4DSIA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, se-dgtp and calcium
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
581
structure length
581
Chain Sequence
GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 208
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsiA01
4DSLA 7ICFA 3VQ8A 2IHMA 1S1WA 2BGGA 3N4MB 8ICOA 4Z4FA 4YN4A 1UOCA 4Y1DA 4CJSA 1WLJA 5KFUA 4RQ5A 2HNZA 1CEZA 3V1RA 4DLGA 3TAGA 4O44A 4FJNA 5CZ2A 4DQQA 1R0AA 4ED7A 2RPIA 5KFRA 4RW9A 4RPZA 4RNNA 3QETA 1RXWA 1LW0A 4DL5A 4FO6A 2I9GA 1DLOA 1JL1A 5HP1A 1C7YA 3CG7A 4F5RA 1EETA 4LSNA 4KLFA 4UB3A 7ICSA 3RJIA 4K4IA 3AO4A 4RT3A 2DPJA 1Q8IA 2YNIA 4CGIA 1S1UA 4BDPA 3L3VA 1XSNA 5J0PA 5EWEA 1A77A 2JEIA 3MEDA 3BQ0A 1IH7A 3GIIA 1ZQWA 1LB2B 3UQ2A 2DFFA 4I28A 4I2EA 4QWBA 4F92B 3NFAA 2HHTA 3GIMA 4C8OA 3MR2A 2RN2A 1FKPA 4C8KA 2KN7A 3MFIA 3C23A 1KVAA 1ZQGA 1RPLA 4CIEA 3AVJA 3K5OA 4I2GA 1EX4A 2V9WA 4CHOA 8ICEA 1NJZA 1KFSA 4M3UA 1D9FA 4O5CA 4I2AA 1ZBIA 4AHCA 1ASWA 4J9QA 2G8VA 2ZE2A 4ED6A 3LZIA 1ITGA 4I9QA 4ED8A 3HYFA 4MEXA 1RT3A 4ECSA 3VA3A 4TUQA 3NHGA 4CHNA 4TQSA 5DQHA 5JS2A 1NOMA 2ZUBA 4KLDA 4NM2A 4NLNA 4ZTFA 8ICHA 4B8CA 4GC6A 3PW5A 3OJUA 2XCPA 3ALYA 5IIKA 3MXMA 5J29A 7ICEA 3IHQB 1NK7A 3VQPA 4HUFA 9ICHA 3JYTA 2ASJA 3DI6A 2OPPA 2LSNA 1NOYA 1UWBA 2GBZA 4F4ZA 3JPQA 3C6TA 3DOLA 3EY1A 8ICRA 3OY9A 4CJPA 3H4BA 1NK5A 1XSLA 4PGYA 4JV0A 1PZNA 3JPRA 3OSNA 4B8AB 5J2KA 3T1AA 5DLGA 3RJKA 2W8LA 1BISA 1ZBHA 1BPXA 3E01A 3HM9A 4KB0A 1BIZA 4I2BA 1A76A 2BHNA 3OVNA 4IG0A 1RDCA 5HHHA 2W9CB 1TKDA 4OPKA 2J6TA 3PY8A 2D0BA 3BQ1A 4FJIA 4KLHA 2JEGA 4NLGA 8ICWA 2HB5A 3QO9A 1JXEA 4Z4IA 1D9DA 3KHLA 3ISNC 1W0HA 5KT2A 1V9PA 1C0TA 4I7FA 3HPOA 3QIOA 4ED0A 2PI4A 3KTQA 4PHDA 8ICTA 4AHUA 9ICNA 1S0MA 4DTJA 4YD2A 1S0NA 4GW6A 4IRKA 4GC7A 2BPCA 5F9NA 1RYRA 4F4YA 1QHTA 4CJ4A 3KLEA 2VG5A 1EP4A 2X6NA 1B92A 3OHAA 4Q44A 4M9NA 4QZ9A 2P6RA 5KFMA 3TR8A 5DBBA 1S9EA 4NCAA 1ZQOA 4QAGA 3CQ8A 1Z25A 1KRPA 2DPIA 3PNCA 9ICFA 4FLWA 4CF8A 4F2SA 1S77D 2VA3A 1D8LA 5IIJA 4BACA 1TK8A 3IM1A 1AROP 1KCFA 4RQ1A 1FK9A 3OYNA 2W42A 4DSFA 3LDSA 4KLGA 5KFFA 3THVA 4ELVA 3MEGA 2XHBA 4R8UA 1O1WA 3QZ8A 7ICNA 3IRXA 5KFYA 4GXJA 4XQ8A 5HRNA 5J2DA 5SZTA 2Z1HA 4TQRA 3GILA 3N97B 4O0IA 3RJJA 3RH4A 3ZT0A 4PWDA 3EZ5A 2PFPA 3DM2A 2JZBB 4PQUA 4CHPA 5HMLA 4Z6EA 2HHSA 4QZGA 3AA5X 2OZMA 3CYMA 4PUOA 7ICOA 1B22A 3ZSQA 1J9AA 1UAXA 5HRPA 4FYDA 4CK1A 1YT3A 4FS2A 3DYAA 3O3FA 2ZTEA 3D0PA 3UXNA 5KFOA 1JN3A 2F8TA 4K8ZA 1LAWA 4P4MA 2I5JA 2XY5A 4CGFA 3OYIA 3ISBA 5EOZA 1RTJA 4DTPA 4JUZA 3NCIA 2OA8A 2FLNA 1TL1A 2ZD1A 1RTDA 2W9BB 3RAXA 2ATQA 3QEAZ 3AA3A 4I2PA 2BCSA 2DFEA 3KLFA 4F93B 4EBCA 9ICBA 4HCBA 3LZJA 4FM0A 2HVIA 2X74A 2ALZA 2BPFA 2BQRA 4F5NA 3KK2A 1RTIA 2VA8A 1WSFA 5EWGA 1ASVA 1FXXA 4CEOA 4HTUA 4DSIA 4AILC 4QWAA 1Q9YA 1T8EA 1U49A 2B4JA 3OYDA 4C8NA 5CP2A 3VQQA 2O4IA 3JSMA 4B9SA 1KVCA 3V7LA 2HMIA 4O3SA 1REVA 2P66A 2PY5A 1QSSA 3ZDAA 4KO0A 3Q8QB 3V72A 8ICKA 4NLZA 3L2WA 3S3MA 3AU6A 1HQUA 5KFNA 3Q8PB 4E7KA 1NOZA 3FFIA 4IQUA 5KFBA 3LANA 4KITB 3B0YA 5DDMA 2Q3SA 1ZQEA 4JS5A 3QEIA 4ECQA 1NK0A 4KLUA 7ICPA 2ZTCA 3QEBZ 1NJWA 4CEBA 4F8RA 5D3GA 3SJJA 4ECYA 8ICVA 3IAYA 4ECTA 1S1VA 1C1BA 1XS9D 5L1LA 4Q8FA 2ZUCA 4CJ3A 2XC9A 4KLOA 3PVXA 9ICGA 1ZBLA 4ZHRA 1UT8A 4RW6A 1C6VA 3DRRA 3S9HA 3LAKA 3EWAA 3RJGA 4GVMA 8ICFA 9ICMA 1H38A 4CJLA 3A2FA 4KTQA 3TWHA 4M41A 1GOAA 3VQCA 1RT5A 4M3YA 3HK2A 2FPMA 2P5OA 4FK0A 1YTUA 4NLKA 4Z6FA 3JPOA 1S10A 4DL4A 4J9NA 5KFPA 5K14A 2IHNA 5KFJA 1A5VA 1L3UA 4DLEA 4CEAA 2HHWA 2ETJA 3WNFA 5J0OA 4DG1A 4O3NA 3OSPA 1CXQA 3O3HA 2IC3A 4FLTA 4JS4A 2KW4A 8ICAA 4JRPA 4CERA 2ATLA 1BCOA 1L5UA 4Q45A 2NRTA 3V7KA 4BXOB 3SQ1A 2G8KA 4HUGA 2E6LA 4DQRA 4Q43A 9ICPA 1ZQTA 4KHWA 4HUEA 4CIGA 4QZEA 4ECZA 4N47A 4UB4A 5E41A 3U6FA 4OKJA 4F5OA 4RT2A 5KFHA 4E19A 3ISCA 1KSPA 4PHEA 4B9LA 3RBEA 2X78A 2VANA 5I42A 4FJ5A 2Z1GA 4NYFA 3F73A 3UQ0A 5DBCA 2WOMA 3PW7A 4ELTA 3DLKA 4CF2A 4PGQA 3NE6A 1A5XA 1ZBUA 1ZQHA 3EPGA 3BQ2A 3TAPA 1K6YA 5J0WA 2AGPA 1Y88A 3T5JA 4JLHA 2KFNA 5JUMA 4E0DA 1VRUA 4Z6DA 3AVCA 3NF6A 4OKEA 5KT5A 1S9GA 4YXMA 3KHHA 3P1GA 2D0CA 4CGDA 3FYHA 4DTUA 4YXJA 1Z00A 3AUOA 3ZT1A 4FJJA 4KHYA 2YHBA 4FJ9A 3RR8A 4XRHA 3ZSRA 5KI6A 2W9MA 3L2QA 8ICIA 4KN4A 1JLEA 3LP1A 4DFPA 4FJLA 8ICGA 1X2IA 3SUNA 1ZQNA 4C8LA 1TVRA 4RW8A 4BDZA 4OPJA 2NRWA 2NRZA 4K4GA 4M3RA 4CJFA 2FLLA 3E2EA 2VG6A 4FK2A 2FC0A 5HRSA 4DSJA 5FRNA 4CESA 2VG7A 3MEEA 2IA6A 5J2FA 2H5XA 1N5YA 1X9MA 3V6DA 4NY8A 2BQUA 3OGUA 3L2RA 4YFUA 4LVSA 3C1YA 3RMBA 3ZT4A 3RH5A 3PMNA 3WNEA 4DU3A 4J9LA 3HPHA 1UT5A 4CEZA 4GLXA 1WSIA 3RJFA 3U3YA 4ID1A 1SKRA 4J9KA 5J2AA 1RILA 2KZMA 2BCRA 1MQ3A 3F9KA 3UPQA 3MECA 2BPGA 4RQ7A 4QZHA 2F96A 4FBUA 4Q0BA 3MABA 3JPTA 4O5EA 4R66A 3V6HA 4ECWA 2Y1IA 4PGXA 2PXIA 3C21A 3MXIA 1DOQA 4DU1A 1L3VA 4DO9A 4JRQA 3C5FA 4JWNA 1KTQA 5EU7A 5J2HA 2IMWP 5L9XA 2XGPA 4RNOA 3NH2A 3SNNA 1B9FA 3TAEA 1JXLA 4IQWA 2IS3A 1CXUA 1RBUA 4CGJA 9ICTA 2BGWA 3MDCA 1QSYA 3ASMA 3L3UA 3SQ0A 2MUTB 2FLPA 5IIIA 4AHSA 5KFIA 3VQ5A 1RT7A 1YTAA 3TAMA 4LY7A 5KG0A 3ZT3A 5FROA 8ICXA 3ZSXA 1KEJA 4R5PA 2A1RA 3OYFA 2RDIA 4N5SA 