4DSIA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, se-dgtp and calcium
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
581
structure length
581
Chain Sequence
GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
total genus 208
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsiA01
4F4KA 1EETA 7ICSA 2HHWA 4Y1DA 3PO4A 1HUOA 3CFOA 1NK0A 1JL1A 3RH4A 3RB4A 3PW7A 1X9MA 1XS9D 5DDYA 3HSTB 1JLFA 4FW1A 4E7JA 2VA2A 4FZXC 1WSHA 1BQNA 2B6AA 3ZT4A 2P6RA 1TV9A 4CEQA 4GLXA 2H5XA 5J2DA 5J0QA 4KV8A 3RMAA 1BL3A 4J9QA 4RQ3A 5J2PA 4B9VA 5DB7A 4RQ1A 3VQEA 3O3FA 1S0MA 3KLHA 2M9NA 5KFRA 1N5YA 3BQ1A 5T7BA 5KRTA 2ATQA 4NM2A 4YFKA 1T8EA 1QLNA 2X6NA 4DQRA 4FW2A 5C5JA 1XI1A 3MEEA 4F2RA 2GUIA 2PZSA 1SUQA 3IG1A 4B9MA 2WONA 4CJVA 4OKJA 3PR4A 4QZFA 5E41A 3LP3A 4I2CA 1VSEA 2HHSA 4O3OA 4M42A 4DTRA 4GW6A 8ICKA 5CYQA 4Q43A 3G10A 2UVWA 4NCGA 2HB5A 3ZDBA 1IG9A 3C5GA 2KTQA 4KHNA 1YTUA 1TKZA 3NGDA 3CFRA 3HW8A 1A5XA 7ICIA 3ISBA 3HXMA 4DSJA 4F3TA 3H7IA 2HVHA 3AA4A 3M9MB 2Z1HA 3ZT2A 4QAGA 4IBNA 1IXRA 2G8HA 4EZ6A 3L2QA 1QSSA 4QZGA 1X2IA 1O1WA 1KFSA 2HHVA 3GIIA 4YFUA 1BVSA 4E7LA 1XC9A 4BWJA 1LB2B 2A1JA 3ZSYA 4TURA 4Q44A 3KLGA 4FJHA 3LALA 4E1MA 1JMSA 4DF8A 4ELUA 3SUPA 1RPLA 2VANA 3VQ8A 4B9UA 4F3OA 2NUBA 4QZEA 4FZYA 5FRNA 1D8LA 1TKTA 3M8RA 2HHTA 1DOQA 4IDKA 3KHLA 4QOZB 3SV4A 3OYIA 4EBDA 1KVBA 5J2FA 4RQ8A 4B3OA 5J0OA 2BKEA 9ICXA 5BPCA 2BQUA 5IIKA 1B43A 4GXIA 3PW4A 4YXMA 9ICKA 1C0MA 1NJXA 3ETLA 4DFMA 1ZBIA 4I28A 1RYRA 2PFQA 4Z6FA 5HMMA 4NCBA 4DL7A 3V1OA 3RAQA 5DBBA 1RDDA 4FJJA 2R8GA 9ICSA 3L2RA 5J2NA 1DTTA 5IIJA 4KN4A 4Q8FA 1CLQA 4I9QA 3L2VA 4NCAA 4DL4A 4Z6EA 5C42A 4I2HA 3OYNA 1DTQA 4ECVA 2MUTB 1NJYA 5J2MA 5KFQA 3UQ2A 1ZYQA 3T1AA 3HP9A 5J2AA 5CA7A 4F5QA 2HHXA 5KTQA 5KFNA 2R8KA 5HLFA 1RZTA 5KFXA 4I9LA 4YR3A 3OYBA 1CZ9A 4RT3A 7ICEA 3EY1A 1C1AA 3UXPA 2AQ4A 4HTUA 3ISDA 3QNNA 5L9XA 2Q3SA 2IHMA 4HUEA 2OZMA 4DSKA 3NGYA 4RNNA 4QZAA 1JLAA 5EWFA 1NK7A 3AU2A 4KREA 3V6HA 4FBTA 2XC9A 2X78A 7ICGA 3ALYA 4Z4GA 4KLJA 4TUQA 1XSNA 4DQPA 3MDAA 1RT5A 1XU4A 3HYFA 3V7LA 3DM2A 1S97A 4PGQA 1U47A 3AVCA 2WOMA 3LAKA 4FO6A 3NF6A 2ITGA 2JEIA 1S1XA 3LZJA 2D5RA 9ICEA 4RPYA 4DLEA 1LAVA 3T19A 4RW8A 4KLLA 1HYZA 5CR0A 2FPKA 3ZDCA 1SZPA 4DS5A 4FYDA 3BQTA 3T5JA 1RXWA 2HHUA 1N6QA 4CJUA 2JLEA 1CXUA 1XHXA 3ULDA 4K8ZA 2G8IA 4BXOB 4ID1A 5KFWA 3EWAA 3ZDEA 3DLHA 1TK0A 1EXQA 1S9FA 4NLKA 3SPZA 5KFFA 3Q8PB 4DTMA 4CEOA 4J9SA 3GILA 4EYIB 2BCQA 1JIHA 5HHIA 2NRXA 1L3SA 4F4ZA 4N5SA 3SZ2A 4W5QA 4FCYA 1A77A 3IHQB 5DQGA 1JXBA 5KFPA 1NK6A 3SNNA 1KSPA 1C1BA 1MQ3A 3L3VA 3HK2A 3N97B 2YV0X 5KG6A 4M3XA 1VK0A 5J2QA 3TFRA 3VQCA 2BCVA 3DRRA 4IG3A 4Z6DA 8ICMA 4JUZA 2XO7A 2E4LA 3AO1A 3RMBA 1C6VA 3PMLA 3Q8SB 3TAPA 4KMUA 2PXIA 4QZCA 3RAXA 2W9CB 1S6PA 2BGWA 4J9OA 3CQ8A 1UOCA 2FMSA 3LP0A 5IINA 4DO9A 2DPIA 5KG4A 1UA1A 5D4BA 1JLGA 2LSNA 3MR3A 5FRMA 3SQ2A 4F5NA 3RBDA 1XHZA 1B9FA 1ZQHA 3IAYA 4TUPA 4DTSA 1MU2A 2W8KA 1IKYA 4AILC 2QK9A 1AROP 4RG8A 3CYMA 3NH2A 4FLTA 2ALZA 1BPBA 4CEZA 3MR6A 4QZDA 4UB2A 2AGOA 5KT2A 4CJWA 4AHTA 4QZIA 4W5TA 4KN7A 1U49A 5L1JA 3M8SA 5KFTA 5CHGA 4KLIA 5CY4A 9ICUA 1DGSA 4CJEA 7ICNA 5KFZA 3ZD8A 4FLWA 1BHLA 4ECZA 3LK9A 2JZBB 2XY7A 4MFCA 3CM5A 3SQ0A 4E7IA 4M9JA 3RMDA 3MXMA 2ZUDA 4R65A 3O4NA 3PW2A 2PFOA 4YD2A 3RB0A 5KFKA 4DL3A 4J9NA 2Z1JA 4LVSA 2FBXA 3H8JA 4KTWA 5KFIA 4M3WA 1LW2A 4XRHA 1SKRA 3OS1A 2YNHA 4KLGA 3AVAA 4CHQA 1KFTA 2NRWA 3WNHA 2C2DA 8ICEA 4I2QA 2FBVA 2Z1GA 1NOMA 4EBCA 3RJHA 3SPYA 3PX0A 1HMVA 5EOZA 1S1TA 3ZSWA 2FPLA 4DFPA 8ICZA 3NE6A 2YKMA 1LV5A 4YD1A 4YMNA 4KB0A 3RWUA 4ECWA 4NLZA 3AVBA 9ICVA 2BANA 3RR7A 4YVZA 5J2HA 2XY5A 4FJ9A 4ZTJA 3RH5A 1BPYA 2DFEA 1ZQUA 3QO9A 4CF8A 4W5NA 2I1QA 4PQUA 5KFHA 2XCAA 1U45A 4BE2A 3Q8KA 4MFAA 3JPNA 5KFJA 4NLGA 3PW5A 2DFHA 4RT2A 2BPGA 1UWBA 3BQ0A 9ICIA 4RPXA 3KLIA 4FJGA 4KHYA 4BE0A 3NHGA 2P6UA 4Z6CA 3OJUA 2F1IA 5DMRA 4G3IA 1A5WA 4PWDA 1J53A 3Q8QB 4FJ7A 7ICOA 3KHGA 3F73A 2X6SA 3GV7B 3VQ7A 3AA3A 2JEJA 1TK8A 1Z00A 4DOAA 4KO0A 4ECRA 2PI5A 1XO1A 4I2BA 3MXIA 4CJ3A 2HVIA 4I2JA 2UVUA 8ICLA 1VSKA 3AA5X 4JV1A 1KTQA 4UBBA 2E6LA 4FBUA 1S0OA 3KKRA 5HRNA 5L1IA 3SUNA 2BQ3A 4NYNA 4M3YA 1BI4A 4YMMA 3AVIA 3PO5A 9ICRA 3G6YA 4FJXA 3GV8B 4PHPA 3TI0A 1U48A 1T05A 1ZQJA 3OSPA 4O5BA 4Z4EA 4M9NA 4QCLA 4PHAA 4J2BA 2ASJA 5DG9A 4KLDA 1ZQGA 1WSGA 4F4XA 4EBEA 4KHWA 4DS4A 4O3SA 1ZQYA 5CWRA 3RTVA 4F2SA 3C94A 1ZQVA 1JX4A 1WSEA 1TAQA 3RJJA 4I27A 2W8LA 4IG0A 3VQ5A 4IQWA 1TVAA 1ZQRA 4YN4A 3OSNA 5L1LA 3AVFA 1PZNA 3PV8A 4DTUA 4CIFA 5HRSA 5KFCA 1Y97A 1IM4A 4I2FA 4O9MA 4P4OA 1Z25A 2OPQA 4RW4A 3QEPA 5BOLA 5KFLA 4P2HA 3OY9A 1K1QA 1RCHA 4ED1A 3KKSA 4LH4A 2ETJA 1KLMA 4B9TA 3K57A 4ED6A 5KI6A 4FJ8A 1C1CA 4CF9A 3LP1A 4M9GA 1BCOA 5HMLA 2HNDA 4Q45A 2V4RA 4FS1A 3RBEA 2QKBA 3UXNA 3T3FA 1RT1A 2ZE2A 4XQ8A 3TAMA 2KN7A 1NOYA 4BDPA 1VSDA 4O44A 3QERA 3WNFA 4DQSA 4LH5A 2VA3A 3D0PA 3T5KA 3F9KA 2D0AA 1JKHA 4O5CA 1NJZA 3QLHA 4R8UB 3AVHA 3GDXA 4N47A 3TAGA 4QZ9A 4M3TA 3RMCA 4RNMA 4UAWA 8ICWA 2W9MA 1SKSA 4R5PA 4QWAA 3UIQA 1KVCA 2AGPA 5KG1A 2IGIA 4CESA 4ED3A 3HX0A 2RDIA 4DFJA 1U04A 1NKBA 5HRPA 4ED0A 