2HHUA

C:o6-methyl-guanine in the polymerase postinsertion site (-1 basepair position)
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
580
structure length
580
Chain Sequence
b'KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*CP*C)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 216
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhuA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhuA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhuA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhuA01
9ICOA 3ITHA 4KKOA 4FJ7A 2J6UA 3O4NA 4LZDA 4UB2A 4J9PA 1KLMA 4Z6DA 4KLDA 1ZYQA 1AROP 3DLBA 4GMJB 3MFIA 4HUGA 4UB4A 3T5KA 3ZSOA 1U47A 1ITGA 1VSMA 4YMOA 4F5RA 3QETA 1RBSA 5J2IA 1ZQUA 2YNIA 4CEQA 4YCXA 1BPZA 4FJMA 3JPNA 1QTMA 5HRRA 3BDPA 2RN2A 1JLGA 2X78A 2BKEA 3KK1A 1BL3A 3MAQA 4DL3A 3DLKA 8ICUA 4O3PA 3H8SA 2IHMA 2DPIA 1C1CA 1DTTA 1VSKA 5DQGA 3L3VA 3ZT0A 4RQ8A 3RJEA 2HNDA 4O9MA 2FBTA 4KN4A 4BE1A 4FM1A 7ICNA 2ZUDA 4I2BA 3Q8KA 4NXZA 4E3SA 3RB4A 3Q8QB 5KFBA 3RBDA 4RZRA 3C6UA 4QZGA 2X74A 2PFQA 1TV6A 1UT5A 1TFRA 1BIUA 4ED3A 4XQ8A 3S3NA 2PZSA 4FJGA 1HQUA 2ISOA 4R66A 4RQ6A 1R0AA 2OPQA 3HVRA 3PW0A 2Z1IA 3HM9A 3CM6A 3O3GA 9ICPA 7ICEA 1Z00B 1SKSA 1KDHA 4QZHA 1KSPA 9ICMA 4AILC 1EXNA 2ZTCA 2YHBA 4TQSA 2ASLA 5E41A 2GWSA 3UPQA 4E7LA 5J2QA 3AVLA 4CJRA 2X6SA 2P6RA 5HP1A 4DOCA 4CEAA 4DTPA 1SKWA 4DF4A 3IG1A 1IH7A 4RG8A 4F4ZA 4E1NA 1B9DA 4LH5A 4W5QA 4FLZA 1RNHA 4TUSA 2PY5A 3AVKA 2HNYA 3ZCMA 7ICSA 2R8JA 4DOBA 4F4KA 4FXDA 1RBRA 5KFYA 5J2NA 5KFQA 5J2AA 4NM1A 4H4OA 3EPGA 4LVSA 5KFSA 4C8MA 4F5QA 4HTUA 1BPBA 3OYMA 4QCLA 4OLBA 2BCVA 4ECQA 4YP3A 1U45A 1U4BA 2BCUA 4DL7A 2FBYA 3G6XA 3VQDA 1A5VA 4ELUA 4I2CA 4MEXA 3AVJA 1TV9A 4RW7A 2BPFA 4B9TA 1KTQA 5J0QA 3MDAA 4KMUA 2VANA 5KRTA 1ZQQA 5EWGA 4QWEA 4FBUA 4CHNA 3OS2A 7ICOA 8ICVA 5BOMA 1BI4A 2KW4A 2QXFA 4OVLA 8ICCA 4K4HA 5J2CA 4M6WB 2DFEA 3V1RA 4DFMA 3DYAA 5L1KA 1RTDA 5BOLA 3RB6A 3VQ8A 3GDXA 3CFOA 4Z0UA 3QEXA 1VRTA 1S6QA 3FYHA 2XY5A 4PGXA 4KREA 3CYMA 1ZQHA 2W9AA 3OYBA 4ECXA 5DGAA 1K6YA 4KHSA 4DLGA 1TKXA 2KZ3A 4M45A 1DGSA 5KFZA 1TAUA 1ZQPA 4I2DA 3O3FA 3V81A 3DMJA 1WLJA 3RMBA 5CB1A 4M04A 4MQ3A 1XI1A 4F92B 3SQ4A 5DB9A 4MFCA 4FJ9A 4YXMA 4DTRA 3HP9A 5J0YA 5DGBA 4YR3A 7ICJA 3LAKA 4LZGA 4RNNA 8ICGA 3SZ2A 4M3WA 4QW8A 2DTUA 4YD2A 3KK2A 3DRRA 2HVIA 4FW1A 3AVIA 3OYCA 1C0TA 4OLAA 4GLXA 3ISNC 1T3NA 4NLGA 3KKRA 3VQ4A 1JKHA 1WSEA 3B6OA 1UA0A 3QO9A 4C8KA 3MEDA 5J2PA 3DOLA 5CYMA 1VRUA 4Z4GA 1NKCA 4LD0A 4DU3A 3HL8A 4PHEA 3EWAA 3RWUA 3ZDCA 3AO4A 4F4XA 1TL1A 4FZZA 2IGIA 3AA3A 2B21A 1ZQJA 4ECSA 3EY1A 1XSLA 1VSEA 5KT2A 2JZBA 2ETJA 4KLEA 4HVJA 3PX4A 3LPUA 3GQCA 3KKSA 3GILA 2BCSA 4FLUA 1ZQKA 4PHAA 4N56A 2OYQA 5HROA 3LAMA 4E0DA 3ZT4A 2BQ3A 2HHTA 9ICVA 1KFSA 4ZTFA 8ICZA 4FJNA 2VWKA 5DB6A 1UOCA 2KZMA 5J2KA 2HHWA 2NUBA 4CFDA 3SYZA 3GV7B 5CHGA 5KFLA 5T7BA 3PX6A 3SUOA 4QZBA 3NGZA 4CIFA 1L5UA 5DQHA 4CEFA 5KFDA 4CJ3A 3H40A 1S1UA 1HNIA 3LALA 8ICOA 1ZBHA 4RU9A 1XHXA 2EX3A 3M8PA 4YR0A 4J9OA 1IM4A 8ICHA 5DB7A 3RB3A 3SPYA 4ECWA 4ED8A 2PFOA 7ICFA 1JXLA 4DF8A 9ICNA 3OSNA 3GV5B 1RT3A 4F50A 3ULDA 2YKNA 5HHHA 2J6TA 1LW0A 3I8DA 4CHZA 3U6FA 2FLLA 8ICSA 4F5OA 4ZTJA 4ECTA 3TARA 1RDCA 2PI4A 8ICTA 1XO1A 3L2WA 4YN4A 9ICSA 2BGWA 9ICCA 4FLXA 4AHVA 1LB2B 5SWMA 1HUOA 2V4RA 3G0ZA 5DLFA 5IIJA 4M42A 1L3UA 4KTZA 3AA4A 1RBTA 3GFKB 4BDYA 7ICLA 4F4WA 4FS1A 1WSJA 3AVMA 5J0TA 3MXMA 1S0NA 3LP3A 4I2JA 1S0OA 1LAWA 1RDAA 1L3VA 2AU0A 3K5OA 3S9HA 1NOMA 1C1AA 2HHQA 1ZQMA 3C21A 1DOQA 1RCHA 4AHTA 4KHYA 1BCOA 4OGEA 1XC9A 2JEGA 3OYDA 5KFWA 2P51A 3MDCA 1RYSA 1VSJA 1BHLA 3V1OA 2H5XA 1NJWA 4RQ0A 4NLZA 9ICFA 1JLFA 2V4QA 1GOBA 5IILA 2YNGA 3LK9A 4FK2A 4E1MA 4TURA 2RDIA 1XWLA 2OZMA 9ICRA 3G10A 4OKEA 5C42A 2G8VA 3WNGA 2KZZA 4CHQA 4CCHA 2YV0X 4GXKA 5KG2A 2UVUA 4BGDA 1JXEA 1WSIA 4YR2A 2JLEA 1B9FA 2BR0A 1ZQEA 4F3OA 5KT6A 4UAZA 4KAZA 4B8AB 3LP1A 3LP0A 3BQ1A 1C6VA 5DBCA 5DB8A 2HHUA 3AVCA 4OKJA 1ASUA 5C24A 4MEYA 9ICQA 4DSJA 1JMSA 4YNQA 2NRVA 1U04A 4ZHRA 3B0YA 3ISCA 3MABA 5K14A 3NF7A 4CJLA 4DLEA 2BANA 3OYEA 4RW8A 3QEIA 1WSHA 3GV8B 3OS1A 1MC8A 3O3HA 1TVRA 1CZ9A 3V6HA 4FCYA 7ICKA 3E01A 5CWRA 2RKIA 1HRHA 3OYFA 3TFSA 3RMCA 4JWNA 3NTUA 4CF0A 3C95A 4BDPA 1LWFA 4RPXA 1SL1A 1H38A 2XHBA 4KITB 4FJHA 2I9GA 5HNKA 4DSIA 9ICLA 1HQEA 2F8SA 1ZQGA 3D0PA 1ZQWA 4FZYA 4DO9A 5J2GA 1HUZA 4CGFA 5KG6A 2ZTDA 1ZQZA 4R8UA 5JS1A 3MEEA 3NF9A 4OKKA 3LDAA 3DLRA 5HMLA 1ZJNA 3PV8A 1UA1A 3V72A 9ICKA 1LAVA 1JLCA 3A2FA 4J2DA 2R8GA 1I39A 4Q5VA 3K57A 1T05A 4B9LA 3UXPA 2FMQA 2VA3A 3Q8PB 2J6SA 5J0UA 2DFLA 3RRHA 4TUQA 4N41A 4R5PA 5KFFA 5J0XA 3B6PA 2RF2A 3HO1A 5HBMA 1NK4A 4DSLA 4FVMA 3ZSZA 2IBKA 3HP6A 4N76A 3LWLA 2UVRA 4DFJA 1ASVA 3K5LA 4F5PA 3VQBA 1U48A 4CJUA 4J9LA 1SL0A 4N5SA 2B4JA 1C7YA 1VK0A 3JYTA 1S9FA 3OS0A 5IINA 4O0JA 3UXOA 4H4MA 2XCAA 4BXOB 4ECZA 2XGQA 2ASDA 4Q45A 3AO5A 4PY5A 2OPSA 4BWMA 1RT7A 3K5MA 1L3SA 1QSYA 3UIQA 1RTHA 1Y97A 4G1QA 1TK8A 3DLGA 4FO6A 5J2BA 5L9XA 3C2KA 4CHYA 3H4DA 3RR8A 8ICBA 5IIIA 3OHAA 3NCIA 5KRSA 5KI6A 4KLFA 3PO4A 1IG9A 2JEFA 2G8FA 2PFNA 2HNZA 5IIOA 4IKFA 4UB3A 4DL5A 3Q8RB 2HMIA 3NDKA 