2MU2A

Nmr structure of the cap domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
b'LLDSYEAILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLLVRVAEDRNLDVEVLNQVRAQSLAEKNAQVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, haloacid dehalogenase-like family
publication title J-UNIO protocol used for NMR structure determination of the 206-residue protein NP_346487.1 from Streptococcus pneumoniae TIGR4.
pubmed doi rcsb
source organism Streptococcus pneumoniae tigr4
molecule tags Hydrolase
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2mu2A00
2MU2A 3WKBA 1RQNA 1ZD2P 1ZRNA 4UW9A 1ZOLA 4F71A 4Y2YA 4GIBA 3S6JA 4G9BA 1RQLA 3E58A 5AM4A 4Y2QA 2HSZA 4C4TA 4UASA 2WF6A 1FEZA 3QUTA 2QLTA 2HI0A 4Y2VA 4OD0A 4EEKA 5AM3A 1ZRMA 2MSNA 2WF9A 3OTQA 3U26A 2B0CA 1O03A 5AHXA 2NYVA 5ALQA 3WKEA 3QU7A 1Z4NA 1ZD3A 3DV9A 4Y2JA 3QU5A 3QU2A 2YMMA 3R9KA 3WKCA 1X42A 2HCFA 5FP0A 3ZI4A 1SWVA 1VJ5A 2AH5A 4Y2TA 5AKHA 4Y2SA 5ALZA 3KOOA 3WK6A 2YMQA 2FI1A 5AK6A 1QQ5A 2WFAA 4JB3A 5AKZA 3WK9A 5AKKA 5AKLA 1RDFA 3KBBA 5AIBA 4EX7A 5ALJA 4CE6A 5ALNA 3FM9A 4EELA 2IOHA 5AI8A 4UAUA 1TE2A 5AKIA 5ALWA 3QUCA 2WF8A 3IRUA 5AKXA 2FDRA 5ALVA 3DDHA 5ALLA 4CF3A 4UATA 5ALDA 1ZD5A 3CNHA 3NASA 3I1YA 5AKJA 3WK4A 2IOFA 4EX6A 4Y2RA 3QNMA 5AIAA 1ZD4A 2IOFK 5ALEA 4DFDA 5ALSA 5ALOA 2PKEA 4Y2UA 5ALFA 5AK3A 5ALRA 5ALUA 5AI9A 3QYPA 2YN4A 5AM0A 3WKAA 4CF4A 4Y2PA 4C4SA 4Y2XA 2NO5A 5AICA 5ALTA 5AM5A 5ALYA 3L5KA 2YMPA 5AI5A 4CNQA 4DCCA 3QU4A 4OCZA 5ALXA 4C4RA 2YY6A 3D6JA 4CF5A 1S8OA 4UARA 3WK8A 3UMCA 5ALHA 1Z4OA 1JUDA 3WKDA 2GO7A 3QU9A 3I28A 2I6XA 3QUQA 5AI0A 2W11A 4UAVA 5AKEA 5AM1A 5AM2A 1SWWA 2NO4A 4FFDA 5AK4A 3QX7A 5AI4A 5ALPA 4F72A 3WK7A 5ALKA 2WF7A 4EENA 1AQ6A 1QQ6A 3QUBA 4J03A 5ALIA 3ED5A 3UMGA 3UMBA 2W43A 1QQ7A 3QXGA 4HAIA 5AI6A 3MC1A 5AKGA 1QH9A 2WF5A 5ALMA 3WK5A 5AK5A 1O08A 3I76A 2YMLA 5AKYA 3SD7A 5ALGA 2WHEA 1LVHA 3UM9A 2HDOA
chains in the Genus database with same CATH superfamily
3N7SC 4YP3A 4UW9A 4EYIB 4ECQA 4DL6A 4C8LA 1KLNA 3QE9Y 2FMSA 3FYHA 3ORYA 4QZBA 1BGXT 4ED1A 3IV6A 3PW7A 4Q8FA 9ICLA 3LVWA 5BPCA 3QU7A 4F5OA 1Z4NA 3QU2A 1SL0A 1XWLA 7ICIA 4OJOA 2ZXIA 4JK1A 3RF9A 1VJ5A 7ICGA 8ICRA 1H38A 1MSWD 2AGPA 4NL9C 3EYZA 1KEJA 2HBKA 2LYBA 3SQIA 1N63A 4RQ5A 5IINA 2K4HA 4UAUA 4YR3A 7ICSA 2R8IA 9ICJA 4G3IA 5KFSA 3V7KA 2AHOB 4TUQA 4UQGA 4DQIA 4TQRA 3PVXA 4Y2RA 4B9SA 4DFDA 1TAQA 1L3TA 4Y2UA 5ALFA 1ZQOA 2VJ5A 4RQMA 2V4RA 4YR0A 2IA6A 2LMRA 5T14A 4B9LA 5DB7A 5DDMA 1U9LA 5ALXA 5L1JA 3SYZA 4UB4A 1WG8A 4J9QA 4K4IA 3F5EA 3JPTA 2BZFA 4O0IA 3RJFA 2JXJA 5KFYA 7ICVA 8ICCA 3PR4A 5ALPA 2E8OA 5AI4A 3WK7A 4KMUA 1BPBA 2GWSA 2KJ5A 4QZAA 1NKBA 2Y9UA 1IXRA 4KLUA 1L7PA 2W43A 4HAIA 4J9RA 3AM9A 2Y1IA 8ICVA 3I76A 4RPXA 2P35A 2XO7A 1IIPA 4M6WA 2HDOA 3PX0A 1ZD2P 4B9NA 4Q8EA 4UAYA 4BWJA 4C4TA 5J0OA 3F2DA 2CRXA 2ZTCA 1TFRA 3MABA 3K75D 4EZ9A 1ZQXA 2AGOA 1VLBA 3RH5A 2GLEA 1KDHA 5DBAA 5D46A 3BQ7A 4RQ4A 2J6TA 8ICBA 2OEHA 5J2IA 3WK6A 2KE7A 2XGQA 5HR7A 4DSIA 5KFHA 3BDPA 2JR5A 2I5HA 3GIKA 2A1JB 2DFLA 1TV9A 5AI8A 1TE2A 5AKXA 3AN1A 3OSNA 1KL9A 1ZD5A 3I1YA 3QEAZ 3EPGA 1BPZA 5KG5A 4DQRA 1UQVA 5KG0A 4C7ZA 4O3NA 4MEYA 4P0QA 1YZ7A 1S97A 2JRZA 5J0YA 4LZGA 4AYBF 9ICKA 2W9BA 4ECXA 1UT5A 4JMUA 2W03A 4NLBA 3H7IA 5KT5A 3WKDA 3I28A 3B9JA 1L3UA 4GXJA 2NO4A 3SR6A 2V4QA 2R8HA 1NOMA 2HHTA 1HUOA 1FIQA 4C0ZA 5ALMA 4M9NA 3SD7A 2ZJ5A 4EZ6A 1BPEA 8ICOA 4C8MA 3JPNA 2KFZA 4MFAA 4GIBA 3RJKA 1ZQWA 4YMOA 3C2MA 2KZ3A 4UASA 1S0NA 3KHLA 4I2AA 4I2IA 4QWCA 1O03A 4P0PA 1ZQRA 2FMQA 1BNOA 5BOMA 1NKCA 5KAFU 1KQQA 4DF4A 3NGDA 5DLFA 1Q3VA 4DFKA 2KEYA 2D3DA 4UAWA 3QZ7A 4A8EA 1XSPA 2XY5A 1AROP 4QW8A 2PFQA 2F44A 4F4WA 4MHVA 3M6ZA 2F1HA 4BX9C 3MGVA 4MF2A 1ZQPA 4PJ0U 2YTUA 2YN4A 3BZKA 4KLHA 1L8OA 1ZQNA 1NI3A 3ALRA 4AP9A 1HUZA 2HHSA 4BWMA 4J9KA 2E8MA 4NM2A 2E8PA 2KIVA 1SXEA 2ZUDA 1ZQ1C 2DUYA 3RB0A 1PUZA 2YB4A 1ZETA 3LDAA 3MDAA 1ZQUA 3L3FX 4I2HA 5F3XB 4BGDA 3HT3A 3LYSA 1AQ6A 4DQPA 8ICJA 3VCBA 1WCNA 1A77A 5J0WA 1X9XA 3NS1A 5AK5A 3PW4A 4PGQA 4KLOA 2H5XA 2LI6A 2ZTEA 2RP5A 4I2GA 3LWMA 2K89A 2DWQA 2KFNA 1P7DA 1N48A 2KOBA 2XCPA 1S76D 5DGAA 2K4IA 2YB1A 4PPXA 4QNLA 2WF6A 2P6UA 2ZUBA 9ICIA 4MEXA 3F53A 5DQHA 2C2EA 2FPMA 1XO0A 4U6PA 1NJZA 1XSNA 3QZ8A 3R9KA 5CP2A 5KFUA 1U47A 1DXSA 2O6KA 3NTUA 9ICNA 3K1ZA 5AKHA 3C29A 2ZIVA 1KRPA 3HKZC 2LYAA 5J2DA 4UAZA 1L7NA 5DKWA 1S0MA 2XC9A 4K4HA 3Q8QB 3PX6A 7ICOA 4IC9A 3F5AA 4MF8A 4I29A 3ZDDA 1SL1A 1F5SA 5J29A 3QNMA 3H0RB 2KKVA 1ZQTA 5ALOA 4YR2A 3L4PA 5J2JA 4CRXA 2F8KA 9ICSA 4DSJA 