4DWIA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with self complementary dna, se-dgtp and calcium
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
581
structure length
581
Chain Sequence
GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
total genus 210
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dwiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dwiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dwiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dwiA01
1RT5A 3V9XA 1ZQNA 5HRSA 1KFTA 4QZEA 1LWEA 4HYKA 1X9WA 1C1BA 1SZPA 1LWCA 1ZBIA 3KIOA 1C0MA 4EP4A 3V6DA 3EWAA 4LY7A 2XC9A 3C23A 3UXPA 4CESA 5CZ2A 3CFRA 5J2CA 4DTOA 4DEZA 1VK0A 1RBRA 4R5PA 1VSHA 3L2QA 5EWGA 1L3VA 3GILA 3KLHA 1S1WA 2G8KA 3HX0A 3EZ5A 3PY8A 4ED6A 7ICLA 3ZSQA 5J2NA 3OVNA 4CK2A 4Z4FA 3MXIA 5HMLA 1O1WA 5J0OA 1QHTA 3AVMA 1W0HA 1BIZA 3K5OA 3M8PA 2C22A 3LALA 2G8VA 3K5NA 1RBVA 4B08A 4UB2A 4F5QA 4YN4A 1ZQPA 4M9GA 5KT3A 1VSEA 5EU7A 1HQUA 4HTUA 1WNSA 2BANA 2W8LA 4Z6EA 3QINA 3IM1A 3OHAA 2VA2A 4MFFA 4ECZA 5DB7A 3GIKA 4DSIA 3NH0A 1MU2A 2UVVA 1LWFA 3NH2A 3TARA 3H08A 5I42A 4RW4A 3F9KA 5KFXA 4Z4IA 2PY5A 3P1GA 9ICQA 3LP2A 4DTSA 3MR5A 3MDCA 4ECWA 2AQ4A 1C6VA 1JLEA 4OVLA 5KI6A 4ECQA 2R7YA 3OYJA 3RR7A 5HP1A 4CJQA 1WSEA 2YNGA 2PZSA 2MUTA 3K4GA 2PI5A 4NM2A 4ELUA 4DTUA 3N97B 3SUQA 3CM6A 5DG8A 5L1IA 3ZD8A 5DBBA 1TAUA 3UIQA 3OYEA 4PY5A 1YT3A 4E1NA 4E0DA 4O3RA 3MEDA 1NKEA 2DPJA 4E7HA 3CQ8A 2FPLA 1CZ9A 3PX6A 3SPYA 4I2BA 4DL6A 8ICFA 2P6UA 2R8HA 4CJTA 2P51A 3DRRA 5J2MA 2ZTCA 1LW2A 4DFPA 5KFZA 4ELTA 5HMMA 4M47A 3DOLA 4KTWA 4CHZA 4KHWA 1VSJA 1BPBA 5J2BA 3KHRA 3M9OB 1UWBA 7ICJA 3SV4A 3THVA 3RAQA 5D4BA 5IIMA 4XRHA 4R8UB 2W9AA 3M8SA 4G1QA 5J2FA 3K59A 4IQWA 3M9MB 3SCXA 4FJ9A 1X9SA 5HBMA 4O5CA 4E7LA 5DLGA 1MSWD 4JS4A 1BHLA 3OYDA 4G3IA 1RYRA 1KVAA 3D45A 4CFCA 9ICMA 3PUFA 1ZQWA 2IAJA 4RQ8A 2YKNA 2ATQA 3V6KA 2BCRA 1BISA 3LZJA 4FJKA 2A1JA 3PW5A 4M6WB 1CXQA 3KLFA 1XI1A 4XIUA 3TR8A 1VSMA 3T5HA 3SQ1A 1S0VA 4N41A 4PGXA 4QZ9A 2MAXA 2DTUA 4BDYA 4QOZB 1L5UA 1BIUA 3AO2A 3ETLA 5KFJA 4I9LA 1VSKA 5KFDA 4OJRA 1ITGA 3DRPA 4R63A 1K6YA 2YKMA 4F4XA 1TVRA 4YP3A 3GIMA 4MQ3A 4UB4A 1S6QA 2IHMA 5KTQA 3LP0A 5L1LA 4HUGA 3U6FA 1UOCA 4FCYA 3ZSZA 1TL3A 2UVUA 3AA5X 4F2RA 5KGWA 1C0UA 1N5YA 3HYFA 3LAMA 1JLGA 1I3AA 4F5NA 3C5FA 1T05A 5KFWA 3OSPA 2KTQA 3ZSYA 4PQUA 1VSLA 4BDZA 2IHNA 8ICVA 3QNNA 1GOCA 2DFLA 2IS3A 4I9QA 1NK4A 1EETA 1NK5A 2J6TA 4YG2A 3L2RA 5KG2A 4FJIA 4P4MA 5TZVA 3BGRA 5J1EA 4CF8A 8ICUA 1NJXA 7ICRA 3ORYA 4N5SA 4K4IA 1TK5A 4LD0A 8ICHA 4BXOA 4QAGA 1ZQSA 9ICBA 4EZ6A 3DLHA 4F3TA 3JYTA 4FLYA 4LZDA 1KFSA 4LVSA 1Q9YA 4YXJA 2AGPA 2F8TA 5SZTA 1B9DA 1NKCA 4KLHA 3S9HA 3KHGA 5DK5A 1RT2A 1TGOA 3KLGA 3RB4A 1JN3A 1RDAA 4F93B 1RDDA 4CF0A 2BGGA 4DU4A 4CF1A 2XCAA 3RB6A 2IBKA 1UT8A 3KTQA 4M3WA 4ZHRA 4ECTA 4MF8A 3WNHA 2P66A 3SUOA 1ZQBA 4J2BA 4B3OA 5EWFA 5KT5A 1A5XA 3OS0A 4B8CA 4RNNA 1UA1A 2B5JA 4FVMA 4J9RA 3M9NB 2P6RA 4E7KA 2ASDA 2YHAA 2ZE2A 2B21A 1BGXT 9ICOA 4CHOA 1WSFA 3DLBA 1RXWA 3RJHA 3VQQA 3V72A 3PVXA 1HJPA 3EPGA 4K4HA 5IINA 2D0AA 4W5RA 4DQIA 4F5PA 3VA3A 2BQRA 3UXNA 2E6MA 1TL1A 4RT2A 4DQRA 3A2FA 4B9UA 4JRQA 1F21A 3DMJA 2W9CB 1T7PA 3OYNA 1ZQRA 7ICKA 2OZSA 3M8RA 1GOBA 4JLHA 2X78A 4KFBA 3DLKA 2XGPA 5CA7A 1VRUA 3KK3A 5J2HA 2DY4A 4BE2A 4KLGA 2R8IA 1QE1A 2PFPA 1U45A 4PPXA 3LPUA 1Z26A 3NF6A 4TQRA 3KHLA 3UPQA 3VQDA 4W5QA 3IRXA 3C1YA 4FZXC 3DRSA 5KG1A 4Z4EA 1BVSA 1Z3EB 4NYFA 2KFNA 3AU2A 3RB3A 1HNIA 4KREA 4FJXA 4E1MA 1LAVA 5DQHA 4N76A 3ISCA 4CJSA 1S5JA 4TUSA 8ICEA 5D3GA 1J9AA 2VG5A 3SYZA 1BQNA 4YR2A 1XWLA 3AVCA 4EYIB 4DFMA 4QWCA 9ICWA 4NCAA 3H8WA 4KKOA 3L2VA 4PHAA 4Z6FA 3PNCA 3MFHA 3RH4A 4ID5A 3H4BA 4IBNA 4Q0BA 3O3GA 1XSNA 3OYHA 4CHPA 3VQ8A 1S1XA 3PX0A 5CYMA 1JLFA 4ED7A 2OPRA 1ZBUA 5DG9A 5JUMA 2Y1JA 2BCVA 4CGIA 3DLRA 3Q8PB 4Q5VA 4UB3A 1S9GA 2PYLA 1NKBA 3ASMA 3ULDA 4UAWA 4KLFA 3CFPA 3HVRA 2G8UA 3ZSRA 3ITHA 1KDHA 4MEXA 1ZQMA 5CB1A 2FBVA 2BHNA 3AO3A 3RMBA 5DB9A 1J53A 4M2YA 8ICNA 4WE1A 3AVKA 4KHUA 1C7YA 2P5OA 2KFZA 2J6UA 4E3SA 4J9MA 2JGUA 2MUTB 4FZYA 5DQGA 3KLIA 3CM5A 5KG0A 1JXLA 4BGDA 5EOZA 3C94A 2OYQA 8ICWA 2FBYA 4N47A 5KT2A 3OYCA 1JIHA 5KG6A 4IRDA 3MAQA 1U47A 3OYFA 4Q8FA 3C2MA 2UVRA 4RUAA 1VSIA 4CJWA 2XY6A 1S1TA 3G10A 2ASJA 5C24A 3OS2A 4IRCA 3IAYA 1NK9A 4FS1A 1B43A 4RPZA 4B9TA 1KRPA 5DGBA 1Z25A 3ZDCA 1RBTA 3O3FA 1WAJA 4C8NA 3C2KA 3T5JA 9ICEA 4Y1DA 5KFBA 4J2AA 1SV5A 4DTPA 1DTTA 3QERA 1TKZA 1KCFA 5T7BA 4GLXA 2RF2A 1S9FA 4O3NA 3ZDAA 3VN5A 3P83D 3MR2A 2FMPA 1WN7A 4H4MA 4CE9A 1BL3A 1S1UA 2V4QA 4X5VA 1NK8A 1S0NA 1ZQAA 5J0QA 4MF2A 1WSGA 7ICSA 3HPHA 2M9NA 4F92B 4ECUA 4Y1CA 4B9LA 4CF9A 5KG4A 9ICCA 3C6UA 1REVA 2A1JB 2YV0X 4RPYA 1YTUA 3HT3A 1EXQA 4YD1A 4KHSA 3QEPA 4M3YA 4QWAA 4CJEA 5C25A 2ZQBA 5F9NA 1ZQEA 4IG3A 1IG9A 2NRTA 1D8LA 1NK6A 4O3QA 3PMNA 2XHBA 1TVAA 2F96A 1IKWA 4OKKA 4EEYA 1AROP 1JLCA 3TAMA 9ICUA 3TAGA 4O9MA 2FBXA 4CHNA 2ATLA 3B0YA 3T5LA 2OPPA 4Z4HA 2OPQA 3DLEA 3HXMA 4Q43A 3GQCA 1U9LA 1ZQIA 3ZSOA 3VQ9A 7ICGA 2W8KA 4CJFA 4FK0A 2VANA 2FPKA 2F8SA 1TKDA 1XO1A 4DL4A 9ICIA 2ASLA 4DS5A 4KI6A 3TAEA 3NTUA 3AVNA 