4ZOHC

Crystal structure of glyceraldehyde oxidoreductase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
MKIINSDQKVKITLKINGEKYETEVEPRRLLVHVLRELGFTGVHIGCDTSNCGACTVIMNGKSVKSCTVLAVEADGAEILTVEGLAKDGKLHPIQEAFWENHALQCGYCTPGMIMEAYWLLREKPNPTEEEIREGISGNLCRCTGYQNIVKAIKAAAEKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal Mo-Containing Glyceraldehyde Oxidoreductase Isozymes Exhibit Diverse Substrate Specificities through Unique Subunit Assemblies.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase molybdopterin-binding subunit
total genus 49
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
C PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 4zohC02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zohC01
2Y5CA 1VJKA 3RPFC 1JWBD 3ZYYX 1DGJA 1J7AA 1L6VA 1NYQA 4YTPB 4N58A 3AH7A 5EE1A 2BS3B 2H89B 3VR8B 3AEFB 4YSXB 3AM9A 1QOAA 1PFDA 2WP9B 3DWGC 1VDVA 4ZOHC 3AE9B 1RWSA 3PO0A 2W54A 1YQ3B 2DBYA 4YT0B 1E0ZA 1YJJA 1TKEA 1XLPA 1TJEA 1N5XA 1PUTA 2JX5A 3AEEB 3LXFA 1KF6B 2BT6A 1JROA 3VRAB 2OHFA 1XLOA 2K22A 4ITKA 2N0SB 3AV8A 5EE9A 4YSZB 1PDXA 3BIID 1JWAD 1WRIA 2Q5WD 3AECB 4YTMB 3SFDB 3EUB2 3P1MA 4ZHPA 1N62A 2CU3A 1QOGA 1FFUA 2JQRB 4HRSA 3B2GA 5EE3A 2LEKA 1RYJA 3B9JA 2WQYB 5MPOA 1KFYB 2DWQA 5G5GA 1EWYC 1FXIA 1ZP0B 2BS2B 5C3JB 3ABVB 2AX5A 2CJNA 3LB8C 4C80A 1R7SA 3SFEB 4KX6B 2W3SA 1J7BA 3CIRB 3AN1A 2M19A 1QOBA 4WWMA 1JRPA 3W5VB 3AE4B 2HTME 1NYRA 1VLBA 1T3QA 4WQMA 4YSYB 4USAA 1KRHA 1TYGB 2WLBA 1XLNA 3AE1B 2E3TA 4IDIA 3AE5B 2EKIA 1SB3C 2B76B 1AYFA 4JWSC 4JX1C 1FFVA 5GXGB 1YJIA 1WXQA 1NENB 1SF0A 2WS3B 2KMMA 1L5PA 2L83A 2K5PA 3NS1A 1NEKB 1L6UA 4YTNB 2WU5B 3W9CB 1DOIA 3HUIA 3AE8B 2MJEA 2G1EA 3AB5A 2FBWB 3AE3B 2QJLA 1RM6C 3P4SB 1QOFA 3NVVA 2W3RA 1AWDA 4JWUC 3AE2B 1V8CA 2WDVB 1E10A 3NRZA 1WYGA 1JQ4A 5C2TB 4N6EB 1YQ4B 2L52A 1QF6A 2KAJA 1DOYA 1FRRA 1TKGA 2CJOA 3WCQA 5G5HA 1FM0D 1FRDA 1L0VB 3KWLA 4A9AA 2MJDA 4YXDB 1DOXA 4LTUA 1ZXIA 1ZOYB 3AMZA 3NVWA 4P6VF 3SR6A 1F0ZA 3W5UB 4ZHOA 3VRBB 1WGKA 3P4RB 1N60A 4C7YA 1RFKA 1GPXA 1FXAA 1N5WA 1UWMA 1JALA 4FXCA 3VR9B 3AEBB 4US9A 1NI3A 3DWMA 3AE7B 2PKOA 2WDQB 4US8A 3P4QB 2H88B 1QT9A 1NVID 1FO4A 2K9XA 1OQRA 1QLBB 2M56B 3CWIA 1FMAD 3P4PB 5EE0A 5AUKA 1FIQA 2PVOD 2QIEB 2MJ3A 3HVZA 3AEDB 3HRDD 3L4PA 1E6EB 1N61A 1E9MA 1WWTA 1ZUD2 3AEAB 5H92C 1OFFA 2BS4B 3NVZA 1I7HA 1XLQA 3AE6B 5H8YE 1XO3A 3P63A 1IUEA 3B2FA 1E7PB 1CJEA 1JW9D 1SIJA 4C7ZA 1GAQB 1ROEA 1TKYA 3ETRA 1A70A 2PIAA 2WU2B 3AEGB 1N63A 5AUIA 1CZPA 2PVGC 4N59A 4HROA 1B9RA 2W55A 3FAHA 1J7CA 3NVYA 2ACZB 2MH7A 3FC4A 1OQQA 2WDRB 1V97A
chains in the Genus database with same CATH superfamily
2Y5CA 4EX6A 3WK8A 3ZDCA 4QWBA 4B9KA 4FHJA 2MBBB 3VXWA 4N58A 3ZQ4A 2JZBB 3DQVA 2YEPB 2EKEC 1D5XC 3PGEA 4LK0M 3VQIA 4ZOHC 5J8YA 5IAAC 2DBYA 2AL6A 1ZQWA 4W9EA 1V86A 2SEBD 5AI0A 4ECXA 1ZD5A 4YTMB 2J42A 1C9FA 3QU4A 3DBRB 3SFDB 2DFLA 1KBUA 2DPIA 3SMVA 4IQVA 1PGAA 2KMDA 2HHTA 3B2GA 3OG5A 5TR5A 4KV2A 4DSEA 1XCTL 4IC9A 2WXJA 3QK0A 1YT3A 2BCSA 1VZ7A 1S9FA 2G08A 4UASA 4C4VB 3PSFA 4P4PA 2KKCA 3GP7A 1YN4A 1S0NA 5KFSA 5IILA 3H8JA 1WMHA 2KWVB 2CPRA 1SE4A 1QOBA 4NJ6A 5AK6A 4OW0A 3M1YA 5AM3A 3LK9A 3MDAA 2MUTB 1T0RC 1MG4A 2EKIA 5KHOA 2MBEA 1PGXA 3IG5A 4NWIA 3V7JA 5AM0A 4DQSA 1C7YA 1PZNA 5BOMA 4K4HA 5GXGB 5AI5A 3LJ3A 2FMQA 2KMCA 4BKGA 3AU4A 4RM8A 1UUPA 2FI1A 1NEKB 4A20A 3KKAC 3FILB 3MGHA 4PT5A 3U7ZA 4EELA 5KT7A 2JH1A 3N28A 5KFNA 2DLBA 3VUXA 5ALYA 2YLMA 4M0WB 5KHQA 4PHDA 2GBJA 3H7PB 2IOHA 1WXVA 5AM4A 4MF2A 3APCA 1Z1BA 4HXDA 2H3FA 2O6VD 2RDBC 1CQVA 4W9CA 5L83A 1CEZA 4F4WA 2KLGA 4M04A 1J97A 5T14A 2LHDA 1ZQVA 1S8OA 3NVWA 3WK5A 3BDPA 2LXCA 2OEDA 3P4RB 1I4GA 3DBLI 1HQRD 4K7SA 4O5KA 4AJWA 1V1PA 3A9JA 2PJHA 2ASJA 1NI3A 5DKWA 3P4QB 5ALNA 5KFDA 2Y5PA 4M9LA 1UD7A 3DHGC 3KUDB 1U47A 3EFCA 3HVZA 3M7DA 3PNCA 4TSSA 2Y3AA 4EEYA 2Y1JA 1UWXA 2WX0A 5HKHA 9ICFA 3L13A 1Q10A 2F1JA 5D6JB 2NPTA 5J2RA 2K8HA 2I6XA 3KVFB 1I7HA 2D5GA 4HPMB 5H8YE 3URYA 7ICSA 2F77X 1GC7A 1JWUD 3H8HA 3MFGA 5AZFA 2YMMA 2UVRA 1TS2A 3TFSA 4DOCA 3T8MA 1D8YA 3R8BA 5KFCA 3PW2A 5AM5A 5KFRA 1HUZA 2K8CB 3FC4A 4KGRA 4A90A 4K4GA 2BBCA 2K4HA 2RGFA 3RPFC 1SE3A 1Y88A 1XO0A 4OD0A 2ZUCA 2KOBA 2LVPA 3IT6B 4I27A 4XDCA 3TJPA 4KLHA 1TAMA 1MPEA 4RH6A 1QLNA 2D2QA 1PUTA 2NRTA 3KZIU 2MQJA 5J2DA 1XLOA 2ZIXA 5ALLA 3KHHA 1K51A 2QSDA 1JWAD 1E7VA 2IZVB 3QA8A 4DS5A 3JPQA 3RJGA 3QYPA 4RF1A 3A1QB 1L7OA 3QUTA 4OZCA 8ICHA 2LMRA 4HPLB 4W9KA 2JXJA 1EWYC 1X2IA 4ACOA 2CJNA 4MEMA 3F5EA 1S10A 1DXSA 4JV2A 2HTME 5IIJA 1N48A 3U52E 4A3PA 1F1HA 1V9PA 5J2AA 5DB9A 4NJ8A 4O3QA 2KK0A 2JZPA 1YJIA 1IBXA 2EAOA 5KAFU 4HYKA 2ASLA 1L5PA 4WJQA 1MI0A 3ALBA 5GTIU 2OCEA 3HUIA 5AK4A 1ZQFA 4TURA 3AB5A 4KSKC 2XGPA 3N20C 1FD6A 3MC9A 2EMTA 2W3RA 4C8KA 3GE3C 1V8CA 1E10A 3NRZA 2LJ5A 4N6EB 1UBIA 4MM3A 4YFKA 3TQ1A 5FR3A 5G5HA 2MJDA 2WTFA 4YCXA 4LTUA 2V4IB 2WXMA 1K5OA 3AMZA 2KVZA 3I5JC 4ICVA 3NHEB 3SR6A 5AKKA 3IVFA 5CX3A 4WJOA 1L0YB 1ZQLA 4ED6A 2IDYA 2G9HD 3C21A 4EBDA 1L4DB 1SKSA 1LB2B 1LKYB 1FO4A 3OJ3A 4QNLA 4WQOB 3RNAC 4KZCA 5KFAA 2DKXA 4DQRA 2IOFK 2D3BA 4M0WA 2N9PC 1M6YA 1IV8A 4UW9A 2W7OA 5AM2A 3QZ8A 2J0JA 3NG0A 4Y2TA 3J81j 4DQPA 3B08A 3VTWA 1ZETA 4QWAA 4MJSB 1ZQXA 5CR0A 2J6UA 3ETRA 2KFNA 5DQHA 2HHXA 4HJGE 4HROA 1ZQTA 2HVIA 2YX8A 4FBUA 3VC8A 1NKBA 5DLFA 4O9MA 4GIBA 3HW8A 2HOIA 5KL1B 3C28A 1COKA 1NZPA 1JWBD 2RPVA 4F1SA 3N30A 3MDCA 4M01A 1C4PA 3W1YA 1YQBA 4BZAA 4J9RA 4ED2A 1VDVA 3MC8A 3Q8CA 2AYOB 2V9WA 4RCOA 4ECTA 2IHMA 4YMNA 2Q4TA 1KH0A 1L2NA 4A8EA 3KQ4A 4MT5A 3ZJTA 2J6TA 1KFTA 4TKNA 1UELA 2K22A 2LHTA 3B0AA 1E5WA 3O65B 3A33B 2LM1A 4DLGA 4B6WA 3TEYA 5KNIA 1MN8A 3ICXA 2YY6A 1FFUA 2BKFA 1P7EA 3X23A 4DHJD 2KACA 2NRXA 3L54A 2LGSA 5AZHA 2GBRA 1L3SA 5MPOA 2ZG6A 5J29A 7ICPA 9ICVA 3W1SC 2WXIA 1ZP0B 4O5CA 4EZ9A 4LZGA 4IWQA 4MHVA 4J9PA 1WJNA 4W9FA 1ZQNA 4DWFA 1B1ZA 2YMPA 7ICLA 2TSSA 2BGWA 1XWLA 3IM1A 4NL9C 4GXJA 5L9XA 4J9KA 3CNHA 3RR8A 2WLBA 2E3TA 3CF6E 3AE5B 4WH4A 4ED7A 2R8JA 3IHPC 1YZ7A 1D3ZA 3OGUA 5KAIU 1P7DA 4LNFA 3ZNZB 1WGRA 5FK9C 3R7RA 1BMLC 1CMXB 1L7PA 3QU7A 4WWOA 5BMGA 3NS1A 3BYYB 3U26A 3ZD9A 2E8PA 4GLXA 2PXIA 1ZQDA 3Q14C 1QQ7A 2FBWB 2KQSA 1N6ZA 4GDKB 5C23A 5I4DA 3L3FX 4ECVA 1IYFA 3IG8A 2EZXA 3EA6A 2Z59B 5J2KA 2DAJA 2JY6A 3WK6A 2EZYA 3QUBA 3HHMA 4NLKA 1FRRA 2KZRA 5DGAA 4C8NA 3MFHA 2EZZA 2JRHA 1SV0A 3RJFA 2W9CA 2MLBA 4XA5A 5CHGA 4DSKA 3PS6A 2I2YA 3DDCB 2B6GA 3I3TB 2JRZA 1SIFA 2BVCA 4ECQA 3JSVA 4P0PB 1Q3UA 2I1JA 2JRIB 1IP9A 2R8GA 4P16A 2KC2A 4OO1J 2AXTU 2M0XA 2CS4A 4P2HA 3TEZA 2WDQB 3SENA 2BHNA 2RR9A 4PGYA 4IKGA 3WA0A 1F0MA 3WKAA 1E90A 1FMAD 4RNMA 2INNE 3Q3FA 2HJ8A 2V4LA 2A5UA 4ECSA 1SSNA 3C0RB 4J9QA 4KGTA 7ICNA 1OFFA 3OWEB 3ML8A 3KWVA 2ZTCA 3PHWB 2BB5A 2NVUI 1E7PB 1C3TA 1GJZA 3PX6A 2CHXA 4B6JA 2WU2B 1N63A 1X6JA 3E9SA 4O3MA 1X9SA 4FULA 2K4PA 2INDC 2DGZA 7ICJA 2F8KA 4DOAA 2W9BA 1V97A 4RQNA 3WKBA 3GU3A 3ZYYX 1A5RA 3PX4A 7ICOA 4C8MA 4KKIA 1WX7A 5KG2A 2V1YA 4FLHA 3DDHA 4PHPA 1ZQSA 4EBCA 3G6XA 1TS3A 2F1IA 4UAVA 2WP9B 1VR9A 4E74A 2J0KA 4ZYNA 1I4PA 3V7KA 4S0RA 3TARA 1EXNA 2KNBA 1KF6B 1HEKA 1JROA 2OHFA 4DL5A 3DEEA 1Q46A 4I2BA 2NMQA 1ZDXA 4DHJB 5D94A 3A4SC 3Q3MC 4IL6U 2WXHA 3U8ZA 2R61A 2IHNA 2WQYB 4BWMA 3OLMD 1SJED 3ZIMA 1E8ZA 4W9DA 4F72A 2D6FC 4CF5A 3ECIA 2FPKA 2O2VB 1F9JA 2VA3A 2YTUA 2PI5A 2BPFA 1B22A 3KYDD 3OHBA 4KX6B 3A0BU 3AN1A 2FMPA 4HCPB 3PRMB 3I57A 1KOTA 2WXKA 4QW8A 1TV9A 3GIJA 4PJ0U 4MACA 1BVSA 1TS5A 4BXOB 3ED5A 4B9VA 3CP8A 5D49A 3RF9A 3J9CA 2MJEA 4NL9A 2NO4A 2G1EA 1RYRA 1YZ6A 2L1AA 5TZVA 4P0PA 8ICOA 2KHVA 5E79U 4M47A 3PV1A 3VUYA 3AQEA 3VTVA 4NNJB 2WF5A 5IINA 3AULA 4UB6U 1O08A 3GZFA 1HTQA 3DHIC 2LI6A 4KITB 1ZQGA 4M02A 3DBLB 1NJYA 3SQIA 1UA1A 1EU3A 2BKRB 2BYVE 2J4XA 1AW7A 1ZQHA 4A8XC 3GQCA 4FXCA 3L17A 4JWNA 2WNMA 4ANVA 5CJ7A 5L1JA 4DXFA 3WK4A 2PKOA 2JHDA 5G55A 5BO4B 9ICNA 2MW5A 3IBEA 4EZLA 3SZ2A 5AUKA 1C4CA 4XX5A 1WR1A 2DUYA 2XVTA 4NJ7A 3PW5A 2DYMA 3HX0A 1ZQ1C 2E8MA 5L1KA 5BYRA 1S0VA 3MHSD 3PV8A 4ANXA 4F5RA 1JW9D 4NY0A 3T5HA 4FJYA 3MR6A 4JIOU 1J7CA 2MH7A 3NVYA 3Q8LA 2AJQA 2M0AA 2Y9UA 3PZ8A 1R4NI 3R3MA 3MR5A 4O3SA 4EEKA 2KX3A 4TQRA 4R3DA 4EE2A 5DLGA 7ICMA 4ELVA 2WXOA 2O6VA 3DV9A 1TE2A 3S2AA 2QC8A 2AQ1B 2NR2A 3AU5A 8ICTA 3RJIA 4WWNA 2JX5A 1YD8U 7ICEA 1XLPA 4XE0A 2PMZC 5KT6A 2HOFA 4FFDA 1RDFA 2C7HA 4GN1A 2BPSA 4ZRJA 5JRTA 4IRDA 2G45B 1LGRA 2HBKA 3QUQA 1JCKB 4ITKA 1KTQA 2JZBA 5J2JA 2F2AB 1P3QU 2NS5A 8ICXA 4KLMA 2N9LA 4GMVA 4RQ4A 4NLGA 8ICSA 2KJ5A 1C76A 4KZ0A 3HILA 4YP3A 2BZFA 4YQWA 4CRXA 3TCAA 3MR2A 3RH5A 3PRPB 3VH3B 3SFEB 3ZDEA 4DHZE 3G6YA 4JV1A 3CIRB 3GIMA 4M0AA 4WWMA 2H3IA 3T3OA 1KKXA 3T3NA 2ZNVB 2C2RA 3EC8A 2W82A 3EWAA 4IDIA 2Y0SC 4LCDE 1AARA 2QB1A 3PMLA 3F2BA 5L95C 2N7EA 2C7NB 4JX1C 2QMTA 3ZNGC 5CHFA 3N9YC 5J17A 4QAYA 4RPZA 2Z7JA 3B0YA 2XCPA 2RDJA 3BY4B 2FUHB 2KSOB 5DG8A 3C19A 2KZZA 3BQ2A 4BGDA 2M1MA 4S17A 4DS4A 1JUDA 5HFYA 5HR7A 3MBYA 4RT3A 1UHUA 1FXTB 3VUWA 2MSNA 2H3VA 4FA6A 1A0PA 1WF9A 1SKWA 2LWPA 1NK7A 1QSSA 2ZIWA 2BPGA 2NBWB 4RPXA 3H1UA 3KTQA 3IHQB 2WXFA 2HBLA 2PEAA 1ZD3A 5E6JA 3ZGZA 4YG2A 4KX3A 4RQ6A 4P6VF 1ED1A 2D8CA 5ALHA 4UB1A 5HHHA 3N4MB 4BWJA 2ES6A 1WGKA 4I2FA 1RFKA 1FXAA 2WX1A 5KT4A 1ZQPA 2BR0A 