2MU2A

Nmr structure of the cap domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
LLDSYEAILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLLVRVAEDRNLDVEVLNQVRAQSLAEKNAQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title J-UNIO protocol used for NMR structure determination of the 206-residue protein NP_346487.1 from Streptococcus pneumoniae TIGR4.
pubmed doi rcsb
source organism Streptococcus pneumoniae tigr4
molecule tags Hydrolase
molecule keywords Hydrolase, haloacid dehalogenase-like family
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2mu2A00
4CE6A 3I28A 5ALJA 3QU7A 4OCZA 1LVHA 2MSNA 2NO4A 3U26A 1ZD4A 4OD0A 5AK6A 4EX7A 1ZRNA 5AM4A 3UM9A 4Y2QA 1S8OA 5AIAA 3QUBA 3UMCA 1TE2A 1O03A 5ALQA 2YMQA 5ALEA 3R9KA 3WKDA 4C4TA 3L5KA 4Y2UA 2HSZA 3QUCA 3QYPA 5ALVA 5ALFA 3I1YA 5AK5A 5AKHA 5AM2A 4J03A 4Y2PA 4FFDA 5ALWA 2HCFA 3WK4A 2IOFK 5ALSA 5AM3A 5ALDA 2HDOA 5AK3A 3WKBA 3WK8A 2IOHA 2WF9A 2IOFA 3S6JA 2YN4A 5AKYA 5AKJA 1RDFA 5ALPA 3FM9A 5AKKA 4F72A 1JUDA 2AH5A 3NASA 5AICA 2I6XA 4UASA 1VJ5A 3KBBA 1RQLA 5AKXA 2PKEA 4HAIA 1ZD3A 3CNHA 3D6JA 3QX7A 4Y2YA 4UATA 2YMMA 1ZOLA 1AQ6A 5ALOA 5AI8A 4EEKA 2YY6A 3QUQA 3ZI4A 5ALZA 3KOOA 3IRUA 3QUTA 5AKGA 2QLTA 5AI4A 5ALGA 5AIBA 4C4RA 2WF5A 5ALXA 4Y2JA 5AKZA 1ZD2P 4Y2RA 3UMGA 1QQ6A 4UAVA 4GIBA 3DDHA 4CF5A 5ALRA 3I76A 4Y2SA 1FEZA 3WK6A 4EX6A 2W11A 2YMLA 1SWVA 3ED5A 4UAUA 3QU2A 2WF7A 5AKEA 1QQ5A 2WF6A 5ALNA 5AM5A 2HI0A 5ALUA 3SD7A 3WKCA 2FDRA 4Y2VA 3QXGA 1ZD5A 5AI0A 3DV9A 2B0CA 4CNQA 4F71A 5ALHA 5AM1A 5ALLA 1QQ7A 4UW9A 3WK9A 4CF3A 2WHEA 1QH9A 4UARA 5AI9A 3WK5A 2WFAA 5ALKA 5ALMA 2GO7A 3WKEA 4DCCA 1Z4OA 2FI1A 3E58A 4G9BA 5ALYA 3WK7A 2WF8A 1SWWA 1ZRMA 2MU2A 4DFDA 2NO5A 4JB3A 4CF4A 3QU4A 5AKIA 3QU9A 5AI5A 5ALTA 3QU5A 3UMBA 5AKLA 5AM0A 3QNMA 5AI6A 3OTQA 5AK4A 1O08A 2NYVA 4C4SA 1RQNA 5ALIA 5FP0A 4Y2TA 4EENA 4Y2XA 1X42A 3WKAA 2W43A 3MC1A 2YMPA 4EELA 5AHXA 1Z4NA
chains in the Genus database with same CATH superfamily
1WYGA 5DB6A 9ICBA 2FLNA 3H4BA 1Z3EB 1TFRA 1RYUA 2ZIWB 3HILA 5KFRA 5AKHA 4NLNA 2YB4A 4FFDA 4EYIB 1PK1B 4TQSA 1KFDA 4JUZA 2NRVA 3H7IA 1UT5A 3Q8MA 2ZIXB 4DL3A 4NL9A 3HW8A 2ZXHA 1MA7A 3B0XA 2OHFA 2AH5A 3NASA 2LYBA 2A3VA 2H3FA 1AROP 2EZYA 2PKEA 3QX7A 8ICEA 5KFLA 4QZGA 4LJXA 4O5KA 2YQEA 4QWAA 5C5JA 3K1RB 3ZDBA 2ZIXA 5HNKA 4YR3A 2XO7A 2FE9A 1SXEA 4UB2A 1SKWA 2XCPA 3AQEA 3HRDD 1SKSA 1ZQFA 2HBLA 1ZQWA 9ICOA 1L7MA 5CWRA 1NJWA 4NWIA 4Y2VA 5KFPA 4P4PA 1HJPA 4DQRA 4O5EA 3WK9A 3QEBZ 8ICCA 5GTIU 5KFCA 1XO0A 8ICJA 5ALKA 2KKPA 3K75D 5L9XA 4DFDA 4ECXA 4O9MA 3TARA 1Z1BA 4O3MA 1T8EA 5AI5A 4J9QA 2E1FA 2KN7A 2KICA 3QNMA 4RU9A 5KFNA 4DSJA 4QZFA 1NK7A 5ALIA 5FP0A 1IM4A 3SZ2A 2QB0B 4DLEA 1PUZA 2JEGA 1VDVA 4UAYA 4FS2A 3U26A 1ZD4A 8ICOA 4YD1A 3PR4A 2Y9TA 2UVWA 4IQWA 1L3VA 2E8PA 4ED6A 2JXJA 4PL1A 4M9JA 4M6WA 3OSPA 5EWEA 5EE0A 2PFNA 2AQ4A 3PZPA 1XU4A 1V85A 3MFHA 4ELUA 1L8LA 4MEXA 3EUB2 4YXJA 2Y0SF 2FLPA 3SV3A 2UVUA 4UB8U 3D6JA 3JPNA 4KLUA 7ICJA 4EEKA 3Q8SB 4K4HA 3NRZA 3QUTA 3IRUA 4I2FA 2EANA 1NK9A 3CP8A 2VA2A 5KFOA 3EPGA 4YMOA 1BGXT 2NRTA 1SZHA 3KHLA 3BQ0A 5J0QA 1EXNA 2MA1A 8ICZA 3NRWA 1QTMA 4YMNA 1Z00A 2WF6A 3T5LA 5KG0A 3MDAA 3PW2A 3GZFA 4O3SA 5KT5A 5AI0A 1FFUA 1DK3A 1KFSA 5KG4A 4FZLA 9ICMA 4Z6DA 5CB1A 2G5IB 1NK8A 2M9NA 2ZTDA 3RF9A 3WK5A 5ALYA 3B9JA 3GV5B 5J0SA 1BPYA 5F9NA 4RQ3A 7ICQA 2ODGA 3PVXA 5AM0A 3N28A 1KQQA 2C2EA 2FMSA 3THVA 5AHXA 1PVQA 3KHRA 4C0ZA 4C8MA 3RH6A 5DGBA 3ZDDA 4RQNA 2V4RA 3PW4A 5AM4A 8ICSA 2OEHA 4FBTA 2EAOA 2ZJ8A 5EE1A 3BQ2A 3GFKB 5T14A 1Q8KA 5KNIA 4J9RA 3T79A 2KV2A 2OCEA 1ZQJA 2ZIUB 3GV8B 3PR5B 1LKYA 2KOBA 1TK0A 1OXJA 3AU6A 4BXOB 5J0OA 3BQTA 2B6GA 2ZJ5A 1TAQA 2IA6A 5J2GA 5DLGA 2R8GA 2KJ5A 5C0YA 2A1AA 1MSWD 2JH7A 5J2BA 4UATA 4KLLA 3FAHA 3KKAA 3E2EA 3NUQA 1K1SA 4U6PA 4ED3A 4YP3A 2KZZA 3T5HA 2W3RA 4Y2RA 4DLGA 4M2YA 2C2RA 3DDHA 2EZXA 1XWLA 2L5YA 5ALRA 2N1RA 1NK4A 2F1HA 2F77X 4NLBA 5ALNA 1SIJA 1NK0A 3SD7A 3AM9A 2BKEA 3D2NA 3QXGA 4C7YA 2K4EA 2R8HA 2FPKA 3RBDA 1SV0A 4RQ4A 3GILA 2WFAA 4UQGA 2W9BB 3WKEA 4PPXA 4DO9A 2WF8A 4DSKA 4J9LA 4ED0A 3E0FA 2HOIA 2W7OA 4ED2A 2KKVA 1ECWA 4EZ6A 5HHHA 5L1MA 1ZQVA 5DDYA 4Y2XA 4QZHA 2R18A 5IINA 5DBAA 2WAQC 4XUSA 3UPQA 1L3TA 3G6YA 2NRZA 2HMXA 3M6ZA 3T5JA 4BDPA 1X2IA 1A77A 4I2BA 2W8LA 1O03A 2YMQA 3R9KA 3HP6A 4FZMA 1ZQZA 1SXDA 2E8NA 3QUCA 4M0AA 4TURA 2V4QA 4GC6A 2F3NA 3VCBA 3C5GA 1TV9A 4Q43A 2ZIWA 9ICGA 5HMLA 2BR0A 4MF2A 2E1EA 5EWFA 1IG6A 2XC9A 5J0TA 1VLBA 4ECUA 1URJA 3QZ8A 2EQYA 4NLKA 4KLIA 3OSNA 1RYRA 4P0PA 1QCKA 1NKEA 