2YY6A

Crystal structure of the phosphoglycolate phosphatase from aquifex aeolicus vf5
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
MRVILFDLDGTLIDSAKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVYTKPYPEIPYTLEALKSKGFKLAVVSNKLEELSKKILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDFTLSRPSDLVKLMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoglycolate phosphatase
publication title Crystal Structure of the phosphoglycolate phosphatase from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2yy6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yy6A01
1Z4MA 3W5CA 2B1RA 2R8YA 4OHFA 1L7OA 1L6RA 2ZG6A 5AM2A 3UMBA 5ALWA 1QH9A 3PGVA 5AVZA 3W5BA 3QUBA 5ALQA 1WR8A 4UU1A 5AI8A 4PNHA 2WF8A 2I34A 2CFRA 4NWIA 3E58A 3ZWDA 5JJBA 2IOFA 3PCTA 3U26A 3UMCA 2FPWA 3OCYA 3WKEA 4BNDA 2WF6A 5AW0A 3CZ4A 2P11A 1AQ6A 1F5SA 1J97A 1U2TA 3EPRA 2GFHA 1U7PA 3FPSA 5AVSA 2FUEA 1YJ5A 2I6XA 2G06A 2DQSA 5AIAA 3SHQA 2JARA 1SWVA 2CFSA 5ALLA 3MPOA 3A1EA 5A3RA 2I54A 2W11A 1WZCA 4UU0A 2OM6A 1ZD5A 4YCNA 4BEWA 2ZBEA 4UARA 3U7GA 5AHXA 5ALVA 3SKYA 4YCLA 4DWOA 2JGAA 4XPZA 4CE6A 3MMZA 4EZEA 2B0CA 3QU7A 2AGVA 2Q4RA 4UMEA 2YBDA 3NAMA 2NYVA 4HAIA 3OTQA 1Q91A 2EARA 3R9KA 2R8EA 3OCXA 1ZS9A 3QXGA 5ALZA 5AW1A 5AKXA 4Y2PA 2HO4A 3L1VA 1T5SA 1TE2A 1ZD2P 3QUTA 3QU5A 1RMTA 3EF0A 3OCUA 4L57A 2P27A 1N9KA 5AW4A 3I6BA 3P96A 4NFLA 1QYIA 4UAVA 1RMQA 3R4CA 2D2VA 3QGMA 3D6JA 3QX7A 5ALMA 4OCZA 2NO4A 3WKBA 1ZRNA 5ALKA 2JAUA 4UMDA 3N8GA 3VAYA 2JAOA 2AUTA 3AR4A 3TLMA 4Y2SA 2R8XA 4HGQA 4BBJA 5AVVA 2R8ZA 2Q4TA 3SLRA 3N5KA 1T5TA 2FPXA 2WF7A 4XQ0A 1Z4JA 1ZD4A 2FPRA 5ALUA 3J7TA 4L6AA 3AR9A 5IT4A 4KNVA 4G63A 3QUCA 3HYCA 5AIBA 3ZX4A 2Q5EA 4JB3A 2AMYA 5AVUA 3FM9A 5ALXA 4CNQA 3B8EA 1J8DA 1RPZA 2HEGA 2WF5A 4HYTA 5E0OA 3QLEA 3AR2A 3KBBA 5AW5A 5ALGA 4CF5A 1MH9A 5AI5A 3QU4A 2ZXEA 5AW2A 1K1EA 2FDRA 5T41A 3E8MA 2YFYA 2HF7A 3ESQA 4GXTA 3KDPA 4HGRA 2YMLA 2G09A 3OCWA 2AH5A 3N1UA 3PGLA 2HF2A 5AI9A 1VJRA 3ZVMA 1L7PA 1XP5A 5AKYA 2C9MA 4IFTA 2C4NA 3RF6A 1XVIA 3K1ZA 3GYGA 3FVVA 3CNHA 1LVHA 4BX0A 2MSNA 4KX3A 1Z4OA 3ZVNA 1Y8AA 1QQ6A 3AR6A 3SKXA 2P9JA 5AW8A 2B8EA 1U7OA 2ZBFA 3M1YA 4RETA 3W5AA 2YMMA 4UASA 2I55A 5IT0A 2PR7A 5AVWA 3OPXA 4QJBA 3L7YA 2ZOSA 2B82A 2WM8A 1XPJA 3KC2A 1Z4LA 4MUMA 3WKAA 3L8EA 4YGYA 4L6CA 3I76A 3NUQA 3ZTWA 3A3YA 4HGOA 3L0BA 1RRCA 3NRJA 4F71A 2CN1A 3U7EB 1RKQA 1RKUA 3L8HA 3QU2A 3KOOA 4Y2TA 3IB6A 1S2OA 5AVTA 3L1UA 1FEZA 3PDWA 5ALNA 4EENA 4EEKA 5ALOA 4AS3A 1X42A 1YNSA 1SWWA 4UW9A 2I33A 5AI0A 5AKGA 5AI4A 3WGVA 4YIHA 3WK5A 5AM0A 4EX6A 1Z4QA 4Y2XA 4BNDB 4Y2UA 4XOUA 2G0AA 1RC8A 2IA5A 1YDFA 1NNLA 2JAWA 1TJ5A 3QNMA 4Y2RA 2RAVA 3OCVA 4NABA 1NRWA 1Z4PX 2YMPA 3IJ5A 3MN1A 5AVXA 4O8CA 2C8KA 4KYTA 5AK4A 3E81A 1Z5UA 2HDOA 1RDFA 3FPBA 3AR5A 4FE3A 3F9RA 3WK4A 4UM7A 3U7FB 3M9LA 3AR7A 4H1WA 1JUDA 3NIWA 3ONNA 2FPUA 1TJ3A 4EELA 4KX5A 2BY4A 5ALRA 4C4SA 5AVQA 3WKDA 5A3QA 4Y2QA 2NO5A 5ALJA 1WVIA 1YV9A 4DW8A 4Y2JA 4Y2YA 4UMVA 3WK8A 2YN4A 2VKQA 3W5DA 5AM1A 2RB5A 3WK6A 5ALTA 1EK1A 1L8OA 1Z4NA 5A3SA 5AKZA 3ZWKA 4ZEXA 4EX7A 2PQ0A 5AW7A 2IOHA 2B1QA 4BKMA 1ZOLA 2G80A 3B9RA 3U19A 1TJ4A 4YH1A 3ZTYA 3OCZA 1L7MA 3QUQA 3DNPA 4J03A 5IS2A 2FUCA 5ALYA 3UMGA 4XE5A 2YY6A 3I28A 2O2XA 2PKEA 5AW3A 2I7DA 3NASA 5AKEA 3N28A 3DV9A 2FEAA 2WHEA 4Y2VA 2HX1A 3R09A 4BYGA 2IOFK 3NALA 2OA0A 3ET4A 3N07A 4RESA 2EAUA 3FGOA 4DCCA 4CF4A 1VJ5A 4F72A 5AW9A 2FPSA 5AM3A 3AR3A 5AVRA 1RMYA 3WKCA 5AVYA 2YJ4A 3AR8A 1U02A 4HGNA 3L0YA 5AK3A 2MU2A 2RARA 3QYPA 2BDEA 1L7NA 1RLMA 3DAOA 3E84A 5AICA 3KZXA 5AKKA 3WK7A 4UM5A 4DFDA 2HSZA 1U2SA 1CR6A 2ODAA 1N8NA 5AKLA 1IWOA 4BX3A 3ZW7A 2IYEA 5AI6A 1YMQA 3ZX5A 2YJ6A 3WK9A 2GHTA 4E88A 3ZUPA 2WF9A 4KNWA 5AESA 3IRUA 3ZVLA 5FP0A 3HLTA 4B6JA 1PW5A 4Y3UA 5AK6A 1O08A 3BA6A 3QU9A 2O9JA 5ALIA 2ZBDA 3DDHA 4FFDA 4YIKA 3A1DA 1ZRMA 1Q92A 1CQZA 3SF0A 2HI0A 5ALHA 2MU1A 2G07A 1T9ZA 2OYCA 1LTQA 2G08A 5ALPA 4I9GA 1TA0A 4HGPA 2W43A 3L5KA 5ALSA 4QQFA 1YS9A 3WGUA 4JDPA 4NV0A 3L8GA 1QQ7A 2BDUA 4OFZA 2GO7A 3EF1A 2HHLA 2W4MA 2B30A 1RLTA 3SD7A 5ALEA 5ALFA 2X4DA 4GIBA 2YMQA 2C8LA 1RKVA 2RBKA 2GMWA 3UM9A 2CFTA 2EATA 5AKJA 5AM5A 1L8LA 5ALDA 2GHQA 3KD3A 1ZD3A 2HCFA 1ZJJA 5AKHA 1Z4KA 3L8FA 3BWVA 1QQ5A 3NANA 3I1YA 2B8JA 5AW6A 4BX2A 3MC1A 3ET5A 4CF3A 4AS2A 1KYTA 2C88A 1O03A 2ZBGA 1Z4IA 3U7HB 4KN8A 1EK2A 4G9BA 4ZEVA 1WPGA 1Z5GA 2YJ3A 5AK5A 2G1AA 3L0CA 4C4TA 4MWOA 4YCMA 3B9BA 5AM4A 4UATA 2FI1A 4J2TA 3A1CA 2P69A 1Z88A 3SMVA 3ZI4A 5AKIA 4IG4A 4UAUA 4C4RA 1RLOA 2WFAA 1NF2A 1VFPA 3ZU6A 1RQLA 4FYPA 3FZQA 4BEVA 2HOQA 4NAVA 3U13A 3RFUA 4I9FA 1SU4A 2YJ5A 3ESRA 3EWIA 4AP9A 3ED5A 4OD0A 2QYHA 3S6JA 4ZEWA 2OBBA 2QLTA 4UMFA 1RQNA 1S8OA
chains in the Genus database with same CATH superfamily
