2MU2A

Nmr structure of the cap domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
LLDSYEAILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLLVRVAEDRNLDVEVLNQVRAQSLAEKNAQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title J-UNIO protocol used for NMR structure determination of the 206-residue protein NP_346487.1 from Streptococcus pneumoniae TIGR4.
pubmed doi rcsb
source organism Streptococcus pneumoniae tigr4
molecule tags Hydrolase
molecule keywords Hydrolase, haloacid dehalogenase-like family
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2mu2A00
4CE6A 5AHXA 2WFAA 2YMQA 5ALKA 1ZD2P 2QLTA 2HDOA 2WF8A 4DFDA 3NASA 5AI8A 4Y2JA 5ALYA 4EX6A 4Y2YA 4CF3A 2WF7A 3UMBA 5ALJA 2I6XA 5AKXA 4C4TA 3QYPA 5ALZA 1RDFA 2MSNA 5FP0A 5AKEA 3I1YA 5ALWA 4UATA 3WKAA 5ALLA 2NO5A 5ALRA 3WK5A 3FM9A 3R9KA 4Y2TA 3ZI4A 1S8OA 1QH9A 2IOHA 1O03A 4CF5A 4EENA 4F71A 2B0CA 2YY6A 2HCFA 5AK4A 2MU2A 5AKIA 5AI6A 5AKLA 4Y2VA 3ED5A 1SWVA 5AKZA 3WKBA 2WF9A 3QU9A 5AM4A 1QQ6A 5AIAA 4UASA 5ALSA 4Y2PA 5ALGA 3WK6A 4UARA 5AKYA 5ALEA 3QUQA 3L5KA 2IOFK 4Y2SA 5ALFA 5AM0A 3WK4A 1RQNA 3WK9A 2AH5A 3WK7A 4EEKA 4Y2UA 5AK6A 3MC1A 5ALXA 1LVHA 4Y2XA 1AQ6A 2NO4A 3QUBA 3I76A 2NYVA 4J03A 5AKGA 5ALTA 1O08A 3OTQA 4OCZA 2W43A 3WKCA 4CF4A 3QU4A 2HI0A 3QU7A 5AM5A 1ZD3A 2PKEA 5AI9A 3WK8A 5AKHA 3UMCA 3I28A 5AICA 3QUCA 4UW9A 5AI5A 5ALVA 3UMGA 5AM1A 5AI4A 3IRUA 2W11A 3WKEA 5ALQA 4FFDA 3QU5A 1Z4NA 3WKDA 4UAVA 5ALPA 4DCCA 1JUDA 3KOOA 5AI0A 1ZD5A 4OD0A 2YMMA 1RQLA 4EX7A 3KBBA 4F72A 1TE2A 5AKKA 5ALIA 5ALHA 5ALUA 4JB3A 5AM3A 3QU2A 4HAIA 1QQ7A 2FI1A 1QQ5A 1VJ5A 2WHEA 3QX7A 5AKJA 4C4RA 5AK3A 3U26A 4UAUA 3D6JA 1Z4OA 3QNMA 5AK5A 2YMLA 4CNQA 1ZRMA 4Y2QA 3UM9A 2YMPA 1X42A 2WF5A 4EELA 3E58A 3QXGA 2HSZA 2FDRA 2GO7A 2WF6A 2YN4A 2IOFA 5ALDA 4C4SA 4Y2RA 3S6JA 5AM2A 5AIBA 1ZD4A 4G9BA 3CNHA 1ZRNA 3DDHA 4GIBA 5ALOA 5ALNA 1SWWA 3SD7A 3DV9A 1FEZA 5ALMA 3QUTA 1ZOLA
chains in the Genus database with same CATH superfamily
5AHXA 9ICXA 2QLTA 4RQMA 2JGAA 4ELTA 5KFDA 1L5UA 4YR0A 1L7PA 4CCHA 4K4GA 2D8CA 5L1LA 5KAIU 1KDHA 8ICJA 1ZQGA 2HHQA 1M6YA 2KFNA 1EXNA 3PX0A 1D8YA 2NRXA 4DL2A 8ICRA 3A0BU 2W9MA 1BGXT 1YZ6A 2KSOA 3M9NB 4BX9C 1L7OA 3NVYA 4YFKA 4QZHA 3LWMA 1XSPA 4O5CA 2JEFA 5ALFA 2XIDA 4Q8EA 2OM6A 4JWMA 2JEIA 4ICAA 4DSKA 2Q0ZX 1B4FA 4ED3A 2WAQF 1BNPA 1O08A 3F5EA 3BS5A 3QU4A 4YCXA 3PW2A 4P0PA 1SKRA 4NLKA 4KLUA 3UMCA 4QZCA 1SZHA 3MGHA 2Q4TA 2NV3A 1BPXA 2W03A 3ICXA 2K8CB 4ECSA 1SIJA 2OEHA 4KLOA 4TUSA 1NKEA 4YVZA 3PSPA 4PGYA 3AQFA 2F2AB 1ZQYA 2XC9A 3PSTA 2DUYA 3IG8A 5J2DA 2KG5A 4P4PA 3RR8A 4DLEA 2GOLA 7ICRA 4J9PA 2LYAA 2FMSA 2BQUA 1ZD4A 4IRDA 1XC9A 1ZQLA 2KMDA 1JMSA 1KQQA 1NNLA 3PW7A 1QTMA 4Y2JA 1X40A 4P0QB 4PJ0U 3ZDCA 3BQ2A 2PXIA 4RPZA 2ZIVB 3RJEA 1RDFA 2HOFA 5DBAA 2EAOA 1X9SA 1NK0A 3RH6A 3CP8A 7ICHA 1RZTA 3E0FA 4UB3A 3QEAZ 1ZQOA 2YY6A 4ZH4A 3RRHA 4DWIA 1NKBA 1N5WA 4Y2VA 3C2MA 3MFHA 4GFJA 4F2SA 1X6IA 3PR4A 4O5EA 5ALGA 4YR2A 4P4MA 4NLNA 2IHMA 3SEIA 1NJWA 2JZBA 3PSIA 1JRPA 5DG9A 4M6WB 1SGGA 3GV8B 3L3FX 4C8NA 3NUQA 4ECRA 2W43A 5HR7A 3N7PD 2OXOA 5AICA 2KJ9A 3QUCA 3C23A 3GZFA 2DKXA 2Y1JA 3ZD9A 2Y0SF 5A0LA 1UT5A 4IQTA 4C8OA 2FE9A 5CEHA 1GO3F 2KTQA 4QWEA 4RQ4A 3BQ1A 2WHEA 2W9CB 1ZJMA 3U26A 1KN5A 3MBYA 1L3VA 5IIJA 7ICJA 4OJ6A 5J8YC 3OHAA 2OHFA 5DB7A 3HJEA 2HSZA 4DSJA 2BPFA 3VC8A 4MFFA 1KRPA 4I2JA 2K4EA 1Q3UA 3Q8PB 9ICUA 3JPRA 3C2KA 4QZ9A 1YT3A 1AROP 2MSNA 1JX4A 2DFLA 5AKEA 4BWMA 4RQ3A 5ALLA 1NK8A 3GIMA 2ES6A 2HCFA 1SKSA 5C5JA 4KLQA 5AK4A 4PZNA 3J81j 4F4KA 3TARA 5J2HA 4B9VA 5AIAA 5KFSA 5KFKA 2BR0A 9ICAA 1ZYQA 2KIWA 4PHEA 2BQ3A 3PV8A 3ISCA 1NZPA 2J6TA 2CRXA 1A77A 1PUZA 2AJQA 1P7DA 1ZQMA 3OPXA 1MC8A 1B22A 4UAZA 4IL6U 5K4LA 4EZ9A 2HI0A 2QB0A 3V7JA 4KLLA 1NJXA 3I28A 3FYHA 3H4BA 5AI5A 4LZDA 4DSFA 3RJHA 2G5IB 8ICGA 1K1SA 1JUDA 5IIMA 2P35A 2ZXHA 3V6HA 1V97A 3Q8LA 3KBBA 5ALIA 5KFHA 4RQ0A 1SZPA 2LPEA 3L4PA 1JXLA 1QQ5A 2A19A 2D6FC 2K4HA 2R8JA 4I2AA 2WF5A 4TQRA 1N63A 2XI9A 5BOMA 5IIIA 3TKAA 2WF6A 9ICBA 1RPLA 2EDUA 2NRZA 3QZ7A 2PI4A 7ICIA 2K89A 3MR2A 4J9KA 2EAMA 5EE1A 5KFPA 2MUTB 1L3SA 1S0VA 4DQRA 2HHSA 5KT4A 1SL0A 2WAQC 5ALYA 4BXOB 1UHUA 2DGZA 2HBJA 3T3FA 4RUCA 2R8KA 2CXYA 2C2RA 1U4BA 3ALRA 2ISOA 4UB1A 3V6KA 2F44A 4ED0A 3BJYA 4RT2A 7ICOA 5ALRA 1B43A 5IINA 1IXRA 2KHVA 4DS5A 2P6RA 4YN4A 2W8LA 5CP2A 4DFMA 2UVRA 1S0MA 3QU9A 1RXVA 3RAQA 3N7RC 2MUTA 3PZPA 1WG8A 4Y2SA 5KNIA 4NV0A 2DL0A 3Q8SB 2YX8A 2HOQA 1OW5A 3QUBA 1F44A 4DQIA 1UPHA 2NYVA 5KFQA 4ECWA 2HHWA 5GTIU 8ICSA 1QCKA 5DB6A 1NJYA 