4DSIA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, se-dgtp and calcium
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
581
structure length
581
Chain Sequence
GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsiA01
3VN5A 5FRMA 5D3GA 4M45A 3TAMA 5KFGA 3M8SA 3OYGA 1JLCA 1XHXA 1ZJMA 3QEXA 5HHIA 4I2HA 2PFQA 4FK0A 3LP2A 3JPQA 4E1NA 2IGIA 2BDPA 2Q3SA 1ZQCA 1J54A 3G6VA 1L5UA 5SZTA 2ASJA 5KT5A 8ICWA 1V9PA 1LW0A 3PUFA 3O4QA 3KK2A 4DO9A 4IQWA 1W0HA 5CY4A 2HB5A 3GV7B 5J0QA 5J2GA 3M9MB 1KDHA 3ZSZA 3LZJA 2R8KA 2C28A 4ECXA 1WSEA 3NDKA 4RPYA 3H40A 4BACA 5HRRA 3PX6A 4CEAA 7ICLA 4E7IA 5KFOA 5CYQA 2I5JA 8ICYA 3AVMA 1MQ3A 3OYFA 4QZCA 8ICMA 1BIUA 3KKRA 3I8DA 4FM0A 5KFYA 1SZPA 1NK4A 4GXJA 4UB2A 7ICQA 4FLZA 9ICOA 4F8RA 5CB1A 4AHCA 4LZDA 4YN4A 7ICSA 5I3UA 4DTOA 2BQ3A 3NH1A 2JLEA 1U49A 1QS4A 4M9GA 5KT7A 4NLGA 3RJJA 1WNSA 1UA1A 4KB1A 1NJYA 3AU2A 1IXRA 4N41A 3MFHA 1HMVA 5L9XA 3SCXA 4ID1A 4HCCA 2DFLA 3ZT0A 1RTJA 1LV5A 5KG2A 2G8KA 2J6SA 2FMPA 4FJ8A 5EWGA 3CFRA 5CZ1A 3NH2A 1Y97A 4CJ5A 1X9SA 2O4GA 3HM9A 4QZ9A 4CJ4A 3OYJA 1WAJA 4BDPA 2OZSA 5E41A 3V81A 4HUEA 4N56A 4J9KA 4MFAA 8ICUA 2F96A 3SQ2A 4UBCA 3OS2A 2P6RA 2ATQA 2W9AA 3QEVA 1ZQKA 4ECUA 3F9KA 3QEIA 5KFLA 1T7PA 3GV5B 3SI8A 3TAQA 1RBSA 2NUBA 2V9WA 4GW6A 4LY7A 3OHBA 1VSDA 2Z1IA 1ZQTA 5C5JA 1IKVA 4CJTA 2FPKA 4PGYA 1QTMA 3OJUA 2J6TA 4FO6A 4KAZA 3JPNA 1DOQA 1XSLA 4CJWA 3BQ1A 1W9HA 4CEDA 2YNHA 4BDYA 5HROA 9ICIA 3T5HA 4KLIA 5HRPA 3OS0A 1TAUA 2PFPA 3PW4A 3LAMA 5L1LA 4O3NA 3RJFA 4KHSA 2PI4A 3LAKA 4CJEA 1L3UA 1X2IA 7ICUA 5KFBA 2VA3A 1WSHA 1EP4A 3JYTA 2HHVA 2NRTA 3THVA 5EWFA 3I0SA 3NF9A 1IKYA 3ZSRA 1A5WA 5CP2A 3OS1A 4YFKA 4FJKA 4YD2A 3KTQA 1I39A 4FJIA 3QESA 5KFIA 4OLAA 3V1QA 5J0YA 5KFFA 3AVKA 4JV1A 3WNHA 1LAVA 3SJJA 4YD1A 4CJSA 4KN4A 2PI5A 3V9UA 2AGQA 2Y1JA 4YMMA 4ED8A 3PW2A 1ZQPA 2PFOA 3HVTA 5KG7A 2M9NA 2XY8A 7ICHA 4M9JA 4LSNA 4FBUA 2R7YA 3GIKA 4K8XA 2QKKA 4O55A 2VWKA 7ICKA 4YNQA 4J9PA 3SUQA 3DRRA 3B6OA 3ITHA 5KFMA 4IQVA 1S0OA 4KTZA 1J9AA 4BE1A 5KT4A 3LPTA 5CHGA 4BXOB 1S10A 2HHXA 4KLSA 1DLOA 4HUFA 3GIMA 4W5QA 2PYJA 3K58A 5HBMA 2PXIA 5KFZA 4QW9A 2F1JA 3T5JA 3VQPA 4MEXA 4QWEA 3DLKA 4H4MA 4MQ3A 3PMLA 5DGAA 4XIUA 1GOCA 1ZQZA 3O3GA 1RXVA 4B08A 5KG1A 1ZETA 2W42A 3K5OA 1JKHA 2G8HA 1HYSA 4K4HA 3H4DA 2R8HA 1L3SA 4M6WB 2GWSA 4Q8EA 2AJQA 2HNYA 4O4GA 5CA7A 3L2WA 4B9NA 5J2JA 2P6UA 4Q5VA 3C5FA 1J5OA 1N56A 2KN7A 4R64A 4IR9A 2UVUA 3BQTA 4DQPA 3MXMA 3S3MA 4GXKA 1D9DA 1VSEA 2C2EA 3T1AA 4CGHA 3VQ6A 3HT3A 3TFSA 4CF9A 3QETA 3S9HA 4KN7A 3DI6A 4FW2A 1S97A 3PR5B 3OYHA 2YKNA 3VQ4A 2YNIA 1RTIA 3KD5E 5DDMA 5J0RA 4KLTA 3K57A 4DFJA 2AQ4A 3UXNA 5KT6A 4FJMA 3JPSA 4ECTA 4CEOA 3HW8A 2LSNA 4IG0A 3CFPA 4RQ2A 4DTMA 3DRSA 5KFPA 2YNFA 1A76A 5IIOA 4KTWA 5DB7A 5L1KA 1S9FA 2G8IA 4I2CA 1I3AA 2WOMA 5DK5A 8ICKA 3RAQA 4O3OA 2OPQA 3MABA 5J0SA 4ZH4A 2YHAA 4IQTA 3C21A 4G3IA 1RT3A 2QK9A 3I0RA 2BR0A 3HXMA 4CHQA 4RW7A 4JWMA 1TL3A 3N97B 3AA5X 4CGJA 1NK9A 3TARA 1TGOA 3B0XA 4EBDA 1EKEA 3HSTB 4EP5A 4CHYA 4EEYA 1VSHA 3LK9A 3RH6A 2F8TA 1SKSA 2W9CB 3QZ7A 1K1QA 3SYZA 1RDCA 4ECZA 4Z4EA 3PO5A 1NKBA 4O3PA 1U47A 1ZQFA 1RTHA 3BDPA 4GLXA 4KHQA 4JV2A 2G8UA 3OYKA 4DOCA 1XI1A 1BI4A 3QINA 5C25A 3UQ2A 3P1GA 4KLFA 9ICBA 3C1ZA 2RN2A 3SPZA 3MR6A 1YVUA 4O5EA 2P51A 4DWIA 1YT3A 3ZSOA 3TAFA 3ZCMA 1T4GA 4M42A 3D45A 4W5RA 2KW4A 4ECSA 4C8KA 4CFBA 4CGFA 1RTDA 4OPKA 4LD0A 1XHZA 1S9GA 4CCHA 5KFRA 4M0AA 5KRTA 4FBTA 4FS2A 2R8GA 1WSGA 4KLEA 2KTQA 2ZUCA 1VSKA 4CECA 2YNGA 1ZBIA 4JRPA 1YTAA 4J2DA 1HRHA 2VG5A 2FMSA 2IDOA 1TK0A 4FK4A 3DOKA 5KT2A 3Q8SB 1LB2B 5HMLA 3OYNA 4XUSA 2DFEA 4WE1A 1K1SA 3Q8PB 4H4OA 5DQGA 3C5GA 1HNIA 2Y1IA 1T3NA 1TFRA 4LZGA 4ED6A 3KIOA 4CESA 4CK3A 4RQ5A 4P4PA 3LP1A 2DY4A 8ICHA 3PX0A 4Y1DA 3ZSWA 1ASUA 3MEEA 2ZD1A 3CQ8A 3KLEA 3MDCA 3VQ8A 2HHUA 3OYIA 4QW8A 3QEWA 5DGBA 4J2EA 5BPCA 2FBYA 1ZQXA 1WCNA 5HHHA 3MGHA 1NKCA 4XQ8A 2P66A 3B6PA 3AO4A 3V6JA 4UBBA 3TR8A 2YKMA 4CF2A 4I29A 2Z1GA 2HVIA 2BANA 1ZQIA 3IHQB 4KB0A 1CXUA 3ISNC 5J2HA 4HHTA 2BGGA 4O5KA 3RMDA 2QKBA 4Z6FA 3PNCA 1C6VA 5DQHA 3HP6A 2GUIA 3AVAA 4JK1A 1S6QA 2PZSA 4CIEA 4Z4CA 4F5NA 1BPYA 4RT2A 4OLBA 3Q8QB 3PW5A 8ICNA 1XS9D 1VRTA 5J0WA 4J9SA 1G15A 3SV4A 4JUZA 4C8LA 3VA0A 1R0AA 3C2MA 1S1UA 2F1IA 3M8PA 5JUMA 3RJIA 3KLHA 5J2QA 4J9LA 1LWCA 4DFPA 1S5JA 4F2SA 5J2IA 9ICCA 3E2EA 5J2FA 4DL2A 4J9QA 2JEGA 4MF2A 4I2JA 4CFDA 4M41A 1ITGA 4Z6CA 4YVZA 4YXMA 4O5CA 1REVA 1VSJA 2FBTA 3C6UA 4ED2A 4LH5A 2R8JA 1FK9A 3MBYA 4UB4A 4F5PA 4UQGA 2A1SA 1KEJA 4FJHA 1KVAA 7ICFA 4OKKA 1SKWA 4Z4FA 3NGZA 2BCUA 3RJHA 1K6YA 3V9WA 4FZXC 1HQEA 1HUOA 1C0UA 4FYDA 4M3RA 3AVBA 3U3YA 4J9RA 1RPLA 4BWJA 4DMNA 3OYEA 1COOA 4F3OA 2IA6A 5KFJA 4KLOA 2VA2A 1C1AA 1MQ2A 3MR3A 4GXIA 4CGDA 3T3FA 1U48A 4F50A 4B9TA 3H08A 5KFDA 1D9FA 1BQNA 1ZQGA 5J1EA 3AA2A 3H8JA 3AVCA 4CF8A 4DSJA 3TAEA 2OA8A 2KFNA 5C42A 4I2DA 4OJRA 4RQ7A 1JLFA 4BE0A 4HUGA 2ISPA 4IRCA 3G10A 4OVLA 1C0MA 1BL3A 3ULDA 1PZNA 4QZFA 5HMMA 4RNNA 4PUOA 3EPIA 3VQAA 1S76D 3O4NA 4JS4A 9ICUA 4EYIB 1ASWA 4UB5A 3EWAA 1RYSA 4FW1A 3VQEA 1S6PA 3AO1A 3AV9A 3ZDBA 2GV9A 4B3OA 4RU9A 