4ZOHC

Crystal structure of glyceraldehyde oxidoreductase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
b'MKIINSDQKVKITLKINGEKYETEVEPRRLLVHVLRELGFTGVHIGCDTSNCGACTVIMNGKSVKSCTVLAVEADGAEILTVEGLAKDGKLHPIQEAFWENHALQCGYCTPGMIMEAYWLLREKPNPTEEEIREGISGNLCRCTGYQNIVKAIKAAAEKLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase molybdopterin-binding subunit
publication title Archaeal Mo-Containing Glyceraldehyde Oxidoreductase Isozymes Exhibit Diverse Substrate Specificities through Unique Subunit Assemblies.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
C PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 4zohC02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zohC01
2E3TA 1A70A 5EE3A 4P6VF 2WU5B 3SFEB 3AECB 1YJIA 1N60A 4N59A 1CJEA 2W54A 1YQ3B 1TYGB 3HRDD 3AN1A 1VJKA 2WQYB 4JWSC 3VRAB 1L6VA 4C7YA 4WQMA 1R7SA 4US9A 1SB3C 1ZUD2 2M19A 1JALA 3KWLA 1GAQB 1WGKA 5GXGB 1IUEA 2WDRB 2WP9B 3BIID 2WU2B 1KRHA 4JX1C 5EE1A 2H88B 4WWMA 1RWSA 3WCQA 3AE1B 3HVZA 2BT6A 3AE7B 2WS3B 2FBWB 4KX6B 1JRPA 3NS1A 1FXAA 1OQQA 1KFYB 1RFKA 2PIAA 3AEEB 4HROA 1DGJA 2K5PA 2JQRB 1XLPA 1V97A 3B9JA 4ZOHC 2LEKA 3EUB2 5H92C 1DOIA 2QJLA 5EE0A 3AE9B 2EKIA 3AE6B 3RPFC 1WRIA 3W5VB 2Q5WD 1SF0A 5MPOA 1JW9D 3AEAB 4N6EB 1YQ4B 3AE2B 4ZHPA 1B9RA 1FXIA 2QIEB 3DWGC 1QF6A 1QLBB 3VRBB 1JWAD 4US8A 1PDXA 1QOAA 2WLBA 1J7CA 1FFUA 3P4PB 5G5GA 1TKYA 1E0ZA 2W55A 1E7PB 1NEKB 1ZOYB 2CJNA 3AE5B 4LTUA 3ETRA 3P63A 1T3QA 2L83A 3W5UB 3P1MA 4JWUC 4C7ZA 3LB8C 1AYFA 3B2GA 1AWDA 3NVWA 2HTME 3AE3B 5AUKA 2DBYA 1L6UA 2DWQA 1NENB 3B2FA 1QOFA 1ROEA 4HRSA 3AMZA 5G5HA 3P4QB 3CIRB 1DOYA 2L52A 4YXDB 1N63A 1FO4A 2KAJA 2PKOA 3CWIA 4ITKA 5EE9A 2Y5CA 1QOBA 1KF6B 3VR9B 1JWBD 4USAA 1J7BA 1FM0D 1NYRA 1N62A 4YTNB 2BS4B 1JROA 1N5WA 2CJOA 1ZXIA 3ABVB 3DWMA 4YSXB 3AE4B 1VLBA 2MJEA 1DOXA 4YSYB 3HUIA 1NVID 1RYJA 3NVYA 3AEFB 2W3SA 1I7HA 2K22A 3LXFA 3NRZA 1VDVA 1N61A 3FAHA 1EWYC 2M56B 2WDQB 3AEDB 3L4PA 3AEGB 2ACZB 5AUIA 2WDVB 1QT9A 1E10A 3AH7A 1F0ZA 3AV8A 3SR6A 2AX5A 4YTPB 4YSZB 3AE8B 1XLOA 4YTMB 3FC4A 1RM6C 1JQ4A 1OFFA 2KMMA 2MJ3A 1TKGA 1E9MA 1XLNA 4YT0B 3ZYYX 2N0SB 2W3RA 1UWMA 3AB5A 4ZHOA 2BS3B 1YJJA 1FIQA 2MJDA 3VR8B 1WWTA 4A9AA 1GPXA 1TJEA 1WYGA 2BS2B 1PUTA 3PO0A 1CZPA 3NVVA 1E6EB 4IDIA 5C3JB 1OQRA 2JX5A 2K9XA 1ZP0B 1XLQA 2OHFA 2G1EA 1N5XA 4C80A 1TKEA 2PVGC 5C2TB 3SFDB 1PFDA 1L0VB 2CU3A 2PVOD 2H89B 3P4SB 4FXCA 1NYQA 3P4RB 1V8CA 3W9CB 3AEBB 5H8YE 3NVZA 1FMAD 1SIJA 4N58A 3AM9A 1WXQA 1J7AA 1FRDA 1L5PA 1FRRA 1XO3A 1FFVA 1NI3A 2B76B 2MH7A 1QOGA
chains in the Genus database with same CATH superfamily
5AM1A 3M95A 1EO6A 3PW7A 2ZJDA 3RJJA 1SKSA 2PE6B 3EPIA 1PVRA 3QX7A 4GOCA 2K4IA 2MRPA 3TSSA 1V81A 4QW9A 2XGQA 3RNFC 2WQYB 4DQIA 2VH1A 5AKHA 3IV6A 4ED1A 2LJ5A 2YX8A 1TK5A 4RT2A 4W9CA 4D2KA 3GE3C 4KX3A 3V7JA 1D8LA 3VAWA 3RB0A 4DWIA 1A76A 9ICSA 2HSZA 3PR5B 1OQQA 5KFKA 1SIFA 4ELTA 2LGSA 4HCNB 5AK4A 4Y2QA 2Q4TA 1XLPA 2FLLA 2V4LA 3NS8A 1F44A 2EANA 1LO5D 3I9V1 4NLZA 3JW0X 2Q5WD 5IOIA 2H3FA 1E8ZA 5EDSA 4QZIA 4MGZE 2PKEA 3WIMA 2KDFB 1PVQA 2WLBA 1ZQXA 4GIVA 3MFHA 5G5GA 1TKYA 4KX5A 5J2GA 4LJOB 4ELUA 4RFBA 3SAFA 1UGMA 8ICFA 4O3SA 4URKA 1AYFA 3B2GA 1ZRNA 2HTME 3VFKA 4CO7A 2DWQA 1L6UA 4WAFA 1MA7A 4P1CC 2AU0A 1SE9A 4HYKA 4O0IA 7ICOA 1DOYA 3TI0A 2WB1F 2W11A 3SZ2A 4BXOB 2ESEA 5AKJA 3LJ3A 4USAA 1K8RB 3M8RA 2G4DB 2JZ3B 2DYMA 2LVPA 2KANA 2LYAA 2O6VB 5CR0A 4ECUA 2R8IA 1WZ3A 4KDIC 5HHDG 3E56A 1JXLA 1YD8U 3ABVB 4NAWA 4MF2A 1SV0A 1P0RA 4IC7B 4Y2JA 5AI0A 2XCPA 2R8JA 4YSYB 3V6EB 1QTMA 3C23A 3QYPA 1MQ3A 3NRZA 5L1JA 5E79U 5J2JA 1JN3A 4TUQA 3KHHA 1ZQYA 3EPGA 3APCA 1TZOA 5KTQA 1WM3A 3I3TB 1SL1A 4YTMB 3G6YA 4EZ6A 1BNOA 2KMMA 4NZLB 4K4IA 3IXSA 4EYHB 2YMPA 4RNMA 1OGWA 3N20C 1NK4A 1L3TA 1L7OA 4F5OA 1QQRA 2ZW1A 1KQQA 2N9PC 3IG3A 2K6DB 1RLFA 4QZDA 4HEA1 4RQNA 1P3QU 4OVVA 3PVXA 4A90A 1E5WA 1N48A 4CQNA 3IDWA 3PMNA 5KFGA 1FNVA 9ICOA 1V6EA 4DHZB 4NJ8A 4PHAA 1ZQLA 3PZ8A 2V0GA 2EAOA 3I57A 5KFJA 2JZBA 1F0MA 4F2SA 1L5PA 4KZ0A 9ICFA 2KG5A 4A8XC 1BT0A 3SFEB 2M0NA 3HP6A 4YCXA 4W9IA 1NKCA 2H3VA 3GQCA 1M94A 1IPGA 2AQ0A 4ACOA 5D4BA 1S5LU 1TFRA 3PX0A 2DAJA 2O2VB 2ONQA 3UINB 2WX1A 4US9A 3R3MA 4FN2A 2W82A 4J3OD 2V1YA 3KWLA 2KHQA 8ICNA 1WGKA 3T5HA 3RRHA 4GLXA 2LZ6A 5HP4A 2WXJA 1C76A 4YMMA 4HPMB 4O3QA 4GIBA 4LNKA 8ICPA 3H4BA 4UQGA 4C00A 1XO1A 2JQRB 1WYWB 5J2IA 2W9BB 1DOIA 1YOVB 5D94A 3WAOA 2XO7A 4J9KA 5KFUA 2IYDB 4PH5A 1C77A 4TKNA 3VTWA 4C4VB 5MPOA 2JMGA 4F4KA 1ZQFA 3AE2B 4IM3A 3AU5A 3DWGC 4DSKA 3QJZA 3VC8A 1WY8A 2K8CA 3I63C 2INPE 4A55A 3VUXA 5G2NA 4JV1A 1IP9A 1N2XA 3AU4A 5D2MB 3W5UB 4DOBA 4RF0A 3BQ2A 4C7ZA 2BQRA 1E90A 2KX3A 2FMPA 2VA2A 4EZ9A 3DVNV 3J81j 2BPSA 2JPHA 1DK3A 4W9GA 1ZETA 2DZMA 5KFIA 4YWGG 4GDLB 2PMVA 1XSNA 5G5HA 1QQ6A 2KQ7A 3P4QB 4EFOA 5IO9A 4NLCA 2KEYA 1U4BA 2CU1A 2FCNA 3ZD8A 5AKXA 2NYVA 2I6XA 5KFOA 1JWBD 3WK5A 1V86A 2K4EA 3WKDA 5IKCM 4M6WA 1ZQBA 2AGQA 1FPYA 3GILA 1RAXA 5CA7A 2XK5A 5KFDA 2HW3A 1ZQAA 3L4PA 4F8RA 2EKEC 3KWVA 2ZIXA 2MLBA 4LDTB 1L3UA 2IO0B 2NR2A 1NKBA 1P98A 3RFZB 2EQYA 1NJXA 3ENEA 2P6UA 3K4GA 3NZUA 4Z6FA 9ICKA 2KZMA 1ZKHA 3OHBA 3X23A 5F9NA 2F8KA 4RNNA 2BS2B 4K4GA 1PUTA 3WAPA 3HT3A 3Q8EA 4DXGA 5FP0A 4WWNA 5AM3A 4M0AA 2K8BB 2JXJA 4IS7A 5AIBA 4IRDA 2JY6A 5F3XB 2M4NA 3IAM1 3BDPA 3RNCC 3M9NB 3AEVA 2BR0A 4NWIA 2CU3A 2IGGA 3TADA 3PS6A 3GS2A 4NAMA 3P4RB 2KVRA 4NJ6A 1TZ1A 5H8YE 3JPTA 4NQKE 5HFYA 2E3TA 3SAGA 1KSPA 2D3AA 2H5XA 4ED6A 2VIXA 1X2IA 3C28A 1XO0A 4LK0M 2KZZA 1WZ0A 3NOBA 4J9RA 4KSKC 2YTUA 2WX0A 5KNIA 3DOWA 4MT5A 2BDPA 3M9OB 2KICA 1AARA 4NV0A 4GB9A 1UT8A 1X9SA 2YN4A 4OCZA 7ICGA 1ED1A 4CCHA 2YB4A 2F77X 5EE1A 2CS4A 2X38A 4RM8A 3WANA 2IHMA 4P4PA 5L95C 2C2DA 4NLBA 4HROA 2PIAA 4RQ6A 4YR0A 3ML9A 5AM2A 3B9JA 2PI5A 3O0FA 2HHWA 5HHHA 2I5HA 5J0WA 5KG4A 4WWOA 3WK8A 2IBIB 1WI0A 2HD5B 2MU2A 5J2CA 1V9JA 3X0WA 1JWUD 5J0UA 2J6UA 2M1MA 4HVBA 5KFHA 4KIKB 4RUCA 2EDUA 3HWTA 1ZDXA 3MDAA 7ICVA 5CHFA 2WFAA 3GOEA 2H3IA 1V38A 1K1SA 3RI7C 3U52E 1E7PB 1WE7A 1ZOYB 1C7YA 4FE3A 2ZIVB 4QZ8A 4ACFA 3HHMA 1S3SG 1UUPA 1RQLA 1EU4A 1KH0A 1F77A 1XD3B 5CX3A 1KEJA 3ZTCA 2DBYA 1V1PA 4O5CA 2JWZA 2BWFA 3NG0A 2D3CA 2HDEA 4I2AA 2G08A 5AI8A 2MP2B 1S0OA 4RMAA 4NLGA 4Q8FA 2JZPA 3CRXA 2NMQA 3QU2A 2R8GA 4KLFA 2WWZA 2O6VD 3D2QA 2PW9A 8ICCA 2UU7A 2D3BA 4RM9A 4HCPB 1UCVA 3NVYA 5D3DA 2WXNA 1TGZB 1YN3A 5GMVA 3RH4A 1VDVA 1N61A 1TKDA 3V7KA 2M56B 3TANA 4IM2A 1GO3F 5AUIA 1ZQWA 4BKTA 4DWFA 1UQVA 3ED5A 1K50A 1D9DA 3A1QB 5CHGA 4DL4A 2YMMA 1NJWA 4QIWF 3L54A 4MM3A 3HILA 2OJRA 3S6JA 4DO9A 5J0TA 1KBUA 1QSYA 1ZQOA 2BS3B 3V61A 3ONSA 3ZRCA 3I1YA 1BNPA 3ML8A 1KFSA 5DG9A 1KDHA 2BWES 3ZNZB 4AP4C 2D2QA 4CF5A 1LV5A 2OCEA 4YL8A 2Y9TA 8ICIA 3N7RC 1KJTA 4W9FA 3BZCA 3SFDB 5HR7A 2V4QA 4P16A 2FDRA 2H89B 4PZOA 3N7SC 2KNBA 2WXLA 5J0RA 2XEWA 2ZPNA 1TS4A 4CF4A 5JUMA 1MQ2A 4P0QB 2L00B 2RDBC 1A70A 4IQUA 1SV0C 2JT4B 3AECB 2BTEA 2RP5A 4DQOC 1C4PA 2HHXA 1ZXHA 5KG2A 5DGBA 4DF4A 1YQ3B 1Q1OA 3KUDB 5T14A 2KO3A 1TAMA 4JWSC 1SKRA 3QUCA 2D11A 2UVUA 3ISBA 2AYOB 1D5MC 2JF5A 4C4SA 2MBBB 2WU2B 1KRHA 3A0HU 5E6OA 1GB1A 1JMSA 3QUTA 4F7ZA 1O03A 4ANUA 3TARA 2PFQA 4M9JA 1MJDA 3N28A 2JR5A 1DGJA 7ICNA 1OUQA 2ASQA 1ZQNA 5H92C 2P35A 9ICJA 2XY5A 4IWQA 4LJPB 1PK1A 2J52A 1JI7A 2LXCA 5KT5A 3SU8X 2PLPA 2PE9A 4EBDA 5DPWA 1S77D 3DDHA 4HDOA 4L23A 4RQ4A 2ISOA 1WGDA 1UELA 3L16A 1PDXA 1FFUA 5ALWA 2IY0B 3SQIA 1PVPA 4BAXA 2IA6A 4AJWA 4RGTA 1YMHE 2REXA 2BCSA 3W1YA 2DUYA 1A6SA 4J03A 1L3SA 1ZQTA 2HHVA 4PHDA 1WIAA 2L32A 4L2YA 3U8ZA 1WCNA 3RJGA 1VD2A 4M02A 4DSJA 2LKYA 2FIFA 4K3CA 4DQRA 5F9LA 3GIIA 1WJNA 3KOOA 3PT2B 2V4RA 2UYZB 2LRUA 3AXCA 3HUIA 1NVID 1SSNA 4BDPA 3B0XA 1EF1A 3LXFA 4QZ9A 1ET6A 5ALFA 5J17A 3LDZE 2ZIWA 2KFKB 1UPHA 3AH7A 2K1FA 4LDTD 2ES6A 3ZXVA 2KDBA 1Z4NA 5D46A 3VUYA 1ZRMA 2N0SB 5CTRC 2W7OA 2WHIA 4JUZA 3PR4A 3A9KB 4BKGA 2XGPA 2Z59B 4XDCA 1WYGA 4M01A 1CZPA 3NVVA 4FBTA 1KFDA 2K89A 2AWTA 4F71A 9ICEA 3MFGA 1WF9A 3E9SA 3V72A 7ICFA 5ALSA 5AI4A 2PVGC 4ED0A 3OWEB 1K5OA 2EAPA 4F92B 3RAXA 3AEBB 1XSPA 1FMAD 2VZKB 4MSQB 1FFVA 1T7PA 2G5HB 3MHZA 5IILA 2IGDA 2WU5B 4TQ1A 5J18A 2KDMA 2LRWA 5KT3A 2GWSA 4BFRA 1IIPA 1Z1VA 2FAZA 2CN1A 1EU3A 1C20A 1I4PA 1VJKA 2BYTA 2D5GA 4RZRA 4FO6A 1BGXT 1UF0A 3I28A 1KRPA 3KLSX 1GAQB 2PFPA 1TBEA 3BIID 4IM0A 3IT4B 4KLDA 2BCRA 2AQ1B 4OVZA 1LFDA 4HAIA 2KSOA 2W9CB 8ICUA 1KFYB 3N30A 1S10A 1WXAA 2V9HA 3BYTB 4M2YA 4NPNA 2DYOA 4RF1A 4FZMA 3R7QA 1C3TA 4TQRA 3TL5A 2LYBA 3JPOA 1BMLC 2MA1A 3TADC 2KQSA 2E8NA 2HDOA 3LWLA 1X9MA 2AQ2B 3W1SA 2OWOA 4MSMB 1R4NB 4A20A 1SL2A 2LGDA 3Q3MC 2OJWA 2BKFA 5B5EU 2QIEB 2HJ1A 2K4HA 4O3NA 4ZRKA 4NM1A 3BZDB 2FE9A 4B6WA 2BGWA 3AE5B 2B21A 4NY8A 4KLTA 3PSFA 4YQWA 5T8IA 2E1FA 4RPYA 2OM6A 1JCKB 1WJ6A 2YEPF 3O13A 4BGDA 4RCOA 2KJ6A 1ZQMA 4I28A 4DQSA 5ALGA 2IHNA 3NY5A 2AL6A 1PK3A 3DVNU 3RMKC 1ROEA 3AMZA 5I4DA 4HPLB 4KVGB 1V85A 2GOLA 4IC9A 2AEHA 2XC9A 4F4XA 2QARB 2BPCA 1RRBA 1LKYA 3SENA 1JROA 3ZKJC 2XI9A 3C2MA 2CXYA 2CJOA 2NRVA 3DWMA 4YSXB 4ZYSA 4EBEA 2R18A 1TS2A 4R66A 3ZQ4A 4KGRA 4DQQA 1HZ6A 3C5GA 1ZQCA 5AK3A 3PW5A 2HBLA 1E10A 1A0PA 3M6KA 4C8MA 1ISNA 1S8OA 4NAWB 2WYQA 5JRTA 4QWAA 3U4EG 1P9DU 1UWMA 1ZW7A 1NK7A 4EELA 1GPXA 1SXTA 