4DSIA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, se-dgtp and calcium
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
581
structure length
581
Chain Sequence
b'GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsiA01
1NK0A 5J2NA 9ICWA 4B9MA 3EZ5A 2HHTA 5KFZA 4QZBA 3OSPA 3DRPA 3OYKA 1RBUA 3C6TA 8ICZA 4BWJA 4GXKA 1N6QA 1S10A 1Z00B 4CF2A 3UPQA 4KLTA 4O3OA 1ZQEA 4FJ8A 2DTUA 4DTPA 2IHNA 4CECA 4GC6A 3JYTA 1L5UA 3TFSA 3KK3A 2R8JA 3SV3A 1F21A 1XC9A 4I2QA 5KG3A 4QWBA 3DLGA 1N56A 3Q8RB 4RUAA 3TAGA 4C8MA 3PW4A 1XU4A 3MFHA 4F4KA 2XGPA 3C5FA 4KLHA 4I2GA 2NRVA 2BQRA 2P6UA 2V4QA 5KFKA 4W5TA 2BPGA 4YXJA 4KHNA 1J9AA 4IQTA 1NKCA 2P5GA 3B0XA 3TAFA 1ASUA 5J1EA 1TL1A 2W8LA 2QKKA 4MFCA 3KJVA 5KT5A 5TZVA 5EWEA 1QSYA 1TV6A 4YNQA 3I0SA 8ICSA 1KFTA 3DOLA 3OYMA 5KG6A 1VSLA 1K6YA 1DGSA 4YCXA 3ALYA 3QEPA 5BOLA 2F96A 4RW4A 3L3VA 4M0AA 3MXJA 3PR5B 3PY8A 1Q9YA 1BQMA 1S9FA 4OPJA 1Y97A 4E7HA 1TK5A 1RT1A 8ICCA 4Z6CA 4WE1A 3L8BA 4E7IA 2BPCA 1PZNA 2FBTA 5HMLA 4LY7A 1UAXA 1LB2B 5I42A 4B9LA 3SUNA 3HP6A 3NGZA 3GIJA 2BCVA 2IA6A 2W9BB 1KCFA 3BDPA 1BIUA 2IGIA 3LZIA 3AUOA 3QNOA 3NTUA 3KIOA 3PW5A 4DFKA 5DKWA 1KLNA 4ECQA 2GUIA 2ITGA 2O4GA 2E6LA 4F93B 9ICKA 2NUBA 3JPPA 3AVJA 1HJPA 5DB6A 3HK2A 4IR1A 3AVIA 4E3SA 4FLXA 2D0BA 9ICCA 1WSHA 3MGIA 1BPBA 4KPYA 1J54A 4JK1A 7ICMA 4RPYA 1EP4A 8ICMA 1ZQSA 3THVA 1U9LA 3V7JA 7ICGA 2BQUA 2W9MA 3NH1A 4RQ2A 8ICUA 3M8SA 1C1CA 4Q8FA 4AHCA 3AV9A 3LWLA 3V6DA 8ICKA 2UVRA 4DEZA 4CEZA 3MR6A 9ICVA 2FPMA 4HUFA 1KLMA 3SNNA 4PGXA 4ED7A 4NLNA 1QHTA 1U04A 3AA2A 1JIHA 1U4BA 3M8QA 3PW7A 4I2BA 4IQWA 4CHZA 3P83D 3OS0A 3L2VA 2ATLA 3O4NA 3C5GA 3QEVA 5CR0A 4NLKA 4B9SA 2EHGA 2G8UA 1BPXA 2AQ0A 3GDXA 4JLHA 2OZMA 4ECRA 4RT2A 4ECZA 4ECSA 1QSLA 4KLEA 4DQIA 3V9SA 1VRUA 5IIOA 2R7YA 4P4PA 2FBYA 4RQ5A 2VG5A 4YMNA 4LVSA 1ZJMA 1WAFA 5JUMA 2G8VA 5C24A 1RNHA 3NF9A 3QLHA 3VQ4A 5DG8A 4ECUA 3PX0A 1WLJA 3HYFA 2A1SA 1RBRA 7ICJA 1S0NA 3N4MB 1JL2A 1VRTA 4O3SA 3QEBZ 4DWIA 7ICKA 4KLMA 5C25A 4BXOB 3KHHA 3QO9A 2M9NA 3A2FA 2DFLA 4CFAA 3C2KA 2HNZA 4H4MA 3T5JA 2QK9A 1SKRA 4AH9A 3UQ0A 4F5OA 3ORYA 4K8ZA 4XA5A 2F1IA 4PUOA 1S0MA 4CJPA 4P2HA 2J6SA 2PFQA 1BPYA 3ZSYA 3GFKB 5E41A 1O1WA 3PX4A 1JLFA 1VSJA 2DFHA 3MAQA 2JEFA 3OHAA 3DYAA 1TKDA 1AROP 4DS4A 3RRHA 4R5PA 4CGJA 4RUCA 1XS9D 5KFIA 5DGBA 3LPTA 3AO5A 3K75D 4IG0A 4IDKA 1LWEA 1LV5A 5KFLA 4DQPA 1BGXT 4UBCA 3SUQA 4RNNA 2HHUA 4CIGA 1JXEA 1RT4A 4RQ8A 2I5JA 4QWAA 4KTWA 1BL3A 4KITB 1CZ9A 4YR0A 4O5KA 4NCGA 3SQ4A 5DB7A 2BGGA 1NJYA 5KT7A 8ICJA 3QEWA 4F3TA 3IAYA 3OS2A 1DTQA 5FRNA 3OYJA 2W9BA 1B43A 1MC8A 1KVAA 3TARA 4ZTFA 4G1QA 1ZETA 3LALA 4IRDA 4RW9A 4W5RA 5KFXA 4CF8A 2FPKA 5J2AA 1Q8IA 1BI4A 9ICJA 1JLEA 4FYDA 4HUGA 1MSWD 1NOMA 3O3GA 4R63A 3GIIA 4YXMA 1RTJA 4PPXA 2I9GA 5KFCA 2WTFA 3M9OB 4QZFA 2QXFA 3DOKA 1TK0A 3BQ2A 2JLEA 4DLGA 4AILC 4HUEA 4OLAA 5J0RA 3KLHA 4B9UA 2HVHA 5KFOA 5T7BA 4FJ7A 4J9MA 4JRPA 1D9FA 4LZDA 8ICVA 9ICFA 4BE0A 4QCLA 4DOAA 1SL2A 3TAEA 3H8SA 4TUQA 4FJMA 4YD1A 3AO3A 5FROA 3Q8KA 3T3FA 1WNSA 4FJ9A 4FM1A 1RZTA 1GOAA 3OYDA 4BDPA 4M42A 2J6UA 1CEZA 4GVMA 4O44A 4H8KA 1HJRA 5HRSA 3F9KA 4CIFA 4KHQA 1RT5A 1ZQPA 1RXWA 1RTIA 2ZTCA 4CEQA 3DI6A 1T7PA 3V81A 4C8OA 1L3UA 4QW8A 4Z6EA 4OKEA 4DF8A 1ZQIA 1HMVA 3BQ1A 1RT2A 2BHNA 3JPQA 1WCLA 4NM2A 3L2QA 2RKIA 2ZJ5A 4DL4A 1C0MA 2DFEA 1EX4A 3ZT0A 4BACA 9ICHA 5C42A 4J2AA 5IIMA 2HHSA 3T19A 4M3UA 4FBUA 3SCXA 4ED2A 3TAQA 3RMBA 2HHXA 4BE1A 1TAUA 4QWDA 3ZSOA 1CLQA 1NK4A 4K4HA 1BCMA 1JX4A 3K57A 3P1GA 5KRTA 7ICQA 4R65A 3OYEA 4KLSA 4J9OA 3T1AA 2VA8A 4CJVA 3VQQA 1XSLA 9ICAA 4PH5A 4CJ4A 2AGQA 2KZ3A 3SQ1A 4LZGA 1QLNA 3OYGA 4EP4A 3AVAA 4Z4CA 3WNHA 3RB4A 3L3UA 2VWKA 5J0QA 5CP2A 1LAVA 1BVSA 3RH4A 5C5JA 9ICGA 2OZSA 4YFUA 2KQ2A 3V7KA 4KLLA 4I2AA 2BCRA 4CEAA 3VQ9A 1ZQKA 3TR8A 4CF1A 4ECYA 2FPLA 5CHGA 2R8HA 2P51A 4O3QA 4K4IA 1KFDA 5J0UA 2Q0ZX 3Q8MA 5D46A 5KFTA 3VA0A 4YR2A 3OS1A 3UQ2A 4QWCA 3LPUA 5HNKA 2DFFA 1WSIA 4RQ7A 1JLQA 3NE6A 4NCBA 3NCIA 2R8IA 1I3AA 3PVXA 3RR8A 1NK9A 1C1AA 1EETA 4ED8A 4FW1A 2PFOA 3OYHA 1ZBHA 5SZTA 3EY1A 2BR0A 3V6JA 1NK7A 1ASVA 9ICLA 1B92A 3N97B 4EZ9A 1RDAA 8ICGA 2R8GA 4M3RA 1GOBA 2BGWA 1SKSA 4ED0A 3QERA 4RQ0A 2A1RA 8ICWA 5IIIA 3KLGA 5KFFA 1C0TA 2GWSA 3NBPA 4CESA 4E0DA 4CJ3A 3D45A 3RMCA 2AQ4A 4M9JA 1N48A 4EYIB 3QESA 4Q45A 3ASMA 3HPOA 2VANA 3TFRA 4FM0A 3DLKA 4ECWA 3DM2A 3Q8PB 3M9MB 4N41A 5KFGA 1FK9A 4FK4A 5JS1A 4YP3A 5DLFA 3D0PA 2PI4A 1L3VA 5KGXA 2VG6A 3CM5A 4UAWA 1RT6A 3RJGA 1TV9A 4EYHB 3VQ8A 4Z4EA 3VQBA 1N5YA 1UOCA 2YNIA 3K5MA 4B9VA 5KFRA 4XRHA 3M9NB 4ELTA 1T03A 1ZQJA 2XO7A 4JS4A 3U6FA 1TFRA 3UIQA 1ZQLA 4TSXA 3AA4A 1BPEA 1ZQFA 1W0HA 2HHQA 4Z6FA 1QTMA 2PXIA 4JWMA 1B22A 8ICFA 1HYSA 3EPGA 3KLIA 5KI6A 1CUKA 4NY8A 2JEIA 5L9XA 4RQ4A 2YNGA 4QW9A 9ICPA 1U49A 1HPZA 4OPKA 5KFAA 3B0YA 4F8RA 3WNGA 2ALZA 2IMWP 3ZDDA 3DLEA 3IM1A 2ETJA 4MFFA 3OYBA 2BKEA 1VSFA 3QNNA 1TL3A 3VQDA 1LAWA 4QZCA 4K4GA 2D0CA 1KRPA 3ZT1A 4BDYA 1RBTA 3ZDAA 1T8EA 1UA0A 2C2EA 5J2MA 5J2GA 4M41A 4KI4A 4CJSA 4F5PA 5DQHA 1S5JA 3C23A 5J2PA 3RJKA 4CK2A 5DB8A 4I28A 5J0OA 5HHHA 2HVIA 4J9KA 2KW4A 2C22A 