4DL4A 3TANA 4DFJA 2EAPA 5EE0A 2A3VA 2P6UA 4NLGA 1RXWA 4MF2A 3H0MB 2YMMA 2ZJ8A 1ZQIA 3SAHA 2ZIVA 4R64A 2IA6A 4KN4A 4P2HA 3PO4A 3TFRA 5J0SA 2GO7A 2GH1A 5DKWA 3D2QA 4KLDA 2CPRA 2KIVA 1ZQTA 5ALOA 1ZRNA 4NJ8A 5J2CA 2I1QA 8ICFA 5ALKA 2ZTCA 7ICPA 3HP6A 2W3SA 1Z19A 9ICJA 2ZTDA 8ICPA 4GXKA 2JR5A 2YQEA 3BQTA 4QWAA 4F4XA 4P0PB 4YP3A 1NK4A 4J9LA 9ICVA 2FLNA 2C2EA 2HHTA 1DK2A 1BNOA 1TAQA 3IM1A 4M9GA 4CDGA 9ICIA 1SWVA 3WKBA 2GWSA 1QQ6A 4UASA 1C20A 4Y2PA 3PMLA 4B9UA 3TI0A 2WB1F 2ZUDA 1TAMA 2R8IA 4RQ1A 1S76D 2ZJ5A 4EEKA 3OHBA 1ZQNA 5GTHU 1NK9A 4Y2XA 4KITB 5J0RA 3AMZA 1KL9A 1X9MA 3HILA 4OCZA 2ZUBA 3TACB 3ONNA 3WKCA 4CF4A 3HW8A 2PKEA 3GIJA 5DDMA 4KLHA 3Q8QB 2V4QA 3WU2U 1ZQKA 2A1JB 3C1YA 5AM1A 5AI4A 5KG7A 1PK1A 1NK7A 2G07A 2JEJA 4ED1A 1SB3C 4NM2A 2KP7A 4JB3A 1QQ7A 2E8MA 3QX7A 4O9MA 3D6JA 3GILA 3RB0A 2M0NA 2IMWP 1F5SA 8ICZA 4F2RA 4DQQA 2Y1IA 1XS9D 4C4SA 3MDCA 1ZQDA 5J8YA 2LYBA 4F4YA 5KFTA 2F76X 4DSEA 1KFSA 3N97B 5ALZA 3A0HU 4JV1A 4IR9A 2NRWA 4R8UA 3ISBA 2YMQA 2WTFA 9ICWA 4QZAA 1TV9A 2C2DA 3SAGA 1MQ2A 4M6WA 3QYPA 5J2JA 3BS5B 1X9WA 4UBBA 4MFAA 1JROA 4OO1J 2BCSA 4RQ5A 3KTQA 3O0FA 4GC7A 4ECXA 4QW9A 3OGUA 5AI6A 2BZFA 4F4WA 2E3TA 4FS2A 2H3VA 1N60A 1NZBA 1DRGA 4DL6A 4KLFA 1LKYA 4O5KA 3PX4A 4U7CA 3CYMA 2XCAA 5HP4A 1RM6C 1WCNA 2QARA 4K4HA 1BPDA 1ZD3A 2KN7A 2FPLA 1N56A 1Q46A 2J6UA 2V9WA 2AGPA 2E5SA 3AUOA 2LI6A 2HBLA 5ALQA 4BJQA 2XGPA 2AQ0A 1K5OA 4UBCA 2ISPA 3H4DA 3TFSA 3KOOA 3H0RB 2R18A 2FMPA 3GIKA 5L1IA 4UB5A 1OUQA 1FO4A 1T94A 4DF4A 2XY7A 3QU2A 3MGVA 2LHTA 2W7OA 5AK3A 2N1RA 1ZRMA 2KOBA 5JU5A 4YD2A 2IHNA 4O3RA 3RFAA 8ICYA 2IOFA 3ZDDA 1VDVA 1DXSA 3T5JA 1SV4A 1NK6A 5J0PA 3V6JA 4FS1A 2W7PA 4QWDA 4FZLA 2RRDA 3UMBA 4DLGA 4KLMA 3KHHA 5J29A 4M04A 4FBTA 2QARB 4EBEA 3M8RA 5L9XA 5CB1A 1BPZA 4DOCA 2F3NA 4YR3A 3PY8A 5BOLA 4F4ZA 5HMLA 5AKZA 3SMVA 5J0OA 4DOBA 2YTUA 4JMUA 5ALEA 1RG6A 3LVWA 5AK6A 1N62A 4F5PA 4JWNA 1XSNA 3NVWA 3UXPA 4B9TA 3D2NA 3M6ZA 1L8LA 3G6YA 1XSLA 5DGBA 2KJ8A 1V9PA 3WK8A 4KLJA 4M9HA 2KZZA 4F93B 3RAXA 4I2BA 5KT7A 3MR5A 5KFWA 3C2LA 3RBDA 3Q8RB 3IP4B 5KTQA 5DQHA 2G06A 2BCVA 5J2KA 2PFNA 5KT5A 4F5NA 5KT3A 1T3NA 3V7KA 2H3QA 1DGJA 2KVCA 5AK5A 2YMLA 3UM9A 4XRHA 4QIWC 4YMMA 4PH5A 1LV5A 4MEXA 1ZQHA 8ICQA 3JPNA 2VA2A 5KG1A 4Y2RA 3KKAA 4B9SA 4JUZA 1IIPA 2G0AA 1TFRA 5ALMA 4J9OA 3ETRA 1IV8A 1KEJA 2Z7JA 4LVSA 5KFOA 4I2GA 2QB1A 4PHPA 2WB1C 1UA0A 3GV5B 5ALJA 4RU9A 5CHGA 4RUAA 4AYBF 2LM4A 4I28A 1D9DA 5ALWA 2JH7A 4O3OA 7ICLA 2H3FA 2KD1A 5KAFU 1UCVA 3BQ7A 5EWGA 4KLTA 1QH9A 4CF5A 4DOAA 2MU2A 1XO0A 5AKIA 3PW4A 3HRDD 2BCRA 4KX5A 5F9LA 9ICTA 2BQRA 4BXOA 4NLZA 2DPJA 1KBUA 5KFCA 3QUQA 3CW2C 5J2EA 4HYKA 3QE9Y 3WK4A 5HR6A 3WK9A 3WK7A 2H3ZA 1QSYA 2W8KA 5ALXA 1AQ6A 4UB4A 3QEBZ 1N48A 2JZBB 4Z6CA 1PVPA 2KJ5A 3PW5A 2BPGA 3C21A 1ZQAA 4I2CA 1ED1A 3F5AA 2XICA 3QU5A 1HIWA 3H8WA 3NTUA 5KFFA 4DCCA 8ICEA 2W9BA 2BDUA 4F72A 1UQVA 5KFNA 2HHVA 2FI1A 1HUZA 4R65A 4UAUA 2OYYA 4DF8A 1SL2A 2IBKA 4YMNA 3H7IA 4I2IA 1TK8A 3KHRA 3DEEA 4C8LA 3KHLA 4QZBA 2YN4A 5EE9A 5KG6A 5KFGA 1XWLA 5EWEA 3B0YA 5DB8A 3V7LA 2AHOB 4Z6EA 2AGQA 5DG7A 2D3DA 5F3XB 5KFXA 9ICFA 2ESEA 2KVSA 3F53A 3JPQA 4PHDA 5JRTA 3C29A 4ED6A 3NGDA 4CF3A 3ZDBA 2KKPA 3F2CA 8ICNA 4ECUA 3IG5A 3BZCA 2V4RA 1JI7A 3HKZF 1URJA 3JPTA 3LDAA 2PI5A 2ZUCA 7ICUA 4J9NA 4B6JA 2ATLA 2FPMA 1FFVA 4KTQA 3H8MA 5L1KA 8ICLA 2UVUA 5CRXA 4RNNA 1Z1VA 3L5KA 5KFEA 9ICRA 2AH5A 3ORYA 4Y2UA 1MQ3A 4Z6DA 4NLBA 3F2DA 5KL1B 4J03A 1V38A 5ALTA 3B0XA 2AU0A 2KK0A 2KSOB 2CN1A 3RJFA 1S9FA 9ICOA 2MRLA 3UXNA 3EPIA 5KFZA 3WKDA 2Y9UA 5AI0A 8ICIA 5E79U 3M1YA 3M9OB 4PL1A 1S10A 4ED8A 2HMXA 4QZGA 3SAFA 1KKXA 4EZ6A 4TQSA 4PGXA 8ICKA 3QZ8A 3FC4A 2YMPA 8ICCA 4A8EA 2QKQA 2UVWA 4NXZA 3IDWA 5AM2A 1XO1A 2E8NA 2E8OA 4F3OA 4MHVA 2HHUA 1Z00A 3BS7A 2FLLA 4O3QA 4OJLA 2WFAA 4RQNA 9ICEA 1ZD2P 1SXDA 4RZRA 2WF8A 3SR6A 1T8EA 2I6XA 4Z6FA 3MGIA 2B21A 4EEYA 4C7ZA 3GQCA 1HUOA 4NWIA 1X6JA 4ELUA 1ECWA 1J2MA 4F8RA 4LZGA 2A1JA 4DL7A 2BHNA 3R9KA 5B5EU 3ZI4A 5DG8A 4IQVA 1X9XA 2F77X 2AQ4A 4F91B 4I27A 5J2BA 2KZ3A 9ICQA 2WF9A 3K4GA 3PMNA 3SQIA 9ICPA 1N61A 5J0YA 2EZZA 2ZIXB 4EBDA 2PFQA 4OJ5A 2A1AA 1TAUA 3HWTA 3FAHA 3KHGA 2W04A 3FDSA 3UPQA 3MC1A 4KMUA 5AKGA 1SKWA 5J2AA 3GV7B 5AKHA 2PMZC 3PX6A 3UMGA 1Z00B 2W11A 4C8KA 4ECYA 5H2FU 4RQ2A 2DPIA 4C80A 9ICNA 4EX7A 7ICKA 4QZEA 1WUDA 1N2XA 3Q8MA 3M8SA 4QZ8A 1VJ5A 4YXJA 1ZQFA 4GXIA 2R8GA 4UQGA 3QNMA 2W9BB 4YG2A 4EELA 2HBMA 1CUKA 2B6GA 1IM4A 2KFZA 3N28A 1QSLA 9ICSA 4GXJA 5KFVA 3CNHA 1ZQVA 4DL3A 3SI8A 3SD7A 2BCUA 3RJGA 4I29A 4PGQA 5L1JA 