2YY6A

Crystal structure of the phosphoglycolate phosphatase from aquifex aeolicus vf5
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
b'MRVILFDLDGTLIDSAKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVYTKPYPEIPYTLEALKSKGFKLAVVSNKLEELSKKILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDFTLSRPSDLVKLMDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoglycolate phosphatase
publication title Crystal Structure of the phosphoglycolate phosphatase from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2yy6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yy6A01
4GXTA 4EELA 5A3RA 2B1QA 3CZ4A 3ZWKA 2ZBGA 3DAOA 1Y8AA 5ALOA 4DFDA 2RB5A 2I6XA 2YMPA 3AR5A 4HGOA 3QXGA 2EAUA 5ALUA 2GFHA 3KZXA 1QH9A 3BA6A 3GYGA 1RQNA 3R09A 4B6JA 3E84A 5AKJA 4EZEA 1Q92A 5AM5A 3AR8A 4CF3A 5AW3A 3AR2A 3E81A 1YS9A 5AKHA 4NABA 2ZXEA 2HF7A 5T41A 2NO4A 5AM2A 4UMFA 2P11A 4KNVA 4NFLA 3IRUA 1Q91A 3D6JA 1XPJA 1S8OA 3ET5A 2CN1A 4UASA 2PR7A 5ALHA 2B1RA 3TLMA 3PGVA 2MU2A 1RLTA 2IOFA 4CF4A 4CNQA 3SKYA 2WF8A 2IOFK 1RMTA 1Z4IA 3UMGA 3U7HB 2FPRA 2PQ0A 3ZU6A 2HEGA 4F71A 2R8EA 3WK5A 3I1YA 4AP9A 1U2TA 1T5SA 2WFAA 2HCFA 2W43A 4EENA 4HGPA 2FUEA 3L0CA 3CNHA 1QQ5A 2B82A 2I54A 3L7YA 3AR4A 4UM5A 3FM9A 5E0OA 3U13A 4YH1A 3NALA 4JDPA 4ZEVA 3QNMA 1JUDA 3RFUA 3WKDA 4HAIA 4BEWA 3OPXA 4YIHA 2Q5EA 5AW7A 2QLTA 5AK3A 2YJ5A 3N07A 3PDWA 3L8FA 3ET4A 4EX6A 4Y2TA 1Z4OA 2AUTA 2G06A 2HDOA 4YCNA 5AK4A 5IT0A 3ZVMA 3WKEA 3QU4A 2CFTA 3E8MA 5AKGA 5AI8A 4YGYA 2WF5A 5AI5A 1N8NA 4FFDA 1L8LA 1RKUA 2FI1A 2OM6A 1NNLA 1Z4JA 3M9LA 3I76A 3E58A 4I9GA 1TJ4A 2PKEA 4HGRA 4H1WA 5AI9A 4Y2RA 3AR9A 1Z5UA 3QUCA 2EARA 5AVZA 4FYPA 2AGVA 4HGNA 4AS3A 2ODAA 4Y2PA 1RKVA 1Z4NA 2BY4A 2FEAA 3ZTWA 5AW6A 5AVYA 3WK6A 2C8LA 1RLMA 3WGUA 2W4MA 1L8OA 2HF2A 3ZX5A 2NO5A 4J2TA 4Y3UA 4YCLA 2GMWA 2HOQA 3EF1A 4IFTA 3FVVA 3OCWA 1Z4MA 5ALJA 1YMQA 1ZRNA 1SWVA 5AKLA 2JAWA 4DCCA 2B8JA 1YDFA 2CFRA 3IB6A 4MWOA 3VAYA 1TJ3A 4UMVA 3QU2A 3ESRA 1RQLA 3NIWA 3U7EB 3AR3A 4BX3A 3U19A 5AESA 1EK1A 2R8ZA 4L6AA 1L7PA 1QQ6A 1O03A 3W5CA 3U7FB 4I9FA 3L5KA 1Z4LA 2EATA 4C4SA 1WPGA 5JJBA 1VFPA 4RESA 4UW9A 5AKXA 5AVXA 3MPOA 5ALWA 3A1CA 3J7TA 1ZS9A 2GHTA 2YJ4A 5AHXA 2B8EA 4UATA 4BX0A 2I7DA 3KC2A 4G63A 4AS2A 4QJBA 3L0YA 2G09A 4UMDA 4HGQA 3SMVA 2P9JA 4BYGA 5ALRA 2D2VA 3K1ZA 2I34A 5ALIA 2R8YA 5FP0A 1Z4PX 2P27A 3EWIA 3QUBA 4IG4A 2YJ6A 1CR6A 1S2OA 1T5TA 1FEZA 4OHFA 3PGLA 4DW8A 5ALXA 5AKEA 1ZRMA 4C4TA 3RF6A 3KBBA 2JAOA 3EF0A 5AI6A 4ZEWA 1WZCA 3UM9A 2G07A 2BDUA 1RMQA 2P69A 1J8DA 2ZOSA 4KNWA 3OCZA 3PCTA 3N28A 3B9RA 4UU0A 4E88A 2AMYA 2RARA 4NWIA 4BNDB 5IT4A 3ZWDA 5ALKA 1Z88A 2HI0A 5ALVA 5AVVA 2FPSA 3AR7A 4KN8A 1U7OA 4NV0A 5ALSA 1U7PA 2OYCA 1XP5A 2JARA 1Z5GA 4PNHA 3SLRA 4JB3A 3ZVNA 4YCMA 1QYIA 3A3YA 1YV9A 3I6BA 1SWWA 3QUTA 3N5KA 3I28A 3NRJA 1CQZA 2FUCA 5A3SA 2BDEA 1O08A 3L0BA 3HYCA 2C4NA 3WGVA 4Y2JA 5AKZA 1J97A 3SD7A 3L8EA 2WF9A 3SHQA 1KYTA 3A1EA 3F9RA 4UAUA 1L7NA 3QU9A 4CE6A 3ZTYA 5AK6A 2ZBEA 2IYEA 2RBKA 5ALMA 1YJ5A 1TJ5A 5AKKA 2FDRA 2HO4A 4BKMA 3W5DA 2MSNA 3WK7A 2YY6A 2DQSA 4OCZA 1EK2A 4Y2YA 3FPBA 3WKCA 3ONNA 2JGAA 3NUQA 5AVRA 5AW8A 3WK9A 3OCUA 4UMEA 3QYPA 5AM1A 5ALZA 1K1EA 3U7GA 2I55A 1U02A 4KX3A 3MMZA 4UU1A 5AKIA 3MN1A 1ZD3A 3EPRA 3S6JA 4G9BA 1NF2A 5ALLA 1WVIA 4XE5A 3SF0A 1N9KA 3N8GA 5IS2A 5AVQA 2OBBA 1RPZA 3B9BA 4XOUA 5AM4A 2YBDA 4DWOA 3U26A 3L1VA 3WKBA 4L6CA 2C8KA 5AW2A 3ZW7A 1U2SA 1TE2A 2W11A 1RLOA 2R8XA 4Y2QA 4XQ0A 3WK8A 4MUMA 2CFSA 1ZD4A 3KOOA 1RMYA 1XVIA 3M1YA 3P96A 3ZI4A 1ZD5A 4BNDA 4YIKA 1RDFA 4KYTA 2G0AA 2FPUA 4BEVA 5AW4A 3QUQA 3BWVA 3WKAA 2HX1A 3FZQA 1SU4A 5ALQA 4HYTA 1L6RA 2FPXA 3W5AA 2O2XA 3SKXA 5AM3A 3QX7A 3ZUPA 2WM8A 3R9KA 1ZJJA 1AQ6A 3B8EA 5AW1A 2RAVA 2OA0A 1RKQA 3ED5A 5AIAA 1TA0A 5AI4A 2IA5A 4UAVA 2QYHA 5AVTA 2VKQA 2ZG6A 2HSZA 4EEKA 4XPZA 1ZD2P 2G80A 1WR8A 4UARA 2MU1A 2YMLA 4RETA 5AVSA 2YMMA 2C9MA 3HLTA 4BX2A 1Z4QA 2WHEA 5ALEA 4EX7A 3DV9A 1IWOA 1RRCA 1PW5A 3NAMA 3OCXA 3AR6A 5AVUA 3NASA 4NAVA 1QQ7A 1VJ5A 4L57A 1LVHA 2NYVA 4Y2XA 3ZX4A 3IJ5A 4BBJA 5AI0A 2WF7A 2C88A 1LTQA 2YFYA 5ALYA 3NANA 4UM7A 3R4CA 1X42A 5AKYA 3ESQA 3UMCA 5ALGA 4O8CA 2B0CA 5AVWA 4KX5A 2FPWA 1RC8A 2G08A 2WF6A 2I33A 3MC1A 3OCYA 4QQFA 2JAUA 3A1DA 3N1UA 5ALNA 3W5BA 5AICA 5ALTA 2O9JA 1MH9A 5AK5A 3L8GA 4F72A 2ZBFA 5ALPA 4OD0A 4Y2SA 5A3QA 4CF5A 2IOHA 3WK4A 3DNPA 2YJ3A 3QLEA 3QGMA 3FPSA 5AW9A 3FGOA 2X4DA 5ALFA 2AH5A 3OTQA 4Y2UA 2GHQA 2G1AA 4OFZA 3ZVLA 1YNSA 5ALDA 4Y2VA 2B30A 3KDPA 2YMQA 2YN4A 1L7OA 5AW5A 2Q4TA 3OCVA 4FE3A 3QU5A 1VJRA 4GIBA 2Q4RA 1T9ZA 5AM0A 4J03A 3UMBA 3KD3A 4C4RA 3DDHA 2HHLA 3L1UA 2GO7A 1Z4KA 3QU7A 5AW0A 1F5SA 2ZBDA 3L8HA 1ZOLA 1L7MA 5AIBA 4ZEXA 1NRWA
chains in the Genus database with same CATH superfamily
