2YY6A

Crystal structure of the phosphoglycolate phosphatase from aquifex aeolicus vf5
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
MRVILFDLDGTLIDSAKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVYTKPYPEIPYTLEALKSKGFKLAVVSNKLEELSKKILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDFTLSRPSDLVKLMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords phosphoglycolate phosphatase
publication title Crystal Structure of the phosphoglycolate phosphatase from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2yy6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yy6A01
1O03A 2FPUA 4HGPA 4EX6A 2I34A 4C4SA 1CR6A 1L6RA 4UAUA 4Y2TA 1S2OA 2WF6A 3FPSA 4NAVA 4UM5A 4UMDA 2CN1A 3UMBA 2GFHA 3KC2A 4UU0A 1Z4MA 2Q4TA 2I6XA 5AM0A 5IT4A 3A1CA 2YFYA 1NF2A 3QXGA 3AR9A 3E81A 1U7OA 2AUTA 1L7MA 4OD0A 5ALQA 5ALTA 3EPRA 1Z4NA 4JDPA 3WK7A 1L7NA 4GXTA 4XE5A 2GMWA 4CF3A 3KD3A 3KBBA 3EF0A 2YMQA 1J97A 1K1EA 3OCYA 2YJ6A 5A3SA 2WF8A 4Y2XA 3DV9A 4YCNA 5AVWA 5A3QA 3PGVA 1TJ4A 5ALDA 3CNHA 5AVRA 4L6CA 2NYVA 4BKMA 4EZEA 1Z4JA 1S8OA 3OCWA 1O08A 4XQ0A 1T5SA 3ESQA 3NIWA 2O9JA 4Y2QA 2B30A 1Z4OA 3N07A 4EEKA 2OA0A 1JUDA 2NO4A 5AK4A 3N8GA 4RESA 3A1DA 4MWOA 5AW6A 5IT0A 1QQ7A 5AKJA 4OCZA 2ZBGA 3S6JA 4Y2YA 2I33A 1YMQA 2YMPA 3PGLA 2BDUA 4Y2PA 1RLOA 2EAUA 4OHFA 4Y3UA 3AR3A 2PQ0A 1N9KA 4BX0A 2B1QA 3QU7A 5ALLA 1ZRNA 3SMVA 5A3RA 4BBJA 5AESA 4NABA 5AVZA 3W5CA 2FI1A 3U7EB 2FPSA 3ZW7A 3MPOA 1Z4IA 2RBKA 3ET4A 5AW5A 3ZWKA 3B9BA 5AKXA 4YIHA 3ED5A 5AKIA 5ALSA 3U7FB 5E0OA 3VAYA 2C88A 5IS2A 5AKGA 5ALUA 5ALOA 3UMGA 3U7HB 2IYEA 3NANA 4UW9A 4YCMA 4HGRA 4BX2A 4XOUA 2HX1A 3AR4A 2YY6A 2B8EA 5ALJA 2G80A 5AM4A 3DDHA 2AMYA 3IJ5A 1RMYA 4O8CA 3NRJA 3I6BA 3B8EA 3KZXA 4HGNA 3QU4A 3NUQA 2YBDA 1NNLA 3K1ZA 2CFTA 5AW8A 2B0CA 4FE3A 2P9JA 2BY4A 5AK5A 2I55A 4IFTA 5ALWA 5AM2A 5FP0A 3L8GA 4EELA 4F72A 3ZTWA 1Y8AA 3BWVA 2B1RA 3EF1A 4G9BA 4BEVA 3WKCA 5JJBA 1J8DA 2WHEA 3OCVA 4YH1A 5AW1A 5AKYA 4FFDA 1XPJA 2JARA 3L1VA 4B6JA 5AKEA 3L0CA 2YMMA 1AQ6A 3R9KA 1TJ5A 1VJ5A 5ALZA 4OFZA 2R8EA 3SKYA 2JGAA 4JB3A 3ZVNA 2G06A 5AI6A 1L7OA 3QYPA 2HSZA 2FDRA 4BNDB 3ZI4A 2OBBA 3WKEA 3QLEA 1XP5A 2WM8A 4BNDA 2Q4RA 2I7DA 2EATA 3NAMA 1Z4KA 2IOHA 5ALMA 2PR7A 2QYHA 3E8MA 2BDEA 3QU2A 1Q91A 4UMEA 3OCUA 2RB5A 4ZEVA 4YIKA 1RKVA 2FPWA 3UMCA 2EARA 3OCXA 1YS9A 1SWWA 3FPBA 3ZTYA 2PKEA 4BX3A 2NO5A 4KX5A 4J2TA 5ALKA 5AW3A 2ZBEA 3L8HA 2IA5A 1CQZA 5AHXA 3N5KA 2MSNA 3QNMA 2ODAA 5AKLA 3IB6A 2G08A 3OCZA 3I76A 3AR5A 3DAOA 3WKAA 2FUCA 1RLTA 3WGVA 1PW5A 1QQ5A 3M9LA 3TLMA 3QX7A 2ZXEA 4KNWA 3QUBA 3PDWA 4DCCA 3QGMA 3RF6A 1ZD3A 4AP9A 1RQLA 5AKKA 2RARA 3DNPA 3W5BA 3W5AA 2B82A 4KYTA 3U26A 2WF9A 2GHQA 1U7PA 3WKDA 5AM5A 5ALGA 3B9RA 5ALFA 3N28A 1NRWA 2YN4A 1FEZA 2P69A 4XPZA 4YGYA 3NASA 4C4RA 5AVVA 4L6AA 1YDFA 3U13A 1SWVA 2VKQA 4J03A 2HF7A 3AR2A 1TA0A 3AR6A 3L8EA 5AI9A 1L7PA 2W43A 4PNHA 4UM7A 1WPGA 4DWOA 3CZ4A 1ZOLA 3ET5A 3M1YA 3N1UA 4UMFA 5AK3A 3KOOA 4H1WA 5AKHA 3SD7A 1TJ3A 4IG4A 1Z5GA 1ZS9A 2WF5A 3KDPA 2C8KA 1L8OA 3I28A 1KYTA 3PCTA 3ONNA 3ZVLA 3QUQA 2YJ3A 3WGUA 4UASA 5ALEA 3A3YA 3BA6A 2X4DA 4Y2JA 1RQNA 4UATA 2GO7A 1ZD2P 3SF0A 2D2VA 5ALPA 1WR8A 5AW4A 1QH9A 3FM9A 5AKZA 1VJRA 3I1YA 2HDOA 2CFSA 1LTQA 2C9MA 2P27A 2C4NA 2B8JA 3L1UA 2HCFA 3FGOA 1ZJJA 4MUMA 4Y2RA 4BEWA 5AW2A 4UMVA 1L8LA 5AIBA 2HF2A 2HOQA 3QUCA 2RAVA 1U02A 3R09A 3SKXA 3ZX4A 4UAVA 1WVIA 3U7GA 3ZX5A 2JAUA 2AH5A 5AW9A 3AR7A 3ZU6A 5AVQA 3OPXA 4Y2VA 4DW8A 4EENA 3RFUA 1N8NA 3WK8A 2GHTA 4KX3A 2JAOA 4L57A 1TE2A 3L7YA 3WK6A 5AI5A 3J7TA 1Q92A 4G63A 3MC1A 5ALYA 2YJ4A 4BYGA 2FUEA 1Z88A 1RKQA 1Z4PX 3L0BA 4NV0A 2ZBFA 4CF5A 3FZQA 5AVYA 2G07A 4EX7A 2IOFA 2R8ZA 1WZCA 3L0YA 4YCLA 2HHLA 3E58A 5AVTA 1T5TA 1U2TA 5AIAA 3WK4A 2HI0A 4QQFA 1ZD4A 1RLMA 4CE6A 3A1EA 4AS3A 1Z4LA 5AVSA 3L8FA 3HLTA 4HGOA 1ZD5A 2Q5EA 2QLTA 1RMTA 1SU4A 3E84A 4HAIA 4I9GA 1YJ5A 1ZRMA 1XVIA 3ZVMA 2O2XA 2R8YA 1VFPA 2FPXA 4GIBA 4UU1A 4NWIA 5AW0A 2I54A 2ZOSA 5ALIA 2G09A 5ALXA 1YV9A 3EWIA 4Y2UA 5T41A 1RMQA 5AICA 1QQ6A 4KN8A 2OM6A 1EK2A 2MU1A 3QUTA 4HGQA 1Z4QA 1RDFA 2IOFK 5ALRA 1X42A 1LVHA 2AGVA 5AK6A 2G0AA 3HYCA 3MN1A 4UARA 4HYTA 3WKBA 3GYGA 3F9RA 4E88A 3R4CA 5AVUA 2W11A 2FPRA 4KNVA 4FYPA 1F5SA 3P96A 2P11A 3ZUPA 3OTQA 3W5DA 5AM1A 2C8LA 1RRCA 3AR8A 5AW7A 4Y2SA 5AM3A 1U2SA 4CF4A 1RC8A 3WK9A 2WFAA 2FEAA 4ZEWA 1Z5UA 4AS2A 3D6JA 3SLRA 2R8XA 2W4MA 5ALHA 2MU2A 4I9FA 1YNSA 2CFRA 4F71A 1QYIA 3SHQA 3FVVA 3QU9A 3QU5A 5AVXA 3UM9A 1MH9A 4DFDA 3NALA 1T9ZA 2JAWA 1EK1A 4ZEXA 2ZBDA 2WF7A 4QJBA 5AI8A 2YMLA 3L5KA 5ALVA 3ESRA 3WK5A 1IWOA 2G1AA 2HEGA 1RKUA 2YJ5A 4RETA 2HO4A 2OYCA 2ZG6A 5AI0A 5ALNA 4CNQA 3IRUA 3U19A 1RPZA 3MMZA 3ZWDA 5AI4A 4C4TA 2DQSA 4NFLA
chains in the Genus database with same CATH superfamily
