4DWIA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with self complementary dna, se-dgtp and calcium
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
581
structure length
581
Chain Sequence
GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dwiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dwiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dwiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dwiA01
5DBAA 2ZUCA 4ECYA 2IC3A 1T8EA 4GC7A 4CJKA 4FO6A 1H38A 3AV9A 2ATQA 3HVRA 1UA1A 1C0MA 3UIQA 4J9PA 4O3PA 3KLHA 4MFAA 4ID1A 2JEJA 4N5SA 1COOA 2VG5A 4M3WA 1ZQMA 4KLGA 3LAMA 4DSLA 4BGDA 4FJ8A 3KJVA 3NFAA 3GIMA 4F3OA 3VQAA 2VG6A 1BQMA 2KTQA 4FS2A 3MABA 3KLGA 4NCGA 8ICLA 3B0XA 2D0AA 2P6UA 2B21A 2Y1JA 3EY1A 5KFAA 2V9WA 3P1GA 4UB4A 1JX4A 2ETJA 1ZQZA 4E7LA 3F73A 2BKEA 3G10A 5J2FA 3LZJA 1JLAA 1S77D 1BI4A 4RNMA 1U45A 2FMSA 4Q45A 3AO5A 8ICWA 4E0DA 3I8DA 2F8SA 3QO9A 2FLPA 3V7LA 1YTUA 1ZQNA 2BQRA 5EWFA 4KN7A 3AVGA 4CEDA 2ASJA 3OS1A 4IG0A 5FRMA 1C1AA 5KFKA 3B0YA 4CGIA 4EYHB 5L9XA 2D0BA 1BCOA 1XWLA 2HB5A 1TK5A 3SQ2A 5J2IA 1N5YA 4M41A 1BI4B 4DTJA 2KFZA 3UQ2A 4CF9A 5DB6A 1ZJMA 1RDCA 1S0NA 4O5BA 1QHTA 3AVKA 3BQ1A 5E41A 2F1JA 4DL4A 3PV8A 4I2CA 4OPJA 7ICLA 2BCUA 2AQ4A 3V1OA 4LSNA 3DLHA 4KI4A 4M0AA 4RNOA 4CEAA 1JL1A 3OYMA 4DS5A 1RT6A 3C94A 2LSNA 1BPZA 3HL8A 4I2PA 2BR0A 4B9NA 4FLUA 3CFOA 4ECXA 5L1IA 1UA0A 3C5GA 1S5JA 2YKMA 3OYEA 5KT6A 2KZ3A 4PGXA 3V9WA 1SL2A 1XSLA 1ZBLA 1IH7A 4RU9A 1YT3A 5HRSA 3ALYA 1VSMA 3MAQA 1J54A 1BVSA 1S9FA 4HUGA 3GIJA 1ZQPA 3GV7B 1WN7A 1CEZA 4FJJA 2BQUA 4DQRA 3RJFA 1YVUA 4CFCA 3RMDA 3JPPA 1XI1A 1VSFA 4KHWA 2GBZA 4EBEA 2A1JA 3RJIA 3KK2A 2ZJAA 4ZH4A 3GV5B 9ICXA 2R8IA 2J6TA 5CB1A 4P4MA 3RB6A 4OGEA 3HX0A 2YNGA 3FFIA 4I29A 3OJSA 5J2JA 4BDPA 2PI5A 5KFSA 2V4RA 3ITHA 4J2AA 5KG4A 4UBCA 4PHPA 2NRXA 3ZT3A 2F96A 1U4BA 3EYZA 1NOZA 4I2QA 5KFWA 4W5NA 5CYMA 7ICGA 4E1MA 4HHTA 4O3OA 8ICYA 5KRTA 4TQSA 5KG3A 3OHBA 4GLXA 2P5GA 2XGQA 4B9TA 3K58A 3PW4A 1WSIA 3CFPA 2OPRA 1RDAA 2A1SA 4Z6CA 3B6OA 4CCHA 2G8HA 3NH1A 5KGWA 1S1XA 1ZQDA 1S0MA 2WOMA 2YHBA 5FROA 3HJFA 1S1UA 3V6JA 3NBPA 9ICPA 2G8UA 1S76D 3TANA 3DLRA 3M9NB 1ZBIA 2I5JA 4DSFA 1ZQRA 7ICVA 1K6YA 4CK3A 1ZETA 1D9FA 2QKKA 4IKFA 2FPMA 4YP3A 3DRRA 1JXEA 3C95A 3V7JA 1XSPA 3SNNA 1NJXA 2ZJ5A 4QW8A 4OVLA 4EBCA 4NYNA 2XO7A 4KAZA 4C8MA 4BDYA 4RUCA 3AVMA 4J2BA 3ZSYA 2FMQA 4FK2A 4J2DA 3QESA 4LD0A 1RT4A 5IIMA 4NCBA 3SPYA 3EWAA 3T3FA 1T05A 9ICLA 3RJGA 1HJPA 4OGCA 4DEZA 5TZVA 2BPCA 2XRIA 3VQDA 2BGGA 8ICQA 1ASUA 2I9GA 2Q3SA 3GDXA 3RR8A 1RBTA 3OYHA 1QLNA 2PY5A 3MDAA 3OYAA 3H8SA 4DOCA 4HYKA 2RDJA 4CJVA 4FZXC 5KFPA 4CEOA 3RBDA 4M2YA 3NH2A 3N4MB 4RW9A 3OYBA 5DQHA 5DBCA 3SV3A 2XCPA 1S9EA 7ICQA 4Z0UA 1S0VA 1C6VA 1TKTA 4KB1A 4DG1A 3K2PA 1TL1A 4PPXA 3C2MA 3AVBA 1JLGA 2HHUA 3ZT1A 1KVAA 5SWMA 1HUOA 2BANA 2ZD1A 3MR6A 7ICIA 9ICFA 3DLKA 4CIEA 4CK2A 4PHDA 4FLTA 5HRNA 3ULDA 4JWMA 3OS0A 4DF4A 1HYVA 3K5MA 3QIPA 2AQ0A 3OSNA 1MQ3A 1ZQUA 2HNYA 4CHNA 4DSJA 4RW8A 5KFTA 2XY8A 4I28A 4JUZA 3WNGA 1LB2B 3MR5A 4NLKA 1ZQIA 1NK5A 4NXZA 2Y1IA 4YD1A 3KK3A 2BCRA 4FLYA 2XCAA 4O3SA 1I39A 3NGYA 3H4BA 2DPJA 2VA3A 4F2RA 1ZBHA 2F8TA 3AVHA 4R65A 4FLVA 1IM4A 3SQ0A 4J9QA 5IIJA 1BGXT 4RPZA 1TAQA 3GIKA 1RYRA 8ICKA 9ICRA 4FM2A 1QE1A 4B8AB 3DOKA 3Q8QB 2IHMA 1S10A 4Q8FA 4BE2A 4CJEA 1S9GA 4NLZA 1ASVA 3ISNC 3SJJA 5F9LA 1DTQA 1EX4A 5DG9A 3AU2A 1SV5A 3FDSA 5J0OA 4M9NA 3SV4A 4KLTA 1JLBA 3VQQA 4CGGA 2R8JA 4O55A 4AH9A 1MQ2A 5J0TA 4I27A 4FJKA 4OPKA 2IHNA 4B9VA 5J29A 4DS4A 3AA3A 4BWJA 2HMIA 3RR7A 5KFFA 3S9HA 2KZZA 5HMLA 1RILA 4ECSA 4GMJB 2RPIA 4ED6A 5J2MA 4O0JA 1Q8IA 3TQ1A 4M47A 4F5QA 1U49A 4TUPA 5J2DA 4CJWA 9ICAA 1IXRA 4Q8EA 4F50A 1RBUA 4J9RA 4KTQA 5D46A 4RQ6A 3JPRA 1BPXA 4MF2A 2JLEA 3RJKA 1A77A 3P5JA 4K4IA 1JLQA 4JWNA 1X9MA 3NE6A 4ED2A 3JPTA 2DTUA 3Q8LA 2YKNA 3HK2A 4M6WA 5KFUA 4DL3A 2OA8A 3TFRA 2JEIA 1I3AA 3U6FA 1MSWD 4UBBA 4OLAA 4EP4A 1KSPA 4M42A 4DU1A 2UVWA 4LH5A 4YMMA 1D8LA 1A5VA 4N76A 2WTFA 4BE0A 7ICEA 3MR2A 2YNIA 5HP1A 4F2SA 3AVFA 4E7JA 3A2FA 5J0SA 1BL3A 1TVAA 4ECZA 4M6WB 4G3IA 3KLIA 4FVMA 4UAWA 2PYLA 5D3GA 1ZQWA 2W8LA 4DFJA 4O44A 1VRTA 9ICOA 3K5LA 3QZ8A 4DO9A 3AO3A 4M3XA 4Z4FA 1C0UA 5HROA 4RQ7A 4CIGA 4I2BA 1IO2A 1DTTA 1WNSA 4N56A 1UOCA 3IG1A 2HVHA 2JEGA 2X78A 2W42A 3SUQA 4HCCA 1SL0A 1DGSA 4DFMA 3QZ7A 2XY7A 1WLJA 4ECUA 4LZGA 5KG6A 1NK9A 4CEQA 3C2LA 1ZQVA 4CJ3A 4ZTFA 3ZT4A 4RNNA 4R66A 4IRDA 3S3NA 8ICSA 1L3VA 4QZIA 4ECTA 4XA5A 5KFJA 3ZSQA 3V6KA 4M9GA 3V72A 1J9AA 3WNFA 1CZBA 3AVCA 3QEXA 3PR5B 2G8IA 1S6QA 4MFBA 4QWCA 3TAMA 3PX0A 1SKRA 4JV2A 3ISDA 1WSFA 4CJTA 3Q8MA 2VA8A 2ZTEA 3PW5A 1A5WA 5EU7A 3LP2A 1ZQTA 3PW0A 4F5NA 4IR1A 2HNDA 5BOMA 1BPBA 4G1QA 4HTUA 1HYSA 2IS3A 2AGPA 3QEBZ 4NM2A 4Q43A 4J9OA 3C23A 1G15A 3LALA 4CERA 4FCYA 2XC9A 2P1JA 5DDMA 4B8CA 3ORYA 1J53A 9ICTA 4UQGA 1RT1A 1Y88A 4FLWA 5KFMA 8ICHA 1K1SA 3Q8RB 1B92A 4I2JA 4PWDA 3ZSZA 3KKRA 2H5XA 4IRCA 1NJYA 4DSKA 3IRXA 4E89A 4QZHA 3LANA 4FJ7A 4O5EA 4Z6DA 9ICEA 3MGIA 4IFYA 4EZ6A 5KG0A 4JS5A 2ZTDA 3ZSOA 4EP5A 5DKWA 3V9ZA 4KB0A 8ICIA 1EP4A 4RPXA 8ICEA 2AGQA 4CF2A 4Q44A 1ZQOA 2XHBA 