4ELUA 4CECA 5J2BA 1N56A 3AVHA 4Z4GA 1HYZA 4H8KA 1J54A 3QESA 3GFKB 3OYGA 8ICUA 4IFYA 2P6UA 9ICUA 1RXVA 5J0XA 4RUAA 4DQIA 4EBDA 2JEFA 3ZSYA 2NRVA 3K4GA 4LD0A 4PH5A 3AVFA 1K1QA 2J6UA 4YFKA 4M9JA 4DMNA 4OLBA 3V4IA 3MR6A 1VSKA 4IG3A 8ICQA 3B6OA 3OYHA 3ULDA 1C1CA 1TVAA 1U9LA 4X5VA 2MUTA 4KLJA 3M9OB 4DOAA 5DLFA 3AVGA 4GMJB 3BGRA 1S1TA 5JS1A 4J9SA 4B08A 4J2AA 4CJVA 1Y97A 2W9AA 4YNQA 3OYLA 3M9MB 1RT2A 2PFOA 5J0SA 3JPPA 7ICUA 3V1QA 1TKXA 1SV5A 3ZDDA 7ICTA 1T05A 3LDAA 3VN5A 1BQMA 4TURA 3V1OA 1ZETA 5KFEA 1UA0A 4P2HA 1JLFA 1LWFA 3M8PA 3RWUA 4F91B 1COOA 1BPDA 4CEDA 1ZQCA 4FJHA 1ZQIA 4KLIA 3NGZA 2ZJAA 2WTFA 2C2DA 2PFNA 2F1IA 3CFPA 4Z4HA 1VSIA 4I2IA 4M2YA 2IDOA 4MF8A 9ICRA 4PY5A 3ZDBA 1XU4A 7ICKA 4ED1A 3K59A 7ICLA 4B9TA 1NK9A 3PMLA 4OGCA 2YHAA 3QNNA 2DY4A 3PW0A 4CJ5A 1SUQA 3PO4A 4QCLA 4AH9A 4IRDA 5CYMA 4CEEA 2ZJ8A 1TK0A 1HNIA 4DQSA 2F8SA 4KTWA 2O4GA 4M6WB 1ZYQA 3VQ4A 4CJQA 3K57A 2AU0A 8ICYA 4FBTA 2FMSA 3TQ1A 3TAFA 4FJGA 4KHUA 1N48A 4RPYA 4CE9A 3ETLA 3QEWA 2MAXA 4J9PA 1EKEA 5KFKA 3P83D 1IO2A 4QW9A 4F3OA 1JLGA 1RT1A 3TI0A 2E4LA 3LP0A 1MU2A 1ZQDA 3O4QA 3DLBA 3QEXA 3TAQA 2G8UA 4BGDA 4M45A 2BQ3A 3IS9A 2ZQBA 2XY6A 2GUIA 4E1MA 4F5PA 4FM2A 1JLQA 5KT4A 5KTQA 5DG9A 4RQ0A 4Z4CA 5KFSA 1WAJA 4W5OA 3L8BA 4I2CA 2XRIA 5CWRA 5DB6A 5DBAA 5IIMA 3Q8MA 2W8KA 3AVAA 2JLEA 1D5AA 1X1PA 3LAMA 4KKOA 1YVUA 4QZAA 3TABA 3SV4A 5C5JA 4DOBA 5CR0A 2YNGA 3GV7B 1S76D 1LAVA 4E7LA 4F4KA 5HBMA 3M8SA 2PI5A 5KT6A 2BE2A 5KFXA 1EXQA 4LH4A 3BQTA 9ICWA 4E89A 3Q8SB 5IIOA 4FJXA 3SUQA 4MF2A 4J9MA 1QTMA 2R8HA 3LK9A 4E7JA 2C2RA 1JIHA 1S5JA 1VSLA 2B21A 2PFQA 4KLSA 1RT6A 9ICQA 4FW1A 1CZBA 2ZJ5A 4RW4A 3C2KA 1LWCA 3V6JA 9ICKA 5J0TA 3OS2A 4DU4A 1XWLA 4LZDA 5KG2A 9ICCA 4FM1A 4E3SA 4DS4A 1BL3A 3QLHA 2V4QA 4QZCA 3KK1A 1JL2A 3CM6A 3T5LA 2YNHA 3G0ZA 5T7BA 1UA1A 4DF4A 4NCBA 1RBTA 4R65A 2G8IA 4CJUA 2FPKA 1HMVA 3H8JA 1RDDA 4O3RA 3LP2A 4RU9A 3UXPA 1NKEA 4CFDA 1NK8A 1G15A 8ICPA 1WSGA 1F21A 3PV8A 8ICZA 4N76A 2W9CA 3VQDA 4RG8A 4RW7A 4YVZA 4KI6A 5J0RA 3H40A 7ICJA 4IFVA 2Q0ZX 4B9VA 4G3IA 5KFWA 1NKBA 4KRFA 4M3ZA 4DSKA 3PW2A 3DMJA 1S6PA 3VQ6A 4Q8EA 4E7IA 1BPEA 5CB1A 3H4DA 1NK6A 3OYAA 4RQ6A 4YR0A 3K58A 4M42A 3BDPA 4DFJA 3AVNA 3AO2A 4UBCA 3ZDCA 1S9FA 2HHQA 2IAJA 1KLMA 1LWEA 4EEYA 4M9HA 4YMOA 3C5GA 3QNOA 5KFCA 3DLHA 4N41A 2V4RA 4O3QA 2QKBA 1QSLA 2Z1IA 3RR7A 4CHYA 3I0SA 4OVLA 5L1JA 4QWCA 4LH5A 5I3UA 2Y1JA 2ZUDA 4DWIA 3PR5B 4EP5A 4XUSA 3S3OA 2NRXA 2YV0X 5J2QA 3I8DA 3RMAA 5KFAA 3AVLA 3RMCA 5J2CA 5KGXA 4RQ2A 1RBRA 4JV1A 7ICVA 3GIKA 7ICRA 4KN7A 2RF2A 5IINA 8ICLA 1ZJNA 4B3OA 3GQCA 3G10A 3NGYA 2HW3A 2KZZA 4IQTA 1ZQMA 4PHPA 4KLLA 2G8HA 2OZSA 4HCCA 3KLGA 1ZQUA 2WONA 4R63A 2BANA 1FKOA 4R8UB 3V9UA 4N56A 4RUCA 3FDSA 3M8QA 9ICEA 1TV6A 2FBTA 5C24A 1CUKA 1HUOA 3VQEA 5DK5A 1I3AA 9ICSA 3HJFA 3V7JA 5J0QA 4CF0A 5C42A 5DGAA 8ICJA 2BCUA 4UAWA 4HVJA 3SPYA 2FBXA 4OJRA 1C0UA 3GV8B 5CA7A 2F1JA 3QEPA 1IKWA 1NK4A 3TARA 4DSEA 1J5OA 3MXJA 4CFCA 3V9ZA 2PZSA 5DB8A 2F1HA 1BI4B 3AO3A 1JXBA 3HL8A 1B43A 1MQ2A 1QLNA 3ZD8A 5HMMA 2BCQA 3VQ9A 4UBBA 8ICNA 1HRHA 4RQ4A 3V81A 4WE1A 1CLQA 1EXNA 4KPYA 1BCMA 3C2MA 4CHZA 5D4BA 1XHXA 5F9LA 1S6QA 5C25A 4W5NA 3RMDA 3MR5A 1JLCA 4G1QA 1RTHA 4P4OA 3S3NA 1Q9XA 3LWMA 2C28A 1ZQAA 1DGSA 2EHGA 4KFBA 4CIFA 3KJVA 1QS4A 1B9DA 3KLHA 4CHQA 4EYHB 1C0MA 1XHZA 2ISOA 3ZSZA 3AU2A 5KGWA 1ZQJA 1BQNA 4DFMA 3T5HA 2XY8A 4O4GA 4CF9A 3SUOA 4Q5VA 3SV3A 4CEQA 1RYSA 2QK9A 5CYQA 1TL3A 3QE9Y 1BPBA 4F5QA 4YP3A 1ZQRA 4DEZA 1Z3EB 2JZBA 4IR1A 4H4OA 5EWFA 1VSFA 3RH6A 4M3XA 2IBKA 2P1JA 4O55A 3NF9A 1WAFA 3H08A 4W5QA 1SKWA 4H4MA 2XO7A 4KLMA 2BCVA 3B6PA 4KHQA 3K5MA 3RB3A 5HRRA 2FMQA 1HQEA 4M0AA 1JLBA 5L1IA 4PHAA 4QWEA 9ICVA 3C1ZA 2W9BA 2A1JA 4ECUA 4XA5A 1BPZA 2R8KA 2DFLA 5BOLA 2A1JB 4O0JA 3AO1A 3LWLA 3D45A 3ZSVA 1BVSA 5KG5A 5KT7A 3MFHA 4RQ3A 1XI1A 5HNKA 4J2EA 4FLVA 3OYJA 2PYJA 4YMNA 3ZD9A 1TAUA 4KLTA 3L2VA 3HSTB 4I27A 2OWOA 4JV2A 5KFVA 4DL2A 2J6SA 7ICGA 1BIUA 2P5GA 3ISDA 4QZ8A 3TFRA 4Y1CA 5KFQA 8ICMA 1ZBFA 3H8WA 4FJKA 3G6XA 4O9MA 1WNSA 4QZDA 3PW4A 8ICSA 1TGOA 3HPGA 4IQVA 4I29A 9ICXA 3Q8RB 5KFGA 3MGHA 3RTVA 4ED2A 1X9WA 2UVWA 4DTXA 4CCHA 4O3PA 5D46A 4EP4A 2XY7A 4CJTA 3VA0A 3LPTA 5DKWA 2VA2A 2JEJA 3VQ7A 4QZBA 3ZCMA 2OPSA 1BGXT 3OHBA 2X6SA 4Z6CA 5DMRA 1KFDA 4QW8A 1N6QA 4O5KA 4CFBA 7ICMA 2AQ0A 4YMMA 2EX3A 1RZTA 3MBYA 3O4NA 4YG2A 1XSPA 5KG7A 2KFZA 4UB1A 1S0OA 4IR9A 2B6AA 7ICQA 4DQPA 3QEVA 3KHRA 3MAQA 1IXRA 3OYEA 1GOCA 1GOBA 3MGIA 2B5JA 4CJKA 4J9RA 3KKRA 4BE1A 1BPYA 4CFAA 1C1AA 2ASLA 3NGIA 3P5JA 4F50A 4J2BA 1WN7A 3SI6A 5KFZA 4KLEA 3KIOA 2C22A 1IG9A 3AV9A 4QZFA 2GV9A 4ZTJA 3WNGA 7ICIA 4RPXA 5HLFA 1T3NA 3HVTA 1ZQYA 4GXKA 2DTUA 2BDPA 8ICBA 2ZTDA 3T5KA 3AVKA 1ZQPA 4DL7A 3LALA 3K5NA 4YR2A 5J0UA 2E6MA 2IOCA 4KMUA 4MEYA 1WSHA 1HJRA 3HW8A 4MFFA 1RBVA 4CEFA 4FCYA 3SQ4A 2G8FA 1S1XA 1IM4A 4F2RA 3QERA 3K2PA 3VQBA 4FZZA 3DRPA 1HYSA 5J0YA 3HT3A 1SL1A 7ICHA 5J2IA 4EBEA 1JLAA 5HROA 1KVBA 4MFBA 1I39A 3ZT2A 4E7HA 3V6KA 1VSEA 4DL3A 2C2EA 4OLAA 4M9LA 4KHSA 4CJRA 2I1QA 1TK5A 2DFHA 1HJPA 3O3GA 1LV5A 9ICJA 3LP3A 2PYLA 4RZRA 3NBPA 4B9NA 4B9MA 4EYIB 