2MU2A

Nmr structure of the cap domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
LLDSYEAILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLLVRVAEDRNLDVEVLNQVRAQSLAEKNAQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, haloacid dehalogenase-like family
publication title J-UNIO protocol used for NMR structure determination of the 206-residue protein NP_346487.1 from Streptococcus pneumoniae TIGR4.
pubmed doi rcsb
source organism Streptococcus pneumoniae tigr4
molecule tags Hydrolase
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2mu2A00
2HCFA 4UASA 3QU2A 2GO7A 3UMCA 4CE6A 5ALZA 1RQNA 4EX7A 2IOFA 1TE2A 5AM0A 4EEKA 4EX6A 2B0CA 3KOOA 3WK8A 4Y2RA 4UATA 5ALGA 3DV9A 4J03A 5AK5A 1ZRNA 3I76A 4Y2PA 4OD0A 5AI9A 3S6JA 3ED5A 3QU4A 4CF3A 3NASA 1SWWA 4CF4A 4G9BA 4Y2TA 5ALPA 4Y2YA 1SWVA 3DDHA 4DCCA 3MC1A 4C4TA 1QQ6A 5ALQA 4Y2VA 5ALIA 3FM9A 3WKCA 2WF8A 4EELA 2QLTA 3QNMA 5ALFA 5AI8A 5ALWA 1AQ6A 5AI0A 1Z4OA 4JB3A 3WK5A 5AKGA 2W11A 4F72A 3QX7A 5AK4A 1O08A 2NYVA 5ALXA 4Y2QA 5AKZA 3ZI4A 3U26A 4FFDA 4F71A 5ALTA 3WK4A 4GIBA 1VJ5A 5AI6A 5ALOA 1ZD3A 5AM3A 3WKDA 1X42A 1FEZA 5AKKA 3QU9A 3QU7A 5AIBA 1QQ5A 3QU5A 1ZOLA 3SD7A 5ALDA 5AKEA 3D6JA 5ALYA 5AK6A 2IOHA 3WKAA 5AKJA 4EENA 1LVHA 5ALJA 1ZRMA 2YMPA 2YN4A 2YMLA 5ALSA 3WK7A 2WHEA 2IOFK 5AKIA 1S8OA 5AM1A 5AKLA 3UMBA 2HSZA 1JUDA 3OTQA 5AK3A 2AH5A 3UM9A 5AI4A 4C4RA 5AI5A 5AHXA 3WKEA 4Y2JA 2YMMA 3CNHA 2FDRA 2YMQA 2FI1A 2YY6A 2WFAA 5AKXA 5ALRA 2MSNA 3E58A 2WF6A 2WF9A 3UMGA 1RQLA 3I1YA 2WF7A 3WK6A 4UAVA 3WK9A 1QH9A 5AIAA 1O03A 5AM5A 2HI0A 3QYPA 5ALKA 4DFDA 1QQ7A 3WKBA 3QXGA 5AKHA 5FP0A 1Z4NA 2NO5A 4OCZA 4CF5A 2I6XA 3IRUA 4HAIA 2W43A 4C4SA 3KBBA 1ZD5A 4UARA 4Y2UA 3I28A 1ZD2P 5ALVA 2WF5A 5AKYA 2PKEA 3QUTA 3QUQA 4Y2SA 1ZD4A 2HDOA 5ALUA 3L5KA 3R9KA 4UW9A 5ALLA 3QUBA 3QUCA 5AM4A 5AM2A 4Y2XA 1RDFA 5ALEA 5ALHA 5ALMA 2MU2A 4CNQA 5ALNA 4UAUA 5AICA 2NO4A
chains in the Genus database with same CATH superfamily
4GFJA 5GTIU 3QU2A 2W55A 1TE2A 1IV8A 2PMZC 2BPFA 4Y2RA 2PMZF 4ED3A 4RQ2A 5AI9A 3UXOA 4G9BA 8ICCA 2MUTB 5DG9A 2KV2A 1BNOA 1N62A 2A3VA 7ICSA 1PVRA 4B9MA 1D9DA 4BGDA 1ZXIA 2DFLA 3RJEA 1SGGA 4TUPA 5G5HA 2RLTA 4YXJA 3LWMA 5AKZA 5KG6A 2O6KA 4DFPA 3QZ8A 3WKDA 3QU9A 3C2MA 4P2HA 5L1MA 4UBCA 2BCUA 5IINA 3GV8B 5AKEA 4DQRA 2EAOA 5AK6A 1L8LA 4KITB 1MQ2A 1D9FA 1J2NA 5DG7A 1L3VA 2JXJA 1F0MA 4C8MA 9ICHA 5AKXA 4O5CA 3T5HA 3BQ7A 4UQGA 2JR5A 1KQQA 3ZDCA 4DSLA 5KFAA 4DFJA 3Q8RB 2KZZA 3WKBA 1NK5A 1X6IA 3AQEA 2KZ3A 2W03A 3HPOA 2FMPA 4J9KA 3M6KA 2PKEA 2HDOA 3R9KA 3MGIA 5AM2A 4I2DA 1AROP 4WJ3B 2MU2A 4CNQA 2KSOB 5L1JA 1XWLA 3H40A 4CE6A 4IR9A 1SZHA 3PSTA 4DQPA 1PK1B 4DEZA 4J9SA 5KFEA 5AK5A 5CEHA 5EWFA 4P0PB 8ICHA 1XU4A 1XSLA 2ISPA 4NY8A 2XCPA 2HMXA 5KFPA 2KHQA 3K4GA 2EAMA 1MC8A 3M9MB 1RYSA 1MN8A 3M1YA 4Z6EA 2D8CA 1U49A 2WF8A 4YFKA 5KL8B 3QNMA 3GILA 3SAHA 5AI8A 7ICLA 1TAMA 9ICPA 3ISDA 1JRPA 3KHLA 4ELVA 4RQ8A 5GTHU 4DSEA 3NVZA 2BPGA 1YT3A 3ICXA 2K8AA 3HW8A 1ZQMA 1BVSA 3BQ0A 3ONNA 3TARA 5CWRA 1WUDA 2W9BA 5ALJA 4F4KA 4FBUA 2E1FA 3BZCA 5AKIA 2ZUBA 5T14A 9ICSA 5KFRA 1XS9D 3RAQA 2LI6A 2GWSA 2VANA 1V38A 1A6SA 3AM9A 4KLMA 4F4YA 3NTUA 1GO3F 4UAVA 1DGJA 4F5NA 4UB1A 1S0VA 3TQ1A 2BPCA 3QYPA 3UPQA 8ICSA 2G5HB 3IRUA 1N60A 4R66A 1ZQPA 4YN4A 3KBBA 4QWCA 2KN7A 2EH9A 5DDYA 2ASJA 4O5EA 1QCKA 8ICMA 1X9MA 5CHGA 1WCLA 4JUZA 3IDWA 2F8KA 1UHUA 2DL0A 5J0QA 4IQWA 3ALRA 4ED2A 1FO4A 5F3XB 4RPYA 5J2FA 4EEKA 3NVVA 2G5IB 3NRZA 4RQ7A 4U6PA 1ZJNA 1ZQTA 4OD0A 2KJ8A 4IR1A 1SZPA 4QWDA 2KZMA 2BCVA 3E2EA 3RB3A 1NNLA 3DEEA 1NK9A 4IQVA 3JPSA 2K8CB 2JHDA 2NRWA 2JGAA 2A1JA 3SENA 5TISU 1M6YA 3M6ZA 4UB4A 4M2YA 2W7PA 3A0BU 1T94A 5ALTA 3KTQA 1NJYA 5ALOA 2JEFA 3NS1A 4IC9A 4ED7A 1D8BA 3SD7A 1S0MA 5JUMA 4DSKA 3LK9A 2KMDA 3WKAA 3GQCA 2YMLA 8ICRA 8ICZA 5KG0A 1RYUA 5AK3A 4PZOA 1Q46A 8ICAA 4B9UA 4JV2A 4K4HA 2HHVA 2YY6A 3N7RC 1WYGA 3AU6A 2G09A 4PGQA 2AU0A 1QH9A 4ECXA 3OSPA 1Z4NA 3AL0B 4O9MA 3JPQA 2HOFA 1A76A 4FE3A 4QZCA 5J0PA 3OSNA 2XIDA 1LV5A 1JXLA 3L5KA 3QUBA 4C8NA 2KSOA 3RJIA 2IHMA 5KG2A 3C5FA 5CA7A 5KT6A 3MFIA 1PK1A 2DPJA 9ICBA 5IIKA 1KRPA 1B43A 4DOCA 4K4IA 2YB4A 1C7YA 4Q8EA 2VIXA 1SV0A 2UVWA 2F77X 4R8UA 4UAYA 5KG7A 3IHQB 2K4PA 2KG5A 3N28A 4PJ0U 3WK5A 4DLGA 2W9CB 2V4RA 4CRXA 2CRXA 5BOMA 1O08A 1VLBA 3BS7A 3N4MB 1SV4A 2BHNA 3ZI4A 4MFCA 5DQHA 1TVAA 4BWJA 3F2CA 4MEYA 3RF9A 2LHTA 3SAFA 1SL0A 2G0AA 4RT2A 4QZBA 9ICTA 2W9AA 1QTMA 1SXDA 2ALZA 1WWUA 1X9WA 1LVHA 3EPIA 2FLNA 3LYSA 2JEIA 4TUQA 2V4QA 9ICIA 2LM1A 5BPCA 3GU3A 4DL7A 5AHXA 