5D49A 9ICWA 4RT3A 1GOCA 1JXLA 1XHXA 3K5OA 4GW6A 4B9UA 1NJZA 4TURA 1RCHA 5C24A 1L3UA 1VSKA 3PMNA 3QIOA 1VSIA 3T5JA 3RMAA 5KFNA 4CF0A 4DL5A 3ETLA 4AHUA 4M9JA 7ICRA 4GXIA 3LK9A 4O3NA 3JYTA 5J0UA 1HNIA 7ICOA 4I9QA 3OSPA 2FBYA 3K59A 2RDIA 1D9DA 5DB7A 4FW2A 1WAFA 4MEXA 4CF8A 4RW6A 4B3OA 1RPLA 4ED7A 1JIHA 1RTDA 1EXNA 3ISBA 4MFCA 2OYQA 1MC8A 2PZSA 3LDSA 4CJSA 3EW9A 3TAGA 4F3TA 1RT3A 4B9MA 8ICOA 5DQGA 3BQ0A 4F4XA 1Z3EB 2X74A 1ZQJA 1KFSA 4BDZA 3HPHA 1W0HA 8ICCA 2FLLA 8ICJA 2ASDA 4I2GA 4B9SA 4KHYA 8ICRA 2EHGA 2OZMA 2DFHA 5EOZA 3PW7A 2NRVA 5KFQA 8ICBA 3AVAA 3QNOA 4PUOA 1CLQA 3HSTB 2UVRA 3VQCA 1QQCA 4YXMA 2ISOA 1U48A 4Z4IA 3NF8A 1UWBA 1S1WA 2HVIA 3QEVA 5I3UA 2HHWA 1B9DA 1S6PA 4M3TA 1LW2A 4QCLA 2J6SA 3P83D 4KFBA 1ZBFA 1X9SA 3AO4A 2P66A 9ICIA 5BOLA 5KG7A 5KG5A 7ICJA 2G8VA 1HJRA 4KHSA 3NF6A 2QK9A 3DLGA 2W8KA 1EETA 3OGUA 5HHIA 4CGJA 8ICPA 4QAGA 1ZQEA 5D4BA 3RH4A 4DOBA 1LW0A 4WE1A 3V6HA 5DG8A 4CGHA 4O3RA 2EX3A 2DFFA 4YVZA 4M3RA 3CM6A 3NHGA 3G6XA 4GXJA 2PXIA 3AUOA 2FPLA 4EYIB 3LP3A 8ICGA 5DB8A 2ZQBA 3H8WA 4PH5A 4KTWA 4CJLA 3HM9A 2OWOA 1BIUA 2G8WA 4I7FA 3B6PA 3G6YA 4CJ4A 4J9SA 4XRHA 1TKXA 2C22A 3RBEA 3Q8KA 1L3TA 3DRPA 3V81A 2B4JA 9ICBA 3TI0A 2ZUDA 7ICPA 3AO1A 5HRRA 5HLFA 2BCVA 5L1JA 5HP4A 4IFVA 5IIKA 4RQ5A 5KFIA 4XIUA 2C2EA 2DPIA 2NRTA 2HHVA 4KHQA 4RT2A 1RBSA 1NKCA 3C1YA 4Q5VA 3KLFA 3M8SA 3PVXA 3ZDDA 1HRHA 3C5FA 3DMJA 1KTQA 4C8KA 1D5AA 1XSNA 1FK9A 1U47A 1C1BA 4CEEA 3I0RA 4RQ4A 5DGAA 1ASWA 4RQ3A 5CHGA 2PI4A 1LAVA 3OYIA 3HP6A 4OKKA 4MF8A 1IKWA 3Q8SB 4KITB 1ZQSA 1BPEA 3PW2A 3HP9A 3QINA 4F4YA 4KREA 2M9NA 1WAJA 3PUFA 4YN4A 3KHGA 4DLEA 1NJWA 4R63A 4RUAA 3MXIA 4DU4A 4FBUA 4PA1A 5T7BA 3ZSXA 4MFFA 9ICMA 3G0ZA 4M3YA 1ZQQA 5L1LA 2BCSA 1JLFA 5IINA 5DGBA 2E4LA 1U04A 3VQ6A 4R64A 3IM1A 4YMNA 5C25A 3MEEA 1A5XA 1S1VA 1NK4A 1TV9A 3QEPA 1WCNA 5KFHA 4K4GA 4DTUA 5CA7A 1NKEA 1WSJA 4HCBA 3ZD8A 1SKSA 1N6QA 4P4OA 4NCAA 3V9UA 3KD5E 4FLZA 3HYFA 2HW3A 2RN2A 4ECQA 4TUSA 5DDYA 4QZ8A 4DFPA 3LDAA 2FLNA 4QZ9A 2R7YA 4AHVA 4DQSA 1RNHA 4C8LA 2RKIA 1IKXA 1TFRA 3ZCMA 5KG1A 1JKHA 2VA2A 1XO1A 2JGUA 3LPTA 4L8RB 4FM0A 3NTUA 4MEYA 3PR4A 3SZ2A 5KFYA 1TGOA 4OKJA 4XQ8A 5DBBA 4Y1CA 4DMNA 4PHEA 4CHZA 3L2RA 5KFLA 4KTZA 2BDPA 4R5PA 4MQ3A 4AHCA 3ISCA 3FYHA 4O5KA 3V6DA 4KLFA 8ICAA 3K75D 1UT8A 4C8NA 4JK1A 4F5PA 2IDOA 3NF7A 3DM2A 4E1NA 1RZTA 3PMLA 5DLFA 4KN4A 3M9MB 1FXXA 1MU2A 2ZJ8A 4CFAA 3TFSA 3MEGA 5CY4A 3PX6A 4CHYA 1KLMA 3SCXA 3AVIA 4PGQA 1ZBUA 4FJ5A 4ECVA 1Y97A 4FJXA 3GV8B 4DTPA 4K8XA 5J2HA 1RXVA 4DQIA 4O4GA 4KLEA 2NRZA 3PO4A 4YD2A 3UXOA 2FC0A 3DOLA 3KK1A 4K8ZA 1AROP 1VK0A 3QNNA 4RG8A 1PZNA 4ED0A 2ZE2A 4KO0A 3PY8A 3Q8PB 1RBVA 3VN5A 2MUTA 1LAWA 5EWEA 2P51A 5J2GA 3ZDEA 4O9MA 3UQ0A 3V1RA 2A1RA 4Z4EA 3DLEA 3U3GA 5CR0A 1Q9YA 2D5RA 4E7IA 4YQWA 2F1IA 2Z1JA 1DOQA 1TVRA 3H08A 4AHSA 4ELTA 1ZQAA 3I0SA 4KLDA 4CFBA 2P6RA 2MUTB 2C2RA 9ICSA 1C0TA 2VG7A 5KT4A 4Y1DA 5J2EA 1U9LA 4M3ZA 5KFBA 4RPYA 4EEYA 5KT2A 4CFDA 2KQ2A 1ZQKA 1JN3A 3MFIA 2FBTA 4CHQA 9ICKA 4QWAA 5CJ7A 3LPUA 3RJHA 1JXBA 1RT7A 5J0XA 3D45A 5K14A 2E6MA 4KLMA 3K57A 3T5HA 1KFTA 4FJMA 2PYJA 4P2HA 9ICGA 3RMBA 2BCQA 4BWMA 3NDKA 1WSHA 4Q0BA 2XY5A 2FPKA 3IHQB 8ICUA 1IKYA 3QETA 3LP0A 4QOZB 4I2EA 1NK8A 2MAXA 2G8FA 3AA4A 1Z26A 5HMMA 4F5OA 3TAQA 4ED3A 3C1ZA 4RQ0A 4GVMA 4OJRA 4ECWA 1CXQA 3PX4A 3MXMA 3H40A 5KT3A 1Q9XA 4B9LA 4IR9A 1WSEA 3KLEA 3TAFA 2QXFA 4DLGA 4DL7A 2BPFA 1ZQHA 4E19A 1SL1A 5C42A 4JRPA 4ED8A 4GXKA 4AILC 3GILA 4C8OA 3OYFA 3OYCA 4I9LA 3VQPA 3SUPA 4QWDA 4IQUA 3BJYA 2XGPA 3L2QA 3C21A 2O4IA 3HPGA 5SZTA 3S3OA 4FS1A 3OYDA 3OYJA 2VWJA 3TWHA 1RDDA 3L2VA 2E6LA 1N48A 7ICFA 3NH0A 2AU0A 4F8RA 1X2IA 1ZQYA 2YHAA 1REVA 4KLJA 4FJLA 3THVA 1SKWA 9ICJA 2WONA 4FYDA 1T4GA 5KFOA 3HXMA 3ZT2A 4KLLA 4YR3A 3ZDCA 3H7IA 5IIIA 2X6SA 4FJ9A 4PHAA 2FBVA 3RMCA 5I42A 3O3HA 1IG9A 4PQUA 2GUIA 3GFKB 2BPGA 5KGXA 3MR3A 3LWMA 5DMRA 4QZEA 3RH6A 2ALZA 1FKPA 4RQ1A 5FRNA 1Z25A 5C5JA 2VWKA 4DTSA 1X9WA 4KHUA 2YNHA 4DL2A 4UAZA 3DRSA 2W9MA 2W9AA 4IDKA 8ICFA 4HUFA 3M8RA 3ASMA 3ZDBA 2KW4A 3KTQA 4TUQA 4Z6EA 3RB0A 3ZD9A 2UVUA 2PFNA 3ZSVA 3VA3A 2W9BA 1TV6A 1QTMA 5KFDA 4UB5A 8ICVA 3OS2A 3T5LA 2W9CA 1HQEA 3G6VA 4M45A 3TABA 2QKBA 4CJUA 1HNVA 3UXPA 1V9PA 4YR0A 4JLHA 2UVVA 4Z6FA 4EZ9A 2Z1GA 2BHNA 4M9LA 2XY6A 5JS1A 5HRPA 4JRQA 3PO5A 4OLBA 5J0YA 4FLXA 5J2AA 3OYGA 8ICTA 4YXJA 4NY8A 1LWEA 2HHTA 4J2EA 5J0PA 1BCMA 3CG7A 4DOAA 2W9BB 4KLOA 4N47A 4FK4A 4QZCA 1ZYQA 3KHHA 3AA2A 2W9CB 4R8UA 4M3UA 1NK6A 1BISA 4QWBA 2PFOA 4RW4A 3VQ5A 3HW8A 4CESA 3OY9A 4DSIA 3RRHA 3RAXA 1RT5A 2Z1IA 3H8JA 4E7KA 5KFXA 3BGRA 3RJEA 3AVJA 3CM5A 1KDHA 2LYHA 3RH5A 9ICNA 3KKSA 4J9KA 5KFEA 1LWCA 1JLCA 5KFZA 3L3UA 3IAYA 4LSLA 3QLHA 4ZHRA 3KHLA 4LH4A 1T3NA 1UAXA 4CGFA 3SQ4A 5CYQA 3O4QA 4KKOA 4KV8A 4ELUA 4UAYA 2IAJA 4R8UB 5BPCA 1HYZA 3TARA 1CUKA 4KHNA 4W5QA 3C6UA 4ED1A 1HUZA 4IQWA 4AHRA 4ECRA 1K1QA 3ZSWA 3KD1E 2KN7A 3TAPA 2JEFA 4J9LA 4ELVA 4M04A 3CFRA 1C7YA 4DF8A 3BQTA 4FW1A 5J0WA 4KMUA 3WNHA 4RZRA 3V7KA 5DK5A 3MGHA 5HBMA 2OZSA 3RAQA 1KVCA 3V1QA 3VQ9A 4QZGA 5CZ1A 4CJRA 1IKVA 2NRWA 1BPYA 1BIZA 3DYAA 3SUOA 3T19A 3VA0A 3GIIA 3QEWA 