1ZBUA 1ZBIA 5J2IA 4OVLA 3BJYA 2C2RA 4E1MA 1ASWA 5KFJA 4CFCA 1MQ3A 4Q44A 5HBMA 3AVGA 1BISA 4F4XA 2X78A 2VA3A 4RQ1A 1WAJA 4JWNA 3PV8A 2AGOA 1D5AA 1S77D 5KFPA 4CFDA 2OPQA 3VQ5A 1IO2A 4QWEA 3SYZA 5DMRA 1NOYA 4IQUA 4EZ6A 2A1JB 3AU6A 3LZJA 3OYAA 4YR3A 4TQRA 4M6WA 9ICSA 3H4BA 4Q43A 3GQCA 3AVNA 2W8KA 3KLFA 4CJUA 1J53A 3BQ0A 3HPHA 5KG1A 2HB5A 3V9XA 5DG7A 1Y88A 3GIKA 4DTXA 2BANA 4Z4IA 5D49A 4ZHRA 5L1LA 4DSFA 3ISNC 2VG7A 2KFNA 8ICTA 3LP3A 5DBBA 2C2DA 4ED1A 1RBVA 3NF7A 4E7JA 1Z26A 4DL7A 4F2SA 1C1BA 2YV0X 5KTQA 2IDOA 2H5XA 1V9PA 5HLFA 3MGHA 3RB6A 4O3RA 2G8IA 4CJKA 1RDCA 4Y1DA 4RQ3A 3AA3A 4IRCA 5DDYA 3G6XA 4ELUA 2QKBA 2UVVA 2YKMA 5J29A 3OJSA 4E89A 8ICEA 1Z25A 4QZGA 8ICBA 3MDAA 4FLWA 2ZJAA 4UB4A 1UA1A 4FJLA 4Z4GA 8ICQA 5KFEA 3IG1A 4KI6A 4FJJA 1K1SA 9ICIA 4RW6A 1TVAA 4ELVA 1RDBA 2FLPA 3OYIA 4OGCA 4F5RA 3OYCA 1FKOA 2OWOA 4B08A 1XHXA 3SV4A 1I39A 8ICAA 4L8RB 3DLHA 1Z00A 2IAJA 3C2MA 4JV2A 5J2DA 4YG2A 7ICFA 4JRQA 4PA1A 1HRHA 2OPPA 4RQ6A 3ZSQA 2XY7A 2YHBA 3LDSA 5J0WA 1KDHA 1YT3A 5KFYA 4QZIA 1DTTA 2YNFA 1ZQQA 1ZQBA 3HP9A 3ZDCA 2XY8A 4I2JA 2ATQA 4DMNA 1NK5A 4GW6A 5EU7A 2ZUBA 3G6YA 4CHNA 2X6NA 4CEFA 4EBCA 4KKOA 4DO9A 3OSNA 4RW7A 2ZTDA 3AA5X 1RBSA 1HQUA 2PYLA 1UT8A 4M9GA 1S9EA 3NF6A 2IC3A 3V9UA 3V1QA 3DRSA 3ZT3A 3OYLA 3VN5A 1NKEA 2UVUA 2DY4A 4UB3A 3K59A 7ICUA 2Z1HA 4CK3A 4DTSA 2D0AA 3G6VA 1FXXA 3CM6A 4M3YA 4RT3A 3DMJA 1ZQCA 4PHAA 4ECTA 4RPXA 5KT3A 5D3GA 4J9PA 3ZD8A 1UT5A 3SI6A 3T5HA 1HYVA 3PUFA 4KN4A 4FJGA 4BDZA 8ICOA 3C94A 4M3XA 4KRFA 3GV7B 3V72A 4KLUA 4KLIA 5KG5A 3SQ2A 4J2DA 4O0IA 1IKXA 4Q5VA 3RRGA 1JLBA 1GOCA 2ASJA 1S1XA 1JLGA 4FLUA 3Q8SB 4QZ8A 4CHQA 1ZQAA 3ZSZA 4DSLA 1RTHA 4QZHA 5IIKA 5IIJA 2ZTEA 4N76A 5F9NA 2RDJA 4KLJA 2FLLA 1Z3EB 1VSHA 3V6HA 1FKPA 3QEIA 3QIOA 5J0XA 1IXRA 4E19A 4CEBA 3NHGA 4C8KA 4BWMA 4AHUA 2A1JA 3S3MA 3EW9A 5KFMA 3Q8LA 4YN4A 3OJUA 9ICQA 2FBVA 3K2PA 4UQGA 3FDSA 4E1NA 4YMMA 4HVJA 4J9LA 2W9CB 4CHYA 3HO1A 3HT3A 4C8NA 4I2PA 4RW8A 4AHSA 1C6VA 3U3GA 3OYNA 3H4DA 5KT6A 2BCUA 3NH2A 5J0YA 2Z1GA 3SPYA 7ICOA 4N5SA 3NAEA 4FZXC 4CE9A 3HW8A 3H7IA 2XCAA 1A5XA 2MUTB 2G8KA 3VQPA 1DLOA 1DOQA 4DFMA 4DL3A 2ZUCA 3QEAZ 1A76A 4QZEA 3H40A 4M47A 3B6OA 3NDKA 4XIUA 3LAKA 3CFOA 1IKYA 5FDLA 3ZD9A 3GV5B 1KTQA 2IBKA 7ICSA 3Q8QB 1BPZA 4FJNA 4Z0UA 1REVA 5KFHA 1C7YA 5KFSA 1RXVA 4IKFA 3KK1A 4Z4FA 3JPOA 4GXJA 4CGGA 5CA7A 1SL1A 1WSFA 4FCYA 4CHOA 1TKXA 3PO4A 3LAMA 2O4IA 3MR5A 4DSKA 5CJ7A 1LWCA 5CYQA 1ZJNA 3G0ZA 4MEYA 1HNVA 3E2EA 3EPIA 3RTVA 2MAXA 2HW3A 2VA2A 4BXOA 4CJEA 3JSMA 4R66A 1T05A 4KB1A 2RF2A 4KHWA 3RBDA 5KT2A 5HRRA 3CYMA 4LSNA 2ZE2A 3AVKA 4KREA 1S1UA 1JMSA 4J9QA 1LW0A 2XY6A 2RPIA 3ISCA 1MQ2A 4PGYA 2F8TA 5DLGA 3AO1A 1VK0A 2R8KA 4M04A 4OKJA 4XUSA 3P5JA 1S1WA 1S97A 1NJWA 4I9QA 4OGEA 1TAQA 5KT4A 9ICEA 3TAPA 2XY5A 4DF4A 1ZBFA 2GBZA 3RJHA 3KD5E 4DOCA 4KLDA 1RT3A 7ICRA 4FS1A 3VQCA 2Q3SA 4RPZA 4O5EA 4DSEA 2G8HA 1JLCA 2W9AA 2ISOA 4CGFA 4CF0A 4O3PA 3C21A 2ZD1A 2YNHA 4LSLA 4CJWA 1HUZA 4R64A 4CJLA 1B9FA 4TQSA 9ICTA 3NH0A 4FLTA 1JXLA 7ICIA 4PGQA 1X1PA 3UXPA 1JN3A 4CK1A 2FMSA 5J2KA 4BE2A 3KKRA 1BHLA 5KG2A 5DDMA 5L1JA 2B21A 3K5LA 3MABA 4EBEA 1WCNA 2FLNA 3PR4A 3TI0A 2F1JA 1ZBLA 4FJKA 4MFAA 2B6AA 5K14A 3ZT2A 1YVUA 1ZQXA 5DGAA 3KKSA 4QZAA 4B9TA 5EOZA 5EWFA 4KAZA 4R8UB 9ICOA 3G10A 4ZH4A 1S1VA 4W5OA 2RDIA 1ITGA 3QZ8A 3FFIA 3IRXA 4CGHA 4JV1A 3KHRA 1TGOA 1ZYQA 3DRRA 4FJHA 1K1QA 4DLEA 1IG9A 1ZQDA 3H8JA 4DTNA 8ICHA 1VSDA 4CIEA 4IG3A 1BIZA 4NLGA 2W9CA 1A5VA 1XWLA 2NRTA 2J6TA 1NK8A 3QEXA 2OA8A 3F73A 4TURA 2IOCA 5L1IA 2NRXA 4P4OA 3JPRA 1XHZA 5IILA 3NF8A 1IKVA 1SV5A 2PY5A 2F1HA 5L1KA 3I8DA 1A77A 3RJJA 2YKNA 2HNDA 1QS4A 2MUTA 4O55A 1R0AA 5CY4A 4DOBA 4NYNA 3ETLA 4RZRA 4I2HA 5HRNA 3LP0A 1Q9XA 3V9WA 8ICNA 4NCAA 4I2EA 4FBTA 2WOMA 4I2CA 3K4GA 8ICRA 3RR7A 1D8LA 1XO1A 2JEJA 4FVMA 3K5OA 3KHGA 2D5RA 5IINA 3QETA 4ZTJA 4DL6A 3K5NA 3IHQB 5KG4A 4TUPA 3C95A 3LWMA 3V4IA 4DL5A 4O5BA 3MXIA 3ZSXA 5J2CA 8ICYA 2OYQA 4EEYA 4IFVA 4I27A 4CGIA 1HQEA 4G3IA 4IRKA 1U48A 1S76D 3KTQA 3ZSRA 3V1RA 3S3OA 5SWMA 4F91B 4UAYA 4OJRA 3OHBA 3WNFA 4FZZA 3NFAA 2YHAA 4PHEA 4FJ5A 2FMQA 4FJXA 4DTUA 2BCSA 1BQNA 4F5QA 2I1QA 1ZQHA 2XRIA 2B4JA 4DQSA 1RDDA 2P66A 1XSPA 1XI1A 3OGUA 1D8YA 5CZ1A 4PHPA 1SZPA 4XQ8A 4GLXA 4HTUA 3ISBA 4J9SA 2EX3A 1COOA 1A5WA 2NRWA 4J2BA 3C2LA 3BGRA 3M8PA 5DK5A 4Z4HA 4ID5A 2LSNA 4NM1A 1ZQVA 4H4OA 1D9DA 2PZSA 3ZCMA 3FYHA 3OY9A 1BI4B 3EYZA 3JPTA 2GV9A 4KLFA 4O3NA 4KV8A 3UXOA 2ZJ8A 1RCHA 3AVLA 4DTRA 4PWDA 2W42A 3QE9Y 4CHPA 3RAQA 4DU1A 3RBEA 1NK6A 2KTQA 3RH6A 5DBAA 3VA3A 3AU2A 1CZBA 3WNEA 4KTZA 3C6UA 4UBBA 3SPZA 3RWUA 3IS9A 4RU9A 5KRSA 4OKKA 3NGYA 4M2YA 4F5NA 4FK0A 7ICNA 1EXNA 5J0TA 1CXUA 5J2EA 4YD2A 4CJTA 4ID1A 3VQ6A 1U47A 4CJFA 1SKWA 5KFWA 2XCPA 2P1JA 4C8LA 3KK2A 1X9SA 4R8UA 3RMDA 5D4BA 1HYZA 1ZQZA 3RMAA 5CZ2A 8ICXA 2KFZA 2JZBB 1KVBA 1WSJA 5HRPA 5HMMA 3PMNA 3QZ7A 1EXQA 4M3WA 9ICRA 4F4WA 2PFPA 4CJRA 3AVFA 4HCBA 4DU4A 4W5NA 1ZQRA 3MFIA 3GV8B 1YTUA 1KSPA 5DG9A 3AVBA 4DFJA 1ZQTA 3EWAA 1NKBA 1RYSA 3RJEA 5FRMA 4NXZA 7ICTA 2B5JA 5DQGA 2V9WA 3E01A 7ICPA 4NLZA 9ICMA 1ZQMA 1BCOA 2Z1JA 