2YMMA 2HHXA 2ZUDA 4ED0A 2MSNA 4Q43A 5DG8A 2WF7A 4UB5A 3RB6A 2ZUCA 1Q3UA 5AKHA 2BGWA 2FLPA 4BXOB 2HBMA 3IG5A 1P7DA 2DUYA 3SV3A 5H2FU 1Z00B 3TAPA 1ZYQA 8ICFA 8ICGA 2WB1C 2HHUA 5KT2A 1NZBA 4PL1A 2PI5A 1N48A 3QUCA 2WB1F 3MR5A 1U45A 2JRZA 5ALEA 1SKSA 2H5XA 5CJ7A 2NO4A 3KKAA 3JPNA 2HHQA 2HOIA 5KAIU 1DXSA 4EBDA 5KFNA 4QIWC 1QSSA 1D8LA 4P0QA 2HW3A 1ZQOA 5DQIA 3G6YA 3SV4A 1TFRA 3C2LA 4DO9A 3IM1A 7ICQA 1SWVA 4O3MA 4OJ5A 2ZG6A 1HIWA 5EE0A 3F5EA 1S97A 5K4LA 3WKCA 4PHPA 1AQ6A 3WU2U 1DRGA 3QX7A 4X5VA 1F44A 5EWEA 3LDAA 3C21A 1ZQBA 3KZIU 4FFDA 1L6NA 3QE9Y 2FMQA 1T3QA 4I2BA 1RXWA 4FZLA 1ZD3A 1X42A 4QWEA 2ZJ8A 1KBUA 2B6GA 3RBDA 1Z3EB 3J81j 4GXIA 1Q3VA 1S0OA 4EZ9A 5ALYA 1U47A 4NLBA 1KW4A 2FLLA 4DFKA 1TK0A 2XGPA 5J0OA 1JN3A 4BDPA 5DB9A 1XNSA 3CNHA 8ICJA 4I2HA 2FI1A 3AEVA 2H3IA 5KAFU 2AGPA 4TQSA 1ZQRA 2K4HA 4F93B 2C2EA 5EE9A 2JH7A 4IRDA 5ALVA 4F2RA 4R64A 4KLUA 4UW9A 4ELUA 4UB6U 3D2SA 4MHVA 1BPZA 1NKBA 5ALHA 3OGUA 3GIJA 5ALMA 1TAUA 5ALNA 4UASA 4NLCA 2ZIVB 1VDVA 4UBBA 3RRHA 4EX6A 2HHWA 4P4PA 5L9XA 2QB0B 3DV9A 3C23A 2CPRA 1OW5A 3ISBA 8ICBA 4P4MA 2BQ3A 2PFPA 4LJXA 1DK2A 4EYHB 4C4TA 1KKXA 4YR2A 8ICEA 4F4WA 3V72A 4KN7A 4MF8A 2AHOB 5DBBA 2K4EA 2XVTA 2KEYA 3ZDBA 5AKGA 4J9PA 2Y1IA 2GH1A 3RFAA 1ZQLA 4KMUA 1SIJA 8ICNA 4JK1A 1ZOLA 1L8OA 4LZDA 3NGDA 3H0LB 3SI8A 3F2BA 1BGXT 4M9GA 2VA3A 4KMOB 3UXNA 2KVCA 2IOFK 2R8JA 3BS5A 3H8SA 3HT3A 1PVPA 5J8YC 3EWAA 5J0WA 3SR6A 2E1EA 4KLEA 3RAXA 1TKDA 3Q8PB 5HHHA 4BXOA 1C20A 4CDGA 1Z00A 2AQ4A 4QZFA 2BCSA 2JEGA 2DWQA 3QUTA 3HX0A 3FYHA 5ALLA 4IL6U 5KFOA 3FC4A 1SKRA 4XRHA 3T5KA 4YD2A 2XI9A 1RQNA 4C80A 4KLIA 3PSPA 2D3DA 2DPIA 4JV1A 4O0IA 1L3TA 1A0PA 1K1QA 4KLGA 3PX4A 2DF4B 4NLGA 4ECWA 5ALPA 4ZOHC 3T3FA 4ECTA 2BR0A 4J9OA 3N7SC 2UVUA 1HUOA 2JZBA 3AQFA 4UB8U 5HHIA 3Q8LA 2C2DA 7ICPA 2LYAA 8ICQA 4F72A 5IIIA 4BJQA 1ZJMA 2OM6A 4ED1A 3K1ZA 3KFUF 1TV9A 4YQWA 5AI6A 4QZ8A 4J9LA 4XQ8A 9ICWA 4KLHA 4US8A 3Q8MA 4DS4A 2K89A 4I2JA 4KLQA 5IIMA 1KDHA 5AKJA 3ETLA 5KFSA 3Q8SB 4M9JA 2F44A 2XICA 5AKLA 3RR7A 1ZQNA 1NK0A 1JXEA 5J2IA 4B9NA 1KTQA 5L1LA 4UB3A 3UXPA 2WF9A 2FPMA 2A19A 3RB0A 9ICUA 1BPEA 5J29A 1MA7A 1JROA 1COOA 4ED8A 4CF5A 3UQ0A 4BUGA 4MFAA 2W43A 1ZD2P 4RT3A 4KX5A 2EZXA 1URJA 1KLNA 5KFDA 3MR3A 4NLNA 4DQIA 2ZJAA 1NK7A 4UAUA 5HMMA 2ZIVA 4PPXA 1N63A 2KJ9A 2QARB 3ZDEA 3NVYA 4EYIB 5L1IA 5KT4A 1S9FA 9ICFA 3HWTA 4DQQA 5ALGA 4J03A 1CRXA 2JV3A 1ZRNA 4Y2PA 4NV0A 1FFUA 2FPKA 1ZQYA 1NKCA 3ED5A 5HR6A 4QWBA 2OH2A 3NASA 3PV8A 4NLZA 4Y2TA 2E8MA 4IQUA 2CN1A 3RH6A 1NJZA 1ZQFA 3MFHA 2P6RA 4G3IA 3H8JA 1K1SA 2ASLA 2F3NA 2ZTEA 4PHEA 7ICKA 3M8SA 3OHAA 2V9WA 5AK4A 5DLFA 2ZJ5A 4M0AA 2LMRA 2VA8A 4KTQA 3WK4A 3OJSA 2MUTA 3NUQA 4FS2A 1JX4A 2DKZA 8ICPA 4C7ZA 4QZDA 2KE7A 4FBTA 1JIHA 1UA1A 3H7IA 3OPXA 4CGZA 4ECVA 5E79U 2L5YA 7ICEA 5C0YA 2H3QA 2EZZA 2KVSA 5JU5A 2F1HA 2KJ5A 2Y9UA 4YMNA 3UMBA 3OTQA 1U9LA 2KFNA 4C8OA 4F92B 4ECUA 2YMQA 1PK3A 2B21A 4EBEA 4GC6A 3M9OB 4AYBC 2KKPA 3MBYA 3RJGA 4AYBF 4DL6A 4KLFA 2ZIXB 5ALKA 2ISOA 3F5AA 2ATLA 2EDUA 2KIWA 1TK5A 2KFZA 4DL3A 3TACB 3HKZC 8ICWA 5B66U 3PX0A 3QUQA 2DKXA 7ICIA 3F2DA 3HKZF 4Q8FA 1NI3A 4YVZA 5AICA 4C7YA 5KT3A 4PL2A 3EUB2 4FZNA 1ECWA 3SQIA 4NLKA 3I76A 9ICQA 2K60A 5F9LA 1ZQAA 5HR7A 1OXJA 1S0NA 2K4IA 4Y2YA 2H3FA 2FMSA 2AXTU 1L7NA 7ICGA 2RHFA 4Y2VA 1UA0A 3TADC 4UAZA 2KICA 4KLTA 1RM6C 4I2EA 4QWAA 2XCAA 4P0PA 4RQ3A 4QZHA 3SMVA 5KFVA 4F71A 3D2QA 1N2XA 3VC8A 4TUSA 3QU7A 4O3QA 2YB1A 9ICRA 3QU5A 5HMLA 4J9MA 3IG8A 1IG6A 3LWLA 2HBLA 1Y88A 3PW0A 5ALSA 3WK7A 2WHEA 3PMNA 1JUDA 4XA5A 1SB3C 1U4BA 3FDSA 3L4PA 1BPYA 2VA2A 3IP4B 4RUAA 4O3SA 1DOQA 3A0HU 4ELTA 1WWVA 5KFMA 1HEKA 4BWMA 4DFDA 2HI0A 2HVHA 5KT5A 2P6UA 2MAXA 4Z6CA 2ZIWB 8ICVA 2OXOA 4OCZA 4Y2UA 5CR0A 4NL9C 5KNIA 8ICXA 4GLXA 2I5HA 3MGHA 4I29A 3JPPA 2RDIA 2QARA 4I2IA 5IIJA 2QKQA 2GO7A 2AJQA 5EWGA 4F91B 4OO1J 2ESEA 3WK8A 4MEXA 4UATA 5D46A 2PFNA 5KFBA 2K8BB 3H8WA 1N56A 3H4DA 5DB7A 3DDHA 4DCCA 4DL4A 2J6TA 1KL9A 4NM2A 1UQVA 1ZQXA 3H0MB 4PHAA 2KK0A 1ZQGA 1ZQUA 4RUCA 1JI7A 1Z4OA 4RNMA 2OWOA 4DS5A 4EEYA 1NJXA 1XO1A 5ALXA 4NM1A 3RH5A 4M9HA 3G6XA 4QIWF 4FZMA 5AM3A 4A8EA 5AIBA 4ECQA 1S76D 3QZ7A 4F5OA 2ZTCA 4M04A 4QZGA 2NRTA 4YR3A 3MDCA 1N61A 3RTVA 3F53A 1PUZA 1ED1A 3ZDDA 3V7LA 2F1IA 5ALRA 1HUZA 3AN1A 5IIOA 2OHFA 4B9LA 3C1YA 2PXIA 2IMWP 2ZIXA 1LKYB 5CB1A 7ICRA 2FJ6A 4DF8A 1XO0A 5TZVA 3KHRA 2BDPA 1ZD5A 5KFLA 4OJLA 1RG6A 3RJJA 4RNOA 2W3SA 2F1JA 1X2IA 5D4BA 2XC9A 2E3TA 9ICGA 2LBOA 5KFHA 3MR6A 2ZXHA 5IILA 2ZTDA 3H0RB 1BPXA 3NRWA 2XGQA 3G6VA 4JWMA 1SL2A 3O0FA 