2HHUA

C:o6-methyl-guanine in the polymerase postinsertion site (-1 basepair position)
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*CP*C)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 216
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhuA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhuA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhuA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhuA01
1I3AA 3AVLA 4FK2A 2ZTDA 1CLQA 3PY8A 4R64A 1NJWA 4O9MA 3RBEA 1ZQKA 2VG5A 1TVAA 3WNFA 3NGIA 2HHWA 4CIGA 3NGYA 1L5UA 4RU9A 3LWMA 3TAPA 2OWOA 2YNFA 3K5MA 3B6PA 4IG3A 4DSEA 4ED7A 5J0WA 3PX4A 3RWUA 1TKZA 4I27A 1KRPA 2IMWP 2ZTEA 4DS5A 5D3GA 2IC3A 1N5YA 1ZETA 5KFBA 4F5PA 5KG0A 1LW0A 3VQ4A 4FZYA 2R8KA 5CA7A 4EYIB 2RDJA 3OS1A 4PWDA 4CEZA 1MQ2A 1RBRA 4O55A 1L3VA 1QSLA 1HYZA 4M9JA 4P4OA 4HUFA 1HQUA 1RDCA 4Q8FA 1T03A 4GMJB 5KRTA 4ZHRA 4CFBA 2KQ2A 2H5XA 4KLFA 4IQUA 4PUOA 2BQRA 1HJRA 4DQRA 1Q8IA 5J2PA 4M9LA 2M9NA 4KLMA 1VSFA 2VA3A 4OLAA 1S9FA 3MR2A 9ICLA 3LP2A 4C8KA 3RMDA 1YTUA 2XGPA 3RTVA 1KTQA 5DG7A 3DYAA 4KV8A 3GIJA 3KHLA 3SPZA 5J2BA 4JV2A 4WE1A 1HPZA 3AVKA 4DEZA 4M9NA 3HXMA 4FO6A 4K4GA 1BI4A 3TAMA 3TI0A 3V4IA 4YNQA 3I8DA 4M3RA 4IQWA 4ZTJA 1KLMA 4F3OA 2BCQA 7ICFA 5KGXA 1TL3A 5DQHA 9ICOA 2GUIA 4JUZA 5KFLA 8ICRA 1C0UA 8ICZA 3S3MA 2C2DA 1GOCA 4CJFA 5KFSA 5HROA 3PW2A 1TFRA 3V9UA 3NCIA 2A1JA 1S76D 2W9BA 5KT2A 1S0VA 1RTDA 1KFDA 4RPXA 1RILA 5DQIA 4ECUA 2PXIA 4RW6A 2YNGA 1WNSA 5CYMA 2IAJA 4TUSA 5F9LA 1ZBLA 1KDHA 3DLGA 4GW6A 4IRCA 3PW7A 1VRTA 2X6NA 2JEFA 1S9EA 3HSTB 3LAKA 3RB4A 1MC8A 2G8HA 1RBVA 3DOKA 3NFAA 1ZQAA 5I42A 1TVRA 3ZSOA 2PYLA 5DLFA 1VSDA 3OSPA 4LH4A 4YR2A 1QLNA 3MR5A 4DF8A 3HO1A 4PH5A 4EYHB 3RJHA 4FJXA 4DQQA 3BJYA 1HUZA 3MABA 1S0OA 9ICJA 2BE2A 3AVIA 3HPGA 5KFDA 7ICSA 4F5NA 3C21A 4I2BA 3SNNA 3ZT0A 1ZQOA 5KFTA 3PW0A 3ZDCA 1HNVA 3G6YA 4Z4GA 1ZQBA 4KTWA 4CF1A 3M8RA 1MU2A 3DLEA 3O4NA 4J2AA 4Y1DA 4IR9A 2G8WA 2QXFA 5IIOA 1N48A 5KFUA 1NK7A 4FZXC 2FPLA 1EKEA 4KI4A 4ED0A 5KFHA 4YXMA 4H8KA 4XQ8A 1U4BA 4L8RB 2RN2A 3QO9A 2R8JA 4HHTA 3IHQB 4RUAA 4QZIA 1TAUA 4ELTA 4CK2A 1K1SA 4DL4A 5EWGA 5D4BA 1ASUA 4I29A 2UVRA 4RT3A 1RDBA 4AHVA 9ICRA 1ZJNA 1FK9A 3P83D 8ICLA 1TAQA 1UA1A 5HRPA 1K1QA 1IXRA 5IIIA 4O0JA 1YVUA 4PPXA 4FCYA 1JL2A 3QNOA 4I2DA 1JXLA 2UVVA 3G10A 3M8QA 4OKEA 3ZSVA 4GXIA 5L1IA 5HRRA 1SUQA 8ICJA 3QINA 1D5AA 3VQCA 2RPIA 2OZMA 3ZSZA 4AHCA 2ZUCA 4ELVA 4NCGA 1BQMA 3K5LA 5I3UA 1A5XA 4ECYA 4N47A 4M3UA 3QEPA 5DK5A 4F2SA 1BIZA 1KVAA 1A5VA 1RXVA 3SCXA 4IRDA 1X9MA 4DTNA 3LZIA 2Z1HA 3K5NA 1JXBA 8ICXA 5DB8A 4J9MA 3MGHA 4O0IA 4F4WA 4DQPA 1XC9A 1T7PA 5EU7A 3LDSA 7ICLA 3TAFA 2KN7A 3RRHA 4RQ8A 1D8LA 3TQ1A 3KKSA 3G6VA 4PA1A 3KD5E 3T3FA 4XA5A 2DFLA 4RW4A 3V6KA 1X9WA 7ICKA 2OYQA 3ISNC 4CK1A 3OYBA 4RNOA 2JEIA 1WLJA 7ICOA 5J2KA 4CGJA 1YTAA 4DS4A 4IKFA 4F8RA 2B21A 1TK8A 1XHZA 4RUCA 5CHGA 4Z4CA 1J53A 4F3TA 2XO7A 2W9CA 4MFCA 5KFVA 2O4GA 1NK0A 1R0AA 2RF2A 4ED3A 1SKWA 3AO4A 5J2AA 4OKJA 2FMQA 4ICLA 5DMRA 4KLHA 4F4ZA 1ASVA 3QZ7A 1BPZA 4UB2A 4FBTA 4MFFA 4QZAA 2BHNA 3GDXA 3AVBA 2NRZA 4M9HA 4YP3A 1KFTA 3QEVA 4DTMA 4CEQA 4KHWA 3JPPA 1T4GA 4YFKA 2ITGA 4MEYA 2E4LA 3V81A 1UT8A 4QZEA 4TUPA 3CQ8A 2KZ3A 1BI4B 1U9LA 1HRHA 4BE2A 4YQWA 4Q44A 2QKKA 3L2VA 5IIJA 3DRRA 4KLOA 2XCPA 3JPNA 4B3OA 3KJVA 3EZ5A 4N41A 1WSFA 2HW3A 4K4HA 3CFRA 4O5KA 2A1JB 1XS9D 3RAQA 4B8CA 2JEGA 1COOA 1EETA 3AVJA 4DU1A 3KK1A 3JPOA 2VG7A 4RPYA 4PY5A 4LSNA 1JLQA 1SKSA 3NE6A 5HHIA 4GLXA 3PW5A 1SL0A 4FXDA 3EW9A 4Q5VA 1U47A 1VK0A 1VSJA 4I9LA 2P5GA 4DOCA 3JYTA 4ECQA 4RQ3A 2RDIA 4DWIA 3FYHA 3THVA 5KFMA 5CWRA 2FBVA 4UBCA 3LDAA 4FYDA 4TURA 2XY7A 4MF8A 5DKWA 1LB2B 1KFSA 2YNIA 4QAGA 5T7BA 2R8IA 3MR3A 3VQAA 3E01A 1T05A 1JKHA 2MUTA 4KITB 3PMNA 4RQ6A 4QOZB 1S97A 1ZQLA 1CUKA 3ISBA 5DDYA 2C28A 3BQTA 1NK5A 8ICFA 9ICUA 4DF4A 3VQ6A 3OHBA 3PO5A 3MEGA 1J5OA 2BQUA 4K8ZA 3Q8KA 3V1QA 2YV0X 4UQGA 4UB3A 2E6MA 2V4QA 1KLNA 3NF7A 3RJEA 1NJXA 3H8SA 3KK2A 3C2LA 4Q0BA 4CGFA 4QWEA 3EYZA 4O3PA 5K14A 1T3NA 3OYFA 3VQ7A 4DL3A 3QESA 1RBUA 4PHDA 4ECZA 1CZ9A 1ZQPA 2EX3A 3PW4A 1QHTA 2KW4A 3T19A 3MBYA 5J2DA 3EY1A 4EBDA 1RT4A 4Z6CA 1SL2A 1YT3A 3OGUA 2YHAA 3P1GA 3NDKA 4O5BA 1F21A 4C8OA 2D0CA 1ZBFA 4O3OA 1ZQDA 2PFNA 2WTFA 4EEYA 1HNIA 3T1AA 2R7YA 5HBMA 3GV7B 1ZBUA 3DMJA 9ICPA 4H4OA 5DB6A 1ZQGA 3L2WA 4I2EA 1EXNA 3DLBA 2MAXA 4E1MA 3C23A 4CGGA 3KLGA 2ASLA 4RG8A 4ECWA 4R63A 8ICNA 3SYZA 1Y97A 3I0RA 1JLAA 3SUOA 1Q9YA 1TV6A 4YXJA 4G1QA 3T5KA 3LAMA 2Q0ZX 4KLEA 1C1BA 3MAQA 4CHQA 5KFKA 2DPJA 3OS0A 4E0DA 4FJ8A 2F1JA 2JGUA 1UWBA 2I1QA 5D46A 5J2CA 4DSIA 4AHSA 3HPOA 3RMCA 3KLEA 3ZT4A 2BPFA 4OPKA 3BDPA 3KHHA 2P66A 4CJQA 1BPYA 1RBTA 1BCOA 4RT2A 3V1OA 2IOCA 2HHSA 2D0BA 3M9MB 2YHBA 3LALA 3KK3A 4CEOA 1VSMA 4KLLA 3OYEA 1VSEA 3ASMA 5L1KA 4XUSA 4CHNA 2JZBB 4YMNA 4CECA 2W9CB 1BGXT 2DPIA 4F5OA 4B9SA 2GBZA 1L3SA 3O3FA 4YCXA 2JLEA 4CHPA 4ID5A 4GXJA 4CIFA 5E41A 2YKMA 1TK5A 1TKXA 2HVIA 4FJKA 4PHAA 3K57A 1QSYA 4KLGA 3AV9A 5CYQA 1ZQUA 1BPXA 3RJKA 4QZCA 4O3SA 1S1XA 4IR1A 7ICGA 3QZ8A 4KLJA 1G15A 5L1LA 1S1WA 3SI8A 4KHUA 3OYLA 4F5RA 4F50A 1BIUA 2AGQA 