5J2JA 4CJWA 1U47A 2LYHA 1TAQA 3NTUA 1SZPA 5KRTA 1VSDA 3MR3A 2HHVA 3QZ7A 4UB5A 3B0XA 2VWKA 3SUPA 4NYNA 3HX0A 4UAZA 1RDAA 1Z00B 5DDYA 3RB6A 4TSXA 4QZIA 2HHUA 4W5RA 4EZ6A 2R7YA 2ASDA 4BE0A 4FJ7A 3OJSA 2YKNA 3NH0A 3T3FA 4BWMA 4FS1A 4LZGA 2AJQA 5J2GA 4UB2A 1NKCA 2KZ3A 1RT4A 2AGQA 5DGBA 2XCAA 1U04A 5HHIA 4PPXA 1RBSA 4KB1A 2FMPA 2R8IA 2RKIA 3DRSA 1IKXA 4FJMA 1K1SA 4J9OA 1XO1A 3TANA 4OKKA 4KLQA 5FDLA 5KG1A 1HYVA 4IRCA 1L3SA 4W5TA 1X9SA 4K4HA 5CHGA 1DTQA 1S0VA 8ICCA 4FLYA 3PO5A 4R64A 3C95A 3LPUA 2UVUA 5DG8A 1VSJA 2AGOA 4AHRA 4M47A 3OYBA 3PX6A 2HHXA 3HO1A 4CJEA 1HPZA 2AQ4A 1WSEA 3NH1A 4BDYA 4FK4A 4O3OA 3IG1A 3OYMA 3QIPA 1U45A 4P4PA 5L1KA 2BKEA 5HP4A 1J53A 3ZDEA 4JWMA 5BPCA 4YR3A 2BR0A 1XC9A 5KFTA 3ITHA 1ASUA 1DTTA 3RB0A 4OGEA 3MDAA 2VWJA 4RQ8A 1ZQZA 3HWTA 3RB4A 1WCLA 3PX0A 3K5LA 2FBVA 3H7IA 3V9SA 4F4WA 3UXOA 2P51A 3DLEA 4F4XA 3G6YA 2D0AA 4FVMA 1HUZA 4ECRA 4K8XA 4FJ8A 9ICOA 4M3WA 3C94A 4B9UA 5KFDA 3KHGA 3OYKA 5D49A 3PR4A 3AA4A 1TKZA 4DTSA 3C6UA 1T03A 4HHTA 1WCNA 2OPRA 1MC8A 3NF7A 4DF8A 2G8WA 3KKSA 1KFTA 4NCGA 4DS5A 3DLRA 1VRTA 4DTOA 3EW9A 3JPNA 4KAZA 4M9GA 4NM1A 3U3GA 4ZH4A 4XIUA 5KG4A 4ID5A 4FLZA 3SI8A 3KK3A 4FLXA 2QKKA 2M9NA 1VK0A 4YQWA 3RRHA 3H8SA 4IBNA 2UVRA 4JK1A 3HVRA 1CZ9A 4FW2A 3V9WA 4O5BA 1ZQSA 4KV8A 4UAYA 3RRGA 1W9HA 1SL0A 4LSLA 1ZQQA 4KTZA 3VQAA 4TUSA 2HVHA 3AVIA 3CFOA 1IKYA 4NXZA 1NJXA 3Q8LA 5IILA 3V9XA 2YKMA 9ICAA 3EYZA 9ICIA 1NJYA 4ED3A 4DL6A 3OYCA 3KD1E 5SWMA 4M04A 4I2JA 3NAEA 5KG3A 4IKFA 4ECVA 2KQ2A 4DTRA 4UQGA 5J2PA 4IDKA 5CY4A 5DB9A 4CGGA 4KREA 4FXDA 4CK3A 2IGIA 1LW2A 3DLGA 1ZJMA 3KLIA 5KFLA 4TUPA 4HYKA 4I2QA 4EZ9A 4I2HA 1S97A 4CF1A 3HP6A 1TKTA 2Z1JA 4YCXA 4MFAA 3RJEA 3PUFA 4Z4EA 2NUBA 3GIJA 5FRMA 3M9NB 1SL2A 5KG6A 5CZ1A 3RJHA 1ZQBA 1RNHA 3AA2A 1ZQXA 3HXMA 4M3TA 5J2MA 4GXIA 3OS0A 3NF8A 4QWDA 3SPZA 1RCHA 4RNMA 1HNVA 1BI4A 2GWSA 3Q8KA 3SYZA 3WNHA 4KI4A 4BXOA 4FZXC 4DOCA 2KTQA 2OPQA 3HP9A 5J2NA 4YD1A 1QE1A 2YNFA 3SQ2A 5TZVA 2R8JA 4QOZB 1TV9A 3C2LA 3ORYA 4I2FA 3K75D 3RBDA 4Z0UA 1U48A 3DOKA 4MQ3A 4FLUA 3M8RA 1KDHA 4CK2A 3AVBA 1KLNA 4I2DA 5KRSA 4I9LA 1ZQFA 1D8YA 2R8GA 1ZQLA 4KHNA 5DQIA 2ITGA 2ISPA 1VSMA 1L3TA 4BE2A 4F3TA 3AVMA 3KD5E 3AO5A 1JX4A 1A5WA 2JGUA 9ICLA 1T4GA 3PX4A 3L2UA 2XGQA 3QINA 2QXFA 4ECXA 5J2EA 4DFKA 3G6VA 2RDJA 1WSJA 3RAQA 4PA1A 3NDKA 3UIQA 1ZQVA 2A1SA 3GDXA 3OS1A 3GV5B 4FZYA 4E1NA 1U4BA 2D5RA 2HNYA 5CJ7A 1TFRA 2UVVA 3BJYA 4DTMA 2FPLA 1JMSA 1T7PA 4BWJA 4C8MA 3SZ2A 5DQGA 3I0RA 4AHTA 1SKSA 3EPIA 3CFRA 4CGHA 4MFCA 1JKHA 5DB7A 1QQCA 3ZSWA 4DTNA 4J2DA 3ZSOA 1MSWD 3CM5A 5J1EA 3NGDA 4ICLA 3T19A 2OYQA 4L8RB 3SCXA 1VSHA 3JPSA 5KT3A 5DG7A 2HNDA 1IKVA 1RDBA 1Z26A 1BHLA 3TFSA 5BOMA 2FBYA 4AHVA 4M6WA 1ZQKA
chains in the Genus database with same CATH superfamily
5M2RA 5GAEI 7ICFA 1M5OC 3VQ8A 5D4NA 3N4MB 3G96A 3EJMA 3H8MA 1WLJA 5KFUA 4RQ5A 2H51B 1AFIA 4X64K 1CEZA 2ZEJA 5AQYA 3V1RA 4J03A 4DLGA 2BRLA 2VASA 4OJ3A 5KQ8A 1R0AA 4UARA 1YX2A 2Y8YA 4ZS6A 2ZKTA 4X4VA 5HP1A 3FRYA 1KBRA 4ZPBA 4OYOA 4FE3A 4WJBA 1LWCB 4XPCA 2DO4A 5RUBA 3AO4A 4RT3A 1Q8IA 2XYPB 3QJLA 5EWEA 4L73A 3BQ0A 4X62K 3N6MA 4UUXA 4JV5J 4BRNA 2ZWPA 2HOEA 1UVIA 2DFFA 6FDRA 1HWKA 4FYWB 3BSOA 4QWBA 1RKJA 1KQQA 2FHOB 2X1BA 3NOCA 3W5YA 2RN2A 1N52B 2KN7A 3MFIA 3TSPA 4CIEA 3MDFA 1UJ5A 5H9FK 3KG1A 1NJZA 3ATVA 1KFSA 1D9FA 3CJRA 4PEOA 2R7UA 2KKVA 4Y2SA 4LFAJ 2G8VA 1F5AA 1U8SA 3LZIA 3R6MA 1ITGA 4MEXA 3KHYA 2NYIA 4O3MA 4ECSA 5AKJA 2UU9K 5HO4A 1WF2A 3VCBA 2FDRA 4DB3A 2RT3A 1SQEA 9ATCB 4NLNA 1MG7A 3UCZP 4ZTFA 2PEBA 2BW7A 2XSJB 2ZKUA 2DEIA 3UVJB 2XEXA 3TPQA 4K2XA 3IHQB 3VQPA 3OXFA 2AH5A 9ICHA 2E5GA 3E0FA 2OPPA 4DQ8A 3JQMA 4F4ZA 3JPQA 1HJOA 8ICRA 3H4BA 1NK5A 1XSLA 4L75A 5A8WB 4BBYA 3RJKA 3HM9A 4I2BA 2BHNA 4IG0A 2ZIVA 1TKDA 4AYBC 4DV7F 3QO9B 2DNLA 3FQKA 1KEKA 3KK7A 3ENOA 1JXEA 5ALRA 1D9DA 3D68A 3KHLA 3THTA 3MXHP 5LMNJ 1W0HA 4A4JA 4RTFD 1DGJA 1L7OA 5KT2A 4B02A 4JKBA 1C0TA 4NCGB 2CUYA 3HPOA 3L7OA 2PFUA 1TL3B 1SV5B 2HZVA 3KTQA 2HRYA 1SV0A 4PL1A 8ICTA 2IYIA 9ICNA 1WEXA 1S0NA 4CO5A 4IRKA 1FI4A 4WFNQ 2RVJA 4IQXA 3ALRA 5AI5A 2ILYA 3SCJE 2E5HA 3KLEA 1EP4A 4NA1A 3OHAA 4M9NA 3QUCA 3DOLB 4CH0S 2L3MA 2X3DA 1T3VA 1S9EA 4ZMMA 2HF3A 4QAGA 4IOCQ 1KRPA 2HFZA 4F2SA 4ZPWR 3HSGA 1D8LA 3C16A 2RF2B 1KCFA 4LRAA 1NZPA 3DLLQ 5G0RA 4X4QA 1QHAA 2W42A 5KFFA 1TZ0A 4UB6U 1RCOB 4ETZA 1OY8A 2E9RX 5H9FJ 3KZXA 4A59A 2V63A 2H3VA 4OLPA 4LF6K 2HMIB 5AQMA 2KG5A 3M6KA 3GILA 3N97B 2W3RA 1YJNS 4PWDA 4N8OA 3DM2A 3I8BA 2CFXA 3CDEA 3HFKA 1FJ7A 2MKHA 1NGCA 4CW7B 3TACB 1OH7A 2UZAA 5HMLA 4Z6EA 2X3GA 5JU5A 1B22A 3ZSQA 3ZTRA 1UAXA 2DHAA 4CK1A 1YT3A 4P2FA 4H4OB 2W04A 4ID8A 2QFJA 4HTIA 3DYAA 1DGKN 2ZTEA 2HFOA 2GELA 2O8BB 2QMUB 1JN3A 2ZOMA 2HI0A 2XY5A 3OYIA 1TL1B 4ZN3A 5EOZA 3IFEA 1WEYA 1JLBB 5LL6Z 4ENOA 3NCIA 2OA8A 2GHWA 2W9BB 2ATQA 2J7WA 3UE5A 4H5WA 4MYUA 2VD3A 4F93B 2QYGA 3KLFA 2O8EB 4EBCA 9ICBA 1SH3A 3G6EN 4HCBA 4FM0A 4K59A 1JCFA 5BPMA 1GT8A 2C42A 2ALZA 2F8HA 3EDRB 4X4OA 4GVBB 3BH7B 3BGRB 4CEOA 4HTUA 2BUPA 2IJNA 1S5LU 1T8EA 4XPEA 2HBJA 3VQQA 3QJPA 3DRYA 5CA5A 1KVCA 4JV5K 1REVA 3S8SA 3GBTA 3R1HA 