4ZOHC

Crystal structure of glyceraldehyde oxidoreductase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
b'MKIINSDQKVKITLKINGEKYETEVEPRRLLVHVLRELGFTGVHIGCDTSNCGACTVIMNGKSVKSCTVLAVEADGAEILTVEGLAKDGKLHPIQEAFWENHALQCGYCTPGMIMEAYWLLREKPNPTEEEIREGISGNLCRCTGYQNIVKAIKAAAEKLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase molybdopterin-binding subunit
publication title Archaeal Mo-Containing Glyceraldehyde Oxidoreductase Isozymes Exhibit Diverse Substrate Specificities through Unique Subunit Assemblies.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
C PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 4zohC02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zohC01
4A9AA 2WS3B 3AMZA 3ETRA 1OQQA 2QIEB 1J7CA 2DBYA 4ITKA 4US9A 1FFUA 3AV8A 4C7YA 4C7ZA 1FXAA 1ZUD2 2EKIA 1V97A 2WU2B 3NS1A 1WYGA 1ZXIA 1YQ4B 3AE8B 4HROA 2K22A 3PO0A 1PUTA 1JROA 3AE2B 3BIID 4JX1C 1E9MA 1FRRA 4FXCA 1SF0A 3WCQA 2JQRB 4N58A 2B76B 3AEFB 1DGJA 1RFKA 1JWBD 1TKEA 3AE7B 1QOGA 1QOFA 1VJKA 2MH7A 3CIRB 3P1MA 2ACZB 1E6EB 1V8CA 3AE5B 5C3JB 2CJOA 2M56B 4YSYB 5AUIA 1VDVA 3AN1A 1QOBA 1YQ3B 5G5GA 3P63A 3RPFC 5EE1A 1FO4A 1N5XA 3P4SB 4YTPB 1XLQA 1F0ZA 1FMAD 1TKGA 1N61A 3LXFA 1SIJA 1AYFA 3AH7A 2E3TA 5H92C 2DWQA 3AE1B 3ABVB 1FFVA 3FAHA 3NVZA 1OQRA 1E0ZA 4YTMB 3SFDB 1ROEA 1RWSA 1KRHA 2PVOD 1FRDA 5EE0A 5G5HA 1J7BA 2JX5A 1RM6C 1WRIA 3SFEB 1NI3A 3HRDD 2BT6A 3DWGC 3P4QB 4ZOHC 1DOIA 3AEDB 1E7PB 1L6UA 1N63A 2K5PA 1GAQB 5AUKA 1TJEA 2LEKA 1N62A 1L5PA 1FXIA 3AM9A 3NVWA 2L52A 1EWYC 2AX5A 2WU5B 1VLBA 1UWMA 2Y5CA 3AEAB 2N0SB 1N5WA 1OFFA 3KWLA 4ZHPA 2QJLA 4USAA 2Q5WD 3ZYYX 4ZHOA 5EE3A 5EE9A 1ZP0B 3W9CB 3W5VB 1KF6B 4P6VF 1QLBB 1FIQA 3B2FA 3SR6A 2FBWB 2WP9B 2WLBA 5H8YE 1PDXA 3LB8C 3P4RB 2KMMA 1L6VA 1CZPA 1NEKB 3B9JA 3L4PA 1NYQA 2M19A 3AE4B 1IUEA 4KX6B 3VRAB 2K9XA 1J7AA 1JW9D 3DWMA 2WDQB 1XLOA 3AE6B 2CU3A 1XLPA 2MJDA 2PKOA 4YTNB 1E10A 1NVID 3CWIA 1B9RA 2G1EA 1DOXA 4LTUA 1GPXA 1R7SA 3NVVA 2H88B 2BS2B 4N6EB 2MJEA 5MPOA 3AB5A 2BS4B 3VRBB 1QF6A 3AE9B 1XLNA 2MJ3A 1QT9A 1NENB 2L83A 1KFYB 2H89B 4HRSA 1QOAA 5C2TB 3VR8B 3B2GA 1A70A 2W54A 3HVZA 1NYRA 4JWUC 3HUIA 1DOYA 1WGKA 3EUB2 1CJEA 1YJIA 2W55A 1AWDA 2BS3B 3VR9B 1WXQA 2CJNA 1TKYA 3FC4A 3AECB 2PIAA 2WDRB 4WWMA 4YXDB 3AEBB 3P4PB 1XO3A 2W3RA 1FM0D 4US8A 2PVGC 3AE3B 4YSXB 4YSZB 2OHFA 1ZOYB 1JQ4A 4C80A 3NVYA 2WQYB 3NRZA 4IDIA 1L0VB 3W5UB 1I7HA 1TYGB 1T3QA 1JALA 2WDVB 2W3SA 1RYJA 1YJJA 4WQMA 3AEGB 1SB3C 3AEEB 4YT0B 1WWTA 5GXGB 1JRPA 2KAJA 2HTME 1PFDA 4JWSC 1JWAD 1N60A 4N59A
chains in the Genus database with same CATH superfamily
1ZD3A 3A1QA 2MBEA 1OQQA 1UPHA 5AK6A 5J0WA 1BXTA 2CU1A 3PT2B 5AKLA 2NCNA 1AQ6A 4KLGA 4Q44A 3S2AA 3ZNID 2DAJA 3H4BA 3NS1A 1ZJMA 1WYGA 3PO4A 4IM3A 2K22A 2REXA 4GIVA 2JF5A 1E9MA 3V3XA 1TS5A 3I9V1 4DQQA 3GQCA 4L1BA 3QZ7A 5JUMA 2MQJA 2Z0DB 1WJ4A 5FR3A 2FCMA 5AHXA 3Q8KA 1K8RB 1VJKA 5ALPA 3LVVA 4I2EA 3C2MA 2NS5A 2KG5A 4FJZA 4H2AA 1VRAB 4DS5A 5ALKA 4J9OA 2M56B 2DAFA 3PV1A 2KIWA 3PV8A 2JZZA 8ICFA 4PGYA 4WJ3B 1L0YB 3KTQA 3QCAA 4ECTA 1QSSA 3VUYA 1MSWD 2V0GA 3J81j 1AYFA 2LRWA 1WRDB 4RFBA 5KG4A 7ICKA 1C4CA 2FLPA 1SE4A 3ENEA 1QSYA 3MC8A 1EUVB 3HILA 5DG8A 3CNHA 4MGIE 3K9OB 1HQRD 3ZIMA 1NI3A 2E6XA 1NBFC 3JPRA 7ICGA 2LEKA 2INDC 2G06A 2YMPA 2AX5A 4EZKA 4J9MA 4CCHA 2RLTA 2L0TA 1YT3A 4NLZA 5BYRA 3TARA 1MFWA 3M9MB 1DGSA 3QU5A 2EKEC 3BK2A 4I6LB 4QZBA 2WLBA 2KMMA 2MP2A 2E1FA 3K75D 1WGRA 4I29A 2MBBB 4OJLA 1HTOA 3O65B 4FJVB 4ED6A 4LNIA 3FYHA 3P2BA 4OJPA 4JPSA 4DHJD 2WHIA 3P42A 2GO7A 4QNLA 3VRBB 2NR2A 4PPXA 1YQBA 2BGWA 4ECVA 3ZDTA 3PX6A 1T8EA 2NRTA 1X9WA 3PX4A 3A4SC 1C3TA 3SAHA 2KHVA 3Q8SB 4XRHA 4ANVA 2ZIWB 3M95A 2AQ1B 4C00A 1WIAA 4YFKA 3OSPA 2ALZA 3ZDBA 3TADA 3OGUA 2KWCA 4WWMA 4P0PB 1BT0A 4FHKA 5L9XA 2NRWA 4ANXA 2K8CB 2ZIVB 1C4AA 4XDDA 3BWUD 4AOFA 5HHIA 4RU9A 5KG3A 4NAMA 4NWIA 3TEZA 4FZLA 3R2IA 2IGDA 4DCCA 4ACOA 3RTVA 1EF5A 3N9YC 2DQNB 3ETRA 3MGIA 4FS1A 1PZNA 1T94A 4ZDVA 1E5WA 5C23A 4I6NB 3C1ZA 4P1CC 4C7ZA 4YR2A 2WGSA 4QZCA 4XC2A 2AGQA 2V3SA 3UXOA 3C5FA 3JW0X 3KUCB 2HHUA 5JU5A 9ICGA 3RD2A 3BJYA 3DBHI 4M01A 2V9WA 2PMVA 3BIID 1U4AA 3WAOA 2MSNA 4ICAA 1SF0A 4GDKB 1ZRNA 3GFKB 5J0PA 4CQNA 4Y2PA 3N28A 2MW5A 1RG6A 1JI7A 8ICJA 3SU8X 1TKEA 1ZQYA 2ZXHA 4QWEA 4NLNA 4TUQA 2KN7A 3LWLA 2ES6A 2ISPA 3N97B 3BYTB 2WB1C 1CK1A 2W7OA 3A1QB 3AN1A 3B0AA 4R8UA 3AUOA 5ALUA 1TE2A 4JWNA 1TKGA 4FBJB 3RJJA 2JV3A 4PL1A 4MEMA 2NTTA 1E0ZA 3TJPA 3KZIU 3ZJTA 3P4QB 1SKSA 2PFQA 3DDCB 1L4ZB 2KMCA 5E6PA 4KLLA 5AUKA 4GMVA 3O0FA 4IOIE 3AM9A 1K51A 3NASA 1ZQLA 4C8KA 2F8KA 3APFA 4IWPA 1ZQAA 4B6WA 3WK8A 2W43A 2KEYA 4PHPA 3V6EB 1DOYA 1ZQIA 3LB8C 4QIWC 1ZJNA 2R2QA 2ESEA 4MGZE 1IUEA 1MA7A 2O2VA 8ICIA 2EH9A 5EWEA 3SV3A 1XLOA 4RQ0A 2DYMA 3MP9A 1V85A 1Z19A 2DHZA 4YXJA 2YB1A 2IY1B 3VTWA 1L8LA 3MFGA 4F91B 4MT5A 2JPHA 1TAMA 4KLIA 4KZ0A 2YMQA 2MA9B 1XLNA 2A1JA 2MJ3A 4DF4A 3H9DA 4HRSA 4IRDA 5AK5A 5D4BA 1X66A 3QU9A 2JWZA 1NYRA 2M17A 4JWUC 4ZRJA 3EYZA 4ECZA 9ICPA 2V4LA 3BK1A 5KG2A 1JCKB 2QLTA 4JV0A 1SE2A 5J2GA 1PGBA 1WXAA 1YN5A 2MP2B 4MJSA 4AUQC 5AI5A 4ECQA 4DFMA 2D3CA 4F5QA 3MFHA 1FM0D 2JEJA 3THVA 2OEHA 3H7IA 1ZETA 2AGPA 1V6EA 3IT4B 1I4GA 4RGMA 5BMIA 2H3IA 1E8WA 2MAXA 4XX5A 2BPSA 2KD0A 4RQMA 3A9JA 4IDIA 3L13A 3QWZB 2WDVB 2V3NA 4WQMA 2KT7A 3MHSD 2UVWA 2ZNVC 4KMUA 1MVKA 3V05A 2D10A 1N60A 2JVCA 3RNFC 4NQLB 2C60A 3AMZA 2QIEB 1PVRA 4R66A 4HDOA 4M0AA 3KBBA 4M8NA 4I6PA 2G5HB 1NZPA 5KFCA 4F72A 4WJPA 1LM8B 2HJ1A 1L7MA 4GC7A 1D8YA 1V80A 4HDQA 2IO2B 3KQ4A 1S5LU 2ISOA 1EF1A 3D2QA 2A4ZA 3WAPA 5KG0A 2PKEA 2KICA 3JPTA 4TUSA 1WE7A 4FXCA 2I2YA 1SWVA 2I5HA 3Q8QB 5JRTA 1WCLA 5J17A 5HI1A 5HR6A 3WALA 3DVNV 3WK5A 2CJOA 1Q0WB 3H40A 5TISU 2BYEA 3IFWB 1U45A 2RPVA 5T8IA 3T3OA 4IWOA 1J2NA 2FMSA 3OJ4B 5L1KA 2BQ3A 2LFIA 4PH5A 1RFAA 5LXHA 3V6HA 5AZFA 1UA0A 1NNLA 1HZ6A 3SFDB 5AKEA 2E5SA 1U9LA 5EE0A 1D9DA 2JGAA 7ICNA 1F2RI 2GBJA 1WRIA 4BUGA 4DFJA 5DCNA 2BT6A 3DWGC 5E6JA 3BZDB 2UVUA 2YB4A 8ICCA 5CEHA 3HK0A 3V60A 2WDTB 5J0SA 1RYSA 2IOFK 3TI0A 3DVNU 1COOA 1KFDA 1KLUD 3L0WB 3HIZA 2QJLA 3CW2C 1WM3A 4R8UB 2KFNA 2M0XA 1L7OA 5KFRA 1D4BA 2BR0A 3B2FA 5E79U 4TUUA 1E8XA 1VZ8A 3WK6A 2JH1A 5CTRC 2FCQA 3AEVA 4UARA 4PHDA 4RQ8A 4K7SA 3PS6A 4HYKA 5KG1A 1NK7A 4DSJA 4G3XB 2G9HD 3ZXVA 2B3AA 2MJDA 3TQ1A 2K89A 2Y9TA 2IO3B 3M9OB 3PMLA 1MC8A 5J0RA 1NVID 2LGIA 1E10A 4QW9A 4AJYB 1LFDA 4KX5A 5AKJA 4NXZA 5KFMA 5C2TB 3R9KA 4FBUA 1ZQSA 2IBKA 3MHZA 3PSPA 1OEYJ 3VR9B 5KHQA 4B9LA 4MH8A 2LHEA 3ML9A 3QHTA 5ALNA 2O2VB 1XO3A 4BFRA 3AE3B 1T0QC 1ZQOA 2XEWA 2YN4A 2F2AB 1ZQFA 3Q8CA 4EBCA 1ZQNA 4RM9A 4YQWA 3R8BA 2HHSA 3UI3A 2AHOB 4C0ZA 2BWFA 1UELA 2IO0B 3T79A 2RD0A 2WXJA 2K8AA 1J19A 2ZPNA 2A1JB 3H8HA 4P1BC 3UQ2A 1NK9A 3LWMA 1I4RA 2G45B 4MH0E 2WXIA 1OW5A 4F8RA 4HPPA 4C4TA 1JWSD 2KFJA 2H5XA 2QKQA 2RGFA 3Q8RB 3L17A 4QZEA 2CRXA 4A3PA 1KTQA 5DB9A 1FFUA 1KEJA 1U49A 4B9MA 4URKA 2M9NA 1FXAA 1JIHA 4MJSB 3TEXA 1V97A 1CQVA 3E56A 1FD6A 4JX1C 1D5MC 2C28A 2K1FA 2I9GA 3NS8A 2V4QA 3A9JB 2KWVB 3PZ8A 4LJPB 4EUTA 4JB3A 1XSNA 2C2RA 1V1PA 4B9SA 1IBXA 3AE7B 4KLQA 4J9KA 2Y5PA 2DFLA 4F3OA 2L05A 3N1XC 2C7HA 3DV9A 5EE1A 4GB9A 4FO6A 4KDLB 2EAOA 1ZQDA 1XS9D 3H0LB 5JZEB 4UB1A 4KLOA 1N61A 3LDZE 1CEZA 7ICPA 5AKKA 5H92C 4ELTA 4ZYNA 1AROP 3NVZA 2KV2A 4O3OA 1KKXA 3Q8EA 4GGQA 5TSSA 1BVSA 4JK1A 4R65A 1WR1A 2ZTEA 1SZPA 4NL9C 3BVGA 5BMGA 4K4HA 3NZ3A 2VJ5A 1PYWD 2KVZA 2WXQA 5J2AA 3RFZB 1WXMA 3GZFA 3ZYYX 3EWAA 3W9CB 4K3BA 4KKIA 2FMQA 3ZDAA 1K1SA 4F5RA 4RGTA 2GBKA 1BPBA 1D3ZA 2ZTCA 5KG7A 1IIPA 2V4RA 2BBCA 2RMMA 4KIKA 3ZRCA 2KK8A 4YTNB 5BO4B 2QHOA 2AQ2B 2FLNA 1QQRA 5D2MB 1X6IA 2G08A 4JV1A 3ONNA 5KFSA 3TAQA 5ALRA 1R4MB 3OJUA 2J6UA 3MC9A 2H89B 1VZ6A 2R61A 4AP9A 3Q8LA 2J0KA 5L1MA 1A77A 2E8PA 4DOCA 9ICMA 4M9HA 1K5OA 3DVGX 1BNOA 4ELUA 1B1ZA 2R8HA 3H7SA 4CGZA 7ICQA 1C20A 2W3RA 3V61A 1LO5D 2FNJB 1X9XA 3WKBA 2VH1A 4YSZB 3HWTA 1WXVA 3RH6A 1JQ4A 3Q3FA 4MSMB 1SXDA 2IOHA 3NVYA 2WQYB 1RZTA 4PYUA 1SJHD 5G2NA 3E2EA 1KM7A 3KVFB 5CB1A 1ZQ1C 3WKEA 1YJJA 2ZXIA 2KTFA 1ESFA 5CA7A 2PI5A 1JRPA 3HX0A 4O5KA 2EANA 1OTRB 4O5EA 2QMTA 5AIAA 2W9BA 2BWES 2DENB 3M7DA 5DKWA 4ZRPA 4WJOA 3RUIB 1J7CA 2IZVB 1EWCA 2MWSB 3E9SA 3HJEA 1ZQGA 1ZW7A 1CRXA 3PMNA 3RNBC 3MR6A 2KIVA 1NK5A 5KFYA 3V7JA 1L5UA 4M04A 4IWQA 2EZXA 1IGCA 5KFLA 4B6JA 1TK8A 1NKEA 5AM4A 2YEPB 1YOVB 2J53A 2BYTA 4DL2A 1QILA 3L16A 4XZ4A 5CHWA 4IQUA 4DSIA 3Q8BA 5LLIA 2ZCBA 3RULA 3A33B 4Y2TA 3WKDA 1DXSA 5DGBA 1STEA 3SHQA 3ZUNA 5D3DA 1P3QU 1Q10A 5KAIU 1WZ0A 1WGHA 3QIJA 1C7YA 3C23A 1LXDA 2OWOA 4CE6A 5KFDA 3ZRFA 1YX5B 1R4NB 2WXRA 3MGVA 2N9PC 5KFEA 1J0GA 4B9VA 4EELA 3N3KB 2L5YA 3RFAA 1KLVA 4YTMB 5EOZA 5ALJA 3VTVA 5C1ZA 3ZDCA 3D2NA 2EMTA 1RM6C 1H38A 4EX6A 2VZKD 3HRDD 5AZHA 2ZUDA 1L7YA 2ZJ8A 2G07A 3M8RA 1K53A 2BW2A 1BUIC 1V81A 1V1PB 1WUDA 1ZDXA 3PZDA 2G09A 4B0EA 2Y5CA 1EWYC 2W7PA 1GG3A 4LDTB 2I6XA 1N5WA 1TTNA 3ZJUA 4QZHA 5DLFA 2PJHA 4Y2YA 4GN1A 4Q8FA 4A55A 5TZVA 5ALLA 8ICEA 4TV3A 4BWMA 2FLLA 5ALIA 2H3QA 3PREA 2LGSA 5AI8A 1RRBA 3VDZA 3RB4A 1MI0A 2GH1A 3PLUA 2EDUA 3EPIA 3CWIA 3GB1A 3KUZA 3BY4B 1GPXA 4O0IA 5KT7A 2VKQA 3N1ZC 3RNAC 2HD5B 4KSKC 3VH4B 4O5CA 5DG7A 2IPKD 3L3FX 3CSTA 3ALBA 1KSPA 