4I2QA 3ZD8A 1B92A 3RJJA 3UXOA 3NH1A 4Q45A 4DTJA 3CFOA 3B0XA 1IH7A 3Q8PB 2AGPA 4CE9A 8ICVA 4LVSA 2ZJ8A 4KTZA 3H40A 3TANA 4F92B 4QCLA 1RZTA 4UAYA 3RB6A 4O44A 3LPTA 4EZ9A 3RJIA 3VQ5A 4IQVA 5C25A 1HQEA 2FLNA 3RMAA 2FLPA 2FBTA 1WSIA 4YN4A 5C5JA 1JLFA 2W9MA 4CIEA 3OYGA 4AHTA 3IRXA 4DMNA 2X6SA 2FPMA 4HUEA 1TL1A 4RQ7A 2BKEA 3NF6A 1S6QA 1IKXA 8ICOA 4Z6DA 1ITGA 5KG4A 3ZT2A 1Z25A 3SUNA 3KLHA 3NF9A 1SV5A 1JIHA 4M47A 4QWDA 4ED8A 1SL1A 2ZUDA 3JPSA 1S1UA 1ZQCA 2ASJA 4FJ7A 4AHUA 3C6TA 3VQPA 3ISCA 1D8YA 4DFMA 3P5JA 4M0AA 4F5QA 4E1NA 4GXKA 3QEAZ 2MUTB 5J2GA 5KFEA 3RH4A 2ISOA 7ICEA 3VQQA 5C24A 3DRPA 3HL8A 1A5WA 4UAZA 4DQSA 2PYJA 2DFEA 2AJQA 1L3TA 2QKBA 3HM9A 5CZ2A 3SQ1A 4RQ2A 5CB1A 4CFAA 1B9DA 3DLRA 3FDSA 3DOLA 4HUGA 2G8KA 1ZBHA 5JS2A 4E89A 3HYFA 1S10A 3ZT1A 4DU3A 4M3XA 4KHSA 1JX4A 3KKRA 3QETA 2PI5A 3L2QA 4AILC 4RW9A 4I2IA 2RKIA 2HMIA 4OKKA 5J0SA 5IINA 3DI6A 3PV8A 3SUPA 3V7JA 3ZSYA 1EX4A 5KFJA 2BCUA 3PR5B 2YNHA 4DOBA 1MSWD 4KO0A 3AVAA 3BQ1A 4E7LA 3LWLA 1XSPA 4B9TA 3RR8A 2X74A 2W8LA 7ICQA 2NUBA 1A77A 4CJLA 4BWMA 4FVMA 4DTRA 4JRPA 4FJLA 2VWJA 1I39A 4W5QA 2UVWA 3IG1A 4I2PA 4Q8EA 5FRMA 8ICKA 4CF9A 4PQUA 1IG9A 4CJTA 4O3RA 3NH0A 1VSKA 4C8NA 4CESA 8ICCA 3MR6A 1BPDA 3UPQA 7ICIA 4DTPA 3MGIA 5J0OA 2IA6A 3VQDA 3QIOA 4E7KA 2F1HA 3RBDA 4I9QA 4KRFA 1CEZA 5D49A 2BR0A 4FLUA 3Q8RB 1XWLA 9ICKA 3Q8SB 3AVFA 4DFPA 1LWFA 4CK3A 3PO4A 3H8WA 3RJGA 2VG6A 4KKOA 3V9ZA 1RYRA 3OJSA 1WSJA 4FS1A 4FW2A 4RQ0A 1IKWA 4KMUA 4FW1A 2JEJA 3OVNA 4CGIA 3Q8LA 3L3UA 4LY7A 4QZ9A 3HWTA 1S0NA 3RH6A 3U6FA 4MQ3A 4BE1A 1ZQWA 5CP2A 3FFIA 3OYDA 4B9MA 3K4GA 2W9AA 2ATQA 3AVMA 3LK9A 1RTJA 4J2DA 4LZGA 3ZCMA 2OZSA 4UBBA 5KG1A 9ICVA 1W0HA 2F96A 4FLYA 1RXWA 4DSFA 4M04A 2VA8A 1QQCA 4TQRA 3M9NB 4O5CA 2I5JA 3RR7A 4CERA 4O4GA 7ICTA 1XHXA 4Z6FA 3HW8A 7ICNA 2IHMA 2IS3A 5KRSA 3RJFA 4Z4IA 1UT5A 3C94A 3DLKA 4M3YA 1ZYQA 4O3QA 4F4XA 4KLUA 1BPBA 3OHAA 2LSNA 3QERA 1BPEA 4DL5A 4PGQA 5J0RA 4CEEA 4ECRA 3HVTA 3NHGA 3NGZA 3DRSA 4H4MA 3C2KA 4QZFA 3AVGA 4Z0UA 4QWBA 3AO1A 3O3HA 4TSXA 3V9WA 5KFPA 4M45A 4G3IA 1RNHA 3M9OB 1RCHA 2P5OA 1L3UA 4JV0A 5L1JA 4CEFA 2FMSA 3AVCA 5KG2A 4C8LA 4I28A 4CJKA 4RW8A 1LWCA 8ICMA 3C1ZA 1RT3A 1Q9XA 3OYNA 4CJSA 2ZUBA 5DB7A 4JK1A 4CJWA 3EPIA 4FS2A 4FLZA 4QWAA 1U48A 4R8UA 4DTOA 3NGDA 1VSIA 1N6QA 3KTQA 2VWKA 4OGCA 1ZBIA 1TGOA 1Z00A 5F9NA 3C95A 3VQBA 3KIOA 4KB0A 4QWCA 1FKPA 1QE1A 4DO9A 1XI1A 1BVSA 5FDLA 4NCBA 5HNKA 3KHGA 2ALZA 4N5SA 3ITHA 2HNYA 4QZDA 4FJ9A 2ZJ5A 5SZTA 1X1PA 1K6YA 8ICAA 2W9BB 3QIPA 3NH2A 4AHRA 3IS9A 1ZQEA 4DG1A 2Q3SA 4B9UA 5J29A 1ZQIA 3MFHA 4MEXA 2ZTCA 4GC7A 1LV5A 3VA0A 1S6PA 4CEDA 4DOAA 4HVJA 1LW2A 1RDDA 3VQ9A 7ICHA 2BDPA 1ZQHA 3S3NA 4GVMA 4EBEA 4R65A 1JLBA 1V9PA 3JPQA 2PFQA 8ICWA 2KFZA 1KSPA 3T5HA 4KTQA 1J9AA 4FJNA 2XCAA 2Y1IA 4F93B 4ECXA 1JXEA 2BANA 2G8VA 4M2YA 1IM4A 3SQ4A 3QEBZ 4CJ3A 2DTUA 1BL3A 4NLNA 4OVLA 1HYSA 3NAEA 2NRTA 1QTMA 5J2QA 4UAWA 5J0XA 3OYIA 4Z6EA 4HYKA 1HUOA 2XRIA 3SUQA 4ID1A 2FBYA 4NLGA 4IG0A 3O4QA 2D5RA 4E7IA 4F4KA 2BGGA 4FBUA 2KZMA 4KLQA 2QK9A 1TV9A 3V6JA 2HHQA 5KT7A 2DFFA 4J2EA 4X5VA 5JUMA 1S77D 4YR3A 4CGHA 1RBSA 2A1RA 2Y1JA 2BCSA 1GOAA 3RB3A 2IDOA 4JWNA 3OYMA 5KFCA 1RT5A 1WCNA 3AO2A 5HMMA 5DG8A 3WNHA 1ZQQA 2E6LA 1DTTA 3GV5B 4I2GA 4M3ZA 3PNCA 2OPRA 4YD1A 2C2RA 2GV9A 2C2EA 5BOMA 2FMPA 1A76A 4K4IA 4FM0A 8ICQA 4NCAA 1B22A 3C5GA 3AA5X 1LWEA 3OYJA 5KFOA 3TAGA 3G6XA 5KTQA 2XY5A 3OY9A 4KLIA 4LZDA 5KFNA 3PUFA 2J6SA 2AGOA 2VANA 4KI6A 3MECA 3SV4A 7ICPA 5J0YA 3KLFA 5IIMA 4FJ5A 3LPUA 3F9KA 3TWHA 5J2JA 4CGDA 4BDPA 3Q8MA 4I2FA 3AUOA 3KHRA 2IGIA 4DL7A 3S9HA 1VSLA 1HMVA 4R66A 5DBBA 4B9LA 4KHQA 3L2RA 4RPZA 4NM1A 1S1VA 3VQEA 2FPKA 5J2EA 3K2PA 1D9DA 5CZ1A 4CHOA 1X2IA 3GQCA 3QEXA 4IFVA 4IDKA 4J9LA 1SKRA 5HRNA 1ZQMA 4RQ1A 1CXQA 4XRHA 3HX0A 1KCFA 3OSNA 1CZBA 2WOMA 2ZQBA 1U04A 4NXZA 4J9KA 3OJUA 2YKNA 3OYKA 4IQTA 1MQ3A 1RYSA 2HB5A 2Z1JA 4Z4HA 2GWSA 4QZ8A 3T5JA 3CM6A 2G8UA 4B9NA 3SI6A 1GOBA 3RB0A 4BWJA 1BQNA 4FJJA 3ZD9A 4R8UB 8ICBA 5KG3A 4AH9A 1IKYA 4QW8A 3AVHA 7ICJA 1RT2A 4YG2A 4NY8A 3LZJA 4DSLA 1Z00B 9ICTA 1T8EA 2PFOA 2D0AA 5J0QA 3KLIA 3V9SA 5J2HA 3N97B 4OGEA 1HJPA 5KT5A 4UB4A 4ECVA 4PHEA 4RQ4A 4MF2A 4BACA 4ECTA 3UXPA 4CJ5A 1DGSA 2XY6A 2FLLA 4EP4A 3ZDEA 2P6UA 5KFYA 5CR0A 3LP0A 4KHNA 3B6OA 4BE0A 3L8BA 2XC9A 3C5FA 3M8PA 3OYHA 3SQ0A 3GIKA 4M6WA 5HP4A 3LANA 1NKCA 4EZ6A 3U3GA 3HP6A 3HK2A 3H7IA 1RT7A 4CJ4A 2B6AA 1J54A 4RW7A 5KFXA 1JLCA 3D45A 4W5OA 4QZBA 1WN7A 1NJYA 4TQSA 4JS4A 4BXOA 1NOYA 1XSNA 4J9OA 4O3NA 1ZQZA 4KN4A 3PX6A 3C1YA 1U49A 3BQ0A 2WONA 4JRQA 1LAVA 1ZQFA 3VA3A 4FJHA 8ICHA 4YMOA 4DFJA 4RQ5A 1ZQNA 3K5OA 3TAQA 8ICIA 3MFIA 4IBNA 2G8IA 4OLBA 2BQ3A 4KLDA 5J0UA 2P1JA 3DM2A 4KHYA 2BCVA 2BGWA 1NKBA 4K8XA 8ICPA 5KT6A 1C1AA 1JL1A 2NRXA 4NYFA 3QLHA 5DGAA 3RRGA 5HMLA 2P6RA 1WSEA 5KGWA 3TAEA 1S1TA 4NYNA 1C1CA 4W5TA 3D0PA 4E7JA 1WAFA 2DFHA 2ATLA 4J2BA 1C0TA 9ICAA 3V7LA 4LD0A 5TZVA 3ZSXA 4GC6A 2AQ0A 4J9SA 5KT4A 3ISDA 4P4PA 4IFYA 4IRKA 3TR8A 1N56A 3BQ2A 4I2HA 3HT3A 4JWMA 3N4MB 8ICUA 1RPLA 4DL6A 2BPGA 4FLVA 3I0SA 1VRUA 5KG5A 1WSHA 1NOMA 3TARA 9ICMA 5DGBA 2W8KA 2B4JA 1QSSA 4P4MA 3TFRA 