5JHBA 5D3IB 4JWNA 5BO4B 3Q8QB 3JPQA 3NRWA 2IGHA 2KFZA 4C4RA 1C79A 2JX5A 1I4XA 2V3PA 2PJHA 1XF5L 3L10B 4BKSA 2N7DA 5IIOA 1XEEA 4BZAA 1N5XA 2K8AA 4BWMA 3V62A 2DLBA 3PW4A 3HVDA 2HJ8A 3SD7A 3C8YA 3RYTA 3NVZA 5KFMA 2I38A 3SV4A 4CF3A 2NVUI 5GXGB 3PPAA 4F91B 4I6PA 2KIVA 3KKAA 4YR3A 3H40A 1TK0A 3UIOB 3RJIA 3PO5A 2JZBB 2W54A 4ECSA 1RFAA 1ZQKA 5KFWA 5AICA 2R8HA 4XA5A 1Q8KA 3NGDA 4Y2SA 4XWWA 3OPXA 4DL5A 1GC6A 4BBNC 3UPQA 2HVHA 4J6IA 2GI9A 1L5UA 4FADA 2FUG1 4UB4A 2NO5A 3AE1B 4JIOU 4CHKA 4GSWA 1RZTA 2I2YA 2A1JA 3PMLA 4ZRIA 2LHEA 3MJWA 3VCBA 1ZQDA 4N9F4 4A3PA 1BPZA 4DS4A 2XIDA 3G6VA 3QUBA 2A4ZA 1HUZA 4MELA 2MWSB 3UQBA 2KWUB 3VHTC 3F53A 2KNJA 2YQEA 1H4RA 3NZ3A 4JPSA 5ALEA 3S2AA 5DPTA 1L8OA 5AEKB 2YEPB 4WJNA 1C4AA 1T0QC 3TEYA 1B9RA 3LK9A 2F8LA 4ELVA 1QILA 4PS7A 4US8A 1N6ZA 2JRHA 2NCNA 4HWIB 1UGJA 2ZXHA 4DSIA 3P63A 3M63B 2ZTEA 1WR6E 2KK8A 1P7FA 3MR2A 1NZPA 8ICZA 2KTFA 3NVWA 4KV2A 2DKXA 4R64A 2K8CB 3WKAA 4TURA 2HTHA 2L3ZA 2MAXA 4I2HA 3EGRA 2KKCA 5DQIA 2VJ4A 4I2FA 3ZRFA 2WXFA 4F93B 3PV8A 5KT2A 4I2BA 4Q8EA 5G55A 2HCFA 1BPBA 4X5VA 2EZXA 1EF5A 5KFRA 1AROP 4GGQA 4JLCA 1DOXA 4UASA 4GC6A 1WE6A 2G5IB 4UAUA 4WJQA 5C23A 3ZDMC 1XWLA 5K4LA 2PXIA 2IO3B 1B1ZA 4NNJB 4PS3A 4S0RA 1V49A 2OYYA 2DHZA 3OAWA 3KZIU 4O5KA 4M6WB 2WDVB 2KJ9A 4WAAA 2FJ6A 3BINA 3WK9A 4P4MA 1VRAB 3I5JC 4QWDA 1ZQVA 4M9HA 5AKGA 3M3JA 1NK5A 4C8OA 2XK5B 5CJ7A 4DLGA 2BB6A 4W9DA 1DYQA 2PMZF 1URJA 3SEIA 4MGYE 3QC8B 2AHOB 2ZIXB 2Y1IA 1E6EB 2NS5A 3H8MA 5EWGA 5IN7A 1XSLA 1IBXA 1XLQA 2Y5PA 2OHFA 4ED7A 5IIKA 4J9SA 1RYUA 3PW2A 2C7MB 3E58A 1ACCA 5DPRA 2ZJ5A 1COKA 3Q8KA 2KKPA 1FRRA 2VZKD 4G0NB 4BBNF 3DV9A 3L5KA 2SEBD 3LVVA 3ZDCA 3VH4B 2F3NA 2ZUBA 1ZQ1C 2KACA 1OEYJ 4B6JA 2WXMA 5TZVA 4BJQA 4DFJA 2LM1A 2V4IB 3A4SC 2KVSA 4C4TA 4DQPA 4MJSB 3K1RB 1ZD3A 3HRDD 2QILA 1NK0A 1U45A 1Q3VA 3IFWB 3Q8AA 4I2DA 5J2DA 4UB1A 1J2MA 4YD1A 1WFYA 4UB6U 4KLUA 2WF6A 9ICVA 3EECA 2LUMA 5ALHA 2DPIA 2L8JA 2WDTB 3Q8BA 2VH2A 1GG3A 1Q3UA 2XNAC 4PK1A 3CSFA 3BK2A 4LNNA 4UB2A 3U7ZA 2HMXA 5DGAA 2ZJAA 2K4PA 1NKEA 2LEKA 3BZKA 3K9OB 3QK0A 1FEHA 1Z2MA 1J0GA 3WKEA 1L2NA 3R66C 1FCLA 2KOBA 4QJFB 3VTUA 1ZD2P 4B9TA 1ZYQA 3MGHA 4ECZA 3RJHA 4WJ3B 5GTIU 3KVFB 2ZXIA 4RPXA 5BYSA 1RDFA 1YIWA 1C1YB 1E0ZA 2JRIB 5J2RA 3C21A 2MUTA 1WGYA 5BMGA 4I2CA 1TT5B 3M6ZA 2JZZA 1TS3A 1WGGA 3OGUA 4P2HA 4J9QA 2WF5A 4IW0A 5LXHA 3QU9A 1GC7A 4AP9A 3RAQA 2Z8LA 3LB8C 2LHTA 8ICYA 2DGZA 3PO4A 3SV3A 2M17A 3Q8LA 3ZXRA 1JX4A 3DBHB 4QAYA 3RCZA 4EEWA 4KKIA 1N63A 5EE9A 4PHEA 5KFZA 1WMHA 5LNK1 4FS1A 2HOFA 1SWVA 4LZGA 4OZAA 2VANA 5ALRA 5IIJA 2G0AA 5KFSA 3TJPA 4F3OA 1SXEA 3AE4B 1T5XD 4WURA 5L1IA 2E8PA 8ICLA 4XC2A 9ICTA 5JH5C 2LWPA 2JEJA 5DLGA 2V3SA 1F2RI 4DDID 3EW9A 2ASJA 3D32A 1SJHD 2KZRA 4EENA 2EAMA 4GU2A 4ECXA 2ATLA 2FNJB 3AE8B 3KW5B 3NJTA 1VZ6A 4NL9A 4X57B 1HTQA 2BBCA 1XLNA 3FM9A 4C0ZA 2TSSA 1B4FA 2YMQA 3ZVVA 2HBJA 4A9AA 2DYBA 2QLTA 1SGGA 5C5JA 3PTFC 1WJ4A 4XX5A 1LQBA 3BY4B 5C3JB 2K9XA 2KK0A 2C28A 3JYUA 2NO4A 5EOZA 3IN5A 3QE9Y 2RQ5A 5J8YA 1PZNA 2LD9A 2QHOA 4MM3B 5IA7A 1L0VB 1WG8A 1KTQA 2PVOD 1XQQA 2ZCCA 3H1UA 3MR6A 1V80A 1F9JA 5FR3A 4IUMB 5HHIA 2LMRA 5AKIA 2F1JA 4H2AA 8ICWA 2ZJ8A 5ALMA 9ICCA 1QOGA 3AQFA 4F4WA 5TISU 4IQVA 1R4MB 4RQ1A 5BOMA 8ICAA 1N60A 2MBEA 5HNKA 3AUOA 1WH3A 1S9FA 2GB1A 2GRIA 4DFMA 3U7DA 5ALVA 3H8HA 2R2QA 2WF9A 8ICSA 2MHJA 3WAMA 5ALUA 3TAQA 3ZDAA 2MQJA 3TAPA 5BMHA 3VQIA 1JALA 3QU7A 4OJ5A 1X40A 4UDUC 3GIJA 2GLEA 3ZLZA 1TS5A 2WXRA 2RRDA 1OXJA 2JVCA 3CSTA 4QIWC 3M7DA 4B95A 2FBWB 4O5EA 4KX6B 2N7EA 4AS1A 5LXIB 3BJYA 2YY6A 2HBKA 3QIJA 1JXEA 2O6KA 4W9LA 4KLIA 2F1HA 1L4DB 3V60A 4R8UA 2Y0SC 4BOZB 2W8LA 3H4DA 5KAFU 3B1LX 1PYWD 3PZ7A 3MDCA 4QNLA 1WRIA 2JEGA 5DG7A 1WXMA 3BVZA 3DPDA 4R63A 2FLPA 4OW0A 5FKAC 2IOFA 3BQ0A 3GB1A 4N6EB 3IAS1 3GIMA 3TEZA 1FXIA 4EZKA 5AKZA 3PRPB 3H8JA 3KKAC 1CMXB 3JPPA 3BS5B 2QEJC 1PK1B 1YZ7A 3DBSA 1I4RA 4KLJA 1RG6A 3PSTA 4JWUC 2LFIA 4HK2A 4IWOA 3ZW3A 5AM5A 3ZD9A 4CE6A 1T8EA 2KV2A 2ZNVC 1ET9A 2RPVA 3RNBC 1NENB 2W9NA 2Y5BB 4REZA 4ED2A 5KFEA 1S97A 3GFKB 4B9UA 3CWIA 5J2AA 2D3GA 1ZQZA 2KFJA 2YB1A 4BOSC 3CYMA 4UARA 4CDGA 3EWAA 5IIIA 1QCKA 2HHQA 3NZSA 3RN9C 3T3NA 1I42A 2KHVA 2LUEA 3HM3A 4ZRJA 4NM2A 4UBBA 3GZFA 5L1KA 3RB4A 2KJ8A 4GFJA 1V5TA 2ZVOA 3FAHA 4IWPA 2OXOA 2WDQB 2CPRA 2E5SA 2O2VA 7ICUA 1NBFC 3URYA 1F52A 2KWDA 2RDJA 2AX5A 4DCCA 3K9PB 1XLOA 1JRUA 4OVUA 1P7EA 2FMSA 4A6QA 3LVWA 2I9GA 2KWCA 2L05A 2VA3A 2F1IA 4ANXA 1D8YA 4HKZE 2DF4B 3AB5A 5DQGA 4ZHOA 4QZBA 3CNHA 5AM0A 5ALQA 5AK6A 4KLMA 2ZIWB 4KN7A 2D8CA 2JXTA 2JV3A 4Y2RA 4G11A 1A5RA 3AULA 5EWEA 1RPLA 5KG7A 1B0XA 2KHWB 4ICUA 5C2TB 2IOFK 2BKRB 4TQSA 2DAFA 4XUSA 3C19A 4K7WA 2RDIA 2N1VA 2J42A 4W9EA 1KLVA 3N97B 1CI4A 2KLCA 1FRDA 3THVA 1L4ZB 4HJKA 4F4ZA 1E8WA 2W8KA 3TIXA 4K7UA 3H0MB 1J2NA 4KLGA 3KFUF 3AN1A 3GU3A 4NXZA 2BZFA 1D6EC 3JSVB 2G09A 2FPLA 4LCDE 2Y0SF 4I2JA 5E6PA 2IJ0A 2QSDA 1CUKA 3PSIA 4P4OA 1SL0A 2XBBC 2H88B 4EE2A 5JU5A 1SJED 3QUQA 1PQSA 3IG8A 4R65A 3FILA 2KWVB 2K5PA 2DX5B 4YP3A 3ZNGC 2BW2A 4GXKA 2MBQA 1HTOA 2KN5A 3AE9B 2MRLA 7ICMA 3RPFC 1SZHA 3QXGA 2NBUA 4Q2JA 3RR7A 4W9HA 2KSOB 3HPOA 3U26A 3PX4A 1PGAA 4KLSA 2W43A 3QEBZ 3ECIA 1I4GA 1RYSA 4NQLB 3SEBA 3TBLD 2KOXA 3ICXA 2BQUA 9ICUA 4AOFA 3P4PB 4I6LB 1B22A 2N9XA 1EUVB 4LTUA 2BYVE 1TV9A 1GB4A 1RXWA 3SMVA 1KLNA 1SEBD 2FCQA 3ZJVA 2QMTA 4EBCA 3DHIC 4RH6A 2DPJA 5LLIA 1KL9A 1UWXA 1N56A 2RLTA 8ICQA 4U7CA 3M62B 1L7YA 1R4NI 4ITKA 3D6JA 1X6JA 4I27A 4YR2A 1JIHA 3VR9B 4DOAA 4F72A 1FM0D 4RQ7A 1OTRB 3MJ5A 1JUDA 4PS8A 5HMMA 1ZQRA 2QKQA 4NLKA 1MG4A 5AI6A 2GLSA 4I2GA 1RYJA 2INNE 2BCQA 1TK8A 2P66A 1LKYB 2BHNA 5D49A 3AV8A 5BYQA 7ICJA 2IMWP 3FC4A 1JQ4A 3GP7A 3D2NA 4FS2A 1MHXA 2MJ3A 1E9MA 5JHAA 2DZKA 3Q3FA 3NUQA 4EYIB 4KDLB 3U2SC 1FCCC 3M1YA 5DB7A 4PPXA 3OHAA 4IDIA 3TEXA 1LVHA 4NY0A 2QB0A 3WKCA 4G3XB 1S76D 3V05A 4C80A 1TKEA 2JWUA 4YFKA 2RD0A 2IO2B 2BPGA 5DDMA 1V8CA 3MABA 2UVRA 4KIKA 3MGVA 2XICA 1RXVA 1WSPA 3DCGA 2J4XA 8ICRA 2LGIA 4PZNA 4XZ4A 1EXNA 3TFRA 2DNFA 4RQ3A 5J29A 1YNTE 2GO7A 2JSVX 1VR9A 3A9JA 2ZIVA 1IGCA 3DQVA 1TY0A 3BVGA 4ICVA 3V6CB 4C8LA 1HJPA 3RUIB 3VRAB 5BMIA 4IR9A 4QZGA 3T8MA 3R9KA 5KFPA 1T0YA 2RGFA 4FULA 4WIPA 3N7PD 2JEFA 4NL9C 1I35A 4E74A 1HXYD 3N32A 2W9AA 4M9GA 2EELA 3JPSA 4M0WA 4ASWC 4JX1C 2BQ3A 1WWUA 3Q8FA 3QEAZ 3MR5A 4RQ5A 4TQ0A 1WXVA 1V97A 2ZNVB 4ZOHC 1QSSA 4DSLA 2B6GA 1KTKA 2H3ZA 4CYEA 5J8YC 2KTRB 4RNOA 3OJUA 2LBOA 2GOWA 3AE6B 1ZDVA 1C4CA 4FBUA 3W2DA 1JMLA 8ICBA 2RMMA 5HR6A 1JW9D 5IIMA 4P0PB 1L7PA 1BPEA 3CMMB 3KUZA 3Q8PB 3R8BA 3PW0A 4O3OA 5GTHU 2MBOA 3KUCB 4DXFA 4F5NA 2E1EA 4KGTA 2NPTA 3PLVA 5DBBA 9ICWA 1K53A 4LJXA 3Q3NC 1SE4A 2HI0A 3PLUA 3Q14C 2WXKA 3ONNA 2ON8A 4RU9A 5KG5A 1TAUA 5KG1A 1GNUA 3LYYA 1Q10A 3UQAA 5IP4D 4KLLA 1HZ5A 2PKOA 3V3XA 3N3KB 1T4GA 3RD2A 4ZRPA 3PZPA 3PZDA 2PTLA 3PGEA 1NYRA 4OZBA 2W04A 2RSUA 3RH5A 1N5WA 1XCTL 2NRZA 4IL6U 1VZ8A 4JMUA 1Z5SB 3KTQA 3H0LB 2KMCA 2OH2A 3ZNID 4JV2A 2ZUCA 2KZ3A 2R8KA 2ALZA 4CRXA 3N1ZC 3IHQB 4TUPA 1DRGA 1K1QA 3F5EA 4MACA 1G6JA 2NBWB 3Q3JA 1F0ZA 3HJEA 5ALTA 2F44A 2K60A 3T9LA 3EYZA 1TKGA 1GOZA 5AZHA 5J2HA 3HK0A 1NK6A 9ICGA 3RULA 2ZIUA 4PL2A 8ICEA 1FNWA 4F50A 3F2CA 1OQRA 3A0BU 4U6PA 2HE7A 4WQOB 4YVZA 4UAWA 5J0SA 1BUIC 2N4FA 3T3FA 2ZEQA 2ZUDA 2KJRA 1ZD5A 1NYQA 5ALJA 3PHWB 5J2BA 5KG0A 1S1QB 1D5ZC 3RBDA 2Q0ZX 3ZJUA 1VZ7A 7ICIA 3QARA 2WNMA 2A3VA 3D2SA 1K52A 5KFTA 3TFSA 3SD5A 1H38A 1PGXA 3GZNB 4PT5A 4ICAA 1ZQIA 2ODGA 1Q5WB 2WAQC 2DKZA 3TACB 2AQ4A 1L6VA 4W9KA 2AH5A 1NZBA 2N1WA 5AI9A 4Z6CA 4UB5A 3ZDDA 2C9WB 2FPMA 2G3QB 1IUEA 4LNOA 3KH0A 1NK9A 2DENB 1E8XA 2E6XA 2PMZC 2BVCA 1S0VA 1LB2B 2GBMA 1ZE3D 2BF8B 3TEWA 3BK1A 1Z00A 2HVIA 3O65B 3ZDTA 5DBCA 2EKIA 4DHZE 4ED8A 3DEEA 3UXNA 2KFNA 2QDFA 5KT4A 4TSSA 3W5VB 5FR6A 1F1HA 4JGHB 2LGYA 4LVSA 4EZJA 2L0FA 1ZQUA 2N1RA 1WWVA 4LNIA 3DBLB 2WXPA 3VRBB 3EHVA 4KMUA 2JH1A 4QZCA 1C78A 4J9NA 3MHSD 5AHXA 1SE2A 3DBRB 4ZDVA 1T6BX 1UHUA 3A9KA 2L83A 1M6YA 1L3VA 3IM1A 5AUKA 1SKWA 3RJKA 5AKLA 2AJQA 4F5PA 8ICHA 2C5LC 2MUTB 4QZEA 2KLGA 3BS7A 1UT5A 3SAHA 2BQQA 1KW4A 2E8OA 3KHRA 1YN5A 4FBJB 4DFKA 3B08A 5CHVC 3MGIA 4MF8A 3RBEA 3TUOA 4GLSC 7ICRA 2E8MA 1J7BA 3BWUD 9ICLA 4TMAB 1KOTA 1QLNA 2G4SA 4OJPA 2QCZA 4G50A 1TTNA 3GV8B 1YX5B 2WXHA 1UA1A 3JPRA 4MEXA 3VDZA 3ZNHB 4UATA 1E7VA 2NTSA 4M9LA 8ICOA 1WMHB 2B3AA 3AEFB 2K22A 4TV3A 4CNQA 3VH3B 2J0JA 4M8MA 1WXSA 2LXAA 3AEGB 1J97A 1QQ5A 4RPZA 5DPSA 2WXIA 4E71A 4JK1A 2FIDA 5L1MA 5J2KA 3TMPB 3IVFA 8ICJA 3BYYB 4FHKA 2M9NA 3HKZC 2PEAA 2NV3A 2B0CA 4FHJA 2W9CA 1TJEA 9ICAA 2INCC 5AI5A 1MSWD 1HQRD 9ICQA 2A5UA 3RFAA 1ZP0B 2LYHA 3CF6E 2BGFA 2MX2A 5KHOA 4GC7A 2LHDA 2NBVB 1S0MA 4Z6DA 4PL1A 2XCAA 2WAQF 3LWMA 5KAIU 4GXBA 2FI1A 2IOHA 2HHTA 2LJIA 9ICMA 3AM9A 2EH9A 1XO3A 1WCLA 4F5RA 1KM7A 8ICKA 3APDA 4BKSD 4P6VF 1X42A 1ZGUB 3C1ZA 4FZLA 3RTVA 5DKWA 1AW7A 2MSNA 4UAYA 3Q69A 1CK1A 1MVKA 2J6SA 5J2FA 3Q8MA 1WX8A 2KKVA 2FCMA 2LMCA 4MEYA 4ZYNA 3AQEA 4Q44A 2NRTA 4ECRA 1ZQJA 1NK8A 2CR5A 3DVGY 3T5LA 3RR8A 1YZ6A 7ICTA 4QZFA 4O3PA 2WDRB 2WP9B 2C7HA 1NJZA 3VVWB 3T5JA 1V5OA 3GV5B 4P1BC 5DB9A 8ICMA 1E7UA 2BT6A 2M8SA 1SWWA 1JRPA 2QARA 3AEEB 2KMDA 1T3NA 1R4MI 1NNLA 3UMBA 4A8EA 3RB6A 3EUB2 2C22A 4OO1J 4C8KA 