4ZOHC

Crystal structure of glyceraldehyde oxidoreductase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
MKIINSDQKVKITLKINGEKYETEVEPRRLLVHVLRELGFTGVHIGCDTSNCGACTVIMNGKSVKSCTVLAVEADGAEILTVEGLAKDGKLHPIQEAFWENHALQCGYCTPGMIMEAYWLLREKPNPTEEEIREGISGNLCRCTGYQNIVKAIKAAAEKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal Mo-Containing Glyceraldehyde Oxidoreductase Isozymes Exhibit Diverse Substrate Specificities through Unique Subunit Assemblies.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase molybdopterin-binding subunit
total genus 49
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
C PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 4zohC02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zohC01
2CJOA 3HUIA 2W3SA 2WDQB 1JRPA 2MJEA 2AX5A 1JROA 4YTPB 3AE2B 1F0ZA 3AEFB 4JX1C 1XLQA 3B2FA 1RYJA 1XLPA 4YT0B 3AN1A 1E9MA 2BT6A 1NYQA 5GXGB 5AUKA 3W9CB 1VDVA 1YJIA 1QOFA 1N63A 2DBYA 1FO4A 1A70A 4P6VF 1DOXA 1NEKB 3W5VB 3HVZA 2WP9B 1JW9D 5EE1A 2W55A 3AEAB 1FIQA 1FMAD 2H89B 3CWIA 4JWSC 4N59A 1QOAA 3VRAB 2ACZB 3CIRB 5H92C 3NS1A 2JQRB 1QF6A 1ZXIA 4USAA 1TKGA 3SFDB 1ZOYB 2HTME 1DOIA 1SB3C 2KAJA 1SF0A 3RPFC 2G1EA 3AEDB 1GPXA 2WDVB 3B9JA 2BS3B 5EE0A 1CJEA 1TYGB 3AV8A 2MJ3A 4HRSA 4KX6B 5EE9A 2CJNA 4ZHOA 1V8CA 1J7CA 2M19A 1TKYA 1NVID 2WS3B 4N58A 2KMMA 2WQYB 3BIID 2E3TA 3EUB2 2QIEB 4US9A 3P4PB 3FC4A 1DGJA 2MH7A 1IUEA 3DWMA 2M56B 4LTUA 5G5HA 1KRHA 4A9AA 2W3RA 3NVVA 1JALA 1T3QA 1FXAA 4WWMA 3NVYA 1PUTA 4YTMB 1L6UA 1PDXA 2FBWB 2QJLA 3AE6B 1L0VB 3P4SB 3NVWA 1RFKA 3FAHA 2DWQA 1FRRA 3P4RB 1XLNA 3PO0A 1TJEA 1N5XA 1OQRA 3AE3B 1QT9A 1WWTA 3VR9B 1WRIA 1JQ4A 5C3JB 1WXQA 5AUIA 2L52A 2BS2B 1ZUD2 2OHFA 4N6EB 3AE1B 1AYFA 4YSYB 4C80A 1QOBA 4C7ZA 1VJKA 3KWLA 3P1MA 4C7YA 3AEBB 4IDIA 4JWUC 5H8YE 3AB5A 1FRDA 1YJJA 3ABVB 4YTNB 1AWDA 1WYGA 2PVOD 1EWYC 1DOYA 1ZP0B 2BS4B 1V97A 1YQ3B 2PKOA 3P63A 1WGKA 2W54A 3AE8B 2PIAA 2WU5B 2Y5CA 3AM9A 1R7SA 1UWMA 3HRDD 4YSZB 3AH7A 3W5UB 2WLBA 1J7BA 1NYRA 3SR6A 1RWSA 1B9RA 1KFYB 1N62A 3AE4B 4US8A 1QOGA 1FFUA 1L6VA 3SFEB 2JX5A 1N5WA 3ETRA 1VLBA 1I7HA 3AE9B 1FM0D 1PFDA 1SIJA 4FXCA 2PVGC 4ZHPA 1ROEA 3VR8B 1E10A 1RM6C 1QLBB 1FXIA 1KF6B 1OQQA 3P4QB 3B2GA 2B76B 3VRBB 2H88B 3WCQA 2K5PA 3DWGC 3AEGB 2CU3A 1N60A 4HROA 1N61A 1E7PB 2WU2B 3NVZA 1JWAD 3AMZA 1XO3A 1YQ4B 1XLOA 4WQMA 4YXDB 2LEKA 2MJDA 1L5PA 5G5GA 2Q5WD 4ITKA 1OFFA 1FFVA 2EKIA 3AE7B 1CZPA 1NENB 1JWBD 1NI3A 1GAQB 3ZYYX 4ZOHC 3AE5B 2L83A 1E6EB 2WDRB 5MPOA 2K22A 1E0ZA 3NRZA 4YSXB 2N0SB 3L4PA 3AEEB 5C2TB 1TKEA 3LXFA 5EE3A 3AECB 1J7AA 3LB8C 2K9XA
chains in the Genus database with same CATH superfamily
1BNOA 1WCLA 3PW5A 4R66A 1MG4A 2KDEB 3T3FA 3IBEA 1UBQA 5AI9A 1BPYA 2Z59B 1FPYA 3AN1A 1P7DA 3EZ5A 4PL2A 5KFUA 8ICBA 2KACA 5EWFA 3M6ZA 1QOFA 4FS2A 4QZGA 3V05A 3VVWB 4CYEA 2WB1F 1FO4A 4RQ5A 2BKRB 3VAWA 3RJJA 4CCHA 5AI8A 5LNK1 3URYA 7ICIA 3W2DA 2IBKA 2B0CA 2IZVB 2R18A 2YTUA 5AI4A 4FO6A 4RH6A 1S9FA 1ZQLA 4RQ0A 2HDOA 2W04A 1DYQA 4O5KA 2RPVA 1TFRA 4Y2QA 2QLTA 2LKYA 4C8LA 1J2NA 3PNCA 2WHEA 1D5ZC 3QIJA 2WXKA 3Q2AC 2KVRA 4WWMA 2K8BB 3MC9A 2IGDA 5KL1B 1WX9A 4C8KA 1V1OA 2FBWB 4M2YA 1N48A 2ASLA 1J97A 3FKYA 5KFCA 3FAHA 5KT6A 4RNAA 4F8RA 5F9NA 2ICIA 1TJEA 1NK5A 4B95A 3RBDA 2BGFA 2INDC 2HHQA 5KFGA 4OCZA 5AKZA 4BUGA 4HJGE 3IRUA 4RPXA 3C1YA 5JU5A 4RPYA 4C80A 5J2DA 4F50A 1QOBA 2GOWA 4JWUC 4NAMA 5G55A 1TE2A 2Y0SC 3WK7A 1WYGA 1V9JA 3UXPA 4CF4A 3Q3OC 5D49A 1ZQGA 1I4QA 2XC9A 1GB1A 1YJ1A 4GC7A 3E58A 4B9UA 2G07A 1ZQFA 4JWMA 3V61A 9ICFA 4RQ7A 2PFOA 4E74A 8ICNA 1C4CA 2V4QA 4QWDA 4CDGA 4GC6A 4RQ1A 4CRXA 5KL8B 1L0YB 4P0PA 2IHMA 1ZQXA 2MBHA 1UBIA 2W9NA 3HIZA 4FHJA 4NAWB 4MF2A 9ICTA 3GZNI 1Z3EB 4K4GA 7ICGA 1D6EC 1V2YA 2EKEC 4W9KA 1NBFC 1UQVA 4MGYE 3VR8B 4JMUA 1L3SA 4RF0A 2H88B 2M0AA 3R7QA 4DCCA 1Z1BA 1LQBA 3KHRA 3GOEA 1CUKA 1K53A 2LMRA 1B4FA 2LGSA 1PK1A 1SE9A 1YQ4B 4EZJA 3C1ZA 4NLNA 3ZD8A 4YL8A 3Q8KA 2D11A 2N9EB 3WKBA 3VUYA 1N2XA 3TSSA 2K4HA 2ZXIA 1ZQOA 1ZQUA 4AP4C 2YN4A 5J0PA 4JK1A 2AU0A 1E6EB 2OJWA 3NRZA 4DSJA 2O6VD 2XIDA 4NY0A 4NM2A 4DFKA 4HDQA 2ZUBA 4UAUA 2K25A 2NTSA 2K9XA 3LB8C 1E10A 4ED6A 1N6ZA 1SXDA 1P0RA 1KKXA 1SE4A 4YT0B 2FCNA 1J8CA 4C4SA 1RG6A 4MDKE 4ASWC 1ZQEA 2HBKA 1BPBA 1T0QC 2KHVA 1A70A 4P6VF 2Q0ZX 8ICGA 2DAFA 2LASA 4DHZE 5ALIA 2OXOA 3H0RB 3MR2A 4OVZA 8ICFA 1H4RA 1GOZA 3NS1A 3ZDCA 1TBEA 4AOFA 1Y56A 4I6NB 2FMPA 2QARB 4EBEA 2RR9A 3EW9A 3U2SC 2N1RA 4QZEA 1EWCA 3IFWB 4GGQA 2EDUA 4Q45A 2G08A 5AK4A 2ASJA 4B9MA 4IC9A 1NVID 2KMMA 4BBNC 2KFNA 4HCNB 8ICTA 4RQ8A 4I6PA 3FC4A 2DHZA 2E8NA 1L7PA 1QSLA 3ONSA 2WX0A 7ICJA 4NNJB 5TISU 5DBBA 1D3ZA 3ZW3A 3O0FA 3NUHB 1OTRB 2KXJA 8ICZA 4YR3A 3WAPA 4K7WA 4AWJA 4B9KA 2DWQA 3P4RB 2IO1B 3GU3A 2PJHA 4TV3A 3SDLC 2WTFA 3PZ8A 2NRTA 4KTQA 4O3SA 2XGPA 4KSLC 2FPMA 1Q3VA 4C7ZA 2I9GA 3H8JA 1LO5D 2KIWA 1L0XB 5ALRA 4DDID 2WXGA 1Z00B 2Y9UA 3K75D 1XS9D 1D8LA 1EWYC 3JPSA 3RNCC 1YQ3B 4X57B 3BQ1A 3AUOA 2PIAA 1CRXA 3ZDDA 4FBTA 2I5HA 5IIJA 2Y5CA 4CO7A 3EWAA 3UPQA 4DL3A 4PHAA 3N7PD 2KQSA 3H8SA 2MEKA 4JGHB 4RM8A 4B6WA 1TS4A 5FR3A 1HUZA 5AIAA 1V80A 5LXIB 3CF6E 2VA8A 4C8NA 3J81j 1ZQMA 1TS5A 4ANVA 1B0XA 3BINA 4CGZA 3AE9B 4Q8FA 2AHOB 4M6WB 5AHXA 4A6QA 4QIWF 4DS4A 4PGQA 2ZTEA 3A0BU 1OQQA 1RYUA 5DLGA 3RZWC 1K1QA 5ALKA 2H3IA 2W9BA 3NZUA 1GC6A 2LBOA 3ZI4A 1S10A 1R4MI 3C8YA 3DBLI 3QXGA 5KG6A 4GN1A 3OPXA 1D5XC 3BYTB 5DLFA 3RJGA 2DPIA 3I9V1 4ECYA 4ZOHC 4MGIE 2NS5A 2UWQA 2WDRB 4MEYA 3AEEB 2Y1JA 3K1ZA 4HPLB 2WXLA 5AKHA 4C8OA 2LUEA 4LLGM 5T8IA 4G3XB 1ZQPA 5TZVA 4P4PA 4UASA 2C2DA 3SD5A 1DXSA 2UVRA 3KKAA 4GB9A 4DOCA 4RNOA 3D32A 3NGDA 4OZAA 3PSPA 5GXGB 1RPLA 1ZOLA 3N97B 1ECWA 2KC1A 2ZVNA 3NS8A 5C23A 2KKPA 1CK1A 3H7SA 4BVUC 4GIVA 5AKGA 1UD7A 4NLKA 5H92C 3HJEA 2Y9TA 4XX5A 2QARA 3EGRA 3H7PA 5KFZA 3VUWA 4EUTA 3ZXRA 1XXGA 4DXAB 1NKCA 3BS5A 9ICEA 4KKIA 1LKYB 2BYFA 4YR2A 1QCKA 2ASQA 1V1PA 4F4KA 1UWXA 9ICLA 2LXCA 3A4SC 2KVCA 2DAJA 3ML9A 1CI4A 1ZRNA 2AGQA 3DHGC 1PGXA 3JW0X 3F2BA 2DQNB 3I28A 2PMZC 3T5LA 1ZQDA 1SL0A 1JALA 4BX9C 5LLIA 1T8EA 5DGAA 1QZEA 2J7QB 2XK5B 1L6UA 4EFOA 2HHSA 4NZLB 1I42A 1T94A 4EOYA 2FCQA 4MEMA 2L1AA 1ZQSA 7ICHA 1WM2A 3MGVA 1OQRA 3RR7A 3ML8A 4I2BA 3T9LA 2EZZA 3UINB 2BS2B 3V7KA 2GBMA 4UDUC 2H5XA 3V7JA 1V81A 1OGWA 5AKIA 4C4VB 1Y88A 2OWOA 3SEIA 2P35A 2KSOA 2C28A 4DOAA 2VA2A 4L1BA 4DXFA 4B9SA 4ECWA 2G5IB 3LJ3A 2DNFA 1K5OA 1I4RA 9ICAA 4Q44A 1E8WA 4I2CA 7ICFA 5J2RA 4ICAA 4P1BC 2JPHA 5F9LA 3AH7A 3CNHA 3SI8A 9ICIA 1YT3A 1XSPA 2RDGA 1RWSA 3I76A 5IIOA 4DO9A 1S0VA 4MELA 4F5QA 3PGEA 4EZKA 5B5EU 1NJWA 5TSSA 2ZIUB 4DLGA 4QJFB 3THVA 2KZMA 1VZ7A 2AWTA 4WJOA 1BPXA 2F44A 2KZZA 1YX5B 1C9FA 1C76A 1QSSA 3AU6A 4ZDVA 3DWGC 3M62B 1QQ7A 1SE3A 2ZIVA 2NBVB 2FLLA 1TZ1A 4WIPA 3A9JA 2C2RA 2C2EA 1O08A 2YMQA 2BVCA 2K89A 5KT5A 2Q5WD 3QUCA 3Q3JA 1FFVA 2WYQA 1SXTA 3K1RB 2ZW0A 1HXYD 1V49A 3WU2U 5AK6A 4IL6U 3SHQA 2BWES 4YSXB 4U7CA 3HX0A 4HWIB 3ZJVA 5IOIA 2A1JB 3HUIA 2NO4A 1KTKA 2MJEA 4K81A 4UB4A 1WG8A 2Q4TA 2HOIA 3UIPB 3GE3C 2F1JA 3N4MB 2K8BA 4CQNA 1Z19A 2KJRA 4B6JA 4MH0E 1SBBB 4P4MA 4J9MA 2HVHA 2BZFA 4Y2PA 4JB3A 4PYUA 4P1CC 4TQRA 5HP4A 4PHEA 2M0XA 1SGHA 1FEHA 2NR2A 1GJZA 1F77A 3RB3A 4RQ4A 3RH4A 2WFAA 2BYVE 1XD3B 2H89B 4C56C 2JQRB 3VFKA 4YFKA 3RMKC 1ZXIA 2BKFA 4LDTB 9ICBA 3RCZA 5IKCM 3WIMA 2ZUDA 2KAJA 3MHSD 1XO1A 3IP4B 4QAYA 2DKZA 1TAUA 2WDVB 5EE0A 1GC7A 4QWBA 3HKZC 4E0DA 9ICJA 1V8CA 5J2AA 2HHTA 5ALHA 4F92B 4DSFA 5J0QA 3RN9C 2KQ7A 5J2FA 5DG7A 2W3RA 1JXLA 1KSPA 2K39A 3VCBA 3C2MA 1L7OA 1NOMA 4PGYA 4PHPA 3KHGA 2IA6A 3F2DA 3RR8A 2O2VB 4ZH4A 4TUQA 2MCNB 2D3DA 2OH2A 3KZIU 3WK6A 3AE3B 2DKXA 2KX3A 2MSNA 1F5SA 1L3UA 4KLFA 5JRTA 1PVQA 2BCRA 1WRIA 3KYCD 2KKVA 5KG0A 5ALLA 2ESEA 1YJJA 4IQWA 4Y2RA 2V4LA 2M0NA 4UB3A 2OM6A 1SZHA 1XO0A 3PW4A 4FADA 1BPZA 1OEYA 3QYPA 2FLPA 2INPE 2PW9A 2H3VA 4IM0A 5D2MB 2WXHA 5EDSA 4GDLA 8ICIA 2KTFA 1ET6A 3UXNA 3E56A 3HRDD 5L9XA 2JZPA 2WXNA 3BK2A 5IO9A 3H9DA 2C5LC 2XO7A 2BWFA 2FDRA 3SYZA 1YZ6A 4LDTD 2PXIA 5FP0A 1KRPA 3ETRA 1U47A 3L13A 4IUMB 5KFMA 5AM1A 2XN9C 3R9KA 1MPEA 3EECA 1I4HA 1MQ2A 1KF6B 2HCFA 3D2SA 2LYBA 2DZJA 1ZQIA 8ICYA 2KZ3A 3CYMA 2RSUA 1ZD3A 2YB4A 2C7HA 5BYSA 3H0LB 2F2AB 4YD2A 4OW0A 5DPSA 4MFCA 1V85A 4OJPA 1IPGA 2JXJA 3BVGA 2A1AA 3WKAA 3MJ5A 4F5RA 3V6EB 1GAQB 2GBJA 4XGAB 4O5EA 4NQLB 4K7SA 3O13A 2L76A 3S6JA 3H4BA 3L4PA 1KH0A 4IR1A 5AKKA 2BPSA 4I6LB 1JRPA 4FZLA 3OJSA 2BGWA 3R66C 2KLGA 2HW3A 3GZNB 5JTIA 5J2HA 3QU4A 2KANA 2KKCA 2PTLA 2DF4B 2GI9A 4RPZA 3Q8QB 2KD1A 4Q2JA 5CRXA 4BWJA 4GDKB 1XNSA 3EYZA 5JUMA 2KLCA 3T79A 2QDFA 2FJ6A 1BPEA 2AXTU 3UXOA 5EE1A 3BQ0A 1PK1B 4AJYB 4D2KA 1FMAD 4N59A 4DQSA 3MFIA 2M9NA 3WK8A 1WJNA 2N1VA 4FJYA 1WE6A 1JWSD 2O6VB 3Q14C 2KG5A 2RDJA 3M8RA 1ZOYB 3HK0A 4P7IA 1DOIA 2G1EA 3P42A 4G0NB 4I2DA 4WWOA 2HOFA 3OJ3A 1BGXT 2BB6A 3ZIMA 2ZXHA 1T3NA 9ICUA 1KLVA 9ICPA 1VD2A 1LB2B 3T3OA 1L7YA 1MC8A 1TKYA 3KBBA 3UQAA 2J6UA 2M1MA 3NTUA 1GO3F 2BTEA 2E8OA 2M4NA 1ZQHA 1T3QA 4YTMB 1JXEA 1L8OA 2IO0B 1IGDA 2JXXA 4RZRA 1KN5A 2P66A 1MA7A 2F76X 4M6WA 1U45A 5C3JB 4PGXA 5KFRA 2JVCA 3VQIA 3U52E 2NRVA 5FKAC 5HMMA 4UBBA 2QC8A 5H8YE 2V4RA 4MGZE 2ZNVB 2K6DB 4FA6A 1E5WA 4F5PA 2DL0A 3ISCA 1ZQWA 4Q8EA 3P63A 3PSFA 