4IQTA 1ZQCA 2ZD1A 4NYFA 5CZ1A 2F1JA 4J9PA 1HQUA 8ICUA 3DOLA 1RDAA 3SUQA 4YCXA 2BDPA 1RYSA 4CJ5A 2C2EA 5KFMA 2RN2A 3MR2A 4M45A 4CHZA 5KG3A 3V6KA 4CECA 4DFKA 4IFYA 3B0YA 1QSLA 4OPKA 4FZZA 4CF2A 4KLEA 2BPCA 1ZBFA 1TAUA 2P51A 1WAFA 4FJNA 3BGRA 5DGBA 1VSJA 1BPXA 4YNQA 4ED8A 3H08A 1ZQSA 5DB8A 4B9NA 3OGUA 4M2YA 1IH7A 3V6JA 3AVJA 3FYHA 1Q9YA 4FJIA 3QINA 3LZIA 1WSJA 3C95A 1WN7A 4NY8A 3V81A 4NM1A 4TQSA 1J9AA 4CHYA 1RT3A 4KKOA 3HPGA 5D46A 5HHHA 8ICTA 1HYVA 1RT4A 3MFIA 3LPUA 2VA8A 4FLXA 2RPIA 3AVGA 4PH5A 4M47A 1RBUA 3K75D 4FJKA 5KFOA 1B9DA 3DLGA 2GV9A 3ZSQA 3PX4A 4QW9A 2ISOA 1HJPA 3VQ9A 3MXJA 5F9LA 5KFEA 2J6SA 3V72A 3B6PA 3ZT0A 4B9LA 4K8XA 1SL2A 1C0UA 2PYJA 1I39A 1RTDA 3V9XA 4QZBA 3IM1A 1HNVA 2D0BA 1S1UA 3M8QA 3MR5A 3QEAZ 5KGXA 5J0TA 1F21A 3B0XA 1RDCA 4UQGA 3KK1A 4O55A 4ECYA 4M9HA 3L2WA 1ZQBA 2X74A 1YVUA 1ZQFA 2ISPA 1WAJA 7ICPA 3DLEA 1WCNA 4UB1A 2VG7A 1BPDA 3OYDA 2AQ0A 2ZUCA 2BE2A 3JPQA 3G6VA 5HP4A 1MSWD 4XIUA 3MABA 1VRUA 3KTQA 3V9UA 9ICFA 1UT8A 4KLHA 5SWMA 3ITHA 2IMWP 3G0ZA 2AJQA 2IAJA 5I3UA 1CUKA 2FC0A 4RW7A 4IR9A 4X5VA 4BWMA 3LP2A 8ICNA 4M3ZA 1SV5A 4OJRA 5J2KA 2KZZA 4EP5A 5DLFA 3N4MB 4KHSA 4JV2A 1Q8IA 1FK9A 2UVVA 5DQHA 5KRSA 5DLGA 2HNYA 4EEYA 4CJPA 3ZT1A 4O0JA 2HHQA 1YTAA 4PUOA 4DU3A 3OYFA 4G1QA 4RQ7A 2B21A 8ICSA 3E01A 1I3AA 3JPRA 4CJSA 1BI4B 1CXQA 4J2AA 4C8NA 2R8HA 4I2EA 1S9EA 4YP3A 3ISNC 2KZ3A 5KG7A 4FVMA 4YQWA 5J0WA 4RQ2A 1TKXA 3KHRA 3PMNA 1H38A 5JS2A 3OYHA 2BPFA 4RUCA 3SV3A 3JPOA 2BGGA 4O3QA 2YNIA 3U3GA 1IKWA 4PPXA 3JYTA 3ZT3A 2AU0A 3PX6A 4M04A 1QE1A 3KK2A 3S3NA 1RDBA 5J29A 5J2BA 4J9RA 3OYAA 3A2FA 2F96A 1S0VA 5KFUA 3SI8A 5KT7A 4GC7A 3K5MA 3I8DA 4KFBA 3LWMA 4H4OA 4QWDA 1LAWA 4LY7A 1ZQLA 9ICLA 4M0AA 2NRTA 2UVRA 4E0DA 4CF1A 4J2EA 4RQ5A 3C5FA 1JN3A 4CFDA 2KW4A 4CEAA 1JXEA 7ICUA 3VQPA 3AVLA 4JRPA 3V4IA 3SQ1A 3OYMA 1BQMA 9ICTA 4JRQA 4RQ6A 3NBPA 4KHUA 4J9KA 3HO1A 4N41A 4M9LA 4CE9A 4PHEA 3TANA 4RW9A 3ZDDA 3QIOA 3VA0A 4UAZA 3P83D 4TQRA 4Z0UA 5CP2A 2Y1JA 3PVXA 4IFVA 1RNHA 3NTUA 4KLFA 3GFKB 5DBCA 4M41A 1UT5A 1A76A 1RT7A 5HNKA 2FMQA 1KVAA 4L8RB 3EPIA 4IQVA 4EZ9A 4FLVA 4MFFA 3HVRA 5IILA 2IC3A 2F8TA 1J54A 1KFDA 3C6TA 1N56A 2HW3A 3HPHA 4HCCA 4DQQA 5KT3A 1VSIA 4BGDA 4RPZA 3GIMA 7ICFA 4RUAA 2BHNA 2OPRA 7ICRA 1HJRA 4OVLA 4KB1A 3MGHA 3KIOA 3ORYA 3AO3A 1S0NA 4F92B 4Z4IA 3ZSOA 4ELVA 3MEDA 4JK1A 1W9HA 2GBZA 5DKWA 4R64A 5KT5A 3TABA 3RB3A 2ZTDA 2MUTA 1WSIA 2XY8A 4HVJA 3QETA 1TK5A 1RT2A 1RBSA 2MAXA 1LW0A 5KFGA 4KITB 1SL1A 2A1JB 2A1RA 1RBRA 3RJIA 1RT6A 1C7YA 4MEYA 1HNIA 2FPMA 1VSFA 3K5NA 2OWOA 1L3TA 3SYZA 1D8YA 4B8AB 4H8KA 4O5EA 4DL6A 4QWBA 1X9WA 4CJ4A 3OJSA 5SZTA 4TUSA 1YT3A 3LDSA 4B08A 3JSMA 4OPJA 1R0AA 1LWFA 2OYQA 3AO5A 5J0YA 3HWTA 3OVNA 4Z4FA 3L3UA 3SI6A 1HPZA 4M3RA 3QNOA 5F9NA 3SCXA 3EZ5A 4CIGA 2ASLA 1JLBA 1ZBHA 4E1NA 1KDHA 4GC6A 1NJWA 3C23A 4O3PA 3ZCMA 2P1JA 3QIPA 2ZTEA 3C2LA 2KZMA 3NF8A 3G6XA 2XHBA 2JEGA 3QESA 3TFSA 4CJTA 3DMJA 8ICXA 2W9AA 4DEZA 4ID5A 3SJJA 1QHTA 4WE1A 4CFCA 4CIEA 4CHNA 5DQIA 1ZJMA 3QEWA 3TARA 3PR5B 3CM6A 1XSPA 3K4GA 4OGEA 2JEFA 2PI4A 1QQCA 4Z4HA 2ZJAA 4DSLA 1DLOA 1ZQEA 3P1GA 4CJRA 3V9WA 3TWHA 4CJKA 4R66A 4BXOA 5TZVA 4FLZA 1ZQQA 4CFBA 2LYHA 1TL1A 3KHHA 2B5JA 4DOBA 4DOCA 4PGXA 1B92A 3S3OA 2P5GA 2W42A 2R8JA 1IKXA 1Y88A 1D9DA 4F8RA 3I0SA 2W9BA 2DTUA 1HRHA 2HMIA 1S76D 5DG7A 5KG0A 5KFSA 1GOBA 4I29A 3C21A 5I42A 4C8OA 1J5OA 5DB6A 1IKVA 5J0SA 1W0HA 3P5JA 5CB1A 1QSYA 1BIUA 4CERA 4KLQA 1ZQXA 3KD5E 2BR0A 5J2CA 1FKPA 1JLQA 3O3HA 3VA3A 3NCIA 3RJEA 4N56A 4M6WA 2R7YA 2W9CA 1KEJA 4LZDA 3OYKA 4DF4A 1ZQDA 2QKKA 3QEBZ 1EKEA 4I2PA 1U9LA 2R8IA 3KLFA 3PUFA 4IRDA 3NGIA 3ZDAA 4HHTA 2AGQA 1LWCA 4PHDA 2C28A 3AVNA 3BJYA 2RF2A 1EP4A 1Z3EB 3H4BA 4NLNA 1KCFA 1RBTA 4O0IA 4ECSA 3V7JA 4Q0BA 2ZTCA 4B9SA 2OZSA 1TV6A 1NK5A 4ICLA 4DTNA 2ZUBA 4LD0A 4CHPA 4YR2A 3B6OA 4AHUA 3QEIA 3LPTA 3NFAA 1GOCA 8ICAA 3QEVA 2IA6A 3RB6A 4E7KA 2BQRA 3AU6A 4OKEA 3S9HA 3O3GA 4IRCA 9ICHA 4W5OA 4TSXA 4LSNA 1NKEA 2J6UA 4KLOA 5J0PA 5KFVA 2YKNA 3PW0A 4DU1A 4YXJA 3DI6A 1S77D 4DL2A 1NK8A 3Q8LA 1LWEA 5CJ7A 3V1RA 4CGIA 7ICMA 1UAXA 4UB3A 1ASVA 4KLSA 2BCSA 3AVMA 4JLHA 3HT3A 2VWKA 4CGGA 1GOAA 3HL8A 9ICQA 4PGYA 4AHRA 4O5KA 1VSHA 2JZBA 4ECTA 3NAEA 2IBKA 1ITGA 3AUOA 1D9FA 1ZQZA 1TL3A 4I2GA 1RTJA 1Q9XA 7ICHA 4LSLA 4GXJA 1BISA 3AVKA 1RBVA 2FLLA 2OA8A 3LAMA 1EXNA 1Z26A 5HROA 1TGOA 5KFBA 4CGJA 4FLYA 7ICTA 1ZQOA 4CHOA 3KJVA 2A1SA 5D49A 4ECXA 9ICMA 4P4MA 2RKIA 5KGWA 5J0UA 1JL2A 3OYEA 1ZETA 9ICWA 3EYZA 3MBYA 1HQEA 3TAEA 2DY4A 1ZQTA 4Q8EA 1K6YA 4CEFA 7ICVA 4BDZA 3GQCA 1D5AA 4PY5A 3PNCA 3IS9A 3K59A 1L3VA 2C22A 2YHAA 1X9SA 1SKWA 4DTJA 2D0CA 3KLEA 3VN5A 3DLBA 1N48A 1KLNA 1B22A 8ICOA 3JPPA 2DFLA 4FLUA 4GMJB 4QWEA 3NGZA 1TKDA 3C6UA 3CG7A 2Y1IA 4DG1A 4KPYA 3HVTA 1TVRA 1RXVA 4UAYA 1WNSA 2G8WA 4CEDA 4DU4A 2JGUA 1HUZA 4K4GA 4JS5A 4FK4A 3EPGA 3NH1A 3HPOA 1L5UA 2ZJ5A 1QTMA 4RQ0A 4ZH4A 1S5JA 1VSLA 3LANA 9ICBA 3H40A 4EYHB 5L1KA 2BCRA 9ICCA 1ASUA 5KG2A 4LZGA 4F5RA 2XRIA 2I9GA 3L2UA 4Y1CA 1MQ2A 2F8SA 3EW9A 3D45A 4MFBA 4W5RA 1WCLA 3TAFA 4FJLA 2FBTA 5DG8A 4EP4A 2E6MA 4CJLA 3MECA 1REVA 3TAQA 2NRZA 