2OEHA 4DS5A 3ALRA 3G6XA 3LYSA 3H7PA 2L5YA 9ICNA 4OJOA 4JE3B 4OJLA 2JXXA 3WA0A 3ORYA 3FDSA 1JWSD 3AEAB 3CP8A 3C5FA 2AXTU 4O9MA 1IM4A 1QLBB 3AI5A 4FA6A 3PY8A 4R8UB 1KN5A 2W55A 2F2AB 2KMAA 3QA8A 2CJNA 3WK6A 2CHZA 1DOQA 3A33B 4AQ7A 5ALYA 4JWMA 2WXQA 1B43A 3ETLA 1RYRA 2EZZA 4DL3A 1X9XA 1F2RC 4DF8A 4DOCA 2SAKA 4GXJA 1WGRA 3U30A 4A3OA 2A1AA 3OJ4B 5CWRA 1GUAB 2L52A 1FO4A 2KN4A 3SHQA 1XU4A 1IXRA 4DFPA 2WXOA 4DFDA 1N62A 4O3RA 5L1LA 4TUSA 1H8CA 5KFNA 4K4HA 2EMTA 2OOBB 4KZCA 2NRXA 5KL1B 3HKZF 1SZPA 2RHFA 1VLBA 1MPEA 2I1JA 5AZFA 4HKQA 2L1AA 1YT3A 3ZJTA 3QHTA 2W3SA 1ZQGA 5J0XA 3KD3A 1COOA 5B66U 2LI6A 4UAZA 2ACZB 4HDQA 5D6JB 2BYFA 3UGBB 4B9VA 3SR6A 4YG2A 4YTPB 4YN4A 2CHXA 5KFFA 4GDKA 1OFFA 1ZQEA 2KD0A 1V1OA 2J0MA 2KJHB 4JQWC 4DDGD 1TAQA 2JUOA 4G3IA 2R2OA 2K0PA 4O1NA 4E3CA 3ZTDA 4NLNA 2IBKA 4MFAA 4ZH4A 4F1SA 3BVMA 1Y88A 1QZEA 3UIPB 1KKXA 1E8YA 2N9EB 3MFIA 1V1PB 4FJZA 5EWFA 4RQ0A 5KHQA 4QW8A 1BXTA 4II2B 2D6FC 5AZGA 5JXVA 3WKBA 2ASLA 4ECVA 1WRDB 3P4SB 3W1SC 3UF8A 4DSEA 4PYUA 1L7NA 1J7AA 1KLGD 2RR9A 4DK5A 3LDAA 3L17A 4BVUC 2A19A 1X66A 2KVZA 3V7LA 4Y2XA 5J0PA 2KC2A 1YJIA 4Z6EA 4ANWA 1OEYA 9ICPA 1XT9B 4M8NA 1NJYA 2V3NA 1CQVA 1UZXB 3UMCA 2JEIA 3IT6B 9ICHA 2LASA 3H6NA 2W9MA 5JTIA 1HA5A 3SI8A 1ZQSA 3H7IA 2R61A 2Y3AA 3HVZA 4R3DA 3F2DA 1UH6A 2WS3B 3MBYA 4DL6A 2CKHB 4OJ6A 3QQ8B 3BQ1A 3NTUA 1AN8A 3OTQA 2D10A 3M8SA 4LZDA 1VCBA 5EE0A 3BQ7A 3EZ5A 1LXDA 3HM6X 2KN7A 4Y2UA 3KBBA 2D07B 4M04A 5HI1A 1FEZA 3C2LA 2N9KA 2QB1A 3FILB 2KJ5A 1YQ4B 2EMSA 1UNSA 3GV7B 3J9CA 4EKUA 2GBKA 2ZZPB 3QAQA 1AQ6A 4WJOA 4Y2PA 3L3FX 3TCAA 2WHEA 4BXOA 2INDC 4B9MA 4DEZA 2JRZA 1UBIA 2MA9B 3OG5A 5HMLA 1LM8B 2YVCA 1D4BA 4ECQA 2F76X 3GIKA 2N7JA 3UQ0A 1AWDA 3APFA 4AUQC 2KDEB 1MFWA 2O6VA 3VXWA 4KLHA 1WUDA 2KQ4X 3Q3OC 3OSNA 1P1AA 3SYZA 1Z19A 4IOIE 1PGBA 2PI4A 2ZTCA 4YXDB 1T0SC 1DGSA 3PSEB 4GMVA 1ZJNA 2DQNB 3PX6A 1KF6B 1X6IA 2AQ3B 4EX6A 3RZFA 3V6JA 4K3BA 7ICKA 2VA8A 1S0NA 3QZ7A 4YTNB 4ARIA 4XGAB 3RRGA 3N1YC 4EOYA 2MJEA 4KKJA 2AL3A 3EC8A 2DFLA 1WJUA 3C1YA 2K25A 3KZXA 1FXTB 3UXPA 7ICHA 4MJSA 1MG8A 2HOQA 2KDIA 2XN9C 4RQ2A 4JB3A 2KVCA 4EEYA 1ENFA 4B0EA 4FZNA 3SDLC 2Y9UA 4KGSA 3PSPA 4OD0A 3ZUNA 5AM4A 3L13A 3Q8SB 2FUHB 1F5SA 3FKYA 5KFCA 7ICLA 3ZYYX 1BVSA 2IZVB 5KFLA 2MJDA 3VR8B 3RZWC 1ZPSA 4WWPA 3A4RA 5KFXA 1D9FA 1SBBB 1PUZA 2BB5A 4J9PA 4DHJB 3C2KA 5ALPA 4AJYB 3F5AA 2FCSA 4M47A 1U48A 3MC9A 1RQNA 1WXQA 1WM2A 3QCAA 5KT6A 2MH7A 1YQBA 2DZJA 3C0RB 5EE3A 2JGAA 5AK5A 2QB0B 4K81A 1U49A 4RGOS 1XCQL 3PHXB 4NJCA 2MEKA 2J53A 3RNGC 1M4VA 1D3ZA 4Y2TA 3RH6A 1Y8RC 1A77A 3KYCD 3DHGC 3C29A 2M0XA 3R2TA 2CRXA 3AU2A 3VTVA 4WQMA 1R7SA 2FE8A 4XE0A 2M19A 2W9BA 1XC9A 3A9JB 5BYRA 3AL0B 4ED3A 5ALNA 1D8BA 2K3UA 4WWMA 4KTQA 1QQ7A 4YD2A 1T0RC 3P42A 3Q6BA 2LM4A 2OEDA 4C4VA 4GXIA 1SV4A 4RQMA 2VRRB 4WJPA 3CW2C 1NDDA 1L0YB 2BYEA 2Z0DB 2J6TA 3DHHC 4M0WB 4KITB 2IDYA 4Q43A 1T94A 4FJVB 4B0MA 7ICQA 4YMOA 2V9WA 3QWZB 2ASDA 5KFAA 5ALXA 5D7GA 1TY2A 5KFQA 4ZHPA 3Q8CA 1QF6A 2JYTA 2BCUA 1QOAA 3ISDA 4F8CB 2GMIC 1SE3A 4QWBA 4GDLA 3WALA 4EEKA 2KYWA 3P1MA 4PGYA 5JZEB 8ICVA 3RNAC 2C60A 1WX9A 4C8NA 3AE3B 3R7RA 4YMNA 3RF9A 2BPFA 3PV1A 4J9LA 1L8LA 3UXOA 4PJ0U 5J2EA 1FD6A 2NPTB 3KHLA 5DCNA 3IP4B 4IR1A 1ZQHA 2J0KA 3H9DA 5KFYA 3UI3A 4YXJA 2AGPA 2I1QA 2AGOA 2BKEA 1U47A 1ZD4A 1ECWA 4HJGE 5HG2A 4KLEA 3RNEC 5C1ZA 2CHWA 5ALDA 5J0YA 1HEKA 5J0OA 1I7HA 2GBRA 2UVVA 2C7NB 3V6HA 4B9SA 1Z4OA 3HX0A 2Z0EB 3QU5A 2ZTDA 1X9WA 4M9NA 4ECWA 2L0TA 3K1ZA 4UW9A 2DZIA 1HE8A 4AYBC 4PGQA 1WGHA 8ICGA 9ICRA 5L9XA 3DVGX 4YXMA 4ZRQA 2K8BA 2PFNA 2W7PA 4KLQA 3GE8C 1L6NA 4M00A 5CRXA 1WWTA 8ICTA 2GH1A 4EX7A 4IQTA 2LPEA 1ZQPA 4PYZA 1STEA 3IG5A 4QZHA 3M9MB 5AKKA 2G9HD 3H8SA 5CB1A 4IKGA 3AU6A 4MGKE 2ZIUB 3MTNB 1IG6A 3ZDEA 5KFVA 2B76B 4NJ7A 3ZIMA 1NI3A 3UM9A 3MP9A 5DB6A 1L7MA 3BS5A 3MR3A 1EM7A 1XXGA 1DXSA 4DSFA 4N59A 2ZG6A 2FLNA 4ECYA 2UVWA 3IHPC 2C2EA 1TYGB 7ICEA 5CP2A 4BWJA 3PNCA 4IRKA 4DBGA 3EFCA 2HBMA 3QX1A 4RGMA 1K51A 3EA6A 5ALIA 1SB3C 1BPYA 4FFDA 5DG8A 9ICBA 4L1BA 5FK9C 1ZQQA 2KP7A 2LVQA 4QWEA 1UD7A 1IGDA 1MC8A 2WF8A 3PRZA 3WCQA 5ALOA 1XS9D 3AE7B 4RGNA 4K7SA 1FXAA 4FJYA 4MEMA 3H7SA 3GZNI 1LGRA 2HOIA 1C9FA 1JWMD 4O3MA 4CGZA 1YX6B 1SF0A 2IPKD 4IG7B 2KIWA 2JU6X 2K8HA 4XYCA 3PRMB 3UQ2A 5KG6A 4MHVA 1Z00B 1XNSA 1J7CA 1U9LA 4E0DA 3T3OA 1NEKB 2MP2A 5DQHA 1TIFA 4WH4A 1NI2A 2KD1A 1NOMA 4EZLA 4QWCA 2IO1B 1DK2A 4KN4A 2HHSA 4JV0A 3I76A 5BOLA 2WTFA 4QZAA 1I4QA 3HIZA 2WXGA 3T79A 1HEZE 2H3QA 1QOFA 3B2FA 3L08A 4HRSA 4W9JA 5IAAC 2KAJA 3PREA 3ZO5B 3IBEA 1I4HA 4MDKE 1SXDA 5KL8B 2ZVNA 3DBLI 3ALBA 2EZYA 1Z3EB 4AYBF 2KX0A 2A1JB 2N9LA 2BDUA 2I1KA 3DBRI 2G45B 3R2IA 1ZXIA 3N4MB 4BUGA 3MC0B 1EWCA 1MI0A 5AKEA 5DB8A 3A1QA 3Q2AC 4UBCA 2RDHA 5HKHA 4XQ8A 5J0QA 4HXDA 4K1RB 1L0XB 2ZW0A 3JSVA 3RJEA 2MBHA 2RPQA 3OJ3A 5DDYA 3PVLA 1QT9A 4BX9C 5TR5A 5CHWA 4II3B 3OLMD 2WF7A 3WK4A 2L7RA 3ISCA 1RM6C 4MH8A 4I6NB 3MC8A 5AKYA 5IINA 7ICSA 1V9PA 2ISPA 2RDGA 5AIAA 1UA0A 1HUOA 3NHEB 2ICIA 1YJJA 2LGXA 2LVOA 4KSLC 2NRWA 7ICPA 1IYFA 3IRUA 4LNFA 1BPDA 1J8CA 4P0QA 4Y2VA 2MW5A 3GDXA 2XVTA 4J9OA 2YMLA 2XY7A 3Q8RB 1X1MA 4DHJD 2MCNB 1CEZA 4FXCA 1TVAA 3QNMA 2IY1B 3W9CB 4IRCA 1SIJA 4N58A 5DBAA 2MSED 4C56C 4B9NA 2QC8A 3UMGA 3KYDD 4Y2YA 2L76A 4XRHA 4KMOB 4OHJA 1Q0WB 4MH0E 3HW8A 4RNAA 2JH7A 3V6KA 3RJFA 2GBNA 1CJEA 4UAVA 3P2BA 3BQTA 5H2FU 5ALKA 1OQYA 9ICXA 2M0AA 2FPKA 2JHDA 5ALLA 4C7YA 1KFTA 1ZUD2 2JYEA 1GJZA 2KTQA 2ZCBA 2LI5A 1MHHE 2YLMA 1QKZA 1RWSA 2BCVA 3NS1A 4RT3A 1RFKA 3QZ8A 1Q46A 2XY6A 4I29A 3MC1A 5KG3A 5A0LA 1WX7A 4RUAA 1U4AA 1IBXB 2QJLA 2K39A 4F4YA 3RB3A 3RT3B 4MFCA 1HIWA 3L0WB 2P6RA 3TKAA 3KHGA 4S17A 4HLEA 2UWQA 3H0RB 5ALZA 3H8WA 1WR1A 5L83A 2PFOA 5TSSA 3NASA 1JWAD 4I2IA 2Z7JA 3FYHA 1ZJMA 5KFBA 3ETRA 3H7PB 1O08A 1T3QA 3WK7A 4I2EA 4IQWA 3N9YC 5E6NA 2FMQA 2J7QB 4JL9A 4LLGM 2VKQA 3N1XC 3OSPA 4XDDA 4J9MA 3ZDBA 4DLEA 2X8XX 4P7IA 4PGXA 1IV8A 1QH9A 3OJSA 1Y56A 4MGIE 3F2BA 4F5QA 1CRXA 3CIRB 4DL7A 3E2EA 1QOBA 4Q45A 2Y5CA 3K75D 2GBJA 4GN1A 3DDCB 3JVZX 2HHUA 1Z1BA 3QU4A 2WGSA 2D3DA 4PHPA 2BS4B 2KFKA 4XWTA 4KLOA 1D5XC 1MN8A 1VJ5A 3NUHB 1J19A 1V2YA 1ESFA 2DL0A 4DL2A 3VUWA 3T5KA 2WB1C 5CEHA 2Y1JA 1QSLA 1EWYC 3AEDB 3B0AA 9ICIA 4AWJA 4B9KA 4ARCA 2VJ5A 2KXJA 4UB3A 2NTTA 5C0YA 4B9LA 1P7DA 5BPCA 4YSZB 1OW5A 3E0FA 4TUUA 2KT7A 8ICXA 4F2RA 1UBQA 1ZOLA 4ECTA 3ZI4A 3B0YA 2G07A 1SGHA 4EUTA 4HPPA 4YT0B 2W3RA 1YJ1A 4FLHA 2KC1A 2G06A 1FIQA 2KE7A 4G9BA 2W03A 4UB8U 1BPXA 3PO0A 1KLUD 3ZGZA 2ZPYA 1TE2A 1YN4A 3JPNA 5DLFA 4GDKB 3EFUA 2PPHA 4RQ8A 1FNUA 4ANVA 2KTRA 5KT7A 4MFFA 2G1EA 2K6QA 3KQ4A 1PFDA 4OZCA 5E6JA 3TQ1A 4P0PA 3WU2U 2C2RA 3DBHI 4DXAB
chains in the Genus database with same CATH topology
2WU5B 2IGDA 4TQ1A 1YJIA 2KDMA 3TSSA 1EU3A 2V3NA 3AN1A 1CQVA 1I4PA 1VJKA 1D6EC 2D5GA 2WQYB 2BYTA 3IT6B 4D2KA 3KLSX 2IJ0A 1GAQB 1HA5A 2QSDA 3BIID 3IT4B 4EE2A 2AQ1B 2H88B 2R61A 2Y3AA 3HVZA 4OVZA 1SJED 4R3DA 2WS3B 1OQQA 1KFYB 3BYTB 3FILA 1AN8A 2K5PA 1XLPA 4RF1A 2DYOA 2BW2A 5EE0A 3AE9B 1BMLC 1LO5D 3I9V1 3RPFC 2AQ2B 4Q2JA 5HI1A 2Q5WD 3W1SA 1PGAA 2N9KA 1I4GA 3FILB 1YQ4B 2QIEB 3SEBA 1UNSA 3J9CA 2WLBA 3P4PB 5G5GA 1TKYA 3BZDB 3AE5B 4LTUA 4RFBA 5T8IA 1GB4A 1JCKB 2YEPF 3O13A 1SEBD 4RCOA 3ZJVA 1D4BA 2N7JA 2QMTA 1AYFA 3B2GA 1AWDA 2HTME 4RH6A 2KQ4X 1L6UA 1UWXA 2DWQA 4WAFA 1ROEA 3AMZA 4IOIE 5I4DA 1PGBA 1DOYA 4YXDB 4ITKA 1KF6B 3VR9B 4USAA 2AQ3B 1FM0D 3MJ5A 2DYMA 4YTNB 4ARIA 1JROA 5HHDG 3E56A 2CJOA 4YSXB 3ABVB 3DWMA 4ZYSA 2MJEA 4KKJA 4YSYB 1TS2A 1RYJA 3ZQ4A 4KGRA 2INNE 3NRZA 1HZ6A 2XN9C 1ENFA 4B0EA 1E10A 4KGSA 1TZOA 3AV8A 5BYQA 4NAWB 4YTMB 3FC4A 1JQ4A 3GP7A 2KMMA 4NZLB 3IXSA 2MJ3A 1MHXA 1E9MA 3U4EG 3ZYYX 1UWMA 2MJDA 1SXTA 1QQRA 2ZW1A 1FCCC 1ZPSA 5D3IB 3U2SC 3VR8B 1GPXA 4HEA1 2IGHA 1C79A 4IDIA 4A90A 1SBBB 2JX5A 1I4XA 2V3PA 3TEXA 1XF5L 4CQNA 1FNVA 2BB5A 1XEEA 3V05A 1N5XA 3PZ8A 2V0GA 4C80A 1TKEA 2JWUA 3I57A 2DLBA 3HVDA 1V8CA 3C8YA 3NVZA 1WSPA 1WXQA 2I38A 2J4XA 1L5PA 2LGIA 2MH7A 5GXGB 5EE3A 4A8XC 1YNTE 4RGOS 1XCQL 3SFEB 2JSVX 4NJCA 1VR9A 2W54A 1IGCA 2MEKA 2J53A 1M4VA 1TY0A 3BVGA 3VRAB 5BMIA 2ONQA 3R2TA 4XWWA 4WIPA 4WQMA 1R7SA 2FE8A 4XE0A 4US9A 2M19A 2W82A 4J3OD 3KWLA 1WGKA 1HXYD 2EELA 2GI9A 5BYRA 4M0WA 4JX1C 2FUG1 2K3UA 2WXJA 1C76A 3AE1B 3Q8FA 4WWMA 3P42A 2OEDA 2I2YA 4TQ0A 2LHEA 2JQRB 1V97A 1L0YB 4ZOHC 1DOIA 1KTKA 2IDYA 3AE6B 1C77A 4B0MA 1ZDVA 3NZ3A 4JPSA 1C4CA 3W2DA 1JMLA 5MPOA 2RMMA 2YEPB 5D7GA 1JW9D 1TY2A 1C4AA 3AE2B 3TEYA 3R8BA 4ZHPA 1B9RA 3DWGC 3Q8CA 1QF6A 1QILA 2JYTA 4DXFA 4US8A 1QOAA 2INPE 4A55A 1SE3A 4KGTA 1UGJA 1K53A 3P63A 1SE4A 3W5UB 3P1MA 1P7FA 4RF0A 4C7ZA 2WXKA 2ON8A 3AE3B 3NVWA 3LYYA 4YWGG 1Q10A 1FD6A 3EGRA 4GDLB 2PMVA 5G5HA 3P4QB 1HZ5A 2PKOA 3V3XA 2WXFA 4ZRPA 1JWBD 3UI3A 2PTLA 1NYRA 4OZBA 1XCTL 1N5WA 1VZ8A 4HJGE 5HG2A 1DOXA 1B1ZA 1I7HA 3L4PA 4MACA 2WDVB 3KWVA 1F0ZA 1VRAB 4ZRQA 3RFZB 1TKGA 1GOZA 2BB6A 1DYQA 1WWTA 2BS2B 1PUTA 1FNWA 1E6EB 3Q8EA 4DXGA 1OQRA 1IBXA 1XLQA 2Y5PA 2OHFA 3IAM1 1STEA 1BUIC 2IGGA 2CU3A 4NAMA 3GS2A 1ACCA 1NYQA 2G9HD 3P4RB 4IKGA 5H8YE 2B76B 1D5ZC 1FRRA 2VZKD 1NI3A 3MP9A 5HFYA 3ZJUA 1VZ7A 2SEBD 2WNMA 2E3TA 1EM7A 1XXGA 2KACA 1K52A 2WXMA 4N59A 4LK0M 2V4IB 1PGXA 4PT5A 