1NKBA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after three rounds of primer extension, following incorporation of dctp, dgtp, and dttp.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkbA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkbA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkbA01
3WNGA 3BGRA 4MFCA 1X9MA 3DMJA 3HX0A 5IIOA 8ICZA 5CHGA 4KLSA 2J6SA 7ICHA 4CHNA 2IA6A 5KFLA 4I2GA 3AO2A 1VSHA 4DEZA 4FVMA 1TK0A 4R66A 3G10A 3ZDCA 1C0UA 3UXNA 3MEGA 3VQ6A 4IRKA 3V7JA 2XRIA 7ICLA 8ICCA 5KGWA 2RDJA 3JPPA 4TQSA 4R5PA 8ICQA 4RUAA 4O3NA 2ATLA 4K4HA 3ZT3A 3TAGA 3BDPA 4RQ2A 1T05A 4Q8FA 3QINA 1CXQA 2YKMA 9ICCA 3Q8QB 1RDBA 3VQBA 2F1IA 1X9WA 2D5RA 8ICKA 3RJJA 4I2DA 4XQ8A 1RBSA 3BQ2A 1T8EA 2IBKA 5HRNA 4KHUA 1D9FA 2JEFA 4QZDA 4M9GA 1LB2B 4AHTA 3N97B 1WLJA 4F5RA 1SKWA 9ICTA 3FYHA 4DU4A 3HXMA 1GOAA 4IKFA 4J2AA 4DTUA 2JEIA 5CY4A 2VG7A 3NF7A 2ZUBA 4Z6CA 1RT5A 4EP5A 1L3SA 4RNNA 4QZAA 4RPZA 5IIKA 4NLGA 5KFXA 3KHRA 4C8NA 4KTZA 1JKHA 4NM1A 3NHGA 1BI4A 1BQNA 3OSPA 4MEYA 4GC6A 2XC9A 4F92B 2VA8A 2KQ2A 3F73A 4FJNA 1ZQVA 2VWJA 1ZQHA 3OYLA 2AGQA 4QZ8A 2BQUA 1UA0A 4I7FA 1LW0A 2B4JA 1RDCA 3RMCA 4CEOA 3RB0A 1D8YA 2PFNA 4W5TA 2GUIA 4FJJA 3ZSOA 3DI6A 1HYZA 4W5OA 3RRHA 4WE1A 4FK2A 2ZE2A 4AHCA 1TL1A 4DQSA 3F9KA 2BKEA 5KFMA 3SV3A 3LZIA 5DLFA 1BQMA 4FJGA 1TV6A 3GIJA 4R8UB 3ZD8A 4RW8A 2QKBA 2Q3SA 4NLNA 4F4XA 4I2HA 1MQ3A 4CFBA 4IG3A 3T5HA 1XSLA 1YTAA 3SPYA 3CM5A 3MEEA 3V1QA 4DQQA 1NKBA 5KFEA 3ULDA 4FM2A 5HLFA 3EPGA 4J9PA 4EBEA 4GXJA 3VA0A 3GV5B 4CCHA 1B92A 4FK0A 3ZSVA 4W5QA 4K8ZA 4JV1A 4DSKA 4M9NA 4GLXA 2KFZA 1TK5A 2BPGA 4KLFA 1EX4A 3FDSA 3L2WA 1MU2A 5FRMA 3QETA 2A1JA 4JWMA 5DQHA 4QW9A 3G6YA 4KRFA 3OYCA 2QKKA 5KT7A 4QZFA 4YXMA 4QWEA 5L1KA 2ASDA 1TVRA 3SQ2A 4E7KA 1TV9A 1LV5A 3HJFA 2BANA 2BE2A 4FCYA 2X78A 4QZEA 4CEFA 4LSNA 4EZ6A 8ICVA 4P4MA 3ETLA 1A5XA 4GC7A 4ED6A 1C7YA 3VQQA 9ICMA 3K2PA 4CFAA 1JXLA 3NBPA 4KLHA 4Z4FA 3OYAA 3CM6A 1IO2A 2MUTB 4KI6A 3M8PA 2NRWA 4YD2A 4CESA 9ICEA 4CJUA 4W5NA 3C23A 4FO6A 5HP4A 1SKSA 5DMRA 3QEBZ 5KRSA 1ZETA 3RJIA 3JYTA 3KLGA 2Z1IA 3QEPA 4CJFA 4CE9A 2A1JB 1HNVA 3DLRA 4H4OA 1RBUA 1HJPA 3V9XA 5CA7A 5J2KA 2X6NA 9ICLA 4CJRA 3PX0A 1IKXA 4BDZA 3I8DA 5JUMA 4TSXA 4IFYA 3SJJA 4RQ6A 2IAJA 4B08A 1XHZA 4JS5A 4Z4IA 3VQDA 4KLEA 1TKTA 2DY4A 5HRSA 3IM1A 4QWAA 3AVLA 3OYNA 5KT3A 3LP3A 4DU3A 2ALZA 4YMNA 2IHNA 3P5JA 2D0AA 3TFRA 4DTRA 3OYEA 2W8LA 4DTMA 4FZYA 3C2MA 3TABA 1S6PA 4J9LA 4XIUA 7ICGA 1U45A 1ZBFA 3K4GA 4UAYA 2Q0ZX 2G8UA 2ZD1A 3TI0A 3V6KA 3V6DA 4RQ5A 1SL0A 1NOYA 3PO4A 4PPXA 1U47A 1ZQIA 5CZ2A 2WTFA 3ORYA 1BISA 8ICHA 3AVBA 2B6AA 4CJLA 2Z1JA 5J0RA 3PVXA 5KRTA 4YVZA 2KTQA 1RT3A 1NK5A 3AVJA 1NK7A 4I2PA 2HNYA 3VA3A 3TAFA 1S0OA 4F3TA 4FXDA 4RW4A 1VSEA 4O3SA 5KFSA 3JPTA 3MGIA 1ZQZA 4JUZA 4B9NA 2P1JA 3V1RA 4CGIA 2G8FA 1CXUA 