3TQ1A 1JIHA 3T19A 3LPUA 4Z4IA 1QE1A 3BQ2A 3TABA 3RJEA 1HYVA 3UIQA 3GILA 1JL1A 4FLUA 7ICTA 3OYMA 4HVJA 4FLVA 2UVWA 4AHVA 5FDLA 4FK2A 3KLIA 1U9LA 9ICPA 3TAPA 3NH0A 2P5OA 4NYNA 4YR2A 4KLGA 2AU0A 3SUNA 8ICRA 1HJPA 1IKXA 5KG0A 1ZBHA 5J0XA 4QZIA 1X1PA 3TAGA 3EYZA 4KHWA 4DSKA 3NCIA 4DTRA 4RPZA 1S0VA 1JLGA 4R66A 4TURA 5IILA 4MFFA 4P4MA 1KVBA 1TK5A 2F1HA 1IO2A 4BDZA 4F93B 4KKOA 4I2IA 2FLLA 5KG4A 3GDXA 3Q8LA 4CFAA 2DFHA 2DTUA 5DG7A 4NLNA 8ICLA 5FROA 2A1RA 4MFCA 3AUOA 3BGRA 3ZT3A 4DTJA 4L8RB 4Q0BA 2AQ0A 4O0IA 1BISA 4KLQA 3RB0A 3C6TA 1HPZA 3LDSA 3BQ0A 4QWAA 3RJGA 3Q8RB 3PVXA 1RBTA 1NJZA 4DL4A 3QEBZ 4DF4A 4EBEA 4ELVA 4O44A 1SL1A 1RCHA 3V9SA 4FJLA 2FLPA 3MXJA 4RZRA 4O9MA 7ICNA 4CEQA 5KGXA 3ZDEA 4KHUA 4QWDA 4I2BA 1VSMA 4RNMA 4ECWA 2I9GA 2ALZA 2HNZA 3VQQA 4MF8A 4QZEA 1UT5A 4KLHA 4N5SA 3PX4A 5DQIA 3PMNA 3M9NB 2C22A 4KPYA 3KHHA 1MU2A 2HMIA 3OGUA 3T5LA 3DMJA 1ZBLA 1KVCA 3OYBA 2OPRA 3HX0A 7ICPA 3HWTA 3SNNA 2PYLA 1BQMA 1ZQLA 4AILC 4JS5A 4F91B 1Z00A 1XSNA 3RBEA 1FKPA 1RYRA 4DLGA 4W5TA 5DBBA 4DFKA 3QIOA 2IOCA 4CEFA 4CJUA 5KFAA 2KZ3A 3O3HA 5BOMA 5KFEA 4CJQA 3UPQA 5L1JA 4E0DA 5KG6A 4IDKA 2DFFA 2WTFA 1N5YA 4UB1A 1HJRA 3OY9A 5SWMA 3G0ZA 5CYMA 1X9WA 4K8ZA 1ZJNA 3MXIA 1WSJA 2OPPA 1CZBA 5IIKA 4FZZA 3AVNA 1ZQDA 4C8MA 4DSFA 5TZVA 3ZT4A 4JLHA 7ICJA 4CK1A 4F2RA 1VSLA 4E1MA 4NM1A 3ASMA 3V4IA 5J0OA 2HHQA 4DF8A 3KK3A 8ICEA 1BVSA 4O3QA 3V6DA 4DS5A 2V4QA 1RBRA 3SV3A 8ICTA 2XGQA 2RDJA 1Q8IA 2RDIA 3OYAA 2B4JA 2JZBA 3G6YA 4F5RA 5KFXA 4LH4A 4R5PA 4MFBA 5F9NA 8ICXA 3O3FA 2XHBA 1KCFA 4DTXA 2IHNA 5J0TA 4F4YA 3KJVA 5KGWA 4M3WA 2XC9A 2ZUDA 4DFMA 1RT7A 4KV8A 2XY6A 1D8LA 4CHZA 4QWCA 2QXFA 1RT6A 2FPLA 2XRIA 4RQ4A 5EU7A 4Z0UA 2ISOA 3SUPA 3IRXA 4XRHA 3OJSA 5DKWA 4N76A 5D4BA 9ICXA 5CJ7A 8ICIA 4RG8A 1C0TA 3AA4A 2ZJ5A 4M9NA 3IS9A 3RMBA 1BPDA 1IM4A 5J2MA 4RW4A 1EX4A 3MFIA 3QZ8A 4YR3A 4KITB 5J2NA 3LALA 3SZ2A 4YMOA 4KI6A 2W9BA 4R8UA 2WONA 5DBAA 4FJ5A 3NGDA 4E3SA 1U45A 3K2PA 1XU4A 4KLLA 1SL0A 3NF8A 3OHAA 2XO7A 4CEBA 2DPIA 3CM5A 4FJNA 4IFVA 3UQ0A 1HNVA 5DDYA 4DS4A 1IH7A 5J2KA 4ED1A 2BCRA 1NJXA 3NTUA 1RT4A 3KHRA 4F4KA 5JS2A 1JN3A 4B9SA 3AO2A 4IKFA 1ZBUA 2IAJA 4I9QA 1RDBA 3HO1A 1Y88A 1NKEA 1BI4B 1IG9A 2VANA 4M3ZA 4B9LA 4BE2A 2X6NA 5KFUA 4JV0A 2KQ2A 1NOYA 3DLEA 4DL6A 7ICMA 5DB9A 5DLFA 3VQ7A 5BOLA 2BPGA 5KFQA 4PQUA 4Y1CA 5KFNA 3V7JA 3LANA 4ED3A 3L2RA 4UB3A 7ICOA 1J53A 1CLQA 4UAWA 3ZSQA 5T7BA 3RAXA 1FKOA 5J0UA 4RQ3A 4TQRA 7ICIA 4FXDA 2IHMA 2XCAA 3MECA 2PFNA 1TKTA 1C1BA 4C8NA 4LSLA 1F21A 2BQRA 4DQIA 1RNHA 3ZDAA 3HPOA 1WN7A 4FJJA 3UXPA 2ZJ8A 5K14A 2FBXA 2UVRA 3Q8MA 3VA3A 4CHNA 5KFWA 1EETA 4CJ3A 5F9LA 1FXXA 5DB8A 2W8LA 1KFTA 3GIJA 1TKDA 1ZYQA 3NHGA 1TKZA 1ZBFA 3ISDA 4AHRA 4FJGA 5J2BA 2D5RA 4CE9A 3K5MA 2FC0A 4DL7A 4FVMA 4IRKA 2NRWA 4KHYA 3M8QA 3JPPA 4F92B 3C2LA 5FRNA 3EY1A 3QNNA 4W5OA 5DB6A 3G6XA 1U4BA 3ISCA 4QZAA 2AGOA 3U3GA 3AVGA 3M9OB 4RQ8A 1ZQAA 4O3RA 3ZSYA 4F4WA 1UT8A 3PR4A 1ZQVA 3HPHA 1JXLA 5HLFA 1KLNA 2FBVA 2ATLA 3ETLA 4I2PA 4CJLA 1ZQJA 4P2HA 4LVSA 3K75D 4QOZB 4XA5A 8ICOA 4CHOA 1X9MA 4KI4A 4F5QA 4ECYA 4KTQA 3IM1A 1KTQA 1KSPA 4QCLA 1RT2A 5KFSA 3RJKA 1SKRA 3HVRA 2G8FA 5J2CA 3AU6A 5CWRA 3JSMA 4ECQA 1JLBA 4NCAA 3DLBA 4NCGA 1QHTA 1B9DA 4RQ0A 1WSFA 4FLYA 3OYDA 5J2PA 5DG8A 4Z6DA 3IAYA 3T5KA 5D46A 4EP4A 5DG9A 3NF7A 3ZSXA 8ICBA 1D8YA 1RXWA 2MUTA 1RZTA 1MC8A 3ZDCA 8ICSA 2A1JA 1A5VA 3AVJA 1T05A 2E6LA 1NK0A 3ZD8A 4CEZA 3PW0A 1ZQBA 4FLTA 4UAZA 2BCVA 3EZ5A 1QSSA 3SQ0A 1BPXA 9ICFA 3WNFA 4CIGA 3V7KA 5KI6A 1Q9YA 9ICRA 3BJYA 4NYFA 9ICQA 4FJ9A 1RT1A 4I2EA 3RB4A 3MEGA 3CG7A 3L3UA 4I2FA 4HTUA 2Z1HA 9ICHA 3VQBA 1GOAA 4KREA 3GIIA 3K5LA 4B8AB 4P4OA 2X6SA 1HQUA 3OYLA 3QLHA 3SQ4A 3RB6A 2Z1JA 9ICJA 1NK5A 5EWEA 3PW7A 1D5AA 4G1QA 4PWDA 4GC6A 1N48A 3RWUA 1BIZA 3LWLA 1S1XA 4M3XA 3PY8A 2BPCA 2BGWA 2B5JA 3LP3A 2B6AA 3GQCA 4H8KA 1RT5A 5KFVA 1LWFA 3HL8A 4DU4A 9ICEA 2HW3A 7ICRA 1CUKA 1C1CA 4TUPA 4I2GA 1CZ9A 2AGPA 2IC3A 4R63A 3HP9A 2XCPA 1MSWD 4M9HA 5EOZA 4PHPA 5J0PA 3HK2A 1B22A 3L8BA 4NXZA 2C2RA 9ICSA 3SQ1A 3SUOA 1LAWA 3K59A 1BPBA 3NGIA 2ASDA 4CJRA 1ZQUA 3H8WA 1ZQHA 2G8VA 4ECRA 4ED7A 4OGCA 5KRSA 1S77D 4TSXA 4RPXA 7ICEA 1ZQYA 4B9VA 1QLNA 3F73A 3AVHA 3VQCA 4RQ6A 1JLAA 2ZTCA 4KLUA 3AVLA 3MR2A 5DLGA 4M04A 4M3TA 2KFZA 1S1TA 2FPMA 4I2AA 5HRNA 2W9MA 1GOBA 4J2AA 3C2KA 1WAFA 3E01A 4DOAA 4KFBA 4AH9A 8ICAA 1TV6A 4JWNA 2BCQA 3KHGA 1LWEA 1ZQQA 4PHDA 3ZT2A 3KKSA 3DRPA 4DOBA 3OSNA 1UOCA 1HYZA 1RILA 1T8EA 3VQ9A 1RBVA 4CF1A 2MAXA 2HHWA 2UVVA 1S1WA 2ZJAA 1BGXT 1BPEA 4BGDA 3L2UA 3TANA 4GC7A 1VRUA 4QZDA 4YG2A 3EW9A 2BKEA 1N6QA 4RUAA 1TV9A 8ICCA 4DTPA 4YCXA 7ICVA 8ICFA 3RR8A 1B43A 4NCBA 1NJWA 1Z00B 1KRPA 2YV0X 2FLNA 3GV8B 9ICKA 2IBKA 1DTTA 3JPRA 2BCSA 9ICNA 2RPIA 4E19A 4QAGA 1KFSA 4E7JA 3K5NA 4M3YA 4NM2A 4F3TA 2BHNA 1U04A 4DG1A 4YFUA 4CJKA 3H4BA 2JGUA 4CK2A 3CM6A 4GVMA 5KG3A 4UAYA 4Q45A 3RH4A 4RW9A 4JRQA 9ICVA 5KT3A 3H8SA 1Z25A 3LZIA 5D49A 5HP1A 2X74A 4J9NA 3RB3A 3DLRA 3DYAA 4M3UA 4J9MA 2OYQA 4FM2A 2F8SA 3IG1A 4DSLA 4PHAA 4ELUA 2D0AA 1ZQMA 3JPOA 3AVFA 4CFCA 4IG3A 4KLJA 3HYFA 4N47A 2HHTA 3OYCA 1XO1A 3KLFA 