2ISPA 4Q8FA 1IO2A 4KLUA 3KLIA 5HMMA 4PGQA 4CGHA 4XUSA 4FJXA 4CK2A 4UQGA 3UQ0A 2XCPA 1C0MA 3PW5A 3C94A 1S76D 4OPKA 1TK0A 5EOZA 3HYFA 2YHAA 5SZTA 1X9SA 5D4BA 7ICIA 1CZBA 3AVNA 1ZQNA 3KLFA 2A1RA 5FRNA 2KQ2A 1BISA 2B5JA 2IAJA 5JS2A 4Y1CA 4Z4EA 4RW4A 9ICGA 3QEPA 4G3IA 4NCBA 1NK6A 2W9CB 4B9NA 1NK0A 2OZSA 2ASJA 4CFBA 3SQ0A 4CGJA 1QSSA 8ICNA 1G15A 4UB1A 1D8LA 4JV1A 4TSXA 4QZCA 4AH9A 1SV5A 1JLQA 3ISBA 1BPXA 1RDBA 2G8IA 3MXIA 1MU2A 1C1BA 5DK5A 3HXMA 4NLKA 2C2DA 4CGIA 8ICFA 5J2JA 4I9QA 4KB0A 3DLEA 4LSNA 4KLIA 3AUOA 4KTQA 4EEYA 3PMNA 4M9NA 4CJSA 2VG7A 5IIKA 5CZ2A 1SZPA 1ZBIA 4FM2A 3SI8A 3RTVA 2IMWP 3JPOA 2FBVA 1DTQA 4C8LA 3QERA 4CJEA 3H8JA 3IAYA 4DTJA 1WSGA 2W9BB 4CF1A 1BCMA 3QEVA 4RQ2A 2PYLA 4CEEA 4DU4A 4I2IA 4Q43A 4F5NA 3BJYA 2PYJA 2D0AA 2RDJA 3F73A 1A76A 4XIUA 4QZEA 3JPTA 2LSNA 8ICMA 4J2EA 4CIEA 1ZQDA 1KRPA 4M9LA 2C28A 3TANA 4M3TA 3KIOA 3K58A 3QZ8A 4DQSA 7ICHA 4YFKA 3V6DA 4IBNA 1ZQAA 3KJVA 4M3XA 1TGOA 4GXIA 4BDZA 2JGUA 3M8RA 4O5CA 4KLSA 3TABA 4I2HA 4QZDA 3NBPA 3VQ9A 3TAGA 4Z4IA 1HYVA 4M3UA 4YG2A 3JPRA 3H7IA 1Z25A 5CP2A 3T5HA 3PMLA 3RH5A 3MGIA 3V6JA 3BGRA 1Q9YA 7ICPA 3HSTB 3L2QA 4DSKA 1KVCA 3L3UA 4IR1A 1TAQA 1RT2A 2ZE2A 1TKDA 3BQ2A 4B9MA 4B9SA 3AVFA 3V9WA 4UAYA 1WNSA 5KGWA 3G6YA 2PFPA 1A77A 4NYNA 3QEAZ 3WNHA 3SUQA 1JL1A 4RQ7A 2G8WA 4KLQA 1IKVA 2P5GA 1JX4A 4DTMA 2HHXA 3TI0A 4EZ9A 4NLNA 4O3RA 1LWEA 1RBVA 4UAWA 4YVZA 2ZQBA 3IRXA 5TZVA 3MGHA 3C5FA 4GC7A 1ZQSA 7ICUA 1S1XA 2KN7A 5EWFA 3MECA 2BHNA 3PNCA 4EZ6A 5HRNA 2YNHA 3L8BA 2AQ4A 4M3YA 3ASMA 3V9UA 4M9GA 4ID1A 4W5RA 4ECYA 4F8RA 1BPYA 2C22A 2ITGA 3THVA 1K1QA 4UB5A 4I2FA 1KCFA 4B3OA 2NRXA 3SQ2A 4R63A 4FZXC 4N47A 1CXUA 5FDLA 4QW9A 2KFZA 3VQ6A 4P4MA 4MF2A 5J2FA 2HVHA 3MR6A 5L1LA 4FLTA 3U3GA 3KK3A 3LDSA 1XSNA 2P6UA 3KTQA 8ICXA 3KD5E 4L8RB 3QIOA 3H08A 5KFRA 1RXVA 4FLYA 5KFOA 2FPLA 5CA7A 1MQ2A 2G8HA 1LW2A 9ICXA 3VN5A 3RR7A 1V9PA 2A1SA 4YXJA 4IDKA 4YD1A 3OYIA 1FKOA 3GIJA 4QZAA 4HCBA 5DG7A 1BPDA 4O3SA 4I28A 3TAMA 3IM1A 5KT7A 1T4GA 4AHRA 3CQ8A 2OWOA 3QINA 3DI6A 3RJGA 5F9NA 3PVXA 5KFCA 1L3TA 3AO3A 5KFIA 3C2MA 4DL6A 2G8KA 4J9SA 4OJRA 3NAEA 3CM5A 3O4QA 3SPZA 4RQ1A 3RJFA 5KFGA 1KVAA 5EWEA 2W8KA 4KI4A 4DG1A 1ZQYA 3DOKA 1Z26A 4J9RA 2I1QA 1N6QA 2F8TA 1X9WA 3T3FA 2F1HA 3LANA 9ICWA 4IQVA 3RH6A 3VA3A 2IS3A 1N48A 1BIZA 4I2GA 4UBBA 2FC0A 4QWBA 1KFTA 1QLNA 5KG4A 3N4MB 4CHPA 2WONA 4CFAA 4DS5A 4KLJA 2XRIA 4Z6FA 4BE0A 4FM0A 1JIHA 3CFRA 2JEIA 3CG7A 3ALYA 2V9WA 3ZSQA 1QQCA 1YT3A 3SUPA 3TR8A 4W5OA 9ICBA 9ICAA 3QLHA 4DTUA 2D5RA 3OYNA 5DKWA 4M9HA 2P66A 3RMDA 3RMAA 4FJ8A 3QNOA 5HHIA 4RPYA 4EYIB 4O55A 1XHZA 4GVMA 3AU6A 4QAGA 4IRDA 5KG5A 4M47A 3NGDA 4M0AA 1VSFA 3CFPA 3MR5A 1Z00A 4QWCA 3V7JA 1WCNA 3KLGA 5CZ1A 3HT3A 1JN3A 3L2UA 3ZT2A 3NHGA 1WAFA 4UBCA 1DLOA 3C2LA 4HYKA 2FPMA 2W9CA 2BDPA 4RW6A 3QNNA 1U49A 4DQIA 2ALZA 2MUTB 2R8HA 1B22A 2R8KA 4DTXA 2OPRA 4FBTA 3RB0A 4IR9A 4E89A 3QZ7A 1NJXA 2Y1JA 5DLGA 1S97A 1HYSA 8ICAA 2QKKA 3T1AA 5I42A 2PXIA 3RH4A 3V4IA 3M8SA 1YTUA 4PUOA 4ED0A 3ZDBA 1BVSA 4O5KA 4I27A 4C8NA 7ICRA 9ICIA 4Y1DA 2BE2A 4QWAA 3I0RA 2MAXA 1ZBLA 8ICPA 2LYHA 5FRMA 3LZIA 4RNOA 4KLHA 3KHGA 1QE1A 4LH4A 2X6NA 3P5JA 3VQQA 4GC6A 3MXJA 2O4IA 4CF8A 4EBCA 3KD1E 3AO2A 4IFVA 3N97B 4KPYA 3HPGA 4I2QA 1NKEA 2Z1JA 4O3QA 4CEZA 5HRSA 4ELVA 4CJWA 1EETA 5J0RA 4KHNA 5KFUA 4J2BA 5JUMA 3VQEA 1Z3EB 2GUIA 3RAQA 4HHTA 1J9AA 4M3ZA 2ZJAA 4XRHA 2EHGA 3U3YA 4M6WA 4AHSA 4ZH4A 1TK5A 3QE9Y 9ICHA 3AV9A 3PUFA 4CERA 1UWBA 2F1IA 5L1IA 2OPPA 4B9VA 5DBBA 2ZJ8A 4NYFA 3H4BA 4CFCA 5J0OA 4ED1A 4Q8EA 4ID5A 3BQ0A 4DS4A 5KFMA 4IG0A 4IG3A 1ZQOA 3L2RA 1WN7A 1ZQTA 4JK1A 4C8OA 4PPXA 4B08A 1S9GA 4DQQA 3DLHA 4RUCA 4I9LA 4ED7A 1C0UA 1RZTA 3S3OA 4E19A 4MFFA 2WTFA 2ATQA 2DPJA 4CK1A 8ICRA 3M9MB 4KHQA 4F93B 4DOAA 2G8UA 4YMNA 8ICLA 3ISDA 4DL4A 5KFTA 2IDOA 4DSEA 5J2MA 2AGPA 5D46A 4F91B 4FLWA 4TUPA 2UVVA 4JS4A 2D0BA 2Q0ZX 5D3GA 4NCGA 3PY8A 1D8YA 3SCXA 9ICUA 4ICLA 5DDYA 4O3OA 4RQ3A 8ICKA 1BQMA 4QZFA 4ECVA 1NJZA 4BE2A 1B92A 3WNEA 5DQIA 1S1TA 4DEZA 3OYHA 2A1JB 4RQ5A 2M9NA 3KHHA 1XU4A 4F3TA 1JLAA 4FS2A 3TAEA 1RTJA 1NKBA 4B9UA 4M9JA 4QZIA 4PHPA 1VSHA 4PA1A 3K59A 1NJYA 2VG5A 3NGYA 2F1JA 1ZQCA 1IKXA 3ZDAA 5EU7A 4O3NA 1MSWD 4HCCA 1CLQA 3GIMA 3Q8LA 1S6PA 1LV5A 2FMSA 1ZQRA 1ZBUA 3HJFA 1Y88A 3ZDDA 4Z4HA 5DDMA 1X1PA 3SV4A 4CECA 1WAJA 4DWIA 2ZJ5A 3QEBZ 2E6LA 1RT5A 4EBDA 3AVHA 4CGGA 4KHWA 5HLFA 2XO7A 2IOCA 5KG3A 5KFKA 4Z6CA 4FLVA 2NRWA 3SI6A 2KFNA 1ZQFA 3ZD9A 4MFAA 4O0IA 2ZUBA 7ICQA 5KFVA 5KG1A 3G6VA 1UAXA 5KGXA 3NH1A 1NOYA 1ZQXA 4J2AA 3P83D 5KG7A 4JS5A 4EYHB 5IIMA 4DTOA 3PW2A 4E7HA 3MR2A 3RJIA 3SV3A 3JPPA 1ZQLA 1W9HA 3C5GA 1ZETA 4KLGA 3HW8A 4YQWA 4J9MA 5CYQA 3TAQA 1ZBFA 2FLPA 1JL2A 3B0XA 4CJFA 4NY8A 2YKMA 4CEDA 4H8KA 2W8LA 3EZ5A 4K4IA 4MF8A 4Z4CA 1A5WA 1N56A 5KFAA 3OHBA 4P2HA 4I2AA 3RRGA 1NK9A 1NK7A 4O4GA 2BPCA 2I5JA 2C2EA 1S1WA 3V1QA 2ZTEA 3QESA 4FJLA 3QIPA 4B8CA 1SKRA 1NOZA 1YVUA 1WCLA 3EW9A 1VSLA 2VA2A 5FROA 3HX0A 2VG6A 4PGYA 4DQRA 5HP4A 1S9EA 3FFIA 4IFYA 4KLLA 3C23A 1T8EA 3MR3A 7ICMA 5HRPA 4KN7A 1HJPA 4CF2A 3NF8A 5J29A 1HPZA 3OYAA 2ZUCA 4W5NA 4QOZB 3HPOA 4DQPA 2XY6A 4CJPA 4O5BA 2ZD1A 