1TYGB 3HRDD 2QILA 4MT5A 1L6VA 4RGMA 3Q8AA 1K51A 3EA6A 1SB3C 4L1BA 5FK9C 1IUEA 5EE1A 1IGDA 2LUMA 2X38A 3WCQA 3AE7B 4RGNA 3Q8BA 1FXAA 4HROA 2PIAA 2XNAC 2E6XA 3BK2A 3U7ZA 3B9JA 2LEKA 1ZE3D 3TEWA 3BK1A 1FEHA 1C9FA 1JWMD 2EKIA 1FCLA 4TSSA 1JWUD 3W5VB 1SF0A 2IPKD 1ZDXA 2JU6X 2WXPA 3VRBB 3U52E 5BYSA 1E0ZA 1J7CA 1C78A 5BMGA 3T3OA 1E7PB 1SE2A 1NEKB 1ZOYB 1TS3A 4WH4A 1T6BX 2L83A 1UUPA 1EU4A 2Z8LA 1KH0A 1F77A 3LB8C 5AUKA 1I4QA 2DBYA 1V1PA 2WXGA 1HEZE 2HDEA 3B2FA 1QOFA 4HRSA 1YN5A 4KKIA 1N63A 2KAJA 5EE9A 5LNK1 1I4HA 2JZPA 4GLSC 3TUOA 1J7BA 2NMQA 3BWUD 4TMAB 4OZAA 2N9LA 2PW9A 3R2IA 2WXHA 1ZXIA 3MC0B 1EWCA 1MI0A 3AE4B 1T5XD 2RDHA 4WURA 2NTSA 3NVYA 5D3DA 2WXNA 3AEFB 1YN3A 2K22A 1VDVA 1N61A 1L0XB 2M56B 1F2RI 2ZW0A 3AEGB 1SJHD 5AUIA 1QT9A 2WXIA 1K50A 3AE8B 1VZ6A 1RM6C 4MH8A 3BYYB 2BBCA 1XLNA 2RDGA 2TSSA 2BS3B 1YJJA 2ICIA 4A9AA 1TJEA 1HQRD 5C3JB 2K9XA 1ZP0B 2LHDA 4MM3B 3SFDB 1L0VB 2PVOD 4P16A 2H89B 4FXCA 3W9CB 5FR3A 2LJIA 1SIJA 4N58A 3AM9A 2WXLA 4H2AA 1XO3A 4C56C 1TS4A 1QOGA 1A70A 4P6VF 4RNAA 4OHJA 3AECB 2BTEA 1N60A 1AW7A 4DQOC 2GRIA 2GB1A 1CJEA 3Q69A 1C4PA 1ZXHA 3H8HA 1CK1A 1MVKA 1YQ3B 2M0AA 2LMCA 4JWSC 4C7YA 5BMHA 3VQIA 1ZUD2 2JYEA 1JALA 1D5MC 2WDRB 1MHHE 2WP9B 4UDUC 1QKZA 2WU2B 1KRHA 1GB1A 1TS5A 2WXRA 1RWSA 2BT6A 2FBWB 4KX6B 1JRPA 3NS1A 3AEEB 1RFKA 4AS1A 1DGJA 5H92C 3EUB2 1L4DB 1IBXB 2QJLA 2J52A 1PYWD 3PZ7A 1WRIA 3BVZA 2PLPA 4JE3B 4OW0A 4L23A 5FKAC 1JWSD 3AEAB 3GB1A 3IAS1 4N6EB 3TEZA 1FXIA 1QLBB 5TSSA 1JWAD 1PDXA 1FFUA 2QEJC 2W55A 2CJNA 3ETRA 1I4RA 4AQ7A 1T3QA 3N9YC 4LLGM 2WXQA 4RGTA 4JWUC 2LFIA 1YMHE 4XDDA 1F2RC 2SAKA 1ET9A 2RPVA 1NENB 1Y56A 4REZA 3CIRB 2L52A 1FO4A 3CWIA 2KN4A 2L32A 2Y5CA 1QOBA 4L2YA 2WXOA 1N62A 2BS4B 3T3NA 4XWTA 1VLBA 1MPEA 4HKQA 1D5XC 2L1AA 3NUHB 3HUIA 1NVID 1SSNA 3ZJTA 1ESFA 2W3SA 3LXFA 3FAHA 3AEDB 1EWYC 2WDQB 1ET6A 4ARCA 2ACZB 2NTTA 3URYA 3AH7A 2KWDA 3SR6A 2AX5A 4YTPB 4YSZB 1XLOA 1P7EA 4A6QA 1OFFA 1V1OA 4YT0B 4HKZE 2N0SB 2W3RA 3AB5A 4ZHOA 1FIQA 2K0PA 4O1NA 4XDCA 3PO0A 1WYGA 1KLUD 1CZPA 3NVVA 3BVMA 3ZGZA 2JXTA 1V1PB 1YN4A 4GDKB 3MFGA 1FNUA 3E9SA 1BXTA 2G1EA 2PVGC 5C2TB 5JXVA 3KQ4A 1PFDA 3OWEB 4OZCA 5E6JA 3P4SB 3AEBB 2J42A 1FMAD 2VZKB 1J7AA 1FRDA 1KLGD 1FFVA 1L4ZB 3MHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3T A;  1A70 A;  5EE3 A;  4P6V F;  2WU5 B;  3SFE B;  3AEC B;  1YJI A;  1N60 A;  4N59 A;  1CJE A;  2W54 A;  1YQ3 B;  1TYG B;  3HRD D;  3AN1 A;  1VJK A;  2WQY B;  4JWS C;  3VRA B;  1L6V A;  4C7Y A;  4WQM A;  1R7S A;  4US9 A;  1SB3 C;  1ZUD 2;  2M19 A;  1JAL A;  3KWL A;  1GAQ B;  1WGK A;  5GXG B;  1IUE A;  2WDR B;  2WP9 B;  3BII D;  2WU2 B;  1KRH A;  4JX1 C;  5EE1 A;  2H88 B;  4WWM A;  1RWS A;  3WCQ A;  3AE1 B;  3HVZ A;  2BT6 A;  3AE7 B;  2WS3 B;  2FBW B;  4KX6 B;  1JRP A;  3NS1 A;  1FXA A;  1OQQ A;  1KFY B;  1RFK A;  2PIA A;  3AEE B;  4HRO A;  1DGJ A;  2K5P A;  2JQR B;  1XLP A;  1V97 A;  3B9J A;  4ZOH C;  2LEK A;  3EUB 2;  5H92 C;  1DOI A;  2QJL A;  5EE0 A;  3AE9 B;  2EKI A;  3AE6 B;  3RPF C;  1WRI A;  3W5V B;  2Q5W D;  1SF0 A;  5MPO A;  1JW9 D;  3AEA B;  4N6E B;  1YQ4 B;  3AE2 B;  4ZHP A;  1B9R A;  1FXI A;  2QIE B;  3DWG C;  1QF6 A;  1QLB B;  3VRB B;  1JWA D;  4US8 A;  1PDX A;  1QOA A;  2WLB A;  1J7C A;  1FFU A;  3P4P B;  5G5G A;  1TKY A;  1E0Z A;  2W55 A;  1E7P B;  1NEK B;  1ZOY B;  2CJN A;  3AE5 B;  4LTU A;  3ETR A;  3P63 A;  1T3Q A;  2L83 A;  3W5U B;  3P1M A;  4JWU C;  4C7Z A;  3LB8 C;  1AYF A;  3B2G A;  1AWD A;  3NVW A;  2HTM E;  3AE3 B;  5AUK A;  2DBY A;  1L6U A;  2DWQ A;  1NEN B;  3B2F A;  1QOF A;  1ROE A;  4HRS A;  3AMZ A;  5G5H A;  3P4Q B;  3CIR B;  1DOY A;  2L52 A;  4YXD B;  1N63 A;  1FO4 A;  2KAJ A;  2PKO A;  3CWI A;  4ITK A;  5EE9 A;  2Y5C A;  1QOB A;  1KF6 B;  3VR9 B;  1JWB D;  4USA A;  1J7B A;  1FM0 D;  1NYR A;  1N62 A;  4YTN B;  2BS4 B;  1JRO A;  1N5W A;  2CJO A;  1ZXI A;  3ABV B;  3DWM A;  4YSX B;  3AE4 B;  1VLB A;  2MJE A;  1DOX A;  4YSY B;  3HUI A;  1NVI D;  1RYJ A;  3NVY A;  3AEF B;  2W3S A;  1I7H A;  2K22 A;  3LXF A;  3NRZ A;  1VDV A;  1N61 A;  3FAH A;  1EWY C;  2M56 B;  2WDQ B;  3AED B;  3L4P A;  3AEG B;  2ACZ B;  5AUI A;  2WDV B;  1QT9 A;  1E10 A;  3AH7 A;  1F0Z A;  3AV8 A;  3SR6 A;  2AX5 A;  4YTP B;  4YSZ B;  3AE8 B;  1XLO A;  4YTM B;  3FC4 A;  1RM6 C;  1JQ4 A;  1OFF A;  2KMM A;  2MJ3 A;  1TKG A;  1E9M A;  1XLN A;  4YT0 B;  3ZYY X;  2N0S B;  2W3R A;  1UWM A;  3AB5 A;  4ZHO A;  2BS3 B;  1YJJ A;  1FIQ A;  2MJD A;  3VR8 B;  1WWT A;  4A9A A;  1GPX A;  1TJE A;  1WYG A;  2BS2 B;  1PUT A;  3PO0 A;  1CZP A;  3NVV A;  1E6E B;  4IDI A;  5C3J B;  1OQR A;  2JX5 A;  2K9X A;  1ZP0 B;  1XLQ A;  2OHF A;  2G1E A;  1N5X A;  4C80 A;  1TKE A;  2PVG C;  5C2T B;  3SFD B;  1PFD A;  1L0V B;  2CU3 A;  2PVO D;  2H89 B;  3P4S B;  4FXC A;  1NYQ A;  3P4R B;  1V8C A;  3W9C B;  3AEB B;  5H8Y E;  3NVZ A;  1FMA D;  1SIJ A;  4N58 A;  3AM9 A;  1WXQ A;  1J7A A;  1FRD A;  1L5P A;  1FRR A;  1XO3 A;  1FFV A;  1NI3 A;  2B76 B;  2MH7 A;  1QOG A; 
#chains in the Genus database with same CATH topology
 5AM1 A;  3M95 A;  1EO6 A;  3PW7 A;  2ZJD A;  3RJJ A;  1SKS A;  2PE6 B;  3EPI A;  1PVR A;  3QX7 A;  4GOC A;  2K4I A;  2MRP A;  3TSS A;  1V81 A;  4QW9 A;  2XGQ A;  3RNF C;  2WQY B;  4DQI A;  2VH1 A;  5AKH A;  3IV6 A;  4ED1 A;  2LJ5 A;  2YX8 A;  1TK5 A;  4RT2 A;  4W9C A;  4D2K A;  3GE3 C;  4KX3 A;  3V7J A;  1D8L A;  3VAW A;  3RB0 A;  4DWI A;  1A76 A;  9ICS A;  2HSZ A;  3PR5 B;  1OQQ A;  5KFK A;  1SIF A;  4ELT A;  2LGS A;  4HCN B;  5AK4 A;  4Y2Q A;  2Q4T A;  1XLP A;  2FLL A;  2V4L A;  3NS8 A;  1F44 A;  2EAN A;  1LO5 D;  3I9V 1;  4NLZ A;  3JW0 X;  2Q5W D;  5IOI A;  2H3F A;  1E8Z A;  5EDS A;  4QZI A;  4MGZ E;  2PKE A;  3WIM A;  2KDF B;  1PVQ A;  2WLB A;  1ZQX A;  4GIV A;  3MFH A;  5G5G A;  1TKY A;  4KX5 A;  5J2G A;  4LJO B;  4ELU A;  4RFB A;  3SAF A;  1UGM A;  8ICF A;  4O3S A;  4URK A;  1AYF A;  3B2G A;  1ZRN A;  2HTM E;  3VFK A;  4CO7 A;  2DWQ A;  1L6U A;  4WAF A;  1MA7 A;  4P1C C;  2AU0 A;  1SE9 A;  4HYK A;  4O0I A;  7ICO A;  1DOY A;  3TI0 A;  2WB1 F;  2W11 A;  3SZ2 A;  4BXO B;  2ESE A;  5AKJ A;  3LJ3 A;  4USA A;  1K8R B;  3M8R A;  2G4D B;  2JZ3 B;  2DYM A;  2LVP A;  2KAN A;  2LYA A;  2O6V B;  5CR0 A;  4ECU A;  2R8I A;  1WZ3 A;  4KDI C;  5HHD G;  3E56 A;  1JXL A;  1YD8 U;  3ABV B;  4NAW A;  4MF2 A;  1SV0 A;  1P0R A;  4IC7 B;  4Y2J A;  5AI0 A;  2XCP A;  2R8J A;  4YSY B;  3V6E B;  1QTM A;  3C23 A;  3QYP A;  1MQ3 A;  3NRZ A;  5L1J A;  5E79 U;  5J2J A;  1JN3 A;  4TUQ A;  3KHH A;  1ZQY A;  3EPG A;  3APC A;  1TZO A;  5KTQ A;  1WM3 A;  3I3T B;  1SL1 A;  4YTM B;  3G6Y A;  4EZ6 A;  1BNO A;  2KMM A;  4NZL B;  4K4I A;  3IXS A;  4EYH B;  2YMP A;  4RNM A;  1OGW A;  3N20 C;  1NK4 A;  1L3T A;  1L7O A;  4F5O A;  1QQR A;  2ZW1 A;  1KQQ A;  2N9P C;  3IG3 A;  2K6D B;  1RLF A;  4QZD A;  4HEA 1;  4RQN A;  1P3Q U;  4OVV A;  3PVX A;  4A90 A;  1E5W A;  1N48 A;  4CQN A;  3IDW A;  3PMN A;  5KFG A;  1FNV A;  9ICO A;  1V6E A;  4DHZ B;  4NJ8 A;  4PHA A;  1ZQL A;  3PZ8 A;  2V0G A;  2EAO A;  3I57 A;  5KFJ A;  2JZB A;  1F0M A;  4F2S A;  1L5P A;  4KZ0 A;  9ICF A;  2KG5 A;  4A8X C;  1BT0 A;  3SFE B;  2M0N A;  3HP6 A;  4YCX A;  4W9I A;  1NKC A;  2H3V A;  3GQC A;  1M94 A;  1IPG A;  2AQ0 A;  4ACO A;  5D4B A;  1S5L U;  1TFR A;  3PX0 A;  2DAJ A;  2O2V B;  2ONQ A;  3UIN B;  2WX1 A;  4US9 A;  3R3M A;  4FN2 A;  2W82 A;  4J3O D;  2V1Y A;  3KWL A;  2KHQ A;  8ICN A;  1WGK A;  3T5H A;  3RRH A;  4GLX A;  2LZ6 A;  5HP4 A;  2WXJ A;  1C76 A;  4YMM A;  4HPM B;  4O3Q A;  4GIB A;  4LNK A;  8ICP A;  3H4B A;  4UQG A;  4C00 A;  1XO1 A;  2JQR B;  1WYW B;  5J2I A;  2W9B B;  1DOI A;  1YOV B;  5D94 A;  3WAO A;  2XO7 A;  4J9K A;  5KFU A;  2IYD B;  4PH5 A;  1C77 A;  4TKN A;  3VTW A;  4C4V B;  5MPO A;  2JMG A;  4F4K A;  1ZQF A;  3AE2 B;  4IM3 A;  3AU5 A;  3DWG C;  4DSK A;  3QJZ A;  3VC8 A;  1WY8 A;  2K8C A;  3I63 C;  2INP E;  4A55 A;  3VUX A;  5G2N A;  4JV1 A;  1IP9 A;  1N2X A;  3AU4 A;  5D2M B;  3W5U B;  4DOB A;  4RF0 A;  3BQ2 A;  4C7Z A;  2BQR A;  1E90 A;  2KX3 A;  2FMP A;  2VA2 A;  4EZ9 A;  3DVN V;  3J81 j;  2BPS A;  2JPH A;  1DK3 A;  4W9G A;  1ZET A;  2DZM A;  5KFI A;  4YWG G;  4GDL B;  2PMV A;  1XSN A;  5G5H A;  1QQ6 A;  2KQ7 A;  3P4Q B;  4EFO A;  5IO9 A;  4NLC A;  2KEY A;  1U4B A;  2CU1 A;  2FCN A;  3ZD8 A;  5AKX A;  2NYV A;  2I6X A;  5KFO A;  1JWB D;  3WK5 A;  1V86 A;  2K4E A;  3WKD A;  5IKC M;  4M6W A;  1ZQB A;  2AGQ A;  1FPY A;  3GIL A;  1RAX A;  5CA7 A;  2XK5 A;  5KFD A;  2HW3 A;  1ZQA A;  3L4P A;  4F8R A;  2EKE C;  3KWV A;  2ZIX A;  2MLB A;  4LDT B;  1L3U A;  2IO0 B;  2NR2 A;  1NKB A;  1P98 A;  3RFZ B;  2EQY A;  1NJX A;  3ENE A;  2P6U A;  3K4G A;  3NZU A;  4Z6F A;  9ICK A;  2KZM A;  1ZKH A;  3OHB A;  3X23 A;  5F9N A;  2F8K A;  4RNN A;  2BS2 B;  4K4G A;  1PUT A;  3WAP A;  3HT3 A;  3Q8E A;  4DXG A;  5FP0 A;  4WWN A;  5AM3 A;  4M0A A;  2K8B B;  2JXJ A;  4IS7 A;  5AIB A;  4IRD A;  2JY6 A;  5F3X B;  2M4N A;  3IAM 1;  3BDP A;  3RNC C;  3M9N B;  3AEV A;  2BR0 A;  4NWI A;  2CU3 A;  2IGG