2YY6A

Crystal structure of the phosphoglycolate phosphatase from aquifex aeolicus vf5
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
MRVILFDLDGTLIDSAKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVYTKPYPEIPYTLEALKSKGFKLAVVSNKLEELSKKILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDFTLSRPSDLVKLMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the phosphoglycolate phosphatase from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
molecule keywords phosphoglycolate phosphatase
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2yy6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yy6A01
3KZXA 1ZRNA 4I9FA 3QYPA 4BX2A 4UMDA 3E8MA 1S8OA 5AW7A 1ZD4A 2HX1A 3PGVA 5AM2A 1QYIA 3ZTYA 4Y2VA 3F9RA 2VKQA 3I76A 5ALDA 4MUMA 5AHXA 1VFPA 5AW6A 3AR5A 4HGQA 3W5AA 1WR8A 3OCXA 2Q4RA 1RKUA 3W5BA 2HF7A 3BWVA 3ZWDA 4YCLA 1L7NA 5E0OA 3AR4A 2HCFA 4NAVA 4RETA 4UMFA 3FPSA 4B6JA 3RF6A 2HDOA 4BNDB 1LVHA 4NV0A 2HI0A 3FVVA 3N07A 1RPZA 2ZOSA 2ZBGA 1SU4A 3ZVMA 1ZJJA 2I7DA 1U2TA 2B8JA 2B1RA 4NFLA 3QU2A 2JARA 3R4CA 3IRUA 5AI0A 3WKAA 1L8OA 3E84A 3DNPA 2W11A 1Z5UA 1Z4PX 5ALSA 2YMLA 3P96A 3QUCA 4BEVA 2I34A 2FPRA 1Y8AA 4OCZA 1ZOLA 1U7OA 2EATA 1XPJA 1L8LA 3QUTA 3AR2A 5ALIA 3OTQA 4IG4A 4UATA 2YBDA 3U13A 3W5DA 5AKGA 3WK6A 4Y2YA 1CQZA 4EZEA 2GO7A 2B82A 4RESA 2GHQA 3ET4A 2EARA 1RC8A 2YMQA 4GIBA 2AUTA 2ZXEA 4ZEWA 5AK4A 3E81A 5ALKA 3NASA 2C8LA 2G80A 4HYTA 3KD3A 3OCYA 3A1CA 2HOQA 4L57A 2OYCA 3SKYA 2G1AA 2EAUA 2FPUA 3WGUA 1Z4MA 2C9MA 1XP5A 5AVTA 2HO4A 3SMVA 3QLEA 1T9ZA 4HGPA 4CF3A 1TJ4A 4HGNA 1WVIA 4XQ0A 5ALEA 3SHQA 3ESQA 1RMQA 4KN8A 1WPGA 5T41A 2G0AA 4QJBA 2W43A 3QNMA 1EK2A 2O9JA 3NANA 5AVYA 3R9KA 2QYHA 3OCZA 2B30A 1SWWA 4F71A 4FFDA 2B8EA 5AW9A 3QU7A 3QXGA 4UAUA 4EX6A 5ALQA 4XOUA 2WFAA 4FYPA 3M1YA 2WM8A 4YIHA 3L8EA 2OA0A 2HHLA 1ZD3A 4H1WA 5AKIA 2OBBA 3SF0A 1KYTA 3HYCA 5AM5A 1YV9A 3AR7A 1L6RA 3WKEA 1Z4QA 2CFSA 3U7FB 5FP0A 3IB6A 1O08A 5AW5A 3ZX5A 2FI1A 1X42A 3WK4A 1RDFA 2RB5A 1NRWA 4MWOA 2WF7A 1N9KA 2I55A 5ALOA 3GYGA 3OCVA 1ZD2P 3I1YA 3ESRA 5ALZA 5AICA 5AVVA 5ALUA 2AGVA 3FM9A 3DV9A 3MPOA 3I6BA 3ZTWA 2NO4A 5AW8A 2ODAA 5ALFA 5AI4A 1RMTA 2FEAA 2HF2A 5AESA 1RLTA 3E58A 4C4TA 4CNQA 2Q4TA 1Z4KA 4OFZA 4J03A 3ZI4A 2O2XA 3ZUPA 2YFYA 3OCWA 4DWOA 3IJ5A 5IS2A 3ONNA 3MC1A 3MMZA 4KX5A 1L7PA 2GMWA 4C4RA 1IWOA 3EPRA 5AM3A 3L0CA 3KBBA 3QUBA 5ALWA 2P9JA 3WKBA 3WGVA 2G08A 4Y2XA 2R8ZA 2YJ6A 4EELA 2FUCA 2W4MA 2YJ3A 2G09A 3SKXA 3QU5A 1YMQA 2ZG6A 5AVRA 1NNLA 3BA6A 2B1QA 2AH5A 1J97A 2X4DA 3AR8A 5AW4A 3NALA 4XE5A 4HAIA 4XPZA 5AK6A 1VJRA 3QX7A 4NABA 3A3YA 2DQSA 5AI5A 3KDPA 4OHFA 1RLOA 5A3SA 5AKZA 3UM9A 5A3QA 3L1UA 2R8XA 3U7GA 1O03A 4CE6A 3UMBA 5AM1A 1XVIA 5AI6A 5ALYA 5AKLA 4UARA 5ALHA 3UMCA 3NAMA 5AVZA 3RFUA 4UMVA 1NF2A 3WKCA 5ALPA 1SWVA 1EK1A 1QQ7A 4Y2RA 2C8KA 4KYTA 2YY6A 2I33A 3L8HA 2WF5A 5ALMA 2I54A 3N8GA 1ZD5A 5AW3A 3W5CA 1ZS9A 2JAUA 2Q5EA 3PDWA 4AP9A 1U02A 1RQNA 3N5KA 3QUQA 4UW9A 2P27A 1QQ6A 4OD0A 3EWIA 3PCTA 4BX0A 2FPSA 1LTQA 4E88A 2BDUA 3I28A 1RKVA 4DW8A 4CF4A 1ZRMA 1T5SA 4PNHA 4JDPA 3EF1A 2MU2A 3ZWKA 2QLTA 3OCUA 3ZW7A 5AKYA 2YMPA 1Z4IA 2D2VA 4DFDA 4EEKA 3L7YA 3U7EB 1N8NA 3WK9A 2CFRA 2P11A 4UMEA 3CNHA 4Y2JA 4NWIA 5AVXA 5A3RA 3NIWA 4L6CA 3A1EA 3DDHA 1WZCA 4UM7A 3FZQA 5ALRA 3FPBA 5ALVA 4BKMA 5ALGA 3KC2A 5AIBA 3MN1A 1QH9A 5IT0A 3HLTA 2FDRA 2WF9A 3ET5A 1Z4OA 3EF0A 4YIKA 4AS2A 1Z5GA 4KX3A 2JAOA 2BY4A 4C4SA 2YJ5A 4CF5A 3AR9A 4DCCA 4F72A 1RKQA 4YCNA 4BNDA 5ALTA 5AKJA 4I9GA 3DAOA 4Y3UA 4L6AA 2C88A 3L0BA 2IA5A 2R8YA 3NRJA 4GXTA 2G06A 2MSNA 2CFTA 3L0YA 2JGAA 2P69A 3L8GA 4J2TA 5AW0A 1JUDA 5ALJA 1T5TA 1L7OA 1MH9A 1YJ5A 1YS9A 3ZVNA 4KNVA 2ZBDA 2G07A 5AVWA 3NUQA 1AQ6A 5AW1A 3N28A 4EX7A 3SLRA 3D6JA 3PGLA 5AKXA 4UU1A 2WF6A 2IOFK 3B9RA 3B9BA 3WK5A 1U2SA 2FPXA 4BX3A 3ZX4A 4YH1A 2YMMA 2WF8A 2YJ4A 2JAWA 5AW2A 1VJ5A 2RARA 4Y2UA 1Q92A 2CN1A 1RQLA 5AM4A 2RAVA 2I6XA 3L1VA 3WK8A 2IOFA 2WHEA 4Y2QA 1RRCA 1S2OA 5AKHA 2FPWA 2GFHA 5ALXA 2HEGA 4Y2SA 5AK5A 4IFTA 3QGMA 5AVSA 5AVQA 4YGYA 2YN4A 2IYEA 5AM0A 3U26A 3WKDA 2PR7A 2NYVA 5AIAA 3KOOA 4HGOA 3U19A 2MU1A 1RMYA 1L7MA 1QQ5A 2ZBFA 2R8EA 3L8FA 4UM5A 1PW5A 1Q91A 4UASA 3ZU6A 3UMGA 3VAYA 4G9BA 1TJ5A 5AKKA 4UU0A 4YCMA 4ZEVA 2NO5A 4EENA 1Z4LA 1TJ3A 3M9LA 3R09A 3ZVLA 4BEWA 3N1UA 4FE3A 4AS3A 4BBJA 3L5KA 2HSZA 1F5SA 2AMYA 4Y2PA 1Z4NA 3AR3A 2B0CA 3J7TA 2IOHA 2ZBEA 4G63A 4QQFA 5AK3A 3QU4A 2OM6A 4ZEXA 1RLMA 3WK7A 1FEZA 3CZ4A 3SD7A 3A1DA 1TE2A 4UAVA 1CR6A 1K1EA 4Y2TA 4O8CA 5AKEA 1Z88A 3TLMA 4HGRA 2FUEA 3FGOA 5AI9A 1YDFA 3B8EA 2RBKA 2PQ0A 2PKEA 3ED5A 2C4NA 2GHTA 4BYGA 1TA0A 4KNWA 5AI8A 5IT4A 4JB3A 1U7PA 5JJBA 3QU9A 3OPXA 3U7HB 3K1ZA 3S6JA 5AVUA 5ALLA 2BDEA 1YNSA 3AR6A 5ALNA 1Z4JA 1J8DA
chains in the Genus database with same CATH superfamily