5F9LA 4I7FA 4ECXA 2BCQA 3U3YA 4M9LA 3ISDA 4YFKA 3QIPA 4M3TA 1QSSA 2BDPA 4CEOA 3LP2A 4FK2A 4Q8EA 4HHTA 3V6KA 4PHDA 5DQIA 1JXBA 4J2EA 1CXQA 3RB3A 4JS5A 4N47A 3ZDEA 2G8WA 3MEEA 1C0UA 3ITHA 5KFDA 4FS2A 4KHYA 1RPLA 2FMPA 3VQ7A 4FLZA 3RB0A 3LP1A 4DL2A 1IH7A 3SQ0A 3RH5A 5KFVA 4KLOA 3RAXA 4RNOA 4F4YA 1ZQYA 5J2HA 4DFPA 1H38A 1QQCA 4QZ9A 3PO5A 1VSMA 5KG0A 1IKWA 4FLYA 4EBDA 3PX6A 1TK8A 1RT7A 3PNCA 2JEGA 2UVWA 3UXNA 4KHUA 4GC7A 3ZDBA 5KFBA 5DBCA 2PI5A 4FXDA 4I2IA 1UWBA 2RN2A 4E7KA 1JLAA 4UB1A 3S9HA 2LYHA 1NJXA 1ZQOA 1ZQUA 1JKHA 3DLRA 3SJJA 4IR9A 4FJIA 2DPIA 3NGDA 1SL0A 5BPCA 4CCHA 5J2FA 4F3OA 3S3NA 3SUPA 2XC9A 1KFSA 4O0JA 5J2BA 4DS5A 4RG8A 1QE1A 4F4ZA 5CWRA 4YQWA 4ED3A 4MFBA 4DTMA 4EP5A 4RNMA 4P4MA 5CB1A 3I0RA 2PYJA 1ZQNA 1ZQGA 2X6SA 4K8XA 4M3ZA 4QOZB 5J2QA 3C1ZA 3MEDA 2ASDA 3VQEA 4QAGA 4DG1A 3PW2A 1JL1A 2ZQBA 5CYMA 2ZUDA 4KLQA 1VSEA 4I2FA 1W9HA 2IS3A 4Y1CA 2BPFA 1WN7A 2PFNA 1WSEA 2P5OA 3VQAA 2BQ3A 1NJZA 1L3TA 3LANA 3AO2A 3OYFA 1HNIA 4B3OA 4J9NA 2IHMA 3SZ2A 4DSJA 4HCCA 1S1TA 4UAZA 4DSIA 2DPJA 1U45A 1LWFA 3JPSA 4MEXA 4DQRA 5I3UA 5J0PA 7ICEA 5HP1A 1X2IA 1ZQWA 4YVZA 4LH4A 3HSTB 4PQUA 3K58A 3CFPA 3KHLA 3HXMA 4I2DA 3TANA 3M8RA 5EWGA 4X5VA 2WONA 2AGPA 1TVRA 4B8AB 7ICLA 3HX0A 1NOZA 1EKEA 4O5CA 3V1OA 4CEEA 5KG7A 2ISPA 4JUZA 3TWHA 5BOMA 3TAMA 4CJQA 1T4GA 3NGIA 4PY5A 3AO4A 2FC0A 1KVCA 4KN7A 4DTJA 3T5KA 3BQTA 5DB9A 1RTDA 4E7LA 4MF2A 2JZBA 4ICLA 3QINA 4JV0A 5J0SA 1TKZA 1RILA 4BGDA 2V4RA 3SUOA 3B6PA 4CERA 9ICNA 2G8FA 1S9GA 7ICVA 2HHVA 4NYFA 3CFRA 3H8WA 5KFQA 3KLEA 9ICXA 3AVHA 1WSGA 4I29A 3V7LA 4CGDA 4W5QA 2X74A 7ICHA 3PMLA 2OPRA 4QZDA 3SI8A 2HNYA 4Q0BA 1X9MA 4GXIA 3KD1E 4M9NA 3MEGA 3RJIA 1MU2A 4OLBA 3HL8A 4LH5A 1VSKA 3MR2A 2E6MA 2P6RA 2AU0A 3L2WA 4DU3A 4IQVA 4AHVA 3AVMA 5KFUA 1T3NA 3O3FA 4LD0A 4DTOA 4UB2A 9ICUA 2JGUA 4AHRA 3MXMA 3HWTA 4M9HA 4M45A 3MECA 4J9RA 1VSIA 2HMIA 3C1YA 4KMUA 3MR3A 1G15A 5KGWA 2KZMA 3HVRA 2Y1JA 2XGQA 5HROA 4KTQA 4CJ5A 4FLVA 1XSNA 3ZSWA 3L2RA 1YTAA 4MQ3A 3HJFA 4CEDA 3PW0A 1B9DA 3ZT4A 2AJQA 4AHTA 4HYKA 4KLGA 2OPSA 4ED6A 1LW2A 1BPDA 5JS2A 1S6QA 2BE2A 3CQ8A 3MBYA 5HP4A 1S0OA 3HM9A 4B8CA 1SUQA 8ICIA 2KZZA 4F2RA 3ULDA 5HHIA 4B9NA 4M6WB 5KFNA 3AVCA 4FO6A 8ICPA 3O3HA 3ZSVA 2VWJA 3H08A 4IBNA 4TUSA 4KB0A 2F8SA 4FM2A 3HPGA 4F92B 3LDAA 4ECVA 8ICLA 4I9LA 3RJFA 2E4LA 3TABA 2FBXA 2Y1IA 4YMOA 4KO0A 1IM4A 1S6PA 1TKTA 5J2JA 9ICBA 4O9MA 3V9ZA 2KN7A 4KFBA 4CFBA 4MF8A 3DLBA 4Z6DA 1L3SA 4O4GA 3GILA 3OVNA 4KHSA 4GMJB 3LK9A 3CG7A 2C28A 4F50A 4FZYA 3HVTA 1KEJA 3JPNA 4FW2A 2Z1IA 2XHBA 3O4QA 2ASLA 3GIMA 1S0VA 1X9WA 2NRZA 4IFYA 3L2UA 4UB5A 3MDCA 4CF9A 1J5OA 4N56A 1HUOA 1RYRA 2HHWA 3TQ1A 3T5LA 4DQQA
chains in the Genus database with same CATH superfamily
2XMTA 5J2NA 2HHHJ 3EZ5A 5KFZA 3DRPA 4FKYA 4IOAQ 3D67A 4ES3A 4BG8A 3JSYA 3C6TA 2FF6A 2KV2A 2GHPA 2IM3A 1U2FA 4BWJA 1Z05A 3S1TA 3A8IA 4OYBA 2OM6A 3UPQA 1FFSB 3QO9B 5IWAF 4DR2K 2ZUAA 2LDYA 2VFVA 2IHNA 4QJFB 5HMXA 4GC6A 3VTIA 3I4PA 3VGMA 4BRGA 1QUVA 1IUJA 4C11A 4MKAA 1UJ6A 3EX7B 3WU2U 1XC9A 5KG3A 3CCQS 4MO5A 3TAGA 4DV1K 4C8MA 1RBLA 4MTPA 1XU4A 1FCAA 3NMRA 3D1HA 2XGPA 2AJ2A 5HVFA 4X4PA 4NYZA 4QYZK 2E1RA 2D3ZA 2P6UA 4NZ7A 1U1PA 1K8KB 1GT8A 3M5RA 1EX8A 1QQMA 3MCOA 3DYAB 5D78A 2MZSA 1NKCA 4C3MA 3TAFA 1ASUA 1Q18A 2AF6A 3WK9A 3MZIA 5TZVA 2ZBPA 3OBIA 3B8AX 2DHGA 4YNQA 3UE5A 4IXCA 2EDUA 3FBBA 8ICSA 1LWEB 5BPMA 4TYAA 4B3SF 3DOLA 1SJFA 2QSFA 1AW0A 5KG6A 4URSA 5F8NA 4J37A 2D8CA 2ZIWA 5BOLA 4RW4A 2VC1A 2ZDPA 4M0AA 3ZETB 3KNAA 2YBVA 1UZHA 3EM1A 1TL7A 2NREA 1BQMA 1RWVB 1TK5A 1RT1A 1Q86T 8ICCA 3CO0P 2F4VJ 3ZXWA 2BPCA 4MLEA 3OBYA 4E2FB 2NXEA 2AD9A 5K8NA 1LKZA 5HMLA 4LY7A 4DR6F 2JGAA 4MK7A 5I42A 2GV1A 4LQ3A 1Z2ZA 2BJ3A 3TRGA 1LXJA 3HP6A 3NGZA 4LFBF 4BC3A 3C6HA 3QU4A 2W9BB 1N63A 3NS7B 3CCZA 3J81Y 4O23A 2GS8A 1EKRA 1QAYA 2D0PA 3MOZA 1FXLA 3AOBA 2GLEA 2OELA 3C15A 2GC8A 4ILGB 1JLEB 1HD0A 2ZIXB 3K17A 1HJPA 1X42A 3RU0A 4IR1A 2IVOA 5LSLA 1WSHA 2DNOA 4CNZA 4WXWA 1BPBA 3DOKB 1ULRA 4P71A 2B56A 2IJFA 2YB1A 3GWCA 4EMDA 4JK1A 3PYEA 4RPYA 5TKWA 2DTJA 2YI1A 1RWPB 5ALRA 7ICGA 1NZAA 2RQ4A 3HDSA 4RQ2A 3M8SA 1C1CA 4AHCA 4FNHA 2HF4A 3FE1A 8ICKA 4GV6A 1NGBA 2UVRA 1T3VA 5D0RA 2GNKA 2AA4A 3OFGA 3WKDA 9ICVA 1PBUA 3G96A 2Y0SC 1HX1A 1CC8A 4M5KA 2ZH5A 1JIHA 4C3KA 4I0WA 1PJ5A 4WQ5A 2YMQA 4QIVA 1C0FA 5AQXA 3L2VA 3AAWB 4NLKA 2EHGA 2DY1A 3R5BA 2GQCA 1BPXA 5IQ6A 1RKIA 2KLAA 5F8JA 2IOHA 4L3KA 4R0JA 1SB3C 4ECZA 4FFDA 1QSLA 2UU9F 2LMIA 3V9SA 5IIOA 2J9DE 4D3HA 4YMNA 1CJKB 4LVSA 2OEMA 5T41A 2VOOA 4O8KA 5JUMA 2KJ8A 1RNHA 2E8OA 5LY3A 4PHTX 2LVWA 1IG8A 4LBIA 2MJUA 3VQ4A 1RHKB 1V38A 5DG8A 4ECUA 3C6AA 3PX0A 3HYFA 4LFCF 4I64A 1RBRA 7ICJA 1S0NA 1RT2B 4MIWA 1NHUA 2RKIB 3D6TB 4KLMA 3T41A 3QO9A 3JSMB 4A5AA 2Q43A 2X1AA 3MWTA 4DUYJ 4CFAA 2HK3A 2RF2B 5C42B 1SKRA 4NWBA 2KM8C 4PYDA 2QC3A 4JMUA 4Y2IA 2HGNA 4JYAF 1LW0B 1VIOA 3RRKA 2ZFHA 3V4MA 1UFLA 2F1IA 1YSJA 3QGIA 1SS6A 1RKJA 2M9KA 4CJPA 3ENBA 1VS3A 3FSXA 3MAHA 2Z0GA 1N4LA 2W2MP 3KUHA 2FVSA 1RLCL 1RUSA 1ZPVA 3CC4S 1VSJA 3PJWA 1K8KA 2F3NA 3MAQA 4IFEA 3L3FX 3DYAA 1VBZA 1TKDA 1AROP 4M94A 