A;  3TAD A;  3PS6 A;  3GS2 A;  4NAM A;  3P4R B;  2KVR A;  4NJ6 A;  1TZ1 A;  5H8Y E;  3JPT A;  4NQK E;  5HFY A;  2E3T A;  3SAG A;  1KSP A;  2D3A A;  2H5X A;  4ED6 A;  2VIX A;  1X2I A;  3C28 A;  1XO0 A;  4LK0 M;  2KZZ A;  1WZ0 A;  3NOB A;  4J9R A;  4KSK C;  2YTU A;  2WX0 A;  5KNI A;  3DOW A;  4MT5 A;  2BDP A;  3M9O B;  2KIC A;  1AAR A;  4NV0 A;  4GB9 A;  1UT8 A;  1X9S A;  2YN4 A;  4OCZ A;  7ICG A;  1ED1 A;  4CCH A;  2YB4 A;  2F77 X;  5EE1 A;  2CS4 A;  2X38 A;  4RM8 A;  3WAN A;  2IHM A;  4P4P A;  5L95 C;  2C2D A;  4NLB A;  4HRO A;  2PIA A;  4RQ6 A;  4YR0 A;  3ML9 A;  5AM2 A;  3B9J A;  2PI5 A;  3O0F A;  2HHW A;  5HHH A;  2I5H A;  5J0W A;  5KG4 A;  4WWO A;  3WK8 A;  2IBI B;  1WI0 A;  2HD5 B;  2MU2 A;  5J2C A;  1V9J A;  3X0W A;  1JWU D;  5J0U A;  2J6U A;  2M1M A;  4HVB A;  5KFH A;  4KIK B;  4RUC A;  2EDU A;  3HWT A;  1ZDX A;  3MDA A;  7ICV A;  5CHF A;  2WFA A;  3GOE A;  2H3I A;  1V38 A;  1K1S A;  3RI7 C;  3U52 E;  1E7P B;  1WE7 A;  1ZOY B;  1C7Y A;  4FE3 A;  2ZIV B;  4QZ8 A;  4ACF A;  3HHM A;  1S3S G;  1UUP A;  1RQL A;  1EU4 A;  1KH0 A;  1F77 A;  1XD3 B;  5CX3 A;  1KEJ A;  3ZTC A;  2DBY A;  1V1P A;  4O5C A;  2JWZ A;  2BWF A;  3NG0 A;  2D3C A;  2HDE A;  4I2A A;  2G08 A;  5AI8 A;  2MP2 B;  1S0O A;  4RMA A;  4NLG A;  4Q8F A;  2JZP A;  3CRX A;  2NMQ A;  3QU2 A;  2R8G A;  4KLF A;  2WWZ A;  2O6V D;  3D2Q A;  2PW9 A;  8ICC A;  2UU7 A;  2D3B A;  4RM9 A;  4HCP B;  1UCV A;  3NVY A;  5D3D A;  2WXN A;  1TGZ B;  1YN3 A;  5GMV A;  3RH4 A;  1VDV A;  1N61 A;  1TKD A;  3V7K A;  2M56 B;  3TAN A;  4IM2 A;  1GO3 F;  5AUI A;  1ZQW A;  4BKT A;  4DWF A;  1UQV A;  3ED5 A;  1K50 A;  1D9D A;  3A1Q B;  5CHG A;  4DL4 A;  2YMM A;  1NJW A;  4QIW F;  3L54 A;  4MM3 A;  3HIL A;  2OJR A;  3S6J A;  4DO9 A;  5J0T A;  1KBU A;  1QSY A;  1ZQO A;  2BS3 B;  3V61 A;  3ONS A;  3ZRC A;  3I1Y A;  1BNP A;  3ML8 A;  1KFS A;  5DG9 A;  1KDH A;  2BWE S;  3ZNZ B;  4AP4 C;  2D2Q A;  4CF5 A;  1LV5 A;  2OCE A;  4YL8 A;  2Y9T A;  8ICI A;  3N7R C;  1KJT A;  4W9F A;  3BZC A;  3SFD B;  5HR7 A;  2V4Q A;  4P16 A;  2FDR A;  2H89 B;  4PZO A;  3N7S C;  2KNB A;  2WXL A;  5J0R A;  2XEW A;  2ZPN A;  1TS4 A;  4CF4 A;  5JUM A;  1MQ2 A;  4P0Q B;  2L00 B;  2RDB C;  1A70 A;  4IQU A;  1SV0 C;  2JT4 B;  3AEC B;  2BTE A;  2RP5 A;  4DQO C;  1C4P A;  2HHX A;  1ZXH A;  5KG2 A;  5DGB A;  4DF4 A;  1YQ3 B;  1Q1O A;  3KUD B;  5T14 A;  2KO3 A;  1TAM A;  4JWS C;  1SKR A;  3QUC A;  2D11 A;  2UVU A;  3ISB A;  2AYO B;  1D5M C;  2JF5 A;  4C4S A;  2MBB B;  2WU2 B;  1KRH A;  3A0H U;  5E6O A;  1GB1 A;  1JMS A;  3QUT A;  4F7Z A;  1O03 A;  4ANU A;  3TAR A;  2PFQ A;  4M9J A;  1MJD A;  3N28 A;  2JR5 A;  1DGJ A;  7ICN A;  1OUQ A;  2ASQ A;  1ZQN A;  5H92 C;  2P35 A;  9ICJ A;  2XY5 A;  4IWQ A;  4LJP B;  1PK1 A;  2J52 A;  1JI7 A;  2LXC A;  5KT5 A;  3SU8 X;  2PLP A;  2PE9 A;  4EBD A;  5DPW A;  1S77 D;  3DDH A;  4HDO A;  4L23 A;  4RQ4 A;  2ISO A;  1WGD A;  1UEL A;  3L16 A;  1PDX A;  1FFU A;  5ALW A;  2IY0 B;  3SQI A;  1PVP A;  4BAX A;  2IA6 A;  4AJW A;  4RGT A;  1YMH E;  2REX A;  2BCS A;  3W1Y A;  2DUY A;  1A6S A;  4J03 A;  1L3S A;  1ZQT A;  2HHV A;  4PHD A;  1WIA A;  2L32 A;  4L2Y A;  3U8Z A;  1WCN A;  3RJG A;  1VD2 A;  4M02 A;  4DSJ A;  2LKY A;  2FIF A;  4K3C A;  4DQR A;  5F9L A;  3GII A;  1WJN A;  3KOO A;  3PT2 B;  2V4R A;  2UYZ B;  2LRU A;  3AXC A;  3HUI A;  1NVI D;  1SSN A;  4BDP A;  3B0X A;  1EF1 A;  3LXF A;  4QZ9 A;  1ET6 A;  5ALF A;  5J17 A;  3LDZ E;  2ZIW A;  2KFK B;  1UPH A;  3AH7 A;  2K1F A;  4LDT D;  2ES6 A;  3ZXV A;  2KDB A;  1Z4N A;  5D46 A;  3VUY A;  1ZRM A;  2N0S B;  5CTR C;  2W7O A;  2WHI A;  4JUZ A;  3PR4 A;  3A9K B;  4BKG A;  2XGP A;  2Z59 B;  4XDC A;  1WYG A;  4M01 A;  1CZP A;  3NVV A;  4FBT A;  1KFD A;  2K89 A;  2AWT A;  4F71 A;  9ICE A;  3MFG A;  1WF9 A;  3E9S A;  3V72 A;  7ICF A;  5ALS A;  5AI4 A;  2PVG C;  4ED0 A;  3OWE B;  1K5O A;  2EAP A;  4F92 B;  3RAX A;  3AEB B;  1XSP A;  1FMA D;  2VZK B;  4MSQ B;  1FFV A;  1T7P A;  2G5H B;  3MHZ A;  5IIL A;  2IGD A;  2WU5 B;  4TQ1 A;  5J18 A;  2KDM A;  2LRW A;  5KT3 A;  2GWS A;  4BFR A;  1IIP A;  1Z1V A;  2FAZ A;  2CN1 A;  1EU3 A;  1C20 A;  1I4P A;  1VJK A;  2BYT A;  2D5G A;  4RZR A;  4FO6 A;  1BGX T;  1UF0 A;  3I28 A;  1KRP A;  3KLS X;  1GAQ B;  2PFP A;  1TBE A;  3BII D;  4IM0 A;  3IT4 B;  4KLD A;  2BCR A;  2AQ1 B;  4OVZ A;  1LFD A;  4HAI A;  2KSO A;  2W9C B;  8ICU A;  1KFY B;  3N30 A;  1S10 A;  1WXA A;  2V9H A;  3BYT B;  4M2Y A;  4NPN A;  2DYO A;  4RF1 A;  4FZM A;  3R7Q A;  1C3T A;  4TQR A;  3TL5 A;  2LYB A;  3JPO A;  1BML C;  2MA1 A;  3TAD C;  2KQS A;  2E8N A;  2HDO A;  3LWL A;  1X9M A;  2AQ2 B;  3W1S A;  2OWO A;  4MSM B;  1R4N B;  4A20 A;  1SL2 A;  2LGD A;  3Q3M C;  2OJW A;  2BKF A;  5B5E U;  2QIE B;  2HJ1 A;  2K4H A;  4O3N A;  4ZRK A;  4NM1 A;  3BZD B;  2FE9 A;  4B6W A;  2BGW A;  3AE5 B;  2B21 A;  4NY8 A;  4KLT A;  3PSF A;  4YQW A;  5T8I A;  2E1F A;  4RPY A;  2OM6 A;  1JCK B;  1WJ6 A;  2YEP F;  3O13 A;  4BGD A;  4RCO A;  2KJ6 A;  1ZQM A;  4I28 A;  4DQS A;  5ALG A;  2IHN A;  3NY5 A;  2AL6 A;  1PK3 A;  3DVN U;  3RMK C;  1ROE A;  3AMZ A;  5I4D A;  4HPL B;  4KVG B;  1V85 A;  2GOL A;  4IC9 A;  2AEH A;  2XC9 A;  4F4X A;  2QAR B;  2BPC A;  1RRB A;  1LKY A;  3SEN A;  1JRO A;  3ZKJ C;  2XI9 A;  3C2M A;  2CXY A;  2CJO A;  2NRV A;  3DWM A;  4YSX B;  4ZYS A;  4EBE A;  2R18 A;  1TS2 A;  4R66 A;  3ZQ4 A;  4KGR A;  4DQQ A;  1HZ6 A;  3C5G A;  1ZQC A;  5AK3 A;  3PW5 A;  2HBL A;  1E10 A;  1A0P A;  3M6K A;  4C8M A;  1ISN A;  1S8O A;  4NAW B;  2WYQ A;  5JRT A;  4QWA A;  3U4E G;  1P9D U;  1UWM A;  1ZW7 A;  1NK7 A;  4EEL A;  1GPX A;  1SXT A;  5JHB A;  5D3I B;  4JWN A;  5BO4 B;  3Q8Q B;  3JPQ A;  3NRW A;  2IGH A;  2KFZ A;  4C4R A;  1C79 A;  2JX5 A;  1I4X A;  2V3P A;  2PJH A;  1XF5 L;  3L10 B;  4BKS A;  2N7D A;  5IIO A;  1XEE A;  4BZA A;  1N5X A;  2K8A A;  4BWM A;  3V62 A;  2DLB A;  3PW4 A;  3HVD A;  2HJ8 A;  3SD7 A;  3C8Y A;  3RYT A;  3NVZ A;  5KFM A;  2I38 A;  3SV4 A;  4CF3 A;  2NVU I;  5GXG B;  3PPA A;  4F91 B;  4I6P A;  2KIV A;  3KKA A;  4YR3 A;  3H40 A;  1TK0 A;  3UIO B;  3RJI A;  3PO5 A;  2JZB B;  2W54 A;  4ECS A;  1RFA A;  1ZQK A;  5KFW A;  5AIC A;  2R8H A;  4XA5 A;  1Q8K A;  3NGD A;  4Y2S A;  4XWW A;  3OPX A;  4DL5 A;  1GC6 A;  4BBN C;  3UPQ A;  2HVH A;  4J6I A;  2GI9 A;  1L5U A;  4FAD A;  2FUG 1;  4UB4 A;  2NO5 A;  3AE1 B;  4JIO U;  4CHK A;  4GSW A;  1RZT A;  2I2Y A;  2A1J A;  3PML A;  4ZRI A;  2LHE A;  3MJW A;  3VCB A;  1ZQD A;  4N9F 4;  4A3P A;  1BPZ A;  4DS4 A;  2XID A;  3G6V A;  3QUB A;  2A4Z A;  1HUZ A;  4MEL A;  2MWS B;  3UQB A;  2KWU B;  3VHT C;  3F53 A;  2KNJ A;  2YQE A;  1H4R A;  3NZ3 A;  4JPS A;  5ALE A;  3S2A A;  5DPT A;  1L8O A;  5AEK B;  2YEP B;  4WJN A;  1C4A A;  1T0Q C;  3TEY A;  1B9R A;  3LK9 A;  2F8L A;  4ELV A;  1QIL A;  4PS7 A;  4US8 A;  1N6Z A;  2JRH A;  2NCN A;  4HWI B;  1UGJ A;  2ZXH A;  4DSI A;  3P63 A;  3M63 B;  2ZTE A;  1WR6 E;  2KK8 A;  1P7F A;  3MR2 A;  1NZP A;  8ICZ A;  2KTF A;  3NVW A;  4KV2 A;  2DKX A;  4R64 A;  2K8C B;  3WKA A;  4TUR A;  2HTH A;  2L3Z A;  2MAX A;  4I2H A;  3EGR A;  2KKC A;  5DQI A;  2VJ4 A;  4I2F A;  3ZRF A;  2WXF A;  4F93 B;  3PV8 A;  5KT2 A;  4I2B A;  4Q8E A;  5G55 A;  2HCF A;  1BPB A;  4X5V A;  2EZX A;  1EF5 A;  5KFR A;  1ARO P;  4GGQ A;  4JLC A;  1DOX A;  4UAS A;  4GC6 A;  1WE6 A;  2G5I B;  4UAU A;  4WJQ A;  5C23 A;  3ZDM C;  1XWL A;  5K4L A;  2PXI A;  2IO3 B;  1B1Z A;  4NNJ B;  4PS3 A;  4S0R A;  1V49 A;  2OYY A;  2DHZ A;  3OAW A;  3KZI U;  4O5K A;  4M6W B;  2WDV B;  2KJ9 A;  4WAA A;  2FJ6 A;  3BIN A;  3WK9 A;  4P4M A;  1VRA B;  3I5J C;  4QWD A;  1ZQV A;  4M9H A;  5AKG A;  3M3J A;  1NK5 A;  4C8O A;  2XK5 B;  5CJ7 A;  4DLG A;  2BB6 A;  4W9D A;  1DYQ A;  2PMZ F;  1URJ A;  3SEI A;  4MGY E;  3QC8 B;  2AHO B;  2ZIX B;  2Y1I A;  1E6E B;  2NS5 A;  3H8M A;  5EWG A;  5IN7 A;  1XSL A;  1IBX A;  1XLQ A;  2Y5P A;  2OHF A;  4ED7 A;  5IIK A;  4J9S A;  1RYU A;  3PW2 A;  2C7M B;  3E58 A;  1ACC A;  5DPR A;  2ZJ5 A;  1COK A;  3Q8K A;  2KKP A;  1FRR A;  2VZK D;  4G0N B;  4BBN F;  3DV9 A;  3L5K A;  2SEB D;  3LVV A;  3ZDC A;  3VH4 B;  2F3N A;  2ZUB A;  1ZQ1 C;  2KAC A;  1OEY J;  4B6J A;  2WXM A;  5TZV A;  4BJQ A;  4DFJ A;  2LM1 A;  2V4I B;  3A4S C;  2KVS A;  4C4T A;  4DQP A;  4MJS B;  3K1R B;  1ZD3 A;  3HRD D;  2QIL A;  1NK0 A;  1U45 A;  1Q3V A;  3IFW B;  3Q8A A;  4I2D A;  5J2D A;  4UB1 A;  1J2M A;  4YD1 A;  1WFY A;  4UB6 U;  4KLU A;  2WF6 A;  9ICV A;  3EEC A;  2LUM A;  5ALH A;  2DPI A;  2L8J A;  2WDT B;  3Q8B A;  2VH2 A;  1GG3 A;  1Q3U A;  2XNA C;  4PK1 A;  3CSF A;  3BK2 A;  4LNN A;  4UB2 A;  3U7Z A;  2HMX A;  5DGA A;  2ZJA A;  2K4P A;  1NKE A;  2LEK A;  3BZK A;  3K9O B;  3QK0 A;  1FEH A;  1Z2M A;  1J0G A;  3WKE A;  1L2N A;  3R66 C;  1FCL A;  2KOB A;  4QJF B;  3VTU A;  1ZD2 P;  4B9T A;  1ZYQ A;  3MGH A;  4ECZ A;  3RJH A;  4WJ3 B;  5GTI U;  3KVF B;  2ZXI A;  4RPX A;  5BYS A;  1RDF A;  1YIW A;  1C1Y B;  1E0Z A;  2JRI B;  5J2R A;  3C21 A;  