2A1SA 2XHBA 1NK6A 5CJ7A 5BPCA 2P51A 5BOLA 4KAZA 3ZDBA 5KFAA 4CF0A 1NKEA 4ZTFA 4UB5A 4KREA 3WNGA 1EXQA 3GIMA 3V7KA 1JLGA 8ICEA 1O1WA 4DTUA 4Y1CA 9ICXA 4CEAA 2NRWA 4I2JA 1XSLA 4NM2A 4RZRA 4M9GA 3O3GA 3V72A 2C22A 3AA4A 4FJGA 4YR0A 2ETJA 1SZPA 1ZQYA 4CHZA 5DDMA 5KFZA 4CFDA 1Z3EB 4MFAA 4JLHA 2G8FA 3UXNA 3ORYA 2W42A 4B08A 5HLFA 4E19A 3AA2A 5DQGA 1X9SA 3SQ2A 4UB1A 1RTIA 3K59A 3C6UA 4N76A 3RH5A 4CHYA 1TK0A 3CYMA 5KG7A 3VN5A 5KFRA 3AO5A 7ICRA 2ZE2A 3RAXA 5DBAA 8ICYA 3NTUA 2LYHA 1DLOA 4Q43A 4J9PA 4HCBA 2KTQA 3PVXA 4CJEA 9ICIA 2PY5A 2AU0A 1TKTA 1CXUA 5HRSA 4HCCA 3EWAA 3GIIA 9ICCA 4KLSA 1NOZA 2ASDA 3L2UA 3EPGA 3SJJA 4FLXA 5J1EA 4QZGA 4NLZA 1UAXA 4YFUA 4ED6A 4DLGA 7ICMA 5JS1A 4DLEA 3OYAA 3UQ2A 4CCHA 2J6TA 4FLWA 4TUQA 5EWEA 5DBCA 3QE9Y 2HVHA 9ICBA 3AU2A 3HJFA 1FKOA 2NRVA 1JN3A 4CJUA 4PHPA 4YD2A 1ZJMA 3HVRA 3ZSQA 5J0TA 3CG7A 4W5RA 1C6VA 1PZNA 4E3SA 2I9GA 2OA8A 4DL2A 3H08A 4BDZA 4EBCA 4FM1A 2XY8A 1AROP 5KFGA 1NK9A 9ICEA 5FRNA 1EP4A 8ICSA 4E7HA 4M3TA 2OPPA 1IKVA 1VSHA 4J9RA 2J6UA 2JZBA 1LAWA 5EWFA 2BCRA 9ICQA 4J9QA 2DY4A 1BCMA 4MFBA 4JS5A 3AA3A 1H38A 2B5JA 4FK0A 2R8GA 5KFIA 4F2RA 4CJRA 3BGRA 4FJIA 1ZQRA 4W5NA 1DOQA 4DSKA 2FC0A 3DLHA 3AO3A 1NK8A 9ICHA 4M6WB 2V9WA 2V4RA 5KFFA 4ED2A 3ZSWA 5KG6A 5DLGA 4EP5A 9ICSA 2ZJAA 4PGXA 3K58A 2UVUA 1IO2A 3NBPA 1U45A 2IHNA 1S5JA 1RTHA 4BXOB 3T5LA 3SV3A 2HHVA 8ICTA 3QNNA 5HP1A 4FZZA 4B9VA 1BHLA 4O5EA 1WSGA 4KLTA 3ZSRA 9ICNA 1D9FA 3GILA 4Z4EA 5DB9A 4YMMA 1W9HA 4CF2A 2HHUA 3SZ2A 3U3YA 1XO1A 2OPSA 4CJPA 5KFWA 2ZD1A 4C8MA 4M41A 3HPHA 5IILA 1BISA 3MDAA 3B0YA 3OS2A 4DFKA 1JLEA 1WCLA 4FJMA 5L9XA 3PMLA 3AVNA 3MXMA 2Z1GA 3CFPA 4RNNA 3GFKB 3M8SA 4ZH4A 1RT1A 1JMSA 4KPYA 3MEEA 4BGDA 2F8SA 4JV1A 3GV8B 4P2HA 3G0ZA 4DQIA 4CEBA 1ASWA 4DTSA 3NF8A 1B43A 2HHXA 4DTXA 3PR4A 1C7YA 3VQ8A 3H8JA 5EOZA 4I2CA 1UOCA 4M42A 4HTUA 3ZT3A 1B9FA 4DU4A 1REVA 1ZQVA 2BPCA 3MEDA 4LH5A 5J2IA 2F8TA 3ETLA 4CFCA 2PZSA 2HNDA 2PFPA 4J9NA 1S9GA 3V6DA 5HHHA 7ICUA 3JSMA 3S3OA 5KT3A 1NK4A 3Q8QB 2PI4A 5CY4A 4OPJA 2F1IA 4FM2A 3F73A 3E2EA 2OPQA 3H4DA 2KFNA 3QEIA 3MDCA 1RDAA 5SWMA 4N56A 4RNMA 4M3WA 2XGQA 1C0MA 3V9XA 4ECSA 3SPYA 4DSJA 1ZQJA 1ZQSA 3KD1E 4LSLA 3HP9A 3UIQA 1HYVA 3QEWA 2IBKA 3IAYA 5J2NA 2O4IA 5FROA 7ICVA 5J2FA 3LP3A 3PX0A 4OJRA 5J2MA 4NLKA 2HHTA 9ICFA 4CF8A 4BDYA 4R5PA 1Z26A 9ICWA 1TKDA 4FLTA 4Z4FA 3A2FA 2AQ4A 3JPRA 3MXJA 4ELUA 3OYCA 3H4BA 3ALYA 1UA0A 4KB1A 4I7FA 3V1RA 1NJZA 3TFSA 4QW9A 3JPTA 3TABA 4KFBA 4KN7A 3UQ0A 2EHGA 2ISPA 4F4YA 2FBXA 5KFQA 8ICGA 1KEJA 3L3VA 1FXXA 3MXIA 3IM1A 3ZDDA 4QZHA 3V6HA 4XIUA 3RMBA 3WNEA 3ZDAA 1RT6A 1S0MA 1XU4A 4ED1A 5DG9A 1KVCA 4B8AB 4F91B 4I2AA 2HNZA 4YVZA 3K75D 4PGYA 2X78A 3C2MA 5J0PA 2VA2A 2Z1IA 4CJVA 5KI6A 3CM5A 2R8HA 1DTQA 1QS4A 5C42A 1ZQTA 4FK4A 1WAJA 1KVBA 1Y88A 5IIKA 9ICGA 3LP1A 3AU6A 3ULDA 2KZZA 1ZQXA
chains in the Genus database with same CATH superfamily
1I3AA 2F8KA 1GK8A 2V0NA 1CLQA 3KK7A 3ILOA 1S79A 5CH7B 3KDNA 3UCGA 3UD4P 3RBEA 4NWIA 1L7MA 4DV0J 3LDQA 4DN0A 2Y1LB 1EP4B 4C9DA 1TVAA 3MWPA 4DUZK 4OX7A 5GTIU 3O9UA 2OPPB 2DIUA 2EEYA 4U8VA 4IG3A 5LMUK 2OD6A 1AUDA 5ALZA 3WK6A 2FJVA 4I27A 4MIWA 2IMWP 1N34J 2IC3A 1OWXA 2W01A 1ZETA 5DZ6A 3NOCA 5KG0A 9ATCB 1LW0A 4QR0A 1DK3A 1S5LU 5CA7A 4EYIB 3BZQA 2EFQA 1T9VA 1YJ7A 4O55A 3MCOA 4F0MA 4QIWF 2N3OA 5CRXA 4M9JA 4ETZA 5G0RB 3WUHA 1WHYA 1FXRA 1HQUA 4X84A 1GLDG 2HWIA 1URRA 4ZHRA 1RHRB 2Q0RA 4ZCLA 5LL6d 2EFNA 5HP1B 3C29A 3VQTA 1IBMJ 3ENOA 2K1RA 5A76A 4A59A 1Q8IA 4JI5F 4DJBA 4LF5J 2ZJRL 2VA3A 4OLAA 1S9FA 3HHLB 1NNLA 2NREA 4CF5A 3OW2M 1Z05A 5SUHA 2GVZA 1H2VZ 3JB9k 1KTQA 3D2EA 4KV8A 3SPZA 4JV2A 2QYGA 1MMLA 4WE1A 2ZM6F 2DGZA 3ICLA 1I51B 1CJVA 3AD8C 1FESA 2ZIXB 4K4GA 3V4IA 1BI4A 3TI0A 2VODA 3I8DA 1YG0A 1FEHA 1KLMA 4F3OA 2EG1A 4EK2A 2KKHA 1QQNA 3MEEB 1CLFA 1UJ6A 3OQ2A 4M5GA 4CT8A 3C46A 5C2GA 4F02A 1GLFO 4JUZA 3D4JA 1CULB 3S3MA 2BJ1A 2ZJQL 1LK7A 1VBXA 4HAIA 2V4JA 5KFSA 1V9OA 2CWKA 2FGOA 5HROA 1N34F 4S0MA 3FZFA 2A1JA 1S76D 4PQAA 2W9BA 4FNIA 2AYEA 1F0XA 3LQVA 1H73A 5AK5A 4ECUA 1REVB 4B3TJ 2DKOB 2XTJP 2YNGA 5CYMA 5F9LA 4KR0B 3P31A 2DEIA 4GW6A 5AKIA 1LXNA 5F3XB 1S9GB 1VQPN 3RSEA 3HSTB 3RB4A 1MC8A 4NOHA 2LQJA 2G8HA 1RBVA 1SJRA 3DOKA 4TKTA 5D8HB 1U8SA 1IBMF 5DLFA 2VFUA 1VI7A 4OZ1A 4H0VB 3MR5A 4DF8A 2OPQB 4EYHB 4LF5F 4DQQA 3UD3P 1HUZA 2AF6A 3ETMA 3N7RC 5KFDA 3R2DJ 2CG4A 3QX7A 4IC9A 3OL7A 4I2BA 1FDNA 1NO8A 3ZT0A 3ZDCA 1VQ5S 1F2HA 4KTWA 1MU2A 1M6YA 2W7OA 4JYAK 4J2AA 4ILLA 2G8WA 2HFOA 5KFUA 2CUYA 2QA4G 3CCRS 2PMZC 1EKEA 4ED0A 5KFHA 1Q81T 3CCES 2RN2A 2BJ7A 3FM9A 4A8EA 1OSDA 2K8AA 4A5AA 3VOVA 2HHHK 2YX1A 1TAUA 3TEGA 4ELTA 1YXQA 4A8KA 3MECB 2XSFA 1CS4A 3JSBA 1U2VB 5G4DA 4LVNP 3NGKA 2VV5A 1TFWA 3P83D 2BE9B 1SB6A 4WCEL 5LXYA 1BQXA 4O0JA 4B3MJ 2V69A 4PPXA 4UF4A 5A8WB 3BSNA 4OKEA 3SXLA 3OT9A 4QPTA 3M5RA 1TL7A 2ZIUB 4OZNA 3SSSA 3VQCA 2JMGA 2GELA 1SQGA 2ZUCA 2NXNA 4NMXA 3VEZA 2QL9B 4KQZA 1BWFO 1WWHA 5I3UA 1A5XA 4ECYA 2VCPA 3CJ8A 1HBNB 4F2SA 3CRXA 3EE9A 3ILIA 2Z1HA 3R3TA 2DKZA 4K4YA 1JXBA 8ICXA 1M5HA 1ZTWA 1LNQA 2E2PA 4UOFA 2M52A 4DQPA 4HI2A 2D74B 1KQFB 3TTDA 1B0XA 2Q1NA 3NAHA 7ICLA 