1NKBA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after three rounds of primer extension, following incorporation of dctp, dgtp, and dttp.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkbA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkbA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkbA01
4NLZA 4CEEA 1ZYQA 3KK1A 3NGIA 4NM1A 4FLWA 4ED1A 4KLJA 5HRPA 4FYDA 4C8OA 4YMNA 1EKEA 4KB0A 3OYKA 3ZD8A 4HUEA 2OPQA 5C24A 4E89A 4O3NA 5KG2A 3PW0A 5IIOA 4DTRA 3LAKA 5DB6A 1ZQRA 1RYSA 3MFHA 5KFJA 4ECYA 5KFQA 2MUTA 4BXOB 3Q8KA 3LP3A 1YT3A 5KFHA 9ICMA 3TAQA 2P6UA 4CGGA 4M9JA 4KLTA 3VQ4A 1XU4A 2JEFA 4EEYA 4FK0A 4RQ4A 3GV8B 4PQUA 5K14A 3HM9A 4B9SA 4HTUA 2P1JA 1JLBA 3Q8QB 1ZQTA 5CYQA 4RNNA 4ELVA 1BCMA 5FROA 2A1SA 3OYDA 4FLTA 4CFDA 3QNOA 4BWMA 4Z4FA 4Y1CA 4XRHA 2D0AA 2ISOA 9ICNA 1ASVA 1JMSA 4RQ2A 2FMPA 3DMJA 8ICFA 1RXWA 1GOAA 4FXDA 5KFUA 1CEZA 4BDYA 1JN3A 4CHOA 3NDKA 3RJHA 4CGIA 5KFAA 2HHSA 4R63A 2YHAA 1K1QA 1CXQA 3PNCA 4XIUA 3ETLA 1TVAA 4YXMA 4IG0A 1VK0A 4KITB 2EX3A 3EZ5A 4KLMA 2NRZA 1QS4A 1QHTA 2HVHA 1S1VA 4Z6CA 4H4OA 3SI6A 4M45A 4UB5A 2G8KA 3GV7B 2C2EA 1UT8A 3ORYA 3LALA 5DGAA 4B9VA 3RH6A 4KLLA 3EPIA 2KQ2A 1Z00A 1U49A 1A5XA 4C8LA 5L1LA 5HP1A 2ITGA 3S9HA 3DYAA 4R8UA 1LW0A 4KLOA 3ITHA 4PGXA 1C0TA 1KVBA 4O3SA 1ZQBA 4CHYA 1IKXA 3H7IA 3AO2A 5J0YA 3KD5E 1S0VA 4FJ5A 1ZQOA 4BWJA 5SWMA 3LWMA 3LP2A 4CCHA 5KGWA 4DTMA 4IRKA 2BGGA 4FJMA 4ELTA 2PFPA 1BPEA 4I2AA 1BPZA 1U04A 1IG9A 4FZXC 9ICQA 1ZQIA 4DTUA 4QZAA 1D9DA 8ICVA 4B9LA 3CQ8A 2B21A 1XSPA 4FJ8A 4K4GA 4AILC 9ICGA 4F2RA 2AGQA 3HP6A 2XCAA 5CHGA 4RNMA 3AVIA 2VA3A 1BGXT 1TFRA 3RH5A 4M0AA 3QESA 3L2WA 4PWDA 4HVJA 5KG7A 2BCVA 3SV4A 4O55A 3C1YA 4LVSA 4DSEA 3PX6A 1HJRA 1FKPA 3GIJA 3B6PA 3QEAZ 2ATQA 3M9OB 2JZBB 5KG0A 3MXJA 4IG3A 3WNHA 4QWEA 3OYMA 3MAQA 5KFDA 1KVAA 4J2AA 3GDXA 1SL1A 2IOCA 3M8PA 3LANA 3SYZA 1RZTA 4Q44A 3AU6A 2FPLA 3RRHA 9ICLA 5J0PA 1EXQA 1BPDA 4DFJA 2FBXA 3V9SA 2HW3A 2IDOA 3M8RA 2ASJA 4KTWA 3G6XA 1XO1A 4I2FA 4FVMA 4NCBA 3MFIA 3V1OA 4DL4A 1XHZA 4XQ8A 4DL3A 4QW8A 5HHIA 4QOZB 2KZZA 3C2KA 2YNHA 4EZ9A 3KLGA 3TQ1A 3K57A 5D46A 1NOMA 4YFKA 3VA0A 4FJ9A 4JV1A 1J54A 3K2PA 4O4GA 3TR8A 3ZCMA 4CGHA 4QWAA 1RBUA 2E6LA 1L3UA 3Q8RB 3L2UA 4ECUA 3V6KA 3RMDA 3TARA 4CJQA 4ED3A 2ZUDA 2DPIA 1Q8IA 4I2CA 3H8JA 3AA3A 1LW2A 3ISNC 2AGOA 3VQCA 3QEXA 1JL2A 2IHMA 1BI4A 2XGPA 1RT6A 4ZTFA 1ZQSA 8ICNA 5I3UA 4I2QA 1HNIA 1KFDA 1SZPA 4PPXA 2FBYA 3OJUA 2Q0ZX 4FO6A 3V9XA 2H5XA 3UQ2A 1S0NA 5CB1A 4J9OA 3MR3A 4DWIA 3NE6A 1NKBA 2A1JB 4I2EA 3JPSA 2WONA 4GXKA 1ZQNA 9ICEA 4KKOA 3KK3A 4CK3A 3JSMA 1I39A 1NJWA 4Z6FA 4CK2A 1CUKA 5KFEA 2I1QA 8ICRA 3OYEA 3OYHA 1B43A 3C6UA 3KD1E 4DFMA 1NK9A 1S10A 5KFFA 3RB0A 2XCPA 4NM2A 1TK5A 4CHZA 9ICTA 4BXOA 1X9MA 4CF9A 5DG9A 4LZGA 3EW9A 5DDMA 3LZJA 4O9MA 2UVWA 2XY8A 2RDIA 2OYQA 4CIFA 2MUTB 2HHTA 2IMWP 2FLPA 5KG6A 5HRNA 7ICHA 2KFZA 4NLKA 4YR0A 1SV5A 2D5RA 3VQ5A 4ELUA 5J2QA 1B92A 1ASUA 1JL1A 3LAMA 4QZCA 4EYHB 5CR0A 2BR0A 4CF0A 7ICRA 4F93B 1NK7A 1UWBA 4BGDA 2PFOA 1S6PA 4OPJA 2NRTA 2RF2A 3V1RA 5D4BA 2A1RA 1BCOA 4DF8A 5KRTA 3IS9A 3QEVA 5HMLA 1ZQJA 4JS4A 4G3IA 4FJ7A 1T7PA 3JPPA 4YNQA 4O5BA 4PHEA 3NGDA 3P83D 5C5JA 2KW4A 1HJPA 1IKWA 1CZ9A 3OYBA 4E7LA 2XY6A 4I2PA 9ICUA 3PO4A 1TKTA 4DG1A 2HB5A 7ICUA 2W9MA 1RTIA 1IO2A 3ZT3A 4FJNA 3MEGA 1VSJA 5J2MA 1WLJA 4FJIA 1CXUA 4CGFA 3K59A 2AU0A 4F5QA 2IBKA 1TKDA 4CIEA 3AVKA 3VQ6A 1HPZA 1YTAA 3I0SA 3PX0A 3CFRA 4F8RA 5DQIA 3TANA 5KT7A 2OA8A 4RQ5A 1HYSA 4NXZA 3C94A 3E2EA 3TI0A 8ICGA 4RQ8A 1G15A 1RDDA 3OGUA 4YMOA 3GIKA 4MQ3A 5KI6A 3L2QA 1J9AA 3VQ9A 3HT3A 4IRDA 3OYCA 4I28A 3C5GA 2FPKA 8ICAA 1ZQFA 4W5TA 4RZRA 4GVMA 3PUFA 3FDSA 1NK0A 4IFYA 4CECA 3OY9A 1JX4A 3KKSA 3MBYA 4EP5A 3KJVA 2PFNA 3CM6A 2G8UA 1TKZA 5DG7A 2VG5A 3RB4A 1BL3A 3T19A 1QE1A 4B08A 5J0SA 3PMLA 3P1GA 4LH5A 4FBTA 1C1AA 3RR7A 2DFEA 2OPPA 3AVFA 1QTMA 4MFFA 3AVGA 4I2DA 3VA3A 2D0CA 4DEZA 4O3PA 4FBUA 5J0TA 4PHAA 4Z6DA 1RT4A 4FJLA 2FC0A 2RKIA 1Q9XA 1WSIA 4IQVA 1TV9A 3NGZA 2X78A 5EWEA 1QQCA 1U47A 3PW7A 2P5GA 4YD2A 4QWDA 4IR1A 4ECZA 4DTNA 2ZTEA 1H38A 1R0AA 2IC3A 3SPYA 1HUZA 5CJ7A 3V9UA 3MABA 1C7YA 9ICFA 9ICJA 4OLAA 4CJEA 4QZ9A 3LZIA 1JIHA 2HHUA 9ICXA 5J0WA 4M3ZA 5KTQA 1BHLA 5J2GA 3ZSWA 2M9NA 1ZQYA 3RJIA 1JLGA 4OGCA 4BE2A 4IBNA 1L3SA 7ICGA 2UVRA 3CFOA 3U3YA 2R8IA 2Z1GA 3HPGA 5J2HA 1ITGA 3S3MA 1ZJNA 4F4XA 1SKRA 3QLHA 3QO9A 1Y88A 3NF7A 4ECVA 4IDKA 1HUOA 3N97B 1ZQLA 3NGYA 4I9LA 4DSFA 1ZQEA 2VWJA 3KHGA 3EPGA 2LSNA 4YQWA 4YMMA 2A1JA 2V9WA 3RMAA 1N6QA 2FPMA 3ISBA 1DTTA 8ICZA 3ZDAA 3VQPA 5IIKA 4QWCA 3MDCA 1DGSA 4I7FA 2XGQA 4RW9A 4DF4A 4DTJA 5J2DA 1VRTA 3QIOA 4CJ4A 3GILA 8ICJA 1JLAA 4F4KA 3NF8A 4ED7A 3FYHA 2HNDA 5DMRA 4F4WA 2R8KA 1U45A 2VA2A 9ICSA 4CJRA 4DQQA 4CK1A 3OYJA 3NFAA 2GUIA 5KG4A 2VG7A 1HQEA 2PZSA 4DTPA 2PYJA 4KLGA 3O3HA 4CIGA 1A5VA 4KFBA 9ICIA 3OYGA 5CZ1A 2OZMA 3RJEA 5KT5A 4KLSA 5FRMA 4UAYA 3OYFA 4PHPA 8ICWA 5T7BA 1A76A 2KFNA 3T5HA 1ZQVA 3K5OA 5HMMA 3NCIA 4KLUA 4B9TA 1A5WA 1S1XA 2PFQA 3AA5X 4LH4A 1VSLA 2JEIA 4YD1A 4B9UA 1KLNA 2G8IA 4DTSA 1ZQCA 1RXVA 1CZBA 4DQSA 2VG6A 2C2DA 3AA2A 3FFIA 