3V6JA 4JS5A 3V9SA 3VQAA 4DF8A 4PWDA 4DO9A 4FBUA 1SUQA 1U4BA 4DLEA 4ID1A 3V7LA 5BOLA 2Z1JA 5KFVA 4YMMA 1IH7A 1DLOA 2DFFA 5D49A 4CCHA 3AVIA 2BPCA 2HHXA 4QWBA 5KFKA 4KV8A 3MXMA 2HNYA 3MFIA 4F8RA 9ICRA 1LB2B 2X6SA 4F4KA 2F1IA 4DSFA 4ELVA 1WCLA 2BCQA 4PA1A 1HPZA 2X6NA 3SV3A 4CF2A 5L1KA 5SWMA 9ICAA 3KKSA 3L2WA 2W9BA 4EBCA 4O0IA 2AJQA 1U49A 4DG1A 4C8OA 1XS9D 2V9WA 3I0RA 4CIEA 3OYGA 4LH4A 3G0ZA 2QKBA 1X1PA 4BE1A 3VQ5A 4CJLA 4BACA 3HW8A 3RJGA 3NF7A 5KT6A 4F4ZA 8ICKA 8ICIA 4TUQA 1A77A 4I27A 4JV1A 4IFYA 4GC7A 1B22A 4TURA 1SL1A 1HYZA 5L9XA 4BDPA 5CZ1A 5E41A 1KLNA 4ED1A 5CP2A 7ICHA 3JPPA 4FJHA 1IM4A 2Q3SA 3JPNA 1S97A 3Q8KA 4J2EA 3ZT2A 2QKKA 4W5TA 2AGQA 3T1AA 2I9GA 3QEXA 5DG7A 3I8DA 4Q8EA 1IO2A 4KN4A 4LH5A 5KFTA 1JX4A 1RDBA 4DSEA 3VQ4A 4KHQA 3NGYA 3NF9A 5HHIA 4M9JA 1HQEA 3TAFA 4UQGA 3ZDBA 1JLAA 4CJPA 9ICJA 4O4GA 7ICVA 3NDKA 4RT3A 3VQBA 5DGAA 1S0MA 7ICUA 1RT6A 5J0YA 4YR3A 3LPTA 2GBZA 1ZBFA 3TANA 8ICMA 9ICXA 3KK2A 5KFAA 1Q9XA 3G6VA 3C5GA 3JPSA 5DBCA 1COOA 1S77D 7ICTA 2YHBA 4CEZA 4FBTA 1KLMA 1G15A 3PMLA 3JPQA 9ICHA 1ZQOA 4QZGA 3U3GA 4E89A 1NK0A 3RH6A 4OGEA 3MGIA 4RU9A 4HVJA 2EX3A 1ZQDA 1ZQLA 5CJ7A 2ZJAA 3OGUA 1ZQGA 1ZBHA 1XSPA 4MFBA 4CIFA 1J54A 3IS9A 4OLAA 4AILC 1WAFA 3AVLA 4GVMA 3K75D 4KTQA 3NAEA 1EP4A 3WNEA 2HHTA 3HWTA 1UA0A 1WSIA 1C1CA 2Y1IA 1HMVA 1JLQA 4FM1A 5HNKA 4F5RA 4FJLA 4C8KA 5FROA 1J5OA 3LDAA 5CR0A 2A1SA 4JWNA 4CFDA 3RRHA 4LSNA 4IQTA 4I7FA 3SI6A 1QTMA 2IMWP 1ZQQA 2C28A 5J0PA 3UQ2A 3Q8SB 4DL5A 4ECRA 3SI8A 2BCSA 4AHCA 4CK3A 1A5VA 2ZUBA 4B9MA 4I2DA 1L3TA 3GFKB 4J9KA 7ICEA 8ICTA 1RTJA 2C2DA 4P4OA 4IQVA 3V7KA 4LZGA 2LYHA 3LZIA 5BOMA 1UAXA 2QK9A 3KKRA 1T8EA 5BPCA 2RDJA 2BE2A 4DTRA 3ZT0A 4KO0A 1RT7A 9ICVA 4ZTFA 4ECSA 4J9NA 3RAXA 4AHUA 1JXEA 4DOAA 4FLWA 1T3NA 4CFAA 3HP6A 3BDPA 2FC0A 4QWEA 2BPFA 4KLQA 2D5RA 4CGJA 4TSXA 3GV8B 1DGSA 4FM0A 2FBTA 2BQ3A 1LAWA 2JEGA 2GUIA 3EPIA 2KQ2A 5C5JA 2W9MA 5KRSA 9ICLA 4RUCA 4OKJA 4I29A 3OS1A 3SQ4A 4F50A 4AHSA 2A1RA 8ICCA 3L8BA 1RT3A 4GC6A 3OYMA 4FJMA 4GW6A 3OJUA 3NGZA 5FRMA 4Z6DA 3MXJA 4YQWA 4DFKA 2XGQA 5K14A 4CEFA 3UXOA 4CIGA 3PR4A 2E6LA 5IIIA 1HRHA 4RW6A 3ISNC 4M04A 4RQ3A 2J6SA 4RG8A 4FJ5A 4Z0UA 2ZD1A 3FDSA 4F2SA 4JRPA 2ETJA 5IIKA 4QZIA 5KFPA 5KFEA 2C2EA 1S0OA 1HUZA 1YVUA 5KG5A 1ZQXA 2ISPA 1ZQZA 1BI4A 3ALYA 3EW9A 4DMNA 1NJYA 4RQ2A 4FLXA 4O0JA 3PO4A 3BQ1A 1Y88A 4I2FA 3QIOA 4KLLA 4KLIA 3RTVA 3N4MB 2VA3A 3T19A 3AV9A 3PV8A 4KAZA 8ICSA 1NOMA 3RRGA 3Q8MA 1JL2A 4I2PA 3H7IA 9ICKA 1JXBA 4DQPA 5KFUA 1U48A 4M3XA 1NOYA 4PUOA 4PH5A 3JSMA 3QEVA 3QZ8A 1S9EA 4CJRA 3MR3A 1N48A 3MECA 1Z00A 4UBBA 4ECXA 5J2GA 5KRTA 4KITB 1NOZA 4FM2A 1RBUA 3DOKA 5DDYA 1BCOA 3AUOA 1D8YA 4I28A 4ED2A 4RQ0A 2F1JA 4YR0A 4KLJA 1ASWA 4CJVA 4DOCA 1ASUA 4M3TA 4YNQA 2BPGA 4F4WA 3SJJA 1NK7A 2VG7A 5KFOA 3GDXA 4RQ5A 2FPMA 2O4GA 4I2EA 1B92A 5L1JA 2WOMA 3MBYA 1B9FA 3NE6A 1N6QA 5DB8A 2RKIA 1TKTA 3F73A 2NRWA 4FO6A 3LP3A 4KLDA 4TQSA 1SKWA 3ISDA 3O4QA 1KFDA 4M9LA 4QZ8A 1ASVA 2KZZA 2KZ3A 4KB1A 2R8KA 4YFUA 2XRIA 2AGOA 4CHQA 4EBDA 4P2HA 1XHXA 2PFOA 3RMDA 4I2QA 2EHGA 4Z4GA 3KLEA 3QEWA 1MQ3A 4O5BA 4GXKA 4Z6CA 1VSFA 3MR6A 4KLSA 2IC3A 2RDIA 8ICGA 2KW4A 2C2RA 4DTJA 5I3UA 4YMNA 2HNZA 4J2DA 3P5JA 3RJEA 2AU0A 4R65A 4E7JA 5J2JA 3ZSVA 4R66A 4KLMA 3QO9A 4NLGA 3O4NA 5KFMA 3JPTA 3KK1A 3K5LA 3C1ZA 1SKSA 2O4IA 4I2HA 4M9NA 4ZH4A 3NF8A 2I5JA 3O3HA 3BJYA 3NGIA 2HW3A 1IKYA 1IKXA 4CGHA 2BCUA 8ICRA 2LSNA 3SQ0A 4W5NA 4FZZA 2JEFA 3WNFA 2I1QA 3S3MA 1BPYA 4UB5A 4Q44A 1QQCA 4FLZA 3MGHA 5KFRA 2IDOA 3EY1A 4O3PA 4CEQA 1JL1A 3V9WA 1SL0A 2NRXA 2ZJ8A 3VA0A 2XO7A 1KVCA 4O3OA 5CHGA 4AHTA 4XUSA 2W9CA 4FXDA 5CWRA 4EYHB 4H8KA 4FK4A 3AVAA 4CGDA 4ED0A 5DLFA 5KFGA 1XSLA 4L8RB 4FLVA 2KN7A 5KFCA 2V4RA 3OJSA 3TFRA 3SZ2A 5IIOA 3GIIA 1BCMA 2WONA 1WSJA 4GMJB 3DI6A 5DB6A 1S76D 3C95A 1ZQJA 2G8FA 5KFQA 3ZD9A 4KN7A 4RNMA 4YVZA 1A5WA 5F9LA 3OYBA 3G6YA 5J0SA 3HL8A 4J9OA 2HVHA 4FK2A 1KSPA 1VRTA 4I2JA 3VQ6A 4HCBA 3ISBA 4ZTJA 4F3OA 3K2PA 2JZBA 4QZDA 2XCPA 3HPGA 3RH5A 3V1RA 9ICGA 4FLTA 1CXUA 1SKRA 3SQ2A 1IXRA 1L3SA 1K1QA 2PFQA 3B6PA 2PYJA 4FJGA 1WSHA 2H5XA 4CEEA 3FFIA 3AU6A 1RT4A 2HNDA 5IILA 3ZSWA 4BE0A 9ICPA 1ZQUA 3S3OA 4QWDA 3V7JA 3WNGA 3LP1A 2OZMA 5IIJA 4M3ZA 4RQ4A 4DQQA 4BXOB 4OKEA 4JWMA 3V4IA 1KTQA 4DOBA 3AVFA 4KLUA 3Q8RB 4YFKA 3Q8QB 4AH9A 1LV5A 4NY8A 2OPSA 4CEBA 2ZJ5A 4CK1A 3LDSA 1H38A 4KLOA 2HHUA 1FXXA 1PZNA 3HO1A 4RNOA 4PHDA 2PFNA 4TUPA 3AA3A 4HHTA 7ICFA 2Z1HA 1XU4A 3NGDA 5FRNA 1RT1A 8ICZA 2HHWA 2E4LA 4I2AA 4CERA 5J2QA 3CFOA 1HUOA 3OSNA 3ZT1A 1RCHA 3PW0A 4KLEA 3LAKA 3QESA 1A76A 2ITGA 3TAQA 5KT7A 1ZBLA 4XA5A 3RJKA 1FKPA 1X2IA 4NXZA 5KFHA 4F5OA 9ICNA 5CYQA 1YTAA 2D0BA 4DQSA 3M8QA 1TFRA 3PX4A 8ICXA 4HCCA 4K4GA 1RDCA 3V9UA 7ICOA 2XY8A 2DFHA 3MABA 3LWMA 3AVHA 1TAQA 2VA8A 2Z1GA 2BGWA 5J2KA 2GWSA 4IRKA 3B0XA 5HLFA 1ZQTA 3VQPA 4DWIA 3AO5A 4ICLA 1X9MA 2XY7A 4M45A 1R0AA 3NHGA 5HRNA 9ICTA 3OYLA 4PGQA 4QW8A 2G8HA 3L3UA 4F4YA 3QLHA 2BR0A 3T5KA 4DL3A 4BWJA 5KG7A 2P1JA 4K8ZA 4DTMA 4MEYA 1FKOA 4DS4A 4EP5A 1Y97A 3TI0A 3GV7B 1QLNA 4M3UA 1TK0A 1C1AA 4M42A 2FLNA 4C8MA 2ZTDA 2JEIA 4CEDA 4KHNA 4YXMA 4FJ8A 3CYMA 2HMIA 2P5GA 