4QZEA 2JH1A 2W8LA 4DL2A 3RRHA 3RH6A 1BPXA 4BXOA 4P4MA 1S8OA 4IQUA 2NV3A 1ZQDA 4BUGA 2W11A 4I2CA 4I2BA 2HOQA 3MR3A 1L3SA 2AJQA 1QQ6A 1T3QA 2DF4B 3TANA 1PVPA 4DOBA 5EWFA 3M9MB 1X9MA 2I9GA 2M9NA 1CRXA 3QXGA 2MUTB 4ZH4A 3H8JA 1F44A 2XICA 1NK7A 2HBMA 2PMZF 3H0MB 3KHHA 4EBEA 4YCXA 4E0DA 3WKBA 1ZOLA 4USAA 4BXOB 3AMZA 2KK0A 1RYSA 2LBOA 8ICIA 1Z3EB 4PHEA 5DDYA 5HNKA 4LJXA 1NK6A 5CRXA 4DLGA 4JUZA 5EOZA 4F3OA 1KTQA 2KJ8A 2FLNA 4P4OA 2HCFA 2ASDA 2ODGA 4DS5A 4DL3A 3V6HA 1QQ5A 2XGPA 4O3SA 1JALA 3KBBA 3AUOA 4ECYA 3THVA 5AKIA 1N5XA 3AQFA 3ETLA 4M9JA 1DGSA 3CYMA 4R8UA 2HHUA 4DQSA 2HVIA 4U7CA 4TQSA 4DOAA 5B5EU 2G5IB 1KFSA 4C8KA 8ICGA 3IM1A 3EUB2 2JGAA 2ES6A 1V97A 4GLXA 4J9NA 2ZJAA 4ECWA 1SIJA 5J2FA 4MFCA 3C28A 5KFDA 2FLPA 4ED8A 5KL1B 5DG9A 2LM4A 4R8UB 9ICMA 3G6VA 5J8YA 1PVRA 2BDUA 2BGWA 1MA7A 4GXIA 1D8BA 1NZBA 1Y88A 4F4XA 2BQ3A 9ICHA 3PY8A 2D8CA 2VANA 4NXZA 4ED6A 4GXKA 1D8YA 1IM4A 2KHQA 4J9PA 8ICMA 2BCVA 2M0NA 3PSPA 4F5QA 1SXDA 3D2QA 1S10A 2HMXA 4KLLA 5IIMA 3QUTA 9ICQA 4AYBC 3RR7A 3GV8B 4OD0A 4PHAA 3O0FA 3U26A 3K1RB 2ASLA 3BQ1A 4O9MA 5KG1A 1ZD3A 3JPRA 3WKCA 5C5JA 3H40A 4DSFA 7ICRA 3T5LA 3VC8A 2R18A 5AK6A 3UPQA 2P66A 5IIOA 2HHQA 1DK2A 4QIWC 2EZXA 4QJFB 5DQIA 4YMMA 3BQTA 1SZPA 2E1EA 1Q8KA 4ECRA 2ZIUA 4J9MA 4EYHB 4YXJA 4YXMA 1ZQFA 3HILA 4ED7A 5AIAA 5KFRA 3RJGA 2PFNA 4KN4A 3C21A 2YQEA 3CRXA 1B22A 3HW8A 5J0QA 2BCSA 4DSLA 3H4DA 2BR0A 3GIJA 5IILA 2YMPA 3H8SA 1ZQCA 1KBUA 5HMMA 4ELVA 4CF5A 2KJ9A 5F9NA 9ICVA 1NK0A 4GFJA 5AI0A 2I6XA 2ZIUB 4JV1A 3GIMA 4FS1A 5KNIA 3Q8SB 3HRDD 3QUBA 5EE3A 2R8JA 3RJIA 2ZTDA 1U45A 1ZQMA 9ICUA 4NL9A 3UMBA 4YQWA 2XY6A 4XA5A 2ZIXB 2K8BB 4NLZA 2WB1F 1T4GA 5AKYA 1ZQZA 2WHEA 3SMVA 1ZRNA 1SZHA 5KFKA 2QB1A 3RTVA 4FZNA 2QLTA 8ICYA 4EEKA 4BJQA 2BPGA 4M9LA 1UA1A 4Y2JA 4RU9A 4UB5A 5FP0A 4QWAA 1X9SA 3B0XA 4DQQA 5KFJA 4PGXA 1JXEA 2AH5A 3RB3A 4Y2SA 3IP4B 2A1JA 2C2RA 7ICNA 4PZNA 3KOOA 4QZ9A 3TFSA 3BZCA 2B6GA 2G08A 2W3SA 5EE1A 8ICHA 4RT2A 2EH9A 4EELA 4Q45A 3RRGA 2Y1JA 2EANA 1Z19A 3UXPA 2KHVA 4YD2A 4R63A 2KN7A 1L6NA 1SV4A 5ALSA 4IR9A 5H2FU 5CHGA 4O5CA 4M9HA 2EQYA 5KFNA 2W3RA 4QZHA 2ESEA 5AICA 1TVAA 3N97B 5KFQA 2XY7A 3GFKB 4DO9A 5DG7A 2YY6A 2V9WA 5L1MA 4FZLA 3AEVA 2Y0SC 3QUQA 1Q3UA 1S77D 2BCUA 1CUKA 1TK0A 3RAQA 3TAPA 3KHRA 1S5LU 4KMOB 1T7PA 5D4BA 2Y9TA 4F2SA 2JV3A 2JEFA 5DB6A 1QQ7A 5AI6A 5KT4A 1UT8A 2DQNB 3V6JA 1RG6A 4OJPA 5IIIA 4Z6EA 5ALGA 3KTQA 1UHUA 1U48A 2KICA 1MQ2A 3E2EA 2RHFA 1JMSA 3PO5A 1OUQA 2ZXHA 4DL5A 4MFFA 2DPIA 2WF9A 4R64A 5KT3A 3MR6A 1ZQVA 2HOFA 5KAIU 1L8LA 5ALQA 2OYYA 2VJ4A 3TACB 5CB1A 2KD1A 3Q8MA 3RJHA 4O3OA 1XS9D 2KZZA 1SKWA 5ALZA 4QZDA 2A19A 2FI1A 5AKKA 1SKRA 1IG6A 1PK3A 1X9WA 2N1RA 2OWOA 2W7PA 2KVSA 3NRWA 5KFPA 4F5PA 3MGIA 4CF3A 4UBCA 3JPSA 2LKYA 5AKJA 2JZBB 1ZD4A 3ZDCA 1A0PA 2IOFK 5ALEA 5DQGA 2HVHA 1B4FA 2LYHA 1LKYA 7ICQA 4QZFA 2MAXA 4GC7A 8ICEA 4C4SA 4ECUA 5J0PA 5KFOA 3L5KA 4ELTA 9ICFA 2K60A 4C4RA 5HR6A 5AKEA 8ICNA 4UAVA 1N56A 2E8NA 2G07A 1SKSA 3OJSA 2ASJA 4EENA 1NK4A 3ISDA 4UB1A 5CWRA 2G0AA 1LKYB 4TURA 3MC1A 2ATLA 2WF5A 4O5KA 4F93B 2OH2A 3V7JA 1JROA 3FAHA 1JI7A 3HJEA 2A3VA 2IBKA 4F92B 3EZ5A 4OO1J 4KITB 1NJXA 3N4MB 3M9OB 3OHBA 4F71A 1KSPA 4B9MA 5J2GA 3G6YA 1PZNA 1XC9A 3PMLA 5AM3A 1ZQLA 3Q8LA 2IHNA 3HX0A 3BS5B 2B0CA 4RZRA 3DV9A 3QU5A 3KKAA 2WAQC 4US8A 2DKZA 5E79U 2J6UA 4CE6A 5ALNA 3NVZA 4F4YA 1ZQQA 2XI9A 4TUSA 1EXNA 3LK9A 2WF8A 3IRUA 2WTFA 1BPDA 5J2KA 4R66A 1J2MA 4RNMA 3OSPA 2UVVA 2QARA 1C20A 1YT3A 1HIWA 4FZMA 4DFPA 1CEZA 5L1LA 5KFTA 1S0OA 2KKPA 2C2DA 2HOIA 4JWNA 4Y2XA 5ALTA 5AI5A 2BKEA 4OJLA 2JEGA 2H3VA 2MA1A 3D2NA 2YX8A 3D6JA 2XCAA 1V9PA 3MFIA 3SV4A 2KP7A 5G5HA 1RXWA 3N7RC 5AM2A 3WU2U 4C7YA 3QEBZ 3PNCA 1SWWA 4KLSA 2MUTA 4PGYA 2G06A 1SV0A 5ALKA 2UVUA 2QARB 1B0XA 4BDPA 8ICXA 3T5HA 1J2NA 8ICZA 2K4PA 3RB6A 4M9GA 4NLKA 3BQ2A 4QZ8A 5HP4A 3RBDA 2MU2A 4NJ8A 4RUAA 2G5HB 4Y2YA 5KG7A 3S6JA 1RQLA 5AM4A 2HSZA 4XQ8A 3AU6A 3C23A 3K4GA 5J0SA 3GIIA 4RQ0A 4Q44A 5EE9A 4I2JA 7ICUA 3IHQB 5KFWA 4PHPA 3SI8A 4YD1A 2DKXA 3ZI4A 3NVWA 5HMLA 2ISPA 1NJWA 5DB8A 1NK9A 1ZQAA 5KFFA 1RDFA 4QWBA 2ZG6A 3FM9A 4KLMA 2IOHA 5ALWA 4ELUA 3RJJA 9ICTA 2FDRA 2OXOA 3T79A 1JIHA 1TKDA 1HEKA 3T5JA 3T3FA 3DDHA 1WYGA 3B0YA 5L1KA 1COOA 1BNPA 2GH1A 5HHHA 1A76A 2JHDA 1K1SA 2HBLA 5ALUA 2DL0A 4PH5A 1LB2B 1RYUA 3WKAA 4CF4A 1L7MA 4CNQA 4OJ6A 1KN5A 3BJYA 4DWIA 2P6RA 2F1IA 7ICHA 4FO6A 4KLTA 4FBUA 4KLFA 4Q43A 2HW3A 3RBEA 3V6KA 4KLGA 4DLEA 4ED2A 4RQ1A 1QLNA 4DFMA 4NY8A 5D49A 2BHNA 1QCKA 5KFIA 5ALIA 4F50A 2C28A 3H0LB 2VKQA 3UMGA 4NM1A 4YG2A 