4ZOHC

Crystal structure of glyceraldehyde oxidoreductase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
MKIINSDQKVKITLKINGEKYETEVEPRRLLVHVLRELGFTGVHIGCDTSNCGACTVIMNGKSVKSCTVLAVEADGAEILTVEGLAKDGKLHPIQEAFWENHALQCGYCTPGMIMEAYWLLREKPNPTEEEIREGISGNLCRCTGYQNIVKAIKAAAEKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase molybdopterin-binding subunit
publication title Archaeal Mo-Containing Glyceraldehyde Oxidoreductase Isozymes Exhibit Diverse Substrate Specificities through Unique Subunit Assemblies.
pubmed doi rcsb
total genus 49
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
C PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 4zohC02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zohC01
1RM6C 1ZOYB 1WYGA 2ACZB 2W54A 2BT6A 1DGJA 2DWQA 2H88B 2MJ3A 1KF6B 4HROA 1T3QA 3P4PB 4WWMA 1F0ZA 5EE1A 2K5PA 2Y5CA 1JWAD 1B9RA 2PIAA 1FFVA 5EE0A 4ZHPA 1J7AA 3FAHA 1CJEA 1QLBB 2W3SA 5G5HA 5C2TB 2PKOA 3AB5A 1N62A 1A70A 1YQ4B 1IUEA 4JX1C 1QOGA 3AECB 3ZYYX 4ITKA 2KMMA 1XLPA 1QF6A 1E7PB 2W55A 1JWBD 2K22A 3NRZA 4P6VF 1FO4A 1NVID 2H89B 4JWUC 3NVZA 3HUIA 1YQ3B 2MJDA 1GPXA 1TKGA 3AE4B 3LB8C 1L6UA 1YJJA 3EUB2 1L0VB 3P4SB 3AE8B 1ZXIA 2WQYB 4YXDB 1QOBA 4YSZB 2WDRB 3AEFB 4FXCA 1JRPA 3SR6A 4IDIA 3B9JA 4ZOHC 1NYRA 3W9CB 1E0ZA 1E6EB 2E3TA 2KAJA 4C80A 1FRRA 1TKYA 4WQMA 4YSXB 1N5XA 1QT9A 4US9A 1WWTA 5G5GA 1XLNA 2WU2B 2LEKA 2CJOA 2EKIA 3W5VB 2L83A 2PVOD 3AN1A 3AE6B 2WDQB 3NVYA 3NVVA 1EWYC 1RFKA 2WDVB 3AMZA 3HRDD 4YTPB 1UWMA 3P4QB 2JQRB 4A9AA 2JX5A 2CJNA 1WXQA 1I7HA 1FRDA 1FXAA 1N61A 1L6VA 1OQQA 1KRHA 1CZPA 1E9MA 2N0SB 3DWMA 3PO0A 1QOAA 2FBWB 1WRIA 3B2GA 1FXIA 3VRAB 3VR8B 3AE7B 5GXGB 1FFUA 3NS1A 3AE9B 3P1MA 1XLQA 3HVZA 4C7YA 1V97A 2MJEA 3P63A 1ZUD2 4HRSA 2BS2B 3AEGB 3AEAB 1E10A 3AE2B 3KWLA 5H92C 1R7SA 1TJEA 4YTNB 1YJIA 3VRBB 2OHFA 1VLBA 1AYFA 1RYJA 2WS3B 3CWIA 4YSYB 3AEBB 1TKEA 1JQ4A 5C3JB 1RWSA 1VJKA 3P4RB 1VDVA 4C7ZA 4YTMB 3AH7A 3AM9A 3SFEB 1N63A 1N60A 3L4PA 3NVWA 3ABVB 1FMAD 3LXFA 4LTUA 4ZHOA 1FIQA 1NENB 3FC4A 1TYGB 3AE5B 3VR9B 2DBYA 3AE1B 2W3RA 3BIID 1NI3A 4US8A 1SF0A 1JW9D 3AV8A 4JWSC 3WCQA 2B76B 1AWDA 1KFYB 1XO3A 3AEDB 1QOFA 2BS4B 4USAA 1FM0D 1JROA 4N6EB 1DOXA 1NYQA 2K9XA 2WU5B 4KX6B 1N5WA 1OFFA 1SIJA 1PUTA 3SFDB 3AEEB 1PFDA 1DOYA 1SB3C 2M56B 1L5PA 2PVGC 3W5UB 3ETRA 4N59A 1WGKA 5AUKA 5MPOA 5EE3A 1GAQB 1XLOA 2AX5A 2Q5WD 5H8YE 2G1EA 2HTME 1OQRA 1NEKB 4YT0B 2WLBA 2QJLA 2CU3A 2QIEB 3CIRB 1J7BA 1V8CA 1ROEA 2WP9B 5AUIA 1J7CA 2M19A 1ZP0B 1DOIA 3DWGC 2BS3B 1PDXA 2L52A 3AE3B 1JALA 3RPFC 3B2FA 4N58A 5EE9A 2MH7A
chains in the Genus database with same CATH superfamily
2AGOA 1F52A 4I6LB 2ACZB 4E3CA 4CF5A 1P1AA 9ICGA 2V0GA 5J2BA 2KIVA 5AM2A 5ALWA 1B4FA 1MA7A 2DFLA 2K6DB 3ZNGC 2E1FA 1J7AA 4M0WA 2JH1A 1GG3A 3BS5A 3Q3JA 4JE3B 4DF8A 2ISPA 4Y2UA 4R8UA 9ICSA 5ALRA 1Q3UA 2DYBA 5T14A 1C20A 1E8YA 2E5SA 4P0PA 2YB1A 4DXAB 1VD2A 4RPYA 1A77A 2GOLA 3PR5B 1ZQMA 3KHLA 4WWPA 3Q6BA 4HLEA 3AI5A 4HKQA 5IIJA 5DBCA 4TUPA 2ZZPB 2EZYA 1LB2B 4C0ZA 2EQYA 5AK4A 4UAWA 2KZMA 7ICJA 7ICEA 3SENA 4C8MA 5DKWA 2INNE 4F8CB 4I2JA 4M9LA 1RAXA 2TSSA 5C1ZA 2Z7JA 3UXOA 1NK5A 3T3NA 5A0LA 4II2B 2VRRB 3GP7A 9ICPA 1SE9A 2PKEA 5ALQA 2D2QA 4IM3A 1Q8KA 5DQHA 4PZNA 4DL6A 4NPNA 1PK1A 4B95A 1Q5WB 1BPXA 1NK8A 2CXYA 4BDPA 4OVZA 2K4EA 2OOBB 5IA7A 2KJ9A 4NQLB 5DBBA 5ALGA 3MABA 2KC2A 3RJKA 3B2GA 3JPRA 4HWIB 4O3NA 5KT5A 3OSNA 4FS2A 4QZ9A 1XLQA 4UB4A 3JPTA 4YFKA 2UVRA 2KZZA 5IILA 2KSOB 2V4RA 2ZNVC 1YX6B 3DQVA 2QMTA 1S8OA 4F5PA 1UT5A 1RYJA 3L08A 1D9FA 3VAWA 1ET6A 1VJKA 3IG8A 2C2RA 2GBKA 4KDLB 2LYHA 2GWSA 2ZVNA 1S10A 2QILA 2N7JA 3AH7A 3GE3C 1B1ZA 1MVKA 4FFDA 2D3AA 4IQVA 4RQ0A 4GXKA 3BIID 4BVUC 1ZDVA 2C22A 1T8EA 3M63B 1YD8U 2EAMA 4YN4A 5L1LA 1FCLA 1TAMA 3ZTCA 5DB9A 1Z4OA 1F2RI 3ECIA 1HZ5A 2I1KA 4F2SA 1ZQCA 2AX5A 2AJQA 1WWVA 4HYKA 2G1EA 1ZQBA 1RG6A 1ZQNA 4KGSA 2HHXA 3SD7A 2WP9B 2HBKA 4XQ8A 4W9KA 3HM3A 5HFYA 1X6JA 4IL6U 1DOIA 3AQFA 1PDXA 1MG4A 3SAFA 1BNPA 3IN5A 4WWNA 5JXVA 1XO1A 1OQYA 1YNTE 2LVQA 4F4KA 2OEHA 2IO0B 3JSVB 3VVWB 2MJ3A 5J2FA 1KF6B 1P7FA 3P4PB 5CHVC 4FJVB 4Y2PA 4CF4A 4EZ6A 5AIAA 1DRGA 1D4BA 2PIAA 1KJTA 1V85A 4B9KA 4QW8A 1ED1A 3UXPA 2Y0SF 1Y8RC 4PHPA 5C2TB 4I2HA 5IN7A 3SQIA 3RH5A 9ICTA 5B5EU 2INPE 4EZLA 2UVUA 1AROP 1E7PB 5JRTA 3UQ0A 3BQ2A 2K22A 2KLCA 3LDAA 2L0TA 3RFZB 1F1HA 1NNLA 5C23A 2BB5A 1ZQIA 4WJNA 3DPDA 4Z6FA 4FZNA 4CQNA 3CSTA 2BQ3A 5BPCA 2N1VA 1L0VB 3PV8A 3TEZA 2WQYB 2QB1A 4AP9A 2FMPA 2WDRB 3MFGA 2QC8A 3WAMA 2BKFA 4YD2A 9ICKA 2AQ0A 4ZRJA 2KQ7A 2VA8A 2MBEA 1FEHA 4DLGA 2O2VA 3RUIB 1T0RC 1L0XB 2A4ZA 2K3UA 8ICBA 2L83A 4M2YA 3GILA 2RSUA 4HVBA 3AE6B 4KLLA 1WXVA 3NVYA 1EWYC 1SEBD 3AMZA 1K1SA 2KWDA 3DEEA 1LXDA 1MQ3A 2F77X 3PLUA 3D6JA 4NXZA 4GU2A 5AZGA 4F92B 4DL3A 1CMXB 3GZNI 5KFLA 3PZPA 1KW4A 1F44A 3NS8A 3PZ8A 4MSMB 2GRIA 2WXOA 4QIWC 4FO6A 5CWRA 1GB4A 2L0FA 2IOFA 5ALOA 3KLSX 3QCAA 4GSWA 1WX9A 3N9YC 4KN4A 3Q8QB 2ASQA 2XIDA 4OZAA 5JTIA 4F2RA 3KHGA 2WB1F 3KZXA 4HJKA 2DGZA 4MSQB 2AL6A 2JEIA 3BK2A 3QQ8B 3H7IA 1KLGD 1QH9A 2XN9C 3Q8MA 3L4PA 1TK5A 1Q10A 1RRBA 4B9VA 2LD9A 5BMGA 4JB3A 1S1QB 5AEKB 2BPFA 1ZQGA 3FM9A 5BYQA 5KFFA 5AI4A 1JWMD 2F1IA 4YD1A 1JW9D 3KYDD 4JWSC 5CX3A 4REZA 4C56C 4EZJA 3NHEB 1VJ5A 2B3AA 1QQ5A 3HK0A 2ZTCA 4QZFA 4LCDE 4XUSA 1TE2A 3NJTA 1DOYA 3M95A 2H3ZA 2AL3A 4M0WB 3KZIU 4MACA 3BS5B 3EGRA 2ASDA 2KFZA 5H8YE 4KTQA 2ZIWA 4R8UB 3H4BA 3FYHA 4M9JA 1ZQVA 2PMZC 1XQQA 4NAWA 1SKWA 4P0PB 4QZDA 4WJQA 2XCPA 2KANA 3IBEA 4WJPA 1B22A 3RBDA 1KRPA 2ZUCA 2KX3A 4G3XB 5L9XA 2KYWA 4PH5A 1QILA 1TKDA 2HHUA 3TI0A 1RYRA 2V3NA 4FBTA 4PGQA 3ZYYX 4QZIA 3L5KA 5L1IA 1CK1A 8ICSA 5E6JA 4PHAA 4F50A 5KFSA 2HHQA 1YT3A 5AI6A 3RYTA 5EE0A 5FR6A 4BBNC 1NZPA 4X5VA 3RJHA 3UQBA 4LLGM 2JGAA 3RAQA 3ZRFA 3MR3A 4MGYE 3AB5A 1YQ4B 1PK1B 1WH3A 3F2CA 3AULA 1ZJMA 4KZ0A 2FIDA 4AP4C 1H8CA 2XI9A 1SE2A 8ICEA 4IQTA 3BZCA 4BWMA 2N7DA 2NO4A 5JU5A 3RNFC 1S0VA 4EFOA 3ZKJC 7ICMA 2IA6A 2KP7A 1YX5B 3T5HA 1I35A 2ODGA 3BZKA 3M8SA 3SR6A 3T8MA 3WU2U 4DFPA 8ICKA 3UMCA 3KOOA 4YSXB 1ZQAA 3SEIA 3V72A 1QT9A 3JYUA 2WWZA 4DS4A 2MBHA 1VZ8A 1PK3A 1L7YA 2PE9A 5DGAA 2NR2A 2PVOD 1AW7A 5ALLA 2KDEB 1OUQA 1ZD5A 4I2IA 4K4HA 4DHJB 2JVCA 2JQRB 1V9PA 3PRZA 1PVPA 2IO2B 5J2CA 1V49A 1LO5D 1QSSA 3V6KA 4R63A 1XF5L 3SZ2A 2F1HA 3G6VA 2Z0DB 1PGAA 4RF1A 4E74A 3CW2C 4PL1A 3B0YA 2UU7A 4HRSA 4KVGB 3KWLA 4I2CA 1XT9B 3BDPA 3HKZF 3KHRA 2PI4A 4BAXA 2IYDB 2VH1A 1L6NA 5C3JB 5LXIB 3C5FA 4IWPA 4DFJA 4DOAA 1EXNA 4WJ3B 3T3FA 3RMKC 4IR9A 5KFUA 1NK6A 5AZHA 2OJWA 3JPOA 1LFDA 3KD3A 1K50A 1TYGB 3EWAA 3EPGA 2ZTDA 4UAVA 4DWIA 3WKAA 3T5LA 4LDTD 2J4XA 2B6GA 2Z59B 4AYBC 1UQVA 3ZLZA 2NMQA 2BF8B 3KKAA 4NY0A 3AEEB 1IGDA 5KFEA 1L5PA 4JUZA 1WJ6A 5MPOA 4JV2A 3H0RB 2DQNB 3LYSA 4KKIA 1KTQA 4RQ1A 1EUVB 1J2NA 4R66A 2BR0A 2RGFA 1UF0A 2KIWA 3OLMD 1J7BA 1ZQSA 1SSNA 2CHZA 4I2AA 2BQUA 4ZDVA 3AE3B 4F4XA 3C2LA 3AL0B 5F3XB 2FPKA 5KTQA 4UQGA 1D9DA 3VHTC 1EU3A 4LNNA 3ZNZB 3Q8SB 1KKXA 4TURA 3Q14C 2KD1A 1NJZA 3N7RC 2DAFA 4M8MA 4F4ZA 1BT0A 5L95C 1FFVA 1K53A 4Y2XA 2LVPA 4ED7A 4I2BA 2W3SA 4F7ZA 5G5HA 3O65B 3KBBA 2O2VB 1L8OA 3APFA 3ZNHB 1XXGA 4ECVA 4ACOA 4DS5A 5KHQA 4HCPB 4M0AA 4LNKA 2WFAA 3IM1A 4IRKA 2IGHA 2HBLA 4HDOA 5TR5A 1ZD3A 3HUIA 2MX2A 3RD2A 1GPXA 1X40A 5DBAA 1URJA 2C2DA 1RFAA 2L32A 3VH4B 2LPEA 3L0WB 2BW2A 2L1AA 3VUXA 4ED3A 4RQ3A 5DPSA 1EO6A 3VTVA 4ELVA 2LXAA 4YMNA 1RDFA 2F1JA 2D10A 2NBWB 4IQWA 2WXNA 3B08A 4IS7A 8ICPA 2KD0A 3OG5A 3Q8LA 3UIPB 2JRHA 3QHTA 2HVIA 3W5VB 1VR9A 2LRUA 4I27A 4OCZA 2G4SA 1LGRA 3ZIMA 2EMTA 2BYEA 5AKEA 1UWMA 2V4QA 1ZD2P 3P4QB 4ELTA 2W9NA 4Y2YA 2IY1B 3DWMA 4DSLA 4EEWA 1S0MA 2M4NA 5KFDA 5BMHA 2AQ2B 3ISDA 4ICAA 2ZJ8A 2NRWA 4BFRA 4KLSA 3N1ZC 1CQVA 2FCSA 2JYTA 2K39A 1P98A 4FBJB 7ICPA 2KFKA 3HWTA 2O6VD 2HI0A 2YMPA 2QDFA 2ZIWB 1VDVA 1K1QA 5KFJA 2JUOA 5KFTA 2IGDA 4NAWB 1SWVA 1C3TA 1N63A 1N60A 3HT3A 5ALFA 4MH0E 4ZHOA 5J0UA 5JHAA 3QU4A 3T79A 3Q8EA 1ECWA 3ZDEA 4QAYA 2XNAC 1UWXA 2KICA 4II3B 3CF6E 3HJEA 8ICZA 3R7QA 2YQEA 2IPKD 2OM6A 1Z00A 2W8LA 9ICLA 2ZUDA 3LDZE 2HDEA 3H9DA 4KX6B 2KMAA 2LUMA 3MJWA 5FK9C 1KDHA 2B21A 1HUOA 2LJ5A 4DK5A 4ACFA 4UB5A 4W9HA 2K8CA 4B9MA 9ICVA 1CRXA 3RNAC 5E6OA 4C8NA 4DQSA 1QZEA 1GC7A 1M4VA 3CIRB 4GOCA 3BYYB 4YG2A 2K1FA 2JZBA 5GTHU 3Q8BA 3OTQA 3KW5B 2J0MA 3PW7A 9ICUA 4YWGG 3B0XA 3V3XA 2YVCA 3BYTB 4L2YA 1U47A 3UIOB 1C76A 5GMVA 3V7JA 5AI0A 3B0AA 3QIJA 2OH2A 4XX5A 1BUIC 4XRHA 5J2HA 2LHEA 3RNCC 1FNUA 2KK8A 4GXJA 1WM2A 3RB4A 2HHTA 4I2DA 1UGMA 3MFIA 8ICWA 1GC6A 4ITKA 4O3QA 3DDHA 4UB8U 3TKAA 2ESEA 4RU9A 1Z1BA 1RYSA 2WDTB 2BDUA 2WF7A 2N1WA 1IYFA 1IBXA 4RT2A 2BHNA 4A8EA 5ALYA 2AQ4A 1ZQHA 5KG5A 3KYCD 1S76D 5KG4A 1ZXIA 7ICNA 3E58A 2LFIA 2FCQA 3QE9Y 3NY5A 2BQQA 4M04A 3NG0A 3OJUA 3Q2AC 3MGVA 4B9UA 4IWQA 2MRLA 1T6BX 2N1RA 1TK8A 1JRUA 2IHNA 2WXKA 3LJ3A 1HUZA 5G55A 3R2IA 3U30A 1X1MA 1SXDA 1K8RB 1LVHA 1HA5A 4Q8EA 1JMSA 4DXGA 1OQQA 3V62A 1R4NB 1F77A 1Q0WB 1QOAA 4RQ4A 1FXIA 1CEZA 2MWSB 4ZRPA 2ZG6A 2RDBC 5IIIA 2ZTEA 3TIXA 3MTNB 3PSIA 4TV3A 3PSFA 1Z1VA 3SAHA 4DHZB 5KFWA 3ALBA 1GB1A 1TS5A 2VZKB 2FJ6A 2OYYA 3Q3FA 1WCLA 4OJ5A 4BJQA 4Z6CA 2MW5A 2K25A 2JXJA 5CJ7A 5ALNA 2Z0EB 4P4MA 3MP9A 4M9GA 5I4DA 4KLUA 2MUTA 4N9F4 