1IG6A 3SMVA 1A70A 4DWFA 2W82A 4MF2A 4Z6FA 2QILA 2W9NA 1FXTB 5AKXA 4LJXA 3HUIA 5IINA 1Q8KA 3RR7A 2ZIWA 1YJIA 2H3FA 4J9PA 3TFSA 5D46A 1X1MA 1WH3A 3N4MB 2L32A 2WXPA 2BCVA 1UCVA 4KIKB 4M00A 1B0XA 1LB2B 5FKAC 3DBLB 3IRUA 2JEFA 3C2KA 2ZIVA 2K8CA 1L8OA 3FM9A 2PW9A 3KW5B 4BZAA 4I2FA 4OO1J 4Z6DA 4A3OA 3AEGB 5EDSA 4F92B 1L2NA 4MELA 2K4EA 5AI4A 1NDDA 2IYDB 4RF1A 2C5LC 4B95A 2PFOA 2WS3B 4I2HA 3CYMA 1QQ6A 4NJCA 3DHIC 2KZZA 1ZUD2 3IM1A 8ICKA 3JPQA 3AQFA 3IV6A 2W9CA 3G6XA 1YD8U 3TSSA 1LV5A 3U7ZA 3V6CB 3RRGA 1NI2A 5KFOA 3DBRI 3GS2A 4RPZA 1JXLA 3TEWA 4RZRA 2EAPA 1S10A 1ZQZA 2NRZA 1DYQA 2MUTA 4ICVA 2WXNA 5DPWA 4UB6U 3BQ2A 2B6GA 2Y5BB 4N58A 5KFFA 1M6YA 1N48A 4G0NB 4F5NA 1QCKA 4DL4A 2LJ5A 5HG2A 4CO7A 4ECYA 4NY0A 4UB2A 3WU2U 3EGRA 3NRWA 4LZGA 3F2DA 1FO4A 2PXIA 2CXYA 4BDPA 3MJWA 4JL9A 4K81A 4O1NA 5DB7A 4I2JA 4RNMA 1UD7A 3T3NA 4X5VA 1Z2MA 3KKAC 2K8BA 4RQ4A 4MM3A 2QSDA 1P98A 1SE9A 3PVLA 3WKCA 3T5LA 2L3ZA 3WK9A 3VHTC 3AEDB 3TMPB 8ICNA 2PMZF 9ICIA 2RDJA 4JV2A 2O6KA 3KZXA 3MGHA 2F77X 4W9JA 1XO1A 3SZ2A 4I2BA 2HBJA 2WYQA 3NGDA 1N56A 2JZBB 2WXKA 1XNSA 1NJYA 5H8YE 2NBUA 4FZNA 3UINB 4EZJA 4ECUA 3H8JA 4R63A 8ICGA 1GB1A 3LYYA 3ICXA 5L1JA 1NKBA 2K8HA 2BDPA 2KNJA 2JHDA 3X23A 2MJEA 4NJ6A 3VTUA 9ICCA 4U6PA 3QUCA 3T3FA 2G4DB 2ASDA 1FEZA 1SZHA 2Q0ZX 1KFYB 4C4VA 2YEPF 2JYEA 2IGGA 4KMOB 3ETLA 2X38A 2O6VD 2DX5B 3C19A 3PY8A 3X0WA 1ZD2P 5AK3A 2BZFA 5TR5A 3QX7A 5DBBA 2W11A 2PEAA 1IXRA 2WDRB 5FR6A 5KT2A 4DS4A 3RJHA 4KTQA 1UF0A 2FAZA 2FCNA 1BPDA 3IHQB 4KV2A 1QSLA 2XICA 4I2GA 1XXGA 4YSXB 3UPQA 4FFDA 3HKZC 4DL5A 4C80A 4YG2A 1T5XD 4M8MA 2XCPA 3PW0A 3W5UB 3Q8AA 3BVZA 5HHHA 3BQ0A 4NV0A 2ZNVB 3V6JA 2KHWB 2KJRA 3UQBA 1JRUA 2WAQC 1J2MA 1TKDA 4N59A 5KFVA 4US9A 4MACA 2LM1A 2F1IA 8ICRA 2BKFA 1V38A 2KVCA 2PTLA 2EZYA 2J52A 3OJSA 1JMLA 1PUTA 4UASA 4EFOA 2ZVNA 2KJ5A 1MG4A 1D8BA 4DL3A 4O3PA 2HDEA 1DGJA 1SEBD 1ZQCA 1JWBD 3I76A 1X42A 4DL7A 1D6EC 1QOFA 2HOQA 4X57B 4C56C 2GBNA 5EWGA 7ICJA 5DPTA 4II3B 2D8CA 2HBKA 4A8EA 2NBWB 3MDAA 3AULA 5AI6A 5DG9A 3M63B 4RNAA 4W9LA 3HPOA 3PX0A 3RPFC 5J2CA 1O03A 4YTPB 3DVGY 2KTRA 1FMAD 8ICQA 2GOLA 1QQ5A 3URYA 1S0VA 2C2EA 1LKYA 4ED8A 2W9CB 3HP6A 3GU3A 3H8WA 4RT2A 4KZCA 3KH0A 4GFJA 1KRHA 4ZRQA 4J9RA 4GC6A 3D32A 2MUTB 5IAAC 2WWZA 2UWQA 1KH0A 3KHLA 4GXIA 4XDCA 9ICHA 5IIMA 1H4RA 3DQVA 2D3BA 2UYZB 3AL0B 5IO9A 3ED5A 1VZ7A 5HMMA 2JH7A 2ATLA 4OCZA 1S77D 5DB6A 1IGDA 2KDFB 1SL0A 4TUPA 2HOFA 1QLBB 2NTSA 2JWUA 5ALGA 4FHJA 4DHJB 3UF8A 1KBUA 4KLEA 4K7UA 3E0FA 3L4PA 4P0QA 3SD7A 3I28A 4C8OA 3AE4B 4Y2JA 8ICXA 4JQWC 3DEEA 5J0TA 1I4HA 4W9FA 2K8BB 2VA8A 3JPPA 4MM3B 4UDUC 1LQBA 1KL9A 3PSEB 1DOXA 4HVBA 2LYBA 2H88B 2BS2B 2JXXA 3HVDA 3AB5A 4LNFA 2ZIUA 1QT9A 2WXOA 3NUHB 3N7PD 2RR9A 3SAGA 1SV0C 2BCQA 2KVRA 5CHFA 1PK1A 2KYWA 4UQGA 2KDIA 4CNQA 1Q3UA 3EUB2 4K3CA 5AI0A 2INCC 1AWDA 4F1SA 1IPGA 2BKRB 2WB1F 7ICSA 2VH2A 5J0OA 1XO0A 4KITB 2DYOA 1C78A 4CF4A 3K1RB 4DFDA 1ZQHA 2N9XA 4F5PA 4EYHB 4DQOC 1MHHE 4PYZA 4F71A 2HOIA 4RPXA 2P6RA 3APCA 5HFYA 4MEYA 4IC7B 4NPNA 2N7DA 1TV9A 1JALA 4DDGD 3ZO5B 2N1WA 2ZJ5A 2XIDA 5CR0A 4C4VB 2HTME 2C2DA 3BQTA 4OHJA 4Y2XA 4ELVA 3PNCA 2XK5B 2NPTA 3OPXA 2W8LA 1XCQL 1EXNA 2JSVX 3SV4A 2K25A 1VCBA 3L10B 4QIWF 4EBDA 3PW4A 4NAWA 2Y9UA 4KN7A 2CHWA 4IG7B 1V9PA 4ZRKA 5KT3A 1T0YA 3IG3A 2MHJA 5DGAA 4TURA 1K1QA 1X6JA 5J2IA 4EE2A 2NBVB 3UQAA 3CIRB 1KOTA 4EBEA 4ED3A 2ZPYA 3BINA 4LLGM 4IRKA 4C4SA 1Z3EB 4YMMA 2BGFA 1HJPA 3QNMA 3QUBA 2KQ7A 3S6JA 1UGMA 3RB0A 4XWWA 1RQNA 2Q4TA 1JWUD 1FFVA 3FAHA 3RJEA 1WJ6A 4BGDA 3UGBB 4M9GA 4P16A 1AN8A 5HMLA 4KVGB 3Q6BA 3U30A 5KFNA 1F0MA 4DOAA 2QB0A 2D2QA 5GMVA 1P0RA 3DBHB 1E7PB 4OVZA 3L5KA 1WMHA 1GB4A 5BOMA 3KHHA 5D7GA 2M0AA 4PGQA 4J9QA 1RXVA 1WR6E 3IDWA 1UWMA 3BZCA 2KJ8A 3C5GA 1SSNA 3QJZA 3VAWA 2D3GA 3A9KA 2BTEA 4ZHOA 3ZTCA 2IBIB 4YN4A 1XSLA 2DKXA 3C28A 1OUQA 3GIJA 3TUOA 5AM2A 1Q3VA 2IHMA 4DQPA 2BYVE 1L6VA 2KTRB 3VRAB 2AJQA 1TS4A 2EZZA 2LXAA 4TSSA 2LVPA 1LKYB 3DWMA 4E3CA 3AE6B 4W9GA 1FPYA 4IRCA 2MA1A 3BVMA 3U8ZA 4WWNA 9ICAA 1B9RA 5KFJA 2ICIA 4FE3A 4NM1A 1GJZA 4GIBA 4HJKA 1TFRA 1XF5L 3RB6A 3PGEA 4EZLA 4DF8A 2ZTDA 2J42A 2ASJA 2R8GA 4W9DA 1A5RA 3I1YA 4QJFB 1YZ7A 2MLBA 2J4XA 1WFYA 4NJ7A 5DQHA 2BQUA 4M2YA 3PRZA 4IQWA 8ICBA 2RRDA 5CWRA 3ZDMC 4WJQA 3QEBZ 3UM9A 1WX7A 1B4FA 2CR5A 2JT4B 4P0QB 4M47A 4YVZA 1FCLA 2INNE 2ZW0A 4US8A 5JTIA 4B9TA 3OTQA 4IS7A 2R8IA 8ICMA 3BDPA 1XEEA 1ZOYB 2OM6A 2WFAA 3IVFA 3EFCA 5DLGA 4UBBA 3SQIA 4AWJA 2NV3A 1V2YA 2KC1A 3SI8A 2N7JA 3TIXA 2ZIUB 4KLHA 3HM6X 3UXNA 1SXTA 2XN9C 3KLSX 1L4DB 4RGNA 8ICUA 2YMLA 1I4QA 1MJDA 1PK1B 4BVUC 4WWPA 2RP5A 4J6IA 2YMMA 4IM0A 3LDAA 4OVVA 4WH4A 1QLNA 5KHOA 7ICOA 3AV8A 5KFIA 2YLMA 3QZ8A 3QA8A 4GDLA 2D07B 2K6DB 3JSVA 2KN4A 1J8CA 4QWBA 2KZMA 5AKGA 4RCOA 1M94A 2FDRA 4KX3A 1MN8A 3C0RB 3SENA 3MR2A 4IR9A 2IOFA 2MRPA 3R2TA 1MG8A 1JMSA 4BOSC 5AI9A 1TS3A 7ICUA 2ASQA 3FILA 1TVAA 2HMXA 4TQRA 1ZDVA 2RQ5A 4FULA 4MFAA 2M0NA 4G9BA 4QZIA 4BKSD 1VDVA 5ALVA 3ZGZA 3UMBA 2NPTB 1URJA 2GLEA 4DSEA 2UU7A 4FBTA 3P4SB 2ZEQA 2IMWP 3HHMA 3RJKA 1L7PA 5ALEA 3JPOA 2E3TA 3JYUA 2QARB 3RR8A 2WXGA 2PE9A 4UB3A 2L1AA 2CS4A 4NAWB 2KKPA 1RWSA 1FRDA 1TIFA 5KFAA 2WF5A 4GXKA 4WWOA 4ZOHC 2C7MB 3C2LA 1RAXA 2K3UA 2A19A 1F1HA 2KD1A 1ZQPA 9ICWA 1L5PA 2KDBA 4LNOA 4F8CB 1VLBA 2E8NA 4AYBF 4BJQA 4F50A 4ECWA 3OJ3A 1Z4OA 4UBCA 3ZNZB 2BPGA 4NLCA 3W5VB 1Z5SB 3GIIA 4YD1A 1V9JA 2VRRB 3IG8A 1NEKB 3H0RB 3B9JA 4BKTA 4BKGA 2Y1IA 1JW9D 5E6OA 4OZAA 3T8MA 4F93B 3PR4A 1S3SG 2FPKA 2Z7JA 5KAFU 1T3NA 2MBOA 3TACB 4K7WA 4YR0A 5L1LA 2QB0B 2Y0SF 3BQ1A 5ALDA 4YP3A 1TZ1A 5AM3A 4BBNF 3PW5A 5J29A 3M6ZA 5JHAA 2QC8A 2SEBD 3TBLD 1WMHB 4PK1A 5J2FA 1PVQA 5CJ7A 1QOAA 1BPEA 2CPRA 1TK0A 1WM2A 4UB4A 2AU0A 3A9KB 2AL6A 3EHVA 2F44A 4REZA 1F44A 2DKZA 1XT9B 2MRLA 1KDHA 5J2DA 1TKYA 3AECB 4M9JA 1TAUA 2KC2A 3F5EA 5ALTA 3KOOA 4UAVA 4KLSA 2PFPA 1SGGA 8ICOA 2PVGC 4EX7A 1OXJA 5CRXA 1FNUA 4BXOA 3H0MB 1Q1OA 2LRUA 1OEYA 2A5UA 2HSZA 1QKZA 3Q3JA 3Q3NC 3PO5A 2Y1JA 4Q2JA 1TYGB 2FIFA 2C22A 4L23A 2FPLA 2E8OA 2HDOA 2L7RA 3JVZX 3TL5A 2UVRA 2KJ9A 4Z6CA 2KLCA 8ICVA 3RF9A 5J8YC 1DK3A 1WX8A 2Z0EB 2V4IB 1FNVA 3RRHA 2GBMA 4OVUA 3RNGC 1E8YA 4XWTA 5IIJA 2ONQA 2LYAA 4DL6A 3H8MA 2P6UA 1YN4A 5GTHU 2GWSA 5J2KA 3KYCD 2LHDA 4C4RA 1ZXIA 1ZYQA 1YQ4B 2G3QB 4ECRA 1E7VA 1WJUA 2DPJA 4HEA1 5KG5A 3ISCA 4CRXA 3H6NA 4DO9A 4XYCA 2JZPA 1Q46A 1WWUA 5DPSA 4NZLB 1CMXB 3RYTA 1JWMD 1QOGA 3DPDA 3HT3A 5J2HA 1XSPA 1ZQTA 7ICEA 4P2HA 4QZDA 2R8JA 1YQ3B 3K1ZA 2HHVA 4BX9C 1E8ZA 3AU5A 1UNSA 2OH2A 3H8SA 4GDLB 3UIOB 3JSVB 3UIPB 1CUKA 1SXEA 4P4MA 1UBQA 2NO4A 2PPHA 4FA6A 1JX4A 1TAQA 4L2YA 1EO6A 2G5IB 1FEHA 3PLVA 3QQ8B 3KHRA 4G50A 1Z1BA 4DK5A 1TY2A 2K5PA 3Q3OC 3MDCA 1GAQB 2XNAC 2KK0A 3FILB 1XWLA 3ZNGC 1SV0A 5T14A 1TT5B 2KKCA 2QEJC 3AEAB 3SD5A 2LUEA 3H7PA 4USAA 2HW3A 5EE3A 5J0YA 2F1HA 4RT3A 1ZKHA 2CHZA 2JZBA 4DQRA 2W8KA 2JY6A 3SR6A 4PZOA 4IQVA 1TY0A 3N1YC 4LNKA 2K0PA 4ANWA 1CZPA 2HI0A 1NK4A 2F3NA 3SAFA 1IYFA 4UB5A 2JU6X 2WXHA 2FJ6A 3BYYB 1P7FA 4ICUA 3PW2A 2XY5A 3Q8PB 1K52A 5LNK1 1QF6A 2KOBA 3V72A 3RJGA 3GIMA 1S8OA 2L83A 2KMDA 2W54A 2AQ0A 2OJWA 5HR7A 9ICEA 1YIWA 2LMCA 9ICJA 3F5AA 4II2B 2FI1A 2W55A 4UATA 5AM5A 5IP4D 3FC4A 4DXFA 5DBCA 1UQVA 1T7PA 3AEBB 1HZ5A 3PHXB 2M4NA 4M9NA 4F4XA 4AP4C 4JMUA 4Z6EA 4J9SA 1RYRA 4K1RB 4DBGA 4TQ0A 2KQ4X 3QU7A 1KN5A 5HP4A 1ACCA 3N7RC 1EM7A 4R3DA 1TK5A 2FIDA 4PT5A 1WY8A 3J9CA 4GXBA 3VVWB 1LGRA 3ZKJC 4GXJA 1RXWA 4Y2VA 4EKUA 2XVTA 4PS3A 3OHBA 2MCNB 2KMAA 1WXSA 5D3IB 3PHWB 4PHAA 2HVIA 2KKVA 3OAWA 3L54A 3U26A 4NJ8A 3ONSA 2VIXA 4C7YA 4HK2A 3N30A 3IBEA 5AKZA 4RQ7A 2NRXA 5DQIA 1T4GA 4LVSA 2JRHA 4HROA 1BMLC 2LVQA 3VXWA 4XUSA 4BXOB 2D6FC 3N32A 2BCSA 1SL1A 2M1MA 1UA1A 4QZ8A 2AQ3B 4I2AA 3ZTDA 5KT6A 2Z59B 3RJFA 4LK0M 5AKIA 3PZ7A 3P1MA 2ACZB 1V8CA 4UAUA 3Q14C 1ZQJA 2Z8LA 2W9AA 4QZGA 2WX0A 4KGSA 2DZIA 5KFPA 3RZWC 2RHFA 5G5GA 1JXEA 5LXIB 2K6QA 1XC9A 3W1SC 3DHHC 2VZKB 5B5EU 1XLQA 4FN2A 5C5JA 3W1YA 3PVXA 4Y2QA 1ZQWA 5KT5A 4ECXA 3B1LX 3AI5A 3AU4A 4KLFA 2ZUCA 1ROEA 2INPE 2O6VA 2EMSA 2PVOD 4W9KA 4HAIA 1WGYA 2KE7A 1PVPA 4JE3B 4M6WA 3F2CA 3GE8C 3U4EG 4W9CA 2KWUB 2K4IA 1X9SA 9ICOA 3NUQA 2JRIB 4PL2A 1DRGA 1MPEA 1D9FA 2LVOA 1GC7A 4AJWA 2ON8A 1P9DU 3R7RA 1PDXA 2D11A 1UT8A 4HKZE 1S97A 4HCPB 3GV5B 4E74A 2UVVA 4R64A 1J7AA 1SKRA 2K9XA 4LJOB 2QDFA 5D94A 4HLEA 3V6KA 3IAM1 1RLFA 1ZE3D 2N1VA 2PMZC 3RAQA 5B66U 2G1EA 5KFTA 1E90A 1RYUA 1J97A 8ICYA 2PE6B 2L00B 2BS4B 1I4XA 2LPEA 1IP9A 3G6YA 2XBBC 1NENB 1VR9A 4F4WA 3IT6B 2JXTA 2GI9A 3EZ5A 3GP7A 2W03A 5BPCA 3NHEB 4ED0A 5BYQA 2NO5A 2GLSA 3H7PB 4Y2RA 4PGXA 4J03A 3PSIA 4WQOB 4A6QA 5HHDG 1WXQA 4RM8A 1GOZA 5HKHA 4IR1A 4KKJA 4NM2A 3BZKA 3JPNA 2XGQA 3P4PB 1SKWA 3PSFA 2K60A 3RN9C 5L95C 9ICTA 3VFKA 4B9KA 2WF8A 5J2JA 2HBLA 3VQIA 1KJTA 2DLBA 4QZFA 2BCUA 1WYWB 2WF7A 4FADA 1YJ1A 1RYJA 2BVCA 3LJ3A 3T5JA 3AEEB 1H8CA 2GOWA 5L1IA 5GXGB 4KLMA 3MR5A 1VJ5A 9ICUA 1JWAD 2ZJAA 1I4PA 3PPAA 2HHQA 8ICHA 3RAXA 1RDFA 2XK5A 3SEBA 5AM1A 2JEIA 8ICAA 2LI6A 4K4IA 2C9WB 5IA7A 5J2EA 1Y8RC 3MC0B 2WU2B 4WAFA 4PHEA 1ZQVA 2HJ8A 1U48A 2JZ3B 2D5GA 5CHVC 1E7UA 3PO0A 1JROA 4N9F4 4Y2UA 3MABA 2JUOA 4YCXA 2BYFA 5IIKA 4M9LA 7ICIA 4IKGA 4S17A 5KTQA 2IHNA 1YMHE 2NMQA 