5DBAA 4BE0A 1LWCA 2F8SA 5J1EA 3MEDA 4J9LA 1RDCA 3RRGA 3RMCA 2JLEA 4RUCA 2C2RA 2FLLA 3V7JA 3T5LA 4W5QA 1NKEA 3I0RA 3DRSA 4J9MA 3QERA 3ZT1A 1JXLA 2BCQA 3SQ2A 2G8FA 4TQSA 5KFZA 5F9NA 1ZQMA 2DFHA 4E7IA 4XA5A 3ZSQA 3ALYA 4OKJA 4RQ6A 4DL5A 5L1JA 1ZQWA 3ZDBA 4NLNA 2HHXA 1ZJMA 1RBSA 1JXBA 4M47A 4R65A 4FLZA 4NCGA 3DOKA 4CGJA 1NK4A 3AVCA 3K75D 1AROP 2HNYA 1NK6A 3LP0A 8ICYA 5D49A 4NLGA 3HSTB 4DU1A 4B3OA 2AQ0A 4M3YA 3PMNA 4CEDA 4W5OA 5KFGA 1BPBA 3LDAA 7ICMA 1RT1A 5JS2A 9ICOA 4KHQA 2W8KA 2ALZA 1N56A 1TAUA 2E4LA 3OSNA 3TWHA 1S1WA 7ICVA 3UXPA 4CF1A 4JK1A 1KFSA 1LAVA 1ZBFA 3UPQA 5KRSA 3ZDEA 4K8ZA 3JPNA 3PY8A 2BQ3A 3DLGA 2KTQA 4RNOA 3SQ0A 4DL2A 4DS4A 1ZQUA 4J2BA 4AHVA 3D45A 4JLHA 4IKFA 3O3GA 2W42A 3S3NA 1WCNA 2UVVA 4DS5A 5KFNA 2BGWA 1K1SA 4KLQA 3DOLA 3HJFA 3OSPA 4CJLA 9ICCA 1S1UA 3O4QA 5CZ2A 1YVUA 3MXMA 1IXRA 3MR6A 1VSFA 4CFBA 5DQHA 9ICAA 1J53A 3EY1A 3G0ZA 1ZQGA 4I2BA 4FCYA 3KLIA 1EX4A 4AHSA 4PUOA 4FM1A 2B6AA 3DLHA 4MFBA 5DB9A 1XSLA 8ICCA 1RTJA 4O0JA 3K4GA 4NY8A 2KZ3A 2BCRA 4YFUA 2W8LA 3NBPA 4FW1A 4RQ1A 2HVIA 4DU3A 3NH2A 4KLIA 3AO1A 1RDAA 3MECA 1X2IA 1ZETA 1EETA 4DOAA 1S77D 1S0MA 5IIJA 4RU9A 4KN4A 2Z1HA 3RAQA 4I29A 4R66A 3JPQA 8ICQA 3AO4A 3M8QA 3LWLA 4FLUA 2RN2A 4O0IA 3Q8LA 4M9LA 4JRQA 3AU2A 5J2AA 4YP3A 2F96A 1WSGA 3TAFA 2QXFA 4EBDA 3TAMA 1ZBUA 2XC9A 3U3GA 1ASWA 4CJ3A 3C23A 2J6UA 4UBCA 4KHSA 3BGRA 1SUQA 3T5KA 5KGXA 3HVRA 1BPYA 3ZSXA 4PGQA 7ICKA 4PH5A 4CJ5A 3QEIA 3GIMA 2OWOA 2HHWA 3BQ2A 1VSMA 4M3WA 3GIIA 3V1QA 3V9ZA 5KT3A 4PGYA 1T03A 4N47A 4UAWA 3K5LA 1C0UA 3ZT2A 2YV0X 3ZDCA 2ASLA 5C42A 1ZQAA 1WSHA 2QK9A 3HW8A 4FS1A 1JLFA 4FM0A 4QCLA 2KZMA 4J9SA 1JLCA 3L2RA 3MDAA 3MR5A 2F1IA 2HMIA 3I8DA 1KSPA 4QZ8A 5IIIA 2EHGA 5HBMA 1MQ3A 2W9AA 4QZFA 4KLDA 1NOZA 1S5JA 1VSDA 2BQUA 7ICQA 4ED0A 1X9SA 2G8WA 4X5VA 2E6MA 1MQ2A 3G6VA 5J0OA 4H4MA 2LYHA 4OJRA 3BDPA 2F8TA 2YKMA 3UXOA 4F5NA 4CEQA 4DL7A 4M3RA 4B9MA 8ICHA 2BPFA 4ECXA 4OLBA 3BQ1A 4QW9A 4QAGA 3KIOA 9ICPA 1Z25A 4CEBA 2W9BA 4KI4A 1ZQZA 1B22A 4LD0A 3RB3A 4KTZA 4GC7A 4DTOA 2MAXA 1JKHA 3LP1A 2FBVA 5I42A 3SUPA 3SNNA 2G8VA 3VQAA 3SI8A 2ZUBA 3ZSRA 4CFAA 2IA6A 5J2FA 4M3XA 7ICTA 3T3FA 4E0DA 3L3UA 1SL0A 2NRVA 4AHTA 2PI4A 1ZQXA 4Z6EA 4OVLA 1WAFA 3PW4A 2BQRA 7ICLA 4ECSA 2JEGA 4E3SA 4DQRA 2I9GA 4KHNA 3KLHA 5F9LA 5CA7A 1SKWA 4LZDA 4CEZA 1GOBA 3L3VA 4E7HA 1ZQPA 4ZH4A 1DTQA 4KI6A 4KRFA 2B5JA 4JS5A 5SZTA 3IM1A 5J2EA 3Q8SB 3IAYA 4CJSA 7ICOA 5FDLA 2IS3A 3BQTA 4MEXA 3SCXA 3F9KA 3D0PA 4CJKA 1RTDA 3B6OA 2GWSA 4EZ6A 4K4HA 3UXNA 5HLFA 2X6SA 2IHNA 3RJJA 3ISDA 3DLBA 5HHHA 2W9CA 9ICWA 1NJZA 4MF2A 5J2CA 9ICHA 1C6VA 4F92B 2ZTDA 2R8JA 5KFPA 2HHVA 1TKXA 4CJPA 4PHDA 2UVUA 2WTFA 4WE1A 4FJJA 5HRSA 5KFXA 1XHXA 4E7JA 4F5RA 5DQGA 3TAPA 4DFKA 4IQWA 4F50A 3OYAA 4O5EA 4CJFA 4DSJA 3RJGA 2GV9A 4EBCA 3RTVA 1MC8A 2B4JA 3AVJA 4TSXA 2BKEA 4IFVA 3Q8PB 4CEOA 3HP9A 4MF8A 4CEAA 5CP2A 8ICIA 8ICOA 4IQTA 2RDJA 2JEJA 3C1ZA 5DBCA 3RJFA 3CFPA 1D9FA 3F73A 1NKCA 3QEPA 5KT6A 4EYIB 2RPIA 3L8BA 4LSLA 3VQBA 4Z4EA 3ZSZA 4HCCA 1QSYA 1EP4A 3ZSVA 2ETJA 1TVRA 1O1WA 3DRPA 1BISA 4LSNA 3AVLA 4DFPA 2IAJA 2PXIA 9ICVA 1IH7A 4NCAA 4W5NA 2BHNA 3C2MA 4FZYA 3S3OA 4K8XA 4RPZA 4F3TA 4KPYA 4Q0BA 3OS1A 2ZJ8A 1KVCA 3RAXA 5L1KA 3QEBZ 4DQIA 1SL2A 4ID5A 3HL8A 4RW7A 3VQ7A 5L9XA 3NH0A 3P5JA 3IHQB 8ICXA 2VA8A 4Y1DA 1JXEA 3KLEA 5DB8A 1UOCA 4UBBA 5CWRA 4M41A 4CGDA 2BCSA 2V4RA 5KFOA 3HXMA 4CE9A 4E1MA 8ICSA 4Q45A 3A2FA 1Y97A 3JPOA 4RW8A 1RILA 4FZZA 5J2KA 3LPUA 2VWKA 3QEWA 4FJHA 8ICUA 1KLMA 3PVXA 3U6FA 1I3AA 3T5JA 4M9GA 1RTHA 3HYFA 3RR8A 4FLYA 4Q5VA 2DFLA 4DLGA 3V6HA 1S0OA 1D8YA 3QZ8A 1S76D 4M6WA 3V7LA 1Q9YA 4M42A 3MEEA 1TL1A 1UAXA 3PV8A 1S9GA 3WNGA 4FK4A 4TUQA 1LAWA 2Z1JA 5KFKA 4O3RA 4N76A 4N41A 1ZQKA 2DFFA 3OYNA 8ICLA 1ZQQA 1LB2B 1JLEA 1WCLA 3B0YA 5E41A 4RQ0A 5CY4A 4M3UA 4B9NA 3K5NA 4C8NA 4YR3A 1XI1A 3QZ7A 4ICLA 5KFWA 1IKVA 1B9FA 4J9PA 5C25A 4R64A 5DLGA 1U4BA 1GOCA 5KFCA 2C28A 4O5CA 5DLFA 1RPLA 4CJTA 2P5OA 4JV0A 4DO9A 2R8HA 3JPRA 2DTUA 3ZD9A 3Q8MA 3KTQA 4BDZA 4KLEA 4RPXA 5J0QA 3WNFA 2G8HA 4FW2A 4DLEA 3NTUA 3MGIA 3NAEA 5TZVA 4CEFA 3NH1A 3SQ4A 4GXIA 1IM4A 5DBBA 3TFRA 2Y1IA 4RUAA 2XY5A 1NJXA 7ICSA 3HPOA 4Q43A 3QE9Y 2P66A 3N4MB 1X1PA 2I5JA 2W9BB 2GBZA 3C95A 5KT4A 4ECQA 2XY7A 4DSLA 5EWFA 4YR2A 1ZQHA 4B8AB 2VANA 4IRCA 5EU7A 1BQNA 1BIZA 3QETA 5KG5A 1WSEA 3O4NA 4DSIA 3QINA 2J6SA 5IINA 4GC6A 3SPZA 2DY4A 4OPKA 4CJWA 4KN7A 2XRIA 4GMJB 4ZHRA 4MFCA 4ED2A 2J6TA 3OVNA 4P4MA 1LV5A 1KDHA 4CERA 2ZUCA 4F3OA 1Z26A 4Q8EA 4KAZA 4I9QA 3OYIA 4F91B 3RJKA 1LWEA 3KHLA 3H4BA 2R7YA 5J2BA 5EOZA 4F2SA 2QKKA 1RBTA 2NRXA 2BANA 3SJJA 1S6QA 3OS0A 2NRWA 4QZIA 1EXNA 4E1NA 3CM5A 1RT7A 5DK5A 1CLQA 2C22A 8ICKA 4KO0A 1T4GA 3PX4A 1TK0A 2X74A 3H8SA 3T1AA 2ZTCA 5KFSA 3LDSA 4I2JA 4RG8A 5D3GA 1J5OA 4AHUA 4F4ZA 3OHAA 4G1QA 2AGPA 2JGUA 2W9CB 5FRNA 4JWNA 1F21A 2PYLA 3SUOA 3EWAA 2ZQBA 3G6YA 1RYRA 1T8EA 4Z0UA 2BDPA 3QIPA 1XSNA 4KREA 3C6TA 4AHRA 9ICRA 8ICMA 4JRPA 7ICFA 4FJXA 1S97A 1B9DA 3KHHA 4M9NA 3VQ8A 8ICEA 3HVTA 4DSKA 2P51A 2BPGA 4PA1A 1ZBIA 4QZHA 3LK9A 4BDPA 2FLNA 3IRXA 4Z4GA 3V72A 1KRPA 3VQDA 1XWLA 3JPTA 1K6YA 