2V4RA 4IRDA 3PV8A 3AA3A 1CXQA 3PO4A 2J6UA 4NY8A 1KLMA 4J9OA 3V7LA 5J2AA 1VSIA 1Z26A 5L1IA 4M2YA 2JZBB 1UA0A 3QO9A 1BHLA 1TAQA 1H38A 1JL2A 3L2VA 3RMCA 1JXEA 3KLGA 2W8KA 1S1VA 1C7YA 4EZ9A 1A77A 2ASLA 2P5GA 9ICAA 5JS1A 2FMQA 3MAQA 5J2EA 4RNOA 1QSYA 3DLHA 4PA1A 3SPYA 4E7LA 5J29A 4F4XA 3FDSA 4M47A 4I9LA 4FS1A 1QSLA 3NFAA 2W9BB 4R8UB 2XGPA 2KZMA 4PY5A 3C95A 2XY7A 4EYHB 3D0PA 2KZZA 4E7HA 4IR1A 3LDAA 2JEFA 4ELTA 2X78A 2GBZA 3QNOA 4C8OA 3VQDA 5IIJA 1QQCA 4KRFA 3P83D 9ICMA 4F5OA 3S3OA 4RW6A 3NE6A 1DGSA 3C94A 3L3VA 2ZE2A 1ASVA 4CJFA 1KFDA 4OKJA 2ETJA 4CEEA 3CFOA 4KO0A 3V6HA 4DLEA 2IS3A 1UAXA 4I27A 4MEYA 4YP3A 3OSPA 3NF6A 4RQ1A 1NOZA 4DSIA 3FFIA 3KHLA 3S3NA 3QIPA 1ZQWA 1TK8A 4R65A 4ID5A 4CHPA 5C24A 1EXQA 4BXOA 9ICLA 3KK1A 4CGGA 1NK6A 1L3VA 3LWMA 3V1OA 4Z4GA 4CIFA 2EHGA 8ICZA 1Q9XA 4NLZA 5KFHA 4B8CA 3ZDDA 1NK8A 3V6KA 4QZBA 2C2DA 3GFKB 1B9FA 4DQQA 2YHBA 4KHNA 4ZHRA 1DTQA 4J2BA 2JEJA 2ITGA 4FLWA 3RH5A 4Q44A 4DTSA 4ZTJA 3NAEA 1BCMA 4E89A 2ZTDA 1XC9A 4W5NA 4M6WA 2XY5A 3ISBA 2PY5A 2Q0ZX 4QWBA 8ICVA 4ICLA 2ZUBA 1RBUA 5DMRA 4ED0A 3HPGA 1WCLA 3L2QA 3P5JA 4PH5A 5HRSA 9ICGA 1AROP 3TI0A 2O4IA 1EXNA 4PGQA 5IIIA 4DL3A 1JLEA 3MDAA 5KFTA 4I7FA 1SV5A 5KFCA 1JXBA 1XWLA 3ORYA 4K4GA 4B9MA 4KLDA 1A5XA 3A2FA 3UXOA 4QZHA 4EZ6A 2EX3A 3EPGA 4I28A 3MGIA 3C23A 1SUQA 7ICGA 5IIMA 1S0NA 4PPXA 4TUQA 3ZD9A 9ICWA 1HUZA 1CEZA 1TVAA 4Q8FA 4QZ8A 3MR5A 2G8WA 1VK0A 5I42A 4X5VA 2HVHA 2RKIA 1WSIA 3WNEA 3ZT1A 4YR0A 4DTUA 3TWHA 1JMSA 4Z6EA 2DPJA 8ICJA 1XSPA 3SI6A 1LW2A 4YMNA 3RBDA 4DU1A 2LYHA 3B0YA 2D0CA 1YTUA 2BQUA 4CGIA 3ALYA 5HP4A 2OZMA 4GMJB 1TVRA 4O3SA 1S0MA 2IMWP 5HNKA 4EBCA 3HJFA 3FYHA 4Z4HA 3K4GA 4M9LA 4FCYA 3JPTA 4O5BA 1ZQNA 3CYMA 1Z3EB 2W9CA 4AHUA 5KTQA 4K4IA 4YXJA 4KLMA 3QEPA 1NOMA 3AVIA 4ZTFA 4DEZA 4KMUA 3QE9Y 1S9EA 4FZYA 1UWBA 2VWJA 4Q43A 2VA8A 2HNDA 4F4ZA 4FJ7A 4AHTA 1RDAA 2P1JA 9ICTA 2OWOA 1O1WA 3ZSVA 4DSEA 4E7KA 4FLXA 4IQUA 2MUTB 3TFRA 3DLGA 3RR7A 5KFKA 4YQWA 3C1YA 2I1QA 2A1JB 2E4LA 3RMAA 3AO5A 4AHSA 2NRXA 5CZ2A 1RDDA 4OPJA 4NLKA 4I2QA 1JX4A 3QEAZ 8ICPA 3NGYA 4QZGA 4DL5A 5J2DA 4B9UA 4PGXA 4ECVA 4CJPA 2ZQBA 8ICQA 3QERA 1ZQEA 2OPSA 2JEIA 3KD1E 1T03A 4CF0A 2R8IA 1VSFA 2H5XA 2E6MA 1ZQOA 4TUSA 2VG6A 4HCBA 3RRGA 4O0JA 3MEDA 3RTVA 1ZQRA 4DU3A 5DBCA 4OKEA 2VG7A 3DM2A 2D0BA 3H7IA 1IKWA 3LP0A 3WNGA 3V72A 4DQSA 5KG5A 8ICGA 1SL2A 4RT3A 3OVNA 5IINA 4HYKA 3N4MB 5CR0A 3V9ZA 4OGEA 2NRZA 1BPZA 4BWMA 4CERA 2NRVA 4RUCA 1BCOA 4TQSA 3Q8KA 2RF2A 3VQ5A 1NK7A 3AO3A 3NBPA 2BPFA 4CJVA 2HHSA 4RW8A 3U6FA 4DQRA 4FJXA 3RRHA 3M8RA 1B92A 3V9XA 1L3TA 1TL1A 4IBNA 1JLQA 4PHEA 4IFYA 2BE2A 4FM1A 3DOLA 3V1RA 2B21A 2ZTEA 1ZQSA 1TKXA 4DTNA 1WLJA
chains in the Genus database with same CATH superfamily
2G5HB 3MWPA 4N7TA 4M45A 4ZDNA 3TAMA 3PTWA 3QFUA 1KD1O 3UPFA 3WKAA 3PSTA 3P8BB 4OZNA 5HHIA 4C0HA 4DV1K 2XBPA 3LP2A 4JKGA 2MKJA 2ZKUA 1RGIA 3NVZA 4KFBB 5LJWA 3ILJA 1E6VB 4OYWA 1WG1A 1ZQ1C 1WBDA 2ASJA 3BPDA 1LWEB 5KT5A 1V9PA 3CRXA 1LW0A 4Y65A 5IOLA 3PUFA 1S3XA 4DO9A 4IQWA 2QL7B 1W0HA 5CY4A 3WXJA 3GJRB 2H3EB 2A1BA 3GB0A 1DK2A 1IN0A 2W6LA 2JVOA 4ECXA 3HLUA 1NGFA 4RQMA 4BR0A 4J37A 4BACA 3LPYA 3PX6A 3LUYA 1K9MO 4QU6A 3C65A 1VRUB 8ICYA 3RUBL 2O8FB 2F44A 2UUCK 2ODGA 1MQ3A 1H98A 1AB8A 2JVRA 3LM2A 4MYTA 4YHHK 1FNOA 7ICSA 1XO0A 3NGRA 4DPTA 2BJ1A 1RZMA 4NL9A 1QS4A 4M9GA 5B09A 5KT7A 3QU4A 1N62A 3RF9A 2V9KA 4KB1A 2HHHF 2WVCA 1HMVA 5L9XA 3SCXA 3LYSA 1VISA 4ID1A 1FKAF 4A8EA 2DFLA 5D0RA 1YGYA 2MHEA 4LF6F 4LVNP 2CGJA 4KBIA 1VQ9N 4ETXA 4JBCA 5FPMA 2KT3A 5KG2A 5HP1B 2OELA 1N88A 3CFRA 1WYGA 1FESA 3NH2A 4IQXA 4NX9A 4CJ4A 1T94A 4USVA 3IG1B 1KVIA 4CYUA 1AZSA 1SJ4P 2FGCA 1RAFB 1T44A 4HI2A 4CTAA 4HUEA 2FF6A 4UUXA 4I6MA 4CLLA 4TXSA 2PD1A 3QJPA 3IBWA 1LVHA 1PC5A 1WOOA 4F4AA 3IUCA 3CCEN 1QVGM 1SWWA 3N6MA 3TAQA 2KV2A 3NS7B 3WXMB 4H0PA 2HGLA 4J5OA 3OHBA 1MROA 2PT0A 2Z1IA 4C3LA 3WK6A 2GVZA 2OO4A 1U1RA 2VQEK 1EB0A 4FO6A 1ZTWA 4DX8H 3TP2A 4BDYA 3T5HA 2R7WA 4IO9L 1TAUA 3CD5A 1T6DA 2P9LA 3SEIA 4WFBQ 2DB1A 4KHSA 2C2NA 4M63C 3EJMA 2R2TA 2MKHA 2JRSA 1L3UA 1X2IA 1VIXA 3R97A 4NLSA 3CCJS 5KFBA 2VA3A 1WSHA 1JALA 1EP4A 1JB0C 3RSEB 3THVA 5EWFA 3I0SA 3ZX0A 2DITA 1OW5A 3ZSRA 2P9GA 2XQCA 2LEPA 5CP2A 3N79A 3OS1A 4FJKA 5E7OB 5HVHA 2YY3A 3V1QA 5KFFA 3AVKA 4JV1A 3WNHA 4WQ4A 1LAVA 4XK8C 3EZUA 3SJJA 4YD1A 4JOUA 4ZVUB 5HBMB 4KN4A 2H54B 3W1YC 1X0PA 4KYZA 2GJFA 1GLFO 3WEEA 3MWBA 1M5HA 2KVIA 4ZOSA 3H0MB 2E5JA 2AEFA 3Q7CA 3DDHA 3C29A 2K7KA 5GAGI 2A1AA 2YWFA 4FBUA 2R7XA 3LF0A 1REGX 3I32A 4K8XA 3VGMA 2DRAA 2VWKA 3FM9A 1RAEB 4PG4A 3DRRA 3FFIB 1XNQK 5KFMA 2WHEA 2JHDA 4JV5J 1BQXA 4NASA 1NZBA 3ET6A 1UJ4A 1YLXA 5C24B 1S10A 4EGLA 1HNXK 4OHXA 3MM6B 2ZH1A 2ZXHA 3H3NO 5HBMA 3CC4N 2PXIA 2QZ8A 3R6LB 1QZ6A 3T5JA 2O8CB 4H4MA 4OJGA 3PMLA 5DGAA 2IJRA 5KG1A 1ZETA 2KP7A 1JKHA 2G8HA 4K4HA 3CMAS 1X3MA 4NLTA 2R8HA 4QIVA 1L3SA 3MF5A 4C3KA 4TNOA 2DH8A 5IWAJ 3WQTA 2GZOA 2HOEA 5CA7A 3VV2B 1ZM4A 3C5FA 1J5OA 3K9JA 1HQ2A 2B3TB 1V4TA 3SBTA 3QU9A 2V7ZA 4IR9A 3VERA 1E6YB 2VPZB 3T1AA 3LM9A 1RAJA 1PVQA 1VQLN 4NWIA 1Z2LA 2GIRA 3SDEA 5HMWA 1Q16B 2B8PA 5DDMA 