2MU2A

Nmr structure of the cap domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
LLDSYEAILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLLVRVAEDRNLDVEVLNQVRAQSLAEKNAQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hydrolase, haloacid dehalogenase-like family
publication title J-UNIO protocol used for NMR structure determination of the 206-residue protein NP_346487.1 from Streptococcus pneumoniae TIGR4.
pubmed doi rcsb
source organism Streptococcus pneumoniae tigr4
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2mu2A00
5ALIA 3WK8A 4DFDA 4DCCA 5ALYA 3QNMA 3QU5A 2WFAA 4G9BA 4Y2TA 1ZD5A 5AKLA 5ALFA 4EELA 5AK5A 4HAIA 3IRUA 3I28A 2IOFA 3D6JA 3QUCA 5ALLA 5AI4A 1ZOLA 1JUDA 3QXGA 4UATA 5AKGA 4EX6A 2MU2A 4CF3A 1RDFA 1ZD2P 1ZRMA 3OTQA 2FI1A 3QUTA 1Z4OA 2NO4A 4J03A 3QU9A 5ALUA 3WK7A 3L5KA 1Z4NA 5AIAA 1SWVA 2WHEA 4Y2PA 5ALXA 2W43A 3I76A 3UMBA 3QYPA 1LVHA 4EEKA 3QU7A 4C4TA 4EENA 3QUQA 2HI0A 2YMPA 1QH9A 2HSZA 1RQNA 2HDOA 3UMGA 4CF4A 5ALKA 3FM9A 2WF5A 5ALZA 5ALVA 1O08A 4Y2QA 5ALMA 4Y2JA 2MSNA 3WKBA 5AK6A 3QUBA 5AKHA 5AM0A 3DV9A 3WKCA 5AM3A 4GIBA 5ALOA 4CE6A 5ALTA 5AHXA 3QU2A 5ALPA 1VJ5A 5ALSA 2YMQA 4JB3A 4Y2SA 4UAVA 2NO5A 2IOFK 2B0CA 5AM4A 3S6JA 3WKEA 3WKDA 5ALHA 5AKXA 4CNQA 2WF9A 4CF5A 1QQ7A 5ALEA 3R9KA 3KBBA 1ZD4A 3KOOA 5AIBA 1ZD3A 1O03A 3ED5A 3WKAA 5FP0A 2YMLA 2HCFA 2QLTA 5AM5A 5AI5A 1X42A 3E58A 2PKEA 1QQ5A 3WK5A 5AKJA 5AM2A 5AI8A 5AI6A 2WF7A 1ZRNA 5ALDA 4UARA 4F72A 1RQLA 5AKKA 5AICA 1SWWA 5AKIA 2YY6A 3WK9A 5ALWA 3QX7A 3WK6A 1AQ6A 5AI9A 1FEZA 2NYVA 2FDRA 4OCZA 5AKEA 2W11A 2GO7A 4UW9A 4UASA 5AI0A 4UAUA 3QU4A 5AM1A 2YMMA 2YN4A 4Y2UA 2WF8A 4Y2RA 3I1YA 1TE2A 4EX7A 5AKZA 3CNHA 3UM9A 3SD7A 5ALRA 3WK4A 4Y2YA 4OD0A 3NASA 5AKYA 5ALNA 3U26A 3ZI4A 4C4RA 4F71A 5ALQA 2I6XA 3DDHA 3MC1A 4FFDA 4Y2XA 5AK4A 5ALGA 1S8OA 2AH5A 5AK3A 1QQ6A 5ALJA 3UMCA 4C4SA 4Y2VA 2WF6A 2IOHA
chains in the Genus database with same CATH superfamily
2LYBA 5KFBA 2DF4B 2PXIA 1KEJA 3FC4A 9ICUA 4O5EA 2DPIA 1ZQVA 4HAIA 5KG3A 4YR0A 4PGYA 5KFJA 3OTQA 4MF8A 4MFFA 3M9MB 1HUZA 1QSLA 4IQVA 4M9GA 4O3MA 3ETRA 3UXNA 3H8JA 3C28A 4C0ZA 1COOA 2H5XA 1PK1A 2KHVA 3DV9A 1RYUA 2RDJA 2ODGA 3UQ2A 3ETLA 3AU2A 1CRXA 4NXZA 2ZIVA 3BZKA 3LYSA 4KLEA 3H7IA 4P4OA 2XICA 2HOFA 2HHWA 1S10A 3PO5A 4O3RA 3K75D 2HOIA 3RFAA 3C2MA 4DFMA 1GO3F 2QLTA 5KT2A 9ICIA 5HMLA 3KKAA 4F5PA 4YP3A 3H8MA 4RNMA 4Q45A 1PUZA 4Z6FA 1QQ5A 5KFIA 3ZDCA 5AKJA 4YN4A 8ICJA 1U45A 2KZ3A 1NI3A 2Y9TA 1LV5A 1VLBA 3GILA 3QX7A 2E1FA 1F44A 1FEZA 4B9SA 2E1EA 4EBCA 7ICIA 2GO7A 4UASA 5J2IA 3ZDEA 3MR6A 4Y2RA 3UPQA 1KFSA 4MEYA 4Y2YA 4QWBA 4O0IA 1JXEA 3G6YA 3F5AA 4RU9A 5CA7A 2C2EA 1MN8A 4B9TA 1XWLA 4DFDA 9ICFA 4P0QA 3WK8A 3TACB 3PNCA 3KHLA 4YVZA 1BPYA 4UB5A 3V7JA 1V9PA 4F4XA 4DSLA 2JHDA 2NRVA 5L1JA 4J9MA 2FPLA 5KT4A 2KJ5A 3MR5A 3Q8KA 5KG6A 1LKYB 4USAA 5ALUA 3FDSA 2RRDA 2EZZA 3GV7B 1LVHA 9ICKA 2KEYA 3KZXA 2PMZF 3RB4A 1FO4A 7ICLA 4J9KA 3M6KA 1ZQSA 1TK0A 4EYHB 3QEAZ 2K60A 5AK6A 4ACOA 1OXJA 2DFLA 1SV0A 4J9LA 1Q3UA 1L3SA 3ONNA 4GLXA 1OW5A 5ALHA 3EYZA 4Q43A 3M8RA 5A0LA 1N5XA 1ZQZA 2QKQA 4RQNA 4RQ0A 4ED6A 2Q0ZX 4O5CA 4PL2A 1WWVA 1ZQOA 4QZHA 1TK5A 4ECWA 2ZIUA 4X5VA 1HUOA 1X42A 3HKZC 4IR1A 4DL2A 2B21A 9ICSA 4FZLA 5J2KA 5DKWA 1L8OA 5AKKA 4RQ8A 5AICA 2ZIVB 5KFGA 4G3IA 4HYKA 1XO0A 5AM1A 2C2DA 5KFDA 3HX0A 4ECYA 2YN4A 5KFUA 2PFQA 4TURA 3HWTA 4UB2A 1BPDA 4U6PA 1T8EA 1XSNA 2QB0B 2FLPA 7ICHA 2KIVA 4RQMA 4Y2VA 2R8KA 5J2GA 7ICQA 4BXOA 2E8OA 4TQSA 3QNMA 1YZ7A 4G9BA 4RQ5A 1SKSA 3JPOA 4KMUA 1Z00A 3UQ0A 2IOFA 1URJA 5DDMA 4J9PA 3H8SA 4DLGA 5CP2A 5DB6A 3GIMA 1ZRMA 4RT2A 2G06A 3SV4A 2A1AA 2KKVA 5BPCA 3H8WA 1Z4NA 4UB6U 4UAWA 4Y2PA 2AGPA 2VJ4A 1N2XA 1S9FA 1BNOA 1X6IA 4TQRA 2ZTDA 3N7RC 4P0QB 4Y2JA 1L7NA 2AHOB 1PVQA 1AROP 5GTIU 3KD3A 1IV8A 3RAXA 1UPHA 2R8JA 3THVA 4Y2SA 4BGDA 2ZJ8A 4R66A 4JK1A 4CF5A 1QQ7A 2BQ3A 3R9KA 4F2RA 2W7OA 2F1JA 1BPZA 5IIKA 3GZFA 5HR6A 2HCFA 3RJFA 5J0OA 1BPXA 4OO1J 7ICRA 5AI5A 4ECZA 4NLKA 2W9CA 3HPOA 2XVTA 2KFZA 4B9NA 1U49A 4UB3A 3ALRA 3PZPA 3KFUF 3C5GA 4UBBA 5ALWA 1S0OA 5DBAA 5J2EA 2ZXIA 1BNPA 4ZOHC 4UBCA 1KLNA 4YD1A 1XO1A 2H3QA 3PR5B 2B6GA 2ALZA 5E79U 4UB1A 5DBCA 4C4SA 1ZQWA 4KLFA 3SAFA 3GU3A 2H3ZA 3GQCA 5EE9A 2E8NA 4F4YA 1ZQMA 5DG9A 3PVXA 5KFKA 1QSSA 8ICEA 5AK5A 4M47A 5DGBA 4M2YA 3A0HU 3ISBA 3PY8A 3BQTA 3SEIA 3H4BA 8ICUA 4ICAA 1JN3A 3VCBA 1KL9A 4NLBA 4ECTA 2BR0A 2W9BB 2PFPA 3RJIA 1JALA 1SB3C 3QU7A 1UA1A 3NTUA 3MGHA 4GC7A 1DOQA 5ALZA 5ALVA 4F91B 1O08A 4ELVA 3B9JA 3M9NB 3CYMA 1TVAA 5C5JA 