4ZOHC

Crystal structure of glyceraldehyde oxidoreductase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
MKIINSDQKVKITLKINGEKYETEVEPRRLLVHVLRELGFTGVHIGCDTSNCGACTVIMNGKSVKSCTVLAVEADGAEILTVEGLAKDGKLHPIQEAFWENHALQCGYCTPGMIMEAYWLLREKPNPTEEEIREGISGNLCRCTGYQNIVKAIKAAAEKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase molybdopterin-binding subunit
publication title Archaeal Mo-Containing Glyceraldehyde Oxidoreductase Isozymes Exhibit Diverse Substrate Specificities through Unique Subunit Assemblies.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
C PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 4zohC02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zohC01
1JWBD 5AUIA 1CZPA 2W3SA 1ZP0B 2CU3A 4HRSA 3SFDB 5EE0A 3AM9A 5G5HA 1RYJA 2H89B 2WDRB 2BS4B 3AV8A 4US9A 2CJNA 4N59A 1T3QA 2BS2B 3NRZA 1QOFA 4YTMB 5H8YE 2ACZB 2DBYA 3B9JA 2EKIA 2QJLA 5H92C 1XO3A 1N63A 2W54A 3EUB2 1FIQA 1NVID 5AUKA 3W5VB 3HUIA 1L0VB 3P4PB 1JQ4A 4YT0B 3NS1A 3AH7A 4JX1C 5G5GA 1OQQA 2HTME 1VDVA 2MJEA 3NVYA 1B9RA 3SR6A 1L6VA 2K9XA 2PVOD 2WQYB 3P4QB 1N5XA 1E10A 3VR8B 1E9MA 1WXQA 3CIRB 2QIEB 3AEGB 1TJEA 1FRRA 5EE3A 5EE9A 3RPFC 1VJKA 1V97A 1I7HA 1E6EB 2WP9B 3L4PA 1ROEA 3FAHA 3AN1A 1TKGA 2WS3B 3P63A 4WQMA 3KWLA 5EE1A 3NVZA 3AE3B 5C3JB 1FM0D 2PVGC 4N6EB 2BS3B 1RWSA 2CJOA 1FFVA 1JWAD 1J7BA 2M19A 2WU2B 1ZUD2 1CJEA 1E0ZA 1L5PA 1TKEA 4A9AA 1PDXA 1NENB 1QT9A 1ZOYB 4ITKA 4KX6B 1FMAD 2WDVB 1WRIA 3VRAB 3ZYYX 3HVZA 1QF6A 3PO0A 4US8A 1J7CA 1FRDA 3VRBB 1E7PB 4LTUA 2WDQB 1JW9D 2PKOA 4YXDB 1VLBA 4C7ZA 3ABVB 4N58A 1FFUA 3W9CB 3AEBB 5C2TB 4YSZB 4YSXB 5MPOA 1J7AA 1PFDA 1NYQA 1XLOA 3AEFB 1WGKA 1YQ3B 3VR9B 1XLPA 1N5WA 1FO4A 3AE6B 1JALA 1R7SA 1UWMA 1N61A 1RM6C 1SF0A 1YJJA 3B2FA 3NVWA 2B76B 2LEKA 3AE4B 1OFFA 3AB5A 3AECB 2L52A 3P1MA 1RFKA 4JWSC 3FC4A 3W5UB 1YQ4B 2JX5A 1WYGA 2PIAA 1DOXA 1QOGA 3DWMA 4JWUC 1GAQB 2K5PA 1A70A 2W3RA 1FXIA 1PUTA 1QOAA 1NEKB 1YJIA 2DWQA 2MJ3A 3AMZA 1KFYB 1V8CA 1XLQA 2WLBA 4C80A 2MH7A 3LXFA 1F0ZA 4YTPB 4WWMA 1GPXA 4C7YA 1N60A 2W55A 1TYGB 1IUEA 1AWDA 2JQRB 2Q5WD 3AEDB 4P6VF 1FXAA 1EWYC 3AE8B 1NI3A 4HROA 2AX5A 1NYRA 4ZHPA 2G1EA 1OQRA 2E3TA 1DOIA 3AE1B 2BT6A 1N62A 1WWTA 1JROA 3AEAB 3B2GA 3CWIA 3LB8C 1SIJA 3AE7B 1KF6B 3HRDD 2WU5B 4IDIA 1L6UA 2Y5CA 3BIID 2M56B 3AE5B 1QLBB 2FBWB 4YTNB 3SFEB 1DGJA 1KRHA 1XLNA 1DOYA 3P4RB 4FXCA 4YSYB 3NVVA 1QOBA 2KMMA 2OHFA 2L83A 4USAA 3WCQA 3ETRA 4ZHOA 2KAJA 1JRPA 2N0SB 1ZXIA 2H88B 2K22A 1SB3C 1TKYA 4ZOHC 3AE2B 2MJDA 3AEEB 3AE9B 5GXGB 3P4SB 3DWGC 1AYFA
chains in the Genus database with same CATH superfamily
5JHAA 4GSWA 5J2FA 4JQWC 2WXIA 2QLTA 4RQ2A 5AKJA 2WHIA 3W1SC 4AJYB 1U49A 3V05A 1L6NA 4HCPB 5BMIA 2J6UA 3JPOA 3BYYB 5KFAA 2Y9TA 4DF8A 3ZKJC 1RQNA 5KFKA 9ICEA 4GLSC 4ZYSA 2ATLA 5C23A 2L1AA 4X57B 4DOCA 1OQQA 3KZIU 5KFXA 1SGGA 4Z6EA 4I2FA 1CK1A 2EMSA 2GLSA 2O2VB 2WQYB 3JVZX 1N5XA 3KTQA 1K52A 1MHXA 4ED2A 2MW5A 2WF7A 5J0XA 3QX7A 1V9PA 4OJ6A 3M8RA 1WR1A 3D32A 4FHJA 8ICOA 3TARA 4BBNF 5EE1A 3AE3B 3ZXVA 1QSLA 4LJOB 1FFVA 4MT5A 1EXNA 3J81j 3ZVVA 5LNK1 1ISNA 4X5VA 5L1LA 3VRAB 4ECWA 1BPYA 2WAQC 1QTMA 4J03A 2AHOB 2JMGA 5F3XB 3VRBB 1ZQZA 4RQ8A 1PGBA 1V81A 2JWZA 3MBYA 2RMMA 4K3BA 1KFDA 1SL1A 1FFUA 3DBLI 3AEBB 3KW5B 1V38A 1FPYA 3MGHA 2N1VA 5HR6A 2LZ6A 2EDUA 2GOLA 1K1QA 5KG7A 4P0QA 2B0CA 4FZMA 4M6WB 1OFFA 1D8BA 5KFFA 3TIXA 5AM2A 2WB1F 2KDIA 8ICGA 1WZ0A 9ICXA 2ZW0A 4GLXA 4YD2A 1WRDB 1TK5A 5J0TA 2QSDA 1WYGA 4MEXA 1ET9A 2KTRB 2PIAA 1TY2A 2HJ8A 4CYEA 1GB4A 2QMTA 1PK1B 1WGRA 2L3ZA 3I3TB 1R4MB 4GN1A 1S1QB 2DWQA 4C4VB 2LYAA 2PMZC 1J2MA 3PHXB 2JQRB 1NK6A 3GV7B 2GLEA 2IPKD 2KVSA 2BCQA 4B9UA 1ZQRA 4F2SA 1NYRA 3HT3A 4JB3A 3NZ3A 2KV2A 3GDXA 4B9LA 1XEEA 3V6KA 2MSNA 1RAXA 2D2QA 1RG6A 1BGXT 3JSVB 1L4DB 2KT7A 1ZQOA 3I5JC 4QZDA 5AI5A 1DOYA 2O6VB 9ICVA 1V9JA 1Q0WB 5AIAA 1F0MA 1BPEA 1OXJA 2PMVA 1ZQTA 2KX0A 1LXDA 3AE9B 5CR0A 3P4SB 1U9LA 3BQ1A 2CRXA 2GBRA 1CZPA 2ZPNA 2PI4A 8ICKA 5EE0A 2KOBA 3FM9A 1NBFC 1ZQGA 1MFWA 2WDRB 1S97A 1B4FA 4YP3A 3DBRI 4UB1A 1ESFA 3LWLA 4KX5A 4BKGA 2ZJAA 2WXRA 2EKIA 2OEHA 4OD0A 1X9SA 3ZO5B 1N63A 3EYZA 2JPHA 4KLMA 2M0NA 3KHGA 2DHZA 1L0VB 3P4PB 3UQAA 3PO4A 4TQ1A 4YR0A 2C7HA 4UB2A 2MA9B 5FK9C 5G5GA 3TANA 5CHVC 5AK4A 2Z7JA 4DSIA 2PVOD 5DG9A 2AH5A 4GDKA 3VR8B 1E9MA 4ED3A 3UQ0A 4KIKA 1TJEA 3FDSA 5EE9A 3MFHA 9ICKA 3Q8RB 1TAMA 1ED1A 2KSOA 4NJ6A 2WS3B 5KFEA 2WXFA 5KG0A 3V7LA 4NY8A 2NRZA 1YX5B 2W7OA 1WFYA 4M00A 5J2RA 1FM0D 4A8XC 4P2HA 1JWAD 1WGGA 4M2YA 4PPXA 3GOEA 5E6NA 3RT3B 3W2DA 2KJ8A 4RGOS 2O6VD 1KOTA 1ZD5A 1TKEA 3DVGY 5DPSA 1EF1A 3KLSX 4GDLB 5KTQA 1V5OA 2BCVA 1L3TA 1ZQBA 1QZEA 4MJSB 3HK0A 4KGTA 4LTUA 3DQVA 2B3AA 1VLBA 1VD2A 4YSXB 2TSSA 2WXQA 5MPOA 3MC9A 3CSFA 3LWMA 4JL9A 2JEGA 1XLOA 1SE9A 4K7UA 3DV9A 3BY4B 1E5WA 5AKEA 2ZUCA 4BFRA 4U6PA 4P4PA 3KHRA 3KWVA 2K8CA 2E1FA 2WXGA 1TKDA 2L0TA 3SDLC 4F3OA 1WF9A 4JWSC 4RNNA 1DRGA 1SWWA 2AJQA 2ZEQA 3GIJA 1CUKA 5CRXA 2FCNA 1FXIA 2LUMA 3MFIA 3SZ2A 2YEPF 2MJ3A 1TGZB 3TUOA 1HJPA 2RGFA 1MA7A 5J2AA 3JPTA 4M9GA 3AEDB 2BYEA 2ODGA 2KQ4X 2LPEA 2R8JA 4IG7B 2EAMA 3MHSD 9ICJA 2ZCBA 1Z19A 9ICSA 2DLBA 2M56B 3HM3A 2LGXA 1YD8U 1ZOLA 1Z00B 4RQ6A 3PGEA 1YOVB 3T3NA 3TEWA 4I6NB 2LVPA 3NVVA 3RBEA 4DF4A 2JXXA 4BX9C 4TUPA 5J2DA 5K4LA 2GMIC 4BKSD 3NG0A 8ICSA 5J0OA 2F1HA 7ICTA 3WU2U 2DQNB 2PW9A 2V4QA 3U4EG 2NBVB 4OJLA 4XGAB 2QARA 1JXEA 3IVFA 5CEHA 4AS1A 4MFAA 4TUUA 1ENFA 3SD7A 3ZQ4A 1SJHD 3NRZA 3LK9A 3ZLZA 2QJLA 2YMQA 2LXAA 4I28A 4BBNC 1B22A 1WGHA 3HUIA 1A76A 4QAYA 1IGCA 4ED8A 3PHWB 2MSED 3MDCA 3O13A 2CXYA 4UB3A 3QJZA 3F53A 2XEWA 1UH6A 2K0PA 2XBBC 4L2YA 4B9KA 4MF8A 2R8KA 4DSLA 1STEA 5BMHA 1O03A 2QKQA 2HHSA 3ED5A 5CB1A 2G08A 2WP9B 2KP7A 3FAHA 1N48A 1YZ6A 1ZQMA 4IRCA 2IY0B 4GXBA 1A5RA 1LKYB 2KZRA 3C1ZA 4ICUA 4UQGA 3BVZA 4KZ0A 2IHMA 4RNOA 3QWZB 1CJEA 1QH9A 2B21A 2RPVA 1E0ZA 2RHFA 2N9PC 1JI7A 2YQEA 2DYBA 4XZ4A 2WXHA 1IP9A 5CHWA 1ET6A 1QF6A 2H3IA 4US8A 4YXMA 2WB1C 5CHFA 9ICHA 2JU6X 4ZRJA 1QSSA 4PHPA 1YX6B 2KJRA 5JUMA 2WXNA 3ISBA 2KZMA 3M63B 3OJ4B 4F1SA 1D4BA 5T8IA 2LM1A 1FO4A 3NZUA 1WX8A 1FNUA 1UWMA 1N61A 2L8JA 2KEYA 4IM0A 3DOWA 4GC6A 3W1YA 2ZPYA 5J2HA 7ICMA 3UIOB 3C2LA 4CO7A 3RNAC 3H1UA 2Y0SF 1SE4A 4DQPA 2VH2A 3PV1A 5DDYA 4IM3A 4CGZA 8ICPA 1XSLA 4P1BC 5CA7A 5DB6A 4I2AA 4BAXA 3DBHB 1GPXA 3ZI4A 5DCNA 3KOOA 2C22A 1WJNA 3RB6A 4NJCA 3R2TA 1PYWD 1EWYC 4B9VA 3TACB 3A9KA 2AX5A 4JV2A 2M0AA 1T0SC 1OQRA 3B2GA 2N9LA 1PGAA 3H8SA 2C5LC 4DQQA 3UGBB 2FPMA 1KFTA 2K6DB 3IBEA 5DGAA 3LVWA 2KNJA 4IDIA 1ZD2P 3ONNA 2BQUA 5D3DA 3ZDTA 1Z1VA 4DQSA 2IY1B 3BINA 1XT9B 1OEYA 1TY0A 2LJIA 3SV3A 1LV5A 1QILA 4I2EA 4I6PA 2DKXA 4IQVA 3RR7A 1SL0A 4FA6A 1EWCA 4PYUA 4IC9A 1C77A 4M8MA 3JYUA 2H88B 1OTRB 2ZIVB 3RMKC 1SGHA 3AUOA 1K53A 2W43A 4CQNA 4RQ4A 1Q8KA 4HDQA 2LFIA 2X8XX 1T8EA 4JV0A 2CJNA 4DO9A 5AZHA 9ICWA 4JV1A 2AQ1B 1ZQXA 2NO4A 4N59A 3ZDCA 3GV8B 3WALA 5H8YE 5E79U 3T3FA 5AZFA 2PI5A 3UMGA 4RFBA 3MABA 3MJWA 3PZ8A 3F5AA 4DSKA 4OZAA 2E8PA 3Q3NC 2JZBB 3RULA 4TQRA 3SYZA 2NTSA 1LVHA 5DLGA 4NAWB 1TAQA 1RPLA 1HXYD 2IOFK 1HIWA 1TFRA 1ROEA 3S2AA 3SI8A 3VAWA 2MEKA 5LXIB 4JWNA 4UAWA 3VH4B 3QCAA 4UAZA 4KSKC 1TIFA 2KACA 3MTNB 4MGZE 1EU3A 2E5SA 1XXGA 5ALZA 5E6PA 5LXHA 3HJEA 3QUQA 1NNLA 4EZ9A 2RPQA 4NWIA 4AQ7A 4ED1A 2EKEC 3RZFA 3C2MA 1XSPA 3N20C 4CE6A 2DZKA 2V1YA 4W9IA 1A77A 4R66A 2LMCA 5DQIA 4NJ8A 5KFGA 2JSVX 1COOA 2QB0B 1OGWA 4ELTA 5J0QA 3OSPA 3MP9A 2EZXA 4M6WA 4EYHB 3SENA 4KKJA 1D5ZC 3UXPA 8ICEA 4O3OA 2N1RA 4IL6U 4BJQA 3MFGA 5KNIA 4BVUC 3AB5A 2KTRA 1RQLA 3AECB 3E9SA 4RGNA 3THVA 1BVSA 2AGQA 1C3TA 1PK1A 9ICGA 2G4SA 2PFPA 2L00B 1Q5WB 2A3VA 4ED7A 4OJ5A 1TS3A 4C4VA 4ARIA 3RH5A 3IFWB 1DOXA 2KWVB 3QAQA 3RAXA 2ZJ8A 2P6RA 2PE9A 2PLPA 3I1YA 3PW5A 1NEKB 2WF9A 4L1BA 3BK1A 3AMZA 2NRVA 4DLEA 2JWUA 1QQRA 9ICUA 3Q8MA 3ZRCA 4IQTA 3M3JA 5T14A 5KFBA 2G45B 3JSVA 1P98A 4WIPA 2E3TA 2ESEA 1D3ZA 3RFAA 2O6VA 2M9NA 2G5IB 3OHBA 1L6UA 4ACFA 4DOAA 4EBCA 3P2BA 4K81A 4A8EA 4MH0E 5AKGA 1SXEA 4ASWC 2ASJA 1X1MA 4PL1A 4DDID 5IAAC 1WH3A 5DKWA 4BXOB 4DWIA 2K22A 4DS5A 2WX1A 3NRWA 1UGJA 5AM5A 5IIMA 3TEYA 2MBQA 2F76X 7ICPA 3G6YA 3IT4B 1KM7A 3UIPB 1SKRA 7ICJA 3PLUA 4JMUA 3LDAA 2ZXHA 2JZ3B 5ALMA 3Q8FA 5BOMA 1MPEA 3E0FA 1FIQA 1JMSA 2JYTA 3M8SA 2PMZF 2D3BA 1F5SA 4LNNA 4ZYNA 5DLFA 1P9DU 4BGDA 2HTME 3IHPC 3NTUA 1RYSA 3ISDA 2KMDA 4NZLB 4YWGG 4B9TA 3TEZA 1M6YA 1CI4A 4Y2JA 1UF0A 2X38A 3GE8C 3ZDDA 4Z6FA 4M02A 3KHLA 2QB1A 1NK0A 3Q3OC 2JEJA 4MGIE 3RI7C 1JMLA 2HE7A 1QCKA 2GB1A 2KX3A 4GDLA 3ZTCA 1T0QC 4IQWA 2E8MA 5AKHA 4MM3B 4F8RA 2WU2B 4Y2UA 4MJSA 4HK2A 4F4WA 2WYQA 2YMMA 4ECRA 2V9WA 1C78A 3PO0A 1Z1BA 2VJ4A 4LZDA 2NVUI 4BKSA 4DEZA 2C28A 1QQ6A 2F8LA 4YMNA 4ECZA 4KLUA 1UBQA 2BYTA 3VUYA 4MSMB 1ZKHA 4YCXA 2BPSA 3DEEA 4RNAA 2ZIWB 2VJ5A 2F3NA 4J9KA 4OO1J 4J9SA 3N30A 5J8YC 3WK5A 3RNFC 4B6JA 5KFNA 5GMVA 4O5EA 2AQ2B 4RM9A 1ZQIA 3BZDB 2LEKA 3M7DA 4HAIA 4DL7A 2D6FC 1WZ3A 2D10A 3OPXA 3OJSA 3SD5A 4NQKE 3DDHA 5J0YA 2Y1IA 5ALRA 4QZIA 4C00A 4F72A 5KFOA 1PUZA 2KIWA 2F2AB 5KG2A 4C8NA 2V3PA 3V60A 2KVRA 3C21A 1GOZA 1ZQWA 9ICOA 1NJWA 1NK4A 4PH5A 4Y2YA 1TYGB 4P6VF 4TSSA 5AIBA 5DGBA 1MG8A 3JPNA 1I4PA 1ZQLA 1PK3A 2BWFA 1S10A 1L8LA 2XCAA 4I2IA 