4PY5A 3V9XA 3QE9Y 1BQNA 1XC9A 1GOBA 1RT2A 5KFGA 4QWEA 3M8QA 2A1JB 2IMWP 3VQ8A 1L3SA 1RTJA 4QZDA 3U3YA 4E7HA 2ZUBA 1TAUA 2PFPA 3QERA 4OKEA 4I2FA 4O5CA 5J1EA 5KI6A 1HMVA 1S97A 4DQQA 5DLGA 4HVJA 4GC6A 5DB9A 1C1CA 4H8KA 4PGYA 2PFQA 9ICCA 3C2KA 1TKZA 2R8KA 3NGZA 4UB2A 3SUNA 1DLOA 3RWUA 4DL6A 5F9NA 3HPOA 7ICHA 4CE9A 1RTIA 4F4ZA 2KFNA 1JLEA 4DTNA 4LY7A 1EXQA 4I2HA 4I2DA 4FBTA 1HQUA 1KFDA 4B08A 3HWTA 4CEBA 3MEDA 3BQ2A 4KLQA 4N41A 4W5OA 4YMOA 5J2BA 4IRKA 4CHOA 7ICNA 1KLNA 1T03A 1J5OA 4CGDA 1S1TA 4BE1A 3SI8A 3T5KA 1QSYA 4JS4A 4E3SA 1BPDA 1VSDA 5KT7A 5KT5A 2BGWA 1TKDA 2I1QA 3KHRA 1ZQGA 4J9MA 4FZYA 3HO1A 4YFUA 4Z4CA 1XS9D 4CEZA 4ID5A 2JZBA 2FMPA 1XHZA 5CZ2A 5HHHA 2B6AA 4F4WA 4YFKA 4FJNA 4O3QA 2VANA 4F93B 4W5RA 1RBRA 4AHTA 2BE2A 5J2NA 1B9FA 3RRGA 4RQ8A 3QEAZ 3SPZA 4YR2A 4EBDA 4KRFA 4YCXA 4LVSA 3AO2A 4JV1A 2F1HA 3BDPA 2X6NA 3NGDA 4DFKA 1RDBA 3DI6A 3VQBA 3VQEA 4W5TA 2JZBB 3EPIA 1ZQBA 2HHQA 4I2IA 1HPZA 3SQ1A 2FBXA 3HVTA 2IA6A 3EPGA 2R8GA 3L3VA 1F21A 4DTMA 5DG7A 1D8YA 7ICSA 2DY4A 1NOMA 1JL2A 4ICLA 1KCFA 5KG2A 2R8HA 4CJ5A 4P4PA 4NYFA 3OYKA 5J2PA 4XUSA 3F9KA 3MBYA 3EZ5A 1NK7A 2IOCA 4F91B 3E2EA 7ICTA 1KVBA 4TSXA 3LAKA 3E01A 3WNEA 2OPPA 1CZ9A 1VRUA 1GOAA 3ZT0A 4IQTA 4Z4HA 2HNZA 3O4NA 4QW9A 2AJQA 3GQCA 2IGIA 2ITGA 1X1PA 9ICQA 1L5UA 1O1WA 2YNFA 5KFVA 5IIOA 1B43A 4X5VA 2C2DA 4DQPA 5KTQA 2D0CA 2Z1HA 1A76A 3S3MA 1Z00A 4KI6A 5IILA 5KRSA 1B22A 4IG3A 3N97B 1ITGA 4JV0A 5CP2A 2O4GA 1RXWA 2GWSA 2OPQA 4F5RA 3NF9A 1KRPA 4FJGA 4FZZA 3JPSA 3SI6A 2G8KA 3HT3A 5J0QA 2GV9A 4CF1A 4KLIA 4H4MA 1ZQCA 3O3FA 7ICMA 4KPYA 3M9OB 3JSMA 5JS2A 1QSSA 4DTXA 1Z00B 4F4KA 2HHSA 4O0IA 3OYNA 2BQ3A 3C6TA 4DU3A 1QSLA 5DQIA 3AU6A 5KFRA 3RJJA 8ICNA 1LWFA 3QEIA 3OJUA 5J2CA 3UPQA 4LZDA 2IBKA 4DSEA 3KIOA 1N56A 1T7PA 4CJQA 3RB4A 4QZAA 4CJFA 1S0OA 3JPOA 1SZPA 7ICUA 4UB1A 1ZQFA 1ZQXA 3MFHA 4CECA 3H4DA 1WSGA 3ZSRA 2ISPA 2YV0X 1ZJNA 4K4HA 4KLSA 1VSLA 1BHLA 3O3GA 4DWIA 1EKEA 4KLHA 3LP1A 4FJIA 2HHXA 3IS9A 3K4GA 1ZQLA 1XU4A 4FK0A 3UXNA 2ASLA 4YNQA 3SYZA 3CYMA 4NLGA 4M9HA 3CQ8A 4KLUA 1TL3A 3TAEA 4TQRA 4CHPA 8ICMA 3L2WA 1VSHA 4CK1A 5J2QA 1W9HA 4Z4GA 4HUEA 4BXOA 4CIFA 1YTAA 2DFLA 2AGOA 1RYSA 1SUQA 5J2KA 3NGIA 1JMSA 3V9SA 3OYLA 4YG2A 3RTVA 3L2UA 1TK0A 3PNCA 8ICZA 3V4IA 4IQVA 5L1KA 1QS4A 1NKBA 4FJHA 4H4OA 5J0RA 1CXUA 4RQ2A 2Q0ZX 3MDCA 7ICKA 3JPQA 4CEFA 4NLNA 5EWGA 4BXOB 3LZIA 3VQ4A 1VSEA 4QZFA 2B5JA 4RW7A 4BACA 2RF2A 4F92B 2J6UA 1VSJA 3OVNA 4ZTJA 4IBNA 1LV5A 3LWLA 1KEJA 3VQ7A 2OPSA 1WCLA 3ZDAA 3NAEA 4FXDA 5KFCA 4CJPA 9ICHA 3RB3A 3AA5X 1RTHA 3JPNA 3AVNA 2DFEA 5FDLA 1TK8A 2ZTCA 3L8BA 1R0AA 2V4QA 5CWRA 4J9NA 9ICVA 3OHAA 4I2AA 2NUBA 8ICXA 3MECA 1UT5A 2ATLA 5HNKA 2C28A 3T1AA 3AVLA 1FKOA 2KZMA 1NOYA 4NM1A 5JUMA 3D0PA 3NCIA 3MXJA 1NK0A 4QZBA 3M8PA 3DLBA 3TR8A 3K5NA 2P5OA 9ICUA 4DTRA 4DTOA 4FM1A 4UB3A
chains in the Genus database with same CATH superfamily
1C0UB 1ILYA 5ADZA 3HRGA 4GC7A 3MECB 1DAXA 1H38A 4UTGA 1U6BA 3PSTA 3AV9A 2ATQA 2XMVA 1XMQJ 5C7PA 1HWUA 4J9PA 4H0XB 4PXCA 1AW0A 3VGVA 2HBZB 3QU9A 3M8PB 2FC9A 2VG5A 1ZQMA 5GAEP 4PZVA 3H0RB 4KLGA 3LAMA 4ES3A 3FEYB 4XO0A 1S57A 4F3OA 2YTCA 1UMJA 1XQIA 5T41A 2P9CA 2CYYA 1GLBG 4B3TF 1NSQA 5KOWA 5CXTA 2IOFK 2ZBPA 5I3QA 3EO3A 4NCGA 8ICLA 3IN5A 2QXLA 2Y1JA 3W7BA 1RBLA 5AQWA 3TAMB 3Q7CA 2RT3A 3TVYA 1VQSA 5F0UA 3LZJA 2YN4A 3GCWP 5L1MA 1HNWK 4YHHK 3CP8A 3KJVB 2CPHA 4E0DA 4YY3K 3UDEA 2A1AA 1NGCA 5GAHP 5EWFA 3KLGB 1NGEA 3W0LA 3AQPA 1SIJA 3AVGA 2F8KA 5FRMA 2IPOB 3CMQA 5KFKA 2XYHB 3CJ8A 3M2RB 1VI7A 5L9XA 1BCOA 1XWLA 4Y2RA 1HNXF 1TK5A 2E5LJ 2QLJB 3SQ2A 3CJBA 3UQ2A 5A8WB 3ZZRA 5DB6A 1FERA 4UB6U 4O5BA 1CULA 2QE5A 2VKQA 2AYEA 3KJQB 1ROFA 2IM0A 3QO9B 3G25A 2F1JA 5E41A 2DUYA 4DL4A 4URGA 3PV8A 3QRQA 1RQLA 2AQ4A 3PYFA 4IG0B 3DLHA 4M0AA 5GMEA 3ILJA 2ZEJA 1JL1A 4WQ5C 4DS5A 1RT6A 3UO0A 1FEZA 1N5YB 4C4TA 2BR0A 5L46A 5L38A 1F1BB 4ECXA 5L1IA 2KZ3A 2FXUA 4PGXA 2NXUA 1XSLA 3H3NO 2IFXA 1T9XA 2QWPA 4RU9A 1YT3A 5FLXU 4UQTA 4X66K 2RUGA 2CIMA 4YOTA 3H5SA 1SB3C 2DXFA 3GV7B 1P6TA 1SS6A 5GIOA 2A2DA 5ALHA 3SBMA 1RUSA 1FRXA 2K89A 5DETA 4CBWA 1XI1A 3PYEA 5ALEA 3H90A 4Y2JA 4I6YA 4F71A 2R8IA 3G86A 3AA9A 5IT9O 2B8QA 1SPBP 2EK1A 2NR0A 4P4MA 2M8DB 4OGEA 1B0TA 3M2VB 2E5SA 2NPIA 1SCJB 2KMDA 2VDIA 4BDPA 2KJ9A 5KFSA 3W63A 5KG4A 4HEA9 2CPZA 3OBIA 4YOWA 3AXMA 1SXLA 3A3OB 2Y0SD 3QATA 4C4WA 2NRXA 3ZT3A 5KFWA 3CNHA 2DH9A 3UB5A 2I5HA 3M7VA 4LFAF 3SBGA 1NB7A 5GMKa 2ZH6A 1H0HB 2UU9F 4CD1A 4XEIA 4TKTA 4U8VA 4OO1J 2JH3A 1IQTA 3CIZA 2YNGB 2CPIA 1RDAA 3FFIB 2E1PA 5EGYA 3ZX0A 5ADXH 1WACA 1CQMA 4MAKA 4QS7A 2WOMA 3E66A 5AK5A 2ZHOA 3I82A 5FROA 2ASPA 4DV3J 4Y65A 4KBIA 1PGZA 2G8UA 3O9UA 1EHWA 5CYMB 3FM9A 4JKGB 2V7YA 4NLDA 2K1RA 5E3PA 1DRZA 3NG8A 2MKIA 5GAGU 2E7WA 3CSKA 7ICVA 3UKRA 5EE1A 4BQLA 1FVSA 1FJGJ 1AUSL 4NE9C 3W3SA 2E3TA 1MROA 3CO0P 2B4UA 3DU5A 2K3KA 4YP3A 1KS2A 2V2ZA 3U26A 3C95A 3J7AP 3CCJN 3L4QA 2ZJ5A 4XPEA 5A2QU 2KYXA 4EBCA 1LW0B 3G71S 1UVJA 2V94A 2QMXA 2J8AA 1Y0HA 4Y2KA 2VQFJ 3F0NA 3WIVA 2FMQA 3OVAA 1QUPA 1X4CA 2NREA 4LD0A 4NCBA 1FESA 3QAEA 3M6WA 3T3FA 3ZZ0A 1T05A 1IWAA 4URSA 4FWPA 4DUYJ 4DV2K 5TZVA 1S22A 