4TUPA 3BDPA 5AM3A 4RNOA 3B0YA 2XGQA 3QU2A 4DF4A 3PSIA 1TV9A 3SMVA 2EDUA 1DGJA 2WF9A 3PX4A 4IRDA 2VKQA 1O03A 1MC8A 5TZVA 5J0SA 5J2JA 1D9FA 5K4LA 2P35A 5JTIA 3VC8A 3QZ8A 1LB2B 1IM4A 3V7LA 3GFKB 2WB1F 5CJ7A 4F4ZA 3PSTA 5AI8A 1RXVA 5ALDA 2G5HB 1L3VA 9ICJA 5KTQA 2M9NA 1Z1BA 3HP6A 2FLLA 3D2SA 3PW0A 2A3VA 5GTHU 7ICTA 3L3FX 1NK0A 1X9XA 5DB7A 4PHAA 2ZJAA 4BWJA 1PVRA 1U9LA 4WJ3B 5ALGA 5L1LA 1N5WA 5F3XB 2W9CB 3ZD9A 4US8A 4YQWA 5F9NA 4ED0A 2WFAA 5ALFA 4I29A 5DG7A 4I2CA 4RUAA 3SR6A 2EAPA 7ICFA 2OH2A 2W9AA 1ZQRA 3C5FA 4EZ9A 3JPRA 3IM1A 2F76X 9ICRA 2BKEA 1XSLA 5T14A 2LI6A 2ASJA 2HBJA 2YMPA 3M8SA 4O3NA 4RQ1A 3BQ7A 8ICTA 4NLZA 1NK5A 2VJ5A 5DDYA 5HP4A 3O0FA 4CE6A 2W7PA 5AHXA 2YMQA 4DWIA 5AKXA 3RH5A 3RR8A 4JMUA 3Q8LA 1ZD3A 4IRCA 1L7MA 4I2EA 1N63A 5G5GA 5JUMA 3E58A 2NRZA 9ICAA 3N7SC 4IQUA 4I2HA 8ICMA 3NVVA 3IV6A 3N7PD 5IIIA 2KZMA 4I2AA 1TFRA 4KX3A 9ICCA 4ED3A 2OXOA 4EZ6A 5DG8A 5D4BA 3HKZF 7ICJA 1KKXA 3H4DA 2RP5A 8ICNA 1S76D 8ICYA 4CCHA 4I2DA 4FBTA 4KLQA 4OD0A 1Q8KA 4F2SA 5L9XA 4F71A 3DEEA 7ICUA 3HT3A 5AK4A 3UMCA 1QQ6A 4AYBF 5KFYA 2BCUA 5KG4A 1NNLA 3IRUA 3I28A 2BGWA 4C80A 5J0YA 2AJQA 1HEKA 4A8EA 1SL1A 5BOLA 5HR7A 1NOMA 4RQ2A 4DL7A 2I1QA 9ICNA 4ECQA 4CF3A 1F0MA 4PPXA 4NJ8A 4IL6U 1UHUA 2KJ9A 4YR2A 2NO4A 3SAGA 3ZDDA 3RB0A 5L1MA 1ZQLA 1MSWD 2NV3A 2JEGA 5KG7A 4I2FA 4KLHA 3G6VA 3PW4A 3MR2A 1M6YA 8ICZA 1TK8A 5ALMA 5KFQA 1RG6A 3V72A 2ASDA 3AEVA 2QARA 2JEFA 2YB1A 2LYAA 4UAVA 4RQ4A 2P6RA 5DLFA 2XI9A 2EAMA 1TAMA 7ICMA 1NK4A 2FPKA 2Y0SC 3EUB2 4F5RA 4IR9A 2K8AA 5J2BA 1SXEA 5HMMA 3PW7A 2ZTCA 2JEJA 2Y1JA 2DGZA 5KAIU 3OPXA 3V6JA 2C28A 4DL4A 1XNSA 4NLGA 1J2NA 4QZFA 2XGPA 3Q8MA 3SZ2A 1ZQCA 4KLUA 1D8BA 3AQEA 3JPTA 1SIJA 3MGIA 8ICVA 5HNKA 5AKEA 2W8KA 1ZQFA 2FMSA 1WG8A 3MBYA 4UW9A 3N28A 3QU4A 4PGXA 4BX9C 3UM9A 2QB0A 4RQ6A 1NKBA 3FAHA 5AKYA 3NASA 4IC9A 4JV2A 8ICFA 4YMOA 1Z3EB 3K4GA 4Y2XA 8ICPA 4KLLA 1ZQQA 4B9VA 2A1JA 2XCPA 4XRHA 1ZQUA 3ZDAA 1NK7A 1DRGA 1V38A 3QU5A 4Y2TA 2VIXA 2W3RA 2O6KA 4YFKA 8ICKA 2E8PA 2YQEA 2Q4TA 4F50A 5J29A 1ZOLA 3J81j 1ZJMA 1N62A 4KLGA 4J03A 1MQ3A 3N4MB 3WK7A 3L4PA 2QB1A 2R8IA 3FYHA 2GWSA 4M9JA 3M7DA 1ZQHA 2YB4A 3EW9A 4UQGA 1SGGA 4F3OA 3MGVA 1V97A 2JGAA 2DBYA 4P0PB 2KICA 3TADC 5ALTA 5D49A 4JB3A 9ICWA 2NO5A 4ED2A 4YG2A 4RZRA 3GDXA 2HW3A 2LBOA 3TFRA 3PR4A 5J8YC 2IHMA 3RJHA 1BPBA 3N97B 2F8LA 3PW2A 3CRXA 5KFNA 1EXNA 4DS5A 3K1RB 5CRXA 5J0QA 4KLIA 2AXTU 2HBLA 4J9NA 1RPLA 3SQIA 2WF7A 1ZRNA 3RB3A 4F72A 2QARB 2NRXA 1J97A 3Q8PB 4U7CA 4F92B 4R63A 1DGSA 2ZTEA 2AQ0A 4R8UA 1J2MA 1L8LA 2ZIWB 1K1QA 5ALRA 1VDVA 2V4RA 4GXKA 2BPFA 2XCAA 1ZQNA 4FE3A 3RJEA 1L7PA 1Z1VA 4DCCA 2G5IB 4JV0A 3QZ7A 3KHGA 4QWDA 1X9SA 5AI4A 2JEIA 5H2FU 2W9BA 4FZMA 3BZCA 1T7PA 2LMRA 5KFRA 3L5KA 3SV3A 5ALXA 4IQWA 3LK9A 8ICCA 4YCXA 3QUQA 4LZDA 4B6JA 3T5HA 5J0XA 3AUOA 2HSZA 3UMGA 5ALKA 4EYIB 2A1JB 2WF5A 2IBKA 4NY8A 4Z6EA 2ZIXB 3WKBA 4DFPA 3QUBA 3JPQA 3MFIA 2BCSA 4QW8A 4O9MA 1NK8A 2OM6A 4C8LA 4KLMA 4DSFA 3WKEA 2E8MA 1IXRA 5ALEA 4JUZA 1T3QA 2A19A 2DKXA 2OEHA 2OCEA 5IINA 4KTQA 1NKEA 2HVIA 2ZXHA 3KKAC 3OJUA 2BCVA 2JH1A 5AM5A 4QZ8A 3IHQB 4QJFB 9ICOA 3RJGA 3WK5A 5JU5A 2DQNB 2R8GA 3RH4A 1SZPA 3A0BU 2V4QA 1SWWA 2KE7A 3WK9A 7ICPA 2NYVA 4C8NA 5B66U 5AI0A 1ZQTA 2YMMA 8ICAA 2HBKA 5KFAA 2KP7A 2HBMA 2KOBA 3LDAA 3NVZA 5ALNA 4UB4A 4CDGA 3DDHA 4JWMA 4EBEA 4F4KA 1PVPA 3MABA 2IOHA 3AL0B 8ICWA 4FZNA 5HHIA 2XO7A 1L6NA 2LM4A 2LKYA 3C29A 1D8YA 4P2HA 4MEXA 4R8UB 3MR3A 4KLOA 2L5YA 1UA0A 3TFSA 4KX5A 3RBDA 2W43A 3NRZA 3MDAA 9ICEA 1P7DA 3ICXA 1L3TA 4DEZA 1XS9D 4CF4A 5J0WA 4RPYA 2AQ4A 3JPNA 5EE0A 1L5UA 1C20A 5KFZA 2MSNA 1NK6A 3D2QA 2IMWP 1UCVA 3TQ1A 3WKCA 2CXYA 2EZYA 2W3SA 3H40A 3OSNA 1ZQEA 3BS7A 4P4MA 4K4GA 1CUKA 4US9A 1JROA 3F5EA 3GIJA 4DSEA 2BPGA 1ZQBA 3Q8RB 5EWEA 1ZQ1C 4RPXA 4XUSA 4DOBA 1KN5A 2Y0SF 1U47A 5AM2A 3TANA 5KFLA 5AI6A 1ZJNA 4UARA 1X9MA 4KN7A 3WK6A 4DSKA 9ICVA 4OCZA 2G09A 2FDRA 3H0RB 2PI4A 3TI0A 5J0RA 1N56A 4DQIA 4EX7A 4DQSA 2PMZC 4QZEA 2R18A 3U26A 5L1KA 2D8CA 4BWMA 3GV5B 1D9DA 3JPPA 4ELTA 1Z19A 5EOZA 2LPEA 3BQ0A 3EZ5A 7ICKA 4UB8U 2ES6A 3E2EA 1S5LU 1MA7A 3OGUA 4NM2A 1RYSA 3D6JA 1KDHA 2K4IA 9ICXA 1WUDA 4YXJA 1ZD2P 1F5SA 3QUTA 5DQIA 1Z4OA 1HIWA 3RBEA 4QIWC 3QU9A 3T3FA 1SWVA 1PZNA 4I2JA 1B0XA 4C4TA 2IA6A 2G07A 1BPEA 2I9GA 2KZZA 4CRXA 1S0MA 2VA3A 3WU2U 3PMLA 4I27A 1KSPA 4DQQA 4DS4A 5KFCA 3C2LA 2WAQC 5AKHA 2D6FC 3F2CA 5KFPA 2Y1IA 2B0CA 2BQRA 4R64A 1N60A 5KAFU 5KFEA 8ICOA 1ZD4A 1RM6C 3MDCA 5J0PA 5FP0A 2C22A 2YMLA 3NRWA 3LVWA 4DO9A 1A76A 3GIIA 2ZJ5A 4M9NA 5KFHA 2RLTA 