1VLBA 1KSGA 3CZMA 2GPTA 8ICRA 1SHJA 5DYGA 4BPRA 7AT1A 3LGAA 1L5HA 5JXJA 3VSBA 1GPAA 3EXHC 1U1FA 4JELA 2YYZA 3HVUA 5D3MB 1J0CA 4DQQA 8ICNA 2WK1A 2OQVA 3VVMA 4Z99A 3RGWS 3VI3B 3MF4A 1CNFA 4TL6A 1KEJA 3CF4G 5A05A 2Y1IA 1GHTA 4AY5A 3K9GA 5LNK1 4D6YA 1EX7A 2O8DA 1HMPA 3EIFA 4RVSA 4XYGA 2ID4A 1S2IA 1TF7A 3F3SA 4YACA 2ENWA 3DR5A 2QBYB 3OEYA 1RVV1 3CUTA 2XDAA 1SB3C 4ELUA 1L4MA 4PFQA 2ZI9A 2OGSA 4YJHA 2JJ1A 4L1KA 3D81A 4KXMA 1P1IA 2GSDA 2KOBA 5KG7A 4E5VA 2GKGA 3F98A 5FOTA 3PQ8A 4ISCA 3QF4A 3I32A 1ZYQA 3TRIA 2Q62A 4ZYVA 4LK2A 1YMQA 1XQYA 4DIMA 3PR5B 4PG6A 2UDPA 4HKTA 3ELWA 7GPBA 4RZSA 2YJNA 2MUTA 4LZOA 1XTJA 5DM2A 1ULZA 3IO3A 4NFYA 4E46A 1XYYA 5HVNA 2F59A 3G2KA 1PO7A 5JV5A 1W47A 4G0UA 3R3VA 2H31A 3T1VA 4ZCRA 5JNRA 1XEFA 3DHNA 4NZOA 4F2SA 1N4DA 1XJQA 4TQ9A 2OHOA 1NOMA 5EJEA 3NNDA 2P9HA 4B3RB 3AESB 4AJ9A 8ICEA 4Z8XA 5K6AC 1FLVA 1TGYA 3B3GA 1E2NA 1JIJA 1JH8A 4Y2JA 2VT6A 5MN4A 3PFGA 3L05A 3E53A 4EF4A 1KQOA 3T7JA 3D02A 5G2OA 3O8OB 5DNDA 1NW9B 2IYEA 2IP4A 1JPVA 3IEMA 1J1UA 5THXA 3OY2A 2PFSA 2PMDA 1FJXA 3GCDA 2FOLA 4HTFB 4F2RA 3L0ZA 1QYRA 4EUEA 1WMEA 5FULA 1S4MA 1Y6GA 3SR4A 1KHTA 5E2IA 1HZZC 3C1OA 3OSUA 1THGA 4WJLA 2OBBA 4D0RA 5JMPA 1ONPA 1N0VC 2V5VA 1X6IA 2EANA 2Q3DA 4GSLA 1T6ZA 4J0GA 4KQ1A 2KD1A 4M47A 2V59A 3V6MA 4BQFA 1GEGA 3M70A 3IMKA 2OXFA 4ZPJA 1RKXA 3BM5A 4EB0A 2F2TA 1V11B 4MZXA 1U0LA 3DVSX 1ADCA 2QYHA 3IVCA 1G8JA 5DDMA 3LWBA 2OVFA 3UATA 2IZOA 1MB4A 2JJ8A 5KYWB 2IHUA 1E62A 5BN4A 5J2CA 2YW9A 5CP2A 1PW5A 5AVUA 5AXAA 1WVMA 5BV1A 3QEMA 5A0TA 4TWBA 3D2NA 2WOOA 2I4LA 4S1PA 1M2KA 3TTVA 5HBGA 2VT2A 4BWMA 4URYR 5CVJA 2HTEA 1HMYA 1ZA1A 2JFNA 3ZY2A 1XLUA 1U28C 1UPXA 2HK7A 2JBHA 1AO3A 2I6QA 4C80A 3OE7D 4MVJG 2OYSA 2HDNB 3BT7A 2AQ0A 2O3UA 3QKRB 3T7AA 1PK9A 1A0OA 1XEWX 2HA6A 2YJZA 1XMXA 3WJ1A 1VSQA 2Q21A 1TM1E 2GR9A 3PQ7A 4UM9B 4ND8A 1PVRA 1SB9A 3DO6A 1RKBA 5FIUA 3X0DA 3DQQA 3KLPX 5DASA 4F50A 1TEZA 4F3TA 1IB6A 4ESVA 3I6ZA 3OG9A 5JJKA 1XNQB 4J4HA 2FEMA 4BLOA 1CR4A 5C1IA 3KEGA 4PSDA 3QTTA 3AXTA 3JAKA 1QAMA 2JJ2A 3VU8A 3V8PA 3E5MA 1E3DA 2JCYA 3V97A 4HMPA 4PYOA 5T57A 3L0CA 4BX9A 2J3KA 5HYVA 1Y5MA 3HUUA 4ZEVA 3RTVA 2ZUSA 1GZHB 1Z56C 1C8LA 5BR7A 2XBMA 1NW5A 2W6PA 3WLAA 5IT0A 4L72A 1AROP 3CB4A 5NLLA 2HW8A 2VBIA 3WB2A 2HL6A 3H86A 1AK1A 3X44A 4UD6A 1RM3A 1NBME 4Y9SA 3GFKB 3FSEA 1LKYA 4QBIA 4X7PA 3CEHA 4IRCA 2B7CA 3KEQA 4L5JA 5K0BA 4FZ5A 3N2GA 2YZGA 2HIHA 2V1XA 1LPOA 2IYFA 1A69A 2X4GA 1GCIA 5CH5A 1Z63A 1G8AA 1FX0A 3NHLA 1XDZA 2X19A 1UC5B 3DEJA 3JVUA 2R6DA 4ZVKA 1RQLA 1N2JA 2VF8A 4JP3A 4GC9A 2LKCA 5EQTA 4BO1A 2PRJA 3CZQA 5TJ9A 3N2IA 4C8MA 3HWRA 1JR3A 2UZ0A 3ASZA 5C2JB 3U9TA 1M0WA 5IBQA 2G25A 4MQEB 5AT1A 4FN4A 4YMTA 4BY9E 1K1SA 1X92A 1RYMA 2XWBF 1C3XA 3CX3A 4NU8X 2DPXA 2OO5C 2GI4A 3NIBA 4K2AA 3DOIA 3WLJA 2Z4RA 4QDUA 2PS0A 4NS4A 3M5WA 3OJEA 4NOMA 4ALLA 3CVVA 3GEMA 4TXHA 3UMMA 2E82A 5CDYA 2PGAA 5DYTA 3GLIE 2A88A 1JIUA 2A92A 2VF7A 4KLLA 3WLTA 1Y1KE 3TSCA 2CD7A 5CW2A 3T5TA 4RACA 2Y1DA 4V1CB 5FI0B 4DG5A 3QQPA 3RR7A 5LUAA 3DKPA 4O3NA 4BXOA 3GK3A 3L4BA 1O96B 3DP9A 2QOEA 2Z2JA 3ZVKA 1EK2A 5KFGA 3W2IA 3RVLA 5ARDA 3O4FA 3RANA 2I2DA 3KIPA 3I37X 1VZ3A 3RHZA 1U02A 3VSDA 4XAQA 1X38A 3VYWA 4XE5A 4XLTA 3PEYA 1W4BA 1SHKA 4MAAA 4QO8A 3D0RA 3WKBA 4H1TA 3ESZA 2JGMA 2X3YA 5EKUA 1JALA 4Y2QA 3WGTA 3K9BA 5LUBA 1K86A 1BMQA 5K0LA 3GG9A 3W4JA 1UAYA 2AN4A 1RBQA 2Q6TA 2YQ4A 2BEVA 3H9UA 2R1UA 3GLFE 4UTPA 1N5WA 3CNBA 3HYNA 5LQJA 3W2FA 1CPYA 1QLJA 2HHCA 4CM8A 5BY2A 3A9RA 3MWGA 2YMLA 4RETA 3EQ9A 3OAAD 4B82A 1KOGA 9ICHA 2OFOA 2ST1A 4NQZA 3GHYA 4FMDF 1BG6A 2WU8A 2HU7A 1C30A 4J07A 3O9MA 1B4FA 5A4AA 4AURA 1XEXA 1PNQA 2LTAA 2XT6A 5EMMA 2AJDA 5LMUB 1Z36A 3BMNB 3UWSA 5DB7A 4YAWA 4F4UA 1ZJYA 3A10A 1JQBA 5K8VA 5ENVA 2C2HA 5B3JA 4MV8A 3DYBA 1S1CA 1W85A 3FFWA 1O89A 2R18A 5AM0A 1BPYA 1OYWA 3F2BA 2DH5A 3HB4X 5K6TA 4PYKA 5ADHA 4LXYA 1QS0A 1G7RA 3RUFA 5KYYA 1XX6A 2CWWA 2FE9A 1AS2A 5BV7A 1NN3A 4I27A 3ETDA 3F5SA 3R09A 3TSOA 4V0QA 4MWDA 1BXGB 1SMKA 3RHFA 1MPTA 3LWZA 4X1KB 4A6PA 3RJTA 4LBVA 3FVRA 3BSYA 4MUIA 1YDEA 3L43A 1R88A 2DPMA 2F43A 2JD2A 2X2FA 5DWQA 1RHMA 2UZ4A 1XTTA 3O8RA 3AXSA 1SUPA 1SUAA 1VHDA 3AJ9A 3MRVA 5TVKA 2HIAA 1OGYA 3WIOA 3FYUB 5CDGA 2ACEA 4PZEA 3UAWA 4CEHA 1Y3CE 4A0RA 4TMFA 3TRJA 1W96A 1QB7A 4NCKA 4C08A 3B38A 1KLNA 1EJ0A 5TQVA 3CNQS 4QOSA 3PQDA 2PSJA 2XI9A 4KN4A 3MWLA 3RRZA 3GFVA 4ZVMA 3STWA 4Q1AA 4KDRA 2EV9A 3DZFA 1XUOA 4GWGA 3K4HA 2F4VB 6NULA 2V45A 3ZTWA 4D96A 1RHUA 1U1CA 3S1AA 1X9MA 1KBZA 3ONEA 4GZ6A 2QM3A 1TZ2A 1L3SA 2OR3A 2RKOA 1NQTA 1NN5A 5KU1A 1JSLA 3H97A 1ZN8A 3V2HA 2VH1A 5JS7A 1QZUA 1P74A 2KEYA 1IC6A 3U19A 1TZJA 5FBQB 2XHEA 4JUBA 2R8ZA 4TZTA 1JEDA 2WUGA 5L4NA 1USVA 5H16A 3Q15C 3GRPA 1RU3A 1JB1A 1X13A 4PCLA 3UN1A 5A4JA 2DFVA 3IP8A 5EQFA 1Z0UA 1O95D 2CLMB 2NGRA 4JBHA 2C7OA 3RU2A 2JNWA 5JLAA 1UOOA 4C06A 3ZHQA 1BE0A 5EE3A 4DCSA 4AULA 4IRKA 1BSVA 3NH9A 4AY6A 2A30A 3N2KA 3TQOA 2JZCA 1KVSA 4I55B 4JT4A 2R1ZA 3PI7A 4BDPA 1OOEA 4I29A 2ZUCA 1QZTA 3FR7A 4XIYA 4XM2A 4CKWA 3A1EA 4AUKA 3NC1C 4PZDA 3FBWA 3BFKA 2ASDA 3BXFA 1J24A 4ZOAA 4N5MA 3NJ4A 1GGHA 4GZ5A 4LZLA 5DCWA 3EVAA 3RARA 4IIVA 4KIJA 1Y5LA 1R0CA 2GBPA 2H63A 3ZEAA 4JEIA 1IBKB 2IIBA 3N7RC 3EXFB 3HLKA 3W1WA 1X1CA 1QGOA 1R18A 5TMDA 3H8MA 4CUKA 3EIWA 4FTWA 4BX9C 4DLEA 2B8NA 2NPFA 4UBKA 3KOUA 1UK7A 5ELLA 3I5AA 1ZI6A 3FKSA 2XGPA 3WFIA 1BRMA 3Q3IA 3WJAA 2BN4A 3HI4A 5AUOB 4ECUA 3HPRA 4RQAA 4GUDA 3DT6A 3OFSA 4MCJA 4D41A 4EIWA 4HTAA 4J7XA 1HX7A 3RS4A 3RFXA 1PBTA 1V96A 2PX8A 2VS1A 4JQYA 3ETRA 1AUVA 1KR2A 4ZT2A 4KRYA 4CPDA 