5KG0A 4JUZA 3E2EA 4KLOA 1N5YA 4CEOA 5C25A 1RBUA 4ED2A 4GXJA 1CUKA 1GOCA 4LSLA 1VSIA 5CR0A 1BGXT 3JSMA 1T03A 3TQ1A 4PWDA 2W42A 2UVWA 3T5JA 4FK0A 1F21A 3VQCA 4KFBA 3M9NB 3ZD8A 4K4GA 2KTQA 4RUAA 4CJKA 3SNNA 3V7LA 3OSPA 4IQWA 3LWMA 4DMNA 1FKPA 1S0VA 4F2RA 5CJ7A 4R65A 5J2EA 2Z1HA 1NK5A 4R8UB 1RILA 3AVAA 2BCQA 3LP2A 1SUQA 4K8XA 4J9KA 2QKBA 5CY4A 3C1YA 4RNMA 2MUTA 5BPCA 4IRCA 2IC3A 4ELTA 3NGIA 5KFJA 3UXNA 3M9OB 4IQTA 4E7IA 1TKTA 4CE9A 4NCAA 2F96A 4CJTA 1Q9XA 4R64A 3PO5A 3NH0A 1ZQVA 2XY8A 4MFBA 1S77D 2DY4A 1XS9D 1S1VA 1HNVA 3T5LA 4KTWA 4KRFA 4BACA 3D45A 3H8WA 1TL3A 4EBEA 5KFHA 3Q8MA 3HPHA 3WNFA 2PI5A 3SUNA 2NRTA 3VQAA 4CJQA 5C5JA 3P1GA 2HB5A 1RT4A 1ASWA 3PR4A 4OPJA 2XGPA 1S0MA 3ZSVA 5I3UA 3ZSXA 1IKWA 4Z6EA 4ECRA 4FJJA 3OY9A 5KT5A 4YMMA 2D0CA 3C1ZA 4RW9A 1ZJMA 5DG8A 3V9SA 5J2HA 4FW2A 3I0SA 2P5OA 1QHTA 3NH2A 3OJSA 4X5VA 5J0SA 5J0PA 4WE1A 3NFAA 3ZSYA 3T19A 7ICTA 4CGDA 2R8IA 1CEZA 1IXRA 1ZQIA 4KO0A 5DMRA 4CEBA 1B43A 2HW3A 4Z4FA 4JRQA 4IRKA 4KLTA 3LZJA 1VSDA 4XA5A 3ZSRA 9ICEA 1K1SA 3SJJA 4J9QA 3TAFA 1LWCA 4I2PA 4CK3A 5DBAA 1YTAA 3NE6A 1RXWA 2B6AA 4E7JA 3ZSWA 4Q0BA 3L2VA 2WOMA 3KLEA 1JLEA 2E4LA 2C2RA 4JV2A 3HVTA 4P4OA 5D49A 1FK9A 4M3RA 3HK2A 2XC9A 3DM2A 3OGUA 5L1JA 3KHRA 4QWDA 9ICTA 2FPKA 3PW4A 2VWJA 3PW7A 4K8ZA 5KFNA 4DFPA 4OGCA 2RPIA 1W0HA 5KFEA 4CJ4A 5KFPA 2ATLA 3PR5B 3EYZA 3RAXA 2HHVA 8ICEA 4FJ5A 1WSFA 1KFDA 4BXOA 1XSPA 5J0WA 3DRSA 1BPEA 2P1JA 3K5NA 3ZDEA 3K75D 4PHDA 3SQ1A 1S5JA 1J54A 1EX4A 2A1JA 1JXBA 3GIIA 3AU2A 3KLHA 4RT2A 4J9NA 1REVA 1EP4A 2FBXA 1EXQA 4E7KA 1X9MA 3BQTA 4W5TA 4QZ9A 4PH5A 4I7FA 4JLHA 4DTNA 3JPSA 3LPTA 3ZT1A 2JEJA 4O44A 4CESA 4CF9A 9ICJA 1BI4B 3DRPA 4F4YA 3RJHA 4AHUA 3ORYA 3Q8SB 3V6KA 2OA8A 4AHCA 4YFUA 1HMVA 3KHLA 3PX0A 3UQ2A 2BQRA 1RT6A 3GIKA 4P4PA 2Q3SA 1ZQBA 4PQUA 4CIGA 4FYDA 1TVAA 4CJVA 4ED6A 8ICJA 3RJKA 3K4GA 1RTIA 1A5XA 2IA6A 4KI6A 4FJIA 4JV0A 4I2EA 4JWMA 4EP4A 1COOA 5KFXA 1RDDA 4M2YA 7ICGA 8ICIA 2FMPA 4DU1A 2BCRA 2O4GA 1SL2A 2W9MA 4DL2A 1I3AA 3V9ZA 1U9LA 1QS4A 4RQ4A 3HWTA 1UT8A 2DFHA 4KB1A 3RJJA 2GV9A 3F9KA 4Q44A 3QEWA 3AVGA 1Q8IA 2XY7A 3OVNA 1GOAA 3C6TA 4EP5A 3MBYA 1RYRA 1PZNA 4RPZA 3MFHA 3AA2A 4JRPA 4GW6A 2W9BA 4DFKA 3TAPA 3FDSA 2VA8A 2AGOA 1S10A 1QSLA 1BQNA 1RPLA 5KT3A 3V9XA 3V7KA 3TFRA 3M8QA 4ECUA 4M41A 5J1EA 3K2PA 4DTSA 4RT3A 2Z1GA 3OYKA 1FXXA 1J53A 1KEJA 4HUEA 4CHOA 4DSFA 1X2IA 2HHSA 3VA0A 3IS9A 3IHQB 3AA5X 3EPIA 2NRZA 3OYLA 1IKYA 3AVBA 2JZBB 1KVBA 4I29A 2AGQA 5KT4A 3ETLA 4IQUA 4KV8A 4NM2A 5DG9A 4LY7A 1D9FA 4KLMA 4TQRA 3RBEA 1D9DA 2FLNA 2IHNA 1D5AA 1RT1A 1JLBA 2BPGA 3JPQA 5F9LA 3VQ7A 3OYGA 1MQ3A 2AJQA 1EKEA 3MEGA 3OYJA 3VQPA 2E6MA 1J5OA 1KLNA 2YNFA 2GBZA 2QK9A 4FJKA 1T7PA 4F2SA 1CXQA 4CJ5A 2BGGA 4KHUA 2Y1IA 3VQ5A 4BWJA 3AO1A 2AQ0A 5KTQA 1HYZA 4FK4A 4HUFA 5J2DA 3S3MA 2R7YA 1TKZA 1NK8A 8ICWA 3TWHA 3OJUA 7ICVA 3NF6A 2DFFA 2BQUA 8ICYA 3ZT3A 4O5EA 4QZ8A 8ICQA 1HJRA 1O1WA
chains in the Genus database with same CATH superfamily
9ICOA 3SENA 5GAHI 3ZEUA 1L8LA 1S4EA 2YKNB 3O4NA 4ZJQA 3NGRA 2CQPA 3KMQA 2VOPA 1AROP 2V34A 1WDTA 3DLBA 3SQGA 2RUGA 1L7OA 1KW4A 4Y00A 3T79A 1U47A 4F5RA 1VQON 5ELZA 5AKEA 2YHXA 2DNGA 2LXIA 5HRRA 2CPZA 2I9SA 2X78A 1M90O 1BL3A 5E3AA 4AXIA 4DL3A 2OKQA 8ICUA 2EZXA 2YHYA 2DPIA 3ONQA 1C1CA 1DTTA 4K4SA 2D41A 3S01A 3HX9A 3I8BA 3RJEA 4RWWA 1MA9B 3K8VA 2XS5A 4C3KA 4KN4A 2N7CA 1ICEB 3CJ9A 4NYOA 3E66A 4NXZA 3HLUA 4ER8A 3Q8QB 2DGXA 1HNXK 3C6UA 1RCOB 5A6PA 2X74A 3L4IA 2LKYA 1BIUA 5AI6A 3S3NA 4XQ8A 5M1NA 3HOTA 3Q83A 5F8LA 2MRLA 4DV5J 3CC4N 4R66A 2HQIA 2VGMA 1UFWA 4FN5A 1R0AA 3F2BA 4EFAC 3ENVA 2OPQA 3W8PA 1AW0A 4LF4F 2OIHA 2Q31A 1HNZK 1WF2A 1TAMA 2Z1IA 1NJIT 4ZJOA 3RZAA 3CM6A 9ICPA 3HZEA 3TTFA 7ICEA 1Z00B 1SKSA 3OFGA 2CDRB 3CIPA 9ICMA 5C2DA 2LHTA 3DDNA 2ASLA 5E41A 3AB2B 4H0VB 2HRYA 1XNRK 4RW6B 2X6SA 2CWKA 5HP1A 1WWVA 4CEAA 1IV0A 4Y2KA 1WHVA 2PE8A 2YHWA 3IG1A 3EGNA 4MLHA 3I9V9 4E1NA 4LIRA 4LH5A 4TUSA 1NUEA 3ZCMA 2NXJA 3KWGA 2DH8A 4FXDA 2O8BA 5KFYA 2XSFA 2ZZMA 4NM1A 3I0RB 5KFSA 5EE0A 4OJOA 5ETOA 3CPEA 2B0CA 4JI8F 1U45A 4ILJA 3KOOA 2YBVA 4IFVB 4PWUA 1W7AA 4I2CA 3G71N 1NCLA 3AVJA 1TV9A 2Z2ZA 1WF0A 3G82A 3QBCA 2KP7A 4AFFA 1Z4NA 4FYVB 3KVGA 2UU9F 3IV6A 3PZPA 3K7RA 3G96A 4ZITA 4ZIWA 4JI0F 5AQWA 1VQPN 1WC4A 2F9JA 1FXLA 2MSTA 4GO5X 5BOMA 2F7TA 4A2AA 4LF7K 2EKYA 2RIJA 4ZVRB 1S5ZA 4HTJA 4M6WB 2V2ZA 3GYXB 2HLTA 3V1RA 1FNMA 1SGGA 5CAAA 1UKUA 3WT0A 1VQSA 3CP8A 3CO9A 3RB6A 4CW7B 3QEXA 4ZPDA 2VPZB 3PFEA 4JI7F 3L7UA 1KHWA 3RW7A 2W9AA 3OYBA 3DOMB 4JKCA 3DXBA 4KHSA 4XAKA 1F2GA 3O9SA 4D3HA 1SZHA 4PXBA 3NS7B 2HWIA 4P2XA 3O4WA 1XMOF 1PILA 3RMBA 2UXCJ 2F3NA 2WVCA 1SPBP 5IFMA 1N5QA 5EOYA 5DGBA 4YR3A 2CDQA 1LNQA 3P49B 1OWXA 4NZ7A 2MZ1A 1KD1T 3BF4A 3X1LB 4OL8A 3L3FX 3QBXA 3VEOA 3TR5A 5GTHU 1Q7YO 3KK2A 3BBFA 4ZLLA 2ZH8A 2V51B 3ENBA 3SJHA 3AVIA 4OLAA 2VB6A 2ZFHA 5M2PA 4GLXA 3BF3A 4NLGA 2FHKA 1JKHA 2OPSB 3W8GA 4QIWF 3MEDA 5J2PA 3DOLA 1FEHA 3POTA 4DU3A 3DLGB 1LK5A 2OEHA 4NLVA 3AO4A 1ROFA 4FZZA 2WUSA 2B21A 1ZQJA 4ECSA 2EK6A 4NXMJ 2Z30B 4AT1B 1VSEA 2DK2A 1RTJB 2LQ5A 4PWWA 2FXUA 4HVJA 1ZTWA 3TTCA 2VZ9A 4UOHA 3D7EO 1NLVA 3MUVP 