4DWIA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with self complementary dna, se-dgtp and calcium
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
581
structure length
581
Chain Sequence
GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 210
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dwiA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dwiA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dwiA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dwiA01
8ICCA 3MAQA 4I2EA 1ASVA 3ASMA 3VN5A 3V9XA 4PY5A 2B21A 2KFNA 3WNGA 3AUOA 3UQ0A 3MEDA 3EYZA 9ICKA 3ZT3A 4J9QA 1NOMA 3AVJA 2C2EA 5D49A 3PNCA 3L2QA 3JPQA 4JS4A 4N47A 3OYIA 4CGGA 2G8VA 2OWOA 9ICLA 4FS1A 4TURA 2PI4A 4YR3A 3OYKA 1JN3A 4J9MA 1KTQA 1EX4A 1RT6A 4XA5A 5KT6A 1RDDA 2X74A 4RZRA 4JWNA 2HHSA 4DTXA 3LP0A 4CHYA 4FS2A 2D5RA 1JKHA 3DRRA 1S1XA 2Z1GA 1B43A 4KTWA 3NF6A 1JL1A 3VA0A 5KFVA 2DFEA 5J0QA 3PY8A 2BCUA 3ZSQA 4Q8EA 3GILA 4UAWA 2JGUA 3PW5A 3EW9A 3GIJA 8ICXA 3KIOA 3M9NB 4H4OA 1WAFA 3OYFA 4XQ8A 3PUFA 4RQ1A 4KLIA 1BISA 4ECRA 4DWIA 1BPBA 4CECA 3RMAA 5DLGA 5JS1A 4EEYA 4IG0A 2E6MA 9ICHA 2KTQA 4K4GA 3V81A 3MGIA 3S3MA 4I2AA 3QEVA 1U47A 4EBEA 4I2CA 4CEZA 4YXJA 2IDOA 4QZIA 1D9FA 4CGHA 4O3NA 5HROA 2A1JB 2I1QA 4DL6A 4O5EA 1RBSA 2BQUA 3KHHA 1S10A 3TWHA 1RT7A 4IBNA 2XY8A 4I2QA 4O0JA 3LAKA 1A5VA 3C2MA 3E2EA 3KD1E 3I0SA 1J5OA 5KG6A 4IQWA 1GOAA 5KFMA 1A77A 4CJ5A 1RT5A 4RUAA 2W8KA 3HP9A 4AILC 1FK9A 3ZSYA 3MFIA 1SL1A 4Q44A 1REVA 5K14A 1XHZA 3AVLA 3HVRA 3L2WA 1D8YA 3C2LA 1QQCA 2ZD1A 5CZ1A 1MQ3A 4FLUA 3UQ2A 3KKRA 3QINA 3NF7A 4LVSA 1BQMA 4UB4A 3KLIA 1AROP 3VA3A 4W5TA 1ITGA 3AA5X 5KFDA 2XY7A 4RPZA 4DLEA 9ICWA 4DS5A 1RYRA 4C8OA 4DTRA 3TR8A 1RYSA 4KN4A 2G8IA 4NLGA 2PXIA 4YFUA 4RQ0A 2R8JA 1XO1A 3PW2A 4DSKA 4UB5A 2H5XA 1PZNA 3MR6A 3F9KA 3KK3A 1V9PA 3U3YA 2R8GA 5KFTA 3OJSA 4CJPA 4CHNA 1TVRA 4OLAA 5CP2A 4DSFA 4FJ8A 4Q8FA 4HCCA 4QOZB 1RNHA 4R65A 4QZHA 2LYHA 3AVCA 3MBYA 1A5XA 2B4JA 2QXFA 3HT3A 2PYLA 4Z4FA 4KLEA 4F91B 4NXZA 4FJ9A 2OZMA 2X6NA 3LZIA 3JPOA 5KTQA 1DOQA 5IINA 2YNHA 3AVHA 4CFBA 4IDKA 2NUBA 4M6WB 5KG5A 5C25A 1KDHA 1BQNA 1Z3EB 5DDMA 4AHVA 3NGDA 1QS4A 4IG3A 3E01A 3NCIA 4KLMA 3MR2A 3ZDCA 1JXEA 1L3UA 2UVWA 4DTUA 1ZQJA 4FLVA 2FBVA 5CWRA 5J2PA 3IG1A 2Y1JA 4YQWA 4F2RA 1ZQDA 2IOCA 2VA3A 4KV8A 5HNKA 4I2HA 1U49A 3K2PA 5J0OA 2EX3A 5L1LA 2XY5A 3ZSVA 3WNEA 1UT5A 4CF0A 1VK0A 4C8KA 4X5VA 5KFSA 4M9GA 5HMMA 4RU9A 4CGIA 8ICVA 5CYMA 1CZ9A 2GWSA 4W5OA 3GDXA 4CFCA 3THVA 4FLWA 5IILA 1FKOA 3V1OA 4RQ2A 3DRSA 1HJRA 1ZJNA 1KLNA 4NLZA 2HHQA 5DQIA 1JLBA 2ISOA 4NYNA 3RWUA 2F8TA 3TQ1A 4FM2A 4UAYA 8ICGA 4ZHRA 3RB6A 1TKTA 4FBTA 3VQAA 5DB6A 1S1WA 4PHDA 2VG6A 3OGUA 4DL2A 1BIZA 1JLAA 3U6FA 5J2MA 2W9CA 5F9LA 2NRVA 2QK9A 4J9OA 3C1YA 3KLGA 4OVLA 4H8KA 8ICBA 4OKEA 4JLHA 5FRMA 2DFHA 4Z4GA 5BOMA 4FO6A 1BPEA 4JRQA 2O4IA 3RB3A 5KFNA 5FDLA 2Q3SA 2W9CB 4UB3A 4ECUA 4JV1A 1MQ2A 2YKMA 4TUQA 9ICRA 1RDCA 3H8SA 4G3IA 3OYNA 3PO4A 3H8WA 3RB0A 2BE2A 3CG7A 4EP4A 1LWEA 4YMOA 5J2QA 3ZDBA 1L3SA 3KHGA 1X9SA 3V4IA 4NM1A 7ICJA 4ELTA 3WNHA 2F96A 3EPIA 3V7JA 1KFSA 8ICFA 2PYJA 2ZJ8A 4RQ8A 2C28A 4LH4A 1WSHA 1NK0A 2ZUCA 4C8NA 5KT5A 2ZTEA 3MABA 3TFSA 4UAZA 1U48A 2MAXA 4HTUA 1RBUA 4PA1A 3JYTA 1KLMA 2FMPA 3IRXA 3AVBA 3ZT1A 5DG9A 4DL3A 1BL3A 3NF8A 3EZ5A 4KLOA 7ICMA 2A1SA 2XGPA 3LP1A 2BHNA 3AVFA 2GV9A 3DOKA 3NGYA 2KFZA 8ICLA 5J2KA 1L3TA 3M8QA 3H8JA 9ICQA 3AVMA 3CM5A 5D46A 4B9NA 4NLNA 4F4YA 3HSTB 4IKFA 4Q43A 1SKRA 4R8UA 3RR7A 4ECVA 5EU7A 4FJGA 1JIHA 4XUSA 1JLFA 4CJSA 1TK5A 3KHRA 2DPIA 4RT2A 1XWLA 1ZQXA 2OYQA 2BPFA 3B6PA 4ECYA 3N4MB 5HP4A 4Z6DA 3PR5B 4KLDA 1NJWA 2M9NA 4Z0UA 3M8SA 4I27A 1ZQBA 3OYBA 3JPSA 3MDAA 1IM4A 5J2EA 7ICQA 2IA6A 1N48A 2KZMA 1LAVA 4RW6A 4MEYA 4JWMA 3C21A 2IGIA 2C2DA 4KLSA 4PPXA 3RBEA 3RRGA 4YNQA 2UVRA 3NTUA 3QERA 3RB4A 3RJGA 1JLQA 4OGCA 4ZTJA 4M6WA 1Y97A 4KMUA 5BOLA 3TABA 1C7YA 4YD1A 5IIKA 2LSNA 2YV0X 3LAMA 1XS9D 5D3GA 4KHNA 3ZT0A 2FLNA 4BACA 3SI8A 3V9UA 3HVTA 5HMLA 2R8IA 3PW7A 1HUZA 1T8EA 1YTAA 3RJJA 1HUOA 2BCVA 4I2GA 3OS0A 5IIMA 3JPNA 4CFAA 4DQIA 4RQ7A 3PMNA 5KT3A 4Q5VA 8ICYA 1XSPA 4EBCA 4RNNA 1NK8A 3IHQB 4I2BA 3NDKA 3QEPA 1YVUA 4NYFA 3SUOA 5KFGA 4DTJA 5EWEA 3V72A 3QZ8A 2IS3A 4B8AB 2JEGA 2ZUDA 3RAQA 1C1BA 1VRUA 1QLNA 1TKDA 5DGBA 8ICEA 3RJHA 4R5PA 4ECXA 5SWMA 1S1VA 1ZBIA 4OJRA 1NJZA 1HJPA 5KFRA 3L3UA 5J0UA 4MFAA 3SI6A 5J2NA 3OYEA 4KHWA 4JV0A 3H40A 3QNNA 3AU2A 4ED7A 1DTQA 1RT2A 5J2BA 3VQ6A 3V1RA 2ZTCA 1HPZA 2NRXA 4ID1A 3ZSZA 4ZTFA 4KAZA 5DMRA 1IO2A 1S9GA 4KKOA 3FFIA 4Q0BA 4LSLA 3U3GA 4JK1A 3LWLA 5HLFA 4IR1A 4RQ3A 2V4RA 4AH9A 1VSFA 1J53A 3QEIA 3G6XA 4CJUA 2E6LA 1LV5A 4CEQA 2QKKA 4GW6A 3AU6A 3MEGA 4DTSA 3SCXA 1WLJA 1TAQA 3KHLA 3QETA 4K8ZA 2W42A 2HB5A 5CZ2A 3V6KA 4KFBA 3LZJA 3CM6A 3VQ7A 1H38A 1LW0A 2FC0A 3VQ5A 9ICUA 2JEFA 1LW2A 3VQCA 4F2SA 1LWCA 1KEJA 4J9SA 1TVAA 2X78A 2RF2A 4E7IA 1RZTA 4KLQA 1Z26A 2G8FA 1SV5A 1BHLA 1MU2A 4KLLA 4GC7A 1XSLA 1TK0A 1VSEA 5IIOA 1ZJMA 4FM0A 9ICBA 4IRDA 1L3VA 4PWDA 2VG5A 8ICNA 4ECSA 3TFRA 3PV8A 4CJ3A 3LP3A 4FJNA 4IR9A 4KITB 3V6HA 2AGOA 1Q8IA 1ZQWA 1GOCA 4G1QA 3NBPA 4RW7A 2WONA 2BCRA 