3KD5E 5J0RA 4KLTA 3K57A 4KH0B 4OI6A 5KT6A 2G0CA 4BRMA 4ECTA 3MURP 1SUQB 3TJ9A 2V4JB 2UP1A 1MWQA 1WC5A 1RBOB 1FX2A 2M88A 2WHOA 5ETKA 3AT1B 1TUWA 2P9NA 3FCWA 4DTMA 5KFPA 4NV0A 1SJRA 4LFCJ 4AF1A 2W03A 2F9TA 1A76A 4KTWA 5DB7A 4I2CA 2ZITA 2LM4A 1LW2B 1CZAN 4TKTA 3CNHA 4O3OA 3OFEA 3CGIA 4ZH4A 1BC6A 4DN0A 4Y2QA 1UCVA 2K4HA 1RT3A 2BR0A 3HXMA 5H9EK 4RW7A 2ZKTA 2E7VA 4CGJA 1NK9A 3GR0A 2XYPB 2BYCA 3HSTB 4CHYA 2DGUA 3N5FA 1A0OB 1U7LA 2A2DA 5AI4A 3FAHA 4MTPA 1KD1T 1SKSA 1GLEG 1UL3A 3SYZA 5AKGA 1FXLA 1RDCA 3PO5A 4O3PA 3OTBA 1N60A 4DX5A 1HNWJ 1KS2A 4JV2A 1S9EB 3PHEA 1UEKA 3A3OB 2ITMA 3CJ4A 3OYKA 2P9IB 1J27A 4LF4J 4CGZA 2PMHA 4ZCIA 2ZF5O 3TTDA 1EWQA 4KLFA 1YVUA 2JV3A 3ENOA 1EAYC 3UKRA 4DV2K 3C16A 3CD6S 4U8VA 2P51A 4DWIA 2OIHA 3FBCA 4X66F 1T4GA 5D78A 4PL8A 3Q2SC 4CE6A 5AI9A 1RISA 2UUBK 1K9MT 2G08A 4BX9C 3LDLA 3O9SA 4OPKA 3O44A 2VDHA 4I2QB 2C2MB 3W64A 5KRTA 2IOFK 4NLUA 2R8GA 4KLEA 4UUWA 2KTQA 3W8PA 4CECA 2YNGA 1W2IA 2OMOA 4JRPA 1VQPN 4KSEB 1HRHA 1RWOB 3JAMU 4FK4A 4IL6U 1KC8O 5KOWA 1I3OB 1WBBA 4F71A 5HMLA 1RE1B 4GKKJ 3OYNA 4UOFA 4KRWA 3NGUA 3ENHA 1F3FA 1TFRA 1QUPA 4CESA 4DR4J 2NXJA 1HD0A 4RQ5A 4RBUA 4NLXA 3ZEUB 1W97L 2ZWPA 2YQ0A 3A3NB 4YMEA 3LP0B 1U6FA 2HIYA 4Y1DA 3WDOA 3ZSWA 2GIFA 1MWMA 3KLEA 3MDCA 1SC1B 1HNZK 3T1YF 4G9ZA 4UB6U 4QW8A 3QEWA 4JI2K 3D2FB 3HVWA 3A0HU 4LF8K 2FBYA 1ZQXA 3KUGA 3MGHA 1J2NA 5HL7Q 2H3GX 4LFBK 3B6PA 3M2RA 3V6JA 1X4FA 3HDSA 4UBBA 3T1HF 2KE7A 1EJ7L 3SEOA 2AX1A 4I29A 2Z1GA 2HVIA 3VWSA 3IHQB 4KB0A 1K8KB 3AAPA 4GMKA 2V50A 2VGNA 8RUCA 4BRQA 4HHJA 4QZVB 3B9JA 2VBWA 1FEZA 4MKBA 3IKMA 1HBMB 3QT7A 3LH2S 3N5BA 3AVAA 4JK1A 2I38A 2K1RB 3D68A 4F5NA 1TKXB 4RT2A 4OLBA 3Q8QB 2W01A 2PBDA 1VRTA 4J9SA 1Q3UA 1G15A 3S6JA 1AW0A 4LQ9A 1S1UA 3MD1A 3M8PA 4H5TA 1LWCA 2K8CB 4DN9A 4EK2A 3A5MC 3TO8A 4DR2F 2MY7A 2M8DB 2H5IB 2WBNA 5DO2A 2V68A 2DNKA 3H20A 4Z6CA 2ZVIA 1HI8A 2G5IB 5AM1A 2B4VA 3K2YA 5T7LB 1FK9A 2DL0A 4YDUA 3AQOA 4FJHA 2OTJS 1SKWA 1UP1A 2K1RA 2YQ3A 5ALNA 1HUOA 5TKYA 5ETVA 1MN9A 4EO6A 2OMLA 1ZAVA 3CJ3A 3TOQA 2OD6A 3DXKB 4OJ1A 3J80O 4KLOA 4FYXB 5I3UB 3CC7N 5F8IA 4M5MA 3R8EA 4CZGA 4B9TA 4B1WB 3SMPA 2XS2A 5KFDA 1D9FA 1ZQGA 3H8JA 3AVCA 4TLRA 1BWEA 4ZVGA 1MN8A 2OA8A 1M5KC 3RU0A 3HULA 2ISPA 3G10A 1BL3A 2N3LA 2QWQA 5TISU 2BDUA 3CJQA 4TU8A 1TMJA 5IQQA 2GOLA 2GAHC 1HR0K 4EYIB 2LEBA 1V38A 2ZOFA 4FW1A 3VQEA 3AO1A 3ZDBA 2H9ZA 3O80A 4JI6K 3TQ1A 1LWXA 2J0WA 3MUMP 4Z4IA 4TYAA 3TABA 5J8YC 3HOSA 1AA1B 4FLUA 4PJ0U 5AZJA 4DU7A 2CQ2A 2GVDB 3VETA 4HVJA 5C2FA 1N36J 1FE0A 1HL6A 5FDLA 3ZZRA 4FK2A 2EFPA 4USUA 9ICPA 2EFOA 3C6TB 1YRUA 2P5OA 4CDGA 2DNHA 2QB0B 4NYNA 3MX2A 1AUSL 3HTVA 4MIAA 2AU0A 1AFIA 2W55A 3HJEA 3KZXA 4AQYF 1ZBHA 2YPYA 3GJTB 1X1PA 1B3TA 3Q86A 4DSKA 4KHPF 4DTRA 3W5ZA 4WF9L 4I6AA 5IILA 4P4MA 3MZIA 2H3QA 4F93B 4TU9A 3GFXA 4M94A 3HHLB 1U2CA 5KG4A 3W2WA 3CCUS 2OCEA 3SCLE 3MDQA 3EKSA 3N4PA 5KAKA 1MWKA 3R1LA 4NLNA 3D5MA 4DV7F 2SXLA 1OO0B 3NVVA 2ZBPA 2RUGA 4Q0BA 1IWAA 2AQ0A 4KLQA 3RB0A 2JWNA 3C6TA 3TEGA 3JYTB 3UI3A 1IKYB 2RSQA 3UNYA 1NJZA 4DL4A 3QEBZ 4DF4A 1WHYA 2J7KA 3V9SA 4NWBA 2COLA 5FP0A 2PDAA 1YAGA 3RBZA 2HHHJ 4RZRA 1S7IA 5K8NA 7ICNA 4CEQA 3MN6A 2WVBA 4I67A 2AEMA 1MMLA 5EOYA 3L9ZA 2ALZA 2MHNA 1UW9A 1N5YB 2HQFA 4QZEA 4KLHA 4N5SA 5FLXU 2B56A 3QJLA 1WC1A 3KHHA 8AT1B 2GO8A 2HMIA 2KYZA 5FPEA 3FE1A 2Z0GA 4NA3A 2QB1A 3HX0A 3M5RA 3KKFA 4LBIA 3ITHB 2U1AA 4O23A 3GR1A 3SNNA 4M95A 1S4EA 3M1VB 4DPYA 1RQLA 3EE8A 4FVUA 3M6UA 5B0AA 1HWJA 3THTA 3MM5B 1UZHA 1RYRA 3OTCA 1IJFB 4F3QA 4UY85 4DFKA 2BOPA 5ALOA 5KFAA 3Q89A 5BOMA 3QFHA 3UPQA 5L1JA 4E0DA 4WP3A 4IDKA 2WTFA 1N5YA 4X65J 4LF9F 1Y4ZB 3N4QA 4CZFA 1RKJA 1NGDA 4WK1A 4LF7F 4GO5X 5CYMA 4DDFA 4GKJJ 4K8ZA 1WSJA 1LXNA 5GAHU 1ZQDA 1U6ZA 4C8MA 5B5EU 4DSFA 1DURA 1WEZA 1GXUA 4O4GB 3J7YI 1VQMS 3VCBA 4R79A 2E1PA 2P9SA 3PIOQ 2O5DA 3LVWA 1WG8A 1R59O 4ZCKA 1KC8T 4DF8A 5CCLA 2BRLA 4ZP6A 4O3QA 3F2CA 1RBRA 1R8HA 2B43A 1UVMA 3CVKA 2B4JA 2YKNB 5RUBA 2VIHA 2XEXA 1EQMA 1RTIB 5KFXA 4R5PA 3WK5A 4ZVTB 4RL1A 3D2EA 3HHKA 2J9EA 4LF5F 4DFMA 2MQLA 1VQ6N 4KGZB 3H5XA 5ETRA 2IRYA 3D1OA 1RHQB 5ALIA 4RQ4A 1XBWA 1FNMA 4N76A 3U9DA 1XIQA 5D4BA 4CO0A 4L76A 8ICIA 5DRKA 1C0TA 3AA4A 3ONNA 1FWKA 3IS9A 2QC3A 4EO8A 3M4XA 5J2NA 3P96A 4OYMA 3POTB 2ZC4A 2WONA 2LVWA 4FJ5A 3HSCA 4DHVA 3L5KA 2A3VA 2OHFA 3K2PA 1XU4A 3RZAA 1TL3B 4KLLA 3B8AX 2XO7A 2ERRA 2B0GA 1CPZA 2MSTA 4IFVA 4UASA 1HNVA 5DDYA 4DS4A 1IH7A 5J2KA 1YHQS 3H2LA 3NTUA 1U8WA 5JS2A 4CDIA 1QQOA 3JAMO 3AO2A 1NSQA 5HVFA 4I9QA 2Q43A 2YKQA 1KAZA 2OUGA 2NUUG 3HO1A 1SZHA 1YJ9S 3VTIA 3M1FA 3PRBA 3D2WA 1IG9A 4URSA 5D4OA 3WQPA 2RHKA 4X4VA 4BE2A 5KFUA 5K14B 4CH0S 1AXQA 2KQ2A 2FXUA 1JWWA 3DLEA 2FJEB 2JL9A 2XHWA 4C4SA 3OTQA 3U1LA 4H0TB 1Q95G 4Z37A 3FC4A 4OX9J 3L4PA 2BPGA 2GC8A 1ZZNA 4PQUA 5KFNA 2RHFA 4HDHA 4MK8A 4A8XA 2BKNA 7ICOA 4OI3A 3NWGA 3ZSQA 3M2UA 5T7BA 1RDRA 2FDRA 2ZIVB 4FXDA 4EI2A 2IHMA 1WWVA 4LSZB 4ES2A 2RE1A 4BRAA 3D6RA 3ZX2A 2Y0SD 4H4OB 2KRRA 1UVNA 3A13A 1Y5NB 1UFLA 3QX7A 1XMOF 4FJJA 2AKWB 1KL9A 1WWHA 5K14A 1TL7B 3MEEB 1Q1KA 2ZD1B 3OUYB 4CHNA 2HF3A 2BVZA 3NAIA 2LYVA 3K8VA 1QZ5A 