2YY6A

Crystal structure of the phosphoglycolate phosphatase from aquifex aeolicus vf5
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
MRVILFDLDGTLIDSAKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVYTKPYPEIPYTLEALKSKGFKLAVVSNKLEELSKKILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDFTLSRPSDLVKLMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the phosphoglycolate phosphatase from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
molecule keywords phosphoglycolate phosphatase
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2yy6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yy6A01
3KOOA 2OBBA 2G08A 1O08A 3OCUA 2QYHA 1RLMA 4XPZA 2C88A 1YV9A 4HGRA 2I6XA 3L1VA 5AKKA 2C4NA 1RQNA 5AIBA 3WKAA 1ZD4A 1XVIA 4UMEA 4YCNA 1RRCA 2D2VA 3L0YA 3ET5A 2Q4RA 5AVZA 1U2TA 2JGAA 3U19A 3WGVA 4ZEXA 3RF6A 1EK2A 2B82A 5AKEA 2EATA 2O2XA 3I28A 4KX3A 2DQSA 3N28A 5ALSA 3WK6A 1TJ3A 3L1UA 4UMFA 2NO5A 2FDRA 2HEGA 2QLTA 3I6BA 4BYGA 4G9BA 4RESA 2FI1A 4XQ0A 1F5SA 2GO7A 1Z4LA 1Z4QA 2C8LA 3W5AA 1Z4IA 2HCFA 5AVYA 3TLMA 1YMQA 5AW9A 2FEAA 3FPSA 3ZVLA 3F9RA 1Z5GA 2NO4A 1ZD3A 5ALUA 3QYPA 5ALXA 2ZBGA 3ED5A 3U7GA 2ZBEA 3P96A 2R8EA 5A3RA 3QXGA 2RARA 3NANA 2WM8A 1O03A 4Y2JA 2IOFK 2IA5A 1ZS9A 2FUCA 2R8ZA 4MWOA 3E58A 4IG4A 3B9BA 1TJ5A 3QUTA 2B8JA 3ZVNA 1EK1A 1RC8A 3DV9A 2AUTA 2BDUA 5AI0A 1U2SA 3QX7A 2YJ6A 5ALYA 4UMDA 2AMYA 3KDPA 1QQ7A 3QU7A 3KBBA 4NAVA 2GHQA 3N1UA 3MMZA 1WVIA 3ZTYA 3NALA 3NASA 5ALDA 4OHFA 2GHTA 1KYTA 5AHXA 1RQLA 4YH1A 1J8DA 3M1YA 5ALOA 5AM3A 1RLTA 3L8FA 5AKIA 3A3YA 4I9FA 4RETA 3W5CA 3AR7A 5FP0A 3FVVA 2AGVA 2R8XA 2W43A 3SHQA 2OM6A 4L57A 1FEZA 5ALGA 2C8KA 4NABA 4Y2RA 3ZTWA 3U7FB 4BEWA 4HGOA 2FPSA 5AVRA 4FFDA 4AP9A 2B1RA 1RMYA 3QUQA 5ALMA 3FPBA 1T9ZA 4HGQA 4Y2TA 4J03A 3I1YA 2P27A 3KZXA 1XP5A 3E81A 3N07A 4MUMA 5AK3A 4UU0A 2WF6A 1WZCA 3J7TA 2G07A 3ZX4A 2HO4A 3R4CA 3QLEA 1LVHA 5AVVA 1RPZA 2ZG6A 4J2TA 4OD0A 4BEVA 4YCLA 1Y8AA 2P11A 2X4DA 5AW3A 2B8EA 5AKYA 1YNSA 2HHLA 3FGOA 2ZXEA 5AI9A 5AM0A 3GYGA 5JJBA 3FM9A 2G06A 3L0CA 1PW5A 3WK5A 3OCWA 1YJ5A 4FE3A 4XE5A 2FPUA 4Y2VA 5AW2A 2VKQA 2JAUA 3BA6A 2OYCA 4CF4A 2RAVA 2MSNA 3DNPA 3OTQA 3ET4A 4G63A 4Y2XA 4HGNA 1RLOA 5AVTA 4DCCA 2HF2A 4UM7A 4Y2PA 4DWOA 1RMTA 3CZ4A 3AR9A 1YDFA 1IWOA 4B6JA 5ALRA 1NNLA 3ZUPA 5ALKA 3I76A 1TA0A 1XPJA 2G09A 3L0BA 3OCZA 3S6JA 2CFRA 1QQ5A 3BWVA 5AW0A 4BX2A 4NWIA 1Z4MA 2FPRA 4UW9A 2Q5EA 4GIBA 4UATA 4HGPA 3HLTA 2HOQA 4KN8A 3AR4A 2FPWA 4ZEWA 4UARA 3U26A 3EF1A 1Z4JA 4KNWA 4NV0A 5E0OA 4H1WA 4QJBA 4KNVA 3M9LA 3UMBA 2I54A 2YJ3A 1ZRMA 2IYEA 1Q92A 1L6RA 1YS9A 5AKZA 2BDEA 2HDOA 1K1EA 2YBDA 3EF0A 3SKXA 3OCYA 1T5TA 2GFHA 3KC2A 2IOFA 3OPXA 5ALEA 1S2OA 3NAMA 4L6CA 5IS2A 1Q91A 2JARA 2JAWA 4CNQA 1VJRA 3AR3A 5AVWA 3L5KA 2B30A 3DAOA 3MN1A 2WFAA 4UU1A 4I9GA 3L8GA 2YJ5A 1J97A 1QH9A 5ALIA 3RFUA 3SLRA 3ZU6A 3ZX5A 2I34A 3CNHA 1AQ6A 3K1ZA 5AVUA 3R09A 4EENA 1SU4A 4Y2UA 5AKGA 3U13A 3ZVMA 3W5DA 2NYVA 4C4SA 3E84A 4HAIA 3ESRA 2IOHA 5AKLA 3ZI4A 4Y2YA 5AK5A 3UMGA 2PR7A 3EPRA 3ESQA 4F71A 2YJ4A 3OCVA 5AVSA 2RB5A 4C4RA 2B1QA 2HSZA 2WF8A 3ZWDA 4E88A 1QYIA 2OA0A 1RKUA 3WK4A 1MH9A 2C9MA 3AR5A 1VFPA 2YN4A 3NUQA 3WK7A 4BBJA 4Y2SA 2ODAA 1ZRNA 4YCMA 2YFYA 4KX5A 5ALHA 3QU5A 5ALJA 3R9KA 4JB3A 4AS3A 3QU9A 3N5KA 4DFDA 2FPXA 2YMMA 2HF7A 4KYTA 2W11A 3FZQA 4EELA 3A1DA 5ALPA 4EX7A 5AIAA 2Q4TA 3QNMA 3SMVA 2G0AA 3DDHA 4YGYA 4BNDA 3B9RA 1ZJJA 3QGMA 5IT4A 3IB6A 2WF5A 1WR8A 5AW5A 1SWWA 1NRWA 5AW4A 3WK8A 2ZOSA 1T5SA 3WKBA 1WPGA 3B8EA 3SD7A 5AESA 2HI0A 3AR8A 1L7MA 2CN1A 5AI5A 4UASA 5IT0A 3SF0A 1VJ5A 2WF7A 3QUBA 4Y3UA 4OFZA 1L7PA 3EWIA 1N9KA 1TE2A 5AKJA 3A1CA 4EEKA 3KD3A 4CF3A 2I7DA 3IRUA 3AR6A 4UAVA 3L7YA 1Z5UA 2G1AA 5AK4A 5ALQA 1Z4OA 4Y2QA 3UM9A 4QQFA 4L6AA 3WK9A 1ZD2P 5AI6A 3QU4A 2CFSA 4XOUA 3PGLA 3NIWA 2YMPA 5A3QA 2P9JA 4BNDB 3SKYA 1U7PA 3N8GA 3VAYA 1U02A 1TJ4A 1L8OA 5AKXA 3AR2A 3PDWA 3MPOA 4GXTA 4CF5A 2MU1A 3D6JA 3WKEA 3WGUA 4PNHA 4ZEVA 2CFTA 2W4MA 4DW8A 4EX6A 2ZBDA 5ALNA 3U7EB 1RKVA 4NFLA 3MC1A 3ONNA 5ALVA 1RMQA 4FYPA 1NF2A 3UMCA 3W5BA 1ZOLA 1L7NA 1CQZA 3E8MA 2JAOA 4BX0A 1S8OA 3IJ5A 5AK6A 2WHEA 1N8NA 5AM4A 5ALLA 4C4TA 1QQ6A 2G80A 3U7HB 2YMQA 3WKCA 3L8EA 5AW1A 5AI4A 5AW7A 5ALFA 1LTQA 2YY6A 3PGVA 3ZWKA 4IFTA 1Z4KA 2EAUA 2B0CA 2PKEA 5AVQA 2PQ0A 5AM2A 4O8CA 2O9JA 5AM1A 1CR6A 1X42A 2RBKA 5AVXA 1ZD5A 4YIKA 2WF9A 4UAUA 3L8HA 5T41A 4EZEA 4UMVA 4HYTA 2R8YA 3OCXA 2I33A 2GMWA 1Z4NA 1L7OA 2BY4A 4OCZA 4CE6A 4UM5A 3ZW7A 4JDPA 2FUEA 1RKQA 5ALTA 5AW8A 1SWVA 2AH5A 2YMLA 3WKDA 5ALWA 3A1EA 1L8LA 2HX1A 1Z88A 1U7OA 2I55A 5AW6A 4BKMA 2ZBFA 4AS2A 4BX3A 2MU2A 2P69A 5ALZA 3NRJA 4F72A 5A3SA 5AM5A 5AI8A 2EARA 5AKHA 3QUCA 3PCTA 1RDFA 5AICA 1Z4PX 4YIHA 3QU2A 3HYCA 1JUDA
chains in the Genus database with same CATH superfamily