3PDUA 4JBIA 5JH7A 3UYLA 2FUKA 1IJBA 2BFBA 1Z39A 2PL5A 2AQIA 1YU6A 3LP8A 1U3VA 1F4LA 2C94A 4YCBA 5CBKA 4C7VA 1SBZA 4O8CA 4O4LB 2R8BA 3VTFA 1MA0A 3O7MA 2AWNA 4IDNA 4R16A 3KP1A 1FNMA 4UTXA 3UH0A 2IK8A 2BKXA 3SVTA 4F4HA 4ED0A 2QRQA 1GZ7A 2QQFA 5BSUA 1DQSA 2IIVA 2AKAB 2EKZA 4EKNB 4GI1A 2ANBA 3HXMA 5T7BA 1ZONA 3TR6A 2GUGA 3KSRA 4R8RA 1HI9A 4ESOA 4M6WA 3UMBA 5GGYA 1H5NA 2I9KA 2XSZD 4O2RA 5JVDF 3ZLJA 4RJ2A 2ISOA 2O54A 5J0QA 4US0R 1DFGA 4PVCA 2HMAA 4UHHA 4LJXA 1XZFA 2XVAA 3F90A 1Z00B 4NABA 4LRXA 3IQEA 5IULC 4CWAA 5FWYA 4YONB 4KR9A 1RTTA 2B94A 3OTGA 1OLUB 1J25A 3NIGB 3DCJA 2GYWA 3QSGA 1LPBB 3PX6A 4XD2A 4M9XA 2RFLA 5HQTA 3RROA 1OBVA 2BHRA 1P4RA 1E8DA 2G9VA 6ABPA 4QATA 5C80A 2ZYUX 1P0MA 3I92A 2Z0MA 5B4TA 3OPXA 4QUEA 4X97A 3QBEA 1TK0A 4C30A 3RAXA 1R64A 3IPRA 4PG5A 1E1CA 2X8AA 2BIFA 5GJVC 5AOBA 2WD7B 2Q9BA 3V42A 2FX3A 1WPXA 4YJDA 5A7FA 4BP3A 1DRJA 1SKSA 4Y2RA 4KMUA 5HK9A 1XRMA 3QUCA 2EARA 3Q2OA 4JXKA 1GSIA 2YV3A 3IR6A 3UANA 1ZHFA 3M6UA 5KOHA 3O94A 4OK5A 1Z0DA 4LXXA 3TIFA 2ZETA 2NO5A 2Y9PB 2JCSA 4JLSA 4Y3UA 3DHEA 3GA7A 3WNZA 1V9CA 1DTWA 1QX3A 1N2CA 5IUNC 5I7SA 3GBSA 4JI7B 4DF3A 3I5YA 2X4IA 1NKSA 5U9CA 1YR2A 5BUSA 3FVWA 2ZIUB 2XI4A 3MERA 4CUJA 2PS3A 1W93A 5DHSA 5JFTA 4I9FA 3CA8A 4IFBA 4S04A 1J00A 3A1CA 4KWCA 2DUNA 4G67A 3MJVA 5ES4B 1WXFA 3O26A 4F3KA 4PFSA 2GLXA 2P27A 2BSXA 1I9CA 1GAQA 5B3JC 2RBEA 2PT7A 1YCDA 3R5JA 1PR2A 3G49A 2NO1A 3TTXA 5BURA 3UKDA 2X1HA 2AFHB 1WXWA 1QAQA 3L0PA 1QFXA 3NW9A 3DOUA 3T5BA 3NGDA 2AD1A 1RRVA 4CETA 1IBCA 2FTKE 1P7CA 4K8OA 3CO0S 3FYDA 2WAQF 4K0KB 1P1CA 5IJAA 4BFWA 1WWVA 3NHUA 4COKA 1AHHA 3ETGA 4L08A 5EESA 5KDOA 3WB1A 1ECCA 1RHQA 4F04A 1QP4A 4MVJD 5H70A 5J0OA 1VDVA 3WGNA 3E9YA 3L3FX 2CSXA 1R12A 1YE5A 2UKDA 2HA2A 2DLNA 4Z4EA 4PZOA 1JLSA 1M1UA 1T7PA 4C6SA 3AERB 4PPYA 3AJDA 3R5SA 1S0NA 2XC9A 5SZIA 5JSFA 1RIFA 1AZTA 4QHTA 2VXBA 4HN4B 1C4WA 3DAPA 4N7RA 4MAMA 4XR9A 2W4IA 3GWZA 1ACLA 4ZVPA 2I76A 4PYLA 4NAUA 3KYDB 3GIDA 4PL2A 4UE2A 1UJ4A 3HKEB 3A9WA 3PWZA 1NMXA 3I1JA 1G42A 1MQ2A 3A14A 4QT0A 2BQ3A 3DMYA 1C3OB 3WLQA 1ZSYA 4ZODA 1TYDE 4IHAA 5T64A 3C1TA 1LV7A 4L4YA 3Q72A 3DNPA 4IXMA 1FNCA 4RSHA 4EI8A 2ZIXB 3G0DA 3OEED 7ICSA 3FPKA 1BDIA 4YCJA 3ZVLA 1Y8CA 2O4UX 1Y9JA 4BNMA 2Y1LA 4AY2A 1P2SA 4R1SA 1UFKA 5JH7F 3VYTB 2GO7A 3IVMA 3GN2A 2D0DA 4OFXA 1RJWA 4QLBA 2JI4A 4KGZA 3V7KA 4XA8A 2QUAA 4URWR 5A0LA 2I7VA 2QIPA 5M3BA 1WAMA 2OILA 5KMGB 1C20A 4U9IS 4W1QA 1KVUA 1SVKA 3Q7EA 5K3BA 4AXBA 1F0PA 1BX3A 3E81A 5JXHA 4PPGA 3PTZA 1KKUA 1R6UA 3IRUA 3SMQA 3ETLA 2FUG6 3QWFA 1JMKC 2B1RA 1SKWA 2Y1GA 4OJTA 3RVDA 1RQXA 3WNBA 3AQ4A 1PIWA 5I47A 2YWBA 4JI0B 1DEHA 1QCKA 4IJ6A 3NYQA 3WHKA 3GZJA 2SKEA 1Q3UA 2XCPA 1NVVQ 1XZQA 4D8YA 2H85A 3EXAA 1VG0B 3O2SB 5FAKA 4WXMA 5TPWA 1E0JA 3ZJ5A 4G89A 1G21B 3QE4A 2ZXIA 1Q3KA 1XLVA 1ZH2A 1PTJA 4WTOA 4NZNA 4I2VA 1T35A 2XKKA 3GU3A 4FZLA 2PZBA 4JGGA 5KTSA 4NBWA 2R4TA 3CISA 4H3SA 5FYQA 3OEHA 2PKEA 1JILA 3PC2A 2Q49A 9ICQA 4PS1A 4LZDA 3EG9A 1PUIA 2XLBA 4BFLA 4IXTA 4XYMA 3OC6A 4HRVA 3PXEA 2ARKA 3R9XA 4HDKA 1L8OA 1O1YA 4P3XA 3Q0IA 4NFSA 5DHRA 2J08A 3LOQA 2KV2A 2C2OA 1VSUA 3NDIA 4A23A 5CX4A 3AIIA 1Y89A 3UFBA 4L8VA 4AYXA 1CDEA 1QG6A 2YB4A 4H6WA 3KKPA 2QN3A 4QAJA 1Z0FA 2X5OA 4NBUA 3ZWXA 3L5KA 4BV8A 3GGDA 1LZKA 4UDXX 3GDFA 1A5SB 3D1JA 1L6NA 3H9QA 4EQ6B 4MIOA 2QW1A 3H5LA 5JIBA 1PJAA 1T6BY 1U1EA 4E07A 2JCBA 4CLEA 2JHGA 4KUEA 3LNTA 1SXJD 3FIUA 5AO9A 2GXAA 1X86B 2JCXA 3GNSA 3HHPA 1UAGA 4GLFA 1QK5A 3KPUA 2XKBA 4XD7D 1AGXA 1I14A 2NO7A 1REQB 3N05A 1M8JA 4XFDA 3NXKA 5KPJA 5IC5A 1HV8A 1Q0QA 3ZDZB 4C3OB 3V34A 2NSHA 2GDZA 4YAKA 1Z5GA 2ZEJA 4M1QA 4RKYA 2B4AA 2DBYA 7REQA 3AKDA 3X1YA 5EIWA 4CG0A 3I4LA 3CR3C 4XQCA 3U39A 3MWFA 1FFDA 4LBYA 3H5AA 3PW0A 4KE7A 4KLGA 3AEUB 3WR5A 1SGGA 5H7XA 2DQSA 3LDAA 2V58A 1F38A 3RB6A 3N0TA 5HM8A 5E7MA 1PUJA 2XAAA 2L2QA 2AGQA 2FOXA 1H3EA 4ZQIA 1WKCA 5K03A 1BN7A 1C8BA 4N3AA 5AVKA 3T1HB 2QF7A 2AR9A 1FPQA 4DQKA 1UT8A 3MLBA 5CWRA 1OIVA 2MRLA 4EBBA 2QW0X 1KKMA 1GGJA 4UUAA 3D2BA 4PINA 2B2CA 1UJ5A 5BPHA 2B99A 4RTNA 1KYYA 1HORA 3DL0A 5BP7A 2ZANA 3TNDA 1NY5A 5LBIA 1GPJA 1XR3A 5AVTA 2EIXA 4ZMBA 3G0GA 1X7XB 3A0HU 2G80A 3IEIA 1BN6A 1GQRA 1JLMA 2ZSUA 5AVSA 1XMOB 2P65A 5JR3A 3CZRA 3GCXA 4DABA 4L57A 3C2KA 4Y2XA 1W73A 4L0MA 4RZ3A 1VECA 4OLAA 2HKIA 2UZ1A 1LB2B 3GHHA 4K6HA 4HCJA 1TVMA 1LDMA 4MRPA 2K87A 2BYTA 3AM1A 4RXUA 3KKQA 1T4CA 3IBSA 5CA1A 1OXBB 5KG1A 4IIGA 4MR8A 2H59A 3ISCA 1OASA 2BLLA 1AHPA 4J0HA 1IQ0A 1B4DA 3U9LA 1N5JA 5IARA 4I4TB 2EYUA 3PC6A 2DFKB 1Z82A 4AICA 3G9UA 3KTFA 5ILOA 4ARZB 1EXDA 2RGUA 4RZRA 4ZK6A 5JJLA 4K6MA 1RAAA 2OEHA 5BN3B 4UNNA 2RB5A 4R8VA 1LD3A 4EG4A 1COKA 5FL7D 1ZQTA 4L9SA 2HHAA 4MRMB 2HOFA 1ODFA 3A1WA 3ZTTA 3I2JA 3V1NA 2BBWA 4GE3A 2Q7OE 4ZQHA 2VQ3A 1PGQA 2FHSA 3COSA 5BT9A 5IJWA 3JQPA 1RYRA 3M34A 1MOZA 2ZZMA 5KZMB 1DBIA 4Q34A 2XZLA 5C1BA 1KYQA 1KTIA 1X77A 4RZUA 4KNYA 3AJRA 4P32A 3T9EA 4HFMA 4TXNA 3S5UA 3LQ2A 3VO2A 4P1ZA 2X2OA 4EENA 3GUHA 2RSLA 1QQ5A 2B82A 5DG7A 2BMJA 5HS4A 2BZ0A 4GMXA 2ZRHA 2PSDA 2IA6A 2MHCA 3WHPA 3HCOA 4TPKA 1W76A 1IJEA 4I0WB 1FUEA 1A04A 4CMAA 5L9AA 1SIBE 3X1MA 4R1OA 2C61A 5FPQA 2Z04A 4F4YA 1T3HA 