2MUT A;  1WGY A;  5BMG A;  4I2C A;  1TT5 B;  3M6Z A;  2JZZ A;  1TS3 A;  1WGG A;  3OGU A;  4P2H A;  4J9Q A;  2WF5 A;  4IW0 A;  5LXH A;  3QU9 A;  1GC7 A;  4AP9 A;  3RAQ A;  2Z8L A;  3LB8 C;  2LHT A;  8ICY A;  2DGZ A;  3PO4 A;  3SV3 A;  2M17 A;  3Q8L A;  3ZXR A;  1JX4 A;  3DBH B;  4QAY A;  3RCZ A;  4EEW A;  4KKI A;  1N63 A;  5EE9 A;  4PHE A;  5KFZ A;  1WMH A;  5LNK 1;  4FS1 A;  2HOF A;  1SWV A;  4LZG A;  4OZA A;  2VAN A;  5ALR A;  5IIJ A;  2G0A A;  5KFS A;  3TJP A;  4F3O A;  1SXE A;  3AE4 B;  1T5X D;  4WUR A;  5L1I A;  2E8P A;  8ICL A;  4XC2 A;  9ICT A;  5JH5 C;  2LWP A;  2JEJ A;  5DLG A;  2V3S A;  1F2R I;  4DDI D;  3EW9 A;  2ASJ A;  3D32 A;  1SJH D;  2KZR A;  4EEN A;  2EAM A;  4GU2 A;  4ECX A;  2ATL A;  2FNJ B;  3AE8 B;  3KW5 B;  3NJT A;  1VZ6 A;  4NL9 A;  4X57 B;  1HTQ A;  2BBC A;  1XLN A;  3FM9 A;  4C0Z A;  2TSS A;  1B4F A;  2YMQ A;  3ZVV A;  2HBJ A;  4A9A A;  2DYB A;  2QLT A;  1SGG A;  5C5J A;  3PTF C;  1WJ4 A;  4XX5 A;  1LQB A;  3BY4 B;  5C3J B;  2K9X A;  2KK0 A;  2C28 A;  3JYU A;  2NO4 A;  5EOZ A;  3IN5 A;  3QE9 Y;  2RQ5 A;  5J8Y A;  1PZN A;  2LD9 A;  2QHO A;  4MM3 B;  5IA7 A;  1L0V B;  1WG8 A;  1KTQ A;  2PVO D;  1XQQ A;  2ZCC A;  3H1U A;  3MR6 A;  1V80 A;  1F9J A;  5FR3 A;  4IUM B;  5HHI A;  2LMR A;  5AKI A;  2F1J A;  4H2A A;  8ICW A;  2ZJ8 A;  5ALM A;  9ICC A;  1QOG A;  3AQF A;  4F4W A;  5TIS U;  4IQV A;  1R4M B;  4RQ1 A;  5BOM A;  8ICA A;  1N60 A;  2MBE A;  5HNK A;  3AUO A;  1WH3 A;  1S9F A;  2GB1 A;  2GRI A;  4DFM A;  3U7D A;  5ALV A;  3H8H A;  2R2Q A;  2WF9 A;  8ICS A;  2MHJ A;  3WAM A;  5ALU A;  3TAQ A;  3ZDA A;  2MQJ A;  3TAP A;  5BMH A;  3VQI A;  1JAL A;  3QU7 A;  4OJ5 A;  1X40 A;  4UDU C;  3GIJ A;  2GLE A;  3ZLZ A;  1TS5 A;  2WXR A;  2RRD A;  1OXJ A;  2JVC A;  3CST A;  4QIW C;  3M7D A;  4B95 A;  2FBW B;  4O5E A;  4KX6 B;  2N7E A;  4AS1 A;  5LXI B;  3BJY A;  2YY6 A;  2HBK A;  3QIJ A;  1JXE A;  2O6K A;  4W9L A;  4KLI A;  2F1H A;  1L4D B;  3V60 A;  4R8U A;  2Y0S C;  4BOZ B;  2W8L A;  3H4D A;  5KAF U;  3B1L X;  1PYW D;  3PZ7 A;  3MDC A;  4QNL A;  1WRI A;  2JEG A;  5DG7 A;  1WXM A;  3BVZ A;  3DPD A;  4R63 A;  2FLP A;  4OW0 A;  5FKA C;  2IOF A;  3BQ0 A;  3GB1 A;  4N6E B;  3IAS 1;  3GIM A;  3TEZ A;  1FXI A;  4EZK A;  5AKZ A;  3PRP B;  3H8J A;  3KKA C;  1CMX B;  3JPP A;  3BS5 B;  2QEJ C;  1PK1 B;  1YZ7 A;  3DBS A;  1I4R A;  4KLJ A;  1RG6 A;  3PST A;  4JWU C;  2LFI A;  4HK2 A;  4IWO A;  3ZW3 A;  5AM5 A;  3ZD9 A;  4CE6 A;  1T8E A;  2KV2 A;  2ZNV C;  1ET9 A;  2RPV A;  3RNB C;  1NEN B;  2W9N A;  2Y5B B;  4REZ A;  4ED2 A;  5KFE A;  1S97 A;  3GFK B;  4B9U A;  3CWI A;  5J2A A;  2D3G A;  1ZQZ A;  2KFJ A;  2YB1 A;  4BOS C;  3CYM A;  4UAR A;  4CDG A;  3EWA A;  5III A;  1QCK A;  2HHQ A;  3NZS A;  3RN9 C;  3T3N A;  1I42 A;  2KHV A;  2LUE A;  3HM3 A;  4ZRJ A;  4NM2 A;  4UBB A;  3GZF A;  5L1K A;  3RB4 A;  2KJ8 A;  4GFJ A;  1V5T A;  2ZVO A;  3FAH A;  4IWP A;  2OXO A;  2WDQ B;  2CPR A;  2E5S A;  2O2V A;  7ICU A;  1NBF C;  3URY A;  1F52 A;  2KWD A;  2RDJ A;  2AX5 A;  4DCC A;  3K9P B;  1XLO A;  1JRU A;  4OVU A;  1P7E A;  2FMS A;  4A6Q A;  3LVW A;  2I9G A;  2KWC A;  2L05 A;  2VA3 A;  2F1I A;  4ANX A;  1D8Y A;  4HKZ E;  2DF4 B;  3AB5 A;  5DQG A;  4ZHO A;  4QZB A;  3CNH A;  5AM0 A;  5ALQ A;  5AK6 A;  4KLM A;  2ZIW B;  4KN7 A;  2D8C A;  2JXT A;  2JV3 A;  4Y2R A;  4G11 A;  1A5R A;  3AUL A;  5EWE A;  1RPL A;  5KG7 A;  1B0X A;  2KHW B;  4ICU A;  5C2T B;  2IOF K;  2BKR B;  4TQS A;  2DAF A;  4XUS A;  3C19 A;  4K7W A;  2RDI A;  2N1V A;  2J42 A;  4W9E A;  1KLV A;  3N97 B;  1CI4 A;  2KLC A;  1FRD A;  3THV A;  1L4Z B;  4HJK A;  4F4Z A;  1E8W A;  2W8K A;  3TIX A;  4K7U A;  3H0M B;  1J2N A;  4KLG A;  3KFU F;  3AN1 A;  3GU3 A;  4NXZ A;  2BZF A;  1D6E C;  3JSV B;  2G09 A;  2FPL A;  4LCD E;  2Y0S F;  4I2J A;  5E6P A;  2IJ0 A;  2QSD A;  1CUK A;  3PSI A;  4P4O A;  1SL0 A;  2XBB C;  2H88 B;  4EE2 A;  5JU5 A;  1SJE D;  3QUQ A;  1PQS A;  3IG8 A;  4R65 A;  3FIL A;  2KWV B;  2K5P A;  2DX5 B;  4YP3 A;  3ZNG C;  2BW2 A;  4GXK A;  2MBQ A;  1HTO A;  2KN5 A;  3AE9 B;  2MRL A;  7ICM A;  3RPF C;  1SZH A;  3QXG A;  2NBU A;  4Q2J A;  3RR7 A;  4W9H A;  2KSO B;  3HPO A;  3U26 A;  3PX4 A;  1PGA A;  4KLS A;  2W43 A;  3QEB Z;  3ECI A;  1I4G A;  1RYS A;  4NQL B;  3SEB A;  3TBL D;  2KOX A;  3ICX A;  2BQU A;  9ICU A;  4AOF A;  3P4P B;  4I6L B;  1B22 A;  2N9X A;  1EUV B;  4LTU A;  2BYV E;  1TV9 A;  1GB4 A;  1RXW A;  3SMV A;  1KLN A;  1SEB D;  2FCQ A;  3ZJV A;  2QMT A;  4EBC A;  3DHI C;  4RH6 A;  2DPJ A;  5LLI A;  1KL9 A;  1UWX A;  1N56 A;  2RLT A;  8ICQ A;  4U7C A;  3M62 B;  1L7Y A;  1R4N I;  4ITK A;  3D6J A;  1X6J A;  4I27 A;  4YR2 A;  1JIH A;  3VR9 B;  4DOA A;  4F72 A;  1FM0 D;  4RQ7 A;  1OTR B;  3MJ5 A;  1JUD A;  4PS8 A;  5HMM A;  1ZQR A;  2QKQ A;  4NLK A;  1MG4 A;  5AI6 A;  2GLS A;  4I2G A;  1RYJ A;  2INN E;  2BCQ A;  1TK8 A;  2P66 A;  1LKY B;  2BHN A;  5D49 A;  3AV8 A;  5BYQ A;  7ICJ A;  2IMW P;  3FC4 A;  1JQ4 A;  3GP7 A;  3D2N A;  4FS2 A;  1MHX A;  2MJ3 A;  1E9M A;  5JHA A;  2DZK A;  3Q3F A;  3NUQ A;  4EYI B;  4KDL B;  3U2S C;  1FCC C;  3M1Y A;  5DB7 A;  4PPX A;  3OHA A;  4IDI A;  3TEX A;  1LVH A;  4NY0 A;  2QB0 A;  3WKC A;  4G3X B;  1S76 D;  3V05 A;  4C80 A;  1TKE A;  2JWU A;  4YFK A;  2RD0 A;  2IO2 B;  2BPG A;  5DDM A;  1V8C A;  3MAB A;  2UVR A;  4KIK A;  3MGV A;  2XIC A;  1RXV A;  1WSP A;  3DCG A;  2J4X A;  8ICR A;  2LGI A;  4PZN A;  4XZ4 A;  1EXN A;  3TFR A;  2DNF A;  4RQ3 A;  5J29 A;  1YNT E;  2GO7 A;  2JSV X;  1VR9 A;  3A9J A;  2ZIV A;  1IGC A;  3DQV A;  1TY0 A;  3BVG A;  4ICV A;  3V6C B;  4C8L A;  1HJP A;  3RUI B;  3VRA B;  5BMI A;  4IR9 A;  4QZG A;  3T8M A;  3R9K A;  5KFP A;  1T0Y A;  2RGF A;  4FUL A;  4WIP A;  3N7P D;  2JEF A;  4NL9 C;  1I35 A;  4E74 A;  1HXY D;  3N32 A;  2W9A A;  4M9G A;  2EEL A;  3JPS A;  4M0W A;  4ASW C;  4JX1 C;  2BQ3 A;  1WWU A;  3Q8F A;  3QEA Z;  3MR5 A;  4RQ5 A;  4TQ0 A;  1WXV A;  1V97 A;  2ZNV B;  4ZOH C;  1QSS A;  4DSL A;  2B6G A;  1KTK A;  2H3Z A;  4CYE A;  5J8Y C;  2KTR B;  4RNO A;  3OJU A;  2LBO A;  2GOW A;  3AE6 B;  1ZDV A;  1C4C A;  4FBU A;  3W2D A;  1JML A;  8ICB A;  2RMM A;  5HR6 A;  1JW9 D;  5IIM A;  4P0P B;  1L7P A;  1BPE A;  3CMM B;  3KUZ A;  3Q8P B;  3R8B A;  3PW0 A;  4O3O A;  5GTH U;  2MBO A;  3KUC B;  4DXF A;  4F5N A;  2E1E A;  4KGT A;  2NPT A;  3PLV A;  5DBB A;  9ICW A;  1K53 A;  4LJX A;  3Q3N C;  1SE4 A;  2HI0 A;  3PLU A;  3Q14 C;  2WXK A;  3ONN A;  2ON8 A;  4RU9 A;  5KG5 A;  1TAU A;  5KG1 A;  1GNU A;  3LYY A;  1Q10 A;  3UQA A;  5IP4 D;  4KLL A;  1HZ5 A;  2PKO A;  3V3X A;  3N3K B;  1T4G A;  3RD2 A;  4ZRP A;  3PZP A;  3PZD A;  2PTL A;  3PGE A;  1NYR A;  4OZB A;  2W04 A;  2RSU A;  3RH5 A;  1N5W A;  1XCT L;  2NRZ A;  4IL6 U;  1VZ8 A;  4JMU A;  1Z5S B;  3KTQ A;  3H0L B;  2KMC A;  2OH2 A;  3ZNI D;  4JV2 A;  2ZUC A;  2KZ3 A;  2R8K A;  2ALZ A;  4CRX A;  3N1Z C;  3IHQ B;  4TUP A;  1DRG A;  1K1Q A;  3F5E A;  4MAC A;  1G6J A;  2NBW B;  3Q3J A;  1F0Z A;  3HJE A;  5ALT A;  2F44 A;  2K60 A;  3T9L A;  3EYZ A;  1TKG A;  1GOZ A;  5AZH A;  5J2H A;  3HK0 A;  1NK6 A;  9ICG A;  3RUL A;  2ZIU A;  4PL2 A;  8ICE A;  1FNW A;  4F50 A;  3F2C A;  1OQR A;  3A0B U;  4U6P A;  2HE7 A;  4WQO B;  4YVZ A;  4UAW A;  5J0S A;  1BUI C;  2N4F A;  3T3F A;  2ZEQ A;  2ZUD A;  2KJR A;  1ZD5 A;  1NYQ A;  5ALJ A;  3PHW B;  5J2B A;  5KG0 A;  1S1Q B;  1D5Z C;  3RBD A;  2Q0Z X;  3ZJU A;  1VZ7 A;  7ICI A;  3QAR A;  2WNM A;  2A3V A;  3D2S A;  1K52 A;  5KFT A;  3TFS A;  3SD5 A;  1H38 A;  1PGX A;  3GZN B;  4PT5 A;  4ICA A;  1ZQI A;  2ODG A;  1Q5W B;  2WAQ C;  2DKZ A;  3TAC B;  2AQ4 A;  1L6V A;  4W9K A;  2AH5 A;  1NZB A;  2N1W A;  5AI9 A;  4Z6C A;  4UB5 A;  3ZDD A;  2C9W B;  2FPM A;  2G3Q B;  1IUE A;  4LNO A;  3KH0 A;  1NK9 A;  2DEN B;  1E8X A;  2E6X A;  2PMZ C;  2BVC A;  1S0V A;  1LB2 B;  2GBM A;  1ZE3 D;  2BF8 B;  3TEW A;  3BK1 A;  1Z00 A;  2HVI A;  3O65 B;  3ZDT A;  5DBC A;  2EKI A;  4DHZ E;  4ED8 A;  3DEE A;  3UXN A;  2KFN A;  2QDF A;  5KT4 A;  4TSS A;  3W5V B;  5FR6 A;  1F1H A;  4JGH B;  2LGY A;  4LVS A;  4EZJ A;  2L0F A;  1ZQU A;  2N1R A;  1WWV A;  4LNI A;  3DBL B;  2WXP A;  3VRB B;  3EHV A;  4KMU A;  2JH1 A;  4QZC A;  1C78 A;  4J9N A;  3MHS D;  5AHX A;  1SE2 A;  3DBR B;  4ZDV A;  1T6B X;  1UHU A;  3A9K A;  2L83 A;  1M6Y A;  1L3V A;  3IM1 A;  5AUK A;  1SKW A;  3RJK A;  5AKL A;  2AJQ A;  4F5P A;  8ICH A;  2C5L C;  2MUT B;  4QZE A;  2KLG A;  3BS7 A;  1UT5 A;  3SAH A;  2BQQ A;  1KW4 A;  2E8O A;  3KHR A;  1YN5 A;  4FBJ B;  4DFK A;  3B08 A;  5CHV C;  3MGI A;  4MF8 A;  3RBE A;  3TUO A;  4GLS C;  7ICR A;  2E8M A;  1J7B A;  3BWU D;  9ICL A;  4TMA B;  1KOT A;  1QLN A;  2G4S A;  4OJP A;  2QCZ A;  4G50 A;  1TTN A;  3GV8 B;  1YX5 B;  2WXH A;  1UA1 A;  3JPR A;  4MEX A;  3VDZ A;  3ZNH B;  4UAT A;  1E7V A;  2NTS A;  4M9L A;  8ICO A;  1WMH B;  2B3A A;  3AEF B;  2K22 A;  4TV3 A;  4CNQ A;  3VH3 B;  2J0J A;  4M8M A;  1WXS A;  2LXA A;  3AEG B;  1J97 A;  1QQ5 A;  4RPZ A;  5DPS A;  2WXI A;  