1DP4A 2A1TS 3COWA 5IAKA 3TCXB 4JI4B 1Y80A 2BMDA 4MP8A 2EKDA 1GQYA 3HR7A 5EQDA 3UHPA 4YT2A 5DN6D 5JSUA 1STOA 2NXNA 3GZNB 3Q2OA 1P1RA 2DULA 1XPUA 4WZZA 4DGQA 4E5VA 1Z8HA 4RQ7A 3GDGA 3M8RA 1DRVA 1FNBA 2UYOA 5T6BA 3GO4A 2PL3A 4GOND 3VCBA 1MO3A 2W2XA 4WNIA 3WB1A 3EX7C 3OA2A 2CXOA 1YQDA 3DEZA 3MTIA 5BQPA 3CLUC 1O96A 2Y9MB 3RKSA 1KQOA 3HCBA 4JJ7A 3TGPA 2V7GA 1AURA 1XX6A 4LJYA 4DNPA 4XA5A 7GPBA 3FCEA 9LDTA 3RTDA 5DZSA 1R0ZA 2XB9A 3V4LA 5BWCA 1T6BY 2XB6A 2ZKLA 3C3XA 3U19A 1WTCA 1JNYA 3H5AA 4GAEA 3RVQA 1W2HA 2YFHA 3SJCA 1EGMB 2PVSA 5BOVA 5CVTA 2ZU0C 2F1IA 5HM6A 121PA 4YCAA 2Y1OA 2PT9A 1IIPA 1EP1B 3ASUA 3G0IA 4M60A 5J2UB 5FI1B 1NT2A 2HFJA 4GM0A 3OE5A 3WK6A 3MBKA 3E2EA 1EG2A 1ZH2A 4A73A 2PKXA 1E89A 1X2EA 3QLUA 1KFBB 2VYVD 4G9BA 2G4CA 5G0WA 5HRUA 2XF2A 4S1PA 1Z4IA 4MWGA 2JNWA 3N0RA 1UK7A 1HZZC 4O4LF 3URKA 2OXRA 1ZXBA 1EWVA 2C2OA 2CZGA 4OYYA 5I7UA 2PS3A 3HRHA 5LCXA 4FU0A 2UDPA 3TX2A 3VPCA 3BBPA 5GM2A 5IDYA 1H8ED 3NBKA 4KBGA 1Z0UA 3TAUA 4CRWB 3MMNA 1HLFA 3W79A 1AGNA 2JAQA 3T9AA 4WXHA 5IJ9A 3II6X 5IT5A 1P45A 3RT9A 4J9RA 3TTXA 3T5TA 4JXZA 2WICA 3GLHA 3AHDA 3NGMA 5DLPA 3D7KA 1PJAA 4OUKX 4TUQA 1Z28A 4TUYB 4C0ZA 3I9LA 2BLLA 1C50A 2F7SA 3HJNA 4MDYA 4WW0A 4TWAA 4ER5A 4ZOAA 1H38A 2WM8A 2F55A 2QU7A 2QD5A 1W30A 2W4IA 3DKVA 5DT9A 4YP7A 4Y2JA 1AN0A 1G7CA 4KR3A 1U3WA 4KXYA 4DILA 1E9BA 1T0HB 2VTDA 3S2UA 3PUXA 3TIFA 4YUVA 3ZCQA 2DLCX 4N6NA 1P0FA 3EPIA 4JJIA 4LTNA 3B9BA 4YROA 3GPBA 1ACJA 4X66B 2JV3A 3ZVNA 1C3OA 1PJBA 4JC4A 4C0JA 2BAGA 4PO1A 3DFUA 3WBJA 1AV6A 1VMEA 2PN1A 1B8PA 3EJ6A 4PPQA 4DFPA 1T7PA 1INLA 3CEPB 3H11B 2PKYX 3C6YA 4QVIA 3FX2A 3TLZA 4EGSA 1L5RA 1Y1TA 2E89A 2WY2D 5BOSB 1QTQA 2R11A 2NU7A 2RHMA 4U2CA 5KSZA 4CU5A 4MFAA 3EPJA 4LGVA 3EIHA 4WERA 4J3JA 4IUDS 5ILGA 2UUPA 1I7NA 5JJCA 1Y3HA 3KUKA 1TUIA 5H82A 3LO8A 1DAGA 4FFVA 2Q2NA 2OP1A 3W8RA 1WL8A 1QSSA 3QWFA 1PJQA 2O8FB 3CSSA 2ZBPA 4MW6A 2Z2JA 2PXIA 2Q0HA 2WV7A 4RVGA 3ZLBA 4TLMB 1SIBE 1MAAA 3KVRA 2O57A 4PC2A 2C29D 4QT0A 3GGPA 4HAWA 4BFUA 2WJ3A 1PRYA 5K4AA 1EHYA 3TR5A 1N0IA 2CDNA 2GXSA 1M54A 4YFKA 3OQ6A 3ZE0B 3PW2A 3TG2A 2AXNA 1VL8A 1KFJB 1L5SA 4BVFA 1JBEA 2BUAA 2FR8C 4K9PA 4KRGA 4UEKA 1Q3TA 1OTHA 1YZNA 5CVEA 1HYBA 1TZJA 3H9QA 2AEJA 4LDNA 3QP9A 4MS1B 1EFTA 1J8QA 1M33A 1RMYA 4NK4A 4ANFA 1Z33A 2W03A 1J2YA 1KSJA 2B2CA 3JQFA 2HF9A 3HXLA 3JSAA 1GPJA 1R4MB 3IDSA 1RJWA 4UDYX 3EUB2 2A5FA 4RA6A 3AMZA 3P71T 4OXRA 1RYMA 4ZVTA 2PZ8A 5JXWA 3SWWA 2I99A 3V72A 5KIAA 1IZ9A 1DAMA 3LRPA 4G25A 4DV3B 3P2KA 3ZX4A 4BX9C 4KQFA 5HBGA 3VR5H 5CDUA 3K4QA 4WCFB 1J0BA 4KPFC 1UDCA 3DZIA 4OUDB 2YBEA 4UQOA 4CM1A 1VSBA 2HJ9A 4RQ8A 1VKJA 2QKYA 3JALB 4FS8A 4BE4A 3O9ZA 3ND8A 2PO5A 4RM3A 4CMGA 3FGOA 3A3NA 3L18A 3ADDA 1TM2A 1HOTA 1W9HA 2BELA 3H2HA 3VO8A 3GYGA 2ZRHA 4TYWA 1DGJA 2G06A 1L3VA 3QKRA 2I0FA 4M38A 1NAHA 2PSEA 4P2HA 2RAPA 1KQFA 4L8WB 3MJEA 5CH8A 4NJMA 3L0CA 5U9CA 2ADMA 1BS2A 3MMXA 2Z2KA 3ADKA 2P3OA 4L4XA 4E2YA 2JCVA 3TLEA 5THQA 2IYTA 1YJ5A 5HHTA 4DL7A 1ZNZA 5LU9A 3WLNA 2DLDA 2ANBA 4PX3A 1VPVA 5CK4A 3WLRA 2WPDD 1U0NA 1D2MA 2VATA 2V4ZA 2MSNA 3N4MB 1FF9A 3TFSA 1GPH1 4Y2XA 1NBOA 1YJBA 2GJ9A 2QJTA 4G63A 4JEMA 1UA0A 1ND6A 2D00A 3JAKB 5DWDA 4DCCA 3K72B 5AVTA 1R74A 3D43A 1QE0A 1CRZA 3CZ4A 4I46A 2BV3A 1WZNA 1U3GA 2DBVO 1PX0A 2NZJA 1T10A 1H23A 2B6NA 2QJFA 2QXYA 2ZPUA 4OXKA 4P08A 3V7NA 3WDLA 1L7RA 4BATA 2OCKA 2D8AA 1A4RA 3LMKA 3U48A 5JNUA 3H1GA 5BOMA 3FR8A 1RTTA 1C3XA 1DHRA 2H18A 2BONA 4QU9A 2BR0A 1ICEA 4HEA6 2JCSA 3JATA 3KUCA 2XOEA 2FPRA 3HY6A 4IILA 1SOVA 3WGGA 1SK8A 3BMXA 3MDAA 3P7MA 4C3OB 3AR4A 2QBYB 4UARA 5IX8A 1I2CA 1R6XA 3ND5A 4BFSA 2NZ2A 2LYHA 2RHFA 1M34E 2XOKD 3MCVA 4FGWA 2BYTA 4QXOA 3QPVA 3LIPA 3V8BA 3FRIA 5EJGA 2P40A 4ECVA 4XFDA 2J59A 3AEZA 5EVCA 3VU0A 1KXZA 4DQKA 4BKPA 2WKQA 5AHOA 4E31A 1M2GA 4CEHB 2QVZX 1LX6A 1N6OA 2XUJA 4O63O 5EZ5A 1OV4A 3SDBA 3UWPA 1U9YA 3MGGA 2YRFA 3IQXA 4P1ZA 2R00C 4KOEC 3TPZA 3JZIA 3TZLA 1A9XA 3L93A 1SA0A 3OZBA 3P9ZA 2PZKA 2O0KA 4B81A 2R85A 1B1CA 4IZHA 1QWOA 1R9NA 3V48A 4DDVA 5C34B 4QT4A 5KS2A 3M89A 1TU3A 3OU2A 3UBTA 3MWGA 3ROMA 5JSFA 2O8BA 1ODKA 3BFPA 5HQJA 5ALEA 1OVMA 1SQ5A 1WULS 4F3TA 1SMKA 3LLMA 3FSRA 4N54A 4P31A 5KQMA 2FUG1 3P2EA 3CT6A 3JRWA 5EE0A 1F2TB 2LCFA 1ADGA 5FLYA 2CK3A 2R6R1 1E9RA 3ZY4A 2I2WA 5IJXA 4ZT3A 3L5KA 2ODGA 3KKNA 2A14A 3MJCA 4UBCA 5D3KA 3BM5A 4ZCLA 1T3TA 2HIHA 2XMRA 3L05A 3GUCA 1UPBA 5KTKA 3O91A 3I9JA 2RBGA 3MELA 1MV8A 4WKPA 3LG2A 2JAXA 4CFYA 1QH9A 5KX5A 7MHTA 1V4BA 1ZMRA 2VUHB 1IHOA 4PSAA 4RTLA 2FFBA 4QUJA 2FFAA 3CX6A 5CVVA 3ZU6A 4K6MA 1PDOA 3C39A 3QZUA 4PHHA 5DGTA 3FNHA 4D9IA 3ETEA 4HB4A 3O2JA 4RSGA 4BP1A 5JQWA 3WL5A 4M8SA 1E6MA 4MHOA 1CWUA 2IEYA 3NDRA 4MW4A 2V96A 4WUVA 2YX1A 1E3QA 1KK3A 3F6SA 4F4WA 3FTQA 4YQEA 4MV5A 1E62A 4NCNA 3ESRA 1TOAA 3NBFA 3PXAA 5C37A 3H8WA 1JFVA 1PR4A 2CMFA 8ICFA 4FDVA 4ZRMA 3UK1A 3MFYA 3FSGA 3NVMB 4NZMA 4EHNA 2VA2A 2JVIA 2COUA 5KFOA 4FYXA 1XO0A 5B55A 5HVNA 1VCHA 3V1UA 3RRNA 2D3DA 2GEFA 3NTRA 4I1SA 3IMGA 2ASLA 3L4PA 5GTHU 5IVIA 3RHTA 4P5EA 4LZGA 1MH9A 1VMKA 4HDSA 4Q3CA 3GLFB 2O52A 3K73O 4MNTA 3QBDA 4TWBA 4JBIA 3PC8C 3SV4A 1GPLA 3H4MA 4YCMA 1HUOA 2WTFA 3E2PA 1HF3A 2IPMA 2ZIXA 2Q07A 4RXMA 3HA5A 4AJNA 1NZJA 2Z6AA 2W6QA 4X6YA 2ECFA 2IMWP 2EP7A 4FFWA 2I7CA 4O02B 3CEJA 7ICUA 4MW7A 3X1KA 4DA9A 4C76A 1T8EA 2IP2A 3F98A 4FX5A 4S1NA 3NDBB 3TTWA 1DCFA 5KAFU 2PXAA 3MUOA 1BEZA 3QNMA 2HQBA 1YKGA 4RYDA 3GDHA 2ZZKA 2H63A 5JNVA 5EMNA 2LCQA 3PX2A 2OILA 3SF8A 4DLRA 3AG6A 5IUKC 4RZSA 5KYXA 5LNK1 1U4BA 4HP8A 3UJPA 5JCXA 