1U4SA 2AE2A 4MKIA 3ZD9A 1D2HA 1GFZA 1A4RA 3T1NA 4ZMSA 3WGKA 1VA4A 2C03A 4N5DA 3GLIB 5F2KA 9ICAA 4QOHA 3I92A 2PSSA 3DTYA 3M6UA 4Y2XA 3ZKWA 4EKIA 1YDHA 1IFXA 4TKLA 1N2GA 3TK1A 3L7KA 2ZJAA 4INPA 1Z4OA 1DAPA 3SGLA 3F9IA 1W36C 1KYXA 1A69A 3PUWA 5IM4A 1E7QA 3CURA 1GG8A 4AD8A 3AERA 1H4SA 3MINB 1A9RA 2J0QA 2B92A 3HFSA 5A5GA 4LPSA 2FA9A 3ZDFA 3R77A 4MPDA 1BX1A 3FFAA 1QGED 4I5DA 3EW7A 4JHXA 4X1KA 3H1TA 5A4DA 4OYYA 2GK6A 2DUYA 3C7KA 1W46A 1C0EA 3IJ5A 1Y4SA 4Y18A 3PUYA 2IY8A 3RTBA 4B71A 4XGIA 2JIZA 3DR3A 4FE3A 1KFJB 2EBHX 1MXFA 2IYPA 4D99A 2E5SA 3M2TA 1W0CA 5GTIU 2R84A 2FWIA 4Q4JB 3VHLB 1FYVA 3C21A 4MP3A 4L5CA 4C0BA 3VX4A 5GMOA 1GFIA 3H4TA 2VHCA 1P2FA 2M6SA 4HDKB 4JUIA 1W0KD 1QP8A 1CY6A 4OJQA 1LWOA 3DZIA 4F2HA 5C35A 1L7AA 1YMVA 3NKFA 3OEEA 4QVGA 1RD4A 4J9QA 3M9XA 4N3AA 4RJIA 2F9LA 2PWZA 4M86A 1KJJA 3HPOA 4NLLA 1RCFA 2PXCA 8ICXA 3WLQA 4B9UA 1G8GA 3OQMA 3M3PA 1M0TA 2XDQA 5F64A 3UW3A 1QHYA 2H1IA 2P41A 1BEZA 4CM4A 4NV3A 4C0SA 3WL7A 1F20A 2XMPA 4R3WA 2KFZA 5CP2A 2I7VA 3AK4A 2PUHA 3E18A 3LTNC 1RWWA 4F1KA 5GINE 5FX2A 2KX7A 4JL5A 2FFQA 1YCHA 1NVGA 3NHZA 2I6QA 1RRGA 3C2LA 1JH9A 3OT5A 4JAVC 2WE8A 5TV2A 3GJSA 2A7QA 4KGZA 4ITUA 3ZCXA 9ICHA 1K8XB 3COWA 3EYWA 3VNUA 4IIBA 3KR2A 4Z53A 4IUDS 1FU7A 3HJFA 1D8YA 4HAZA 1P2DA 1UF9A 2X19A 5I47A 1FTYA 3BMQB 4OXRA 2GUWA 4YECA 4U4AA 4N54A 1UBNA 3WK6A 1R16A 1ISGA 3G8DA 4ECYA 4XQ9A 1F3OA 2CJWB 3GBSA 1Z4PX 3IAHA 5JNWA 3PQCA 3RE1A 4QHTA 2I5HA 1MIOA 3L6BA 1W2WB 4G24A 4NBLA 3OJCA 4GYKA 3G2LA 4CQJA 1NUSA 4F8YA 3JX9A 4MQMA 1UXJA 1K8QA 1V9CA 3SEFA 2ZBUA 4BATA 2GASA 3GI1A 4O4IA 4HH0A 4PSCA 2BH9A 4ND2A 1KI9A 3DVRX 1C4WA 5SYMA 4MYUA 4BQRA 3RNLA 3WP0A 1YH3A 4PAWA 3UGQA 3CS3A 3WYCA 1QDEA 3FSRA 3RH5A 2IYVA 2FPRA 4KRYA 2VHVA 1AG9A 2F3RA 3HO6A 1QS0B 5I9LA 3OC6A 3RS3A 5GADl 2OILA 3ZWWA 5I7OA 2Y93A 1Y6GA 1FFEA 1P9NA 2QTVA 4WUTA 4YPVA 3KQNA 3F5AA 1UFRA 1J4AA 3K09C 3K31A 4CDRA 3WQSB 3IHTA 3QQPA 4DB2A 1AUQA 1TF2A 5A1TA 5C0OE 5AJTA 4YMOA 3TRIA 1AHIA 5IJAA 3P52A 4CQMD 1MEJA 4X3CA 3WL8A 3OQVA 4RGVA 3VR6H 4TS3A 3IT2A 5CM8B 4FS1A 4HY3A 1B2LA 1MA3A 2JS7A 4EHIA 1OOEA 5EL0A 3ADOA 2DWQA 4XW2A 1P8JA 4CM9A 2W2KA 1AGXA 4C7XA 5CGQB 2PX5A 1Q0UA 3LZCA 1DQSA 1F0PA 4XGQA 2O5CA 1XRPA 4MO9A 1EWTA 1IZ7A 4ED2A 3CT6A 1VHDA 1G66A 1NV8A 1O95C 2IT1A 3KVRA 1SZJG 1PG0A 3L7OA 4RUCA 5EGSA 2B1QA 1WUHS 1E9RA 2JI9A 3F5FA 4ESEA 3COJA 1RXUA 4X1IA 4N0EA 2YVQA 1ZWKA 3W79A 1A5AB 3L7JA 4G2TA 3F98A 3NGXA 3MBYA 4TXLA 5E4YA 3K0CC 2GKOA 4P4NA 3ZHVA 1J8QA 2JI7A 2YW9A 5TS3A 2GKGA 1Q0PA 5KT6A 3LVVA 5J0YA 1NLUA 4UE3S 3IQWA 1Y4ZA 4UXHA 3Q41A 3V4PB 2VR1A 2XY7A 4ZOLF 3IUPA 4P0QB 5LQUA 3JQ7B 2WE7A 3EUFA 2HQ1A 1CQXA 4HB2A 3OTWA 1NVXQ 4JLUA 4U8HA 4CUZA 5E9AA 4C7VA 1OZGA 2V7TA 2QRQA 1RAGA 4PLZA 1V96A 4CKWA 4DLNA 3GEMA 1QIMA 2Q7XA 4OHBA 4G6ZA 2PFOA 3N2GB 5CT4A 2XCIA 3UUFA 4ENUA 4OK3A 2XWQA 2E48A 4WLFA 3FPAA 3VR0A 1NR1A 1I14A 3RJMA 1VPVA 1PTJA 3F74A 3HI6A 2GEUA 1PKXA 4XXHA 4MO2A 1U0NA 4F8JA 1NW8A 3G85A 4YN4A 5EQTA 5KT5A 3W4IA 1LDBA 2ZTLA 2F7SA 1EAMA 5LNK6 4LAFA 4DJJA 1E5DA 5ICFA 3B13B 4JI5B 4A23A 2AIRA 1SPXA 3AR2A 5FR1A 4TS9A 1HE3A 3NHBA 1SQ6A 3B8HA 4TVOA 5DNCA 1IJKA 3LHFA 3OM0A 1JJBA 2J5KA 7ICQA 5EJ5A 2P4UA 3TLGB 5HQJA 3KQKA 3FM9A 1DIGA 1KOGA 1W5BA 2B8JA 1DKQA 4V0OA 1A2QA 2H1SA 3PEYA 3NXKA 5AIBA 1UDAA 3GWGA 4X8LA 3NHUA 3BDAA 3T5JA 1V8PA 1XAGA 2RHHA 3U7GA 1EHCA 2YNMA 5FQOA 1RE0A 1X39A 1YVDA 4FDLA 2DUMA 1ZCFA 3SI7A 3HA7A 3G2NA 4O3QA 2VZLA 1JDZA 4DRZA 2KPOA 3EB9A 1G9TA 2H5IA 2ZI9A 3DNMA 4IVPA 1XZQA 3DA8A 1PV4A 3TRJA 4ZK6A 4LWZA 4B33A 3L8MA 4QT0A 4UJ5A 3TJZA 3KHTA 2Y66A 2DJ5A 1UZMA 1Z0IA 1ZPDA 2X0KA 2ZTEA 3OJLA 3OPYI 3ORFA 3GP3A 4A0SA 2XQIA 4XRHA 3UMVA 1PS0A 5A3JA 1P0CA 2OLEA 4X90A 2MU1A 1D0SA 2V3WA 1EX1A 3O1HB 2XRMA 5AK6A 3OO0A 5KCZA 5LBUA 4B79A 2HRCA 3N6RA 2X1VA 1FK8A 4KUEA 1W0JA 1AQUA 1TUGA 4CEJB 3IN5A 3U3XA 4TT8A 1HKHA 1LC3A 4Z5XA 1QF9A 4V02A 4LRWA 3ZV6A 2POCA 4OK6A 1K68A 2MUTA 4IDFA 5CM2Z 5GZ3A 4IDQA 4YYZA 5KX5A 3U4QB 1MQ2A 4Y9TA 4YJ3B 1JU9A 3AL2A 1RADA 2XJ9A 1U28A 2WJYA 3NEJA 1DJQA 1Y9EA 2LE0A 4P4GA 3CKMA 1NKBA 2B5OA 4XGRA 3U7RA 4LVNA 4RQ0A 5KQRA 1KYIA 4ZPJA 2W6IA 3GLIA 3A6ZA 2SKEA 4CGZA 2I3BA 2ZRJA 3AU2A 4Q82A 3O1LA 4PQRA 3H0MB 4C7BA 3CYMA 3C29A 3E7PA 3UGJA 4JBWA 2AC4A 3CW8X 4DJFC 4JK3A 4KXLA 4HZGA 1I7QB 1JB9A 2D0DA 4PC2A 4RCVA 5B7PA 2OVBA 4B3FX 2YWFA 2OHHA 2GCNA 1XNRB 4NNJA 5GVSA 2WICA 5JADA 1G2OA 2ESEA 4HLDA 4CMAA 4TV9B 4LZPA 4ER3A 4JXKA 1FUYB 1Z36A 1TO6A 5DW3A 2W00A 3BIJA 1XC9A 3MINA 3H7IA 1PEAA 1IJFA 3SC2A 5IUNC 4WBNF 1BOOA 4DV0B 5CNKA 4QVIA 4TXJA 1U49A 1XS9D 2ONYA 721PA 2QE7A 4MW7A 3CX8A 4F4CA 4YJ2B 4GC9A 2Z08A 3H11B 2RHWA 1JSXA 3IVCA 4YMHA 2QB1A 3A9CA 821PA 1P2UA 3L0IB 1ISSA 4O3PA 3K4GA 1YCGA 1VTKA 1ZW6A 1G0NA 2C9BA 3AOGA 1B0AA 4U2EA 3DE2X 2VCEA 1VHLA 2H1WA 1MH1A 2NU8B 4Q4JA 3P8ZA 4DEXA 3O21A 4UB3A 1GZ4A 3AJDA 5B58C 5HTOA 4HNUA 1XFAA 2RHJA 5KFYA 2QB0B 4C7KA 1U4OA 5J58A 4KLOA 3BHMA 1EP9A 4G5FA 3Q12A 1VL6A 1WULS 3QI2A 1SRQA 2PSDA 4HDKA 2F9FA 1YGYA 2PCLA 1E6EA 3WLJA 5EJ2A 4NDZA 4Q4HB 3ROGA 5HCUA 1CYDA 3RQSA 4I1PA 1VCHA 1AT1A 3BE5A 1IXRC 1DTEA 1U81A 1HORA 4H6XA 1MQSA 4JXJA 1Z25A 5AM5A 4I36A 2GRAA 1YVPA 1PUXA 3I1JA 2ZR0A 4MJLA 3EY4A 4F86A 1QKKA 1T36B 4G4IA 1JPVA 4JGIA 4UZFA 3SYLA 3IVXA 1PQPA 2WBLC 4MKXA 1DQYA 1JQJC 2HVHA 1Q21A 4B3IA 4S0XA 4ALKA 4U0JA 2Z6UA 1IH8A 3IEUA 4C2UA 4ANFA 3QXJA 1BEUB 4RHCA 3PNVA 1HDGO 4IQGA 1NJ1A 1WR8A 3M6XA 5TE9A 2HMTA 2NQ2C 1RAFA 3EXFB 2Z5VA 4NU8X 3C5WP 2ZE5A 4J4BA 1IZZA 4HEJA 4IJ5A 5JJIA 3NETA 1OGJA 3BMQA 3HBAA 5H3HA 