4E71 A;  4JK1 A;  2FID A;  5L1M A;  5J2K A;  3TMP B;  3IVF A;  8ICJ A;  3BYY B;  4FHK A;  2M9N A;  3HKZ C;  2PEA A;  2NV3 A;  2B0C A;  4FHJ A;  2W9C A;  1TJE A;  9ICA A;  2INC C;  5AI5 A;  1MSW D;  1HQR D;  9ICQ A;  2A5U A;  3RFA A;  1ZP0 B;  2LYH A;  3CF6 E;  2BGF A;  2MX2 A;  5KHO A;  4GC7 A;  2LHD A;  2NBV B;  1S0M A;  4Z6D A;  4PL1 A;  2XCA A;  2WAQ F;  3LWM A;  5KAI U;  4GXB A;  2FI1 A;  2IOH A;  2HHT A;  2LJI A;  9ICM A;  3AM9 A;  2EH9 A;  1XO3 A;  1WCL A;  4F5R A;  1KM7 A;  8ICK A;  3APD A;  4BKS D;  4P6V F;  1X42 A;  1ZGU B;  3C1Z A;  4FZL A;  3RTV A;  5DKW A;  1AW7 A;  2MSN A;  4UAY A;  3Q69 A;  1CK1 A;  1MVK A;  2J6S A;  5J2F A;  3Q8M A;  1WX8 A;  2KKV A;  2FCM A;  2LMC A;  4MEY A;  4ZYN A;  3AQE A;  4Q44 A;  2NRT A;  4ECR A;  1ZQJ A;  1NK8 A;  2CR5 A;  3DVG Y;  3T5L A;  3RR8 A;  1YZ6 A;  7ICT A;  4QZF A;  4O3P A;  2WDR B;  2WP9 B;  2C7H A;  1NJZ A;  3VVW B;  3T5J A;  1V5O A;  3GV5 B;  4P1B C;  5DB9 A;  8ICM A;  1E7U A;  2BT6 A;  2M8S A;  1SWW A;  1JRP A;  2QAR A;  3AEE B;  2KMD A;  1T3N A;  1R4M I;  1NNL A;  3UMB A;  4A8E A;  3RB6 A;  3EUB 2;  2C22 A;  4OO1 J;  4C8K A;  2OEH A;  4DS5 A;  3ALR A;  3G6X A;  3LYS A;  3H7P A;  2L5Y A;  9ICN A;  4OJO A;  4JE3 B;  4OJL A;  2JXX A;  3WA0 A;  3ORY A;  3FDS A;  1JWS D;  3AEA B;  3CP8 A;  3C5F A;  2AXT U;  4O9M A;  1IM4 A;  1QLB B;  3AI5 A;  4FA6 A;  3PY8 A;  4R8U B;  1KN5 A;  2W55 A;  2F2A B;  2KMA A;  3QA8 A;  2CJN A;  3WK6 A;  2CHZ A;  1DOQ A;  3A33 B;  4AQ7 A;  5ALY A;  4JWM A;  2WXQ A;  1B43 A;  3ETL A;  1RYR A;  2EZZ A;  4DL3 A;  1X9X A;  1F2R C;  4DF8 A;  4DOC A;  2SAK A;  4GXJ A;  1WGR A;  3U30 A;  4A3O A;  2A1A A;  3OJ4 B;  5CWR A;  1GUA B;  2L52 A;  1FO4 A;  2KN4 A;  3SHQ A;  1XU4 A;  1IXR A;  4DFP A;  2WXO A;  4DFD A;  1N62 A;  4O3R A;  5L1L A;  4TUS A;  1H8C A;  5KFN A;  4K4H A;  2EMT A;  2OOB B;  4KZC A;  2NRX A;  5KL1 B;  3HKZ F;  1SZP A;  2RHF A;  1VLB A;  1MPE A;  2I1J A;  5AZF A;  4HKQ A;  2L1A A;  1YT3 A;  3ZJT A;  3QHT A;  2W3S A;  1ZQG A;  5J0X A;  3KD3 A;  1COO A;  5B66 U;  2LI6 A;  4UAZ A;  2ACZ B;  4HDQ A;  5D6J B;  2BYF A;  3UGB B;  4B9V A;  3SR6 A;  4YG2 A;  4YTP B;  4YN4 A;  2CHX A;  5KFF A;  4GDK A;  1OFF A;  1ZQE A;  2KD0 A;  1V1O A;  2J0M A;  2KJH B;  4JQW C;  4DDG D;  1TAQ A;  2JUO A;  4G3I A;  2R2O A;  2K0P A;  4O1N A;  4E3C A;  3ZTD A;  4NLN A;  2IBK A;  4MFA A;  4ZH4 A;  4F1S A;  3BVM A;  1Y88 A;  1QZE A;  3UIP B;  1KKX A;  1E8Y A;  2N9E B;  3MFI A;  1V1P B;  4FJZ A;  5EWF A;  4RQ0 A;  5KHQ A;  4QW8 A;  1BXT A;  4II2 B;  2D6F C;  5AZG A;  5JXV A;  3WKB A;  2ASL A;  4ECV A;  1WRD B;  3P4S B;  3W1S C;  3UF8 A;  4DSE A;  4PYU A;  1L7N A;  1J7A A;  1KLG D;  2RR9 A;  4DK5 A;  3LDA A;  3L17 A;  4BVU C;  2A19 A;  1X66 A;  2KVZ A;  3V7L A;  4Y2X A;  5J0P A;  2KC2 A;  1YJI A;  4Z6E A;  4ANW A;  1OEY A;  9ICP A;  1XT9 B;  4M8N A;  1NJY A;  2V3N A;  1CQV A;  1UZX B;  3UMC A;  2JEI A;  3IT6 B;  9ICH A;  2LAS A;  3H6N A;  2W9M A;  5JTI A;  1HA5 A;  3SI8 A;  1ZQS A;  3H7I A;  2R61 A;  2Y3A A;  3HVZ A;  4R3D A;  3F2D A;  1UH6 A;  2WS3 B;  3MBY A;  4DL6 A;  2CKH B;  4OJ6 A;  3QQ8 B;  3BQ1 A;  3NTU A;  1AN8 A;  3OTQ A;  2D10 A;  3M8S A;  4LZD A;  1VCB A;  5EE0 A;  3BQ7 A;  3EZ5 A;  1LXD A;  3HM6 X;  2KN7 A;  4Y2U A;  3KBB A;  2D07 B;  4M04 A;  5HI1 A;  1FEZ A;  3C2L A;  2N9K A;  2QB1 A;  3FIL B;  2KJ5 A;  1YQ4 B;  2EMS A;  1UNS A;  3GV7 B;  3J9C A;  4EKU A;  2GBK A;  2ZZP B;  3QAQ A;  1AQ6 A;  4WJO A;  4Y2P A;  3L3F X;  3TCA A;  2WHE A;  4BXO A;  2IND C;  4B9M A;  4DEZ A;  2JRZ A;  1UBI A;  2MA9 B;  3OG5 A;  5HML A;  1LM8 B;  2YVC A;  1D4B A;  4ECQ A;  2F76 X;  3GIK A;  2N7J A;  3UQ0 A;  1AWD A;  3APF A;  4AUQ C;  2KDE B;  1MFW A;  2O6V A;  3VXW A;  4KLH A;  1WUD A;  2KQ4 X;  3Q3O C;  3OSN A;  1P1A A;  3SYZ A;  1Z19 A;  4IOI E;  1PGB A;  2PI4 A;  2ZTC A;  4YXD B;  1T0S C;  1DGS A;  3PSE B;  4GMV A;  1ZJN A;  2DQN B;  3PX6 A;  1KF6 B;  1X6I A;  2AQ3 B;  4EX6 A;  3RZF A;  3V6J A;  4K3B A;  7ICK A;  2VA8 A;  1S0N A;  3QZ7 A;  4YTN B;  4ARI A;  4XGA B;  3RRG A;  3N1Y C;  4EOY A;  2MJE A;  4KKJ A;  2AL3 A;  3EC8 A;  2DFL A;  1WJU A;  3C1Y A;  2K25 A;  3KZX A;  1FXT B;  3UXP A;  7ICH A;  4MJS A;  1MG8 A;  2HOQ A;  2KDI A;  2XN9 C;  4RQ2 A;  4JB3 A;  2KVC A;  4EEY A;  1ENF A;  4B0E A;  4FZN A;  3SDL C;  2Y9U A;  4KGS A;  3PSP A;  4OD0 A;  3ZUN A;  5AM4 A;  3L13 A;  3Q8S B;  2FUH B;  1F5S A;  3FKY A;  5KFC A;  7ICL A;  3ZYY X;  1BVS A;  2IZV B;  5KFL A;  2MJD A;  3VR8 B;  3RZW C;  1ZPS A;  4WWP A;  3A4R A;  5KFX A;  1D9F A;  1SBB B;  1PUZ A;  2BB5 A;  4J9P A;  4DHJ B;  3C2K A;  5ALP A;  4AJY B;  3F5A A;  2FCS A;  4M47 A;  1U48 A;  3MC9 A;  1RQN A;  1WXQ A;  1WM2 A;  3QCA A;  5KT6 A;  2MH7 A;  1YQB A;  2DZJ A;  3C0R B;  5EE3 A;  2JGA A;  5AK5 A;  2QB0 B;  4K81 A;  1U49 A;  4RGO S;  1XCQ L;  3PHX B;  4NJC A;  2MEK A;  2J53 A;  3RNG C;  1M4V A;  1D3Z A;  4Y2T A;  3RH6 A;  1Y8R C;  1A77 A;  3KYC D;  3DHG C;  3C29 A;  2M0X A;  3R2T A;  2CRX A;  3AU2 A;  3VTV A;  4WQM A;  1R7S A;  2FE8 A;  4XE0 A;  2M19 A;  2W9B A;  1XC9 A;  3A9J B;  5BYR A;  3AL0 B;  4ED3 A;  5ALN A;  1D8B A;  2K3U A;  4WWM A;  4KTQ A;  1QQ7 A;  4YD2 A;  1T0R C;  3P42 A;  3Q6B A;  2LM4 A;  2OED A;  4C4V A;  4GXI A;  1SV4 A;  4RQM A;  2VRR B;  4WJP A;  3CW2 C;  1NDD A;  1L0Y B;  2BYE A;  2Z0D B;  2J6T A;  3DHH C;  4M0W B;  4KIT B;  2IDY A;  4Q43 A;  1T94 A;  4FJV B;  4B0M A;  7ICQ A;  4YMO A;  2V9W A;  3QWZ B;  2ASD A;  5KFA A;  5ALX A;  5D7G A;  1TY2 A;  5KFQ A;  4ZHP A;  3Q8C A;  1QF6 A;  2JYT A;  2BCU A;  1QOA A;  3ISD A;  4F8C B;  2GMI C;  1SE3 A;  4QWB A;  4GDL A;  3WAL A;  4EEK A;  2KYW A;  3P1M A;  4PGY A;  5JZE B;  8ICV A;  3RNA C;  2C60 A;  1WX9 A;  4C8N A;  3AE3 B;  3R7R A;  4YMN A;  3RF9 A;  2BPF A;  3PV1 A;  4J9L A;  1L8L A;  3UXO A;  4PJ0 U;  5J2E A;  1FD6 A;  2NPT B;  3KHL A;  5DCN A;  3IP4 B;  4IR1 A;  1ZQH A;  2J0K A;  3H9D A;  5KFY A;  3UI3 A;  4YXJ A;  2AGP A;  2I1Q A;  2AGO A;  2BKE A;  1U47 A;  1ZD4 A;  1ECW A;  4HJG E;  5HG2 A;  4KLE A;  3RNE C;  5C1Z A;  2CHW A;  5ALD A;  5J0Y A;  1HEK A;  5J0O A;  1I7H A;  2GBR A;  2UVV A;  2C7N B;  3V6H A;  4B9S A;  1Z4O A;  3HX0 A;  2Z0E B;  3QU5 A;  2ZTD A;  1X9W A;  4M9N A;  4ECW A;  2L0T A;  3K1Z A;  4UW9 A;  2DZI A;  1HE8 A;  4AYB C;  4PGQ A;  1WGH A;  8ICG A;  9ICR A;  5L9X A;  3DVG X;  4YXM A;  4ZRQ A;  2K8B A;  2PFN A;  2W7P A;  4KLQ A;  3GE8 C;  1L6N A;  4M00 A;  5CRX A;  1WWT A;  8ICT A;  2GH1 A;  4EX7 A;  4IQT A;  2LPE A;  1ZQP A;  4PYZ A;  1STE A;  3IG5 A;  4QZH A;  3M9M B;  5AKK A;  2G9H D;  3H8S A;  5CB1 A;  4IKG A;  3AU6 A;  4MGK E;  2ZIU B;  3MTN B;  1IG6 A;  3ZDE A;  5KFV A;  2B76 B;  4NJ7 A;  3ZIM A;  1NI3 A;  3UM9 A;  3MP9 A;  5DB6 A;  1L7M A;  3BS5 A;  3MR3 A;  1EM7 A;  1XXG A;  1DXS A;  4DSF A;  4N59 A;  2ZG6 A;  2FLN A;  4ECY A;  2UVW A;  3IHP C;  2C2E A;  1TYG B;  7ICE A;  5CP2 A;  4BWJ A;  3PNC A;  4IRK A;  4DBG A;  3EFC A;  2HBM A;  3QX1 A;  4RGM A;  1K51 A;  3EA6 A;  5ALI A;  1SB3 C;  1BPY A;  4FFD A;  5DG8 A;  9ICB A;  4L1B A;  5FK9 C;  1ZQQ A;  2KP7 A;  2LVQ A;  4QWE A;  1UD7 A;  1IGD A;  1MC8 A;  2WF8 A;  3PRZ A;  3WCQ A;  5ALO A;  1XS9 D;  3AE7 B;  4RGN A;  4K7S A;  1FXA A;  4FJY A;  4MEM A;  3H7S A;  3GZN I;  1LGR A;  2HOI A;  1C9F A;  1JWM D;  4O3M A;  4CGZ A;  1YX6 B;  1SF0 A;  2IPK D;  4IG7 B;  2KIW A;  2JU6 X;  2K8H A;  4XYC A;  3PRM B;  3UQ2 A;  5KG6 A;  4MHV A;  1Z00 B;  1XNS A;  1J7C A;  1U9L A;  4E0D A;  3T3O A;  1NEK B;  2MP2 A;  5DQH A;  1TIF A;  4WH4 A;  1NI2 A;  2KD1 A;  1NOM A;  4EZL A;  4QWC A;  2IO1 B;  1DK2 A;  4KN4 A;  2HHS A;  4JV0 A;  3I76 A;  5BOL A;  2WTF A;  4QZA A;  1I4Q A;  3HIZ A;  2WXG A;  3T79 A;  1HEZ E;  2H3Q A;  1QOF A;  3B2F A;  3L08 A;  4HRS A;  4W9J A;  5IAA C;  2KAJ A;  3PRE A;  3ZO5 B;  3IBE A;  1I4H A;  4MDK E;  1SXD A;  5KL8 B;  2ZVN A;  3DBL I;  3ALB A;  2EZY A;  1Z3E B;  4AYB F;  2KX0 A;  2A1J B;  2N9L A;  2BDU A;  2I1K A;  3DBR I;  2G45 B;  3R2I A;  1ZXI A;  3N4M B;  4BUG A;  3MC0 B;  1EWC A;  1MI0 A;  5AKE A;  5DB8 A;  3A1Q A;  3Q2A C;  4UBC A;  2RDH A;  5HKH A;  4XQ8 A;  5J0Q A;  4HXD A;  4K1R B;  1L0X B;  2ZW0 A;  3JSV A;  3RJE A;  2MBH A;  2RPQ A;  3OJ3 A;  5DDY A;  3PVL A;  1QT9 A;  4BX9 C;  5TR5 A;  5CHW A;  4II3 B;  3OLM D;  2WF7 A;  3WK4 A;  2L7R A;  3ISC A;  1RM6 C;  4MH8 A;  4I6N B;  3MC8 A;  5AKY A;  5IIN A;  7ICS A;  1V9P A;  2ISP A;  2RDG A;  5AIA A;  1UA0 A;  1HUO A;  3NHE B;  2ICI A;  1YJJ A;  2LGX A;  2LVO A;  4KSL C;  2NRW A;  7ICP A;  1IYF A;  3IRU A;  4LNF A;  1BPD A;  1J8C A;  4P0Q A;  4Y2V A;  2MW5 A;  3GDX A;  2XVT A;  4J9O A;  2YML A;  2XY7 A;  3Q8R B;  1X1M A;  4DHJ D;  2MCN B;  1CEZ A;  4FXC A;  1TVA A;  3QNM A;  2IY1 B;  3W9C B;  4IRC A;  1SIJ A;  4N58 A;  5DBA A;  2MSE D;  4C56 C;  4B9N A;  2QC8 A;  3UMG A;  3KYD D;  4Y2Y A;  2L76 A;  4XRH A;  4KMO B;  4OHJ A;  1Q0W B;  4MH0 E;  3HW8 A;  4RNA A;  2JH7 A;  3V6K A;  3RJF A;  2GBN A;  1CJE A;  4UAV A;  