5KEIA 1L5WA 1FU4A 1QIDA 1E9SA 1T15A 3NTOA 4P3XA 4AYTA 1GN9A 3HR7A 1TJNA 4E4RA 3ADCA 1Z37A 2CLSA 2PTHA 5CGQB 4GDMA 1BQEA 1EBBA 1QK3A 1QZ3A 1TNDA 1UINA 2HZBA 3NONA 4G5FA 4Q1CA 4MQEA 1RHUA 5TXGA 1Z62A 3D1LA 4I19A 3BQ7A 5K4AA 5FX2A 4OBEA 2I4LA 2J08A 7ICFA 3BJIC 3BXHA 2ZXHA 5JBIA 2RI1A 3JD4A 3KSBC 3AL0C 4TROA 2C04A 3ZG6A 3MQ2A 4C6HA 2GASA 5HHIA 5EJ9A 5JRTA 2J33A 3SJAA 5KYUB 4J0IA 4YR7A 3A11A 5EP2A 1C4KA 2K8CB 3PMNA 4HQLA 3AETA 3R74A 4TLAA 3V2GA 1E8DA 3B70A 5K05A 3IHLA 3P8ZA 3EVZA 3EYAA 5EHQA 3AF2A 4GOJA 4IF4A 2ZWIA 4DL4A 4EPYA 5AO9A 4L28A 1W75A 5D3MB 2RGBA 1HQDA 4X5VA 4O1IA 5TARA 2VKTA 4O0IA 2GZSA 1RXIA 3E48A 4MW7A 4H0FA 1PCXA 4N82A 4ZVKA 2BCQA 1IPEA 2B1RA 2Y1IA 3EXHA 3LO5A 4Q3NA 1ZR4A 2FPMA 1K98A 3BWDD 1Z26A 3K92A 1KW4A 3Q9LA 3FWHA 1RYNA 3J81k 1UL1X 4LXTA 2WE7A 1WZEA 1IL0A 1Z73A 1IK4A 3Q8WA 3GP5A 4IIYA 1GTRA 4QARA 1JR3E 5KOYA 3E84A 3I1JA 2YUIA 3ILYA 1BVRA 1MB2A 4J9OA 3RKSA 4B44A 4FFLA 2HMVA 3GRZA 3K0CC 3SS8A 2IHMA 4QTUB 3SSOA 2ZLBA 2QP4A 1ZIDA 1Q1BA 3WZ2A 3D3NA 1YJ8A 5JMWA 4NXMB 1XROA 1XPJA 4MGIR 1USGA 3NJ8A 2Q4DA 5KDLA 1T8PA 2OK8A 1IONA 4MQUA 4ND2A 4FIDA 5B1HA 2QGFA 2ZS9A 2AVNA 3CNNA 3KAKA 4D56A 3OQIA 4TS1A 3U13A 1P4HA 3W9BA 4DPMA 4ER5A 3LGSA 4KXXA 2IUTA 3CPSA 5FUBA 3UMRA 1AM4D 1W36B 4ARBA 1ACLA 5KYYA 4X65B 4F5YA 1TD1A 4LOKA 3G6XA 2RD2A 2NP6A 3H5VA 5IHXA 1CS0A 1IJEA 2KOBA 2VCYA 3ZDQA 4C0SA 1NVBA 4D82A 3R24A 3UK7A 4NNPA 1ESZA 3P9RA 2DHCA 5FO0A 3RH0A 1JB1A 3VI4B 1X1SA 1P9OA 2YQ5A 1QLNA 1P2BA 3OZCA 1O4WA 3T38A 2X22A 4Z51A 5MDHA 1P1KA 3PHCA 3EVDA 2WAXA 2HA2A 2DPHA 3CNLA 1SHJA 3WP0A 3IMEA 3EAGA 4O4JB 3C23A 3KZ1E 4DCMA 5AVTA 1BS9A 1VHDA 3PJFA 4KMOB 1VCHA 2WA2A 4OREX 4F8RA 4GZ3A 2XHZA 3EG9B 3VJMA 3AIOA 2O1EA 3HDVA 3WO1A 2W6IA 5FL7D 3BM5A 3ZV4A 3UOGA 3ZYCA 1SOAA 2H06A 2H65A 4NCKA 4BJHB 1YQUA 3RSGA 5LIRA 3EYZA 2IBMA 2E89A 2P9GA 1JLHA 1TYAE 1U98A 2HLDD 4WN9A 1CVLA 1K6IA 3DZIA 1DG3A 1Q57A 2HHWA 1V7CA 3NCTA 3BC1A 5LQMA 3BH0A 5KMGB 2ZUUA 2O2YA 3WWCA 4RY2A 3BMQA 3NDIA 3BXFA 5EEHA 3K70B 2E8MA 1DINA 4LF8B 4L9WA 3V9PA 1ZQDA 1ACJA 1BD4A 4I4TB 1CDEA 4II7A 3STWA 3NFRA 3HR4A 3B89A 1WUYA 2VQ3A 5KVQA 5J1SB 4NARA 1THGA 2JL1A 3SK0A 3QTBA 2W6JA 2K4IA 1X7GA 5BW5A 1R6XA 3PVXA 5DZSA 4M0MA 3CRXA 4AZ3A 1AQNA 5A2QA 3H8WA 3BQTA 3PCXA 1GZ4A 1YB6A 1ZVJA 5FL3A 5K09A 5DT9A 3UJ9A 4LF7B 2CLIB 1RRGA 4HS4A 2A1UA 1GPJA 5LD2C 4G0WA 2HRZA 2XQJA 1QHYA 2VHJA 3A4NA 3B1VA 1P44A 3OVMA 4UNIA 1PGOA 5CDGA 1SUBA 1YONA 1JTEA 3BTUA 3OEEA 4V3CA 1Y8RA 3IB6A 3RRBA 1FFAA 1XDBA 2OV8A 2OO3A 1V26A 2O5RA 3LC2O 1Q3VA 3PR2B 2PH1A 1I10A 4R1LA 5IVIA 4S12A 2DSTA 2G5CA 3SDBA 4WQMA 3ZDYB 3EPLA 1DP4A 4BLUA 4R0NA 1ISRA 4COOA 1NK9A 2ZE6A 4FZNA 4DV6B 4MWOA 1T5DX 4UQLA 4F4FA 2ES6A 1UA1A 2C0QA 1CEZA 1R8SA 1XJQA 4RSGA 5DBIA 5EE3A 3PUIA 3MUOA 2KNJA 5ALZA 3TACB 5FHQA 4A8JC 1PL7A 2W2VA 9ICQA 2WKRA 1L5HB 4HY3A 4M0AA 4ARAA 5CJ2A 3IL2A 1M8KA 3MPOA 1SKYE 1CY8A 3N87A 3TAUA 1FZTA 5AOAA 1CF2O 2BGRA 1J8QA 4EB3A 2EIHA 3QOXA 1B43A 3UNXA 2AEEA 3O84A 4Y9SA 4G5XA 3E22A 4HZIA 3ZLJA 1XRSB 2CHGA 4Z4FA 1VRWA 1T4DA 4JU8A 3RU3A 2XOEA 2XGPA 1E3LA 2HYIC 3WGGA 2FMTA 2WMNB 3CZCA 4J1TC 5CT9A 3AVOA 1FVXA 3I04M 3E9EA 1OF1A 3DVRX 4ND8A 3H5AA 1YZ6A 3IJ5A 2GHIA 4U7CA 1NUTA 4HYEA 5CMLA 4BBAA 2JEJA 1BNPA 2IXEA 4PO3X 4A27A 3DVSX 3MTIA 1YB4A 2BKXA 3K72B 4LHVA 5DCWA 1M5TA 1IWOA 4D45A 2Z58A 3JZAA 4I55A 1T13A 2ASJA 1JHAA 4BQPA 2O2DA 2QTVA 2YCLA 2H8KA 2NUAA 3P2KA 4PVDA 3LQKA 3WL4A 1EE1A 1QDUA 3HBNA 4PWYA 2FZKA 3GV0A 4YQEA 4H18A 3X1ZA 1E1NA 5BUSA 5H3CA 1LFAA 2R48A 3JQGA 3LLCA 3NU1A 4KLAA 7ICOA 2RI0A 3EEOA 2EZUA 5AVRA 5A9TA 4OUKX 4A2CA 3UK1A 2SICE 3HA5A 2X4DA 3U4HA 1T2CA 1R5NA 2I76A 3PDCA 4Y6OA 5JJCA 2HLPA 3TLAA 2XQFA 3KFLA 3WNDA 1N8SA 2J5QA 6LDHA 2C20A 3QX7A 1U4SA 3A3YA 3CCFA 4S1PA 2JEZA 1AH2A 4GC5A 4QZ9A 4ZI7F 5HW0A 4AKSA 1L7AA 1PR3A 1Z6PA 3K5IA 1DXHA 3KOYA 5JXGA 5F2OA 1TQDA 3LQ1A 5CCDA 5H68A 3U09A 1OB2A 2BH2A 4Q8EA 4RQAA 1IZZA 2JLAA 4D9FA 2ZYSA 6AT1A 1S0OA 3QUSA 5GV8A 3JVVA 2V6BA 4KKVA 5KWVA 1WX1A 2P9HA 2VTBB 2H8GA 5JQGA 3KKAC 4EI2A 4AVYA 4K46A 5ICEA 4GMGA 5FBHA 1OAKA 3R8CA 4A8JB 5HQ3A 2KQUA 4KN9S 5H80A 3HJUA 1BWQA 1WA5A 2WIDA 5K3SA 4CCYB 4QKQA 2JAUA 1N6IA 1VPEA 1L5UA 1C3XA 1WTAA 3M6IA 4LNUA 1XZJA 1M1UA 4EGAA 3EVEA 4YYEA 3H0MB 4MWDA 3ENQA 1WM1A 2XKBA 5LUAA 3N2YA 4WK6A 3GBPA 4U8HA 3STHA 2Z8YM 1LDYA 4DLBA 4NAHA 2EC5A 2OR3A 3L18A 4LYFA 1WPQA 4NBKA 1FRQA 3OX1A 5EWLA 2C9DA 4YALA 1USUA 2AYYA 2IXBA 1B8VA 2YRFA 4XUDA 2JCXA 3Q3EA 2WKWA 1U99A 4QIHA 3N8IA 1K6EA 3Q8MA 1PK1B 2G17A 1RXSA 2ILVA 1D6MA 2HUNA 3R6LA 4QICA 3RJIA 2FZCA 5IFKA 2W7OA 1ZRMA 1GN8A 4IQUA 1E2PA 1NIJA 2JIBA 3H5LA 5HF8A 4M88A 2OCEA 4CM8B 1A82A 1UEXC 2KV2A 4DS3A 4JWNA 3I42A 5F5LA 4I6GA 2Q4OA 2LR0A 2FX5A 1PR9A 4M4SA 3WLPA 1GOTA 2DHEA 3GGOA 3HCPA 3WGMA 1TO1E 2VYQA 5DX0A 4ZVUA 3BE4A 2H00A 1FUUA 4BVJA 4EMUA 1E0AA 3IQDB 4UMEA 1EIZA 3IAAA 2CE2X 2J0QA 3Q1LA 4G2TA 2MAXA 1OYVA 1GCAA 3MRVA 2ZJ2A 4EKGA 1L3UA 1ONSA 2JCYA 4O5AA 4YLGA 3VI3B 2R25B 3EDOA 2XWPA 3SI8A 1F20A 2ERXA 3HJRA 3IQZA 3LYLA 3PQ6A 4M37A 4N6GA 4MEYA 4BMDA 4QOIA 2NRTA 2FMHA 3KC2A 3PDHA 1NSFA 5C8XA 1IVNA 2XOKD 1C9JA 4BNJA 4DMMA 2AL7A 3PA6A 4EY7A 3EN0A 4C7ZA 1I7LA 3UIEA 3MA0A 4OHWA 5EIAA 5A5EA 1OT3A 2C31A 2NTEA 5DE3A 5K8VA 1ZQKA 4LRUA 1J24A 4PO1A 4F91B 4AS2A 4DJEC 3WIEA 1DCFA 1KYIA 2XCLA 4OGGA 5ED0A 4ZGWA 2WU0A 2Y67A 2VK2A 3LUFA 4QPJC 3MR6A 2F6RA 2DBQA 2EV9A 4M7RA 2VSFA 3CNEA 5CA0A 3ZJVA 3ZEIA 1KVTA 1SURA 2CBZA 4YRCA 3RRNA 1XXHA 3VSAA 1U5BB 1A7AA 3QEMB 3DAOA 4HDKB 2UV8A 4M22A 