2SKDA 5KOHB 1XGKA 2HQRA 2YB1A 1FIUA 4K9RA 1CKEA 1JR6A 4PICA 1MR3F 2DY1A 3ZZTA 2DHDA 2JCSA 3G0IA 4CTMA 5B3KA 1RZ3A 5DXFA 1ENZA 4RJLA 2NW6A 5BVHB 1U0JA 4HF7A 1EBUA 2GPYA 5FL3A 1VIAA 4C6RA 4XLLA 3JQ9A 3LVBA 5EQFA 3BJIC 1G4UR 2J4FA 1HDZA 5C81A 1PFYA 2WAMA 4EY8A 1U9JA 3DZGA 4WE3A 2ATVA 3V8MA 2XWJI 3JD3A 5BWLA 1QFSA 3PXDA 3TQQA 4HX5A 3R1IA 1E4EB 2COEA 2QU7A 2E4VA 2DFDA 1E89A 4LZWA 1N92A 4PHPA 4J7CA 1XRQA 3ECAA 1QS0A 4BU0A 1KP3A 3Q15C 4K2HA 4BZXA 1GSAA 4MV8A 4UDYX 3EGDB 4UNIA 1E2PA 2QX7A 2AWNA 1Q6ZA 5TMDA 2ZBPA 4QYIA 2VJNA 3ACCA 1G98A 1HZZA 2OYSA 3R2JA 5A71A 5EMJA 4XD2A 4YP1A 1M8KA 2KKVA 3IUNA 2ASVA 2WTMA 1J9GA 5JC8A 4LRSB 4D81A 1ONSA 4EX6A 2I34A 3OHAA 3RKRA 4UM5A 4WY5A 5K2MA 4ECQA 1VI5A 2YFYA 2Y0CA 1JRLA 1Y5LA 1LLFA 4D7AA 3NC1C 4JDPA 4LJ5A 5EXXA 2DETA 1OH8A 1KZ1A 3P20A 3BBPA 2FFAA 4MINA 3CJTA 4BP1A 1IULA 3MWDB 2CYAA 4N5LA 5FOXA 1T8EA 5JHGB 1WD5A 2QQ5A 2JIZD 5CBPB 4P86A 4YCAA 2HMUA 4Q7KA 3AM1A 4AP6A 3GDHA 5IW8A 5KU7A 2PMZF 2Y1CA 4K4HA 2OV3A 3C3MA 2Q28A 4YROA 5KNDA 4KG7A 2J0EA 1BQ3A 3D8RA 3C97A 2C88A 3PLNA 5FB3A 4OBEA 3ND8A 1EM6A 5K6RA 4OHKA 4DREA 3L92A 1QGAA 1DOHA 1OMOA 3NRJA 3E9EA 1DPGA 2EF1A 4I6JA 2O8BA 5BSKA 1RZUA 3L7IA 3TZKA 4HNGA 3KTOA 4ZC8A 1BGXT 4P0QA 4PC7A 3JQ7A 1ZRSA 1YIOA 1HC7A 3KPJA 4X71A 3FNRA 4CDMA 3GCDA 3NR2A 1C3XA 3I0ZA 3ZQKA 4D45A 2HLHA 4I1SA 1L7EA 3RJFA 4QRIA 2VH5R 1T94A 2FXVA 1SKMA 3B1YA 1AQ6A 3ZHOA 4L4XA 5EE5B 3CPHA 2OLJA 5CA0B 4B4WA 1KEPA 1P0PA 2RGYA 4FB5A 1DAFA 2Y6UA 2WABA 5KFWA 2RB5A 3T5BA 5JYBA 3N2GA 1B23P 2B7BA 3HPRA 2JCVA 2GAAA 2YOHA 3DBOB 3Q7TA 1TZ2A 2PUWA 2WTXA 4IXDA 3IVGA 2XLCA 4W5RA 3U60B 4LZZA 5EUQB 4WKOA 4FNAA 2IWRA 4PX9A 4BHTA 2YFHA 2ZP1A 1ZLXA 3ZXXA 4CLEA 1R10A 4F46A 4CL8A 3BL6A 1YDFA 4LYFA 4I29A 5CW2A 1YRLA 1D5WA 1LBHA 2C2BA 5FDFA 3NP7A 2F3QA 3RH6A 3TSWA 4IHJF 5C1IA 4IILA 1S96A 1TZMA 5E95A 2I3GA 3T54A 1XQYA 4P54A 3PJDA 2IHUA 4K28A 1L6NA 3TLAA 3IP3A 2JD0A 2NVUB 2AF4C 3TLGA 3BPSA 4B2LA 4XI9A 4MUMA 3DP9A 1U02A 4GHWA 1C20A 1SCBA 1MQ9A 4TMWA 3DXXA 3FKSA 4OHPA 4EB8A 5CXQA 1M54A 2P5SA 3PJFA 4F04A 4G0PA 5KTYA 2WIBA 3G6KA 4W5NA 1XZIA 3BIFA 2R8ZA 2XADA 2JZOA 4M0FA 2HHLA 1XDGA 3G0OA 2VHJA 4BB0A 4RQ8A 4RTJA 2XB4A 3PMNA 4ZN6A 3ISDA 4FBUA 3G6WA 3V97A 3FVWA 2I3DA 3V1TC 4D79A 3E84A 1IPEA 1ZICA 4J0GA 1NAHA 4YYEA 3SR4A 2DGDA 4JVMA 4HWGA 4RHEA 1F8XA 2G09A 4M1ZA 3PWTA 5FULA 3RR2A 2GPSA 4LYEA 3RG8A 2V4RA 3SR0A 1WU7A 5CHGA 2ZU6A 4M88A 4GOXA 3RIEA 4QAQA 2CMFA 2IUSA 4XUSA 4Y0VA 2E87A 2PKCA 2XUHA 2EZXA 2FQXA 3A0RB 4G09A 3FCCA 3DWGA 4CEJA 4CM9D 3ASUA 2BGJA 2B1IA 1DG9A 4MTCA 2QPLA 2F17A 5DIFA 2JEGA 2GPAA 5T3UA 2C97A 3GGSA 2M6KA 1MRSA 3PQ8A 3U4QA 2I2CA 1RJGA 4FN5A 2AJQA 3QVSA 4QOIA 4YJ3A 4GMDA 3G68A 3KU1A 3LH5A 3CUUA 5LDHA 2Q6OA 2W54A 3KSAC 1DCTA 4BV9A 5JANA 4X5OA 4F38A 3IIKA 3UICA 3GMSA 2TECE 3X1YA 1KJNA 5JT1A 3KOWA 3T7JA 1SL1A 3V9AA 1PJQA 3AUFA 1DIHA 4JKOA 2WSSA 5C5CA 1N5XA 2FKNA 3INGA 1R5JA 3BFXA 3KYCA 3EF0A 1LLUA 3DVSX 1MA0A 4IMRA 1FMFA 3M6IA 3ETJA 5F9NA 1ORIA 2JHAA 2P9QA 3DE3X 1GADO 1MGOA 3ZDDA 2G77B 3MTGA 4Z4CA 1I36A 1NVBA 3B9JA 4PPXA 3BRWD 1GFWA 4BMYA 1JS1X 4J0IA 4PSDA 3P9XA 5JXHA 1ZQBA 1BJKA 4N18A 4FCTA 3KLPX 4PO9A 3JVUA 2NO7A 2VDJA 4I3HA 4AF8A 2A86A 4OI0A 4ED0A 2FJPA 1JIXA 4JA0A 3EK2A 5C8ZA 3QRWA 4JR0A 3WJ7A 1MF7A 3LFUA 4YJ2A 3HR4A 1LEHA 1IY9A 1M0EA 3THXB 2B0CA 3HCEA 1NU8A 3EC2A 5LA6B 1E0JA 4G9BA 2RH9B 1GCOA 5H4GA 4Z54A 5JXGA 3F1LA 2R11A 4JVSB 1M2NA 1O6ZA 3R8CA 3F8WA 1PCXA 4P6VF 3FPJA 1XZGA 3R20A 5HTKA 2O2ZA 2QB0A 3HCNA 4MCJA 3BYZA 1JJVA 2F1KA 4GECA 3WLMA 1M1YB 2QAJA 1BMDA 2YZNA 8MHTA 2R9VA 3NH9A 5D3MB 1U9IC 3HJRA 4RYDA 4Q4HA 2Z09A 2WPNA 3H1PA 3U1VA 1TJPB 3C8UA 3ZWPA 5JZVA 4DMUB 6REQB 3OECA 1YRWA 3ZCSA 1PFVA 1NF8A 2DPIA 4W5OA 2EP8A 5HIAA 5JZOA 5AUPB 4P2GA 3C98A 5K8UA 3LFTA 4YCCA 1FFYA 2VT3A 4DSNA 2IHTA 4DL4A 2WOJA 5FTKA 1WXHA 5FJJA 4DSAA 2XWSA 5IUJC 1CQJA 1H66A 4MKRA 5DCYA 1DK3A 4L7VA 5LOVB 2UDPA 4LEIA 3EQ2A 2ERCA 4RKWA 1EFKA 4EY3A 3A28A 2C4TA 1YMUA 4S0ZA 4M53A 2D59A 1LJ8A 3IHLA 5I48A 2QENA 3EXFA 1Z56C 4MRMA 3UJ7A 3AU8A 3CTPA 2CUZA 1J8VA 3NX4A 1RWKA 2Y0PA 5KOHA 5EHQA 3ICCA 4O2BF 1JJAA 1W0JD 3TQCA 2G9NA 3F2VA 4D6PA 1ZI8A 4UFOA 4DQ0A 3DVQX 3HFGA 1MG5A 3CISA 1A96A 3HJEA 2QTHA 2CXNA 5BVHA 4S1PA 1JZQA 2ZDGA 3DUWA 3HLTA 1K97A 2BBSA 5H81A 5T4FA 2EL7A 2QV7A 5K05A 1OFIA 1GA4A 1N9GB 1MLDA 3GIMA 5JU5A 1EK2A 3KT0A 3IBGA 2WKPA 3RYIA 3WLPA 2XWBF 2H3QA 4TN5A 5KTTA 4KQKA 3RUPA 3A6PC 3PR5B 4MS1A 4DFMA 4OKSA 1E4EA 2W6ID 1NRIA 2I8CA 3VR2A 3IJEB 3OJXA 1HFEL 5TXGA 4WXYB 1JG6A 3G89A 2P9GA 2IXBA 4BWFB 1AO0A 3QVUA 3NALA 4PSKA 4TLDA 2EAPA 4G0XA 3MQ4A 2IY7A 4P82A 3HU2A 1ZJMA 2HEGA 3VR1A 2BR0A 2VRBA 5D85A 3FUUA 1NLFA 5AP9A 1EUDB 5IFKA 3EBPA 4B82A 4AB1A 3R74A 3GOQA 3ZE6A 5L51A 3OMWA 4JT8A 5KAPA 4ESHA 3P0EA 1APBA 4RZ3A 1V6CA 2QVGA 2IP2A 4KHPB 5JMTA 1O1YA 1R3UA 1KQ3A 3C6ZA 2O3UA 3IOCA 1NVMB 2BKLA 4B45A 1P7CA 2YXLA 3DT8A 5ISMA 2IEDA 1J97A 2QE7D 2H54A 4N5HX 5JDIA 4ZVPA 4B6PA 2I78A 3LYUA 4X85A 4DLVA 1ULZA 4G9EA 4XCQA 1HFKA 2J3HA 3K16A 5FADA 1YVUA 1A9XA 1UH5A 4UBBA 4MFFA 3DAYA 3MWDA 1HM5A 3FY4A 4L78A 4PONA 1OX5A 3PR4A 1J20A 3KHRA 2OQVA 3M9MB 2CNDA 3L01A 