5K0TA 2LIPA 3DOIA 1Y6ZA 4NBNA 4OXKA 1JG3A 1M7HA 3MILA 3SV4A 2VWQA 5BWNA 1U3WA 3B6KA 1RYYA 3IH5A 3KKQA 1NULA 1PT8A 3UXOA 3F9IA 4R1PA 2G06A 3EVDA 3GEBA 4R8UA 2YASA 2EX4A 3RSOA 4PG7A 3K0EA 1Y1LA 3OLZA 3GJTA 4KUEA 1ECBA 4NBUA 4GUAA 2VJAA 1JDJA 4CF6A 2QK4A 4KEAA 5K20A 5A5VA 1R74A 2ZXFA 2EKDA 4G9GA 5JNLA 1N9KA 4J9UE 3GFOA 4NBTA 2BFBB 1TTTA 1SL1A 5KHAA 1TAHA 3BAFA 3EEYA 4D9CA 4I55B 4Q0MA 1Z6GA 2IXDA 3HDVA 2R1TA 4P3YA 3G5TA 2YN2A 2ZJ2A 1OW3B 4KG7A 3AERA 4JFRA 2O8BB 1XG5A 4YDSA 3ROKA 1RBMA 2ACKA 3KQTA 2BBOA 1KL9A 2A0KA 5ALGA 1PWHA 5IVKA 1F0KA 3D0QA 1J5PA 3F6PA 3ZWMA 5C9ZA 1X74A 3K70D 4V2UA 3I30X 1OTYA 4KMOB 2FG6C 5D3QA 1UK7A 2OHOA 5I3CA 4KYVA 3EE6A 4HPJB 3DXFA 5I7HA 3DB2A 4J9QA 1N4DA 1HDCA 4C9BA 4DR2B 3O3MB 3TZHA 5H8WA 3RT7A 4PNPA 2Q5JA 1NV9A 3KWFA 3HJGA 5TGDA 2E4XA 3IC5A 5JBQA 3PDWA 3RUFA 4Q34A 1T3LA 3UXHA 1H2XA 3AIIA 4IDEA 1JEAA 2QUKA 4PZPA 4AX8A 3COVA 1TZJA 3D8BA 1Z5ZA 3LGAA 4TUYF 3OCVA 4CM8B 2TMGA 1IU9A 2FSFA 2IXBA 3M4NA 5JDCA 1J56A 3PSAA 2XZOA 1ABBA 2GCEA 1ZQBA 4MMZB 1ZN9A 3MZ0A 1XEWX 1NVTA 1U98A 1XKLA 2X2FA 3MF4A 2J6IA 1IG0A 1CDEA 2O4UX 3TEMA 3K70B 3W7VA 1KI1A 4MDYA 4CCAA 3NG1A 2CPRA 1TTQB 3GLRA 2FMUA 1BRTA 4PG8A 1WB4A 4MTLA 1ZGAA 3AV3A 2IHVA 4MYUA 4CM3A 4TS3A 2X8WA 1Y9ZA 1F2TA 3GIMA 3R7WA 4MI6A 4FMPA 2X3YA 1JL3A 2B6GA 3LYAA 4C6SA 4MPDA 5KJFA 4GGPA 3TE7A 4MRRA 3OZGA 3TI9A 4IXTA 3RCBA 5IJ9B 1E3SA 1L5RA 4PLPA 3X1XA 3E9CA 5BR1A 4C89A 2HBQA 4WCFA 1NK8A 1IH8A 2XGMA 1YBMA 2OYCA 1YL5A 2BUAA 3OFSA 2F48A 3WQRA 5KG6A 5A9RA 4PGHA 1GR0A 3G2NA 5K6TA 3WA7A 4DFMA 3O8QB 2KM1A 5JWHA 3GFKB 2WWFA 1DIOB 1QOZA 4IDHA 4A1FA 1YIOA 3P20A 3I39X 1C0KA 2COKA 5GOTA 1A50B 1KYYA 1X1QA 1JLSA 2JLRA 2MSDB 4DEVA 3W2FA 4MWOA 5HGXA 3NAGA 3TZQA 1GU1A 2OHJA 3IHTA 1Z7EA 4I3GA 3DEKA 4PLTA 2VJYA 2K87A 5AYVA 3FZQA 4OJMX 4R6WA 3VAAA 3EXHB 3KQPA 3ED5A 3RREA 4ZVLA 4V0SA 1SVSA 1M3SA 4M04A 3UMBA 3ANTA 2DKXA 3ITNA 3GNLA 1CUEA 3RIEA 1W48A 3ZZ0A 5KTSA 3HCBA 2VAXA 3H2GA 2W48A 2GEKA 4N6NA 4XZ3A 5JSYA 2Z4RA 4KO2S 1KEEB 4PYIA 4N9WA 4AUKA 2E55A 1HK7A 1VI6A 4RWZA 9ICEA 1SBHA 1PV2A 1Q3KA 1XCBA 4UJ3A 4RK0A 3FIUA 3EOAI 4QT4A 4WX2B 1JXOA 2Y93A 3LWBA 5KTRA 1O94D 2XLBA 1KQ3A 4C43A 3AY0A 3QBEA 4PS1A 2NXEA 4RQNA 3E4DA 3AJAA 1RPLA 3LX6A 1PZNA 1JR4A 4FEYA 4XDHA 3QFCA 3HBAA 3L7AA 4LXUA 4DJ5X 1GKIA 4KKXB 4FFRA 4MTCA 2OP0A 3B8EA 2CZQA 3UT5B 3VR4H 2GBFA 3AU6A 3GARA 5J63A 5KIAA 1S1CA 2P9QA 3E22A 1ZNZA 4ZTBA 2PMEA 2RDJA 1KMMA 3HEMA 5AKYA 4P3PA 4M49A 3EWAA 3LC1O 1EA5A 2MRLA 2O8DA 4A82A 4TL7A 1QVRA 4CLEA 3GXOA 1TF2A 4YP3A 1U7OA 1TAQA 2EJVA 4XWTA 4J4HA 1VHDA 4J8PA 1FP2A 3T9FA 4XJVA 3G23A 3VX4A 3DDWA 2N47A 4F2HA 3JQBC 2GEUA 3U9SA 1Y98A 1T1EA 2C3YA 4D02A 4OH7A 3KOXA 2QGNA 3CEAA 4ESHA 1VI5A 1OUMA 1M8KA 1Z2CA 3OLWA 4DLGA 5ULLA 4JUBA 3T7CA 3L0IB 4XA5A 1OIWA 1TU4A 1NKEA 1MAVA 3VZQA 2B1IA 5JCXA 3MN1A 5F78A 4UBMA 3EDCA 5I9LA 3LUBA 3G5LA 1WNTA 3BB4A 1QRTA 3CX3A 1JUDA 1MQAA 1NKBA 4GNRA 2WP8J 1ZQFA 5ALRA 3F8TA 1XFDA 2NWQA 2XECA 1TCBA 5LVAA 1KRHA 3QWIA 3D7SA 5CX1A 4UEQA 3QLUA 1BD3A 4MZXA 2N9UA 1A4IA 3KFUF 3R6GA 1YH3A 2LZ0A 3U19A 2NQ2C 4N3CA 2OWDA 4B4DA 2R1UA 1Y8RB 3O4HA 4NPCA 2OBXA 4LYAA 2PPVA 4NYMR 1S8AA 3STUA 2C2DA 1QONA 1UBTS 8ICSA 1N3BA 3BMXA 3FUWA 1G8YA 4HY3A 5AFSA 2ZUFA 2Y9MB 3W06A 4KRYA 1AH2A 1MNAA 1Q74A 4HUTA 1ZITA 2Y66A 3KAJA 1QQBA 5C1OA 1XUOA 4OJQA 5GM2A 4DARA 4TTPA 3U4AA 3I2HA 4CR7A 5J4KA 4UHDA 4YI5A 3WYBA 5AESA 1RM3A 4HGZA 4JJ8A 2Z8YA 4DPLA 1L4BA 4KI7A 1Q92A 2R4UA 1LTQA 2MYPA 2OZLB 1ZQIA 1ZIOA 3TLGA 1BDIA 3N0TA 4P84A 3NDIA 3D4NA 4X5VA 4D4HA 2XF2A 4JJ6A 3BTUA 5FOXA 1I4EB 4ZI7F 5JSFA 3BRSA 1GPUA 3K2EA 4K9QA 4MGEA 4DDUA 1GL7A 2BKUA 4S0XA 3LMKA 1MAWA 3QRWA 1OFVA 5DB4A 4UD2A 2JGNA 1XIVA 3GBVA 4MF2A 3CMCO 4Z2AA 5FBRB 3T5GA 4Y0NA 2IW3A 4X7RA 3CT4A 3DUFB 1C3VA 5C0OE 1O7JA 5F1YA 1NJZA 2WIAA 1F3LA 2R6DA 2GR9A 1ZQ9A 4KLGA 1WMDA 3RFXA 3NIBA 2EXXA 3LW7A 3SDZA 1RWQA 4B6EA 4LWQA 4ECZA 1ZXXA 2C04A 3P9ZA 4WV3A 3UXYA 3MB8A 1JE0A 4QXAA 3PW0A 1FSFA 1G7SA 3UY4A 3EC2A 1Z74A 1RS0A 3IAEA 1CFJA 4YAEA 2UDPA 1UR5A 1Z0KA 4ZOBA 4ADSG 4EKGA 4DLEA 1M74A 4KAFA 5KFVA 3PX6A 3O8LA 3V9AA 5JAPA 2YV2A 4YXFA 1GPWB 1V8FA 3IAAA 3UW1A 2PXIA 3V8NA 3VU9B 2G82A 1U8CB 2IOQA 2OCBA 1H42A 4MUJA 5J59A 3V7NA 4HX2A 3AXTA 1AKVA 1Q1BA 3DE2X 1BDBA 4DSEA 1AO3A 1ZC3A 4U2EA 1SXJC 7MDHA 5C4IA 4MYRA 3JPTA 3CYMA 3C6KA 2BH2A 4INPA 1D4ZA 1G0OA 4QU5A 1W59A 3KS9A 4ZT3A 3IHWA 3W1VA 3ISCA 1F2DA 4N6OA 2ACWA 3QK7A 2K8AA 1CP3A 1GA4A 5FADA 2HF7A 1XLUA 5FTWA 4WN3A 2BCRA 1PQWA 4DR3B 2C3OA 1XO0A 3JQGB 1MRSA 1V95A 4RK7A 1LVHA 2KIVA 1P7DA 2PUGA 1BXZA 1MHPA 2IHZA 4L50A 3SKXA 4UKDA 5EI5A 1DB3A 5EZ6B 4M0MA 1KHTA 3UWDA 5JSZB 3UA4A 2IEAA 3OTOB 2P3OA 3CS3A 3H1GA 3GV0A 2RCYA 2G25A 4A15A 1E9VA 4L4RA 1R18A 1KBOA 4II7A 4L6IA 3L4JA 4B4VA 3V1NA 1U49A 2C2OA 3LKVA 2EERA 3EMVA 1MENA 1MNQA 2BMAA 4QVIA 1VECA 4O3QA 5C35A 2GBCA 3ZKAA 1C30A 4EB6A 1V3VA 1BGXT 4BLTA 3T35A 3ESXA 4J0EA 3MR5A 2AFIE 1A8HA 3KP1A 2FFJA 4ZWNA 1FUYB 1NFRA 1DAIA 1H0HA 1KP2A 4JWMA 3D6TB 5KVVA 1HF3A 2VTDA 1ZGCA 4OHOA 4R64A 3JR7A 3ZU3A 4JQSA 3OIYA 1K88A 2ZJAA 5EIEA 2PCJA 2G70A 1WY7A 3WKDA 1NVEA 1CX9B 1P44A 1KVSA 5AUOB 3TLBA 4Y2JA 4C4YA 3B5JA 3KU1A 3PNVA 3N2NA 1L4NA 2VI5A 4MVJI 4V0KA 4GI3A 1JDPA 2DQ4A 2YJNA 4JSTA 5DB7A 5KFHA 4MR9B 4J3JA 4YAJA 5JEDA 2XCRB 2XOKD 1XROA 1EMDA 4DQUA 3RFTA 1QE0A 1Q3UA 3GI1A 1L9KA 3QENA 1NSYA 2NTEA 3C2MA 1XRNA 3DTTA 3NC1C 4H6PA 3HCAA 2HLDA 3KEGA 3SZLA 3SXUA 2OV3A 2WE7A 2WB1F 2EZ8A 3KYJB 4KJZA 2UVWA 1JG2A 2R47A 3ONDA 1X1SA 1GYRA 4AMYA 3UT0A 1B93A 4D82A 1Z73A 2XOKA 2BKVA 