4CJ3A 1VHFA 5F9LA 5BYSA 1FXXA 1BNOA 1WSVA 5DB8A 4U67Q 2BA9A 3GIJA 5AT1B 4DV5F 3ZYYX 4P2XA 1ZYQA 2KJ5A 4BLGA 3HHEA 1TKZA 1ZBFA 1QVFM 1RA7A 1M5VC 2Q6BA 5CRXA 2FC0A 2GHPA 5B66U 2NRWA 3J8AA 1ITPA 2DXDA 4CLSA 4FYVB 2BANB 4ILMA 2WVDA 3EY1A 1TELA 4W5OA 4WTYA 4QZAA 3O5BA 3FSIA 3U3GA 3P3DA 4H0OA 1ZQAA 2MPUA 4O3RA 1RK8A 4I1TA 3PR4A 3IWNC 3HPHA 5ETPA 5A8KB 4CJLA 1ZQJA 4P2HA 4LVSA 3CDUA 3S41A 3KKAC 1JUDA 1UVJA 4X66J 2GA7A 2PEHA 1FNXH 8ICOA 2HBMA 5E3PA 1SS6A 2K89A 4P0QA 2ZFHA 3DXMA 3CJTA 4DPOA 1BUPA 4Y2KA 4F5QA 2IDLA 2HFSA 4HKQA 2AJ0A 1R6YA 4KTQA 4FP9A 2LECA 3IM1A 2VFVA 1RT2A 4QCLA 1REVB 3HVRA 1WI6A 2AIRB 1APSA 1ZZFA 4ECQA 4NCAA 5D15A 2R2UA 3R9PA 1UTAA 1V97A 4GV3A 3I5BA 4CZHA 5AZIA 3UD5A 3A5OC 4RQ0A 3IRWP 4FLYA 3QT8A 2Q0UA 3HD2A 1HQEB 1BU6O 1VQ8S 2LM1A 5KPTA 5EXWA 1SIZA 3DGPA 3CQXA 1ZM9A 2WF9A 1SB3C 4EP4A 1FDDA 4E98A 3D0IE 2CJYB 3ZSXA 2GO7A 4Q2LA 1RGVA 5C2CA 2MUTA 3ZETA 5C42B 3G87A 1JJ2R 2O1PA 2A1JA 1JLFB 3AVJA 1U2VB 4CEZA 3CCRN 2AP6A 1IBMK 1H7XA 4Q7AA 1ZQBA 2BACA 4A47A 1HKAA 2CJAA 1QSSA 4BVOA 4KHRA 4MYUA 3UVJB 2PSZA 2QT7A 1WSRA 1QVGR 3QBXA 2HVEA 4I2FA 2VGMA 2MLYA 9ICHA 4KREA 4WYLA 2EVZA 3I56S 2KOBA 4JI0F 3TZYA 1RG6A 2XVTA 1M5PC 2BRKA 3RWUA 5IQ6A 3ENQA 2Z57B 2EWHA 1QQ6A 1CLFA 2LQBA 4KC5A 3KLIB 3I5AA 3IMXA 1KKHA 3AA9A 4JI5F 2BPCA 3LQVA 3NAHA 5KFVA 1YSJA 1HNWK 2HW3A 3ENAA 4DR2J 4Y3CA 1TAMA 3ETMA 3TVZA 2V2QA 4TUPA 1PSDA 4LF4K 2RVJA 4R63A 3DJCA 4KPCA 3R3LA 2X1AA 2WAQC 2MTLA 4M9HA 1NZ8A 5EOZA 4M63A 2EH9A 5J0PA 2OSQA 2R4FA 5F8JA 1Z1ZA 2EQYA 1F5CA 3SUOA 4KKOB 5LY3A 2ASDA 5FLXO 4CJRA 2CJKA 2VC1A 4WP8A 1ZQHA 2FHMA 1SV0A 4X4OA 1S77D 7ICEA 1ZQYA 3KMSA 1UETA 3AJDA 1F9EB 2ZTCA 2CNKB 3VEXA 2V8VA 1I6JA 5ALPA 1VQKS 2FPMA 5HRNA 4GKKK 4O44B 1FRKA 3WUHA 3M32B 3WK9A 4DR4K 2BCQA 3CJKA 1ZQQA 1VYAA 3ZT2A 1YK9A 3SFUA 3NCQA 3R5DA 1RBVA 4QR1A 2HBYB 2MAXA 1MU2B 2RE2A 3CO9A 2UVVA 3L2UA 1FDAA 1WUAA 4GC7A 2B4OA 4ZPVR 2CGKA 1HBNA 4YG2A 1DEJA 2VDIA 5AJ3F 1N6QA 4P0PB 4RUAA 8ICCA 4NZ6A 4YCXA 2PIIA 3UCGA 5ALLA 1NJWA 1KBUA 1RTZA 1CQNA 3M8YA 1Z00B 1KRPA 3QRRA 2FLNA 2J9CA 1Y0HA 1HEKA 2QEXS 2MLZA 1X4GA 5FD1A 4E19A 2OM6A 4IDHA 1P1TA 1MA7A 1J5EJ 1KFSA 4E7JA 4YOUA 3MEKA 4DG1A 3KOAA 4JI3F 4AQYJ 1N34J 1B70B 2C3UA 3MOZA 3HRDD 3RH4A 1T9YA 4ZVPB 5HK4A 4JRQA 2P9EA 5KT3A 1RDUA 5AKZA 1HKGA 4Y2UA 4XDCA 5M2RA 2HK2A 1NH7A 3DYAA 4M3UA 2FIUA 4J9MA 4QOTA 3DDKA 4DSLA 4P75A 3K0JA 4X4NA 3V4IB 4DV7J 3HYFA 4AXJA 3MPYA 2HHTA 2IM1A 2J76E 2G0AA 1X7VA 3UDEA 3AA3A 5HMYA 1EHWA 1NSAA 1KLMA 4JKEA 4UY8O 3V7LA 2LDYA 3UWTA 3TSQA 5E3CA 4PYAA 1Z26A 1OVYA 1TAQA 1JL2A 4LBHA 3KLGA 2DD8S 2W8KA 3DRYA 1C7YA 4USMA 3X3UA 2HRUA 2NSCA 1RT7B 4KV8B 2FVCA 1YJTA 2NV3A 3MD3A 3DLHA 3PKMA 2WVFA 4BR7A 3PCOB 4KO0B 1WC0A 3RW7A 3MCSA 1QSLA 1IJJA 2CXEA 3NOGA 3MPDA 3NFAA 4CRJA 2XGPA 2PKEA 2HRYA 2HBJA 3QU7A 2KZMA 2IM2A 3AEVA 2CQIA 3VEOA 3C95A 2E2QA 2YMLA 2W7AA 2HLTA 1U1KA 4E7HA 3UW1A 2BUNA 3LDAA 3RBXA 1JQGA 2UU9F 3IWLA 3QNOA 3BSCA 4C8OA 4ISEA 3VQDA 4WQ5C 3JXOA 5K4LA 5ALEA 2POKA 5BRDA 4MO4A 4RW6A 1PO6A 1AQ6A 1Z4UA 4G65A 1RT4B 3C94A 3L3VA 4LF7J 1VQNS 5AQSA 1GMVA 4OKJA 4XH1A 4PXBA 2IAJB 1KQFB 4CEEA 4KO0A 3WZ0A 4DZ6A 4KJIA 1FFGB 3OL9A 2W41A 4ZP7A 3E0FA 2HSEB 4MEYA 3AFGA 4WKRA 2ZEJA 3QIPA 5J1NA 1TK8A 2AZ1A 5GAGP 4WFNL 3MM8B 1YJNS 3NNAA 3CXCM 1FTCA 1LCUA 2M5YA 3G71N 4AD6A 3L7OA 1V5IB 3FSYA 3M30A 4BQZA 4CIFA 2AJFE 4OHYA 3JQJA 5L9NA 5BXIA 4NLZA 1FKOB 3CC2S 5HR7A 3M6ZA 3ZDDA 3V6KA 2KG5A 3GFKB 1B9FA 3D54A 4DQQA 2D3ZA 4M5GA 2L08A 4LF5J 1DTQA 3HMJG 4NB4A 2MZRA 1NDKA 4JKAA 5CQGA 2XO6A 3J7A1 4FN5A 2ITGA 1LKYA 1IWGA 3WKDA 3RH5A 1RWWB 3RG6A 4ZITA 2QLBB 1BCMA 4E89A 2A19A 2RU9A 2KIVA 4M6WA 2PY5A 2WSFC 1NPRA 2XICA 5I42B 2J4RA 1VQ5N 1S99A 2MJUA 2HHHK 4ICLA 3N7RC 1EETB 2WK4A 2Q1NA 1RBUA 4QYRA 5AQWA 4A4JA 5D4NA 2RD5C 2EW9A 4FDFA 3TI0A 2O4IA 1EXNA 4PGQA 5IIIA 3MDAA 5KFTA 4I7FA 4IYQA 5AICA 3ORYA 4K4GA 3PKYA 3M8QB 4C1NK 1WOSA 1FJGF 2O8BB 1YVNA 4KLDA 1NSKL 1NCLA 3A2FA 5BJRA 5F8LA 3UXOA 1U1NA 4EZ6A 2GTDA 3EPGA 5GADU 2HMXA 2N82B 3TWZA 1S0NA 2CQCA 3N6NA 3ZD9A 1N4LA 3IFRA 1HUZA 1TVAA 3KK7A 2G8WA 5I42A 2FYXA 2KKHA 4H0YB 2IDEA 4F67A 2E8PA 5HLFB 1UW4A 3WNEA 5BN8A 4UZCA 4BRIA 2DPJA 3J7AN 4UOHA 3OLBA 1SKUB 3RBDA 2D6FC 4X65K 3B0YA 2ZZNA 5HP4A 2JLFA 3U4LA 5IFMA 3ETRA 1TVRA 1S0MA 4USTA 3BYRA 3KZBA 2DR6A 4ZVHA 2UUAJ 4JK9A 1QQ5A 4EBCA 3FYHA 2CDQA 4Z4HA 4M9LA 4O5BA 4EU0A 3KXDA 2W9CA 1X5TA 5GAEU 3IR6B 5KTQA 4K4IA 4NCGB 3QEPA 4FPAA 2LEAA 3TA0A 1N0VC 2B4PA 1S49A 4KMUA 3QE9Y 1XMOJ 4K4SA 4Z7YA 1N33F 4FZYA 1PYSB 1UWBA 3A8IA 3PACA 3ISZA 4HI1A 4BRCA 1EO1A 1UPPA 4FJ7A 1X42A 4AHTA 3NGTA 2V67A 2OWOA 2MGZA 4B3TF 3ZSVA 1VQ7S 4FLXA 4H5VA 4I64A 1F5SA 4N77A 4DV5J 5CHIA 3T9ZA 5KFKA 3C1YA 4B3RF 2E4LA 2E9TA 2J0XA 1JX4A 1VJQA 2EBEA 3QEAZ 4U8YA 5M1OA 4DL5A 3FGVA 8ICQA 3CETA 4DR3F 3QERA 1DRZA 2CQPA 3KD1E 4CF0A 1ZQOA 2KG1A 2V2KA 3RRGA 1NZAA 1U2RA 2LMRA 3RTVA 3ZO7A 5AI6A 2YWEA 4ZMMA 4FWMA 1F44A 1V9OA 3R3TA 3H90A 5FPNA 1HQUB 3FMWA 1GXLA 1R31A 4G1QB 4PWDB 4OHZA 2BJ7A 2PEBA 4P2MA 3V72A 3CJCA 8ICGA 1VJWA 3I6PA 2G2OA 2MJNA 2B6AB 4HYKA 2ZZMA 3HBTA 1ZTTA 2QRRA 