5EOYA 3V72A 2HOQA 8ICKA 3L2WA 2DISA 1RDUA 3QT5A 3PYDA 1NOZA 3FFIA 2LYAA 4E7KA 4IQUA 5AXLA 4BGBA 3A13A 3J7ZO 4JI8F 2G0IA 3CPWR 2FF6A 2F7VA 1G2EA 3B0YA 4H03B 3CCLN 1VQ6N 2K06A 2Q3SA 2WBMA 3CGIA 1ZQEA 3FLCO 1WOSA 1U2FA 2Q2RA 4G65A 1NJWA 1H2UX 3HM8A 2VOOA 3WKCA 8ICVA 2UXCK 2YNFB 4KMOB 2IJRA 2XNRA 3F5AA 3TVKA 1F3VA 4ITSA 2HLTA 2OPSB 4ZHRA 1MN8A 4IXCA 5IXUA 1P90A 4RW6A 1C6VA 3H2VE 3S9HA 3ZYYX 4MMOA 2WB1F 5AKLA 1EARA 3US5A 2BYCA 4CJLA 3W2WB 2KJ9A 3A2FA 4CH1A 4M41A 1GOAA 4NZ0A 4X4SA 4M3YA 1BOTO 3AH6A 3QU2A 4NLKA 3VTIA 4P0PA 3U02A 5F3ZA 3G71N 5KFPA 4F3QA 4X4RA 4E98A 4MKVA 3CO0P 1WHVA 1A5VA 2LI6A 4DG1B 4YOYA 4LF5K 3QFWA 4IJAA 1TL4A 4FLTA 5J2MB 4W4MA 1EKRA 2BDUA 2UV8A 1CJTB 1RT6B 9RUBA 4A46A 2DNQA 1BCOA 3GFHA 2E1AA 4PKIA 3QGIA 1AZSA 4HUGA 2MQLA 5CHIA 2FD2A 1YUWA 2A0FB 3FZBA 3JS6A 3KOOA 5EE0A 1ZQTA 5DZ6A 4D3HA 5A6WA 1F2GA 4ECZA 4WWSA 2HEKA 2LM1A 3ISCA 1KSPA 4PHEA 3J7YI 4TU7A 4RL1A 1G4CA 2H65B 1VQOS 1ZA2B 2GJ2A 2BKPA 2ZIXA 1J2MA 5DBCA 3W3SA 3QMLA 4MDBA 4ZKAA 1U2RA 4PGQA 3FBCA 2R7WA 2GWJA 1NGEA 1RHUB 1ZBUA 4KH6A 2QWRA 4DV5J 1D9AA 2AGPA 1Y88A 3MTJA 1LKYA 3T5JA 2KKHA 3MMCA 4PL7A 5JUMA 2PN6A 4V19X 4CZCA 2VKZG 4R0JA 4Z6DA 1KQFB 3M3ZA 1NB7A 2A3VA 4OKEA 5KT5A 2HS0A 2C2NA 1S9GA 4YXMA 2HVEA 1Y4ZB 2E1CA 4LFBF 1LVHA 4YXJA 1ELOA 4KHYA 3ZSRA 2W9MA 2CN1A 4ZCLA 5EGYA 3F9MA 4DU7A 3A5NC 3HCXA 5D6GA 8ICIA 3KLEB 1JLEA 4FJLA 4ANCA 2HAFA 5AKKA 5AFUA 2VIHA 5HVFA 1R8CA 1NDLA 1FRMA 1FTRA 1TVRA 1MWMA 5ALIA 4M3RA 3SFGA 5LMNF 2FLLA 3E2EA 4FK2A 1VYAA 5FRNA 5A8WA 4L72B 3MEEA 3LDQA 5EE3A 5J2FA 2ATCB 2H5XA 4PQAA 2PAVA 1X9MA 2B9WA 4NY8A 2XMKA 1IIPA 2B43A 4YFUA 4DX8H 4F25A 3C1YA 3JS9A 4J9LA 4I0WA 3HPHA 2AX1A 1SKRA 4MH8A 1RWPB 3W65A 4A8YA 1RILA 2I38A 2GOLA 4YOVA 5BRHA 4QZHA 4I7FB 4Y6IA 1S7HA 4OYZA 3UN5A 5F3XB 3JPTA 4JOUA 4RX6A 4R66A 3V6HA 3M5RA 4PGXA 3DXSX 3MUMP 1OY9A 3MXIA 2WAQC 2E8MA 3BZKA 1IJEB 4FZMA 5E26A 2UU9F 4UZCA 4RW8B 5IC4B 1IM6A 1HBMA 4DV6K 4LQ9A 1L7PA 4F36A 5EVZA 5GAGU 2W24A 2CKWA 1N5TA 1YLXA 3BUZB 2WHOA 3SNNA 4DR1J 4CF3A 1FHTA 3KBBA 2F5GA 2LYBA 1FEZA 4WU3A 3CCVN 1TTHB 4TU8A 1CXUA 3AXKA 3PEHA 4CGJA 3BDEA 3MDCA 4X84A 4FDFA 2MUTB 3IAS9 3VF0B 5LSOA 5IIIA 1X4AA 3D6HB 4AHSA 5KFIA 3LVWA 2IDEA 3HI9A 4ZPVR 5FPEA 5KG0A 1T3OA 1R6YA 1XNQK 1DFDA 3AQFA 1NBEB 4ZOSA 1RWOB 4N5SA 2VQEF 1HQUB 2RRNA 2JZ5A 1N56A 2AJFE 3OTQA 2P9SA 2GGPA 5AQFA 2NYVA 2JV3A 5B0EA 4Z4GA 2QE5A 3MM7A 2A3JA 5ETSA 4JKEA 3H1QA 3WBZA 3GFKB 3GDQA 3VQTA 2ZH5A 3IG1B 3QRRA 2P6UA 4U7UK 2PFDA 2MQPA 2LM4A 3GJTB 3W8PA 1RG6A 2A41A 2G5IB 1RAIB 2JEFA 1KVJA 2MKIA 4OI1A 1TE2A 4KH1B 2JWLA 5BN9A 2HIYA 3AVFA 3NS5A 4JKFA 4MN4C 4YFKA 1KN6A 3OTCA 2HWTA 3V4IA 1SAZA 1UEVA 2YY6A 8ICQA 4RQMA 2IRUA 3JSBA 1U8WA 3MEGB 3QAUA 1FERA 3ULDA 4X4UA 3KJVB 1XNQF 1U9LA 4X5VA 1SJ1A 3AVGA 5DLFA 2CRXA 4GKJJ 4P52A 1S1TA 1HHSA 2NREA 2RAQA 2AX0A 2LEPA 2ZJPL 1RA6A 4J9SA 3CC2N 1FFWB 1BNOA 2F1FA 1DK2A 4CJVA 1NB2A 1Y97A 3D6TB 2W9AA 3A5LC 3QT6A 4LF6F 2V2VA 4KGMA 1SH2A 2LA4A 4BHQA 5ALSA 7ICUA 1UVMA 2DL0A 1VQ5S 1SV0C 4OQJA 4TURA 1N36J 1ZETA 5F41A 3M8PA 5AJ3F 1N36K 3O2IA 1COOA 1NNEA 4FJHA 2DNRA 1OJ4A 3CMAS 3NGZA 2NPIA 3WUHA 4JP8A 2WTFA 4WZQA 4C11A 1RBLA 9ICRA 4PY5A 2IA0A 4Q2MA 4LF1A 1GXUA 7ICKA 2YTUA 3A8JA 4ED1A 4P9SA 3SQIA 1J97A 4B9TA 1VQ5N 1RB0A 3PMLA 5GMDA 2R7SA 4KHRA 3PO4A 2ZZMA 4QCLA 2YWEA 2VL1A 2ZXHA 4CEEA 2HQGA 1TK0A 2FQQB 4HTLA 3T1HK 1SBRA 4WP9A 2ZH4A 2EDUA 3WEEB 2O4GA 3K1RB 5A0YB 4KBOA 2IPOB 4CJQA 4NLRA 3EL2A 3TAFA 1UJ4A 1N48A 1ZM3A 1RDWX 1XMQK 2HWIA 4FXWA 4QR1A 3KFUF 2JVRA 4B1UB 1P9YA 3MPYA 3QEWA 4OPHA 4UW2A 3MPVA 5K14B 2WVDA 2F4VK 2E9TA 1M1KT 1DKGD 3OL6A 4JI3K 1BQMB 1SC3B 3GSIA 4OPAA 4F0KA 1NGIA 1QUVA 4NLCA 3DLBA 3TAQA 3D3CJ 3PKMA 1PBUA 3CCJN 4BGDA 1T95A 3IS9A 2ZQBA 4EK2A 3EVMA 2PDAA 3AQPA 3CDAA 4ICLB 5KT4A 5DG9A 4QS7A 2QRRA 1WAJA 3BEGB 4I2CA 3RRKA 4KJIA 2KHDA 1PVPA 2W8KA 2JLEA 4KKOA 4DL0C 1YVUA 1WG8A 1HNIB 2VBZA 2B4UA 3AJ1A 3MEEB 4I4BA 5C5JA 3NRWA 3BGLA 4DOBA 1FWKA 2L9WA 2NZCA 3JSMB 4FWRA 5HBMA 3M8SA 3AB4B 1REGX 2RQCA 3B8AX 4LH4A 9ICWA 3OPXA 3DLJA 4F9OA 3Q8SB 4FJXA 5L8RC 1PUZA 3NUQA 5FLXO 1DLOB 2NPFA 4A61A 4KLSA 2CQ2A 1N62A 2G1DA 3T9NA 2ZJ5A 4RW4A 3CB4A 2BMBA 3C2KA 2F9DA 4WQ5A 1XR6A 4QZVB 4BR5A 2M5YA 2LLZA 4RNHA 5AI4A 9ICKA 1N32F 3DXKB 3J80O 4LVOP 3H6EA 1VLBA 2PMZC 1D0EA 4BR0A 3R5GA 4FM1A 4E3SA 3EZOA 2J0SD 4WCEL 4BRDA 1TUWA 3GTYX 2V4QA 3TJAA 4QZCA 2XMAA 2RDDA 1H72C 5H1SV 1VQKN 3S1TA 3G0ZA 4AT1B 2PFFB 3UO0A 4NCBA 3MM8A 2WF9A 1RISA 3ET6B 5KL8B 1WBDA 1U1LA 5MLCQ 1KN5A 2FPKA 1HMVA 3H8JA 3AGRA 2Y0SF 4A5BA 1NK8A 2WK4A 3GFYA 1G15A 5C10A 2I9SA 5E3QA 3PV8A 4N76A 1X5OA 2D4WA 2NXUA 2X51A 3ILIA 3IO1A 5AIAA 2OAUA 2E9ZA 4KI6A 5J0RA 7ICJA 4IFVA 4B9VA 2Y9UA 2WHEA 4KRFA 2G09A 2AYBA 1S6PA 5BRFA 3IDHA 5CR4A 2DT9A 5CB1A 3H4DA 2KRRA 4KX3A 5ETQA 4LR7A 2OJ3A 1LWEA 4GO7X 2KD1A 3C5GA 3DLHA 4ILMA 1MMNA 3GFXA 4ISGA 2O5DA 5GAHI 2Q66A 4CHYA 3I0SA 4QWCA 1NWKA 2JC1A 1J5EF 2J0WA 1T02A 1YBTA 4P74A 1HARA 4EP5A 4XUSA 4Q2LA 2H9ZA 1IKYB 3D1QA 5KFAA 3ENQA 5KGXA 1E6YA 2ASOA 7ICVA 4EHUA 3HSJA 2JHEA 3E9OA 3E3XA 2XI3A 4QOTA 4CZMA 4B3SK 2RF2A 5IINA 8ICLA 