 1UAWA 4MEXA 1NPKA 4ZVRB 3CCTA 3N9UC 1X8DA 3OS2A 1E3MA 5C25B 4LFCJ 1A0PA 3M2VA 4JI4K 4XAKA 3FQKA 3NH1A 1PUZA 1ZQLA 1L3VA 4C23A 3FZLA 3CCQN 3ALRA 2VQFK 4CO0A 2G8HA 4O3OA 4ZKAA 2Q66A 1TUUA 3WEEB 4CHZA 3RBXA 3R5JB 2QLBB 3EPGA 2R2SA 2KL8A 4KLDA 2YPYA 3TI0A 4Z6DA 4PYAA 4FVUA 2NPFA 2W1BA 4M47A 1X4FA 2VQEK 2W9AA 1DURA 2BDPA 3AV9A 2E9TA 3EUNA 4C3KA 3RSEA 3QAEA 3TZWA 4KJIA 1EQYA 1SI9A 4TUQA 2KJ5A 4UOHA 2GMHA 1B0VA 3AJ1A 2J8SA 1NOYA 5C0YA 1FFVA 4BRHA 4RO0A 3ISBA 4N5SA 3BPDA 3FCWA 2XO7A 1BY9A 2V6AA 3NG8A 1RT6B 1FD8A 2YX1A 3QSYB 4JK7A 3IG5A 3UMGA 5J2MB 2UXDJ 2B4OA 2BPGA 5BR9A 4GVLA 4DQSA 3LPUA 1UJ6A 1C20A 3ITHA 2BDUA 4KMUA 3QINA 5ALGA 4BRQA 4LD0A 1ZQVA 4DZDA 2OMOA 3DNCA 3BP8A 3CCVN 4ZP6A 4P2MA 4LF8F 2DTUA 4J9VA 4DV0K 2E1RA 2K8GA 2J0QD 9ATCB 2WF5A 1HMVB 3H5XA 2R7VA 4IFYB 4DTOA 5J1EB 4WBFA 5AQXA 4M3XA 4EBDA 1A0OB 2RHQB 1X5OA 2I7NA 1MQ3A 1WC6A 5LSOA 3CPWM 2I6XA 4EELA 1XHZA 3GYNA 5IQQA 1V3SA 8ICCA 2LU1A 5DM6L 4DQIA 2BE7D 5LM7E 2RD5C 3NFAA 3EE3A 3HCXA 2Y0BB 3R5AA 4OLAA 3D1OA 1Z00B 2J6TA 3MPVA 2FPMA 2BR0A 1NM2A 9ICAA 4LRFA 1W7AA 2P9NB 3KNAA 4XIUA 3J81j 1B4FA 5JLFA 3T1YJ 2HB5A 4W90B 1QAIA 5CA5A 4LBHA 4JI0J 1D3WA 4JI2F 4FWPA 4GO7X 3AARA 3QFUA 5BYSA 5AK5A 2BE2A 4ZPWR 4X64F 2ASYA 1VSHA 3CJ2A 2V63A 3M6UA 1OWXA 4HT5A 3G6EN 4CYUA 4UT4A 3EICA 4I2JA 3QNNA 4IO9L 3W5ZA 4H5NA 1S5LU 4QNLA 2CA9A 2Y8YA 3H42A 4RBUA 3NS7B 3TAMA 4YXMA 4DR3F 5B0DA 2QWLA 3M9NB 1RU2A 2VG7B 2ZBQA 1T9WA 2KHCA 3GR0A 1M5HA 4K42A 3MI7X 1SIZA 3GCWP 1HMVA 2BPFA 2ZJPQ 4IR1A 4AL5A 4C4RA 4P0PA 4OV6A 4DPOA 5LMNJ 2WB1D 2MGZA 2P9CA 1WDTA 4OJLA 5BPCA 4DR4K 3O9QA 3N7RC 2AP1A 3WBZA 3C16A 5BR8K 4U8YA 3HVTA 3OL7A 1RDFA 3IR5B 4C97A 3HYFA 1S7IA 1BQNA 3MD3A 2VB6A 2YPZA 5KFXA 1RCOB 5J2MA 3A8IA 2H5XA 3ET6A 4DTJA 2DNZA 1Y5NB 4H54A 5DBBA 4ECSA 1URRA 3B6OA 2V8VA 2CQDA 3O3GA 4I2FA 1LEOA 4DUYF 2ABYA 4BG9A 3W0LA 5EUHA 1JLCB 1VK8A 4GV6A 3TTFA 1NNDA 4ZP8A 3RH6A 1ZETA 5IM0B 2VQFF 2L9NA 1XSNA 2GWJA 4AFFA 4OJRA 4JI2J 4FFDA 2RN2A 2KYXA 3AD9C 3R6MA 5HLFA 3L2WA 3GLJA 2NRHA 2LMIA 3ZSQA 2YHXA 3UKUB 2N82B 1YWXA 3WNGA 1MDUB 3UW1A 3KD5E 2C2MB 2GH1A 4K4HA 1T03A 3SQ0A 1RHRB 2R7WA 2C2ZB 1ZQSA 5J1PA 2J5AA 5J0UA 2ASMA 5CY4A 9ICFA 1CG2A 3HP6A 4ECZA 2WOMA 3G6VA 1R8PA 4JNEA 3D9BA 4IKFA 3CT9A 7ICQA 3OTCA 1UZDA 2EEYA 2DGOA 1FDNA 1Q53A 1LVHA 1RAOA 2K3IA 1WWUA 7ICOA 3BQ1A 3R9PA 1NAQA 9ICVA 4K4WA 1TYQB 2ZJQQ 2G08A 1E4GT 2UXDF 3ULEB 4PGQA 2CN1A 3EM1A 1PK1B 1IR2A 5T14A 1YJWS 2IC3B 4IG0B 3TTCA 4LSNA 4DL4A 2RILA 4ED8A 3QQCD 2YX4A 3VGLA 4KTWA 4HDHA 2O67A 4QR1A 4LF8K 1CJKB 4S0MA 4FZYA 4ISGA 4OMFG 2OA8A 1ZZFA 2OJ3A 1URJA 2ZF5O 2VIHA 1FNMA 1KP6A 3E66A 1HBMA 4JI8F 5E79U 3E3XA 2GCFA 3N5BA 3AA3A 2VC0A 4WKYA 4YY3F 3BKFA 4JKEA 3UDLA 1FEEA 4C7QA 1XMOK 5LMUF 3LH2S 3ILOA 1QQMA 3NH2A 2CVIA 4NPOA 3B8AX 2F77X 1QHAA 2FJXA 5D6GA 1S6QA 1JL1A 3LPTA 4AQYK 4HYKA 1TUYA 4NLYA 3MAAB 5KAKA 3WDOA 3O1LA 4I2BA 1WORA 4JKCA 1JK9B 3AJDA 3H2LA 2YQEA 5IWAJ 3UKRB 1GLFO 4Y34A 3W60A 1IQZA 5CB1A 1RTHB 3QFPA 1EQMA 2FYXA 2MHEA 1IH7A 4NLKA 5AT1B 3LDNA 2Q97A 3UI3A 3GG0A 3MM5B 2QWRA 5AQRA 2DEIA 3V9SA 3KHLA 2ETJA 4NXNJ 4MIAA 1PO6A 