1JALA 1COOA 4US8A 2DQNB 4RQ6A 2RHFA 4MF8A 2HVHA 5KAFU 4DOCA 9ICEA 1ZQSA 5BOMA 2RRDA 5IIMA 5D46A 2G0AA 1X9SA 2HI0A 1Y88A 2C2DA 3HKZF 2QKQA 4P0PB 1L7OA 2ZTEA 5DB9A 4FO6A 2BCUA 4UW9A 8ICYA 4ED7A 4ZH4A 3F2BA 1NKBA 4CCHA 2LKYA 2C28A 3QEAZ 4QWBA 2V9WA 4DS5A 3MBYA 4EBDA 5AKIA 4F5QA 5KFJA 1NJZA 1D9FA 5EWGA 3V6HA 5KG6A 4TUQA 2HBMA 4QZ8A 5CJ7A 1SKRA 3M1YA 3C2LA 4QWCA 4C80A 8ICWA 2KG5A 9ICNA 5G5GA 2BHNA 1J97A 1T4GA 4KLJA 1IXRA 2ASDA 3TI0A 2FJ6A 1WCNA 2CPRA 5CP2A 3BS7A 1ZQDA 2Y1JA 4DEZA 5KFUA 5DQHA 5KT3A 4DF4A 5KL1B 4EEYA 5ALVA 4PGYA 5KFQA 3WK4A 2HDOA 2IOHA 2WF9A 2Q4TA 3S6JA 2D6FC 5ALPA 5J8YC 2ZIVA 2W3SA 3C28A 3KBBA 4KLMA 1UT8A 4HAIA 4IRDA 2FPLA 3TADC 4DF8A 5AKGA 1J2MA 5HP4A 2BDUA 1FO4A 3OJSA 3MGIA 2AXTU 4AYBC 5A0LA 2JZBB 4Y2SA 2KZMA 4YXMA 4X5VA 1X9WA 2A19A 3M7DA 3AN1A 4UAZA 4JWMA 4F50A 4MFFA 3J81j 2EAMA 3DV9A 1ZQGA 2JZBA 5DB7A 2F2AB 3GQCA 2I9GA 2PI4A 5ALMA 3A0BU 3GIKA 4RZRA 2F8KA 2B21A 3MABA 2PXIA 4BXOA 1KSPA 5CRXA 7ICLA 3MR2A 4TQRA 1NJYA 3EW9A 4ED1A 4I2GA 3BZKA 3PSPA 3H8JA 1H38A 8ICBA 3FC4A 1ZYQA 2WAQF 3C1YA 2K4HA 3MR6A 4FZNA 2DKZA 2JEIA 1ZQTA 3LYSA 4GC7A 1S8OA 3RRGA 1MQ3A 3UMCA 2OM6A 3OHBA 3JPRA 3D2QA 4RQ5A 2XGQA 4TUPA 1ZQXA 5DBBA 2K8BB 1XO1A 3PMNA 4A8EA 4MHVA 4MFCA 1L6NA 5DLFA 5AKJA 4GLXA 4IR9A 3UXNA 4RPXA 1B43A 2GLEA 3RB0A 2P6UA 7ICKA 1RXVA 2IMWP 2YY6A 2HHTA 5ALZA 2WB1C 1ZETA 4DQQA 3ISDA 2QLTA 4C4RA 3UMGA 5IILA 4JK1A 1ED1A 2NRXA 2BCRA 4I2DA 1KKXA 3HJEA 4LZGA 3JPTA 4ECQA 4MEYA 2YMLA 3SI8A 2AGOA 2J6UA 8ICTA 1RM6C 5ALUA 1X40A 2AQ0A 2AGPA 3M8SA 2PFOA 5J2CA 5ALHA 5J2KA 4RUCA 2K4PA 3RR8A 2CRXA 2YX8A 3HKZC 3M6KA 4UARA 2HHXA 4IC9A 3D2SA 4XQ8A 3WK7A 4ECZA 3RJEA 1N60A 2VANA 3UMBA 5AKLA 5J0YA 4IS7A 3PY8A 2W43A 4CE6A 4I2JA 3BS5A 4DL2A 4O3QA 5L1KA 2BDPA 3NGDA 4B9NA 1ZRNA 8ICIA 3UM9A 1JX4A 2KFNA 4F5PA 3PX4A 1TE2A 3NTUA 1L3UA 3SENA 3LWMA 5AM2A 5KG1A 4J03A 2UVRA 2MUTA 2HCFA 1U45A 5AM3A 1NZPA 3NVZA 1XSPA 5CEHA 4RQ0A 3TAPA 3H4DA 4UB5A 5F9LA 4KLDA 9ICUA 4I2AA 4DFPA 2KP7A 1XSLA 1N48A 3N4MB 4DL5A 3JPSA 1CI4A 3MR5A 3Q8RB 2XY7A 2ES6A 4KN4A 1N5XA 4CF5A 1BPDA 4ED8A 1SL2A 4QNLA 4YR2A 3H8SA 5KG7A 3RB6A 2HHQA 4B9VA 1KW4A 3HX0A 1S0MA 2ZXIA 4F2RA 1GO3F 1X9XA 3OGUA 3AU2A 1S0VA 1LB2B 2WTFA 1N62A 5HMMA 4RQ2A 2BZFA 1Z4OA 4DL6A 2MUTB 5KT2A 1BVSA 1ZRMA 1NNLA 2G09A 4UBBA 1PK1A 1X6JA 5CA7A 3QU5A 2W54A 2RQ5A 2JEJA 4C7ZA 2BCSA 1WWVA 3LDAA 1N56A 5B66U 4O3OA 4O3NA 8ICUA 3RJGA 2F1JA 7ICGA 2VJ4A 2NO4A 4IRCA 1UCVA 5KFBA 3KHHA 1SZPA 3BJYA 4QZ9A 3GIJA 2CN1A 5KFGA 1K1QA 1IV8A 4G3IA 3ZDAA 4RQ8A 4J9MA 2XIDA 2OYYA 3N7SC 4QZCA 1Q46A 5ALSA 2HHSA 4P0QB 3WK8A 3KZXA 4CGZA 2YN4A 1RDFA 3B0YA 4DWIA 3Q8KA 4C8OA 4NV0A 2AHOB 1X66A 3QE9Y 9ICQA 3JPPA 3K1ZA 5KFSA 4Y2YA 3CW2C 4TUSA 4M04A 3FDSA 3AQFA 2JEFA 1C7YA 1S9FA 1RXWA 5KFXA 5JUMA 7ICMA 4JMUA 4OO1J 3NVWA 5DG8A 3GV7B 3SAHA 4ELVA 2VA3A 3I76A 9ICVA 2W11A 4UAUA 4NXZA 2Y0SC 4CDGA 8ICVA 2KEYA 5J0XA 4M9NA 3V6JA 4I2CA 4R65A 5G5HA 2KD1A 2AGQA 7ICOA 3TACB 7ICHA 4CNQA 2W03A 5DQIA 8ICQA 9ICIA 7ICTA 4YQWA 2P6RA 4F5NA 3RBEA 1DRGA 2H3VA 2ZUCA 1XSNA 4F5OA 1TAUA 1A0PA 3GU3A 1ZQBA 1NKCA 1ZQCA 4RT2A 5TISU 2F1IA 3OTQA 1BPXA 1ZJMA 1YZ6A 1RQNA 3ZDEA 1WWUA 4NM2A 2BCQA 4PH5A 2QARB 4IQVA 3PW7A 2W9MA 1IIPA 3SAFA 4BWMA 2MSNA 4KITB 1ZQMA 2DPJA 9ICTA 2NV3A 5ALQA 1CEZA 4DSEA 4DQIA 4R8UA 2VA8A 4Y2UA 3UXOA 3PNCA 4F8RA 1V97A 1Q3UA 2H3IA 1ZQEA 1BPEA 5J0PA 1MQ2A 3QZ7A 5KFHA 2P35A 2ZUBA 1JXEA 5AKXA 4YVZA 2KJ8A 1LKYB 1ZD3A 4F4KA 2BPCA 3PX0A 2K89A 4QW8A 4RPZA 3SEIA 1U4BA 1DGSA 3QUQA 1A6SA 1N61A 4DQSA 3C1ZA 2WF5A 3PO4A 4RNNA 2ATLA 2HHWA 3C5FA 2K4IA 4PZNA 4KMUA 3UXPA 1WCLA 7ICSA 4F3OA 2EAPA 1QLNA 1PK3A 2LPEA 5D4BA 3T5KA 2H3QA 3WKCA 4J9NA 1SL1A 2OH2A 5KFIA 1QSYA 4XRHA 2ESEA 4WJ3B 5J29A 4EBCA 3F5EA 4CF3A 1BNOA 2PI5A 2KE7A 4RPYA 4I2EA 3ZD8A 2C22A 4G9BA 2W9AA 2KHVA 2HW3A 1LV5A 2E8OA 1ZQKA 4AYBF 1KEJA 1FFVA 2DKXA 5AK4A 1T7PA 1X42A 1D8BA 3AL0B 3KHGA 1Z4NA 3MFIA 5ALJA 4EBEA 2PFQA 3A0HU 9ICLA 2BGWA 4DSFA 5AK6A 2HHVA 4KLSA 4PHAA 5DDMA 4QZIA 1SV0C 3LK9A 4UB3A 3C29A 3PV8A 3V6KA 3C21A 3G6VA 5J2HA 8ICHA 3L5KA 3DEEA 8ICLA 4NL9C 3BS5B 3H40A 1ZQOA 4J9PA 4KLGA 4PHPA 3RH4A 4Z6CA 4LVSA 2G06A 3V7LA 2IHMA 1M6YA 3LWLA 3FYHA 1ZOLA 5KG5A 4ELTA 3Q8PB 1L3SA 2W8KA 3F53A 1F5SA 2XCAA 3KKAC 4GXIA 1SB3C 5IIIA 2KK0A 4DSLA 2HVIA 5DG9A 2D3DA 2WF7A 1QQ5A 3M9NB 2KMDA 4NLGA 3ICXA 1ZQQA 2JRZA 9ICCA 5J0RA 3IN5A 4F71A 1QQ7A 5DKWA 4JV2A 2H3ZA 7ICRA 5J2JA 2GH1A 5AI9A 1PZNA 4DL4A 3WU2U 4K4GA 2KNJA 1ZQRA 3V7KA 3QU9A 2DF4B 2ZIVB 3ORYA 5AI6A 2DWQA 4C4SA 1U49A 5KL8B 1SGGA 3TADA 