3G6XA 1ZETA 4I2HA 2ZJ5A 3ZDEA 3H7PB 1YQBA 3NASA 3T5HA 1SV0A 1PK3A 3H8MA 4KLEA 1NK8A 2WAQF 1JWMD 4RGTA 1X1MA 3ORYA 5KFKA 2MP2B 3QC8B 3DOWA 2XK5A 2RP5A 1U9LA 1JMSA 1TK8A 2PPHA 1QQRA 4KX5A 3QAQA 3TADA 4O3QA 2GH1A 4P4OA 1WX7A 2W8KA 1VRAB 1S5LU 2BW2A 1X40A 2D3CA 1GB4A 2VJ4A 4PS8A 3UIOB 1DRGA 3RNGC 4QNLA 1HJPA 3LVVA 3EPIA 1E7VA 3QA8A 5ALMA 3SQIA 1E7PB 4F2RA 4XDDA 1XLOA 2MJDA 3PSTA 4IS7A 2DZIA 1JWBD 4ED1A 3B1LX 3AE5B 1SEBD 3MC0B 4OZCA 4YCXA 2VJ5A 5DB8A 1TV9A 3TKAA 2EANA 8ICMA 2R2QA 2G09A 5HG2A 4EELA 2KN7A 3RULA 4TUPA 3I3TB 5KFBA 3BQ2A 2HHWA 4ED0A 4NJ8A 2HDEA 4KLUA 3NY5A 3RUIB 2WB1C 5J29A 2C7MB 2JY6A 2Z0DB 1C79A 3DCGA 4KKJA 1VZ6A 3CP8A 4Y2VA 2I1JA 2EQYA 2E1FA 3SAGA 3HKZF 4BWMA 2FUHB 2KEYA 3R2IA 3HVZA 5CEHA 1PVPA 4BZAA 2KJ5A 4F91B 2H3QA 1NK0A 2J42A 3DBLB 3KVFB 4IWQA 4NJ7A 3U8ZA 1I4XA 3GV8B 4EBDA 2KP7A 3SV3A 4ED7A 3L54A 1ZJMA 3V7LA 3C29A 2CN1A 4J9PA 4HPMB 2M17A 3RNAC 2PEAA 1Q5WB 4HRSA 4ECQA 1SSNA 3U7ZA 3ZNGC 1T5XD 5AM0A 4PS3A 2NMQA 2E3TA 2MQJA 2LJIA 2M56B 1UA0A 4ARCA 2AJQA 3SU8X 2GBNA 4B9TA 4ZRKA 2CR5A 3UQ0A 2BKEA 2MBQA 3P4SB 2G06A 3NVWA 4XDCA 4YWGG 5DQGA 4HEA1 5KFTA 3OG5A 4A8EA 3I5JC 3QEBZ 2OYYA 2K4IA 3GP7A 2I2YA 5F3XB 2KTQA 4QZIA 1AYFA 3W1YA 1NK6A 4HDOA 4YTNB 3E2EA 3ABVB 3RNFC 4WWPA 1C4PA 5E79U 4RQ2A 3LDAA 1WFYA 3IDWA 1ZP0B 1ZRMA 3SEBA 2BPFA 3KTQA 5KFQA 1WGYA 3KWVA 4DXGA 3AM9A 4ECZA 1R7SA 2JEJA 2K4PA 4IKGA 5T14A 4KVGB 4ICUA 1KQQA 2LHDA 3B0AA 3PT2B 2KK0A 5ALQA 2WLBA 4FZMA 4TKNA 4KLTA 2F3NA 2ISOA 5CJ7A 1P98A 3TIXA 4YG2A 2G3QB 5ALGA 5IILA 2JRIB 3N28A 5AKYA 5AM2A 3KUDB 5DDMA 4FXCA 5L1IA 2PVGC 2ES6A 1IXRA 2ZTDA 2KQ4X 4ZHPA 4RF1A 2JV3A 3D6JA 1UNSA 2QCZA 4IOIE 3TUOA 2J6SA 1WM3A 3B2GA 1KLNA 1VCBA 5ALSA 3BQ7A 2PKEA 3MR5A 4HROA 4II3B 3NOBA 3U7DA 2MBBB 2WXIA 3AMZA 4FBUA 4ANUA 3NG0A 4QWCA 4KLMA 5KT3A 5CX3A 2AGPA 4R8UB 5AK3A 3JPNA 1QTMA 4EZ6A 1ZXHA 4MHVA 2VH2A 2VIXA 5E6PA 3PTFC 2D2QA 2GBRA 4JE3B 4ED2A 3ZNZB 2TSSA 2K22A 3DBRI 3ZLZA 8ICQA 2MWSB 1E0ZA 3QU2A 3NZ3A 4RGNA 2GWSA 2R2OA 2MU2A 2NO5A 1V5OA 2E5SA 4FE3A 2F1IA 5BO4B 3SAFA 2JYEA 5K4LA 5IIKA 1UGJA 1YN4A 4CF5A 4CNQA 2K8CA 3APCA 2VRRB 3DVNV 2ZEQA 2FPKA 4Y2YA 3DPDA 3IT6B 4AJWA 5AUKA 4WWNA 3VTWA 2LYHA 5L95C 2KO3A 3IVFA 1V86A 2DBYA 5ALDA 5DB6A 1ESFA 1V1PB 2SEBD 3W5VB 2PFPA 1NZBA 4DF4A 2BCQA 2VZKB 1P9DU 1DOQA 3BS5B 1U4BA 1G6JA 4HAIA 5DGBA 3M9MB 5AM3A 2CU1A 4M01A 4J9OA 2WHIA 3DQVA 1IBXB 1HEZE 5LXHA 1TS3A 4E71A 2K6QA 5J0RA 8ICPA 3T3NA 4BXOA 3I63C 1GPXA 5BMHA 2XVTA 4YD1A 3Q8PB 1XSNA 5C0YA 1TYGB 2KK8A 2WXFA 3AV8A 3L17A 5FR6A 3TEYA 1WIAA 1KFTA 1D8BA 1EF5A 1TTNA 4E3CA 2L00B 2GLEA 2KMAA 2QIEB 1ZJNA 1QSYA 2P6RA 3JPQA 2W82A 3P2BA 3VHTC 1P3QU 1WJ6A 3I57A 2MRLA 4EYIB 4K3CA 1SGGA 2IOHA 2UVUA 3QEAZ 1FXAA 1WSPA 4NPNA 3D2QA 3JPTA 8ICVA 4JQWC 4P0PB 4F4XA 1J0GA 2L7RA 3J9CA 4UAZA 4UB2A 5DPRA 3N7SC 7ICEA 4QW9A 1HUOA 1FXTB 4DFPA 3GE8C 1Z00A 2V3PA 8ICXA 3RJHA 3TAQA 3IG3A 1L6NA 4F2SA 2UYZB 4F8CB 1VJKA 4XA5A 3P1MA 3Q8EA 2BCSA 4PZOA 3PO5A 2LGDA 3PZPA 1AWDA 4EBCA 4MFFA 2E8MA 5KFDA 2FCSA 1V97A 3IG5A 3LYSA 1FNUA 3IM1A 1NZPA 2RRDA 4RQ6A 2GB1A 4HYKA 2W9CB 1A77A 2X38A 2D6FC 4YSZB 4Z6EA 4P0QB 1URJA 1ZQ1C 1RXVA 3QUQA 3SR6A 4R64A 4XYCA 2NPTB 4ZRQA 4KX3A 4JV0A 2ZJDA 2JHDA 4UB1A 3ZDTA 3N32A 7ICQA 3IHQB 2HBMA 2IBIB 3M7DA 1IBXA 2OOBB 4KV2A 2IY0B 2DYBA 5AZFA 3V62A 1L4DB 5JHAA 4DSEA 2R61A 1HIWA 3AEGB 1N60A 1WGGA 2LXAA 5KFHA 3PMNA 5KFIA 1JWAD 1IM4A 2KD0A 4J3OD 1S77D 2LEKA 2YX8A 1OFFA 2EKIA 1KTQA 3ONNA 2NCNA 1FCCC 2KE7A 3AEVA 1M6YA 3GIJA 4B9NA 1K50A 2WXOA 5AI6A 4EEKA 2OEHA 3LXFA 5IP4D 5KFSA 3Q69A 1IIPA 5KT4A 3WK5A 1Q0WB 2AX5A 5DG8A 1O03A 2V3NA 5BOLA 4LNIA 2ALZA 4KLOA 2V1YA 3VH4B 3A33B 5KT7A 3CSFA 5CTRC 2J0MA 1C20A 2E1EA 1NJYA 2KN4A 5KG5A 2KWVB 3N30A 1ISNA 1YX6B 2BYEA 4R8UA 1L4ZB 4A3OA 2PLPA 2D10A 1VJ5A 3C2KA 3X23A 1V6EA 2W55A 1FIQA 4DQIA 3PZ7A 4IRKA 1CMXB 3OHBA 5KFYA 3DVGY 1SWWA 2EMSA 3H40A 4OJOA 4XUSA 2A1JA 2EH9A 3VUXA 4DFJA 4PZNA 2EZYA 1L3TA 2PI4A 2G4DB 2O6VA 2AQ4A 7ICUA 2KTRA 2L05A 4KX6B 3F53A 4A90A 1DK2A 2RGFA 5C1ZA 3PX0A 3RJEA 4NL9A 4N58A 3HPOA 3HWTA 4ECSA 4HVBA 3APDA 1U48A 1RYRA 3G6VA 2WX1A 3U4EG 3RF9A 2D8CA 4F4WA 2CRXA 3BVZA 4EEYA 1FNWA 4DL5A 4C4VA 1PUTA 4DL4A 1S0OA 3A9KA 8ICUA 1PDXA 2EZXA 4PS7A 2BQQA 3KKAC 3LYYA 1F1HA 3A9KB 2RHFA 3PO0A 3GILA 1KLGD 3DBHI 5ALTA 4HPPA 2KICA 2ZIWB 1UCVA 3L5KA 1QKZA 2FMSA 9ICKA 3TQ1A 4YN4A 5AZHA 4GDLB 4IDIA 2P6UA 1FRDA 2A19A 1U49A 4P2HA 2K1FA 3L3FX 2NTTA 4LNFA 4UAYA 4WURA 5DPWA 3IT4B 3G6YA 2PKOA 2W9CA 1SV0C 2KDBA 4HJKA 5L1MA 2QB1A 1TKDA 5BOMA 5EOZA 2A3VA 5KG3A 9ICNA 2HBJA 1LKYA 3W5UB 3WA0A 3UMCA 4BKGA 5DG9A 4M9HA 3BDPA 2KC2A 9ICWA 1PVRA 2XGQA 3SFEB 3BK1A 4W9HA 5CB1A 1PQSA 3PV1A 3A0HU 2DYOA 2FLNA 2UU7A 1MSWD 2M8SA 5D94A 1ZQNA 1S0NA 2AL3A 4PJ0U 2XY5A 2B76B 4A55A 4FJVB 1WY8A 3UMBA 1KOTA 2JRZA 2KTRB 1L8LA 2WGSA 5I4DA 4ITKA 3EHVA 3BYYB 5FK9C 3ZYYX 2PE6B 2KJ8A 2N9PC 2INNE 2XBBC 3Q8MA 4TURA 1D4BA 3HP6A 5E6NA 3X0WA 2ASDA 5AKXA 4AYBF 4KMOB 4DL6A 2JT4B 4GIBA 3GB1A 4X5VA 2AQ0A 1XT9B 4BKSD 1C4AA 9ICCA 2GMIC 2GRIA 4CHKA 1MG8A 1ZD5A 3DHIC 3H6NA 4F4ZA 4M9GA 3V72A 4YP3A 1HZ6A 3PRPB 1YJIA 1KEJA 1QILA 3ZJTA 4RGMA 4DEZA 4KLHA 1F2RC 2IYDB 5IN7A 2MW5A 2QSDA 4II2B 1TK0A 4FS1A 1JRUA 3H8HA 3AEAB 3N20C 1QOAA 3CW2C 1HZ5A 3EFCA 3TFSA 1QF6A 2KV2A 5EWGA 1WWVA 3SENA 2UVVA 4C4TA 5HR7A 2AEHA 3OSPA 3F2CA 3EC8A 2ZCBA 4NM1A 3ISBA 5BYRA 1AQ6A 2IGGA 3PR4A 1PGAA 1UZXB 2IOFA 2LVOA 4XWWA 4IC7B 3GIMA 4G9BA 2M19A 2KNJA 4YR0A 4F93B 3CMMB 4LZGA 4EZLA 1XU4A 4IR9A 3Q6BA 4WH4A 5AEKB 1SKSA 1UT5A 2FAZA 3UF8A 4L23A 3PW2A 4O0IA 5ALPA 3AE6B 3AI5A 2RD0A 1IYFA 3GZFA 2L3ZA 3BJYA 4NLCA 4BJQA 3PREA 5KNIA 4WAFA 2AQ2B 5KG2A 1P7FA 2DX5B 4EYHB 4F71A 3RRHA 1XC9A 4XWTA 2NRXA 3SD7A 2BQUA 3JYUA 3KW5B 5AM5A 4RCOA 2IOFK 1B1ZA 1KL9A 2W54A 3KD3A 1SZPA 2RDIA 2WU5B 4REZA 5KFLA 2IJ0A 1WUDA 2D07B 2MSED 3W1SA 1KDHA 4IM3A 3PW7A 4K4HA 1HE8A 5KFVA 2LHEA 3A1QB 4JLCA 4OVUA 2EAPA 3TEWA 2ON8A 3QK0A 2KZRA 3N1YC 3PRMB 4F5NA 2DZKA 4US8A 3EFUA 3BQTA 2C60A 1M4VA 1EO6A 4DQRA 4TSSA 3PVXA 3NHEB 2VA3A 1E8ZA 2N9KA 5JXVA 5CHVC 3C28A 3TMPB 1QLBB 2Y5BB 1X9WA 1T0SC 2ZW1A 3PMLA 1CEZA 5KTQA 3ZDMC 1P1AA 5KG7A 2XCPA 7ICNA 5KT2A 2WXJA 4ZYNA 3NVZA 4U6PA 1F0MA 1L5PA 2KHWB 2JEIA 3ICXA 2HMXA 5KFFA 3MR6A 3ECIA 1SL1A 1KLUD 4A3PA 4NWIA 1SE2A 4GOCA 4J9NA 2ZJ8A 2IGHA 4ECRA 3V6KA 5C2TB 2XNAC 2N9XA 4W9LA 1UA1A 1WR6E 7ICRA 3MABA 3BZKA 2FPLA 3B2FA 5KFXA 1ZQQA 2ZCCA 3DBHB 2YVCA 3TBLD 1NYQA 5ALEA 2RQ5A 2QB0A 1VDVA 3PVLA 4H2AA 2PFNA 1ZE3D 2LD9A 3V6HA 5DPTA 2HI0A 3QE9Y 1P7EA 4K3BA 2BR0A 3UQBA 5JZEB 2KMCA 4IG7B 3BZDB 4BKSA 1XEEA 3RAXA 2ZIXA 7ICTA 4NV0A 2FI1A 3CIRB 1Q3UA 1TK5A 4RQNA 3V3XA 3AU4A 3L16A 2RLTA 3N3KB 1EU4A 4DQPA 5DQIA 4F3OA 3Q8CA 4FN2A 2FIFA 5CHWA 2MUTA 3IAM1 3PW0A 3M63B 4ZHOA 4L2YA 4KDIC 3VXWA 3RFAA 1K8RB 1X2IA 1JIHA 3EUB2 1NK9A 2Y3AA 1PYWD 2JGAA 2EELA 2FNJB 7ICKA 4O5CA 4S17A 1XCTL 1X42A 3NVVA 3VTVA 3KUZA 3DBSA 5L1JA 2Z7JA 5J17A 4B9LA 5JH5C 3QX1A 4IW0A 2LFIA 1NKEA 4JV2A 5J0YA 4R63A 1Q1OA 4QZ8A 3VR9B 1C3TA 1JQ4A 3HILA 4IRDA 5AUIA 3TL5A 1V9PA 2WF8A 3AE1B 2BHNA 4QZFA 4PPXA 4C7YA 3AEBB 3UM9A 9ICVA 3BZCA 4KZCA 4QWEA 5J18A 2LI6A 4UATA 1PUZA 2DFLA 5KFJA 4ED3A 3WK9A 1C7YA 4HCPB 3AXCA 4PK1A 3M8SA 2B3AA 5D3IB 4BFRA 4PH5A 3MJWA 9ICRA 2KYWA 1WX8A 4UBCA 4GMVA 1R4MB 4NXZA 1X9MA 3T8MA 4HKQA 2JH7A 2WF7A 2IO3B 5GTIU 2YQEA 2BDPA 1VR9A 4GXKA 4RQMA 4G50A 4XZ4A 2JZBB 4UB8U 3PZDA 2EMTA 4M8NA 2KWUB 2R8JA 5J0OA 3KZXA 3HM6X 3ZTCA 1ZGUB 5KFNA 2KN5A 2WXMA 3PO4A 3P4QB 5KAIU 3FM9A 3TEXA 4B0EA 3ZRFA 4YXJA 8ICWA 4GFJA 3LDZE 4C4RA 4WQMA 3TACB 2C9WB 1R4NB 3C19A 2XICA 2SAKA 1CZPA 1NI3A 3NRWA 1QQ6A 4Y2SA 4YVZA 1JWUD 1OQYA 2IO2B 4KGRA 1COOA 4ANWA 1RDFA 2YMLA 1AARA 5BPCA 1KW4A 3U30A 1ZW7A 2JU6X 4WAAA 3RJKA 2CHXA 2J4XA 4LJOB 4QZAA 3JVZX 4O3RA 2LGIA 2BCVA 1L7NA 4JX1C 4KN4A 1QH9A 2QB0B 4FHKA 4A8XC 3MC8A 1JN3A 1LVHA 2MA1A 5AM4A 2H3ZA 2LVQA 1N63A 3RD2A 3DVGX 2ZTCA 3AL0B 2ZIVB 4BKTA 3RAQA 4GSWA 1OEYJ 2LWPA 3KQ4A 2WF6A 1XSLA 3C2LA 1F9JA 3PLVA 1ZQZA 2KFKB 2K0PA 4O3PA 2ZIUA 3PY8A 2JZZA 3PPAA 1YZ7A 5CR0A 4LJXA 5ALXA 2IHNA 4KLIA 4J9SA 5DKWA 4DQQA 3RB4A 3TCAA 2KMDA 1KBUA 4I29A 1WXMA 4LCDE 1TY0A 5AKJA 1WGRA 4DF8A 1RQNA 2KWDA 3ED5A 1SIFA 2KT7A 3MHZA 3BIID 1ZKHA 3DBRB 4LNKA 1H38A 2W7OA 2DZMA 2Z8LA 4CE6A 4KSKC 1UELA 3RH6A 3K9OB 2KSOB 1SKWA 4TQ0A 2QJLA 4K1RB 4MJSA 5E6OA 2KNBA 2DYMA 4F1SA 1DK3A 3WAMA 4ELUA 4QZ9A 3MC1A 3B0YA 3ZD9A 3QARA 5HHDG 5CWRA 4UB5A 1WXAA 4GLSC 4KN7A 2BQ3A 4YSYB 2RDHA 3PHWB 4IQUA 4W9IA 5AK5A 2PVOD 5KFOA 3OJ4B 2YMMA 5J2BA 2RMMA 4DWFA 3W1SC 2LM4A 1Z4OA 4UQGA 3ENEA 3M6KA 1MHXA 1S8OA 1J7BA 1TAQA 4W9DA 3KHLA 2V4IB 3OSNA 5IIIA 4M47A 4DL2A 4Z6DA 2BQRA 1BMLC 4JL9A 4MSQB 3PV8A 1X6JA 2NRWA 4NJ6A 4UAVA 4O1NA 1A6SA 1JMLA 1SIJA 1SJHD 2G4SA 2DENB 2KFKA 1ROEA 3DHHC 1FXIA 4TQ1A 2K60A 2K5PA 2BDUA 1T0RC 2WAQC 1N61A 3RT3B 5ALJA 5H2FU 4KLJA 4KLSA 5B66U 1LFDA 4LK0M 1BNPA 4DDGD 1ACCA 4RNMA 4KZ0A 8ICRA 3U26A 2LZ6A 2DUYA 3QU9A 5J2JA 5J0XA 1XQQA 4NLGA 1ZPSA 5J0UA 2WXRA 2LJ5A 3Q8FA 2UVWA 1EU3A 2HJ1A 5J2GA 4FBJB 4YXMA 1JROA 2KOBA 3DEEA 3GDXA 2LVPA 2R8KA 3AE2B 3RJIA 1F0ZA 4LNNA 5HHIA 4OJ5A 1UPHA 1XLQA 3A1QA 1E8XA 2G5HB 3TI0A 4KLGA 1E9MA 2BT6A 3PSIA 3GIKA 1TVAA 1WRDB 2OJRA 