3PR4A 1SL2A 4M45A 3TAEA 3RTVA 4DOBA 4NLKA 3NGDA 1ZBUA 3RMDA 2BGGA 5EWFA 3V1OA 1Q9XA 3UXPA 4ZH4A 4PHPA 3IHQB 4FS2A 5KFFA 3NAEA 4E1NA 4KLOA 4KLJA 4Q0BA 3HWTA 3OYFA 2B21A 1C1BA 4CK3A 7ICKA 1ZQYA 3MR6A 4QAGA 5CZ1A 4J2EA 3BQ1A 2ZJ8A 5L1JA 2XGQA 1IKYA 3Q8RB 5J0UA 4JV0A 3T1AA 1Z26A 1S1VA 2LYHA 5C24A 3KLEA 3RJEA 2J6TA 1EETA 1EP4A 1UT8A 4J9RA 4KTWA 1WAFA 3U3YA 3TR8A 3GILA 2GWSA 3LPUA 3KK2A 4FLVA 2OZSA 1ZJNA 5KFQA 4RT3A 9ICJA 5SZTA 1ZQQA 4HYKA 1IKWA 2P6RA 1ZBIA 3H4DA 1RILA 1NK6A 1ZQXA 4ECYA 1S76D 4Q43A 4KV8A 1ZQWA 4IFVA 1WCNA 2PFQA 4CEQA 4CERA 5I42A 1JLCA 5CYQA 3HP6A 4B9MA 3EPIA 3B6PA 4Z4HA 3NH0A 3QESA 1HQEA 2DFFA 4CFCA 2ZTCA 3RJKA 2JGUA 3ZSZA 3DRSA 3LP1A 3VQ4A 4NM2A 4UAZA 2XY8A 4FW1A 4FLUA 3FFIA 5KFHA 4YNQA 7ICUA 2BGWA 2G8VA 3D0PA 4FS1A 4KB1A 4ECQA 9ICHA 1XWLA 4O0IA 3TFSA 3CFPA 4IRDA 2HW3A 4RW6A 3GV8B 4BXOA 4LVSA 4KHSA 1JLEA 9ICXA 4ICLA 4OPKA 3DOKA 1Y97A 2XY5A 7ICVA 3EWAA 5C5JA 1S1TA 3M9NB 4EBDA 2PI5A 9ICBA 4KFBA 3HP9A 3HYFA 3T19A 1ZQOA 1IXRA 1X2IA 1RBRA 4I2CA 4QWDA 3WNFA 3OS2A 4ECXA 2PYLA 4I2AA 3GV7B 1WN7A 3MDAA 4ZHRA 5T7BA 4E7HA 4F93B 5IIJA 4CIFA 2HNZA 2VG6A 3ZD9A 3TANA 2YNIA 5KFOA 4Z6EA 4OVLA 4PHEA 2J6UA 2E6LA 2NUBA 4DSIA 4NCAA 1RTIA 4DTPA 4CEDA 1U04A 4KN4A 4CGDA 5DDMA 1QSYA 1LAVA 4KLIA 3V6HA 3ALYA 1S1WA 5IINA 8ICRA 4PHDA 3TAQA 3DOLA 1BVSA 7ICQA 1A76A 2FBVA 4JV2A 3ASMA 4F4ZA 1NKCA 1W0HA 4RW9A 3LWLA 3HL8A 3L2QA 5KGXA 4EBCA 4PWDA 3RJHA 3UPQA 3Q8KA 5KG4A 4B9VA 1CEZA 3UIQA 1ZBLA 1TAQA 4QZHA 3T5KA 5JS1A 1T4GA 4LH4A 2XY6A 1C1AA 1RT6A 1D8LA 5DB7A 1TGOA 1BHLA 2ASJA 4PH5A 4CJEA 3VQ8A 2DPIA 2FBXA 3AA2A 4DTSA 1BGXT 3KKSA 1T3NA 4IDKA 4K4GA 3OYMA 2B5JA 3L3VA 3MEDA 4H4MA 4JRQA 4M04A 5DK5A 3ZT4A 3CYMA 4M9HA 4O5CA 5BOLA 4CHQA 4O3RA 4I9LA 1N6QA 3G6XA 3NGYA 3LZJA 4KI4A 1ZQFA 2RF2A 1X9SA 9ICKA 2WONA 1LWEA 3KD1E 1REVA 3PY8A 2BDPA 5J2MA 2FMQA 2I1QA 5KFVA 4BWMA 3Q8LA 1NOZA 4F3OA 5L9XA 4YCXA 2R8HA 3SQ4A 1XSNA 1RBTA 2OWOA 4BGDA 1ZQAA 2ZJAA 3MFHA 3C1YA 5KFPA 3VN5A 4CHOA 2R8JA 2DFEA 1C6VA 1ASWA 1J5OA 5KFGA 4OJRA 2NRXA 5BPCA 4DOAA 1K1QA 4EEYA 4DL6A 4UBCA 1S77D 1QQCA 1Q9YA 1A5VA 4DQRA 3JPNA 3KK3A 4HTUA 5J0QA 5HBMA 3SUOA 1ZQNA 1W9HA 2FLLA 1JN3A 2AGOA 4K8XA 3K59A 3KLIA 4FLZA 3SUQA 4QZBA 3HPOA 3E2EA 4ED2A 4NYFA 3ISBA 3SUPA 2X6SA 4G1QA 5KG0A 1ZQJA 5DG7A 1NJYA 1VRTA 1YT3A 5F9NA 4QZGA 4IQTA 3HT3A 5L1LA 3V9SA 3DLHA 1SUQA 3ZCMA 5F9LA 4E1MA 1N48A 1JMSA 5DKWA 1S9EA 4PUOA 3OYDA 4TQRA 3HVTA 2ZJ5A 3I0SA 3HSTB 4OGCA 1XI1A 3OHAA 4CF0A 4O3PA 9ICVA 4MEXA 1NJWA 5KFJA 2V9WA 4QZIA 2ZQBA 3PW5A 5HMMA 2AJQA 5IIIA 5DG8A 3HO1A 4KLGA 4CEEA 4BXOB 3GFKB 2OPPA 2RPIA 5JS2A 3S3OA 2YKNA 5DBAA 4F4WA 3PR5B 4CJWA 4LZDA 5J0OA 4NLZA 3NE6A 1ZQLA 3UQ0A 3PW7A 3AO5A 2XO7A 3KD5E 3TARA 4KPYA 1O1WA 5KI6A 1JLBA 3T5LA 5D49A 1JLQA 3LPTA 4DG1A 1C0MA 4KREA 4HUEA 3VQAA 1BIUA 2YHBA 1S9GA 4O5BA 2D0CA 