4I2GA 2RN2A 3PR5B 4B8AB 2G8IA 2IOCA 1RTIA 2ZUCA 5J2EA 4GXIA 4NLKA 4BWMA 9ICFA 5KFFA 1D9DA 3SPZA 4RQ7A 4KTZA 4K8XA 4DL2A 1BI4B 3I0SA 3C6TA 4RW9A 4PHEA 5HHHA 4OGCA 4I2IA 4EZ9A 2OWOA 4IQUA 3SUNA 3TAPA 3VQEA 4KRFA 2JEJA 1ZYQA 3RMCA 3VQCA 1S6PA 2DPIA 1RILA 2YNFA 2NRVA 4KLTA 4CJUA 4IKFA 3RJJA 1QSYA 4IFVA 3HPOA 3V6HA 1SL2A 1ZQYA 5J2IA 5J29A 4CFBA 4DU1A 2AQ0A 1Z00B 4Z4CA 2W42A 3H40A 2OA8A 4FS2A 7ICIA 3MDAA 3OYIA 8ICQA 3V1QA 3HK2A 5J2PA 3C21A 2FLPA 1FK9A 3QZ7A 3LANA 4QZHA 4QW9A 1TK8A 3PW2A 3SUPA 1S1VA 1D9FA 3K57A 4JUZA 4FW2A 4B9NA 3KJVA 5J2AA 4RPXA 1BPXA 4J9PA 2PI4A 7ICQA 1RBSA 3H8JA 2D0CA 4MFAA 4J9SA 4DSJA 3AVGA 3RBDA 4CHYA 3DLGA 1BPEA 2BKEA 4FJ7A 1ZQHA 4RW7A 4RQ1A 2KZMA 5DKWA 2Z1IA 5KG3A 4GXJA 1V9PA 4O55A 3MEGA 3JPRA 2FLLA 4MFCA 3E2EA 4P4PA 5EWEA 3L2UA 1IKVA 1EKEA 1I39A 4AHVA 1RPLA 2X74A 1JMSA 1MC8A 5J0WA 3QIPA 4DSKA 4DSLA 4LSLA 2VG6A 7ICNA 4FW1A 5J0RA 4J9QA 3EYZA 3ZT3A 1W9HA 1L3UA 5JS2A 5J2DA 5C42A 1RTHA 5J0UA 3V9ZA 4YD2A 3S3NA 3T3FA 3HSTB 3TFSA 3QE9Y 4UAZA 4QZAA 4FLUA 1EX4A 4FJNA 5CY4A 5HROA 3ZCMA 4M41A 4HUEA 2BDPA 3RBEA 3KD5E 3LWLA 2ZTEA 1CZBA 2ZUDA 3AA2A 2IGIA 3TWHA 5KFIA 3D0PA 3G6XA 3H8SA 3QNOA 1HNVA 1T4GA 4KHYA 4DF4A 4CJ3A 3QEAZ 3VQ7A 1WCNA 3QETA 1NJWA 1HYSA 5JS1A 4R8UA 3GIJA 2BQUA 1BQMA 1QS4A 9ICSA 2Q0ZX 1D5AA 4E7IA 2FMSA 3SNNA 3QEIA 4YCXA 5KGXA 1WLJA 4KPYA 1LW0A 2HHVA 2XY5A 1ZQKA 4J9LA 3OY9A 4B9VA 4JV0A 1UT5A 4O3SA 4RZRA 3HM9A 3BQTA 3NBPA 3AO1A 4CEAA 4CJ4A 4PHPA 4E19A 2G8WA 4DTXA 1VSDA 3JPOA 3UQ0A 3BQ0A 3DYAA 3DM2A 4NM1A 1TV6A 4EBEA 4M6WA 3PW4A 3HP9A 1QSLA 3CG7A 2HVIA 2JZBB 4DL7A 8ICYA 4IDKA 1DOQA 4N56A 5DMRA 3HVTA 4OPKA 1RTDA 4KB0A 4ED3A 1JLBA 3E01A 4DTNA 1XHZA 1JKHA 3K5MA 3C2LA 1CLQA 4ECYA 3RR8A 4O44A 3HJFA 4OPJA 5HP4A 4ED8A 2PXIA 3AA4A 3PO5A 3NFAA 4IR9A 2F1HA 4RW8A 1QSSA 4CJ5A 1ZQVA 3MEEA 3GV5B 4M0AA 2B4JA 1RXVA 3ZDEA 3AVJA 2YNIA 1ZJNA 1MQ2A 2ISOA 1T03A 3TABA 1BPDA 4IR1A 3OYAA 2IA6A 4HUFA 4KI4A 5J0TA 8ICLA 3H4DA 1S10A 7ICMA 4JK1A 1CEZA 5DBAA 1C0TA 3U3YA 5J0XA 3RMAA 3TQ1A 1ZQCA 5HRRA 5DQIA 3NH1A 4NCBA 3AO4A 4CEOA 4QZBA 1K1SA 4DFJA 4CECA 3BQ2A 2GV9A 3B6OA 1KVBA 2UVWA 2NUBA 4UBCA 2FMQA 7ICPA 4KMUA 3LK9A 4DLGA 3OYKA 2HHQA 2W9BB 4O5EA 4CGGA 3NCIA 2WTFA 3FYHA 4NLNA 4O5KA 1HYVA 1CUKA 5FDLA 3PW7A 5KFNA 4NLZA 3V1OA 4B9SA 2JLEA 1ZQFA 2VWKA 4C8LA 4I2CA 2YNHA 1N56A 4M9HA 4UAYA 3RB0A 2R8GA 3IHQB 8ICBA 3AVBA 4F91B 1U04A 3OHBA 1ZETA 2R8JA 4FYDA 1NJZA 8ICPA 3K58A 2B6AA 3RWUA 3Q8LA 3IG1A 3ZDDA 2HHSA 5KFYA 5KT4A 2HB5A 4R64A 1KEJA 1GOAA 5KFSA 4PGYA 3KD1E 2VWJA 4YMOA 4CGFA 4DU3A 4JV2A 3KHHA 4CJKA 3RJIA 4AHRA 8ICAA 4RQ6A 1XC9A 4QCLA 5DDMA 4IG0A 4Q45A 1HJRA 3L3VA 3RJFA 2QXFA 1RYSA 3V81A 5KFLA 1RNHA 1RZTA 2DFEA 1ZJMA 1TV9A 3ZT4A 1DTQA 4H4OA 4UB1A 4FJJA 5HRPA 4W5OA 4XQ8A 2NRZA 5D46A 8ICJA 3ZSXA 4NYNA 1Q8IA 3QEBZ 4QZFA 1EXNA 4ECVA 4NCGA 8ICOA 4M3RA 1TKXA 2RPIA 2ALZA 4OLBA 4QZCA 1BPZA
chains in the Genus database with same CATH superfamily
1RT5A 1ZQNA 1S48A 1KFTA 1PBUA 2EFPA 3QYYA 3PIOQ 2E5LF 2VGMA 4WJ3B 4HYKA 1SWWA 5ALQA 4QJVA 5B0BA 5F8HA 1LWCA 1RBLA 1N0VC 3ZNJ1 1QZ5A 3VEYA 3KIOA 3V6DA 2YNFB 4OFZA 5KPTA 2K8CB 4RO0A 3WXMB 3I82A 1KLMB 2ZXIA 3C23A 4NXNK 2YXLA 2KH9A 4PZOA 2ALYB 5CZ2A 3WXKA 3SDEA 2R42A 1RBRA 4OMFG 3KVGA 1VSHA 3L2QA 1NSAA 5EWGA 1KWMA 2FVCA 2IVNA 1F0MA 3NEKA 3EGNA 3WQPA 1DURA 3TX8A 2QFJA 1TE2A 4IOAL 2ZIWA 4QYRA 5AT1B 2ATCB 1YHQN 2NYHA 3PTWA 4X64K 1BWFO 4JI8K 3PSIA 5CRXA 2DGWA 3I32A 1WD6A 1W0HA 2AX1A 3LALA 1T6DA 2MQQA 3FM9A 3TUZC 5EE0A 5EGYA 5F3TA 4F5QA 3CMQA 5AFUH 5CHCB 3B6BA 5AKHA 1N88A 3GFHA 2DWQA 3HKZD 3SQIA 1ZQ1C 3MMAB 1Z2LA 4X4OA 4IL6U 2JH1A 2VASA 2VA2A 3W62A 3K9KA 4I69A 2UVVA 4WIIA 3TR5A 1LWFA 3NH2A 1LXNA 4UW2A 2MZQA 5I42A 3H2LA 5KQDA 2RIJA 3LP2A 3A0IX 3MDCA 4ECWA 1N60A 2R7YA 1JLEA 2UUWA 3HJEA 3DDHA 2J9DE 4ELUA 3SUQA 4USHA 2DR8A 3EXCX 5DG8A 5L1IA 1TAUA 5HAOA 1KW4A 3I9ZA 2RQCA 2UUCF 3OTDA 1NMNA 4JV5J 2AWZA 3MEDA 2Y1LB 1JALA 1REGX 5DS7A 2CJYB 1ZTTA 1TL5A 2VHGA 3M7VA 3W1YC 2R8HA 2P51A 4ZVQB 3HKZF 1U2RA 1EB0A 3T1HF 2QM1A 3F2KA 4DFPA 5KFZA 2MPUA 4PL7A 2WVCA 1VSJA 3NWRA 5AQMA 3NRBA 3HILA 1F3VA 2M5YA 5HVHA 3RAQA 1HYSB 2QL5B 1X4HA 5AM4A 5J2FA 2CQCA 1A6LA 1BQMB 4DX8H 5F3XB 1P8GA 3IR5B 2KICA 3SCXA 2EW9A 2B0CA 2NXEA 2XSJA 3MMBB 4FWNA 3ZYYX 1VQ8N 2XZWA 4I6AA 3OYDA 2G09A 4G3IA 2IVMA 3PDNA 1HQ2A 4CFCA 1WG4A 3TACB 1QAYA 3PUFA 4MO4A 1WUUA 2ZH6A 1RHQB 5CD4H 2ATQA 2B9WA 3DYAB 2MU2A 3KLFA 2FQQB 1XI1A 4NA1A 2GVZA 4IOAQ 4OLPA 4OHWA 2CZ9A 3T5HA 3D0GE 3OR1A 2GELA 3THWA 1RDWX 4LF9K 2DTUA 1V5IB 2EC0A 5AZIB 1N5WA 1B7FA 1Q3UA 3AO2A 3ETLA 1XUPO 1VSKA 5GMKa 1LNQA 2O8BA 4OYXA 1T9YA 3JSMB 3IMQJ 1K6YA 3D2EB 4YP3A 5AQJA 5LL6Z 1S6QA 2IHMA 4DV7J 2D3DA 1FRIA 1UOCA 2GQQA 3HRGA 4FP9A 3DOKB 1N5YA 3HYFA 2D3ZA 4FFDA 2B56A 5ALMA 1H72C 4A59A 4FF2A 1VQKN 3C5FA 2C2ZB 5KFWA 1T03B 4CD3A 2KTQA 2AYMA 1XMBA 2OAUA 4G1PA 3RJMB 3FEYB 2IHNA 1Q0NA 1U0HB 1SQKA 3H5UA 1YJTA 2DFLA 1NGEA 1ZA2B 3OBIA 3C19A 2KFYA 4DV2F 2HVZA 3L2RA 4P4MA 4CF8A 2E1RA 4YOTA 3UVJA 2QKQA 2V4JB 3ZO7A 4QNLA 3LF0A 1LK7A 4LD0A 2YB4A 1ZQSA 3CCSS 3DLHA 2GQ2A 3POTA 5IS2A 4LVSA 1Q9YA 3W7BA 2AGPA 2VZ9A 1VGYA 