4DWIA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with self complementary dna, se-dgtp and calcium
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
581
structure length
581
Chain Sequence
GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 210
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dwiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dwiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dwiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dwiA01
1UA0A 3PMLA 3KIOA 4M04A 3TANA 4OJRA 8ICFA 3TAPA 4KRFA 1JN3A 5KFBA 4UAWA 4GVMA 2MAXA 1WCNA 3T5HA 3AU6A 3F9KA 1ZQSA 3KK3A 1CXUA 1BVSA 4FJNA 3HO1A 4I9QA 2XY5A 5KI6A 1TL3A 3RMDA 3V4IA 5DBBA 2ZJ5A 3OYCA 1JL1A 3LPTA 1QLNA 4ECWA 1XC9A 4KLTA 4ICLA 5CWRA 2FLLA 4CESA 3G10A 4I2PA 3PW4A 4FM0A 4YCXA 3QNOA 1JLAA 1L3UA 4KTQA 4CJKA 3IAYA 4JWMA 1ZJNA 4DFMA 4OLAA 9ICBA 1RT5A 2C2RA 2H5XA 4UBBA 4NLKA 4J2DA 4RU9A 7ICJA 4KHYA 4DFPA 4IR9A 5J2QA 2KZMA 5D4BA 4EYIB 8ICEA 3RAXA 3VQ7A 4PWDA 4M47A 3RH4A 4UAYA 1VSDA 4BWMA 3VQAA 4FJHA 7ICUA 4AHUA 4DEZA 4Z4GA 1X1PA 1BIUA 4RQ0A 1W0HA 5J2HA 3PX4A 5T7BA 1IG9A 4MQ3A 3K5NA 4CFCA 4DLGA 2G8HA 9ICIA 3OYEA 1PZNA 4CEBA 1TKZA 3NF9A 9ICTA 4PHDA 3K5MA 2AQ0A 5KFAA 5HMLA 3C6TA 4CJ5A 2BPFA 4KLFA 1RBVA 2KQ2A 4NLNA 3OVNA 1IO2A 1QQCA 4ECTA 3O3GA 3OSNA 2PXIA 4B9MA 4DOCA 5KFVA 8ICYA 4FK0A 3EWAA 2V4QA 4C8KA 1IKXA 5IIKA 4RT3A 3JPRA 1QSSA 4QAGA 3DLGA 1S0MA 3GV5B 3PUFA 2ZTCA 2HHWA 3P1GA 1B9FA 3BQTA 1BQNA 2BCUA 4KHUA 1QS4A 3LZIA 1IKVA 4Q43A 1ASUA 1GOBA 4J2BA 2F1HA 1TV9A 3QZ7A 3Q8SB 7ICQA 5KG5A 5FRMA 3ISDA 5DDMA 2C28A 5I42A 1KLNA 4RW9A 2BQRA 9ICEA 5KT3A 1RT1A 4DF4A 2P6RA 2ZUBA 3LP1A 2JZBB 4UBCA 3M9MB 4TSXA 1BQMA 3CFOA 4E89A 9ICVA 2GBZA 4DSFA 3OJUA 1ZYQA 3OYHA 5D3GA 2XY7A 1BI4B 3V9WA 2DTUA 3CFPA 2G8WA 1U9LA 1JXEA 3Q8PB 2BCRA 4W5OA 1T3NA 1HMVA 8ICNA 4O0JA 2PZSA 8ICPA 4KN7A 2X6SA 4CF8A 2FPLA 4J9SA 4O3RA 3PW7A 4LSLA 4FLUA 1NOMA 1JXBA 3PW2A 3OYDA 1TFRA 8ICSA 4ZTJA 5HHHA 1KFSA 2EX3A 4YR2A 8ICZA 5L9XA 3NH2A 1A5XA 1K6YA 3C21A 4IQTA 3TAQA 2RPIA 4CJTA 1VSHA 3MECA 2HVHA 2IHMA 3KLHA 4QOZB 1RT6A 4XQ8A 4FLTA 1XU4A 1S1VA 1VSKA 2NRZA 4P4OA 3H8WA 4M6WB 2IAJA 4HCCA 2AU0A 2ASDA 4UAZA 3QEWA 3T1AA 2ZJAA 4CHOA 4KV8A 4IR1A 1WAFA 8ICOA 2P5OA 1RCHA 3RJJA 3AVHA 3RJFA 2HHTA 9ICRA 2ISOA 4YMMA 3GDXA 3HJFA 1B9DA 4RZRA 4QZ8A 3I0RA 4N56A 4JUZA 1D9FA 4UB2A 3QEIA 3EPIA 2DPIA 4FJLA 5J2NA 4B9SA 4DTJA 4KLMA 4N5SA 4B8AB 4FJ8A 5KG3A 3Q8RB 2HHQA 4UB3A 2KFZA 2JEIA 1BCOA 4KLHA 4DFJA 4FLYA 3MR3A 4R5PA 4CGDA 3AVKA 2M9NA 3JPQA 1RTHA 4M2YA 3OS2A 2GV9A 5KFKA 4AHRA 1K1SA 4I2BA 3SQ0A 4DFKA 1KFDA 4BWJA 4PGXA 5DB7A 5KG7A 5CYQA 4QW9A 4PHAA 1CXQA 3DOKA 3M9OB 3QEBZ 4YR0A 5KFLA 3ZSZA 1ZQXA 2F1IA 2D0BA 3HSTB 3VQ5A 4M9LA 3QIOA 1TK0A 3BGRA 4YFKA 4M3UA 5KT5A 3SI6A 5KFIA 5DLFA 5HLFA 5EWEA 1VRUA 1HYZA 1JLFA 3IG1A 1VSLA 2R8KA 4FS1A 4I2IA 9ICXA 4NXZA 3SQ2A 3ZDCA 5EOZA 9ICJA 8ICHA 4FS2A 4RQ7A 2NRWA 4Q45A 3HL8A 4EBDA 3ALYA 1HYSA 3H8JA 1UA1A 4HTUA 4I27A 3QE9Y 3TARA 3AA5X 2ATQA 2RN2A 4F4WA 1SL0A 4DL3A 4DU1A 1RT3A 3TWHA 1KFTA 1NK4A 4CECA 4GC6A 2FPMA 3K5LA 4JK1A 2W9BB 4PGYA 1RDAA 4B9NA 4LH4A 5DGBA 1WAJA 2DFLA 3H4DA 1MU2A 4MFBA 1BL3A 4NLGA 2D5RA 1D9DA 3CYMA 5CZ2A 3KLGA 1IH7A 1C0MA 3N4MB 4JS5A 4ECQA 3DLEA 2FBTA 2HNZA 2FPKA 1J5OA 1NK8A 2YNHA 1ZQQA 4DOBA 4Z4HA 3VQ6A 4DOAA 3AA4A 3ISBA 2YHBA 5HNKA 4GC7A 1HRHA 2A1RA 4PGQA 3D45A 2ETJA 1B43A 3V6DA 1ZQMA 4HCBA 2IDOA 1L3VA 2FLPA 1UT8A 3NGIA 4FW2A 1RT7A 4MF8A 5HRSA 4FZZA 2JEJA 3NGDA 3AVNA 3MR5A 4F5QA 3NE6A 3C6UA 4ECSA 1IM4A 1UOCA 3GQCA 1RT2A 4IQUA 4F50A 3L2UA 4TURA 4RQ5A 2YV0X 3RJHA 4O9MA 5CB1A 3NH1A 1IXRA 4DSEA 3OGUA 2YNFA 2YNIA 3NTUA 1BPEA 2A1JA 4OPKA 2HHVA 1BPXA 4E1NA 1MC8A 3HP9A 4LY7A 3QEVA 4RQ4A 4BE1A 1JX4A 2DFHA 3OHBA 4F2RA 8ICIA 4YG2A 2KTQA 3DLRA 3K75D 3JPSA 4KLDA 2FBYA 3N97B 3P83D 4F4YA 1VK0A 3NCIA 2XY6A 4IKFA 4PHPA 4M3ZA 1X9WA 4RW6A 3SJJA 1DOQA 1HUOA 4DSJA 4Z4IA 4R64A 4QWDA 4FM1A 5DQHA 3ORYA 4M3TA 5CHGA 2IBKA 2DFFA 1ZBLA 3NBPA 5IIJA 4CJWA 1J54A 3HW8A 1S1XA 5J0PA 4MEXA 1DTQA 1WSJA 4QWEA 1ZQLA 5J2EA 4CJVA 1BISA 1JL2A 8ICQA 1ZQEA 4ZTFA 2WTFA 1ZQGA 1ZQZA 2YKMA 3JPNA 1EP4A 1DGSA 3Q8KA 8ICMA 4CF9A 2V9WA 5IILA 1XSLA 1VRTA 2WONA 5F9NA 4WE1A 4FLVA 4B9TA 3C94A 4FZYA 4TUSA 3U3GA 4I2JA 5EWFA 5DGAA 1EX4A 3K57A 4CJ3A 1C1BA 3M8QA 5KFYA 2OPQA 2ALZA 5KG0A 3T5KA 1HNIA 1S0NA 1CLQA 4OLBA 3SCXA 4CEFA 3V9SA 3C23A 1JLEA 4FJGA 4Q44A 2AGOA 1ZQRA 3ASMA 5J2FA 1MSWD 3RTVA 8ICJA 4I2AA 4YMNA 5DKWA 4ED1A 5HRRA 3L2WA 1J53A 3T5JA 3QINA 2I5JA 3AVLA 5KFXA 1RT4A 5CR0A 5KFJA 3V6JA 4IG0A 3VA3A 1LB2B 7ICNA 1S6PA 4RPXA 5CYMA 3PX6A 4DTSA 3DLBA 4I29A 4YVZA 2VG5A 2HHUA 8ICUA 2MUTA 9ICHA 3KHLA 2B6AA 1ZBIA 2BCSA 3PV8A 4CHQA 4KHNA 3HP6A 4NYNA 3MBYA 4GMJB 7ICLA 3KTQA 3V6HA 7ICTA 3OYKA 1JLQA 3HXMA 4N41A 1YT3A 3AVIA 5JS2A 3AVFA 4CEDA 2R8HA 2P5GA 5KG2A 4KMUA 4JV2A 1G15A 9ICGA 3MR6A 3RAQA 2AGPA 4QWBA 3WNEA 4F91B 2KZZA 4RUAA 1TV6A 2QKKA 2VWJA 4FCYA 9ICQA 4PQUA 4XRHA 2ISPA 3NF8A 4DL7A 5CZ1A 1C6VA 1LAWA 2F1JA 3EZ5A 5IINA 1SL1A 4MEYA 1ZQIA 2OPRA 1NOYA 3AVMA 3PY8A 4CK3A 2FBVA 1NK9A 4QZEA 4NM2A 4C8OA 4EYHB 1RTDA 4B9VA 