4QZEA 5AM0A 1PVQA 5J2AA 2B0CA 4R63A 4NWIA 4DSIA 3D2NA 2I9GA 2F8LA 3SYZA 4DL5A 3K75D 3PW7A 5DB6A 3RBEA 4Z6FA 2W04A 1X6JA 4EZ6A 2W7OA 4CCHA 4M9NA 4K4GA 1SL1A 2IBKA 3CP8A 4JV0A 4O5KA 3IN5A 5J0YA 1RZTA 2DGZA 1RPLA 3FM9A 2JH1A 4DOBA 2KIVA 2W9BB 4C8KA 5J2KA 5EE3A 3VCBA 2FPLA 1X9SA 9ICNA 4F5PA 3B9JA 3U26A 3RR8A 3GIIA 4YXMA 5KFJA 3V7KA 1NK8A 3CRXA 3RH4A 2RQ5A 4DQSA 3LVVA 4DSFA 5KFKA 4F4XA 2DQNB 2IOHA 5D49A 3V6HA 2W9CA 2YMPA 1HJPA 9ICXA 2EQYA 5AM1A 2VJ4A 5J0SA 3PR5B 1YZ6A 4P4OA 4YMOA 2KKVA 4Y2JA 2PFQA 2WTFA 7ICNA 4J9QA 2M9NA 9ICJA 1RQLA 2XY6A 2QB1A 3WK6A 2HOQA 4I2CA 5AM5A 1N5WA 2ZIWA 3PSFA 3EW9A 3GIKA 3AUOA 5J0RA 2LM4A 4XUSA 3HILA 1TK8A 3I28A 1KSPA 4RQ0A 2N1RA 1N5XA 1IXRA 2WF5A 2R8KA 4KLLA 1V97A 2NRZA 2F76X 2JMGA 2Q0ZX 2LYHA 4F5QA 2HCFA 1ZQIA 3PY8A 4MFFA 5ALZA 3PVXA 4ECRA 1Z1BA 2A1JB 3PO4A 1V85A 3Q8QB 5J2HA 1WCNA 4KLJA 1SWWA 1XC9A 1CI4A 4IQTA 2PI4A 5CP2A 2XY7A 2H3VA 2HHTA 5ALQA 5BOLA 2MA1A 1DK3A 1KFTA 3GDXA 1S10A 4Q44A 4GXJA 4TURA 1WG8A 2Y1JA 9ICMA 4M47A 2BCQA 1T4GA 3H4BA 2W54A 2G06A 9ICEA 1YZ7A 4RU9A 2G07A 2ZXIA 3M8RA 1KFSA 3HP6A 1SKWA 2UVRA 2GOLA 5J2GA 4ACOA 1S8OA 4ICAA 4I27A 4C0ZA 4IRCA 2BKEA 2KTQA 3N7PD 4C4RA 4TQRA 7ICHA 2R8HA 5AI5A 2G08A 2EZYA 3PX6A 2KOBA 4AP9A 3PR4A 2WFAA 4I2FA 4ECSA 3I1YA 1LKYA 4RZRA 1X66A 4IRKA 2E8PA 4KLDA 3SZ2A 3NVWA 4O3PA 5J2CA 2I6XA 2ZIUB 2EAPA 1KN5A 3TFRA 4PH5A 1RXVA 1T7PA 1CEZA 4RQ5A 2XY5A 4M9LA 4R8UB 1FIQA 8ICOA 8ICLA 2NRXA 3PW5A 3FAHA 1L7MA 4QZ9A 1KEJA 3SEIA 2OEHA 1LB2B 1B0XA 1X9XA 5C5JA 2P35A 4F50A 3S6JA 4B9VA 4JWNA 1SV0C 2RDJA 3C28A 3HJEA 2LKYA 3MC1A 4F3OA 4I2GA 2Y0SC 5ALIA 5KFCA 4EELA 2HHSA 2QLTA 5ALFA 2Y0SF 4IS7A 3PMLA 2QB0A 4F2SA 5KFIA 1BPBA 4QZIA 2R8IA 1ZQJA 1BPDA 2XO7A 4QW9A 5KFZA 4GIBA 1VJ5A 7ICUA 3V6JA 5AKKA 4KX3A 2IHNA 5G5GA 4B6JA 5DKWA 4ZH4A 2C28A 4YR0A 4DSJA 5KG4A 3BZKA 2R18A 3JPOA 3Q8KA 2ODGA 4LZGA 1UT5A 1NZPA 1K5OA 1Q8KA 4ECZA 1ZQKA 8ICKA 2HSZA 2AH5A 5DBAA 4J9NA 3ZD9A 3EZ5A 4ED6A 1U48A 5DDMA 3C1ZA 3JPRA 5J2DA 3ETRA 5J8YA 4DLEA 2KD1A 4NXZA 3UMGA 3K1RB 5KFQA 1O03A 1QQ7A 3M9NB 3LVWA 1KFDA 2I1QA 3V7JA 2RP5A 4O3NA 1MSWD 1MQ3A 4P0QB 4DWIA 5ALUA 4LVSA 4M6WB 3GV7B 3GZFA 3THVA 2UVVA 3ZD8A 4UB2A 3KKAC 4EBCA 2W3RA 5KFFA 2IOFA 1X40A 7ICTA 3KZXA 3AMZA 2P66A 1J97A 3UQ2A 4CF4A 1V9PA 4YG2A 3MR2A 1QSLA 8ICUA 3CW2C 2BZFA 3GFKB 1ZQCA 2CXYA 5A0LA 1CUKA 1NKEA 4RPXA 1S77D 3KHGA 4RNNA 2W8KA 1COKA 5AI0A 2AQ0A 2MRLA 3L3FX 3EYZA 2W11A 4JMUA 4DOAA 7ICVA 4UAWA 2PFOA 3H8MA 2ASDA 1FEZA 2A1AA 4DFMA 1QSYA 3M7DA 5KFGA 4KN4A 7ICMA 4PZNA 3OHBA 4YD1A 1Z19A 1RYRA 5J0XA 7ICJA 1T8EA 3RJFA 2BQRA 3E0FA 3WKEA 4Q45A 1TAQA 2FDRA 1ZQQA 9ICCA 4F4ZA 4PGXA 1IIPA 2YX8A 3MDAA 4US9A 3GIMA 2D6FC 1L7PA 4RQ1A 3E58A 3JPTA 4Z6DA 3T79A 3QXGA 5DB8A 3TI0A 8ICYA 5FP0A 2W9MA 2ZIUA 3PNCA 3KD3A 1EXNA 5KFXA 4GXKA 4C4SA 3KHHA 2LPEA 1ZQ1C 4Y2SA 3B0YA 3GV5B 5AM4A 4J9RA 1T3NA 4Y2XA 1NK4A 1RDFA 4DL2A 2Y9TA 1BNPA 1Z1VA 3UMCA 2NRVA 5KT7A 5L1KA 3V6KA 5KTQA 4RQNA 2LYBA 2RRDA 4PGYA 4RQMA 4QNLA 9ICVA 5KL1B 5CRXA 2E8OA 9ICAA 1NOMA 2YQEA 3BJYA 2AGOA 5KG3A 4E0DA 3BQTA 3MGVA 1L5UA 5ALWA 4JB3A 4OJPA 3BS5B 1L3SA 5JTIA 2KP7A 2AGQA 4NJ8A 1JMSA 4O3RA 2E8NA 3PSIA 4F8RA 4USAA 5DGBA 2GLEA 1QQ5A 3BQ2A 4FO6A 2Z7JA 2YTUA 1XSPA 3MABA 1ZRMA 2YN4A 2VKQA 2E5SA 9ICLA 3PZPA 3QEAZ 7ICOA 5AI4A 2BCRA 7ICFA 2OYYA 5J2BA 2HVIA 1ZQEA 2HBJA 5KG5A 1UCVA 2WF6A 5J0TA 1UPHA 1ZQSA 4MF2A 3RB4A 5AIAA 1QLNA 5B5EU 3ZDAA 4PHDA 5DGAA 2JEJA 5KG1A 1S5LU 4HAIA 1ZETA 1L3UA 2Q4TA 4O3OA 1ZQVA 4QZAA 5KFWA 5AKYA 3C29A 3QEBZ 4M6WA 4ECYA 2KHVA 5HNKA 5JRTA 1NJWA 3BDPA 2W8LA 2JZBB 1J2MA 2DBYA 4QW8A 4EX7A 2NV3A 1B22A 3RJKA 4HYKA 4OJ6A 3KOOA 3OJUA 3ORYA 4RQ6A 3TFSA 3TKAA 4B9SA 3QU4A 4CF3A 3N97B 5DQGA 3IV6A 4DF4A 2R8GA 1B4FA 5KFUA 1ZQHA 1OUQA 3CYMA 2FE9A 3SAGA 3TANA 1ZQZA 1QQ6A 5J2JA 4QJFB 4R65A 1H38A 2C2RA 1L7OA 3TADA 4FS1A 4B9TA 1ZQWA 3T5JA 1A77A 4YCXA 4F5RA 2NYVA 4Y2QA 3BQ1A 2F2AB 5EOZA 5HP4A 2OCEA 4U7CA 1FFVA 3TAQA 3RRGA 3C5GA 1UT8A 4RQ4A 4OJOA 3ISCA 5DLGA 5ALDA 1NK6A 3D6JA 5EE1A 4EENA 5DBCA 1IM4A 2VJ5A 2WAQC 3EPGA 8ICIA 3UM9A 2WAQF 3PO5A 3HRDD 2BQUA 4C8LA 5J2EA 2J6UA 1SXEA 2M0NA 4I2AA 3T5LA 2C22A 3PW4A 4YP3A 9ICKA 1JALA 9ICOA 3WK9A 1F5SA 2J6SA 4I28A 3AU2A 5F9NA 2ES6A 4YMMA 4KLSA 2BDUA 2NO5A 1DGSA 5KFTA 2KNJA 1XSNA 4UARA 2EANA 2H3ZA 2IA6A 4KLOA 2HBKA 5KFYA 3C2KA 4NL9A 3RJHA 1ZD4A 8ICTA 4GC7A 4BX9C 3PW2A 1D8YA 1ZQDA 3B0XA 5J0UA 1PZNA 4RPZA
chains in the Genus database with same CATH topology