3GV8B 5J0XA 2W82A 5J18A 3C8YA 1ZW7A 2GH1A 9ICCA 4NV0A 4J9OA 2RHFA 2REXA 1T0SC 2JMGA 4DL2A 1Y88A 1JROA 2KKPA 2BGFA 4BKTA 2NYVA 3QU9A 3IFWB 2JRZA 5KG1A 5IKCM 4EZ9A 1WE6A 5IAAC 3UMGA 4O3PA 3L10B 1YZ6A 1BVSA 5D7GA 3UI3A 4CHKA 4RGTA 5J2AA 1YN4A 2EZZA 3NTUA 4FA6A 4J9PA 2K60A 1IP9A 2FLNA 5AZFA 3PY8A 2Y1IA 4YVZA 2LHDA 2W9AA 1COKA 3GIKA 2CHWA 1YN5A 2W54A 3H8MA 1MQ2A 1TT5B 3N97B 3Q8RB 3N3KB 4KDIC 4KX3A 3RH6A 5AIBA 8ICOA 2K5PA 2Y5CA 1UT8A 1I4XA 3A0HU 4KMUA 3TMPB 1HIWA 3SYZA 5DCNA 3FAHA 1SL0A 1RXVA 1X66A 5J2RA 3RJJA 3TARA 4M01A 1TZOA 3F2BA 4BX9C 2Y0SC 5ALTA 1H4RA 5J0SA 3DBLB 2Y9UA 2AHOB 3C21A 3GB1A 4KGTA 3CSFA 5HR7A 5KFZA 2H89B 4Q43A 1OGWA 9ICQA 3EC8A 2KLGA 2MJDA 3I5JC 5DQGA 2AWTA 3TADA 2B0CA 1YJJA 3NOBA 2WHIA 3UQAA 1KN5A 2E8NA 4R64A 3AE8B 4I2GA 4KLOA 3C19A 3UXNA 3KTQA 3ISCA 5KFBA 3H7SA 2WXHA 2P66A 3W1SC 2GBJA 4O3SA 5KFQA 2E8OA 1WWTA 2KFKB 1U49A 4DF4A 2KTRA 3C0RB 4RCOA 5BYRA 4IQUA 4PHDA 7ICIA 1N2XA 3C29A 3ZRCA 2K8BA 1WXQA 4M6WA 2KACA 1I4RA 4BKSD 4J6IA 1T4GA 4MEYA 5AKZA 4KV2A 4R65A 2A1JA 2ZCCA 4RM9A 4UB2A 3LVVA 3AQEA 2VA2A 2HHSA 3NS1A 3D2NA 1Z00B 2HOIA 1BPYA 1UPHA 1G6JA 4CGZA 3R9KA 1WGHA 1ET9A 2KQ4X 5AM0A 1GO3F 3QU2A 4F93B 4YMOA 5AKYA 4RPXA 3URYA 1SKRA 2UWQA 4DHZE 3BK1A 4QZGA 3QU7A 8ICJA 4DFMA 3CWIA 3ZTDA 4AWJA 4KIKA 1YQBA 1D8YA 2K8CB 1Z4NA 3CP8A 1TGZB 4JMUA 3DV9A 3DHGC 4E71A 4GC7A 1JWUD 2JZBB 3WKDA 4LTUA 1PUZA 5AM4A 1T0QC 2ZEQA 4WWOA 3AE1B 3NZ3A 4US8A 3SEBA 3TBLD 3W2DA 4BXOA 4EX6A 4P16A 1ZQQA 2P35A 5KFYA 2H3IA 5ALXA 2WX1A 2FLPA 1NYQA 2WU5B 5J8YC 7ICRA 3SV3A 1A76A 3SFDB 3PTFC 4JWMA 1PFDA 4ECRA 2PVGC 3VQIA 2LXCA 4ELUA 5DDYA 1L5UA 2KJRA 1GAQB 3MHZA 1C4PA 4PS8A 3ZD8A 1V1PA 1UBQA 3H1UA 2R18A 2J42A 4G0NB 4URKA 3KUZA 1SXEA 2W11A 1IBXB 1X9MA 3IT6B 5AKIA 4UB1A 4C4SA 1WXMA 3JW0X 4JWNA 4MM3A 3A1QA 3X0WA 4NM1A 2WX0A 3M3JA 1TTNA 3RR8A 3NASA 1ZQOA 2P6RA 2D3GA 4PYZA 4WURA 4WWMA 1J8CA 2R61A 5EE1A 5AKKA 1GNUA 4DOCA 3AU5A 3KUDB 3L13A 4KKJA 1COOA 8ICLA 3V6CB 4FADA 3S6JA 5J0PA 2PTLA 2UYZB 4CF3A 2ISOA 4YCXA 2HBJA 2I1JA 3V60A 4DWFA 1ZOLA 4TMAB 4CYEA 7ICUA 9ICAA 4QWCA 1LKYA 3VFKA 5D49A 2UVVA 4IM2A 2ZJAA 1T3NA 1F2RC 4DQPA 2ZUBA 2ZIXA 2NRXA 2YB4A 4JIOU 5J0WA 4RPZA 4NL9C 3Q3MC 4YSZB 5KL8B 5DB8A 1QQ7A 4EOYA 3C23A 2KWCA 2RDIA 1I42A 4C80A 4F4YA 1SKSA 5DDMA 9ICBA 1FRRA 2DHZA 1F0MA 4ECWA 3VUYA 1VCBA 1NKCA 2KDMA 3MR5A 1XLNA 3DBHB 3RJFA 1R4NI 1PYWD 2NS5A 3AXCA 4HEA1 1E8XA 4W9LA 1D5MC 1V80A 5ALDA 2WDQB 1MG8A 1WGYA 2LZ6A 1XS9D 4IG7B 4GDKA 3QXGA 2CJNA 2LYBA 9ICIA 2K6QA 2BPCA 2KN4A 2HHWA 2N9EB 4XWTA 1QQ6A 3U7DA 5DG9A 2MUTB 2KFNA 2FBWB 4OO1J 3TJPA 2JR5A 4A3PA 3VRAB 3RNGC 3P1MA 3DVGX 5AM1A 4K4GA 1WI0A 1L7MA 2RD0A 4C8KA 2N9KA 5JHBA 3AE2B 1STEA 4QZAA 4GXIA 1TY0A 4YTNB 2J0KA 2KHQA 2IMWP 2R8JA 5DQIA 4IR1A 4HAIA 3RAXA 7ICFA 2KOBA 2QKQA 8ICFA 2EKEC 2IY0B 2ZVOA 4L1BA 3P4RB 2K8HA 5KAFU 4QWBA 4UATA 4FZLA 3AM9A 4F5NA 2PPHA 2PI5A 3RZWC 1BXTA 4Y2VA 1KLNA 3AE5B 5HP4A 2DBYA 2H3VA 2GBNA 3RRHA 3CYMA 3AEDB 1SV0A 2G0AA 8ICVA 5KFGA 1QOFA 2E1EA 4EX7A 2JT4B 2LJIA 2ZCBA 3L16A 1ESFA 4DDGD 1L0YB 1RQLA 2JYEA 1N5WA 2NTTA 3R7RA 2WAQF 1D5XC 1SIJA 3T3OA 1B43A 3ETRA 4J9SA 2BWES 3QAQA 2FMQA 3B1LX 4UDUC 3U7ZA 1HXYD 1XU4A 3RULA 4MDKE 4ECZA 3PVLA 1C79A 3PS6A 3N28A 2P6UA 9ICMA 4DQOC 2X8XX 1E7VA 1F5SA 2GI9A 2KVRA 3PX6A 2D5GA 3TUOA 1DOQA 1JALA 2LM1A 3IV6A 2I2YA 2G4DB 1YZ7A 2SEBD 2KMDA 1DGJA 5AI8A 3LVWA 9ICFA 5EOZA 2L3ZA 3DBLI 2H3QA 2KKCA 2ASJA 2ZPYA 1KLVA 1I4PA 1JMLA 1TIFA 1WRDB 5ALPA 3JPQA 1UA1A 3RJEA 1WF9A 2E6XA 2KTRB 2K4HA 5FP0A 2NPTA 4O1NA 4UBCA 3Q8PB 2JZPA 3NRZA 4XA5A 5IO9A 1CUKA 2K8BB 3H4DA 4M6WB 3RR7A 4I2EA 2YEPF 1TKGA 2XVTA 4O0IA 2A1JB 5D94A 3EUB2 3MC9A 3PRMB 3RB3A 4R3DA 5J0OA 1QOBA 1LM8B 2ONQA 2BTEA 4KGRA 4ECSA 1KEJA 4LK0M 5ALMA 3GQCA 2CKHB 3PZDA 3M9NB 1S3SG 1D8LA 4TUUA 4LJPB 4US9A 4RGNA 3ONNA 1HTOA 2LEKA 4KIKB 1NKEA 4KSLC 5KFNA 3AN1A 3PNCA 4W9EA 4RMAA 2C2EA 4ICUA 3HRDD 4RGOS 4O3RA 5ALJA 4C4RA 2KN7A 4YMMA 1J2MA 3QK0A 3PSEB 1SGHA 1WMHA 3ZGZA 1L7PA 2ZIVA 1WUDA 4BXOB 3WK5A 2M0XA 5TZVA 4RNMA 3RRGA 2G9HD 4OZCA 5ALHA 5CR0A 1XNSA 1E10A 2XGPA 4CRXA 3M6KA 2XY5A 2FMSA 3E0FA 3MJ5A 2PLPA 3MDCA 1C78A 2OHFA 1WFYA 2OXOA 2JXXA 2C7HA 4LNFA 5HI1A 1V1PB 2C5LC 2EZXA 4J03A 3EYZA 4GC6A 2D3BA 4GIBA 4ZH4A 2PMVA 4NJ7A 3K75D 2JZZA 3QEAZ 4TQ1A 4LVSA 5CEHA 5KFHA 3UINB 3F53A 4MM3B 1SF0A 1ZGUB 2J52A 3A1QB 8ICQA 4Z6DA 2B76B 4W9DA 1ZETA 3PSPA 3GV7B 3PMNA 1KFYB 5AKXA 1MHHE 4QNLA 1FNVA 2ZIUA 2DX5B 3I9V1 4M9NA 4RQ5A 2WF6A 4XC2A 5J0QA 1K5OA 2QARA 3UM9A 4Q8FA 3WANA 1PUTA 2MSNA 5KNIA 1N6ZA 2QHOA 5EE3A 2JEGA 4KX5A 5LLIA 2FLLA 1LKYB 4XYCA 4B6WA 4DBGA 3DHHC 2O6VA 3ZDCA 2PXIA 2CU3A 2D6FC 2DZKA 1ZP0B 2ZIXB 1JN3A 2N9PC 1SL1A 4IC7B 4YQWA 2KC1A 3VR9B 4C4VA 4AUQC 4A8XC 2K4IA 5J2GA 3Q8AA 4HROA 4Q2JA 1ZQJA 3A9JA 3R66C 2K8AA 4RQ6A 5KHOA 4JPSA 3UPQA 3N7SC 3NUHB 3QC8B 1FEZA 3RFAA 4BKGA 4ANUA 5KFAA 1WGGA 3H7PA 3PPAA 4OVUA 2OWOA 3ALRA 3MGHA 5J29A 3OJ4B 4OZBA 2K0PA 2LYAA 1IUEA 1QOGA 4C4TA 1BMLC 1TV9A 5DGBA 2IO3B 1IM4A 2W55A 1NKBA 4Y2JA 1R4MB 3APCA 3TSSA 4GDKB 2VH2A 1MSWD 2F3NA 1TAUA 3L54A 2BGWA 5D3IB 4QIWF 3BWUD 3DBHI 2KXJA 1K51A 4LZDA 2KKVA 4MF8A 3HIZA 2F44A 1JRPA 4RQ2A 4QW9A 1ZQEA 2QSDA 2C60A 4ED6A 2KWVB 3W9CB 2QCZA 1C4AA 5FKAC 4C00A 2V3PA 2HVHA 3H40A 2ALZA 1L8LA 1ZQTA 1QCKA 3PX0A 2NCNA 1WJ4A 1SBBB 4K4IA 3J9CA 2Z8LA 2LMCA 3JPSA 2WDVB 1ZQFA 2C28A 4ECQA 5IIKA 1UBIA 1YJ1A 2IGGA 2Y9TA 2JEJA 2N0SB 4OD0A 2XICA 1E9MA 4B0MA 3BY4B 3Q69A 2YLMA 4KLEA 2M17A 4ZRIA 5GXGB 3SMVA 2Y5BB 8ICHA 4FULA 1QKZA 3P63A 3EA6A 2OCEA 1UNSA 3AEAB 4Y2RA 2IO1B 5KFPA 1Z3EB 3KUCB 4KMOB 1VLBA 8ICNA 4NLBA 5BMIA 3I63C 5J0TA 3R3MA 3M62B 5ALKA 5FR3A 1SL2A 3LXFA 1XSNA 2X38A 2RPVA 3FC4A 3K9PB 1SZPA 2FDRA 5ALUA 2W3RA 1SIFA 3KH0A 4DQQA 1XO3A 2LWPA 2MSED 1MFWA 3DOWA 1U9LA 3TAPA 4CE6A 4RQ7A 4EZKA 3MC1A 3K1ZA 3KQ4A 5IOIA 1V2YA 3SV4A 5AK5A 1OFFA 4LDTB 3QX1A 4WQMA 3ICXA 5CTRC 1NDDA 3Q3OC 2QB0A 1CI4A 4GDLA 1X9SA 2DPJA 5KFCA 7ICSA 2LBOA 3H8SA 1L3VA 1AQ6A 9ICWA 2MRPA 4YR2A 2NPTB 1J19A 1X6IA 1WZ0A 5E6NA 1NEKB 2LI5A 2OJRA 4XDCA 2FE8A 2M8SA 3NZSA 3PT2B 2AU0A 3U4EG 3TAQA 1T94A 1ROEA 1WX7A 4QJFB 1UELA 4YXMA 2V4LA 5E6PA 4UW9A 2AQ1B 3RPFC 1FCCC 5BO4B 3PSTA 5EE9A 1RM6C 1U48A 3LYYA 1HEZE 2YN4A 3F5AA 5AKGA 8ICTA 3NGDA 4DOBA 2AQ3B 2WGSA 4IKGA 1F0ZA 2W03A 3IP4B 2KJ5A 3FILA 1B9RA 2PFPA 2KVCA 4PHEA 1WR1A 1XSLA 5AI9A 4S17A 5AK3A 4GIVA 1H38A 5AI5A 4P0QA 2RRDA 2N7EA 3C1YA 2J7QB 4CDGA 2A3VA 2MP2A 1DK3A 4F71A 4P6VF 1ZQ1C 4BUGA 5KL1B 1RYUA 3P2BA 3ZO5B 1SWWA 2PEAA 1WMHB 3WK7A 4EELA 4DL5A 2ZIVB 1ZQXA 2BCQA 4MJSA 5DB7A 7ICOA 1D6EC 3ZJUA 3I57A 3AEFB 4FXCA 2YEPB 3B9JA 2NO5A 4TUQA 1ZQRA 2NRTA 2E3TA 3BINA 4Y2SA 2V9HA 1RLFA 3ETLA 8ICCA 2ZNVB 4HK2A 2BQRA 4EKUA 2HW3A 4NAMA 2WF5A 3PMLA 3EFUA 3WK4A 3QZ8A 1PGBA 9ICNA 3L17A 3T5JA 3IG3A 1IPGA 2LMRA 3QZ7A 4RZRA 3N32A 5KFMA 4DDID 2DENB 1N61A 3BZDB 3M7DA 2LGDA 3BVZA 3ZVVA 1QQRA 2C9WB 1X2IA 3ZNID 3ML8A 4AYBF 2KT7A 4JV1A 1WGRA 4UAUA 4UBBA 2E8PA 2ZIUB 3BS7A 2JSVX 1P7EA 1UHUA 2MJEA 1ZUD2 2CN1A 3SDLC 4KLIA 2KG5A 2QARB 4MFFA 2RMMA 2RDHA 3AEGB 4IUMB 2I5HA 3H8HA 5IIMA 1WY8A 2YTUA 1XEEA 2INCC 2KQSA 5C5JA 4FN2A 3LWMA 4NLNA 2BWFA 1JQ4A 4DL4A 2DPIA 3BQTA 5AKJA 5AKLA 2IJ0A 1ZQDA 3OJ3A 2NV3A 3HX0A 2O6VB 1OTRB 2KFJA 3ABVB 1FMAD 3OPXA 3U52E 4K7WA 3KHHA 4W9GA 5DPRA 7ICKA 3RI7C 1JIHA 1PQSA 1IV8A 5J2JA 4C4VB 5KT7A 1L7OA 2YMQA 1V6EA 4Z6EA 2CS4A 4IM0A 4BKSA 4CO7A 3A9JB 1WM3A 4FZMA 5H2FU 3VTWA 4C8LA 3HILA 3TEYA 2FCNA 1QTMA 3H0LB 1JXLA 4EBEA 3H7PB 3PGEA 2VANA 3MC8A 3BVMA 3W5UB 2LRWA 5AUKA 3V05A 4O9MA 2LASA 2KVZA 3BJYA 4OHJA 2KMCA 3DVGY 2N4FA 1DXSA 1WZ3A 5DB6A 2BYVE 2DLBA 3MGIA 1XWLA 3DBSA 4UB6U 1S97A 4HCNB 2QIEB 3M9MB 3VTUA 4EEYA 4DSJA 2BCVA 2HD5B 4MHVA 3HP6A 2JU6X 4F91B 1KBUA 3PW5A 2L52A 2LHTA 2HSZA 1C1YB 3B2FA 4WJOA 3M8RA 2ES6A 4Y2QA 2UVWA 1ZOYB 3APDA 2M0NA 1C9FA 2DWQA 1E8ZA 5KAIU 7ICTA 1KFTA 3VCBA 3QA8A 4FS1A 5AKHA 3RNEC 2XEWA 5CHGA 3JPPA 3MDAA 3WK8A 4MELA 4KLQA 4ED0A 4GB9A 3NUQA 3D32A 2J0JA 2XY6A 1IG6A 3ENEA 2N9XA 1T0YA 3K9OB 1OW5A 4IOIE 2G3QB 5DG7A 4EEKA 1ZJNA 4IWOA 2RPQA 3E56A 2KJ6A 2KMMA 2W8KA 3E2EA 2ON8A 2EANA 1YQ3B 3MHSD 4GGQA 1XCQL 2J6UA 3N7PD 4FBUA 2IOFK 2K4PA 2AEHA 3EZ5A 5EDSA 4PYUA 5KFXA 1WR6E 4P2HA 5T8IA 4XGAB 4B0EA 1YMHE 4RF0A 1M6YA 2JEFA 3IT4B 4MFCA 3IHQB 4ZRKA 4DFKA 2RDJA 2ZXHA 1LQBA 3RT3B 3PHXB 2MU2A 4A9AA 3KWVA 1TK0A 1FRDA 3Q3NC 5JH5C 1IXRA 4MGKE 5CHFA 5L1MA 2Q4TA 3SU8X 1A6SA 3M1YA 9ICOA 4ICVA 2VIXA 2K89A 7ICQA 1TBEA 1BGXT 5ALIA 1NOMA 4JV0A 4B9TA 1QLNA 1UGJA 2M0AA 5HMMA 2QB0B 1ZXHA 4KLJA 4GDLB 1Q46A 4YXJA 1AYFA 4DQIA 1C7YA 4O3MA 4NJ8A 1RWSA 2L05A 1L4ZB 3CRXA 4KLDA 4XWWA 1EM7A 2DYOA 1BPDA 2V9WA 1MN8A 4GXBA 3IAS1 5D6JB 2HCFA 1QSLA 2F8LA 1HJPA 2M9NA 2KZ3A 3MR2A 4F5OA 1TZ1A 1MPEA 1AWDA 2YMMA 3H0MB 3EHVA 3QARA 4F5RA 2F2AB 2VKQA 2K9XA 3OJSA 2I6XA 3FILB 3N30A 4A90A 4A55A 4HJGE 2WAQC 3F2DA 2M56B 5HMLA 3RJGA 3SI8A 4P0QB 2RDGA 3T5KA 4ECTA 2WB1C 2AGPA 2MP2B 2WLBA 4P4PA 8ICIA 2MHJA 2IHMA 3SAGA 1J7CA 3JVZX 3DWGC 2PJHA 3D2QA 2BPGA 3QUBA 1V86A 5KFRA 2A19A 1KH0A 4EYHB 2AXTU 4MJSB 4RGMA 4PZOA 2BDPA 2JWZA 5D2MB 2J6SA 4FLHA 1PZNA 3EW9A 4NJCA 5KFKA 4IRCA 7ICHA 4A20A 1QLBB 1NJYA 2WXQA 1ZD4A 4NZLB 4PS7A 4HXDA 8ICXA 