3ZSRA 4DLGA 9ICPA 4C8MA 2IOCA 8ICQA 4K4HA 2IHNA 9ICJA 3VQDA 4BACA 4OLBA 4O3NA 1T4GA 2PY5A 2QXFA 4MF8A 3PY8A 3CFPA 3MDCA 4FM2A 7ICJA 4CGHA 4RZRA 8ICCA 5J2EA 1COOA 1V9PA 1RTIA 5KG5A 4DWIA 5BOMA 4ELTA 2HNZA 3OYCA 5FROA 1G15A 1S9GA 1S6QA 3OYGA 4F5PA 3TQ1A 4GXKA 1MC8A 3LDAA 1CEZA 1VSMA 1SL0A 4Z4CA 4F91B 3JPTA 2C2RA 3RJKA 4KLMA 2YNGA 3V1QA 3V6DA 4F5OA 1Z00B 8ICRA 3VQAA 3U6FA 3DLKA 1BPZA 3FFIA 4HCBA 5D3GA 4FS2A 2Z1IA 4H4MA 5HRRA 2EHGA 4JV0A 2V9WA 4OLAA 4R63A 1BGXT 4F4WA 1K1SA 1NK4A 4DTPA 5JS1A 4RU9A 4CJFA 4E89A 4JWNA 3VQQA 3LWLA 8ICGA 4ECUA 3DRPA 4M3UA 4YMOA 4O3RA 4IQUA 5DB9A 3MFHA 4GVMA 2I5JA 4RW6A 1TFRA 2KFZA 3OHBA 4YG2A 4IR1A 4F4YA 3L8BA 4DTOA 3Q8RB 5EWEA 2W9BB 4CFAA 4BDYA 4J2DA 5DK5A 5J2GA 4E7HA 9ICOA 3ASMA 5IIOA 4CCHA 4AHSA 7ICQA 1U4BA 4ZTFA 3H4DA 3TR8A 4R8UA 4KTZA 8ICHA 1EX4A 1S1WA 3U3YA 5J2IA 3AO4A 5KFAA 1S10A 4C8KA 3K5LA 3ISCA 1T03A 4CEEA 1JLEA 3OHAA 4ED7A 3ZSZA 2Q0ZX 5CYMA 3KK3A 3HP6A 3AO2A 4CK3A 4YR0A 2VG5A 4M6WB 4CK1A 5KT4A 3QE9Y 3E2EA 4OGCA 4AH9A 5KFYA 1ZBUA 4PA1A 2G8KA 3JPSA 5FDLA 2G8VA 2YNFA 3WNEA 2O4IA 1NK9A 8ICFA 7ICLA 2P5OA 5DDMA 1NOZA 3RH6A 8ICJA 2BCUA 8ICYA 3T5LA 4FJ5A 4XA5A 2IS3A 4CEBA 4E19A 2EX3A 3AA2A 4FM0A 4I2IA 4CF0A 3NF9A 3IRXA 3S3MA 4KTQA 1FKOA 5C25A 3DLRA 1RILA 2ZQBA 4MQ3A 1ZQKA 3MEGA 3SUOA 5KT6A 2XGQA 3ZSVA 1HYSA 3VQ4A 4HUFA 5DGAA 3GIJA 4RNOA 2XGPA 5IIIA 4MF2A 5KFDA 8ICPA 4CGDA 3UQ0A 5J0XA 3H8WA 4C8LA 7ICKA 1ZJNA 4HUGA 4CK2A 3I0RA 9ICNA 3THVA 3VQBA 3OS2A 3OS0A 1ZQWA 2ZJ8A 3K2PA 5J1EA 4BE1A 5J0RA 3VQ6A 3AV9A 4QWCA 3T5HA 4E3SA 4F50A 1XWLA 4FK2A 1JLCA 2DPJA 2PYLA 5DBAA 1ZQAA 1BPEA 4AHCA 9ICAA 2OPSA 2F1HA 2FLNA 3NH0A 3RR8A 3GV5B 4HYKA 3C2KA 1IO2A 4KI6A 3H8SA 2GWSA 4KLTA 3RJFA 4I2DA 1BIZA 1FXXA 3DRSA 4KAZA 5EU7A 4IKFA 3NDKA 2XY6A 3FDSA 1JXLA 2P66A 2XCPA 2B4JA 3DOKA 5C24A 4MEXA 4ED2A 9ICGA 4O4GA 4J9MA 2O4GA 1NKCA 4K4IA 2NRVA 8ICIA 3V9ZA 4JS4A 4DL5A 2FBYA 3QZ8A 4QZHA 5EWGA 4P4PA 3UPQA 2VWJA 2OPPA 4N76A 4DTXA 3BQ2A 4NXZA 3C1YA 8ICBA 3ZSXA 1CZBA 4XUSA 4FJMA 2IDOA 4AHVA 2ATLA 4J9LA 5IIMA 4DSFA 3HM9A 4QZ8A 1VRTA 4OKKA 4I2AA 4KRFA 3NF7A 4DMNA 3K58A 4UB5A 5K14A 2VG6A 3C1ZA 2V4QA 3HJFA 3M9NB 4F93B 3O4QA 4JWMA 3KD1E 2KFNA 3SQ4A 1KRPA 4ECQA 2PFPA 3BDPA 4KLUA 4KI4A 3QEXA 4UBCA 2WTFA 2YHBA 4FM1A 4I7FA 4FXDA 4DSIA 5JUMA 3MAQA 3UXOA 4Q5VA 1WSFA 1UA0A 1ZQMA 3DYAA 2PFNA 1ZQPA 4FK0A 3ZD9A 4UB4A 3RRHA 2FLPA 1XSLA 2DFFA 3K5OA 1T3NA 1ASWA 3MGIA 1ZQNA 2G8FA 1A5VA 1ZBLA 2RDJA 3M9OB 4B8CA 3C2MA 4ZHRA 3Q8MA 5CZ2A 1QS4A 1L3UA 1BCMA 1C0TA 3M8PA 1RTHA 2FMPA 8ICVA 5J2JA 1S1VA 5HBMA 3V9SA 3GIKA 4CGFA 4DSEA 5HP1A 3OYJA 4DQIA 4CJQA 4RQ4A 3RJGA 4QW8A 3WNGA 3QZ7A 3RRGA 1WLJA 4KHQA 3V7KA 2ASDA 2G8UA 1T7PA 2J6TA 1X1PA 4IRKA 1ZQIA 2KQ2A 3OYLA
chains in the Genus database with same CATH superfamily
3THWA 4RW7B 1TMMA 4Y1DA 1HUOA 2I6XA 1S6QB 1NK0A 3H2UB 1JL1A 2OCEA 2J7WA 1AW0A 4JI3K 1Z2ZA 3Q22A 1JLFA 1CLFA 4E7JA 3DXKA 2VPXB 3IDHA 3ZEUA 4WKRA 1R6YA 2B6AA 4IZ9A 4CEQA 3DDIA 2UUCK 2U2FA 5GMDA 2BACA 2EKNA 1VQ4N 1UCVA 5E3CA 4PG7A 4Y3CA 4J9QA 3HHLB 4RQ1A 1XMOJ 3O3FA 1FJEB 1ED1A 2HEKA 4K41A 2M9NA 5KFRA 3PJWA 5AK6A 3WDOA 2ZWPA 5T7BA 1FFGB 2EXUA 2P9SB 4R25A 2CQ0A 2ATQA 4NM2A 4JD2B 4YFKA 2DNRA 1QLNA 4FW2A 1NU0A 5C5JA 3ZETA 1KQQA 2ZUGA 1H6KX 2EVZA 2YNIB 2PZSA 3RG6A 2YBVA 2XMVA 2Y9HA 3R9PA 4WFAL 1VQ7S 4B9MA 2WONA 2RAQA 1Q79A 1Q53A 4WFZA 4OKJA 2RJZA 4QZFA 3FZ2A 4BRDA 5E41A 1DGKN 4ILMA 3W0LA 3HFZB 4Z7YA 2P9NB 8ICKA 2WB4A 4LF2A 4H4OB 3G71S 4Q43A 3BB5A 4LF5K 1T44A 2NS1B 3N6LA 2EWHA 4JKGA 1Z19A 1XBWA 4EENA 1OY6A 1HNWF 3OLBA 4Y0WA 1YTUA 2PT0A 4KX3A 1DQ9A 2LP4A 3OL9A 3CFRA 3MCSA 1VQMS 3TNVA 1LNQA 3ZZYA 4DSJA 4YOWA 4HVZA 1WOSA 4IBNA 4EZ6A 2D74B 2Y0SF 1X2IA 1KFSA 2HHVA 2MJNA 4RW9B 3A8IA 4X4NA 1FW6A 4TURA 4HHJA 5HL7Q 1TMJA 4FJHA 3LALA 2HIYA 3N28A 3QRRA 2XHWA 1RT7B 4F3OA 2WSEC 2HURA 1GLLO 2NUBA 3TQEA 2XYHB 3M8RA 2F9WA 5LY3A 3V5RA 5JMVA 2ZITA 3QBCA 5ETSA 1E4GT 3EN9A 4RL1A 2F4VF 3MM6B 2D8CA 1UEKA 3AQPA 3UKRB 5B08A 2E2OA 1HHSA 1VQSA 4B3SJ 4UY85 3PW4A 2DH7A 1TFWA 4YXMA 4JK8A 9ICKA 2P6TA 3I4HX 1NJXA 3VF2A 5ALIA 3ETLA 4U67Q 4I28A 4DL7A 3V1OA 3RAQA 4YOVA 1SV0A 2R8GA 9ICSA 2YB1A 5J2NA 2DNMA 3MEDB 5IIJA 3NVVA 4KN4A 2VL1A 1M5PC 3CNQP 1FD8A 5B0GA 3M6WA 4ECVA 1X42A 1GX5A 3NS1A 4RWXA 3UQ2A 1FRLA 1RT2B 3T1AA 3HP9A 3SBGA 5J2AA 3R6MA 2OD6A 4MH8A 4Z2XA 2VIHA 3ID8A 4I9LA 2NYVA 2EFOA 3BS7A 5H9FJ 7ICEA 1F5AA 2V69A 4JI4J 4FKYA 5L9XA 4U7UD 2W40A 4LFAK 4DV0J 4LFCF 2E1ZA 2OZMA 2VJ5A 5JVGL 2GVDB 3VEYA 1I94J 5LOQA 4QZAA 2DB1A 2HFVA 4KGXB 1QDUB 3QMQA 2J5AA 4C23A 1L7PA 4MMOA 4KT0C 1YJUA 1HPZB 2NXEA 3PSFA 5EXWA 4JI0F 1XSNA 5E7OB 2QC3A 5E3PA 2IM0A 1E6YA 5AKKA 1UVKA 3D6JA 1XU4A 3HYFA 3CQXA 3GB0A 4P7TA 3DXMB 2LQ8A 5U47A 3AQEA 3SSSA 2ITGA 4OI3A 2JEIA 2ZM6K 3AQFA 2D5RA 4FKXA 3THTA 3W60A 5TKWA 4WP8A 4RW8A 5CR0A 4LJXA 3ZDCA 1SZPA 3UO0A 4ZP8A 2D3O1 1HQ2A 1NGIA 1MN9A 4FYDA 5E26A 2GJ2A 2EC2A 2Y1RI 4OJ5A 5BJRA 3T5JA 1DLOB 4ZJQA 2R7WA 2CPJA 5HK4A 4WCEQ 2JLEA 4A8OA 1F60B 3S6EA 4LF8J 2HOFA 1TK0A 4RCHA 1UVMA 3D2EA 5KFFA 4AE5A 4EYIB 2I0XA 2BCQA 2NRXA 4F4ZA 1A77A 3IHQB 4X4TA 1JXBA 3JS9A 