2ZZPB 1Y88A 1WG8A 2BKEA 4RQ2A 3T5KA 4BOZB 4Q8EA 3NY5A 2YX8A 2LUMA 3AQEA 2WF9A 5EWFA 1ZQRA 4MSQB 1HUZA 4QAYA 2NYVA 3IG5A 1F0ZA 2FUG1 4YMOA 4DQIA 4IQTA 2OJRA 5J0UA 4HKQA 3D2SA 3AE1B 4HJGE 4PJ0U 8ICLA 1P7EA 4NY8A 7ICTA 1PGXA 4DXGA 1ZRMA 3MR3A 4F4ZA 4P4PA 4NL9A 4QZAA 5BYSA 1V49A 5JXVA 1DOIA 3ML8A 1V5OA 3DBRB 3HKZF 4ARIA 4MEXA 4P7IA 1FXIA 3NVWA 2WX1A 3MTNB 4A20A 1X9MA 1UH6A 1OFFA 2ZG6A 3BS5A 4XA5A 3PW7A 3TFRA 4O3SA 4C8LA 1KF6B 4P6VF 8ICTA 4RNNA 2WAQF 2BB6A 2FBWB 4MGYE 3P4RB 2LKYA 3SDLC 1NK6A 3M1YA 3I63C 4G11A 3RT3B 4RH6A 3W2DA 3PSTA 2ASLA 2PKOA 2O6VB 3E58A 4OW0A 3WKAA 3NVVA 3ALRA 2R2OA 2MSED 3NZSA 5ALOA 2DPIA 9ICFA 4JWMA 1SL2A 3LK9A 2L8JA 1SV4A 7ICLA 4M6WB 4GOCA 1PK3A 3NOBA 4RF0A 4RQ3A 4HCNB 4NLBA 1U4BA 2KQSA 3ISBA 4NLGA 5ALWA 5J8YA 1D8LA 5E6NA 1N2XA 1XQQA 1ZOLA 2KTQA 2IJ0A 5C0YA 5CHGA 3RH4A 3QU4A 4J3OD 2BS3B 2I1QA 1C79A 1CI4A 2IA6A 1DK2A 2AL3A 3QARA 5KFWA 2DGZA 4YR3A 2YY6A 4DLEA 2WNMA 2DZKA 4RNOA 2G4SA 1V1OA 3QXGA 3M6KA 1JN3A 3A0HU 4Q45A 2ZIXA 3EA6A 3TEYA 2D3DA 3ZD9A 4TQSA 7ICFA 2ZW1A 4PS7A 1WJNA 2JXJA 5ALSA 2KX0A 4PS8A 1YNTE 4WIPA 3QYPA 4O3QA 1ZQMA 4JWSC 4XE0A 4OJ5A 2AXTU 1TBEA 1Z00A 5ALHA 4ED7A 2P66A 4JGHB 8ICSA 5DDMA 4E71A 4KN4A 1L0XB 5DPRA 1C9FA 1PQSA 1GC6A 4TKNA 1F9JA 5KFGA 2XO7A 2C7NB 2XC9A 2NVUI 5ALFA 2XGPA 1XCTL 3AE8B 1KFSA 2KJ6A 3KYDD 4O3NA 5KNIA 1NJWA 4ZH4A 4EYIB 3QAQA 2WXFA 2B76B 2K4HA 1C76A 3ZW3A 1YX6B 4KSLC 1WWVA 5AM0A 2HCFA 4HWIB 3ZVVA 5C3JB 3ZNHB 1N6ZA 2DF4B 4M0WA 5AICA 2MU2A 3V7LA 5AUIA 1TGZB 2JR5A 3BQ7A 2BQRA 1QOBA 2MX2A 2OOBB 2BPFA 1C4PA 3AXCA 1N5XA 4C8MA 5KG6A 4A90A 1U47A 2F8LA 4EZ9A 5IILA 3LVWA 1L6NA 1SIJA 3WANA 4RPYA 2QARA 3B08A 3JPSA 1Z4NA 1NK8A 8ICPA 4DDID 1ZQXA 2AEHA 5G5HA 4MGKE 2CKHB 2B21A 3GZNI 2LMRA 1X40A 1AW7A 2XCAA 2J6SA 2B0CA 1WZ3A 3L08A 4JIOU 2RPQA 2VANA 1KLGD 2L52A 2Y3AA 3B0YA 5F9LA 1FCCC 3EECA 2N0SB 1L3SA 4K4GA 5KFHA 4ZHPA 4J9LA 1T0SC 3EC8A 4JLCA 2WP9B 3Q69A 2HHWA 2EAMA 7ICMA 1C1YB 3U2SC 1XLPA 4DSLA 2SAKA 3GOEA 3DBSA 4NLKA 1R7SA 3ZDDA 2D3AA 1QH9A 2E1EA 4OJ6A 4HXDA 8ICZA 1EU4A 2WXMA 4GLSC 5AEKB 2P35A 3TKAA 3GV8B 1KQQA 2L0FA 9ICNA 3HVZA 5I4DA 1WI0A 3OLMD 1A76A 3M9NB 2LWPA 3BS5B 5D49A 4UAYA 1WCNA 4EENA 3MJ5A 2FCSA 4F7ZA 3V62A 1JUDA 1B43A 4DWIA 2I1KA 2N7EA 2L76A 4FS2A 2LJIA 5H2FU 1D5ZC 4FZMA 3VH3B 4QZ9A 2RSUA 2KANA 3GILA 5ALMA 4GSWA 2KDEB 4BKSA 1HUOA 3QEAZ 5AKHA 4DXAB 1I7HA 3I57A 3PTFC 2W3SA 2KNBA 4LZDA 2MBQA 2XY7A 1SIFA 2IDYA 2KXJA 4YT0B 2J6TA 2KAJA 2OXOA 2HBMA 2N1RA 1KTKA 2AYOB 4EOYA 2LXCA 3W1SA 4PZNA 3C1YA 5AZGA 1RQLA 2LGDA 4F2RA 2G0AA 3V7KA 2KFZA 3RNEC 1RPLA 4RQNA 3G6VA 2I38A 1NOMA 3UMGA 4OJOA 3KUDB 4U7CA 2ZIXB 4O3MA 3WCQA 3Q3MC 1UUPA 4EZ6A 9ICBA 5IN7A 4CF3A 3CMMB 2KDMA 3MBYA 1ZQKA 3ECIA 1TS2A 3AE5B 2IO1B 1BGXT 4DHZE 1YN3A 9ICVA 4DSFA 3AU6A 2LZ6A 3KWVA 4GU2A 2KOXA 1Z00B 2LD9A 5CX3A 2QCZA 1COKA 4ECSA 3U7DA 4NQKE 3C21A 4MFFA 2PFNA 3ABVB 3TAPA 1HA5A 3KKAA 7ICVA 2KP7A 1UHUA 5AIBA 3O13A 1R4MI 2BCRA 4I27A 3BS7A 3C8YA 2V1YA 5F3XB 3EFUA 1KRPA 2VJ4A 4UB8U 1ZXHA 3EW9A 3QX1A 9ICXA 2IY0B 4F2SA 2KN5A 4YWGG 4RQ5A 3GZNB 5FK9C 5KL8B 5A0LA 2K39A 4UAZA 3DDHA 4I2IA 4M0WB 2J0MA 1S9FA 2DZJA 1KFTA 5J2RA 2M8SA 3QUQA 3ZJVA 1HXYD 1NYQA 1V86A 3NG0A 4GLXA 1HTQA 1MQ2A 2H3VA 3ZDEA 4WURA 1S0OA 1HE8A 3PRMB 3K4GA 2EQYA 5KFUA 3KHGA 1PGAA 2J0JA 3QU2A 4I28A 2ZCCA 3N20C 4N6EB 4D2KA 3H1UA 2QB1A 1NKCA 4AYBC 1I35A 1QTMA 3IXSA 2MEKA 2WXLA 1M4VA 4LCDE 4EEYA 4RUCA 4IUMB 5DB8A 4RUAA 3DHGC 2JMGA 4QWDA 3UXPA 1WGKA 3ZD8A 3OG5A 3B0XA 1CJEA 3MC1A 3WA0A 2PIAA 4YXDB 2KWDA 4ZYSA 5IIOA 5J0QA 1DOQA 1Z1VA 2KHQA 3R7QA 4Y2SA 2Y0SC 1F52A 1UGJA 4YMNA 4O3RA 4BBNC 4KDIC 4QW8A 2N9LA 3CF6E 4I2DA 3H4DA 2FUHB 2KSOA 2EELA 3A4RA 3M62B 4OZBA 2KFKA 3EPGA 4ED2A 4EEWA 4MFCA 3NRZA 4AS1A 1Q5WB 3KFUF 4OZCA 1GNUA 3WK4A 1B22A 1WGDA 3VUWA 1HEKA 2FE8A 2LGYA 2RDHA 2V9HA 2BQQA 2YQEA 3IAS1 3QK0A 4KGTA 1R4NI 1S76D 1L7NA 2FE9A 2AQ4A 4WJNA 1ET6A 4DHZB 2GMIC 4F5OA 2WHEA 3TADC 2XI9A 3WK7A 2EKIA 3UQ0A 3GIKA 3WAMA 2IGHA 4TQ1A 4RMAA 3GE3C 3SEIA 1WGGA 2BF8B 1ENFA 5KFKA 4CYEA 2AWTA 4C8NA 5DDYA 1I42A 3F2BA 1G6JA 5BOLA 1S1QB 2GRIA 4HPLB 5DQGA 5BMHA 3N7SC 2MH7A 2OCEA 1E6EB 1KW4A 4CF5A 4YSYB 3PR5B 3RB3A 3NZUA 5J18A 3OHAA 1MQ3A 3IHPC 3P63A 3TCAA 1UZXB 2BHNA 5FP0A 4RQ6A 3LXFA 2AGOA 4B9UA 2ZJDA 2A1AA 1TZOA 1OQRA 5DBAA 1ZD4A 3HW8A 1PUZA 4CHKA 2PI4A 1A0PA 2GB1A 2JX5A 4TMAB 1UT5A 1NK0A 1QZEA 1L6UA 4FLHA 1N63A 3VUXA 2R18A 1N62A 3ISDA 4I2CA 1ET9A 3SYZA 2LHTA 1EU3A 3QC8B 2WU5B 1WE6A 2LGXA 3KWLA 5ALYA 2DZMA 5KFBA 1BPYA 4AQ7A 1FIQA 1P1AA 3NJTA 3I3TB 2E8MA 1GUAB 2N9KA 3RCZA 3K9PB 4YD2A 2ZVOA 2DL0A 4KX6B 3WIMA 4LDTD 2FMPA 3RH5A 3DBLI 1HEZE 1SE3A 1KLNA 2WDQB 2CU3A 5CP2A 3RI7C 5AK4A 3PRPB 4HPMB 3D6JA 3C29A 3DCGA 3RZFA 2KZRA 4LTUA 5MPOA 4DOBA 2OYYA 3APDA 2W9MA 1OQYA 4J9NA 4KLTA 3ZXRA 3T9LA 4IW0A 5ALZA 2F1JA 1UWXA 4S0RA 3B2GA 1ZGUB 2DUYA 4CDGA 3KD3A 4ED1A 4F4YA 2F76X 2CJNA 4RGOS 4MHVA 4XGAB 5IIIA 5JHBA 4OD0A 5IOIA 2VA2A 1YZ6A 2XY6A 3GV7B 2I1JA 2N4FA 4ASWC 3LYSA 2OHFA 2JYTA 3CSFA 3RBDA 2KX3A 1SJED 4KLUA 3M8SA 2KACA 1T3QA 5K4LA 2DNFA 2RDGA 1ECWA 5JH5C 2KO3A 1WWTA 3Q8MA 3TANA 4YL8A 4QWCA 2GBRA 2DYBA 5D6JB 2K4PA 1WSPA 1SBBB 2ZUBA 2KVSA 3R66C 2BB5A 3T5HA 2DBYA 5KL1B 3QE9Y 4ITKA 2AH5A 2V3PA 4UAWA 3M3JA 4EEKA 2YTUA 4DEZA 1T0RC 2NRVA 3CP8A 4DQSA 2PLPA 4W9IA 3AU2A 1ED1A 1O08A 2HHTA 4W9HA 3RJIA 5HNKA 4MF8A 2OEDA 1HIWA 1WF9A 3PZPA 1FNWA 1UBIA 2J7QB 2HTHA 3ORYA 3AE2B 3MFIA 2KSOB 3R3MA 1FRRA 4ACFA 2KFKB 1WX9A 2LI5A 4ZRIA 3IN5A 1ZPSA 2JQRB 5J2BA 3AEFB 1VD2A 4BAXA 1NZBA 1X2IA 3F53A 1RFKA 4A9AA 1IBXB 3NTUA 2KZ3A 1L3VA 5ALXA 1SWWA 4UW9A 3Q2AC 1IM4A 3HM3A 2JRZA 1C77A 7ICHA 4M02A 4P4OA 4YXMA 1BPZA 4E0DA 3VCBA 4DSKA 2H3ZA 4B0MA 4IC9A 4QWAA 3AH7A 3OWEB 2DWQA 2ODGA 1QQ7A 2JEGA 1F77A 5IKCM 1ZD5A 3OSNA 2VA3A 1BNPA 3FKYA 4G3IA 3VC8A 5KFQA 4F4KA 5KFZA 3CRXA 1J7BA 1S0NA 3SFEB 4A8XC 3I5JC 5AKYA 4FJYA 3ZI4A 1ZQQA 2HHXA 1F2RC 1TJEA 9ICLA 3ZQ4A 2BDUA 9ICQA 4DLGA 1ZQUA 1MHXA 4ARCA 5J0XA 2WF6A 3FDSA 2R8KA 4IM2A 1AARA 2CHXA 1SGHA 1F5SA 2CN1A 1ISNA 2N9EB 5EE9A 2Q5WD 1ZP0B 4KGRA 4LNNA 4ANUA 3RMKC 9ICRA 2MBHA 1XD3B 2RDBC 2RDIA 3U52E 4IL6U 1V5TA 2M19A 3IP4B 1NJXA 4P0PA 5L83A 1ZQEA 4RQ1A 2KJHB 4W9EA 1L3UA 1Y56A 1ZQBA 2LM4A 5G55A 2TSSA 1S0MA 9ICSA 3AE9B 4NNJB 4WAAA 9ICKA 2BPCA 5KT4A 2KLGA 4KLDA 1IV8A 2WTFA 4DFKA 3VR8B 1T6BX 3Q8FA 2FPMA 1P7DA 3A0BU 3RNCC 4O9MA 2A3VA 2YVCA 1A6SA 1K50A 4KLJA 2W04A 2X8XX 4JUZA 1BPXA 2HVHA 1D5XC 8ICWA 2HE7A 2LASA 3QUTA 3UMCA 1NJZA 3DOWA 1L3TA 4MDKE 4Q43A 5F9NA 2LBOA 1GO3F 1OGWA 1LVHA 5ALQA 5KFXA 4GDKA 1XU4A 7ICRA 4BWJA 1L0VB 4XQ8A 1SB3C 3RBEA 3GDXA 5GTIU 3ZLZA 4B9NA 1PFDA 2LYHA 4DFPA 2W9BB
chains in the Genus database with same CATH topology
4WH4A 1OQQA 4ZRPA 1J7CA 1BXTA 3AV8A 3E9SA 1EWCA 1L0XB 1C9FA 2KN4A 4RCOA 3NS1A 1WYGA 1XCTL 3AE8B 2K22A 1IGCA 3R2TA 1E9MA 3V3XA 1TS5A 3I9V1 2YEPB 2J53A 2BYTA 4L1BA 1QILA 2WXFA 2B76B 1TS3A 5FR3A 3FILA 1C76A 1VJKA 3Q8BA 1ZDVA 4H2AA 5C3JB 1VRAB 1STEA 4M0WA 2M56B 5D3DA 1Q10A 5AUIA 1VDVA 3ZGZA 1QOBA 1C4PA 1N5XA 3P4SB 4A90A 1L0YB 2WXRA 1SIJA 1AYFA 2V0GA 2E3TA 4RFBA 1C4CA 2WXGA 1SE4A 2L1AA 4YTMB 4NAWB 1RWSA 1FRDA 1HQRD 5G5HA 1RM6C 2VZKD 1NI3A 3HRDD 2E6XA 4ZOHC 1K53A 1AW7A 2BW2A 1BUIC 1V1PB 1ZDXA 2K3UA 2LEKA 1L5PA 2L52A 1KLGD 1EWYC 2AX5A 1FCCC 1VLBA 2Y5CA 2Y3AA 4B0EA 2N0SB 1N5WA 4ZHPA 3ZJUA 5BYRA 3W5VB 4A55A 3BK2A 2WP9B 3Q69A 2WLBA 2KMMA 1NEKB 3B9JA 1JW9D 4OZAA 3U2SC 1XLPA 2SAKA 1MI0A 3CWIA 3GB1A 4JPSA 3P42A 1R7SA 1GPXA 3VRBB 2SEBD 2IPKD 1EU4A 2WXMA 4GLSC 1QOAA 1A70A 2W82A 3HVZA 5I4DA 2QILA 3HUIA 2AQ1B 1YJIA 4REZA 3MJ5A 1TKYA 3AECB 4WWMA 2LJIA 1D5ZC 2L32A 2WXPA 2PVGC 1FNUA 5FKAC 1QKZA 1C4AA 2PW9A 4Q2JA 3BWUD 4XDDA 1I7HA 1TYGB 4L23A 3I57A 2W3SA 3TEZA 4NAMA 3AEGB 2IDYA 4YT0B 3R2IA 2IGDA 2KAJA 3N9YC 4RF1A 1KTKA 2V4IB 1FNVA 3ETRA 2WS3B 4XWTA 3W1SA 2ONQA 4NJCA 4C7ZA 1ZUD2 1YN4A 2LHDA 3TSSA 3U7ZA 1ZXIA 1YQ4B 3GS2A 2I38A 2PMVA 3BIID 3TEWA 1DYQA 4HEA1 1SF0A 4GDKB 2WXNA 4CQNA 3WCQA 1UUPA 2JZPA 4N58A 4NZLB 1TKEA 2KDMA 1JWMD 1QOGA 1TS2A 3AE5B 5HG2A 3BYTB 1YN3A 1CK1A 3KWVA 3EGRA 3AN1A 1YQ3B 1FO4A 4O1NA 1UNSA 1TKGA 4GDLB 3T3NA 2NTTA 1HA5A 3ABVB 1E0ZA 2QSDA 3O13A 3ZJTA 4L2YA 3C8YA 1FEHA 3P4QB 3AEDB 1TY2A 1ZXHA 2K5PA 1L4ZB 1GAQB 2XNAC 5AUKA 4YWGG 3FILB 5FK9C 4IOIE 3AM9A 1K51A 2QEJC 3AEAB 4USAA 5EE3A 2WXKA 5H8YE 1DOYA 3SR6A 1TY0A 3ZJVA 2K0PA 3LB8C 1CZPA 1HXYD 1NYQA 1IUEA 1GB1A 3LYYA 2DYMA 4WURA 1XLOA 3MP9A 2JU6X 2WXHA 3BYYB 1P7FA 1PGAA 3MFGA 4N6EB 2MJEA 4D2KA 4MT5A 1K52A 5LNK1 1QF6A 1XLNA 4RGNA 2MJ3A 3IXSA 2MEKA 2L83A 2WXLA 1KFYB 4HRSA 1M4VA 2JYEA 2IGGA 2YEPF 2X38A 2W54A 2LMCA 1NYRA 4JWUC 1WGKA 1CJEA 2W55A 3BK1A 3FC4A 1JCKB 2PIAA 2WDRB 4DXFA 4YXDB 2KWDA 1SE2A 1YN5A 1PGBA 3AEBB 4ZYSA 1HZ5A 1FM0D 1UGJA 1XXGA 4YSXB 4TQ0A 4RGMA 2N9LA 3IT4B 1I4GA 5BMIA 2KQ4X 4C80A 1ACCA 2EELA 4OZBA 5BYSA 1EM7A 1T5XD 3NRZA 4IDIA 4R3DA 4AS1A 3W5UB 4PT5A 3Q8AA 2WDVB 2V3NA 3BVZA 3J9CA 4OZCA 4WQMA 2FE8A 3V05A 2RDHA 1N60A 4N59A 4KGTA 3IAS1 5D3IB 3AMZA 2QIEB 4US9A 1ET6A 4C7YA 4MACA 2PTLA 2EKIA 2IGHA 4TQ1A 2J52A 1BMLC 1JMLA 4HROA 1PUTA 1ENFA 3KQ4A 4FXCA 2AQ3B 2I2YA 2HDEA 1DGJA 1SEBD 2GRIA 5HI1A 1JWBD 4LK0M 1D6EC 1QOFA 2MH7A 3PZ7A 