1FPYA 4LNOA 1ZE3D 4W9JA 4PT5A 1Q3VA 4X57B 4OJLA 4UB3A 4DLEA 1WXSA 1FO4A 5CRXA 2BBCA 1NVID 2WTFA 2ZPNA 2GBMA 1NJXA 3NVZA 5TISU 3A4RA 1NI2A 3TCAA 4J9KA 2R2OA 1ZQUA 2V4IB 2O6KA 3I76A 3RTVA 2KHWB 2NVUI 2WXPA 3A33B 2KO3A 1Y56A 4DQRA 2KVSA 4MGZE 4ARCA 2G09A 2ZW0A 2BCSA 4G11A 5DPTA 2ZJ5A 4DO9A 3KFUF 1RXWA 2WYQA 1NYRA 3THVA 4MEMA 1ZQZA 4NLCA 2KNBA 1WJNA 3I3TB 1HZ6A 4AS1A 4YR0A 4EUTA 3WAPA 5KG3A 2EKIA 3A4SC 3ZDBA 3DBRB 4ASWC 4P1BC 4I2FA 2VJ5A 3ONSA 3HVDA 3H8JA 4F3OA 3DVNV 4TSSA 2G45B 2HBMA 4J9LA 2AYOB 1FFUA 4GMVA 4LZGA 2FI1A 1WGDA 2HE7A 3ZI4A 7ICGA 1MC8A 4UASA 2D3DA 2EAOA 4KN7A 1R7SA 5H92C 5KFOA 2KNJA 1YJIA 2BKEA 3V6JA 4YSYB 2V3SA 4F1SA 3AEBB 1TKEA 3DCGA 4MH8A 2EH9A 4RM8A 3PLVA 3S2AA 2XK5A 4YTMB 3R8BA 5J2KA 1BPZA 1HQRD 1MJDA 3G6XA 4RFBA 1VZ6A 1HTQA 2FCMA 4F8RA 1NENB 4HPPA 4Q44A 4FJYA 2W43A 3WKBA 1LV5A 4QZ8A 4FE3A 3VXWA 1S5LU 1TAQA 3Q8CA 5LXHA 4RH6A 5JUMA 3KKAC 4USAA 1I4QA 3WIMA 4TUSA 3G6YA 2MAXA 2RR9A 3IAM1 2MCNB 4QZEA 3MBYA 4EE2A 5J0RA 1WJUA 1JCKB 2Q5WD 3HKZC 1X42A 2KDIA 4UARA 2R2QA 3ZDTA 4EBDA 2HMXA 3RBEA 3C28A 1WG8A 3H6NA 3QUCA 3NRWA 2JH7A 2YMLA 1DK2A 4ANXA 5BOMA 2I9GA 5AHXA 4CCHA 3W1YA 1IIPA 2NTSA 2H88B 1KTKA 3OHAA 1UH6A 3ZDAA 1Z5SB 3GV5B 5J0YA 1XD3B 3GS2A 4J9NA 1Q1OA 1KSPA 2F8KA 2DF4B 2G07A 2W9MA 3A0BU 1WXAA 3IVFA 2HOQA 4ARIA 5G2NA 1MHXA 4P1CC 1JI7A 3EPIA 3RJIA 3AE4B 4DFDA 4U6PA 3LB8C 1L6UA 4NY8A 5J2EA 4U7CA 9ICHA 4ED2A 1N48A 1D8BA 7ICLA 3VDZA 2INDC 5AK6A 2BKRB 4L23A 3TEWA 5KG0A 4PJ0U 4ZOHC 4RQMA 2XBBC 1T5XD 1ZQYA 5K4LA 1ZRMA 1ZQWA 1SJED 2FPLA 4YP3A 1EWCA 4GLSC 2W7PA 5G5GA 2BVCA 1V5TA 4DHJD 4M47A 3W1SA 5HR6A 1D5ZC 2GB1A 1P0RA 3NZUA 1HEKA 9ICXA 3RN9C 4K7SA 1RFKA 1A5RA 2LGIA 3QUQA 1E5WA 1VZ7A 4PS3A 4TQ0A 1O08A 5KT3A 4DSFA 2CR5A 2WNMA 4B6JA 1I7HA 1KLUD 2FE9A 4MFAA 4KLGA 3PO4A 5ALZA 3IHPC 4FHJA 3PO0A 3WK9A 2R8GA 2BPSA 4OVVA 1WRIA 3ZXRA 2W9CA 1E8WA 2Y3AA 2W7OA 3BQ1A 1SJHD 4C7YA 3HVZA 4FHKA 4ANWA 4BWJA 3KVFB 4ZYSA 1V1OA 2Q0ZX 4DEZA 2L5YA 3ZDMC 1L3UA 3WAOA 3OGUA 4F4WA 4KSKC 2WXGA 1JUDA 2WXLA 2E8MA 1DGSA 4NLZA 1P3QU 1J97A 1JWSD 2HDOA 1GJZA 3C1ZA 1V38A 3V6HA 2H5XA 1NI3A 2G5HB 2LI6A 4O3OA 3PR4A 3WALA 4G50A 2XCAA 2CU1A 3F5EA 1KM7A 4O5KA 1C77A 5D3DA 1TFRA 4D2KA 2L8JA 3D2SA 5J8YA 4KLFA 4XZ4A 1ZQKA 3GIJA 1L3SA 4B9LA 1WGKA 1OEYA 3AU4A 5EWGA 5HHDG 1TVAA 2KHVA 3TANA 3M9OB 4AQ7A 4ED1A 5J2IA 4IC9A 4B9NA 4M9HA 1OQRA 2KZRA 2LGYA 2KE7A 4HPMB 3PO5A 5HKHA 4J9MA 2IDYA 2EDUA 2KTQA 3CMMB 4WQOB 3PREA 4J3OD 5TSSA 4A3OA 5D4BA 4GN1A 3VC8A 4IRDA 5F9NA 1U4BA 2MLBA 4NQKE 2RLTA 3GU3A 1ACCA 2ZJDA 1T3QA 3GIIA 1XO0A 5BYSA 2W9BA 3JPNA 1V5OA 2JZ3B 2A5UA 2YY6A 5B66U 4MEXA 2FUHB 4E0DA 2ZXIA 1FNWA 1KQQA 2PKOA 5AM5A 1N62A 5J2DA 2PE6B 3RH4A 1EF5A 1ENFA 3QWZB 1N56A 1TS4A 4ZYNA 4WH4A 3GE8C 4KLTA 2LGSA 5KG7A 4QZCA 4I6NB 3WK6A 1EU4A 3UMBA 4G3IA 1D3ZA 4NWIA 2MBBB 5DG8A 1NK4A 3P4SB 3A9KA 1L7NA 3PX4A 3VUWA 2G5IB 2R8KA 3P42A 4NL9A 3DBRI 3ZUNA 4HPLB 2KOXA 4IDIA 2IOHA 5DLFA 3PW0A 1TKYA 1N5XA 4IW0A 2WU2B 3U8ZA 4DL7A 3PRPB 3ISBA 5AM3A 4WAAA 1O03A 2XK5B 5HNKA 5HG2A 3V6EB 1TS3A 4BZAA 3N20C 3DHIC 3ED5A 1ZYQA 2JX5A 4JQWC 2Y1JA 2QEJC 4TQRA 1L6VA 4EBCA 2EAPA 2QLTA 2GLSA 2I38A 3VR8B 3ZXVA 3TL5A 3J81j 4P4OA 4G9BA 2BS2B 1PVRA 5EWFA 2MBQA 2CHXA 2XO7A 2KJ8A 2JWUA 4QZHA 3OSPA 2JY6A 3GFKB 2DZJA 2L00B 2WXIA 3RF9A 2DL0A 3R2TA 5L1KA 4KLMA 2NRZA 4C7ZA 3HW8A 5L83A 1YOVB 2DAJA 3SFEB 1GUAB 4J9RA 5ALVA 2KDBA 3QYPA 9ICEA 3QNMA 4PL2A 8ICRA 1FIQA 4PGYA 4K1RB 3X23A 4RNNA 2KV2A 1WSPA 2LUEA 3AV8A 1PVQA 1MI0A 2JF5A 3UF8A 1V9JA 2ICIA 2GMIC 4N6EB 2J53A 1FD6A 1TY2A 4M8NA 3GDXA 4DSIA 8ICYA 2JPHA 4KLHA 3PW2A 1A0PA 4N59A 2DZIA 4MT5A 3U2SC 1X9WA 1SZHA 2PMZF 3ORYA 2MA1A 2D3CA 5CB1A 4HDQA 1ZQPA 3SHQA 1JXEA 1I4HA 2QJLA 1YIWA 3FKYA 3HM6X 7ICVA 5KG2A 1QSYA 4ECXA 1Z2MA 4Q45A 1S0NA 4NNJB 2BS3B 1ZPSA 4JGHB 2Y5PA 2PFOA 2FNJB 4NM2A 2BZFA 2DYMA 2FAZA 2FUG1 2NRVA 4BBNF 5IP4D 2JHDA 3VH3B 3MR6A 4ZHPA 2ASLA 1CJEA 1OXJA 5HHHA 1ZKHA 1FXTB 2D07B 1L2NA 2J6TA 4JX1C 5E79U 1X9XA 1JWBD 3PVXA 1WE7A 4K81A 4O5CA 1BNOA 5KT2A 4TQSA 4JWUC 3HHMA 3TADC 2G08A 2VA3A 4ZRQA 4ANVA 2I1QA 1AN8A 1SE3A 3LWLA 3Q8KA 4ECYA 3N1XC 5KT4A 2W9CB 4YXDB 1J0GA 4B9SA 4XE0A 2V1YA 4W9IA 2WF8A 5KFIA 1SGGA 3ZJTA 2HOFA 1E0ZA 1B0XA 1E6EB 2KAJA 3O13A 3C2MA 3AU2A 2BB6A 1BPBA 4J9QA 1NK0A 2MEKA 5HHIA 1U4AA 4QWEA 2EMSA 1ZQLA 1WX8A 1SXTA 2NBVB 4JL9A 4BOZB 3TFSA 2BCRA 3NVVA 5ALSA 4GLXA 1BPEA 2PFNA 3C5GA 4H2AA 2HHVA 4AJWA 5CP2A 5IINA 1NK9A 1TS2A 2GO7A 1JX4A 4HKZE 1CZPA 4K3BA 5L1JA 1K52A 3TFRA 2DKZA 2G06A 1NK7A 1I4GA 3AE9B 2EELA 3MC0B 4M00A 1V97A 2VZKD 3OAWA 3ZJVA 4FJZA 3UGBB 2IBIB 4K3CA 2MA9B 3IDWA 9ICRA 1Z19A 3RZFA 4MF2A 1V81A 1F9JA 1UA0A 8ICMA 2KN5A 4MGIE 2XGQA 5LNK1 4QZBA 3Q8FA 3SD5A 4NLGA 4DSKA 2DKXA 3OWEB 2DUYA 2IBKA 1ISNA 3GIMA 4RT3A 2NBUA 4Y2TA 1KFSA 4PGXA 2BS4B 2MBOA 4KZCA 2W9BB 5KFVA 2KSOA 4ECUA 1RQNA 4RNOA 3I28A 2N9LA 2CPRA 2WXJA 2PW9A 2R8IA 1SB3C 1L3TA 2DZMA 3PV1A 2C7MB 2JRIB 1E90A 4P7IA 1C4CA 4F72A 1OEYJ 4M02A 5C0YA 3QX7A 2KK0A 4ED8A 3TQ1A 5DPWA 2YX8A 3IG5A 3K1RB 1S0OA 4NLKA 1UZXB 1V8CA 4OJOA 3N1YC 5KG6A 2PFQA 4F5QA 2M19A 9ICJA 4YL8A 1P7DA 2A1AA 3T9LA 5BOLA 4N58A 4XDDA 2FPMA 4UAYA 1WYGA 3RB0A 3A9KB 3BQ0A 1VRAB 3UQ2A 2BT6A 4I6PA 3DVNU 2WXMA 1SV4A 2D8CA 1NBFC 3EFCA 5CA7A 4QWDA 1JWAD 1HE8A 4RUCA 2XY7A 3I1YA 3V7KA 3OHBA 3BQ7A 3U26A 3L3FX 3IRUA 5D46A 3V61A 4AOFA 1A70A 2GOWA 2KJHB 3AECB 3ZD9A 4W9FA 4LJOB 1XLPA 1SE4A 4RNAA 1QF6A 4I29A 2OEDA 4PK1A 1UD7A 3E9SA 2R8HA 1RZTA 4LJXA 5J17A 1NJWA 4AJYB 3ZDDA 1XCTL 2CRXA 2HJ1A 3JSVA 2HJ8A 4I28A 3QU5A 4K7UA 1M94A 1R4MI 2KX0A 2SAKA 4CNQA 5AICA 1PGXA 2AH5A 2VJ4A 2RQ5A 4EYIB 3QJZA 2XC9A 2CJOA 4LNIA 3MFHA 2WF9A 3N4MB 4DXFA 3CNHA 4TKNA 2FIFA 3GZFA 4YTPB 4BGDA 4UAZA 1YN3A 2JXTA 4NJ6A 3TACB 1WIAA 3AU6A 1T7PA 3O0FA 2ZW1A 2GBRA 1WWUA 3V7LA 2L7RA 1FXAA 5JZEB 4DCCA 1KRHA 3EECA 8ICAA 3WA0A 3ZW3A 4BOSC 2D11A 4O5EA 4W9CA 3QUTA 3H8WA 3AE7B 8ICUA 3AEVA 1DYQA 4PPXA 2WXRA 4OJPA 2BCUA 2MQJA 1UCVA 4S0RA 3PHWB 2M1MA 4RUAA 4DSEA 1E7UA 1ZRNA 5IIOA 1WCNA 1S77D 2RP5A 5GTIU 1TJEA 1XC9A 1EF1A 4GFJA 3WKEA 1ZDXA 3GZNB 3PZ7A 3VRBB 4EENA 1P9DU 2ATLA 1KL9A 4JK1A 5F9LA 2GLEA 2WS3B 3GOEA 2L76A 4WIPA 3ZQ4A 1XSPA 2LM4A 5KT6A 2F76X 2WXFA 2LKYA 2BYFA 3NVWA 2KTFA 3M6ZA 3RNBC 8ICGA 2WHEA 3QEBZ 3TEXA 3K4GA 4RQ8A 3LK9A 3RB6A 1SV0C 3AUOA 4WAFA 3WCQA 3ML9A 2W04A 1KOTA 2KDFB 2H3FA 2AGQA 1NZBA 1GOZA 2LVOA 1FM0D 1DOXA 1U45A 5DLGA 1KFDA 2KEYA 5ALEA 4OJ6A 3C2KA 3DDCB 5CHWA 3FDSA 4JLCA 2C7NB 1RPLA 1XLOA 3IXSA 2KWUB 5EWEA 3HPOA 1IGCA 1L4DB 2HTME 4RQNA 1S9FA 2DNFA 4KITB 4YT0B 4A6QA 3RCZA 2JV3A 1AARA 1UUPA 3BVGA 5AUIA 3PW4A 2LGXA 2BYTA 3WKCA 4C8OA 2HTHA 4QWAA 2IZVB 4OW0A 4YR3A 1WYWB 2MH7A
chains in the Genus database with same CATH topology
4YWGG 4A8XC 3V3XA 2ACZB 3BYTB 2NTSA 3Q8AA 2H88B 1C76A 4HROA 4L2YA 4Q2JA 1KTKA 2V0GA 4JPSA 1BUIC 2LHEA 3NUHB 1FNUA 3GS2A 1J7AA 4M0WA 4OZBA 2K0PA 4JE3B 1IUEA 1QOGA 1BMLC 4ITKA 4ARIA 2W55A 1MHXA 3TSSA 4GDKB 1IBXA 4HKQA 3AE4B 3LB8C 5D3IB 1L6UA 3BWUD 1ZXIA 1K51A 2INNE 2LFIA 4L23A 3TEWA 1JRPA 2TSSA 2QSDA 3T3NA 4ZOHC 3W9CB 1T5XD 3GP7A 1C4AA 1SJED 5FKAC 2V3PA 1EWCA 4GLSC 1T6BX 5G5GA 3W1SA 2WXKA 1D5ZC 2GB1A 3R2IA 1SBBB 3J9CA 2Z8LA 2LMCA 1RFKA 2WDVB 2LGIA 4OVZA 1VZ7A 4TQ0A 1HA5A 2WNMA 1I7HA 1KLUD 2IGGA 4DXGA 1OQQA 2N0SB 1E9MA 4B0MA 3PO0A 1F77A 3Q69A 1QOAA 1WRIA 3B2GA 1FXIA 5GXGB 2Y3AA 4ZRPA 1XLQA 1SJHD 4C7YA 3HVZA 1QKZA 3P63A 4ZYSA 1V1OA 3EA6A 1UNSA 3AEAB 2QMTA 1GB1A 1TS5A 2VZKB 1VLBA 1RYJA 2WXGA 1ET6A 1VJKA 2WXLA 2QILA 5BMIA 2N7JA 3AH7A 1B1ZA 5FR3A 1MVKA 1JWSD 3LXFA 2X38A 3MP9A 2RPVA 3FC4A 5I4DA 2W3RA 3BIID 1NI3A 1ZDVA 2W82A 3C8YA 1XO3A 1JROA 3KQ4A 1FCLA 1OFFA 1C77A 5D3DA 4D2KA 1F2RI 1HZ5A 1WGKA 2AX5A 5HHDG 4AQ7A 2G1EA 5D7GA 3UI3A 1OQRA 1NEKB 4RGTA 1YN4A 4XDCA 2FE8A 4KGSA 3U4EG 1ROEA 2WP9B 2IDYA 5TSSA 5HFYA 4J3OD 1DOIA 1PDXA 2AQ1B 3RPFC 2LHDA 1FCCC 5EE9A 5JXVA 1RM6C 3LYYA 1YNTE 1HEZE 1YN5A 2W54A 2MJ3A 1ACCA 2AQ3B 1KF6B 1P7FA 1T3QA 3P4PB 4IKGA 5BYSA 1F0ZA 2K5PA 2Y5CA 3FILA 1B9RA 1D4BA 2PIAA 1I4XA 3FAHA 1FNWA 5C2TB 2PKOA 1TZOA 1N62A 2INPE 1ENFA 3GB1A 1E7PB 4KGTA 1TS4A 4P6VF 2K22A 4WH4A 3RFZB 2BB5A 2H89B 1EU4A 4CQNA 2MJDA 1YJJA 1L0VB 3P4SB 3AE8B 3TEZA 2WQYB 1D6EC 3ZJUA 3I57A 2WDRB 3AEFB 3MFGA 4FXCA 3P42A 2YEPB 4IDIA 3B9JA 2WXHA 2E3TA 1TKYA 1N5XA 1FEHA 1WWTA 2WU2B 4NAMA 1L0XB 2K3UA 2L83A 1PGBA 3AE6B 4RCOA 5BYRA 5HG2A 3NVYA 1EWYC 1SEBD 3AMZA 1TS3A 2KWDA 2JX5A 1WXQA 2QEJC 2KACA 1I4RA 1L6VA 1N61A 3BZDB 3BVZA 1QQRA 2I38A 3VR8B 3PZ8A 3NS1A 2JSVX 2GRIA 2WXOA 1P7EA 2MJEA 1GB4A 1ZUD2 3KLSX 1ET9A 2BS2B 2KQ4X 2RMMA 3AEGB 2RDHA 2JWUA 1XEEA 3H8HA 3N9YC 4OZAA 3URYA 3BK1A 2WXIA 3CWIA 3R2TA 1JQ4A 2IJ0A 3BK2A 4C7ZA 1KLGD 2XN9C 3SFEB 3L4PA 3ABVB 1Q10A 1FMAD 3U52E 1JWUD 4LTUA 5BMGA 1FIQA 3AE1B 5BYQA 3NZ3A 4US8A 1JWMD 1WSPA 1JW9D 3AV8A 4JWSC 1MI0A 3SEBA 3W2DA 4REZA 4C56C 2ICIA 4P16A 4N6EB 1NYQA 2WU5B 2J53A 1FD6A 3TEYA 1TY2A 3SFDB 1DOYA 1PFDA 4MACA 2PVGC 3BVMA 3W5UB 4N59A 3U2SC 3VQIA 3EGRA 4MT5A 5AUKA 1GAQB 3MHZA 1C4PA 5H8YE 1V1PA 3V05A 4OHJA 2DLBA 2J42A 1I4HA 2QJLA 2QIEB 1IBXB 3IT6B 2JU6X 2BS3B 2L52A 1ZPSA 3B2FA 1QILA 2Y5PA 1ZOYB 2V3NA 1C9FA 2DWQA 4WURA 3ZYYX 4WWMA 1CK1A 5E6JA 2DYMA 2R61A 