1NKCA 1RT2A 1TGOA 3KLGA 1JN3A 3BGOP 4F93B 1HNWF 4JMUA 4DU4A 3DFEA 4LJMA 3HHNB 1VR6A 4X66J 3GJSB 4LF6K 4ECTA 4MF8A 3GMGA 2XZTB 2B6AB 3OW2R 3OS0A 3WKEA 1RGIA 4M5MA 3WX4A 2AJ0A 4FVMA 1MLAA 1PK1B 4B3RJ 3HOTA 2KHOA 4ZCIA 3PCOB 4KQZA 1HKAA 2B21A 1U25A 3OL9A 3KMSA 2ILYA 1M1KO 4H0YB 4DV5F 2F77X 4CHOA 2MKYA 4K4HA 2E1MC 4DQIA 3V81B 3AB4B 3WZ0A 2ZIVA 2KLAA 1TL1A 4RT2A 1YJNS 3A2FA 4JI4J 5AQSA 2YBVA 1F21A 2MHEA 5FIIA 3OYNA 3GG1A 3PEHA 4OLOA 3A1YG 5IC6B 1GOBA 3UQSA 4KFBA 2X78A 2GOLA 4AL7A 2LQ5A 5DM7L 1AFJA 3HVWA 5ALVA 2LQ8A 1SXDA 5J2HA 2DY4A 2V6AA 4BE2A 5CCMA 2F2AB 4KLGA 2R8IA 4WQ5C 4M5KA 3D54A 4JHDA 1FNXH 1RWXB 3HSDA 3LPUA 4O5FA 2AJ2A 4L3NA 1I94J 4TQRA 1LWCB 3DWLA 5K8PA 1WB9A 2N3OA 2F40A 2N4CA 5C2FA 3HKWA 2KFNA 3OTBA 3AU2A 4FJXA 2JOQA 5DQHA 3SDEB 4K50A 5IT9Y 3H0RB 4CJSA 3VPZA 4EEKA 5GMDA 3O9TA 3J80O 3IO1A 2GV1A 1YRTA 5G5GA 3FFIB 4NZ7A 5IQ6A 3SYZA 4YR2A 2HNDB 4PRFA 3KNAA 3AVCA 4ZLPA 1GLFO 2DKZA 2ZIWB 4GV9A 4DFMA 9ICWA 4KKOA 3CDAA 4I56A 1VQLS 3PNCA 1SAZA 3CQXA 3O9UA 2GA7A 2K4PA 4XEIA 4ID5A 1WSVA 3H4BA 4IBNA 4OYOA 5JTIA 4LBHA 1G6BA 4DR5J 4URSA 4A48A 1JJ4A 3U4LA 3HBTA 2VOOA 2EZXA 3CD6N 1OY9A 2OPSB 2K4EA 2NUHA 3H3OB 2OPRA 3NAIA 1KTVA 5JUMA 1KVKA 5A6PA 3DLRA 4H0PA 1VIXA 4OHZA 5J2QB 1S9GA 1X4CA 2ZJQL 4GVEA 3BH6B 3BKFA 3VAFA 3CFPA 2QWOA 1LWFB 4BR5A 3FCVA 2BHNA 4WWSA 5I42B 3VEWA 3RMBA 5DB9A 4M2YA 1T0TV 4LF9F 3O9SA 2P2CB 4PXBA 4KHUA 1ZS6A 1GQEA 1RK8A 5A2QO 1BLUA 1N34J 4FZYA 2JGUA 2HRTA 5KG0A 4J8FA 3CCVN 1Y5NB 4YB1P 2OYQA 3TP2A 1JIHA 1OUQA 2LXFA 3AA8A 1U47A 1LKYA 1RWMB 2VH7A 2Q36A 4ICLB 4Q8FA 3C2MA 2XY6A 3IKMA 5GAGI 2ZM6J 5LXRA 4IRCA 1Z25A 2DNNA 3ZDCA 3O3FA 3C2KA 4NZ6A 5AQYA 3HZGA 5M1KA 4ZMMA 3QERA 1B3TA 1KCFA 2F8MA 3A3NB 3ZDAA 1HHTP 3GE1A 2KI2A 3M30A 1L8LA 1YTYA 1OIAA 3F5EA 4LFBJ 3R3LA 2Q6BA 1VQ4N 1RCXB 4BVOA 2WVDA 5AQUA 4MF2A 4LF7K 3HPHA 5AE2A 5LSOA 2GS8A 4F92B 4Y1CA 4CF9A 4K4YA 3J7A1 3KLFB 4ZVSB 1HI1A 3IMXA 2GVZB 3ET6B 1D8BA 1RWPB 4PR6A 2K60A 3BBCA 3QEPA 1M5VC 3OR1B 4FXVA 4US8A 3J7Z5 3THWB 1RLDA 4O8UA 1PUZA 4IG3A 1NK6A 4A8EA 2HSZA 4O3QA 1YZ7A 1Z1VA 3PRBA 3PMNA 2BE9B 2CRXA 4OKKA 1RAFB 4EEYA 1UW4A 3AHPA 2BW2A 4DPWA 4AQYK 2RUGA 3TAGA 5L39A 3QWUA 1JI7A 2QLBB 2MGZB 5ELZA 4ATNA 5ETVA 3T5LA 2OPPA 3DLEA 1N5YB 4EIAA 4YY3F 2VQEJ 2YKOA 2KJ9A 4Y28C 4Z7CA 1SJRA 3UDEA 2GHVC 3D2NA 4UB6U 1TUUA 2I6XA 3R7NB 3ZETB 4B17A 1O03A 2FPKA 1OMSA 1XO1A 2KVQE 4UZBA 9ICIA 3KJVB 3ENHA 4WFXA 5B5EU 2O8EA 1HA1A 4KI6A 3F41A 3TAEA 2J9EA 2WF7A 1U2VA 5B8HA 3AVNA 5LSLA 2F1FA 1QHAA 5JXSA 4DF8A 4BGAA 4BGBA 4M7YA 3M3ZA 4PWDA 3R5BA 4FBUA 4KYZA 1SUQA 3POTB 5AQLA 4BRHA 2Z1JA 4L73A 1K8AT 3MEGB 3VF0B 1CRXA 4ETXA 1RT2B 4X65J 3UMBA 3KLGB 4FVUA 2ZKUA 3R27A 2HWHA 4KV8A 1IKVB 3I33A 2QLFB 4A62A 3MXMA 2XMUA 2FPHX 2HNYA 2KT3A 2XMAA 2M3DA 3OA9A 5AKYA 9ICRA 4U7UK 3LM9A 1IJFB 2F1IA 3NWGA 1VQ7N 4L74A 1YRXA 5GMEA 3U7JA 2KOBA 1UJ6A 5L1KA 5K5MA 3VVUA 1NZAA 3WEEA 3L2WA 4EBCA 2QT7A 3C16A 4JI7J 4U9RA 1UL3A 1LVHA 1BNOA 4Y6IA 2ASOA 9RUBA 2A2DA 4NMLA 1YI2S 3P6YC 2V9WA 3UWTA 4NO7A 5AZJB 3I0RA 4CIEA 1XC3A 3EWGA 3E3XA 4BE1A 3VQ5A 3O08A 4BACA 3CC7N 4IKAA 5KT6A 1TL1B 8ICKA 3SCLE 3FZFA 2R7UA 4TURA 4K0KK 4OYIA 3OHRA 1HYZA 2I2YA 2RNEA 2EAPA 4L3QA 2B9YA 4KFBB 4I6MA 3VTHA 5CZ1A 4ED1A 3UPFA 2FJ6A 7ICHA 5LMNF 2FZGB 1JWWA 4PKIA 1FIQA 1A9NB 2UUCJ 2F3JA 1S97A 3OTOK 2VODA 2M7SA 3ZT2A 3LVVA 1TYQA 2JR5A 1B0TA 4LRCA 4JHDB 2DIUA 4TVAB 3QEXA 5DG7A 4WK3A 1J27A 3M1VB 4KN4A 1GLLO 4LREA 4H5RA 2QC3A 4DSEA 2DR7A 3FCHA 3CJQA 1X66A 2V0NA 2CAJA 1H98A 2BMBA 5ETPA 2H3EB 4M9JA 5BN8A 5IQQA 4KH4A 2MEWA 2MLYA 5AICA 4ZDNA 2NSCA 1DBDA 3VQBA 5DGAA 4BRPA 1JNZB 5IV3A 3MMCA 1RT6A 2ZH2A 4I67A 1RG6A 4KKOB 3NNCA 8ICMA 9ICXA 3KK2A 3RAMA 5KFAA 3J81U 4C98A 3C5GA 2NUUG 4P7TA 1VQ9S 5C12A 2CGJA 3QB0A 4ID5B 7ICTA 2J5AA 3BS5A 1G15A 4RL1A 2NO5A 3JPQA 2QFIA 4QZGA 1N32K 3HI9A 3BSOA 1UEKA 2G5HB 3MGIA 1RU1A 4RU9A 4CLZA 1RQLA 4HVJA 3IRWP 2OPRB 5CJ7A 1XNSA 2IDEA 5B08A 1AT1B 3OGUA 2FJWA 3KFUF 2WBRA 4XAKA 4QIEA 5HL7Q 3IS9A 3QT8A 3EUB2 1V97A 4AYBD 1WAFA 1GXTA 3AVLA 4GVMA 4Y2XA 5RUBA 1EP4A 3CJCA 2YWGA 4JK9A 5M1NA 1U6ZA 2CH6A 1VBYA 2R7SA 4NLRA 1AUSL 3QFWA 1HMVA 5HNKA 4F5RA 1BWVA 4FJLA 4C8KA 3I96A 5H9EK 1J5OA 3LDAA 5CR0A 4LSNA 3L5KA 1ZQQA 2DT9A 4XH4A 2C28A 1AQ6A 3AB2B 4ECRA 3DKDA 4NLWA 4AQYF 5AIBA 1SV0C 1G4CA 2HBMA 3U26A 4B9MA 4TYAA 4A5AA 4OZ2A 2B9XA 2V5HG 1LKYB 3QNMA 2LU2A 7ICEA 2R7RA 3P4UB 2RRDA 4P4OA 5LMUK 4CE6A 1S4EA 3QAUA 4ES2A 2N82B 3CF5L 4U7UD 1UAXA 1MW7A 2CQBA 1RWUA 2A19A 3PJWA 3ZT0A 1RT7A 9ICVA 4P71A 4BUGA 3THPA 3GSDA 4OO1J 4HKQA 2BOAA 5H9FK 4AHUA 3CT9A 1T3NA 1V3SA 4RNFA 3BDPA 1Q95G 4GIBA 4URQU 1HNWJ 2RT3A 4ZITA 4FWLA 4NLXA 2FBTA 2QWMA 4O0NA 2W9MA 5KRSA 2HAFA 3M32A 1LCUA 4OKJA 1HKBA 3SQ4A 1F9HA 1NG9A 3L8BA 2QYCA 5LL6d 4FJMA 2SXLA 3OJUA 3N28A 1WSRA 2L9DA 2M0NA 4DFKA 3CCRS 5K14A 2I7NA 2CGKA 3UN3A 4CIGA 2I8EA 4RW6A 3CCUN 3HMJG 1C1BB 5D6GA 3A5OC 4RG8A 1M0SA 2ZD1A 4DV5J 5F8JA 4F2SA 5F0XA 3U1MA 4JRPA 4G9BA 2FHOB 1NMDA 2ETJA 4IG3B 3KZBA 3JTPA 4QZIA 2E8PA 2MJUA 2KK0A 4LFCJ 1SIZA 4ILRA 2B7BB 2DGTA 1YVUA 2W2NP 2ISPA 1ZBSA 4R5PB 3ALYA 4DMNA 2FE9A 4FOEA 2DISA 3G8TA 3KLHB 