3CG7A 2QKBA 4J9KA 4O3QA 4EP4A 4YG2A 1UA1A 2HNZA 5KG3A 1V9PA 2F1JA 4QWBA 3C5FA 8ICPA 5J0XA 4C8MA 2ZJAA 1MU2A 1HRHA 4KHYA 3GFKB 4AHCA 4UQGA 3K58A 4ECRA 3K5MA 5J2IA 4FK2A 2XHBA 5J29A 4QZBA 1JLQA 3H40A 7ICIA 4Z4HA 3WNEA 3KHRA 3PR5B 1NK8A 4UAZA 2NUBA 4J2EA 3H08A 1TK8A 1TGOA 4O3OA 4M04A 1S1TA 4F4YA 4GW6A 4E19A 3KKRA 1DLOA 2O4IA 2D0BA 2ISPA 1WN7A 4I2GA 4NYFA 5KFVA 3THVA 4I2HA 2YKNA 3AVAA 4J9QA 4QZDA 3PR4A 1C1BA 2IGIA 3M9MB 1NJYA 2R8GA 3HPHA 3OYLA 3DLEA 3RMBA 2BPCA 7ICEA 3MXIA 4K4IA 1UT5A 2HHQA 1QSSA 5KFYA 5KFTA 3AV9A 4P4PA 3TABA 4J9RA 1Z3EB 2KN7A 1FXXA 3ZDDA 3PW5A 5KG1A 5J0RA 4DL6A 1WSFA 2AJQA 1RBRA 4BE1A 1KEJA 1VSKA 2YNFA 1U9LA 4HYKA 5IIMA 3M9NB 3SUQA 4AH9A 3ZT4A 2OPRA 2OPSA 3ASMA 5DKWA 4KV8A 5J2PA 1NOYA 3SV3A 4N5SA 2ZJ5A 3KLFA 1X9WA 2OZSA 3HO1A 5DG8A 4N56A 4KHWA 1A77A 3ZSYA 1HMVA 4OGEA 5KFIA 3RB6A 4M6WB 2Z1IA 4Z4IA 4QZEA 4KLHA 1QLNA 2YHBA 1NK5A 3IG1A 4H8KA 4KLFA 3B0XA 4MFAA 3EYZA 1N48A 2AQ4A 1L3VA 1KTQA 3TAGA 4E7KA 2P6RA 3G10A 2ASDA 1WAJA 4UB2A 1LWFA 3OS2A 4RT2A 1RCHA 1TL3A 3L2VA 4UB3A 5CYMA 3PO5A 1RT3A 1HNVA 1D5AA 2WOMA 4KHUA 4FS2A 2FMSA 5KT2A 1HYVA 3DLRA 3RH4A 4CF2A 4OKEA 1MSWD 5KFBA 3M8SA 3BQ0A 4RW4A 4F5PA 3LPTA 5HROA 1L5UA 5KFMA 3OHBA 3E01A 4KMUA 4HUFA 2BE2A 1TAQA 4JWMA 4KTQA 3AVBA 4GXJA 4ED6A 1S9FA 3ISCA 3V7KA 4FLVA 4XUSA 5DB7A 5J0UA 4TUPA 1BIUA 4YN4A 5HNKA 4P4OA 4PY5A 3C2LA 5J2JA 4TQRA 4C8KA 7ICJA 1XC9A 3HK2A 3V6JA 4I27A 3SZ2A 3AUOA 2ZD1A 8ICTA 3CYMA 7ICNA 1BVSA 3H4DA 9ICKA 3ZT0A 5HP4A 1ZBHA 2FMQA 1VRUA 4JV2A 3VN5A 4DTXA 3TFSA 3NF6A 4CHQA 4B8CA 3VQQA 4FLXA 4FM2A 3KK2A 1RNHA 1KFTA 1WNSA 3AA4A 3DI6A 4I2IA 3BJYA 5JUMA 4HUGA 4M2YA 4CF8A 4LY7A 3O3FA 3AVMA 2YNGA 4M9HA 4IR9A 3V9WA 3V4IA 1Z00B 5BPCA 2F1HA 4HCBA 3UIQA 1HYZA 1U48A 1RT2A 1RT5A 2FBTA 3RWUA 4KB1A 4R8UB 4RT3A 3HX0A 1SKSA 1S9EA 1D8LA 4ECWA 4CJUA 3ULDA 3PW2A 3SUNA 2ZE2A 4UB1A 1XS9D 3GQCA 5JS1A 5IILA 9ICBA 5DDYA 1W9HA 3NHGA 5KFRA 4DQPA 4GLXA 3DLKA 4HHTA 4CHPA 4FJKA 4CJVA 3GV5B 4YCXA 4UB4A 4J9NA 1PZNA 3AO3A 1KCFA 4M3TA 1ZQDA 4Z4CA 3TAEA 1N5YA 1BQMA 4W5RA 1ZBLA 5DGBA 3H8WA 3DRRA 3DM2A 2Y1JA 3SQ1A 4OKKA 2JZBA 2XO7A 3RBDA 4ID1A 4J2DA 4TURA 3C21A 4CESA 1FKOA 2O4GA 4R5PA 8ICBA 3OJSA 2Q3SA 5BOLA 2V4QA 4YXJA 3MR2A 1VSIA 3VQEA 3UQ0A 3MGHA 5L1IA 4YVZA 3ZSOA 4RPYA 1YTUA 3HWTA 1REVA 1VSEA 1DOQA 1L3TA 2DPJA 4DOCA 4P2HA 1T05A 2PY5A 2ATLA 3AVNA 4MEYA 1W0HA 4BACA 1IKYA 2YNIA 5BOMA 4DMNA 4RW6A 3AO5A 5HRRA 7ICPA 1HQUA 5J2NA 4EBEA 1T3NA 3V6DA 5KFLA 1TV6A 3RBEA 4RQ3A 4IQUA 4FJGA 3V81A 1C0MA 3QNNA 4ZTJA 3NF9A 4Q8FA 4TUSA 1UA0A 2BCUA 4DOBA 1VSHA 2X6NA 4RQ7A 4O5KA 4NYNA 1C1CA 4ECTA 4ED8A 1WSJA 1RDBA 4DU4A 4CFCA 4F5OA 4O44A 4CHNA 1COOA 4QZGA 5EWGA 1BPXA 1BI4B 2PI5A 1RBVA 3AVHA 1QSLA 1FK9A 4L8RB 4JUZA 3JYTA
chains in the Genus database with same CATH superfamily
4NLZA 2BXJA 1ZYQA 5BREA 2RRDA 1VQ5N 1RLCL 2MZ1A 2QEXN 5J2PB 3A3OB 4FZMA 1C20A 1SJFA 4NM1A 2VQFJ 4HAIA 3SAFA 1EKEA 2E20A 1QD1A 3PLAA 1ILYA 3OYKA 3KK3B 3JSMB 5AQRA 3TA0A 2OTJS 1HX1A 2OPQA 3MTJA 5C24A 4X4NA 5GAEP 3NMAA 3BS9A 4O3NA 6FDRA 5KG2A 3PW0A 1M5KC 5IC4B 3IG1B 1N5VA 1TP7A 2GJIA 2GCFA 4BY9C 2V51B 3DN9A 4ECYA 3C6AA 2YXLA 2OGUA 3DXMB 3CXCM 4BXOB 3LP3A 1IBMJ 4DV5J 3G25A 2V69A 3MEKA 2OXOA 3OTEA 3VQ4A 1R8PA 1YRTA 3GONA 4EEYA 3GV8B 1YJWS 2IOHA 4PQUA 3NKYA 5K14A 3I9ZA 2QYCA 2G09A 3Q8QB 4US9A 1BCMA 2RMLA 3O9QA 3N9UC 2MKSA 1NGDA 3MGJA 4DV1K 2ZIXA 4CFDA 4PG6A 4Y1CA 2NZTA 3QGHA 5F8MA 4MKBA 3DV9A 2EC0A 3R9KA 8ICFA 3PIOL 3D6JA 1OVYA 2MLZA 4BDYA 1JN3A 3CUNA 4F7VA 3KDOA 3RJHA 4R63A 2YHAA 5HQ8A 2CNOB 2VYPA 4YORA 4TXSA 4KITB 3KDNA 4CYUB 1EZZB 5JVHQ 4ZA1A 3K5PA 4H4OA 4PYDA 4GKJJ 2QA2A 3GV7B 1UT8A 5CRXA 5J1PA 2LEAA 2UXDF 3GU0A 1U49A 5L1LA 1S4EA 1LW0A 3GOIA 4QU7A 1TKTB 4PGXA 1U6BA 3J81Y 3BGOP 3V4IB 1R8AA 1DRGA 2AW0A 3FBEA 5ALWA 4H5NA 2XULA 1S9EB 1ZQOA 1HPZB 4USIA 5AM5A 3BS5B 3TUZC 1FVQA 4DTMA 4IRKA 2AF6A 4FJMA 1BPEA 4I2AA 1VJ5A 2XSJA 1IG9A 3I6PA 9ICQA 1ZQIA 4DV0K 3Q83A 3QAEA 3CQ8A 2HQIA 1UVKA 1HNXJ 4OJLA 3HP6A 1YJ9N 3QU7A 1JQGA 4RNMA 3AVIA 3UB5A 1BGXT 3QESA 3RH5A 4M0AA 4FWOA 3QFPA 3OTDA 3KWMA 5KG7A 1F0XA 2YKPA 3VGLA 4IFYB 3SV4A 4PXCA 4LVSA 5EHHA 2VIHA 3PX6A 1FKPA 3AB4B 2FYXA 1HR0K 2VG5B 4CNZA 1OSCA 3M9OB 1U1QA 3BF4A 3T1HJ 2PMZF 3WNHA 3O08A 5KFDA 1KVAA 3GDXA 3R3TA 4FXWA 2ZDOA 4NXMJ 3ID8A 1A0PA 1H74A 1IBLK 5J0PA 1FDBA 1U1KA 4DFJA 4BRIA 3P4UB 2LA6A 1IBKK 5DJBA 3AM9A 2IDOA 4P2SA 5E3QA 4KTWA 2N3OA 4IL6U 1U6ZA 2WF6A 3HD1A 3V1OA 3FR0A 3OR2B 1AFJA 4DL4A 4MKVA 4DL3A 5L1MA 5HHIA 4QOZB 3R5GA 3C2KA 2RDDA 4JI8J 5E7OB 2OEJA 4C48A 3IR7B 5ALMA 2LXFA 2IYGA 1NOMA 4WU3A 4QYZK 3K2PA 2W3RA 1T3VA 3QB0A 2V0NA 3ZCMA 1RBUA 3L2UA 3Q8RB 2HGMA 3DLLL 3RMDA 3OTCA 4BQZA 4KMOB 3GJQB 4ZOHC 4Y2QA 3IAM9 4FO0A 5A2QO 3QEXA 1TUWA 1OPIA 1JL2A 3PYFA 2IHMA 2WSFC 2DNMA 2DISA 2XGPA 5I3UA 4MT1A 1OWXA 3CIZA 1N33J 2D3O1 3GLJA 2Q0ZX 5ALPA 5GMEA 5F8IA 1S0NA 2EG1A 3HMJG 1NGHA 5ELZA 4DWIA 4RLEA 2M52A 2PMHA 4JI4J 4X65K 4XEIA 9ICEA 4KKOA 4CK3A 3WKAA 3KK1B 4B1ZA 2BABA 3P39A 3I5BA 3TJ8A 3OYEA 3OYHA 5ALKA 4OL8A 3C6UA 3RB0A 2WHEA 4NM2A 1JLAB 3GSDA 4M63A 2FSKA 1X9MA 5AZIA 2JL9A 