3QUTA 1Z4OA 3KZIU 2RDJA 1L7MA 4MEYA 4CE6A 4BUGA 2ZIUB 5J2FA 2F8LA 3AU6A 2WF7A 3OSNA 1L8OA 3H40A 5J0QA 5FP0A 4F92B 3NVZA 3OSPA 2NRVA 5KG0A 1LKYB 4YD1A 1ZXIA 1LB2B 1O03A 4F71A 5D46A 2B0CA 4YXMA 2LM1A 1L6NA 3ED5A 4R63A 5AM4A 4X5VA 5HNKA 4B9MA 2FMQA 4I2DA 4DS4A 3G6XA 1ZQEA 3KZXA 3THVA 1LVHA 4AP9A 2NO4A 3EYZA 4O3SA 3AEVA 5KG3A 4OJPA 5J2GA 3BZKA 2KZMA 2W9AA 3BQ0A 4UW9A 7ICEA 4M0AA 1V85A 4LJXA 2BCQA 4IS7A 1A76A 1CEZA 4OD0A 4C8MA 3JPPA 3H8SA 2R8HA 2RQ5A 4RNMA 3PSFA 3TADC 2DKZA 2ZIWB 4CNQA 4R8UB 4Q43A 3IN5A 4M9NA 3C1ZA 2YB1A 3RTVA 4YQWA 3IV6A 2FDRA 2AGOA 4FE3A 5KFIA 1F0MA 2XY5A 7ICNA 4KN7A 4I2HA 1SWWA 3PO5A 3NS1A 1ZQUA 1WCLA 4OJOA 5CR0A 2BDPA 2E1EA 1J2NA 3LVVA 4BWJA 5DDYA 2OWOA 2VJ4A 1BPEA 3ISDA 2EZXA 1HEKA 3PR5B 8ICTA 1WWVA 1KLNA 2G5HB 4M9LA 2EQYA 4KMOB 4BGDA 3C5FA 3UQ2A 2K60A 1Z1BA 3AQEA 4UATA 3WKAA 2RLTA 4RT3A 5L1MA 3B9JA 3EWAA 1DK3A 5D49A 3EUB2 5JUMA 8ICVA 4EENA 4QZDA 3MABA 3MR3A 1BPBA 4Q8FA 2VIXA 4P0QA 2E8PA 9ICKA 2RP5A 3N7SC 2ZG6A 2F1JA 5DBBA 4JK1A 4NL9C 3RRGA 2ASDA 2RHFA 3ETLA 3ZDEA 4UAWA 4J9MA 1KFTA 2C28A 4G3IA 4C7YA 4R66A 1NK5A 5AM5A 2XY6A 4NM1A 5ALVA 3K75D 3GDXA 4FBUA 1Z4NA 2JXJA 1L3TA 2JEGA 1ZQSA 1K1QA 2M9NA 3SZ2A 5ALUA 1COKA 3TQ1A 3AL0B 1S0NA 4QZIA 2XO7A 4O0IA 1MSWD 3M9MB 4C0ZA 5C0YA 4QW8A 1OXJA 4IR1A 1KW4A 4FZMA 4NL9A 5DGAA 2DBYA 9ICGA 1A6SA 4G9BA 3RH4A 5KFMA 2ZIWA 4GIBA 3JPSA 2AXTU 4F5RA 4JV0A 1S0OA 2OH2A 4DFPA 4KX3A 3BDPA 4QWBA 1ZQ1C 1MN8A 4J9RA 2K8AA 5J0XA 2G09A 5JTIA 1FFUA 3EPGA 3N4MB 3HX0A 1RYUA 1T3QA 4F5QA 4I2FA 3PVXA 2KHQA 1UT8A 2ALZA 5KG4A 2NO5A 3AN1A 3G6VA 5KFAA 2DF4B 3C5GA 2L5YA 3RBEA 4O3MA 5HMMA 3RJKA 2LMRA 3NRZA 1KSPA 3K1RB 2FLPA 1X2IA 3RJIA 3EZ5A 4UARA 4CGZA 9ICCA 4O3NA 4PZOA 5AM0A 1BVSA 2I9GA 1RQNA 5HHIA 3HPOA 2ODGA 3M7DA 8ICAA 3HT3A 1VLBA 2EZYA 4RQ7A 5KL8B 1TK0A 1U9LA 2J6SA 1U45A 4M2YA 3TADA 3C28A 8ICMA 4ED7A 5AI9A 4YMOA 3GU3A 5CJ7A 2W9CA 4QJFB 4UB6U 2W3RA 5J0UA 5HHHA 1KTQA 5AKKA 2EH9A 2LKYA 4QZFA 4MFCA 1T7PA 4Y2QA 2C22A 1X42A 3T79A 4Q44A 9ICHA 2KNJA 2HVIA 2VANA 3D2SA 1PK1B 2RDIA 2W54A 3S6JA 1ZQCA 3TAPA 4PHAA 5IILA 3ZD8A 5CWRA 2UVVA 4PPXA 2F1IA 1FEZA 4US8A 4ECTA 1RYRA 4NY8A 5TZVA 1UA1A 2ZIXA 1S5LU 4UB8U 3OJSA 4ECVA 1NKCA 4EX6A 4RQ6A 3F2BA 3PNCA 1ZQXA 4UB2A 5D4BA 4I2EA 1ZETA 3VCBA 2VJ5A 1H38A 2JH1A 1D9FA 4RPXA 2ZXIA 4XA5A 2EANA 4Y2TA 4XQ8A 1ZJNA 2XGQA 4BDPA 2KEYA 3H8JA 4ACOA 4O3PA 1NJZA 1XU4A 3RF9A 2BPCA 2JMGA 1Y88A 5ALSA 3AM9A 3WK6A 4ELVA 2FJ6A 1IG6A 7ICQA 2H5XA 3M6KA 4U6PA 4ED2A 3I76A 3OJUA 1S97A 1JXEA 5EE3A 2JHDA 5EOZA 2E1FA 4DL5A 5DB9A 5KFRA 3SENA 4PL2A 2MAXA 3SV4A 3WKEA 4KLSA 2ZIUA 5J0WA 4UAVA 4TUQA 1WWUA 1ZD5A 9ICLA 4DFKA 1RQLA 4FO6A 5ALHA 7ICVA 3EW9A 5TISU 4C4RA 4IQUA 2MA1A 4NLCA 4DQPA 4UAYA 4AYBC 8ICHA 3K1ZA 4FZNA 1X66A 4P4OA 5CA7A 3JPOA 3H0LB 3QXGA 1CI4A 7ICFA 3RB3A 4KLGA 2F1HA 1JN3A 5AIBA 1BPYA 1QSSA 2NRTA 3DDHA 1TVAA 4IC9A 1ZQJA 4WJ3B 1NOMA 2K8BB 5KT6A 4K4IA 3NASA 5AI8A 4EYHB 4F5OA 3HKZC 1SXEA 5F9NA 2JRZA 5T14A 3CRXA 4C4TA 1DGSA 2BGWA 4JV2A 2K4PA 2W55A 3RJJA 3IHQB 3UXOA 3T5HA 1S8OA 1PZNA 2IOHA 5KG2A 4CRXA 3NVVA 2PMZF 4RPYA 2F8KA 4B9LA 1PVRA 8ICBA 3MDAA 1JALA 5B66U 4J9QA 4US9A 4IQWA 8ICXA 5KG5A 5IIKA 1KFDA 4EBCA 1ZQRA 4IRCA 5KT2A 5AKYA 4ECQA 4KLEA 4E0DA 2IOFK 4DQSA 4QWCA 2ASJA 3SV3A 2FPKA 5KFUA 3Q8KA 4QNLA 1ZQWA 2VA8A 1D8LA 2Y0SC 1RYSA 2VA3A 5KFBA 4IRKA 2P66A 3KFUF 3RR7A 3V72A 4FFDA 1MA7A 4M47A 4XUSA 5ALPA 5J2IA 4DO9A 3AU2A 2HHXA 1C7YA 4GC6A 1FIQA 1ZQQA 2KV2A 2K4IA 4TUPA 1HJPA 2I5HA 4GLXA 3KD3A 4DEZA 3RH5A 1ZQPA 3E2EA 1YZ7A 5J0TA 5ALDA 5DBCA 1SV0A 2JV3A 1D8BA 3LK9A 5DLFA 2ASLA 1WYGA 1DOQA 2VKQA 2QB0B 2HW3A 2KICA 2H3IA 5IIOA 1TK5A 3DV9A 1ZOLA 3MR6A 3LYSA 1SL1A 2BKEA 2PFPA 3ZDAA 2HDOA 3LWLA 2DQNB 4DFDA 4Y2YA 5G5GA 4Q45A 2XVTA 8ICUA 5AKXA 1Q8KA 1N5XA 1S77D 3I1YA 1ZQZA 1J97A 3WK5A 3GFKB 3FM9A 1B0XA 2PFOA 7ICGA 3T5LA 5AKLA 5KFJA 1U47A 2DWQA 1T4GA 7ICTA 2LBOA 2LYHA 4B9NA 4TURA 4KLIA 2KE7A 4F50A 7ICSA 5KFYA 3GIIA 1PVQA 3PW0A 1QLNA 2ZTEA 1XNSA 2XCPA 5EWFA 2HVHA 4DSIA 1TKDA 1U49A 4QIWF 3OTQA 2G08A 4RNOA 3RB6A 3QU7A 4J9SA 1A0PA 4USAA 3IRUA 1Q3VA 2OCEA 2HOIA 3SYZA 2ZJAA 4DSLA 3RB4A 8ICOA 1PK3A 1L3UA 1JIHA 1SV0C 1TE2A 4MF8A 7ICMA 5G5HA 5DQIA 5AM3A 3TAQA 4HAIA 1L7NA 1NI3A 5AKJA 3UQ0A 2O6KA 4M9JA 1COOA 4ZOHC 1Z3EB 2GLEA 3MFIA 3E58A 3KKAC 2YB4A 3NRWA 4EYIB 1U48A 4RQ8A 5KFLA 1CRXA 5DLGA 4ECZA 3T5KA 5BPCA 5DQGA 9ICMA 5ALNA 1ZQBA 2HBKA 8ICWA 2KKVA 2Y9TA
chains in the Genus database with same CATH topology