4MYUA 2G5HB 3SD7A 3CVKA 5CCLA 3RR8A 1RBTA 4MDAA 3MDAA 3OYAA 3J81U 1WELA 3H8SA 1RZMA 1NBWA 4M2YA 2POKA 1K9MO 2HG4A 4L74A 4RW9A 1VJWA 2AIRB 3HZGA 3QUCA 4IFVB 2UXCJ 2DXDA 2W03A 2QFIA 5KOXA 1TKTA 4BLGA 2L5YA 1F0MA 3J7YP 5EY4A 1X5SA 3BBBA 4HACB 2UUBK 4PPXA 4GKKJ 5D4OA 2HHHF 3POTB 2ZH1A 4NLCA 1XIQA 1XJWB 2EFQA 2AF6A 3GJQB 2QW9A 2KVSA 3O80A 4CIEA 2VYPA 3PIPQ 3PACA 2I1RA 1P9QC 1FX2A 1KTVA 1R43A 2AQ0A 5IXUA 4UAUA 2UUAK 2P35A 2H3FA 3I1YA 2XY8A 5ALMA 1FFWB 1ZAVA 4LF9J 4NXZA 1E6YB 5IZHA 2D1CA 1YQHA 2AJ0A 3CJ3A 4ZPVR 4O3SA 3IDWA 1I39A 3NGYA 2G0JA 2C3OA 2G4BA 2F8TA 4R65A 2FHJA 3OLBA 4WQ4A 3BPDA 1E3MA 2DNZA 2MKCA 4J9QA 2KT2A 5HVFA 1IBLF 5MLCQ 2MY8A 3AAQA 2MQ8A 3GIKA 4XH4A 2GJFA 4MHVA 1RYRA 1M0SA 5J8YC 9ICRA 1H6KX 3MD3A 4IQMA 3T69A 1XMOJ 4GO7X 1WBDA 2IHMA 3FUYA 4K2JA 5AXKA 4Y2YA 2Q6CA 3KG4A 1S5LU 1ASVA 2QO3A 5AKKA 3T1HF 3SXLA 5F9LA 2ZIUB 2ADBA 2RKIB 1L8OA 3CJ7A 5J0OA 1JLBA 3GYXB 1J5EF 3WT0A 1RA7A 4O55A 4RJVA 4I27A 1F0XA 2BM1A 3A0BU 5LMNF 4BRFA 4DS4A 2UV8G 3DOKB 1NI3A 1UETA 4HDHA 3KUEA 2BACA 2KZZA 1IBMF 1IR2A 4NRUA 5AQUA 2RPIA 4ED6A 4BBYA 3ILLA 3I4PA 4OX9F 1ZM2A 1DTQB 1LFWA 1O03A 1U49A 4CJWA 1IXRA 1SV5B 4Q8EA 3CWJA 3Q8UA 5LXRA 5D46A 4RQ6A 3JPRA 4MF2A 4OI3A 1IV8A 1VQ5S 5EVZA 1XMBA 2F4VK 2P9UB 3W64A 3QBXA 2B56A 5K4LA 2QTWA 4IO1A 2ZIVA 4JWNA 1X9MA 2DTUA 1QD1A 4JI3F 3HK2A 5J2MB 5KFUA 1G2EA 1D4XA 2MDAA 4ZOSA 2DWQA 2JEIA 1F60B 5ALNA 1MSWD 1RSCA 5HI7A 3MWPA 4EP4A 2ZE2B 1NGGA 1KSPA 1Q86O 4DCJB 2WW4A 4N76A 3RW7A 1IG6A 4X62K 7ICEA 3K5PA 4BC9A 2KT3A 3OUYA 5AKEA 3UCGA 3AVFA 3UKUB 1HR0J 1WKJA 3W9IA 1BL3A 1TMJA 1N5XA 3M6KA 4KIAA 1N33J 4RUHA 4I56A 4M6WB 4G3IA 4H0VB 4BCAA 3UR3C 2PYLA 4ZJQA 4LRAA 2IHR1 3SENA 9ICOA 4KMOB 1X4AA 1M90T 1R3NA 3R8EA 3WBZA 2GHVC 2YNIB 3SBTA 1HKCA 2VQEF 2N82B 4DV1F 3SLCA 3R2CJ 2HVHA 1JJ2M 3MN7A 3H45C 4I69A 4A2BA 1VBYA 4Y2CA 3SUQA 4LQ9A 1YAGA 2K4IA 5IWAJ 1DGSA 4PL2A 3SEIA 1WLJA 3I56N 2GVZA 5ALZA 2MPUA 3C2LA 2KE7A 2CWXA 3P3DA 4ZTFA 4X2BA 4RNNA 4R66A 4ZIVA 4ZVFA 5EE0A 2E2OA 1SH2A 2G9OA 4EEKA 3UPFA 2V68A 4EX7A 2GQ2A 1V9OA 3CJCA 4XA5A 1PBAA 5GVQA 5FD1A 1DTTB 3THXA 1V3ZA 3D7SB 2ZIXB 1J9AA 3QEXA 4GKJK 2B7CB 2RMLA 4GY2B 3CCTA 4MFBA 3OL8A 5AR0A 3P8BB 1RM6C 1Q82O 2PFFB 1FHTA 2W2OP 4RTFD 3Q8MA 2VA8A 1UJ6A 3QBCA 3PW5A 4MT1A 5EU7A 1ZQTA 3PW0A 9RUBA 4F5NA 2HNDA 3AODA 4A47A 4HTUA 4QIWF 1WDTA 2R7RA 5G0RB 3CNQP 3QEBZ 3I31A 4NM2A 4EUVA 4A8WA 3D1QA 1PK1A 3RZAA 2P1JA 2VBWA 4KHPJ 1ZZNA 4FLWA 4OZ0A 1JJ2R 2BZ2A 3KUHA 2W54A 3L4BC 7FD1A 3Q8RB 2ZVIA 4PWDA 2GO9A 3ZSZA 3KKRA 3CD0A 4DSKA 3IRXA 2UXDF 3U4LA 4HLBA 4E89A 4QZHA 6AT1B 3IR5B 2PDAA 4G1QB 1SKUB 2ZBIA 4EZ6A 1Q53A 3OXGA 2HBJA 2QARA 4JS5A 1RWWB 5FJ4A 3CJ1A 2Q1NA 3ZSOA 1RT1B 2J7KA 2HIQA 5I42B 4KB0A 5AT1B 3IV6A 2L3MA 8ICIA 2PEBA 1X4DA 2B4VA 2NO5A 2AGQA 1D1UA 4Q44A 2P5VA 3BZCA 1ZQOA 2NSBA 5D49A 2OIHA 1GOCA 1QJHA 1N62A 4GW6A 2MGZA 1KXPA 1NJZA 1A7GE 1WOOA 4ZVQB 3LM9A 1RCHA 2YWWA 4ZK7M 3IBPA 3DRSB 2M0NA 1L3UA 4EO6A 5IV3A 3KXDA 1F9EB 1Q95G 1KOHA 3ETLA 3HTVA 3RSEA 3FJ2A 3U1MA 2JVOA 2OMLA 5AQSA 5B66U 2ZJQL 1NLKL 1UL3A 5J0UA 3I87A 1VQ7S 3FZHA 3MM6B 2FBYA 3W8PA 4CLSA 1Z1BA 3T6BA 4CDIA 1D9DA 2HKEA 2YKOA 1P9YA 1F5CA 3OTBA 4LJMA 4RW6A 3KVGA 4AYBC 4ED7A 5K9FA 1KW4A 3MN9A 4NX9A 1EXNA 2GJ2A 3TUIC 2XWYA 3JQKA 1MC8A 3QT5A 3IM8A 3LDSA 4WKRA 2BA9A 3AOCA 3TAGA 3JYTB 2AA4A 1HNIB 4P0PB 1N54B 1YBAA 1RT3A 2PO4A 1IBCB 1JALA 5DQGA 3ZC4A 3D2EB 3BQ0A 2J0XA 5B0GA 3KMSA 2HQFA 1W0HA 4OZ2A 2MHNA 2FLLA 3TTDA 2HGMA 4CI6A 1CJTB 4OJ3A 2OZMA 3ET6A 3I9V9 3PW7A 3GYGA 2RRBA 3QRPA 1YX2A 2NRVA 5KFQA 2E5JA 2Y1LB 3CCSS 1WWUA 4JI8J 1YJWN 3CT9A 1QQCA 4MMOA 2KV2A 4CLFA 2OYYA 1UWBA 4U67L 2VC0A 2LYAA 3FCVA 4K4ZA 5B09A 2J6SA 5H1SV 4KFBA 3P83D 2P66A 4AFFA 2GIRA 9ICIA 2A3VA 2E5IA 4DU8A 5A8RA 2MZTA 3NF6A 5EXWA 3DLGA 2W8KA 1EETA 3OTOF 1WBBA 1A9NB 4CGJA 4B1UB 1N33F 4PUOB 3M30B 2QM1A 5D4BA 3RH4A 1I3OB 1DQ9A 1WI8A 4KPCA 2JRSA 2DFFA 1RAJA 2A41A 4EFHA 4UY85 3CJKB 3M8QB 3G6XA 2AMCB 1YJNS 3AUOA 2FPLA 2AV5A 1B64A 5TKYA 5HANA 4PH5A 3TOQA 4BVOA 4L75A 5C0YA 1FEEA 4CJLA 4UARA 4FYWB 3P5TL 4FPBA 3TA0A 3TEHB 3UVJA 2G8WA 3B6PA 5IT9U 4CJ4A 4J9SA 2BJ7A 4AL5A 1TKXA 2C22A 2MLXA 3RBEA 1H74A 4Z7YA 1Q79A 2WTUA 4PHTX 1YJRA 5AM5A 3KKFA 2P6TA 5HLFA 2A40A 4B3MF 2F40A 4DV7K 3SSQA 4RQ5A 5KFIA 2K8GA 4B17A 1WUAA 1Q81O 3OA9A 1I51B 3QWPA 4I7FB 4LF6K 4NASA 4KHQA 3HKZD 3DGPB 3ZDDA 3DMJA 1KTQA 4P0QB 1D5AA 3CETA 2DKXA 2GW8A 1FJEB 2XMJA 5CHGA 2ZM6K 1VQON 1OY6A 1HW9A 4JP8A 2PMZC 2XMWA 3L3CA 3HP9A 4NLUA 3QINA 2F9WA 3PUFA 3GZFA 4CGZA 1NJWA 4C11A 3LYSA 4RUAA 4DU4A 2OFGX 2B6AB 4KHPF 3R2DJ 2DEIA 3BS5A 2IDEA 4WFBQ 4MFFA 4BRIA 3CDAA 3IC1A 3MM9B 3FKBA 2CFXA 3C6HA 2A5XA 4UB8U 4R64A 4V1Ak 4JI0F 4FZVA 3IM1A 1A6SA 1IIPA 2FIUA 2Y9HA 3BKUA 1TV9A 1RWXB 2BRKA 1WCNA 1MA9B 4DTUA 2GVDB 2I7NA 1NKEA 1N5TA 4X65J 3TR5A 4B3SJ 4P4OA 3QT6A 3O44A 3G4SN 2N3LA 1R8AA 4DFDA 4ICLB 3D28A 2DHSA 5HQ8A 1JLFB 1VMBA 1YKWA 4AHVA 1SIWB 4DQSA 2C3UA 4C8LA 5M2RA 4DR6F 1MMNA 3MEEB 1JXVA 3DHWC 3O4WA 4ZN1A 2R7TA 1RAGB 2DGSA 4BY9C 3NRBA 2H4WB 4FM0A 3KG1A 1CC8A 2AH5A 4Y1CA 3JXUA 2ZUAA 3L2RA 1Q7LB 4CZKA 1EO1A 4KTZA 2FZKB 3V6DA 