3RH6A 5C0YA 2BDPA 1ZQAA 5KL8B 1RQLA 8ICIA 4RNNA 3SENA 1FFVA 2YY6A 1SKRA 1BVSA 5AI9A 5J0UA 2DL0A 1JIHA 1CEZA 4TUSA 2BCQA 1KW4A 2FLNA 1KFTA 1TE2A 5KT5A 2VANA 4JWNA 1WCLA 4J9SA 5EWGA 2FPMA 4B9LA 4C4RA 4PHPA 5F9LA 8ICBA 3RR7A 3C1YA 1H38A 3ZDBA 2KFNA 1RXWA 1S8OA 2K4HA 4ZH4A 2Z7JA 2KVCA 4NWIA 2AGOA 4NL9C 3T5JA 2JZBB 4Z6CA 1SL0A 5J2FA 5IILA 3NVWA 2R8HA 4EEYA 3SYZA 1RDFA 3KHRA 1D8LA 1RZTA 1S0VA 3TADA 5TISU 1ZQPA 2ZUCA 2PFNA 1Y88A 4YR3A 2WHEA 4DOCA 3UMBA 4PHEA 1T94A 4KLDA 2F3NA 4QNLA 3T79A 2HDOA 5EWFA 4QWCA 5J2HA 5J8YA 3TKAA 2JV3A 2ESEA 4P0PA 3AM9A 5DQGA 2G0AA 4OJ6A 1V85A 4IRKA 1VJ5A 3NS1A 2KSOB 5J0TA 1X6JA 5AM4A 8ICXA 4NLCA 7ICNA 5KFFA 3KOOA 4K4HA 4KLJA 4Z6DA 3PSPA 5IIMA 5KT7A 1JI7A 2MAXA 2BPCA 2F77X 4DL5A 1FFUA 2EH9A 2WTFA 3EPIA 2BDUA 4TUQA 2FE9A 4GXJA 5CHGA 3PSFA 2KKPA 2F2AB 1JX4A 2ZIWA 1SKWA 1QTMA 4KITB 3ISCA 3AU6A 1ZQYA 2WF8A 2I5HA 3BJYA 4F5OA 4F4WA 3KHHA 3SD7A 2HMXA 9ICBA 2PI5A 1PK3A 3Q8SB 2ISPA 3K1ZA 5AKLA 2OHFA 2DWQA 2ISOA 4QZGA 3V7KA 1DXSA 2UVRA 4FBUA 3QEBZ 4ED7A 1TAQA 4J9RA 3M6ZA 3QYPA 2BQUA 7ICEA 2KN7A 5DB9A 1K5OA 2ZIXA 1NKCA 1QH9A 2J6TA 1RQNA 2K4EA 2WB1C 3CP8A 1X40A 2J6SA 2KHQA 2G08A 3ORYA 4F93B 3LWLA 1JRPA 3BS5B 1MQ2A 4FS1A 4Q8EA 1ZQJA 4ECVA 1ZQXA 3G6XA 8ICQA 2MUTB 9ICTA 2JR5A 1BGXT 2NRWA 2D3DA 4CNQA 5CWRA 4M0AA 4I2BA 4C7ZA 1ZQGA 3KBBA 4UAZA 4BDPA 1T3NA 1SZHA 4O5KA 3QE9Y 4F5NA 4J9QA 1U48A 4RQ3A 1ZQDA 5KFXA 5KFSA 3SI8A 4QZAA 5L1IA 4M9HA 2DKZA 2XY7A 1NJXA 2KIWA 1U4BA 3C1ZA 4ELUA 3MFHA 5AKIA 3TARA 2Y9UA 5DGAA 4DOAA 1N48A 2ZG6A 4ECSA 3WK4A 1X66A 4QWEA 2KD1A 2LM1A 1B43A 4QZBA 4KMOB 3TAQA 3H0MB 2GH1A 2XC9A 4O3PA 2OYYA 5KFMA 1YZ6A 3V6HA 9ICGA 2NRTA 5ALYA 2K89A 1ZD5A 4GFJA 2KTQA 3RTVA 1C7YA 3QXGA 4UATA 5AKGA 2MU2A 4OJLA 2RDIA 3BQ2A 2EQYA 4I2IA 5KL1B 5KT6A 3PMNA 5KG2A 2JXJA 4EENA 2UVVA 1WYGA 2KMDA 4QIWF 2N1RA 2HOQA 3F2DA 4XQ8A 1ECWA 3PX0A 1XC9A 1IG6A 9ICLA 5KT3A 3RJJA 1JMSA 2F1HA 3C2KA 1PK1B 8ICRA 3NGDA 2WAQF 2H3VA 1QSYA 3GV8B 3KTQA 4IQTA 3RAQA 4GC6A 5AIBA 3ZD8A 4AYBC 3M9OB 4MFAA 2F1IA 1NK9A 2FMPA 2KK0A 8ICHA 3HRDD 4R65A 1NZBA 2RQ5A 4K4IA 1WWUA 1NJYA 4P4PA 2GLEA 4RT3A 2W8LA 2HHVA 4E0DA 1KRPA 1SL2A 4C7YA 4UAUA 3M1YA 2RHFA 4Y2UA 3I1YA 5KG1A 3IG5A 2KVSA 3CNHA 7ICSA 2HHUA 1UT8A 1A0PA 4M6WA 4C8KA 5ALQA 3MC1A 3EPGA 2IHNA 5J2DA 3LVVA 2E5SA 4LZGA 5ALIA 2CPRA 2V9WA 3RB6A 3UXOA 4EELA 4PJ0U 2BHNA 3NVYA 7ICVA 3HILA 3D2NA 4EX6A 5EE3A 1X2IA 4QWAA 1X9WA 4LVSA 4C8OA 1S77D 4PZNA 5CR0A 1JXLA 2JH7A 3JPSA 2P6UA 4B9UA 4PL1A 4MHVA 3IN5A 3FM9A 4FO6A 1NJZA 3PX6A 4O3OA 3HW8A 4M9LA 2KG5A 5BOMA 4Q44A 1L7OA 2W54A 3SAHA 4NM1A 3RJKA 4PGQA 4DQRA 2K4PA 4QZ9A 2FJ6A 1B4FA 1IIPA 4DL6A 1QLNA 2KNJA 2DPJA 1ZQIA 1TKDA 3T5LA 4DQPA 2KJ8A 3ISDA 3ED5A 2ASLA 3WKAA 2CN1A 4DFJA 4DF8A 3AN1A 2AU0A 1SV0C 4O3SA 5KFVA 2F44A 2JRZA 3V6KA 4J9OA 2ZIUB 5EE1A 4OJ5A 1KTQA 5DBBA 4NL9A 4RUCA 4GXIA 2W04A 4QZDA 4YMMA 2OWOA 8ICGA 2H3FA 4IS7A 1KQQA 3KZIU 4O3QA 2XY5A 5AKZA 2HHQA 2HHSA 3OJSA 1YT3A 4RQ7A 2KV2A 1ED1A 4M04A 4EBDA 1FIQA 2AH5A 2ZUDA 5AK3A 3GIKA 2CRXA 2JZBA 2VA8A 1NJWA 4DL3A 5CB1A 3LWMA 3EWAA 2E3TA 4OJPA 2BCRA 4XA5A 4BXOB 4QW9A 5ALLA 3QUCA 2UVWA 1DK2A 1JUDA 4ED8A 1Z00B 2VA2A 1KBUA 1B22A 4JV1A 1CI4A 3OHAA 4NLNA 2ZUBA 5AIAA 2W03A 2K8BB 4M6WB 8ICLA 2HI0A 2XIDA 4I2GA 5IIOA 3HJEA 2HVHA 2EANA 2KSOA 5ALOA 5KFOA 5ALPA 3UXPA 1UQVA 2F8KA 2YX8A 1HJPA 5ALSA 5J2CA 1SXDA 2J6UA 4ECXA 9ICQA 3F2BA 4BJQA 5DQHA 3H0LB 2ATLA 1OUQA 1Q3VA 4F5QA 7ICGA 2AGQA 3IG8A 4B9MA 1TAUA 4PH5A 1COKA 1S97A 2PKEA 4PZOA 2LHTA 1KFDA 5HHHA 4KLSA 2HHTA 3OSPA 1AQ6A 1Q46A 2HHXA 3RRHA 2PFOA 2UVUA 5CEHA 2K8CB 2MRLA 3AQFA 4DSJA 3ZI4A 1ZQKA 2M0NA 3BQ1A 2I6XA 4ECUA 4LJXA 2MA1A 2WF6A 2XY6A 4BUGA 5G5HA 3T5KA 4QZCA 2W55A 2FMQA 4UAYA 3F53A 5JRTA 1UT5A 4ECRA 4YMNA 4MFCA 1A77A 2FI1A 5KNIA 3B0XA 5D46A 4NV0A 2W9MA 3I76A 4EEKA 1RYRA 1DK3A 3BS5A 3TAPA 4F8RA 4AP9A 4Y2QA 2EZXA 5KG5A 1ZETA 3OHBA 2MUTA 4QZIA 5B5EU 5AM0A 3IDWA 4MF2A 4GIBA 4KN4A 5DB8A 3AMZA 3C21A 5DLGA 5J2AA 3Q8QB 8ICSA 3IP4B 2IOFK 1QCKA 3NUQA 3S6JA 3WKDA 2BZFA 1ZYQA 4Q8FA 2P66A 1N61A 1SV4A 4YD2A 2H3IA 4YXMA 4ED1A 1WCNA 1L3UA 5KFTA 3C23A 1A6SA 1S0NA 2YTUA 9ICPA 1XU4A 3CW2C 4RPZA 2LYHA 1ZXIA 3PO4A 5KG0A 1XSPA 3PV8A 7ICOA 2JMGA 2W11A 4DSIA 1T4GA 4PHDA 4I28A 1LKYA 2GOLA 2EAOA 2DUYA 5KFWA 9ICMA 4C8MA 3RRGA 9ICHA 3PW5A 4OJOA 1NZPA 3E0FA 5IIJA 4FS2A 4CGZA 4DLEA 4KLTA 2C2RA 1K1SA 4FFDA 4DFKA 5ALJA 3RF9A
chains in the Genus database with same CATH topology