1Z00A 1N62A 4EUTA 1NKBA 8ICFA 1PGXA 2AQ4A 5C1ZA 1WM2A 2V0GA 1QLBB 3DHGC 5KFCA 2JR5A 2JZPA 4WQOB 2RDJA 2J6SA 1C76A 2IGDA 2N7EA 1S0MA 2XY5A 2EQYA 1B1ZA 1SE3A 4ZRIA 4F4KA 2V3NA 3PY8A 3UI3A 4O5CA 2FI1A 5DG8A 1SBBB 2N9XA 3R66C 1UA1A 3SU8X 4DHZE 2CS4A 4J6IA 2JV3A 5DQHA 5D3IB 1NJYA 2G06A 2CU3A 1WM3A 1NJXA 1L0YB 3EC8A 3ZW3A 2BGWA 2D11A 1BUIC 3H8MA 2F44A 2H3QA 2VIXA 4KN7A 1TVAA 4NLZA 1L7YA 2AGPA 3B9JA 1Z4NA 1WJ6A 2AL3A 4F5NA 1S77D 1EF5A 4RGMA 2XNAC 3T5HA 3PSEB 1NZBA 2DFLA 4ECUA 1ZQDA 3N1YC 2KO3A 5D6JB 1GB1A 1L6VA 2K9XA 4QWCA 3B08A 4Y2PA 1I4QA 1LKYA 2FCSA 4HJKA 4PS3A 4RQ1A 1WCLA 2KQ7A 5C3JB 5KG5A 4OJOA 2LKYA 1E8YA 4F8CB 2V3SA 3NGDA 3N97B 2D5GA 1LO5D 1J7BA 2M19A 5FKAC 4MH8A 2FIDA 2HDEA 5AM3A 1RXVA 3KFUF 1KQQA 4E71A 4M04A 3BJYA 4ACOA 3ZJVA 4HWIB 2GOWA 3AQEA 4UW9A 1V5TA 1NJZA 2PKOA 2P66A 2CHZA 3AXCA 4KLOA 1WR6E 9ICBA 4KVGB 3PSTA 2J6TA 5D49A 5JTIA 5KAFU 5KFZA 1NZPA 4ED0A 1XLPA 2XY6A 5KFUA 2IO3B 5CJ7A 1SF0A 2XVTA 2JRIB 5J18A 2E8OA 2HBKA 1IPGA 4OW0A 2D3GA 2HSZA 2HBJA 4C8LA 4IWPA 4KDLB 4P1CC 2EMTA 1RLFA 2L52A 2KDMA 1O08A 3PT2B 4DSEA 1R4NI 3CP8A 4LLGM 2IOFA 2CN1A 3KKAA 3QU9A 1D9FA 2R8GA 3T5JA 3R7RA 1WXVA 4QWEA 3WAMA 3ISCA 3L08A 3B0YA 4RM8A 1BNOA 2IA6A 2RLTA 2HHVA 2Y9UA 4C7YA 3MJ5A 1PQSA 4U7CA 4PJ0U 3APCA 4DWFA 5AI9A 3ENEA 1WUDA 4EFOA 1JIHA 2FMPA 4TV3A 2MA1A 3I76A 2VA8A 3L5KA 4IRKA 2W9NA 2N9KA 3KYDD 4S17A 5IN7A 3BVGA 3T8MA 5L95C 1QSYA 3MC0B 2GBMA 1YIWA 2W9BB 2ZIVA 3QXGA 2W9AA 2N7DA 1QOBA 1FCCC 3L0WB 8ICBA 2DKZA 8ICCA 3VUXA 1HZ5A 2JEFA 2NBWB 2XCPA 2Z59B 1KLGD 2FUHB 3AEEB 5GXGB 3A0HU 3WAPA 3RBDA 1HQRD 3MC1A 2ZIUB 3WKEA 1KLUD 4E3CA 4CNQA 1ACCA 3CSTA 1RFAA 4DQIA 7ICQA 2XK5B 2I1QA 4RQ3A 5JRTA 1TZ1A 5A0LA 2KWDA 1Y8RC 3RNGC 3KYCD 3SQIA 2PTLA 1D9DA 4KLGA 2FNJB 1Q10A 2JZBA 1FD6A 1TBEA 1XS9D 1JX4A 1PVRA 2I1JA 3FYHA 3IN5A 1ZJMA 2LJ5A 3AH7A 4NAWA 3V6HA 4A20A 2W9MA 4F5RA 3RJKA 3R9KA 1ZJNA 4B95A 5KFMA 3ZUNA 4RUAA 1AROP 3GV5B 5KFTA 2K3UA 4IR9A 4HLEA 3CIRB 4NLGA 1C4PA 1WYWB 4NLCA 1FRRA 2DPIA 3GZNB 4G0NB 4FULA 2G0AA 5IKCM 2BB6A 1V85A 3NVZA 1X2IA 3WK4A 2ASQA 3TADC 4F5PA 2JRHA 3Q8BA 3OHAA 1HA5A 2HMXA 3ZDEA 1KH0A 1QKZA 2MBEA 2H5XA 4PZNA 1OW5A 1PDXA 3PVXA 1ZOYB 3TL5A 3N9YC 3C23A 1CMXB 4XC2A 2ICIA 2FMQA 3U30A 3U2SC 2QB0A 4ARCA 5D2MB 4GIBA 3LDZE 4HKZE 4NV0A 4K4HA 2J7QB 2BPFA 2GBNA 3RJGA 5C2TB 3VDZA 4LNIA 2WF8A 2Q4TA 1ZQFA 4ECTA 4FJYA 3HX0A 3VR9B 1SZHA 2RQ5A 3JPRA 3VTUA 2LHEA 3WK6A 3PV8A 3C2KA 4KDIC 4G9BA 3QUBA 2B76B 5AM0A 3VQIA 4EKUA 5JXVA 3BZCA 1UCVA 1LFDA 4UB8U 2ZTEA 3QNMA 5KL8B 1RFKA 3FC4A 8ICZA 2Y5PA 4MGKE 1SXDA 5ALGA 4FLHA 4DSFA 2KN4A 2E1EA 2IMWP 2A1AA 2R8HA 1U48A 2GWSA 3W1SA 1KFYB 5C5JA 1F0ZA 9ICCA 4LK0M 1N60A 2K4HA 2K60A 2W55A 3G6XA 3RTVA 4DL2A 1AWDA 4KKIA 2Q5WD 4ZRKA 4NQLB 5J17A 5AI0A 1DOIA 4PS7A 2D8CA 2PXIA 1KF6B 3HRDD 3V6JA 4LDTB 4EELA 3A1QB 2A19A 5IIOA 2AEHA 2W82A 1X9WA 1K8RB 3BQ0A 4BXOA 2NS5A 3MC8A 3M9NB 3KD3A 4KLTA 3DVNU 3X23A 4AWJA 2KIVA 4XX5A 3H0MB 5F9LA 4F4XA 3H7SA 2GRIA 1SIFA 3AI5A 2DAJA 1AYFA 1IM4A 1JWBD 3ZJUA 1ZP0B 3F5EA 1S5LU 4ECVA 4M9NA 2GBKA 1DOQA 1ZQNA 2ISPA 3EW9A 3AU5A 3PZDA 3LYSA 2C60A 1X6JA 3QYPA 3WANA 4IWOA 1NK7A 2KD0A 1C79A 4UDUC 2EZYA 3EUB2 4ZH4A 1NVID 3K9OB 5DQGA 1ZQJA 2HTHA 5DB8A 1XC9A 4P16A 4TKNA 2ES6A 4R65A 3K75D 1YN5A 5AI4A 3MGVA 3MGIA 4M47A 4UBCA 2WTFA 1B43A 3CNHA 1RYUA 1HTQA 1V1OA 4I2DA 5D4BA 4DL5A 2FCQA 3H7PB 3L3FX 1WX7A 2BKFA 2Z0EB 2YEPB 4MM3A 5J0SA 4YMOA 5AZGA 3VUWA 3DPDA 3GS2A 2YB4A 3AN1A 2WNMA 2BF8B 4QZAA 3IAS1 4C4SA 4LDTD 2W11A 4MHVA 4CDGA 1X66A 1WMHB 2BKRB 1ZW7A 1U45A 2RRDA 1S8OA 2INNE 1XCQL 2K8BB 4KGSA 2DAFA 1L3UA 4RGTA 2ZG6A 3ZYYX 1WG8A 3RZWC 3I57A 3DVNV 1L5UA 2ZIWA 3F2DA 2WDQB 3KH0A 5J0PA 4C7ZA 4EYIB 3OGUA 4UBBA 4TUSA 4BOSC 1NI2A 1VR9A 3I9V1 2IZVB 4AOFA 1NYQA 5DBAA 4M9JA 1N5WA 4EEKA 3EPIA 1S76D 2NYVA 9ICQA 1D5MC 3V6CB 3PTFC 1URJA 2M1MA 3PPAA 4TMAB 4QZHA 5L83A 3P1MA 2LASA 2JX5A 3RFZB 1AW7A 4QZFA 1H38A 1YN4A 5DG7A 3APFA 1GAQB 2WXOA 3SEIA 2W3RA 3VCBA 1UT8A 2LI6A 7ICHA 4RQ7A 1XLQA 3LXFA 2MH7A 4JGHB 4WWNA 3QA8A 5ALSA 4Q2JA 1T5XD 5KFJA 7ICOA 3L10B 1BT0A 3DBLB 1HE8A 1WWTA 2WF6A 1D8LA 1SIJA 2VRRB 3AE7B 1H8CA 2FJ6A 2QHOA 4DS4A 4ECXA 1KEJA 2HOQA 3RD2A 4DK5A 2KN5A 3A9JA 3PVLA 2EAPA 3IG8A 3ZDMC 8ICUA 2BR0A 5ALLA 1F52A 3ETRA 4ZHOA 3R8BA 4UB4A 4Q8EA 2M17A 2VKQA 1N56A 1WJUA 5I4DA 3DWGC 2W7PA 3TSSA 2WFAA 3SV4A 1MC8A 8ICHA 2VANA 2XI9A 2ISOA 1KDHA 1FXTB 4FHKA 1RZTA 4B6WA 2EANA 2BS2B 5AKIA 1ZRMA 9ICMA 2ASLA 4KITB 5BYQA 5AKYA 4TUQA 1ZRNA 2HBLA 3VVWB 5KFSA 1BPDA 4MSQB 5TZVA 4PHEA 1Y56A 2CPRA 2NCNA 2LYBA 2FLNA 4W9LA 2KG5A 2R18A 3SR6A 1S0VA 3E2EA 2V9HA 3AQFA 4K7WA 2IDYA 1ZQ1C 4IQUA 1C7YA 2WGSA 1FNVA 2D3CA 3APDA 2JZZA 1WSPA 1V97A 4JE3B 4L23A 4HCNB 1L7PA 2N7JA 1KSPA 2KWUB 2D3DA 4M8NA 1WXMA 1JUDA 4F50A 4DFMA 5IIKA 5L1KA 5HHHA 4EX7A 2LRWA 4WJPA 3PX0A 1QT9A 1DXSA 3S6JA 1XO1A 2INCC 2KDFB 5BYRA 3PW7A 4PHAA 1C1YB 4H2AA 4XDDA 2RR9A 4MFFA 4KLEA 2UWQA 3ABVB 4LVSA 5DPRA 1UELA 4ANVA 2JHDA 5KT6A 4E0DA 1IV8A 2FPKA 1MQ3A 2R61A 3UINB 1KTQA 1GC6A 3GIKA 4HVBA 2UVWA 1Q46A 4WH4A 5L1JA 1Q3VA 3B0XA 1YQ3B 2KWCA 3NOBA 4I27A 3B2FA 1ZD3A 1L7NA 1UGMA 5B66U 4R3DA 3WKCA 3OLMD 1ZQUA 4XQ8A 4BDPA 2LHTA 1MSWD 3RYTA 3R7QA 5KG4A 3BQ7A 9ICAA 3NUQA 4F5QA 4FBTA 3EPGA 3AU2A 2W03A 4FZNA 1L3VA 1ZQPA 1QOGA 2NMQA 2K5PA 3QU7A 4URKA 2KOXA 3PNCA 2L0FA 5HMLA 3PR4A 2YTUA 3C29A 4DHJB 4YTPB 3DVGX 5ALTA 4J9MA 5H2FU 3RF9A 1IUEA 5ALDA 4HROA 2WF5A 1ZQHA 3PRMB 5TSSA 2KE7A 1CRXA 2JXJA 3PMLA 1A6SA 5KAIU 5HHDG 3U7ZA 3BIID 1PZNA 3ZD9A 2W9BA 4FE3A 2KLCA 4NL9C 5HFYA 1MVKA 3WK9A 4FXCA 3G6VA 2QDFA 4KMOB 1UBIA 5KFLA 2LVOA 3AU4A 5ALYA 2BZFA 3LVVA 3EGRA 7ICSA 4XYCA 2ZIUA 2QILA 4Y2QA 4NPNA 2AU0A 2BCSA 5AICA 2JRZA 4Z6CA 4Q45A 2XK5A 3NJTA 3URYA 2G4DB 2G5HB 4G3XB 4HRSA 4FS1A 2MBBB 4O0IA 5IOIA 2A1JB 1EU4A 5KT7A 3T79A 1K1SA 2LVQA 2IYDB 3WKDA 5ALQA 4EZ6A 1VZ6A 4QIWC 1XWLA 2DBYA 3WA0A 5F9NA 5AUKA 2JT4B 3N4MB 4O3QA 3NS1A 2CHWA 3QIJA 1L7OA 5FR6A 1GJZA 1AQ6A 4Y2RA 5EOZA 4PGXA 1HEKA 3PW0A 4GOCA 2ZTDA 3SAFA 1YZ7A 2UYZB 4AYBF 5KFQA 2JY6A 4DHJD 3H8WA 2LI5A 1E10A 1TAUA 4O5KA 3V6EB 2K25A 3NUHB 5EE3A 9ICNA 1F9JA 2PFQA 3RPFC 1WI0A 3QK0A 3IG3A 4UASA 3L4PA 5KFDA 1C9FA 2REXA 2FMSA 4NXZA 1S0OA 2KDBA 1RWSA 1BPBA 8ICIA 4XUSA 4NNJB 3R3MA 2PPHA 4O3NA 1OQYA 3O65B 2OYYA 2BDUA 2OXOA 5HP4A 4C8MA 4W9DA 4TURA 1R4MI 4A9AA 3QARA 3BS5B 1SWVA 4DXFA 4HKQA 2DZMA 2MHJA 3NY5A 2MAXA 5DDMA 4QZGA 1DGSA 2C2RA 2YX8A 2I1KA 4IS7A 2LM4A 2Y3AA 2GBJA 4KLHA 1HUZA 4B9SA 1IG6A 4RU9A 2XIDA 3MR5A 7ICEA 7ICGA 2MUTB 1SE2A 4Y2SA 2DZJA 1GC7A 2R2OA 1R7SA 1S9FA 3H4BA 4MEYA 3M9MB 3EECA 3Q69A 3R2IA 3VFKA 3VXWA 3Q8KA 4M0AA 1JN3A 4KV2A 3Q8EA 4UAVA 4IOIE 1C20A 1P3QU 2BDPA 4P4OA 3ZTDA 4NM2A 3N7RC 3ICXA 2ZXIA 4KZCA 3IV6A 3MR2A 4JWUC 4NJ7A 3HIZA 4JLCA 1YNTE 4J9LA 4MDKE 2LRUA 1EUVB 1GUAB 1HZ6A 2G9HD 4ZRPA 1ZQYA 4ECQA 5HMMA 3L54A 3M62B 2K39A 2VA2A 2OH2A 3RJIA 2K4IA 1T4GA 5KFHA 1KTKA 7ICIA 1SL2A 3N7SC 3A1QA 1X9XA 5ALHA 2BT6A 1JROA 4G11A 3LB8C 3V72A 3I63C 3RRGA 2FAZA 3ZJTA 1DGJA 1KRHA 3ZNZB 4ICVA 1XLNA 2MRPA 3MR6A 1T0YA 5HNKA 5KL1B 2NRWA 3CMMB 1RRBA 4FBJB 3EZ5A 3M95A 1SJED 3M6ZA 4F71A 2XC9A 1JRPA 4B9MA 2JEIA 4ZOHC 1ZQKA 2K1FA 3ML9A 5AUIA 2GI9A 4LZGA 3J9CA 5JU5A 1JRUA 2BS4B 2INDC 3K4GA 4JPSA 1DYQA 1TS2A 1I4RA 2K8AA 1QOFA 3TFSA 4DL6A 1KN5A 2R8IA 2KD1A 2NTTA 1I4XA 1KLVA 2BVCA 3W5VB 4KTQA 1TT5B 3IAM1 4RQ5A 2MBOA 5KT4A 3U26A 4ZRQA 3RNBC 2V4IB 1ZE3D 1IBXB 5ALJA 1WXAA 3H7PA 2G3QB 4F93B 2K4EA 2RDHA 2EH9A 4FJZA 3HKZF 4RPYA 3P4QB 3X0WA 4EEWA 4RNMA 4CCHA 3A9JB 2HVIA 2L7RA 2VZKB 3PS6A 4J3OD 4B9NA 3H6NA 1WMHA 1WE7A 2HI0A 4CF4A 2J42A 2K8BA 4GFJA 7ICLA 2H3FA 2CJOA 3QZ7A 3H8HA 4PZOA 3ZNHB 2WX0A 3EFCA 4K1RB 3PR5B 2F1IA 5L1IA 1XO0A 3E56A 3PO5A 2IBIB 2WDVB 1WRIA 3D6JA 3FKYA 3TKAA 3IP4B 3OAWA 2YB1A 2IO0B 3C8YA 4R63A 4CF3A 1UNSA 4ICAA 5AM4A 1BMLC 4J9NA 5LLIA 3U52E 4BUGA 8ICRA 5TISU 1ZDXA 9ICIA 5D94A 1V80A 1UT5A 3N28A 5FP0A 3HILA 3Q8QB 1V2YA 5KG6A 4YFKA 1SEBD 4YMMA 3WKAA 1YJJA 3T5LA 3CYMA 4CHKA 3QEAZ 3U8ZA 3H7IA 3F2BA 2KJ5A 4WJNA 3QU2A 1XU4A 4KLSA 2KJHB 2HCFA 1KRPA 5IA7A 2UVUA 2FLPA 4DFDA 2I9GA 1YQ4B 3IDWA 4YR3A 4TQ0A 4EZKA 2BQRA 3QU5A 4RQNA 5GTHU 1NK5A 1M4VA 2JF5A 4CRXA 2KC1A 4B0MA 4QJFB 4IW0A 3VTVA 5IILA 2KJ9A 5DBBA 5AM1A 3RNEC 4FFDA 4RT2A 7ICNA 1RDFA 2IGGA 5KFIA 2AGOA 2VZKD 4II2B 4XWTA 4FZLA 2YLMA 4I6LB 4UARA 2DYOA 1QQ7A 4W9FA 4I2JA 5ALUA 5IIJA 3Q8LA 1EM7A 4WAAA 2K4PA 4NLBA 4OVZA 1L0XB 1D6EC 1ZQCA 3AEAB 4ECYA 2ZZPB 2BYFA 2Z8LA 3HWTA 3N1XC 5J2GA 5AKKA 2HJ1A 4ECSA 4OHJA 3MR3A 3GILA 2LGDA 4O9MA 4QZBA 5EDSA 4NM1A 4WWPA 3VTWA 4UB5A 4W9KA 5JZEB 4RF0A 3WCQA 3BYTB 2ZVNA 5J0RA 4PYZA 1SV4A 4F5OA 4P0PB 2KK8A 1WXSA 3Q2AC 4Q44A 1JXLA 2W3SA 2XY7A 3PX6A 7ICFA 3BK2A 4HEA1 2SEBD 3OWEB 4AYBC 3AV8A 2CU1A 5KT5A 4WJ3B 4O3RA 4DL4A 2ZIXB 3TMPB 3DBSA 3PREA 5DPWA 4KX3A 4YTMB 3ALRA 3IG5A 4KSLC 2AYOB 4QWDA 2BHNA 1XO3A 5IO9A 1SZPA 1WCNA 5ALOA 2NPTA 3TEXA 4DBGA 1B0XA 2RDIA 2RDBC 4YT0B 4D2KA 1YJ1A 5KFVA 4W9HA 2WXPA 4REZA 5KHOA 1RYRA 3QC8B 5J8YA 3KBBA 3NVYA 3RR8A 3H0LB 3WIMA 4JUZA 2BCRA 3ZNGC 1WXQA 3D2QA 2KFZA 2WXKA 1L2NA 4Y2TA 5ALKA 2W9CB 1X42A 4QW9A 1LM8B 5J0WA 3GIIA 5BYSA 1SV0A 2NRXA 5J2CA 3CRXA 2NBUA 2K6QA 4ZDVA 4NLKA 3HW8A 