3VQ9A 1LWFA 1RTHA 4O3QA 4E7JA 2FLPA 3OJSA 4YMOA 4M6WA 9ICGA 1Z00B 3KHLA 1GOCA 5DDYA 1C1CA 3AVFA 4YR2A 4G3IA 5J2HA 3V9UA 1ZQUA 3H7IA 4UB1A 4N5SA 4J9KA 3KLFA 7ICJA 9ICPA 4OPJA 5HROA 3L2VA 4O0JA 4O5EA 4M3XA 3IG1A 1RDAA 3V9ZA 2P6UA 2UVWA 1J53A 1LAWA 8ICMA 2IMWP 3ZT2A 2W42A 4FK4A 4CIEA 1SZPA 2Y1IA 3H4BA 1D5AA 2HMIA 3SNNA 2HHXA 4BDYA 5KG5A 2R7YA 4ZTFA 4CF2A 2RN2A 1BPDA 3QEIA 3GIKA 4B8AB 1J54A 4ID1A 3V72A 3HM9A 4QWBA 1XO1A 1VSMA 2XCAA 4M3RA 9ICOA 1S5JA 5C25A 3MAQA 4PGYA 4YG2A 4QZ9A 2HHVA 4PQUA 2YV0X 3IRXA 4NYNA 1VSDA 3PV8A 1S0VA 2FBTA 2OA8A 3O4QA 5DQIA 5HNKA 4EYIB 5DGBA 5HRRA 3THVA 4DFPA 2PY5A 4DLEA 4MQ3A 1WSEA 4CJ3A 1XSPA 2HHQA 3KTQA 3AV9A 2ZTDA 4B8CA 3B6OA 2DFLA 3AVIA 4FLXA 5DB9A 4F4YA 1MSWD 3TAMA 7ICPA 4NXZA 3MXIA 2DTUA 2I5JA 1JLFA 4LSLA 2NRVA 5FROA 1WSGA 1UAXA 2GBZA 2JZBB 4KAZA 1D9DA 8ICGA 3EZ5A 4CJ5A 3RB3A 1S9FA 4X5VA 1ZJMA 1A5WA 1S1UA 3QLHA 1SKRA 5EOZA 2QXFA 4GXKA 4I27A 3OGUA 1NK8A 4JS4A 4AHUA 3VQEA 4CK1A 3RR7A 1S10A 2W9BB 4B3OA 2RDIA 3SZ2A 2FMSA 2BPFA 5EU7A 1ZQEA 4AHVA 1AROP 2W9BA 4FLYA 4F8RA 4AHRA 1ZQRA 3S3MA 4FYDA 8ICTA 2H5XA 2AQ0A 2VWKA 2BHNA 1L5UA 4IQVA 4FJMA 2FBYA 5D3GA 4RPYA 1JLGA 4KLTA 3RRGA 1JL2A 2XHBA 1CZBA 2V4QA 3SQ0A 5KFWA 4UQGA 4N56A 3OYJA 2W8KA 3UQ2A 4PHAA 4N47A 3U6FA 1ZQDA 1RTJA 1S0MA 4EZ9A 2D0BA 3BQ0A 3GIMA 3QEAZ 2YNFA 4RPXA 3QEVA 2W9CA 1HJRA 7ICOA 3SI6A 5KTQA 4ID5A 4BE2A 1JX4A 4DTNA 4JRPA 2VANA 5FRNA 3LDSA 1BPBA 1WSJA 1T03A 4UB3A 3LAMA 5HHHA 1KFDA 3JPQA 3V9WA 9ICIA 9ICUA 4KLLA 1LW2A 4EYHB 4YMMA 3MR3A 5J0YA 3D45A 4IRCA 1K6YA 4CJQA 4KN7A 5J29A 3H8WA 4P4PA 2R8IA 3DLKA 3MXJA 4CHPA 4AHSA 4Q5VA 3M8SA 3VQ7A 2W9CB 4RQ0A 1JL1A 4BE0A 3CFRA 3AUOA 3MR5A 4BWJA 1KTQA 4KHQA 4IQWA 1QTMA 2FC0A 4LZGA 2C2DA 1UT5A 3MDCA 1HQUA 8ICUA 4RG8A 3K5OA 4CEZA 5KFRA 2KZZA 5KFBA 4N41A 3ZDDA 1B22A 1WSIA 1BCMA 2EHGA 2LSNA 4E7IA 4O3OA 1BIZA 8ICWA 1VSLA 3AA5X 3OY9A 1ZQTA 5I3UA 5J2EA 3E01A 2W9AA 5J0WA 1HRHA 2JEJA 5J2BA 4I2QA 1VSKA 2HHWA 3AVKA 3C94A 2IHMA 3O3HA 4KHWA 2PXIA 4DQPA 3CFOA 1ZQPA 4DLGA 3QIPA 3AO1A 4Z4CA 1FK9A 3DLEA 3SYZA 2ASLA 4M6WB 3V81A 1EXNA 1NK4A 4QCLA 4DMNA 2VA3A 4DSFA 2OPQA 1ZQSA 4DTOA 2G8KA 1RXWA 1F21A 4YFKA 3WNEA 3MECA 3NGIA 4AILC 4YN4A 3KKRA 4H8KA 5KFNA 2W9MA 1RT7A 4DSEA 4DL7A 4XUSA 4DO9A 3QNNA 4CJKA 1BCOA 3DLBA 3ZSXA 1RXVA 4C8KA 2HHSA 3AU2A 3PW0A 2G8HA 5J0SA 5CJ7A 4R64A 1FKOA 1NOMA 4UB2A 2AGPA 4RNOA 1B9FA 3ZDAA 3M9MB 2ZUDA 2XCPA 1KEJA 9ICFA 1Z3EB 4RQ8A 4DFKA 3AO4A 5J0PA 1HPZA 1BPXA 4F50A 1XS9D 4PY5A 7ICTA 1VRUA 4OKJA 2KW4A 3K5MA 4KMUA 4UBBA 4PGQA 2PI4A 4FJKA 4F2RA 3DM2A 1NKEA 1RBVA 5HP1A 1IH7A 4KLMA 2JZBA 4I28A 1DTTA 4RW7A 4GVMA 1KDHA 4GW6A 2VG5A 2BCUA 2BQRA 1DTQA 4HVJA 4CECA 2UVUA 4NCBA 3QEWA 1NK9A 3V4IA 2ATQA 5CWRA 4NCGA 4J2BA 1H38A 4ECTA 2XY7A 4PA1A 4HCCA 2BQ3A 4J9MA 3AA3A 3H40A 4DF8A 4DU1A 3M8RA 1KVAA 1WSFA 2X74A 