4ZA1A 1BG3A 1HBMA 3EVMA 1U1LA 3U1LA 5AQHA 3D7EO 3L3VA 2VWBA 3I5AA 2YMMA 3HK2A 3MCMA 2YWFA 5KG6A 2YV0X 3N5FA 3I4PA 2VJUA 5J2QA 2BDUA 3TFRA 3ET6B 1MLAA 4IG3A 3ZI4A 3CDAA 4Z6DA 1FRKA 3RMBA 3Q8SB 2OLWA 4C7QA 1GLJO 2PXIA 2W9CB 1MWMA 1Q7YO 4YB5A 3BZCA 2E29A 3BKFA 3CQ8A 4PCQA 1WI8A 4LSZB 2FJ6A 2FMSA 1UOCA 2FD2A 1RDRA 1ZA1B 3Q2TC 1YBUA 4KSEB 2KJWA 1UA1A 2XSJB 4HACA 2PO4A 4NMXA 2NRRA 1H7WA 1Z1ZA 1RAHB 1KVJA 2W4DA 1MU2A 4OX6A 3OXGA 2IRYA 5LSLA 3JAMO 3W63A 2K8GA 4ICLB 3MM9B 2FVSA 2WB1C 4LF6K 2ALZA 1RACB 1U1RA 3GFYA 5AKXA 4UB2A 4X65K 3FBBA 4DXLA 4CJWA 2IVYA 4QZIA 4KN7A 3MEKA 1WC0A 1KBUA 9ICUA 2G1HA 2W55A 3P96A 5LMNF 5HL7L 4X4PA 5JMNA 5IC4B 4HI1A 2UV8G 4ECZA 1S5ZA 2JZBB 2BVZA 2C2ZB 3SLCA 2KV2A 3CM5A 1RTJB 2ZUDA 4R65A 4LSLB 5HAOA 2RNEA 3IMXA 2HVEA 2CDRB 2FSKA 3RB0A 5KFKA 4DL3A 4M7XA 2DVIA 4LVSA 2LDIA 3SDEB 5HROB 2PMZF 5KFIA 5M2PA 2JGAA 3ALRA 4XRHA 3TWZA 3OS1A 4KLGA 3AVAA 2ZNYA 5HVGA 4U67L 5AQZA 1KFTA 3T6JA 4USHA 8ICEA 2DXEA 4I2QA 1EJ7L 3CCUN 3PX0A 1QTNB 5IT4A 4YMNA 2R7TA 4J37A 3RYLA 1YG0A 2BANA 2WRMA 2FIUA 4BC3A 1WEXA 4FJ9A 4Z7CA 1UPHA 3QO9A 1K73O 1TUVA 3MGVA 4DR1F 4PQUA 2Y8WA 3V4MA 2XCAA 4I64A 3Q8KA 3PEHA 4MFAA 1KVKA 3PLAA 1YX2A 5AJ3F 2XB2D 3CPWR 3C6UB 4DG1B 2KE7A 9ICIA 1V5IB 3HVTB 3KLVA 3KLIA 1F5CA 4KHYA 2HQIA 1HBNA 2P6UA 4Z6CA 4UY8O 1ZPVA 4XDDA 4IJAA 4M5KA 7ICOA 3KHGA 3BSNA 3F73A 4RPFA 2X6SA 1F2HA 4QPTA 3G6ES 4K7QA 3TUPA 3HHLD 4FF3A 2QA2A 4JKDA 4IWVA 1K8KB 1LCUA 1XO1A 4CP5A 2R2SA 2HVIA 2ZZMA 3AEVA 2UVUA 4WFXA 4LQ3A 1VSKA 4LBIA 2X1GA 4UBBA 4R0JA 5F41A 5B0CA 5HRNA 3F5TA 2CA9A 2A42A 4Y2SA 4OV6A 3ZTOA 5B0FA 3G82B 4Q2LA 3CD5A 1NGDA 1XQIA 1VQ9N 2MKYA 3AVIA 4C97A 1RKIA 3DFEA 4EMDA 3ULEB 1N32K 1NSKL 3GYGA 2BZ2A 1G1XA 1P6TA 1V5VA 4M8LA 1T05A 2BH1A 4O5BA 4Z4EA 1GH8A 4M9NA 4WCEL 1Q1KA 1UWAA 5DG9A 3BR8A 3MWBA 2EAOA 1ZQGA 4WU2A 4MO5A 1WSGA 1QQ5A 3VF6A 1YHQS 3ZFVA 3NXZA 2QIFA 5CWRA 5A6PA 3MM7A 4X64J 5HI7A 3RJJA 1TUGB 4FN5A 3V6DB 4IG0A 2DF4B 1KWMA 3VQ5A 2CVEA 1U0SA 1K8AO 5M2RA 5L1LA 2QJ3A 3KDNA 1PZNA 3PV8A 2Z56B 5AE3A 1Y97A 1IM4A 1UKUA 4ATNA 3LUYA 3ZC4A 4P4OA 4DV4J 3OBWA 3DCAA 1Z25A 1Z4NA 2VV5A 4QIEA 3M6UA 5KFLA 1K1QA 1M1KT 1RCHA 3KKSA 3GG0A 4H0XB 1KQKA 3K57A 3HDSA 4USMA 2OUGA 3NMRA 2VQEK 1B70B 3K1ZA 2EAPA 2QMWA 3BN7A 4RW6B 3WKDA 3UXNA 3TSUA 2ZE2A 1VQ7N 4XQ8A 4HHHA 2H3EB 4AXIA 4K2XA 4ZCLA 1HKCA 2CQCA 3D0PA 3MAAA 4DR2J 1X6IA 4ES3A 2UUAF 2WCXA 4R8UB 1RZMA 4BG9A 1RE1B 1S1WB 3G71N 2NSCA 2KXFA 4DUYJ 2XI9A 4CWBA 4M3TA 3KWIA 4RNMA 3CCQS 4UAWA 3IMQJ 3LVWA 2EQYA 1C0GA 1UPPA 1JLEB 1NZAA 1KVCA 2AGPA 3WHIA 1VQMN 5KG1A 3JTNA 2RDIA 1U04A 4FPBA 4ED0A 2PE8A 4NXMK 1JJHA 4GKJK 8ICUA 4F02A 2ZZTA 3IGVA 1RYSA 4CJ5A 4Y0FA 2RN2A 2YNFB 1ZA2B 3H42A 1YXQA 4CHZA 4AL6A 3PM9A 2BA9A 4L3QA 1RCOB 3SCJE 4WQ5C 4ZCMA 1YZ6A 4CECA 1Z6RA 4WKYA 3SQIA 2H5JB 1R0BG 3GJTB 4JI1J 2GCFA 4OJPA 2R4FA 3AFGA 3BEXA 3WBZA 3VGTA 2P51A 1TYQB 1HWKA 5CXTA 4K59A 3MPVA 1FKOB 5C25B 4YNQA 2VHGA 3MGJA 3IG8A 4ZP6A 3QRPA 4WTYA 4RX6A 4M5NA 1QZ6A 3IC1A 1I6JA 1IH7A 3V6JA 2CJKA 5IZHA 3ZTPA 1Q9YA 3H5YA 2P9KB 5AKIA 4HH0A 2QRRA 4G65A 3C95A 4DCCA 2RU9A 4NM1A 1FNXH 2YMLA 4CHYA 3HPGA 2M52A 5HHHA 1RT4A 3NAHA 2UXBK 2VA8A 2YCHA 1VHIA 3MPDA 2HBQB 2KT3A 4ZLNA 2A3VA 4QW9A 2ISOA 2O66A 4IOAQ 3K0SA 3C29A 2F8KA 5E3AA 2OPSB 4B9LA 3HSJA 1XK8A 3DHWC 2E1MC 1RFQA 2ASOA 1OQ6A 4UOHA 1CJKA 3EZOA 2G0CA 1JQGA 2CJAA 3M8QA 3CHWA 3MR5A 1JRPA 1SIZA 4BREA 3QEAZ 5KGXA 1P90A 2CQ4A 5C24B 3B0XA 1URJA 3T1YJ 2J76E 3NY0A 4ZK7M 2QLBB 2K4IA 4JKHA 2G4BA 3CCZA 1ZQBA 3PJXA 2VD3A 5IXUA 2AYMA 1WAJA 4LF7K 2VG7A 3OTDA 1MA7A 2BE2A 1XMQF 1DEJA 3DEEA 4FWLA 2BEFA 2K7JA 4B9QA 4XIUA 3KTQA 1NNLA 5SWMA 2IMWP 2A2CA 3NMAA 3G0ZA 2IAJA 2AP1A 3CT9A 2FC0A 1NJIO 3D6MB 3MCNA 4UB8U 2ESEA 5ALXA 1RWPB 4I7FB 4U96A 2G06A 1SV5A 2LHTA 2MB0B 1RK8A 1F2GA 3QAUA 1HNZK 4KO0B 1ITPA 1QQNA 4JV2A 1WD6A 1Q8IA 3AH6A 5DQHA 5DLGA 2HNYA 3T9ZA 2GAGC 1HWJA 3KUHA 4O0JA 2HHQA 4PUOA 4ZHRB 2IHR1 1YTAA 2DPNA 4G1QA 1X4BA 2B21A 2WB1D 1SH3A 4CJSA 2JR5A 3CCTA 5AM1A 5EX0A 3FVYA 2QA4S 2EI5A 1CXQA 3FMWA 4J2AA 2ZIXB 3ISNC 4OIXA 3QFUA 2QB0B 4FVMA 5HBMB 2KHCA 1YDLA 2YKPA 1TKXA 5JS2A 3SMSA 4RUCA 3SV3A 2L08A 1NM2A 3DHXA 4C6AA 2A5XA 2YPZA 3L09A 2BGGA 4DFDA 2ADBA 2CJYB 2AU0A 1DARA 3JAMY 1T94A 5D8HB 3THWB 1PKUA 3G8QA 4JI8K 4H03B 1RDBA 1KN6A 4OPAA 5DZ7A 4HDGA 5HR7A 3A2FA 2E3TA 3GONA 3ZXWA 4K4XA 1JLFB 4QWDA 3M2RA 2NNWA 1WBDA 1Q16B 3DXKB 3M5RA 3ZEUB 2B6AB 2NRTA 1HI0P 1TE2A 4DR3F 1ZRMA 8ATCB 3H6EA 2AYBA 2GHWA 5EGYA 1NMDA 3SQ1A 2ILZA 4JRQA 2W03A 4N41A 4M9LA 2B3TB 3TANA 4BRAA 1ZBTA 3QIOA 4NXNK 3KFWX 4DV6F 5CP2A 2Y1JA 4IFVA 3BYPA 3L95X 2XMAA 1RAAB 3ZETB 4GV6A 1M6YA 1A76A 4IQVA 2WONB 3HVRA 2YHXA 1VQYA 2E8NA 3BH7B 3D1OA 1UVJA 4XH5A 1SB3C 5G5GA 4X2BA 1UZDA 5BYQA 1Q18A 2FGOA 1TQLA 1VSIA 4ILHA 4RPZA 4OYMA 3AGKA 3UNYA 2QWQA 2KIWA 4JB3A 4KB1A 2E8AA 2IDEA 4JKGB 1XUPO 2ZHOA 3WK9A 2DGVA 2KD1A 1NGEA 5ETNA 3ZSOA 2GBZA 4J9UE 3QBWA 2KB2A 2ROGA 1KD1O 3RB3A 4HT5A 1WSIA 2E2PA 2AJ4A 2XY8A 3QETA 4GV3A 4X66J 4NPOA 1RBSA 4C7YA 1LW0A 5ADZA 3ILJA 4CM0A 2A1RA 1RBRA 2RUGA 1RT6A 2DEJA 3N4WA 3U9ZA 3VETA 4GRSA 4OYPA 