3P1MA 2ACZB 4C56C 1E6EB 5BMHA 1V8CA 2Z8LA 2CJOA 4RNAA 4WIPA 4YSYB 4KGSA 5G5GA 5T8IA 2RPVA 3P63A 3RPFC 3T3OA 4YTPB 2VZKB 1XLQA 1FMAD 3LXFA 2LFIA 3URYA 1TZOA 1OQRA 2INPE 1HZ6A 1ROEA 3SFDB 1KRHA 2PVOD 5EE0A 1F2RI 2GB1A 2JX5A 1WRIA 4ZRQA 2BT6A 3DWGC 1KH0A 4TMAB 3BZDB 4JE3B 4XDCA 5E6JA 1L6UA 3U4EG 1N63A 1N62A 1ET9A 1EU3A 2WU5B 1VZ7A 1KLUD 1MPEA 3KWLA 2QJLA 1IGDA 4AQ7A 1D4BA 2ON8A 1QLBB 1FIQA 3B2FA 2NTSA 2JWUA 1VZ8A 1PDXA 2N9KA 4HKZE 3L4PA 3AE4B 4KX6B 2K9XA 1J7AA 1HEZE 1SE3A 2WDQB 2G9HD 2CU3A 3IAM1 1I4HA 2MJDA 1ZE3D 4MM3B 1E10A 2LGIA 1NVID 4UDUC 2G1EA 1DOXA 4LTUA 2H88B 5MPOA 2BS2B 3HVDA 3AB5A 2BS4B 1I4XA 1QT9A 1NENB 1VR9A 2WXOA 3IT6B 3NUHB 5C2TB 1UWXA 2JXTA 2GI9A 3B2GA 3GP7A 5BYQA 3MHZA 3EUB2 4A6QA 1AWDA 3VR9B 5HHDG 1WXQA 2CJNA 1GOZA 4RGOS 4MH8A 2LHEA 4KKJA 2DYOA 1C78A 3P4PB 1XO3A 4DQOC 3AE3B 1MHHE 2OHFA 3Q8CA 2JYTA 5HFYA 3R8BA 1SJED 3UI3A 3VQIA 2DLBA 2WXJA 2KACA 1T3QA 1JALA 2RDGA 1RYJA 3H8HA 3AEEB 1WWTA 5GXGB 1I4RA 2HTME 2WXIA 1JWAD 1JWSD 1WSPA 1I4PA 4OHJA 1SBBB 2BB5A 2DBYA 4ITKA 3SEBA 1FFUA 2V3PA 2PLPA 1FXAA 1XCQL 2JSVX 3MC0B 3TEXA 1V97A 1CQVA 2WU2B 3E56A 2OEDA 4WAFA 2D5GA 1FNWA 1FD6A 3PO0A 1JROA 3AE2B 4JX1C 1D5MC 1FRRA 3PZ8A 4EE2A 4IKGA 1ZPSA 2JQRB 3AEFB 1IBXB 2NMQA 1V1PA 1YMHE 1IBXA 1RFKA 3AE7B 3CIRB 4A9AA 4LLGM 2Y5PA 2LUMA 1C77A 5EE1A 1F0ZA 2FUG1 4B0MA 1N61A 4XWWA 4HKQA 3AH7A 1JWUD 3OWEB 5H92C 2DWQA 3AE1B 4HJGE 1FFVA 3FAHA 3NVZA 1F77A 3Q8EA 5TSSA 1P7EA 1PGXA 4DXGA 4P16A 1AN8A 1J7BA 4A8XC 3SFEB 3BVGA 5JXVA 5BMGA 1DOIA 4OVZA 1E7PB 1GB4A 4ARIA 3NZ3A 1F2RC 1TJEA 3ZQ4A 5D7GA 1PYWD 2M0AA 1FXIA 3NVWA 1MHXA 2WXQA 4ARCA 3RFZB 1UWMA 1SSNA 1OFFA 2BTEA 4KGRA 2Q5WD 3ZYYX 4ZHOA 5EE9A 1ZP0B 3W9CB 1KF6B 4P6VF 3TUOA 2BB6A 2FBWB 4KKIA 3P4RB 1L6VA 3U52E 2M19A 4RGTA 3VRAB 4TSSA 1TS4A 3DWMA 4RH6A 3AE6B 2RMMA 2BBCA 3W2DA 3BVMA 2PKOA 4YTNB 1Y56A 2AQ2B 1B9RA 1QQRA 4OW0A 2ICIA 2TSSA 3NVVA 3AE9B 1XF5L 4RF0A 2H89B 1VZ6A 2J42A 3VR8B 2R61A 1T6BX 3Q8FA 2J4XA 2IJ0A 4J3OD 2BS3B 1K50A 1C79A 1B1ZA 1D5XC 2WNMA 1FCLA 2INNE 2W3RA 2ZW0A 4US8A 1LO5D 4YSZB 1XEEA 1V1OA 1ZOYB 1JQ4A 3EA6A 3TEYA 3NVYA 2WQYB 1L0VB 1SJHD 2ZW1A 1YJJA 1SB3C 2N7JA 1ESFA 1JRPA 1YNTE 1SXTA 2XN9C 1PFDA 3KLSX 1L4DB 4XE0A 4JWSC 2QMTA 1I4QA 1MVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9A A;  2WS3 B;  3AMZ A;  3ETR A;  1OQQ A;  2QIE B;  1J7C A;  2DBY A;  4ITK A;  4US9 A;  1FFU A;  3AV8 A;  4C7Y A;  4C7Z A;  1FXA A;  1ZUD 2;  2EKI A;  1V97 A;  2WU2 B;  3NS1 A;  1WYG A;  1ZXI A;  1YQ4 B;  3AE8 B;  4HRO A;  2K22 A;  3PO0 A;  1PUT A;  1JRO A;  3AE2 B;  3BII D;  4JX1 C;  1E9M A;  1FRR A;  4FXC A;  1SF0 A;  3WCQ A;  2JQR B;  4N58 A;  2B76 B;  3AEF B;  1DGJ A;  1RFK A;  1JWB D;  1TKE A;  3AE7 B;  1QOG A;  1QOF A;  1VJK A;  2MH7 A;  3CIR B;  3P1M A;  2ACZ B;  1E6E B;  1V8C A;  3AE5 B;  5C3J B;  2CJO A;  2M56 B;  4YSY B;  5AUI A;  1VDV A;  3AN1 A;  1QOB A;  1YQ3 B;  5G5G A;  3P63 A;  3RPF C;  5EE1 A;  1FO4 A;  1N5X A;  3P4S B;  4YTP B;  1XLQ A;  1F0Z A;  1FMA D;  1TKG A;  1N61 A;  3LXF A;  1SIJ A;  1AYF A;  3AH7 A;  2E3T A;  5H92 C;  2DWQ A;  3AE1 B;  3ABV B;  1FFV A;  3FAH A;  3NVZ A;  1OQR A;  1E0Z A;  4YTM B;  3SFD B;  1ROE A;  1RWS A;  1KRH A;  2PVO D;  1FRD A;  5EE0 A;  5G5H A;  1J7B A;  2JX5 A;  1RM6 C;  1WRI A;  3SFE B;  1NI3 A;  3HRD D;  2BT6 A;  3DWG C;  3P4Q B;  4ZOH C;  1DOI A;  3AED B;  1E7P B;  1L6U A;  1N63 A;  2K5P A;  1GAQ B;  5AUK A;  1TJE A;  2LEK A;  1N62 A;  1L5P A;  1FXI A;  3AM9 A;  3NVW A;  2L52 A;  1EWY C;  2AX5 A;  2WU5 B;  1VLB A;  1UWM A;  2Y5C A;  3AEA B;  2N0S B;  1N5W A;  1OFF A;  3KWL A;  4ZHP A;  2QJL A;  4USA A;  2Q5W D;  3ZYY X;  4ZHO A;  5EE3 A;  5EE9 A;  1ZP0 B;  3W9C B;  3W5V B;  1KF6 B;  4P6V F;  1QLB B;  1FIQ A;  3B2F A;  3SR6 A;  2FBW B;  2WP9 B;  2WLB A;  5H8Y E;  1PDX A;  3LB8 C;  3P4R B;  2KMM A;  1L6V A;  1CZP A;  1NEK B;  3B9J A;  3L4P A;  1NYQ A;  2M19 A;  3AE4 B;  1IUE A;  4KX6 B;  3VRA B;  2K9X A;  1J7A A;  1JW9 D;  3DWM A;  2WDQ B;  1XLO A;  3AE6 B;  2CU3 A;  1XLP A;  2MJD A;  2PKO A;  4YTN B;  1E10 A;  1NVI D;  3CWI A;  1B9R A;  2G1E A;  1DOX A;  4LTU A;  1GPX A;  1R7S A;  3NVV A;  2H88 B;  2BS2 B;  4N6E B;  2MJE A;  5MPO A;  3AB5 A;  2BS4 B;  3VRB B;  1QF6 A;  3AE9 B;  1XLN A;  2MJ3 A;  1QT9 A;  1NEN B;  2L83 A;  1KFY B;  2H89 B;  4HRS A;  1QOA A;  5C2T B;  3VR8 B;  3B2G A;  1A70 A;  2W54 A;  3HVZ A;  1NYR A;  4JWU C;  3HUI A;  1DOY A;  1WGK A;  3EUB 2;  1CJE A;  1YJI A;  2W55 A;  1AWD A;  2BS3 B;  3VR9 B;  1WXQ A;  2CJN A;  1TKY A;  3FC4 A;  3AEC B;  2PIA A;  2WDR B;  4WWM A;  4YXD B;  3AEB B;  3P4P B;  1XO3 A;  2W3R A;  1FM0 D;  4US8 A;  2PVG C;  3AE3 B;  4YSX B;  4YSZ B;  2OHF A;  1ZOY B;  1JQ4 A;  4C80 A;  3NVY A;  2WQY B;  3NRZ A;  4IDI A;  1L0V B;  3W5U B;  1I7H A;  1TYG B;  1T3Q A;  1JAL A;  2WDV B;  2W3S A;  1RYJ A;  1YJJ A;  4WQM A;  3AEG B;  1SB3 C;  3AEE B;  4YT0 B;  1WWT A;  5GXG B;  1JRP A;  2KAJ A;  2HTM E;  1PFD A;  4JWS C;  1JWA D;  1N60 A;  4N59 A; 
#chains in the Genus database with same CATH topology
 1ZD3 A;  3A1Q A;  2MBE A;  1OQQ A;  1UPH A;  5AK6 A;  5J0W A;  1BXT A;  2CU1 A;  3PT2 B;  5AKL A;  2NCN A;  1AQ6 A;  4KLG A;  4Q44 A;  3S2A A;  3ZNI D;  2DAJ A;  3H4B A;  3NS1 A;  1ZJM A;  1WYG A;  3PO4 A;  4IM3 A;  2K22 A;  2REX A;  4GIV A;  2JF5 A;  1E9M A;  3V3X A;  1TS5 A;  3I9V 1;  4DQQ A;  3GQC A;  4L1B A;  3QZ7 A;  5JUM A;  2MQJ A;  2Z0D B;  1WJ4 A;  5FR3 A;  2FCM A;  5AHX A;  3Q8K A;  1K8R B;  1VJK A;  5ALP A;  3LVV A;  4I2E A;  3C2M A;  2NS5 A;  2KG5 A;  4FJZ A;  4H2A A;  1VRA B;  4DS5 A;  5ALK A;  4J9O A;  2M56 B;  2DAF A;  3PV1 A;  2KIW A;  3PV8 A;  2JZZ A;  8ICF A;  4PGY A;  4WJ3 B;  1L0Y B;  3KTQ A;  3QCA A;  4ECT A;  1QSS A;  3VUY A;  1MSW D;  2V0G A;  3J81 j;  1AYF A;  2LRW A;  1WRD B;  4RFB A;  5KG4 A;  7ICK A;  1C4C A;  2FLP A;  1SE4 A;  3ENE A;  1QSY A;  3MC8 A;  1EUV B;  3HIL A;  5DG8 A;  3CNH A;  4MGI E;  3K9O B;  1HQR D;  3ZIM A;  1NI3 A;  2E6X A;  1NBF C;  3JPR A;  7ICG A;  2LEK A;  2IND C;  2G06 A;  2YMP A;  2AX5 A;  4EZK A;  4J9M A;  4CCH A;  2RLT A;  2L0T A;  1YT3 A;  4NLZ A;  5BYR A;  3TAR A;  1MFW A;  3M9M B;  1DGS A;  3QU5 A;  2EKE C;  3BK2 A;  4I6L B;  4QZB A;  2WLB A;  2KMM A;  2MP2 A;  2E1F A;  3K75 D;  1WGR A;  4I29 A;  2MBB B;  4OJL A;  1HTO A;  3O65 B;  4FJV B;  4ED6 A;  4LNI A;  3FYH A;  3P2B A;  4OJP A;  4JPS A;  4DHJ D;  2WHI A;  3P42 A;  2GO7 A;  4QNL A;  3VRB B;  2NR2 A;  4PPX A;  1YQB A;  2BGW A;  4ECV A;  3ZDT A;  3PX6 A;  1T8E A;  2NRT A;  1X9W A;  3PX4 A;  3A4S C;  1C3T A;  3SAH A;  2KHV A;  3Q8S B;  4XRH A;  4ANV A;  2ZIW B;  3M95 A;  2AQ1 B;  4C00 A;  1WIA A;  4YFK A;  3OSP A;  2ALZ A;  3ZDB A;  3TAD A;  3OGU A;  2KWC A;  4WWM A;  4P0P B;  1BT0 A;  4FHK A;  5L9X A;  2NRW A;  4ANX A;  2K8C B;  2ZIV B;  1C4A A;  4XDD A;  3BWU D;  4AOF A;  5HHI A;  4RU9 A;  5KG3 A;  4NAM A;  4NWI A;  3TEZ A;  4FZL A;  3R2I A;  2IGD A;  4DCC A;  4ACO A;  3RTV A;  1EF5 A;  3N9Y C;  2DQN B;  3ETR A;  3MGI A;  4FS1 A;  1PZN A;  1T94 A;  4ZDV A;  1E5W A;  5C23 A;  4I6N B;  3C1Z A;  4P1C C;  4C7Z A;  4YR2 A;  2WGS A;  4QZC A;  4XC2 A;  2AGQ A;  2V3S A;  3UXO A;  3C5F A;  3JW0 X;  3KUC B;  2HHU A;  5JU5 A;  9ICG A;  3RD2 A;  3BJY A;  3DBH I;  4M01 A;  2V9W A;  2PMV A;  3BII D;  1U4A A;  3WAO A;  2MSN A;  4ICA A;  1SF0 A;  4GDK B;  1ZRN A;  3GFK B;  5J0P A;  4CQN A;  4Y2P A;  3N28 A;  2MW5 A;  1RG6 A;  1JI7 A;  8ICJ A;  3SU8 X;  1TKE A;  1ZQY A;  2ZXH A;  4QWE A;  4NLN A;  4TUQ A;  2KN7 A;  3LWL A;  2ES6 A;  2ISP A;  3N97 B;  3BYT B;  2WB1 C;  1CK1 A;  2W7O A;  3A1Q B;  3AN1 A;  3B0A A;  4R8U A;  3AUO A;  5ALU A;  1TE2 A;  4JWN A;  1TKG A;  4FBJ B;  3RJJ A;  2JV3 A;  4PL1 A;  4MEM A;  2NTT A;  1E0Z A;  3TJP A;  3KZI U;  3ZJT A;  3P4Q B;  1SKS A;  2PFQ A;  3DDC B;  1L4Z B;  2KMC A;  5E6P A;  4KLL A;  5AUK A;  4GMV A;  3O0F A;  4IOI E;  3AM9 A;  1K51 A;  3NAS A;  1ZQL A;  4C8K A;  2F8K A;  3APF A;  4IWP A;  1ZQA A;  4B6W A;  3WK8 A;  2W43 A;  2KEY A;  4PHP A;  3V6E B;  1DOY A;  1ZQI A;  3LB8 C;  4QIW C;  1ZJN A;  2R2Q A;  2ESE A;  4MGZ E;  1IUE A;  1MA7 A;  2O2V A;  8ICI A;  2EH9 A;  5EWE A;  3SV3 A;  1XLO A;  4RQ0 A;  2DYM A;  3MP9 A;  1V85 A;  1Z19 A;  2DHZ A;  4YXJ A;  2YB1 A;  2IY1 B;  3VTW A;  1L8L A;  3MFG A;  4F91 B;  4MT5 A;  2JPH A;  1TAM A;  4KLI A;  4KZ0 A;  2YMQ A;  2MA9 B;  1XLN A;  2A1J A;  2MJ3 A;  4DF4 A;  3H9D A;  4HRS A;  4IRD A;  5AK5 A;  5D4B A;  1X66 A;  3QU9 A;  2JWZ A;  1NYR A;  2M17 A;  4JWU C;  4ZRJ A;  3EYZ A;  4ECZ A;  9ICP A;  2V4L A;  3BK1 A;  5KG2 A;  1JCK B;  2QLT A;  4JV0 A;  1SE2 A;  5J2G A;  1PGB A;  1WXA A;  1YN5 A;  2MP2 B;  4MJS A;  4AUQ C;  5AI5 A;  4ECQ A;  4DFM A;  2D3C A;  4F5Q A;  3MFH A;  1FM0 D;  2JEJ A;  3THV A;  2OEH A;  3H7I A;  1ZET A;  2AGP A;  1V6E A;  3IT4 B;  1I4G A;  4RGM A;  5BMI A;  2H3I A;  1E8W A;  2MAX A;  4XX5 A;  2BPS A;  2KD0 A;  4RQM A;  3A9J A;  4IDI A;  3L13 A;  3QWZ B;  2WDV B;  2V3N A;  4WQM A;  2KT7 A;  3MHS D;  2UVW A;  2ZNV C;  4KMU A;  1MVK