4DWIA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with self complementary dna, se-dgtp and calcium
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
581
structure length
581
Chain Sequence
GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dwiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dwiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dwiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dwiA01
5CZ1A 2MAXA 4KLEA 4DU4A 3ZD8A 4CHPA 3G0ZA 2F8TA 4I2CA 3IG1A 4DLGA 3TAFA 4FJ8A 3RBEA 5DLGA 3PO5A 2F1JA 3C23A 2BE2A 4M2YA 8ICHA 5DQHA 2YHAA 1JLGA 3AUOA 3UIQA 4PHDA 1JLEA 2YNGA 8ICWA 1ZBIA 3H4DA 4ELVA 3NF9A 3ALYA 1KTQA 9ICJA 3DMJA 3ZT3A 3HO1A 4GLXA 2DFFA 1ZQFA 3QNNA 4TUQA 3G6XA 4W5RA 1MC8A 5DGAA 2JEIA 1JMSA 4DQQA 4J2EA 2ZJ5A 4N56A 2BKEA 3EPIA 3TFRA 4FZXC 2FPKA 4E3SA 4JK1A 1WNSA 4ZH4A 4E7LA 4R8UB 1BHLA 2XY8A 5D4BA 1NJZA 3HVTA 3HSTB 3MDAA 1PZNA 4P2HA 4DFJA 3OYNA 4FW1A 1VSIA 3HP6A 4CF9A 3T5JA 4AHUA 3RJHA 2W8LA 5D46A 1SL1A 4ECRA 3NBPA 1J53A 3IAYA 3UQ2A 4M42A 9ICIA 3BGRA 1YTUA 4PHAA 5J0QA 1BPXA 4NLKA 2RDJA 1S9FA 1NOMA 3VA3A 1IG9A 4O9MA 4QWDA 1B92A 3SCXA 3SI8A 1NK8A 4RQ3A 2E4LA 2VG7A 2ZJAA 3LDSA 3SI6A 4YR0A 1K6YA 3QERA 3K75D 3SUPA 9ICVA 2B21A 1D8LA 2XHBA 4M3YA 1QHTA 3VA0A 5I3UA 3AU2A 3TAPA 4R5PA 1CEZA 5HRPA 2G8FA 4F4ZA 3JPTA 1BPDA 4RUCA 4NM1A 3V1OA 4P4MA 4DMNA 4DF4A 9ICMA 1D8YA 4O3NA 3JPOA 3SUQA 3S9HA 3QINA 2C2RA 1VSJA 4I28A 4O0JA 5JS2A 1S77D 3OYAA 4RNOA 1LAVA 3LPUA 5IIMA 3DLEA 7ICKA 4UAWA 1ZQPA 3KKRA 9ICLA 2F1IA 4GXIA 1CXQA 4DU1A 3V81A 1S0VA 8ICPA 4CFBA 3JPPA 4DFKA 2UVWA 4CJUA 9ICWA 4BXOA 5DB8A 4FJ9A 1RTJA 2B5JA 3E2EA 3Q8RB 4E0DA 3CM5A 5DMRA 1RXVA 4J9OA 4J2AA 4LSLA 5CR0A 1QLNA 1S9EA 1WN7A 3LP2A 3EPGA 3TAEA 7ICHA 4M3XA 1N56A 2YKNA 3ZSZA 4I2QA 2JEFA 4DTOA 4RT2A 2UVRA 3GIIA 1ZQGA 1S10A 2G8VA 3JSMA 3OYJA 5SZTA 8ICRA 2YNIA 4UB4A 5KT4A 3EW9A 3PVXA 9ICKA 4JWMA 1ZBFA 3OJSA 3EWAA 5F9LA 3T19A 3ISCA 4KITB 2OYQA 4ED2A 4P4PA 1H38A 5FRMA 2HHSA 7ICGA 4FJIA 4K4HA 5HROA 1ZYQA 5TZVA 4YMOA 3GIMA 3A2FA 4IG3A 1S9GA 4YMMA 4I2FA 4I2JA 4M9LA 4ED1A 3TAGA 2XCPA 3BQTA 9ICGA 5KI6A 4YXMA 2I9GA 3H7IA 5KG7A 3KLEA 2ZUBA 3SYZA 2HW3A 2R8JA 3PX0A 3VQ7A 5C42A 4DTRA 3AA2A 2J6TA 1C0MA 4N5SA 1KFDA 4BWMA 1HPZA 4KB1A 3ISBA 3Q8PB 1KLNA 2RPIA 1REVA 2FBTA 2XGPA 2ALZA 4QAGA 4YFKA 3SQ4A 4M04A 3OYFA 4KLDA 3NGIA 1KVCA 4QZ8A 4B8CA 2H5XA 3SUNA 4I29A 3DOLA 1KCFA 4MFAA 3RJFA 4DQIA 4O44A 2PYJA 3C21A 3RH4A 1ZJMA 4M9GA 4FYDA 3AO2A 1AROP 3VN5A 4I7FA 3UXOA 4FJNA 2I1QA 1RTHA 1NOYA 1MQ3A 4AHVA 3PW7A 4M3RA 3QESA 4CEDA 4ICLA 3C1YA 4JV0A 1VSDA 4RQ5A 2YNFA 4R63A 3L2UA 4AILC 1ITGA 4RQ6A 2BCRA 7ICPA 4X5VA 1X9MA 3PW4A 2FLLA 3AVMA 1U45A 3I8DA 3BJYA 2XO7A 4KMUA 4RT3A 9ICTA 3AVAA 7ICUA 3KKSA 4ED7A 2E6MA 3OJUA 4K8XA 3LZJA 4K8ZA 4UBCA 4J9LA 3B6OA 9ICQA 4LSNA 4KI6A 1KVBA 1LWFA 4FLZA 1L3VA 2KFZA 4M41A 1S0MA 5J0RA 4I9LA 4FK0A 5KFGA 5KG0A 1Q9YA 3VQCA 3OVNA 1NK6A 4FVMA 2VG5A 3KLIA 1WAFA 4MF8A 4AHTA 4NCBA 4DTMA 1UT5A 5EWFA 4E19A 3SV3A 3U3GA 4I2PA 3L3UA 4R64A 4KO0A 2RN2A 2VG6A 1RDAA 5CY4A 4QZAA 1RDDA 3MXMA 4KLUA 1T03A 3IHQB 4CJRA 4IG0A 5KG3A 4BXOB 3MR3A 2X6NA 4IBNA 4EZ9A 4RPXA 3G6VA 3T3FA 7ICIA 4Z4CA 1C7YA 4OKJA 3VQ5A 2M9NA 2IHMA 4CEFA 3Q8LA 4NXZA 3K5MA 4QZCA 4PWDA 1WCLA 3V6JA 4H4OA 3WNHA 2B6AA 4DS5A 4CFCA 1RXWA 2VA3A 4KHQA 1S6PA 5HHIA 1B43A 5KFOA 4CECA 4CEBA 1N6QA 3HXMA 4XIUA 4TSXA 2ISPA 3ZT0A 1ZBLA 3C6TA 4IRDA 4DEZA 1S0NA 1ZETA 4RW9A 4AHCA 3NAEA 2QXFA 4PPXA 1CZBA 1W9HA 3KLHA 1WSFA 4DTSA 3QEBZ 3JPRA 2HHXA 3AVNA 1S97A 4ECUA 4J9SA 4C8LA 4KTZA 4Z6EA 1X9WA 8ICIA 5KT5A 4I27A 2R8HA 3HT3A 3MDCA 2YKMA 3ZDEA 4Q8EA 4B9VA 3E01A 4PUOA 4FM2A 5J2QA 3HK2A 3ORYA 1LAWA 2X74A 2KZMA 1WSEA 1KFSA 4E7KA 7ICRA 3TAMA 4QZIA 2G8WA 4NLZA 3OHAA 1EX4A 4IFYA 4KLGA 3KK2A 4CJ3A 3V6DA 8ICLA 2FBXA 2P66A 2KZ3A 4IDKA 2BPCA 4FM0A 4MFCA 4OVLA 4RQ8A 4DSJA 3RWUA 3THVA 3EZ5A 5F9NA 3RH5A 2BQRA 4LD0A 1K1SA 4CFDA 3RJGA 3DOKA 2WONA 4KTWA 4KLJA 4CJQA 3NGDA 4MEYA 9ICFA 1JLFA 1SKWA 5HP4A 1SKRA 3OYBA 3RH6A 3HX0A 2AU0A 3AO1A 5HHHA 2W42A 2OPRA 2W9AA 3EYZA 3BDPA 3TR8A 3ZDCA 1U04A 4PY5A 4KTQA 4M9NA 5EWEA 3RB3A 2FMPA 3RRHA 3OYEA 5I42A 4JS5A 4Z4GA 4FJLA 4NCAA 4DL5A 3K4GA 3K5OA 2G8IA 1NKCA 4R66A 2PI4A 5J2PA 2FPMA 1LV5A 3L2QA 1TVAA 1RTIA 4H8KA 5EOZA 3CM6A 1JKHA 2VA8A 1JLBA 5BOMA 2OZMA 4I2DA 4HCBA 4CEOA 4PH5A 1ZQKA 3DYAA 1QE1A 4KAZA 4DSIA 1RT2A 5KT7A 2ASJA 4KHYA 4FS1A 3RB4A 1JN3A 1BL3A 4EYHB 5L1IA 4GVMA 8ICJA 2V9WA 2IMWP 2HB5A 4F8RA 4MF2A 3QEAZ 3L2RA 3MR5A 2R8IA 3V6HA 3VQ4A 5IILA 4RPZA 3ETLA 4O3OA 3PMLA 3SQ0A 1RT6A 1FXXA 2BCSA 4M47A 3S3NA 5J2NA 4Z4HA 4KV8A 3HPHA 2IDOA 1UOCA 4CGJA 4Y1CA 3CYMA 3JPSA 2VWKA 4CJEA 1MQ2A 3RBDA 8ICMA 4DTJA 4JUZA 1U47A 5SWMA 1ZQEA 4OPJA 5KFLA 4XA5A 2O4GA 3PW5A 8ICEA 3ZSYA 4DF8A 2XY7A 3MXJA 4MQ3A 5KFUA 3AO4A 2FC0A 4FLUA 3DM2A 9ICPA 2ETJA 4JLHA 4R65A 3UQ0A 5BOLA 5HRRA 4KPYA 4QZEA 3NF8A 3T5HA 4DL4A 4CF0A 4O3QA 4FW2A 4W5TA 4L8RB 2C2EA 2ZTEA 4G3IA 4CGHA 2IS3A 4LZGA 1LB2B 4CIEA 7ICFA 4DOAA 1TGOA 3CFRA 1DTQA 5DB9A 2KTQA 3H4BA 4FBTA 4KLLA 4ED8A 8ICYA 4OLAA 1NK0A 4O55A 3MAQA 1O1WA 1VSMA 1A5WA 4DSEA 4LZDA 4FJMA 