1WCLA 1E3DA 1EUCB 221PA 2J85A 2WA1A 2Z5VA 4PNPA 1NLZA 2IA5A 4EEZA 2BFAA 1YJQA 4D9JA 3C6YA 5HILA 1GO2A 3NHLA 2MSNA 4PZUA 1DQNA 4OXXA 1UBRS 8ADHA 2PDAA 3EZ9A 2K7ZA 1NQ5A 4ZCPA 1WP4A 2YR0A 4MV5A 3AB8A 3W7VA 4AWXA 5KFAA 2OV3A 1AQYA 1RWMA 1TOAA 1Y5LA 1KMQA 3TOXA 4ZU6X 2J4DA 2H4JA 4R7TA 4FDUA 1V9CA 3A05A 4S0XA 5TC4A 3DE5X 3TFRA 5JBNA 5BT9A 5T8KC 3MF4A 3KIPA 4AY3A 3M81A 5MFPA 2H52A 1ESEA 1K7FB 3HWTA 1OC4A 4O5EA 3KFVA 5TR9A 3IQEA 3UW3A 5JSQA 3VO2A 2B94A 2EGUA 3IR7A 3QX3A 2G67A 2R4QA 3B5EA 4RABA 3WA7A 3KQKA 1L7QA 1E1LA 2OAP1 2O0MA 2WWHA 3NAQA 4O4LF 2QN8A 4CMJA 3AEKA 1SHLA 3B9BA 3GI1A 3ILXA 2C59A 1NW6A 4TOIA 4DANA 1HUOA 1YC2A 3EIHA 2IS1A 1HYQA 3FVTA 4Q4JA 2WSSA 1V6AA 3C3KA 4MYHA 4PHHA 2NVBA 3QOYA 4IEIA 1LRKA 2RI6A 4QYSA 1I2AA 1G8HA 1Y37A 1Z2NX 2EKBA 2VN8A 3GLVA 2GR9A 4JLUA 4QECA 4II3A 3RO7A 4LF4B 5KG7A 4K1LA 4XFDA 2VJ4A 2ZIVB 4ND1A 1QKIA 2JC3A 1VSQA 2H2GA 1MVOA 4MJ7A 4RTNA 4L5JA 1I7PA 4C8LA 3S1AB 2X0NA 4FEGA 4F4UA 3E23A 3R7WB 3E1GA 3E3MA 2QRQA 1Y1QA 2AFVA 1KEUA 4GC6A 3O1IC 5AK5A 3VOBA 5CLJA 1IIPA 1G21E 2Z4TA 2RFLA 3B1XA 1H0KA 4HMPA 4TYQA 1XEAA 3CC8A 1SXPA 2CCJA 1W8DA 3BHIA 1UC4B 1WYGA 1HORA 2KBEA 2GLUA 3Q7PA 4CLEA 4F5QA 3IUPA 4TMYA 1X0VA 4PZOA 4IIVA 5AHKA 3TNYA 2QTCA 3DTNA 4MUKA 2ZTDA 1T0PA 2EXXA 2OPBA 5AIAA 2ZAOA 3L02A 3OP4A 4G85A 1A4UA 4W5QA 3RJFA 1QTRA 2DUWA 1SB8A 3QPVA 1U0EA 4D6YA 5CB4B 4WVFA 1UXIA 3GK3A 5DVZA 2ZBFA 4GS5A 1EU1A 4PTLA 1BFDA 1SCUA 4I3HA 4ALIA 1H8ED 1L5ZA 3KVOA 1D2MA 3IRVA 4TTSA 2HIHA 2FAXA 1X8KA 1KQ3A 2Q1SA 2X2EA 8ICUA 1OUMA 2YWHA 3A27A 3JPYA 3BSFA 4HDQB 4MV4A 4WZ6A 3UFXB 2QRNA 4CQLB 3RF9A 4CLHA 3K6SB 1U6KA 4L51A 4DFKA 3E5MA 2AKEA 1DAFA 2AXNA 4L95C 4R98A 2QD5A 4UU0A 5LB2A 2QJFA 3TG2A 1SXJD 4AULA 2OZLA 1HDCA 1Z4LA 3A4YA 5NULA 3WQBA 4DR3B 3H0KA 1FYWA 3R5TA 4FE3A 1CRWG 1K7SN 1CB7A 1D1SA 2G9QA 5KX5A 2X0FA 3LPDA 3CTPA 4CKBB 1U6JA 1VG9B 2VIIA 3LX6A 4G8DA 4IIHA 2FR8A 4HB4A 4Z6EA 1U1CA 3S29A 2GWHA 5HSGA 1E5VA 1KFKB 3A1WA 4OB7A 4WSOA 4INJA 1I13A 2JVIA 1W2GA 4H0CA 4LYYA 3J7TA 5D85A 3EX7C 5ECGC 4AX8A 1CI4A 1MJFA 2XVTA 5EKDA 4BDTA 1I2MA 4YWJA 4M0DA 1U1IA 2DFKB 1JAIA 3QY0A 4MAAA 2V7EA 4QIWF 1OYYA 3P2IA 3WLNA 1HFJA 3PLRA 4BLWA 4BU1A 4PGQA 3FNBA 5LQJA 1YZYA 5GJVC 4CTJA 3PX7A 4O3PA 3AHHA 3Q8QB 4P2HA 3SD7A 1TW3A 1NW4A 3GD5A 3KHKA 3IEXA 4HYYA 4LRWA 1XEFA 4ZV7A 4BKPA 4C5CA 4GR5A 3J7AC 1AG9A 3FCOA 3V4LA 3O4RA 3RR8A 3NHZA 3RIEA 1M8FA 3OI7A 1ZI6A 3ESZA 4HHEA 2GUWA 3QMPA 2FJPA 3UC9A 5BV7A 5TQJA 3AP2A 2Z08A 2ZE5A 2ORIA 3EWAA 1NJ6A 4RM2A 5CA1A 1QJ4A 2ORWA 5CDSA 1EESA 3FPKA 4D9IA 1L5FA 1F8UA 1VE7A 4YMNA 3K5WA 1I36A 1VM6A 3VR4D 4F06A 2B4QA 2BWJA 3E9QA 2EZ8A 3ZZ0A 5KYNA 3FDXA 3GRFA 2OAQ1 1ILWA 4MRPA 4Q1AA 1EE9A 3BIFA 3TZKA 5KNBH 5ENZA 3ITKA 1UPTA 3QPCA 4OK5A 3A2KA 1HC7A 4M9JA 3R3SA 3P19A 2H08A 4Z7OB 2BEUA 1Z4JA 2FWAA 1OGYA 2XH8A 4BKUA 5IYZB 3GBVA 3KZXA 4Z5XA 3BX1A 1I4WA 2WHYA 4MR8A 4IV5A 3RI3A 1MA7A 3WWEA 4FOSA 1A1SA 1LV5A 2IYRA 3TOSA 5A6VA 3D3EA 2HRRA 5IEJA 5EWGA 3H17A 2RGRA 4BKOA 2YH2A 5GQSA 3TUIC 4W5WA 3FPEA 4RQ7A 1IM4A 5E2BA 3EGXB 4QZEA 4NR0A 3ZY6A 3MM4A 1PUJA 4UPDA 4IICA 1RAHA 3FUWA 4NQZA 1N57A 1TQ6A 2C9ZA 3P9YA 4LCJA 5A4IS 3N6VA 1E3QA 5EOZA 3AVPA 3ZOZA 4R4JA 1BZYA 1UJ6A 3BWVA 2AXTU 4WINA 3KQMA 1ZQPA 2EKQA 4U7TB 3WXMA 3V1KA 4BNIA 1UOOA 4HUTA 4YV7A 5M34A 2I91A 5JRDS 3T4EA 4YP6A 1ZQUA 5DGBA 2NXNA 4Y1RB 1E20A 4U7GA 2LE0A 3GJSA 4Z9AA 1R74A 1SQ5A 1JIHA 1UXHA 3CIFA 3FXAA 4HWGA 4WESB 3F6SA 1FP1D 5JAZA 4PFJA 1KAOA 2P4SA 4CODB 1Q19A 1FJHA 4E14A 4CDMA 1N8KA 1QCKA 2PVCA 3GFGA 3HKDA 1TZKA 1CLEA 1BMFD 1FB5A 1E4EB 2C4VA 2FMKA 1UHUA 2P78A 1PDWA 2BF4A 3HDYA 2VP5A 1DPFA 3FFAA 3Q3VA 4D3YA 3OZWA 3X1XA 2RGNA 3LC1O 3R9WA 3AFNA 3MD0A 4AMBA 3LTEA 1L5RA 1SUDA 2BGMA 3GRVA 4YEDA 3H6KA 5FBVB 2ES4A 4DO9A 4N39A 1ESDA 2AD5A 1A4RA 3GWGA 4BEVA 5CDUA 4CKCB 1F12A 1V5GA 4ND3A 2K4MA 4TTPA 4Y6RA 3F6RA 3TFWA 3EW7A 1U7OA 3WQHA 2P67A 4B79A 2ZTSA 1PL0A 3EHDA 4IJ5A 4LQ4A 5D5QA 5FV7A 3UJ3X 2G40A 4UVHA 3AR2A 2P6OA 5IWAB 4E32A 3CVUA 3TTYA 2BFCA 2CUZA 3ZV6A 3FKSD 4RK0A 1WB4A 4B6RA 4INZA 4BNLA 4UXJA 2EH9A 4B6FA 3HX0A 1ZJNA 1JKXA 1B41A 4O3OA 4F3OA 3OX3A 2YBEA 3H19A 1WNFA 4EITA 2L42A 4MUYA 3VU8A 4GPAA 3HY3A 1X7YA 5J4VA 2HWKA 1O9GA 821PA 4EYGA 1QG6A 1W9HA 2J9ZB 3K9CA 4FQ5A 1A98A 1W35A 2GFQA 3NEJA 3D7LA 1E77A 2GKSA 4L57A 4NE2A 3ICOA 3F6BX 5FPYA 4EZ6A 1H5NA 3MUNA 3FOEC 2YXDA 4N8SA 4WLVA 1OH6A 2FPUA 2JJMA 2UDPA 3PUWA 1RABA 5FFNA 2H2AA 5J29A 1E2EA 5CWRA 5FBWB 3PYXA 4A03A 3UAGA 1CFJA 1VJGA 4E2WA 3EDQA 4JQYA 4DRXA 1GJRA 2AJBA 4A82A 5CB0A 4BO1A 2DHRA 3IAEA 1LB1B 2BMJA 2CHEA 4IOLA 4P0QB 3CUKA 3LNTA 3RUCA 3RODA 2XTJA 4CMBA 1Y4SA 3FWKA 1RFLA 4LJSA 1OYWA 3OJOA 4KWIA 4R05A 1EK2A 1NBHA 5FV4A 1BXKA 1ZHFA 2AXQA 4D8YA 2V0NA 3OCZA 4ZOCA 3TO5A 4CEIB 4RXMA 1GFIA 2BR0A 2QD2A 5E6RB 1DX6A 4GX1A 2XVXA 1OTHA 4XI9A 2B8EA 3R0QA 4PZNA 8ICLA 2H3FA 2Y2UA 2XT9A 3ZIAD 5KYTA 4V03A 4B4DA 4UAUA 2AHRA 3TI7A 4NMHA 2IW1A 1AKRA 2AZMA 2BFEA 2Q46A 2X4LA 1O6BA 3JZDA 3K32A 3NT2A 1WEKA 2WFAA 4XGKA 4FDMA 4AJ9A 4BFYA 1FQOA 1G66A 4D0SA 3MWGA 1GNSA 4Q9HA 1A9TA 4L9AA 3E70C 5IW8A 2HEIA 4DUGA 1N2CA 3MBOA 4TV9A 4RA9B 1ZI8A 3AC0A 3HBLA 2GBLC 4RHEA 