5JNRA 3ZU3A 4ABTA 1E99A 1J1UA 3LLUA 4MUNA 3LPAA 4O4JF 3KEQA 4A0QA 3SU8A 5I3CA 3V4PB 1RYHA 1WPGA 2GPBA 3HJUA 5C0OE 4H08A 4ZQEA 2ZIUA 4QELA 4HDNA 3K6RA 4V3BA 4UPDA 1X0VA 2PZAA 4PYQA 3W6PA 1FFHA 3T99A 1YCGA 4JU9A 3GVHA 4AX4A 2DPXA 1SV4A 1BS1A 1N5MA 5F9NA 2WHPB 5HMMA 2Q8QA 3L4BA 3OWXA 3O4VA 2NT3A 3ZDBA 4HAVA 1XZIA 3FH0A 4IIGA 2ODBA 1P9LA 1SQFA 3AHIA 4HYYA 4KVZA 4MS3A 4NMWA 4RY9A 4B4KA 4EO4A 4Y3UA 4EVIA 3MINA 4OFZA 5EPUA 5F33A 4LOJA 1MU0A 4UZSA 4D26A 3ETJA 5E2BA 4PZAA 4JY7A 5AKJA 4PZCA 3D2BA 3JARB 4Z3OA 5ED0A 2GAIA 4PX2A 1Q20A 3JS5A 1JLLB 1Z6TA 3GAZA 3FHOA 4PQEA 3WLHA 4YP3A 4E46A 1N0HA 1W94A 1T1RA 3KYBA 2JK0A 4TTSA 1ZIYA 3VV3A 4EFLA 2EWVA 1OB2A 1FRFS 4DFKA 1USUA 4GPAA 5B6PA 5BXYA 1IXRA 3SFTA 2P9EA 3TGWA 4B7UA 1TTTA 3JWHA 4Y9TA 1NVMB 3E0QA 5J0SA 4D7AA 4AZ3B 3YASA 1R0SA 3HN6A 4AO7A 2BGWA 1C3VA 1HH4A 4J8PA 1NNI1 3RUCA 3N8GA 3EMVA 4LSZA 4FW9A 3DR3A 3SZUA 3LQKA 3AR2A 4NH0A 8ICBA 1QHNA 1NYLA 1ZMTA 5EKTA 2GLXA 2OLJA 5CA0F 2PH1A 5TQ2B 2EDCA 4QYTA 1XU7A 5CYGA 1VLBA 4TN5A 4F5PA 4Y6RA 5D5PA 3DWEX 4CG0A 1YA6A 1A5ZA 2VJMB 1YRWA 2QQFA 5ENZA 5BUSA 1JF8A 2Y8EA 3ICOA 2B5WA 4PAWA 1EA5A 4II2A 2A6PA 2FG7C 2Y99A 3F1LA 2HMWA 5T14A 1ZQSA 4H17A 2D0IA 4LRUA 4FLFA 4WKBA 1V1MA 2O54A 1JJIA 3UICA 3C41J 4HX9A 5JRJA 4RD4A 3BA1A 5LBTA 3ECAA 3WWCA 4GC9A 3A6LA 4R6WA 1QRDA 4PSVA 3W4KA 3MGAA 5LQJA 2QMYA 1SVOA 3VZCA 1U3TA 4EY8A 3RAEC 3BL5A 4ZTBA 2ODPA 1J1IA 1L7NA 1C0KA 4AF8A 1XD2A 1KJYA 4W5WA 1Z7YA 3IJ5A 4M0UA 3HXOA 2CT8A 2EZZA 4DA8A 1KZ7B 3M4JA 1RJEA 3M3DA 1TVKA 5DXFA 5AUNB 1FZQA 4FMCB 5DE3A 3H8MA 2JFWA 2G80A 2JA2A 5KREA 5L4SA 5IAJA 3R74A 1BW9A 2CJWA 3K0AA 2GF0A 3GWGA 4JCOA 4FUTA 4JUIA 5JD3A 2R87A 1F8XA 3PTLA 2QVLA 5IH7A 3QPCA 1CJMA 4R54A 1NVKA 4FEYA 4CFSA 1FLVA 2J9GA 1VGRA 3UB3A 3HBLA 2JANA 3BSYA 1UXIA 1RBZA 5F4BA 5LYYA 3ISTA 2IX3A 3IELA 1WOMA 3E22B 4W1QA 1BQ3A 1GZSA 5BSVA 3KJGA 4J9MA 1XFDA 3SEFA 2OD9A 2B61A 1OHHA 2XRFA 3N3AC 5F77A 2JH9A 4A8JA 4ZJYA 1XN4A 1GNPA 5ESDA 4C6RA 3RS0A 3U5TA 3C7AA 4UAUA 3BRSA 2AWOA 4MICA 1DBSA 2W7TA 1Z29A 4UMVA 2IQ5A 3IAAA 1FVOA 2ORIA 3JQRA 2BEVA 2YWJA 4HD8A 3U7RA 5LQDA 4Z6KA 2VDOB 2P2NA 4J2HA 1GJRA 2PX2A 3G2OA 3ZR4B 1JH9A 2G28A 2Q99A 4ECRA 4Q7KA 2A5YB 3CVVA 2GBPA 3D31A 4V0LA 1YDHA 2HMVA 1E9SA 4Y7CA 2NRVA 2IYFA 4HDMB 2W93A 2ZDQA 4I5FA 3EIWA 4PZPA 2NUAB 5ADHA 4V0MA 4F5DA 1L8LA 1Z88A 3ZH9B 4LXHA 4TS3A 2ONZA 5CYPA 2VH5R 3FB4A 3KLNA 1K3TA 4J94A 4I4CA 1UFRA 1CEQA 4MW2A 1KFCB 2NU9B 1AY0A 2JLCA 1QVAA 5TMPA 3NTXA 1JHYA 1CQJA 2QN8A 2MT9A 4Q16A 4C5AA 5JMWA 1HFWA 2VDPB 4L8GA 4QPNA 4KLTA 3KAPA 3PX0A 3JVIA 1N1EA 3BRWD 1MEOA 1T36A 3D1LA 4RKRA 3TTVA 1LJLA 1EBBA 2H6EA 3E70C 3Q9UA 1V6AA 1RAHA 4I66A 4L5IA 3RVLA 3NNSA 4NLCA 3QNUA 5CDTA 4UU7A 2QJRA 1X1TA 5IEBA 2WB1F 1AQYA 2ZU6A 1RIFA 6ADHA 2LM1A 1N5WA 3GJ8A 3UAWA 2Q1SA 3WMEA 3QSYA 2C4VA 2ZSJA 1RYFA 4EJSA 3MRVA 2UVDA 2CYBA 3D4OA 3KFVA 3THSA 4QYMA 2QZJA 3F5FA 4GSKA 3H0RB 2KIWA 3R8FA 2MINA 5AKKA 1X7WB 2DWUA 3QZ7A 2J45A 2Z3WA 4WEQA 5HOEA 2F4VB 1U8AA 3VR1A 3IUMA 4OQFA 3ANNA 4J29A 1IRXA 4HNSA 4I3FA 3HYSA 4U6PA 2RG7A 5LLDA 2BGGA 1O94D 3GEBA 1KBOA 4LOKA 1KU0A 5DDMA 1O2DA 5SYMA 4B3RB 2RP5A 3V8VA 4FZJA 1I1HA 3AV3A 4ZT5A 2W7OA 3FOAA 1PD1A 2GKGA 1SV0C 5KMGB 1F14A 1M1YA 1A88A 1LPOA 1MRZA 3FWKA 4GLLA 5TJHA 2O5EA 4BQFA 1KL7A 2JZBA 1LWOA 2RSLA 2XNJA 1I24A 2BCVA 3S2YA 3CTPA 4MR8A 1GLVA 1I51A 3OPYI 2NO5A 2YHBA 4YJHB 3JASB 1ZETA 2XWQA 3GLSA 3AOEC 4OQXA 4H35A 4UVEA 5C46F 1ZZGA 2X1MA 3HCCA 5TSDA 1IQPA 1M5RA 4WA7A 2ZATA 3W34A 1UJMA 1U6KA 1D5WA 2QAGA 5GV8A 4DC1A 3PMLA 1WV0A 2VQ6A 3TLGA 4CIBA 5D00A 3U5ZB 2WJWA 3T3EA 2I4NA 1C41A 3RDPA 2BKXA 1C81A 5G1NA 1BYIA 1TKBA 2GTHA 3EZNA 3ZU2A 3K8QA 4P38A 1NR5A 4UTXA 1UWCA 2ZREA 2R1TA 3H13A 5BUZA 2J5XA 2Q0ZX 3LUJA 2Z08A 2ZBGA 1MC5A 2JPDA 3HCFA 1G8YA 3ESXA 1GVHA 4GGMX 1L5UA 4TKLA 4B32A 4D9JA 5B2FA 2CFIA 3V46A 4KMOB 1T6NA 3BD6A 2VP0A 1LPNA 4JP2A 2KVCA 2R8EA 2ZE8A 4HR7A 5CCDA 4F4IA 4FZ5A 3MGVA 3HCWA 4EEXA 2ET6A 5BQXA 2QE7A 3LOUA 4DR7B 3V8EA 1E4EB 4KLEA 4CI9A 1WB4A 7ICGA 1TO6A 4NLZA 3P0HA 4XWOA 1UMCA 4MS4B 1N6IA 1RWMA 2BPFA 2EZ4A 4IINA 4FCTA 5DISB 4DTIA 4ILKA 2ZUTA 3I6MA 4UNNA 1T15A 2G82A 4U2FA 5B3LA 4CN8A 5J2DA 1TM4E 3QX7A 4K2AA 5H3CA 2P6UA 4P9NA 2Q2OA 4ALLA 1DRGA 5KT2A 2OFOA 3EDCA 4YRFA 3R7WB 3RYCB 2IXTA 2BMFA 3P94A 3AW8A 3SE0A 3WLLA 3S28A 2FOXA 3DOJA 1ULUA 1GVNB 1YUBA 1D1QA 1AQLA 1JPUA 2WHRA 3EH1A 4GNRA 2IGBA 4HQLA 4MSUA 4PRLA 5EIOA 1O95A 4RPKA 3RUHA 4LW8A 1ZGHA 4B85A 2LTAA 4WKNA 4CKXA 4QEDA 5FWXA 3GU3A 2BDTA 2HPHA 2YWFA 4O4HA 1T3LA 2RGGA 3HKZF 2PYIA 3O4GA 1QGUA 1VHTA 2INGX 4LOAA 5DN9A 3TZEA 1TCAA 3GJXC 3W5CA 3L9WA 1Z2DA 2PL5A 3LBHA 3M34A 1IJKA 1GZ6A 4WOBA 4Q02A 2GZRA 4FO6A 1SHJA 5IF9A 2PLRA 2CKDA 2ZJOA 2R5NA 3F71A 3FZGA 3FMOB 4KIUA 2F44A 1CR4A 4IICA 4YJ2F 3OE7D 4ZOCA 4LRXA 2CV1A 2H7XA 5DSXA 1G16A 1C3LA 2X9NA 1SY7A 3F6BX 3HCAA 3HSKA 3OWOA 5FAXA 2VYCA 4BECA 1U28C 4P83A 4U2DA 3WIDA 3U80A 2Q5CA 1UKAA 3B70A 1XF1A 2GEBA 3W1VA 3W1EA 4QWEA 1AUXA 2XQVA 4M6WA 3HVKA 4EW3A 3PEYA 2HHCA 3PQ6A 2CWDA 4Y2TA 2AC4A 4PC1A 1QKKA 4TV9B 3P9CA 1RRGA 1WP9A 3EY9A 3W6OA 3J7AC 4UBJA 2UVWA 1R8XA 1YZUA 5IDVA 3D8RA 3WS7A 3KAQA 1PWHA 