4CE6A 5AHXA 2WFAA 2YMQA 5ALKA 1ZD2P 2QLTA 2HDOA 2WF8A 4DFDA 3NASA 5AI8A 4Y2JA 5ALYA 4EX6A 4Y2YA 4CF3A 2WF7A 3UMBA 5ALJA 2I6XA 5AKXA 4C4TA 3QYPA 5ALZA 1RDFA 2MSNA 5FP0A 5AKEA 3I1YA 5ALWA 4UATA 3WKAA 5ALLA 2NO5A 5ALRA 3WK5A 3FM9A 3R9KA 4Y2TA 3ZI4A 1S8OA 1QH9A 2IOHA 1O03A 4CF5A 4EENA 4F71A 2B0CA 2YY6A 2HCFA 5AK4A 2MU2A 5AKIA 5AI6A 5AKLA 4Y2VA 3ED5A 1SWVA 5AKZA 3WKBA 2WF9A 3QU9A 5AM4A 1QQ6A 5AIAA 4UASA 5ALSA 4Y2PA 5ALGA 3WK6A 4UARA 5AKYA 5ALEA 3QUQA 3L5KA 2IOFK 4Y2SA 5ALFA 5AM0A 3WK4A 1RQNA 3WK9A 2AH5A 3WK7A 4EEKA 4Y2UA 5AK6A 3MC1A 5ALXA 1LVHA 4Y2XA 1AQ6A 2NO4A 3QUBA 3I76A 2NYVA 4J03A 5AKGA 5ALTA 1O08A 3OTQA 4OCZA 2W43A 3WKCA 4CF4A 3QU4A 2HI0A 3QU7A 5AM5A 1ZD3A 2PKEA 5AI9A 3WK8A 5AKHA 3UMCA 3I28A 5AICA 3QUCA 4UW9A 5AI5A 5ALVA 3UMGA 5AM1A 5AI4A 3IRUA 2W11A 3WKEA 5ALQA 4FFDA 3QU5A 1Z4NA 3WKDA 4UAVA 5ALPA 4DCCA 1JUDA 3KOOA 5AI0A 1ZD5A 4OD0A 2YMMA 1RQLA 4EX7A 3KBBA 4F72A 1TE2A 5AKKA 5ALIA 5ALHA 5ALUA 4JB3A 5AM3A 3QU2A 4HAIA 1QQ7A 2FI1A 1QQ5A 1VJ5A 2WHEA 3QX7A 5AKJA 4C4RA 5AK3A 3U26A 4UAUA 3D6JA 1Z4OA 3QNMA 5AK5A 2YMLA 4CNQA 1ZRMA 4Y2QA 3UM9A 2YMPA 1X42A 2WF5A 4EELA 3E58A 3QXGA 2HSZA 2FDRA 2GO7A 2WF6A 2YN4A 2IOFA 5ALDA 4C4SA 4Y2RA 3S6JA 5AM2A 5AIBA 1ZD4A 4G9BA 3CNHA 1ZRNA 3DDHA 4GIBA 5ALOA 5ALNA 1SWWA 3SD7A 3DV9A 1FEZA 5ALMA 3QUTA 1ZOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CE6 A;  5AHX A;  2WFA A;  2YMQ A;  5ALK A;  1ZD2 P;  2QLT A;  2HDO A;  2WF8 A;  4DFD A;  3NAS A;  5AI8 A;  4Y2J A;  5ALY A;  4EX6 A;  4Y2Y A;  4CF3 A;  2WF7 A;  3UMB A;  5ALJ A;  2I6X A;  5AKX A;  4C4T A;  3QYP A;  5ALZ A;  1RDF A;  2MSN A;  5FP0 A;  5AKE A;  3I1Y A;  5ALW A;  4UAT A;  3WKA A;  5ALL A;  2NO5 A;  5ALR A;  3WK5 A;  3FM9 A;  3R9K A;  4Y2T A;  3ZI4 A;  1S8O A;  1QH9 A;  2IOH A;  1O03 A;  4CF5 A;  4EEN A;  4F71 A;  2B0C A;  2YY6 A;  2HCF A;  5AK4 A;  2MU2 A;  5AKI A;  5AI6 A;  5AKL A;  4Y2V A;  3ED5 A;  1SWV A;  5AKZ A;  3WKB A;  2WF9 A;  3QU9 A;  5AM4 A;  1QQ6 A;  5AIA A;  4UAS A;  5ALS A;  4Y2P A;  5ALG A;  3WK6 A;  4UAR A;  5AKY A;  5ALE A;  3QUQ A;  3L5K A;  2IOF K;  4Y2S A;  5ALF A;  5AM0 A;  3WK4 A;  1RQN A;  3WK9 A;  2AH5 A;  3WK7 A;  4EEK A;  4Y2U A;  5AK6 A;  3MC1 A;  5ALX A;  1LVH A;  4Y2X A;  1AQ6 A;  2NO4 A;  3QUB A;  3I76 A;  2NYV A;  4J03 A;  5AKG A;  5ALT A;  1O08 A;  3OTQ A;  4OCZ A;  2W43 A;  3WKC A;  4CF4 A;  3QU4 A;  2HI0 A;  3QU7 A;  5AM5 A;  1ZD3 A;  2PKE A;  5AI9 A;  3WK8 A;  5AKH A;  3UMC A;  3I28 A;  5AIC A;  3QUC A;  4UW9 A;  5AI5 A;  5ALV A;  3UMG A;  5AM1 A;  5AI4 A;  3IRU A;  2W11 A;  3WKE A;  5ALQ A;  4FFD A;  3QU5 A;  1Z4N A;  3WKD A;  4UAV A;  5ALP A;  4DCC A;  1JUD A;  3KOO A;  5AI0 A;  1ZD5 A;  4OD0 A;  2YMM A;  1RQL A;  4EX7 A;  3KBB A;  4F72 A;  1TE2 A;  5AKK A;  5ALI A;  5ALH A;  5ALU A;  4JB3 A;  5AM3 A;  3QU2 A;  4HAI A;  1QQ7 A;  2FI1 A;  1QQ5 A;  1VJ5 A;  2WHE A;  3QX7 A;  5AKJ A;  4C4R A;  5AK3 A;  3U26 A;  4UAU A;  3D6J A;  1Z4O A;  3QNM A;  5AK5 A;  2YML A;  4CNQ A;  1ZRM A;  4Y2Q A;  3UM9 A;  2YMP A;  1X42 A;  2WF5 A;  4EEL A;  3E58 A;  3QXG A;  2HSZ A;  2FDR A;  2GO7 A;  2WF6 A;  2YN4 A;  2IOF A;  5ALD A;  4C4S A;  4Y2R A;  3S6J A;  5AM2 A;  5AIB A;  1ZD4 A;  4G9B A;  3CNH A;  1ZRN A;  3DDH A;  4GIB A;  5ALO A;  5ALN A;  1SWW A;  3SD7 A;  3DV9 A;  1FEZ A;  5ALM A;  3QUT A;  1ZOL A; 
#chains in the Genus database with same CATH topology
 5AHX A;  9ICX A;  2QLT A;  4RQM A;  2JGA A;  4ELT A;  5KFD A;  1L5U A;  4YR0 A;  1L7P A;  4CCH A;  4K4G A;  2D8C A;  5L1L A;  5KAI U;  1KDH A;  8ICJ A;  1ZQG A;  2HHQ A;  1M6Y A;  2KFN A;  1EXN A;  3PX0 A;  1D8Y A;  2NRX A;  4DL2 A;  8ICR A;  3A0B U;  2W9M A;  1BGX T;  1YZ6 A;  2KSO A;  3M9N B;  4BX9 C;  1L7O A;  3NVY A;  4YFK A;  4QZH A;  3LWM A;  1XSP A;  4O5C A;  2JEF A;  5ALF A;  2XID A;  4Q8E A;  2OM6 A;  4JWM A;  2JEI A;  4ICA A;  4DSK A;  2Q0Z X;  1B4F A;  4ED3 A;  2WAQ F;  1BNP A;  1O08 A;  3F5E A;  3BS5 A;  3QU4 A;  4YCX A;  3PW2 A;  4P0P A;  1SKR A;  4NLK A;  4KLU A;  3UMC A;  4QZC A;  1SZH A;  3MGH A;  2Q4T A;  2NV3 A;  1BPX A;  2W03 A;  3ICX A;  2K8C B;  4ECS A;  1SIJ A;  2OEH A;  4KLO A;  4TUS A;  1NKE A;  4YVZ A;  3PSP A;  4PGY A;  3AQF A;  2F2A B;  1ZQY A;  2XC9 A;  3PST A;  2DUY A;  3IG8 A;  5J2D A;  2KG5 A;  4P4P A;  3RR8 A;  4DLE A;  2GOL A;  7ICR A;  4J9P A;  2LYA A;  2FMS A;  2BQU A;  1ZD4 A;  4IRD A;  1XC9 A;  1ZQL A;  2KMD A;  1JMS A;  1KQQ A;  1NNL A;  3PW7 A;  1QTM A;  4Y2J A;  1X40 A;  4P0Q B;  4PJ0 U;  3ZDC A;  3BQ2 A;  2PXI A;  4RPZ A;  2ZIV B;  3RJE A;  