2KZZA 3AO3A 4DTNA 4DFKA 1KFTA 4NCAA 3SV4A 5L1KA 1CXUA 1D9DA 3K5MA 8ICJA 4DTOA 4CK2A 1IG9A 1ZQKA 3RAXA 2KZ3A 5DG7A 4F50A 4LD0A 2A1JA 3DLBA 4PH5A 1K1SA 4E7JA 1NOYA 3LWMA 4B9VA 4O3SA 5I42A 1ZQNA 1ZQMA 4QZGA 5KT2A 3L3VA 1K1QA 4KHQA 1ZQGA 2DTUA 2VWKA 3DLEA 3JPRA 5DQHA 4Z4CA 4GXIA 1QSLA 1ZQOA 4DSIA 5KFQA 2G8HA 2FBYA 3V1QA 4RQ6A 3UXPA 1J54A 3FDSA 1NOZA 1SUQA 3BQ0A 3HX0A 1ZQYA 3CQ8A 4DQRA 4I2FA 1RTIA 2MUTB 1QTMA 5KFHA 3G6YA 1YTUA 1HYVA 1G15A 4MFBA 3OSNA 3PX6A 4E0DA 1NK7A 3AA4A 2FLLA 4ED8A 3K57A 1TK8A 3O4QA 4GLXA 1ZQEA 4CEOA 2FBXA 4RNMA 3Q8PB 1VSKA 4CJVA 3C5FA 2ASJA 3LDSA 5IIIA 9ICFA 1RBTA 4DS4A 2UVVA 4LY7A 8ICSA 1C0TA 1HNIA 2WOMA 4FJLA 2NRWA 3JPTA 4P4MA 2W9MA 2ZQBA 1TL3A 2BDPA 7ICFA 5J0PA 3SQ4A 5DQGA 4M3UA 4UBBA 1LAWA 5J2IA 4N41A 1ZQTA 1ZQPA 1C1AA 1W9HA 1BVSA 3PR4A 3CFOA 2AU0A 1B9DA 8ICHA 4BDPA 1IKWA 2BANA 2JLEA 2Z1HA 4CIGA 4KRFA 4J9KA 4B9LA 4JV2A 2HHXA 1CZBA 4RW4A 3SJJA 4DFJA 2XO7A 3C5GA 1BI4A 1COOA 2JEJA 4CHPA 4MF8A 4O9MA 4DTPA 3GV8B 4OKJA 3ISCA 2ATQA 4CJQA 3TANA 3RJKA 3G10A 4E1NA 2Z1JA 4FJHA 5KFCA 3M8PA 4KPYA 1GOBA 3DLHA 4ED6A 5D4BA 1CXQA 4MEXA 3QEAZ 3NFAA 4AHUA 1BPZA 3T5LA 4QZDA 1NJXA 1RTHA 3V9SA 5J2CA 4BGDA 8ICOA 5DB8A 5KFYA 3S3NA 2A1RA 1C0MA 1UA0A 4C8LA 2BGWA 1XU4A 1S9EA 3K5OA 4J2EA 1I3AA 2JZBA 3K59A 1KCFA 7ICNA 1F21A 2F1IA 2P5GA 2HVIA 1VSHA 4BWMA 1T7PA 2ETJA 4M9NA 1RTDA 9ICVA 3HXMA 1Q9XA 4QZAA 5KFOA 3ZT4A 5KG1A 1WSJA 1VSIA 1WSGA 3WNFA 4FK4A 3LP2A 4O3PA 4OPJA 3ZSXA 2HMIA 3RMCA 1YT3A 3C94A 7ICKA 2V4QA 1NK6A 2ISPA 4KTZA 3B6OA 3OJUA 4EBDA 4TUSA 3T5JA 4F3TA 2QKBA 7ICHA 3PO5A 4M9LA 1UAXA 1BPXA 1BI4B 1ZQSA 2HNYA 1C0UA 4CJFA 4ZH4A 3PX4A 1DGSA 2BCQA 9ICCA 4CF1A 4IFVA 9ICAA 5L1IA 3OSPA 3VQDA 7ICLA 3L2UA 4M3XA 1RT1A 1TFRA 4B3OA 1ASUA 1D8LA 2KQ2A 4MQ3A 4RG8A 4KLFA 3S9HA 4HUFA 5DBCA 4J2DA 1TL1A 3SNNA 2IMWP 4DOCA 2ZJ5A 2HHVA 1KVCA 3RH5A 2C22A 3EY1A 4KB1A 2KW4A 3HPGA 1S6PA 1VRTA 4GVMA 3ZSOA 4CEFA 4R66A 4CE9A 3T5HA 1WAJA 4CFDA 4HVJA 4DQQA 4F4WA 4YFKA 1T3NA 3OS2A 2GUIA 2DFLA 5KFWA 4M42A 3OHAA 4O3RA 1VSJA 3I0RA 3RBDA 4H4MA 3TAGA 1HYZA 5KG2A 3BQ2A 4J9PA 4F5PA 4PHEA 4Q45A 3MDCA 2VWJA 3ZD9A 3AO2A 2ALZA 3OYHA 3G0ZA 8ICZA 3SV3A 2P5OA 4IQUA 3SQ2A 4I2IA 5KG4A 4O55A 5J2FA 3H4DA 1VSMA 4M41A 4DL7A 1EP4A 3KLHA 8ICQA 4TSXA 3HO1A 3NH2A 3VQQA 4I2JA 7ICTA 1S5JA 2IAJA 3SPYA 1TV9A 1ZQZA 3VQBA 2HNZA 3K58A 4KLGA 2AQ4A 5J2JA 5CYQA 5HRPA 3IM1A 5J2GA 4CJ4A 4FJKA 3LPUA 1JLCA 4DTMA 3RJEA 5HP1A 1S9FA 4B9SA 4CJWA 1U9LA 4M45A 4BXOB 5J0YA 9ICPA 1FXXA 4M2YA 5J29A 2W9AA 4GXJA 2HHWA 4DG1A 4YVZA 2I9GA 2DFFA 4I2DA 1ZYQA 1WNSA 4RQ4A 2I5JA 3AO4A 3VQ4A 4KHUA 4CJTA 1ZBHA 4L8RB 2IHMA 4F92B 4W5QA 2RKIA 4AHSA 3SUNA 1ZQUA 3ZDAA 4ED3A 4CIEA 2R7YA 2JEIA 5DKWA 4IFYA 3RRHA 3TAQA 4ECZA 1ZBFA 8ICRA 4NM2A 5DB7A 3NGZA 1BCOA 4CIFA 4QWAA 4F5NA 1IKXA 3QIOA 4PUOA 3FYHA 3MGHA 3AVKA 2PY5A 2OPRA 9ICNA 4CJLA 4YMNA 1Z25A 3V9ZA 5EOZA 4OLBA 4PGXA 2YNGA 5KI6A 2HVHA 1SL0A 2DY4A 4M04A 4QWEA 3RH6A 1X9MA 4CF8A 4EP5A 2NRZA 2V9WA 3BGRA 3C6TA 5HHIA 1T03A 2PFOA 5KG0A 4TUPA 2P51A 4O5KA 1ZQAA 2P1JA 3BQ1A 5J0WA 3MXMA 4O3OA 2YHAA 1NK5A 1NK4A 1QE1A 7ICPA 9ICOA 4KO0A 2J6SA 2NRTA 4RNOA 3AVNA 3KLEA 7ICRA 1N5YA 3H7IA 3NE6A 3Q8RB 3F73A 4FZXC 2ASLA 3Q8MA 5J1EA 4FZYA 4FYDA 1BGXT 1JLEA 4CF9A 4K4IA 5CR0A 4ECWA 1HQUA 5HRRA 9ICGA 1T05A 4Z4IA 5HBMA 4YD2A 1EKEA 4E89A 4KI4A 3SZ2A 1DTTA 1NK9A 4E7KA 1IH7A 1ZQQA 2HNDA 1UT8A 4WE1A 1T4GA 2X6SA 3VQ9A 4DFMA 4FJXA 4YR0A 2FMSA 1C1CA 3QO9A 4MFCA 4ELVA 1XSNA 1WSIA 4M3ZA 4DSEA 3K75D 3AO5A 4Y1CA 4RPYA 2PZSA 3ZDEA 3V9WA 4JS5A 3GQCA 1WSEA 2VA8A 3LPTA 3ISBA 3PW4A 5C42A 5CA7A 4BE1A 4KLHA 3M9OB 2RN2A 5KT4A 1BPDA 5L9XA 4IRCA 5KFZA 3OVNA 4HHTA 4RW8A 2J6UA 4HUEA 1CLQA 2J6TA 2FMQA 3RJFA 5KFKA 2ASDA 2OZSA 3V6JA 4FJMA 4KN7A 8ICMA 4CGDA 4RW9A 4B9UA 2HW3A 1ZQHA 4FCYA 4AHCA 5KGXA 2W9BB 4O44A 4FJJA 5C24A 5FROA 1NJYA 4J9NA 5KG7A 4Z4EA 4R64A 5J2AA 4F4KA 4DL4A 4W5RA 4I9QA 3NGIA 3AVAA 3QEXA 5BPCA 1RPLA 1ZQIA 5CY4A 3HK2A 5CJ7A 3OYLA 4DU1A 2XCPA 3PVXA 4QWBA 3KK2A 2XC9A 3ISNC 2BR0A 4DEZA 4F5QA 3O3FA 8ICIA 3TAEA 4R63A 4I29A 3L8BA 4ED0A 3GV5B 7ICIA 3ZT2A 1Z00B 3UXNA 3UPQA 4NCBA 4DOBA 1R0AA 3HW8A 3EPGA 1S1UA 4M9JA 1SKWA 4Y1DA 3TAFA 4FXDA 4QAGA 3DYAA 4O5CA 3ZSWA 1SZPA 2WTFA 3RMBA 4CK3A 2MUTA 3UXOA 5TZVA 1HRHA 4CJEA 3OS1A 2EHGA 1N6QA 4ECTA 4LSNA 3Q8LA 5C5JA 3OYMA 1RT3A 4CEEA 4F3OA 1CUKA 1UA1A 1U45A 4PGQA 1KRPA 4CERA 3LALA 5L1JA 5DG8A 3GV7B 1X1PA 3ITHA 4ECQA 3SPZA 3QIPA 1EETA 4QWCA 3G6VA 4K4HA 4HYKA 3PMLA 1S0VA 2XHBA 1ZQLA 4KLJA 2W8LA 2FBTA 1MSWD 3JSMA 5DDYA 3H4BA 4MF2A 9ICJA 2IC3A 5FRNA 3PX0A 2FPLA 4B8CA 4KTQA 2AGQA 1X9WA 4C8MA 1KVAA 5EWFA 8ICPA 3NAEA 1JXBA 2PFPA 4FLTA 4PHPA 2BQRA 4ED1A 2BPGA 2G8UA 4R8UB 1RDBA 3K5NA 3C23A 2UVUA 1RTJA 4M3TA 4EYHB 4AHTA 4QZ8A 3RR8A 1XI1A 1U4BA 3BJYA 4MFFA 3NHGA 2ZTDA 4I2PA 2ZJAA 2YNIA 1B9FA 1QSYA 1BPYA 3VQ8A 4PHAA 3TAPA 3C2KA 4ELUA 3PW0A 4DSJA 4P2HA 4DLGA 5KFIA 2W9BA 5J0XA 4DMNA 2P6RA 4M9HA 2F1JA 5KFAA 1TGOA 5J0TA 4K8XA 2GBZA 4F5OA 1S0MA 1A5WA 4KB0A 4BE2A 2BQ3A 4F4XA 1W0HA 1WN7A 2OPPA 1K6YA 4PGYA 4BDYA 3HPHA 1RILA 1XC9A 1JX4A 3DRPA 1ZETA 4QZBA 3KJVA 3HYFA 4DF8A 3T19A 4IQVA 4DFPA 