4I2JA 2D3GA 1NJXA 2IPKD 4I27A 4DHJD 2WP9B 2ZPYA 5KHQA 3LWLA 1ZQTA 1Z5SB 4DFMA 1WMHA 3ZKJC 5AKLA 1TKGA 5ALZA 3SFDB 8ICOA 4MH8A 3VC8A 4ZRIA 2N1WA 4BOSC 3BY4B 4GXJA 2KWCA 3TARA 3RB6A 2FUG1 5ALNA 2L32A 3QQ8B 1Z2MA 4DHZB 2NBUA 1YNTE 4O9MA 4UB6U 1IG6A 1J7CA 2WDTB 2KJ9A 3M3JA 4DWIA 4ELVA 2J0JA 3QHTA 3RFZB 1GG3A 2MH7A 2K4EA 2BPCA 2R8GA 2OCEA 2KFZA 3R7RA 1YOVB 3A9JB 5CHFA 5J0SA 1MFWA 4URKA 5J8YC 1I4GA 7ICSA 4IWPA 1N5XA 1WYWB 1XF5L 3QNMA 2QMTA 3UI3A 1ZUD2 2OHFA 4RFBA 3MGHA 2K8HA 4PT5A 3QU5A 2G45B 3FILB 3RBEA 3JPOA 4BDPA 3AB5A 3GS2A 1JX4A 2WF9A 2JZBA 2WF5A 2YEPF 2NYVA 3Q8RB 2HJ8A 4NJCA 2L0TA 3ETLA 2Y0SF 4NQKE 2XY7A 1ZD2P 1Q46A 4G11A 1X66A 1UWMA 2MRPA 2ONQA 2OEDA 4FLHA 1Z4NA 5D3DA 5IA7A 1NYRA 5AIBA 9ICOA 3RJFA 4K7UA 4J6IA 3C5FA 3TADC 1N62A 1J19A 2AQ3B 3AE4B 4PL1A 3JSVB 3K9PB 3O65B 3GIIA 2B21A 1KJTA 8ICEA 2MX2A 2J53A 3HM3A 4RU9A 5D7GA 3ZUNA 3PSEB 2L0FA 9ICGA 4BOZB 1BT0A 2W11A 5KG4A 2HVIA 1LGRA 2ZIXB 2CU3A 1V5TA 2F8KA 2CS4A 3NJTA 2CXYA 3L0WB 2HTHA 2Y5PA 2YLMA 1WXSA 2J0KA 4RUCA 4MACA 1N56A 1S97A 4UARA 4W9EA 5BMIA 2FE8A 2ZPNA 3AE7B 1NENB 1ZYQA 2C22A 3HHMA 4IM2A 2L83A 1K52A 2GBKA 3CSTA 4WJNA 2N0SB 1UGMA 3OHAA 2LHTA 1J7AA 1HA5A 3N7RC 1I4PA 3OAWA 3VDZA 2V9WA 1DGSA 5CHGA 3NUQA 3T5KA 2MUTB 2JR5A 5AKEA 4M04A 4OZBA 1RYJA 3ZDBA 4HKZE 1Q8KA 1ZQJA 3RTVA 2JEFA 2FMQA 3KHHA 2KDIA 1D9FA 1WWUA 2HD5B 2JZ3B 4Y2UA 5J2CA 1DOXA 1WZ0A 3KLSX 4DFDA 2KVSA 1NDDA 3QJZA 2K8CB 3TFRA 1NI2A 1ZDVA 4KIKA 3UGBB 2PFQA 2NRZA 3QWZB 2VANA 2ACZB 2FE9A 4KIKB 3UMGA 3APFA 1F52A 4USAA 4W9JA 3AQFA 1HTOA 3IN5A 1XCQL 2KFJA 1RRBA 3N9YC 3RPFC 2CHWA 2GLSA 2EAMA 4NAWA 4WJ3B 4M0AA 5DBCA 2HHVA 5EWEA 7ICPA 2BS3B 2KX0A 2MJ3A 4JV1A 2ZUCA 2W8LA 4LNOA 5ALUA 1Z1VA 1ZD4A 2HOQA 2WS3B 1S3SG 4GU2A 2WQYB 3RH5A 4P16A 1LM8B 4KLQA 3P4PB 3JSVA 4LTUA 5G5HA 4MM3A 5J0TA 1L5UA 1NJZA 3F5EA 1QLNA 1TIFA 2NPTA 3LWMA 4I2FA 1BPDA 1QT9A 2BB5A 3GV5B 4RQ3A 5AICA 3QU7A 1WJUA 2D3AA 2IY1B 2LGYA 1WGDA 1A76A 1WZ3A 2WNMA 5CA7A 3ZTDA 4O3OA 4KMUA 2LI5A 1LV5A 5D4BA 3MR3A 1RAXA 2F8LA 3ZO5B 2BS4B 4GLXA 3Q8SB 1H8CA 5KAFU 5KFWA 3AE8B 5DCNA 2KIVA 1FD6A 3D2NA 4FZNA 3GV7B 2KVZA 3WKDA 2N7EA 5L1LA 2MLBA 3ALRA 2X8XX 4MFAA 1B9RA 2PE9A 2MA9B 1KFYB 3PHXB 1RFAA 4OHJA 5G2NA 4W9GA 1ZQVA 7ICLA 1EXNA 4AP9A 8ICSA 1J2MA 3OLMD 9ICSA 1YN3A 2LPEA 1STEA 1E8YA 3FILA 5D46A 2O6KA 5ALFA 3ISDA 2AGOA 2JH1A 3PS6A 1TS2A 2HHUA 5J0WA 4FULA 4ECTA 3IG8A 4BXOB 1NNLA 3WALA 4NL9C 3H1UA 4ICVA 7ICVA 5ALYA 3H4DA 5AI0A 2JEGA 1U4AA 4C8MA 5EE3A 8ICLA 1Q10A 4ECUA 1ED1A 4NY8A 3AECB 2W9BB 4DSKA 4TUUA 2I38A 5C5JA 2QHOA 1NK4A 2QKQA 3M9NB 3AEFB 4W9FA 4OO1J 1SJED 3RRGA 4DOBA 1AN8A 4DSLA 4DL7A 4P0QA 5BMGA 5HFYA 2QILA 2F77X 2YY6A 2B6GA 2Y1IA 3E0FA 2W9MA 4F4YA 3ZRCA 1TGZB 1NEKB 2FCMA 1T0YA 2INCC 2K8AA 1JW9D 2I1KA 4JWSC 5KHOA 3CWIA 9ICXA 4XQ8A 3VRAB 1R4NI 1D9DA 1SWVA 3OJUA 1BVSA 4QZHA 4YMNA 1TZOA 4GXIA 5KFEA 2BYTA 4DS5A 5DBAA 5HR6A 3ZDAA 1UF0A 1ZQBA 4KDLB 5L1KA 5GTHU 1PZNA 2CHZA 2I6XA 4YMMA 1HQRD 3FDSA 2LRWA 4F5OA 1C77A 2N7JA 4BAXA 3B0XA 4RNNA 4PHDA 2XI9A 2YB1A 1IUEA 1ZQYA 4QZCA 5HMLA 1WI0A 2DGZA 2W43A 4EEWA 1F2RI 4G3IA 3A4RA 4EENA 3MTNB 5BYQA 2ZVOA 2JYTA 2C7NB 4M0WB 1RFKA 4B9VA 4ED8A 4EX6A 4HK2A 2G0AA 2D5GA 3WAOA 3SAHA 4I2AA 4QZDA 3V6CB 3CRXA 5KG1A 4OJLA 2LMCA 4HLEA 1EM7A 3Q8AA 2L52A 2KDFB 2Z0EB 2KOXA 4N6EB 3Q3MC 1XWLA 2G9HD 2N7DA 7ICOA 3SMVA 1NKBA 1B22A 2YEPB 4HXDA 2V3SA 1F44A 4TUSA 4QZBA 4R65A 4DK5A 4R3DA 3VTUA 1WGKA 4EKUA 1UUPA 1UHUA 3Q8LA 1YIWA 2ATLA 1MN8A 4XRHA 2PMVA 2NBWB 4BBNF 8ICCA 2XCAA 1YD8U 2V9HA 3Q3NC 1ET9A 1A5RA 3T5JA 3C5GA 3I1YA 1IGCA 5J2KA 3MBYA 4F72A 2VKQA 2ZG6A 4JUZA 3AU5A 4S0RA 3KOOA 1L6VA 3MDAA 4LZDA 1AROP 1I7HA 4M9JA 4EZ9A 2GO7A 4QW8A 2R8HA 1PFDA 3ZQ4A 3KH0A 3WKCA 4DLEA 1RM6C 1HEKA 2IMWP 3WCQA 8ICJA 2WXPA 3LK9A 3OGUA 1WXVA 2WWZA 3ZXVA 4KGSA 1A0PA 4OD0A 3EPGA 2CKHB 1I35A 8ICAA 1GUAB 3BS7A 3HVDA 3DDHA 1KFSA 4TMAB 4ACFA 4WJPA 1HTQA 3JPRA 2MBEA 1S0MA 1IV8A 1RXWA 2LUMA 4MJSB 3LVWA 2CJOA 3C23A 5HHHA 4J9LA 1Y8RC 4J03A 2QEJC 2WDQB 3ZNHB 4DBGA 1C78A 3L10B 3PR5B 4CF3A 2PMZF 3VH3B 4M8MA 1RLFA 3QZ7A 1WE7A 2F1HA 4QIWC 3PX6A 1TT5B 1EUVB 1C1YB 3QUBA 4IRCA 4JWNA 2IDYA 2HE7A 4M9LA 3W9CB 4DSIA 2J6TA 4RT2A 1BUIC 3ALBA 4RMAA 2D3BA 2JXTA 4ZRJA 4LVSA 4ECXA 4XE0A 2JF5A 2BPGA 4MT5A 1FCLA 1K1SA 1X9SA 2JWZA 1SB3C 1SF0A 3AEDB 4LJPB 4B0MA 3B9JA 2W03A 3ZJUA 5EE9A 2CJNA 3GFKB 2VZKD 3TAPA 2JMGA 3RB0A 3R3MA 4M0WA 7ICMA 1ZDXA 4N9F4 4A9AA 1GNUA 4JPSA 3UQ2A 3R8BA 3NVYA 2BF8B 1RYSA 3AQEA 2KJ6A 2RDBC 3TANA 4C0ZA 1UH6A 2MP2A 3ZGZA 1WR1A 1FRRA 1YMHE 1XLNA 4I2EA 2NVUI 3C0RB 3N1ZC 4XC2A 2AL6A 1WWTA 4TQSA 4IWOA 2N9LA 4WJQA 1WXQA 4K4IA 3DVNU 2HBLA 4ELTA 1JUDA 3RNEC 4ACOA 1SKRA 2DLBA 5IINA 3DDCB 4KITB 4ECVA 2RPQA 3K4GA 2PI5A 5ALWA 3RI7C 2BCUA 3ZNID 1DOYA 1S1QB 2J52A 2ZNVC 2LRUA 4AUQC 3SZ2A 5L83A 2YMPA 1FEZA 2E6XA 2V0GA 1WGHA 1V38A 2LGXA 2ZZPB 1MJDA 4RM9A 1LXDA 3BWUD 3PX4A 3L08A 1QOGA 1CQVA 3KYDD 1FFUA 1N5WA 3QCAA 3N1XC 4KLLA 8ICHA 1FM0D 1E7UA 4I28A 3F5AA 4MM3B 3S2AA 4J9RA 4UW9A 1BXTA 4IQTA 1MHHE 4AS1A 2AH5A 2EAOA 1PGBA 1X9XA 3Q8BA 4YXDB 3TEZA 2L8JA 2ODGA 2MHJA 3H0MB 1AW7A 1SV4A 4ANXA 5D6JB 3WK4A 1WCNA 4MF8A 2CPRA 3PRZA 3IAS1 3HT3A 4EX7A 4Q43A 4QWAA 3EA6A 1M94A 2A5UA 3R2TA 1B43A 9ICMA 2W3SA 4ARIA 4YTPB 5HI1A 2N4FA 1WMHB 2ZIWA 3MGIA 3RNBC 5AZGA 3QUTA 1XLPA 3E9SA 5KFAA 1QQ5A 2JSVX 5DB7A 2XY6A 1L7MA 1ZQAA 1T4GA 4Y2XA 3GQCA 4RUAA 4J9KA 4W9CA 2KDMA 2MAXA 1UT8A 4Y2TA 2JUOA 4JIOU 9ICHA 2ZJAA 4M00A 4WQOB 3QZ8A 3V6JA 3KFUF 2VH1A 5E6JA 4C00A 4A20A 2HTME 5IAAC 4AQ7A 4J9QA 2KJHB 3Q3FA 2JRHA 3TJPA 2NV3A 3JPPA 1CJEA 1OUQA 4BGDA 4ZRPA 4PYZA 1OW5A 5DDYA 1SXEA 5CP2A 2HSZA 5J2EA 1K51A 5KFPA 4DQOC 2DPJA 1JI7A 3MDCA 4US9A 1DGJA 1X6IA 2A4ZA 3DWMA 2HHXA 4AYBC 1KRHA 5JHBA 2MBOA 3B08A 4FJZA 3MP9A 3BVMA 4GXBA 3WANA 4FFDA 2W7PA 3OTQA 4ZYSA 2BBCA 1L0VB 9ICQA 1JCKB 3RZFA 1RQLA 3WKEA 5AI5A 3HW8A 1WF9A 4IQVA 3MFHA 4RGOS 1T6BX 3QX7A 3M9OB 4UAWA 4O3NA 1MI0A 4KGTA 2FIDA 1RZTA 3KUCB 3KWLA 3AU2A 3M1YA 1TAMA 5DQHA 3PLUA 4Z6FA 1D5MC 2K3UA 8ICKA 5HNKA 1NK7A 2I1QA 5GMVA 2WXQA 2AYOB 1OXJA 3FYHA 2GOLA 4Z6CA 1IP9A 1WJ4A 2ISPA 1E90A 1KM7A 1COKA 4GDKA 1ZQKA 3AULA 2AQ1B 4NLZA 5IIMA 4MEXA 2LM1A 2L5YA 5A0LA 3IXSA 4F7ZA 4MSMB 4EE2A 5ALVA 4NLBA 3H8WA 1MQ3A 2W9AA 1ZQCA 3IV6A 1KFDA 1ZQRA 2JX5A 2JWUA 1VLBA 2O2VA 4YMOA 4M9NA 3OWEB 4YQWA 1TY2A 4MGKE 1MVKA 3C21A 5ALOA 4Y2JA 4KLDA 3MFGA 1SL2A 2LYAA 5HKHA 4OJ6A 3VRBB 3SV4A 1EF1A 3ZVVA 4OVVA 5J8YA 1T7PA 2R8IA 2REXA 2KHQA 3NZSA 3M95A 3RYTA 2H3FA 1L2NA 2XEWA 2WU2B 1XO3A 1FNVA 2E8PA 4I2IA 3DV9A 1ENFA 5G5GA 1VZ8A 4RT3A 3V60A 5DB9A 4M02A 3H7IA 1L3VA 4DHJB 5TR5A 3IHPC 5MPOA 5J2IA 1TKEA 1S76D 1YN5A 4I2GA 4O3MA 1WH3A 1D8YA
chains in the Genus database with same CATH topology
1C4AA 1I4PA 1JRPA 2GRIA 2PTLA 4OZBA 1RYJA 2GI9A 4HKZE 3AN1A 1HZ6A 4Q2JA 2KACA 1YJIA 4GDKB 1QOFA 3V05A 1QILA 3ZJTA 4RGMA 1FO4A 1F2RC 1DOXA 2QSDA 3KLSX 4D2KA 3H8HA 1ZDVA 5EE1A 5LNK1 3AEAB 1FMAD 4N59A 1QOAA 1HZ5A 3URYA 2ACZB 3W2DA 1QF6A 1JWSD 4USAA 1XCQL 1ZOYB 1DOIA 3N9YC 3RPFC 2G1EA 3P42A 5BYRA 2IGGA 4RH6A 2BB6A 1PGAA 2BS3B 2MJ3A 4XWWA 1DYQA 2RPVA 3T3OA 2M19A 1TKYA 2WS3B 2WQYB 4P16A 4WH4A 3P4PB 1D5ZC 2BTEA 2WXKA 5G5HA 4LTUA 1T3QA 4WWMA 4YTMB 4L23A 2IGDA 2FBWB 1V1OA 3AE6B 1IGDA 3FAHA 4RNAA 2ICIA 1TJEA 1QT9A 2BB5A 4HJGE 5C3JB 4WAFA 2AQ2B 1P7FA 3VQIA 3U52E 4XWTA 4C80A 1QOBA 5FKAC 4NAMA 4JWUC 2WNMA 5H8YE 1WYGA 4RCOA 2BS4B 1I4QA 3P63A 1B1ZA 1GB1A 2W54A 3AE8B 1FD6A 4REZA 2WU5B 2IJ0A 3W1SA 1C4CA 2LHEA 3TEWA 1JWMD 2ON8A 1B9RA 4RGTA 1KFYB 4OHJA 1L0YB 4US8A 4NAWB 1M4VA 1D6EC 4TSSA 2N9KA 1QQRA 5JXVA 3VR8B 1QLBB 1YN3A 1STEA 2ZW1A 4RF0A 1VRAB 2H88B 2M0AA 2BW2A 3FILA 1GB4A 1K53A 1E7PB 1TS2A 2WXJA 3NVZA 4XDDA 1YQ4B 1XLOA 2MJDA 1L5PA 3TSSA 1JWBD 3AE5B 1KLUD 1SEBD 3MC0B 4OZCA 1E6EB 1SE2A 3NRZA 2IGHA 5C2TB 2XNAC 5EE3A 1Q10A 5HG2A 3AECB 2NTSA 2K9XA 3LB8C 2I38A 1E10A 2HDEA 3AEFB 1SJED 1SE4A 3B2FA 1AN8A 1C79A 4YT0B 5BMGA 5HFYA 4KKJA 1NYQA 1VZ6A 2QILA 1VDVA 4H2AA 1ZE3D 1A70A 1P7EA 4P6VF 1NEKB 3R2IA 3HVZA 1JW9D 3BZDB 4JWSC 3CWIA 4OVZA 1XEEA 2J42A 3VRAB 3CIRB 1GOZA 3NS1A 1I4XA 1Y56A 3V3XA 1TZOA 1EU4A 2BYTA 3Q8CA 3IAM1 4HRSA 4ZHOA 1SSNA 3U7ZA 3U2SC 1EWCA 1T5XD 1HQRD 4L2YA 2N7JA 1C77A 1NVID 2KMMA 2NMQA 2E3TA 3EUB2 2Y3AA 1PYWD 3FC4A 2EELA 1IUEA 2LJIA 1XCTL 2M56B 4ARCA 3NVVA 1F2RI 5BYQA 2JYTA 3NUHB 3P4SB 3NVWA 4XDCA 1RFKA 2DWQA 4YWGG 3P4RB 2LFIA 4HEA1 2D5GA 3PZ8A 3VR9B 2LMCA 1JQ4A 1EM7A 3GP7A 2L52A 3Q8AA 5AUIA 2I2YA 4N6EB 3AE1B 1AYFA 4C7ZA 4C7YA 3AEBB 1LO5D 2G9HD 1L0XB 3ABVB 4YTNB 2YEPB 2WXGA 1C4PA 1EWYC 1ZP0B 4R3DA 1YQ3B 3SEBA 1WGKA 1UUPA 2PIAA 3KWVA 4DXGA 2Y5CA 2PMVA 5D3IB 3AM9A 1R7SA 4IKGA 2MEKA 2LHDA 4HKQA 1TS4A 2WLBA 1ET9A 5FR3A 1IGCA 1VR9A 1L6VA 1TS5A 1I7HA 3AE9B 1PFDA 2WXMA 4FXCA 3ZQ4A 2PVGC 4A6QA 4ZHPA 2KQ4X 4RF1A 1RM6C 1UNSA 1OQQA 4IOIE 3P4QB 3TUOA 3B2GA 3WCQA 3TEXA 4B0EA 2WXPA 4HROA 4KGSA 4WQMA 2WXIA 3AMZA 3C8YA 1D5XC 3BYTB 1ZXHA 2SAKA 1CZPA 1NI3A 3I9V1 3HVDA 4KGRA 4ZOHC 1JWUD 4JE3B 4TMAB 2TSSA 2WDRB 2K22A 1E0ZA 3AEEB 3NZ3A 2JU6X 2LUMA 4RGNA 2J4XA 2WXLA 2CJOA 4LLGM 2QEJC 2WDQB 5T8IA 1C78A 2LGIA 2JYEA 1UGJA 1YN4A 4JX1C 4A8XC 3IT6B 4OZAA 5GXGB 2IDYA 5AUKA 3W9CB 1N63A 