3P2B A;  3BQT A;  5H2F U;  5ALK A;  1OQY A;  9ICX A;  2M0A A;  2FPK A;  2JHD A;  5ALL A;  4C7Y A;  1KFT A;  1ZUD 2;  2JYE A;  1GJZ A;  2KTQ A;  2ZCB A;  2LI5 A;  1MHH E;  2YLM A;  1QKZ A;  1RWS A;  2BCV A;  3NS1 A;  4RT3 A;  1RFK A;  3QZ8 A;  1Q46 A;  2XY6 A;  4I29 A;  3MC1 A;  5KG3 A;  5A0L A;  1WX7 A;  4RUA A;  1U4A A;  1IBX B;  2QJL A;  2K39 A;  4F4Y A;  3RB3 A;  3RT3 B;  4MFC A;  1HIW A;  3L0W B;  2P6R A;  3TKA A;  3KHG A;  4S17 A;  4HLE A;  2UWQ A;  3H0R B;  5ALZ A;  3H8W A;  1WR1 A;  5L83 A;  2PFO A;  5TSS A;  3NAS A;  1JWA D;  4I2I A;  2Z7J A;  3FYH A;  1ZJM A;  5KFB A;  3ETR A;  3H7P B;  1O08 A;  1T3Q A;  3WK7 A;  4I2E A;  4IQW A;  3N9Y C;  5E6N A;  2FMQ A;  2J7Q B;  4JL9 A;  4LLG M;  2VKQ A;  3N1X C;  3OSP A;  4XDD A;  4J9M A;  3ZDB A;  4DLE A;  2X8X X;  4P7I A;  4PGX A;  1IV8 A;  1QH9 A;  3OJS A;  1Y56 A;  4MGI E;  3F2B A;  4F5Q A;  1CRX A;  3CIR B;  4DL7 A;  3E2E A;  1QOB A;  4Q45 A;  2Y5C A;  3K75 D;  2GBJ A;  4GN1 A;  3DDC B;  3JVZ X;  2HHU A;  1Z1B A;  3QU4 A;  2WGS A;  2D3D A;  4PHP A;  2BS4 B;  2KFK A;  4XWT A;  4KLO A;  1D5X C;  1MN8 A;  1VJ5 A;  3NUH B;  1J19 A;  1V2Y A;  1ESF A;  2DL0 A;  4DL2 A;  3VUW A;  3T5K A;  2WB1 C;  5CEH A;  2Y1J A;  1QSL A;  1EWY C;  3AED B;  3B0A A;  9ICI A;  4AWJ A;  4B9K A;  4ARC A;  2VJ5 A;  2KXJ A;  4UB3 A;  2NTT A;  5C0Y A;  4B9L A;  1P7D A;  5BPC A;  4YSZ B;  1OW5 A;  3E0F A;  4TUU A;  2KT7 A;  8ICX A;  4F2R A;  1UBQ A;  1ZOL A;  4ECT A;  3ZI4 A;  3B0Y A;  2G07 A;  1SGH A;  4EUT A;  4HPP A;  4YT0 B;  2W3R A;  1YJ1 A;  4FLH A;  2KC1 A;  2G06 A;  1FIQ A;  2KE7 A;  4G9B A;  2W03 A;  4UB8 U;  1BPX A;  3PO0 A;  1KLU D;  3ZGZ A;  2ZPY A;  1TE2 A;  1YN4 A;  3JPN A;  5DLF A;  4GDK B;  3EFU A;  2PPH A;  4RQ8 A;  1FNU A;  4ANV A;  2KTR A;  5KT7 A;  4MFF A;  2G1E A;  2K6Q A;  3KQ4 A;  1PFD A;  4OZC A;  5E6J A;  3TQ1 A;  4P0P A;  3WU2 U;  2C2R A;  3DBH I;  4DXA B; 
#chains in the Genus database with same CATH homology
 2WU5 B;  2IGD A;  4TQ1 A;  1YJI A;  2KDM A;  3TSS A;  1EU3 A;  2V3N A;  3AN1 A;  1CQV A;  1I4P A;  1VJK A;  1D6E C;  2D5G A;  2WQY B;  2BYT A;  3IT6 B;  4D2K A;  3KLS X;  2IJ0 A;  1GAQ B;  1HA5 A;  2QSD A;  3BII D;  3IT4 B;  4EE2 A;  2AQ1 B;  2H88 B;  2R61 A;  2Y3A A;  3HVZ A;  4OVZ A;  1SJE D;  4R3D A;  2WS3 B;  1OQQ A;  1KFY B;  3BYT B;  3FIL A;  1AN8 A;  2K5P A;  1XLP A;  4RF1 A;  2DYO A;  2BW2 A;  5EE0 A;  3AE9 B;  1BML C;  1LO5 D;  3I9V 1;  3RPF C;  2AQ2 B;  4Q2J A;  5HI1 A;  2Q5W D;  3W1S A;  1PGA A;  2N9K A;  1I4G A;  3FIL B;  1YQ4 B;  2QIE B;  3SEB A;  1UNS A;  3J9C A;  2WLB A;  3P4P B;  5G5G A;  1TKY A;  3BZD B;  3AE5 B;  4LTU A;  4RFB A;  5T8I A;  1GB4 A;  1JCK B;  2YEP F;  3O13 A;  1SEB D;  4RCO A;  3ZJV A;  1D4B A;  2N7J A;  2QMT A;  1AYF A;  3B2G A;  1AWD A;  2HTM E;  4RH6 A;  2KQ4 X;  1L6U A;  1UWX A;  2DWQ A;  4WAF A;  1ROE A;  3AMZ A;  4IOI E;  5I4D A;  1PGB A;  1DOY A;  4YXD B;  4ITK A;  1KF6 B;  3VR9 B;  4USA A;  2AQ3 B;  1FM0 D;  3MJ5 A;  2DYM A;  4YTN B;  4ARI A;  1JRO A;  5HHD G;  3E56 A;  2CJO A;  4YSX B;  3ABV B;  3DWM A;  4ZYS A;  2MJE A;  4KKJ A;  4YSY B;  1TS2 A;  1RYJ A;  3ZQ4 A;  4KGR A;  2INN E;  3NRZ A;  1HZ6 A;  2XN9 C;  1ENF A;  4B0E A;  1E10 A;  4KGS A;  1TZO A;  3AV8 A;  5BYQ A;  4NAW B;  4YTM B;  3FC4 A;  1JQ4 A;  3GP7 A;  2KMM A;  4NZL B;  3IXS A;  2MJ3 A;  1MHX A;  1E9M A;  3U4E G;  3ZYY X;  1UWM A;  2MJD A;  1SXT A;  1QQR A;  2ZW1 A;  1FCC C;  1ZPS A;  5D3I B;  3U2S C;  3VR8 B;  1GPX A;  4HEA 1;  2IGH A;  1C79 A;  4IDI A;  4A90 A;  1SBB B;  2JX5 A;  1I4X A;  2V3P A;  3TEX A;  1XF5 L;  4CQN A;  1FNV A;  2BB5 A;  1XEE A;  3V05 A;  1N5X A;  3PZ8 A;  2V0G A;  4C80 A;  1TKE A;  2JWU A;  3I57 A;  2DLB A;  3HVD A;  1V8C A;  3C8Y A;  3NVZ A;  1WSP A;  1WXQ A;  2I38 A;  2J4X A;  1L5P A;  2LGI A;  2MH7 A;  5GXG B;  5EE3 A;  4A8X C;  1YNT E;  4RGO S;  1XCQ L;  3SFE B;  2JSV X;  4NJC A;  1VR9 A;  2W54 A;  1IGC A;  2MEK A;  2J53 A;  1M4V A;  1TY0 A;  3BVG A;  3VRA B;  5BMI A;  2ONQ A;  3R2T A;  4XWW A;  4WIP A;  4WQM A;  1R7S A;  2FE8 A;  4XE0 A;  4US9 A;  2M19 A;  2W82 A;  4J3O D;  3KWL A;  1WGK A;  1HXY D;  2EEL A;  2GI9 A;  5BYR A;  4M0W A;  4JX1 C;  2FUG 1;  2K3U A;  2WXJ A;  1C76 A;  3AE1 B;  3Q8F A;  4WWM A;  3P42 A;  2OED A;  2I2Y A;  4TQ0 A;  2LHE A;  2JQR B;  1V97 A;  1L0Y B;  4ZOH C;  1DOI A;  1KTK A;  2IDY A;  3AE6 B;  1C77 A;  4B0M A;  1ZDV A;  3NZ3 A;  4JPS A;  1C4C A;  3W2D A;  1JML A;  5MPO A;  2RMM A;  2YEP B;  5D7G A;  1JW9 D;  1TY2 A;  1C4A A;  3AE2 B;  3TEY A;  3R8B A;  4ZHP A;  1B9R A;  3DWG C;  3Q8C A;  1QF6 A;  1QIL A;  2JYT A;  4DXF A;  4US8 A;  1QOA A;  2INP E;  4A55 A;  1SE3 A;  4KGT A;  1UGJ A;  1K53 A;  3P63 A;  1SE4 A;  3W5U B;  3P1M A;  1P7F A;  4RF0 A;  4C7Z A;  2WXK A;  2ON8 A;  3AE3 B;  3NVW A;  3LYY A;  4YWG G;  1Q10 A;  1FD6 A;  3EGR A;  4GDL B;  2PMV A;  5G5H A;  3P4Q B;  1HZ5 A;  2PKO A;  3V3X A;  2WXF A;  4ZRP A;  1JWB D;  3UI3 A;  2PTL A;  1NYR A;  4OZB A;  1XCT L;  1N5W A;  1VZ8 A;  4HJG E;  5HG2 A;  1DOX A;  1B1Z A;  1I7H A;  3L4P A;  4MAC A;  2WDV B;  3KWV A;  1F0Z A;  1VRA B;  4ZRQ A;  3RFZ B;  1TKG A;  1GOZ A;  2BB6 A;  1DYQ A;  1WWT A;  2BS2 B;  1PUT A;  1FNW A;  1E6E B;  3Q8E A;  4DXG A;  1OQR A;  1IBX A;  1XLQ A;  2Y5P A;  2OHF A;  3IAM 1;  1STE A;  1BUI C;  2IGG A;  2CU3 A;  4NAM A;  3GS2 A;  1ACC A;  1NYQ A;  2G9H D;  3P4R B;  4IKG A;  5H8Y E;  2B76 B;  1D5Z C;  1FRR A;  2VZK D;  1NI3 A;  3MP9 A;  5HFY A;  3ZJU A;  1VZ7 A;  2SEB D;  2WNM A;  2E3T A;  1EM7 A;  1XXG A;  2KAC A;  1K52 A;  2WXM A;  4N59 A;  4LK0 M;  2V4I B;  1PGX A;  4PT5 A;  1TYG B;  3HRD D;  2QIL A;  4MT5 A;  1L6V A;  4RGM A;  3Q8A A;  1K51 A;  3EA6 A;  1SB3 C;  4L1B A;  5FK9 C;  1IUE A;  5EE1 A;  1IGD A;  2LUM A;  2X38 A;  3WCQ A;  3AE7 B;  4RGN A;  3Q8B A;  1FXA A;  4HRO A;  2PIA A;  2XNA C;  2E6X A;  3BK2 A;  3U7Z A;  3B9J A;  2LEK A;  1ZE3 D;  3TEW A;  3BK1 A;  1FEH A;  1C9F A;  1JWM D;  2EKI A;  1FCL A;  4TSS A;  1JWU D;  3W5V B;  1SF0 A;  2IPK D;  1ZDX A;  2JU6 X;  2WXP A;  3VRB B;  3U52 E;  5BYS A;  1E0Z A;  1J7C A;  1C78 A;  5BMG A;  3T3O A;  1E7P B;  1SE2 A;  1NEK B;  1ZOY B;  1TS3 A;  4WH4 A;  1T6B X;  2L83 A;  1UUP A;  1EU4 A;  2Z8L A;  1KH0 A;  1F77 A;  3LB8 C;  5AUK A;  1I4Q A;  2DBY A;  1V1P A;  2WXG A;  1HEZ E;  2HDE A;  3B2F A;  1QOF A;  4HRS A;  1YN5 A;  4KKI A;  1N63 A;  2KAJ A;  5EE9 A;  5LNK 1;  1I4H A;  2JZP A;  4GLS C;  3TUO A;  1J7B A;  2NMQ A;  3BWU D;  4TMA B;  4OZA A;  2N9L A;  2PW9 A;  3R2I A;  2WXH A;  1ZXI A;  3MC0 B;  1EWC A;  1MI0 A;  3AE4 B;  1T5X D;  2RDH A;  4WUR A;  2NTS A;  3NVY A;  5D3D A;  2WXN A;  3AEF B;  1YN3 A;  2K22 A;  1VDV A;  1N61 A;  1L0X B;  2M56 B;  1F2R I;  2ZW0 A;  3AEG B;  1SJH D;  5AUI A;  1QT9 A;  2WXI A;  1K50 A;  3AE8 B;  1VZ6 A;  1RM6 C;  4MH8 A;  3BYY B;  2BBC A;  1XLN A;  2RDG A;  2TSS A;  2BS3 B;  1YJJ A;  2ICI A;  4A9A A;  1TJE A;  1HQR D;  5C3J B;  2K9X A;  1ZP0 B;  2LHD A;  4MM3 B;  3SFD B;  1L0V B;  2PVO D;  4P16 A;  2H89 B;  4FXC A;  3W9C B;  5FR3 A;  2LJI A;  1SIJ A;  4N58 A;  3AM9 A;  2WXL A;  4H2A A;  1XO3 A;  4C56 C;  1TS4 A;  1QOG A;  1A70 A;  4P6V F;  4RNA A;  4OHJ A;  3AEC B;  2BTE A;  1N60 A;  1AW7 A;  4DQO C;  2GRI A;  2GB1 A;  1CJE A;  3Q69 A;  1C4P A;  1ZXH A;  3H8H A;  1CK1 A;  1MVK A;  1YQ3 B;  2M0A A;  2LMC A;  4JWS C;  4C7Y A;  5BMH A;  3VQI A;  1ZUD 2;  2JYE A;  1JAL A;  1D5M C;  2WDR B;  1MHH E;  2WP9 B;  4UDU C;  1QKZ A;  2WU2 B;  1KRH A;  1GB1 A;  1TS5 A;  2WXR A;  1RWS A;  2BT6 A;  2FBW B;  4KX6 B;  1JRP A;  3NS1 A;  3AEE B;  1RFK A;  4AS1 A;  1DGJ A;  5H92 C;  3EUB 2;  1L4D B;  1IBX B;  2QJL A;  2J52 A;  1PYW D;  3PZ7 A;  1WRI A;  3BVZ A;  2PLP A;  4JE3 B;  4OW0 A;  4L23 A;  5FKA C;  1JWS D;  3AEA B;  3GB1 A;  3IAS 1;  4N6E B;  3TEZ A;  1FXI A;  1QLB B;  5TSS A;  1JWA D;  1PDX A;  1FFU A;  2QEJ C;  2W55 A;  2CJN A;  3ETR A;  1I4R A;  4AQ7 A;  1T3Q A;  3N9Y C;  4LLG M;  2WXQ A;  4RGT A;  4JWU C;  2LFI A;  1YMH E;  4XDD A;  1F2R C;  2SAK A;  1ET9 A;  2RPV A;  1NEN B;  1Y56 A;  4REZ A;  3CIR B;  2L52 A;  1FO4 A;  3CWI A;  2KN4 A;  2L32 A;  2Y5C A;  1QOB A;  4L2Y A;  2WXO A;  1N62 A;  2BS4 B;  3T3N A;  4XWT A;  1VLB A;  1MPE A;  4HKQ A;  1D5X C;  2L1A A;  3NUH B;  3HUI A;  1NVI D;  1SSN A;  3ZJT A;  1ESF A;  2W3S A;  3LXF A;  3FAH A;  3AED B;  1EWY C;  2WDQ B;  1ET6 A;  4ARC A;  2ACZ B;  2NTT A;  3URY A;  3AH7 A;  2KWD A;  3SR6 A;  2AX5 A;  4YTP B;  4YSZ B;  1XLO A;  1P7E A;  4A6Q A;  1OFF A;  1V1O A;  4YT0 B;  4HKZ E;  2N0S B;  2W3R A;  3AB5 A;  4ZHO A;  1FIQ A;  2K0P A;  4O1N A;  4XDC A;  3PO0 A;  1WYG A;  1KLU D;  1CZP A;  3NVV A;  3BVM A;  3ZGZ A;  2JXT A;  1V1P B;  1YN4 A;  4GDK B;  3MFG A;  1FNU A;  3E9S A;  1BXT A;  2G1E A;  2PVG C;  5C2T B;  5JXV A;  3KQ4 A;  1PFD A;  3OWE B;  4OZC A;  5E6J A;  3P4S B;  3AEB B;  2J42 A;  1FMA D;  2VZK B;  1J7A A;  1FRD A;  1KLG D;  1FFV A;  1L4Z B;  3MHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...