2HHUA

C:o6-methyl-guanine in the polymerase postinsertion site (-1 basepair position)
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*CP*C)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 216
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhuA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhuA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhuA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhuA01
1BPDA 1IH7A 4UAWA 1K1SA 4FLUA 2ZUCA 1S9FA 2JEFA 1HYZA 4CEEA 4QZFA 4JV2A 1ZBFA 4K4HA 1T4GA 1B9DA 4FJ9A 3PR5B 5KT7A 4DFKA 2YKNA 3CFRA 5CZ1A 4DQSA 1T05A 4JS4A 4GXJA 4JV1A 3MFHA 4K4GA 1RYRA 4I9QA 9ICFA 4KB1A 2MAXA 4RQ6A 4P4MA 4XQ8A 4RNNA 4AHTA 4DQIA 3ASMA 1RDDA 4CHYA 5J0QA 5DQHA 5KFFA 4RPYA 8ICTA 4Z0UA 8ICOA 4O5CA 3ISBA 4I7FA 4I2EA 3HWTA 3NGIA 4HUEA 4KLOA 3VQ7A 4C8OA 5IINA 3ZD8A 4Z6CA 1LWCA 2P1JA 3OHAA 3SUPA 4C8MA 1ZQNA 3AVGA 4W5NA 4KITB 1LWFA 4M3UA 3ULDA 4FS1A 2UVRA 1ZQOA 2JZBA 2PFPA 3L8BA 4CJRA 4ECXA 1SKRA 2W9MA 4CJSA 1CXQA 3S3NA 3KLIA 3QNNA 3KK2A 3GQCA 4ED3A 1I39A 5DMRA 2R8GA 4Z4CA 4F2SA 7ICGA 4YVZA 3PX0A 3LPTA 1BQNA 4QZEA 1RT3A 1RTIA 4Z6FA 4Q8FA 3HPOA 5C25A 7ICHA 5EU7A 1RXWA 2G8VA 3NF8A 3HM9A 2IMWP 1BVSA 7ICNA 3GV8B 3T5HA 2HB5A 2XCPA 3RJGA 4B8CA 4Q0BA 3OY9A 4KLMA 3H8SA 1RT1A 3HW8A 1RBRA 4DSFA 1NK9A 1ASWA 1TV6A 4MFCA 3VA0A 3C2MA 1C1CA 5KTQA 4HTUA 5E41A 4CEDA 4NM2A 3UPQA 1DTQA 3OYFA 3RMDA 3JPTA 9ICUA 2IHNA 2D0AA 4EEYA 8ICFA 4Z6EA 3SYZA 3SUQA 3SNNA 1NJWA 1VSHA 9ICLA 3C6TA 3V6DA 1ZQIA 1ZQCA 4CEZA 2LYHA 5J0OA 3FDSA 1HJPA 3SV4A 9ICJA 3V4IA 4FJXA 1DTTA 1ZQTA 2F8TA 2AGPA 4QWDA 4DTRA 2BKEA 5KGWA 4DL4A 1ASUA 3AVNA 3TR8A 4I27A 5J2QA 5D3GA 1UAXA 2M9NA 2KN7A 2KZ3A 3C94A 1V9PA 2IGIA 1TK0A 5KFZA 2IOCA 7ICSA 2HNZA 2FC0A 1Y97A 3SQ1A 1W9HA 4KI6A 4RT2A 1K6YA 1D9DA 4F4KA 3LP1A 3ZT3A 2ATLA 2AGQA 3H7IA 4J2DA 1KVBA 3RJHA 4DL7A 8ICSA 3OHBA 4OJRA 8ICMA 3U3YA 1SL1A 1YT3A 1TV9A 3WNFA 4I2QA 2RKIA 4YNQA 4F4ZA 4EBCA 1NKBA 8ICPA 1JL2A 2X78A 4J9SA 3BQ2A 5DKWA 2IAJA 2AU0A 3IS9A 4EBEA 1ZYQA 2VA3A 5J2MA 5KFRA 5CWRA 4ECQA 5J2GA 5HP4A 3AVKA 4CFCA 1HMVA 9ICBA 3G10A 5KG0A 4E7KA 3TABA 7ICMA 1TL3A 4FO6A 3SCXA 3K5LA 4CIFA 3UXNA 1S97A 2JGUA 3T19A 3C23A 4M3RA 4QZCA 2RF2A 3VN5A 1TAUA 2HVHA 2IA6A 4DTOA 1RCHA 4BDYA 3SQ0A 3OYHA 3RAXA 5HMLA 1NK6A 1XWLA 2FLPA 4M3YA 8ICAA 4OKKA 2DFEA 1ZBLA 5J2HA 2OPQA 2ZJ5A 1HUZA 4YP3A 3TANA 4MFFA 4B9LA 4NXZA 4J2BA 2UVWA 4ELTA 1A5WA 4CGGA 1ZQMA 2G8FA 3DLGA 4UB2A 2QKKA 4MF8A 2OWOA 3HVRA 1CZBA 4DSLA 2VANA 3SI6A 1U45A 3DOKA 2BCQA 1WSFA 1BPBA 3GIJA 1LV5A 2FPMA 3AA5X 2P51A 3UXOA 2ASJA 3LP0A 4RQ3A 1QSLA 4QWBA 2V9WA 4YMOA 1ZQUA 5KFNA 3ZSRA 5HRNA 1CUKA 4MEXA 4BDPA 2RPIA 4KFBA 2P6RA 4NLZA 3AVAA 3V9WA 4KKOA 1D9FA 7ICTA 1ZQPA 2I1QA 3KKSA 4BE2A 3AO3A 9ICVA 3L3VA 2PYLA 4JK1A 3JSMA 2HNYA 1JLGA 5FDLA 4M45A 3Q8LA 3VQQA 1Z3EB 3RRHA 1N56A 2QK9A 1J5OA 4HCBA 2IDOA 2R8HA 4O0JA 1WCNA 4Z4FA 4QZHA 1S6QA 2HVIA 3UIQA 2X6SA 1C0TA 4RQ2A 1FKOA 4YFKA 4CF9A 4HUFA 5KFGA 2PFNA 4M9LA 8ICXA 4KTZA 2Q0ZX 2UVVA 8ICBA 1TL1A 1ZQJA 3C95A 2A1JB 3RJEA 2XY7A 2W9CB 4CJLA 1RT4A 3HSTB 5KG2A 4O3NA 4EZ6A 3ZSQA 1X9MA 3MECA 2BQ3A 2RDIA 4DSIA 8ICWA 3N4MB 1GOCA 3KLGA 1KCFA 3PMNA 3M9MB 2PFQA 2GV9A 3QNOA 3RTVA 5DB8A 5J0YA 3OYDA 2DPIA 1NK7A 3NF7A 3LP2A 4YFUA 3S3MA 2FLLA 1BI4A 4KLIA 2OZSA 1VRUA 4RQ0A 4YCXA 2P66A 2HMIA 4AHRA 4TURA 2X74A 3MXIA 3QZ8A 2ISOA 2BCVA 4KI4A 1TVRA 2XGPA 4MQ3A 4DTNA 4ECYA 4IDKA 5HP1A 2J6TA 4CHNA 4FZZA 4OLBA 3OS1A 3P83D 7ICUA 4PHPA 3AVMA 4CCHA 3L2WA 3PW5A 4M9NA 1S9EA 5HROA 2ZUBA 4N41A 1L3SA 3OYEA 3KTQA 4MFBA 1UA0A 3MBYA 4CECA 2D0BA 3V6KA 3LK9A 5KFQA 1XC9A 3B6OA 3EPGA 5FROA 4Z4EA 4MFAA 3RB3A 4LH5A 3MFIA 4KN4A 4BWJA 1ZBIA 5KFKA 3OS2A 1RDBA 1BIUA 4DL2A 4KPYA 1WNSA 4IG0A 3VQBA 2ZJ8A 1FK9A 1RDCA 2IC3A 1U48A 1ZETA 3GFKB 4HYKA 1NKCA 3B0XA 4TUQA 2BQRA 9ICOA 4X5VA 4E7IA 1A76A 3OYIA 3UQ0A 1QQCA 3TAMA 2ZE2A 1Y88A 1IM4A 4K8XA 4IR9A 3HVTA 3OS0A 3C2KA 4YD2A 1ZQRA 4BDZA 4CGDA 4IRCA 4BE1A 4CFBA 4Q44A 3PVXA 4DU1A 4NLGA 2F1IA 9ICKA 5J1EA 2HHSA 2BPCA 8ICVA 3OYLA 4I28A 3ZSOA 9ICIA 4DOBA 3MR2A 4F4YA 4ID5A 2XHBA 4R8UB 2BCRA 3H08A 3M8QA 4ECZA 1JKHA 5KFUA 4CJ3A 4KLUA 3LZIA 2R7YA 4BWMA 3QEAZ 4P4OA 4W5OA 2W42A 3PX6A 4LY7A 4CJPA 2MUTB 3KK3A 4TUSA 1ZJMA 1JX4A 2FLNA 4IRKA 5HRSA 4NYNA 2DFHA 3IG1A 3MXMA 1RBVA 4JRQA 4KHSA 1ZQQA 3LAKA 4N76A 5T7BA 3ZSZA 3BQTA 3E2EA 1CZ9A 1JLFA 3OYAA 4IQUA 5IIKA 3AUOA 8ICZA 4RG8A 3MXJA 1KSPA 5HBMA 4PPXA 4FM2A 4FJLA 4NY8A 3I0RA 1Z26A 4M3TA 4GLXA 9ICMA 4CHPA 1WLJA 3CM5A 3AO4A 3HK2A 4KHWA 2FBXA 3AVLA 4F3OA 1Q9XA 3DLKA 4ED8A 5C42A 4IG3A 1TKTA 4G3IA 2DFLA 3NBPA 4ED1A 1KVCA 3K4GA 4DQQA 2GWSA 4JUZA 5D4BA 3QERA 5KFJA 5HHHA 2NRTA 4RQ1A 2O4IA 4HUGA 5J2BA 4JS5A 4Y1DA 3SQ2A 3BQ0A 4DLGA 3G6VA 4CIGA 2ZQBA 3JPNA 5J2IA 4KLFA 5EWGA 3V6HA 1N48A 3DRPA 3K2PA 4DF4A 4FZXC 1X1PA 3EY1A 1L3TA 1QLNA 3JPRA 4CF8A 4DS4A 5J2KA 4CJKA 1PZNA 3OYKA 4I2BA 1J54A 2DFFA 3NGZA 3FYHA 1RNHA 3JYTA 4DFMA 2ZJAA 2V4RA 2Z1IA 4YQWA 3LZJA 1KEJA 3NF6A 4LSNA 1X2IA 3TI0A 3SQ4A 3RJKA 2ASLA 3V9XA 3V9SA 1ZQWA 1IKXA 4UB1A 4I2PA 5K14A 4XA5A 2ITGA 3RB0A 4IQTA 4ECWA 1U9LA 3EPIA 3NGDA 2AJQA 