1U0HA 4PKGA 1X6JA 4DV1K 1U2VB 2M9NA 2VA8A 3V9WA 1NZPA 2JJ4D 3NGKA 5F8GA 4QZCA 3KHHA 3R9KA 3LL3A 2OGUA 3AVBA 2AJ1A 3TRGA 4NCAA 4WCEQ 2HMPA 4I0WA 3GSDA 1V85A 4PWDA 2EC0A 4NLXA 4NYFA 4Z7CA 2KEYA 3ZEUB 4DV5F 4F4YA 3CD5A 2KM8C 3BBBA 4FZLA 4GVBB 3P1GA 1FNOA 2FHKA 2DGUA 3ORYA 1ZPWX 4MKAA 2NO4A 4RJVA 3UVJB 4O3SA 4Y1DA 1YZ7A 5L1JA 8ICJA 1W0HA 3HPHA 2I6WA 1SV0A 1PILA 2OEMA 1JLQA 2V34A 2LQ8A 1WG1A 3L4BC 1C4AA 4BRGA 4M9HA 1HWIA 4MKVA 2RVJA 2IA0A 2BH1A 2E7VA 5E3RA 3OFFA 4CJVA 4WP9A 5CZ1A 3K9JA 4EO8A 3DLRA 2I5HA 1BCMA 1PJ7A 2IM0A 3UCGA 3M8ZA 3Q22A 3U3GA 5D46A 1HHTP 1O08A 3EZOA 4BRKA 4J9UE 4AM6A 4LF9F 3RH5A 5I42A 8ICIA 8RUCA 2V2VA 3MOZA 4CLLA 2LEAA 4DFDA 3MMBB 3V6DA 3QJPA 3HBTA 1R43A 4JRQA 4DTRA 3MWPA 7ICLA 5HP1A 1DTTB 4AD6A 4A5AA 1Q46A 3A12A 3IBCB 3TUZC 4B3TK 1KFDA 1NRKA 3MR7A 1IO2A 5JMVA 1BLUA 3IM1A 9ICKA 4QIWF 2LHTA 3BGLA 2Z58B 1WI6A 3WK5A 4EYHB 4E7KA 2UZAA 3V6KA 1SUQB 4CEQA 3CMES 4PRFA 2OPQB 1IBKK 2XZWA 5GMEA 5HMYA 1Q82O 1N33F 2UUBJ 4DSFA 2RSQA 5HRSA 1SPBP 1FEHA 4CJPA 3ZI4A 4NI2B 4J2DA 4B9TA 2PMWA 2G9OA 2G5HB 4NLCA 3MDQA 4NRTA 3GIRA 3I56S 3OVSA 3THYB 4W5NA 4Y2YA 2EKYA 3K2YA 2IY5B 3I8DA 4JI1K 5J2KA 1S5JA 4PUOA 1REGX 1OW5A 5AQKA 2LYBA 4I2IA 4Z0UA 4BE1A 3A3OB 3A8YA 1HR0F 3NCPA 1CXQA 4DBQA 3M7VA 4FJ7A 1Q5VA 1XIQA 3KLVA 3HVRA 1YJ9S 2BJEA 2JX2A 1H0HB 4LFAJ 4KLSA 1N34F 1SJ1A 4DR7F 1N5QA 3NEKA 5BPNA 3WNHA 2D9PA 4N8OA 2XZTB 4NXMF 4PY5A 3SQOP 2HNZA 1NBWA 1TE2A 5CP2A 2ZH3A 4XRHA 1X5PA 4QZGA 3QFHA 2GBZA 5CA7A 4ZMMA 1NGEA 3F9MA 3EJMA 4BR5A 2VBYA 5EOZA 4CK1A 5AI8A 2GWSA 2ZH2A 1O0PA 2OFHX 1KTVA 2M5YA 2JC0A 1YJNN 5L46A 5AXMA 2I2YA 4ZCIA 4CF4A 1KVAA 3TJAA 2W4PA 2PXIA 1RDBA 1VAZA 1ZBSA 3OL8A 1S57A 2RQKA 4EX6A 2MZJA 2DNLA 3AOBA 3MM6B 3EE8A 2HAFA 1DQ8A 1RBVA 3H0RB 3K1RB 1KHWA 4CFCA 2LPEA 4URSA 1WJ9A 2IOHA 1VRTA 4LF7K 1R8BA 2DUYA 2UUCJ 2ZZNA 1Z4OA 1VJ5A 2VF3A 4A8YA 4JV1A 3AB2B 5AKLA 3PM9A 2DNGA 3M1YA 5AKHA 4OPHA 1YRXA 4ZVHA 3TWHA 1X9WA 3BGFA 3SJHA 1HBUB 5BOMA 3LAMA 3QO9B 2EC2A 3ULEA 2Q1LA 3SK3A 1MU2B 4US9A 1VCTA 2ZM6K 4R64A 3JQMA 4RQ8A 4WQ5A 4OLOA 4QYZJ 2VG6B 2B6AA 4G9BA 3G9CA 4B1XB 4JLHA 4PABA 3VEVA 2HQGA 3SD7A 1ZQQA 2XYHB 4PUOB 5AZJB 1KW4A 5MLCV 1S9EB 2F9JA 1JIHA 3TAGA 1N52B 3MM7B 3GB0A 4DL5A 5KFOA 1SC3B 4A8OA 3C6AA 5CEHA 3GZ7A 2I8EA 3L3VA 1KAZA 5AK4A 4CCHA 4NMLA 3J7YI 5AQYA 3HK2A 2CKWA 1VHFA 4WIIA 3A1YG 2GTDA 1F3VA 1F9EB 4PHTX 4FZXC 2PE8A 3G8SA 2UYTA 1JLEA 4PHAA 3CJ0A 1RA6A 2KKVA 4RQ0A 3OW2M 2XQCA 4EZ6A 4YXJA 1UEVA 1BQMB 4CNQA 3FNNA 2UU9J 3CXCR 3UQ2A 3CF5L 4YB1P 4CLKA 1AZSA 2X6SA 4YOYA 1OH8A 3MCAB 4B17A 3L2RA 3M32A 2HHHK 3MEEA 2JEIA 4OHWA 4KV8A 3MXIA 2XSJB 1RQLA 3NGIA 4W5RA 1F2HA 3CC7S 2MA1A 1T11A 2U1AA 3WIUA 1CQNA 4CJLA 4O5BA 2MZQA 2B6GA 2OANA 1XNQK 2KXNB 4OI2A 3MDAA 1RCXB 1KC8T 2NUBA 1VDVA 3AXKA 3KHGA 4ZVOB 4FXVA 4ETZA 3C5GA 1RDUA 1HWLA 2DO4A 3KK1B 3A2FA 1GLJO 3HI9A 1CJTA 4X4NA 3R97A 1H7WA 1I5OB 1WG5A 1A6LA 1S9EA 4FYVB 1U09A 5AJ3F 2PA3A 1T9XA 4DOZA 2F8KA 2E8OA 3HJFA 3L6QA 4M3YA 1T9YA 3VAKA 1N60A 4B3MF 1O03A 1Z3EB 4CIFA 2JNJA 2Q6BA 4OZNA 3VQ5A 1QHTA 2BW7A 3OYDA 8ICLA 3QGGA 2YNFB 2BJ7A 4ZCMA 2MSSA 