3PZPA 2LMRA 2BS3B 3PRZA 1X40A 4KLJA 3B0AA 3K9PB 4MGYE 3FILB 3IHQB 4KX6B 1FMAD 3V62A 3N7PD 5C0YA 1ZQAA 4RZRA 8ICVA 7ICVA 3DBHI 2Z0DB 1J7CA 1FRDA 2BW2A 1UUPA 5ALIA 2ZUBA 1XQQA 3H9DA 2ZNVC 2YMPA 1Z2MA 4YSZB 1YMHE 1J7AA 4YN4A 3GQCA 4I2HA 2NR2A 3ZIMA 4EZLA 2KKCA 1TV9A 3UPQA 2M4NA 1J0GA 2ZJ5A 3QQ8B 4S0RA 1NK9A 1C4CA 2EELA 5KFYA 1ZQVA 2PFOA 1ECWA 2Q0ZX 1ZDVA 4DL3A 2EZZA 2MX2A 1UPHA 2KLGA 5EWFA 1KJTA 3NZSA 3BZKA 4BOZB 1A70A 1F2RI 3VHTC 2MWSB 1QOAA 4QNLA 4HDOA 3BQ2A 1P7FA 2G07A 1MI0A 2V4RA 4WWMA 4M9LA 2IO1B 3GP7A 5EWEA 1NI3A 1V1PB 4JWMA 4ZHPA 3HM6X 5BOLA 3RJFA 3GFKB 1TS4A 2L76A 4RH6A 2BWES 2XICA 2KYWA 3AE5B 3EFUA 3N1ZC 3M6KA 4EZJA 2RDGA 1N2XA 1SXTA 3VC8A 2FLLA 4YSYB 2J52A 2K8HA 4HPMB 3UF8A 1TZOA 2N1WA 2C7MB 1F77A 3CW2C 2N0SB 1SB3C 5BPCA 2A1JA 2FE9A 4RF1A 7ICRA 3RUIB 1TK8A 3PLVA 1GG3A 4R8UB 2IO2B 1L3SA 1RYJA 3HKZC 2CHXA 2AL6A 2DNFA 4US9A 4KLIA 4DFKA 2J4XA 1XSNA 1Z3EB 2ACZB 5ALWA 2DENB 2W54A 4K4IA 5IIIA 4MACA 1JQ4A 2SAKA 4ELVA 3H8JA 2JGAA 4KGRA 3B1LX 4NAMA 3D2NA 4BKTA 1B9RA 2IGHA 2UU7A 2WXMA 5AKZA 2R2QA 1ZGUB 4RQMA 1FEZA 2DF4B 1K5OA 4GGQA 1V6EA 3PSIA 2LYHA 2J0MA 2L32A 2QIEB 1LB2B 2RD0A 5ALVA 4DSJA 1S3SG 2M0XA 3UMCA 4RCOA 4WQMA 2PEAA 3JW0X 2BQ3A 3KWLA 4WURA 2KTQA 4GXKA 5AKXA 2PFNA 4N6EB 1IYFA 2KHVA 3BS5A 3SAGA 4J9RA 2WXJA 2I2YA 2MLBA 3PW2A 1HTOA 2ONQA 4O1NA 4C56C 2LGYA 1DK3A 1M94A 2L5YA 1Y88A 3HP6A 2C2EA 3A33B 3BWUD 4QZCA 4HJGE 4ITKA 2MU2A 4YR2A 1ZQQA 1WJ4A 1DK2A 2J0KA 1VRAB 2DL0A 2UVVA 4F92B 4Q43A 2MUTA 4A90A 2ZUDA 3ZD8A 4CF5A 2DPJA 2KVZA 2LXCA 4N58A 3TJPA 4ANUA 3JPSA 4RPZA 2HHQA 3RB4A 2K89A 4LJPB 1PFDA 1RXWA 1ZD4A 4WJOA 4QIWF 3H40A 2IHNA 2WDTB 4MEMA 3DDCB 4F4YA 1RM6C 1WWUA 3NVWA 4HPLB 4OVUA 3L17A 1ZYQA 2G09A 3I28A 2C9WB 4OZCA 4RMAA 1UHUA 2KK0A 3WAOA 3W5UB 2KFKB 5TR5A 3RN9C 2YN4A 3PSPA 4AP4C 4QZ8A 4EX6A 1OEYJ 3KQ4A 3L16A 4MELA 4DQRA 4W9GA 4O3SA 2M8SA 2D07B 2DUYA 1T6BX 4AJWA 2HW3A 5ALNA 5HG2A 2FCMA 1NKEA 2LD9A 5J29A 2BPGA 4DDGD 8ICWA 5KHQA 1VCBA 5AEKB 4G50A 2DZIA 4GMVA 1LQBA 5JH5C 3TCAA 1WX9A 3OSNA 3HPOA 3SFDB 3D2SA 4YTNB 4IM2A 5KFRA 2LGSA 2KJ6A 4C4TA 3Q8CA 1FCLA 2KFJA 3TFRA 1I4GA 1ZXHA 2JYEA 2ASDA 7ICUA 4IKGA 1F1HA 4WWOA 1AN8A 2L83A 1JWSD 4QZEA 2W8KA 1R4NB 2KAJA 2HBMA 3WKBA 1JWUD 4PT5A 1ZXIA 4QW8A 2Y1JA 4KLDA 3TADA 2E8NA 3SHQA 1I4HA 5AK3A 5JHBA 1MHHE 4ED6A 3BDPA 2HOIA 7ICKA 4OJPA 4BWJA 2BQQA 4A55A 3A4SC 1E7VA 3Q8AA 1IBXA 2YMLA 3RB0A 2F77X 1C4AA 4W9CA 3QE9Y 3Q3JA 2L05A 4HXDA 3SMVA 2NO5A 2AQ0A 4EOYA 1OUQA 4FN2A 5IP4D 2HHXA 4RQ0A 1PVQA 1K51A 2A4ZA 3RJEA 3TBLD 2OEDA 4YXJA 3L13A 8ICYA 4GC7A 2MJEA 3TI0A 1IIPA 4C8OA 1J19A 4Z6DA 2FPLA 5KFPA 1K50A 2BBCA 5CWRA 4FADA 2N4FA 3AEGB 1L7MA 2MP2A 3RNCC 1VJKA 1WY8A 4JIOU 3P63A 1E6EB 1CQVA 2XGPA 3QEBZ 2VA3A 3AULA 5KT3A 2KICA 1Z4OA 2J0JA 2PVGC 3M1YA 3Q3FA 4KN4A 4DLGA 8ICTA 4RPXA 3V7KA 3RCZA 1TK0A 3AU6A 1P7DA 4EBEA 1VZ7A 2KQSA 3HVDA 2OM6A 2DX5B 5DBCA 1UA0A 3UM9A 4XA5A 3HVZA 4M01A 4PGQA 4LCDE 1U4AA 4YXDB 1PVPA 3RH4A 2H3ZA 2NPTB 3W9CB 4W9EA 3AL0B 3QZ8A 3RB3A 3Q14C 2BGFA 1ZPSA 4QWAA 4C0ZA 1WGKA 1ZETA 2JVCA 4O3MA 1ZQEA 1JALA 4PL2A 3PMNA 4DFPA 5DB7A 2HVHA 5HR7A 9ICFA 9ICLA 1Q1OA 2FIFA 2OOBB 1FNWA 2WWZA 2OCEA 2WXLA 3AE4B 2MCNB 1COKA 1J8CA 1NK8A 1BNPA 4P0QB 5G55A 5AKLA 4FS2A 1MN8A 3DBRB 3TAPA 2IOHA 5DB9A 3ECIA 4PS8A 4DXGA 1S0NA 4I29A 1TTNA 2I5HA 3MDAA 3M9OB 1WGDA 3Q3MC 4OVVA 1KLNA 4DFJA 1I42A 2KHWB 2WLBA 2BYVE 3KZXA 4EE2A 3K1ZA 5AHXA 3A4RA 4F4ZA 3CF6E 1KL9A 5G2NA 1L4ZB 2OJRA 2PKEA 3AE8B 2LWPA 2G1EA 2JH1A 5KG1A 3OJUA 4Q8FA 3AE1B 2ZVOA 3ALBA 5J0UA 5CX3A 2WU5B 1BPZA 3TQ1A 4PGYA 2C2DA 1TS5A 1UZXB 3ONSA 4KMUA 1MQ2A 2O2VA 3EA6A 3WK7A 3F2CA 5L9XA 1E8XA 3P4RB 1MJDA 4GXJA 4P0PA 1NDDA 2KMMA 2OHFA 2Y5BB 4E74A 4M0WA 2INPE 4UATA 4KLFA 1TKYA 3N3KB 4IUMB 1VJ5A 3NASA 3IXSA 2KN7A 3C1YA 2KHQA 3V3XA 1J97A 1E8ZA 2ZIXA 3PW4A 1P0RA 3AM9A 1A0PA 5G5HA 1P1AA 1NOMA 2KANA 2YVCA 4II3B 2GO7A 5BMGA 5E6OA 4BWMA 1Z5SB 1F44A 2GH1A 2ZCCA 1T3QA 1HEZE 1U47A 3GE3C 4RT3A 3QX1A 4LNFA 3UMBA 5H92C 5HI1A 2KZZA 4G3IA 4XRHA 5L1MA 1JWMD 4EBDA 1IGDA 2HD5B 4A3OA 8ICXA 4JX1C 5KG3A 2HHWA 3PX4A 1NKCA 5ALFA 1VDVA 3PSFA 3C5GA 1E7UA 2KVCA 4LNKA 2W9CA 5CTRC 3SEBA 3P42A 1T94A 4FJVB 1BXTA 4HPPA 4P4MA 4RUCA 4HYKA 1AARA 1WE6A 3JPPA 2HHUA 4J9QA 4K3CA 2F8KA 4JK1A 5CHGA 9ICTA 1I7HA 4GDKB 3FILA 3JPQA 3A0BU 5KFWA 2RSUA 4KIKB 1X6IA 2QEJC 1V86A 2HOFA 4I2GA 2KSOB 1UWXA 2NV3A 1L5PA 5ALXA 2BKEA 5HKHA 3LJ3A 2KXJA 3PZ7A 2N9EB 1XCTL 3UQBA 4QWBA 4XWWA 4UAYA 1N6ZA 3QUCA 1JW9D 2LHDA 4LJXA 3E58A 5CP2A 3DCGA 1XF5L 4K7SA 2MBHA 5J2BA 2IJ0A 4P7IA 3ZRFA 8ICNA 2EAOA 2E6XA 1YT3A 5ALPA 4Y2XA 1QQ5A 2H3VA 1X9MA 5IINA 1WIAA 1KBUA 2WAQF 1T3NA 4NLNA 2C7NB 1SKSA 3V7JA 3ZDBA 1WGYA 4I2CA 3Q8SB 3C19A 3O0FA 4IRDA 2W8LA 1D8YA 4A6QA 3SAHA 2MRLA 3ZNID 8ICQA 2K8CB 3KVFB 3VH3B 4R64A 2V4LA 3QHTA 1V8CA 1V1PA 1U4BA 1HUOA 4W9JA 2AQ3B 2BTEA 9ICRA 4J9PA 2ZW1A 3OG5A 1FXAA 3KHHA 2UVRA 5DPTA 2PE6B 3CWIA 4LNOA 5AK5A 4PHDA 4KLQA 2Y5CA 2FBWB 3MHZA 4XDCA 2KMAA 2O6KA 2XN9C 2BCUA 2FE8A 1KFSA 1KW4A 1E8WA 4GIVA 2P35A 2ALZA 2YY6A 4EENA 4O3PA 2LBOA 4MF2A 1P7EA 1T0RC 2KTFA 3BVMA 4AUQC 2A5UA 3GZNI 3T5KA 4ANWA 1BPXA 4R8UA 8ICMA 3AE2B 3IM1A 5D46A 4YG2A 5EWGA 5E6JA 3KKAC 1GO3F 5D7GA 4BZAA 1V49A 1T7PA 1EO6A 2KZ3A 3OTQA 1E90A 2BB5A 5HHIA 3TAQA 3RRHA 2H89B 4UB6U 4UAUA 3UXOA 3EHVA 3KUDB 3Q6BA 5FR3A 2P6UA 4J9OA 1IXRA 1Q3UA 4EEYA 4F7ZA 2FDRA 5GTIU 4AP9A 2QARB 4FBUA 1GNUA 4DCCA 3EWAA 4C4RA 3GU3A 2VH1A 2WHEA 2KKVA 2J53A 2W04A 2XO7A 3H0RB 2AWTA 2ZNVB 2JUOA 4MFCA 3BQTA 1SSNA 4ANXA 2Y0SC 4DHZB 3N32A 3DHHC 3LYYA 3BS7A 3C0RB 4GXIA 1JCKB 2D3AA 1J2NA 1F2RC 1TKGA 1YQBA 2KDEB 2MQJA 4N9F4 4OCZA 2KFNA 3ZGZA 4DOBA 3ORYA 5AK6A 4IR1A 3UQ2A 3U7DA 2CKHB 5J2IA 4TQSA 1QLNA 3AEVA 3KUZA 4M0WB 2HDOA 3GZFA 1SV0C 1ZUD2 4IWQA 5J2KA 2IBKA 2OWOA 1NENB 1ZQSA 2KNBA 2ZJDA 2KKPA 3KUCB 1WWVA 4FO6A 1KKXA 2CR5A 2QC8A 1E7PB 5KT2A 3UXNA 4XE0A 4KLLA 3QUTA 4F2RA 1D5XC 2AXTU 5B5EU 3Q8PB 3C28A 2ZTCA 2LUEA 3AEFB 4NL9A 4ELUA 3NHEB 4NY0A 1LGRA 3AE6B 1SKWA 3T9LA 3V61A 3RH6A 4DQOC 4M9HA 4K4GA 2KFKA 4WAFA 4OZBA 2MP2B 2NRTA 4GU2A 1UQVA 5BO4B 2HHTA 2I6XA 2JH7A 2RP5A 1XD3B 3ML8A 3GIMA 4IC7B 2FUG1 4Y2VA 3RJHA 2OJWA 3DWMA 5J2JA 1H4RA 5ALEA 2QCZA 3ZDAA 1VZ8A 1MG4A 3DHIC 2BPCA 3PRPB 1PUTA 4B0EA 2XGQA 1YJIA 4WJQA 4I2BA 4C80A 1G6JA 4DXAB 3IT6B 4PK1A 3RAQA 2LGIA 3NS8A 5AI8A 3WK8A 4GB9A 2I38A 1XNSA 9ICPA 2F1JA 2B6GA 2ON8A 3A9KB 8ICJA 3QU4A 4YD1A 3H4DA 8ICLA 2KC2A 3SFEB 3K1RB 2PJHA 4QZ9A 2KMCA 1CEZA 3IRUA 5AI6A 4F91B 1FEHA 4YL8A 3ZXRA 3GB1A 3HHMA 1L8OA 5J2EA 1I35A 3OJ3A 8ICAA 4USAA 1UD7A 4A3PA 4YVZA 2DYMA 1TE2A 3C5FA 2JXTA 4C8KA 3T3OA 1YN3A 4YQWA 2DGZA 2MJDA 3RJJA 3ETLA
chains in the Genus database with same CATH topology
3TEYA 2WXIA 1RYJA 3IT4B 3V05A 4US9A 5BMIA 2BS2B 3BYYB 2J4XA 2ACZB 5BYQA 3Q8FA 2W54A 1MPEA 4ZYSA 1FIQA 4GLSC 4MACA 2JYTA 2L1AA 1JQ4A 2SAKA 1Y56A 4KGRA 4NAMA 1OQQA 2HTME 1CK1A 1B9RA 3SR6A 2IGHA 2WQYB 2WXMA 4RF1A 1N5XA 1K52A 1MHXA 2IDYA 4NZLB 4YWGG 3TEZA 1FNVA 2X38A 2QIEB 2L32A 1WSPA 1V97A 4JE3B 4L23A 4WQMA 2N7JA 4RCOA 5EE1A 4WURA 1JMLA 3KWLA 3AE3B 4N6EB 2GB1A 2WXJA 2I2YA 1FFVA 4MM3B 2WU2B 4MT5A 2ONQA 4O1NA 5LNK1 4C56C 3VRAB 1QT9A 4ITKA 4HJGE 3BWUD 5BYRA 1C78A 3PO0A 1VRAB 4H2AA 4XDDA 3VRBB 4A90A 1PGBA 2RMMA 4N58A 3ABVB 2BYTA 1FFUA 3AEBB 2R61A 1PFDA 4RNAA 4WH4A 1YQ3B 2AQ2B 3B2FA 1RM6C 3NVWA 3BZDB 2LEKA 4R3DA 1OFFA 4OZCA 3W5UB 2ZW0A 3KQ4A 2QSDA 1WYGA 1ET9A 2PIAA 1QOGA 1TY2A 2NMQA 1GB4A 2K5PA 1T6BX 2QMTA 2V3PA 1GOZA 2DWQA 5HG2A 4YTPB 1TYGB 1IUEA 2JQRB 4P6VF 4TSSA 2IPKD 1I4PA 4HROA 5TSSA 1NYRA 1N62A 3NZ3A 1PGXA 3SFDB 1XEEA 4YTNB 5HHDG 3BIID 3U7ZA 2V0GA 1QLBB 3Q8CA 5HFYA 1L4DB 1FCLA 1MVKA 1DOYA 1I4GA 1ZXHA 2JYEA 4FXCA 2JZPA 4IKGA 1C76A 2IGDA 1B1ZA 1SE3A 1AN8A 2L83A 3EGRA 1JWSD 2QILA 2PMVA 2KAJA 2V3NA 3UI3A 1JWUD 4PT5A 1ZXIA 3AE9B 1SBBB 3P4SB 1I4HA 3URYA 1CZPA 5D3IB 2CU3A 4HRSA 5EE0A 1MHHE 1L0YB 1EU4A 2WDRB 4A55A 1ESFA 3Q8AA 1BUIC 1VZ6A 1IBXA 1C4AA 2WXRA 2DBYA 2EKIA 3B9JA 1N63A 5AUKA 4RGMA 1L0VB 2XNAC 3P4PB 3NS1A 1K51A 4TQ1A 5G5GA 2OEDA 1GB1A 2MJEA 1L6VA 2K9XA 2PVOD 1E10A 1K50A 2BBCA 3VR8B 1I4QA 1E9MA 3AEGB 1TJEA 3NUHB 5EE3A 5EE9A 3RPFC 1VJKA 2WS3B 1E6EB 2WXFA 3L4PA 1CQVA 3P63A 1C9FA 5C3JB 1FM0D 2PVGC 4A8XC 1RWSA 1JWAD 2D5GA 1LO5D 1J7BA 2M19A 3W2DA 4RGOS 5FKAC 1VZ7A 3HVDA 1TKEA 4MH8A 4A9AA 2HDEA 3KLSX 4GDLB 4DXFA 4HKQA 3HVZA 3ZJVA 4KGTA 4LTUA 2PKOA 4YXDB 1VLBA 2Y3AA 3W9CB 4YSXB 2TSSA 2WXQA 5MPOA 1ZPSA 1SE2A 1XLOA 1WGKA 1XLPA 1JALA 1R7SA 1SF0A 5FK9C 3R2IA 3Q69A 1FNWA 4OW0A 2WXLA 3AE4B 3KWVA 2WXGA 3Q8EA 2L52A 4IOIE 2KDMA 4JWSC 4LLGM 4JWUC 4DXGA 1YNTE 1FXIA 2LUMA 2YEPF 2MJ3A 1HZ6A 3TUOA 2G9HD 2WLBA 4ZRPA 4EE2A 4C7YA 3MJ5A 3AEDB 1L4ZB 3AE8B 2KQ4X 1KTKA 2G1EA 3AE1B 2BT6A 1JROA 3LB8C 2WU5B 2N9KA 2DLBA 2M56B 1TS5A 3BVGA 3ZJTA 1DGJA 1KRHA 1XLNA 3EA6A 3P4RB 3MC0B 3T3NA 3TEWA 3NVVA 1QOBA 1FCCC 2KMMA 2OHFA 1SJED 2INPE 1HZ5A 1JRPA 1KLGD 3AEEB 1TKYA 5GXGB 4ZOHC 3IXSA 3V3XA 1HQRD 5AUIA 1KLUD 2GI9A 2PW9A 3AM9A 5G5HA 3J9CA 3U4EG 1ACCA 2BS4B 5BMGA 4JPSA 4AS1A 3ZQ4A 1ENFA 1DYQA 1T3QA 1TS2A 2KWDA 1I4RA 1HEZE 3NRZA 1QOFA 1SJHD 2QJLA 2NTTA 1I4XA 2PTLA 5H92C 5HI1A 3W5VB 3IAM1 1Q10A 1JWMD 3HUIA 1FD6A 1IGDA 