1JXEA 1I3AA 3KJVA 2IHMA 2A1JA 3JPPA 1RILA 4RW6A 3OYMA 1B22A 2XY8A 2FPLA 1ZBUA 1XO1A 3VQ9A 4R5PA 1X9WA 1BPZA 4JV0A 3FFIA 5KG5A 4BE0A 4I2HA 1LAWA 4F92B 3EYZA 3U3GA 3HP6A 1MQ2A 2BPFA 4FLTA 5KRSA 1IO2A 3MEGA 5KG4A 4O0IA 5CY4A 4M42A 5KFIA 1YTAA 1C0UA 4UAYA 2NRVA 3PW4A 1T03A 5L9XA 2RDJA 1L5UA 1ZQDA 3RJFA 2W9BB 3LPUA 1Z00A 1SL0A 3B0YA 4JRPA 4Z4GA 1K1QA 1N5YA 7ICEA 1DGSA 4QZGA 4Y1CA 3S9HA 4K4IA 2P6UA 4M6WB 3KK1A 3ISNC 1TFRA 2ASDA 4FLXA 5KFPA 4ED0A 3K5MA 2J6UA 4KAZA 3C21A 3JPQA 1HQEA 5J0UA 3HPGA 3PW2A 4CJEA 3T5KA 7ICQA 1XHZA 4I2JA 1QS4A 2F1HA 4CK3A 3QEWA 4BXOB 1RTDA 4FJIA 4KRFA 3GIMA 1JXLA 3CFOA 5EWFA 4R63A 1TAQA 4Q5VA 2P5GA 4HCCA 2BPGA 4PGXA 3NH2A 3ETLA 4PH5A 5IIIA 1L3UA 4AHCA 7ICLA 9ICNA 1JLAA 4J9PA 3NF9A 1XSPA 2XY6A 4JWNA 4CHQA 3RWUA 3GV5B 1TK8A 1HQUA 3LDSA 5KG1A 5IIOA 3A2FA 2YNGA 4PHAA 3AO2A 3NTUA 4XRHA 3GV7B 3C2LA 4QZAA 4GW6A 5KFDA 4QZ9A 4IFVA 1KFSA 4M3ZA 4W5TA 1RT6A 1N6QA 1UT8A 3TAFA 1BL3A 5BPCA 3AV9A 1R0AA 4DTUA 3KLEA 4H4MA 1ZQLA 4KHUA 3PO4A 4I2CA 2MUTA 4CEQA 4FJ5A 1JN3A 4MF2A 3QEVA 1T8EA 2HHUA 1HYVA 1MC8A 4QWCA 2HHWA 4DG1A 4F93B 3T1AA 2JEJA 4M9HA 3ZSYA 4PHEA 9ICEA 3V1QA 3BQ1A 3O4QA 4AH9A 4YG2A 5KI6A 4M2YA 4ZH4A 4HVJA 2J6SA 2AQ4A 2VG7A 2QXFA 2C2DA 4FVMA 3N97B 1RZTA 2W8KA 3B6PA 4NM1A 4KLEA 1KTQA 4M9JA 5EOZA 4KN7A 4OKJA 5DB9A 2E4LA 3OSPA 1RDAA 1ZQBA 2R8KA 3G6XA 4CK1A 8ICYA 5L1IA 1VRTA 3VQ4A 4FW2A 4KLLA 4KO0A 3M9OB 1CLQA 4F5OA 5KT3A 1VSLA 1FKPA 3NDKA 3BJYA 4EYHB 3Q8QB 4AILC 4DEZA 2WOMA 4LZDA 2UVUA 4B9VA 1H38A 4KTQA 3V81A 1S1XA 1WAFA 4NCAA 4PHDA 4CF2A 3T3FA 4K8ZA 1Z25A 5DB6A 4YMMA 4CJ4A 1RPLA 1ITGA 5KFAA 5L1KA 1L3VA 1KDHA 3IRXA 1QHTA 2NRXA 2A1RA 1J53A 4FK0A 1ZQEA 5TZVA 3OVNA 4FBTA 1UOCA 4F8RA 1RT2A 3DM2A 3SPZA 3M8SA 1XSNA 3K59A 2E6LA 5KG3A 4I29A 4FXDA 2ETJA 4RW4A 4KHYA 3ZDBA 3V1OA 1VSJA 1KFDA 1A5VA 5KFEA 4J9RA 1HRHA 3RB6A 4NLKA 4CIEA 4E3SA 4RQ8A 2XY5A 7ICFA 4E1NA 4CEFA 1C6VA 4QWEA 4UB4A 2YKMA 4DL5A 5DG8A 1BIZA 4DTXA 1SL2A 3PO5A 4DTPA 2B6AA 1EXNA 4Z4HA 5KT6A 3OJUA 4KLJA 4BGDA 3RH5A 2B4JA 1MU2A 2OYQA 3ZT0A 4CFDA 1NJZA 3V9UA 1S6PA 4W5RA 3VQEA 2KZZA 3RB4A 3RMBA 5C5JA 4O3QA 3L2RA 4QZ8A 4ED7A 2KFNA 4Z6DA 4DL6A 1F21A 8ICIA 1VSKA 1RT5A 4B3OA 4CJVA 4CGJA 4B9NA 7ICIA 1BPEA 2PZSA 4M04A 5KFWA 4I2GA 1SKSA 1HPZA 3TFRA 4KTWA 3TAEA 1VSFA 4O3OA 4L8RB 1HUOA 3HYFA 1KVAA 3DOLA 3AVFA 3Q8KA 3L2VA 1ZQVA 4YR0A 4FCYA 4KLGA 4ELUA 2W9BA 4LSLA 4YMNA 3HJFA 3VQ6A 8ICKA 4J9MA 2BE2A 4QW8A 4P2HA 1TKXA 5HNKA 4E7LA 5D46A 3PW0A 1QSSA 4Z4IA 4B9SA 2VG6A 4IQWA 5IIJA 1UA1A 3GIKA 3AVIA 3OGUA 4E7HA 9ICPA 4CF1A 4ED6A 1WSIA 2C22A 5KFVA 4N47A 4DTSA 4B08A 4J9KA 4H8KA 5DQIA 2A1SA 8ICRA 2XO7A 4PA1A 3H8WA 5CR0A 4BXOA 1WSJA 1IKYA 4CGFA 2EX3A 1XU4A 2W8LA 4J9QA 2G8HA 5JUMA 4IQVA 3AO5A 4FYDA 4R64A 1LB2B 5L1JA 4KHQA 3LALA 4I2FA 3ZT2A 4UQGA 4H4OA 4CE9A 2VA2A 4FJGA 1IKVA 2D0CA 1LAVA 1JMSA 3RAQA 3LWLA 2VG5A 1LWEA 1VSDA 1RTJA 4KLSA 1XSLA 8ICLA 5JS2A 4R66A 4OGCA 1HNIA 3LANA 4FJ7A 4F50A 4KLTA 3EWAA 1B43A 2JEIA 2AQ0A 5CZ2A 5KFSA 5KT5A 5CHGA 4UB3A 5KFBA 4WE1A 8ICHA 3I8DA 3EW9A 2Z1GA 3DYAA 7ICOA 3CM6A 4UBCA 4KB0A 3RBDA 2OZMA 4DO9A 4J9LA 3DRSA 4OGEA 3PX4A 3P1GA 1Q8IA 1O1WA 4DU4A 5SWMA 1JL1A 4PGQA 4OKEA 3WNGA 3AVJA 4DTMA 2KFZA 3AVCA 1CXUA 5SZTA 3VQ5A 2ZTEA 2BCSA 2IBKA 8ICEA 4QZBA 2FBTA 2WONA 2YNHA 3K5NA 4E89A 3V7JA 3PR4A 3GILA 3MABA 1VSEA 3ZT1A 3MR3A 2BGGA 1U47A 4NYFA 5KG6A 4CEOA 1HJRA 3TQ1A 5DQGA 1MSWD 5J2DA 3L3UA 4M3WA 3ITHA 2BHNA 1GOAA 5DBAA 4KLHA 2XGQA 9ICRA 3RBEA 5KFYA 3VQAA 4ZTJA 4C8KA 4FLWA 3OJSA 2WTFA 3IAYA 4CHOA 4XIUA 3IM1A 4DQPA 4CJQA 3ZDAA 4I9LA 3D0PA 3U6FA 5HHIA 4DLEA 4KV8A 1SV5A 5KFLA 3QE9Y 1BCOA 1CEZA 4GVMA 3V1RA 2YNFA 3KLHA 3LDAA 4O4GA 3SJJA 4O5EA 1RBSA 3ZD9A 4TUPA 1NK5A 1S1VA 1RBUA 3QEPA 4F5NA 1TKDA 2PFOA 2AGOA 3MEDA 2G8UA 5F9LA 3AA3A 4IFYA 3E01A 3SUNA 3M9NB 3ZSWA 3C1ZA 4QWAA 5KFCA 3THVA 4DOAA 2VWJA 4IKFA 3IHQB 3RJIA 4DQRA 4E19A 3O3HA 1S1UA 2YV0X 1S0OA 9ICTA 2C2RA 4CJTA 1C1AA 8ICJA 1RTHA 8ICUA 3O3FA 3V72A 7ICRA 2Z1JA 3Q8PB 1FXXA 2FPKA 3T5LA 3ISDA 1U4BA 1JLBA 3K5OA 5KFOA 2G8WA 2I5JA 3PNCA 3HT3A 3VQCA 4F91B 2OPPA 3MDCA 1J9AA 2JEGA 4M0AA 5CP2A 4PGYA 2W9CA 2DY4A 4FLVA 3QLHA 4YXMA 1ZQKA 4B9MA 4KLQA 7ICJA 2ZD1A 3HL8A 5KG7A 4RQ5A 9ICHA 3AVBA 4DMNA 4OPJA 4M47A 4YD1A 3CFPA 4AHVA 2IS3A 3SV3A 3K58A 1WCLA 3GDXA 4CK2A 1EX4A 1IKWA 3M8RA 2KZMA 1HNVA 1KLMA 4CGHA 1AROP 1XHXA 3MEEA 4OPKA 4C8LA 3V7KA 2FMQA 3JPSA 2QKBA 3H4DA 3DLRA 2ZTCA 3DLHA 4RW7A 1YVUA 3ZDEA 3AA2A 4DSJA 1B9FA 3OYJA 3LWMA 3UXPA 1S1WA 1NK0A 1BI4B 4FBUA 2ZTDA 3G0ZA 4IR1A 1GOBA 2HHXA 4O5KA 1S1TA 3SPYA 4O3RA 3K57A 4C8NA 4KHNA 4O3SA 4Q45A 4DWIA 4O9MA 9ICAA 1RT7A 4FS2A 3C6UA 2Z1HA 2YHBA 4ELVA 4F5QA 1QTMA 5KT4A 4FJ8A 2G8KA 4QCLA 3SZ2A 4UAZA 1T7PA 5J0PA 1NOZA 1UT5A 2HW3A 1B92A 1VSMA 2BANA 4P4PA 3QINA 4Q43A 3AO1A 3KIOA 2C28A 1X9SA 3G6YA 2BDPA 3HPHA 4TSXA 2OA8A 2DPJA 1QE1A 4DL3A 4GXKA 5DDYA 9ICXA 1XI1A 1ZQHA 4LVSA 1WSEA 3OYCA 4QOZB 5J2FA 3C5GA 1ASVA 1JIHA 2X6NA 3TFSA 4DSEA 3ZCMA 4FW1A 3ZSXA 5KT2A 1NJYA 4RUCA 3QO9A 3D45A 3AU6A 1JLEA 3NH0A 2ISPA 1KLNA 2B5JA 5J2CA 5DLFA 2V4QA 3TAQA 3KLFA 4GXIA 4NCBA 4F3TA 5DGBA 3NH1A 2OPSA 2B21A 