5CBPA 4IJVA 3EEYA 4TN1A 1V3TA 5B1IA 4NE9A 2RQ5A 1NI3A 4BQEA 3LT2A 3NXSA 3GGGA 4NEQA 2XDQB 2GILA 2ZJ6A 4RQBA 5JHHB 4CM4B 2V0CA 5AKGA 5CFNA 1IAVA 3UAVA 1XWIA 1UPFA 1K1QA 3D8TA 4OLAA 2J9FB 5KTQA 3GH1A 3KQQA 2RHRA 3L6UA 1I2ZA 4Z9XA 2R85A 5GIOE 4G1BA 1RRFA 3DV0B 3HV2A 4P1ZA 8ICTA 2P6OA 4DNPA 4EI2A 3L6EA 3LK7A 4B73A 4LI3X 3WKCA 1N6HA 1RTKA 3NT4A 1KEVA 1XPOA 3HY6A 1MAWA 2Q5OA 3DB2A 3ZNQA 1KVQA 2D1QA 3L79A 1B0UA 5CA0A 4JJAA 4N8EA 4Z3OA 4L8VA 3WICA 4YR3A 4JVOA 5TQ0A 1ST3A 4MVJA 1MJFA 2F8KA 2BF7A 3ZGNA 4WLUA 4O1MA 4JC0A 1RYHA 2C59A 3TTXA 4FCVA 7GPBA 1IN1A 5EIHA 3N05A 1M9NA 3C4VA 3DC7A 1RQ2A 1L3CA 5JS2A 1VYTA 4OI4A 4GGPA 3HU3A 3E7WA 4AIIA 2Y2UA 1ZD3A 2ECKA 2IX9A 5HRCA 2HHJA 1Y4AE 4OXYA 4MQLA 3VPSA 3IPCA 3DKRA 2UVUA 2ZRIA 3WKDA 2A1TS 1K8RA 2VUHB 4UOQA 2OV4A 1Q50A 3VJLA 4PAQA 1OHHA 1F6DA 2ZITA 4X00A 3AI7A 7MHTA 4BO6A 2ASJA 5E3HA 3F6RA 3ILYA 3ESBA 3K6JA 3EBOA 4BJ6A 2EH9A 3LDGA 3LZDA 2ODQA 2ADFA 4OH7A 5C53B 4DSTA 2NVUA 1D9FA 5A7GA 4KMMA 4HLQB 3UPUA 3FN4A 3LYAA 1E8MA 2EV9A 2XUDA 1XMOB 3HL4A 5AVQA 1HWYA 1V97A 3I2JA 1SK8A 2AHOB 4C2BA 4Q3KA 5CVUA 3WX0A 2AOUB 3CMCO 1VMKA 5CT6A 2IYXA 1WWUA 3DXFA 4GGMX 2MWMA 2EGUA 2OGTA 1Y7LA 1P0MA 2FFHA 1NSTA 1LDEA 5G4LA 2P9EA 4ER0A 4ECTA 2AG6A 4DCGA 3WYDA 3ZVMA 1EFTA 2HMYB 2VJAA 2HL6A 5DWQA 1NJ5A 1FBNA 1QH8B 5AICA 3MGAA 1MEEA 2ZI4A 2IH4A 1E9EA 2HA4A 1NQVA 2R7LA 3VVLA 5F3DA 4LHXA 2HHCA 1ETHA 3INRA 1KAEA 2MIIA 4X1IB 1XJ0A 4RA6A 2HNBA 1JU4A 3KVYA 1WLSA 1Q44A 4DF4A 5L4LA 1IHUA 2ZIZA 4S04A 1N5RA 3RUEA 5FA5A 1DE0A 3ZUGA 3SX4A 5CH5A 4LY9A 4UTXA 2YOFA 3LBIA 5LB4A 4URXR 2DC1A 4KLSA 3UB2A 4UAUA 4Y2TA 3LXUX 5B30A 4B6QA 3W3AA 3LF1A 1TK5A 2OTCA 3LJKA 2NV3A 4PRKA 5A5FA 2IHNA 5DHPA 1P6XA 2FMPA 1RFLA 3NU1A 1LW6E 2CHGA 4BFSA 1U8XX 2FK7A 1LJUA 2YYYA 1YBHA 3W6NA 2P9FA 3TPCA 1T2FA 1T43A 4HC4A 3P4UA 5BN4B 1YSCA 4DO9A 5DN9A 3OX2A 2QMUA 4FTWA 3HRIA 1C41A 1XV5A 3OQJA 3PT9A 3OQHA 1JVNA 4X7PA 1UT8A 5IN4A 1P0QA 1FU8A 1QK4A 3NHRA 3TQHA 1T1IA 3OMXA 4ZVNA 3OQPA 3QX8A 5FTLA 4YASA 1CDZA 1UJBA 10MHA 1ED1A 1MX5A 2DUWA 1B93A 3TJMA 3CBGA 2ZJ3A 4QICA 3D8SA 4Q47A 2R47A 1NP6A 3WMFA 1DOZA 8OHMA 3VJKA 3D0RA 1IJEA 3EHDA 3Q4GA 4FBMA 4HVTA 1EAYA 2IZOA 2R1TA 4LJLA 4DTIA 2PGIA 2PK3A 4M04A 1TZCA 2R6DA 3KYIB 3THXA 2YCLA 4YUXA 1NN0A 5LA6A 4Q66C 1LS1A 1N8SA 1C81A 1JYSA 5B4UA 1VC2A 2I2DA 4BMXA 3MXOA 3V4FA 5IUKC 1VG9B 3G6YA 5CCXA 2BEUB 2QLNA 1GU0A 1QVRA 5CM9C 3JWJA 2NZ2A 3E15A 2CLKB 4JWNA 4QBIA 5SV2A 1LPSA 1M1YA 1TADA 4P4LA 1LVUA 1K7YA 5D3MA 2H0RA 3T9BA 4UAZA 3HCFA 1BDMA 2IPNA 2V9WA 4BLOA 1NBME 1C50A 2ZAMA 1XMQB 1C29B 2FSHA 6REQA 1EVQA 5K8TA 1I0IA 4M55A 3FKSD 4IYJA 2FLKA 3ROQA 3OM1A 4BUZA 2B6NA 3O9VA 5HR5A 3SEIA 3A3NA 3TSOA 4FT2A 5B2ZA 3AQ4A 1JDPA 4RVSA 2I91A 4PNHA 1ADGA 5TC4A 1XA3A 4XVHA 2HBMA 2XXAA 2C8KA 4UU7A 3PUJA 5I6DA 3K96A 1P7WA 5LOVA 4KLJA 1VDZA 1R6DA 4ID3A 3JPOA 3QKSA 1OLXB 2JR5A 5IINA 4IH9A 5J5AA 3GN1A 1L5SA 4G0WA 5CFPA 4HDOB 1DK2A 3SSAA 4MYSA 3OLQA 3NFRA 4FINA 3PWKA 1I2MA 4QYTA 4NCAA 1NK7A 4L8WB 4NV0A 4IDNA 2WNIA 3QFTA 5EJFA 2YWJA 1YL7A 1U6KA 1H93A 1JAYA 3UT5A 1PVDA 3G0BA 1ZITA 3NC0C 1XU9A 5AXBA 2H2GA 3WIOA 3AHGA 3BG5A 1VCOA 5P8WA 5CDFE 1BC5A 3X2EA 3GJ3A 1E1NA 2UKDA 1LSSA 2IK8A 3IXLA 4P34A 1VECA 3V80A 4L0QA 5CLHA 1N9GA 3VXKA 3VKGA 1N0IA 4QDXA 2R4UA 2WLTA 5FLXA 4EI9A 2PFSA 3OLCX 4ZDWA 2Y9UA 5EEHA 3TFSA 4HQRA 2Q49A 3SC2B 4DV3B 1RAEA 2WSSD 3ISJA 3FHJA 3GJ5A 3V32A 5I9SA 3UJ3X 1RWQA 4TUQA 3VTAA 3WWDA 3TAPA 1W73A 4BZZA 4R2WA 3U9TA 4EHDA 2FZGA 1NUPA 3RANA 2BJVA 1HUQA 2X8LA 4EB0A 1GGKA 3OSPA 4QEZA 3VM6A 3RWOA 3QXCA 5EMLA 2VZEA 2XTNA 1G8JA 3Q6IA 1EUDA 4OQYA 2YUTA 2Q1XA 4DCVA 4NFLA 4J90A 3FXAA 1CUCA 2X7XA 4YDSA 3G17A 5F7XA 3LQ1A 2OXRA 4O0LA 1JHUA 1G6Q1 2H3VA 1KKLA 4LZLA 4AMGA 4FSHA 2ZEJA 1UC5B 2W7TA 4A92A 2O8DB 4M0PA 1RXVA 3AFOA 2VWHA 1TRHA 3QW4B 3B1FA 1W9MA 1AKEA 5AVRA 2JFZA 4JI7B 1V7QA 4WLVA 1P17A 2O5EA 3UPQA 1KI1A 2E0IA 3OJSA 1RYEA 5DPMA 4C43A 2QF7A 1R6XA 3Q3IA 4BGVA 2VATA 4YP9A 1IOZA 1PRYA 2GJ4A 2XB9A 1T2VA 1YRYE 1ZOPA 3NHAA 4LJ6A 3LU1A 4MLDA 4YI3A 4HYQA 1U31A 4O3RA 3UUWA 3NVDA 3RREA 2AJDA 2IODA 4UW9A 3VBEA 5JYEA 2WJZB 4RU9A 8ICOA 2OWEA 4H2DA 4LG1A 2P6RA 4H15A 2J9FA 1BXKA 4HGNA 1EDEA 1B16A 1PI3A 4EVQA 3DV0A 1OXBB 4ACBA 4DOCA 3MB8A 1X7WB 4K3VA 5E8JA 1R0SA 2ZSUA 3GROA 4PZNA 1KQGA 4BNHA 2ZREA 4J0EA 3IS3A 2FEKA 1CHNA 2LKCA 3D3KA 3S68A 4YNBA 4CRWB 2DM6A 4JB3A 4YLEA 3BK7A 2JI8A 4YBRA 2FSPA 2FN3A 3QW2A 4WDRA 4IIJB 1UIMA 3DHYA 2MJLA 3QFRA 4M46A 1HUZA 3U81A 3IL2A 2YC2C 3SQNA 2KIWA 1YS9A 2WWRA 3A9TA 2P67A 5M04A 2A94A 1AS3A 3FUVA 5EN4A 4PIVA 3CX7A 2QTWB 2YXNA 4NHEA 3SG0A 1NQ5A 1HK7A 3N2YA 4YCSA 4BFLA 4EY6A 3GJ6A 4TUYF 3CJQA 4RK6A 1CR0A 2FMTA 3OHSX 1GL7A 3V4SA 3G0DA 4D43A 3USZA 3L07A 1D1SA 2QD3A 2VHTA 1L5FA 4L6AA 4X63A 2B4KA 4HZUB 1GTMA 5KJ6A 5JAPA 5CJ2A 4DA8A 4UMFA 3EIHA 3OZBA 1TJ3A 3GEGA 4IF4A 3Q7QA 5BNIA 1U63A 2QPAA 2ZB8A 3EZ6A 3KSZO 4QYIB 4B4DA 2IEZA 1T5IA 5REQA 2HTEA 3T9AA 4V0LA 4ZO6A 1GU7A 2ZTMA 1QGYA 1UZUA 5D5HA 4J3NA 3FRHA 2OYRA 4ZU6X 1QF7A 4F8RA 1CETA 2AHOA 3PC8C 4XOIA 1H6BA 2YFQA 4DIBA 4F9TA 2XNSA 2AOUA 1IB6A 3JPRA 2VPPA 5KG2A 4U6SA 5JD4A 4X45A 3O5AA 2XHZA 3LK9A 1CUZA 