4AE5A 5A6WA 2YTUA 1EZZB 2O66A 3LDPA 3IC1A 3SPZA 1X7VA 2HHUA 4MF2A 2EK6A 2QLWA 4BWJA 3H1VX 3CWJA 2W42A 2OIHA 2DFHA 1C0GA 3KK2B 4F67A 4RQ7A 2ZNYA 5CD4A 1WUDA 3R5CA 4MH8A 2MQLA 2D3OR 2ZDPA 2OZSA 1UZHA 3PW5A 3QEXA 5EU7A 3IBWA 3VOVA 3K5NA 3QGIA 1SH3A 4TLRA 1VQMN 4F5QA 1JLGB 5D4LA 4DF4A 3QRQA 2OTLS 2EX3A 1WWVA 4ER8A 4YD2A 3G6ES 3TUIC 5ALEA 3MCSA 1LCUA 2LI6A 4WQ4C 2BTFA 4HAIA 5I42B 3TAPA 1XN9A 2M9KA 4FF1A 3N28A 5AI5A 4XA5A 4MFBA 3H2VE 4P52A 4DU4A 4A8EA 2G8WA 3J7AP 1SV0C 5IINA 4CZKA 2YX7A 4ZN3A 3KUHA 3I0RB 4DV2K 4IH5A 1FX2A 5ALTA 1LW0A 2P9KA 1S1WA 2L41A 1V9OA 2B4PA 3PX6A 4QZ8A 2GFFA 4B3OA 3BKTA 3FFIA 4LBPA 4I6MA 4YB5A 4FYWB 3BQ7A 3H40A 5KTQA 1KRPA 3RW6A 2CJ9A 4AH9A 1QQ5A 4CI6A 1RWOB 3Q8KA 4FP9A 4KN7A 3TABA 4H4MA 3E1YA 4KQZA 1JJ2M 1SC1B 2W6LA 5HAOA 2O1PA 1WC5A 4XO0A 2WFBA 2XHWA 4BS2A 4C4SA 1WSIA 1GAOA 1RU1A 1S1TA 2UUBK 1VK3A 2GV1A 1FDBA 1HQEB 2DO0A 2K4PA 2V4QA 1T6DA 4JYAK 7ICUA 3I76A 1VSIA 2FMQA 3F5EA 4TY8B 3QATA 2Y9HA 4H5WA 4ENOA 2KOBA 3UB5A 3ZSRA 4K4ZA 4UAZA 1Y7PA 1SKRA 4HI1A 4NLNA 4K4VA 2PFPA 2IJFA 3AHPA 5KG1A 5G0RB 1QTMA 4Z4GA 2PZSA 1X4GA 2Y1LB 3EL2A 4C80A 2YMLA 1GMUA 2FZGB 2QWOA 2H48B 3I32A 1KVBA 2KICA 3QYYA 2IVYA 2UVUA 4ZDNA 2W24A 1PC4A 1M90T 3NCIA 4US8A 4PG5A 2BHNA 4BRMA 4GKKK 3HSTB 1HW9A 3S1TA 2ZOGA 1DQAA 2HK3A 3VWSA 4QJFB 4ZJQA 4I69A 1YF5L 2UXDK 5D4BA 3R3LA 4BUGA 4A5BA 3CJRA 1D8YA 1NKCA 1PSDA 4QOTA 2IHMA 4F3OA 5JLHA 4PXDA 2XMMA 5AM1A 1S9GB 1RTJB 4KITB 3POTB 4AP9A 5IIOA 4UOFA 4M5MA 2D3DA 3PMNA 3FZFA 2FVSA 5D4NA 5KG5A 1WD6A 2JV3A 3PKMA 1GMVA 3MR5A 4M5GA 3LZIA 2W41A 3CCQS 2R8HA 4K50A 2FGCA 2XMUA 3EWAA 5HK4A 5D3GA 1O13A 2QG9B 1ZQPA 3HWTA 1SV4A 2FDRA 3FC4A 5KFTA 4CFDA 4LIRA 2KI2A 1UJ5A 4LF1A 2YB4A 1D8BA 5J2HA 1RZMA 3UPQA 4C8YA 3PHEA 5J8YC 5I3UA 2OELA 3PRVA 3CVKA 3K75D 1YIJS 1S6PB 4B3RK 3FZKA 1SCJB 3PIOL 4CGGA 1PVPA 3KLHA 3EDQB 1SXEA 3O08A 1JXEA 3VEWA 4JN4A 3NRWA 2A6OA 3HKZD 1RDCA 1SZ2A 4FWNA 4BGAA 1OYEA 2EFVA 4YNQA 5J0TA 1IBLJ 3JSYA 3CJAA 5IC4B 1ZQFA 5BOLA 3D2SA 2DNRA 2VFTA 4IQXA 2LEBA 1RWPB 5K8MA 2QL5B 5AI9A 1S6PA 3VHQA 4J9LA 3Q7CA 4M42A 1ZQGA 3AB4B 3DV9A 2JR5A 4NLVA 2YKQA 1S1XA 3M8QA 1BIZA 3QU7A 5ALXA 5KFSA 1YDLA 1KVJA 4GRSA 4NA3A 2CJQA 2KJ8A 2DPNA 1CJVB 1JCFA 1XK8A 1HLUA 3MAAA 3K8WA 5K8PA 4ZVPB 2J4RA 5FPDA 1P7DA 3KKAA 1RDDA 2KJVA 3VAHA 1S1TB 2QYGA 3G96A 2G8KA 3U9DA 1HQUB 1UT5A 3BF3A 3KOOA 2HS4A 2HQ3A 1QAYA 2VASA 8ICHA 3QT7A 2EFOA 3VF0B 4ZH4A 3SUOA 3HJVA 1BQXA 1YAGA 2UUCK 1YBTA 4LJMA 4K2XA 4DU3A 4CJEA 4DO9A 2R7QA 1N5TA 2E2QA 4LY7A 1ZM3A 3V9ZA 3I28A 4B1VA 2EXUA 2E5LK 3C16B 3P5BP 2ATLA 1FWLA 2YHYA 3UD4P 4KV8B 4YB6A 1TMMA 1UVNA 4I2PA 5KPRA 4MFAA 3T9ZA 2WAQC 4PG4A 2H4WB 1FDAA 4FWKA 1XMQF 1PYOB 4LREA 4ZK7M 2JRSA 2UV8G 5M2PA 3AVFA 1RT3B 3UR3C 3ZT2A 2CPHA 3LWLA 4DSEA 1SH2A 2P9LB 1IV8A 1VBYA 4WXOA 3JTOA 4B6JA 1RFQA 4DMZA 4UTGA 5HRPA 2R7SA 4BRDA 2PFFB 2HS0A 3SEIA 2NYVA 3DGPB 2Z4PA 1GK8A 4PG7A 4HEA9 4P2HA 2HZCA 1NGCA 4CLUA 4J9QA 3QU9A 3GIMA 1DQ9A 1XR5A 4OZ2A 3LWMA 4DHVA 3SV3A 4PL1A 2VG5A 4ZVSB 2KHQA 3VQEA 4OJGA 2YV0X 4R25A 4YDXA 1LKZA 2WK4A 2K2PA 1X5TA 3RW7A 1GFWB 3OL6A 3IMXA 1N2XA 1RGIA 