5ALIA 3WK8A 4DFDA 4DCCA 5ALYA 3QNMA 3QU5A 2WFAA 4G9BA 4Y2TA 1ZD5A 5AKLA 5ALFA 4EELA 5AK5A 4HAIA 3IRUA 3I28A 2IOFA 3D6JA 3QUCA 5ALLA 5AI4A 1ZOLA 1JUDA 3QXGA 4UATA 5AKGA 4EX6A 2MU2A 4CF3A 1RDFA 1ZD2P 1ZRMA 3OTQA 2FI1A 3QUTA 1Z4OA 2NO4A 4J03A 3QU9A 5ALUA 3WK7A 3L5KA 1Z4NA 5AIAA 1SWVA 2WHEA 4Y2PA 5ALXA 2W43A 3I76A 3UMBA 3QYPA 1LVHA 4EEKA 3QU7A 4C4TA 4EENA 3QUQA 2HI0A 2YMPA 1QH9A 2HSZA 1RQNA 2HDOA 3UMGA 4CF4A 5ALKA 3FM9A 2WF5A 5ALZA 5ALVA 1O08A 4Y2QA 5ALMA 4Y2JA 2MSNA 3WKBA 5AK6A 3QUBA 5AKHA 5AM0A 3DV9A 3WKCA 5AM3A 4GIBA 5ALOA 4CE6A 5ALTA 5AHXA 3QU2A 5ALPA 1VJ5A 5ALSA 2YMQA 4JB3A 4Y2SA 4UAVA 2NO5A 2IOFK 2B0CA 5AM4A 3S6JA 3WKEA 3WKDA 5ALHA 5AKXA 4CNQA 2WF9A 4CF5A 1QQ7A 5ALEA 3R9KA 3KBBA 1ZD4A 3KOOA 5AIBA 1ZD3A 1O03A 3ED5A 3WKAA 5FP0A 2YMLA 2HCFA 2QLTA 5AM5A 5AI5A 1X42A 3E58A 2PKEA 1QQ5A 3WK5A 5AKJA 5AM2A 5AI8A 5AI6A 2WF7A 1ZRNA 5ALDA 4UARA 4F72A 1RQLA 5AKKA 5AICA 1SWWA 5AKIA 2YY6A 3WK9A 5ALWA 3QX7A 3WK6A 1AQ6A 5AI9A 1FEZA 2NYVA 2FDRA 4OCZA 5AKEA 2W11A 2GO7A 4UW9A 4UASA 5AI0A 4UAUA 3QU4A 5AM1A 2YMMA 2YN4A 4Y2UA 2WF8A 4Y2RA 3I1YA 1TE2A 4EX7A 5AKZA 3CNHA 3UM9A 3SD7A 5ALRA 3WK4A 4Y2YA 4OD0A 3NASA 5AKYA 5ALNA 3U26A 3ZI4A 4C4RA 4F71A 5ALQA 2I6XA 3DDHA 3MC1A 4FFDA 4Y2XA 5AK4A 5ALGA 1S8OA 2AH5A 5AK3A 1QQ6A 5ALJA 3UMCA 4C4SA 4Y2VA 2WF6A 2IOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ALI A;  3WK8 A;  4DFD A;  4DCC A;  5ALY A;  3QNM A;  3QU5 A;  2WFA A;  4G9B A;  4Y2T A;  1ZD5 A;  5AKL A;  5ALF A;  4EEL A;  5AK5 A;  4HAI A;  3IRU A;  3I28 A;  2IOF A;  3D6J A;  3QUC A;  5ALL A;  5AI4 A;  1ZOL A;  1JUD A;  3QXG A;  4UAT A;  5AKG A;  4EX6 A;  2MU2 A;  4CF3 A;  1RDF A;  1ZD2 P;  1ZRM A;  3OTQ A;  2FI1 A;  3QUT A;  1Z4O A;  2NO4 A;  4J03 A;  3QU9 A;  5ALU A;  3WK7 A;  3L5K A;  1Z4N A;  5AIA A;  1SWV A;  2WHE A;  4Y2P A;  5ALX A;  2W43 A;  3I76 A;  3UMB A;  3QYP A;  1LVH A;  4EEK A;  3QU7 A;  4C4T A;  4EEN A;  3QUQ A;  2HI0 A;  2YMP A;  1QH9 A;  2HSZ A;  1RQN A;  2HDO A;  3UMG A;  4CF4 A;  5ALK A;  3FM9 A;  2WF5 A;  5ALZ A;  5ALV A;  1O08 A;  4Y2Q A;  5ALM A;  4Y2J A;  2MSN A;  3WKB A;  5AK6 A;  3QUB A;  5AKH A;  5AM0 A;  3DV9 A;  3WKC A;  5AM3 A;  4GIB A;  5ALO A;  4CE6 A;  5ALT A;  5AHX A;  3QU2 A;  5ALP A;  1VJ5 A;  5ALS A;  2YMQ A;  4JB3 A;  4Y2S A;  4UAV A;  2NO5 A;  2IOF K;  2B0C A;  5AM4 A;  3S6J A;  3WKE A;  3WKD A;  5ALH A;  5AKX A;  4CNQ A;  2WF9 A;  4CF5 A;  1QQ7 A;  5ALE A;  3R9K A;  3KBB A;  1ZD4 A;  3KOO A;  5AIB A;  1ZD3 A;  1O03 A;  3ED5 A;  3WKA A;  5FP0 A;  2YML A;  2HCF A;  2QLT A;  5AM5 A;  5AI5 A;  1X42 A;  3E58 A;  2PKE A;  1QQ5 A;  3WK5 A;  5AKJ A;  5AM2 A;  5AI8 A;  5AI6 A;  2WF7 A;  1ZRN A;  5ALD A;  4UAR A;  4F72 A;  1RQL A;  5AKK A;  5AIC A;  1SWW A;  5AKI A;  2YY6 A;  3WK9 A;  5ALW A;  3QX7 A;  3WK6 A;  1AQ6 A;  5AI9 A;  1FEZ A;  2NYV A;  2FDR A;  4OCZ A;  5AKE A;  2W11 A;  2GO7 A;  4UW9 A;  4UAS A;  5AI0 A;  4UAU A;  3QU4 A;  5AM1 A;  2YMM A;  2YN4 A;  4Y2U A;  2WF8 A;  4Y2R A;  3I1Y A;  1TE2 A;  4EX7 A;  5AKZ A;  3CNH A;  3UM9 A;  3SD7 A;  5ALR A;  3WK4 A;  4Y2Y A;  4OD0 A;  3NAS A;  5AKY A;  5ALN A;  3U26 A;  3ZI4 A;  4C4R A;  4F71 A;  5ALQ A;  2I6X A;  3DDH A;  3MC1 A;  4FFD A;  4Y2X A;  5AK4 A;  5ALG A;  1S8O A;  2AH5 A;  5AK3 A;  1QQ6 A;  5ALJ A;  3UMC A;  4C4S A;  4Y2V A;  2WF6 A;  2IOH A; 
#chains in the Genus database with same CATH topology
 2LYB A;  5KFB A;  2DF4 B;  2PXI A;  1KEJ A;  3FC4 A;  9ICU A;  4O5E A;  2DPI A;  1ZQV A;  4HAI A;  5KG3 A;  4YR0 A;  4PGY A;  5KFJ A;  3OTQ A;  4MF8 A;  4MFF A;  3M9M B;  1HUZ A;  1QSL A;  4IQV A;  4M9G A;  4O3M A;  3ETR A;  3UXN A;  3H8J A;  3C28 A;  4C0Z A;  1COO A;  2H5X A;  1PK1 A;  2KHV A;  3DV9 A;  1RYU A;  2RDJ A;  2ODG A;  3UQ2 A;  3ETL A;  3AU2 A;  1CRX A;  4NXZ A;  2ZIV A;  3BZK A;  3LYS A;  4KLE A;  3H7I A;  4P4O A;  2XIC A;  2HOF A;  2HHW A;  1S10 A;  3PO5 A;  4O3R A;  3K75 D;  2HOI A;  3RFA A;  3C2M A;  4DFM A;  1GO3 F;  2QLT A;  5KT2 A;  9ICI A;  5HML A;  3KKA A;  4F5P A;  4YP3 A;  3H8M A;  4RNM A;  4Q45 A;  1PUZ A;  4Z6F A;  1QQ5 A;  5KFI A;  3ZDC A;  5AKJ A;  4YN4 A;  8ICJ A;  1U45 A;  2KZ3 A;  1NI3 A;  2Y9T A;  1LV5 A;  1VLB A;  3GIL A;  3QX7 A;  2E1F A;  1F44 A;  1FEZ A;  4B9S A;  2E1E A;  4EBC A;  7ICI A;  2GO7 A;  4UAS A;  5J2I A;  3ZDE A;  3MR6 A;  4Y2R A;  3UPQ A;  1KFS A;  4MEY A;  4Y2Y A;  4QWB A;  4O0I A;  1JXE A;  3G6Y A;  3F5A A;  4RU9 A;  5CA7 A;  2C2E A;  1MN8 A;  4B9T A;  1XWL A;  4DFD A;  9ICF A;  4P0Q A;  3WK8 A;  3TAC B;  3PNC A;  3KHL A;  4YVZ A;  1BPY A;  4UB5 A;  