5FRMA 2KTQA 1ZQFA 3CYMA 4KMUA 5DBBA 4DS5A 4CEBA 4BACA 1ZJNA 3BDPA 3TAGA 7ICVA 2XCAA 4R8UA 4RZRA 4IRDA 3MAQA 3PW7A 2YHAA 3C5FA 3O3GA 1EKEA 2FBYA 4MEYA 4QZDA 4DFJA 4AHUA 1NOMA 4EP4A 5HLFA 5DK5A 4F5PA 4CJUA 3V7LA 4M41A 3QETA 4FJJA 5J2JA 3LP3A 5KFMA 1S0NA 1W0HA 4DU3A 4RNOA 1NKEA 4FLZA 1RYSA 3RJJA 5I3UA 5HMMA 5J2PA 3H40A 1S0MA 1ZBHA 9ICWA 4FJKA 4EYIB 4RUAA 4RNMA 2NRWA 3VQ8A 4CHZA 1JXBA 4YN4A 2I9GA 3F73A 3T5JA 4QAGA 3NCIA 5HRRA 3CG7A 3ISCA 4M9GA 1WSGA 3SI8A 2R8IA 3Q8SB 1S76D 4FJMA 4J9NA 3C1YA 4ECRA 4O44A 3JPOA 3LAMA 2GBZA 5KGXA 2F8SA 1NJXA 4CJFA 4AHSA 3TWHA 3QEXA 1SUQA 3NGYA 3KHRA 3NFAA 5DG9A 2HHVA 3SUOA 3F9KA 4F4WA 4N56A 3AVHA 3H4BA 4RQ4A 4OVLA 3S3OA 2FMPA 4OLAA 5DDMA 4IBNA 5D49A 8ICGA 2YNIA 5IIMA 8ICNA 1BQMA 1LW2A 1QSYA 1BHLA 3EZ5A 5J29A 2KQ2A 2F1JA 4O3PA 4Q8EA 3PMLA 4UB5A 1BPYA 3DLBA 3CQ8A 4FK4A 1SKWA 4JWMA 4FK2A 3ZSVA 3KHLA 3KKRA 3BGRA 4TQSA 4ECUA 2G8IA 4FZYA 3ZDDA 4GMJB 1EXQA 1WN7A 3DRRA 4PQUA 3MR5A 3ORYA 4ECTA 3L2UA 5KFHA 1ZQSA 4LZGA 1D8LA 4DFPA 4PY5A 3UQ2A 5DB7A 3WNEA 1D8YA 3HXMA 1HYSA 4GC7A 2ZUDA 3HX0A 4RU9A 5KFTA 4O5BA 3RRGA 4LH4A 1NK8A 9ICCA 2ATQA 3AU2A 4W5QA 3VA3A 1ZQXA 2D5RA 3OYGA 3RMCA 1ZQGA 3KD1E 4J9OA 4TQRA 4PUOA 2C2EA 9ICSA 2NUBA 3TARA 1BGXT 3RMAA 4CGIA 3RH6A 4RW9A 1C0MA 5JS1A 2JZBB 2Y1IA 4M3XA 2GUIA 4JLHA 4YR3A 4YR2A 3NAEA 4LD0A 4EBDA 3QIOA 8ICCA 3MGHA 2VWKA 5KRTA 5FRNA 1A77A 2Y1JA 4O55A 4F5RA 1S5JA 3DMJA 1C7YA 5DG7A 4FJHA 3DLEA 5BOMA 4RT3A 1DLOA 3MR6A 1COOA 1UWBA 1TKZA 3QZ7A 3ZDCA 1YTUA 1ZQAA 4I2IA 3NE6A 4NLNA 4ZHRA 7ICPA 3PUFA 5J0SA 5J2AA 4ECSA 2VA8A 2OPRA 2Q3SA 3AA4A 4PWDA 4CESA 1U49A 1JLQA 3QESA 4M6WA 4G1QA 2F96A 1BISA 2HHQA 4FM0A 1Z00B 4E1MA 1REVA 2ALZA 5DBCA 2O4GA 3NHGA 4ED2A 1D5AA 4F4XA 8ICQA 9ICQA 5IILA 4N5SA 3Q8MA 2P5OA 5CJ7A 2E6MA 4J2EA 3PV8A 3TAPA 4RQ7A 4QZIA 4QW9A 2DTUA 4B9TA 4FLYA 4FJNA 2RN2A 4B8AB 7ICKA 5CYQA 1WSHA 5C24A 5L1LA 1C1BA 4RW8A 2BCUA 5DLGA 3PY8A 5EWEA 4I2DA 5J0WA 4KREA 5J0TA 4HHTA 3DI6A 3Q8RB 1S77D 1VK0A 4FM1A 1KRPA 2PYJA 4CEAA 1TGOA 1EP4A 1NK4A 3OYNA 3OSNA 2XRIA 4EZ9A 5J0RA 4RPXA 5I42A 4DSKA 4CERA 4B9UA 2XC9A 3KHHA 1A5XA 2R8JA 2KW4A 1NOYA 4ZTFA 3M8PA 5KFXA 3WNHA 4F2RA 4NCGA 4E7JA 4R65A 2PI5A 4ICLA 3I0SA 1WAJA 3MDAA 4DTJA 4EP5A 1Q9YA 1DOQA 3ZT4A 3OYBA 4GC6A 1TK5A 3HP9A 4CF0A 3QEIA 3ALYA 3H8JA 5J2NA 4CFAA 4DOCA 1VSIA 4CJ5A 5CB1A 5DGAA 1BPXA 1RBTA 1XS9D 3KD5E 1ZQYA 3O4NA 3V6JA 3VQDA 1JLCA 3P5JA 3RR8A 4ID1A 1BCMA 2FBVA 2HNDA 5J2EA 4RPZA 5J0XA 2BR0A 1S10A 3VQPA 3QIPA 2FMSA 2HHTA 5CYMA 4XUSA 4DF8A 2H5XA 5BOLA 1LW0A 1T3NA 1EETA 2PXIA 2NRZA 2W9AA 3GIIA 5F9NA 3V9ZA 5CA7A 3HO1A 1TVAA 5HRPA 3RR7A 2BQUA 4J2AA 1KFTA 2PI4A 4KLDA 1ZQZA 1S9GA 3QEBZ 3K75D 3L2QA 2BGWA 4I2AA 1MQ3A 2PY5A 4E0DA 1U04A 1RXVA 9ICGA 1SZPA 4YXJA 2LSNA 2JLEA 1IG9A 1G15A 2EHGA 4CJWA 4ECVA 1S0VA 3RH4A 3MGIA 4UBBA 3KHGA 1IXRA
chains in the Genus database with same CATH superfamily
2COLA 3R2DJ 2G0JA 4OJHA 2ZH2A 1EIYB 4RL1A 4KFBB 1UEUA 1S9FA 2JEFA 1HYZA 4IJAA 3CO0P 4K50A 1ZBFA 4K4HA 2M3DA 4FJ9A 1NAQA 1SV0A 1FVQA 4HH1A 2IM2A 4Z7CA 1MWQA 1B70B 3HLUA 4I9QA 3JSMB 3UQSA 2NYIA 3DM2B 2MAXA 4P4MA 1RB0A 1JLGB 4AHTA 5IM0B 4MTPA 3MPDA 4LF5F 2NUUG 8ICTA 4HR2A 2NYVA 1HBOA 3OR1B 3ISBA 1KQGB 3PDNA 3W3SA 5IINA 4QIWF 2KG5A 3VGUA 4WFBL 5D77A 1LWCA 5KOWA 2P1JA 4C8MA 1WC4A 4W5NA 1VQMN 3KK7A 1UZHA 3GU3A 4AP9A 1BO5O 3H5SA 3ULDA 2UVRA 1HUXA 2YWEA 3C14B 4CJRA 4LF6K 1GLFO 4QU7A 5AQXA 1MROA 2OEKA 3VAJA 4HACA 5E79U 3T9NA 4BLGA 4CO0A 2KSOA 3KK2A 4K4ZA 3BN7A 3MECB 1M5VC 5K8MA 2VQFJ 1RBOB 1HD0A 2HGLA 2R7QA 2MKHA 4Z6FA 1B7FA 5LT5A 5EDWA 3RGIA 4B3OB 4XH5A 5EU7A 4WCEQ 2CIMA 1RXWA 4DV5F 3UDLA 2F8MA 3NF8A 3AEVA 4DR2F 2ZXIA 4ZCKA 5EY4A 1EWRA 2XWYA 1W97L 5FLXY 2HB5A 5KL1B 2XCPA 3MOJB 3RJGA 4UF4A 2D1CA 2ZHOA 3C2MA 2I1RA 3VWSA 4HTUA 5E41A 2ROGA 1OW5A 4M5LA 2E1YA 1OQ6A 4NM2A 4FF2A 4WF9L 1X3NA 4M1KA 1HEKA 1U0HB 2Y8WA 8ICFA 4RTFD 3SUQA 3SNNA 4C3KA 3PSTA 2AEMA 3WXLA 3V6DA 1VQLS 4Y6IA 3BS5A 1ZQIA 5G0RB 4A4JA 3M6GA 3FDSA 1HJPA 3SV4A 3V4IA 4FJXA 4WFAL 2JH3A 3CCSS 2E1AA 2BKEA 4AYBC 3G96A 2QYCA 4I6AA 3TR8A 2AKWB 2GO8A 5D3GA 3NNCA 2FJBB 2M9NA 1WDDA 5CZXA 3UNGC 4LF7F 2KZ3A 3C94A 1V9PA 2FDRA 2VKQA 1IIPA 1TK0A 7ICSA 2HNZA 3TAMB 5CZVA 3CNQP 3VAGA 3UN3A 3CJCA 3LP1A 3BBCA 5ALOA 5AQZA 2AGQA 4JI0F 3ZT3A 3H7IA 5FPMA 5AZIA 3WX8A 4OX7A 2PO4A 3U3YA 3G9CA 5HL7Q 1ZOTA 1EWQA 3WNFA 5J8YC 3Q23A 3ET6B 1T9YA 4CNYA 4GKJK 4YNQA 2DGOA 5E7OB 1E3MA 2P8IA 2DCLA 1NKBA 5G4DA 1JL2A 2X78A 4TLRA 3BQ2A 3TADC 1HNIB 2ZH5A 2IAJA 4A47A 4EBEA 1Y64A 2XTJP 1ZYQA 1Z6RA 4ECQA 1D3WA 1UKUA 9ICBA 1FTCA 1KEKA 2YH0A 3KWIA 2EBEA 4FO6A 3C7NA 3FKBA 3K5LA 4CIFA 2JGUA 2KKHA 1HR0F 4LFCJ 3C23A 4UT4A 1NM1A 2P9SA 3VN5A 1QQNA 3AA8A 2JR5A 2O8CA 5HMLA 1NK6A 2DNLA 2FLPA 4M3YA 3PIPQ 1VQPS 4CLKA 5J2HA 3SQOP 2ZBCA 3MX5A 2RS2A 2ASPA 2UXDK 1CULB 1NGDA 5IC6B 4MFFA 2KB2A 3I0RB 1BLUA 1HLWA 1A5WA 4CGGA 3JQKA 1VQ4N 2K89A 3DLGA 3TTCA 4MF8A 3JXOA 4IH6A 2VANA 3BBFA 3DOKA 2K7JA 5KPZA 4C4WA 3AA5X 3LDOA 3ID6A 3D3CJ 4RJVA 3ITHB 2ASJA 1DK2A 3O9UA 3MMVA 4QWBA 2W4CA 4LF8K 3QWUA 4YMOA 3UW1A 1VC5A 3GB0A 3O1BA 1M1HA 1OY6A 2KXNB 3MGJA 4X4RA 1FD2A 