2HCFA 4UASA 3QU2A 2GO7A 3UMCA 4CE6A 5ALZA 1RQNA 4EX7A 2IOFA 1TE2A 5AM0A 4EEKA 4EX6A 2B0CA 3KOOA 3WK8A 4Y2RA 4UATA 5ALGA 3DV9A 4J03A 5AK5A 1ZRNA 3I76A 4Y2PA 4OD0A 5AI9A 3S6JA 3ED5A 3QU4A 4CF3A 3NASA 1SWWA 4CF4A 4G9BA 4Y2TA 5ALPA 4Y2YA 1SWVA 3DDHA 4DCCA 3MC1A 4C4TA 1QQ6A 5ALQA 4Y2VA 5ALIA 3FM9A 3WKCA 2WF8A 4EELA 2QLTA 3QNMA 5ALFA 5AI8A 5ALWA 1AQ6A 5AI0A 1Z4OA 4JB3A 3WK5A 5AKGA 2W11A 4F72A 3QX7A 5AK4A 1O08A 2NYVA 5ALXA 4Y2QA 5AKZA 3ZI4A 3U26A 4FFDA 4F71A 5ALTA 3WK4A 4GIBA 1VJ5A 5AI6A 5ALOA 1ZD3A 5AM3A 3WKDA 1X42A 1FEZA 5AKKA 3QU9A 3QU7A 5AIBA 1QQ5A 3QU5A 1ZOLA 3SD7A 5ALDA 5AKEA 3D6JA 5ALYA 5AK6A 2IOHA 3WKAA 5AKJA 4EENA 1LVHA 5ALJA 1ZRMA 2YMPA 2YN4A 2YMLA 5ALSA 3WK7A 2WHEA 2IOFK 5AKIA 1S8OA 5AM1A 5AKLA 3UMBA 2HSZA 1JUDA 3OTQA 5AK3A 2AH5A 3UM9A 5AI4A 4C4RA 5AI5A 5AHXA 3WKEA 4Y2JA 2YMMA 3CNHA 2FDRA 2YMQA 2FI1A 2YY6A 2WFAA 5AKXA 5ALRA 2MSNA 3E58A 2WF6A 2WF9A 3UMGA 1RQLA 3I1YA 2WF7A 3WK6A 4UAVA 3WK9A 1QH9A 5AIAA 1O03A 5AM5A 2HI0A 3QYPA 5ALKA 4DFDA 1QQ7A 3WKBA 3QXGA 5AKHA 5FP0A 1Z4NA 2NO5A 4OCZA 4CF5A 2I6XA 3IRUA 4HAIA 2W43A 4C4SA 3KBBA 1ZD5A 4UARA 4Y2UA 3I28A 1ZD2P 5ALVA 2WF5A 5AKYA 2PKEA 3QUTA 3QUQA 4Y2SA 1ZD4A 2HDOA 5ALUA 3L5KA 3R9KA 4UW9A 5ALLA 3QUBA 3QUCA 5AM4A 5AM2A 4Y2XA 1RDFA 5ALEA 5ALHA 5ALMA 2MU2A 4CNQA 5ALNA 4UAUA 5AICA 2NO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCF A;  4UAS A;  3QU2 A;  2GO7 A;  3UMC A;  4CE6 A;  5ALZ A;  1RQN A;  4EX7 A;  2IOF A;  1TE2 A;  5AM0 A;  4EEK A;  4EX6 A;  2B0C A;  3KOO A;  3WK8 A;  4Y2R A;  4UAT A;  5ALG A;  3DV9 A;  4J03 A;  5AK5 A;  1ZRN A;  3I76 A;  4Y2P A;  4OD0 A;  5AI9 A;  3S6J A;  3ED5 A;  3QU4 A;  4CF3 A;  3NAS A;  1SWW A;  4CF4 A;  4G9B A;  4Y2T A;  5ALP A;  4Y2Y A;  1SWV A;  3DDH A;  4DCC A;  3MC1 A;  4C4T A;  1QQ6 A;  5ALQ A;  4Y2V A;  5ALI A;  3FM9 A;  3WKC A;  2WF8 A;  4EEL A;  2QLT A;  3QNM A;  5ALF A;  5AI8 A;  5ALW A;  1AQ6 A;  5AI0 A;  1Z4O A;  4JB3 A;  3WK5 A;  5AKG A;  2W11 A;  4F72 A;  3QX7 A;  5AK4 A;  1O08 A;  2NYV A;  5ALX A;  4Y2Q A;  5AKZ A;  3ZI4 A;  3U26 A;  4FFD A;  4F71 A;  5ALT A;  3WK4 A;  4GIB A;  1VJ5 A;  5AI6 A;  5ALO A;  1ZD3 A;  5AM3 A;  3WKD A;  1X42 A;  1FEZ A;  5AKK A;  3QU9 A;  3QU7 A;  5AIB A;  1QQ5 A;  3QU5 A;  1ZOL A;  3SD7 A;  5ALD A;  5AKE A;  3D6J A;  5ALY A;  5AK6 A;  2IOH A;  3WKA A;  5AKJ A;  4EEN A;  1LVH A;  5ALJ A;  1ZRM A;  2YMP A;  2YN4 A;  2YML A;  5ALS A;  3WK7 A;  2WHE A;  2IOF K;  5AKI A;  1S8O A;  5AM1 A;  5AKL A;  3UMB A;  2HSZ A;  1JUD A;  3OTQ A;  5AK3 A;  2AH5 A;  3UM9 A;  5AI4 A;  4C4R A;  5AI5 A;  5AHX A;  3WKE A;  4Y2J A;  2YMM A;  3CNH A;  2FDR A;  2YMQ A;  2FI1 A;  2YY6 A;  2WFA A;  5AKX A;  5ALR A;  2MSN A;  3E58 A;  2WF6 A;  2WF9 A;  3UMG A;  1RQL A;  3I1Y A;  2WF7 A;  3WK6 A;  4UAV A;  3WK9 A;  1QH9 A;  5AIA A;  1O03 A;  5AM5 A;  2HI0 A;  3QYP A;  5ALK A;  4DFD A;  1QQ7 A;  3WKB A;  3QXG A;  5AKH A;  5FP0 A;  1Z4N A;  2NO5 A;  4OCZ A;  4CF5 A;  2I6X A;  3IRU A;  4HAI A;  2W43 A;  4C4S A;  3KBB A;  1ZD5 A;  4UAR A;  4Y2U A;  3I28 A;  1ZD2 P;  5ALV A;  2WF5 A;  5AKY A;  2PKE A;  3QUT A;  3QUQ A;  4Y2S A;  1ZD4 A;  2HDO A;  5ALU A;  3L5K A;  3R9K A;  4UW9 A;  5ALL A;  3QUB A;  3QUC A;  5AM4 A;  5AM2 A;  4Y2X A;  1RDF A;  5ALE A;  5ALH A;  5ALM A;  2MU2 A;  4CNQ A;  5ALN A;  4UAU A;  5AIC A;  2NO4 A; 
#chains in the Genus database with same CATH topology
 4GFJ A;  5GTI U;  3QU2 A;  2W55 A;  1TE2 A;  1IV8 A;  2PMZ C;  2BPF A;  4Y2R A;  2PMZ F;  4ED3 A;  4RQ2 A;  5AI9 A;  3UXO A;  4G9B A;  8ICC A;  2MUT B;  5DG9 A;  2KV2 A;  1BNO A;  1N62 A;  2A3V A;  7ICS A;  1PVR A;  4B9M A;  1D9D A;  4BGD A;  1ZXI A;  2DFL A;  3RJE A;  1SGG A;  4TUP A;  5G5H A;  2RLT A;  4YXJ A;  3LWM A;  5AKZ A;  5KG6 A;  2O6K A;  4DFP A;  3QZ8 A;  3WKD A;  3QU9 A;  3C2M A;  4P2H A;  5L1M A;  4UBC A;  2BCU A;  5IIN A;  3GV8 B;  5AKE A;  4DQR A;  2EAO A;  5AK6 A;  1L8L A;  4KIT B;  1MQ2 A;  1D9F A;  1J2N A;  5DG7 A;  1L3V A;  2JXJ A;  1F0M A;  4C8M A;  9ICH A;  5AKX A;  4O5C A;  3T5H A;  3BQ7 A;  4UQG A;  2JR5 A;  1KQQ A;  3ZDC A;  4DSL A;  5KFA A;  4DFJ A;  3Q8R B;  2KZZ A;  3WKB A;  1NK5 A;  1X6I A;  3AQE A;  2KZ3 A;  2W03 A;  3HPO A;  2FMP A;  4J9K A;  3M6K A;  2PKE A;  2HDO A;  3R9K A;  3MGI A;  5AM2 A;  4I2D A;  1ARO P;  4WJ3 B;  2MU2 A;  4CNQ A;  2KSO B;  5L1J A;  1XWL A;  3H40 A;  4CE6 A;  4IR9 A;  1SZH A;  3PST A;  4DQP A;  1PK1 B;  4DEZ A;  4J9S A;  5KFE A;  5AK5 A;  5CEH A;  5EWF A;  4P0P B;  8ICH A;  1XU4 A;  1XSL A;  2ISP A;  4NY8 A;  2XCP A;  2HMX A;  5KFP A;  