4DSIA 5DGAA 2E5SA 1ZQUA 4BJQA 4BWJA 1YZ7A 4O0IA 1S0OA 1JROA 1COKA 3N7PD 1X9MA 8ICKA 2M0NA 2ZJAA 3QU7A 4UAWA 3F5AA 2GWSA 4Q44A 4DQPA 4JV1A 1SL0A 5J2AA 1NOMA 3QUBA 3M9MB 2QB0A 4C4TA 4PGXA 3JPQA 3G6XA 5ALFA 5AK5A 2ASLA 5KFKA 4Z6EA 2JGAA 3ONNA 1S97A 1BPZA 5AK3A 3WKBA 3N7RC 1Z19A 2ASJA 4IR1A 4P4MA 1VJ5A 1N63A 3CNHA 1AQ6A 5GTHU 4M47A 4YN4A 2KVCA 4P4OA 4IL6U 2HBKA 3AEVA 5AI4A 2BQ3A 2H5XA 4AP9A 5KG3A 1ZD2P 1CRXA 5CHGA 4PGQA 1UA1A 7ICFA 9ICRA 3NS1A 2KIWA 5HR7A 1BPBA 1L8OA 3SMVA 3RH5A 5L1IA 2DPIA 4ECWA 2Z7JA 4J9SA 4CRXA 2B0CA 4BUGA 4R66A 3IHQB 2ZTCA 4F91B 5DG7A 4NJ8A 3F2DA 2F8LA 3C23A 4FS1A 1Z00B 3L3FX 3ETLA 3TAQA 3RR7A 2DFLA 2D8CA 4RNOA 3IG5A 3RAQA 8ICXA 2UVVA 3Q8LA 4FBUA 1O08A 4C8KA 1N5WA 1RG6A 1T94A 1KRPA 5CR0A 4NLCA 4LZDA 9ICJA 1L7PA 4I28A 4OCZA 2FPMA 3RJIA 4EX7A 4DOBA 3V7JA 4PHEA 4I27A 3HT3A 4OJ6A 3VC8A 4QJFB 2OWOA 3UQ0A 3TQ1A 1S77D 5B5EU 3NVVA 7ICPA 4J9KA 1NI3A 4JWNA 1J2NA 5HR6A 1WG8A 1ZXIA 4YCXA 2BQUA 9ICKA 2BPFA 1NZBA 2I6XA 4USAA 1RQLA 3H0MB 2YMMA 1HEKA 3AUOA 5ALOA 3KOOA 5KAIU 3N97B 5ALGA 4ACOA 1HUOA 5AKZA 2IHNA 4UAVA 1CUKA 4GIBA 4YFKA 1D9DA 5KT6A 1UHUA 3WK6A 5J8YA 2Q0ZX 4QWDA 5IIKA 1ZQ1C 9ICWA 5IIOA 5JTIA 5J2EA 2LHTA 1ZQYA 4O3PA 2BQRA 8ICPA 2HOFA 1JRPA 3GIMA 8ICFA 7ICUA 1C20A 2YTUA 3V72A 4KLQA 2XI9A 1S0NA 4KTQA 2P66A 2HHUA 4DCCA 5L1LA 3PSIA 4XA5A 2FI1A 2J6SA 1OW5A 2ISOA 3H8WA 2MU2A 3RFAA 4CF4A 2MRLA 5KFYA 3SQIA 5DQGA 4ECTA 5L1JA 4EENA 8ICRA 1ZQLA 3ETRA 3TKAA 2W9BA 5HHIA 5KFEA 4YD2A 1KLNA 4Q8EA 4KX3A 2KVSA 1U9LA 3PSFA 3RRHA 1YT3A 3ZD9A 1L7NA 4Y2QA 5J2DA 3SYZA 5AIAA 2RLTA 1F0MA 4B9LA 5ALEA 4DOAA 2JH1A 7ICEA 3HWTA 2R8KA 4QIWF 3IP4B 3RJJA 4Y2PA 2JHDA 1MC8A 1XS9D 5AKYA 2F44A 4F72A 2R8IA 2ZG6A 3RTVA 3MR3A 3AMZA 5KTQA 4RQMA 1KDHA 4C8NA 3BQ1A 2W7PA 4KLHA 5DB8A 4KLOA 4R63A 5AIBA 1BNPA 2JV3A 3Q8QB 2RP5A 1KTQA 4B9MA 1TKDA 1SWVA 3ED5A 4YR0A 2ZIUA 5AKEA 4C8LA 1TK8A 4BX9C 1P7DA 1N2XA 1MN8A 1V9PA 5TZVA 2YB1A 1Z1VA 4I2IA 2LBOA 2ISPA 2O6KA 1TAMA 8ICMA 9ICXA 3TFSA 5ALLA 2LMRA 3H0RB 1D8YA 5F3XB 4RUAA 4B9UA 4PL2A 4NLZA 2GO7A 4UB4A 2Y9UA 2EDUA 2NO5A 4DFJA 1UQVA 8ICAA 4F5RA 4U7CA 7ICVA 1S5LU 2CXYA 3WKAA 4UB1A 2A1JA 9ICFA 2YMPA 4EELA 1ZQHA 4F92B 5AICA 3I28A 4ECSA 1QSSA 1LVHA 8ICNA 4OD0A 2K8AA 4F93B 2HOQA 9ICHA 2PMZF 3BDPA 3BQ7A 4KMOB 4OJOA 1B0XA 4Z6FA 4OJLA 9ICAA 3ZDCA 2W9CB 1U48A 2BPGA 5KG2A 2IOFK 3PSTA 4JV0A 3ISBA 4PZOA 1S10A 5E79U 4F4YA 4K4IA 4GFJA 4O5CA 5J0UA 1JUDA 3M8RA 4UASA 1OUQA 2JR5A 5KT4A 4M9LA 8ICGA 5KFDA 2W9CA 5J0WA 3EZ5A 4M9HA 4P0QA 4DFKA 4FE3A 2LYAA 9ICSA 2KFZA 2BCVA 1PVRA 5ALXA 4Y2JA 1F44A 4YMMA 1QQ6A 3TANA 7ICIA 1WUDA 2PFPA 2A1JB 3QU2A 3PW5A 1UA0A 4IQUA 1TVAA 1NK5A 5AM5A 5BPCA 3OPXA 4F4XA 3RJHA 1ZD5A 3K4GA 4RNMA 3H0LB 2OXOA 1XNSA 1NK6A 5EOZA 3CYMA 3O0FA 2I1QA 4UB6U 2ZUDA 2VIXA 4RQ1A 4Q45A 1A76A 3EWAA 2JMGA 4RQ7A 1U47A 3MGHA 1ZJNA 4QZAA 3NVYA 5H2FU 4PHDA 2LYHA 3PX6A 4KN7A 3OHAA 1V38A 4B9TA 1ZQAA 1KFTA 2IBKA 4F4WA 4Y2TA 4KLTA 5IIJA 2DGZA 2XGPA 2KTQA 3C2KA 1JI7A 5KFVA 2NRWA 4GXJA 3BZCA 1ZQIA 3WKDA 4MFAA 1RZTA 4F2SA 1ZQNA 2G5HB 2QARA 3PO5A 1L5UA 4QIWC 2KHQA 2F76X 5KFWA 3HPOA 3TFRA 5EE3A 3L4PA 1JXLA 1DK2A 5AKKA 2G07A 4B6JA 3RAXA 2EH9A 4O3RA 2PMZC 4UBCA 4ECVA 1D8LA 3ZI4A 3MDCA 1B4FA 1HIWA 5KFMA 2VKQA 2LI6A 1X6IA 3PW0A 4ECYA 3RJKA 1FEZA 4M9GA 4M6WB 2DL0A 2R8JA 4EYHB 4J9OA 2I5HA 2FDRA 3UQ2A 3RB3A 3IM1A 3C2MA 1DGJA 5AM1A 4E0DA 2WHEA 4BGDA 1QH9A 1RYSA 1TK5A 3E58A 4QWEA 4Q8FA 1SWWA 2DBYA 4QW9A 4JB3A 3QU4A 1JN3A 3ALRA 5ALTA 2AJQA 2KZ3A 5J2FA 3MGVA 1JMSA 3SAGA 3EPIA 4F4ZA 2NYVA 4ICAA 2QB1A 1KN5A 3H8MA 1QSLA 2EZZA 4QZBA 3M9OB 4R8UB 3KFUF 5KT7A 4R64A 1Q3VA 3LVVA 3IV6A 1S76D 7ICNA 4DFMA 4DS4A 2Y1IA 5KFTA 2W04A 5JU5A 3ISCA 5KFAA 1NJXA 4US9A 3GIIA 4B9SA 1PVPA 2HSZA 3QYPA 3I1YA 2KSOB 3RB4A 3OJUA 2GOLA 4IQTA 2XY5A 5KFZA 3SV4A 5ALWA 4I2HA 1FIQA 5ALDA 5D49A 2FMQA 1DOQA 2IOFA 4PJ0U 1XC9A 1UPHA 1KL9A 2RDJA 1K5OA 2VJ5A 3FM9A 2K60A 2KSOA 5J2IA 4IRKA 2XVTA 2J6TA 9ICPA 2XY6A 1T3QA 5AI8A 4GXKA 1KBUA 2E3TA 4QZEA 1B22A 4QZDA 4YG2A 3JPOA 4NM1A 3SR6A 2K8CB 4RT3A 5BOLA 4OJPA 3PMLA 4P2HA 3T3FA 2WB1F 4EX6A 4KX5A 2AU0A 4ZOHC 2W55A 3KTQA 5JRTA 1SV4A 5EE9A 4OJ5A 3KZIU 3IG8A 2MAXA 2FLLA 2E8MA 2XICA 3KD3A 3RJFA 4EZ9A 2KIVA 2G08A 2ALZA 3F2CA 4DL7A 1HUZA 1ZQPA 1DXSA 1JIHA 5KFFA 1RPLA 3CRXA 2HBJA 2FMPA 1T3NA 2KJ9A 4HYKA 2LM4A 4I29A 4ECRA 4KLEA 5DBCA 2RDIA 2DUYA 5K4LA 3GDXA 3MC1A 3LVWA 3EYZA 3IDWA 2LM1A 4KLFA 4NY8A
chains in the Genus database with same CATH topology