4CF3A 3DLEB 5MLCQ 2RHFA 4I2FA 3QIOA 3H1QA 3WXLA 1QAJA 3KMQA 3A4TA 3AV9A 1H1VA 2P9KB 4PQAA 3NVMA 3RRGA 2XEXA 1JL2A 9ICKA 1N61A 4DQPA 2A10A 2IVPA 4K4SA 1RACB 4K0KF 4PUOA 3M8PB 2KVSA 3ZXWA 4EUVA 4CJRA 3QJLA 1N48A 2YJFA 1U2VB 1U8SA 3A3PB 4ID8A 4U67L 4F26A 4FM2A 3OTOF 1RBUA 2QSFA 5D77A 4I28A 3T6JA 3EVOA 5DO2A 3OXGA 1I6JA 4CJVA 2CPRA 1IBKK 1Y5IB 4QIWF 2AJFE 3G71S 4DN0A 4KV8B 3SMSA 2VFTA 3SJJA 1FRMA 1YIJN 2VG7A 3ENVA 2IOHA 2VICA 4C7ZA 3R6LB 5ALTA 4ENOA 2FPMA 3CC4S 2O4GA 1B92A 3EGWB 3NVYA 5L1JA 2WOMA 1NWKA 3NMRA 3NE6A 1X8DA 3LDOA 3F2BA 4BR9A 2CNOB 3E9OA 3CPWM 4KB1A 2KZZA 2R8KA 2XRIA 2R7WA 3WEEB 4YUDA 3HJVA 2FHJD 4I2QA 3KOOA 2H9ZA 3EE9A 4A8SA 1I51B 3QEWA 2AYEA 3Q0AA 1VSFA 1WC0A 4C1NI 2IC3A 8ICGA 2KW4A 3QBCA 1U6BA 3F56A 5I3UA 4DTJA 1A0PA 3I0RB 4ZLJA 1P9YA 2RP5A 5F41A 3DRRB 3HFKA 5J2JA 4J37A 5F0WA 4R66A 2PEHA 4GVBA 3QO9A 4NLGA 4WFZA 5E3AA 3GONA 3R5JB 5KFMA 3KK1A 2N7CA 3K5LA 3C1ZA 1SKSA 1VBKA 3L3CA 3DU6A 3BJYA 3FSXA 4A4JA 2BCUA 3CMES 4I6MB 1CZAN 2I5HA 2JEFA 3WNFA 1BPYA 4UB5A 1RI7A 2HSTA 3SBGA 1TYQB 4CEQA 2MKCA 3B8AX 1N5VA 3W60A 1WKKA 2H54B 4Z37A 2NRXA 4BRQA 2HWIA 2ZJ8A 3VA0A 1D3WA 2GUPA 2DPNA 1N33F 3QFUA 4O3OA 3Q83A 5JLHA 2EVZA 5CHGA 4XUSA 2EFNA 4H8KA 1NMEB 3AVAA 5KAFU 1XSLA 4FLVA 2DGZA 5D4LA 5KFCA 3OJSA 3SZ2A 3GIIA 3SIPB 4GMJB 4K42A 3DI6A 4JK7A 2G8FA 5KFQA 5LMUF 2LVWA 3JSBA 8ATCB 4GNIA 1U1RA 1Q1KA 1TVRB 2LYAA 1UVMA 1JK9B 5AXKA 4CRXA 2RH3A 3KK2B 3CJTA 4U67Q 1VRTA 4I2JA 2HQGA 2Z2MA 5IM0B 3K2PA 2CGLA 1SZ2A 5IT9U 4LF5K 1JLGB 2MTLA 3J7YU 4QZDA 2XCPA 3HPGA 1D09B 5CQGA 4PQUB 1F9FA 4EK2A 9ICGA 1LEOA 3VAHA 3AFGA 3SQ2A 1IXRA 1ZD3A 2F3NA 3BKUA 1K1QA 2PYJA 4DR2F 2QMXA 3BB5A 3IS9B 3HHLB 3ZSWA 2MQLA 1CVJA 3LP1A 3S1TA 4M3ZA 5GAGP 2ZZTA 4RQ4A 1DEJA 1ZAXA 3W64A 4OKEA 3AVFA 1UVKA 2RILA 2W4PA 3SEIA 4A57A 4KLUA 3Q8RB 3ENBA 1HMVB 3K8VA 1K9MT 3IWLA 4YY3J 4DV1J 2HHPA 2FHKA 1Y10A 3LDSA 1H38A 4KLOA 1J5OB 1FXXA 2Q1LA 4LSNB 1GH8A 4QR2A 2GO7A 4ZHRB 2I0XA 3AA3A 2OEJA 2DCUB 5D4PA 2FVQA 1XU4A 1QJHA 4M63A 4Y2TA 1Z05A 4UY85 4A8WA 3W0LA 2E4LA 2G2OA 1HUOA 4NPOA 1HWLA 2GIQA 3FZ2A 3OSNA 4EI2A 2YX8A 3GJTB 4NWBA 2DNYA 1KKXA 5KT7A 5BPMA 1FKPA 2X1GA 3UFCX 2VPZB 2K3KA 4E1JA 1U1NA 3JAMY 4WBFA 2ZE2B 4NYOA 3QYPA 1SPBP 5ALFA 1BWEA 3H3NO 3V9UA 1SI9A 4Y2RA 1KXPA 2F4FA 3VVTA 3QT7A 1EWQA 2C2NA 2XY8A 3QSYB 3LWMA 2VBWA 3MZIA 1TAQA 2VA8A 3ZFVA 1HIWA 4IRKA 3GP9A 3B0XA 1ZQTA 1RHMB 2PBDA 1R0AA 3M32B 3C8YA 1HNZJ 2G8HA 3OYLA 4USMA 3L3UA 4K5SA 3MN5A 5HVGA 4WK1A 4WTOB 2KRBA 4MEYA 1IBKF 3VESA 4DS4A 2CVEA 2CQGA 3GWCA 2LECA 1Y97A 5K14B 3GV7B 3EZUA 4RW6B 4M42A 4LRDA 2ZTDA 2KIWA 4CRJA 4KHNA 5IWAJ 3DRSB 5AE1A 2W4CA 4FJ8A 1LFWA 4DR7F 4I2GA 2RN2A 1NB2A 3E8OA 1T11A 2HK2A 3TZWA 2CH5A 2EFVA 5KFFA 3ELHA 4ZPCA 1F1BB 1VAZA 1VDVA 3ZX3A 1UQVA 4PAAA 4EZ9A 1N8RT 4C97A 1MROA 3NOGA 4S0MA 2GGPA 4B02A 2ZH1A 4F0KA 3G96A 3TAPA 4M5NA 2RHQB 3BF3A 1WI6A 3EVMA 4PG6A 1BQXA 4JOUA 3BO3A 4WYLA 5K8MA 3RJJA 4Q0BB 2DGOA 3HPOA 2B43A 2W41A 5J2IA 1MMDA 2C42A 2HGMA 5J29A 2AQ0A 1WWVA 2JWNA 1FNMA 4IS7A 5BRDA 1VISA 3OYIA 4CF5A 2JRZA 5IV4A 5J2PA 3NRWA 2FLPA 1YITS 1FK9A 1OS5A 1D9AA 2LEBA 4B1ZA 3LANA 2U2FA 3CXCR 2KV2A 1S1VA 3DLLL 1SJ1A 4JUZA 5AQZA 3HHLD 2AD9A 2BKPA 2JV3A 1S22A 2E8OA 2FSNA 1OH5A 1BPXA 4FF3A 3MUMP 2WOMB 4NWIA 3H8JA 1KQQA 2QA4G 5AFUA 3IBWA 3KLIB 5AM3A 2BKEA 5DDOC 4DR6F 2H5IB 4I2QB 2YQ0A 2NO4A 1RWKB 2KZMA 1H7WA 4IQMA 1S4FA 2DNGA 4OI0A 1JNRB 3E2EA 4P4PA 2WZ1A 3L2UA 4TU7A 5C7PA 1EKEA 4B3SF 1MC8A 4GVBB 4LSLA 2EPIA 2MMYA 2VG6A 3QO9B 7ICNA 3CCES 4J9QA 3HSJA 4CZEA 3ZT3A 3TOQA 3D7SB 3OLAA 5JS2A 5J2DA 1WDDA 5C42A 3NNAA 1DTTB 3CB4A 3UNGC 3R7BB 1VQMS 2MKHA 4YD2A 3HSTB 3H90A 3TFSA 4X4SA 3NGRA 4KBIA 4KAIA 2O66A 5ALRA 2H1YA 3RBEA 3KD5E 1H0HB 1VHIA 2JSXA 2ZUDA 1ZH5A 1CZBA 1K73O 4BRNA 1HNVA 3HSCA 2F8LA 2HRUA 4CVNE 3NVZA 3NP5A 1T4GA 4K2JA 4RLEA 2ZJRQ 4JI1J 1W97L 4CJ3A 4RWTA 1UVNA 2V8GA 3FR0A 3MCPA 3J7AN 2YMQA 4OZ1A 1HI8A 5AXLA 5BYQA 3JS6A 1Z19A 3SNNA 2OLWA 3QU2A 2G0CA 3R8EA 5KGXA 3DI6B 5AM1A 1LW0A 3OUYA 2HHVA 2XY5A 2P9CA 5D0RA 1IBLK 4CQ1A 2W11A 3ZEUB 2MLZA 3OY9A 1UT5A 3MUTP 2RQ5A 1D8ZA 4ZVRB 3HM9A 4JYAK 4CBUA 4PHPA 1QQNA 3K1ZA 3DM2A 4ZP7A 1TV6A 3PHTA 3PW4A 4UT4A 2E3TA 2HVIA 4C6AA 5CYJA 1X60A 8ICYA 4IDKA 1JLBA 4IZ9A 3AAWB 3E01A 3QSIA 4OYAA 1XMOF 1JKHA 3KYLA 3DLLQ 3K5MA 1OPIA 4H5VA 4ECYA 4A8OA 4OPJA 2BJ1A 2ITMA 3AA4A 3PO5A 5EE3A 3NFAA 2EANA 2OANA 3LH2S 4OYMA 3LP1B 4MHVA 3KJQB 3QXGA 1M1GA 4NLSA 4RW8A 4MTPA 4CJ5A 3MEEA 2YMLA 3GPAA 1RXVA 3AVJA 5KPRA 2YNIA 1X5SA 3QMQA 4FN5A 1ZD5A 6FD1A 1N4LA 1SBRA 1Q16B 4KH6A 2MLXA 2HQIA 1BD6A 3L7UA 1S10A 1AFIA 1C0TA 1YJNN 1SIJA 5J0XA 3O5TB 3UCUP 1ZQCA 2VU5A 5HRRA 5DQIA 3AO4A 4DFJA 4CECA 2UUAK 4PKDB 2GV9A 3M2VA 1NNDA 2IRYA 1DARA 3O4WA 4DLGA 3GLJA 1QQ7A 1HLWA 2HHQA 2NNWA 1GFWB 4CGGA 3QUBA 3U1LA 1FXLA 4M5GA 1HYVA 1WC1A 2C2MB 1WKJA 4UOGA 1CC8A 4CM0A 3MCAB 5KFNA 5ADZA 3V1OA 4B9SA 1VQNN 2IVOA 4NL5A 3H45C 4NYPA 4UAYA 4KHPK 2PMHA 4CO2A 4KT0C 2G13A 4RBUA 1U04A 3ID8A 3CCJN 3OHBA 2CQHA 5I9EB 8ICPA 3K58A 1SH0A 5AQRA 3RWUA 2F9WA 1XIQA 3U02A 3CETA 3ZDDA 1T02A 4TYBA 1KEJA 3BQ7A 3GE9A 1FO1A 2CA9A 4YMOA 1JMTA 3ETRA 4JV2A 