4ICAA 1YVFA 2KN7A 3RRHA 4RQ8A 1HBMA 3QBXA 3TQ1A 1B70B 3SCIE 3KKSA 2AZ1A 4Y2PA 2E9TA 3CCSN 4JK8A 1RHJB 5C15A 5CAAA 4RW4A 1HNZJ 9RUBA 3H3NO 2OYQA 1RAEB 2CJKA 4CK1A 4GY2B 4RNOA 3ZI4A 2JEIA 2F7TA 3SD7A 2EFOA 4C8YA 2VIXA 1EWRA 1YTAA 5L38A 4IKFA 2VKZG 4B17A 4RUCA 1KS2A 4FOIA 4DV5J 1HHQA 2VBWA 2O4GA 2CN1A 5KFVA 2AJ1A 4ED3A 5MAOA 1SKWA 1D9AA 3OL8A 2ZWHA 1JALA 4CLPA 4ICLA 4U96A 1S7HA 4TU7A 4KLHA 4B3MF 1DURA 1ASVA 3QZ7A 4IZ9A 5E3PA 4USHA 4MFFA 4UY8O 3MCMA 1UVKA 4F67A 2C2ZB 2NRZA 3DYAB 1GMUA 3UD5A 1KFTA 4DTMA 1Q95G 5ETSA 4CEQA 2IRUA 1GFWB 4OI4A 2VFVA 1IG8A 1HNWK 4DUTA 4TUPA 1HRHA 1B4FA 4M5JA 1PYOB 4BC4A 1U26A 4FFDA 1VQ8S 1UFLA 1UVNA 3ZZUA 2XCPA 2MLXA 3MXHP 2YI1A 2KMDA 1OY6A 4HI1A 2WB1F 1Y0HA 1C0UB 2H54B 4B3RJ 2R7OA 1T9XA 2HW3A 1IXKA 4K4HA 4NXMJ 3I82A 2K06A 2B9XA 1PK1B 1VHIA 3U7JA 1VQYA 5A2QY 4PXBA 4LSNA 4MH8A 1HWKA 1HNZF 5LJVA 3NE6A 1F5SA 5E3AA 3PW5A 1QVGM 4OLOA 1VRTB 1B0TA 2BKOA 1PAUB 4FXDA 1HARA 1S9EB 4Q5VA 3BB5A 1U47A 2KG5A 2Z7JA 1QZ5A 4DV5F 4ZPCA 1OVYA 2PGCA 3PNIA 4RQ3A 5ALDA 1C4AA 2EZXA 2KM8C 3AQPA 2G0AA 3M8YA 4UBCA 3B4DA 2VJ4A 2XY7A 3BO3A 1LB2B 3WZ0A 4QAGA 3MM6A 3VQAA 1XC3A 4QOZB 4RQ6A 2Y1RI 1ZQLA 3ISBA 5DDYA 3TACB 1EB0A 1UVMA 3BQTA 1NK5A 2C1EB 9ICUA 3BP8A 4DF4A 3VQ6A 1YBTA 2OELA 4EO6A 4CZMA 1YKWA 1R43A 1J5OA 3M6UA 2CH5A 2KVCA 1NGFA 5KOWA 1NJXA 2QLFB 3KK2A 3M7VA 3C2LA 1X4DA 4Q0BA 3THPA 3VQ7A 2PA3A 2MZQA 5JICA 2DTJA 3CNHA 4P72A 4B3RF 3ISND 4ECZA 1ZQPA 2EX3A 4NXMF 4FKYA 3J80Y 4NEZA 3T19A 3MBYA 4ISFA 1JI7A 5J2DA 1SL2A 4OYPA 3OGUA 3HKZC 3C6UB 3P1GA 4ZVHA 3JAMY 5BYSA 2BMBA 2FVPA 2PFNA 4EEYA 4K7QA 5HBMA 2ZE2B 2QWMA 4ZVEA 1CJTB 1XTZA 1YRXA 2V8DA 3P5TL 2KHOA 4PHTX 5LMNJ 5AQVA 2GIQA 2HRYA 3M1VA 3T69A 3L2WA 1EXNA 4QR1A 4W4MA 1L8OA 3D7SB 1IJJA 2Q3PA 2JC0A 2GHPA 4RG8A 3PIOL 8ICNA 4WU2A 3SYZA 1Y97A 1Q9YA 2OLWA 3T5KA 3JTNA 3CJ0A 4KLEA 1NWKA 4CHQA 4DR5K 4ZVOB 3D1HA 2CVIA 3CCUN 1NB2A 5HQMA 4C80A 4DCJB 3MMBA 3BS7A 4CTAB 5D46A 1I1GA 4DSIA 5CCMA 3J8AA 3ZT4A 5ALYA 2BPFA 4Z94A 4HTJA 3OTOJ 4JEPA 2AA4A 3V1OA 5KPRA 5THWA 4IH6A 1NMNA 2H48B 2D0BA 2HQCA 2I38A 1SH3A 3KJNB 4DX5A 4X4UA 1VSMA 1G4CA 3GDQA 2P35A 3ASMA 1NSQA 4XUSA 3NNHA 4CHNA 4YMNA 4M5LA 4OZLA 4CECA 2HHPA 2FGCA 4B9SA 1QHAA 3O3FA 4Y2KA 2UP1A 4ID5A 2F3NA 3BBBA 5E41A 4D3GA 1TK5A 1TKXA 2HVIA 5D4PA 4PHAA 2WSCC 4N7TA 2QB0A 2MGZA 5RUBA 1RU1A 4K4ZA 5CYQA 3MN7A 4QZCA 1WOPA 5B08A 4M7XA 3U27A 1JB0C 5AQMA 4BR2A 1HR0J 1R8PA 2RQ4A 4ZMMA 3OYLA 4BX9C 4F5RA 1J97A 3DRYA 1BIUA 3ZD8A 5HL7Q 2D0PA 2IIRA 4ISGA 1FRKA 3V81B 1TYQB 4Q45A 4ZJQA 4ID8A 3LPYA 1PJ6A 1COKA 3PFEA 4CO4A 4Y2QA 2YY6A 1ZPWX 2QARB 4EGLA 4CE9A 1F3FA 4I64A 3DRRB 4BC7A 2ZJ8A 4DHVA 5EX0A 4F25A 4KTZA 4B3OB 3H40A 3KJVB 1VIXA 4JBCA 1BA0A 2A42A 1FNMA 3VQ5A 2OPSB 3K2YA 5C25A 4FWOA 4MLEA 3RMAA 2FLPA 4LREA 5AHXA 1RB0A 4O5FA 4CIEA 3ENBA 1YJNS 4DMNA 3OTOF 4OHWA 3G9CA 2JVOA 4RQ7A 3GWCA 3P5BP 1JLQB 2XWXA 1U6BA 4JI8J 2PIIA 2YWFA 5AQFA 4JI5K 3GR0A 4DBQA 3SUNA 3CC7N 1QJHA 1W26A 2P9NB 1TP7A 5BR9A 2DRDA 4L3KA 4CO1A 2UUAJ 4AHUA 3ISCA 3JTPA 4ALZA 2FJDB 2YH1A 1KN5A 2OHFA 2DXFA 1TUGB 4E1NA 4NA1A 2WSFC 5J2GA 4C1NK 4CGZA 5K8PA 7ICEA 1D8ZA 4TU9A 4LMZA 2FJWA 1HR0F 4QNLA 1KP6A 2DFEA 1YWXA 1N34K 4CFAA 2IVMA 4OJHA 1N52B 1B9DA 3DLLL 4HUGA 2G8KA 3LUYA 4E89A 4KH6A 3LA0A 3FK4A 5DO2A 4HT5A 4X4VA 3G6ES 3CO9A 2V67A 4LQ3A 3A13A 4AILC 4RW9A 1F5CA 1SXDA 1YUWA 1N33J 4LSLB 1NHKL 2KT3A 3CJKB 2A3ZA 3TTCA 2RKIA 3HJVA 3W3SA 2GW8A 1RT4B 5C2DA 3NLCA 3TZWA 2RRNA 5BJRA 1QCKA 3DC2A 2YNHA 5AE3A 4KO0A 4E7LA 2Y8WA 1XSPA 4JI8F 5M1KA 4JAXA 2W8LA 2WB4A 4B1YB 4NLDA 3W9JA 4JRPA 4FJLA 3MMAA 3EE8A 4Q8EA 1YITN 1IG9A 2DGVA 4QPXA 4CJTA 4O3RA 4M5IA 3ZTQA 2UUAF 2YY3A 1BPDA 4FOEA 1M90T 2GHVC 5A8RA 4E7KA 3MM7B 3PIPL 2VFTA 2OEHA 4I9QA 2D7SA 3N6MA 5D49A 2BR0A 3RG6A 5AQIA 4KGZB 1U02A 1F9HA 9ICKA 3Q8SB 3PM9A 1XJWB 3KMQA 1O0PA 4JB8B 3WEEB 2CXEA 5AE2A 1KOOA 1LWFA 4K0KJ 1NAQA 2JH1A 3H8WA 3RJGA 3OFHA 5ADXH 3C14B 1HKAA 2FDNA 3BH6B 2CRLA 3V9ZA 1WSJA 4DU8A 2XHWA 1IKWA 4WWSA 4H5VA 4FW1A 3Q8LA 4QQBA 4LY7A 3HWTA 3MN5A 1S0NA 3I1YA 4BE1A 1FEZA 3FFIA 3OYDA 4C98A 3M6KA 3CSKA 1LXJA 1X9XA 5K8NA 1Z4NA 3AVMA 1H2UX 3CDAA 1ZBTA 1N33F 2HOFA 4IG3B 2JHDA 3K8VA 4M04A 4DSFA 4BC9A 1QQCA 2IC3B 4O5CA 2LPEA 2I5JA 1MN9A 2DPNA 3VGVA 2HAIA 1BG3A 2DXEA 3J7ZO 2YKMB 2JWNA 4BLGA 2YHWA 3MCAB 3N5BA 5DJBA 3W2VA 2IRXA 2IS3A 1JJHA 2Y9HA 4Z4IA 1N5VA 3UNGC 5DM7Q 3T79A 5GAEP 1XERA 3NL0A 2ZBQA 2AD9A 1Q82O 5D4NA 3I5CA 2ZXIA 1EZZB 3HVTA 3NHGA 5L9NA 1SB3C 1FRXA 3C2KA 2VIHA 2OI2A 3O3HA 5HOOA 4M45A 4G3IA 3TVKA 3ENQA 3PYFA 3MURP 4BRNA 2OANA 1U1KA 3A3NB 1GO3F 2CNKB 2IVFB 3QQCD 2YTUA 2AJ0A 4GKJJ 3M1FA 4PG4A 1N63A 3SFUA 4K0KF 2GVZB 3ELHA 3NCRA 2Q66A 4RW8A 3BREA 3NG8A 1S12A 4ZPWR 1L8LA 2ZUBA 1PCAA 1KQGB 1YI2N 1CJVB 4DKWA 3EPIA 1TL1B 4FS2A 2W4CA 4DPTA 5AI8A 5AKLA 4B3MK 4IO1A 5F9NA 3CCVN 1FX2A 1SV5B 1YRTA 3VQBA 1KQSM 4QWCA 4NLOA 1W2BM 1A0PA 1WEXA 4H0PA 5C2CA 1VJWA 3TSPA 4LIWA 3LW5C 2VGNA 2HPUA 2ALZA 3MDQA 8ICAA 2W9BB 1BU6O 5KOXA 1VOMA 1K47A 2KICA 4RPFA 4DG1A 1VQ4N 4QYZJ 4B9UA 1ZQIA 2GGPA 2ZTCA 2HI0A 5CYMB 1WEYA 3VA0A 1S6PA 4OV6A 5C24B 1A0OB 3FNNA 1X40A 1APSA 