2CXEA 3W2WB 1XS9D 5AXMA 2E8MA 4PG7A 4IG0A 3N0VA 3DXBA 3NGKA 1LWEA 3M8WA 1RG6A 3SUQA 3M2RA 4O0NA 2K3IA 3HFVA 3ZETA 4CIGA 1MWKA 1ZXIA 1M90T 1JXEA 2LKZA 5KOXA 3D6RA 2EK6A 1VFJA 4QWAA 4KTWA 1BL3A 2WF9A 4DV7K 1OJ4A 2E1PA 3H20A 5M1NA 5AQQA 5DB7A 2YHYA 3P39A 5KT7A 1G2EA 4PG6A 3W0LA 5GAHP 3IAYA 1RAEB 3OS2A 3IGNA 1JLQB 3D2QA 2MHNA 2K3KA 5E3PA 1EETB 2W9BA 3TOQA 2HOQA 2EK1A 1KTVA 2JLFA 1ZETA 1RADB 1U8SA 3I1YA 4W5RA 2LYBA 5KFXA 3QUTA 3KOAA 2FPKA 5J2AA 1BI4A 1N8RT 1JLEA 4Z37A 2ZIXA 4FYDA 1S6OA 4I68A 3IRWP 4NLTA 5B0GA 1T6CA 5KFCA 4TN2A 4KHRA 5DM6Q 3DOKA 1S5ZA 2GIQA 4L74A 3L0QA 4K8RA 2NYVA 1UEKA 3A8YA 1OSCA 4AT1B 4DLGA 1WELA 2HS4A 2GVZB 2E3TA 3NVWA 4B9UA 2VG6B 5T7BA 3J7AN 3GL1A 4LZDA 4QCLA 4DV5J 2XTJP 2GQQA 2DVIA 1SL2A 3BF4A 2PE8A 3TAEA 4YD1A 3FEYB 5LL6d 5B7WA 2HBJA 3T3FA 4UF4A 2KVIA 4IOCL 4BJQA 2Y9HA 2P8IA 1FO1A 2Q36A 4LF8K 3U7JA 2B4UA 3OYDA 2CWKA 3UM9A 4M42A 3AJ1A 4CBUA 3IP4B 2YNGB 3CCWA 4Q2LA 5HL7Q 1KOHA 4ACOA 4KR0B 3NCPA 4GFJA 4DX5A 1CJKA 3Q83A 4WPAA 1RXWA 3CJ8A 4C8OA 3H6EA 1L3UA 4BS2A 2XVTA 2W04A 1ZQIA 1AYEA 1N0UA 2BHNA 1RT2A 1GO3F 3JPQA 3L2QA 2CJQA 2RKIA 5J2MB 4PCQA 1KVIA 2ZBCA 1H1VA 1WC1A 5J2PB 1YJNS 1X7VA 3IG5A 5C42A 4J2AA 1R31A 5IV3A 4M3UA 5AXKA 3OL8A 4PKHA 1NK4A 3K57A 2XMWA 5AK3A 7ICQA 2WW8A 5HBMB 4PRFA 2QLXA 1VRQC 2W24A 4R65A 4J9OA 1SGGA 3VAHA 4TXSA 5JVHL 3AOAA 9ICAA 1T6DA 2Q4TA 3TX8A 2OPQB 2UZAA 3JTNA 4ZPAA 2C3PA 3D3BJ 3TEHB 2EEYA 4Z4CA 5A76A 1RP5A 3NS5A 4NXNJ 5J0QA 1BVSA 4GRSA 3IWLA 3CW2C 1VQYA 1NGJA 2JC0A 5KOWA 2IJRA 4CEAA 4F3MA 2Y0SD 1MW7A 3CEDA 4BGAA 4CF1A 1SQGA 5IT4A 4JB3A 2R7WA 4ZLLA 1WG4A 2R8HA 2CQCA 1KFDA 4JKDA 2R2RA 2R42A 3THPA 2ACMA 2DRAA 3VA0A 3OS1A 4ZP9A 2KSOA 1DXSA 1JLQA 4NCBA 3NE6A 3T1HK 4ATNA 3QYPA 3PVXA 1EETA 4ED8A 2DHSA 2B4VA 2PFOA 1Y5IB 3FCHA 2ZNZA 4BROA 2LYAA 2BH1A 4JI8F 1ATSA 1FXRA 3EVWA 2IA0A 1UFKA 1RDAA 4CP5A 3BGFA 4Y00A 8RUCA 1MROB 1MN9A 4ED0A 1BQXA 2D7SA 5KFFA 1HR0F 3NMUA 1C0TA 4OYWA 4WJBA 1QAJA 1MA7A 4CESA 3RMCA 5AQUA 2O1PA 1V3RA 3ASMA 3ZZYA 1YLXA 3CC7S 4US9A 4PZOA 4ECWA 4X4OA 3PZPA 3Q8PB 3CPWR 3MMCB 4TYBA 2IAJB 2Q6CA 5EOYA 1R8CA 2ZM6K 2VPZB 1L3VA 5KGXA 2VG6A 4GKKK 2FJVA 4RKUC 4CWBA 2OPPB 4J7CA 2XMAA 1TV9A 4EYHB 3EEQA 4DV4K 3VQ8A 2QRRA 2E1MC 1V4TA 1KR4A 5CHCB 2KNJA 1R59O 2VQEJ 3MX2A 4JKGB 4B9VA 2J9DA 4DV6K 4ELTA 3KWIA 1ZQJA 2G0IA 3UIQA 1ZQLA 4TSXA 2PMZC 2LFVA 2PXIA 1FFWB 3LOUA 1Y00A 1HQUB 1SIWB 5KI6A 5GMEA 2WTUA 2JEIA 1S9EB 5AIAA 3H0PA 4LFAK 2YNGA 4MMOA 5ALWA 3U1NA 2ZH8A 2VONA 3W3DA 9ICPA 1RSCA 4V19S 1Q82O 5KFAA 2NS1B 1YJ7A 2B8QA 4DL0C 3SMVA 3WNGA 2ALZA 2WC9A 1R8BA 2MKCA 1EQMA 3IM1A 3OYBA 1W2IA 1UWBB 4ZJQA 3R8EA 2VICA 4QZCA 1KRPA 4UOFA 2EW9A 3GBTA 3ZNUA 1T8EA 2E7XA 1J2NA 2W55A 5J2MA 4KI4A 5K8PA 2BOPA 5J2PA 5LMUK 1TL5A 2P9UA 4FF2A 3VQTA 1XMQK 3G9CA 2HGMA 1RDFA 4K4WA 4J9KA 2BMBA 2JRZA 2KW4A 4LRDA 1ZH5A 4RUBA 3EE8A 5J2IA 1Q1KA 1OW5A 2Z58B 1FKAF 3WT0A 1ASWA 2H3IA 4CFCA 3J80U 2FHMA 2RDDA 4Q44A 3GU3A 5HBMA 4C7QA 2A10A 3AVGA 2CZ9A 4LF7J 3WQUA 1RTHB 2YWGA 1HKCA 4EIAA 3PV8A 1KAYA 2FLOA 2AGOA 4EO8A 2WF6A 3EKUA 1D5AA 2OPQA 4QWEA 4TLQA 1EWRA 4K50A 4DOZA 3I76A 4IQUA 1NOYA 1JNRB 1SQEA 4TQRA 2XHWA 3H4BA 1F5AA 1YTYA 4B3OB 4CJUA 4OHZA 2AWZA 3M6XA 5D0GA 5KG1A 3TUZC 4BRDA 3M6WA 3GIKA 4JI5J 4KBIA 2P9IB 5AE1A 2ZHOA 3GJQB 5G4DA 4XH1A 4Z4IA 2CNLB 3L7PA 2V2KA 5J8YC 1F9FA 1FRMA 2X3GA 5DBBA 2C2DA 2QG9B 1I51B 2KB2A 3A1YG 5THWA 2V51B 4E7JA 1V3ZA 3RBXA 4DL7A 2H1YA 2GA7A 1J2VA 1ZOLA 5JU5A 5BR8J 1ZRMA 4B6JA 3RB6A 4O3RA 2YWEA 4IJNA 4RQ3A 2G2YA 5FDLB 3FNNA 3K2YA 4A8YA 2QKBA 5J29A 4CYUB 1FDDA 8ICEA 4B1ZA 2KI2A 3CJRA 5B0FA 8ICBA 4IJAA 1MROA 2GO8A 2I9SA 2FJWA 3KG0A 3PTWA 4YDXA 3MD1A 4FJJA 3U02A 4M7XA 4RW6A 1RDBA 2OYYA 2FLPA 5H9FJ 4CLKA 3ILJA 4OGCA 3ILLA 4F5RA 3AL0B 4BX9C 1B0VA 1KP6A 4C23A 4L6V3 3PSIA 3TUIC 1WORA 3MN6A 1N60A 2IAJA 3C2MA 3O9UA 2L41A 2D0OA 2GCFA 2K8AA 2OPPA 4RQ6A 1R7IA 1UTAA 3WIVA 2EG2A 2YNFA 3CD6N 1R8HA 5CEHA 4F02A 4JKGA 3ZDCA 4EELA 4PJ0U 4W4MA 1RA6A 2HMIB 3JTPA 1IR2A 5EU7A 2HURA 2ZUBA 3G6YA 4AYBD 4EFAC 2X6NA 4M1KA 4EBCA 3WC0A 1EQYA 3WK5A 2ZTDA 1HQUA 1NAQA 4M9GA 1SZ2A 1S9EA 1ZM3A 3V1QA 2G0CA 3ZT3A 3M7DA 1SJQA 4DPXA 1NKEA 4KH6A 2DY4A 4JI3F 1RT3B 2LQJA 4UB3A 3LVVA 1QZ5A 3FAHA 3EVOA 4CIOA 1EB0A 4LR7A 4OD0A 2OPSB 4H0OA 4CZMA 4JN4A 2UXCJ 1HI8A 2QL9B 2V0NA 2YWKA 4PHAA 2YNHB 3CRXA 3KWGA 4YORA 3N01A 1NZPA 3OV7A 3OL7A 3LH2S 1ZD2P 3EGVA 4GVEA 3DGPA 3QX7A 5E3AA 3GV7B 3V72A 3GU0A 1XK8A 1H3DA 4WYBA 2VF3A 4IOAL 1WOPA 4B1XB 5HO4A 4J2DA 4YOVA 4O0IA 1K47A 4Q5VA 5AZIB 2HHHF 1CC7A 2BJ1A 3OA9A 4Y2XA 2XYGB 2YQ3A 4FLUA 4FOIA 5CE3A 3DGVA 4GKJJ 2HBRB 3ZSZA 1S48A 1RTHA 3ADAC 5AK5A 2D41A 2WAQC 4QJVA 4O4GB 4N76A 4NB4A 5F9NA 2RDJA 4USKA 4KLJA 1Z3EB 1VSHA 3GR1A 5H2FU 4OI1A 2W54A 3QIOA 3IRXB 1IXRA 4LF2A 3DRRB 3FZKA 3D4JA 3S3MA 1FWPA 3TACB 2XSFA 4HVJA 2IIRA 4ZLPA 2HFUA 3FCVA 3H0LB 4RW8A 1NG9A 3HHKA 4AHSA 1C6VA 1RAOA 2ZZMA 3CCVS 5BYSA 2P9IA 2LEAA 4OCZA 2Z1GA 4LC9B 4DB3A 3SPYA 3UD4P 3FMBA 2PMZD 1ZD5A 1LCUA 2YKNB 3HZEA 2VIHA 2G8KA 3VQPA 3BYRA 4M5LA 2ZUCA 1JB0C 4HLBA 1FNMA 2IRUA 3LP0B 3M6ZA 3H3NO 3LAKA 3NRWA 1FDAA 