4DJBA 1ZJNA 4OZJA 3UCGA 2OMOA 3V6DB 3LTOA 3G10A 3L3CA 2XSFA 2HW3A 2E66A 1L6NA 4KLLA 4FKXA 1WHXA 5AQRA 2NZ4A 2OZSA 4HACA 2BJ8A 4FN5A 2WUSA 2QO3A 3HOTA 3D2EB 4ZP7A 4U9RA 1ZQUA 4RWXA 2BANA 1FKOA 3OFEA 1UFWA 1HWUA 4P71A 3CIMA 3DXMB 4OJ5A 4KT0C 3VQEA 2DITA 2BACA 9ICSA 3UWTA 3CCSN 2BVZA 3FE1A 3GYGA 2H1YA 3MAAA 3GJRB 3SPYA 2AJ0A 4OJRA 1YZ7A 4MYTA 4HI2A 2F1JA 3AQOA 4ID5B 4Y2YA 2J8SA 2JR5A 2DO0A 4DX5A 2RRBA 3VTHA 3ETOA 5DB8A 1X31C 2Q43A 1RQ0A 3CCRS 2EZZA 5HJXA 1M90O 4O5FA 3ZD8A 5HMMA 5EX5A 4UBBA 1HRHA 4Y2KA 4K43A 3MMBB 3V81A 4DR4J 2KEYA 5AKGA 3TEGA 1N33K 3LH2S 5J1NA 4JKHA 4KPYA 1N33J 1TFWA 5D4BA 5F9LA 4CLFA 1JLCA 2DNMA 1Q82O 4GKKF 4UOFA 5B66U 2C28A 1TKZB 2XNQA 3ZETB 2Z56B 3I56S 4CIFA 3TR5A 3KJVA 3THPA 1B9DA 5AE2A 4B1YB 1ZBTA 4WQ4C 1C0MA 2PIIA 4ZPCA 3EVOA 3U26A 1PVRA 2MHNA 4ES1A 4UY8T 4WQ4A 3SV3A 4BRPA 1TELA 2I2YA 4UTGA 3P45B 5K8MA 2GVZA 2KXNB 4H4OA 2DNZA 4IFYB 2O01C 2YH0A 2EFPA 3QIPB 2YMMA 3H45C 2P1JA 3VETA 4O55A 3H5YA 3HILA 1LWFB 1WAFA 2FJWA 4ZP9A 2XO7A 4KLMA 2BCVA 4CTAA 3JSYA 2APOA 2OEMA 4CDIA 4QWEA 3K0SA 2F76X 4WTOB 2W9BA 5D0GA 4XA5A 2EANA 5AQPA 5H9EK 2DBBA 3M2RA 2KL8A 1YI2N 2QL9B 5GTHU 4JHDB 1BVSA 2J9EA 3ZSVA 2GIQA 5KT7A 2L41A 1XI1A 4ZVRB 1OW5A 3CPEA 4U7UD 3CCRN 3OYJA 3ZD9A 1TAUA 2EC2A 1SC1B 4M5DB 4ZJOA 2B4OA 1H0HB 2CIMA 3KWMA 4NB4A 1U1RA 4I27A 4YHHK 2J6SA 1WYGA 4LF5F 1YI2S 4QZ8A 3W62A 4Y1CA 1ZBFA 2FC8A 4CF4A 2NO5A 3N5FA 1TUYA 2CJXB 3H3OB 3OW2M 1VJWA 3PW4A 2M8HA 1KWMA 3CJKB 1XBWA 1VDHA 4IQVA 4JI0F 3Q8RB 2CZ4A 3BF4A 2UVWA 3EZUA 5K5MA 4CJTA 1UQVA 3LPTA 2VA2A 4K4YA 1AZSB 3QU7A 1TL5A 4MTPA 2OPSA 3R8YA 4ZHRB 1UVNA 3WK9A 4Z6CA 3A0HU 4EUVA 4FKYA 3MBYA 4MDAA 4WF9Q 4L74A 4YG2A 1KXPA 4D3GA 3T1YJ 2IBOA 4MAKA 3TEHB 3A3PB 5JVGL 2CPFA 3POTA 2FHMA 2EC0A 1GXLA 1S0OA 3J8AA 4IR9A 4QBUA 3MGVA 4KHPF 2L9NA 2I7NA 2QWMA 3FNNA 4G9BA 2ZM6J 3OYEA 1JROA 4H0TB 2HBYB 2OI2A 1JLAB 3W8GA 4KO0B 4MFBB 3AXMA 1J2VA 4CFAA 1WELA 1IVZA 1RT2B 2OGUA 3P5JA 1RT3B 4F50A 4QJFB 2XMMA 5CD4H 3JXUA 5KFZA 4Y34A 3L09A 1IG9A 2GMHA 1NPPA 2HBLA 4LREA 2QV6A 4PG6A 3C29A 3HVWA 3U1MA 2H4YB 5A8RA 1EKSA 2IVFB 3G25A 4JV5F 3EGVA 3H0MB 4G9ZA 1ZQYA 3Q8UA 2I6XA 1IG8A 2ZTDA 1S6UA 2G5HB 2NUUG 1UWAA 4OJPA 3K5NA 3CC4S 4CP5A 5HATA 5J2QB 3WXLA 1HJRA 4MFFA 4FCYA 1JB0C 1QAXA 1JALA 2G8FA 1IM4A 1GMVA 4F2RA 3W64A 3TX0A 3T7ZA 4NA2A 1XO0A 4FZZA 2DGQA 5H9EJ 2VONA 5J0YA 1SIJA 1U0SA 1SL1A 3OTOJ 3G82B 5J2IA 1QQNA 1KP6A 2IVYA 1WWUA 2V94A 3GWCA 4U96A 2GZOA 3V6KA 1RFQA 4DL3A 4EX6A 3D0GE 4OLAA 2L5YA 3IGNA 1ZD4A 1DQ8A 1R0AB 4KHSA 7FDRA 3FKBA 3MD3A 1VQMN 1V3SA 1LV5A 3D2FA 2VKQA 5BJRA 3NBPA 2DTJA 2V7YA 3OHRA 4EHTA 5J2JA 2VQFJ 1NUEA 1FE4A 4A57A 4UOGA 3U4LA 1VSDA 1SB6A 2K1RA 3BR8A 5EX0A 4UB5A 3THYB 4Q0BB 4RCHA 1M90T 2VWKA 3KXDA 2LU1A 1NZ8A 3HX0A 4UAZA 1IBKK 5D4OA 1Q8BA 5G5GA 2D8CA 5DDYA 3TSUA 2B4PA 4TYAA 4WP3A 5BREA 4W5RA 2W40A 2R7YA 3FCVA 3L0QA 3A0BU 3C15A 4TU9A 1XUPO 5B0AA 3MN6A 1X5TA 4FS1A 1SXDA 3UW1A 3BPSP 4CZLA 2B51A 4MKAA 3F56A 1CPZA 3AM9A 4UB2A 1NKCA 2WMMA 5DGBA 2E8OA 3G6ES 4Y2CA 4KB1A 2RIJA 3B4DA 2RKIA 1FK9B 3U8XA 1NAQA 2A6OA 1F6TA 1K1SA 2QWLA 4J9OA 4KLQA 5FDLA 1FEHA 4ZVSB 2ZOFA 4NWBA 3IM9A 5DJBA 5CHGA 2LQ5A 2C3UA 2QKQA 1S0VA 2KIVA 4CLTA 2HQ3A 3W1YC 4FLYA 4R64A 1FRLA 2IAJB 3N9UC 2W11A 2HPUA 2ZM6F 2GX9A 3F5TA 2P9SB 4O8KA 4KHPJ 4M47A 1KONA 4CJEA 2AQ4A 4IZ9A 1T44A 3FMWA 1WSEA 4CD1A 3OYMA 4OJ6A 2W01A 3T1YF 2HBQB 1VQ9N 3GSDA 5BPCA 4YR3A 2ZBPA 3JXOA 1X4EA 4P7VA 1DTTA 2MHEA 2VWJA 1MN7A 1EO1A 4FF1A 3PX0A 3CCSS 3K5LA 3D7EO 2FBVA 3H7IA 1VOMA 3UXOA 4QPXA 3FAHA 4LF9F 3VEXA 4AFFA 2WF6A 5D8HB 4NLUA 1HLWA 3W5ZA 2VFSA 3CO9A 4O23A 2RQ5A 2FJAB 5IT4A 1TKZA 2UUAJ 4NRUA 2HBMA 1Q5VA 1RHKB 5HJYA 2MXYA 2RP5A 3KKSA 4CVNE 2EBGA 2CDQA 2D3OR 4NCGA 3A5OC 3DLRA 5G5HA 4Y2JA 1VRTA 4NLYA 2D3UA 1APSA 3EW9A 4YN3B 4DV4K 3O44A 3RW6A 4NM1A 2KN4A 1RTZA 4NZ6A 3CP8A 5KG4A 4Y2MA 1YJUA 3CRXA 1VK0A 2XSJA 1BE4A 4FW2A 3V9WA 4YMEA 1HHQA 2OEJA 3CJKA 1F0XA 2ASMA 2W41A 4CZIA 4HVZA 2CH5A 1UW4A 3QT7A 4ZPTR 3A1YG 4JI4K 4ZVOB 1UETA 3D5MA 1X0FA 3I5BA 4IC9A 1TUGB 3CFOA 1XMOK 2XG8A 3EYZA 3OT9A 1QVFR 1FRXA 3O9SA 1LWXA 3KJNB 5G0RB 1NJYA 2KHCA 1XNRF 3Q2TC 4I2JA 3HHLD 4X62F 4ECVA 4GVBA 3LW5C 2ZH8A 2VOPA 1R59O 3W2VB 3HKZF 1NHUA 1ZTTA 3A8KA 4B9QA 4DTRA 4UQGA 2RHFA 3J80U 1VQ9S 1JNRB 1VQON 5DB9A 2FHJA 1GLEG 2IGIA 1F2HA 1LW2A 2LXFA 1D8BA 4QS8A 3EVWA 3TO8A 4NLWA 2UUAF 4I2HA 1S97A 4CF1A 1TKTA 4MIBA 1D1UA 4AP9A 2ABYA 4Z4EA 3P31A 1Y0HA 2RRAA 2KLAA 5IS2A 3M9NB 1W7AA 1K9MO 1ZQBA 1RNHA 2K3KA 3U7JA 2F44A 3NF8A 3SPZA 3Q2SC 3S6EA 1RCHA 1HNVA 1O13A 5C2GA 2YKOA 2IRYA 4LFCK 2XHCA 2H5EA 3IR6B 4KI4A 2QLXA 3P49B 4DOCA 4LF4J 5ETNA 1XN9A 4H5TA 3DU6A 1OS5A 2OHFA 4I2FA 1S6OA 3NAHA 2J0XA 1KC8T 2CYYA 2EBEA 3TZWA 4FLUA 3M8RA 3FZFA 2R4FA 3S7RA 3AVBA 1KLNA 1HBOA 5KRSA 2JH1A 4PZVA 1Q95G 1OO0B 1D8YA 3CCVS 5C15A 2ITGA 2ISPA 1VSMA 3GJSB 5F0WA 1CJUB 4F3TA 3AO5A 5T7LB 4IO9L 4CLWA 3BREA 1A5WA 2JGUA 1IBLK 3L2UA 3QINA 2MSNA 1Z19A 4PXDA 4ECXA 5J2EA 2MTLA 2RDJA 3JSRA 3QB0A 1ZM4A 2QX0A 1BO5O 3O1WA 3NDKA 2AEJA 2A1SA 4YY3K 2DR6A 4PR6A 4E1NA 4CZFA 2UVVA 1HA1A 4ISFA 3NNAA 5F2RA 3SSSA 