2UVRA 4ED1A 5J0TA 7ICEA 4M42A 4DOCA 2ZTEA 5FDLA 4J9QA 4O55A 3L8BA 2FPLA 3ZSYA 1WAJA 4FJLA 2KN7A 3V7KA 5KT2A 5J2GA 2BCVA 4LY7A 3HW8A 3NGZA 3C2LA 1KCFA 3LP2A 3HK2A 2EX3A 3L2RA 2I9GA 3RMAA 4XA5A 4UAWA 3IAYA 4ED3A 2F1JA 3C6TA 3QE9Y 3LK9A 4J9OA 2PYJA 4RZRA 2F8TA 4DS5A 3PMNA 5J1EA 2MAXA 5DG9A 4E7LA 1HYVA 2YHAA 3DRPA 5KG1A 2KZ3A 4RUCA 4Y1DA 3LAKA 2C28A 3PO5A 5DB6A 2BPCA 5J2IA 1CUKA 4B9UA 1X1PA 1PZNA 2ISPA 3OYBA 3HVRA 4KLQA 2BCQA 1CLQA 4FLTA 5J2JA 1IM4A 4M0AA 1KLMA 2XGPA 3JSMA 1BPZA 4M9JA 4FBTA 4O5KA 3RBEA 1TKZA 2HNDA 3MABA 2RKIA 1A77A 3O4NA 3GDXA 4M3YA 2PZSA 1U49A 2NRZA 4NY8A 4OKEA 4M2YA 5DGAA 1NJXA 4KHNA 3AVNA 3OYHA 1QS4A 3K5LA 4IG0A 5KG7A 3LDAA 1RT4A 3EW9A 3V7LA 2E4LA 4KKOA 3T3FA 5DBCA 3SQ1A 1JLAA 3NF8A 3TAPA 4FBUA 1Y88A 3NFAA 1BI4B 2IDOA 2ISOA 4I2FA 3RBDA 5KT6A 4CHZA 2BCRA 2DPJA 3NCIA 1ZYQA 1I39A 2HVHA 2MUTA 4W5RA 4Z0UA 1COOA 1KFTA 1ASUA 1QHTA 4R8UA 5KFDA 4M3TA 2OYQA 4ZTJA 4TUSA 4M3WA 1UWBA 3N4MB 4FZXC 1BL3A 4CF8A 4MFAA 3S3NA 8ICJA 2YNGA 5KFUA 4QOZB 4OGEA 4KO0A 1U4BA 4FJ8A 3SV4A 2PFOA 4CJTA 2R8KA 3PW4A 5J2QA 2ITGA 3VQ5A 4ED7A 1BPYA 2C2RA 4RNMA 2P51A 4IR1A 3SCXA 4KTQA 1ZBHA 5CB1A 3IS9A 2A1SA 1V9PA 2M9NA 4RU9A 3K75D 1B9DA 1Z00A 3AVAA 4HHTA 2Y1JA 2IOCA 9ICAA 2QK9A 4DL2A 4I2EA 5KG6A 1DLOA 4ECSA 3AA4A 4ECRA 1B43A 2IS3A 1NJZA 1RT2A 1C0TA 1U48A 3AVCA 4DL5A 3Q8PB 1YVUA 1KFSA 3ITHA 4BACA 4FM1A 8ICPA 1RCHA 4DS4A 3OYGA 4YR3A 3M9OB 1EKEA 3SUNA 4YD1A 4Z4GA 1G15A 4KB0A 5EWGA 4QW8A 1U9LA 2GV9A 3MFIA 4BE1A 5DLGA 4CF1A 3LP0A 4JWNA 4FLWA 4M41A 4IQUA 3EYZA 4MF2A 3RH5A 3ZT1A 5D4BA 4CK2A 5EWEA 3PUFA 4QWCA 4DSJA 3U3GA 1VSJA 3JPRA 5KG2A 3RB4A 5J0XA 3PNCA 3PW2A 1N56A 8ICEA 2FPKA 4GMJB 3ZSQA 5SWMA 1WCLA 4HUFA 1WSHA 7ICNA 5CR0A 3K5NA 1L3VA 1Z25A 3RAXA 1ZQCA 1I3AA 3AVGA 4Z6DA 4CIGA 3B0YA 4P2HA 1XHXA 4EP4A 4CGJA 3PX6A 3C5GA 1CZ9A 2F8SA 4F4KA 3MGHA 2JLEA 3V6JA 3HPGA 8ICSA 4JLHA 1RT1A 8ICNA 4F5NA 5CYMA 2ETJA 3C1ZA 4GXIA 9ICSA 4Z6FA 3CG7A 1QSLA 4MFFA 1ZQKA 4FJXA 8ICLA 1JXEA 1RZTA 1S1XA 3OSNA 3AU6A 3EY1A 3NH2A 3NDKA 4FJHA 3NF6A 4C8LA 4J9NA 4CJPA 4OKKA 4RQ3A 4LD0A 1ITGA 2F96A 1J9AA 4ED0A 3GQCA 3L2UA 2NRTA 3H8JA 3QERA 2P66A 4YQWA 3K57A 3ZSRA 3QZ8A 1HNIA 3OYIA 1S0NA 4XRHA 1GOBA 4YFUA 4ED8A 1Q8IA 3S9HA 4C8OA 1RDDA 1UA1A 4CFDA 2OZMA 3ZT0A 4DL4A 5K14A 1QLNA 1KVBA 1ZQBA 3O3GA 2KFNA 1IG9A 3RJGA 1N5YA 2YNHA 4KITB 2WOMA 4E0DA 3OJUA 4IBNA 4E19A 5BOMA 3AVHA 5KT5A 1VK0A 1ZQGA 4FZZA 1TKXA 5J2PA 4I9QA 4L8RB 1TAUA 3P83D 2F1HA 1T7PA 5DQGA 4R65A 4TURA 3DYAA 7ICIA 8ICOA 3QIOA 4CJVA 4M9LA 1RTDA 4MFBA 5CP2A 1R0AA 3MXMA 3ISDA 1S6QA 1MC8A 4ECVA 4DL3A 3Q8SB 4B9LA 4YR0A 4I2JA 1DOQA 3G0ZA 5KFTA 4K4IA 3A2FA 4JK1A 1HMVA 4CGFA 4F5QA 2O4IA 2FPMA 5J2AA 5IILA 2R8GA 3L3UA 2V4RA 1WNSA 2BR0A 2AU0A 4RT2A 2C22A 4I2IA 4J2DA 1KLNA 4CJ4A 3RMBA 4B9TA 4LH5A 3O3FA 3UXOA 3CQ8A 3SPZA 3NF9A 3RAQA 