1QSYA 4CGFA 4UBBA 1ASWA 5KFAA 3ZSXA 4QZGA 4O0IA 3G10A 4XQ8A 4F5NA 5HLFA 3RJIA 1CLQA 3BQ0A 1DOQA 3KTQA 4DTUA 4QW8A 3SZ2A 4RW4A 4F3OA 3WNFA 4ELTA 5K14A 4K4IA 4CEAA 1Z26A 3RB6A 1Z00A 4CJPA 5J0UA 5L1LA 2P5GA 1KEJA 1BVSA 4OGCA 1TK5A 3GV8B 2QKKA 5C24A 2XRIA 2GBZA 5DG8A 5IIKA 4KLOA 2VWJA 3UPQA 1ZQNA 2LYHA 7ICLA 4ED3A 4DFPA 4OPKA 5DDYA 1XI1A 4FJ5A 3KHLA 4CIFA 5JS1A 3NE6A 2IA6A 4FLVA 4EYIB 4EZ6A 5J2DA 3ULDA 3IS9A 2X78A 1JLCA 4KRFA 4BE1A 3C5FA 3U6FA 4CF2A 4NCGA 1EXQA 4PGXA 1VSEA 2HHQA 1BIUA 2FPLA 1HQUA 3LAMA 4IQUA 3RJJA 4EP4A 4YMNA 3M9NB 3PX4A 3BQ1A 5J2GA 2NRTA 2ZUCA 1S6QA 3T1AA 4F4XA 5KFEA 3Q8SB 2FBVA 3C2LA 3MEDA 5D3GA 4F5PA 1LW2A 3AVJA 3NF6A 4Q44A 1Q9XA 3PX6A 1RBVA 5KFJA 3LP0A 2PI5A 3QE9Y 1EP4A 4J2BA 3MECA 1Y97A 3FFIA 4ECTA 5KRSA 3OYKA 3U3YA 4EP5A 4OGEA 3S3MA 5DB7A 4QZDA 2HHTA 4IRKA 4O5KA 3F9KA 1HMVA 1ZQTA 5DBAA 1BI4B 3ZSWA 2BANA 8ICSA 3OYLA 2BHNA 3VQQA 4O3SA 3HPOA 2IHNA 2D0AA 4CGIA 3PW2A 2JEJA 2C22A 1ZQMA 5J0YA 4O5EA 3EY1A 4YP3A 4XUSA 4J9QA 1TAQA 2RDIA 3SQ2A 5KFCA 5CYQA 4CGGA 1FKOA 4HYKA 4M0AA 3LAKA 4DS4A 4IR9A 1KRPA 8ICCA 3L2VA 7ICOA 3SQ1A 4DSLA 3L8BA 4FZZA 5DG7A 7ICEA 5DLFA 7ICTA 4F3TA 1X1PA 3FYHA 1XU4A 1QTMA 3NHGA 4KREA 2QKBA 3IRXA 1TK0A 4CFAA 4ZTFA 3GV5B 1XS9D 1JXBA 3NFAA 1SL0A 3RJKA 4Q8FA 1HNVA 4FCYA 2OPSA 5CP2A 4FJ7A 3KD5E 5J0PA 2OWOA 3H08A 4GXJA 1RBSA 4CJWA 2PZSA 4F2RA 2IOCA 3AA3A 3QLHA 3MFIA 3V9SA 3T5KA 4N41A 4W5NA 7ICMA 4K4GA 4DTXA 4QWEA 4ID1A 1RZTA 3KHRA 2BQUA 1DTTA 7ICQA 1VRUA 1ZQUA 5J1EA 7ICNA 4Q43A 3AVIA 1ASVA 3NF7A 4DOCA 1UWBA 2IAJA 4W5QA 2JEGA 2F96A 1BCMA 2P6UA 1U4BA 4YR2A 3C2MA 3MR2A 2QK9A 4E89A 5FDLA 2Y1IA 3O3GA 3ZT4A 4HCCA 5JUMA 2HNZA 2FLPA 4F5QA 4UB3A 1Z00B 1ASUA 5DBCA 5DDMA 1NK9A 3NGYA 4FLYA 3QETA 1RT1A 5KFQA 3T5LA 1IKVA 4CEEA 2D0BA 3NGZA 1BGXT 4I9QA 4ZTJA 5CHGA 1U49A 1XSPA 2G8UA 1NK4A 1ZQCA 1ZQAA 1XSNA 1UA0A 4FJXA 2FLNA 4KLMA 1RTDA 1C1CA 9ICSA 2ITGA 4RPYA 1FK9A 4NLNA 4JV1A 4DO9A 2VANA 3LANA 4GMJB 1S1TA 5FROA 1KSPA 4UAZA 4CK3A 4ECVA 3V9WA 4F4YA 3G6YA 2C28A 3TABA 5KFZA 4Z6DA 1MSWD 3C6UA 1TL1A 5CZ2A 2GV9A 2NUBA 5E41A 3P5JA 2IGIA 2P6RA 2ZJ8A 4KB0A 2BCVA 4CHYA 9ICRA 1BIZA 1RBRA 2HVHA 2R8KA 4ZHRA 1IKWA 4CERA 5J2FA 2AQ0A 3AO3A 4W5OA 1J5OA 4RNMA 4RNNA 1WCNA 3VQ8A 4CESA 4GC7A 2Z1HA 5KT6A 5IINA 1G15A 4CGDA 2PYLA 4CEZA 4CJKA 3M9OB 3HVRA 2BPFA 2ASDA 4UB5A 2W9CA 4E1MA 5FRNA 4QZ9A 4FZYA 4BE0A 4CIGA 3NCIA 1IXRA 2XC9A 3RTVA 1TVRA 3ZCMA 3MFHA 3QIOA 2IBKA 4Z6CA 2ZTCA 5HRSA 3AVBA 3K5LA 3OYHA 2AQ4A 1GOCA 2PFOA 1WSHA 3AA4A 3GQCA 1S5JA 4J9RA 3ASMA 2O4IA 3C2KA 1Z25A 4YG2A 3MABA 2EX3A 1D9FA 4Q0BA 3Q8MA 2ZD1A 2RF2A 2RKIA 2ZTDA 3B6PA 1DLOA 3M8SA 5C5JA 2FMQA 1XHZA 4FK2A 4EBCA 1HYZA 5CWRA 3OS1A 2GUIA 3KD1E 1UT8A 2AGOA 9ICNA 1Z3EB 1F21A 3WNEA 3TWHA 4B08A 1MU2A 1CZ9A 1BQMA 1WSIA 3KLGA 4EBEA 4ELUA 2D5RA 4I2BA 3H8SA 8ICOA 2WTFA 2YHBA 1L3TA 2A1RA 4M9HA 4FXDA 2J6SA 5EWGA 4QWAA 3AA5X 3L3VA 5KGWA 5KG5A 3SNNA 1QS4A 3ISDA 3HW8A 4DWIA 3P83D 5IIOA 4IRCA 3RAXA 5KFXA 3NH1A 4E7IA 5J2BA 4B9SA 2ASLA 2E6LA 5KRTA 2AGQA 2HNYA 4FK4A 2XY6A 4CHQA 2HMIA 2PFQA 2A1SA 2NRVA 4HUEA 4B9UA 5CB1A 3PW0A 8ICGA 3H8WA 4DQSA 3NTUA 5D49A 3M8QA 3GV7B 3QEWA 3PMNA 4DL3A 3OYIA 4J9KA 3KJVA 3RMBA 5J2JA 4RW6A 3QEVA 2JLEA 4F91B 1RYSA 5J29A 4N76A 1HQEA 4CHZA 3HM9A 1BPYA 3QZ8A 2HHVA 3N4MB 2BPGA 4O4GA 3I0SA 3QNOA 3OYGA 5HRNA 1S1WA 2IC3A 2PY5A 5J2AA 4M9JA 4CJ4A 1NJYA 1L3UA 1W0HA 3RJEA 1B9FA 1QQCA 4B9LA 3M8PA 4OKKA 8ICVA 4F92B 3WNGA 3ZDAA 9ICUA 3PR4A 2KN7A 3LWMA 1A5VA 1RDBA 3IM1A 3HYFA 1I39A 3OS0A 4YD1A 1N5YA 5C25A 3H40A 3ZDBA 4OLBA 2W9MA 4BACA 4F5RA 3JPQA 1T7PA 3DI6A 2GWSA 4HTUA 4Y1DA 1RCHA 1BI4A 1JLQA 1RDCA 4M6WA 2Z1IA 2BCUA 3AO5A 4Z0UA 1HRHA 2DPJA 4QWBA 2HHWA 1VSKA 5KFKA 1HYVA 3ZDDA 5DBBA 3LPTA 3TANA 4UAYA 1DGSA 2W9CB 4Z4FA 4IQVA 4BWJA 2KFNA 3N97B 1JX4A 3ZSOA 3TQ1A 4MEXA 2DTUA 3VQEA 3Q8KA 1S0OA 1NJXA 3V4IA 4DG1A 5KFBA 3OHBA 4JV2A 3DRPA 3ZSRA 4DLEA 1YTAA 1NK7A 3FDSA 4YXJA 4YD2A 3SJJA 4E7JA 4KFBA 1LW0A 2BQ3A 2R7YA 4FM1A 1ZQJA 1VSLA 2F8SA 3D0PA 4EBDA 3HWTA 1TKTA 1BCOA 4C8OA 3PUFA 5DGBA 5HBMA 8ICQA 3RR8A 5KFDA 4C8KA 3C94A 1QSSA 1BQNA 3B0XA 4KLIA 1ZJNA 2ZE2A 4YNQA 4BDZA 4J9MA 8ICFA 1FKPA 2KW4A 4DL2A 3V7JA 3JYTA 3MGHA 4YN4A 1GOBA 4KN7A 3DLBA 3HP9A 4I2HA 3VQPA 5L1JA 4FJKA 3V9ZA 4AHSA 1BPZA 2ATQA 4B3OA 4UQGA 9ICXA 4OJRA 9ICBA 4RQ0A 4NLGA 5KFHA 1ZQQA 3OSNA 4ECYA 5KFRA 4FJJA 4FO6A 1JLAA 1I3AA 4CF8A 4IKFA 2BR0A 5EU7A 4GW6A 5KFPA 1SV5A 4C8MA 4ID5A 3OS2A 4QZFA 3RB0A 3OYDA 3VQ9A 4CJSA 5J2MA 4IQTA 2R8GA 4ED0A 1KFTA 1WSGA 5J0OA 1C1AA 4YFUA 1CUKA 4CK2A 4B8AB 2DFLA 1TV6A 2B4JA 4B9MA 1Q8IA 4O5CA 5J0SA 3KLFA 1A77A 3C1ZA 4PGQA 8ICZA 5J2EA 3AVKA 1IH7A 1TAUA 3QZ7A 5J2IA 3RMAA 5KFFA 4DTNA 1U9LA 5DG9A 3HJFA 3NH0A 1BPBA 5DKWA 3AVHA 5DQIA 4E7HA 2G8KA 4ECWA 4XRHA 3SPZA 1TKZA 4CCHA 1TV9A 5KG4A 1HUOA 1TL3A 3TI0A 4KLQA 1RBUA 3AVLA 4O3RA 1ZQXA 4NYFA 1IKXA 3PNCA 3MBYA 1ZQVA 3LALA 2FBYA 4J2DA 4ED6A 4JRPA 3AV9A 3TFSA 4AH9A 4QCLA 3MR6A 3V6KA 3CFPA 3QEIA 4KLFA 3KIOA 1L5UA 4QZHA 4OKEA 4I2EA 1TK8A 1RT3A 1ZQDA 4M6WB 1ZQRA 2BCQA 3V72A 4C8NA 4KKOA 9ICCA 2MUTB 4RQ1A 4EEYA 1XHXA 2DFHA 4M3ZA 3ITHA 4IR1A 1RT4A 