4X1YA 4H1HA 2CE7A 4RL4A 1C1XB 5BRJA 1OX4B 5I8WA 1VMAA 4A91A 4DDKA 4Q21A 2IYVA 4KC0A 4M9CA 3HO6A 221PA 2W03A 4N76A 4EPTA 5KL1B 2FFJA 3PO4A 2FEWB 5L1JA 2QZ9A 1EHYA 4MS4B 1JHRA 4AS1A 4K6CA 4B71A 4IEIA 4DJFC 2PGNA 3CNOA 4NE2A 1H2ZA 4WFQA 2XJ4A 1LX7A 4IQ8A 1VFPA 1SXEA 2MAXA 4JLVA 4JLAA 3QEKA 2Y9UA 3H2KA 2YJ4A 4F6CA 1KEKA 2G5HB 3BTVA 3KB1A 4NLGA 4FCVA 3ONFA 4F4KA 3SQDA 3FSRA 3P9IA 4DSLA 3OZXA 1WU7A 3EWIA 3BJEA 4KQHA 1C2YA 4QTZA 3T3OA 4FOOA 2YWJA 4G3XA 1ZNXA 2X0KA 4BTEA 2YIVX 1XEAA 4FZNA 3AVVA 2RIPA 1Z19A 3WFZA 3CLRD 3AEVA 2J45A 4AYBF 3ZDFA 2PX2A 1XCGB 2EW2A 4EY4A 4QGHA 3UJBA 3HDHA 3ZYZA 4BPBA 1T2DA 3RH4A 4XX0A 3QPUA 5EVJA 1NQ5A 1U7WA 2ZI7A 1LLUA 5K01A 3K70D 3HWTA 5CXXA 1FMCA 4QPCA 2FEKA 2Q3LA 1OXSC 2IXTA 1TAHA 2QAIA 2HO4A 2QN8A 2ZIFA 2ZSIA 3IEUA 1QKKA 3QHPA 3HY4A 4LC1A 4Y2YA 4R71A 4JFAA 2WZQA 1IM5A 3PDCA 3DBOB 1FBTA 4J2OA 3O21A 3OCCA 3MN1A 4ZXPA 1L3IA 2E1FA 4GRAA 5K6AA 4FI3C 5L8VA 4F4DA 4OQPA 4QFBA 1Y33E 3AHDA 4NRDA 1GCOA 3EQ7A 2V97A 1ZA2A 4CW7A 5CLQA 4YP6A 4BMOB 3V1UA 4N7BA 3J7AC 1PTJC 4Y30A 2CDAA 5MFZA 2J6TA 2DHDA 4J3JA 4FWBA 1VIYA 3ZU3A 1JH9A 3FTPA 2EKBA 3FW1A 1XZKA 4REQB 4XRHA 4P7KA 1LVGA 4DY4A 3CXUA 4D3ZA 5A1TA 5CDFE 1AXGA 2BH9A 1T2FA 2B6NA 3W04A 4FFVA 1HYQA 4BBZA 2IHMA 3EPPA 4XWOA 4LIPD 4AJKA 1IWOA 1PJZA 2C4HA 2P41A 4Z7NB 3JWIA 3HKCA 1H94A 2PZMA 5FKJA 4XWTA 5KX5F 1IUOA 2DBVO 2GZMA 3A4YA 1UC8A 2H3ZA 4X6YA 4L50A 2ZIWA 1BD3A 1V7CA 1DELA 3P52A 4OJQA 1WHSB 3GA5A 5DZSA 1VKHA 4U8HA 3JWEA 1H1LB 4OMFG 3O38A 1ZHOA 5BV2P 4E6EA 2Q3FA 4GIBA 2J3LA 1DKQA 1AGNA 5LZ2A 1VPWA 2NZUG 9ICLA 3KUKA 3D5TA 2O0LA 2QVBA 1T6YA 1PEKE 4EMUA 2X8JA 5REQB 4ZOLB 4QUBA 1ZMTA 2DUJA 4F9TA 3TW8B 3V9PA 3MTIA 1RXVA 8ICPA 1H9CA 1NURA 2VYNA 4X66B 1EUDB 3QWAA 4ZYLA 4M0EA 2YWRA 3NHJA 5G0WA 4ZYUA 5CA1F 4PHHA 1Y63A 1G21E 5DGBA 2WWIA 2H1SA 1CZUA 2I71A 1MSWD 3A1UA 2ASVA 1E0DA 2QQGA 3WMRA 4F56A 1R5BA 4TUYA 1XS9D 4DMLA 5CFPA 3JQDA 3G8BA 3EGWA 4PGQA 4LZPA 2ZSJA 1UOEA 3QNMA 3ZWWA 2J9YB 4OHXA 1KPHA 4DY6A 1QG2A 3NWBA 2C4KA 4YP3A 1NN1A 1JZQA 4IQFA 3L92A 2PJUA 2EKLA 1D6MA 4R8LA 4JMPA 3G7NA 2I2XB 4MYTA 1N1EA 2OXCA 2FU5C 3HFSA 4N0DA 4N9QA 3Q4GA 4HX5A 1XOIA 1U3WA 4WSOA 4B32A 3JQAA 2ZIZA 1JDNA 1NG9A 4RPZA 3TANA 1K7FB 1A9SA 4LYEA 3KSBC 2Q6IA 1CYDA 3G6VA 4DSUA 1A5TA 4FFSA 5SZJA 3QELA 2GM9A 5D6OA 4R68A 2O3SA 2F4NA 1MUUA 2I4MA 5IKPA 9ICPA 5AKLA 2JAWA 4TMVA 1YI0A 1CUHA 5TY0A 2Y1FA 1EZ1A 5EGSA 2ECQA 4RIFA 4MNTA 3SHOA 1GRQA 2V6JA 5A71A 5BR1A 4HDRA 1DRVA 1ZQLA 4P4NA 3B9QA 1I0ZA 1EWVA 3J7TA 3CLSC 2LBOA 1NR5A 1GYPA 4P7BA 3BXEA 3CLTD 3W5VA 2QROA 5K8CA 3WO1A 2UVDA 4XIFA 5DV9A 2H3EA 3H6GA 1UM9B 2GBGA 3ZQ6A 3EIQA 4JZKA 1CR6A 3GCZA 2W6IA 3VOTA 2HLDD 3ADPA 3AFIA 4MWEA 4KWEA 3UK1A 3BHIA 2G07A 4M0LA 1KI6B 3KZNA 4R9NA 3OZBA 3CPEA 3QIVA 5G3ZA 1XRPA 5IUJC 5J2TB 3VR5D 4IHJF 4FBUA 2ZB4A 3E2EA 3ZXYA 2VP6A 1MO6A 5J5AA 1JDPA 5LYYA 2E5FA 1W2GA 2WAMA 3NOXA 3ML1A 4GMFA 2NSJA 1KOLA 3UGJA 4GMKA 4HYKA 4L4XA 4B3FX 2WF9A 2EP7A 3WWDA 1R27A 3LDHA 1ZM7A 2O7NA 2JLXA 1XB2A 2LHTA 3X1JA 4YT8A 1CEZA 1XJ0A 1M1NB 5KYXB 3MXTA 5D4BA 1W25A 3CUVA 4OCZA 3G0HA 1BYIA 1PLLA 3KHUA 1Z28A 1BVRA 3TXAA 4L6IA 4EK9A 1U6KA 5H02A 2P91A 4I8IA 3QFRA 3JD3A 5KAFU 3SR3A 1Z2OX 3D8BA 2JFXA 2NUAB 4PGYA 2DY1A 4WOJA 3I0NA 3QLUA 3IG8A 3ODPA 2G82A 3KJXA 3LUDA 4RELA 2J67A 2FOIA 3PKJA 4J6EA 2HHVA 2HT1A 1GVHA 3PFFA 4PN3A 1QU3A 1WA5A 4UU8A 1UP4A 1L6RA 3N7TA 1BVUA 4MV1A 3ISVA 3OTIA 4R9SA 4DF8A 1GFZA 4XDZA 3GT0A 5EWMB 4X91A 1DAKA 2C2YA 4PLGA 4E15A 3CNLA 3AEKA 5ICFA 3R41A 3V4FA 3N58A 5J29A 4IYJA 2ZRMA 4V38A 1M2OB 1EG2A 1ZQXA 2NZYA 1TA9A 2SHKA 2WIBA 2ISPA 1UODA 3IJ5A 1Y98A 4GSKA 2VTBA 3RLFA 4K86A 3ZGZA 4CDGA 3TBFA 2OE2A 3GRVA 5DN9A 3RAGA 1LH0A 1A8HA 2I6TA 2R3SA 4J9KA 2VIXA 3OZTA 1T3LA 2F1KA 2E85A 1KEPA 3OLQA 4FOPA 1VE3A 2HJRA 4YRQA 4R6XA 2C4UA 5KL8B 5KFPA 3NVZA 4NU0A 1R37A 2A3RA 3SHTA 2F8MA 3V48A 4ZZIA 1DLJA 4LGVA 1YGYA 4A7PA 4L75A 3LO8A 3TE7A 3MQ4A 3P2OA 4ZV7A 3GZFA 1WNTA 1GRCA 2GYVA 1ILWA 2W9MA 4HB4A 3FF4A 5AIBA 2I3DA 1QTNA 3EOBI 2R60A 5GIPE 1E1RA 5D7BA 4BNYA 4MCAA 4EUFA 4RQ5A 3S29A 5HTOA 3GJRA 1QUFA 5EZYB 4S35A 1DBQA 3BD9A 1CKEA 1ZIYA 3RUAA 4B9EA 2X14A 1FQKA 5KREA 3GELA 1ZNWA 3CQ9A 5AHRA 2QG9A 2ZBRA 4HN9A 4MROA 4RLFA 2DWOA 2G1PA 1FYWA 1JWAB 3RNOA 2ZJFA 3BJIC 4QASA 5JS8A 3ORSA 3V3TA 1DCFA 3B9JA 1IE3A 3GNTA 1QHNA 4L4ZA 3GNQA 3ZD6A 3IM1A 3T7RA 2C5FA 2GGSA 2GZ1A 2VP9A 1X1BA 1G19A 1ZXIA 2ZJ2A 3P9SA 3OOSA 4INOA 2O6HA 2MYPA 3IKMB 2FDCA 1NXTA 1EK6A 3QVOA 4YXJA 1EB9A 4I4IA 2O3RA 4HQLA 1ZLXA 3C74A 1EM8A 1DCMA 5DG9A 2BAGA 3P5SA 2QM0A 3FY4A 1JROA 4G2TA 5C1DA 1AM4D 2NRXA 3IKJA 4IUBS 3ZI7A 4QELA 3KTAB 1TKDA 3NPMA 3KRTA 4K88A 3LV8A 2C9CA 1CEYA 4TUYF 1O0CA 2FP3A 5DW0A 1KDYA 5LLDA 2OFWA 2XNDD 4DOMA 3KAPA 4OQFA 4ALNA 1ESDA 2ORIA 3P9RA 3Q40A 8AT1A 1J23A 3AGPA 1Z3EB 4ZZ3A 3ZD7A 4UPDA 1DXHA 2QJWA 1L1FA 3RTEA 5HCNA 4NENB 4TYMA 2E4WA 1E3WB 1SQSA 5A0FA 3UK0A 2WSIA 3FTQA 2WUEA 1R9JA 5MF6A 3BRQA 3O73A 2RHLA 1R8SA 1IY1A 5B3LA 3THXA 4WBNB 2KP7A 4P5PA 3NUZA 1ZEJA 3DZJA 1DRWA 3AL2A 2BZSA 4KVZA 4UVHA 2WWXA 1GR1A 3T3HA 2W9BA 2ECKA 3WYEA 3LQFA 3WGHA 3LLUA 1XMVA 1G9SA 4OX9Y 4NBNA 4BLRA 3GEPA 1KOFA 1IIBA 