3V7J A;  1V9P A;  4F4X A;  4DSL A;  2JHD A;  2NRV A;  5L1J A;  4J9M A;  2FPL A;  5KT4 A;  2KJ5 A;  3MR5 A;  3Q8K A;  5KG6 A;  1LKY B;  4USA A;  5ALU A;  3FDS A;  2RRD A;  2EZZ A;  3GV7 B;  1LVH A;  9ICK A;  2KEY A;  3KZX A;  2PMZ F;  3RB4 A;  1FO4 A;  7ICL A;  4J9K A;  3M6K A;  1ZQS A;  1TK0 A;  4EYH B;  3QEA Z;  2K60 A;  5AK6 A;  4ACO A;  1OXJ A;  2DFL A;  1SV0 A;  4J9L A;  1Q3U A;  1L3S A;  3ONN A;  4GLX A;  1OW5 A;  5ALH A;  3EYZ A;  4Q43 A;  3M8R A;  5A0L A;  1N5X A;  1ZQZ A;  2QKQ A;  4RQN A;  4RQ0 A;  4ED6 A;  2Q0Z X;  4O5C A;  4PL2 A;  1WWV A;  1ZQO A;  4QZH A;  1TK5 A;  4ECW A;  2ZIU A;  4X5V A;  1HUO A;  1X42 A;  3HKZ C;  4IR1 A;  4DL2 A;  2B21 A;  9ICS A;  4FZL A;  5J2K A;  5DKW A;  1L8O A;  5AKK A;  4RQ8 A;  5AIC A;  2ZIV B;  5KFG A;  4G3I A;  4HYK A;  1XO0 A;  5AM1 A;  2C2D A;  5KFD A;  3HX0 A;  4ECY A;  2YN4 A;  5KFU A;  2PFQ A;  4TUR A;  3HWT A;  4UB2 A;  1BPD A;  4U6P A;  1T8E A;  1XSN A;  2QB0 B;  2FLP A;  7ICH A;  2KIV A;  4RQM A;  4Y2V A;  2R8K A;  5J2G A;  7ICQ A;  4BXO A;  2E8O A;  4TQS A;  3QNM A;  1YZ7 A;  4G9B A;  4RQ5 A;  1SKS A;  3JPO A;  4KMU A;  1Z00 A;  3UQ0 A;  2IOF A;  1URJ A;  5DDM A;  4J9P A;  3H8S A;  4DLG A;  5CP2 A;  5DB6 A;  3GIM A;  1ZRM A;  4RT2 A;  2G06 A;  3SV4 A;  2A1A A;  2KKV A;  5BPC A;  3H8W A;  1Z4N A;  4UB6 U;  4UAW A;  4Y2P A;  2AGP A;  2VJ4 A;  1N2X A;  1S9F A;  1BNO A;  1X6I A;  4TQR A;  2ZTD A;  3N7R C;  4P0Q B;  4Y2J A;  1L7N A;  2AHO B;  1PVQ A;  1ARO P;  5GTI U;  3KD3 A;  1IV8 A;  3RAX A;  1UPH A;  2R8J A;  3THV A;  4Y2S A;  4BGD A;  2ZJ8 A;  4R66 A;  4JK1 A;  4CF5 A;  1QQ7 A;  2BQ3 A;  3R9K A;  4F2R A;  2W7O A;  2F1J A;  1BPZ A;  5IIK A;  3GZF A;  5HR6 A;  2HCF A;  3RJF A;  5J0O A;  1BPX A;  4OO1 J;  7ICR A;  5AI5 A;  4ECZ A;  4NLK A;  2W9C A;  3HPO A;  2XVT A;  2KFZ A;  4B9N A;  1U49 A;  4UB3 A;  3ALR A;  3PZP A;  3KFU F;  3C5G A;  4UBB A;  5ALW A;  1S0O A;  5DBA A;  5J2E A;  2ZXI A;  1BNP A;  4ZOH C;  4UBC A;  1KLN A;  4YD1 A;  1XO1 A;  2H3Q A;  3PR5 B;  2B6G A;  2ALZ A;  5E79 U;  4UB1 A;  5DBC A;  4C4S A;  1ZQW A;  4KLF A;  3SAF A;  3GU3 A;  2H3Z A;  3GQC A;  5EE9 A;  2E8N A;  4F4Y A;  1ZQM A;  5DG9 A;  3PVX A;  5KFK A;  1QSS A;  8ICE A;  5AK5 A;  4M47 A;  5DGB A;  4M2Y A;  3A0H U;  3ISB A;  3PY8 A;  3BQT A;  3SEI A;  3H4B A;  8ICU A;  4ICA A;  1JN3 A;  3VCB A;  1KL9 A;  4NLB A;  4ECT A;  2BR0 A;  2W9B B;  2PFP A;  3RJI A;  1JAL A;  1SB3 C;  3QU7 A;  1UA1 A;  3NTU A;  3MGH A;  4GC7 A;  1DOQ A;  5ALZ A;  5ALV A;  4F91 B;  1O08 A;  4ELV A;  3B9J A;  3M9N B;  3CYM A;  1TVA A;  5C5J A;  4TUP A;  3BDP A;  5AM3 A;  4RNO A;  3B0Y A;  2XGQ A;  3QU2 A;  4DF4 A;  3PSI A;  1TV9 A;  3SMV A;  2EDU A;  1DGJ A;  2WF9 A;  3PX4 A;  4IRD A;  2VKQ A;  1O03 A;  1MC8 A;  5TZV A;  5J0S A;  5J2J A;  1D9F A;  5K4L A;  2P35 A;  5JTI A;  3VC8 A;  3QZ8 A;  1LB2 B;  1IM4 A;  3V7L A;  3GFK B;  2WB1 F;  5CJ7 A;  4F4Z A;  3PST A;  5AI8 A;  1RXV A;  5ALD A;  2G5H B;  1L3V A;  9ICJ A;  5KTQ A;  2M9N A;  1Z1B A;  3HP6 A;  2FLL A;  3D2S A;  3PW0 A;  2A3V A;  5GTH U;  7ICT A;  3L3F X;  1NK0 A;  1X9X A;  5DB7 A;  4PHA A;  2ZJA A;  4BWJ A;  1PVR A;  1U9L A;  4WJ3 B;  5ALG A;  5L1L A;  1N5W A;  5F3X B;  2W9C B;  3ZD9 A;  4US8 A;  4YQW A;  5F9N A;  4ED0 A;  2WFA A;  5ALF A;  4I29 A;  5DG7 A;  4I2C A;  4RUA A;  3SR6 A;  2EAP A;  7ICF A;  2OH2 A;  2W9A A;  1ZQR A;  3C5F A;  4EZ9 A;  3JPR A;  3IM1 A;  2F76 X;  9ICR A;  2BKE A;  1XSL A;  5T14 A;  2LI6 A;  2ASJ A;  2HBJ A;  2YMP A;  3M8S A;  4O3N A;  4RQ1 A;  3BQ7 A;  8ICT A;  4NLZ A;  1NK5 A;  2VJ5 A;  5DDY A;  5HP4 A;  3O0F A;  4CE6 A;  2W7P A;  5AHX A;  2YMQ A;  4DWI A;  5AKX A;  3RH5 A;  3RR8 A;  4JMU A;  3Q8L A;  1ZD3 A;  4IRC A;  1L7M A;  4I2E A;  1N63 A;  5G5G A;  5JUM A;  3E58 A;  2NRZ A;  9ICA A;  3N7S C;  4IQU A;  4I2H A;  8ICM A;  3NVV A;  3IV6 A;  3N7P D;  5III A;  2KZM A;  4I2A A;  1TFR A;  4KX3 A;  9ICC A;  4ED3 A;  2OXO A;  4EZ6 A;  5DG8 A;  5D4B A;  3HKZ F;  7ICJ A;  1KKX A;  3H4D A;  2RP5 A;  8ICN A;  1S76 D;  8ICY A;  4CCH A;  4I2D A;  4FBT A;  4KLQ A;  4OD0 A;  1Q8K A;  4F2S A;  5L9X A;  4F71 A;  3DEE A;  7ICU A;  3HT3 A;  5AK4 A;  3UMC A;  1QQ6 A;  4AYB F;  5KFY A;  2BCU A;  5KG4 A;  1NNL A;  3IRU A;  3I28 A;  2BGW A;  4C80 A;  5J0Y A;  2AJQ A;  1HEK A;  4A8E A;  1SL1 A;  5BOL A;  5HR7 A;  1NOM A;  4RQ2 A;  4DL7 A;  2I1Q A;  9ICN A;  4ECQ A;  4CF3 A;  1F0M A;  4PPX A;  4NJ8 A;  4IL6 U;  1UHU