1BUIC 2DBYA 1ESFA 1V1PB 2SEBD 1CK1A 2JXTA 3W5VB 2VZKB 3KQ4A 4XE0A 5H92C 1IBXB 1HEZE 4MT5A 1TS3A 2K0PA 1FCLA 3EGRA 1SB3C 1XXGA 1SF0A 3T3NA 3AEDB 4KKIA 1GPXA 5BMHA 4B0MA 3B9JA 3ZJUA 3AV8A 1TYGB 2WXFA 1V1PA 5EE9A 2CJNA 3TEYA 1UWXA 1TY0A 2VZKD 2KWDA 4M0WA 1PGXA 3MHZA 3BIID 2QIEB 2W82A 2Z8LA 1ZDXA 3I57A 4A9AA 1JALA 4JPSA 1FXAA 1WSPA 3R8BA 3NVYA 1L6UA 4TQ0A 2QJLA 4NZLB 2DYMA 3ZGZA 1YMHE 1FRRA 2L1AA 1XLNA 3J9CA 1OQRA 1WWTA 2N9LA 2V3PA 5HHDG 1WXQA 4GLSC 2BS2B 4UDUC 4YSYB 1VJKA 2RDHA 2DLBA 3P1MA 3Q8EA 1AWDA 4L1BA 4DXFA 2PVOD 1DOYA 2J52A 2RMMA 1V97A 1FNUA 2V0GA 1I4RA 2E6XA 2GB1A 2X38A 4YSZB 3AH7A 1MHXA 2RDGA 1J7BA 3BWUD 3SR6A 1RWSA 2V4IB 1QOGA 1CQVA 4ZRQA 1BMLC 1FFUA 1N5WA 5TSSA 4O1NA 1FM0D 1JMLA 1SIJA 1SJHD 1VZ7A 1IBXA 1ROEA 4MM3B 1FXIA 1C9FA 1L4DB 1C76A 4TQ1A 2K5PA 3DWGC 1SE3A 2R61A 1BXTA 3AEGB 1N60A 1MHHE 1N61A 4WIPA 4AS1A 1PGBA 1JWAD 3Q8BA 4YXDB 3TEZA 4J3OD 2LEKA 4LK0M 2Q5WD 1OFFA 1AW7A 1FFVA 1ACCA 2EKIA 1SXTA 2ZW0A 1FCCC 1HXYD 1K50A 1ZPSA 2WXOA 3IAS1 4YSXB 2WXRA 3EA6A 3LXFA 3Q8FA 3Q69A 3R2TA 3ZJVA 1EU3A 3HUIA 2W3SA 1KTKA 4ARIA 4YTPB 2MJEA 2AX5A 1JROA 5HI1A 3AE2B 1F0ZA 2V3NA 1XLQA 4CQNA 1XLPA 3E9SA 1SBBB 1E9MA 2BT6A 2JSVX 2KN4A 1L4ZB 2KDMA 2IPKD 2PLPA 1FEHA 2WP9B 2W55A 1FIQA 1F77A 2H89B 3PZ7A 4C56C 2JQRB 1ZXIA 1TKGA 5E6JA 3SFDB 2HTME 4AQ7A 4MH8A 2KAJA 2FUG1 2WDVB 5EE0A 2L32A 1CJEA 4KX6B 4ZRPA 4A90A 1V8CA 1YNTE 1J7CA 1K51A 4N58A 4DQOC 4US9A 3RFZB 3U4EG 1DGJA 2MH7A 3DWMA 3BVZA 1KRHA 2W3RA 1FNWA 1PUTA 3BVMA 3MP9A 4ZYSA 1PDXA 2BBCA 1L0VB 1JCKB 1I4GA 3LYYA 4RGOS 3PO0A 1T6BX 1KLGD 1N5XA 3AE3B 1XF5L 1WRIA 2QMTA 1MI0A 4KGTA 3UI3A 1QKZA 1ZUD2 2OHFA 4RFBA 4PT5A 3KWLA 3FILB 4GDLB 4IDIA 3AB5A 1FRDA 1YJJA 1D5MC 3GS2A 2K3UA 2NTTA 4WURA 3IT4B 2YEPF 4NJCA 2WXQA 2PW9A 2INPE 2PKOA 2WXHA 1ET6A 2ONQA 1UWMA 3E56A 2OEDA 3HRDD 2AQ1B 2JZPA 2WXNA 3BK2A 5D3DA 3W5UB 1NYRA 3IXSA 1N62A 2AQ3B 3AE4B 4EE2A 2JWUA 3SFEB 2JX5A 3BK1A 3ETRA 1VLBA 3OWEB 1TY2A 2J53A 1MVKA 2DYOA 2XN9C 5D7GA 1MPEA 1I4HA 3MFGA 1KF6B 2B76B 3VRBB 4A55A 5BYSA 2CU3A 4OW0A 2WU2B 5I4DA 1XO3A 2Y5PA 1FNVA 3BVGA 4MACA 1ENFA 5G5GA 1VZ8A 4ITKA 5BMIA 2FE8A 3MJ5A 3BYYB 5FK9C 3AE7B 1NENB 1GAQB 3ZYYX 2L83A 2INNE 5MPOA 1K52A 3O13A 1D4BA 2N0SB 3L4PA 1KH0A 1TKEA 1YN5A 3GB1A 1J7AA 1HA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJO A;  3HUI A;  2W3S A;  2WDQ B;  1JRP A;  2MJE A;  2AX5 A;  1JRO A;  4YTP B;  3AE2 B;  1F0Z A;  3AEF B;  4JX1 C;  1XLQ A;  3B2F A;  1RYJ A;  1XLP A;  4YT0 B;  3AN1 A;  1E9M A;  2BT6 A;  1NYQ A;  5GXG B;  5AUK A;  3W9C B;  1VDV A;  1YJI A;  1QOF A;  1N63 A;  2DBY A;  1FO4 A;  1A70 A;  4P6V F;  1DOX A;  1NEK B;  3W5V B;  3HVZ A;  2WP9 B;  1JW9 D;  5EE1 A;  2W55 A;  3AEA B;  1FIQ A;  1FMA D;  2H89 B;  3CWI A;  4JWS C;  4N59 A;  1QOA A;  3VRA B;  2ACZ B;  3CIR B;  5H92 C;  3NS1 A;  2JQR B;  1QF6 A;  1ZXI A;  4USA A;  1TKG A;  3SFD B;  1ZOY B;  2HTM E;  1DOI A;  1SB3 C;  2KAJ A;  1SF0 A;  3RPF C;  2G1E A;  3AED B;  1GPX A;  2WDV B;  3B9J A;  2BS3 B;  5EE0 A;  1CJE A;  1TYG B;  3AV8 A;  2MJ3 A;  4HRS A;  4KX6 B;  5EE9 A;  2CJN A;  4ZHO A;  1V8C A;  1J7C A;  2M19 A;  1TKY A;  1NVI D;  2WS3 B;  4N58 A;  2KMM A;  2WQY B;  3BII D;  2E3T A;  3EUB 2;  2QIE B;  4US9 A;  3P4P B;  3FC4 A;  1DGJ A;  2MH7 A;  1IUE A;  3DWM A;  2M56 B;  4LTU A;  5G5H A;  1KRH A;  4A9A A;  2W3R A;  3NVV A;  1JAL A;  1T3Q A;  1FXA A;  4WWM A;  3NVY A;  1PUT A;  4YTM B;  1L6U A;  1PDX A;  2FBW B;  2QJL A;  3AE6 B;  1L0V B;  3P4S B;  3NVW A;  1RFK A;  3FAH A;  2DWQ A;  1FRR A;  3P4R B;  1XLN A;  3PO0 A;  1TJE A;  1N5X A;  1OQR A;  3AE3 B;  1QT9 A;  1WWT A;  3VR9 B;  1WRI A;  1JQ4 A;  5C3J B;  1WXQ A;  5AUI A;  2L52 A;  2BS2 B;  1ZUD 2;  2OHF A;  4N6E B;  3AE1 B;  1AYF A;  4YSY B;  4C80 A;  1QOB A;  4C7Z A;  1VJK A;  3KWL A;  3P1M A;  4C7Y A;  3AEB B;  4IDI A;  4JWU C;  5H8Y E;  3AB5 A;  1FRD A;  1YJJ A;  3ABV B;  4YTN B;  1AWD A;  1WYG A;  2PVO D;  1EWY C;  1DOY A;  1ZP0 B;  2BS4 B;  1V97 A;  1YQ3 B;  2PKO A;  3P63 A;  1WGK A;  2W54 A;  3AE8 B;  2PIA A;  2WU5 B;  2Y5C A;  3AM9 A;  1R7S A;  1UWM A;  3HRD D;  4YSZ B;  3AH7 A;  3W5U B;  2WLB A;  1J7B A;  1NYR A;  3SR6 A;  1RWS A;  1B9R A;  1KFY B;  1N62 A;  3AE4 B;  4US8 A;  1QOG A;  1FFU A;  1L6V A;  3SFE B;  2JX5 A;  1N5W A;  3ETR A;  1VLB A;  1I7H A;  3AE9 B;  1FM0 D;  1PFD A;  1SIJ A;  4FXC A;  2PVG C;  4ZHP A;  1ROE A;  3VR8 B;  1E10 A;  1RM6 C;  1QLB B;  1FXI A;  1KF6 B;  1OQQ A;  3P4Q B;  3B2G A;  2B76 B;  3VRB B;  2H88 B;  3WCQ A;  2K5P A;  3DWG C;  3AEG B;  2CU3 A;  1N60 A;  4HRO A;  1N61 A;  1E7P B;  2WU2 B;  3NVZ A;  1JWA D;  3AMZ A;  1XO3 A;  1YQ4 B;  1XLO A;  4WQM A;  4YXD B;  2LEK A;  2MJD A;  1L5P A;  5G5G A;  2Q5W D;  4ITK A;  1OFF A;  1FFV A;  2EKI A;  3AE7 B;  1CZP A;  1NEN B;  1JWB D;  1NI3 A;  1GAQ B;  3ZYY X;  4ZOH C;  3AE5 B;  2L83 A;  1E6E B;  2WDR B;  5MPO A;  2K22 A;  1E0Z A;  3NRZ A;  4YSX B;  2N0S B;  3L4P A;  3AEE B;  5C2T B;  1TKE A;  3LXF A;  5EE3 A;  3AEC B;  1J7A A;  3LB8 C;  2K9X A; 
#chains in the Genus database with same CATH topology
 1BNO A;  1WCL A;  3PW5 A;  4R66 A;  1MG4 A;  2KDE B;  3T3F A;  3IBE A;  1UBQ A;  5AI9 A;  1BPY A;  2Z59 B;  1FPY A;  3AN1 A;  1P7D A;  3EZ5 A;  4PL2 A;  5KFU A;  8ICB A;  2KAC A;  5EWF A;  3M6Z A;  1QOF A;  4FS2 A;  4QZG A;  3V05 A;  3VVW B;  4CYE A;  2WB1 F;  1FO4 A;  4RQ5 A;  2BKR B;  3VAW A;  3RJJ A;  4CCH A;  5AI8 A;  5LNK 1;  3URY A;  7ICI A;  3W2D A;  2IBK A;  2B0C A;  2IZV B;  2R18 A;  2YTU A;  5AI4 A;  4FO6 A;  4RH6 A;  1S9F A;  1ZQL A;  4RQ0 A;  2HDO A;  2W04 A;  1DYQ A;  4O5K A;  2RPV A;  1TFR A;  4Y2Q A;  2QLT A;  2LKY A;  4C8L A;  1J2N A;  3PNC A;  2WHE A;  1D5Z C;  3QIJ A;  2WXK A;  3Q2A C;  2KVR A;  4WWM A;  2K8B B;  3MC9 A;  2IGD A;  5KL1 B;  1WX9 A;  4C8K A;  1V1O A;  2FBW B;  4M2Y A;  1N48 A;  2ASL A;  1J97 A;  3FKY A;  5KFC A;  3FAH A;  5KT6 A;  4RNA A;  4F8R A;  5F9N A;  2ICI A;  1TJE A;  1NK5 A;  4B95 A;  3RBD A;  2BGF A;  2IND C;  2HHQ A;  5KFG A;  4OCZ A;  5AKZ A;  4BUG A;  4HJG E;  3IRU A;  4RPX A;  3C1Y A;  5JU5 A;  4RPY A;  4C80 A;  5J2D A;  4F50 A;  1QOB A;  2GOW A;  4JWU C;  4NAM A;  5G55 A;  1TE2 A;  2Y0S C;  3WK7 A;  1WYG A;  1V9J A;  3UXP A;  4CF4 A;  3Q3O C;  5D49 A;  1ZQG A;  1I4Q A;  2XC9 A;  1GB1 A;  1YJ1 A;  4GC7 A;  3E58 A;  4B9U A;  2G07 A;  1ZQF A;  4JWM A;  3V61 A;  9ICF A;  4RQ7 A;  2PFO A;  4E74 A;  8ICN A;  1C4C A;  2V4Q A;  4QWD A;  4CDG A;  4GC6 A;  4RQ1 A;  4CRX A;  5KL8 B;  1L0Y B;  4P0P A;  2IHM A;  1ZQX A;  2MBH A;  1UBI A;  2W9N A;  3HIZ A;  4FHJ A;  4NAW B;  4MF2 A;  9ICT A;  3GZN I;  1Z3E B;  4K4G A;  7ICG A;  1D6E C;  1V2Y A;  2EKE C;  4W9K A;  1NBF C;  1UQV A;  4MGY E;  3VR8 B;  4JMU A;  1L3S A;  4RF0 A;  2H88 B;  2M0A A;  3R7Q A;  4DCC A;  1Z1B A;  1LQB A;  3KHR A;  3GOE A;  1CUK A;  1K53 A;  2LMR A;  1B4F A;  2LGS A;  1PK1 A;  1SE9 A;  1YQ4 B;  4EZJ A;  3C1Z A;  4NLN A;  3ZD8 A;  4YL8 A;  3Q8K A;  2D11 A;  2N9E B;  3WKB A;  3VUY A;  1N2X A;  3TSS A;  2K4H A;  2ZXI A;  1ZQO A;  1ZQU A;  4AP4 C;  2YN4 A;  5J0P A;  4JK1 A;  2AU0 A;  1E6E B;  2OJW A;  3NRZ A;  4DSJ A;  2O6V D;  2XID A;  4NY0 A;  4NM2 A;  4DFK A;  4HDQ A;  2ZUB A;  4UAU A;  2K25 A;  2NTS A;  2K9X A;  3LB8 C;  1E10 A;  4ED6 A;  1N6Z A;  1SXD A;  1P0R A;  1KKX A;  1SE4 A;  4YT0 B;  2FCN A;  1J8C A;  4C4S A;  1RG6 A;  4MDK E;  4ASW C;  1ZQE A;  2HBK A;  1BPB A;  1T0Q C;  2KHV A;  1A70 A;  4P6V F;  2Q0Z X;  8ICG A;  2DAF A;  2LAS A;  4DHZ E;  5ALI A;  2OXO A;  3H0R B;  3MR2 A;  4OVZ A;  8ICF A;  1H4R A;  1GOZ A;  3NS1 A;  3ZDC A;  1TBE A;  4AOF A;  1Y56 A;  4I6N B;  2FMP A;  2QAR B;  4EBE A;  2RR9 A;  3EW9 A;  3U2S C;  2N1R A;  4QZE A;  1EWC A;  3IFW B;  4GGQ A;  2EDU A;  4Q45 A;  2G08 A;  5AK4 A;  2ASJ A;  4B9M A;  4IC9 A;  1NVI D;  2KMM A;  4BBN C;  2KFN A;  4HCN B;  8ICT A;  4RQ8 A;  4I6P A;  3FC4 A;  2DHZ A;  2E8N A;  1L7P A;  1QSL A;  3ONS A;  2WX0 A;  7ICJ A;  4NNJ B;  5TIS U;  5DBB A;  1D3Z A;  3ZW3 A;  3O0F A;  3NUH B;  1OTR B;  2KXJ A;  8ICZ A;  4YR3 A;  3WAP A;  4K7W A;  4AWJ A;  4B9K A;  2DWQ A;  3P4R B;  2IO1 B;  3GU3 A;  2PJH A;  4TV3 A;  3SDL C;  2WTF A;  3PZ8 A;  2NRT A;  4KTQ A;  4O3S A;  2XGP A;  4KSL C;  2FPM A;  1Q3V A;  4C7Z A;  2I9G A;  3H8J A;  1LO5 D;  2KIW A;  1L0X B;  5ALR A;  4DDI D;  2WXG A;  1Z00 B;  2Y9U A;  3K75 D;  1XS9 D;  1D8L A;  1EWY C;  3JPS A;  3RNC C;  1YQ3 B;  4X57 B;  3BQ1 A;  3AUO A;  2PIA A;  1CRX A;  3ZDD A;  4FBT A;  2I5H A;  5IIJ A;  2Y5C A;  4CO7 A;  3EWA A;  3UPQ A;  4DL3 A;  4PHA A;  3N7P D;  2KQS A;  3H8S A;  2MEK A;  4JGH B;  4RM8 A;  4B6W A;  1TS4 A;  5FR3 A;  1HUZ A;  5AIA A;  1V80 A;  5LXI B;  3CF6 E;  2VA8 A;  4C8N A;  3J81 j;  1ZQM A;  1TS5 A;  4ANV A;  1B0X A;  3BIN A;  4CGZ A;  3AE9 B;  4Q8F A;  2AHO B;  4M6W B;  5AHX A;  4A6Q A;  4QIW F;  4DS4 A;  4PGQ A;  2ZTE A;  3A0B U;  1OQQ A;  1RYU A;  5DLG A;  3RZW C;  1K1Q A;  5ALK A;  2H3I A;  2W9B A;  3NZU A;  1GC6 A;  2LBO A;  3ZI4 A;  1S10 A;  1R4M I;  3C8Y A;  3DBL I;  3QXG A;  5KG6 A;  