5EE1A 2FUG1 4KKJA 5EE0A 2PTLA 4ZHPA 1CJEA 4LLGM 4IOIE 3AB5A 4TMAB 1YQ4B 4JX1C 3E56A 2KMMA 1JWBD 1F2RC 1SE2A 4JWUC 2ON8A 1YQ3B 4ZRQA 1AN8A 1SE3A 1XCQL 4YXDB 4XE0A 4YSZB 3ZJTA 3SR6A 1E0ZA 1E6EB 2KAJA 3O13A 4C80A 2BB6A 1FRRA 4YSXB 5T8IA 4B0EA 1QT9A 2MEKA 1YMHE 2KDMA 1XLNA 1VZ8A 4RF0A 3IT4B 4HEA1 1PYWD 1SXTA 2PVOD 1AW7A 1D5MC 2WDQB 3NVVA 4H2AA 2JQRB 4A9AA 2CJNA 3KWVA 1TS2A 1FRDA 2KN4A 4HKZE 1CZPA 4XWTA 2FBWB 1LO5D 1K52A 3VRAB 1XF5L 3AE9B 1I4GA 3MC0B 2EELA 3P1MA 1PGAA 4RF1A 1V97A 2VZKD 4HRSA 3ZJVA 2M0AA 2N9KA 1UGJA 3AE2B 3KWLA 1STEA 4YTNB 1ZXHA 1TY0A 4GDLB 1AYFA 5C3JB 1RWSA 4L1BA 1L4ZB 3P4RB 4XWWA 5LNK1 3Q8FA 1EM7A 2DYOA 3AM9A 3IAS1 1BXTA 3OWEB 1K50A 1TYGB 3AE5B 2DBYA 1MPEA 1AWDA 2J4XA 3AEDB 1QOFA 2BS4B 2LJIA 1ESFA 1L0YB 2K9XA 2JYEA 3FILB 1N5WA 2NTTA 2NMQA 1D5XC 1SIJA 4A90A 2N9LA 4A55A 3AEEB 1IGDA 2WXJA 2PW9A 4HJGE 3T3OA 1SB3C 2M56B 1L5PA 3ETRA 5MPOA 1C4CA 4KKIA 2RDGA 4UDUC 1HXYD 3U7ZA 2WLBA 1C79A 4DQOC 1J7BA 1V8CA 2GI9A 1SSNA 1J7CA 2M19A 3TUOA 3DWGC 3AE3B 1JALA 2I2YA 1KH0A 4N58A 4XDDA 2SEBD 4RGMA 1WYGA 2BT6A 1VRAB 1DGJA 1EU3A 2WXMA 1JWAD 4NJCA 1FFVA 1K53A 1I4PA 1JMLA 1QLBB 2W3SA 5G5HA 2WXQA 4NZLB 1A70A 2E6XA 1XXGA 1ZE3D 3AECB 4PT5A 4O1NA 1XLPA 1SE4A 4RNAA 2JZPA 1QF6A 3NRZA 2OEDA 1FO4A 2BBCA 1NVID 3E9SA 2IGHA 3NVZA 3HUIA 2YEPF 1GPXA 1TKGA 2V4IB 3EUB2 2WXPA 1XCTL 2L32A 1Y56A 4R3DA 1QOBA 4ARCA 2ONQA 2BW2A 2ZW0A 2BTEA 2L1AA 4KGRA 1NYRA 4LK0M 2SAKA 1HZ6A 1PGXA 2WXNA 4WQMA 4AS1A 4US9A 4RGNA 2LEKA 2CJOA 2EKIA 3W5VB 1VR9A 3AN1A 4DXFA 4YTPB 1YN3A 3HRDD 2JXTA 1UWMA 3P4QB 4RGOS 2ZW1A 3HVDA 1FXAA 1KRHA 3DWMA 4TSSA 3ZGZA 3AE7B 1FFUA 2WXRA 1DYQA 2G9HD 5BMHA 2AQ2B 4OZCA 1E10A 1CQVA 1R7SA 1TJEA 2JYTA 3MJ5A 5H92C 1YJIA 1ZDXA 2PLPA 3PZ7A 1C78A 2OHFA 2WS3B 3VRBB 4YSYB 3AEBB 1TKEA 5HI1A 1V1PB 4MH8A 4WIPA 1VDVA 3ZQ4A 4YTMB 2IGDA 4NAWB 3R8BA 2WXFA 1N63A 1N60A 3NVWA 1HQRD 2PMVA 4RFBA 1VZ6A 4TQ1A 4ZHOA 1NENB 3TEXA 4MM3B 3Q8EA 4WAFA 1SF0A 2J52A 2XNAC 1UWXA 3WCQA 2B76B 1KFYB 2IPKD 3Q8CA 1MHHE 1FNVA 1GOZA 3I9V1 4RH6A 4USAA 1FM0D 1I4QA 1DOXA 2HDEA 4KX6B 2LUMA 5FK9C 3IAM1 1PUTA 4EE2A 1JCKB 5EE3A 1XLOA 2Q5WD 3IXSA 1IGCA 1L4DB 2HTME 4YT0B 4A6QA 1M4VA 2CU3A 3CIRB 1UUPA 3BVGA 3BYYB 5AUIA 1ZP0B 3Q8BA 2BYTA 4OW0A 2D5GA 3VR9B 2MH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM6 C;  1ZOY B;  1WYG A;  2ACZ B;  2W54 A;  2BT6 A;  1DGJ A;  2DWQ A;  2H88 B;  2MJ3 A;  1KF6 B;  4HRO A;  1T3Q A;  3P4P B;  4WWM A;  1F0Z A;  5EE1 A;  2K5P A;  2Y5C A;  1JWA D;  1B9R A;  2PIA A;  1FFV A;  5EE0 A;  4ZHP A;  1J7A A;  3FAH A;  1CJE A;  1QLB B;  2W3S A;  5G5H A;  5C2T B;  2PKO A;  3AB5 A;  1N62 A;  1A70 A;  1YQ4 B;  1IUE A;  4JX1 C;  1QOG A;  3AEC B;  3ZYY X;  4ITK A;  2KMM A;  1XLP A;  1QF6 A;  1E7P B;  2W55 A;  1JWB D;  2K22 A;  3NRZ A;  4P6V F;  1FO4 A;  1NVI D;  2H89 B;  4JWU C;  3NVZ A;  3HUI A;  1YQ3 B;  2MJD A;  1GPX A;  1TKG A;  3AE4 B;  3LB8 C;  1L6U A;  1YJJ A;  3EUB 2;  1L0V B;  3P4S B;  3AE8 B;  1ZXI A;  2WQY B;  4YXD B;  1QOB A;  4YSZ B;  2WDR B;  3AEF B;  4FXC A;  1JRP A;  3SR6 A;  4IDI A;  3B9J A;  4ZOH C;  1NYR A;  3W9C B;  1E0Z A;  1E6E B;  2E3T A;  2KAJ A;  4C80 A;  1FRR A;  1TKY A;  4WQM A;  4YSX B;  1N5X A;  1QT9 A;  4US9 A;  1WWT A;  5G5G A;  1XLN A;  2WU2 B;  2LEK A;  2CJO A;  2EKI A;  3W5V B;  2L83 A;  2PVO D;  3AN1 A;  3AE6 B;  2WDQ B;  3NVY A;  3NVV A;  1EWY C;  1RFK A;  2WDV B;  3AMZ A;  3HRD D;  4YTP B;  1UWM A;  3P4Q B;  2JQR B;  4A9A A;  2JX5 A;  2CJN A;  1WXQ A;  1I7H A;  1FRD A;  1FXA A;  1N61 A;  1L6V A;  1OQQ A;  1KRH A;  1CZP A;  1E9M A;  2N0S B;  3DWM A;  3PO0 A;  1QOA A;  2FBW B;  1WRI A;  3B2G A;  1FXI A;  3VRA B;  3VR8 B;  3AE7 B;  5GXG B;  1FFU A;  3NS1 A;  3AE9 B;  3P1M A;  1XLQ A;  3HVZ A;  4C7Y A;  1V97 A;  2MJE A;  3P63 A;  1ZUD 2;  4HRS A;  2BS2 B;  3AEG B;  3AEA B;  1E10 A;  3AE2 B;  3KWL A;  5H92 C;  1R7S A;  1TJE A;  4YTN B;  1YJI A;  3VRB B;  2OHF A;  1VLB A;  1AYF A;  1RYJ A;  2WS3 B;  3CWI A;  4YSY B;  3AEB B;  1TKE A;  1JQ4 A;  5C3J B;  1RWS A;  1VJK A;  3P4R B;  1VDV A;  4C7Z A;  4YTM B;  3AH7 A;  3AM9 A;  3SFE B;  1N63 A;  1N60 A;  3L4P A;  3NVW A;  3ABV B;  1FMA D;  3LXF A;  4LTU A;  4ZHO A;  1FIQ A;  1NEN B;  3FC4 A;  1TYG B;  3AE5 B;  3VR9 B;  2DBY A;  3AE1 B;  2W3R A;  3BII D;  1NI3 A;  4US8 A;  1SF0 A;  1JW9 D;  3AV8 A;  4JWS C;  3WCQ A;  2B76 B;  1AWD A;  1KFY B;  1XO3 A;  3AED B;  1QOF A;  2BS4 B;  4USA A;  1FM0 D;  1JRO A;  4N6E B;  1DOX A;  1NYQ A;  2K9X A;  2WU5 B;  4KX6 B;  1N5W A;  1OFF A;  1SIJ A;  1PUT A;  3SFD B;  3AEE B;  1PFD A;  1DOY A;  1SB3 C;  2M56 B;  1L5P A;  2PVG C;  3W5U B;  3ETR A;  4N59 A;  1WGK A;  5AUK A;  5MPO A;  5EE3 A;  1GAQ B;  1XLO A;  2AX5 A;  2Q5W D;  5H8Y E;  2G1E A;  2HTM E;  1OQR A;  1NEK B;  4YT0 B;  2WLB A;  2QJL A;  2CU3 A;  2QIE B;  3CIR B;  1J7B A;  1V8C A;  1ROE A;  2WP9 B;  5AUI A;  1J7C A;  2M19 A;  1ZP0 B;  1DOI A;  3DWG C;  2BS3 B;  1PDX A;  2L52 A;  3AE3 B;  1JAL A;  3RPF C;  3B2F A;  4N58 A;  5EE9 A;  2MH7 A; 
#chains in the Genus database with same CATH topology
 2AGO A;  1F52 A;  4I6L B;  2ACZ B;  4E3C A;  4CF5 A;  1P1A A;  9ICG A;  2V0G A;  5J2B A;  2KIV A;  5AM2 A;  5ALW A;  1B4F A;  1MA7 A;  2DFL A;  2K6D B;  3ZNG C;  2E1F A;  1J7A A;  4M0W A;  2JH1 A;  1GG3 A;  3BS5 A;  3Q3J A;  4JE3 B;  4DF8 A;  2ISP A;  4Y2U A;  4R8U A;  9ICS A;  5ALR A;  1Q3U A;  2DYB A;  5T14 A;  1C20 A;  1E8Y A;  2E5S A;  4P0P A;  2YB1 A;  4DXA B;  1VD2 A;  4RPY A;  1A77 A;  2GOL A;  3PR5 B;  1ZQM A;  3KHL A;  4WWP A;  3Q6B A;  4HLE A;  3AI5 A;  4HKQ A;  5IIJ A;  5DBC A;  4TUP A;  2ZZP B;  2EZY A;  1LB2 B;  4C0Z A;  2EQY A;  5AK4 A;  4UAW A;  2KZM A;  7ICJ A;  7ICE A;  3SEN A;  4C8M A;  5DKW A;  2INN E;  4F8C B;  4I2J A;  4M9L A;  1RAX A;  2TSS A;  5C1Z A;  2Z7J A;  3UXO A;  1NK5 A;  3T3N A;  5A0L A;  4II2 B;  2VRR B;  3GP7 A;  9ICP A;  1SE9 A;  2PKE A;  5ALQ A;  2D2Q A;  4IM3 A;  1Q8K A;  5DQH A;  4PZN A;  4DL6 A;  4NPN A;  1PK1 A;  4B95 A;  1Q5W B;  1BPX A;  1NK8 A;  2CXY A;  4BDP A;  4OVZ A;  2K4E A;  2OOB B;  5IA7 A;  2KJ9 A;  4NQL B;  5DBB A;  5ALG A;  3MAB A;  2KC2 A;  3RJK A;  3B2G A;  3JPR A;  4HWI B;  4O3N A;  5KT5 A;  3OSN A;  4FS2 A;  4QZ9 A;  1XLQ A;  4UB4 A;  3JPT A;  4YFK A;  2UVR A;  2KZZ A;  5IIL A;  2KSO B;  2V4R A;  2ZNV C;  1YX6 B;  3DQV A;  2QMT A;  1S8O A;  4F5P A;  1UT5 A;  1RYJ A;  3L08 A;  1D9F A;  3VAW A;  1ET6 A;  1VJK A;  3IG8 A;  2C2R A;  2GBK A;  4KDL B;  2LYH A;  2GWS A;  2ZVN A;  1S10 A;  2QIL A;  2N7J A;  3AH7 A;  3GE3 C;  1B1Z A;  1MVK A;  4FFD A;  2D3A A;  4IQV A;  4RQ0 A;  4GXK A;  3BII D;  4BVU C;  1ZDV A;  2C22 A;  1T8E A;  3M63 B;  1YD8 U;  2EAM A;  4YN4 A;  5L1L A;  1FCL A;  1TAM A;  3ZTC A;  5DB9 A;  1Z4O A;  1F2R I;  3ECI A;  1HZ5 A;  2I1K A;  4F2S A;  1ZQC A;  2AX5 A;  2AJQ A;  1WWV A;  4HYK A;  2G1E A;  1ZQB A;  1RG6 A;  1ZQN A;  4KGS A;  2HHX A;  3SD7 A;  2WP9 B;  2HBK A;  4XQ8 A;  4W9K A;  3HM3 A;  5HFY A;  1X6J A;  4IL6 U;  1DOI A;  3AQF A;  1PDX A;  1MG4 A;  3SAF A;  1BNP A;  3IN5 A;  4WWN A;  5JXV A;  1XO1 A;  1OQY A;  1YNT E;  2LVQ A;  4F4K A;  2OEH A;  2IO0 B;  3JSV B;  3VVW B;  2MJ3 A;  5J2F A;  1KF6 B;  1P7F A;  3P4P B;  5CHV C;  4FJV B;  4Y2P A;  4CF4 A;  4EZ6 A;  5AIA A;  1DRG A;  1D4B A;  2PIA A;  1KJT A;  1V85 A;  4B9K A;  4QW8 A;  1ED1 A;  3UXP A;  2Y0S F;  1Y8R C;  4PHP A;  5C2T B;  4I2H A;  5IN7 A;  3SQI A;  3RH5 A;  9ICT A;  5B5E U;  2INP E;  4EZL A;  2UVU A;  1ARO P;  1E7P B;  5JRT A;  3UQ0 A;  3BQ2 A;  2K22 A;  2KLC A;  3LDA A;  2L0T A;  3RFZ B;  1F1H A;  1NNL A;  5C23 A;  2BB5 A;  1ZQI A;  4WJN A;  3DPD A;  4Z6F A;  4FZN A;  4CQN A;  3CST A;  2BQ3 A;  5BPC A;  2N1V A;  1L0V B;  3PV8 A;  3TEZ A;  2WQY B;  2QB1 A;  4AP9 A;  2FMP A;  2WDR B;  3MFG A;  2QC8 A;  3WAM A;  2BKF A;  4YD2 A;  9ICK A;  2AQ0 A;  4ZRJ A;  2KQ7 A;  2VA8 A;  2MBE A;  1FEH A;  4DLG A;  2O2V A;  3RUI B;  1T0R C;  1L0X B;  2A4Z A;  2K3U A;  8ICB A;  2L83 A;  4M2Y A;  3GIL A;  2RSU A;  4HVB A;  3AE6 B;  4KLL A;  1WXV A;  3NVY A;  1EWY C;  1SEB D;  3AMZ A;  1K1S A;  2KWD A;  3DEE A;  1LXD A;  1MQ3 A;  2F77 X;  3PLU A;  3D6J A;  4NXZ A;  4GU2 A;  5AZG A;  4F92 B;  4DL3 A;  1CMX B;  3GZN I;  5KFL A;  3PZP A;  1KW4 A;  1F44 A;  3NS8 A;  3PZ8 A;  4MSM B;  2GRI A;  2WXO A;  4QIW C;  4FO6 A;  5CWR A;  1GB4 A;  2L0F A;  2IOF A;  5ALO A;  3KLS X;  3QCA A;  4GSW A;  1WX9 A;  3N9Y C;  4KN4 A;  3Q8Q B;  2ASQ A;  2XID A;  4OZA A;  5JTI A;  4F2R A;  3KHG A;  2WB1 F;  3KZX A;  4HJK A;  2DGZ A;  4MSQ B;  2AL6 A;  2JEI A;  3BK2 A;  3QQ8 B;  3H7I A;  1KLG D;  1QH9 A;  2XN9 C;  3Q8M A;  3L4P A;  1TK5 A;  1Q10 A;  1RRB A;  4B9V A;  2LD9 A;  5BMG A;  4JB3 A;  1S1Q B;  5AEK B;  2BPF A;  1ZQG A;  3FM9 A;  5BYQ A;  5KFF A;  5AI4 A;  1JWM D;  2F1I A;  4YD1 A;  1JW9 D;  3KYD D;  4JWS C;  5CX3 A;  4REZ A;  4C56 C;  4EZJ A;  3NHE B;  1VJ5 A;  2B3A A;  1QQ5 A;  3HK0 A;  2ZTC A;  4QZF A;  4LCD E;  4XUS A;  1TE2 A;  3NJT A;  1DOY A;  3M95 A;  2H3Z A;  2AL3 A;  4M0W B;  3KZI U;  4MAC A;  3BS5 B;  