1N56A 3MR5A 4M3RA 4QZCA 3SUPA 3KLFA 3C95A 2BGGA 1A76A 4IRKA 4I28A 1WCLA 1LB2B 1JLGA 1S1TA 1HYSA 1QSSA 1I39A 2O4GA 5JUMA 5J0RA 3OYCA 2FPKA 1DLOA 1NKEA 3ISDA 2PFQA 1EXNA 4YXMA 4Z6FA 3VQPA 3AVIA 4CJKA 1S6QA 4GC6A 3KTQA 5DBAA 3MFHA 1RXVA 2HHUA 1WCNA 5KFJA 4DQPA 3C6UA 4CHQA 3KKSA 2F8SA 4OKKA 4J9RA 5KFEA 4ED2A 3SYZA 5CB1A 5HHHA 3TI0A 2FLPA 1EXQA 4PQUA 2XY6A 4O4GA 4E1MA 3HL8A 4YCXA 1UOCA 1C6VA 2Z1IA 1RXWA 4NLKA 4J2AA 3OYDA 3OY9A 1NKBA 4UBCA 5SZTA 4CGFA 4AHRA 3RTVA 4E7HA 1ASWA 3LDAA 4O3QA 4RPXA 4CEBA 3OHBA 2Q0ZX 4QZFA 4HCBA 4Z6EA 3ZDDA 3T1AA 4EZ9A 3MEEA 1TKZA 2P6UA 9ICMA 4F8RA 3P1GA 2VANA 5KRSA 2D0BA 2YNFA 4I9LA 4QCLA 4GXKA 4XIUA 1TV6A 4UB1A 4DQSA 3LANA 4JRPA 5J0SA 4DOAA 4KLTA 4KLUA 2Y1IA 1QHTA 5EWGA 2ATLA 4FLZA 4N56A 3ZSRA 1S0OA 1J9AA 4N5SA 2XGQA 1IXRA 3L2VA 1WSFA 3DLRA 1Y88A 1UWBA 8ICKA 4UB2A 5KRTA 4BDZA 4QW9A 4CF2A 3M9MB 7ICOA 3DMJA 1TAUA 2AQ0A 8ICAA 4ID5A 4BXOA 3T3FA 3HPOA 1B22A 4UQGA 4YMMA 1L5UA 3C1ZA 3HP6A 4F4ZA 1ZQFA 4QW8A 3AVGA 2RDIA 2XCAA 1KFDA 4CEAA 5KFFA 5KFBA 3CYMA 3VQEA 4LZGA 2ZE2A 2OPSA 8ICUA 4ICLA 3QLHA 4IQTA 4DU3A 4BE0A 3NH1A 1S97A 1TKXA 4E3SA 2KN7A 3GIMA 3KK1A 4NCGA 4DF4A 1BCMA 3DOLA 5DLFA 4TQSA 3Q8SB 2IHNA 4I7FA 9ICEA 1S77D 1U04A 2G8KA 1B92A 5T7BA 3O3HA 4FK0A 4EYIB 1RT4A 4O0IA 1JMSA 9ICTA 2IBKA 4RT3A 3K4GA 5KGWA 3MECA 3ZD8A 7ICVA 4TQRA 4CJRA 4NY8A 2PI5A 4CEDA 3V7KA 3K5LA 4DL5A 1RDAA 1VSDA 2JZBB 5F9NA 2BPCA 2R8HA 3T5KA 4RUCA 2VG7A 3QESA 2D0CA 3AO1A 2DPJA 3D45A 2YHBA 4GMJB 4EZ6A 9ICIA 5IIJA 2AGPA 4N76A 3ZCMA 3MXJA 1ZQVA 2XRIA 2ITGA 1LWFA 3NF9A 3DLKA 8ICWA 4FW1A 3CFRA 3QNOA 4CGJA 1ZQRA 4FW2A 5DBBA 1D5AA 3S3OA 3AA3A 2ZUBA 2HHTA 1XHXA 5JS2A 3HJFA 4DO9A 4LH5A 3RMDA 3SUQA 4DU4A 4CHZA 7ICSA 3EWAA 2RDJA 1VSLA 3SQ1A 4KHSA 4O5BA 3HM9A 3B0XA 4W5NA 4RQ5A 2R8KA 4J2BA 3P83D 3Q8KA 5KG3A 2P66A 1IKYA 4Z4HA 3DI6A 3UIQA 3I8DA 9ICSA 1FKPA 3ULDA 4JUZA 7ICUA 1KVBA 5CHGA 3QZ7A 1JL2A 5J2DA 5I3UA 3V7LA 1BIUA 2OPQA 5KFUA 4OGEA 2OA8A 4F93B 3O3GA 3NH0A 1MC8A 4J9LA 4FBUA 3V6DA 3OYAA 1S76D 3P5JA 4Z6CA 3RJIA 3TARA 4B08A 4CHOA 3A2FA 4FK2A 1ZBLA 3ORYA 3B0YA 2D0AA 5J2HA 4KREA 4CCHA 7ICGA 3DLGA 4B9TA 3GFKB 4HUGA 9ICXA 4B9MA 3QEWA 5HRSA 2G8WA 2RPIA 3DM2A 2VA2A 5DGAA 2E4LA 1X2IA 1KSPA 4FZZA 4P4OA 5KFLA 3KD5E 7ICEA 3H08A 8ICTA 4P4PA 4FVMA 4QZ9A 4YG2A 4YP3A 3ALYA 4E19A 5HRNA 4FJIA 1S0NA 3TAMA 1HNVA 1HQEA 1SL2A 1ZBUA 4KI6A 4DSLA 2B6AA 3JPPA 4KHYA 3GIIA 3CFPA 1RBVA 2AJQA 3RH4A 4FLYA 3QEBZ 4LZDA 4YN4A 3GIKA 2FPMA 2BKEA 3ETLA 3L2RA 1HMVA 1JXLA 1RCHA 3AV9A 1IKVA 3BQTA 2F1HA 4FJ7A 3Q8QB 3HWTA 4M47A 3IAYA 2C2RA 4M0AA 4CESA 3IS9A 3QE9Y 4FM1A 1O1WA 3N97B 1NKCA 1ZQCA 4M3YA 5DB9A 4OPKA 5DK5A 3BDPA 2B5JA 4QZEA 4E7LA 1Z00A 3OYJA 4FLXA 5E41A 3O4NA 5KT7A 5KFPA 1CEZA 3LK9A 4QWDA 1Q9YA 3SQ0A 3M8RA 4F5RA 1SKSA 3AA2A 3MXIA 4FJ5A 5KFXA 3D0PA 2BCSA 4YR2A 2PFNA 2YKNA 3MR3A 1RBRA 4M3WA 4XRHA 3OYGA 4BWJA 4CK1A
chains in the Genus database with same CATH superfamily
4I2EA 4G1QB 2LYVA 5AQIA 4BRLA 2EAMA 1N54B 1VQNN 2V8HA 3MEDA 4UW9A 1HFEL 4PL7A 2CQGA 4YMEA 4JKAA 3QU7A 3JPQA 3W2VB 3OYIA 1JN3A 3LDNA 4J9MA 5DM7Q 1GEHA 2DHAA 4A59A 2KSOB 2VHGA 4WKYA 1LK5A 1U1NA 3NS6A 2OI2A 5F1XA 2LMIA 2FJEB 3C3LA 3LP0A 5A2QO 3LF0A 3MAAB 2MEWA 4FS2A 1VRUB 2D5RA 1JKHA 1S1XA 1B43A 3BY5A 2PMZC 1VQ9S 3PY8A 4PRFA 4CBWA 3GIJA 4CBXA 3UCUP 3M9NB 3ENBA 4XQ8A 1HJOA 4DV2J 4EO6A 3PXGa 3H5SA 4RQ1A 3TO8A 2BDUA 4CRXA 3RMAA 3RGIA 2BANB 5JS1A 2Z58B 4QR0A 2RS8A 3C7NA 4PKIA 3ILOA 1MWKA 1VQPS 4C0HA 3S3MA 1L7PA 1T94A 2IDOA 3ULEB 4G9ZA 2RU9A 2R7TA 3EMTA 2F9DA 4JKBA 3HRDD 4CGHA 2KG1A 2I1QA 3WQPA 3ICLA 4IC9A 3AQEA 1RBSA 3NL0A 1HNXJ 4KMOB 1S10A 1RT7A 1UVNA 4Y34A 3CIMA 3QJJA 2XY8A 4O0JA 2L3MA 1WACA 3IWNC 3DN9A 3VERA 2C42A 3AOAA 3E2EA 1FI4A 2BJ7A 2DNLA 2MKJA 3QIPB 3I0SA 1J5OA 5KG6A 2F7VA 3TA0A 4LFCF 3NNAA 4JI3J 4CJ5A 4RUAA 3HP9A 1FK9A 2OP5A 4CZEA 2VPXB 4Q44A 3G87A 1XHZA 5K14A 5AM2A 1V5VA 3MGJA 2DBYA 3HVRA 1HI0P 3MWPA 2E1RA 1KQFB 3C2LA 2ZD1A 1QQCA 2G0AA 2A40A 5CZ1A 2V63A 2O01C 2YQEA 5CCLA 2ZGZA 1SZHA 4GO7X 1K44A 3QICA 3QIDA 1AROP 1DRGA 2BUPA 3ID6A 2HBQB 4W5TA 2KT2A 3BQ7A 1AFIA 3K89A 2FHJD 1Z05A 9ICWA 4LRFA 2LMRA 3KJVB 1Q5YA 4KN4A 2G8IA 2HFVA 4IEEA 4CZMA 2V34A 3TADC 1UPPA 4PKGA 2QE5A 2QC3A 1XNRK 3D2QA 2KI2A 5C7PA 1HNIB 4CW7B 1QAYA 2ZH7A 2CAJA 2GX9A 5KFTA 1R0CB 4BRHA 2NYHA 4CHNA 1TVRA 2ZZMA 2UV8G 1SXDA 5AE2A 3NWRA 4HCCA 3CJ4A 2H3QA 2Y9TA 1S48A 3MBYA 2B4JA 1A5XA 3AVCA 2QXFA 2PYLA 1JXVA 3VC8A 4DCHA 3A0BU 4JK9A 5AM5A 4F91B 4U8VA 1OPIA 4W92B 3PFEA 2C3YA 5ETRA 4FJ9A 5F0UA 2X6NA 4RUBA 3H90A 3QU2A 4FVUA 2D0OA 5KTQA 1DOQA 3B6BA 5J2PB 3MCNA 4WXWA 4IDKA 3MN7A 2KVSA 4M6WB 2HBMA 4KSEB 2VH7A 3FZLA 3FMWA 3NGDA 4FDFA 3FZKA 1HWKA 3DOMB 1TL7A 2M4MA 2PBDA 4DR4K 2DGWA 3MR2A 2ZOFA 5FP0A 2EZZA 3H8MA 3WZ0A 5MAOA 2YJFA 2VYPA 5CWRA 3IG1A 2E8AA 5ALXA 1ZQDA 4LFAF 2G5HB 2VA3A 1UPHA 4H0PA 4I2HA 3K2PA 1SAZA 5J0OA 1N8RO 2MSTA 2LXUA 3WX4A 4C7ZA 3GPAA 4MO4A 4C3KA 1FRMA 5HMMA 4RU9A 1VQSA 6AT1B 1Y11A 2HAIA 1RAIB 2CPXA 4DV1J 4W5OA 4HACA 3GDXA 3OR2B 5EUHA 3I4PA 3KUGA 3THVA 3WBZA 1HI8A 4JI6F 2ZJPL 4F3MA 2G1DA 1T02A 4CZFA 1HJRA 1ZJNA 2HHQA 4OX6A 1WEXA 2PA8D 