4DQIA 4I28A 3ISCA 1ZQRA 3I1YA 3UINB 2KKPA 3KW5B 1SWWA 5DGBA 4QZFA 2KDBA 2YQEA 1WCNA 1U48A 4YXJA 4TQ1A 5J8YC 2LHEA 5D46A 4OJPA 5H2FU 2ZIVA 3TEXA 3U2SC 2BS4B 2KZ3A 3RNEC 8ICNA 5IKCM 2JSVX 3EFUA 1PVPA 2C22A 3Q3NC 2P35A 1SIJA 1K8RB 4ELUA 5HI1A 2PIAA 5BYQA 2JUOA 4RQ2A 5KFMA 1MVKA 1S1QB 4N59A 5KFWA 2H3QA 3FAHA 3KUCB 2I38A 2QB0A 4UAZA 3HPOA 1K53A 1WGYA 2L32A 5ALOA 5DG7A 1U45A 2LPEA 3HKZF 5KFLA 4BVUC 2WHEA 4KIKA 3AH7A 1DRGA 2P6UA 7ICIA 3BZDB 3QAQA 1KLUD 3BS7A 2WHIA 1Z00B 3BYTB 2XNAC 3IDWA 2IJ0A 4OVUA 1QH9A 3SEIA 1RFAA 2WAQF 4HAIA 1BT0A 1C1YB 1I4HA 2MP2B 4W9HA 2AQ3B 5KT2A 1C78A 1I35A 3Q3OC 4AOFA 3CSFA 5KT5A 1KLGD 1DOQA 4FE3A 4UARA 3I9V1 2W8LA 1FXIA 2KTRA 3UI3A 2G06A 2C7MB 3FM9A 1WM2A 4F71A 4PGXA 1MSWD 1F52A 1JMSA 4FBJB 1IXRA 1ZQBA 3RB3A 5HG2A 3RI7C 8ICAA 2AU0A 3W5VB 2ZIVB 5B66U 1MFWA 1ZXHA 4F5QA 4JB3A 3RD2A 1X9MA 2JGAA 3RNGC 2KE7A 1AN8A 1Q8KA 2BPCA 4QWCA 4DCCA 3UQ0A 3EHVA 3Q8RB 4EZ6A 1WH3A 5A0LA 4ACFA 5GTHU 2JR5A 2KVSA 2LBOA 2BCRA 2INCC 3RT3B 3PW7A 3AE3B 5IIIA 2DX5B 9ICXA 1SE9A 2LRUA 2FCNA 3NVVA 4PL2A 4FS2A 1AWDA 4C4SA 1GUAB 3V61A 4WJPA 2E8NA 4LNKA 1BPDA 1WYGA 3RTVA 2HMXA 2L52A 4KLOA 2KV2A 3PX0A 3WKDA 2KLCA 2OJRA 5HHDG 1RXWA 1EO6A 1SL2A 1V1OA 2XEWA 3ZI4A 2XIDA 4OJLA 1D8LA 3V72A 3DOWA 4JPSA 4HKZE 2VIXA 4HLEA 2BCVA 3RH6A 4Q8FA 4P7IA 1L8LA 4YMMA 2LYAA 5D2MB 3K9PB 3ZRCA 4IOIE 1JIHA 1QT9A 4C4RA 4IC7B 1ZQUA 2KFZA 3KD3A 1C20A 2M56B 2Y5BB 5IA7A 3BZCA 4C56C 3U30A 4BUGA 2JEGA 2KP7A 1WRDB 2GBKA 4JLCA 1T0SC 1UQVA 2RPQA 1MA7A 2MWSB 3KZXA 2H5XA 3QJZA 3TEWA 4C7ZA 3Q69A 1ROEA 3RN9C 5AUIA 1KFSA 2FIDA 4IG7B 3UF8A 1BPYA 2ZJDA 3VH4B 5AKHA 2PTLA 3AV8A 3JYUA 3NZUA 3NZ3A 3VAWA 1OW5A 1TZ1A 3IAM1 1KN5A 1NYQA 3SYZA 3QQ8B 3V3XA 4MELA 3GILA 2DENB 3ZTDA 2G09A 4KIKB 1WM3A 9ICHA 2KOXA 3PO0A 2W54A 3RRGA 3NUHB 1WUDA 3RJEA 1TS4A 2DHZA 3FILA 3UGBB 9ICOA 1WZ0A 1XF5L 4RGOS 3V05A 5ALIA 1WGGA 4PH5A 1BXTA 5AZGA 3CYMA 4BKSD 4IUMB 1QOGA 4GC7A 3QXGA 4TUPA 2FJ6A 5D4BA 2ICIA 7ICQA 1L7MA 2ZIUA 2UVVA 2KO3A 5G5GA 4QIWC 2XBBC 5CEHA 1WMHB 2VJ5A 1BPZA 5F3XB 2GWSA 1V9JA 3H6NA 4P1CC 5JXVA 1TFRA 5J0RA 2AQ4A 1SE2A 3SI8A 1J7BA 4IR9A 4PYUA 2AGPA 1JI7A 5LLIA 1NKEA 5J2IA 4Y2PA 3M3JA 1T3QA 1EF1A 1KRHA 2LYHA 2DZIA 3P42A 4K3BA 2WF6A 5CA7A 4DF8A 1V2YA 5JHBA 2RDHA 4MJSA 2DL0A 3WK9A 1B9RA 1L6UA 4KMOB 3UMGA 5BYSA 4K4IA 3QX1A 1H38A 1H4RA 3K75D 2BYFA 3AI5A 3GIKA 4ED3A 3BZKA 4I29A 5AKLA 3OSPA 1S0MA 4KLGA 1UZXB 3VFKA 1X9XA 1KLVA 2BDUA 1VCBA 1IG6A 2GB1A 1UNSA 1OQYA 2DAFA 5FKAC 2K0PA 3C5FA 1FM0D 4CCHA 2VA2A 9ICKA 2BB6A 5ALKA 1S77D 1DYQA 4QZEA 1ZOYB 2JT4B 2M4NA 1KM7A 2UYZB 4IM3A 2J52A 2H3ZA 5J0QA 4B9NA 2Z0DB 2MRLA 2C28A 4KLLA 9ICLA 3F2CA 1ZKHA 1X40A 8ICWA 5JZEB 3ZTCA 3RBEA 3C1YA 3MGIA 1NOMA 2J6SA 3AE7B 4J9MA 3JPRA 4NZLB 1KL9A 5IO9A 2CXYA 4US8A 9ICGA 2N4FA 4ZYSA 1MC8A 1P9DU 2GLSA 4HWIB 1C77A 1QQ5A 3JVZX 4KLEA 3F2DA 2CU1A 4GGQA 1TK0A 3AEDB 2MCNB 3QU2A 2IO0B 3ZW3A 2W9BB 2I1KA 4D2KA 4BKSA 4KN4A 4C8OA 4MH0E 4II2B 3BK2A 4OCZA 1MQ2A 1ZQCA 1PQSA 1ZRMA 1XO3A 3B2FA 3N97B 4DHZB 4JGHB 4PS3A 3ZKJC 4F2SA 3Q6BA 3IFWB 4NQKE 4WJ3B 1ZGUB 4KGSA 4NLBA 1SGGA 2MBOA 2ZW1A 1UGJA 2UWQA 2XN9C 5DBCA 2D10A 2XK5A 2XY5A 1MHXA 1XD3B 4Z6DA 3T9LA 2LVOA 2KSOA 4DFMA 1VJKA 1HZ6A 4F4ZA 1ZQYA 4ZRKA 3AEFB 3TUOA 4UB2A 1IPGA 2LZ6A 2LGYA 5AK5A 4GXIA 4I6LB 2ZJAA 1XT9B 2KWCA 2INPE 4GLSC 4IRKA 2ON8A 3AEEB 4DL2A 1IM4A 1NKCA 1YJ1A 4KVGB 3BIID 3MR3A 2NYVA 3IAS1 3EECA 4KTQA 4IWOA 1PK1A 3T79A 4HJKA 4GXKA 1HTOA 2KFJA 3PLUA 3B9JA 4Y2SA 1SJHD 1WX8A 2FUG1 2V4QA 1ZQQA 4DWIA 2LGDA 4F50A 1UT8A 3SV3A 1NDDA 4B0MA 1OEYA 5KFFA 3OJUA 2KDEB 4EBEA 1EUVB 1KSPA 2MBHA 2QARB 4USAA 2WXRA 4RQ7A 2B0CA 3RB0A 3N7PD 5KFJA 4JWSC 5KG6A 1BPEA 2IGDA 4P1BC 2V3SA 2KN7A 4HEA1 4PHAA 3AE8B 3ISDA 3CW2C 4RQ5A 1PYWD 3A1QA 5KFYA 1WWVA 5DDMA 2ZVOA 4IM0A 3RJKA 4HK2A 4N9F4 4Y2YA 3RNBC 5CRXA 4C4VA 1TT5B 2YB1A 4I2AA 3OJSA 1H8CA 3F5AA 1YQ4B 3GOEA 5DQGA 9ICTA 1F77A 5BOLA 3GIIA 3LYYA 2O6KA 3H4BA 4UATA 2X38A 1RYUA 4ECRA 1V1PB 2E1FA 5FP0A 3PTFC 2QB0B 1NJZA 4EZJA 4MGKE 5HP4A 4X5VA 3TADA 4YN4A 3AL0B 5CTRC 1J2NA 4RMAA 1UCVA 3RR7A 5ALQA 1S5LU 3V60A 1G6JA 4DK5A 5KG3A 4UDUC 4BFRA 2QDFA 2CHZA 4IRCA 1JALA 2LI5A 3SV4A 4Z6FA 3AEBB 2G4SA 5DPWA 1F2RC 1GOZA 2GOWA 2PKEA 1L3TA 2LD9A 5JH5C 4QZIA 4DOBA 5ALSA 9ICQA 2JWZA 2MJ3A 4QZHA 8ICJA 3HRDD 3L4PA 4RUCA 4MGIE 1ZQOA 3RH4A 2WXPA 3BWUD 1ZQMA 4LZDA 3TBLD 3EYZA 2XO7A 1K50A 3KHGA 1YN3A 1WJ4A 4ZRPA 4ZDVA 2W43A 3Q8PB 5EDSA 4II3B 3GDXA 4TV3A 4TMAB 1NNLA 1VZ8A 2KWDA 3B1LX 1S0OA 1E7UA 4KDIC 4CF3A 2ZW0A 4WAAA 8ICKA 2IGGA 1Z4NA 2LYBA 3QC8B 1DGJA 2JWUA 2OM6A 3GB1A 3BQTA 2BKEA 2P6RA 1Q5WB 3C2KA 4Q44A 3VR8B 1TKDA 3C5GA 3PRZA 2HDEA 3RB6A 4TUUA 4ARIA 1ZQIA 1NJXA 2BYTA 5AKJA 3Q8EA 5HMMA 3QCAA 1WYWB 4XC2A 2G0AA 4RT2A 2XI9A 2OOBB 4XQ8A 3BK1A 4XRHA 1PDXA 4ZHPA 1L7YA 2W9NA 3AECB 3V7LA 2FIFA 1NK0A 4C4TA 5CB1A 2KWUB 4HRSA 1LXDA 4YWGG 3NY5A 2FMSA 4B9UA 2G5HB 1LQBA 5AKGA 2E1EA 8ICYA 1RYJA 3ZVVA 4BDPA 1ZYQA 5L1MA 3PW4A 1I4XA 1KFYB 3UXNA 4RM9A 2BS2B 4C8LA 2NBVB 1RZTA 1F44A 4F4KA 3ABVB 1YX5B 2K60A 1J2MA 2WXLA 2LUMA 3APDA 4NAWB 3UQ2A 1B0XA 3K1ZA 1JRPA 2DYOA 3AXCA 2Y1IA 5KFUA 1JXEA 4LLGM 3MGVA 3H7PA 4YR2A 2KMMA 2KDMA 4LDTB 3GZNI 4K7UA 3AQFA 1NK6A 3DVNU 3WALA 1RYSA 1HZ5A 1QOFA 1ZDVA 2K3UA 1D4BA 5HMLA 2JEJA 4NLZA 5DB7A 2W7PA 2ISOA 3PVXA 4KKJA 1B4FA 1SL0A 1HEZE 1AROP 3K4GA 3D2NA 2DQNB 4UB3A 4LJPB 1RQNA 3WAMA 2HBMA 3RFAA 4J9SA 1S3SG 1TKGA 1WCLA 1NBFC 2KHQA 4Y2RA 2IPKD 1FCLA 2K8BA 2KJHB 5J0YA 4PK1A 4DQQA 2BYEA 4I2EA 1KRPA 2ZJ8A 2PPHA 5FR6A 5DPRA 1O03A 2FLPA 4KMUA 5ALDA 3T5JA 4RF0A 3D6JA 3ZO5B 3UQAA 3R66C 3IV6A 4OZBA 4PGQA 1GPXA 1UWMA 4QZGA 1J19A 3E0FA 3OTQA 3BQ1A 1WXSA 3PMNA 1XSNA 3ORYA 2V4RA 2HBJA 4HDOA 4KLJA 3JPTA 7ICVA 2MA1A 4X57B 2UU7A 5KG0A 5EWGA 3NRWA 1ZOLA 2QKQA 3MC1A 1GNUA 4WAFA 4G50A 4AUQC 2K8CA 5AEKB 5TSSA 3TIXA 2QCZA 1CI4A 3C2MA 3AE6B 2BQQA 1ZQJA 1V5TA 2ALZA 1I42A 1XLNA 2KN4A 4B9TA 4R65A 2HI0A 1WXMA 4M9JA 1WGHA 1SWVA 1ZRNA 2KIVA 3M62B 4J9OA 2GI9A 4AWJA 4DSIA 3MABA 3PY8A 2WDRB 4OJ6A 5ALUA 4I2CA 4Y2QA 1QKZA 4MFFA 1P0RA 1TY0A 4PS8A 4NAMA 2KZMA 4W9GA 2Y0SF 3NGDA 4DSLA 1QOAA 2L0TA 1K1SA 3DWGC 3PLVA 2IOFA 1BUIC 4B95A 2AL3A 4OHJA 1E0ZA 1YJJA 1KJTA 1TIFA 2JYTA 4JV0A 3LXFA 4GDLA 4YD1A 1KEJA 2IBIB 3AEVA 2L7RA 3TKAA 2BQ3A 2A1JB 3I28A 1N56A 3QWZB 2Q5WD 4F4XA 3KFUF 2KX0A 3N1XC 3LYSA 4E71A 4ANUA 3DHHC 1L0XB 4URKA 4F2RA 3N3KB 2NTSA 4F7ZA 3B0XA 2AEHA 4M2YA 5ALFA 5AI6A 1GB1A 4M9NA 5IOIA 3CMMB 2G4DB 3JPSA 2VZKB 2KNJA 5AM1A 3ZJVA 1E8XA 3GS2A 4AYBC 1LKYA 2HDOA 4GC6A 9ICEA 3ISBA 1RAXA 4Y2UA 2GLEA 2E8OA 8ICPA 5E6PA 3TACB 2JEFA 1TGZB 1KW4A 1XNSA 3D2QA 2PFNA 1ZJNA 1KDHA 3AU2A 4QW9A 3PR4A 2B76B 2KQ7A 1WWUA 1D6EC 3N7SC 4DLEA 1XS9D 1NENB 3QIJA 4YTNB 5ALMA 1X1MA 4HDQA 5ALJA 3SU8X 4QZDA 4JMUA 1S76D 4YD2A 4BBNC 5J2HA 1NZBA 1L8OA 1Z1VA 2KJ6A 5KFGA 2K8AA 4KLFA 2ZXHA 5KG7A 1V81A 2NRWA 1XEEA 3PPAA 1MQ3A 1T94A 4PZNA 5G2NA 2DKZA 3M6KA 4EX7A 3ZDTA 1Y56A 2KJ8A 4CQNA 4LNOA 1UF0A 4GDLB 3KHRA 5D3IB 2WGSA 3SHQA 3WCQA 2KANA 5DCNA 1ET9A 2PLPA 1WXAA 4OJ5A 2IBKA 2KD1A 3ALRA 1JRUA 2KDFB 1T4GA 4WWPA 1D9FA 3ZJUA 4C7YA 4GXBA 3ZDMC 2QARA 2QILA 1D8BA 4DL3A 5KG1A 2JH7A 3QZ7A 4HVBA 2VZKD 4EUTA 2LGIA 3CWIA 4FZNA 1ZE3D 2C2EA 1E6EB 4UB5A 3AEAB 2RQ5A 3AU6A 2BGFA 2FLLA 1HIWA 1RG6A 2YVCA 3RZWC 8ICGA 1L7NA 3SAHA 3SAFA 7ICRA 1LVHA 1A70A 3AEGB 2IGHA 2AGOA 4RQ8A 2PE9A 2ACZB 2ZNVC 3GZNB 4LNNA 2ZVNA 3I63C 3PREA 4TQSA 4KLQA 1L3VA 1FPYA 4OVZA 2YN4A 2M8SA 3ZUNA 1J7AA 4DL6A 1IIPA 1P1AA 1ET6A 1LO5D 4CYEA 5KFZA 5JTIA 2WF9A 1TAUA 4YSXB 4I2GA 5KFKA 3AM9A 4RQ1A 1PK3A 3TI0A 3K9OB 4FHKA 4I6PA 3AE9B 4LNIA 2ZCBA 2F8LA 3KKAA 1R4MB 3BVZA 4JUZA 4E0DA 4G3XB 4DFPA 4NY8A 3ML9A 1J8CA 3UIPB 1UA0A 5IIOA 2J7QB 2B3AA 3BQ7A 4UBCA 4BOZB 3TADC 4F91B 4RZRA 2KC1A 2KVRA 3KUZA 1VJ5A 2NPTB 1HJPA 3MC0B 2BWES 2OJWA 3U4EG 4G9BA 3H8WA 2AX5A 2PE6B 3A4RA 4EFOA 2G5IB 3F53A 2AHOB 2CN1A 4M9HA 2GOLA 3V6CB 3WIMA 1WR6E 3Q2AC 5AI8A 5KL8B 2L05A 3W2DA 3AE4B 2ZIUB 1I4RA 2J53A 3H8MA 4MFCA 4YSYB 4Y2JA 3AE1B 2N7JA 3HP6A 3M63B 4L2YA 1KTKA 3M9OB 8ICCA 2MBQA 4CO7A 1SZHA 2Z0EB 1WXQA 2KEYA 1SF0A 3QU5A 2IY0B 2WAQC 1AQ6A 1ECWA 1FEZA 2RLTA 5ALXA 3PZDA 3H4DA 4I2DA 4U7CA 4B0EA 5DPTA 3Q3JA 2GO7A 4JWUC 5C0YA 2BWFA 4QZAA 3PSIA 2K4IA 4Z6CA 2WDVB 3LWLA 3E58A 1QQ6A 3C29A 1QZEA 1OGWA 3WKCA 2HSZA 4L23A 3SD5A 4C00A 1DOYA 1ZD2P 2FCSA 4LJXA 1T0YA 3RYTA 3VCBA 1E8WA 3AUOA 5LXIB 4A9AA 4RGNA 4FZMA 1E8YA 5AICA 4DL4A 2R8HA 4B9SA 2V3PA 3KBBA 1TY2A 1EWCA 2K25A 1P7FA 5LXHA 4ZH4A 3RAQA 2K6QA 2VH2A 4RUAA 1V6EA 2RP5A 2LJIA 1N5WA 1WI0A 4U6PA 1TVAA 2RDIA 4US9A 1NK5A 5AKEA 3KYCD 1JWMD 4EOYA 4KLDA 4NLNA 2KYWA 4IM2A 4O1NA 3JSVB 2HE7A 4A55A 3S6JA 3LVVA 2Y9TA 1URJA 2K89A 4QZ8A 2ZTEA 1B43A 9ICRA 2F1HA 3Q8FA 3KHLA 3RBDA 2HD5B 1Z5SB 2HHVA 1VRAB 3JPNA 1D5MC 4UB8U 4AJYB 2UVWA 1WE6A 3ZDAA 4NJCA 2HOQA 2J0MA 3O13A 3NVZA 1Z2MA 4R64A 4I2JA 4UAYA 4PZOA 2I1QA 9ICAA 3LDZE 2K1FA 4CHKA 5AKXA 2O6VB 3VTUA 2I5HA 1XSPA 1TAQA 5AKIA 3ZDBA 1RQLA 4TUQA 1ZJMA 4IQWA 2ASDA 3IG3A 3DWMA 4GDKA 5EWFA 4CGZA 4RNAA 5KFTA 4R63A 4RGMA 1EM7A 1Z4OA 4MM3B 3RJHA 2VRRB 1Y8RC 1L6VA 3OAWA 3UIOB 5EE1A 2BS3B 1T6BX 2WXNA 4UBBA 2FDRA 1J0GA 4UQGA 1GG3A 1EU4A 2Z8LA 3MHZA 3HM3A 2FE9A 1NI2A 1TKEA 