1NVVR 4ECQA 3GMDA 3N2ZB 3R3HA 4PHCA 4DPLA 1E5DA 3DYIA 3N07A 2ZSHA 1NJZA 4US0R 1I7PA 2HSEA 2PMKA 2JRZA 5I01A 3T5AA 1EVLA 2C2GA 1JYFA 1M8JA 1NUUA 3L49A 3OFVA 5F12A 3FDXA 3HB0A 4IRUB 4US9A 1TVCA 4MQ4A 3MA0A 5JCPA 2E9SA 3I01M 4K46A 3V1NA 3R9XA 2LPMA 4IJUA 4CQLA 4OATA 1UXHA 4OD0A 3Q7TA 2RGCA 3EXAA 3R0JA 4JL5A 4J0CA 3DDSA 5TEWA 3U81A 5KT6A 3D8SA 3HDHA 4G01B 4B8YA 2VA8A 2P90A 4DJEC 1BXZA 4Y1RA 4ZZ2A 5DTIA 1WSAA 5CNIA 5LD2C 2VNIA 2W7PA 2E87A 1W0JA 3GJZA 4FOOA 3FZEA 2PYZA 3D4LA 3VU8A 1FFDA 1RE0A 1CBUA 1OYVA 3S7ZA 3VPGA 5KG0A 1MAWA 3BTVA 3AONB 3WBFA 1CR0A 3FWPA 4K6OA 4XFKA 1H6AA 2YQZA 2YRWA 3HUFA 3TI9A 3Q6IA 4B3JA 4F4ZA 1MX5A 1XCLA 2JCGA 1N1DA 4CLEA 4EJ2A 5ADVA 2XWPA 2ZRFA 5AW2A 1KTVA 5HR5A 4AZ0A 4CF4A 3BQMB 5GTDA 2VFAA 4C22A 4CRXA 4CMHA 4OEHA 3EVDA 2JCXA 3ONDA 4ER7A 1MJHA 1Y5RA 2WK1A 3RTCA 4Y2PA 4EFDA 3D1JA 1CE8B 2FSVA 1S7CA 3EC2A 5L53A 1APBA 2FQYA 4KC0A 4UBLA 1FPMA 1NNLA 4PANA 5JRDS 1LUAA 2QPTA 2JD1A 1PGOA 3NRBA 2WE8A 4MPJA 1AZLA 3GD7A 2D1TA 3K5PA 1TA9A 1P4AA 4V24A 4NG5A 3E23A 3OQHA 4S24A 3RADC 2DKXA 4RVCA 2RJNA 3I6QA 4UQPA 1SVWA 2IEIA 3JQBC 3KOZA 4Q66C 1ZUWA 2Z3ZA 4JLWA 2RH8A 3FE2A 5BNFA 5M3BA 9LDBA 1Q11A 2EZYA 2QR2A 4KN8A 5EXDA 5DWVA 5JZBA 1F4LA 1TFUA 4LZPA 4BV9A 5BNZA 4QDUA 1RSZA 1W1UA 4PY2A 4G1MB 1GT6A 4J1TC 1NRJB 4OUDA 2JFBA 4YCJA 5CFOA 2K7ZA 1G6HA 2XAUA 3MJDA 4RLSA 3HEMA 1L4EA 3B1VA 3B38A 1X8KA 2W2LD 4RW0A 3TBKA 2E18A 1Z2EA 1ESZA 1O9GA 4KWIA 3IR7A 4MWZA 2CD9A 5C4MA 4O08A 3LH5A 1J0DA 4LXXA 5EKDA 3TM4A 3AI3A 3HU3A 1P3Y1 3JYLA 3C45A 1T5TA 1COWA 4BO7A 3DF7A 1CDDA 3OPXA 2FSVC 3IAXA 3ICQB 3A9RA 1O77A 4BMNA 1ZNYA 3ABQB 4FXPA 2QM8A 2HPZA 2JL1A 4JC0A 1T4DA 4NRDA 3UA4A 4MDEA 1MQ8B 3OFNA 1T8YA 4OAPA 5CDGA 3N70A 4GYKA 3C5WP 4I1PA 4ZVMA 2FP4A 3DT6A 1XTVA 2Z8XA 3H7AA 1H5NA 3O31A 3QG1A 4M22A 4DDMA 4LOHA 3QVJA 2C22A 4QU0A 1WCXA 2HCRA 5CA0A 2OR3A 1EQUA 3OLZA 3HJTA 4C5BA 1TZCA 2G0NA 4MVYA 4DQRA 4CLDA 2NZUG 2W22A 4MCIA 2WE7A 4D8UA 1QOZA 1BNOA 4F3NA 4DLYA 1YVPA 2DL0A 3TAPA 3AJ9A 4MW1A 3ZXYA 1P60A 3F2DA 1G98A 4IW3B 1FYVA 3F3SA 2Q27A 4BQSA 3UH0A 3D6AA 3ELUA 1I6LA 5KQPA 1XTSA 4WBNF 3P0JA 4BRZA 1YIDA 3IULA 2EG5A 2GK6A 1R4ZA 5DGBA 1JDJA 1QGOA 3CBQA 5HIKA 4I27A 3OHSX 1J21A 3DDOA 1T29A 2ZYAA 2I9GA 2IOHA 5AKLA 1KY4A 1MEEA 4P0QB 2I3DA 2YZNA 4ICIA 4X6UA 3V32A 4WESA 1J0EA 2GJAA 4MEAA 1KAMA 1WM1A 4YALA 2O06A 4JUZA 3D0QA 1EHCA 4XGKA 1N1GA 3FCSB 1OXXK 1THZA 4Q1EA 4HWKA 5E3IA 2Z6UA 3C2QA 3CPSA 1W5BA 1BRTA 2I8CA 5CW1A 4B3FX 2IT1A 2HWKA 1P6XA 1E1NA 3U40A 5DDYA 2FSHA 2QRGA 2AFIB 1VXRA 3KZ1E 3UNXA 4YMUA 3I39X 4Y2SA 4FMBB 3RVBA 2I6SA 2REXB 4IUYA 5BV8A 5K8TA 2AMJA 1DOZA 2YOFA 2YWBA 2WW8A 3X3HA 4EGJA 1BVHA 2ZYVX 1XLUA 4O0LA 4Z1MD 2GCNA 1C9KA 2XA2A 2PQ6A 4JUCA 4TMKA 3VKFA 3T7SA 1YFJA 4WT7A 3X1ZA 1BKDR 3D2QA 3ZHYA 4NZYA 3W9YA 4B82A 4Z2AA 4R8MA 3SMVA 1KAGA 1PFQA 3DS8A 3EBPA 3MBOA 3V7YA 4EYIB 4DF4A 4RHUA 3GXBA 4YEDA 1ADYA 3S27A 3ZLJA 4URVR 3T1OA 5KNBH 2WTBA 1C7IA 4EHDA 4GOOD 5AW5A 4PNEA 1EVYA 4HCJA 3M6MD 5BURA 1KJ8A 2ATXA 3CEHA 4Q7QA 3DOUA 2HDWA 2MRLA 2DUJA 4PO9A 4FGKA 1ZVJA 2V54A 1VLLA 2AKEA 4F5RA 3IE2A 4XDHA 3Q85A 3SDZA 4QWDA 1MJ5A 3FFXA 4KBYA 5HYVA 3E5MA 3RO7A 3B8EA 2DPIA 2YUTA 2WFLB 3CRVA 2VH2A 2ZUSA 3S70A 1XNGA 2C31A 4HG2A 3WL3A 1VDVA 5K0JA 1I3MA 2F3SA 4PYKA 3TW6A 3LY5A 1S9HA 3LX4A 5JEDA 3T35A 3PEVA 2D1RA 3ZD9A 2OXEA 3T4UA 4L4YA 4S04A 4BFXA 1H4TA 1QIFA 4QC2A 4ZKDA 5HTOA 1DPGA 2QG9A 4Z9BA 3JYNA 3SHVA 1GCIA 5KG1A 4WH0A 1K92A 2O8CB 3KTAA 5FH9A 4C2AA 4MA0A 1XNQB 5KFRA 2UXBB 4QHTA 4OQDA 5FOUA 1XMPA 2BN4A 2RCNA 3KQNA 4OX9Y 1WHSA 2DLNA 4MRRA 4R8KA 4TT8A 5KC8A 1P2UA 3KOXA 4EFMA 2UVUA 4JWNA 2VAPA 3HYLA 1T34A 1ECWA 3QKUA 4LC0A 4BNFA 4BUJA 4E33A 3MSCA 2IHYA 3R5JA 3QMPA 2ZIXB 2FW7A 2QVBA 3EQ9A 3QX8A 4QHYA 1ZCZA 3L77A 4PSDA 3CRW1 1K7SN 2ONJA 5K1ZA 1QOPB 4HK4A 4XOUA 1QAMA 2FN7A 2OECA 3JWPA 1IRIA 3CZQA 4FS3A 3VMMA 1NVDA 2FFHA 2NGRA 4YBZA 5KFAA 2AOTA 3OLXA 2IF0A 4B4VA 1TYAE 1C8KA 5CA1F 1QIKA 3MGIA 2QAJA 3HVHA 2BFNA 3O3MB 3MLEA 4O4LB 5AKXA 2FMQA 1LJ8A 1M2VA 1GUAA 1J5XA 3H4TA 2F43B 3DEAA 4RK1A 5IHPA 2W6MA 1NY6A 4Q8EA 1O97C 4LJ6A 1ABFA 1U1FA 2ACEA 2GM3A 4EBDA 5HKOA 1F38A 2JDID 1SOWA 4O0MA 2OAGA 4BAUA 2CFTA 2O7NA 3D2LA 5HKBA 3VKHA 3ZDAA 4RZXA 1A2OA 1DIOB 2XF8A 3B1JA 4BWYA 4L74A 1RYRA 2Q2WA 4GO1A 4ZZIA 1XRQA 2GN2A 4IO1A 3DPUA 3NT4A 4Y6GB 3RRXA 4MCJA 3W2IA 4BKRA 5JYBA 3QLVC 2K87A 4UFOA 2AJ8A 1AGRA 4XA8A 3JQAB 3PPVA 1BX3A 1NYRA 1QP8A 5WRFA 1XIVA 2NRWA 3LW7A 4ZO6A 5FA5A 3ZDRA 1ESDA 2HK9A 5IXJA 2JLWA 5KYYB 3EARA 2HYIC 2Z4SA 2KLHA 4LRYA 1LBQA 3BKXA 2MUTA 3ZHSA 1J70A 4ZAYA 5EUQB 4BMPB 1W36B 3UWMA 8ICWA 1WBDA 4G4SP 2Z30A 3F49S 3K0CC 4LXUA 2HMXA 3K3PA 2HRRA 5CB4B 1XL0A 5IULC 4AKEA 1IXYA 3LQ4A 2NUTB 4BWFB 2RI1A 1MPTA 1NJXA 1DIRA 2BFWA 2B0CA 1Y63A 2OHJA 5EWFA 4FBGA 4OGGA 4LPKA 1D2GA 2AL7A 3BORA 3G85A 2H11A 3MPUA 1Q19A 3KKMA 1VI5A 2ZJ1A 4J0EA 2ERCA 2JFOA 2WDZA 5D01A 1I6KA 1SB8A 2FLWA 1MO2A 4RQ2A 2RHRA 2ZSAA 1TDJA 3H05A 4JR0A 3E9QA 5L3VA 1N6KA 3ETLA 4MYSA 3LK6A 3P32A 2A35A 3AQIA 3OTWA 5KL8B 5F7JA 2RDMA 2VQDA 3MWEA 3F8TA 4ED9A 4D9MA 2YY5A 1KMQA 3HWRA 3I0MA 4I6GA 2QUKA 4TSFA 2FSIA 4ARIA 1K3UB 4DNOA 4FLMA 2FUEA 3BEOA 