2KHQ A;  3K4G A;  2EAM A;  1MC8 A;  3M9M B;  1RYS A;  1MN8 A;  3M1Y A;  4Z6E A;  2D8C A;  1U49 A;  2WF8 A;  4YFK A;  5KL8 B;  3QNM A;  3GIL A;  3SAH A;  5AI8 A;  7ICL A;  1TAM A;  9ICP A;  3ISD A;  1JRP A;  3KHL A;  4ELV A;  4RQ8 A;  5GTH U;  4DSE A;  3NVZ A;  2BPG A;  1YT3 A;  3ICX A;  2K8A A;  3HW8 A;  1ZQM A;  1BVS A;  3BQ0 A;  3ONN A;  3TAR A;  5CWR A;  1WUD A;  2W9B A;  5ALJ A;  4F4K A;  4FBU A;  2E1F A;  3BZC A;  5AKI A;  2ZUB A;  5T14 A;  9ICS A;  5KFR A;  1XS9 D;  3RAQ A;  2LI6 A;  2GWS A;  2VAN A;  1V38 A;  1A6S A;  3AM9 A;  4KLM A;  4F4Y A;  3NTU A;  1GO3 F;  4UAV A;  1DGJ A;  4F5N A;  4UB1 A;  1S0V A;  3TQ1 A;  2BPC A;  3QYP A;  3UPQ A;  8ICS A;  2G5H B;  3IRU A;  1N60 A;  4R66 A;  1ZQP A;  4YN4 A;  3KBB A;  4QWC A;  2KN7 A;  2EH9 A;  5DDY A;  2ASJ A;  4O5E A;  1QCK A;  8ICM A;  1X9M A;  5CHG A;  1WCL A;  4JUZ A;  3IDW A;  2F8K A;  1UHU A;  2DL0 A;  5J0Q A;  4IQW A;  3ALR A;  4ED2 A;  1FO4 A;  5F3X B;  4RPY A;  5J2F A;  4EEK A;  3NVV A;  2G5I B;  3NRZ A;  4RQ7 A;  4U6P A;  1ZJN A;  1ZQT A;  4OD0 A;  2KJ8 A;  4IR1 A;  1SZP A;  4QWD A;  2KZM A;  2BCV A;  3E2E A;  3RB3 A;  1NNL A;  3DEE A;  1NK9 A;  4IQV A;  3JPS A;  2K8C B;  2JHD A;  2NRW A;  2JGA A;  2A1J A;  3SEN A;  5TIS U;  1M6Y A;  3M6Z A;  4UB4 A;  4M2Y A;  2W7P A;  3A0B U;  1T94 A;  5ALT A;  3KTQ A;  1NJY A;  5ALO A;  2JEF A;  3NS1 A;  4IC9 A;  4ED7 A;  1D8B A;  3SD7 A;  1S0M A;  5JUM A;  4DSK A;  3LK9 A;  2KMD A;  3WKA A;  3GQC A;  2YML A;  8ICR A;  8ICZ A;  5KG0 A;  1RYU A;  5AK3 A;  4PZO A;  1Q46 A;  8ICA A;  4B9U A;  4JV2 A;  4K4H A;  2HHV A;  2YY6 A;  3N7R C;  1WYG A;  3AU6 A;  2G09 A;  4PGQ A;  2AU0 A;  1QH9 A;  4ECX A;  3OSP A;  1Z4N A;  3AL0 B;  4O9M A;  3JPQ A;  2HOF A;  1A76 A;  4FE3 A;  4QZC A;  5J0P A;  3OSN A;  2XID A;  1LV5 A;  1JXL A;  3L5K A;  3QUB A;  4C8N A;  2KSO A;  3RJI A;  2IHM A;  5KG2 A;  3C5F A;  5CA7 A;  5KT6 A;  3MFI A;  1PK1 A;  2DPJ A;  9ICB A;  5IIK A;  1KRP A;  1B43 A;  4DOC A;  4K4I A;  2YB4 A;  1C7Y A;  4Q8E A;  2VIX A;  1SV0 A;  2UVW A;  2F77 X;  4R8U A;  4UAY A;  5KG7 A;  3IHQ B;  2K4P A;  2KG5 A;  3N28 A;  4PJ0 U;  3WK5 A;  4DLG A;  2W9C B;  2V4R A;  4CRX A;  2CRX A;  5BOM A;  1O08 A;  1VLB A;  3BS7 A;  3N4M B;  1SV4 A;  2BHN A;  3ZI4 A;  4MFC A;  5DQH A;  1TVA A;  4BWJ A;  3F2C A;  4MEY A;  3RF9 A;  2LHT A;  3SAF A;  1SL0 A;  2G0A A;  4RT2 A;  4QZB A;  9ICT A;  2W9A A;  1QTM A;  1SXD A;  2ALZ A;  1WWU A;  1X9W A;  1LVH A;  3EPI A;  2FLN A;  3LYS A;  2JEI A;  4TUQ A;  2V4Q A;  9ICI A;  2LM1 A;  5BPC A;  3GU3 A;  4DL7 A;  5AHX A;  2YMM A;  2HHX A;  2ZUD A;  4ED0 A;  2MSN A;  4Q43 A;  5DG8 A;  2WF7 A;  4UB5 A;  3RB6 A;  2ZUC A;  1Q3U A;  5AKH A;  2BGW A;  2FLP A;  4BXO B;  2HBM A;  3IG5 A;  1P7D A;  2DUY A;  3SV3 A;  5H2F U;  1Z00 B;  3TAP A;  1ZYQ A;  8ICF A;  8ICG A;  2WB1 C;  2HHU A;  5KT2 A;  1NZB A;  4PL1 A;  2PI5 A;  1N48 A;  3QUC A;  2WB1 F;  3MR5 A;  1U45 A;  2JRZ A;  5ALE A;  1SKS A;  2H5X A;  5CJ7 A;  2NO4 A;  3KKA A;  3JPN A;  2HHQ A;  2HOI A;  5KAI U;  1DXS A;  4EBD A;  5KFN A;  4QIW C;  1QSS A;  1D8L A;  4P0Q A;  2HW3 A;  1ZQO A;  5DQI A;  3G6Y A;  3SV4 A;  1TFR A;  3C2L A;  4DO9 A;  3IM1 A;  7ICQ A;  1SWV A;  4O3M A;  4OJ5 A;  2ZG6 A;  1HIW A;  5EE0 A;  3F5E A;  1S97 A;  5K4L A;  3WKC A;  4PHP A;  1AQ6 A;  3WU2 U;  1DRG A;  3QX7 A;  4X5V A;  1F44 A;  5EWE A;  3LDA A;  3C21 A;  1ZQB A;  3KZI U;  4FFD A;  1L6N A;  3QE9 Y;  2FMQ A;  1T3Q A;  4I2B A;  1RXW A;  4FZL A;  1ZD3 A;  1X42 A;  4QWE A;  2ZJ8 A;  1KBU A;  2B6G A;  3RBD A;  1Z3E B;  3J81 j;  4GXI A;  1Q3V A;  1S0O A;  4EZ9 A;  5ALY A;  1U47 A;  4NLB A;  1KW4 A;  2FLL A;  4DFK A;  1TK0 A;  2XGP A;  5J0O A;  1JN3 A;  4BDP A;  5DB9 A;  1XNS A;  3CNH A;  8ICJ A;  4I2H A;  2FI1 A;  3AEV A;  2H3I A;  5KAF U;  2AGP A;  4TQS A;  1ZQR A;  2K4H A;  4F93 B;  2C2E A;  5EE9 A;  2JH7 A;  4IRD A;  5ALV A;  4F2R A;  4R64 A;  4KLU A;  4UW9 A;  4ELU A;  4UB6 U;  3D2S A;  4MHV A;  1BPZ A;  1NKB A;  5ALH A;  3OGU A;  3GIJ A;  5ALM A;  1TAU A;  5ALN A;  4UAS A;  4NLC A;  2ZIV B;  1VDV A;  4UBB A;  3RRH A;  4EX6 A;  2HHW A;  4P4P A;  5L9X A;  2QB0 B;  3DV9 A;  3C23 A;  2CPR A;  1OW5 A;  3ISB A;  8ICB A;  4P4M A;  2BQ3 A;  2PFP A;  4LJX A;  1DK2 A;  4EYH B;  4C4T A;  1KKX A;  4YR2 A;  8ICE A;  4F4W A;  3V72 A;  4KN7 A;  4MF8 A;  2AHO B;  5DBB A;  2K4E A;  2XVT A;  2KEY A;  3ZDB A;  5AKG A;  4J9P A;  2Y1I A;  2GH1 A;  3RFA A;  1ZQL A;  