2LVQA 3H9DA 1N5XA 2RSUA 2LFIA 4ZRIA 1DK3A 5ALTA 4ICUA 1XQQA 3PHXB 4PYZA 4QWEA 2MAXA 5EE9A 3QE9Y 4BOSC 4DQOC 3IP4B 2MA9B 3DBHI 2CU3A 2ZEQA 3RFZB 2BQRA 1A76A 2RHFA 3I76A 3NUQA 3EPIA 4QJFB 2KJRA 1X9WA 2LEKA 3RMKC 1L5UA 3M9NB 2VH1A 2DWQA 2ATLA 5AHXA 3GV8B 4XDDA 3OPXA 5C3JB 2KQ4X 9ICWA 3THVA 4DXAB 3L16A 1Q0WB 5D3DA 1SBBB 1WIAA 9ICIA 1U4AA 1VLBA 1UH6A 3U7DA 4F3OA 2WXGA 1FFVA 2KHWB 2WS3B 4K7WA 2MP2A 5IN7A 3RAXA 2JZ3B 4K3CA 1DOIA 2MU2A 3ONNA 4F93B 3G6VA 2W9AA 1RPLA 1ZD4A 5J2FA 3SAGA 1TZOA 5J2CA 1R4NB 1RM6C 1ZPSA 9ICMA 1V80A 2IA6A 3LDAA 4J6IA 4NAWA 2X8XX 2D3DA 3RUIB 3RNCC 3FYHA 2XY6A 2MEKA 5C2TB 2LXAA 4M8NA 2LMCA 1V38A 2GRIA 2KAJA 3H0RB 4RNOA 1Z3EB 2YMLA 4NQLB 5ALPA 3PSEB 2CJOA 1A77A 2AQ0A 5J0XA 2ZUBA 1L0VB 1U9LA 2A3VA 2IO1B 1D5ZC 5KFOA 3TL5A 2W8KA 4EEWA 1UT5A 1ZQKA 3TMPB 5DG9A 1STEA 2ODGA 3FDSA 4WJNA 3WAPA 3JW0X 2YEPF 3DVNV 1GC6A 2JV3A 4XUSA 3V6JA 1V85A 2D3CA 4EYIB 2N9XA 3MJ5A 3M6ZA 1Q1OA 1QLBB 2L00B 4GFJA 3TAQA 3BVMA 3L10B 1FIQA 3P4PB 2UVUA 2EQYA 5KFHA 1WWTA 4W9JA 7ICHA 5H92C 2FCQA 9ICBA 2WFAA 2ZPNA 8ICEA 4P4MA 4WURA 7ICGA 4G3IA 4B9LA 4ECWA 1OTRB 3P63A 1SV4A 2OWOA 4MDKE 2ISPA 4F5PA 3H8SA 2W55A 4ARCA 5KFPA 4J03A 2SAKA 4YL8A 1OQQA 1GB4A 2XK5B 4MGZE 1F5SA 2IMWP 5J0TA 2PFPA 3KOOA 3HK0A 2C60A 5ALEA 3ZRFA 1YOVB 2F44A 1BGXT 5AIAA 1QSLA 3DBRI 2V0GA 4WIPA 2DYBA 9ICJA 2HHWA 5ALVA 4YT0B 4M8MA 1YN5A 3BJYA 1YQ3B 2PMVA 3R2IA 4BJQA 5F9LA 2LASA 1X42A 3EPGA 2VJ4A 2K4EA 2FAZA 2KJ9A 2KMAA 2V9HA 2L0FA 1KFDA 4NLCA 3ZD8A 8ICBA 4FZLA 2N0SB 3DBHB 2HCFA 3H0LB 2DNFA 4GOCA 1SXEA 2N1VA 3P1MA 1XO1A 1N62A 5EOZA 3ZXRA 1HUOA 1JN3A 2OXOA 2LM4A 4Q45A 1T7PA 8ICMA 4IR1A 3WAOA 3X0WA 3A9JB 3NOBA 1ENFA 3QHTA 2AQ2B 1TBEA 1EF5A 2C5LC 4EENA 2A1AA 2HVHA 5HR6A 3OJ4B 3LB8C 4AS1A 2D07B 3HVDA 2M0NA 2M19A 3H40A 4DXGA 4NM2A 4XZ4A 3UQBA 4PPXA 1NYRA 4WQMA 3T5KA 3JPOA 5BMHA 3BQ0A 2BDPA 1K52A 4HCNB 1U49A 8ICZA 1AYFA 2KFKB 4KLUA 5L1IA 4K81A 1NK9A 5GMVA 2K5PA 4BX9C 1L3UA 2XC9A 1KQQA 5AKZA 3QARA 2GH1A 2BW2A 3CRXA 3ONSA 2ZIWB 5J0PA 2FPLA 3P4SB 1QTMA 4KN7A 5L1LA 1FNVA 2JMGA 3PZPA 3K1RB 3LVWA 3ZXVA 1BNOA 4HPPA 1IGCA 4EZKA 4YXMA 3SD7A 1NK4A 4H2AA 5IP4D 4BKTA 2L76A 2DZJA 1S97A 1T8EA 1BPBA 2OEHA 1NJWA 3PO5A 3KWLA 2D11A 1M94A 7ICFA 2D3GA 5BPCA 2N9EB 4ECYA 4GSWA 2E6XA 3UXPA 2N9KA 3M8RA 4ZHOA 4JQWC 2KG5A 3ETLA 1MG8A 3L5KA 1HXYD 2KXJA 2RDGA 5KT3A 4EYHB 4B9MA 3BVGA 2L8JA 5ALGA 1T0QC 2H88B 2L5YA 5EE0A 1OQRA 4IQUA 3M8SA 4F5NA 2AH5A 1N2XA 4DF4A 5KFEA 2ZTDA 4ELTA 4KDLB 2JXXA 3A9KB 2MSED 1LV5A 2C9WB 2JVCA 2WWZA 4MFAA 4I2IA 4L1BA 4FJZA 2HHUA 2MX2A 2RMMA 4NPNA 1XLQA 4YR3A 3PR5B 5CP2A 2P66A 8ICUA 2D3AA 2JPHA 1TKYA 2KD0A 3QU9A 1I4QA 1CK1A 3NZSA 3P2BA 4ED0A 3SDLC 1COOA 4O3NA 3CSTA 3N1ZC 3L08A 1FNUA 4DDID 2FNJB 2NRVA 2DZKA 2HJ1A 4CE6A 1SV0C 5KTQA 4MSMB 2GBNA 3GE8C 4Q8EA 2KK8A 4MGYE 4RU9A 3GFKB 4IQTA 1R4MI 4RFBA 4JWMA 2MUTA 4P4OA 1A6SA 1TJEA 4O5EA 4Q2JA 3UMBA 2PFOA 4FBTA 1YNTE 4O3PA 2IO2B 2WF8A 3E56A 4J3OD 2L3ZA 3NTUA 3Q8AA 3ZLZA 2NCNA 3V6EB 4YSZB 4M6WB 5ALWA 2E5SA 2PFQA 1PUZA 4P0QA 2W11A 4C0ZA 2G07A 3ZNHB 5E6OA 1WGDA 2JU6X 2EH9A 1M4VA 3W1SA 2M9NA 2QHOA 2EAPA 1P98A 2O2VA 4W9IA 2XICA 2DPJA 5DPSA 2PMZF 2C2DA 3UM9A 5IIKA 1UPHA 3TFRA 3BS5A 9ICPA 1T5XD 1ZW7A 3RCZA 3UPQA 4ECUA 4NXZA 4KX5A 2YMQA 1UBQA 4GIVA 5J2EA 1TK8A 2BCQA 4DDGD 5HNKA 2CKHB 1SKRA 2EELA 3WKEA 4LVSA 4KLIA 1ISNA 5E6NA 4FS1A 2HHQA 3R2TA 2F76X 5CHVC 3PO4A 4XGAB 4MEYA 3W9CB 2HW3A 1YMHE 5AI4A 1SGHA 2ZUDA 4F4YA 1RXVA 5KFQA 4F8RA 1PK1B 3H7IA 2I9GA 3MJWA 4MH8A 3AE2B 3BINA 3HM6X 4Z6EA 2BCUA 2ZIXB 4DFJA 5HHIA 1C4AA 3OSNA 3EGRA 1JWSD 1L4ZB 2IY1B 5LNK1 4IWPA 2FPMA 3RJJA 1FRDA 3E2EA 3N7RC 1QQRA 3KLSX 2CRXA 4YXDB 5EWEA 4ED8A 5DQIA 4AP9A 8ICLA 2LKYA 3ZNID 1YX6B 3Q8MA 4QZ9A 1N60A 1HA5A 2K8BB 1WFYA 2W9MA 1D9DA 3VR9B 2W03A 3IXSA 3QEBZ 4O3RA 2JYEA 3NASA 2R8KA 3D32A 3MP9A 4R66A 3MTNB 5DB6A 2XCAA 4Y2XA 3UMCA 2K9XA 1ZQZA 3PSTA 3APFA 4F8CB 4QZBA 2QIEB 2B21A 1PVRA 4FADA 4LJOB 2VA8A 3HJEA 3DVGX 4KLTA 2IYDB 4CF4A 3OHAA 4JL9A 4RQ0A 1CJEA 1GAQB 2R8IA 4JE3B 1ZQEA 4J9LA 2K6DB 2W9CB 1BPXA 8ICIA 8ICVA 4OVVA 2NO5A 1OXJA 3EW9A 4ICAA 4IS7A 3WK7A 3RB4A 4F5OA 2BQUA 9ICSA 4OJOA 2WB1F 3RNFC 3PT2B 1T3NA 1QILA 7ICUA 3VDZA 3V6KA 4YTPB 4CDGA 2BTEA 3GV5B 5K4LA 4R8UA 4XWWA 1Q3VA 1WJUA 1ZQAA 1RWSA 4XWTA 1IGDA 1K1QA 4G11A 2G3QB 2BT6A 2JZZA 2DZMA 1RLFA 4DEZA 4PS7A 3TSSA 3VRAB 4Y2VA 3N32A 2ZXIA 2WXQA 1WRIA 4LDTD 2WB1C 3TAPA 1UGMA 4AQ7A 1TK5A 5EE3A 5J2GA 2HHSA 3LWMA 4REZA 3A0HU 2PW9A 1CUKA 2FE8A 1JX4A 4TQ0A 1JXLA 1OUQA 5B5EU 4PHEA 2CR5A 5AKYA 3H0MB 5T8IA 4Q43A 4KSLC 5JU5A 1VZ6A 4C80A 3JPPA 1XSLA 2ZZPB 5J0OA 1GO3F 2EAMA 3DBSA 5KG5A 1TYGB 1XC9A 3KH0A 1TTNA 4UB4A 3HIZA 4FJVB 4ASWC 3M95A 3Q8BA 5CHWA 4ZRQA 2A19A 5DBAA 3T5LA 2LRWA 2FLNA 2EDUA 4RNNA 3QEAZ 2F3NA 3O0FA 2R2QA 2GBMA 9ICCA 2XY7A 2OH2A 3Q8SB 2EMSA 4ECZA 2QLTA 2KTFA 8ICQA 1F2RI 2VKQA 1XCQL 1MJDA 4AYBF 3IRUA 3DPDA 4W9LA 3IN5A 4RGTA 2KVCA 5F9NA 1DOXA 1QCKA 2VANA 4YVZA 4M9GA 4YMOA 5KFIA 5KFVA 1ZXIA 4E3CA 1FEHA 1SEBD 3L0WB 5D7GA 3PZ7A 2ESEA 4TUSA 4RQ3A 2KN5A 3W5UB 1F0ZA 3ENEA 3RZFA 3PSPA 2YB4A 5BMIA 1X66A 3EZ5A 4MF8A 2KTQA 2LGXA 4MSQB 1SXDA 5KFXA 4HKQA 4O3OA 4J9NA 4KLSA 4DO9A 1NK8A 4A6QA 1Z00A 5TISU 2ZCCA 4GB9A 3Q8KA 3PVLA 2QEJC 1WE7A 2PVOD 4JK1A 2M17A 5J0SA 2N1WA 3R7QA 3D2SA 2AGQA 1U4BA 3N1YC 1ZUD2 5ALZA 1V5OA 3VVWB 1WZ3A 5ALRA 1C79A 1ESFA 4IW0A 3SEBA 2MRPA 2N1RA 4RPYA 2PI4A 2ONQA 3TANA 1CZPA 2KTRB 1V49A 4XYCA 5DDYA 4O0IA 3C1ZA 3NS8A 5J0WA 2Q0ZX 4UAWA 2W04A 5AK3A 1KLNA 4DBGA 4PL1A 3M9MB 4I6NB 3UXOA 4DFKA 2H89B 2KFKA 4FN2A 2ZJ5A 3DVGY 2NRZA 1PFDA 5J0UA 3QX7A 8ICFA 3MFIA 3NJTA 2WF7A 4K1RB 3R9KA 3WU2U 3QNMA 2MHJA 3DCGA 1L6NA 3WANA 4UAUA 2A4ZA 3T3FA 2CHWA 3C8YA 4P0QB 2R2OA 2KKVA 3HWTA 5JUMA 1IBXB 3EUB2 1RRBA 2A1JA 4FO6A 1SL1A 2V3NA 5JHAA 2JQRB 2NV3A 1OEYJ 2XGQA 2AWTA 1XU4A 2JEIA 1ACCA 1SXTA 2NBUA 3BS5B 2BF8B 3ZDDA 3HT3A 4BXOA 1WX9A 1WG8A 1LFDA 1R7SA 2W3SA 5C1ZA 7ICKA 3V62A 4EKUA 5IIMA 4YR0A 2KIWA 2GMIC 1SB3C 2RRDA 4OZAA 4DFDA 4M6WA 4DL7A 2KICA 4NM1A 3VRBB 2L83A 1YIWA 1HE8A 4QIWF 1SZPA 3RULA 2WU5B 3HKZC 4ED1A 3VHTC 2HTHA 1X6IA 4MEXA 2QJLA 2IO3B 3H7SA 1DGSA 4GU2A 3V6HA 1WJ6A 3QUCA 3GV7B 1XXGA 2ZPYA 1FNWA 1QSYA 5CWRA 1FCCC 1JQ4A 2EANA 5C5JA 2KT7A 8ICRA 3FKYA 2NTTA 1QF6A 4QWDA 4I2HA 3IT4B 3PW0A 4AP4C 2N7DA 5J2BA 4M00A 1MHHE 2FCMA 1PGBA 4BBNF 5AIBA 5KFBA 1PVQA 2RD0A 1Z19A 2DF4B 4G0NB 1DK2A 3A9KA 4CNQA 2LUEA 2WYQA 2JXTA 4DSFA 4R8UB 2ASQA 1NVID 2WDTB 2K39A 4RQMA 2OYYA 5J18A 1VD2A 4ANWA 1WY8A 4DSJA 2REXA 4NV0A 1LM8B 1E9MA 2R18A 1N61A 5KG4A 9ICUA 2JF5A 7ICTA 5DB8A 4BAXA 1JMLA 1WSPA 5AI9A 3C2LA 1IUEA 1BNPA 3Q8QB 3RRHA 1CRXA 4F92B 5DBBA 2PVGC 3C23A 2KDIA 4QZCA 4A3OA
chains in the Genus database with same CATH topology
2Y5CA 2ZW0A 2IGGA 4R3DA 1DGJA 2JWUA 4EE2A 3GB1A 2WXOA 4N58A 3VR8B 3ZQ4A 4ARIA 2HDEA 2YEPB 2V0GA 4WIPA 4LK0M 1D5XC 2BYTA 2AQ1B 3VQIA 4ZOHC 4YT0B 1YN5A 2DBYA 1YQ3B 2PMVA 3Q8EA 2JX5A 3R2IA 1XLPA 4XE0A 2SEBD 4ITKA 1JCKB 2N0SB 3BK1A 4YTMB 1PDXA 2J42A 4ZHPA 1C9FA 3AECB 3SFDB 3P1MA 1N62A 2N9LA 4HRSA 4YWGG 1PGAA 3B2GA 1XCTL 1ENFA 2WXJA 1RYJA 1C76A 2AQ2B 1I4XA 1KFYB 1VZ7A 2BS2B 3ABVB 3LB8C 3GP7A 1YN4A 4AS1A 2WXLA 2LUMA 3SFEB 4NAWB 3CIRB 3HVDA 3T3OA 1SE4A 1QOBA 2M19A 4WWMA 1JRPA 4DXGA 3T3NA 4OW0A 1NYRA 2DYOA 4WQMA 2W82A 4IDIA 5BMHA 1K52A 2EKIA 1PGXA 1AYFA 4JX1C 2QMTA 4LLGM 3N9YC 5GXGB 2KMMA 2K5PA 1UUPA 1NEKB 2KDMA 3FILB 4PT5A 3U7ZA 2BW2A 2DLBA 1HZ5A 5HFYA 3P4SB 1QOFA 1ZDVA 2K3UA 1D4BA 1FNVA 4KKJA 1IGCA 1HEZE 4H2AA 1TKGA 1CQVA 2IPKD 1FCLA 2WXFA 3KWLA 5E6JA 3ZGZA 2LHDA 4P6VF 3NVWA 2E6XA 2N9KA 2OEDA 4RF0A 4ZHOA 1WGKA 1I4GA 3P4RB 4OZBA 1RFKA 1HQRD 1GPXA 1FXAA 1UWMA 1V1PA 1HXYD 1NI3A 2RDGA 3BVGA 3P4QB 2H88B 2Y5PA 5EE0A 1OQRA 3HVZA 4TQ1A 2LHEA 4TSSA 4WAFA 2Y3AA 1UWXA 4L1BA 3TEXA 3U2SC 2BS4B 1Q10A 5TSSA 3URYA 2RMMA 1I7HA 2D5GA 1XLQA 2JSVX 3AE6B 5H8YE 1XLNA 2KN4A 1SIJA 1TKYA 3H8HA 1JWUD 3MFGA 2PIAA 5HI1A 5BYQA 1I4QA 1CK1A 1MVKA 1TS2A 4N59A 3R8BA 3FAHA 2GI9A 4KGRA 4A90A 2I38A 3FC4A 1FNUA 2L32A 1K53A 2WDRB 2BBCA 1QKZA 3RPFC 1SE3A 1TY0A 3AH7A 3BZDB 4NAMA 1KLUD 3IT6B 1QOAA 4XDCA 3BYTB 3DWGC 4RFBA 1E0ZA 1BUIC 2XNAC 1MPEA 4OHJA 4RH6A 1YJJA 1TJEA 1PUTA 2JYTA 4Q2JA 1YNTE 2IJ0A 3LXFA 4J3OD 3E56A 1XLOA 1I4HA 3Q8AA 1K51A 2QSDA 4YSZB 1JWAD 2AQ3B 2Q5WD 1C78A 1L0XB 4RF1A 2NTSA 1KLGD 2JU6X 4OZCA 3W1SA 1M4VA 1GB1A 3I9V1 1EWYC 1FXIA 2VZKB 3UI3A 3ZJVA 2CJNA 3GS2A 1GB4A 5HG2A 1T5XD 3W5VB 2HTME 3U52E 2EELA 1ZXHA 1AN8A 2B76B 2JZPA 1YJIA 1D6EC 3R2TA 1IBXA 1NENB 4YTNB 1L5PA 1MI0A 3W9CB 3HUIA 1YMHE 3AB5A 3AE3B 1FD6A 3NVVA 2W3RA 1AWDA 1XEEA 4MH8A 3AE2B 1V8CA 1E10A 3NRZA 1WYGA 4N6EB 2L52A 1C4AA 1Y56A 5HHDG 4CQNA 3EGRA 1JWSD 1L4ZB 4GDLB 5FR3A 5D3IB 5LNK1 3WCQA 1V1OA 5G5HA 1QQRA 3KLSX 1FRDA 2MJDA 4YXDB 4LTUA 2V4IB 2WXMA 3AMZA 1ET9A 2PLPA 3SR6A 4HKZE 4JPSA 3ZJUA 1N60A 4C7YA 1HA5A 1L0YB 2QILA 3VR9B 3IXSA 2IDYA 2JYEA 2G9HD 4IOIE 3MP9A 1L4DB 1QT9A 2VZKD 2K9XA 1FO4A 2LGIA 3CWIA 2M56B 4C56C 1ZE3D 2QIEB 4M0WA 1E6EB 3AEAB 1GAQB 1CJEA 4JE3B 3TEWA 4C7ZA 3Q69A 1ROEA 3ETRA 1A70A 3AEGB 5AUIA 4HJGE 2IGHA 4HROA 2ACZB 2PTLA 3AV8A 3NZ3A 4OVZA 1JWBD 1J7AA 1QILA 2RPVA 3IAM1 1NYQA 4YTPB 1ET6A 1LO5D 2BTEA 3V3XA 