1FKPA 2KZMA 2ZUCA 7ICMA 3OYKA 3ISNC 4I29A 2Z1GA 2OPRA 1TL3A 3ZSWA 3MBYA 1QE1A 3H8SA 1ASVA 4M3ZA 4E89A 1K1SA 4FJ7A 3G6VA 4M47A 1RYRA 4OLAA 7ICRA 9ICQA 2HHTA 1TVAA 3AVMA 4BDPA 4CGGA 4KHYA 2HVIA 3C5FA 8ICFA 2IC3A 5KFAA 8ICIA 3JPOA 4FW2A 3TWHA 4ECUA 1RYSA 4FJ5A 1SL1A 7ICSA 4DFMA 4ECZA 4UB4A 2UVVA 4B9SA 8ICAA 3KK1A 3KJVA 3RB6A 3OS1A 3K58A 4O9MA 1NK0A 3C95A 2P5OA 4P4OA 3B0XA 1KRPA 3C21A 3ZDBA 4QZCA 4ECWA 9ICNA 5DBBA 2DFHA 5L1IA 2FLNA 1S97A 2G8WA 3RH4A 1YTUA 5D46A 3OHBA 4F2SA 4DTXA 4O44A 4KLDA 4M3UA 1FXXA 1RNHA 1VSFA 3PMLA 4Y1CA 3C2KA 1TFRA 1MQ2A 3KHHA 4Q8EA 4HUGA 3T5JA 3DRRA 3LALA 4F5PA 2BCSA 4TUQA 2IGIA 5C42A 2Z1HA 4IR9A 5KT4A 4PGXA 5KG3A 1ZQMA 4UB5A 1VSIA 3LWMA 3C6UA 4OLBA 3SI8A 3ZDEA 5KFCA 1RPLA 3BJYA 1KSPA 7ICFA 2A1RA 1KVCA 4C8MA 4R63A 2C2EA 3RR8A 3LANA 9ICWA 4CF9A 4DSLA 5J2NA 4DWIA 4DF4A 1HUZA 2PFPA 3OVNA 8ICXA 3VQPA 2VA2A 4I2BA 3Q8MA 3MR2A 3QEXA 4Q45A 5E41A 4O4GA 3QZ7A 5TZVA 5KFZA 4N76A 3QNOA 4F91B 4FM0A 3DLGA 3QO9A 3I0RA 4ELUA 2G8IA 4MF8A 3HPHA 3RWUA 4FJIA 2FMPA 1QSSA 4DQIA 3NTUA 3P1GA 8ICBA 4RQ7A 5HHIA 1XU4A 3GIIA 3TQ1A 1IKVA 4J9SA 4KLUA 2AQ4A 5J2DA 4RQ1A 3WNHA 1XC9A 4RQ4A 3KIOA 4CEBA 4ELVA 2P5GA 5HMLA 2O4GA 1JXBA 1UOCA 4YXJA 3NH1A 3JPSA 3OS0A 5KFIA 3BQTA 4Q44A 3RH6A 1TKDA 4AH9A 3KLHA 2OPSA 1BPEA 2JEGA 4CEAA 1EXQA 1SV5A 1JIHA 4Z4EA 4HCBA 5J2FA 1L3UA 4DTJA 1TK8A 8ICYA 2HHUA 1HYSA 4YP3A 2HB5A 4ELTA 3PX4A 4CJSA 5IIMA 3KHGA 3ISCA 4E3SA 4F5OA 4TUPA 4CGHA 4DFJA 3RJFA 1LWCA 2E6MA 5KFYA 4CHYA 4FJ9A 1L3TA 3M8QA 5KFKA 3AO3A 1DGSA 3VQCA 5DB8A 5HRPA 5J2CA 3H08A 1HUOA 9ICRA
chains in the Genus database with same CATH superfamily
1U1RA 4AE5A 1WG8A 8ICZA 4LFCK 3SCJE 4BC2A 1BG3A 4U9RA 1WBBA 4OI6A 1VSHA 4A8EA 1V4SA 2FUG9 4FNHA 3DLJA 2ZNYA 4C7QA 2WW8A 3AJ1A 1XNRF 4R66A 5ETRA 1RP5A 4RL1A 5C10A 4Y34A 2GH1A 1C0UA 3UXNA 3MEGA 4PABA 2EQYA 4G9ZA 4ZOHC 2WFBA 4LBIA 2Q97A 4X65F 4RW7B 2BANB 1HEKA 1V97A 4R5PA 5D4PA 4NX9A 4WU2A 1ZD5A 2A42A 2Q6CA 1NHUA 1OIAA 2C2NA 5AZJA 1T05A 4WFYA 2V63A 2GUPA 2QLTA 4I69A 8ICKA 3RJJA 2ZDPA 4L74A 4I2DA 4XQ8A 2FXUA 3M6GA 2GAGC 2H48B 1A7GE 2N82B 5HRNA 1HI8A 4ZJQA 1LB2B 3N97B 1WLJA 3WXLA 3FYHA 1M90O 3MPDA 2JEIA 2X51A 2XG8A 1P7DA 2ZUBA 1GLEG 1S1VB 1RT5A 2QB0B 4DZDA 3KHRA 1LWFB 3QAEA 4DV7J 4CDGA 4OZ3A 2YKMB 3ZX0A 3BR9A 4ZJOA 4C98A 4GVBB 3C7NB 1LVHA 1SC6A 4DX8H 2HIQA 3OYLA 2W01A 4GKKF 2AGQA 2DNYA 1WUUA 4YN3B 3H59A 5EN1A 5FD1A 1UA0A 3QT7A 4A61A 3I87A 4NLVA 4ILLA 3DXSX 1TKZB 4W5OA 4WE1A 1NJIO 1TL1A 5KFMA 3AJDA 2K4PA 2WHOA 1NMNA 2WSEC 1SWVA 3TPQA 1ZBTA 1TV6A 2PMWA 3ZD8A 1HWLA 3EGNA 4IYQA 2Q3SA 4NLNA 2UP1A 2VUGA 4K4XA 3QBCA 4US8A 5HMZA 3PXGa 4LF8F 2EWSA 4IG0B 4X4UA 2VFUA 4URQU 1T9XA 4JI0F 3UKRA 3SCLE 4DQQA 1HUXA 3HCXA 2CQCA 2XSFA 4JNEA 3MD3A 3ULDA 4FM2A 1S1UB 3SDEB 3WK8A 4BR2A 2DIVA 3VA0A 2MZRA 2HMPA 1N5TA 1A0PA 2BOPA 2WC9A 