3AVBA 4O44A 3QZ8A 2Q3SA 4I2HA 3WNGA 1KSPA 4CJQA 2OZMA 4YNQA 4GXIA 4KREA 4FM2A 3TAEA 3V7LA 3NFAA 3ITHA 4R63A 1RYSA 3HVTA 3NF6A 3V1QA 1S1UA 1EKEA 4XUSA 4J9QA 4W5RA 8ICKA 4Q8EA 4R66A 4ECZA 3DMJA 3LPUA 4FJJA 1EETA 3DRPA 2KN7A 3EYZA 3ZSOA 4F4XA 4KTZA 5IIIA 2HHXA 4KLJA 3DM2A 4H8KA 1Q9XA 1B92A 2XRIA 4DU3A 3MDCA 4G3IA 4YN4A 1BPYA 2E6LA 4IDKA 4FJXA 5J2JA 9ICMA 3GFKB 4YMOA 2AJQA 1LW2A 4K8ZA 2LYHA 2PY5A 2GWSA 4E1MA 1RBRA 2V4RA 3VA0A 3QNNA 4CF0A 2JZBA 3RJGA 3OYBA 1LV5A 5J2KA 3S3NA 1BGXT 1NJYA 1LWEA 3PW5A 4YXJA 1D8YA 3KKRA 2PFOA 5J0RA 3WNFA 3IS9A 2A1JB 5KG4A 2HW3A 3LP2A 1JIHA 9ICUA 2Q0ZX 1ITGA 4ECRA 3C1ZA 2KFNA 4CF2A 3QO9A 1HQUA 4DS5A 3I8DA 4QZCA 1N5YA 3LDSA 1SKSA 4F5RA 4M9JA 5J0UA 4AHTA 4IFYA 4CHNA 4JV0A 4PH5A 4RNNA 1ZETA 1NK5A 2R8IA 4C8LA 3RMCA 3L2QA 2VANA 4KI6A 4TUQA 8ICXA 1C0TA 2Z1IA 5J2IA 2X74A 3VQ4A 1NKEA 3HPHA 4IRDA 3HT3A 1HJRA 1H38A 2HNDA 3HVRA 4ECUA 2BANA 3NGYA 1VSJA 3HYFA 3MABA 3AVCA 3OYJA 4DS4A 1DLOA 3PO4A 3ZT2A 4RQ6A 2C2DA 3RH5A 2W8KA 1KTQA 2JGUA 4YFUA 5FROA 4K4HA 1Z26A 2I1QA 1D5AA 3KK2A 1ZQWA 4KO0A 5HP4A 4YXMA 4E7KA 3SPYA 3MFIA 1S0OA 9ICOA 9ICKA 4FJ5A 3TAFA 4B9LA 4CHPA 1UAXA 2FLNA 1HJPA 2HMIA 7ICOA 3G6YA 5EWGA 4F8RA 4M9HA 5IIMA 4CFBA 3DRSA 3MEGA 3RJKA 2NRTA 2UVVA 1FK9A 1QTMA 2X78A 1WCLA 1ZQJA 4LZGA 4KI4A 2BCQA 5I3UA 3OSPA 3DI6A 3UXOA 1NJWA 3L2RA 4E19A 4FK4A 1T4GA 1K1QA 1IKWA 3T5LA 7ICPA 4HYKA 4FYDA 2Z1JA 7ICMA 3PNCA 4FBUA 4PUOA 7ICVA 4FVMA 4F3OA 3LAKA 5KFDA 4W5QA 1WSEA 3M8RA 4M42A 4RNOA 4DTXA 3RB0A 2G8FA 5CP2A 2B4JA 4E7JA 2PFQA 4I2DA 2MUTB 2DFEA 4F4ZA 3OYIA 1GOAA 3SV4A 4BDYA 3RMAA 4M0AA 5HBMA 3P5JA 3ISNC 3MEEA 1Y97A 4NY8A 2W9AA 9ICFA 5J0XA 1JLBA 3KD5E 2UVRA 3GV8B 4FO6A 5KFPA 4E0DA 2KW4A 4Z6EA 2AQ4A 3TAMA 3V1RA 4PY5A 3VN5A 3K4GA 5J1EA 5DB6A 4QZIA 1NK7A 2XO7A 4QCLA 4KTWA 3JPPA 2BR0A 9ICLA 4EZ9A 2G8KA 2J6UA 1ZBHA 7ICIA 4M41A 5J2BA 2P1JA 3M8SA 3TABA 3PX0A 3SQ4A 2DPJA 2YNGA 4FBTA 3S3OA 4DL2A 2AGQA 3OYLA 1ZJMA 5J2MA 1TK8A 1QSYA 4X5VA 1U04A 4DTPA 5J0TA 3TR8A 3ISCA 3A2FA 3H7IA 3RRGA 3ZT1A 3MFHA 3M9NB 1A5VA 3AVJA 2IA6A 4CEAA 3RMBA 5DB8A 3DOLA 4ZH4A 4EBEA 2ZTEA 1KCFA 4BGDA 4ELTA 3V9XA 4XA5A 5L1IA 4DG1A 3KLEA 4OGEA 4CJUA 9ICWA 3FDSA 4KITB 3QEAZ 1NJXA 4TQSA 4ELVA 4ED7A 3MAQA 3QERA 1BCMA 2VG7A 4FJIA 4JLHA 1N48A 2IOCA 4RPYA 1TVAA 4FLXA 4I9LA 2C2EA 5D46A 4XIUA 3UIQA 1D8LA 3ZDDA 3DYAA 3HM9A 1XWLA 3ZT0A 2Z1GA 3KJVA 3K2PA 4F3TA 4DO9A 2EHGA 4BDPA 3KKSA 5HRPA 4KLGA 1ZBFA 1BIZA 1YTUA 3C2KA 4I7FA 3AO5A 4OKJA 4FLZA 4YD1A 1VSIA 3QEPA 4BXOA 1EXQA 1ZQOA 4E7HA 1QE1A 1X2IA 4DQPA 4QZBA 3TI0A 4W5NA 3IM1A 4UQGA 3GIJA 5KFRA 1S5JA 3Q8QB 3OS1A 4F92B 3M8PA 4IG3A 4IQVA 5BPCA 1QHTA 3OHAA 3AVGA 5HMMA 5E41A 5FDLA 4O3SA 5BOLA 5KFHA 3EY1A 2XHBA 1KRPA 4Z4EA 4HVJA 4CE9A 3AO1A 4KKOA 2XCPA 1A76A 1TKTA 4OVLA 4CEZA 1ZQNA 4MF2A 3RBEA 4RPZA 3NF7A 4AH9A 4NM1A 3L3UA 1S10A 4O4GA 2XGPA 3THVA 4QZAA 5IIOA 4UB4A 3PO5A 4N76A 2NRXA 2R8JA 3JPTA 4DU4A 3F73A 2UVUA 1XO1A 1JMSA 3H4BA 3V7KA 2DY4A 5FRNA 5BOMA 4NLZA 4CGJA 4KPYA 2BCVA 4CJEA 9ICSA 4CF1A 1U49A 4DTUA 4TUPA 4AHCA 5CA7A 2D0CA 3GILA 2LSNA 7ICGA 4PA1A 4M6WA 4JRQA 4IRCA 3VQPA 4FLWA 3ZSVA 3V72A 3T3FA 4DTMA 4B3OA 3LALA 2IS3A 4G1QA 1WSHA 5KRSA 3ZT4A 4M9NA 2FMSA 4KLLA 2NRVA 3PR5B 2PFNA 4J9PA 4CFDA 4KLQA 3C1YA 4B08A 1KVCA 1XS9D 4CEOA 1ZQPA 4KB0A 1RILA 4KN4A 4QZDA 1RTJA 3AVAA 1RZTA 1COOA 2W8LA 4FJ9A 3HPGA 1V9PA 1S77D 4KHSA 1RDCA 1BPZA 4O3OA 5CJ7A 4N47A 3V7JA 4O5KA 3ETLA 5KFZA 3GV7B 1ZBUA 3LANA 5KFFA 4IFVA 2E6MA 2F8SA 4RW4A 5L1KA 1MQ2A 3UQ2A 3V81A 3T19A 4FK2A 3RB4A 4C8MA 5JUMA 1T03A 5J2GA 4KFBA 1KEJA 5KG1A 4DMNA 4Z4FA 4J9MA 1X9MA 1Q8IA 4RW7A 2VA8A 3C2MA 4RNMA 1TGOA 4ECVA 1FKPA 4Z6FA 4ZHRA 1Z25A 2XY8A 4CERA 4CGGA 4I28A 1LWCA 4J9KA 5HRNA 4QZGA 2BKEA 5KT2A 4O3PA 2X6NA 4J2EA 4ID1A 1S1WA 2RF2A 1XSPA 1A5WA 4RT2A 3LWMA 4F2SA 4L8RB 4O3QA 5HP1A 4RQ3A 1WSFA 3RR8A 4RUCA 2RKIA 1BI4A 3OYAA 1Y88A 2VWKA 4GXKA 4Y1CA 1Z00A 2FMQA 2UVWA 3QLHA 3SQ1A 2PI5A 5KFWA 3LWLA 1RNHA 5J0YA 3LAMA 3KK1A 1RDDA 3QIPA 4H4OA 1WSGA 4YR3A 5KRTA 4F93B 4P4MA 1R0AA 3DRRA 5J0SA 7ICKA 3V9UA 3D0PA 5DB9A 3KHGA 4UB1A 5DMRA 1HYVA 4DTRA 3K58A 1ASWA 3E2EA 3OS0A 1U4BA 3K59A 3SZ2A 1TKDA 2O4GA 4RW8A 3SI8A 4ECYA 4CJPA 3QESA 3RH6A 1U45A 4HUEA 3G6XA 3RR7A 3JSMA 3ZDAA 3AA2A 4M3WA 2BGGA 3AO3A 2BPCA 3PW0A 1ZQAA 4AILC 4K8XA 1LW0A 1WLJA 2BQUA 2OA8A 4ECXA 4F5NA 4I2GA 3HPOA 3PMNA 4ED6A 2ZE2A 3C95A 4LH5A 3S3MA 5DG7A 1TVRA 4J9LA 4HUFA 3Q8LA 4DTNA 3O3FA 5JS1A 4NCBA 1NOZA 3BQ2A 1O1WA 1F21A 3Q8MA 1ZQYA 1LAVA 2XGQA 4Z0UA 3RJIA 3ZSYA 3MEDA 4W5TA 3ZSXA 1ZQCA 3V9ZA 5KFGA 1T8EA 3TQ1A 2FBXA 4ELUA 2F8TA 3L2VA 1A77A 1CUKA 3PR4A 3FFIA 4J9RA 4OGCA 3UXNA 4E7IA 1EXNA 4KLSA 2JEFA 3OJSA 2Y1JA 1SKRA 3ULDA 4I2FA 5C24A 4P4PA 5DQIA 1RXVA 1ZQKA 5F9LA 1ZQUA 1WNSA 5C25A 4CGIA 4J2AA 3HWTA 1XSNA 4JV1A 3U3YA 5HHIA 4FJMA 3LDAA 3B6PA 5J0WA 4DL5A 1VSFA 3O3HA 1XI1A 3C2LA 3BQ1A 1SZPA 3V1OA 1HUZA 4HUGA 4DSKA 1T05A 3B0XA 2BDPA 5J29A 1YVUA 3BJYA 1L5UA 4KHQA 2I9GA 3VQDA 1SKWA 2OZSA 3KD1E 4BDZA 4FXDA 1S0VA 4F5PA 3LP0A 1ZQBA 2HB5A 2IC3A 3B6OA 5J2DA 5KFCA 4DQSA 3IHQB 3CG7A 5EU7A 3FYHA 5KT6A 8ICLA 4BACA 3TFRA 4JRPA 8ICWA 1J9AA 3JPOA 