1SQKA 1T44A 4KLFA 4JI6K 4DUZF 4ENOA 2GFFA 3ULHA 4CVNE 3QWUA 4K5SA 1B4FA 2JR5A 2LXUA 5AM0A 1FXXA 3T7ZA 4EU0A 4CFAA 3HZ6A 3N5FA 3AVIA 1OXJA 4FJ5A 4ECVA 3KOAA 1D8BA 2RQ5A 1HHQA 5DDQC 5ETPA 1W25A 4O4GA 4G9BA 5GAGI 1M5PC 3PHEA 3P96A 3PDNA 3UM9A 3DOLA 2EWSA 2PMHA 5E0OA 4YN3B 4BRCA 3DM2B 3QNNA 2MKSA 1RQNA 2D6FC 2BOAA 3R27A 2QYCA 3H1QA 3Q8PB 4DUTA 2HFUA 1N32K 3ZDEA 2H3GX 1HA1A 2WF9A 1LK5A 4NL9C 3AY9A 1CS4B 4PAAA 4P72A 4Y2SA 2VOPA 3R7NB 3ID6A 1RAOA 2GGPA 2XNRA 2VOOA 8AT1B 2A6AA 2W55A 1ZQAA 2XSFA 3I0SA 2D0PA 4CFBA 2FDRA 2MZSA 3D3CJ 3OPXA 2V6AA 4PL7A 1ACMB 3BO4A 3WXKA 5BPLA 1WEZA 2DPNA 1RAFB 3UFCX 1IBKJ 2EZYA 3BO3A 1JCFA 4M3ZA 5KFBA 4EEYA 1NB2A 3W9HA 2DK2A 3GR1A 2Z30B 4CFDA 3D2FB 2JZ5A 5CR4A 5D6GA 3LQVA 2FBTA 1WC1A 4QWAA 5CJ7A 1MG7A 1Q5YA 2PFUA 2FJVA 3RJHA 3L4IA 4NI2B 3M1VB 4Y2XA 4BGAA 3O8WA 2LFVA 5J0XA 4KLMA 5HMYA 4C3MA 1D0EA 2MKJA 2PYJA 3CULA 2CADA 2VB6A 1X8DA 4BC2A 2BCQA 2RE1A 4BWMA 1WSHA 2CUYA 4TXSA 3GSIA 3RBZA 3IKMA 1IN0A 2NRHA 4H4OB 4K4WA 3QETA 3CCZA 1IR1A 3HULA 2KG5A 1MW7A 1Z26A 2QG9B 5HMMA 2VKZG 1NHUA 4ED3A 3C1ZA 4WXOA 1CXQA 3GG4A 3PX4A 1RT7B 3H40A 1NDPA 4F67A 3MXMA 1ATNA 3CJ2A 1GLCG 2RF2B 3GU3A 1Q9XA 4MDBA 4B9LA 2QTDA 3CJ0A 2HS4A 1TL7A 3TAFA 4DLGA 4DL7A 3ED5A 1S3XA 1SL1A 3HSZA 5C42A 4BJQA 2A42A 3LTOA 4C8OA 5ETLA 4I9LA 3BS7A 1NDKA 2FQQB 4DPOA 3VQPA 3SUPA 2XGPA 1R0AB 3N28A 5B0AA 3S3OA 4B02A 4CO3A 3OYDA 3TWHA 1WC4A 3L2VA 3ETOA 1N48A 1XBWA 1Q8KA 1ZQYA 2XULA 1SKWA 1B0PA 1HW8A 2NNWA 1WUDA 4H5TA 1KHVA 1Y5LB 3HHDA 3MR7A 4KLLA 2DH8A 2HZAA 3CC4N 1M5OC 1YJTA 4O23A 1KQGB 4FJ9A 2FBVA 3L3FX 2E2QA 3O3HA 1IG9A 3KZIU 5BN9A 4CZEA 1XUPO 1ZAXA 1RGVA 3MR3A 4WZMA 3MCMA 5ETKA 3C29A 2ZC4A 4ZDNA 2ZZMA 3GDQA 2V63A 1BHNA 2WONB 4WFNQ 1UW4A 3FMBA 4A8MP 2W9MA 2W9AA 2GS8A 3VTIA 1DURA 2F8HA 3KTQA 2XLJA 2ZWHA 3RB0A 3FQLA 2UVUA 3ZSVA 1BQMB 3M2UB 4NLPA 2MSSA 2H5EA 5KFDA 4UB5A 3OS2A 4DPUA 1Y10A 5D4LA 3T5LA 4HI1A 1HQEA 3D67A 1HNVA 3UXPA 1Y7PA 3F41A 3M6XA 3VGKA 3QQCD 2FF6A 4JLHA 5JXSA 2MKYA 3VVTA 2XY6A 2YNHB 1VQMS 3LDPA 2CJ9A 4EWTA 2MA1A 1REGX 4YXJA 1VIOA 2YX1A 1E4FT 1LWEA 2DNYA 2MMYA 5F8LA 4KLOA 1Y5IB 4DR3J 1GH8A 4N47A 4ILHA 4WQ5A 2C3YA 2W9CB 3W60A 1KNZA 2AT1B 2Y8WA 4QWBA 4RW4A 3GFHA 2FHKA 1RT5A 1NAQA 2A19A 1NDLA 3UNGC 4IL6U 3EN9A 2LYHA 4FF1A 1ZA1B 9ICNA 4YDDB 2GMLA 4J9KA 4KH4A 4IEIA 1JLCA 5KFZA 5ALPA 3K8WA 3L3UA 1ICEB 4RBVA 4ZPCA 3DDIA 1UAXA 4CGFA 3C0BA 4KV8A 1KWMA 4ELUA 4UAYA 1A0OB 3CCQN 4R8UB 5BPCA 5E79U 3W9JA 4W5QA 4ED1A 1HIWA 4LSNB 2RHSB 1K1QA 2WBRA 3GE9A 3ZSWA 2KVIA 2H5JB 4CT8A 3CCRN 3DLLQ 2HK3A 3BQTA 4FW1A 2IYIA 3ZNJ1 4OX8A 4LQ3A 1XMQK 2YKMB 2E1ZA 2WAQC 4M7YA 1KVCA 3V1QA 2K06A 1L7MA 3DYAA 4V19S 4DV5F 3IGNA 3J80U 3RBXA 1KL9A 3C6UB 4PKDB 1FIQA 4ZA1A 3V9XA 2OANA 3H25A 3QE9Y 1GOBA 3R3LA 5KFGA 4KE5A 1U2RA 1D09B 1UEVA 4JI4J 2MQQA 3Q7BA 4OKEA 4O5CA 3O1LA 3VGMA 5KI6A 4IH6A 1APSA 2UUCF 4DQQA 1U6FA 4HVJA 1C1CA 3SDEB 5F2RA 1PSDA 2UP1A 1KC8T 5CH7B 1WF2A 3ITHB 3QAUA 3SUNA 3ZETB 4FZMA 1DLOA 2OGUA 4OI6A 3RWUA 4TU9A 4IOAL 5F9NA 1R31A 1RTJB 3B4DA 3PHTA 2VIXA 4F4ZA 4BRQA 2E5LK 4AXIA 1HQUA 1GTEA 3RW6A 2G0CA 4B08A 2KKZA 4W5OA 1N2XA 2DRDA 2XSJA 3CF5Q 1Q1KA 3VVUA 4AYBF 3QT8A 2PN6A 3T5KA 2DNNA 3QU7A 1QSYA 3G87A 4A8YA 5KT5A 2BGWA 2DO4A 1TKDA 2QWNA 2I1QA 1L7PA 4U8YA 1B4SA 3T9NA 5CA5A 2V7ZA 4DQ8A 2QB1A 1S59A 3HO1A 3HOTA 4YFUA 1XS9D 2I5JB 3EWGA 4ID5A 3ENAA 5AQVA 4NLSA 3AEVA 4MKAA 2WUSA 5CZ2A 1F9FA 5AE1A 4F4WA 5C2CA 4YFKA 3MM7A 4O3QA 5KPTA 4FJNA 2QLTA 4F93B 3RJMB 1RBRA 2B9XA 5J2NA 1B9FA 4HTJA 3B4MA 2IVPA 3N5BA 4LF4J 4V19X 2NZCA 1V4TA 1X9JA 1RDBA 3F5AA 3W2VA 4W5TA 2XHCA 3DC2A 2Y9TA 1FDDA 2FBXA 3HVTA 4DR7J 5D4NA 3AOBA 1RT4B 2RVJA 3AAWB 2KT5A 1RAEB 2BE2B 1NOMA 3FZFA 5KG2A 1BA1A 4RCHA 1YJVA 2FJAB 2O8BB 3OXLA 3DXBA 4QPXA 4XUSA 5AQKA 3S6JA 5THWA 5LY3A 3EZ5A 7ICTA 3MM8A 4FL9A 2OPPA 2EG2A 1IVZA 1T9VA 4Z4HA 2HNZA 4K4XA 2FY8A 2AJQA 1OS5A 4F3MA 2M70A 1O1WA 2EW9A 1N4LA 2HWIA 5M1PA 3TSUA 3AJDA 5JVGQ 1A76A 4BR5A 4AP9A 1U09A 1V3RA 4CYUB 2CAJA 1JLGB 2CQIA 4DV3K 2Q3PA 1ZXOA 3N97B 3TJ9A 2GWSA 1ZRNA 1VRUB 4NLWA 4F5RA 2QC3A 3BR9A 3JPSA 1V97A 2GV9A 2M0GB 1GEHA 4CF1A 2K4HA 3THPA 3GE1A 2WFAA 3NEKA 4DR3F 1I94K 4KPYA 3M9OB 4HAIA 3UD5A 3EKUA 5D0HA 1C20A 1KONA 1NEEA 4DTXA 4F4KA 4BHQA 2F8LA 2HNYB 1TUUA 2WVEA 2EG1A 2F5GA 1MWMA 3AU6A 3CO9A 5KFRA 1FO1A 4US9A 2OPQB 3T1YF 3QICA 3QEIA 1PAEX 3OJUA 5J2CA 4LF8F 2YB1A 3LPEA 2IBKA 4DSEA 4UT4A 3VF6A 1EX8A 5HVGA 4QZAA 1G6BA 3HFVA 2MKKA 4QNLA 5EHHA 2DNRA 3MCNA 3SEOA 2VQFK 4UB1A 5AQXA 3KWGA 1GMUA 3H4DA 1WSGA 2ISPA 2DNHA 5AQQA 4L3NA 2PMZF 1K8KA 1BHLA 1EB0A 2F2AB 1Y00A 2DCLA 4KLHA 3LP1A 1GMWA 2HHXA 3IS9A 5GTHU 1XU4A 2RNEA 4DUYK 2J7UA 2OD6A 3SYZA 3FSIA 5FLXY 2O66A 4OYIA 1HWJA 3TAEA 3SAHA 2F9JA 3M6GA 4XAKA 5J2QA 4AF1A 4HUEA 1X31C 2L9NA 2DFLA 2OXOA 3DU6A 2UXCK 2EI5A 2HWTA 3OFFA 4YG2A 3ILOA 1HI0P 1F2HA 4TU8A 4H4KA 3PNCA 1KKHA 8ICZA 4CT9A 4IQVA 3CPWR 1J2VA 1XR5A 3NNCA 3S1TA 2XG8A 1WG5A 4NLNA 2OKQA 2YHYA 4QZFA 2HI0A 5TISU 4BACA 3H0LB 1ZD2P 4P74A 1SUQB 1YGYA 1R8CA 2L08A 3OVNA 4QYZJ 1N34J 4IBNA 1ZBTA 1HBOA 1KEJA 1H73A 1VQ9N 1WCLA 2M8HA 2COLA 2IIHA 3EDRB 3EDQB 4M5IA 1EWQA 