1RDF A;  2HOF A;  5DBA A;  2EAO A;  1X9S A;  1NK0 A;  3RH6 A;  3CP8 A;  7ICH A;  1RZT A;  3E0F A;  4UB3 A;  3QEA Z;  1ZQO A;  2YY6 A;  4ZH4 A;  3RRH A;  4DWI A;  1NKB A;  1N5W A;  4Y2V A;  3C2M A;  3MFH A;  4GFJ A;  4F2S A;  1X6I A;  3PR4 A;  4O5E A;  5ALG A;  4YR2 A;  4P4M A;  4NLN A;  2IHM A;  3SEI A;  1NJW A;  2JZB A;  3PSI A;  1JRP A;  5DG9 A;  4M6W B;  1SGG A;  3GV8 B;  3L3F X;  4C8N A;  3NUQ A;  4ECR A;  2W43 A;  5HR7 A;  3N7P D;  2OXO A;  5AIC A;  2KJ9 A;  3QUC A;  3C23 A;  3GZF A;  2DKX A;  2Y1J A;  3ZD9 A;  2Y0S F;  5A0L A;  1UT5 A;  4IQT A;  4C8O A;  2FE9 A;  5CEH A;  1GO3 F;  2KTQ A;  4QWE A;  4RQ4 A;  3BQ1 A;  2WHE A;  2W9C B;  1ZJM A;  3U26 A;  1KN5 A;  3MBY A;  1L3V A;  5IIJ A;  7ICJ A;  4OJ6 A;  5J8Y C;  3OHA A;  2OHF A;  5DB7 A;  3HJE A;  2HSZ A;  4DSJ A;  2BPF A;  3VC8 A;  4MFF A;  1KRP A;  4I2J A;  2K4E A;  1Q3U A;  3Q8P B;  9ICU A;  3JPR A;  3C2K A;  4QZ9 A;  1YT3 A;  1ARO P;  2MSN A;  1JX4 A;  2DFL A;  5AKE A;  4BWM A;  4RQ3 A;  5ALL A;  1NK8 A;  3GIM A;  2ES6 A;  2HCF A;  1SKS A;  5C5J A;  4KLQ A;  5AK4 A;  4PZN A;  3J81 j;  4F4K A;  3TAR A;  5J2H A;  4B9V A;  5AIA A;  5KFS A;  5KFK A;  2BR0 A;  9ICA A;  1ZYQ A;  2KIW A;  4PHE A;  2BQ3 A;  3PV8 A;  3ISC A;  1NZP A;  2J6T A;  2CRX A;  1A77 A;  1PUZ A;  2AJQ A;  1P7D A;  1ZQM A;  3OPX A;  1MC8 A;  1B22 A;  4UAZ A;  4IL6 U;  5K4L A;  4EZ9 A;  2HI0 A;  2QB0 A;  3V7J A;  4KLL A;  1NJX A;  3I28 A;  3FYH A;  3H4B A;  5AI5 A;  4LZD A;  4DSF A;  3RJH A;  2G5I B;  8ICG A;  1K1S A;  1JUD A;  5IIM A;  2P35 A;  2ZXH A;  3V6H A;  1V97 A;  3Q8L A;  3KBB A;  5ALI A;  5KFH A;  4RQ0 A;  1SZP A;  2LPE A;  3L4P A;  1JXL A;  1QQ5 A;  2A19 A;  2D6F C;  2K4H A;  2R8J A;  4I2A A;  2WF5 A;  4TQR A;  1N63 A;  2XI9 A;  5BOM A;  5III A;  3TKA A;  2WF6 A;  9ICB A;  1RPL A;  2EDU A;  2NRZ A;  3QZ7 A;  2PI4 A;  7ICI A;  2K89 A;  3MR2 A;  4J9K A;  2EAM A;  5EE1 A;  5KFP A;  2MUT B;  1L3S A;  1S0V A;  4DQR A;  2HHS A;  5KT4 A;  1SL0 A;  2WAQ C;  5ALY A;  4BXO B;  1UHU A;  2DGZ A;  2HBJ A;  3T3F A;  4RUC A;  2R8K A;  2CXY A;  2C2R A;  1U4B A;  3ALR A;  2ISO A;  4UB1 A;  3V6K A;  2F44 A;  4ED0 A;  3BJY A;  4RT2 A;  7ICO A;  5ALR A;  1B43 A;  5IIN A;  1IXR A;  2KHV A;  4DS5 A;  2P6R A;  4YN4 A;  2W8L A;  5CP2 A;  4DFM A;  2UVR A;  1S0M A;  3QU9 A;  1RXV A;  3RAQ A;  3N7R C;  2MUT A;  3PZP A;  1WG8 A;  4Y2S A;  5KNI A;  4NV0 A;  2DL0 A;  3Q8S B;  2YX8 A;  2HOQ A;  1OW5 A;  3QUB A;  1F44 A;  4DQI A;  1UPH A;  2NYV A;  5KFQ A;  4ECW A;  2HHW A;  5GTI U;  8ICS A;  1QCK A;  5DB6 A;  1NJY A;  4DL4 A;  3TAN A;  4DFJ A;  2EAP A;  5EE0 A;  2A3V A;  2P6U A;  4NLG A;  1RXW A;  4MF2 A;  3H0M B;  2YMM A;  2ZJ8 A;  1ZQI A;  3SAH A;  2ZIV A;  4R64 A;  2IA6 A;  4KN4 A;  4P2H A;  3PO4 A;  3TFR A;  5J0S A;  2GO7 A;  2GH1 A;  5DKW A;  3D2Q A;  4KLD A;  2CPR A;  2KIV A;  1ZQT A;  5ALO A;  1ZRN A;  4NJ8 A;  5J2C A;  2I1Q A;  8ICF A;  5ALK A;  2ZTC A;  7ICP A;  3HP6 A;  2W3S A;  1Z19 A;  9ICJ A;  2ZTD A;  8ICP A;  4GXK A;  2JR5 A;  2YQE A;  3BQT A;  4QWA A;  4F4X A;  4P0P B;  4YP3 A;  1NK4 A;  4J9L A;  9ICV A;  2FLN A;  2C2E A;  2HHT A;  1DK2 A;  1BNO A;  1TAQ A;  3IM1 A;  4M9G A;  4CDG A;  9ICI A;  1SWV A;  3WKB A;  2GWS A;  1QQ6 A;  4UAS A;  1C20 A;  4Y2P A;  3PML A;  4B9U A;  3TI0 A;  2WB1 F;  2ZUD A;  1TAM A;  2R8I A;  4RQ1 A;  1S76 D;  2ZJ5 A;  4EEK A;  3OHB A;  1ZQN A;  5GTH U;  1NK9 A;  4Y2X A;  4KIT B;  5J0R A;  3AMZ A;  1KL9 A;  1X9M A;  3HIL A;  4OCZ A;  2ZUB A;  3TAC B;  3ONN A;  3WKC A;  4CF4 A;  3HW8 A;  2PKE A;  3GIJ A;  5DDM A;  4KLH A;  3Q8Q B;  2V4Q A;  3WU2 U;  1ZQK A;  2A1J B;  3C1Y A;  5AM1 A;  5AI4 A;  5KG7 A;  1PK1 A;  1NK7 A;  2G07 A;  2JEJ A;  4ED1 A;  1SB3 C;  4NM2 A;  2KP7 A;  4JB3 A;  1QQ7 A;  2E8M A;  3QX7 A;  4O9M A;  3D6J A;  3GIL A;  3RB0 A;  2M0N A;  2IMW P;  1F5S A;  8ICZ A;  4F2R A;  4DQQ A;  2Y1I A;  1XS9 D;  4C4S A;  3MDC A;  1ZQD A;  5J8Y A;  2LYB A;  4F4Y A;  5KFT A;  2F76 X;  4DSE A;  1KFS A;  3N97 B;  5ALZ A;  3A0H U;  4JV1 A;  4IR9 A;  2NRW A;  4R8U A;  3ISB A;  2YMQ A;  2WTF A;  9ICW A;  4QZA A;  1TV9 A;  2C2D A;  3SAG A;  1MQ2 A;  4M6W A;  3QYP A;  5J2J A;  3BS5 B;  1X9W A;  4UBB A;  4MFA A;  1JRO A;  4OO1 J;  2BCS A;  4RQ5 A;  3KTQ A;  3O0F A;  4GC7 A;  4ECX A;  4QW9 A;  3OGU A;  5AI6 A;  2BZF A;  4F4W A;  2E3T A;  4FS2 A;  2H3V A;  1N60 A;  1NZB A;  1DRG A;  4DL6 A;  4KLF A;  1LKY A;  4O5K A;  3PX4 A;  4U7C A;  3CYM A;  2XCA