1B22A 3VQCA 3AA3A 1U48A 3H40A 2QKBA 4DQQA 4CEEA 1CZ9A 4C8NA 3ZDBA 2IMWP 2ZJ8A 2W9CA 1Z00B 2G8UA 3L3VA 4DQIA 2XC9A 1DTTA 3RRHA 2BQ3A 2J6SA 2VA3A 5J2PA 3TFSA 3UXPA 1XHXA 4IQWA 2JLEA 4CJLA 4OKKA 3LP3A 4DTOA 5KFSA 3LZJA 5DG9A 3ZSQA 2W9BA 3ZSWA 5KT4A 3AUOA 1TK5A 4YP3A 3QEXA 1T7PA 4BE0A 3E01A 3KLFA 3CM5A 2PYJA 9ICCA 1NJZA 4GW6A 3EW9A 2PI4A 2D0AA 4CHYA 1KVAA 3DLKA 5K14A 5DQGA 8ICBA 3OYGA 4LD0A 4YD2A 5KFOA 3O4QA 3IRXA 1ZQHA 5KGXA 1ZQDA 2B21A 1I3AA 1S1TA 1HNVA 9ICAA 5KFMA 5TZVA 4RQ1A 1VSEA 4KHWA 4EBCA 3MGHA 4Q8FA 3B0YA 3G6VA 1CZBA 3I0SA 2J6TA 4Z4CA 3QETA 2OYQA 1LWFA 3AO2A 1RYRA 4CJ4A 2QK9A 4DSIA 3ZCMA 3DLHA 4ID5A 4Y1DA 3AO4A 2P51A 3C5GA 3MGIA 3H8SA 4KLOA 5DK5A 3VQQA 3ZSRA 1C7YA 3VQ8A 4TQRA 1CEZA 2KZ3A 4CIFA 5KFNA 4QW8A 1Z3EB 5DLGA 5J0OA 4PHEA 2P66A 2RDIA 3MR2A 4J9OA 5DBCA 4CEQA 4O55A 4EZ6A 3L8BA 3SUOA 1NKCA 2OPSA 1VSMA 1S9GA 4EEYA 1C1AA 1MQ3A 2GUIA 3SYZA 4CJFA 5KFTA 3TAGA 5SZTA 1BPDA 4LZDA 3PVXA 4FZXC 4B8CA 3OYNA 5HROA 2WOMA 3UQ0A 4R8UB 5KFUA 4MFAA 2HNYA 1U47A 4IBNA 3U6FA 1QSLA 3SV3A 5KFEA 2G8VA 1S97A 3G0ZA 3CQ8A 1GOCA 1UT5A 1NK0A 3ZDEA 3GIIA 4MFCA 3CM6A 2PFPA 3SUPA 3O4NA 1ZQTA 2IHNA 5DG8A 3NAEA 9ICPA 4O5EA 2ITGA 3LK9A 4O5BA 3KHRA 5CY4A 4MFFA 4UB5A 2BGWA 2A1SA 5J2CA 3UPQA 2ZD1A 1W9HA 4KAZA 1NKBA 5DDYA 3ZD9A 3GIKA 3KLIA 4DF8A 5KTQA 4ED0A 3RBDA 5KGWA 3SPZA 4NCGA 1RXWA 4BE2A 3RB3A 1AROP 2C22A 4ED3A 4CGFA 3RB6A 1NK6A 2R8GA 1RBUA 3BQ0A 4LSNA 5DBAA 1WN7A 1FKOA 2BE2A 5L1LA 1RTIA 1N6QA 8ICRA 3NDKA 1BHLA 7ICFA 1JXLA 3NH0A 1FXXA 3HX0A 7ICRA 2FC0A 4CJSA 1ZQVA 4O0IA 2YHAA 1S76D 1RDBA 4Z6CA 2G8IA 8ICGA 4JWNA 2W9CB 3KHHA 2PYLA 2VG6A 4FW1A 5KT7A 3GIMA 3K5OA 3S9HA 1YTAA 1TKXA 1S9FA 4IRKA 3JYTA 3AV9A 1TAQA 1S6QA 4AHSA 4Z6DA 2NUBA 1C0UA 8ICTA 2W42A 4CHZA 1WSIA 2ZUCA 1HPZA 4B9UA 1IKYA 2ATLA 1JLGA 4DLEA 2RDJA 1XHZA 4KLIA 4JS4A 3WNHA 4GLXA 4M3RA 5SWMA 4DQRA 3CFRA 4R8UA 8ICAA 1SUQA 2Z1HA 3ZT3A 1RBSA 1REVA 3AU2A 4K4GA 1JLCA 5C5JA 2ZQBA 7ICHA 2P6UA 1KVBA 1KLMA 1ZQFA 3C5FA 2XCAA 2R7YA 2Y1IA 4NCAA 5KG6A 8ICVA 1SV5A 3MXJA 2VA2A 7ICEA 4AHVA 4BXOB 3V6KA 2BPGA 3ZD8A 3NHGA 4KLUA 4R65A 5D49A 1RBTA 2YKNA 4FJKA 4O5CA 4K4IA 4Q0BA 2O4IA 8ICCA 2ASJA 3SUNA 5J2AA 2HVIA 4M3YA 4KB1A 4I2QA 4M45A 4RQ2A 3VQBA 4OKEA 3OYMA 1KDHA 1C1CA 4DWIA 2IGIA 4O3NA 1SL2A 4PPXA 4DSLA 4HHTA 4CGHA 4NYFA 4QZFA 3H08A 4CCHA 7ICSA 4E7LA 3RJEA 2ASLA 1I39A 3OY9A 1Q9YA 1BPBA 2OWOA 4DL6A 4DL4A 5L1JA 4F5OA 4CK2A 3MXMA 2OPPA 3OYFA 2QXFA 1UWBA 4QZHA 2JEGA 3MDAA 3SUQA 1L3TA 2ZTDA 1L3SA 5J0QA 5KFQA 4OPJA 4QWAA 5C42A 1ASVA 1HQEA 2W9MA 1N56A 2HHSA 4KLEA 4CFAA 3VQ9A 4ED2A 4E3SA 4RG8A 3MXIA 4ED8A 4FJ7A 4CJRA 3NGZA 2BHNA 4H4MA 3BDPA 3SNNA 4RQ8A 1TAUA 4GXJA 4M3XA 3VQEA 2FMPA 4QZ9A 1X9SA 4I2CA 4YQWA 4J9NA 4QWCA 3RWUA 1TL1A 4LVSA 4CK1A 1RPLA 4P2HA 3HK2A 1S9EA 4Q5VA 9ICNA 2F96A 4M9GA 1JKHA 4EP4A 3EPGA 4CIEA 4F4KA 2B5JA 4EP5A 2ZUDA 4I2EA 2E4LA 4CIGA
chains in the Genus database with same CATH superfamily
2CQBA 3PMLA 2OTLS 1R31A 2VONA 3TANA 3MAAA 2WTUA 2DB1A 3ULEA 3TAPA 4KRFA 4Y2YA 1IJEB 2FDNA 4ZPAA 1XC3A 2UXDK 4ID5B 1WCNA 3G71S 1BVSA 1S12A 4I6AA 1TL3A 1OJ4A 3RMDA 2JNJA 3L3CA 3H1QA 3QSYB 4JKGA 4Y2VA 1R0AB 1PAEX 1IKXB 4ECWA 1VR6A 5FJ4A 1XC9A 5CWRA 1MROB 5I3PA 3VGMA 2IHR1 3BKTA 1HNVB 2IM1A 5AKYA 3IAYA 3QRRA 1ZJNA 3IBWA 1VQ8S 3KWMA 1HKAA 2X51A 3OUYA 4NLKA 4LF9F 3MM6A 3TTCA 4JI8J 1X4AA 2KG1A 2E7WA 4BC7A 2O8CA 5J2QA 2KZMA 1YJ9S 2N4CA 5D4BA 3TAMB 2JXJA 3RAXA 3VQ7A 3GCXP 4MHVA 3FZLA 1Q8KA 1VQKS 1PBAA 4M7YA 4AHUA 3R7NB 4B6JA 3L4QA 5T7BA 3MEDB 1TUVA 2LXUA 2IYGA 4MQ3A 2Y9UA 1UFKA 3K5NA 4BC5A 4V19X 2DO4A 3OYEA 1PZNA 9ICTA 2CNOB 4PHDA 1RE1B 2M0NA 2V34A 3C6TA 4CI0B 2BM0A 3TVZA 2KQ2A 1S6OA 3TX8A 3OVNA 2KL8A 4ECTA 3OXLA 5THWA 4DR2J 3K1RB 1YUWA 2OLWA 4DOCA 4US8A 2V4QA 3IXQA 1SQGA 2FQQB 4FYWB 4BR9A 2EBGA 4YY3K 4FXWA 1Y3KA 1DHMA 1B9FA 1BQNA 5EE1A 3J80Y 3G8SA 2QA4G 2BCUA 4XDDA 5LL6Z 1QS4A 1IKVA 1GOBA 1SC3B 1QVFM 1TV9A 1YQHA 1GEHA 3QZ7A 2MKCA 3WX4A 4GV9A 1IQZA 3ISDA 1T9YA 2ACMA 1KLNA 4PCQA 3NOCA 1FJCA 5ADZA 3NG8A 1RADB 1KVKA 1N88A 5D4PA 4H0OA 4UBCA 4H0YB 1BQMA 3KXDA 3CFOA 1OY8A 1NM2A 3Q86A 3OJUA 2NUHA 1UZHA 3V9WA 2DTUA 2RHFA 1SS6A 4W5OA 1LXNA 1HMVA 3TJAA 2VPXB 3M1VB 4LRDA 2FPLA 3B82A 5KPRA 2ACYA 4AQYF 3EEQA 1UMJA 2CPEA 1NOMA 1EX8A 2GAHC 8ICSA 5ALKA 1Q79A 2O8BB 4MMOA 1LOUA 2MQPA 3ZZZA 1W2BR 2EX3A 2MZTA 8ICZA 5L9XA 3NH2A 4DU8A 2L41A 3UFCX 1A5XA 5GADI 4MAKA 2M7SA 4CJTA 3N6MA 1VSHA 2W41A 3HZGA 1BG3A 5AICA 2LU2A 5IOLA 2W40A 3WXLA 2W7AA 2AX0A 4FLTA 1XU4A 3H25A 3D2QA 2IAJA 2AU0A 4PYDA 1VQNN 1RWMB 4WFBQ 4CHOA 3NWRA 3EKSA 2DF4B 8ICOA 9ICRA 4WIQA 4QZ8A 3DAWA 2IJFA 3TUZC 3QEIA 3EPIA 4FJLA 5AKIA 3KUGA 4DTJA 4B8AB 4N5SA 2CGKA 5IC6B 1BUPA 2JEIA 4WFAQ 5HANA 5I4MA 4DFJA 2M9NA 3JPQA 1RTHA 1K8KA 3PKYA 2J4RA 1DK3A 3CJ7A 3CJSA 5A76A 3SQ0A 4UZCA 3DRPB 4DFKA 2DGWA 4PGXA 4DR1F 5CYQA 3Q7CA 2PD1A 1J2MA 3OVSA 2W1BA 3AGRA 1KC8O 3SQOP 2A2DA 1ZQXA 1NDLA 3HSTB 4YN3B 2JVOA 2RHSB 4YFKA 3SJHA 1Q46A 5ALXA 1X4DA 4A46A 4ZLJA 1R59O 3EDRB 4BRDA 4PXCA 1S72N 5HN0A 5GVQA 2EQYA 1HYZA 2YI1A 1BC6A 2DGUA 2E1RA 2GV1A 4ZMMA 1IIPA 1TELA 4WPAA 3SQ2A 1YBAA 3ZDCA 4MO4A 9ICJA 4NLPA 