2OHFA 4LVSA 4DOCA 2R8GA 4RNOA 4I27A 2F1JA 4DS4A 4M47A 2AXTU 1LVHA 2AQ4A 1ZJNA 3UQ2A 2DGZA 5DB9A 1KKXA 2W9CB 1RQNA 8ICUA 4IQVA 4XRHA 3RFAA 4Y2QA 5GTIU 2BQUA 2DPJA 3G6XA 1FEZA 2L5YA 4I2DA 2E3TA 3SAFA 3V72A 3OTQA 3AU2A 2W8KA 1VDVA 4UBBA 2F3NA 1SWVA 2YMQA 4NWIA 2WFAA 3TADA 4R65A 4JB3A 2KV2A 5AIBA 5IIKA 3C5FA 4Z6FA 2CXYA 2BPCA 1NNLA 4CGZA 3JPPA 1Q46A 3DEEA 5J2HA 4C8NA 4EEYA 5KT7A 1D8LA 3MFHA 2KVCA 4IR1A 5KFLA 3WK4A 1ZJMA 1FFVA 3HWTA 4YVZA 3AL0B 2PXIA 2FJ6A 2KIWA 5AK3A 2PFOA 3QYPA 3HKZF 1KFDA 2PFPA 4KLJA 4KX3A 3GQCA 2W9MA 1FO4A 3TI0A 1PK1B 1KW4A 1ZQGA 2FLLA 8ICPA 2B21A 4B6JA 3RJEA 7ICMA 1ZQJA 1X6IA 4B9UA 1T3NA 1NK5A 2VA2A 4QZIA 2NRXA 4LZDA 3ZD9A 3MBYA 2ZIXA 3GZFA 4FFDA 1QSLA 2FPKA 9ICOA 2VA8A 3KHGA 4DSKA 1WCLA 1ED1A 5DLGA 3TARA 3PW2A 5KT2A 4M04A 4KTQA 2A1AA 1NJYA 2W55A 3JPOA 3UM9A 5J2BA 3C2LA 3Q8RB 3ETRA 1C7YA 4NV0A 1MN8A 4DL7A 1Z1BA 1DOQA 1YZ6A 2HI0A 3C1ZA 4KLQA 4UB2A 1IV8A 4F4ZA 4FBTA 3EWAA 5KFCA 3M1YA 4ZOHC 4IRDA 1OXJA 3GDXA 2UVRA 2KTQA 5CA7A 2NYVA 7ICEA 2AQ0A 4CDGA 1MC8A 1X42A 1X66A 3JPQA 3HP6A 3HPOA 1ZYQA 3A0BU 2F77X 4I2FA 3IG5A 4J9LA 4K4GA 2ALZA 1TAUA 3PZPA 2RQ5A 4OJ5A 4UATA 3NASA 4EX6A 4EBCA 5EE0A 2PKEA 3M9NB 5AI9A 8ICSA 1N61A 4QZGA 2RDJA 2KG5A 3SZ2A 3NVVA 4YFKA 3RH4A 4JV2A 1QTMA 4DCCA 2ISOA 1UCVA 9ICCA 3PO4A 3LVVA 1RPLA 1Z4OA 3QU9A 2BCQA 1ZQEA 3NVYA 2G09A 1S0VA 3CW2C 3IN5A 4RQ2A 4RQ3A 1F0MA 4F72A 1J97A 1ZQHA 3FDSA 3RAXA 4ICAA 5J2AA 3N28A 5KTQA 1TAMA 5KG6A 3WK5A 2J6SA 5KFBA 2AGQA 2YMLA 3SV3A 5DGBA 1SB3C 5IIJA 4IQWA 8ICQA 4GC6A 2FPLA 4CCHA 3E58A 4J9OA 4M6WB 3MR2A 2MSNA 4F5RA 4I2EA 1OW5A 4KN7A 3WKEA 2JH7A 1BPYA 2EAOA 3M6KA 1JN3A 3H8WA 1ZQIA 3KD3A 4YMNA 3H4BA 1N2XA 4ECZA 9ICPA 2JZBA 2PI5A 5G5GA 5ALVA 5DG8A 5TZVA 4JWMA 3PMNA 3CNHA 5A0LA 3RB4A 2RLTA 1S9FA 4O3PA 5C0YA 3OJUA 3NRZA 1ECWA 5KT6A 3N7PD 4HYKA 2F2AB 4KLDA 3ISBA 5DBBA 5AM0A 5KFZA 2ZIWA 4QIWF 3EPIA 2HHWA 4Y2PA 5KFVA 4ECSA 2LM1A 1UPHA 3ZDEA 2VIXA 2PMZC 4P0QB 4PL2A 1M6YA 5GTHU 3UMCA 3CP8A 2QB0A 4DF8A 2JEJA 5J2CA 5J0UA 3MGHA 2W9BB 7ICKA 3ONNA 1V85A 4DL4A 3F2CA 3KZXA 5JUMA 2CPRA 4US9A 4B9TA 3PSFA 1HJPA 2H3QA 5AKGA 4IQTA 5CEHA 1QH9A 3PW0A 2HBJA 4P2HA 3KZIU 2ZIWB 1B43A 1JRPA 5KG4A 4UB6U 2R8KA 2LHTA 2FE9A 3BS5A 4ACOA 4G9BA 2QB0B 2E5SA 3BS7A 5KG3A 2LPEA 4RQ6A 4UB3A 5HHIA 1WUDA 3SAHA 4M0AA 3IG8A 2NRTA 5EWGA 3PV8A 4NLNA 5BOLA 3PX4A 1CI4A 2K8AA 4RUCA 4P0PB 5AKZA 8ICAA 1WWUA 2IHMA 1N62A 1GO3F 4EX7A 4I28A 4UB8U 5DBCA 2DBYA 2BDPA 4F2RA 9ICEA 2KSOA 1COKA 4PZOA 1X6JA 3KKAC 1DRGA 1UA0A 4KLIA 3MDCA 3A0HU 5CJ7A 2XVTA 3AQEA 3PW5A 2VA3A 3M8RA 2NRVA 1JX4A 7ICFA 4RPYA 4KX5A 9ICWA 3MR5A 2OCEA 2NO5A 5ALYA 3IDWA 4WJ3B 2RRDA 5JRTA 1D9DA 2PI4A 4F5NA 1ZXIA 1DGJA 3WK8A 3UQ0A 4O5EA 2H3IA 2Q4TA 1L7OA 5JU5A 1FFUA 4P4PA 2H3ZA 4IS7A 5AM1A 2KSOB 2E1FA 1MQ3A 4IRKA 3QX7A 3TKAA 8ICLA 2WF7A 4JV0A 4IRCA 4J03A 1Z00A 4C80A 3TFRA 1SGGA 4F8RA 2W54A 1TK5A 1DK3A 8ICKA 2NRWA 4QW9A 1RZTA 3RR8A 4DSEA 1ZQBA 2ZUCA 3GU3A 1SV0C 7ICPA 3PSIA 4DFJA 2Y0SF 4RQNA 2W7OA 4Z6CA 2EZZA 1XSLA 4QZCA 4J9SA 1NK8A 2RDIA 1WWVA 4IL6U 3C2KA 2MRLA 1A6SA 5AHXA 4RQ7A 2ZJ8A 4NLGA 4DEZA 5KL8B 5F9LA 4RT3A 1Z00B 5KFEA 4B9VA 1PVQA 3EW9A 8ICWA 9ICGA 3T5KA 4RNNA 3Q8KA 4NLCA 2BCRA 4RQ8A 3WK9A 5AKLA 1V38A 3J81j 5ALJA 3FC4A 3ISCA 2JEIA 2HHVA 2ZIVB 7ICJA 3QUCA 5J0XA 3OGUA 3Q8PB 2HHXA 1L3VA 2OM6A 3ZDBA 5L9XA 1ZQKA 9ICXA 2K4EA 5ALRA 1XO1A 5J0TA 3OHAA 4X5VA 2BQRA 5CR0A 2NRZA 4M2YA 4O3QA 5AM5A 4QWEA 2WB1C 3QU4A 4OCZA 3UXOA 5B66U 4UARA 5ALHA 1ZQSA 1XU4A 1X2IA 1U4BA 1Z1VA 4ED3A 3E0FA 8ICFA 4RPZA 3TAQA 1RYRA 2EDUA 5KFXA 2XIDA 4ECVA 2IMWP 1X40A 3ED5A 5EWEA 2W9CA 4PHDA 4FS2A 9ICAA 5ALDA 3M7DA 8ICTA 1K5OA 1D9FA 1RM6C 2H3FA 4O3RA 1TK8A 1U49A 3KFUF 2C22A 2W9AA 5JTIA 4Y2VA 1ZRMA 1NKEA 2GOLA 3TQ1A 4C8OA 1T8EA 4KLEA 2FMPA 3ZDAA 2KMDA 9ICBA 2YMMA 3GILA 1XNSA 1L5UA 2JMGA 4Y2TA 3SEIA 5KG2A 4ECTA 5KFAA 5J8YC 3D2SA 2K8CB 4XUSA 1N5WA 5J2EA 2KZMA 1SL2A 2D6FC 7ICLA 1QSSA 3C5GA 7ICTA 1RXVA 5KFGA 1ZQYA 5ALLA 5J0RA 1T94A 2AU0A 4PL1A 3GV7B 4QWDA 4EBDA 2F8LA 2IOFA 3TADC 1URJA 2I1QA 3NUQA 1QSYA 3UXNA 2WAQF 4ED0A 1PK1A 5L1IA 2EAPA 1KFTA 2W04A 1JXLA 4TUPA 4FE3A 5TISU 4F4KA 3SAGA 4YN4A 2Q0ZX 5K4LA 3ZD8A 4O3MA 3SENA 1N60A 9ICRA 4F91B 3BQ0A 1JUDA 2GO7A 3PSTA 2F76X 3GV5B 2UVWA 1K1QA 3LWLA 5AK4A 1BVSA 2EAMA 5KFMA 3OPXA 3H8MA 4Z6DA 2CN1A 3ICXA 2KNJA 3V7LA 2Z7JA 1LV5A 1NZPA 2EZYA 3PR5B 1O08A 2QKQA 3C1YA 2BPFA 3F2BA 3M8SA
chains in the Genus database with same CATH topology