4ZRQA 2V4IB 1IGCA 1ZE3D 3AH7A 1IBXB 3O13A 4JX1C 1VDVA 2RDHA 3SEBA 3P42A 3P4QB 2K0PA 1BXTA 4L2YA 2K3UA 2VZKB 3CIRB 1C4PA 4J3OD 1STEA 5BMHA 1FRRA 1I7HA 2WP9B 4GDKB 4M0WA 2BB6A 3FAHA 3FILA 3NVZA 2J42A 2QEJC 3H8HA 2CJOA 3BVZA 3Q8BA 1UWXA 1HA5A 1KH0A 1CJEA 1QKZA 1E0ZA 1L5PA 2RPVA 1PDXA 1ZOYB 3E56A 2WXHA 2WDVB 3N9YC 1WRIA 3PZ7A 1XCTL 1ET6A 2ICIA 3U2SC 4XWWA 1QF6A 4US8A 4ARCA 3C8YA 1JW9D 2JU6X 1UNSA 2LHDA 4HKZE 1BMLC 1XF5L 2IJ0A 5C2TB 3U52E 1ZDXA 2WXNA 2E6XA 1D4BA 3VR9B 5T8IA 1FO4A 1FNUA 2LHEA 1SEBD 1UWMA 1N61A 1YJJA 2B76B 3VQIA 5JXVA 1RFKA 4A6QA 3FC4A 2Y5PA 1YQ4B 4TQ0A 1M4VA 1SE4A 2KN4A 4B0MA 3W1SA 1KFYB 1V8CA 1V1PA 2IGGA 2VZKD 4XWTA 1F0ZA 1GPXA 2AQ3B 4LK0M 2BTEA 1N60A 2W55A 2DYOA 1AWDA 1EM7A 2ZW1A 2Q5WD 4KKIA 3R2TA 1FXAA 1EWYC 1PYWD 4NJCA 4OVZA 2AX5A 2M0AA 1L0XB 1D6EC 1OQRA 3AEAB 1DOIA 2N9LA 3B2GA 3CWIA 1PGAA 1KF6B 3HRDD 2Z8LA 4IDIA 2Y5CA 5D3DA 2FBWB 3MHZA 4XDCA 2W82A 4OHJA 1TY0A 2LJIA 2XN9C 2FE8A 1QILA 1P7EA 3BVMA 4RF0A 3WCQA 3BYTB 1EWCA 1C77A 3AE2B 2H88B 2GRIA 5E6JA 5D7GA 3ZJUA 1AYFA 1JWBD 1K53A 2W3SA 4CQNA 1ZP0B 2LFIA 2BB5A 3BK2A 4HEA1 2SEBD 3OWEB 2H89B 3AV8A 2CJNA 2AQ1B 5FR3A 4N59A 4YTMB 5H8YE 1C79A 4UDUC 1XO3A 1NVID 3EUB2 3TEXA 4P16A 4YT0B 4D2KA 4RFBA 2WXPA 4REZA 3PZ8A 2J53A 4OZAA 3NVYA 1YN5A 1SSNA 2NTSA 1V1OA 4NAWB 1WXQA 2WXKA 3LYYA 1JCKB 1HXYD 2YEPB 5BYSA 1F2RC 1ROEA 3GS2A 3AN1A 1TKGA 2MEKA 2WNMA 3IAS1 3ZGZA 2BS3B 2KACA 1EU3A 1XXGA 3FILB 1ZUD2 4RGTA 2INNE 1XCQL 4KGSA 1NENB 4KX6B 4AQ7A 1FMAD 3ZYYX 3I57A 1J7CA 1FRDA 1E7PB 1UUPA 2BW2A 2WDQB 4XE0A 2LMCA 4C7ZA 2JSVX 1D5XC 4YSZB 1YMHE 1J7AA 1VR9A 3I9V1 3MP9A 1NYQA 3AEFB 1N5WA 3AE6B 1D5MC 1D5ZC 4KKJA 1C4CA 4DQOC 2EELA 3MFGA 4WAFA 4OZBA 3AB5A 4TMAB 3AECB 3E9SA 4RGNA 3P1MA 1ZDVA 2JX5A 3RFZB 1AW7A 1TS3A 2FUG1 4ARIA 1YN4A 1DOXA 3DWMA 1GAQB 2WXOA 1VZ8A 1A70A 1F2RI 2W3RA 1PUTA 1QOAA 2PLPA 4B0EA 1NEKB 1YJIA 4L1BA 1P7FA 3AMZA 3BK1A 1XLQA 2JWUA 4C80A 1QQRA 2MH7A 3LXFA 1MI0A 4WWMA 3IT6B 4Q2JA 2LGIA 3GP7A 1T5XD 1NI3A 1V1PB 4ZHPA 4WIPA 2E3TA 2I38A 1WWTA 1TS4A 1SIJA 2ON8A 3AE7B 4RH6A 1L6UA 3AE5B 3SFEB 2RDGA 1FEHA 1SXTA 4YSYB 3GB1A 2J52A 1TZOA 4USAA 3ETRA 4ZHOA 3R8BA 1F77A 2DYMA 2JXTA 2N0SB 3T3OA 2K22A 1YN3A 1SB3C 2MJDA 1UGJA 5I4DA 3DWGC 3TSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWB D;  5AUI A;  1CZP A;  2W3S A;  1ZP0 B;  2CU3 A;  4HRS A;  3SFD B;  5EE0 A;  3AM9 A;  5G5H A;  1RYJ A;  2H89 B;  2WDR B;  2BS4 B;  3AV8 A;  4US9 A;  2CJN A;  4N59 A;  1T3Q A;  2BS2 B;  3NRZ A;  1QOF A;  4YTM B;  5H8Y E;  2ACZ B;  2DBY A;  3B9J A;  2EKI A;  2QJL A;  5H92 C;  1XO3 A;  1N63 A;  2W54 A;  3EUB 2;  1FIQ A;  1NVI D;  5AUK A;  3W5V B;  3HUI A;  1L0V B;  3P4P B;  1JQ4 A;  4YT0 B;  3NS1 A;  3AH7 A;  4JX1 C;  5G5G A;  1OQQ A;  2HTM E;  1VDV A;  2MJE A;  3NVY A;  1B9R A;  3SR6 A;  1L6V A;  2K9X A;  2PVO D;  2WQY B;  3P4Q B;  1N5X A;  1E10 A;  3VR8 B;  1E9M A;  1WXQ A;  3CIR B;  2QIE B;  3AEG B;  1TJE A;  1FRR A;  5EE3 A;  5EE9 A;  3RPF C;  1VJK A;  1V97 A;  1I7H A;  1E6E B;  2WP9 B;  3L4P A;  1ROE A;  3FAH A;  3AN1 A;  1TKG A;  2WS3 B;  3P63 A;  4WQM A;  3KWL A;  5EE1 A;  3NVZ A;  3AE3 B;  5C3J B;  1FM0 D;  2PVG C;  4N6E B;  2BS3 B;  1RWS A;  2CJO A;  1FFV A;  1JWA D;  1J7B A;  2M19 A;  2WU2 B;  1ZUD 2;  1CJE A;  1E0Z A;  1L5P A;  1TKE A;  4A9A A;  1PDX A;  1NEN B;  1QT9 A;  1ZOY B;  4ITK A;  4KX6 B;  1FMA D;  2WDV B;  1WRI A;  3VRA B;  3ZYY X;  3HVZ A;  1QF6 A;  3PO0 A;  4US8 A;  1J7C A;  1FRD A;  3VRB B;  1E7P B;  4LTU A;  2WDQ B;  1JW9 D;  2PKO A;  4YXD B;  1VLB A;  4C7Z A;  3ABV B;  4N58 A;  1FFU A;  3W9C B;  3AEB B;  5C2T B;  4YSZ B;  4YSX B;  5MPO A;  1J7A A;  1PFD A;  1NYQ A;  1XLO A;  3AEF B;  1WGK A;  1YQ3 B;  3VR9 B;  1XLP A;  1N5W A;  1FO4 A;  3AE6 B;  1JAL A;  1R7S A;  1UWM A;  1N61 A;  1RM6 C;  1SF0 A;  1YJJ A;  3B2F A;  3NVW A;  2B76 B;  2LEK A;  3AE4 B;  1OFF A;  3AB5 A;  3AEC B;  2L52 A;  3P1M A;  1RFK A;  4JWS C;  3FC4 A;  3W5U B;  1YQ4 B;  2JX5 A;  1WYG A;  2PIA A;  1DOX A;  1QOG A;  3DWM A;  4JWU C;  1GAQ B;  2K5P A;  1A70 A;  2W3R A;  1FXI A;  1PUT A;  1QOA A;  1NEK B;  1YJI A;  2DWQ A;  2MJ3 A;  3AMZ A;  1KFY B;  1V8C A;  1XLQ A;  2WLB A;  4C80 A;  2MH7 A;  3LXF A;  1F0Z A;  4YTP B;  4WWM A;  1GPX A;  4C7Y A;  1N60 A;  2W55 A;  1TYG B;  1IUE A;  1AWD A;  2JQR B;  2Q5W D;  3AED B;  4P6V F;  1FXA A;  1EWY C;  3AE8 B;  1NI3 A;  4HRO A;  2AX5 A;  1NYR A;  4ZHP A;  2G1E A;  1OQR A;  2E3T A;  1DOI A;  3AE1 B;  2BT6 A;  1N62 A;  1WWT A;  1JRO A;  3AEA B;  3B2G A;  3CWI A;  3LB8 C;  1SIJ A;  3AE7 B;  1KF6 B;  3HRD D;  2WU5 B;  4IDI A;  1L6U A;  2Y5C A;  3BII D;  2M56 B;  3AE5 B;  1QLB B;  2FBW B;  4YTN B;  3SFE B;  1DGJ A;  1KRH A;  1XLN A;  1DOY A;  3P4R B;  4FXC A;  4YSY B;  3NVV A;  1QOB A;  2KMM A;  2OHF A;  2L83 A;  4USA A;  3WCQ A;  3ETR A;  4ZHO A;  2KAJ A;  1JRP A;  2N0S B;  1ZXI A;  2H88 B;  2K22 A;  1SB3 C;  1TKY A;  4ZOH C;  3AE2 B;  2MJD A;  3AEE B;  3AE9 B;  5GXG B;  3P4S B;  3DWG C;  1AYF A; 
#chains in the Genus database with same CATH topology
 5JHA A;  4GSW A;  5J2F A;  4JQW C;  2WXI A;  2QLT A;  4RQ2 A;  5AKJ A;  2WHI A;  3W1S C;  4AJY B;  1U49 A;  3V05 A;  1L6N A;  4HCP B;  5BMI A;  2J6U A;  3JPO A;  3BYY B;  5KFA A;  2Y9T A;  4DF8 A;  3ZKJ C;  1RQN A;  5KFK A;  9ICE A;  4GLS C;  4ZYS A;  2ATL A;  5C23 A;  2L1A A;  4X57 B;  4DOC A;  1OQQ A;  3KZI U;  5KFX A;  1SGG A;  4Z6E A;  4I2F A;  1CK1 A;  2EMS A;  2GLS A;  2O2V B;  2WQY B;  3JVZ X;  1N5X A;  3KTQ A;  1K52 A;  1MHX A;  4ED2 A;  2MW5 A;  2WF7 A;  5J0X A;  3QX7 A;  1V9P A;  4OJ6 A;  3M8R A;  1WR1 A;  3D32 A;  4FHJ A;  8ICO A;  3TAR A;  4BBN F;  5EE1 A;  3AE3 B;  3ZXV A;  1QSL A;  4LJO B;  1FFV A;  4MT5 A;  1EXN A;  3J81 j;  3ZVV A;  5LNK 1;  1ISN A;  4X5V A;  5L1L A;  3VRA B;  4ECW A;  1BPY A;  2WAQ C;  1QTM A;  4J03 A;  2AHO B;  2JMG A;  5F3X B;  3VRB B;  1ZQZ A;  4RQ8 A;  1PGB A;  1V81 A;  2JWZ A;  3MBY A;  2RMM A;  4K3B A;  1KFD A;  1SL1 A;  1FFU A;  3DBL I;  3AEB B;  3KW5 B;  1V38 A;  1FPY A;  3MGH A;  2N1V A;  5HR6 A;  2LZ6 A;  2EDU A;  2GOL A;  1K1Q A;  5KG7 A;  4P0Q A;  2B0C A;  4FZM A;  4M6W B;  1OFF A;  1D8B A;  5KFF A;  3TIX A;  5AM2 A;  2WB1 F;  2KDI A;  8ICG A;  1WZ0 A;  9ICX A;  2ZW0 A;  4GLX A;  4YD2 A;  1WRD B;  1TK5 A;  5J0T A;  2QSD A;  1WYG A;  4MEX A;  1ET9 A;  2KTR B;  2PIA A;  1TY2 A;  2HJ8 A;  4CYE A;  1GB4 A;  2QMT A;  1PK1 B;  1WGR A;  2L3Z A;  3I3T B;  1R4M B;  4GN1 A;  1S1Q B;  2DWQ A;  4C4V B;  2LYA A;  2PMZ C;  1J2M A;  3PHX B;  2JQR B;  1NK6 A;  3GV7 B;  2GLE A;  2IPK D;  2KVS A;  2BCQ A;  4B9U A;  1ZQR A;  4F2S A;  1NYR A;  3HT3 A;  4JB3 A;  3NZ3 A;  2KV2 A;  3GDX A;  4B9L A;  1XEE A;  3V6K A;  2MSN A;  1RAX A;  2D2Q A;  1RG6 A;  1BGX T;  3JSV B;  1L4D B;  2KT7 A;  1ZQO A;  3I5J C;  4QZD A;  5AI5 A;  1DOY A;  2O6V B;  9ICV A;  1V9J A;  1Q0W B;  5AIA A;  1F0M A;  1BPE A;  1OXJ A;  2PMV A;  1ZQT A;  2KX0 A;  1LXD A;  3AE9 B;  5CR0 A;  3P4S B;  1U9L A;  3BQ1 A;  2CRX A;  2GBR A;  1CZP A;  2ZPN A;  2PI4 A;  8ICK A;  5EE0 A;  2KOB A;  3FM9 A;  1NBF C;  1ZQG A;  1MFW A;  2WDR B;  1S97 A;  1B4F A;  4YP3 A;  3DBR I;  4UB1 A;  1ESF A;  3LWL A;  4KX5 A;  4BKG A;  2ZJA A;  2WXR A;  2EKI A;  2OEH A;  4OD0 A;  1X9S A;  3ZO5 B;  1N63 A;  3EYZ A;  2JPH A;  4KLM A;  2M0N A;  3KHG A;  2DHZ A;  1L0V B;  3P4P B;  3UQA A;  3PO4 A;  4TQ1 A;  4YR0 A;  2C7H A;  4UB2 A;  2MA9 B;  5FK9 C;  5G5G A;  3TAN A;  5CHV C;  5AK4 A;  2Z7J A;  4DSI A;  2PVO D;  5DG9 A;  2AH5 A;  4GDK A;  3VR8 B;  1E9M A;  4ED3 A;  3UQ0 A;  4KIK A;  1TJE A;  3FDS A;  5EE9 A;  3MFH A;  9ICK A;  3Q8R B;  1TAM A;  1ED1 A;  2KSO A;  4NJ6 A;  2WS3 B;  5KFE A;  2WXF A;  5KG0 A;  3V7L A;  4NY8 A;  2NRZ A;  1YX5 B;  2W7O A;  1WFY A;  4M00 A;  5J2R A;  1FM0 D;  4A8X C;  4P2H A;  1JWA D;  1WGG A;  4M2Y A;  4PPX A;  3GOE A;  5E6N A;  3RT3 B;  3W2D A;  2KJ8 A;  4RGO S;  2O6V D;  1KOT A;  1ZD5 A;  1TKE A;  3DVG Y;  5DPS A;  1EF1 A;  3KLS X;  4GDL B;  5KTQ A;  1V5O A;  2BCV A;  1L3T A;  1ZQB A;  1QZE A;  4MJS B;  3HK0 A;  4KGT A;  4LTU A;  3DQV A;  2B3A A;  1VLB A;  1VD2 A;  4YSX B;  2TSS A;  2WXQ A;  5MPO A;  3MC9 A;  3CSF A;  3LWM A;  4JL9 A;  2JEG A;  1XLO A;  1SE9 A;  4K7U A;  3DV9 A;  3BY4 B;  1E5W A;  5AKE A;  2ZUC A;  4BFR A;  4U6P A;  4P4P A;  3KHR A;  3KWV A;  2K8C A;  2E1F A;  2WXG A;  1TKD A;  2L0T A;  3SDL C;  4F3O A;  1WF9 A;  4JWS C;  4RNN A;  1DRG A;  1SWW A;  2AJQ A;  2ZEQ A;  3GIJ A;  1CUK A;  5CRX A;  2FCN A;  1FXI A;  2LUM A;  3MFI A;  3SZ2 A;  2YEP F;  2MJ3 A;  1TGZ B;  3TUO A;  1HJP A;  2RGF A;  1MA7 A;  5J2A A;  3JPT A;  4M9G A;  3AED B;  2BYE A;  2ODG A;  2KQ4 X;  2LPE A;  2R8J A;  4IG7 B;  2EAM A;  3MHS D;  9ICJ A;  2ZCB A;  1Z19 A;  9ICS A;  2DLB A;  2M56 B;  3HM3 A;  2LGX A;  1YD8 U;  1ZOL A;  1Z00 B;  4RQ6 A;  3PGE A;  1YOV B;  3T3N A;  3TEW A;  4I6N B;  2LVP A;  3NVV A;  3RBE A;  4DF4 A;  2JXX A;  4BX9 C;  4TUP A;  5J2D A;  5K4L A;  2GMI C;  4BKS D;  3NG0 A;  8ICS A;  5J0O A;  2F1H A;  7ICT A;  3WU2 U;  2DQN B;  2PW9 