4FS2A 1PSDA 4Q45A 1F60B 2ASOA 1PYSB 3THPA 2ZXIA 1YJRA 4HTUA 2VPWB 3GFZA 3NVKA 3NNHA 1K8KB 1M5OC 2UUCK 2KG0A 1DAXA 2XSJB 1NK4A 4GC6A 2ZBIA 3K5LA 4JK1A 2FHJA 4ETXA 3VCDA 2WZ1A 4FSVA 2DNLA 4DV5F 1HWIA 1E6VB 2E1PA 3KHYA 4EIAA 2OGUA 4I69A 1YRTA 1JMTA 3OD2A 2QL9B 2E5LJ 2HHPA 3P31A 3IR7B 2V69A 4BX9C 2DXDA 5CZ2A 5HQMA 1IH7A 1C0MA 1LQ9A 2KHCA 4ECQA 3DLEA 1NGEA 1RQLA 2A3ZA 4UZBA 1GT8A 4LBHA 3UCGA 1J5OA 2YWGA 4HACB 3HFVA 4DOAA 1D4XA 4DL0C 1W7AA 3NGTA 1IM6A 2MSTA 3SBGA 3BN7A 1S9GB 3MURP 1M90O 1HRHA 1O0PA 3IGVA 1NAQA 3P5BP 2MZSA 1ZQMA 2CPJA 2HOQA 4U7UD 3NCRA 1U2RA 2NZ4A 3FGUA 4BCAA 4K4XA 4AP9A 2BABA 4KGVB 3OTBA 4O5FA 5EVZA 4WJ3B 5HRSA 1ILYA 2XZDB 4HHJA 3NVYA 3ZEUB 3NGDA 2CVIA 3AVNA 3CC4N 2O8DB 3NE6A 2OFHX 4MKAA 1OYEA 3C6UA 3GP9A 2JH1A 3MPUB 4B3TJ 4F50A 4H5WA 5A0YA 2V52B 1J27A 3I4HX 2QFIA 4J7CA 1RHUB 4O9MA 5J8YA 3NNCA 2UZAA 2YNFA 3G87A 1O51A 2YNIA 1IVZA 4ZVPB 3HF5A 3SCJE 3QEVA 1JX4A 2YCHA 3CI5A 1SQKA 4FWRA 4FOIA 3BH7B 1JALA 3BV8A 2KTQA 3DLRA 3JPSA 4K4VA 2FBYA 1WI8A 4F25A 1YX2A 3NCIA 3Q8VA 2XY6A 1E6YA 1OH7A 3QT7A 2YXLA 2AZ3A 1L7OA 4IKFA 4PHPA 2XTJP 4W90B 5F3ZA 5AQKA 2PDAA 4QWDA 3MMAB 4FM1A 2E8NA 3TA2A 3ORYA 3VQSA 2IBKA 1RKIA 2OD6A 3BO4A 2MKHA 1H2TZ 1NNEA 5IIJA 1O13A 4CJWA 1KS2A 1S1XA 2KHVA 3CW2C 2GUPA 2B3TB 1L7MA 4O8KA 3VEOA 1WSJA 4Y2IA 4WP9A 2D74B 2VG6B 1JL2A 8ICQA 5JTIA 4ZTFA 1ZQZA 4P9SA 2IJNA 4PEOA 3LH2S 2AF6A 2DISA 3MCSA 2U1AA 3CCLS 1ZTTA 2DRBA 3L09A 3QWUA 1YF5L 2OEMA 3WQUA 2HBZB 4B9TA 5JVGQ 1RM6C 5H9EJ 3O9TA 1WC4A 4TUSA 3SENA 3U3GA 1RAIB 3L0QA 4I2JA 5JU5A 5EWFA 4Q2LA 2XS2A 1EX4A 3K57A 1C1BA 3CERA 2OPQA 4CO1A 1YI2S 1WF1A 1ZAWA 2RRNA 3W9HA 3C23A 1B99A 4ES1A 1QAIA 1P9YA 3UKUB 2DY9A 8ICJA 2JH7A 4A62A 1X4HA 1URRA 2H1YA 5HRRA 5EOYA 3IG5A 3T5JA 3QLHB 1EQYA 2H5JB 5BRFA 5KFXA 1SC6A 1R6VA 1Y5NB 1V5IB 1PAUB 3V6JA 3VA3A 4AYBC 3OL8A 2IRUA 3B4DA 2GA7A 3N79A 3L7OA 4RPXA 2W03A 5CYMA 4I29A 5F0WA 4IQXA 3HZ6A 2B9YA 5IQQA 4DUYK 1Q8BA 4YVZA 3T7ZA 2MUTA 2IRXA 2H9ZA 3FZKA 4DV3K 5IT0A 3KHLA 2B6AA 1NGHA 1ZBIA 1BU6O 3BQ7A 3PV8A 3SXLA 1FT8A 3HP6A 3BGRB 4Y0WA 4GMJB 1TQLA 7ICLA 1Y9OA 1JLQA 2E1EA 4N41A 4JOUA 1YT3A 5E5NA 3DOKB 2PFFB 5CYJA 2XWXA 2Q4TA 3CCJN 1VFJA 5CYQB 3QU9A 9ICGA 2KIWA 1ZAXA 2RQKA 3UKUA 4DR3K 3WK7A 1U2VB 4XRHA 1WG4A 2XB2D 5CZ1A 1MMNA 4MEYA 2BE9B 4FE3A 5GAEU 4NXMF 4XEIA 3KJFB 1TU0B 4PL7A 3DXKB 4PABA 2BJ3A 2FBVA 1D1UA 2KHDA 3THYB 2KEYA 2B51A 4JKEA 3KWIA 3VF6A 2W2PP 2JC1A 3GOIA 2NLWA 4F72A 4C8OA 4EYHB 4B9VA 3AVBA 3QZ8A 3JTPA 3BS9A 1UHUA 1A0OB 3KK7A 2D9PA 4FM2A 3ITHA 5AK3A 3RUBL 4NLVA 3MM9A 3A13A 1BWVA 5B0DA 4J9QA 2I5HA 4Q8EA 3KK1B 1WOQA 4FJJA 3RF9A 2FVSA 5CEHA 2KN7A 1QVGR 3B8HA 3ZSOA 5CZXA 2HHXA 4KLJA 3DM2A 3PDNA 2M8DB 4TN2A 1Q9XA 2XRIA 3FZFA 4DU3A 2K4HA 2ZHBA 5HL7Q 3CSKA 4YN4A 3OL9A 4NLOA 4IS7A 3MMBA 5J2JA 1K8AO 5ALJA 2ZUGA 2AJQA 1LW2A 2N3OA 3L5KA 3OPXA 2V9KA 2PY5A 2GWSA 2AJ2A 1SJQA 2V4RA 2ZHOA 5LMNK 3M4XA 2XMAA 1SJ3P 3THYA 2FHOB 3R5DA 5F3XB 2ASMA 1R6YA 2GMHA 4DKWA 3RJGA 3OYBA 2RS2A 3QFUA 1BGXT 1AXQA 1LWEA 3PW5A 2PFOA 3WNFA 3IS9A 2A1JB 2DXEA 9ICUA 2B4UA 2Q0ZX 2XMWA 4F3MA 1XQSC 4WIIA 3R1XA 3NXZA 2AJFE 1N5YA 3DOMB 3HTVA 5GADP 1RAJA 5AJ3K 3A1YG 4IZ9A 3UE2A 1DGKN 4IFYA 3J81U 2EVZA 4EMDA 2MZQA 3N4QA 2R8IA 1JLEB 4B1UB 3L2QA 4KI6A 2CGJA 3M6ZA 3DYAB 2H3VA 3W66A 4JKAA 2Z1IA 4LFCK 4DXLA 4EAHD 5AQVA 3VQ4A 2MPUA 1NKEA 5A6WA 5JICA 4IRDA 2YPYA 3NMAA 3HVRA 3QMLA 3CD7A 3NGYA 4LF4J 1OPIA 3IC1A 3O44A 2MJUA 5C7PA 3P39A 3VF2A 2ZBCA 5C0YA 2QI2A 3CJ1A 4RQ6A 2V0NA 4BUGA 2W8KA 4KH4A 1KTQA 1Q86O 3R1LA 2FI1A 2O8FB 3A8JA 3MCMA 1ZQWA 3U27A 4YXMA 2FVCA 3ITHB 4B3RK 2ZOFA 2HRUA 1XK8A 2HWTA 2NCKL 4CLSA 1L7PA 2VQFF 9ICOA 9ICKA 1B70B 5HLFB 1HIYA 2D1CA 1UAXA 5DM6Q 1BQNB 2ZM6K 4WXOA 1S59A 4A57A 3OFGA 4CFBA 1WWVA 2PMHA 2CPRA 4TNOA 2JHDA 2PAVA 4LZGA 3NRBA 2BCQA 3MI7X 1N34J 3N4WA 3L2RA 5AE2A 3WKAA 1ZM4A 4FK4A 1RU2A 4O23A 1RBAA 3H5UA 4U67Q 7ICMA 5F41A 3PNCA 4FBUA 2NLXA 1FERA 3ZX0A 2RKIB 2BRKA 4F3OA 4LR7A 5KFDA 2MLYA 4ZVQB 5DDQC 1GO3F 3GG1A 2A42A 1WUDA 3MDFA 4M42A 1YVFA 4RX6A 2V50A 1S48A 1WEZA 2DHXA 4MDBA 2PFQA 5DRKA 2F4VK 2DFEA 3OYIA 4BDYA 5HBMA 3PJWA 3ISNC 1EWRA 1HBMA 2CG4A 1T44A 1Q7YT 3OTQA 1JLBA 4DR6F 3R7SB 4ILLA 3O6QA 1TYQA 2KW4A 4CLFA 4Z6EA 3TAMA 3GB0A 5J1EA 3K4GA 1I94J 4QCLA 1YJNN 2FF3B 1RACB 2E8AA 5T14A 1DTQB 2BR0A 2CH6A 2DGOA 3FFIB 4M5DB 7ICIA 2P1JA 2WAQD 3M8SA 1P8GA 5AQZA 1XNRJ 1LW2B 5EUHA 2BTFA 4FBTA 3S3OA 3HT0A 1ZJMA 4N7TA 2UUWA 4BC3A 2C2ZB 3TR8A 2AV5A 3ISCA 4WKRA 3E9OA 3N6LA 2C1EB 3KFUF 4JD2B 3TPQA 3SBMA 4KSEB 3US5A 3AVJA 5DB8A 4ZH4A 2E9TA 3GPAA 5AQMA 1L6NA 5BPMA 1FRHA 1RT5B 3J7ZO 4C48A 3KLEA 1LW0B 1ZRNA 4KITB 1KBRA 5F8JA 2QMWA 2B7BB 3WZ0A 1ZC6A 2IPOB 3M1YA 2Z58B 4CNQA 1UVMA 1TVAA 3LL3A 4XIUA 3JB9k 3MECB 3DYAA 4NA3A 2WF9A 1IBMJ 5AFUA 1LVHA 3FBCA 3KJVA 2PFDA 2X3GA 1VQOS 2OPRB 1HFEL 3HHEA 4QYZK 3CWJA 4FZVA 3JSMB 1QE1A 1S9EB 1MDUB 4QIWF 2POKA 4NO7A 3Q8QB 1A0PA 5EN1A 3DV9A 3L4PA 1HWKA 3VMFB 4CT8A 4IQVA 3KOOA 2L5YA 1IKVB 3OHAA 1GXUA 5HBMB 1VQSA 1BOTO 4O3SA 5BOLA 5KFHA 1RAOA 1U6FA 2UXBK 3EY1A 3T1HJ 2XHBA 5B0BA 2ASPA 1HPZB 5I3UB 3ZTRA 2W2OP 2D3UA 5E3AA 4USJC 3ZTSA 1Q4RA 4JI3J 