4HMPA 5DX8A 3K9GA 9ICCA 2DTDA 1YRYE 1AKMA 2H1RA 3OY7A 3BCUA 4CMIA 1HUQA 4Q93A 3H8SA 1YFKA 2ZS7A 1T9KA 5CYFA 3BA1A 3ZCTA 1RE1A 4C3ZA 2NU6A 2DBZA 2CHUA 2MSWA 4CMEA 2X4DA 3TCKA 4NCIA 2ZYAA 3AL2A 1KP9A 2IH2A 2ZJ8A 3CKMA 4WT7A 5IIKA 1BD4A 4M9JA 4QZIA 4TUYB 3V4SA 2Z8ZA 1EBFA 1JRLA 1SXGA 5KDDA 1HFEL 3HP1A 1VE1A 3SMVA 3GRYA 3OUUA 1SQ5A 5A71A 3EVFA 1TF5A 5DSZA 3VUFA 2BFFA 3IHLA 1MOQA 4CT4B 2CV2A 1J1ZA 3H19A 4MK4A 2ETXA 3ZLJA 4KGZA 3AM3A 4DJFC 1GG9A 4INOA 5KO2A 4CM9D 3MUFA 2R68A 4FYJA 3COSA 2RE8A 1P4RA 1UMCB 4W5TA 3NBXX 4NV1A 1JWAB 3CLRC 1FUEA 3RQSA 2HNKA 4BFYA 4M47A 1Z15A 1MFZA 4B7UA 3QE2A 4PW0A 4YCNA 3MGBA 1Y5LA 3UFXB 5AJUA 1JDBC 3BRCA 3OEEA 1JDUA 3HWWA 1SELA 3OPMA 4ZPXA 4L16A 1FTWA 3QXGA 3IP5A 4Y2PA 4BLPA 2OECA 4CM9A 4YK7A 1CJTC 3EZFA 3CVYA 3X0DA 1DLJA 1J33A 3FDZA 1KS2A 1NQTA 1KEPA 1Z17A 1NK9A 5BV1A 3TR0A 3I64A 4RPJA 2C5GA 4LYDA 2QTCA 2CL5A 3VO9A 2HRZA 3GJYA 1CERA 3O8OB 5C8VA 3GDHA 2DTXA 2FQ1A 1TRHA 2VWPA 4ZQFA 4RDHA 5FT9A 4CM4A 1P5HA 1J8DA 5E0OA 5J2GA 4WLFA 5J40A 1N57A 1ZMRA 4RD2A 4H2DA 4KN7A 4G1FA 1XZHA 3DONA 1VJRA 3VHXB 2PFSA 4GWGA 5HZMA 5E6SA 4II3A 3GDGA 5FI1B 2AUMA 3RTVA 4DC9A 4BWMA 2W8KA 4M37A 4X60A 2H92A 5DBFA 4F84A 4UVHA 2C5HA 3K6SA 1I2CA 4YC7A 5EL0A 4YWJA 3HY3A 1XZLA 3RTAA 1F48A 5IM4A 4FPXA 3K8QA 2KFNA 3A8TA 1HXHA 4ES6A 3JRNA 4HCJA 2FRDC 4AS3A 3PXGA 4KJXA 1IPFA 3SBOA 1SVLA 4DF4A 2H4YA 3EHDA 4K7JA 5DBHX 3ZE1B 2GTPA 1U0EA 2ZJFA 5EJIA 1US8A 4DLWA 2WI8A 4YP6A 2XUIA 4Q44A 4MZDA 2HO5A 3SF8B 2Y0PA 2EG9A 4B6RA 4KFUA 5A3QA 3RJ9A 2PPLA 3ABOB 2VP5A 1XK6A 4RIGA 2CD7A 3A6GA 5KFXA 4NJOA 3RU3A 4MCHA 3BWEA 3NWJA 5CLIA 5CDHA 3TINA 1ADJA 1AHIA 4TKZA 5K8IA 1YGYA 2FQWA 5CLHA 1G5IA 4P2GA 3B0YA 3ORSA 4Z6CA 3K4QA 2XAUA 3MGVA 2WT9A 3I61A 3N87A 4LOJA 4UM8B 3WYFA 1KE2A 1CI4A 4IV8A 3KZXA 2BDEA 4RZRA 2WTBA 4BB9A 2EANA 3GFFA 3CE6A 1CUHA 4MQFB 4GXJA 3K9QO 5DWVA 1NKSA 3HYSA 3RO7A 2EIXA 2C58A 2Y2VA 4IH1A 1EB8A 5I48A 2QV7A 1H9CA 1IXRA 1QU2A 1CR0A 1NG1A 1R6XA 3B1XA 1EUZA 3TCNA 1GADO 2N46A 4LZAA 2MCFA 4F3NA 5ESDA 2DR2A 3DH0A 3C4QA 2I4LA 2J8ZA 5I45A 3BB3A 2GM4A 4BVFA 1QH1B 2BPOA 4GD3Q 3O8DA 3MM4A 2K8BB 1DWPA 4ZVTA 2JW5A 3U4CA 3PBKA 2DJIA 4MWSA 3RJMA 4L75A 1Q2UA 2CVFA 3OP1A 5BVGA 3Q9UA 3ZIAA 4GX2A 3ST7A 1U9IA 2XNHA 2CCKA 5G5HA 4KLDA 2JH8A 5ALWA 5AVZA 3EXFA 3NDRA 1M2OA 1GPYA 2V9WA 3G8DA 1MAAA 1LUAA 3P2MA 1P74A 1VCOA 1DTEA 3IAM6 4D3YA 2CUZA 4R3WA 1FMTA 5AVSA 1PBTA 3NDPA 1CYEA 4A8JA 1JVSA 4F3TA 4HAZA 4MARA 4V3BA 2XUAA 3JYLA 2WRZA 3I62A 2PGXA 4R8MA 3DQQA 1G6HA 3OCXA 2J6TA 1NBMA 4NP6A 1QIHA 2EWMA 2GYUA 2A3VA 1R0CA 1HUOA 3AW8A 2A35A 2XB6A 4QWEA 4UHKA 2XA2A 1UBEA 2HYIC 4CKWB 2H1WA 1JG7A 2XNCA 3JD3A 4HFMA 5CD9A 2OL4A 1VLZA 3C85A 3R0ZA 2IW1A 3RUCA 2XVYA 2Z8XA 4Y1RA 1FUIA 1D04A 2Z5LA 4WWHA 1Z8DA 4Q37A 1X9GA 1J5XA 4P4SA 4C3VA 1GPNA 2PSEA 4ZI7B 1IG3A 1X2BA 3G9TA 2D0OB 3S8YA 2FVXA 5JHGB 1R0WA 4YJDA 3B52X 1K1EA 5F5XA 1OXMA 4D3XA 2ATEA 3R5FA 2GX6A 4L9WA 4HDRA 1WCYA 4ZYLA 3KHLA 2MMCA 4TZ0A 3HL0A 1Y8AA 4GXNA 2YHUA 3U7QA 2P9JA 5JH7B 3ENNA 4YX9A 4F04A 1Q1QA 1U0HC 1YJBA 5BUCA 2DPJA 4EKDA 2Q4EA 4KOAA 8OHMA 1ABFA 5EJFA 1YC5A 3GWGA 2F44A 1GP2A 3WHPA 4IIYA 4B2YA 3ZGYA 4WJZA 2KIWA 1AA6A 1TTPB 4I99A 1SCQA 2Z1NA 3MQ2A 3UJ8A 2G8NA 4AYTA 4QLOA 1MVOA 2WB1C 2C2YA 1TCCA 1ZQRA 5AKGA 4UUMA 3CYFA 3HU2A 4J1NA 1Q95A 3PA8A 4FZ5A 5EMKA 3WL3A 1S9DA 2XSZD 4PNEA 3K75D 4ER6A 3OO0A 1SOMA 1Y4UA 2NT3A 4K9NA 4QUHA 3GLGA 2I80A 1DAEA 1QS0B 1U65A 1U3VA 4J7UA 5JVDF 3WGNA 5ICSA 2G40A 1T2NA 1RI5A 3DMDA 5C1PA 2EWWA 4IL6U 1UMBB 4NE7A 2QTVA 1L6IA 3WGTA 3HBFA 1WUJS 4PH5A 3BMNA 2KV2A 4MFFA 1NDUA 1XQ6A 3ZCRA 1CRLA 5ER6A 1H5QA 3I9MA 4ZN6A 2LP4Y 2B4AA 1UP4A 1IVNA 1HFJA 1CLUA 3HSSA 4IJ6A 1A04A 2KBEA 1MB2A 3G1UA 3KHSA 2AWOA 2NZWA 1EFHA 2JJYA 3LCUA 5BSVA 3UKDA 5MN5A 2H3EA 4DM3A 4LI3X 2ZE8A 3A1DA 1JI0A 3ASUA 2XIQA 2L5YA 4ARSA 4P0PB 4GKJB 4K6HA 2OXRA 3HJTA 4UBNA 4AUNA 2E82A 2Q1XA 3N8IA 4PSDA 1QDEA 2VZ8A 2C84A 3GRCA 4HH4A 1E6EA 2H1IA 1R6AA 1C7JA 3AUFA 4MV1A 5AVJA 1LI7A 1THZA 5LDDC 2L18A 5FI5A 1E5TA 1QFZA 1DG1G 4KW7A 3GO4A 2OUKA 5SYNA 1KZGB 2YYYA 4Q3KA 2AD5A 3LQQA 3GR6A 3JPPA 2JJ1A 5I4KA 2G1AA 5E8JA 1D5CA 3GBPA 2LR0A 1X87A 4OHKA 3DZ8A 3S5UA 3NHZA 2Z7JA 1RM0A 2WYUA 1Q0QA 3Q6NA 1GUAA 2ASLA 4AP9A 4QELA 1R8QA 3R20A 4OJLA 3OG9A 1MB9A 1ETHA 1YA8A 2IHBA 4IVPA 2QDKA 4LZZA 4LISA 3DOEA 1X38A 2YL2A 4Y67A 1HURA 4KBFA 4MW5A 1P1HA 4IW3B 3WL4A 4XJXA 4CHGA 1QF7A 3DM5A 3LXRA 4HDAA 1K08A 3OC6A 1DRJA 1AMNA 2V58A 3BIWA 3JU3A 1N2SA 3VHRA 4CGYA 3CNOA 3EJWA 4JR0A 4YMUA 3CJRA 3I52A 3PDIA 3JAMA 4BZZA 4FZVA 5FOWA 3K30A 2NYVA 2PRSA 1WYGA 3I9FA 2JLBA 3H8MA 2VPYA 3SHVA 5AW4A 1LGYA 3EGWA 2R3SA 2BW0A 2P9GA 4OJYA 5K1ZA 3JATA 1BS1A 1KLNA 3QKIA 1GGHA 1FX0B 1W1WA 3T7TA 2WF7A 2E4WA 1A5TA 1X1AA 5D1HA 1ZM3A 4IUDS 4HAOA 3JARA 2PCLA 2J5QA 4Z6FA 5CB6A 4KBGA 3OT4A 5J58A 2WW8A 1EDBA 3WLMA 3FPHA 2J7KA 3WLTA 2G09A 4IFEA 5FUVA 5CB1A 1PWYE 2BQ3A 1K7EB 4JLWA 1LVUA 2AN3A 2JH9A 3T5PA 4MF8A 4RSMA 4WLNA 4NULA 5P21A 4NTZA 3E9YA 3BJZA 1EX6A 4WXEA 3VDXA 5AVWA 4NG5A 5CB4A 2VDMB 5ECDA 2PZMA 3QFSA 4OL9A 4UQLA 3SSNA 4C2UA 4B8ZA 1K6JA 4AJ2A 4I2AA 4J6FA 4ZQEA 4LOLA 4D9JA 5DTIA 1KR2A 4QO8A 1Q1ZA 