2IIQA 2CXPA 5BN5A 4FZVA 3SHWA 2KMLA 4DOMA 2PSEA 1BFUA 2PD4A 5WRFA 4QSHA 2OO7A 3UFBA 4GZLA 3PUIA 5ALIA 2FMKA 1HYGA 2EW1A 4ERXA 4RVFA 1QH8A 1J9ZA 2IW3A 1K5GA 4ZICA 3QE9Y 4HQKA 1AZLA 1CXZA 2CXUA 4R8UA 3FJ1A 5DBFA 1V8DA 4KNVA 4NZOA 1NOKA 1RYMA 3STHA 4C08A 3BH7A 3NTLA 3X43A 4AKHA 3LHIA 5KAIU 4NCBA 5J4VA 1F9AA 4FQ8A 2H1VA 2XCQA 3C5HA 1ML4A 5C4GB 4Z7QB 1M83A 4M37A 4TL8A 3ANNA 1CSEE 1MX9A 4ENPA 2VK2A 1FS6A 1W29A 5AHRA 3R7NA 4OY3A 3H3XA 2O8BB 2GEFA 1P75A 2BKUA 1XU7A 1KLNA 2F2TA 4XDZA 3D5TA 4NBUA 4EVRA 3A10A 2B2CA 1F2VA 5EJ8A 3LL4A 3U6BA 3VR5D 3PRHA 5CCDA 5JCPA 4PZAA 1NJSA 4G65A 1GLVA 4U0KA 2FE4A 4QOSA 5ALQA 3LO5A 4RNOA 1NPDA 3UGTA 4M9CA 2VOEA 2F1JA 2W2QA 1MB2A 5A3SA 5ADUS 4C9BA 4WY8A 4E5MA 2RMKA 5BN4A 5DNWA 5YASA 1BE8A 2WG0A 2E49A 1PL8A 5HZMA 3G2OA 3GZJA 4OV6B 3CNNA 2W9MA 5C8XA 1VGRA 4A5OA 3AI1A 4BTVA 5AOBA 3TQTA 4REMA 1DQPA 1XXHE 3PGLA 1A8SA 2VXOA 2DULA 4JI1B 2GN2A 3M6WA 1DXSA 3RT1A 3DC2A 2UZ3A 3ZK8A 2L2QA 2Z2IA 1RHMA 2ZU0C 1D4OA 1IY1A 4YHHB 4NNOA 5DHSA 3PUVA 1L5GB 5I51A 2IYEA 4PG4A 5DNEA 4MVJD 5DNVA 4EUHA 2VANA 1HR0B 2BHTA 4NARA 1L5RA 4Q7QA 4AG3A 3PSTA 1MJNA 5LP6F 3KPVA 1KAOA 2BY4A 4MV7A 1U80A 1NXQA 1N6IA 4ZI5A 4BO5A 2AB0A 3Q6MA 4BYMA 5DYIA 3GMTA 4TXNA 2XCRB 2ZJFA 1KARA 1YT5A 5T8KA 4ZQIA 2LP4Y 4H0CA 3KYDB 3LE8A 2D0OB 1CJTC 2BEUA 3PXEA 1A0OA 1Y37A 3R0ZA 1P4RA 2ZJ5A 2XA9A 1N3YA 1XEXB 4KSBA 3KB1A 3F46A 1UFQA 1AXEA 4ARUA 4JQZA 1L3SA 5JW6A 5C34B 2AW5A 3O7WA 1UDXA 2UVVA 3EIUA 2X22A 1I5EA 4LX8A 1UFOA 4PBTA 2HA7A 3ZHXA 4ZJUA 1OREA 3FDJA 2WFZA 2XYQA 4MUXA 4E7OA 1YDEA 3VHRA 4ID9A 3LQ2A 4TXMA 1FUEA 3FMGA 1DKNA 2ZYTX 2X8JB 1WIWA 1KAQA 4ER5A 1FEZA 5H70A 5SYAA 4KWHA 1LX6A 3WBKA 4TX1A 3EXG2 2YQ4A 2OQIA 4B3JA 4U7JA 1ZQXA 2PL1A 3MR2A 3MUOA 3T5MA 4BX9A 4LHYA 3BK2A 3ORRA 2O14A 4WW0A 4RZHA 2H59A 3DW1X 3GMIA 3VZCA 4TV8B 2XE7A 3EZ5A 4L3OA 3OM8A 1Q0SA 2E3TA 3C74A 2YHIB 1L5ZA 3CLTC 2IYLD 4RHXA 1OLXA 4JVNA 5F4BA 4E94A 5AW9A 4LRUA 3EVEA 3II6X 2YXDA 4PX2A 4UBCA 3UATA 4N82A 3HB5X 4W8OA 5AI5A 2D6FA 2X9VA 5KFEA 1J39A 2C92A 4BYGA 3F6BX 4EGJA 2EWWA 3I64A 4KPFC 4G1EB 3PHHA 3TTTA 1S9DA 3R3JA 4O3SA 3DS8A 1N25A 3KYCB 5JAOA 3TL3A 1CNEA 4FMDF 3JPTA 5F1KA 2PMDA 4M99A 4IQUA 4GMHA 3C3CA 2R86A 4ZRDA 2Q3HA 1Z5PA 2QL6A 1WV0A 3IE2A 2ETVA 1QZUA 2AN5A 2HRBA 3KXLA 4C3UA 4EJ0A 3KO8A 1BKSB 2LIVA 1XPUA 4ALJA 5C5IA 2EDAA 3RU7A 2BRUC 4YAGA 1DC8A 3VR6A 4M98A 3NMUF 2DPHA 1CY0A 4JI3B 3EDOA 4WZAE 4JOBA 3IQGX 3DCIA 1U5AA 2ZJ1A 5J0SA 3I9MA 2PFNA 4LN1A 1E20A 2RHTA 3LV8A 1NXXA 4H18A 4QKQA 3R3WA 3HMKA 1GNQA 4LVCA 3HN7A 4GI5A 3TWOA 4D41A 4YFKA 4FGWA 3ZNOA 3I73A 2KSOB 2BQ3A 4Z0HO 5HK9A 1G64A 3GIIA 3GUYA 4Y30A 1KERA 1CJMA 3ZCUA 2P9YA 4DDMA 4WAUA 4Z1OA 1ZH8A 1V3VA 3ERCA 1X9GA 2Z9BA 1IU9A 4IWYA 2G8LA 1CG6A 4FB4A 3GJZA 1OF1A 1U2GC 3N0RA 4MHOA 4C3ZA 5JI3E 3TACB 2O8DA 5LN1A 3K9HA 4KTQA 2QR3A 2G6TA 3PFCA 1M76A 4XA8A 2GAJA 3WB2A 2RHFA 1YI0A 2WQ6A 2XEDA 4CQNA 1D2AA 1AUXA 2C8JA 3MHTA 3PDIB 3TW6A 3MPOA 4N12A 5ADHA 1EEHA 1CQJB 4H7JA 4QZEA 3DUFB 3LLVA 2J85A 1E6CA 3QQ5A 5MN4A 3DE5X 3FOEC 3K30A 4TTIA 2B4YA 3OZEA 3HXLA 2DHEA 5CDSA 1CV2A 3ZYCA 1ODJA 2H0AA 1H2FA 5LP1A 2PX3A 1QRTA 1Y8AA 3K2QA 4E07A 3ZDBA 1NV9A 2RHLA 1FDUA 1VMEA 4MRMB 1X7WA 3OCVA 3ND5A 1G2IA 4IOMA 1JQEA 1WS6A 4ZQHA 2JKZA 1A8HA 1DWUA 3AF3A 5AI6A 4PLWA 1O0CA 2JFQA 4MAAA 5GPBA 5E9QA 3TE7A 4IIJA 3G5AA 4B80A 4JV2A 2QG9A 5JNUA 3LOPA 4QREA 2PR7A 2QYHA 3QU2A 3UH1A 1ZD8A 4XSVA 3QK7A 5IYZF 1T9AA 4G56A 5CB4B 2C98A 3MF4A 2E6UX 4DZTA 5SZIA 2BELA 5KREA 4ECXA 4ISBA 2NTYC 2V0GA 2PX8A 5D6NA 1TCAA 3QUBA 2WJ4A 4DPMA 3PDWA 1JFVA 3HXPA 3W5BA 2W6ZA 3RYIB 2GSWA 2GXQA 2F1HA 1P4SA 3QY0A 3RADC 1Q8KA 3V3KA 3M5DA 4MS1B 1JBKA 2INGX 1KJWA 2A5LA 3QPBA 3SAFA 2JGKA 5DSXA 4HZUA 1Z2CA 1ZOLA 3F2CA 3WVNA 3ABZA 4RTPA 1P7DA 4IDHA 1EQUA 1H3FA 3BAZA 3ROXA 4ZCQA 4WEQA 4FWTA 2CKMA 2HEIA 3LUBA 1DXYA 3M1AA 4JVLA 3JTEA 1LK0A 3NIBA 4H17A 1DRWA 4IRKA 4PZZA 3DNFA 2ZJZA 3IEMA 4H27A 5GIPE 1FU4A 3AUJB 4QZGA 4DQSA 1MJHA 3VTFA 3UXOA 3RS2A 1ZN2A 4XVRA 2JLBA 1QNFA 1KZ4A 1UXGA 1Y3FE 5E6SB 3CVJA 4TMZA 2HJSA 2AOTB 2K4PA 4RMGA 5F7OA 1J2EA 1PJ8A 5DHUA 4K03A 3ZC3A 4OUKX 4Q9NA 1OXJA 2IOFA 3PUXA 2JATA 2QL5A 3WA7A 1YAHA 5BPCA 3TEMA 4QQFA 4BS9A 3RS9A 3MWGA 4MQ6A 1A9XB 4QODA 4DV4B 2GM9A 3ZY4A 1UFVA 2VDWB 5F9HA 3ENWA 1WHTB 3OPNA 3DDWA 2A0FA 3PSIA 2G1UA 3GUHA 4FKMA 3QI7A 1I7NA 4JJGA 1JQKA 2PLRA 2W11A 2LZ0A 3B51X 1PT7A 3ZUPA 3H1GA 2C8LA 4R65A 4PQEA 3LBNA 4Q48A 4HWPA 3TEFA 4OAQA 2LGJA 1YL6A 2BH2A 1FA9A 1YZLA 2ZSDA 3X1ZA 1RC0A 1O5IA 3UB3A 3T5DA 5IVKA 3RBVA 2XUAA 4ZYTA 2QD2A 2EFDB 1FQWA 2IUUA 1OC2A 1SCNE 1FZTA 5AXCA 4PV7A 1ZQAA 3OEED 2GNOA 3NWJA 2WQZA 4YP3A 1P44A 4TVKA 4AYBF 5HHHA 1THGA 3FTFA 3OQ6A 3WGIA 3W6ZA 2PZAA 2Y1KA 3D02A 2PKYX 4MXDA 3NOOA 3O3MB 1JL3A 1U11A 1HYHA 4BO9A 1Y6ZA 3E81A 4HN4B 5DTEA 2AMFA 1VIMA 2G36A 3JASB 5TQ0B 3ILXA 4IDEA 1P62B 5AVWA 2I6SA 1WDKA 2XD4A 5B6PA 3S8MA 2JJQA 3GDOA 4KLCA 3CRXA 3E0QA 5DZSA 2QTFA 2X4LA 5E8RA 1TEHA 2BUAA 3RARA 4JHLA 3DMTC 5LLDA 2HMAA 3TS1A 4MRNA 3HB7A 2ZBGA 3M0EA 3C3EA 1F1JA 5LQAA 2IPMA 1ODCA 3AVPA 1YZKA 4LJ9A 1DEHA 1U7DA 5B37A 3BH6A 2V1UA 3KJQA 3HU5A 1XMIA 2EDUA 4RPGA 4LCJA 1FFGA 1ACJA 