A;  2KJ9 A;  4YR2 A;  2NO4 A;  3SAG A;  3ZDD A;  3RB0 A;  5L1M A;  1ZQL A;  1MSW D;  2NV3 A;  2JEG A;  5KG7 A;  4I2F A;  4KLH A;  3G6V A;  3PW4 A;  3MR2 A;  1M6Y A;  8ICZ A;  1TK8 A;  5ALM A;  5KFQ A;  1RG6 A;  3V72 A;  2ASD A;  3AEV A;  2QAR A;  2JEF A;  2YB1 A;  2LYA A;  4UAV A;  4RQ4 A;  2P6R A;  5DLF A;  2XI9 A;  2EAM A;  1TAM A;  7ICM A;  1NK4 A;  2FPK A;  2Y0S C;  3EUB 2;  4F5R A;  4IR9 A;  2K8A A;  5J2B A;  1SXE A;  5HMM A;  3PW7 A;  2ZTC A;  2JEJ A;  2Y1J A;  2DGZ A;  5KAI U;  3OPX A;  3V6J A;  2C28 A;  4DL4 A;  1XNS A;  4NLG A;  1J2N A;  4QZF A;  2XGP A;  3Q8M A;  3SZ2 A;  1ZQC A;  4KLU A;  1D8B A;  3AQE A;  3JPT A;  1SIJ A;  3MGI A;  8ICV A;  5HNK A;  5AKE A;  2W8K A;  1ZQF A;  2FMS A;  1WG8 A;  3MBY A;  4UW9 A;  3N28 A;  3QU4 A;  4PGX A;  4BX9 C;  3UM9 A;  2QB0 A;  4RQ6 A;  1NKB A;  3FAH A;  5AKY A;  3NAS A;  4IC9 A;  4JV2 A;  8ICF A;  4YMO A;  1Z3E B;  3K4G A;  4Y2X A;  8ICP A;  4KLL A;  1ZQQ A;  4B9V A;  2A1J A;  2XCP A;  4XRH A;  1ZQU A;  3ZDA A;  1NK7 A;  1DRG A;  1V38 A;  3QU5 A;  4Y2T A;  2VIX A;  2W3R A;  2O6K A;  4YFK A;  8ICK A;  2E8P A;  2YQE A;  2Q4T A;  4F50 A;  5J29 A;  1ZOL A;  3J81 j;  1ZJM A;  1N62 A;  4KLG A;  4J03 A;  1MQ3 A;  3N4M B;  3WK7 A;  3L4P A;  2QB1 A;  2R8I A;  3FYH A;  2GWS A;  4M9J A;  3M7D A;  1ZQH A;  2YB4 A;  3EW9 A;  4UQG A;  1SGG A;  4F3O A;  3MGV A;  1V97 A;  2JGA A;  2DBY A;  4P0P B;  2KIC A;  3TAD C;  5ALT A;  5D49 A;  4JB3 A;  9ICW A;  2NO5 A;  4ED2 A;  4YG2 A;  4RZR A;  3GDX A;  2HW3 A;  2LBO A;  3TFR A;  3PR4 A;  5J8Y C;  2IHM A;  3RJH A;  1BPB A;  3N97 B;  2F8L A;  3PW2 A;  3CRX A;  5KFN A;  1EXN A;  4DS5 A;  3K1R B;  5CRX A;  5J0Q A;  4KLI A;  2AXT U;  2HBL A;  4J9N A;  1RPL A;  3SQI A;  2WF7 A;  1ZRN A;  3RB3 A;  4F72 A;  2QAR B;  2NRX A;  1J97 A;  3Q8P B;  4U7C A;  4F92 B;  4R63 A;  1DGS A;  2ZTE A;  2AQ0 A;  4R8U A;  1J2M A;  1L8L A;  2ZIW B;  1K1Q A;  5ALR A;  1VDV A;  2V4R A;  4GXK A;  2BPF A;  2XCA A;  1ZQN A;  4FE3 A;  3RJE A;  1L7P A;  1Z1V A;  4DCC A;  2G5I B;  4JV0 A;  3QZ7 A;  3KHG A;  4QWD A;  1X9S A;  5AI4 A;  2JEI A;  5H2F U;  2W9B A;  4FZM A;  3BZC A;  1T7P A;  2LMR A;  5KFR A;  3L5K A;  3SV3 A;  5ALX A;  4IQW A;  3LK9 A;  8ICC A;  4YCX A;  3QUQ A;  4LZD A;  4B6J A;  3T5H A;  5J0X A;  3AUO A;  2HSZ A;  3UMG A;  5ALK A;  4EYI B;  2A1J B;  2WF5 A;  2IBK A;  4NY8 A;  4Z6E A;  2ZIX B;  3WKB A;  4DFP A;  3QUB A;  3JPQ A;  3MFI A;  2BCS A;  4QW8 A;  4O9M A;  1NK8 A;  2OM6 A;  4C8L A;  4KLM A;  4DSF A;  3WKE A;  2E8M A;  1IXR A;  5ALE A;  4JUZ A;  1T3Q A;  2A19 A;  2DKX A;  2OEH A;  2OCE A;  5IIN A;  4KTQ A;  1NKE A;  2HVI A;  2ZXH A;  3KKA C;  3OJU A;  2BCV A;  2JH1 A;  5AM5 A;  4QZ8 A;  3IHQ B;  4QJF B;  9ICO A;  3RJG A;  3WK5 A;  5JU5 A;  2DQN B;  2R8G A;  3RH4 A;  1SZP A;  3A0B U;  2V4Q A;  1SWW A;  2KE7 A;  3WK9 A;  7ICP A;  2NYV A;  4C8N A;  5B66 U;  5AI0 A;  1ZQT A;  2YMM A;  8ICA A;  2HBK A;  5KFA A;  2KP7 A;  2HBM A;  2KOB A;  3LDA A;  3NVZ A;  5ALN A;  4UB4 A;  4CDG A;  3DDH A;  4JWM A;  4EBE A;  4F4K A;  1PVP A;  3MAB A;  2IOH A;  3AL0 B;  8ICW A;  4FZN A;  5HHI A;  2XO7 A;  1L6N A;  2LM4 A;  2LKY A;  3C29 A;  1D8Y A;  4P2H A;  4MEX A;  4R8U B;  3MR3 A;  4KLO A;  2L5Y A;  1UA0 A;  3TFS A;  4KX5 A;  3RBD A;  2W43 A;  3NRZ A;  3MDA A;  9ICE A;  1P7D A;  3ICX A;  1L3T A;  4DEZ A;  1XS9 D;  4CF4 A;  5J0W A;  4RPY A;  2AQ4 A;  3JPN A;  5EE0 A;  1L5U A;  1C20 A;  5KFZ A;  2MSN A;  1NK6 A;  3D2Q A;  2IMW P;  1UCV A;  3TQ1 A;  3WKC A;  2CXY A;  2EZY A;  2W3S A;  3H40 A;  3OSN A;  1ZQE A;  3BS7 A;  4P4M A;  4K4G A;  1CUK A;  4US9 A;  1JRO A;  3F5E A;  3GIJ A;  4DSE A;  2BPG A;  1ZQB A;  3Q8R B;  5EWE A;  1ZQ1 C;  4RPX A;  4XUS A;  4DOB A;  1KN5 A;  2Y0S F;  1U47 A;  5AM2 A;  3TAN A;  5KFL A;  5AI6 A;  1ZJN A;  4UAR A;  1X9M A;  4KN7 A;  3WK6 A;  4DSK A;  9ICV A;  4OCZ A;  2G09 A;  2FDR A;  3H0R B;  2PI4 A;  3TI0 A;  5J0R A;  1N56 A;  4DQI A;  4EX7 A;  4DQS A;  2PMZ C;  4QZE A;  2R18 A;  3U26 A;  5L1K A;  2D8C A;  4BWM A;  3GV5 B;  1D9D A;  3JPP A;  4ELT A;  1Z19 A;  5EOZ A;  2LPE A;  3BQ0 A;  3EZ5 A;  7ICK A;  4UB8 U;  2ES6 A;  3E2E A;  1S5L U;  1MA7 A;  3OGU A;  4NM2 A;  1RYS A;  3D6J A;  1KDH A;  2K4I A;  9ICX A;  1WUD A;  4YXJ A;  1ZD2 P;  1F5S A;  3QUT A;  5DQI A;  1Z4O A;  1HIW A;  3RBE A;  4QIW C;  3QU9 A;  3T3F A;  1SWV A;  1PZN A;  4I2J A;  1B0X A;  4C4T A;  2IA6 A;  2G07 A;  1BPE A;  2I9G A;  2KZZ A;  4CRX