1I1GA 4DPTA 2QW9A 5FDLA 3M4XA 3ZD9A 3ZTOA 2BJ8A 2GW8A 1AQ6A 1KTQA 2OIHA 1IBLJ 4CYUA 2YWWA 4HKQA 2QMUB 4Z0UA 1WTFA 3A12A 3H8YA 2HFNA 4CI6A 2MLXA 3JPOA 1DQ8A 2ODGA 2D3OR 2H65B 4A2AA 2DEJA 1WSFA 3BQ7A 2LDIA 4CHOA 5HVGA 2EFGA 1NLVA 3P5TL 1Q3VA 2JR5A 4AE5A 4NO7A 5CJ7A 4OHXA 5CYQA 3O8WA 3G0ZA 2KXHA 3RTVA 1NSAA 2V50A 4ZKAA 3O9TA 4LVNP 2VA2A 4ANEA 2Q6BA 3PFEA 1NCLA 3DFEA 4C80A 3RBDA 2R7SA 3SMPA 3ISCA 4PGYA 4Y2KA 1BQNB 3M3ZA 1D8ZA 1LQ9A 2ZH6A 1HWIA 2V69A 1VDVA 2CQIA 3S01A 3UD5A 4MK8A 5K5MA 1QTNB 5KT4A 3BY5A 1B64A 4G65A 4B3TJ 1KQSR 3WKAA 4H5NA 4UAVA 3RJHA 4PWUA 1RT3A 2L9WA 1OVYA 3F0NA 5CR4A 2BDUA 2Q3SA 3MI7X 4GY2B 2KHQA 4CF0A 4KV8B 2W7AA 2YNHA 1HUZA 4DN9A 2V6AA 2XB2D 4NXMK 4YHHK 5AQZA 1B9FA 2D9OA 4FLTA 4NL9C 3CCMS 4LF6K 4AYBF 4YN3B 3MM9A 4RO0A 2B21A 1DAXA 1KD1O 2XLKA 1IIPA 4K4TA 1RAFB 1REGX 2FLNA 2M8HA 1M1HA 2ZH1A 5ALVA 2F1JA 5AZIA 4MFAA 1HWJA 2F44A 1YVUA 5DGAA 3KKSA 2W01A 1T9VA 4RWXA 2CPJA 3BR8A 3KK2B 3S7RA 4R8UB 4YY3J 4NLWA 9ICOA 4F25A 4Y2JA 4OJ5A 3O8MA 4DUYF 4DUZJ 3H1QA 1ITGA 3IRXA 2MSTA 1Z1ZA 1TGOA 3KHRA 2V8HA 1ZYQA 3DRRA 2IVNA 4DLEA 2C3OA 2OSQA 3WZ0A 1ZQDA 4OI3A 2OJ3A 3CJTA 8ICHA 3UN3A 5ETKA 4DDFA 3M1YA 4NLGA 1I3OB 3E01B 3J80Y 4LF9J 2J6TA 3QEXA 4KRWA 1V5VA 4WF9Q 4I7FB 3F73A 2IOCA 1IBMK 2NRXA 1BWEA 3QIPB 2YHWA 4XEIA 5IILA 3TVKA 2F1HA 5L1KA 2YH1A 4QS9A 2YKNA 2N4CA 2HNDA 2Z4PA 5BXIA 2YMMA 2PFUA 4DR5K 4DR1F 4PZNA 3MN5A 1S12A 3I5AA 3S41A 5HQMA 2KYXA 3LP0A 3BREA 3EUB2 4PXCA 4YOTA 1Q9XA 3V9WA 4NCAA 4FBTA 2M5YA 2Z2LA 3HHDA 5H9EJ 5C15A 1NEEA 3K5OA 2ASMA 3R9PA 2KN4A 4USAA 4DR4J 1O13A 4LQ9A 2DRBA 1IKWB 4DL6A 2A3VA 3C95A 3D68A 3CCES 3V4IA 2AJ4A 3DNCA 2ZWHA 3K8WA 1FTCA 2IOFK 1UMJA 2DGVA 4LJXA 4I27A 2CPHA 3ZZ0A 3BP8A 5JLHA 2HQ3A 4KMOB 4WP3A 4G3IA 2QEXS 3VGKA 1U48A 3F5EA 1HBNB 2UXDJ 1FEHA 3E9OA 3KTQA 2E9ZA 3ZSRA 1HI0P 4C4SA 4OJRA 1JJCB 5DM6L 3MURP 2P35A 4PHEA 1H73A 2XMKA 4FJ5A 4QIFA 4DTUA 2BJ9A 2WAQD 5HOOA 1BQNA 4GIBA 3I0RB 1ZRNA 3W61A 4Y2PA 2XRIA 2B4JA 5E5NA 4DQSA 4DV2J 2ASOA 4FWKA 2P66A 5D8HB 2JC1A 1QQ6A 4BRNA 5CZ1A 4RUHA 1K44A 3P3DA 2EVZA 4DG1B 3CCLN 1YDLA 1WOQA 3G8TA 3DXKB 3LW5C 1XMBA 2JXJA 2NRWA 5DJBA 4C0HA 4EWTA 2M0NA 4F7VA 2VCPA 3C2LA 1WI6A 3FLCO 4DV5F 3BGRA 2W4PA 4ZPCA 5DK5A 4Z4HA 3T79A 4NM1A 4JI0K 1ZQ1C 1AT1B 3JPTA 1P8ZA 2EKYA 4KV8A 2W6LA 5HL7L 2VD3A 3D6HB 2ZJ8A 3OTOK 4ZLJA 3RBEA 3RH6A 4ZCLA 5DBAA 5BRFA 3VA3A 3AU2A 4IEEA 5C2GA 1WKLA 4HTIA 4JI2F 4K0KK 4YOUA 2O66A 4M2YA 4ZOSA 4ISGA 7ICNA 1YUWA 1X0FA 5AKYA 2MSNA 4ZITA 4CJTA 2NLWA 3PSPA 4ILMA 4ZIWA 3R1HA 3SLCA 1B0PA 3H7HB 3TVZA 3FKBA 5LJ5Y 3KK2A 2HAIA 4R8UA 3G8SA 3RMDA 4RJVA 4X66J 4JI4J 3POTB 4CH7A 4WU2A 1RWKB 2ZH9A 1RTDB 3K7RA 1P1TA 5HRPA 4RBVA 5HMMA 4LF5K 2ZUGA 9ICRA 2BM0A 3IFRA 1XEZA 3AVFA 5D6GA 4HCBA 4W5NA 3GV8B 2R7OA 1KSPA 1HL6A 5B0CA 1NKBA 1L7PA 7ICTA 3FFKB 3E01A 4NLZA 2M70A 1VLBA 4J5OA 4I7FA 5FPEA 2BCQA 3ISDA 2CH6A 3QIPA 1MU2B 4WKYA 1GLEG 3VCBA 2BW7A 2XSJB 3Q22A 3MMAB 1GLDG 2XI9A 2PA8D 3O3LA 4QPTA 3VZIA 3V6KA 3SBTA 2XBPA 2Q2RA 4NASA 2WHEA 2MZQA 1CXQA 3RB3A 4ZS6A 5C2FA 2UUAJ 5KFDA 4AXJA 4TU7A 4FS2A 3VQ7A 4FLZA 1W7AA 3WKCA 2HQDA 3B6BA 2AW0A 5ETQA 3IMXA 2MA1A 2QGFB 3X3UA 4KLOA 1VBXA 4RNOA 4F4YA 3P45B 2P5VA 1H38A 4OZNA 1QQCA 4QZ9A 1VSMA 5KG0A 1IKWA 3MTKA 3PNCA 2FIUA 3ZX0A 1KBRA 2DXDA 5KFBA 4NZ6A 2E5IA 3ED5A 4I2IA 4CLYA 3IR7B 2RN2A 1SUQB 4CD3A 2UXBJ 4UB1A 2J8AA 4G1IA 1X9XA 1WHYA 1HBNA 2CJAA 2Y1RI 1ZQUA 1JKHA 2HSTA 1YK9A 3R6LB 2FSKA 2HMPA 3SJJA 3M6GA 2DPIA 1SL0A 4F3OA 2LPEA 2DPNA 4OYAA 5AKKA 1M6YA 1DARA 2XC9A 3D0HE 3CSKA 1QE1A 3T1YJ 3C16B 1WF0A 4JKFA 4KH0B 4DTMA 5HAOA 2KG1A 3ICLA 4P4MA 3I0RA 1TKTB 3I31A 3K9KA 1BY9A 1ZQGA 4U95A 4M3ZA 3LDOA 2VGNA 4MDBA 4P10A 1KQQA 4DI6A 5AFUA 3PYDA 4DG1A 1C2PA 2ZQBA 3DXKA 3MF5A 4Y1CA 2PFNA 2YX8A 3W65A 4YEAA 1FRKA 3VGVA 2VQEF 1L3TA 3THTA 2NRRA 2GO7A 1ZD3A 1HKAA 4ZVSB 1HEKA 1S6UA 4EEKA 4P74A 3FUYA 3RW7A 1KEKA 4QOTA 2FJEB 4HL9A 2L48A 3A3OB 3JSRA 4MEXA 2E2QA 4DQRA 5J0PA 2EI5A 4NMLA 1W97L 1HI1A 3W63A 4LH4A 2HYIB 3BUZB 4OI0A 2H51B 3HXMA 3M8RA 4K5SA 4BBYA 2V68A 4XK8C 1FFUA 3HX0A 2LQBA 1GTEA 2HFZA 4P6QA 2ISPA 1FRXA 4F4AA 5BOMA 1XR5A 3KK3B 3CQXA 3N4QA 1PC5A 3AH6A 1RAGB 1KVCA 2O67A 3POTA 2P9NB 5DB9A 1RTDA 1U6FA 2P2CB 3I56S 5J0SA 2R2UA 1FF2A 1MN7A 1HD1A 1RILA 4BGDA 1BC6A 3EL2A 3HSDA 3TSQA 2WB1F 4NYFA 3H8WA 5KFQA 1WSGA 1UWAA 1GXTA 1JJ2M 1Q86O 2DJWA 4LF7F 2KT3A 7ICHA 1WC4A 5AK4A 3PMLA 2OPRA 1PGZA 4FL9A 1X9MA 4YOYA 4GXIA 3LF0A 2H9ZA 4M9NA 1MU2A 3CI5A 3HL8A 4LH5A 4FP9A 4UTGA 3MMAA 2P6RA 3Q2TC 5ETVA 2RHSB 4KE5A 4NLQA 3CC2N 4DTOA 2BXJA 2DR5A 9ICUA 1NLKL 1NMNA 2JGUA 3KG1A 4AHRA 3ENAA 4BCAA 3CCUN 4LR9A 3CCTA 4KTQA 4QNLA 4OMFG 5AKGA 4BVPA 1XSNA 3SCIE 2NZ4A 1TAMA 1N5XA 2OEKA 1KVJA 3NWRA 5DRKA 4RCHA 4OHYA 2H3VA 1TZ0A 3LGHA 1HHTP 4X2BA 3BS9A 1BPDA 5JS2A 1X4CA 2J9EA 5HP4A 1FX2A 3LA0A 2AEMA 3WEEA 1SUQA 3H2LA 1U1OA 1VQOS 4B9NA 1PIEA 5E79U 1ZD4A 5KFNA 3ENOA 3O3HA 4MYUA 3ZSVA 2XI2A 3HLUA 1YQHA 2ZXIA 1T95A 2CADA 5LSOA 2F3JA 1SQFA 2IRYA 3ETMA 1VDHA 2CDRB 3C16A 3BS5B 3WK7A 4YMOA 4NRTA 1S6PA 2UUCK 1TKTA 3CNHA 5J2JA 1ZAWA 4BC7A 3V9ZA 4MF8A 3CDWA 1Y5LB 