3EGR A;  2ASD A;  2KFZ A;  5H8Y E;  4KTQ A;  2ZIW A;  4R8U B;  3H4B A;  3FYH A;  4M9J A;  1ZQV A;  2PMZ C;  1XQQ A;  4NAW A;  1SKW A;  4P0P B;  4QZD A;  4WJQ A;  2XCP A;  2KAN A;  3IBE A;  4WJP A;  1B22 A;  3RBD A;  1KRP A;  2ZUC A;  2KX3 A;  4G3X B;  5L9X A;  2KYW A;  4PH5 A;  1QIL A;  1TKD A;  2HHU A;  3TI0 A;  1RYR A;  2V3N A;  4FBT A;  4PGQ A;  3ZYY X;  4QZI A;  3L5K A;  5L1I A;  1CK1 A;  8ICS A;  5E6J A;  4PHA A;  4F50 A;  5KFS A;  2HHQ A;  1YT3 A;  5AI6 A;  3RYT A;  5EE0 A;  5FR6 A;  4BBN C;  1NZP A;  4X5V A;  3RJH A;  3UQB A;  4LLG M;  2JGA A;  3RAQ A;  3ZRF A;  3MR3 A;  4MGY E;  3AB5 A;  1YQ4 B;  1PK1 B;  1WH3 A;  3F2C A;  3AUL A;  1ZJM A;  4KZ0 A;  2FID A;  4AP4 C;  1H8C A;  2XI9 A;  1SE2 A;  8ICE A;  4IQT A;  3BZC A;  4BWM A;  2N7D A;  2NO4 A;  5JU5 A;  3RNF C;  1S0V A;  4EFO A;  3ZKJ C;  7ICM A;  2IA6 A;  2KP7 A;  1YX5 B;  3T5H A;  1I35 A;  2ODG A;  3BZK A;  3M8S A;  3SR6 A;  3T8M A;  3WU2 U;  4DFP A;  8ICK A;  3UMC A;  3KOO A;  4YSX B;  1ZQA A;  3SEI A;  3V72 A;  1QT9 A;  3JYU A;  2WWZ A;  4DS4 A;  2MBH A;  1VZ8 A;  1PK3 A;  1L7Y A;  2PE9 A;  5DGA A;  2NR2 A;  2PVO D;  1AW7 A;  5ALL A;  2KDE B;  1OUQ A;  1ZD5 A;  4I2I A;  4K4H A;  4DHJ B;  2JVC A;  2JQR B;  1V9P A;  3PRZ A;  1PVP A;  2IO2 B;  5J2C A;  1V49 A;  1LO5 D;  1QSS A;  3V6K A;  4R63 A;  1XF5 L;  3SZ2 A;  2F1H A;  3G6V A;  2Z0D B;  1PGA A;  4RF1 A;  4E74 A;  3CW2 C;  4PL1 A;  3B0Y A;  2UU7 A;  4HRS A;  4KVG B;  3KWL A;  4I2C A;  1XT9 B;  3BDP A;  3HKZ F;  3KHR A;  2PI4 A;  4BAX A;  2IYD B;  2VH1 A;  1L6N A;  5C3J B;  5LXI B;  3C5F A;  4IWP A;  4DFJ A;  4DOA A;  1EXN A;  4WJ3 B;  3T3F A;  3RMK C;  4IR9 A;  5KFU A;  1NK6 A;  5AZH A;  2OJW A;  3JPO A;  1LFD A;  3KD3 A;  1K50 A;  1TYG B;  3EWA A;  3EPG A;  2ZTD A;  4UAV A;  4DWI A;  3WKA A;  3T5L A;  4LDT D;  2J4X A;  2B6G A;  2Z59 B;  4AYB C;  1UQV A;  3ZLZ A;  2NMQ A;  2BF8 B;  3KKA A;  4NY0 A;  3AEE B;  1IGD A;  5KFE A;  1L5P A;  4JUZ A;  1WJ6 A;  5MPO A;  4JV2 A;  3H0R B;  2DQN B;  3LYS A;  4KKI A;  1KTQ A;  4RQ1 A;  1EUV B;  1J2N A;  4R66 A;  2BR0 A;  2RGF A;  1UF0 A;  2KIW A;  3OLM D;  1J7B A;  1ZQS A;  1SSN A;  2CHZ A;  4I2A A;  2BQU A;  4ZDV A;  3AE3 B;  4F4X A;  3C2L A;  3AL0 B;  5F3X B;  2FPK A;  5KTQ A;  4UQG A;  1D9D A;  3VHT C;  1EU3 A;  4LNN A;  3ZNZ B;  3Q8S B;  1KKX A;  4TUR A;  3Q14 C;  2KD1 A;  1NJZ A;  3N7R C;  2DAF A;  4M8M A;  4F4Z A;  1BT0 A;  5L95 C;  1FFV A;  1K53 A;  4Y2X A;  2LVP A;  4ED7 A;  4I2B A;  2W3S A;  4F7Z A;  5G5H A;  3O65 B;  3KBB A;  2O2V B;  1L8O A;  3APF A;  3ZNH B;  1XXG A;  4ECV A;  4ACO A;  4DS5 A;  5KHQ A;  4HCP B;  4M0A A;  4LNK A;  2WFA A;  3IM1 A;  4IRK A;  2IGH A;  2HBL A;  4HDO A;  5TR5 A;  1ZD3 A;  3HUI A;  2MX2 A;  3RD2 A;  1GPX A;  1X40 A;  5DBA A;  1URJ A;  2C2D A;  1RFA A;  2L32 A;  3VH4 B;  2LPE A;  3L0W B;  2BW2 A;  2L1A A;  3VUX A;  4ED3 A;  4RQ3 A;  5DPS A;  1EO6 A;  3VTV A;  4ELV A;  2LXA A;  4YMN A;  1RDF A;  2F1J A;  2D10 A;  2NBW B;  4IQW A;  2WXN A;  3B08 A;  4IS7 A;  8ICP A;  2KD0 A;  3OG5 A;  3Q8L A;  3UIP B;  2JRH A;  3QHT A;  2HVI A;  3W5V B;  1VR9 A;  2LRU A;  4I27 A;  4OCZ A;  2G4S A;  1LGR A;  3ZIM A;  2EMT A;  2BYE A;  5AKE A;  1UWM A;  2V4Q A;  1ZD2 P;  3P4Q B;  4ELT A;  2W9N A;  4Y2Y A;  2IY1 B;  3DWM A;  4DSL A;  4EEW A;  1S0M A;  2M4N A;  5KFD A;  5BMH A;  2AQ2 B;  3ISD A;  4ICA A;  2ZJ8 A;  2NRW A;  4BFR A;  4KLS A;  3N1Z C;  1CQV A;  2FCS A;  2JYT A;  2K39 A;  1P98 A;  4FBJ B;  7ICP A;  2KFK A;  3HWT A;  2O6V D;  2HI0 A;  2YMP A;  2QDF A;  2ZIW B;  1VDV A;  1K1Q A;  5KFJ A;  2JUO A;  5KFT A;  2IGD A;  4NAW B;  1SWV A;  1C3T A;  1N63 A;  1N60 A;  3HT3 A;  5ALF A;  4MH0 E;  4ZHO A;  5J0U A;  5JHA A;  3QU4 A;  3T79 A;  3Q8E A;  1ECW A;  3ZDE A;  4QAY A;  2XNA C;  1UWX A;  2KIC A;  4II3 B;  3CF6 E;  3HJE A;  8ICZ A;  3R7Q A;  2YQE A;  2IPK D;  2OM6 A;  1Z00 A;  2W8L A;  9ICL A;  2ZUD A;  3LDZ E;  2HDE A;  3H9D A;  4KX6 B;  2KMA A;  2LUM A;  3MJW A;  5FK9 C;  1KDH A;  2B21 A;  1HUO A;  2LJ5 A;  4DK5 A;  4ACF A;  4UB5 A;  4W9H A;  2K8C A;  4B9M A;  9ICV A;  1CRX A;  3RNA C;  5E6O A;  4C8N A;  4DQS A;  1QZE A;  1GC7 A;  1M4V A;  3CIR B;  4GOC A;  3BYY B;  4YG2 A;  2K1F A;  2JZB A;  5GTH U;  3Q8B A;  3OTQ A;  3KW5 B;  2J0M A;  3PW7 A;  9ICU A;  4YWG G;  3B0X A;  3V3X A;  2YVC A;  3BYT B;  4L2Y A;  1U47 A;  3UIO B;  1C76 A;  5GMV A;  3V7J A;  5AI0 A;  3B0A A;  3QIJ A;  2OH2 A;  4XX5 A;  1BUI C;  4XRH A;  5J2H A;  2LHE A;  3RNC C;  1FNU A;  2KK8 A;  4GXJ A;  1WM2 A;  3RB4 A;  2HHT A;  4I2D A;  1UGM A;  3MFI A;  8ICW A;  1GC6 A;  4ITK A;  4O3Q A;  3DDH A;  4UB8 U;  3TKA A;  2ESE A;  4RU9 A;  1Z1B A;  1RYS A;  2WDT B;  2BDU A;  2WF7 A;  2N1W A;  1IYF A;  1IBX A;  4RT2 A;  2BHN A;  4A8E A;  5ALY A;  2AQ4 A;  1ZQH A;  5KG5 A;  3KYC D;  1S76 D;  5KG4 A;  1ZXI A;  7ICN A;  3E58 A;  2LFI A;  2FCQ A;  3QE9 Y;  3NY5 A;  2BQQ A;  4M04 A;  3NG0 A;  3OJU A;  3Q2A C;  3MGV A;  4B9U A;  4IWQ A;  2MRL A;  1T6B X;  2N1R A;  1TK8 A;  1JRU A;  2IHN A;  2WXK A;  3LJ3 A;  1HUZ A;  5G55 A;  3R2I A;  3U30 A;  1X1M A;  1SXD A;  1K8R B;  1LVH A;  1HA5 A;  4Q8E A;  1JMS A;  4DXG A;  1OQQ A;  3V62 A;  1R4N B;  1F77 A;  1Q0W B;  1QOA A;  4RQ4 A;  1FXI A;  1CEZ A;  2MWS B;  4ZRP A;  2ZG6 A;  2RDB C;  5III A;  2ZTE A;  3TIX A;  3MTN B;  3PSI A;  4TV3 A;  3PSF A;  1Z1V A;  3SAH A;  4DHZ B;  5KFW A;  3ALB A;  1GB1 A;  1TS5 A;  2VZK B;  2FJ6 A;  2OYY A;  3Q3F A;  1WCL A;  4OJ5 A;  4BJQ A;  4Z6C A;  2MW5 A;  2K25 A;  2JXJ A;  5CJ7 A;  5ALN A;  2Z0E B;  4P4M A;  3MP9 A;  4M9G A;  5I4D A;  4KLU A;  2MUT A;  4N9F 4;  3GV8 B;  5J0X A;  2W82 A;  5J18 A;  3C8Y A;  1ZW7 A;  2GH1 A;  9ICC A;  4NV0 A;  4J9O A;  2RHF A;  2REX A;  1T0S C;  2JMG A;  4DL2 A;  1Y88 A;  1JRO A;  2KKP A;  2BGF A;  4BKT A;  2NYV A;  3QU9 A;  3IFW B;  2JRZ A;  5KG1 A;  5IKC M;  4EZ9 A;  1WE6 A;  5IAA C;  3UMG A;  4O3P A;  3L10 B;  1YZ6 A;  1BVS A;  5D7G A;  3UI3 A;  4CHK A;  4RGT A;  5J2A A;  1YN4 A;  2EZZ A;  3NTU A;  4FA6 A;  4J9P A;  2K60 A;  1IP9 A;  2FLN A;  5AZF A;  3PY8 A;  2Y1I A;  4YVZ A;  2LHD A;  2W9A A;  1COK A;  3GIK A;  2CHW A;  1YN5 A;  2W54 A;  3H8M A;  1MQ2 A;  1TT5 B;  3N97 B;  3Q8R B;  3N3K B;  4KDI C;  4KX3 A;  3RH6 A;  5AIB A;  8ICO A;  2K5P A;  2Y5C A;  1UT8 A;  1I4X A;  3A0H U;  4KMU A;  3TMP B;  1HIW A;  3SYZ A;  5DCN A;  3FAH A;  1SL0 A;  1RXV A;  1X66 A;  5J2R A;  3RJJ A;  3TAR A;  4M01 A;  1TZO A;  3F2B A;  4BX9 C;  2Y0S C;  5ALT A;  1H4R A;  5J0S A;  3DBL B;  2Y9U A;  2AHO B;  3C21 A;  3GB1 A;  4KGT A;  3CSF A;  5HR7 A;  5KFZ A;  2H89 B;  4Q43 A;  1OGW A;  9ICQ A;  3EC8 A;  2KLG A;  2MJD A;  3I5J C;  5DQG A;  2AWT A;  3TAD A;  2B0C A;  1YJJ A;  3NOB A;  2WHI A;  3UQA A;  1KN5 A;  2E8N A;  4R64 A;  3AE8 B;  4I2G A;  4KLO A;  3C19 A;  3UXN A;  3KTQ A;  3ISC A;  5KFB A;  3H7S A;  2WXH A;  2P66 A;  3W1S C;  2GBJ A;  4O3S A;  5KFQ A;  2E8O A;  1WWT A;  2KFK B;  1U49 A;  4DF4 A;  2KTR A;  3C0R B;  4RCO A;  5BYR A;  4IQU A;  4PHD A;  7ICI A;  1N2X A;  3C29 A;  3ZRC A;  2K8B A;  1WXQ A;  4M6W A;  2KAC A;  1I4R A;  4BKS D;  4J6I A;  1T4G A;  4MEY A;  5AKZ A;  4KV2 A;  4R65 A;  2A1J A;  2ZCC A;  4RM9 A;  4UB2 A;  3LVV A;  3AQE A;  2VA2 A;  2HHS A;  3NS1 A;  3D2N A;  1Z00 B;  2HOI A;  1BPY A;  1UPH A;  1G6J A;  4CGZ A;  3R9K A;  1WGH A;  1ET9 A;  2KQ4 X;  5AM0 A;  1GO3 F;  3QU2 A;  4F93 B;  4YMO A;  5AKY A;  4RPX A;  3URY A;  1SKR A;  2UWQ A;  4DHZ E;  3BK1 A;  4QZG A;  3QU7 A;  8ICJ A;  4DFM A;  3CWI A;  3ZTD A;  4AWJ A;  4KIK A;  1YQB A;  1D8Y A;  2K8C B;  1Z4N A;  3CP8 A;  1TGZ B;  4JMU A;  3DV9 A;  3DHG C;  4E71 A;  4GC7 A;  1JWU D;  2JZB B;  3WKD A;  4LTU A;  1PUZ A;  5AM4 A;  1T0Q C;  2ZEQ A;  4WWO A;  3AE1 B;  3NZ3 A;  4US8 A;  3SEB A;  3TBL D;  3W2D A;  4BXO A;  4EX6 A;  4P16 A;  1ZQQ A;  2P35 A;  5KFY A;  2H3I A;  5ALX A;  2WX1 A;  2FLP A;  1NYQ A;  2WU5 B;  5J8Y C;  7ICR A;  3SV3 A;  1A76 A;  3SFD B;  3PTF C;  4JWM A;  1PFD A;  4ECR A;  2PVG C;  3VQI A;  2LXC A;  4ELU A;  5DDY A;  1L5U A;  2KJR A;  1GAQ B;  3MHZ A;  1C4P A;  4PS8 A;  3ZD8 A;  1V1P A;  1UBQ A;  3H1U A;  2R18 A;  2J42 A;  4G0N B;  4URK A;  3KUZ A;  1SXE A;  2W11 A;  1IBX B;  1X9M A;  3IT6 B;  5AKI A;  4UB1 A;  4C4S A;  1WXM A;  3JW0 X;  4JWN A;  4MM3 A;  3A1Q A;  3X0W A;  4NM1 A;  2WX0 A;  3M3J A;  1TTN A;  3RR8 A;  3NAS A;  1ZQO A;  2P6R A;  2D3G A;  4PYZ A;  4WUR A;  4WWM A;  1J8C A;  2R61 A;  5EE1 A;  5AKK A;  1GNU A;  4DOC A;  3AU5 A;  3KUD B;  3L13 A;  4KKJ A;  1COO A;  8ICL A;  3V6C B;  4FAD A;  3S6J A;  5J0P A;  2PTL A;  2UYZ B;  4CF3 A;  2ISO A;  4YCX A;  2HBJ A;  2I1J A;  3V60 A;  4DWF A;  1ZOL A;  4TMA B;  4CYE A;  7ICU A;  9ICA A;  4QWC A;  1LKY A;  3VFK A;  5D49 A;  2UVV A;  4IM2 A;  2ZJA A;  1T3N A;  1F2R C;  4DQP A;  2ZUB A;  2ZIX A;  2NRX A;  2YB4 A;  4JIO U;  5J0W A;  4RPZ A;  4NL9 C;  3Q3M C;  4YSZ B;  5KL8 B;  5DB8 A;  1QQ7 A;  4EOY A;  3C23 A;  2KWC A;  2RDI A;  1I42 A;  4C80 A;  4F4Y A;  1SKS A;  