1OYEA 2P6RA 1RDWX 1SV5B 1Q86T 3V9WA 1JUDA 3J80U 4QPXA 4DV2J 1G2EA 1OVYA 5A6PA 4BE2A 1RHUB 2E8NA 2CRLA 2EEYA 3HZ6A 2ZH3A 1M5HA 5EX5A 3BS7A 5CEHA 1FXDA 4OYZA 1SWWA 3E01B 3HHLC 3PCOB 3GYXB 5LSOA 3JS9A 3EICA 2HNYA 5BYQA 5MLCV 2DWQA 2DR6A 3VQQA 1Z3EB 2H3FA 4Y2RA 3SAFA 3GE9A 4DN9A 3R8EA 2R8HA 1JNZB 5M1FA 2QMXA 4OJ3A 2F9DA 4LSNB 4OHVA 4Z2XA 4JI4J 4Z4FA 2P6SA 2HVIA 1QAXA 3I87A 1KBUA 4QYZJ 3FQKA 3MN5A 1KQSM 2H5IB 5B0AA 2Q4TA 1KVIA 1KD1O 1F0XA 3WKBA 4FWKA 3QSIA 2Q0ZX 3ZNJ1 1ATRA 2A1JB 2XY7A 1WC3A 1P27B 3ZEUA 3MM6A 3MM7A 3ZZZA 1YBTA 4Y2AA 1XNRK 2AV5A 1Q81O 4RKUC 2BQ3A 3CJ0A 5M2UA 2MKIA 2F1FA 2V51B 3FZFA 3OYDA 4JD2A 2IDEA 3PRVA 1WI8A 3TWZA 5FIIA 1SKUB 3LP2A 3S3MA 2FLLA 3M6KA 4IWVA 3CJ9A 2P66A 3K0JA 2HMIA 3LDQA 4URSA 2CPRA 2BCVA 2EPIA 1KQKA 2MDAA 2ZOFA 3CVKA 3MURP 4MQ3A 4DTNA 3RF9A 4IDKA 3CCSN 2DR8A 4JV5F 2QA4N 1URNA 2HQDA 5ETKA 2LHTA 4CCHA 4QIVA 4NX9A 4C7QA 5F0UA 3GIRA 4KH4A 3UD3P 1Q53A 4XH4A 1L3SA 3KK1B 1UA0A 4ZLPA 2WAQF 3MBYA 3C6UB 4K0KF 4DV7J 3V6KA 1OS5A 3QATA 5IXUA 3WKEA 1HHSA 5EN1A 4Z4EA 1VLYA 3RB3A 4PQAA 3MFIA 4KPCA 4KN4A 1BIUA 3UVJA 4DL2A 4CH1A 2WVFA 1WNSA 2DKZA 1OPIA 1U48A 1X60A 1WKLA 3M2UA 3LDLA 1U26A 2BQRA 9ICOA 4N7TA 5DDPC 4HTIA 4B3SK 4NXMF 1A76A 3PFOA 4JI3K 1QQCA 4YY3K 2MQPA 3D3BJ 1YDLA 1Y88A 3NGUA 3QUCA 3MM9B 4YD2A 1M1KO 1TUVA 3PJ9A 2G2OA 1ZQRA 4BDZA 4U67Q 4CGDA 5B8HA 4CFBA 4JK9A 1YRXA 2BPCA 2A10A 1VQ9S 5JVHL 1XMQK 5A8WA 1WOPA 4U7CA 2XS7A 3N7RC 4JP8A 3MR2A 4H0VB 1ZD5A 4JKCA 4ID5A 3FEYB 3ULHA 2E2NA 2EFQA 1UZDA 4K8RA 2Y0SC 1KVKA 4M7YA 3H08A 4PR6A 2Q66A 4BR9A 1SAZA 1VMBA 3Q83A 1YBAA 4JI5K 2ZVIA 4IZ9A 4CJ3A 1FCAA 4KLUA 4X84A 2BM0A 2O3DA 2R7YA 3QEAZ 2YX4A 4X4SA 5KL8B 2EK6A 2QV6A 1O8BA 5LJWA 4QQBA 4CJPA 3R2CJ 4EENA 2O01C 2MQMA 1QVGM 4XTTA 1JX4A 2FLNA 4F67A 3WQTA 4NYNA 5BRFA 2DPNA 5I3UB 5J2PB 2JFDA 3E2EA 3AT1B 3LDNA 1JLFA 5IIKA 2QMUB 3AUOA 4EIAA 3NNHA 5HBMA 1TYQA 3IA0A 2H51B 4FJLA 5LL6Z 2MY7A 4CHPA 5IT9Y 3EEQA 1WLJA 3CM5A 4EO6A 4KHWA 3ATUA 3ED5A 4F3OA 2BV3A 3CQYA 4NYOA 1Q4RA 5C42A 4P73A 1TKTA 3MTJA 4USWA 4H4KA 2CQ0A 4G3IA 2VPXB 3K4GA 1CPZA 1L6NA 3L9ZA 3OVAA 3EGNA 4OJLA 4RQ1A 2WZ1A 3SMPA 4DR3K 2C3OA 2AF6A 3V81B 2BX6A 3HHLB 4NA2A 3G6VA 1L7OA 4KLFA 3V6HA 4I67A 3TZYA 1V6HA 1XR5A 3HM8A 4A57A 3IBCB 2SXLA 3IRXB 4WYBA 1L3TA 1QLNA 4U9RA 3JPRA 4NA1A 1PZNA 1RK8A 1KC8O 3NGZA 3MM8B 3FYHA 3SD7A 1V85A 1RNHA 4FNHA 4DV6J 3W2WA 3G25A 1WYGA 3O9RA 1CJTA 3DRRB 4BG9A 2XMKA 4YQWA 3UR0A 1Y11A 2OELA 3NF6A 1ZZFA 4WZMA 3TI0A 3CETA 1T3VA 1RFQA 1YJWN 4ANCA 3V9XA 1TL7A 3CXCR 4OX9J 5LM7E 4IQTA 2AJ0A 4FO0A 2A2DA 1FNOA 2G0CA 3EPIA 2NXCA 1ZAWA 5A8RA 1X9XA 3GYNA 1I3AA 3CWJA 3KKAC 1FFGB 3HOTA 3ETMA 4WKRA 1B22A 2FPLA 4JKGA 3M7DA 2VBZA 3F5AA 1S6PB 4OHXA 1SH2A 1N32K 1LCUA 2CJBA 4ZJQA 3R27A 4MIWA 2GTDA 5H2FU 2NZ4A 1RT5B 4M7XA 2HHHF 4B3MK 3PYDA 1PBAA 3EYZA 5BRDA 1MQ2A 3C0BA 4DZDA 3MEGA 2ASMA 2HS3A 4ZK7M 4UAYA 1U1QA 4CGZA 3PW4A 3ILIA 4W92B 3D2WA 5HMWA 4YORA 1CI4A 1DLOB 1S99A 1HKBA 1ZQDA 3RJFA 2LM4A 2WF6A 5B0BA 5F8HA 3EE9A 4QIFA 1SL0A 3OTQA 2FIUA 4Z4GA 1K1QA 4ZJOA 1N5YA 1DGSA 4QZGA 4Y1CA 3S9HA 1YX2A 3QAUA 4OQJA 4BVPA 4NEYA 4M6WB 3ISNC 4FLXA 4IOBA 1GMWA 1REVB 4ZPCA 2L9DA 3CE8A 1HQEA 5EE1A 5ALHA 3HPGA 2E5SA 5C0YA 2R3VA 2WB1D 2GWJA 2O8DB 7ICQA 3W63A 4MLHA 4I2JA 2F1HA 3MUVP 3T9ZA 4BRQA 4BXOB 3QXGA 3NAIA 1IJJA 1FX4A 1VK8A 5G5GA 3GIMA 4DCHA 3JAMY 1YZ6A 1T9TA 4R63A 5EWFA 3NXZA 3ZZ0A 5GAGU 3VEYA 3GCXP 2LKYA 2BPGA 3NRWA 3A0IX 3CJ1A 1GMWD 4QBUA 3CCRS 4DR7K 3PRDA 4PH5A 5C2DA 3KJNB 1JLAA 2JNJA 4J9PA 1Q16B 3EO3A 4J37A 5H9EK 3TNVA 1GMVA 2VFSA 3DI6B 1N5TA 4D3HA 4CHQA 3RWUA 1MNEA 3ONQA 2UUBJ 4N77A 4CH7A 1QQMA 5CHCB 1HQUA 3LDSA 2VPZB 3UKRA 3DXMA 3AO2A 1U8WA 3GV7B 1TFWA 1S4FA 3JB9k 2EC0A 4E2FB 4QZ9A 4P0QA 2J7UA 4IFVA 4M3ZA 2IPOB 1N88A 1VQ5S 1UT8A 1JCFA 1BL3A 5BPCA 4WE1B 1K8AO 1R0AA 1ZQLA 4KHUA 1X4FA 3PHEA 1B0PA 3PO4A 4I2CA 4FJ5A 4J9VA 1Z4NA 3T1HK 1GLDG 5E3AA 2HHUA 2VJVA 4OJGA 2BKNA 1UCVA 3IWLA 4DCOB 4QWCA 5KAIU 4DDFA 1KONA 2JEJA 4M9HA 2QFIA 3HTVA 4OLOA 1FXLA 3FZKA 4CLZA 2WVBA 3EM1A 3S41A 3TUZC 3KOOA 4ZPBA 3W60A 2U2FA 3QMLA 4WTYA 1NJIO 3ZZRA 5M1OA 2QXFA 3N97B 1RZTA 3U4LA 2W8KA 2XMWA 1RP5A 1IWGA 4JB8B 3VTIA 4P6QA 1RDAA 2ZIUB 3B4MA 2HK3A 4CK1A 3BKUA 5L1IA 1VRTA 3CJKB 2DH7A 2ZHBA 3FLCO 2NRHA 4YDXA 2K2PA 2WVEA 3SMZA 5CABA 5KT3A 2LKZA 2V9KA 1RADB 1TMMA 4AILC 2BJEA 4DEZA 2HWIA 4WCEL 1FJGK 4Z7YA 4DU8A 2X51A 1Y00A 3VF6A 1OPZA 1S1XA 4LBPA 1WAFA 4GVBA 4K8ZA 3ILJA 4ISFA 1YJVA 4YMMA 4UATA 3DDNA 2YMLA 2KOBA 1ITGA 3BSNA 1WI6A 2XNRA 3S6EA 2HGMA 2A1RA 4FVUA 5TZVA 5KPRA 1F5CA 2QB0A 4IJNA 4DV2K 1XSNA 1HARA 1TL4A 2YKAA 5KG3A 4H5WA 1S1UB 2ZZTA 2LU2A 1A5VA 2PSZA 1NNLA 3WK4A 4NLKA 2QA1A 4RQ8A 1PILA 2XY5A 4YDUC 3I8BA 2GJIA 2YKMA 1R43A 1T9VA 3J81U 2D3O1 4DTXA 3KWGA 1ZH5A 3BYRA 1Z4UA 1HBOB 3CCZA 3IWXA 2QRRA 1QTNB 2J8SA 5AM1A 2H1YA 1SC3B 3EKUA 3MCOA 2W54A 1IN0A 4NE9C 2OEMA 1R6YA 2VL1A 5D0EA 1LWCB 2ZM6F 3M6ZA 4PL7A 3VQEA 3E8OA 3RB4A 3RMBA 4O3QA 1P90A 1NM2A 1F21A 3FNNA 3WZ0A 4HACB 3CNHA 5MLCQ 1BPEA 5JRTA 3MCMA 5BJRA 2FZCB 2G0AA 2K7KA 3KK2B 3CC7N 4P0PA 2NLWA 5LSLA 1YK9A 1W25A 1VSFA 4L8RB 1HUOA 5HL7L 