1U24A 1N60A 4DHVA 4CJPA 3BSOA 2RQCA 4Y2QA 3MCSA 4LF9K 4XK8C 1Z4NA 4TVAB 5FDLA 5ETOA 3MWBA 3L8BA 4JI7K 5CWRA 1Q3VA 2B5JB 2F65A 4I2AA 5HP1B 2FJDB 8ICXA 3GG1A 1UT5A 4ID8A 3AA8A 1JJ4A 1FKOA 3OQ2A 3AGKA 4FOEA 4N77A 2ASOA 3MAHA 3R5JB 4H5RA 2HQ3A 1Y4ZB 3R6GB 3MXJA 5D3GB 4WF9L 4QZBA 1QVFM 3TR8A 5DM7L 2WBNA 1RTHB 1XMOK 1U2CA 4W4MA 4CNYA 1VRTB 4FM1A 4U95A 3DN9A 3VC8A 2QL5B 2G2YA 1RADB 4YOUA 3KMQA 4ECYA 2IC3A 1T8EA 3EGNA 5A2QY 4MH8A 1MN9A 5GIPA 2R42A 3HVRA 2DCUB 4L73A 4LF4F 3ZTQA 4O3PA 3CERA 3D7EO 2G08A 4MFAA 1Q0NA 3KLHA 1W97L 1WC6A 4Y3CA 3GFXA 4F72A 4DSLA 3M1FA 2OTLN 4BGDA 1XR6A 4MK9A 3FZLA 2XB2D 1U0HA 3D6FB 1K5OA 3PRDA 2VG6A 1LOUA 5E3QA 2R2TA 4H03B 2KXNB 3B0XA 2D0AA 2DNGA 1K47A 2W2MP 3J8AA 4DJBA 4Y2PA 4P71A 3EY1A 4M95A 2V9WA 2KXHA 4EENA 4EMDA 2ETJA 5HMWA 2VG5B 1SB6A 5J2FA 5AI5A 1JLAA 1GK8A 3VETA 2P9IB 1UPHA 1HHTP 5M2UA 3LP2B 2F8SA 3PM9A 3A5MC 2Q43A 4HVZA 2BQRA 4OIXA 2O8DA 4NCGB 2WHEA 1RKIA 2RQKA 1C1AA 1FJCA 3B0YA 1FD2A 3M32A 1QHAA 4X64J 4EYHB 3TQEA 4QIFA 1WSRA 1HR0K 5J2IA 3CHWA 4M41A 4UAVA 4LF5F 5AZJB 4ZLJA 4QIWD 1NGDA 1LK7A 3DV9A 3AVKA 3CCJS 3L7UA 3D6MB 3DRYA 3PFOA 7ICLA 5BR8J 1J27A 2P9GA 3V1OA 2JRZA 2CZ4A 1F3FA 4RNOA 5AK4A 4CEAA 1XO0A 4DR5J 2G0AA 3PYGA 3CD5A 4CO2A 3NS7B 2LSNA 2MQOA 2GAHC 1ZS6A 3HL8A 1EP4B 1VOMA 4FLUA 3PIOQ 3CJAA 3CFOA 2K60A 3C5GA 1UFWA 2EDUA 1WOQA 2W2NP 3TVZA 2G1HA 3VR1A 4NA1A 1ZBLA 1AFJA 5IWAK 3P39A 4GFJA 3A8EA 4KJIA 3WEEB 3X1LB 3EUNA 5HRSA 3ALYA 2KJ8A 3MAQA 1S9FA 4DV2J 3GIJA 3N7SC 4LRBA 2AEJA 4DQRA 4WWSA 3RJFA 3RMDA 1RT6B 1W2IA 2XYGB 3SCIE 2GBZA 3JSBA 4EBEA 2A1JA 3KUGA 8RUCA 3RJIA 3CE8A 3MDFA 1IM6A 3P49B 1UKUA 5L39A 1T94A 2VONA 3KLVA 1DARA 3CJRA 5CB1A 5M1KA 4L6V3 4JB3A 4USKA 1SJ1A 1X4BA 2V2KA 3HSDA 2HOQA 3TWZA 5AJ3K 3EE8A 4BR2A 2V4RA 2DHGA 4J2AA 1RTZA 2YWFA 1TE2A 1YJ9S 1U8SA 4I2QA 1LVHA 4WYWA 4W5NA 1K73O 1HNWF 4E1MA 4YHHF 1SJ3P 5KRTA 5ALRA 4ED4A 4YY3F 5A0YA 5LXYA 2QMWA 1WSIA 2OPRA 2A1SA 1ZM3A 3B6OA 4CCHA 2FD2A 2IM3A 3NH1A 1S1XA 1ZQDA 4AQYK 4DCOB 2DGTA 2P9PA 1RHUB 2F44A 1CG2A 4NPOA 3NBPA 3UQSA 3TA1A 1BC6A 1NM1A 3TADC 1FRMA 1WYGA 3TANA 1NPPA 3A5OC 2A6MA 5G5HA 3VGTA 2LP4A 4ZVUB 5I3UB 4KB7A 1K6YA 1L7OA 4CK3A 2XTJP 2LXIA 1ZH5A 2XQCA 5BN8A 2WOMB 1ZETA 3MUTP 2JX2A 5AE3A 1NPKA 3O3LA 3N6LA 2FPMA 3DRRA 3SNNA 2XNQA 3EVMA 5DM6Q 1XNRJ 3AN1A 1RJJA 4NYNA 2K1RB 4KAZA 4BDYA 4RUCA 3AVMA 4J2BA 3PEJA 2C2KB 3UKRB 4X66F 2D7SA 2RD5C 1ZD3A 3D6HB 2YWKA 1RABB 2MQPA 2JOQA 3O0FA 2IMOA 1MROB 3K9KA 2KXFA 1NU0A 3MF5A 4YB5A 1RFQA 4OJHA 2BGGA 2HFZA 1ASUA 2WAQF 5AQIA 2D3OR 1I1GA 2ZC3A 4K25A 3U27A 5ALFA 3MEKA 4UZCA 4ISEA 2KKVA 2PY5A 2NV3A 2GWJA 3HBTA 1ESVA 2QN6B 3QJPA 2CJAA 3NVZA 4FWQA 5B0BA 2I7PA 4HYKA 5F8NA 5T7LB 5KFPA 5ALVA 4CEOA 3NH2A 4BX9C 1FXRA 1N8RO 3H5UA 1RGIA 3HHEA 1UAWA 4G1PA 1S9EA 1T05B 3NS1A 3H46O 2E1YA 1C6VA 1CJUA 4DCCA 1VDVA 3F9MA 2Y3YA 1DHMA 4A2AA 5KAIU 4JI1J 1TL1A 3C2MA 3AVBA 1NM2A 1ZZFA 5HMXA 2R7WA 1KVAA 5SWMA 1HUOA 1X3MA 3EZUA 3CQXA 4WCEL 2ZD1A 1YITN 3MR6A 3DLKA 4RW9B 4JI8K 4CK2A 4PHDA 2RRNA 1IKWB 3QU2A 3OS0A 4BUGA 3ZX3A 1Y11A 3TSPA 2OEJA 3OSNA 2YY3A 1NGIA 1KR4A 4ETZA 2YMPA 2GJIA 4DSJA 3U02A 4JI5F 3E9OA 3FNNA 1FDNA 3A3PB 3IP0A 4RO0A 4I28A 2CQ1A 3MR5A 3VAHA 5LSOA 4NLKA 3D5MA 4MN4C 2N7CA 1VAZA 1NK5A 3QUQA 4HHJA 4FLYA 2XCAA 2XS7A 2Z2ZA 1D8ZA 5AKJA 2ZH4A 3HDSA 1U2VB 3MI7X 2D3DA 2MZQA 2YJFA 2MQLA 3I56S 1S1VB 3BR8A 2H51B 2VPZB 1VISA 4Z37A 4IJNA 3FLCO 4YDUA 1VQYA 2LDIA 3W5ZA 4ZITA 2ZG6A 1N6QB 4OX7A 2CRXA 1SC4B 3Q8QB 4PPZA 1S10A 3B9JA 5AKZA 1QY7A 5B7WA 4NLZA 2ZDPA 4CBXA 1Q18A 5DG9A 3RF9A 3FDSA 4ALZA 5F8GA 3SV4A 4CGGA 5KPRA 3VZHA 2EZXA 4OV1A 4DV2F 3ZI4A 2E9ZA 1RHJB 3TZXA 4JYAJ 3F5EA 3C16A 3K7RA 4OPKA 5JICA 4NZ7A 3AA3A 2DTJA 3RR7A 5KFFA 5HMLA 3TUZC 4GV6A 2BKOA 1J2MA 1R89A 4F5QA 1EQYA 2EANA 5J2DA 9ICAA 3BF3A 4F50A 4TN2A 1JLBB 4KTQA 2H3QA 1HKAA 5M1FA 1BPXA 2JLEA 3NLCA 3QMQA 3LUYA 4DPYA 3BGOP 3PG9A 2GHWA 2UUBF 3P5JA 4K4IA 4CIOA 3OTDA 4BQZA 1JLQA 3NE6A 3A5LC 3PRVA 3HHNB 3Q8LA 2YKNA 4RWXA 2DR9A 4DL3A 1ZOLA 3QMLA 4U7UK 3GYNA 4CZMA 3HFKA 1U8WA 3U6FA 4OLAA 2ZDOA 2V5HG 2UVWA 2P9LB 1S12A 4LH5A 4YMMA 1NSKL 1D8LA 2GNKA 2OP5A 1FEHA 2H65B 4BE0A 3Q89A 2UUAF 5KPZA 2CQ0A 2ZIVB 2J4RA 2HOIA 2QT7A 5CE3A 3KLIA 3Q86A 4X65K 4PR6A 4KAIA 4UAWA 1ZQWA 1QDUB 3OPKA 4B3SK 2E44A 3AARA 3DGVA 3BBFA 4EGLA 4EAHD 3KWIA 3N6MA 2O8FA 4HTLA 2XLIA 4CLLA 2D41A 4FDFA 1BMQB 4WBFA 1JCEA 2V9KA 3VEXA 4DO9A 1YXQA 1O0PA 2VG7B 3NCQA 4Z4FA 1C0UA 4CBUA 5HROA 4RQ7A 2F8EX 2ZOMA 3OUYB 1NMNA 4IOCQ 5HL7Q 4I2BA 4ILMA 2HURA 1WNSA 3HD2A 1SVDA 2FVQA 3J7AN 2LEAA 3ONNA 3IG1A 5IC6B 2X78A 3HOSA 2PC6A 1N88A 4C98A 4BS2A 3EE9A 2RAQA 1NK9A 4LZGA 1VQKN 4DV6J 1ZQVA 3H2UB 1BUPA 1B0VA 3MUMP 5AI6A 4QZIA 1Y64A 4ECTA 2X3DA 2ZH8A 5IT9Y 2ILYA 5KFJA 1UFKA 4M9GA 4Q0BB 4H0TB 2XMAA 3ID8A 1GO3F 4OZNA 4K43A 4LIWA 5ALKA 1S6QA 1SV0C 4C8YA 4QWCA 3TAMA 1OKJA 3U7JA 3PX0A 4JV2A 2DNQA 2CPYA 3ISDA 3K9JA 3MWTA 1TYQA 2OCEA 3THWA 3CRXA 2ZJRQ 1A5WA 1E6VB 2F4VF 3W5YA 1YJWS 5HR7A 2MJUA 2I6XA 5G4DA 4J9OA 3EJMA 3UCZP 2NUHA 4OPAA 4B8CA 2LA4A 1J53A 2FC8A 9ICTA 2GLEA 4OHXA 2RHKA 3L09A 5KFMA 5ETQA 5GMDA 3NWRA 3J7ZO 2H5XA 