5DDM A;  9ICB A;  1FRR A;  2DHZ A;  1F0M A;  4ECW A;  3VUY A;  1VCB A;  1NKC A;  2KDM A;  3MR5 A;  1XLN A;  3DBH B;  3RJF A;  1R4N I;  1PYW D;  2NS5 A;  3AXC A;  4HEA 1;  1E8X A;  4W9L A;  1D5M C;  1V80 A;  5ALD A;  2WDQ B;  1MG8 A;  1WGY A;  2LZ6 A;  1XS9 D;  4IG7 B;  4GDK A;  3QXG A;  2CJN A;  2LYB A;  9ICI A;  2K6Q A;  2BPC A;  2KN4 A;  2HHW A;  2N9E B;  4XWT A;  1QQ6 A;  3U7D A;  5DG9 A;  2MUT B;  2KFN A;  2FBW B;  4OO1 J;  3TJP A;  2JR5 A;  4A3P A;  3VRA B;  3RNG C;  3P1M A;  3DVG X;  5AM1 A;  4K4G A;  1WI0 A;  1L7M A;  2RD0 A;  4C8K A;  2N9K A;  5JHB A;  3AE2 B;  1STE A;  4QZA A;  4GXI A;  1TY0 A;  4YTN B;  2J0K A;  2KHQ A;  2IMW P;  2R8J A;  5DQI A;  4IR1 A;  4HAI A;  3RAX A;  7ICF A;  2KOB A;  2QKQ A;  8ICF A;  2EKE C;  2IY0 B;  2ZVO A;  4L1B A;  3P4R B;  2K8H A;  5KAF U;  4QWB A;  4UAT A;  4FZL A;  3AM9 A;  4F5N A;  2PPH A;  2PI5 A;  3RZW C;  1BXT A;  4Y2V A;  1KLN A;  3AE5 B;  5HP4 A;  2DBY A;  2H3V A;  2GBN A;  3RRH A;  3CYM A;  3AED B;  1SV0 A;  2G0A A;  8ICV A;  5KFG A;  1QOF A;  2E1E A;  4EX7 A;  2JT4 B;  2LJI A;  2ZCB A;  3L16 A;  1ESF A;  4DDG D;  1L0Y B;  1RQL A;  2JYE A;  1N5W A;  2NTT A;  3R7R A;  2WAQ F;  1D5X C;  1SIJ A;  3T3O A;  1B43 A;  3ETR A;  4J9S A;  2BWE S;  3QAQ A;  2FMQ A;  3B1L X;  4UDU C;  3U7Z A;  1HXY D;  1XU4 A;  3RUL A;  4MDK E;  4ECZ A;  3PVL A;  1C79 A;  3PS6 A;  3N28 A;  2P6U A;  9ICM A;  4DQO C;  2X8X X;  1E7V A;  1F5S A;  2GI9 A;  2KVR A;  3PX6 A;  2D5G A;  3TUO A;  1DOQ A;  1JAL A;  2LM1 A;  3IV6 A;  2I2Y A;  2G4D B;  1YZ7 A;  2SEB D;  2KMD A;  1DGJ A;  5AI8 A;  3LVW A;  9ICF A;  5EOZ A;  2L3Z A;  3DBL I;  2H3Q A;  2KKC A;  2ASJ A;  2ZPY A;  1KLV A;  1I4P A;  1JML A;  1TIF A;  1WRD B;  5ALP A;  3JPQ A;  1UA1 A;  3RJE A;  1WF9 A;  2E6X A;  2KTR B;  2K4H A;  5FP0 A;  2NPT A;  4O1N A;  4UBC A;  3Q8P B;  2JZP A;  3NRZ A;  4XA5 A;  5IO9 A;  1CUK A;  2K8B B;  3H4D A;  4M6W B;  3RR7 A;  4I2E A;  2YEP F;  1TKG A;  2XVT A;  4O0I A;  2A1J B;  5D94 A;  3EUB 2;  3MC9 A;  3PRM B;  3RB3 A;  4R3D A;  5J0O A;  1QOB A;  1LM8 B;  2ONQ A;  2BTE A;  4KGR A;  4ECS A;  1KEJ A;  4LK0 M;  5ALM A;  3GQC A;  2CKH B;  3PZD A;  3M9N B;  1S3S G;  1D8L A;  4TUU A;  4LJP B;  4US9 A;  4RGN A;  3ONN A;  1HTO A;  2LEK A;  4KIK B;  1NKE A;  4KSL C;  5KFN A;  3AN1 A;  3PNC A;  4W9E A;  4RMA A;  2C2E A;  4ICU A;  3HRD D;  4RGO S;  4O3R A;  5ALJ A;  4C4R A;  2KN7 A;  4YMM A;  1J2M A;  3QK0 A;  3PSE B;  1SGH A;  1WMH A;  3ZGZ A;  1L7P A;  2ZIV A;  1WUD A;  4BXO B;  3WK5 A;  2M0X A;  5TZV A;  4RNM A;  3RRG A;  2G9H D;  4OZC A;  5ALH A;  5CR0 A;  1XNS A;  1E10 A;  2XGP A;  4CRX A;  3M6K A;  2XY5 A;  2FMS A;  3E0F A;  3MJ5 A;  2PLP A;  3MDC A;  1C78 A;  2OHF A;  1WFY A;  2OXO A;  2JXX A;  2C7H A;  4LNF A;  5HI1 A;  1V1P B;  2C5L C;  2EZX A;  4J03 A;  3EYZ A;  4GC6 A;  2D3B A;  4GIB A;  4ZH4 A;  2PMV A;  4NJ7 A;  3K75 D;  2JZZ A;  3QEA Z;  4TQ1 A;  4LVS A;  5CEH A;  5KFH A;  3UIN B;  3F53 A;  4MM3 B;  1SF0 A;  1ZGU B;  2J52 A;  3A1Q B;  8ICQ A;  4Z6D A;  2B76 B;  4W9D A;  1ZET A;  3PSP A;  3GV7 B;  3PMN A;  1KFY B;  5AKX A;  1MHH E;  4QNL A;  1FNV A;  2ZIU A;  2DX5 B;  3I9V 1;  4M9N A;  4RQ5 A;  2WF6 A;  4XC2 A;  5J0Q A;  1K5O A;  2QAR A;  3UM9 A;  4Q8F A;  3WAN A;  1PUT A;  2MSN A;  5KNI A;  1N6Z A;  2QHO A;  5EE3 A;  2JEG A;  4KX5 A;  5LLI A;  2FLL A;  1LKY B;  4XYC A;  4B6W A;  4DBG A;  3DHH C;  2O6V A;  3ZDC A;  2PXI A;  2CU3 A;  2D6F C;  2DZK A;  1ZP0 B;  2ZIX B;  1JN3 A;  2N9P C;  1SL1 A;  4IC7 B;  4YQW A;  2KC1 A;  3VR9 B;  4C4V A;  4AUQ C;  4A8X C;  2K4I A;  5J2G A;  3Q8A A;  4HRO A;  4Q2J A;  1ZQJ A;  3A9J A;  3R66 C;  2K8A A;  4RQ6 A;  5KHO A;  4JPS A;  3UPQ A;  3N7S C;  3NUH B;  3QC8 B;  1FEZ A;  3RFA A;  4BKG A;  4ANU A;  5KFA A;  1WGG A;  3H7P A;  3PPA A;  4OVU A;  2OWO A;  3ALR A;  3MGH A;  5J29 A;  3OJ4 B;  4OZB A;  2K0P A;  2LYA A;  1IUE A;  1QOG A;  4C4T A;  1BML C;  1TV9 A;  5DGB A;  2IO3 B;  1IM4 A;  2W55 A;  1NKB A;  4Y2J A;  1R4M B;  3APC A;  3TSS A;  4GDK B;  2VH2 A;  1MSW D;  2F3N A;  1TAU A;  3L54 A;  2BGW A;  5D3I B;  4QIW F;  3BWU D;  3DBH I;  2KXJ A;  1K51 A;  4LZD A;  2KKV A;  4MF8 A;  3HIZ A;  2F44 A;  1JRP A;  4RQ2 A;  4QW9 A;  1ZQE A;  2QSD A;  2C60 A;  4ED6 A;  2KWV B;  3W9C B;  2QCZ A;  1C4A A;  5FKA C;  4C00 A;  2V3P A;  2HVH A;  3H40 A;  2ALZ A;  1L8L A;  1ZQT A;  1QCK A;  3PX0 A;  2NCN A;  1WJ4 A;  1SBB B;  4K4I A;  3J9C A;  2Z8L A;  2LMC A;  3JPS A;  2WDV B;  1ZQF A;  2C28 A;  4ECQ A;  5IIK A;  1UBI A;  1YJ1 A;  2IGG A;  2Y9T A;  2JEJ A;  2N0S B;  4OD0 A;  2XIC A;  1E9M A;  4B0M A;  3BY4 B;  3Q69 A;  2YLM A;  4KLE A;  2M17 A;  4ZRI A;  5GXG B;  3SMV A;  2Y5B B;  8ICH A;  4FUL A;  1QKZ A;  3P63 A;  3EA6 A;  2OCE A;  1UNS A;  3AEA B;  4Y2R A;  2IO1 B;  5KFP A;  1Z3E B;  3KUC B;  4KMO B;  1VLB A;  8ICN A;  4NLB A;  5BMI A;  3I63 C;  5J0T A;  3R3M A;  3M62 B;  5ALK A;  5FR3 A;  1SL2 A;  3LXF A;  1XSN A;  2X38 A;  2RPV A;  3FC4 A;  3K9P B;  1SZP A;  2FDR A;  5ALU A;  2W3R A;  1SIF A;  3KH0 A;  4DQQ A;  1XO3 A;  2LWP A;  2MSE D;  1MFW A;  3DOW A;  1U9L A;  3TAP A;  4CE6 A;  4RQ7 A;  4EZK A;  3MC1 A;  3K1Z A;  3KQ4 A;  5IOI A;  1V2Y A;  3SV4 A;  5AK5 A;  1OFF A;  4LDT B;  3QX1 A;  4WQM A;  3ICX A;  5CTR C;  1NDD A;  3Q3O C;  2QB0 A;  1CI4 A;  4GDL A;  1X9S A;  2DPJ A;  5KFC A;  7ICS A;  2LBO A;  3H8S A;  1L3V A;  1AQ6 A;  9ICW A;  2MRP A;  4YR2 A;  2NPT B;  1J19 A;  1X6I A;  1WZ0 A;  5E6N A;  1NEK B;  2LI5 A;  2OJR A;  4XDC A;  2FE8 A;  2M8S A;  3NZS A;  3PT2 B;  2AU0 A;  3U4E G;  3TAQ A;  1T94 A;  1ROE A;  1WX7 A;  4QJF B;  1UEL A;  4YXM A;  2V4L A;  5E6P A;  4UW9 A;  2AQ1 B;  3RPF C;  1FCC C;  5BO4 B;  3PST A;  5EE9 A;  1RM6 C;  1U48 A;  3LYY A;  1HEZ E;  2YN4 A;  3F5A A;  5AKG A;  8ICT A;  3NGD A;  4DOB A;  2AQ3 B;  2WGS A;  4IKG A;  1F0Z A;  2W03 A;  3IP4 B;  2KJ5 A;  3FIL A;  1B9R A;  2PFP A;  2KVC A;  4PHE A;  1WR1 A;  1XSL A;  5AI9 A;  4S17 A;  5AK3 A;  4GIV A;  1H38 A;  5AI5 A;  4P0Q A;  2RRD A;  2N7E A;  3C1Y A;  2J7Q B;  4CDG A;  2A3V A;  2MP2 A;  1DK3 A;  4F71 A;  4P6V F;  1ZQ1 C;  4BUG A;  5KL1 B;  1RYU A;  3P2B A;  3ZO5 B;  1SWW A;  2PEA A;  1WMH B;  3WK7 A;  4EEL A;  4DL5 A;  2ZIV B;  1ZQX A;  2BCQ A;  4MJS A;  5DB7 A;  7ICO A;  1D6E C;  3ZJU A;  3I57 A;  3AEF B;  4FXC A;  2YEP B;  3B9J A;  2NO5 A;  4TUQ A;  1ZQR A;  2NRT A;  2E3T A;  3BIN A;  4Y2S A;  2V9H A;  1RLF A;  3ETL A;  8ICC A;  2ZNV B;  4HK2 A;  2BQR A;  4EKU A;  2HW3 A;  4NAM A;  2WF5 A;  3PML A;  3EFU A;  3WK4 A;  3QZ8 A;  1PGB A;  9ICN A;  3L17 A;  3T5J A;  3IG3 A;  1IPG A;  2LMR A;  3QZ7 A;  4RZR A;  3N32 A;  5KFM A;  4DDI D;  2DEN B;  1N61 A;  3BZD B;  3M7D A;  2LGD A;  3BVZ A;  3ZVV A;  1QQR A;  2C9W B;  1X2I A;  3ZNI D;  3ML8 A;  4AYB F;  2KT7 A;  4JV1 A;  1WGR A;  4UAU A;  4UBB A;  2E8P A;  2ZIU B;  3BS7 A;  2JSV X;  1P7E A;  1UHU A;  2MJE A;  1ZUD 2;  2CN1 A;  3SDL C;  4KLI A;  2KG5 A;  2QAR B;  4MFF A;  2RMM A;  2RDH A;  3AEG B;  4IUM B;  2I5H A;  3H8H A;  5IIM A;  1WY8 A;  2YTU A;  1XEE A;  2INC C;  2KQS A;  5C5J A;  4FN2 A;  3LWM A;  4NLN A;  2BWF A;  1JQ4 A;  4DL4 A;  2DPI A;  3BQT A;  5AKJ A;  5AKL A;  2IJ0 A;  1ZQD A;  3OJ3 A;  2NV3 A;  3HX0 A;  2O6V B;  1OTR B;  2KFJ A;  3ABV B;  1FMA D;  3OPX A;  3U52 E;  4K7W A;  3KHH A;  4W9G A;  5DPR A;  7ICK A;  3RI7 C;  1JIH A;  1PQS A;  1IV8 A;  5J2J A;  4C4V B;  5KT7 A;  1L7O A;  2YMQ A;  1V6E A;  4Z6E A;  2CS4 A;  4IM0 A;  4BKS A;  4CO7 A;  3A9J B;  1WM3 A;  4FZM A;  5H2F U;  3VTW A;  4C8L A;  3HIL A;  3TEY A;  2FCN A;  1QTM A;  3H0L B;  1JXL A;  4EBE A;  3H7P B;  3PGE A;  2VAN A;  3MC8 A;  3BVM A;  3W5U B;  2LRW A;  5AUK A;  3V05 A;  4O9M A;  2LAS A;  2KVZ A;  3BJY A;  4OHJ A;  2KMC A;  3DVG Y;  2N4F A;  1DXS A;  1WZ3 A;  5DB6 A;  2BYV E;  2DLB A;  3MGI A;  1XWL A;  3DBS A;  4UB6 U;  1S97 A;  4HCN B;  2QIE B;  3M9M B;  3VTU A;  4EEY A;  4DSJ A;  2BCV A;  2HD5 B;  4MHV A;  3HP6 A;  2JU6 X;  4F91 B;  1KBU A;  3PW5 A;  2L52 A;  2LHT A;  2HSZ A;  1C1Y B;  3B2F A;  4WJO A;  3M8R A;  2ES6 A;  4Y2Q A;  2UVW A;  1ZOY B;  3APD A;  2M0N A;  1C9F A;  2DWQ A;  1E8Z A;  5KAI U;  7ICT A;  1KFT A;  3VCB A;  3QA8 A;  4FS1 A;  5AKH A;  3RNE C;  2XEW A;  5CHG A;  3JPP A;  3MDA A;  3WK8 A;  4MEL A;  4KLQ A;  4ED0 A;  4GB9 A;  3NUQ A;  3D32 A;  2J0J A;  2XY6 A;  1IG6 A;  3ENE A;  2N9X A;  1T0Y A;  3K9O B;  1OW5 A;  4IOI E;  2G3Q B;  5DG7 A;  4EEK A;  1ZJN A;  4IWO A;  2RPQ A;  3E56 A;  2KJ6 A;  2KMM A;  2W8K A;  3E2E A;  2ON8 A;  2EAN A;  1YQ3 B;  3MHS D;  4GGQ A;  1XCQ L;  2J6U A;  3N7P D;  4FBU A;  2IOF K;  2K4P A;  2AEH A;  3EZ5 A;  5EDS A;  4PYU A;  5KFX A;  1WR6 E;  4P2H A;  5T8I A;  4XGA B;  4B0E A;  1YMH E;  4RF0 A;  1M6Y A;  2JEF A;  3IT4 B;  4MFC A;  3IHQ B;  4ZRK A;  4DFK A;  2RDJ A;  2ZXH A;  1LQB A;  3RT3 B;  3PHX B;  2MU2 A;  4A9A A;  3KWV A;  1TK0 A;  1FRD A;  3Q3N C;  5JH5 C;  1IXR A;  4MGK E;  5CHF A;  5L1M A;  2Q4T A;  3SU8 X;  1A6S A;  3M1Y A;  9ICO A;  4ICV A;  