5H9FJ 3NMUA 3Q8KA 1E4FT 2QA4G 2O5DA 3AY9A 4FCYA 4ELUA 3CTRA 2PFFB 3KHYA 3HJFA 3VQ6A 5C7PA 2BE2A 3H3OB 4H5RA 3FSXA 5D4OA 1TKXA 5HNKA 3E1YA 2B43A 4E7LA 1PUZA 2RRBA 4USKA 1RT7B 3VOVA 3THXA 4WQ4A 4BC9A 2YCHA 3OTOK 2HQCA 4B9SA 2J5AA 1APSA 1EO1A 3D2EA 2NLXA 4ED6A 2WFBA 1WSIA 4CI0B 2C22A 5KFVA 1B64A 3D54A 4J9KA 3AJ1A 3NVKA 4X2BA 4PA1A 3DGPA 2KIVA 3M6VA 3NVYA 5CR0A 4RUBA 3VESA 5IZHA 1IKYA 3TZWA 3V6DB 4B3TJ 1XU4A 3BEGB 3N6NA 2W8LA 4USVA 4J9QA 2G8HA 3V4IB 5F8JA 2BXJA 3SJHA 1NGGA 3FVYA 1LB2B 1NGAA 2WF7A 2BE7D 4UQGA 2CNOB 1IKVA 1WHWA 2W4DA 4MKYA 1LWXA 3RAQA 3RW6A 3Q86A 2HNZB 3C2PA 4DR6J 1LWEA 1VSDA 1RTJA 1CC8A 3CI5A 3LP1B 5JS2A 3HFKA 1RU2A 3PXGa 5AZIB 1BWFO 5AQNA 1YI2S 1K5OA 5HMYA 3MX2A 1JI7A 4AM7A 4PKIA 3TVYA 4ZLLA 2HVDA 1EZZB 1WSVA 5HLFB 2JH7A 3O1WA 3I8DA 2OCEA 4LFBF 3CM6A 2M4MA 3KWMA 3CCLS 2IAJB 1X0PA 2HFUA 2DGSA 3WK9A 3DRSA 5MAOA 3P1GA 4DV1K 5AKLA 5FLXO 1BWEA 2UUWA 4ACOA 5F8GA 4QIWD 3SCLE 1FWKA 3AVJA 3TJ8A 3MI7X 1EKSA 3IO1A 1VQYA 2P9SB 2D3DA 4B02A 1YVNA 2B6GA 4LR9A 2AXTU 5DDRC 1IBLJ 3MABA 4ZVRB 3GFHA 4NYFA 4CEOA 2O6KA 4B1VA 3ZX2A 3NS6A 2BHNA 1V4TA 2AH5A 4YY3F 4WZQA 4O23A 5KFYA 4TU8A 4FLWA 3IAYA 3IM1A 4DQPA 2YBVA 1IBKK 5T7LA 5HHIA 3QE9Y 1K0VA 2BTFA 1CEZA 1XMQF 2YNFA 2IVYA 4O4GA 3SJJA 4JKFA 5K8NA 2YX8A 3A5MC 3DFEA 5HI7A 3MEDA 2G8UA 5F9LA 3AA3A 4IFYA 1ITPA 3H98A 4NLYA 2BJ1A 5AKEA 2VWJA 4EX6A 4GKKJ 1PO6A 3N0VA 1IR0A 4DV3K 2VC1A 3O3HA 2H3QA 3D28A 2C3MA 2ILYA 3NASA 5AQFA 5ETQA 4OI6A 3C28A 1RTHA 2BJ3A 3O3FA 4UW9A 3JSRA 5CD4A 4OL8A 3Q8PB 1O5JA 4DR4J 4USAA 3ISDA 1JLBA 2HNYB 2A41A 2NQPA 3W2VB 2I5JA 3PNCA 1HYSB 3G71S 4BRGA 1E6YA 2OPPA 3PSPA 2R4FA 1VQNN 4PWUA 2R9LA 2W9CA 5AK4A 3M7VA 4QU6A 2B3TB 1WJ9A 1N63A 4FLVA 4YXMA 3ICLA 2ZD1A 5KG7A 2XI3A 4RQ5A 9ICHA 4ED4A 4AQYF 1H74A 4DMNA 4OPJA 2K8GA 3VZIA 2ZEJA 2WHEA 3SV3A 1P9QC 3VEVA 4ILRA 1EX4A 3ZEUB 1KLMA 3ZZUA 4IOCQ 1YJTA 3EKSA 1AROP 5AI0A 1IG8A 2FMQA 3I96A 2KKVA 2NPFA 4DR3F 1HKGA 3CCES 4RW7A 3ZDEA 5ALQA 1RYUA 3OVBA 4JD2B 2F76X 5HR7A 2IOHA 4KGZB 3LP2B 1S1WA 1NK0A 2ZTDA 3BF4A 3MCPA 2H9ZA 2HMIB 2EAPA 2HHXA 3BDEA 3J80Y 4KGKA 2U1AA 3SPYA 4O3RA 2HWTA 4O3SA 2ZKUA 4DWIA 9ICAA 1T9XA 4BC5A 3S1TA 2OTLS 1OVQA 3QJJA 4IDKB 2Z1HA 1EHWA 2R7UA 3ILOA 3D2SA 2YHBA 2KDOA 1T95A 4ELVA 1WG4A 1QTMA 4FJ8A 1ZOLA 3HHDA 1NOZA 3E3XA 2HW3A 4J91A 1EKRA 4M5JA 3OQ2A 5ADXH 3CMAS 4KR0B 2BEFA 4Q43A 3WUHA 3QGGA 3CXCM 1K73T 2BDPA 3TSUA 2EK1A 5IS2A 2OA8A 2CH6A 3KUGA 4Y2QA 5DDYA 9ICXA 4JI2J 1IQZA 1Y3JA 4LVSA 3THTA 3VGSA 3TZXA 1RGIA 4KH5A 2N4DA 1SJQA 3C5GA 1YI2N 4FOIA 3CD6S 2X6NA 1X0FA 2OD6A 3ZSXA 5KT2A 2Q36A 1VQOS 4ZCLA 4PYAA 3H8YA 5GAHP 5AQHA 1JLEA 2CGLA 3M2UB 2ISPA 2B5JA 2P9NB 4B3MF 2LEPA 2VCPA 2VQFF 5DGBA 5M1KA 2KU7A 3NH1A 1FEZA 5FRMA 3H6EA 4KMUA 4CEBA 4YOVA 2AZ1A 3JSYA 4BACA 2XLIA 3UI3A 1Q0NA 4CBWA 1VLOA 1HNWK 2XCAA 3ZTRA 4AL7A 1D0EA 4FWSA 3PW7A 1UPPA 2CQ4A 3KOAA 5CE3A 3L4PA 1PJ6A 5ETLA 1WSRA 4AHUA 4ENOA 4BC4A 1NG9A 4LBHA 4EP4A 1WC1A 2DR5A 2JFKA 4GVEA 4ES2A 2WBMA 3MPWA 1FO4A 2KP7A 2DEJA 4ID5B 4F0HA 2VODA 4DR5J 1RWWB 4MKBA 3D4JA 4DU3A 1SXDA 4QS7A 3CEDA 3A3OB 4TY8A 3TA0A 3NP5A 4FJKA 4EYIB 5BYRA 3C8YA 1Q79A 3MM5A 2C1EB 4A8QA 2NRWA 5AK3A 1NGIA 3UNYA 4CHZA 2FZKB 1UTAA 2HNDB 4EFAC 1PAEX 4CH0S 3CG7A 3ISCA 1R0CB 1ZTWA 4ANEA 4RR5A 4OMFG 1S76D 2XBPA 4Y34A 2FI1A 2KFYA 1JLFB 5KGXA 1IJEB 2GZOA 1TYQB 2F8SA 3JS6A 4U7BA 2IYGA 3SXLA 3QEXA 3M4XA 1ZD4A 4DR7F 1SUQA 3VGMA 2PDAA 3O6QA 5DG9A 3L4BC 3E58A 4HHHA 3SUOA 3DOMA 1M1GA 2OTJS 1X4EA 4RQ4A 2HBZB 3AVHA 2FMPA 3TU5A 5DDMA 4AYBF 1KR4A 3ZTOA 5C42B 5K5MA 8ICNA 1TKTB 1UJ4A 5AM3A 4ZPDA 2KICA 4ZP9A 4LF9K 2CZVC 3CRXA 2NXUA 1EQ0A 1NWKA 3OUYA 4ATNA 2ZWPA 1ZA1B 2NRRA 4ZPVR 4O3PA 4Q8EA 4RUHA 3SDEB 4UB5A 1BPYA 4B1ZA 5DETA 3CQ8A 1PVQA 2PEBA 3M2RB 3U27A 2ERRA 2PA8D 1BY9A 3F2KA 5LXYA 3CC2N 4ECUA 1SB6A 4B1WB 2G8IA 2CJQA 3UMGA 2MZJA 4QZVB 1VQ6S 4UB8U 2YKNB 1GX5A 1K9MT 4CZFA 1ZD2P 4IO9Q 3M5RA 1T11A 5KFHA 1WF1A 1ATNA 2WAQD 4PY5A 2HEKA 1DFDA 3UQ2A 2DHGA 4C7ZA 4A48A 2Q1NA 4BVOA 1OMSA 1XBWA 4LFCF 2AJ4A 4F04B 3BS9A 2H3GX 1NK8A 2AJ1A 4W5QA 2GA7A 4CLYA 2A1AA 1VYAA 2GO9A 2G1HA 3KD1E 3HCXA 3SSSA 3ZYYX 3UB5A 4PUOA 2W7PA 3N79A 3QU5A 1VJWA 2E88A 2UUAK 2E1CA 5A8RB 1C0MA 2VBXA 4M3XA 2EAOA 4BJQA 4YR3A 3HF5A 4URQU 4EEKA 4DR1J 3QIOA 3TW0A 2C3YA 3MGHA 2LDIA 1HBNA 2HMXA 3AJDA 5FRNA 1A77A 4BRAA 5DG7A 4DV0J 5E33A 2XLJA 2A0FB 3TSQA 3VENA 5BOMA 3QU2A 3MR6A 5IT9O 1TKZA 3C19A 3MEGB 2GMLA 3AQOA 4ZHRA 2VUGA 3PUFA 1F0MA 3TJAA 5E5NA 2VA8A 4Q0BB 3I31A 4YHHK 1EARA 2AYEA 4PWDA 2KV2A 4CESA 4DV2F 2F96A 1BISA 2HQGA 4E1MA 2ALZA 2DJWA 3R9LA 5M1PA 5DBCA 2O4GA 3NHGA 2FSJA 2W40A 4HT7A 4JYAK 3QT8A 5AM0A 3AQPA 1BHNA 3CCVS 2V50A 4FWQA 8ICQA 2UU9J 4N5SA 1WHXA 4O0NA 3EVOA 3GSIA 2LLZA 4DX6A 4JI4F 4J2EA 3MPVA 3G87A 6AT1B 2ZIXA 4YB1P 4B9TA 3UR3C 1HWIA 2RN2A 4B8AB 4PHTX 7ICKA 1ZA2B 4RW8A 1RACB 5EHHA 4I2DA 2E7VA 3ULEA 3QGHA 1X5PA 2IOFA 4L3NA 2DQNB 2YB4A 4V19S 1S77D 2PYJA 4CEAA 3PNIA 1TGOA 2X1GA 4OHZA 2E8OA 3OYNA 5LJ5Y 2PMZC 4ETXA 2UUCK 1N36J 2W11A 3F0NA 4B9UA 1VGYA 1A5XA 5ALTA 5CH7B 1YRUA 2VIXA 4RX6A 1KP6A 2VOOA 4IXCA 3P31A 3N7PD 1RXOB 4F2RA 4E7JA 2PI5A 