4A8SA 4HDGA 2LPEA 3DFEA 2WVFA 4X62F 3RU0A 5AQTA 2HNDB 4A8KA 4F0HA 3H20A 3MGIA 3JAMO 3JS9A 1GMWD 1WC0A 4M5HA 4CZLA 2CN1A 1RA6A 1S72N 4URQU 2IBOA 4FPIA 4EP5A 2AX1A 3Q8VA 1G3OA 5DKWA 1IBKK 3TO8A 3V9ZA 2W7PA 3ZTSA 4IDHA 8ICEA 5IM0B 1FWPA 3IRXB 9ICWA 5ALSA 1RDRA 4QJVA 1JXLA 4FO0A 4B9UA 3I8BA 2OJ3A 3WX8A 4TURA 2BJ9A 2DGXA 2QARB 3C65A 1L8LA 3QIOA 1YRXA 1VSIA 3T5JA 3RMAA 4CF0A 5ALIA 1PIEA 4F9OA 4NLTA 4EIAA 4GXIA 4O3NA 2DF4B 4ER8A 3TNVA 4I9QA 2B4PA 1U6ZA 3WK5A 3ZZPA 1BD6A 3K59A 1QUVA 2RDIA 2VC1A 2MGZB 4DV7J 1W2BR 2KSOA 4KSEB 1KN6A 3CTRA 1KD1O 1Y9OA 1WAFA 5HK4A 1GLEG 4CF8A 5K8PA 1JIHA 4X4VA 2E1AA 4GKJF 4M63A 3MD1A 4Y28C 1VQOS 2LQ5A 1K0TA 2EAOA 3RSEB 2PZSA 4P10A 3PEHA 5AM3A 3SFGA 2RQMA 2ZM6J 4FWKA 2FZGB 1ELOA 5AZIB 2ACMA 5D78A 4B1YB 3F2BA 4C4RA 3CXCM 2KYZA 4B1VA 1HNZF 1ZQJA 3QJJA 4BDZA 4RW6B 1SAZA 4JHDB 3G82A 8ICJA 2DY1A 3ISZA 2QWOA 3H8MA 3FZKA 2YJEA 4KHYA 8ICRA 5BYRA 2QV6A 5AFUH 4Y2IA 1R27B 3AVAA 3ZZUA 3RAMA 1NMEB 3R5AA 3N4PA 1X4EA 1CLQA 3HSTB 4JKGA 1NNDA 3VHQA 2DXEA 2LU2A 5B8HA 4WP9A 3MOJB 1WG1A 4Z4IA 2K4PA 5ALGA 1S1WA 3QEVA 2HHWA 5K20B 1B9DA 3G4SS 1U1KA 3AHPA 5C2DA 3AO4A 5BOLA 5KG7A 3BZKA 7ICJA 1H2TZ 4KHSA 4UASA 2B9WA 1OYDA 2E66A 4CI0B 3D3BJ 5AM1A 4OHYA 8ICPA 1IG8A 4QAGA 2VGNA 1ZQEA 1C4CA 1LW0A 3NS5A 3V6HA 1PJ6A 1N5QA 4CGHA 2ZZTA 2EX3A 3KNGA 5FPEA 2RHQB 3CXCR 3CM6A 1RDFA 2ZBQA 5M2PA 4KFBB 1OQ3A 4EYIB 2ZH9A 1S8OA 1IV0A 5A8RB 3H8WA 3DLGB 1EETB 3HM9A 4FF4A 1BIUA 1UEKA 4TYAA 4K0KJ 3G6YA 2LKZA 2ZWOA 2V8PA 4XRHA 2DQNB 2R3VA 3Q8KA 2KICA 2KEYA 1S99A 4AM7A 9ICBA 5L1JA 2GV1A 5HP4A 3HJEA 4IFVA 3HHLB 2UXBF 2C2EA 5HAOA 1SWWA 2NRTA 2V69A 5C2FA 5FIIA 3GZ7A 4EHTA 3PKYA 4OYMA 1TKXB 2IA0A 2Q36A 3M8SA 3S8SA 3POTA 2GZOA 1FK9A 1DT9A 3HI0A 3I32A 1U47A 3N4WA 4GRSA 4OYXA 4CLWA 2PBDA 4CTAB 2MEWA 1B70B 4AL7A 2YMLA 4RQ3A 5BR9A 2PI4A 2MSNA 1NDCA 3FBEA 3KWMA 5HLFB 1LAVA 4BRHA 4CO0A 3HP6A 4CO1A 2YMQA 3QUBA 3LO3A 2K3IA 1ZQSA 2G09A 4F4YA 3MHYA 2BOPA 4KREA 4G65A 3MXIA 4Z7CA 2NLWA 4PA1A 4Y6IA 4AYBD 4ZVTB 3EL2A 1G99A 2P9EA 2H3ZA 4P7TA 4M3YA 4OLOA 4F3QA 1VK8A 3LDOA 4GVEA 4OL8A 1RWVB 1N36F 1BQXA 1X0FA 5ITHA 1Q81T 2Q66A 4LF7J 3MPWA 2QA4N 4YMNA 1Z2ZA 3HSGA 5E3AA 1XK8A 1YUWA 1A5XA 2B9YA 5ADXA 1GX5A 4DR4K 5CA7A 4JI4K 3BS5B 5AQZA 4NCAA 3E58A 3IFRA 3KD5E 3HYFA 1S7HA 4K4YA 2JH1A 4TUSA 1S5ZA 4PWWA 5DDYA 4OI1A 4B3RJ 4DFPA 2HVDA 1LQ9A 5LMUK 4ANEA 1KQQA 1RNHA 2RKIA 1IKXA 1R6YA 3BB5A 2UUWA 2VA2A 2BABA 2K7JA 3OBYA 3E01B 3AJ2A 5KFYA 1TGOA 4LUBA 2SXLA 5DBBA 3KKAA 1M5VC 4DMNA 4OZJA 4WJBA 4CHZA 5KFLA 3OTEA 3MCPA 3EE3A 4K4SA 5C12A 4O5KA 8ICAA 3FC4A 3DHXA 2EKNA 4F5PA 2PEHA 3NF7A 2DBBA 1Z1VA 4E1NA 5DLFA 3NRZA 4H0OA 1MU2A 3MDQA 2ZJ8A 2G2OA 3BF1A 1PYTA 3MEGA 2KJWA 1H1VA 5CY4A 3Q24A 4CHYA 3F2KA 4CM2A 1KLMA 4LF6F 1Y97A 2O67A 4FJXA 4K8XA 3A8IA 5A76A 1JNZB 4C7YA 4KLEA 3NCRA 3IMXA 4BG8A 2HAFA 3PO4A 4YD2A 2ZM6F 3CC4S 1DKGD 4YDXA 4K8ZA 1AROP 1VK0A 2ZIWA 3GB0A 4PG6A 4ED0A 2ZE2A 3PY8A 1RWMB 4UY8T 1RBVA 5EWEA 4U7BA 5H2FU 1GLJO 2AYMA 4GIBA 4NZ0A 5CCMA 3UKUA 4RPFA 3V1RA 2ODGA 2CPFA 5CR0A 2D5RA 4NLBA 3H98A 1PJ5A 3DOLB 1HPMA 2VFRA 2VJ5A 4DR7K 1WOSA 1TVRA 2QEXN 4AHSA 4OYWA 2VL1A 1X7VA 3VCDA 2QSWA 3E8OA 1RWNB 2UXDK 3WK8A 2DH7A 3I33A 2KD1A 1C0TA 1ZOTA 1PUZA 1WEYA 3ZTRA 1B3TA 3A0HU 2M52A 1F2GA 3I5AA 4CZHA 1TL3B 1UVLA 1WOPA 4RPYA 3TRGA 3IG5A 2HWHA 2PMZD 4CDGA 4OJLA 1OIAA 2ZWPA 2GGPB 4ZOHC 2VFTA 2HVEA 4DR1J 1AXQA 4DV4F 1F44A 4ZPAA 5K14A 2C2NA 4J37A 3F2CA 1HX1A 3H3OB 2RDDA 2Q31A 1NG9A 2DIVA 3DLLL 1QQMA 2QA4G 4ZCKA 2NCKL 5D0GA 8ICUA 1IKYA 2XEXA 4QOZB 3T79A 4I2EA 2C1EB 4JI6F 1QTNB 4OZLA 1ATSA 3K17A 4F5OA 3TAQA 1YTYA 3LW5C 4OJRA 4OYOA 1T9UA 4DBQA 5KT3A 3N7PD 4A8EA 3KJNB 4AT1B 3KLEA 2MLYA 3CCQS 5C15A 2QXFA 2BE9B 2BPFA 1V5VA 4Y0FA 2MTLA 2CQGA 3OYFA 3CCRS 4J9VA 3NMRA 2A3JA 5IQQA 2O4IA 3A8KA 4LFCJ 2E8MA 3O2IA 2DY9A 4BR7A 1RDDA 4UOCA 3MN6A 1RHRB 4F8RA 2U2FA 1FA0A 3OXFA 1KVIA 1TL7B 4KLJA 1N32F 3L6QA 5LJWA 2NZTA 2V8DA 4LF1A 4NXNJ 2LMIA 4LBPA 3FSXA 3QFWA 3H7IA 2KN4A 4PHAA 1RB0A 1WKKA 4JKCA 5I42A 3RMCA 2GMHA 3UMGA 4XPCA 2E8PA 3BKTA 3CD6N 2GUIA 5KGXA 3R7BB 1SJFA 3CCVN 4CNQA 5T14A 3MUVP 1FKPA 4RQ1A 2ILZA 1B7YB 1Z25A 3VGSA 2DRBA 3DXMA 2ZZNA 1X9WA 4DTSA 4IEEA 3MTJA 4DL2A 3DRSA 2CQ4A 4HUFA 1RBAA 4TUQA 4Z6EA 3EMTA 2LM4A 5EE9A 1JQGA 2PFNA 5ALQA 3SAGA 2LCWA 8ICVA 3BGUA 3C46A 4BR0A 4M45A 5FPNA 1N5SA 2VJ4A 4DMZA 3ALRA 4Z6FA 2Z1GA 5B5EU 2ITMA 3UMCA 1VBKA 4QYZK 5JS1A 1N34K 4JRQA 2KRBA 5J0YA 3ONQA 3CJQA 1TL5A 4FLXA 1FWKA 4UW2A 4C7ZA 2HHTA 2ATCB 3MZIA 4DOAA 4FK4A 4QZCA 3SSRA 1ZYQA 3KHHA 3AA2A 3OY9A 2CXYA 1BLUA 3RAXA 1HNVB 1EIYB 3RJEA 3CM5A 5E7OB 2ADCA 2H54B 3A0IX 1NPRA 3TTFA 4LSLA 1Q8LA 2FPHX 1LWEB 4LH4A 1T3NA 1O8BA 5CYQA 2D4WA 3SQ4A 3GG0A 3O4QA 4JAXA 1H7XA 4RW4B 4BC4A 4ZPTR 4KHNA 2KDOA 1RT5B 3JAMU 3QIDA 2HRYA 2FHMA 4ZPDA 3TAPA 2YPZA 3K89A 3FQKA 3SIPB 3WQTA 4USVA 1HKGA 4M04A 3CFRA 1T3QA 1C7YA 1CJKA 1JLCB 5J0WA 4KMUA 4FVUA 2BJ3A 3OD2A 3QSIA 4KQZA 3V7KA 4PKIA 4X4UA 3UN3A 3RAQA 1NZPA 4CJRA 1IKVA 2BJEA 4HWIA 1OVYA 4KV8B 5KQDA 1SJ4P 2O5DA 3KG0A 1BIZA 1OJ4A 2XMUA 4H5VA 3SUOA 3M30A 3T19A 3SMPA 5CRXA 1EKRA 4O3MA 2AYBA 2VGMA 1QH9A 