4PG4A 3PYGA 1A76A 4OVLA 4CEZA 1ZQNA 3CCLN 3RBEA 2Z2YB 4NM1A 1NPKA 3TR5A 3W2WB 1S10A 4O4GA 4HHHA 3TTDA 4QZAA 1RWVB 3IR5B 4YS2A 5IIOA 2BACA 4QIVA 3PRVA 1JMSA 2YMLA 3TNVA 2ZWHA 3OFHA 1XUPO 5HMXA 4P71A 4CJEA 4OI4A 1ZM9A 3TADC 4DTUA 5ALZA 3HKZD 4DR6J 2WVBA 3C29A 3GILA 4FYXB 4M6WA 2QWRA 3HVTB 3E1YA 2MEWA 1V38A 2KVSA 4DR4J 1HD1A 3V72A 3WK9A 2FHMA 3T3FA 1GLJO 4DTMA 2VZ9A 1WKKA 2WVDA 1BXNA 2IS3A 2RJZA 2UXBJ 4WBFA 2FMSA 3EGVA 1R8PA 2PFNA 2DHSA 4K25A 4B08A 1KVCA 3I9ZA 4BVPA 3TKAA 1N33J 4ZVRB 1YJ9N 5AXKA 1FFVA 4M5HA 4RW7B 2Y3YA 4KHSA 3CCES 2VIXA 2F2AB 4O3OA 5CJ7A 1ICEB 4N47A 5G5HA 4ANDA 3ETLA 3J81Y 2LDIA 2V6AA 5KFZA 3TSPA 2GZOA 4ACOA 3GFYA 2QA2A 3IFEA 5A2QU 3BZKA 2F8SA 4RW4A 3GLJA 3DM2B 3WXMB 5L1KA 4ANCA 3UQ2A 1EARA 3TADA 3V81A 4NL9C 5E3QA 5ALMA 4C8MA 5JUMA 1EETB 3M8WA 5J2GA 1MN8A 1KEJA 5KG1A 1P9QC 4ZVOB 4DU7A 4DMNA 2LHTA 1YBUA 6AT1B 1X9MA 1BUXA 1Q8IA 2ZDOA 4O8UA 4WWSA 1NMNA 2HFUA 1F0XA 2Y0SC 5CABA 2XY8A 5LJ5Y 5M1NA 3SAFA 1LWCA 4C3LA 1U26A 2BKEA 3FQLA 3ENVA 2RLTA 1VDHA 2QLWA 2X6NA 3D6FB 2HOFA 4ID1A 4NA1A 3VAJA 1UVIA 1GTHA 4RT2A 4F2SA 4L8RB 4O3QA 2B6GA 5HP1A 4P72A 1T3VA 4PG8A 3ENBA 1QZ5A 1W26A 1Y88A 4RUBA 2HDOA 2K7JA 2XI3A 3KD3A 1DLOB 3C15A 2PI5A 5KFWA 2BBEA 2D9OA 5J0YA 5AQPA 3KK1A 2PGCA 1YHQS 5KRTA 3AQFA 4F93B 2XLIA 4DV6K 1R0AA 2Z2MA 3LGNA 4NI2B 2PIIA 4IOAL 4QBUA 1HYVA 2DNKA 4NCGB 4FO0A 1S1TB 3HOTA 1U4BA 2XZTB 4CZCA 2OEHA 1UTAA 1VRQC 3O4WA 4DHYA 4CJPA 3QESA 1DY3A 1U45A 3AMZA 3SEIA 5AI8A 3CJBA 4M3WA 1OYDA 3AO3A 4CLLA 2JSXA 3NEKA 1JXVA 3DN9A 2ZBPA 1FFWB 2GEMA 2QM1A 2CAJA 3IS9B 1ZQAA 2W3RA 4AILC 2C2KB 2OA8A 2DNRA 4I2GA 2DIUA 3HPOA 3AD7C 4X62J 4URGA 2ZE2A 3C95A 3S3MA 1FX4A 3QQCD 2P9GA 2R42A 4OL8A 1VQ7N 1NH7A 1RLDA 3SCIE 3LTOA 1J5EK 1S6UA 1N54B 3R97A 3Q8MA 3HHLA 1ZQYA 1LAVA 2XGQA 3MD3A 1QJHA 4XPCA 3QJLA 4K4SA 1H73A 3MEDA 1X6IA 4W5TA 1D3WA 3ZSXA 4J8FA 4YHHJ 2YX1A 4PJ0U 2IOFA 3DC2A 3KKAA 3V4MA 1A77A 1CUKA 1HHQA 4IFYB 3R2DJ 4CLUA 1NMDA 1WG8A 4Q0BB 3NAIA 3MPVA 1UPHA 3UXNA 4HLBA 4E7IA 5KL1B 3ID8A 3ULDA 3PZPA 5M1OA 4B3SF 5JJBA 4P4PA 2OO4A 2CNKB 1ZQUA 3GJRB 2YQEA 1QZ6A 1FRMA 3UI3A 4MYTA 2VHGA 1P7DA 5HHIA 2EKNA 4FJMA 3IG1B 3CCQS 2W7OA 2G0AA 2YWFA 1Z4NA 5J0WA 5IC4B 3O3HA 1XI1A 4ILMA 1SZPA 2WBMA 2HZCA 2BZFA 3BUZB 5F8MA 2B9WA 4BRQA 1T05B 3AN1A 4DV2J 1YVUA 3LPYA 3BJYA 1L5UA 2I9GA 3VQDA 1RSCA 4C98A 1RZMA 1S0VA 2YWEA 3LUYA 4WQ5A 3D28A 5KFCA 2ZH1A 3MTJA 5EU7A 2BX6A 8ICLA 3MWTA 4P2MA 4A5BA 2E1FA 3TFRA 2V2QA 4JRPA 3SLCA 8ICWA 2HZAA 4LVNP 4TY9A 4CEEA 3A3OB 4AE5A 3ZDBA 1ZM3A 1QM9A 3CO9A 3QNWB 1VC0A 2FJXA 2G8UA 4DQIA 2XC9A 3CJ2A 1DTTA 5IT9Y 5CHCB 2G06A 2WF5A 4OKKA 2RRBA 3VAIA 2W4PA 4I2QB 4DTOA 4BREA 3CDAA 2NO4A 4KQZA 3ZSQA 1N6QB 4X66F 2W9BA 3ZSWA 4DV2K 4IWVA 3M6GA 3O08A 5DO2A 3B54A 1IXKA 1RTJB 1HQEB 1N2XA 1TUYA 3EW9A 2MSSA 1UVNA 4KH0B 2D0AA 3I8BA 3GZ7A 2NZCA 4X4TA 3DLKA 1VMBA 1VGYA 3OYGA 1PVQA 2ZDPA 4AD6A 3H0PA 1TL1B 2GS8A 4YD2A 1RFQA 4ZLLA 5KGXA 3DHXA 2P35A 1M5HA 1S99A 4FFDA 4WK1A 2ZH7A 1I3AA 1VQ4N 1HNVA 5LMNJ 5TZVA 2R7VA 1N5QA 2H54B 2EC0A 1MWMA 1DEJA 3B0YA 3G6VA 3I0SA 1WI6A 3QETA 3AO2A 1RYRA 5J2MB 4IOAQ 3BF1A 3HKWA 2JMGA 3MWBA 4LT6A 2KVQE 4CE6A 2MGZA 3UR0A 2B4OA 3MGIA 3VQQA 4P73A 3ZSRA 4TQRA 4YOVA 1WKLA 2CDQA 3ADAC 5KFNA 1RWNB 2YQ0A 5SUHA 4BVOA 1GLFO 4FKXA 4OPAA 5J0OA 3OBYA 2RDIA 4J9OA 2VFVA 4OI1A 2WF6A 3EE9A 4DCHA 4EZ6A 2G2ZA 4DX5A 4LF2A 4F71A 2Q1LA 2LKYA 2MKYA 2OPSA 3WK5A 3A0IX 3D2FB 1HNXK 3CQXA 2FF6A 3KMQA 4GVBB 4USUA 4ES2A 3SYZA 3BR8A 4HTIA 2JHEA 2QWOA 4C0ZA 4LZDA 1JLCB 3W9JA 2OSQA 1U1MA 2R4FA 1V9OA 3B78A 3GJTB 4MN4C 3HRGA 4X62K 1MA7A 3WQTA 3SV3A 4HR2A 3OL6A 5KFEA 1ZA1B 2G8VA 4MH8A 3G0ZA 5D8HB 1FXDA 3PFEA 4MFCA 3FUYA 3W8PA 1KDNA 4IG0B 3BO2A 2QWMA 5K14B 2Q43A 4OJOA 5LXYA 5BN9A 5DM7Q 1LWEB 4O5EA 5IWAF 2ITGA 3LK9A 2DR6A 4O5BA 5AQUA 2YKOA 3KHRA 1VBKA 2WB1C 2F4FA 4E2FB 3AODA 4Y2SA 5CZVA 4DI6A 1HPMA 1D09B 1WEYA 4DF8A 3HULA 2IY5B 1RDWX 4NCGA 2CJAA 4JI4K 1RK8A 3RB3A 2O8BA 1OSCA 3BYRA 1RT2B 4ED3A 3RB6A 3N01A 1HNWJ 3D6TB 1VBXA 1XNQJ 4LSNA 3HSCA 1CC8A 2A18A 2G1DA 1WN7A 1FKOA 2BE2A 1X4CA 2A3JA 2Y1LB 3MHYA 1N6QA 4FNHA 3FC9A 3NDKA 4HAIA 4RBVA 1OO0B 3NH0A 1HNZJ 1FXXA 7ICRA 1A7GE 4UTGA 3CXCM 4O0IA 3BS7A 1S76D 2PMZC 1UWAA 2Z2LA 3ISZA 1X31C 1PK1B 8ICGA 3KHHA 2VKQA 2P6SA 2VG6A 1QQOA 3VTIA 1VK3A 3WC0A 4KBIA 1PC4A 3IDHA 1R89A 4UOCA 2PBDA 1U1PA 2YTUA 1NPPA 2GW8A 2LM1A 5KAFU 3MXHP 4N77A 8ICTA 4CHZA 2ZUCA 3TJ8A 1XR6A 4C7ZA 1IKYA 1VQ9N 4GLXA 4QS8A 5AKZA 3W3DA 3K1ZA 4DQRA 3CFRA 4R8UA 1PG5B 1K44A 1EZZB 3DEEA 1YJNS 5AXMA 1REVA 2I1RA 2E8PA 1JLCA 1SV4A 2AEFA 2P6UA 1KVBA 4LF9J 3KVGA 2NS1B 2XCAA 2D8CA 2Q31A 2X1AA 4NCAA 3SFUA 2B7CB 5KG6A 2EDUA 5BXIA 3I5BA 3M8YA 2CN1A 3MWPA 1RHKB 3NHGA 2IVOA 1F6TA 2P2CB 4YB1P 4R65A 4Y2QA 4IJAA 2VF3A 2QLXA 2I2YA 2YKNA 4G9ZA 3EXYA 1DQ8A 1SV0A 1Q78A 2HIYA 2E2PA 2G0JA 2D3OR 1B4SA 5BPLA 3I5CA 4DV1J 5J2AA 4M3YA 4DPWA 2EZXA 1R27B 4OYPA 4P2FA 2LCWA 3UKRA 2MKJA 4F36A 3QGPA 3VQBA 3RZAA 2CJXB 3AY9A 3BPSP 4OKEA 2LQ5A 3OYMA 2ZEJA 4O3NA 2MA1A 3AJDA 2XNRA 4KO0B 1SIZA 3O80A 4DPTA 4HHTA 3NP5A 4QZFA 5ADXH 1WJ9A 2X1FA 7ICSA 3HSDA 2KYXA 4EX7A 1QD1A 1NBEB 2UXCK 