1HQUB 1W7WA 4ICLA 4P2XA 3CCTA 3I0SA 1I94J 2ZIVA 3MDAA 4DTJA 1NH7A 1Q9YA 4ZVOB 4YOWA 3OTBA 4IFVB 2BJ7A 3D6HB 2RHQB 2F8LA 5AM2A 5B0DA 3N4WA 2J0WA 2OAUA 3GJTB 4KHRA 2IVFB 1YITN 1H3DA 1NXIA 4KHMA 1KAYA 2OTJN 4K59A 1R0AB 2IDLA 3I32A 1RBTA 5A2QO 3V6JA 4J9UE 1JLCA 2PFDA 2MLXA 1JWWA 4DV7F 2XG8A 3VGKA 5J2EA 4M5DA 1B7YB 5J0XA 2OSQA 1BOTO 1G4CA 2FMSA 2DNZA 4DB3A 2HMPA 2K8CB 2LYAA 4CLSA 4DF8A 2XMMA 2H5XA 3OXGA 4TLQA 3H8MA 4P52A 1XN9A 2ZVSA 3THYA 3RU0A 1TVAA 1KFTA 2B0GA 1S9GA 3K75D 3I82A 3ZX0A 3H2UB 4ZVTB 1U04A 4PG7A 4LRCA 2EW9A 4MMOA 2HRUA 2EC2A 1SZPA 1VRTB 1M90O 1LK5A 1IG9A 5GTIU 2K8AA 3NAHA 4NWIA 2YI1A 1S5ZA 2KXHA 4ECVA 4P71A 3QSYB 2I9SA 4FYWB 4HHUA 2EH9A 3JAMO 4ZJLA 2HYIB 3RH4A 2V2ZA 3MGIA 4UBBA 2G2ZA 2KHOA 3OT9A 4KJIA 4Y2SA 4UAWA 3R7SB 1N8RT 5E3QA 4FWPA 1A0PA 4MO4A 1VCTA 2ZUCA 3I4PA 3VGLA 4GVBB 4NXNK 4QZFA 3TRGA 1T4GA 4C97A 2UXBJ 3OTDA 5AR0A 1B0XA 3VAMA 1T05A 2W7OA 1T02A 4ILMA 1VQKN 1NMEB 4NLUA 2MQ8A 4K4GA 4UW2A 9ICFA 4KB1A 2ZG6A 2JWNA 4XQ8A 4RNNA 1KTVA 1YG0A 4FPIA 3ASMA 2Y0SF 4I6YA 3PG9A 3T6BA 2J0SD 4RPYA 4I7FA 4I2EA 4DCCA 3NGIA 1XNQJ 3MWBA 3VQ7A 2HBRB 3ZD8A 3M8YA 3FSIA 4PL2A 2FJXA 4Z6CA 4FN5A 1UP1A 5T14A 3SUPA 1AQ6A 4KITB 4QOTA 3I56S 1OIAA 2CPFA 2V2KA 2JZBA 2KT2A 3R5AA 1F9HA 2RQCA 3O6WA 5H1SQ 4CJSA 1HLUA 4CLPA 1CXQA 3S3NA 1WTFA 3D0HE 1COKA 4HT5A 2YQEA 3J7YU 3QNNA 3WK6A 3GQCA 3LPYA 4X66J 1I39A 4Z4CA 1IBKF 4WP8A 1BQNA 1RT3A 3CCVN 3PACA 4Q8FA 3HPOA 3PFEA 4PAAA 3HM9A 2IMWP 3WIUA 5GMEA 1BVSA 4PPDA 3K8WA 3KG1A 3FM9A 2YX1A 5T41A 3KNGA 4KY3A 3VMFB 4WJ3B 4KLMA 3HW8A 4CLTA 4PL1A 4DSFA 4DCJB 4EI2A 4OYMA 1GH8A 2E7XA 5HVGA 2PEHA 5KAKA 2A6MA 1ZBSA 3C16B 4FPBA 3OW2R 1FRHA 4XO0A 3RMDA 2W6LA 2IHNA 2D0AA 4DV6F 2IM1A 2E20A 4Z6EA 1UEKA 2VOPA 3C6TA 2DF4B 2A2CA 4C9DA 3D2EB 4CEZA 2LYHA 2ZIWA 4OX9F 2GW8A 3WDOA 3H1VX 1CG2A 3G8QA 1PVPA 2KE7A 3V5RA 1DTTA 1M5OC 1TFYA 2MQOA 2DKXA 2AGPA 3DGPB 3WEEA 1HNXK 1ASUA 3AVNA 2OMLA 2BRKA 4HL9A 5J2QA 1RWOB 4KC5A 1UAXA 4X64K 1LK7A 2VFRA 4NWBA 2JHDA 2V63A 4LIWA 2ES6A 3BSCA 4GO5X 4NB4A 1FESA 2ASYA 3SQ1A 1W9HA 2R2SA 3MD1A 3ENHA 1D9DA 4CW7B 2XZDB 1HKCA 1CQNA 2ATLA 2QGFB 4AXJA 4KBIA 1N33K 1IKVB 4DL7A 4PKGA 4EU0A 8ICMA 2D0OA 1SL1A 1TQLA 2RKIA 3UCZP 4IOXA 1Q46A 1RTJB 1UJ6A 4HWIA 3OBYA 4EBCA 2D6FC 1SXEA 8ICPA 3W5YA 5DKWA 2RMLA 4DPTA 2AU0A 3IS9A 2HOFA 5CWRA 5KFRA 2VJ4A 4L6V3 2ITMA 2PN6A 2GVZA 3AVKA 4CFCA 1HMVA 2L9WA 3D1OA 3EJMA 3MGVA 4CLUA 2M8DB 1J2VA 7ICMA 1PYSB 5D4NA 1P9YA 2HF4A 3VGTA 2PAVA 3SCJE 1J5EJ 4QZCA 3DRSB 2RF2A 3P49B 2HVHA 4DTOA 2QLJB 4BDYA 1RM6C 3RAXA 2RH3A 1S72S 4Y2PA 2E9RX 3C6HA 2HK2A 8ICAA 4OKKA 1OH8A 3G82A 1ZBLA 3TX8A 4USMA 2BH1A 3CO9A 2G09A 3I5BA 5ALFA 2KRBA 2I6WA 1DKGD 1T6DA 4NXZA 3CT9A 4J2BA 3KLVA 3D6FB 2WW4A 1M0SA 2UXCK 3US5A 2BCQA 1WSFA 2P51A 4RQ3A 1QSLA 1V5IB 5GADP 1ESVA 2YTUA 3CJAA 2LQJA 3UFCX 1HPMA 1UMJA 2F4FA 2WTUA 2XWXA 4KRWA 4KFBA 3WC0A 2UUBF 4NLZA 3AVAA 5FLXU 4NL9C 2YNFB 1D9FA 4O4GB 3I56N 4ZKAA 3B78A 4EX7A 5HOOA 1ZBTA 2PYLA 2YWFA 3N01A 2ZH4A 1Q82O 4QPTA 2ILZA 2Z58B 3JSMA 3L6QA 4I64A 4AL6A 2ZGZA 1JLGA 2NNWA 5IM0A 4G65A 1J5OA 2KIWA 3VERA 3OR1A 3FZMA 1RTHB 2ZJRL 4QZHA 1S6QA 2RUGA 2R7XA 2VQEK 1PKUA 1RQNA 2BZFA 3EE8A 4I2PB 5K14B 1JLBB 4HDHA 4W90B 2I5JB 1X6IA 2BUPA 4CF9A 2RLTA 4LIRA 2A3JA 1E6YB 5KFGA 2PFNA 4M9LA 5DM6Q 3ILLA 2UVVA 3KJVB 3C95A 2W9CB 1N52B 5LL6d 2M88A 5KG2A 1R6VA 4WFNQ 2O66A 2Q2RA 1X9MA 3MECA 2Q43A 3KLGA 1KCFA 3PMNA 2XS2A 2O8FB 3QNOA 3RTVA 4Y2CA 1Q1KA 3FFIB 2DNKA 5J0YA 2DPIA 3NF7A 1U2VB 2LXUA 4KLIA 2F4VK 2OZSA 3R8YA 4RQ0A 5EGYA 2KRRA 1UW4A 4TURA 4QIGA 3MXIA 3A5OC 4C98A 2HQFA 1H0HB 3A8EA 4WJBA 5C2GA 4KI4A 3SIPB 2X1BA 3RBZA 4ECYA 4OZJA 1S1WB 2BVZA 3UDVA 2V7ZA 2J6TA 2HKEA 4FZZA 3C66A 4OLBA 4QR1A 4PHPA 3H45C 1S9EA 2MJNA 2NS1B 1IJFB 1N5XA 4N41A 1U0HA 3KTQA 4G1IA 4ANDA 1YAGA 5CAAA 2D0BA 3OFFA 5G0RA 1XC9A 3B6OA 2AP1A 3EPGA 2Q0UA 1RBLA 2PKEA 4NOHA 2XO6A 1G1XA 2K06A 1X4DA 3H1QA 1ZBIA 5KFKA 3GFYA 1RDBA 1FDDA 1D4XA 4R0EA 2UUAF 1G7CB 2MRLA 1FK9A 3VAHA 2A40A 5B0EA 2IC3A 2HLUA 4LF4K 4E7IA 3OYIA 1V3SA 3UQ0A 3TAMA 1OSCA 4ZMMA 2ZE2A 3DLLQ 4ZVSB 4B9QA 3HVTA 2KT3A 4X4PA 1JLEB 2YPYA 1OUQA 4G6VB 4BE1A 9ICKA 4JK7A 4C0ZA 1UVKA 3T1YJ 1NRKA 1FE4A 5BYSA 3ZSOA 2QX0A 3QUTA 4JKHA 4F4YA 1DQ9A 4ZPTR 5AZJB 1HWUA 1B3TA 3G8SA 3WK5A 4NLDA 3GR0A 4ECZA 1NZAA 4IO9L 1RT6B 3LZIA 1R7IA 4BWMA 2K3IA 3PRBA 1I5OB 4W5OA 3PX6A 2GVDB 1UW9A 3AJ2A 4ZVPB 1L8OA 2MUTB 1V3ZA 4TUSA 2QIFA 3HOSA 1RDFA 3VHQA 4BRMA 4TY8B 1O6XA 3IG1A 1QAIA 1IV0A 3MPYA 5F3TA 4KHSA 3J80O 4OPAA 3LAKA 2E5LJ 3MM5B 2MEWA 3ZSZA 3BQTA 2XICA 2A3VA 5LMUJ 4NRTA 3OYAA 1WUDA 4IQUA 8ICZA 2KI2A 4RG8A 1HD1A 2L9NA 4B3TF 1QVFR 1BWVA 3I0RA 4JI1J 2PBDA 2WC9A 4FL9A 3HKWA 1RSCA 3AO4A 5CCMA 2VV5A 3AVLA 2EKYA 3FSYA 3H0LB 1UVMA 1ZC6A 2KVSA 5IQ6A 5AKZA 2KKZA 1FNMA 5TISU 2DFLA 4KHPJ 4ED1A 3NL0A 1KVCA 4OHYA 5D4BA 1FVSA 1SUQB 2LQBA 2XIDA 2XM3A 1S22A 2V0NA 4YOEA 7AT1B 3HSZA 4F3QA 2O4IA 4DR6F 4ZIVA 5EUHA 4YOYA 3P39A 4Y1DA 3NGTA 4NEZA 4CIGA 3JPNA 2FSNA 5IQQA 1N48A 4ZVEA 3OUYB 4CO4A 3KUHA 4DF4A 3H5XA 5AQOA 2CG4A 4FZXC 1Y5LB 1X1PA 4A61A 3EY1A 2DGZA 4DS4A 4NLTA 1DQAA 1HKAA 1S12A 4CJKA 