2ZVIA 2CQ3A 2IPOB 3BKTA 1QM9A 5K9FA 2HVDA 5HN0A 3LK9A 3CG7A 3HJVA 1FWLA 4FZYA 1CI4A 1WG8A 3QFHA 2KVSA 4FW2A 2QJ3A 2JLGA 3GIMA 2YKQA 1X9WA 1URRA 3MOJB 3MPYA 2W41A 3LO3A 2DNRA 4OJ1A 3MDCA 3HRGA 1J5EJ 5E7OB 2Y8WA 2HHWA 3GSIA 1NJIT 3HTVA 2C2NA 3D1OA 4K2XA 2KDOA 5M1PA 2WVDA 2HHTA 1FEZA 4QZBA 2ZF5O 2EG1A 3L4QA 5CD4H 1VQ6N 1RBUA 5F1XA 4B3SK 5L46A 2DNNA 1N2XA 3K5PA 3QGGA 4F36A 1Z00B 4K43A 2XICA 2H4YB 2GVDB 4HHUA 3UPFA 4P0PB 1D9AA 3P5BP 2ZJPQ 2I1RA 4BR0A 1IBKJ 1L5UA 4ZJOA 3KK3A 4EENA 4I2QA 4QWBA 3DLGA 3Q8RB 4RUAA 2XS7A 3ZZUA 3I55N 4PUOB 2P9NA 2GGPB 3MCSA 4KLHA 1OQ6A 1TL4A 1BG3A 4ED4A 2ZHAA 1XTZA 4DV7J 5KFKA 2MLYA 1GLLO 2BPGA 2BRKA 1HNZJ 3ZO7A 3UB5A 1WNEA 1M90O 4IQTA 1R89A 3OTDA 2E9RX 2P5GA 1H2TZ 2CJXB 2VPYB 5J1EA 1EO1A 4GKJF 4MFCA 4ER8A 5IC4B 4RTFD 2W11A 5DS7A 1TV6A 4WP9A 3BH7B 3HT0A 7FDRA 1Z4UA 1NMDA 1YG0A 3EE9A 1K6YA 2WBNA 4P72A 1YIJS 2F96A 3A5LC 5FPNA 1H74A 3W7BA 2K8CB 4B3MJ 3PJXA 5ALQA 4CLZA 3L8BA 2BKOA 3VF0B 1PZNA 1N36J 4F72A 2IDLA 1N52B 4GMKA 3T69A 1S7HA 1N8RO 3CXCM 1GTHA 4USJC 3QRQA 2JWKA 2P9CA 1DTQB 2KD1A 2BCVA 4FWRA 3QUBA 1JLBB 2FZKB 3A3PB 1S1XB 1VQ4N 2OUGA 2V2QA 3AFGA 3NTUA 2RVJA 2QWOA 3QNOA 3KIOA 3PW5A 4DFKA 5DKWA 5EHHA 1VQLN 4MYTA 4FKXA 3QFUA 2GUIA 1RHMB 4A57A 5EGYA 4C2MA 4F93B 4ALZA 3IFEA 1IJEB 3D6JA 2KT5A 3HK2A 2L08A 2D0BA 9ICCA 4NLPA 3MGIA 2AEJA 2KKHA 2YQEA 4X84A 1IBLF 4LF8J 1UVJA 3CD0A 2EWSA 3R3LA 4ZIVA 3QT7A 3TJ8A 3EZUA 3KLHB 2B7BB 4BRCA 3NH1A 3SMZA 4LFCK 4Q8FA 3LWLA 1RLDA 3HI0A 3A0IX 2HFVA 2QMWA 3WKBA 3BS5A 3EDQB 4YOEA 2FPMA 4HUFA 2RP5A 2VB6A 3SNNA 5KNIA 3D2WA 1NHVA 2EAMA 4LVOP 3SMSA 3CVKA 4QR0A 3HD1A 4JYAK 4I2BA 4IQWA 4CHZA 3OS0A 3O4NA 3QEVA 1PCAA 1OH5A 4B9SA 1OVQA 3R2CJ 4JI7F 2F8MA 3GDXA 2A1BA 2HQFA 2VBXA 2OZMA 4RT2A 1REVB 3A0BU 2OTLS 1K8AT 4CO5A 5JJBA 1IV8A 2KJ9A 3UKUA 5I3QA 2GIFA 2JOQA 4U7UD 5DZ7A 1RT5B 1RTIB 1WAFA 3CWJA 3WK8A 3DI6B 3QLHA 1NSQA 4B3TF 5AIBA 1FEEA 2DNLA 1WLJA 3MD3A 1HMVB 2A1SA 4FVCA 2N3LA 3PXGa 4X65J 4QZVB 4YB7A 5G5HA 4DWIA 7ICKA 3GYNA 1FWKA 4BXOB 3KHHA 2M9NA 4CZGA 4CJ7A 3A2FA 2DGSA 3C2KA 3G6ES 2IM1A 3T5JA 2YPYA 4AH9A 3UQ0A 1S1UB 3UVJB 3ENQA 1KVKA 4B9QA 4F5OA 4K8ZA 3CF5Q 1F6TA 2L5YA 2E9TA 3T9ZA 1PO6A 1M5KC 3M6KA 4JV5J 4PUOA 1S0MA 4GNIA 5AQHA 2GGPA 3HX9A 2J6SA 1BPYA 3ZSYA 2RRBA 1TUGB 3R27A 3CQYA 2G2OA 4IKAA 1HBUB 4N7TA 3M2VA 3WXLA 3KJQB 2IVFB 2DFHA 2MQOA 2DR9A 3IWNC 3F5TA 1EHWA 3RRHA 1I94K 2XM3A 4CT9A 2KEYA 1OY9A 4YY3F 1SWVA 3LPTA 1HW8A 2R7QA 2RMLA 2R7TA 3CJ9A 2B4PA 1FNXH 4DUZF 3NNCA 2OCEA 4C8ZA 4V19X 2GWJA 1IBCB 3CJ3A 2Z2YB 1MWZA 4NA1A 2WRMA 4HACB 2MKSA 1Z1BA 4BRMA 5CRXA 1KHWA 4YR0A 2IRXA 3GIRA 3SQ4A 4DZDA 3LPEA 4LF9F 2OD4A 4FWQA 4EUVA 2C2MB 4EI2A 2A1AA 4NA2A 2QFJA 1DTQA 5FRNA 4WJ3B 3CCLS 1IJJA 3TARA 1FJGK 5ALKA 1XBWA 1E3MA 2Z57B 3MCMA 3VALA 4LJMA 4CF8A 3TYTA 2B9XA 3GZFA 3KLGB 4HUGA 3SD7A 3C65A 1NOMA 3O3GA 3VAIA 2NUHA 4USMA 5DETA 5AQSA 3CJCA 3PHEA 4DR4F 3BQ2A 3WXKA 2JLEA 3DLKB 3D0IE 5F2RA 4AILC 3DM2B 4HUEA 4OLAA 1Q53A 1YJVA 4DR6J 3HMJG 3KLHA 1VISA 2ZJRQ 2PT0A 4YDUA 2HVHA 5AQLA 1WWHA 4M5IA 2V9KA 2VH7A 4HEA9 8ICVA 4BE0A 2UXDF 2V8PA 3VZHA 2LP4A 4FJMA 2DEIA 1R0AB 3GPAA 1WNSA 3ZZZA 4CH0S 4BR9A 5AI0A 2PC6A 4FM1A 1YWXA 5LMUJ 2CGKA 4BDPA 3AD8C 4A5BA 3NVKA 2AMCB 3AJ2A 1CEZA 2CNOB 4QIWD 4GVMA 2DIUA 3W3SA 2MZ1A 1H72C 4DV2F 2CG4A 2R7VA 1X6JA 2AJFE 3F9KA 4CIFA 3VEVA 3WQPA 1RT5A 1RTIA 5AQVA 3UCGA 1OH7A 2X1FA 2YXLA 3DI6A 1T7PA 4ZDNA 2LXFA 2K06A 1J27A 2EPIA 4GV9A 2XNQA 1HMVA 2J0WA 3BQ1A 2E5LJ 2FVQA 3M2UB 1BHNA 1U0SA 1C0MA 2KG0A 4C7ZA 3I96A 3KVGA 4CNYA 4P2FA 3SCKE 4OO1J 9ICHA 2GUPA 3SDEA 1RYUA 1UJ4A 4M95A 2K8GA 3W2VA 3C8YA 1HPMA 1MN8A 2UUWA 2MRLA 4BE1A 3W5YA 1IWAA 1X5TA 3MR7A 2IFXA 2YVSA 4KQZA 2AX1A 2UU9J 4RNFA 3O44A 3D28A 3RZAA 4KLSA 1N32J 4WIIA 5AM3A 4CJVA 3TADC 1HBUA 1LEOA 1ELOA 2BVZA 1U8WA 4V19J 1EZZB 2RJZA 1NDCA 2W43A 1WHXA 2KJWA 4JI8K 1ZOTA 4ZCIA 1OXJA 3OYGA 2HSEB 4U67Q 3AVAA 4X66F 5CP2A 2J7KA 1HR0K 1QVFR 4U9RA 4YFUA 3QT8A 5ALYA 3P4IA 2BCRA 1U1KA 2ACYA 3TW0A 2FY1A 2LCWA 4OV1A 3ZI4A 2BANB 4HACA 3PRVA 4LR8A 3QWPA 5G0RB 1TMJA 3WXIA 2VG7B 5DDOC 3W62A 4KB7A 4MO4A 1X0PA 2ZKUA 2XHCA 3BPDA 4EHUA 5A0LA 1SV0A 2JFKA 4QWCA 3LPUA 5GADU 3WXMB 1ACMB 4IO1A 3KG4A 2QA4N 1KN5A 4B02A 1SJ4P 2A41A 3NCIA 2R8IA 1I3AA 3VOVA 2WF5A 4FW1A 3OYHA 3PYGA 5SZTA 2LU1A 3EY1A 2BR0A 1N33J 1NK7A 1B92A 3O2IA 4MT1A 8ICGA 1WC6A 2UUAF 3DXSX 2BGWA 1GOBA 1SKSA 4RQ0A 1O51A 4XPEA 3IG1B 5IIIA 1CQNA 3KLGA 1YRXA 1T44A 4NLRA 3FEZA 5HI7A 4CJ3A 2AQ4A 3TU5A 2ILZA 4USIA 2VANA 3TFRA 4OX7A 2Y9TA 3DLKA 2CJKA 2C1EB 4WIQA 5B0EA 3DM2A 2OEJA 5F3TA 2X1GA 3PDNA 3M9MB 1T9YA 4N41A 5KFGA 3HSGA 4FK4A 1TUVA 4NLUA 2ZJQQ 3D0PA 4A8EA 3PSFA 1N5QA 3UNYA 3CM5A 2AIRB 5AKHA 4A2BA 1YHQN 1PILA 3LP2B 1TQLA 2ES6A 2UXBF 2WVEA 3VQBA 4NLBA 5C2CA 2VQFJ 2D74B 2RHKA 1ZXOA 3TR5A 3E51A 5KFRA 2D9PA 5KAKA 1V85A 2ZZTA 3MEEB 4LREA 1A0PA 5A8RB 2AKWB 2XO7A 1ZQFA 2HHQA 3J7AP 3SAGA 1B22A 4ENOA 5L39A 4RW7B 4UY85 2NPIA 3A0HU 2EFVA 4NY8A 4JKBA 4RWWA 5L9XA 3GYGA 3CMEN 2KHVA 4C97A 4P9SA 4K4ZA 1QY7A 3BGUA 2Y3YA 2YWHA 3B0YA 4IH5A 4F8RA 2IMWP 2HS3A 4EHTA 2ETJA 4MFFA 