4KMU A;  1SIJ A;  8ICN A;  4JK1 A;  1ZOL A;  1L8O A;  4LZD A;  3NGD A;  3H0L B;  3SI8 A;  3F2B A;  1BGX T;  4M9G A;  2VA3 A;  4KMO B;  3UXN A;  2KVC A;  2IOF K;  2R8J A;  3BS5 A;  3H8S A;  3HT3 A;  1PVP A;  5J8Y C;  3EWA A;  5J0W A;  3SR6 A;  2E1E A;  4KLE A;  3RAX A;  1TKD A;  3Q8P B;  5HHH A;  4BXO A;  1C20 A;  4CDG A;  1Z00 A;  2AQ4 A;  4QZF A;  2BCS A;  2JEG A;  2DWQ A;  3QUT A;  3HX0 A;  3FYH A;  5ALL A;  4IL6 U;  5KFO A;  3FC4 A;  1SKR A;  4XRH A;  3T5K A;  4YD2 A;  2XI9 A;  1RQN A;  4C80 A;  4KLI A;  3PSP A;  2D3D A;  2DPI A;  4JV1 A;  4O0I A;  1L3T A;  1A0P A;  1K1Q A;  4KLG A;  3PX4 A;  2DF4 B;  4NLG A;  4ECW A;  5ALP A;  4ZOH C;  3T3F A;  4ECT A;  2BR0 A;  4J9O A;  3N7S C;  2UVU A;  1HUO A;  2JZB A;  3AQF A;  4UB8 U;  5HHI A;  3Q8L A;  2C2D A;  7ICP A;  2LYA A;  8ICQ A;  4F72 A;  5III A;  4BJQ A;  1ZJM A;  2OM6 A;  4ED1 A;  3K1Z A;  3KFU F;  1TV9 A;  4YQW A;  5AI6 A;  4QZ8 A;  4J9L A;  4XQ8 A;  9ICW A;  4KLH A;  4US8 A;  3Q8M A;  4DS4 A;  2K89 A;  4I2J A;  4KLQ A;  5IIM A;  1KDH A;  5AKJ A;  3ETL A;  5KFS A;  3Q8S B;  4M9J A;  2F44 A;  2XIC A;  5AKL A;  3RR7 A;  1ZQN A;  1NK0 A;  1JXE A;  5J2I A;  4B9N A;  1KTQ A;  5L1L A;  4UB3 A;  3UXP A;  2WF9 A;  2FPM A;  2A19 A;  3RB0 A;  9ICU A;  1BPE A;  5J29 A;  1MA7 A;  1JRO A;  1COO A;  4ED8 A;  4CF5 A;  3UQ0 A;  4BUG A;  4MFA A;  2W43 A;  1ZD2 P;  4RT3 A;  4KX5 A;  2EZX A;  1URJ A;  1KLN A;  5KFD A;  3MR3 A;  4NLN A;  4DQI A;  2ZJA A;  1NK7 A;  4UAU A;  5HMM A;  2ZIV A;  4PPX A;  1N63 A;  2KJ9 A;  2QAR B;  3ZDE A;  3NVY A;  4EYI B;  5L1I A;  5KT4 A;  1S9F A;  9ICF A;  3HWT A;  4DQQ A;  5ALG A;  4J03 A;  1CRX A;  2JV3 A;  1ZRN A;  4Y2P A;  4NV0 A;  1FFU A;  2FPK A;  1ZQY A;  1NKC A;  3ED5 A;  5HR6 A;  4QWB A;  2OH2 A;  3NAS A;  3PV8 A;  4NLZ A;  4Y2T A;  2E8M A;  4IQU A;  2CN1 A;  3RH6 A;  1NJZ A;  1ZQF A;  3MFH A;  2P6R A;  4G3I A;  3H8J A;  1K1S A;  2ASL A;  2F3N A;  2ZTE A;  4PHE A;  7ICK A;  3M8S A;  3OHA A;  2V9W A;  5AK4 A;  5DLF A;  2ZJ5 A;  4M0A A;  2LMR A;  2VA8 A;  4KTQ A;  3WK4 A;  3OJS A;  2MUT A;  3NUQ A;  4FS2 A;  1JX4 A;  2DKZ A;  8ICP A;  4C7Z A;  4QZD A;  2KE7 A;  4FBT A;  1JIH A;  1UA1 A;  3H7I A;  3OPX A;  4CGZ A;  4ECV A;  5E79 U;  2L5Y A;  7ICE A;  5C0Y A;  2H3Q A;  2EZZ A;  2KVS A;  5JU5 A;  2F1H A;  2KJ5 A;  2Y9U A;  4YMN A;  3UMB A;  3OTQ A;  1U9L A;  2KFN A;  4C8O A;  4F92 B;  4ECU A;  2YMQ A;  1PK3 A;  2B21 A;  4EBE A;  4GC6 A;  3M9O B;  4AYB C;  2KKP A;  3MBY A;  3RJG A;  4AYB F;  4DL6 A;  4KLF A;  2ZIX B;  5ALK A;  2ISO A;  3F5A A;  2ATL A;  2EDU A;  2KIW A;  1TK5 A;  2KFZ A;  4DL3 A;  3TAC B;  3HKZ C;  8ICW A;  5B66 U;  3PX0 A;  3QUQ A;  2DKX A;  7ICI A;  3F2D A;  3HKZ F;  4Q8F A;  1NI3 A;  4YVZ A;  5AIC A;  4C7Y A;  5KT3 A;  4PL2 A;  3EUB 2;  4FZN A;  1ECW A;  3SQI A;  4NLK A;  3I76 A;  9ICQ A;  2K60 A;  5F9L A;  1ZQA A;  5HR7 A;  1OXJ A;  1S0N A;  2K4I A;  4Y2Y A;  2H3F A;  2FMS A;  2AXT U;  1L7N A;  7ICG A;  2RHF A;  4Y2V A;  1UA0 A;  3TAD C;  4UAZ A;  2KIC A;  4KLT A;  1RM6 C;  4I2E A;  4QWA A;  2XCA A;  4P0P A;  4RQ3 A;  4QZH A;  3SMV A;  5KFV A;  4F71 A;  3D2Q A;  1N2X A;  3VC8 A;  4TUS A;  3QU7 A;  4O3Q A;  2YB1 A;  9ICR A;  3QU5 A;  5HML A;  4J9M A;  3IG8 A;  1IG6 A;  3LWL A;  2HBL A;  1Y88 A;  3PW0 A;  5ALS A;  3WK7 A;  2WHE A;  3PMN A;  1JUD A;  4XA5 A;  1SB3 C;  1U4B A;  3FDS A;  3L4P A;  1BPY A;  2VA2 A;  3IP4 B;  4RUA A;  4O3S A;  1DOQ A;  3A0H U;  4ELT A;  1WWV A;  5KFM A;  1HEK A;  4BWM A;  4DFD A;  2HI0 A;  2HVH A;  5KT5 A;  2P6U A;  2MAX A;  4Z6C A;  2ZIW B;  8ICV A;  2OXO A;  4OCZ A;  4Y2U A;  5CR0 A;  4NL9 C;  5KNI A;  8ICX A;  4GLX A;  2I5H A;  3MGH A;  4I29 A;  3JPP A;  2RDI A;  2QAR A;  4I2I A;  5IIJ A;  2QKQ A;  2GO7 A;  2AJQ A;  5EWG A;  4F91 B;  4OO1 J;  2ESE A;  3WK8 A;  4MEX A;  4UAT A;  5D46 A;  2PFN A;  5KFB A;  2K8B B;  3H8W A;  1N56 A;  3H4D A;  5DB7 A;  3DDH A;  4DCC A;  4DL4 A;  2J6T A;  1KL9 A;  4NM2 A;  1UQV A;  1ZQX A;  3H0M B;  4PHA A;  2KK0 A;  1ZQG A;  1ZQU A;  4RUC A;  1JI7 A;  1Z4O A;  4RNM A;  2OWO A;  4DS5 A;  4EEY A;  1NJX A;  1XO1 A;  5ALX A;  4NM1 A;  3RH5 A;  4M9H A;  3G6X A;  4QIW F;  4FZM A;  5AM3 A;  4A8E A;  5AIB A;  4ECQ A;  1S76 D;  3QZ7 A;  4F5O A;  2ZTC A;  4M04 A;  4QZG A;  2NRT A;  4YR3 A;  3MDC A;  1N61 A;  3RTV A;  3F53 A;  1PUZ A;  1ED1 A;  3ZDD A;  3V7L A;  2F1I A;  5ALR A;  1HUZ A;  3AN1 A;  5IIO A;  2OHF A;  4B9L A;  3C1Y A;  2PXI A;  