1C4PA 4YSXB 4XWWA 3AM9A 4RCOA 1VDVA 3AE9B 3PO0A 1RWSA 3Q8CA 2W54A 4XWTA 3NUHB 3BVZA 1KH0A 1IGDA 1TS4A 3FILA 2BT6A 3KQ4A 1XF5L 4MT5A 4RGOS 3TSSA 3V05A 3VRAB 3ZJTA 2K22A 2WXQA 1BXTA 1WRIA 3TEYA 1QOGA 1FFUA 1P7EA 2ICIA 4AQ7A 2KACA 5EE3A 3MC0B 4REZA 2PW9A 5MPOA 5G5GA 2WXIA 1ZP0B 2FE8A 3U4EG 4TQ0A 2AX5A 5T8IA 5JXVA 1VZ6A 4C80A 1SE2A 1B1ZA 1J7BA 2TSSA 3W2DA 3AE4B 1I4RA 2J53A 1T3QA 4YSYB 1KRHA 1TYGB 2WLBA 3AE1B 2N7JA 2E3TA 4WH4A 3AE5B 3P42A 4L2YA 1KTKA 2RDHA 5FK9C 1WXQA 3Q8BA 1BMLC 1SF0A 4ZRQA 5BMGA 1B9RA 3NS1A 1L6UA 3BYYB 5BYSA 2FBWB 4GDKB 5I4DA 4B0EA 4JWUC 3EA6A 2WDVB 1F2RI 2GB1A 1XCQL 1UNSA 4L23A 1DOYA 1FRRA 5FKAC 2K0PA 4RGTA 1FM0D 4A9AA 1DOXA 2BB6A 4RGNA 1DYQA 1ZXIA 1ZOYB 1FEHA 1SEBD 5D7GA 2V3PA 1TY2A 2I2YA 1EWCA 3PZ7A 1P7FA 2J52A 1F0ZA 3W5UB 2LJIA 5BMIA 1N5WA 4P16A 3TEZA 4US9A 3AE7B 4HKQA 4NZLB 2WDQB 1JWMD 4A6QA 4US8A 4ZYSA 4IKGA 4O1NA 4A55A 1C77A 1FMAD 2INNE 3Q8FA 2QEJC 2PVOD 3AEDB 1SSNA 4KGTA 1VRAB 1ZUD2 1D5MC 1OFFA 3OWEB 4D2KA 4NJCA 3KWVA 3BK2A 3NVZA 3O13A 2BB5A 1C79A 1ESFA 1XO3A 3B2FA 3SEBA 1E7PB 2WU2B 2ONQA 1N63A 3E9SA 1CZPA 4KGSA 2ZW1A 1UGJA 2XN9C 3DWMA 4RNAA 1MHXA 1V97A 4RGMA 1EM7A 4MM3B 1VJKA 3ZYYX 1HZ6A 1L6VA 4KKIA 5EE1A 2BS3B 1T6BX 2H89B 2WXNA 3AEFB 3TUOA 1TS3A 2WP9B 1PFDA 1VR9A 1EU4A 2Z8LA 3MHZA 1I4PA 1TKEA 2INPE 4GLSC 1N5XA 2LFIA 2ON8A 3AEEB 1KF6B 1JROA 2OHFA 3C8YA 5EE9A 2NMQA 3BIID 1IBXB 3EUB2 4DQOC 2CU3A 2V3NA 1ZDXA 3IAS1 3RFZB 2JQRB 2WXHA 2R61A 2LEKA 3B9JA 2WQYB 1SJHD 2DWQA 2FUG1 1ACCA 1SXTA 4XDDA 1SJED 5C3JB 2KQ4X 1R7SA 4KX6B 2W3SA 5D3DA 3AN1A 4B0MA 1SBBB 1VLBA 3I57A 4USAA 2WXKA 2WXRA 1SB3C 4JWSC 2WXGA 4MACA 1TS5A 1FFVA 2IGDA 4OZAA 2WS3B 4HEA1 3VRBB 2L83A 2WU5B 1DOIA 3AE8B 3J9CA 2MJEA 1TZOA 2G1EA 2QJLA 1RM6C 1PYWD 1ZPSA 2L1AA 1XXGA 1FNWA 1FCCC 1JQ4A 2MEKA 5C2TB 1YQ4B 1F77A 2NTTA 2LMCA 2GRIA 3IT4B 1QF6A 2KAJA 3LYYA 2X38A 1V1PB 2CJOA 1L0VB 1D5ZC 1MHHE 1PGBA 1EU3A 1STEA 4UDUC 2J4XA 1AW7A 4A8XC 4FXCA 1JALA 2YEPF 2WNMA 3AEBB 4DXFA 2PKOA 1F2RC 1GOZA 2JXTA 1NVID 3MJ5A 5AUKA 1QLBB 1C4CA 3BVMA 3P4PB 1FIQA 2MJ3A 2DYMA 3HRDD 3L4PA 1E9MA 1N61A 1WWTA 5H92C 2WXPA 3BWUD 4WURA 1K50A 5BYRA 1JMLA 1WSPA 1YN3A 3P63A 4ZRPA 1IUEA 1JW9D 2PVGC 2W55A 1J7CA 2MH7A 3NVYA 4TMAB 4ARCA 2SAKA 1OQQA 2M0AA 1VZ8A 2KWDA 3PZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y5C A;  1VJK A;  3RPF C;  1JWB D;  3ZYY X;  1DGJ A;  1J7A A;  1L6V A;  1NYQ A;  4YTP B;  4N58 A;  3AH7 A;  5EE1 A;  2BS3 B;  2H89 B;  3VR8 B;  3AEF B;  4YSX B;  3AM9 A;  1QOA A;  1PFD A;  2WP9 B;  3DWG C;  1VDV A;  4ZOH C;  3AE9 B;  1RWS A;  3PO0 A;  2W54 A;  1YQ3 B;  2DBY A;  4YT0 B;  1E0Z A;  1YJJ A;  1TKE A;  1XLP A;  1TJE A;  1N5X A;  1PUT A;  2JX5 A;  3AEE B;  3LXF A;  1KF6 B;  2BT6 A;  1JRO A;  3VRA B;  2OHF A;  1XLO A;  2K22 A;  4ITK A;  2N0S B;  3AV8 A;  5EE9 A;  4YSZ B;  1PDX A;  3BII D;  1JWA D;  1WRI A;  2Q5W D;  3AEC B;  4YTM B;  3SFD B;  3EUB 2;  3P1M A;  4ZHP A;  1N62 A;  2CU3 A;  1QOG A;  1FFU A;  2JQR B;  4HRS A;  3B2G A;  5EE3 A;  2LEK A;  1RYJ A;  3B9J A;  2WQY B;  5MPO A;  1KFY B;  2DWQ A;  5G5G A;  1EWY C;  1FXI A;  1ZP0 B;  2BS2 B;  5C3J B;  3ABV B;  2AX5 A;  2CJN A;  3LB8 C;  4C80 A;  1R7S A;  3SFE B;  4KX6 B;  2W3S A;  1J7B A;  3CIR B;  3AN1 A;  2M19 A;  1QOB A;  4WWM A;  1JRP A;  3W5V B;  3AE4 B;  2HTM E;  1NYR A;  1VLB A;  1T3Q A;  4WQM A;  4YSY B;  4USA A;  1KRH A;  1TYG B;  2WLB A;  1XLN A;  3AE1 B;  2E3T A;  4IDI A;  3AE5 B;  2EKI A;  1SB3 C;  2B76 B;  1AYF A;  4JWS C;  4JX1 C;  1FFV A;  5GXG B;  1YJI A;  1WXQ A;  1NEN B;  1SF0 A;  2WS3 B;  2KMM A;  1L5P A;  2L83 A;  2K5P A;  3NS1 A;  1NEK B;  1L6U A;  4YTN B;  2WU5 B;  3W9C B;  1DOI A;  3HUI A;  3AE8 B;  2MJE A;  2G1E A;  3AB5 A;  2FBW B;  3AE3 B;  2QJL A;  1RM6 C;  3P4S B;  1QOF A;  3NVV A;  2W3R A;  1AWD A;  4JWU C;  3AE2 B;  1V8C A;  2WDV B;  1E10 A;  3NRZ A;  1WYG A;  1JQ4 A;  5C2T B;  4N6E B;  1YQ4 B;  2L52 A;  1QF6 A;  2KAJ A;  1DOY A;  1FRR A;  1TKG A;  2CJO A;  3WCQ A;  5G5H A;  1FM0 D;  1FRD A;  1L0V B;  3KWL A;  4A9A A;  2MJD A;  4YXD B;  1DOX A;  4LTU A;  1ZXI A;  1ZOY B;  3AMZ A;  3NVW A;  4P6V F;  3SR6 A;  1F0Z A;  3W5U B;  4ZHO A;  3VRB B;  1WGK A;  3P4R B;  1N60 A;  4C7Y A;  1RFK A;  1GPX A;  1FXA A;  1N5W A;  1UWM A;  1JAL A;  4FXC A;  3VR9 B;  3AEB B;  4US9 A;  1NI3 A;  3DWM A;  3AE7 B;  2PKO A;  2WDQ B;  4US8 A;  3P4Q B;  2H88 B;  1QT9 A;  1NVI D;  1FO4 A;  2K9X A;  1OQR A;  1QLB B;  2M56 B;  3CWI A;  1FMA D;  3P4P B;  5EE0 A;  5AUK A;  1FIQ A;  2PVO D;  2QIE B;  2MJ3 A;  3HVZ A;  3AED B;  3HRD D;  3L4P A;  1E6E B;  1N61 A;  1E9M A;  1WWT A;  1ZUD 2;  3AEA B;  5H92 C;  1OFF A;  2BS4 B;  3NVZ A;  1I7H A;  1XLQ A;  3AE6 B;  5H8Y E;  1XO3 A;  3P63 A;  1IUE A;  3B2F A;  1E7P B;  1CJE A;  1JW9 D;  1SIJ A;  4C7Z A;  1GAQ B;  1ROE A;  1TKY A;  3ETR A;  1A70 A;  2PIA A;  2WU2 B;  3AEG B;  1N63 A;  5AUI A;  1CZP A;  2PVG C;  4N59 A;  4HRO A;  1B9R A;  2W55 A;  3FAH A;  1J7C A;  3NVY A;  2ACZ B;  2MH7 A;  3FC4 A;  1OQQ A;  2WDR B;  1V97 A; 
#chains in the Genus database with same CATH topology
 2Y5C A;  4EX6 A;  3WK8 A;  3ZDC A;  4QWB A;  4B9K A;  4FHJ A;  2MBB B;  3VXW A;  4N58 A;  3ZQ4 A;  2JZB B;  3DQV A;  2YEP B;  2EKE C;  1D5X C;  3PGE A;  4LK0 M;  3VQI A;  4ZOH C;  5J8Y A;  5IAA C;  2DBY A;  2AL6 A;  1ZQW A;  4W9E A;  1V86 A;  2SEB D;  5AI0 A;  4ECX A;  1ZD5 A;  4YTM B;  2J42 A;  1C9F A;  3QU4 A;  3DBR B;  3SFD B;  2DFL A;  1KBU A;  2DPI A;  3SMV A;  4IQV A;  1PGA A;  2KMD A;  2HHT A;  3B2G A;  3OG5 A;  5TR5 A;  4KV2 A;  4DSE A;  1XCT L;  4IC9 A;  2WXJ A;  3QK0 A;  1YT3 A;  2BCS A;  1VZ7 A;  1S9F A;  2G08 A;  4UAS A;  4C4V B;  3PSF A;  4P4P A;  2KKC A;  3GP7 A;  1YN4 A;  1S0N A;  5KFS A;  5IIL A;  3H8J A;  1WMH A;  2KWV B;  2CPR A;  1SE4 A;  1QOB A;  4NJ6 A;  5AK6 A;  4OW0 A;  3M1Y A;  5AM3 A;  3LK9 A;  3MDA A;  2MUT B;  1T0R C;  1MG4 A;  2EKI A;  5KHO A;  2MBE A;  1PGX A;  3IG5 A;  4NWI A;  3V7J A;  5AM0 A;  4DQS A;  1C7Y A;  1PZN A;  5BOM A;  4K4H A;  5GXG B;  5AI5 A;  3LJ3 A;  2FMQ A;  2KMC A;  4BKG A;  3AU4 A;  4RM8 A;  1UUP A;  2FI1 A;  1NEK B;  4A20 A;  3KKA C;  3FIL B;  3MGH A;  4PT5 A;  3U7Z A;  4EEL A;  5KT7 A;  2JH1 A;  3N28 A;  5KFN A;  2DLB A;  3VUX A;  5ALY A;  2YLM A;  4M0W B;  5KHQ A;  4PHD A;  2GBJ A;  3H7P B;  2IOH A;  1WXV A;  5AM4 A;  4MF2 A;  3APC A;  1Z1B A;  4HXD A;  2H3F A;  2O6V D;  2RDB C;  1CQV A;  4W9C A;  5L83 A;  1CEZ A;  4F4W A;  2KLG A;  4M04 A;  1J97 A;  5T14 A;  2LHD A;  1ZQV A;  1S8O A;  3NVW A;  3WK5 A;  3BDP A;  2LXC A;  2OED A;  3P4R B;  1I4G A;  3DBL I;  1HQR D;  4K7S A;  4O5K A;  4AJW A;  1V1P A;  3A9J A;  2PJH A;  2ASJ A;  1NI3 A;  5DKW A;  3P4Q B;  5ALN A;  5KFD A;  2Y5P A;  4M9L A;  1UD7 A;  3DHG C;  3KUD B;  1U47 A;  3EFC A;  3HVZ A;  3M7D A;  3PNC A;  4TSS A;  2Y3A A;  4EEY A;  2Y1J A;  1UWX A;  2WX0 A;  5HKH A;  9ICF A;  3L13 A;  1Q10 A;  2F1J A;  5D6J B;  2NPT A;  5J2R A;  2K8H A;  2I6X A;  3KVF B;  1I7H A;  2D5G A;  4HPM B;  5H8Y E;  3URY A;  7ICS A;  2F77 X;  1GC7 A;  1JWU D;  3H8H A;  3MFG A;  5AZF A;  2YMM A;  2UVR A;  1TS2 A;  3TFS A;  4DOC A;  3T8M A;  1D8Y A;  3R8B A;  5KFC A;  3PW2 A;  5AM5 A;  5KFR A;  1HUZ A;  2K8C B;  3FC4 A;  4KGR A;  4A90 A;  4K4G A;  2BBC A;  2K4H A;  2RGF A;  3RPF C;  1SE3 A;  1Y88 A;  1XO0 A;  4OD0 A;  2ZUC A;  2KOB A;  2LVP A;  3IT6 B;  4I27 A;  4XDC A;  3TJP A;  4KLH A;  1TAM A;  1MPE A;  4RH6 A;  1QLN A;  2D2Q A;  1PUT A;  2NRT A;  3KZI U;  2MQJ A;  5J2D A;  1XLO A;  2ZIX A;  5ALL A;  3KHH A;  1K51 A;  2QSD A;  1JWA D;  1E7V A;  2IZV B;  3QA8 A;  4DS5 A;  3JPQ A;  3RJG A;  3QYP A;  4RF1 A;  3A1Q B;  1L7O A;  3QUT A;  4OZC A;  8ICH A;  2LMR A;  4HPL B;  4W9K A;  2JXJ A;  1EWY C;  1X2I A;  4ACO A;  2CJN A;  4MEM A;  3F5E A;  1S10 A;  1DXS A;  4JV2 A;  2HTM E;  5IIJ A;  1N48 A;  3U52 E;  4A3P A;  1F1H A;  1V9P A;  5J2A A;  5DB9 A;  4NJ8 A;  4O3Q A;  2KK0 A;  2JZP A;  1YJI A;  1IBX A;  2EAO A;  5KAF U;  4HYK A;  2ASL A;  1L5P A;  4WJQ A;  1MI0 A;  3ALB A;  5GTI U;  2OCE A;  3HUI A;  5AK4 A;  1ZQF A;  4TUR A;  3AB5 A;  4KSK C;  2XGP A;  3N20 C;  1FD6 A;  3MC9 A;  2EMT A;  2W3R A;  4C8K A;  3GE3 C;  1V8C A;  1E10 A;  3NRZ A;  2LJ5 A;  4N6E B;  1UBI A;  4MM3 A;  4YFK A;  3TQ1 A;  5FR3 A;  5G5H A;  2MJD A;  2WTF A;  4YCX A;  4LTU A;  2V4I B;  2WXM A;  1K5O A;  3AMZ A;  2KVZ A;  3I5J C;  4ICV A;  3NHE B;  3SR6 A;  5AKK A;  3IVF A;  5CX3 A;  4WJO A;  1L0Y B;  1ZQL A;  4ED6 A;  2IDY A;  2G9H D;  3C21 A;  4EBD A;  1L4D B;  1SKS A;  1LB2 B;  1LKY B;  1FO4 A;  3OJ3 A;  4QNL A;  4WQO B;  3RNA C;  4KZC A;  5KFA A;  2DKX A;  4DQR A;  2IOF K;  2D3B A;  4M0W A;  2N9P C;  1M6Y A;  1IV8 A;  4UW9 A;  2W7O A;  5AM2 A;  3QZ8 A;  2J0J A;  3NG0 A;  4Y2T A;  3J81 j;  4DQP A;  3B08 A;  3VTW A;  1ZET A;  4QWA A;  4MJS B;  1ZQX A;  5CR0 A;  2J6U A;  3ETR A;  2KFN A;  5DQH A;  2HHX A;  4HJG E;  4HRO A;  1ZQT A;  2HVI A;  2YX8 A;  4FBU A;  3VC8 A;  1NKB A;  5DLF A;  4O9M A;  4GIB A;  3HW8 A;  2HOI A;  5KL1 B;  3C28 A;  1COK A;  1NZP A;  