4GN1 A;  3OPX A;  1D5X C;  3BYT B;  5DLF A;  3RJG A;  2DPI A;  3I9V 1;  4ECY A;  4ZOH C;  4MGI E;  2NS5 A;  2UWQ A;  2WDR B;  4MEY A;  3AEE B;  2Y1J A;  3K1Z A;  4HPL B;  2WXL A;  5AKH A;  4C8O A;  2LUE A;  4LLG M;  5T8I A;  4G3X B;  1ZQP A;  5TZV A;  4P4P A;  4UAS A;  2C2D A;  3SD5 A;  1DXS A;  2UVR A;  3KKA A;  4GB9 A;  4DOC A;  4RNO A;  3D32 A;  3NGD A;  4OZA A;  3PSP A;  5GXG B;  1RPL A;  1ZOL A;  3N97 B;  1ECW A;  2KC1 A;  2ZVN A;  3NS8 A;  5C23 A;  2KKP A;  1CK1 A;  3H7S A;  4BVU C;  4GIV A;  5AKG A;  1UD7 A;  4NLK A;  5H92 C;  3HJE A;  2Y9T A;  4XX5 A;  2QAR A;  3EGR A;  3H7P A;  5KFZ A;  3VUW A;  4EUT A;  3ZXR A;  1XXG A;  4DXA B;  1NKC A;  3BS5 A;  9ICE A;  4KKI A;  1LKY B;  2BYF A;  4YR2 A;  1QCK A;  2ASQ A;  1V1P A;  4F4K A;  1UWX A;  9ICL A;  2LXC A;  3A4S C;  2KVC A;  2DAJ A;  3ML9 A;  1CI4 A;  1ZRN A;  2AGQ A;  3DHG C;  1PGX A;  3JW0 X;  3F2B A;  2DQN B;  3I28 A;  2PMZ C;  3T5L A;  1ZQD A;  1SL0 A;  1JAL A;  4BX9 C;  5LLI A;  1T8E A;  5DGA A;  1QZE A;  2J7Q B;  2XK5 B;  1L6U A;  4EFO A;  2HHS A;  4NZL B;  1I42 A;  1T94 A;  4EOY A;  2FCQ A;  4MEM A;  2L1A A;  1ZQS A;  7ICH A;  1WM2 A;  3MGV A;  1OQR A;  3RR7 A;  3ML8 A;  4I2B A;  3T9L A;  2EZZ A;  3UIN B;  2BS2 B;  3V7K A;  2GBM A;  4UDU C;  2H5X A;  3V7J A;  1V81 A;  1OGW A;  5AKI A;  4C4V B;  1Y88 A;  2OWO A;  3SEI A;  2P35 A;  2KSO A;  2C28 A;  4DOA A;  2VA2 A;  4L1B A;  4DXF A;  4B9S A;  4ECW A;  2G5I B;  3LJ3 A;  2DNF A;  1K5O A;  1I4R A;  9ICA A;  4Q44 A;  1E8W A;  4I2C A;  7ICF A;  5J2R A;  4ICA A;  4P1B C;  2JPH A;  5F9L A;  3AH7 A;  3CNH A;  3SI8 A;  9ICI A;  1YT3 A;  1XSP A;  2RDG A;  1RWS A;  3I76 A;  5IIO A;  4DO9 A;  1S0V A;  4MEL A;  4F5Q A;  3PGE A;  4EZK A;  5B5E U;  1NJW A;  5TSS A;  2ZIU B;  4DLG A;  4QJF B;  3THV A;  2KZM A;  1VZ7 A;  2AWT A;  4WJO A;  1BPX A;  2F44 A;  2KZZ A;  1YX5 B;  1C9F A;  1C76 A;  1QSS A;  3AU6 A;  4ZDV A;  3DWG C;  3M62 B;  1QQ7 A;  1SE3 A;  2ZIV A;  2NBV B;  2FLL A;  1TZ1 A;  4WIP A;  3A9J A;  2C2R A;  2C2E A;  1O08 A;  2YMQ A;  2BVC A;  2K89 A;  5KT5 A;  2Q5W D;  3QUC A;  3Q3J A;  1FFV A;  2WYQ A;  1SXT A;  3K1R B;  2ZW0 A;  1HXY D;  1V49 A;  3WU2 U;  5AK6 A;  4IL6 U;  3SHQ A;  2BWE S;  4YSX B;  4U7C A;  3HX0 A;  4HWI B;  3ZJV A;  5IOI A;  2A1J B;  3HUI A;  2NO4 A;  1KTK A;  2MJE A;  4K81 A;  4UB4 A;  1WG8 A;  2Q4T A;  2HOI A;  3UIP B;  3GE3 C;  2F1J A;  3N4M B;  2K8B A;  4CQN A;  1Z19 A;  2KJR A;  4B6J A;  4MH0 E;  1SBB B;  4P4M A;  4J9M A;  2HVH A;  2BZF A;  4Y2P A;  4JB3 A;  4PYU A;  4P1C C;  4TQR A;  5HP4 A;  4PHE A;  2M0X A;  1SGH A;  1FEH A;  2NR2 A;  1GJZ A;  1F77 A;  3RB3 A;  4RQ4 A;  3RH4 A;  2WFA A;  2BYV E;  1XD3 B;  2H89 B;  4C56 C;  2JQR B;  3VFK A;  4YFK A;  3RMK C;  1ZXI A;  2BKF A;  4LDT B;  9ICB A;  3RCZ A;  5IKC M;  3WIM A;  2ZUD A;  2KAJ A;  3MHS D;  1XO1 A;  3IP4 B;  4QAY A;  2DKZ A;  1TAU A;  2WDV B;  5EE0 A;  1GC7 A;  4QWB A;  3HKZ C;  4E0D A;  9ICJ A;  1V8C A;  5J2A A;  2HHT A;  5ALH A;  4F92 B;  4DSF A;  5J0Q A;  3RN9 C;  2KQ7 A;  5J2F A;  5DG7 A;  2W3R A;  1JXL A;  1KSP A;  2K39 A;  3VCB A;  3C2M A;  1L7O A;  1NOM A;  4PGY A;  4PHP A;  3KHG A;  2IA6 A;  3F2D A;  3RR8 A;  2O2V B;  4ZH4 A;  4TUQ A;  2MCN B;  2D3D A;  2OH2 A;  3KZI U;  3WK6 A;  3AE3 B;  2DKX A;  2KX3 A;  2MSN A;  1F5S A;  1L3U A;  4KLF A;  5JRT A;  1PVQ A;  2BCR A;  1WRI A;  3KYC D;  2KKV A;  5KG0 A;  5ALL A;  2ESE A;  1YJJ A;  4IQW A;  4Y2R A;  2V4L A;  2M0N A;  4UB3 A;  2OM6 A;  1SZH A;  1XO0 A;  3PW4 A;  4FAD A;  1BPZ A;  1OEY A;  3QYP A;  2FLP A;  2INP E;  2PW9 A;  2H3V A;  4IM0 A;  5D2M B;  2WXH A;  5EDS A;  4GDL A;  8ICI A;  2KTF A;  1ET6 A;  3UXN A;  3E56 A;  3HRD D;  5L9X A;  2JZP A;  2WXN A;  3BK2 A;  5IO9 A;  3H9D A;  2C5L C;  2XO7 A;  2BWF A;  2FDR A;  3SYZ A;  1YZ6 A;  4LDT D;  2PXI A;  5FP0 A;  1KRP A;  3ETR A;  1U47 A;  3L13 A;  4IUM B;  5KFM A;  5AM1 A;  2XN9 C;  3R9K A;  1MPE A;  3EEC A;  1I4H A;  1MQ2 A;  1KF6 B;  2HCF A;  3D2S A;  2LYB A;  2DZJ A;  1ZQI A;  8ICY A;  2KZ3 A;  3CYM A;  2RSU A;  1ZD3 A;  2YB4 A;  2C7H A;  5BYS A;  3H0L B;  2F2A B;  4YD2 A;  4OW0 A;  5DPS A;  4MFC A;  1V85 A;  4OJP A;  1IPG A;  2JXJ A;  3BVG A;  2A1A A;  3WKA A;  3MJ5 A;  4F5R A;  3V6E B;  1GAQ B;  2GBJ A;  4XGA B;  4O5E A;  4NQL B;  4K7S A;  3O13 A;  2L76 A;  3S6J A;  3H4B A;  3L4P A;  1KH0 A;  4IR1 A;  5AKK A;  2BPS A;  4I6L B;  1JRP A;  4FZL A;  3OJS A;  2BGW A;  3R66 C;  2KLG A;  2HW3 A;  3GZN B;  5JTI A;  5J2H A;  3QU4 A;  2KAN A;  2KKC A;  2PTL A;  2DF4 B;  2GI9 A;  4RPZ A;  3Q8Q B;  2KD1 A;  4Q2J A;  5CRX A;  4BWJ A;  4GDK B;  1XNS A;  3EYZ A;  5JUM A;  2KLC A;  3T79 A;  2QDF A;  2FJ6 A;  1BPE A;  2AXT U;  3UXO A;  5EE1 A;  3BQ0 A;  1PK1 B;  4AJY B;  4D2K A;  1FMA D;  4N59 A;  4DQS A;  3MFI A;  2M9N A;  3WK8 A;  1WJN A;  2N1V A;  4FJY A;  1WE6 A;  1JWS D;  2O6V B;  3Q14 C;  2KG5 A;  2RDJ A;  3M8R A;  1ZOY B;  3HK0 A;  4P7I A;  1DOI A;  2G1E A;  3P42 A;  4G0N B;  4I2D A;  4WWO A;  2HOF A;  3OJ3 A;  1BGX T;  2BB6 A;  3ZIM A;  2ZXH A;  1T3N A;  9ICU A;  1KLV A;  9ICP A;  1VD2 A;  1LB2 B;  3T3O A;  1L7Y A;  1MC8 A;  1TKY A;  3KBB A;  3UQA A;  2J6U A;  2M1M A;  3NTU A;  1GO3 F;  2BTE A;  2E8O A;  2M4N A;  1ZQH A;  1T3Q A;  4YTM B;  1JXE A;  1L8O A;  2IO0 B;  1IGD A;  2JXX A;  4RZR A;  1KN5 A;  2P66 A;  1MA7 A;  2F76 X;  4M6W A;  1U45 A;  5C3J B;  4PGX A;  5KFR A;  2JVC A;  3VQI A;  3U52 E;  2NRV A;  5FKA C;  5HMM A;  4UBB A;  2QC8 A;  5H8Y E;  2V4R A;  4MGZ E;  2ZNV B;  2K6D B;  4FA6 A;  1E5W A;  4F5P A;  2DL0 A;  3ISC A;  1ZQW A;  4Q8E A;  3P63 A;  3PSF A;  3G6X A;  1ZET A;  4I2H A;  2ZJ5 A;  3ZDE A;  3H7P B;  1YQB A;  3NAS A;  3T5H A;  1SV0 A;  1PK3 A;  3H8M A;  4KLE A;  1NK8 A;  2WAQ F;  1JWM D;  4RGT A;  1X1M A;  3ORY A;  5KFK A;  2MP2 B;  3QC8 B;  3DOW A;  2XK5 A;  2RP5 A;  1U9L A;  1JMS A;  1TK8 A;  2PPH A;  1QQR A;  4KX5 A;  3QAQ A;  3TAD A;  4O3Q A;  2GH1 A;  4P4O A;  1WX7 A;  2W8K A;  1VRA B;  1S5L U;  2BW2 A;  1X40 A;  2D3C A;  1GB4 A;  2VJ4 A;  4PS8 A;  3UIO B;  1DRG A;  3RNG C;  4QNL A;  1HJP A;  3LVV A;  3EPI A;  1E7V A;  3QA8 A;  5ALM A;  3SQI A;  1E7P B;  4F2R A;  4XDD A;  1XLO A;  2MJD A;  3PST A;  4IS7 A;  2DZI A;  1JWB D;  4ED1 A;  3B1L X;  3AE5 B;  1SEB D;  3MC0 B;  4OZC A;  4YCX A;  2VJ5 A;  5DB8 A;  1TV9 A;  3TKA A;  2EAN A;  8ICM A;  2R2Q A;  2G09 A;  5HG2 A;  4EEL A;  2KN7 A;  3RUL A;  4TUP A;  3I3T B;  5KFB A;  3BQ2 A;  2HHW A;  4ED0 A;  4NJ8 A;  2HDE A;  4KLU A;  3NY5 A;  3RUI B;  2WB1 C;  5J29 A;  2C7M B;  2JY6 A;  2Z0D B;  1C79 A;  3DCG A;  4KKJ A;  1VZ6 A;  3CP8 A;  4Y2V A;  2I1J A;  2EQY A;  2E1F A;  3SAG A;  3HKZ F;  4BWM A;  2FUH B;  2KEY A;  3R2I A;  3HVZ A;  5CEH A;  1PVP A;  4BZA A;  2KJ5 A;  4F91 B;  2H3Q A;  1NK0 A;  2J42 A;  3DBL B;  3KVF B;  4IWQ A;  4NJ7 A;  3U8Z A;  1I4X A;  3GV8 B;  4EBD A;  2KP7 A;  3SV3 A;  4ED7 A;  3L54 A;  1ZJM A;  3V7L A;  3C29 A;  2CN1 A;  4J9P A;  4HPM B;  2M17 A;  3RNA C;  2PEA A;  1Q5W B;  4HRS A;  4ECQ A;  1SSN A;  3U7Z A;  3ZNG C;  1T5X D;  5AM0 A;  4PS3 A;  2NMQ A;  2E3T A;  2MQJ A;  2LJI A;  2M56 B;  1UA0 A;  4ARC A;  2AJQ A;  3SU8 X;  2GBN A;  4B9T A;  4ZRK A;  2CR5 A;  3UQ0 A;  2BKE A;  2MBQ A;  3P4S B;  2G06 A;  3NVW A;  4XDC A;  4YWG G;  5DQG A;  4HEA 1;  5KFT A;  3OG5 A;  4A8E A;  3I5J C;  3QEB Z;  2OYY A;  2K4I A;  3GP7 A;  2I2Y A;  5F3X B;  2KTQ A;  4QZI A;  1AYF A;  3W1Y A;  1NK6 A;  4HDO A;  4YTN B;  3E2E A;  3ABV B;  3RNF C;  4WWP A;  1C4P A;  5E79 U;  4RQ2 A;  3LDA A;  1WFY A;  3IDW A;  1ZP0 B;  1ZRM A;  3SEB A;  2BPF A;  3KTQ A;  5KFQ A;  1WGY A;  3KWV A;  4DXG A;  3AM9 A;  4ECZ A;  1R7S A;  2JEJ A;  2K4P A;  4IKG A;  5T14 A;  4KVG B;  4ICU A;  1KQQ A;  2LHD A;  3B0A A;  3PT2 B;  2KK0 A;  5ALQ A;  2WLB A;  4FZM A;  4TKN A;  4KLT A;  2F3N A;  2ISO A;  5CJ7 A;  1P98 A;  3TIX A;  4YG2 A;  2G3Q B;  5ALG A;  5IIL A;  2JRI B;  3N28 A;  5AKY A;  5AM2 A;  3KUD B;  5DDM A;  4FXC A;  5L1I A;  2PVG C;  2ES6 A;  1IXR A;  2ZTD A;  2KQ4 X;  4ZHP A;  4RF1 A;  2JV3 A;  3D6J A;  1UNS A;  2QCZ A;  4IOI E;  3TUO A;  2J6S A;  1WM3 A;  3B2G A;  1KLN A;  1VCB A;  5ALS A;  3BQ7 A;  2PKE A;  3MR5 A;  4HRO A;  4II3 B;  3NOB A;  3U7D A;  2MBB B;  2WXI A;  3AMZ A;  4FBU A;  4ANU A;  3NG0 A;  4QWC A;  4KLM A;  5KT3 A;  5CX3 A;  2AGP A;  4R8U B;  5AK3 A;  3JPN A;  1QTM A;  4EZ6 A;  1ZXH A;  4MHV A;  2VH2 A;  2VIX A;  5E6P A;  3PTF C;  2D2Q A;  2GBR A;  4JE3 B;  4ED2 A;  3ZNZ B;  2TSS A;  2K22 A;  3DBR I;  3ZLZ A;  8ICQ A;  2MWS B;  1E0Z A;  3QU2 A;  3NZ3 A;  4RGN A;  2GWS A;  2R2O A;  2MU2 A;  2NO5 A;  1V5O A;  2E5S A;  4FE3 A;  2F1I A;  5BO4 B;  3SAF A;  2JYE A;  5K4L A;  5IIK A;  1UGJ A;  1YN4 A;  4CF5 A;  4CNQ A;  2K8C A;  3APC A;  2VRR B;  3DVN V;  2ZEQ A;  2FPK A;  4Y2Y A;  3DPD A;  3IT6 B;  4AJW A;  5AUK A;  4WWN A;  3VTW A;  2LYH A;  5L95 C;  2KO3 A;  3IVF A;  1V86 A;  2DBY A;  5ALD A;  5DB6 A;  1ESF A;  1V1P B;  2SEB D;  3W5V B;  2PFP A;  1NZB A;  4DF4 A;  2BCQ A;  2VZK