1W35A 1IL0A 7ABPA 4B9NA 1FP4B 2O7VA 4X65B 2YOGA 2QSUA 2Z2IA 4O4IA 5NULA 3L8ZA 1M66A 1VLJA 4D1YA 5CLLA 3ZWOA 3CM0A 1ML3A 3AQ4A 3U3XA 4KPGA 1AK9A 2AR0A 3KJZA 5LYJF 2NQTA 1JA9A 4UNQA 1Q1NA 2F8TA 3E81A 2WICA 1SBZA 1UC8A 2QG9A 4WJKB 2Y76A 4M0CA 2ZPUA 4NFYA 3FYTA 5AXDA 4OI0A 4D97A 2OCXA 5F2OA 3DW1X 3H87A 3L41A 4KQ1A 1Q77A 1XMQB 3R77A 4ZRNA 1E3QA 3QBJA 4AB1A 1G42A 3HJNA 4WTOA 1KZYC 1AV6A 3TTVA 1MVLA 4KB5A 3ZWKA 3V97A 1JN3A 1RAGA 2C0QA 1X77A 4PC6A 3R7DA 2PMKA 4ARUA 2REOA 1ZOPA 3Q0IA 4AZSA 4GE0A 2W98A 4QUBA 3UMFA 2QM0A 1QLJA 3BTOA 3AB8A 5D85A 5EHQA 3G2MA 3I9V6 5LOVA 1CHDA 3S2IA 2FWBA 4JVMA 4FYXA 1A77A 2WIDA 5KFJA 1RABA 1PR4A 1QHHB 3SX4A 1AK1A 2D1SA 1XX6A 4NNJA 2R8IA 4ZAXA 3JRWA 7GPBA 3R74A 3HP7A 2XRZA 2DT5A 3MT8A 4PYJA 4FM9A 1GG2A 1EVKA 5FBZA 3ZWVA 4PO1A 1O8BA 4B2LA 4XWKA 5B7NA 2G07A 4U9UA 4HNUA 1XWWA 4PFKA 5J2EA 2AJQA 2OXIA 3E9MA 1AB5A 2WYWA 2B3TA 5CDFE 1PGPA 4GIBA 2YMQA 3UM9A 3JQFC 4HNSA 3V7KA 2Q3EA 3ICXA 1HOTA 1T9AA 4AJIA 5E6RA 3MMPA 5JPDA 1DRWA 5GTHU 5CHYA 3AKEA 1PX2A 3T9BA 4KN8A 2Q5QA 4DVGA 4E51A 3PSIA 3BD6A 3P9KA 5K3CA 5DNUA 2AFHE 4ZT2A 3EGVA 4YJ2F 4HNVA 3PZBA 4Q4HA 4YPVA 1VE9A 4HX5A 3DE4X 5F2EA 3EIXA 3TKAA 4ZFNA 4LHWA 1G8MA 1LWNA 5KJEA 4N9QA 3C5GA 4ZJPA 1IM5A 4INJA 5D3KA 4PCAA 4C7YA 3OIDA 1O5OA 4BNKA 5DTJA 4Y7CA 4Y1EA 5FPHA 3W8FA 5JOQA 4L5IA 4DSLA 4URWR 1VGQA 3A05A 2ZRCA 1KH3A 4A5OA 3VZRA 1YBAA 2JGJA 1MRNA 2CY0A 3OZAA 4EFMA 1Z6YA 3EISA 3Q9SA 3GLHA 1KTQA 2JEOA 2YN0A 1Q22A 3Q5DA 1COZA 1E1QA 4KIFA 3CRW1 3UAYA 1Q5PA 1WOYA 4WNCA 5F1PA 5FWDA 1CF9A 3CN7A 3TBHA 2W6JA 1RQ2A 3T3HA 3WISA 2QQFA 1CRPA 1W4CA 1DO0A 4YUVA 1ZVMA 3BSYA 2PKRA 2LBOA 4GKAA 1GQOA 3HZRA 1GO3F 4K6CA 1V3QE 1NN5A 1JAXA 4UBJA 4QJFB 9ICFA 3FM9A 1YE5A 2BCUA 2AFVA 2FX2A 4WFKA 4GBGA 2FE9A 5JMPA 4O2AB 5ILOA 3KFLA 1M76A 3K5HA 3RB8A 3TO5A 2XQGA 3WFJA 1V6SA 4TUPA 1HDXA 2W00A 4IVNA 2FMIA 3B1FA 3PXUA 4DSNA 4ZCRA 1W49A 3HA3A 2P9FA 3HKCA 4EPYA 4YMIA 2HHSA 5HCUA 3IXLA 3AEKA 5IVIA 4GECA 2Q07A 1E4EB 1NI4A 2BZFA 4OFXA 2WM8A 2X1MA 1WUYA 3AY6A 3RS3A 4BL5A 5KU1A 4RULA 3W2IA 4YD2A 3LFHA 4F5ZA 2KEYA 2KJ9A 1HORA 1GRRA 1YJAA 3HWTA 2OB2A 3TSZA 4YALA 1O58A 3JASA 4YRDA 1UUFA 5L7WA 5EUQB 3H4MA 3HZHA 1P7CA 2VHUA 2EP8A 4C2AA 2IIPA 4RJ2A 1AX9A 1V7QA 5E1BA 5A0FA 2P6PA 1PN3A 5A6SB 3CBGA 2K4MA 3K1YA 3KQOA 2R4TA 1K68A 5JYBA 1WHSB 3IBTA 1XPOA 3KTAB 4IHKA 2J31A 1COWD 4DPMA 5BYKA 3NFRA 1WVIA 1DXOA 2QLLA 2YN4A 4TQUS 3Q8PB 3KDSE 2Y1FA 2ZWAA 4YAUA 4G81A 1FNDA 4D46A 4XR9A 2JBWA 1AZSC 5ESRA 2XJ9A 4WOPA 4KXUA 3WLQA 1CZUA 1WXIA 4FBMA 3V2UA 5EMJA 2JEIA 5ES4B 3R0QA 1I94B 3HJAA 4XSVA 4JT2A 1RPAA 1A8SA 2IOFK 3UKOA 1QCYA 3HPRA 2NAFA 4BMPB 2ZIUB 1U2GC 5AM3A 4HLQB 1COWA 4CDGA 1AOXA 2WOOA 3WVNA 2E3JA 1HE4A 1Q44A 1QR2A 1QYVA 3C1TA 3RV3A 4YROA 4M0DA 4Q3LA 1EM6A 3UEOA 4CV2A 1H8EA 2IYEA 2ZP1A 2BFBA 3ZVLA 5HF5A 4PYNA 3FTNA 1CY4A 5KL8B 1MLDA 1MO3A 2FSGA 4I55A 3ONFA 4RQ5A 2RRDA 5EKSA 3GIDA 4ECTA 1XSEA 5CLJA 3T9CA 5FWYB 1K9VF 4CEHB 2O8BA 1NQVA 4PHAA 4LK3A 1N56A 1ZIPA 3KD3A 2YVUA 2WAOA 3CKKA 5JY1A 1KXJA 3NHRA 3QBVA 2MSEB 3ZDRA 4DN6A 4KMOA 5KC8A 1S7GA 2RH4A 4PGFA 2ZSJA 4V0QA 4PSUA 8ICMA 5JXJA 5AUPB 1GTJ1 3RRFA 2FVYA 1RLOA 1TQDA 3ML1A 2DJ5A 1RCFA 4NCHA 2HQOA 1RSZA 4MRAA 3EASA 4F4JA 1G9XA 2EP5A 4YMNA 2LCQA 1A97A 2WG2A 4XIGS 2PJZA 1J8QA 3U2QA 3RJTA 3PVXA 1KE1A 2ZJ0A 4UXJA 4BRZA 4QYSA 4CM8A 4CIXA 5D87A 4JX8A 2ZETA 4F1WA 2ZBPA 4JBNA 4WBNB 4X3CA 4IQGA 1RRMA 2Z8YM 4D5EA 1QO0D 3ZHOA 4ZTZB 1G5TA 2C00A 5KAMA 2P4UA 1VGRA 1FDRA 3HI6A 3DZCA 3E7DA 4YAIA 2X6TA 4LV6A 3GGOA 5ITSA 1R6TA 7ICJA 2A67A 4IRCA 2V4UA 2ONJA 4BY9E 1PVVA 4IMRA 1TVMA 3VYWA 1F06A 3FJYA 5CPBA 4FNGA 4LHEA 1P5RA 4OU4A 2DWUA 2X9LA 2IYYA 2O8CB 3HDHA 4CUZA 4S1WA 4HFNA 5AHKA 5DOZA 1XL1A 4G63A 4D4LA 5AVUA 1QCCA 1ISRA 5ALXA 4OUKX 3R3JA 3Q3JB 2QPAA 2I7XA 4MW2A 5LFAA 1RYBA 4UVIA 2EKQA 3O9ZA 1JQJC 1J9GA 1SVWA 2FGKA 3G6VA 1DEHA 2C9MA 2PGNA 5KFGA 1DKNA 4N01A 3TQHA 2AZXA 1VYTA 1CBUA 2BEUB 4UU8A 4BECA 3SENA 2JL1A 3BH0A 5IAOA 4KRXA 1LFDB 1TMGE 3ZJVA 4MGZR 2NSDA 1F2UB 4BGUA 3GY0A 3DL2A 3PFGA 1Y0BA 6LDHA 2J67A 2OB1A 3MWKA 5BRNA 1KK2A 1RZRD 3O8QA 3KFVA 2ZJ6A 4TLAA 2O57A 1AQLA 3WTCA 2I1VB 3VC7A 3A9RA 3GLTA 5ALOA 3OEYA 5IXYA 1BE1A 3CRZA 1L4GA 1MX3A 4UPVA 5SICE 1M75A 1SUAA 5BOSB 3FDSA 1NVVQ 2WTFA 3EYWA 2Q6IA 5TB5A 4DBVO 1F4VA 3F4KA 1NGSA 3GZFA 4A73A 4TTJA 1DV1A 5FF9A 2VH5R 1TK9A 2IJGX 4BLSA 2FQQA 3G7SA 2JJQA 1FRNA 2AN9A 3HM9A 3EXHA 2LW7A 1RZRA 1QAQA 5IAAA 5TNXA 4B2IA 3VVCA 4RMGA 4L1KA 5C81A 3NKFA 2VKQA 3U16A 2WZBA 4YWHA 1R37A 1JLLA 4NXZA 2WDPA 4EKIA 2H06A 2RAPA 4QU8A 1KPIA 2CEKA 5CB8A 3G6XA 3IQGX 5IS2A 3VPDA 2BTQB 1KEEA 4F86A 2V7QD 3WP0A 4J0JA 1GLVA 3RS2A 1NF3A 2DM6A 2CBZA 4AJJA 1U80A 2X14A 3NALA 3UMMA 1OA0A 3JQ8A 4KIWA 1I33A 4DKXA 3A0RB 2Q5IA 1HT1E 5HUHA 2ARKA 1VIMA 3T1QA 5CDGA 1EVJA 2RARA 1NP3A 3T15A 1R27A 1D9XA 3K1JA 1T3NA 1QFSA 4TGLA 4TKLA 1UZNA 2A0FA 3RV4A 1OH8A 4PLGA 1DUVG 4RU1A 4N5HX 3SXPA 3VSEA 2FG7C 3NDBB 2MINB 4YUZA 3R9IA 4CLXA 5BN3B 2GILA 2ZANA 2V7QA 3F47A 3QLVA 3K72B 4Y0VA 2H2WA 4O2BB 2ZIEA 4NAHA 4NCXA 2VDLB 3VPGA 3RF9A 1Q7TA 4US8A 2CMHA 2H3VA 3TSCA 1UAAA 2FZWA 4OPMA 4EF5A 5E3HA 4RQUA 4ALIA 