2HMIB 2C3YA 4DV0F 4PHAA 2OYQA 1FO1A 4E0DA 3ZT4A 4K43A 2GTDA 4I56A 4OZ0A 1G1XA 1KFSA 3EGZA 4L3KA 1FF2A 2VWKA 3N7RC 4CFDA 5T7BA 1AQ6A 2DH9A 4HL9A 2ADBA 2HSEB 3THYB 2QYCA 4CIFA 5HMWA 4YOYA 2BUNA 1SJ1A 5H1SV 1ZTTA 1Q46A 5KFDA 3H40A 4C8YA 3G6EN 2QWMA 4R25A 1KVJA 5K8PA 1U1RA 2XG8A 3BYPA 1ZBHA 3TA0A 4YR0A 4J9OA 3GSDA 2KJ5A 1SV5B 2PC6A 3AOCA 3SPYA 3NAIA 3KJQB 4ECWA 1NAQA 2ZKUA 3HJEA 1J97A 4PKIA 3ULDA 2YKNA 2DQNB 2MQOA 5ALIA 4CHZA 2YB4A 3FK4A 1RU2A 4ZTJA 2K7KA 3CULA 3FSIA 2EBEA 3QSYB 1DTQB 9ICSA 2BGWA 5AK6A 2VODA 4WTYA 4V19J 2ZXHA 4AHVA 3TPQA 1GQEA 5SWMA 1HUOA 2ZH6A 4I6MB 2GW8A 3FFIB 3VOVA 4A8YA 1RDUA 2M9KA 3D1OA 1YIJN 4M5IA 3VR1A 4OI4A 3GFKB 4BDYA 3FZ2A 1WSJA 2Y3YA 4C6AA 1RA6A 2G13A 4I2JA 3EDRB 5DDRC 1LAWA 1L3VA 1C1AA 4M5LA 1RCHA 4KHYA 4OGEA 3MM9A 2AH5A 3OYDA 2CVIA 4CF4A 5KFWA 2P51A 2FSNA 3U4LA 2A6AA 1DJ0A 4DCPB 3MEKA 3HFVA 4CZFA 2PFUA 5ALDA 4E1MA 4TURA 2RDIA 3R9LA 4DFDA 2O8DB 2G8VA 3WNGA 4CCHA 3QFUA 4ILMA 4QIGA 2BKOA 1D0EA 6AT1B 5E3QA 3T1YK 1XEZA 5AKYA 4MFBB 1C6VA 4LVOP 3IRXB 1YSJA 4I6AA 3CCQN 2HHUA 3DAWA 1ASUA 4MEYA 4ES1A 2IIRA 2MQLA 1S1XB 3MD3A 3ISCA 4ZDNA 4KC5A 1NXIA 4DBQA 3E8OA 2YNHB 3NF7A 3DGPB 3CJKB 4RW8A 3ZZTA 3QEIA 1RDWX 4XDDA 3VAMA 4KHPK 4CP5A 4DR5F 4NYPA 3D7SB 4JI7J 2EC2A 2K8AA 2R7RA 2AEJA 4IOAL 3E01A 5CWRA 1HRHA 3TFSA 1XNSA 4JWNA 2F9WA 3C95A 2E8NA 2BH1A 3AFGA 1LWFA 4RPXA 5LMUK 5AQIA 4F3MA 4DSIA 4MJKA 4KO0B 2E5LF 4FXWA 5CD4H 1J6ZA 2P9KB 4LVNP 3BH7B 3D0PA 3OFFA 4FPBA 3D68A 4CGFA 2HHHK 5F8IA 2KE7A 2ZTDA 1ZQZA 3WBZA 5JS1A 2DD8S 3LDAA 4B3MF 1Y64A 3D3CJ 4ZCMA 1U1MA 5M1PA 1ZJNA 4FL9A 4DPOA 9ICKA 3M6XA 1WHYA 4HHJA 3H25A 1I39A 2UXDK 3EDQB 3UXPA 2FMQA 2VA3A 5IV3A 1H0HB 3Q8PB 2J9CA 1GT8A 1UHUA 3NEKA 4TUQA 3CCJN 4R5PA 5KFFA 4WQ4C 4CF5A 2RF2A 5HBMA 1CC7A 2FB0A 3PYEA 4N76A 3QUQA 5C15A 2UVRA 3WKDA 4ES2A 2GQCA 3F2KA 2P9CA 3J7Z5 5D4LA 3G25A 3K5LA 1IR0A 3JS6A 2Y1RI 2DO4A 1U48A 1OY6A 2F4VJ 1SL0A 1VQOS 5IINA 1WG5A 1YRXA 2BV3A 5C7PA 4DV0J 2XCAA 1YITN 3AN1A 2JOQA 2YWGA 2JWNA 4ECZA 3VETA 4MT1A 3P8BB 4IH5A 3GL1A 3QX7A 2OPSA 4BWMA 3VF6A 2XNQA 2HMPA 1N63A 3VF0B 3DLGA 4FO6A 2RHSB 3CMEN 1QD1A 2N1RA 1FJGF 4CHYA 2MQQA 2POKA 2KHOA 3RR8A 2A3VA 2G5IB 4FWSA 3NCIA 5KI6A 3FVYA 4PG7A 1P8ZA 2G8FA 5GIPA 2PFNA 5IIOA 1A6LA 3BGOP 2HMIA 2DR5A 2ZXIA 5HMMA 4CGHA 4CK2A 2XWXA 3CC4S 2N4CA 1WNEA 3F41A 3IRWP 3C94A 3I56N 2KFYA 4DUYF 2R18A 1TK0A 1N52B 1FA0A 5GMEA 4YHHF 2R3VA 3HYFA 3LDNA 4NZ6A 3IR6B 2FYXA 3AXKA 2KQ2A 1Y9OA 1M5KC 3LGNA 4RW4A 3B9JA 9ICGA 2ZC3A 4NCBA 4KBIA 2AYMA 4LFAJ 2UYTA 4FXVA 1S7HA 4FKYA 3SQ0A 8ICNA 1KR4A 2BACA 1WOQA 1QH9A 4TSXA 2DNHA 4LFBF 3UVJB 1SV5A 1RDBA 3SMZA 1ZRNA 5F3TA 2HOEA 5I42B 4CZKA 4OIXA 2A41A 2KNJA 3TWZA 3HFKA 2QSFA 1FX2A 4DX5A 4NLTA 4ZVGA 1ZBIA 2E7WA 4FWKA 3JPOA 4USVA 1DTQA 4C8LA 3QERA 2X1AA 4CJEA 3H8JA 4J9UE 3ULEA 3TZWA 2KICA 3G71S 2UP1A 3QEVA 2PYLA 3F2CA 3ZNJ1 3FM9A 1K44A 1YBUA 2PYJA 1Z05A 5F8NA 4QZEA 3M8QB 1V4SA 3CD5A 1VQPS 4FP9A 4W98A 4CIEA 3AGKA 2N4DA 2B7BB 2KSOA 3K58A 4LRBA 3J80U 1L7NA 3QZ8A 1MWYA 7ICHA 4YFKA 1T0TV 3V6DA 4IBNA 1YJ9N 4M3XA 2UUCK 5B0CA 1V4TA 4O5CA 3CCZA 2FVSA 3NBPA 4Z4IA 3LDQA 4CO4A 1KQSR 2EFGA 4YG2A 4P2FA 3H7IA 2BABA 1HI8A 5CP2A 3T5HA 1NH7A 1U2CA 5DZ7A 1RT1B 3MGIA 1NU4A 2GO9A 7ICPA 3HSTB 4DSKA 3L3UA 4WP3A 3QRRA 1R7IA 4IG3B 3BO4A 4JV5K 4WFYA 3LUYA 1J5OB 4NLDA 4OJ6A 4U7CA 4B9SA 4BRAA 1RYUA 4LRDA 4A2BA 2R2UA 3QSIA 3DLLQ 3G6YA 1A77A 5B8HA 3QEAZ 4RQ7A 1RJJA 4E98A 2HHXA 4EMDA 3CUNA 1IV8A 3GU0A 1RBVA 1JXVA 2XHCA 1GMWD 3G86A 2FLOA 3IRXA 2PMZD 1VI7A 3P39A 3HJVA 1ZQSA 7ICUA 1S1XA 4KKOB 1L3KA 2KN7A 4IOXA 2FSJA 1LEOA 2AKWB 4WIIA 5HQ8A 2HURA 4LRFA 2YNHA 1AXQA 2WW4A 2E5LJ 1BG3A 1Y5IB 3DGPA 4M9GA 4MYUA 4CIOA 2Y9UA 1T6DA 4DCHA 3EWGA 4WU2A 3HBTA 1BPYA 3THVA 2UUBK 2NXCA 3HHDA 1QQMA 1NM1A 1JLAB 2V52B 4B3MJ 2ROPA 3KMSA 3DGVA 3M1VB 3NVMA 1N36K 4PKGA 4U67L 1NZPA 3OXFA 4FZXC 1NO8A 4QW9A 3VQ6A 4WZQA 3NWGA 1Z19A 1Z4UA 1B99A 4QBUA 2V7YA 2KRRA 4FYWB 4LC9B 1B0VA 1RXVA 3JQJA 4FLYA 1MQ2A 1IBCB 1B3TA 4CD1A 3O9QA 2C2OB 3VPZA 2B8QA 5ALOA 4YD1A 3MHYA 3OXGA 2PN6A 3OUYB 3OYIA 4HCBA 4QZAA 4O3SA 3G6ES 3BO2A 4JI6K 1T4GA 3UDCA 2OWOA 1S7IA 3FSXA 4IFEA 4CH0S 4DN9A 1L3TA 5E3PA 4XH1A 1PKUA 4RBVA 2G8KA 1CC8A 3CIMA 2ES6A 4J9SA 1Y5NB 4DV2J 1BO5O 3NAEA 1NJIO 2SXLA 1SQFA 4P74A 2RVJA 5ALPA 2YQEA 2AT1B 2W8KA 5KAIU 2F9TA 3J80O 5BJRA 4DG1A 1B64A 1Z26A 4J9RA 4YB1P 2RS8A 1X9WA 3QUCA 2F1HA 5DM7Q 5AQFA 3RH6A 3CO0P 3IBWA 1C20A 2I6WA 5AJ3K 1COKA 4YB7A 1LVHA 3DLJA 2ABYA 2WONA 2QWOA 4BE0A 1YIJS 4DUYJ 2RHQB 3HRGA 5HR6A 2LDYA 2HLUA 2LECA 5EGYA 1CG2A 2ZM6K 2MZTA 4ZOHC 1YT3A 3CXCR 5JVGQ 2W2NP 3QLHA 1PUZA 2EZYA 1QAXA 1N61A 5C25B 3PIPL 1VHXA 5DKWA 4KGZB 4M9HA 2E7VA 2P66A 2V8HA 2OELA 2GO7A 4LSLB 3RMAA 3R6GB 3JSMB 3WXMB 2PDAA 2VQFJ 4RPYA 4M7YA 4TLQA 3CHWA 4DV3K 4P7VA 2E1FA 1S5LU 4NX9A 4IRDA 5KG5A 3SEIA 1X31C 1H2VZ 2IM0A 2MB0B 1CJKA 3CCWA 3HT3A 2WF6A 2HBMA 3N4QA 1WAFA 3LP2B 3C2LA 2FPMA 2BDPA 2RAQA 2VBYA 1V5IB 3DEEA 4Z94A 1KXPA 3MI7X 1WSRA 3UKRB 4DQIA 3VALA 5AKIA 3ICXA 3ZC4A 2R8KA 2E1EA 1RADB 1TTHB 2OPRA 3OFEA 3UVJA 3HHNB 2C2KB 5ALQA 1FDAA 3DMJB 4DPUA 2QL7B 2CPFA 2QKKA 3CCQS 5I42A 3M8SA 