1O8BA 3BSOA 1RDDA 3VQ9A 3T1YJ 2RD5C 5CE3A 2ACMA 1UPPA 3DOLB 4WXWA 3BN7A 3AAQA 2B9YA 1X7VA 4DPXA 3C15A 1HNZK 4CM2A 4GKJF 2HWHA 4I68A 2G8VA 3L7OA 3CGIA 2HMIB 1Z2LA 4OVLA 3BH7B 3WKEA 3ID8A 2L41A 1SJFA 5F8JA 3MK6A 3ZZZA 4UAWA 5J0XA 4WXOA 2E1FA 1KTVA 5C0YA 3IG8A 2HBMA 2YH0A 3A5LC 3VEVA 5CD4A 3OYIA 4Z6EA 1SWVA 2N1RA 4CT9A 4NLGA 5ETLA 4BUGA 3O9RA 2KJ9A 4V19S 4I2PB 1OH8A 2CJXB 3SBGA 4FF2A 3NVWA 3EM1A 4RLEA 5JTIA 2QK9A 4OJ5A 4J2EA 3FRYA 3N4PA 4X5VA 1CJUB 4ZN3A 1RBSA 1HI1A 4L72B 1S6OA 3ENAA 3POTA 1N4LA 4JWNA 4MAKA 3ZTPA 2YWGA 4Y2MA 4J5OA 3T1YF 1WCNA 1S5ZA 5I3QA 3AO2A 3WNHA 2LQ8A 3LDPA 1DTTA 2Q36A 3C6AA 2ZNZA 3I5BA 3GV5B 4ZVUB 2KM8B 3CJCA 3PNCA 4YD1A 2VL1A 2C2RA 3D66A 3GFXA 2YHXA 1A76A 4K4IA 2H5IB 2RJZA 1B22A 1ZPVA 4JKGB 1FFSB 4F3MA 5KAFU 3VALA 1BD6A 2WB1D 5KFOA 3O9TA 4KI6A 4KC5A 3C7NB 3WQPA 4I6MA 3GYXB 2F4VJ 5J0YA 4PWUA 2QM1A 3QMLA 1PC5A 3WC2A 2GMHA 4IO9Q 2MQNA 4CZGA 3U1NA 5J2JA 3A1YG 3Q8MA 1U7LA 4MYUA 4P75A 2NO4A 4R66A 1HMVA 1JWWA 3MPYA 1HJOA 4KHQA 1MMDA 4WQ4C 2NSCA 4CNYA 2ZC3A 2KHCA 1SPBP 4K4VA 1VC0A 5HVHA 2DY1A 3DRSB 5HRNA 3IWNC 2QA4N 3NAIA 4ICLB 4XRHA 4OYIA 2WCXA 3IRUA 1R0BG 4QIWC 3DXKB 2YKNA 2RHFA 2J8SA 4DZDA 3P49B 3TRGA 5AKHA 4HDGA 1RYSA 3TADC 3M1YA 2IRYA 2Z1JA 4QZ8A 3OTDA 3M2VB 1TL4A 1NXIA 1HIWA 2PFUA 5JVHQ 3ZETB 3O3LA 3RB0A 3HFKA 4BWJA 2YMMA 3SQOP 8ICBA 4R8UB 5KG3A 2EDUA 1WOSA 1RWWB 3IBCB 3AVHA 7ICJA 1RT2A 4NY8A 1JNRB 1FFVA 2YX6A 1Z00B 9ICTA 4BC3A 3OTQA 2EZYA 1ZD5A 1E4GT 4NZ0A 1RCXB 1QE1B 5HR7A 3WQUA 3ZZRA 4UUWA 4LR8A 1YDLA 2HZCA 2F4VF 4BACA 4ECTA 3BGOP 2M0NA 2P6UA 1YRUA 3M8PA 4ZP8A 3N6LA 3OYHA 1KOHA 2XEXA 4P0PB 3LANA 4UOGA 1NKCA 4EZ6A 4BR0A 2ZG6A 3P4IA 1LW2B 2BW2A 3HK2A 3SR6A 1RT7A 4HTLA 1N36J 4RW7A 5KFXA 2EXUA 4P2SA 1FKAF 2CH6A 4RJVA 3G8QA 3SFGA 1NOYA 2HF3A 4PEOA 2FHMA 1XSNA 4O3NA 3H8MA 4OLPA 3OTOK 4IXCA 3DEEA 1X42A 4YMOA 5ALTA 3NOGA 5A6WA 3MFIA 4UOHA 5AZJA 2XO6A 3GG0A 1NLKL 4K8XA 3DOMB 3TZZA 1HYSB 1U0SA 1JL1A 4NYFA 4MYTA 3BS5B 1OQ3A 2HS3A 1UW4A 3PEJA 4UY85 1WSEA 5KGWA 3TAEA 1S1TA 4NYNA 2Z30B 2KJ8A 2A0FB 4OI3A 5ALIA 4E7JA 1RQLA 3KK2B 4J8FA 1NGHA 3OLAA 2DO0A 2CGKA 4J2BA 2ZZNA 5KPZA 1RHMB 3OUYB 2VDIA 5AKXA 1NRKA 1ZC6A 3DGPB 3VF2A 2E1PA 1OIAA 4P4PA 2DGOA 4IFYA 4I2HA 3Q7CA 4WP8A 3RW7A 2QKQA 4JWMA 1SVDA 2WVCA 2AX1A 3CB4A 2YQEA 2ZBIA 4DL6A 1GAOA 2BPGA 2EPIA 3B8HA 3I0SA 2JWKA 4DR2J 2A40A 5BN9A 1YAGA 1X60A 3SQGA 3UMCA 2QW9A 1SZHA 2LYBA 1N36F 3TA1A 2GO9A 4JI0K 2ZWOA 1T95A 4DDFA 4L75A 4ATNA 1HBOA 2NRRA 4UB5A 3THXA 3M2RB 1EXQA 2BM0A 3GIMA 2R18A 1S8OA 1O1WA 2V50A 2YX4A 1ZD3A 4CEAA 2CQDA 3H1QA 2QEXN 4NM2A 4RZRA 3F44A 3CHWA 3V72A 3HF5A 3IDWA 2DR7A 2ETJA 3GMGA 1Q4RA 4MFAA 1Q16B 2J0QD 3QU2A 3UXNA 4BRHA 2PSZA 3M6WA 3EGZA 3TTFA 4NJ8A 4ZVPB 5DDRC 1RTIA 3K59A 5C7PA 5A0YB 3RVCA 4N76A 2QSWA 5KG7A 2WRMA 3VN5A 2KKZA 3AO5A 3D6HB 3LDNA 2HVDA 2W2OP 4J9PA 3PVXA 4CJEA 4F3QA 2W40A 2J8AA 9ICIA 4IH5A 3H2VE 2DNPA 1U24A 4M63A 2MZSA 4ZK7M 2W3SA 1FD8A 3MPWA 4KLSA 2HQ3A 4HCCA 1BLUA 3SJJA 3FZ2A 2ZGYA 1K73O 3F56A 4H5WA 2QRRA 2GX9A 4YFUA 1S4FA 1W2IA 2E1ZA 2GH1A 4BQLA 1PUZA 3OYAA 3UQ2A 4DR2F 1TKXB 4KH5A 3ULEA 3SCLE 3HHDA 3AXKA 3TNVA 5EWEA 1FRIA 2P2CB 2QB0B 4GRSA 3UN3A 4KT0C 4X65J 3QJJA 1NLVA 4NI2B 2IPOB 3AU2A 3MOZA 1F5BA 1R59O 4ZLJA 3HJFA 2NRVA 2GMJA 2K60A 3IKMA 5L39A 1C6VA 2VB6A 4E3SA 2LKZA 2OA8A 2FTRA 4CZKA 3L4IA 1AROP 4YN3B 1Y3JA 1U2FA 4YB5A 5ALKA 2QL5B 1OPIA 2LM1A 3PSIA 1UPHA 2A2CA 2DY4A 4MFBA 2G1HA 3AA3A 2B5JA 4IFEA 4FWLA 5KFIA 1QVFR 3CPWR 4FJIA 1G1XA 4W5NA 1ED1A 1DOQA 4IO8A 2DHSA 4CO0A 1NK8A 1GLCG 2G4BA 3MM8A 3I33A 4M6WB 1RSCA 2V4RA 2WB1C 5JRTA 5KG6A 4BC2A 4V19J 1N2XA 1Q79A 5DLGA 1WC1A 2B6AB 3WKDA 2ZJAA 2CPXA 2UVUA 3CC7S 1U45A 4LF4K 4YS2A 4M7YA 3QATA 4NEYA 2IYGA 3D3BJ 1IVZA 4DOZA 5LSRA 4E8UA 1WSGA 2NRHA 5HQLA 1NG9A 1WEZA 1D9FA 4HR2A 2MZ1A 4X65F 5C2FA 3EMTA 4K5SA 1W9HA 2HHUA 2OMOA 1U2RA 1MWKA 3U3YA 1CQMA 5FJ4A 4CJPA 4FYXB 5KFWA 2UUTA 4FNHA 4F0KA 5BR8J 4FWKA 3MDAA 3B0YA 1JMTA 1JLEA 1WCLA 1SH2A 3BM7A 4GNIA 3QLHB 3WK4A 3JTOA 2JXJA 5KPTA 1T9TA 2O1PA 2BDUA 1WI6A 3OBIA 2DR5A 2NCKL 1CPZA 4Q2LA 1C0TB 5B5EU 4W90B 4KX3A 3AOCA 3KUEA 1FCAA 2ADCA 4CZHA 2F9DA 2ZJPQ 2AP1A 2ASOA 1ASWA 3EXCX 3FZKA 1T9UA 3G82A 4M63C 2RKIB 1F60B 5CA5A 3IC1A 2DVIA 4DTXA 2P9KB 3IMXA 3H8JA 1SC1B 5EOZA 3HCXA 3MUTP 1OYEA 1UOCA 5JLHA 2F8LA 1SCJB 4FZVA 5F8GA 3NS1A 5D4LA 1ZQVA 1T9YA 2BPCA 2OXOA 4A8QA 5AQNA 5DDOC 3WHIA 3MM5A 1OY9A 4GKJK 1RAHB 3V6DA 2RS8A 1QM9A 2YKPA 3JSMA 5KT3A 3H2UB 3MAAA 3NS5A 4U8YA 3VCDA 2ODGA 1JLGB 3KG1A 2Z0GA 5A8RB 1YITS 1SC3B 2F1IA 4FM2A 3QFPA 1K44A 3E2EA 2CPZA 2XLJA 4F7VA 3WDOA 3QEIA 1RDAA 3MX2A 1LQ9A 3D6JA 1ROFA 4RNMA 3AOAA 1OKJA 2RSQA 1C0MA 4DSJA 3PG9A 3MF5A 2GWKA 1HYVA 1LWFB 1HKCA 5BR8F 1AXQA 2O4IA 1QAXA 1JROA 5HLFB 2W2QP 4A62A 1SGGA 4CF8A 4R5PA 2GJ2A 4UZCA 2VKQA 1W7WA 2Q79A 4Z4FA 2KT2A 3A2FA 2GA7A 3OYCA 5L8RC 1UA0A 3V1RA 1NJZA 1FJGJ 3TFSA 3S6JA 4QW9A 3X1LB 2V8VA 1FO1A 2XM3A 2ISPA 3GZFA 1TQLA 4LF8J 1N60A 5KFQA 3L3VA 1KEJA 2AH5A 3T1YK 3W60A 1KN6A 3BGLA 3HOTA 2MHNA 5J1EB 1XIQA 3KKAA 5AK6A 2OMLA 3ZDDA 3QBWA 2ES6A 3V6HA 3UW1A 1RT6A 1N8RO 4DU7A 3L09A 4ED1A 4B8AB 