1T11A 5J1PA 1VSFA 1FX2A 1NSQA 4CLKA 3R5GA 1IWAA 4IOAL 3SCKE 4GVEA 1L3TA 3SYZA 1FFSB 4LFBJ 4O5EA 2HGMA 4BBYA 3IXQA 3BYRA 5SZTA 2E5LK 2M7SA 3LDSA 2OEMA 3JSMA 4OPJA 2UUWA 3AO5A 3OL8A 3HWTA 1IG6A 1IQTA 3L3UA 3QNOA 4LMZA 5AI4A 3EZ5A 2JLFA 5K8PA 1NJWA 3UW1A 1UMJA 1SI9A 2YWHA 3KKAC 1RP5A 2MHNA 1T9VA 4UZBA 3BO4A 1G99A 5H9EJ 2ZF5O 2ZTEA 4OO1J 5J2NB 3KOAA 3QESA 2X1AA 5IM0A 2QEXS 1DJ0A 2W9AA 4ID5A 4LRAA 1X7VA 4EFAC 4WE1A 3FCWA 4CFCA 4CIEA 2IVFB 1RAIB 3TARA 2DTJA 4KC5A 1X9JA 1RQLA 3K4GA 1XSPA 2KP7A 1KXPA 4DV3F 1XQSC 2PI4A 2YPYA 2MQMA 2ZJAA 1KR4A 4UAUA 3D3BJ 4UUXA 4B3RK 1Q5YA 2ZBQA 5GAGU 2EFPA 4QR0A 2BJ3A 4PJ0U 3PJ9A 4CFBA 2XZDB 3L5KA 4RKUC 2K4EA 1TL1A 4HH1A 3GR1A 1PK1B 1ATNA 5E33A 4DPWA 2UUBF 2FPHX 2Z58B 5KAIU 3JAMU 3GIRA 3OTOJ 1IKXA 4Y2MA 2E5JA 2D3UA 3R1HA 2DHSA 2HMIA 2EKYA 5LXRA 1Q86O 1VQNS 4DUZJ 1E6YB 2KHDA 1X3NA 3J7ZT 3LM2A 5ALGA 1X40A 5JJBA 1J5OA 1F0XA 1ELOA 1A7GE 2ZVSA 1RDWX 4YHHF 1FO4A 1IBKF 1W0HA 2DNLA 2MA1A 4A8QA 1J2VA 2J0QD 1NBWA 3ETMA 3BGUA 2CDQA 4AYBC 1FKPA 3GOIA 2Q36A 1J2MA 3CO9A 4RW8B 4M6WA 1RBLA 4DF4A 1UJ5A 1KQFB 4BQLA 5K8MA 3FKBA 2RQ4A 2AX0A 2FF6A 3PUFA 1X5PA 1HJOA 4HHTA 3H20A 3QGGA 2FDRA 5JXSA 1LWCA 4PHDA 2M3DA 1VQLS 2RF2A 1EP4A 1RBTA 3D2EB 2EC0A 3QFHA 3HULA 3CMQA 2D1CA 2UXDF 4USAA 4Q0BA 3D1HA 1TV6A 4ISFA 4LRCA 1QUVA 5ALOA 1QUPA 2RHQB 4ZPTR 3AARA 4DTNA 2MZTA 3NFAA 8ICAA 1HBMB 2LDYA 3FMBA 1YJRA 5JLFA 3S9HA 4MKAA 1PJ5A 4G1IA 3CCQN 5IV3A 4LSNA 2GMHA 2PSZA 1NKEA 2J6UA 2YKNA 3FQKA 2HI0A 4E1JA 2W11A 3Q8LA 3V1RA 4OV1A 5J2QB 4UB3A 1ASVA 1FE0A 4KLSA 2P9CA 4IG3B 3AVMA 2VWKA 3DJCA 1GOAA 2WSFC 1OO0B 2CADA 4AHRA 5M1NA 1RWNB 3PYFA 2XMWA 3ETRA 2IBKA 2G5IB 5C12A 1VQ6S 2ASYA 3NEKA 7ICHA 3AAPA 3M3ZA 4GXJA 1BISA 5KPZA 4Z94A 2ZG6A 4HACB 2OA8A 5LL6Z 2RS8A 5AI8A 1B0TA 2BJEA 1W7AA 1RU1A 4FLYA 1ZQOA 1MU2B 2A1SA 5D49A 4P4MA 1T6CA 2JC1A 3SAGA 2DO4A 1JL2A 3OYEA 1ZETA 3EYZA 2DIUA 1YGYA 4I56A 2QLXA 3TZWA 1U2FA 4IO8A 3VEWA 1HQEA 4MLEA 2DY4A 2AHOB 4BR0A 4YDXA 4BDZA 3GQCA 1D5AA 3TZZA 2UXCF 1MWKA 2KMDA 1ZZNA 3SCLE 1G6BA 4FZNA 1YJWS 2AMCB 3K59A 2C22A 1X9SA 3J80Y 4BRMA 3SAHA 5IWAJ 3DLBA 1QAXA 1FRXA 4OZ1A 3FBEA 3BSCA 3POTA 3QMLA 5I3PA 2OPRB 2RS2A 2MSTA 1WNSA 3UR3C 2G8WA 5IQQA 1HUZA 4K4GA 3QT7A 3A0IX 4CH0S 2MTLA 3MPUB 3DRYA 3EPGA 5EE0A 3NH1A 1JJCB 3LANA 9ICBA 3H40A 5ADXH 2PBDA 3ZX0A 4CZCA 2ZH1A 4NLYA 1EQMA 1T3QA 3L2UA 4ZP7A 1MQ2A 4BROA 1RLCL 4A5BA 4I2QB 4DN0A 4MFBA 2HBLA 4DR4J 3P4IA 4J9VA 3CULA 3TAFA 2FBTA 1Q8LA 5JVHQ 3MECA 2QLFB 1NDLA 4DLGA 1SH2A 4RNHA 1B0XA 3MXHP 1UW4A 2BOAA 2KG1A 1T9YA 2IHNA 2CGLA 2BANB 2QL5B 4BACA 4O3NA 4K42A 1VJWA 3QO9B 3GCXP 4DHYA 1N52B 4PQUB 4C4WA 7ICJA 2FXUA 3CCSS 4Y2YA 1COOA 4ANCA 2HWHA 4RUBA 4B3SK 5KG5A 1EX8A 4DWIA 4ZPDA 3AM9A 2PC6A 3KLIB 2KG5A 5DDPC 1HBNB 3MAHA 3OYGA 4EU0A 1RHRB 1CEZA 4Z4CA 4KLMA 2YNGA 3V1QA 4A59A 3RAMA 4U7CA 4PG8A 3DMJB 2HQ3A 2N4DA 5IS2A 3CJCA 2FY8A 3FFIA 4BHQA 2P6SA 1VLBA 4H4MA 2EHGA 4JV0A 3DKDA 5F1XA 1LEOA 4R63A 2RRBA 1IBLF 1BGXT 2KT5A 2QA4N 4JYAJ 5DM6L 4F4WA 3UR0A 4JI2J 2RLTA 4CJFA 4DR7J 3LWLA 1F1BB 2NPIA 4DBQA 4JI4K 4YMOA 1KNZA 2P2CB 2FSJA 5HATA 4OZ2A 2HHHJ 1ZD2P 2LVWA 2W6KA 4LR8A 4IR1A 1T05B 1EHWA 4USIA 4F4YA 2IPOB 3BBCA 3I0SB 4BDYA 4F25A 2GIFA 3CJ0A 3QSYB 9ICOA 2AJ0A 3H5SA 2QMUB 1NMNA 2WAQD 3A5MC 2YWEA 8ICHA 1X5TA 3MM7B 2KLAA 3ZZZA 4UF4A 4IUFA 4IG0B 3CMAS 2C3PA 1IQZA 3W5ZA 4RQMA 1QAYA 3IBPA 1EKRA 4NZ0A 3ZSZA 2B4VA 3SFGA 5CYMA 3A12A 2XICA 4IOCQ 1DAXA 4HHUA 5AQPA 3OBIA 1KN5A 2Y0SC 2G8KA 2RD5C 3WNEA 1XNQF 1VQ8S 4M63C 2P5OA 4Y34A 2QT7A 8ICJA 1RWUA 4LF8K 3AQOA 2JRZA 8ICYA 4FJ5A 4RO0A 3HI0A 2IS3A 4CEBA 5B66U 2ZE2B 2ZOFA 4M5DA 3J80U 2BJ8A 4FM0A 1U09A 3MAAB 3CJ2A 1RTZA 1J2NA 2LMRA 4MQ3A 3ZYYX 1DK3A 3OBYA 2R2UA 3KBBA 1VBYA 3ENVA 3TYTA 2KXNB 3AOAA 1NH7A 5AQVA 4K0KJ 2P9UA 3OPXA 4NYOA 2XGPA 1EWQA 1YRXA 3CJ8A 5KFDA 8ICPA 1U25A 3PDNA 1S4EA 1KQSM 3I0RA 4N8OA 3UD3P 4PYAA 2Z2YB 4USVA 1MN7A 4PXEA 4BE1A 1KS2A 3VQ6A 1RDFA 1XR5A 4F50A 1C20A 1JJ4A 1JWWA 2ZKUA 2O8BA 4FZVA 4BY9C 2PYLA 2X1FA 1TUUA 2OEHA 5AI5A 2GO7A 5GVQA 3VCBA 4OYWA 3C2KA 5AM5A 1X60A 4KLTA 3RJFA 4ZN1A 4I0WA 3NKYA 1BIZA 5EU7A 4WYLA 2AZ3A 4OPHA 4UT4A 2H54B 2V0NA 4MEXA 4ED2A 3HTVA 5GADI 2NRVA 1LQ9A 3WXJA 4UW9A 1TP7A 4A46A 3TADC 8ICIA 3VGUA 4DL5A 3IAS9 5EWGA 3UPQA 5FLXO 1PJ6A 4NLUA 2E44A 4N76A 1JJ2M 1CZBA 1LVHA 3WK4A 4WBFA 6AT1B 4AHVA 3KJQB 2XLJA 4DSFA 3SBMA 2Z2MA 5JVHL 1Y4ZB 4DX5A 3D2QA 2BZFA 2ZIWA 1RT4B 4OKKA 1J5EJ 2ACYA 1S49A 2VFSA 3TOQA 1NXIA 3UB5A 3HJFA 4NOHA 4F93B 1XR7A 3W5YA 3TP2A 3SQ4A 1KRPA 4L76A 2WMMA 1IBMJ 1RBOB 3QEXA 4KI4A 4UBCA 2HPUA 2YHBA 1N5WA 2NO5A 2J0SD 4FXDA 3VAMA 2RP5A 4DSIA 5JUMA 1P8GA 3UXOA 5GADP 2HZAA 3E9LA 3KZIU 1ZQPA 2C42A 4DZDA 3IR6B 1O03A 3ZD9A 4UB4A 1CJKB 2DFFA 2YX4A 4HTLA 1NZ8A 3MGIA 2NLWA 3M8QB 3SENA 2YWKA 3C2MA 2HIQA 4OI6A 4OYXA 1QS4A 3O44A 1HD1A 5AXNA 1N33J 2IVPA 1VQNN 1C0TA 1NGCA 3M8PA 3ZZRA 4K43A 3D4JA 2FMPA 4QR1A 1Y7PA 4WFYA 3BF3A 3H7HB 2VG7B 3GDQA 3MI7X 3FEYB 2Z57B 2BE2B 2RDDA 1P1LA 4CJQA 2DY9A 3IO1A 4ITSA 3RJGA 1X3MA 2QFIA 3QZ7A 3RW7A 4KHQA 5EY4A 2IAJB 3T41A 1M0SA 2HFSA 5D0GA 1OIAA 2XG8A 2W6LA 3PO4A 