1YDEA 2EATA 4JKOA 3STXA 4IY1A 4HEHA 4XA8A 2E4AA 5K03A 2P2SA 4QDZA 2I3ZA 2R48A 5LYJB 5E79U 3UPTA 1OLXB 4AP6A 2F8LA 4FUQA 2JZOA 4F3OA 1KAEA 1XC9A 1YJQA 3GV5B 3ABZA 5D1NA 3GG2A 1JMVA 3WBBA 4FGWA 5CLQA 1CF2O 3I1IA 3B6JA 1VGVA 1O94A 4LZNA 1Q0SA 5J2IA 2W22A 2W6ZA 1BPBA 2G1UA 2Z5GA 3KV3O 1GNQA 4ED7A 3JX9A 4KXNA 5DG9A 1FK8A 1PFUA 4UBKA 5EJ6A 4NRDA 4BVEA 1D6MA 5FFNA 1P7WA 1X1CA 5DW3A 4BMOB 4FHZA 2QMQA 4DSKA 1CRXA 4J9OA 1QP8A 3EYZA 4HYQA 1RHMA 1RC1A 3BQ1A 1G17A 1VKNA 3IUSA 2VT3A 4YMHA 3PIIA 1FYEA 4I4TF 1Q46A 3WLLA 1NIPA 1OZFA 4GL2A 1T34A 4GM0A 3AO0B 1PNTA 1IBSA 3L7BA 3ZGNA 4CYMA 1O0SA 3UO8B 1J49A 5GINE 1UF9A 4AO6A 4AF6A 4CG0A 1Q8KA 2I2AA 4HXEB 1A9SA 1LKYB 3IEIA 1U0LA 2ZS9A 5LMCA 1Y8RA 5FPTA 3OLVA 5BXQC 1FDUA 1LS1A 5IIIA 3JPOA 2ENWA 3GLFB 4DA6A 2ZE6A 2DP4E 1EQAA 2GNAA 3UYKA 1X1EA 2EH9A 2PNFA 4WOKA 3WIOA 4ZGWA 3TTSA 1B0UA 3A58B 4AT1A 1LCIA 1XT6A 2BI7A 2VBGA 2BKXA 4DQLA 2OQVA 3OTIA 3TLEA 1QSLA 1JYSA 5E3JA 5F7ZA 4JT4A 3I1FA 1MV5A 1V1MB 3CNHA 4BYMA 3QEMB 4MAFA 4R2JA 2AXQA 4R2XA 3LS2A 1VBMA 3M1YA 2RB4A 5L1KA 4YJGA 2HK6A 1MABB 3DXZA 3GWZA 3HCPA 4JI4B 2OZLA 2ONZA 3G85A 3U7IA 1UMDB 2CE7A 4LECA 2ZI7A 3FNIA 3ZTWA 3PFIA 2ZAIA 2AX3A 1N60A 1SRRA 4TSKA 4LGMA 1USWA 3IT2A 3MRXA 2W93A 3TFOA 2E21A 3N3AC 1RYZA 3C6XA 2N42A 3DUFA 4DUZB 2WLSA 5FAKA 1QGAA 2Y1IA 1TEHA 1G7CA 5C5IA 5TQ2A 1M2FA 3M6LA 2FTKE 1Z5UA 4UEJA 3HDQA 1OXJA 8ICGA 4HH1A 1ITZA 3ANMA 3MT7A 2XUZA 2LRHA 3G02A 4X41A 1T94A 2YB1A 1H2FA 5DLDA 3CX7A 3B9JA 2MYNA 5KOIA 3RADC 4UMVA 4QLBA 3I6MA 5HRAA 3TARA 1T0HB 2YQEA 1ECPA 2EAMA 4DDWA 2Z1DA 4E6EA 3RVRA 2FQXA 3OMWA 1L4LA 5DHPA 5K3OA 1KOGA 4NSNA 5AW3A 4JYCA 5ADUS 2W9CA 4AUEA 2RBEA 3WMWA 5B6JA 3NR2A 3LBIA 1OB2A 3M6WA 2HHAA 1PQPA 1H6AA 4CHTA 3VU9A 5EXXA 4BN0A 3QKUA 3R0XA 2GA8A 4HXFB 3VHLB 4QYTA 4OI2A 1XJ5A 4WZAB 3CPEA 3HN2A 2ONKA 4EHBA 5LQRA 1M67A 5JQGB 2YZKA 2J4FA 4LRSB 1PZHA 1CQZA 1QTNA 3LFTA 2MU1A 3H86A 121PA 2VYVD 2EFYA 1G2QA 2XYRA 3N7TA 3R3UA 1DTWA 2O7QA 4X97A 3MOGA 3ZLTA 3GH1A 1N8KA 3THVA 3NC0C 3MTJA 5AKJA 7ICSA 2OZKA 1I3OA 4MO9A 4KCGA 3TR5A 3IVCA 5K8VA 1KP3A 3JQGA 2FK8A 2WHPB 4D9KA 2ISPA 2PX8A 1IHOA 2X1LA 3FIJA 9ICQA 5B2FA 2F3RA 5JSZA 3ZI4A 4MFAA 3E5RA 1DG9A 2VHZA 4IRXA 3GU3A 1KO5A 2IODA 4X8HA 4OM8A 1WHTB 1FLVA 4L8WB 4M9RA 4KR3A 2B1RA 3IBSA 1QIFA 1LBTA 5BV7A 4ITVA 2XKBA 1O96B 4LTMA 1CP2A 2JEJA 1G66A 3DEIA 1PS9A 4RZUA 4YCAA 2C54A 2W3SA 1SEPA 1MN8A 2C31A 2W0MA 3AVVA 2OHVA 2OCDA 1XTJA 2VUHB 1WABA 1IQPA 3W05A 1VDVA 4IG9A 4B85A 3UTDA 1JIJA 4P4OA 1U8ZA 2ZYRA 1KI6B 1GT91 4FUTA 3Q7EA 3MAGA 4CEJB 3M3HA 1R50A 2OAP1 3GNQA 3HA7A 2JGRA 2BI8A 3T8YA 4ZPJA 4X6UA 4COOA 3VYVA 1ZD2P 1ZH6A 2B9EA 1P33A 3ABIA 3I01M 1VIAA 2XVTA 3P96A 3SYTA 5JD6A 3IUMA 2VHJA 3RVDA 4AY6A 4MR9A 4GI7A 1BHQ1 3KWLA 5BN5B 3FTFA 4C1BA 2POCA 4JROA 3EGDB 1DGJA 1NN0A 3U0BA 3TL3A 3HUUA 3AR9A 1K06A 3OP4A 3UXMA 4FGLA 4A0QA 1UXJA 2RH5A 3GMDA 4ZU1X 3U17A 2JEGA 1OE0A 1DQNA 4U39A 2OSVA 3VCBA 3VYSB 4KFTA 4GE3A 1R0LA 4V02A 3IEPA 4NESA 2BFPA 1SKAA 1CRZA 2J5XA 4GXTA 3OCWA 2X4IA 1VP9A 1SXJD 1RP1A 4QWAA 4FLMA 3RF6A 1KFEB 3TOXA 2G0NA 2GHRA 3D1VA 1M1XB 3F4LA 2NZVG 3V00A 4MCJA 2CNBA 4KO8A 1W34A 2QRVA 3GB9A 4C78A 2PFOA 5J0XA 5U1PA 2Q1UA 3A1VA 1GSIA 2CNNA 1ZU5A 5EFZA 1VE5A 2ORIA 4FBUA 1LKZA 1K8XB 3NRJA 5AJTA 2AKAB 1I6MA 4RTLA 1ICEA 4REOA 3STHA 2RHLA 3WE7A 4BC0A 4TYWA 2YIMA 4TUYA 4NZ9A 3SJUA 3A6EA 3WLEA 2QG4A 5GZ6A 1C9MA 3WYGA 4O3RA 1I6LA 2OTCA 3ZE6A 2O8EB 1T5IA 3PV0A 1XQ1A 5CMLA 3SVLA 1UWLA 4OQLA 3M9WA 1UFKA 4WMLA 1CUVA 2I5HA 1XCMA 2J59A 4EELA 1XMIA 3KVOA 1SXJB 2JIZD 4X54A 4KE7A 4XUDA 4LF4B 4G23A 5EG5A 2PFGA 1H0KA 3MG9A 1QTRA 2QLMA 1RXSA 2XQFA 1RHJA 4GRIA 3LWLA 5JNUA 4QBFA 4LY9A 2PJDA 4C7MA 1DQRA 5F51A 2MR6A 4D57A 1XS9D 1F0NA 4BRUA 4LI0A 2OG1A 4TUQA 2PU7A 4PZUA 3UFXA 3N8NA 4H60A 3J81A 3ZY5A 4J9RA 3NH9A 1O95C 2EW1A 2G5CA 2R6HA 4I1UA 5MGBA 3DAOA 2ZTEA 3L4KA 2JIZA 2ATCA 3NYIA 1YHNA 2RG1A 3GNSA 2P6MA 3EYAA 4PICA 2LYAA 4J90A 3ZYZA 1QSYA 2Q6KA 4MWBA 5IYZF 2W8BA 4GR4A 5FB3A 1QO9A 4GGMX 3DZHA 1K1QA 1F9AA 5I7RA 5BURA 4IJ5A 2VF7A 1YMVA 5LQUA 5A62A 3PZPA 3O8OA 1QVVA 5KB3A 5EIBC 1H22A 3DSRA 1RD4A 4RHEA 2GEDA 4P4LA 2H4HA 3EVCA 1M9NA 2R6ZA 4B3CA 4AD8A 4QGAA 3D7LA 4P3NA 2FV8A 1OBVA 4JP2A 1EX9A 4PZLA 3SI8A 2K89A 3VHXA 4JENA 3ZNNA 2UUOA 1H94A 1JHXA 3BFXA 1Z4IA 1KMHB 4YUYA 5CH3A 4PL1A 2A57A 5L1MA 2HMYB 3JQPA 3A10A 3HH8A 3KB1A 3ESZA 2BT4A 4KXMA 1N4AA 4RV4A 1FFBA 2XKKA 2PA0A 3UJCA 3E0FA 2CHEA 2M2IA 2IU4A 3PD7A 4NDNE 5CURA 2O3SA 4GEGA 3EG9B 2R8GA 4BZPA 3HFGA 1WXFA 3KALA 3VYRB 4ESVA 3VSAA 3HGMA 3B1WA 2B0JA 5J2UF 1X8LA 1C41A 3UJ6A 2JFUA 2F2TA 2P2NA 4Q9NA 1J6UA 3UWPA 2H5XA 3KYDB 2GFHA 2VPXA 3IELA 1NP7A 2D3DA 1GZDA 3TLYA 5KYXB 3RU7A 3AI3A 1F38A 3KPWA 4M9ZA 3ALRA 4FJ0A 3U4QB 3KHKA 1KQNA 1YFJA 3SF8A 5PNTA 3CJQA 4NIMA 3FFTA 4CG1A 4MQ4A 2IUTA 2HLHA 3KSAC 1Y4DE 2I4RA 2YINC 5LQCA 4G8JA 3RKUA 4O1HA 1JIUA 2GN0A 2XWQA 3CLRD 2V6GA 3THWB 4NFLA 2FEOA 2QRPA 2RIPA 3U61B 5BR8B 1X1TA 2ET6A 3P0JA 4OQPA 4F96A 4M98A 2GN1A 3TQFA 1I2BA 1NJ1A 3MLEA 1Z4JA 4AMBA 4DA4A 8ICKA 3KZNA 2CDBA 4JR1A 2FJ6A 4QM7A 1ZHOA 5DM2A 3RM3A 1N92A 1E66A 2OFWA 2W6CX 4AKHA 4MLDA 5AI5A 2FN9A 