4FK0A 3NS6A 3PHEA 2E9RX 4BC4A 2EWHA 4JV1A 1HIWA 2I6WA 3SQGB 3P38A 4M9NA 4GLXA 1TK5A 4Y2UA 2DWQA 3ZI4A 1EX4A 1UVKA 3CULA 2G9OA 5B0BA 4M7YA 1JLCB 5ITHA 1OKJA 2QKKA 4QZFA 4QWEA 4YXMA 4URSA 2QI2A 1VHIA 3ELHA 4K4UA 2DH7A 2K3IA 2RQKA 3FK4A 2M3DA 3CMQA 1R27B 4B6JA 2VPZB 1A5XA 3T1YK 4GC7A 3VQQA 2DGVA 1Z6RA 2HS3A 2ZXHA 4LF2A 3QMLA 4ILRA 1HD1A 1X3NA 4YHHJ 1IKWB 4O0NA 3OL8A 3C23A 2OI2A 2BVZA 2RE2A 5FLXU 1KKHA 4LF7K 3QEBZ 1RACB 3P31A 4H0XB 3DDHA 3F41A 3AB2B 4KO0B 4IEEA 3WC0A 3DLRA 3M3ZA 1RHJB 2BW7A 4DCHA 3V9XA 3CJKA 2X6NA 2NO4A 1V38A 4PXDA 1KVJA 5DETA 3CD7A 3I8DA 4FF3A 3R1XA 4H4MB 2B9YA 1VBZA 2E2QA 3UD5A 1TKTA 2DY4A 3LYSA 2CXEA 4X2BA 3AVLA 3OYNA 1JUDA 1RHKB 3LP3A 5AQTA 1S57A 2EI5A 5D0GA 4IC9A 4OYWA 4DU3A 3QT8A 4YMNA 4OO1J 3EE3A 2D3O1 2IHNA 1ICEB 4DTRA 1FVQA 1O08A 2JFDA 2AYGA 4DTMA 4FZYA 4E1JA 1N4LA 1NPPA 5IT0A 5D3GB 1T9YA 4XIUA 7ICGA 1JLQB 2G1HA 2QLJB 3VAIA 4ZVHA 4RQ5A 1SL0A 4X4OA 2ILYA 3E8OA 1NMEB 8ICHA 4G1PA 2B6AA 4JI4F 4CJLA 2Z1JA 5J0RA 3PVXA 3VC8A 3UVJB 1Y10A 1NK5A 3AVJA 3RUBL 5DS7A 5B08A 2R42A 3TAFA 4RW4A 3UDCA 1VSEA 2DRDA 3BSNA 4IKAA 3GFXA 3JPTA 4IOAQ 5AM2A 3MGIA 1Y0HA 3IRXB 1PILA 2OHFA 2XMWA 4JMUA 4PG6A 4B9NA 1RT5B 1LW0B 2P1JA 4CGIA 5J8YA 2FY1A 1CXUA 1PSDA 2G8FA 1SL2A 2LQBA 3TAEA 2HBJA 4DOBA 4NLKA 1ECWA 4FF2A 3RMDA 3OTOK 1TELA 2NNWA 4DR4J 3UXPA 4PHPA 3IHQB 5KFFA 4P7TA 4E1NA 4KLOA 2Z2YB 2KT5A 1O6XA 3G8QA 4CK3A 7ICKA 3MR6A 4QAGA 2ZJ8A 1DJ0A 2KT3A 1XUPO 3ATUA 4JI5F 4EMDA 3T1AA 2AEFA 4BREA 3RJEA 2CQ4A 3MWBA 2Y0SD 3CC4N 2NYVA 4B3SK 4LF8K 1VQ8S 2B7CB 2BJDA 2JGAA 1ZJNA 2EFOA 2HWHA 4IQMA 5EXWA 1O5JA 2BUNA 4HYKA 3HOTA 4DX7A 2KYZA 3L0QA 1VRQC 1ZBIA 3NL0A 4KV8A 3OTQA 1U1QA 1ZQWA 4C4WA 4GV3A 4CI0B 4IFVA 2HSZA 3U7JA 4OCZA 1E6VA 2W55A 5I42A 1SQKA 2WTUA 4J9VA 2DFFA 4CFCA 3RJKA 5LSLA 3BUZB 3DRSA 2DCLA 4NM2A 3FCVA 2XLKA 2XY8A 4FW1A 4FLUA 1KQKA 3CPWR 2RHSB 2GV1A 3D2WA 4YNQA 3I31A 2EFVA 1S72S 2G8VA 3BGOP 3D0PA 4FS1A 4OI1A 3CIPA 4ECQA 3WZ0A 4O0IA 3HBTA 3CFPA 2I7PA 4KHSA 2HRUA 5F8JA 1RQLA 1FE0A 4ICLA 3R5BA 5M1QA 4EBDA 9ICBA 2LXIA 5J2PB 5HK4A 4KRWA 2HS0A 5BXIA 1ZQOA 2P9NA 3MM7B 3R2CJ 5J8YC 1WOOA 4FWKA 3OS2A 4ECXA 2EC0A 4C1NI 3QGHA 1JLBB 1GH8A 5K14B 4LJXA 1GMWD 4BRPA 2ZGZA 2QL9B 4ZHRA 4USTA 1FFGB 4FOEA 5AE1A 4IEIA 4K41A 3ZD9A 1RT4B 5AK3A 5TISU 3TANA 3VCDA 1S99A 2YNIA 5KFOA 2WVCA 4OVLA 4JI3K 3MAAB 4G1IA 4KHPK 2VJVA 3HFKA 4PEOA 1X60A 2LEPA 2YPZA 1QUVA 3UN2A 1KXPA 1RTIA 4DTPA 4RBVA 2JRSA 3GFHA 1P8GA 4KN4A 2YN4A 4CGDA 4YOUA 1UZHA 3R6GB 4ATNA 3AN1A 3ALYA 3FZ2A 2OAUA 2O8CB 3DOLA 3VGSA 2DD8S 2MRLA 3JQJA 4QPTA 4JV2A 5IV3A 2AT1B 1LKYB 4RW9A 3N4QA 5GADU 3L2QA 5IC6B 5GADP 3UPQA 1KS2A 4MT1A 4Q2MA 3EKUA 4B9VA 1JJ4A 3UIQA 4YOYA 2LM1A 4M95A 5G5GA 1JJCB 4ZVPB 4LQ9A 1AZSB 3I5CA 1MMNA 3MMVA 1GLBG 2HCFA 4B3RK 1BHLA 4M5HA 4MDAA 4H0PA 4X64F 3VQ8A 4NOHA 3AA2A 