2P9UA 1RT2B 1J54A 2DFFA 1JROA 3G4SS 2R7TA 1IVZA 3LM9A 2GJFA 4DFMA 2Z1IA 4PZVA 3MN7A 4IQXA 4ZDNA 3LZJA 4C3LA 4Y2YA 4L75A 5ALVA 4LSNA 1X2IA 4DUTA 3CQXA 1ZQWA 1IKXA 4UB1A 2OKQA 4XA5A 1SC1B 2ITGA 4Z94A 5J1NA 2Z2MA 4BGBA 2B6AB 2J9CA 1C4AA 2ZH7A 3NGDA 2AJQA 4OYWA 1OWXA 5AXLA 3R5BA 5EE3A 2A1JA 1YKWA 4YB7A 1MU2B 4RW6A 1IBLF 3OYMA 4LF6J 1FI4A 2XY8A 3F44A 2ATCB 2A19A 4PUOB 5U47A 2OD4A 4Y28C 1JJHA 4R5PA 1LFPA 4I2HA 1VIOA 1XMOK 1LAWA 3DHWC 1PJ5A 2WF9A 3FR0A 4F92B 1HBNB 1U0SA 3O2IA 1FEHA 5KG4A 3MTKA 3WK8A 5L39A 4M42A 5KFIA 1P6TA 1CVJA 1YTAA 5AQSA 2QLWA 2NRVA 1RQLA 1DRGA 3GZFA 5EE0A 2P35A 2ZH9A 3LPUA 2W9BB 1TKZB 3NGKA 3KXDA 1BA0A 4BR2A 3CF5L 4GRSA 5A0LA 2QA2A 4ZHRB 2WB1C 3D66A 4GKKF 2V8VA 4DX8H 4K4IA 2P6UA 4F02A 3KK1A 1GLAG 2ASDA 5KFPA 2EXUA 3BO2A 2J6UA 1RLDA 3IRUA 5M1NA 1EQYA 1DRZA 3QU7A 4HI2A 2DISA 3PW2A 3WC2A 1I3OB 4CJEA 3T5KA 4AUKA 6FDRA 1LKZA 2J7WA 1QS4A 3IBFB 3AM9A 1RTDA 5F0WA 4KRFA 4JB3A 3NLCA 2CNLB 2W2OP 2VKZG 2ZIXB 1TAQA 4OHWA 2P2CB 1ZXIA 5B5EU 5E26A 5IT9U 2VWBA 3T79A 4RW8B 5J8YA 2VHGA 4AYBD 3K0SA 4H4OB 1Q7LB 4MDBA 3UKUA 4K4YA 1JXVA 2MMYA 3TADA 1C20A 3HZEA 4C23A 3HHEA 2YPZA 1DEJA 4KSEB 3QUQA 3VALA 1LEOA 2IRXA 3MUMP 3QYYA 1WKKA 5KG1A 5IIOA 3A2FA 4OZ5A 4CIOA 3E51A 4GKJJ 1NGEA 3VF2A 3C2LA 4PXDA 1W2BR 4QZAA 4B6JA 4GW6A 1A9NB 5AK5A 4W5TA 1N6QA 3OW2M 2RRDA 5C2CA 2KD1A 4ICLB 2POKA 3I0SB 3KLEA 2ZIVB 4CT8A 4LR8A 3FAHA 4CEQA 6FD1A 2OEHA 3LGMA 3WBZA 4P74A 3MCSA 5D0HA 4F93B 1HWLA 3BQ1A 4Y3CA 3RYLA 4AH9A 1JLCB 4ZH4A 4JI2F 2LVWA 4M5DB 2Q6BA 2WONB 2YNHB 2P9PA 3TUIC 2UXDJ 3B6PA 4NM1A 4KN7A 1SQGA 1QQOA 2R8KA 8ICYA 2HOEA 5DJBA 2ZF5O 3VQ4A 3THYB 4KLLA 1PAUB 1CLQA 1GK8A 5AKIA 4ZITA 1FKPA 3NDKA 3NWRA 4CF3A 4EYHB 1KAZA 4DBQA 2WOMA 2DK2A 1S7IA 4LZDA 2UVUA 4LF8J 3V81A 2YXLA 3HHLA 2JMGA 2FVRA 3T3FA 5AXMA 2DGWA 2ADCA 4L76A 2KH9A 4MK7A 1KDHA 3IRXA 1WF2A 1QHTA 3DKDA 4UOGA 4FK0A 1RDUA 1BG3A 1CLFA 3SPZA 1ZQ1C 5ALEA 2W25A 2E6LA 2Z2ZA 2OO4A 2VPYB 4DR5F 3ZDBA 1T05B 1TL5A 1F3VA 2PA3A 2R42A 5GAGI 3HHLD 3J7ZT 1FO1A 5GIOA 4HTJA 4L3QA 3BREA 3Q22A 5C10A 3IG8A 3CUNA 2ZH1A 1SL2A 4DTPA 1EXNA 4Z4HA 1GX6A 1MDUB 2F77X 3OJUA 4I7FB 3W65A 1WG5A 3O1LA 3S01A 2MZSA 3ZNUA 4YMEA 4BUGA 1HI1A 3JAMU 1S6PA 2HSEB 1YTYA 2PC6A 4HKQA 2W2MP 4QZ8A 1XNRJ 3BV8A 4MT1A 4Z6DA 5HQ8A 1RT5A 4CGJA 1MN7A 2H4WB 1MWMA 2PZSA 4M04A 2KHQA 4I2GA 3L5KA 1HPZA 3M6XA 2EZXA 3SAGA 3TAEA 5IWAK 2BKOA 3BSOA 2ZOMA 2IHR1 3HYFA 3LDPA 3AVFA 4E1JA 3L2VA 2DH9A 4PCQA 4LT6A 2B9EA 4YMNA 1S6OA 3R5DA 4QW8A 5F41A 1X4AA 2P9KA 4MJKA 3W61A 3ETOA 1ICEB 4KX3A 2MKCA 3MAHA 5LY3A 2FDNA 1QSSA 1R89A 1CZAN 2DD8S 4DUZK 4UASA 2VG6A 2B8PA 5IIJA 1UA1A 1RWMB 2DGQA 4C4RA 4CF1A 3KFUF 2QG9B 4DTSA 2O8DA 3W0LA 5DQIA 8ICRA 4DQ8A 2J4RA 3H8WA 5ALMA 2RB7A 4BRIA 2LM1A 4BXOA 4JKEA 4CVNE 3QUBA 5AQIA 2LQ5A 5LMNK 3A13A 1K8KA 5E84A 2ZIWB 3QT6A 5JUMA 4IQVA 1DTTB 4R64A 5L1JA 4TNOA 4B3SJ 3LALA 1HI0P 4NLWA 4JI3J 4YY3J 4DR1F 5E3PA 2ODGA 4WU2A 5AKGA 1LAVA 1JMSA 1XMBA 3ENBA 2NCKL 5L46A 4F4AA 3AGRA 3O9QA 1YZ7A 8ICLA 4DV0F 4R66A 1XMQJ 3S6JA 2GNKA 1VFJA 4BRCA 5CZ2A 2CVIA 2XYHB 5CHGA 2RKIB 3FZBA 3DXBA 4DOZA 4OCZA 3LOUA 4MIBA 5KFBA 4QIWC 1BUXA 4WE1A 1FFVA 2Z1GA 4JI5J 3WXKA 3N7SC 3W5XA 4FZVA 3IS9B 4KB0A 2NR0A 2OZMA 1RAFB 2Y0SD 5BPMA 4J9LA 1V9OA 3C3LA 4OGEA 2MU2A 3PX4A 2W01A 1Q8IA 4ZLNA 1KL9A 4BRLA 1O1WA 1HX1A 3CGIA 4ZS6A 5ADXA 4DPYA 1CS4A 2ZFHA 3OR2B 2UU9F 3WNGA 3CJRA 2CN1A 3K89A 2E1EA 4K2JA 3MN6A 3AVCA 1FRJA 4M94A 4UY8T 2IBKA 8ICEA 2FBTA 4QZBA 5DM6L 1XJWB 5LMUK 2ZBIA 4DI6A 3ZT1A 1ED1A 1KBRA 2ZIUA 2YQ0A 3G82B 3TQ1A 4FWLA 2ABYA 3QFHA 3VEXA 1RTZA 3L3UA 3CJKA 1YHQN 3SAHA 4YEAA 2XGQA 3RBEA 3G6ES 3H5YA 1SJ3P 2MA1A 4XIUA 2RQ5A 2YNIB 1RWUA 3ZTPA 4LVNP 3WXIA 4QYRA 1BCOA 3V1RA 1N36F 1H2VZ 1DGKN 4OYOA 3KLHA 3FZLA 4ZVHA 4O5EA 1RBSA 4Q7AA 2M70A 4UOFA 1DHMA 4TUPA 1NK5A 2LXIA 3QEPA 2HFNA 4WU3A 4KYZA 4RWWA 4LRDA 3H0PA 4BRNA 3SUNA 2PMZF 5KFCA 2W03A 4DOAA 5E3RA 2MSNA 4A62A 1X42A 3IM9A 1I94F 1TR0A 2CPZA 4DQRA 5D6GA 2H3VA 4E19A 1S1UA 3OLBA 1PK1A 1IBMK 2RD5C 5DRKA 2YV0X 4BCAA 1S0OA 9ICTA 2ALYB 4K5SA 3PSIA 1H98A 2QN6B 3KKAA 3QRRA 1EQMA 4Y2XA 3LTOA 4ILLA 3K5OA 5KFOA 2G8WA 3HT3A 1J5OB 2MKYA 1IQTA 4F91B 3Q7CA 4H5NA 2JEGA 4A8MP 5CP2A 2CPDA 4CI6A 4BY9C 2FC8A 1HA1A 1KNZA 1QH9A 3GZ7A 1S6QB 1VRQC 4C0BA 5HK4A 1QVFM 3HI0A 1ZQKA 3BP8A 1NU4A 3RRKA 2YQ3A 1Z19A 3AVBA 4JKAA 5F8MA 3A4TA 4KE5A 3QWPA 2NXJA 4K5RA 2F3JA 3WQUA 1WF0A 1N32J 1YUWA 4JI7K 1RAHB 2AYBA 1QD1A 4A8EA 3DLLL 4CK2A 2E2PA 2KZMA 3H90A 4CGHA 4B3MJ 1YJ9S 2LBOA 5AJ3K 1XHXA 3V7KA 1AT1B 3JPSA 3SFUA 3KLGB 2QKBA 2KG1A 5B0FA 3DLRA 3DLHA 3LM2A 4LQ9A 2FPHX 3DMJB 1YVUA 3PYFA 3FMWA 2AJ2A 2FF3B 3DLEB 3FC9A 4WK3A 3IFEA 4JI8K 3I55N 4FBUA 5GMDA 4CF5A 1RZMA 4O5KA 2F9WA 4ZPWR 1QDUB 3MWTA 3BSAA 2UXBF 1WBBA 1W2IA 2HLTA 1RT7A 2IM3A 2WW8A 1Q86O 4F5QA 1T7PA 5J0PA 3N5FA 2M8HA 1D9AA 1S9EB 4LF1A 1X9SA 3G6YA 2QLXA 1N0UA 3HPHA 4GVLA 1VQ7S 3ISND 2P9CA 4TSXA 3THWA 5IT4A 3RSEA 2OHFA 2BM1A 2X1FA 2E2QA 3L0QA 1XNQF 5I9EB 5ETOA 1ASVA 5BR8K 1JIHA 1FX2A 3ZCMA 4OI4A 1FXRA 1NJYA 5CQGA 1U6FA 1FK9B 4DR7J 3AU6A 3A12A 4C8ZA 2IC3B 3AXKA 4BHQA 1QAJA 1XMOF 1KLNA 3IWNC 5H9EJ 