4JI5F 4ZOSA 5FJ4A 3RH4A 3LL3A 4JKEA 1K9MO 3PW7A 1SV5B 3FK4A 2VC0A 1T95A 4HTJA 3KDOA 2NLXA 3OXFA 1WSHA 3D6FB 1BQNA 3BPSP 1VQLN 2A0FB 3NOGA 5J2DA 2HNYB 3R7BB 4KV8A 3I5CA 3ZTQA 4FPRA 4B9VA 4PUOB 2RRDA 4V19X 4G1QB 4DKWA 4QIWD 1R8CA 3KLHA 4ILLA 2NQPA 4MJKA 1VQKS 2XZTB 3DRXA 1N5YA 2V2ZA 5KRTA 4YOEA 1RU2A 4LIWA 3BO3A 4JV5J 3OA9A 1TKXB 1OPIA 1T8EA 5ALHA 4IOCL 1VS3A 3SFUA 3MEEA 4EEKA 1NO8A 1A0OB 1QQ7A 3TA0A 1R31A 2VQFJ 4IOXA 2YQ3A 5C2GA 2Q0RA 1Q8BA 2ZIVB 5KQ8A 2JRSA 3AT1B 4ALZA 2DCUB 4ZLLA 3IM9A 4A2BA 3LP3A 3CO0P 3D2NA 3O9TA 1N34F 1VQ6N 4O3OA 4M42A 4OZ5A 4DTRA 1GMUA 1VCTA 5KOXA 3M2RB 3N4QA 2GQ2A 3G10A 2UVWA 4NCGA 3C7NA 2W24A 5HN0A 3R5CA 2KTQA 3NLCA 5AT1B 2BJ9A 4DV4K 5AQXA 1TKZA 2PMZC 2J9CA 3ZZ0A 7ICIA 3O8WA 3K17A 4BRLA 3ZT2A 2VJ4A 1YBAA 1IXRA 2G8HA 3L2QA 1QSSA 1X4EA 4QZGA 2JWLA 1E3MA 1MROA 1WEYA 4KHPF 4YFUA 1BVSA 1WTFA 2NV3A 3NS5A 1WC6A 3U7JA 1Q46A 4IFVB 3MC1A 4Q44A 1PGZA 3R6LB 3CJ9A 3J7A1 3H5XA 4E1MA 3SUPA 1BUXA 4NI2A 3VQ8A 1HLUA 4QZEA 2BOPA 4CIOA 2A1BA 3EZUA 4H4KA 1VK8A 4QOZB 3OYIA 1KVBA 3HJVA 5J0OA 2BKEA 1U1MA 3G96A 1JNZB 3CB4A 3P39A 4LC9B 4FYWB 3R1LA 4G1PA 4H0TB 2QE5A 4FF1A 2GIRA 1M5KC 1S22A 1NBEB 5HMMA 3A0HU 3TPQA 1X5OA 3GG1A 4KYZA 4GNIA 4RQNA 1DTTA 3EDRB 5A0YA 4Z6EA 2DY1A 5C42A 2R3VA 4FSVA 4I2HA 2CNNB 3SK3A 3OYNA 3OUYA 1DTQA 2ASMA 1NJYA 2Z2LA 4YS2A 1LW0B 2XIDA 2GWJA 3NGRA 5HLFA 1RZTA 5KFXA 4DR1K 2FC8A 4OHVA 1RT6B 4ETXA 3FM9A 2HRUA 3PXGa 1C1AA 5AJ3K 3D2FA 3QNNA 1IN0A 1R59O 2Q3SA 2QLTA 2IHMA 3OR2A 2BV3A 4DSKA 4LF9J 2I6WA 1JLAA 3CCSN 4YOYA 3AU2A 4NMLA 3JSMB 4KREA 4Y2RA 2E1FA 4BQZA 4MYUA 2AD9A 4B1VA 1PYTA 2GV1A 4OJ3A 4B6JA 4DQPA 4FO0A 4Y00A 2F77X 1RT5A 5ALDA 3C28A 2E1PA 4IOBA 5BRHA 4URGA 4CO0A 4PGQA 1Q82T 5KL8B 1X6JA 3NF6A 4FO6A 3TKAA 2OO4A 1ZM4A 2ZJRQ 2BM0A 4ID5B 3T1HJ 3R5BA 5BN9A 1NPRA 9ICEA 4WE1B 4DLEA 2G2ZA 2Y0SD 3TJ8A 4KLLA 1HYZA 4ZCIA 1Z4OA 4DS5A 4OJOA 3CJKA 1Y3JA 4NO7A 2CPXA 5AQRA 3BQTA 2VPZB 1RXWA 1N6QA 3VOVA 3CC4S 5TISU 1CXUA 1XHXA 4IJNA 3ULDA 4FVCA 2G8IA 5D77A 5KFWA 3EWAA 4IEEA 1TL1B 3R1XA 2YX7A 4KGMA 4NLKA 3DXBA 1SJ1A 2HQFA 3T1YK 1S6OA 4J9SA 3VGLA 1IKXB 3GYXB 1T6DA 3O1LA 5BYSA 1JIHA 4DR5J 4C8ZA 1WC1A 1SC1B 3AA8A 3SZ2A 2HMIB 1WHYA 3TUIC 5KL1B 3BKUA 3HHNB 4LF6J 4LUBA 3SNNA 2Y8YA 5IFMA 1KSPA 2ZGYA 1MQ3A 4PZNA 3CMAN 1OWXA 1YIJS 1J5OB 1QQMA 1M5VC 4X65J 3EGVA 5GAHU 3KG4A 1YRTA 1VK0A 3VQTA 4DV1F 4YDUC 1HR0K 4ED5A 2W43A 3B9JA 4A8MP 2ZXHA 2MKIA 4JUZA 5JRTA 5T14A 2XO7A 2N82B 4I69A 2E4LA 4C11B 1FKPB 4DR6K 4LREA 2KL8A 3TUJC 2CGKA 2V2VA 1KEKA 3EUNA 4IKAA 3LQVA 2BJ1A 3MR7A 3JQKA 2DPIA 3JTOA 2ZWHA 1GLDG 1ZTWA 1S79A 1PCAA 2LSNA 5FRMA 1LWCB 3SQ2A 2CG4A 2RUSA 2RF2B 1B9FA 1EP4B 3IAYA 4TUPA 4KQZA 4Q0BB 5BPNA 2IMOA 4YMEA 4ES2A 1WHWA 5EVZA 2N7YA 3U8XA 1VMBA 2V51B 3EWGA 1VQOS 3FZFA 4CEZA 3VC8A 3UDCA 4LSNB 2YKNB 1WKKA 3M6VA 4FWQA 4AHTA 1VDVA 5L1JA 3SBTA 3M8SA 3J7AP 2QL7B 4I1TA 5KFTA 5CY4A 2MLYA 5GMEA 3IDWA 2YI1A 3W65A 7ICNA 3O8MA 4QNLA 3ZD8A 4ZPBA 5A0LA 3H5UA 3A5LC 2KHOA 4U8YA 2DJWA 2RU3A 2HQGA 1ROFA 3DC2A 5FLXY 4E7IA 2OMOA 3PW2A 2CFXA 4LF4F 3IR5B 2PFOA 1NDPA 3AAWB 4MDAA 4KGZB 3AJ1A 2QLJB 1PIEA 4M3WA 1PO6A 1SKRA 2YVSA 2CH6A 4L75A 4NRUA 2NRWA 3WNHA 3AA9A 2QWNA 1FE4A 2FBVA 1TR0A 2K4HA 1U1QA 4EBCA 3RJHA 2Z1GA 3SPYA 2W1BA 4OFZA 1HMVA 2XM3A 5EOZA 3DU6A 1HQEB 1BC6A 1IV8A 3ZSWA 2FPLA 1HL6A 3SSRA 1CJUA 4P2XA 3LGNA 2YKMA 3DNCA 4A62A 4KB0A 4QJVA 3C66A 1N54B 1FIQA 1ZTTA 3JB9k 4YVZA 2XY5A 2HS3A 1WC4A 4WWSA 2XO6A 1N32J 4N77A 3RH5A 3P8BB 4USJC 3M2VA 4W5NA 1ZPWX 3JS6A 2I1QA 2RQ5A 2V8PA 5KFHA 1COKA 1U45A 4BE2A 3POTB 3HX9A 5ALUA 3PW5A 1ZH5A 1HBOA 4RT2A 4CBXA 2BPGA 1UWBA 1K47A 5KPTA 2HBZB 4CO5A 3M1FA 4FXVA 5E79U 3KKFA 3S01A 4G3IA 4PWDA 1D0EA 1V4TA 3GV7B 1TK8A 1WHVA 2GW8A 3SEOA 2VBYA 2CXYA 1NM1A 3F2DA 4CJ3A 4LBHA 2UU9F 4CZFA 3OLAA 3AA5X 4X66K 4DPYA 4MFBB 4JV1A 4NRTA 1KTQA 4YEAA 1NDCA 2W01A 3KKRA 1FF2A 3MECB 2RQMA 4FWOA 3ILOA 1XERA 3M30A 4KPCA 3SUNA 2CPYA 4NYNA 4M3YA 2ZJRL 4NL9A 2RH3A 5EX5A 1ZZFA 2ZH3A 4OL8A 3LDLA 2VQEJ 4LFBK 3CE8A 4ZVRB 3OSPA 1O13A 3T6BA 3GCWP 3AD8C 4QCLA 4J2BA 5KAFU 1BWEA 1TL7A 5AIAA 4FYXB 3LH2S 4F4XA 3MPWA 1EWRA 1KDNA 1WOPA 5JU5A 2DHGA 1ZQYA 4NYPA 4ZDNA 3C94A 2Z8QA 3VGVA 5AICA 1N36F 5H9EK 1U02A 2R7QA 3MM5A 1WSEA 2YNGB 2FJEB 4OX9J 1B0PA 1KQSR 2HBRB 4IQWA 5HQLA 1TVAA 1QH9A 4YN4A 3OSNA 2PMZD 3AVFA 3FFIB 2AJ1A 4DPXA 4CIFA 2BJDA 5HRSA 2YTUA 3DGPA 3HZGA 4H4MB 4WQ4A 4I2FA 3VAKA 2OPQA 2KKHA 3GU3A 5AXKA 4NXMJ 3O5BA 1VQKN 5BOLA 4GKJJ 1CZAN 3OY9A 2V8HA 3KVGA 3TO8A 4AL5A 1XNRF 3FAHA 3SQGA 5I3QA 4FJ8A 2FHJA 2VDHA 3LP1A 1DK2A 4BS2A 4US9A 5HMLA 1D4XA 2HDOA 3S1TA 4GO5X 2V4RA 4FS1A 4Y2PA 1RT1A 3OTOK 2QV6A 1AB8A 3SIPB 3N9UC 3WNFA 2RMLA 1WG8A 4NEZA 1YF5L 3F9KA 1JJ2R 4DUZK 4DCOB 4FZLA 1HLWA 2HHHF 3U26A 5FLXU 3AVHA 3R3LA 4N47A 1PYOB 2FJVA 4QZ9A 2E1AA 3RMCA 3VGSA 3RSEA 1UFLA 1X4CA 4US8A 2WSCC 4FVUA 1SKSA 4B3MJ 4R5PA 3H0MB 2EZZA 3SAFA 5J8YC 3T7ZA 5CYMB 4AQYJ 3MURP 3VEZA 4ED3A 3HX0A 2AJFE 4DFJA 2R7XA 3LOUA 4IQTA 1GLBG 2ZD1A 2ZH6A 1ZM9A 2RHSB 1HQUA 3CNHA 3DOLA 1RDAA 4YCXA 5E84A 3WEEA 1MMDA 2V68A 2HFOA 3MR2A 2QTDA 3DDKA 1XC3A 4BX9C 2VICA 