B;  1P9D U;  1DOQ A;  3BS5 B;  1U4B A;  1G6J A;  4HAI A;  5DGB A;  3M9M B;  5AM3 A;  2CU1 A;  4M01 A;  4J9O A;  2WHI A;  3DQV A;  1IBX B;  1HEZ E;  5LXH A;  1TS3 A;  4E71 A;  2K6Q A;  5J0R A;  8ICP A;  3T3N A;  4BXO A;  3I63 C;  1GPX A;  5BMH A;  2XVT A;  4YD1 A;  3Q8P B;  1XSN A;  5C0Y A;  1TYG B;  2KK8 A;  2WXF A;  3AV8 A;  3L17 A;  5FR6 A;  3TEY A;  1WIA A;  1KFT A;  1D8B A;  1EF5 A;  1TTN A;  4E3C A;  2L00 B;  2GLE A;  2KMA A;  2QIE B;  1ZJN A;  1QSY A;  2P6R A;  3JPQ A;  2W82 A;  3P2B A;  3VHT C;  1P3Q U;  1WJ6 A;  3I57 A;  2MRL A;  4EYI B;  4K3C A;  1SGG A;  2IOH A;  2UVU A;  3QEA Z;  1FXA A;  1WSP A;  4NPN A;  3D2Q A;  3JPT A;  8ICV A;  4JQW C;  4P0P B;  4F4X A;  1J0G A;  2L7R A;  3J9C A;  4UAZ A;  4UB2 A;  5DPR A;  3N7S C;  7ICE A;  4QW9 A;  1HUO A;  1FXT B;  4DFP A;  3GE8 C;  1Z00 A;  2V3P A;  8ICX A;  3RJH A;  3TAQ A;  3IG3 A;  1L6N A;  4F2S A;  2UYZ B;  4F8C B;  1VJK A;  4XA5 A;  3P1M A;  3Q8E A;  2BCS A;  4PZO A;  3PO5 A;  2LGD A;  3PZP A;  1AWD A;  4EBC A;  4MFF A;  2E8M A;  5KFD A;  2FCS A;  1V97 A;  3IG5 A;  3LYS A;  1FNU A;  3IM1 A;  1NZP A;  2RRD A;  4RQ6 A;  2GB1 A;  4HYK A;  2W9C B;  1A77 A;  2X38 A;  2D6F C;  4YSZ B;  4Z6E A;  4P0Q B;  1URJ A;  1ZQ1 C;  1RXV A;  3QUQ A;  3SR6 A;  4R64 A;  4XYC A;  2NPT B;  4ZRQ A;  4KX3 A;  4JV0 A;  2ZJD A;  2JHD A;  4UB1 A;  3ZDT A;  3N32 A;  7ICQ A;  3IHQ B;  2HBM A;  2IBI B;  3M7D A;  1IBX A;  2OOB B;  4KV2 A;  2IY0 B;  2DYB A;  5AZF A;  3V62 A;  1L4D B;  5JHA A;  4DSE A;  2R61 A;  1HIW A;  3AEG B;  1N60 A;  1WGG A;  2LXA A;  5KFH A;  3PMN A;  5KFI A;  1JWA D;  1IM4 A;  2KD0 A;  4J3O D;  1S77 D;  2LEK A;  2YX8 A;  1OFF A;  2EKI A;  1KTQ A;  3ONN A;  2NCN A;  1FCC C;  2KE7 A;  3AEV A;  1M6Y A;  3GIJ A;  4B9N A;  1K50 A;  2WXO A;  5AI6 A;  4EEK A;  2OEH A;  3LXF A;  5IP4 D;  5KFS A;  3Q69 A;  1IIP A;  5KT4 A;  3WK5 A;  1Q0W B;  2AX5 A;  5DG8 A;  1O03 A;  2V3N A;  5BOL A;  4LNI A;  2ALZ A;  4KLO A;  2V1Y A;  3VH4 B;  3A33 B;  5KT7 A;  3CSF A;  5CTR C;  2J0M A;  1C20 A;  2E1E A;  1NJY A;  2KN4 A;  5KG5 A;  2KWV B;  3N30 A;  1ISN A;  1YX6 B;  2BYE A;  4R8U A;  1L4Z B;  4A3O A;  2PLP A;  2D10 A;  1VJ5 A;  3C2K A;  3X23 A;  1V6E A;  2W55 A;  1FIQ A;  4DQI A;  3PZ7 A;  4IRK A;  1CMX B;  3OHB A;  5KFY A;  3DVG Y;  1SWW A;  2EMS A;  3H40 A;  4OJO A;  4XUS A;  2A1J A;  2EH9 A;  3VUX A;  4DFJ A;  4PZN A;  2EZY A;  1L3T A;  2PI4 A;  2G4D B;  2O6V A;  2AQ4 A;  7ICU A;  2KTR A;  2L05 A;  4KX6 B;  3F53 A;  4A90 A;  1DK2 A;  2RGF A;  5C1Z A;  3PX0 A;  3RJE A;  4NL9 A;  4N58 A;  3HPO A;  3HWT A;  4ECS A;  4HVB A;  3APD A;  1U48 A;  1RYR A;  3G6V A;  2WX1 A;  3U4E G;  3RF9 A;  2D8C A;  4F4W A;  2CRX A;  3BVZ A;  4EEY A;  1FNW A;  4DL5 A;  4C4V A;  1PUT A;  4DL4 A;  1S0O A;  3A9K A;  8ICU A;  1PDX A;  2EZX A;  4PS7 A;  2BQQ A;  3KKA C;  3LYY A;  1F1H A;  3A9K B;  2RHF A;  3PO0 A;  3GIL A;  1KLG D;  3DBH I;  5ALT A;  4HPP A;  2KIC A;  2ZIW B;  1UCV A;  3L5K A;  1QKZ A;  2FMS A;  9ICK A;  3TQ1 A;  4YN4 A;  5AZH A;  4GDL B;  4IDI A;  2P6U A;  1FRD A;  2A19 A;  1U49 A;  4P2H A;  2K1F A;  3L3F X;  2NTT A;  4LNF A;  4UAY A;  4WUR A;  5DPW A;  3IT4 B;  3G6Y A;  2PKO A;  2W9C A;  1SV0 C;  2KDB A;  4HJK A;  5L1M A;  2QB1 A;  1TKD A;  5BOM A;  5EOZ A;  2A3V A;  5KG3 A;  9ICN A;  2HBJ A;  1LKY A;  3W5U B;  3WA0 A;  3UMC A;  4BKG A;  5DG9 A;  4M9H A;  3BDP A;  2KC2 A;  9ICW A;  1PVR A;  2XGQ A;  3SFE B;  3BK1 A;  4W9H A;  5CB1 A;  1PQS A;  3PV1 A;  3A0H U;  2DYO A;  2FLN A;  2UU7 A;  1MSW D;  2M8S A;  5D94 A;  1ZQN A;  1S0N A;  2AL3 A;  4PJ0 U;  2XY5 A;  2B76 B;  4A55 A;  4FJV B;  1WY8 A;  3UMB A;  1KOT A;  2JRZ A;  2KTR B;  1L8L A;  2WGS A;  5I4D A;  4ITK A;  3EHV A;  3BYY B;  5FK9 C;  3ZYY X;  2PE6 B;  2KJ8 A;  2N9P C;  2INN E;  2XBB C;  3Q8M A;  4TUR A;  1D4B A;  3HP6 A;  5E6N A;  3X0W A;  2ASD A;  5AKX A;  4AYB F;  4KMO B;  4DL6 A;  2JT4 B;  4GIB A;  3GB1 A;  4X5V A;  2AQ0 A;  1XT9 B;  4BKS D;  1C4A A;  9ICC A;  2GMI C;  2GRI A;  4CHK A;  1MG8 A;  1ZD5 A;  3DHI C;  3H6N A;  4F4Z A;  4M9G A;  3V72 A;  4YP3 A;  1HZ6 A;  3PRP B;  1YJI A;  1KEJ A;  1QIL A;  3ZJT A;  4RGM A;  4DEZ A;  4KLH A;  1F2R C;  2IYD B;  5IN7 A;  2MW5 A;  2QSD A;  4II2 B;  1TK0 A;  4FS1 A;  1JRU A;  3H8H A;  3AEA B;  3N20 C;  1QOA A;  3CW2 C;  1HZ5 A;  3EFC A;  3TFS A;  1QF6 A;  2KV2 A;  5EWG A;  1WWV A;  3SEN A;  2UVV A;  4C4T A;  5HR7 A;  2AEH A;  3OSP A;  3F2C A;  3EC8 A;  2ZCB A;  4NM1 A;  3ISB A;  5BYR A;  1AQ6 A;  2IGG A;  3PR4 A;  1PGA A;  1UZX B;  2IOF A;  2LVO A;  4XWW A;  4IC7 B;  3GIM A;  4G9B A;  2M19 A;  2KNJ A;  4YR0 A;  4F93 B;  3CMM B;  4LZG A;  4EZL A;  1XU4 A;  4IR9 A;  3Q6B A;  4WH4 A;  5AEK B;  1SKS A;  1UT5 A;  2FAZ A;  3UF8 A;  4L23 A;  3PW2 A;  4O0I A;  5ALP A;  3AE6 B;  3AI5 A;  2RD0 A;  1IYF A;  3GZF A;  2L3Z A;  3BJY A;  4NLC A;  4BJQ A;  3PRE A;  5KNI A;  4WAF A;  2AQ2 B;  5KG2 A;  1P7F A;  2DX5 B;  4EYH B;  4F71 A;  3RRH A;  1XC9 A;  4XWT A;  2NRX A;  3SD7 A;  2BQU A;  3JYU A;  3KW5 B;  5AM5 A;  4RCO A;  2IOF K;  1B1Z A;  1KL9 A;  2W54 A;  3KD3 A;  1SZP A;  2RDI A;  2WU5 B;  4REZ A;  5KFL A;  2IJ0 A;  1WUD A;  2D07 B;  2MSE D;  3W1S A;  1KDH A;  4IM3 A;  3PW7 A;  4K4H A;  1HE8 A;  5KFV A;  2LHE A;  3A1Q B;  4JLC A;  4OVU A;  2EAP A;  3TEW A;  2ON8 A;  3QK0 A;  2KZR A;  3N1Y C;  3PRM B;  4F5N A;  2DZK A;  4US8 A;  3EFU A;  3BQT A;  2C60 A;  1M4V A;  1EO6 A;  4DQR A;  4TSS A;  3PVX A;  3NHE B;  2VA3 A;  1E8Z A;  2N9K A;  5JXV A;  5CHV C;  3C28 A;  3TMP B;  1QLB B;  2Y5B B;  1X9W A;  1T0S C;  2ZW1 A;  3PML A;  1CEZ A;  5KTQ A;  3ZDM C;  1P1A A;  5KG7 A;  2XCP A;  7ICN A;  5KT2 A;  2WXJ A;  4ZYN A;  3NVZ A;  4U6P A;  1F0M A;  1L5P A;  2KHW B;  2JEI A;  3ICX A;  2HMX A;  5KFF A;  3MR6 A;  3ECI A;  1SL1 A;  1KLU D;  4A3P A;  4NWI A;  1SE2 A;  4GOC A;  4J9N A;  2ZJ8 A;  2IGH A;  4ECR A;  3V6K A;  5C2T B;  2XNA C;  2N9X A;  4W9L A;  1UA1 A;  1WR6 E;  7ICR A;  3MAB A;  3BZK A;  2FPL A;  3B2F A;  5KFX A;  1ZQQ A;  2ZCC A;  3DBH B;  2YVC A;  3TBL D;  1NYQ A;  5ALE A;  2RQ5 A;  2QB0 A;  1VDV A;  3PVL A;  4H2A A;  2PFN A;  1ZE3 D;  2LD9 A;  3V6H A;  5DPT A;  2HI0 A;  3QE9 Y;  1P7E A;  4K3B A;  2BR0 A;  3UQB A;  5JZE B;  2KMC A;  4IG7 B;  3BZD B;  4BKS A;  1XEE A;  3RAX A;  2ZIX A;  7ICT A;  4NV0 A;  2FI1 A;  3CIR B;  1Q3U A;  1TK5 A;  4RQN A;  3V3X A;  3AU4 A;  3L16 A;  2RLT A;  3N3K B;  1EU4 A;  4DQP A;  5DQI A;  4F3O A;  3Q8C A;  4FN2 A;  2FIF A;  5CHW A;  2MUT A;  3IAM 1;  3PW0 A;  3M63 B;  4ZHO A;  4L2Y A;  4KDI C;  3VXW A;  3RFA A;  1K8R B;  1X2I A;  1JIH A;  3EUB 2;  1NK9 A;  2Y3A A;  1PYW D;  2JGA A;  2EEL A;  2FNJ B;  7ICK A;  4O5C A;  4S17 A;  1XCT L;  1X42 A;  3NVV A;  3VTV A;  3KUZ A;  3DBS A;  5L1J A;  2Z7J A;  5J17 A;  4B9L A;  5JH5 C;  3QX1 A;  4IW0 A;  2LFI A;  1NKE A;  4JV2 A;  5J0Y A;  4R63 A;  1Q1O A;  4QZ8 A;  3VR9 B;  1C3T A;  1JQ4 A;  3HIL A;  4IRD A;  5AUI A;  3TL5 A;  1V9P A;  2WF8 A;  3AE1 B;  2BHN A;  4QZF A;  4PPX A;  4C7Y A;  3AEB B;  3UM9 A;  9ICV A;  3BZC A;  4KZC A;  4QWE A;  5J18 A;  2LI6 A;  4UAT A;  1PUZ A;  2DFL A;  5KFJ A;  4ED3 A;  3WK9 A;  1C7Y A;  4HCP B;  3AXC A;  4PK1 A;  3M8S A;  2B3A A;  5D3I B;  4BFR A;  4PH5 A;  3MJW A;  9ICR A;  2KYW A;  1WX8 A;  4UBC A;  4GMV A;  1R4M B;  4NXZ A;  1X9M A;  3T8M A;  4HKQ A;  2JH7 A;  2WF7 A;  2IO3 B;  5GTI U;  2YQE A;  2BDP A;  1VR9 A;  4GXK A;  4RQM A;  4G50 A;  4XZ4 A;  2JZB B;  4UB8 U;  3PZD A;  2EMT A;  4M8N A;  2KWU B;  2R8J A;  5J0O A;  3KZX A;  3HM6 X;  3ZTC A;  1ZGU B;  5KFN A;  2KN5 A;  2WXM A;  3PO4 A;  3P4Q B;  5KAI U;  3FM9 A;  3TEX A;  4B0E A;  3ZRF A;  4YXJ A;  8ICW A;  4GFJ A;  3LDZ E;  4C4R A;  4WQM A;  3TAC B;  2C9W B;  1R4N B;  3C19 A;  2XIC A;  2SAK A;  1CZP A;  1NI3 A;  3NRW A;  1QQ6 A;  4Y2S A;  4YVZ A;  1JWU D;  1OQY A;  2IO2 B;  4KGR A;  1COO A;  4ANW A;  1RDF A;  2YML A;  1AAR A;  5BPC A;  1KW4 A;  3U30 A;  1ZW7 A;  2JU6 X;  4WAA A;  3RJK A;  2CHX A;  2J4X A;  4LJO B;  4QZA A;  3JVZ X;  4O3R A;  2LGI A;  2BCV A;  1L7N A;  4JX1 C;  4KN4 A;  1QH9 A;  2QB0 B;  4FHK A;  4A8X C;  3MC8 A;  1JN3 A;  1LVH A;  2MA1 A;  5AM4 A;  2H3Z A;  2LVQ A;  1N63 A;  3RD2 A;  3DVG X;  2ZTC A;  3AL0 B;  2ZIV B;  4BKT A;  3RAQ A;  4GSW A;  1OEY J;  2LWP A;  3KQ4 A;  2WF6 A;  1XSL A;  3C2L A;  1F9J A;  3PLV A;  1ZQZ A;  2KFK B;  2K0P A;  4O3P A;  2ZIU A;  3PY8 A;  2JZZ A;  3PPA A;  1YZ7 A;  5CR0 A;  4LJX A;  5ALX A;  2IHN A;  4KLI A;  4J9S A;  5DKW A;  4DQQ A;  3RB4 A;  3TCA A;  2KMD A;  1KBU A;  4I29 A;  1WXM A;  4LCD E;  1TY0 A;  5AKJ A;  1WGR A;  4DF8 A;  1RQN A;  2KWD A;  3ED5 A;  1SIF A;  2KT7 A;  3MHZ A;  3BII D;  1ZKH A;  3DBR B;  4LNK A;  1H38 A;  2W7O A;  2DZM A;  2Z8L A;  4CE6 A;  4KSK C;  1UEL A;  3RH6 A;  3K9O B;  2KSO B;  1SKW A;  4TQ0 A;  2QJL A;  4K1R B;  4MJS A;  5E6O A;  2KNB A;  2DYM A;  4F1S A;  1DK3 A;  3WAM A;  4ELU A;  4QZ9 A;  3MC1 A;  3B0Y A;  3ZD9 A;  3QAR A;  5HHD G;  5CWR A;  4UB5 A;  1WXA A;  4GLS C;  4KN7 A;  