2MU2A 3WKBA 1RQNA 1ZD2P 1ZRNA 4UW9A 1ZOLA 4F71A 4Y2YA 4GIBA 3S6JA 4G9BA 1RQLA 3E58A 5AM4A 4Y2QA 2HSZA 4C4TA 4UASA 2WF6A 1FEZA 3QUTA 2QLTA 2HI0A 4Y2VA 4OD0A 4EEKA 5AM3A 1ZRMA 2MSNA 2WF9A 3OTQA 3U26A 2B0CA 1O03A 5AHXA 2NYVA 5ALQA 3WKEA 3QU7A 1Z4NA 1ZD3A 3DV9A 4Y2JA 3QU5A 3QU2A 2YMMA 3R9KA 3WKCA 1X42A 2HCFA 5FP0A 3ZI4A 1SWVA 1VJ5A 2AH5A 4Y2TA 5AKHA 4Y2SA 5ALZA 3KOOA 3WK6A 2YMQA 2FI1A 5AK6A 1QQ5A 2WFAA 4JB3A 5AKZA 3WK9A 5AKKA 5AKLA 1RDFA 3KBBA 5AIBA 4EX7A 5ALJA 4CE6A 5ALNA 3FM9A 4EELA 2IOHA 5AI8A 4UAUA 1TE2A 5AKIA 5ALWA 3QUCA 2WF8A 3IRUA 5AKXA 2FDRA 5ALVA 3DDHA 5ALLA 4CF3A 4UATA 5ALDA 1ZD5A 3CNHA 3NASA 3I1YA 5AKJA 3WK4A 2IOFA 4EX6A 4Y2RA 3QNMA 5AIAA 1ZD4A 2IOFK 5ALEA 4DFDA 5ALSA 5ALOA 2PKEA 4Y2UA 5ALFA 5AK3A 5ALRA 5ALUA 5AI9A 3QYPA 2YN4A 5AM0A 3WKAA 4CF4A 4Y2PA 4C4SA 4Y2XA 2NO5A 5AICA 5ALTA 5AM5A 5ALYA 3L5KA 2YMPA 5AI5A 4CNQA 4DCCA 3QU4A 4OCZA 5ALXA 4C4RA 2YY6A 3D6JA 4CF5A 1S8OA 4UARA 3WK8A 3UMCA 5ALHA 1Z4OA 1JUDA 3WKDA 2GO7A 3QU9A 3I28A 2I6XA 3QUQA 5AI0A 2W11A 4UAVA 5AKEA 5AM1A 5AM2A 1SWWA 2NO4A 4FFDA 5AK4A 3QX7A 5AI4A 5ALPA 4F72A 3WK7A 5ALKA 2WF7A 4EENA 1AQ6A 1QQ6A 3QUBA 4J03A 5ALIA 3ED5A 3UMGA 3UMBA 2W43A 1QQ7A 3QXGA 4HAIA 5AI6A 3MC1A 5AKGA 1QH9A 2WF5A 5ALMA 3WK5A 5AK5A 1O08A 3I76A 2YMLA 5AKYA 3SD7A 5ALGA 2WHEA 1LVHA 3UM9A 2HDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MU2 A;  3WKB A;  1RQN A;  1ZD2 P;  1ZRN A;  4UW9 A;  1ZOL A;  4F71 A;  4Y2Y A;  4GIB A;  3S6J A;  4G9B A;  1RQL A;  3E58 A;  5AM4 A;  4Y2Q A;  2HSZ A;  4C4T A;  4UAS A;  2WF6 A;  1FEZ A;  3QUT A;  2QLT A;  2HI0 A;  4Y2V A;  4OD0 A;  4EEK A;  5AM3 A;  1ZRM A;  2MSN A;  2WF9 A;  3OTQ A;  3U26 A;  2B0C A;  1O03 A;  5AHX A;  2NYV A;  5ALQ A;  3WKE A;  3QU7 A;  1Z4N A;  1ZD3 A;  3DV9 A;  4Y2J A;  3QU5 A;  3QU2 A;  2YMM A;  3R9K A;  3WKC A;  1X42 A;  2HCF A;  5FP0 A;  3ZI4 A;  1SWV A;  1VJ5 A;  2AH5 A;  4Y2T A;  5AKH A;  4Y2S A;  5ALZ A;  3KOO A;  3WK6 A;  2YMQ A;  2FI1 A;  5AK6 A;  1QQ5 A;  2WFA A;  4JB3 A;  5AKZ A;  3WK9 A;  5AKK A;  5AKL A;  1RDF A;  3KBB A;  5AIB A;  4EX7 A;  5ALJ A;  4CE6 A;  5ALN A;  3FM9 A;  4EEL A;  2IOH A;  5AI8 A;  4UAU A;  1TE2 A;  5AKI A;  5ALW A;  3QUC A;  2WF8 A;  3IRU A;  5AKX A;  2FDR A;  5ALV A;  3DDH A;  5ALL A;  4CF3 A;  4UAT A;  5ALD A;  1ZD5 A;  3CNH A;  3NAS A;  3I1Y A;  5AKJ A;  3WK4 A;  2IOF A;  4EX6 A;  4Y2R A;  3QNM A;  5AIA A;  1ZD4 A;  2IOF K;  5ALE A;  4DFD A;  5ALS A;  5ALO A;  2PKE A;  4Y2U A;  5ALF A;  5AK3 A;  5ALR A;  5ALU A;  5AI9 A;  3QYP A;  2YN4 A;  5AM0 A;  3WKA A;  4CF4 A;  4Y2P A;  4C4S A;  4Y2X A;  2NO5 A;  5AIC A;  5ALT A;  5AM5 A;  5ALY A;  3L5K A;  2YMP A;  5AI5 A;  4CNQ A;  4DCC A;  3QU4 A;  4OCZ A;  5ALX A;  4C4R A;  2YY6 A;  3D6J A;  4CF5 A;  1S8O A;  4UAR A;  3WK8 A;  3UMC A;  5ALH A;  1Z4O A;  1JUD A;  3WKD A;  2GO7 A;  3QU9 A;  3I28 A;  2I6X A;  3QUQ A;  5AI0 A;  2W11 A;  4UAV A;  5AKE A;  5AM1 A;  5AM2 A;  1SWW A;  2NO4 A;  4FFD A;  5AK4 A;  3QX7 A;  5AI4 A;  5ALP A;  4F72 A;  3WK7 A;  5ALK A;  2WF7 A;  4EEN A;  1AQ6 A;  1QQ6 A;  3QUB A;  4J03 A;  5ALI A;  3ED5 A;  3UMG A;  3UMB A;  2W43 A;  1QQ7 A;  3QXG A;  4HAI A;  5AI6 A;  3MC1 A;  5AKG A;  1QH9 A;  2WF5 A;  5ALM A;  3WK5 A;  5AK5 A;  1O08 A;  3I76 A;  2YML A;  5AKY A;  3SD7 A;  5ALG A;  2WHE A;  1LVH A;  3UM9 A;  2HDO A; 
#chains in the Genus database with same CATH topology
 3N7S C;  4YP3 A;  4UW9 A;  4EYI B;  4ECQ A;  4DL6 A;  4C8L A;  1KLN A;  3QE9 Y;  2FMS A;  3FYH A;  3ORY A;  4QZB A;  1BGX T;  4ED1 A;  3IV6 A;  3PW7 A;  4Q8F A;  9ICL A;  3LVW A;  5BPC A;  3QU7 A;  4F5O A;  1Z4N A;  3QU2 A;  1SL0 A;  1XWL A;  7ICI A;  4OJO A;  2ZXI A;  4JK1 A;  3RF9 A;  1VJ5 A;  7ICG A;  8ICR A;  1H38 A;  1MSW D;  2AGP A;  4NL9 C;  3EYZ A;  1KEJ A;  2HBK A;  2LYB A;  3SQI A;  1N63 A;  4RQ5 A;  5IIN A;  2K4H A;  4UAU A;  4YR3 A;  7ICS A;  2R8I A;  9ICJ A;  4G3I A;  5KFS A;  3V7K A;  2AHO B;  4TUQ A;  4UQG A;  4DQI A;  4TQR A;  3PVX A;  4Y2R A;  4B9S A;  4DFD A;  1TAQ A;  1L3T A;  4Y2U A;  5ALF A;  1ZQO A;  2VJ5 A;  4RQM A;  2V4R A;  4YR0 A;  2IA6 A;  2LMR A;  5T14 A;  4B9L A;  5DB7 A;  5DDM A;  1U9L A;  5ALX A;  5L1J A;  3SYZ A;  4UB4 A;  1WG8 A;  4J9Q A;  4K4I A;  3F5E A;  3JPT A;  2BZF A;  4O0I A;  3RJF A;  2JXJ A;  5KFY A;  7ICV A;  8ICC A;  3PR4 A;  5ALP A;  2E8O A;  5AI4 A;  3WK7 A;  4KMU A;  1BPB A;  2GWS A;  2KJ5 A;  4QZA A;  1NKB A;  2Y9U A;  1IXR A;  4KLU A;  1L7P A;  2W43 A;  4HAI A;  4J9R A;  3AM9 A;  2Y1I A;  8ICV A;  3I76 A;  4RPX A;  2P35 A;  2XO7 A;  1IIP A;  