1NMEB 4M5DB 2HBMA 4C0HA 1FWKA 7ICVA 3SQ2A 3GFYA 2VJ4A 2Y3YA 3GIKA 2BABA 3UCZP 2E1PA 2YNHA 3UKRA 2CAJA 2LMRA 5IS2A 2QT7A 3KDOA 2DHGA 3OW2R 2ZH7A 3T1HK 3DRRB 4BGDA 3OXGA 2ZHOA 2FBVA 3L4QA 1R0AA 1HR0K 4H03B 5KFBA 4K25A 3PYEA 3HRDD 3DLGB 3P96A 2UVRA 2XGPA 1U04A 5FDLA 4JBCA 4KGKA 3O5BA 4F71A 2NUUG 1X4EA 4X4UA 1VK0A 3Q8PB 2P9UA 4NO7A 3K4GA 3LK9A 4RTFD 2V8HA 2RKIA 4NX9A 2P9PB 5BXIA 5DDRC 3O6QA 3CNHA 3WT0A 2MKSA 1N36F 1RWWB 3DOMB 4DQPA 2P6RA 4NYOA 2MZ1A 5IT9O 3ZSZA 4I1TA 3DWLA 4UUXA 1FFSB 2HPUA 2QMXA 4RU9A 1JROA 1XBWA 4EEKA 3RR8A 5DBAA 3J7YU 4BRNA 4FK4A 1JLBA 4CJRA 3D6JA 4ILRA 4P4OA 1YHQS 1C0UA 3IDWA 3IGNA 2FC8A 2YKMA 2DH7A 4B3SF 3CF5Q 2FJEB 1T05B 1SGGA 2B7CB 4HTLA 2UU9K 2QEXS 2WUSA 5KAIU 4KLGA 4CJTA 2R8JA 2KZ3A 3NVWA 2E8MA 1KN5A 1FO1A 2EI5A 3DRYA 4M3WA 4DQQA 4LF4J 4U67L 1HNZK 4FKYA 5DQGA 4L72B 3CQXA 5DDYA 4CD1A 4O8UA 2Y1IA 5F8HA 5LJ5Y 8ICGA 4CJFA 2HBRB 2D0AA 3MUTP 1HNVB 1MSWD 3JS6A 4F26A 2VJUA 4K59A 2KO1A 4PGYA 3EDRB 1WBDA 4G65A 1X31C 1B3TA 3KLFA 3KZXA 3HP9A 2GC8A 3JPQA 3PIPL 4P75A 2ZHAA 1KVCA 3M32B 4IR9A 4CHPA 4P6QA 3CGIA 3TUJC 5CRXA 1B99A 5FPMA 5H1SV 2IYIA 1X4CA 4DV4J 3ZT4A 3I31A 4M45A 2IOFA 5CHGA 4U67Q 2J0XA 5FPNA 1ZQKA 4CESA 2Q2RA 2HEKA 1LNQA 1UPMB 4F5RA 4FF4A 1E6YB 4IOCQ 5IT0A 4MK9A 2QFJA 5IWAK 3CCRS 3DRPA 5T7BA 1VISA 5E5NA 4OJPA 3NNAA 1OMSA 1PBUA 3OFGA 3OYLA 1VQON 2FJDB 1P6TA 4RUCA 1O8BA 1DRZA 3OD2A 1Z1ZA 4DTNA 2D0CA 1S79A 3TADA 3GL1A 3NF8A 3MM8B 1JLGA 3A3PB 3VR1A 2BOPA 5AK6A 1JQGA 2D4WA 1QUVA 4ILMA 3TANA 3VQ9A 4BC9A 4R79A 3H6EA 3MTJA 4CO2A 5HRRA 2C3OA 2XYPB 4DPUA 4PA1A 3P31A 4WU3A 2V8PA 3RZAA 1A7GE 4Y2VA 3CYMA 3NS6A 1C7YA 3R5DA 3VALA 4MLEA 4M9JA 2WF6A 4OGCA 4CHYA 3R8EA 5C5JA 2I0XA 1GLEG 1UVMA 5J2QA 2LA4A 2ZIUA 4BQZA 4H0XB 3PW2A 3D4JA 3B82A 4KGZB 4TN2A 1JL2A 5AE3A 2DHSA 1U1RA 2E1YA 2ZE2B 2AEJA 3IHQB 1H72C 3WQTA 3ETRA 3DXKB 3K5PA 2IHR1 2X7IA 3FC9A 4C98A 4MYTA 4RQ6A 4AYBF 1NZ8A 3T1HF 4DQRA 3TP2A 1FJ7A 1UPPA 1VGYA 5EWEA 3QXGA 5IILA 7ICFA 1A9NB 2IVMA 4C6AA 2M0NA 2GEMA 2DHXA 2HBKA 3G82A 9ICTA 5L1KA 2KKPA 1W2IA 3KD3A 1DAXA 1L8OA 4KAIA 4JMUA 3D0IE 4OJ5A 4W5OA 4UOGA 2V50A 2ZBCA 1J5OA 3I33A 3CO0P 4I2QB 2ZH6A 3GONA 2Y0SC 2VFUA 3M6ZA 3E2EA 4LVSA 4PL8A 1ZQDA 3VQAA 2E29A 3ITHB 4H4OB 3IAS9 4DZ6A 4Z6EA 2H5IB 2PN6A 4LVOP 2P9UB 1BPBA 4JHDA 3GV8B 2WBMA 4USMA 1ZM4A 3N6MA 4JI0F 2UXCF 2KE7A 4AT1B 3AEVA 3LPYA 2GV9A 3ZEUA 2ZIVA 4DOCA 4B3SK 4JS4A 1JMSA 1IKVA 2Z0GA 4NLQA 4CQ1A 4R0EA 3V4IB 4QPXA 2E5JA 4LH5A 2MTLA 8ICKA 1T9TA 3VVUA 3MGVA 1IBCB 2OEJA 3OR1A 1XERA 5C2GA 2GO7A 4NA2A 1FW6A 1NDPA 4YOWA 4W5QA 4DUYK 4QR0A 3NVMA 2CJXB 5KFNA 1VQMS 3N4MB 1HUZA 1XI1A 2B5JA 2P35A 2XMJA 4RWWA 4HVZA 4ES3A 2E20A 4CE9A 4LRDA 1UVKA 2XI2A 2OPRA 1TZ0A 1N62A 2HVDA 2QFIA 2ZUGA 1DEJA 3QIPB 3PSTA 3G6XA 1TL4A 3ULDA 4YP3A 3D7SB 4DG1A 4B9MA 1FJEB 3FVYA 1TAUA 4EO6A 3C0BA 4BACA 4UAUA 4NRUA 1C0TB 3CJ8A 1WLJA 2YQ3A 4DU8A 1AQ6A 4HACB 3MGIA 2RPIA 4DQ8A 4R8UB 3HD1A 2J9CA 4BQLA 2W43A 2W8KA 2QARA 3BGRB 3CETA 3SQIA 4JI6F 4YMEA 2DK2A 2HNDA 4K7QA 5HMMA 5GAHP 3MR2A 1W97L 4F0MA 4AM7A 4J9MA 3R6LB 3OFHA 3MN9A 5B0BA 2IMOA 1NI3A 1GEHA 4ZVUB 3DOKA 