4CE6A 3I28A 5ALJA 3QU7A 4OCZA 1LVHA 2MSNA 2NO4A 3U26A 1ZD4A 4OD0A 5AK6A 4EX7A 1ZRNA 5AM4A 3UM9A 4Y2QA 1S8OA 5AIAA 3QUBA 3UMCA 1TE2A 1O03A 5ALQA 2YMQA 5ALEA 3R9KA 3WKDA 4C4TA 3L5KA 4Y2UA 2HSZA 3QUCA 3QYPA 5ALVA 5ALFA 3I1YA 5AK5A 5AKHA 5AM2A 4J03A 4Y2PA 4FFDA 5ALWA 2HCFA 3WK4A 2IOFK 5ALSA 5AM3A 5ALDA 2HDOA 5AK3A 3WKBA 3WK8A 2IOHA 2WF9A 2IOFA 3S6JA 2YN4A 5AKYA 5AKJA 1RDFA 5ALPA 3FM9A 5AKKA 4F72A 1JUDA 2AH5A 3NASA 5AICA 2I6XA 4UASA 1VJ5A 3KBBA 1RQLA 5AKXA 2PKEA 4HAIA 1ZD3A 3CNHA 3D6JA 3QX7A 4Y2YA 4UATA 2YMMA 1ZOLA 1AQ6A 5ALOA 5AI8A 4EEKA 2YY6A 3QUQA 3ZI4A 5ALZA 3KOOA 3IRUA 3QUTA 5AKGA 2QLTA 5AI4A 5ALGA 5AIBA 4C4RA 2WF5A 5ALXA 4Y2JA 5AKZA 1ZD2P 4Y2RA 3UMGA 1QQ6A 4UAVA 4GIBA 3DDHA 4CF5A 5ALRA 3I76A 4Y2SA 1FEZA 3WK6A 4EX6A 2W11A 2YMLA 1SWVA 3ED5A 4UAUA 3QU2A 2WF7A 5AKEA 1QQ5A 2WF6A 5ALNA 5AM5A 2HI0A 5ALUA 3SD7A 3WKCA 2FDRA 4Y2VA 3QXGA 1ZD5A 5AI0A 3DV9A 2B0CA 4CNQA 4F71A 5ALHA 5AM1A 5ALLA 1QQ7A 4UW9A 3WK9A 4CF3A 2WHEA 1QH9A 4UARA 5AI9A 3WK5A 2WFAA 5ALKA 5ALMA 2GO7A 3WKEA 4DCCA 1Z4OA 2FI1A 3E58A 4G9BA 5ALYA 3WK7A 2WF8A 1SWWA 1ZRMA 2MU2A 4DFDA 2NO5A 4JB3A 4CF4A 3QU4A 5AKIA 3QU9A 5AI5A 5ALTA 3QU5A 3UMBA 5AKLA 5AM0A 3QNMA 5AI6A 3OTQA 5AK4A 1O08A 2NYVA 4C4SA 1RQNA 5ALIA 5FP0A 4Y2TA 4EENA 4Y2XA 1X42A 3WKAA 2W43A 3MC1A 2YMPA 4EELA 5AHXA 1Z4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CE6 A;  3I28 A;  5ALJ A;  3QU7 A;  4OCZ A;  1LVH A;  2MSN A;  2NO4 A;  3U26 A;  1ZD4 A;  4OD0 A;  5AK6 A;  4EX7 A;  1ZRN A;  5AM4 A;  3UM9 A;  4Y2Q A;  1S8O A;  5AIA A;  3QUB A;  3UMC A;  1TE2 A;  1O03 A;  5ALQ A;  2YMQ A;  5ALE A;  3R9K A;  3WKD A;  4C4T A;  3L5K A;  4Y2U A;  2HSZ A;  3QUC A;  3QYP A;  5ALV A;  5ALF A;  3I1Y A;  5AK5 A;  5AKH A;  5AM2 A;  4J03 A;  4Y2P A;  4FFD A;  5ALW A;  2HCF A;  3WK4 A;  2IOF K;  5ALS A;  5AM3 A;  5ALD A;  2HDO A;  5AK3 A;  3WKB A;  3WK8 A;  2IOH A;  2WF9 A;  2IOF A;  3S6J A;  2YN4 A;  5AKY A;  5AKJ A;  1RDF A;  5ALP A;  3FM9 A;  5AKK A;  4F72 A;  1JUD A;  2AH5 A;  3NAS A;  5AIC A;  2I6X A;  4UAS A;  1VJ5 A;  3KBB A;  1RQL A;  5AKX A;  2PKE A;  4HAI A;  1ZD3 A;  3CNH A;  3D6J A;  3QX7 A;  4Y2Y A;  4UAT A;  2YMM A;  1ZOL A;  1AQ6 A;  5ALO A;  5AI8 A;  4EEK A;  2YY6 A;  3QUQ A;  3ZI4 A;  5ALZ A;  3KOO A;  3IRU A;  3QUT A;  5AKG A;  2QLT A;  5AI4 A;  5ALG A;  5AIB A;  4C4R A;  2WF5 A;  5ALX A;  4Y2J A;  5AKZ A;  1ZD2 P;  4Y2R A;  3UMG A;  1QQ6 A;  4UAV A;  4GIB A;  3DDH A;  4CF5 A;  5ALR A;  3I76 A;  4Y2S A;  1FEZ A;  3WK6 A;  4EX6 A;  2W11 A;  2YML A;  1SWV A;  3ED5 A;  4UAU A;  3QU2 A;  2WF7 A;  5AKE A;  1QQ5 A;  2WF6 A;  5ALN A;  5AM5 A;  2HI0 A;  5ALU A;  3SD7 A;  3WKC A;  2FDR A;  4Y2V A;  3QXG A;  1ZD5 A;  5AI0 A;  3DV9 A;  2B0C A;  4CNQ A;  4F71 A;  5ALH A;  5AM1 A;  5ALL A;  1QQ7 A;  4UW9 A;  3WK9 A;  4CF3 A;  2WHE A;  1QH9 A;  4UAR A;  5AI9 A;  3WK5 A;  2WFA A;  5ALK A;  5ALM A;  2GO7 A;  3WKE A;  4DCC A;  1Z4O A;  2FI1 A;  3E58 A;  4G9B A;  5ALY A;  3WK7 A;  2WF8 A;  1SWW A;  1ZRM A;  2MU2 A;  4DFD A;  2NO5 A;  4JB3 A;  4CF4 A;  3QU4 A;  5AKI A;  3QU9 A;  5AI5 A;  5ALT A;  3QU5 A;  3UMB A;  5AKL A;  5AM0 A;  3QNM A;  5AI6 A;  3OTQ A;  5AK4 A;  1O08 A;  2NYV A;  4C4S A;  1RQN A;  5ALI A;  5FP0 A;  4Y2T A;  4EEN A;  4Y2X A;  1X42 A;  3WKA A;  2W43 A;  3MC1 A;  2YMP A;  4EEL A;  5AHX A;  1Z4N A; 
#chains in the Genus database with same CATH topology
 1WYG A;  5DB6 A;  9ICB A;  2FLN A;  3H4B A;  1Z3E B;  1TFR A;  1RYU A;  2ZIW B;  3HIL A;  5KFR A;  5AKH A;  4NLN A;  2YB4 A;  4FFD A;  4EYI B;  1PK1 B;  4TQS A;  1KFD A;  4JUZ A;  2NRV A;  3H7I A;  1UT5 A;  3Q8M A;  2ZIX B;  4DL3 A;  4NL9 A;  3HW8 A;  2ZXH A;  1MA7 A;  3B0X A;  2OHF A;  2AH5 A;  3NAS A;  2LYB A;  2A3V A;  2H3F A;  1ARO P;  2EZY A;  2PKE A;  3QX7 A;  8ICE A;  5KFL A;  4QZG A;  4LJX A;  4O5K A;  2YQE A;  4QWA A;  5C5J A;  3K1R B;  3ZDB A;  2ZIX A;  5HNK A;  4YR3 A;  2XO7 A;  2FE9 A;  1SXE A;  4UB2 A;  1SKW A;  2XCP A;  3AQE A;  3HRD D;  1SKS A;  1ZQF A;  2HBL A;  1ZQW A;  9ICO A;  1L7M A;  5CWR A;  1NJW A;  4NWI A;  4Y2V A;  5KFP A;  4P4P A;  1HJP A;  4DQR A;  4O5E A;  3WK9 A;  3QEB Z;  8ICC A;  5GTI U;  5KFC A;  1XO0 A;  8ICJ A;  5ALK A;  2KKP A;  3K75 D;  5L9X A;  4DFD A;  4ECX A;  4O9M A;  3TAR A;  1Z1B A;  4O3M A;  1T8E A;  5AI5 A;  4J9Q A;  2E1F A;  2KN7 A;  2KIC A;  3QNM A;  4RU9 A;  5KFN A;  4DSJ A;  4QZF A;  1NK7 A;  5ALI A;  5FP0 A;  1IM4 A;  3SZ2 A;  2QB0 B;  4DLE A;  1PUZ A;  2JEG A;  1VDV A;  4UAY A;  4FS2 A;  3U26 A;  1ZD4 A;  8ICO A;  4YD1 A;  3PR4 A;  