1VQLN 3M6UA 2FY8A 1VBXA 4RQ6A 2C2KB 4QCLA 1HJRA 4F4AA 1PYOB 2VOPA 2RRBA 2DNHA 1KD1T 2NR0A 3EX7B 2DFEA 3NGSA 1FE0A 1U1PA 4ZS6A 2ADBA 4UB1A 4NI2A 3BREA 5HRPA 4OD0A 3DDNA 3J81O 5JVHL 3AARA 5GIPA 1HQEB 2VJUA 2NRZA 1K44A 1YJ7A 2HRYA 1F9EB 1EXNA 4ECVA 1E6VA 4M3RA 2ALZA 3V9XA 2WCXA 4FE3A 3MM5B 2BJ9A 2C1EB 4DV0J 4RPFA 1R8CA 1NDCA 5KAKA 5E0OA 1LWEA 3VF4A 1X9WA 1IBMF 3M6WA 2RHKA 2HF4A 1ULRA 4H5TA 1C0MA 4EP4A 5E79U 4KX5A 5GTIU 1NHVA 3QATA 4XDCA 2MJNA 2L5YA 4NLPA 4BBYA 2YQ3A 4OV6A 4C4WA 5ETSA 1N33J 4YHHF 3TSQA 2JJ4D 3CI5A 2W43A 1UVLA 3G4SS 2E1AA 3RBXA 1SB6A 2C3MA 2FJAB 2PGCA 2DR5A 2OEHA 5J2PB 4EFHA 3I55N 5EX3A 2RU9A 5J2NA 4XH5A 3ZSQA 4D3GA 1XMQJ 2IJFA 1O1WA 3P39A 4HR2A 3UI3A 1GMWD 3MURP 2J8SA 1YQHA 1ESVA 3OFHA 2G8VA 1RBVA 4B08A 5AJ3K 2FDNA 1TMJA 2VC1A 2HAIA 1ZQPA 3VCBA 4DFDA 4M9GA 5F8IA 4J9UE 1VQ8S 2FGCA 1VSEA 4BC2A 5EU7A 1IBLF 5EVZA 4HTUA 2LDYA 2P35A 2BANA 4MH8A 3QINA 3OHAA 3JAMO 4MFFA 1FFGB 4DSIA 3BF4A 3MM8B 3NH0A 1RTJB 1FF2A 4OCZA 4LIWA 2O6KA 3D1HA 1RABB 2KE7A 2BUNA 3AXMA 3F9KA 1DQ9A 4OX7A 3P1GA 3QJPA 4LSLB 2VG6B 4DTSA 4KO0B 1C6VA 2ABYA 1K0VA 4OVLA 3RR7A 1X4AA 1EO1A 3J81j 5C42B 2PZSA 4DBQA 1SJFA 4YDXA 3CM6A 1B0VA 1LK5A 4DU8A 2QL9B 1Z1BA 4ISFA 2BTFA 5KOWA 1PVQA 4PY5A 1YT3A 4CZKA 4E1NA 3HTVA 2BJEA 2IJNA 1JJ2R 1DRZA 2M4MA 5JVHQ 4I2BA 1VQKS 8ICFA 3P8BB 4QR1A 3R9PA 4JKGA 2JLFA 1FFVA 1HNVB 2ROGA 4TY8A 1TUYA 3VENA 2WF9A 3M9OB 2E8NA 3SAGA 1UWBA 3SV4A 2HVDA 3M8SA 5AI0A 1KAYA 4YS2A 1ZRNA 4E98A 4X4PA 1IXKA 4A8FA 3E1YA 4CT8A 4O5CA 4BVPA 1QVGM 5DLGA 4NLVA 2CPXA 1MSWD 4JS4A 1BHLA 1LW0B 2UXDJ 3NS6A 4ANCA 2XTJP 3FSYA 4N8NA 3ZTPA 2RD5C 3QQCD 2GJIA 3UR3C 4BC5A 2XBPA 1KVAA 2UXCK 2HOFA 2UU9K 3IWXA 4DPUA 2DO0A 2IAJA 2W7PA 1RWVB 2WAQC 3DM2B 1T6CA 1TV6B 2QW9A 3SJHA 3PW5A 1YUWA 4XIUA 3TR8A 4WP8A 3N0VA 5M2RA 2MKJA 3TZYA 2XO6A 2H51B 4FPIA 4QZ9A 2OD4A 5KQ8A 2J0QD 3E01B 1JKHB 1L5UA 1B64A 2HWTA 2K89A 3KNGA 4Y2JA 1ITGA 2B3TB 2DGVA 2K8BB 4R63A 4F4XA 4DR7J 2JHDA 2H3IA 1N63A 2FZCB 1HPMA 1F3FA 4JKBA 1W2BM 4RW8B 3MN9A 5L1LA 3IV6A 4FCYA 2NRHA 1YI2N 3C2PA 5ALDA 4QJFB 2O5DA 5E26A 1Z4NA 3QAEA 2P9IA 2LBOA 2DF4B 2G0AA 3I5AA 4LJXA 1AYEA 8ICVA 4RKUC 4NL9C 3FZHA 2C3PA 1C0TB 2GZOA 2OSRA 5HMXA 2GLEA 4ED4A 4USKA 1W25A 1NK4A 3HSZA 2HBJA 4FJIA 2QA1A 1FEZA 2GQCA 4N5SA 4K4IA 2IYIA 3BPDA 1TK5A 4ILHA 4EZ6A 5ALLA 3JYTA 4FLYA 4OZ5A 4KGZB 1NH7A 3CE8A 3SD7A 2WRMA 1RWNB 5DK5A 5EXWA 3TTDA 3CMAN 2GIFA 3IR7B 2HZCA 2H3ZA 2VJ5A 2X7IA 3TADA 4BS2A 2HNZB 3RB6A 3D66A 4L3KA 3M2RA 1YBUA 4I1TA 4KPCA 3A5NC 2A2CA 1ZQBA 3QRPA 4OJPA 4ISEA 2JNJA 3FZBA 3MTKA 3WK5A 1UA1A 2B5JA 4YOVA 2YMPA 3MUVP 1HBOA 4M94A 4Y2UA 3M9NB 2RE1A 1OSCA 2ASDA 3S8SA 3FBCA 1YXQA 2WAQD 2C2OB 3ILJA 2HLTA 1Y0HA 1RXWA 1SVDA 4OHVA 1NNLA 3EPGA 5IINA 3EE8A 4W5RA 3CD6S 2DD8S 3G2XA 1NJIT 2BRKA 1Y3KA 2E6MA 3DRYA 4B3SJ 1YJWS 1IV8A 2CPEA 3MN6A 3LA0A 2YI1A 4LF8J 4X64J 1ZPWX 1XJWB 4JI8J 4GKKF 2IRUA 2XG8A 4CLTA 3M8RA 4RWXA 4HACB 1WTBA 2XGPA 4AXIA 4HL9A 1E6VB 3OVBA 4PL8A 1QE1A 2PFPA 1R8PA 2LXIA 5M1PA 3C14A 2AYGA 1Z26A 4NRUA 4FZXC 3MC1A 5KG1A 1BVSA 2LKYA 1X9XA 2WAQF 1EHWA 2ZWHA 2DHXA 4JKEA 3KKAC 2APOA 3CCVS 2F4VF 1ATRA 4KREA 3G6EN 1RJJA 3TKAA 4EWTA 3FZMA 4N76A 3T6BA 4NLUA 3A8IA 3DEEA 4TUSA 5AK4A 5D3GA 4A8XA 1BQNA 2DR6A 4M5LA 4EYIB 1ZZNA 4QWCA 5J2NB 3H8WA 1GX6A 3L2VA 4PHAA 4CZIA 3MFHA 3RH4A 4K4WA 4H5WA 3OYHA 1KNZA 4X2BA 4OX9K 1HHSA 4OZNA 1S1XA 3WIVA 2DEJA 5J8YC 4UAVA 2BYCA 5CYMA 4B6JA 1JLFA 1IM6A 2BW7A 2A3ZA 2UYTA 5KAIU 2BZFA 1ZBUA 3HOSA 2ZC4A 5DG9A 2Y1JA 2BCVA 4FVCA 2H5JB 4CGIA 5GAGU 1XMOJ 4V19J 2IM0A 2BANB 4Q5VA 3A8YA 3AT1B 3AJ1A 2J4RA 5L46A 1WC5A 2PYLA 1NKBA 3TA1A 4HDGA 3ASMA 5F1XA 4BC3A 2D3O1 5DM6L 3HDSA 3ULDA 2GO8A 3J7ZO 2XI3A 1KDHA 1ZQMA 2L41A 2J9CA 5GADI 5AKGA 2FHMA 2P5OA 3TA2A 1K73T 1VJ5A 2J6UA 1N5TA 2DIVA 4J9MA 4LMZA 1TP7A 1JXLA 4DV7K 1TZ0A 5EOZA 2BA9A 3C94A 1TAMA 8ICWA 4N47A 5D4NA 4X4UA 5KG6A 2HOIA 4Y34A 1JXVA 5DDPC 2QARA 1ZM4A 2UVRA 4OZ3A 1K8KB 4CJWA 1S1TA 3OS2A 2ASJA 3AN1A 5HQ8A 1BNPA 2OELA 4OJLA 4FS1A 1B43A 4RPZA 1KP6A 1KRPA 2PO4A 4BC7A 1P8ZA 1RBTA 4JKGB 1WAJA 4DCHA 4C8NA 3T5JA 9ICEA 3TEHB 3ZZRA 4C0HA 4DTPA 5AM5A 1DRGA 3GG0A 2KMDA 1XNRJ 4BR4A 4GLXA 2DHHA 5AM0A 2W6LA 5ALYA 2NZCA 2EG1A 4O3NA 2XS5A 1B99A 2DK2A 4FSVA 3VN5A 3CNQP 3G8QA 2QYGA 3P83D 2HBZB 2YPYA 2FJXA 1V4TA 2HMIB 4DPTA 3QT6A 1KC8T 3ISZA 4H4MA 4CE9A 3CDEA 1S1UA 3CERA 4IUFA 2O1PA 1NK8A 3VWSA 2YX1A 1S0NA 3I0SB 1MWMA 1ZQAA 5J0QA 2GIRA 4NE9C 1WSGA 2IAJB 2HK3A 3TYTA 4LC9B 9ICCA 1UMJA 3C6UA 3HT3A 1EXQA 1X42A 1G99A 1VDHA 2Q97A 5C25A 3CC4N 1VQ7S 1IG8A 3IDWA 1VHXA 3OFGA 3SQGA 5L8RC 2NRTA 1D8LA 3R6MA 3DV9A 3NG8A 3GG4A 2ZOGA 3MK6A 1PG5B 2A42A 4B3RK 2A40A 2YVSA 3DN9A 2XHBA 4MK9A 2F96A 2RB7A 1QVFM 1AROP 2KHQA 3TAMA 3D6JA 3P3DA 2ZOMA 2DNOA 3D67A 3MD1A 4CHNA 3SAHA 3UW1A 2RHSB 1HW9A 4UARA 4LF6J 4H4KA 4L75A 1U1MA 2W2QP 2NRRA 2M8HA 3VQ9A 5AE3A 3CCWA 2YN4A 4UASA 2W8KA 1VLOA 4ETZA 3ATVA 4O3MA 2YWFA 2H4WB 5LOQA 5DM6Q 3KG1A 4H0VB 1TKDA 4U8YA 3ILIA 1IBMJ 1W7AA 4DS5A 3DRXA 4WXOA 4CI6A 5ALUA 3MPVA 3NTUA 4JS5A 4AL6A 3RGIA 4YHHJ 5AKEA 3O80A 1GAOA 2XLJA 3BR9A 2WFBA 4F7VA 4D3HA 4GY2B 4DO9A 1I94K 1WACA 