1RWWB 1VQNS 5DG9A 3M30B 4LZGA 3IA0A 5AIAA 1CJVA 3LZJA 4CI6A 4O9MA 2UVWA 1SJ3P 2WVBA 2IMWP 3I55N 1F2HA 3I82A 3F2KA 5ALRA 2YKOA 4JKCA 1IQZA 2HGNA 3U4LA 5J2QA 1B92A 3LAMA 3R1HA 1CPZA 2WW8A 4DX7A 4X4PA 3CCJS 5HANA 1JCEA 2CGKA 4LVNP 5HAOA 2BR0A 2J0WA 4XPCA 2PIIA 2L08A 1UWBA 3JQMA 2NREA 1S6PA 4DUTA 2HRYA 2RF2A 1CVJA 5DDPC 1BCOA 5KRTA 2DH8A 3IS9A 3L4IA 1ZQJA 1HARA 4JS4A 3JTNA 3PYGA 5MLCQ 3UMGA 4PHEA 4AQYK 2KW4A 3P5TL 3V2UC 1HJPA 1IKWA 2EANA 1HIWA 1S48A 2O66A 5HN0A 3CT9A 4P72A 3UM9A 3P31A 1XNSA 1TQLA 2QFJA 1E4FT 3TO8A 4USMA 2B9YA 2VFVA 5LMNK 4BRAA 3BP8A 1MWMA 3K59A 1PKUA 1K8AO 4F5QA 3HKZC 4HI1A 5FLXU 1VQ9S 3AVKA 2E8OA 3ZC4A 2BH1A 5GADI 4A2BA 4F8RA 3UKUA 3TANA 2B4UA 2OA8A 1HYSA 4C0ZA 4O0NA 4DV0F 2A10A 2ZZNA 1I94K 4NCGB 3P3DA 2LMRA 2HNYB 3TI0A 1UW9A 3ID6A 2YQ3A 1HI1A 3LP0B 4Y2VA 4IO8A 4KSEB 4B3OB 3W9HA 4MQ3A 3L2QA 3VAGA 4LQ9A 3QFUA 2YQEA 3FFKB 4I28A 4QOTA 3MMVA 2FPKA 4LIRA 3T9ZA 3D4JA 1DQAA 4GVMA 3HHDA 2WZ1A 3FDSA 1NK0A 2IBOA 2RT3A 4K2XA 3KKSA 2E1FA 3MBYA 3EUNA 2PFNA 1GLCG 4HHJA 2KIVA 2G8UA 3IFRA 3QFWA 4DR7F 1TKZA 5DG7A 4IOBA 3T19A 1BL3A 3CC7S 4LIWA 1MROB 2CPEA 2VKZG 1T9VA 1C1AA 2DFEA 4DR4K 3KXDA 3LOUA 2HSZA 4WYLA 4X62K 2Q31A 4NLOA 5E84A 1VHXA 1WUDA 1RAOA 1IBKF 2IVMA 1ZAXA 4O3PA 1LWXA 4ED5A 2CJ9A 2RKIA 1S1UB 3DRYA 3HKZD 3J7YU 1TV9A 3CJ4A 3CDUA 3QATA 4A8XA 3IGNA 5EOYA 1Q4RA 3HTVA 4YOWA 3C2PA 4ECZA 2ZTEA 3QJJA 1CBKA 4QIWC 2H3VA 3BEGB 1C7YA 5BXIA 3NVYA 4NYPA 4DL0C 5L46A 4QQBA 4NB4A 4QZ9A 2W03A 2YNHB 2O8FA 3KLGB 4C4WA 1JIHA 2HOEA 2HHUA 3N4QA 4M3ZA 2ZHOA 3ZSWA 2JX2A 1ZM9A 1WG1A 3SSQA 4FPBA 1Z6RA 1K73O 2JWLA 2A1AA 2G0JA 1EETB 4F3QA 2FZGB 1Q1KA 3DDNA 3HI9A 5CZXA 3QO9A 2VPYB 1J5EJ 1LW2B 4V19S 4CLTA 4JI2F 2Z2LA 5E3RA 4X64J 1ZQLA 1NRKA 3C7NB 4DSFA 4YQWA 1KXPA 3PRDA 3VAFA 1QVFM 1X5PA 1YBAA 2FSNA 2LCWA 2QB0A 1N6QA 5BYRA 3TAMB 3IUCA 2FPMA 8ICZA 3ZDAA 2ZBQA 1DGSA 2VKRA 2XGQA 2B6GA 2AYMA 1NGAA 3W9IA 1V4TA 1Q8LA 2WONB 2QLXA 3GILA 4XDDA 2VQEK 2GQQA 4OHXA 1LEOA 2C3MA 3NF8A 4BQLA 2HNDA 5DMRA 4ID8A 4F4WA 3K1RB 5K8PA 2BKOA 4FF2A 3KJQB 4CJRA 4DQQA 2V2VA 4CF3A 4QIWD 3NFAA 5DETA 1X8DA 4XH1A 2PZSA 4KLGA 5IT0A 3CCLN 1S99A 3O3HA 3O2IA 2AZ1A 2DO0A 4KFBA 2KHVA 2EI5A 4QJFB 3OYGA 2OZMA 4KLSA 3FRZA 2WBRA 2BKPA 3KMSA 5T7BA 2ZHAA 1ZQVA 3K5OA 1SB6A 1OSDA 1N61A 3BUZB 2HS0A 2CG4A 4JYAJ 3KFUF 3AHPA 3FBCA 5HMMA 3CJ5A 3NCIA 5G0RA 3PACA 2AMCB 4JI3J 4LH4A 2DNPA 2JEIA 3FKBA 3W3SA 1O51A 2E5LK 5B7WA 3VMFB 3CCMS 4DTSA 3CP8A 2VG6A 4BE0A 2G2YA 2FY1A 2ZIUA 5E0OA 4ZP7A 2F8SA 5J1EA 2HBQB 4I4BA 5D0RA 2C2RA 1CS4B 1B0XA 7FDRA 2BJ8A 3LP1B 3T5LA 1NKEA 1QDUB 4J9MA 1BD6A 5EVZA 4PHTX 2JH7A 2BCQA 4LT6A 3OPXA 5LMNF 2G08A 5F9NA 3L7UA 1GK8A 3KK7A 3TVKA 1S7HA 2KVCA 3CPEA 2O67A 1RDFA 1XNQJ 2KKZA 2VBZA 2HEKA 3ETOA 3WEEA 1JXBA 4R65A 3SD7A 4FLZA 4QS7A 3RYLA 2VICA 4JI7F 2Z4PA 1H1VA 5GADP 2ZUGA 2H3QA 4NLGA 1GQEA 4F04B 2VJUA 3FC4A 2MSTA 1R27B 3PMNA 1CQNA 1G6BA 1BDGA 4W5OA 4XK8C 1RTDB 3LDAA 4V19X 2N7YA 2ZKUA 3MN7A 1KVJA 1T9XA 4DR1K 1TAUA 4WCEQ 3OSNA 5HQMA 2N3LA 4YUDA 4OCZA 4QYRA 4BRNA 4USUA 2BACA 4ZVRB 4M95A 3A4TA 2DVIA 1ESVA 2EKYA 5C2GA 5GAEU 3R6LB 3Q2SC 3UPQA 3ZDEA 3ILLA 2XG8A 5FPMA 4RJVA 3DLGA 4DR4F 4RNOA 3SQ0A 2KJWA 4DL2A 4DS4A 4LR9A 2LM1A 3R8EA 1CULA 3O3GA 4C7QA 4JEPA 3DC2A 5KFNA 4K2JA 4KLQA 1QH9A 2YMLA 1FI4A 2OPPB 3FRYA 1R89A 2ZWPA 4IFVB 3E9OA 2LI6A 2NLXA 3EGZA 3O4QA 5E26A 4JV5J 3GMGA 1IXRA 9ICAA 2D69A 2NRRA 2DRBA 3TX8A 2DGZA 2YTCA 2E44A 5HVFA 4DV7K 1NGIA 3D6FB 4WK3A 1TYQA 4NEZA 4PUOA 2IOFK 2I8EA 5K4LA 2F3JA 3A13A 1WBDA 2KD1A 2IVOA 1RTJA 3FZHA 1WC5A 4NY8A 2KZ3A 2ZVSA 4LSLB 4YFUA 3D9BA 5AQMA 4KHRA 3NBPA 5B0CA 4YEAA 4TU9A 1VLYA 4YB6A 4BGBA 4LSNB 5G4DA 4MJKA 3X3UA 2IAJB 1RDAA 2OD4A 3SR6A 2KH9A 1ZETA 1U6FA 3C14A 1DGKN 4PWUA 4NLQA 1F9EB 2GC8A 4MO5A 3TZZA 3LGNA 2FJVA 4I29A 3IP0A 4O5FA 4R66A 1VBXA 3M8QA 4Q0BB 3AO4A 2BMBA 1KD1O 2OIHA 3PEJA 4O0IA 3RG6A 2DJWA 1B4FA 1M1KT 3AU2A 3NCRA 4ID5B 2E3TA 2F96A 2CYYA 2VDHA 4OX7A 2UUAJ 2P8IA 2YPYA 3E9PA 2ZC4A 3U3GA 3SMZA 1YJ7A 3CO9A 2N82B 3GBTA 4KHPJ 1M5VC 1RWOB 1RWXB 1CRXA 3GFXA 2G2OA 5A6PA 5KGXA 5AQZA 3R97A 1Q7LB 4I7FB 2OLWA 4PGQA 7ICKA 2O8EB 4PH5A 2YMPA 3LVWA 1PYTA 2HHWA 3BQ2A 3SSRA 1VBKA 2H3FA 3MCPA 1F5AA 4UAWA 2YV0X 2AYEA 2RJZA 5CD4H 2ASLA 5C42A 4U96A 1WSHA 2HRUA 4MAKA 1N34K 3HW8A 4QIGA 2DGWA 4QCLA 2V2QA 3WUHA 3AJDA 3ET6B 4HLBA 4FF3A 4DR2K 1KSPA 1JLEB 1YG0A 2M4MA 2QSWA 3TSUA 2E1MC 4CBXA 4QZFA 4JB3A 4Y2AA 3QRPA 7ICQA 4ED0A 1UZHA 5FPNA 1MQ2A 1VQPS 3G6VA 2A40A 4CBWA 4JKGB 5IQQA 1ZS6A 3ZFVA 4DL7A 1N5WA 4OLBA 3N7RC 3N4WA 3SEOA 4PKDB 1VQ7N 3ZXWA 1Z25A 3L6QA 4K4XA 2W9BA 1ZQZA 3EDQB 4KTZA 5LSRA 4GC7A 1JKHA 4PG4A 4M5KA 4JK8A 1VQYA 3ETRA 3FGVA 2SXLA 7ICTA 2EFQA 2FIUA 1SL0A 3LPYA 4P6QA 2GO8A 4Z6EA 1BQNB 1O08A 3NWRA 4F25A 1LKYA 4E3SA 5CHIA 2I9GA 4LQ3A 2DD8S 1D4XA 3KLHA 5F9LA 4LZDA 3L3VA 4E7HA 1YHQN 4KI6A 2YX4A 1FO1A 3NVMA 4WIQA 4CJSA 7ICOA 2IS3A 2RHSB 4IQXA 2MHEA 1QQOA 4MKYA 2JRSA 5ALYA 1RT7B 3UXNA 5G5GA 5HLFA 4DR1F 1Q82O 4OI0A 3WHIA 3A12A 2JNJA 3ISDA 3DLBA 5HHHA 1D8BA 1NJZA 4MF2A 4DUYJ 1NB7A 2B56A 2IDLA 4UUWA 3EKUA 5JVHL 3I5AA 4EO8A 3NAIA 2R8JA 