4ZVVA 1A97A 1KL9A 3TOSA 4RFLA 1V5EA 4GLLA 3OLYA 4CMCA 1R8QA 4KXYA 1H2AS 1QHXA 1WZEA 2C5FA 3GAFA 5HF9A 5K4GA 2ISQA 3B1JA 1SXJE 4WK4B 3EULA 1D6MA 1JROA 1ST2A 4M0AA 3DZKA 3FJYA 2VAVA 1E8DA 4C88A 2BSAA 5KYKA 1GTRA 4IFTA 2FZ5A 3I3SR 3WGYA 1MG0A 1HQCA 4HRYA 5KPJA 4F93B 4HWRA 3KETA 1T4MA 3QYFA 3UMSA 1UWLA 4HXYA 1MJ5A 5HQ3B 3S7TA 3NUZA 3LS2A 1DKPA 2QSYA 1KN5A 4MW1A 1GKIA 2NZ8A 3UQYS 1E7WA 4L4RA 4IQVA 5BSHA 1PJTA 2VBCA 4ECAA 3KYDA 1T3HA 5KDDA 4NULA 1GA1A 2BC9A 2ORVA 2EBFX 5J2UF 1LGYA 2I2WA 3H97A 4DLXA 1XRLA 3Q5EA 1XEXA 3VOTA 4J9RA 5ENVA 4F2GA 1WRBA 3SAJA 4MJ3A 3FWKA 4KKVA 1ZCJA 1M1UA 2A0KA 1Z00B 2YZ2A 2ATCA 1ITZA 1ZK0A 4XWYA 1KA9H 2I7TA 4XDYA 1UOEA 3KP1A 1H9AA 4XPZA 2X8JA 1AS2A 3QZUA 2DFPA 3AINA 1I4WA 3KKLA 3WRWA 4RA6B 3PZPA 2IE0A 2OO5C 2DTXA 1EXNA 4K26A 1W85B 4QRHA 5AKHA 2IMWP 9ICSA 5IWAB 1KH2A 1R18A 1I33A 1UT6A 1GAQA 1KU0A 4QXOA 4FN4A 3DFUA 4WECA 3H0RB 1LLCA 1OYVA 4G85A 5KFQA 4TV8A 4NLZA 1P0IA 4S12A 4ENRA 3LG2A 2YHIA 3KDAA 1KRPA 2ZCVA 2Y0BA 1RC1A 4LC1A 1BS2A 1WXQA 1XZ8A 2PX6A 1TQ2A 1D7AA 4RY2A 2JIMA 4WESB 3VRHA 2EIXA 4QNMA 5LNK1 4DR2B 2A9OA 4CE6A 3V6HA 1MAUA 4C4AA 3BCRA 2Q3JA 1A71A 5THKA 4E3ZA 1SMKA 3GPLA 4L6IA 3TMKA 3TAUA 5FBWB 5ELMA 1TVAA 2C2KA 1U0LA 5HW0A 2QY9A 5EKSA 3I6QA 3LMKA 4OU4A 4B4KA 1SVSA 2OCAA 2W7OA 4BDPA 4CFSA 4DG8A 1JKMA 4R68A 3R4CA 3RRHA 3P96A 1GHTA 3U17A 4BLPA 4AXXA 1N6PA 3LQ4A 1ZIYA 2GYVA 1ZQLA 3CE9A 2H3ZA 4ZTZB 4DWJA 1MSWD 3KLOA 1Y8ZA 1MH9A 4HDMA 2R6CA 1QVWA 4HTAA 2Y77A 3L5KA 3JZDA 2RIPA 4KLNA 3BS4A 3Q2KA 3WMEA 3AHIA 2R1TB 4I50F 1PU2A 3G2JA 3UBTA 4ZTUB 2ZIUB 3UK6A 3IHKA 2WJAA 6YASA 2KSOA 2YASA 4HGPA 1CR6A 4UNPA 3GPBA 4O9MA 4AL4A 2OESA 4WGFA 1U2PA 3TQOA 3KQOA 4ZGBA 1JZSA 4WSOA 3I5YA 1RYRA 3KZ1E 1MW8X 2KVSA 4GX0A 3OCYA 2YJ6A 1MX3A 4LXUA 1JXEA 4FBGA 4PFSA 1XZCA 3EXAA 4CM7A 4ZOEA 1XD9A 1TM1E 2ZQZA 1A1SA 2AE1A 4KLLA 4UBOA 4DLGA 4LJAA 3V4LA 3L1KA 2P5UA 2NPIA 4KQ6A 3I12A 3PNOA 2YNMD 3JWPA 1QGUA 3PDIA 1FP1D 3ZWBA 3V1KA 4MB6A 1PK7A 3K6SB 4G8JA 4W1QA 1KEUA 4XJXA 2O3JA 5FCDA 3ID6C 4ED3A 1RM0A 2FQ1A 4TM8A 2XGMA 2XXAB 3DUFA 2XMDA 5AOAA 4FYVA 5B3AA 5CCEA 3CC8A 4IHQA 1DS6A 3AWIA 1SXGA 2NP6A 2O3RA 3HVIA 3AL3A 1JDBB 5L1IA 4BQSA 4V0KA 3QKSB 3ZTWA 3STYA 3RSZA 2VPQA 5CEHA 1ZQYA 4Q9KA 2IV2X 1Y5MA 2PTGA 4FFPA 4EL5A 2G7ZA 5KUTA 3NNSA 2V7EA 1RYSA 1WVGA 5GVRA 2FDRA 4UOEA 3EYZA 4INOA 1RWPA 3A27A 5AUNB 5DBIA 3UT5B 1XZJA 4NI5A 3GCZA 4WZBA 3HVRA 4IV8A 3N8NA 1M2WA 5SY9A 1EIWA 4ZJYA 1KE2A 1YRBA 2PJZA 1E2HA 5CB4A 1PZXA 3IHWA 5FL7A 5HS6A 5AVOA 1MD9A 3AZQA 2P9BA 4OQLA 1T35A 4CKBB 3L0OA 5LBTA 5JO0A 1N6LA 5JATA 4NV1A 1LPNA 1S2NA 1DTWA 3VYSB 3DLTA 5DB4A 2NV2B 4I9HA 2W6NA 1ZOOA 2VFAA 2NOAA 1Q1QA 3WGJA 2ZBQA 1J0DA 3PIIA 4QPZA 2X4DA 3DV2A 4V1CB 1S2LA 4POAA 3MPUA 4CKXA 1WP4A 3F97A 4R2MA 2F6RA 4Q3OA 4BEWA 2H00A 3M8RA 2YCBA 3GJRA 1BTOA 3UJBA 2H1LA 1S9FA 1E2NA 3KXKA 4Y2VA 4MVYA 3OG9A 5B64A 4U2FA 2W7PA 4ZT2A 3VR6D 1ZMXA 4XLZA 1KE1A 2PX0A 5J0WA 5E6SA 5FYDA 3PI6A 3MGIA 2HOFA 2CB9A 2X1LA 4O2AF 2OUIA 2PVPA 2AOTA 1PSZA 3T4UA 4A8JC 3N7SC 2NUPA 2I9KA 2CVPA 4K6FA 3M4YA 4DVJA 3NPMA 4H1TA 3QBDA 1Z4LA 4QZ8A 1J8FA 1GUAA 2WFMA 5AVSA 4TOIA 1I94B 2PRZA 1UJCA 1EDZA 4X91A 4IC9A 1NQAO 2X9LA 3IT1A 3UWPA 2VDWA 1SCIA 1PP4A 3NGLA 3S5JA 1NOJA 3AP1A 1WHTA 1YRHA 1DDOA 1UC9A 3I9NA 4EEXA 1VKJA 1IY8A 3Q9NA 2BT4A 4MQEB 1RRCA 3UMJA 1O8CA 1W1IA 5E3IA 3TI9A 3HYLA 3FNHA 5FNVF 2LBOA 4WOKA 2P9CA 5KHOC 2NXWA 4BVAA 1L4EA 4YXWA 5E1OA 1OW3B 3DLHA 4E6PA 1A9ZA 4PS1A 4YACA 5FFMA 5CA7A 1JIUA 1JFRA 2VOJA 2GWRA 1VRWA 1DCKA 3BCHA 4PGFA 4WL0A 1U0FA 1J8YF 1KVUA 2IDMA 7ICIA 2DQ4A 3H2KA 1AMOA 2EX1A 2JRZA 1PWEA 4C4TA 3MGGA 2OC9A 1W6RA 4EBDA 3LCJA 2WF6A 5HKKA 2CMHA 2E6KA 5EE1A 2F64A 4GPZA 2WTEA 1R6TA 1S2DA 3C41J 2QEQA 4LZGA 5B2FA 3T3OA 5BOMA 4YCBA 2D2EA 4ZEMA 1P6UA 2HPZA 1CVRA 4LMPA 3JASA 3CKLA 1WW3A 1XTIA 4IRUB 4AJ9A 1FP4B 3A06A 3S4YA 1UCVA 3MRXA 1QX3A 1WQ1R 2PLAA 3TB6A 4DIUA 3PV8A 4BO1A 4QXAA 1PUZA 2AZTA 1JG7A 4CU5A 5K8LA 3QHQA 3LT0A 3O73A 2IYFA 5DLFA 4EHJA 3HGTA 2QQGA 3UV7A 1DI0A 3TIVA 2E4YA 2JCXA 4DLAA 2FZKA 1LJLA 4FFMA 3HXKA 1Y9AA 2J1LA 3EC1A 5IEJA 4XYGA 5CYFA 3DM5A 1CWUA 1G2PA 1U4NA 1ZX1A 2ZWMA 3V6LA 3HZZA 1SM4A 1HA3A 5REQB 5AK5A 4OAPA 3G82C 2XTZA 1Z5OA 4IDPA 4B2YA 3RRJA 4PRLA 4WXHA 2CLSA 4PZEA 5HQ3A 4IIDA 4RK7A 3SJ7A 5ECWA 2I1QA 4YRCA 3OWHA 2OT3B 4DLBA 3W04A 3NIDB 2GK7A 2ANCA 2FZWA 5FBHA 2YWRA 3E9MA 1BH6A 4ZVTA 5D87A 5GM2A 5IDQA 5BN5B 2RH4A 2D0IA 2ZT8A 3AB3A 3IIIA 4H3SA 4PCLA 4J2TA 1RPNA 8ICQA 5K7SA 4D1YA 2OQRA 2OORC 3AR5A 1T6XA 4MR9B 4JJ6A 2VJCA 2H1HA 3F5SA 5DI3B 2MCFA 4F85A 3SSMA 2HJRA 3I4FA 1D4AA 5KI6A 1FSGA 1Z00A 2C61A 4R8UB 4M1KA 2FW1A 4N5IX 3TW8B 4LHSA 1NRWA 3FIJA 5KNCH 3PKZA 2E4ZA 3H9JA 3FVTA 5TQ2B 1B41A 1X87A 3AR6A 5KQLA 1E8NA 3DJYA 3CZ4A 1WZ2A 4GSLA 5JO9A 1GGNA 3BA1A 5J4KA 1W85A 3WLRA 3FSGA 3FYSA 3HJHA 4X61A 2PXAA 3RROA 3ZY3A 3RAEC 1HLGA 4IH1A 2X15A 1TTHA 2BN4A 1RNLA 1QRAA 2RGXA 3JD1A 5AVKA 1YZ3A 4BVGA 4DQKA 2HU8A 3BRSA 2JAUA 4GLBA 1YDGA 1VLVA 6PFKA 4R84A 3RW9A 4FZ5A 1M1XB 1DKRA 2H5EA 3ILHA 3RU9A 4M9SA 5JS6A 1U9LA 2DFKB 1R5NA 2W6PA 4OLBA 2XCAA 4IZHA 5BQPA 1YKGA 2VF8A 5KNDD 3WTCA 2VHZA 4WESA 4ZZ1A 