2Y9T A;  2UVW A;  4IQW A;  1L3V A;  2E8P A;  4ED6 A;  2JXJ A;  4PL1 A;  4M9J A;  4M6W A;  3OSP A;  5EWE A;  5EE0 A;  2PFN A;  2AQ4 A;  3PZP A;  1XU4 A;  1V85 A;  3MFH A;  4ELU A;  1L8L A;  4MEX A;  3EUB 2;  4YXJ A;  2Y0S F;  2FLP A;  3SV3 A;  2UVU A;  4UB8 U;  3D6J A;  3JPN A;  4KLU A;  7ICJ A;  4EEK A;  3Q8S B;  4K4H A;  3NRZ A;  3QUT A;  3IRU A;  4I2F A;  2EAN A;  1NK9 A;  3CP8 A;  2VA2 A;  5KFO A;  3EPG A;  4YMO A;  1BGX T;  2NRT A;  1SZH A;  3KHL A;  3BQ0 A;  5J0Q A;  1EXN A;  2MA1 A;  8ICZ A;  3NRW A;  1QTM A;  4YMN A;  1Z00 A;  2WF6 A;  3T5L A;  5KG0 A;  3MDA A;  3PW2 A;  3GZF A;  4O3S A;  5KT5 A;  5AI0 A;  1FFU A;  1DK3 A;  1KFS A;  5KG4 A;  4FZL A;  9ICM A;  4Z6D A;  5CB1 A;  2G5I B;  1NK8 A;  2M9N A;  2ZTD A;  3RF9 A;  3WK5 A;  5ALY A;  3B9J A;  3GV5 B;  5J0S A;  1BPY A;  5F9N A;  4RQ3 A;  7ICQ A;  2ODG A;  3PVX A;  5AM0 A;  3N28 A;  1KQQ A;  2C2E A;  2FMS A;  3THV A;  5AHX A;  1PVQ A;  3KHR A;  4C0Z A;  4C8M A;  3RH6 A;  5DGB A;  3ZDD A;  4RQN A;  2V4R A;  3PW4 A;  5AM4 A;  8ICS A;  2OEH A;  4FBT A;  2EAO A;  2ZJ8 A;  5EE1 A;  3BQ2 A;  3GFK B;  5T14 A;  1Q8K A;  5KNI A;  4J9R A;  3T79 A;  2KV2 A;  2OCE A;  1ZQJ A;  2ZIU B;  3GV8 B;  3PR5 B;  1LKY A;  2KOB A;  1TK0 A;  1OXJ A;  3AU6 A;  4BXO B;  5J0O A;  3BQT A;  2B6G A;  2ZJ5 A;  1TAQ A;  2IA6 A;  5J2G A;  5DLG A;  2R8G A;  2KJ5 A;  5C0Y A;  2A1A A;  1MSW D;  2JH7 A;  5J2B A;  4UAT A;  4KLL A;  3FAH A;  3KKA A;  3E2E A;  3NUQ A;  1K1S A;  4U6P A;  4ED3 A;  4YP3 A;  2KZZ A;  3T5H A;  2W3R A;  4Y2R A;  4DLG A;  4M2Y A;  2C2R A;  3DDH A;  2EZX A;  1XWL A;  2L5Y A;  5ALR A;  2N1R A;  1NK4 A;  2F1H A;  2F77 X;  4NLB A;  5ALN A;  1SIJ A;  1NK0 A;  3SD7 A;  3AM9 A;  2BKE A;  3D2N A;  3QXG A;  4C7Y A;  2K4E A;  2R8H A;  2FPK A;  3RBD A;  1SV0 A;  4RQ4 A;  3GIL A;  2WFA A;  4UQG A;  2W9B B;  3WKE A;  4PPX A;  4DO9 A;  2WF8 A;  4DSK A;  4J9L A;  4ED0 A;  3E0F A;  2HOI A;  2W7O A;  4ED2 A;  2KKV A;  1ECW A;  4EZ6 A;  5HHH A;  5L1M A;  1ZQV A;  5DDY A;  4Y2X A;  4QZH A;  2R18 A;  5IIN A;  5DBA A;  2WAQ C;  4XUS A;  3UPQ A;  1L3T A;  3G6Y A;  2NRZ A;  2HMX A;  3M6Z A;  3T5J A;  4BDP A;  1X2I A;  1A77 A;  4I2B A;  2W8L A;  1O03 A;  2YMQ A;  3R9K A;  3HP6 A;  4FZM A;  1ZQZ A;  1SXD A;  2E8N A;  3QUC A;  4M0A A;  4TUR A;  2V4Q A;  4GC6 A;  2F3N A;  3VCB A;  3C5G A;  1TV9 A;  4Q43 A;  2ZIW A;  9ICG A;  5HML A;  2BR0 A;  4MF2 A;  2E1E A;  5EWF A;  1IG6 A;  2XC9 A;  5J0T A;  1VLB A;  4ECU A;  1URJ A;  3QZ8 A;  2EQY A;  4NLK A;  4KLI A;  3OSN A;  1RYR A;  4P0P A;  1QCK A;  1NKE A;  1JAL A;  1COO A;  4US8 A;  2DQN B;  4RQ6 A;  2RHF A;  4MF8 A;  2HVH A;  5KAF U;  4DOC A;  9ICE A;  1ZQS A;  5BOM A;  2RRD A;  5IIM A;  5D46 A;  2G0A A;  1X9S A;  2HI0 A;  1Y88 A;  2C2D A;  3HKZ F;  2QKQ A;  4P0P B;  1L7O A;  2ZTE A;  5DB9 A;  4FO6 A;  2BCU A;  4UW9 A;  8ICY A;  4ED7 A;  4ZH4 A;  3F2B A;  1NKB A;  4CCH A;  2LKY A;  2C28 A;  3QEA Z;  4QWB A;  2V9W A;  4DS5 A;  3MBY A;  4EBD A;  5AKI A;  4F5Q A;  5KFJ A;  1NJZ A;  1D9F A;  5EWG A;  3V6H A;  5KG6 A;  4TUQ A;  2HBM A;  4QZ8 A;  5CJ7 A;  1SKR A;  3M1Y A;  3C2L A;  4QWC A;  4C80 A;  8ICW A;  2KG5 A;  9ICN A;  5G5G A;  2BHN A;  1J97 A;  1T4G A;  4KLJ A;  1IXR A;  2ASD A;  3TI0 A;  2FJ6 A;  1WCN A;  2CPR A;  5CP2 A;  3BS7 A;  1ZQD A;  2Y1J A;  4DEZ A;  5KFU A;  5DQH A;  5KT3 A;  4DF4 A;  5KL1 B;  4EEY A;  5ALV A;  4PGY A;  5KFQ A;  3WK4 A;  2HDO A;  2IOH A;  2WF9 A;  2Q4T A;  3S6J A;  2D6F C;  5ALP A;  5J8Y C;  2ZIV A;  2W3S A;  3C28 A;  3KBB A;  4KLM A;  1UT8 A;  4HAI A;  4IRD A;  2FPL A;  3TAD C;  4DF8 A;  5AKG A;  1J2M A;  5HP4 A;  2BDU A;  1FO4 A;  3OJS A;  3MGI A;  2AXT U;  4AYB C;  5A0L A;  2JZB B;  4Y2S A;  2KZM A;  4YXM A;  4X5V A;  1X9W A;  2A19 A;  3M7D A;  3AN1 A;  4UAZ A;  4JWM A;  4F50 A;  4MFF A;  3J81 j;  2EAM A;  3DV9 A;  1ZQG A;  2JZB A;  5DB7 A;  2F2A B;  3GQC A;  2I9G A;  2PI4 A;  5ALM A;  3A0B U;  3GIK A;  4RZR A;  2F8K A;  2B21 A;  3MAB A;  2PXI A;  4BXO A;  1KSP A;  5CRX A;  7ICL A;  3MR2 A;  4TQR A;  1NJY A;  3EW9 A;  4ED1 A;  4I2G A;  3BZK A;  3PSP A;  3H8J A;  1H38 A;  8ICB A;  3FC4 A;  1ZYQ A;  2WAQ F;  3C1Y A;  2K4H A;  3MR6 A;  4FZN A;  2DKZ A;  2JEI A;  1ZQT A;  3LYS A;  4GC7 A;  1S8O A;  3RRG A;  1MQ3 A;  3UMC A;  2OM6 A;  3OHB A;  3JPR A;  3D2Q A;  4RQ5 A;  2XGQ A;  4TUP A;  1ZQX A;  5DBB A;  2K8B B;  1XO1 A;  3PMN A;  4A8E A;  4MHV A;  4MFC A;  1L6N A;  5DLF A;  5AKJ A;  4GLX