4FO6A 2EU8A 3H2SA 1DTWA 5EPUA 3CSDA 3QENA 1AN0A 4KVAA 4RV9A 1O87A 3LHFA 4FZ3A 4ZXPA 4DRZA 1AA9A 2B1GA 2D1RA 2YV4A 3RJ9A 4EL0A 2CVHA 2QMHA 3FCYA 4IUCS 4FWIB 2L18A 3G2JA 1SHUX 4KIJA 3E8XA 8ICTA 1G5RA 2E4AA 4NU6A 3BMOB 4G26A 3ZWOA 1V8DA 3FCXA 3K0AA 4FGKA 4NM1A 1Q50A 4MDFA 1GPKA 3N2GA 5FPHA 3GLTA 1SCKA 1E7YA 1QF9A 3GXOA 2XJ4A 3KKNA 4GYWA 4LY3A 4P1ZA 2QXYA 4FCCA 2P9CA 3WB2A 2VDJA 2OCXA 3QTLA 4RS4A 1HLFA 2FFJA 3OLZA 1G59A 1GAXA 5IVPA 2FMSA 4QDJA 3IP1A 1JT2A 3SNHA 2FLPA 5LQCA 2PUJA 5DKFA 5EIXA 3K7EA 3SJZA 3M9NB 4MRMB 3K0SA 4KLSA 1G16A 4N0EA 2D5CA 5IUKC 2JIQA 5JDCC 2KPOA 3DE0X 3AEVA 1NVXQ 3L8YA 4Q37A 4DIKA 1K5PA 3TRFA 5J2EA 2H1CA 1FMLA 2H16A 3GJQA 3OJLA 2DP4E 3SSMA 3W05A 4CNQA 4OFZA 3MTGA 4EUKA 1ZOOA 1PWHA 2UVWA 4D80A 2CNWD 3G0IA 4CIXA 3CNBA 4KXUA 4DWOA 1Z7WA 1EG2A 3MMZA 3C6KA 4J07A 3RASA 2QW1A 2C9YA 4IIJA 1JMSA 4Z6DA 2WYUA 4CMGA 1WXQA 1ZXLA 2FVXA 1G6KA 1Q17A 2GMWA 4LRTB 2PX0A 2WJWA 3ZBQA 1B8NA 4BV2A 1OU4A 7AT1A 1Z0ZA 1ENZA 1IN5A 4FKMA 1XDUA 3NHYA 1DAIA 1D2NA 5CAEB 1CY0A 3GLHE 3U7JA 3OZAA 1GILA 2BR4A 4D5GA 1DUIA 2X3UA 4Q1FA 4DMLA 3AIKA 3FY4A 4PGGA 2FP3A 3BMCA 3TB4A 5IM4A 2ISOA 1N63A 5EWEA 2O1XA 1PQYA 2P9QA 1KH2A 3KRTA 2VVTA 3MNFA 4Y30A 3VYWA 1W2WB 4ESOA 4W5OA 4UJ3A 1EXNA 4KU4A 3T7RA 3T5AA 3TVYA 3OIVA 2GLXA 1ZKMA 1R8QA 1SUPA 3NDPA 1CYDA 1K86A 3K8QA 4J29A 1UC5B 3GDGA 3O31A 2I2DA 2YDXA 2EAMA 1EZ4A 3PFWO 3RV4A 1KSFX 8MHTA 3OZDA 3PX0A 4TT3D 3WBKA 2XMDA 1T1JA 1UWVA 4OQZA 4Q82A 4WKCA 3UM9A 2ABWA 2FNAA 3SN6A 1DJMA 4M1KA 4MHSA 2WWIA 2ZFUA 1I33A 2LDXA 3ZXUB 1I01A 2Q0ZX 1TC1A 2FEMA 2A9RA 5J0TA 4FYIA 5BOMA 1A97A 2XE7A 3ZW8A 4AQYB 2IH5A 1VCNA 5CR0A 4BUGA 4KP7A 1UP7A 4P0PB 4PG5A 1IY0A 3JQ8B 4WFJA 1P9WA 2GF9A 1UXOA 3QBEA 2H2DA 3RYIB 1U9IA 2B2XA 3HZOA 2QMQA 3WGKA 5J43A 2Y8EA 4DG5A 4K9SA 3B78A 4IXTA 4K9MA 4FZVA 1S3SA 5K99A 4WZBA 1C29B 1Z15A 3A6ZA 3EJWA 3LCCA 4IRMA 4PSVA 4RADA 3L6CA 1SRQA 3BDVA 1AB6A 4E30A 1CF9A 4CL0A 3FNFA 4DA7A 3GLFB 1ZS9A 1YMVA 2WVAA 3AG6A 4C43A 4KLZA 1SB9A 4PHGA 1UPUA 1ISPA 3V4SA 3V8MA 4AB1A 3NI2A 4DCTA 5IVHA 1YCDA 3OQ6A 1IUNA 3N5KA 4R54A 3DF9A 3G8CA 2V3VA 3KCNA 1B6TA 3ZD7A 1QQ6A 1IOVA 1C80A 5TVGA 1ZP6A 1J8MF 4O4HF 1IUKA 1ORTA 3HP1A 2HRCA 1C8LA 5T4BA 1AHHA 4LQDA 2XIJA 1XRNA 3CLRD 3M6LA 5KINB 4GDFA 2ZIUB 5CA1F 8ICEA 2N1RA 1FE8A 3D3WB 4A23A 8ICGA 4AMYA 2A1JA 3ILSA 3M9OB 5H3HA 1PR4A 3B9JA 1AQLA 2Q3FA 3K4QA 3JZIA 3O8OA 4LJ5A 3JPTA 1KJQA 1UXJA 1XKLA 2K4PA 4XGNA 2CE7A 1XTSA 4E1BA 2PX4A 5F7OA 3ZWKA 4P2BA 2QLTA 2W37A 5PGMA 2H4FA 3SJBA 2YMPA 1MQ2A 3HCRA 1BX3A 5CFRA 1R4NB 1UPAA 1BMFA 1QYDA 2M2IA 4ME6A 5JG7A 4YNBA 5DB6A 4RH3A 2XICA 4GOKA 1PTKA 1UMDB 4AXBA 3IO5A 3H11A 1OKKA 2X5KO 3I34X 1U2GA 5TY0A 4QVIA 2LZ0A 2GBLA 3KKZA 4AO8A 3IELA 3NIWA 3D8RA 5SZHB 4ZOAA 5DB9A 1U2EA 3G89A 3AY6A 2P68A 3G17A 3DHNA 2KHVA 4DLNA 2Q50A 3A4VA 3A4IA 4E12A 2RC6A 3DE3X 3FPBA 1U0RA 1EDZA 1U2RA 3EWSA 2GRAA 3GT0A 3L6UA 3AH8A 5J0OA 3VHXA 1QH9A 5KJCA 1UJNA 1JALA 3UMMA 3DB2A 5HQJA 3UB2A 3UJCA 5GADl 1Q6ZA 1ORVA 2WIAA 2FCRA 5JD4A 2JLXA 4TN1A 3CZRA 5JI3E 4FMPA 3HSYA 5CYFA 1KP9A 1P4RA 4E11A 1W46A 3C24A 1ADGA 1Z36A 2JAOA 3IE0A 2Q3JA 3N8NA 2BCJQ 3QXXA 2CFIA 3TIFA 3VKFA 1SUFA 1JEQB 2WJZB 1X2BA 4J4BA 3F5MA 4RJIA 1V5FA 1NF8A 2C5AA 2J9FA 4FN5A 2TS1A 2G1KA 4LDNA 2C00A 3ALRA 3MGHA 3I2FA 1N7HA 3HS3A 3QWAA 2PT6A 4Q21A 4ZAXA 3AF6A 4IWNA 1IXKA 1U31A 2ID7A 2R8YA 2XCQA 3FD8A 3SX2A 3D5EA 5DBHX 2MR5A 3QMMA 4BX9A 4EY8A 5CRIA 4ECEA 2C4UA 3GFKB 2XUPA 2VDVE 3AV0B 1YDEA 4LYAA 4O8ZA 1DK2A 4TL8A 4RHFA 4XUGB 3ZWMA 4ZZIA 1ZQXA 1EXVA 2ODWA 4C4PA 2CXOA 1XX6A 2WJ3A 4EJSB 1MAUA 3DQPA 3C21A 2XB4A 3MUEA 4YAFA 4M76B 3SLGA 2AFRA 5JVDA 4NMMA 1OASA 1W52X 4ARSA 1Y98A 3CMMA 4UUMA 3ZNQA 2ONKA 3PP8A 1KEKA 2GS9A 4R3UC 1X8XA 4PSAA 2ID4A 2QL9A 1JDJA 3H87A 1HSZA 2GCNA 1SKUA 4D92A 5IVDA 3UBTA 1BROA 2BMFA 1QO0D 3OJEA 521PA 4UHJA 4C87A 1AF4A 5L51A 2NX2A 3MTQA 3ZS9A 3WK5A 5DBCA 3E9NA 4HDNB 3SC6A 4BX3A 1UWCA 1K27A 3ZX4A 1NE2A 4O29A 4JSRA 5LA6A 4YPVA 4L85A 3D31A 2X3YA 2XYVA 2BGWA 3GR6A 4X94A 4BLOA 4C6TA 2EZTA 4EG7A 2ZSEA 3MB8A 2H7XA 4OQXA 5C46F 1ZQOA 1VSUA 3RD5A 3ANMA 3ZK7A 5CFNA 1KWGA 2K4EA 1V6SA 2OPHA 4JLOA 4BO8A 1IYZA 1B4FA 1O8CA 1UOQA 3FTDA 2QD1A 2JGIA 2LKCA 1NVVR 1JI0A 2QRUA 2W48A 2GPAA 1P19A 2W2NA 2DERA 2ERCA 5HXAA 1DAPA 4LC1A 1HT0A 2QM0A 4A1FA 5HTOA 4ENRA 2P2CA 1SUAA 4UAYA 2H5XA 1L7EA 2LTAA 3F78A 4R3WA 1AURA 3PSPA 3AY3A 4LJLA 3NC4A 1RI1A 3A6KA 5EQDA 4BGVA 2PWBA 1W47A 2PR7A 2J3HA 1DWUA 2X9VA 2YRXA 3CE6A 4QJ4A 2J59A 1CQIB 2WYOA 4JJ8A 4KH0A 5JWRA 2XUOA 3VBCA 1ES9A 4FR0A 4MCIA 2YWCA 3K9NA 4WAUA 4XR4A 3AVXA 4Y2HA 3TMYA 2BZ1A 1PGPA 1SULA 2FHPA 3DYIA 5HWSA 3B1JA 2DPGA 3ZD8A 1FXSA 1ULHA 1I3NA 4IDNA 5BWBA 1V41E 4OGKA 3FCEA 3NYWA 4O5KA 3BBPA 3FLEA 1UBUS 4KL8S 4UB8U 3RYFB 5KT6A 1JIJA 2FFQA 3L77A 4PXYA 1SXGA 3BD9A 5TB5A 4LYGA 1C1HA 3RVRA 3QG5A 5E1DA 3EIEA 2AEJA 3I01A 1WULS 4M60A 4QJ5A 3KV1A 2VJCA 4G0QA 4WNYA 3P0EA 2PUTA 1G4HA 1MOQA 3G13A 1COZA 1V8PA 1RXUA 1CKEA 3I9MA 4UB2A 5TEWA 4BMCA 2YHIB 2EKDA 1SFRA 4V0NA 1E2DA 2WOOA 4C30A 2E4WA 3V7FA 3QZ7A 3AUKA 3HDHA 5CM2Z 5FA8A 1WIWA 3A0BU 3DMNA 1FXWF 2PS9A 2V6FA 1RW4A 2NUPA 4JBGA 4L8FA 4AMGA 3P9XA 4FIZA 