3J8AA 2FVCA 4NYNA 3RWUA 4CZCA 2K7KA 2XLKA 2MQLA 1Q7YT 3TZWA 4CZLA 3RB6A 3Q7CA 1S1WA 4Y2VA 4Y2AA 2VG6A 1KVKA 2QFJA 3U6FA 4K4YA 5J2MA 1P8ZA 1FO4A 4LJMA 3VPZA 4OI0A 3C1YA 3MMBB 2EANA 2XO6A 2HS0A 1HNZJ 4OVLA 1QAXA 2GWKA 5I3UB 4OKEA 5FRMA 3BR9A 4JK7A 5ALVA 2OMLA 3OLBA 5ALSA 3BV8A 2UXDJ 4CT8A 5BOMA 2O4IA 5KFNA 1HYSB 5FDLA 5D8HB 2YB4A 4M63C 3BH6B 1YJNS 2XTJP 1G3OA 3UMBA 1MQ2A 1RDCA 3UN2A 2LBOA 3PO4A 4C3LA 4KV8B 2L9NA 1WD6A 5J2QA 4WZMA 2MGZB 3PRVA 3OFEA 3ENQA 3BREA 2OH2A 2EW9A 2DR8A 2V7YA 1VYAA 3V7JA 1RAFB 3D1OA 2PYJA 2ZJ8A 1RWOB 1WSHA 4C8NA 1GMWA 1RWNB 4UOGA 1H3DA 1QY7A 2V8GA 3TFSA 4UAZA 2MAXA 1KLMA 2CJAA 3BP8A 1W7AA 2IOFA 1YSJA 3IRXA 4BC3A 3ZT1A 4QS9A 3SDEB 1KEKA 2G0JA 3KLVA 5DG9A 3WIUA 4OYZA 3G4SS 4KLOA 1IBLF 2XGPA 3OFGA 1O5JA 1SJRA 1TUWA 3ISND 2KFZA 8ICLA 3UE5A 3BO2A 1F5CA 3C66A 3AVMA 3HT0A 2QMUB 3CQXA 4IKFA 2WW4A 2NRHA 3M5RA 2FJVA 1Q82O 1HR0F 4LBPA 3RR7A 4XUSA 1JLFA 1TK5A 4V19J 1XWLA 4LF6F 4DV5K 1UJ6A 2RAQA 2I2YA 4MH8A 3B6PA 5HP4A 3KDOA 3PR5B 4OHXA 1NJWA 5L1MA 3MMCB 3M8SA 2KEYA 2QL5B 1FDDA 3CD0A 2IM1A 2HWHA 2E5LK 3OYBA 3D67A 3ET6B 5C2CA 1HUXA 3ZZPA 1CJTA 4ETXA 1ITPA 3QU5A 3Q8YA 2YKPA 2IGIA 4YUDA 4KLSA 4PPXA 1HWUA 3RRGA 3JQJA 4YNQA 4LF2A 1D8BA 5DM7L 3CB4A 2UVRA 2KNJA 3M2RA 3ATUA 1V3ZA 4DV3K 3HFZB 4KMUA 2ZJRQ 5BOLA 3TABA 1SQKA 2RHFA 5IIKA 1ACMB 2LSNA 2QWOA 3QWUA 4BACA 2C1EB 4FWSA 5HMLA 2WK4A 1HUZA 4KGVB 3JSYA 1C2PA 1XUPO 4ED4A 3OFHA 4AM7A 1DGJA 3THWB 3V81B 1K9MT 4DPTA 5ETVA 2OFGX 4DPWA 4UOHA 3HJVA 1UEUA 4L6V3 5BYSA 3VGUA 2BJDA 1NK8A 5AIBA 2Q6CA 1P6TA 1YVUA 3MDQA 5HROB 4A57A 4XH1A 3B78A 4DR3K 4ISEA 2XYHB 1XEZA 3D2FA 1C0FA 2L5YA 2DXFA 1A9NB 3E58A 4NYZA 1LWEB 2AJ4A 4CP5A 7FDRA 2JEGA 2ZUDA 2JH1A 2MLXA 4DI6A 1QLNA 4ES2A 5DGBA 1BOTO 4Y28C 1KVJA 2HEKA 1FJGF 4MHVA 1ZBIA 2ZFHA 2O1PA 3CCJN 2K8BB 2XWXA 2OFHX 4OHVA 4MFAA 3SI6A 2YHXA 3DWLA 3GR1A 2ZBPA 5HQ8A 3CDBA 4RW9B 3QNNA 3AU2A 5CR4A 2CNLB 1JLQB 4BRIA 4DV5J 3NS5A 1NMEB 4AP9A 2ZTCA 4LSLB 1R0BG 4Y2XA 1M6YA 1HPZA 1H6KX 1X31C 3G6EN 1T9WA 5C2DA 3CCRN 3O3LA 3ZSZA 4ZTFA 3MM6A 2R18A 2LI6A 1PAUB 4KKOA 3A12A 4Q0BA 3U3GA 4JK1A 3K5PA 1QH9A 2O8CA 2O8BB 3QEIA 4CJUA 1S12A 3U9ZA 1P9QC 2CADA 1VC0A 1N34J 3FGVA 1LV5A 4CEQA 2AH5A 1TL3B 4FYYB 4I2QB 3J7Z5 1PO6A 5AQWA 3MEGA 3KHYA 3H5YA 3I56N 3DFEA 1ATSA 4C0ZA 2XMTA 4X4OA 1WKKA 3CM6A 4NB4A 2FC0A 2F8EX 4A62A 3BGLA 2WONB 3QJLA 1ZC6A 2C2OB 1LWCA 2Q4TA 3RF9A 1W26A 2ZH3A 2E2OA 3IC1A 1Q86O 1TVAA 2RF2A 3BSNA 4JI3F 2ZBIA 2R7XA 5D0HA 4UY8T 1BHLA 3R5AA 1UW9A 4CZGA 1XSLA 1RA6A 5IIOA 2GVDA 3AD7C 3CT9A 1TFYA 5IFMA 2ZIWA 1L3VA 4QYZJ 2AZ3A 1KQSM 5BRHA 1FW6A 1RSCA 3NGRA 1NGIA 2DL0A 5AQHA 3TFRA 3PV8A 3AOCA 5A0YA 3VALA 3CJTA 4CGZA 3FBCA 1O0PA 1S3XA 2ZM6J 3WKBA 4C6AA 2F2AB 4KITB 2R2RA 1A6SA 4FKXA 3NBPA 1VIXA 3VEYA 2A2CA 2K8CB 3PCOB 2R9LA 9RUBA 3D6MB 3AO3A 3CJBA 4RCHA 5C42B 3K5MA 1WHXA 2IY5B 4B1ZA 2HQFA 3O9RA 4OZLA 1QAIA 5F8JA 1SJQA 2HF3A 4LD0A 2UXCF 1NOYA 2I38A 1S59A 4B9VA 1RGVA 1K5OA 1N4LA 5KT2A 3HDSA 1K1QA 4KHQA 2HHHK 2YI1A 3ICXA 3F44A 3JPRA 4Z4CA 1UVKA 3OHRA 1J5OB 2H3ZA 2YX4A 4RQ6A 2DIVA 5EGYA 4MAKA 1D4XA 1J54A 1NOZA 3C46A 1FDBA 3OBIA 4DV5F 2DNZA 1J5EF 2ZWHA 3ZNJ1 2H5EA 4NRTA 1YGYA 1RTIA 4X62K 3OTQA 3THXA 2UUCK 1YTUA 1HYVA 2BE7D 4PAAA 2AEMA 2BYCA 1FEEA 5ALUA 5FLXY 2W1BA 3CHWA 3O4QA 2JSXA 2F7TA 2NPFA 1VHXA 3KJNB 4XK8C 4OI6A 4RNMA 3J81j 3WK5A 2EWHA 4CJVA 3D6TB 3IBCB 1Z4NA 9ICFA 2UVVA 4JI7K 5CE3A 3CNQP 1HNIA 3CJAA 1PBAA 2O8BA 2VQFF 4NLSA 4CH7A 2MQQA 5IV4A 1TL3A 2M9KA 3WEEA 4O3MA 1KD1O 2BDPA 3OL8A 4LF8J 3Q83A 4ZCKA 4UBBA 1YJ7A 1MU2B 2GH1A 2ZXIA 5J2IA 1LAWA 3TTCA 5H2FU 1C1AA 3W8GA 3R6LB 3IXQA 1EKRA 2RT3A 4JI8K 2Z8QA 8ICHA 1IKWA 2B6GA 2KDOA 4M95A 2WF6A 1RADB 2Z1HA 4DUYF 4CIGA 5FPEA 2DGZA 3SJJA 2AMCB 3K0JA 1IUJA 2MHEA 4YN3B 4G65A 3M6VA 2JEJA 3G8QA 2NQPA 3H5XA 4C3MA 4MO5A 5AQNA 2I1RA 4NWIA 4E1NA 4FJHA 3ALRA 1TYQA 4KPYA 3DLHA 2P9IB 4ED6A 2XS7A 1NH7A 4AHUA 2J76E 2BJ9A 1CC8A 4DV0J 4UOCA 1B99A 1RTHA 3TUZC 4BGDA 1OSDA 5DB8A 4CD3A 5KFYA 2A1RA 4C8LA 4JI5K 3VENA 5J1NA 1I3AA 2RKIB 2LEAA 2FD2A 2UUAK 2E5SA 2P9LA 2HVIA 4X62F 4ZPWR 4ZVGA 1ZPWX 2V5HG 5HQMA 4WWSA 3HFVA 4NRUA 1RTDA 4K4ZA 3NS1A 2AYMA 3QT7A 3CJQA 2AJ0A 3PSTA 4M5IA 5A8KB 5KG1A 5IM0B 4TLRA 3D2SA 3HHDA 3GR0A 4ZVPB 3D7EO 1WBBA 3ENWA 4UZCA 4ZITA 3SMPA 4OYWA 3CC7S 3DKDA 3ILJA 2J5AA 3TP2A 3H42A 1JLBB 3C94A 2YBVA 2ISPA 3LL3A 1F3FA 3B6OA 3B8AX 3GTYX 4KHMA 1XNQJ 1OSCA 2C3MA 4K4XA 4AQYK 3T5JA 3T41A 3IS9B 4DCJB 3IRXB 7ICHA 2QKBA 1YKWA 1RWKB 3HVWA 2ZOGA 1BI4B 1H7WA 4CJFA 1C0UA 4ZH4A 1PJ7A 3BR8A 3ZI4A 2BCQA 4CF1A 4IFVA 4FWRA 3RBZA 2BE2B 2GNKA 1MROA 3QUQA 4CLWA 3CCJS 1YZ6A 3OSPA 3L5KA 4KH5A 1F44A 2CZ4A 7ICLA 2ABYA 3ENOA 4M3XA 3OQ2A 4EENA 1RT1A 1TQLA 2F65A 2KQ2A 2KG5A 4MQ3A 4RG8A 4QIWF 4EIAA 1HIWA 3S9HA 5BN8A 5DBCA 3I9V9 2PSZA 3VCDA 4AYBD 3AQFA 2ZJRL 4DOCA 3CJ2A 1KVCA 1VQ5S 1YF5L 3NGSA 4P0QA 2I5JB 3QMQA 5CHIA 4CEFA 4CE9A 5IC4B 2Y0BB 4NX9A 3BH7B 3G82B 1T3NA 5EDWA 1XERA 2FPHX 3NVMA 3KNAA 4O3RA 3I0RA 3RBDA 2XYPB 2VQEF 3TAGA 3NLCA 5KG2A 2H5JB 3BQ2A 1BA1A 3I56S 1K73O 2ZC3A 2VWJA 3AO2A 2ALZA 5GADP 8ICZA 1NM1A 4IQUA 3MURP 5M2UA 1S4FA 3N79A 1HW9A 3D54A 