3SQIA 1K8AT 3T9NA 2R2TA 1BVSA 1NBEB 1OIAA 4FF2A 2K8BB 2MAXA 1N4LA 3EGWB 4DCOB 1JJ2M 2MKIA 3W0LA 3OTBA 3H5SA 3VCBA 4FWNA 4FFDA 2XNRA 3ET6A 3SMVA 3KD1E 4B1UB 5G4DA 4M5DB 1KD1O 3N97B 1V3ZA 3EM1A 3UMBA 2WB1C 2Z1JA 4O3QA 4M63C 4TY9A 2CGJA 1EETA 5BPLA 3OL9A 4KHNA 3QMLA 5KFUA 2HWHA 5CYMB 1VRUB 2JVRA 1Z3EB 4WE1B 1HNZF 2GUIA 4X65K 1YGYA 4HHTA 4I69A 5ALLA 4K0KJ 4HTLA 3VF4A 2QLJB 3THWA 3WHIA 4ZH4A 5CE3A 5AHXA 2HGLA 1RXOB 3QE9Y 4P2MA 4DV7K 3ZX3A 1XNRF 5A8RB 1PG5B 1UWBA 2F1IA 2HFZA 1AFJA 3KZXA 3H4BA 4CFCA 2HBLA 1Q5YA 4OZJA 4ED1A 5KFMA 3R7NB 5BRFA 5EXWA 4IG3A 1E6VB 2WOMB 2DNMA 1FRJA 4P9SA 4RUCA 4OV1A 4CH7A 3BSOA 2AXTU 2C2MB 4BRGA 1NB7A 1IUJA 3CDEA 4MFFA 3CCJS 1FD2A 1WC0A 2QFJA 2ATQA 1U1LA 3H46O 4ZPTR 1S1UB 3M9MB 4DOAA 2V94A 4NLPA 2AP1A 5KFTA 4DN0A 2C3MA 2Z2LA 2AGPA 2X51A 4FLWA 4TUPA 1BXNA 2LYBA 1GMUA 3I82A 2D0BA 4OI0A 1V85A 4YOUA 2Q0ZX 2OD6A 1RGIA 4J5OA 3PFOA 3U7JA 1YITS 2EI5A 3ETMA 5AKXA 4RQ3A 4LF7F 5FP0A 2BM0A 3MM5B 5F3XB 2EVZA 5DO2A 4EU0A 2B4OA 3CMES 1XQIA 4ZCKA 3OBIA 2HOFA 2M9NA 2XZDB 3CJ5A 1JLAA 2KKVA 2X1FA 2F4FA 3DJCA 1VJWA 4FS2A 3EXYA 2ZZTA 5D78A 4PEOA 4PHPA 4LF6K 1JCGA 4DU8A 1NJYA 2VG5A 4GKKK 2ZGYA 4PG8A 3U8XA 3BPSP 1MSWD 3GIMA 4DJBA 3PXGa 4I6WA 3VEYA 2E1PA 3KDOA 1G99A 3MCNA 3I56S 1ZBUA 3ZDDA 5DDMA 3MCPA 3SV4A 4CECA 1X5TA 2ZG6A 1U1KA 2E6LA 1RT5A 3J81U 3P96A 5KG3A 3OUYA 3FZMA 3D0IE 4PQUB 1IM6A 3SI6A 2Q3PA 2WF5A 3GB0A 4OX7A 1VQ6N 2ZUBA 2HVDA 4CZJA 2YKAA 2GJIA 5KFVA 4MKYA 4AM7A 4H5RA 4EYHB 1QVGR 1P9QC 3GE1A 3JPPA 3KYLA 2P9GA 2YNGB 3NUQA 3DHWC 3ZZYA 4NMXA 2IVNA 3L7PA 2FLPA 2JNJA 4DX6A 3OL6A 4KMOB 4CJFA 4NY8A 2YKMA 4HDHA 4CEDA 3C15A 3EZ5A 3NGUA 1FRIA 2OM6A 1O5JA 5D0HA 1HKGA 3OHBA 2CPDA 4I2AA 3RRGA 1V3SA 4PABA 4LF5K 2GJFA 2C2EA 1S1WA 3OTDA 3V1QA 2B9XA 4YDUA 2J7WA 2JLFA 3W62A 3QESA 4FJLA 4PKHA 3D0GE 5M1OA 1SKRA 1NOZA 2HG4A 1VSLA 3I4PA 3HHLA 5LMNF 4R79A 1HW9A 4LFCF 5HP4A 4FVUA 2KKZA 4KLLA 2IOFK 5MAOA 4FPAA 7ICMA 1HBMB 3OXLA 4CZMA 5G0RB 2J9DE 2ILYA 4A57A 4AD6A 1P9YA 2P5VA 5I4MA 4QOZB 3NOGA 1TMMA 2MYFA 1YJ9S 5AE2A 4KLOA 5C25A 4HH1A 4ID8A 4P0PA 4LSLA 5CR0A 2F9DA 1KC8O 3JSMA 3SMSA 1S22A 4F4AA 2E1YA 1EWRA 4K4GA 4URGA 2VBWA 2VKQA 1WYGA 1XNQF 5LXYA 5HJYA 3LWMA 2A6OA 1QAJA 2F65A 1FKPA 2CG4A 2YWFA 1XTZA 2Z1HA 2O8FB 3AVAA 3LP2A 1SUQA 4J9KA 1KBRA 4C4TA 2RT3A 3PEJA 2BW2A 4P52A 2GWKA 3U9ZA 1IVZA 3FQKA 1QZ5A 3RSEB 2IM3A 2ZIWB 4IRCA 1WWHA 2N82B 2IC3A 4CO2A 3IR7B 4O5FA 3J80Y 4ZVUB 4A8QA 4IQTA 1T05B 1RWOB 1N34F 3RU0A 2AD9A 1JUDA 2R7UA 4KTWA 4OPHA 1HNZJ 2QG9B 3BM7A 2HF3A 1OVQA 3H8WA 3D4JA 2DBYA 1O6XA 1HIWA 5KFHA 4UB8U 1K8KA 1KQFB 3HPHA 3J81O 3WNFA 2PI5A 1OQ6A 2MQPA 4EHTA 3ZX2A 3P1GA 4M5DA 2AHOB 2DNYA 3RVCA 1RT4A 1J2NA 3BS7A 1X7VA 3PR4A 1R8BA 1TL7B 4OPJA 2XGPA 1S0MA 1CS4B 1GAOA 1CJVB 4OYZA 2YNIB 2HQ3A 2L5YA 4Y2JA 5JU5A 4QIVA 1SBRA 4YMMA 2D0CA 3C1ZA 3KK1B 3PJWA 5J0SA 2RRNA 4G1QB 4WE1A 3CJ8A 4DUTA 4KH0B 3T19A 1X6JA 7ICTA 4CGDA 2QTWA 2YVSA 1ZQIA 1EHWA 3SCLE 2WSCC 3K9JA 4CEBA 4DU7A 5A8RA 1TV6B 1HARA 3ZSRA 3ZZUA 1K1SA 4J9QA 2H3ZA 4J7CA 3ZSWA 3WK9A 3M32B 4JMUA 2ERRA 2FJWA 3AEVA 1E6VA 2WOMA 4RR5A 3ZZPA 5T41A 2MHEA 4LQ9A 2YJEA 1HBNA 3HK2A 1X4FA 2JR5A 2XC9A 3LM9A 3OGUA 1O08A 3NXZA 2IAJB 3KHRA 2DGUA 3A8YA 4QWDA 3Q7BA 4N8NA 2CADA 2FPKA 3CVKA 4DPWA 2DKZA 4DFPA 2D3O1 5KQ8A 2ZVIA 1Y3JA 2G1HA 3VAGA 3L4PA 4KHPF 1C1BB 4BS2A 4IJAA 3OL7A 2UV8G 4LSNB 4CGZA 8ICEA 1VGYA 2KL8A 5LJ5Y 2GEMA 5J2NB 1H98A 1XSPA 3FEZA 3FAHA 4Y28C 2P1JA 3K75D 4PHDA 2OYYA 3QRQA 1YWXA 2CNLB 1J54A 5B0DA 2AEFA 1EX4A 2ZITA 3GIIA 1N32K 2N3LA 1NHUA 3M4XA 4J9NA 1SH2A 1EXQA 1IJFB 4E7KA 2BA9A 2OTLN 1X9MA 2W4DA 4PH5A 4JLHA 4B02A 3TSQA 3I9ZA 4A4JA 4C23A 2EFNA 2O67A 5A0YB 4MDAA 3M5RA 4Y2IA 2JEJA 3GFYA 4O44A 2H3VA 5CZVA 3EL2A 4ZIVA 1BI4B 2VWBA 4AHUA 1T9VA 3QFWA 2G08A 3THTA 2ZH1A 2D1KA 1HMVA 3KHLA 5IXUA 3FZKA 4PQUA 4BC7A 5JJBA 2IMOA 2WMMA 2HYIB 1VDVA 2H3GX 2KT5A 4IDHA 3DDKA 2W11A 5I3PA 4JV0A 1COOA 4C7YA 2ZJRL 2DJWA 3KKAC 1WC3A 2IBOA 2XQCA 4M2YA 4UW9A 5LMNJ 2FMPA 4QPXA 4LFCJ 2O4GA 1JI7A 1I3AA 4RBUA 3V9ZA 4CT8A 3FCHA 5BN8A 2KV2A 1WEXA 3Q7CA 3M2RA 3MX5A 1KQKA 4WJ3B 3HOSA 1S59A 2CPIA 3TRGA 2DH7A 3FBFA 1WB9A 3MBYA 4PPDA 5B0AA 4GW6A 2D0OA 3TAPA 4H4KC 1T9TA 2OSQA 2RU3A 1S10A 1RPLA 4PXDA 1C0TB 5H9FJ 2OHDA 5G5GA 1F0MA 2FC9A 4O0NA 1X8DA 4K4YA 1ZM9A 4ECUA 1XNQJ 1J2VA 5G0RA 3GE9A 1J53A 1BHNA 2D7SA 3KBBA 1QDUB 3OPXA 3MCOA 2P9NB 4FZLA 3IS9A 3IHQB 3PTWA 4DV5K 4GV6A 3Q2SC 1W7WA 3G8QA 2PAVA 3A5OC 4LF9F 4A59A 2NRZA 1UVNA 3SEOA 3AVBA 1NWKA 2JZBB 1KVBA 2VQEF 2AGQA 1RCXB 2BJDA 2UZAA 4NM2A 1KEKA 1NEEA 5DG9A 2IJRA 1D9FA 4KLMA 3R6MA 3RBEA 2ZDPA 1D9DA 3B4DA 2F8EX 5CCMA 4ILGB 1XR6A 1N34J 2NS1B 1VJQA 3JPQA 5F9LA 4MKVA 3OYGA 2AJQA 2FJXA 4KQZA 4Y65A 2VDHA 3KFWX 1WUUA 1F9EB 2VFUA 2O8FA 5AM1A 2E8OA 2ROGA 1OXJA 3PDNA 3EMTA 3VQ5A 1QUVA 4ANEA 1HNIB 1UJ4A 3AO1A 5D0EA 3W65A 4FK4A 2YQ0A 4Q7AA 4X66J 1NK8A 3OA9A 3CCUN 3TWHA 3P4UB 1S99A 1Q8LA 1SC1B 3NF6A 2AJFE 1EQYA 8ICQA 4HAIA 4M5HA 1HJRA 2F44A 1O1WA 1RHKB 3RF9A 2J6UA 3CGIA 2KN4A 4LZDA 4UB2A 4J9PA 4Z6DA 1TP7A 5HI7A 3W64A 1UVJA 3CI5A 4JKEA 4DV1J 1MMNA 2ZGZA 2XSJA 5HANA 4GMJB 2I0XA 1YJNN 1SC4B 2YX6A 