4K4GA 3CUNA 3DFEA 5HO4A 2XZTB 5HMWA 5DK5A 3ZT4A 4CHQA 4ETXA 1ZOTA 3G6XA 1HA1A 2VQEJ 1X9SA 3J8AA 2GJIA 4CO3A 2WHEA 3DLKB 1REVA 3MN9A 3PY8A 2XHWA 4O44B 5J2MA 2QA4G 3V5RA 5KFVA 2NRHA 2P5VA 1C0FA 3Q8LA 4NZ0A 3DRXA 1IBKK 4L3KA 2OWOA 3BSCA 4BGDA 1E6VB 1NDPA 4CM2A 4CLPA 2QO3A 3VN5A 2R8JA 2DFEA 1WC3A 2AEMA 4ZS6A 1FEEA 3THYB 4A8FA 2KV2A 2KHOA 1OY8A 3SAGA 2KIVA 1ZQNA 2E1RA 2VU5A 2QC3A 2AGOA 4K8XA 3K59A 3HM8A 4CZMA 3CEDA 1CULA 1R8AA 3KLIA 5LT5A 4FLZA 5A6WA 3CDEA 1NB7A 2W54A 1AW0A 3LTOA 1VRUB 4KHRA 2M0GB 2XYPB 3OTEA 2D3UA 5AKLA 3WU2U 2X6SA 3Q2TC 2MZSA 5L1LA 3GYGA 2PFDA 1SUQA 3F2DA 5F8IA 3C14B 4PUOA 4TQRA 3F56A 3ZC4A 3HVTA 3HSTB 3M8WA 1XI1A 3J80O 2A3VA 4O3PA 2R7SA 5IXUA 1NJWA 5KFJA 4CZJA 3PZPA 4E8UA 2PAVA 2PT0A 2GIQA 3PW5A 1WTFA 2MQ8A 3SSRA 3U9ZA 3PRBA 4KLGA 4CEEA 2RPIA 3GFKB 4PL1A 3G87A 3IRUA 2GA7A 5DBAA 3PR5B 1QZ5A 1PC4A 3KKAA 2YHXA 4RW4B 5J0OA 5D0RA 3NE6A 2OTJN 2VODA 1ZQLA 2IM1A 5ALPA 4TY8A 1RQNA 1FVSA 3L7PA 5H1SV 4CW7B 1J27A 3HDSA 4OJ1A 1S5ZA 3LPTA 2MA1A 2CADA 3PDNA 4Z7CA 5DDOC 1BIUA 5E26A 5E5NA 4M5GA 3VQ9A 3FQKA 1RM6C 2E7WA 5AI8A 5I9EB 4M6WA 2AMCB 9ICGA 3R7BB 4NLRA 5DDYA 1C1CA 3ET6A 3QPIA 3AVFA 4G3IA 1QHAA 5I3UB 2HBYB 2E5JA 4CRJA 3FM9A 2CNOB 3U27A 3CNHA 2W3SA 7ICJA 4JKFA 4OPJA 1T05B 5F41A 5HROA 4O0JA 1T9UA 2WCXA 1OO0B 2Z0GA 1TQLA 2PKEA 3ZT2A 1IJFB 5K9FA 4FK4A 5D4OA 3M8YA 4CIEA 3H4BA 1D5AA 2HHXA 5KG5A 4OZLA 1MU2B 3QEIA 3GIKA 3VAJA 4RQNA 1OPZA 2DGWA 3V72A 5M1PA 4WYWA 1ELOA 3ZZYA 2XCAA 2UV8G 2XM3A 2D6FC 3U9DA 9ICOA 4CZFA 4PGYA 4YG2A 1YAGA 4PQUA 4TVAB 4ALZA 2X1FA 3DM2B 3UQSA 2HVZA 2N7YA 2FBTA 2X3GA 3OXGA 3WQUA 5DGBA 5HRRA 4DFPA 2PY5A 1XQSC 4UOHA 4MQ3A 1I94K 1WSEA 3LW5C 2ZUGA 1XSPA 4CJ3A 3KUHA 3JYTB 4MYUA 1AZSA 4NA1A 5HQLA 4FLXA 1MSWD 4KHPJ 3I6PA 3K5PA 3MXIA 3FZMA 2I5JA 4JB8B 4FF1A 1SUQB 4J7CA 2NRVA 4AL6A 1CJVA 2XICA 1UAXA 2NQPA 3EZ5A 2LXFA 2PFUA 1VGYA 1KEKA 4CJ5A 5F3TA 1MA7A 1NAQA 1S9FA 3QLHA 4DX6A 2KG5A 2QXFA 2KK0A 5L8RC 2R7QA 2W9BB 4B3OA 2RDIA 3IG5A 1ZQEA 2WMMA 4AHVA 1AROP 4OHYA 1RABB 4AHRA 1GAOA 1Y00A 8ICTA 2H5XA 2G07A 1L5UA 4L3NA 1S4FA 4FWSA 3D2FB 4FJMA 3MN7A 5AM4A 5D3GA 1HHQA 1WG4A 1CJTB 3CJ1A 2QTWA 4WFBQ 3Q8YA 4LREA 1CZBA 2V4QA 2L08A 3TSQA 1OMSA 2RD5C 4Z94A 3HD1A 2R7UA 3BH7B 4N47A 3UI3A 3THTA 2KM8B 1S0MA 4EZ9A 4LRCA 2LI6A 2D0BA 3OTOJ 4B1XB 2EKYA 3E51A 1DQAA 3NS7B 3QEVA 2W9CA 5IT4A 2MZTA 2P9CA 3OUYB 7ICOA 3B54A 3I9V9 2ZITA 1QQNA 2E1ZA 3O4WA 4MIAA 4NRUA 1JX4A 3PRDA 5FRNA 4DCPB 3SIPB 2C3MA 2E9ZA 1WSJA 4B02A 1T03A 3LAMA 1UPMB 4LSNB 3JPQA 1C0TB 4WFXA 4CLKA 4B1UB 3IG1B 4EYHB 2UUBJ 4LF8J 3MR3A 4WFNQ 2HIYA 4IRCA 4Y6IA 2DGZA 4Y2JA 5J29A 3H8WA 2FJXA 2R8IA 4OZ1A 4CHPA 4JKAA 1G6BA 4AHSA 3H5YA 3W1YC 2E2OA 5DM7Q 4BE0A 4WQ5A 3BBFA 1EETB 4BWJA 4KHQA 3ICLA 3NCRA 1QTMA 1U25A 4W90B 1KR4A 3CPEA 1N36K 2QW9A 1IQZA 1Q3UA 3NASA 3MDCA 1HQUA 3D2NA 