1JLMA 1E2FA 2CJYA 3L05A 4Q7KA 5FI0B 2IS6A 4QZGA 4WH0A 1C7RA 1X87A 4WJKB 4BP1A 4F12A 2XBMA 5CJJA 1TKCA 4C88A 2O8DB 3S2IA 2GM9A 3TGWA 4UAVA 4C0ZA 1BC5A 3JQ9C 1VLZA 4BLTA 1G6Q1 9ICXA 1WW8A 1Z45A 3B1ZA 1KBUA 3R40A 4XWTA 4IJUA 3VUFA 2KVCA 6ABPA 1H4SA 2MTBA 4U0JA 3S55A 2O3SA 1EVQA 5EVJA 4FBUA 2X2FA 5JT1A 5KTKA 2OORC 3DDZX 3UG6A 6REQB 2PQ0A 4DR4B 1EB9A 3DDSA 5D86A 1WUJS 2BJHA 5HX7A 1Z2OX 1JLRA 4RFVA 5F5XA 2UYCA 3JS5A 5ERGB 3SYLA 3UQZA 4XTRA 4RH0A 2WU1A 5FEMA 1JWLA 4LZWA 2HOIA 1VLBA 1OBHA 2CEKA 2G6TA 1Q2XA 1L5SA 3HK2A 1I80A 2PA0A 2AG0A 1ZH0A 4V0RA 1V4VA 3SQOA 5EUMA 3RS9A 2HHVA 2JFZA 1XZPA 3I09A 1WV1A 1Z5OA 2REXB 4KSCA 3FOCA 3LBFA 4HH1A 4O4LB 1M2EA 4EHKA 4ARZB 4CI9A 5FUMA 1X7XA 2AEFA 4HXYA 2QPAA 2D8CA 3AVUA 1NY5A 1Y3HA 5DG9A 3LDHA 3VH3A 4C0BA 3STYA 5JAHA 2D7CA 4N54A 1XTKA 4OIFA 2WFLA 2LI6A 2YJGA 3QBJA 4K6FA 5C8YF 1SC9A 2V9ZA 1T1IA 4RLSA 4RZHA 4TXHA 4NECA 2WMDA 2HAEA 1W0JA 4WD3A 4HV4A 1WR8A 4MIOA 3RYTC 3T34A 9ICFA 2QN7A 4O2BF 4RL6A 1AHPA 1RKUA 2CB9A 4XXHA 1DBRA 4EJ0A 2UU9B 2GAIA 3QNWA 4YCLA 1RYMA 1CUWA 1Q46A 3DFZA 4HC4A 3AW9A 1QRAA 4BNVA 5IANA 1R0RE 5IU6A 1OW3B 3I1FA 3AMZA 1OPRA 2ZI9A 2HDOA 1L2TA 4O4JA 1HFWA 3QKSB 3TLKA 4TXJA 5FR2A 4YQZA 3T4UA 5EIWA 4IR9A 3ACDA 2K6GA 1EM8B 4LGMA 4ZAZA 3BREA 1JLSA 2P0YA 3EG9A 1OWNA 4UNNA 4GZLA 4I66A 3ZHXA 2B8JA 4FEYA 3TQSA 2Q1UA 1GZ5A 4MB0A 4MMXB 4DMGA 1QHFA 2CKMA 1CRXA 3KYBA 3ND5A 4BCDA 3N97B 2F8KA 1JAHA 3ABRB 1XNJA 3CRZA 5EJFA 4XOIA 4X61A 2IEIA 1Q8KA 1B0PA 2E85A 3PQ3A 3T4XA 3NDBB 1A0PA 3CCBA 4RD1A 2SKCA 4R1UA 1Q2UA 4E0DA 4MSUA 4OCZA 1CIJA 3A14A 2WHPB 1MO5A 1ZOLA 4YRSA 3TR6A 5T3YA 2WC1A 3JRXA 4DC0A 3I9OA 4BNYA 3L0OA 1VHWA 2EJVA 4BAGA 1Z13A 4BGIA 3F9CA 3AUUA 5I6DA 5DM0A 3DKKA 4N47A 5KTPA 4YQFA 1TRHA 3G6KA 1NR1A 1XD9A 4WADA 5CNKA 2CV1A 5DPMA 3ER6A 5DYTA 1PK7A 4TLCA 4ZTZB 1XNRB 1XAHA 1LBQA 2JCVA 1C9DB 3ZD9A 2Q1WA 3RR2A 1DB3A 3D7KA 3V46A 3JQEA 3O82A 1UKVY 2X8AA 1A6SA 4YRPA 2YNMA 1GKYA 3WICA 4A2WA 4PG6A 3ZGYA 3K3PA 2WT4A 2PX6A 4PN3A 4NX2A 4ZYWA 5BQFA 1JTVA 5TPZD 1Y4DE 3DBRB 4EF5A 4LHZA 3LTNC 1SU8A 4Q9JA 2D5IA 3W6NA 1OAOC 1UFOA 5CVJA 5EWMA 3EFBA 3P1JA 3E2IA 3DMRA 7ICLA 4ENQA 3E1KA 3AUOA 1WMAA 4NCJA 3AKCA 1QWSA 2QV0A 4TQAA 2IY8A 2XMRA 3LLMA 4UREA 5EMHA 4E2XA 4N40A 3T5DA 3OOEA 1HXHA 4KI7A 2AB0A 1QV7A 2VFAA 4I2JA 5CTAA 4WLUA 3WDLA 3IOMA 1WVIA 4J94A 2GH1A 3V2HA 3ESQA 3CEJA 4MWZA 4CN8A 4ZZ2A 4JMPA 1L5LA 4AZ0B 1S0VA 3ETHA 4QUEA 1GLNA 3VM6A 3V4ZA 3ZY3A 4D0GA 2AVDA 3D8TA 5KSPA 4G4GA 4M54A 2QORA 2PI4A 2PFGA 2YS7A 3ZWPA 4DZTA 4YUAA 2NU9B 3THYA 4QJ3A 3SC4A 4RQ3A 2MUTA 2OB2A 4NHOA 4F50A 3GVCA 4IDEA 4M89A 1XD8A 5DNVA 4ZALA 3SM3A 4F21A 1CETA 1M9NA 4ZAWA 3P0IA 2PGIA 2OXOA 1FYFA 1G6OA 2A1IA 3LV8A 3KQPA 4YFYA 3KR1A 4RV4A 4YGXB 5D7NA 1GGHA 5AW9A 3RC8A 5KYWB 3HW8A 1XF1A 2DZDA 2GARA 4YPOA 1VHJA 4OH7A 1E8NA 3KJZA 1AKWA 3N3AC 4FYXA 2MJLA 4RD6A 2EP7A 1FPQA 1N6KA 2J31A 4LPSA 1P7YA 3S7ZA 4Z4CA 5B5SA 5G53C 2ASDA 1EVZA 4C7KA 3JQAB 3REOA 1W94A 4HVCA 3JAMA 1QDEA 3IESA 3GJ7A 3R6DA 3RTEA 1R8YA 1Z2AA 2H54A 4P22A 2DM6A 3MCAA 4RNDB 5TQ0B 2X9GA 2J0SA 4R6XA 2PANA 4HH3C 4WOPA 1AGRA 5AKIA 2EFHB 2JFFA 1X9XA 1ZQAA 5L1KA 1EDBA 3H16A 1E62A 2K8AA 2AR7A 3I72A 4U0KA 3ULKA 4NCXA 9ICBA 1MIHA 3DBHB 1MP0A 4D74A 1NN0A 5IKPA 5DHFA 2NACA 2H48A 4CV0A 3LCUA 3BJZA 2MYPA 3AMVA 1KA9H 1SM4A 2ECFA 2MSWA 3QQPA 4IIBA 4CTKA 4Z6KA 1BRTA 3WAGA 1XCLA 1CUCA 3SAFA 1JQEA 4JI8B 4ZQGA 4K3UA 3CKKA 1R64A 3JYOA 3CX8A 3OEED 4ZYYA 2RB5A 4RBNA 1L7RA 4X6XA 1KEZA 3W06A 3N2ZB 1PEKE 4I2VA 3SBDA 5IASA 1Y7PA 4EARA 1ONOA 3AF5A 3ORFA 4HP8A 4AKHA 1YQWA 3R7AA 4FBLA 1Z0JA 1E3EA 3BAFA 5A4JA 3RRYA 2FWMX 1U7XA 1HI9A 2BL4A 1QPBA 1Y6FA 1NTRA 2RK6A 1Y80A 1ZITA 1W85B 2KJ5A 4W5JA 1HFEL 2KMLA 4KLCA 1RMTA 5H02A 5IMBA 3ZYZA 2O8CB 2GPSA 1V35A 2CMKA 2MT9A 3BSSA 3D54D 4IZIA 4JI7B 1IHXA 4J03A 4KLUA 4WDQA 4NBUA 3PO4A 5EJAA 2ZRCA 3U4GA 3CX6A 4FS3A 2QTAA 4HNAB 1TZ2A 1SPXA 1W4AA 3M2PA 2X9LA 2IH4A 4JWKA 1B6GA 3DV0B 4RZXA 2C95A 5JUMA 4G1EB 3PFFA 4TLBA 4D0RA 1BVYF 3GRCA 2CLKB 2EFGA 1BGXT 1A7JA 1FUEA 1WPRA 1JQ3A 3RV3A 5BN3B 3MFYA 3ONVA 2GM3A 1VECA 1H6CA 1QLWA 4XLTA 3KFXA 4TUYB 4XWKA 4IIFA 5K03A 4BV3A 4L22A 2C4MA 4P4SA 3H3JA 4P93A 1D9XA 2ODPA 4XUEA 4WEOA 4ZO4A 2BDPA 2GJ4A 3G1UA 4DSLA 2EP5A 5EESA 4DQDA 3AR8A 1JDBC 1O77A 3DV2A 4R84A 4IVPA 5EQTA 1T36A 2NO9A 3T1HB 2JLYA 2GEFA 1T3TA 3TXXA 5MF6A 3S8EA 1TPYA 2HJWA 3TGPA 4OHFA 1Q3HA 3DUFA 4YX9A 3LYAA 2PFQA 4MTLA 3IVCA 4OVKA 4C0AC 3L04A 3KB8A 3PC7A 4UM9B 2FJ0A 2P6NA 1AO0A 2JBAA 3NRBA 3U7GA 2XZTA 4KO2S 1UBKS 4W5RA 1BX1A 1G3MA 4IDHA 2MINB 5CM8B 1RYBA 1UK8A 2HIAA 1UPXA 4F4KA 1G18A 1VBNA 2RIRA 4KI0A 1YL5A 2FQXA 1UXGA 3FHOA 5ITZB 1M83A 1ZC3A 3RFUA 3WNZA 5HUQA 1AQJA 3WKCA 4Q7JB 2HB6A 2I5HA 1DWPA 1Y1LA 3AONB 5G41A 1SCAA 1TLLA 2H6EA 2WJYA 2I54A 4OFBA 4QBHA 4MKZA 4MVJP 1POWA 3LOUA 5KOJA 5AW3A 1PZXA 1A7KA 1YB7A 3C16C 1HEKA 1JWBB 4HRYA 5EGNA 3UH1A 2LPEA 1RZRD 1C4OA 4GGMX 1JH9A 2Z8ZA 4B85A 1GQ2A 1UM9B 3FH0A 4AROA 2YXLA 5ARCA 1PFGA 2C96A 4AP9A 1ML3A 1XXHB 1QZUA 2WJHA 3DGFC 4HB3A 4LE0A 3TNDA 2ZATA 4EG0A 2GBGA 3G2NA 4DSZA 4QPPA 3TAXA 2P8JA 1CZLA 2IHBA 1QRTA 3DZ8A 3G9XA 3T3OA 3TNJA 3RB4A 4MGEA 3UK6A 