1JWB D;  2RPV A;  4F1S A;  3N30 A;  3MDC A;  4M01 A;  1C4P A;  3W1Y A;  1YQB A;  4BZA A;  4J9R A;  4ED2 A;  1VDV A;  3MC8 A;  3Q8C A;  2AYO B;  2V9W A;  4RCO A;  4ECT A;  2IHM A;  4YMN A;  2Q4T A;  1KH0 A;  1L2N A;  4A8E A;  3KQ4 A;  4MT5 A;  3ZJT A;  2J6T A;  1KFT A;  4TKN A;  1UEL A;  2K22 A;  2LHT A;  3B0A A;  1E5W A;  3O65 B;  3A33 B;  2LM1 A;  4DLG A;  4B6W A;  3TEY A;  5KNI A;  1MN8 A;  3ICX A;  2YY6 A;  1FFU A;  2BKF A;  1P7E A;  3X23 A;  4DHJ D;  2KAC A;  2NRX A;  3L54 A;  2LGS A;  5AZH A;  2GBR A;  1L3S A;  5MPO A;  2ZG6 A;  5J29 A;  7ICP A;  9ICV A;  3W1S C;  2WXI A;  1ZP0 B;  4O5C A;  4EZ9 A;  4LZG A;  4IWQ A;  4MHV A;  4J9P A;  1WJN A;  4W9F A;  1ZQN A;  4DWF A;  1B1Z A;  2YMP A;  7ICL A;  2TSS A;  2BGW A;  1XWL A;  3IM1 A;  4NL9 C;  4GXJ A;  5L9X A;  4J9K A;  3CNH A;  3RR8 A;  2WLB A;  2E3T A;  3CF6 E;  3AE5 B;  4WH4 A;  4ED7 A;  2R8J A;  3IHP C;  1YZ7 A;  1D3Z A;  3OGU A;  5KAI U;  1P7D A;  4LNF A;  3ZNZ B;  1WGR A;  5FK9 C;  3R7R A;  1BML C;  1CMX B;  1L7P A;  3QU7 A;  4WWO A;  5BMG A;  3NS1 A;  3BYY B;  3U26 A;  3ZD9 A;  2E8P A;  4GLX A;  2PXI A;  1ZQD A;  3Q14 C;  1QQ7 A;  2FBW B;  2KQS A;  1N6Z A;  4GDK B;  5C23 A;  5I4D A;  3L3F X;  4ECV A;  1IYF A;  3IG8 A;  2EZX A;  3EA6 A;  2Z59 B;  5J2K A;  2DAJ A;  2JY6 A;  3WK6 A;  2EZY A;  3QUB A;  3HHM A;  4NLK A;  1FRR A;  2KZR A;  5DGA A;  4C8N A;  3MFH A;  2EZZ A;  2JRH A;  1SV0 A;  3RJF A;  2W9C A;  2MLB A;  4XA5 A;  5CHG A;  4DSK A;  3PS6 A;  2I2Y A;  3DDC B;  2B6G A;  3I3T B;  2JRZ A;  1SIF A;  2BVC A;  4ECQ A;  3JSV A;  4P0P B;  1Q3U A;  2I1J A;  2JRI B;  1IP9 A;  2R8G A;  4P16 A;  2KC2 A;  4OO1 J;  2AXT U;  2M0X A;  2CS4 A;  4P2H A;  3TEZ A;  2WDQ B;  3SEN A;  2BHN A;  2RR9 A;  4PGY A;  4IKG A;  3WA0 A;  1F0M A;  3WKA A;  1E90 A;  1FMA D;  4RNM A;  2INN E;  3Q3F A;  2HJ8 A;  2V4L A;  2A5U A;  4ECS A;  1SSN A;  3C0R B;  4J9Q A;  4KGT A;  7ICN A;  1OFF A;  3OWE B;  3ML8 A;  3KWV A;  2ZTC A;  3PHW B;  2BB5 A;  2NVU I;  1E7P B;  1C3T A;  1GJZ A;  3PX6 A;  2CHX A;  4B6J A;  2WU2 B;  1N63 A;  1X6J A;  3E9S A;  4O3M A;  1X9S A;  4FUL A;  2K4P A;  2IND C;  2DGZ A;  7ICJ A;  2F8K A;  4DOA A;  2W9B A;  1V97 A;  4RQN A;  3WKB A;  3GU3 A;  3ZYY X;  1A5R A;  3PX4 A;  7ICO A;  4C8M A;  4KKI A;  1WX7 A;  5KG2 A;  2V1Y A;  4FLH A;  3DDH A;  4PHP A;  1ZQS A;  4EBC A;  3G6X A;  1TS3 A;  2F1I A;  4UAV A;  2WP9 B;  1VR9 A;  4E74 A;  2J0K A;  4ZYN A;  1I4P A;  3V7K A;  4S0R A;  3TAR A;  1EXN A;  2KNB A;  1KF6 B;  1HEK A;  1JRO A;  2OHF A;  4DL5 A;  3DEE A;  1Q46 A;  4I2B A;  2NMQ A;  1ZDX A;  4DHJ B;  5D94 A;  3A4S C;  3Q3M C;  4IL6 U;  2WXH A;  3U8Z A;  2R61 A;  2IHN A;  2WQY B;  4BWM A;  3OLM D;  1SJE D;  3ZIM A;  1E8Z A;  4W9D A;  4F72 A;  2D6F C;  4CF5 A;  3ECI A;  2FPK A;  2O2V B;  1F9J A;  2VA3 A;  2YTU A;  2PI5 A;  2BPF A;  1B22 A;  3KYD D;  3OHB A;  4KX6 B;  3A0B U;  3AN1 A;  2FMP A;  4HCP B;  3PRM B;  3I57 A;  1KOT A;  2WXK A;  4QW8 A;  1TV9 A;  3GIJ A;  4PJ0 U;  4MAC A;  1BVS A;  1TS5 A;  4BXO B;  3ED5 A;  4B9V A;  3CP8 A;  5D49 A;  3RF9 A;  3J9C A;  2MJE A;  4NL9 A;  2NO4 A;  2G1E A;  1RYR A;  1YZ6 A;  2L1A A;  5TZV A;  4P0P A;  8ICO A;  2KHV A;  5E79 U;  4M47 A;  3PV1 A;  3VUY A;  3AQE A;  3VTV A;  4NNJ B;  2WF5 A;  5IIN A;  3AUL A;  4UB6 U;  1O08 A;  3GZF A;  1HTQ A;  3DHI C;  2LI6 A;  4KIT B;  1ZQG A;  4M02 A;  3DBL B;  1NJY A;  3SQI A;  1UA1 A;  1EU3 A;  2BKR B;  2BYV E;  2J4X A;  1AW7 A;  1ZQH A;  4A8X C;  3GQC A;  4FXC A;  3L17 A;  4JWN A;  2WNM A;  4ANV A;  5CJ7 A;  5L1J A;  4DXF A;  3WK4 A;  2PKO A;  2JHD A;  5G55 A;  5BO4 B;  9ICN A;  2MW5 A;  3IBE A;  4EZL A;  3SZ2 A;  5AUK A;  1C4C A;  4XX5 A;  1WR1 A;  2DUY A;  2XVT A;  4NJ7 A;  3PW5 A;  2DYM A;  3HX0 A;  1ZQ1 C;  2E8M A;  5L1K A;  5BYR A;  1S0V A;  3MHS D;  3PV8 A;  4ANX A;  4F5R A;  1JW9 D;  4NY0 A;  3T5H A;  4FJY A;  3MR6 A;  4JIO U;  1J7C A;  2MH7 A;  3NVY A;  3Q8L A;  2AJQ A;  2M0A A;  2Y9U A;  3PZ8 A;  1R4N I;  3R3M A;  3MR5 A;  4O3S A;  4EEK A;  2KX3 A;  4TQR A;  4R3D A;  4EE2 A;  5DLG A;  7ICM A;  4ELV A;  2WXO A;  2O6V A;  3DV9 A;  1TE2 A;  3S2A A;  2QC8 A;  2AQ1 B;  2NR2 A;  3AU5 A;  8ICT A;  3RJI A;  4WWN A;  2JX5 A;  1YD8 U;  7ICE A;  1XLP A;  4XE0 A;  2PMZ C;  5KT6 A;  2HOF A;  4FFD A;  1RDF A;  2C7H A;  4GN1 A;  2BPS A;  4ZRJ A;  5JRT A;  4IRD A;  2G45 B;  1LGR A;  2HBK A;  3QUQ A;  1JCK B;  4ITK A;  1KTQ A;  2JZB A;  5J2J A;  2F2A B;  1P3Q U;  2NS5 A;  8ICX A;  4KLM A;  2N9L A;  4GMV A;  4RQ4 A;  4NLG A;  8ICS A;  2KJ5 A;  1C76 A;  4KZ0 A;  3HIL A;  4YP3 A;  2BZF A;  4YQW A;  4CRX A;  3TCA A;  3MR2 A;  3RH5 A;  3PRP B;  3VH3 B;  3SFE B;  3ZDE A;  4DHZ E;  3G6Y A;  4JV1 A;  3CIR B;  3GIM A;  4M0A A;  4WWM A;  2H3I A;  3T3O A;  1KKX A;  3T3N A;  2ZNV B;  2C2R A;  3EC8 A;  2W82 A;  3EWA A;  4IDI A;  2Y0S C;  4LCD E;  1AAR A;  2QB1 A;  3PML A;  3F2B A;  5L95 C;  2N7E A;  2C7N B;  4JX1 C;  2QMT A;  3ZNG C;  5CHF A;  3N9Y C;  5J17 A;  4QAY A;  4RPZ A;  2Z7J A;  3B0Y A;  2XCP A;  2RDJ A;  3BY4 B;  2FUH B;  2KSO B;  5DG8 A;  3C19 A;  2KZZ A;  3BQ2 A;  4BGD A;  2M1M A;  4S17 A;  4DS4 A;  1JUD A;  5HFY A;  5HR7 A;  3MBY A;  4RT3 A;  1UHU A;  1FXT B;  3VUW A;  2MSN A;  2H3V A;  4FA6 A;  1A0P A;  1WF9 A;  1SKW A;  2LWP A;  1NK7 A;  1QSS A;  2ZIW A;  2BPG A;  2NBW B;  4RPX A;  3H1U A;  3KTQ A;  3IHQ B;  2WXF A;  2HBL A;  2PEA A;  1ZD3 A;  5E6J A;  3ZGZ A;  4YG2 A;  4KX3 A;  4RQ6 A;  4P6V F;  1ED1 A;  2D8C A;  5ALH A;  4UB1 A;  5HHH A;  3N4M B;  4BWJ A;  2ES6 A;  1WGK A;  4I2F A;  1RFK A;  1FXA A;  2WX1 A;  5KT4 A;  1ZQP A;  2BR0 A;  4DQI A;  4I28 A;  3ISC A;  1ZQR A;  3I1Y A;  3UIN B;  2KKP A;  3KW5 B;  1SWW A;  5DGB A;  4QZF A;  2KDB A;  2YQE A;  1WCN A;  1U48 A;  4YXJ A;  4TQ1 A;  5J8Y C;  2LHE A;  5D46 A;  4OJP A;  5H2F U;  2ZIV A;  3TEX A;  3U2S C;  2BS4 B;  2KZ3 A;  3RNE C;  8ICN A;  5IKC M;  2JSV X;  3EFU A;  1PVP A;  2C22 A;  3Q3N C;  2P35 A;  1SIJ A;  1K8R B;  4ELU A;  5HI1 A;  2PIA A;  5BYQ A;  2JUO A;  4RQ2 A;  5KFM A;  1MVK A;  1S1Q B;  4N59 A;  5KFW A;  2H3Q A;  3FAH A;  3KUC B;  2I38 A;  2QB0 A;  4UAZ A;  3HPO A;  1K53 A;  1WGY A;  2L32 A;  5ALO A;  5DG7 A;  1U45 A;  2LPE A;  3HKZ F;  5KFL A;  4BVU C;  2WHE A;  4KIK A;  3AH7 A;  1DRG A;  2P6U A;  7ICI A;  3BZD B;  3QAQ A;  1KLU D;  3BS7 A;  2WHI A;  1Z00 B;  3BYT B;  2XNA C;  3IDW A;  2IJ0 A;  4OVU A;  1QH9 A;  3SEI A;  1RFA A;  2WAQ F;  4HAI A;  1BT0 A;  1C1Y B;  1I4H A;  2MP2 B;  4W9H A;  2AQ3 B;  5KT2 A;  1C78 A;  1I35 A;  3Q3O C;  4AOF A;  3CSF A;  5KT5 A;  1KLG D;  1DOQ A;  4FE3 A;  4UAR A;  3I9V 1;  2W8L A;  1FXI A;  2KTR A;  3UI3 A;  2G06 A;  2C7M B;  3FM9 A;  1WM2 A;  4F71 A;  4PGX A;  1MSW D;  1F52 A;  1JMS A;  4FBJ B;  1IXR A;  1ZQB A;  3RB3 A;  5HG2 A;  3RI7 C;  8ICA A;  2AU0 A;  3W5V B;  2ZIV B;  5B66 U;  1MFW A;  1ZXH A;  4F5Q A;  4JB3 A;  3RD2 A;  1X9M A;  2JGA A;  3RNG C;  2KE7 A;  1AN8 A;  1Q8K A;  2BPC A;  4QWC A;  4DCC A;  3UQ0 A;  3EHV A;  3Q8R B;  4EZ6 A;  1WH3 A;  5A0L A;  4ACF A;  5GTH U;  2JR5 A;  2KVS A;  2LBO A;  2BCR A;  2INC C;  3RT3 B;  3PW7 A;  3AE3 B;  5III A;  2DX5 B;  9ICX A;  1SE9 A;  2LRU A;  2FCN A;  3NVV A;  4PL2 A;  4FS2 A;  1AWD A;  4C4S A;  1GUA B;  3V61 A;  4WJP A;  2E8N A;  4LNK A;  1BPD A;  1WYG A;  3RTV A;  2HMX A;  2L52 A;  4KLO A;  2KV2 A;  3PX0 A;  3WKD A;  2KLC A;  2OJR A;  5HHD G;  1RXW A;  1EO6 A;  1SL2 A;  1V1O A;  2XEW A;  3ZI4 A;  2XID A;  4OJL A;  1D8L A;  3V72 A;  3DOW A;  4JPS A;  4HKZ E;  2VIX A;  4HLE A;  2BCV A;  3RH6 A;  4Q8F A;  4P7I A;  1L8L A;  4YMM A;  2LYA A;  5D2M B;  3K9P B;  3ZRC A;  4IOI E;  1JIH A;  1QT9 A;  4C4R A;  4IC7 B;  1ZQU A;  2KFZ A;  3KD3 A;  1C20 A;  2M56 B;  2Y5B B;  5IA7 A;  3BZC A;  4C56 C;  3U30 A;  4BUG A;  2JEG A;  2KP7 A;  1WRD B;  2GBK A;  4JLC A;  1T0S C;  1UQV A;  2RPQ A;  1MA7 A;  2MWS B;  3KZX A;  2H5X A;  3QJZ A;  3TEW A;  4C7Z A;  3Q69 A;  1ROE A;  3RN9 C;  5AUI A;  1KFS A;  2FID A;  4IG7 B;  3UF8 A;  1BPY A;  2ZJD A;  3VH4 B;  5AKH A;  2PTL A;  3AV8 A;  3JYU A;  3NZU A;  3NZ3 A;  3VAW A;  1OW5 A;  1TZ1 A;  3IAM 1;  1KN5 A;  1NYQ A;  3SYZ A;  3QQ8 B;  3V3X A;  4MEL A;  3GIL A;  2DEN B;  3ZTD A;  2G09 A;  4KIK B;  1WM3 A;  9ICH A;  2KOX A;  3PO0 A;  2W54 A;  3RRG A;  3NUH B;  1WUD A;  3RJE A;  1TS4 A;  2DHZ A;  3FIL A;  3UGB B;  9ICO A;  1WZ0 A;  1XF5 L;  4RGO S;  3V05 A;  5ALI A;  1WGG A;  4PH5 A;  1BXT A;  5AZG A;  3CYM A;  4BKS D;  4IUM B;  1QOG A;  4GC7 A;  3QXG A;  4TUP A;  2FJ6 A;  5D4B A;  2ICI A;  7ICQ A;  1L7M A;  2ZIU A;  2UVV A;  2KO3 A;  5G5G A;  4QIW C;  2XBB C;  5CEH A;  1WMH B;  2VJ5 A;  1BPZ A;  5F3X B;  2GWS A;  1V9J A;  3H6N A;  4P1C C;  5JXV A;  1TFR A;  5J0R A;  2AQ4 A;  1SE2 A;  3SI8 A;  1J7B A;  4IR9 A;  4PYU A;  2AGP A;  1JI7 A;  5LLI A;  1NKE A;  5J2I A;  4Y2P A;  3M3J A;  1T3Q A;  1EF1 A;  1KRH A;  2LYH A;  2DZI A;  3P42 A;  4K3B A;  2WF6 A;  5CA7 A;  4DF8 A;  1V2Y A;  5JHB A;  2RDH A;  4MJS A;  2DL0 A;  3WK9 A;  1B9R A;  1L6U