3B54A 1YVNA 1GLAG 1VSMA 1ECWA 1CS4A 2MQ8A 3QETA 5AXLA 5J2IA 4RUHA 5HSPA 1CRXA 2YNIA 4ZVHA 3U27A 3EZWA 3BR9A 1QTMA 1PJ5A 1B70B 2RN2A 2KB2A 2VPXB 4HI1A 3KK1A 3MAQA 5FJ4A 3QU7A 5HQMA 1VC0A 4O3PA 3MDFA 4JBCA 1SIJA 2GC8A 3VC8A 2P8IA 5DQGA 1RQ0A 2XMKA 3HDSA 5GAEU 1WKKA 1N2XA 4BE1A 2K3KA 4FM1A 4K5RA 2U1AA 3EKSA 4I2BA 3Q8KA 3RB4A 3F56A 5KFBA 1U2VA 1FRHA 3ATUA 1NI3A 1TV6A 1UT5A 3BR8A 4ZK7M 4FJGA 4PG6A 1IBKF 1HQUA 2V6AA 5AKHA 3VGUA 1VQ6S 1UPMB 4CZCA 4WTOB 2UXCK 3CIZA 1TUUA 2WF9A 2A3ZA 1YKWA 4BR5A 2Z2YB 3HM9A 1JLFB 1KDHA 3JTNA 2G4BA 3H0PA 1U0HA 4AILC 4NRUA 4AYBC 4JI5F 3H8MA 3CDAA 3ED5A 3FCVA 4K25A 1RG6A 3UPQA 1DQ8A 2MTLA 2GV1A 2HQCA 1GLCG 3TX0A 2QARB 1XIQA 2UUBF 3C2PA 4GY2B 2HSTA 1T3VA 4RG8A 4F4ZA 1Q3VA 1OY9A 4W5QA 1N36F 3SK3A 4OYAA 4US8A 3J81Y 2ZOFA 2H65B 4EEKA 7ICSA 2LP4A 3R7SB 4QU7A 4H0PA 4DOBA 1SXDA 5J2NA 1M5HA 1FVQA 3CMAN 1K8AO 3DXMA 2ADCA 1APSA 1RK8A 4NXMK 2HGMA 4WYWA 3VWSA 4YOVA 3TUZC 2VGNA 1BPBA 4RJVA 4C80A 1N5VA 2BCVA 2HIYA 1U4BA 4HR2A 1ZD3A 4ELUA 4MEXA 5HMYA 4RW7A 2QI2A 2BPFA 5HL7L 5KL1B 3NS5A 1JALA 4KMUA 4JB8B 5KRTA 3KK7A 4FZMA 1Y11A 3P38A 3O1LA 3VGVA 1OH6A 4CHNA 2ZKTA 1RZMA 3WQPA 3VTIA 1BD6A 3R1XA 1VOMA 3R3TA 2PMWA 2F8LA 2WW8A 4KH5A 2GFFA 1BI4A 1ATNA 1K0VA 2QXFA 2NYVA 8ICCA 4DXLA 4BRIA 4OI3A 1S6UA 1HLUA 3MM6A 3DYAA 2JGAA 3FJ2A 2FDRA 2ZIUA 3VQ8A 1S3XA 3GDXA 1KVKA 1NRKA 3CFOA 4H5NA 4YDDB 3MEEB 3CYMA 1RABB 1K6YA 2DRBA 5JLFA 3VAIA 5AJ3F 1VFJA 1TAUA 1ZQPA 4I2DA 5ALWA 4BC3A 3GBTA 3BQ7A 2CA9A 1WLJA 1T3OA 1FXDA 3W2VB 4CNZA 5CB1A 3KWIA 1A0PA 2WFBA 1YZ6A 4WFAL 4MQ3A 3FC4A 4DV4F 4CLSA 1SV0A 5BRHA 2YWHA 5DB9A 4MFCA 2VUGA 2AIRB 3WK4A 1ULRA 1EKRA 3VENA 1X5OA 3LAKA 5IT4A 4LZGA 8ICGA 3MPYA 1L6NA 4LF9J 2DITA 2KG0A 4M3WA 2HKEA 2V8VA 4C8ZA 1LK7A 2VQEJ 2G07A 3A8EA 3AJDA 4YD2A 2OTJN 1YHQN 3NRZA 4NLYA 2W55A 3C0BA 1OQ3A 4UY8O 1LXJA 3NY0A 2XULA 1QQ7A 3OW2M 2QO3A 2AZ3A 1AYEA 1BQMB 1C0TA 4MO4A 3ISNC 1NDCA 4DV3F 2FPHX 3VQ4A 1GTEA 1UA0A 3QO9A 2QKQA 1NMDA 4LD0A 1S1TB 3FGUA 4EUVA 1TL1A 2P9NA 1EARA 1T9UA 3QMQA 1BWVA 5KT2A 2JZBA 2BE9B 4WK1A 4CH1A 3GQCA 2A0FB 3RYLA 3GILA 4FLUA 5E7OB 5ALYA 3VESA 2BQ3A 2FD2A 2K2PA 1S6PB 1W2BR 2RB7A 8ICZA 1YJ7A 3FLCO 4BGBA 5DB6A 5J2KA 2P9UA 3SYZA 3BKFA 3GV7B 3X3UA 4WU3A 5KFLA 3KLFB 3SUOA 1O51A 4DB3A 3QAEA 1FDNA 5DJBA 5DQHA 1CJUA 5K4LA 1U02A 2X1BA 3D2QA 2DYAA 1DY3A 2FHMA 3HD1A 1BWEA 1HNIA 8ICOA 2MGZA 2F76X 4RU9A 2EX3A 1QUPA 2PGCA 4RWTA 1P8GA 3M8PA 2M2BA 3H45C 4K59A 5DB7A 1JLQB 1X5PA 5I3QA 5CYQB 9ICNA 2JWLA 2XB2D 2KDOA 4YORA 2LQBA 2P9EA 2HAIA 3CCEN 4NASA 4WWSA 3I8DA 3OLAA 3MUMP 3LTOA 8ICSA 4CNQA 4JI7K 2ODGA 2PI4A 1NSKL 1XO1A 5A8KB 3GJRB 2I7NA 4YN4A 2MZSA 3OPKA 2P9PA 1SCJB 5E33A 4FLXA 4PXCA 2CQDA 3JB9k 1MW7A 3L95X 3QFHA 1M90T 3BO3A 3G0ZA 2OTLS 1IBKJ 1RDFA 2GZOA 5H9EJ 5IIJA 1J27A 5BYSA 2GAGC 2DR9A 4QQBA 4F0MA 5GAHU 5L46A 3O8MA 3OTOF 3UN2A 3R97A 4F4WA 4FS1A 4USHA 3T7ZA 3NGKA 3MXMA 4E8UA 4UAUA 3C7NB 4TU7A 3LP3A 4JI5J 1DQAA 3NS1A 4MDBA 1S0OA 4KAIA 3IWLA 2AU0A 3K5OA 1NOMA 3ZO7A 2ZWPA 4DMZA 1N5YB 4YDXA 1VIOA 2PO4A 3C21A 3BKTA 3LW5C 4B17A 1BCOA 1U6FA 4F04B 2CPJA 2JEGA 3A8KA 3SCIE 1FW6A 3HRDD 4OQJA 1QQ5A 2EFQA 4PWDB 3D0HE 3KG1A 3D54A 1N36J 2WB1F 3V1OA 2H5XA 3EE8A 4ANDA 2EWSA 4QR2A 3VAHA 5ALUA 4PR6A 3CCMN 3J7AN 9ICFA 1JLFA 4ZP6A 2XICA 3ETRA 1GOBA 5IILA 3PKMA 2G2YA 4YEAA 5HK4A 4G9BA 1XWLA 4OKEA 5DM6L 4CHQA 3O6QA 2F4VK 4F25A 3NGSA 2D69A 4AL5A 2EAOA 4BGDA 1WSIA 1ZD2P 2JLEA 3QICA 2BR0A 1I5OB 2WK4A 2UXBF 4LBPA 1LWEB 1NPPA 5EVZA 2A40A 2R7VA 3LP1A 2NZ4A 2E8AA 4LF6F 1RWVB 1HNVB 3H59A 3HVWA 1FTCA 4YNQA 4O8UA 3PSTA 4DI6A 1P90A 2HQFA 4RWXA 4RTFD 2G0JA 3PHEA 1R0BG 1TYQA 1M1GA 3OTEA 2O1PA 4CJLA 1VQ7S 3OYEA 1GLJO 2XI9A 1WSHA 5IWAK 2CQIA 3HILA 5I3UB 4URSA 2ZC4A 1TVRA 1TELA 1VK8A 4ZVFA 5HN0A 4B3OB 4A8EA 1N5SA 4FKXA 4FCYA 3E51A 1O0PA 3PYFA 4YOWA 5AJ3J 2FQQB 3RMCA 3NTUA 4CF0A 4XPEA 4GVEA 4WQ5C 1RAOA 2FHJA 3SCJE 1SL1A 3KK3B 4FJHA 2I9GA 4KPCA 9ATCB 2HQGA 2B9WA 5BR8K 1NZBA 5CH7B 2E5IA 1FEEA 4LFAK 4DV4J 1BUXA 2ZBIA 3SFGA 4KGMA 2XBPA 1ZQGA 3D2FA 4FZYA 1ZQWA 3T1HF 1HUZA 4R8UA 1FKOB 1GLFO 1HX1A 3MEEA 2DO0A 3NVZA 1M6YA 4EENA 4OKKA 4LF5F 3DLRA 5HMLA 3MMAB 2HZAA 5B66U 2QSWA 1YK9A 1JLCA 1UZDA 3KLEB 1JLEB 4J2DA 2R8GA 3C14B 3C6AA 1KN5A 3K57A 4LF2A 2CJ9A 1KAYA 1FK9B 3CCUS 2AX1A 4B9LA 2W7AA 1Z1VA 3W2VA 4M5MA 2J6SA 3ZFVA 2LPEA 3RRHA 5F41A 5J0XA 3B6PA 2QJ3A 1NPKA 4QR0A 2QLFB 2OMOA 2DHAA 4DSLA 2IBKA 3QQCD 3LWLA 1N6QB 4ATNA 4F3QA 4DFJA 4IOAQ 3ATVA 4KYZA 1Q7YT 1VQ5N 3A13A 3TQEA 3VQBA 1YJNS 3P45B 3H98A 2FSKA 4J9LA 2B4JA 1C7YA 1S9FA 1C2PA 5IT9U 2E88A 3GLJA 1ED1A 8RUCA 1WC6A 2XGQA 4K4ZA 5AQKA 4Q45A 3C16A 2W24A 4PY5A 3K5MA 1L3SA 3N28A 1RTHA 1Y97A 1H74A 5B0GA 1S72N 5J2BA 3GYNA 1RQLA 2BJEA 5CZXA 1REVB 1G4CA 8ICBA 2XEXA 3OHAA 5KRSA 4KLFA 2R4FA 5AQHA 3CC7N 3PO4A 3Q24A 4OMFG 5D77A 3BV8A 5DDQC 2WAQD 4DL5A 3U1LA 3A0IX 4Q8FA 5AT1B 1IO2A 1WKLA 3C66A 4UQGA 1T44A 2XCPA 3DRPB 3CJTA 1ELOA 4Y2QA 3PW5A 4ANCA 1S76D 5A0LA 2Z7JA 3OTQA 4BC4A 3JS9A 1RAJA 2WRMA 1ITPA 2FIUA 4H5VA 1RT6B 3AVNA 3KLFA 3UPFA 1IWGA 4L72B 1PK1B 4MKBA 1BISA 1WTFA 3QATA 2LEBA 4HVZA 3HI9A 1WEYA 2BJ9A 4WF9L 2DY1A 3QEPA 