A;  5HP4 A;  1RM6 C;  1WCN A;  2QAR A;  4K4H A;  1BPD A;  1ZD3 A;  2KN7 A;  2FPL A;  1N56 A;  1Q46 A;  2J6U A;  2V9W A;  2AGP A;  2E5S A;  3AUO A;  2LI6 A;  2HBL A;  5ALQ A;  4BJQ A;  2XGP A;  2AQ0 A;  1K5O A;  4UBC A;  2ISP A;  3H4D A;  3TFS A;  3KOO A;  3H0R B;  2R18 A;  2FMP A;  3GIK A;  5L1I A;  4UB5 A;  1OUQ A;  1FO4 A;  1T94 A;  4DF4 A;  2XY7 A;  3QU2 A;  3MGV A;  2LHT A;  2W7O A;  5AK3 A;  2N1R A;  1ZRM A;  2KOB A;  5JU5 A;  4YD2 A;  2IHN A;  4O3R A;  3RFA A;  8ICY A;  2IOF A;  3ZDD A;  1VDV A;  1DXS A;  3T5J A;  1SV4 A;  1NK6 A;  5J0P A;  3V6J A;  4FS1 A;  2W7P A;  4QWD A;  4FZL A;  2RRD A;  3UMB A;  4DLG A;  4KLM A;  3KHH A;  5J29 A;  4M04 A;  4FBT A;  2QAR B;  4EBE A;  3M8R A;  5L9X A;  5CB1 A;  1BPZ A;  4DOC A;  2F3N A;  4YR3 A;  3PY8 A;  5BOL A;  4F4Z A;  5HML A;  5AKZ A;  3SMV A;  5J0O A;  4DOB A;  2YTU A;  4JMU A;  5ALE A;  1RG6 A;  3LVW A;  5AK6 A;  1N62 A;  4F5P A;  4JWN A;  1XSN A;  3NVW A;  3UXP A;  4B9T A;  3D2N A;  3M6Z A;  1L8L A;  3G6Y A;  1XSL A;  5DGB A;  2KJ8 A;  1V9P A;  3WK8 A;  4KLJ A;  4M9H A;  2KZZ A;  4F93 B;  3RAX A;  4I2B A;  5KT7 A;  3MR5 A;  5KFW A;  3C2L A;  3RBD A;  3Q8R B;  3IP4 B;  5KTQ A;  5DQH A;  2G06 A;  2BCV A;  5J2K A;  2PFN A;  5KT5 A;  4F5N A;  5KT3 A;  1T3N A;  3V7K A;  2H3Q A;  1DGJ A;  2KVC A;  5AK5 A;  2YML A;  3UM9 A;  4XRH A;  4QIW C;  4YMM A;  4PH5 A;  1LV5 A;  4MEX A;  1ZQH A;  8ICQ A;  3JPN A;  2VA2 A;  5KG1 A;  4Y2R A;  3KKA A;  4B9S A;  4JUZ A;  1IIP A;  2G0A A;  1TFR A;  5ALM A;  4J9O A;  3ETR A;  1IV8 A;  1KEJ A;  2Z7J A;  4LVS A;  5KFO A;  4I2G A;  2QB1 A;  4PHP A;  2WB1 C;  1UA0 A;  3GV5 B;  5ALJ A;  4RU9 A;  5CHG A;  4RUA A;  4AYB F;  2LM4 A;  4I28 A;  1D9D A;  5ALW A;  2JH7 A;  4O3O A;  7ICL A;  2H3F A;  2KD1 A;  5KAF U;  1UCV A;  3BQ7 A;  5EWG A;  4KLT A;  1QH9 A;  4CF5 A;  4DOA A;  2MU2 A;  1XO0 A;  5AKI A;  3PW4 A;  3HRD D;  2BCR A;  4KX5 A;  5F9L A;  9ICT A;  2BQR A;  4BXO A;  4NLZ A;  2DPJ A;  1KBU A;  5KFC A;  3QUQ A;  3CW2 C;  5J2E A;  4HYK A;  3QE9 Y;  3WK4 A;  5HR6 A;  3WK9 A;  3WK7 A;  2H3Z A;  1QSY A;  2W8K A;  5ALX A;  1AQ6 A;  4UB4 A;  3QEB Z;  1N48 A;  2JZB B;  4Z6C A;  1PVP A;  2KJ5 A;  3PW5 A;  2BPG A;  3C21 A;  1ZQA A;  4I2C A;  1ED1 A;  3F5A A;  2XIC A;  3QU5 A;  1HIW A;  3H8W A;  3NTU A;  5KFF A;  4DCC A;  8ICE A;  2W9B A;  2BDU A;  4F72 A;  1UQV A;  5KFN A;  2HHV A;  2FI1 A;  1HUZ A;  4R65 A;  4UAU A;  2OYY A;  4DF8 A;  1SL2 A;  2IBK A;  4YMN A;  3H7I A;  4I2I A;  1TK8 A;  3KHR A;  3DEE A;  4C8L A;  3KHL A;  4QZB A;  2YN4 A;  5EE9 A;  5KG6 A;  5KFG A;  1XWL A;  5EWE A;  3B0Y A;  5DB8 A;  3V7L A;  2AHO B;  4Z6E A;  2AGQ A;  5DG7 A;  2D3D A;  5F3X B;  5KFX A;  9ICF A;  2ESE A;  2KVS A;  3F53 A;  3JPQ A;  4PHD A;  5JRT A;  3C29 A;  4ED6 A;  3NGD A;  4CF3 A;  3ZDB A;  2KKP A;  3F2C A;  8ICN A;  4ECU A;  3IG5 A;  3BZC A;  2V4R A;  1JI7 A;  3HKZ F;  1URJ A;  3JPT A;  3LDA A;  2PI5 A;  2ZUC A;  7ICU A;  4J9N A;  4B6J A;  2ATL A;  2FPM A;  1FFV A;  4KTQ A;  3H8M A;  5L1K A;  8ICL A;  2UVU A;  5CRX A;  4RNN A;  1Z1V A;  3L5K A;  5KFE A;  9ICR A;  2AH5 A;  3ORY A;  4Y2U A;  1MQ3 A;  4Z6D A;  4NLB A;  3F2D A;  5KL1 B;  4J03 A;  1V38 A;  5ALT A;  3B0X A;  2AU0 A;  2KK0 A;  2KSO B;  2CN1 A;  3RJF A;  1S9F A;  9ICO A;  2MRL A;  3UXN A;  3EPI A;  5KFZ A;  3WKD A;  2Y9U A;  5AI0 A;  8ICI A;  5E79 U;  3M1Y A;  3M9O B;  4PL1 A;  1S10 A;  4ED8 A;  2HMX A;  4QZG A;  3SAF A;  1KKX A;  4EZ6 A;  4TQS A;  4PGX A;  8ICK A;  3QZ8 A;  3FC4 A;  2YMP A;  8ICC A;  4A8E A;  2QKQ A;  2UVW A;  4NXZ A;  3IDW A;  5AM2 A;  1XO1 A;  2E8N A;  2E8O A;  4F3O A;  4MHV A;  2HHU A;  1Z00 A;  3BS7 A;  2FLL A;  4O3Q A;  4OJL A;  2WFA A;  4RQN A;  9ICE A;  1ZD2 P;  1SXD A;  4RZR A;  2WF8 A;  3SR6 A;  1T8E A;  2I6X A;  4Z6F A;  3MGI A;  2B21 A;  4EEY A;  4C7Z A;  3GQC A;  1HUO A;  4NWI A;  1X6J A;  4ELU A;  1ECW A;  1J2M A;  4F8R A;  4LZG A;  2A1J A;  4DL7 A;  2BHN A;  3R9K A;  5B5E U;  3ZI4 A;  5DG8 A;  4IQV A;  1X9X A;  2F77 X;  2AQ4 A;  4F91 B;  4I27 A;  5J2B A;  2KZ3 A;  9ICQ A;  2WF9 A;  3K4G A;  3PMN A;  3SQI A;  9ICP A;  1N61 A;  5J0Y A;  2EZZ A;  2ZIX B;  4EBD A;  2PFQ A;  4OJ5 A;  2A1A A;  1TAU A;  3HWT A;  3FAH A;  3KHG A;  2W04 A;  3FDS A;  3UPQ A;  3MC1 A;  4KMU A;  5AKG A;  1SKW A;  5J2A A;  3GV7 B;  5AKH A;  2PMZ C;  3PX6 A;  3UMG A;  1Z00 B;  2W11 A;  4C8K A;  4ECY A;  5H2F U;  4RQ2 A;  2DPI A;  4C80 A;  9ICN A;  4EX7 A;  7ICK