3WICA 3AYZB 1MC4A 4JHLA 2R6GA 4B6SA 2P6OA 3T94A 3NBZC 4RKFA 1CX9B 6Q21A 2RD2A 5IYZA 2KZZA 1SUWA 3NDPA 1OH6A 1ZQDA 4YMLA 3CE6A 1JKXA 1DDGA 5FFMA 4WBXC 4RTJA 1TCUA 4QPZA 4AY5A 4CW7A 2WNSA 1ZQ1C 5EY5B 3JQBA 3LK7A 4E22A 3X1XA 3TINA 2J85A 3WYGA 1SV0A 4NMMA 4KR7A 1LPPA 2IOYA 5ALZA 1NK0A 4P7GA 5JVDF 4X61A 3HA2A 1JLRA 5F5XA 5A3SA 4EUFA 6AT1A 1OW5A 1QPBA 3HFGA 1WQ3A 2L69A 4FDTA 1LKYB 3QUCA 1K5HA 3WB2A 3INTA 4IHKA 1KEUA 2O48X 2WTEA 4RKQA 2ECKA 5DMXA 3NHZA 1CJSA 5DB6A 1VLMA 3VC8A 4CXMA 1JDBB 3COVA 1K08A 4Q3NA 1W1IA 1CUCA 1L1EA 2CJYA 1I7DA 1MBZA 5HJ2A 3B12A 2O0HA 1JIVA 2G08A 1SOAA 1AZWA 1M2EA 2W2PA 3EWNA 4FXOA 1CYDA 4IRMA 5DBGA 3CUKA 3SJUA 3RSZA 1TVMA 4AK9A 1Q0RA 3ZLUA 4BAZA 2B4RO 1YV9A 4A82A 2RGAA 4KSCA 2JHDA 3LDAA 1M2NA 3MWJA 4EFKA 1Q0TA 2XCRB 3OT5A 3QY9A 4LNUA 5JEEA 2O3UA 3KJXA 3DMGA 1JLMA 4DL2A 4NE7A 3OFKA 1XZDA 1JU9A 5JC8A 1E66A 3DFIA 4CMJA 3ZGNA 4H1HA 3UB4A 4AYTA 2KZ3A 4IR7A 1B00A 1UBSB 1C9NA 2IUEA 4ALJA 2R8BA 3LUAA 1MOSA 5REQA 3SR0A 4RQ0A 4Z9YA 2XBMA 2VI5A 1CUVA 4AUEA 3CVJA 1EK2A 5CVUA 1HA3A 3VO2A 1Z8DA 2GRUA 3KS9A 3MNFA 5B2ZA 3C7CB 2Q6KA 5CIWA 4GYYA 2CUZA 3EIQA 1WW3A 2Q2VA 4MV4A 2AJDA 1C0PA 4JUFA 5BOSA 3S8EA 3MW8A 5MDHA 2FDCA 3F2IA 3IKTA 4M4SA 4OJQA 1DARA 3ZJTA 1W5AA 1E94E 1Z4QA 4S3MA 1PSDA 2QLLA 3ZTTA 3NATA 5TXGA 4FHZA 1XKLA 2HCFA 1WD5A 3DNMA 1TM7E 2QPAA 1Q46A 5JJ5A 1PDWA 5CB4F 4RH0A 1N4DA 4I55A 4EUHA 4Z9AA 3O7WA 2X5OA 1AX9A 4Q18A 2OZVA 2H3IA 1UXOA 3K8ZA 3GRZA 4DS5A 2Y68A 3THWB 2GILA 1DZ3A 2WV9A 1GPDG 4A8JC 2Q3HA 1JBKA 4K9NA 5SZKB 2ADOA 5HGXA 3T15A 1S5PA 1R0YA 1KJNA 1UIMA 1WE2A 3WO0A 4BXOA 3FVWA 3GLGB 4M86A 5ALXA 1WNFA 1V5WA 1L5ZA 1W5EA 3WDKA 2EFCB 4MH0R 5BPHA 1T4CA 5C8YA 3M6KA 5GTIU 4OSOA 3TTTA 3DONA 4YMSA 1GR1A 4L5AA 4EGFA 4AWXA 1V7PC 1GNQA 2UZIR 5FI0B 2VDWB 4G86A 4NEGA 1XDZA 3KUUA 3EOBI 5A9TA 3ND7A 2IIQA 3FETA 1OA1A 3EGWA 5TX7A 4ARSA 4U6QA 1R4MA 3KDAA 2FSFA 2IA5A 2VJAA 3DC7A 3TQHA 3T7RA 1ZS9A 2WG0A 2K2WA 1T9GR 2OBXA 2X0IA 3QVMA 2KHVA 4JT4A 1EK1A 3Q40A 5KHOC 5KNLA 4IFBA 3DV9A 4R51A 5KNCA 3AWIA 4R1TA 2TMYA 3PA6A 5KB3A 3LRXA 3RFXA 2RQ5A 2VRCD 3I9V6 3WP0A 5DOVA 4XYMA 5HKLA 3LDFA 4D3SA 3I1IA 3K15A 5LYJA 4B75A 2CXYA 3OPVA 4FX2A 4GMFA 3MOGA 4R1QA 1KK2A 1R0CA 4UB8U 3D3QA 1NR1A 4MB6A 4MVJM 4DLLA 1V5GA 2Y0SF 1GTVA 4NAVA 5DTMA 3JASA 3TKAA 3K9LA 3N1UA 3NOOA 5TC4A 4EGQA 1PLKA 5F9FA 2AEEA 3PW7A 4ZGWA 4ZYXA 4MQUA 2HZ7A 3ZNQA 2YDYA 2IC5A 1LDBA 3MCTA 4DLXA 5DLYA 3LT0A 5AHXA 5JSQA 2EAOA 1Z15A 4JS0A 2DPMA 5K4LA 1D2CA 3LW8A 3ROFA 1NK7A 3ELYA 1TKRA 4LHSA 3TLGB 3TLYA 5I7EA 5ICCA 5SYAA 1PUIA 1R4NB 1K98A 3LT2A 1E7WA 5DNDA 3PFIA 3MYYA 2DC1A 2K7FA 3DL4A 2Q0QA 4C8KA 3SQDA 4BRSA 1BIFA 1J2TA 1JXAA 1A0OA 2OENG 4GR4A 1OJ7A 1XRRA 3FMVA 4N7RA 3IJEB 4AKIA 4BEWA 2OBFA 3ADCA 3U7QB 4JK3A 2I78A 3KL4A 2HHUA 2V5VA 4RGQA 1CUKA 3AJAA 1L6IA 4DMHA 1QCZA 5CUQA 3AF4A 2AXTU 3MAJA 3UFXB 4EGCB 5I48A 2GEJA 2FGJA 4C3UA 1MR3F 1T8TA 1E6CA 1KTQA 4NARA 3A32A 4NBVA 2G9RA 3UCFA 4UKDA 4TLCA 1HQDA 5FL7A 1AMNA 3L2OB 5FYQA 1EPUA 2FPPA 2R8JA 1T9BA 1U6JA 2A0YA 2R7NA 1DKLA 2X14A 3E81A 3L0SA 1Z25A 4RNOA 4FINA 1C0LA 1W4LA 1YB5A 1U0HC 3R7FA 2UYCA 1XA3A 2XMQA 3AY0A 5LXTF 3RJKA 3F1KA 4C30A 1WABA 2QG4A 4HY3A 4OHKA 1L9XA 1CY6A 4C3ZA 5AVVA 5HIMA 1GUBA 4LA4A 3AZQA 4BEVA 3PJGA 5K3OA 5J23A 4M9LA 5AW3A 1N7IA 4O1MA 1UPTA 2FR8A 3N5CA 2BMJA 4Q12A 5EWMA 5LQNA 3K71B 1SXQA 3A9WA 4OK6A 5ERYA 1IBSA 1QORA 1ULBA 1UJ4A 4YRPA 1DXHA 1I8TA 2NUBA 5CYOA 3WL4A 2DU8A 4Q48A 1PJ2A 4QXPA 5FFNA 4PAQA 5AFSA 4YQWA 3JSXA 3ZD6A 1PEYA 2GEUA 4Q00A 1FXWF 1WUDA 1UPAA 3INRA 4BP9A 3N97B 1HG1A 2TS1A 3NRWA 3CT4A 3GNSA 3LBAA 5KYTA 3GLQA 4IAOA 4HRXA 2NU8A 3A2NA 3KQWA 4H31A 4QDZA 1CDEA 1ZYQA 2G8LA 4Q7EA 4BPRA 4YAGA 4LTMA 4DSOA 4WZAB 1ADBA 1NE2A 5FO1A 1SC6A 2DTDA 2HF2A 2QT1A 3E9MA 5C32A 2FVXA 3T7DA 3ETHA 3QVXA 4HUQA 3MR6A 3FN4A 4PC6A 4BMVA 4BQEA 2LPEA 3WV4A 3JQ6A 4TXNA 1PEKE 5EJEA 4G0MA 1LSUA 1Y6FA 4AICA 2HLPA 3WLFA 2FLVA 1WMFA 5ALKA 3I76A 3HJCA 1N7HA 1IC6A 2ZI4A 1S3GA 5LQRA 1QONA 1DT5A 1HE1C 1DO2A 1THTA 4A4DA 1I1NA 3CLVA 4F3YA 2HWYA 3T5MA 1XTKA 3SBOA 1KOGA 4D45A 2AMLA 4X44A 3D6VA 4J9SA 4HGPA 1H6CA 4A0HA 2QX7A 1A98A 5LP1A 3IUSA 3QTBA 4R63A 2HAEA 4QXRA 4RSRA 1XS9D 1H6DA 3PW0A 2WU4A 5DWQA 4I2CA 3ZCSA 4AO8A 2H4XA 2J3QA 3DNFA 4LYGA 4YNBA 5LU8A 4WUTA 2J1LA 3CUEF 3O94A 4FQ5A 3FMFA 4NNJA 3B9PA 1YOVA 3ENVA 3KVYA 1P7DA 3NFRA 4DG9A 2E82A 3FI9A 5BMVB 2QI9F 2V0NA 3AM1A 1BG6A 1ZICA 5TJ9A 3MJVA 2KBEA 4I50F 1E9AA 2IXBA 3AEYA 3C8ZA 4LJ5A 5FD8A 3VMFA 1M6VA 3EFOB 1P5RA 3BCRA 4X1YB 1L8QA 4BQNA 5BP7A 4OSEA 4AI6A 1PL7A 2QARA 1S2GA 2OBMA 5BQFA 5I9LA 2GXAA 2GHIA 4CMEC 4NLKA 5FBVB 1E61A 3M9XA 4JP5A 1KSFX 3OSUA 4IDQA 3W3AA 4QHSA 4W6QA 3IR6A 1MX3A 4Q3DA 4WNCA 3VYVA 3IQZA 2EH9A 3JXEA 4B7ZA 2W2OA 1KHTA 3NAMA 4ER3A 4AZ0B 1EKXA 4L6CA 5IS2A 2CLEB 2O20A 5BYKA 2VAVA 1P75A 4HEA1 5KHLB 1RC1A 4WK0B 1RYEA 2W4QA 3QKIA 1HT2E 3WMFA 5J2BA 4TMTA 2GETA 1GQFA 1OKKD 1DLJA 4MKRA 1CUGA 1U9CA 3P19A 4DCGA 2WQZA 2BHRA 5M29A 3A70A 5KWIA 3K9HA 3O47A 1N6RA 3R4VA 4U8GA 1Q0UA 1YIAA 5E9QA 1XRMA 1ECPA 1PU2A 2RHLA 3TTSA 4BQOA 5LJIA 2J3HA 1PZGA 2BR5A 1Q1GA 2FDXA 1I4EB 4F85A 2GAFA 2IE8A 3I6IA 2G4LA 3L6OO 