2DCLA 3MWPA 2W1BA 3NGTA 3JYTB 2LM1A 1UAWA 5GINA 3BUZB 1NSKL 3DHXA 2DFFA 4I6WA 3M7DA 4H0TB 2HHXA 5KFKA 2J7UA 1NUEA 4JV5F 2F8EX 3J7YI 3EZOA 1LB2B 2X6SA 4DPYA 1PAUB 4DSFA 1WCLA 5EE9A 2DTJA 3AD8C 2I1RA 1X4FA 4Y00A 2BCQA 5KNIA 2PE8A 3RFAA 1HPZA 3LGNA 3U27A 1GLDG 2X6NA 2B5JB 5KL1B 3KKSA 2W9BA 1HBOB 3QU5A 4Y2IA 4NEZA 4KGKA 1HLUA 2ASPA 3D6HB 1UFKA 3AEVA 2AJQA 5LXYA 1EQMA 4DR5K 3H0LB 1CJKB 1WOPA 1U49A 4DG1A 5HROB 4XO0A 1AXQA 4FDFA 2I9SA 2V8HA 2WBNA 4LH4A 3DJCA 4QR0A 5SUHA 3MI7X 1KN6A 4F02A 3Q24A 4ZJQA 4K4UA 3NF7A 3OXFA 4HWIA 2KM8C 1MDUB 4FPBA 1YBTA 8ICIA 3TW0A 2CNLB 4JV1A 3SSQA 1YJ9N 4GC7A 3I8BA 1SL1A 3MN7A 2CPFA 2E20A 4BDPA 5E41A 5AK5A 3JPPA 5HR6A 1IM4A 1SQFA 3NS1A 4BJQA 2DGQA 3SAFA 1QE1B 4LVNP 3RSEA 4P73A 3EVWA 2WSEC 3GJQB 2RE2A 1HD0A 1SC6A 1HARA 2HKEA 2WBMA 3C14B 4ILLA 3AQEA 3CDWA 3ZZ0A 3ZTQA 2AEJA 2QSWA 1JX4A 1RDBA 2DL0A 1QD1A 1BDGA 4Y2PA 1M90O 1Z6RA 3U1NA 3NGYA 1L6NA 2V2QA 2FB0A 3VCDA 3NCPA 5M1OA 4GV6A 2MY8A 1HKGA 1AW0A 1JLAA 4H54A 4CJPA 4WYBA 3N7RC 2HFUA 3OTQA 2ZM6K 7ICVA 5AQGA 2JC1A 2AJ4A 3E66A 1FX2A 4NLBA 3R9KA 5J0YA 1BQNB 1HR0K 2ZNZA 3EXYA 3LGHA 4ERDA 1ZBFA 2POKA 3M4XA 4DHVA 2CPJA 1RWWB 3TANA 1QH9A 2W3RA 2B7CB 1COOA 4Y2MA 3I28A 3DXMB 2KXFA 2YHBA 4CEZA 1KLMA 1HUXA 3MOJB 9ICHA 1ZQOA 3IN5A 1S1XB 3U3GA 4WFAL 1NK0A 3RH6A 4OGEA 1QM9A 4LFBK 1VYAA 4GKJJ 2PC6A 1ZBHA 2CYYA 3AQOA 2JHEA 3OVSA 4QS9A 3BBFA 3D7EO 2LMRA 2WB1C 2J9DA 1M5PC 4AILC 2F76X 3KUEA 4X66F 5ETTA 2M52A 3VAJA 3CCUS 2HHTA 3HWTA 4R79A 3ZX0A 1UFLA 3ALRA 1JLQA 4FM1A 3F9MA 3A8JA 4I68A 3NAHA 4UUXA 4DZDA 3PYGA 2A1SA 4IQTA 1RKJA 3BR8A 1QTMA 2IMWP 1SB3C 1PCAA 4LF7J 4B3TJ 3UQ2A 3BO4A 2ZITA 4DL5A 3QGHA 1SJ4P 4CW7B 1A5VA 2H65B 3FKBA 5AQVA 4I2DA 2VQEK 4J9KA 4DU7A 2C2DA 1S1TB 4QBUA 3V7KA 4LZGA 4UUWA 1NSQA 4BC4A 2MKIA 4HAIA 3TSPA 4B1WB 4JI4F 4RNHA 3RF9A 5M1QA 3KKRA 1R31A 2BE2A 2PMZC 3N5FA 3J8AA 2YWHA 1CULA 2YX4A 1GXLA 5JLFA 4QZVB 2XI2A 3RAXA 2B0GA 1U26A 3HP6A 4IG0B 3F5AA 2P9EA 4CLKA 5D4OA 3TZZA 4CGJA 3UD4P 4BX9C 4TSXA 5K9FA 3AL0B 1B4SA 2CNKB 1IR2A 2NPFA 3OD2A 2B4OA 5ALHA 2GUIA 1OH6A 3EPIA 1J6ZA 2EZZA 3GCXP 2LQBA 2KQ2A 2Y9UA 4DCCA 5C5JA 1T9TA 1Y64A 1JCGA 3UM9A 3AA9A 9ICLA 3FZKA 3OS1A 4M5JA 3DXSX 1S1UB 2CDRB 1RT3A 1SGGA 3R7SB 2AW0A 3NGZA 5FRMA 2WHOA 2VJVA 3ULEB 1U1LA 4YQWA 2Q4TA 2XGQA 1YIJS 2DGUA 4CEFA 1JRPA 3C6UB 3R5AA 2IVYA 3TO8A 4E8UA 4DR1F 4FNIA 5IIIA 2JWKA 1HRHA 3F44A 3N79A 1Q7YT 4M04A 1UFWA 5C25B 2B6GA 4Z0UA 3MX2A 3FDSA 3CEDA 2W01A 3SQGB 1VOMA 1OPZA 3PSTA 5KFPA 5KFEA 2ZUAA 5ETOA 2WB1D 2GJ2A 2GH1A 2D41A 3O6QA 1PGZA 2YQEA 4WFAQ 1S0OA 4K2XA 3HHDA 3RVCA 4GKKJ 3M8WA 3CJ0A 3SBMA 1Y88A 1YGYA 5AI4A 2EAOA 1DAXA 3RG6A 1BG3A 3N4MB 3KK7A 3QICA 4KAZA 1NOMA 1S6UA 1Y11A 4P0QA 3CCZA 5AZIA 3CCEN 2R4FA 3JB9k 2FJVA 3H7IA 1JXBA 3M8YA 1U48A 4M3XA 3QEVA 3JSMA 3D2EA 1VQMN 2UUCK 2JDJA 1Z00A 3MGJA 3DGVA 1U1OA 5JVGL 3J80Y 5J2GA 1RXOB 2A6AA 2HQFA 3DOKA 5E5NA 1BCOA 1WG5A 1X5OA 1UETA 5AQWA 4HTJA 4L6V3 1XEZA 4YR0A 3T1HK 4N8OA 7AT1B 1ASWA 2DITA 2PMZD 1N34F 4G65A 4DOCA 1ASUA 1IUJA 4YNQA 1MWYA 1U0HA 3KDNA 2MSNA 1NK7A 2BM1A 5LSRA 3GDXA 3AODA 3JQJA 4I2EA 2BVZA 3V2UC 3BBBA 5DB8A 3S6EA 1TKTA 2NRWA 4FO6A 2V34A 2FSJA 2O8FA 1UHUA 1J2NA 4FYVB 2V4JA 2PD1A 1F5AA 3QGPA 2KZ3A 3IBCB 2AGOA 1KEKA 1XHXA 2PFOA 2KEYA 3AMZA 2R7OA 2EHGA 4OQJA 1H7XA 1RADB 3NUQA 2H3GX 3J7AP 2C2RA 2NPIA 4WQ5A 3RJEA 2ZJPL 2LM4A 3ZSVA 5ALPA 1MN7A 4KLMA 1WHYA 2PMZF 4F71A 5EOYA 1RUSA 3W5YA 4Y2KA 5A2QY 2O4IA 3B4DA 4I2HA 3PKMA 2PSZA 1X0FA 4ZH4A 4HI2A 2I5JA 4FF1A 4C80A 3SQ0A 1T9WA 4W5NA 4FZZA 4FNHA 5FD1A 3PYFA 1UCVA 2CQ2A 4FZVA 5IOLA 4Q44A 5AKKA 1UVJA 2IDOA 3RSEB 4URGA 3O3LA 4OL8A 5CXTA 1XBWA 2ILZA 2QWPA 1NEEA 1KVCA 4CLPA 2YKNB 4OHXA 1HEKA 4ZPWR 2QA4N 1KKHA 2DH9A 4OV1A 2CRLA 1JLAB 4ED0A 4DV2K 5KFGA 2F8KA 2CQ0A 3BF1A 1ZTWA 2GEMA 2EH9A 2NZTA 1BCMA 3DC2A 1S76D 3IUCA 2ZH7A 5H9EJ 1N62A 4RNMA 2YKMB 5DRKA 1PKUA 1A5WA 1ZOLA 4J9OA 3LP0B 5JVGQ 3N4QA 4FK2A 3EM1A 2AEMA 1NPKA 1HNWK 3CPEA 4ZTJA 5GADP 1VCTA 1KBUA 2CQDA 4C3MA 3FMWA 2JZBA 3TU5A 1VQON 3IAM9 4HVZA 5ALOA 4FLTA 1WUDA 3A8EA 3W65A 5ALSA 2IFXA 2PFQA 4FJGA 1U2FA 3TSUA 4CEEA 2A18A 3FFIA 3AU6A 3TVKA 3FAHA 2HNDA 2MKSA 2FYXA 4X65F 3S3OA 4QWDA 1KBRA 3WNGA 3BGRB 4P2FA 4DN9A 5IIJA 2YX6A 4DQQA 4BXOB 1GNKA 4DV5K 2E5SA 1KTQA 4DOBA 4YB6A 4WKRA 3AGKA 4ZVHA 3W2VB 2E1EA 1PC5A 1JLQB 4EHUA 2OPSA 4LFCK 2EFGA 3W8PA 2BABA 4JI7F 3HO1A 4RNOA 2ZJPQ 5BRFA 4FPAA 2PFNA 4TUPA 3O0FA 7ICFA 2ZH3A 2Z1HA 3NGDA 1T95A 8ICZA 4CERA 5J2QA 4B3OB 4CLYA 1NI3A 3ZT1A 5ALKA 2MZJA 3QESA 3TAQA 3L4BC 1X2IA 4NXZA 4F5OA 2HFVA 2ZZMA 2BXJA 4MKBA 5F8NA 3SBTA 1WDTA 1NPRA 2BE2B 1YTAA 2G0IA 4QQBA 1CULB 2BZ2A 4ICAA 2JVOA 2KG0A 4XH1A 8ICXA 2WF5A 2PMWA 1HW8A 2O8CB 2FF3B 1HI0P 2DFHA 1GLCG 3CCQN 3HHKA 4RTFD 2GWSA 3G4SN 4A46A 1Q18A 1Q8BA 1VQ5N 5HLFA 3WK9A 2OP5A 3DMJB 3VQPA 2ZBPA 4ICLA 1GXUA 1R43A 2OFHX 3MM7B 2E88A 5HRNA 4TXSA 4QW8A 4LBPA 3M6KA 3IFRA 4F4YA 1QAXA 2DGXA 2LU1A 4JD2A 1RT3B 3D2SA 3UE2A 2B9EA 1DZ5A 2OMOA 2A5XA 3OBWA 3O9QA 1VRUB 1FKOA 3KK3B 1Y9OA 4EP5A 1WF1A 2EQYA 4M3UA 3JXUA 4NXMJ 1C1AA 3KZXA 3AY9A 1WF2A 3C6AA 2RVJA 4TLQA 4C8MA 2XMJA 1TL7A 1TMMA 2QWRA 2F9TA 