4G3IA 1DLOB 3L4BC 1ZQ1C 2OZSA 3ALRA 2W03A 1QQNA 2ZWOA 3KJNB 1M5SA 1JLQA 2EK1A 4ZPVR 1BPXA 3MXIA 1MU2A 4RX6A 3HXMA 5DK5A 4NLKA 1HYSB 4F7VA 2DHHA 2E5LK 4U8VA 4I9QA 2J0WA 4KB0A 3DHXA 4PG4A 3OTOJ 1MROB 3CMAS 3PMNA 3NKYA 3O5BA 2VG7A 2R7XA 4YS2A 4OYWA 4B3MK 3SI8A 4PL7A 1QE1B 2IMWP 2RE2A 5A8KA 3J7YP 2FBVA 2J9DA 3HM8A 5TKWA 3IAYA 3UDEA 1U26A 2KJVA 5A8WA 1WSGA 2W9BB 1SJ4P 4AP9A 3IP0A 1RBLA 4QNLA 3KUHA 4Q43A 1WORA 4F5NA 3SSSA 2RDJA 5LJ3Y 1UEVA 8ICMA 2HF4A 2JX2A 2MKHA 1KRPA 3W3DA 3TANA 3UKUB 3D6HB 1EZZB 1QAIA 3C7NA 4GV9A 2NPFA 1X4GA 5L9NA 4BDZA 1GLDG 2JGUA 2O5DA 3D3BJ 5IS2A 2MXYA 2R42A 2UXBJ 4X4NA 2YXLA 1Z25A 4DV2K 2IVYA 3RH5A 2J4RA 5GMKa 3CETA 5IT9O 4MO5A 4Y2YA 3L2QA 2Z58B 4AM6A 1TAQA 2DNPA 3NRBA 4CO5A 3CCRN 3GR0A 2KOBA 5IM0A 1C0UB 1HWUA 1B0TA 3V9WA 2W04A 1WNSA 2PFPA 3TUPA 4NYNA 3JSRA 3WNHA 1FNXH 2O8EB 3SUQA 1JL1A 5AKKA 2NNWA 2G8WA 2P5GA 1JX4A 2Y8YA 2Z2MA 2FVQA 4P0QB 4EZ9A 3T69A 1LWEA 4KH4A 4UAWA 3QAUA 1WUDA 1TKZB 4DUYK 2OTJS 1YHQS 1SWWA 1FERA 2QA2A 4RNHA 3J7YI 4MIAA 3R5JB 4DHVA 4GC7A 4U7BA 4PXEA 2OMLA 3U9DA 5K8OA 4LF8F 2DGQA 2E9RX 2V63A 4UOCA 1MMDA 2B4VA 2BHNA 3PNCA 4EZ6A 4P73A 4BC9A 3EE9A 4OJPA 3S7RA 4QS7A 3PYDA 3SQGB 3TEHB 3ASMA 3V9UA 1VMBA 2EEYA 1J5EF 3R3LA 4ECYA 2E2PA 5EUHA 2C22A 3T1HJ 2ITGA 3ILJA 2VQFK 3BSNA 4DR4F 4UB5A 2IA0A 2IPOB 2DCUB 4B3OA 1RAFB 4BRCA 5H2FU 3TJ9A 5K5MA 3SQ2A 3R9PA 1HHTP 4A47A 3QXGA 1SC3B 4XO0A 5J2FA 1C1CB 3WX8A 1DTTB 5IC6B 2Q4TA 2YX7A 4WQ4A 5L1LA 3A8JA 4KGXB 3KK3A 2P6UA 3H08A 3ZTRA 5KFOA 5CA7A 3AH6A 3UR0A 2MLXA 2HHPA 3HCXA 2G8HA 3W9HA 3VN5A 1V9PA 5EE1A 4YY3F 1UVMA 3AODA 1RHJB 1FKOA 3GIJA 2D6FC 2V50A 3NGTA 1K5OA 1BPDA 3QYPA 3MMAA 5KT7A 2BKPA 1Z1ZA 2D3DA 3QINA 3DI6A 1LWXA 1R0AB 3RJGA 5F9NA 2OPQB 3R5CA 4F0KA 4BREA 2ZJQQ 4DL6A 4GMKA 2LLZA 3KJFB 3V5RA 1BA1A 4OJRA 2HVEA 3O4QA 1T9XA 4RQ1A 5KFGA 3IRUA 2KXNB 2VV5A 3CCES 1P6TA 4U67Q 4IO1A 1SQGA 3CE8A 5HP1B 3VAJA 1N6QA 3T3FA 1VLOA 1X5SA 9ICWA 4L75A 1ZOTA 2A5XA 4IQVA 3IG1B 3EZUA 3H3NO 3MMCA 3NVVA 2F63A 2IRYA 2VOOA 1N48A 1U1NA 1QCKA 4I2GA 2BMBA 4IYQA 2FC0A 4K41A 3GU3A 1RACB 2I2YA 3MMBA 1CQNA 2O8BB 3VGSA 3BBCA 3GCWP 2R7SA 4CFAA 4K0KK 1TL4A 2VG6B 4DS5A 1PIEA 4IFYB 2RLTA 4CZGA 3IBFB 1JIHA 3IKMA 4ES3A 5L8RC 4USAA 5AM5A 3UM9A 4W5OA 1WI8A 1VR6A 4NYZA 1ILYA 5KL8B 3DFEA 1M5OC 3K1RB 2E9ZA 1HPMA 2OO4A 1K0TA 4FJ8A 3QNOA 5BPMA 4TNOA 4OV6A 1XHZA 4L73A 3CJAA 3NG8A 2W01A 4KFBB 3TJ8A 3NGDA 2BOAA 1VHIA 1VSFA 1UJ6A 3CCMS 4ZCLA 3SMPA 3BREA 2NXUA 3MR5A 1XR7A 1XC3A 4LUBA 1ZAXA 3V7JA 1WCNA 3NLCA 5CZ1A 3J81j 1UPHA 3NHGA 2ZDOA 2EANA 4UBCA 1DLOA 3HSDA 4HYKA 3ZNUA 4B6JA 7AT1B 2MUTB 4H5TA 4I4BA 4DTXA 4FBTA 2R7WA 3QZ7A 1SS6A 3UNGC 3B78A 5DLGA 1S97A 1HYSA 2PFFB 4LIWA 1N54B 2PXIA 4PUOA 1S1VB 5LXRA 4GNIA 4ED0A 3QNWB 4BVPA 2H5JB 4C8NA 1Q7LB 3A12A 7ICRA 1F6TA 2BE2A 4QWAA 2FVPA 3PIPQ 2LYHA 5AXMA 3LZIA 4RNOA 2AW0A 1QE1A 2DNZA 2BVZA 2X6NA 3QRPA 4GC6A 1OH5A 4CF8A 2C1EB 4KPYA 4X84A 3KK2B 4QYZJ 4PYDA 1NKEA 3JTOA 1FJCA 3AQOA 4OZ3A 4WPAA 1GLBG 1EJ7L 4CEZA 3RGIA 1SB3C 1JKHB 3CTRA 2UXCF 4TYAA 3I0SB 3UD5A 3OQ2A 3MEDB 5HR7A 1BUPA 5J2PB 2XYPB 2O01C 3RAQA 2RQ5A 1QVFM 2UUAF 3I76A 2KHVA 2FY1A 4V19S 4WIQA 5E84A 3U3YA 4AHSA 2P6TA 3WQUA 2F8HA 5CD4A 2B9EA 4BRDA 3GR1A 9ICHA 3PUFA 3ZZRA 1K73O 2V2VA 2BJ7A 4FPRA 2RDDA 4ID5A 2B6AB 3VGKA 2DVIA 4IG0A 2EQYA 2W6KA 4LF8J 3GDQA 3IM9A 4FNHA 3HVTB 1C0UA 2I38A 1HJOA 3S3OA 4DR1J 3D6RA 1JRPA 4WYBA 4NXMF 2CJQA 3R1LA 2O8EA 1MN9A 2DPJA 4CK1A 1Q1KA 2NXNA 1J5EJ 8ICLA 5DRKA 1KOOA 3KOAA 2MEWA 4DR4J 5GAGU 4IZ9A 4JHDA 4LJMA 1VQ5S 2QTDA 1FRLA 1DHMA 3IG5A 3IN5A 1O8BA 4HWIA 2PEHA 5AK5A 1D8YA 3HKZD 2QL5B 3IFRA 4PHTX 4YUDA 2VICA 1NU0A 4ECVA 3SQOP 4PYAA 2ZHBA 4USUA 3MPVA 2RH3A 2MA1A 2ZBPA 1S72S 3ONNA 4YY3J 2LU2A 3R5GA 3CPWM 4A8FA 4F3TA 4RU2A 3CC7S 3G87A 1VISA 5B09A 1RWXB 2L08A 1GX5A 4Y3CA 2QA4N 4M9JA 4PA1A 1VSHA 3MCSA 1UZHA 2NSCA 3DXSX 4I7FB 2V9KA 3M30B 1ZQCA 5EU7A 3NAHA 1CLQA 5J1PA 4NO7A 1WWUA 2IVPA 4DPYA 4BR2A 3R8YA 1LV5A 2FMSA 1ZQRA 3FMWA 3QDKA 3Q8YA 3UCGA 1UW9A 3HJFA 4ILHA 1Y88A 2W7PA 1X1PA 1WAJA 1GTHA 3GSIA 1DARA 3AVHA 1CULB 2PMZC 4KHWA 1SQEA 1AA1B 2KVSA 3MM9B 5CQGA 4Z6CA 5FPNA 1ZQFA 2V8PA 3C8YA 4AQYF 4U9RA 3ZETA 2WCXA 4ISFA 4A8XA 5AFUA 5KGXA 2HAFA 2IRXA 4J2AA 1ZQXA 5KG7A 5IIMA 3PW2A 4E7HA 2ITMA 3EUB2 1ZQLA 2YX8A 2G06A 2IHR1 4YQWA 4J9MA 4CDIA 3O2IA 2OUGA 3MPWA 2FZCB 3B0XA 3K0SA 4K4XA 1SKUB 3GJQB 4H8KA 2Z4PA 4Z4CA 1N56A 1VBYA 1UEKA 3S1TA 4P2HA 1NK9A 4O4GA 4JKFA 4NWIA 2ZTEA 1RTZA 2KM8B 2CQ0A 2XM3A 1WC1A 1IR1A 1Y3KA 5BYQA 1WCLA 4XK8C 3MWTA 3L9ZA 3CJBA 1F9FA 1UJ5A 3CC2N 1B7YB 2DIVA 2YX1A 3HX0A 2VG6A 1BQNB 5AQTA 4IFYA 3KG4A 2ZHOA 3C23A 1T8EA 4FDFA 4UB6U 3Q8VA 2OFHX 2E1RA 3JSYA 4CNYA 1RWMB 5J1EB 1T9WA 4CRXA 3EX7B 3NASA 1FRXA 3NF8A 2K7JA 5ALHA 4RW8B 1HPZA 3OYAA 2ZUCA 4DQPA 2AF6A 1KOHA 5KG0A 2GQ2A 1RWUA 1RBUA 4ED2A 5B5EU 4FVCA 1CUKA 1ATRA 2RMLA 3E01B 1VSIA 3MWPA 1BGXT 2FZKB 4C97A 1FWPA 1X4AA 2M0GB 2WF8A 2UVWA 3T5JA 4GV3A 1LWFB 1JCEA 3O08A 2H3FA 4KFBA 3F44A 1JLBB 1T6CA 2QB0B 3V7LA 3CCRS 4I68A 1DT9A 4BR4A 3ENOA 5J2EA 3CDWA 1TFWA 1R31A 1NK5A 2OEJA 1ZM4A 1QZ6A 4K4VA 1RILA 4C4SA 4K8XA 2XMMA 5CY4A 3VZHA 3MWBA 