5D3GB 3DXKA 4CJPA 5FP0A 4WE1A 4FJJA 2V6AA 2R7TA 4OJHA 1R6VA 1RCXB 3MM7A 3HSDA 2VJVA 2E2QA 1S1WB 1U1LA 3F2DA 3TAPA 4DFKA 1WI6A 4CJFA 4ZCLA 4K4WA 3MHYA 1FRHA 3AVJA 4NLCA 3FSYA 1YJRA 3WXJA 4FWRA 4PXDA 2BJEA 2RHFA 5ETLA 1FO4A 2W1BA 4ZIVA 2HOQA 2JEJA 3IRXB 4NYZA 1NKCA 3LDLA 1RJJA 3THYB 3W64A 1U2VA 2H1YA 3D2QA 1Y0HA 1DGJA 3L8BA 1Q81O 2WAQC 1WEXA 1X4GA 2K8AA 1RA7A 1QSYA 1EP4A 1YJVA 1OIAA 4CRJA 2P9CA 2CDQA 1RKIA 3UQSA 2J9DE 9ICVA 4B3RK 1G2EA 2MKIA 1FWKA 4BHQA 3G87A 3FE1A 2XHWA 4K8XA 1YTYA 4RPZA 4F3TA 1PJ7A 4HKQA 4CDGA 5H9FK 1E6YA 3OS1A 2ZJ8A 1L7PA 3M6UA 1SL2A 1FERA 1KHVA 1U26A 8ICXA 4EAHD 2VA8A 1RAGB 4YOTA 2OUGA 3ZZUA 2WSEC 2YKNB 2VFSA 1WHYA 5CWRA 4M41A 3MN5A 2C3UA 1V5VA 3MOZA 3DLEB 4CE9A 1BOTO 5U47A 3G2XA 2NSBA 2WMMA 1Y97A 1XMQF 2VODA 2O1PA 4RW8A 4LC9B 1TU0B 2R7RA 4FZZA 2HSTA 5J2KA 4H5VA 5HL7L 5ETMA 2FVQA 1DEJA 4KH4A 2ZBPA 4A8FA 3ZI4A 3U6FA 2XYPB 3QSIA 1RTHA 3HYFA 3LDPA 5AM3A 4FLYA 5ETRA 2DFLA 3OL7A 2OPRB 2IM3A 4KV8B 1PJ6A 1XR6A 2A3JA 5LL6Z 3QZ8A 4GFJA 4OYXA 4M42A 3KLFB 4LFAK 3WNGA 2FJAB 1LAWA 5KFKA 2JVOA 4GVLA 1SB3C 1ZQKA 3IKMA 2E5SA 4HDGA 4DR2F 4B1YB 2DFFA 4G9ZA 2YX8A 8ICLA 1NDPA 1F1BB 1YBUA 1WCLA 5E41A 4M3UA 2VFRA 4C8NA 3K5NA 4DX8H 1XI1A 2ZH8A 5C25A 2OI2A 1B9FA 3W9JA 1U4BA 5G5HA 2EFPA 2C28A 2V7ZA 2KO1A 2W04A 2GMHA 4BC7A 1GMWA 2DR9A 2CQ2A 1LWFB 5HBMB 4JV0A 3SMPA 3IM9A 3JPRA 3ZD9A 3Q8MA 3JQJA 1P7DA 4JI6F 4W98A 2D6FC 2P9IB 4NX9A 2G8HA 4FW2A 4DLEA 5AQKA 1I1GA 1WUAA 3SQ4A 1IM4A 4FZLA 2CNKB 2EPIA 1X9JA 3HT0A 5AKGA 4RUAA 4MIWA 2OEMA 4DR6K 3QE9Y 3P8BB 3ATUA 1X1PA 4H03B 2GBZA 3C95A 1FXRA 5KT4A 1Y5LB 4DR5J 2VBWA 4YR2A 3M1VA 1RQ0A 8RUCA 2BJ1A 5EU7A 2N1RA 4BG9A 1BIZA 4YOYA 1YF5L 5IINA 4BREA 2GIRA 3H59A 2DY4A 1YVFA 1W7AA 4UF4A 1NGGA 4GMJB 2IJNA 2QSFA 1SQEA 2J6TA 2Z2YB 3D6RA 4P4MA 1WSVA 2PEHA 4NLVA 1KDHA 1NDKA 3OTOF 4CERA 4F3OA 1UPPA 4LRBA 3RJKA 2FLOA 1AXQA 1FFGB 4M5DB 2OAUA 2R7YA 5J2BA 3IBWA 2NRXA 4ZPTR 1RBTA 1VQ4S 3MPUB 1ELOA 3DI6B 2Y0SF 1RYUA 2B4OA 1EXNA 3CM5A 1EWQA 2RP5A 5AQIA 2ZM6K 4K8RA 1X0PA 4ZLLA 2C22A 4KO0A 1T4GA 3TRGA 7FD1A 2X74A 3H8SA 2ZTCA 3LDSA 2IM0A 1CJKA 4ZVOB 5GMDA 3ZTSA 2QARA 4AHUA 5CA5A 2Z2MA 3OHAA 2OD6A 4G1QA 3JAMY 2VB6A 1VQ5S 3NRBA 1RP5A 2QEXS 1XMBA 2DWQA 4Y2IA 3EWAA 4ANEA 4FF1A 1RYRA 1T8EA 1KWMA 1NH7A 1ATSA 3AB2B 3QIPA 4HT5A 2UXDJ 3GG0A 4MO4A 4AHRA 3SAGA 4JRPA 4FJXA 4FXVA 1YVNA 4YDUA 4NV0A 4DKWA 3DNCA 2VZ9A 3VQ8A 3CW2C 2L41A 4B3SK 1U8SA 2MZTA 2QB1A 2FLNA 4P52A 1KC8O 3VEZA 1KRPA 1XWLA 2DHSA 1M5SA 4A48A 2QKBA 5HMYA 2YHYA 3DRRB 4H4KA 3DM2B 2LQBA 2HNZA 2P9LA 2C3OA 2BVZA 3MM8A 2MZRA 4Y00A 5DDOC 2F1JA 1DY3A 2ZJAA 3GFHA 3GFKB 3I4PA 3HRGA 3KUGA 4ECRA 3K5MA 2XMJA 5J2IA 2GHWA 4FK2A 2I2YA 2XHBA 1B7YB 4QZBA 4ISEA 3A8EA 3VC8A 3H40A 5L9NA 2Q1NA 7ICIA 5DO2A 3QUQA 3WNEA 3UI3A 4WFNL 4HTJA 3H08A 4BX9C 1T05B 4LF9K 4ZIWA 3KG1A 4Y28C 3HKWA 2RUSA 2K4HA 2MMYA 3BSAA 1HQUB 1KNZA 2JSXA 3E3XA 3V6DB 1C1BA 5AKKA 2QG9B 3HPHA 3OYLA 2EFGA 2NXJA 4GV9A 1HWJA 3DGVA 5ALVA 2B51A 4DV4K 1VQ6N 3L95X 5KFYA 2QWPA 3I4HX 2XBPA 4ED4A 3AV9A 4J9RA 2G13A 3FEZA 3K8WA 3LYSA 2HHHK 3TWZA 5GADU 4BE1A 3MMBB 2I6WA 2IVYA 3QXGA 4O44B 1TR0A 1U9LA 2DBYA 4HYKA 2OO4A 5IIMA 2W7OA 3M9NB 4AH9A 3ZT4A 5J2PA 4JHDB 3L4QA 4B3MJ 5GIOA 2NXUA 1Q79A 4DZ6A 3SDEB 4LF6K 2GGPB 2DGXA 2VOOA 2FGOA 5BRHA 1HMVA 5KFIA 3RB6A 4Z4IA 4QZEA 4K41A 1TL1B 3DGPA 3IG1A 1FWPA 3Q7CA 4KLFA 4MH8A 1YJ9S 2J0QD 4O8UA 2PO4A 2G9OA 1KTQA 3GB0A 2R7VA 4ZVSB 3G10A 4E7KA 2JC1A 2PGCA 3LTOA 2EWSA 1QY7A 3OS2A 7AT1B 1WOPA 3CJ0A 4QR2A 2MB0B 4C97A 1IKVB 1XN9A 3JTPA 2Q0RA 2DXFA 3UDEA 4KHUA 4FS2A 2QLWA 3KUHA 5H2FU 3M8SA 4HEA9 3W0LA 5KFMA 3QUTA 1X4CA 3AA8A 1AUDA 4I6MB 5B8HA 2CQ0A 4KTQA 4DHVA 4PQUB 1HBUB 2DNRA 3MOJB 3NLCA 1PGZA 5DB7A 2YB4A 4TUPA 4K0KF 3WIUA 3MMAA 4LF5K 4JI0F 3TP2A 5J2JA 4TQRA 1WWVA 1JALA 4CZCA 2GOLA 2M2BA 4LBIA 3H4DA 3I56S 1KTVA 5HP4A 1IR2A 4CYUA 2FMQA 5AKEA 5LM7E 3VQQA 2BZ2A 2KXHA 2HQFA 2J7KA 3CD5A 1TUUA 1GLJO 1AZSB 4DV1J 2JMGA 3BJYA 2JJ4D 4HUGA 4BR4A 4H4OB 1KQGB 3O3FA 4L75A 1LWEB 3N5BA 2ZM6F 4IR9A 3V4IA 4C3LA 4H0TB 1U48A 1RT2A 3RWUA 4KH5A 3WT0A 1LW0B 1SKSA 1S9EA 1HLUA 3Q8VA 1D8LA 4ECWA 4NOHA 1FJGK 5JVGQ 4B9QA 2RHQB 2F4VK 3FMBA 3AQEA 4LMZA 1RADB 2QL9B 2W3SA 2ZE2A 1SIJA 2QT7A 2RU9A 3EX7B 4GV6A 3GQCA 1ZXOA 2Q3PA 4M5GA 2XTJP 4PPZA 4QS9A 1O13A 3MUVP 2YWFA 4URQU 2UUTA 4A46A 5ADXA 3CHWA 5KFRA 2NYHA 2XSJB 4DQPA 3W5XA 3SFGA 4CHPA 2OEKA 2VONA 2HF4A 1BC6A 3GV5B 4BGAA 1I3OB 4YCXA 2ES6A 1HI0P 2E1RA 3N6MA 3AO3A 2GAGC 3WQUA 2HFOA 4NMLA 2V50A 3R9LA 3TAEA 5CZVA 1WEZA 4W5RA 1N36K 5BR9A 3N7PD 3M2UB 2Y1JA 1ZBSA 4NA3A 2V94A 1U0HA 1KOOA 3H1VX 2CQCA 2J9CA 3K8VA 3I55S 4J2DA 1S5ZA 1MN9A 3TZWA 1FKOA 4G1PA 1RFQA 1FKPB 3W66A 1Q86O 4LRDA 4PZVA 5JLFA 1FT8A 5HMZA 2V4QA 3SQOP 4YXJA 5LJWA 2DRDA 4M5MA 1WWUA 3L4PA 3D2EB 4WCEL 4JKEA 1T3OA 2X51A 5BN8A 1REVA 1MU2B 1F9HA 3K89A 5LJ5Y 1L3TA 4NXNK 3OR2A 4FOIA 2ATLA 3AVNA 3CO0P 3SCKE 5AI8A 2ZH1A 1JLQB 3J7AN 1NU4A 4ZCIA 1VC0A 3G4SN 2YNIA 5BOMA 1HR0J 4RNHA 5AK6A 5J2NA 4JKAA 3R1LA 4PZNA 3H5XA 1VIXA 4XAKA 2ALYB 2HGLA 2AJ2A 4DPYA 2HFNA 1IBLJ 1HIYA 2LM4A 1YK9A 4H0PA 2DY1A 1IWAA 4ZTJA 