4FZVA 3SQ2A 3CJ5A 3VVUA 5J2FA 4IO8A 1P27B 1OO0B 1EP4A 4TSXA 3RRKA 4U67Q 3ZZZA 2YNHB 3NH2A 3JTPA 4NXNF 3TTDA 2RUGA 1EIYB 2CNNB 4DG1B 4RKUC 2ZIXA 3IM1A 2E1MC 4Y2KA 1Q8KA 2APOA 3IG8A 5HP1A 1Y5IB 1S9GB 1H72C 3IAM9 2OPQB 2GIQA 2WSEC 4CJWA 4M45A 2MQPA 9ICPA 3F9MA 2E88A 4GXJA 1C0UB 3WK6A 1QJHA 2DFFA 1ZYQA 3VEOA 3AO4A 3UWTA 4KAIA 4NEYA 4WP3A 2LDIA 3TPQA 2RKIA 4AHSA 3T1HK 2GX8A 3JSBA 1ZQUA 4ED3A 2L48A 4A2BA 3ILLA 1YHQS 1PYTA 3K1ZA 5DKWA 3CDUA 4IFYA 8ICRA 4NM2A 3GE9A 5DB7A 3FM9A 3V2UC 5A8KA 2ASOA 2GEMA 2HRTA 2E8PA 1BCOA 4KR0B 2CPHA 5GMKa 4QWAA 5HVFA 3MCSA 4EEKA 3PZPA 2CPYA 3RW7A 4A8QA 3AVKA 1WC5A 3DU5A 4EK2A 1QTNB 3N28A 1TZ0A 3V9ZA 4OLBA 1XJWB 2JJ4D 4PGXA 1GLBG 2MZSA 3LM2A 1KWMA 1DAXA 3BZKA 3VQTA 2NO4A 4LF5J 4EP5A 3BGRA 2FLOA 4OX9J 3I32A 2H1YA 1CLFA 3FLCO 3MM7B 1KHVA 4GNIA 3CO9A 3MXMA 4O3OA 1NK4A 3KZXA 5E3PA 2NLXA 4KO0A 1IBMK 2EFPA 4OJGA 1YRXA 2JMGA 3KLGB 1MW7A 7ICRA 3BB5A 3W9IA 1VRQC 2ASLA 2DNYA 5J1EA 4DX7A 1XNQK 5HVHA 4F04B 4M63A 3IM8A 1BGXT 2ZBQA 4CF9A 4WQ4C 1WBDA 5CR0A 4ECWA 1OVQA 5HRRA 4YD2A 1EKEA 1V85A 1YJUA 4E89A 1CULA 2O8EA 1Q7LB 1DTTA 2I7NA 3C19A 2KVCA 3BSOA 4C4RA 3I31A 3VQ9A 4FJXA 1U0HB 4YR0A 3GZ7A 3LGHA 2YX8A 4JKDA 1Y00A 2AD9A 2PN6A 3MPUB 4RPYA 2VC1A 5EHHA 1N5SA 4NLUA 1DQAA 5C42A 3EE8A 4BE1A 1XMQK 3M9OB 5ALFA 2RN2A 1BPDA 5L9XA 2UXCJ 2XMVA 2D4WA 4HHTA 2V8VA 4HUEA 1KQSR 2Y3YA 2DD8S 1N8RT 3ZZ0A 4KN7A 3DXSX 1N60A 2HW3A 4JYAF 2FHJA 4AHCA 2B6AB 1RTIB 2ZH5A 2P9SB 3DDHA 4FJJA 3BO4A 4USIA 3DRXA 2ODGA 1GLLO 2WRMA 4J9NA 3GG4A 4R64A 3O8MA 4DL4A 4U7UD 3C29A 1TUVA 3AVAA 2CRXA 4PYAA 3P8BB 4NZ7A 4H5WA 3HK2A 2KJWA 3UQSA 5CJ7A 1OPZA 5ETTA 3OYLA 4QWBA 1PILA 3K17A 2WOMB 3O3FA 2ZNYA 4QYRA 4IJAA 2ZBRA 2RLTA 3CJ1A 3CETA 4U6PA 3W60A 4OJPA 2P9CA 4KFBB 4I29A 5B0FA 3L8BA 4ED0A 3GV5B 7ICIA 4OCZA 1KBRA 2FY1A 2B4UA 5AQJA 3HM8A 3UPQA 5F3XB 1WG1A 4DOBA 1OH5A 3HW8A 1S1UA 1RAGB 4M9JA 3MM9A 3UD5A 4GKKK 1FNXH 5AI6A 2DGSA 3CE8A 1Z4OA 2QRRA 1FJGJ 3N4QA 3A0HU 5ALPA 2DBBA 1X4AA 2HMIB 1TL4A 1YBAA 2O8DA 4CJEA 2AF6A 1N6QA 3KYLA 4LSNA 3CD6N 3AXMA 2KT5A 1ZM4A 3MM5A 3VMFB 1RT3A 4CEEA 4AQYJ 1CUKA 2GMLA 4PGQA 3QGPA 4Y2YA 5ALJA 2ZOMA 4EO8A 5L1JA 4LFAK 2D1CA 3O9SA 2OAUA 3BGUA 2D3O1 2V0NA 3TJ9A 3SPZA 4ZCMA 3QIPA 4XO0A 4IOBA 4USTA 4K4HA 1YIJS 2DB1A 1S72S 3SLCA 3AJ1A 1VQLS 4KLJA 4U96A 3G86A 4MKVA 2EQYA 2FBTA 3L3FX 1MSWD 2Q2RA 4PQUB 5ETSA 4MF2A 4HACB 2FPLA 2G2ZA 4KTQA 3O08A 2AGQA 1VR6A 1GNKA 4U8YA 4C8MA 8ICPA 4H5TA 5FPMA 3O1BA 1LXJA 4YOWA 2NCKL 2C2ZB 2G8UA 2QLWA 1RHJB 1FWKA 2VKRA 3BJYA 4URGA 4AL6A 4I2PA 1QD1A 1VQKS 1B9FA 3FZBA 1GK8A 1QSYA 5HN0A 3MCPA 5IT9Y 1SQGA 3C2KA 2FHKA 5IS2A 3JAMY 5KFIA 2W9BA 1Q53A 1R8CA 2RQ4A 3FK4A 2A3JA 2K89A 1FRHA 2P6RA 5D3GB 3VF4A 2HSEB 4C0BA 1WF1A 2XSFA 2GBZA 4F5OA 3GL1A 2V6AA 2UZAA 2O5DA 2A10A 4F4XA 4C1NI 2KFYA 4PGYA 2PO4A 2DVIA 4LFBJ 3CCRS 4K2XA 2VD3A 2HI0A 1ZQ1C 4LQ3A 1ZBTA 4HLBA 4A46A 3F2CA 2VFTA 1NWKA 2HIQA 4IQVA 4DFPA 3VZIA 1G7CB 1PGZA 3G4SN 3SUPA 1CJVB 3IMXA 3HHEA 2ZJQL 3HKWA 4IRKA 5B66U 2HGMA 1S1TA 1JLGA 4GO5X 2OPPB 2I7PA 1N2XA 2JNJA 1I39A 1F2GA 3CCUS 4C48A 2KM8C 2W04A 2IBOA 1X0FA 1D3WA 4BUGA 3AVIA 2QZ8A 1UWBB 3OXLA 5DBAA 1RXVA 5AK3A 4F67A 5GAHI 2ZHBA 3T1YJ 1JUDA 2HHUA 3WC2A 4CNQA 5A8RA 1F9HA 4PABA 3BEXA 3KKSA 2F8SA 2KRRA 4J9RA 4NLTA 2ERRA 1FIQA 4KKOB 5E3RA 5EX5A 2YTUA 3DHWC 1FKAF 1CULB 1HA1A 3A3PB 1SIZA 2XY6A 3NXZA 1UJ4A 4YCXA 1OS5A 1E4GT 4LR9A 4QPXA 4JKGB 4J2AA 4ZHRB 3OY9A 2E8NA 5SZTA 1ASWA 3LDAA 3FRYA 5KNIA 3HKZF 4RPXA 3F2DA 2Q0ZX 5J1PA 4HCBA 4Z6EA 3QT8A 4H0VB 1BQXA 1HWIA 3IKMA 1VC5A 3L4PA 1U6FA 3B82A 1WC3A 1MLAA 1S4EA 2HRUA 5ETMA 1HNZF 2QSFA 4OLPA 5KQDA 1G99A 4M94A 2YNFA 1I94K 1NBWA 4GXKA 2Q97A 4CZKA 3DLEB 4DQSA 1CS4B 3LANA 1NGGA 1JJ2R 3A8KA 2IDEA 1XNRJ 5JLFA 4KLTA 4ZN3A 5TKWA 1QHTA 4N56A 3DAWA 1S0OA 1WWUA 1IR2A 1J9AA 5AQRA 3ED5A 2LQJA 1WSFA 1H0HB 4LF9J 4BDZA 2GVZA 2OD4A 3PFOA 1TAUA 2AQ0A 4DL0C 1RU2A 4UUWA 3ZX0A 4UQGA 4RX6A 1L5UA 2M8HA 2VQFK 2RDIA 2DXDA 4QIVA 4L3QA 5KFFA 4DFDA 5KFBA 3CYMA 2IJFA 2OKQA 2W25A 4B3MK 2MSSA 2YWKA 2VWBA 3SBMA 3M32A 2NZTA 2ROGA 3R3TA 3C28A 4X62J 4C7QA 5F8LA 3NH1A 3B9JA 1TKXA 2KN7A 3G71N 4NCGA 2RP5A 3L9ZA 1T6DA 3ET6A 5KL1B 1B70B 2E7VA 1BXNA 2JRSA 1Q3VA 2P9UA 4DR6F 3BGOP 4QU6A 5DLFA 2KH9A 1U2VA 1S77D 3K8WA 3AJDA 4DMZA 3J81U 2EC0A 1JMSA 1UL3A 1NPKA 4RT3A 2XB2D 3HKZD 4BRAA 5ALTA 3OPKA 4TQRA 1BA0A 3BSAA 3ENVA 2E1PA 4IDKB 2LECA 2WZ1A 3V7KA 3LYSA 1CI4A 4DL5A 1TE2A 4NPOA 4ED5A 3GYXB 2BPCA 1IR1A 2R2TA 5CCMA 2JFKA 4I6AA 1M0SA 2GHVC 3T5KA 3OR1B 3QESA 2UXCK 2D0CA 4UF4A 1VHIA 2RQKA 3EZOA 1R7IA 2YHBA 3SSQA 1N5WA 2BRKA 4G6VB 1X6IA 4EZ6A 1T9VA 1B4FA 4N76A 3OTOF 3MXJA 5FLXO 1LWFA 4PL1A 2L08A 2EFOA 3CFRA 1A0OB 2QMWA 2VBXA 1YXQA 1SQFA 3BBBA 5DBBA 4CI6A 4CYUA 2ZUBA 2ADBA 3WIVA 3C14B 1TELA 4DO9A 2Z4PA 3H8YA 2GGPA 2A19A 5U47A 4DU4A 3H59A 1Z4UA 1ZBSA 4KHSA 1KNZA 1V38A 1PVRA 2CG4A 3HM9A 1IBKJ 1DK2A 4W5NA 2DWQA 2VKQA 1U1RA 5KG3A 5AK5A 1S72N 2X7IA 4FYXB 3I8DA 9ICSA 4JUZA 7ICUA 3EGZA 4C8ZA 2FJXA 1Y3JA 2E1AA 3WXKA 1MC8A 4ANDA 2YMLA 4FBUA 1ZTTA 1X60A 4F7VA 1UTAA 4RR5A 4DV7J 2CGKA 4H0TB 2ZH4A 1K8AT 5KPZA 1ZBLA 2D74B 1T9UA 4CCHA 4FF1A 