1R0AB 2GHVC 3IG1A 2A6MA 2A18A 3S3OA 4DF8A 9ICCA 2UUTA 2PFUA 5AKIA 2XC9A 2DY9A 4X4OA 1UHUA 3FBCA 4B8AB 9ICUA 3HSJA 2CJYB 5HQLA 3TA0A 4WCEL 4WJ3B 3KJVB 4GXKA 3WK8A 3AVNA 1Q3UA 5LOQA 2ZM6J 3T9NA 2BJ3A 4WPAA 3IWLA 3H5YA 1M90O 4P0PB 3KUGA 1IBLK 1RT4A 1I94J 3UO0A 1GT8A 2HF4A 3M30A 3VAJA 5ITHA 2FBYA 1C6VA 2CJBA 1EETB 4FK0A 1M5SA 4KR0B 3M6WA 1EP4B 2AJ4A 2OLWA 3A0IX 1YJ7A 2V9KA 4WYLA 2HFNA 1WAJA 4YD1A 3UVJA 1AT1B 4RW6A 4GKJK 5KG7A 1HIWA 4M95A 4MHVA 3G25A 2FBTA 1BXNA 3LGHA 5KI6A 5JTIA 1UAXA 2A41A 4WFAL 1TU0B 1JB0C 3GDXA 5AKYA 2ZBRA 4O4GA 3MM8A 1OY9A 1GOCA 1ILYA 3HKZF 2LYHA 4KSEB 3VQSA 4PCQA 2HHVA 2DR9A 2DKOB 3BQ2A 2BJDA 1S6OA 2DRDA 4ZPDA 4DR6J 1XSPA 2QA4S 1Q78A 3AL0B 1T7PA 5LJ3Y 4IO8A 3VPZA 3KG0A 2AMCB 1RKJA 1L3UA 3NGUA 2E2PA 1IQTA 3WC0A 3G8QA 1VQ5S 2O8EB 2J9DE 1HI8A 3NCQA 1EKSA 2KU7A 5KT6A 5IIKA 2J7WA 1RHMB 3SQGA 5F8LA 3NAEA 4QJVA 2P5OA 2PYJA 1FKOA 1Q95G 1SV5B 3KVGA 4TYAA 2DT9A 3KIOA 1FRJA 5HLFB 2KH9A 3DFEA 3EW9A 2R18A 4LFCK 3DOKB 2OHDA 2Z1GA 1MG7A 1U1MA 4CK2A 4KFBB 2RDJA 2RF2B 2Q79A 1NBEB 4MFBB 3L3FX 4DCJB 1HUOA 4DXLA 3FLCO 5J1EA 1Q4RA 1RISA 4JKGB 1IBMJ 1ZTTA 4XDDA 3PVXA 2RE1A 5ALSA 4R8UA 3H46O 4M63A 2UUCF 1DY3A 4HI2A 2FVQA 2VIXA 1TVRB 1REVA 4LQ3A 3NNCA 1QVGM 3UMBA 1VC6A 5IIJA 3I82A 3OSNA 4W4MA 2JH7A 5ALOA 4C1NI 4FJLA 3O9TA 4IH6A 3DLEA 2ES6A 3P38A 4WFNL 2FGOA 2W6KA 1D1UA 2MDAA 2F3NA 3HSDA 4D3GA 4O4GB 2I1QA 1Z19A 1B70B 3BSAA 2IJRA 3QMQA 4LSNB 4DR4J 3VGMA 3R7NB 4YUDA 3KKRA 4JKDA 3MXHP 2E1MC 4OL8A 5AZIB 3DLLQ 3V2UC 3MGJA 4Z4FA 4QBUA 2V7ZA 1RHKB 1U2FA 7ICNA 5H9EK 3D67A 1QS4A 2JWNA 5AICA 3IWXA 3CCSN 1HHQA 2A1SA 5C2CA 2IMWP 4F93B 4K8RA 2D0PA 1NSPA 4I56A 3KBBA 5DM7L 4DFJA 4O5EA 2MUTA 3TZYA 2Y9UA 4EIAA 4K2JA 1MMNA 3DMJA 4QOZB 2VWBA 4AILC 4H4MB 1G6BA 2Q6CA 1F5AA 5FPEA 9ICSA 4K41A 2FPKA 3DXMA 2HK2A 3TOQA 3D3BJ 1ZC6A 1Q9YA 4HTUA 2KG0A 5I3UB 2X51A 3GR1A 4Y2XA 1BWEA 4X66K 1XC9A 2JEFA 2CPYA 3Q0AA 4M3ZA 1D8LA 3S6JA 4CEDA 3EUB2 4RPYA 4HLBA 2A42A 4M5DA 1VQ6S 3JS9A 3TW0A 2QV6A 1V4TA 1GLDG 1LW2A 2OPPB 1CS4B 1DGSA 4CGZA 1NB7A 2BJ8A 1X0FA 1N33J 3CD6S 1BMQB 4NXMK 1SB3C 3FZMA 5HP4A 1JLEB 3PZPA 2F63A 3J7Z5 5DM7Q 5HATA 4DL6A 1F44A 5HI7A 3TR5A 1HNXJ 1K8AT 1E6VA 1UFWA 3NBPB 1KLMA 1ATRA 3RMAA 2J6SA 1RWUA 4FZMA 2BRKA 1LK7A 2ZVIA 4A8KA 3OY9A 1U2RA 2KG1A 3Q8YA 3ZFVA 4ZLJA 1F6TA 2BE2B 1X0PA 3O4WA 1ZAVA 2ACYA 3UFCX 2FVPA 1COOA 4HL9A 4I6WA 1W2BM 1KQKA 5J0PA 1BIUA 3H98A 4J9RA 3AGKA 5AQOA 3F2DA 2W25A 1RT1A 3SMZA 4K4SA 2DJWA 5DJBA 2EAOA 1R89A 4DL3A 4K5SA 5F0XA 3X1LB 3CCMS 1ZRNA 2GAHC 4NYZA 4CO1A 3UWTA 2L9DA 3ZETA 4ANEA 3RF9A 4KIAA 5DM6Q 5CHIA 3L09A 3CULA 4UASA 4Z37A 4FNHA 2OPQA 3HHLA 4DR1J 4O8KA 5E84A 1NDCA 2XIDA 1BISA 3B6PA 3EKSA 4AL7A 2QLXA 4M7XA 4Q0BA 3R5BA 1ZM2A 5HROA 3PSPA 4DR6F 3WUHA 3T5KA 1EKEA 3IR7B 5MLCQ 1J6ZA 3N4WA 4B1WB 3AQFA 5BN8A 5KFGA 2NV3A 3UE2A 1ASWA 3QETA 5L1MA 4FJJA 8ICFA 2PC6A 4LF6K 2WVFA 3N5FA 1QQ7A 3AN1A 4IKAA 5A2QO 2HVIA 2A2DA 1FJCA 2HFSA 4N41A 1RTZA 4QZ9A 1JNZB 5AFUA 5BPLA 4K4XA 2JEGA 3SMPA 3FSXA 1PJ5A 3SIPB 1Z2ZA 3NGRA 4CJ3A 4J2BA 3LP0A 2OPSA 2BA9A 3K17A 1FF2A 5B0CA 2RQMA 2WRMA 1CQMA 4GY2B 1HFEL 