1REVB 2QE5A 4B1VA 3QMQA 4CJ7A 2ZJRQ 4WQ5C 3MD1A 1VC6A 2ZJQL 4CK2A 5AKHA 4WP3A 2KK0A 3K8VA 1UWBA 3OFFA 4KHMA 4PG7A 3MDAA 3EDQB 1L3TA 1Y5IB 4YUDA 4LIWA 1YWXA 4QWAA 2AP6A 2NR0A 5JXSA 3TZXA 3VETA 2K4EA 1HQEA 2W9MA 2FJ6A 3BBCA 2HHSA 2GGPA 3ILIA 4ED2A 2BJ1A 4Y2MA 5B66U 4ED8A 4CJRA 3CIPA 3O5TB 4JAXA 3C3LA 1KQGB 4RQ8A 2A10A 3FZBA 2FMPA 4QJFB 2ABYA 4YQWA 2WB4A 4AFFA 2CZVC 2RAQA 4C7YA 1TL1A 2RB7A 1RPLA 3AAWB 3HK2A 4A5AA 2B8PA 1YXQA 1OVYA 4LFCJ 3Q7BA 4M5JA 4W98A 4F4KA 3A0HU 2MKSA 3UE5A 3ZNUA 3H1VX 3VCBA 4I7FB 2WBNA 2AYEA 4NXNF 4LF4K 2N3LA 1IBLJ 2V94A 4ZIVA 1N32F 4UAWA 2QL7B 4GVMA 2XSFA 2OSRA 2MAXA 3AU6A 1ATNA 3AARA 1ZQSA 4DR2F 5E3CA 1CXUA 4FJNA 5FD1A 1REGX 4I9QA 5KI6A 3C14A 2ZJ5A 3CCWA 1K73O 1IG8A 1O08A 2QYGA 2RF2B 3LPTA 1PVPA 4UASA 1E6YB 1UPPA 4KLTA 1X4GA 3J80U 3CCUS 2OIHA 3G10A 4JHDB 2N4DA 3QNOA 1JLAA 1L3UA 4KTQA 3HD2A 4FP9A 4CJKA 4AL7A 2QLFB 3VZIA 4JWMA 1KC8T 4ZP8A 1N33F 4OLAA 1RYUA 3V5RA 1VQLN 1JI7A 3O9QA 2C2RA 3U1NA 3IO1A 1RHMB 4MKVA 3R6GB 4KHYA 4NEYA 4IR9A 3T1HF 1K9MT 4Q7AA 4OJHA 4RW9B 1NB2A 4WP8A 4EYIB 8ICEA 5CH7B 3F5TA 4PWDA 3KLHB 4CH0S 1PVRA 1VSDA 5HJYA 3G4SS 4H0PA 2HBLA 4FJHA 5AQQA 3D1HA 1X1PA 1M1KO 4RQ0A 5J2HA 5BN8A 1JJ2M 4V19J 1IG9A 4DUYJ 4USKA 3R5CA 3J7YI 4OHVA 3IRUA 2G8HA 5AQJA 4CVNE 2LMRA 3K5MA 4CM0A 1XMOJ 4HT7A 3M6UA 3RVCA 5AKJA 3MAAB 3O3GA 2R18A 4IG3B 1NGBA 1HBMB 2PXIA 2DTJA 4UOGA 4B9MA 4R5PB 1MW7A 4UQTA 3EWAA 1H0HB 3LVVA 1IKXA 4OQJA 3JPRA 1QCKA 1QSSA 1ZPVA 3MOZA 3AGKA 4QAGA 2UU9K 3GV5B 3AT1B 2ZTCA 3LP0B 2BKNA 3JTNA 3I96A 1LEOA 4WFXA 5LJWA 5ETMA 4UARA 3ZZ0A 1U8WA 4Y2XA 3UCUP 3UVJB 3QO9B 4Z37A 3AB4B 3Q8SB 2IMOA 2FSJA 5FRMA 4KV8B 5G4DA 5H9FJ 3AQEA 4Y2TA 2GAGC 3W3SA 2BQRA 3GBTA 4WFZA 9ICEA 4PKHA 1G2EA 5KT3A 1JWWA 3R8EA 2JZBB 1J5OB 1SZHA 1B7FA 2ZNYA 4E89A 9ICVA 1PYTA 1RP5A 4DSFA 1RWOB 3VGSA 1ZYQA 1T9VA 1X3MA 2BCRA 3Q8PB 1JCEA 3H45C 4ZJLA 1S7HA 2FY1A 8ICPA 2EG2A 2UV8A 4O3RA 1ZH5A 3PW7A 4LSLA 2WFAA 4FLUA 2QGFB 1JXBA 3ZLJA 4ISFA 3PW2A 4AQYK 4NV0A 3D68A 2FVRA 4TXSA 1RDRA 4C0OC 2LFVA 4F7VA 3NRWA 3C21A 3AA9A 3DKDA 3TAQA 5ALPA 3MECA 3OTCA 3P5TL 4LRFA 1XNQK 2IHMA 3Q83A 4KE5A 3PSPA 3EZWA 1VSKA 4P4OA 4JI0K 2VOOA 3H8WA 1HR0J 1T6DA 1DQAA 1PYOB 3AD9C 1HBUA 1S79A 2YBVA 2XMUA 3PLAA 1HNWF 2WSFC 3EGZA 5AQTA 4A8FA 3DCAA 3F0NA 3LDPA 2P5OA 4PAAA 3D9BA 4J03A 5ETNA 2FXUA 3NRZA 8ATCB 1K73T 3HJFA 4YOUA 2B4PA 3DRYA 1MU2B 2QO3A 1FJ7A 1CRXA 4B3MK 4KMOB 1D9FA 4PXEA 4UB2A 4ZITA 5F3TA 5CQGA 4FJ8A 2HHQA 3HOSA 3GYNA 1BNOA 2I9SA 4MO5A 4DQ8A 2ZH5A 4C23A 3J7A1 1F5AA 5I3QA 4FLYA 2UUBK 4H0TB 4KHPJ 2GV9A 3OS2A 4AHRA 4I0WA 3QUTA 1K1SA 1KLMB 5HVHA 4I2BA 5IV4A 4R0JA 1W25A 2EEYA 4C4RA 1IV8A 1FJGF 4Y0FA 1SIWB 3NCQA 1CC7A 3GCWP 3AM9A 4LFBF 2F1IA 4OZ0A 1I3OB 4M9LA 2DH9A 2CQ1A 3CCRN 1CULA 2VQEK 1QH9A 5DLFA 3H6EA 5EWEA 1VRUA 4HH1A 2R8KA 1NHKL 2LVWA 3OXFA 9ICXA 2EBEA 4NXZA 2Q0RA 5AIBA 2R7WA 2QSFA 2F9WA 3T6JA 3HHDA 2K1RB 5ETPA 2E7XA 3EVWA 3IWXA 2KIVA 4BBYA 3U26A 1RABB 3AA5X 1NSAA 4DV1F 2GO9A 1XN9A 5AIAA 5ALTA 1ZS6A 2MTLA 3TWHA 2RQMA 2AYBA 4CECA 4C3KA 3CHWA 2W9BB 3NASA 4PGYA 3K17A 3THTA 4Y28C 1JLGB 4J91A 5T7LA 1WAJA 2DFLA 3H4DA 2DCLA 2X3DA 2PC6A 4NLGA 4JI5K 2DJWA 1SWWA 2QMXA 3DXBA 3MN7A 3J7YU 3QBXA 4MK9A 1NK8A 2YNHA 5G5GA 4HDHA 2HOIA 4DOBA 4Z4HA 4UAUA 1OH8A 4NZ0A 4USMA 1DKGD 2MYFA 1SWVA 3W5ZA 3ISBA 3MN9A 3C6HA 5HNKA 2XG8A 4RL1A 4PGQA 4X64J 4JK7A 4NLQA 4K2XA 4JNEA 4IEEA 4IOXA 1VQ6S 1HHSA 2IDOA 3GIRA 5KAIU 1L3VA 2ZH8A 2R3VA 1F2GA 2FLPA 1RJJA 2RT3A 4WF9Q 4CLZA 4HHUA 5H9EK 5AQIA 2MB0B 2X7IA 5CHIA 2JEJA 1WB9A 3RSEB 4F5QA 2CADA 3EKUA 1IM4A 2YKNB 5TKWA 4ICAA 1UOCA 4IQUA 1JK9B 3FZ2A 3CJKB 4FWQA 1WSVA 2KJ8A 3RJHA 5AQOA 3QNMA 2CXEA 2JFDA 4IDHA 3NH1A 4DSEA 4PRFA 3OGUA 3W0LA 2LXFA 5GADU 3NTUA 1BPEA 4OPKA 3KZIU 3DFEA 4E1NA 1MC8A 2ASYA 4RJVA 4C3MA 4LY7A 4FWSA 4JB3A 5IS2A 1M90T 3D2EB 4F2RA 8ICIA 4OX7A 4KLDA 3N97B 4F4YA 2P9IB 2NREA 2E20A 4GVEA 3FCHA 3HKZF 3H5SA 1X9WA 4WFBL 4RW6A 1X42A 2O01C 3SJJA 4Z4IA 1C1CB 1DQ9A 1FVQA 2XYGB 1VIOA 4X62F 1NNLA 4ILHA 4MIBA 2YX8A 4ATNA 2IOHA 5DS7A 2A6AA 1J54A 3HW8A 3K9JA 1PK3A 1DTQA 1RKJA 4BR5A 4F9OA 2A1AA 3L9ZA 2JFKA 1T9XA 2V2KA 1ZQGA 1AUSL 3AHPA 1VYAA 2YKMA 4KX3A 3JPNA 9RUBA 8ICMA 2G2YA 2YMMA 2X1GA 2WONA 3WK6A 4WE1A 2EW9A 2YMPA 4QIWD 4OLPA 4EWTA 2A0FB 1UP1A 1HD0A 3T1YJ 3C94A 3TZWA 5DGAA 3MN6A 4CJ3A 2QLBB 3M8QA 4Y3CA 1S22A 4G1IA 3HVAA 4OX6A 3SCXA 4B3MF 1V5VA 1RT3B 2VD3A 1TMMA 3V9SA 1JLEA 4Q44A 2AGOA 3E66A 4P2SA 1R0CB 3EVOA 5HROB 5AXNA 1MSWD 3EGNA 1HW9A 1AQ6A 4I2AA 4C11B 4YMNA 3BF3A 4ED1A 4ZN1A 1J53A 3QINA 3JAMO 3AVLA 3D2FA 5HSPA 3VGKA 2Z7JA 1XIQA 4DV0F 4OJ3A 5CR0A 2QC3A 3CNHA 1ZXOA 2JZ5A 4AYBF 4OZLA 2Z57B 4DR6K 2HOEA 4USAA 2VG5A 2HHUA 4FYVB 3LF0A 1QY7A 3UVJA 2QWLA 3CF5Q 7FD1A 4IQMA 1D9AA 3MEEB 1AW0A 5AE3A 2P9CA 1P6TA 4FVUA 4CHQA 2M4MA 2LA6A 3PRBA 5AZJA 3AL0B 3KTQA 1HNXJ 7ICTA 3OYKA 4OYWA 4DR7K 2OPSB 5JS2A 1L3KA 3M2RA 4CEDA 4NJ8A 3VVUA 2R8HA 2P5GA 4KMUA 5ALUA 2HLTA 1CJTA 1G15A 2KYZA 1OXJA 3PKMA 3DOLB 4F91B 3H8YA 2KZZA 4RUAA 1TV6A 2MZ1A 3VTHA 1VRTB 4PQUA 2ISPA 5DJBA 1IKWB 4KGZB 4BQZA 3CCMN 4QPXA 3DDNA 1C6VA 1LAWA 4K8RA 2Z8QA 1H7WA 1ZQIA 3DLKB 2FVPA 