2VBWA 5LMUF 3NUQA 3B0YA 1HKAA 2N7CA 4FZZA 1T3VA 3QATA 4M5DB 4KLEA 4ENOA 2O8FA 1S72S 1WAFA 4FJNA 2CQ1A 5DGBA 1BPXA 1AZSB 5AXLA 3TR5A 3TACB 1IJJA 2KYXA 2FVQA 3OGUA 4M2YA 1W2BM 2DHHA 2WF9A 1C2PA 2LXIA 3AVJA 2GFFA 4X4RA 2P9UB 3LZIA 1WSJA 1NCLA 1WN7A 2P9PA 3M2UA 3V81A 3QSIA 2H48B 3TTCA 5D46A 2H1YA 2DISA 1HYVA 3I0RB 4KR0B 3MFIA 3PIPQ 4FLXA 2RPIA 3LPEA 1FXRA 2RRNA 2YX6A 3AVGA 4PH5A 4M47A 2MQNA 1D1UA 1B9DA 2W54A 3OD2A 1GXUA 4WTOB 3H25A 3UVJA 3PX4A 2WAQF 2H3VA 2O8BB 4BRHA 2VCPA 2DRBA 3V72A 1BWFO 3NAIA 3S6JA 1SL2A 2DBYA 1O5JA 3E58A 2JSXA 2PYJA 1WKJA 1RTDA 1FFVA 1U8WA 2YX1A 1WC3A 1OW5A 3L3CA 1HNVA 1S1UA 2P5VA 3EDQB 1FJGF 3M8YA 4YOUA 1VQ5N 3CIPA 3MN5A 5AK3A 1N8RT 5A2QY 4U8VA 1RDCA 4UQGA 3KK1A 3O3LA 1R89A 4ECYA 4M9HA 1KP6A 3W2WA 1X4FA 1WELA 4DV7J 1NH8A 3CP8A 3VMFB 2ZIUA 1P8ZA 7ICPA 2W3SA 1UFKA 1I51B 1SXLA 2DNNA 3C14A 1SXDA 3JPQA 1PAEX 3K7RA 1SPBP 3H45C 3SJHA 3G6VA 2J0XA 2ZIWB 4DV3K 8RUCA 3MABA 4DDFA 1UT8A 2OTLS 1C4CA 3ITHA 1CQMA 2Y3YA 2AJQA 2ZJQQ 5I3UA 1FNMA 2OELA 4JI8J 4X5VA 4FOEA 2W7AA 2RE1A 4GVLA 3BZQA 1DHMA 1N61A 2CYYA 1RB0A 3H3NO 8ICNA 1BNPA 2Q6CA 3CC4N 4OJRA 2KT2A 1Q81T 3VESA 2GHPA 2MEWA 3U9DA 3TX8A 1I1GA 2VKRA 4D3GA 4B3TF 1VJ5A 1FK9A 2CZ4A 5LT5A 2ZDPA 2RQCA 2KVCA 2F44A 2I2YA 3ZT1A 4DR4K 2DEIA 4JI3F 2AWZA 1SGGA 4DU3A 3E01A 4YHHK 2ZH8A 1IBKK 3LF0A 4OLPA 1BI4B 1C0TB 3M8PB 5GAHI 3AB2B 5EN1A 2VOOA 2QFJA 3EE3A 2UUCF 4NXNJ 4DV2F 4JI6K 1YIJN 5A8RA 3KOOA 2KZ3A 4WXWA 2VONA 4YQWA 5KOWA 2MQPA 1ACMB 1H38A 3PMNA 3O9UA 5AHXA 5FPNA 3U3GA 1NPPA 3VAJA 4OZ0A 2AF6A 2LYAA 3BSOA 3T79A 2XMMA 4CLYA 4TYAA 2QL9B 1BO5O 3Q8YA 4RJVA 4DV5J 3KK2A 4A8EA 5A6WA 2ZBCA 3UE5A 2WTUA 3JTPA 1FDAA 4NZ6A 2QARA 5J29A 1HNXJ 3OYAA 3OW2M 1S0VA 4PEOA 5KT7A 4GC7A 2HZVA 4OMFG 1RAEB 4IYQA 4Y6IA 2MSSA 5GAHP 1BQNB 3CF5Q 2R42A 1NUEA 2W7OA 4CF1A 3A5NC 3W1YC 1GTEA 4KV8B 4RQ5A 4BR7A 3C5FA 3VEOA 4CFDA 3ENQA 4LBPA 2KW4A 1JXEA 4Y65A 4AFFA 3KLHB 3OYMA 4FPAA 2L5YA 9ICTA 4RQ6A 4J9KA 3HO1A 1N5YB 4LF5F 4DR7K 3JQJA 4PHEA 2GQQA 1VQON 5AE2A 4UAZA 2F9JA 2CRLA 3AY9A 1URNA 2GZOA 3MEEB 3ILIA 3TAMB 2KRRA 3KXDA 3OXLA 3TZXA 5HNKA 2B7CB 4L8RB 1BXNA 3H0RB 3TVYA 5K5MA 4MFFA 1S4FA 2F8TA 1WSVA 5EHHA 1J54A 2GX8A 3KJNB 2HLTA 2K3KA 3CEDA 4HCCA 3QUQA 3SEIA 4MYTA 4A47A 2JWKA 2N3LA 5KQDA 5KT3A 1O08A 4V19S 4BGDA 1R0CB 2CG8A 1BU6O 2BHNA 4EFHA 1NNEA 4GV9A 1FRHA 1HJRA 4ZJLA 4NCGB 3C7NB 1NB7A 1S0NA 4ZLJA 3EMTA 1TKZB 4JK1A 1W9HA 1GMVA 2WBRA 5DKWA 5EE9A 3MD3A 5ALZA 4GIBA 2UXCK 2MUTA 5A2QU 2E8OA 4HVJA 5BR8F 1JUDA 2MAXA 3PIPL 3G8SA 3VERA 2VUGA 3FCVA 1TTHB 3HHKA 4NLBA 1HNIA 2OANA 4NI2B 3K5NA 2OWOA 1DY3A 2XZWA 1VQPS 4H8KA 4QIWF 4QWBA 4QIFA 1YT3A 3VENA 2WW4A 2IJNA 2FE9A 1R0AA 2PEHA 2OYQA 5J0YA 5AQOA 3E66A 3CMES 3SI6A 4M3RA 4K0KK 3MWTA 1U0HA 4CIGA 2ASLA 1JLBA 4E1NA 3BDEA 4LFAF 4O3PA 3ZCMA 1PSDA 2L48A 3QIPA 3RBZA 5AQWA 1HARA 3NF8A 1DTTB 3G6XA 4MIBA 5A0YB 4CJTA 4EHUA 5C42B 3OUYB 1DTQB 5ALLA 2FB0A 5DQIA 1RKJA 1ZJMA 3B82A 3QEWA 3HOTA 2G1DA 5F8IA 3O0FA 3CM6A 3W3SA 4OGEA 2OH2A 4C3MA 5HLFB 2GELA 3DV9A 1QQCA 4TY9A 4QS9A 4JP8A 4DSLA 4KBIA 3N5BA 2DNOA 3VZHA 2ZM6F 5L9NA 2OYYA 3I96A 3D2FB 4CJKA 2O3DA 2CWXA 4FLZA 1XEZA 4BRFA 2IVMA 3OR2B 5DDRC 4ZPCA 4NEYA 2B5JA 4DOBA 2QO3A 4PGXA 1JLAB 1B92A 5ALRA 1UL3A 4Y2TA 2FJBB 2R8JA 1Y88A 2BYCA 3MCAB 2DTUA 5AI0A 1CG2A 5DG7A 5KFSA 2A1AA 4O8UA 4A48A 3A8YA 5IT9O 3QRQA 3R7NB 2DKXA 4OHXA 1C0FA 1YK9A 3VGKA 1IKVA 1M1KO 1J5EK 1SVDA 3H0PA 2PA3A 5BPMA 1BIUA 4F71A 3VTIA 2NCKL 3NNAA 4P2MA 2ITMA 1CC8A 4MIWA 3O3HA 1IBMK 3T9NA 2A18A 4CLPA 2YQ1A 1QZ5A 3CJKB 4FNIA 3EL2A 1AQ6A 1Q7LB 3OYKA 1F9EB 2OEJA 1ZQDA 2F1FA 2QKKA 1N6QB 3QEBZ 1RCXB 1ZAXA 1U9LA 2R8IA 3ZX2A 4CI0B 2KJ5A 4IRDA 2RE2A 4JI7F 1OH8A 2EPIA 3DN9A 3ZZPA 2M0GB 3HHEA 2BXJA 3HHLC 1YKWA 3BJYA 1Z3EB 4XPEA 1OVYA 3CQYA 2XYGB 2OMLA 2KYZA 1FHTA 5CCLA 1NGHA 1JK9B 1VGYA 3PYEA 1G4CA 1N33K 1YITS 4B9SA 3P49B 2HWTA 1IWGA 2QGFB 2ODGA 5KAKA 4LD0A 3CF5L 3QEIA 3QEVA 5HANA 1RUSA 2BQRA 5AK5A 5HJXA 9ICHA 4FYVB 4W5OA 4EAHD 4KLOA 5J0PA 2XS5A 3DI6A 1LWEA 3LW5C 3FEZA 1ESVA 2F8MA 1UAXA 4L3KA 5CA5A 5K8OA 2AKWB 4JLHA 4S0MA 3HT3A 4F4AA 2F63A 2ZUAA 1U2RA 4RBVA 1FO1A 4X65F 3NAEA 3O1BA 4LRBA 4J5OA 3OVAA 3ULHA 4C0OC 3K8WA 1TL3A 1U1PA 2FC9A 1ILYA 3AVKA 1RBVA 4C4RA 3LAMA 1EXNA 3G4SS 1SQFA 2QYCA 4ZPVR 4YY3J 1S72N 1DURA 4P2SA 2VPYB 4ECXA 5KGWA 5J0UA 4CO3A 2KJVA 4WFNL 2W4CA 4MTPA 4PKDB 2G0IA 4JV5K 5AQQA 4PQAA 3L7OA 1IJEB 3EVWA 2EZXA 4Q8EA 4K50A 1SBRA 3NVMA 3FZBA 3TW0A 2Q4TA 3DGVA 3QFWA 2VQFK 2DGWA 2YQEA 2E9RX 1WORA 2COLA 1N48A 1KLNA 4L6V3 3IKMA 5ALWA 4GMJB 4QWEA 4UTGA 3ED5A 1TKDA 4FWMA 2Y1IA 4EIAA 3Q8VA 1KTVA 2ZBPA 2GMLA 1TVRA 1RXVA 3WXMB 1NWKA 3M1YA 3HCXA 4PR6A 1UVIA 1L5UA 3FSYA 3PRBA 4ZJOA 1V97A 4ZH4A 2A40A 4EYHB 2BCRA 2CQIA 1ASUA 5KG2A 2N1RA 4LZGA 4CZIA 4F5RA 3AJDA 1UVLA 2H65B 4B1UB 1LKZA 4F7VA 3D45A 4W5RA 1R27B 4GKKF 1HMVB 4CJLA 5E2QA 1FXDA 3E3XA 4EX6A 2CPEA 1CJUB 3TAQA 1F3VA 2YKMB 1HIWA 3ZSRA 9ICPA 4DPTA 4AXJA 3CDWA 2B51A 4K4HA 3KJFB 4ZVUB 1UAWA 4OLBA 1UETA 4H5NA 2HZCA 3M2VB 2PY5A 4QU6A 4WK3A 2OTLN 1MWZA 3QJJA 4USWA 3CFPA 2W41A 3VPZA 4CGHA 4RZRA 1OH7A 4FPIA 1HBOB 