2VDIA 3RJIA 1S3XA 2F1FA 4KHNA 3H25A 1HNZJ 2AYBA 2Q43A 2P1JA 5AXNA 4ID1A 1YTUA 1VQPS 3W8GA 1NJXA 5IWAF 3QB0A 3CNQP 3QIOA 4KC5A 3THPA 4KB1A 4DCOB 2WF7A 4MIWA 2G1HA 2ZH9A 3D1HA 2DY1A 3HM9A 2H3ZA 2XCAA 3VF4A 4E0DA 2HHHF 1BI4B 3WKDA 3W62A 1HUXA 3AO1A 4Q2MA 4ZPAA 3UN5A 4RW4B 4TUPA 4C8ZA 2V4RA 5J2PA 5SUHA 3HXMA 1H6KX 5AQVA 3HT3A 1IG9A 4NOHA 3AU6A 3TVKA 4YY3J 2FJ6A 5AM3A 2Q36A 3UMCA 2BCRA 1WELA 3LW5C 1FEZA 5KFDA 1SC6A 2QXLA 3VEXA 2ZIUB 4B3SJ 1QJHA 4GKKJ 1NH7A 4NYNA 4DV1F 2DIUA 3RJEA 3TSUA 5IV4A 3CDAA 3VESA 3BGOP 1S6UA 4NV0A 5M1PA 2CUYA 2RF2A 1SKSA 2HF3A 1NM1A 2HVHA 2QI2A 3DU5A 3ZT3A 1QSLA 4EBCA 4OZ5A 4O5FA 4ED7A 4G1QB 3IMQJ 4K0KJ 4H4KC 4P71A 3T1AA 1RABB 3RJKA 1ZZNA 2EZXA 3SCIE 3NGYA 3PW7A 2ZJRL 4UB6U 4CEAA 3ENBA 2AIRB 3A0HU 3ZDDA 1JLFA 1VSKA 2ASJA 5HQ8A 3C65A 3G71S 2E7XA 3WKBA 1K73T 4X65F 4EGLA 1SQGA 2P9GA 4I2AA 3WZ0A 4NMXA 4IUFA 2W04A 1Q81T 4IBNA 3CCLN 2CRXA 1TKZB 3NVYA 5KFEA 3AO5A 3CI5A 3J81Y 2H3VA 3IG8A 3VETA 2NRZA 3LGNA 4LFAF 2QARB 2CQ2A 4OI1A 4KYZA 2HNZB 2BV3A 3J7AN 1YJ9N 2E1EA 2F7VA 4BXOA 2GMJA 3BO4A 4KY3A 4MIBA 2ZIWA 4JV5F 2Q3PA 2YKAA 4DV2F 3TQEA 1UWAA 4BCAA 1B9FA 3OPKA 4KB7A 4UW9A 1AROP 3RBDA 5K4LA 1OSCA 2QWPA 1XUPO 3RH4A 1WKJA 4MN4C 1J2NA 2O8CA 3P6YC 1UCNA 1TYQA 2GVDA 4QS7A 2AYGA 3UE5A 4DPWA 3V9XA 1IBKF 7ICMA 2A5XA 3JPSA 2KIVA 4C4WA 2PT0A 4FW1A 4Q2LA 2ZIWB 4CEFA 1NJZA 1IKVB 3CM6A 4I67A 4FK2A 2ZBPA 1Q8IA 5ALYA 4G1PA 1BL3A 1J27A 2YKMB 2RIJA 6AT1B 4KX5A 3M2UA 5ETMA 3OLAA 1WC3A 4UF4A 4DPTA 4M1KA 3PSFA 4M5IA 2E8PA 4BC7A 3I6PA 4PXCA 2AX0A 5GTIU 1RXWA 4J37A 4I2PB 2L3MA 8ICYA 3VAGA 4OI4A 3THXA 2H9ZA 4NEYA 1IBMF 2HI0A 2BYCA 1T94A 1HPMA 3HSGA 3HZ6A 1G15A 3IA0A 1P8GA 3ISDA 4LF9J 1S1WB 2XLKA 3QJLA 4OLPA 3KKSA 1SQFA 4TKTA 2JZ5A 2F65A 3DLJA 3HFZB 3I0SA 3R27A 6FD1A 5AQUA 4HT7A 2DKZA 2DISA 1RQ0A 1DARA 4JV2A 1NH8A 5JS2A 1HNIB 3RTVA 4B3RF 1TUVA 1SKWA 2A1BA 1XC3A 4PPZA 1ZQXA 4LFBK 1MROA 4Q44A 2KXFA 4C7ZA 2XULA 5E33A 3JB9k 5C2FA 1G99A 4HH0A 3BKUA 2UV8A 2K60A 4AQYJ 3WQUA 1S5ZA 1R7IA 3H3OB 5HSPA 1TL1A 3VTIA 5C42B 4MEYA 3M5RA 3K9KA 2BUNA 3GG4A 1DHMA 1VYAA 5ETKA 1A5XA 4O44A 3ADAC 4EFAC 4G6VB 2P2CB 4JV0A 2PI4A 3T69A 2IOFK 1OIAA 1F1BB 2X1AA 2XNQA 2JDJA 5LMNK 2VG7A 5TZVA 3IRXA 5G0RA 2J7KA 3A8KA 3Q8RB 3N79A 3FE1A 1GTEA 3HTVA 2ZGYA 1UL3A 3K0JA 2FPHX 4E7IA 5CABA 3WX4A 3QGHA 1S22A 5ALRA 3OYEA 4M04A 5HJYA 3CDUA 1IBLF 2YBVA 2MZSA 5IIIA 2KHOA 4IOCL 1CLQA 2KSOB 1OY6A 4DUZF 3D7EO 9ICXA 1DOQA 3MN5A 1OPZA 2KHDA 4YHHK 5DZ6A 2FJBB 1P8ZA 5HL7L 1LKYB 4DV4F 1Y3JA 2ZH1A 1U0HB 3NVZA 3CERA 2BACA 5C10A 4AHSA 3V6DB 1QUPA 1LWEA 1Y64A 2WB4A 2AJFE 1VC5A 4NLRA 4O3QA 1RXOB 4H0PA 3ICXA 5K20B 9ICHA 1RAGB 2A3JA 1VJWA 1CSJA 4I6AA 3IDHA 2VOOA 1QQCA 2O6KA 2B21A 2KNJA 1X9MA 1SB6A 2QKQA 2DNPA 3H8YA 4ED6A 1RT4B 2OFGX 1WEXA 3O0FA 2VA3A 3GFXA 2HGMA 1R6YA 4DL2A 5ETOA 5A0YA 2W8LA 4MKBA 4M9LA 1RKIA 4O0NA 1RTDB 1R0CB 1SV5A 1F3FA 1UEUA 3VCDA 4C9DA 4PYDA 4TQRA 2DBYA 2LDYA 4KO0A 4ZA1A 1SJRA 4CO3A 1RYRA 1HYVA 5K8OA 5KOWA 4IC9A 1FHTA 5ALZA 2PMZC 5LJVA 1FI4A 2F8SA 3PNIA 5U47A 3AAQA 2VHGA 3D1QA 3AVJA 1RWXB 1N8RO 3ZTSA 2AP6A 4EWTA 4HDGA 2GJFA 