3L6QA 3ZO7A 2MQOA 2G0JA 5M1FA 3DXKA 5ALEA 1JKHA 3ILJA 1G7CB 2BJ3A 1QQCA 1RBAA 1R6VA 4JI0K 4DTNA 1MMDA 2OD6A 4J8FA 1W97L 3TYTA 2V67A 4RW6B 3UD3P 2E3TA 3BGOP 4ICLA 3CC7S 3O5TB 3T19A 1B64A 4L8RB 3PYEA 3DCAA 4URGA 3ZLJA 1VSHA 3JPSA 3CNHA 1IKVA 3CJCA 4FP9A 3K89A 1AUDA 4XK8C 2FBYA 3N6LA 1ZQKA 3S41A 3FZHA 3DLLL 2XMVA 1K9MT 4CLPA 4DSLA 3ZX3A 3WK6A 3KNGA 4Z4FA 4Y1DA 1HBNB 1K0TA 1WOPA 2E44A 2XB2D 3EGNA 2GHVC 2HNZA 1Q0NA 1Q18A 1PBAA 2RD5C 4WF9L 4FJNA 4DQQA 5LT5A 4ED7A 2RPIA 4HR2A 4JKGA 3BEXA 1I94F 3QETA 4FO6A 1DLOA 1JL1A 1WD6A 2GQCA 3LP0B 4MHVA 1EQMA 1S22A 1EETA 4LSNA 2PSZA 3TADC 4JNEA 2VPXB 4PYDA 4IEEA 4KLFA 4UB3A 4K4IA 2DPJA 4CGIA 4BDPA 5ADXA 2P2CB 1OH6A 3L3VA 3LPYA 3HSDA 5AQGA 2J9DE 2JEIA 3MEDA 3T69A 3X1LB 3GIIA 1WG4A 1ZQWA 3LM9A 1JLEB 1LB2B 2DPNA 2Y8WA 4XEIA 1GLAG 3H5SA 3IG5A 1VDVA 2FDNA 1V97A 4L3NA 3NFAA 1F0MA 2HHTA 3GIMA 4C8OA 2JX2A 3MR2A 2E29A 2D9PA 3OXGA 3C23A 1KVAA 3OBYA 3PIOQ 3IP4B 3NEKA 4K5SA 3K0JA 1EX4A 4YOTA 4CHOA 4NO7A 3C8YA 4G1PA 5HMZA 2ZOGA 1KQKA 2IOHA 2W03A 1ZBIA 2CQCA 3NGRA 2ZE2A 4CGZA 4ED6A 2DYAA 4I9QA 2R18A 1DQAA 3I5CA 5D0EA 2ZJQL 2VBYA 4CRXA 4TUQA 4Y2IA 2JHDA 1VQYA 2UU9J 4CHNA 3NHGA 4R5PB 5DQHA 5JS2A 2AYGA 4KLDA 3H20A 2JH7A 1EIYB 4RQNA 3IWNC 4JK9A 2UYTA 2KXFA 3ALYA 5IIKA 4XO0A 3QU4A 4DR2K 3FMBA 5J29A 7ICEA 4CBWA 1NK7A 3BM7A 1XNSA 3JYTA 1X6JA 2ASJA 4FVCA 2LSNA 4ZCMA 2CVIA 3EN9A 4PKDB 3CMQA 4LF9J 4JI5K 3EKUA 1CS4B 3W0LA 4PKGA 2N82B 3N4PA 2EWHA 2FIUA 4PGYA 4K0KJ 2HZAA 1L3KA 3OSNA 4B8AB 5J2KA 1GXTA 3DRXA 1FNMA 3THXA 4M63C 1BPXA 3R9KA 2LKZA 4CLSA 2J6TA 2AZ3A 3DLKB 4B1WB 4C8ZA 3BQ1A 2YX6A 4FJIA 1FRJA 2O6KA 1ZQ1C 3UDEA 2HB5A 4Z4IA 1N0VC 3CPWM 2OPRB 4PL2A 4ZVEA 1TUUA 5JLHA 1V9PA 1C4CA 3I9ZA 4I7FA 5A8KB 1AW0A 4E1JA 4CO4A 1F9HA 1HWIA 3TKAA 4B1VA 4PHDA 2C3YA 5ELZA 1Q8KA 3B6BA 4DTJA 2ZHOA 4FNHA 4GC7A 2XLKA 3SLCA 4GO5X 3NASA 4A48A 2ITMA 1RYRA 3HRGA 2DHHA 3Q86A 4CTAB 1SVDA 4NE9C 4QZ9A 3H5UA 1FA0A 2P6RA 5KFMA 2G2ZA 4Y3CA 3TR8A 3FEXB 2GUPA 1ZQOA 2VC1A 3CJ5A 3FC9A 1X3MA 1S77D 4UOHA 4L6V3 3AY9A 4DV5F 2VA3A 4K8RA 1TMJA 1XNRK 3O6QA 5IIJA 1TK8A 4CZKA 1AROP 3V4IB 2VPYB 5IT9U 3BKFA 4RQ1A 3PFOA 1IKXB 4LVNP 3LDSA 1URJA 4KLGA 2IM2A 4ELVA 5B5EU 2XHBA 3C6UB 3ETRA 3ENAA 5TISU 3BO4A 1YTYA 3QZ8A 1RWUA 2VBWA 2WC9A 3CF5L 1D3WA 5HRNA 5SZTA 2AW0A 3VEOA 2HHPA 1ZOLA 4O0IA 3RJJA 4CI0B 4FWMA 2QARA 2PFPA 2WVEA 4GKJF 4CHPA 2HHSA 1HNXF 3I55N 3CYMA 4ZVPB 3VENA 7ICOA 5L46A 5HRPA 4FYDA 1DRGA 4NXNF 1FF2A 3EEQA 3D0PA 2XWYA 3ZNJ1 2CQPA 4NXMK 1LAWA 1FXLA 3NNCA 2VDHA 1IQZA 4DTPA 2WAQF 4JUZA 2FZKB 2XMTA 1U1QA 3AA3A 1EX8A 3RAMA 2BCSA 4FWPA 1K47A 1BD6A 5IWAK 5J8YA 2X74A 2KG1A 5IWAJ 3G87A 4F5NA 1G1XA 2QZ8A 4OZNA 1RTIA 4LC9B 2V68A 4DBQA 3SQGA 1WSFA 1VRQC 5KNIA 4AILC 1U7LA 4FWLA 5ADXH 1S79A 1FESA 1U49A 5LMUF 1CC8A 3C2PA 4C8NA 4KQZA 2OP5A 2G0CA 2ZBRA 1Q7YT 5IT0A 4EFHA 4W98A 1SJQA 3DDIA 1YITN 2PY5A 3KG0A 2Z30B 3J81j 4KO0A 4TLQA 3ZFVA 2FE9A 3FFIB 1HLUA 2DR5A 3S3MA 3AU6A 1HQUA 2N3OA 3Q8PB 2CNKB 2DY1A 4OI6A 5KFBA 2B7CB 3MM7B 1X66A 3LANA 3H98A 1T9UA 1ZD2P 4KX5A 5E3AA 4AXIA 5ALPA 3TA1A 4ECQA 4DR1F 3QEBZ 3OBIA 1P8GA 2BA9A 1S1VA 1J5EJ 5L1LA 3HT0A 4Q8FA 2V9KA 4KLOA 2F9JA 3PVXA 2CPJA 5JMVA 3POTB 3NMRA 3VERA 3DRRA 3TUPA 3LAKA 3EWAA 5LJ3Y 4QIFA 1KD1O 9ICMA 4DV7K 2AHOB 3CE8A 3E1YA 2GHPA 4AXJA 2RRDA 3TWHA 4U95A 5ALGA 1V85A 2HFNA 4DPWA 1RT5A 4EWTA 1R8AA 2R7RA 3AA9A 2K4PA 1BWEA 2JSXA 1XMBA 3C3LA 5GAEP 4JI2J 2NLWA 4TN2A 4DR7J 2P5OA 4JI0J 2R7XA 2EG2A 4KSEB 2EK1A 1YTUA 4Z6FA 1QZ5A 2WSEC 3DXBA 1QVFM 5K14A 5KFJA 1L3UA 1UW9A 3KYLA 4LF5J 4CEAA 2HHWA 1VQ8S 2N4DA 5J0OA 5KAFU 3BKUA 5DM7L 1I3OB 3C65A 4JS4A 2AJ1A 2KW4A 4JRPA 4NLPA 4FWSA 1Z2LA 1L5UA 3N0VA 4Q45A 3V7KA 3CD6S 4DCOB 1VQ7N 4BXOB 1OPZA 4WTYA 1X42A 4Q43A 5J1EB 1Q3UA 3FBEA 2N4CA 4YOUA 1PJ5A 4KHWA 4NLDA 3R7BB 4YUDA 4JI7J 3NCRA 4JI7K 5E41A 1GMUA 3BBFA 2B0CA 4F5OA 3DGPB 3O4WA 4B9LA 4LFBJ 2VANA 5I42A 2KVSA 2D0PA 1Z4OA 5AQWA 3UKUA 3PYGA 4FJ5A 4NASA 4NYFA 2XMUA 3UQ0A 3WEEA 1NPKA 3S01A 3TZXA 4C2MA 4ELTA 3DLKA 2GO7A 2FGOA 1L8LA 1QQ7A 3VGVA 3NE6A 2ZH6A 4NLBA 4PPZA 3B54A 3BQ2A 2L9DA 3MTKA 3QFUA 5CQGA 5J0WA 3IR5B 1QM9A 4FZNA 5HMWA 2CJBA 1WTBA 2BJDA 5AQKA 4J5OA 1NZBA 5IQQA 4NOHA 4NEYA 1GH8A 2IIHA 3AVCA 2WFAA 5DDRC 3KHHA 3I6PA 4DR3J 2D0CA 2UV8G 2GJIA 2DUYA 4DTUA 4M5LA 2HBKA 4FJJA 3ZT1A 2YHBA 2C2ZB 2K1RB 3SAFA 3RR8A 4LBPA 4TVAB 1FD2A 3D4JA 3CJTA 4DFPA 1Y11A 4ICAA 4GKKJ 4WXWA 1X2IA 4C4RA 3OR1B 1W25A 4LR8A 4OX6A 4C8LA 1Q5YA 1RT4B 2DGZA 4CJFA 1P27B 3V2UC 2VG6A 4LUBA 4DR4F 5ALUA 4C6AA 3LGMA 4CESA 1N5SA 3WK8A 2UXDJ 4Y2TA 1N5YA 1J6ZA 3O3LA 2CNNB 3D2WA 4WYWA 3PMNA 4DU3A 4CEZA 2IVMA 3U3YA 4JI5F 2E1PA 1Q1KA 3OTDA 2BCRA 4JI2F 3UQSA 2CPRA 3I82A 4USIA 2B56A 2BPGA 6FD1A 5E3PA 2H3GX 2F96A 2YCHA 2FVCA 4BC4A 5K20B 4CLKA 3OQ2A 4OIXA 1ATRA 2PXIA 3ZZ0A 3C21A 4JEPA 4FVUA 1DOQA 4LF2A 2CJAA 1UCVA 3MCSA 3KK1B 1L3VA 2KI2A 3HKWA 1OYEA 5ETVA 5J2HA 5EU7A 2IMWP 3PSIA 3ZTOA 4EO8A 4KB7A 4ZP8A 4DR1K 3TAEA 1N5QA 3TZYA 2IS3A 2ZH2A 3SQGB 4LFBK 3ETMA 3ASMA 3VALA 1IG6A 4PABA 4H0PA 1YVFA 5KQDA 3LVVA 4DUZJ 2M9KA 2WB1D 4LY7A 3ZT3A 5HQLA 2IM0A 5CYJA 4O4GB 