4F91B 2HNZA 3IBPA 2UUBJ 4WIQA 1ZM3A 4PGYA 5J0PA 1U1RA 4BRQA 2DHXA 4B1ZA 1VISA 4QS7A 5KI6A 1QS4A 2J7KA 2O67A 5HSPA 3ALRA 5IIKA 5BRDA 2ATCB 2GQ2A 2KZZA 1NGBA 3AVLA 4WBFA 4I67A 3PY8A 3G2XA 4R64A 1I94J 3DJCA 4TLQA 4H0YB 2CVEA 1Q46A 2VG5A 2E1EA 3WNFA 3NGIA 3NGYA 1IKVB 4L6V3 4BGBA 3QUQA 2YNFA 4CYUA 5AKYA 3TWZA 1D0EA 5J0WA 1TKZA 2AW0A 2MZTA 4ES1A 1N5YA 2KEYA 3BGRB 2WF6A 5KFBA 5HR6A 4QS8A 2RE2A 1GX6A 1V3RA 2RDJA 3H7HB 4PWDA 3OS1A 4CEZA 4H4KC 1MQ2A 2IJRA 1RBRA 3CCMN 1YI2S 1NPPA 2C3YA 2YWWA 1FJGF 5KL1B 1S72N 4ETXA 1T03A 1ZA2B 1P7DA 5EN1A 4GMJB 2OM6A 5L46A 4LF8F 3CCVS 4CFBA 3NBPB 1HA1A 2ZH8A 3OA9A 1UZDA 4IQUA 2LBOA 4PUOA 3QFHA 2ROPA 2BQRA 4DQRA 3LGMA 5B0DA 1S22A 2HK3A 1SAZA 1KXPA 3O44A 1VSFA 2GCFA 4DG1B 3BF1A 2O8CA 3EEQA 2UUBF 4C8KA 3RMDA 4K4WA 1YTUA 1HIYA 3RTVA 1TE2A 1DJ0A 1T3VA 1QDUB 1S6PB 5HVFA 1VQ4S 2ZD1B 3AD9C 2NUUG 3WIVA 4WTYA 1HPZA 3AVKA 2LI6A 3J7Z5 3CQXA 3BS9A 3HXMA 5F8LA 2F4VK 3HD2A 3TAMA 2FJBB 1I94F 1ICEB 2W04A 2HGMA 3R5BA 4WFBL 7ICFA 2FY1A 3EE3A 1RT1B 3UKUB 4WQ5A 3HT0A 4A8WA 3PDNA 1V4TA 4WFZA 5DQHA 3MWBA 2XYGB 4WFAL 3KOOA 4BRIA 8ICRA 2C2DA 4CJFA 2COLA 3PW2A 2VPWB 1CQNA 2M70A 3D2WA 5KT2A 1S0VA 1VMBA 3KWIA 1MWZA 4EMDA 2KT5A 4C3KA 3VAJA 2E9RX 3KKAC 2ZEJA 5DQIA 3QT8A 2PXIA 2F7VA 4RW6A 5AI6A 4O8KA 5IT4A 1QUVA 2EW9A 1X66A 3DLGA 4EU0A 4U9RA 4IRCA 3MN9A 1PJ7A 2BVZA 1XR6A 2EAMA 2XNQA 3D0IE 2DQNB 1FDAA 4CIOA 2IDLA 1RDRA 5I42A 2HK2A 4WKYA 3ZSOA 2PYLA 1VSDA 4HHJA 3OSPA 3CMQA 4PH5A 4O0NA 4U95A 1NSAA 3AEVA 3RJHA 4YOTA 4Y2XA 4FJXA 3MABA 1BA1A 3POTB 1NMDA 2BE2A 2B4VA 3RJMB 7ICSA 4F5NA 3D3CJ 2DCUB 3SNNA 1ZQOA 5KFTA 4EI2A 5LJ3Y 1ZQBA 1Y11A 4CF1A 4BRFA 4YUDA 3M8RA 4PG6A 3O4NA 4US9A 1WG5A 1DTTB 2CQCA 4Y1DA 1BY9A 2QXFA 3QIDA 4BR5A 2HURA 2FPLA 4MKBA 2WFBA 4YXMA 4H8KA 1G99A 2R8JA 6FD1A 3E3XA 4CF4A 5AM5A 5GADU 4RUAA 4QZIA 1ZAXA 5BREA 1K1SA 5EWGA 2KJVA 3UN5A 5D4BA 3VTIA 4I29A 2UVRA 3VAKA 4AHVA 4AFFA 2MKKA 4AL6A 1EQ0A 1N36K 1VLOA 2MKCA 1FK9A 2CQ2A 5AQYA 1UA1A 2NLWA 3RUBL 4BROA 1K1QA 5FIIA 4QOTA 1KHVA 5ALEA 5TKYA 5AE1A 1JL2A 4I1TA 3D2FB 4I2DA 2UVVA 1VCTA 2DNQA 3HSJA 1UCVA 4DV6J 3M8QA 3CP8A 1BWVA 2G0JA 2C42A 4HT7A 1TUWA 2RMLA 3R5DA 2DBBA 5C42B 1SUQA 3I9V9 8ICJA 1AFJA 1FWLA 4DMZA 1D5AA 2WW8A 3LP1B 2RPIA 4AHCA 1DY3A 4NCGA 5EHHA 3JAMO 4RNHA 4X66J 4FWMA 2FYXA 1R7IA 4CDIA 1BIZA 1A5VA 1XNQJ 2F2AB 3OR2A 1WI8A 2QA4S 5H9FJ 5M1PA 4DR7K 3SCKE 2YKNB 2J4RA 3DXMA 3M6GA 1RCOB 4F4WA 2B9WA 3O8MA 4HH0A 1YJTA 3TAFA 2YPZA 1X3MA 2E5LK 4P7VA 2XMKA 2R2UA 1D8LA 3G6VA 3UR3C 1ZM9A 2BACA 3KD5E 2K8BB 1C4CA 3M6XA 3EX7B 1H72C 3V6KA 4UW2A 4JKFA 3OYBA 1BDGA 3HSZA 2PD1A 2B6GA 7ICOA 2XULA 2G13A 4A47A 2B21A 1TK8A 1XHZA 2Y3YA 4Z4CA 5AICA 1J53A 2HBYB 4MFCA 5ETNA 2D0OA 2RF2A 5J2AA 3AGKA 2FMQA 1PVPA 4DV2K 3AH6A 4EFAC 4ZIVA 1DGJA 5J2PB 2ABYA 1BPZA 4UB2A 4FBTA 3M8PB 3LP2B 2F76X 4QZAA 1QQMA 3MMJA 3AVBA 4M9HA 4X62J 2PT0A 2MY8A 3AA8A 2O01C 2N4DA 4EWTA 3SBTA 3DU5A 4RW7B 2ITGA 4XDCA 1UT8A 1XR7A 3CQ8A 5JVGQ 4FF3A 1U9LA 1Q78A 3T6JA 4X66F 4JP8A 1XNQF 2QKKA 4NLSA 2ADBA 3JPNA 2AYBA 2RRDA 3NXZA 2R7XA 4CVNE 2WF8A 4F71A 1QD1A 5HAOA 1YJ9N 3CO0P 4KGMA 2XSJA 4CLYA 1ZM4A 3C6HA 4QJVA 5AZJB 4LF9K 1BOTO 3OXGA 3C65A 2BXJA 2JEGA 1X4AA 4ZA1A 1EQYA 1RTDB 2LP4A 2V68A 1YVNA 1EETA 2K4IA 3KK1A 5F3ZA 1S1TB 4PY5A 2KJ5A 1S48A 1M1KO 4URQU 1SKSA 3VEYA 3QT7A 5HHIA 4AXJA 4EIAA 4X65K 2KN4A 3I6PA 1Z4OA 3EW9A 3H46O 4X4TA 4YOVA 3QJPA 1VSJA 3MN6A 3R7SB 3THYB 4CZLA 4Q2MA 4DOCA 2G2ZA 3A8KA 2YQ0A 3JYTA 1TVRB 3RBXA 2RDIA 1X4FA 3KHYA 1WUAA 3FYHA 3THVA 5KFMA 2XLIA 5GADI 2DYAA 4FYDA 4TURA 2NUHA 2EWSA 2W7AA 2YXLA 2YNIA 3CJQA 5T7BA 3I55N 3E01A 4RTFD 2MUTA 1S97A 1VYAA 4NO7A 4OV1A 4X62F 5AI0A 1TELA 2LDYA 3VGTA 1FF2A 5AQTA 2DHAA 3DLEB 3MEGA 4K8ZA 1P9QC 3Q8KA 5FLXO 3W63A 4UY8T 2E6MA 3PYGA 3QUTA 3H8SA 4K5RA 3QO9B 4OYAA 1CVJA 3H0MB 3P38A 3TOQA 1GMVA 3I4PA 1T3NA 2GX8A 3OYFA 4DL3A 4FDFA 4W98A 3QESA 4PJ0U 4PHDA 3QGPA 2QEXS 2K7JA 4W92B 2KW4A 3EY1A 4Z6CA 2HQDA 4IOXA 1RTIB 1RM6C 5DDPC 2D0CA 4O3OA 1VJ5A 2MY7A 2A19A 4IEEA 3T1AA 2AYGA 3GV7B 4IOCQ 3BKUA 3UN2A 2HS0A 1V38A 3DMJA 4BRLA 4Q7AA 4I2EA 4TYAA 4LRDA 3TUJC 4JHDA 3NS6A 5BR8K 4ZP6A 2XMTA 3W2WA 4TN2A 1FWKA 1QAIA 3NGUA 5IV4A 1TV6A 4YXJA 1RWNB 1ZBSA 2J76E 2P9PA 2BRLA 4USAA 3ULEB 1PAEX 5KFKA 2BJDA 4UW9A 2E88A 3I87A 2F1JA 2EVZA 3TZXA 2JGUA 2WAQF 1UWBA 2I1QA 4PR6A 4YMEA 2A3VA 4QJFB 4J91A 3RMCA 3KLEA 4QYRA 5H9EK 4OPKA 2FF6A 2P66A 1BCOA 4RT2A 4L3NA 4BGAA 4DX7A 2HHSA 1Z1ZA 3PJXA 1TL5A 3KK3A 2CDQA 1VQNN 1VSEA 3R6MA 2J9EA 3JQKA 4MO5A 3NUQA 2VC1A 3J81U 4YOYA 4FF1A 4ZVFA 2Q6CA 2IJNA 1SXEA 2W9CB 1U2CA 3VAHA 1BGXT 4F5OA 2ZDPA 3CDBA 4YCXA 1VQON 2JLEA 4CHPA 2AJFE 4JKCA 2V63A 3FCHA 4GXJA 4NLWA 2Q97A 4E2FB 3BY5A 2VQEJ 4LRCA 2HLTA 4O4RA 2QMUB 4KLGA 2OSQA 3UDEA 5ITHA 4C0OC 4O3SA 4IR1A 3QZ8A 4KLJA 1SJ1A 3UKRB 1S1WA 5L1LA 4KHUA 3I9ZA 4F50A 1FE4A 4I2QA 3NMRA 2IM0A 3CPEA 2V2QA 4DTJA 4X4RA 2DRBA 5BXIA 5AJ3J 4ES3A 2RAQA 3Q8PB 3TYTA 3QSYB 2LECA 1T94A 1K0TA 8ICVA 3KZBA 4Y6IA 1BUPA 4ZVTB 3UFCX 1FO4A 4NASA 4CLLA 3RB6A 1E4FT 5K20B 3SEIA 3QUBA 3RJIA 4EZ9A 1FJGK 1TMJA 5F41A 1Q81O 4JYAJ 2KXHA 4M5NA 4WTOB 4UARA 2FLNA 