3ILJA 2MY8A 1WDDA 3PY8A 2DY1A 4LQ9A 1TKZB 2MQOA 4QS7A 2V7YA 2GH1A 1ZBSA 1FRLA 3C6AA 2O8DA 5EGYA 2QTWA 2K8BB 4WE1B 4I56A 5BR8K 4KR0B 4O44A 4DR7J 2P5VA 2O66A 4CJQA 2YJEA 2VKZG 2OZMA 4GXIA 2JDJA 4MKBA 5F8GA 4KREA 2K1RA 2FJWA 4PL2A 3NFAA 4C97A 3IG8A 4BR2A 2I5JB 2RRDA 3NUQA 1TUGB 5C24B 1RYSA 3NF6A 4U8VA 2P9IA 4NYOA 4W5RA 4R66A 4UOFA 1EETA 5AQRA 1SH0A 2ZJPQ 3N5FA 3JSBA 4ZIWA 1IBMK 5KNIA 3KMSA 5IIIA 4H8KA 2R2TA 1B92A 5AK6A 1A6SA 1KQQA 3MDCA 4M5GA 4G3IA 2VGNA 2E6LA 3C7NA 2YHWA 4IDKA 4B1WB 2BANB 1YVNA 9ICMA 3BSOA 4LFCF 3GFKB 1J5EF 1AA1B 4JV5K 1RHRB 2OI2A 2EPIA 3BS5B 2CYYA 4DV4J 1CS4A 2CGLA 1T11A 1YJWS 3DLLQ 8RUCA 1N36J 1LV5A 3S3NA 2EG1A 3KKRA 5KOWA 2YY6A 5J0RA 2AJ4A 3TP2A 1WUAA 4CDGA 3CUNA 2WSCC 4H0XB 4ECRA 3G71N 4CF2A 3QO9A 4IFEA 4QZCA 5AKKA 1RTZA 2KDOA 3KLVA 1U0HA 4PG5A 4OFZA 4FWKA 3GYXB 2XS7A 1VQPS 4UF4A 2PMWA 2K89A 1ZETA 3ELHA 1NK5A 4K4TA 3RMCA 4KIAA 4ANEA 4LF8J 3NVVA 1NDKA 1MWQA 2AJ1A 8ICXA 5GAGP 1RBLA 2OPQB 3FK4A 1Q7YO 1VQLS 5J2IA 2X74A 1ATRA 3C7NB 1H1VA 4DV6F 4WFYA 1I5OB 4J37A 3HT3A 3CO0P 1H38A 3PTWA 4LQ3A 1JNZB 1RG6A 1VQ5S 4ZCMA 4CYUB 4GO7X 1QAJA 3J81O 2IRYA 3AOBA 1NGGA 1B0VA 3OYJA 4RKUC 3QPIA 3PO4A 1EWQA 2LMIA 3ZT2A 3JS9A 2C2DA 4CO5A 4LF6J 4YFUA 1I94K 3HILA 5FROA 4K4HA 1U25A 1Z26A 4OYMA 4BRFA 5T7LB 4GKJK 5HP1B 4FPAA 1TUWA 4KO0A 5E84A 1WWUA 3M1VA 2QA4S 1CQMA 3KZXA 4KB7A 2EANA 2QB1A 1IJJA 4B9LA 1N5YB 2CQGA 1F9FA 4RR5A 2F1FA 1HJPA 4RBTA 3G6YA 5EWGA 1EKSA 4M9HA 1DBDA 2Z4PA 5IIMA 3O2IA 3DRSA 1NGCA 4C8YA 1B4FA 1FNXH 2NRTA 2UVVA 1QTMA 3QIPB 3CJCA 3TTFA 2KB2A 3UXOA 4MYUA 2M70A 2VWBA 5A2QO 1K1QA 1IKWA 2VBYA 4XH5A 3LA0A 3HX9A 4LRCA 2EXUA 4FYDA 2Z1JA 2FUG9 2HSEB 3ZETA 2ZH6A 3LAKA 1X5SA 3TZYA 1WSEA 2Y0BB 2ZNZA 3LVWA 3FEYB 4RNOA 4Y2UA 4DTXA 4UY85 3V4IB 3I0SB 1GMUA 5ALIA 3DHWC 3F5AA 4DB3A 5CP2A 1N0VC 3GSIA 4ZDNA 1WHYA 3SSQA 3UWTA 4F4ZA 1G4CA 4C4TA 1JQGA 2F5GA 4CQ1A 5FDLB 4NMLA 4PR6A 1XMOF 3P5JA 3H0LB 2OHFA 1M5SA 1Y97A 1UETA 5J0XA 4CD1A 3EZOA 4A8QA 5KOXA 3AEVA 3GV8B 4NZ7A 1N36F 3L6QA 3MX2A 3HCXA 3B8AX 1ZBTA 4QZVB 2QX0A 5DB6A 2AT1B 5D4LA 2H4WB 1GMWD 4DV7J 4JI7K 5J2NB 3JPPA 3I56N 2JVRA 9ICLA 1U1LA 4HH0A 2E1MC 1QQMA 3CD5A 3VAHA 2J6UA 4RBUA 5J2BA 3UMGA 2FSNA 1ED1A 3PX0A 2A19A 3KBBA 5D6GA 2YNGA 5E3PA 2LBOA 2CWXA 2GELA 2LU1A 5H1SQ 3QAUA 2ATCB 5CR4A 1G99A 1U04A 4WJBA 4DTPA 3D7EO 2K8AA 3BGLA 5ALFA 3M9NB 1A5VA 3QT6A 3DOLA 1NZ8A 3BEGB 2ZTEA 3GJQB 2E8MA 2YH0A 1SJ1A 4FWLA 1VQON 1NSPA 1JUDA 4DG1A 1N0UA 4M94A 4OGEA 9ICWA 3FDSA 3CDWA 4ELVA 4HDGA 4DR4K 3VZHA 2BZ2A 1XR5A 2XMTA 2VG7A 1NEEA 3CCZA 4JLHA 2YNHB 2FZCB 5L38A 5IQ6A 5LMUF 2H48B 4I9LA 2WW4A 1C0TB 2R7OA 3ZDDA 4O44B 2NSCA 3M3ZA 4F3TA 1RT7B 5HRPA 2ILZA 4U7UK 1ZBFA 2FHJD 1YTUA 3DLJA 4X64K 4OKJA 3VWSA 5GMEA 1DTTB 3MUMP 4CBXA 1EXQA 1ZQOA 1URNA 2W11A 4FDFA 4E7HA 4F02A 5ITHA 1LK7A 4QZBA 2M2BA 1LKYA 2ADBA 4W5NA 3IM1A 5TISU 5D0GA 1VISA 1YJVA 1AFIA 3OS1A 3BGUA 2OP5A 2W54A 4CO3A 4CW7B 3JQMA 3BSNA 5BPCA 1AB8A 1HL6A 3W9IA 5E41A 5FDLA 4EGLA 4Z94A 5C12A 3QBWA 3KDOA 2HGMA 2DNPA 3MCPA 2YPZA 4EO6A 1HKGA 2MGZB 1VHXA 2ZH2A 3ZTPA 2J76E 4ZPCA 3THVA 1UWBB 1WC0A 2NPIA 1IWGA 4UB4A 2DNHA 1YITS 1U1QA 3PO5A 2ZH9A 1T9UA 2M3DA 2R8JA 3D5MA 3SEOA 3JPTA 3F73A 4IJNA 2UVUA 1XO1A 4QU7A 3H4BA 1NLVA 2DY4A 4NLZA 4CGJA 1HNWK 3UPFA 1X8DA 4ZS6A 1VBYA 3J81j 3VGVA 4ZVFA 3A5NC 4AHCA 5CA7A 4MLEA 4DUZK 2D0CA 1QQNA 2BYCA 2J8SA 1HBOA 2W3SA 3Q2SC 2YQ1A 4JRQA 3ZSVA 3C19A 2DGTA 3BGOP 1H2VZ 3EJMA 3OTDA 3LALA 3PEHA 5HVGA 3L7UA 2XWYA 3T9ZA 5AE1A 3C1YA 1XS9D 1YBTA 2GQQA 1RZTA 1WSRA 2F9DA 2XMVA 2W8LA 2DR8A 3BREA 2ZZTA 1S77D 2ZG6A 2VKRA 1LFPA 3CCQN 2E7VA 3QU4A 1SC1B 1RISA 2HBQB 4PL1A 1GLBG 4NEZA 2EWHA 3CE8A 1HWUA 3I55N 3T19A 1OH5A 4KFBA 4U8YA 2IAJB 4JKCA 3QDKA 2B9XA 1FK9B 2FJEB 3M30B 1Z4OA 4RW7A 3B9JA 3CCEN 4MT1A 2VA8A 3Q0AA 3C2MA 4ECVA 1FKPA 4ZHRA 4DMZA 1FKOB 3SMPA 3THXB 4I28A 4X66K 3PIOQ 1UAWA 5E33A 2XLKA 2IM0A 1FE4A 3JXUA 1V3SA 3G9CA 5KT2A 4O3PA 2GGPB 3NOGA 4KAIA 2RF2A 4ZCKA 5MLCQ 3M30A 2LQBA 3LWMA 1CJKB 4ZCLA 4WKYA 1FXRA 2QB0A 1AZSA 4RQ3A 1WSFA 5EE0A 3GE9A 2HQCA 3CJ5A 1BI4A 3OYAA 3PSIA 3EVMA 4GXKA 4RWWA 4Y1CA 3DDIA 2FMQA 3QLHA 3SQ1A 1TZ0A 5C10A 2J9EA 2SXLA 3G8QA 3AA8A 2LEBA 2BE2B 2LLZA 2HSZA 3CP8A 3GG0A 4QPTA 4H4OA 2PFUA 2HNDB 3Q8UA 1S5ZA 3DRRA 4OIXA 3ZX3A 1UJ4A 2J0SD 5J0SA 7ICKA 3R5JB 3OBWA 5F1XA 2K3KA 2RVJA 4JI0J 4M5IA 4UB1A 1EB0A 4L3QA 1Q0NA 5CCLA 5AKGA 4CNZA 3OS0A 1RTDB 2BKPA 1YGYA 4ES3A 2M0GB 4EFHA 3SMZA 2O4GA 1H98A 2WB1D 2GJIA 2OTLN 3SI8A 5IXUA 1N5XA 2ZIVB 3I5AA 4HUEA 3H5XA 3RR7A 2PEBA 3JSMA 4P10A 2P9EA 1WD6A 4WXWA 2RU3A 1FA0A 4H0VB 2ZIVA 3C46A 3KLFB 3Q89A 4WFNL 5M2UA 1LW0A 1WLJA 2BQUA 4K8XA 4ECXA 1R8CA 3KLGB 2GX8A 5GMDA 2Q3PA 3HBTA 1RWKB 2HNZB 4EELA 2HQGA 1EHWA 3UDVA 3CCVN 3PYDA 4J9LA 4HUFA 4K5RA 5JS1A 4NCBA 3MX5A 1F21A 4FNIA 2GFFA 2KT5A 1NMEB 2MXYA 4ZPBA 1FEEA 1RA6A 1DXSA 2FBXA 4ELUA 1I51B 1VQPN 2B6AB 3PR4A 4WQ4C 4YB7A 4X66J 2EFGA 3HHLD 4KLSA 2JEFA 1QAYA 1Y5LB 1SKRA 2O5DA 2XLJA 5A8WB 4I2FA 3FR0A 4BRKA 5DQIA 3LDLA 3VEYA 4JV5J 1W2IA 2C3OA 5C25A 3CCSS 3H46O 1VQ5N 1FXLA 1C4AA 4JV1A 3E8OA 1U0SA 1VSFA 1Y10A 4B3MJ 3I32A 5ETVA 3V1OA 4P52A 5HJXA 