1Z1VA 1IBKJ 2EXUA 5D78A 5IWAK 4DOBA 3PM9A 4PG7A 1VSHA 5DZ7A 4FVUA 1ITPA 1HUXA 4C2MA 3CWJA 4V19J 4BRPA 3CPWM 2DXEA 2GO7A 4NYNA 4GV3A 4F5OA 1COOA 3QJPA 5D4OA 3I9V9 1UP1A 1F2GA 5AI5A 5EWGA 1BPXA 1LXNA 3PYDA 1IBMF 5I3UB 4DV5F 4QYZJ 5D6GA 4L8RB 2HYIB 2Z57B 4IOCQ 4CEEA 1IJEB 3MURP 2ACMA 3OPKA 3KK1A 1FNMA 3CF5Q 4FLWA 4LF7K 4C8OA 2LYBA 3I32A 4KKOB 4L3NA 4WYWA 3IBCB 4FWNA 4WP8A 1X4AA 4CO1A 5IIOA 2EQYA 3EGNA 3B4DA 4MK9A 4CTAB 4DTRA 5B08A 5DB6A 4PAAA 3OXFA 2BYCA 1RYSA 3AEVA 3MFHA 2KIWA 1KL9A 2M70A 1ECWA 3Q8KA 4EELA 1TL3B 5AZIB 2F77X 4IJAA 3BSCA 9ICMA 4CGGA 4M9JA 2L9WA 2WOMB 4KLTA 3IV6A 2Q36A 3OT9A 4RX6A 5IOLA 3DXSX 4X65J 2P9PA 5I9EB 4FK0A 4B9SA 1H7XA 1XTZA 2P1JA 4GKJF 1FX2A 3O9SA 2VPWB 3OYDA 2BE2B 3H1QA 5AQFA 1JI7A 3HFZB 3U1LA 2W2OP 4BWMA 4FWSA 5J2QB 3VF0B 3MD3A 2HMXA 1K8AT 3MN6A 3MMCB 4ZJQA 1SXEA 3HHKA 1MDUB 5M1PA 1HNWK 3MAAB 2HHSA 2BZFA 2GVZA 3R7BB 4OZ5A 2ZD1B 2KHOA 4F26A 3T79A 3THXB 1S6PB 1HBOB 1CXQA 2MA1A 1NHUA 3KJFB 2EX3A 1GMWD 3C16A 1XERA 3CJ7A 1ZOTA 5EY4A 4KLMA 3ETMA 4UOFA 1VRUB 1JXVA 2K1RA 1QS4A 2HVHA 1QHTA 3JAMU 4Z6CA 1S7IA 3PFOA 4ZDNA 3SI6A 1HKAA 2C2EA 2HFUA 5E5NA 5DGAA 2OYYA 2YCHA 2QA4N 1HNXF 1WNEA 5IQ6A 4KLLA 1IKWB 2WRMA 4OX6A 4W90B 2H5JB 2E1YA 5HP1A 4KQZA 3CD6N 3D0HE 3R3LA 4KLOA 4J9VA 2GS8A 1EO1A 2DK2A 2LYVA 1KVBA 4CHYA 2GA7A 3H7IA 1RT5B 2Q2RA 1O6XA 1NLKL 2KN4A 3TUJC 1H3DA 4YDUC 1S0VA 4FJ5A 4BC3A 5SWMA 1VI7A 4AQYJ 3LWMA 3UKUB 4CCHA 2KI2A 2CQ4A 3OTQA 4ES1A 2BGGA 1HYSB 2PFPA 1NAQA 1U04A 1HWKA 2KKVA 1D9DA 8ICVA 5C12A 2GHVC 4H4KC 4FJ8A 2YWHA 4AILC 2QYGA 3NMRA 3MM9A 2AGQA 5HI7A 2LDIA 1VBZA 1U09A 2V34A 4KGKA 5CHGA 2LXIA 4IYQA 5CCMA 2PD1A 4WFXA 2VA3A 1N36F 3L2WA 4RTFD 1Z2LA 3CXCR 1LK5A 1NSKL 3NRWA 3J80O 3OL6A 3C1YA 1MROA 1NM1A 4DSEA 4JI8F 3CCLS 1I94J 1BQMB 1HJRA 4FWLA 3H0LB 3GIJA 1VC6A 5H9EK 3B6PA 2LBOA 2DBBA 2J9EA 4F36A 2WSCC 2ATQA 3DEEA 3D54A 5KG0A 3KWIA 4YOUA 4ZVHA 1YWXA 1K73T 1MWKA 3NOCA 2XICA 2J9DA 3M8PA 2X7IA 2B7BB 1Q5VA 3TJ9A 4NXNF 4UTGA 4C8YA 4WKYA 5B0DA 1ICEB 3BN4A 2MKCA 3D1OA 1NCLA 2VF3A 4LFCK 3ZETB 1XO1A 4I2FA 3QT8A 4FVMA 2RKIB 2KM8B 4CZMA 4TKTA 1HW9A 1P6TA 1GO3F 5THWA 4F0MA 4WFYA 3DLJA 2RU3A 4XQ8A 3IFEA 1J5EK 4QW8A 1N33F 2OCEA 2JR5A 2KZZA 2YNHA 3KLGA 3TQ1A 3BSNA 3K57A 2QJ3A 1N5SA 4X62J 3AN1A 1RU2A 3P45B 1ZOLA 3VA0A 4FJ9A 3GJTB 1J54A 4JI4F 1TV6B 3TR8A 3TZXA 2O8FB 1L3UA 4NA2A 1WB9A 4ECUA 4G65A 1PC5A 3TARA 4CJQA 2DPIA 4US8A 1DAXA 2MQ8A 4BLGA 1LW2A 2GFFA 5AFUA 2GQCA 1BI4A 4NLYA 4CLUA 3C7NA 1JNRB 1ZQSA 1P27B 3J80U 4I2QA 3FQLA 2V8DA 1HNIA 2V63A 4PPXA 1X42A 4P7TA 3OJUA 2ESEA 3V9XA 2UU9K 3UQ2A 4EGLA 5CB1A 5HOOA 2XQCA 4J9OA 4KH6A 5HO4A 2FJEB 4QR1A 4I2EA 3I5CA 2QB0B 4D3GA 1N6QB 3JPSA 2WONA 4AYBF 4GXKA 2B9XA 2CQHA 4A8SA 4CK2A 1CUKA 5KFEA 8ICRA 4DR3K 1B43A 3KD1E 4DFMA 2EBEA 1S10A 3EVMA 2XCPA 2YX1A 1TK5A 3CDWA 5B5EU 2HNDB 2X3DA 3T1YK 3F5AA 4CF9A 4EHTA 2BV3A 2KT5A 2ZIWA 2WBMA 3M8ZA 2CVEA 2RDIA 4CIFA 5AI0A 2MUTB 2UXBK 3EICA 4ZVGA 3SJHA 1FDAA 2ZOFA 5HRNA 4KFBB 4BS2A 4NZ0A 2M88A 4YR0A 1DBDA 2VQEJ 2FD2A 8AT1B 3L5KA 3VF2A 4K4SA 2R2UA 3IM8A 5CR0A 1WHVA 4HTIA 3CRXA 5G0RB 3K7RA 7ICRA 2H54B 4F93B 1NK7A 4BGDA 2YPZA 1B70B 3HHEA 2NRTA 4Y2UA 1EKSA 2A1RA 4FDFA 3UKRA 4LFBK 2JZ5A 2ZIUB 3DU6A 3D3BJ 4ZMMA 5AT1B 1T7PA 3JPPA 4DX5A 4O5BA 4IG0B 1YZ6A 3LGHA 5J1EB 6FD1A 3P83D 4Y0WA 5C5JA 1AW0A 5CE3A 1CC8A 1KOHA 2MKKA 2XY6A 2ZF5O 1FDNA 3HVAA 2HB5A 4RWTA 1IO2A 4FJNA 2E5LJ 3MEGA 4FP9A 1HJOA 2RH3A 1WLJA 1UEUA 3SXLA 3UW1A 1VHFA 4CGFA 4LSZB 5ALSA 2AU0A 1T44A 2Z0GA 4DCHA 2ZJPQ 1X4DA 3VQ6A 4FWMA 4KGMA 4CZFA 3CFRA 2M8HA 2WB1F 1GLDG 1IKXB 2E5HA 5KT7A 4FWQA 3EE3A 3U9DA 3N6LA 5F3ZA 2W24A 5JJBA 3C94A 2HZAA 4U95A 3E2EA 4RQ8A 1RDDA 4Y3CA 3OGUA 2DGVA 3LP2B 4P75A 4AXIA 4YMOA 1YJNS 5KI6A 3VQ9A 4MMOA 4IRDA 3C5GA 3F56A 3WK9A 2YBVA 8ICAA 4W5TA 2KYXA 3PUFA 4CECA 3UMBA 4A8MP 3G9CA 4DN9A 3MWPA 1JROA 4EP5A 2KHCA 3M2VA 3CM6A 4ZP8A 3FC9A 4DPOA 3HHNB 2B0GA 4B08A 3NVKA 5J0SA 4LH5A 1XR5A 2VFUA 4FBTA 3RR7A 2OPPA 2DGQA 1WKLA 2YWKA 4USJC 5AQOA 4PKHA 3HX9A 4MFFA 4DR1J 3AVGA 5F3XB 1RWVB 4JI5K 3RFAA 4AP9A 2E2NA 4BC5A 4LRCA 1KD1T 3A1YG 1UVLA 4PHAA 4Z6DA 5IS2A 1Q9XA 3NGZA 3HOTA 2LDYA 3MUTP 1J5EF 5EWEA 3MDQA 1VR6A 5B0AA 2P5GA 1VQ7S 4YD2A 3SBTA 3A3NB 4F4AA 4X64F 4DTNA 2KSOA 4PUOB 1QM9A 1R0AA 3G8TA 3V9UA 2BW7A 3VF4A 1X6IA 9ICJA 4OLAA 1RTJB 4QNLA 4USAA 1WF0A 1IXKA 2E66A 5A0YA 3OXGA 3NBPB 2COLA 4UAUA 1BHLA 2ZNZA 3BQ7A 2R7OA 4BE2A 2KP7A 4MTPA 3R6GB 3ZNUA 5H1SV 3U3YA 3NGUA 4DV7J 5J2HA 1ITGA 3C14B 1ZJNA 1X5TA 4F4XA 3QLHA 1Y88A 4ECVA 1YHQS 4IDKA 4OI6A 1HUOA 4TLQA 5L39A 2H3ZA 5CH7B 2UU9F 3EPGA 2DITA 3IMXA 3RMAA 2Z7JA 4EWTA 2JLFA 4ILRA 1DTTA 1SKUB 5GVQA 4M94A 4QIFA 1YX2A 4WP9A 4K5SA 4KBOA 4QWCA 4ZS6A 1V3SA 4I7FA 3TPQA 4DR3F 3AJ2A 4RW9A 2H3EB 1Y11A 2O8EA 5J2DA 3NEKA 4CJ4A 2CXYA 4B17A 2LU1A 2KB2A 1N0UA 3T1YF 4U7UD 3FYHA 2R8KA 1COKA 3VAJA 2UV8G 5AXLA 3M7DA 1RBLA 2BRLA 1A5VA 5C42B 2OSQA 3G6EN 9ICIA 1P8ZA 5CZ1A 3M6WA 3RJEA 2E5IA 1UFKA 4UAYA 3OYFA 4PHPA 8ICWA 4N77A 4C1NK 5JICA 1RBAA 1JCFA 1A76A 3T5HA 4BR7A 2JFDA 5EE3A 3ALRA 2DHGA 4KLUA 2CKWA 1SV5B 3R7NB 4JKGA 2WTUA 2LU2A 2OJ3A 