1GQEA 5JMNA 1T3OA 1AQ6A 3I55N 1VFJA 4LIRA 1BQNA 1RISA 1RT2A 4F02A 3BEXA 3M8QA 2WK4A 5JLFA 4PZNA 2CA9A 2ZITA 4C9DA 3KK2B 3US5A 1T0TV 4QZDA 2W6LA 2ZUBA 4DU7A 2CH6A 2WF8A 4I2FA 5J1EA 5AI8A 4BROA 2V4JB 2E7XA 1VJQA 4LBIA 5DB9A 4BRNA 4H8KA 2PFQA 9ICCA 5FP0A 1TKZA 2R8KA 3MXHP 4OYZA 1UVIA 1BOTO 2FJBB 4RUBA 3THYA 2ZJPL 2F77X 5I3PA 7ICHA 3CIMA 3VEOA 4N8NA 1MNEA 4X64K 4FPRA 4LY7A 3BSNA 2FY1A 1I94J 3MN5A 4I2HA 4I2DA 1ZTWA 2DIUA 2Z8QA 3HWTA 1C1CB 4ZLLA 5DDOC 4CEBA 3DGPA 3D6TB 2JH7A 3MEDA 1M5KC 3RFAA 4N41A 4KH1B 1MWYA 1RLCL 5J2BA 1KLNA 1T03A 3UR0A 2QSFA 1S1UB 2O8CB 3SI8A 3FZBA 3R5DA 5BR8K 1BPDA 4ZVPB 5CAAA 5KT7A 2FVSA 4BRLA 4JOUA 3EVWA 4DR5K 3VGLA 1ED1A 4HHUA 4LF2A 1WD6A 2B6AA 3AT1B 1SQGA 1QAJA 1COKA 4WK3A 4AHTA 3CC2N 4QIEA 3OLAA 2KP7A 2J9EA 4RQ8A 3SPZA 4YR2A 2LQJA 3MM9A 3HD1A 3IGVA 4LVSA 4IO8A 4K59A 5EDWA 3AO2A 1XMQF 1JI7A 3F2DA 4H5NA 2OI2A 3R9LA 4BRAA 4RWTA 1YVFA 4ID5B 1ZQBA 2ZJQQ 4I2IA 3SQ1A 3P31A 2NXNA 1HEKA 2RLTA 2FJEB 2XBPA 4J7CA 3R9KA 3I9ZA 4DTMA 4J03A 4K42A 1KAXA 5DG7A 2BTFA 7ICSA 5J2NB 1UHUA 4NXMJ 2B51A 1JL2A 4ICLA 4OJOA 1ZM9A 2VICA 3C7NA 1NLVA 2KKPA 4C0HA 2ROGA 4P4PA 2VBYA 1E4GT 3OYKA 1NK7A 2BM0A 2DNLA 2ZKTA 4TSXA 3W2VB 1N61A 4GO5X 3GFYA 5EX5A 1OPIA 2QL9B 4ED5A 1GOAA 4IQTA 1VQ9S 1KBUA 3QGGA 4QW9A 2IGIA 2VU5A 1M1KT 2ITGA 2M4MA 5AKXA 5IIOA 3NXZA 1CVJA 2W25A 3H7HB 1UQVA 4DQPA 5KTQA 5JVHQ 2QYGA 2WFBA 1ZA2B 1J2NA 4KI6A 5DS7A 1DK2A 4CW7B 5KRSA 1UJ4A 1ITGA 2OPPB 2E5LF 2O4GA 3M3ZA 3G2XA 3NF9A 2F9DA 2V0NA 5AKGA 3QDKA 4JI7J 4WQ4C 1IWGA 1RHQB 2G8KA 4KLIA 1IJEB 7ICMA 3IG8A 1TL4A 2QWLA 3QIPB 2RU3A 3HSJA 2HQCA 2FTRA 1V38A 2HFSA 2YH1A 4QR0A 2HHSA 1V3SA 2QLBB 4QS8A 2KIWA 3G8TA 2WSEC 2UZAA 3C6TA 1HBMA 5DQIA 2HOFA 2L9WA 8ICNA 4BGBA 1CS4A 2R9LA 1XNRK 3L5KA 3W61A 3KIOA 1N56A 4CJQA 4CJFA 3HRDD 1S0OA 1HBUA 3B78A 4WPAA 2E2NA 4ZMMA 7FDRA 5B0DA 4LBHA 2Z58B 1ZQFA 1ZQXA 2OTLS 1ZJNA 1HD0A 2CQ2A 3PKMA 3P5BP 2B43A 1OQ6A 1X6IA 3FRYA 2VCPA 4FK0A 1NXIA 1S9GB 3CYMA 4M9HA 3C3LA 1AYEA 4M5JA 2E5HA 8ICMA 2RH3A 2V8VA 3MPDA 2D1KA 3A1YG 4O8UA 3I4HX 3L2WA 1URJA 2ROEA 4ZVGA 4KGXB 4CWBA 1VSHA 1W9HA 4Z4GA 3F53A 1YZ7A 2AP6A 2O6KA 3PSFA 4H0YB 2DITA 4CIFA 1SV4A 2JXJA 1K8KB 4ZS6A 3FBBA 3CCUN 2AGOA 1RYSA 4RKUC 4MIAA 2HMIB 2GIQA 1SQFA 3IS9B 1Y5NB 5J2KA 1WHVA 4DN0A 4CF3A 3OYLA 3BYPA 4A48A 1YLXA 3L2UA 1R0CB 2NYHA 5HOOA 3V4IA 2HLUA 4JI1K 4KT0C 4CP5A 3PIOL 1NKBA 4FJHA 4H4OA 5J0RA 2OM6A 1CXUA 3QB0A 1SI9A 3CW2C 4MLEA 3LZIA 2XVTA 3MMBB 4LVNP 1VQ8N 3VQ4A 4Z2XA 1MLAA 2RF2A 4ZIWA 3BPSP 4P73A 4DV3F 1LV5A 4NRTA 3LWLA 2N4DA 3VQ7A 4U7CA 5ETMA 1CPZA 1Q4RA 5LJ3Y 2F7VA 1FJ7A 4M5LA 4AL6A 1MN8A 3QU5A 3NGTA 3RB3A 3KDOA 2CGJA 2KJ5A 2IVMA 1I94F 3NGUA 2N7YA 3EGZA 3AVNA 4MYTA 5F8IA 3E0FA 1TK8A 1PC5A 1LCUA 2ZTCA 4PEOA 1R0AA 4FF2A 1FJGF 4J9NA 2E1RA 1M1HA 4ACOA 5F41A 2HZVA 1BNPA 2J9DA 1HBOB 5HNKA 2C28A 4WYLA 1FDBA 2KZMA 5J1NA 1I6JA 2V2QA 2J7WA 3MMAA 5JUMA 3DJCA 1P27B 1OY8A 3TVKA 2Y9UA 4Q7AA 3KZBA 1NK0A 4B6JA 3WU2U 3MAAA 2P5OA 3CCEN 9ICUA 3HCXA 4DTRA 5FDLB 4DTOA 2PIIA 5CZVA 3ZTPA 2VQFF 4BG9A 4KGVB 3PLAA 5DBAA 1N5VA 2ZUCA 5AIBA 4CJKA 4FO6A 2VF3A 1Z4OA 1UA1A 4DUYF 5IT0A 2EAMA 2OEHA 4ZLPA 2UUTA 4ILGB 4JYAK 3NWGA 4M5NA 4UATA 4ID1A 2JEJA 4N5SA 1COOA 4M3WA 4JI2J 3WXLA 4FJ8A 3JSYA 5AJ3J 4LMZA 2RB7A 2KO1A 3NFAA 4NWBA 3VQAA 1B7FA 5B0EA 4ES2A 1BQMA 2D9PA 3MGVA 2IC3B 2KTQA 2K2PA 3O08A 4FS2A 2AJFE 3CJTA 4FE3A 2YX8A 2QLFB 2UXCF 3UN2A 2R2SA 2B21A 4CLKA 5FLXO 5BPNA 3J81j 3R1XA 2RS8A 4HH1A 3ULEB 4CJ7A 4UB4A 1JX4A 1ZQZA 3UDLA 4GKKF 3F73A 2AHOB 4NMLA 2BKEA 3G10A 2EBGA 1UVNA 1BI4A 3ILIA 4RNMA 3P38A 5DM6L 3OVSA 2GX8A 2FMSA 3P4IA 4Q45A 3AO5A 3UE5A 2YTUA 8ICWA 1U0HB 4AQYJ 3I8DA 4CO5A 4EHUA 2FLOA 2FLPA 1HFEL 2UUCK 2EBEA 4KN7A 1HUXA 4CEDA 2ASJA 3OS1A 4FYYB 2WVBA 1T95A 2XI2A 1TFWA 1X4HA 2XMKA 2WB4A 4ANCA 4CGIA 4K4TA 2K4EA 2HB5A 4PYAA 4TLRA 1WWHA 4F36A 1JLAB 4LF9F 1VQLN 3E9PA 4DTJA 1R7IA 5JLHA 2KFZA 4CF9A 1ZJMA 1S0NA 4QPTA 3W1YC 3SR6A 4I2CA 3D2SA 2O8DB 4LSNA 4JB8B 3R6LB 1ULRA 3DOMA 3M32B 3FBCA 1DGKN 2LVWA 3OYMA 2HBLA 1BPZA 3WHIA 5JJBA 4I2PA 2VPWB 3A3NB 1XMOF 5GADU 4IO9L 1Q46A 1UA0A 2YKMA 3TX0A 2FSJA 3OYEA 3QFUA 3V9WA 1SL2A 1LKYA 4BRMA 2AD9A 1WF0A 1RAHB 1J97A 1UP1A 4DV6K 4GVBB 1VSMA 1BVSA 2QX0A 4HUGA 3BO2A 1HL6A 1ZQPA 2YVSA 3OR1A 2KK0A 2KKHA 4FJJA 4CFCA 3BS9A 2NS1B 3AXKA 3JPPA 3LDLA 1VSFA 4KHWA 5D77A 1KC8O 4GV3A 1YWXA 4ZH4A 5HVHA 3Q0AA 2J9CA 8ATCB 9ICXA 4AXJA 1YIJN 2J6TA 3UDVA 1X3NA 2DKZA 3TUJC 5LSRA 4B3OB 4I29A 1BUXA 5AQRA 5J2JA 4KY3A 1FTRA 1QAXA 3H0MB 1TZ0A 3ITHA 2BMBA 2W6KA 3CMEN 1D9AA 2LYVA 2F96A 1FF2A 1NOZA 1Q7YT 4JN4A 7ICGA 1N0VC 8ICYA 2OEKA 5KG3A 3OHBA 2P5GA 2XGQA 4O8KA 3CD7A 5AQMA 3AD8C 2ZHBA 3K58A 4JV5J 3LA0A 2QWQA 3CFPA 1A0PA 3O9SA 2JHEA 1WJ9A 3J81O 4LT6A 1DQAA 2BV3A 1Z19A 2YHBA 4RU2A 2Q0UA 3ZEUB 1WG8A 3HJFA 1L7NA 3BGLA 1X5PA 4KH6A 1UWAA 3V6JA 3ENHA 1HR0F 3VPZA 3I28A 9ICPA 4NEZA 3SMVA 2Z56B 4I2QB 2D8CA 2Z2YB 4PG7A 1FRIA 3PRBA 4H5WA 1LKZA 1AT1B 5GINA 2I5JA 1ZQRA 4PL1A 2X1GA 1HLUA 4PL8A 2K8CB 1NGHA 2DR7A 4TLQA 1S1XB 2CDQA 3HHLC 3WDOA 2Q79A 2P9PB 3VTHA 1HWIA 2HDOA 4PG8A 1HWKA 1JXEA 2MQMA 2OMOA 2E8AA 3RVCA </