4PQUA 4H4MA 1X9SA 4CJFA 3F73A 3DRSA 2NRXA 4UB2A 4BDYA 3GDXA 4F4KA 2F1HA 4PHEA 4CE9A 3PR5B 2W9BA 1C1BA 4HHTA 2G8HA 1TKDA 2P51A 5CJ7A 4IQWA 1J9AA 3PO4A 5T7BA 1LWCA 2Y1JA 4RQ7A 3OYCA 4I2IA 2ATLA 1RT5A 3CFOA 1JXLA 1TKXA 1D9DA 2DPIA 4FLTA 5IIIA 4F4WA 4KLTA 2P1JA 4DFMA 4F5OA 4NYNA 4TUPA 4CF1A 3GFKB 1SL2A 3NDKA 3VQ6A 5DQGA 1XC9A 4CJLA 2P5OA 4QZBA 1HJPA 3VQDA 3TARA 2ZQBA 4BE2A 2Q0ZX 4CHOA 1KDHA 3HL8A 3JPNA 4B9TA 4KN4A 4J9NA 2Z1JA 4IFVA 2UVUA 3AVCA 7ICVA 4G1QA 4TURA 3AVFA 4NY8A 3I0RA 1UAXA 4KHWA 1YT3A 5L9XA 1JL1A 3DLHA 1JIHA 4M3WA 5KFWA 1EKEA 3K59A 5KG2A 8ICNA 3DLGA 5L1KA 2ISOA 4MFFA 2YV0X 3LWLA 2XCAA 1ZQLA 3KHHA 5KFSA 1ZQOA 8ICBA 4LVSA 1XSLA 1NOZA 1RT7A 1S1UA 1B22A 4BGDA 4AHRA 3DRRA 2OZSA 4RUAA 3ZSQA 4FS2A 2AGPA 1NKBA 1C6VA 5J0XA 5KFNA 1KVAA 4Z4IA 4KHUA 3SPYA 3VQBA 1XWLA 4PHPA 3P1GA 3DLRA 4J9PA 4Q45A 4YQWA 4KLHA 3HPGA 1ZQZA 1LWEA 3GIKA 3V7LA 4ECSA 5IIJA 1ZQWA 3V7KA 3QEPA 4HUGA 4DL7A 2UVVA 1VSFA 3QIPA 4CJVA 1X2IA 4B9NA 4I2GA 3O4NA 4LH4A 9ICOA 4DSFA 3B0YA 3KHGA 2NRZA 2Z1GA 3OSPA 2JZBA 4RG8A 1ZBHA 4I2AA 3RMDA 2A1JA 1IM4A 1GOAA 4ECXA 3LP1A 3MEEA 3QO9A 5J2CA 2BGWA 4GC6A 4WE1A 1RPLA 3H8JA 3O4QA 4FLWA 1RNHA 1RYRA 4DSKA 4DU3A 4O3PA 3TAQA 1VK0A 9ICHA 3OYMA 4M3TA 1HYSA 3BQ2A 3SV4A 4QOZB 4FLXA 1VSHA 4M3UA 1TFRA 4CJ5A 4CEQA 3GIJA 2LSNA 8ICUA 1SUQA 4NM2A 4DQPA 3NH2A 2X6SA 2OPPA 4M45A 1RILA 1L3SA 1IO2A 3ZSVA 3RAQA 2JGUA 8ICKA 3K5NA 4YVZA 4PA1A 2HVIA 4RW8A 2HNDA 2W9BB 1HJRA 3QEXA 4KLSA 3OGUA 4Z4EA 3C5GA 1J54A 4KI4A 7ICJA 4GXKA 4TUSA 3UXPA 2W8KA 1V9PA 3DLKA 2PFNA 3O3HA 1D5AA 4O5BA 3V9XA 2D0CA 4FJHA 4Q5VA 3LDAA 1JXEA 3MGIA 1S76D 3ZT2A 2I5JA 4HUFA 3SUOA 1HNIA 3K2PA 1A76A 1VRTA 5KFIA 5CA7A 8ICTA 5HMLA 4DQRA 1T4GA 4UB1A 3Q8QB 3L2WA 3K58A 1ZQSA 4HVJA 1T05A 2VA2A 4CHNA 1RBTA 1EXNA 3OY9A 3CG7A 4LH5A 5KFMA 1COOA 5KT2A 1BISA 4N47A 5KGXA 1Y88A 2BDPA 2ZUDA 1C0TA 2J6UA 2OPQA 4R8UA 4RQ4A 4TQSA 3UXNA 3MXIA 1S1VA 4QWCA 2AJQA 3ZT1A 4PGYA 1KLMA 2KZZA 2V4QA 1N48A 1ZQYA 3RMCA 5J0TA 4E1NA 5KG6A 8ICXA 1JL2A 1QSLA 1U48A 4JS4A 2NRWA 3ZD9A 2KQ2A 4QW9A 3AU6A 4BDPA 1WLJA 4ECZA 1ZQIA 3PY8A 5HP1A 2HHUA 3V1RA 4RU9A 1EETA 3RR7A 1NJWA 4RQ2A 3D45A 4DOBA 3C95A 5J2KA 3MEGA 2BGGA 3LP3A 4P4OA 3LZIA 1NKEA 1BPEA 1HUZA 1IKYA 3M9MB 3V1QA 2DY4A 5J0WA 4F93B 5KFYA 5DK5A 3CQ8A 3RRGA 4TQRA 4F2SA 3K57A 2OA8A 1R0AA 5BPCA 2JZBB 2FMSA 1YVUA 5HMMA 5KFTA 2DFEA 4YR3A 3VQAA 4CJTA 2A1JB 4DTPA 4FBUA 2V4RA 1S1XA 5CYMA 4LY7A 5KT3A 1ZQBA 4Z6FA 2PFPA 3ISNC 5KG1A 5J2HA 1B9DA 2MUTA 4RW7A 3GILA 1NK5A 5KFVA 2XY5A 1UA1A 2YNHA 1T3NA 5HNKA 1K1QA 4YCXA 4ECQA 4DL6A 5DB6A 4KHNA 1T8EA 2WOMA 1A5XA 1C0UA 4FJGA 5KTQA 1WAJA 3O3FA 7ICSA 3S3OA 4MFBA 2Q3SA 8ICAA 3KK1A 3LK9A 2PXIA 2XGQA 3AVGA 1ZBUA 1SZPA 1WSJA 4JRQA 4CK1A 2EHGA 3M8RA 2C2DA 9ICAA 3KK3A 1SKSA 1ZQHA 4RZRA 1XO1A 1CXUA 4KHSA 9ICEA 3PV8A 4JWNA 3V9UA 4F50A
chains in the Genus database with same CATH superfamily
2MAXA 3R7BB 4M5DB 3PSTA 3D2EB 4CBUA 1YJUA 1IBKF 5AK5A 2DTJA 3FM9A 1PK1A 3DLKB 3IG1A 5BYRA 3KUGA 4DV2K 2W2MP 4JI5J 2G2ZA 2FJEB 3R27A 8ICHA 1H3DA 1CJUB 3AUOA 5AKGA 2JLFA 4J8FA 4XH4A 5E33A 2YNGA 1AB8A 3PLAA 2GVDA 1DFDA 5A6WA 3H4DA 1F5AA 4ELVA 1NSKL 3HSJA 1J27A 2EZXA 3RYLA 3DMJA 3HO1A 4GLXA 2DFFA 3SFUA 3GYGA 3QNNA 3LPYA 4YS2A 4DCOB 1JMSA 4DQQA 2UU9K 1WG1A 3L4QA 4KX5A 2MJNA 2WB1D 1KQFB 2HHHF 5G0RA 5CEHA 2HRUA 3TFRA 4ZH4A 2HQGA 3TR5A 4E7LA 3R8YA 2XY8A 1S1VB 3HSTB 1PZNA 4P2HA 4IDKB 1FWPA 4DFJA 4PWUA 5ETRA 4ZIVA 3V4MA 2HRTA 5D46A 3PRBA 5F3XB 3FQLA 2G0CA 4OI0A 4LF1A 3BGRA 2HSTA 4M5IA 1BPXA 3E0FA 1EKRA 3K9JA 1FFSB 2KI2A 1P7DA 2DKZA 3VA3A 3HJEA 5HP1B 1YZ7A 2VG7A 4ID8A 1EETB 4AYBD 1DXSA 3B6BA 4F26A 5ADXH 5F0XA 2B8PA 1D8LA 2XHBA 3CCRN 1WC0A 4IQMA 1KAZA 2DH7A 1CEZA 5HRPA 1IKYB 4PKGA 1BC6A 1RDWX 1NBWA 2WAQD 3JPTA 1BPDA 4NB4A 4U6PA 4RUCA 4NM1A 3AL0B 4JKDA 1RQLA 3JPOA 4LFCF 5JJBA 4B1UB 4MK8A 1AZSA 5AI0A 2ZWOA 3WC2A 3CC4S 3LPUA 1S1XB 1Q16B 5IIMA 1WTBA 4BC7A 1WI8A 3DLEA 4NA3A 1RLCL 2W04A 3IA0A 3G8TA 1CXQA 4DU1A 5AQPA 3ZZUA 1B99A 3O2IA 1NGBA 2P9UB 4J9OA 1NNLA 3E58A 4LSLA 1S9EA 4UOGA 5BR8F 3IMQJ 1WEZA 4M3XA 3W8GA 3UE2A 2QMWA 3QAUA 5CAAA 2F3JA 1S10A 4KQZA 4DX6A 3K8VA 4UB4A 4PL7A 4JI5F 4I69A 4KH5A 1KC8T 2P9GA 2OYQA 5AQLA 4ED2A 3VAMA 1H38A 5FRMA 2HHSA 7ICGA 4UZCA 4K4HA 2E9RX 2K1RA 4YOTA 4NYOA 3DRXA 5TZVA 5FPDA 2FY8A 1RDFA 1GLAG 3ZC4A 4YMMA 2MDAA 2CDQA 4I2JA 4B6JA 2E7XA 3C14A 5AXLA 1JLGB 2C3YA 1VQSA 5KI6A 4J5OA 3DU5A 2NYHA 1JLEB 3C7NB 4H0VB 2CQDA 4QYRA 3VALA 5CXTA 3VQ7A 3AA2A 1SQGA 4N5SA 1C0MA 4BWMA 4KR0B 2VFVA 2AH5A 1YXQA 1K73T 1REVA 2XGPA 4JKGB 4QAGA 3C0BA 2FVCA 4YFKA 3Q89A 2EFVA 3NGIA 3D7SB 3MM7B 2H5XA 3D28A 4Y65A 1OH7A 2J9DE 1ZTTA 4FF1A 4PL2A 5LJVA 1N52B 1WKKA 3K17A 4M9GA 1UEVA 4FYDA 4MKYA 4ZP8A 1B3TA 2P9NB 4FJNA 2I1QA 3NVVA 1RTHA 5H9FK 2NXUA 1MQ3A 4AHVA 2GGPA 4JV0A 4JYAJ 5ALVA 1RM6C 3NBPB 1E6YA 2MZSA 5BR9A 4BR9A 1M0SA 4M7XA 4RQ6A 2CJKA 2FHJA 4Y2KA 1F2GA 4PAAA 1YDLA 3FC9A 3UWTA 3CTRA 3BJYA 3KBBA 3QT8A 3MEKA 3NG8A 1OS5A 1GT8A 2E6MA 5AXKA 4K8ZA 4BRHA 4J9LA 3W8PA 2XLJA 1GTHA 4KI6A 1E6VB 2NSCA 3F5AA 5H1SV 2KFZA 4R5PB 4P10A 1NO8A 1L6NA 4X66K 3WXKA 2ASYA 4FK0A 2KJ5A 1VDHA 