3I55S 1V9PA 1RTIA 2FYXA 3EXYA 1UWBB 4ZOHC 2AV5A 2MZRA 3F56A 1S6QA 5F8NA 3TQ1A 4ZKAA 4PWDB 1MC8A 1EO1A 4E8UA 3LDAA 5H1SV 3OTCA 3JPTA 2C2RA 4MK7A 4O0NA 4BG8A 3MF5A 2K60A 3W3DA 2J9DA 2QTWA 3CCES 3DLKA 4KJIA 2GHVC 3C8YA 1JROA 2LM1A 5HRRA 3H98A 4ZP9A 2FHOB 4NZ7A 2GH1A 3ICXA 2XI2A 4Y2JA 2F9TA 2LKYA 2ZOGA 1PBAA 5D0EA 4A4JA 3M30B 2BTFA 2JH1A 4K4UA 4OQJA 4FFDA 1NK4A 5JS1A 3BREA 3J81O 3A1YG 4Q2MA 3DRPA 3KD3A 4M3UA 2HKEA 3NASA 5DB9A 1NB2A 3MFHA 1P1TA 3UDLA 2I5JA 1TFRA 1QY7A 2BBEA 4LF9K 2BMBA 4UOFA 4YG2A 1NHVA 3TA2A 3AD7C 3Q8RB 2W9BB 3UWTA 4PXBA 4J2DA 3SSQA 5DK5A 5J2GA 1W2BR 1Q8KA 2VQEF 1TL7B 4E7HA 1I3OB 5IIOA 1HNWJ 1KW4A 3W5XA 1OY8A 1H7XA 2NR0A 3HBTA 5MLCV 4C3KA 1NLKL 5HQ8A 3IBFB 1EX4A 2D41A 1V85A 4KY3A 3MM5B 5AQIA 3DLLQ 3JXOA 3O80A 2KM8B 5J2IA 3EGNA 4OZNA 1OVQA 3KNGA 2OGUA 4ZVOB 3I8BA 1T03A 4DJBA 1TL5A 3T1HK 1S59A 3R2DJ 3DGPB 3KK3A 1U6BA 4UZCA 2F7VA 2OPQB 1ATRA 2VG5A 2U1AA 5KT4A 1FJ7A 3TU5A 3S7RA 4OGCA 5AQKA 1V3ZA 1GQEA 1JCEA 1ZBUA 4PA1A 2IJFA 1KKHA 1V6HA 4I2PB 3SQGB 2YTCA 2FZCB 4PABA 5D0HA 2W2MP 3UKUA 8ICFA 7ICLA 1NDKA 3K9KA 5DDMA 3LP1B 2Z7JA 4ZVEA 2BCUA 3GZ7A 3AOCA 4NXMF 1RT1B 4GKJF 2AXTU 1KONA 2PKEA 4DR5K 4CF0A 5M2UA 3NF9A 3IRXA 3L3FX 1N5QA 4KTQA 4ISEA 3DLRA 2AYGA 4IH7A 1UQVA 3A5OC 1O0PA 1ZQKA 1FEHA 1VK3A 2AJ2A 2E20A 5CD4H 3LDQA 2XGQA 1HYSA 3QT5A 4XAKA 5DGAA 3H90A 1H1VA 4RNOA 1CSJA 3RSEB 2E9ZA 3D66A 4R5PB 3P31A 1ZJNA 4RWTA 2VC1A 3WKAA 4CLLA 2YKQA 1FKAF 1ZQWA 2ZD1B 2PMWA 3K2PA 1HQUB 3AV9A 4QWCA 3DOLB 3T5HA 3MN9A 4E3SA 3WEEB 4NASA 3H2VE 4X4UA 1XWLA 3FCHA 3BKTA 4FK2A 4A8FA 5EE1A 1ZQAA 1BPEA 1L7OA 4AHCA 3JSBA 4LFCJ 2FLNA 4A5AA 5RUBA 2UXBF 4JNEA 3PSPA 3I28A 5D4PA 1AFIA 2JC0A 2QSFA 1VQPN 4I2DA 3L4PA 2IRUA 3VAGA 4KAZA 1L7MA 2Q2RA 4JI0J 4IKFA 2O8FB 3CD7A 2DNYA 3DOKA 1KOHA 2GO8A 4J9MA 2O4GA 3L0QA 3CMEN 1DZ5A 2V52B 2VWJA 2QW9A 3HSDA 2HSZA 2YY6A 3BQ2A 3ZSXA 3C1YA 3RU0A 2P9PB 3M2UB 2XNQA 3V81B 4FJMA 2ATLA 5DRKA 4J9LA 1ZOLA 2WVBA 1QVFM 3WK7A 4WPAA 2ZZNA 3DXMA 4F0MA 3NF7A 1IR0A 4DOZA 4DMNA 3OT9A 2BUPA 5K14A 2VG6A 3OW2R 3M9NB 1UFWA 2KRBA 3UVJB 1APSA 4QS8A 1OYDA 4LF7F 1U7LA 3GR0A 3IRWP 3BDPA 4K4SA 4OI0A 2WTFA 2CQGA 1E4FT 1VC5A 3FRYA 4FM1A 2BRLA 1UEUA 1ZAVA 1RABB 3MAQA 1VC0A 5IT9Y 4PWUA 1WSFA 3DYAA 5G4DA 4X62F 5ADXA 4FK0A 1WJ9A 1R3NA 3N7PD 5AKJA 2W2PP 3BP8A 1HNVB 2Q79A 1S1UB 1ZQNA 3J7ZO 2LQBA 1NGJA 4CI6A 2DBBA 1ZBLA 2RDJA 4DQ8A 4B8CA 4CNZA 2W3RA 2FQQB 2K8AA 2RSQA 3H3OB 2E8MA 5HSPA 1HNZF 3W2WB 4OYIA 4OD0A 1RTHA 3EXCX 4FWNA 2ZIUB 2OFGX 3WIUA 4FL9A 4NA2A 1K0TA 3GU0A 1YWXA 4FOIA 4DSEA 4CVNE 3C14B 4DQIA 2JH3A 1Z1VA 3ITHB 2M70A 4D3HA 1X1PA 5I3UB 2KQ2A 2KJ8A 3OYLA 3QJLA 4F4KA 1EETA 3G86A 4P73A 3CFOA 4W98A 3A3OB 5AKEA 2VKQA 3AXKA 1KQGB 1XS9D 4KH1B 3ZX3A 5DDYA 2MGZA 2CPFA 3UCZP 4FW1A 4FZXC 2P6RA 1TV9A 1FK9B 4GLXA 4KHRA 1YJNS 3W61A 2C3UA 1BL3A 2O67A 5J2PA 5DB7A 3DLLL 1YAGA 1YITN 3VQEA 3QUBA 2K2PA 3CCRS 3BQ1A 1G7CB 4M5GA 4BC5A 5A8RB 3LVVA 5GTIU 5LMNJ 3M7VA 2CPRA 3FZHA 1Q78A 3BN4A 4QOTA 5HMXA 3C6HA 4HI2A 1BA1A 3BM7A 3CDBA 2AEFA 5KNIA 2LM4A 4CJVA 3LGHA 1MW7A 3OPKA 1KBRA 2PFDA 1XN9A 2QARB 4X4OA 2GTDA 1W26A 5AZJA 4I2CA 1VSEA 1ZD5A 4OX9K 2F5GA 2HAFA 4GW6A 5CYQA 2OFHX 1SZHA 1RHKB 2CQHA 2HB5A 2V67A 3ZDBA 3C5GA 4O23A 3G4SN 4KHNA 1X66A 2OIHA 3FJ2A 4P0PA 3NGDA 2D1KA 2M4MA 2RVJA 3HW8A 1A5XA 3HXMA 4F3TA 4F0KA 2YJFA 3M9MB 4H0YB 3NP5A 3PZPA 1O1WA 1S6UA 1U1OA 2ZEJA 4E7LA 2NPFA 1N5TA 2MZQA 4DR1J 2A1JA 3ZSYA 5HVHA 1YJTA 2JH7A 1W7WA 4DF8A 4ELUA 5AJ3J 3HFKA 2MU2A 4FZYA 3MUMP 5FRNA 1D8LA 2IYIA 1DOQA 3PYGA 2JV3A 3AJ2A 4TKTA 2IOHA 4B3OA 3ENOA 4PPZA 9ICXA 3DLJA 3CGIA 1HW9A 2XQCA 3D5MA 5IIKA 2UZAA 3FSXA 4GXIA 2ALYB 1HFEL 3MMVA 2ZNZA 5AQGA 2PA8D 1RAFB 1Q3UA 3R9KA 1KVIA 3Q0AA 4DFMA 4FP9A 5IT9U 4BRNA 3HJEA 2C2MB 5J1NA 4B3MK 3UCGA 2E1CA 1ZOTA 2CN1A 2E5LF 2KVQE 3UD4P 1RDDA 2IIRA 3L2RA 2QM1A 4AQYK 4EUVA 4Q8FA 3AL0B 4I9QA 2IOFK 1CLQA 3W9JA 3L2VA 4NCAA 4DL4A 3UNGC 3WT0A 2WF6A 2X3GA 1NNDA 2MUTB 2DR5A 3CDUA 1S7HA 5J2MA 1JLCB 5KFQA 2YY3A 2CVIA 1CULA 3MX2A 3BPDA 5CA7A 2K06A 4YOXA 5KTQA 1GLAG 2R8KA 1FWPA 4YR3A 4KMOB 2ADCA 2M8HA 1CZ9A 1HEKA 1HNIB 4HTUA 3J80O 2BRKA 3G2XA 2B7BB 4QYZK 4BR5A 1L8LA 2RHFA 4Y2KA 3ULEA 2B56A 3GLJA 5B0EA 2DT9A 2KHQA 3I55N 3PEJA 3HF5A 3V6HA 1R0AB 2XC9A 4J90A 7ICGA 4CYUA 5C10A 4B3RF 2Y9TA 3KWMA 4KLJA 1U0HB 3NCRA 1JLBB 2WF5A 3R6GB 4DCJB 3J81Y 2W25A 1EQYA 4F3MA 3QIPB 1ZAWA 3DM2A 1S97A 1T9XA 3CCEN 1U47A 3E51A 2WOMA 4KB7A 3LAKA 1K0VA 1HR0J 2FDNA 3R9LA 1LAVA 3UE2A 4DR6J 3VVTA 2ROEA 4QU7A 3D6HB 3L4IA 2FPKA 3MM8A 2E5HA 2Q31A 4NLTA 4NB4A 1GEHA 3EZWA 4CJUA 1AXQA 3L7UA 1OS5A 3N6MA 3M32A 4LVOP 2ZH5A 2AZ1A 4ID1A 2UUAJ 1IJFB 3CSKA 1EXQA 2B5JB 4J03A 3VCDA 2F2AB 3WK5A 3SPZA 4DTMA 4NJ8A 4NA3A 5GAEI 3E1YA 2DGZA 5HHIA 3WX8A 1L3SA 3SMVA 4N5SA 4FCYA 4AL7A 3QUCA 3LPYA 3MTJA 4DV7K 5DQGA 5ALNA 3CTRA 2PEBA 2MZJA 1NK6A 2CZ9A 1QVGM 4LQ9A 1NGAA 5ETOA 3N97B 1B0VA 1IKVB 1NGFA 4M3XA 1NHKL 4I68A 4IO1A 2BCVA 3CETA 4C7ZA 5KPRA 4OYZA 4F67A 3AO1A 2R7UA 1C6VA 2I1RA 4Y2UA 2CH5A 2G08A 3RAXA 1D09B 4LRFA 4O4RA 1S6PA 2E66A 2KNJA 2BGWA 1OY9A 4NYZA 5GAEP 1G3OA 1WG5A 4DO9A 4B02A 5JTIA