1V5VA 1WSIA 5C5JA 3DN9A 1FFUA 4LF8K 3KKFA 2Z2MA 3IRXA 3MM9A 1M5SA 4HUEA 1PKUA 4CBUA 3SIPB 3NF6A 2CQBA 3R3LA 3H20A 1UKUA 2CDRB 4CLUA 1Z25A 2J9DA 3MGVA 3O1BA 1HW9A 2R7RA 2UUBK 5DRKA 4M47A 2QLWA 2O5DA 4QWDA 4Y2UA 1FRMA 3R7NB 2ZIWA 5HJXA 3R5JB 3QB0A 2QFIA 2ZUDA 3JPSA 1ZQCA 4DXLA 4TY8B 2HOQA 4WF9Q 3G82B 1D8YA 3FZLA 4ZP7A 3CJ2A 4M0AA 2VQEF 4F5QA 4NYZA 3J81j 2AV5A 5I3PA 1T05B 1ZXOA 4GXKA 3D9BA 1JKHB 5ALLA 2LCWA 3RH4A 1Y00A 4PPDA 5ALQA 2RQCA 5B0CA 3V6DB 4U7BA 2PYJA 2MQPA 3QU9A 4RQ2A 5CB1A 2R7SA 4I6AA 2O8FA 4P6QA 3MAAB 4GFJA 3MTJA 4D3HA 5AJ3F 1Q7YT 1ZBHA 3BBCA 1S10A 3FEXB 3ZT1A 4KGXB 4CZEA 2E1RA 3HM8A 3TVYA 3KKRA 2XI9A 2E1MC 1NGJA 2MSNA 4JYAF 1M5KC 2M8DB 2RP5A 4YDUA 4RWTA 2NZCA 3IBWA 3SUPA 1T0TV 5KFJA 4DOBA 2H3VA 4R5PB 4IOBA 3BQ1A 3K9JA 2NLXA 3RR8A 3C3LA 2C3PA 2X74A 3KUGA 1A77A 4CJLA 4P2XA 3PRBA 4H4OB 2YKAA 3IG1A 2DJWA 3N7SC 1NH7A 1Q8BA 4CF9A 4DPWA 1VSKA 1FRJA 4U67L 8ICCA 2QMXA 3KLGB 1FDDA 3TSUA 3HTVA 1NGIA 2F1HA 3IAS9 2DR9A 1JLAB 4G1QB 4KRFA 3Q89A 4FLUA 5GAHU 3K1RB 1XWLA 3H25A 2CQIA 1V97A 3AARA 4BRDA 3EJMA 1G3OA 2A3JA 3PO4A 2GQCA 2Z56B 1U6ZA 2WF5A 4KKOA 2LXUA 2WC9A 3OJSA 4FW2A 5E3RA 4JI6J 4NA2A 4KMUA 2VQFJ 5TKWA 4OYWA 4IOAL 5D78A 4OYZA 4FL9A 4FZNA 3L3UA 3RBZA 1R6YA 3U6FA 4MQ3A 2QB1A 1HFEL 2JOQA 4NWBA 2MTLA 2RT3A 3P39A 2BTFA 5J8YA 4GV3A 1LCUA 2W9AA 2ATQA 3LK9A 3ZLJA 2BJ8A 4J2DA 2LA4A 3M3ZA 5CR4A 4LZGA 1SBRA 2OZSA 4LRFA 2F96A 5AM3A 1TKZB 1NGEA 2VA8A 2CPJA 1RQ0A 1SJ3P 4TQRA 2BYCA 2CPIA 1WYGA 4CH7A 1E3MA 1XHXA 2R42A 2P9LB 1SQFA 8RUCA 3K0JA 1VQSA 3RJFA 4A57A 2O6KA 1UT5A 3DLKA 1ZYQA 2QWOA 4F4XA 3OHAA 1DEJA 3R1HA 2CA9A 4PGQA 1T03B 5J0RA 2ZH4A 3EVOA 1S72S 2XMMA 3NGZA 5JMNA 2VWBA 4H4MA 1VQ6S 4QZFA 4OJGA 3AVGA 4QWBA 2JNJA 2XB2D 5AQKA 2KLAA 2QN6B 3V9WA 5KFPA 2VBZA 2D8CA 1LKYB 2DRAA 3M9OB 2IYIA 1RCHA 4NE9C 2DY9A 2O8CB 5L1JA 2MMYA 3W9HA 2I6WA 4O44B 1GXLA 1N32K 1MROB 1N62A 4C8LA 3DCAA 4I28A 1OS5A 1E6YB 1HQEB 5IT9O 3THTA 5B0GA 2DHHA 5G5HA 3FCWA 1JLFB 1Q9XA 3OYNA 2ROEA 4JI6F 2VQFF 5DB7A 4YDUC 3CIMA 4CJWA 4ZLPA 1AZSB 4X4QA 1U48A 4FLZA 1S6QB 1HL6A 2D1KA 1N6QA 1ZBIA 4CZCA 1TGOA 2V9KA 2HSTA 1YHQN 1T6CA 5EE9A 3UM9A 3N6NA 4C4SA 4NCBA 5FDLA 5HNKA 3KHGA 1S1UB 4ILMA 4N5SA 2HNYA 1Q7LB 3M2UB 2JR5A 1K6YA 2AP6A 4XO0A 3NH2A 2JFDA 2D3O1 2K7KA 1DK2A 4X66K 1VQ7N 5J29A 2YB4A 4MEXA 3NGSA 1LV5A 3FJ2A 5H9FK 5DM6L 1Q86O 3DRPB 4HVJA 3LYSA 4CLWA 3EL2A 4BRMA 1X6IA 3V4MA 3GONA 4GVMA 3DNCA 2CQ4A 2MDAA 4DV4K 1O5JA 8ICWA 2JJ4D 4NLUA 2KFZA 2DITA 1KSPA 1K0VA 2P8IA 1J9AA 3EVWA 1RWOB 5AQJA 2VKRA 3NMAA 4FVCA 4F93B 4WK1A 4AUKA 5B0BA 3SENA 4M2YA 1IM4A 1C2PA 3SQ4A 3MTKA 2KIVA 4ZVGA 4CJ3A 4NLNA 1KR4A 1GEHA 3DI6B 1IR1A 5GAHI 1QTMA 2HDOA 5ALOA 3AGRA 2KKPA 4F72A 2AYMA 3SK3A 1Q53A 5AM4A 2DF4B 1REGX 2QJ3A 3ZZ0A 3R9PA 5ETQA 1VC5A 1HWUA 1NZ8A 1Y10A 2IBOA 4ID1A 2FBYA 4X62K 2V51B 2GQQA 4PQUB 1KQKA 2D5RA 2GMLA 3VZIA 4F4KA 2BGGA 2K2PA 3QJLA 2KZMA 1UP1A 3UB5A 2HHQA 2MJUA 2ZZTA 3AMZA 4YR3A 4KHRA 4CGHA 3MOJB 2Y1JA 3BUZB 1GOAA 3NY0A 3J7YU 3OYMA 4M5KA 2N4CA 4R0JA 2EBGA 2ZFHA 5KFCA 2VG6B 3AQFA 5T7LB 4JI2J 3SAHA 3SMSA 2ZH3A 3L4PA 4NCGB 2OPRA 5BOMA 5F0XA 4Z37A 3AA5X 1XN9A 1LWEA 3RZAA 1LFWA 4NLYA 3HSCA 2XS5A 1RTJB 4KX5A 2XY5A 4BR9A 4LZDA 5KFNA 2J6SA 2AGOA 1N5SA 3W1YC 1ACMB 2RQKA 3EZOA 3JSRA 3KLFA 5GMEA 4YOWA 4FJ5A 3HHEA 3LPUA 3HI0A 4R25A 4FWRA 4PKDB 4JI5J 4NLXA 5FPNA 4BDPA 4X4SA 3AUOA 4WZQA 4K43A 3IAM9 4ILGB 1JCFA 1UPMB 4K42A 4GVBB 2F9JA 2K8GA 2X1AA 2DISA 5J2EA 3K2PA 1D9DA 5CZ1A 2APOA 1CG2A 1BNOA 3GQCA 5D0GA 3HDSA 4FXWA 4FKXA 2Z2ZA 4IFVA 5AQRA 1ZH5A 2GVDB 4C23A 2X51A 1CXQA 3IM9A 3MX5A 1S59A 1VQ9N 2WOMA 1U04A 4NXZA 2EZZA 4QIEA 4C1NI 4IQTA 1MQ3A 3GYGA 4C0HA 1SV0A 2G5IB 1WJ9A 3AJ2A 4Z4HA 4MK9A 4MT1A 2OTLN 3WIUA 2GWSA 1LWCB 4JI2F 1Y9OA 3TA0A 3VF6A 2BABA 3CM6A 6AT1B 1RT3B 4GVEA 1GOBA 1KD1O 1BQNA 3M32A 2KG1A 1L6NA 3ZD9A 4OYBA 1MG7A 2B51A 1FX4A 4YG2A 4WF9L 4HACB 3LZJA 3IO1A 1EJ7L 2KSOA 5ADZA 3C16B 1FKPB 5J2HA 3ZTOA 3EZWA 1R8BA 2XNRA 1P90A 5KT5A 4ECVA 1HI8A 3ITHB 4RQ4A 4JD2A 1YJ9S 4Y28C 1ATSA 1YJRA 2RLTA 2XYHB 1U0HA 3QIPB 4EP4A 1WHWA 3PYDA 4C7ZA 3ET6B 1CI4A 1ZOTA 3LP0A 3IS9B 3VGUA 4OD0A 2XC9A 3C5FA 3OR1A 5IV3A 2IA0A 3CDWA 1ZD2P 3GJSB 3U3GA 3VPZA 3HP6A 3SJHA 3H7IA 3BGUA 1HHTP 4CJ4A 1J54A 1JLCA 3D45A 4W5OA 3PHEA 3CXCR 3LH2S 1V85A 3QXGA 2B8PA 1JLBB 1NJYA 4A48A 2CJ9A 3SAGA 4TYBA 2VH7A 1IG6A 3CD7A 2A1BA 3I28A 2JDJA 3C1YA 4JB3A 2HQGA 3TU5A 2E8MA 4IQXA 2WONA 1LAVA 4FJHA 3CJAA 1U09A 2D3DA 3E01B 1ZQNA 3DDNA 2WAQD 3K5OA 3TAQA 2BANB 1I5OB 1HKGA 3GFHA 5J0UA 3I55S 3DM2A 4KHYA 2N7CA 2BCVA 2I7PA 1SJQA 1C1AA 3QRPA 3MEGB 1GLEG 2NRXA 2DNOA 3RRGA 5HMLA 2P6RA 4PG8A 5J2QB 3J7YI 3NCQA 5DDQC 1KBRA 3H42A 2VQEK 2DFHA 3DHXA 3IRWP 2ATLA 3V7LA 1RBAA 1RJJA 4EELA 2ZWPA 5TZVA 3HHLD 1UJ5A 4CD3A 2QFJA 4C0BA 4IG0B 1NGAA 1PYTA 4ERDA 1RK8A 5KT4A 2JH7A 3D67A 2EWHA 4IRKA 2F9TA 2A18A 4LR7A 3D0GE 1N56A 1F9FA 4LF6J 1DRZA 3MUVP 4PXCA 2DD8S 1VAZA 5AJ3K 1GQEA 5FLXU 4DFDA 2Z57B 1UFWA 2BZFA 2F44A 5KG5A 3NRZA 5BPNA 9ICMA 2PA8D 1P9YA 2HGLA 2BX6A 2B4JA 2A1SA 1NK6A 1IR0A 1RT5B 1SV0C 1NDCA 5CJ7A 2Z4PA 1NBWA 2P9SA 2P51A 1IBCB 4GVLA 1KAXA 3UE5A 4OZ0A 