1M90T 2HIQA 1Q9YA 2V8PA 5GMKa 2FSNA 3N7SC 3HULA 4LR9A 1WAFA 4AHTA 2EVZA 4DTMA 2A18A 4YB7A 3U3GA 4I2PA 4GKKK 1ZD3A 3NGUA 4KO0A 4DUYF 3CJBA 2CJYB 3FCVA 3U8XA 4QZAA 1RDDA 3BKUA 3A3NB 4P9SA 4A47A 3T9ZA 5D4NA 4NASA 1VQ7S 1FVQA 3W9JA 2K4EA 4IG0A 2UXCJ 1CJTB 2RQ4A 2X3DA 4BXOB 3HHLC 3FAHA 2B5JB 4DV1K 2MHNA 2E8OA 3GJRB 5B08A 4Z4CA 1C7YA 5AJ3K 3MUMP 3L09A 1MA7A 3Q8LA 3POTB 2YKNB 4QZCA 5HI7A 4FZNA 4FWRA 1WCLA 3V6JA 4I2QB 2P9LA 2FC9A 4DXLA 3FK4A 4HTLA 4FPAA 4PXEA 3JSMB 2E44A 2MQQA 4KHQA 4GO7X 2YNIB 1N6QA 2JNJA 4BBYA 3TA1A 4ICAA 2CQGA 4BGBA 2VC0A 3CF5Q 1ZBLA 3C6TA 5B66U 4X65J 5M2PA 3NAEA 2QXFA 5DDRC 3KLHA 5ALSA 1VS3A 1CJUA 4IH5A 2PDAA 5C2CA 3M2RB 1BNPA 1S97A 3Q83A 3CMEN 2AKWB 4J9SA 3KNGA 1FJGF 3R2DJ 4Z6EA 1S72S 2W24A 4X4TA 2KE7A 3IAM9 3IN5A 2FYXA 2YX1A 2ASPA 3KLEB 2CH6A 2V4JA 1PVRA 2KN4A 1NDPA 2KZMA 4EFHA 1KFSA 3TAMA 2CYYA 2K89A 1UJ5A 2OIHA 4JI2K 1X3MA 2R7XA 5EUHA 8ICLA 2FBXA 4IOAL 1FWKA 4U8YA 4NJ8A 1XUPO 5AHXA 4IUFA 4IDKA 4RL1A 1OXJA 2BPCA 4OZ3A 3WKCA 1G2EA 4RQ8A 5ADXA 1Y3KA 1K1SA 3RJGA 5FDLB 1VQPS 1U1NA 3G96A 2I7NA 4I7FB 3RU0A 1S6OA 2LU1A 9ICFA 1FIQA 1PKUA 5HP4A 1VAZA 1C0FA 2YNFB 4A8KA 2AU0A 2F8LA 5HHHA 3BDPA 4YOUA 2CJQA 1RWWB 5JVGL 1IJEB 4KTQA 4K2XA 4M9NA 4WFYA 1IKVB 2FMPA 3IFRA 5AKEA 5AKKA 3RRHA 3OYEA 3G71N 2B4OA 3OVSA 5ALDA 4JS5A 4F71A 1N34J 2K4PA 5AQRA 1NKCA 1HNWJ 4R66A 5J2PA 2BXJA 2W55A 2JC1A 2DYAA 1VOMA 3L2QA 2UXDJ 4LSNB 1KEKA 3BQ7A 5EOZA 2GCFA 1CG2A 1R59O 3DOMA 5JVHL 2VA8A 2I7PA 5BOMA 3IV6A 2OZMA 4OI2A 4ES1A 3N4WA 1IBMK 2MLZA 2RHQB 1RUSA 1XQSC 4HCBA 3SEIA 4U7CA 1P9QC 2XMKA 1UTAA 4DUZF 2DNQA 2CN1A 4WFNQ 5KT7A 2ASJA 2VG6B 4KHYA 2MKKA 2UXCF 4FS1A 3OR2B 1BLUA 1VQYA 4FWSA 3RB4A 1K8KB 5EE0A 4JK8A 2IRUA 5L1IA 1DJ0A 2QA1A 3J7Z5 1QVGM 3CIMA 1T03B 1KQQA 4ITSA 2WVCA 2R8IA 2VJUA 1VQ9N 4OIXA 4LMZA 4RPZA 2L9DA 3ETLA 2ODGA 1RT6A 2P9IA 4Y2RA 4M47A 3S3NA 4KV8A 2L5YA 3J81Y 3FZMA 1UOCA 1O08A 2RRBA 2GELA 3CYMA 3ZFVA 4X65F 2DNHA 4CJEA 3RBDA 8ICMA 2BW7A 3RJMB 1U47A 5SWMA 1ZQEA 1RBOB 5JMNA 3ELHA 1CS4A 1RE1B 1KL9A 4MQ3A 3AO4A 3OBYA 4RTFD 3ID8A 1WEXA 4OJ1A 3BKFA 3M05A 4HEA9 3UQ0A 4OJLA 3UMCA 3WX4A 3T5HA 2BOPA 4DL4A 2PT0A 4YDXA 4W5TA 3O08A 4L8RB 1NMDA 4AE5A 5GAEP 2F3NA 4DPXA 2QARA 4CLSA 2HOFA 2JWLA 2DR6A 2H3EB 7ICFA 3CFRA 4M5NA 5DB9A 2KTQA 3DXKA 1HBUB 4KLLA 4H5RA 5BRHA 1B0PA 1VSMA 2Q43A 2GX9A 4LZDA 3FSXA 2D9OA 4CGFA 1Q4RA 3R9LA 5KFAA 4KGVB 4O0IA 1VJ5A 1GXLA 2GO9A 2F4VJ 4PKHA 3Q0AA 1BWEA 1PILA 4RWWA 3QU2A 2FDNA 3DCAA 2VQFK 1JRPA 2KIVA 4N8NA 1CSJA 4BLGA 4WCEQ 3GBTA 3BQ0A 1YBTA 3VF4A 2DR9A 1SV4A 3MAHA 2ZG6A 3C65A 1YVNA 3MMBB 4GVBA 4F3OA 3CCWA 3DOKB 4ELTA 5K14A 5IT9O 2V34A 1A9NB 2NRHA 1MMNA 3P4UB 3PKYA 3PSFA 4FO0A 3WBZA 3GV8B 2QKKA 2RUSA 5D4LA 5DG8A 5IIKA 2NPFA 1EQMA 3UPQA 1N34F 2J9DA 3JTNA 4ED3A 1XI1A 4FJ5A 2XSFA 3VAGA 2UXDF 1HBMA 4JI8F 4DV3F 3DGPA 1EZZB 5J2DA 4ZDNA 1N0UA 2UUAK 3D2WA 1ACMB 2X78A 5C7PA 3M7DA 1ZBTA 1Y00A 3C5FA 2HHQA 2AEMA 1DGKN 2NRRA 4Y2PA 3CO0P 3ZEUB 4WWSA 2ZVSA 4C48A 3PX4A 2CPHA 3R6LB 4QS7A 4F4XA 4U7UD 3WXLA 4NLTA 1VK8A 1FRMA 3M8PB 1Q9XA 3GE9A 2JOQA 1QE1B 3F41A 1BXNA 1RAGB 4J2BA 1RT2B 1Y97A 3FFIA 1VBZA 4K7QA 3OYKA 1RJJA 1YK9A 4YDDB 4OGEA 3S3MA 3AFGA 2G08A 3QWPA 3AN1A 5G5GA 3F9KA 1ZQTA 1N63A 2EAPA 3W5XA 3VQQA 3HPOA 4ED5A 1S57A 2OUGA 2C22A 1ZQMA 1HKBA 3QJJA 3EY1A 3KKAC 4HH0A 1RAAB 3CIPA 5CCMA 1TAQA 3SQ2A 2RAQA 2DNOA 4E98A 4HYKA 1QD1A 4M0AA 4C4SA 1S8OA 3CCLN 4DS4A 3D0IE 4IR9A 4CBWA 3NWGA 3L2VA 3QYYA 3SQ1A 2UXBK 2OJ3A 4QOTA 4F3TA 4NX9A 2WHOA 3EEQA 3CGIA 1QTMA 4H0YB 3NY0A 4B1WB 1H72C 2DR7A 5H2FU 2WCXA 2QRRA 3IRXA 2XMJA 1TK0A 3DAWA 4ZTFA 6FD1A 5CYJA 2BJ9A 2FJ6A 4HT7A 4IEEA 3F5TA 3MK6A 1OWXA 2HS3A 4H0TB 3N7RC 4PXCA 2PZSA 3QLHA 4X4OA 2IM0A 3NASA 3V9SA 4N41A 1FNXH 3TSUA 2GMJA 3N6NA 4QWEA 1HJOA 4JK7A 3VGKA 1ZXIA 4FF2A 3OLAA 1YG0A 3KHRA 1UJ6A 2LQ8A 3MR7A 1DTTA 7ICQA 1ZQUA 4IO9Q 1X8DA 7ICNA 4Q43A 3LO3A 1SJFA 1D9AA 2IAJA 2V0NA 2G4BA 4UOCA 4CLLA 1JJ2R 1BCMA 2P6UA 3M6UA 3MR2A 2QK9A 3RRKA 2G1DA 5FDLA 5DDOC 4E89A 4IH6A 2Y1IA 4J9VA 3ENHA 3BF4A 4RW4B 2HNZA 1ZA2B 3T69A 2QKQA 1HBNB 3AHPA 4X4SA 4LF2A 1W26A 2RRNA 3OTBA 2OD6A 3DRYA 2QA2A 3KFWX 1ASUA 4BGAA 5DDMA 1SJ3P 1B64A 5C24B 2IRXA 5KFQA 1IKVA 4U9RA 2LU2A 3ET6B 4C7QA 5HJYA 4I9QA 4U7BA 2A41A 3LOUA 1U49A 1QY7A 2GX8A 1TZ0A 4OHVA 1XSPA 1NK4A 1Q0NA 1GLJO 1ZQCA 1UA0A 2FLNA 2E8PA 3W9IA 4NRUA 3IS9B 4RPYA 1JLCB 2CPIA 2XWXA 5C2FA 4NLNA 4X62J 2Q6CA 3TWZA 2NO4A 2XG8A 4DO9A 2DIVA 2HBQB 4RBTA 2VANA 2CNOB 4JD2B 3M6WA 1DGJA 1ED1A 3LANA 5BYSA 1IV8A 1S1TA 4URQU 3A3PB 4PHTX 4FPRA 2AJFE 3V9WA 4F4YA 4ETXA 1COKA 2FZKB 5KFZA 2IOFK 4CTAB 3W2WB 3C19A 1NHVA 2ZGZA 2NUBA 4ZVOB 4K4ZA 2F9DA 2PBDA 4KB0A 4CHYA 9ICRA 3QJLA 3CJ2A 1BIZA 3UFCX 3K89A 1HUXA 5AE2A 3NVYA 2R8KA 1E4FT 2MKYA 4OYAA 1HMVB 3PJWA 1J5OA 2DY1A 4RNNA 5B7WA 4FWQA 4USKA 1WCNA 4CESA 4GC7A 4DV5J 5KT6A 1Q53A 3FZ2A 3ZNUA 5HSPA 3NS6A 2W9CA 4ANDA 4QZ9A 1GLCG 2ZJQL 5KAIU 2C3MA 4QIVA 2E5SA 2ZGYA 3SBGA 2J8AA 1SXLA 2IBKA 3TA2A 5HRSA 3K5LA 1EJ7L 1HNXF 2AQ4A 1GOCA 1Q5VA 4CVNE 5CD4H 1WSHA 4WXWA 3AA4A 2YXLA 2F40A 3BPSP 3AD9C 4LF4F 3EE8A 1Z25A 4HHHA 3Q24A 1HR0F 1D9FA 4Q0BA 