2BQ3 A;  4YSY B;  2RDH A;  3PHW B;  4IQU A;  4W9I A;  5AK5 A;  2PVO D;  5KFO A;  3OJ4 B;  2YMM A;  5J2B A;  2RMM A;  4DWF A;  3W1S C;  2LM4 A;  1Z4O A;  4UQG A;  3ENE A;  3M6K A;  1MHX A;  1S8O A;  1J7B A;  1TAQ A;  4W9D A;  3KHL A;  2V4I B;  3OSN A;  5III A;  4M47 A;  4DL2 A;  4Z6D A;  2BQR A;  1BML C;  4JL9 A;  4MSQ B;  3PV8 A;  1X6J A;  2NRW A;  4NJ6 A;  4UAV A;  4O1N A;  1A6S A;  1JML A;  1SIJ A;  1SJH D;  2G4S A;  2DEN B;  2KFK A;  1ROE A;  3DHH C;  1FXI A;  4TQ1 A;  2K60 A;  2K5P A;  2BDU A;  1T0R C;  2WAQ C;  1N61 A;  3RT3 B;  5ALJ A;  5H2F U;  4KLJ A;  4KLS A;  5B66 U;  1LFD A;  4LK0 M;  1BNP A;  4DDG D;  1ACC A;  4RNM A;  4KZ0 A;  8ICR A;  3U26 A;  2LZ6 A;  2DUY A;  3QU9 A;  5J2J A;  5J0X A;  1XQQ A;  4NLG A;  1ZPS A;  5J0U A;  2WXR A;  2LJ5 A;  3Q8F A;  2UVW A;  1EU3 A;  2HJ1 A;  5J2G A;  4FBJ B;  4YXM A;  1JRO A;  2KOB A;  3DEE A;  3GDX A;  2LVP A;  2R8K A;  3AE2 B;  3RJI A;  1F0Z A;  4LNN A;  5HHI A;  4OJ5 A;  1UPH A;  1XLQ A;  3A1Q A;  1E8X A;  2G5H B;  3TI0 A;  4KLG A;  1E9M A;  2BT6 A;  3PSI A;  3GIK A;  1TVA A;  1WRD B;  2OJR A;  4I2J A;  2D3G A;  1NJX A;  2IPK D;  4I27 A;  4DHJ D;  2WP9 B;  2ZPY A;  5KHQ A;  3LWL A;  1ZQT A;  1Z5S B;  4DFM A;  1WMH A;  3ZKJ C;  5AKL A;  1TKG A;  5ALZ A;  3SFD B;  8ICO A;  4MH8 A;  3VC8 A;  4ZRI A;  2N1W A;  4BOS C;  3BY4 B;  4GXJ A;  2KWC A;  3TAR A;  3RB6 A;  2FUG 1;  5ALN A;  2L32 A;  3QQ8 B;  1Z2M A;  4DHZ B;  2NBU A;  1YNT E;  4O9M A;  4UB6 U;  1IG6 A;  1J7C A;  2WDT B;  2KJ9 A;  3M3J A;  4DWI A;  4ELV A;  2J0J A;  3QHT A;  3RFZ B;  1GG3 A;  2MH7 A;  2K4E A;  2BPC A;  2R8G A;  2OCE A;  2KFZ A;  3R7R A;  1YOV B;  3A9J B;  5CHF A;  5J0S A;  1MFW A;  4URK A;  5J8Y C;  1I4G A;  7ICS A;  4IWP A;  1N5X A;  1WYW B;  1XF5 L;  3QNM A;  2QMT A;  3UI3 A;  1ZUD 2;  2OHF A;  4RFB A;  3MGH A;  2K8H A;  4PT5 A;  3QU5 A;  2G45 B;  3FIL B;  3RBE A;  3JPO A;  4BDP A;  3AB5 A;  3GS2 A;  1JX4 A;  2WF9 A;  2JZB A;  2WF5 A;  2YEP F;  2NYV A;  3Q8R B;  2HJ8 A;  4NJC A;  2L0T A;  3ETL A;  2Y0S F;  4NQK E;  2XY7 A;  1ZD2 P;  1Q46 A;  4G11 A;  1X66 A;  1UWM A;  2MRP A;  2ONQ A;  2OED A;  4FLH A;  1Z4N A;  5D3D A;  5IA7 A;  1NYR A;  5AIB A;  9ICO A;  3RJF A;  4K7U A;  4J6I A;  3C5F A;  3TAD C;  1N62 A;  1J19 A;  2AQ3 B;  3AE4 B;  4PL1 A;  3JSV B;  3K9P B;  3O65 B;  3GII A;  2B21 A;  1KJT A;  8ICE A;  2MX2 A;  2J53 A;  3HM3 A;  4RU9 A;  5D7G A;  3ZUN A;  3PSE B;  2L0F A;  9ICG A;  4BOZ B;  1BT0 A;  2W11 A;  5KG4 A;  2HVI A;  1LGR A;  2ZIX B;  2CU3 A;  1V5T A;  2F8K A;  2CS4 A;  3NJT A;  2CXY A;  3L0W B;  2HTH A;  2Y5P A;  2YLM A;  1WXS A;  2J0K A;  4RUC A;  4MAC A;  1N56 A;  1S97 A;  4UAR A;  4W9E A;  5BMI A;  2FE8 A;  2ZPN A;  3AE7 B;  1NEN B;  1ZYQ A;  2C22 A;  3HHM A;  4IM2 A;  2L83 A;  1K52 A;  2GBK A;  3CST A;  4WJN A;  2N0S B;  1UGM A;  3OHA A;  2LHT A;  1J7A A;  1HA5 A;  3N7R C;  1I4P A;  3OAW A;  3VDZ A;  2V9W A;  1DGS A;  5CHG A;  3NUQ A;  3T5K A;  2MUT B;  2JR5 A;  5AKE A;  4M04 A;  4OZB A;  1RYJ A;  3ZDB A;  4HKZ E;  1Q8K A;  1ZQJ A;  3RTV A;  2JEF A;  2FMQ A;  3KHH A;  2KDI A;  1D9F A;  1WWU A;  2HD5 B;  2JZ3 B;  4Y2U A;  5J2C A;  1DOX A;  1WZ0 A;  3KLS X;  4DFD A;  2KVS A;  1NDD A;  3QJZ A;  2K8C B;  3TFR A;  1NI2 A;  1ZDV A;  4KIK A;  3UGB B;  2PFQ A;  2NRZ A;  3QWZ B;  2VAN A;  2ACZ B;  2FE9 A;  4KIK B;  3UMG A;  3APF A;  1F52 A;  4USA A;  4W9J A;  3AQF A;  1HTO A;  3IN5 A;  1XCQ L;  2KFJ A;  1RRB A;  3N9Y C;  3RPF C;  2CHW A;  2GLS A;  2EAM A;  4NAW A;  4WJ3 B;  4M0A A;  5DBC A;  2HHV A;  5EWE A;  7ICP A;  2BS3 B;  2KX0 A;  2MJ3 A;  4JV1 A;  2ZUC A;  2W8L A;  4LNO A;  5ALU A;  1Z1V A;  1ZD4 A;  2HOQ A;  2WS3 B;  1S3S G;  4GU2 A;  2WQY B;  3RH5 A;  4P16 A;  1LM8 B;  4KLQ A;  3P4P B;  3JSV A;  4LTU A;  5G5H A;  4MM3 A;  5J0T A;  1L5U A;  1NJZ A;  3F5E A;  1QLN A;  1TIF A;  2NPT A;  3LWM A;  4I2F A;  1BPD A;  1QT9 A;  2BB5 A;  3GV5 B;  4RQ3 A;  5AIC A;  3QU7 A;  1WJU A;  2D3A A;  2IY1 B;  2LGY A;  1WGD A;  1A76 A;  1WZ3 A;  2WNM A;  5CA7 A;  3ZTD A;  4O3O A;  4KMU A;  2LI5 A;  1LV5 A;  5D4B A;  3MR3 A;  1RAX A;  2F8L A;  3ZO5 B;  2BS4 B;  4GLX A;  3Q8S B;  1H8C A;  5KAF U;  5KFW A;  3AE8 B;  5DCN A;  2KIV A;  1FD6 A;  3D2N A;  4FZN A;  3GV7 B;  2KVZ A;  3WKD A;  2N7E A;  5L1L A;  2MLB A;  3ALR A;  2X8X X;  4MFA A;  1B9R A;  2PE9 A;  2MA9 B;  1KFY B;  3PHX B;  1RFA A;  4OHJ A;  5G2N A;  4W9G A;  1ZQV A;  7ICL A;  1EXN A;  4AP9 A;  8ICS A;  1J2M A;  3OLM D;  9ICS A;  1YN3 A;  2LPE A;  1STE A;  1E8Y A;  3FIL A;  5D46 A;  2O6K A;  5ALF A;  3ISD A;  2AGO A;  2JH1 A;  3PS6 A;  1TS2 A;  2HHU A;  5J0W A;  4FUL A;  4ECT A;  3IG8 A;  4BXO B;  1NNL A;  3WAL A;  4NL9 C;  3H1U A;  4ICV A;  7ICV A;  5ALY A;  3H4D A;  5AI0 A;  2JEG A;  1U4A A;  4C8M A;  5EE3 A;  8ICL A;  1Q10 A;  4ECU A;  1ED1 A;  4NY8 A;  3AEC B;  2W9B B;  4DSK A;  4TUU A;  2I38 A;  5C5J A;  2QHO A;  1NK4 A;  2QKQ A;  3M9N B;  3AEF B;  4W9F A;  4OO1 J;  1SJE D;  3RRG A;  4DOB A;  1AN8 A;  4DSL A;  4DL7 A;  4P0Q A;  5BMG A;  5HFY A;  2QIL A;  2F77 X;  2YY6 A;  2B6G A;  2Y1I A;  3E0F A;  2W9M A;  4F4Y A;  3ZRC A;  1TGZ B;  1NEK B;  2FCM A;  1T0Y A;  2INC C;  2K8A A;  1JW9 D;  2I1K A;  4JWS C;  5KHO A;  3CWI A;  9ICX A;  4XQ8 A;  3VRA B;  1R4N I;  1D9D A;  1SWV A;  3OJU A;  1BVS A;  4QZH A;  4YMN A;  1TZO A;  4GXI A;  5KFE A;  2BYT A;  4DS5 A;  5DBA A;  5HR6 A;  3ZDA A;  1UF0 A;  1ZQB A;  4KDL B;  5L1K A;  5GTH U;  1PZN A;  2CHZ A;  2I6X A;  4YMM A;  1HQR D;  3FDS A;  2LRW A;  4F5O A;  1C77 A;  2N7J A;  4BAX A;  3B0X A;  4RNN A;  4PHD A;  2XI9 A;  2YB1 A;  1IUE A;  1ZQY A;  4QZC A;  5HML A;  1WI0 A;  2DGZ A;  2W43 A;  4EEW A;  1F2R I;  4G3I A;  3A4R A;  4EEN A;  3MTN B;  5BYQ A;  2ZVO A;  2JYT A;  2C7N B;  4M0W B;  1RFK A;  4B9V A;  4ED8 A;  4EX6 A;  4HK2 A;  2G0A A;  2D5G A;  3WAO A;  3SAH A;  4I2A A;  4QZD A;  3V6C B;  3CRX A;  5KG1 A;  4OJL A;  2LMC A;  4HLE A;  1EM7 A;  3Q8A A;  2L52 A;  2KDF B;  2Z0E B;  2KOX A;  4N6E B;  3Q3M C;  1XWL A;  2G9H D;  2N7D A;  7ICO A;  3SMV A;  1NKB A;  1B22 A;  2YEP B;  4HXD A;  2V3S A;  1F44 A;  4TUS A;  4QZB A;  4R65 A;  4DK5 A;  4R3D A;  3VTU A;  1WGK A;  4EKU A;  1UUP A;  1UHU A;  3Q8L A;  1YIW A;  2ATL A;  1MN8 A;  4XRH A;  2PMV A;  2NBW B;  4BBN F;  8ICC A;  2XCA A;  1YD8 U;  2V9H A;  3Q3N C;  1ET9 A;  1A5R A;  3T5J A;  3C5G A;  3I1Y A;  1IGC A;  5J2K A;  3MBY A;  4F72 A;  2VKQ A;  2ZG6 A;  4JUZ A;  3AU5 A;  4S0R A;  3KOO A;  1L6V A;  3MDA A;  4LZD A;  1ARO P;  1I7H A;  4M9J A;  4EZ9 A;  2GO7 A;  4QW8 A;  2R8H A;  1PFD A;  3ZQ4 A;  3KH0 A;  3WKC A;  4DLE A;  1RM6 C;  1HEK A;  2IMW P;  3WCQ A;  8ICJ A;  2WXP A;  3LK9 A;  3OGU A;  1WXV A;  2WWZ A;  3ZXV A;  4KGS A;  1A0P A;  4OD0 A;  3EPG A;  2CKH B;  1I35 A;  8ICA A;  1GUA B;  3BS7 A;  3HVD A;  3DDH A;  1KFS A;  4TMA B;  4ACF A;  4WJP A;  1HTQ A;  3JPR A;  2MBE A;  1S0M A;  1IV8 A;  1RXW A;  2LUM A;  4MJS B;  3LVW A;  2CJO A;  3C23 A;  5HHH A;  4J9L A;  1Y8R C;  4J03 A;  2QEJ C;  2WDQ B;  3ZNH B;  4DBG A;  1C78 A;  3L10 B;  3PR5 B;  4CF3 A;  2PMZ F;  3VH3 B;  4M8M A;  1RLF A;  3QZ7 A;  1WE7 A;  2F1H A;  4QIW C;  3PX6 A;  1TT5 B;  1EUV B;  1C1Y B;  3QUB A;  4IRC A;  4JWN A;  2IDY A;  2HE7 A;  4M9L A;  3W9C B;  4DSI A;  2J6T A;  4RT2 A;  1BUI C;  3ALB A;  4RMA A;  2D3B A;  2JXT A;  4ZRJ A;  4LVS A;  4ECX A;  4XE0 A;  2JF5 A;  2BPG A;  4MT5 A;  1FCL A;  1K1S A;  1X9S A;  2JWZ A;  1SB3 C;  1SF0 A;  3AED B;  4LJP B;  4B0M A;  3B9J A;  2W03 A;  3ZJU A;  5EE9 A;  2CJN A;  3GFK B;  2VZK D;  3TAP A;  2JMG A;  3RB0 A;  3R3M A;  4M0W A;  7ICM A;  1ZDX A;  4N9F 4;  4A9A A;  1GNU A;  4JPS A;  3UQ2 A;  3R8B A;  3NVY A;  2BF8 B;  1RYS A;  3AQE A;  2KJ6 A;  2RDB C;  3TAN A;  4C0Z A;  1UH6 A;  2MP2 A;  3ZGZ A;  1WR1 A;  1FRR A;  1YMH E;  1XLN A;  4I2E A;  2NVU I;  3C0R B;  3N1Z C;  4XC2 A;  2AL6 A;  1WWT A;  4TQS A;  4IWO A;  2N9L A;  4WJQ A;  1WXQ A;  4K4I A;  3DVN U;  2HBL A;  4ELT A;  1JUD A;  3RNE C;  4ACO A;  1SKR A;  2DLB A;  5IIN A;  3DDC B;  4KIT B;  4ECV A;  2RPQ A;  3K4G A;  2PI5 A;  5ALW A;  3RI7 C;  2BCU A;  3ZNI D;  1DOY A;  1S1Q B;  2J52 A;  2ZNV C;  2LRU A;  4AUQ C;  3SZ2 A;  5L83 A;  2YMP A;  1FEZ A;  2E6X A;  2V0G A;  1WGH A;  1V38 A;  2LGX A;  2ZZP B;  1MJD A;  4RM9 A;  1LXD A;  3BWU D;  3PX4 A;  3L08 A;  1QOG A;  1CQV A;  3KYD D;  1FFU A;  1N5W A;  3QCA A;  3N1X C;  4KLL A;  8ICH A;  1FM0 D;  1E7U A;  4I28 A;  3F5A A;  4MM3 B;  3S2A A;  4J9R A;  4UW9 A;  1BXT A;  4IQT A;  1MHH E;  4AS1 A;  2AH5 A;  2EAO A;  1PGB A;  1X9X A;  3Q8B A;  4YXD B;  3TEZ A;  2L8J A;  2ODG A;  2MHJ A;  3H0M B;  1AW7 A;  1SV4 A;  4ANX A;  5D6J B;  3WK4 A;  1WCN A;  4MF8 A;  2CPR A;  3PRZ A;  3IAS 1;  3HT3 A;  4EX7 A;  4Q43 A;  4QWA A;  3EA6 A;  1M94 A;  2A5U A;  3R2T A;  1B43 A;  9ICM A;  2W3S A;  4ARI A;  4YTP B;  5HI1 A;  2N4F A;  1WMH B;  2ZIW A;  3MGI A;  3RNB C;  5AZG A;  3QUT A;  1XLP A;  3E9S A;  5KFA A;  1QQ5 A;  2JSV X;  5DB7 A;  2XY6 A;  1L7M A;  1ZQA A;  1T4G