1A5WA 3QT5A 4MLHA 4FPAA 2HURA 5GAHU 4W92B 4JI1K 2CPIA 3UMCA 3OW2M 1NGCA 1KLNA 4L6V3 2G8IA 1ZQCA 1CZBA 1N34J 3AA2A 2C2DA 5DBAA 3OBWA 1HHQA 3CCUN 4KE5A 4DR2J 2KXFA 3MEDA 4J9LA 1ZBTA 2V8PA 2NXNA 3RMCA 2JLEA 4ZP9A 3R8YA 3D2FA 2FLLA 4ZJLA 1Q82T 2VH7A 2F76X 3V7JA 4K4YA 1JKHB 1IG8A 1QQMA 2DGSA 4W5QA 5F0UA 3L4BC 5ALJA 3QERA 2NXEA 3ZT1A 1JXLA 5IM0A 3SQ2A 2EZZA 2MZJA 2P6SA 1ZQMA 3B4MA 4UY85 3P6YC 4FE3A 3Q89A 3ZX0A 3L7PA 4TU7A 3NL0A 4N8NA 3PHEA 3ZEUB 1RTIB 1VIOA 2FY8A 4JNEA 3KLHB 4QJVA 2HBLA 1ZQWA 2MQNA 5HJXA 3CCEN 2HHXA 1RBSA 4A2AA 4M47A 2YHXA 4CGJA 3AVCA 5HR6A 1NK6A 4Y2PA 3GP9A 5E3PA 3R5DA 3CCZA 2RB7A 2Z56B 2R4FA 5TKWA 3AY9A 5KFGA 2J4RA 1H7WA 1YUWA 1FEHA 1DQ9A 2J0XA 4CBUA 3HSZA 5HLFB 4JV5F 1L7NA 1W25A 3TWHA 4JAXA 4N8OA 4JK7A 1S1WA 1RGIA 1CLFA 1Q81T 4LF2A 3A3PB 2MKHA 2VD3A 3ZZTA 1KFSA 3GE9A 3LVVA 1LAVA 3M8YA 2B0CA 3D66A 1RDUA 4EFAC 2O8BA 2M8DB 3MM7B 1URJA 2AP6A 1KHWA 1BO5O 5EN1A 2KTQA 2LVWA 3CMES 4OYOA 5LJ3Y 4FYVB 4J2BA 3D45A 3VGSA 4ISGA 4JLHA 1PIEA 3EGWB 3S3NA 1WCNA 2H3IA 2UVVA 1QE1B 4TYBA 2KXNB 2BGWA 5JVGL 1K1SA 3WU2U 2VBXA 2VJ5A 3EZUA 4NZ6A 1ZQ1C 4CJLA 2XHCA 4U6PA 2XMAA 4ES2A 3MXMA 3MR6A 4IFEA 1L8LA 1BNPA 2FHKA 4CFBA 3VTHA 1J53A 1F3VA 1RDWX 4C1NI 3G0ZA 4FCYA 4DV3K 1LVHA 2FVPA 3KLIA 1EX4A 1KN5A 2UUAF 1TUGB 4ANDA 3Q0AA 3GTYX 1YBTA 4O4RA 8ICCA 4O0JA 4JK9A 3K4GA 1XNRK 2E88A 4RQ1A 2IC3B 3RUBL 1DK3A 3QGPA 2PFDA 1X9XA 4KHPF 4DU3A 2GHPA 3IRWP 3NH2A 1ZZFA 3F5TA 4HVZA 3HZEA 1T0TV 3MECA 4PR6A 1X2IA 1S77D 1S0MA 5IIJA 1I5OB 4OZ0A 4KN4A 2VL1A 2CQ1A 3JPQA 1E6YB 4FLUA 1IR0A 2HWHA 3Q8LA 5D8HB 2CVIA 1QHAA 3CJ8A 1U1MA 4BRQA 1B7FA 3I31A 2QWNA 3W65A 1ZBUA 4B3RJ 1AFIA 2GAHC 2O6KA 1ASWA 5AQGA 1FFVA 3NGTA 1FJCA 1BUPA 4CJ3A 4KHSA 2CQPA 5IT9O 4X4UA 5H9FJ 1RWMB 2DHHA 3OL9A 1SUQA 3BZCA 2NPIA 3PDNA 3HVRA 2A3VA 4IEIA 1Y5IB 4RW8B 1SC1B 4I6AA 1NHKL 5AQNA 1NMEB 4CJ5A 3QEIA 2C2ZB 1RTHB 3RSEA 4DI6A 3V1QA 1TTHB 5KT3A 1WTBA 3V9ZA 4X66K 2F2AB 1T03A 3K5LA 2KRRA 1C0UA 1MLAA 3EE8A 3EN9A 3ZDCA 1H73A 2WUSA 3CCRN 3NVZA 1HQEB 4OJ5A 2KZMA 1YJUA 3N5FA 3MR5A 2V2KA 2HMIA 2ZJQQ 1E4GT 5IIIA 5HBMA 3W2WA 3H8MA 2W9AA 4KLDA 1NOZA 3FEYB 5C25B 4DV6K 5HMXA 4NZ7A 3GL1A 4JI1F 3GFYA 2WF7A 4ALZA 2HQDA 4IOCL 5E3CA 2A6OA 1LFPA 4J37A 2F8TA 3VALA 3QWUA 4LFAJ 3CF5L 4M3RA 1Q7YO 2BPFA 4ECXA 4O23A 4KY3A 3BQ1A 4QW9A 4QAGA 9ICPA 3J7YP 2UYTA 4BR0A 4KI4A 4LD0A 2E7WA 3RB3A 3CVKA 2R7QA 1HQ2A 2JWNA 2O3DA 4QIEA 3UVJB 3SUPA 4V1Ak 3VQAA 1LWCB 3ZSRA 2O8CB 2AJ1A 1Y3JA 3FJ2A 4M3XA 5M1KA 3OLAA 1PK1A 4FVCA 3M1VB 4IO9Q 2PI4A 3DRSB 4DUYF 1ZQXA 1REGX 4OVLA 1WAFA 3TKAA 4LF1A 5KAFU 4DQRA 1B0VA 3CC4N 2IIHA 4M5DA 3GZ7A 4CEZA 3RF9A 4QPTA 1GOBA 4DR6J 3C29A 4ETXA 2W6KA 4B1VA 2AKWB 2YQ1A 3UR3C 4KRFA 2B5JA 1VQ6S 5BR8K 4JS5A 5SZTA 3IM1A 2D0OA 3IAYA 3R6MA 2I6XA 5FDLA 3SCXA 1BE4A 3B6OA 4K43A 1GX5A 1KC8T 2W6LA 2BE9B 2XI3A 3GJSB 5AM1A 2Y0BB 4USVA 2RS2A 3RJJA 4KO0B 9ICWA 3U27A 5J2CA 1RT1B 5CEHA 5C15A 4X4SA 2OTJN 2HIYA 1TKXA 2UVUA 3EEQA 4G1QB 1W7WA 4S0MA 5KFXA 2HOFA 2IRYA 1S59A 2BJDA 2CPRA 5DQGA 4HHHA 1WKKA 2K7KA 3M3ZA 4IQWA 2IA0A 2ZM6J 4O5EA 3POTB 4DSJA 1UWAA 3RJGA 2KOBA 3QIPB 3MZIA 4XO0A 1NI3A 4EBCA 4J8FA 1MC8A 1SJQA 3U7JA 3OTBA 5ETNA 2F7TA 5LMUK 1P9YA 2QN6B 4TSXA 2BKEA 4PWWA 2NUUG 3Q8PB 1ZTTA 4HH1A 2Y9HA 8ICIA 1SI9A 2AA4A 1S5LU 4CE6A 2RDJA 3IMQJ 3C1ZA 1AUSL 4KX3A 3CFPA 2Y0SC 2FUG9 3F73A 3QEPA 5KT6A 2CRXA 2FDNA 1KEKA 3TOQA 4EENA 2HNZB 2RPIA 3MM8B 2EKNA 3UD5A 3ZSZA 3S1TA 3VQTA 4HCCA 2QMWA 1TVRA 3KUEA 1X6JA 1O1WA 5ADZA 3CTRA 3TA1A 4H54A 4B3SJ 2XM3A 4CGZA 2PXIA 4AM7A 1IH7A 4W5NA 4FZNA 3G8SA 3S3OA 4PL1A 3O44A 4KPYA 2MQLA 2LQ8A 3KZBA 2XMUA 2QX0A 5L1KA 1VQSA 2G5HB 4DB3A 4BRKA 1QAYA 5BRDA 1ZTWA 5ITHA 1NPKA 5DB8A 3WC0A 4KX5A 3GYNA 3JS9A 2JGAA 4CGDA 4JD2A 5L8RC 2K06A 1LCUA 2V4RA 2FE9A 3A8IA 1R8BA 3HXMA 8ICSA 4NLXA 4EX7A 4LF9J 1RAHB 1OY6A 3NGRA 3AODA 1NB2A 3CDEA 4IOXA 4OYWA 1QQ5A 1RILA 3LPUA 4JHDA 2B8QA 2VWKA 8ICUA 3BY5A 1KQSM 2JRZA 4M9GA 1SJ1A 4EI2A 4ZPDA 3J7Z5 4DLGA 2A42A 3MWTA 1T3QA 2IRUA 2OMLA 1D8YA 1TL1A 1UAXA 3PV8A 4DV4J 3ZTOA 4ZVQB 4FKYA 2Z1JA 3D1QA 2HQCA 1QZ6A 2HHHJ 3THWA 1HMVB 2R7UA 1ZQQA 5ETSA 3DGPB 2ADCA 1NEEA 4YR3A 4DV6F 4DR5F 2CGLA 4ICLA 1IKVA 1JLFB 5KFCA 4O5CA 3JQKA 2JV3A 5DLFA 2O5DA 1RPLA 1KVKA 2F8HA 2MQOA 2WBNA 1BA1A 4DO9A 2R8HA 2O01C 3TYTA 4LF6J 5J0QA 2P9UA 4J9UE 4I6MA 1HBUA 1H72C 3ZTQA 4CH0S 3MGIA 4CEFA 3NH1A 4WXWA 3PSIA 5DBBA 2YKMB 4U7BA 4WXOA 4CZKA 5D0GA 2CAJA 1YQHA 2JDJA 1N2XA 2EVZA 4Q43A 3MC1A 2KJ8A 4KYZA 2DEIA 2I5JA 3NG8A 4LF4K 1F0MA 3IAS9 3MMAB 5EWFA 5I42B 4B8AB 4W4MA 2JC0A 3G4SS 1NJIO 3UN3A 1RXOB 3QINA 1WSEA 4R79A 1HWIA 3M05A 3FZ2A 2W43A 3OBIA 3VENA 4OPKA 4CJWA 1YKWA 2XRIA 4CWBA 1AZSA 2KJ5A 5JXSA 2GMJA 3KOAA 1GLBG 4ED2A 3OVNA 4CLZA 2ZUCA 1RUSA 1Z26A 4Q8EA 1M5OC 1Z05A 4KAZA 4F91B 5CR4A 1LWEA 3CCVS 3H4BA 4ILJA 2MGZB 2QKKA 4ZPCA 3SJJA 4LF5J 3VOVA 4RO0A 2NRWA 3C6HA 3FUYA 4E1NA 2FHMA 3I8BA 1RSCA 2RRAA 1CLQA 4UZBA 3AJ1A 4WYBA 1TK0A 2GX8A 1RT2B 3EVWA 5KFSA 2XYHB 1Q3VA 2HQGA 2V8HA 4WKRA 3CDAA 1Q86T 2W9CB 5A8RA 3SMSA 4CO2A 1F21A 2ZE2B 4JKFA 2HFSA 5FPEA 5I4MA 2DUYA 3MK6A 4PPDA 3TJAA 3PSTA 2PBDA 