2CRXA 3SEOA 2RF2A 4HWIA 2FMQA 4DU8A 1VQLN 1KONA 1LQ9A 2DGVA 2XI2A 3AAPA 2BUPA 9ICNA 3G8QA 1Z3EB 2G1HA 4NL9C 5IM0A 1F21A 4KHPK 2K8AA 3WNEA 4B08A 2ZOFA 2OTJS 1CZ9A 1BQMA 1RGVA 4X4UA 4URSA 1QDUB 4EBEA 2E5LJ 1SQEA 4I2BA 4EELA 3HMJG 8ICOA 2DNPA 3FFKB 1L3TA 1NSPA 2CGLA 1RKJA 4FXDA 2J6SA 4QWAA 3AA5X 4CJ7A 5AQTA 2ATCB 3SQGB 1SIWB 2R4FA 4B1VA 4MKAA 4BR5A 1X4BA 4Y2UA 2J4RA 4CZMA 4Y2AA 2WVBA 4WYBA 4B3SK 3QMQA 3T41A 4WKYA 4KH6A 2IRYA 2VONA 2WBMA 3CCSN 3VEWA 4HUEA 4BRLA 1X4EA 3NTUA 5D49A 1YJVA 3M8QA 2EWSA 3VERA 1N62A 4DL3A 4J9KA 3RMBA 2HWHA 4RW6A 2B51A 5DM6Q 4DHVA 4N76A 3SCLE 2M70A 3IWXA 3N4MB 3I0SA 1S12A 4TN2A 3LGHA 3OYGA 1C1CB 1M5VC 4DV4F 3R3LA 1XNRF 1REGX 4M9JA 4KH0B 2ROGA 4A46A 2OGUA 4WBFA 1TL5A 2WF9A 2PFUA 3ZETB 1VIOA 3RVCA 4B9LA 3M8PA 1FVSA 4G1PA 2B7BB 9ICUA 4F0MA 2F7TA 1GMWD 2FVQA 3BGFA 2XZDB 1A5VA 2WW8A 3C6UB 5C25A 5ETOA 2I1RA 3MM9B 1AYEA 1FE0A 4F5RA 1T7PA 2C2NA 2JX2A 3EE3A 3L5KA 4Y1DA 4LFAK 3TW0A 1RDCA 4M6WA 2BCUA 1IKWB 1R89A 3ZX0A 1NGCA 2HHWA 5KFKA 2K4IA 4Q2LA 3ZDDA 4YEAA 5DBBA 2PE8A 4HHUA 2PA3A 2LEPA 3CD6N 2VGNA 2FJBB 4U7UK 1TVRB 1FEEA 2KFNA 3CCUS 2XWYA 2DNYA 1R31A 2A6MA 4B3MJ 3VVUA 3ICLA 4MEXA 2B4PA 2ZH3A 4NRTA 3GJQB 1NJXA 2F9WA 3V4IA 5F1XA 4DG1A 3OHBA 4O8KA 1YTAA 3IBPA 5E3RA 3HKWA 4YXJA 2JHEA 4LQ3A 2RKIB 1CLFA 1LW0A 1DLOB 2V8VA 1ZQJA 1QQMA 3D0PA 4YHHJ 1AA1B 1TKTA 3OLBA 2Z58B 3I9ZA 1JUDA 5HBMA 4DPTA 3RR8A 2E5LF 1UVLA 4C8KA 2Z0GA 2V6AA 3B0XA 2ZE2A 3W2VA 3ED5A 3ETRA 4J9MA 4KJIA 1FKPA 3JYTA 1T9WA 3DXMA 3M8ZA 4KN7A 3KLGB 2ZOMA 3TZXA 4R25A 3UCUP 4FN5A 1NGAA 1VBYA 4QU6A 1Y0HA 2NREA 3V9ZA 2HBLA 3UPFA 2ZZMA 3IG8A 4I68A 4ANEA 4K4SA 1HWUA 3GU3A 2HQIA 2VF3A 1HBNA 4P2SA 4Y0WA 1U24A 5EVZA 3IBFB 3PEJA 3W0LA 1VQ4S 4ID5A 4NLSA 4PKIA 3BM7A 3RB0A 1GEHA 2RU9A 1WBDA 2DEJA 5J2MA 1QCKA 1KXPA 2OEKA 1M5HA 2R8GA 2HF3A 2OH2A 4BVPA 3E1YA 2MZJA 2DFLA 2UYTA 3OXLA 5ETMA 2BACA 4O5CA 4Y2JA 4O4GB 3KLFA 3I56S 4PGQA 3GFXA 5J2EA 3AVKA 1XR5A 1Q81O 3SMZA 3A0IX 1S1WB 2E1YA 3RMAA 3AQFA 2ZVIA 1VQ5N 5J1PA 4CO4A 4RQNA 3SMVA 1ZA1B 4OV1A 4NI2B 3TVZA 1WEYA 3AVHA 2B4UA 4LVOP 3DLLL 2G8KA 3MN6A 3T1YK 1FRHA 2O8CB 3LDOA 3SPZA 2GAGC 1IQTA 1TKZA 1MG7A 3EL2A 1HUOA 4A8XA 2YX4A 1ZQXA 4NYFA 1IKXA 4BRGA 1IXKA 3AD7C 1ZQVA 2MMYA 1P1TA 1SVDA 1R6VA 2FD2A 3LALA 4JRPA 2MZTA 2ZBCA 4EEKA 2E1RA 3F56A 4ES2A 3MGVA 4AL7A 2QL5B 5CD4A 4YOWA 4FVCA 4JI4J 3CFPA 2DKOB 2ACYA 3QEIA 2AV5A 2DHSA 5I4MA 3D2FA 2ESEA 3ZZRA 1ZQDA 5U47A 2A1AA 2E8NA 3HKZD 1IBLK 3P38A 3UW1A 3V72A 4C8NA 3JQJA 2I8EA 2CVIA 1VJQA 4UQTA 4UATA 5HMYA 1J5EJ 2XS7A 1ZXOA 1I94J 3VHQA 4UW2A 4OMFG 1KN5A 4EEYA 4B3MF 4R0EA 3VETA 3ITHA 4IR1A 4H4MA 2RH3A 4CJFA 2BOAA 1Z2LA 2IY5B 4LF9J 2YWEA 5L1MA 2MQ8A 1DK2A 4IEIA 4F4KA 2HBMA 3MM6B 4CM2A 2DWQA 4PHEA 2QWMA 3WQUA 3IC1A 1SC3B 5IXUA 4AP9A 4OZJA 1JNZB 4ZPTR 1ILYA 1X4GA 4AD6A 2D8CA 1LWCA 2Y1JA 1U7LA 4RQ7A 4I2IA 1EHWA 3U02A 2DGWA 1RT5A 1YBAA 3CFOA 1JXLA 2EQYA 4KLTA 3OL7A 3IRUA 1BQNB 2ZOGA 3J7YP 2O67A 4P0PB 3VQ6A 3M5RA 2BTFA 4CJLA 2P5OA 1HJPA 2HGMA 2QFIA 3HHKA 2Q0ZX 1RHRB 3LDQA 1N32F 2XYGB 4KN4A 1NG9A 2ZWPA 3AVFA 3G9CA 3N9UC 3BGOP 4LF8K 4KHWA 5IWAJ 2DBBA 1U2FA 2KHDA 1JIHA 4M3WA 1EKEA 5DM7L 3DLGA 2HRYA 3AB2B 2B9YA 2CAJA 4AL5A 2ABYA 3G82B 3D7EO 1ZQLA 1WDDA 2CQPA 4B3TK 1RLDA 3UDLA 1HEKA 2OANA 3IDWA 1RT7A 2A5XA 2HYIB 2ZHOA 3I31A 3DRRA 1A7GE 2FGOA 2R7QA 4FS2A 2AGPA 1MWKA 5J0XA 4JI6K 3T1HJ 2EANA 2LYVA 2DUYA 4DR6J 3JSRA 4P7VA 3W65A 4KLHA 1YSJA 1PJ7A 5EE1A 1SZHA 3UKUA 3R5DA 3NVZA 1RACB 3GIKA 2VKQA 1D3WA 5F8MA 2MU2A 4USJC 1ZM4A 5AKLA 4HUGA 3L7UA 2UVVA 4WFBQ 5H9EK 1Y5NB 3KFUF 4CJVA 4QYZJ 4B9NA 1QQ5A 5I3UB 3BB5A 4LH4A 9ICOA 1DAXA 1NCLA 3P45B 4FVUA 4TKTA 3ULEB 3GPAA 1AFIA 3B0YA 4JI4F 3OR1B 3MM9A 4Y2CA 2JZBA 4OCZA 2C3PA 5HL7Q 2LFVA 2G0AA 5GAEU 1VC0A 2BKPA 2HG4A 2VC1A 5B0AA 4MLHA 1IM4A 4ECXA 4LRAA 3MEEA 4TXSA 4C11B 2G0IA 2R7SA 2QN6B 3H8JA 3Q8UA 2OP5A 1RNHA 1SKUB 1QVFR 4DSKA 3ZTRA 5M2UA 1WF2A 3KXDA 2A3VA 1U8SA 4U8VA 2QMUB 4M3TA 2E9TA 1HYSA 3BQ2A 1AUSL 5AQFA 5CABA 4B1ZA 4QOZB 1EIYB 1S48A 1TFRA 2YKAA 1Q3VA 1NZPA 4CJ5A 1N33J 1JI7A 4CM0A 3GIJA 3SR6A 4NM2A 1RB0A 3H5SA 1RT4B 2K60A 4K4XA 3NH2A 4AT1B 2OPPA 1RILA 1L3SA 2HBZB 1DK3A 1RAFB 3M6XA 2R2RA 3AJDA 3QGGA 3RAQA 3F44A 4LRDA 2ILYA 2R3VA 3WDOA 1QUVA 2ILZA 2W9BB 1M6YA 3FE1A 4KLSA 1J54A 4UB8U 3BBBA 4GXKA 3IDHA 1T3QA 4LJXA 2KKPA 4DV6K 4KYZA 2O8EB 2BEFA 3DXBA 4O5BA 2ZC4A 3WK4A 4FJHA 3LDAA 3MPDA 2H48B 1MWYA 2I5JA 3R5JB 3SUOA 1HNIA 3D0GE 4DV2J 1A76A 2FTRA 1RYUA 2VZ9A 3SK3A 4K8RA 3A8YA 3CEDA 1RFQA 1YTYA 1T4GA 1GK8A 3Q8QB 1XERA 3L2WA 1B0VA 5IWAF 2BJDA 2VH7A 1ZQSA 4IOBA 1XNQK 4CZGA 1HLWA 1T05A 2VA2A 4CHNA 1YJ7A 1EXNA 4G1QB 2O6KA 3R9PA 3CG7A 4LH5A 5AI4A 4ZCMA 2BDPA 2D69A 2ZUDA 1H0HB 1X66A 2J6UA 9ATCB 3LM2A 4R8UA 2UU9J 3CCES 3MXIA 3BS5A 4AM7A 4OHYA 1IWGA 4JHDB 3ZT1A 3GJTB 2AYBA 2F9TA 1ZQYA 2IA0A 3RMCA 2R18A 1VQOS 4IQXA 2H3VA 1S1UB 2VYPA 3SDEA 4DR7F 2W43A 2PAVA 2OHDA 2B9XA 3EZWA 3MMVA 3M6KA 2KQ2A 4L3KA 2RB7A 1ZQIA 2O5DA 3MM5B 3C66A 2H5JB 3PYFA 4P52A 3IXQA 1Z19A 1VHIA 3KHYA 3LP3A 2EFNA 1PIEA 1S5LU 2Q2RA 3HZGA 3LZIA 1NKEA 3QIPB 4CE6A 5J0WA 3PRDA 2HS4A 4LF6F 2OAUA 3BF1A 4JI0K 