A;  4KMO B;  3UMG A;  5BYS A;  4K4I A;  3QX1 A;  1H38 A;  1H4R A;  3K75 D;  2BYF A;  3AI5 A;  3GIK A;  4ED3 A;  3BZK A;  4I29 A;  5AKL A;  3OSP A;  1S0M A;  4KLG A;  1UZX B;  3VFK A;  1X9X A;  1KLV A;  2BDU A;  1VCB A;  1IG6 A;  2GB1 A;  1UNS A;  1OQY A;  2DAF A;  5FKA C;  2K0P A;  3C5F A;  1FM0 D;  4CCH A;  2VA2 A;  9ICK A;  2BB6 A;  5ALK A;  1S77 D;  1DYQ A;  4QZE A;  1ZOY B;  2JT4 B;  2M4N A;  1KM7 A;  2UYZ B;  4IM3 A;  2J52 A;  2H3Z A;  5J0Q A;  4B9N A;  2Z0D B;  2MRL A;  2C28 A;  4KLL A;  9ICL A;  3F2C A;  1ZKH A;  1X40 A;  8ICW A;  5JZE B;  3ZTC A;  3RBE A;  3C1Y A;  3MGI A;  1NOM A;  2J6S A;  3AE7 B;  4J9M A;  3JPR A;  4NZL B;  1KL9 A;  5IO9 A;  2CXY A;  4US8 A;  9ICG A;  2N4F A;  4ZYS A;  1MC8 A;  1P9D U;  2GLS A;  4HWI B;  1C77 A;  1QQ5 A;  3JVZ X;  4KLE A;  3F2D A;  2CU1 A;  4GGQ A;  1TK0 A;  3AED B;  2MCN B;  3QU2 A;  2IO0 B;  3ZW3 A;  2W9B B;  2I1K A;  4D2K A;  4BKS A;  4KN4 A;  4C8O A;  4MH0 E;  4II2 B;  3BK2 A;  4OCZ A;  1MQ2 A;  1ZQC A;  1PQS A;  1ZRM A;  1XO3 A;  3B2F A;  3N97 B;  4DHZ B;  4JGH B;  4PS3 A;  3ZKJ C;  4F2S A;  3Q6B A;  3IFW B;  4NQK E;  4WJ3 B;  1ZGU B;  4KGS A;  4NLB A;  1SGG A;  2MBO A;  2ZW1 A;  1UGJ A;  2UWQ A;  2XN9 C;  5DBC A;  2D10 A;  2XK5 A;  2XY5 A;  1MHX A;  1XD3 B;  4Z6D A;  3T9L A;  2LVO A;  2KSO A;  4DFM A;  1VJK A;  1HZ6 A;  4F4Z A;  1ZQY A;  4ZRK A;  3AEF B;  3TUO A;  4UB2 A;  1IPG A;  2LZ6 A;  2LGY A;  5AK5 A;  4GXI A;  4I6L B;  2ZJA A;  1XT9 B;  2KWC A;  2INP E;  4GLS C;  4IRK A;  2ON8 A;  3AEE B;  4DL2 A;  1IM4 A;  1NKC A;  1YJ1 A;  4KVG B;  3BII D;  3MR3 A;  2NYV A;  3IAS 1;  3EEC A;  4KTQ A;  4IWO A;  1PK1 A;  3T79 A;  4HJK A;  4GXK A;  1HTO A;  2KFJ A;  3PLU A;  3B9J A;  4Y2S A;  1SJH D;  1WX8 A;  2FUG 1;  2V4Q A;  1ZQQ A;  4DWI A;  2LGD A;  4F50 A;  1UT8 A;  3SV3 A;  1NDD A;  4B0M A;  1OEY A;  5KFF A;  3OJU A;  2KDE B;  4EBE A;  1EUV B;  1KSP A;  2MBH A;  2QAR B;  4USA A;  2WXR A;  4RQ7 A;  2B0C A;  3RB0 A;  3N7P D;  5KFJ A;  4JWS C;  5KG6 A;  1BPE A;  2IGD A;  4P1B C;  2V3S A;  2KN7 A;  4HEA 1;  4PHA A;  3AE8 B;  3ISD A;  3CW2 C;  4RQ5 A;  1PYW D;  3A1Q A;  5KFY A;  1WWV A;  5DDM A;  2ZVO A;  4IM0 A;  3RJK A;  4HK2 A;  4N9F 4;  4Y2Y A;  3RNB C;  5CRX A;  4C4V A;  1TT5 B;  2YB1 A;  4I2A A;  3OJS A;  1H8C A;  3F5A A;  1YQ4 B;  3GOE A;  5DQG A;  9ICT A;  1F77 A;  5BOL A;  3GII A;  3LYY A;  2O6K A;  3H4B A;  4UAT A;  2X38 A;  1RYU A;  4ECR A;  1V1P B;  2E1F A;  5FP0 A;  3PTF C;  2QB0 B;  1NJZ A;  4EZJ A;  4MGK E;  5HP4 A;  4X5V A;  3TAD A;  4YN4 A;  3AL0 B;  5CTR C;  1J2N A;  4RMA A;  1UCV A;  3RR7 A;  5ALQ A;  1S5L U;  3V60 A;  1G6J A;  4DK5 A;  5KG3 A;  4UDU C;  4BFR A;  2QDF A;  2CHZ A;  4IRC A;  1JAL A;  2LI5 A;  3SV4 A;  4Z6F A;  3AEB B;  2G4S A;  5DPW A;  1F2R C;  1GOZ A;  2GOW A;  2PKE A;  1L3T A;  2LD9 A;  5JH5 C;  4QZI A;  4DOB A;  5ALS A;  9ICQ A;  2JWZ A;  2MJ3 A;  4QZH A;  8ICJ A;  3HRD D;  3L4P A;  4RUC A;  4MGI E;  1ZQO A;  3RH4 A;  2WXP A;  3BWU D;  1ZQM A;  4LZD A;  3TBL D;  3EYZ A;  2XO7 A;  1K50 A;  3KHG A;  1YN3 A;  1WJ4 A;  4ZRP A;  4ZDV A;  2W43 A;  3Q8P B;  5EDS A;  4II3 B;  3GDX A;  4TV3 A;  4TMA B;  1NNL A;  1VZ8 A;  2KWD A;  3B1L X;  1S0O A;  1E7U A;  4KDI C;  4CF3 A;  2ZW0 A;  4WAA A;  8ICK A;  2IGG A;  1Z4N A;  2LYB A;  3QC8 B;  1DGJ A;  2JWU A;  2OM6 A;  3GB1 A;  3BQT A;  2BKE A;  2P6R A;  1Q5W B;  3C2K A;  4Q44 A;  3VR8 B;  1TKD A;  3C5G A;  3PRZ A;  2HDE A;  3RB6 A;  4TUU A;  4ARI A;  1ZQI A;  1NJX A;  2BYT A;  5AKJ A;  3Q8E A;  5HMM A;  3QCA A;  1WYW B;  4XC2 A;  2G0A A;  4RT2 A;  2XI9 A;  2OOB B;  4XQ8 A;  3BK1 A;  4XRH A;  1PDX A;  4ZHP A;  1L7Y A;  2W9N A;  3AEC B;  3V7L A;  2FIF A;  1NK0 A;  4C4T A;  5CB1 A;  2KWU B;  4HRS A;  1LXD A;  4YWG G;  3NY5 A;  2FMS A;  4B9U A;  2G5H B;  1LQB A;  5AKG A;  2E1E A;  8ICY A;  1RYJ A;  3ZVV A;  4BDP A;  1ZYQ A;  5L1M A;  3PW4 A;  1I4X A;  1KFY B;  3UXN A;  4RM9 A;  2BS2 B;  4C8L A;  2NBV B;  1RZT A;  1F44 A;  4F4K A;  3ABV B;  1YX5 B;  2K60 A;  1J2M A;  2WXL A;  2LUM A;  3APD A;  4NAW B;  3UQ2 A;  1B0X A;  3K1Z A;  1JRP A;  2DYO A;  3AXC A;  2Y1I A;  5KFU A;  1JXE A;  4LLG M;  3MGV A;  3H7P A;  4YR2 A;  2KMM A;  2KDM A;  4LDT B;  3GZN I;  4K7U A;  3AQF A;  1NK6 A;  3DVN U;  3WAL A;  1RYS A;  1HZ5 A;  1QOF A;  1ZDV A;  2K3U A;  1D4B A;  5HML A;  2JEJ A;  4NLZ A;  5DB7 A;  2W7P A;  2ISO A;  3PVX A;  4KKJ A;  1B4F A;  1SL0 A;  1HEZ E;  1ARO P;  3K4G A;  3D2N A;  2DQN B;  4UB3 A;  4LJP B;  1RQN A;  3WAM A;  2HBM A;  3RFA A;  4J9S A;  1S3S G;  1TKG A;  1WCL A;  1NBF C;  2KHQ A;  4Y2R A;  2IPK D;  1FCL A;  2K8B A;  2KJH B;  5J0Y A;  4PK1 A;  4DQQ A;  2BYE A;  4I2E A;  1KRP A;  2ZJ8 A;  2PPH A;  5FR6 A;  5DPR A;  1O03 A;  2FLP A;  4KMU A;  5ALD A;  3T5J A;  4RF0 A;  3D6J A;  3ZO5 B;  3UQA A;  3R66 C;  3IV6 A;  4OZB A;  4PGQ A;  1GPX A;  1UWM A;  4QZG A;  1J19 A;  3E0F A;  3OTQ A;  3BQ1 A;  1WXS A;  3PMN A;  1XSN A;  3ORY A;  2V4R A;  2HBJ A;  4HDO A;  4KLJ A;  3JPT A;  7ICV A;  2MA1 A;  4X57 B;  2UU7 A;  5KG0 A;  5EWG A;  3NRW A;  1ZOL A;  2QKQ A;  3MC1 A;  1GNU A;  4WAF A;  4G50 A;  4AUQ C;  2K8C A;  5AEK B;  5TSS A;  3TIX A;  2QCZ A;  1CI4 A;  3C2M A;  3AE6 B;  2BQQ A;  1ZQJ A;  1V5T A;  2ALZ A;  1I42 A;  1XLN A;  2KN4 A;  4B9T A;  4R65 A;  2HI0 A;  1WXM A;  4M9J A;  1WGH A;  1SWV A;  1ZRN A;  2KIV A;  3M62 B;  4J9O A;  2GI9 A;  4AWJ A;  4DSI A;  3MAB A;  3PY8 A;  2WDR B;  4OJ6 A;  5ALU A;  4I2C A;  4Y2Q A;  1QKZ A;  4MFF A;  1P0R A;  1TY0 A;  4PS8 A;  4NAM A;  2KZM A;  4W9G A;  2Y0S F;  3NGD A;  4DSL A;  1QOA A;  2L0T A;  1K1S A;  3DWG C;  3PLV A;  2IOF A;  1BUI C;  4B95 A;  2AL3 A;  4OHJ A;  1E0Z A;  1YJJ A;  1KJT A;  1TIF A;  2JYT A;  4JV0 A;  3LXF A;  4GDL A;  4YD1 A;  1KEJ A;  2IBI B;  3AEV A;  2L7R A;  3TKA A;  2BQ3 A;  2A1J B;  3I28 A;  1N56 A;  3QWZ B;  2Q5W D;  4F4X A;  3KFU F;  2KX0 A;  3N1X C;  3LYS A;  4E71 A;  4ANU A;  3DHH C;  1L0X B;  4URK A;  4F2R A;  3N3K B;  2NTS A;  4F7Z A;  3B0X A;  2AEH A;  4M2Y A;  5ALF A;  5AI6 A;  1GB1 A;  4M9N A;  5IOI A;  3CMM B;  2G4D B;  3JPS A;  2VZK B;  2KNJ A;  5AM1 A;  3ZJV A;  1E8X A;  3GS2 A;  4AYB C;  1LKY A;  2HDO A;  4GC6 A;  9ICE A;  3ISB A;  1RAX A;  4Y2U A;  2GLE A;  2E8O A;  8ICP A;  5E6P A;  3TAC B;  2JEF A;  1TGZ B;  1KW4 A;  1XNS A;  3D2Q A;  2PFN A;  1ZJN A;  1KDH A;  3AU2 A;  4QW9 A;  3PR4 A;  2B76 B;  2KQ7 A;  1WWU A;  1D6E C;  3N7S C;  4DLE A;  1XS9 D;  1NEN B;  3QIJ A;  4YTN B;  5ALM A;  1X1M A;  4HDQ A;  5ALJ A;  3SU8 X;  4QZD A;  4JMU A;  1S76 D;  4YD2 A;  4BBN C;  5J2H A;  1NZB A;  1L8O A;  1Z1V A;  2KJ6 A;  5KFG A;  2K8A A;  4KLF A;  2ZXH A;  5KG7 A;  1V81 A;  2NRW A;  1XEE A;  3PPA A;  1MQ3 A;  1T94 A;  4PZN A;  5G2N A;  2DKZ A;  3M6K A;  4EX7 A;  3ZDT A;  1Y56 A;  2KJ8 A;  4CQN A;  4LNO A;  1UF0 A;  4GDL B;  3KHR A;  5D3I B;  2WGS A;  3SHQ A;  3WCQ A;  2KAN A;  5DCN A;  1ET9 A;  2PLP A;  1WXA A;  4OJ5 A;  2IBK A;  2KD1 A;  3ALR A;  1JRU A;  2KDF B;  1T4G A;  4WWP A;  1D9F A;  3ZJU A;  4C7Y A;  4GXB A;  3ZDM C;  2QAR A;  2QIL A;  1D8B A;  4DL3 A;  5KG1 A;  2JH7 A;  3QZ7 A;  4HVB A;  2VZK D;  4EUT A;  2LGI A;  3CWI A;  4FZN A;  1ZE3 D;  2C2E A;  1E6E B;  4UB5 A;  3AEA B;  2RQ5 A;  3AU6 A;  2BGF A;  2FLL A;  1HIW A;  1RG6 A;  2YVC A;  3RZW C;  8ICG A;  1L7N A;  3SAH A;  3SAF A;  7ICR A;  1LVH A;  1A70 A;  3AEG B;  2IGH A;  2AGO A;  4RQ8 A;  2PE9 A;  2ACZ B;  2ZNV C;  3GZN B;  4LNN A;  2ZVN A;  3I63 C;  3PRE A;  4TQS A;  4KLQ A;  1L3V A;  1FPY A;  4OVZ A;  2YN4 A;  2M8S A;  3ZUN A;  1J7A A;  4DL6 A;  1IIP A;  1P1A A;  1ET6 A;  1LO5 D;  4CYE A;  5KFZ A;  5JTI A;  2WF9 A;  1TAU A;  4YSX B;  4I2G A;  5KFK A;  3AM9 A;  4RQ1 A;  1PK3 A;  3TI0 A;  3K9O B;  4FHK A;  4I6P A;  3AE9 B;  4LNI A;  2ZCB A;  2F8L A;  3KKA A;  1R4M B;  3BVZ A;  4JUZ A;  4E0D A;  4G3X B;  4DFP A;  4NY8 A;  3ML9 A;  1J8C A;  3UIP B;  1UA0 A;  5IIO A;  2J7Q B;  2B3A A;  3BQ7 A;  4UBC A;  4BOZ B;  3TAD C;  4F91 B;  4RZR A;  2KC1 A;  2KVR A;  3KUZ A;  1VJ5 A;  2NPT B;  1HJP A;  3MC0 B;  2BWE S;  2OJW A;  3U4E G;  4G9B A;  3H8W A;  2AX5 A;  2PE6 B;  3A4R A;  4EFO A;  2G5I B;  3F53 A;  2AHO B;  2CN1 A;  4M9H A;  2GOL A;  3V6C B;  3WIM A;  1WR6 E;  3Q2A C;  5AI8 A;  5KL8 B;  2L05 A;  3W2D A;  3AE4 B;  2ZIU B;  1I4R A;  2J53 A;  3H8M A;  4MFC A;  4YSY B;  4Y2J A;  3AE1 B;  2N7J A;  3HP6 A;  3M63 B;  4L2Y A;  1KTK A;  3M9O B;  8ICC A;  2MBQ A;  4CO7 A;  1SZH A;  2Z0E B;  1WXQ A;  2KEY A;  1SF0 A;  3QU5 A;  2IY0 B;  2WAQ C;  1AQ6 A;  1ECW A;  1FEZ A;  2RLT A;  5ALX A;  3PZD A;  3H4D A;  4I2D A;  4U7C A;  4B0E A;  5DPT A;  3Q3J A;  2GO7 A;  4JWU C;  5C0Y A;  2BWF A;  4QZA A;  3PSI A;  2K4I A;  4Z6C A;  2WDV B;  3LWL A;  3E58 A;  1QQ6 A;  3C29 A;  1QZE A;  1OGW A;  3WKC A;  2HSZ A;  4L23 A;  3SD5 A;  4C00 A;  1DOY A;  1ZD2 P;  2FCS A;  4LJX A;  1T0Y A;  3RYT A;  3VCB A;  1E8W A;  3AUO A;  5LXI B;  4A9A A;  4RGN A;  4FZM A;  1E8Y A;  5AIC A;  4DL4 A;  2R8H A;  4B9S A;  2V3P A;  3KBB A;  