2K7KA 4YXMA 4BR0A 1YX2A 4RCHA 3N7PD 3CYMA 5B0EA 2QX0A 2AX0A 3SENA 4RX6A 2ZUCA 2HI0A 4BWMA 4IOBA 3SPZA 1FJCA 4RW9A 5HHHA 4OIXA 2G2ZA 2OWOA 3UD5A 3I1YA 2WB4A 3MM6A 4LSZB 4ZCKA 4A8QA 3ET6A 3VQEA 1Z4OA 4KRFA 1GK8A 1NGBA 2JEJA 1YVFA 3GCWP 4P0QB 1S6PA 5HMWA 2HBKA 1UWAA 2BJDA 1RILA 4CJUA 3J7YP 4IKFA 2BKNA 4EELA 1QSYA 1Q86O 1KQFB 2QMUB 1SL2A 3CGIA 1Q82O 1ZQYA 2FD2A 3OL6A 1HNXJ 3FBEA 2IM1A 4USVA 1V3ZA 3C28A 3IDHA 2ZXHA 3KXDA 1Z00B 3CD0A 5AQQA 2KKPA 2YMMA 2MGZA 2W42A 2Q43A 2OA8A 7ICIA 6FDRA 1QQMA 2BJ8A 3L4IA 2J7KA 1XR7A 2Y8WA 3D5MA 2JX2A 1F5BA 2IIHA 1V3RA 1UVIA 3OW2M 1GTHA 4QZHA 4QW9A 3Q86A 1WOQA 5TKWA 3ZETA 1D0EA 1D9FA 3B82A 3K57A 1KS2A 3CIZA 3N4WA 4B9NA 1GEHA 3KJVA 4DJBA 1NGDA 5J2AA 2DVIA 2OD6A 2ZOFA 2EFOA 4J9PA 5B0DA 2PI4A 4F36A 1S57A 1TKTB 4DSJA 2O8FB 3RBDA 4YOEA 1R8AA 4CHYA 3DLGA 4NA3A 4UZCA 3JQKA 2PKEA 4NYZA 3CJKB 3P45B 4RW7A 3MTJA 4RQ1A 2R3VA 5K8NA 4GXJA 1V9PA 1NO8A 3MEGA 3TEGA 1UW9A 2FLLA 1FA0A 3M6ZA 2AP6A 3K17A 2HCFA 2VBYA 1IKVA 3B54A 1I39A 4IO9Q 4H03B 2LXUA 5GVQA 4DSLA 5GAEI 5BREA 1RHUB 4FW1A 2CPDA 2Q3PA 1W9HA 1U6FA 2ZFHA 3OPXA 1SV5B 3IP0A 4PG4A 4DOZA 5H1SQ 4C8YA 1UZDA 5J0UA 2EK6A 1QUVA 2I5JB 3T3FA 1IG6A 4NRTA 1MWKA 1A7GE 4ZPAA 3QE9Y 1XN9A 4UAZA 1Q81O 4TN2A 2W25A 3ADAC 3MCNA 2HOQA 1COKA 4FJNA 1EARA 5CEHA 2CJAA 1R6VA 1IWAA 2W2PP 5L1MA 2WSFC 5AZJA 2AJ1A 4YY3K 4DV1K 1R7IA 4DR3J 5ALIA 4WZQA 3NNHA 3W3DA 2EWSA 3SSSA 5DDRC 2E2OA 5KFIA 3D0PA 3Q22A 2FJEB 3D3BJ 2E5HA 1FI4A 4LFCF 3H5SA 4PWUA 1ICEB 3L4PA 3R6GB 4CT9A 4M5IA 1REVB 3N5BA 5JS1A 2DNRA 5A8KA 2V9KA 1QS4A 1FCAA 2JL9A 3BZCA 2VL1A 4ZVTB 1RAEB 1T94A 3G82A 5GIOA 3QEIA 3AY0A 3BS9A 4KPYA 1VLBA 1ZQKA 4J9LA 1XK8A 3EN9A 2GX9A 3MOZA 4RZRA 3BQTA 3H98A 3NBPA 3M1VA 3AO1A 3UD3P 4DTXA 1X31C 2XWYA 1VSDA 3UDCA 3UQ0A 1VQNS 2F63A 2KJWA 3HP9A 1QSLA 2L3MA 2JZBB 4OJ6A 1H74A 4DL7A 3CCJS 5DMRA 2XI9A 3I56N 2KXNB 3BGLA 4DR1J 1HNZK 2MZTA 4DTNA 1FX4A 3C2LA 2DRAA 3D2FA 3WT0A 1QCKA 3D2QA 1FD2A 3C15A 4ED8A 1PJ5A 3M1FA 4BC9A 1X0PA 1RAHB 4IJNA 4CGZA 2DO4A 1IN0A 3O5BA 1R0BG 1SV0A 1QSSA 3AJDA 4CLUA 4F04B 1ZQVA 4M0AA 4ZP8A 3PYDA 2KSOA 3FLCO 3CJAA 5IWAK 5F3ZA 1RKIA 1ZJNA 5BR8J 4PZNA 2Z8QA 1TUWA 1BPDA 4IR1A 3OYAA 2VQFJ 2IA6A 2P9NA 1J5EF 4YOWA 1V38A 4JK1A 1YJWN 4YDUC 1YWXA 4MK8A 4CLLA 1HBUB 3RMAA 1FRXA 4BRMA 3Q8YA 3NH1A 3ZZYA 4CEOA 1K1SA 5LMNK 4UBCA 1I1GA 3WXIA 3QGGA 1E6YA 1ZXOA 4ZN3A 5CCLA 4F0HA 2E29A 2FC8A 2Z58B 4BLGA 3NCIA 2AEFA 3FYHA 1NDLA 1IR1A 3THXB 2FHJA 2JZ5A 4F0MA 3EGZA 3ZTOA 4NLZA 3GFZA 3AAQA 5EX0A 3PYEA 1ZQFA 4IO8A 4NOHA 4C8LA 2YNHA 1RB0A 1N56A 2MQ8A 3RB0A 2R8GA 2GJFA 3AVBA 4MDBA 4U8VA 3QGIA 4OI1A 3G25A 4JNEA 1ZETA 1NJZA 3IG1A 1IV0A 5HMZA 2FY1A 5KFYA 5HLFB 4C0ZA 2IHR1 2HF3A 2HB5A 1PK3A 2LI6A 4JD2B 3I55S 4DCJB 2ZKTA 4CGFA 4C4SA 1M5SA 3KHHA 2KD1A 1YF5L 1FKOB 3RJIA 4QPTA 2RU3A 2RSQA 4CZCA 1VBZA 2QXFA 4LQ3A 2BDUA 1TL7B 5D0GA 1RZTA 2UUBF 2O3DA 1ROFA 1DTQA 2RAQA 5AM2A 5CA5A 1F44A 4ZPBA 2ROPA 1FXDA 4CLWA 5D46A 4JBCA 3ZSXA 1OXJA 4O4GB 4RW9B 4YB5A 2RPIA 3D28A 3A0HU 4OLBA 4WFNQ 4WU3A 2VFUA 4W92B 3MM6B 4CH0S 4QZEA 1C1BA 1GT8A 4CWBA 2WC9A 1M6YA 1SZPA 4EAHD 3KWIA 4DPXA 3TVYA 1S6PB 4MDAA 3ATUA 3LM2A 2YH0A 2V68A 5HQLA 2Z56B 2A1BA 2UXBJ 3MAAA 4CESA 3CFRA 1EX8A 4DEZA 1RP5A 2KYXA 1VK0A 3UNYA 4R5PA 2KU7A 2Y1RI 3SFGA 1RAGB 2C3YA 3GILA 3KLHA 3C29A 2L08A 1S1WA 2F9DA 3IA0A 2G8KA 4C4TA 4CO1A 3HX0A 4DV1F 4CZFA 3PY8A 4M5DA 1VS3A 4FKXA 4ED6A 5DZ6A 4JI1K 3SMPA 7ICLA 3H8YA 2P9KA 3OVNA 4CK2A 2P9LA 4Z4FA 4PEOA 5HOOA 3MXIA 4LBIA 1IQZA 2D4WA 5HMLA 4WJBA 5LT5A 4IOXA 1BIZA 4C11A 3K5OA 1P9QC 3M8PA 2YKPA 2HFNA 2CJXB 2UV8G 2JC0A 5ALNA 2LEPA 4UB2A 1HWKA 4F67A 2D1KA 4YN4A 2EG2A 1FJGF 5KT3A 3PZPA 2Y0BB 4I7FB 3DLGB 4OJGA 1FEHA 2XMTA 1WNSA 4RW7B 3ONNA 4USAA 1K47A 4Z6EA 4YN3B 4ECZA 5DB7A 4I4BA 3GIKA 1F0XA 2Q0UA 3TJ8A 4LFAJ 1FWKA 4TY9A 1P6TA 2QG9B 4OYPA 4P0PA 4AM7A 4C3LA 5HL7L 5AHXA 3TARA 3H08A 3MD3A 4Z4IA 9ICQA 4DUYJ 2AQ4A 5KI6A 4Z94A 1HNZF 2XS7A 3OYJA 4FKYA 4CJQA 1F5SA 4DX5A 1WSEA 2V8VA 2MUTA 4JYAJ 2PI5A 1UEUA 1X3MA 4DTUA 2AT1B 4ZVGA 3ZD8A 5DBBA 3UIQA 2RQ4A 2W24A 1NZ8A 3OYEA 2PN6A 4ZOHC 4O3RA 3LPYA 5DETA 1XNQF 4IEIA 3C65A 2P8IA 1J97A 4CIOA 3PX6A 1MN8A 1U0SA 2P6UA 5IWAF 3DRRA 1BOTO 3I6PA 2ZTCA 1LW2A 3O1LA 5J2MA 2FVPA 2KO1A 1FD8A 4ELTA 3FCWA 5A2QU 1NBWA 4M47A 4CZHA 3DOLA 4KHWA 2HHHJ 1BPBA 4ZJLA 3KHRA 2AP1A 1MG7A 2EKNA 2F7TA 4EX7A 1WG8A 3N6MA 4JI0J 5HK4A 5D4BA 2ESEA 1HBNA 4XRHA 2DNPA 2W9AA 5A8KB 2Y9HA 3K59A 3Q23A 4BROA 4DV4F 1OO0B 2D6FC 7FDRA 2XQCA 1VQPN 4FJ9A 3G82B 1X9SA 5HBMA 4E7LA 3CJ8A 5TKYA 1UTAA 4M8LA 4P2SA 2DH8A 2NYVA 4DUTA 4IFEA 3NBPB 3SXLA 3CMAS 5FLXO 3THTA 3EKUA 2UUAJ 4RQ8A 3V6KA 2I38A 3CWJA 1BISA 3K0SA 1M5KC 3VGMA 4DCPB 3SQ1A 1S0VA 1OQ3A 2QI2A 2MAXA 2LYVA 4LRAA 3TJAA 3WK8A 4ZCMA 4QOZB 3D2FB 3SCKE 5KFDA 3C15B 3DRPA 3U9ZA 1FTRA 1TVRA 3MECB 4MQ3A 4UB4A 1UCNA 4HUGA 4A8MP 2UVUA 3AA5X 4CYUB 2KSOB 5IM0A 1C0UA 3N6LA 5KGWA 5M2UA 3EMTA 2EXUA 1JLGA 1I3AA 4KIAA 3ZZZA 2NQPA 1I3OB 4PQUA 3TJ9A 1VSLA 3M1YA 2ZBRA 2P9NB 2DNQA 1FDNA 3W3SA 2F7VA 2GMHA 2ZH8A 5LJVA 3DDIA 3PIPQ 3HHLA 2ACYA 3CJ3A 2E1FA 2ROEA 1NK5A 2J6TA 4YG2A 5KG2A 4C9DA 1N6QB 5TZVA 1JROA