5HROB 4LFCF 1CLFA 2V69A 1ZOLA 3SAFA 2DHHA 3NRBA 3SCLE 2NZ4A 2LQBA 2GS8A 5T7LB 4PWUA 2KT2A 3UD5A 2K1RB 4FLXA 2YX6A 2OSRA 5KFMA 4F2SA 3V81A 3IAM9 1U1KA 2E5SA 4USKA 3V7LA 1PYTA 1GLLO 4CRXA 3AO3A 4X4RA 5M2UA 2FZCB 2G4BA 1WF1A 4IEEA 3FRYA 1UVLA 4QYRA 1RTHA 2Y0SF 1BG3A 4OYIA 2ASPA 4KHPK 3D6MB 2YQ1A 2E44A 2P5VA 2XLJA 1XMQK 4DG1B 2BQRA 4B02A 2W55A 2DTJA 4Y00A 2RUGA 4ELVA 1N63A 2EHGA 2IM2A 2FVCA 1CJUB 1YVNA 4GW6A 2IS3A 4QW8A 4I9QA 3IBPA 4P2SA 2GOLA 2QX0A 5K14B 1YVFA 1HX1A 2B5JB 2EFNA 1VHIA 1NK8A 2PFNA 3HDSA 4RG8A 4Y0WA 2XS2A 1HKGA 3MM6A 4YEAA 1SL2A 3KK7A 1WC4A 2VQFJ 4QZEA 3RBZA 3TAQA 3FFIB 4G3IA 1YI2S 3LVVA 1N6QB 5D0EA 4USHA 2ROGA 2KVIA 5KRTA 1VRTB 1WAFA 3DYAB 1GLCG 2A1JB 3IG1B 4YDUA 4AXJA 4FSVA 1NK6A 1V38A 2NPIA 1A6SA 5CAAA 3BO2A 5KL8B 4OZ1A 1BA1A 1BO5O 1J2MA 1S4EA 3PO4A 3ENQA 2FSNA 5B0EA 4YCXA 4E89A 2ZOMA 4XH5A 3VEOA 2XRIA 5AM5A 4B3TJ 3BGRA 2CNLB 4CJWA 1UPHA 5LMNF 4CJ5A 3N4QA 3R7BB 3J7YP 2G2OA 2ZVSA 3K7RA 3ZT1A 3VA0A 1G2EA 3DYAA 3ZCMA 2HDOA 2CJAA 4G1QA 4CZHA 2A10A 1H38A 4BRAA 2CWXA 4BREA 1BPZA 3R9LA 2VKZG 1KHVA 1NGHA 1RZTA 3ZDAA 1R8CA 1X2IA 3JPTA 3OYJA 3QAUA 2PFDA 2ZHBA 2CG4A 4M9GA 3C1ZA 4P74A 2AU0A 1WSGA 3DM2B 2WB1C 4MAKA 3OFEA 3AAPA 2QB1A 3DLEB 4KGXB 5DB9A 4TXSA 3C14B 3M7DA 4IRCA 1SZHA 1ZQZA 5JXSA 5CD4H 1J2VA 4DDFA 4IQUA 1UEKA 2DBBA 3U26A 2YNGA 3BSCA 3CPWR 1SXDA 1F0MA 4KB0A 2V68A 2XMKA 3KHYA 1U6ZA 1WOQA 4CNZA 4N77A 2C2OB 1KQFB 4WFBL 4BLGA 3ED5A 5DBCA 4NLSA 2VUGA 1FJGF 2QIFA 1HNZF 1NB2A 3MMBA 1IG8A 1CZ9A 1CBKA 4C2MA 3ZO7A 4Z2XA 3QYPA 2G2YA 2FB0A 8ICBA 4F9OA 4LR9A 1UA1A 1HQUA 1G3OA 4DR5J 1DK2A 3CCMN 1D4XA 2Z1IA 4FS1A 5ALPA 3TADC 2D1KA 1CUKA 4XDCA 2MKCA 1C1CA 1VQ4S 2W7OA 3GE9A 4ETXA 3QNOA 2KJWA 4DOBA 4A48A 4FJHA 4YFKA 2O8DB 3FFKB 2MZTA 3CC4S 1VBKA 2FBXA 4NLTA 4Y65A 4I28A 1QE1A 4FKXA 2QN6B 2VJVA 4OPAA 1RG6A 2DNKA 1KN6A 2AW0A 1Z2LA 4ZITA 9ICRA 4FL9A 5HVGA 2ZC3A 4PWDB 5AE1A 4JK9A 3GFHA 1L7OA 1X5SA 3GIJA 2RDDA 2UUAF 4X4TA 1RT6A 3OVAA 1YJRA 2RQ5A 4LRAA 4WK1A 4M5HA 5AKGA 4O23A 3FZBA 3D5MA 2LFVA 1XNRF 2WVCA 3WK7A 3RJFA 3D2EA 3O9SA 1F5SA 1ZBHA 3V5RA 3RUBL 4KHRA 3CXCM 4RCHA 1C0UB 4LF4F 1AUDA 2EG1A 1X4BA 5D77A 1DJ0A 2E6LA 2KD1A 1VQ6N 2NRXA 1FX4A 1TFYA 5AIAA 4ED0A 2JRZA 3M6VA 4OVLA 4LC9B 2J9DA 3T41A 3KXDA 4FF2A 2XYGB 4IL6U 3UN2A 4ZHRB 4B1YB 2KFYA 1NJIT 1S6QB 4B9LA 5DQIA 1B43A 4J2AA 4UOCA 2HMIA 4RW4A 2XICA 3DU6A 1KDHA 4V1Ak 1TL7B 1DK3A 3DGVA 1HWKA 3P5JA 2HIYA 1KCFA 1WNSA 3D0GE 3KK1A 1KVKA 1RHJB 2XGQA 3RGIA 1NKEA 4FXDA 1MW7A 1N36J 3RR7A 5A8RB 5B66U 4HHTA 4C1NK 2GIRA 4DL7A 3ZSXA 2KFNA 4OJ3A 2QKBA 3D6TB 1BD6A 1IJEB 2QB0A 1S1UA 1PVQA 4QZAA 4WWSA 4ICLB 2H1YA 2Y9TA 3ONNA 3NS1A 3D66A 3BS5B 2ZIXB 3GG1A 2DGZA 3FCVA 1HBMB 1KQSR 4TQSA 4QYZK 1HA1A 2RKIB 2ZH8A 1ZTWA 4KMOB 1CC8A 4BC5A 1CJKA 1M1HA 3A5MC 4XH1A 1FKAF 3C7NB 2XY6A 5HMZA 1JJCB 1IWAA 3PIPQ 5HNKA 3G71N 2HHPA 5FRNA 2UXBJ 3CP8A 1QLNA 3ILLA 1JRPA 4C8NA 4K4GA 4G1IA 4F4ZA 2DXFA 2IIHA 7ICTA 3GOIA 3P5TL 3BPSP 4Q0BB 4RT2A 3HFKA 1TELA 5HMLA 3JQKA 4CJ4A 3NRZA 4N76A 3Q2TC 5KL1B 1TV6A 4UZCA 2ROPA 4OI3A 5AQNA 3B54A 5IZHA 3MHYA 2QC3A 4J8FA 2LEPA 4BR7A 2VG6A 4K8ZA 