A;  4Y2X A;  3GQC A;  4RUA A;  4J9K A;  4W9C A;  2KDM A;  2MAX A;  1UT8 A;  4Y2T A;  2JUO A;  4JIO U;  9ICH A;  2ZJA A;  4M00 A;  4WQO B;  3QZ8 A;  3V6J A;  3KFU F;  2VH1 A;  5E6J A;  4C00 A;  4A20 A;  2HTM E;  5IAA C;  4AQ7 A;  4J9Q A;  2KJH B;  3Q3F A;  2JRH A;  3TJP A;  2NV3 A;  3JPP A;  1CJE A;  1OUQ A;  4BGD A;  4ZRP A;  4PYZ A;  1OW5 A;  5DDY A;  1SXE A;  5CP2 A;  2HSZ A;  5J2E A;  1K51 A;  5KFP A;  4DQO C;  2DPJ A;  1JI7 A;  3MDC A;  4US9 A;  1DGJ A;  1X6I A;  2A4Z A;  3DWM A;  2HHX A;  4AYB C;  1KRH A;  5JHB A;  2MBO A;  3B08 A;  4FJZ A;  3MP9 A;  3BVM A;  4GXB A;  3WAN A;  4FFD A;  2W7P A;  3OTQ A;  4ZYS A;  2BBC A;  1L0V B;  9ICQ A;  1JCK B;  3RZF A;  1RQL A;  3WKE A;  5AI5 A;  3HW8 A;  1WF9 A;  4IQV A;  3MFH A;  4RGO S;  1T6B X;  3QX7 A;  3M9O B;  4UAW A;  4O3N A;  1MI0 A;  4KGT A;  2FID A;  1RZT A;  3KUC B;  3KWL A;  3AU2 A;  3M1Y A;  1TAM A;  5DQH A;  3PLU A;  4Z6F A;  1D5M C;  2K3U A;  8ICK A;  5HNK A;  1NK7 A;  2I1Q A;  5GMV A;  2WXQ A;  2AYO B;  1OXJ A;  3FYH A;  2GOL A;  4Z6C A;  1IP9 A;  1WJ4 A;  2ISP A;  1E90 A;  1KM7 A;  1COK A;  4GDK A;  1ZQK A;  3AUL A;  2AQ1 B;  4NLZ A;  5IIM A;  4MEX A;  2LM1 A;  2L5Y A;  5A0L A;  3IXS A;  4F7Z A;  4MSM B;  4EE2 A;  5ALV A;  4NLB A;  3H8W A;  1MQ3 A;  2W9A A;  1ZQC A;  3IV6 A;  1KFD A;  1ZQR A;  2JX5 A;  2JWU A;  1VLB A;  2O2V A;  4YMO A;  4M9N A;  3OWE B;  4YQW A;  1TY2 A;  4MGK E;  1MVK A;  3C21 A;  5ALO A;  4Y2J A;  4KLD A;  3MFG A;  1SL2 A;  2LYA A;  5HKH A;  4OJ6 A;  3VRB B;  3SV4 A;  1EF1 A;  3ZVV A;  4OVV A;  5J8Y A;  1T7P A;  2R8I A;  2REX A;  2KHQ A;  3NZS A;  3M95 A;  3RYT A;  2H3F A;  1L2N A;  2XEW A;  2WU2 B;  1XO3 A;  1FNV A;  2E8P A;  4I2I A;  3DV9 A;  1ENF A;  5G5G A;  1VZ8 A;  4RT3 A;  3V60 A;  5DB9 A;  4M02 A;  3H7I A;  1L3V A;  4DHJ B;  5TR5 A;  3IHP C;  5MPO A;  5J2I A;  1TKE A;  1S76 D;  1YN5 A;  4I2G A;  4O3M A;  1WH3 A;  1D8Y A; 
#chains in the Genus database with same CATH homology
 1C4A A;  1I4P A;  1JRP A;  2GRI A;  2PTL A;  4OZB A;  1RYJ A;  2GI9 A;  4HKZ E;  3AN1 A;  1HZ6 A;  4Q2J A;  2KAC A;  1YJI A;  4GDK B;  1QOF A;  3V05 A;  1QIL A;  3ZJT A;  4RGM A;  1FO4 A;  1F2R C;  1DOX A;  2QSD A;  3KLS X;  4D2K A;  3H8H A;  1ZDV A;  5EE1 A;  5LNK 1;  3AEA B;  1FMA D;  4N59 A;  1QOA A;  1HZ5 A;  3URY A;  2ACZ B;  3W2D A;  1QF6 A;  1JWS D;  4USA A;  1XCQ L;  1ZOY B;  1DOI A;  3N9Y C;  3RPF C;  2G1E A;  3P42 A;  5BYR A;  2IGG A;  4RH6 A;  2BB6 A;  1PGA A;  2BS3 B;  2MJ3 A;  4XWW A;  1DYQ A;  2RPV A;  3T3O A;  2M19 A;  1TKY A;  2WS3 B;  2WQY B;  4P16 A;  4WH4 A;  3P4P B;  1D5Z C;  2BTE A;  2WXK A;  5G5H A;  4LTU A;  1T3Q A;  4WWM A;  4YTM B;  4L23 A;  2IGD A;  2FBW B;  1V1O A;  3AE6 B;  1IGD A;  3FAH A;  4RNA A;  2ICI A;  1TJE A;  1QT9 A;  2BB5 A;  4HJG E;  5C3J B;  4WAF A;  2AQ2 B;  1P7F A;  3VQI A;  3U52 E;  4XWT A;  4C80 A;  1QOB A;  5FKA C;  4NAM A;  4JWU C;  2WNM A;  5H8Y E;  1WYG A;  4RCO A;  2BS4 B;  1I4Q A;  3P63 A;  1B1Z A;  1GB1 A;  2W54 A;  3AE8 B;  1FD6 A;  4REZ A;  2WU5 B;  2IJ0 A;  3W1S A;  1C4C A;  2LHE A;  3TEW A;  1JWM D;  2ON8 A;  1B9R A;  4RGT A;  1KFY B;  4OHJ A;  1L0Y B;  4US8 A;  4NAW B;  1M4V A;  1D6E C;  4TSS A;  2N9K A;  1QQR A;  5JXV A;  3VR8 B;  1QLB B;  1YN3 A;  1STE A;  2ZW1 A;  4RF0 A;  1VRA B;  2H88 B;  2M0A A;  2BW2 A;  3FIL A;  1GB4 A;  1K53 A;  1E7P B;  1TS2 A;  2WXJ A;  3NVZ A;  4XDD A;  1YQ4 B;  1XLO A;  2MJD A;  1L5P A;  3TSS A;  1JWB D;  3AE5 B;  1KLU D;  1SEB D;  3MC0 B;  4OZC A;  1E6E B;  1SE2 A;  3NRZ A;  2IGH A;  5C2T B;  2XNA C;  5EE3 A;  1Q10 A;  5HG2 A;  3AEC B;  2NTS A;  2K9X A;  3LB8 C;  2I38 A;  1E10 A;  2HDE A;  3AEF B;  1SJE D;  1SE4 A;  3B2F A;  1AN8 A;  1C79 A;  4YT0 B;  5BMG A;  5HFY A;  4KKJ A;  1NYQ A;  1VZ6 A;  2QIL A;  1VDV A;  4H2A A;  1ZE3 D;  1A70 A;  1P7E A;  4P6V F;  1NEK B;  3R2I A;  3HVZ A;  1JW9 D;  3BZD B;  4JWS C;  3CWI A;  4OVZ A;  1XEE A;  2J42 A;  3VRA B;  3CIR B;  1GOZ A;  3NS1 A;  1I4X A;  1Y56 A;  3V3X A;  1TZO A;  1EU4 A;  2BYT A;  3Q8C A;  3IAM 1;  4HRS A;  4ZHO A;  1SSN A;  3U7Z A;  3U2S C;  1EWC A;  1T5X D;  1HQR D;  4L2Y A;  2N7J A;  1C77 A;  1NVI D;  2KMM A;  2NMQ A;  2E3T A;  3EUB 2;  2Y3A A;  1PYW D;  3FC4 A;  2EEL A;  1IUE A;  2LJI A;  1XCT L;  2M56 B;  4ARC A;  3NVV A;  1F2R I;  5BYQ A;  2JYT A;  3NUH B;  3P4S B;  3NVW A;  4XDC A;  1RFK A;  2DWQ A;  4YWG G;  3P4R B;  2LFI A;  4HEA 1;  2D5G A;  3PZ8 A;  3VR9 B;  2LMC A;  1JQ4 A;  1EM7 A;  3GP7 A;  2L52 A;  3Q8A A;  5AUI A;  2I2Y A;  4N6E B;  3AE1 B;  1AYF A;  4C7Z A;  4C7Y A;  3AEB B;  1LO5 D;  2G9H D;  1L0X B;  3ABV B;  4YTN B;  2YEP B;  2WXG A;  1C4P A;  1EWY C;  1ZP0 B;  4R3D A;  1YQ3 B;  3SEB A;  1WGK A;  1UUP A;  2PIA A;  3KWV A;  4DXG A;  2Y5C A;  2PMV A;  5D3I B;  3AM9 A;  1R7S A;  4IKG A;  2MEK A;  2LHD A;  4HKQ A;  1TS4 A;  2WLB A;  1ET9 A;  5FR3 A;  1IGC A;  1VR9 A;  1L6V A;  1TS5 A;  1I7H A;  3AE9 B;  1PFD A;  2WXM A;  4FXC A;  3ZQ4 A;  2PVG C;  4A6Q A;  4ZHP A;  2KQ4 X;  4RF1 A;  1RM6 C;  1UNS A;  1OQQ A;  4IOI E;  3P4Q B;  3TUO A;  3B2G A;  3WCQ A;  3TEX A;  4B0E A;  2WXP A;  4HRO A;  4KGS A;  4WQM A;  2WXI A;  3AMZ A;  3C8Y A;  1D5X C;  3BYT B;  1ZXH A;  2SAK A;  1CZP A;  1NI3 A;  3I9V 1;  3HVD A;  4KGR A;  4ZOH C;  1JWU D;  4JE3 B;  4TMA B;  2TSS A;  2WDR B;  2K22 A;  1E0Z A;  3AEE B;  3NZ3 A;  2JU6 X;  2LUM A;  4RGN A;  2J4X A;  2WXL A;  2CJO A;  4LLG M;  2QEJ C;  2WDQ B;  5T8I A;  1C78 A;  2LGI A;  2JYE A;  1UGJ A;  1YN4 A;  4JX1 C;  4A8X C;  3IT6 B;  4OZA A;  5GXG B;  2IDY A;  5AUK A;  3W9C B;  1N63 A;  1BUI C;  2DBY A;  1ESF A;  1V1P B;  2SEB D;  1CK1 A;  2JXT A;  3W5V B;  2VZK B;  3KQ4 A;  4XE0 A;  5H92 C;  1IBX B;  1HEZ E;  4MT5 A;  1TS3 A;  2K0P A;  1FCL A;  3EGR A;  1SB3 C;  1XXG A;  1SF0 A;  3T3N A;  3AED B;  4KKI A;  1GPX A;  5BMH A;  4B0M A;  3B9J A;  3ZJU A;  3AV8 A;  1TYG B;  2WXF A;  1V1P A;  5EE9 A;  2CJN A;  3TEY A;  1UWX A;  1TY0 A;  2VZK D;  2KWD A;  4M0W A;  1PGX A;  3MHZ A;  3BII D;  2QIE B;  2W82 A;  2Z8L A;  1ZDX A;  3I57 A;  4A9A A;  1JAL A;  4JPS A;  1FXA A;  1WSP A;  3R8B A;  3NVY A;  1L6U A;  4TQ0 A;  2QJL A;  4NZL B;  2DYM A;  3ZGZ A;  1YMH E;  1FRR A;  2L1A A;  1XLN A;  3J9C A;  1OQR A;  1WWT A;  2N9L A;  2V3P A;  5HHD G;  1WXQ A;  4GLS C;  2BS2 B;  4UDU C;  4YSY B;  1VJK A;  2RDH A;  2DLB A;  3P1M A;  3Q8E A;  1AWD A;  4L1B A;  4DXF A;  2PVO D;  1DOY A;  2J52 A;  2RMM A;  1V97 A;  1FNU A;  2V0G A;  1I4R A;  2E6X A;  2GB1 A;  2X38 A;  4YSZ B;  3AH7 A;  1MHX A;  2RDG A;  1J7B A;  3BWU D;  3SR6 A;  1RWS A;  2V4I B;  1QOG A;  1CQV A;  4ZRQ A;  1BML C;  1FFU A;  1N5W A;  5TSS A;  4O1N A;  1FM0 D;  1JML A;  1SIJ A;  1SJH D;  1VZ7 A;  1IBX A;  1ROE A;  4MM3 B;  1FXI A;  1C9F A;  1L4D B;  1C76 A;  4TQ1 A;  2K5P A;  3DWG C;  1SE3 A;  2R61 A;  1BXT A;  3AEG B;  1N60 A;  1MHH E;  1N61 A;  4WIP A;  4AS1 A;  1PGB A;  1JWA D;  3Q8B A;  4YXD B;  3TEZ A;  4J3O D;  2LEK A;  4LK0 M;  2Q5W D;  1OFF A;  1AW7 A;  1FFV A;  1ACC A;  2EKI A;  1SXT A;  2ZW0 A;  1FCC C;  1HXY D;  1K50 A;  1ZPS A;  2WXO A;  3IAS 1;  4YSX B;  2WXR A;  3EA6 A;  3LXF A;  3Q8F A;  3Q69 A;  3R2T A;  3ZJV A;  1EU3 A;  3HUI A;  2W3S A;  1KTK A;  4ARI A;  4YTP B;  2MJE A;  2AX5 A;  1JRO A;  5HI1 A;  3AE2 B;  1F0Z A;  2V3N A;  1XLQ A;  4CQN A;  1XLP A;  3E9S A;  1SBB B;  1E9M A;  2BT6 A;  2JSV X;  2KN4 A;  1L4Z B;  2KDM A;  2IPK D;  2PLP A;  1FEH A;  2WP9 B;  2W55 A;  1FIQ A;  1F77 A;  2H89 B;  3PZ7 A;  4C56 C;  2JQR B;  1ZXI A;  1TKG A;  5E6J A;  3SFD B;  2HTM E;  4AQ7 A;  4MH8 A;  2KAJ A;  2FUG 1;  2WDV B;  5EE0 A;  2L32 A;  1CJE A;  4KX6 B;  4ZRP A;  4A90 A;  1V8C A;  1YNT E;  1J7C A;  1K51 A;  4N58 A;  4DQO C;  4US9 A;  3RFZ B;  3U4E G;  1DGJ A;  2MH7 A;  3DWM A;  3BVZ A;  1KRH A;  2W3R A;  1FNW A;  1PUT A;  3BVM A;  3MP9 A;  4ZYS A;  1PDX A;  2BBC A;  1L0V B;  1JCK B;  1I4G A;  3LYY A;  4RGO S;  3PO0 A;  1T6B X;  1KLG D;  1N5X A;  3AE3 B;  1XF5 L;  1WRI A;  2QMT A;  1MI0 A;  4KGT A;  3UI3 A;  1QKZ A;  1ZUD 2;  2OHF A;  4RFB A;  4PT5 A;  3KWL A;  3FIL B;  4GDL B;  4IDI A;  3AB5 A;  1FRD A;  1YJJ A;  1D5M C;  3GS2 A;  2K3U A;  2NTT A;  4WUR A;  3IT4 B;  2YEP F;  4NJC A;  2WXQ A;  2PW9 A;  2INP E;  2PKO A;  2WXH A;  1ET6 A;  2ONQ A;  1UWM A;  3E56 A;  2OED A;  3HRD D;  2AQ1 B;  2JZP A;  2WXN A;  3BK2 A;  5D3D A;  3W5U B;  1NYR A;  3IXS A;  1N62 A;  2AQ3 B;  3AE4 B;  4EE2 A;  2JWU A;  3SFE B;  2JX5 A;  3BK1 A;  3ETR A;  1VLB A;  3OWE B;  1TY2 A;  2J53 A;  1MVK A;  2DYO A;  2XN9 C;  5D7G A;  1MPE A;  1I4H A;  3MFG A;  1KF6 B;  2B76 B;  3VRB B;  4A55 A;  5BYS A;  2CU3 A;  4OW0 A;  2WU2 B;  5I4D A;  1XO3 A;  2Y5P A;  1FNV A;  3BVG A;  4MAC A;  1ENF A;  5G5G A;  1VZ8 A;  4ITK A;  5BMI A;  2FE8 A;  3MJ5 A;  3BYY B;  5FK9 C;  3AE7 B;  1NEN B;  1GAQ B;  3ZYY X;  2L83 A;  2INN E;  5MPO A;  1K52 A;  3O13 A;  1D4B A;  2N0S B;  3L4P A;  1KH0 A;  1TKE A;  1YN5 A;  3GB1 A;  1J7A A;  1HA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...