1FIUA 3S7TA 4U5XA 1CB7A 1XMVA 4RKWA 4RPIA 3TCKA 4EHJA 1U0RA 2R96A 2WM9B 4GOJA 3PWZA 4U9HS 2W6JA 3RAJA 3WWZA 3RYIB 1A9SA 4LF4B 5EIFA 1D2NA 2JI7A 4MUBA 5B5EU 3I83A 3DL7A 5E4TA 4DXAA 4FR0A 3AF1A 4HNUA 5BPFA 3RCBA 1V8PA 1FQJA 2VJ5A 4HAIA 4RPZA 3KHGA 1LPBB 3A11A 3H5IA 4FNAA 3QVGB 4N1AA 4JI5B 4PZ9A 2ZIVA 1V6SA 3EPRA 2HCTA 3RWMB 2YJ4A 3ZY3A 4WI1A 5ECGC 4EJFA 2JVJA 1E8DA 4QUKA 4HNHA 2D6FC 3K6SA 1YRYE 3OQIB 4QBGB 1DKUA 1GGFA 1RFLA 5EUBA 4HS9A 4ZARA 5TRTA 2FE4A 4E7PA 4XOIA 4EHAA 3DV0B 4HLUA 4IPTA 3VPDA 5KAPA 4NM1A 1VFPA 2WWIA 4O0IA 4PLHA 4K4HA 2ZRQA 1RVV1 1SXGA 1GIAA 1E2HA 4F7DA 3GOHA 1EGVB 5JI3E 1F7UA 2PS0A 2HO5A 4FC7A 3PJDA 1ZSVA 2C9ZA 2CLFB 4R2WA 4BB0A 1SQGA 4DUGD 4RVFA 2FPXA 1Q21A 2C2WA 1MJGA 1VG9B 3PDJA 3PC7A 3WP1B 4AL4A 2FP4B 3ZZ1A 3CLSD 4H3VA 1X7YB 4OQ4A 221PA 3QV2A 3M0EA 4XSVA 1EM8A 2XDYA 3OM9A 3DDHA 2PUBA 4EM6A 3QGMA 4FIDA 1VLHA 1ZLXA 4DIUA 4AMYA 3INNA 1YDWA 1NP3A 2Z2IA 2CHEA 3SGLA 3I9V1 1WMDA 3D8UA 4KIGA 3P9KA 1L9KA 2P79A 2Q9BA 2B9VA 2J0EA 2NYUA 3QWBA 3SDSA 4ZICA 3O74A 2GGSA 2Y05A 4LKOA 1KRHA 1UBKS 1MNQA 5IKOA 1YS6A 3I04A 4YD2A 4PRYA 4IIJB 3USCS 3E4DA 3V7FA 1ECJA 2BBOA 3O75A 4WKCA 4D6PA 2E3JA 4M8IA 2Y1IA 1ZY2A 4KB5A 4QJ3A 3PDUA 4R65A 2V6BA 4GQAA 2L5YA 4RGYA 5CLHA 3VXKA 4BYMA 2NU6B 2VDJA 1ZN8A 4WADA 2J33A 4E5DA 4LKRA 2BHTA 3RUAA 1QV6A 1V16B 1HDZA 1P0CA 1OT5A 1E3EA 2IHVA 3KHHA 2P9GA 5MF6A 3I92A 5A5DA 3SG0A 3H4VA 1G41A 2REQA 9ICFA 5F3XB 1L4YA 2JJ2A 3GBVA 1OWLA 3L0ZA 4YP6A 2WPNA 4DJAA 4F56A 3CFYA 1M1NA 3WGKA 2WMDA 3Q6NA 4G07A 3VPBA 1AOXA 4HT3B 5F2OA 3OP1A 3FIUA 4YCCA 3L7YA 3NETA 2JLBA 2IIBA 4FKZA 3LS2A 4UTRA 1U7ZA 2Q2QA 4MV8A 2WVHA 2YJTD 5EHQA 3R0ZA 1Z4OA 2EANA 3LHSA 1KSHA 4EB6B 1I4OA 1NQXA 2QROA 1Y42X 1TNDA 3LT4A 4YAKA 3U4QA 3BMOA 1VTKA 2PBZA 1GSHA 1NR7A 2JEOA 1X39A 4F2RA 5H3HA 1J6UA 1SKQA 2G70A 1ELOA 2XCIA 1EVZA 5CEHA 4U2GA 2CXHA 2EW2A 4R3NA 4WHMA 1XWFA 1YBHA 5AJXA 2EEPA 5G02A 3GY0A 3UYLA 1Y1RA 2IV7A 4BO9A 4NZNA 4F2HA 5ADUS 3VKVA 2WOJA 5JTUA 1VYTA 3D6JA 2ZXFA 4GDMA 4XRGA 2GJKA 3JWEA 4I9NA 4NMXB 4CBVA 1XRSB 2QQGA 3AIMA 1FFCA 4UOZA 3DLAA 1L3IA 3RBAA 4W9NA 2WVJA 3ASVA 1UP6A 3KKLA 5KTTA 1R64A 1T35A 2OYSA 1HV8A 1AB5A 2F1OA 3D4PA 3ONNA 4WFIA 4IZ6A 3Q0IA 2XODA 3BGIA 4DXDA 1Z63A 1XLVA 2Y1WA 4PXSA 4KPYA 2NU9A 1YB1A 4L4SA 4OFXA 3MIIA 3OY7A 1SHLA 3WJ7A 4RPJA 5AXCA 4OH1A 3W5BA 4MGHA 1CQZA 5F1YA 3WYCA 2WIFA 1ZQOA 1G63A 4ID9A 4S1TA 2RC5A 1UM8A 3IE0A 3L79A 3ZBPA 2C03A 1DC8A 4MPTA 3DDNA 2FUKA 1YVRA 4MZDA 4RXTA 1GEEA 1B2RA 1DC6A 4PG8A 2OQRA 3FOCA 5J2FA 4DLEA 1KI7A 3JZFA 3WKCA 3QOYA 1CC1S 5AW1A 4K6FA 3GLKA 5DKWA 3LCMA 5M04A 5JSKA 4TTIA 1CRPA 2QUIA 2NACA 5GONB 5HZHA 3MIZA 1PR2A 4OSPA 3CLRD 4KNYA 2YIDA 4XUDA 3OZWA 1MG5A 4JYBA 4MWBA 1JPVA 1F48A 3LTNC 2QMHA 3SR3A 2HMSA 2Q5QA 1E98A 1JXOA 5CURA 4J0KA 2QSJA 7MDHA 2RBKA 2Q3FA 2B7LA 4E14A 1UBFA 3ZQKA 3H9UA 1UDXA 3HQ4O 3S2ZA 4W5QA 4PN7A 1CLUA 3R3UA 1CTQA 1I30A 2XVTA 3CEMA 3ZVKA 2ZS9A 4HS4A 4D25A 4U2EA 1G9SA 1QHHA 1MX9A 4X71A 3FMIA 2XXAB 1KVQA 4AJHA 5IJAA 5KFYA 1R5NA 1XXHB 3CJTA 3I5MA 1Y4UA 1Z4NA 3LPNA 3KTDA 2EU8A 3O92A 2QTBA 9ICNA 4ED6A 2BTQB 4YAEA 3RRGA 3DAGA 2ZIZA 4DIBA 3GLIA 1GN9A 2JZBB 3C6ZA 5J2KA 1AUQA 4LRTB 1JYSA 1WB5A 2XUZA 5L3ZA 4JWKA 4TMFA 4O4IB 3I53A 4Q7MB 3HYTA 1E6WA 1BPEA 4DLGA 1DX9A 3AOGA 1ZLYA 5CM8B 1AQNA 2X42A 3PIDA 3DXFA 1PJZA 1ZISA 3EVZA 4BFCA 2QW8A 4GL2A 4XR4A 4R64A 4QRDA 1A7AA 3WRVA 1JDNA 3QKWA 4BNZA 1XQ6A 5KBYA 2QAGB 1YONA 4HN9A 1I4WA 1JEQB 2EWMA 2ZJ3A 1R8JA 3AY3A 5EE1A 2NUPA 1BHSA 3GMSA 3K9NA 1CIVA 4QRHA 3S99A 3TXXA 3G2QA 4F04A 1HEIA 3IP8A 4AT1A 3ZLTA 4DCOA 3JQGA 1P44A 2SBTA 2X9VA 1VPDA 3K4PA 3OOHA 4JN6B 3LX6A 4E09A 1UDBA 1ZQXA 1NE7A 1ZUD1 1BU8A 1IUNA 4GHWA 2C7PA 5F3WB 5A4IS 3CF4A 2CXPA 2B36A 2G9ZA 5MN5A 4HGRA 3EVNA 4NXNB 7REQB 2OPBA 2I8AA 4N3AA 5JQGF 3TLXA 2D2IA 3STYA 4D4GA 3F6YA 3I8XA 1R0KA 3WLKX 4QZDA 4TYPA 2C4KA 2QM7A 1NNSA 1TQ6A 1D8BA 3HILA 4FFSA 1A8PA 4OJKA 1YR7A 4ND8B 4R5MA 1IN6A 4TKZA 4DG8A 1K8QA 1M7BA 2I4RA 4UMEA 1SXJB 2XQIA 3VKGA 2GZ1A 2DCUA 4WL0A 4LN1A 5AXBA 2J6SA 1OXBB 3I34X 4RTNA 2IP1A 3R3SA 1C1DA 2AS0A 1GA6A 2AVNA 5EHNA 3SOZA 2B82A 1ZRSA 2X0NA 2HM7A 3G6KA 4TPKA 1WCLA 1CVLA 2YB4A 4KCGA 1UCFA 2CMDA 1O6CA 3BD7A 5B1DA 3TTUA 4DLNA 2ZTEA 2AN3A 2BRUA 3AUKA 1CUEA 1EJ0A 4WGFA 3F46A 2RGRA 3RBEA 3MS4A 1T8PA 2DPYA 2JFHA 4MUGA 2B92A 1BKSB 5DG8A 3J81A 3N0TA 4EQZA 3WB9A 1RRPA 2QSYA 4KOAA 2JEYA 2ZS7A 4J0HA 4N0PA 2CDRA 5TPWB 1B14A 3EXG1 3FPCA 5KJEA 1BZYA 4XAQA 2FF7A 3P1JA 3ZV7A 1N32B 1LKYA 4F6LA 3W90A 7ICMA 1JDVA 1Y3AA 3NHAA 3UN1A 1KYYA 3MWFA 2IYOA 3WRWA 1ND5A 4GZLA 4BN0A 3NLLA 3EW7A 2VXOA 3ZNOA 3EZ7A 4PPGA 5EQTA 5CR0A 3ZH2A 1K5OA 1Z6PA 1FSSA 1MAVA 3IYLW 2GZ2A 3H40A 4GT1A 3OT4A 1SEPA 1K6XA 1ST2A 2FPGB 2HA3A 2Q1XA 3EFHA 3L9XA 4MRPA 5ARBA 4D0GA 1ZQEA 2DWCA 1SQ0A 3A0BU 2GRAA 3G59A 3U7GA 3QA3E 4Q7LA 1CQIB 3P96A 4QA9A 3LWDA 4O33A 1G291 1ESCA 3IPXA 4RV5A 3SPXA 2OG1A 2WIGA 2QTWB 1P2VA 2HHXA 5J8YA 1AS0A 1BE0A 1NJ2A 2OK8A 4P4TA 3M2TA 1VB5A 2PPLA 5F76A 3UUFA 3U56A 4A8EA 1XRJA 1QP0A 3KFXA 2NSHA 2WJVA 3RS5A 4LSWA 2A9OA 2ZZNA 3A6ZA 2HNKA 4FBMA 1L1QA 1VE5A 2FMUA 1JEAA 4X5VA 2H0QA 2I87A 3GQVA 3I58A 1JR6A 3UWDA 