2IMW P;  2ZIX A;  1LKY B;  5CB1 A;  7ICR A;  2FJ6 A;  4DF8 A;  1XO0 A;  5TZV A;  3KHR A;  2BDP A;  1ZD5 A;  5KFL A;  4OJL A;  1RG6 A;  3RJJ A;  4RNO A;  2W3S A;  2F1J A;  1X2I A;  5D4B A;  2XC9 A;  2E3T A;  9ICG A;  2LBO A;  5KFH A;  3MR6 A;  2ZXH A;  5IIL A;  2ZTD A;  3H0R B;  1BPX A;  3NRW A;  2XGQ A;  3G6V A;  4JWM A;  1SL2 A;  3O0F A;  4QZE A;  5AM0 A;  1PVQ A;  5J2A A;  2B0C A;  4R63 A;  4NWI A;  4DSI A;  3D2N A;  2I9G A;  2F8L A;  3SYZ A;  4DL5 A;  3K75 D;  3PW7 A;  5DB6 A;  3RBE A;  4Z6F A;  2W04 A;  1X6J A;  4EZ6 A;  2W7O A;  4CCH A;  4M9N A;  4K4G A;  1SL1 A;  2IBK A;  3CP8 A;  4JV0 A;  4O5K A;  3IN5 A;  5J0Y A;  1RZT A;  2DGZ A;  1RPL A;  3FM9 A;  2JH1 A;  4DOB A;  2KIV A;  2W9B B;  4C8K A;  5J2K A;  5EE3 A;  3VCB A;  2FPL A;  1X9S A;  9ICN A;  4F5P A;  3B9J A;  3U26 A;  3RR8 A;  3GII A;  4YXM A;  5KFJ A;  3V7K A;  1NK8 A;  3CRX A;  3RH4 A;  2RQ5 A;  4DQS A;  3LVV A;  4DSF A;  5KFK A;  4F4X A;  2DQN B;  2IOH A;  5D49 A;  3V6H A;  2W9C A;  2YMP A;  1HJP A;  9ICX A;  2EQY A;  5AM1 A;  2VJ4 A;  5J0S A;  3PR5 B;  1YZ6 A;  4P4O A;  4YMO A;  2KKV A;  4Y2J A;  2PFQ A;  2WTF A;  7ICN A;  4J9Q A;  2M9N A;  9ICJ A;  1RQL A;  2XY6 A;  2QB1 A;  3WK6 A;  2HOQ A;  4I2C A;  5AM5 A;  1N5W A;  2ZIW A;  3PSF A;  3EW9 A;  3GIK A;  3AUO A;  5J0R A;  2LM4 A;  4XUS A;  3HIL A;  1TK8 A;  3I28 A;  1KSP A;  4RQ0 A;  2N1R A;  1N5X A;  1IXR A;  2WF5 A;  2R8K A;  4KLL A;  1V97 A;  2NRZ A;  2F76 X;  2JMG A;  2Q0Z X;  2LYH A;  4F5Q A;  2HCF A;  1ZQI A;  3PY8 A;  4MFF A;  5ALZ A;  3PVX A;  4ECR A;  1Z1B A;  2A1J B;  3PO4 A;  1V85 A;  3Q8Q B;  5J2H A;  1WCN A;  4KLJ A;  1SWW A;  1XC9 A;  1CI4 A;  4IQT A;  2PI4 A;  5CP2 A;  2XY7 A;  2H3V A;  2HHT A;  5ALQ A;  5BOL A;  2MA1 A;  1DK3 A;  1KFT A;  3GDX A;  1S10 A;  4Q44 A;  4GXJ A;  4TUR A;  1WG8 A;  2Y1J A;  9ICM A;  4M47 A;  2BCQ A;  1T4G A;  3H4B A;  2W54 A;  2G06 A;  9ICE A;  1YZ7 A;  4RU9 A;  2G07 A;  2ZXI A;  3M8R A;  1KFS A;  3HP6 A;  1SKW A;  2UVR A;  2GOL A;  5J2G A;  4ACO A;  1S8O A;  4ICA A;  4I27 A;  4C0Z A;  4IRC A;  2BKE A;  2KTQ A;  3N7P D;  4C4R A;  4TQR A;  7ICH A;  2R8H A;  5AI5 A;  2G08 A;  2EZY A;  3PX6 A;  2KOB A;  4AP9 A;  3PR4 A;  2WFA A;  4I2F A;  4ECS A;  3I1Y A;  1LKY A;  4RZR A;  1X66 A;  4IRK A;  2E8P A;  4KLD A;  3SZ2 A;  3NVW A;  4O3P A;  5J2C A;  2I6X A;  2ZIU B;  2EAP A;  1KN5 A;  3TFR A;  4PH5 A;  1RXV A;  1T7P A;  1CEZ A;  4RQ5 A;  2XY5 A;  4M9L A;  4R8U B;  1FIQ A;  8ICO A;  8ICL A;  2NRX A;  3PW5 A;  3FAH A;  1L7M A;  4QZ9 A;  1KEJ A;  3SEI A;  2OEH A;  1LB2 B;  1B0X A;  1X9X A;  5C5J A;  2P35 A;  4F50 A;  3S6J A;  4B9V A;  4JWN A;  1SV0 C;  2RDJ A;  3C28 A;  3HJE A;  2LKY A;  3MC1 A;  4F3O A;  4I2G A;  2Y0S C;  5ALI A;  5KFC A;  4EEL A;  2HHS A;  2QLT A;  5ALF A;  2Y0S F;  4IS7 A;  3PML A;  2QB0 A;  4F2S A;  5KFI A;  1BPB A;  4QZI A;  2R8I A;  1ZQJ A;  1BPD A;  2XO7 A;  4QW9 A;  5KFZ A;  4GIB A;  1VJ5 A;  7ICU A;  3V6J A;  5AKK A;  4KX3 A;  2IHN A;  5G5G A;  4B6J A;  5DKW A;  4ZH4 A;  2C28 A;  4YR0 A;  4DSJ A;  5KG4 A;  3BZK A;  2R18 A;  3JPO A;  3Q8K A;  2ODG A;  4LZG A;  1UT5 A;  1NZP A;  1K5O A;  1Q8K A;  4ECZ A;  1ZQK A;  8ICK A;  2HSZ A;  2AH5 A;  5DBA A;  4J9N A;  3ZD9 A;  3EZ5 A;  4ED6 A;  1U48 A;  5DDM A;  3C1Z A;  3JPR A;  5J2D A;  3ETR A;  5J8Y A;  4DLE A;  2KD1 A;  4NXZ A;  3UMG A;  3K1R B;  5KFQ A;  1O03 A;  1QQ7 A;  3M9N B;  3LVW A;  1KFD A;  2I1Q A;  3V7J A;  2RP5 A;  4O3N A;  1MSW D;  1MQ3 A;  4P0Q B;  4DWI A;  5ALU A;  4LVS A;  4M6W B;  3GV7 B;  3GZF A;  3THV A;  2UVV A;  3ZD8 A;  4UB2 A;  3KKA C;  4EBC A;  2W3R A;  5KFF A;  2IOF A;  1X40 A;  7ICT A;  3KZX A;  3AMZ A;  2P66 A;  1J97 A;  3UQ2 A;  4CF4 A;  1V9P A;  4YG2 A;  3MR2 A;  1QSL A;  8ICU A;  3CW2 C;  2BZF A;  3GFK B;  1ZQC A;  2CXY A;  5A0L A;  1CUK A;  1NKE A;  4RPX A;  1S77 D;  3KHG A;  4RNN A;  2W8K A;  1COK A;  5AI0 A;  2AQ0 A;  2MRL A;  3L3F X;  3EYZ A;  2W11 A;  4JMU A;  4DOA A;  7ICV A;  4UAW A;  2PFO A;  3H8M A;  2ASD A;  1FEZ A;  2A1A A;  4DFM A;  1QSY A;  3M7D A;  5KFG A;  4KN4 A;  7ICM A;  4PZN A;  3OHB A;  4YD1 A;  1Z19 A;  1RYR A;  5J0X A;  7ICJ A;  1T8E A;  3RJF A;  2BQR A;  3E0F A;  3WKE A;  4Q45 A;  1TAQ A;  2FDR A;  1ZQQ A;  9ICC A;  4F4Z A;  4PGX A;  1IIP A;  2YX8 A;  3MDA A;  4US9 A;  3GIM A;  2D6F C;  1L7P A;  4RQ1 A;  3E58 A;  3JPT A;  4Z6D A;  3T79 A;  3QXG A;  5DB8 A;  3TI0 A;  8ICY A;  5FP0 A;  2W9M A;  2ZIU A;  3PNC A;  