4G1VA 4Z4QA 2Q29A 4QZIA 1LTQA 2Z3ZA 4R8UB 4ED3A 3BFXA 1VL1A 3QYJA 4WT7A 1JFSA 3GEIA 2VYNA 2ARKA 3RSHA 3PJRA 3TQCA 2IGBA 2HQSA 2JH3A 1SKMA 4I50B 3E3AA 1WHSA 4ZO7A 2B5VA 5CX4A 2H5IA 4KFRA 2VPPA 3ROGA 5BP7A 4OXKA 2BKLA 3GDXA 1NDHA 3ZCSA 5FFMA 1SAYA 1ZW6A 2YV5A 1U11A 4OB6A 1U0NA 3ORSA 4PZCA 1FP2A 1IB6A 2BJWA 4DFDA 1XU9A 4K88A 4YONB 4BJ1A 3SX0A 1KU6A 3HCBA 5BSRA 1QUFA 4DQXA 1OX6A 1NJXA 3T9BA 3VSCA 2ET6A 3W34A 4V1CB 5G3ZA 4Y2JA 4I27A 2F1OA 4FYKA 1N48A 1JHDA 3AHDA 4PS0A 4YAGA 2EBWA 3UEOA 4KB5A 3KT0A 1E5TA 3DDHA 1V1RA 1VI2A 2XCIA 3CMCO 1P7PA 3AL2A 3N3BC 2H1OA 4QEZA 3BE8A 1FSSA 1KDRA 3BTOA 3KJFA 3MHPA 3PC2A 2Z4SA 5ALVA 4LHEA 4BIIA 4NZNA 4Q01A 2WAQC 2KX7A 2FW1A 4DIOA 4YDQA 5JZ9A 3AVVA 2BCSA 4ZRMA 1DO8A 1NQXA 1S2NA 1FP4A 3IPAA 1G9TA 3U9TA 3H4MA 3S2ZA 1IATA 3DONA 3KPYA 3KP1A 3W5UA 1NMYA 2WF9A 1LS6A 1NZDA 4CKXA 5KHAA 1TA4A 2N42A 2V4ZA 3LD9A 2IPNA 2Y27A 1XN4A 5DG8A 2ODQA 2WJ6A 3VZBA 1GL7A 1HPLA 1XC7A 3AETB 3GXBA 3MCTA 4CF5A 2QN3A 3OM0A 4DLPA 4M1MA 2Q28A 4TKMA 1QOPB 4DCCA 3H8VA 3CLUC 1M33A 2FHSA 2ICAA 1XTPA 5ES3A 2OV1A 3RWBA 4BTVA 3JASA 1L8XA 4ZDJA 3V1YA 1GA1A 3IP7A 3A6HA 3VDNB 1B76A 1KYZA 3FPAA 3BFJA 4YV0A 1UKZA 1N0UA 5FQNA 2G06A 3EUAA 4O4IB 2ZZMA 5G02A 1FLAA 2VDUE 4OI4A 5FORA 5CDFE 1ZQ1C 2FN8A 4JCOA 5IABA 1RRMA 2XVAA 1QRRA 5JAUA 4ZZ3A 1TAUA 1Z0SA 2H0AA 1AZSC 2ALJA 4ZFNA 4KH1A 4XX1A 4TWBA 1E89A 4N3AA 1ZA1A 3ILHA 5CT4A 4AG5A 2OCBA 1E9EA 2WPDD 4KDCA 1OTYA 2C92A 3V34A 2R60A 1OBOA 1YS9A 2HPZA 3GNLA 4YUWA 2IEYA 2ZBDA 4IF6A 1Y4ZA 2VHYA 3FYDA 1AQ6A 3FYTA 4XQGA 3M49A 1P4SA 4PZLA 4Q6WA 1E63A 3JQ7B 2A5FA 2PX3A 2YY7A 3DW1X 4JP3A 3L3FX 1RKXA 2F1KA 3I6QA 1W4BA 3KSRA 1ED1A 4B9AA 4B9EA 4JA0A 2PUGA 2AFIB 2HNBA 4X8MA 3RRHA 2ISQA 3NRWA 2PYDA 2YV3A 1SB3C 2YYYA 1E9CA 3GPDG 1RZRA 2QTLA 3CH7A 1GGMA 5JMOA 4YR0A 4A3SA 3OOHA 5H3LA 4B1FA 5BVHA 2Y1CA 4D98A 3KQOA 3IG8A 1F60A 4JR1A 3UWDA 4KR3A 4H6VA 4JP8A 4XKJA 3DXXA 4UVDA 4FFVA 3IKLA 3I3OA 1UJ5A 5TV2A 2W6PA 5BW6B 2H2HA 3CQ9A 2I6XA 2ZZNA 5BMOA 1XPOA 1WBJB 2VP6A 5DGHA 2IOFA 3ZDRA 2WUEA 5JWHA 1S01A 5HRAA 5B66U 5EZ5A 4OHZA 1F2UA 1M1XB 4J9MA 3ANYB 3GPBA 1ORRA 4UBNA 1TFRA 1P1HA 3FSGD 4Y2SA 3A9SA 1Y5RA 1ZUHA 2VF5X 1OFIA 1GUZA 2ECOA 3SS9X 4ALMA 3QGMA 4PAMA 5JC8A 1V7ZA 1U04A 1Z8DA 3OE7A 1FP6A 1KP2A 4H31A 4UZEA 4Z1OA 4UUQA 4PO9A 1LF0A 4KLIA 3ZJUA 2VRBA 4KTVE 1U4NA 1V3TA 2PBRA 4NYJQ 3RB8A 5LWQA 3BT7A 2EZ4A 3X43A 1NUPA 4I28A 4C80A 2A0YA 2FXVA 3GQBB 3LT5A 1M1ZA 2FMIA 2I4IA 3CPEA 4KIUA 4KMOA 4DMRA 4YD1A 4EVQA 2MU1A 4OSPA 3TBFA 3DE7X 4CR7A 4HH4A 1NYLA 2N0SA 4LXGA 2ZUCA 2GDJA 4EDFA 1NW8A 3L8FA 2FE9A 5DLFA 1ZGCA 3RSFA 5B7PA 5ISMA 4HKTA 4U2CA 3AQ4A 1USWA 3QVOA 4FILA 2A58A 3GPIA 1ZRSA 3TARA 2QY6A 3CX4A 1E1KA 2VJPA 1YSCA 1ABBA 2YYSA 4TV8B 4FZ5A 4YP0A 1MHPA 1M2VB 3DNMA 3HUTA 3ILVA 5A0LA 3OT4A 2Y9UA 1M6WA 4M8LA 4MCJA 5DNCA 5LMCA 1F48A 1C0EA 1U0FA 3DE1X 1QH8B 3C3DA 1TJ3A 2C7BA 4IHAA 3P9CA 5YASA 3TK1A 3N1UA 1ZRHA 4RJ2A 1PTJC 3EDMA 3GRUA 4K9DA 1LPBB 2P65A 2A4KA 4JOQA 3IR5A 1H8HD 2ZUEA 1GZUA 5J0XA 3CH5A 2HSZA 4TRNA 3UK2A 1XGKA 3R5JA 1XNSA 3JVIA 1NF9A 2FSPA 4HDAA 5KOIA 3TN7A 1D04A 3Q41A 5FJIA 2OMKA 4JHXA 3X2FA 2VF7A 4Z7JA 4OHOA 1FFBA 3I92A 3QPWA 2RIPA 3COYA 1IY1A 1ONPA 4R2LA 5SZJA 1ZOPA 2C94A 1NHGA 3VJRA 3BHJA 4Y1RA 1WOYA 2PAFA 2LKYA 5LQDA 2W54A 1RJWA 3AI1A 3G0OA 2X40A 4JT2A 3IP5A 4NOMA 1JFVA 4JX9A 2JAPA 3GJRA 2WM3A 5G40A 2P9EA 2RGXA 5JNVA 3E9RA 4G5QA 3U62A 2B21A 2VJKA 4C8KA 1MD9A 2GZAA 5CFZA 1JS1X 2FQWA 4JYPA 1DE0A 1QIEA 3C45A 4X8HA 2XRZA 2M6RA 5BR1A 3JYLA 1LBTA 8ICAA 2AOUA 4U7FA 5IUJC 4MULA 2UUCB 4YXJA 4AJ2A 3I1IA 1IHPA 1XQXA 1XVTA 1Q0UA 1ZN7A 3ANLA 3NDRA 1ETUA 1ZIXA 3ML1A 3OUUA 4R5MA 3CKMA 2HU8A 1ECPA 4D81A 1YO6A 2XD9A 3URKA 1RRPA 4E7PA 4FI3F 2EFYA 1L3SA 3Q9SA 5DM70 2ODGA 3OPXA 3A3PA 1ULZA 3EIWA 3LGAA 2IPXA 1PWEA 4G0MA 3VPXA 1VSTA 3CJQA 1VE3A 1W5FA 4E5NA 3KQNA 3MSXA 4BBZA 1VLMA 4L3OA 3VTFA 4DXDA 4YCJA 4IVQA 1MEEA 1VMDA 3FVRA 4QPNA 3U0BA 2X8JB 1H2AS 4ND8B 2WG2A 2A86A 1IXRA 3E8MA 4Q12A 4WMLA 5AXCA 1CU1A 5LQUA 3ZDFA 3QVUA 1Z38A 1NJ1A 5DM1A 1I2CA 3V6MA 1M0SA 2I2BA 2XECA 2H2FA 4FXOA 2Q1YA 2GJSA 3LBNA 2PNJA 5AW6A 5DI3B 2P2ZA 3VAZA 1OIWA 3CVWA 3C1TA 4FX2A 3HSSA 2X1VA 1PT5A 2J3QA 3K5HA 3G59A 4TKLA 5GJWC 3VJKA 1X6IA 2CYBA 4OU4A 4N0MA 4PRKA 4E7OA 1T2FA 2YXBA 2XJ9A 3AR4A 4GPD1 4HQNA 3S2EA 5CEFA 2QBYB 1U0BB 3O93A 2XRFA 1AHIA 4NH0A 1PVOA 2GYVA 3HN6A 3LWZA 4ACAA 2H3VA 1NVGA 3GLQA 4XM1A 1C7YA 4NV0A 2QRVA 3GT4A 4ECTA 1R4MA 1BPEA 4JITA 4ALLA 4JEMA 1JTFA 3AF0A 2EWVA 3I58A 3Q12A 3W6ZA 3E03A 1SY7A 1V8BA 5COBA 2IYZA 4QASA 1T9HA 2OK7A 1LK7A 1Z17A 4QA9A 3RQIA 1L4YA 2HRDA 2C2BA 2WZCA 4PV7A 2VP0A 5H9VA 5A71A 3WADA 3D7SA 4BGEA 4IHJF 4YJFA 2JFGA 5F33A 4XRGA 2XGMA 4XVUA 2AN5A 2FSHA 1CR4A 3SF8A 4JC5A 2BBWA 3O3OB 3Q0IA 2X5JO 1CJCA 4PAWA 1CEEA 4IS3A 3RSZA 3V8VA 3LUBA 3OJSA 3KYIB 4HAVA 9ICIA 4HDOB 4IDPA 1U8TA 3ZXYA 1FLNA 1TGYA 1NK0A 3C3XA 4MS1A 4ZYVA 2G1PA 4OX9Y 2ZSHA 4JJEA 5EC8A 2ZUTA 4XIIA 5A06A 5L3QB 3FDZB 2JD2A 1N5MA 1YE3A 2AWNA 2X58A 3EOBI 1NUSA 4QELA 1IEXA 2WSBA 5FNVA 1WXWA 1CR1A 3CVYA 1SKRA 3ENWA 1KVSA 5AUNB 5EI5A 4ISBA 2QVXX 4F6LA 4B9UA 5AVKA 3W5DA 1OV4A 3QUAA 1JDSA 3R3VA 