1I94F 1HI0P 2MUTA 5BPCA 3NGIA 4F72A 3AGRA 2R7TA 5AE3A 3LPYA 4NV0A 1OUQA 4CE9A 2F96A 2KXFA 1NGDA 1TR0A 4CJTA 3PO5A 3QJLA 3NH0A 1ZQVA 2RQ4A 3FRYA 1S1VA 1F44A 4R5PB 4X64J 1FIQA 2RF2B 5HBMB 2Y0SF 2VKZG 2UUAJ 4HT5A 1Q82O 4EBEA 3SSQA 3Q8MA 4EWTA 3FGVA 1ZRMA 3SUNA 3LOUA 3PHTA 5T14A 2NRTA 4GO7X 3VQAA 3L09A 2XMAA 4CJQA 3O1BA 1Z2LA 3ZSVA 3CSKA 3ILOA 2MU2A 1U2RA 1HR0F 1PAUB 1JLGB 2P5OA 4FW2A 3I0SA 5ALXA 5J0PA 3NFAA 2LQ8A 2IM2A 2W4CA 3BEGB 2R8IA 3H20A 1IXRA 2FJAB 4ZPBA 1KDNA 2ZF5O 1IBMJ 5LOQA 1JCFA 3UWTA 3RBXA 1TL5A 4DOZA 2F4VF 4KLTA 3GZ7A 1WKJA 3LZJA 5LMNK 4LFCK 1OPZA 5G5HA 4I2PA 3NE6A 2MKCA 2B6AA 3I33A 4E7JA 5ADZA 4MN4C 4W90B 2E4LA 4IS7A 3TJAA 2C2RA 4JV2A 3GMGA 4B3SJ 3HVTA 2VJ4A 4P4OA 5D49A 1RB0A 5F0UA 5A76A 4M3RA 2BM1A 4RW4B 2VWJA 3PW7A 5KFNA 2DHSA 4OGCA 3GJSB 3TUJC 1PVQA 3AQPA 2F1FA 4KE5A 5IWAF 3JQKA 3NCQA 5H9FK 2RPIA 1W0HA 3L6QA 4QR1A 1GXUA 4CJ4A 5KFPA 1XNQK 3EYZA 1ZZNA 5LM7E 2HNYB 2IOFA 2HHVA 2RHKA 4BXOA 3DRSA 2BKNA 3K5NA 3ZTOA 2FE9A 1U6BA 2WVDA 1S5JA 5BR8F 4LFAF 1JXBA 4YB5A 1HL6A 3AT1B 3ULEB 3P6YC 1R6VA 2WTUA 4FOIA 1N34K 1MWKA 3QWUA 4AQYJ 2Q97A 3BQTA 4OHWA 3BDEA 1ZS6A 4I7FA 3M30A 4DTNA 1NGIA 3VERA 2Z0GA 3JPSA 3PRDA 5AQPA 1T9YA 2NYHA 3WK6A 1OKJA 2DNRA 3K5PA 1WTBA 3ORYA 2KSOB 3MR7A 2ASOA 3SSRA 2NSBA 2GAHC 3GFZA 3V6DB 3F53A 5ETVA 2E5SA 3MDQA 1CULA 4K4WA 2H5IB 3NBPB 3CNHA 4P4PA 2DXEA 2DUYA 5K20B 5LJVA 1DRZA 4FYDA 1RTDB 3VF2A 1V3RA 4X66K 1VRTB 1XERA 3FZLA 8ICJA 1RTIA 4A5BA 3ELHA 2IA6A 1FWLA 2FJ6A 1RAGB 4X4TA 2FI1A 3KNAA 1C4CA 1UWAA 4EP4A 4RUBA 3I5BA 8ICIA 2E9TA 1SL2A 2YKPA 4DL2A 4DV1K 1NGBA 2YTCA 1SB6A 1UVKA 4NEYA 4G1PA 2QV6A 3HWTA 4KB1A 4X4QA 2ZHAA 3RJJA 2VJVA 3J7AP 3N4PA 2MHNA 3AVGA 4HT7A 4OI1A 2XY7A 3OVNA 1EB0A 4JEPA 1YI2N 2B56A 4M8LA 2A1AA 3MFHA 4JRPA 4A46A 2J7UA 4NPOA 1N5TA 1WG8A 4DFKA 1DURA 1U1QA 4JI4J 3FDSA 4P72A 1BQNA 1URJA 2QMXA 2UUWA 4EX6A 2ZIVA 3GFHA 5DDPC 2MMYA 3TFRA 1Y4ZB 2G9OA 5J1EA 4DTSA 1FI4A 4P6QA 4F02A 3OYKA 1FXXA 1WOSA 1K9MO 2XIDA 3FBBA 1X2IA 2HHSA 1HQ2A 2FJDB 3I5AA 2JWKA 2ZJRQ 3OYLA 1IKYA 1KC8T 1I94J 4I29A 3TEGA 4JI3F 3ETLA 2GX8A 4KV8A 1SIZA 4NEZA 4IEIA 3P31A 2IJFA 1RLDA 3PEHA 2QRRA 4ISGA 1D5AA 1JLBA 2BPGA 1QQOA 5D0GA 4BRLA 2QB0A 4H0TB 3VQ7A 1MQ3A 2G0IA 4Z2XA 1PGZA 3MEGA 2HS0A 5TKYA 1AB8A 1T94A 1KQQA 1A7GE 1WOOA 2GBZA 5CRXA 2QK9A 3FR0A 4F2SA 2CIMA 1REGX 2XS2A 3U26A 3KNGA 1V5VA 4KHUA 3AAPA 2KK0A 4BWJA 3NNAA 2HIQA 2Y9TA 1Z4OA 2AQ0A 1N0VC 4KIAA 1HYZA 3TADC 4KR0B 2W3RA 5B0BA 1HR0J 1LOUA 1NHKL 2DFFA 1WDDA 8ICYA 4UQTA 4O5EA 2P6RA 4PZOA 1KKHA 3ITHA 4DG1B 2Q0UA 3EVOA 5AI4A 1KLMA 1ZYQA 4OHYA 2Y1LB 3MFIA 2C2ZB 2D3ZA 4UB4A 4UUWA 2DIUA 3ZSOA 1MLAA 4Y2TA 4UZBA 4YMOA 3KFUF 1URNA 2KKPA 1B4SA 2QM1A 4YCXA 1BPZA 3G8SA 2CZVC 2WONB 3GG1A 2QA4S 4DV2F 4CZIA 4IUFA 1JLGA 2BKEA 2KD1A 2P35A 4NJ8A 3H8SA 2IHMA 3D1QA 4M7XA 1VSKA 4EIAA 3L3VA 3ZTSA 4RQ8A 2HNDA 2FBTA 1H6KX 2A6MA 7ICNA 2B51A 1I51B 3QLHB 3NVYA 3RBDA 2EXUA 3HD2A 5AI8A 2OEMA 4QZGA 2PFQA 3CD6N 4USTA 2PZSA 5IWAJ 1BC6A 3H7HB 3HMJG 4RQ6A 2EFOA 3D28A 3HVRA 3VQTA 3G4SN 2JC0A 5A2QU 4NLSA 2BRKA 1DK3A 2HS3A 3O3GA 1H1VA 1CJKB 2V5HG 4QZHA 3HSGA 1EXNA 4LF9K 2VQEK 3A1YG 5BR8J 4E7LA 2NPIA 1PJ6A 1FE0A 1OO0B 3W60A 4JD2B 3Q2TC 4DOCA 2P9SB 3I5CA 2ALYB 3ENWA 1SKWA 4DF4A 2OPRB 1IN0A 2VQFF 4K7QA 1VC6A 3DC2A 1IH7A 4EI2A 1B9DA 1ESVA 1T95A 3LP0B 2CG8A 2QLWA 2YPZA 2NRRA 2HNYA 2XI3A 1Y10A 3CC2S 3QYYA 2MKJA 3UFCX 1W97L 2F40A 4H4OA 2VFVA 2PSZA 3EPGA 2ZBRA 1ZA2B 1Q0NA 5THWA 4C8MA 4F5QA 3BKUA 3OYMA 4C98A 4OLBA 2F8KA 5JTIA 2GVZB 3MX2A 5K14B 4H03B 3L7OA 3ET6B 4DL7A 3JTPA 2BANB 1GX6A 1A5VA 1SH3A 4PZVA 3IO1A 4BBYA 3CW2C 2LA4A 1KTQA 3DRYA 4DPTA 5EWGA 2VKRA 4A8SA 2D8CA 1EETB 3UN3A 4QWEA 3AD8C 1VLBA 1J2MA 2L48A 2EPIA 7ICOA 3ETOA 3AXMA 8ICVA 3RW6A 4IL6U 2Q6CA 5IV4A 4BUGA 2DR7A 3THWB 1I6JA 4XDCA 4DFMA 3OR2A 1Q95G 1UWBB 1RTDA 2RD5C 2KG5A 1VRTA 4JI1F 1S6QA 3FYHA 2DCLA 2XMUA 2QT7A 4PGXA 4H4KA 4KREA 1UEUA 4JYAF 3CD7A 4ICAA 1SJQA 4ECXA 2LM4A 5DGAA 2J8AA 4DZDA 3CCSN 1R8CA 3EZOA 2KZ3A 2MQNA 2VYPA 5KFZA 2K4EA 3QWPA 3WC2A 4N8OA 2OI2A 3V81A 4K0KF 2EG1A 2Q43A 2IYIA 2BW7A 2RSQA 2EW9A 1DKGD 5HL7Q 1QM9A 4M5JA 4NL5A 2GA7A 3OBWA 2LM1A 3SQ4A 4FJ9A 3HP9A 5J0YA 3M8WA 4RNNA 1UPPA 1R59O 1IBKK 5H9EK 3SZ2A 1VBXA 2FF3B 4QW8A 4JI3J 5AQGA 1G7CB 3R5DA 2W3SA 5AQLA 3DRRA 2HVIA 2QZ8A 4EO8A 2JHDA 4H4MB 3BEXA 1OW5A 4JI5K 3OYCA 2B6GA 1T3NA 5A2QO 4OHXA 2B9YA 3KKRA 2CZ4A 3B6OA 1WSEA 3PYGA 4ETZA 2CZ9A 5HVGA 3HL8A 3EWAA 3RWUA 1U8WA 4F4XA 2IGIA 3AA3A 3SBMA 1WSVA 2J7KA 5HO4A 1XSLA 5CHIA 2MZQA 4NLBA 2ETJA 4MYTA 1FE4A 3PX4A 2VG5B 3KKSA 4LJXA 3CJ0A 5E2QA 4C7QA 3D2WA 3WXJA 3D6JA 1ZQKA 4N56A 2QN6B 2APOA 4WFAQ 5HROA 3PJXA 1F5BA 4ZS6A 2HHTA 3Q89A 4TVAB 9ICVA 2U2FA 1KQGB 4GVBB 2E3TA 4X4PA 4ZTFA 1UCNA 3IDHA 4FJNA 2OLWA 4M5GA 1UOCA 2HHWA 1RT5B 2NUBA 1T11A 1RI7A 1TUYA 1NSPA 1B7FA 2VL1A 5AM3A 4C4WA 3PX6A 5J8YA 2W43A 4CBWA 2B5JB 4QZBA 3NGZA 1IWAA 1L5UA 4CEFA 3HHKA 4CJ3A 2BJ8A 2YTUA 5L39A 4WXOA 4RLEA 2CRXA 1S4FA 2EDUA 2ZUAA 4RKUC 1VAZA 2XO6A 1IM4A 8ICHA 3RB3A 2AMCB 4KGKA 2PFOA 7ICFA 1JXLA 4DF8A 4OX9K 2AWZA 3DLEB 3B8HA 3QT6A 3GV5B 1RT3A 2YKMB 4F50A 3C15B 2PT0A 5HHHA