1TY2 A;  1EWC A;  2K25 A;  1P7F A;  5LXH A;  4ZH4 A;  3RAQ A;  2K6Q A;  2VH2 A;  4RUA A;  1V6E A;  2RP5 A;  2LJI A;  1N5W A;  1WI0 A;  4U6P A;  1TVA A;  2RDI A;  4US9 A;  1NK5 A;  5AKE A;  3KYC D;  1JWM D;  4EOY A;  4KLD A;  4NLN A;  2KYW A;  4IM2 A;  4O1N A;  3JSV B;  2HE7 A;  4A55 A;  3S6J A;  3LVV A;  2Y9T A;  1URJ A;  2K89 A;  4QZ8 A;  2ZTE A;  1B43 A;  9ICR A;  2F1H A;  3Q8F A;  3KHL A;  3RBD A;  2HD5 B;  1Z5S B;  2HHV A;  1VRA B;  3JPN A;  1D5M C;  4UB8 U;  4AJY B;  2UVW A;  1WE6 A;  3ZDA A;  4NJC A;  2HOQ A;  2J0M A;  3O13 A;  3NVZ A;  1Z2M A;  4R64 A;  4I2J A;  4UAY A;  4PZO A;  2I1Q A;  9ICA A;  3LDZ E;  2K1F A;  4CHK A;  5AKX A;  2O6V B;  3VTU A;  2I5H A;  1XSP A;  1TAQ A;  5AKI A;  3ZDB A;  1RQL A;  4TUQ A;  1ZJM A;  4IQW A;  2ASD A;  3IG3 A;  3DWM A;  4GDK A;  5EWF A;  4CGZ A;  4RNA A;  5KFT A;  4R63 A;  4RGM A;  1EM7 A;  1Z4O A;  4MM3 B;  3RJH A;  2VRR B;  1Y8R C;  1L6V A;  3OAW A;  3UIO B;  5EE1 A;  2BS3 B;  1T6B X;  2WXN A;  4UBB A;  2FDR A;  1J0G A;  4UQG A;  1GG3 A;  1EU4 A;  2Z8L A;  3MHZ A;  3HM3 A;  2FE9 A;  1NI2 A;  1TKE A;  2LVQ A;  3H9D A;  1N5X A;  2RSU A;  2LFI A;  4ZRI A;  1DK3 A;  5ALT A;  4ICU A;  1XQQ A;  3PHX B;  4PYZ A;  4QWE A;  2MAX A;  5EE9 A;  3QE9 Y;  4BOS C;  4DQO C;  3IP4 B;  2MA9 B;  3DBH I;  2CU3 A;  2ZEQ A;  3RFZ B;  2BQR A;  1A76 A;  2RHF A;  3I76 A;  3NUQ A;  3EPI A;  4QJF B;  2KJR A;  1X9W A;  2LEK A;  3RMK C;  1L5U A;  3M9N B;  2VH1 A;  2DWQ A;  2ATL A;  5AHX A;  3GV8 B;  4XDD A;  3OPX A;  5C3J B;  2KQ4 X;  9ICW A;  3THV A;  4DXA B;  3L16 A;  1Q0W B;  5D3D A;  1SBB B;  1WIA A;  9ICI A;  1U4A A;  1VLB A;  1UH6 A;  3U7D A;  4F3O A;  2WXG A;  1FFV A;  2KHW B;  2WS3 B;  4K7W A;  2MP2 A;  5IN7 A;  3RAX A;  2JZ3 B;  4K3C A;  1DOI A;  2MU2 A;  3ONN A;  4F93 B;  3G6V A;  2W9A A;  1RPL A;  1ZD4 A;  5J2F A;  3SAG A;  1TZO A;  5J2C A;  1R4N B;  1RM6 C;  1ZPS A;  9ICM A;  1V80 A;  2IA6 A;  3LDA A;  4J6I A;  4NAW A;  2X8X X;  2D3D A;  3RUI B;  3RNC C;  3FYH A;  2XY6 A;  2MEK A;  5C2T B;  2LXA A;  4M8N A;  2LMC A;  1V38 A;  2GRI A;  2KAJ A;  3H0R B;  4RNO A;  1Z3E B;  2YML A;  4NQL B;  5ALP A;  3PSE B;  2CJO A;  1A77 A;  2AQ0 A;  5J0X A;  2ZUB A;  1L0V B;  1U9L A;  2A3V A;  2IO1 B;  1D5Z C;  5KFO A;  3TL5 A;  2W8K A;  4EEW A;  1UT5 A;  1ZQK A;  3TMP B;  5DG9 A;  1STE A;  2ODG A;  3FDS A;  4WJN A;  3WAP A;  3JW0 X;  2YEP F;  3DVN V;  1GC6 A;  2JV3 A;  4XUS A;  3V6J A;  1V85 A;  2D3C A;  4EYI B;  2N9X A;  3MJ5 A;  3M6Z A;  1Q1O A;  1QLB B;  2L00 B;  4GFJ A;  3TAQ A;  3BVM A;  3L10 B;  1FIQ A;  3P4P B;  2UVU A;  2EQY A;  5KFH A;  1WWT A;  4W9J A;  7ICH A;  5H92 C;  2FCQ A;  9ICB A;  2WFA A;  2ZPN A;  8ICE A;  4P4M A;  4WUR A;  7ICG A;  4G3I A;  4B9L A;  4ECW A;  1OTR B;  3P63 A;  1SV4 A;  2OWO A;  4MDK E;  2ISP A;  4F5P A;  3H8S A;  2W55 A;  4ARC A;  5KFP A;  4J03 A;  2SAK A;  4YL8 A;  1OQQ A;  1GB4 A;  2XK5 B;  4MGZ E;  1F5S A;  2IMW P;  5J0T A;  2PFP A;  3KOO A;  3HK0 A;  2C60 A;  5ALE A;  3ZRF A;  1YOV B;  2F44 A;  1BGX T;  5AIA A;  1QSL A;  3DBR I;  2V0G A;  4WIP A;  2DYB A;  9ICJ A;  2HHW A;  5ALV A;  4YT0 B;  4M8M A;  1YN5 A;  3BJY A;  1YQ3 B;  2PMV A;  3R2I A;  4BJQ A;  5F9L A;  2LAS A;  1X42 A;  3EPG A;  2VJ4 A;  2K4E A;  2FAZ A;  2KJ9 A;  2KMA A;  2V9H A;  2L0F A;  1KFD A;  4NLC A;  3ZD8 A;  8ICB A;  4FZL A;  2N0S B;  3DBH B;  2HCF A;  3H0L B;  2DNF A;  4GOC A;  1SXE A;  2N1V A;  3P1M A;  1XO1 A;  1N62 A;  5EOZ A;  3ZXR A;  1HUO A;  1JN3 A;  2OXO A;  2LM4 A;  4Q45 A;  1T7P A;  8ICM A;  4IR1 A;  3WAO A;  3X0W A;  3A9J B;  3NOB A;  1ENF A;  3QHT A;  2AQ2 B;  1TBE A;  1EF5 A;  2C5L C;  4EEN A;  2A1A A;  2HVH A;  5HR6 A;  3OJ4 B;  3LB8 C;  4AS1 A;  2D07 B;  3HVD A;  2M0N A;  2M19 A;  3H40 A;  4DXG A;  4NM2 A;  4XZ4 A;  3UQB A;  4PPX A;  1NYR A;  4WQM A;  3T5K A;  3JPO A;  5BMH A;  3BQ0 A;  2BDP A;  1K52 A;  4HCN B;  1U49 A;  8ICZ A;  1AYF A;  2KFK B;  4KLU A;  5L1I A;  4K81 A;  1NK9 A;  5GMV A;  2K5P A;  4BX9 C;  1L3U A;  2XC9 A;  1KQQ A;  5AKZ A;  3QAR A;  2GH1 A;  2BW2 A;  3CRX A;  3ONS A;  2ZIW B;  5J0P A;  2FPL A;  3P4S B;  1QTM A;  4KN7 A;  5L1L A;  1FNV A;  2JMG A;  3PZP A;  3K1R B;  3LVW A;  3ZXV A;  1BNO A;  4HPP A;  1IGC A;  4EZK A;  4YXM A;  3SD7 A;  1NK4 A;  4H2A A;  5IP4 D;  4BKT A;  2L76 A;  2DZJ A;  1S97 A;  1T8E A;  1BPB A;  2OEH A;  1NJW A;  3PO5 A;  3KWL A;  2D11 A;  1M94 A;  7ICF A;  2D3G A;  5BPC A;  2N9E B;  4ECY A;  4GSW A;  2E6X A;  3UXP A;  2N9K A;  3M8R A;  4ZHO A;  4JQW C;  2KG5 A;  3ETL A;  1MG8 A;  3L5K A;  1HXY D;  2KXJ A;  2RDG A;  5KT3 A;  4EYH B;  4B9M A;  3BVG A;  2L8J A;  5ALG A;  1T0Q C;  2H88 B;  2L5Y A;  5EE0 A;  1OQR A;  4IQU A;  3M8S A;  4F5N A;  2AH5 A;  1N2X A;  4DF4 A;  5KFE A;  2ZTD A;  4ELT A;  4KDL B;  2JXX A;  3A9K B;  2MSE D;  1LV5 A;  2C9W B;  2JVC A;  2WWZ A;  4MFA A;  4I2I A;  4L1B A;  4FJZ A;  2HHU A;  2MX2 A;  2RMM A;  4NPN A;  1XLQ A;  4YR3 A;  3PR5 B;  5CP2 A;  2P66 A;  8ICU A;  2D3A A;  2JPH A;  1TKY A;  2KD0 A;  3QU9 A;  1I4Q A;  1CK1 A;  3NZS A;  3P2B A;  4ED0 A;  3SDL C;  1COO A;  4O3N A;  3CST A;  3N1Z C;  3L08 A;  1FNU A;  4DDI D;  2FNJ B;  2NRV A;  2DZK A;  2HJ1 A;  4CE6 A;  1SV0 C;  5KTQ A;  4MSM B;  2GBN A;  3GE8 C;  4Q8E A;  2KK8 A;  4MGY E;  4RU9 A;  3GFK B;  4IQT A;  1R4M I;  4RFB A;  4JWM A;  2MUT A;  4P4O A;  1A6S A;  1TJE A;  4O5E A;  4Q2J A;  3UMB A;  2PFO A;  4FBT A;  1YNT E;  4O3P A;  2IO2 B;  2WF8 A;  3E56 A;  4J3O D;  2L3Z A;  3NTU A;  3Q8A A;  3ZLZ A;  2NCN A;  3V6E B;  4YSZ B;  4M6W B;  5ALW A;  2E5S A;  2PFQ A;  1PUZ A;  4P0Q A;  2W11 A;  4C0Z A;  2G07 A;  3ZNH B;  5E6O A;  1WGD A;  2JU6 X;  2EH9 A;  1M4V A;  3W1S A;  2M9N A;  2QHO A;  2EAP A;  1P98 A;  2O2V A;  4W9I A;  2XIC A;  2DPJ A;  5DPS A;  2PMZ F;  2C2D A;  3UM9 A;  5IIK A;  1UPH A;  3TFR A;  3BS5 A;  9ICP A;  1T5X D;  1ZW7 A;  3RCZ A;  3UPQ A;  4ECU A;  4NXZ A;  4KX5 A;  2YMQ A;  1UBQ A;  4GIV A;  5J2E A;  1TK8 A;  2BCQ A;  4DDG D;  5HNK A;  2CKH B;  1SKR A;  2EEL A;  3WKE A;  4LVS A;  4KLI A;  1ISN A;  5E6N A;  4FS1 A;  2HHQ A;  3R2T A;  2F76 X;  5CHV C;  3PO4 A;  4XGA B;  4MEY A;  3W9C B;  2HW3 A;  1YMH E;  5AI4 A;  1SGH A;  2ZUD A;  4F4Y A;  1RXV A;  5KFQ A;  4F8R A;  1PK1 B;  3H7I A;  2I9G A;  3MJW A;  4MH8 A;  3AE2 B;  3BIN A;  3HM6 X;  4Z6E A;  2BCU A;  2ZIX B;  4DFJ A;  5HHI A;  1C4A A;  3OSN A;  3EGR A;  1JWS D;  1L4Z B;  2IY1 B;  5LNK 1;  4IWP A;  2FPM A;  3RJJ A;  1FRD A;  3E2E A;  3N7R C;  1QQR A;  3KLS X;  2CRX A;  4YXD B;  5EWE A;  4ED8 A;  5DQI A;  4AP9 A;  8ICL A;  2LKY A;  3ZNI D;  1YX6 B;  3Q8M A;  4QZ9 A;  1N60 A;  1HA5 A;  2K8B B;  1WFY A;  2W9M A;  1D9D A;  3VR9 B;  2W03 A;  3IXS A;  3QEB Z;  4O3R A;  2JYE A;  3NAS A;  2R8K A;  3D32 A;  3MP9 A;  4R66 A;  3MTN B;  5DB6 A;  2XCA A;  4Y2X A;  3UMC A;  2K9X A;  1ZQZ A;  3PST A;  3APF A;  4F8C B;  4QZB A;  2QIE B;  2B21 A;  1PVR A;  4FAD A;  4LJO B;  2VA8 A;  3HJE A;  3DVG X;  4KLT A;  2IYD B;  4CF4 A;  3OHA A;  4JL9 A;  4RQ0 A;  1CJE A;  1GAQ B;  2R8I A;  4JE3 B;  1ZQE A;  4J9L A;  2K6D B;  2W9C B;  1BPX A;  8ICI A;  8ICV A;  4OVV A;  2NO5 A;  1OXJ A;  3EW9 A;  4ICA A;  4IS7 A;  3WK7 A;  3RB4 A;  4F5O A;  2BQU A;  9ICS A;  4OJO A;  2WB1 F;  3RNF C;  3PT2 B;  1T3N A;  1QIL A;  7ICU A;  3VDZ A;  3V6K A;  4YTP B;  4CDG A;  2BTE A;  3GV5 B;  5K4L A;  4R8U A;  4XWW A;  1Q3V A;  1WJU A;  1ZQA A;  1RWS A;  4XWT A;  1IGD A;  1K1Q A;  4G11 A;  2G3Q B;  2BT6 A;  2JZZ A;  2DZM A;  1RLF A;  4DEZ A;  4PS7 A;  3TSS A;  3VRA B;  4Y2V A;  3N32 A;  2ZXI A;  2WXQ A;  1WRI A;  4LDT D;  2WB1 C;  3TAP A;  1UGM A;  4AQ7 A;  1TK5 A;  5EE3 A;  5J2G A;  2HHS A;  3LWM A;  4REZ A;  3A0H U;  2PW9 A;  1CUK A;  2FE8 A;  1JX4 A;  4TQ0 A;  1JXL A;  1OUQ A;  5B5E U;  4PHE A;  2CR5 A;  5AKY A;  3H0M B;  5T8I A;  4Q43 A;  4KSL C;  5JU5 A;  1VZ6 A;  4C80 A;  3JPP A;  1XSL A;  2ZZP B;  5J0O A;  1GO3 F;  2EAM A;  3DBS A;  5KG5 A;  1TYG B;  1XC9 A;  3KH0 A;  1TTN A;  4UB4 A;  3HIZ A;  4FJV B;  4ASW C;  3M95 A;  3Q8B A;  5CHW A;  4ZRQ A;  2A19 A;  5DBA A;  3T5L A;  2LRW A;  2FLN A;  2EDU A;  4RNN A;  3QEA Z;  2F3N A;  3O0F A;  2R2Q A;  2GBM A;  9ICC A;  2XY7 A;  2OH2 A;  3Q8S B;  2EMS A;  4ECZ A;  2QLT A;  2KTF A;  8ICQ A;  1F2R I;  2VKQ A;  1XCQ L;  1MJD A;  4AYB F;  3IRU A;  3DPD A;  4W9L A;  3IN5 A;  4RGT A;  2KVC A;  5F9N A;  1DOX A;  1QCK A;  2VAN A;  4YVZ A;  4M9G A;  4YMO A;  5KFI A;  5KFV A;  1ZXI A;  4E3C A;  1FEH A;  1SEB D;  3L0W B;  5D7G A;  3PZ7 A;  2ESE A;  4TUS A;  4RQ3 A;  2KN5 A;  3W5U B;  1F0Z A;  3ENE A;  3RZF A;  3PSP A;  2YB4 A;  5BMI A;  1X66 A;  3EZ5 A;  4MF8 A;  2KTQ A;  2LGX A;  4MSQ B;  1SXD A;  5KFX A;  4HKQ A;  4O3O A;  4J9N A;  4KLS A;  4DO9 A;  1NK8 A;  4A6Q A;  1Z00 A;  5TIS U;  2ZCC A;  4GB9 A;  3Q8K A;  3PVL A;  2QEJ C;  1WE7 A;  2PVO D;  4JK1 A;  2M17 A;  5J0S A;  2N1W A;  3R7Q A;  3D2S A;  2AGQ A;  1U4B A;  3N1Y C;  1ZUD 2;  5ALZ A;  1V5O A;  3VVW B;  1WZ3 A;  5ALR A;  1C79 A;  1ESF A;  4IW0 A;  