7ICGA 4DOZA 1QQMA 1NSAA 5AQQA 1RT3B 2G8WA 3S8SA 1SXEA 4FF3A 1YITS 1SZ2A 1X2IA 4FZZA 4FNIA 3H08A 4YG2A 2HVEA 4K0KF 2JWNA 3KG0A 4YP3A 4RUHA 4LF4F 3ALYA 4BG9A 5HRNA 3OLAA 3UKUB 4DR1F 2BJEA 3TAMA 3Q0AA 2BH1A 4M5DA 1SL2A 3HKZC 1ZBUA 4KI6A 1RLCL 2YKQA 1N0UA 4KYZA 3GIIA 2B56A 1RBVA 1U24A 5LMNF 4S0MA 3GZFA 3QEBZ 2CWXA 1RISA 2PD1A 5GAGP 3HZ6A 1WOOA 2AYEA 2H48B 3Q8QB 3HWTA 3TRGA 5AHXA 3W2WB 2E1ZA 2I9SA 1YITN 4M0AA 3CJ9A 1FXLA 2MA1A 2NXJA 2FSJA 1UWAA 3AA9A 5HMZA 3N97B 1J5EK 1SC1B 1ZQCA 1J2VA 1LOTB 4IXCA 4M3YA 2JFDA 4KX3A 1LFPA 3O9TA 3BDPA 2DGUA 1WG4A 3L95X 2FVSA 4D3GA 3OYJA 3IDWA 5EX3A 1DTQB 2BE9B 4H0XB 1BC6A 4JI8J 5I3PA 4CLYA 1CEZA 1VBKA 2XZTB 5B08A 3N7SC 2QKQA 3LK9A 2PC6A 3T9NA 3THTA 2DEJA 4NLYA 2FJAB 2DNQA 4P0PA 1VIOA 4P75A 5IC6B 4ZOHC 2BCSA 2B43A 1YJ9S 3MR3A 4YB6A 3GLJA 3WK8A 2FSKA 1IG6A 3UR0A 3MAQA 2X1BA 1ASVA 3ASMA 2B21A 3WNGA 2ZHOA 2UU9J 3CCEN 3U27A 3EYZA 5H9EK 3QT5A 9ICKA 3ZT3A 1B0XA 2C2EA 4RL1A 5C2FA 3W63A 1I1GA 3BM7A 3THPA 4JS4A 2F44A 4CGGA 1EO1A 9ICLA 3ZC4A 1CZAN 1SV0C 3SCKE 2XI9A 1L8LA 4OYOA 3A5LC 4ICAA 1KTQA 2LEBA 3MEDB 4XA5A 5KT6A 8RUCA 1E4FT 3GSDA 4RZRA 4XAKA 2HHSA 2EPIA 3OVAA 2DQNB 3D0IE 1YRUA 4NLXA 2XSJA 4Y2MA 5GAGI 1X8DA 2R7VA 2KJ5A 1HNWK 3NNCA 2RHKA 4F71A 2UUAF 1JL1A 5JTIA 1H2VZ 1RZMA 4C80A 2DFEA 5DRKA 2BCUA 1G4CA 2JGUA 4PWDB 3KIOA 2RRDA 1N6QB 1WAFA 3OYFA 3O0FA 1L7MA 4OIXA 1IWAA 4ECRA 1BISA 4DWIA 2YQ1A 1BPBA 2QSWA 4FWLA 5DLGA 4OYXA 1E6YB 2E6MA 9ICHA 3SQIA 3L3CA 4K4GA 3V81A 2F8HA 3OBYA 3J7YI 2FVPA 3MGIA 4YXJA 1F3VA 2DH7A 3CDEA 3C6HA 5JLHA 2HFOA 1D9FA 4O3NA 3PRBA 4A8KA 3EDRB 3QWPA 4O5EA 2BQUA 3CC2N 1NGEA 2F4VJ 2Y1RI 4IBNA 4AT1B 4I2QA 2CYYA 3BDEA 3LAKA 1XMQJ 3H3OB 1NPRA 1A5VA 1HLWA 1CJUB 5F0WA 3J7AN 4HHJA 4JI4F 3LDOA 1REVB 2KK0A 3DRPB 2YMQA 4IQWA 1Q79A 5KL8B 2Q43A 3R9LA 4UARA 1UFLA 1A77A 2YTCA 3DOLB 4MK8A 3ZSYA 2Q1NA 2WMMA 4FNHA 3MWBA 3AXKA 3DXKA 5DO2A 2K3KA 3TJ8A 4BQZA 4PXDA 5L46A 2QWPA 1WF0A 4FLUA 2KL8A 3CC4S 1UFWA 1NZ8A 4AF1A 2G0IA 3VEVA 4WFYA 4LVSA 2WF5A 3WKAA 1BQMA 1FK9B 2HVDA 5D4PA 2KYXA 3NMRA 1A7GE 3TYTA 4OJ6A 1WTBA 2D3UA 4JI2F 2XY7A 4NLCA 2GQQA 2MY7A 4OYPA 1HKAA 2OHDA 3QMLA 1JNZB 2EC2A 3WKCA 4NLGA 2PXIA 1XMOJ 4YFUA 4RQ0A 2R8JA 3ISZA 2VV5A 3WUHA 2OUGA 2XVTA 4QIEA 4UB5A 3I28A 3M6UA 1VC6A 4KY3A 1UPMB 4YY3K 2ZC4A 5HK4A 3OJSA 5ETOA 3MCOA 2BABA 3ZO7A 3DV9A 4QOZB 2H3IA 1RNHA 4ZA1A 4X64J 3DGPB 2GFFA 1YHQN 1PG5B 3H1QA 3UI3A 4BR4A 1WUDA 2R2SA 1AXQA 2RQCA 4IQMA 2ZNZA 2CXYA 1D8ZA 2OZMA 3DEEA 3LZIA 3ZLJA 2PFUA 1RTZA 4MYUA 1SXLA 3B4MA 3N4PA 2U1AA 3HHLD 5IINA 4OQJA 4A8MP 3CVKA 1ZZFA 2NUBA 5KG5A 3NMUA 5C25A 1BQNA 5DDMA 4C98A 4TY9A 2FDRA 1DARA 1QS4A 1LKYB 3NCIA 2DRDA 2C2MB 3ZDCA 2Y9HA 2UVWA 4OZ0A 4PCQA 4R79A 1FRXA 5J2PA 5JICA 1GMWD 1WC6A 4F2RA 2QG9B 2M3DA 5IT0A 4JI0J 3TSPA 4KV8A 5HNKA 1DY3A 1F5BA 1U49A 3P4UB 5L1LA 5BR8J 5G0RB 2VJVA 1UT5A 3NWGA 4WFNL 3DM2B 5AT1B 3U9DA 5KFSA 2CQIA 3ETOA 4J37A 1CZ9A 3NOGA 1C0TB 1CJKB 2GAHC 5IILA 3V1OA 3IR6B 3DRSA 4B3SJ 1KLNA 2OHFA 4ILLA 4NLZA 5DQIA 5HI7A 1JLBA 1B7YB 1ZAWA 5EE3A 3VTIA 5HANA 1V97A 1FFGB 4DN0A 4DN9A 5GAEP 3TQ1A 4FM2A 5AQPA 5ALMA 4ZHRA 1MWYA 2ZEJA 5GAHP 4PHDA 4RQMA 1F5AA 3VETA 3OGUA 2KJ8A 1BIZA 2UV8A 2V8DA 2E5LJ 4J9OA 2A42A 4Y0FA 3KLGA 4B3MJ 2DK2A 5AQXA 4H8KA 2YX6A 1AT1B 2CPDA 3IBWA 2K2PA 1UAWA 1OYEA 1OVYA 5CD4H 4ZJLA 3RB3A 4XPCA 3ENHA 3A0IX 4UB3A 1WSVA 2ZH6A 2CVIA 4ECUA 4TU8A 4TUQA 9ICRA 5HVGA 4JHDB 2ZIVA 5CZVA 2Z30B 3SBTA 2KKHA 4X65J 2CPZA 2XHWA 4YMOA 1L3SA 3SDEA 4K5SA 3V4IA 3WNHA 1Q86T 1X5OA 5K8PA 1KFSA 8ICFA 3KVGA 1RT6B 2BJ1A 3M2VA 5AQVA 4LH4A 1AQ6A 4CLFA 5KT5A 3MABA 2N1RA 1VGYA 4KHPF 1HIYA 1RBUA 1SB6A 3JYTA 3PEHA 4ZCLA 4ZK7M 2FMPA 4J9VA 1S6PB 1E6VB 1OXJA 2ZH8A 1RHUB 4RW7B 3WXJA 2FGOA 1BL3A 3P38A 1IKWB 2ZG6A 3LP1A 3PG9A 1BHNA 3DOKA 4V19X 3NGKA 3NGYA 1Q78A 2NNWA 5J2KA 1L3TA 3M8QA 3QBWA 1OIAA 3H8JA 5LSRA 3O6QA 4JI2J 3A8YA 1IBLK 1FJGK 4Q43A 2XWYA 3PACA 2X3DA 4R8UA 1XN9A 2JR5A 3KHRA 2QA1A 2OYQA 2YX7A 1UCNA 4CLSA 2BPFA 1RXOB 3WKDA 1RTHB 4RW4B 1DFDA 4KLDA 2G2YA 2XM3A 3VEXA 1VMBA 1FTCA 1OQ3A 4YHHK 2ZUGA 3JPSA 4K4VA 3NMAA 1IM4A 3KUEA 4UT4A 5J2EA 3FFIB 1M5OC 4TU7A 4ZP7A 4RW6A 2H3EB 4JWMA 3C21A 2C2DA 4G1IA 4IH5A 3RG6A 3BYRA 3U1MA 3R3LA 2M5YA 3CD6S 4C4WA 1IJJA 3QERA 3RJGA 1JLQA 4OGCA 4WCEL 4ZTJA 4M6WA 3W5ZA 1Y97A 1Q95G 1EB0A 4DPYA 2ZKUA 2YV0X 3LAMA 1XS9D 4KHNA 1X4DA 2M0GB 2R8IA 3CWJA 1T8EA 1H1VA 1YTAA 3OS0A 2CPFA 1RCOB 5D0RA 5IQQA 4QJFB 2B4VA 1IBMF 3PMNA 1VQLN 4G9BA 5AM1A 5CYQB 1XSPA 3M6XA 2HZAA 3LPEA 2A1AA 2GO8A 5I9EB 4FWOA 3IHQB 2HQIA 5ETPA 2DR7A 1R8PA 1FFSB 3J80Y 3SUOA 5BR8K 2JWKA 2W3RA 2WB1D 3EUNA 3CEDA 3V72A 1WWHA 1HBMA 1PSDA 2EK1A 1U8WA 3DYAB 5HL7Q 3MX2A 1VRUA 1X3NA 4GV6A 1TKDA 1V6HA 5AZIB 3OL7A 3RJHA 4R5PA 2AX1A 3EGVA 5AJ3K 4PR6A 3OR1A 1ZXOA 2DXEA 2O67A 4OJRA 1U26A 3TVKA 2XNQA 1HJPA 3L3UA 4YDUC 5J0UA 2MZ1A 4KHWA 3IP4B 1U2CA 1PK1A 4TY8A 5J8YC 4CTAA 4H4KA 3P6YC 2HSZA 3C15A 1DTQA 4YOTA 4QPTA 5J2BA 2XSJB 4OX9K 1QE1B 5RUBA 2B5JB 4OYAA 4P7TA 1SJFA 4BC5A 1D9AA 1RDFA 1ZD4A 2B3TB 3FNNA 3EEQA 3NRWA 3CJ8A 3MMAB 5DM6Q 4KAZA 2W2NP 3QT6A 1RBOB 3BS9A 1IO2A 1NZBA 3HVTB 4Y65A 3FFIA 1S49A 3KFUF 