4M6W A;  2HDO A;  3PX0 A;  1ZD2 P;  4B9N A;  4Q8E A;  4UAY A;  4BWJ A;  4C4T A;  5J0O A;  3F2D A;  2CRX A;  2ZTC A;  1TFR A;  3MAB A;  3K75 D;  4EZ9 A;  1ZQX A;  2AGO A;  1VLB A;  3RH5 A;  2GLE A;  1KDH A;  5DBA A;  5D46 A;  3BQ7 A;  4RQ4 A;  2J6T A;  8ICB A;  2OEH A;  5J2I A;  3WK6 A;  2KE7 A;  2XGQ A;  5HR7 A;  4DSI A;  5KFH A;  3BDP A;  2JR5 A;  2I5H A;  3GIK A;  2A1J B;  2DFL A;  1TV9 A;  5AI8 A;  1TE2 A;  5AKX A;  3AN1 A;  3OSN A;  1KL9 A;  1ZD5 A;  3I1Y A;  3QEA Z;  3EPG A;  1BPZ A;  5KG5 A;  4DQR A;  1UQV A;  5KG0 A;  4C7Z A;  4O3N A;  4MEY A;  4P0Q A;  1YZ7 A;  1S97 A;  2JRZ A;  5J0Y A;  4LZG A;  4AYB F;  9ICK A;  2W9B A;  4ECX A;  1UT5 A;  4JMU A;  2W03 A;  4NLB A;  3H7I A;  5KT5 A;  3WKD A;  3I28 A;  3B9J A;  1L3U A;  4GXJ A;  2NO4 A;  3SR6 A;  2V4Q A;  2R8H A;  1NOM A;  2HHT A;  1HUO A;  1FIQ A;  4C0Z A;  5ALM A;  4M9N A;  3SD7 A;  2ZJ5 A;  4EZ6 A;  1BPE A;  8ICO A;  4C8M A;  3JPN A;  2KFZ A;  4MFA A;  4GIB A;  3RJK A;  1ZQW A;  4YMO A;  3C2M A;  2KZ3 A;  4UAS A;  1S0N A;  3KHL A;  4I2A A;  4I2I A;  4QWC A;  1O03 A;  4P0P A;  1ZQR A;  2FMQ A;  1BNO A;  5BOM A;  1NKC A;  5KAF U;  1KQQ A;  4DF4 A;  3NGD A;  5DLF A;  1Q3V A;  4DFK A;  2KEY A;  2D3D A;  4UAW A;  3QZ7 A;  4A8E A;  1XSP A;  2XY5 A;  1ARO P;  4QW8 A;  2PFQ A;  2F44 A;  4F4W A;  4MHV A;  3M6Z A;  2F1H A;  4BX9 C;  3MGV A;  4MF2 A;  1ZQP A;  4PJ0 U;  2YTU A;  2YN4 A;  3BZK A;  4KLH A;  1L8O A;  1ZQN A;  1NI3 A;  3ALR A;  4AP9 A;  1HUZ A;  2HHS A;  4BWM A;  4J9K A;  2E8M A;  4NM2 A;  2E8P A;  2KIV A;  1SXE A;  2ZUD A;  1ZQ1 C;  2DUY A;  3RB0 A;  1PUZ A;  2YB4 A;  1ZET A;  3LDA A;  3MDA A;  1ZQU A;  3L3F X;  4I2H A;  5F3X B;  4BGD A;  3HT3 A;  3LYS A;  1AQ6 A;  4DQP A;  8ICJ A;  3VCB A;  1WCN A;  1A77 A;  5J0W A;  1X9X A;  3NS1 A;  5AK5 A;  3PW4 A;  4PGQ A;  4KLO A;  2H5X A;  2LI6 A;  2ZTE A;  2RP5 A;  4I2G A;  3LWM A;  2K89 A;  2DWQ A;  2KFN A;  1P7D A;  1N48 A;  2KOB A;  2XCP A;  1S76 D;  5DGA A;  2K4I A;  2YB1 A;  4PPX A;  4QNL A;  2WF6 A;  2P6U A;  2ZUB A;  9ICI A;  4MEX A;  3F53 A;  5DQH A;  2C2E A;  2FPM A;  1XO0 A;  4U6P A;  1NJZ A;  1XSN A;  3QZ8 A;  3R9K A;  5CP2 A;  5KFU A;  1U47 A;  1DXS A;  2O6K A;  3NTU A;  9ICN A;  3K1Z A;  5AKH A;  3C29 A;  2ZIV A;  1KRP A;  3HKZ C;  2LYA A;  5J2D A;  4UAZ A;  1L7N A;  5DKW A;  1S0M A;  2XC9 A;  4K4H A;  3Q8Q B;  3PX6 A;  7ICO A;  4IC9 A;  3F5A A;  4MF8 A;  4I29 A;  3ZDD A;  1SL1 A;  1F5S A;  5J29 A;  3QNM A;  3H0R B;  2KKV A;  1ZQT A;  5ALO A;  4YR2 A;  3L4P A;  5J2J A;  4CRX A;  2F8K A;  9ICS A;  4DSJ A;  4QZE A;  2JH1 A;  2W8L A;  4DL2 A;  3RRH A;  3RH6 A;  1BPX A;  4BXO A;  4P4M A;  1S8O A;  4IQU A;  2NV3 A;  1ZQD A;  4BUG A;  2W11 A;  4I2C A;  4I2B A;  2HOQ A;  3MR3 A;  1L3S A;  2AJQ A;  1QQ6 A;  1T3Q A;  2DF4 B;  3TAN A;  1PVP A;  4DOB A;  5EWF A;  3M9M B;  1X9M A;  2I9G A;  2M9N A;  1CRX A;  3QXG A;  2MUT B;  4ZH4 A;  3H8J A;  1F44 A;  2XIC A;  1NK7 A;  2HBM A;  2PMZ F;  3H0M B;  3KHH A;  4EBE A;  4YCX A;  4E0D A;  3WKB A;  1ZOL A;  4USA A;  4BXO B;  3AMZ A;  2KK0 A;  1RYS A;  2LBO A;  8ICI A;  1Z3E B;  4PHE A;  5DDY A;  5HNK A;  4LJX A;  1NK6 A;  5CRX A;  4DLG A;  4JUZ A;  5EOZ A;  4F3O A;  1KTQ A;  2KJ8 A;  2FLN A;  4P4O A;  2HCF A;  2ASD A;  2ODG A;  4DS5 A;  4DL3 A;  3V6H A;  1QQ5 A;  2XGP A;  4O3S A;  1JAL A;  3KBB A;  3AUO A;  4ECY A;  3THV A;  5AKI A;  1N5X A;  3AQF A;  3ETL A;  4M9J A;  1DGS A;  3CYM A;  4R8U A;  2HHU A;  4DQS A;  2HVI A;  4U7C A;  4TQS A;  4DOA A;  5B5E U;  2G5I B;  1KFS A;  4C8K A;  8ICG A;  3IM1 A;  3EUB 2;  2JGA A;  2ES6 A;  1V97 A;  4GLX A;  4J9N A;  2ZJA A;  4ECW A;  1SIJ A;  5J2F A;  4MFC A;  3C28 A;  5KFD A;  2FLP A;  4ED8 A;  5KL1 B;  5DG9 A;  2LM4 A;  4R8U B;  9ICM A;  3G6V A;  5J8Y A;  1PVR A;  2BDU A;  2BGW A;  1MA7 A;  4GXI A;  1D8B A;  1NZB A;  1Y88 A;  4F4X A;  2BQ3 A;  9ICH A;  3PY8 A;  2D8C A;  2VAN A;  4NXZ A;  4ED6 A;  4GXK A;  1D8Y A;  1IM4 A;  2KHQ A;  4J9P A;  8ICM A;  2BCV A;  2M0N A;  3PSP A;  4F5Q A;  1SXD A;  3D2Q A;  1S10 A;  2HMX A;  4KLL A;  5IIM A;  3QUT A;  9ICQ A;  4AYB C;  3RR7 A;  3GV8 B;  4OD0 A;  4PHA A;  3O0F A;  3U26 A;  3K1R B;  2ASL A;  3BQ1 A;  4O9M A;  5KG1 A;  1ZD3 A;  3JPR A;  3WKC A;  5C5J A;  3H40 A;  4DSF A;  7ICR A;  3T5L A;  3VC8 A;  2R18 A;  5AK6 A;  3UPQ A;  2P66 A;  5IIO A;  2HHQ A;  1DK2 A;  4QIW C;  2EZX A;  4QJF B;  5DQI A;  4YMM A;  3BQT A;  1SZP A;  2E1E A;  1Q8K A;  4ECR A;  