A;  3V05 A;  2D10 A;  1N60 A;  2JVC A;  3RNF C;  4NQL B;  2C60 A;  3AMZ A;  2QIE B;  1PVR A;  4R66 A;  4HDO A;  4M0A A;  3KBB A;  4M8N A;  4I6P A;  2G5H B;  1NZP A;  5KFC A;  4F72 A;  4WJP A;  1LM8 B;  2HJ1 A;  1L7M A;  4GC7 A;  1D8Y A;  1V80 A;  4HDQ A;  2IO2 B;  3KQ4 A;  1S5L U;  2ISO A;  1EF1 A;  3D2Q A;  2A4Z A;  3WAP A;  5KG0 A;  2PKE A;  2KIC A;  3JPT A;  4TUS A;  1WE7 A;  4FXC A;  2I2Y A;  1SWV A;  2I5H A;  3Q8Q B;  5JRT A;  1WCL A;  5J17 A;  5HI1 A;  5HR6 A;  3WAL A;  3DVN V;  3WK5 A;  2CJO A;  1Q0W B;  3H40 A;  5TIS U;  2BYE A;  3IFW B;  1U45 A;  2RPV A;  5T8I A;  3T3O A;  4IWO A;  1J2N A;  2FMS A;  3OJ4 B;  5L1K A;  2BQ3 A;  2LFI A;  4PH5 A;  1RFA A;  5LXH A;  3V6H A;  5AZF A;  1UA0 A;  1NNL A;  1HZ6 A;  3SFD B;  5AKE A;  2E5S A;  1U9L A;  5EE0 A;  1D9D A;  2JGA A;  7ICN A;  1F2R I;  2GBJ A;  1WRI A;  4BUG A;  4DFJ A;  5DCN A;  2BT6 A;  3DWG C;  5E6J A;  3BZD B;  2UVU A;  2YB4 A;  8ICC A;  5CEH A;  3HK0 A;  3V60 A;  2WDT B;  5J0S A;  1RYS A;  2IOF K;  3TI0 A;  3DVN U;  1COO A;  1KFD A;  1KLU D;  3L0W B;  3HIZ A;  2QJL A;  3CW2 C;  1WM3 A;  4R8U B;  2KFN A;  2M0X A;  1L7O A;  5KFR A;  1D4B A;  2BR0 A;  3B2F A;  5E79 U;  4TUU A;  1E8X A;  1VZ8 A;  3WK6 A;  2JH1 A;  5CTR C;  2FCQ A;  3AEV A;  4UAR A;  4PHD A;  4RQ8 A;  4K7S A;  3PS6 A;  4HYK A;  5KG1 A;  1NK7 A;  4DSJ A;  4G3X B;  2G9H D;  3ZXV A;  2B3A A;  2MJD A;  3TQ1 A;  2K89 A;  2Y9T A;  2IO3 B;  3M9O B;  3PML A;  1MC8 A;  5J0R A;  1NVI D;  2LGI A;  1E10 A;  4QW9 A;  4AJY B;  1LFD A;  4KX5 A;  5AKJ A;  4NXZ A;  5KFM A;  5C2T B;  3R9K A;  4FBU A;  1ZQS A;  2IBK A;  3MHZ A;  3PSP A;  1OEY J;  3VR9 B;  5KHQ A;  4B9L A;  4MH8 A;  2LHE A;  3ML9 A;  3QHT A;  5ALN A;  2O2V B;  1XO3 A;  4BFR A;  3AE3 B;  1T0Q C;  1ZQO A;  2XEW A;  2YN4 A;  2F2A B;  1ZQF A;  3Q8C A;  4EBC A;  1ZQN A;  4RM9 A;  4YQW A;  3R8B A;  2HHS A;  3UI3 A;  2AHO B;  4C0Z A;  2BWF A;  1UEL A;  2IO0 B;  3T79 A;  2RD0 A;  2WXJ A;  2K8A A;  1J19 A;  2ZPN A;  2A1J B;  3H8H A;  4P1B C;  3UQ2 A;  1NK9 A;  3LWM A;  1I4R A;  2G45 B;  4MH0 E;  2WXI A;  1OW5 A;  4F8R A;  4HPP A;  4C4T A;  1JWS D;  2KFJ A;  2H5X A;  2QKQ A;  2RGF A;  3Q8R B;  3L17 A;  4QZE A;  2CRX A;  4A3P A;  1KTQ A;  5DB9 A;  1FFU A;  1KEJ A;  1U49 A;  4B9M A;  4URK A;  2M9N A;  1FXA A;  1JIH A;  4MJS B;  3TEX A;  1V97 A;  1CQV A;  3E56 A;  1FD6 A;  4JX1 C;  1D5M C;  2C28 A;  2K1F A;  2I9G A;  3NS8 A;  2V4Q A;  3A9J B;  2KWV B;  3PZ8 A;  4LJP B;  4EUT A;  4JB3 A;  1XSN A;  2C2R A;  1V1P A;  4B9S A;  1IBX A;  3AE7 B;  4KLQ A;  4J9K A;  2Y5P A;  2DFL A;  4F3O A;  2L05 A;  3N1X C;  2C7H A;  3DV9 A;  5EE1 A;  4GB9 A;  4FO6 A;  4KDL B;  2EAO A;  1ZQD A;  1XS9 D;  3H0L B;  5JZE B;  4UB1 A;  4KLO A;  1N61 A;  3LDZ E;  1CEZ A;  7ICP A;  5AKK A;  5H92 C;  4ELT A;  4ZYN A;  1ARO P;  3NVZ A;  2KV2 A;  4O3O A;  1KKX A;  3Q8E A;  4GGQ A;  5TSS A;  1BVS A;  4JK1 A;  4R65 A;  1WR1 A;  2ZTE A;  1SZP A;  4NL9 C;  3BVG A;  5BMG A;  4K4H A;  3NZ3 A;  2VJ5 A;  1PYW D;  2KVZ A;  2WXQ A;  5J2A A;  3RFZ B;  1WXM A;  3GZF A;  3ZYY X;  3EWA A;  3W9C B;  4K3B A;  4KKI A;  2FMQ A;  3ZDA A;  1K1S A;  4F5R A;  4RGT A;  2GBK A;  1BPB A;  1D3Z A;  2ZTC A;  5KG7 A;  1IIP A;  2V4R A;  2BBC A;  2RMM A;  4KIK A;  3ZRC A;  2KK8 A;  4YTN B;  5BO4 B;  2QHO A;  2AQ2 B;  2FLN A;  1QQR A;  5D2M B;  1X6I A;  2G08 A;  4JV1 A;  3ONN A;  5KFS A;  3TAQ A;  5ALR A;  1R4M B;  3OJU A;  2J6U A;  3MC9 A;  2H89 B;  1VZ6 A;  2R61 A;  4AP9 A;  3Q8L A;  2J0K A;  5L1M A;  1A77 A;  2E8P A;  4DOC A;  9ICM A;  4M9H A;  1K5O A;  3DVG X;  1BNO A;  4ELU A;  1B1Z A;  2R8H A;  3H7S A;  4CGZ A;  7ICQ A;  1C20 A;  2W3R A;  3V61 A;  1LO5 D;  2FNJ B;  1X9X A;  3WKB A;  2VH1 A;  4YSZ B;  3HWT A;  1WXV A;  3RH6 A;  1JQ4 A;  3Q3F A;  4MSM B;  1SXD A;  2IOH A;  3NVY A;  2WQY B;  1RZT A;  4PYU A;  1SJH D;  5G2N A;  3E2E A;  1KM7 A;  3KVF B;  5CB1 A;  1ZQ1 C;  3WKE A;  1YJJ A;  2ZXI A;  2KTF A;  1ESF A;  5CA7 A;  2PI5 A;  1JRP A;  3HX0 A;  4O5K A;  2EAN A;  1OTR B;  4O5E A;  2QMT A;  5AIA A;  2W9B A;  2BWE S;  2DEN B;  3M7D A;  5DKW A;  4ZRP A;  4WJO A;  3RUI B;  1J7C A;  2IZV B;  1EWC A;  2MWS B;  3E9S A;  3HJE A;  1ZQG A;  1ZW7 A;  1CRX A;  3PMN A;  3RNB C;  3MR6 A;  2KIV A;  1NK5 A;  5KFY A;  3V7J A;  1L5U A;  4M04 A;  4IWQ A;  2EZX A;  1IGC A;  5KFL A;  4B6J A;  1TK8 A;  1NKE A;  5AM4 A;  2YEP B;  1YOV B;  2J53 A;  2BYT A;  4DL2 A;  1QIL A;  3L16 A;  4XZ4 A;  5CHW A;  4IQU A;  4DSI A;  3Q8B A;  5LLI A;  2ZCB A;  3RUL A;  3A33 B;  4Y2T A;  3WKD A;  1DXS A;  5DGB A;  1STE A;  3SHQ A;  3ZUN A;  5D3D A;  1P3Q U;  1Q10 A;  5KAI U;  1WZ0 A;  1WGH A;  3QIJ A;  1C7Y A;  3C23 A;  1LXD A;  2OWO A;  4CE6 A;  5KFD A;  3ZRF A;  1YX5 B;  1R4N B;  2WXR A;  3MGV A;  2N9P C;  5KFE A;  1J0G A;  4B9V A;  4EEL A;  3N3K B;  2L5Y A;  3RFA A;  1KLV A;  4YTM B;  5EOZ A;  5ALJ A;  3VTV A;  5C1Z A;  3ZDC A;  3D2N A;  2EMT A;  1RM6 C;  1H38 A;  4EX6 A;  2VZK D;  3HRD D;  5AZH A;  2ZUD A;  1L7Y A;  2ZJ8 A;  2G07 A;  3M8R A;  1K53 A;  2BW2 A;  1BUI C;  1V81 A;  1V1P B;  1WUD A;  1ZDX A;  3PZD A;  2G09 A;  4B0E A;  2Y5C A;  1EWY C;  2W7P A;  1GG3 A;  4LDT B;  2I6X A;  1N5W A;  1TTN A;  3ZJU A;  4QZH A;  5DLF A;  2PJH A;  4Y2Y A;  4GN1 A;  4Q8F A;  4A55 A;  5TZV A;  5ALL A;  8ICE A;  4TV3 A;  4BWM A;  2FLL A;  5ALI A;  2H3Q A;  3PRE A;  2LGS A;  5AI8 A;  1RRB A;  3VDZ A;  3RB4 A;  1MI0 A;  2GH1 A;  3PLU A;  2EDU A;  3EPI A;  3CWI A;  3GB1 A;  3KUZ A;  3BY4 B;  1GPX A;  4O0I A;  5KT7 A;  2VKQ A;  3N1Z C;  3RNA C;  2HD5 B;  4KSK C;  3VH4 B;  4O5C A;  5DG7 A;  2IPK D;  3L3F X;  3CST A;  3ALB A;  1KSP A;  1IG6 A;  3SMV A;  1A70 A;  4DWF A;  2W82 A;  4MF2 A;  4Z6F A;  2QIL A;  2W9N A;  1FXT B;  5AKX A;  4LJX A;  3HUI A;  5IIN A;  1Q8K A;  3RR7 A;  2ZIW A;  1YJI A;  2H3F A;  4J9P A;  3TFS A;  5D46 A;  1X1M A;  1WH3 A;  3N4M B;  2L32 A;  2WXP A;  2BCV A;  1UCV A;  4KIK B;  4M00 A;  1B0X A;  1LB2 B;  5FKA C;  3DBL B;  3IRU A;  2JEF A;  3C2K A;  2ZIV A;  2K8C A;  1L8O A;  3FM9 A;  2PW9 A;  3KW5 B;  4BZA A;  4I2F A;  4OO1 J;  4Z6D A;  4A3O A;  3AEG B;  5EDS A;  4F92 B;  1L2N A;  4MEL A;  2K4E A;  5AI4 A;  1NDD A;  2IYD B;  4RF1 A;  2C5L C;  4B95 A;  2PFO A;  2WS3 B;  4I2H A;  3CYM A;  1QQ6 A;  4NJC A;  3DHI C;  2KZZ A;  1ZUD 2;  3IM1 A;  8ICK A;  3JPQ A;  3AQF A;  3IV6 A;  2W9C A;  3G6X A;  1YD8 U;  3TSS A;  1LV5 A;  3U7Z A;  3V6C B;  3RRG A;  1NI2 A;  5KFO A;  3DBR I;  3GS2 A;  4RPZ A;  1JXL A;  3TEW A;  4RZR A;  2EAP A;  1S10 A;  1ZQZ A;  2NRZ A;  1DYQ A;  2MUT A;  4ICV A;  2WXN A;  5DPW A;  4UB6 U;  3BQ2 A;  2B6G A;  2Y5B B;  4N58 A;  5KFF A;  1M6Y A;  1N48 A;  4G0N B;  4F5N A;  1QCK A;  4DL4 A;  2LJ5 A;  5HG2 A;  4CO7 A;  4ECY A;  4NY0 A;  4UB2 A;  3WU2 U;  3EGR A;  3NRW A;  4LZG A;  3F2D A;  1FO4 A;  2PXI A;  2CXY A;  4BDP A;  3MJW A;  4JL9 A;  4K81 A;  4O1N A;  5DB7 A;  4I2J A;  4RNM A;  1UD7 A;  3T3N A;  4X5V A;  1Z2M A;  3KKA C;  2K8B A;  4RQ4 A;  4MM3 A;  2QSD A;  1P98 A;  1SE9 A;  3PVL A;  3WKC A;  3T5L A;  2L3Z A;  3WK9 A;  3VHT C;  3AED B;  3TMP B;  8ICN A;  2PMZ F;  9ICI A;  2RDJ A;  4JV2 A;  2O6K A;  3KZX A;  3MGH A;  2F77 X;  4W9J A;  1XO1 A;  3SZ2 A;  4I2B A;  2HBJ A;  2WYQ A;  3NGD A;  1N56 A;  2JZB B;  2WXK A;  1XNS A;  1NJY A;  5H8Y E;  2NBU A;  4FZN A;  3UIN B;  4EZJ A;  4ECU A;  3H8J A;  4R63 A;  8ICG A;  1GB1 A;  3LYY A;  3ICX A;  5L1J A;  1NKB A;  2K8H A;  2BDP A;  2KNJ A;  2JHD A;  3X23 A;  2MJE A;  4NJ6 A;  3VTU A;  9ICC A;  4U6P A;  3QUC A;  3T3F A;  2G4D B;  2ASD A;  1FEZ A;  1SZH A;  2Q0Z X;  1KFY B;  4C4V A;  2YEP F;  2JYE A;  2IGG A;  4KMO B;  3ETL A;  2X38 A;  2O6V D;  2DX5 B;  3C19 A;  3PY8 A;  3X0W A;  1ZD2 P;  5AK3 A;  2BZF A;  5TR5 A;  3QX7 A;  5DBB A;  2W11 A;  2PEA A;  1IXR A;  2WDR B;  5FR6 A;  5KT2 A;  4DS4 A;  3RJH A;  4KTQ A;  1UF0 A;  2FAZ A;  2FCN A;  1BPD A;  3IHQ B;  4KV2 A;  1QSL A;  2XIC A;  4I2G A;  1XXG A;  4YSX B;  3UPQ A;  4FFD A;  3HKZ C;  4DL5 A;  4C80 A;  4YG2 A;  1T5X D;  4M8M A;  2XCP A;  3PW0 A;  3W5U B;  3Q8A A;  3BVZ A;  5HHH A;  3BQ0 A;  4NV0 A;  2ZNV B;  3V6J A;  2KHW B;  2KJR A;  3UQB A;  1JRU A;  2WAQ C;  1J2M A;  1TKD A;  4N59 A;  5KFV A;  4US9 A;  4MAC A;  2LM1 A;  2F1I A;  8ICR A;  2BKF A;  1V38 A;  2KVC A;  2PTL A;  2EZY A;  2J52 A;  3OJS A;  1JML A;  1PUT A;  4UAS A;  4EFO A;  2ZVN A;  2KJ5 A;  1MG4 A;  1D8B A;  4DL3 A;  4O3P A;  2HDE A;  1DGJ A;  1SEB D;  1ZQC A;  1JWB D;  3I76 A;  1X42 A;  4DL7 A;  1D6E C;  1QOF A;  2HOQ A;  4X57 B;  4C56 C;  2GBN A;  5EWG A;  7ICJ A;  5DPT A;  4II3 B;  2D8C A;  2HBK A;  4A8E A;  2NBW B;  3MDA A;  3AUL A;  5AI6 A;  5DG9 A;  3M63 B;  4RNA A;  4W9L A;  3HPO A;  3PX0 A;  3RPF C;  5J2C A;  1O03 A;  4YTP B;  3DVG Y;  2KTR A;  1FMA D;  8ICQ A;  2GOL A;  1QQ5 A;  3URY A;  1S0V A;  2C2E A;  1LKY A;  4ED8 A;  2W9C B;  3HP6 A;  3GU3 A;  3H8W A;  4RT2 A;  4KZC A;  3KH0 A;  4GFJ A;  1KRH A;  4ZRQ A;  4J9R A;  4GC6 A;  3D32 A;  2MUT B;  5IAA C;  2WWZ A;  