2XUGA 4X84A 1NHGA 4A1OA 2AH5A 4US9A 2GPWA 2H4WA 2IU3A 2NXWA 4NLKA 5BSUA 2INGX 4FWTA 4MQFA 3EOBI 1EINA 2GK4A 1V9CA 1C8LA 4EDHA 2YCBA 3BIOA 4D0SA 5FIUA 1E0SA 4RNDB 5FJIA 4XWWA 2ZUBA 4U7DA 1WSAA 3UGTA 3U09A 4KDCA 3WP1B 2FF7A 1RFLA 3ROGA 3RPEA 4XCQA 4D0GA 5KSWB 2YVAA 3L8EA 2JI8A 1E18A 3M5CA 6GPBA 3WC4A 4TTSA 3ZDBA 4YA6A 1MKYA 1YOVB 2FHPA 4GXRA 1KFBB 2O8VA 1SG9A 3UHFA 5KFKA 4R71A 1ZJMA 1UINA 1SQGA 2DH5A 2Y6UA 1Z5WA 1YNSA 1BWRA 1QH1A 1L4FA 2BJVA 1T9GS 2D0IA 2EGUA 1LX6A 1JDBB 4FYKA 5JZOA 4B3TB 1QUFA 2OBNA 3O2NA 4P36A 2C2HA 5JAZA 5KT3A 4I4TB 1KIFA 3T3MB 3I01A 4DOCA 4Q43A 2P2ZA 4DSFA 2J08A 3FRIA 1Q16A 1ZWLA 2EKBA 4RSGA 3G2HA 5IBQA 1BW9A 5LQJA 4QWDA 2I6SA 1R4ZA 3SEFA 1UJCA 3IL2A 2A92A 3PW4A 2B4TO 2Q6OA 4COKA 4EZIA 2WUDA 4YH1A 2C9OA 3UXNA 4IKPA 3QUQA 3K2IA 4D98A 4C7OB 3ZZUA 4HNRA 2GAAA 1SC4A 4K2HA 1DARA 4AROA 1DRKA 1JBQA 1FCJA 1BVSA 1TJPB 4NG4A 5T4EA 2QQGA 1LSSA 3VPFA 1T4BA 3DOUA 2Z9DA 2QL5A 3V3KA 1VPVA 3ZLBA 3KJXA 3AR8A 4O0MA 2BGMA 3TJMA 2FWNA 2ZTVA 4DMUB 3D3EA 2P75A 2DX7A 2YWHA 3GUUA 3GT4A 4CIVA 3JAKB 2XKAA 5M7EA 4PTLA 4BN4A 3O82A 4CKWA 1EUCA 3HLTA 3UHPA 4B35A 2W0SA 1NYLA 1GG8A 4PSVA 1X7HA 3OICA 2V9CA 2AW5A 3I9JA 3WICA 5MF6A 4M6WB 4IIJF 3BX1A 4ZI7A 4MKHA 2GVZC 4BP3A 3SIPA 4ZK6A 2J5KA 3RJGA 3IPYA 3FXAA 3OE7D 3EARA 4KUHA 1XCPA 2HYDA 4K4IA 2I6FA 1E61A 1ZBQA 5KFWA 1RCUA 1SXHA 4CM7A 4ZVPA 4XFDA 4CTJA 3JD4A 4ZZ2A 4OA8A 1BXRB 3B53X 2J0VA 1B41A 5JH7A 1E2QA 4CI0B 1PEYA 4BEBA 4AJNA 5E4TA 3AZOA 2OE2A 3DDZX 4R54A 2GTIA 1NF8A 2Y9UA 3VNQA 1JJIA 3MDAA 3TXYA 4XI9A 2EX0A 2XLCA 3ROXA 2QLTA 3RK4A 3M83A 2QR2A 3STWA 4H1UA 2O0MA 3TLCA 2HF9A 5HZGA 3QFRA 1MJ5A 1V6CA 1C7YA 4LJKA 1Z2AA 3P0IA 3N58A 3G9XA 3E53A 3OSNA 5FWNA 1E3DA 4ECVA 1U6IA 1VMKA 3QE4A 5C5DA 2EDUA 4LA4A 2P5YA 3TTWA 4DLLA 1DWQA 4A8EA 2C3UA 1E7YA 4Q6BA 4BATA 1ZL0A 4DZZA 2MIIA 3LCVB 2AXPA 1GU0A 4RH1A 1DUIA 2YYSA 4WJLA 1QS0A 9ICPA 3TNDA 5FLYA 1ZK4A 1P9WA 2GD2A 2PRKA 2X86A 2EG5A 4GH5A 3H0EA 4O5AA 5KTMA 3QKTA 3RABA 2I22A 3WA6A 3KL2A 1UMBA 3B82A 4PFJA 2A2ZA 4G5XA 1QGED 2ZE5A 3BHNA 4YBZA 4N8SA 3IDZA 1KDVA 4FW9A 2HMUA 2QTHA 5KWIA 1GZ7A 4Z7JA 3BH7A 1E3WB 3ACDA 3L3BA 5EUCA 2XZPA 1U4BA 1ZVVA 1X9SA 3ZWWA 5DNCA 3NTLA 1H38A 2C94A 5DI9A 4YP5A 3M6MD 3DCJA 2ZZMA 3P5BA 4DL9A 2XSZA 1WZUA 5A4AA 3EFOB 3NHFA 3O26A 5FRDA 3CY6A 3K31A 2MUTB 2QTLA 3B3JA 1GTSA 3ZOKA 2ID7A 4YRKA 4FFWA 3W5AA 2DY1A 1VIDA 2B2XA 4W8GA 2VYFA 3S55A 3ER6A 4WBSA 4D80A 4P0PA 2A94A 2B82A 1XPJA 3DF7A 3HGTA 4JHXA 3IAUA 4J1SA 3M5DA 1KSFX 1EWKA 4BWGA 1ZSYA 4TV8F 3D6AA 2DC1A 3ELDA 3H4DA 2JIQA 4DPKA 4DL2A 1ULSA 4KLCA 2ECPA 2JAHA 3H1FA 5F73A 5BQ5A 4D9BA 1BDHA 3A4NA 2BE9A 1FYFA 4NYJR 4WAUA 1NAHA 4XWAA 1I30A 4HN9A 1XNHA 4M7OA 4MVJE 3C1OA 1X2EA 5I7FA 3VR5D 1CD5A 2E18A 4OXXA 5JCOC 5FOUA 2VJQA 1ESEA 2NTJA 1P4JA 3K94A 4DJAA 1AHNA 3IIMA 4KQXA 3ILSA 3LKDA 1EA7A 2HSWA 4AF7A 4OGLA 4DQXA 4J0HA 2XXJA 4FR5A 5B3JA 3FR8A 2FZGA 1YRWA 3VR5A 3GGSA 4UUNA 2KBFA 2ZI6A 3BMQB 1BHSA 4BVBA 4TLEA 1X80B 3ELYA 5TR9A 2R66A 4TYNA 2Q4OA 3RR2A 5LQKA 3ZX5A 1KSPA 3ORRA 3R5JA 2J45A 1FX0A 4ZDWA 3VVMA 2A9QA 3URMA 3FYSA 2O3JA 3QJ5A 1K5HA 1KOFA 2HM7A 4ZD6A 3GPBA 3KXIA 5J5AA 3OZCA 1URJA 2GMWA 4C0KA 4BU1A 4AULA 4KR0A 1EUQA 3OQOA 2PMCA 5ILQA 1N33B 2J3DA 4UAWA 2VSQA 1S4MA 1KORA 1UHUA 5CK4A 3SU8A 2FZLA 3TRIA 4K6GA 5E0KB 1FDOA 2XMRA 1EX7A 1FXSA 3QX8A 1Y3AA 4FSDA 3IB3A 2GO1A 1Z88A 1Q3VA 3VR2D 3LP8A 1Y6QA 1BH6A 1QPGA 2WWWA 2C2RA 4UZSA 5A0VA 1VCMA 3RFUA 2JIMA 1KJ8A 3SS8A 3VPBA 3ZQ6A 4KAJA 1FP4A 3NW9A 4PS0A 1QE5A 1J0XO 3BILA 3K0CA 3FBTA 3Q3GE 4O5KA 5AJVB 2QZ4A 4OHPA 4R7ZA 3AQEA 3BHMA 1ZH2A 2Q1TA 5KG5A 1C0IA 3VR2A 4IIHA 2I2CA 1KJQA 3LRTA 5FO1A 4BQRA 4NNOA 4QUKA 4N47A 4KDFA 2H31A 1ZCBA 4WA8A 4Y30A 2JCBA 4EP1A 2C99A 3MOIA 5IHXA 7ICFA 4FSHA 1M83A 2VCEA 1Z3EB 1TW3A 2E7ZA 3TQTA 1YZGA 3F2VA 4NJMB 1U8XX 3MHTA 5EWFA 1ZEMA 2FPXA 3KX2A 1NOMA 1OAKA 3KKZA 4O4HF 1IK6A 3OKPA 1ULHA 3UMRA 4CKZA 3LHDA 2VBIA 1FDTA 4TOIA 1CNMA 1BGWA 2KVSA 1QZTA 3LF2A 1QHHA 5JXGA 5A02A 2E1FA 1EWYA 1EE1A 4FMBB 5JT1A 4KXVA 2IQ5A 3DEFA 1XVIA 1ID8A 1WM1A 1BMQA 5EUBA 1IBLB 4OX9Y 4PLVA 9ICMA 1K92A 2DKOA 3P2OA 2XGOA 1W5TA 2YMMA 3PHHA 2BR0A 4KPEC 1K7YA 5J29A 2NZJA 4KLHA 1G291 2W9MA 2QYOA 4MKIA 6YASA 2DCUA 3H5RA 2GESA 1ZQPA 4NKRA 2OSBA 1PI3A 4MHSA 1DDGA 1B0AA 1BC5A 4WNIA 3H2SA 2NV3A 4MKZA 2BBTA 4C0QC 5B1SA 1E6CA 3OZXA 4FDMA 2AZTA 3LCJA 2JLUA 2RKWA 4D8YA 8LDHA 2JAXA 3SC6A 3T7DA 2F90A 1KQPA 1RC0A 3MOSA 3JD0A 4HPWA 5CM8B 2X2PA 1T3GA 1KY4A 3PNMA 3H2ZA 3CEPB 1XKTA 1LPBB 1GGKA 2ADFA 2FP3A 2VP2A 4KQKA 1PV1A 2I0FA 1K98A 1ADYA 3CGWA 4G89A 1MEEA 5KDOA 1OX6A 4NS4A 4ER3A 9ICGA 4R2LA 4KQ6A 3AHHA 1TJNA 1H8HD 1EAYA 2ZUVA 1RXEA 7ICUA 4WKCA 2GRUA 4YB8A 3MB5A 2BLNA 1X19A 1GKUB 1TC1A 4GYKA 3RFVA 3GGPA 1EGVB 2JGLA 2E6UX 3A9VA 4B6GA 1TK2A 1ND5A 3OIGA 1LPSA 5AT1A 1E9AA 2VRCD 4OYLA 1X9XA 2C61A 1LX7A 1QORA 4E7OA 5J0YA 2GOYA 2IZ5A 4Z9FA 3S2GA 5IAEA 1AMOA 5AICA 2I2BA 3ISJA 2DY0A 2D5BA 3MSXA 2PMBA 3MWFA 3HJRA 1SZHA 4ZCMA 2FFBA 3ZQ4A 4DIEA 1R0XA 3JSXA 4M86A 4Q7EA 4RJLA 1T6ZA 3CUSA 4JP3A 3LSTA 2I29A 5TSDA 1U1FA 1D07A 8ICPA 4TLCA 3IP1A 4G5HA 3OQBA 1OLSB 4MRMA 5TMEA 2PZFA 1HIWA 3TEJA 3D5EA 