2ZIU A;  4J9M A;  4EYH B;  4YXJ A;  4YXM A;  1ZQF A;  3HIL A;  4ED7 A;  5AIA A;  5KFR A;  3RJG A;  2PFN A;  4KN4 A;  3C21 A;  2YQE A;  3CRX A;  1B22 A;  3HW8 A;  5J0Q A;  2BCS A;  4DSL A;  3H4D A;  2BR0 A;  3GIJ A;  5IIL A;  2YMP A;  3H8S A;  1ZQC A;  1KBU A;  5HMM A;  4ELV A;  4CF5 A;  2KJ9 A;  5F9N A;  9ICV A;  1NK0 A;  4GFJ A;  5AI0 A;  2I6X A;  2ZIU B;  4JV1 A;  3GIM A;  4FS1 A;  5KNI A;  3Q8S B;  3HRD D;  3QUB A;  5EE3 A;  2R8J A;  3RJI A;  2ZTD A;  1U45 A;  1ZQM A;  9ICU A;  4NL9 A;  3UMB A;  4YQW A;  2XY6 A;  4XA5 A;  2ZIX B;  2K8B B;  4NLZ A;  2WB1 F;  1T4G A;  5AKY A;  1ZQZ A;  2WHE A;  3SMV A;  1ZRN A;  1SZH A;  5KFK A;  2QB1 A;  3RTV A;  4FZN A;  2QLT A;  8ICY A;  4EEK A;  4BJQ A;  2BPG A;  4M9L A;  1UA1 A;  4Y2J A;  4RU9 A;  4UB5 A;  5FP0 A;  4QWA A;  1X9S A;  3B0X A;  4DQQ A;  5KFJ A;  4PGX A;  1JXE A;  2AH5 A;  3RB3 A;  4Y2S A;  3IP4 B;  2A1J A;  2C2R A;  7ICN A;  4PZN A;  3KOO A;  4QZ9 A;  3TFS A;  3BZC A;  2B6G A;  2G08 A;  2W3S A;  5EE1 A;  8ICH A;  4RT2 A;  2EH9 A;  4EEL A;  4Q45 A;  3RRG A;  2Y1J A;  2EAN A;  1Z19 A;  3UXP A;  2KHV A;  4YD2 A;  4R63 A;  2KN7 A;  1L6N A;  1SV4 A;  5ALS A;  4IR9 A;  5H2F U;  5CHG A;  4O5C A;  4M9H A;  2EQY A;  5KFN A;  2W3R A;  4QZH A;  2ESE A;  5AIC A;  1TVA A;  3N97 B;  5KFQ A;  2XY7 A;  3GFK B;  4DO9 A;  5DG7 A;  2YY6 A;  2V9W A;  5L1M A;  4FZL A;  3AEV A;  2Y0S C;  3QUQ A;  1Q3U A;  1S77 D;  2BCU A;  1CUK A;  1TK0 A;  3RAQ A;  3TAP A;  3KHR A;  1S5L U;  4KMO B;  1T7P A;  5D4B A;  2Y9T A;  4F2S A;  2JV3 A;  2JEF A;  5DB6 A;  1QQ7 A;  5AI6 A;  5KT4 A;  1UT8 A;  2DQN B;  3V6J A;  1RG6 A;  4OJP A;  5III A;  4Z6E A;  5ALG A;  3KTQ A;  1UHU A;  1U48 A;  2KIC A;  1MQ2 A;  3E2E A;  2RHF A;  1JMS A;  3PO5 A;  1OUQ A;  2ZXH A;  4DL5 A;  4MFF A;  2DPI A;  2WF9 A;  4R64 A;  5KT3 A;  3MR6 A;  1ZQV A;  2HOF A;  5KAI U;  1L8L A;  5ALQ A;  2OYY A;  2VJ4 A;  3TAC B;  5CB1 A;  2KD1 A;  3Q8M A;  3RJH A;  4O3O A;  1XS9 D;  2KZZ A;  1SKW A;  5ALZ A;  4QZD A;  2A19 A;  2FI1 A;  5AKK A;  1SKR A;  1IG6 A;  1PK3 A;  1X9W A;  2N1R A;  2OWO A;  2W7P A;  2KVS A;  3NRW A;  5KFP A;  4F5P A;  3MGI A;  4CF3 A;  4UBC A;  3JPS A;  2LKY A;  5AKJ A;  2JZB B;  1ZD4 A;  3ZDC A;  1A0P A;  2IOF K;  5ALE A;  5DQG A;  2HVH A;  1B4F A;  2LYH A;  1LKY A;  7ICQ A;  4QZF A;  2MAX A;  4GC7 A;  8ICE A;  4C4S A;  4ECU A;  5J0P A;  5KFO A;  3L5K A;  4ELT A;  9ICF A;  2K60 A;  4C4R A;  5HR6 A;  5AKE A;  8ICN A;  4UAV A;  1N56 A;  2E8N A;  2G07 A;  1SKS A;  3OJS A;  2ASJ A;  4EEN A;  1NK4 A;  3ISD A;  4UB1 A;  5CWR A;  2G0A A;  1LKY B;  4TUR A;  3MC1 A;  2ATL A;  2WF5 A;  4O5K A;  4F93 B;  2OH2 A;  3V7J A;  1JRO A;  3FAH A;  1JI7 A;  3HJE A;  2A3V A;  2IBK A;  4F92 B;  3EZ5 A;  4OO1 J;  4KIT B;  1NJX A;  3N4M B;  3M9O B;  3OHB A;  4F71 A;  1KSP A;  4B9M A;  5J2G A;  3G6Y A;  1PZN A;  1XC9 A;  3PML A;  5AM3 A;  1ZQL A;  3Q8L A;  2IHN A;  3HX0 A;  3BS5 B;  2B0C A;  4RZR A;  3DV9 A;  3QU5 A;  3KKA A;  2WAQ C;  4US8 A;  2DKZ A;  5E79 U;  2J6U A;  4CE6 A;  5ALN A;  3NVZ A;  4F4Y A;  1ZQQ A;  2XI9 A;  4TUS A;  1EXN A;  3LK9 A;  2WF8 A;  3IRU A;  2WTF A;  1BPD A;  5J2K A;  4R66 A;  1J2M A;  4RNM A;  3OSP A;  2UVV A;  2QAR A;  1C20 A;  1YT3 A;  1HIW A;  4FZM A;  4DFP A;  1CEZ A;  5L1L A;  5KFT A;  1S0O A;  2KKP A;  2C2D A;  2HOI A;  4JWN A;  4Y2X A;  5ALT A;  5AI5 A;  2BKE A;  4OJL A;  2JEG A;  2H3V A;  2MA1 A;  3D2N A;  2YX8 A;  3D6J A;  2XCA A;  1V9P A;  3MFI A;  3SV4 A;  2KP7 A;  5G5H A;  1RXW A;  3N7R C;  5AM2 A;  3WU2 U;  4C7Y A;  3QEB Z;  3PNC A;  1SWW A;  4KLS A;  2MUT A;  4PGY A;  2G06 A;  1SV0 A;  5ALK A;  2UVU A;  2QAR B;  1B0X A;  4BDP A;  8ICX A;  3T5H A;  1J2N A;  8ICZ A;  2K4P A;  3RB6 A;  4M9G A;  4NLK A;  3BQ2 A;  4QZ8 A;  5HP4 A;  3RBD A;  2MU2 A;  4NJ8 A;  4RUA A;  2G5H B;  4Y2Y A;  5KG7 A;  3S6J A;  1RQL A;  5AM4 A;  2HSZ A;  4XQ8 A;  3AU6 A;  3C23 A;  3K4G A;  5J0S A;  3GII A;  4RQ0 A;  4Q44 A;  5EE9 A;  4I2J A;  7ICU A;  3IHQ B;  5KFW A;  4PHP A;  3SI8 A;  4YD1 A;  2DKX A;  3ZI4 A;  3NVW A;  5HML A;  2ISP A;  1NJW A;  5DB8 A;  1NK9 A;  1ZQA A;  5KFF A;  1RDF A;  4QWB A;  2ZG6 A;  3FM9 A;  4KLM A;  2IOH A;  5ALW A;  4ELU A;  3RJJ A;  9ICT A;  2FDR A;  2OXO A;  3T79 A;  1JIH A;  1TKD A;  1HEK A;  3T5J A;  3T3F A;  3DDH A;  1WYG A;  3B0Y A;  5L1K A;  1COO A;  1BNP A;  2GH1 A;  5HHH A;  1A76 A;  2JHD A;  1K1S A;  2HBL A;  5ALU A;  2DL0 A;  4PH5 A;  1LB2 B;  1RYU A;  