4IYQA 4L3NA 3IFEA 3ONQA 2IDLA 2GO8A 3C21A 4CRJA 5JJBA 4J03A 1JLAB 5B7WA 2C2NA 2NXCA 2XWYA 3HX9A 4KAZA 1TL5A 2YWHA 1RBTA 4ECXA 5JICA 1RE1B 2HBYB 5AQLA 3SSQA 1GH8A 1K8AO 5ADXA 1VRUA 3N6NA 3O6WA 2B0GA 5J2EA 5M1OA 3M6GA 1JLCA 1U1PA 3DLBA 2YMPA 2YX8A 1JJ2R 3THVA 3AVIA 4HHJA 3OBWA 3RJGA 3T5HA 2B8PA 4OYWA 4JWMA 1PKUA 3SQ4A 1XMBA 3QFWA 4A2AA 2VICA 2WSEC 1LXJA 1NHVA 1VC0A 4AHRA 3NGSA 2XMWA 3BSOA 2HQDA 2IM3A 4QZVB 3Q86A 2KN4A 4FBUA 5M1QA 2OEHA 4B9VA 3MEGA 4FJIA 1M1KT 2WONB 3KJQB 3DHWC 2F5GA 1KAYA 1TKTB 1JJHA 2D9OA 3MPDA 2ODGA 3D6HB 1LK5A 1A5VA 4Z4IA 1VQ4N 3G87A 4FJXA 3LANA 4DMNA 4F4AA 2F9DA 2GW8A 1S1XB 2NR0A 1LXNA 3SCJE 2EFPA 1UVIA 2GJ2A 5LL6Z 1KEJA 5C24B 3H7IA 2O8EA 4F02A 3AOAA 3D45A 5L39A 3V7JA 2ZQBA 1IKYA 1FO4A 2G0CA 5F3XB 2HWHA 3C29A 4M5NA 3QRPA 4QU7A 3R6GB 1PAUB 1VSLA 2WBNA 4DV5J 3OVNA 4KBOA 4J2EA 2YQ0A 4F50A 2NREA 2O01C 2W9CA 2CPRA 3QEBZ 4OHYA 2V67A 3C15A 1DRGA 3MGHA 1Q7LB 1HARA 1F0XA 4YOTA 3FKBA 3G86A 1FCAA 1YIJN 3D2NA 2CPEA 3NUQA 3F53A 3AJ2A 1HYSA 2BGWA 3M9MB 4U96A 2VL1A 3PR4A 4DU7A 2XMTA 1WSEA 2KIWA 1JKHA 2OYQA 4CIOA 3NP5A 4DI6A 1ACMB 3WXIA 2LECA 4X5VA 1HKAA 1I3OB 4DR1F 2EBGA 2MKKA 3KOAA 4Q45A 1CJTB 2QE5A 1S9FA 2B51A 4J90A 2LQ5A 3MEGB 1TL3A 2ZM6F 4IJAA 3KKFA 3Q83A 4PXEA 4NLUA 2B4UA 2CXEA 4OI6A 2M70A 1O6XA 2MKHA 2LU2A 1E6YA 3BF4A 4ECWA 2A3VA 1RA7A 3DC2A 4Y1CA 3KD1E 1C0MA 2F76X 4RX6A 3PRDA 2AA4A 2JVRA 2UVWA 5I9EB 3QT6A 2ADCA 3MEEB 4WFNQ 5AI4A 5DETA 4XK8C 2XY7A 1XNQJ 2V51B 3HHLB 7ICPA 1H98A 1YG0A 3ILIA 2BKEA 1VR6A 2LKYA 4ELUA 4ZLLA 4KLIA 4UB2A 1SBRA 2BKNA 4A2BA 3CD0A 3C95A 3ZTQA 5AQGA 1RADB 4NLOA 5HJXA 4WZMA 1RAFB 4D3HA 2UUAJ 2Y0SD 2R2TA 3TAMB 4DSJA 3D6FB 5G5HA 3QESA 1L7PA 1NO8A 1RAAB 3DLHA 3QBWA 2D1CA 1Y88A 2W4CA 5ADZA 4CZFA 4ANCA 5F3ZA 4WTOB 1LWEB 4FZZA 4CZGA 2BKOA 2W7AA 1W7WA 2KV2A 2Q0ZX 1YRTA 1FK9B 2XEXA 4TNOA 3PTWA 5L8RC 3QUCA 4Y2CA 5ALMA 2XWXA 4V19J 2AXTU 3PEHA 4NY8A 4N56A 2BX6A 3W3DA 1X9SA 1MN9A 1RGVA 2CDRB 2O8CB 3TSQA 1RT5B 1RK8A 4AYBC 2YNGB 1A77A 3QRRA 3BDEA 4RNMA 1HQ2A 4B9QA 3BUZB 1LWCA 5EX3A 2GA7A 1HI0P 1LFWA 2VPYB 4USWA 1NGBA 4EBEA 4BXOB 2Q0RA 3Q8SB 2XY5A 1FXRA 2IDEA 3MM9B 5GAEP 3QPIA 1V4SA 4ZOSA 5GAEU 5T41A 4Y2TA 4KBIA 2YH1A 1LOTB 5ALWA 3T3FA 2ESEA 2BJ1A 3NMRA 2FXUA 1ZA1B 2WAQF 5AQJA 2QL9B 5AQWA 2YHWA 1QY7A 4RW8A 5I4MA 1S0VA 1ZOTA 5IM0A 2MY7A 2ZJAA 2FUG9 1T3OA 3RG6A 3BYPA 2E1AA 2CPFA 4JI3F 4DFKA 4IFEA 3I55N 3TJ8A 5DG9A 3O5TB 3KYLA 2PYLA 3DLGA 1RDAA 5DZ7A 3MX5A 3EGWB 2KFZA 1VBZA 4M94A 2JOQA 3AY0A 1XQSC 4PPXA 3RVCA 3HSZA 2HCFA 4K43A 1JI7A 1PYSB 1V6HA 4DEZA 3CD6N 4F91B 8ICAA 2E66A 5KQ8A 1NZBA 1VBXA 2NXJA 2OTJS 1J5OB 5DGAA 4P7TA 1ZQ1C 4OD0A 1ZRMA 1D9FA 1NGDA 4WYBA 4NWIA 1RNHA 3BF1A 4P72A 2M3DA 5FIIA 2E8AA 1ZQYA 1N32F 3CG7A 4WF9L 4NEZA 1M6YA 3CTRA 4DR3J 4TY9A 3AVMA 3SI8A 2R7XA 2UXCK 1Q8LA 2K7JA 1Z26A 5D0GA 2ROEA 4FLTA 3CM5A 4YR2A 2Q4TA 1KKXA 2IC3A 1KBRA 2OEKA 4IG0A 4DPYA 1JMTA 3PJXA 3SNNA 5L9XA 4F25A 4ZPCA 3OHAA 3JAMY 4FCYA 3OYIA 3B6BA 3O9UA 3CCJS 3L2QA 1WOSA 3P4UB 2JH3A 1BHNA 4C8MA 3GFKB 3DDHA 3VQ7A 3HVWA 1WHYA 3O3HA 2P6SA 2Q1NA 2MZRA 2ZD1A 4PJ0U 3H90A 1COKA 3F44A 3ZYYX