2UWQ A;  1KH0 A;  3KHL A;  4GXI A;  4XDC A;  9ICH A;  5IIM A;  1H4R A;  3DQV A;  2D3B A;  2UYZ B;  3AL0 B;  5IO9 A;  3ED5 A;  1VZ7 A;  5HMM A;  2JH7 A;  2ATL A;  4OCZ A;  1S77 D;  5DB6 A;  1IGD A;  2KDF B;  1SL0 A;  4TUP A;  2HOF A;  1QLB B;  2NTS A;  2JWU A;  5ALG A;  4FHJ A;  4DHJ B;  3UF8 A;  1KBU A;  4KLE A;  4K7U A;  3E0F A;  3L4P A;  4P0Q A;  3SD7 A;  3I28 A;  4C8O A;  3AE4 B;  4Y2J A;  8ICX A;  4JQW C;  3DEE A;  5J0T A;  1I4H A;  4W9F A;  2K8B B;  2VA8 A;  3JPP A;  4MM3 B;  4UDU C;  1LQB A;  1KL9 A;  3PSE B;  1DOX A;  4HVB A;  2LYB A;  2H88 B;  2BS2 B;  2JXX A;  3HVD A;  3AB5 A;  4LNF A;  2ZIU A;  1QT9 A;  2WXO A;  3NUH B;  3N7P D;  2RR9 A;  3SAG A;  1SV0 C;  2BCQ A;  2KVR A;  5CHF A;  1PK1 A;  2KYW A;  4UQG A;  2KDI A;  4CNQ A;  1Q3U A;  3EUB 2;  4K3C A;  5AI0 A;  2INC C;  1AWD A;  4F1S A;  1IPG A;  2BKR B;  2WB1 F;  7ICS A;  2VH2 A;  5J0O A;  1XO0 A;  4KIT B;  2DYO A;  1C78 A;  4CF4 A;  3K1R B;  4DFD A;  1ZQH A;  2N9X A;  4F5P A;  4EYH B;  4DQO C;  1MHH E;  4PYZ A;  4F71 A;  2HOI A;  4RPX A;  2P6R A;  3APC A;  5HFY A;  4MEY A;  4IC7 B;  4NPN A;  2N7D A;  1TV9 A;  1JAL A;  4DDG D;  3ZO5 B;  2N1W A;  2ZJ5 A;  2XID A;  5CR0 A;  4C4V B;  2HTM E;  2C2D A;  3BQT A;  4OHJ A;  4Y2X A;  4ELV A;  3PNC A;  2XK5 B;  2NPT A;  3OPX A;  2W8L A;  1XCQ L;  1EXN A;  2JSV X;  3SV4 A;  2K25 A;  1VCB A;  3L10 B;  4QIW F;  4EBD A;  3PW4 A;  4NAW A;  2Y9U A;  4KN7 A;  2CHW A;  4IG7 B;  1V9P A;  4ZRK A;  5KT3 A;  1T0Y A;  3IG3 A;  2MHJ A;  5DGA A;  4TUR A;  1K1Q A;  1X6J A;  5J2I A;  4EE2 A;  2NBV B;  3UQA A;  3CIR B;  1KOT A;  4EBE A;  4ED3 A;  2ZPY A;  3BIN A;  4LLG M;  4IRK A;  4C4S A;  1Z3E B;  4YMM A;  2BGF A;  1HJP A;  3QNM A;  3QUB A;  2KQ7 A;  3S6J A;  1UGM A;  3RB0 A;  4XWW A;  1RQN A;  2Q4T A;  1JWU D;  1FFV A;  3FAH A;  3RJE A;  1WJ6 A;  4BGD A;  3UGB B;  4M9G A;  4P16 A;  1AN8 A;  5HML A;  4KVG B;  3Q6B A;  3U30 A;  5KFN A;  1F0M A;  4DOA A;  2QB0 A;  2D2Q A;  5GMV A;  1P0R A;  3DBH B;  1E7P B;  4OVZ A;  3L5K A;  1WMH A;  1GB4 A;  5BOM A;  3KHH A;  5D7G A;  2M0A A;  4PGQ A;  4J9Q A;  1RXV A;  1WR6 E;  3IDW A;  1UWM A;  3BZC A;  2KJ8 A;  3C5G A;  1SSN A;  3QJZ A;  3VAW A;  2D3G A;  3A9K A;  2BTE A;  4ZHO A;  3ZTC A;  2IBI B;  4YN4 A;  1XSL A;  2DKX A;  3C28 A;  1OUQ A;  3GIJ A;  3TUO A;  5AM2 A;  1Q3V A;  2IHM A;  4DQP A;  2BYV E;  1L6V A;  2KTR B;  3VRA B;  2AJQ A;  1TS4 A;  2EZZ A;  2LXA A;  4TSS A;  2LVP A;  1LKY B;  3DWM A;  4E3C A;  3AE6 B;  4W9G A;  1FPY A;  4IRC A;  2MA1 A;  3BVM A;  3U8Z A;  4WWN A;  9ICA A;  1B9R A;  5KFJ A;  2ICI A;  4FE3 A;  4NM1 A;  1GJZ A;  4GIB A;  4HJK A;  1TFR A;  1XF5 L;  3RB6 A;  3PGE A;  4EZL A;  4DF8 A;  2ZTD A;  2J42 A;  2ASJ A;  2R8G A;  4W9D A;  1A5R A;  3I1Y A;  4QJF B;  1YZ7 A;  2MLB A;  2J4X A;  1WFY A;  4NJ7 A;  5DQH A;  2BQU A;  4M2Y A;  3PRZ A;  4IQW A;  8ICB A;  2RRD A;  5CWR A;  3ZDM C;  4WJQ A;  3QEB Z;  3UM9 A;  1WX7 A;  1B4F A;  2CR5 A;  2JT4 B;  4P0Q B;  4M47 A;  4YVZ A;  1FCL A;  2INN E;  2ZW0 A;  4US8 A;  5JTI A;  4B9T A;  3OTQ A;  4IS7 A;  2R8I A;  8ICM A;  3BDP A;  1XEE A;  1ZOY B;  2OM6 A;  2WFA A;  3IVF A;  3EFC A;  5DLG A;  4UBB A;  3SQI A;  4AWJ A;  2NV3 A;  1V2Y A;  2KC1 A;  3SI8 A;  2N7J A;  3TIX A;  2ZIU B;  4KLH A;  3HM6 X;  3UXN A;  1SXT A;  2XN9 C;  3KLS X;  1L4D B;  4RGN A;  8ICU A;  2YML A;  1I4Q A;  1MJD A;  1PK1 B;  4BVU C;  4WWP A;  2RP5 A;  4J6I A;  2YMM A;  4IM0 A;  3LDA A;  4OVV A;  4WH4 A;  1QLN A;  5KHO A;  7ICO A;  3AV8 A;  5KFI A;  2YLM A;  3QZ8 A;  3QA8 A;  4GDL A;  2D07 B;  2K6D B;  3JSV A;  2KN4 A;  1J8C A;  4QWB A;  2KZM A;  5AKG A;  4RCO A;  1M94 A;  2FDR A;  4KX3 A;  1MN8 A;  3C0R B;  3SEN A;  3MR2 A;  4IR9 A;  2IOF A;  2MRP A;  3R2T A;  1MG8 A;  1JMS A;  4BOS C;  5AI9 A;  1TS3 A;  7ICU A;  2ASQ A;  3FIL A;  1TVA A;  2HMX A;  4TQR A;  1ZDV A;  2RQ5 A;  4FUL A;  4MFA A;  2M0N A;  4G9B A;  4QZI A;  4BKS D;  1VDV A;  5ALV A;  3ZGZ A;  3UMB A;  2NPT B;  1URJ A;  2GLE A;  4DSE A;  2UU7 A;  4FBT A;  3P4S B;  2ZEQ A;  2IMW P;  3HHM A;  3RJK A;  1L7P A;  5ALE A;  3JPO A;  2E3T A;  3JYU A;  2QAR B;  3RR8 A;  2WXG A;  2PE9 A;  4UB3 A;  2L1A A;  2CS4 A;  4NAW B;  2KKP A;  1RWS A;  1FRD A;  1TIF A;  5KFA A;  2WF5 A;  4GXK A;  4WWO A;  4ZOH C;  2C7M B;  3C2L A;  1RAX A;  2K3U A;  2A19 A;  1F1H A;  2KD1 A;  1ZQP A;  9ICW A;  1L5P A;  2KDB A;  4LNO A;  4F8C B;  1VLB A;  2E8N A;  4AYB F;  4BJQ A;  4F50 A;  4ECW A;  3OJ3 A;  1Z4O A;  4UBC A;  3ZNZ B;  2BPG A;  4NLC A;  3W5V B;  1Z5S B;  3GII A;  4YD1 A;  1V9J A;  2VRR B;  3IG8 A;  1NEK B;  3H0R B;  3B9J A;  4BKT A;  4BKG A;  2Y1I A;  1JW9 D;  5E6O A;  4OZA A;  3T8M A;  4F93 B;  3PR4 A;  1S3S G;  2FPK A;  2Z7J A;  5KAF U;  1T3N A;  2MBO A;  3TAC B;  4K7W A;  4YR0 A;  5L1L A;  2QB0 B;  2Y0S F;  3BQ1 A;  5ALD A;  4YP3 A;  1TZ1 A;  5AM3 A;  4BBN F;  3PW5 A;  5J29 A;  3M6Z A;  5JHA A;  2QC8 A;  2SEB D;  3TBL D;  1WMH B;  4PK1 A;  5J2F A;  1PVQ A;  5CJ7 A;  1QOA A;  1BPE A;  2CPR A;  1TK0 A;  1WM2 A;  4UB4 A;  2AU0 A;  3A9K B;  2AL6 A;  3EHV A;  2F44 A;  4REZ A;  1F44 A;  2DKZ A;  1XT9 B;  2MRL A;  1KDH A;  5J2D A;  1TKY A;  3AEC B;  4M9J A;  1TAU A;  2KC2 A;  3F5E A;  5ALT A;  3KOO A;  4UAV A;  4KLS A;  2PFP A;  1SGG A;  8ICO A;  2PVG C;  4EX7 A;  1OXJ A;  5CRX A;  1FNU A;  4BXO A;  3H0M B;  1Q1O A;  2LRU A;  1OEY A;  2A5U A;  2HSZ A;  1QKZ A;  3Q3J A;  3Q3N C;  3PO5 A;  2Y1J A;  4Q2J A;  1TYG B;  2FIF A;  2C22 A;  4L23 A;  2FPL A;  2E8O A;  2HDO A;  2L7R A;  3JVZ X;  3TL5 A;  2UVR A;  2KJ9 A;  4Z6C A;  2KLC A;  8ICV A;  3RF9 A;  5J8Y C;  1DK3 A;  1WX8 A;  2Z0E B;  2V4I B;  1FNV A;  3RRH A;  2GBM A;  4OVU A;  3RNG C;  1E8Y A;  4XWT A;  5IIJ A;  2ONQ A;  2LYA A;  4DL6 A;  3H8M A;  2P6U A;  1YN4 A;  5GTH U;  2GWS A;  5J2K A;  3KYC D;  2LHD A;  4C4R A;  1ZXI A;  1ZYQ A;  1YQ4 B;  2G3Q B;  4ECR A;  1E7V A;  1WJU A;  2DPJ A;  4HEA 1;  5KG5 A;  3ISC A;  4CRX A;  3H6N A;  4DO9 A;  4XYC A;  2JZP A;  1Q46 A;  1WWU A;  5DPS A;  4NZL B;  1CMX B;  3RYT A;  1JWM D;  1QOG A;  3DPD A;  3HT3 A;  5J2H A;  1XSP A;  1ZQT A;  7ICE A;  4P2H A;  4QZD A;  2R8J A;  1YQ3 B;  3K1Z A;  2HHV A;  4BX9 C;  1E8Z A;  3AU5 A;  1UNS A;  2OH2 A;  3H8S A;  4GDL B;  3UIO B;  3JSV B;  3UIP B;  1CUK A;  1SXE A;  4P4M A;  1UBQ A;  2NO4 A;  2PPH A;  4FA6 A;  1JX4 A;  1TAQ A;  4L2Y A;  1EO6 A;  2G5I B;  1FEH A;  3PLV A;  3QQ8 B;  3KHR A;  4G50 A;  1Z1B A;  4DK5 A;  1TY2 A;  2K5P A;  3Q3O C;  3MDC A;  1GAQ B;  2XNA C;  2KK0 A;  3FIL B;  1XWL A;  3ZNG C;  1SV0 A;  5T14 A;  1TT5 B;  2KKC A;  2QEJ C;  3AEA B;  3SD5 A;  2LUE A;  3H7P A;  4USA A;  2HW3 A;  5EE3 A;  5J0Y A;  2F1H A;  4RT3 A;  1ZKH A;  2CHZ A;  2JZB A;  4DQR A;  2W8K A;  2JY6 A;  3SR6 A;  4PZO A;  4IQV A;  1TY0 A;  3N1Y C;  4LNK A;  2K0P A;  4ANW A;  1CZP A;  2HI0 A;  1NK4 A;  2F3N A;  3SAF A;  1IYF A;  4UB5 A;  2JU6 X;  2WXH A;  2FJ6 A;  3BYY B;  1P7F A;  4ICU A;  3PW2 A;  2XY5 A;  3Q8P B;  1K52 A;  5LNK 1;  1QF6 A;  2KOB A;  3V72 A;  3RJG A;  3GIM A;  1S8O A;  2L83 A;  2KMD A;  2W54 A;  2AQ0 A;  2OJW A;  5HR7 A;  9ICE A;  1YIW A;  2LMC A;  9ICJ A;  3F5A A;  4II2 B;  2FI1 A;  2W55 A;  4UAT A;  5AM5 A;  5IP4 D;  3FC4 A;  4DXF A;  5DBC A;  1UQV A;  1T7P A;  3AEB B;  1HZ5 A;  3PHX B;  2M4N A;  4M9N A;  4F4X A;  4AP4 C;  4JMU A;  4Z6E A;  4J9S A;  1RYR A;  4K1R B;  4DBG A;  4TQ0 A;  2KQ4 X;  3QU7 A;  1KN5 A;  5HP4 A;  1ACC A;  3N7R C;  1EM7 A;  4R3D A;  1TK5 A;  2FID A;  4PT5 A;  1WY8 A;  3J9C A;  4GXB A;  3VVW B;  1LGR A;  3ZKJ C;  4GXJ A;  1RXW A;  4Y2V A;  4EKU A;  2XVT A;  4PS3 A;  3OHB A;  2MCN B;  2KMA A;  1WXS A;  5D3I B;  3PHW B;  4PHA A;  2HVI A;  2KKV A;  3OAW A;  3L54 A;  3U26 A;  4NJ8 A;  3ONS A;  2VIX A;  4C7Y A;  4HK2 A;  3N30 A;  3IBE A;  5AKZ A;  4RQ7 A;  2NRX A;  5DQI A;  1T4G A;  4LVS A;  2JRH A;  4HRO A;  1BML C;  2LVQ A;  3VXW A;  4XUS A;  4BXO B;  2D6F C;  3N32 A;  2BCS A;  1SL1 A;  2M1M A;  1UA1 A;  4QZ8 A;  2AQ3 B;  4I2A A;  3ZTD A;  5KT6 A;  2Z59 B;  3RJF A;  4LK0 M;  5AKI A;  3PZ7 A;  3P1M A;  2ACZ B;  1V8C A;  4UAU A;  3Q14 C;  1ZQJ A;  2Z8L A;  2W9A A;  4QZG A;  2WX0 A;  4KGS A;  2DZI A;  5KFP A;  3RZW C;  2RHF A;  5G5G A;  1JXE A;  5LXI B;  2K6Q A;  1XC9 A;  3W1S C;  3DHH C;  2VZK B;  5B5E U;  1XLQ A;  4FN2 A;  5C5J A;  3W1Y A;  3PVX A;  4Y2Q A;  1ZQW A;  5KT5 A;  4ECX A;  3B1L X;  3AI5 A;  3AU4 A;  4KLF A;  2ZUC A;  1ROE A;  2INP E;  2O6V A;  2EMS A;  2PVO D;  4W9K A;  4HAI A;  1WGY A;  2KE7 A;  1PVP A;  4JE3 B;  4M6W A;  3F2C A;  3GE8 C;  3U4E G;  4W9C A;  2KWU B;  2K4I A;  1X9S A;  9ICO A;  3NUQ A;  2JRI B;  4PL2 A;  1DRG A;  1MPE A;  1D9F A;  2LVO A;  1GC7 A;  4AJW A;  2ON8 A;  1P9D U;  3R7R A;  1PDX A;  2D11 A;  1UT8 A;  4HKZ E;  1S97 A;  4HCP B;  3GV5 B;  4E74 A;  2UVV A;  4R64 A;  1J7A A;  1SKR A;  2K9X A;  4LJO B;  2QDF A;  5D94 A;  4HLE A;  3V6K A;  3IAM 1;  1RLF A;  1ZE3 D;  2N1V A;  2PMZ C;  3RAQ A;  5B66 U;  2G1E A;  5KFT A;  1E90 A;  1RYU A;  1J97 A;  8ICY A;  