A;  1S0M A;  2VA3 A;  3WU2 U;  3PML A;  4I27 A;  1KSP A;  4DQQ A;  4DS4 A;  5KFC A;  3C2L A;  2WAQ C;  5AKH A;  2D6F C;  3F2C A;  5KFP A;  2Y1I A;  2B0C A;  2BQR A;  4R64 A;  1N60 A;  5KAF U;  5KFE A;  8ICO A;  1ZD4 A;  1RM6 C;  3MDC A;  5J0P A;  5FP0 A;  2C22 A;  2YML A;  3NRW A;  3LVW A;  4DO9 A;  1A76 A;  3GII A;  2ZJ5 A;  4M9N A;  5KFH A;  2RLT A;  3RH6 A;  5C0Y A;  2BDP A;  1ZQA A;  5KL8 B;  1RQL A;  8ICI A;  4RNN A;  3SEN A;  1FFV A;  2YY6 A;  1SKR A;  1BVS A;  5AI9 A;  5J0U A;  2DL0 A;  1JIH A;  1CEZ A;  4TUS A;  2BCQ A;  1KW4 A;  2FLN A;  1KFT A;  1TE2 A;  5KT5 A;  2VAN A;  4JWN A;  1WCL A;  4J9S A;  5EWG A;  2FPM A;  4B9L A;  4C4R A;  4PHP A;  5F9L A;  8ICB A;  3RR7 A;  3C1Y A;  1H38 A;  3ZDB A;  2KFN A;  1RXW A;  1S8O A;  2K4H A;  4ZH4 A;  2Z7J A;  2KVC A;  4NWI A;  2AGO A;  4NL9 C;  3T5J A;  2JZB B;  4Z6C A;  1SL0 A;  5J2F A;  5IIL A;  3NVW A;  2R8H A;  4EEY A;  3SYZ A;  1RDF A;  3KHR A;  1D8L A;  1RZT A;  1S0V A;  3TAD A;  5TIS U;  1ZQP A;  2ZUC A;  2PFN A;  1Y88 A;  4YR3 A;  2WHE A;  4DOC A;  3UMB A;  4PHE A;  1T94 A;  4KLD A;  2F3N A;  4QNL A;  3T79 A;  2HDO A;  5EWF A;  4QWC A;  5J2H A;  5J8Y A;  3TKA A;  2JV3 A;  2ESE A;  4P0P A;  3AM9 A;  5DQG A;  2G0A A;  4OJ6 A;  1V85 A;  4IRK A;  1VJ5 A;  3NS1 A;  2KSO B;  5J0T A;  1X6J A;  5AM4 A;  8ICX A;  4NLC A;  7ICN A;  5KFF A;  3KOO A;  4K4H A;  4KLJ A;  4Z6D A;  3PSP A;  5IIM A;  5KT7 A;  1JI7 A;  2MAX A;  2BPC A;  2F77 X;  4DL5 A;  1FFU A;  2EH9 A;  2WTF A;  3EPI A;  2BDU A;  4TUQ A;  2FE9 A;  4GXJ A;  5CHG A;  3PSF A;  2KKP A;  2F2A B;  1JX4 A;  2ZIW A;  1SKW A;  1QTM A;  4KIT B;  3ISC A;  3AU6 A;  1ZQY A;  2WF8 A;  2I5H A;  3BJY A;  4F5O A;  4F4W A;  3KHH A;  3SD7 A;  2HMX A;  9ICB A;  2PI5 A;  1PK3 A;  3Q8S B;  2ISP A;  3K1Z A;  5AKL A;  2OHF A;  2DWQ A;  2ISO A;  4QZG A;  3V7K A;  1DXS A;  2UVR A;  4FBU A;  3QEB Z;  4ED7 A;  1TAQ A;  4J9R A;  3M6Z A;  3QYP A;  2BQU A;  7ICE A;  2KN7 A;  5DB9 A;  1K5O A;  2ZIX A;  1NKC A;  1QH9 A;  2J6T A;  1RQN A;  2K4E A;  2WB1 C;  3CP8 A;  1X40 A;  2J6S A;  2KHQ A;  2G08 A;  3ORY A;  4F93 B;  3LWL A;  1JRP A;  3BS5 B;  1MQ2 A;  4FS1 A;  4Q8E A;  1ZQJ A;  4ECV A;  1ZQX A;  3G6X A;  8ICQ A;  2MUT B;  9ICT A;  2JR5 A;  1BGX T;  2NRW A;  2D3D A;  4CNQ A;  5CWR A;  4M0A A;  4I2B A;  4C7Z A;  1ZQG A;  3KBB A;  4UAZ A;  4BDP A;  1T3N A;  1SZH A;  4O5K A;  3QE9 Y;  4F5N A;  4J9Q A;  1U48 A;  4RQ3 A;  1ZQD A;  5KFX A;  5KFS A;  3SI8 A;  4QZA A;  5L1I A;  4M9H A;  2DKZ A;  2XY7 A;  1NJX A;  2KIW A;  1U4B A;  3C1Z A;  4ELU A;  3MFH A;  5AKI A;  3TAR A;  2Y9U A;  5DGA A;  4DOA A;  1N48 A;  2ZG6 A;  4ECS A;  3WK4 A;  1X66 A;  4QWE A;  2KD1 A;  2LM1 A;  1B43 A;  4QZB A;  4KMO B;  3TAQ A;  3H0M B;  2GH1 A;  2XC9 A;  4O3P A;  2OYY A;  5KFM A;  1YZ6 A;  3V6H A;  9ICG A;  2NRT A;  5ALY A;  2K89 A;  1ZD5 A;  4GFJ A;  2KTQ A;  3RTV A;  1C7Y A;  3QXG A;  4UAT A;  5AKG A;  2MU2 A;  4OJL A;  2RDI A;  3BQ2 A;  2EQY A;  4I2I A;  5KL1 B;  5KT6 A;  3PMN A;  5KG2 A;  2JXJ A;  4EEN A;  2UVV A;  1WYG A;  2KMD A;  4QIW F;  2N1R A;  2HOQ A;  3F2D A;  4XQ8 A;  1ECW A;  3PX0 A;  1XC9 A;  1IG6 A;  9ICL A;  5KT3 A;  3RJJ A;  1JMS A;  2F1H A;  3C2K A;  1PK1 B;  8ICR A;  3NGD A;  2WAQ F;  2H3V A;  1QSY A;  3GV8 B;  3KTQ A;  4IQT A;  3RAQ A;  4GC6 A;  5AIB A;  3ZD8 A;  4AYB C;  3M9O B;  4MFA A;  2F1I A;  1NK9 A;  2FMP A;  2KK0 A;  8ICH A;  3HRD D;  4R65 A;  1NZB A;  2RQ5 A;  4K4I A;  1WWU A;  1NJY A;  4P4P A;  2GLE A;  4RT3 A;  2W8L A;  2HHV A;  4E0D A;  1KRP A;  1SL2 A;  4C7Y A;  4UAU A;  3M1Y A;  2RHF A;  4Y2U A;  3I1Y A;  5KG1 A;  3IG5 A;  2KVS A;  3CNH A;  7ICS A;  2HHU A;  1UT8 A;  1A0P A;  4M6W A;  4C8K A;  5ALQ A;  3MC1 A;  3EPG A;  2IHN A;  5J2D A;  3LVV A;  2E5S A;  4LZG A;  5ALI A;  2CPR A;  2V9W A;  3RB6 A;  3UXO A;  4EEL A;  4PJ0 U;  2BHN A;  3NVY A;  7ICV A;  3HIL A;  3D2N A;  4EX6 A;  5EE3 A;  1X2I A;  4QWA A;  1X9W A;  4LVS A;  4C8O A;  1S77 D;  4PZN A;  5CR0 A;  1JXL A;  2JH7 A;  3JPS A;  2P6U A;  4B9U A;  4PL1 A;  4MHV A;  3IN5 A;  3FM9 A;  4FO6 A;  1NJZ A;  3PX6 A;  4O3O A;  3HW8 A;  4M9L A;  2KG5 A;  5BOM A;  4Q44 A;  1L7O A;  2W54 A;  3SAH A;  4NM1 A;  3RJK A;  4PGQ A;  4DQR A;  2K4P A;  4QZ9 A;  2FJ6 A;  1B4F A;  1IIP A;  4DL6 A;  1QLN A;  2KNJ A;  2DPJ A;  1ZQI A;  1TKD A;  3T5L A;  4DQP A;  2KJ8 A;  3ISD A;  3ED5 A;  2ASL A;  3WKA A;  2CN1 A;  4DFJ A;  4DF8 A;  3AN1 A;  2AU0 A;  1SV0 C;  