1GCUA 2EZYA 4O2AA 4HDCA 2IFTA 3GN2A 1IXSB 3Q8KA 3L8FA 3O74A 1XTTA 3E3LA 1UPCA 5LIRA 2GOLA 4E2WA 4ZARA 4F8RA 2QTNA 1N5MA 5KWEA 2YJ3A 4FGUA 4P6VF 4WKGA 1S3GA 3NBQA 4H35A 1QMGA 4FI3F 3ZH9B 3R3VA 1HPLA 3O4FA 1LPMA 4EVSA 2QRNA 1A69A 2VIIA 4I9FA 721PA 2YXBA 3RTGA 4F46A 3IT1A 2OBBA 3EQ6A 2JFWA 4BNJA 4O59O 2AEEA 4JI6B 4FFPA 1NDHA 2P30A 4X8LA 3MT0A 1V26A 5HDQA 2RGDA 2FPWA 5FO0A 1ZBDA 2FQYA 2ZYWX 4JB0A 1L0BA 1YJ5A 3H99A 2ZJ5A 2BSQA 4MJLA 1IZYA 2PWZA 5A6SA 3LTNC 4YCXA 5A03A 1Z6PA 2B61A 1WZCA 1PIWA 4CKEB 3MJEA 4RVDA 2GSDA 2CMDA 4RA9B 1VCIA 3AB7A 3KTAA 1N1GA 3DEZA 3WWYA 3RC3A 1ONPA 3FRHA 3U7JA 3UG6A 1SKBA 2E8OA 3UYLA 5KFYA 5TJHA 3ZNOA 2QQEA 1BFDA 1JJ7A 3U3OA 1GFIA 2PLFA 1E4OA 2X0DA 2HLNA 3A04A 4MW9A 4MA0A 1P4AA 1SJ9A 2JAUA 3BS4A 3STTA 1BKYA 4PRLA 1NVKA 3ZOZA 1JXAA 4XWYA 2O54A 2B94A 4C0XA 3DVRX 3UOAB 2HMWA 3MJTA 4LHVA 3RLFA 2ZIUA 4FOPA 4D44A 2SHKA 3INNA 1TO1E 5JAOA 4YQYA 2W90A 4EGFA 3OCJA 1TLFA 5D5HA 1DTSA 2HOIA 3CA8A 4MKGA 2O5RA 3OSPA 4QO7A 2CZGA 2V3VA 5IWAB 3BG5A 1WQ1R 2PR7A 1PG2A 1RE0A 1PUXA 2QRJA 4CEHA 4LGVA 1USGA 2ZKLA 4YGYA 2YWXA 1RJFA 3DP7A 2QKYA 4JJFA 2IUFA 5K8CA 2PVCA 3F97A 3K9NA 1NPYA 1Z6XA 4DBZA 2VFAA 3JQ7B 4S24A 1NA5A 2C5EA 3C1AA 1KAMA 2OILA 5JRJA 1X42A 2H5JA 3EPPA 2P91A 1D1SA 1SU6A 4RX1A 4MQLA 4IKEA 4ZCPA 1O6CA 3GIKA 1B3RA 1W2GA 5AK4A 2VTKA 3KJNA 3EJ6A 1U45A 4AJLA 3RU2A 1FJHA 3MD0A 3AR7A 3HO6A 5KNLA 1IFXA 3A7EA 2DEUA 4LDZA 4P8RA 5L7TA 4KWTA 2XD9A 7ICRA 4Y2QA 4G0ZA 1P5FA 3PGA1 4QATA 1XD2B 5A4MS 3HJBA 3RBEA 1QVAA 4RY0A 3PXAA 5TGZA 4ZT4A 1FPQA 1Z08A 7ICMA 1XGKA 3GVPA 1M1NB 1ZQEA 4HFJA 4UFOA 3WWZA 1OBCA 4ZZ0A 2HUPA 3ORFA 1EFKA 5EJEA 1SK8A 2QROA 1X1DA 2FSPA 5DQGA 1AZWA 3QQPA 2VRNA 4MV4A 2C5LA 5F35A 4BLUA 1UDXA 4A16A 2QV0A 1MW8X 1KYIA 5B3KA 1QRUA 5EWGA 4WBNA 4ZAZA 5L6LB 1L3UA 5JVDB 1QVWA 5LYYA 2R8KA 1GZHB 4JX9A 1F3OA 5LZ2A 1V96A 3QJYA 1F14A 1CVIA 2JV3A 2XYHA 4RV5A 5DQIA 4QBTA 1UBUS 3H4TA 1C29B 5FULA 4WDRA 1N5RA 4WXPA 2VEOA 3IA7A 4FFLA 1A0OA 2W6QA 2O8CA 1YBVA 1YZ7A 3MCVA 2HBYA 4I1VA 4F45A 4KH0A 1LBEA 1AK2A 1CR1A 1U3DA 1Y7PA 2W4MA 1KDRA 3ZCSA 2UAGA 2HBJA 4WGFA 4LXTA 1GDHA 3G79A 4TV8B 4MFCA 4J3NA 2R8JA 3W04A 2NTNA 2K6GA 4HL6A 1CUSA 4EFDA 1T3HA 1P7VA 5E1MA 4QDTA 2XCAA 3WLNA 4XLLA 4LZWA 5TC4A 2IHMA 5AK5A 1V2GA 3THOA 1FNBA 3UGQA 2PH7A 5TS2A 4RANA 4M7PA 1QO0A 2DHCA 1F2UA 1BVHA 1FYDA 1T35A 5EE9A 2BFOA 1HQCA 3Q4GA 4TUSA 2EQAA 2GBGA 5LB2A 3BXOA 3EQ9A 5IJ9A 2ECOA 5M29A 2RHHA 3NV9A 4RPGA 1Z56C 1H69A 5DYNA 3GEHA 4RQ2A 3G68A 2WSBA 3MTAA 2VDPB 1ZMXA 2O6HA 3CZ4A 2ZIVB 4FZMA 4QRIA 4DMKA 3AU2A 3FHOA 3EGOA 4ZYTA 2O5CA 4JBWA 1X8KA 1GZUA 4TZTA 3PFNA 5KG2A 9ICBA 1RWNA 3FVWA 1R8JA 1IY8A 1Z5VA 5H83A 5AKXA 4ZVVA 1XU7A 3TLAA 1I32A 3VH4A 4F1KA 2FOLA 4FILA 1M2JA 16PKA 3DCNA 1P2VA 4RLSA 5A2GA 1FYXA 2BTQA 1DO2A 2W04A 5LKAA 3FC4A 1V25A 3EZLA 4FHCA 5A4JA 3LTEA 1Y3DE 4PGXA 1R15A 2X7JA 1HL3A 4B3JA 5JIBA 4LCBA 5CT8A 1PJRA 3G0HA 3NATA 3VTKA 3RSHA 2BF7A 2QT0A 3PL5A 5COQA 2GZ1A 3UCFA 4DSOA 1NFFA 3ROEA 1TKRA 3TRHA 1AM4D 3PGLA 4BBZA 4DZTA 4U0JA 4FQ5A 4IFTA 4ESOA 4RQMA 3HNOA 5J0UA 4ACBA 1AE1A 2K7FA 1ZQDA 1NKVA 5BN3A 1XMPA 3NEPX 1ACLA 4O2BA 1KRXA 3I83A 4BWJA 5GJCA 2QTRA 1SAYA 2C59A 3OOJA 4KI0A 2I2DA 3D4BA 4HWOA 1DRGA 3PO5A 2MTBA 5E4JA 2CXHA 2JHPA 5BWBA 5KFAA 3N6XA 3WMFA 4KV9A 1ZR2A 2RDIA 4RQ0A 5KX5F 3MINB 3GGDA 3V72A 3NNSA 3KHTA 1E79D 1DDOA 5LYJA 4DIDA 1H66A 3W7BA 1W5AA 3K9CA 2PIAA 1E1KA 4N8DA 1QXSA 4NMXB 1UDWA 2X0EA 1MOPA 3UT5A 1JMKC 3RVPA 1JDSA 2VXOA 5CA0F 3PHLA 4YR9A 3PDUA 2IZ1A 3FOWA 3WGHA 2JZBB 3ZDAA 1DC5A 3WK8A 1OY1A 1ZQYA 4QNRA 3M6FA 5HIAA 2GPTA 2I3DA 4LWOA 1Z2DA 4ND4A 3H8JA 1DRUA 2ZBUA 5C1BA 2N1RA 1ZH8A 2ZRMA 2KICA 1ZK2A 3DFKA 2XHEA 2IH5A 2XGPA 3VNVA 3FNBA 2K4IA 4ML3A 1V8DA 5D3MB 3HZZA 4ZJUA 3BK2A 4PLCA 3BQ7A 2PK3A 3C74A 3S7ZA 2I9PA 3PPXA 4FI3C 4B7ZA 4BKQA 2A58A 4MRSA 1E6UA 3V46A 4ECWA 5A5GA 5JMOA 2XT0A 3IDSA 4HZIA 2F3SA 1LKYA 2PX5A 1TDJA 2ZWIA 1GPDG 4AICA 3TIXB 1OPRA 1SZJG 1KU0A 5CNJA 4YUXA 2FLVA 3PQFA 3EIHA 4YDRA 3D2QA 3GLFA 1GZ6A 5K51A 2XUQA 1WP4A 1GNPA 5JAHA 2Z3WA 3H9CA 1W1UA 1ZM7A 4RXTA 3QV2A 1EWVA 2YC4C 2HUNA 1GN9A 4G5SA 1UOOA 2GCIA 3V1MA 1EXWA 4Y1FA 1V5GA 3CLTC 3UF0A 1N5OX 3WXMA 1QG0A 1D2CA 3JVUA 2VBCA 5DMHA 4IXDA 3ZI7A 5KYWB 4LVOA 3H0KA 1WW3A 5IEBA 3T99A 4M0UA 2CYAA 3RQIA 2IU6A 1RHQA 2HDHA 1K0UA 1QNFA 4R9SA 1HOXA 2HY7A 4LBVA 3FI9A 1MABA 1N3LA 3AFIA 1Z47A 2VBFA 2VVTA 4GWLA 1S10A 4YXJA 4DYVA 1NJ5A 2C9BA 4DV5B 4WXMA 3BSSA 1UMDA 2EFCB 4P3OA 3DS8A 1H6BA 1BKDR 1U5CA 2GJ8A 3ZLVA 1KEUA 4BMXA 3F71A 4ACAA 3KQLA 4ECAA 4G2NA 4B48A 2KG5A 2Q3DA 3OQNA 4EEYA 1VA4A 4B9SA 2HTFA 3L6BA 2G36A 2VDJA 4XYMA 4YJ2B 1ZQOA 1I1NA 4BCBA 3NVDA 4DNQA 5B4TA 2H54A 2NRWA 1W36C 1B6TA 2MSKA 5HTKA 5BWCA 1FSPA 4LQLA 2BMEA 1N2JA 1OXTA 2VJ5A 4F5WA 3HMQA 3UAVA 3PVSA 5BMOA 1RQPA 1S89A 1THGA 4U02A 3PJDA 1W5SA 4CKYA 5IAGA 4JMLA 3W0LB 4MWEA 1T2VA 4ZVQA 4PG5A 2G9VA 4EHIA 5CJ2A 4X95A 4E2ZA 1HNZB 4EO9A 2FK7A 2AQ4A 1PQYA 2XI9A 3AI2A 4PWZA 3UQYS 5TQJA 2QTWB 2IC5A 3OWXA 3U4DA 2IYSA 1GGFA 2F3TA 4DDTA 5CA1F 2VSNA 3FAKA 3U5ZB 1CB0A 2P3LA 2HHTA 2R5WA 2XKJE 3HM2A 3O1HB 2DFKB 4KR2A 1BPDA 1W4ZA 4HJXA 4WZAA 4WFQA 4W5RA 