3EGWB 2Q1LA 4A8OA 4IR1A 1FRLA 4RQ3A 2V4RA 1VSFA 4OJHA 1HI1A 3G6XA 1WKJA 2VF3A 5HMXA 2E6LA 3UDVA 5CYJA 1I94F 4ID5B 3AU6A 2ZZNA 2P9GA 3SCXA 1TAQA 1DKGD 2OELA 3D7SB 5M1KA 2V51B 2W42A 2HB5A 5CZ2A 3V6KA 3LZJA 3VQ7A 1RKJA 9ICUA 2ZVSA 1F0MA 3VQCA 2FC8A 4UAUA 1SI9A 2EFNA 3G6ES 2DH9A 1RZTA 1ZRNA 1N61A 2GOLA 2M52A 2FQQB 3UPFA 1ZD3A 3CERA 1TK0A 4AL5A 3JTOA 1ELOA 4QYZK 4FM0A 3OTDA 4B6JA 3TUJC 4IRDA 3BS5B 1GLJO 3S41A 3HHNB 4ECSA 2ITMA 3C65A 2IRXA 2P8IA 4CJ3A 3LP3A 4MKAA 4IR9A 4M5JA 3V6HA 4WU3A 2HBLA 2RE2A 1HQ2A 3W7BA 2XMAA 1GOCA 4G1QA 2P9NB 3B4DA 3UMGA 1FXRA 3JSRA 2KZZA 4KBOA 5L1KA 4DKWA 1XK8A 4P2SA 3VWSA 3UE2A 8ICJA 4CK2A 3VGKA 5KOXA 3T1YK 1ZQKA 5LJ3Y 2FE9A 1QQ6A 2J9CA 2NLWA 3BBFA 2WVBA 4NE9C 1HBUA 1TL5A 3MI7X 4US9A 4DV6J 4E7JA 2MB0B 3NRBA 1RBAA 1ZQNA 3SQGB 3QSIA 4X4SA 1X4CA 3N6MA 2VWKA 3DLEA 4GXIA 4I1TA 3HVAA 2E8OA 4LF4K 2NYVA 1N33J 4ZCIA 3NNHA 2MZQA 3ZFVA 1N36F 4ZMMA 1FT8A 2GS8A 1SUQA 3HX0A 3DMJB 2E7WA 4UQTA 3ZTRA 2G1HA 2YQ3A 4DQRA 1CJKA 2A3VA 2Z0GA 4I2FA 2E29A 1G15A 5LMUF 4KGXB 4MFBA 3PX6A 1HD1A 3AA4A 3KLEB 3L0QA 2F8LA 4FXVA 3R7BB 1IV0A 3AD8C 3K57A 2CZ9A 4HDGA 1Z1VA 1Q7YO 2MU2A 2F9TA 4DCOB 4CEOA 4CJ7A 3Q8PB 1X4FA 3IA0A 2RRAA 3O4WA 2CGJA 3A1YG 2W4PA 1RBTA 4LY7A 8ICSA 2UU9K 1C0TA 2HGLA 1YQHA 5AJ3J 3NAHA 3TUIC 2QI2A 4J03A 2ZQBA 2HKEA 2IJRA 2RQMA 2OEJA 2VC0A 2CQ0A 7ICFA 5DQGA 1H7XA 1SH0A 1FNOA 3W5XA 4KH1B 1ZQTA 1ZQPA 1X9JA 3IP0A 1JI7A 2AU0A 3D28A 2DKXA 3IDHA 2EK6A 2ILZA 4B9LA 1RQLA 2HHXA 1SPBP 1IVZA 4HL9A 1BI4A 3QX7A 2HOIA 4MF8A 3GJRB 3H2LA 3RJKA 2NXCA 3G10A 2IA0A 3M8PA 1GOBA 2GHWA 5D4BA 4MEXA 5IWAJ 1C1BB 5CZXA 1BPZA 3T5LA 2MGZA 4U7UK 1NJXA 3CCES 5J2CA 2WBNA 4CM0A 8ICOA 1X3MA 5KPTA 4O44B 1DBDA 1C0MA 2BGWA 3K8VA 3EVOA 4IH7A 3NCPA 4ZS6A 3HOSA 1TP7A 1GLDG 1VSHA 3MCMA 2CQ1A 3FSXA 4KC5A 4P0PB 2LA6A 2VFRA 1U2RA 1LEOA 4A8YA 4Q0BB 1FVQA 2ZIUB 2VOPA 1WSGA 1EETB 2HOQA 3QGGA 4FK4A 2HMIA 5DS7A 3ZSXA 3K1RB 4LR8A 1HLUA 3ZZUA 1YT3A 2IVFB 2PMZD 7ICKA 3OJUA 1UEVA 3VVTA 4RTFD 3T6BA 4BBYA 1GQEA 1HHQA 4ACOA 1BPXA 4TNOA 2HNYA 4WQ5A 3W8PA 1DGSA 4OPAA 2K7JA 9ICCA 5D4LA 2I6XA 2Y0SD 2VB6A 3R9PA 4PXEA 3D6JA 3CJKB 3MUTP 1NLKL 4JI4K 3MZIA 2W41A 4HUFA 3I0RB 4LRDA 3QAEA 3SNNA 2N4DA 3AY9A 1R8HA 1NI3A 2HHVA 1QUVA 1Q3UA 3EY1A 4A8WA 3R8YA 1VRTA 3I6PA 2BOAA 2DRBA 2WF8A 4U95A 4QS8A 4F4WA 2GO9A 4C23A 1KTVA 4XPEA 3OHAA 3PEJA 1VQKN 4R0EA 3PLAA 1KAYA 3TX0A 1HYZA 2PT0A 2RNEA 3OV7A 4QQBA 2QO3A 4E8UA 3X1LB 3GB0A 3W65A 3FAHA 5ALGA 2P5OA 2QB0A 5HAOA 4O4RA 2GCFA 3IBFB 2BVZA 2F77X 2ZXHA 4KH6A 1D1UA 1HBOA 1ZRMA 2N82B 5AQUA 1VQ5N 3F2KA 2DT9A 2VCPA 7ICTA 3ETRA 3M1YA 3THYB 2DO4A 3R5GA 3K58A 3K9JA 4KLGA 3HSGA 5CYQA 3M2UA 2JWLA 4FJKA 2PMZF 1RT1B 3KNGA 1UVJA 4DTMA 3RJEA 2HNZB 2F9WA 1S9FA 1VI7A 2KV2A 1U9LA 4ZDNA 1WOQA 4KH0B 4M2YA 2EAOA 2HHWA 2MQNA 1KAXA 3UNYA 3A5MC 2I9GA 4I2DA 3VQ4A 2I5JA 4G1PA 2XMKA 1RP5A 2GLEA 1AUSL 4F92B 4W5QA 3SUNA 3US5A 1JK9B 4CIEA 2JEIA 4LRAA 5CYMB 1UKUA 1DGKN 1WHVA 4I0WA 5AKGA 3TAQA 1QQ5A 1XR7A 4ECZA 3Q89A 4DZ6A 4DCCA 1N0VC 5IQ6A 1RB0A 1XMQF 4BCAA 1UVIA 2O8FA 1HBMB 4V1Ak 5G5GA 4X4NA 4JB3A 4GVBA 3GSIA 1YZ7A 3K2YA 5CXTA 1KDNA 4YMNA 1HL6A 4YDUA 4BRKA 1N5TA 2OTLN 5EOZA 1DLOB 5KI6A 4GVBB 1T03B 4M04A 1FJ7A 5A8WA 4AYBF 2XI2A 5JRTA 1RHMB 4MYTA 3MMJA 1M5HA 1T03A 3LO3A 3L6QA 1SKUB 4RNFA 1NGJA 4KRWA 2RU3A 2YKMB 1KQQA 5AXMA 3CXCM 2YHAA 1QE1A 2DRAA 4BRNA 4DXLA 5CRXA 3AVNA 1N5YA 2GC8A 4NA3A 2KXNB 3UVJA 3FFKB 3NE6A 4AUKA 4FZXC 3Q8MA 2FHOB 4FZYA 4IFEA 3M2VB 3GBTA 3OVBA 2CQ3A 3JSMB 4RNHA 1T9TA 3H3NO 1EX8A 2KO1A 4JI5F 4CO2A 4KI4A 3CCVS 3MMAA 3GONA 4PG7A 2QWMA 5JJBA 1QVFR 4YB1P 2KP7A 2AT1B 5HO4A 1T4GA 4MLHA 3TA2A 2FMSA 3QO9A 4FN5A 2WVEA 2VFSA 1BMQB 3MPVA 1VK8A 1WSIA 4M3ZA 4DSEA 2Z57B 3AO5A 4A5AA 4ZVTB 2RB7A 2K8AA 3ZDEA 2NUUG 4WKRA 4QIWC 3GQCA 1UHUA 3ZZOA 4LF7F 1TUGB 3I5BA 3ISBA 4BC7A 3BGFA 1NAQA 4KLHA 1B0VA 2BW7A 5KT4A 3BGRB 4IRCA 2LM1A 2H5IB 1MN7A 4ZVEA 2J6UA 4B3OB 2DR6A 3WXLA 1OH7A 4RBUA 2R3VA 2OZSA 3NAIA 3KUHA 4MK7A 3P31A 1N32F 5AXKA 4RW9A 2MXYA 4FCYA 2A1BA 2NO5A 4HKQA 3VF6A 2FZKB 1RDRA 4ZJOA 4C2MA 4AE5A 4O0NA 1FRKA 1ZH5A 2HQGA 4KE5A 5DDRC 4FWMA 3QEXA 1ZQIA 3WK4A 3K0SA 1BE4A 3L7OA 1OH8A 1R43A 1JALA 3UVJB 4DEZA 1Y0HA 2LP4A 1OYDA 3Q8UA 1QVFM 3CIZA 4LVNP 3CC7N 2X51A 2KMDA 4R63A 4IQXA 4M5KA 2PDAA 1IKXB 1BLUA 1XR6A 2R7SA 2GQCA 1Z00B 3L7PA 3KK2B 5FJ4A 1U6ZA 4LBHA 1WTFA 2IHR1 2D9OA 1RDUA 2RF2B 3DOKB 2GQ2A 3DJCA 4Y1DA 5HL7L 3TACB 3EXCX 3DYAA 5BRFA 1U8SA 3RMBA 4CK3A 1PCAA 1G6BA 3DGPA 2EHGA 5AM0A 2QMXA 2KHQA 3Q8LA 2QLXA 3OL6A 3OYMA 3LGNA 5K14B 1UA1A 4F3OA 1FE0A 3LALA 5AK6A 5EY4A 1M1GA 1X1PA 4L74A 2RE1A 2DISA 3M1VA 3G6VA 4QWCA 1EETA 1VBXA 1ZQLA 4OX9F 1TKZB 1GLCG 1FX2A 5DDYA 2IVPA 1VQ6N 4MN4C 9ICJA 1R6YA 2BOPA 1KOOA 5FRNA 3PX0A 2W4DA 3CPEA 2JV3A 4URQU 1YJWS 3QJPA 2F9JA 1KVAA 5EWFA 4WIIA 3NAEA 4B3TF 3FZMA 1T0TV 1IBKF 2E5IA 2KD1A 3EDQB 4FLTA 2CDRB 2BQRA 2UP1A 2XYGB 4ED1A 4H4KC 3KLFB 4E98A 2GO7A 1RDBA 3CSKA 3C23A 4M3TA 1GX5A 4EYHB 4AHTA 3WX8A 4I68A 4PHTX 3QUCA 2ZJAA 5HBMB 1Z2ZA 3VQ8A 3EN9A 1WUAA 1Z1BA 4JI1J 4DSJA 2PFDA 1LWFB 3EGNA 4DMNA 4E1JA 4M9HA 4JI3K 3ZTPA 4IKAA 2B9EA 1Q8LA 5J0TA 4MIBA 