4GXIA 4L73A 3ISZA 5AKHA 2RQKA 1NEEA 4ILGB 4X66F 3R1XA 4A8YA 3BGLA 2OPSA 2B21A 2KTQA 3K5PA 3QJPA 2ZE2B 3CYMA 5DBBA 4NYPA 3KDNA 3P3DA 3HVTB 1ZJNA 3BDPA 2D9OA 3TAGA 7ICVA 2NZCA 1OY8A 4R8UA 1RABB 4RZRA 3ENOA 3C5FA 2FJEB 2XVTA 3BO3A 3M8PB 5FJ4A 1EKEA 2FBYA 4MEYA 4QZDA 1NOMA 4NCGB 5HLFA 4F5PA 4LJXA 4Z37A 5HJXA 3QETA 4FJJA 5J2JA 1MMDA 4RWTA 5IV4A 1AXQA 1W0HA 3FRYA 1RYSA 5DZ6A 1UCNA 3H40A 1S0MA 2DXDA 4OIXA 3T1HJ 1ZBHA 3MR7A 2J0XA 4RNMA 1Z4OA 1URRA 3EZOA 4Y2IA 5K9FA 3VQ8A 2D9PA 5GIPA 4DUYJ 4US8A 1NMDA 1J27A 3FCWA 1ULRA 1DBDA 3F73A 2W7AA 1NDCA 4QAGA 3NCIA 3ZLJA 3IG1B 3QIPB 5LXRA 1NZPA 3DHXA 2EZZA 5I3QA 1U09A 3NS7B 2IJRA 5EOYA 1EETB 1N2XA 3W62A 2QWPA 4I4BA 3NGYA 1MWKA 3NFAA 3ADAC 2HHVA 3F9KA 4F4WA 3ALRA 5F3XB 4E8UA 3H4BA 4EO8A 5D49A 2PT0A 2M9KA 5BN8A 5AIBA 1FJGJ 1VBYA 3C15B 1KQQA 2ZZNA 1QSYA 3EZ5A 5J29A 1TUWA 4P75A 5E0OA 2H3ZA 1YIJS 4RLEA 3DLBA 2UYTA 1W2BM 4NL5A 3THPA 2GCFA 3KKRA 4LRAA 4YDUA 4TQSA 3KMSA 5FPDA 4ZN3A 1HQ2A 3CDAA 1SVDA 3GJRB 4NLBA 4RCHA 4UOHA 2OEJA 5KNIA 2FY8A 4C0OC 4PQUA 3MR5A 4BRDA 3ORYA 1ZQSA 3HULA 1MLAA 1VISA 2KN4A 3W8PA 2P9UB 5ALIA 2DO4A 5DB7A 2QE5A 1VBKA 5FPNA 3W2VA 3HXMA 1YJ9N 2IM0A 1J5EF 4BR0A 1HYSA 2CQDA 3DDIA 3BGFA 4RU9A 4ZCIA 3RRGA 4LH4A 1CJUA 2ATQA 1RHRB 3AU2A 2JLGA 2CGJA 1IKXB 1ZQXA 3GBTA 3VA3A 5ALPA 3RMCA 2NUBA 1RBAA 3L7UA 1BGXT 1LWFB 3HT0A 3RMAA 4CGIA 1DURA 5GMKa 2FZGB 5JS1A 3DC2A 2GUIA 4U8YA 4EBDA 2VWKA 3BYPA 4RW6B 4DU7A 5HMZA 2BDUA 4ZLJA 2Y1JA 4F5RA 4X62K 1F1BB 3HKZD 4R5PB 1C7YA 5ALDA 1WUUA 4FJHA 3H46O 1WKJA 4RT3A 1VQ7N 3CERA 1YTUA 1ZQAA 2AMCB 2RILA 4I2IA 4AF1A 3NE6A 1VQLN 1S59A 7ICPA 1L3KA 2OPRA 3H25A 2QL9B 2UZAA 2YX7A 3QT5A 1RT1B 1JLQA 4HTLA 4G1QA 4BBYA 4WXOA 1GTEA 3IR7B 2IJFA 1ZPWX 4C8YA 1N5QA 2YMMA 3R7BB 2IRUA 1NPKA 3OTOJ 4N8OA 4B3RK 1BE4A 2H3EB 3F2CA 4F4XA 1DQ8A 1VIXA 2BW2A 2HFVA 3HSJA 1DGJA 4DXLA 4WFBQ 4O4RA 4QW9A 2JWKA 3B6BA 3N9UC 4X4VA 1XO0A 2E3TA 2G07A 5CYQA 1NGCA 5L1LA 2W1BA 2BCUA 3FC4A 1PYTA 4KGVB 5EWEA 1CJKA 1RTDB 5J0WA 4KREA 2XB2D 4ISEA 2NXNA 4MKVA 2BUNA 3IKMA 2P9NA 1T3QA 1RHQB 1QUVA 4FM1A 3X3UA 1O03A 4ZVUB 1KRPA 1FF2A 1ECWA 2FGCA 3W5ZA 1PYOB 2P9EA 1X4CA 3W8GA 4DV4K 4EZ9A 2X1AA 2EFVA 1KQFB 2IJNA 2QLBB 3UKUB 1L7PA 5I42A 4DSKA 4CERA 5HSPA 3NEKA 4FWMA 2XC9A 4U95A 2BJ8A 4MKAA 1PIEA 1GXUA 2FHJA 2CAJA 2QEXS 4MH8A 1SS6A 2L48A 1XQSC 2UV8G 1QZ5A 2Q3PA 2ZOGA 5CCLA 1WAJA 3SMVA 3IXQA 1IBCB 1VQPN 5HJYA 3K2YA 1U02A 2I6XA 2DTJA 4CZCA 4WF9Q 4CFAA 3MDQA 2K8BB 3O08A 1VSIA 4CJ5A 1N6QB 4LF5K 4DV1J 5CB1A 3O3LA 1F3FA 3CCMS 3Q2SC 3VC8A 3O8MA 1XS9D 3KLEB 3KD5E 3VQDA 1P8GA 4ID1A 2FHJD 1BCMA 2HNDA 2FYXA 3MUTP 3NG8A 4RPZA 2RIJA 3DU6A 1FRMA 1SQKA 4JAXA 4WFAQ 3TP2A 1ACMB 2WB4A 4G9ZA 4XUSA 5BOLA 1NPRA 1RHKB 2OPQB 2PXIA 3RBXA 4DN0A 2W9AA 3JSBA 3HO1A 3KJFB 5HRPA 3RR7A 2KNJA 1NDKA 2V67A 2P9PB 4J2AA 5FPEA 4Y00A 1ZQZA 2FQQB 3QEBZ 3EX7B 3MMAA 2D74B 3L2QA 1MQ3A 4RPFA 4N8NA 3N5BA 1RXVA 9ICGA 3O5BA 2CWXA 1LVHA 1IBKJ 3D6JA 4DV5K 2MJUA 3LP0B 2ZITA 4DR2K 3F5TA 4RBVA 1FKPB 2F2AB 4P7VA 4P2MA 3SDEA 1IH7A 1YJNS 2BJ9A 2WOMB 3EDRB 3L7PA 1ELOA 1K1SA 2AYMA 3M2RA 4LJMA 3RVCA 4K4WA 3AODA 3T1YF 2CA9A 2C2OB 4CEEA 3NWGA 4JV2A 2YTCA 3UE2A 4Y2UA 3PR5B 4DFKA 2YKNA 3CFRA 5CZ1A 4DV3J 2BOPA 4GXJA 3O4WA 1KS2A 3MFHA 3N6MA 3IP0A 1VDHA 1S3XA 2HZCA 2HF3A 4DQIA 4CZJA 4J8FA 2ZGYA 5J0QA 5DQHA 2EWSA 8ICOA 4O5CA 3HWTA 4HUEA 4C8OA 1QQ6A 2G5IB 5D0GA 1C0TB 2E5LF 4TN2A 4H5TA 2E8PA 2V2QA 1IM6A 3QGPA 4MYTA 5AQRA 5B0CA 5LMUF 4M3UA 5GAHU 1NHUA 4F0MA 5GINA 1ZQOA 2GOLA 2GO7A 8RUCA 3VAKA 3L8BA 4LF7K 3D6MB 2YJEA 2W9MA 4JI1F 5JU5A 2XMAA 1Q7YT 1B99A 2AJFE 5ALSA 2EFPA 3Q8YA 2E5GA 1D1UA 4ED3A 2OHDA 5DMRA 5SUHA 4F3MA 4JI0K 7ICGA 4YVZA 3C29A 4QZEA 3DNCA 4KHPF 3BGOP 3UE5A 2YY3A 4EUVA 4BRFA 2G8VA 3F2BA 4U6PA 2K1RB 1HPZB 4AL5A 3GV8B 3UPFA 3T5HA 4P2FA 1GO3F 5JMNA 4EFHA 4Q0BA 1FTRA 1I51B 2MY8A 1D8BA 3OY9A 4PABA 4BG8A 1RBRA 1ASWA 4IFEA 3VA0A 3R9KA 3RJMB 2GWKA 5KTQA 4LF2A 1UQVA 2DITA 2P9KB 3D68A 4X4QA 3VQTA 3U8XA 2FF6A 9ICUA 2B56A 2ZJQQ 4FXWA 1HR0K 4EEYA 3POTA 2KVCA 3QRQA 5B66U 5CRXA 9ICLA 2VG6B 3TVKA 1RWXB 1ZQCA 3GWCA 4KMOB 1TU0B 5J0OA 1ZQTA 2GV1A 2F8TA 1VQ9N 4QWDA 2FJAB 5AM5A 4DL4A 2BBEA 4I27A 4WP9A 3HMJG 4ALZA 1K8KB 3D0GE 4LF6F 1KKXA 4YB5A 2IGIA 3L95X 5KFZA 1YJ7A 1YSJA 5IFMA 1FRLA 1K6YA 3SBMA 2EANA 5HN0A 3QPIA 1NB2A 1KVBA 3RJHA 8ICSA 1VQSA 4I56A 3B9JA 3OHBA 4OJRA 4B17A 1HNWJ 3B82A 1YT3A 1XTZA 3PJWA 1XC3A 4I2QA 1RWKB 3ELHA 4KIAA 2RJZA 4F4ZA 2MQNA 3IGVA 2QO3A 4UZBA 1CRXA 4A8SA 4C7YA 2GC8A 2VA3A 3GYGA 3UWTA 1CQMA 3FZHA 1FJ7A 1SV4A 4O8KA 4A5AA 4ILJA 1RQ0A 1M6YA 3TABA 1MWYA 5DDQC 1DXSA 3NRBA 3AHPA 5B08A 3O0FA 2CADA 1S97A 3GJSB 4M3RA 2OFHX 1DJ0A 3ENAA 1G99A 2WB1F 1TAUA 1RCHA 2DXEA 3HZGA 3SQ0A 5AKJA 2OUGA 1XWLA 3J7YI 2DYAA 4JK8A 4DUYK 4XK8C 4C11B 1CS4B 4FWNA 1RHMB 2LP4A 2JWLA 2JVRA 2OJ3A 4OV6A 4NLSA 2JGAA 3D1HA 3J81j 4OZ2A 4YP3A 2IBOA 2ZUAA 2E2OA 3HFZB 4B9LA 2EFOA 3MEKA 2LQ8A 2UVWA 2G8FA 2QKKA 3HVRA 1CZBA 3SI6A 2KXFA 1BPBA 1LV5A 4IG3B 1QHAA 4QNLA 3UXOA 2EAMA 1AFIA 1IXKA 4JOUA 3O5TB 2GHVC 2XI9A 4LF9J 5JVHQ 2D41A 1ZQUA 3BB5A 1WG1A 5HRNA 3LGHA 3DAWA 2W2NP 3TTDA 3CCUS 3BZQA