2YQZA 2HRDA 2AMYA 3LL7A 1QZ3A 2RHFA 3OZUA 4X6XA 2KZMA 1O4VA 2QTGA 3KKKA 2RLTA 2VHZA 3UW3A 1IZ8A 1JX4A 3IOBA 2H4XA 3V1MA 1Z2NX 1CUWA 4IKOA 5JSYA 1UK6A 4BNLA 3OPYA 2JZBB 5HIJA 1IWBB 4FYJA 3Q9LA 2D62A 3TMKA 4Z9AA 1UBHS 1EIZA 2Q1UA 3VV2A 5KNCA 1GV0A 3A58B 5FOSA 4U7HA 3KYIB 4ZAYA 2Y27A 2JIMA 3X2FA 4FB4A 3RAEC 4OX9B 3AILA 1TFRA 1Z7EA 2V9WA 2CLOB 2XMRA 1JEEA 1A9ZA 4HUTA 1DCTA 1IBSA 3B9BA 4MWSA 1TVKB 1TAQA 1TT7A 4M76B 1XDBA 4H1VA 5KOIA 1BA3A 2HN9A 1XTUA 4AQYB 3LLMA 2ID7A 1CJUC 2QMYA 1MRNA 1M0SA 3D4NA 3NWEA 1AU9A 1B42A 4OL0A 4U2DA 3VC8A 2WUWE 1W2HA 5IFKA 2IV2X 3LVVA 2BP7B 3TS1A 1V1MA 4RVHA 2ZREA 5DSXA 3D6MA 4NIMA 1WQ4A 4LE2A 4OHWA 2XQVA 4G81A 2GESA 4GLBA 1Z0ZA 4UREA 1X42A 4P54A 4D4JA 4TVSA 4KX5A 2WFLA 2ZTLA 3Q7QA 2RHRA 2IOYA 2QN6A 1T4BA 5DN6D 4AZ3B 5AW9A 5BWNA 1A6SA 4KGXA 2NTNA 1E20A 1NZBA 4LTMA 4B3GA 1VCIA 1X7DA 4I4NA 4QLAA 4XGNA 2B9EA 4CUZA 3FGNA 1V2GA 4XWYA 4RHYA 1VJGA 1LUAA 3DAHA 2DUWA 2HQRA 3CH7A 4EELA 1SZHA 1X70A 4CQMB 5F3RA 2VXYA 1ILEA 2OCGA 2IZZA 3GGPA 1MJGA 2EFEB 2GF9A 2VOEA 3AUJB 3DMNA 3OJXA 2GN6A 4OBWA 4TSFD 3ZCPA 1C3EA 2WJ6A 4ZH4A 1QFYA 4FUQA 1PT5A 2HJ9A 6REQA 2JH9A 3BCUA 5B1SA 1HDEA 2POQX 1QKIA 1PFKA 3E35A 5G0TA 4AMVA 1DT5A 4S1NA 1XU9A 4MUAA 4DV6B 1S77D 2XMDA 4OATA 2WWTA 2H17A 2HUNA 1P73A 3QMPA 2PO5A 5IIKA 2BPFA 1M6NA 3QLUC 4WLVA 1L0BA 1ULSA 4DVJA 3E1KA 3D0OA 3HT3A 1SXHA 3OZRA 3PHBE 3I9V1 5FB3A 1RWMA 1C7JA 5HQ3B 3NBFA 1C1DB 1B8PA 1HL3A 3MYRA 4JYAB 2O7SA 4X0EA 3FKQA 1LNQA 4MS1A 3JPOA 2VJOA 4PX3A 4B2IA 3QU2A 3PQ2A 4CMHA 2VSOA 2BHLA 1GSAA 2DQYA 4R1UA 4EYGA 5JO9A 4YUYA 2DTEA 2D1TA 2GHRA 3RVRA 2G6TA 3JQ6A 2P7HA 2AXTU 2C22A 3T99A 1VMIA 1RYDA 1KRPA 4RCVA 1QYDA 1RM5A 1UWCA 1C0EA 4IL6U 4IJWA 1SC6A 2IX3A 4N8EA 4Q7LA 3M89A 2C07A 5F7ZA 1LA2A 1MQ8B 2BHNA 2EDUA 4C76A 1ICIA 2ZTUA 5D85A 3TYXA 2H1VA 1SOMA 5ICMA 5I7WA 4P34A 5L6LB 4H27A 3HYLA 2VANA 3I6IA 3SN6A 1JE1A 7ICKA 1V3UA 4CMJA 4XQ9A 1M7GA 5ED0A 1GAXA 2UYCA 1ODCA 4F3OA 4ESHA 1CY6A 1DARA 4F5RA 1P4AA 2H9IA 4AVYA 1CUJA 1GPYA 3CEPB 2EZTA 3C5CA 2H2IA 4XDYA 3VTZA 4KXVA 5IINA 5CVUA 4EGAA 4AJOA 1PFGA 3LKDA 4GOXA 1XD9A 4NVRA 1SXIA 3C6MA 3PCRB 2QYTA 3PKIA 3N8DA 1CRXA 2NU7A 2CCGA 2HK9A 1SKBA 2H3QA 3EVBA 1VLMA 1A4UA 4UFNA 3N8GA 1Z0KA 3EX7C 4O4JA 2JW5A 1X14A 4C4AA 3KJHA 4PC7A 4P2BA 1YZGA 1RLOA 4WT7A 3ZHCA 1NIPA 3RSHA 4LFAB 2JFFA 3DV2A 2FPXA 1E2IA 2WY2D 2VYVA 2UZAA 2CMDA 3IKVA 4DM3A 2M6SA 3GAZA 1NDHA 3HY6A 4K9MA 3G0CA 1DUSA 2WJZB 4MW1A 1XP8A 2X23A 5BN1A 2WM2A 1KTVA 3IBFA 2C1XA 3QX8A 3AIKA 4F8RA 2WIJA 1T3ZA 4EUHA 3R0XA 3W7VA 1XZNA 2OORA 1JXQA 3F8SA 5C32A 3SOZA 3C21A 5D1NA 2QARB 3VJRA 3RT9A 5MHTA 4FXOA 3JYPA 3PENA 5JAMA 3GOHA 3H75A 5FOXA 3PWTA 3D7RA 3ANSA 5JYBA 2PKXA 1LJLA 2OUIA 1PNTA 4BMSA 4A26A 2XTJA 1PJ4A 3A7EA 3SICE 4DQVA 1C7RA 1W29A 1XXLA 1DL5A 2J4DA 3ZLBA 1YZLA 1SVNA 1SK8A 3HBFA 3TQ1A 1KPGA 4BUZA 3ORYA 3WBFA 3E22B 4P92A 1V9SA 3PUVA 3IAAA 1M33A 1ZH4A 1JG7A 1KJJA 3H2GA 2XGGA 2PD6A 2DG2A 1V5WA 1Z2AA 3K4GA 3U7JA 4YV1A 2PQ2A 1IZ9A 2P90A 2Y66A 3PR1A 2J6BA 1S5LU 2QL5A 4RVFA 4ZD6A 2PAFA 5EIXA 5LZ7A 3D6JA 3INNA 3ACCA 1TAUA 3TLYA 3N76A 4BQSA 1BXRB 1XLTA 3BFVA 1OW3B 4DL4A 1AQLA 1OCEA 5LQDA 3DMPA 3LX4A 4Q1EA 2I65A 4RPLA 4TT3A 4O1IA 1YS6A 3S2ZA 2AHRA 3CZCA 5T4BA 4RABA 2A5YB 1RACA 2IPMA 5FWDA 3I45A 3W2EA 5CCXA 4U0JA 2AEFA 3JQFA 4AG6A 1Q57A 1AA6A 3ACBA 2WW8A 5AI5A 1NOIA 4XYLA 1RKUA 3WB0A 1B41A 4F2GA 5GVRA 1CR1A 2Q4OA 3MOSA 5DCUA 3DW1X 3GRCA 2MSEB 3TZHA 2ONJA 4BO0A 1G291 4OYHA 3K4PA 3NHPA 4WCVA 2E7ZA 4UCWA 3Q8RB 2V98A 2PWYA 2W9CB 4QZIA 1GGVA 1MKYA 4X60A 3D4BA 3O4JA 4RO0A 1CZRA 1H65A 3U4CA 1NWHA 3HJAA 2P6MA 1Z4MA 4LPSA 2QRZA 2YJTD 1X6JA 4J9LA 2B8JA 4MWOA 4CNBA 1O8BA 2QTCA 4KXQA 3V2UA 3VI4B 3WLNA 3FNRA 1Y1LA 4BASA 1ONSA 5MDHA 1F12A 4II3A 3Q9SA 2HBJA 4C7ZA 1V8PA 5KWSA 3C3EA 2X6RA 1B73A 4PYNA 3VR3A 1I4WA 4H6VA 4LTDA 4N03A 3JQEA 4KR3A 4EPRA 2V7XA 5LB4A 2FNAA 4GMDA 3HN2A 5E2AA 3QVUA 3MR6A 3DBLB 1JQJC 4I6GA 2I34A 3IPLA 3O95A 4O4IB 4MPTA 2YN2A 2Z7JA 2VRCA 3IP3A 2HIGA 1Z26A 4RVGA 2YVLA 2RHTA 2ZR9A 4C01A 3A2MA 5GWXA 1BJKA 4LCBA 2G5IB 1FFVA 4MK4A 1AGRA 2NZ8A 1GV1A 5FH9A 3LQKA 1IRXA 1N3BA 2FMSA 3N5KA 4JA2A 3UF0A 3LCCA 3P94A 4IJVA 4IPTA 3A9SA 1VOTA 4A27A 4MIKA 1PV1A 1MW8X 1YJ5A 1XA0A 2VDLB 4CR6A 1ZOOA 4DFJA 3SIPA 1J0EA 1DC3A 2OGWA 4RZXA 4Z3DA 3ZKAA 3SR0A 2E4XA 1ZQGA 1IHDA 3H7IA 5EWLA 1HFKA 4MA0A 2QPAA 4L4RA 5KC9A 3WRXA 2ZJBA 1MEEA 4DSIA 2VWGA 1U0BB 1LTHR 1U3DA 2CXXA 3ZQUA 2KE7A 5H2FU 2UUBB 4L27A 5DWVA 1NAIA 2IUSA 4MW7A 3P7MA 1W1UA 3DVRX 4PTYA 5FORA 5AHOA 2DCMA 1O97C 3X43A 1O94A 1P7YA 5D2CA 1EFUA 2EIHA 4KTVE 2DP4E 4GPAA 5L4SA 1JN3A 3LHFA 1CUBA 4RNOA 2R47A 2WVJA 2MINB 1SOAA 4X8HA 1I8TA 2Q1XA 3BGOS 3DZGA 2WUDA 3RLIA 4YRCA 1LX6A 3MDAA 1MO5A 4NOLA 4TT8A 5JCJD 2XITA 4O4JF 2NP7A 5F2OA 4TXJA 4BUJA 2OD7A 1QTIA 2B1IA 3OQNA 1T2EA 3COJA 1BDBA 1E79D 1Q8KA 4ER0A 2BCVA 2DGDA 1P39A 3QUAA 4RKRA 2HD4A 3N86A 2M1XA 2GM4A 1VYUA 3P9NA 4Q45A 3WIDA 4C7OB 1TC2A 3TXXA 1ISJA 1OYYA 4OPMA 1Y3FE 4Z86A 4X95A 2AS0A 3R0ZA 1F14A 3DW3X 5DBFA 3LD9A 1JKMA 2NTVA 1DO8A 2DKZA 1M76A 4JJ4A 1NVKA 1JHMA 2FQWA 3QXGA 1U8XX 2WLTA 8LDHA 3CB2A 3KSDO 1JE0A 1D9DA 3TOVA 3M9WA 