A;  4QZE A;  1WUD A;  1N2X A;  3Q8M A;  3M8S A;  4QZ8 A;  1VJ5 A;  4YXJ A;  1ZQF A;  4GXI A;  2R8G A;  4UQG A;  3QNM A;  2W9B B;  4YG2 A;  4EEL A;  2HBM A;  1CUK A;  2B6G A;  1IM4 A;  2KFZ A;  3N28 A;  1QSL A;  9ICS A;  4GXJ A;  5KFV A;  3CNH A;  1ZQV A;  4DL3 A;  3SI8 A;  3SD7 A;  2BCU A;  3RJG A;  4I29 A;  4PGQ A;  5L1J A;  3QUT A;  1Z4O A;  3KZI U;  2RDJ A;  1L7M A;  4MEY A;  4CE6 A;  4BUG A;  2ZIU B;  5J2F A;  2F8L A;  3AU6 A;  2WF7 A;  3OSN A;  1L8O A;  3H40 A;  5J0Q A;  5FP0 A;  4F92 B;  3NVZ A;  3OSP A;  2NRV A;  5KG0 A;  1LKY B;  4YD1 A;  1ZXI A;  1LB2 B;  1O03 A;  4F71 A;  5D46 A;  2B0C A;  4YXM A;  2LM1 A;  1L6N A;  3ED5 A;  4R63 A;  5AM4 A;  4X5V A;  5HNK A;  4B9M A;  2FMQ A;  4I2D A;  4DS4 A;  3G6X A;  1ZQE A;  3KZX A;  3THV A;  1LVH A;  4AP9 A;  2NO4 A;  3EYZ A;  4O3S A;  3AEV A;  5KG3 A;  4OJP A;  5J2G A;  3BZK A;  2KZM A;  2W9A A;  3BQ0 A;  4UW9 A;  7ICE A;  4M0A A;  1V85 A;  4LJX A;  2BCQ A;  4IS7 A;  1A76 A;  1CEZ A;  4OD0 A;  4C8M A;  3JPP A;  3H8S A;  2R8H A;  2RQ5 A;  4RNM A;  3PSF A;  3TAD C;  2DKZ A;  2ZIW B;  4CNQ A;  4R8U B;  4Q43 A;  3IN5 A;  4M9N A;  3C1Z A;  2YB1 A;  3RTV A;  4YQW A;  3IV6 A;  2FDR A;  2AGO A;  4FE3 A;  5KFI A;  1F0M A;  2XY5 A;  7ICN A;  4KN7 A;  4I2H A;  1SWW A;  3PO5 A;  3NS1 A;  1ZQU A;  1WCL A;  4OJO A;  5CR0 A;  2BDP A;  2E1E A;  1J2N A;  3LVV A;  4BWJ A;  5DDY A;  2OWO A;  2VJ4 A;  1BPE A;  3ISD A;  2EZX A;  1HEK A;  3PR5 B;  8ICT A;  1WWV A;  1KLN A;  2G5H B;  4M9L A;  2EQY A;  4KMO B;  4BGD A;  3C5F A;  3UQ2 A;  2K60 A;  1Z1B A;  3AQE A;  4UAT A;  3WKA A;  2RLT A;  4RT3 A;  5L1M A;  3B9J A;  3EWA A;  1DK3 A;  5D49 A;  3EUB 2;  5JUM A;  8ICV A;  4EEN A;  4QZD A;  3MAB A;  3MR3 A;  1BPB A;  4Q8F A;  2VIX A;  4P0Q A;  2E8P A;  9ICK A;  2RP5 A;  3N7S C;  2ZG6 A;  2F1J A;  5DBB A;  4JK1 A;  4NL9 C;  3RRG A;  2ASD A;  2RHF A;  3ETL A;  3ZDE A;  4UAW A;  4J9M A;  1KFT A;  2C28 A;  4G3I A;  4C7Y A;  4R66 A;  1NK5 A;  5AM5 A;  2XY6 A;  4NM1 A;  5ALV A;  3K75 D;  3GDX A;  4FBU A;  1Z4N A;  2JXJ A;  1L3T A;  2JEG A;  1ZQS A;  1K1Q A;  2M9N A;  3SZ2 A;  5ALU A;  1COK A;  3TQ1 A;  3AL0 B;  1S0N A;  4QZI A;  2XO7 A;  4O0I A;  1MSW D;  3M9M B;  4C0Z A;  5C0Y A;  4QW8 A;  1OXJ A;  4IR1 A;  1KW4 A;  4FZM A;  4NL9 A;  5DGA A;  2DBY A;  9ICG A;  1A6S A;  4G9B A;  3RH4 A;  5KFM A;  2ZIW A;  4GIB A;  3JPS A;  2AXT U;  4F5R A;  4JV0 A;  1S0O A;  2OH2 A;  4DFP A;  4KX3 A;  3BDP A;  4QWB A;  1ZQ1 C;  1MN8 A;  4J9R A;  2K8A A;  5J0X A;  2G09 A;  5JTI A;  1FFU A;  3EPG A;  3N4M B;  3HX0 A;  1RYU A;  1T3Q A;  4F5Q A;  4I2F A;  3PVX A;  2KHQ A;  1UT8 A;  2ALZ A;  5KG4 A;  2NO5 A;  3AN1 A;  3G6V A;  5KFA A;  2DF4 B;  3C5G A;  2L5Y A;  3RBE A;  4O3M A;  5HMM A;  3RJK A;  2LMR A;  3NRZ A;  1KSP A;  3K1R B;  2FLP A;  1X2I A;  3RJI A;  3EZ5 A;  4UAR A;  4CGZ A;  9ICC A;  4O3N A;  4PZO A;  5AM0 A;  1BVS A;  2I9G A;  1RQN A;  5HHI A;  3HPO A;  2ODG A;  3M7D A;  8ICA A;  3HT3 A;  1VLB A;  2EZY A;  4RQ7 A;  5KL8 B;  1TK0 A;  1U9L A;  2J6S A;  1U45 A;  4M2Y A;  3TAD A;  3C28 A;  8ICM A;  4ED7 A;  5AI9 A;  4YMO A;  3GU3 A;  5CJ7 A;  2W9C A;  4QJF B;  4UB6 U;  2W3R A;  5J0U A;  5HHH A;  1KTQ A;  5AKK A;  2EH9 A;  2LKY A;  4QZF A;  4MFC A;  1T7P A;  4Y2Q A;  2C22 A;  1X42 A;  3T79 A;  4Q44 A;  9ICH A;  2KNJ A;  2HVI A;  2VAN A;  3D2S A;  1PK1 B;  2RDI A;  2W54 A;  3S6J A;  1ZQC A;  3TAP A;  4PHA A;  5IIL A;  3ZD8 A;  5CWR A;  2UVV A;  4PPX A;  2F1I A;  1FEZ A;  4US8 A;  4ECT A;  1RYR A;  4NY8 A;  5TZV A;  1UA1 A;  2ZIX A;  1S5L U;  4UB8 U;  3OJS A;  4ECV A;  1NKC A;  4EX6 A;  4RQ6 A;  3F2B A;  3PNC A;  1ZQX A;  4UB2 A;  5D4B A;  4I2E A;  1ZET A;  3VCB A;  2VJ5 A;  1H38 A;  2JH1 A;  1D9F A;  4RPX A;  2ZXI A;  4XA5 A;  2EAN A;  4Y2T A;  4XQ8 A;  1ZJN A;  2XGQ A;  4BDP A;  2KEY A;  3H8J A;  4ACO A;  4O3P A;  1NJZ A;  1XU4 A;  3RF9 A;  2BPC A;  2JMG A;  1Y88 A;  5ALS A;  3AM9 A;  3WK6 A;  4ELV A;  2FJ6 A;  1IG6 A;  7ICQ A;  2H5X A;  3M6K A;  4U6P A;  4ED2 A;  3I76 A;  3OJU A;  1S97 A;  1JXE A;  5EE3 A;  2JHD A;  5EOZ A;  2E1F A;  4DL5 A;  5DB9 A;  5KFR A;  3SEN A;  4PL2 A;  2MAX A;  3SV4 A;  3WKE A;  4KLS A;  2ZIU A;  5J0W A;  4UAV A;  4TUQ A;  1WWU A;  1ZD5 A;  9ICL A;  4DFK A;  1RQL A;  4FO6 A;  5ALH A;  7ICV A;  3EW9 A;  5TIS U;  4C4R A;  4IQU A;  2MA1 A;  4NLC A;  4DQP A;  4UAY A;  4AYB C;  8ICH A;  3K1Z A;  4FZN A;  1X66 A;  4P4O A;  5CA7 A;  3JPO A;  3H0L B;  3QXG