A;  2V4Q A;  3U4E G;  2NBV B;  4OJL A;  4XGA B;  2QAR A;  1JXE A;  3IVF A;  5CEH A;  4AS1 A;  4MFA A;  4TUU A;  1ENF A;  3SD7 A;  3ZQ4 A;  1SJH D;  3NRZ A;  3LK9 A;  3ZLZ A;  2QJL A;  2YMQ A;  2LXA A;  4I28 A;  4BBN C;  1B22 A;  1WGH A;  3HUI A;  1A76 A;  4QAY A;  1IGC A;  4ED8 A;  3PHW B;  2MSE D;  3MDC A;  3O13 A;  2CXY A;  4UB3 A;  3QJZ A;  3F53 A;  2XEW A;  1UH6 A;  2K0P A;  2XBB C;  4L2Y A;  4B9K A;  4MF8 A;  2R8K A;  4DSL A;  1STE A;  5BMH A;  1O03 A;  2QKQ A;  2HHS A;  3ED5 A;  5CB1 A;  2G08 A;  2WP9 B;  2KP7 A;  3FAH A;  1N48 A;  1YZ6 A;  1ZQM A;  4IRC A;  2IY0 B;  4GXB A;  1A5R A;  1LKY B;  2KZR A;  3C1Z A;  4ICU A;  4UQG A;  3BVZ A;  4KZ0 A;  2IHM A;  4RNO A;  3QWZ B;  1CJE A;  1QH9 A;  2B21 A;  2RPV A;  1E0Z A;  2RHF A;  2N9P C;  1JI7 A;  2YQE A;  2DYB A;  4XZ4 A;  2WXH A;  1IP9 A;  5CHW A;  1ET6 A;  1QF6 A;  2H3I A;  4US8 A;  4YXM A;  2WB1 C;  5CHF A;  9ICH A;  2JU6 X;  4ZRJ A;  1QSS A;  4PHP A;  1YX6 B;  2KJR A;  5JUM A;  2WXN A;  3ISB A;  2KZM A;  3M63 B;  3OJ4 B;  4F1S A;  1D4B A;  5T8I A;  2LM1 A;  1FO4 A;  3NZU A;  1WX8 A;  1FNU A;  1UWM A;  1N61 A;  2L8J A;  2KEY A;  4IM0 A;  3DOW A;  4GC6 A;  3W1Y A;  2ZPY A;  5J2H A;  7ICM A;  3UIO B;  3C2L A;  4CO7 A;  3RNA C;  3H1U A;  2Y0S F;  1SE4 A;  4DQP A;  2VH2 A;  3PV1 A;  5DDY A;  4IM3 A;  4CGZ A;  8ICP A;  1XSL A;  4P1B C;  5CA7 A;  5DB6 A;  4I2A A;  4BAX A;  3DBH B;  1GPX A;  3ZI4 A;  5DCN A;  3KOO A;  2C22 A;  1WJN A;  3RB6 A;  4NJC A;  3R2T A;  1PYW D;  1EWY C;  4B9V A;  3TAC B;  3A9K A;  2AX5 A;  4JV2 A;  2M0A A;  1T0S C;  1OQR A;  3B2G A;  2N9L A;  1PGA A;  3H8S A;  2C5L C;  4DQQ A;  3UGB B;  2FPM A;  1KFT A;  2K6D B;  3IBE A;  5DGA A;  3LVW A;  2KNJ A;  4IDI A;  1ZD2 P;  3ONN A;  2BQU A;  5D3D A;  3ZDT A;  1Z1V A;  4DQS A;  2IY1 B;  3BIN A;  1XT9 B;  1OEY A;  1TY0 A;  2LJI A;  3SV3 A;  1LV5 A;  1QIL A;  4I2E A;  4I6P A;  2DKX A;  4IQV A;  3RR7 A;  1SL0 A;  4FA6 A;  1EWC A;  4PYU A;  4IC9 A;  1C77 A;  4M8M A;  3JYU A;  2H88 B;  1OTR B;  2ZIV B;  3RMK C;  1SGH A;  3AUO A;  1K53 A;  2W43 A;  4CQN A;  4RQ4 A;  1Q8K A;  4HDQ A;  2LFI A;  2X8X X;  1T8E A;  4JV0 A;  2CJN A;  4DO9 A;  5AZH A;  9ICW A;  4JV1 A;  2AQ1 B;  1ZQX A;  2NO4 A;  4N59 A;  3ZDC A;  3GV8 B;  3WAL A;  5H8Y E;  5E79 U;  3T3F A;  5AZF A;  2PI5 A;  3UMG A;  4RFB A;  3MAB A;  3MJW A;  3PZ8 A;  3F5A A;  4DSK A;  4OZA A;  2E8P A;  3Q3N C;  2JZB B;  3RUL A;  4TQR A;  3SYZ A;  2NTS A;  1LVH A;  5DLG A;  4NAW B;  1TAQ A;  1RPL A;  1HXY D;  2IOF K;  1HIW A;  1TFR A;  1ROE A;  3S2A A;  3SI8 A;  3VAW A;  2MEK A;  5LXI B;  4JWN A;  4UAW A;  3VH4 B;  3QCA A;  4UAZ A;  4KSK C;  1TIF A;  2KAC A;  3MTN B;  4MGZ E;  1EU3 A;  2E5S A;  1XXG A;  5ALZ A;  5E6P A;  5LXH A;  3HJE A;  3QUQ A;  1NNL A;  4EZ9 A;  2RPQ A;  4NWI A;  4AQ7 A;  4ED1 A;  2EKE C;  3RZF A;  3C2M A;  1XSP A;  3N20 C;  4CE6 A;  2DZK A;  2V1Y A;  4W9I A;  1A77 A;  4R66 A;  2LMC A;  5DQI A;  4NJ8 A;  5KFG A;  2JSV X;  1COO A;  2QB0 B;  1OGW A;  4ELT A;  5J0Q A;  3OSP A;  3MP9 A;  2EZX A;  4M6W A;  4EYH B;  3SEN A;  4KKJ A;  1D5Z C;  3UXP A;  8ICE A;  4O3O A;  2N1R A;  4IL6 U;  4BJQ A;  3MFG A;  5KNI A;  4BVU C;  3AB5 A;  2KTR A;  1RQL A;  3AEC B;  3E9S A;  4RGN A;  3THV A;  1BVS A;  2AGQ A;  1C3T A;  1PK1 A;  9ICG A;  2G4S A;  2PFP A;  2L00 B;  1Q5W B;  2A3V A;  4ED7 A;  4OJ5 A;  1TS3 A;  4C4V A;  4ARI A;  3RH5 A;  3IFW B;  1DOX A;  2KWV B;  3QAQ A;  3RAX A;  2ZJ8 A;  2P6R A;  2PE9 A;  2PLP A;  3I1Y A;  3PW5 A;  1NEK B;  2WF9 A;  4L1B A;  3BK1 A;  3AMZ A;  2NRV A;  4DLE A;  2JWU A;  1QQR A;  9ICU A;  3Q8M A;  3ZRC A;  4IQT A;  3M3J A;  5T14 A;  5KFB A;  2G45 B;  3JSV A;  1P98 A;  4WIP A;  2E3T A;  2ESE A;  1D3Z A;  3RFA A;  2O6V A;  2M9N A;  2G5I B;  3OHB A;  1L6U A;  4ACF A;  4DOA A;  4EBC A;  3P2B A;  4K81 A;  4A8E A;  4MH0 E;  5AKG A;  1SXE A;  4ASW C;  2ASJ A;  1X1M A;  4PL1 A;  4DDI D;  5IAA C;  1WH3 A;  5DKW A;  4BXO B;  4DWI A;  2K22 A;  4DS5 A;  2WX1 A;  3NRW A;  1UGJ A;  5AM5 A;  5IIM A;  3TEY A;  2MBQ A;  2F76 X;  7ICP A;  3G6Y A;  3IT4 B;  1KM7 A;  3UIP B;  1SKR A;  7ICJ A;  3PLU A;  4JMU A;  3LDA A;  2ZXH A;  2JZ3 B;  5ALM A;  3Q8F A;  5BOM A;  1MPE A;  3E0F A;  1FIQ A;  1JMS A;  2JYT A;  3M8S A;  2PMZ F;  2D3B A;  1F5S A;  4LNN A;  4ZYN A;  5DLF A;  1P9D U;  4BGD A;  2HTM E;  3IHP C;  3NTU A;  1RYS A;  3ISD A;  2KMD A;  4NZL B;  4YWG G;  4B9T A;  3TEZ A;  1M6Y A;  1CI4 A;  4Y2J A;  1UF0 A;  2X38 A;  3GE8 C;  3ZDD A;  4Z6F A;  4M02 A;  3KHL A;  2QB1 A;  1NK0 A;  3Q3O C;  2JEJ A;  4MGI E;  3RI7 C;  1JML A;  2HE7 A;  1QCK A;  2GB1 A;  2KX3 A;  4GDL A;  3ZTC A;  1T0Q C;  4IQW A;  2E8M A;  5AKH A;  4MM3 B;  4F8R A;  2WU2 B;  4Y2U A;  4MJS A;  4HK2 A;  4F4W A;  2WYQ A;  2YMM A;  4ECR A;  2V9W A;  1C78 A;  3PO0 A;  1Z1B A;  2VJ4 A;  4LZD A;  2NVU I;  4BKS A;  4DEZ A;  2C28 A;  1QQ6 A;  2F8L A;  4YMN A;  4ECZ A;  4KLU A;  1UBQ A;  2BYT A;  3VUY A;  4MSM B;  1ZKH A;  4YCX A;  2BPS A;  3DEE A;  4RNA A;  2ZIW B;  2VJ5 A;  2F3N A;  4J9K A;  4OO1 J;  4J9S A;  3N30 A;  5J8Y C;  3WK5 A;  3RNF C;  4B6J A;  5KFN A;  5GMV A;  4O5E A;  2AQ2 B;  4RM9 A;  1ZQI A;  3BZD B;  2LEK A;  3M7D A;  4HAI A;  4DL7 A;  2D6F C;  1WZ3 A;  2D10 A;  3OPX A;  3OJS A;  3SD5 A;  4NQK E;  3DDH A;  5J0Y A;  2Y1I A;  5ALR A;  4QZI A;  4C00 A;  4F72 A;  5KFO A;  1PUZ A;  2KIW A;  2F2A B;  5KG2 A;  4C8N A;  2V3P A;  3V60 A;  2KVR A;  3C21 A;  1GOZ A;  1ZQW A;  9ICO A;  1NJW A;  1NK4 A;  4PH5 A;  4Y2Y A;  1TYG B;  4P6V F;  4TSS A;  5AIB A;  5DGB A;  1MG8 A;  3JPN A;  1I4P A;  1ZQL A;  1PK3 A;  2BWF A;  1S10 A;  1L8L A;  2XCA A;  4I2I A;  1Z00 A;  1N62 A;  4EUT A;  1NKB A;  8ICF A;  1PGX A;  2AQ4 A;  5C1Z A;  1WM2 A;  2V0G A;  1QLB B;  3DHG C;  5KFC A;  2JR5 A;  2JZP A;  4WQO B;  2RDJ A;  2J6S A;  1C76 A;  2IGD A;  2N7E A;  1S0M A;  2XY5 A;  2EQY A;  1B1Z A;  1SE3 A;  4ZRI A;  4F4K A;  2V3N A;  3PY8 A;  3UI3 A;  4O5C A;  2FI1 A;  5DG8 A;  1SBB B;  2N9X A;  3R66 C;  1UA1 A;  3SU8 X;  4DHZ E;  2CS4 A;  4J6I A;  2JV3 A;  5DQH A;  5D3I B;  1NJY A;  2G06 A;  2CU3 A;  1WM3 A;  1NJX A;  1L0Y B;  3EC8 A;  3ZW3 A;  2BGW A;  2D11 A;  1BUI C;  3H8M A;  2F44 A;  2H3Q A;  2VIX A;  4KN7 A;  1TVA A;  4NLZ A;  1L7Y A;  2AGP A;  3B9J A;  1Z4N A;  1WJ6 A;  2AL3 A;  4F5N A;  1S77 D;  1EF5 A;  4RGM A;  2XNA C;  3T5H A;  3PSE B;  1NZB A;  2DFL A;  4ECU A;  1ZQD A;  3N1Y C;  2KO3 A;  5D6J B;  1GB1 A;  1L6V A;  2K9X A;  4QWC A;  3B08 A;  4Y2P A;  1I4Q A;  1LKY A;  2FCS A;  4HJK A;  4PS3 A;  4RQ1 A;  1WCL A;  2KQ7 A;  5C3J B;  5KG5 A;  4OJO A;  2LKY A;  1E8Y A;  4F8C B;  2V3S A;  3NGD A;  3N97 B;  2D5G A;  1LO5 D;  1J7B A;  2M19 A;  5FKA C;  4MH8 A;  2FID A;  2HDE A;  5AM3 A;  1RXV A;  3KFU F;  1KQQ A;  4E71 A;  4M04 A;  3BJY A;  4ACO A;  3ZJV A;  4HWI B;  2GOW A;  3AQE A;  4UW9 A;  1V5T A;  1NJZ A;  2PKO A;  2P66 A;  2CHZ A;  3AXC A;  4KLO A;  1WR6 E;  9ICB A;  4KVG B;  3PST A;  2J6T A;  5D49 A;  5JTI A;  5KAF U;  5KFZ A;  1NZP A;  4ED0 A;  1XLP A;  2XY6 A;  5KFU A;  2IO3 B;  5CJ7 A;  1SF0 A;  2XVT A;  2JRI B;  5J18 A;  2E8O A;  2HBK A;  1IPG A;  4OW0 A;  2D3G A;  2HSZ A;  2HBJ A;  4C8L A;  4IWP A;  4KDL B;  4P1C C;  2EMT A;  1RLF A;  2L52 A;  2KDM A;  1O08 A;  3PT2 B;  4DSE A;  1R4N I;  3CP8 A;  4LLG M;  2IOF A;  2CN1 A;  3KKA A;  3QU9 A;  1D9F A;  2R8G A;  3T5J A;  3R7R A;  1WXV A;  4QWE A;  3WAM A;  3ISC A;  3L08 A;  3B0Y A;  4RM8 A;  1BNO A;  2IA6 A;  2RLT A;  2HHV A;  2Y9U A;  4C7Y A;  3MJ5 A;  1PQS A;  4U7C A;  4PJ0 U;  3APC A;  4DWF A;  5AI9 A;  3ENE A;  1WUD A;  4EFO A;  1JIH A;  2FMP A;  4TV3 A;  2MA1 A;  3I76 A;  2VA8 A;  3L5K A;  4IRK A;  2W9N A;  2N9K A;  3KYD D;  4S17 A;  5IN7 A;  3BVG A;  3T8M A;  5L95 C;  1QSY A;  3MC0 B;  2GBM A;  1YIW A;  2W9B B;  2ZIV A;  3QXG A;  2W9A A;  2N7D A;  1QOB A;  1FCC C;  3L0W B;  8ICB A;  2DKZ A;  8ICC A;  3VUX A;  1HZ5 A;  2JEF A;  2NBW B;  2XCP A;  2Z59 B;  1KLG D;  2FUH B;  3AEE B;  5GXG B;  3A0H U;  3WAP A;  3RBD A;  1HQR D;  3MC1 A;  2ZIU B;  3WKE A;  1KLU D;  4E3C A;  4CNQ A;  1ACC A;  3CST A;  1RFA A;  4DQI A;  7ICQ A;  2XK5 B;  2I1Q A;  4RQ3 A;  5JRT A;  1TZ1 A;  5A0L A;  2KWD A;  1Y8R C;  3RNG C;  3KYC D;  3SQI A;  2PTL A;  1D9D A;  4KLG A;  2FNJ B;  1Q10 A;  2JZB A;  1FD6 A;  1TBE A;  1XS9 D;  1JX4 A;  1PVR A;  2I1J A;  3FYH A;  3IN5 A;  1ZJM A;  2LJ5 A;  3AH7 A;  4NAW A;  3V6H A;  4A20 A;  2W9M A;  4F5R A;  3RJK A;  3R9K A;  1ZJN A;  4B95 A;  5KFM A;  3ZUN A;  4RUA A;  1ARO P;  3GV5 B;  5KFT A;  2K3U A;  4IR9 A;  4HLE A;  3CIR B;  4NLG A;  1C4P A;  1WYW B;  4NLC A;  1FRR A;  2DPI A;  3GZN B;  4G0N B;  4FUL A;  2G0A A;  5IKC M;  2BB6 A;  1V85 A;  3NVZ A;  1X2I A;  3WK4 A;  2ASQ A;  3TAD C;  4F5P A;  2JRH A;  3Q8B A;  3OHA A;  1HA5 A;  2HMX A;  3ZDE A;  1KH0 A;  1QKZ A;  2MBE A;  2H5X A;  4PZN A;  1OW5 A;  1PDX A;  3PVX A;  1ZOY B;  3TL5 A;  3N9Y C;  3C23 A;  1CMX B;  4XC2 A;  2ICI A;  2FMQ A;  3U30 A;  3U2S C;  2QB0 A;  4ARC A;  5D2M B;  4GIB