3SEB A;  2MRP A;  2N1R A;  4RPY A;  2PI4 A;  2ONQ A;  3TAN A;  1CZP A;  2KTR B;  1V49 A;  4XYC A;  5DDY A;  4O0I A;  3C1Z A;  3NS8 A;  5J0W A;  2Q0Z X;  4UAW A;  2W04 A;  5AK3 A;  1KLN A;  4DBG A;  4PL1 A;  3M9M B;  4I6N B;  3UXO A;  4DFK A;  2H89 B;  2KFK A;  4FN2 A;  2ZJ5 A;  3DVG Y;  2NRZ A;  1PFD A;  5J0U A;  3QX7 A;  8ICF A;  3MFI A;  3NJT A;  2WF7 A;  4K1R B;  3R9K A;  3WU2 U;  3QNM A;  2MHJ A;  3DCG A;  1L6N A;  3WAN A;  4UAU A;  2A4Z A;  3T3F A;  2CHW A;  3C8Y A;  4P0Q B;  2R2O A;  2KKV A;  3HWT A;  5JUM A;  1IBX B;  3EUB 2;  1RRB A;  2A1J A;  4FO6 A;  1SL1 A;  2V3N A;  5JHA A;  2JQR B;  2NV3 A;  1OEY J;  2XGQ A;  2AWT A;  1XU4 A;  2JEI A;  1ACC A;  1SXT A;  2NBU A;  3BS5 B;  2BF8 B;  3ZDD A;  3HT3 A;  4BXO A;  1WX9 A;  1WG8 A;  1LFD A;  1R7S A;  2W3S A;  5C1Z A;  7ICK A;  3V62 A;  4EKU A;  5IIM A;  4YR0 A;  2KIW A;  2GMI C;  1SB3 C;  2RRD A;  4OZA A;  4DFD A;  4M6W A;  4DL7 A;  2KIC A;  4NM1 A;  3VRB B;  2L83 A;  1YIW A;  1HE8 A;  4QIW F;  1SZP A;  3RUL A;  2WU5 B;  3HKZ C;  4ED1 A;  3VHT C;  2HTH A;  1X6I A;  4MEX A;  2QJL A;  2IO3 B;  3H7S A;  1DGS A;  4GU2 A;  3V6H A;  1WJ6 A;  3QUC A;  3GV7 B;  1XXG A;  2ZPY A;  1FNW A;  1QSY A;  5CWR A;  1FCC C;  1JQ4 A;  2EAN A;  5C5J A;  2KT7 A;  8ICR A;  3FKY A;  2NTT A;  1QF6 A;  4QWD A;  4I2H A;  3IT4 B;  3PW0 A;  4AP4 C;  2N7D A;  5J2B A;  4M00 A;  1MHH E;  2FCM A;  1PGB A;  4BBN F;  5AIB A;  5KFB A;  1PVQ A;  2RD0 A;  1Z19 A;  2DF4 B;  4G0N B;  1DK2 A;  3A9K A;  4CNQ A;  2LUE A;  2WYQ A;  2JXT A;  4DSF A;  4R8U B;  2ASQ A;  1NVI D;  2WDT B;  2K39 A;  4RQM A;  2OYY A;  5J18 A;  1VD2 A;  4ANW A;  1WY8 A;  4DSJ A;  2REX A;  4NV0 A;  1LM8 B;  1E9M A;  2R18 A;  1N61 A;  5KG4 A;  9ICU A;  2JF5 A;  7ICT A;  5DB8 A;  4BAX A;  1JML A;  1WSP A;  5AI9 A;  3C2L A;  1IUE A;  1BNP A;  3Q8Q B;  3RRH A;  1CRX A;  4F92 B;  5DBB A;  2PVG C;  3C23 A;  2KDI A;  4QZC A;  4A3O A; 
#chains in the Genus database with same CATH homology
 2Y5C A;  2ZW0 A;  2IGG A;  4R3D A;  1DGJ A;  2JWU A;  4EE2 A;  3GB1 A;  2WXO A;  4N58 A;  3VR8 B;  3ZQ4 A;  4ARI A;  2HDE A;  2YEP B;  2V0G A;  4WIP A;  4LK0 M;  1D5X C;  2BYT A;  2AQ1 B;  3VQI A;  4ZOH C;  4YT0 B;  1YN5 A;  2DBY A;  1YQ3 B;  2PMV A;  3Q8E A;  2JX5 A;  3R2I A;  1XLP A;  4XE0 A;  2SEB D;  4ITK A;  1JCK B;  2N0S B;  3BK1 A;  4YTM B;  1PDX A;  2J42 A;  4ZHP A;  1C9F A;  3AEC B;  3SFD B;  3P1M A;  1N62 A;  2N9L A;  4HRS A;  4YWG G;  1PGA A;  3B2G A;  1XCT L;  1ENF A;  2WXJ A;  1RYJ A;  1C76 A;  2AQ2 B;  1I4X A;  1KFY B;  1VZ7 A;  2BS2 B;  3ABV B;  3LB8 C;  3GP7 A;  1YN4 A;  4AS1 A;  2WXL A;  2LUM A;  3SFE B;  4NAW B;  3CIR B;  3HVD A;  3T3O A;  1SE4 A;  1QOB A;  2M19 A;  4WWM A;  1JRP A;  4DXG A;  3T3N A;  4OW0 A;  1NYR A;  2DYO A;  4WQM A;  2W82 A;  4IDI A;  5BMH A;  1K52 A;  2EKI A;  1PGX A;  1AYF A;  4JX1 C;  2QMT A;  4LLG M;  3N9Y C;  5GXG B;  2KMM A;  2K5P A;  1UUP A;  1NEK B;  2KDM A;  3FIL B;  4PT5 A;  3U7Z A;  2BW2 A;  2DLB A;  1HZ5 A;  5HFY A;  3P4S B;  1QOF A;  1ZDV A;  2K3U A;  1D4B A;  1FNV A;  4KKJ A;  1IGC A;  1HEZ E;  4H2A A;  1TKG A;  1CQV A;  2IPK D;  1FCL A;  2WXF A;  3KWL A;  5E6J A;  3ZGZ A;  2LHD A;  4P6V F;  3NVW A;  2E6X A;  2N9K A;  2OED A;  4RF0 A;  4ZHO A;  1WGK A;  1I4G A;  3P4R B;  4OZB A;  1RFK A;  1HQR D;  1GPX A;  1FXA A;  1UWM A;  1V1P A;  1HXY D;  1NI3 A;  2RDG A;  3BVG A;  3P4Q B;  2H88 B;  2Y5P A;  5EE0 A;  1OQR A;  3HVZ A;  4TQ1 A;  2LHE A;  4TSS A;  4WAF A;  2Y3A A;  1UWX A;  4L1B A;  3TEX A;  3U2S C;  2BS4 B;  1Q10 A;  5TSS A;  3URY A;  2RMM A;  1I7H A;  2D5G A;  1XLQ A;  2JSV X;  3AE6 B;  5H8Y E;  1XLN A;  2KN4 A;  1SIJ A;  1TKY A;  3H8H A;  1JWU D;  3MFG A;  2PIA A;  5HI1 A;  5BYQ A;  1I4Q A;  1CK1 A;  1MVK A;  1TS2 A;  4N59 A;  3R8B A;  3FAH A;  2GI9 A;  4KGR A;  4A90 A;  2I38 A;  3FC4 A;  1FNU A;  2L32 A;  1K53 A;  2WDR B;  2BBC A;  1QKZ A;  3RPF C;  1SE3 A;  1TY0 A;  3AH7 A;  3BZD B;  4NAM A;  1KLU D;  3IT6 B;  1QOA A;  4XDC A;  3BYT B;  3DWG C;  4RFB A;  1E0Z A;  1BUI C;  2XNA C;  1MPE A;  4OHJ A;  4RH6 A;  1YJJ A;  1TJE A;  1PUT A;  2JYT A;  4Q2J A;  1YNT E;  2IJ0 A;  3LXF A;  4J3O D;  3E56 A;  1XLO A;  1I4H A;  3Q8A A;  1K51 A;  2QSD A;  4YSZ B;  1JWA D;  2AQ3 B;  2Q5W D;  1C78 A;  1L0X B;  4RF1 A;  2NTS A;  1KLG D;  2JU6 X;  4OZC A;  3W1S A;  1M4V A;  1GB1 A;  3I9V 1;  1EWY C;  1FXI A;  2VZK B;  3UI3 A;  3ZJV A;  2CJN A;  3GS2 A;  1GB4 A;  5HG2 A;  1T5X D;  3W5V B;  2HTM E;  3U52 E;  2EEL A;  1ZXH A;  1AN8 A;  2B76 B;  2JZP A;  1YJI A;  1D6E C;  3R2T A;  1IBX A;  1NEN B;  4YTN B;  1L5P A;  1MI0 A;  3W9C B;  3HUI A;  1YMH E;  3AB5 A;  3AE3 B;  1FD6 A;  3NVV A;  2W3R A;  1AWD A;  1XEE A;  4MH8 A;  3AE2 B;  1V8C A;  1E10 A;  3NRZ A;  1WYG A;  4N6E B;  2L52 A;  1C4A A;  1Y56 A;  5HHD G;  4CQN A;  3EGR A;  1JWS D;  1L4Z B;  4GDL B;  5FR3 A;  5D3I B;  5LNK 1;  3WCQ A;  1V1O A;  5G5H A;  1QQR A;  3KLS X;  1FRD A;  2MJD A;  4YXD B;  4LTU A;  2V4I B;  2WXM A;  3AMZ A;  1ET9 A;  2PLP A;  3SR6 A;  4HKZ E;  4JPS A;  3ZJU A;  1N60 A;  4C7Y A;  1HA5 A;  1L0Y B;  2QIL A;  3VR9 B;  3IXS A;  2IDY A;  2JYE A;  2G9H D;  4IOI E;  3MP9 A;  1L4D B;  1QT9 A;  2VZK D;  2K9X A;  1FO4 A;  2LGI A;  3CWI A;  2M56 B;  4C56 C;  1ZE3 D;  2QIE B;  4M0W A;  1E6E B;  3AEA B;  1GAQ B;  1CJE A;  4JE3 B;  3TEW A;  4C7Z A;  3Q69 A;  1ROE A;  3ETR A;  1A70 A;  3AEG B;  5AUI A;  4HJG E;  2IGH A;  4HRO A;  2ACZ B;  2PTL A;  3AV8 A;  3NZ3 A;  4OVZ A;  1JWB D;  1J7A A;  1QIL A;  2RPV A;  3IAM 1;  1NYQ A;  4YTP B;  1ET6 A;  1LO5 D;  2BTE A;  3V3X A;  1C4P A;  4YSX B;  4XWW A;  3AM9 A;  4RCO A;  1VDV A;  3AE9 B;  3PO0 A;  1RWS A;  3Q8C A;  2W54 A;  4XWT A;  3NUH B;  3BVZ A;  1KH0 A;  1IGD A;  1TS4 A;  3FIL A;  2BT6 A;  3KQ4 A;  1XF5 L;  4MT5 A;  4RGO S;  3TSS A;  3V05 A;  3VRA B;  3ZJT A;  2K22 A;  2WXQ A;  1BXT A;  1WRI A;  3TEY A;  1QOG A;  1FFU A;  1P7E A;  2ICI A;  4AQ7 A;  2KAC A;  5EE3 A;  3MC0 B;  4REZ A;  2PW9 A;  5MPO A;  5G5G A;  2WXI A;  1ZP0 B;  2FE8 A;  3U4E G;  4TQ0 A;  2AX5 A;  5T8I A;  5JXV A;  1VZ6 A;  4C80 A;  1SE2 A;  1B1Z A;  1J7B A;  2TSS A;  3W2D A;  3AE4 B;  1I4R A;  2J53 A;  1T3Q A;  4YSY B;  1KRH A;  1TYG B;  2WLB A;  3AE1 B;  2N7J A;  2E3T A;  4WH4 A;  3AE5 B;  3P42 A;  4L2Y A;  1KTK A;  2RDH A;  5FK9 C;  1WXQ A;  3Q8B A;  1BML C;  1SF0 A;  4ZRQ A;  5BMG A;  1B9R A;  3NS1 A;  1L6U A;  3BYY B;  5BYS A;  2FBW B;  4GDK B;  5I4D A;  4B0E A;  4JWU C;  3EA6 A;  2WDV B;  1F2R I;  2GB1 A;  1XCQ L;  1UNS A;  4L23 A;  1DOY A;  1FRR A;  5FKA C;  2K0P A;  4RGT A;  1FM0 D;  4A9A A;  1DOX A;  2BB6 A;  4RGN A;  1DYQ A;  1ZXI A;  1ZOY B;  1FEH A;  1SEB D;  5D7G A;  2V3P A;  1TY2 A;  2I2Y A;  1EWC A;  3PZ7 A;  1P7F A;  2J52 A;  1F0Z A;  3W5U B;  2LJI A;  5BMI A;  1N5W A;  4P16 A;  3TEZ A;  4US9 A;  3AE7 B;  4HKQ A;  4NZL B;  2WDQ B;  1JWM D;  4A6Q A;  4US8 A;  4ZYS A;  4IKG A;  4O1N A;  4A55 A;  1C77 A;  1FMA D;  2INN E;  3Q8F A;  2QEJ C;  2PVO D;  3AED B;  1SSN A;  4KGT A;  1VRA B;  1ZUD 2;  1D5M C;  1OFF A;  3OWE B;  4D2K A;  4NJC A;  3KWV A;  3BK2 A;  3NVZ A;  3O13 A;  2BB5 A;  1C79 A;  1ESF A;  1XO3 A;  3B2F A;  3SEB A;  1E7P B;  2WU2 B;  2ONQ A;  1N63 A;  3E9S A;  1CZP A;  4KGS A;  2ZW1 A;  1UGJ A;  2XN9 C;  3DWM A;  4RNA A;  1MHX A;  1V97 A;  4RGM A;  1EM7 A;  4MM3 B;  1VJK A;  3ZYY X;  1HZ6 A;  1L6V A;  4KKI A;  5EE1 A;  2BS3 B;  1T6B X;  2H89 B;  2WXN A;  3AEF B;  3TUO A;  1TS3 A;  2WP9 B;  1PFD A;  1VR9 A;  1EU4 A;  2Z8L A;  3MHZ A;  1I4P A;  1TKE A;  2INP E;  4GLS C;  1N5X A;  2LFI A;  2ON8 A;  3AEE B;  1KF6 B;  1JRO A;  2OHF A;  3C8Y A;  5EE9 A;  2NMQ A;  3BII D;  1IBX B;  3EUB 2;  4DQO C;  2CU3 A;  2V3N A;  1ZDX A;  3IAS 1;  3RFZ B;  2JQR B;  2WXH A;  2R61 A;  2LEK A;  3B9J A;  2WQY B;  1SJH D;  2DWQ A;  2FUG 1;  1ACC A;  1SXT A;  4XDD A;  1SJE D;  5C3J B;  2KQ4 X;  1R7S A;  4KX6 B;  2W3S A;  5D3D A;  3AN1 A;  4B0M A;  1SBB B;  1VLB A;  3I57 A;  4USA A;  2WXK A;  2WXR A;  1SB3 C;  4JWS C;  2WXG A;  4MAC A;  1TS5 A;  1FFV A;  2IGD A;  4OZA A;  2WS3 B;  4HEA 1;  3VRB B;  2L83 A;  2WU5 B;  1DOI A;  3AE8 B;  3J9C A;  2MJE A;  1TZO A;  2G1E A;  2QJL A;  1RM6 C;  1PYW D;  1ZPS A;  2L1A A;  1XXG A;  1FNW A;  1FCC C;  1JQ4 A;  2MEK A;  5C2T B;  1YQ4 B;  1F77 A;  2NTT A;  2LMC A;  2GRI A;  3IT4 B;  1QF6 A;  2KAJ A;  3LYY A;  2X38 A;  1V1P B;  2CJO A;  1L0V B;  1D5Z C;  1MHH E;  1PGB A;  1EU3 A;  1STE A;  4UDU C;  2J4X A;  1AW7 A;  4A8X C;  4FXC A;  1JAL A;  2YEP F;  2WNM A;  3AEB B;  4DXF A;  2PKO A;  1F2R C;  1GOZ A;  2JXT A;  1NVI D;  3MJ5 A;  5AUK A;  1QLB B;  1C4C A;  3BVM A;  3P4P B;  1FIQ A;  2MJ3 A;  2DYM A;  3HRD D;  3L4P A;  1E9M A;  1N61 A;  1WWT A;  5H92 C;  2WXP A;  3BWU D;  4WUR A;  1K50 A;  5BYR A;  1JML A;  1WSP A;  1YN3 A;  3P63 A;  4ZRP A;  1IUE A;  1JW9 D;  2PVG C;  2W55 A;  1J7C A;  2MH7 A;  3NVY A;  4TMA B;  4ARC A;  2SAK A;  1OQQ A;  2M0A A;  1VZ8 A;  2KWD A;  3PZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...