2PE6 B;  2L00 B;  2BS4 B;  1I4X A;  2LPE A;  1IP9 A;  3G6Y A;  2XBB C;  1NEN B;  1VR9 A;  4F4W A;  3IT6 B;  2JXT A;  2GI9 A;  3EZ5 A;  3GP7 A;  2W03 A;  5BPC A;  3NHE B;  4ED0 A;  5BYQ A;  2NO5 A;  2GLS A;  3H7P B;  4Y2R A;  4PGX A;  4J03 A;  3PSI A;  4WQO B;  4A6Q A;  5HHD G;  1WXQ A;  4RM8 A;  1GOZ A;  5HKH A;  4IR1 A;  4KKJ A;  4NM2 A;  3BZK A;  3JPN A;  2XGQ A;  3P4P B;  1SKW A;  3PSF A;  2K60 A;  3RN9 C;  5L95 C;  9ICT A;  3VFK A;  4B9K A;  2WF8 A;  5J2J A;  2HBL A;  3VQI A;  1KJT A;  2DLB A;  4QZF A;  2BCU A;  1WYW B;  2WF7 A;  4FAD A;  1YJ1 A;  1RYJ A;  2BVC A;  3LJ3 A;  3T5J A;  3AEE B;  1H8C A;  2GOW A;  5L1I A;  5GXG B;  4KLM A;  3MR5 A;  1VJ5 A;  9ICU A;  1JWA D;  2ZJA A;  1I4P A;  3PPA A;  2HHQ A;  8ICH A;  3RAX A;  1RDF A;  2XK5 A;  3SEB A;  5AM1 A;  2JEI A;  8ICA A;  2LI6 A;  4K4I A;  2C9W B;  5IA7 A;  5J2E A;  1Y8R C;  3MC0 B;  2WU2 B;  4WAF A;  4PHE A;  1ZQV A;  2HJ8 A;  1U48 A;  2JZ3 B;  2D5G A;  5CHV C;  1E7U A;  3PO0 A;  1JRO A;  4N9F 4;  4Y2U A;  3MAB A;  2JUO A;  4YCX A;  2BYF A;  5IIK A;  4M9L A;  7ICI A;  4IKG A;  4S17 A;  5KTQ A;  2IHN A;  1YMH E;  2NMQ A;  2ZZP B;  1Y88 A;  1WG8 A;  2BKE A;  4RQ2 A;  3T5K A;  4BOZ B;  4Q8E A;  3NY5 A;  2YX8 A;  2LUM A;  3AQE A;  2WF9 A;  5EWF A;  1ZQR A;  4MSQ B;  1HUZ A;  4QAY A;  2NYV A;  3IG5 A;  1F0Z A;  2FUG 1;  4YMO A;  4DQI A;  4IQT A;  2OJR A;  5J0U A;  4HKQ A;  3D2S A;  3AE1 B;  4HJG E;  4PJ0 U;  8ICL A;  1P7E A;  4NY8 A;  7ICT A;  1PGX A;  4DXG A;  1ZRM A;  3MR3 A;  4F4Z A;  4P4P A;  4NL9 A;  4QZA A;  5BYS A;  1V49 A;  5JXV A;  1DOI A;  3ML8 A;  1V5O A;  3DBR B;  3HKZ F;  4ARI A;  4MEX A;  4P7I A;  1FXI A;  3NVW A;  2WX1 A;  3MTN B;  4A20 A;  1X9M A;  1UH6 A;  1OFF A;  2ZG6 A;  3BS5 A;  4XA5 A;  3PW7 A;  3TFR A;  4O3S A;  4C8L A;  1KF6 B;  4P6V F;  8ICT A;  4RNN A;  2WAQ F;  2BB6 A;  2FBW B;  4MGY E;  3P4R B;  2LKY A;  3SDL C;  1NK6 A;  3M1Y A;  3I63 C;  4G11 A;  3RT3 B;  4RH6 A;  3W2D A;  3PST A;  2ASL A;  2PKO A;  2O6V B;  3E58 A;  4OW0 A;  3WKA A;  3NVV A;  3ALR A;  2R2O A;  2MSE D;  3NZS A;  5ALO A;  2DPI A;  9ICF A;  4JWM A;  1SL2 A;  3LK9 A;  2L8J A;  1SV4 A;  7ICL A;  4M6W B;  4GOC A;  1PK3 A;  3NOB A;  4RF0 A;  4RQ3 A;  4HCN B;  4NLB A;  1U4B A;  2KQS A;  3ISB A;  4NLG A;  5ALW A;  5J8Y A;  1D8L A;  5E6N A;  1N2X A;  1XQQ A;  1ZOL A;  2KTQ A;  2IJ0 A;  5C0Y A;  5CHG A;  3RH4 A;  3QU4 A;  4J3O D;  2BS3 B;  2I1Q A;  1C79 A;  1CI4 A;  2IA6 A;  1DK2 A;  2AL3 A;  3QAR A;  5KFW A;  2DGZ A;  4YR3 A;  2YY6 A;  4DLE A;  2WNM A;  2DZK A;  4RNO A;  2G4S A;  1V1O A;  3QXG A;  3M6K A;  1JN3 A;  3A0H U;  4Q45 A;  2ZIX A;  3EA6 A;  3TEY A;  2D3D A;  3ZD9 A;  4TQS A;  7ICF A;  2ZW1 A;  4PS7 A;  1WJN A;  2JXJ A;  5ALS A;  2KX0 A;  4PS8 A;  1YNT E;  4WIP A;  3QYP A;  4O3Q A;  1ZQM A;  4JWS C;  4XE0 A;  4OJ5 A;  2AXT U;  1TBE A;  1Z00 A;  5ALH A;  4ED7 A;  2P66 A;  4JGH B;  8ICS A;  5DDM A;  4E71 A;  4KN4 A;  1L0X B;  5DPR A;  1C9F A;  1PQS A;  1GC6 A;  4TKN A;  1F9J A;  5KFG A;  2XO7 A;  2C7N B;  2XC9 A;  2NVU I;  5ALF A;  2XGP A;  1XCT L;  3AE8 B;  1KFS A;  2KJ6 A;  3KYD D;  4O3N A;  5KNI A;  1NJW A;  4ZH4 A;  4EYI B;  3QAQ A;  2WXF A;  2B76 B;  2K4H A;  1C76 A;  3ZW3 A;  1YX6 B;  4KSL C;  1WWV A;  5AM0 A;  2HCF A;  4HWI B;  3ZVV A;  5C3J B;  3ZNH B;  1N6Z A;  2DF4 B;  4M0W A;  5AIC A;  2MU2 A;  3V7L A;  5AUI A;  1TGZ B;  2JR5 A;  3BQ7 A;  2BQR A;  1QOB A;  2MX2 A;  2OOB B;  2BPF A;  1C4P A;  3AXC A;  1N5X A;  4C8M A;  5KG6 A;  4A90 A;  1U47 A;  2F8L A;  4EZ9 A;  5IIL A;  3LVW A;  1L6N A;  1SIJ A;  3WAN A;  4RPY A;  2QAR A;  3B08 A;  3JPS A;  1Z4N A;  1NK8 A;  8ICP A;  4DDI D;  1ZQX A;  2AEH A;  5G5H A;  4MGK E;  2CKH B;  2B21 A;  3GZN I;  2LMR A;  1X40 A;  1AW7 A;  2XCA A;  2J6S A;  2B0C A;  1WZ3 A;  3L08 A;  4JIO U;  2RPQ A;  2VAN A;  1KLG D;  2L52 A;  2Y3A A;  3B0Y A;  5F9L A;  1FCC C;  3EEC A;  2N0S B;  1L3S A;  4K4G A;  5KFH A;  4ZHP A;  4J9L A;  1T0S C;  3EC8 A;  4JLC A;  2WP9 B;  3Q69 A;  2HHW A;  2EAM A;  7ICM A;  1C1Y B;  3U2S C;  1XLP A;  4DSL A;  2SAK A;  3GOE A;  3DBS A;  4NLK A;  1R7S A;  3ZDD A;  2D3A A;  1QH9 A;  2E1E A;  4OJ6 A;  4HXD A;  8ICZ A;  1EU4 A;  2WXM A;  4GLS C;  5AEK B;  2P35 A;  3TKA A;  3GV8 B;  1KQQ A;  2L0F A;  9ICN A;  3HVZ A;  5I4D A;  1WI0 A;  3OLM D;  1A76 A;  3M9N B;  2LWP A;  3BS5 B;  5D49 A;  4UAY A;  1WCN A;  4EEN A;  3MJ5 A;  2FCS A;  4F7Z A;  3V62 A;  1JUD A;  1B43 A;  4DWI A;  2I1K A;  2N7E A;  2L76 A;  4FS2 A;  2LJI A;  5H2F U;  1D5Z C;  4FZM A;  3VH3 B;  4QZ9 A;  2RSU A;  2KAN A;  3GIL A;  5ALM A;  4GSW A;  2KDE B;  4BKS A;  1HUO A;  3QEA Z;  5AKH A;  4DXA B;  1I7H A;  3I57 A;  3PTF C;  2W3S A;  2KNB A;  4LZD A;  2MBQ A;  2XY7 A;  1SIF A;  2IDY A;  2KXJ A;  4YT0 B;  2J6T A;  2KAJ A;  2OXO A;  2HBM A;  2N1R A;  1KTK A;  2AYO B;  4EOY A;  2LXC A;  3W1S A;  4PZN A;  3C1Y A;  5AZG A;  1RQL A;  2LGD A;  4F2R A;  2G0A A;  3V7K A;  2KFZ A;  3RNE C;  1RPL A;  4RQN A;  3G6V A;  2I38 A;  1NOM A;  3UMG A;  4OJO A;  3KUD B;  4U7C A;  2ZIX B;  4O3M A;  3WCQ A;  3Q3M C;  1UUP A;  4EZ6 A;  9ICB A;  5IN7 A;  4CF3 A;  3CMM B;  2KDM A;  3MBY A;  1ZQK A;  3ECI A;  1TS2 A;  3AE5 B;  2IO1 B;  1BGX T;  4DHZ E;  1YN3 A;  9ICV A;  4DSF A;  3AU6 A;  2LZ6 A;  3KWV A;  4GU2 A;  2KOX A;  1Z00 B;  2LD9 A;  5CX3 A;  2QCZ A;  1COK A;  4ECS A;  3U7D A;  4NQK E;  3C21 A;  4MFF A;  2PFN A;  3ABV B;  3TAP A;  1HA5 A;  3KKA A;  7ICV A;  2KP7 A;  1UHU A;  5AIB A;  3O13 A;  1R4M I;  2BCR A;  4I27 A;  3BS7 A;  3C8Y A;  2V1Y A;  5F3X B;  3EFU A;  1KRP A;  2VJ4 A;  4UB8 U;  1ZXH A;  3EW9 A;  3QX1 A;  9ICX A;  2IY0 B;  4F2S A;  2KN5 A;  4YWG G;  4RQ5 A;  3GZN B;  5FK9 C;  5KL8 B;  5A0L A;  2K39 A;  4UAZ A;  3DDH A;  4I2I A;  4M0W B;  2J0M A;  1S9F A;  2DZJ A;  1KFT A;  5J2R A;  2M8S A;  3QUQ A;  3ZJV A;  1HXY D;  1NYQ A;  1V86 A;  3NG0 A;  4GLX A;  1HTQ A;  1MQ2 A;  2H3V A;  3ZDE A;  4WUR A;  1S0O A;  1HE8 A;  3PRM B;  3K4G A;  2EQY A;  5KFU A;  3KHG A;  1PGA A;  2J0J A;  3QU2 A;  4I28 A;  2ZCC A;  3N20 C;  4N6E B;  4D2K A;  3H1U A;  2QB1 A;  1NKC A;  4AYB C;  1I35 A;  1QTM A;  3IXS A;  2MEK A;  2WXL A;  1M4V A;  4LCD E;  4EEY A;  4RUC A;  4IUM B;  5DB8 A;  4RUA A;  3DHG C;  2JMG A;  4QWD A;  3UXP A;  1WGK A;  3ZD8 A;  3OG5 A;  3B0X A;  1CJE A;  3MC1 A;  3WA0 A;  2PIA A;  4YXD B;  2KWD A;  4ZYS A;  5IIO A;  5J0Q A;  1DOQ A;  1Z1V A;  2KHQ A;  3R7Q A;  4Y2S A;  2Y0S C;  1F52 A;  1UGJ A;  4YMN A;  4O3R A;  4BBN C;  4KDI C;  4QW8 A;  2N9L A;  3CF6 E;  4I2D A;  3H4D A;  2FUH B;  2KSO A;  2EEL A;  3A4R A;  3M62 B;  4OZB A;  2KFK A;  3EPG A;  4ED2 A;  4EEW A;  4MFC A;  3NRZ A;  4AS1 A;  1Q5W B;  3KFU F;  4OZC A;  1GNU A;  3WK4 A;  1B22 A;  1WGD A;  3VUW A;  1HEK A;  2FE8 A;  2LGY A;  2RDH A;  2V9H A;  2BQQ A;  2YQE A;  3IAS 1;  3QK0 A;  4KGT A;  1R4N I;  1S76 D;  1L7N A;  2FE9 A;  2AQ4 A;  4WJN A;  1ET6 A;  4DHZ B;  2GMI C;  4F5O A;  2WHE A;  3TAD C;  2XI9 A;  3WK7 A;  2EKI A;  3UQ0 A;  3GIK A;  3WAM A;  2IGH A;  4TQ1 A;  4RMA A;  3GE3 C;  3SEI A;  1WGG A;  2BF8 B;  1ENF A;  5KFK A;  4CYE A;  2AWT A;  4C8N A;  5DDY A;  1I42 A;  3F2B A;  1G6J A;  5BOL A;  1S1Q B;  2GRI A;  4HPL B;  5DQG A;  5BMH A;  3N7S C;  2MH7 A;  2OCE A;  1E6E B;  1KW4 A;  4CF5 A;  4YSY B;  3PR5 B;  3RB3 A;  3NZU A;  5J18 A;  3OHA A;  1MQ3 A;  3IHP C;  3P63 A;  3TCA A;  1UZX B;  2BHN A;  5FP0 A;  4RQ6 A;  3LXF A;  2AGO A;  4B9U A;  2ZJD A;  2A1A A;  1TZO A;  1OQR A;  5DBA A;  1ZD4 A;  3HW8 A;  1PUZ A;  4CHK A;  2PI4 A;  1A0P A;  2GB1 A;  2JX5 A;  4TMA B;  1UT5 A;  1NK0 A;  1QZE A;  1L6U A;  4FLH A;  1N63 A;  3VUX A;  2R18 A;  1N62 A;  3ISD A;  4I2C A;  1ET9 A;  3SYZ A;  2LHT A;  1EU3 A;  3QC8 B;  2WU5 B;  1WE6 A;  2LGX A;  3KWL A;  5ALY A;  2DZM A;  5KFB A;  1BPY A;  4AQ7 A;  1FIQ A;  1P1A A;  3NJT A;  3I3T B;  2E8M A;  1GUA B;  2N9K A;  3RCZ A;  3K9P B;  4YD2 A;  2ZVO A;  2DL0 A;  4KX6 B;  3WIM A;  4LDT D;  2FMP A;  3RH5 A;  3DBL I;  1HEZ E;  1SE3 A;  1KLN A;  2WDQ B;  2CU3 A;  5CP2 A;  3RI7 C;  5AK4 A;  3PRP B;  4HPM B;  3D6J A;  3C29 A;  3DCG A;  3RZF A;  2KZR A;  4LTU A;  5MPO A;  4DOB A;  2OYY A;  3APD A;  2W9M A;  1OQY A;  4J9N A;  4KLT A;  3ZXR A;  3T9L A;  4IW0 A;  5ALZ A;  2F1J A;  1UWX A;  4S0R A;  3B2G A;  1ZGU B;  2DUY A;  4CDG A;  3KD3 A;  4ED1 A;  4F4Y A;  2F76 X;  2CJN A;  4RGO S;  4MHV A;  4XGA B;  5III A;  5JHB A;  4OD0 A;  5IOI A;  2VA2 A;  1YZ6 A;  2XY6 A;  3GV7 B;  2I1J A;  2N4F A;  4ASW C;  3LYS A;  2OHF A;  2JYT A;  3CSF A;  3RBD A;  2KX3 A;  1SJE D;  4KLU A;  3M8S A;  2KAC A;  1T3Q A;  5K4L A;  2DNF A;  2RDG A;  1ECW A;  5JH5 C;  2KO3 A;  1WWT A;  3Q8M A;  3TAN A;  4YL8 A;  4QWC A;  2GBR A;  2DYB A;  5D6J B;  2K4P A;  1WSP A;  1SBB B;  2ZUB A;  2KVS A;  3R66 C;  2BB5 A;  3T5H A;  2DBY A;  5KL1 B;  3QE9 Y;  4ITK A;  2AH5 A;  2V3P A;  4UAW A;  3M3J A;  4EEK A;  2YTU A;  4DEZ A;  1T0R C;  2NRV A;  3CP8 A;  4DQS A;  2PLP A;  4W9I A;  3AU2 A;  1ED1 A;  1O08 A;  2HHT A;  4W9H A;  