3RRGA 4WK1A 1R0AA 1I51B 1TE2A 4B3RF 2VG5B 5A8RB 1QAIA 5AQQA 1UETA 1D8ZA 4DTPA 3LP1B 4IWVA 3QO9B 4FBUA 2V4RA 1R3NA 5CYMA 5JICA 5K5MA 1FWLA 5E0OA 3K7RA 4DFDA 5L38A 3DDHA 1JJCB 2W2QP 3FVYA 3VEVA 1N33F 3CIZA 5AXNA 3ISNC 3OTOF 2P9EA 4RW7A 5KFVA 2JH1A 1UA1A 5HNKA 3IAS9 5GINA 5DB6A 3TTFA 4KHNA 3ETOA 4FJGA 7ICSA 2JMGA 2ZH8A 1UVMA 2Q3SA 1UZHA 2PXIA 2LDIA 2DXDA 1ZBUA 1GLBG 4JRQA 2E1FA 2C2DA 3WEEA 2EFOA 1R8AA 1SB6A 1CULB 2HNDB 2FVPA 1S7HA 4H5TA 1KQSR 4HTJA 1S6PB 4KLEA 5AM3A 2ZBIA 3O3LA 2DEIA 2Y3YA 4C3KA 4DLGA 3CC7S 3X3UA 5DLGA 1F3VA 3C23A 2BE2A 2GQCA 3M2VA 2C2OB 3WKBA 4K4YA 4WIIA 2X3GA 4ZA1A 1KKHA 4KSEB 2QSWA 3L4IA 2VBZA 3M4XA 5MLCQ 1Z1ZA 4C6AA 1TYQB 3VEZA 5B0DA 2O8DA 2RQ5A 1QZ6A 2N1RA 4X2BA 3NF9A 4URGA 3FBBA 2MEWA 3ZT3A 2XS5A 1WJ9A 4ILLA 2KL8A 4TUQA 1HKCA 2RU3A 1DURA 3RG6A 4W5RA 2JEIA 1YF5L 3SCJE 4HVZA 1OYEA 1SV0A 4J2EA 2BKEA 1FXLA 2QWQA 1DRGA 1EWQA 1NHUA 4RWTA 3RZAA 4FZXC 4C7ZA 4JK1A 3I87A 3NOCA 1NAQA 1C0TB 2OPQB 2NZ4A 3NKYA 2MGZB 3OA9A 1TU0B 3HVTA 5M1KA 5BPMA 3TZZA 5ALPA 3CCMN 2PC6A 3FGUA 3OYNA 1KLMB 1VSIA 5D6GA 1FDNA 1ECWA 2WSCC 4AHUA 1NBEB 5MAOA 4JV5K 2HOEA 1J53A 9ICIA 2E7VA 4PHAA 1HHQA 4FYXB 5AI6A 4FSVA 3NP5A 1YVFA 1IG9A 1V85A 4O9MA 3SCXA 4K43A 1NK8A 3LDSA 3SI6A 4K0KF 1K6YA 2CADA 3M30A 3QERA 3MEGB 3K75D 3CUNA 3UI3A 5AE1A 3QWUA 4KGMA 4M3YA 5FD1A 5I3UA 3TAPA 4A57A 4M5MA 2ZIUB 1Q79A 2IVFB 2NV3A 1CQNA 2HGNA 4F4ZA 4FDFA 4DMNA 2YPYA 4HL9A 1JCFA 1XMQF 4X66J 3SUQA 1D0EA 1QUPA 3BSNA 1U2VA 3UE5A 4KMOB 5M1NA 3QINA 4CF4A 2IVMA 2OI2A 5J1NA 5JS2A 4HAIA 4RNOA 4NLBA 1NM2A 5ALYA 3BR8A 4TU7A 1C4CA 2DRBA 7ICKA 3EVOA 4UOFA 3R7SB 4GKKJ 2OELA 1H74A 2KRBA 3HILA 2MXYA 2UVWA 4CJUA 1SWWA 3GSIA 2J9CA 4UUWA 3E2EA 3Q8RB 1SJRA 5KNIA 2G07A 1VCTA 2D3ZA 5AM0A 1OQ6A 4J2AA 3LP2A 4CYUB 1YWXA 3TAEA 7ICHA 4MFBB 4NMLA 3KK1B 1OJ4A 4DV1J 4RT2A 2MPUA 3KOOA 3GIIA 5AJ3J 2G8VA 3W3SA 2XYHB 5SZTA 4M8LA 4V19S 4X4NA 2CQ0A 9ICKA 3VR1A 2RP5A 4JWMA 2XMUA 1NB7A 4DCCA 3EGZA 5ALKA 4M95A 2QB0A 4NLVA 4AQYK 4CD1A 1ZYQA 3PYGA 3MPWA 3CF5L 3NCRA 1KS2A 3K0SA 1V4SA 4ED1A 3VOVA 3AM9A 9ICGA 2GTDA 1JQGA 4YY3K 4YXMA 1UEUA 3EGWB 3FSYA 4WP8A 3H7IA 5KG7A 5LJ3Y 3M6VA 4PG8A 2FY1A 3W9HA 2Q31A 3SYZA 1WC4A 3MMCA 2YTUA 4HLBA 4DR3K 3PX0A 3NAHA 4DTRA 3QU9A 5IT0A 3SAHA 3MURP 5T14A 4F9OA 5AQNA 3ISBA 4CLWA 2AD9A 5K4LA 1MW7A 3S6JA 3NVMA 4CQ1A 1S7IA 2ALZA 5B0BA 2A19A 3SQ4A 2MKCA 4X64F 1KBUA 4CH0S 5AQOA 4NXMK 5AQIA 2W40A 1GQEA 3EE9A 1WOSA 1PAEX 4ZP6A 3BY5A 2WSEC 4PZNA 4O44A 1KOHA 2PYJA 2W2OP 3MCAB 2V2ZA 1ZJMA 3L4BC 2ZJRQ 3AO2A 3THYB 5EXWA 3VN5A 1L3KA 1FDAA 1NOYA 3O6WA 3QESA 4ICLA 3C1YA 2BA9A 3L2UA 4R63A 1Q81T 3GFHA 3MOJB 1UVJA 4WIQA 4BC4A 3SBMA 2KSOB 4CZFA 2FLLA 3AVMA 4DV7K 2E5IA 4CW7B 4EFAC 4KMUA 4OD0A 4RT3A 4UT4A 4NA2A 3AVAA 7ICUA 1M1GA 1FTCA 3KKSA 2W25A 1G7CB 2PFFB 3LZJA 5ALQA 3VAFA 2DGOA 4GRSA 4M5JA 2CQIA 3B6OA 3EGNA 3MM8B 1LWFA 5D77A 3K5PA 3THPA 4M41A 5J0RA 3L4PA 4ZJLA 1ZOTA 2XHCA 3HI9A 5LMUK 2DRDA 2KXFA 4FVMA 2VG5A 3GP9A 4RBUA 4ZN1A 4LBHA 1YRUA 4XDCA 2XQCA 3H0MB 2DJWA 2D6FC 4DDFA 3ILIA 5AKIA 3MF5A 4PKDB 3K8WA 3LP0B 3DN9A 2KNJA 5AKZA 4IJNA 1EP4B 1XN9A 2VJVA 1NNEA 4OPHA 4NEYA 3WC0A 1T44A 3MXMA 3L9ZA 4AF1A 5KG3A 3EUNA 2ASMA 4DV1F 2HBRB 4RPXA 1M5KC 1UWAA 2QXLA 4WFZA 3MTJA 4KIAA 4DR2J 4CEFA 3GL1A 5AKYA 4NXZA 4PWDA 2WVEA 3WNHA 4H4OA 1RWUA 2B6AA 3QGPA 2VGMA 2L08A 4DS5A 2RMLA 5CHCB 4F3MA 1RXWA 1X4FA 2VA3A 1FKOB 2JH7A 1S6PA 4CECA 3CCRS 3HXMA 4C7YA 2HGLA 4XIUA 2A40A 4TSXA 3UMBA 3FQKA 5ETPA 4DEZA 2IFXA 2UZAA 1I3OB 1W9HA 3ENAA 1QHAA 4B1YB 3JPRA 1KW4A 2UV8A 1SJ1A 1S9GB 2NZTA 2HHXA 3CQYA 3GMGA 4ECUA 2UUBJ 1PCAA 4C8LA 1X9WA 4ZOSA 4FWMA 4I27A 4QR1A 3VAJA 3HT3A 3ZDEA 4DV0F 1XO0A 2JJ4D 3CDWA 4PUOA 4FM2A 3CPEA 3ORYA 1FFVA 5C42B 1LAWA 3BO4A 3NVWA 4NLRA 3AEVA 2W3RA 2OEMA 4ILGB 5KQDA 1HPZB 4HTIA 2G8WA 1O0PA 1R0BG 3UKRB 4KLGA 1KD1O 4CJ3A 5LMNK 1BOTO 1OYDA 2Z2YB 2OFHX 4MYTA 4X4RA 4CZJA 3DOLB 3P49B 1RWVB 2JHDA 3RWUA 3THVA 2HWTA 2VQFJ 2WONA 1RXOB 4KLJA 5E3PA 1OKJA 3NGDA 3VGUA 3IG5A 2KH9A 2ZIXB 2C1EB 3D6MB 2DGTA 3CNHA 1YHQN 1SKWA 4NPOA 3RH6A 2HFVA 5GMDA 2KB2A 1VK3A 2OPRA 2W9AA 4P0QB 4ZMMA 4W90B 3ZDCA 2W4CA 2BH1A 5JTIA 3JXUA 1QQOA 1OIAA 2F8KA 3CW2C 2CFXA 3CCJN 1OSCA 2EBEA 5K8PA 4KGKA 1F2HA 2IMOA 2QL7B 4Z4GA 4FJLA 3AGRA 3OTDA 4DL5A 4JAXA 2O8BB 2K7JA 3E51A 2PI4A 1U02A 4JI3F 2FPMA 2FPHX 3NCPA 4RQMA 2L9WA 4H8KA 2Y1LB 2XSJB 4ZVTB 3A1YG 1FNOA 3ILLA 1JKHA 3P6YC 2ZEJA 4OZ2A 3KLIB 3OTEA 1S79A 3WXJA 2VV5A 2A42A 2V8GA 4PH5A 3FEZA 4GNIA 1VGYA 3DYAA 5F3TA 1IN0A 4LRFA 4KAZA 4BREA 2FJAB 1T02A 5DETA 4EYHB 1VMBA 3WIVA 2V8DA 8ICJA 4ZPWR 4DR2F 2JVRA 3S1TA 4MF2A 3L2RA 1M1HA 3VQ4A 3OW2M 2I38A 1W2BM 3SQ0A 3PMLA 3H2LA 2VFSA 4DZDA 3GIRA 2BCSA 1NH7A 5J2NA 4Z4HA 1B70B 2GHVC 4WF9L 3HPHA 3FBCA 2B43A 1LFPA 4Y1CA 2Q0UA 2Y0SC 1RBLA 3JPSA 1MQ2A 1WB9A 4JUZA 5KPRA 2XO6A 3K1ZA 1CVJA 5KFLA 3NAIA 4UF4A 3M32B 1IBKK 1P90A 4BC2A 1NH8A 3FEYB 2KLAA 3HOTA 4RW9B 2UUBF 2FC0A 1MMDA 9ICPA 3O80A 2PMWA 3BN7A 1JK9B 2KG5A 4PJ0U 3NF8A 1Y7PA 4CF0A 4BRPA 1X6JA 4FW2A 3OVAA 2W6LA 2C2EA 2ZTEA 3QT5A 4CGHA 3UVJB 3UD5A 1OH5A 2KU7A 4OI1A 4CIEA 1DTQA 2H9ZA 3WU2U 4KBIA 3E01B 