2P9KB 2UUBJ 3DMJB 3QNNA 4K4GA 4WZMA 2COLA 2GMHA 4UB6U 1DRZA 4HDGA 3ZT1A 1PG5B 3DLLQ 3CDUA 4F5PA 2DGTA 1RK8A 5DQHA 2MQLA 3TPQA 2KIVA 5LJVA 3RJKA 4CK2A 3E66A 3M1FA 5J0OA 3TUPA 3FGVA 5HHHA 3K1ZA 1A6SA 3I5BA 5ETNA 1OY8A 3CCUS 4L73A 1KDNA 4QIWF 5AXNA 3ONNA 2C22A 2G4BA 1ZTTA 1ZBUA 2QLJB 1ZBIA 4E1MA 2G13A 5KFJA 2WBRA 1M5OC 3WX4A 2CGJA 2X78A 3F56A 1OYDA 1DGJA 1WB9A 2ZITA 4RQ1A 4OI2A 3KYLA 3CJ1A 1DK2A 2WB4A 1S77D 5KFPA 2D3UA 3VEWA 4CFDA 1VQKN 3VQ5A 3SYZA 2FJAB 2YMLA 5L8RC 2ZIUB 1DT9A 4FVUA 5C2DA 3DU6A 3DXMB 2PEBA 4M6WA 2ZOFA 3P96A 4ETZA 4R25A 2D4WA 3FGUA 1O6XA 2W8KA 2R2TA 1X4FA 1H2VZ 3HPHA 1WG1A 3ICXA 4A8XA 5F8HA 4I2PB 1Y0HA 5CA5A 4UW9A 2V5HG 3TX0A 3V9XA 3A8KA 2BANA 4LBPA 4ZHRA 5G0RA 2VG7A 8ICTA 3G71S 3QU5A 4CO4A 3NF7A 2DXFA 4EX7A 4Y65A 3EDRB 3MM8B 2D3O1 1DLOB 2HLUA 4WYLA 2F9WA 2OTJN 2H5XA 4NE9C 2JWNA 1FXDA 4FYVB 3IKMA 4CJKA 4MAKA 1RDCA 1TYQB 5ITHA 5DDYA 1K5OA 2UVVA 3R1XA 5K4LA 3ZEUB 4E89A 2HRUA 1NZBA 1UP1A 4OYIA 1NU4A 4AQYK 3MDAA 4UB4A 1UA1A 5ALNA 4FJLA 4Z4GA 2HLTA 3AEVA 3ZX2A 5KFEA 3IG1A 4OX9K 1K1SA 2NXUA 3OYIA 1UEVA 4YOWA 3OYCA 2OWOA 4B08A 1HNVB 1I39A 4I69A 8ICAA 3LQVA 2AYGA 3H42A 3LYSA 4JV2A 3BPSP 1T05B 3J7YP 5J2DA 3QGPA 4LSNB 3NS6A 2XY7A 2YHBA 4TVAB 2J76E 4PL7A 1F0XA 1DTTA 1H98A 5E3QA 3C46A 1ZQQA 1ZQBA 1ZBTA 3MAAB 2N7CA 4W90B 2XY8A 2FF3B 5A8RA 4NXMJ 5C12A 4O3MA 4DMNA 1U25A 3GSDA 4K4SA 2WVCA 3DOMB 3I55S 1VQ9S 4RW7A 4ITSA 3VGSA 1FHTA 4Y2TA 3D6FB 2P9PB 2PYLA 2F9DA 3V9UA 2QA2A 1FVSA 4HVZA 4FN5A 3VN5A 4J03A 4FOEA 3J7ZT 4NI2A 5LMNK 2V4JA 2E8NA 2Z1HA 4AXIA 2D0AA 1JLCB 3CCSN 2QLBB 2ZWPA 2ZBQA 1FXXA 2BE2B 3IDWA 4M3YA 4RT3A 3DMJA 1OPZA 2WFAA 5AM1A 4LSLB 4ECTA 3TA0A 1NRKA 2A0FB 4RPXA 1HLUA 1BLUA 4J9PA 1UT5A 3MGJA 3EZWA 1HYVA 3PUFA 4BDZA 8ICOA 3C94A 3H46O 4NLSA 3H2VE 2BJ7A 1N61A 1J5EF 3DRYA 3DRXA 1BNOA 1YJ9N 4EK2A 3SQ2A 1Z2LA 3CJ4A 4CLSA 3OL6A 1T9UA 2WSEC 1N34K 1IN0A 3OVAA 3BBBA 1GOCA 3Q8SB 3J7Z5 1ZQAA 1RU2A 2ZJPL 3H0MB 5IIJA 4X62J 1S1VB 1H2UX 2JDJA 2XMUA 1NWKA 2RB7A 3FFIB 5A6WA 2LXUA 2F4VK 4C8KA 2ZIUA 4H5TA 2E7VA 3EW9A 5KFMA 3DXMA 3OJUA 2HAFA 1P6TA 5FLXU 3FDSA 4DCJB 1VBYA 4IFYB 4JK7A 3KNGA 3NVVA 2W9CB 1VJWA 3R5GA 4LUBA 1YBAA 2KICA 4KC5A 2N3OA 3VGUA 3HT3A 2ZH2A 4C8NA 4I2PA 4DV7F 2EANA 2K2PA 2VV5A 3OYNA 3H4DA 1ZBSA 3FRZA 2BCUA 4LRAA 4Y3CA 4FWOA 2YTCA 3OXLA 1SV5B 3DRPB 3GMGA 3MK6A 2ROEA 2KO1A 2AYBA 3SSRA 4CE9A 3HW8A 3H7IA 4PABA 3QQCD 2MZRA 3FK4A 2MUTB 3MM8A 2NXCA 1DLOA 3OW2R 1DOQA 4DFMA 4DL3A 4B1VA 3N9UC 2VL1A 4ZVUB 1A76A 1E6VB 3H40A 4M47A 1GX6A 4XIUA 3CFOA 1TYQA 3O08A 3R7BB 4PL8A 1H0HB 2WOMB 3CJ5A 2LKYA 2IBKA 3R6GB 7ICSA 3ZEUA 1BPZA 1FESA 5KFSA 1RXVA 4IKFA 4JKEA 4GXJA 1OSDA 4CGGA 5GADP 4IH7A 3PEJA 2VJUA 2G09A 3FBFA 1FE4A 3MR5A 4DSKA 2DNGA 1X4AA 2F8KA 1LFWA 2W40A 2R9LA 1ZJNA 4MEYA 4A59A 1HNVA 1R6VA 2CPFA 5EE9A 2YY6A 4CJEA 2MGZB 3PCOB 1T05A 2FDNA 3Q86A 5M1KA 2IHR1 5KT2A 4A46A 3CYMA 4LSNA 5HRRA 3UD3P 1SCJB 1KC8T 1ZS6A 1YF5L 2P9LA 4J9QA 4BC2A 1NH7A 1BQMB 1NNLA 3HBTA 2B0CA 3MAAA 4LF8F 2RQ5A 2R8KA 4OKJA 4OJGA 4XUSA 3RUBL 1XO0A 3DOMA 4P2XA 3V5RA 4DCOB 1E4FT 4QR1A 3O9RA 1TAQA 2P9PA 1WBDA 9ICEA 1JJHA 3TAPA 1CZAN 1ZBFA 2G0JA 3TA2A 4ZMMA 2I38A 1J97A 1O03A 3J80O 4KHMA 4DOCA 4CI0B 4B1YB 4CLTA 2FSJA 4Y2UA 2NXNA 4FS1A 4G9BA 5EDWA 1BA1A 1QVGR 1G99A 1JLCA 5BYQA 3I32A 3PKYA 2ISOA 2N1RA 1PYTA 4O3PA 4LSLA 4PWDB 4CJLA 1SQKA 3NH0A 1JXLA 3HI9A 4PGQA 1FJ7A 2CQPA 2O8EB 1JN3A 4CK1A 3WUHA 3HF5A 3C6UB 1BO5O 3OVSA 2QL5B 3KKRA 2QT7A 1SI9A 5KG2A 3IS9B 1PC4A 3NNHA 3HFKA 2OI2A 1RGVA 3IBCB 5F8LA 3PR4A 3TI0A 2UUTA 3V2UC 1ZBLA 4FJKA 1T02A 1AUSL 1VQPS 1ZQXA 2G1DA 4QZAA 4B9TA 2AHOB 1P1LA 1Q5YA 3ZZPA 4KAZA 3N28A 4JHDB 2CXYA 2W4DA 1KWMA 3G10A 5GMDA 1S1VA 2K89A 3CF5L 2DGWA 4W5OA 2RDIA 3DKDA 3NGTA 3FFIA 2HG4A 4CGHA 3FZHA 5LT5A 1WTBA 4JV1A 1K1QA 1S4EA 1XNQK 2KK0A 3E3XA 4DTNA 3MPVA 4A8OA 4ZOHC 3PG9A 1BIZA 1T3QA 2LM1A 2W9CA 2B5JB 3SAFA 1A5VA 3MUVP 1DKGD 1NK8A 4CLPA 4DR3K 1F2HA 1G3OA 4Z94A 1E6YB 4PWWA 4F71A 4KGXB 2LA4A 4A4JA 3JPRA 2W3RA 1XHZA 5EN1A 1SV5A 3EUNA 1F2GA 3Q8UA 5CABA 4NLVA 2QWNA 3RJJA 3KFUF 2MUTA 1C0UB 2YHXA 4DOBA 1VQ5S 4RZRA 4I2HA 1E6VA 5HRNA 1SH0A 1T11A 3LP1B 3HSCA 2A6AA 4I2EA 3OUYB 2WOMA 3K4GA 8ICRA 2DGOA 3O1WA 4FPIA 4FVMA 2D5RA 2KHCA 1UETA 2QO3A 2BABA 4BR2A 3D54A 1VQSA 2WMMA 4TUPA 1T94A 3QICA 3I87A 4FF1A 3ZSXA 3R8YA 5J2CA 3NGRA 2OYQA 3THXB 4EEYA 4DHVA 2HHPA 4CGIA 2KKVA 4Z7CA 2ZM6F 2RU9A 2DNQA 2WF7A 3NWGA 2RUGA 1S99A 3AQFA 4IG0B 1CRXA 4USUA 2MGZA 5SWMA 3M2RB 3N7RC 4B3RK 4ZA1A 1TU0B 4UAYA 4PXBA 5L9NA 1ATNA 4FZZA 4I56A 1HA1A 3NFAA 1RE1B 4YDDB 1HJOA 2E88A 3BZKA 3BDEA 1X5PA 5AZJA 4BC4A 2ZJRL 1XSPA 3EO3A 1XI1A 3VENA 3OGUA 1D8YA 4LFAF 1SZPA 4HTUA 4J9SA 2BKPA 2FTRA 3EGNA 2BACA 4U6PA 1COOA 3VAKA 4J2BA 3PRBA 1LWXA 2KU7A 4ZP6A 2MKYA 3DWLA 3ZCMA 1H7WA 3FYHA 4DR7K 2PO4A 1BI4B 4BREA 2X1BA 5GTIU 1AUDA 4IH6A 1UL3A 4O3NA 4PEOA 3UXOA 3KXDA 4ILJA 4WQ4C 5LMUF 2K4HA 4PWDA 4CHPA 3RAQA 1XMQF 1NK6A 5B0BA 2KTQA 3QFWA 4X4SA 1NGEA 2O8EA 5CCMA 2JFDA 4KTZA 1QUPA 4BRHA 3C6UA 4PAAA 1DZ5A 3VEYA 4Z2XA 3RWUA 3IS9A 4RU9A 1KN6A 5KRSA 3UDEA 5AQGA 4FK0A 2KHDA 1EXNA 