3KJHA 5DEOA 3FNGA 1CQZA 4Y2YA 1JDNA 3PLAE 1ISGA 1G4AE 4BXOB 3HWSA 1MQ3A 3PPIA 3RT1A 4DNFA 1RC8A 5HR5A 2WBLC 2E1EA 2PI5A 3T3DA 4A5SA 2YXNA 2CXTA 1NK8A 1O6FA 1ZONA 3NRCA 5FOVA 5ER6A 4EA9A 2BFWA 1CUFA 3USCS 1MB9A 1QTQA 4GL4A 3IS3A 3WVNA 2E49A 2IPOA 2DULA 1YDWA 2OD2A 4DV2B 4BB6A 5DI9A 5KL1B 1PBNA 4R9RA 1J0EA 3WNCA 1R66A 4YRBA 2HOQA 5CHYA 3T3GA 1KFTA 1NBWB 1SJ9A 4HWOA 1K4MA 2VYND 2R7NA 5T5QA 1IM5A 4P08A 3TF5A 1OB5A 4O3NA 1N2HA 2Q45A 1OLXA 4ZU3A 2VPXA 1DRKA 3SMVA 4MRSA 4U4AA 4CEHB 1XWLA 1MX1A 3BKWA 4R8MA 3G2KA 3X44A 1F1BA 2BM0A 2R1TA 3T5BA 4CN9A 4E13A 1HDIA 3H2HA 1GNRA 1NV8A 3LK6A 4YCAA 1TJYA 4JVOA 4QJBA 5J40A 3T7EA 1DIAA 3HB1A 2X86A 3OU7A 3MGAA 3JY6A 2X19A 4GMXA 3VR2D 3HH8A 4AY5A 2OBMA 2PPVA 3SOZA 1C7FA 2GK6A 1PG2A 1FTYA 2E18A 3A28A 2ZRLA 2IUEA 1QSLA 2WSIA 3HUUA 3EXEA 4ZC8A 2UVPA 4QLAA 1G8MA 4LGCA 4LQCA 1YRYE 5CPBA 5GAJA 2JLRA 3CLTC 4I1IA 4OXRA 4WNAB 3U48A 1PR0A 2P1ZA 1D4OA 3JAWB 3DGEC 1U9ZA 4W5HA 5JYBA 2SNIE 3QU7A 1JIVA 2CYAA 1T9CA 2IXTA 4DWJA 3UANA 1TK2A 4S24A 5FRDA 4YXWD 2BQ3A 1NJ5A 2Q6LA 4ZO6A 3IG5A 1NVUQ 2QX4A 4HVAA 3EVGA 5LC1A 1V39A 3QEMA 3WL3A 5KU7A 3RTVA 1H5QA 1TECE 2OA0A 5BSEA 3AU8A 2J3MA 1ZEMA 1UQVA 3G6WA 2HN9A 1D9FA 4I4NA 4L2IA 3RTCA 3Q6MA 3SZOA 1WDMA 2OBBA 4NLLA 5ICFA 4W5TA 2ZM6B 4Z0HO 3HYCA 3TPZA 1U4BA 4RY9A 4NY1A 1GU1A 1F9EA 5B58T 1O0CA 2IU4A 3ZU3A 4BMZA 4BKRA 3RYCA 2IV7A 4MVJI 5JNTA 3WLTA 2W2KA 2FSFA 4BZXA 5DHUA 8ICYA 2L2QA 7GPBA 3MOIA 4C2BA 4CIWA 4OQEA 1Q1ZA 2F4NA 5E6SB 1NQVA 2HXGA 2W6ID 2E4XA 4H16A 4BNMA 3EXIB 3R3HA 1O6ZA 1B8OA 4MOWA 4OUDB 3TH5A 1HLPA 1KQOA 4JXJA 3ZI0A 3KKLA 4E94A 1YZLA 1WY5A 4L74A 1MO4A 3SENA 4K9KA 4MWSA 1I2DA 1IK6A 4EBFA 2Y6UA 4NK4A 2JGMA 3FM9A 5KYXA 2LM4A 2FMFA 4YMMA 2Y4OA 3I6BA 3SZRA 1PW7A 1KEJA 1E7WA 4Q4JB 3WMEA 9LDBA 4BLSA 5U1PA 4P4TA 1Y9DA 1NDUA 1NXPA 4JJGA 2P35A 4LJAA 4N49A 1JLLB 3FNEA 1Y6GA 3C3BA 2QY9A 1EGVB 2EJBA 2QW8A 2QR5A 3PVCA 4TX1A 3TTSA 3LQFA 1ZU4A 3DLTA 8ICKA 3JYNA 2C3PA 3LUKA 3PU6A 2W6OA 3MC1A 4R8KA 5IS2A 3PGMA 5J47A 2HW8A 3OD5A 1YIOA 1JA1A 5SY9A 2R8JA 2XOXA 2HHQA 4IQ0A 3TPCA 4BFTA 5KNBD 3G5UA 4OJTA 3O8RA 4HTFB 1C4WA 3OFKA 3QUBA 1NK5A 3I2IA 2GYUA 4DIUA 4FDAA 4GGOA 5MFZA 1Z6TA 4DCJA 1YFKA 3COWA 3KE8A 1ZSYA 5J2JA 4ZT4A 2R00C 1CD5A 3EGDB 5H4HA 3ER9A 1SKAA 3HU2A 3DMGA 1NT2A 4RACA 4IL6U 3HY6A 4EY3A 1FFEA 2DFVA 3B12A 1EGQA 4GXJA 1JHPA 2N1BA 4RELA 3HI6A 1OZFA 5FD8A 2MRLA 3C1YA 1LZLA 1TF7A 1U90A 5DWQA 3X1KA 3ZHVA 1XTUA 3OZRA 2CXXA 2OGWA 4XE5A 3X1YA 5KFOA 5A5FA 5JCXA 4HAIA 1ZQRA 1KHTA 3HYRA 4DMKA 4HAXA 1VJRA 1LJUA 4QZHA 5TQ2A 5INTA 3DCIA 4JYCA 4PZDA 4RA6A 2XDQB 5E7IA 8ATCA 4GVPA 2NW6A 3KKPA 2ZUDA 4AJLA 1U48A 5B1DA 5IH3A 2DWQA 1E18A 1O03A 4DYHA 3CP8A 1Z7YA 1MZVA 3LQQA 4ZJUA 1ZZGA 1O89A 3JRNA 4JKIA 1KDPA 3TQRA 1R0KA 3RUPA 3DOEA 3LRXA 3V1NA 3ZDBA 5AKLA 3PT9A 3OA2A 2A5DA 3LLVA 3HYSA 3I12A 3NAMA 4OOFA 3CB2A 3H1FA 2PAAA 5FOUA 5B2EA 3D1VA 5D3KA 5JSZB 3IA7A 1N5IA 3Q40A 2ZRQA 1QJCA 2C5LA 1EK1A 2BUBA 1FU8A 2FN9A 4LZNA 2I33A 1AXRA 1UWKA 3K0FA 4GYYA 4W7HA 4WUTA 5IP5A 4W63A 3AM4A 3ONWA 4G4JA 4J8PA 4ZHQB 4GXKA 2JZCA 4P35A 2Z1NA 5KT7A 4AP5A 2A59A 4FXPA 4CEJA 4GOND 2J9FB 3WYFA 4BLPA 3UBMA 3HVUA 4E3ZA 3A9TA 4ZC1A 4ERXA 1PLJA 3EFOB 4KGDA 5L3SB 3QV1A 5KCMA 2C9OA 4RVHA 2JLZA 4G89A 4ZVNA 3HO1A 1SU6A 2CVQA 2W7PA 2P27A 3SFVA 4DSOA 4TQ9A 2JHDA 5FPPA 1YC5A 2WQ6A 3H5RA 3RTDA 3HDJA 4TUSA 1YZGA 1JWAB 2RG7A 2GPTA 2CBGA 5CA1B 3ANNA 2HHJA 4EJSA 5JFTA 3ME5A 5KKNB 5K2OA 2AYZA 4P4OA 3I61A 3FIJA 4PQFA 2Q41A 3LXMA 1KEWA 2PUDA 3NT5A 4EFKA 4LZJA 1H3EA 4I8DA 5H9WA 3H7AA 2CZGA 1OVGA 1PLLA 4BVHA 1JA0A 2IYUA 2HU5A 3GUCA 2V6JA 2PJRA 5IKEA 1ZSVA 2H7YA 1HLGA 1M34A 3M7DA 1W7AA 4N9WA 5FOXA 3HGMA 5EP1A 1ZFNA 4TYYA 1YT3A 1KARA 3PQ7A 2IPAB 4IZHA 4JUIA 3WK9A 4L5IA 5CVEA 3LWLA 3KQYA 3RAPR 3VXKA 4BNZA 3B1FA 4CCYA 2EOAA 3N8KA 2AW5A 4UTVA 2NGRA 4D4LA 3P94A 3AHEA 3M8SA 4BJQA 1FYVA 3DEIA 2DLNA 1AKTA 3A1EA 4I99A 4DMCA 1HRDA 2ZULA 1TDJA 2XB2A 3ZCQA 4L4YA 3CO0S 2QGZA 1ZK4A 3EXFB 4M1OA 3O26A 1E4OA 4X3OA 3TM4A 5LKAA 4XFKA 3MN1A 2NZ2A 2ZTUA 1Z3EB 3VGJA 3W9SA 4DCOA 3GEGA 1QWOA 4ZCSA 4Q4DA 4DUPA 3SEIA 3C3WA 3CX3A 5FA5A 2AOWA 2P9TA 3F5EA 4NCBA 4PQGA 5BMVA 2QJWA 3F4LA 3LI2A 4R81A 1N2SA 1Z5GA 2QVLA 3KXDA 2BT4A 2TRSB 1MT0A 3SC2B 2YWJA 3AQIA 2P8SA 4QNLA 4EDHA 3MJVA 5E1OA 4Y6LA 3QLVA 1HQKA 4M1YA 3GQCA 4QEKA 5DN6A 3A4TA 3SR0A 4YN4A 4JKYA 3V32A 1NRJB 7ICEA 1C81A 1MRZA 1VYUA 2VATA 1J8YF 3PDUA 2VDLB 4H3HB 3CF4A 1M0TA 4RVCA 4B40A 3JR7A 1U47A 1QR6A 1D2HA 1P2FA 1YS1X 4MEJA 3Q7IA 3LL4A 1ZVKA 3WXBA 1V97A 1IY9A 1TYBE 2GZRA 3T7CA 2OTCA 2AKAB 3MK31 4YREA 1E1MA 1BXRA 1GNLA 1M7HA 2J0VA 5LZ7A 5KVSA 4PGHA 1ZM2A 1Y1PA 4KBYA 3L8GA 3OD1A 4AKGA 2VJLA 4CMIB 4MYCA 1SVWA 3OBIA 3ND7A 2R1ZA 4HH0A 3TLYA 5JBQA 1N60A 3L8CA 1JG6A 5C8YA 1TZBA 4I5FA 4B47A 1XZMA 4C2UA 1CR0A 1I2BA 3WLAA 1JZTA 3ZGLA 1XHLA 2HIMA 2C2DA 3GP8A 3UT6A 4UBCA 1ZH8A 3H3XA 3SDZA 4B0OA 4BVAA 1OH7A 2LUOA 5EJ4A 2AFIE 1ISJA 5CVUA 1WG8A 1DCKA 3TZLA 3QF4A 1U0TA 3PXCX 4KQ9A 3U9SA 5JNSA 1Z00B 1Q7BA 2QRJA 2W6CX 3AL3A 2XY4A 8ICPA 2F67A 2HA6A 2GN1A 3GAFA 3GLSA 3HXKA 4DFMA 3KLMX 2XPCA 2F4VB 1SHZA 3B6IA 2P3LA 2QP3A 3GYBA 1USIA 3L5OA 4PHPA 1WDTA 