A;  3LDZ E;  4HKZ E;  4NV0 A;  4K4H A;  2J7Q B;  2BPF A;  2GBN A;  3RJG A;  5C2T B;  3VDZ A;  4LNI A;  2WF8 A;  2Q4T A;  1ZQF A;  4ECT A;  4FJY A;  3HX0 A;  3VR9 B;  1SZH A;  2RQ5 A;  3JPR A;  3VTU A;  2LHE A;  3WK6 A;  3PV8 A;  3C2K A;  4KDI C;  4G9B A;  3QUB A;  2B76 B;  5AM0 A;  3VQI A;  4EKU A;  5JXV A;  3BZC A;  1UCV A;  1LFD A;  4UB8 U;  2ZTE A;  3QNM A;  5KL8 B;  1RFK A;  3FC4 A;  8ICZ A;  2Y5P A;  4MGK E;  1SXD A;  5ALG A;  4FLH A;  4DSF A;  2KN4 A;  2E1E A;  2IMW P;  2A1A A;  2R8H A;  1U48 A;  2GWS A;  3W1S A;  1KFY B;  5C5J A;  1F0Z A;  9ICC A;  4LK0 M;  1N60 A;  2K4H A;  2K60 A;  2W55 A;  3G6X A;  3RTV A;  4DL2 A;  1AWD A;  4KKI A;  2Q5W D;  4ZRK A;  4NQL B;  5J17 A;  5AI0 A;  1DOI A;  4PS7 A;  2D8C A;  2PXI A;  1KF6 B;  3HRD D;  3V6J A;  4LDT B;  4EEL A;  3A1Q B;  2A19 A;  5IIO A;  2AEH A;  2W82 A;  1X9W A;  1K8R B;  3BQ0 A;  4BXO A;  2NS5 A;  3MC8 A;  3M9N B;  3KD3 A;  4KLT A;  3DVN U;  3X23 A;  4AWJ A;  2KIV A;  4XX5 A;  3H0M B;  5F9L A;  4F4X A;  3H7S A;  2GRI A;  1SIF A;  3AI5 A;  2DAJ A;  1AYF A;  1IM4 A;  1JWB D;  3ZJU A;  1ZP0 B;  3F5E A;  1S5L U;  4ECV A;  4M9N A;  2GBK A;  1DOQ A;  1ZQN A;  2ISP A;  3EW9 A;  3AU5 A;  3PZD A;  3LYS A;  2C60 A;  1X6J A;  3QYP A;  3WAN A;  4IWO A;  1NK7 A;  2KD0 A;  1C79 A;  4UDU C;  2EZY A;  3EUB 2;  4ZH4 A;  1NVI D;  3K9O B;  5DQG A;  1ZQJ A;  2HTH A;  5DB8 A;  1XC9 A;  4P16 A;  4TKN A;  2ES6 A;  4R65 A;  3K75 D;  1YN5 A;  5AI4 A;  3MGV A;  3MGI A;  4M47 A;  4UBC A;  2WTF A;  1B43 A;  3CNH A;  1RYU A;  1HTQ A;  1V1O A;  4I2D A;  5D4B A;  4DL5 A;  2FCQ A;  3H7P B;  3L3F X;  1WX7 A;  2BKF A;  2Z0E B;  2YEP B;  4MM3 A;  5J0S A;  4YMO A;  5AZG A;  3VUW A;  3DPD A;  3GS2 A;  2YB4 A;  3AN1 A;  2WNM A;  2BF8 B;  4QZA A;  3IAS 1;  4C4S A;  4LDT D;  2W11 A;  4MHV A;  4CDG A;  1X66 A;  1WMH B;  2BKR B;  1ZW7 A;  1U45 A;  2RRD A;  1S8O A;  2INN E;  1XCQ L;  2K8B B;  4KGS A;  2DAF A;  1L3U A;  4RGT A;  2ZG6 A;  3ZYY X;  1WG8 A;  3RZW C;  3I57 A;  3DVN V;  1L5U A;  2ZIW A;  3F2D A;  2WDQ B;  3KH0 A;  5J0P A;  4C7Z A;  4EYI B;  3OGU A;  4UBB A;  4TUS A;  4BOS C;  1NI2 A;  1VR9 A;  3I9V 1;  2IZV B;  4AOF A;  1NYQ A;  5DBA A;  4M9J A;  1N5W A;  4EEK A;  3EPI A;  1S76 D;  2NYV A;  9ICQ A;  1D5M C;  3V6C B;  3PTF C;  1URJ A;  2M1M A;  3PPA A;  4TMA B;  4QZH A;  5L83 A;  3P1M A;  2LAS A;  2JX5 A;  3RFZ B;  1AW7 A;  4QZF A;  1H38 A;  1YN4 A;  5DG7 A;  3APF A;  1GAQ B;  2WXO A;  3SEI A;  2W3R A;  3VCB A;  1UT8 A;  2LI6 A;  7ICH A;  4RQ7 A;  1XLQ A;  3LXF A;  2MH7 A;  4JGH B;  4WWN A;  3QA8 A;  5ALS A;  4Q2J A;  1T5X D;  5KFJ A;  7ICO A;  3L10 B;  1BT0 A;  3DBL B;  1HE8 A;  1WWT A;  2WF6 A;  1D8L A;  1SIJ A;  2VRR B;  3AE7 B;  1H8C A;  2FJ6 A;  2QHO A;  4DS4 A;  4ECX A;  1KEJ A;  2HOQ A;  3RD2 A;  4DK5 A;  2KN5 A;  3A9J A;  3PVL A;  2EAP A;  3IG8 A;  3ZDM C;  8ICU A;  2BR0 A;  5ALL A;  1F52 A;  3ETR A;  4ZHO A;  3R8B A;  4UB4 A;  4Q8E A;  2M17 A;  2VKQ A;  1N56 A;  1WJU A;  5I4D A;  3DWG C;  2W7P A;  3TSS A;  2WFA A;  3SV4 A;  1MC8 A;  8ICH A;  2VAN A;  2XI9 A;  2ISO A;  1KDH A;  1FXT B;  4FHK A;  1RZT A;  4B6W A;  2EAN A;  2BS2 B;  5AKI A;  1ZRM A;  9ICM A;  2ASL A;  4KIT B;  5BYQ A;  5AKY A;  4TUQ A;  1ZRN A;  2HBL A;  3VVW B;  5KFS A;  1BPD A;  4MSQ B;  5TZV A;  4PHE A;  1Y56 A;  2CPR A;  2NCN A;  2LYB A;  2FLN A;  4W9L A;  2KG5 A;  2R18 A;  3SR6 A;  1S0V A;  3E2E A;  2V9H A;  3AQF A;  4K7W A;  2IDY A;  1ZQ1 C;  4IQU A;  1C7Y A;  2WGS A;  1FNV A;  2D3C A;  3APD A;  2JZZ A;  1WSP A;  1V97 A;  4JE3 B;  4L23 A;  4HCN B;  1L7P A;  2N7J A;  1KSP A;  2KWU B;  2D3D A;  4M8N A;  1WXM A;  1JUD A;  4F50 A;  4DFM A;  5IIK A;  5L1K A;  5HHH A;  4EX7 A;  2LRW A;  4WJP A;  3PX0 A;  1QT9 A;  1DXS A;  3S6J A;  1XO1 A;  2INC C;  2KDF B;  5BYR A;  3PW7 A;  4PHA A;  1C1Y B;  4H2A A;  4XDD A;  2RR9 A;  4MFF A;  4KLE A;  2UWQ A;  3ABV B;  4LVS A;  5DPR A;  1UEL A;  4ANV A;  2JHD A;  5KT6 A;  4E0D A;  1IV8 A;  2FPK A;  1MQ3 A;  2R61 A;  3UIN B;  1KTQ A;  1GC6 A;  3GIK A;  4HVB A;  2UVW A;  1Q46 A;  4WH4 A;  5L1J A;  1Q3V A;  3B0X A;  1YQ3 B;  2KWC A;  3NOB A;  4I27 A;  3B2F A;  1ZD3 A;  1L7N A;  1UGM A;  5B66 U;  4R3D A;  3WKC A;  3OLM D;  1ZQU A;  4XQ8 A;  4BDP A;  2LHT A;  1MSW D;  3RYT A;  3R7Q A;  5KG4 A;  3BQ7 A;  9ICA A;  3NUQ A;  4F5Q A;  4FBT A;  3EPG A;  3AU2 A;  2W03 A;  4FZN A;  1L3V A;  1ZQP A;  1QOG A;  2NMQ A;  2K5P A;  3QU7 A;  4URK A;  2KOX A;  3PNC A;  2L0F A;  5HML A;  3PR4 A;  2YTU A;  3C29 A;  4DHJ B;  4YTP B;  3DVG X;  5ALT A;  4J9M A;  5H2F U;  3RF9 A;  1IUE A;  5ALD A;  4HRO A;  2WF5 A;  1ZQH A;  3PRM B;  5TSS A;  2KE7 A;  1CRX A;  2JXJ A;  3PML A;  1A6S A;  5KAI U;  5HHD G;  3U7Z A;  3BII D;  1PZN A;  3ZD9 A;  2W9B A;  4FE3 A;  2KLC A;  4NL9 C;  5HFY A;  1MVK A;  3WK9 A;  4FXC A;  3G6V A;  2QDF A;  4KMO B;  1UBI A;  5KFL A;  2LVO A;  3AU4 A;  5ALY A;  2BZF A;  3LVV A;  3EGR A;  7ICS A;  4XYC A;  2ZIU A;  2QIL A;  4Y2Q A;  4NPN A;  2AU0 A;  2BCS A;  5AIC A;  2JRZ A;  4Z6C A;  4Q45 A;  2XK5 A;  3NJT A;  3URY A;  2G4D B;  2G5H B;  4G3X B;  4HRS A;  4FS1 A;  2MBB B;  4O0I A;  5IOI A;  2A1J B;  1EU4 A;  5KT7 A;  3T79 A;  1K1S A;  2LVQ A;  2IYD B;  3WKD A;  5ALQ A;  4EZ6 A;  1VZ6 A;  4QIW C;  1XWL A;  2DBY A;  3WA0 A;  5F9N A;  5AUK A;  2JT4 B;  3N4M B;  4O3Q A;  3NS1 A;  2CHW A;  3QIJ A;  1L7O A;  5FR6 A;  1GJZ A;  1AQ6 A;  4Y2R A;  5EOZ A;  4PGX A;  1HEK A;  3PW0 A;  4GOC A;  2ZTD A;  3SAF A;  1YZ7 A;  2UYZ B;  4AYB F;  5KFQ A;  2JY6 A;  4DHJ D;  3H8W A;  2LI5 A;  1E10 A;  1TAU A;  4O5K A;  3V6E B;  2K25 A;  3NUH B;  5EE3 A;  9ICN A;  1F9J A;  2PFQ A;  3RPF C;  1WI0 A;  3QK0 A;  3IG3 A;  4UAS A;  3L4P A;  5KFD A;  1C9F A;  2REX A;  2FMS A;  4NXZ A;  1S0O A;  2KDB A;  1RWS A;  1BPB A;  8ICI A;  4XUS A;  4NNJ B;  3R3M A;  2PPH A;  4O3N A;  1OQY A;  3O65 B;  2OYY A;  2BDU A;  2OXO A;  5HP4 A;  4C8M A;  4W9D A;  4TUR A;  1R4M I;  4A9A A;  3QAR A;  3BS5 B;  1SWV A;  4DXF A;  4HKQ A;  2DZM A;  2MHJ A;  3NY5 A;  2MAX A;  5DDM A;  4QZG A;  1DGS A;  2C2R A;  2YX8 A;  2I1K A;  4IS7 A;  2LM4 A;  2Y3A A;  2GBJ A;  4KLH A;  1HUZ A;  4B9S A;  1IG6 A;  4RU9 A;  2XID A;  3MR5 A;  7ICE A;  7ICG A;  2MUT B;  1SE2 A;  4Y2S A;  2DZJ A;  1GC7 A;  2R2O A;  1R7S A;  1S9F A;  3H4B A;  4MEY A;  3M9M B;  3EEC A;  3Q69 A;  3R2I A;  3VFK A;  3VXW A;  3Q8K A;  4M0A A;  1JN3 A;  4KV2 A;  3Q8E A;  4UAV A;  4IOI E;  1C20 A;  1P3Q U;  2BDP A;  4P4O A;  3ZTD A;  4NM2 A;  3N7R C;  3ICX A;  2ZXI A;  4KZC A;  3IV6 A;  3MR2 A;  4JWU C;  4NJ7 A;  3HIZ A;  4JLC A;  1YNT E;  4J9L A;  4MDK E;  2LRU A;  1EUV B;  1GUA B;  1HZ6 A;  2G9H D;  4ZRP A;  1ZQY A;  4ECQ A;  5HMM A;  3L54 A;  3M62 B;  2K39 A;  2VA2 A;  2OH2 A;  3RJI A;  2K4I A;  1T4G A;  5KFH A;  1KTK A;  7ICI A;  1SL2 A;  3N7S C;  3A1Q A;  1X9X A;  5ALH A;  2BT6 A;  1JRO A;  4G11 A;  3LB8 C;  3V72 A;  3I63 C;  3RRG A;  2FAZ A;  3ZJT A;  1DGJ A;  1KRH A;  3ZNZ B;  4ICV A;  1XLN A;  2MRP A;  3MR6 A;  1T0Y A;  5HNK A;  5KL1 B;  2NRW A;  3CMM B;  1RRB A;  4FBJ B;  3EZ5 A;  3M95 A;  1SJE D;  3M6Z A;  4F71 A;  2XC9 A;  1JRP A;  4B9M A;  2JEI A;  4ZOH C;  1ZQK A;  2K1F A;  3ML9 A;  5AUI A;  2GI9 A;  4LZG A;  3J9C A;  5JU5 A;  1JRU A;  2BS4 B;  2IND C;  3K4G A;  4JPS A;  1DYQ A;  1TS2 A;  1I4R A;  2K8A A;  1QOF A;  3TFS A;  4DL6 A;  1KN5 A;  2R8I A;  2KD1 A;  2NTT A;  1I4X A;  1KLV A;  2BVC A;  3W5V B;  4KTQ A;  1TT5 B;  3IAM 1;  4RQ5 A;  2MBO A;  5KT4 A;  3U26 A;  4ZRQ A;  3RNB C;  2V4I B;  1ZE3 D;  1IBX B;  5ALJ A;  1WXA A;  3H7P A;  2G3Q B;  4F93 B;  2K4E A;  2RDH A;  2EH9 A;  4FJZ A;  3HKZ F;  4RPY A;  3P4Q B;  3X0W A;  4EEW A;  4RNM A;  4CCH A;  3A9J B;  2HVI A;  2L7R A;  2VZK B;  3PS6 A;  4J3O D;  4B9N A;  3H6N A;  1WMH A;  1WE7 A;  2HI0 A;  4CF4 A;  2J42 A;  2K8B A;  4GFJ A;  7ICL A;  2H3F A;  2CJO A;  3QZ7 A;  3H8H A;  4PZO A;  3ZNH B;  2WX0 A;  3EFC A;  4K1R B;  3PR5 B;  2F1I A;  5L1I A;  1XO0 A;  3E56 A;  3PO5 A;  2IBI B;  2WDV B;  1WRI A;  3D6J A;  3FKY A;  3TKA A;  3IP4 B;  3OAW A;  2YB1 A;  2IO0 B;  3C8Y A;  4R63 A;  4CF3 A;  1UNS A;  4ICA A;  5AM4 A;  1BML C;  4J9N A;  5LLI A;  3U52 E;  4BUG A;  8ICR A;  5TIS U;  1ZDX A;  9ICI A;  5D94 A;  1V80 A;  1UT5 A;  3N28 A;  5FP0 A;  3HIL A;  3Q8Q B;  1V2Y A;  5KG6 A;  4YFK A;  1SEB D;  4YMM A;  3WKA A;  1YJJ A;  3T5L A;  3CYM A;  4CHK A;  3QEA Z;  3U8Z A;  3H7I A;  3F2B A;  2KJ5 A;  4WJN A;  3QU2 A;  1XU4 A;  4KLS A;  2KJH B;  2HCF A;  1KRP A;  5IA7 A;  2UVU A;  2FLP A;  4DFD A;  2I9G A;  1YQ4 B;  3IDW A;  4YR3 A;  4TQ0 A;  4EZK A;  2BQR A;  3QU5 A;  4RQN A;  5GTH U;  1NK5 A;  1M4V A;  2JF5 A;  4CRX A;  2KC1 A;  4B0M A;  4QJF B;  4IW0 A;  3VTV A;  5IIL A;  2KJ9 A;  5DBB A;  5AM1 A;  3RNE C;  4FFD A;  4RT2 A;  7ICN A;  1RDF A;  2IGG A;  5KFI A;  2AGO A;  2VZK D;  4II2 B;  4XWT A;  4FZL A;  2YLM A;  4I6L B;  4UAR A;  2DYO A;  1QQ7 A;  4W9F A;  4I2J A;  5ALU A;  5IIJ A;  3Q8L A;  1EM7 A;  4WAA A;  2K4P A;  4NLB A;  4OVZ A;  