3RJI A;  5HNK A;  4MF8 A;  2OED A;  1HIW A;  1WF9 A;  3PZP A;  1FNW A;  1UBI A;  2J7Q B;  2HTH A;  3ORY A;  3AE2 B;  3MFI A;  2KSO B;  3R3M A;  1FRR A;  4ACF A;  2KFK B;  1WX9 A;  2LI5 A;  4ZRI A;  3IN5 A;  1ZPS A;  2JQR B;  5J2B A;  3AEF B;  1VD2 A;  4BAX A;  1NZB A;  1X2I A;  3F53 A;  1RFK A;  4A9A A;  1IBX B;  3NTU A;  2KZ3 A;  1L3V A;  5ALX A;  1SWW A;  4UW9 A;  3Q2A C;  1IM4 A;  3HM3 A;  2JRZ A;  1C77 A;  7ICH A;  4M02 A;  4P4O A;  4YXM A;  1BPZ A;  4E0D A;  3VCB A;  4DSK A;  2H3Z A;  4B0M A;  4IC9 A;  4QWA A;  3AH7 A;  3OWE B;  2DWQ A;  2ODG A;  1QQ7 A;  2JEG A;  1F77 A;  5IKC M;  1ZD5 A;  3OSN A;  2VA3 A;  1BNP A;  3FKY A;  4G3I A;  3VC8 A;  5KFQ A;  4F4K A;  5KFZ A;  3CRX A;  1J7B A;  1S0N A;  3SFE B;  4A8X C;  3I5J C;  5AKY A;  4FJY A;  3ZI4 A;  1ZQQ A;  2HHX A;  1F2R C;  1TJE A;  9ICL A;  3ZQ4 A;  2BDU A;  9ICQ A;  4DLG A;  1ZQU A;  1MHX A;  4ARC A;  5J0X A;  2WF6 A;  3FDS A;  2R8K A;  4IM2 A;  1AAR A;  2CHX A;  1SGH A;  1F5S A;  2CN1 A;  1ISN A;  2N9E B;  5EE9 A;  2Q5W D;  1ZP0 B;  4KGR A;  4LNN A;  4ANU A;  3RMK C;  9ICR A;  2MBH A;  1XD3 B;  2RDB C;  2RDI A;  3U52 E;  4IL6 U;  1V5T A;  2M19 A;  3IP4 B;  1NJX A;  4P0P A;  5L83 A;  1ZQE A;  4RQ1 A;  2KJH B;  4W9E A;  1L3U A;  1Y56 A;  1ZQB A;  2LM4 A;  5G55 A;  2TSS A;  1S0M A;  9ICS A;  3AE9 B;  4NNJ B;  4WAA A;  9ICK A;  2BPC A;  5KT4 A;  2KLG A;  4KLD A;  1IV8 A;  2WTF A;  4DFK A;  3VR8 B;  1T6B X;  3Q8F A;  2FPM A;  1P7D A;  3A0B U;  3RNC C;  4O9M A;  2A3V A;  2YVC A;  1A6S A;  1K50 A;  4KLJ A;  2W04 A;  2X8X X;  4JUZ A;  1BPX A;  2HVH A;  1D5X C;  8ICW A;  2HE7 A;  2LAS A;  3QUT A;  3UMC A;  1NJZ A;  3DOW A;  1L3T A;  4MDK E;  4Q43 A;  5F9N A;  2LBO A;  1GO3 F;  1OGW A;  1LVH A;  5ALQ A;  5KFX A;  4GDK A;  1XU4 A;  7ICR A;  4BWJ A;  1L0V B;  4XQ8 A;  1SB3 C;  3RBE A;  3GDX A;  5GTI U;  3ZLZ A;  4B9N A;  1PFD A;  2LYH A;  4DFP A;  2W9B B; 
#chains in the Genus database with same CATH homology
 4WH4 A;  1OQQ A;  4ZRP A;  1J7C A;  1BXT A;  3AV8 A;  3E9S A;  1EWC A;  1L0X B;  1C9F A;  2KN4 A;  4RCO A;  3NS1 A;  1WYG A;  1XCT L;  3AE8 B;  2K22 A;  1IGC A;  3R2T A;  1E9M A;  3V3X A;  1TS5 A;  3I9V 1;  2YEP B;  2J53 A;  2BYT A;  4L1B A;  1QIL A;  2WXF A;  2B76 B;  1TS3 A;  5FR3 A;  3FIL A;  1C76 A;  1VJK A;  3Q8B A;  1ZDV A;  4H2A A;  5C3J B;  1VRA B;  1STE A;  4M0W A;  2M56 B;  5D3D A;  1Q10 A;  5AUI A;  1VDV A;  3ZGZ A;  1QOB A;  1C4P A;  1N5X A;  3P4S B;  4A90 A;  1L0Y B;  2WXR A;  1SIJ A;  1AYF A;  2V0G A;  2E3T A;  4RFB A;  1C4C A;  2WXG A;  1SE4 A;  2L1A A;  4YTM B;  4NAW B;  1RWS A;  1FRD A;  1HQR D;  5G5H A;  1RM6 C;  2VZK D;  1NI3 A;  3HRD D;  2E6X A;  4ZOH C;  1K53 A;  1AW7 A;  2BW2 A;  1BUI C;  1V1P B;  1ZDX A;  2K3U A;  2LEK A;  1L5P A;  2L52 A;  1KLG D;  1EWY C;  2AX5 A;  1FCC C;  1VLB A;  2Y5C A;  2Y3A A;  4B0E A;  2N0S B;  1N5W A;  4ZHP A;  3ZJU A;  5BYR A;  3W5V B;  4A55 A;  3BK2 A;  2WP9 B;  3Q69 A;  2WLB A;  2KMM A;  1NEK B;  3B9J A;  1JW9 D;  4OZA A;  3U2S C;  1XLP A;  2SAK A;  1MI0 A;  3CWI A;  3GB1 A;  4JPS A;  3P42 A;  1R7S A;  1GPX A;  3VRB B;  2SEB D;  2IPK D;  1EU4 A;  2WXM A;  4GLS C;  1QOA A;  1A70 A;  2W82 A;  3HVZ A;  5I4D A;  2QIL A;  3HUI A;  2AQ1 B;  1YJI A;  4REZ A;  3MJ5 A;  1TKY A;  3AEC B;  4WWM A;  2LJI A;  1D5Z C;  2L32 A;  2WXP A;  2PVG C;  1FNU A;  5FKA C;  1QKZ A;  1C4A A;  2PW9 A;  4Q2J A;  3BWU D;  4XDD A;  1I7H A;  1TYG B;  4L23 A;  3I57 A;  2W3S A;  3TEZ A;  4NAM A;  3AEG B;  2IDY A;  4YT0 B;  3R2I A;  2IGD A;  2KAJ A;  3N9Y C;  4RF1 A;  1KTK A;  2V4I B;  1FNV A;  3ETR A;  2WS3 B;  4XWT A;  3W1S A;  2ONQ A;  4NJC A;  4C7Z A;  1ZUD 2;  1YN4 A;  2LHD A;  3TSS A;  3U7Z A;  1ZXI A;  1YQ4 B;  3GS2 A;  2I38 A;  2PMV A;  3BII D;  3TEW A;  1DYQ A;  4HEA 1;  1SF0 A;  4GDK B;  2WXN A;  4CQN A;  3WCQ A;  1UUP A;  2JZP A;  4N58 A;  4NZL B;  1TKE A;  2KDM A;  1JWM D;  1QOG A;  1TS2 A;  3AE5 B;  5HG2 A;  3BYT B;  1YN3 A;  1CK1 A;  3KWV A;  3EGR A;  3AN1 A;  1YQ3 B;  1FO4 A;  4O1N A;  1UNS A;  1TKG A;  4GDL B;  3T3N A;  2NTT A;  1HA5 A;  3ABV B;  1E0Z A;  2QSD A;  3O13 A;  3ZJT A;  4L2Y A;  3C8Y A;  1FEH A;  3P4Q B;  3AED B;  1TY2 A;  1ZXH A;  2K5P A;  1L4Z B;  1GAQ B;  2XNA C;  5AUK A;  4YWG G;  3FIL B;  5FK9 C;  4IOI E;  3AM9 A;  1K51 A;  2QEJ C;  3AEA B;  4USA A;  5EE3 A;  2WXK A;  5H8Y E;  1DOY A;  3SR6 A;  1TY0 A;  3ZJV A;  2K0P A;  3LB8 C;  1CZP A;  1HXY D;  1NYQ A;  1IUE A;  1GB1 A;  3LYY A;  2DYM A;  4WUR A;  1XLO A;  3MP9 A;  2JU6 X;  2WXH A;  3BYY B;  1P7F A;  1PGA A;  3MFG A;  4N6E B;  2MJE A;  4D2K A;  4MT5 A;  1K52 A;  5LNK 1;  1QF6 A;  1XLN A;  4RGN A;  2MJ3 A;  3IXS A;  2MEK A;  2L83 A;  2WXL A;  1KFY B;  4HRS A;  1M4V A;  2JYE A;  2IGG A;  2YEP F;  2X38 A;  2W54 A;  2LMC A;  1NYR A;  4JWU C;  1WGK A;  1CJE A;  2W55 A;  3BK1 A;  3FC4 A;  1JCK B;  2PIA A;  2WDR B;  4DXF A;  4YXD B;  2KWD A;  1SE2 A;  1YN5 A;  1PGB A;  3AEB B;  4ZYS A;  1HZ5 A;  1FM0 D;  1UGJ A;  1XXG A;  4YSX B;  4TQ0 A;  4RGM A;  2N9L A;  3IT4 B;  1I4G A;  5BMI A;  2KQ4 X;  4C80 A;  1ACC A;  2EEL A;  4OZB A;  5BYS A;  1EM7 A;  1T5X D;  3NRZ A;  4IDI A;  4R3D A;  4AS1 A;  3W5U B;  4PT5 A;  3Q8A A;  2WDV B;  2V3N A;  3BVZ A;  3J9C A;  4OZC A;  4WQM A;  2FE8 A;  3V05 A;  2RDH A;  1N60 A;  4N59 A;  4KGT A;  3IAS 1;  5D3I B;  3AMZ A;  2QIE B;  4US9 A;  1ET6 A;  4C7Y A;  4MAC A;  2PTL A;  2EKI A;  2IGH A;  4TQ1 A;  2J52 A;  1BML C;  1JML A;  4HRO A;  1PUT A;  1ENF A;  3KQ4 A;  4FXC A;  2AQ3 B;  2I2Y A;  2HDE A;  1DGJ A;  1SEB D;  2GRI A;  5HI1 A;  1JWB D;  4LK0 M;  1D6E C;  1QOF A;  2MH7 A;  3PZ7 A;  3P1M A;  2ACZ B;  4C56 C;  1E6E B;  5BMH A;  1V8C A;  2Z8L A;  2CJO A;  4RNA A;  4WIP A;  4YSY B;  4KGS A;  5G5G A;  5T8I A;  2RPV A;  3P63 A;  3RPF C;  3T3O A;  4YTP B;  2VZK B;  1XLQ A;  1FMA D;  3LXF A;  2LFI A;  3URY A;  1TZO A;  1OQR A;  2INP E;  1HZ6 A;  1ROE A;  3SFD B;  1KRH A;  2PVO D;  5EE0 A;  1F2R I;  2GB1 A;  2JX5 A;  1WRI A;  4ZRQ A;  2BT6 A;  3DWG C;  1KH0 A;  4TMA B;  3BZD B;  4JE3 B;  4XDC A;  5E6J A;  1L6U A;  3U4E G;  1N63 A;  1N62 A;  1ET9 A;  1EU3 A;  2WU5 B;  1VZ7 A;  1KLU D;  1MPE A;  3KWL A;  2QJL A;  1IGD A;  4AQ7 A;  1D4B A;  2ON8 A;  1QLB B;  1FIQ A;  3B2F A;  2NTS A;  2JWU A;  1VZ8 A;  1PDX A;  2N9K A;  4HKZ E;  3L4P A;  3AE4 B;  4KX6 B;  2K9X A;  1J7A A;  1HEZ E;  1SE3 A;  2WDQ B;  2G9H D;  2CU3 A;  3IAM 1;  1I4H A;  2MJD A;  1ZE3 D;  4MM3 B;  1E10 A;  2LGI A;  1NVI D;  4UDU C;  2G1E A;  1DOX A;  4LTU A;  2H88 B;  5MPO A;  2BS2 B;  3HVD A;  3AB5 A;  2BS4 B;  1I4X A;  1QT9 A;  1NEN B;  1VR9 A;  2WXO A;  3IT6 B;  3NUH B;  5C2T B;  1UWX A;  2JXT A;  2GI9 A;  3B2G A;  3GP7 A;  5BYQ A;  3MHZ A;  3EUB 2;  4A6Q A;  1AWD A;  3VR9 B;  5HHD G;  1WXQ A;  2CJN A;  1GOZ A;  4RGO S;  4MH8 A;  2LHE A;  4KKJ A;  2DYO A;  1C78 A;  3P4P B;  1XO3 A;  4DQO C;  3AE3 B;  1MHH E;  2OHF A;  3Q8C A;  2JYT A;  5HFY A;  3R8B A;  1SJE D;  3UI3 A;  3VQI A;  2DLB A;  2WXJ A;  2KAC A;  1T3Q A;  1JAL A;  2RDG A;  1RYJ A;  3H8H A;  3AEE B;  1WWT A;  5GXG B;  1I4R A;  2HTM E;  2WXI A;  1JWA D;  1JWS D;  1WSP A;  1I4P A;  4OHJ A;  1SBB B;  2BB5 A;  2DBY A;  4ITK A;  3SEB A;  1FFU A;  2V3P A;  2PLP A;  1FXA A;  1XCQ L;  2JSV X;  3MC0 B;  3TEX A;  1V97 A;  1CQV A;  2WU2 B;  3E56 A;  2OED A;  4WAF A;  2D5G A;  1FNW A;  1FD6 A;  3PO0 A;  1JRO A;  3AE2 B;  4JX1 C;  1D5M C;  1FRR A;  3PZ8 A;  4EE2 A;  4IKG A;  1ZPS A;  2JQR B;  3AEF B;  1IBX B;  2NMQ A;  1V1P A;  1YMH E;  1IBX A;  1RFK A;  3AE7 B;  3CIR B;  4A9A A;  4LLG M;  2Y5P A;  2LUM A;  1C77 A;  5EE1 A;  1F0Z A;  2FUG 1;  4B0M A;  1N61 A;  4XWW A;  4HKQ A;  3AH7 A;  1JWU D;  3OWE B;  5H92 C;  2DWQ A;  3AE1 B;  4HJG E;  1FFV A;  3FAH A;  3NVZ A;  1F77 A;  3Q8E A;  5TSS A;  1P7E A;  1PGX A;  4DXG A;  4P16 A;  1AN8 A;  1J7B A;  4A8X C;  3SFE B;  3BVG A;  5JXV A;  5BMG A;  1DOI A;  4OVZ A;  1E7P B;  1GB4 A;  4ARI A;  3NZ3 A;  1F2R C;  1TJE A;  3ZQ4 A;  5D7G A;  1PYW D;  2M0A A;  1FXI A;  3NVW A;  1MHX A;  2WXQ A;  4ARC A;  3RFZ B;  1UWM A;  1SSN A;  1OFF A;  2BTE A;  4KGR A;  2Q5W D;  3ZYY X;  4ZHO A;  5EE9 A;  1ZP0 B;  3W9C B;  1KF6 B;  4P6V F;  3TUO A;  2BB6 A;  2FBW B;  4KKI A;  3P4R B;  1L6V A;  3U52 E;  2M19 A;  4RGT A;  3VRA B;  4TSS A;  1TS4 A;  3DWM A;  4RH6 A;  3AE6 B;  2RMM A;  2BBC A;  3W2D A;  3BVM A;  2PKO A;  4YTN B;  1Y56 A;  2AQ2 B;  1B9R A;  1QQR A;  4OW0 A;  2ICI A;  2TSS A;  3NVV A;  3AE9 B;  1XF5 L;  4RF0 A;  2H89 B;  1VZ6 A;  2J42 A;  3VR8 B;  2R61 A;  1T6B X;  3Q8F A;  2J4X A;  2IJ0 A;  4J3O D;  2BS3 B;  1K50 A;  1C79 A;  1B1Z A;  1D5X C;  2WNM A;  1FCL A;  2INN E;  2W3R A;  2ZW0 A;  4US8 A;  1LO5 D;  4YSZ B;  1XEE A;  1V1O A;  1ZOY B;  1JQ4 A;  3EA6 A;  3TEY A;  3NVY A;  2WQY B;  1L0V B;  1SJH D;  2ZW1 A;  1YJJ A;  1SB3 C;  2N7J A;  1ESF A;  1JRP A;  1YNT E;  1SXT A;  2XN9 C;  1PFD A;  3KLS X;  1L4D B;  4XE0 A;  4JWS C;  2QMT A;  1I4Q A;  1MVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...