A;  4IR9 A;  3UXN A;  4RPX A;  1B43 A;  2GLE A;  3RB0 A;  2P6U A;  7ICK A;  1RXV A;  2IMW P;  2YY6 A;  2HHT A;  5ALZ A;  2WB1 C;  1ZET A;  4DQQ A;  3ISD A;  2QLT A;  4C4R A;  3UMG A;  5IIL A;  4JK1 A;  1ED1 A;  2NRX A;  2BCR A;  4I2D A;  1KKX A;  3HJE A;  4LZG A;  3JPT A;  4ECQ A;  4MEY A;  2YML A;  3SI8 A;  2AGO A;  2J6U A;  8ICT A;  1RM6 C;  5ALU A;  1X40 A;  2AQ0 A;  2AGP A;  3M8S A;  2PFO A;  5J2C A;  5ALH A;  5J2K A;  4RUC A;  2K4P A;  3RR8 A;  2CRX A;  2YX8 A;  3HKZ C;  3M6K A;  4UAR A;  2HHX A;  4IC9 A;  3D2S A;  4XQ8 A;  3WK7 A;  4ECZ A;  3RJE A;  1N60 A;  2VAN A;  3UMB A;  5AKL A;  5J0Y A;  4IS7 A;  3PY8 A;  2W43 A;  4CE6 A;  4I2J A;  3BS5 A;  4DL2 A;  4O3Q A;  5L1K A;  2BDP A;  3NGD A;  4B9N A;  1ZRN A;  8ICI A;  3UM9 A;  1JX4 A;  2KFN A;  4F5P A;  3PX4 A;  1TE2 A;  3NTU A;  1L3U A;  3SEN A;  3LWM A;  5AM2 A;  5KG1 A;  4J03 A;  2UVR A;  2MUT A;  2HCF A;  1U45 A;  5AM3 A;  1NZP A;  3NVZ A;  1XSP A;  5CEH A;  4RQ0 A;  3TAP A;  3H4D A;  4UB5 A;  5F9L A;  4KLD A;  9ICU A;  4I2A A;  4DFP A;  2KP7 A;  1XSL A;  1N48 A;  3N4M B;  4DL5 A;  3JPS A;  1CI4 A;  3MR5 A;  3Q8R B;  2XY7 A;  2ES6 A;  4KN4 A;  1N5X A;  4CF5 A;  1BPD A;  4ED8 A;  1SL2 A;  4QNL A;  4YR2 A;  3H8S A;  5KG7 A;  3RB6 A;  2HHQ A;  4B9V A;  1KW4 A;  3HX0 A;  1S0M A;  2ZXI A;  4F2R A;  1GO3 F;  1X9X A;  3OGU A;  3AU2 A;  1S0V A;  1LB2 B;  2WTF A;  1N62 A;  5HMM A;  4RQ2 A;  2BZF A;  1Z4O A;  4DL6 A;  2MUT B;  5KT2 A;  1BVS A;  1ZRM A;  1NNL A;  2G09 A;  4UBB A;  1PK1 A;  1X6J A;  5CA7 A;  3QU5 A;  2W54 A;  2RQ5 A;  2JEJ A;  4C7Z A;  2BCS A;  1WWV A;  3LDA A;  1N56 A;  5B66 U;  4O3O A;  4O3N A;  8ICU A;  3RJG A;  2F1J A;  7ICG A;  2VJ4 A;  2NO4 A;  4IRC A;  1UCV A;  5KFB A;  3KHH A;  1SZP A;  3BJY A;  4QZ9 A;  3GIJ A;  2CN1 A;  5KFG A;  1K1Q A;  1IV8 A;  4G3I A;  3ZDA A;  4RQ8 A;  4J9M A;  2XID A;  2OYY A;  3N7S C;  4QZC A;  1Q46 A;  5ALS A;  2HHS A;  4P0Q B;  3WK8 A;  3KZX A;  4CGZ A;  2YN4 A;  1RDF A;  3B0Y A;  4DWI A;  3Q8K A;  4C8O A;  4NV0 A;  2AHO B;  1X66 A;  3QE9 Y;  9ICQ A;  3JPP A;  3K1Z A;  5KFS A;  4Y2Y A;  3CW2 C;  4TUS A;  4M04 A;  3FDS A;  3AQF A;  2JEF A;  1C7Y A;  1S9F A;  1RXW A;  5KFX A;  5JUM A;  7ICM A;  4JMU A;  4OO1 J;  3NVW A;  5DG8 A;  3GV7 B;  3SAH A;  4ELV A;  2VA3 A;  3I76 A;  9ICV A;  2W11 A;  4UAU A;  4NXZ A;  2Y0S C;  4CDG A;  8ICV A;  2KEY A;  5J0X A;  4M9N A;  3V6J A;  4I2C A;  4R65 A;  5G5H A;  2KD1 A;  2AGQ A;  7ICO A;  3TAC B;  7ICH A;  4CNQ A;  2W03 A;  5DQI A;  8ICQ A;  9ICI A;  7ICT A;  4YQW A;  2P6R A;  4F5N A;  3RBE A;  1DRG A;  2H3V A;  2ZUC A;  1XSN A;  4F5O A;  1TAU A;  1A0P A;  3GU3 A;  1ZQB A;  1NKC A;  1ZQC A;  4RT2 A;  5TIS U;  2F1I A;  3OTQ A;  1BPX A;  1ZJM A;  1YZ6 A;  1RQN A;  3ZDE A;  1WWU A;  4NM2 A;  2BCQ A;  4PH5 A;  2QAR B;  4IQV A;  3PW7 A;  2W9M A;  1IIP A;  3SAF A;  4BWM A;  2MSN A;  4KIT B;  1ZQM A;  2DPJ A;  9ICT A;  2NV3 A;  5ALQ A;  1CEZ A;  4DSE A;  4DQI A;  4R8U A;  2VA8 A;  4Y2U A;  3UXO A;  3PNC A;  4F8R A;  1V97 A;  1Q3U A;  2H3I A;  1ZQE A;  1BPE A;  5J0P A;  1MQ2 A;  3QZ7 A;  5KFH A;  2P35 A;  2ZUB A;  1JXE A;  5AKX A;  4YVZ A;  2KJ8 A;  1LKY B;  1ZD3 A;  4F4K A;  2BPC A;  3PX0 A;  2K89 A;  4QW8 A;  4RPZ A;  3SEI A;  1U4B A;  1DGS A;  3QUQ A;  1A6S A;  1N61 A;  4DQS A;  3C1Z A;  2WF5 A;  3PO4 A;  4RNN A;  2ATL A;  2HHW A;  3C5F A;  2K4I A;  4PZN A;  4KMU A;  3UXP A;  1WCL A;  7ICS A;  4F3O A;  2EAP A;  1QLN A;  1PK3 A;  2LPE A;  5D4B A;  3T5K A;  2H3Q A;  3WKC A;  4J9N A;  1SL1 A;  2OH2 A;  5KFI A;  1QSY A;  4XRH A;  2ESE A;  4WJ3 B;  5J29 A;  4EBC A;  3F5E A;  4CF3 A;  1BNO A;  2PI5 A;  2KE7 A;  4RPY A;  4I2E A;  3ZD8 A;  2C22 A;  4G9B A;  2W9A A;  2KHV A;  2HW3 A;  1LV5 A;  2E8O A;  1ZQK A;  4AYB F;  1KEJ A;  1FFV A;  2DKX A;  5AK4 A;  1T7P A;  1X42 A;  1D8B A;  3AL0 B;  3KHG A;  1Z4N A;  3MFI A;  5ALJ A;  4EBE A;  2PFQ A;  3A0H U;  9ICL A;  2BGW A;  4DSF A;  5AK6 A;  2HHV A;  4KLS A;  4PHA A;  5DDM A;  4QZI A;  1SV0 C;  3LK9 A;  4UB3 A;  3C29 A;  3PV8 A;  3V6K A;  3C21 A;  3G6V A;  5J2H A;  8ICH A;  3L5K A;  3DEE A;  8ICL A;  4NL9 C;  3BS5 B;  3H40 A;  1ZQO A;  4J9P A;  4KLG A;  4PHP A;  3RH4 A;  4Z6C A;  4LVS A;  2G06 A;  3V7L A;  2IHM A;  1M6Y A;  3LWL A;  3FYH A;  1ZOL A;  5KG5 A;  4ELT A;  3Q8P B;  1L3S A;  2W8K A;  3F53 A;  1F5S A;  2XCA A;  3KKA C;  4GXI A;  1SB3 C;  5III A;  2KK0 A;  4DSL A;  2HVI A;  5DG9 A;  2D3D A;  2WF7 A;  1QQ5 