2VIX A;  2K89 A;  7ICQ A;  1TBE A;  1BGX T;  5ALI A;  1NOM A;  4JV0 A;  4B9T A;  1QLN A;  1UGJ A;  2M0A A;  5HMM A;  2QB0 B;  1ZXH A;  4KLJ A;  4GDL B;  1Q46 A;  4YXJ A;  1AYF A;  4DQI A;  1C7Y A;  4O3M A;  4NJ8 A;  1RWS A;  2L05 A;  1L4Z B;  3CRX A;  4KLD A;  4XWW A;  1EM7 A;  2DYO A;  1BPD A;  2V9W A;  1MN8 A;  4GXB A;  3IAS 1;  5D6J B;  2HCF A;  1QSL A;  2F8L A;  1HJP A;  2M9N A;  2KZ3 A;  3MR2 A;  4F5O A;  1TZ1 A;  1MPE A;  1AWD A;  2YMM A;  3H0M B;  3EHV A;  3QAR A;  4F5R A;  2F2A B;  2VKQ A;  2K9X A;  3OJS A;  2I6X A;  3FIL B;  3N30 A;  4A90 A;  4A55 A;  4HJG E;  2WAQ C;  3F2D A;  2M56 B;  5HML A;  3RJG A;  3SI8 A;  4P0Q B;  2RDG A;  3T5K A;  4ECT A;  2WB1 C;  2AGP A;  2MP2 B;  2WLB A;  4P4P A;  8ICI A;  2MHJ A;  2IHM A;  3SAG A;  1J7C A;  3JVZ X;  3DWG C;  2PJH A;  3D2Q A;  2BPG A;  3QUB A;  1V86 A;  5KFR A;  2A19 A;  1KH0 A;  4EYH B;  2AXT U;  4MJS B;  4RGM A;  4PZO A;  2BDP A;  2JWZ A;  5D2M B;  2J6S A;  4FLH A;  1PZN A;  3EW9 A;  4NJC A;  5KFK A;  4IRC A;  7ICH A;  4A20 A;  1QLB B;  1NJY A;  2WXQ A;  1ZD4 A;  4NZL B;  4PS7 A;  4HXD A;  8ICX A;  1FPY A;  4LNO A;  1ZE3 D;  4W9J A;  4PT5 A;  1Q3V A;  4X57 B;  4OJL A;  4UB3 A;  4DLE A;  1WXS A;  1FO4 A;  5CRX A;  2BBC A;  1NVI D;  2WTF A;  2ZPN A;  2GBM A;  1NJX A;  3NVZ A;  5TIS U;  3A4R A;  1NI2 A;  3TCA A;  4J9K A;  2R2O A;  1ZQU A;  2V4I B;  2O6K A;  3I76 A;  3RTV A;  2KHW B;  2NVU I;  2WXP A;  3A33 B;  2KO3 A;  1Y56 A;  4DQR A;  2KVS A;  4MGZ E;  4ARC A;  2G09 A;  2ZW0 A;  2BCS A;  4G11 A;  5DPT A;  2ZJ5 A;  4DO9 A;  3KFU F;  1RXW A;  2WYQ A;  1NYR A;  3THV A;  4MEM A;  1ZQZ A;  4NLC A;  2KNB A;  1WJN A;  3I3T B;  1HZ6 A;  4AS1 A;  4YR0 A;  4EUT A;  3WAP A;  5KG3 A;  2EKI A;  3A4S C;  3ZDB A;  3DBR B;  4ASW C;  4P1B C;  4I2F A;  2VJ5 A;  3ONS A;  3HVD A;  3H8J A;  4F3O A;  3DVN V;  4TSS A;  2G45 B;  2HBM A;  4J9L A;  2AYO B;  1FFU A;  4GMV A;  4LZG A;  2FI1 A;  1WGD A;  2HE7 A;  3ZI4 A;  7ICG A;  1MC8 A;  4UAS A;  2D3D A;  2EAO A;  4KN7 A;  1R7S A;  5H92 C;  5KFO A;  2KNJ A;  1YJI A;  2BKE A;  3V6J A;  4YSY B;  2V3S A;  4F1S A;  3AEB B;  1TKE A;  3DCG A;  4MH8 A;  2EH9 A;  4RM8 A;  3PLV A;  3S2A A;  2XK5 A;  4YTM B;  3R8B A;  5J2K A;  1BPZ A;  1HQR D;  1MJD A;  3G6X A;  4RFB A;  1VZ6 A;  1HTQ A;  2FCM A;  4F8R A;  1NEN B;  4HPP A;  4Q44 A;  4FJY A;  2W43 A;  3WKB A;  1LV5 A;  4QZ8 A;  4FE3 A;  3VXW A;  1S5L U;  1TAQ A;  3Q8C A;  5LXH A;  4RH6 A;  5JUM A;  3KKA C;  4USA A;  1I4Q A;  3WIM A;  4TUS A;  3G6Y A;  2MAX A;  2RR9 A;  3IAM 1;  2MCN B;  4QZE A;  3MBY A;  4EE2 A;  5J0R A;  1WJU A;  1JCK B;  2Q5W D;  3HKZ C;  1X42 A;  2KDI A;  4UAR A;  2R2Q A;  3ZDT A;  4EBD A;  2HMX A;  3RBE A;  3C28 A;  1WG8 A;  3H6N A;  3QUC A;  3NRW A;  2JH7 A;  2YML A;  1DK2 A;  4ANX A;  5BOM A;  2I9G A;  5AHX A;  4CCH A;  3W1Y A;  1IIP A;  2NTS A;  2H88 B;  1KTK A;  3OHA A;  1UH6 A;  3ZDA A;  1Z5S B;  3GV5 B;  5J0Y A;  1XD3 B;  3GS2 A;  4J9N A;  1Q1O A;  1KSP A;  2F8K A;  2DF4 B;  2G07 A;  2W9M A;  3A0B U;  1WXA A;  3IVF A;  2HOQ A;  4ARI A;  5G2N A;  1MHX A;  4P1C C;  1JI7 A;  3EPI A;  3RJI A;  3AE4 B;  4DFD A;  4U6P A;  3LB8 C;  1L6U A;  4NY8 A;  5J2E A;  4U7C A;  9ICH A;  4ED2 A;  1N48 A;  1D8B A;  7ICL A;  3VDZ A;  2IND C;  5AK6 A;  2BKR B;  4L23 A;  3TEW A;  5KG0 A;  4PJ0 U;  4ZOH C;  4RQM A;  2XBB C;  1T5X D;  1ZQY A;  5K4L A;  1ZRM A;  1ZQW A;  1SJE D;  2FPL A;  4YP3 A;  1EWC A;  4GLS C;  2W7P A;  5G5G A;  2BVC A;  1V5T A;  4DHJ D;  4M47 A;  3W1S A;  5HR6 A;  1D5Z C;  2GB1 A;  1P0R A;  3NZU A;  1HEK A;  9ICX A;  3RN9 C;  4K7S A;  1RFK A;  1A5R A;  2LGI A;  3QUQ A;  1E5W A;  1VZ7 A;  4PS3 A;  4TQ0 A;  1O08 A;  5KT3 A;  4DSF A;  2CR5 A;  2WNM A;  4B6J A;  1I7H A;  1KLU D;  2FE9 A;  4MFA A;  4KLG A;  3PO4 A;  5ALZ A;  3IHP C;  4FHJ A;  3PO0 A;  3WK9 A;  2R8G A;  2BPS A;  4OVV A;  1WRI A;  3ZXR A;  2W9C A;  1E8W A;  2Y3A A;  2W7O A;  3BQ1 A;  1SJH D;  4C7Y A;  3HVZ A;  4FHK A;  4ANW A;  4BWJ A;  3KVF B;  4ZYS A;  1V1O A;  2Q0Z X;  4DEZ A;  2L5Y A;  3ZDM C;  1L3U A;  3WAO A;  3OGU A;  4F4W A;  4KSK C;  2WXG A;  1JUD A;  2WXL A;  2E8M A;  1DGS A;  4NLZ A;  1P3Q U;  1J97 A;  1JWS D;  2HDO A;  1GJZ A;  3C1Z A;  1V38 A;  3V6H A;  2H5X A;  1NI3 A;  2G5H B;  2LI6 A;  4O3O A;  3PR4 A;  3WAL A;  4G50 A;  2XCA A;  2CU1 A;  3F5E A;  1KM7 A;  4O5K A;  1C77 A;  5D3D A;  1TFR A;  4D2K A;  2L8J A;  3D2S A;  5J8Y A;  4KLF A;  4XZ4 A;  1ZQK A;  3GIJ A;  1L3S A;  4B9L A;  1WGK A;  1OEY A;  3AU4 A;  5EWG A;  5HHD G;  1TVA A;  2KHV A;  3TAN A;  3M9O B;  4AQ7 A;  4ED1 A;  5J2I A;  4IC9 A;  4B9N A;  4M9H A;  1OQR A;  2KZR A;  2LGY A;  2KE7 A;  4HPM B;  3PO5 A;  5HKH A;  4J9M A;  2IDY A;  2EDU A;  2KTQ A;  3CMM B;  4WQO B;  3PRE A;  4J3O D;  5TSS A;  4A3O A;  5D4B A;  4GN1 A;  3VC8 A;  4IRD A;  5F9N A;  1U4B A;  2MLB A;  4NQK E;  2RLT A;  3GU3 A;  1ACC A;  2ZJD A;  1T3Q A;  3GII A;  1XO0 A;  5BYS A;  2W9B A;  3JPN A;  1V5O A;  2JZ3 B;  2A5U A;  2YY6 A;  5B66 U;  4MEX A;  2FUH B;  4E0D A;  2ZXI A;  1FNW A;  1KQQ A;  2PKO A;  5AM5 A;  1N62 A;  5J2D A;  2PE6 B;  3RH4 A;  1EF5 A;  1ENF A;  3QWZ B;  1N56 A;  1TS4 A;  4ZYN A;  4WH4 A;  3GE8 C;  4KLT A;  2LGS A;  5KG7 A;  4QZC A;  4I6N B;  3WK6 A;  1EU4 A;  3UMB A;  4G3I A;  1D3Z A;  4NWI A;  2MBB B;  5DG8 A;  1NK4 A;  3P4S B;  3A9K A;  1L7N A;  3PX4 A;  3VUW A;  2G5I B;  2R8K A;  3P42 A;  4NL9 A;  3DBR I;  3ZUN A;  4HPL B;  2KOX A;  4IDI A;  2IOH A;  5DLF A;  3PW0 A;  1TKY A;  1N5X A;  4IW0 A;  2WU2 B;  3U8Z A;  4DL7 A;  3PRP B;  3ISB A;  5AM3 A;  4WAA A;  1O03 A;  2XK5 B;  5HNK A;  5HG2 A;  3V6E B;  1TS3 A;  4BZA A;  3N20 C;  3DHI C;  3ED5 A;  1ZYQ A;  2JX5 A;  4JQW C;  2Y1J A;  2QEJ C;  4TQR A;  1L6V A;  4EBC A;  2EAP A;  2QLT A;  2GLS A;  2I38 A;  3VR8 B;  3ZXV A;  3TL5 A;  3J81 j;  4P4O A;  4G9B A;  2BS2 B;  1PVR A;  5EWF A;  2MBQ A;  2CHX A;  2XO7 A;  2KJ8 A;  2JWU A;  4QZH A;  3OSP A;  2JY6 A;  3GFK B;  2DZJ A;  2L00 B;  2WXI A;  3RF9 A;  2DL0 A;  3R2T A;  5L1K A;  4KLM A;  2NRZ A;  4C7Z A;  3HW8 A;  5L83 A;  1YOV B;  2DAJ A;  3SFE B;  1GUA B;  4J9R A;  5ALV A;  2KDB A;  3QYP A;  9ICE A;  3QNM A;  4PL2 A;  8ICR A;  1FIQ A;  4PGY A;  4K1R B;  3X23 A;  4RNN A;  2KV2 A;  1WSP A;  2LUE A;  3AV8 A;  1PVQ A;  1MI0 A;  2JF5 A;  3UF8 A;  1V9J A;  2ICI A;  2GMI C;  4N6E B;  2J53 A;  1FD6 A;  1TY2 A;  4M8N A;  3GDX A;  4DSI A;  8ICY A;  2JPH A;  4KLH A;  3PW2 A;  1A0P A;  4N59 A;  2DZI A;  4MT5 A;  3U2S C;  1X9W A;  1SZH A;  2PMZ F;  3ORY A;  2MA1 A;  2D3C A;  5CB1 A;  4HDQ A;  1ZQP A;  3SHQ A;  1JXE A;  1I4H A;  2QJL A;  1YIW A;  3FKY A;  3HM6 X;  7ICV A;  5KG2 A;  1QSY A;  4ECX A;  1Z2M A;  4Q45 A;  1S0N A;  4NNJ B;  2BS3 B;  1ZPS A;  4JGH B;  2Y5P A;  2PFO A;  2FNJ B;  4NM2 A;  2BZF A;  2DYM A;  2FAZ A;  2FUG 1;  2NRV A;  4BBN F;  5IP4 D;  2JHD A;  3VH3 B;  3MR6 A;  4ZHP A;  2ASL A;  1CJE A;  1OXJ A;  5HHH A;  1ZKH A;  1FXT B;  2D07 B;  1L2N A;  2J6T A;  4JX1 C;  5E79 U;  1X9X A;  1JWB D;  3PVX A;  1WE7 A;  4K81 A;  4O5C A;  1BNO A;  5KT2 A;  4TQS A;  4JWU C;  3HHM A;  3TAD C;  2G08 A;  2VA3 A;  4ZRQ A;  4ANV A;  2I1Q A;  1AN8 A;  1SE3 A;  3LWL A;  3Q8K A;  4ECY A;  3N1X C;  5KT4 A;  2W9C B;  4YXD B;  1J0G A;  4B9S A;  4XE0 A;  2V1Y A;  4W9I A;  2WF8 A;  5KFI A;  1SGG A;  3ZJT A;  2HOF A;  1E0Z A;  1B0X A;  1E6E B;  2KAJ A;  3O13 A;  3C2M A;  3AU2 A;  2BB6 A;  1BPB A;  4J9Q A;  1NK0 A;  2MEK A;  5HHI A;  1U4A A;  4QWE A;  2EMS A;  1ZQL A;  1WX8 A;  1SXT A;  2NBV B;  4JL9 A;  4BOZ B;  3TFS A;  2BCR A;  3NVV A;  5ALS A;  4GLX A;  1BPE A;  2PFN A;  3C5G A;  4H2A A;  2HHV A;  4AJW A;  5CP2 A;  5IIN A;  1NK9 A;  1TS2 A;  2GO7 A;  1JX4 A;  4HKZ E;  1CZP A;  4K3B A;  5L1J A;  1K52 A;  3TFR A;  2DKZ A;  2G06 A;  1NK7 A;  1I4G A;  3AE9 B;  2EEL A;  3MC0 B;  4M00 A;  1V97 A;  2VZK D;  3OAW A;  3ZJV A;  4FJZ A;  3UGB B;  2IBI B;  4K3C A;  2MA9 B;  3IDW A;  9ICR A;  1Z19 A;  3RZF A;  4MF2 A;  1V81 A;  1F9J A;  1UA0 A;  8ICM A;  2KN5 A;  4MGI E;  2XGQ A;  5LNK 1;  4QZB A;  3Q8F A;  3SD5 A;  4NLG A;  4DSK A;  2DKX A;  3OWE B;  2DUY A;  2IBK A;  1ISN A;  3GIM A;  4RT3 A;  2NBU A;  4Y2T A;  1KFS A;  4PGX A;  2BS4 B;  2MBO A;  4KZC A;  2W9B B;  5KFV A;  2KSO A;  4ECU A;  1RQN A;  4RNO A;  3I28 A;  2N9L A;  2CPR A;  2WXJ A;  2PW9 A;  2R8I A;  1SB3 C;  1L3T A;  2DZM A;  3PV1 A;  2C7M B;  2JRI B;  1E90 A;  4P7I A;  1C4C A;  4F72 A;  1OEY J;  4M02 A;  5C0Y A;  3QX7 A;  2KK0 A;  4ED8 A;  3TQ1 A;  5DPW A;  2YX8 A;  3IG5 A;  3K1R B;  1S0O A;  4NLK A;  1UZX B;  1V8C A;  4OJO A;  3N1Y C;  5KG6 A;  2PFQ A;  4F5Q A;  2M19 A;  9ICJ A;  4YL8 A;  1P7D A;  2A1A A;  3T9L A;  5BOL A;  4N58 A;  4XDD A;  2FPM A;  4UAY A;  1WYG A;  3RB0 A;  3A9K B;  3BQ0 A;  1VRA B;  3UQ2 A;  2BT6 A;  4I6P A;  3DVN U;  2WXM A;  1SV4 A;  2D8C A;  1NBF C;  3EFC A;  5CA7 A;  4QWD A;  1JWA D;  1HE8 A;  4RUC A;  2XY7 A;  3I1Y A;  3V7K A;  3OHB A;  3BQ7 A;  3U26 A;  3L3F X;  3IRU A;  5D46 A;  3V61 A;  4AOF A;  1A70 A;  2GOW