4DAOA 4QVKA 2N0SA 4LWPA 1DI0A 2IY8A 2J3MA 4JBWA 3ZEIA 1TJ5A 4U02A 2QTVA 4FSXA 5CR9A 3CVXA 3NDIA 5FPKA 1ZQQA 3AB8A 1YRAA 3AFIA 5KFPA 3U6BA 1AKMA 1O6GA 2NO0A 2PHZA 4ERNA 2ZSEA 3IVMA 3WSWA 1ZD1A 4TXLA 2VHWA 1RPJA 2BZSA 4I50A 4OJ6A 2AUMA 3V8NA 3DH0A 4JP8A 1YQTA 4DREA 2M6KA 1TEVA 3LYSA 2EQ5A 4PZLA 2GCOA 3CSDA 3I05A 4OP3A 3G6XA 1ZNWA 4EVQA 3IEXA 1U0SY 5EJ7A 2F3RA 1LKZA 3N8NA 4H4DA 5DP2A 4ATNA 2XO7A 4DLKA 4X7RA 1UDWA 1GAQA 2L2QA 1XQWA 3IC5A 3RGWS 1KMMA 1KO5A 3IHWA 3H2GA 3IXQA 5COBA 2DRIA 3ME5A 2BBWA 2EHJA 4L8LA 4FKBA 3O5AA 3ROQA 4B40A 1K1SA 4D3YA 5FWYA 3RE1A 4O3SA 1EDBA 3H1TA 1E3DA 2W43A 1RWOA 4CF7A 4DA4A 2OV6A 5E4JA 1B7GO 4H6VA 4Q9JA 1LK0A 1OKKA 2C8KA 5HNKA 1Z06A 4OPMA 1EFVA 1LDEA 4H0FA 4RX1A 3ZTWA 5L3QB 2D1QA 4HGOA 4MROA 2W9CB 1ZQKA 2QP4A 1YU6A 5DK6A 4ZD6A 4A2QA 4E21A 4NKRA 1XWIA 2VDWA 4O3OA 2R3SA 3R2JA 4HTAA 4TL9A 7ICKA 3T6KA 1P5HA 3S1SA 1G1MA 4BLWA 4HUJA 3TCNA 3UWKA 1N2ZA 1BYUA 3P8ZA 2XCPA 2QZZA 9MHTA 3BK1A 5JVDB 1A7KA 1K1QA 2J09A 4G2NA 3ZI0A 4D80A 6YASA 3JR7A 4EYHB 4NNOA 1M7GA 4PXYA 4U9IS 4M21A 5JPCA 1AMUA 1U11A 4RH1A 2OUIA 5C81A 4C7XA 2WKWA 1HDCA 1Q16A 3H4IA 4AQDA 3MBIA 1I13A 2QS9A 3UXYA 3N75A 1G3UA 2O2HA 1U45A 3GVCA 3HDGA 4UZFA 2Z2XA 5EE9A 4KVAA 4DL6A 3ZV6A 5FYDA 5LYJB 3VR0A 3LVWA 1ODLA 3NOXA 1XEFA 2WJPA 4JGGA 3IAM6 2XKBA 3KKZA 3HUDA 1NAIA 1A71A 5D46A 2BEKA 4BO6A 4YCLA 3TSWA 4HO1X 2B8EA 5AKYA 1ATZA 4QPPA 4C0SA 4B31A 2FMIA 4FFNA 2R6FA 3P9SA 3D3WA 3E9CA 3G0GA 2VIXA 2FSPA 1CY1A 3SAFA 4I4IA 1CZOA 4INZA 1S5LU 2J9FA 5EKUA 1WBJB 4LRSB 4Q45A 2PUGA 2XBLA 3SK0A 5C8DA 3OCWA 4HVAA 2AU0A 1NZDA 4UDXX 5ICFA 4JXKA 2ZQ5A 4DQ0A 5F78A 1I6WA 1RJ9B 1JIIA 3AP3A 3LQYA 4X8MA 1CPYA 4BFVA 5B12A 5EHXA 3ZGVA 1F1JA 3CLHA 4LHYA 4BO2A 2OC9A 2R8IA 3BA6A 2OHVA 3H2ZA 1EWYA 4G1FA 1TX4B 4EQ6B 3NXSA 4PNZA 1DOHA 1W0JD 4HGNA 2B4YA 3QOFA 3O3NB 1E8NA 2CVFA 3L7BA 4PZNA 1D1SA 8ICUA 4F93B 1IHUA 2V65A 4AJEA 5JFTA 3KWLA 3OT1B 5EYPB 1VCOA 2VDVE 3FVQA 3M7DA 2ZTHA 5ALRA 4J16C 3KOWA 4AQ7A 4WNYA 3B9QA 3CUSA 4OQQA 3FOEC 1SUIA 2HCJB 4FHDA 1OCEA 4L3WA 1W87A 2WB2A 1V8DA 1GTRA 2ZI3A 4RTOA 5ITZA 2KSOB 3Q8PB 1E2NA 1EWTA 4B17A 5GOZA 2LCIA 1PLJA 2C5FA 4C8LA 2G25A 1J2RA 2NQ8A 1GSOA 5FO0A 3T7JA 1WF6A 1XMOB 3OBBA 4UATA 2JW5A 2AG8A 5J5VA 1WDMA 1G6Q1 2FN3A 2WD9A 3Q0TA 4H59A 1CT9A 1K8XB 1CETA 1OYOA 1HEKA 2C28A 1IY8A 1X92A 2IPXA 4MMXB 5EESA 3R40A 3R3JA 1EUYA 3PFGA 1N3BA 5F2NA 4UM9D 4UVGA 3EMDA 5AJVB 1NBHA 5EWMB 5BV1A 1EWQA 4CI0B 1GYQA 3TSOA 1YS9A 3DP9A 2A1IA 1FP1D 1DG9A 2ODWA 1JA0A 3H97A 9ICTA 3CX7A 3ORHA 4L50A 1SCUA 2YZKA 2DMRA 4D8TA 4JL8A 2EBFX 2NSYA 5E7MA 1H3NA 2VDRB 5G41A 5HZGA 1CUZA 1MO4A 2XHEA 3OCYA 4KN6A 1ZH8A 4Y1GA 4XEHA 2HEIA 4G89A 3W2HA 3SICE 4DV0B 3N39C 1JKMA 2EJWA 4CQMA 2GYWA 2HHWA 3ABSB 1E2LA 1Z8FA 1W49A 5B66U 1GD1O 4YASA 4S05A 5H4GA 4R1LA 3PV0A 2A78A 3QF4A 4WOJA 1F8GA 2GWSA 2OHXA 3DTNA 4TMZA 5IVKA 1NSFA 1CDZA 4RBNA 1YRQA 3G5MA 3VBCA 5A1TA 1D8YA 4UEOA 1AD2A 1EAMA 3G9ZA 5FJJA 1G66A 5EJ2A 2AJQA 2Y0EA 1NJ5A 3KEOA 3PUYA 4I8IA 1JAXA 1RWPA 3RVMA 2B20A 2WTNA 3C87A 3HU5A 2G5PA 3QLJA 1MQ9A 2D7DA 2GDZA 5KU1A 1ZEJA 3V2UA 3SSOA 3ZX5A 4BV2A 1MXFA 5F51A 2JFGA 3Q9LA 3N9IA 3O4RA 4MJLA 4CMEA 3DKRA 1SU4A 1YA4A 4PIPA 4ZOEA 3U13A 3EXEB 4KYVA 3TMAA 5JUWA 5EJ8A 3AO0B 4Y2YA 1MRNA 2NPIA 1K9SA 3ORRA 2FAXA 5EWLB 4CEHA 3TRDA 2E1PA 2G1JA 3NEPX 4JLUA 4WK6A 3WISA 4G0XA 1GFIA 2C2RA 3B2NA 3CGWA 3DXZA 3MT8A 4QTUB 4BOYA 3IIIA 5AYVA 1KO7A 1IIRA 1M6VB 1SA0B 4D81A 3SJAA 4V1CB 2CLOB 3BWDD 3Q98A 1QTNA 1NWHA 2UYGA 4UUPA 4MX8A 4PQRA 4M55A 4H77A 4O5AA 4P4NA 5JARA 2FZKA 3WK7A 4PSCA 4NZOA 2W0MA 2YFYA 1F9AA 4KQJA 4BMZA 4KX5A 3K70B 3U4IA 3ACDA 1JEYA 5ALJA 3R9KA 1JE1A 1V5FA 3H2SA 1LXCA 1B23P 3UUWA 4C7BA 1D04A 2H1VA 4KYTA 4ZQCB 5KL1B 1QJCA 1CF9A 5KJFA 2HH9A 3KLOA 4G23A 1V9PA 4R7GA 4AIIA 3GUUA 4D5EA 3BIXA 3KQKA 2A1TR 5FULA 2Z5FA 3O4IA 3VVMA 2XT0A 2J87A 1RHQA 2O7RA 5EHZA 1EUQA 3LECA 1EWKA 2Y1DA 3D7MA 1UBCA 5KYYA 3CNBA 3KFLA 4QXQA 1EDOA 2OB1A 4RTSA 1TLLA 3GJ6A 1W4ZA 4WEOA 1TKDA 1Y1PA 2FN4A 3KB6A 5ECYA 4HVCA 3RAFC 4MO9A 1IEXA 4V38A 2X2EA 6PFKA 3GRFA 4JYZA 1KVRA 3DBLB 2P5YA 2IPLA 1O6ZA 1AB6A 1PYDA 1ZNQO 2BGKA 4HDRA 4RMIA 5GOTA 3RBVA 1T1SA 4BNUA 1MO6A 3OZGA 4D8WA 4WY2A 4D9NA 2CN1A 2Q6IA 1JMYA 2OCPA 3LDHA 4TTRA 3ROPA 3TJMA 4LISA 1W85A 3UANA 1KEKA 1FDUA 1Z6ZA 1VQ1A 5TLSA 3PGXA 4PHPA 1KH2A 1DPFA 1BQ4A 3AP2A 2OXIA 3IP1A 4RF5A 4W5RA 1YVEI 3KE9A 3UC5A 2X6TA 3PPWA 3OE1A 4E5PA 1XJCA 1IMJA 2Z1MA 2YJZA 2D1SA 3KNZA 3PUIA 4C0QC 9ICAA 2AXQA 3DO8A 1JHRA 1O95D 3HFRA 3F2VA 5FORA 4CF3A 4NYJR 1BAPA 2KIVA 2NYRA 4KQ6A 5FEMA 5BYAA 4JBYA 4GI2A 1ECBA 3IQFA 4HN2A 1Z0AA 1QZ3A 3FDZB 4J2TA 1GG5A 1L5QA 4Y6OA 3TFWA 3WWDA 4QQFA 2F77X 1B6SA 2E4XA 2HSDA 2O8NA 3NO4A 5AI6A 3O8OB 3UJHA 3RABA 1RCUA 3O26A 1CUUA 3DZCA 3OCCA 5BSWA 3U3JA 1LB2B 1DAEA 2CDAA 3PGLA 4Q1VA 3GAFA 3TZKA 3FTNA 4CKYA 3C3BA 2ZJ6A 1MUUA 4DLZA 5KQLA 5LP6F 1OXKB 3OETA 3OEHD 3A1SA 5KTQA 3E9NA 4LE2A 1YF3A 1XGKA 4PGHA 4XLZA 1TJ4A 3PNCA 3ZOKA 2PSJA 3H84A 3NHLA 1SCIA 5IFLA 5LR6A 2DWPA 3WQQA 1N0WA 3FWHA 5ESWA 3PJRA 3BDAA 1RHMA 1HRDA 3VSAA 5HUJA 3QE9Y 1G60A 4ZO8A 1KDOA 3TPFA 4ALIA 1U9JA 3BWYA 5ICSA 3ESAA 1NMSA 4YV0A 1NASA 