A;  3M9N B;  2KMD A;  4NLG A;  3ICX A;  1ZQQ A;  2JRZ A;  9ICC A;  5J0R A;  3IN5 A;  4F71 A;  1QQ7 A;  5DKW A;  4JV2 A;  2H3Z A;  7ICR A;  5J2J A;  2GH1 A;  5AI9 A;  1PZN A;  4DL4 A;  3WU2 U;  4K4G A;  2KNJ A;  1ZQR A;  3V7K A;  3QU9 A;  2DF4 B;  2ZIV B;  3ORY A;  5AI6 A;  2DWQ A;  4C4S A;  1U49 A;  5KL8 B;  1SGG A;  3TAD A;  4DSI A;  5DGA A;  2E5S A;  1ZQU A;  4BJQ A;  4BWJ A;  1YZ7 A;  4O0I A;  1S0O A;  1JRO A;  1COK A;  3N7P D;  1X9M A;  8ICK A;  2M0N A;  2ZJA A;  3QU7 A;  4UAW A;  3F5A A;  2GWS A;  4Q44 A;  4DQP A;  4JV1 A;  1SL0 A;  5J2A A;  1NOM A;  3QUB A;  3M9M B;  2QB0 A;  4C4T A;  4PGX A;  3JPQ A;  3G6X A;  5ALF A;  5AK5 A;  2ASL A;  5KFK A;  4Z6E A;  2JGA A;  3ONN A;  1S97 A;  1BPZ A;  5AK3 A;  3WKB A;  3N7R C;  1Z19 A;  2ASJ A;  4IR1 A;  4P4M A;  1VJ5 A;  1N63 A;  3CNH A;  1AQ6 A;  5GTH U;  4M47 A;  4YN4 A;  2KVC A;  4P4O A;  4IL6 U;  2HBK A;  3AEV A;  5AI4 A;  2BQ3 A;  2H5X A;  4AP9 A;  5KG3 A;  1ZD2 P;  1CRX A;  5CHG A;  4PGQ A;  1UA1 A;  7ICF A;  9ICR A;  3NS1 A;  2KIW A;  5HR7 A;  1BPB A;  1L8O A;  3SMV A;  3RH5 A;  5L1I A;  2DPI A;  4ECW A;  2Z7J A;  4J9S A;  4CRX A;  2B0C A;  4BUG A;  4R66 A;  3IHQ B;  2ZTC A;  4F91 B;  5DG7 A;  4NJ8 A;  3F2D A;  2F8L A;  3C23 A;  4FS1 A;  1Z00 B;  3L3F X;  3ETL A;  3TAQ A;  3RR7 A;  2DFL A;  2D8C A;  4RNO A;  3IG5 A;  3RAQ A;  8ICX A;  2UVV A;  3Q8L A;  4FBU A;  1O08 A;  4C8K A;  1N5W A;  1RG6 A;  1T94 A;  1KRP A;  5CR0 A;  4NLC A;  4LZD A;  9ICJ A;  1L7P A;  4I28 A;  4OCZ A;  2FPM A;  3RJI A;  4EX7 A;  4DOB A;  3V7J A;  4PHE A;  4I27 A;  3HT3 A;  4OJ6 A;  3VC8 A;  4QJF B;  2OWO A;  3UQ0 A;  3TQ1 A;  1S77 D;  5B5E U;  3NVV A;  7ICP A;  4J9K A;  1NI3 A;  4JWN A;  1J2N A;  5HR6 A;  1WG8 A;  1ZXI A;  4YCX A;  2BQU A;  9ICK A;  2BPF A;  1NZB A;  2I6X A;  4USA A;  1RQL A;  3H0M B;  2YMM A;  1HEK A;  3AUO A;  5ALO A;  3KOO A;  5KAI U;  3N97 B;  5ALG A;  4ACO A;  1HUO A;  5AKZ A;  2IHN A;  4UAV A;  1CUK A;  4GIB A;  4YFK A;  1D9D A;  5KT6 A;  1UHU A;  3WK6 A;  5J8Y A;  2Q0Z X;  4QWD A;  5IIK A;  1ZQ1 C;  9ICW A;  5IIO A;  5JTI A;  5J2E A;  2LHT A;  1ZQY A;  4O3P A;  2BQR A;  8ICP A;  2HOF A;  1JRP A;  3GIM A;  8ICF A;  7ICU A;  1C20 A;  2YTU A;  3V72 A;  4KLQ A;  2XI9 A;  1S0N A;  4KTQ A;  2P66 A;  2HHU A;  4DCC A;  5L1L A;  3PSI A;  4XA5 A;  2FI1 A;  2J6S A;  1OW5 A;  2ISO A;  3H8W A;  2MU2 A;  3RFA A;  4CF4 A;  2MRL A;  5KFY A;  3SQI A;  5DQG A;  4ECT A;  5L1J A;  4EEN A;  8ICR A;  1ZQL A;  3ETR A;  3TKA A;  2W9B A;  5HHI A;  5KFE A;  4YD2 A;  1KLN A;  4Q8E A;  4KX3 A;  2KVS A;  1U9L A;  3PSF A;  3RRH A;  1YT3 A;  3ZD9 A;  1L7N A;  4Y2Q A;  5J2D A;  3SYZ A;  5AIA A;  2RLT A;  1F0M A;  4B9L A;  5ALE A;  4DOA A;  2JH1 A;  7ICE A;  3HWT A;  2R8K A;  4QIW F;  3IP4 B;  3RJJ A;  4Y2P A;  2JHD A;  1MC8 A;  1XS9 D;  5AKY A;  2F44 A;  4F72 A;  2R8I A;  2ZG6 A;  3RTV A;  3MR3 A;  3AMZ A;  5KTQ A;  4RQM A;  1KDH A;  4C8N A;  3BQ1 A;  2W7P A;  4KLH A;  5DB8 A;  4KLO A;  4R63 A;  5AIB A;  1BNP A;  2JV3 A;  3Q8Q B;  2RP5 A;  1KTQ A;  4B9M A;  1TKD A;  1SWV A;  3ED5 A;  4YR0 A;  2ZIU A;  5AKE A;  4C8L A;  1TK8 A;  4BX9 C;  1P7D A;  1N2X A;  1MN8 A;  1V9P A;  5TZV A;  2YB1 A;  1Z1V A;  4I2I A;  2LBO A;  2ISP A;  2O6K A;  1TAM A;  8ICM A;  9ICX A;  3TFS A;  5ALL A;  2LMR A;  3H0R B;  1D8Y A;  5F3X B;  4RUA A;  4B9U A;  4PL2 A;  4NLZ A;  2GO7 A;  4UB4 A;  2Y9U A;  2EDU A;  2NO5 A;  4DFJ A;  1UQV A;  8ICA A;  4F5R A;  4U7C A;  7ICV A;  1S5L U;  2CXY A;  3WKA A;  4UB1 A;  2A1J A;  9ICF A;  2YMP A;  4EEL A;  1ZQH A;  4F92 B;  5AIC A;  3I28 A;  4ECS A;  1QSS A;  1LVH A;  8ICN A;  4OD0 A;  2K8A A;  4F93 B;  2HOQ A;  9ICH A;  2PMZ F;  3BDP A;  3BQ7 A;  4KMO B;  4OJO A;  1B0X A;  4Z6F A;  4OJL A;  9ICA A;  3ZDC A;  2W9C B;  1U48 A;  2BPG A;  5KG2 A;  2IOF K;  3PST A;  4JV0 A;  3ISB A;  4PZO A;  1S10 A;  5E79 U;  4F4Y A;  4K4I A;  4GFJ A;  4O5C A;  5J0U A;  1JUD A;  3M8R A;  4UAS A;  1OUQ A;  2JR5 A;  5KT4 A;  4M9L A;  8ICG A;  5KFD A;  2W9C A;  5J0W A;  3EZ5 A;  4M9H A;  4P0Q A;  4DFK A;  4FE3 A;  2LYA A;  9ICS A;  2KFZ A;  2BCV A;  1PVR A;  5ALX A;  4Y2J A;  1F44 A;  4YMM A;  1QQ6 A;  3TAN A;  7ICI A;  1WUD A;  2PFP A;  2A1J B;  3QU2 A;  3PW5 A;  1UA0 A;  4IQU A;  1TVA A;  1NK5 A;  5AM5 A;  5BPC A;  3OPX A;  4F4X A;  3RJH A;  1ZD5 A;  3K4G A;  4RNM A;  3H0L B;  2OXO A;  1XNS A;  1NK6 A;  5EOZ A;  3CYM A;  3O0F A;  2I1Q A;  4UB6 U;  2ZUD A;  2VIX A;  4RQ1 