2Y0SF 5J2QB 3KWMA 1MU2B 2A2CA 4BX9C 1NK0A 3MAQA 1O1WA 1HNZJ 2CJAA 2BJ1A 2W54A 2OTLN 4DSEA 4M94A 4FJMA 3DKDA 3DDIA 4IFYB 4Y0FA 2HHHK 3KJQB 4QZGA 2C2KB 3KK2B 3A5OC 4F5NA 2F65A 4MDBA 2ERRA 4CNZA 5M1FA 5HLFA 4IO9L 3GSDA 3JTOA 3KTQA 4DTUA 1RHQB 1RCXB 1ULRA 3MN5A 2BABA 4KB7A 1VQ7N 3WNFA 2BKNA 4K4IA 4BS2A 3QMLA 4CEAA 1Z26A 5ALXA 3GG4A 2RD5C 1Z00A 1FO4A 4L76A 4CJPA 3GWCA 1JLFB 4OGCA 4YB1P 4OJ6A 3PDNA 4KLOA 4H4KA 3BH6B 2Q4TA 2E8MA 1VRQC 1VIXA 3DDNA 2LYHA 3KZIU 3FMBA 4DFPA 2GFFA 5DDYA 3AJ1A 4G9BA 4OQJA 3M3ZA 3H46O 1SQKA 2K2PA 3CJKA 5HMZA 5JS1A 3NE6A 2E29A 4FLVA 3SCIE 3CMES 1Q78A 5I42B 3SQOP 1NB2A 4WJBA 2VKZG 3BDEA 3JTPA 3U6FA 4NCGA 1UFLA 1Q82T 1WSRA 1DQ9A 1U26A 2JL9A 3PZPA 3CO9A 1RTIB 2FPLA 1HQUA 3TUPA 3LAMA 4IQUA 3RJJA 4CO1A 1M5OC 3TSPA 4MK7A 3BQ1A 5J2GA 1JLBB 5AK3A 2CNLB 4LFCK 1GH8A 3Q8SB 2FBVA 4QBUA 3VWSA 1BU6O 1LW2A 3FBFA 1S72N 1NGIA 3AVJA 4Q44A 4HACA 2J7WA 2CGKA 1RBVA 5KFJA 2IDEA 3LP0A 4OZ5A 1CBKA 2QJ3A 2VBWA 1EP4A 1FRXA 2VL1A 2QX0A 1N5YB 5KRSA 3P3DA 4YOXA 4ZVHA 1J97A 4QZDA 3BR9A 2QYGA 2QW9A 1VI7A 1APSA 1BI4B 4LF5F 3OYLA 2BHNA 4PZVA 2D0AA 4CGIA 3DHWC 4A8EA 1T11A 3CCZA 5IT9Y 5BR8K 1HD1A 4UY8O 3CWJA 4KHRA 4MIWA 2YI1A 4KBOA 4YMEA 3FGVA 3HHLA 5A8KB 3CP8A 3OBWA 4CGGA 4CWBA 1FKOA 3C6HA 3LAKA 2VUGA 4M5LA 2WK4A 4FWLA 7ICOA 4DSLA 5DG7A 3NGSA 4JI5K 4ZPCA 1FJEB 2FE9A 2QE5A 3FYHA 1X1PA 2J0SD 5LSRA 5F8JA 3LGNA 1SC4B 2QG9B 4RNFA 4KREA 3WQPA 3DM2B 1JXBA 3W60A 4C3LA 1ZOLA 3RJKA 1HNVA 1LOTB 2OPSA 4FJ7A 5J0PA 1H2UX 1TL7A 1CJKA 4F2RA 1T3VA 1SI9A 2ZH7A 2IOCA 1HNZF 4FE3A 3MFIA 5D8HB 2J7KA 3O9UA 4DTXA 2NXEA 5T7LA 1D4XA 2DCUB 4P72A 4KHPJ 3G8SA 2BQUA 3A5LC 1XR7A 1VRUA 1SV0C 5KL8B 3HX9A 1U1OA 1VQ9S 2MZ1A 3AVIA 1ASVA 1J2VA 4DOCA 1VR6A 3SAGA 4XEIA 1ZH5A 3BSOA 2F96A 4WTYA 2LCWA 1JJ4A 2PA8D 3C16A 3WQTA 3O3GA 5GVQA 3ZT4A 3NL0A 2J0XA 3MWTA 1GMUA 4JEPA 1V5VA 5LL6d 5DBCA 1NK9A 3S6EA 4B3SJ 1VFJA 1YJWN 3MCNA 3QETA 2L9NA 1U1QA 4F72A 3U1LA 4CRXA 3ULHA 4IL6U 5BPLA 2D0BA 2AT1B 2EFQA 4PG4A 1X9JA 5CHGA 4ZTJA 3J7A1 2F9JA 3E9PA 1CJVA 4FJXA 1TV6B 3M7VA 2XI9A 4KLMA 1RTDA 5DM6L 2B4VA 2ITGA 3QX7A 4EX6A 1X5PA 3MPVA 5C12A 2JV3A 3MMAB 1OPZA 4JOUA 4ZPBA 2BJ7A 3OQ2A 1S6QB 5D3GB 3G6YA 2G5HB 4Z6DA 5ETSA 5CZ2A 2GV9A 1HWKA 4DUYK 4FKXA 3FEXB 3ID6A 2P6RA 3MECB 3I4PA 1IR0A 3T6BA 2R7UA 2K8CB 3PSPA 3MHYA 4CERA 2AQ0A 4W5OA 1VISA 2CPEA 2BANB 1X4AA 4LFAJ 2P9KA 5LJ5Y 1HI8A 1C0GA 1QM9A 5IINA 1G15A 4CJKA 3L95X 1S49A 2BPFA 2MKSA 3KD3A 1BDGA 3BS7A 1R6YA 3C8YA 1YJNS 4C0OC 4USTA 5CYQB 3BGUA 2ZTCA 3AVBA 1FHTA 3OYHA 1BUPA 3GQCA 1S5JA 1I1GA 1WUAA 3D2NA 1QVGR 4J9RA 3ASMA 3ZZTA 2O4IA 2EX3A 3MABA 2ZD1A 2ZTDA 4HI1A 3M8SA 5C5JA 1XHZA 5F8IA 4FK2A 5D0EA 5AQWA 1FJGK 5A8WB 3EMTA 4K59A 2V68A 4J9UE 2KHOA 4DR4J 1MU2A 4L72B 2BKOA 2O01C 1Y5LB 1WSIA 1BUXA 2WTFA 3CDBA 1OY9A 4C3MA 2YHBA 2V63A 4M9HA 3EX7B 3SENA 4CO0A 3VQTA 1X0FA 2NYIA 3RSEA 5KG5A 4RWXA 4K5SA 1QS4A 1HW9A 1TL4A 2LDYA 3ISDA 3M1VA 4PYAA 3MD1A 1UWBB 3HW8A 5FIIA 4DWIA 1JALA 5DM7Q 3HFKA 1Q8LA 5J2BA 2EH9A 3I96A 2AGQA 2HNYA 4BJQA 2XY6A 4GY2B 4YUDA 2PFQA 1K9MO 1Q3UA 2NRVA 5CB1A 4N7TA 1F5CA 3I8BA 3BH7B 4ZVGA 2F77X 2FJWA 1RT1B 3QEVA 3LDNA 4F91B 2MA1A 4CLFA 4G9ZA 1HQEA 1BPYA 2CQ3A 2VIHA 4NLQA 1JJHA 3CNQP 2E2QA 3CB4A 5B09A 1H2VZ 1FK9B 2C3OA 4XO0A 2NCKL 1WI6A 5I3QA 3RJEA 2R2SA 5HMXA 4K41A 1LKYB 4WFAL 3PACA 3QRRA 4Y28C 3IM1A 4RPFA 4OO1J 5LL6Z 3T1YJ 4YD1A 1TL1B 1N5YA 5M1PA 4DUZK 3H40A 2H5IB 5DDPC 3BUZB 4BACA 4DZ6A 3JPQA 1FTRA 3DI6A 2O66A 2GWSA 2XYPB 3DV9A 2OKQA 4C8ZA 1BI4A 5M2RA 4ZHRB 2Z1IA 3AO5A 3QT7A 4Z0UA 4F36A 2DPJA 1JMTA 4QWBA 2W03A 1ZTWA 4B02A 4KRWA 3LPTA 2D41A 2YY3A 2Z57B 4OI3A 3ENWA 1IBLJ 5ETNA 5TKWA 3WXIA 4IQVA 2GOLA 1VQNN 1NU4A 2CDRB 4X65K 1PO6A 4OV6A 2RE2A 1JX4A 1TQLA 1U8WA 3KZBA 3TQ1A 3ZSOA 2DTUA 3BYPA 3Q8KA 1S0OA 3H2UB 2F1FA 3GZFA 4KPCA 3DRPA 3O44A 2P35A 4DLEA 1W2IA 1NK7A 3H42A 2VOOA 3UCGA 3PFOA 1QZ5A 4E7JA 2G13A 3F9MA 1EKSA 4J03A 2W01A 2F8SA 2RQKA 3RF9A 5ETKA 4EBDA 3HWTA 4DR4F 3ICXA 2IDLA 3CJTA 4C8OA 2YB4A 4A2BA 2JDJA 5DGBA 4U67Q 3CJ5A 5AK6A 2DHAA 2J5AA 2VPWB 1QSSA 1ZJNA 4CLYA 1ROFA 2MKIA 4DL2A 3R5CA 1GOBA 2W2PP 4ZPVR 2KKZA 2AJ4A 1WACA 3ILOA 3A3OB 1MN8A 4CH7A 3VQPA 5L1JA 4FJKA 2KKVA 1BPZA 4A5BA 3OUYA 1M1KO 4MHVA 4ZCIA 9ICXA 3IMXA 2HF4A 1ZQQA 3OSNA 1H73A 2VU5A 4UAVA 2YCHA 2DNRA 1U2CA 3BP8A 3CPWM 2HK2A 4FO6A 1JLAA 4LF8J 2CQ4A 1SV5A 1XMBA 2HMIB 4JKEA 3E66A 3BYRA 1P6TA 1DEJA 2FHJD 3UDCA 4LF7J 4CRJA 3D5MA 1G3OA 1K8AO 3H1QA 3HD1A 4ZVSB 4OYWA 3KJVB 4B3TJ 4ED0A 1KFTA 4RBVA 3TEGA 1C1AA 4YFUA 4LVNP 1TV6A 2UXDK 4JI8K 1OPIA 4DV3K 2WB4A 4WKRA 3FNNA 2DRAA 5K20B 3C1ZA 4GV3A 1N8RO 1Z4OA 4ETZA 2BBEA 2KEYA 3TZYA 4XK8C 5DG9A 3H1VX 2V67A 5DKWA 4DU7A 4OL8A 4IZ9A 3GR1A 2QWNA 4XRHA 1UL3A 2V2QA 4BR0A 1NUEA 5AZJA 4OJHA 4CCHA 1TL3A 5BJRA 3TI0A 4OZLA 4WFBL 5H9EJ 4WPAA 3PNCA 3QFHA 1ATNA 2P9SA 3E9OA 1GAOA 1NZAA 2FBYA 4OHZA 4ED6A 4ZVEA 3HSCA 3MR6A 3V6KA 2D3DA 4FZVA 4OYOA 1L5UA 5HL7L 3TX8A 1JLQB 3U26A 1RT3A 3J7ZT 1AT1B 3R9KA 3EKSA 3FSIA 5ALHA 3MDQA 1HI1A 1MWZA 4BRDA 2UP1A 2QT7A 4A62A 5A76A 2MUTB 4PZOA 4ES3A 4RQ1A 1XHXA 2NXJA 2DFHA 1A0OB 1GLLO 4FWOA 1RQ0A 2YY6A 4JI7J 4OYZA 