2A1RA 2RDIA 1X6IA 4CECA 5J2BA 2GQQA 2D1KA 2MQMA 2C3MA 4U8VA 3G8SA 1HYZA 3BGUA 1J54A 3QESA 2XS5A 1FWPA 1S57A 8ICUA 3I96A 4DR7K 1TP7A 4F3MA 2VG5B 3BYRA 1C20A 1JJCB 3MX5A 3KUEA 4OZLA 1N34F 2DGWA 2W4PA 4Z7YA 3O8MA 2BJ1A 1NBWA 3K4GA 1D4XA 4PH5A 1NGDA 3IMXA 2J6UA 3KUHA 2HK3A 2HQIA 2PE8A 4DMNA 2AYMA 3LL3A 4DV0F 1JLCB 2ILZA 3MR6A 1LNQA 1F5CA 2RHKA 1HNXJ 4BVPA 1NXIA 4GMJB 1URRA 4JI6K 1DXSA 4BUGA 2QG9B 4JI6J 4C4WA 3VR1A 1V9OA 4DOZA 4B08A 1N32J 2ESEA 4J2AA 4DCCA 3NY0A 3N79A 3QBWA 1KD1T 2V8HA 5J0SA 4J9VA 2GGPB 4J90A 1TKXA 1NU0A 2P9KB 1SV5A 4OJHA 1VS3A 1T05A 2CQGA 3VN5A 3V1OA 1JLFA 1LWFA 2IRXA 3UNYA 1ZQCA 1ZQIA 3W5XA 4C7QA 3DNCA 2OM6A 2XULA 2FF3B 1Q86T 3T79A 4BS2A 2F1IA 2C2MB 4I2IA 3H2UB 2K4IA 1S9EB 4CLUA 2GNKA 5ALFA 4KY3A 3ZDBA 4HKQA 2OPQB 2YKMB 4ILHA 2I1RA 4RLEA 2E5IA 1HQ2A 3SMZA 4OGCA 2DY4A 3P5TL 2GAGC 1X4CA 2F4FA 2CPIA 2ZH1A 3AEVA 1LK5A 4CD3A 5L9NA 3ZETA 1VQPN 5ALOA 1KL9A 3SJHA 2LU2A 2L48A 4K4WA 5GAGP 1ZYQA 4LF8K 1J5EK 2ZIUA 2ROPA 3BSCA 4C97A 3VGUA 1GX5A 2VFVA 4FBTA 4BRFA 2CQ3A 4ILLA 2FMSA 1GX6A 5GMKa 4RPYA 3ETLA 1VLYA 5DM7Q 4P2MA 2E7XA 2HFVA 1NO8A 1RJJA 3IN5A 4DV7J 2UXDK 4F3OA 1VBZA 1BUPA 4O0NA 2K4EA 3TI0A 5HP1B 1ZQDA 3AD8C 3O4QA 2QN6B 3QEXA 4BQZA 3BPDA 1C1BB 1WNEA 3HKZD 4LF8F 2XY6A 4ETXA 2GUIA 1QCKA 1H2TZ 1V3RA 2G2OA 2YWGA 4P6QA 1HIWA 4W5OA 2XZDB 3RU0A 3TSQA 5CWRA 1NNLA 3D6RA 1IKVB 4B3TK 3KMQA 2BE9B 1NPRA 1L7MA 4QZAA 3TABA 2O66A 2HNDB 1RAGB 3SV4A 4N7TA 2FC9A 5AHXA 4UW9A 4ZIWA 5CR0A 3GV7B 1S76D 1LAVA 1TR0A 4E7LA 5KT6A 2HNZB 3MI7X 2HVZA 2DGUA 1RAHB 2E1RA 2KU7A 3CJSA 2KNJA 4UATA 4E89A 5IIOA 2BE2B 3NLCA 5B8HA 1EZZB 3LO3A 1QTMA 3LK9A 1X9JA 1PYTA 4U67L 1JIHA 2E2QA 4NL9A 1X5SA 9ICQA 3NBPB 3G71S 2AT1B 1CZBA 4BLGA 2XYHB 2R2UA 4CNQA 3V6JA 4AQYK 1AUSL 3OS2A 1S49A 1NH8A 4Y00A 4DU4A 4LZDA 3MCNA 4BVOA 4ED5A 1XNQJ 3UDLA 5TKYA 3HD2A 1HR0K 3KK1A 1QTNB 1IXKA 4USHA 1YJ9N 4TY8B 2YNHA 1YQHA 4EELA 1UA1A 3C15B 5T7BA 4DF4A 4N77A 1RBTA 4R65A 3ADAC 3UFCX 2G8IA 3M6WA 1WKJA 3PRVA 1RDDA 2W7PA 3LP2A 3HKZC 3UXPA 3JB9k 4A62A 8ICPA 2KXHA 4CLYA 1I94J 5ADZA 8ICZA 1K73O 1ITPA 2Q6BA 1X60A 1NRKA 5AKHA 1DAXA 4CO3A 3SCLE 2HF4A 3H40A 1D8ZA 2Q0ZX 4I56A 4DXLA 2DJWA 4RR5A 3OTEA 3DMJA 1OY6A 3CUNA 3VQ6A 5HOOA 1BPEA 1X7VA 2VQEJ 1YJWS 4DFDA 2MQNA 1NSQA 2I5HA 4M42A 2EZYA 1S9FA 2VWBA 2IAJA 3CCQN 3D66A 1KLMA 1ZS6A 3TNVA 1WOOA 2AZ1A 2Z57B 4BR9A 3QUBA 4N41A 4O3QA 4RWWA 1C0FA 4DUZF 1QQMA 5AZIA 8RUCA 1Q4RA 5AQLA 1QVGM 3HZ6A 4IO8A 4C7ZA 2KIWA 1HKBA 1CULA 5B0CA 3G9CA 2ZUDA 4DWIA 2DNNA 3PR5B 1YJWN 2M3DA 2PO4A 1OH8A 2YV0X 5J2QA 2FI1A 2F9WA 4Y0FA 3AVLA 5J2CA 4RQ2A 2YWFA 1RBRA 2WF8A 4ZK7M 2EFQA 1WACA 4B3SJ 2HHHF 1S6QB 2XICA 3NGYA 4H0VB 2R7OA 5FDLB 5HMYA 4Z2XA 3L95X 3EICA 4JYAJ 1ZXOA 3P8BB 4YDDB 3O5BA 4R63A 3V9UA 5AM2A 2MA1A 3CEDA 2ES6A 4QIGA 1T03B 2OD4A 3TU5A 4K5RA 3U27A 9ICEA 1OSDA 1SXLA 3E51A 1HUOA 3CXCM 1I3AA 4WYBA 4J37A 1ZAVA 3M8QB 2PA3A 1SGGA 2ASPA 5C42A 5J0QA 4CF0A 4JKAA 2FVRA 8ICJA 1VISA 1N5VA 3QEPA 1NK4A 2RQ4A 3UNGC 4YDUA 2JL9A 2ZWOA 3OL9A 2MYFA 1B43A 1QLNA 1N2XA 1KR4A 2XLIA 8ICNA 4ZVTB 4LRBA 4LF4F 1CLQA 3PM9A 1YSJA 3QWPA 4HT5A 1BCMA 1FT8A 1IWGA 3E01B 3C14B 4WFYA 5GADU 4G1QA 4P4OA 4QR0A 4L76A 1Q9XA 4KFBA 3KLHA 3BH6B 2ZC3A 4UY85 4OHZA 4CHQA 4K41A 4YOWA 2N3LA 1OVQA 3ZSZA 5KGWA 4DR3F 4U67Q 1WJ9A 3T5HA 4CF9A 4LBHA 1OKJA 1BQNB 1RYSA 1FRIA 3Q8VA 3QE9Y 4F5QA 4YP3A 3I4PA 2KB2A 3M1VA 4IOCL 4IUFA 2NZTA 2VQEK 1HPZB 2K8CB 2AJ2A 3ULEA 1E3MA 4AD6A 3BS5A 1SS6A 2IBKA 1VHXA 4W5QA 1SKWA 4H4MA 4KHQA 2WFBA 3UDVA 2DEJA 5HRRA 4M0AA 2CPXA 2R3VA 4YB7A 3IBPA 1KKXA 4WE1B 5L1IA 2JVOA 3OLAA 2ZFHA 5AQZA 3LGNA 3UCUP 3M2RB 4ECUA 2R8KA 2DFLA 4JI7F 4DN0A 2A1JB 4OI3A 2AP1A 3AO1A 3LWLA 3CJAA 2RS2A 5KG5A 5K4LA 1CRXA 3MFHA 4RQ3A 3K8VA 1H7WA 5D4PA 5HNKA 4G1IA 5DM6Q 2KFYA 4J2EA 2AMCB 2YKQA 3N28A 2PYJA 3PNIA 4KLTA 2YB1A 4GV3A 4JYAK 1E4FT 1RWNB 2OWOA 4JV2A 1RADB 5KFVA 4DL2A 2DCLA 5LL6d 3DGVA 4OYMA 1R0BG 3TFRA 8ICMA 4FJKA 4NRTA 2DHGA 4CI6A 4O9MA 4QZDA 2VPWB 4NMLA 8ICSA 2RUGA 4M8LA 1TGOA 3HPGA 4I29A 3H25A 3VQSA 9ICXA 3MGHA 1RTJB 1X9WA 4CCHA 5D15A 5IM0A 5DKWA 2YNIB 2QB0B 4QZBA 3VAGA 3ZCMA 4WFAL 3F0NA 4QW8A 1K0VA 1N6QA 4CFBA 4F0HA 1U1KA 2EX3A 2GWKA 3TVYA 2KMDA 1O6XA 1E4GT 4M63A 4NYOA 4NWIA 3T9ZA 1X4BA 3CD0A 3HX9A 1FX4A 1R89A 3QEVA 3UKUB 3MM6A 1PVQA 1Y5IB 3SSQA 2HLUA 5EE1A 1PJ7A 4ILRA 1VQSA 2KV2A 3PTWA 4J9RA 3NGSA 1S72S 1T6CA 2QB1A 3RSEB 3NAIA 1MW7A 2C3PA 3MAHA 5HL7Q 3WXMB 3ED5A 2V2ZA 3SI6A 2C22A 3LA0A 1XTZA 2A6AA 4QZFA 2MKYA 2AD9A 2RHSB 4W92B 2VFUA 3D1HA 5F3TA 3IP0A 4LSNB 3HHLB 4CT8A 2QEXS 5LMUJ 1Q86O 5JVGQ 1FJGF 3T5KA 2IY5B 5KPRA 1IUJA 4YR2A 1DT9A 5J0UA 3WZ0A 4OHWA 3VVUA 3B9JA 4DV2K 2P8IA 3RF9A 3KFWX 2WBRA 1UMJA 5CE3A 2GVDB 5ALZA 1TYQA 3CVKA 3PIPQ 2YI1A 2Y0BB 3QGPA 3VQBA 2Y9TA 3FZMA 1VAZA 2VKRA 4JK8A 3HT3A 2DRAA 5BPNA 2VQFF 3BO3A 1RACB 2V69A 4I6WA 3VV2B 4EBEA 2W7OA 4C0OC 5HROA 4BR4A 2ZH3A 1NLKL 2QGFB 4E7HA 3I87A 2C2EA 1UEKA 4M9LA 1FX2A 1SH0A 4CJRA 3NRBA 2I1QA 1B70B 1HJPA 1XC3A 1JJHA 3FZKA 1BA1A 4Y2RA 4EYIB 3OTOF 1U47A 1ZC6A 5CEHA 2HHVA 3IA0A 4HAIA 1ZD5A 3HVTB 3TVZA 3MOZA 4BG9A 3A0IX 2J0QD 2CA9A 