5L95A 2H1HA 3I58A 5LQRA 1OI7A 3GLHB 3D54D 3WBBA 4KZKA 5P8WA 4QQ8A 2CXYA 4M2LA 4GM0A 2EQBA 3G3EA 2HCBA 1O5OA 4REMA 4AX4A 3K0FB 4R0NA 2K4IA 4TRJA 4DARA 5FQNA 4I28A 1PD1A 3IMEA 1SCKA 3D7NA 3QA3E 4RLQA 1US8A 1S6YA 2CBXA 1KI7A 1Y7LA 5EP1A 1KO4A 4RA6A 2HBZA 3Q8SB 3KKEA 3OIUA 3TX6A 3FPAA 4ROTA 3MLAA 1R00A 3CJTA 2Y1JA 4BV2A 2VN8A 4UNQA 1NF3A 4IIFA 3GH1A 5G0UA 2PNFA 1JJFA 4K0RA 4HEHA 1XGKA 3C7DB 4H9GA 4ALJA 5JWRA 3HBAA 3KKLA 1L4FA 4B3BA 4ZCSA 3FDSA 1TTHA 3OZFA 1BMFD 2HM7A 3O1IC 2UVWA 2X0DA 4M7WA 1HDOA 3FUVA 2OXOA 4M0UA 1Y8QA 1VXRA 2OORC 5KQRA 1BQEA 3GJTA 4N7JA 1WPGA 2XY4A 4CFYA 5EXDA 10MHA 2JL1A 1VGRA 3TPCA 2WVAA 5CFQA 3V7JA 3FD8A 3UZUA 2RK4A 1YAJA 1RJGA 4RA9B 1A9XA 1UPCA 1AXEA 4YR3A 5TS3A 3AKYA 3AHFA 1ESCA 3HKBB 4I6JA 2JAOA 5SY6A 1ST3A 2Z56A 4CN8A 5B4UA 1IJKA 4G2NA 4PU0A 5IEJA 4BN0A 2Y77A 1I4EB 2QRMA 3W8FA 3VAAA 2FPSA 1UJ2A 2JARA 4QARA 3T7EA 3N8KA 1HWYA 5J58A 5INTA 5M2QA 1SWWA 1UDCA 3THVA 3VR6D 2ZRDA 2DM6A 2VYFA 1W0CA 2N3ZA 5FADA 2FSHA 3ODGA 5G3YA 1KJIA 1C4KA 4Q01A 3NU1A 1KRHA 3ZDAA 3M49A 1II0A 1AKEA 3K35A 4LPKA 1X7HA 4H4CA 5E1MA 8ICMA 1XLTC 4BO6A 3E9NA 2J07A 5KCZA 5CPFA 2HMVA 3PX3A 3VDNB 5J2KA 4E03A 1D4OA 1RPZA 3S68A 3MGBA 2C8KA 2R1TB 1IHUA 3KEFA 2Y3IA 2W9XA 1T1EA 3BS5B 1IK4A 4BB9A 3JQFC 3ZBTA 1UEJA 3IE1A 3KQPA 4CM6A 3SZ2A 3UWOA 4EB6A 1VCMA 2ODNA 5KYKA 3VNVA 4RFVA 3OZIA 3PIIA 2LYHA 5K3DA 2E18A 5L51A 3OA0A 7ICEA 8ICXA 1JDZA 1XROA 1Z6PA 3KFVA 1TQ2A 4EX7A 3C1ZA 2HJSA 2WP0A 4B79A 1TEVA 1RYZA 4IINA 1MG5A 3N3BC 3KOZA 2J7PD 1YRLA 4C1NA 1M2VB 2ZB2A 4CMEA 1U6IA 4Z1OA 1KAGA 4JWKA 1QIJA 4RJKA 1X19A 2HMUA 1Y1QA 1K5GA 1DCKA 3ZE8A 1P6QA 2PWBA 1UBJS 1EXNA 2YJ3A 4B1FA 1YZHA 3FGOA 2ONZA 4M9SA 4MITA 3TPFA 3EPHA 3SX2A 4EUKA 3UQ0A 4KWIA 1P5ZB 2QLFA 2ZUFA 2XA1A 1OWMA 3CWQA 3RYIB 4DRXA 2TS1A 1ZJZA 2C92A 5FNVB 1P77A 2IY8A 1UBUS 2DPGA 3I1IA 4MV7A 3QE2A 1P62B 4GSYA 5JI3E 3A2LA 2R2AA 1QCCA 4RULA 3RJKA 2O48X 3G1TA 3NVKI 1T26A 2XVXA 4RMNA 4N5NA 2XIDA 1DAIA 5KFMA 1PFUA 4PG8A 2DGZA 4QT4A 5T41A 4I5EA 1Y0BA 5B2EA 2C0PA 2I4NA 3ENKA 3QPWA 4O2LA 4C3ZA 4LTNA 5BOMA 2RG7A 5TARA 3PFNA 5C8ZA 4QPPA 4I99A 4DO9A 3UUEA 3DGFC 1WB9A 4JT2A 1JNXX 2RBGA 3AR4A 4NBRA 4MSUA 1CUXA 1PGNA 1UDAA 4RE6A 1M73E 1VB3A 4ZT3A 1USUA 2PZGA 4JC5A 3WRXC 5FAXA 2YWFA 2DBQA 3QW2A 1XL1A 3HMKA 1G4UR 1MAWA 2DUMA 3WHLA 4AY3A 5EMHA 3RYHA 1Z1BA 2XD4A 1FLNA 4Y6PA 1E9DA 4HUJA 4O33A 5DGDA 5G5HA 1PU2A 1FUKA 1O94C 1G6OA 4LVOA 4X8MA 3A3OA 1U0OC 3PK0A 4DSFA 3LUKA 1BW9A 4DT1B 1L3CA 4DUYB 4KRGA 4R0VA 3D6HA 3MFHA 1J8VA 2GZRA 3L02A 3NIWA 1RZUA 3BK7A 3V72A 1WYGA 2Z2IA 2PBLA 2J9FB 2WINI 3ZZNA 1JPJA 2GJSA 1FLAA 1J9ZA 5AJWA 2B7LA 1N34B 1ORTA 3DBVO 4Y1FA 1DXSA 2QN9A 5FOUA 1ZK1A 1K98A 1N1MA 2GEVA 5ALRA 1WBJB 3RO7A 3AI1A 3NEJA 3RU7A 1JG6A 3HXPA 4XQEA 2DU8A 5J0PA 1FUIA 1ML3A 4AKTA 4IRUB 4QHSA 2H9YA 2VNIA 5AMXA 1MAAA 1U7OA 4NQRA 5KT5A 4BO4A 2CWDA 4MTCA 2BPOA 1KDRA 4ATNA 4P86A 3PDHA 3BHMA 1J2NA 5AK0A 4KMSA 2PRKA 4I1RA 3ICOA 2X76A 3BXHA 1YIDA 3RUCA 1XZLA 2E8OA 3BFPA 2C5LA 4QWBA 3JRWA 3FCSB 2VPYA 4QZCA 3DZHA 2YNMA 4HDNB 2P9TA 1Q3VA 1ENOA 4ZVNA 1VBKA 3RASA 2NU8A 1MO4A 4XIJA 3TKYA 5FBWB 1QO0A 4FT4A 1M2FA 2C58A 4IEFB 3L1VA 1AGYA 3TNLA 2HU2A 2XB6A 3H4MA 2BFAA 4NCJA 1P9OA 4FGJA 5C1PA 3GMTA 2VLIA 2AMLA 1L5GB 1TCAA 1JECA 1LBTA 3UPUA 1QHYA 4J9PA 1JBKA 3AU9A 4DMMA 2DQKA 1UT6A 3V4OA 3JQ7A 4BJ1A 5KG6A 1K9VF 4JOQA 2PV0A 4I50B 3SP1A 1I24A 3EASA 1NBAA 2OZLB 4I46A 1D2HA 5JFOA 4M21A 5DT2A 4LJ4A 3R0JA 2FK8A 1R74A 3H42B 1SQ6A 1USKA 4B3HA 1IN6A 5GOTA 1GPWB 1Z16A 5C9ZA 2NACA 1NBMA 1M8PA 4WZAB 3ANXA 1JI7A 3B0XA 1QQAA 4JVNA 3LQYA 3W5BA 4RH3A 1CZOA 3ACDA 3SV3A 4J29A 1PVOA 2G6BA 3VU3A 1Z38A 4AMUA 1GPNA 4IS2A 3ZNNA 2Q6LA 4ENVA 2FW0A 1WDKA 1HNNA 3GDWA 1A96A 2IDJA 5BMOA 1GY8A 1C7EA 4TV9B 1GO3F 5KYTA 4FI3F 4M9QA 1EGMB 2PIAA 2I6XA 4IJQA 3B3FA 5KTTA 2I2WA 3BA6A 3E7WA 2XOEA 1NTOA 3F6YA 3KG2A 1CZLA 1ZM2A 5AJXA 2R11A 3K2BA 4FFLA 3JQBA 4PCUA 3FLMA 4R8UA 2W9AA 4KV7A 4PIVA 2J0UB 2WQZA 3U3KA 2AFHE 1E1MA 5A1JA 3UK2A 1WNFA 2FX2A 3SS9X 3PXGA 4GEKA 4J9NA 3QW4B 3GDOA 2WMOB 1V6CA 2W2LD 3DTYA 1A3CA 4OGLA 2R8PA 4G0NA 4WZ6A 4EFLA 4S05A 4KQXA 5FI3A 3R9WA 2EFHB 2Q5LA 2R00A 2ZSDA 2N47A 4PC1A 3QJYA 1BKDR 4ILKA 2DHCA 3PNSA 4N8SA 1VL0A 1YQGA 1RJDA 3DZIA 1AKUA 2ZXHA 5BUZA 1UXHA 4UM8B 3BAFA 1TADA 2CVQA 2EG9A 4CKCA 1EXWA 1T0BA 2CHFA 4OGGA 4OJ6A 2QA5A 2Y6UA 2RHOA 3HJRA 2AGVA 1FRZA 2WHPB 5ABPA 3IODA 2O8BB 4QECA 1EX1A 1YZUA 4CIXA 1WX1A 3RI3A 2HNBA 2VUHB 1ZICA 2DUYA 1Z0IA 1NAHA 4Q9HA 2JHFA 1XKTA 1N5OX 3EVGA 3IPAA 3TK1A 2HBYA 1QLWA 1GNVA 1HR0B 3T4UA 4BB0A 3KKNA 2YW2A 3LO5A 3CVUA 3WWOA 1AUQA 4JXZA 4CMEC 1IVSA 1Z15A 5C5JA 2A67A 2V0GA 3LQ1A 2XIQA 3GLFA 3QOWA 3H1AA 2LCFA 1HTWA 3ESAA 1W5BA 4JEMA 2P9JA 4UTNA 4YP0A 2PWAA 4PC3A 3ZJYA 1B6SA 2OHHA 1TUIA 1DDOA 1TJYA 3VHXA 1P7PA 1RCUA 5B1DA 4A8EA 2ZPTX 2FRVA 1OXMA 4TQSA 2GX6A 3L6BA 4RMGA 4ZMRA 5D5PA 1P2TA 5IH3A 4QQKA 3KYCB 3M5CA 3CRMA 4H4EA 1M75A 2PAAA 4LV6A 2RG1A 4PNZA 1VPVA 5CB4A 4WL0A 5FI5A 4ENUA 2ES6A 4DMUB 4FHFA 3ZTYA 3RRXA 1HUZA 3F5DA 3SNHA 5IBCA 2D1SA 2W83A 1OW5A 3ABQB 2WU4A 1ECJA 1XD8A 3M6ZA 3RB8A 4FR0A 2C3MA 2R97A 2B0JA 4Z2AA 2PUFA 1X1TA 2VJDA 2HHJA 