3DOMA 5T14A 1N61A 4PPZA 2NRZA 2M4MA 3I9V9 3UD4P 4JD2A 2CWKA 3PYGA 4RUCA 4QR2A 4WFBL 4TQSA 2IHR1 3OL6A 1JK9B 2ZIWA 3HX9A 4M5LA 3R6MA 3NBPA 4OV6A 4K0KF 3M8RA 4UY8T 5AI5A 2QLTA 2MXYA 4DV3J 2F3NA 3GE9A 1V4SA 1TL1A 2XULA 4B1UB 1ATRA 1JLQA 3EUB2 3R5JB 4P2FA 4IFYA 2M0NA 2Q79A 2L48A 1RWKB 1EQ0A 1HLUA 3DOLA 1TFWA 1ZQSA 4DTNA 2B9WA 4ZLLA 3R1HA 1XMQJ 2EAPA 2FZGB 2YQEA 2F3JA 1S1TB 2LQJA 1JLCA 1ZJMA 2M70A 1U1OA 4I2HA 3CCSS 4FK0A 1OSDA 4WK3A 3JPQA 3E01B 4ZVEA 1ZQCA 1L5UA 1K0VA 2B7CB 5SZTA 2V2ZA 2K3KA 3KHYA 8ICWA 3WK8A 3PXGa 1KHVA 2WB1C 4LR8A 3DRPB 4URGA 2A6OA 5J0QA 5J2GA 1YJWN 4GRSA 3ZSZA 1FRLA 1WHWA 3O1WA 3NDKA 4RPYA 2DR7A 4FWOA 3GWCA 3H40A 5HRRA 3FZLA 3HKZC 1CVJA 2DQNB 7ICLA 2RT3A 4J90A 3U8XA 4CNYA 1A6LA 1O5JA 3AVMA 3C46A 3KKRA 2DBBA 3I8DA 3OBIA 3IP0A 4FM0A 5KFYA 1SH3A 7ICQA 4UB2A 5FIIA 1DHMA 1RHUB 4AHCA 5M1KA 2QYGA 2NZCA 4CO4A 2BQ3A 3DU6A 4CH7A 4CZEA 1U49A 4KX5A 1YG0A 3TSUA 2KFYA 2IM3A 2GH1A 4QQBA 3AODA 5AIBA 5AM5A 4N8NA 4GV6A 2A3JA 1RTJA 3D2SA 5C2GA 3VF0B 3O9UA 5AQNA 5EWGA 2AW0A 4CJ5A 3AM9A 5E3RA 4X66K 5AQIA 3OYJA 1FHTA 3HD1A 3G4SN 4BDPA 1SH0A 5ETNA 2H3IA 3BV8A 2IM0A 2KT2A 5CA5A 4J9KA 1SC3B 3KNAA 4V19J 2FGOA 2VFTA 3QGPA 4UBCA 2P6RA 4HH0A 2Y1RI 4C8ZA 4ECUA 4F04B 5AE3A 5KFLA 1B0VA 1NDPA 4BROA 5AKIA 4GW6A 3QNWB 5E2QA 5F3ZA 1T0TV 4F25A 2RS8A 3G86A 1ZRNA 3FUYA 1BG3A 1IKVA 4NLVA 4I69A 1YDLA 4FWQA 2IVPA 1MA9B 4Y2JA 2FPKA 4PGYA 2QE5A 1U02A 1F5BA 3BQ1A 1W9HA 3CCVN 3TQEA 2E5IA 2H51B 2XSJB 4KLIA 5HRPA 3H8MA 1T3VA 4GNIA 2E66A 3PW4A 2CVEA 2ZDOA 4HDGA 3RJFA 4LRCA 3TUZC 5AJ3J 3GTYX 4AYBC 4CJEA 2K4EA 3DWLA 1Q8LA 4HACA 4B6JA 3TACB 4H5NA 4Y28C 3T1HK 1IJEB 3VOVA 1NNEA 2NRTA 1R0CB 1LXJA 4P71A 2UXCF 1M1HA 1ICEB 3T41A 2K8BB 2BJ8A 4YD2A 1I39A 4FJIA 2R7OA 1J2MA 4JI3J 4L3QA 2MKKA 5JU5A 2RRBA 2PI5A 2Y1JA 4YMMA 2BV3A 3PW2A 2ZE2B 3I87A 1DBDA 3AY9A 2PFOA 3HVTA 2E5LF 2M9NA 5F8NA 2LXIA 2XY8A 3THPA 4LSNA 2AEJA 2R7YA 3BO2A 3GIKA 3AAQA 1CJTB 3QAUA 2ZH2A 1M5OC 3MMCB 2BM1A 4DR2K 1F5AA 4ZKAA 2ZH7A 1QTNB 4IQVA 1S0OA 3MN5A 4K25A 4KTZA 4P74A 2D8CA 2QLJB 3M8WA 3G96A 1FFUA 2LI6A 5JVHQ 2Y9HA 3I55S 2QA4G 1Y9OA 2FJAB 4BE1A 3LPTA 5CHGA 4BXOB 2JH3A 2W04A 1DLOA 4ZP9A 4AP9A 4PG5A 1WOQA 1X5OA 2MQ8A 5A76A 5LMNF 1G1XA 1QAYA 3IR5B 4WU2A 1VC0A 1O51A 1SVDA 5KFZA 4QW9A 1CJUB 2HBQB 4OLPA 4JI4F 2EC0A 1Q18A 5LJVA 1X4HA 4MEXA 4QWEA 4XPCA 4MQ3A 1WTFA 1FRXA 1GOCA 4XIUA 1ZQZA 1RXVA 1IXKA 4B08A 3TZXA 5HATA 3CC4S 2A3ZA 3K5OA 2O3DA 3IN5A 2GWSA 2AJQA 2DNGA 2IBOA 4QJFB 1DFDA 2DNPA 2M3DA 1LK5A 5HL7L 4Q5VA 3O8MA 1N56A 2MKCA 2UVUA 3BQTA 3MXMA 1VSEA 5ALXA 4CGHA 1W7AA 3J80Y 2W7OA 3AHPA 3TJAA 3QETA 4ETZA 1VQYA 2YMPA 1JRPA 3PR5B 2UU9J 3OYHA 2E1AA 1UPHA 2FHJD 4JKHA 4UT4A 3IR7B 2BH1A 3P31A 3JPSA 1VQLS 2P9UB 2W2PP 3HW8A 2F76X 3PIPQ 2LSNA 3ILOA 3GLJA 1URJA 3KKAA 4X62J 3VGUA 4FWNA 4BR2A 4CD3A 5E84A 2YNFA 1J5EK 2PMZC 2RKIB 5L1KA 2HAIA 3L3FX 2GMHA 2WOMA 5HAOA 2LP4A 4AQYK 1N34K 3KZIU 2OPQA 4OL8A 3ENWA 3H5SA 4IQTA 3NS1A 2O8DB 4KB7A 3FLCO 4CHQA 1QAJA 1RDFA 3TARA 2KVCA 1EKEA 2X1BA 2P9UA 3NL0A 2XTJP 1W7WA 3DLLQ 3AXKA 2QV6A 3WIVA 4DV7K 3PM9A 5F8GA 2RNEA 2E29A 1U47A 2AYBA 2WTUA 5HJYA 4OYBA 4DV1J 3MMBA 3LOUA 2YQ1A 3TZWA 1XI1A 2A42A 4OZ3A 5C25A 3UQ2A 1JCEA 3P1GA 2XG8A 4ZVQB 3DXBA 3SPZA 3AQEA 5AKXA 4CH1A 4O5EA 4HL9A 2H4YB 1YT3A 3DLGB 3TAFA 3BR8A 4A48A 4M42A 1CSJA 2KW4A 4C8KA 3EVWA 3SXLA 4CFBA 1ZRMA 1RTDA 4LD0A 1S9GA 4J91A 3LDOA 4FBTA 4A5AA 3AA8A 2OTLN 1WSGA 2ZUCA 1VSKA 1NJIO 4DX6A 1ZBIA 3VAMA 3R1XA 3FVYA 2YMQA 4OX8A 4J2DA 2CPDA 2VG5A 4BC9A 2FMSA 2OPSB 1T03B 5KT2A 2QL5B 1GNKA 4Y2XA 3B54A 4WE1A 4XO0A 5DQGA 1HNIA 4DR7F 1V6HA 3TSPA 4ED6A 3WKCA 4I56A 1NPKA 4P4PA 3LP1A 4HHHA 4JNEA 8ICHA 4DL0C 3PX0A 1Z05A 3OFFA 1S6QB 4OI2A 3BS7A 3VQ8A 4KHMA 4UW9A 1DGJA 5EE0A 1RM6C 2ROPA 1U0HB 4B3SF 4LF7K 1KEKA 2VPYB 5J2QB 4USHA 5A0YA 1VQON 1WCNA 3D9BA 5HHHA 2EANA 4X4TA 3HRGA 2RF2B 3TUJC 1B0PA 3TR8A 5ETLA 3QT6A 2VUGA 4CF2A 1H1VA 3Q24A 1ZQIA 2OEKA 1RUSA 2LU1A 3TVKA 4CBXA 1JI7A 2O6KA 3ISNC 2ABYA 2YKOA 3IWXA 2BGGA 4C9DA 3RMDA 3THXA 2QKBA 1YJRA 2BE2B 4IUFA 1C6VA 1Y00A 1N33J 2K3IA 1S6QA 2PZSA 4Z4CA 2RILA 3KK1B 4PXDA 3PW5A 3OHRA 3ELHA 5D3GB 4RWWA 5J0WA 2NO4A 1TR0A 1R0AA 3VA0A 5G0RB 1H2UX 5J2QA 3EE3A 1FIQA 4J9LA 4LF5K 4JK7A 1R3NA 4F2SA 3E2EA 2LFVA 2PGCA 4I2JA 1BUXA 5AK6A 1RHRB 4CFDA 2D9OA 4QR0A 3KK2B 1ITGA 3C6UA 2FBTA 4ED2A 4YY3F 2DNQA 3SQGB 1M1KT 2YWWA 3T69A 3MBYA 2AZ3A 3OR2A 4JI8F 4RNFA 2A1SA 2ILYA 3QWUA 1KVAA 3T9NA 2C2OB 4Z4FA 1D09B 5CYQB 2I5JB 4FZXC 2GIQA 3SSRA 4FYDA 4M3RA 3AVBA 3U3YA 5HMXA 2Q31A 3ID8A 3SIPB 5BR8F 2IA6A 5KFJA 4OJ6A 1Q82O 2R7QA 1SBRA 3MR3A 4L72B 2OSRA 5E3AA 2EBGA 1U48A 4F50A 3H08A 2GJ2A 5A6WA 5GVQA 4YOYA 4ICAA 4CF8A 3TAEA 1SAZA 2P6TA 4ILRA 4I2DA 2I6WA 4ZIWA 4N8OA 3CC7S 3FNNA 4OVLA 2WAQF 4DR6F 4DCHA 2V34A 3CJRA 3ULDA 2XZTB 5HMMA 4FWLA 3EPIA 1KQQA 3VQAA 1IKXB 3PIOL 4J9VA 1Q5VA 2VQFJ 4L6V3 1NZPA 9ICUA 2OHDA 3MPVA 1DQ8A 4K0KJ 3EWAA 4K8RA 4ZVOB 1S6PA 1WDDA 2V0NA 4B3OA 3IRUA 2FJDB 2LCWA 4GVBB 3T19A 2O8EB 3QATA 1RB0A 3R5BA 3BO4A 2MZQA 3BQ2A 2VBZA 3RJEA 1HYVA 3H7HB 3V81B 1JL1A 3JSYA 3MPUB 5GAHI 4FZLA 2E8OA 