1RDAA 2GW8A 3ILLA 3PDNA 3CW2C 2HHUA 4EZ6A 3TP2A 1A6LA 2ASDA 1VIOA 4QIWF 4QIWD 5ALJA 2XBPA 3RUBL 4BWMA 1HBMB 4LZGA 3MMAA 2EAPA 5HK4A 1FKPB 3CCQS 4DZ6A 1RT4A 4DPTA 2XCAA 3GJQB 3HHEA 5HHIA 5GVQA 1RBSA 2CPEA 3FM9A 1VK3A 4YY3J 3QICA 2KYXA 1NMEB 4FJMA 4OKKA 1HYVA 2D0OA 4IRCA 4V19J 2QWQA 4OCZA 2HGNA 3QRQA 4F0MA 8ICCA 3AAQA 3EZWA 4PCQA 2IDLA 3EGWB 3KJFB 2LA6A 3SXLA 1UEUA 3C95A 3CJ1A 3LPUA 1NDKA 1C0TB 2LEBA 4FWNA 3DAWA 1PYSB 3ZTSA 2AGOA 3WXJA 2QA1A 1PGZA 3OYBA 3NVYA 4JAXA 3HO1A 2KT5A 1HPZA 1YVNA 3OA9A 1UZDA 3FC4A 3NWRA 3NH1A 4FK4A 3IG1A 4USUA 1U45A 4P4PA 4DCJB 5AQIA 4PG5A 4M94A 2R7TA 2KOBA 3CCES 5KFTA 4PXCA 1ASUA 5MAOA 1IR0A 1ZQZA 1FDAA 3M8YA 2KHQA 3RB4A 5ALWA 5CABA 3DLEB 2CWKA 2HGLA 4BG8A 3V9SA 4F4WA 4C8YA 2WBNA 4F4XA 2V2KA 1UZHA 2D0AA 1HUZA 4ECRA 3MM5A 5HL7L 1ZPWX 5DDPC 3L9ZA 3C94A 3ISND 4BRHA 2HFSA 2HRUA 3WK5A 4B9UA 2JLFA 1GQEA 4BRQA 5KFDA 1U26A 1P6TA 4RWTA 4X66J 3NS1A 1WORA 4DR2F 3HULA 3C6UA 3HSZA 1WCNA 4HHTA 2OPRA 1GLLO 3KLHB 1SV4A 3NF7A 4DF8A 5LXYA 2Y1RI 4AE5A 4XDDA 3RGIA 4I2QB 2HQDA 4IH7A 4H4KA 4DTOA 2ZUGA 4CO0A 3IUCA 5ETRA 1ZAXA 3U3GA 3LDNA 3CJ7A 4XIUA 3SI8A 4OX8A 2OUGA 4YQWA 3RRHA 3WIVA 3AFGA 2UVRA 1XMOF 4O5BA 4LFAF 1B0PA 5E79U 4IS7A 1ZQSA 4KV8A 5H2FU 3VOVA 4DU8A 1SL0A 1W9HA 2NNWA 3WT0A 2F8EX 4IO9Q 1IBKJ 1SKUB 5KOWA 1V38A 4JI1J 2WSCC 4NXZA 5BYSA 3Q8LA 2B9XA 2VFTA 4ISEA 9ICAA 3O1LA 4PZOA 9ICIA 3HHLC 2QFIA 4DL6A 1RTHB 1KOOA 3OYCA 2O67A 1S3XA 2V51B 4OYBA 3JTNA 4IKFA 3SIPB 2XIDA 4S0MA 3KVGA 1KS2A 2A19A 2COLA 2KQ2A 4CYUB 4HACB 1BXNA 5J2PA 3D6MB 4IDKA 5IV4A 1FFGB 5E3CA 3EGZA 3C19A 4E2FB 2GA7A 5A0YA 4FWQA 1KQSM 4TUPA 4GVLA 3KJQB 1W2BM 4EZ9A 1DJ0A 2RU9A 3HP6A 4MFAA 1N34K 1JCEA 1TQLA 3MAAB 5KG6A 2VH7A 2YWHA 4M3TA 5J2MA 5BR9A 2V0NA 4QWDA 2I5JB 2LXIA 3Q8KA 3WNHA 4JI3F 3VGLA 1FO1A 2GJFA 5D0RA 2OPQA 4L3KA 5LSRA 2YNFA 2IIRA 5TZVA 3QNMA 5KPZA 4QOZB 2EI5A 4P2XA 2W4CA 1XIQA 4OZ2A 3K75D 3RBDA 2CJKA 4Z0UA 4MQ3A 2MU2A 2Q3PA 3H8YA 4DX6A 1ZQFA 1HW9A 2GX8A 1CG2A 3HRDD 3BYPA 2FVQA 2BE7D 4MO4A 4HWIA 4C4SA 2DIVA 1VHIA 3IAM9 3CCJS 3VAIA 2QXFA 1K8KB 5DM6L 2P6TA 4P0PB 1BNPA 3ZTPA 2W25A 4DFKA 3RAQA 2GTDA 3RG6A 2BX6A 4PA1A 2R2SA 3UIQA 1ZQVA 1N5WA 3KNAA 2YX4A 1FNOA 4AL6A 1TFRA 3PIOL 2FPLA 1M5HA 1T7PA 4BWJA 4C8MA 3I31A 5DQGA 4AHTA 1Y5LB 2VYPA 3EPIA 1P1TA 2OYYA 3CFRA 4KBIA 4MFCA 2KRBA 5DB7A 5K9FA 3E66A 4M5GA 5ALVA 3CCWA 4J2DA 3ZSOA 1MSWD 2VJUA 3CM5A 1NM1A 4Y2AA 3VEZA 5BXIA 3TX8A 2CPYA 2RUSA 3NGDA 5CH7B 2IVPA 5KT3A 1DZ5A 4J91A 3TUIC 2HNDA 2LP4A 3DGPA 1VQ6S 2FYXA 1RDBA 2OLWA 1N5XA 1BHLA 5AKEA 1H7XA 4BRMA 5BOMA 4AHVA 3WQUA 4M6WA 2BEFA 3DRPB 1X4HA 1WHWA 2DH9A 3ONNA 1GLBG 2IHMA 5ETKA 3RZAA 3GG4A 2LEAA 4YN4A 2XVTA 1UOCA 4CJSA 2M2BA 5CZ2A 1HIYA 5IV3A 1S5ZA 4RW9A 1RT1B 5AK6A 4RNNA 1RXWA 1LW0A 2BM0A 5BYQA 1UPHA 3BKTA 4WCEQ 1C7YA 3J7AN 4F5RA 3TTFA 3R3TA 2UUBJ 2UUAK 1Q81O 5ALXA 1IJJA 4GVEA 7ICSA 1Z4NA 1I51B 1WWVA 1WC0A 4OLOA 5AM3A 1GTEA 3I32A 2WCXA 1XSNA 5J0PA 3QBXA 1A77A 1IH7A 1Z05A 4LF4K 4IEIA 2MKKA 1XNRJ 3UQ2A 2E1MC 4I28A 3DJCA 4ZLPA 5ALNA 3W3DA 2KP7A 5AK3A 4QQBA 1E6YB 2C3OA 2BJEA 3G8TA 1SZHA 1FKPA 4C8KA 1PIEA 2XS2A 1ZQGA 1RPLA 3K5OA 2KJWA 3SFUA 3K9KA 2AKWB 2V9WA 1RLCL 1M0SA 3OR2A 4QIEA 3I1YA 1FXDA 8ICEA 5B09A 4DR5J 4M3UA 3WK4A 3VGKA 4C7YA 4O5CA 2E88A 4AHCA 1KHVA 1ASWA 4J9QA 2ADBA 1QAJA 4JI1K 3VC8A 1YBUA 3EKSA 2O8DB 1RT3A 3QGHA 3FVYA 3NGUA 4H5NA 2VPZB 5F0XA 5LSLA 1UCNA 4NM2A 2CQ4A 2ROGA 2A40A 2PEHA 2BJ9A 1OMSA 4B8CA 5FPMA 4F72A 4GC6A 3PW5A 1X3NA 2HHHK 3N5BA 1WF0A 4FYYB 3OJUA 3MXMA 2O8FA 5E2QA 3GIRA 5T14A 3C66A 3H5XA 3DI6A 5C12A 1NOYA 3L4QA 3VWSA 3C6TA 1SCJB 3DOLA 3EY1A 2B8QA 1IR1A 4EIAA 3OY9A 4CJPA 5HR7A 3RJMB 3T1AA 5AQSA 2KO1A 3AN1A 1BISA 1ZBHA 2ZIVB 2Z8QA 4KB0A 2ZF5O 1BIZA 1A76A 1RHJB 4WFBQ 4YHHF 2ZJQQ 3HFVA 3H3NO 2QC3A 4N8NA 3V5RA 5HHHA 1U02A 4HHJA 3PY8A 2D0BA 3GYXB 4PRFA 4KLHA 2JEGA 2BOAA 1S99A 2Z2ZA 4BREA 4NLGA 8ICWA 4EENA 2J8AA 3ISNC 5LMNK 3D3BJ 3CULA 2CH6A 3KDOA 3HJEA 1C0GA 2QTWA 3DDHA 3U9ZA 2DBYA 4X64J 5FLXU 4IJNA 4HDHA 4Z7CA 4AHUA 3M1VB 4RBVA 4CZJA 2KJ5A 3QXGA 1VQNS 4YD2A 4GW6A 2BPCA 1WC6A 5F9NA 3BS5B 2Q31A 4F4YA 5AQOA 3BN7A 2X6NA 2Y0SC 4Q44A 2FSNA 1NCLA 4BC2A 4NCAA 3AAPA 2DPIA 9ICFA 4JBCA 2X1FA 4MJKA 2DNHA 2QA4S 5AT1B 2O8EA 2YPYA 2MQ8A 5FD1A 1V5VA 2JFKA 4DUYF 2M4MA 3DRSB 3OYNA 4DSFA 4JD2B 2VGMA 2CQ1A 4LIRA 2B9EA 2ERRA 4CF5A 3MEGA 4AQYF 2LMIA 3BY5A 1O1WA 2RQMA 1ZA1B 1YRXA 1OVYA 4FF3A 3T41A 3KZIU 2Z0GA 3IRXA 4Y2UA 1TV6B 4GXJA 4XQ8A 5DDOC 3DLGB 2P9LB 4TQRA 1DQ9A 3FCWA 3PHTA 3ZT0A 4GKKK 2LKYA 3EZ5A 3GCWP 5ALQA 2ZJPQ 1FO4A 4QZGA 3AA5X 2OZMA 5CYQB 4PUOA 2F8MA 3IBWA 1W7WA 6AT1B 1J9AA 5KPTA 4NXNK 5E0OA 3ZZPA 3MC1A 1Y00A 4X65J 3O3FA 2YPZA 3UXNA 2XO6A 4YB1P 4FYVB 2I5JA 4CGFA 1RTJA 1FDDA 1DTTB 1BHNA 2FLNA 2KE7A 1Q81T 1KAXA 1T9TA 3RAXA 2CNLB 4ERDA 1Z6RA 2DFEA 4H5VA 2SXLA 1LEOA 2KJ8A 2HVIA 1VHFA 1B7YB 2KDOA 4HH1A 4K4XA 1Y64A 2K7KA 4H0OA 1OWXA 3PSTA 2VA8A 1A9NB 1Z1VA 4LIWA 2WVBA 2ZH9A 1FXXA 5EWGA 1ASVA 3GG0A 4QWAA 5AQUA 1B0VA 1Q9YA 3QYPA 3JSMA 4B9SA 1J27A 3V7LA 2HMIA 1E6VB 4H54A 5B7WA 3WKEA 4C9DA 3OFHA 3SDEB 1QSSA 3NVZA 3ZDAA 5GAHP 3BGFA