A;  1CI4 A;  7ICF A;  3RB3 A;  4KLG A;  2F1H A;  1JN3 A;  5AIB A;  1BPY A;  1QSS A;  2NRT A;  3DDH A;  1TVA A;  4IC9 A;  1ZQJ A;  4WJ3 B;  1NOM A;  2K8B B;  5KT6 A;  4K4I A;  3NAS A;  5AI8 A;  4EYH B;  4F5O A;  3HKZ C;  1SXE A;  5F9N A;  2JRZ A;  5T14 A;  3CRX A;  4C4T A;  1DGS A;  2BGW A;  4JV2 A;  2K4P A;  2W55 A;  3RJJ A;  3IHQ B;  3UXO A;  3T5H A;  1S8O A;  1PZN A;  2IOH A;  5KG2 A;  4CRX A;  3NVV A;  2PMZ F;  4RPY A;  2F8K A;  4B9L A;  1PVR A;  8ICB A;  3MDA A;  1JAL A;  5B66 U;  4J9Q A;  4US9 A;  4IQW A;  8ICX A;  5KG5 A;  5IIK A;  1KFD A;  4EBC A;  1ZQR A;  4IRC A;  5KT2 A;  5AKY A;  4ECQ A;  4KLE A;  4E0D A;  2IOF K;  4DQS A;  4QWC A;  2ASJ A;  3SV3 A;  2FPK A;  5KFU A;  3Q8K A;  4QNL A;  1ZQW A;  2VA8 A;  1D8L A;  2Y0S C;  1RYS A;  2VA3 A;  5KFB A;  4IRK A;  2P66 A;  3KFU F;  3RR7 A;  3V72 A;  4FFD A;  1MA7 A;  4M47 A;  4XUS A;  5ALP A;  5J2I A;  4DO9 A;  3AU2 A;  2HHX A;  1C7Y A;  4GC6 A;  1FIQ A;  1ZQQ A;  2KV2 A;  2K4I A;  4TUP A;  1HJP A;  2I5H A;  4GLX A;  3KD3 A;  4DEZ A;  3RH5 A;  1ZQP A;  3E2E A;  1YZ7 A;  5J0T A;  5ALD A;  5DBC A;  1SV0 A;  2JV3 A;  1D8B A;  3LK9 A;  5DLF A;  2ASL A;  1WYG A;  1DOQ A;  2VKQ A;  2QB0 B;  2HW3 A;  2KIC A;  2H3I A;  5IIO A;  1TK5 A;  3DV9 A;  1ZOL A;  3MR6 A;  3LYS A;  1SL1 A;  2BKE A;  2PFP A;  3ZDA A;  2HDO A;  3LWL A;  2DQN B;  4DFD A;  4Y2Y A;  5G5G A;  4Q45 A;  2XVT A;  8ICU A;  5AKX A;  1Q8K A;  1N5X A;  1S77 D;  3I1Y A;  1ZQZ A;  1J97 A;  3WK5 A;  3GFK B;  3FM9 A;  1B0X A;  2PFO A;  7ICG A;  3T5L A;  5AKL A;  5KFJ A;  1U47 A;  2DWQ A;  1T4G A;  7ICT A;  2LBO A;  2LYH A;  4B9N A;  4TUR A;  4KLI A;  2KE7 A;  4F50 A;  7ICS A;  5KFY A;  3GII A;  1PVQ A;  3PW0 A;  1QLN A;  2ZTE A;  1XNS A;  2XCP A;  5EWF A;  2HVH A;  4DSI A;  1TKD A;  1U49 A;  4QIW F;  3OTQ A;  2G08 A;  4RNO A;  3RB6 A;  3QU7 A;  4J9S A;  1A0P A;  4USA A;  3IRU A;  1Q3V A;  2OCE A;  2HOI A;  3SYZ A;  2ZJA A;  4DSL A;  3RB4 A;  8ICO A;  1PK3 A;  1L3U A;  1JIH A;  1SV0 C;  1TE2 A;  4MF8 A;  7ICM A;  5G5H A;  5DQI A;  5AM3 A;  3TAQ A;  4HAI A;  1L7N A;  1NI3 A;  5AKJ A;  3UQ0 A;  2O6K A;  4M9J A;  1COO A;  4ZOH C;  1Z3E B;  2GLE A;  3MFI A;  3E58 A;  3KKA C;  2YB4 A;  3NRW A;  4EYI B;  1U48 A;  4RQ8 A;  5KFL A;  1CRX A;  5DLG A;  4ECZ A;  3T5K A;  5BPC A;  5DQG A;  9ICM A;  5ALN A;  1ZQB A;  2HBK A;  8ICW A;  2KKV A;  2Y9T A; 
#chains in the Genus database with same CATH homology
 4CE6 A;  5AHX A;  2WFA A;  2YMQ A;  5ALK A;  1ZD2 P;  2QLT A;  2HDO A;  2WF8 A;  4DFD A;  3NAS A;  5AI8 A;  4Y2J A;  5ALY A;  4EX6 A;  4Y2Y A;  4CF3 A;  2WF7 A;  3UMB A;  5ALJ A;  2I6X A;  5AKX A;  4C4T A;  3QYP A;  5ALZ A;  1RDF A;  2MSN A;  5FP0 A;  5AKE A;  3I1Y A;  5ALW A;  4UAT A;  3WKA A;  5ALL A;  2NO5 A;  5ALR A;  3WK5 A;  3FM9 A;  3R9K A;  4Y2T A;  3ZI4 A;  1S8O A;  1QH9 A;  2IOH A;  1O03 A;  4CF5 A;  4EEN A;  4F71 A;  2B0C A;  2YY6 A;  2HCF A;  5AK4 A;  2MU2 A;  5AKI A;  5AI6 A;  5AKL A;  4Y2V A;  3ED5 A;  1SWV A;  5AKZ A;  3WKB A;  2WF9 A;  3QU9 A;  5AM4 A;  1QQ6 A;  5AIA A;  4UAS A;  5ALS A;  4Y2P A;  5ALG A;  3WK6 A;  4UAR A;  5AKY A;  5ALE A;  3QUQ A;  3L5K A;  2IOF K;  4Y2S A;  5ALF A;  5AM0 A;  3WK4 A;  1RQN A;  3WK9 A;  2AH5 A;  3WK7 A;  4EEK A;  4Y2U A;  5AK6 A;  3MC1 A;  5ALX A;  1LVH A;  4Y2X A;  1AQ6 A;  2NO4 A;  3QUB A;  3I76 A;  2NYV A;  4J03 A;  5AKG A;  5ALT A;  1O08 A;  3OTQ A;  4OCZ A;  2W43 A;  3WKC A;  4CF4 A;  3QU4 A;  2HI0 A;  3QU7 A;  5AM5 A;  1ZD3 A;  2PKE A;  5AI9 A;  3WK8 A;  5AKH A;  3UMC A;  3I28 A;  5AIC A;  3QUC A;  4UW9 A;  5AI5 A;  5ALV A;  3UMG A;  5AM1 A;  5AI4 A;  3IRU A;  2W11 A;  3WKE A;  5ALQ A;  4FFD A;  3QU5 A;  1Z4N A;  3WKD A;  4UAV A;  5ALP A;  4DCC A;  1JUD A;  3KOO A;  5AI0 A;  1ZD5 A;  4OD0 A;  2YMM A;  1RQL A;  4EX7 A;  3KBB A;  4F72 A;  1TE2 A;  5AKK A;  5ALI A;  5ALH A;  5ALU A;  4JB3 A;  5AM3 A;  3QU2 A;  4HAI A;  1QQ7 A;  2FI1 A;  1QQ5 A;  1VJ5 A;  2WHE A;  3QX7 A;  5AKJ A;  4C4R A;  5AK3 A;  3U26 A;  4UAU A;  3D6J A;  1Z4O A;  3QNM A;  5AK5 A;  2YML A;  4CNQ A;  1ZRM A;  4Y2Q A;  3UM9 A;  2YMP A;  1X42 A;  2WF5 A;  4EEL A;  3E58 A;  3QXG A;  2HSZ A;  2FDR A;  2GO7 A;  2WF6 A;  2YN4 A;  2IOF A;  5ALD A;  4C4S A;  4Y2R A;  3S6J A;  5AM2 A;  5AIB A;  1ZD4 A;  4G9B A;  3CNH A;  1ZRN A;  3DDH A;  4GIB A;  5ALO A;  5ALN A;  1SWW A;  3SD7 A;  3DV9 A;  1FEZ A;  5ALM A;  3QUT A;  1ZOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...