A;  4Q45 A;  1A76 A;  3EWA A;  2JMG A;  4RQ7 A;  1U47 A;  3MGH A;  1ZJN A;  4QZA A;  3NVY A;  5H2F U;  4PHD A;  2LYH A;  3PX6 A;  4KN7 A;  3OHA A;  1V38 A;  4B9T A;  1ZQA A;  1KFT A;  2IBK A;  4F4W A;  4Y2T A;  4KLT A;  5IIJ A;  2DGZ A;  2XGP A;  2KTQ A;  3C2K A;  1JI7 A;  5KFV A;  2NRW A;  4GXJ A;  3BZC A;  1ZQI A;  3WKD A;  4MFA A;  1RZT A;  4F2S A;  1ZQN A;  2G5H B;  2QAR A;  3PO5 A;  1L5U A;  4QIW C;  2KHQ A;  2F76 X;  5KFW A;  3HPO A;  3TFR A;  5EE3 A;  3L4P A;  1JXL A;  1DK2 A;  5AKK A;  2G07 A;  4B6J A;  3RAX A;  2EH9 A;  4O3R A;  2PMZ C;  4UBC A;  4ECV A;  1D8L A;  3ZI4 A;  3MDC A;  1B4F A;  1HIW A;  5KFM A;  2VKQ A;  2LI6 A;  1X6I A;  3PW0 A;  4ECY A;  3RJK A;  1FEZ A;  4M9G A;  4M6W B;  2DL0 A;  2R8J A;  4EYH B;  4J9O A;  2I5H A;  2FDR A;  3UQ2 A;  3RB3 A;  3IM1 A;  3C2M A;  1DGJ A;  5AM1 A;  4E0D A;  2WHE A;  4BGD A;  1QH9 A;  1RYS A;  1TK5 A;  3E58 A;  4QWE A;  4Q8F A;  1SWW A;  2DBY A;  4QW9 A;  4JB3 A;  3QU4 A;  1JN3 A;  3ALR A;  5ALT A;  2AJQ A;  2KZ3 A;  5J2F A;  3MGV A;  1JMS A;  3SAG A;  3EPI A;  4F4Z A;  2NYV A;  4ICA A;  2QB1 A;  1KN5 A;  3H8M A;  1QSL A;  2EZZ A;  4QZB A;  3M9O B;  4R8U B;  3KFU F;  5KT7 A;  4R64 A;  1Q3V A;  3LVV A;  3IV6 A;  1S76 D;  7ICN A;  4DFM A;  4DS4 A;  2Y1I A;  5KFT A;  2W04 A;  5JU5 A;  3ISC A;  5KFA A;  1NJX A;  4US9 A;  3GII A;  4B9S A;  1PVP A;  2HSZ A;  3QYP A;  3I1Y A;  2KSO B;  3RB4 A;  3OJU A;  2GOL A;  4IQT A;  2XY5 A;  5KFZ A;  3SV4 A;  5ALW A;  4I2H A;  1FIQ A;  5ALD A;  5D49 A;  2FMQ A;  1DOQ A;  2IOF A;  4PJ0 U;  1XC9 A;  1UPH A;  1KL9 A;  2RDJ A;  1K5O A;  2VJ5 A;  3FM9 A;  2K60 A;  2KSO A;  5J2I A;  4IRK A;  2XVT A;  2J6T A;  9ICP A;  2XY6 A;  1T3Q A;  5AI8 A;  4GXK A;  1KBU A;  2E3T A;  4QZE A;  1B22 A;  4QZD A;  4YG2 A;  3JPO A;  4NM1 A;  3SR6 A;  2K8C B;  4RT3 A;  5BOL A;  4OJP A;  3PML A;  4P2H A;  3T3F A;  2WB1 F;  4EX6 A;  4KX5 A;  2AU0 A;  4ZOH C;  2W55 A;  3KTQ A;  5JRT A;  1SV4 A;  5EE9 A;  4OJ5 A;  3KZI U;  3IG8 A;  2MAX A;  2FLL A;  2E8M A;  2XIC A;  3KD3 A;  3RJF A;  4EZ9 A;  2KIV A;  2G08 A;  2ALZ A;  3F2C A;  4DL7 A;  1HUZ A;  1ZQP A;  1DXS A;  1JIH A;  5KFF A;  1RPL A;  3CRX A;  2HBJ A;  2FMP A;  1T3N A;  2KJ9 A;  4HYK A;  2LM4 A;  4I29 A;  4ECR A;  4KLE A;  5DBC A;  2RDI A;  2DUY A;  5K4L A;  3GDX A;  3MC1 A;  3LVW A;  3EYZ A;  3IDW A;  2LM1 A;  4KLF A;  4NY8 A; 
#chains in the Genus database with same CATH homology
 4CE6 A;  3I28 A;  5ALJ A;  3QU7 A;  4OCZ A;  1LVH A;  2MSN A;  2NO4 A;  3U26 A;  1ZD4 A;  4OD0 A;  5AK6 A;  4EX7 A;  1ZRN A;  5AM4 A;  3UM9 A;  4Y2Q A;  1S8O A;  5AIA A;  3QUB A;  3UMC A;  1TE2 A;  1O03 A;  5ALQ A;  2YMQ A;  5ALE A;  3R9K A;  3WKD A;  4C4T A;  3L5K A;  4Y2U A;  2HSZ A;  3QUC A;  3QYP A;  5ALV A;  5ALF A;  3I1Y A;  5AK5 A;  5AKH A;  5AM2 A;  4J03 A;  4Y2P A;  4FFD A;  5ALW A;  2HCF A;  3WK4 A;  2IOF K;  5ALS A;  5AM3 A;  5ALD A;  2HDO A;  5AK3 A;  3WKB A;  3WK8 A;  2IOH A;  2WF9 A;  2IOF A;  3S6J A;  2YN4 A;  5AKY A;  5AKJ A;  1RDF A;  5ALP A;  3FM9 A;  5AKK A;  4F72 A;  1JUD A;  2AH5 A;  3NAS A;  5AIC A;  2I6X A;  4UAS A;  1VJ5 A;  3KBB A;  1RQL A;  5AKX A;  2PKE A;  4HAI A;  1ZD3 A;  3CNH A;  3D6J A;  3QX7 A;  4Y2Y A;  4UAT A;  2YMM A;  1ZOL A;  1AQ6 A;  5ALO A;  5AI8 A;  4EEK A;  2YY6 A;  3QUQ A;  3ZI4 A;  5ALZ A;  3KOO A;  3IRU A;  3QUT A;  5AKG A;  2QLT A;  5AI4 A;  5ALG A;  5AIB A;  4C4R A;  2WF5 A;  5ALX A;  4Y2J A;  5AKZ A;  1ZD2 P;  4Y2R A;  3UMG A;  1QQ6 A;  4UAV A;  4GIB A;  3DDH A;  4CF5 A;  5ALR A;  3I76 A;  4Y2S A;  1FEZ A;  3WK6 A;  4EX6 A;  2W11 A;  2YML A;  1SWV A;  3ED5 A;  4UAU A;  3QU2 A;  2WF7 A;  5AKE A;  1QQ5 A;  2WF6 A;  5ALN A;  5AM5 A;  2HI0 A;  5ALU A;  3SD7 A;  3WKC A;  2FDR A;  4Y2V A;  3QXG A;  1ZD5 A;  5AI0 A;  3DV9 A;  2B0C A;  4CNQ A;  4F71 A;  5ALH A;  5AM1 A;  5ALL A;  1QQ7 A;  4UW9 A;  3WK9 A;  4CF3 A;  2WHE A;  1QH9 A;  4UAR A;  5AI9 A;  3WK5 A;  2WFA A;  5ALK A;  5ALM A;  2GO7 A;  3WKE A;  4DCC A;  1Z4O A;  2FI1 A;  3E58 A;  4G9B A;  5ALY A;  3WK7 A;  2WF8 A;  1SWW A;  1ZRM A;  2MU2 A;  4DFD A;  2NO5 A;  4JB3 A;  4CF4 A;  3QU4 A;  5AKI A;  3QU9 A;  5AI5 A;  5ALT A;  3QU5 A;  3UMB A;  5AKL A;  5AM0 A;  3QNM A;  5AI6 A;  3OTQ A;  5AK4 A;  1O08 A;  2NYV A;  4C4S A;  1RQN A;  5ALI A;  5FP0 A;  4Y2T A;  4EEN A;  4Y2X A;  1X42 A;  3WKA A;  2W43 A;  3MC1 A;  2YMP A;  4EEL A;  5AHX A;  1Z4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...