4O3S A;  5KFV A;  2F44 A;  2JRZ A;  3V6K A;  4J9O A;  2ZIU B;  5EE1 A;  4OJ5 A;  1KTQ A;  5DBB A;  4NL9 A;  4RUC A;  4GXI A;  2W04 A;  4QZD A;  4YMM A;  2OWO A;  8ICG A;  2H3F A;  4IS7 A;  1KQQ A;  3KZI U;  4O3Q A;  2XY5 A;  5AKZ A;  2HHQ A;  2HHS A;  3OJS A;  1YT3 A;  4RQ7 A;  2KV2 A;  1ED1 A;  4M04 A;  4EBD A;  1FIQ A;  2AH5 A;  2ZUD A;  5AK3 A;  3GIK A;  2CRX A;  2JZB A;  2VA8 A;  1NJW A;  4DL3 A;  5CB1 A;  3LWM A;  3EWA A;  2E3T A;  4OJP A;  2BCR A;  4XA5 A;  4BXO B;  4QW9 A;  5ALL A;  3QUC A;  2UVW A;  1DK2 A;  1JUD A;  4ED8 A;  1Z00 B;  2VA2 A;  1KBU A;  1B22 A;  4JV1 A;  1CI4 A;  3OHA A;  4NLN A;  2ZUB A;  5AIA A;  2W03 A;  2K8B B;  4M6W B;  8ICL A;  2HI0 A;  2XID A;  4I2G A;  5IIO A;  3HJE A;  2HVH A;  2EAN A;  2KSO A;  5ALO A;  5KFO A;  5ALP A;  3UXP A;  1UQV A;  2F8K A;  2YX8 A;  1HJP A;  5ALS A;  5J2C A;  1SXD A;  2J6U A;  4ECX A;  9ICQ A;  3F2B A;  4BJQ A;  5DQH A;  3H0L B;  2ATL A;  1OUQ A;  1Q3V A;  4F5Q A;  7ICG A;  2AGQ A;  3IG8 A;  4B9M A;  1TAU A;  4PH5 A;  1COK A;  1S97 A;  2PKE A;  4PZO A;  2LHT A;  1KFD A;  5HHH A;  4KLS A;  2HHT A;  3OSP A;  1AQ6 A;  1Q46 A;  2HHX A;  3RRH A;  2PFO A;  2UVU A;  5CEH A;  2K8C B;  2MRL A;  3AQF A;  4DSJ A;  3ZI4 A;  1ZQK A;  2M0N A;  3BQ1 A;  2I6X A;  4ECU A;  4LJX A;  2MA1 A;  2WF6 A;  2XY6 A;  4BUG A;  5G5H A;  3T5K A;  4QZC A;  2W55 A;  2FMQ A;  4UAY A;  3F53 A;  5JRT A;  1UT5 A;  4ECR A;  4YMN A;  4MFC A;  1A77 A;  2FI1 A;  5KNI A;  3B0X A;  5D46 A;  4NV0 A;  2W9M A;  3I76 A;  4EEK A;  1RYR A;  1DK3 A;  3BS5 A;  3TAP A;  4F8R A;  4AP9 A;  4Y2Q A;  2EZX A;  5KG5 A;  1ZET A;  3OHB A;  2MUT A;  4QZI A;  5B5E U;  5AM0 A;  3IDW A;  4MF2 A;  4GIB A;  4KN4 A;  5DB8 A;  3AMZ A;  3C21 A;  5DLG A;  5J2A A;  3Q8Q B;  8ICS A;  3IP4 B;  2IOF K;  1QCK A;  3NUQ A;  3S6J A;  3WKD A;  2BZF A;  1ZYQ A;  4Q8F A;  2P66 A;  1N61 A;  1SV4 A;  4YD2 A;  2H3I A;  4YXM A;  4ED1 A;  1WCN A;  1L3U A;  5KFT A;  3C23 A;  1A6S A;  1S0N A;  2YTU A;  9ICP A;  1XU4 A;  3CW2 C;  4RPZ A;  2LYH A;  1ZXI A;  3PO4 A;  5KG0 A;  1XSP A;  3PV8 A;  7ICO A;  2JMG A;  2W11 A;  4DSI A;  1T4G A;  4PHD A;  4I28 A;  1LKY A;  2GOL A;  2EAO A;  2DUY A;  5KFW A;  9ICM A;  4C8M A;  3RRG A;  9ICH A;  3PW5 A;  4OJO A;  1NZP A;  3E0F A;  5IIJ A;  4FS2 A;  4CGZ A;  4DLE A;  4KLT A;  2C2R A;  1K1S A;  4FFD A;  4DFK A;  5ALJ A;  3RF9 A; 
#chains in the Genus database with same CATH homology
 5ALI A;  3WK8 A;  4DFD A;  4DCC A;  5ALY A;  3QNM A;  3QU5 A;  2WFA A;  4G9B A;  4Y2T A;  1ZD5 A;  5AKL A;  5ALF A;  4EEL A;  5AK5 A;  4HAI A;  3IRU A;  3I28 A;  2IOF A;  3D6J A;  3QUC A;  5ALL A;  5AI4 A;  1ZOL A;  1JUD A;  3QXG A;  4UAT A;  5AKG A;  4EX6 A;  2MU2 A;  4CF3 A;  1RDF A;  1ZD2 P;  1ZRM A;  3OTQ A;  2FI1 A;  3QUT A;  1Z4O A;  2NO4 A;  4J03 A;  3QU9 A;  5ALU A;  3WK7 A;  3L5K A;  1Z4N A;  5AIA A;  1SWV A;  2WHE A;  4Y2P A;  5ALX A;  2W43 A;  3I76 A;  3UMB A;  3QYP A;  1LVH A;  4EEK A;  3QU7 A;  4C4T A;  4EEN A;  3QUQ A;  2HI0 A;  2YMP A;  1QH9 A;  2HSZ A;  1RQN A;  2HDO A;  3UMG A;  4CF4 A;  5ALK A;  3FM9 A;  2WF5 A;  5ALZ A;  5ALV A;  1O08 A;  4Y2Q A;  5ALM A;  4Y2J A;  2MSN A;  3WKB A;  5AK6 A;  3QUB A;  5AKH A;  5AM0 A;  3DV9 A;  3WKC A;  5AM3 A;  4GIB A;  5ALO A;  4CE6 A;  5ALT A;  5AHX A;  3QU2 A;  5ALP A;  1VJ5 A;  5ALS A;  2YMQ A;  4JB3 A;  4Y2S A;  4UAV A;  2NO5 A;  2IOF K;  2B0C A;  5AM4 A;  3S6J A;  3WKE A;  3WKD A;  5ALH A;  5AKX A;  4CNQ A;  2WF9 A;  4CF5 A;  1QQ7 A;  5ALE A;  3R9K A;  3KBB A;  1ZD4 A;  3KOO A;  5AIB A;  1ZD3 A;  1O03 A;  3ED5 A;  3WKA A;  5FP0 A;  2YML A;  2HCF A;  2QLT A;  5AM5 A;  5AI5 A;  1X42 A;  3E58 A;  2PKE A;  1QQ5 A;  3WK5 A;  5AKJ A;  5AM2 A;  5AI8 A;  5AI6 A;  2WF7 A;  1ZRN A;  5ALD A;  4UAR A;  4F72 A;  1RQL A;  5AKK A;  5AIC A;  1SWW A;  5AKI A;  2YY6 A;  3WK9 A;  5ALW A;  3QX7 A;  3WK6 A;  1AQ6 A;  5AI9 A;  1FEZ A;  2NYV A;  2FDR A;  4OCZ A;  5AKE A;  2W11 A;  2GO7 A;  4UW9 A;  4UAS A;  5AI0 A;  4UAU A;  3QU4 A;  5AM1 A;  2YMM A;  2YN4 A;  4Y2U A;  2WF8 A;  4Y2R A;  3I1Y A;  1TE2 A;  4EX7 A;  5AKZ A;  3CNH A;  3UM9 A;  3SD7 A;  5ALR A;  3WK4 A;  4Y2Y A;  4OD0 A;  3NAS A;  5AKY A;  5ALN A;  3U26 A;  3ZI4 A;  4C4R A;  4F71 A;  5ALQ A;  2I6X A;  3DDH A;  3MC1 A;  4FFD A;  4Y2X A;  5AK4 A;  5ALG A;  1S8O A;  2AH5 A;  5AK3 A;  1QQ6 A;  5ALJ A;  3UMC A;  4C4S A;  4Y2V A;  2WF6 A;  2IOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...