3CCLN 4DV4J 1NUEA 1S0MA 3E3XA 1A5WA 3UKRB 1ZD2P 1W0HA 4J90A 3HZEA 2RRNA 1X0PA 5B7WA 1JX4A 3RBXA 5IOLA 1ZETA 2YX1A 5E84A 4QZBA 3EKUA 3LP1B 5GMEA 4DF8A 1NSPA 3T19A 4B1VA 1YDLA 4X4PA 3R1HA 1N56A 2Y8WA 3CIPA 4M3RA 2GUPA 4PWWA 1DJ0A 3KLFA 3C95A 1LW2B 2BGGA 3MM8B 1Z1ZA 3IG1B 1LB2B 3ZZYA 4M8LA 4QNLA 2ES6A 4GVEA 5JUMA 3E9LA 2FPKA 3L4IA 3O9QA 1RWPB 4LFBK 3QFUA 1QUPA 4CJKA 4A5BA 4GC6A 1XQSC 3MFHA 5K9FA 4I4BA 2CFXA 5D4OA 3FMBA 5KFJA 3C6UA 5D4NA 5LMUJ 2LKZA 3L09A 2OTJN 2V4JA 4N8NA 1TL1B 2F63A 2H54B 1DHMA 4BY9C 3PJWA 2GAGC 2FLPA 1RTJB 4DR6J 1EXQA 1URRA 2KIWA 2E9RX 3AAQA 3HL8A 1K8AO 1UOCA 1C6VA 3L4QA 2Z1IA 4CZIA 1RXWA 1HWLA 2YQ0A 1XMOF 3OUYA 1HR0K 3WQTA 1NKBA 4UBCA 3IM9A 3KZBA 4CQ1A 4LF6J 3WDOA 5AJ3F 1WG5A 3SEIA 4NMXA 3OHBA 1X4BA 4OYIA 4QZFA 2KHOA 5H9EJ 4P71A 2QL9B 3T1AA 4EZ9A 1HD0A 2HYIB 2V2KA 4BGAA 1OKJA 3NY0A 1JQGA 3D1QA 3U8XA 4I9LA 4QCLA 1K0VA 3BKUA 1MWQA 4XIUA 3F5AA 2V4JB 1HBUB 4UB1A 4A48A 2HRYA 4YOVA 5J0SA 4LF8K 1JJ4A 3HFKA 4Y6IA 2KIVA 4N7TA 2ATLA 4FLZA 3GU3A 2DNKA 3ZSRA 3CD5A 3L2VA 1VQPN 1T95A 4OJLA 2CJKA 3FZFA 1UWBA 1FEZA 1CS4A 4WIQA 3M9MB 3DMJA 1N34K 2H3GX 4ID5A 3KBBA 2FYXA 3T3FA 3HPOA 1S9EB 4PG8A 1NBEB 3GYNA 4YMMA 3C1ZA 4WYWA 3W3SA 3AVGA 4OJOA 1PJ6A 2W6LA 2B7CB 3JB9k 3TSQA 1HEKA 4BRPA 5GAEI 2AEJA 4IG0B 1B3TA 4BRFA 4FSVA 3DRYA 4PPZA 2DHXA 3TSUA 3DXMB 4USMA 4PYDA 1T11A 1S97A 3PDNA 3GU0A 3GIMA 3KK1A 4JI5J 2GIFA 4DF4A 1JJCB 4DR3J 2N3OA 1CJVA 4GKKF 4N77A 5TISU 1HBNA 3NVVA 3BO3A 5EE0A 3DOLA 3Q8SB 2IHNA 3MDFA 2O8DB 1U04A 2A41A 2G8KA 1HHSA 3CD7A 4ZVUB 2MKIA 5T7BA 3EE9A 1SBRA 2KKPA 1H98A 1RWXB 2IBKA 1TYQB 5K4LA 1VBYA 4GKJJ 3K4GA 1IKVB 2KT3A 3W61A 3UDLA 2FC9A 4OHZA 7ICVA 3J7YP 3O6WA 1N5YB 4NY8A 3KLHB 1RACB 2PI5A 2W2PP 3K5LA 2J7KA 2VBWA 3G71S 2E9TA 1VSDA 2FXUA 2RSQA 1FFWB 4QIWD 4C97A 3R27A 4KH4A 3NOCA 3D68A 2MYFA 1NSQA 5LJWA 4BC9A 2OCEA 2R7QA 1YUWA 2LYAA 4FYVB 3AO1A 2DPJA 3KWIA 3VAMA 1ZTWA 3PJXA 4C1NK 1P7DA 2Q3PA 1NB7A 4JI7J 3MEEB 5IIJA 3NEKA 2MQOA 2XRIA 3WHIA 1KBUA 2LQ5A 8ICWA 4FW1A 1Q1KA 4ZVFA 1BWFO 1ZQRA 4HHUA 1D5AA 4FOEA 1S5LU 1B7FA 1Q82T 4OZ5A 1NMDA 2BUNA 7ICSA 1P9YA 2YNIB 2HSTA 5AI8A 3TQEA 3EWAA 4NL9C 5LMUK 1VSLA 3SQ1A 4O5BA 3TEHB 3H98A 4J2BA 4LSZB 3Q8KA 3DI6A 4ALZA 1KVBA 5CHGA 2O3DA 2OJ3A 2F3NA 5J2DA 5L39A 4I2PB 4QIFA 1WHYA 2J9EA 5LSOA 5LXYA 1JKHB 1Y9OA 2IC3B 3IN5A 2FZCB 1J97A 2ZE2B 1WNEA 4WE1B 3NH0A 4J9LA 4J91A 5ADXA 4HVZA 3SENA 4IZ9A 1HARA 1PVPA 2ZBCA 3FBBA 4JKEA 3OA9A 3TARA 4B08A 1UMJA 2VQEK 3SK3A 3A2FA 2D0AA 2ZH1A 2B4OA 2M2BA 5HR7A 3CJ0A 2K06A 5C2GA 2UXBK 3QUTA 3D2FB 2AP6A 3PIPQ 4TY8B 9ICXA 5HQLA 1O08A 5AQLA 3M30B 2LPEA 1RAAB 3ZXWA 5DGAA 4NLWA 4ATNA 4FWKA 1S57A 2E4LA 2YHWA 2PEBA 4P10A 3ULEA 5KFLA 4P4PA 1OY8A 4QZ9A 3QXGA 3RFAA 3THWA 4FJIA 4JP8A 1S0NA 1FA0A 1HNVA 3IAS9 3NVWA 1HQEA 2DJWA 3MOZA 3JPPA 2CJ9A 3GJSB 1MMNA 4DV0K 2X1FA 1TAMA 4LZDA 1QVGR 1YJNN 2FPMA 2ZVIA 1I6JA 3ETLA 1M5SA 3QFWA 5LMNJ 1FDAA 1JXLA 3P45B 3AV9A 1IKVA 3BQTA 4LRBA 2F1HA 5HSPA 5C25B 2IIRA 1PJ5A 2W2QP 4P72A 3MM6B 3IAYA 2LA4A 2CWKA 1Q0NA 3RU0A 3E1YA 3IS9A 4IL6U 5ALQA 4BROA 1WYGA 4JD2B 1O1WA 1CVJA 1QQ7A 1NKCA 3H0LB 1YVFA 3C15B 2E5JA 2Z2MA 3GFHA 5DB9A 3DDKA 5F8IA 1FESA 1ZA2B 2BBEA 4E7LA 4FLXA 1BUXA 4P52A 3EKSA 4RW6B 3M2RB 4NO7A 4DV4K 5KT7A 2BRLA 4BRDA 1YAGA 1EJ7L 4QWDA 5IT9U 3SQ0A 3M8RA 3AA2A 4ZLLA 4KPCA 3JAMU 4YR2A 1A0PA 4KO0B 2COLA 4XRHA 3OYGA 4OI3A 3M8QB 4I67A 2OLWA 3TEGA 4CK1A 8ICCA 4PY5A 1S1WB 2POKA 2Q66A 3AODA 5IXUA 2HZCA 1NU0A 2AJ1A 3H0PA 2H65B 4LF5F 2HBZB 4N47A 5B09A 2VG5B 1SJ3P 2P9IA 2G8VA 4FS1A 4TURA 4YR3A 2J0XA 5DDQC 2A6MA 4OX7A 1RT6A 1C20A 5ALKA 4ZPVR 3RYLA 2CQ4A 5AICA 4ZIWA 4HWIA 3R5JB 1RDDA 4DUYK 2X74A 4DPUA 3U02A 4JWNA 4ZLJA 4DTXA 3EL2A 2AIRB 3AAWB 4CHYA 1ZA1B 2OSQA 3TTFA 2Z1GA 1HPZB 4KTWA 4ZIVA 2F3JA 5KFVA 3R1XA 4FO0A 4H0OA 1PAEX 5J0QA 3MPWA 4Q8EA 2GZOA 4UAWA 3PW5A 8ICXA 1LWXA 4H4OA 5DDPC 2RD5C 3KMSA 2K4IA 1F1BB 2RDDA 2W43A 4JI0F 3PUFA 4KLIA 3KJFB 4WFNQ 4KBIA 2KB2A 4IG0A 1U1LA 2ZIVB 2QL7B 3F53A 3FEYB 2KTQA 1GLAG 2DITA 4I2AA 1U47A 3C14A 4EBEA 4CEZA 2FJ6A 4QZIA 3D2EB 3NRZA 1LNQA 5THWA 4LQ9A 2WUSA 2IYGA 2A1JB 1FFUA 5IWAF 4C0OC 2CNOB 3C6UB 4CZHA 4DL6A 1CBKA 4H5NA 3T6JA 4BR0A 1U0HA 2UUCF 1SC4B 3TWHA 2D8CA 5IWAK 1X66A 3C2MA 1YWXA 5A6WA 2ZZTA 4OD0A 2BZFA 3KD1E 2K60A 4O23A 2W54A 3BF1A 2QLTA 1VQMS 3QAUA 3NGTA 1GOAA 4F36A 2BJ8A 2GWJA 1JB0C 4AILC 3MFIA 1SL1A 4PZVA 4TYBA 5AKYA 5BXIA 2HOEA 3AVLA 5M2RA 3MX5A 3MF5A 3FZHA 3LM9A 4QJVA 1MQ3A 4BRMA 1FO1A 3IMQJ 4JB8B 3CC2S 3UQ2A 3M05A 4YOEA 3QINA 3TOQA 3NF7A 3JAMO 3KLIA 3I55S 6FDRA 3VA3A 3P39A 2OXOA 3AA5X 4JKHA 2N4CA 4RPZA 4DS5A 2KXHA 1S99A 1RYRA 4C8OA 4CE6A 2B8PA 4DTRA 4WXOA 2YNGB 1BU6O 4YY3F 1T3VA 3Q2TC 2M70A 3G82A 3PW2A 4DSKA 3I5CA 2H5XA 2M88A 3MR6A 3F9KA 3KK3A 1JCEA 2B4PA 1V9PA 3U3YA 3C8YA 2R8GA 2EEYA 5CP2A 4DSFA 4FJ8A 1RYUA 4Q8FA 3J81Y 3LVVA 1RLDA 4R65A 4QZHA 4NXMF 1FF2A 1VBZA 4Z4FA 5CABA 3HSCA 2KG0A 1NZPA 4KLEA 1NDLA 5L38A 4KHPK 5HR6A 5AI5A 4FPBA 1J2MA 3JPOA 1NB2A 2ZGYA 2YNHA 4ER8A 3A5OC 4Y2IA 2W40A 1NHKL 1Z3EB 2CQDA 4A2AA 3MM5B 2UUWA 2H3VA 3E01A 3MCAB 4KLMA 2BKPA 4OYBA 2HFZA 4LF1A 4M7YA 3FSIA 3ZEUA 2Y1JA