2UUAK 1ELOA 1PVPA 4K59A 1SGGA 3A0BU 1QH9A 1BDGA 3PFOA 1LKZA 3FZHA 4FNIA 5EX3A 2B4UA 4YR2A 5ALYA 3TVYA 8ICRA 3M05A 2XLIA 1HJPA 1IKXA 3UMGA 1XMOK 4QZIA 4OJ3A 3TAGA 2DRBA 4IO1A 2Y0BB 1FJ7A 3TADC 5F3XB 5AQZA 1JLGA 4TURA 1CC8A 4GVBA 4WP9A 2YNHB 5HROB 1IO2A 4JAXA 4DV5K 3O1BA 4I2IA 1C4AA 4PZNA 3Q8LA 4CFAA 3ONQA 5DG7A 4BJQA 2ZM6F 8ICLA 2DHHA 2D1CA 2EWSA 2P9KA 3IC1A 2QGFB 2JOQA 1K5OA 4HTIA 4O0IA 1BISA 1HPZA 3RJGA 4TY8B 1SXEA 3CW2C 1R7IA 1RBTA 1GTEA 1FKPB 4OX7A 1SL1A 5HVGA 4BG9A 1ILYA 3ZZUA 2FLPA 3AL0B 2YHWA 2QX0A 4O9MA 1IM6A 4KHUA 4QWDA 1VSMA 2GO9A 4RNMA 5F3TA 3VQQA 1WORA 3CXCR 5BPNA 3CCJN 3M9NB 2OFGX 1OWXA 3T6BA 3T5LA 3VZHA 4BHQA 1Y5LB 1ZBLA 3MM9A 7ICPA 1WTBA 4NLBA 3LGNA 4FVCA 2I7PA 1N5WA 1BQMA 1ZQLA 3EMTA 4AILC 3M6KA 3TTCA 2FJBB 1IR0A 1FKPA 3D6FB 4DLGA 1WI8A 4B17A 3H8YA 1T6CA 5DBBA 3E8OA 3IAS9 1P90A 2IOCA 2A18A 4KMOB 3M2VB 1NAQA 4DV3K 3UDVA 2VKRA 3O3HA 3IP4B 4J9UE 3EO3A 4NEYA 3ICLA 5KFEA 4CJQA 4ZJOA 2G09A 3OXFA 4Y2AA 4PKHA 2VYPA 2VFSA 3DLKB 4UB1A 1N5VA 3KJVB 5SWMA 4OYOA 4XEIA 1X9WA 1T9VA 4PR6A 4U67L 4FZZA 3GG1A 1RWVB 5MAOA 3AVNA 4R25A 4JB3A 5TZVA 2HNYB 3QFWA 3CMEN 3BPSP 1NJIT 4F2RA 1BD6A 2DIUA 3ASMA 3KFWX 5J0OA 2PC6A 1WHVA 1IBLF 3KK3A 1OQ6A 2XI9A 1Q5YA 3CMQA 4FKXA 3DI6B 1VDHA 2CA9A 3W9HA 2Q0RA 3THYA 4ZPWR 3SV3A 2LXFA 8ICTA 2RDIA 3OYAA 2YNIB 2JZBA 4MFBA 3KOOA 8ICXA 3OTOF 1KCFA 3SSQA 4DTXA 4RKUC 3ZZOA 3O8WA 4F4YA 3BH6B 3KJVA 4WCEL 4ISGA 2GCFA 2NLWA 4JI0K 1MMDA 2HRTA 1HNZJ 2ZUDA 4PWWA 1X3NA 2A0FB 2XY6A 2W4PA 2R7VA 4QWCA 4IG0B 2XRIA 1PG5B 5EU7A 1RHKB 4RUBA 2DIVA 4OJOA 3T79A 5DKWA 2JR5A 9ICXA 3EE9A 1XQIA 3ZZZA 1VQ6S 4LFBJ 3D7EO 4M9NA 5J2MA 3TNVA 3LDPA 1EX4A 3MFIA 3K89A 3QZ8A 3NMRA 3SZ2A 4YMOA 2W9BA 5DBAA 4RQNA 3NGDA 1U45A 3PHTA 1SQFA 3I0RB 3CCQN 3HHLC 5LSLA 2VC0A 3L3CA 3BBFA 2CZ9A 1SL0A 4QNLA 3HSZA 3OHAA 4J8FA 1N5QA 1BOTO 2MZJA 3VAGA 5LMNJ 4FJNA 2PMWA 5KOXA 2WBRA 1KVJA 3SQOP 4ED1A 2BCRA 1IBCB 2U2FA 2ROEA 4UW2A 4BRHA 2ZDPA 2ZHBA 4IOXA 7AT1B 2GHVC 2RB7A 4RJVA 5AM2A 2XI2A 1RDBA 1GFWB 3NRWA 2FVSA 1Y88A 1BI4B 1LQ9A 2VANA 5FLXY 3TYTA 2X6NA 4JV0A 3VQTA 1MLAA 1NGHA 3W2VA 1NOYA 1QUVA 1VFJA 3FC9A 2E2PA 2DGXA 1B0TA 2Y3YA 4FFDA 5H1SQ 2WB4A 4PYDA 3MGVA 4CRXA 2XYGB 1MDUB 4I68A 2WMMA 5L46A 2K8AA 3IG5A 1J53A 3GONA 1L3KA 4LVOP 5J0UA 1LNQA 1Q82T 3DOKB 3RVCA 5AJ3K 3CJBA 3OL8A 1TKTA 3O9RA 4ZLNA 1H74A 4B02A 4LSLA 2V8HA 2BQRA 3M7VA 1TYQB 3SBGA 1PYTA 2GS8A 3QICA 1WN7A 3V5RA 5L39A 3JQKA 2NXNA 3AAWB 3CCWA 3VA3A 2YJFA 4JI3K 1HBUB 1TKDA 2VICA 4LREA 1Q3VA 2XZWA 3O5TB 3K5MA 3UE2A 4IRKA 1OH7A 3H0LB 2YKMB 4QIGA 3JPPA 1NGAA 2DHSA 5FRNA 2L3MA 3AOCA 3CCMS 4KX3A 2PN6A 4FO0A 3ISCA 2Q1LA 3MK6A 1X4DA 4RQ8A 3CO0P 2M8HA 4FZVA 2VQEF 1Q0NA 3MAAA 3UN5A 1JXLA 1M0SA 1ZD2P 1SZ2A 3M6WA 1NRKA 3O08A 1NMEB 3GFZA 2CQ3A 4BR5A 3K75D 3B6BA 5AK5A 1BHNA 2VD3A 2NZ4A 1HWUA 3KLHB 1N54B 1NMNA 2X7IA 5D4LA 1PYOB 2ZH4A 4ZOHC 2WZ1A 4KI4A 3L7PA 2RRAA 1KAXA 2D3O1 4HR2A 4OIXA 1WB9A 1KTQA 2KNJA 1KSPA 3E9OA 2DKZA 3EGNA 5KFSA 1FT8A 3PNIA 3RJKA 2G8FA 1A9NB 3AU6A 3JSMA 2AA4A 3H42A 3ETOA 2E5GA 2G9OA 2GNKA 4DR7J 1C0UB 5HQMA 3PYFA 5DG8A 2UU9K 3UFCX 3T5KA 5D46A 2AV5A 2O66A 2F4VF 3I9ZA 3NF7A 5KAIU 4LT6A 4C7QA 8ICBA 4ZCMA 3WX8A 1O8BA 1BQNB 5J1EB 2LPEA 3JTOA 3VGKA 3E1YA 8ICSA 2FJVA 3S7RA 3H98A 4A8SA 1T05A 1A5VA 2OTJN 3ZD8A 3FZKA 5ALHA 4FLTA 1X4AA 1VAZA 1MNEA 1BPXA 5C2DA 2GFFA 3D3BJ 4U7UD 4QS7A 5KI6A 3B8HA 2OLWA 3RRKA 1W25A 2QWLA 1NDCA 3AQFA 4ENOA 4F3MA 3R5GA 3VQBA 4CLYA 1GOAA 1H7WA 3K5LA 1QE1B 3JS6A 4P4OA 4KQZA 5M2UA 3QLHA 3SQ4A 5EWEA 2MQNA 2CRXA 3PW7A 1D5AA 5F41A 1BIZA 4M3XA 2DHAA 2QMUB 3R2DJ 2HCFA 4JKBA 1U6BA 2BGWA 4C2MA 3LP3A 4H8KA 1RT5A 1LWFA 3HL8A 1YJ7A 2WB1F 2KL8A 1TMMA 1SQGA 3DU5A 2ZJPQ 4YN3B 3FZMA 1C1CA 2IC3A 3HP9A 5HR6A 4K5RA 2NXUA 3BM7A 3HKZF 5IT0A 4PHPA 3QU5A 1P27B 4DZDA 2FJ6A 2YHYA 1B22A 4DUYF 5IXUA 2UXBF 1S5LU 2K2PA 3K59A 2PFFB 2IVOA 3UKUA 3H8WA 4ECRA 1DZ5A 4ED7A 4OGCA 5KRSA 2AYGA 4B9VA 3BGRB 4ZK7M 1TE2A 5BR8J 1ZD3A 2J7UA 3WXIA 1YTYA 1JLAA 1FJGK 4KLUA 3D6TB 2WW4A 2MQPA 4U7BA 1SJFA 2F9WA 4I2AA 4DUZF 4J2AA 3VEVA 3O4WA 4DOAA 4KFBA 4C0BA 8ICAA 1E6VA 4MT1A 1XNRF 4JWNA 4DMZA 4BRFA 1KDNA 1LWEA 5EE3A 2JSXA 3KKSA 2HNZB 1HYZA 3VF4A 1RILA 1T8EA 3ZZTA 3A8YA 4V19S 3VQ9A 5IT9O 2YX8A 4RW9B 2RUSA 1HJOA 3WT0A 1UJ6A 3DMJB 2ZJAA 1BGXT 1NSPA 4BGDA 2OPRB 3TANA 1LFWA 1VRUA 2HPUA 2O8FA 3EW9A 2BKEA 4DTPA 2HZVA 1B43A 3J80U 2KMDA 3A8KA 2HBRB 2YV0X 9ICKA 2X51A 4NLOA 3NCRA 4H4KC 4Z2XA 9ICNA 2RQCA 2DGOA 4QAGA 3G25A 1IIPA 4M3YA 4NM2A 1T11A 2BHNA 4DV2F 4KE5A 4YFUA 2Z4PA 4CZJA 5KG3A 2GWKA 1C0GA 1N33K 2VL1A 3VAHA 4RW9A 1N2XA 3HSGA 3H8SA 2OPPB 1Z25A 3LZIA 4B3TK 2Y0SC 5D49A 5HP1A 2APOA 4F7VA 2MA1A 4ATNA 4AYBF 2QTDA 4FM2A 3IG1A 1FRHA 4EHTA 5CD4H 4JKDA 4ELUA 4CM2A 4KLJA 2KHQA 3GE1A 4KT0C 4WFAQ 4PQAA 3OYCA 1XO1A 4QBUA 3PV8A 2HBKA 1CXQA 3V6DB 3PO4A 5AKYA 2J6UA 3R9LA 4NY8A 3OW2R 5M1QA 1VSIA 3SCKE 5L1IA 4M2YA 2HFOA 4LBPA 1UA0A 1UMJA 4EFHA 2V8GA 2CN1A 4JI2F 4FF4A 3I28A 1A77A 1OY8A 2L5YA 3UR3C 4ISFA 4Y2VA 2LBOA 4OI0A 2OFHX 3UM9A 2YH1A 4ZLJA 2FMQA 4Y00A 4NOHA 1RT6B 2BJ3A 4RNOA 2LA4A 4BY9C 3IRXB 3FZBA 