1NKEA 1HWIA 5AXMA 4KREA 2WVFA 3K17A 4HKQA 5LT5A 1F1BB 2NRWA 1M5OC 3TR5A 4I2JA 5A8KA 4M9GA 3O3GA 4MKVA 1F5AA 3AA4A 2DGUA 4YR0A 3VAGA 2PMZF 1RAOA 1V4SA 3IM8A 3O5BA 2HWTA 3M30B 2FUG9 4M5DB 2QX0A 5HMWA 1Z3EB 3CCLS 4US8A 4YB1P 2G8FA 4WFNQ 4B08A 4MK7A 4BRKA 3I56N 1X9SA 3SQ2A 5B7WA 1YBAA 3KLEB 1IWAA 4ZKAA 3VR1A 5EE3A 4BY9C 3SDEA 1H7WA 3K89A 3NTUA 1DLOA 2BH1A 2IDEA 3GSIA 1QAJA 4HCBA 1S1VB 2ASYA 3U02A 2B7CB 3WXIA 2HVEA 1TKTA 2MB0B 5HRSA 3EWAA 9ICCA 3JXOA 2ASDA 4ACOA 3L2UA 3EPGA 2CZ9A 4IDKB 1VQNS 4FLXA 4A46A 4LF6F 2GC8A 4Y34A 3OVSA 4USWA 4DLGA 3AFGA 4DLEA 1NU4A 3VGMA 4X4OA 5GMDA 4NYOA 4MKAA 4TUQA 1VQOS 3LVWA 4X64J 2FLOA 3S8SA 3QE9Y 1OVQA 4Y2SA 5DZ7A 5HANA 3GJRB 1FKOA 2B7BB 4DV3J 5J0TA 1K8KB 1PZNA 3GBTA 3P6YC 1OJ4A 2I9GA 2A41A 4DL2A 3VHQA 2XY8A 5KFGA 5CD4H 4M1KA 5FRNA 5EVZA 1MA9B 1EP4A 1R89A 1ZOLA 8ICSA 1B0VA 4PZVA 2WBMA 5EUHA 2OPPA 3KLIB 5ETVA 1N5WA 4E98A 1LAWA 5BN8A 2BCRA 1BCMA 4JS5A 4P74A 5EY4A 4BJQA 3HHNB 1RKJA 2VPYB 2QWQA 4DSKA 4B9QA 3DLHA 4BRPA 3L3CA 3AO3A 2A6AA 3E58A 2UXDK 2NSBA 1U1NA 4O23A 3QFWA 5B0FA 2XLKA 4OHYA 1WHVA 1RAAB 5KFFA 4DPYA 5G0RA 4TU8A 3DGVA 5IOLA 4EHUA 2ITMA 5F3TA 2E1CA 1Q1KA 3R5AA 4MTPA 2ZIWB 2IHNA 2W4PA 4R79A 4BXOB 1VR6A 8ICTA 3MMCA 1CC8A 3B54A 5HP1A 2GS8A 3D2NA 4JI6K 1IM6A 3DLJA 2VQFK 4CM0A 1WWUA 2BUPA 2RE1A 3VENA 4KLTA 4ZJOA 2DL0A 1RYUA 3ZX3A 3GILA 5HMYA 4L3QA 2VDHA 4DQ8A 3HHLA 4X64F 3M4XA 2ZF5O 3MCSA 4CF2A 4BQZA 1XK8A 2V2VA 2V7ZA 1XO1A 4LSZB 2RIJA 4G9BA 2LEPA 4MDAA 3A5OC 2CYYA 4M41A 3HPHA 5IILA 4DV3F 5IC6B 2PC6A 5IS2A 3OS2A 3BN4A 4DFKA 2B4PA 4FJMA 2ZIXA 4NL9A 4NLRA 1G7CB 2OGUA 2QLXA 3NVKA 1X5TA 2IFXA 4ZVQB 3AVNA 3GFKB 1N54B 3M8SA 1AA1B 2QLJB 4XPCA 1EAYC 4ZH4A 2GIRA 2NXEA 1KC8T 3MEEA 3RAMA 1EKSA 2F8SA 2WUSA 4JV1A 3GV8B 5GAGP 2E8PA 4P2HA 2X1GA 1CULA 3G0ZA 2ZZMA 1CSJA 3IG5A 4JI3K 3P4UB 3O8WA 3UDCA 2D6FC 3NF8A 2HHXA 4QZVB 2GZOA 4M42A 4CRXA 5ALPA 2QTWA 3WBZA 3ZTRA 1B9FA 1REVA 1VRUB 1CJKB 4RQMA 3MEDA 2DNYA 1SIJA 4WPAA 4HDHA 4ED4A 4H5TA 3BEXA 1FTRA 1NDPA 1S9GA 2XMAA 4F9OA 3MDFA 3IG1B 7ICUA 3VGKA 1NK4A 2O8EB 2QWPA 2YMQA 1IWGA 2KVIA 2PI4A 1U25A 3S1TA 1WB9A 3THWB 4OJ1A 4OPJA 4DHYA 5B8HA 3F73A 3CQYA 2OPQA 2KFNA 5ALGA 3U4LA 1FHTA 3BV8A 3V9XA 3RF9A 2K4HA 2CQ0A 1ZQJA 3HP9A 3UIQA 1MNEA 3CNQP 4PXEA 2ZH2A 3CJ3A 1QVFM 3CPWM 3C28A 1SS6A 4KKOB 5CZVA 5J2FA 2YX8A 2OP5A 3FSYA 2VONA 3G96A 3FSIA 3NS7B 2IOFK 2OAUA 2VJVA 3MXJA 3HKZF 3H4BA 4K50A 2DB1A 2WAQC 3S01A 4Y2JA 3AAWB 4DR6J 1AFIA 2FBXA 8ICGA 5F8IA 2G08A 4NL5A 3R9LA 5AI4A 4K8RA 3RMBA 5KL8B 3WNEA 1J2MA 1FVSA 4IKAA 2OTJN 2ZGZA 1X4EA 4FPRA 4YVZA 5A8WA 4RO0A 3PJWA 2X78A 4OI2A 3DLKB 2Z1IA 4ANDA 3QU4A 4RBTA 2K8CB 4C4TA 2ZIUA 2R8HA 4FK4A 1KVBA 1UZHA 3MAHA 1HD1A 1YZ7A 2VD3A 4FK2A 1YJUA 2ZTDA 4PAAA 4HWIA 4NLTA 5CQGA 5FPEA 1HBNA 4OI0A 4NL9C 1ZQKA 3PKYA 4JI4K 1EHWA 4RU9A 5A6PA 3LWMA 3TAPA 2OWOA 4KIAA 3KNAA 2DNKA 3OTBA 4ED7A 1J2NA 3PX4A 3RWUA 1KRPA 1RQNA 2ZTEA 5HQ8A 4DS5A 5D3GA 1TR0A 2CJYB 3VQ4A 4FZYA 3B78A 2D9PA 2YJEA 1Q8LA 2E44A 2IVOA 2R4FA 3VEWA 2NZ4A 2OEKA 5AQHA 3A8IA 1HYZA 3CCZA 4P4OA 3TW0A 1Q5VA 4WYBA 4HUFA 1HLWA 4DR6F 3AQOA 2KYXA 1YHQS 5HN0A 2KQ2A 4JI2K 4CZIA 1GXTA 1RTHB 2HNYB 2RUSA 4KLFA 4MLHA 1UJ4A 5IT9U 4CNQA 2HGNA 1HJRA 2VOPA 4JI7F 2M9NA 1JRPA 1M5PC 3MR2A 3R9KA 2HVZA 1HWLA 3IA0A 2XZDB 2XGPA 4Y0FA 4JI0J 5AXNA 3DYAA 1VQ7S 3GIJA 3UMBA 4ZOSA 1K8AO 4XEIA 4M9NA 1N8RT 4FO6A 2HIYA 1VQ8N 3Q8YA 3HX9A 1WG4A 4IQWA 2BEFA 4LJMA 1LK5A 2NR0A 4ZTJA 3KD3A 2BCQA 4NLBA 2HS4A 1H3DA 3O0FA 3RFAA 3L6QA 1TL3A 2GUIA 2B8QA 3PSPA 4USKA 4JK9A 5AQUA 1H74A 4K4SA 2RRAA 4BREA 1C0UA 1N61A 1GOCA 2BOPA 4BG9A 2EAPA 3V9UA 2FXUA 3NCIA 4C7YA 1QZ6A 3CD6N 1SI9A 2E7XA 3X3UA 2ZJRQ 1KFDA 4YB7A 4RPXA 1RWUA 1PK1A 3H5YA 5B0EA 2YVSA 1T6DA 3CDEA 4UQTA 2IAJA 1O6XA 1RGIA 4TUSA 4Z7CA 1ZBLA 2W43A 5D0RA 1VRTA 1ZXIA 3WC0A 2HNDB 3NASA 4ZITA 1X3NA 1S9EA 1U1LA 3WQTA 2Q4TA 2WVBA 1ZQAA 1Z6RA 3TX0A 2GJFA 1RAIB 1UAWA 4LH4A 4C7QA 4YR2A 1QLNA 2QWNA 3OTCA 1M5VC 2IHR1 2BJEA 3HO1A 1NPRA 1UHUA 9ICJA 3MHYA 2ASMA 4EX6A 1VIOA 4JI0F 4J90A 1D4XA 3G6YA 3G8TA 5J2NB 2F63A 3R27A 5J2MB 4H0TB 4G9ZA 2X3DA 1WHXA 4I6WA 4LUBA 4O8UA 4U7CA 4YOXA 4XQ8A 1U4BA 4HHTA 1NM2A 4I7FB 3WXLA 1OUQA 1LWEB 3E1YA 4CK2A 4DL4A 3F2CA 4KFBB 4OI6A 3PACA 1ASUA 2CXYA 3OL9A 3KLFB 3KFWX 3KVGA 5J1PA 4ZCMA 4I56A 4MIBA 1RXOB 4P0QA 1IXRA 1RWXB 3KJQB 2BJ3A 1YVUA 2R9LA 4FCYA 3CJ4A 3QNOA 3M6ZA 1JXLA 1AT1B 3G10A 4WIIA 1CJTA 3ZSVA 2D3UA 5L1IA 1P1TA 2MQMA 3UWTA 4LF4J 1B3TA 3UI3A 3C66A 2QE5A 1DTQB 1TUVA 4XH4A 5HRRA 1KL9A 3F2KA 4LR9A 3PYEA 4IH7A 1MWYA 2OZMA 3ZSZA 1WBBA 2M88A 1WC5A 4ZS6A 1HBUA 3AB2B 3ILJA 4N47A 3LM9A 3QEPA 2E8OA 2G0IA 3SCXA 4IRDA 1X9MA 4DTNA 3LZIA 1VGYA 4IDHA 1WG1A 1KNZA 5DB8A 2F65A 3QFUA 2N3LA 4J9MA 2PBDA 2CPEA 1ZA1B 5EU7A 2KIWA 5M1QA 4WCEQ 4DCCA 3FQKA 3ZYYX 2YKOA 3O5TB 2PN6A 2OTLS 1LW0B 1S99A 4AM7A 4HHUA 3CCWA 3IDHA 3KG4A 4LF6K 4PA1A 2DFLA 1VLYA 1JXVA 1TTHB 3OD2A 2HZVA 3ISNC 1MN8A 4QIVA 1WLJA 5F1XA 5J2KA 1HQUB 4OMFG 4CGJA 3UE2A 5AXLA 2KSOB 4DS4A 2ZBCA 3KZIU 4F0HA 4ZHRB 5CHGA 3BSCA 4F3TA 4LF7K 1X8DA 1P6TA 3F2DA 4OKJA 1QTNB 2WK4A 2DUYA 3BYRA 2QI2A 5DMRA 1U0HB 2K1RB