3WKA A;  4CF4 A;  1L7M A;  4CNQ A;  4OJ6 A;  1KN5 A;  3BJY A;  4DWI A;  2P6R A;  2F1I A;  7ICH A;  4FO6 A;  4KLT A;  4FBU A;  4KLF A;  4Q43 A;  2HW3 A;  3RBE A;  3V6K A;  4KLG A;  4DLE A;  4ED2 A;  4RQ1 A;  1QLN A;  4DFM A;  4NY8 A;  5D49 A;  2BHN A;  1QCK A;  5KFI A;  5ALI A;  4F50 A;  2C28 A;  3H0L B;  2VKQ A;  3UMG A;  4NM1 A;  4YG2 A;  2OHF A;  4LVS A;  4DOC A;  2R8G A;  4RNO A;  4I27 A;  2F1J A;  4DS4 A;  4M47 A;  2AXT U;  1LVH A;  2AQ4 A;  1ZJN A;  3UQ2 A;  2DGZ A;  5DB9 A;  1KKX A;  2W9C B;  1RQN A;  8ICU A;  4IQV A;  4XRH A;  3RFA A;  4Y2Q A;  5GTI U;  2BQU A;  2DPJ A;  3G6X A;  1FEZ A;  2L5Y A;  4I2D A;  2E3T A;  3SAF A;  3V72 A;  3OTQ A;  3AU2 A;  2W8K A;  1VDV A;  4UBB A;  2F3N A;  1SWV A;  2YMQ A;  4NWI A;  2WFA A;  3TAD A;  4R65 A;  4JB3 A;  2KV2 A;  5AIB A;  5IIK A;  3C5F A;  4Z6F A;  2CXY A;  2BPC A;  1NNL A;  4CGZ A;  3JPP A;  1Q46 A;  3DEE A;  5J2H A;  4C8N A;  4EEY A;  5KT7 A;  1D8L A;  3MFH A;  2KVC A;  4IR1 A;  5KFL A;  3WK4 A;  1ZJM A;  1FFV A;  3HWT A;  4YVZ A;  3AL0 B;  2PXI A;  2FJ6 A;  2KIW A;  5AK3 A;  2PFO A;  3QYP A;  3HKZ F;  1KFD A;  2PFP A;  4KLJ A;  4KX3 A;  3GQC A;  2W9M A;  1FO4 A;  3TI0 A;  1PK1 B;  1KW4 A;  1ZQG A;  2FLL A;  8ICP A;  2B21 A;  4B6J A;  3RJE A;  7ICM A;  1ZQJ A;  1X6I A;  4B9U A;  1T3N A;  1NK5 A;  2VA2 A;  4QZI A;  2NRX A;  4LZD A;  3ZD9 A;  3MBY A;  2ZIX A;  3GZF A;  4FFD A;  1QSL A;  2FPK A;  9ICO A;  2VA8 A;  3KHG A;  4DSK A;  1WCL A;  1ED1 A;  5DLG A;  3TAR A;  3PW2 A;  5KT2 A;  4M04 A;  4KTQ A;  2A1A A;  1NJY A;  2W55 A;  3JPO A;  3UM9 A;  5J2B A;  3C2L A;  3Q8R B;  3ETR A;  1C7Y A;  4NV0 A;  1MN8 A;  4DL7 A;  1Z1B A;  1DOQ A;  1YZ6 A;  2HI0 A;  3C1Z A;  4KLQ A;  4UB2 A;  1IV8 A;  4F4Z A;  4FBT A;  3EWA A;  5KFC A;  3M1Y A;  4ZOH C;  4IRD A;  1OXJ A;  3GDX A;  2UVR A;  2KTQ A;  5CA7 A;  2NYV A;  7ICE A;  2AQ0 A;  4CDG A;  1MC8 A;  1X42 A;  1X66 A;  3JPQ A;  3HP6 A;  3HPO A;  1ZYQ A;  3A0B U;  2F77 X;  4I2F A;  3IG5 A;  4J9L A;  4K4G A;  2ALZ A;  1TAU A;  3PZP A;  2RQ5 A;  4OJ5 A;  4UAT A;  3NAS A;  4EX6 A;  4EBC A;  5EE0 A;  2PKE A;  3M9N B;  5AI9 A;  8ICS A;  1N61 A;  4QZG A;  2RDJ A;  2KG5 A;  3SZ2 A;  3NVV A;  4YFK A;  3RH4 A;  4JV2 A;  1QTM A;  4DCC A;  2ISO A;  1UCV A;  9ICC A;  3PO4 A;  3LVV A;  1RPL A;  1Z4O A;  3QU9 A;  2BCQ A;  1ZQE A;  3NVY A;  2G09 A;  1S0V A;  3CW2 C;  3IN5 A;  4RQ2 A;  4RQ3 A;  1F0M A;  4F72 A;  1J97 A;  1ZQH A;  3FDS A;  3RAX A;  4ICA A;  5J2A A;  3N28 A;  5KTQ A;  1TAM A;  5KG6 A;  3WK5 A;  2J6S A;  5KFB A;  2AGQ A;  2YML A;  3SV3 A;  5DGB A;  1SB3 C;  5IIJ A;  4IQW A;  8ICQ A;  4GC6 A;  2FPL A;  4CCH A;  3E58 A;  4J9O A;  4M6W B;  3MR2 A;  2MSN A;  4F5R A;  4I2E A;  1OW5 A;  4KN7 A;  3WKE A;  2JH7 A;  1BPY A;  2EAO A;  3M6K A;  1JN3 A;  3H8W A;  1ZQI A;  3KD3 A;  4YMN A;  3H4B A;  1N2X A;  4ECZ A;  9ICP A;  2JZB A;  2PI5 A;  5G5G A;  5ALV A;  5DG8 A;  5TZV A;  4JWM A;  3PMN A;  3CNH A;  5A0L A;  3RB4 A;  2RLT A;  1S9F A;  4O3P A;  5C0Y A;  3OJU A;  3NRZ A;  1ECW A;  5KT6 A;  3N7P D;  4HYK A;  2F2A B;  4KLD A;  3ISB A;  5DBB A;  5AM0 A;  5KFZ A;  2ZIW A;  4QIW F;  3EPI A;  2HHW A;  4Y2P A;  5KFV A;  4ECS A;  2LM1 A;  1UPH A;  3ZDE A;  2VIX A;  2PMZ C;  4P0Q B;  4PL2 A;  1M6Y A;  5GTH U;  3UMC A;  3CP8 A;  2QB0 A;  4DF8 A;  2JEJ A;  5J2C A;  5J0U A;  3MGH A;  2W9B B;  7ICK A;  3ONN A;  1V85 A;  4DL4 A;  3F2C A;  3KZX A;  5JUM A;  2CPR A;  4US9 A;  4B9T A;  3PSF A;  1HJP A;  2H3Q A;  5AKG A;  4IQT A;  5CEH A;  1QH9 A;  3PW0 A;  2HBJ A;  4P2H A;  3KZI U;  2ZIW B;  1B43 A;  1JRP A;  5KG4 A;  4UB6 U;  2R8K A;  2LHT A;  2FE9 A;  3BS5 A;  4ACO A;  4G9B A;  2QB0 B;  2E5S A;  3BS7 A;  5KG3 A;  2LPE A;  4RQ6 A;  4UB3 A;  5HHI A;  1WUD A;  3SAH A;  4M0A A;  3IG8 A;  2NRT A;  5EWG A;  3PV8 A;  4NLN A;  5BOL A;  3PX4 A;  1CI4 A;  2K8A A;  4RUC A;  4P0P B;  5AKZ A;  8ICA A;  1WWU A;  2IHM A;  1N62 A;  1GO3 F;  4EX7 A;  4I28 A;  4UB8 U;  5DBC A;  2DBY A;  2BDP A;  4F2R A;  9ICE A;  2KSO A;  1COK A;  4PZO A;  1X6J A;  3KKA C;  1DRG A;  1UA0 A;  4KLI A;  3MDC A;  3A0H U;  5CJ7 A;  2XVT A;  3AQE A;  3PW5 A;  2VA3 A;  3M8R A;  2NRV A;  1JX4 A;  7ICF A;  4RPY A;  4KX5 A;  9ICW A;  3MR5 A;  2OCE A;  2NO5 A;  5ALY A;  3IDW A;  4WJ3 B;  2RRD A;  5JRT A;  1D9D A;  2PI4 A;  4F5N A;  1ZXI A;  1DGJ A;  3WK8 A;  3UQ0 A;  4O5E A;  2H3I A;  2Q4T A;  1L7O A;  5JU5 A;  1FFU A;  4P4P A;  2H3Z A;  4IS7 A;  5AM1 A;  2KSO