3KD3 A;  1EXN A;  5KFX A;  4GXK A;  4C4S A;  3KHH A;  2LPE A;  1ZQ1 C;  4Y2S A;  3B0Y A;  3GV5 B;  5AM4 A;  4J9R A;  1T3N A;  4Y2X A;  1NK4 A;  1RDF A;  4DL2 A;  2Y9T A;  1BNP A;  1Z1V A;  3UMC A;  2NRV A;  5KT7 A;  5L1K A;  3V6K A;  5KTQ A;  4RQN A;  2LYB A;  2RRD A;  4PGY A;  4RQM A;  4QNL A;  9ICV A;  5KL1 B;  5CRX A;  2E8O A;  9ICA A;  1NOM A;  2YQE A;  3BJY A;  2AGO A;  5KG3 A;  4E0D A;  3BQT A;  3MGV A;  1L5U A;  5ALW A;  4JB3 A;  4OJP A;  3BS5 B;  1L3S A;  5JTI A;  2KP7 A;  2AGQ A;  4NJ8 A;  1JMS A;  4O3R A;  2E8N A;  3PSI A;  4F8R A;  4USA A;  5DGB A;  2GLE A;  1QQ5 A;  3BQ2 A;  4FO6 A;  2Z7J A;  2YTU A;  1XSP A;  3MAB A;  1ZRM A;  2YN4 A;  2VKQ A;  2E5S A;  9ICL A;  3PZP A;  3QEA Z;  7ICO A;  5AI4 A;  2BCR A;  7ICF A;  2OYY A;  5J2B A;  2HVI A;  1ZQE A;  2HBJ A;  5KG5 A;  1UCV A;  2WF6 A;  5J0T A;  1UPH A;  1ZQS A;  4MF2 A;  3RB4 A;  5AIA A;  1QLN A;  5B5E U;  3ZDA A;  4PHD A;  5DGA A;  2JEJ A;  5KG1 A;  1S5L U;  4HAI A;  1ZET A;  1L3U A;  2Q4T A;  4O3O A;  1ZQV A;  4QZA A;  5KFW A;  5AKY A;  3C29 A;  3QEB Z;  4M6W A;  4ECY A;  2KHV A;  5HNK A;  5JRT A;  1NJW A;  3BDP A;  2W8L A;  2JZB B;  1J2M A;  2DBY A;  4QW8 A;  4EX7 A;  2NV3 A;  1B22 A;  3RJK A;  4HYK A;  4OJ6 A;  3KOO A;  3OJU A;  3ORY A;  4RQ6 A;  3TFS A;  3TKA A;  4B9S A;  3QU4 A;  4CF3 A;  3N97 B;  5DQG A;  3IV6 A;  4DF4 A;  2R8G A;  1B4F A;  5KFU A;  1ZQH A;  1OUQ A;  3CYM A;  2FE9 A;  3SAG A;  3TAN A;  1ZQZ A;  1QQ6 A;  5J2J A;  4QJF B;  4R65 A;  1H38 A;  2C2R A;  1L7O A;  3TAD A;  4FS1 A;  4B9T A;  1ZQW A;  3T5J A;  1A77 A;  4YCX A;  4F5R A;  2NYV A;  4Y2Q A;  3BQ1 A;  2F2A B;  5EOZ A;  5HP4 A;  2OCE A;  4U7C A;  1FFV A;  3TAQ A;  3RRG A;  3C5G A;  1UT8 A;  4RQ4 A;  4OJO A;  3ISC A;  5DLG A;  5ALD A;  1NK6 A;  3D6J A;  5EE1 A;  4EEN A;  5DBC A;  1IM4 A;  2VJ5 A;  2WAQ C;  3EPG A;  8ICI A;  3UM9 A;  2WAQ F;  3PO5 A;  3HRD D;  2BQU A;  4C8L A;  5J2E A;  2J6U A;  1SXE A;  2M0N A;  4I2A A;  3T5L A;  2C22 A;  3PW4 A;  4YP3 A;  9ICK A;  1JAL A;  9ICO A;  3WK9 A;  1F5S A;  2J6S A;  4I28 A;  3AU2 A;  5F9N A;  2ES6 A;  4YMM A;  4KLS A;  2BDU A;  2NO5 A;  1DGS A;  5KFT A;  2KNJ A;  1XSN A;  4UAR A;  2EAN A;  2H3Z A;  2IA6 A;  4KLO A;  2HBK A;  5KFY A;  3C2K A;  4NL9 A;  3RJH A;  1ZD4 A;  8ICT A;  4GC7 A;  4BX9 C;  3PW2 A;  1D8Y A;  1ZQD A;  3B0X A;  5J0U A;  1PZN A;  4RPZ A; 
#chains in the Genus database with same CATH homology
 2HCF A;  4UAS A;  3QU2 A;  2GO7 A;  3UMC A;  4CE6 A;  5ALZ A;  1RQN A;  4EX7 A;  2IOF A;  1TE2 A;  5AM0 A;  4EEK A;  4EX6 A;  2B0C A;  3KOO A;  3WK8 A;  4Y2R A;  4UAT A;  5ALG A;  3DV9 A;  4J03 A;  5AK5 A;  1ZRN A;  3I76 A;  4Y2P A;  4OD0 A;  5AI9 A;  3S6J A;  3ED5 A;  3QU4 A;  4CF3 A;  3NAS A;  1SWW A;  4CF4 A;  4G9B A;  4Y2T A;  5ALP A;  4Y2Y A;  1SWV A;  3DDH A;  4DCC A;  3MC1 A;  4C4T A;  1QQ6 A;  5ALQ A;  4Y2V A;  5ALI A;  3FM9 A;  3WKC A;  2WF8 A;  4EEL A;  2QLT A;  3QNM A;  5ALF A;  5AI8 A;  5ALW A;  1AQ6 A;  5AI0 A;  1Z4O A;  4JB3 A;  3WK5 A;  5AKG A;  2W11 A;  4F72 A;  3QX7 A;  5AK4 A;  1O08 A;  2NYV A;  5ALX A;  4Y2Q A;  5AKZ A;  3ZI4 A;  3U26 A;  4FFD A;  4F71 A;  5ALT A;  3WK4 A;  4GIB A;  1VJ5 A;  5AI6 A;  5ALO A;  1ZD3 A;  5AM3 A;  3WKD A;  1X42 A;  1FEZ A;  5AKK A;  3QU9 A;  3QU7 A;  5AIB A;  1QQ5 A;  3QU5 A;  1ZOL A;  3SD7 A;  5ALD A;  5AKE A;  3D6J A;  5ALY A;  5AK6 A;  2IOH A;  3WKA A;  5AKJ A;  4EEN A;  1LVH A;  5ALJ A;  1ZRM A;  2YMP A;  2YN4 A;  2YML A;  5ALS A;  3WK7 A;  2WHE A;  2IOF K;  5AKI A;  1S8O A;  5AM1 A;  5AKL A;  3UMB A;  2HSZ A;  1JUD A;  3OTQ A;  5AK3 A;  2AH5 A;  3UM9 A;  5AI4 A;  4C4R A;  5AI5 A;  5AHX A;  3WKE A;  4Y2J A;  2YMM A;  3CNH A;  2FDR A;  2YMQ A;  2FI1 A;  2YY6 A;  2WFA A;  5AKX A;  5ALR A;  2MSN A;  3E58 A;  2WF6 A;  2WF9 A;  3UMG A;  1RQL A;  3I1Y A;  2WF7 A;  3WK6 A;  4UAV A;  3WK9 A;  1QH9 A;  5AIA A;  1O03 A;  5AM5 A;  2HI0 A;  3QYP A;  5ALK A;  4DFD A;  1QQ7 A;  3WKB A;  3QXG A;  5AKH A;  5FP0 A;  1Z4N A;  2NO5 A;  4OCZ A;  4CF5 A;  2I6X A;  3IRU A;  4HAI A;  2W43 A;  4C4S A;  3KBB A;  1ZD5 A;  4UAR A;  4Y2U A;  3I28 A;  1ZD2 P;  5ALV A;  2WF5 A;  5AKY A;  2PKE A;  3QUT A;  3QUQ A;  4Y2S A;  1ZD4 A;  2HDO A;  5ALU A;  3L5K A;  3R9K A;  4UW9 A;  5ALL A;  3QUB A;  3QUC A;  5AM4 A;  5AM2 A;  4Y2X A;  1RDF A;  5ALE A;  5ALH A;  5ALM A;  2MU2 A;  4CNQ A;  5ALN A;  4UAU A;  5AIC A;  2NO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...