1JDVA 2HI0A 1GITA 4UQGA 3NKLA 3BE4A 2VP6A 2O2CA 3ESCA 5INTA 5EWLA 3H5IA 1IG3A 4YJKA 3JD4A 4MUEA 4AICA 2BCQA 1IL0A 5JXWA 2D8CA 1HV8A 5ED4A 3UGKA 1JLKA 1XELA 1XNJA 3EFHA 1ESZA 4PG8A 3SEAA 2Q0QA 2PT6A 4TZ6A 5G41A 2K7ZA 4KXUA 1QBGA 1Z8HA 3HDHA 5JDCC 3G3EA 2YOGA 1F7VA 2W0SA 1LV7A 4H35A 4ZYUA 4KFRA 1P1CA 4HJXA 4OA8A 1WUTA 2IY9A 5IXSA 4M1EA 3FVVA 4EIWA 4H7HA 1T2AA 3B52X 1KETA 1ZR4A 2XCSB 2I5PO 2CMKA 4M83A 3QFFA 1X9HA 4AJIA 5CB8A 3KIPA 4PLCA 2FSGA 2CDNA 4GQIA 5BSRA 1NC3A 2CXXA 3MCUA 4KRGA 4PF1A 3VHQA 2CL5A 2Z56A 2ZIUA 3QUSA 1Z6GA 3E6AA 3OTHA 1K0FA 2NZWA 1W5SA 4RKQA 4IKEA 3D6AA 4FQ5A 5IAAA 3NFYA 4GP9A 5EMNA 4DL5A 4G37A 1T6NA 4JJ8A 2I6XA 4XWAA 3X2FA 5IT4A 4DNQA 4GPAA 1RM5A 1NN1A 3HCPA 3EPRA 3KZNA 1IDN1 2H4XA 4NOLA 2X86A 4URFA 2J5QA 1EZ4A 4QQKA 4PO3X 1VLMA 1J2YA 2DAPA 4I2BA 3D6HA 4D25A 2A3NA 4NFYA 1PWZA 2XRYA 1N57A 2VQ6A 2IOQA 3KQPA 3U49A 1H1DA 4Q9LA 3IODA 1IQPA 1KQQA 5F3WB 2VXYA 2QNRA 1OA0A 4I3GA 5ARDA 1T9DA 4RNMA 3UCEA 5CYOA 1IHOA 3H6HA 3CRMA 2VSQA 4FGLA 4BTLA 4F3KA 3NRBA 4IMPA 4LXYA 1SD2A 4EJMA 2R60A 2VT7A 4L5YA 1BD4A 4G0NA 1JJFA 5KWEA 4YT8A 5AW5A 2JK0A 1NVTA 5LYYA 3GJYA 1SQFA 3VAAA 2JPDA 3SBOA 3K6SA 1GA6A 2KP7A 3F7OA 3O0DA 3I6BA 3WRXA 5G0WA 1ORDA 4YR7A 1T9GS 3BT7A 1GCUA 3LC2O 4YP5A 3ZJ4A 3SS9X 4QVKA 4BNUA 4CLDA 4JC8A 4B35A 1Q11A 2IXAA 4C7YA 3D3WB 2G88A 4YH1A 5AFSA 2PY6A 4C76A 1B26A 5ABPA 5KT7A 1QORA 4BBZA 1O87A 4CV0A 1F2DA 5IASA 1L4UA 4MICA 1N3LA 1P9WA 3WYEA 2KD1A 3AIKA 1RG6A 3CUYA 2WLSA 3WWCA 3RSGA 4MDHA 4Q18A 1FYWA 1MC8A 1YB1A 2Y0DA 1XAIA 2PKXA 2DG2A 1PW5A 3LW7A 8ICLA 3KXIA 3LKDA 2DMRA 3IGFA 3ST7A 4HWKA 1G7RA 5BW5A 3NYIA 5KVAA 4CKBA 1KPIA 4GI3A 1OI3A 1VSUA 3KSRA 1D9XA 3MUEA 2ODWA 3A04A 4EB6A 1E92A 5IHPA 3MOSA 5AI9A 2QLLA 4KAAA 1JEOA 4EFDA 4B3MB 1Q0TA 1Y1SA 1TZJA 1QLWA 2RC5A 2RKBA 4DUZB 1KHTA 3ONDA 3DBRA 2DBQA 4RGYA 3C3WA 1TTPB 4NYMR 3LKVA 1NJGA 1R00A 4KIWA 4DCNA 1VLZA 4M2YA 4D4IA 3VI3B 4V1CA 7ICEA 1MW9X 1ZD9A 5CVTA 3WQQA 1NBHA 4L9SA 1R9JA 4CKYA 3F3MA 1T8YA 1GDHA 2HBRA 1MQ8B 4D4MA 4M8LA 2R0QC 2FUEA 2QJRA 4LYJA 1FFWA 3T5LA 3FHTA 1P2TA 3CZ9A 5DTRA 3L4SO 3O8NA 4YUWA 4PL2A 1KO5A 1WUKS 1J22A 3E3AA 1Z73A 2J6SA 3HCWA 4BFZA 2OCLA 1IRIA 3BMNB 5K8IA 1VPDA 1Z26A 2BTEA 1PJSA 3NO4A 2GPBA 4UVDA 3EEIA 2GJKA 2PUDA 3U4HA 4UOZA 4GX1A 3B89A 1VFNA 3L8DA 2RI0A 4OSOA 1I0ZA 1A8PA 4HVLA 5C8DA 3R8XA 4MQEA 4QGGA 4RHUA 5FBRB 2FVYA 2QIPA 1G6OA 2G04A 2UVWA 2ZRGA 1NUHA 4K87A 2YHAA 3W8EA 1ZQOA 2BTQB 3EAGA 1T9ZA 4KE6A 1Y1TA 3KOMA 1EHYA 5IVIA 3ADCA 1VBMA 4H1UA 4BO3A 5A9TA 1T24A 1FJXA 4GICA 4TLEA 2P40A 3KVOA 1TXGA 4BNKA 2OE2A 3CRNA 3T3PB 3IG5A 2F67A 2VUSA 1FTQA 4MLCA 1QKJA 3VGJA 2B4AA 3RJHA 2IYTA 3KXDA 4YCXA 1G21E 3NHWA 3GGOA 3HVJA 4UDOA 2WP8J 3JWGA 3FNQA 3IULA 3BBLA 4QZFA 1Y8QB 4L4UA 1OXKB 1AGPA 2XD9A 4MK4A 1E66A 1HQYE 4PLGA 1Y89A 1ZXLA 1KO7A 5HA5A 3ZWMA 3RC2A 4HWSA 4DQIA 3AM4A 1L5QA 2WKWA 1ZEMA 3HMQA 3DF7A 2A6PA 1LDGA 4DSOA 1FP4A 2LW7A 1FYXA 2ZYWX 3QEAZ 3N8IA 1M2GA 2GD6A 3BSYA 2ATLA 2OL4A 1CT9A 3QHPA 4IEEA 4AIRA 1VSBA 3V8QA 4KXXA 1FUKA 5GGXA 1J2RA 3ZWKA 1BAPA 2C4KA 4JWKA 1TTQB 2HU5A 3W0LB 2OBMA 1T3NA 3S0JA 3OF2A 3KEGA 4NPAA 4FW9A 3QMWA 1SVMA 5A4JA 1BVYF 3S99A 3CRQA 4L4YA 4QU5A 1NUUA 1K7FB 1A77A 2P9JA 1SUCA 4JOCA 1ZJNA 1AUPA 1ORHA 2HJVA 5FL7D 1GCAA 4C7MA 3JXEA 1S3IA 1YNOA 3OZRA 1ZQWA 4B9MA 5A3VA 1ZRHA 2RC6A 4RTOA 4G36A 5K01A 3I37X 4KQMA 3C45A 3UC5A 3G23A 4Z2AA 3RYCA 4IMIB 1THTA 4H4CA 4IO1A 5JLJA 3E82A 5CYPA 5DRYA 3VR2D 5I5EA 2YN0A 2EATA 3MJ4A 1M6EX 2I8AA 3B5EA 3W5IA 4RV5A 3HPQA 1Q91A 4XFKA 2PZBA 1RKVA 2VSYA 4TVSA 3IBTA 4IR9A 1EGVB 2KZ3A 5EJ9A 2BI4A 2BFEA 4RVDA 4BRZA 1G59A 2QMQA 3EPGA 4MR9A 3WNZA 8ICUA 5DI3A 3QKTA 4DRYA 3LYLA 3TL2A 5EKUA 2ICAA 3HXMA 3TW8A 3RS8A 1SHUX 1WMEA 4JELA 5CB6A 5TQ2A 2HT6A 2P2YA 1ZU5A 5FLYA 2WA1A 5ALEA 3I9JA 1E69A 2G9RA 4OOFA 2IH5A 2ATEA 4UUBA 3HO8A 3ZHBA 1L7BA 1PJBA 3FDIA 4F2RA 1U1CA 3T9EA 1FFSA 3RJ5A 3LCRA 5EIEA 1WXIA 3D1VA 4IW3B 2FJ0A 1ZUHA 4CKCB 3I4LA 3DMYA 1X1RA 4KRXA 5LVAA 2E5FA 4XCXA 4NU6A 2FW6A 2HK6A 2ECOA 1KSHA 5A7FA 4NY1A 4I7EA 4LE1A 4QECA 4BNNA 1SBZA 1IWBB 1FFDA 3JCZA 4HNQA 3FCOA 5CA1A 5AK0A 2YVLA 3GDGA 3F3SA 1YI8A 3OCJA 4O1HA 3OTOB 1ND6A 1PTJC 3WJAA 3ZCVA 4ZYZA 2HIGA 4CF6A 3T06B 2JFHA 1BVSA 2GEKA 5JZMA 4DS5A 1VL1A 3NBQA 3EYAA 5KJ1A 1RJEA 1FVXA 4I8XA 3KPYA 1WCV1 1X7DA 1CPYA 1V7CA 1XMPA 4D98A 5ICGA 4IBOA 3DO8A 3GJ4A 3MYRA 4XQCA 4RQMA 3U3MA 4MNTA 3SHFA 4I2IA 1I7PA 3GELA 4D5GA 3TQFA 4JV0A 4EF6A 4FVTA 1JMKC 2QJTA 1EK1A 4J76A 1W8IA 4JEUA 3JD2A 4EDHA 5IX8A 5A6VA 2DKXA 4RT2A 1LBSA 4TPKA 4M0KA 3HTXA 2CUTA 1N2ZA 1YFKA 6ABPA 2YXPX 1W1UA 1EFPA 4AG6A 2QRUA 3FTQA 1ZIOA 1R6BX 2XCTB 2QM7A 3FCYA 4B48A 3V8VA 2IQIA 3EAFA 3UMBA 5LM3A 5JNRA 1HDXA 2XZLA 3UZUA 1YWGO 1WZUA 2DWCA 1L5KA 3KJNA 1EVIA 5SY4A 2NYUA 2PL9A 3RDPA 1J49A 5H3LA 1RVV1 2KOBA 1OHHD 3EZFA 5B3JA 1G7SA 2AC7A 3AEUB 5EE9A 3UXNA 2JBAB 2I7CA 3BWDD 3C0KA 1NYLA 2FPKA 4CI0B 3BREA 3MWEA 3MRTA 3A1DA 3LBAA 5J0QA 1MN8A 2I33A 1ZWLA 2JB9A 4Y2PA 2MYTA 3UT0A 2SBTA 4KN5A 1IHYA 2PXHA 2J3JA 3MTIA 3VC1A 1XR3A 5DFAA 2G5PA 1IMOA 2VDPB 3NJRA 5E0OA 1IONA 2IEBA 2XCLA 4N3NA 4XOUA 4FUTA 4MS4B 4U9IS 1D2CA 5DGAA 1E3QA 3FCUB 