B;  2E1F A;  1MQ3 A;  4IRK A;  3QX7 A;  3TKA A;  8ICL A;  2WF7 A;  4JV0 A;  4IRC A;  4J03 A;  1Z00 A;  4C80 A;  3TFR A;  1SGG A;  4F8R A;  2W54 A;  1TK5 A;  1DK3 A;  8ICK A;  2NRW A;  4QW9 A;  1RZT A;  3RR8 A;  4DSE A;  1ZQB A;  2ZUC A;  3GU3 A;  1SV0 C;  7ICP A;  3PSI A;  4DFJ A;  2Y0S F;  4RQN A;  2W7O A;  4Z6C A;  2EZZ A;  1XSL A;  4QZC A;  4J9S A;  1NK8 A;  2RDI A;  1WWV A;  4IL6 U;  3C2K A;  2MRL A;  1A6S A;  5AHX A;  4RQ7 A;  2ZJ8 A;  4NLG A;  4DEZ A;  5KL8 B;  5F9L A;  4RT3 A;  1Z00 B;  5KFE A;  4B9V A;  1PVQ A;  3EW9 A;  8ICW A;  9ICG A;  3T5K A;  4RNN A;  3Q8K A;  4NLC A;  2BCR A;  4RQ8 A;  3WK9 A;  5AKL A;  1V38 A;  3J81 j;  5ALJ A;  3FC4 A;  3ISC A;  2JEI A;  2HHV A;  2ZIV B;  7ICJ A;  3QUC A;  5J0X A;  3OGU A;  3Q8P B;  2HHX A;  1L3V A;  2OM6 A;  3ZDB A;  5L9X A;  1ZQK A;  9ICX A;  2K4E A;  5ALR A;  1XO1 A;  5J0T A;  3OHA A;  4X5V A;  2BQR A;  5CR0 A;  2NRZ A;  4M2Y A;  4O3Q A;  5AM5 A;  4QWE A;  2WB1 C;  3QU4 A;  4OCZ A;  3UXO A;  5B66 U;  4UAR A;  5ALH A;  1ZQS A;  1XU4 A;  1X2I A;  1U4B A;  1Z1V A;  4ED3 A;  3E0F A;  8ICF A;  4RPZ A;  3TAQ A;  1RYR A;  2EDU A;  5KFX A;  2XID A;  4ECV A;  2IMW P;  1X40 A;  3ED5 A;  5EWE A;  2W9C A;  4PHD A;  4FS2 A;  9ICA A;  5ALD A;  3M7D A;  8ICT A;  1K5O A;  1D9F A;  1RM6 C;  2H3F A;  4O3R A;  1TK8 A;  1U49 A;  3KFU F;  2C22 A;  2W9A A;  5JTI A;  4Y2V A;  1ZRM A;  1NKE A;  2GOL A;  3TQ1 A;  4C8O A;  1T8E A;  4KLE A;  2FMP A;  3ZDA A;  2KMD A;  9ICB A;  2YMM A;  3GIL A;  1XNS A;  1L5U A;  2JMG A;  4Y2T A;  3SEI A;  5KG2 A;  4ECT A;  5KFA A;  5J8Y C;  3D2S A;  2K8C B;  4XUS A;  1N5W A;  5J2E A;  2KZM A;  1SL2 A;  2D6F C;  7ICL A;  1QSS A;  3C5G A;  7ICT A;  1RXV A;  5KFG A;  1ZQY A;  5ALL A;  5J0R A;  1T94 A;  2AU0 A;  4PL1 A;  3GV7 B;  4QWD A;  4EBD A;  2F8L A;  2IOF A;  3TAD C;  1URJ A;  2I1Q A;  3NUQ A;  1QSY A;  3UXN A;  2WAQ F;  4ED0 A;  1PK1 A;  5L1I A;  2EAP A;  1KFT A;  2W04 A;  1JXL A;  4TUP A;  4FE3 A;  5TIS U;  4F4K A;  3SAG A;  4YN4 A;  2Q0Z X;  5K4L A;  3ZD8 A;  4O3M A;  3SEN A;  1N60 A;  9ICR A;  4F91 B;  3BQ0 A;  1JUD A;  2GO7 A;  3PST A;  2F76 X;  3GV5 B;  2UVW A;  1K1Q A;  3LWL A;  5AK4 A;  1BVS A;  2EAM A;  5KFM A;  3OPX A;  3H8M A;  4Z6D A;  2CN1 A;  3ICX A;  2KNJ A;  3V7L A;  2Z7J A;  1LV5 A;  1NZP A;  2EZY A;  3PR5 B;  1O08 A;  2QKQ A;  3C1Y A;  2BPF A;  3F2B A;  3M8S A; 
#chains in the Genus database with same CATH homology
 2MU2 A;  3WKB A;  1RQN A;  1ZD2 P;  1ZRN A;  4UW9 A;  1ZOL A;  4F71 A;  4Y2Y A;  4GIB A;  3S6J A;  4G9B A;  1RQL A;  3E58 A;  5AM4 A;  4Y2Q A;  2HSZ A;  4C4T A;  4UAS A;  2WF6 A;  1FEZ A;  3QUT A;  2QLT A;  2HI0 A;  4Y2V A;  4OD0 A;  4EEK A;  5AM3 A;  1ZRM A;  2MSN A;  2WF9 A;  3OTQ A;  3U26 A;  2B0C A;  1O03 A;  5AHX A;  2NYV A;  5ALQ A;  3WKE A;  3QU7 A;  1Z4N A;  1ZD3 A;  3DV9 A;  4Y2J A;  3QU5 A;  3QU2 A;  2YMM A;  3R9K A;  3WKC A;  1X42 A;  2HCF A;  5FP0 A;  3ZI4 A;  1SWV A;  1VJ5 A;  2AH5 A;  4Y2T A;  5AKH A;  4Y2S A;  5ALZ A;  3KOO A;  3WK6 A;  2YMQ A;  2FI1 A;  5AK6 A;  1QQ5 A;  2WFA A;  4JB3 A;  5AKZ A;  3WK9 A;  5AKK A;  5AKL A;  1RDF A;  3KBB A;  5AIB A;  4EX7 A;  5ALJ A;  4CE6 A;  5ALN A;  3FM9 A;  4EEL A;  2IOH A;  5AI8 A;  4UAU A;  1TE2 A;  5AKI A;  5ALW A;  3QUC A;  2WF8 A;  3IRU A;  5AKX A;  2FDR A;  5ALV A;  3DDH A;  5ALL A;  4CF3 A;  4UAT A;  5ALD A;  1ZD5 A;  3CNH A;  3NAS A;  3I1Y A;  5AKJ A;  3WK4 A;  2IOF A;  4EX6 A;  4Y2R A;  3QNM A;  5AIA A;  1ZD4 A;  2IOF K;  5ALE A;  4DFD A;  5ALS A;  5ALO A;  2PKE A;  4Y2U A;  5ALF A;  5AK3 A;  5ALR A;  5ALU A;  5AI9 A;  3QYP A;  2YN4 A;  5AM0 A;  3WKA A;  4CF4 A;  4Y2P A;  4C4S A;  4Y2X A;  2NO5 A;  5AIC A;  5ALT A;  5AM5 A;  5ALY A;  3L5K A;  2YMP A;  5AI5 A;  4CNQ A;  4DCC A;  3QU4 A;  4OCZ A;  5ALX A;  4C4R A;  2YY6 A;  3D6J A;  4CF5 A;  1S8O A;  4UAR A;  3WK8 A;  3UMC A;  5ALH A;  1Z4O A;  1JUD A;  3WKD A;  2GO7 A;  3QU9 A;  3I28 A;  2I6X A;  3QUQ A;  5AI0 A;  2W11 A;  4UAV A;  5AKE A;  5AM1 A;  5AM2 A;  1SWW A;  2NO4 A;  4FFD A;  5AK4 A;  3QX7 A;  5AI4 A;  5ALP A;  4F72 A;  3WK7 A;  5ALK A;  2WF7 A;  4EEN A;  1AQ6 A;  1QQ6 A;  3QUB A;  4J03 A;  5ALI A;  3ED5 A;  3UMG A;  3UMB A;  2W43 A;  1QQ7 A;  3QXG A;  4HAI A;  5AI6 A;  3MC1 A;  5AKG A;  1QH9 A;  2WF5 A;  5ALM A;  3WK5 A;  5AK5 A;  1O08 A;  3I76 A;  2YML A;  5AKY A;  3SD7 A;  5ALG A;  2WHE A;  1LVH A;  3UM9 A;  2HDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...