A;  2KJH B;  3AEC B;  3ZD9 A;  4W9F A;  4LJO B;  1XLP A;  1SE4 A;  4RNA A;  1QF6 A;  4I29 A;  2OED A;  4PK1 A;  1UD7 A;  3E9S A;  2R8H A;  1RZT A;  4LJX A;  5J17 A;  1NJW A;  4AJY B;  3ZDD A;  1XCT L;  2CRX A;  2HJ1 A;  3JSV A;  2HJ8 A;  4I28 A;  3QU5 A;  4K7U A;  1M94 A;  1R4M I;  2KX0 A;  2SAK A;  4CNQ A;  5AIC A;  1PGX A;  2AH5 A;  2VJ4 A;  2RQ5 A;  4EYI B;  3QJZ A;  2XC9 A;  2CJO A;  4LNI A;  3MFH A;  2WF9 A;  3N4M B;  4DXF A;  3CNH A;  4TKN A;  2FIF A;  3GZF A;  4YTP B;  4BGD A;  4UAZ A;  1YN3 A;  2JXT A;  4NJ6 A;  3TAC B;  1WIA A;  3AU6 A;  1T7P A;  3O0F A;  2ZW1 A;  2GBR A;  1WWU A;  3V7L A;  2L7R A;  1FXA A;  5JZE B;  4DCC A;  1KRH A;  3EEC A;  8ICA A;  3WA0 A;  3ZW3 A;  4BOS C;  2D11 A;  4O5E A;  4W9C A;  3QUT A;  3H8W A;  3AE7 B;  8ICU A;  3AEV A;  1DYQ A;  4PPX A;  2WXR A;  4OJP A;  2BCU A;  2MQJ A;  1UCV A;  4S0R A;  3PHW B;  2M1M A;  4RUA A;  4DSE A;  1E7U A;  1ZRN A;  5IIO A;  1WCN A;  1S77 D;  2RP5 A;  5GTI U;  1TJE A;  1XC9 A;  1EF1 A;  4GFJ A;  3WKE A;  1ZDX A;  3GZN B;  3PZ7 A;  3VRB B;  4EEN A;  1P9D U;  2ATL A;  1KL9 A;  4JK1 A;  5F9L A;  2GLE A;  2WS3 B;  3GOE A;  2L76 A;  4WIP A;  3ZQ4 A;  1XSP A;  2LM4 A;  5KT6 A;  2F76 X;  2WXF A;  2LKY A;  2BYF A;  3NVW A;  2KTF A;  3M6Z A;  3RNB C;  8ICG A;  2WHE A;  3QEB Z;  3TEX A;  3K4G A;  4RQ8 A;  3LK9 A;  3RB6 A;  1SV0 C;  3AUO A;  4WAF A;  3WCQ A;  3ML9 A;  2W04 A;  1KOT A;  2KDF B;  2H3F A;  2AGQ A;  1NZB A;  1GOZ A;  2LVO A;  1FM0 D;  1DOX A;  1U45 A;  5DLG A;  1KFD A;  2KEY A;  5ALE A;  4OJ6 A;  3C2K A;  3DDC B;  5CHW A;  3FDS A;  4JLC A;  2C7N B;  1RPL A;  1XLO A;  3IXS A;  2KWU B;  5EWE A;  3HPO A;  1IGC A;  1L4D B;  2HTM E;  4RQN A;  1S9F A;  2DNF A;  4KIT B;  4YT0 B;  4A6Q A;  3RCZ A;  2JV3 A;  1AAR A;  1UUP A;  3BVG A;  5AUI A;  3PW4 A;  2LGX A;  2BYT A;  3WKC A;  4C8O A;  2HTH A;  4QWA A;  2IZV B;  4OW0 A;  4YR3 A;  1WYW B;  2MH7 A; 
#chains in the Genus database with same CATH homology
 4YWG G;  4A8X C;  3V3X A;  2ACZ B;  3BYT B;  2NTS A;  3Q8A A;  2H88 B;  1C76 A;  4HRO A;  4L2Y A;  4Q2J A;  1KTK A;  2V0G A;  4JPS A;  1BUI C;  2LHE A;  3NUH B;  1FNU A;  3GS2 A;  1J7A A;  4M0W A;  4OZB A;  2K0P A;  4JE3 B;  1IUE A;  1QOG A;  1BML C;  4ITK A;  4ARI A;  2W55 A;  1MHX A;  3TSS A;  4GDK B;  1IBX A;  4HKQ A;  3AE4 B;  3LB8 C;  5D3I B;  1L6U A;  3BWU D;  1ZXI A;  1K51 A;  2INN E;  2LFI A;  4L23 A;  3TEW A;  1JRP A;  2TSS A;  2QSD A;  3T3N A;  4ZOH C;  3W9C B;  1T5X D;  3GP7 A;  1C4A A;  1SJE D;  5FKA C;  2V3P A;  1EWC A;  4GLS C;  1T6B X;  5G5G A;  3W1S A;  2WXK A;  1D5Z C;  2GB1 A;  3R2I A;  1SBB B;  3J9C A;  2Z8L A;  2LMC A;  1RFK A;  2WDV B;  2LGI A;  4OVZ A;  1VZ7 A;  4TQ0 A;  1HA5 A;  2WNM A;  1I7H A;  1KLU D;  2IGG A;  4DXG A;  1OQQ A;  2N0S B;  1E9M A;  4B0M A;  3PO0 A;  1F77 A;  3Q69 A;  1QOA A;  1WRI A;  3B2G A;  1FXI A;  5GXG B;  2Y3A A;  4ZRP A;  1XLQ A;  1SJH D;  4C7Y A;  3HVZ A;  1QKZ A;  3P63 A;  4ZYS A;  1V1O A;  3EA6 A;  1UNS A;  3AEA B;  2QMT A;  1GB1 A;  1TS5 A;  2VZK B;  1VLB A;  1RYJ A;  2WXG A;  1ET6 A;  1VJK A;  2WXL A;  2QIL A;  5BMI A;  2N7J A;  3AH7 A;  1B1Z A;  5FR3 A;  1MVK A;  1JWS D;  3LXF A;  2X38 A;  3MP9 A;  2RPV A;  3FC4 A;  5I4D A;  2W3R A;  3BII D;  1NI3 A;  1ZDV A;  2W82 A;  3C8Y A;  1XO3 A;  1JRO A;  3KQ4 A;  1FCL A;  1OFF A;  1C77 A;  5D3D A;  4D2K A;  1F2R I;  1HZ5 A;  1WGK A;  2AX5 A;  5HHD G;  4AQ7 A;  2G1E A;  5D7G A;  3UI3 A;  1OQR A;  1NEK B;  4RGT A;  1YN4 A;  4XDC A;  2FE8 A;  4KGS A;  3U4E G;  1ROE A;  2WP9 B;  2IDY A;  5TSS A;  5HFY A;  4J3O D;  1DOI A;  1PDX A;  2AQ1 B;  3RPF C;  2LHD A;  1FCC C;  5EE9 A;  5JXV A;  1RM6 C;  3LYY A;  1YNT E;  1HEZ E;  1YN5 A;  2W54 A;  2MJ3 A;  1ACC A;  2AQ3 B;  1KF6 B;  1P7F A;  1T3Q A;  3P4P B;  4IKG A;  5BYS A;  1F0Z A;  2K5P A;  2Y5C A;  3FIL A;  1B9R A;  1D4B A;  2PIA A;  1I4X A;  3FAH A;  1FNW A;  5C2T B;  2PKO A;  1TZO A;  1N62 A;  2INP E;  1ENF A;  3GB1 A;  1E7P B;  4KGT A;  1TS4 A;  4P6V F;  2K22 A;  4WH4 A;  3RFZ B;  2BB5 A;  2H89 B;  1EU4 A;  4CQN A;  2MJD A;  1YJJ A;  1L0V B;  3P4S B;  3AE8 B;  3TEZ A;  2WQY B;  1D6E C;  3ZJU A;  3I57 A;  2WDR B;  3AEF B;  3MFG A;  4FXC A;  3P42 A;  2YEP B;  4IDI A;  3B9J A;  2WXH A;  2E3T A;  1TKY A;  1N5X A;  1FEH A;  1WWT A;  2WU2 B;  4NAM A;  1L0X B;  2K3U A;  2L83 A;  1PGB A;  3AE6 B;  4RCO A;  5BYR A;  5HG2 A;  3NVY A;  1EWY C;  1SEB D;  3AMZ A;  1TS3 A;  2KWD A;  2JX5 A;  1WXQ A;  2QEJ C;  2KAC A;  1I4R A;  1L6V A;  1N61 A;  3BZD B;  3BVZ A;  1QQR A;  2I38 A;  3VR8 B;  3PZ8 A;  3NS1 A;  2JSV X;  2GRI A;  2WXO A;  1P7E A;  2MJE A;  1GB4 A;  1ZUD 2;  3KLS X;  1ET9 A;  2BS2 B;  2KQ4 X;  2RMM A;  3AEG B;  2RDH A;  2JWU A;  1XEE A;  3H8H A;  3N9Y C;  4OZA A;  3URY A;  3BK1 A;  2WXI A;  3CWI A;  3R2T A;  1JQ4 A;  2IJ0 A;  3BK2 A;  4C7Z A;  1KLG D;  2XN9 C;  3SFE B;  3L4P A;  3ABV B;  1Q10 A;  1FMA D;  3U52 E;  1JWU D;  4LTU A;  5BMG A;  1FIQ A;  3AE1 B;  5BYQ A;  3NZ3 A;  4US8 A;  1JWM D;  1WSP A;  1JW9 D;  3AV8 A;  4JWS C;  1MI0 A;  3SEB A;  3W2D A;  4REZ A;  4C56 C;  2ICI A;  4P16 A;  4N6E B;  1NYQ A;  2WU5 B;  2J53 A;  1FD6 A;  3TEY A;  1TY2 A;  3SFD B;  1DOY A;  1PFD A;  4MAC A;  2PVG C;  3BVM A;  3W5U B;  4N59 A;  3U2S C;  3VQI A;  3EGR A;  4MT5 A;  5AUK A;  1GAQ B;  3MHZ A;  1C4P A;  5H8Y E;  1V1P A;  3V05 A;  4OHJ A;  2DLB A;  2J42 A;  1I4H A;  2QJL A;  2QIE B;  1IBX B;  3IT6 B;  2JU6 X;  2BS3 B;  2L52 A;  1ZPS A;  3B2F A;  1QIL A;  2Y5P A;  1ZOY B;  2V3N A;  1C9F A;  2DWQ A;  4WUR A;  3ZYY X;  4WWM A;  1CK1 A;  5E6J A;  2DYM A;  2R61 A;  5EE1 A;  2FUG 1;  4KKJ A;  5EE0 A;  2PTL A;  4ZHP A;  1CJE A;  4LLG M;  4IOI E;  3AB5 A;  4TMA B;  1YQ4 B;  4JX1 C;  3E56 A;  2KMM A;  1JWB D;  1F2R C;  1SE2 A;  4JWU C;  2ON8 A;  1YQ3 B;  4ZRQ A;  1AN8 A;  1SE3 A;  1XCQ L;  4YXD B;  4XE0 A;  4YSZ B;  3ZJT A;  3SR6 A;  1E0Z A;  1E6E B;  2KAJ A;  3O13 A;  4C80 A;  2BB6 A;  1FRR A;  4YSX B;  5T8I A;  4B0E A;  1QT9 A;  2MEK A;  1YMH E;  2KDM A;  1XLN A;  1VZ8 A;  4RF0 A;  3IT4 B;  4HEA 1;  1PYW D;  1SXT A;  2PVO D;  1AW7 A;  1D5M C;  2WDQ B;  3NVV A;  4H2A A;  2JQR B;  4A9A A;  2CJN A;  3KWV A;  1TS2 A;  1FRD A;  2KN4 A;  4HKZ E;  1CZP A;  4XWT A;  2FBW B;  1LO5 D;  1K52 A;  3VRA B;  1XF5 L;  3AE9 B;  1I4G A;  3MC0 B;  2EEL A;  3P1M A;  1PGA A;  4RF1 A;  1V97 A;  2VZK D;  4HRS A;  3ZJV A;  2M0A A;  2N9K A;  1UGJ A;  3AE2 B;  3KWL A;  1STE A;  4YTN B;  1ZXH A;  1TY0 A;  4GDL B;  1AYF A;  5C3J B;  1RWS A;  4L1B A;  1L4Z B;  3P4R B;  4XWW A;  5LNK 1;  3Q8F A;  1EM7 A;  2DYO A;  3AM9 A;  3IAS 1;  1BXT A;  3OWE B;  1K50 A;  1TYG B;  3AE5 B;  2DBY A;  1MPE A;  1AWD A;  2J4X A;  3AED B;  1QOF A;  2BS4 B;  2LJI A;  1ESF A;  1L0Y B;  2K9X A;  2JYE A;  3FIL B;  1N5W A;  2NTT A;  2NMQ A;  1D5X C;  1SIJ A;  4A90 A;  2N9L A;  4A55 A;  3AEE B;  1IGD A;  2WXJ A;  2PW9 A;  4HJG E;  3T3O A;  1SB3 C;  2M56 B;  1L5P A;  3ETR A;  5MPO A;  1C4C A;  4KKI A;  2RDG A;  4UDU C;  1HXY D;  3U7Z A;  2WLB A;  1C79 A;  4DQO C;  1J7B A;  1V8C A;  2GI9 A;  1SSN A;  1J7C A;  2M19 A;  3TUO A;  3DWG C;  3AE3 B;  1JAL A;  2I2Y A;  1KH0 A;  4N58 A;  4XDD A;  2SEB D;  4RGM A;  1WYG A;  2BT6 A;  1VRA B;  1DGJ A;  1EU3 A;  2WXM A;  1JWA D;  4NJC A;  1FFV A;  1K53 A;  1I4P A;  1JML A;  1QLB B;  2W3S A;  5G5H A;  2WXQ A;  4NZL B;  1A70 A;  2E6X A;  1XXG A;  1ZE3 D;  3AEC B;  4PT5 A;  4O1N A;  1XLP A;  1SE4 A;  4RNA A;  2JZP A;  1QF6 A;  3NRZ A;  2OED A;  1FO4 A;  2BBC A;  1NVI D;  3E9S A;  2IGH A;  3NVZ A;  3HUI A;  2YEP F;  1GPX A;  1TKG A;  2V4I B;  3EUB 2;  2WXP A;  1XCT L;  2L32 A;  1Y56 A;  4R3D A;  1QOB A;  4ARC A;  2ONQ A;  2BW2 A;  2ZW0 A;  2BTE A;  2L1A A;  4KGR A;  1NYR A;  4LK0 M;  2SAK A;  1HZ6 A;  1PGX A;  2WXN A;  4WQM A;  4AS1 A;  4US9 A;  4RGN A;  2LEK A;  2CJO A;  2EKI A;  3W5V B;  1VR9 A;  3AN1 A;  4DXF A;  4YTP B;  1YN3 A;  3HRD D;  2JXT A;  1UWM A;  3P4Q B;  4RGO S;  2ZW1 A;  3HVD A;  1FXA A;  1KRH A;  3DWM A;  4TSS A;  3ZGZ A;  3AE7 B;  1FFU A;  2WXR A;  1DYQ A;  2G9H D;  5BMH A;  2AQ2 B;  4OZC A;  1E10 A;  1CQV A;  1R7S A;  1TJE A;  2JYT A;  3MJ5 A;  5H92 C;  1YJI A;  1ZDX A;  2PLP A;  3PZ7 A;  1C78 A;  2OHF A;  2WS3 B;  3VRB B;  4YSY B;  3AEB B;  1TKE A;  5HI1 A;  1V1P B;  4MH8 A;  4WIP A;  1VDV A;  3ZQ4 A;  4YTM B;  2IGD A;  4NAW B;  3R8B A;  2WXF A;  1N63 A;  1N60 A;  3NVW A;  1HQR D;  2PMV A;  4RFB A;  1VZ6 A;  4TQ1 A;  4ZHO A;  1NEN B;  3TEX A;  4MM3 B;  3Q8E A;  4WAF A;  1SF0 A;  2J52 A;  2XNA C;  1UWX A;  3WCQ A;  2B76 B;  1KFY B;  2IPK D;  3Q8C A;  1MHH E;  1FNV A;  1GOZ A;  3I9V 1;  4RH6 A;  4USA A;  1FM0 D;  1I4Q A;  1DOX A;  2HDE A;  4KX6 B;  2LUM A;  5FK9 C;  3IAM 1;  1PUT A;  4EE2 A;  1JCK B;  5EE3 A;  1XLO A;  2Q5W D;  3IXS A;  1IGC A;  1L4D B;  2HTM E;  4YT0 B;  4A6Q A;  1M4V A;  2CU3 A;  3CIR B;  1UUP A;  3BVG A;  3BYY B;  5AUI A;  1ZP0 B;  3Q8B A;  2BYT A;  4OW0 A;  2D5G A;  3VR9 B;  2MH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...