3CCQS 5ETVA 4E1JA 4L3QA 1U0HA 2W2NP 3GG0A 1VHXA 1XJWB 3DRSA 2ZITA 2N7CA 3BO2A 2JGAA 2NRXA 4UB2A 3UN3A 1F44A 2NUHA 2DD8S 4BDYA 2KD1A 3O8WA 4GKJJ 4Y2QA 1OW5A 3GZ7A 3PR5B 1C1BA 4QIWD 1TKDA 2H5EA 5CJ7A 4KFBB 3RW6A 1V4TA 1N36J 5T7BA 2D3OR 1WTFA 4ZVUB 5A8WA 1XK8A 4W98A 3Q7CA 2ATLA 2C2ZB 2FC8A 5CZXA 4JI1J 1TKXA 1D9DA 4F5OA 4NYNA 4CF1A 3GFKB 3HVWA 3NDKA 3JAMU 4LC9B 4JKBA 4QZBA 4Y2SA 3G2XA 3VQDA 4NL9A 1ZS6A 3JPNA 2H51B 4QPTA 1F5SA 4HT5A 3WUHA 1S5ZA 3L0QA 4Z7CA 3RFAA 4B3OB 1F9FA 1ELOA 3C15B 2WMMA 3CD6S 3G6EN 1XNQJ 2LXUA 3E3XA 2CPXA 1UAWA 2MSNA 2BJEA 4LF7F 2ISOA 4LBPA 1WD6A 2YV0X 4F7VA 3LWLA 3H7HB 2MY8A 2XCAA 4ZPDA 2GVZB 2F8EX 1MWQA 4LVSA 5TISU 3RW7A 4H4KC 2Z8QA 1B22A 1LXJA 5HR7A 3RUBL 3KNAA 2WC9A 4AHRA 4DI6A 2Z7JA 3UN5A 3B4MA 7AT1B 1XQIA 5KFNA 4USVA 4AFFA 1KVAA 3SPYA 3VQBA 1XWLA 2K8BB 3VTHA 3D4JA 2XMTA 1XNSA 2M8HA 4PHPA 3DLRA 4J9PA 1N0VC 1X60A 4A8QA 2D1KA 3HPGA 1ZQZA 1YI2N 4ECSA 3PRVA 2E2NA 5IIJA 3QEPA 3F2BA 1WHWA 1GFWB 1KQGB 1SIZA 1ESVA 4ZVQB 2EZZA 5L39A 2W7PA 5EDWA 3I28A 3O1LA 5GAGP 5CR4A 1L7OA 3N4QA 5BN8A 2IIHA 1MN7A 4A8YA 2VBXA 4PG7A 5AZIB 3QDKA 2HOIA 1G4CA 1OO0B 2NUUG 2FSJA 4ZCLA 2MQOA 3OV7A 4JI0J 2BGWA 2YX7A 4A4JA 4BUGA 4WE1A 1HWLA 2DL0A 3VESA 1T9VA 4GVLA 4O3PA 3TAQA 4JI7F 1VK0A 2QFJA 1YJRA 3OYMA 3JS6A 4KKOB 1TAMA 2K06A 2I6WA 4OYXA 1QQNA 4FLXA 4M3UA 3C6AA 4W92B 1RTJB 8ICUA 3CULA 2LSNA 1NDCA 4GKJF 4PQUB 5CHIA 5KPTA 1HNXK 4M45A 3KG4A 3OHRA 3T7ZA 1VQ4N 3TACB 3QRPA 1WDTA 4K50A 4LF4K 1N36F 1Z05A 2JGUA 3QU5A 1HR0K 1F6TA 1VQ5S 3K5NA 4H5WA 4YVZA 2EZYA 4RW8A 3QEXA 4PEOA 2YHYA 2ZIVB 4M5DA 4JI1F 2IOHA 3D2EA 4Z4EA 7ICJA 4TUSA 1WWHA 3DLKA 2W8KA 1V9PA 1NPKA 3I56N 5GAGI 1UPMB 4MIAA 3MX2A 4Y2TA 5C0YA 1ZAWA 2HFNA 2DR5A 4JB3A 2FIUA 3O1WA 5AQHA 2CA9A 3V9XA 2ZKUA 1AW0A 2IHR1 1B7FA 2CH5A 4TY8B 3SFGA 4IG3B 2ZIWB 3ZT2A 2MQPA 3VCBA 1EQ0A 3VAKA 3D6JA 5KFIA 5CA7A 1XEZA 2GMLA 4P2XA 8ICTA 3G25A 3K58A 2FB0A 3O5TB 1B4SA 4M63C 1RBTA 2QM1A 3R5BA 2JC0A 2KK0A 3JSYA 3I0RB 1TMMA 4GV9A 4USHA 3VF6A 1BISA 5K8NA 5KGXA 2W6KA 1NWKA 5KOWA 3OD2A 3HFZB 1FFWB 1S1VA 4QWCA 1NGGA 5ALEA 2NS1B 2KZZA 4JYAF 3PIPQ 1L7NA 1WF0A 2H65B 4QIFA 2E9ZA 5J0TA 1RA6A 2JRSA 3WKDA 3CRXA 4P2FA 1JL2A 2W7OA 3PYEA 2YB1A 4J90A 4QW9A 4JV5J 1KBRA 1YITN 1QTNB 3PY8A 5HP1A 3V1RA 4DV4K 3R2CJ 1EETA 4WTOB 1XNRK 4RQ2A 1P1LA 3D45A 1NJIT 2RRDA 3C95A 3NNAA 1LWEB 1MROB 2OMOA 1U25A 2Z30B 4P4OA 5I3PA 2CIMA 3HM8A 1BPEA 1HUZA 1IKYA 3QUTA 3V1QA 2FGCA 2YPZA 5DK5A 1SC6A 3A5NC 1U2RA 1RHUB 1UQVA 3CQ8A 4TQRA 4F2SA 3K57A 5BPCA 1X7VA 1YVUA 5LXRA 3AA9A 1GX5A 4CJTA 2A1JB 2XZTB 3QQCD 2Q36A 1S1XA 4LY7A 4BRFA 5KT3A 2R42A 5J2HA 1RA7A 4A8MP 2Y9HA 2P9PB 2MUTA 3GILA 1NK5A 2RVJA 4B17A 1IBCB 2XY5A 2YVSA 1ATRA 2YWGA 4WP3A 1T9TA 2MSSA 1WNEA 3MN9A 1T3NA 5FPNA 1AUDA 1OH6A 3GFZA 2P9UA 3NGTA 4OLOA 2DR8A 1A5XA 4ZKAA 3O4WA 2LYBA 1SUQB 3N0VA 3CJAA 4IC9A 8ICAA 3VEYA 2E1PA 3UB5A 2KVSA 2OHFA 2HFZA 2QGFB 2MY7A 2KJWA 4CK1A 3M8RA 9ICAA 4PRFA 4RZRA 1XO1A 1NLVA 3AXKA 4M1KA 4JWNA 4F50A 4GO5X 2XNRA 3ZD8A 3J80U 4ZVPB 4CHPA 2MKJA 2E1ZA 2E8AA 1WC6A 4I2CA 1YGYA 2YH1A 1QAXA 2E5LK 1Y3JA 3TAFA 4FJ8A 3RBEA 2QWLA 4NEZA 1S6UA 1KC8O 4M2YA 5BPNA 3W64A 2M7SA 4AQYJ 2YHAA 1JLGA 3ZZPA 2WW4A 1WC1A 4ZPAA 3UIQA 4PHDA 1JLEA 3C7NA 1I6JA 1VRTB 3KJNB 3LL3A 4KH4A 1T9YA 2KDOA 3CJRA 2ZWHA 1KTQA 1UVIA 5A0LA 2N4DA 1NM1A 3G6XA 1MC8A 2AX1A 4DR3J 2IPOB 4JKGA 4OX6A 5CE3A 2HOQA 2L41A 4DCHA 4N56A 5D4OA 4YDUC 3EPIA 3MM7A 1RGIA 4BCAA 2FPKA 5F3ZA 5HJXA 1WNSA 1K73O 1ZC6A 1BHLA 2WFAA 3ATUA 3MDAA 2K8GA 2LEAA 3BSAA 4FW1A 3AY0A 3GFYA 2P9NA 4YOYA 5ALMA 4NYPA 3RJHA 2YWHA 4KGXB 1SL1A 5ALTA 4NLOA 4ECRA 3NBPA 3UQ2A 2ZJRL 5DDQC 1VQ6N 2PFDA 2HKEA 1YTUA 5J0QA 3QBWA 4NLKA 4PG6A 3VTIA 1S9FA 1NOMA 2D3O1 3DLJA 3IP4B 4I6YA 4ISFA 2GIFA 1ITPA 4QWDA 3MAAB 1B92A 1HNWF 2CG4A 1UP1A 3CJ4A 4YR0A 4OYMA 1PJ6A 2BE7D 1L7MA 4RCHA 3A0HU 2PO4A 5GAEI 1AFJA 2E20A 3KVGA 1BWFO 4IO1A 2B21A 1BHNA 1E6VA 1QHTA 3VA0A 1RU2A 1EAYC 1N5QA 1AQ6A 3HRDD 4CO5A 4R5PA 4NLDA 2YHWA 4ZITA 2CXYA 2VODA 2Q1NA 5AR0A 4TVAB 3V1OA 4P4MA 3M2UB 4DF4A 9ICMA 5FPEA 1L8OA 2ZZNA 1OY8A 5HQMA 2QLWA 1VSJA 2B7CB 4I28A 1SCJB 2BUNA 5LMUJ 1S77D 3CC2S 1LAVA 2DITA 1FEHA 1EX8A 3P4IA 4DCJB 3KZXA 4UAWA 1ZQPA 1WWVA 2E5GA 3KKRA 9ICLA 4GXIA 4JNEA 1S0VA 1TFWA 8ICPA 1RQNA 3JPPA 2HZAA 1CJTA 3KMSA 4B3MK 4BXOA 5DB8A 3OTQA 1VLYA 3DGVA 3TVYA 3A8EA 1RTJA 2B5JA 4UY85 2YNHB 2IVNA 3UD4P 4FFDA 2MZRA 4E0DA 3CM5A 3IKMA 2WOMB 4NA1A 2W4PA 1C0UB 4A8OA 1JXVA 4WF9Q 2YX6A 3CCEN 1TP7A 3EPGA 3POTA 1N56A 2YKNA 1KAYA 3ZZOA 2OCEA 3A8KA 4I2QA 4QR0A 1VQ8S 2E2PA 4OZ1A 3QUCA 3JSMA 3R5GA 3ZO7A 2ZJPQ 3CD0A 3KK3B 5IC4B 3KYLA 1GLDG 2YNIA 2AEFA 3H5XA 3CMAS 1ZBFA 3OJSA 3CCTA 3EWAA 1Q7LB 5F9LA 3ISCA 1PK1B 4FJIA 3TU5A 3LM9A 4YMOA 3M2RA 4IG3A 4Y2IA 2ZIWA 4I2FA 2A6OA 4M9LA 2XCPA 2LQ5A 4I64A 4CZEA 2VPYB 4F04B 2I9GA 2VDIA 2NQPA 2X7IA 3ENOA 2XS2A 3KLEA 2ZUBA 4PL1A 1LCUA 1N32K 2H4WB 2GVDB 3BZQA 3TEHB 4NOHA 1HFEL 4FXWA 5T41A 2XLIA 3DMJB 4PQAA 2RHFA 2F4VF 3LVVA 3IR7B 3TQEA 2M52A 1PK3A 3TA0A 3D0HE 2J7UA 2R7VA 4M04A 2BM1A 4KLDA 3R3TA 3SBTA 4QZ8A 8RUCA 2HVEA 1A6LA 3MXHP 2NR0A 3KKFA 3RJFA 2E1AA 5LMNJ </