3JTMA 3L7OA 1B6RA 1G21B 3HWSA 4IV8A 4KXWA 1QOQB 4LYAA 5LUBA 3VR6H 4E6PA 1KYQA 1CYEA 4EA9A 1G5TA 3GFVA 1SZCA 4URWR 2D62A 3ZLVA 3E2MA 4E32A 4F1WA 3UFBA 4X62B 4IGEA 1DWQA 2C9BA 3QOWA 1JQKA 4WNAA 4R41A 4ZVLA 1K5PA 1YZTA 3F53A 1G38A 3UMCA 3LPMA 5FOWA 1IZ0A 3G1WA 1DKOA 2WEKA 3DPIA 3M6LA 1U90A 5IILA 1XNHA 3OC0A 5EP4A 5A7FA 2YVQA 4CKBA 3IVXA 3WNZA 4R8LA 3B13B 1IIBA 1IXSB 4L9SA 1G4AE 1HFJA 5BV2P 2GK3A 3C3MA 3O1IC 2BH9A 1GITA 2JIQA 5LWHA 2W2KB 1JR3D 1O9BA 4HMQA 2AK2A 1KDVA 2QN2A 4YP0A 4KYUA 4AC9A 4AG3A 3F9CA 1QR2A 1UPCA 3FZNA 4G4JA 3TQTA 1FYDA 2KX7A 2GR9A 5FHRA 3STWA 3PHLA 1U5CA 4MW0A 5DHFA 1K5DA 3JQPA 1Z1BA 2F48A 1MN8A 3NT5A 1LPAB 1TD9A 2AK3A 2O9JA 4TMVA 5A62A 3CXRA 1GA4A 1NF3A 4AZ3A 2DAPA 1VHQA 1Z18A 1N77A 5B58C 2FW1A 3EEFA 5AVXA 4BFZA 2H65A 4BCCA 3A58B 1VLJA 2RK6A 3DPSA 2BGIA 4M0DA 4UPVA 2DKZA 1ZM2A 5TQ2A 2ZJBA 1DIBA 1FCJA 4HOYA 1GDHA 3V4VB 3NVYA 5J2TA 2E5LB 5AXDA 4CE6A 2V8OA 3RYHB 4MGYR 4NL9A 4CLRB 3UJ3X 2J4CA 2RGBA 5FUXA 5FNZA 1QS0A 3M2PA 4OGLA 2AH5A 3A1EA 4OQEA 2KFZA 4U5QA 1Y33E 4WOKA 3DTYA 1BPYA 3PEEA 1KTIA 4HSGA 1U0TA 1UDAA 3BGOS 3EIUA 3H19A 4IYJA 4K1XA 4PBTA 5TNXA 2IY9A 1DG1G 5C8ZA 1PNVA 3MOIA 4NBRA 3T1TA 2Q29A 3NIBA 3H5OA 3ZU5A 4D99A 1W47A 4O3FA 2AOXA 4TV9F 1NW9B 1DIAA 4GPEA 3KYDB 1M75A 4C7OA 1ECGA 1FUEA 4X93A 1IG0A 1GU0A 1E2FA 1C8LA 1WWKA 1G0OA 1QR6A 2PKQP 3N76A 4TYMA 2PYDA 3ADBA 3RRBA 4ZVSA 2HF8A 5KT3A 2YV5A 3IO5A 4KN5A 3BG5A 1DRJA 4CKZA 2JLZA 3RJJA 4KLGA 2QP3A 3NWOA 4I55F 5MHTA 1TQ8A 5DHSA 1GL3A 1EFUA 4N7JA 5IZ4A 4TURA 1YC5A 4QOEA 3E15A 1Y7IA 3UW1A 1GZDA 2C4TA 3GUYA 2BJHA 3GNTA 4XPZA 2C88A 3UXNA 1JQEA 4F8EA 2PUCA 1II9A 4Q3BA 4OJNA 5J43A 1OTXA 1YQUA 5JJKA 2P3LA 3BFVA 1FU4A 1PS9A 4DLTA 3ZWCA 1CP2A 1U31A 1ZQ1A 2QTTA 3U60B 4IDCA 1N2CE 3HTXA 2E4WA 4X20A 1F5NA 3NTVA 3NC4A 4W9NC 1G8MA 2F1JA 2N42A 1YASA 3IIKA 1U94A 3R3ZA 5CRIA 2C3UA 1CY0A 4RNNA 1N61A 1J7JA 2OO5C 3RHSA 4DCPA 2QJOA 1N2JA 3QHAA 4YS6A 4DBZA 2JLVA 4QIWC 1J9ZA 2OCEA 4X64B 4ZEXA 2PNJA 2QX4A 3RKUA 4O2LA 3AUTA 1SUPA 4QDKA 1PL6A 2XZPA 4E94A 3DM9B 2HT6A 4YK7A 2PR2A 4ZDJA 3A1TA 3DZHA 4YXWD 3C3JA 3BXGA 3LGXA 5FWXB 1YL6A 4I4TF 1ADFA 4K9OA 3AQFA 3EVTA 4EHBA 2HEGA 1E3MA 3RJMA 4JC5A 2QLTA 3K0SA 1E6EA 4P32A 5J0PA 1JNXX 1KZ4A 2OZKA 1IHXA 1YB4A 3IO3A 4BYGA 5F2KA 4XWWA 4IJMA 1UM9A 2QTZA 4MI6A 3B36A 2VSYA 4DJDC 2EBUA 3KSRA 3O1LA 3HRDD 3REQB 3CH5A 4WZBE 3M6ZA 2NUPB 5DB7A 2P9ZA 2WFZA 4OKNA 2WM3A 3FYUC 1VOTA 3QEBZ 2FEXA 2UXDB 3AXTA 1XG5A 2DQZA 2GNOA 1R37A 4XTCS 1RXVA 3JQGB 3VH2A 2ZPAA 5ALUA 5AUQA 1T91A 3QYPA 5B5SA 5IAAA 1F60A 1D2AA 1Y8CA 3CVWA 1WEKA 3EIEA 3FSJX 3M9NB 1MAUA 1ZCBA 3AL3A 2ZBEA 2JATA 3SQLA 3P27A 3TWOA 1T24A 3FNFA 5I7FA 4LBWA 1JSRA 5CT6A 5C0YA 3I62A 1AA9A 1FOEB 3FOWA 2NZYA 4NBLA 2O7VA 3AHGA 2PX4A 1GSIA 5B1SA 4YAOA 5GJCA 1JSXA 4LJ7A 1RYSA 1ZQMA 4F21A 4IL6U 2PGIA 3DHEA 4HX5A 1Z36A 3SQWA 2GH1A 2YL2A 3SAHA 1OMOA 4OX9B 3OVMA 1NN5A 1EX7A 2AT1A 5TGDA 3RUIA 1NXTA 2H4YA 2YV1A 3DD1A 2DBRA 4M8KA 1OTYA 1RP7A 2ZRMA 1GZ5A 2B8JA 2HVIA 1ZUIA 1EWRA 1C1DB 3U4DA 2XOKA 3V34A 1XF9A 2WAMA 4GSYA 4IMJB 1RC8A 4GWKA 1LSSA 3LXMA 5BQOA 6REQA 2WYWA 1IBMB 5AI0A 2WSBA 3HNRA 5ALYA 4ZVQA 2G40A 3OJEA 3UXEA 1FMFA 4NR0A 4B8ZA 1AJEA 3KDPA 3Q2IA 4BNLA 4J9VA 2HXSA 1BHQ1 1D5CA 3C3PA 5JLAA 1EMDA 4BTLA 4RJKA 5KWJA 4H15A 3KZNA 4N82A 1H2HA 2VHEA 2VRWA 3FHJA 1I0LA 1MAHA 2D3WA 3LBYA 1GTJ1 5TPWA 1S8FA 5KQRA 5LOVA 1X80B 2X8BA 2POCA 5JU6A 4HNAA 2AR7A 1T4BA 3ITNA 4PW0A 2ZCVA 5HJEA 1ISRA 1WPRA 4RD1A 1PV1A 4XYEA 3VJRA 3K9GA 2OCDA 1E69A 1Q14A 3UAVA 3A28A 4QJ4A 2LUOA 4DM7A 1DK2A 5AHRA 4B4OA 2BFBA 2CL6X 3PW4A 3UK0A 2DVMA 2N1MA 4B4DA 1KY3A 3Q2KA 4WLEA 3DO6A 3FFBA 5DM70 2A1JA 4ENVA 4OBEA 2MHCA 5LQMA 1VKZA 3BRCA 5I45A 3RFTA 4LYJA 2XZLA 3A1FA 4TSRA 1QHGA 1Z34A 4QGHA 5TR9A 4DUZB 4AMGA 1MMFB 2E5WA 2X5XA 3ZW9A 2KD1A 4B3DA 4YDSA 3BD9A 1Q1NA 3K05A 4HXYA 4M04A 2EXXA 4UB5A 2NXJA 2JKVA 4N4AA 2H3QA 4EYEA 1ZQRA 1L5GB 2HHTA 1HTTA 5FUWA 2RLTA 4JV0A 1DBWA 1Q3HA 3PRYA 1PUXA 1FFAA 2O2IA 4KLCA 1X7XB 4LYDA 3ZWNA 3EGVA 3QEOA 3ZKWB 1RI1A 3GLIE 1DAHA 2EL9A 3E9ZA 3QELA 2YVLA 3IMCA 4S1WA 4BUCA 5JAPA 2HYDA 3JVDA 5JDCC 4BGIA 2G07A 4MIKA 4REOA 2J7PA 3DVSX 2WFMA 4WCVA 4RGVA 3MFIA 3AEXA 3K6JA 3AI2A 3G0BA 4BVKA 1Y7PA 2LKDA 4UE2A 1YDEA 3HWWA 1PAUA 5C7LO 4G24A 2ZG6A 4I50B 4DNXA 3UY4A 4ZVOA 3C5EA 2P11A 3BK7A 3IA2A 2H92A 5HRCA 2JH8A 2P1DA 2XWJI 3TDNA 5D7NA 1YULA 5FOXA 2ALZA 3A4IA 3AEUA 4DUGA 5CEJA 3EFOA 3ICPA 4Q9AA 3PYLA 4OG2A 1T2CA 4S0XA 4PQYA 2XTAA 2OM2A 3RVNA 1C0EA 1N6PA 1YVDA 5FV4A 3WK5A 5LDDC 1B0ZA 4FC6A 3WWOA 1ZESA 1YQEA 3VH3A 5CM9C 1GTSA 5CMLA 1E2PA 1VJCA 4RHCA 5T8KC 4RIHA 2JAUA 3NUZA 3W3AH 4K9RA 2F8KA 1KZ9A 2CW5A 4B45A 2W2TA 1D0VA 2QRVB 3OBIA 3AXSA 3E3AA 5K3DA 3V33A 5DGIA 4F46A 3BE6A 5DNCA 1ZQPA 1U4OA 1G2OA 1UKZA 4I1VA 3TQCA 3PSTA 1EDEA 2F9MA 1EFAA 2FWMX 4B6JA 2BW0A 2OBNA 2X8WA 2FW0A 3F4LA 5DHUA 4F38A 4JEHA 1U48A 2F8MA 2L0XA 2CV2A 1QRTA 3ABZA 4HWTA 4YWHA 4LCEA 1QH8B 2JJQA 2WP8J 4ELUA 4GPBA 4CCWA 1VKOA 3JD3A 3D0RA 2Z0MA 3C43A 4IL5A 3DLBA 1SUDA 1Q0QA 1YZGA 1UJCA 1JI0A 4UHEA 4NWIA 1ZPDA 1R15A 1Z4MA 2ECOA 3EWSA 4HRAA 1YAJA 4Q37A 4WPGA 5I9MA 4UAZA 5JDIC 5KT5A 2P1RA 3BSFA