4AYTA 1JKIA 1SUFA 3LPAA 4OO3A 3VYSB 3KLOA 4MUMA 5DBGA 5KU7A 1EVKA 4XRGA 4KJXA 4EVQA 2W7TA 3BDIA 5BVGB 2ZKIA 2P8SA 1U94A 1YHNA 1RXSA 3RW9A 3MJSA 4OYYA 1J7KA 2F76X 2IYNA 4B4VA 3ALRA 1JMSA 2ZG6A 5JI2E 4IKPA 4E7PA 3O0TA 4WN9B 1ZQMA 3I2KA 4DQ0A 3O8NA 3DXXA 1WR8A 2JGDB 5GTHU 4C22A 1FP6A 2QUIA 4ZVLA 3LPLA 1K7SN 2VWQA 3U1BA 5KFYA 2QTTA 2PS1A 1IXYA 1RWNA 3W7BA 3WLRA 5DOVA 1LFAA 2C88A 1Q7GA 2PT6A 1OXUA 3FC4A 5JRZA 4L02A 3CKYA 1U81A 2X5KO 3C3JA 5I45A 3T0GA 3KT3A 1RE1A 1SG6A 3BEDA 1XBTA 1BEUB 4WHMA 1YNSA 1YOVA 4Y9TA 3KDPA 3U3ZA 3BULA 4HG2A 1ZM4A 3IV7A 4E1BA 4MEAA 5A5VA 2AG5A 4U2GA 1Z5VA 4OQNA 1CJBA 1AVTA 4RWEA 1A8QA 4X54A 5HE8A 2C99A 4YP5A 5L6MB 1MB9A 4UEOA 4N3CA 5JEEA 1FRVA 1AIPA 3DE3X 1YNOA 3E0FA 3L01A 1YZ3A 2PUDA 1SIJA 4X1OA 2IU4A 3O8DA 5JWOA 5JS2A 1OH5A 2PMZF 1EGAA 3OZCA 2A78A 4MS3A 4U5QA 1TD1A 3V8RA 2HREA 4UJ3A 1JSZA 1YVRA 4F93B 3DO8A 3GUUA 2SNIE 2PG3A 1H3FA 4EMSA 1PR5A 1OILA 1Z08A 3GBVA 7ICRA 1KYVA 2PI4A 5FHRA 2FPPA 4D9EA 1U2TA 1BWPA 9ICTA 2YNMC 3SAFA 1V5IA 2HPZA 3GX1A 1J0AA 4RQNA 2XEXA 3DOEA 4OHKA 1KJQA 3EGOA 1UKVY 1P1KA 3HI6A 5DI3A 4AB1A 1OZAA 4WX2B 3ISDA 3H4TA 4D8VA 1V8OA 2QAGB 5KTPA 4RU9A 1K4YA 4PLCA 4OXRA 3U4DA 2PO7A 3ER8A 4WBXC 1B00A 4RFLA 2PXIA 1QDEA 2JK1A 4LK3A 2CNWD 3DBRB 4FDAA 1B1CA 2R4QA 2CZQA 2L42A 2W8KA 1NR7A 1I94B 1OBCA 2YS6A 1N57A 1V11A 4P4UA 2R6CA 1UBSB 1IM4A 3PLRA 1L3BA 4RD0A 4FD3A 4BNZA 1C9MA 3V55A 4OQZA 2X0JA 3B1YA 4XVHA 5IW8A 3HSKA 2JLRA 4NLCA 3ZI0A 1V2HE 2AC4A 2C7VA 4MRSA 1Y3BE 1I5EA 3NBUA 4GRIA 4DM4A 5F2EA 3LK6A 5D86A 1NI4B 4V39A 2PMZC 2NV2B 3RRHA 1F2TB 2CBZA 1X94A 4G1VA 1AV6A 4KVAA 5BXQC 4MFFA 4INJA 1QO9A 1XMJA 4HC4A 4FSXA 2B21A 2NSDA 5HW0A 3AF1A 4EPVA 1WIWA 2QTVB 3TBHA 1ZD8A 4ZMSA 1E0KA 4LF8B 1YMUA 2IVFA 5CFMA 1W44A 1L4GA 5CEHA 2CL6X 3OCJA 1H22A 1RJ9B 1HGXA 4PSKA 4R40A 1U80A 5DF1A 3FDZA 4CLOB 4PTZA 2V7EA 2ALZA 1BXKA 4LVNA 3K1JA 1VB5A 3HHEA 3IKTA 5DISB 2BGIA 4D4GA 5BSMA 1QFSA 1U9YA 4D0GA 2KG5A 1EHCA 3LUGA 1YQDA 1RXWA 5KFTA 3JQBC 2RBKA 3LBYA 4L95C 5ERYA 1YSCA 3MRTA 1VSTA 3VO8A 5AJYA 1TYBE 4NONA 2YKGA 4KB5A 1L7RA 2UYGA 4MVJM 1SUSA 3HCBA 5CM9C 1ISPA 1X7WB 2D3TA 3B2EA 4D25A 2YOFA 1H6CA 3R20A 2FN4A 1YO6A 3MINB 3TI0A 2NX2A 3DB2A 2AZ4A 3CSUA 4HLCA 2R00C 3HCAA 2ZJYA 2Z3VA 3AI3A 2GCOA 5CB4F 5KFFA 2QRVB 1GG8A 1YFJA 2PXHA 3QUQA 3FWZA 4US9A 1S0OA 1T2UA 1C0IA 4BMYA 1S8AA 3G79A 3CUEF 1V35A 3K92A 4AG5A 4M0MA 4Z0TA 2ISCA 2R5FA 3WVNA 3S55A 2NU9B 4L22A 1F6DA 4TYYA 1U49A 4RANA 3F7TA 2P77A 4EKGA 4PL1A 3ICEA 1RAEA 1SOWA 3K0AB 4A73A 4OREX 4BNIA 4MDFA 5DQHA 2NUTA 8ICAA 3VA7A 3JY6A 4H15A 1SC1A 2ACVA 8ICLA 1ZEMA 3GLQA 4JJZA 4ABYA 3FWHA 2PMKA 4UAWA 1NGSA 1EKXA 3EHDA 1VSVA 2OLEA 3CYMA 3B1ZA 5IAJA 1IRIA 4U7TB 5D00A 4ZFNA 4EL5A 3KD3A 5HKKA 4MWTA 4MJ7A 1XC9A 1GL3A 3T9FA 1P8AA 2OFFA 3DULA 3VYVA 4GXTA 2FVXA 4YCCA 5KTRA 3WMGA 3DWGA 3QNWA 3TM5A 1M74A 2O5EA 1U6JA 1Y4SA 3Q1KA 3QEJA 1DZ3A 1HC7A 4IVNA 1LSOA 4K9PA 4QZAA 3DOCA 1X9IA 1LK5A 4DADA 4V1CA 4CNQA 2UYYA 3A9VA 1T1IA 2IOFK 3B51X 3AV3A 1EU1A 2Q5IA 3ZPXA 4IH9A 4WKCA 1KP3A 4TL7A 4E94A 1TU4A 2XOXA 4IR7A 4PRYA 3I4CA 1DBVO 5HEKA 2J87A 1W94A 4B9UA 4RZQA 1NJZA 4BEWA 4J0EA 1Y4UA 4EBDA 4GVPA 1YTLA 3WNVA 3CS3A 4MYSA 2D4AA 4R81A 1J22A 4LRSB 2DWQA 1YONA 2EDCA 3NKVA 1NM5A 3WL5A 1XPUA 1WSWA 2VPZA 4OBXA 1U2EA 2R6GA 2WBLC 3EVDA 5H8WA 3I76A 1KI3A 4YA6A 2HGZA 2IYRA 4MYCA 4DHEA 1A5BB 3IDFA 4FR2A 4DLUA 5FLEX 2BW0A 1NLZA 2JF0A 1PEDA 3EGXB 1Z4NA 1DK3A 4JI8B 3JPSA 4BGEA 1RWBA 5JQWA 621PA 3ZX5A 4K6OA 4WLUA 5K0NA 2WAAA 2A1JB 2EBHX 2FSPA 3LHKA 3MT8A 2IZ7A 4YRSA 4B6GA 4C1BA 4Q9NA 4PIMA 5JS1A 4BUCA 4FCCA 3MJDA 3WLFA 3VC2A 3UC5A 4DV4B 2RGBA 4HYQA 2JH3A 7ABPA 3D1LA 5CEEA 3OU6A 4DEVA 1V48A 3A9UA 3SJUA 2ZE7A 4RMJA 2I2AA 1KBUA 2NZWA 2H0RA 1P72A 3JYHA 5A5EA 3D3WB 3BZKA 1RFGE 1P45A 2VFAA 2GBCA 3ETCA 1RS0A 3THRA 2DT5A 2B61A 1DGJA 5BNTA 3TDMA 3EQ6A 5EIEA 3OCZA 4P7GA 2V7VA 3P4XA 2YDYA 4Z3KA 4PW0A 2OO3A 4C0KA 5HGXA 4NWIA 2WRZA 2VAWA 3OQIA 3RRNA 4ZKEA 2FGJA 1A7AA 3CCCA 1Z6TA 2LXNA 4YJ2A 2O2DA 1LS6A 3VGPA 1BXGA 2F1HA 4A9AA 3OJWA 4FEGA 3L1HA 4GYJA 2A9RA 2C7BA 2GEJA 1HE1C 2OEPA 3M4NA 4I2HA 2JA1A 3E9QA 3VH4A 4C7YA 2X8WA 4Z4QA 2OK8A 1MPXA 4FYXA 3UCXA 1KAHA 3JS5A 4GXQA 1G5IA 2FY8A 3WK9A 3T12A 2D8AA 1OX6A 3NOVA 5HG0A 4CZ2A 3AEXA 4HEA1 1OV4A 1X8JA 2H06A 3WLLA 1EPUA 2Q3HA 2VJKA 3R5XA 5CX1A 2DLDA 4QPZA 5KAMA 5JMTA 1YL5A 3AW9A 2QXYA 5DHQA 4IC9A 3ZW7A 2KIWA 4ZDJA 3FYUA 1SKRA 1ZCFA 1UZAA 1Z1VA 2BFNA 4EJFA 3K8YA 2ZTEA 1VJCA 2PSFA 2R48A 3LPNA 1FF9A 2AUMA 2YZ7A 3C5WP 3K73O 4QWEA 3A3NA 1PJRA 3MBKA 5LP6B 1L7VC 1YWGO 1G20A 3TCXB 1EFTA 3HACA 3B48A 4E08A 4XPZA 1W0JD 2G8NA 4TLBA 3WE7A 4IIHA 4R41A 3ZC3A 1F0NA 2UUOA 1MB2A 3U0VA 3DYVA 1R7RA 3W78A 1P81A 3GFTA 5TIIA 2IDMA 4D9MA 4LE0A 2YFYA 1DIAA 1PCXA 3Q5GA 1OZ0A 2NQ8A 4QYXA 2EGUA 1NX9A 1GPH1 4ZDIA 3UUFA 3V2IA 1QE0A 1JTEA 4Z53A 4KLIA 1SBYA 5EPUA 3V80A 1EAYA 3FPHA 4TGLA 2JXJA 4CT5A 1PQ4A 3O0DA 1S2LA 2NSYA 2JK0A 3KJFA 4GYYA 1BJTA 4WRRA 1QIHA 1M34A 5AHKA 3LPMA 3CE9A 1H05A 3AEQA 5EIHA 4MV4A 2OV8A 4J03A 4Y9DA 1VJTA 2BMFA 4D44A 2Y4NA 3TI9A 1L7MA 3R3XA 3F6PA 2GOYA 4P53A 5CDUA 2RRDA 1FXSA 2FWPA 5I9BA 5I7UA 4GOMD 2FZ5A 