1PYOB 3Q0AA 1WWUA 4YD2A 4NXNK 3CDAA 1U47A 1WDTA 5KFWA 2YY3A 5GADI 3DJCA 2E5LF 3QJPA 4JHDA 4K4YA 1S4FA 5D4BA 1KQKA 5IOLA 3UN2A 5CZ2A 4HH1A 1FA0A 4FXVA 2KFZA 2JZBB 1KVBA 3CPWM 3PMNA 2F2AB 5ALSA 3TO8A 1EXQA 1PUZA 3CMAS 2PGCA 4DU7A 3QSIA 5LL6Z 3KBBA 1S9GB 1TTHB 2IYGA 4KH4A 1ZQTA 4NYPA 4OJLA 1NNDA 2NSBA 3P6YC 3RJEA 1GLAG 4AP9A 2B5JA 5LJ3Y 1HARA 1N32F 2FXUA 2APOA 2EFNA 9ICMA 2QMXA 2E2OA 1ZQMA 1BCOA 1E6YA 4U67L 3U3YA 5HK4A 4YFKA 4M3TA 2BDPA 1GLJO 4FK2A 1ZC6A 1XUPO 1PK1B 1TUUA 2DUYA 4PHDA 2YN4A 1JXBA 2FGOA 2PN6A 4J2EA 1SVDA 3EGWB 3MCAB 1ROFA 6FD1A 3HRDD 2MZJA 3ZDEA 2G8WA 1C0UA 1RBAA 1LVHA 3KKFA 4KHYA 4NWIA 1KBUA 5FLXY 2FMPA 3UCZP 3B4DA 5ALMA 3CT9A 3MUMP 3LP1A 2A3ZA 4DL2A 2CUYA 3OUYA 5ADXA 4I6WA 4CZEA 3G2XA 2CFXA 3RAXA 3N79A 4DCPB 3H3OB 2Q0UA 3PO5A 4EBDA 1TK8A 1RT7A 1YJWS 2UV8A 3UXNA 2GHWA 2VJ4A 5EX3A 5DBCA 1S6QB 3THXA 4OYMA 4UOHA 1N33F 1WKJA 3QAEA 1ZQOA 4DV0K 3O6QA 4FJIA 4IR9A 2WVFA 2OMLA 4KIAA 4DR1J 3GG1A 3NGDA 5HATA 2KP7A 4CO3A 2MKKA 3S3NA 5FJ4A 3SUPA 2E1AA 3DHXA 1X4GA 5J2BA 4XDCA 1CBKA 2OLWA 4R0EA 1XR7A 4ED3A 4EP5A 2BEFA 3NVMA 3M30B 4KO0B 4NRUA 2HGLA 4FPBA 3GDQA 2PYJA 1PJ6A 4K8XA 3H90A 5I9EB 2ZJQL 3QDKA 3IM9A 4KFBB 3NGSA 1WI8A 4BRLA 2KSOB 3C1ZA 2ASDA 3B9JA 1WF1A 5KQ8A 4FZMA 2HIQA 3PW2A 1HKGA 2VDHA 2JRSA 3GYXB 2ZUDA 4KLQA 2RILA 5F0UA 1HWUA 1VSEA 3WHIA 3W60A 1YITN 4DCCA 1WN7A 1F9EB 2P5OA 3CPEA 2VQFF 1VQKS 1VAZA 3Q7CA 1K9MT 1RWMB 3LANA 5CYJA 3CJBA 2BZFA 4J9NA 1X6IA 3IA0A 5ETLA 4DSIA 2DPJA 5B66U 3IUCA 1C0TB 1LWFA 4F67A 5B5EU 7ICEA 4M63C 2GAHC 4C4RA 3MM7B 1X2IA 4U7BA 2RE1A 4LF4J 3HSTB 3K58A 1FFVA 1Q95G 5ALXA 5EWGA 4X5VA 2U1AA 2F1FA 4F3QA 7ICLA 1RAHB 3VMFB 1LOTB 1S3XA 3V1OA 3AXMA 2W25A 2FVRA 3O5BA 5KG7A 4KT0C 2HK2A 2UUBF 3DLLL 3CIZA 3JYTB 3TWHA 4L3QA 3CCQN 1KKXA 3AO4A 2D1KA 1RDWX 2FC0A 2B43A 1HNXJ 3LM9A 4CZKA 4JI5K 3BQTA 3MUTP 3CCRS 2JZBA 4ID8A 4WCEQ 1SXDA 3B8HA 4JV0A 1TKZA 3FEXB 2E20A 2LLZA 3F9MA 2DH9A 5AT1B 3VF4A 4CERA 3BF1A 9ICNA 1S9GA 1M5VC 1TFWA 1PVRA 7ICVA 2HHVA 5HANA 5M2RA 2OXOA 3GZ7A 3KLEA 9ICXA 1BMQB 3AVHA 4TKTA 3O6WA 4I29A 3KJVB 1XMOK 2G5IB 3V7LA 2DR8A 4CH1A 3ATUA 5BR8K 4CGDA 2BE9B 4USWA 2X74A 4JI2J 5A2QO 2Z2ZA 3I0SB 3SI8A 4USVA 1VHXA 2Y9UA 3U1LA 4H0TB 4OLBA 4L72B 1QZ6A 1PK1A 4IQVA 1ZM4A 2EAOA 3AB2B 3O3FA 4LD0A 2Q97A 2GTDA 4WE1B 2QM1A 4M9HA 2P9UB 3MECA 2G2ZA 3C1YA 4F0KA 2CRXA 3F2CA 2CRLA 2Y1JA 5F41A 1RU1A 3FC9A 3ZSWA 3ATVA 4CDIA 3SEIA 1S59A 2QIFA 1YTAA 4OYZA 2FGCA 4HYKA 4XTTA 4ED6A 3DCAA 1S6QA 5HSPA 4LIRA 3SBGA 3MBYA 1S0OA 4CRJA 4AYBC 4U96A 4QIEA 1JROA 3OTCA 3N5FA 4KGKA 3VQSA 5F0XA 3C19A 1URNA 1SH3A 4FO6A 8ICPA 4IOXA 1JMTA 2VWJA 1EP4B 3EXYA 3NCQA 3HPGA 4F92B 3LDAA 1WUUA 8ICLA 3KZIU 3HZ6A 2RRNA 5LM7E 4H5WA 4KHPJ 3TABA 1YJ9S 3JAMU 1KXPA 3M30A 4KO0A 2HI0A 4NL5A 1V97A 1KLMB 3H59A 2UXCK 4O9MA 4KFBA 1IR0A 4CFBA 1K8AO 3DLBA 3F2KA 4Y2QA 1Q7YT 4Z6DA 4ANCA 3M8QB 3SAHA 3OVNA 4UAUA 5C7PA 4A8WA 2RHQB 3I28A 3EWGA 2Q3PA 2VPWB 2C28A 4F50A 4K42A 2KH9A 4UUXA 3JPNA 2Z1IA 5ADXH 3C7NB 3NP5A 2XHBA 3CE8A 4ERDA 2ASLA 3O4QA 1S0VA 4OI6A 3SFGA 5AQFA 2DGZA 3SENA 2NRZA 3QYYA 5CH7B 4NXMF 4YHHF 4CF9A 2PKEA 3S6EA 1XR6A 2VG5B 3PSTA 2PIIA 4LF6F 4UW2A 4RW6B 3T5LA 3CERA 3ISZA 4RQ7A 1BU6O 4H03B 5DM7Q 2NNWA 3AOCA 1M1KO 1RWWB 3MM7A 2DK2A 3OYKA 1SH2A 1WOOA 4FWPA 4M5HA 2L9NA 3OL9A 2QLWA 3R5DA 8ICZA 2K4IA 3AM9A 4XH4A 5G5GA 1N6QA 2GWKA 1S57A 3HOSA 3MHYA 2CN1A 4KLTA 1I94J 1ZQEA 4B1WB 4OHVA 2HNZB 4H4MB 5MLCV 5IT0A 1H6KX 4CECA 3JYTA 4JD2B 2Z2MA 2R8JA 3HKWA 2AYMA 3SV3A 2YNFB 4R79A 3CCJS 3M05A 3PW4A 1U6ZA 3BKUA 3G87A 1M5PC 3P31A 2QSWA 3BF3A 4F4KA 4CLFA 1KAZA 3CETA 2RIJA 4IQMA 3CC4N 4I2GA 1LKYA 2NRVA 2PMHA 1VQ7S 5KQDA 2V4QA 3WQTA 3NG8A 3LDNA 3KFWX 1J9AA 3ENWA 2M7SA 1DHMA 2XWXA 2DWQA 3IXQA 3UNGC 4KJIA 2W2OP 1TL1A 4R5PB 2W8LA 1OMSA 1XQSC 1X3NA 3TEGA 3KJVA 3O4WA 1MG7A 1FRIA 4YB1P 1QSYA 4IDKB 2ADCA 4X62F 3I0SA 2FUG9 2RRAA 5EY4A 4ZLNA 3H0RB 4L75A 4JI6K 1G4CA 1DGSA 1Q78A 4OZ2A 1IBLK 3ALYA 2J0QD 4C4TA 4DR5F 4A61A 2HFOA 2FJDB 3AQPA 4IYQA 3PR5B 1Q9YA 2MKIA 2F77X 3K8VA 1KQSM 5CZXA 1NUEA 3G82B 2I5JB 1Y97A 2A6MA 1UFWA 4Z6CA 4WE1A 3DGPB 3UN5A 2XMVA 4NCGB 1X31C 2CQGA 1VJ5A 4IO9Q 1NZ8A 1UAXA 1LB2B 2J7WA 3SUNA 5IZHA 4KAIA 3GCXP 2LQ8A 2IA6A 1BIUA 3FCWA 2IGIA 3LZIA 3NOGA 1RHRB 4BR7A 4G1QB 1XQIA 2WSCC 4RL1A 1F60B 2MHEA 4WU3A 1KLNA 2E1ZA 4WP8A 2ITGA 2E6LA 3IP0A 1VCTA 2WBMA 5CAAA 9ICKA 4N8OA 2MQNA 2NUBA 3AVJA 2LXIA 2WF8A 3AVIA 4E3SA 4FLXA 1RTJB 5ALUA 5FPDA 1WSRA 5IM0B 1YBTA 5AKXA 4WYWA 3ZNJ1 4KYZA 4KPYA 2O6KA 1J54A 4A8FA 3PJ9A 1EP4A 3CP8A 3WXJA 4ZPWR 4BRKA 1U9LA 3V7JA 4RW8B 4B3TK 1RZMA 3KWMA 2BQUA 2YX4A 8ICUA 2O3DA 2GIRA 2KRRA 1RAAB 1MWQA 4BRPA 3PFOA 5HMWA 1KLMA 3VPZA 2V34A 4J8FA 1S8OA 1QHTA 3FZ2A 1QHAA 3GLJA 1U4BA 3M8QA 1YBUA 4KGMA 1GXUA 1UPPA 3P83D 2CQDA 2H3EB 2GJ2A 5CR0A 5GMKa 2G8UA 2AQ0A 4JLHA 5ALLA 3C7NA 5GVQA 4ECRA 4O44B 4KLEA 2RNEA 1TFYA 3OTOF 4P4PA 4G9ZA 2FBYA 2VG5A 3GJRB 1NXIA 4ZP8A 1ZJMA 5A8KB 2AYEA 3SK3A 2JL9A 3NF9A 3D7EO 2FPHX 2PDAA 3V81B 4OI4A 4K0KF 4Y2SA 1WHVA 3NRZA 3BKFA 3J81U 5BREA 5CYQB 4ZPBA 2H3QA 1YJNN 3N4MB 4O3SA 2V94A 3K89A 1YAGA 5ALOA