4R0JA 4G9BA 3C6TA 1S12A 3QU9A 3UCZP 8ICMA 1SH3A 3DCAA 4LF8K 5HK4A 4NLPA 3KHHA 1B9DA 2A3ZA 1FJGJ 1A7GE 1V3ZA 4P2FA 2F4VJ 2ZJPL 3M2UA 2QA1A 2HS3A 4KIAA 4NLRA 3KG4A 2BPGA 1O03A 1KQFB 1ZBIA 4QZHA 4BDPA 4EK2A 4ZPAA 3JPTA 3CG7A 4CZGA 2CQDA 1N8RO 2QZ8A 4YG2A 1U0HB 1UA1A 1V9PA 4UB6U 3MDFA 5ALXA 1FTCA 1FKOB 1RABB 3D2EA 3M6KA 2L9DA 2MJNA 1MU2A 3E9LA 4PL2A 3WK5A 2LA4A 5E2QA 1SXLA 3GFZA 4TN2A 2KU7A 1JLQA 4Z4HA 1N36J 1REVB 2NUBA 5BYQA 2KFYA 1JNZB 1ZM2A 1TGOA 4O3OA 1S1TA 2FI1A 4H5WA 3HD2A 2A6AA 4GW6A 2YNIB 5C10A 2L5YA 1NNEA 3NP5A 2OKQA 4E1JA 2H51B 4B3MF 4WJ3B 5J2NB 5LY3A 1Y00A 3D2NA 1SZHA 3FSXA 2X1FA 5M1QA 3PR4A 2YWWA 1EARA 3IR5B 4JOUA 2IGIA 3M9MB 2QA4S 1NJYA 5F8LA 3VEXA 4RW7B 4NXNJ 4I64A 3RMBA 2BPCA 7ICEA 3KLEB 2CPYA 4OI1A 5ETPA 3UE2A 5AR0A 3PW5A 3IDHA 5EXWA 2LPEA 2LQ5A 2DQNB 1WC6A 1RBRA 1KEJA 3KMQA 1GLAG 3BEXA 4I67A 3D2WA 2OPSA 3GYXB 3UWTA 1AA1B 5IXUA 2I38A 1X9WA 3HO1A 3U1NA 2CZVC 3ILIA 3P38A 3CETA 2MDAA 4A8EA 3C15B 3RAMA 4H0YB 4N56A 3O6QA 1A77A 4CM0A 2YMMA 4B6JA 5IWAJ 3A5NC 1VLOA 5DM6Q 3E58A 4KLHA 3MEEB 1NK5A 4H8KA 4FYYB 1MMDA 2NO5A 3EYZA 4ZPWR 1N48A 4CTAA 3KLVA 3QQCD 1L3VA 4OPAA 2W2PP 3CDBA 3TAGA 3ZZRA 2QMUB 4UB2A 1YI2N 4CO3A 4TU8A 4YB1P 1TL3A 3W62A 1RCHA 2FF3B 5FLXO 4WWSA 2AYBA 2WOMA 3F0NA 1HYVA 1RZMA 4CF2A 3VEVA 4UOCA 5KFBA 3TX0A 1WUUA 2DB1A 4ZVEA 3KBBA 2WVDA 1L5UA 4LF7J 4HUFA 4PJ0U 5KL1B 2BE2A 2C1EB 4DU7A 4DV1F 4JWMA 2P9PB 5ETVA 1Q5YA 4KAIA 4GXJA 1S8OA 3ISCA 4FLVA 4IS7A 2YMQA 3MMCA 4B3TK 4XUSA 1XMOK 3FMWA 1BIUA 2EAPA 5LJVA 4YN4A 5HNKA 4PY5A 1V6HA 5D0HA 2IVPA 3HK2A 3GCWP 3W63A 3SZ2A 1WYGA 1KVIA 3MAAA 4ZVPB 1URNA 2ZD1A 3THXA 3K0JA 1HBOA 3CYMA 3JS6A 4O3MA 4ZOSA 5KNIA 1X60A 1SV4A 1YITN 1VRUA 1UW4A 5KOXA 2GVZB 4G1IA 4DTXA 2GW8A 3TFSA 4CHQA 4B8CA 2GLEA 2FTRA 1WOSA 4FM2A 1QVGR 3GJRB 1KFTA 3C16B 2WF9A 1WNSA 1FTRA 4HHUA 2K1RB 2E8MA 3RU0A 5FD1A 4I2IA 4PKIA 1UFWA 4LY7A 5AE1A 3AVMA 1NG9A 2QLTA 1OH7A 4OI3A 2Y1RI 2ACYA 5IT9Y 2HDOA 1C4AA 1HNWJ 1HYZA 1RT5A 5HP1B 2LLZA 4OJ1A 2FDRA 2KDOA 4GY2B 4CJUA 3QU2A 3BV8A 3PW2A 3CJ9A 2QV6A 3ZZ0A 4CP5A 1XS9D 2CJBA 4FPRA 3EE9A 5JS1A 3FK4A 5A8KB 5IILA 2LP4A 3NHGA 4LF8F 4GLXA 4ES3A 2CIMA 4HHTA 3VERA 4CJVA 1CI4A 3NCQA 4UB4A 3BBBA 3QGIA 4GVEA 4J9NA 3MM9B 1PZNA 1Z4OA 3CNHA 2B8PA 1RHMB 5AI4A 1PG5B 4Z4CA 3HVTB 1N5YA 1BQMA 3DJCA 4K25A 4WFZA 3WKCA 3E51A 2WVEA 5DGBA 1HR0F 2V8VA 3VR1A 1RWKB 2CXEA 2E1EA 3MAHA 3G71S 2MPUA 1YXQA 4CESA 5EX3A 2U2FA 4PABA 4CLLA 1XR7A 5BOLA 3NGSA 1IBLF 2K2PA 3MR2A 3H3OB 1JJ2M 3MCAB 2AWZA 4NMXA 2E8PA 3MGHA 5KPRA 4YVZA 1SIZA 3M8PB 2FSJA 4RPYA 3HWTA 3ZETA 3A8JA 4Q2LA 2ZHBA 2ZDPA 1VOMA 1GTEA 1VDVA 3CCSN 2MKYA 4BACA 5AM0A 1G7CB 3S7RA 1IKYA 4GNIA 1VQ8N 4RW6A 5LT5A 5H9EJ 5HRRA 2BTFA 3UCUP 4YDDB 4LBPA 1BHNA 1TV6A 4BRFA 3IBFB 2FXUA 4H0XB 2HK2A 4RUHA 3E0FA 4PRFA 4P74A 2CPHA 4C4TA 2BRKA 1N4LA 3T69A 3NF9A 4NL9C 3MUMP 4DMZA 4TUSA 4PEOA 1UA0A 3RZAA 4QU6A 4LFCJ 4X4VA 3ULEA 5AKJA 4FNHA 2OHDA 2XYGB 4OYAA 4RQ7A 3GZFA 3KOOA 1C1CA 1WSJA 5JTIA 3U9ZA 4DU4A 4CFCA 4CHNA 4QZGA 5LXRA 2B3TB 1E6VB 2M5YA 1SZ2A 1BI4B 1N0VC 2V2ZA 5EE9A 1RBVA 3AVHA 1RAFB 2MXYA 3VEYA 1PVPA 4I2QB 1UTAA 1HNIB 4NI2B 3UR0A 1SC3B 4X65F 3I87A 3JYTA 1S22A 1FVSA 2DR8A 3KZXA 3GWCA 3NGIA 4UQTA 3OVAA 2K4EA 4KLJA 5HRPA 4FYDA 2VCPA 3VETA 2FJXA 4KB0A 4UATA 4TY8B 4OHWA 4DCJB 3K9JA 2P9SB 1P90A 1ZD3A 3J8AA 3ZD8A 2W41A 4OZLA 2FVRA 4DV2K 2YH0A 1SVDA 3MPWA 1SPBP 2BBEA 2VPXB 5KFQA 2MUTA 2UU9J 2JWKA 1QZ5A 1YT3A 1Y4ZB 5CYMB 1EB0A 4ZN3A 3TAQA 2P6UA 2ZIWB 1XU4A 2HK3A 5AQQA 4C6AA 5F3TA 4RQ4A 9ATCB 1W97L 4AUKA 4HTUA 1T95A 2D8CA 1JLBA 3V5RA 1ZQTA 4RW4B 4ELVA 2K89A 4B3TF 1XMOF 2HIQA 5HROB 4WTYA 3HSJA 4DR3J 3O1LA 3KFWX 4FLTA 3Q22A 3AAPA 1PCAA 1RWNB 4O8KA 2XZWA 3MCMA 4Z4FA 4AXJA 3MI7X 4XRHA 1P8GA 3SENA 5J8YA 1ASVA 1JMSA 2FMPA 3DMJA 3PHTA 3T1YJ 1GOAA 4FXDA 2ZH2A 4A62A 3EDRB 1RA6A 1CEZA 4CHOA 2ZJRQ 2UUCK 3J81U 3NDKA 1R43A 4AD6A 4CGIA 2DNOA 2UXBJ 3PNCA 4XIUA 4ZP6A 3ETLA 4AQYF 4IG0A 1VK0A 3EZ5A 3UD4P 4TVAB 3UKRB 2NRZA 4ILGB 2ZJQL 4UB8U 2QKQA 4UB5A 3CJBA 2G8KA 3ORYA 3LALA 3PRVA 5DDQC 3NS6A 2KQ2A 3C28A 1A5XA 3H98A 4CZIA 2R9LA 1B3TA 1CQMA 3ITHA 2B9WA 2QLJB 3PJWA 2J8SA 3MEGB 1C0TA 4O3SA 1IKXA 2CUYA 4LFBJ 3WXLA 3SQGB 3OD2A 3KD5E 1VJWA 1I94F 4BWJA 1FA0A 3LP2A 3KKAA 2F9JA 1DKGD 4DPTA 1BPZA 4FZXC 3OV7A 2G5IB 4KHMA 4DTUA 1Z2ZA 3HHLA 4IO9L 3CJSA 1XSPA 2QL7B 9ICGA 2KT3A 3OFFA 1WDTA 4IDHA 2E7XA 4F71A 4EEKA 2XCAA 3NGKA 1FCAA 1TFRA 4PWDA 4E2FB 2J7WA 4HVJA 2I7NA 4CLSA 3H5UA 3TUPA 2CZ4A 2BCVA 4O55A 1RE1B 4ZLJA 1RG6A 2HCFA 2E9ZA 1EHWA 3M2VB 4BC4A 4CDIA 4AL7A 4X62F 2AJ4A 2NQPA 1IV8A 4DQ8A 1EKRA 2C2NA 4IO1A 4OZ2A 4IG3A 1HLWA 2QWOA 1RZTA 3SK3A 4Q44A 9ICLA 4TYAA 1EXQA 5BJRA 1BPDA 2FBXA 3V9SA 4OI2A 3M8RA 3D7EO 4NLTA 3EUB2 2FJBB 1RAJA 3Q24A 5EE1A 5MAOA 4NCBA 2ATCB 2XMWA 2MY8A 3R2CJ 3CCUS 2CPFA 1VDHA 5ETTA 4EZ9A 2DKOB 4C7ZA 2K8GA 1ED1A 4C0BA 2KSOB 1S49A 3ICLA 1KBUA 1R0AB 1BLUA 2V5HG 4YFKA 3A0IX 4URGA 3TVYA 4JI5J 4BR9A 3BF3A 4QWAA 2ITMA 2E6LA 4CJ7A 1GXTA 5A0YB 2EAMA 2ZUDA 1N5QA 2AX1A 1Q8IA 4WQ5A 1K8KA 3AA3A 1WG5A 4U8YA 1Y9OA 2RE2A 3O9UA 2AGOA 4ZITA 3VQCA 4OYZA 3W1YC 1RT6A