3PD7A 2AG0A 4W8GA 3TTUA 4B0OA 2DHRA 4X90A 3V4ZA 1IY2A 3EGDB 5C7LO 4ASUD 3IELA 2QRHA 1G8HA 3TAPA 3G8AA 5LQKA 3RBVA 2NYRA 1L5OA 4DGQA 3SG0A 5H0IA 1DAHA 2B4TO 3CLVA 4M7OA 3RVPA 3D4PA 1C80A 3OQMA 2BI7A 4WK0B 1YRBA 3L07A 1ZRHA 1A7JA 3FAZA 3KXPA 3FOZA 1PJBA 4PBTA 3N7PD 4TOIA 1KDOA 4RTRA 4RLSA 1ZH0A 4X65B 3EXFA 1O9BA 4EYSA 3FFTA 3JQ8A 3G6YA 3L8FA 4EX6A 1NRXA 5I3CA 4LHSA 4X20B 2LKDA 3QNUA 4LJKA 3PJFA 1RM0A 1F0MA 4IOKA 3WXBA 2DF8A 3QJGA 1PK8A 1EESA 1XDWA 2AQ4A 3O4VA 2JFWA 5AI9A 4WFKA 3JXEA 3A1SA 1U2DA 1OI3A 4IUYA 5E6SA 5E9WA 2X5JO 2PWPA 4FLEA 2Q2WA 3IJPA 2K89A 2HOQA 1MXHA 8ICBA 1EP9A 2CK3D 3RC3A 5CCBA 2WA2A 2YFKA 3VAYA 1Q74A 5LP1A 2RDMA 4I2FA 1Z2CA 1A2BA 1QJCA 4UC0A 5KSOA 1JA1A 1KAEA 4UQLA 1YBVA 1VC2A 1AHIA 4B81A 3MUOA 4XGQA 3OZEA 3F8WA 3LWDA 1R4NB 4COOA 1N9GA 2X5NA 1K7CA 2O8VA 4MGHA 1JIHA 3HKZF 4B8WA 4O4LA 5LZ8A 4GDFA 4DQDA 2BM0A 2HU8A 4YRJA 1NPTO 1PK1A 4YQWA 1QBKC 2EJVA 4HB0A 1S7CA 3FUXA 1FXWA 3F6CA 1XAIA 4EAQA 4JASB 1LVUA 3PCTA 4TTPA 3HFGA 3O93A 3H83A 1JTVA 3NC0C 2H2HA 2AJ8A 3QVGA 1TIPA 3WOVA 2E3JA 2VPTA 3OOWA 2A9FA 4DL7A 1NVVR 4B74A 4ELTA 4K4HA 1Z33A 1Z7YA 1Z00A 2ILVA 2MSKA 2PZEA 3IAEA 4QDKA 3W9SA 2QD1A 1RXIA 5B30A 4KWTA 4JSRA 3WSVA 1WOMA 2Q0QA 1AS3A 1XWIA 1OLUA 4P93A 2PR2A 3RFAA 3H5OA 1EVYA 4YRPA 2DRIA 2RD2A 9MHTA 5ITVA 3IDZA 4YEDA 1W4CA 1RXUA 2FV8A 1XZCA 3R8CA 2WYHA 1IN4A 4JCCA 1J2RA 3KL4A 4NECA 1A95A 3HB5X 5CR0A 5LL6P 4YJ2F 3U7QA 4ZYWA 1YQTA 5F4ZA 1VRVA 4CJXA 4M7RA 2BCEA 4YIKA 1H4VB 2ZYVX 7ICJA 1NM5C 3K53A 4J9RA 1QGYA 1K5PA 2VUUA 4DL3A 1J8MF 2PUVA 1T0JB 3T38A 4RKQA 1VPEA 3HKZC 5BQFA 1OVMA 4PHCA 5KJEA 5EIAA 3E61A 1F0YA 1MNQA 3SHWA 1U8YA 2QDKA 1D6NA 4B17A 1P0IA 3L1IA 3K6JA 4FUTA 3AR6A 2KJ8A 3C97A 1UBKS 2ZAOA 4EG5A 5LXTA 1ENZA 3TLJA 3BRSA 3STVA 5H9WA 4B3MB 2HIMA 1PSDA 2A58A 1U98A 2Y92A 4C5BA 1DQZA 5CTAA 3LA6A 2GVZC 1TZCA 3GXOA 1TTTA 2REXB 3JVVA 1XPRA 2DKNA 3MCUA 4LJRA 3PW2A 2PH7A 3EY9A 4AJ1A 1VJRA 1O3YA 1R8XA 4JB0A 3LXUX 1IY8A 3OC0A 1Y82A 4QOJA 1CQXA 1J20A 5CEJA 3SYNA 3PQCA 5D3ZA 1BHQ1 1UANA 1ZUWA 2CY0A 4B9LA 1V16A 1X1EA 5LM3A 5AKHA 3DLIA 2EZYA 4KNVA 4RPYA 3OEWA 2Z5FA 3UKJA 2PMCA 5G53C 1AKVA 1KFDA 4PZNA 3I9JA 2IKQA 2BOVA 5CJJA 5LWHA 1HPLA 3I52A 1V41E 3LTEA 1GL6A 4AZ0A 3MTAA 3OQHA 3KOXA 1YR7A 1NT2A 5IDWA 2J9GA 3NEPX 9ICBA 2GAOA 1UPAA 5KQGA 5EQDA 2FW1A 1EUYA 1RI2A 3ZZTA 1F1BA 3RG8A 2CCKA 3F49S 2YV1A 4ZQBA 1M8KA 3QYAA 2ZRFA 5DHFA 3TL2A 4RK4A 4DLAA 3BD8A 3IOYA 5ECYA 3B6EA 4V3BA 3SJ7A 3P26A 3PDIA 3TJZA 1IOVA 3KHLA 1DOQA 2QX6A 5E6RB 3VO9A 4DPKA 2XYQA 2R7LA 3C6XA 3AERA 3FYUC 4DR5B 4NZMA 3NEAA 5EHIA 3HCFA 3EMVA 2HQ1A 4BE4A 3BWEA 4YP9A 1XD2A 1HDIA 4K4GA 3N2LA 4U8GA 4AS3A 4BCBA 3HV0A 4DE5A 1FYEA 1I6KA 4HWTA 3AJ8A 3BKXA 5E8RA 1CI4A 1RWXA 3EFOB 1ZIXA 3K1YA 4QUHA 4IIDA 2EZ8A 2AOUB 4QXQA 3HKEA 2KSOA 1ZAYA 5HF5A 4CL8A 3A4IA 4PGXA 1MN6A 4BMDA 4MP8A 4ZVTA 1HBJA 3PYLA 3S28A 1HDXA 3V4LA 3JVEA 1SUEA 2CMKA 4IIXA 3BD7A 3V2GA 2ISSD 5CDFA 1UOQA 4RU1A 1FFSA 4DSZA 4AS2A 1YE3A 2IFTA 3A06A 3ZIUA 1X1RA 1WW2A 1RRFA 2P1RA 3RKSA 1LI4A 2C9BA 1T5TA 5CRIA 2H5XA 3R7SA 4WZBB 4C3VA 1Q21A 1Q22A 2PKCA 3J81k 5B58C 4BNDB 3B52X 4A5SA 5KT3A 4UCXA 1OBFO 1AQNA 4TRRA 4M1TA 1ODSA 4X5VA 2BMDA 5FUYA 3HXQA 4RSGA 4P7FA 1ES9A 2Q45A 4G4SP 3MMPA 5KMGA 2C4NA 1VSBA 2XUFA 3WX0A 5LOVB 2CXTA 3SXPA 2VHVA 4IGKA 4KSYA 3RBZA 3BSFA 4RPXA 3AM3A 3JD1A 1A9YA 1GFSA 3EPIA 4D99A 2G9ZA 5EHGA 1ZD9A 1MCZA 1FP4A 4TL8A 5J47A 4P98A 1GKLA 2QL9A 4QBKA 4UHCA 1IULA 3DGEC 3LQQA 2IZ6A 1GTSA 4JZYA 3IAXA 2QRGA 1MJNA 2C2GA 5IILA 2OENG 1ZISA 3SNKA 3DMDA 4TUSA 2EFCB 2WTXA 2PU7A 2BF4A 4AYWA 2H1RA 3LKZA 3NHMA 4IJMA 4OXQA 3K1AB 5KG0A 4YRBA 1E5XA 4HDMB 4K9KA 2WQ6A 1UDWA 2QN2A 4Q1FA 2R7MA 3K5PA 2FHPA 5LCXA 4GMHA 4PG4A 5DPMA 2W2KB 5DNCA 2PL1A 4AKEA 2BTEA 4RL6A 2IY7A 4UQOA 3PNQA 1U2DC 1JFLA 2IXFA 2J5QA 1YZNA 3UMYA 1E92A 4L7VA 1NKVA 3LY5A 4NMHA 3L6EA 2V7GA 2KJ9A 4BO9A 5A4KA 3DOJA 4NJEA 1DAPA 4WVFA 2COUA 4RQ7A 4LVUA 4J43A 4E1VA 4ANFA 4IHKA 3DD1A 3NGXA 4KQ2A 2IOHA 2VBGA 3HYTA 5I7OA 3KWLA 4DOAA 4LISA 3SXUA 2IDZA 4OFZA 3E27A 3G6KA 3N87A 3AVTA 4EQ6A 5CK5A 4PV7A 4DR7B 4LDNA 5DCYA 3CRXA 4DANA 2QB5A 1OXJA 4AP6A 4I5IA 3QP9A 2QKQA 5TVGA 2J31A 4JLDA 5LXTF 1QXSA 1RYUA 5I8PA 3GV5B 4C4PA 3CBGA 3QUSA 4R2HA 3TIXB 3AR8A 1ABFA 1E4VA 4F8YA 3BTOA 1YJAA 4HDCA 1JZTA 4NCBA 4G0ZA 2AN3A 4QRDA 2W98A 3ZUGA 3UHOA 5DB9A 4UASA 1P7WA 2FFRA 2G76A 1RRKA 3ICVA 1W75A 5TB5A 3SC4A 2ZJ3A 5FTKA 3AEUA 1RCTE 1FQJA 3U44A 3RD5A 5LN1A 1T5BA 5A03A 3NETA 2BCSA 1P1RA 5IHXA 4CU2A 1UL1X 1DTSA 4QUDA 4QWAA 1AQUA 4R5MA 3VO1A 4W5TA 1DBPA 3V7WA 1ZDMA 3LVFO 2IYTA 5JYEA 3BMOB 2LR0A 4W7SA 2DH6A 2ONCA 3Q11A 4XCVA 3R8FA 1VRWA 3BPSA 1WO8A 3MTGA 3W6OA 3LRPA 1MAUA 3DYIA 4KYIB 4HEQA 2Q1WA 5FUWA 2QB1A 5FBVB 4OHYA 4R01A 2DAPA 1N6PA 1NLFA 2FZWA 3E18A 4FSDA 2XWPA 2FWMX 2P35A 2I4TA 4LOJA 4LNHA 1ND6A 3EDYA 4D9JA 1F4VA 4PO8A 4XSGA 4BRUA 4IL5A 5KSPA 3C7KA 5LLTA 3AUXA 3BORA 1NJGA 3DS8A 4ZO8A 3ABSB 3GUYA 5GZ1A 1QGUB 1SUCA 4F5NA 1V7QA 4R5HA 2CZCA 3PF8A 4MWBA 4DCUA 2IP2A 2GPWA 5HP4A 3HA3A 3GLTA 2EGGA 1R6BX 1UADA 1YZVA 2D06A 1GGNA 3WYNA 1F0KA 1GGFA 4I4TA 3KLMX 4HBGA 4ZV9A 3MWYW 4HX9A 2HRBA 3SVZA 4WFIA 4A8PA