1L0X B;  1D6E C;  1ZQC A;  3AEA B;  4ECY A;  2ZZP B;  2BYF A;  2Z8L A;  3HWT A;  3N1X C;  5J2G A;  5AKK A;  2HJ1 A;  4ECS A;  4OHJ A;  3MR3 A;  3GIL A;  2LGD A;  4O9M A;  4QZB A;  5EDS A;  4NM1 A;  4WWP A;  3VTW A;  4UB5 A;  4W9K A;  5JZE B;  4RF0 A;  3WCQ A;  3BYT B;  2ZVN A;  5J0R A;  4PYZ A;  1SV4 A;  4F5O A;  4P0P B;  2KK8 A;  1WXS A;  3Q2A C;  4Q44 A;  1JXL A;  2W3S A;  2XY7 A;  3PX6 A;  7ICF A;  3BK2 A;  4HEA 1;  2SEB D;  3OWE B;  4AYB C;  3AV8 A;  2CU1 A;  5KT5 A;  4WJ3 B;  4O3R A;  4DL4 A;  2ZIX B;  3TMP B;  3DBS A;  3PRE A;  5DPW A;  4KX3 A;  4YTM B;  3ALR A;  3IG5 A;  4KSL C;  2AYO B;  4QWD A;  2BHN A;  1XO3 A;  5IO9 A;  1SZP A;  1WCN A;  5ALO A;  2NPT A;  3TEX A;  4DBG A;  1B0X A;  2RDI A;  2RDB C;  4YT0 B;  4D2K A;  1YJ1 A;  5KFV A;  4W9H A;  2WXP A;  4REZ A;  5KHO A;  1RYR A;  3QC8 B;  5J8Y A;  3KBB A;  3NVY A;  3RR8 A;  3H0L B;  3WIM A;  4JUZ A;  2BCR A;  3ZNG C;  1WXQ A;  3D2Q A;  2KFZ A;  2WXK A;  1L2N A;  4Y2T A;  5ALK A;  2W9C B;  1X42 A;  4QW9 A;  1LM8 B;  5J0W A;  3GII A;  5BYS A;  1SV0 A;  2NRX A;  5J2C A;  3CRX A;  2NBU A;  2K6Q A;  4ZDV A;  4NLK A;  3HW8 A;  3PZP A;  2LMR A;  2BS3 B;  3PRZ A;  1X40 A;  4KLJ A;  3B0A A;  3K9P B;  4MGY E;  3FIL B;  3IHQ B;  4KX6 B;  1FMA D;  3V62 A;  3N7P D;  5C0Y A;  1ZQA A;  4RZR A;  8ICV A;  7ICV A;  3DBH I;  2Z0D B;  1J7C A;  1FRD A;  2BW2 A;  1UUP A;  5ALI A;  2ZUB A;  1XQQ A;  3H9D A;  2ZNV C;  2YMP A;  1Z2M A;  4YSZ B;  1YMH E;  1J7A A;  4YN4 A;  3GQC A;  4I2H A;  2NR2 A;  3ZIM A;  4EZL A;  2KKC A;  1TV9 A;  3UPQ A;  2M4N A;  1J0G A;  2ZJ5 A;  3QQ8 B;  4S0R A;  1NK9 A;  1C4C A;  2EEL A;  5KFY A;  1ZQV A;  2PFO A;  1ECW A;  2Q0Z X;  1ZDV A;  4DL3 A;  2EZZ A;  2MX2 A;  1UPH A;  2KLG A;  5EWF A;  1KJT A;  3NZS A;  3BZK A;  4BOZ B;  1A70 A;  1F2R I;  3VHT C;  2MWS B;  1QOA A;  4QNL A;  4HDO A;  3BQ2 A;  1P7F A;  2G07 A;  1MI0 A;  2V4R A;  4WWM A;  4M9L A;  2IO1 B;  3GP7 A;  5EWE A;  1NI3 A;  1V1P B;  4JWM A;  4ZHP A;  3HM6 X;  5BOL A;  3RJF A;  3GFK B;  1TS4 A;  2L76 A;  4RH6 A;  2BWE S;  2XIC A;  2KYW A;  3AE5 B;  3EFU A;  3N1Z C;  3M6K A;  4EZJ A;  2RDG A;  1N2X A;  1SXT A;  3VC8 A;  2FLL A;  4YSY B;  2J52 A;  2K8H A;  4HPM B;  3UF8 A;  1TZO A;  2N1W A;  2C7M B;  1F77 A;  3CW2 C;  2N0S B;  1SB3 C;  5BPC A;  2A1J A;  2FE9 A;  4RF1 A;  7ICR A;  3RUI B;  1TK8 A;  3PLV A;  1GG3 A;  4R8U B;  2IO2 B;  1L3S A;  1RYJ A;  3HKZ C;  2CHX A;  2AL6 A;  2DNF A;  4US9 A;  4KLI A;  4DFK A;  2J4X A;  1XSN A;  1Z3E B;  2ACZ B;  5ALW A;  2DEN B;  2W54 A;  4K4I A;  5III A;  4MAC A;  1JQ4 A;  2SAK A;  4ELV A;  3H8J A;  2JGA A;  4KGR A;  3B1L X;  4NAM A;  3D2N A;  4BKT A;  1B9R A;  2IGH A;  2UU7 A;  2WXM A;  5AKZ A;  2R2Q A;  1ZGU B;  4RQM A;  1FEZ A;  2DF4 B;  1K5O A;  4GGQ A;  1V6E A;  3PSI A;  2LYH A;  2J0M A;  2L32 A;  2QIE B;  1LB2 B;  2RD0 A;  5ALV A;  4DSJ A;  1S3S G;  2M0X A;  3UMC A;  4RCO A;  4WQM A;  2PEA A;  3JW0 X;  2BQ3 A;  3KWL A;  4WUR A;  2KTQ A;  4GXK A;  5AKX A;  2PFN A;  4N6E B;  1IYF A;  2KHV A;  3BS5 A;  3SAG A;  4J9R A;  2WXJ A;  2I2Y A;  2MLB A;  3PW2 A;  1HTO A;  2ONQ A;  4O1N A;  4C56 C;  2LGY A;  1DK3 A;  1M94 A;  2L5Y A;  1Y88 A;  3HP6 A;  2C2E A;  3A33 B;  3BWU D;  4QZC A;  4HJG E;  4ITK A;  2MU2 A;  4YR2 A;  1ZQQ A;  1WJ4 A;  1DK2 A;  2J0K A;  1VRA B;  2DL0 A;  2UVV A;  4F92 B;  4Q43 A;  2MUT A;  4A90 A;  2ZUD A;  3ZD8 A;  4CF5 A;  2DPJ A;  2KVZ A;  2LXC A;  4N58 A;  3TJP A;  4ANU A;  3JPS A;  4RPZ A;  2HHQ A;  3RB4 A;  2K89 A;  4LJP B;  1PFD A;  1RXW A;  1ZD4 A;  4WJO A;  4QIW F;  3H40 A;  2IHN A;  2WDT B;  4MEM A;  3DDC B;  4F4Y A;  1RM6 C;  1WWU A;  3NVW A;  4HPL B;  4OVU A;  3L17 A;  1ZYQ A;  2G09 A;  3I28 A;  2C9W B;  4OZC A;  4RMA A;  1UHU A;  2KK0 A;  3WAO A;  3W5U B;  2KFK B;  5TR5 A;  3RN9 C;  2YN4 A;  3PSP A;  4AP4 C;  4QZ8 A;  4EX6 A;  1OEY J;  3KQ4 A;  3L16 A;  4MEL A;  4DQR A;  4W9G A;  4O3S A;  2M8S A;  2D07 B;  2DUY A;  1T6B X;  4AJW A;  2HW3 A;  5ALN A;  5HG2 A;  2FCM A;  1NKE A;  2LD9 A;  5J29 A;  2BPG A;  4DDG D;  8ICW A;  5KHQ A;  1VCB A;  5AEK B;  4G50 A;  2DZI A;  4GMV A;  1LQB A;  5JH5 C;  3TCA A;  1WX9 A;  3OSN A;  3HPO A;  3SFD B;  3D2S A;  4YTN B;  4IM2 A;  5KFR A;  2LGS A;  2KJ6 A;  4C4T A;  3Q8C A;  1FCL A;  2KFJ A;  3TFR A;  1I4G A;  1ZXH A;  2JYE A;  2ASD A;  7ICU A;  4IKG A;  1F1H A;  4WWO A;  1AN8 A;  2L83 A;  1JWS D;  4QZE A;  2W8K A;  1R4N B;  2KAJ A;  2HBM A;  3WKB A;  1JWU D;  4PT5 A;  1ZXI A;  4QW8 A;  2Y1J A;  4KLD A;  3TAD A;  2E8N A;  3SHQ A;  1I4H A;  5AK3 A;  5JHB A;  1MHH E;  4ED6 A;  3BDP A;  2HOI A;  7ICK A;  4OJP A;  4BWJ A;  2BQQ A;  4A55 A;  3A4S C;  1E7V A;  3Q8A A;  1IBX A;  2YML A;  3RB0 A;  2F77 X;  1C4A A;  4W9C A;  3QE9 Y;  3Q3J A;  2L05 A;  4HXD A;  3SMV A;  2NO5 A;  2AQ0 A;  4EOY A;  1OUQ A;  4FN2 A;  5IP4 D;  2HHX A;  4RQ0 A;  1PVQ A;  1K51 A;  2A4Z A;  3RJE A;  3TBL D;  2OED A;  4YXJ A;  3L13 A;  8ICY A;  4GC7 A;  2MJE A;  3TI0 A;  1IIP A;  4C8O A;  1J19 A;  4Z6D A;  2FPL A;  5KFP A;  1K50 A;  2BBC A;  5CWR A;  4FAD A;  2N4F A;  3AEG B;  1L7M A;  2MP2 A;  3RNC C;  1VJK A;  1WY8 A;  4JIO U;  3P63 A;  1E6E B;  1CQV A;  2XGP A;  3QEB Z;  2VA3 A;  3AUL A;  5KT3 A;  2KIC A;  1Z4O A;  2J0J A;  2PVG C;  3M1Y A;  3Q3F A;  4KN4 A;  4DLG A;  8ICT A;  4RPX A;  3V7K A;  3RCZ A;  1TK0 A;  3AU6 A;  1P7D A;  4EBE A;  1VZ7 A;  2KQS A;  3HVD A;  2OM6 A;  2DX5 B;  5DBC A;  1UA0 A;  3UM9 A;  4XA5 A;  3HVZ A;  4M01 A;  4PGQ A;  4LCD E;  1U4A A;  4YXD B;  1PVP A;  3RH4 A;  2H3Z A;  2NPT B;  3W9C B;  4W9E A;  3AL0 B;  3QZ8 A;  3RB3 A;  3Q14 C;  2BGF A;  1ZPS A;  4QWA A;  4C0Z A;  1WGK A;  1ZET A;  2JVC A;  4O3M A;  1ZQE A;  1JAL A;  4PL2 A;  3PMN A;  4DFP A;  5DB7 A;  2HVH A;  5HR7 A;  9ICF A;  9ICL A;  1Q1O A;  2FIF A;  2OOB B;  1FNW A;  2WWZ A;  2OCE A;  2WXL A;  3AE4 B;  2MCN B;  1COK A;  1J8C A;  1NK8 A;  1BNP A;  4P0Q B;  5G55 A;  5AKL A;  4FS2 A;  1MN8 A;  3DBR B;  3TAP A;  2IOH A;  5DB9 A;  3ECI A;  4PS8 A;  4DXG A;  1S0N A;  4I29 A;  1TTN A;  2I5H A;  3MDA A;  3M9O B;  1WGD A;  3Q3M C;  4OVV A;  1KLN A;  4DFJ A;  1I42 A;  2KHW B;  2WLB A;  2BYV E;  3KZX A;  4EE2 A;  3K1Z A;  5AHX A;  3A4R A;  4F4Z A;  3CF6 E;  1KL9 A;  5G2N A;  1L4Z B;  2OJR A;  2PKE A;  3AE8 B;  2LWP A;  2G1E A;  2JH1 A;  5KG1 A;  3OJU A;  4Q8F A;  3AE1 B;  2ZVO A;  3ALB A;  5J0U A;  5CX3 A;  2WU5 B;  1BPZ A;  3TQ1 A;  4PGY A;  2C2D A;  1TS5 A;  1UZX B;  3ONS A;  4KMU A;  1MQ2 A;  2O2V A;  3EA6 A;  3WK7 A;  3F2C A;  5L9X A;  1E8X A;  3P4R B;  1MJD A;  4GXJ A;  4P0P A;  1NDD A;  2KMM A;  2OHF A;  2Y5B B;  4E74 A;  4M0W A;  2INP E;  4UAT A;  4KLF A;  1TKY A;  3N3K B;  4IUM B;  1VJ5 A;  3NAS A;  3IXS A;  2KN7 A;  3C1Y A;  2KHQ A;  3V3X A;  1J97 A;  1E8Z A;  2ZIX A;  3PW4 A;  1P0R A;  3AM9 A;  1A0P A;  5G5H A;  1P1A A;  1NOM A;  2KAN A;  2YVC A;  4II3 B;  2GO7 A;  5BMG A;  5E6O A;  4BWM A;  1Z5S B;  1F44 A;  2GH1 A;  2ZCC A;  1T3Q A;  1HEZ E;  1U47 A;  3GE3 C;  4RT3 A;  3QX1 A;  4LNF A;  3UMB A;  5H92 C;  5HI1 A;  2KZZ A;  4G3I A;  4XRH A;  5L1M A;  1JWM D;  4EBD A;  1IGD A;  2HD5 B;  4A3O A;  8ICX A;  4JX1 C;  5KG3 A;  2HHW A;  3PX4 A;  1NKC A;  5ALF A;  1VDV A;  3PSF A;  3C5G A;  1E7U A;  2KVC A;  4LNK A;  2W9C A;  5CTR C;  3SEB A;  3P42 A;  1T94 A;  4FJV B;  1BXT A;  4HPP A;  4P4M A;  4RUC A;  4HYK A;  1AAR A;  1WE6 A;  3JPP A;  2HHU A;  4J9Q A;  4K3C A;  2F8K A;  4JK1 A;  5CHG A;  9ICT A;  1I7H A;  4GDK B;  3FIL A;  3JPQ A;  3A0B U;  5KFW A;  2RSU A;  4KIK B;  1X6I A;  2QEJ C;  1V86 A;  2HOF A;  4I2G A;  2KSO B;  1UWX A;  2NV3 A;  1L5P A;  5ALX A;  2BKE A;  5HKH A;  3LJ3 A;  2KXJ A;  3PZ7 A;  2N9E B;  1XCT L;  3UQB A;  4QWB A;  4XWW A;  4UAY A;  1N6Z A;  3QUC A;  1JW9 D;  2LHD A;  4LJX A;  3E58 A;  5CP2 A;  3DCG A;  1XF5 L;  4K7S A;  2MBH A;  5J2B A;  2IJ0 A;  4P7I A;  3ZRF A;  8ICN A;  2EAO A;  2E6X A;  1YT3 A;  5ALP A;  4Y2X A;  1QQ5 A;  2H3V A;  1X9M A;  5IIN A;  1WIA A;  1KBU A;  2WAQ F;  1T3N A;  4NLN A;  2C7N B;  1SKS A;  3V7J A;  3ZDB A;  1WGY A;  4I2C A;  3Q8S B;  3C19 A;  3O0F A;  4IRD A;  2W8L A;  1D8Y A;  4A6Q A;  3SAH A;  2MRL A;  3ZNI D;  8ICQ A;  2K8C B;  3KVF B;  3VH3 B;  4R64 A;  2V4L A;  3QHT A;  1V8C A;  1V1P A;  1U4B A;  1HUO A;  4W9J A;  2AQ3 B;  2BTE A;  9ICR A;  4J9P A;  2ZW1 A;  3OG5 A;  1FXA A;  3KHH A;  2UVR A;  5DPT A;  2PE6 B;  3CWI A;  4LNO A;  5AK5 A;  4PHD A;  4KLQ A;  2Y5C A;  2FBW B;  3MHZ A;  4XDC A;  2KMA A;  2O6K A;  2XN9 C;  2BCU A;  2FE8 A;  1KFS A;  1KW4 A;  1E8W A;  4GIV A;  2P35 A;  2ALZ A;  2YY6 A;  4EEN A;  4O3P A;  2LBO A;  4MF2 A;  1P7E A;  1T0R C;  2KTF A;  3BVM A;  4AUQ C;  2A5U A;  3GZN I;  3T5K A;  4ANW A;  1BPX A;  4R8U A;  8ICM A;  3AE2 B;  3IM1 A;  5D46 A;  4YG2 A;  5EWG A;  5E6J A;  3KKA C;  1GO3 F;  5D7G A;  4BZA A;  1V49 A;  1T7P A;  1EO6 A;  2KZ3 A;  3OTQ A;  1E90 A;  2BB5 A;  5HHI A;  3TAQ A;  3RRH A;  2H89 B;  4UB6 U;  4UAU A;  3UXO A;  3EHV A;  3KUD B;  3Q6B A;  5FR3 A;  2P6U A;  4J9O A;  