4J7XA 3AHGA 5JQGA 3PUWA 2WD8A 1IXKA 2WIKA 3F6CA 3JQBA 5J2KA 3ZG6A 3T5JA 3PSPA 4GSKA 2JFFA 3JZMA 1L5YA 4IGIA 1LQTA 3HO1A 1DQZA 4KV7A 1ZA2A 4OHWA 4BDSA 3ROMA 4PIPA 4N48A 3A3YA 4GGOA 4G86A 4LVCA 1Z0AA 3MTEA 2HJSA 1V1RB 2PL5A 1LLUA 2FRXA 1VB3A 3TQCA 2L42A 3L1HA 1SL0A 5SY6A 4FYMA 3S2UA 3CUYA 4UEWA 4PNZA 5EJ2A 2WHPA 3GCXA 2AGPA 5C5CA 5I7EA 2XIDA 4ID9A 2B5WA 2CXSA 1CC1S 3IUBA 3V8QA 3OZSA 4J4BA 1Z2EA 4QOIA 1HT3A 1QFJA 3KQSA 4Q9DA 3CZPA 1ZQ1C 2W8LA 2RK6A 2WT4A 4ZT7A 4ED2A 4L07A 1O96A 4FDLA 1YXMA 1U04A 4OBXA 2CXPA 1ORIA 5CEFA 3AI7A 1XQXA 3DYBA 3ZTYA 2VYVA 2IGTA 4ECSA 1VP3A 1SCKA 5ALYA 1JPJA 2M1ZA 4H1VA 3HHEA 2AMVA 4UTVA 13PKA 3RKRA 1P7ZA 4HWTA 4RABA 3S2ZA 4IJKA 4D42A 1ODLA 2A9JA 3EDRA 4Q1FA 5CJ7A 4R1TA 3BF7A 4YCBA 2JZCA 3URKA 5ICEA 4YGXB 5AVYA 3RS0A 4HWGA 4M9QA 1QIGA 5TVGA 1Y1QA 3OFVA 5AMXA 1C4WA 4J75A 2A5LA 1B42A 1GCOA 1JHMA 4YT4A 5SYMA 1W0JD 2B4QA 5BN5A 4NENB 5HXAA 1O5TA 4Q12A 3EGDA 3U3MA 1NVBA 4F3RA 3L5OA 1NRJB 2G08A 3F90A 2ZSHA 1H85A 2QMYA 4XAQA 4A0SA 3F5SA 5I8ZA 2XRYA 4FMCF 1AJEA 5G2OA 3WQBA 1I7QB 1EK0A 2BD0A 1QCDA 3SJAA 3G7UA 2WIBA 2WWGA 1EI9A 3ZY4A 1MOZA 3NHUA 3KUXA 4BV3A 2AI2A 4DS4A 5TZVA 1N0VC 2UUCB 2O20A 1QYRA 4O8ZA 1IRIA 4JJAA 2Q4BA 4LXYA 1Y8QB 2CD9A 5CLFA 2GJAA 2BZSA 3WL6A 1WVGA 4LGCA 1KVTA 1CUUA 2HA6A 2H4FA 4E32A 1ZQVA 3IUNA 1HE8B 5DN9A 1I2ZA 5KFDA 1KRWA 1N2XA 2H3HA 1LEHA 3V3TA 1NXWA 3TAUA 1PBNA 4BNXA 2MA1A 2E8NA 4NWIA 4F6RB 4K2AA 5BQOA 1ZJWA 4L3WA 1GL3A 1GZVA 3BGIA 3S99A 4ME6A 3ABSB 1BG6A 3JSAA 4DL5A 1N0UA 5FWAA 5CVJA 5K0SA 3FWZA 4AJEA 2O8EA 4I6JA 1HLGA 1PK1B 5LP1A 1Y3BE 2JI9A 1Y7IA 4CRWB 2TRSB 4EHLA 4K1XA 4LF6B 5HDBB 1EM8B 1SXJA 3OTQA 2EARA 4JASB 5MN4A 1L1EA 3QVUA 1C20A 4OMFG 4JYZA 4AG5A 5JS6A 1YVPA 1Z82A 1GARA 4OHVA 5CBPB 1QYIA 3SI7A 3BTVA 1PT6A 3KIPA 8ICEA 5DE3A 3OQJA 1OJ7A 4JD5A 4Q05A 3LUJA 2PY6A 2QMHA 4GMHA 5DLFA 2Y99A 4EI8A 4RS3A 1QQAA 4KE6A 3WFIA 3DNMA 1NU8A 3IT0A 5HE8A 3MIIA 4KR6A 2KZMA 3TQIA 2FAXA 3EVAA 4E5YA 5HS6A 3OQ1A 4N3GA 4N5MA 1PVDA 2ZXEA 1CQPA 5I9SA 4QZGA 2RONA 1UMCA 5J5VA 4QOSA 1WG8A 2XAAA 3KQWA 1XYVA 4FKMA 3HX0A 3TTUA 4ZQGA 1Z3IX 3H5IA 3QPBA 4CDRA 3RRMA 1JHVA 5E38A 3PYMA 4UQPA 2C5SA 3D6UA 3LA8A 4UBLA 4LC0A 4ENWA 2PLAA 3E15A 4KN4A 2IEZA 2VSXA 3PVZA 4LX0A 4OJPA 1SZDA 4N4AA 2X58A 4M83A 1AD2A 3WX0A 3KT6A 4NU8X 5IP5A 2F00A 3GFTA 5KVQA 5BYBA 3PQ3A 3OESA 2R79A 3H1EA 3QELB 4MCAA 1KMHA 4RD1A 2DZDA 4HN4B 2V4QA 3LBHA 2AD1A 1C3OB 2IEIA 3NEJA 3LYSA 1NNSA 4DE5A 1CIJA 1V37A 2WHYA 3L7OA 2IS6A 4CCHA 3T3GA 1GEEA 1YZHA 8ICZA 2ZBRA 1OLOA 1R8SA 3IS3A 3CW2C 4UCQA 3HILA 4C8KA 3S70A 4DOMA 1LV5A 3IR7A 2XE7A 2OEPA 2NZYA 3EG9A 1NW9B 4F4DA 3DP9A 1DLIA 3C5HA 4FBLA 4F6CA 1T9DA 1RYDA 1OBFO 2WU1A 3SJ7A 4DXHA 2GUWA 1W93A 2H57A 1E3LA 3SIRA 3KYDA 3I72A 2YNMC 1U9CA 2XQJA 5DU2A 2H6EA 4EJ6A 1TCUA 4PANA 4XUSA 3KTFA 2WHEA 4BQIA 4G0WA 4Q7LA 3U4QA 4NATA 4TZ6A 2WWRA 1IOWA 4DCCA 1VJ5A 4ND2A 4ZAVA 1GLGA 3JYQA 4EYOA 1ZCAA 1KK3A 3E9EA 4PO3X 1VPDA 1KOLA 2YFHA 4AY2A 2XNKA 1TK8A 3THWA 2PZAA 5FP0A 3H8WA 3CZCA 1O08A 1SVUA 1WBDA 1W2HA 2H5LA 2PQ2A 1MJGA 1O95D 4RS4A 2JFGA 1RM5A 5ENVA 3RKSA 4TS1A 1JR3E 4Q9JA 3HXLA 4G0VA 3W77A 3ELWA 4AAYA 2A6PA 4Z9AA 1J07A 3EEBA 1PSWA 4GLLA 3CF2A 1J1UA 3C8DA 1YZQA 3C48A 4D9NA 5AW6A 4DL4A 1L5SA 2QNRA 4PPFA 2C4HA 3PC4A 5EIBD 4C4TA 1U7WA 4GKKB 5C7LO 3L7LA 2VQFB 5DXAA 3SS7X 4E14A 1YR7A 3FJ1A 3GUCA 4MGKR 5SZIA 5CA0B 3T9AA 4W7IA 1WNFA 4FYPA 1DC6A 5IZCC 4P98A 1FQKA 221PA 4MDHA 2OKGA 3R5HA 4X90A 5C51B 2WILA 1YOVA 3UBTA 4ACOA 2VWHA 2PZLA 3R5SA 5BY2A 3M4YA 4M99A 5DBGA 4JL6A 4BO5A 1P1RA 2BGRA 2DOKA 3BOSA 4Q47A 3FOAA 3TOZA 2VKTA 2FUEA 4RQTA 8ABPA 1DIBA 3SHQA 4NYIR 3ANYB 3BZBA 5F77A 1D2HA 2I54A 4MHVA 4JOCA 4WSOA 3GA7A 4PGYA 1AGNA 1HDOA 3DLAA 5FI3A 1AGRA 4H3HB 2CJPA 4PCVA 3BORA 3TNLA 3DZBA 5IDVA 2ZPTX 4AJHA 2Z09A 2XX3A 3EUEA 4PLYA 1RWOA 1L5KA 2ZUEA 3U9LA 3MMNA 3F73A 1N2BA 3QE0A 3A4MA 1Z16A 4Z86A 2P2YA 1OZ0A 1DKOA 3C7CB 3FPCA 3VAYA 4XYEA 1GN8A 3TLMA 4LYJA 1ESDA 4C7OA 5B1HA 4LW8A 1J7JA 2BCQA 4DCTA 1EXNA 2YFKA 4RTRA 4KMSA 2VATA 2VANA 5JTUA 3AYXB 3AVQA 3C3MA 4TRJA 4IZIA 1EP9A 2OYRA 1Y89A 1C8VB 3OEWA 3TW6A 2OCLA 6ADHA 3E8MA 3TGLA 4MVYA 4JI7B 2QBYB 3JAKA 2R8HA 3QWBA 3CVJA 2JGIA 1KMIY 2GA9A 3HCDA 4LPKA 3ZHYA 4W9RA 4JUAA 4ENRA 2JFVA 1GTRA 1H1DA 7ICHA 5KFMA 1SUPA 4DRXB 4LPSA 1ICIA 4OJ5A 4ED0A 1DADA 1A8IA 3AT1A 1S96A 1EE2A 3F3MA 2FRDA 2XWJI 2W2XA 5BYAA 4M6WA 4X1OA 1YFLA 1M5RA 1V97A 1NQXA 3AVUA 3SNHA 2UUBB 5ARCA 5KQPA 2JB9A 2EFDB 3GRZA 2D5IA 5DHRA 1CZLA 1Y33E 1IQ0A 8AT1A 3KQYA 2LE0A 1XYGA 4EYIB 2CF5A 2EBWA 3CRVA 1BXRA 5ELMA 2JANA 1ZNXA 2OKCA 1YZLA 2FPGB 2GD0A 3PVCA 5KEIA 3LWDA 2H4JA 1PCXA 4JWKA 2CDAA 2PV7A 4ZRMA 3V7WA 1RJ9B 4WASA 3A26A 5IKEA 2O52A 3MYYA 4OBEA 2SKDA 2V1UA 1VHWA 5JU5A 5K0JA 4YR3A 5BN4B 2P7HA 3S68A 3DEHA 2ZIZA 3A2MA 3IALA 4DF3A 2AC7A 4D5GA 1YE8A 3O83A 2GWHA 5CDSA 3QEJA 4B75A 1CDDA 1K5OA 2O23A 2I7DA 1T8WA 2YUTA 1MZPA 3N8DA 2MYTA 3FGOA 3OE7A 4J0QA 2CGEA 4IEFB 1SKYB 4XTRA 1QGUB 2XWSA 4E30A 4PJ0U 1KEJA 1U2EA 5LQMA 3F8WA 1XJ0A 2QZPA 4TX1A 2HW3A 1AKWA 2XGJA 2PRZA 1G19A 3N97B 4C3UA 4Q3CA 2PZ8A 1A8QA 4B3BA 1NR5A 1VKHA 1E62A 1JIKA 1FFVA 1IZ9A 3AVPA 4DQPA