2Q8NA 4ZEOA 1DHTA 3U4IA 4YR2A 2K4HA 4LDRA 2IDJA 4XX1A 1KQNA 2BL4A 3GLHE 4A10A 5JFTA 3NHJA 3ZN2A 1NE7A 1YGPA 4KPYA 1WAMA 1Z38A 2ACWA 4H31A 4GZ6A 3D3WA 4EAQA 4LZDA 5EJ7A 3FTDA 1DIBA 4IL5A 3NVWA 4JBLA 4HI0E 3KAJA 3ZD6A 3Q3HA 3SJBA 3ZJYA 2WJPA 2FVXA 1T8WA 2M6RA 4CQLB 4FDUA 1T1RA 4J9KA 4EPRA 3GPDG 4MZXA 1L6IA 2JFUA 1QRUA 2XOKA 2PKWA 3K6RA 1KRXA 2NZJA 3KOZA 5C1PA 2XTJA 1TK8A 4KX5A 2DHCA 1DC4A 3KR0A 1NNEA 1ZL2A 4K1XA 3NHFA 4XFDA 3WKAA 2JFFA 1HNWB 4XSHA 3O9MA 2E37A 1PVPA 4O33A 3RF6A 1FTSA 4K4IA 2CLDX 3LECA 3WO1A 2VNSA 4MFCA 1QCCA 3KD2A 3A6HA 4L3WA 1V7ZA 5TQVA 4G0MA 4R0NA 3W3AD 3GFQA 1SQGA 5I7RA 3A2MA 4PXYA 2O7NA 1GL6A 1PR2A 3OESA 3HBJA 4LOJA 3SD7A 3LNCA 4ZANA 4G4GA 3QUQA 4HDMB 4K7JA 4ETWA 4MJXA 1Z5ZA 1CZUA 5JALA 5A03A 3FYDA 2ZSJA 4LECA 1UP7A 3C7TA 3VU0A 2HDOA 4DDHA 3KKNA 5CJJA 2KZZA 1N2XA 2GGSA 2VZ0A 4CEHB 2B9EA 3WK8A 3MGVA 5IDXA 5C4IA 1OX6A 3EA0A 3P2JA 2RD2A 5DBGA 3H86A 4AZ3B 2QGZA 3HKBA 3PXUA 3MJHA 2PGJA 3B7GA 3BJZA 4MW0A 4N39A 4JFRA 3ZXSA 1NK5A 4I4TF 4EEYA 3ABIA 4YRKA 3GT4A 2RGCA 4KR6A 1F06A 1JF8A 4ON9A 5DGBA 5H4HA 3BMNA 2XO7A 3KOXA 3BXHA 5ALXA 1E2MA 3ELUA 1H2RS 2JAQA 2FV8A 2HUNA 5H2FU 3TBKA 3KQTA 1QGUB 1UAYA 1WKCA 1GQOA 3O95A 1BRMA 4NCIA 4BMNA 3TFRA 1U3DA 2IGBA 3FYHA 4IIVA 2MU2A 5CEJA 1AZWA 4HSGA 3TM4A 5AJZA 1RI5A 2BTQA 1ZI9A 1M0WA 4Y6GB 1NBEA 1QE3A 3OJOA 1IWOA 2IVFA 4D3FA 1GEGA 4ND8B 4WKCA 8ICAA 4NESA 3AQIA 4IIYA 4MW4A 3A14A 4DR6B 4R1QA 2WSMA 1DEXA 2VNHA 3D3NA 1T2CA 2FZEA 1BO6A 1IIBA 4U2BA 1KAGA 1PK3A 1NUTA 3DOOA 1ECLA 2QP9X 3EA5A 1R9MA 3TX6A 4EGFA 4Q1VA 2NU6B 1SGWA 3ZNPA 2R87A 3JTMA 3FETA 1Y8QA 3MFYA 3LY9A 3JQ9C 2BVNA 4DQLA 3TSYA 1QG0A 2HXYA 4WZBB 1LXCA 2OECA 4W5QA 1UBHS 2ODGA 2R5NA 1WUYA 5J5CA 1UAGA 5HVNA 1ZYQA 4RQTA 3RRZA 2XF8A 4O29A 3KKQA 3SS8A 4MVJG 1NRJB 2XT9A 5KWIA 1EVZA 4KLTA 2WV7A 3UMFA 3ZWCA 4BECA 3OZAA 1USIA 3DFFA 5B57C 4C87A 3AJAA 3EIFA 1HSOA 1DTWB 1E1KA 2ACKA 2G63A 4ESOA 4KQHA 2G4VA 3K32A 5I9IA 4GYYA 4IH4A 3HG7A 4JZYA 4HAUA 3G9XA 2DLCX 4RD4A 2WIFA 4GP7A 3U4CA 5FO0A 3OFVA 1T7PA 1V1JA 1KF0A 5DWDA 5DHRA 1QSGA 5FO1A 2WB1C 1O96B 3L82B 3CZCA 1T6BY 4N3BA 4B5KA 3O90A 4MAMA 3PUKA 3OZIA 3G8BA 3MT0A 3OOWA 5J2TB 4NM1A 4A8TA 1Q12A 4ED1A 1JAZA 2VK1A 1XRMA 3WADA 4FFDA 3UCXA 4I1VA 3FWYA 1XQ9A 4BQPA 4YRPA 5ED0A 1CP3A 1U5CA 4ELTA 5ETJA 3X44A 1D1PA 1NXOA 1J7KA 2NUPB 2EERA 5LQRA 5FA8A 3EPHA 3AX6A 3I09A 3HKZF 3VZRA 3Q10A 4WNAB 2ZVJA 1E4YA 5J2BA 2Y2VA 3KJGA 3IMKA 1RHQA 7ICLA 1CEEA 1Q57A 2KHZA 4HUQB 3C8HA 2VWGA 5HM6A 2UZAA 3ZKAA 1I7DA 3TLMA 5FPPA 1T5BA 2RAFA 4B6OA 3RAJA 4XUCA 1PWXA 4DNFA 5LDGA 4AN4A 4MGZR 3M82A 4K9QA 1D2EA 1DFIA 3F4BA 3PHCA 4GRIA 1LLQA 3QLVC 1O6BA 4R7TA 1C7EA 3K5WA 4AKEA 2YJ3A 2D13A 1PNOA 2Q4EA 2IU3A 1SG6A 1B6RA 3LYSA 1K3FA 4GOMD 4DLYA 1AB6A 1JG1A 1YCDA 5KO2A 1YBFA 1L4FA 1O54A 3DYIA 3QOWA 1YFLA 1RFGE 9ABPA 1ZQRA 4CKCA 5HKLA 4P4UA 4MP6A 3WSWA 4C2AA 2C7RA 3IP1A 4MUKA 1YXMA 1Y81A 1OFTA 4B3GA 2RCYA 4DLKA 4LF5B 1NVWQ 5A0VA 1XZHA 1P7ZA 3G2HA 2IKQA 1QU3A 3H8VA 3R3VA 1UMCB 1YD7A 3EDMA 3V72A 4HGOA 4PSVA 1FE8A 4MW5A 3F7MA 2ZJBA 1Q74A 3GFFA 4NCXA 2HXGA 4MUHA 1DQZA 1NBOA 4GYJA 4Y0AA 2YS6A 5THXA 5KG4A 3UK0A 2VXBA 3I5MA 2I4IA 2AKEA 1XMSA 1N3IA 3KZCA 3UWSA 3UMMA 4I5IA 5BNZA 3GRRA 2ONZA 2FN7A 5BV8A 3OBIA 1W4CA 3RC9A 2DZDA 2O7RA 2PLFA 2KYRA 3ZZUA 1P81A 1WEHA 1B4FA 3V46A 2V98A 2VHXA 1UQTA 2V7VA 1OU0A 5BXQC 3STXA 1J0XO 4L07A 2J3LA 3M6MD 5C37A 2HJ9A 1UA1A 2HYIC 1Q1AA 5DLYA 2EYQA 3CJRA 3C8ZA 2D7DA 5K3EA 3O92A 3F5DA 1EHIA 1GUYA 3K9GA 2QX9A 1SBYA 1KDZA 4P33A 3CSUA 1IIRA 3BWMA 2E5WA 2ET6A 2TSYB 3LC1O 5J2JA 2JHFA 4LOLA 2WJVA 1F8YA 4QUJA 4PCUA 3OLVA 2ENUA 5CHYA 3HBNA 2W6CX 1P0FA 2I2FA 2DKFA 2B78A 4UEKA 5K4AA 4RGBA 1CJCA 1KWKA 3I3OA 4D5EA 3DV9A 4GG1A 2AL7A 2GPTA 5HKOA 5H02A 3SLGA 3DHEA 5DE3A 3AEKB 3QX9A 3L3FX 3ODGA 3Q8SB 2R48A 3QKWA 3AEUA 1L2TA 4LUCA 2JBAA 4O5AA 2AJTA 4IGFA 2C2DA 3I2FA 1B8VA 2H5LA 1C9DB 2QTAA 5CVVA 2X6RA 4B7ZA 3L93A 3ELDA 3HA5A 3L7CA 4QQ8A 4KYIB 4HAXA 4ZALA 2AJBA 1ZMBA 3V4ZA 2F43B 2I2BA 3CSSA 1GXSB 2WWTA 4CPDA 4HAWA 3IESA 4KSCA 3M6KA 3GRKA 2B98A 1NKTA 4XB1A 1Z0FA 2QZJA 1UBCA 4MQ4A 1BHJA 4FEGA 3U3ZA 2AYXA 4MS4A 2HIMA 4AT1A 4HKTA 1U8ZA 1G7TA 4QFMA 1PW7A 1K0UA 4MP8A 3VDMA 2PT7A 2DH6A 2QVXX 1GTJ1 4BEVA 2C84A 3N8DA 4QTXA 4BGUA 5LQNA 1KK0A 1KC3A 3RYHB 1QRRA 3IV7A 3OIVA 4L1KA 3SKYA 4UNRA 4EF4A 4ED9A 4FI3F 1A88A 2ZRBA 1BH2A 1QHEA 1RPTA 2A58A 2QDXA 1L9XA 4CU2A 4CQLA 4DARA 2ZTUA 3FB4A 3UMCA 5T67A 3DT9A 1RRPA 2I66A 3EIEA 5EWLB 5L53A 3SWWA 4C5CA 5C1BA 3H4MA 5AKLA 4C78A 4LJYA 4IDDA 4WBNB 1C8VB 3VNSA 2E82A 2VDQB 5IWCA 3D6VA 4PLPA 4JL8A 2N1MA 4PR0A 3W1VA 1M2OB 5LD2B 1WYGA 1X1AA 1SWVA 1LDNA 5HQTA 5DU2A 1THZA 4YI5A 1P31A 3FA2A 3QMPA 4MRVA 4QASA 3TSZA 3SDSA 4LF7B 2A4MA 1UK7A 1ZD1A 3LCVB 3RPEA 2BZGA 1CEQA 3LPNA 3I53A 2QJOA 2EP5A 1CEXA 2A9KA 3JSXA 4F1JA 3OWXA 3FGOA 1U8EA 1UPHA 2JGFA 4JI6B 4CEHA 5ITWA 3AFIA 5KFLA 1GGMA 1J8MF 1BMQA 5JAMA 1VPLA 3GJ8A 4DNXA 5EXEA 2P5TB 1PJ2A 1COKA 1U7WA 4AZ3A 4NXMB 5DYWA 3T12A 5KPDA 1NLZA 5FI3A 1DHRA 1XEWY 2W6OA 4FD2A 4PCAA 1I2BA 4YUVA 2MR5A 3LVQE 2J6CA 1E1MA 1I2AA 4GDFA 9ICNA 3GHYA 2X2FA 3OEWA 4RH0A 2WYVA 3BZKA 1Q0QA 3BULA 2AUNA