4PA1A 4BRNA 5J29A 5GADI 3FDSA 4O8UA 2D0PA 4F0HA 3MC1A 5LSOA 4I9LA 3OTEA 3NMUA 1WWUA 4RR5A 4R8UB 1Y7PA 5B0CA 5E0OA 2ASOA 4PY5A 2QN6B 3IM9A 3K17A 3GJQB 4EYHB 4I6WA 2VQFK 2WW8A 3RSEA 4A8KA 4K0KK 2JEFA 2H4WB 4ELTA 3ULEB 2LU2A 2WAQD 3PJWA 4EIAA 2W24A 1YIJS 1Y10A 2DGWA 9ICMA 4NEZA 4BC2A 2N7CA 3NE6A 1DQAA 3VAFA 1CS4B 5IM0B 3CFOA 2H48B 2JX2A 2ZBCA 5HSPA 5ALUA 2F1FA 4ZIVA 5GAEI 2X1FA 4YP3A 1C20A 3VGLA 3OSPA 2FUG9 2E8MA 1NOZA 1P8GA 3FFIA 3KHLA 2KG0A 3S3NA 4ZS6A 2DGTA 4DV6F 2Z2MA 4JYAF 5C24A 1D4XA 4JN4A 2XS7A 5C7PA 9ICLA 3MM6A 2HIQA 2JNJA 2JHEA 2C3MA 2RHSB 2MMYA 3QQCD 1JLEB 1EZZB 5KFHA 4QZBA 3C15B 1CS4A 2YHBA 3ZZ0A 4KHNA 3G71S 3MECB 2O8CA 4J2BA 1C1BB 3VMFB 4WQ4C 1YBUA 4U95A 4FLWA 2PMZF 4L75A 4ZTJA 3NAEA 3QUBA 4CVNE 4YS2A 1HR0F 1U25A 3EXCX 3BEXA 5HO4A 1XC9A 1NLVA 1IBMJ 5AKHA 2FZCB 1CRXA 1NU0A 8ICVA 4JI6F 2ZUBA 4NYZA 3RJMB 3EZWA 3EKUA 1E6YA 3KMQA 2WFBA 3R27A 4RLEA 1L6NA 9ICGA 1X60A 1V3RA 1H2VZ 1JLEA 2LA6A 2M7SA 2QL9B 4MK7A 3EN9A 2OEMA 2QMXA 2AMCB 4CWBA 3J7YU 3AJ2A 1OY6A 1ZOLA 3ICXA 3I33A 1SUQA 3MGIA 2O01C 2V4JA 4A8WA 4TUQA 9ICWA 2Q2RA 2DNOA 2VPWB 4YB1P 4Q8FA 3MR5A 3AARA 1RLCL 4AM7A 4TU7A 5JXSA 2DHXA 3MCPA 1YITN 4NLQA 4LF2A 2CPXA 2HVHA 2RP5A 2HWIA 1WSIA 4M5DB 4YR0A 5ALJA 3TWHA 4I2PB 4HHUA 3ALRA 1LW2A 3M6GA 2DNNA 4DU1A 1YTUA 4CIOA 2VFRA 4W90B 1RADB 2YKPA 2NXEA 2OZMA 4GMJB 2FHKA 2NPIA 4PXEA 2FJXA 2NPFA 1MW7A 2IMWP 1FRMA 1DRGA 4A61A 5IZHA 1UFKA 1KOHA 1WNEA 3HJFA 2F65A 4FCYA 2I5HA 1KTVA 3VEWA 3T6JA 1KW4A 1DARA 1X8DA 3QSYB 3TU5A 1JLBB 2ZH9A 3CYMA 1Z3EB 4AHUA 3KDNA 3SAGA 3EEQA 4YXJA 4KLMA 2BEFA 3I1YA 2QJ3A 3AVIA 3GIRA 4JP8A 4US9A 5J2PB 5AQVA 1S9EA 4YOEA 2P9IA 2EAMA 3W3SA 1ATNA 2FJWA 4H0VB 4XAKA 4P10A 4QIWC 1FA0A 2P1JA 2ZUAA 4IXCA 1U2FA 4ES1A 2B8QA 4IQUA 3QJJA 5KAFU 4L73A 3RR7A 1MWZA 5ALWA 3MCNA 2F5GA 2E5LK 2KVQE 3AO5A 5AQMA 4AHSA 1KONA 1G6BA 5CZ2A 1Y64A 4OPJA 4NLKA 2HURA 4I2QA 4YDXA 4A5BA 8ICPA 4DR1J 5J2DA 2G07A 5AQTA 2GV1A 1R8BA 4BRKA 2NZTA 5H9FK 2W3SA 1ZQEA 4CF3A 4DCOB 2R8IA 3F0NA 4OI4A 1VSFA 2HLUA 5AQFA 3MEGB 4D3HA 4O0JA 3BN7A 3BUZB 4FXWA 4BR4A 4DU3A 2YXLA 4OKEA 3TUIC 4PEOA 3UN3A 2CVIA 2ZH3A 1S12A 3BZKA 3ZEUA 1RAOA 1YWXA 2G0JA 3F5AA 3H7IA 2VHGA 4YOXA 5LMNK 3THWB 3LP0A 1S8OA 5BN9A 2Z30B 3WNGA 2J0SD 1XK8A 1S1XB 2NYHA 4JI4K 3ZXWA 4CF4A 3WKBA 2B5JB 5ADZA 3MN7A 3D2FA 5IINA 3CJAA 2PFUA 3GCWP 2K8GA 5CR0A 3LDQA 1SIWB 1BPZA 4BWMA 4CERA 1X40A 3I56N 2NRVA 3LDNA 2W2QP 2MB0B 3QT5A 3VQ5A 1DT9A 4XDDA 1GAOA 4HT5A 4ILJA 3AO3A 1KQSM 5AK4A 2HHSA 3KJNB 1KQKA 1YJUA 3KBBA 4DQRA 2OD4A 5D0GA 3J81O 1ZOTA 3C19A 1NHVA 1K8KA 4C0OC 1NO8A 2FSJA 5KNIA 3GOIA 4PHEA 1HBMA 1QAIA 3THWA 5DZ7A 3NS5A 1UAWA 3O6WA 2E1YA 1TKXA 2F4VJ 2IIRA 1WLJA 1WC4A 1NNDA 5FRMA 4OPAA 5KFGA 2ZGYA 3NEKA 2DGQA 3OYGA 2CADA 3LTOA 4WXWA 3HSJA 1N8RO 2K06A 3QEXA 4U7UK 3BR9A 4CLUA 2RJZA 2Q3SA 2BDPA 2IYGA 2ASYA 1WC6A 3JSBA 1F6TA 3Q7BA 3CJ7A 2YH0A 2YX4A 3VEZA 4CZLA 4C80A 1X6IA 2HB5A 4UF4A 4YEAA 4IFEA 2VASA 4RUHA 3LZJA 2R8KA 1WSEA 5T7LA 3VVTA 3BN4A 5JVHL 3BB5A 4CEAA 5EUHA 4E7IA 2QTWA 3CPEA 4KGKA 5KFOA 1R43A 4B1ZA 1YJWS 5AQRA 2P9CA 1H72C 1BIUA 1T9WA 1SZPA 4FLZA 1N52B 4OJHA 4F8RA 1JCFA 3DXKA 4LZDA 4UB8U 4YN4A 5I3UA 2UUTA 3D7SB 3NH1A 2JLEA 2W2NP 4D3GA 4KIAA 1HX1A 4G1PA 2E5SA 1JNRB 2V51B 4NLGA 4EAHD 3AU2A 1IXRA 2JWLA 3MFHA 3IBCB 1Q86O 2QWNA 4Y2CA 5CHCB 4HCCA 2EZYA 2RQ4A 3ZT0A 3C3LA 3S01A 2CPZA 2G2YA 2GW8A 4DUYJ 2G8KA 2FMPA 2UXBJ 2CKWA 4FJ8A 5J1PA 3MTJA 2QEXN 3I96A 1X9SA 4M5IA 2ZIXB 2O4GA 4FPIA 3HM9A 1B4FA 4QZ9A 1WACA 3C8YA 3IBFB 2R2SA 3D2NA 4C11B 2LLZA 1WAJA 4A8QA 2RQ5A 4YDUC 3CIPA 3H5UA 5A8WB 4IG3B 3TX0A 1RACB 1S59A 1NGEA 3HZGA 2BTFA 4N56A 4MFAA 3KLFB 1NWKA 4NLWA 1EIYB 2GVDA 1OSCA 8ICUA 2F96A 2KICA 3PIPL 3OS2A 1O03A 3NKYA 2W9AA 3QEVA 1ZQKA 3QO9B 3Q8VA 1SQEA 4QS9A 3UCZP 2QB0A 3SI8A 2NXCA 1RBSA 4DR7K 2AD9A 2NUBA 1S1VB 3NUQA 2YI1A 5GAHP 1VSDA 4F72A 2KH9A 4IOAQ 3ATUA 2CGLA 3FQKA 3BDEA 3R8YA 1NBWA 2VH7A 3IXQA 1VLOA 2QG9B 1QTMA 5GMDA 1ZAXA 2J6TA 2J9DA 4KAZA 3JPNA 2QO3A 4MJKA 1XSLA 4LF6J 5DJBA 1RWNB 4CEDA 1KN5A 1RQNA 2E3TA 2FE9A 9ICIA 4C11A 1XMBA 2PFPA 5AKKA 3HHLA 4JV5F 5K8OA 5E26A 1UEUA 4GVEA 2YB4A 4C1NI 4OJPA 3MM7B 1RAAB 1CJVB 2RQMA 1Y3KA 3DLLL 4E1JA 3NGSA 3JYTA 2HHVA 3QRPA 3ED5A 4MMOA 5CH7B 3NF9A 1IKYA 4IO8A 3WXLA 5CZXA 1F0MA 3NNCA 1A5WA 4YFKA 3QESA 2KXFA 4OYXA 5J0YA 2Y8YA 4CJSA 4BC7A 3AGKA 1X5PA 4DB3A 2Q6CA 4WU3A 4AM6A 5KG7A 2W2MP 2VJ4A 5IWAF 2CRLA 2AXTU 3HILA 3G8TA 1HYSB 2QKKA 4YNQA 4J9PA 4MKYA 2W43A 3ITHA 4MAKA 3ENVA 3GU0A 3M1VA 2CWXA 1J9AA 1W26A 4ID5B 5TKWA 2XSFA 5JMNA 3MM5A 2W40A 4ED5A 2VBXA 2DUYA 4HUFA 4JI8K 2KK0A 3GIMA 1CULB 4W5QA 5ETOA 3U1NA 1C4CA 3K58A 1IG6A 4QU7A 4NRUA 1GLBG 2BOAA 2ZH6A 3FCHA 4ZHRB 2BW2A 3H25A 2BABA 3HKZD 1CC7A 5BR8K 3O3GA 4JK8A 4LFCF 2W3RA 2Z58B 3OR1B 2G2ZA 2IRUA 1HYSA 5B0FA 4ZPBA 2D3UA 4OQJA 4O4GA 3DRSB 1O13A 2B9XA 2P6UA 2BBEA 5F0XA 4DR6K 3CC2N 2KN7A 4YB6A 4R64A 4OX6A 4DQPA 1I5OB 3B82A 4GXKA 1I1GA 4YDDB 1NM2A 2ZOMA 2D3DA 3VQ6A 3HT3A 3TFSA 4Q2MA 4USWA 3S9HA 2QARB 2UXDF 3FR0A 3UN2A 1K44A 1SV5B 3MOJB 2YKNA 3VQ4A 2DGSA 1RTIA 3FEXB 1Q7YO 3KG0A 1OYEA 3KJF