3N0VA 2JAWA 4E07A 4ZZ1A 5JLJA 1J33A 1TI7A 1QZXA 2X23A 2ANBA 2Q6TA 1S9FA 1IG6A 1U2DA 1Z08A 1GV0A 2NUPB 2Q5JA 3AERA 4IJVA 1U3CA 2DKFA 3OICA 3CPHA 3QIAA 3QXJA 5IKOA 4EG5A 1GPYA 4H4EA 1IXRC 1DC8A 2DFTA 1WCIB 2FK8A 4CPDA 3L8MA 4LZZA 4PIMA 3CGWA 3H2KA 5FAKA 1GPNA 1U0JA 4I5EA 5ALXA 4Q4AA 4RYLA 5K2MA 1ZMRA 4LOHA 2ZSFA 4FSDA 3WV4A 4AY6A 1U3FA 4F3YA 1ATZA 2ZXFA 3WGTA 4J9RA 2OFXA 5AVQA 1I7QB 3NWJA 1PGQA 3LDUA 4XJSA 2YN4A 1YCHA 1T7PA 4YRMA 3B52X 3U26A 3PXEA 3RJ5A 1EVIA 1NBIA 4W8OA 2HMYB 4LYHA 1ADCA 1JEDA 4KUEA 3RFVA 2YWXA 4S1OA 3B1WA 1MORA 4ENTA 2OAGA 3QE9Y 4JJ4A 4PANA 5B55A 2GPBA 1M2HA 3EVFA 2JATA 2PSFA 2WD8A 5DHTA 5BXQC 1E2NA 1QNLA 3E5HA 2VBFA 2FZ5A 1P1RA 3G8YA 5DNUA 3UKJA 4S04A 4WACA 3BS7A 2X8BA 4IH9A 5KB3A 4QUBA 1E5DA 5BQ3A 3O3NB 3WFZA 1DOQA 3M3DA 4EZBA 4YRQA 5C37A 1F4VA 1ODFA 4XIYA 3PZRA 3PKIA 1PJ4A 1GCIA 5KNCA 1NURA 4ZEVA 1QG2A 1UZUA 2HSWA 2F8LA 1VLJA 5C7OO 2QDXA 3LPCA 3GMTA 4O63O 3MOSA 5B7QA 2ODEA 1P33A 4MYTA 2B61A 3DEYX 3GELA 2XXAA 3BSWA 3LO8A 4AS3A 5JEEA 4LZAA 1G4UR 2NADA 4KLMA 1ZK3A 3RUAA 4M9QA 1QFXA 3VSBA 4E5VA 5JHGB 2C2XA 3CNOA 1UZMA 3H1AA 1HZZA 1KJIA 3KZOA 4LXYA 4PONA 5JD5A 2DGDA 2ZYHA 1ZQVA 4QSMA 2ONJA 3V7KA 2E9SA 4J9NA 3H9QA 5KNLA 4AD8A 2VQEB 4CRXA 1M72A 3N7TA 2IOHA 1U3DA 4R8LA 5T7BA 2I1QA 2BCRA 3ORQA 2GN0A 4N6OA 4EY5A 3NVMB 2FMQA 1AKVA 2JAQA 4QTTB 5FTWA 3S44A 3Q7TA 3UPDA 5J0QA 2QSZA 3F6PA 3BMOA 3UJPA 4EHAA 2YWFA 3FWZA 5IN4A 2W3RA 4WLNA 5LLSA 1FEZA 1A5SB 3F6EX 4B33A 4O9MA 5KQLA 5L1MA 2WV7A 4DSJA 1O95D 3FYCA 2XMGA 1MO2A 1T4BA 2AF4C 2HK9A 4HEA6 1WXGA 4WXRA 1Z88A 1KI2A 5CLHA 4ZO8A 3TQHA 4FUTA 4TLEA 5DN9A 4F5WA 1UEIA 1O57A 5IM5A 1I4LD 1QMGA 1UOPA 5DHQA 5AI9A 3V8EA 5KTTA 1YDFA 3B8EA 4TS9A 721PA 3QPAA 3OIFA 1U4OA 3IDWA 1HMYA 3G0GA 3NBKA 5AI8A 4TLLB 5BMVF 2XT6A 3C8HA 5HFAA 1KK2A 1R16A 3QU9A 4CKBA 2CXHA 1TM4E 4WZAB 3F7TA 4HZUA 2BDEA 1VQ1A 3LFHA 2OOKA 4FKBA 1IMOA 1G19A 1ULTA 2I78A 2XYPA 4QBKA 1OXBB 2C7OA 1YNSA 1U0OC 4US8A 1R7RA 2ZCUA 3DTYA 3KPJA 1JG1A 3KSZO 4DSIA 1P5HA 2C82A 4XEHA 4ZI5A 4D7AA 3HJHA 1KEEA 3CSUA 3ECCA 1X1EA 1ZMXA 3IOBA 4BTLA 1A9XB 1FJXA 1VIYA 2JFWA 3SMQA 4CLDA 3GN1A 5L7WA 4BDSA 4Y6QA 5KPJA 3BILA 2ZWPA 3ZIAA 4PBRA 2GAOA 2FW7A 3DCJA 1F2TA 3WBJA 3THVA 3VC7A 4A26A 3H05A 4FP9A 1DOZA 3REQA 1MVLA 5FNZA 1GGFA 4R51A 1SXDA 1WW2A 3WZMA 3A9CA 5J2HA 2G76A 2H3QA 2PGXA 3TSWA 3JPSA 3UJNA 4MLCA 2GLEA 4B9NA 2HIGA 3GV8B 2OILA 1I9CA 1KO4A 4B9MA 2OLKA 2NYUA 5A03A 2G5TA 3B1KA 2DX7A 5FB3A 2Z6UA 1GFSA 4R1MA 1Y88A 3RF6A 1ZW1A 2HA0A 3QWFA 3H83A 1LVHA 2VQSA 2P3OA 5EWJA 1J2EA 3IHKA 1S1CA 4URUR 4E0BA 1BO6A 1D8YA 4GLLA 2PXIA 1WMDA 4QBGB 3ZXXA 3TSAA 1NZFA 2R6ZA 1GM5A 2QUJA 4TYNA 2AMFA 3HLKA 3PWSA 1C3VA 3FAZA 3PDJA 4M1SA 2GZ2A 3AF4A 1BH2A 4KNYA 3HG7A 4WXEA 1T43A 3VZRA 2K60A 3I5YA 2GPWA 4NLZA 4I4TA 1OY1A 3JQ8A 3UWMA 4BAUA 4MHVA 1RTKA 1R1DA 1KBQA 1W9MA 3F49S 3GEPA 3BEOA 3QE3A 2I3ZA 5I7RA 3ZGZA 1NXXA 1V85A 4YV1A 4ZVVA 3IBFA 4LF6B 4I08A 1T3SA 3T5MA 3VR1A 3C7CB 1IU9A 1GXSB 2EFEB 1BU8A 4C89A 3V72A 5DDMA 2ZKLA 4HEQA 2JGNA 4HN9A 1J5EB 4BO9A 1GITA 4JMLA 4ZGGA 1LWOA 3RG8A 2DBRA 1X1DA 2Y1WA 2BHRA 1XKXA 3ZY2A 3NTQA 3IPLA 3OKAA 5IZCA 4U2BA 1PZMA 1LW7A 1G8PA 3QKIA 4FZJA 1Z33A 4P4NA 2PBZA 4CFYA 4LXIA 1Y3CE 1FSPA 1C4XA 3SAJA 2G82A 4L72A 4KRFA 1Y42X 3D3WA 3FMOB 1T8EA 2IF2A 3A4MA 3L84A 5F12A 4OJPA 1K4KA 1RBYA 1X6JA 1MCZA 2G88A 5SYNA 4CQJA 5ALKA 2H1SA 4DQKA 4DQ0A 5HRUA 1W88B 3OCYA 3PNBA 1N5DA 1RPJA 4ZAGA 5E9QA 2XMCA 1WUDA 4KLQA 1BMDA 5JEDA 3OX2A 4YQWA 1FS5A 1WP9A 4JBWA 1WUIS 4UBLA 4RSMA 2BFDB 3QJ5A 2BM1A 5G1NA 4QWEA 3T3NA 1PEYA 4ND6A 5J2CA 2XF8A 5KYUA 1G8YA 3WQRA 2XVYA 2CDBA 4JJAA 1EFAA 2FEKA 3T1VA 2GZDA 1XNGA 2LIPA 3FLBA 3E22B 2PRZA 3QOFA 2PGDA 4MGYR 1HV8A 1T6BY 7ICGA 1QIFA 3LVWA 2LXNA 2UUOA 2BE9A 3BKXA 3LWDA 4OQNA 4EA7A 1GAWA 1NMXA 1RM3A 3C3YA 3HKEA 5C4GB 2JASA 5IXSA 3KYJB 1XRLA 3OECA 2ZYUX 2DPIA 3J80A 4FWTA 2F3RA 4HNQA 1CC1S 2AN4A 4FBTA 2R6GA 3PB3A 2JGKA 5IAJA 4JV5B 3OEHA 4W6ZA 2C57A 3A1UA 1MN8A 1SU7A 2PT5A 1X7YB 2JGLA 2CNNA 2LD4A 1XQWA 4JP1A 2WJJA 3OU6A 1XSLA 1GPUA 3IIKA 4JL5A 1MV8A 2ZB4A 1N9GA 1WLYA 4WKOA 1OI4A 1M54A 4I46A 5CLLA 5CIQA 4BCBA 1FDWA 1ZQBA 4P7GA 1PWZA 5FWNA 1E2GA 2AQ0A 1HDXA 1SXHA 2B9VA 3OF5A 3DZGA 3F47A 4RK1A 3AVTA 2XYQA 3MWEB 1NASA 3PZPA 3ZIUA 2IHZA 2QP9X 5C8DA 3BL8A 4Q15A 4DDUA 2PN1A 5ES4B 3T61A 5JOQA 3TGLA 5L1JA 1E3SA 1BCSA 3NUGA 4PSKA 5HMLA 4EP1A 4UEJA 2CSXA 1X1BA 5IYZF 3ZIDA 2Y0CA 4JLVA 1RRVA 3RAXA 2IDJA 9ICHA 2NV0A 2O07A 2IW3A 2PZBA 4PPFA 2JZNA 3U40A 2DQYA 2R7MA 1I4OA 1Z4QA 4OHXA 3ND6A 4Z1MD 3U44B 2HCTA 1U8CB 2VK4A 6GPBA 2E7ZA 4KPUA 5IBPA 3TZCA 1KJ9A 2AG5A 4MYRA 4PYQA 5H2FU 2O2EA 4R2KA 5KFWA 4YWHA 4XQ8A 2UVVA 1YNOA 3FPCA 3WTBA 4F0JA 4CETA 2O8FA 3RBEA 3S70A 1BS1A 3P71T 1CS0B 3LECA 4UBKA 1CJTC 2C3OA 5JAIA 2PMBA 2WF7A 2COEA 2XA9A 2QLJA 3E3OA 5E6RA 3OHMA 2I80A 3HCNA 3RTBA 5ALOA 3C6XA 1A8UA 4LYJA 3X2SA 4EJFA 1Q83A 5ITZA 1ZCAA 2PV0A 4FW9A 5GGYA 4G4SP 4EKNB 2QG9A 3SBXA 2XKKA 2FFAA 3BFPA 2DTEA 4LK3A 3WISA 5ALFA 4O33A 4GSYA 4CT0A 4D46A 1FMFA 1NNSA 3W5VA 4EK9A 3DM9B 1OI3A 3EGWA 4I6JA 2NPIA 2Q5QA 2RGYA 3E58A 4C4TA 1OZHA 2Q4TA 1KVRA 3CR3C 4FC6A 3RNOA 1IC6A 3NKVA