3KKAC 3FSXA 1FKPB 2BDPA 2E9ZA 1YJUA 2KNJA 2OZSA 3OT9A 4BDZA 2JRSA 4NXMK 4F5PA 3CMEN 2Q66A 2IC3A 5J1EB 4DQSA 2AEMA 3IHQB 2MKIA 2XMMA 3FYHA 1BDGA 4BACA 1BA1A 2AW0A 1J9AA 3JPOA 3VQCA 4DV7F 4KGXB 4DUZF 3M32B 4UT4A 2QKBA 5HMZA 1CJVA 4DQQA 4ED4A 1Q86T 1Z1ZA 3MUVP 3DLLL 5EE9A 1C0GA 1WACA 4X64F 3RRHA 2VA3A 3RU0A 3UXPA 2XBPA 1XHXA 4IQWA 4CJLA 3MM7A 4NLWA 3LP3A 1EKRA 1XMQF 3HD1A 3R9KA 1NLKL 5KFSA 4A4JA 3K5PA 4XPEA 1X66A 3G82B 2KU7A 5KT4A 3AUOA 5AI9A 4EK2A 3E01A 3AAPA 3HM8A 3H8MA 4OZ1A 4C2MA 1Y11A 2F8EX 4CHYA 5GIPA 2C3UA 5K14A 5DQGA 1RWXB 2I0XA 2KHOA 2F8MA 4LC9B 3ZTOA 3OFEA 3CCTA 3R6LB 5KFOA 1ZQHA 5J2QB 1ZQ1C 1J97A 2XYPB 1TV6B 4UW2A 4X65F 4TU9A 2IIRA 4LF7J 4X4SA 3TVKA 2DL0A 9ICAA 3N6NA 4CYUA 2YB1A 4EBCA 4Q8FA 3VR1A 3CMQA 3J7ZT 2QK9A 4I4BA 3ZCMA 2CQ4A 5C2FA 3I56S 2YNGB 2V51B 3AO4A 3PEJA 3C5GA 3ULEB 3VQ8A 3WDOA 1CEZA 4Y2KA 1PIEA 2VOPA 2ADCA 1Z3EB 5ALWA 5DLGA 2P66A 4PHEA 1HI0P 3MR2A 2L9WA 2ZC3A 3MC1A 4O55A 3M8PB 3U8XA 1BQXA 1FNMA 2OJ3A 2AX1A 5LL6d 4EEYA 1C1AA 4CZMA 1N63A 4CJFA 5KFTA 2DRAA 1BPDA 4HACA 3PVXA 2E2OA 4K5SA 3RYLA 4R79A 4FZXC 1X5PA 4TY8A 1NU0A 2DWQA 2YVSA 3N9UC 4MFAA 2YJFA 3O9RA 3VEWA 2VDHA 2JC0A 3BPDA 2RUGA 3ED5A 2DPNA 2Y1RI 1Q82T 1GOCA 4DCOB 3ENHA 2XO6A 3GIIA 1FFGB 3CM6A 1UPMB 5C42B 4TLQA 4C8ZA 3I76A 3SUPA 1ACMB 2UXBF 5DG8A 5FPDA 9ICPA 9ATCB 4C80A 4X65K 5K8PA 1KD1O 4J9UE 2GO8A 2AD9A 4A8SA 4C0BA 1NGIA 4OCZA 3UPQA 5ALOA 4XO0A 2JLGA 4BC4A 5KTQA 3A12A 5C2CA 1OY6A 2RP5A 3NGSA 1RXWA 1HNZK 1T94A 4OJ5A 3NL0A 2CQIA 2GX9A 3OL7A 1RXOB 1VI7A 3M2UA 5AM2A 2W04A 1MLAA 4CGFA 1WHVA 1NK6A 4F0HA 5HR6A 3F2BA 1H2UX 1Q3VA 1XMQK 2CPHA 5DBAA 2AXTU 8ICRA 3ONNA 4OYIA 1NXIA 1PC5A 3MEKA 1IBKF 1HLWA 7ICFA 1FJGK 1HYSB 3HX0A 1RCOB 4CJSA 1PCAA 2UV8G 2ZKUA 2HI0A 4JWNA 1HWJA 2Z2ZA 4Y34A 4Y6IA 1YTAA 1S1WB 1TKXA 3H3NO 1SAZA 3PSFA 2PEHA 4KC5A 3AV9A 1TAQA 3I28A 4OJ1A 4ZKAA 1S6QA 3S1TA 4AUKA 4AHSA 2DBYA 1XR7A 7AT1B 1WC6A 1ROFA 2CPDA 1KQSM 4DX6A 3N7SC 1KW4A 5C15A 3I9V9 5HAOA 4QIEA 1E6VA 3D6RA 4DLEA 2RDJA 2P6TA 1EO1A 1O5JA 4ERDA 2QRRA 2CQ3A 4M3RA 1SPBP 3FRZA 1FD8A 1QVGM 3ZT3A 1RBSA 5AKXA 3AU2A 2HPUA 3CULA 5C5JA 2GVDB 1ZQFA 4UY8O 2R7YA 4ED5A 5ETKA 4JI0F 1RWUA 8ICVA 3AJ2A 3MXJA 3TRGA 4A48A 7ICEA 4AHVA 4RLEA 2BPGA 1S49A 4M1KA 1TYQB 3AQOA 5D49A 1RBTA 4FVCA 4K4IA 2O4IA 8ICCA 1WBBA 1NNDA 2ZVIA 4KGKA 1COKA 3SUNA 2HVIA 2HK3A 4I2QA 4JYAK 5B0AA 2HHHJ 4M45A 4QR0A 3UDCA 3M6WA 4A8OA 4B1YB 2IGIA 1SL2A 2V8PA 4OJ6A 2YX7A 2Q97A 4DSLA 1DRGA 1TUUA 2KOBA 1FNOA 4DG1B 2EK1A 4CGHA 1IBMF 1TVRB 2VYPA 3RJEA 1GNKA 2QG9B 2ASLA 1I39A 4NWIA 3ZNJ1 3KLEB 1BPBA 1KOHA 4C6AA 5F8HA 4F5OA 2AHOB 4FPIA 2CPXA 3IRWP 2HMPA 2GIRA 3AJ1A 1AZSB 1QDUB 3UKRB 2F8HA 3SUQA 2DT9A 1L3SA 4RWXA 5J0QA 4EFAC 4WCEL 1NRKA 2MRLA 4OI3A 4CFAA 3VQ9A 2QMUB 3MXIA 4FJ7A 3NGZA 2GJFA 4H4MA 4I6MA 3UNYA 3D2SA 4KY3A 4B3RF 3DOMA 2ZWOA 3C15B 3POTA 3PJ9A 4M3XA 3VQEA 1B0XA 2XMJA 2KVCA 2KV2A 4I2CA 2K8CB 3W1YC 3ICLA 1O8BA 4QWCA 4E8UA 3RG6A 1M5KC 3FCWA 4PXBA 1B0PA 1S9EA 1JROA 1FCAA 4OX9F 4Q5VA 4I6YA 1DFDA 1ATSA 3CPWM 1XTZA 4DOZA 4OX9K 2IDLA 1X40A 4EP4A 3P4IA 4EP5A 4I2EA 2CZ4A 4CIGA 5H1SV 4GVLA 5HI7A 2K60A 4M04A 5CE3A 3N4PA 4OJRA 4DBQA 3QGGA 4NE9C 1JN3A 5KFBA 4OHWA 4P0QB 2IDEA 5AZJB 4RU2A 1BWFO 3KK3A 3SBTA 2JWNA 1IG6A 5DBBA 3LOUA 3OYCA 1JL1A 4LF6K 2RS8A 4X4QA 2ZJRL 1QLNA 3GYGA 1DRZA 2RNEA 4YEAA 2FLLA 4I2PA 4FM0A 3TSQA 1VQ6N 1CJVB 2W43A 4K59A 1N60A 5D0EA 1T6CA 2WFBA 4K0KF 1RU1A 1OY9A 2CRLA 2QWNA 2H5XA 3KZBA 1FRIA 5H2FU 1LKYB 2P9UA 4RU9A 1HKBA 4DFPA 3I33A 5JVHQ 4M5MA 1S4FA 3ENOA 1ZOTA 4M47A 3RH4A 3SSRA 4KH6A 5D4OA 4DR3J 2XHCA 7ICUA 4OYBA 4Z4GA 3CCJS 4LF7K 3DXMA 1JLAB 1W0HA 3EXCX 3GR1A 4IEIA 2R7UA 4YY3F 3HHNB 2VQEJ 3T1YF 2WHOA 3VEZA 1GLLO 9ICIA 2IFXA 5GAGU 1Z4UA 4CEBA 3QFWA 5AKLA 1Q81T 3NF9A 3W2VA 2DNZA 2E1YA 3M6XA 4ISEA 2BJ9A 1FW6A 2UUAJ 2AQ0A 5KFAA 3MM7B 5HMLA 4NXNJ 2RE2A 4RO0A 4FZMA 3FBBA 1SKUB 5U47A 1IO2A 4QR2A 1N61A 3R6MA 2BV3A 2KFYA 2WC9A 1L8OA 2CJKA 5JLFA 1X7VA 3H2UB 2Z56B 4NMXA 3FVYA 5KFVA 8ICYA 1IBKK 4FK0A 5AQGA 5IIKA 5HK4A 4RT3A 1SXLA 3D66A 3CMES 2OCEA 4AL5A 1WOOA 3DLGA 1TL3B 3PUFA 2CZ9A 3CF5L 3P1GA 2MQNA 2EK6A 3KUHA 3LZIA 4Q43A 1XO0A 1X3NA 2F1HA 3EZUA 3OPKA 4URSA 5KG5A 4BJQA 4NB4A 2UUAK 2BKOA 3W64A 4RW9A 1FD2A 2QARB 3VESA 3CJQA 5B09A 2CH5A 2CQPA 2ZUBA 4DR3F 2YKPA 3M9MB 4Y2RA 4TSXA 2AJ0A 3WUHA 5BYSA 2D69A 2GBZA 1JLFB 2O6KA 5D3GA 3O0FA 3O1WA 3O1BA 2XY7A 2P9LB 3CFPA 4A61A 1U9LA 4F04B 2WAQF 1T3NA 1KXPA 3M8ZA 5AR0A 2DGVA 2RIJA 2PZSA 4CF8A 3PFOA 4FWMA 2G2OA 3P45B 2DKOB 2ZC4A 3QWPA 5CD4A 1RQ0A 2BW2A 2VG7B 4ZTJA 4PZNA 3KK3B 1KFSA 5IT4A 2BW7A 3NGRA 1C0UB 2M9KA 1K6YA 1F3VA 2OYYA 4YOYA 2HVHA 3L4BC 2VB6A 2ZOMA 4OV1A 4HTLA 3AOCA 3TSUA 1RT6A 4M5KA 5DDOC 1S1VA 1T9WA 2F4VJ 4M6WB 4CZEA 2Q79A 4HCCA 3K0SA 1FWKA 3MZIA 1CJUB 2QARA 2WHEA 1NHVA 3QU7A 3QEWA 3OW2M 3T1AA 2OTJS 2CPFA 4KV8A 4IR1A 2PSZA 3PG9A 1TAMA 1WAFA 1MNEA 5AT1B 3BSAA 1RCHA 3RJJA 3NS1A 3RJFA 5AI5A 3GDXA 2B0GA 1B9DA 4HKQA 5ALLA 3X3UA 3I0RA 3NS7B 4MFBB 3T79A 2B4VA 3HI0A 4N56A 4JUZA 4CH7A 4WQ4A 4TY8B 2DPIA 1KVIA 2BUNA 4KLMA 1IBKJ 5KG3A 1L7NA 2O8EA 1BCOA 4KLHA 1MWZA 3VAGA 1DGJA 4CGDA 4DV1K