1IXR A;  1Q3U A;  4EEY A;  4F7Z A;  2FDR A;  5GTI U;  4AP9 A;  2QAR B;  4FBU A;  1GNU A;  4DCC A;  3EWA A;  4C4R A;  3GU3 A;  2VH1 A;  2WHE A;  2KKV A;  2J53 A;  2W04 A;  2XO7 A;  3H0R B;  2AWT A;  2ZNV B;  2JUO A;  4MFC A;  3BQT A;  1SSN A;  4ANX A;  2Y0S C;  4DHZ B;  3N32 A;  3DHH C;  3LYY A;  3BS7 A;  3C0R B;  4GXI A;  1JCK B;  2D3A A;  1J2N A;  1F2R C;  1TKG A;  1YQB A;  2KDE B;  2MQJ A;  4N9F 4;  4OCZ A;  2KFN A;  3ZGZ A;  4DOB A;  3ORY A;  5AK6 A;  4IR1 A;  3UQ2 A;  3U7D A;  2CKH B;  5J2I A;  4TQS A;  1QLN A;  3AEV A;  3KUZ A;  4M0W B;  2HDO A;  3GZF A;  1SV0 C;  1ZUD 2;  4IWQ A;  5J2K A;  2IBK A;  2OWO A;  1NEN B;  1ZQS A;  2KNB A;  2ZJD A;  2KKP A;  3KUC B;  1WWV A;  4FO6 A;  1KKX A;  2CR5 A;  2QC8 A;  1E7P B;  5KT2 A;  3UXN A;  4XE0 A;  4KLL A;  3QUT A;  4F2R A;  1D5X C;  2AXT U;  5B5E U;  3Q8P B;  3C28 A;  2ZTC A;  2LUE A;  3AEF B;  4NL9 A;  4ELU A;  3NHE B;  4NY0 A;  1LGR A;  3AE6 B;  1SKW A;  3T9L A;  3V61 A;  3RH6 A;  4DQO C;  4M9H A;  4K4G A;  2KFK A;  4WAF A;  4OZB A;  2MP2 B;  2NRT A;  4GU2 A;  1UQV A;  5BO4 B;  2HHT A;  2I6X A;  2JH7 A;  2RP5 A;  1XD3 B;  3ML8 A;  3GIM A;  4IC7 B;  2FUG 1;  4Y2V A;  3RJH A;  2OJW A;  3DWM A;  5J2J A;  1H4R A;  5ALE A;  2QCZ A;  3ZDA A;  1VZ8 A;  1MG4 A;  3DHI C;  2BPC A;  3PRP B;  1PUT A;  4B0E A;  2XGQ A;  1YJI A;  4WJQ A;  4I2B A;  4C80 A;  1G6J A;  4DXA B;  3IT6 B;  4PK1 A;  3RAQ A;  2LGI A;  3NS8 A;  5AI8 A;  3WK8 A;  4GB9 A;  2I38 A;  1XNS A;  9ICP A;  2F1J A;  2B6G A;  2ON8 A;  3A9K B;  8ICJ A;  3QU4 A;  4YD1 A;  3H4D A;  8ICL A;  2KC2 A;  3SFE B;  3K1R B;  2PJH A;  4QZ9 A;  2KMC A;  1CEZ A;  3IRU A;  5AI6 A;  4F91 B;  1FEH A;  4YL8 A;  3ZXR A;  3GB1 A;  3HHM A;  1L8O A;  5J2E A;  1I35 A;  3OJ3 A;  8ICA A;  4USA A;  1UD7 A;  4A3P A;  4YVZ A;  2DYM A;  1TE2 A;  3C5F A;  2JXT A;  4C8K A;  3T3O A;  1YN3 A;  4YQW A;  2DGZ A;  2MJD A;  3RJJ A;  3ETL A; 
#chains in the Genus database with same CATH homology
 3TEY A;  2WXI A;  1RYJ A;  3IT4 B;  3V05 A;  4US9 A;  5BMI A;  2BS2 B;  3BYY B;  2J4X A;  2ACZ B;  5BYQ A;  3Q8F A;  2W54 A;  1MPE A;  4ZYS A;  1FIQ A;  4GLS C;  4MAC A;  2JYT A;  2L1A A;  1JQ4 A;  2SAK A;  1Y56 A;  4KGR A;  4NAM A;  1OQQ A;  2HTM E;  1CK1 A;  1B9R A;  3SR6 A;  2IGH A;  2WQY B;  2WXM A;  4RF1 A;  1N5X A;  1K52 A;  1MHX A;  2IDY A;  4NZL B;  4YWG G;  3TEZ A;  1FNV A;  2X38 A;  2QIE B;  2L32 A;  1WSP A;  1V97 A;  4JE3 B;  4L23 A;  4WQM A;  2N7J A;  4RCO A;  5EE1 A;  4WUR A;  1JML A;  3KWL A;  3AE3 B;  4N6E B;  2GB1 A;  2WXJ A;  2I2Y A;  1FFV A;  4MM3 B;  2WU2 B;  4MT5 A;  2ONQ A;  4O1N A;  5LNK 1;  4C56 C;  3VRA B;  1QT9 A;  4ITK A;  4HJG E;  3BWU D;  5BYR A;  1C78 A;  3PO0 A;  1VRA B;  4H2A A;  4XDD A;  3VRB B;  4A90 A;  1PGB A;  2RMM A;  4N58 A;  3ABV B;  2BYT A;  1FFU A;  3AEB B;  2R61 A;  1PFD A;  4RNA A;  4WH4 A;  1YQ3 B;  2AQ2 B;  3B2F A;  1RM6 C;  3NVW A;  3BZD B;  2LEK A;  4R3D A;  1OFF A;  4OZC A;  3W5U B;  2ZW0 A;  3KQ4 A;  2QSD A;  1WYG A;  1ET9 A;  2PIA A;  1QOG A;  1TY2 A;  2NMQ A;  1GB4 A;  2K5P A;  1T6B X;  2QMT A;  2V3P A;  1GOZ A;  2DWQ A;  5HG2 A;  4YTP B;  1TYG B;  1IUE A;  2JQR B;  4P6V F;  4TSS A;  2IPK D;  1I4P A;  4HRO A;  5TSS A;  1NYR A;  1N62 A;  3NZ3 A;  1PGX A;  3SFD B;  1XEE A;  4YTN B;  5HHD G;  3BII D;  3U7Z A;  2V0G A;  1QLB B;  3Q8C A;  5HFY A;  1L4D B;  1FCL A;  1MVK A;  1DOY A;  1I4G A;  1ZXH A;  2JYE A;  4FXC A;  2JZP A;  4IKG A;  1C76 A;  2IGD A;  1B1Z A;  1SE3 A;  1AN8 A;  2L83 A;  3EGR A;  1JWS D;  2QIL A;  2PMV A;  2KAJ A;  2V3N A;  3UI3 A;  1JWU D;  4PT5 A;  1ZXI A;  3AE9 B;  1SBB B;  3P4S B;  1I4H A;  3URY A;  1CZP A;  5D3I B;  2CU3 A;  4HRS A;  5EE0 A;  1MHH E;  1L0Y B;  1EU4 A;  2WDR B;  4A55 A;  1ESF A;  3Q8A A;  1BUI C;  1VZ6 A;  1IBX A;  1C4A A;  2WXR A;  2DBY A;  2EKI A;  3B9J A;  1N63 A;  5AUK A;  4RGM A;  1L0V B;  2XNA C;  3P4P B;  3NS1 A;  1K51 A;  4TQ1 A;  5G5G A;  2OED A;  1GB1 A;  2MJE A;  1L6V A;  2K9X A;  2PVO D;  1E10 A;  1K50 A;  2BBC A;  3VR8 B;  1I4Q A;  1E9M A;  3AEG B;  1TJE A;  3NUH B;  5EE3 A;  5EE9 A;  3RPF C;  1VJK A;  2WS3 B;  1E6E B;  2WXF A;  3L4P A;  1CQV A;  3P63 A;  1C9F A;  5C3J B;  1FM0 D;  2PVG C;  4A8X C;  1RWS A;  1JWA D;  2D5G A;  1LO5 D;  1J7B A;  2M19 A;  3W2D A;  4RGO S;  5FKA C;  1VZ7 A;  3HVD A;  1TKE A;  4MH8 A;  4A9A A;  2HDE A;  3KLS X;  4GDL B;  4DXF A;  4HKQ A;  3HVZ A;  3ZJV A;  4KGT A;  4LTU A;  2PKO A;  4YXD B;  1VLB A;  2Y3A A;  3W9C B;  4YSX B;  2TSS A;  2WXQ A;  5MPO A;  1ZPS A;  1SE2 A;  1XLO A;  1WGK A;  1XLP A;  1JAL A;  1R7S A;  1SF0 A;  5FK9 C;  3R2I A;  3Q69 A;  1FNW A;  4OW0 A;  2WXL A;  3AE4 B;  3KWV A;  2WXG A;  3Q8E A;  2L52 A;  4IOI E;  2KDM A;  4JWS C;  4LLG M;  4JWU C;  4DXG A;  1YNT E;  1FXI A;  2LUM A;  2YEP F;  2MJ3 A;  1HZ6 A;  3TUO A;  2G9H D;  2WLB A;  4ZRP A;  4EE2 A;  4C7Y A;  3MJ5 A;  3AED B;  1L4Z B;  3AE8 B;  2KQ4 X;  1KTK A;  2G1E A;  3AE1 B;  2BT6 A;  1JRO A;  3LB8 C;  2WU5 B;  2N9K A;  2DLB A;  2M56 B;  1TS5 A;  3BVG A;  3ZJT A;  1DGJ A;  1KRH A;  1XLN A;  3EA6 A;  3P4R B;  3MC0 B;  3T3N A;  3TEW A;  3NVV A;  1QOB A;  1FCC C;  2KMM A;  2OHF A;  1SJE D;  2INP E;  1HZ5 A;  1JRP A;  1KLG D;  3AEE B;  1TKY A;  5GXG B;  4ZOH C;  3IXS A;  3V3X A;  1HQR D;  5AUI A;  1KLU D;  2GI9 A;  2PW9 A;  3AM9 A;  5G5H A;  3J9C A;  3U4E G;  1ACC A;  2BS4 B;  5BMG A;  4JPS A;  4AS1 A;  3ZQ4 A;  1ENF A;  1DYQ A;  1T3Q A;  1TS2 A;  2KWD A;  1I4R A;  1HEZ E;  3NRZ A;  1QOF A;  1SJH D;  2QJL A;  2NTT A;  1I4X A;  2PTL A;  5H92 C;  5HI1 A;  3W5V B;  3IAM 1;  1Q10 A;  1JWM D;  3HUI A;  1FD6 A;  1IGD A;  4ZRQ A;  2V4I B;  1IGC A;  1ZE3 D;  3AH7 A;  1IBX B;  3O13 A;  4JX1 C;  1VDV A;  2RDH A;  3SEB A;  3P42 A;  3P4Q B;  2K0P A;  1BXT A;  4L2Y A;  2K3U A;  2VZK B;  3CIR B;  1C4P A;  4J3O D;  1STE A;  5BMH A;  1FRR A;  1I7H A;  2WP9 B;  4GDK B;  4M0W A;  2BB6 A;  3FAH A;  3FIL A;  3NVZ A;  2J42 A;  2QEJ C;  3H8H A;  2CJO A;  3BVZ A;  3Q8B A;  1UWX A;  1HA5 A;  1KH0 A;  1CJE A;  1QKZ A;  1E0Z A;  1L5P A;  2RPV A;  1PDX A;  1ZOY B;  3E56 A;  2WXH A;  2WDV B;  3N9Y C;  1WRI A;  3PZ7 A;  1XCT L;  1ET6 A;  2ICI A;  3U2S C;  4XWW A;  1QF6 A;  4US8 A;  4ARC A;  3C8Y A;  1JW9 D;  2JU6 X;  1UNS A;  2LHD A;  4HKZ E;  1BML C;  1XF5 L;  2IJ0 A;  5C2T B;  3U52 E;  1ZDX A;  2WXN A;  2E6X A;  1D4B A;  3VR9 B;  5T8I A;  1FO4 A;  1FNU A;  2LHE A;  1SEB D;  1UWM A;  1N61 A;  1YJJ A;  2B76 B;  3VQI A;  5JXV A;  1RFK A;  4A6Q A;  3FC4 A;  2Y5P A;  1YQ4 B;  4TQ0 A;  1M4V A;  1SE4 A;  2KN4 A;  4B0M A;  3W1S A;  1KFY B;  1V8C A;  1V1P A;  2IGG A;  2VZK D;  4XWT A;  1F0Z A;  1GPX A;  2AQ3 B;  4LK0 M;  2BTE A;  1N60 A;  2W55 A;  2DYO A;  1AWD A;  1EM7 A;  2ZW1 A;  2Q5W D;  4KKI A;  3R2T A;  1FXA A;  1EWY C;  1PYW D;  4NJC A;  4OVZ A;  2AX5 A;  2M0A A;  1L0X B;  1D6E C;  1OQR A;  3AEA B;  1DOI A;  2N9L A;  3B2G A;  3CWI A;  1PGA A;  1KF6 B;  3HRD D;  2Z8L A;  4IDI A;  2Y5C A;  5D3D A;  2FBW B;  3MHZ A;  4XDC A;  2W82 A;  4OHJ A;  1TY0 A;  2LJI A;  2XN9 C;  2FE8 A;  1QIL A;  1P7E A;  3BVM A;  4RF0 A;  3WCQ A;  3BYT B;  1EWC A;  1C77 A;  3AE2 B;  2H88 B;  2GRI A;  5E6J A;  5D7G A;  3ZJU A;  1AYF A;  1JWB D;  1K53 A;  2W3S A;  4CQN A;  1ZP0 B;  2LFI A;  2BB5 A;  3BK2 A;  4HEA 1;  2SEB D;  3OWE B;  2H89 B;  3AV8 A;  2CJN A;  2AQ1 B;  5FR3 A;  4N59 A;  4YTM B;  5H8Y E;  1C79 A;  4UDU C;  1XO3 A;  1NVI D;  3EUB 2;  3TEX A;  4P16 A;  4YT0 B;  4D2K A;  4RFB A;  2WXP A;  4REZ A;  3PZ8 A;  2J53 A;  4OZA A;  3NVY A;  1YN5 A;  1SSN A;  2NTS A;  1V1O A;  4NAW B;  1WXQ A;  2WXK A;  3LYY A;  1JCK B;  1HXY D;  2YEP B;  5BYS A;  1F2R C;  1ROE A;  3GS2 A;  3AN1 A;  1TKG A;  2MEK A;  2WNM A;  3IAS 1;  3ZGZ A;  2BS3 B;  2KAC A;  1EU3 A;  1XXG A;  3FIL B;  1ZUD 2;  4RGT A;  2INN E;  1XCQ L;  4KGS A;  1NEN B;  4KX6 B;  4AQ7 A;  1FMA D;  3ZYY X;  3I57 A;  1J7C A;  1FRD A;  1E7P B;  1UUP A;  2BW2 A;  2WDQ B;  4XE0 A;  2LMC A;  4C7Z A;  2JSV X;  1D5X C;  4YSZ B;  1YMH E;  1J7A A;  1VR9 A;  3I9V 1;  3MP9 A;  1NYQ A;  3AEF B;  1N5W A;  3AE6 B;  1D5M C;  1D5Z C;  4KKJ A;  1C4C A;  4DQO C;  2EEL A;  3MFG A;  4WAF A;  4OZB A;  3AB5 A;  4TMA B;  3AEC B;  3E9S A;  4RGN A;  3P1M A;  1ZDV A;  2JX5 A;  3RFZ B;  1AW7 A;  1TS3 A;  2FUG 1;  4ARI A;  1YN4 A;  1DOX A;  3DWM A;  1GAQ B;  2WXO A;  1VZ8 A;  1A70 A;  1F2R I;  2W3R A;  1PUT A;  1QOA A;  2PLP A;  4B0E A;  1NEK B;  1YJI A;  4L1B A;  1P7F A;  3AMZ A;  3BK1 A;  1XLQ A;  2JWU A;  4C80 A;  1QQR A;  2MH7 A;  3LXF A;  1MI0 A;  4WWM A;  3IT6 B;  4Q2J A;  2LGI A;  3GP7 A;  1T5X D;  1NI3 A;  1V1P B;  4ZHP A;  4WIP A;  2E3T A;  2I38 A;  1WWT A;  1TS4 A;  1SIJ A;  2ON8 A;  3AE7 B;  4RH6 A;  1L6U A;  3AE5 B;  3SFE B;  2RDG A;  1FEH A;  1SXT A;  4YSY B;  3GB1 A;  2J52 A;  1TZO A;  4USA A;  3ETR A;  4ZHO A;  3R8B A;  1F77 A;  2DYM A;  2JXT A;  2N0S B;  3T3O A;  2K22 A;  1YN3 A;  1SB3 C;  2MJD A;  1UGJ A;  5I4D A;  3DWG C;  3TSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...