2LPEA 4HT5A 1WYGA 5A8KA 5T7LB 4KC5A 2M5YA 3OW2R 8AT1B 3VAMA 3R3LA 5AIAA 2VZ9A 5C0YA 5D8HB 2OH2A 2QWMA 3QBXA 1ZTTA 1WSIA 2A41A 1BCMA 1HYSB 4O23A 4BR4A 5K8PA 3NNHA 4F72A 1VSLA 3OPXA 1G7CB 3AA5X 5IOLA 3IMQJ 5I3UA 1IIPA 3E01A 1H74A 4IWVA 5E2QA 3ID6A 2JEJA 3VESA 3TTFA 4MO4A 3C94A 2IHMA 3O3HA 4KHWA 1DFDA 2MMYA 3CFOA 3UMCA 3AO1A 1FK9A 3DLEA 3SYZA 2ASLA 3CMEN 5IQ6A 1ATRA 2E29A 1NK4A 1NPRA 1R89A 3MM8A 3PIPQ 4NI2B 3CXCM 2KG1A 1ZQSA 2F9TA 1FJEB 1RXWA 1F21A 5KOWA 5ELZA 3L95X 3CCJS 2P9KA 2DNHA 3ZO7A 5DZ7A 4CT9A 4A8MP 4H8KA 2W9MA 5I4MA 4DSEA 1TE2A 2W04A 2ZXIA 1F0XA 4CJKA 1VQ6N 1CJKB 4N7TA 2VKQA 4CO0A 3PW0A 5CJ7A 4USAA 4CE6A 4R64A 1PC5A 5JVHL 1HMVB 3TR5A 2QARB 4N77A 1FKAF 1SB6A 1HI1A 4RNOA 1SB3C 2UXBK 3GTYX 2HKEA 5CE3A 2FGOA 1RT3B 1Q46A 1S59A 4USJC 7FDRA 2BUPA 5K20B 2J7KA 3FJ2A 1XN9A 4AYBC 1VRUA 3THPA 2B4OA 3UR0A 2W3RA 1HIYA 2R7TA 4PG4A 4B3RJ 2ZOGA 1NGBA 3H46O 2JZBA 4I28A 3AOCA 3T79A 3OBIA 1B0XA 2FLOA 4RKUC 2MXYA 4UOGA 1SPBP 2E1MC 2FD2A 2VG5A 4K43A 1IR1A 3CC7N 2MEWA 4DV3J 4EELA 1HKBA 4FZMA 5M1NA 3CT9A 3PRVA 3I8BA 5B66U 5GAHI 5JTIA 1JROA 4HCCA 3HI0A 3AA3A 1VQ5N 3H40A 1ZC6A 1XIQA 1HW8A 4U7BA 1WSFA 2AEJA 2UVRA 7ICEA 4DOCA 4XH4A 1WAJA 4DU8A 5JMNA 3BGRB 2YMQA 2BCVA 1N88A 4QJFB 1XC3A 3OFGA 3NGZA 1KCFA 5LJVA 5HN0A 2BZFA 3TVZA 5IWAF 2F1JA 4A8XA 3ZNUA 3LK9A 2PYJA 4RZRA 5KL1B 4DS5A 2MAXA 4DR1F 3U1MA 4PPZA 1HYVA 1SV0A 5KG1A 3KK7A 2DNZA 4Y1DA 3K8WA 5DB6A 2FPHX 1IQTA 4C3KA 1K8AO 3HVRA 3MMJA 1IBMJ 4KLQA 1YVNA 1ED1A 2WVEA 1CLQA 2IFXA 4FLTA 1IM4A 4M0AA 4X62K 4HL9A 3UR3C 4FZLA 2B4VA 1BO5O 3V81B 4M9JA 4FWRA 3EGZA 2OYYA 3RBEA 2VPXB 4J37A 3WT0A 1CJUA 1G4CA 3VEXA 4ZP6A 2HQ3A 3PSTA 3GSIA 1U49A 1RT1B 3GBTA 3HHLB 4QU6A 3OT9A 3JAMU 1Q79A 1NJXA 3AVNA 3QU5A 3C14A 1HBUB 4X4SA 2BRLA 4IG0A 2GS8A 2EFQA 4IUFA 3BZQA 3EW9A 2WAQC 4KKOA 3SQ1A 1M1KO 4FBUA 2XMMA 1LXJA 2HK2A 2R2UA 1BQNB 1BI4B 2ZBPA 3CSKA 1ACMB 4WJBA 2NXCA 3QT6A 1I39A 2HVHA 4M5LA 2V7YA 2KXNB 2AX1A 1KFTA 5JVGQ 4D3GA 1ASUA 1QHTA 3W5YA 3TX0A 1UZDA 2ADBA 4M3WA 2HVEA 2GJ2A 1Y64A 3BBCA 2P9SB 4FZXC 3NVWA 3TUPA 2HBMA 3VAGA 2YX6A 2F44A 1FEZA 4NPOA 2YXLA 5AKHA 1RB0A 1VAZA 3S3NA 1SVDA 1CBKA 5GIPA 4TY9A 2VBWA 3TA0A 4MDBA 3D28A 4KT0C 2PFOA 3DXBA 1ZM2A 5J2QA 2QB0A 3C19A 2MQOA 5A2QO 2UXCJ 4ED7A 2IOHA 3EZWA 3EICA 4OHXA 2P51A 3RW7A 1J5EJ 4HVZA 1ZBHA 5CB1A 4DV4J 4LFCF 4EHUA 1XQIA 4AQYJ 3AVAA 4HHTA 3B9JA 9ICAA 1Y7PA 2ROEA 5AQUA 1R3NA 2Z58B 3DEEA 4UTGA 4I2EA 4DCCA 1DLOA 1HNWJ 4ECSA 2Q43A 2ZKUA 4ECRA 2PN6A 1J2VA 5IT9Y 2IS3A 3QSYB 3QX7A 5GADI 3Q8PB 3NCQA 4BACA 4DFDA 2LKYA 5HMXA 5LSRA 3V6DB 2MU2A 3A8KA 2JH1A 1U2RA 1GLJO 4Z4GA 1G15A 5EWGA 2OFGX 1I3OB 3BH6B 1HNWK 1U9LA 1P9YA 1LKZA 2GV9A 2L5YA 3G82A 3EGVA 1WHYA 4U67Q 3LP0A 4WCEL 1PYSB 4M41A 2BJEA 1JMTA 2B7BB 2XS7A 4IQUA 4CK2A 3ZT1A 3CJ9A 5D4BA 4DSJA 2ZH1A 2NCKL 1TFWA 3LH2S 4OHWA 4WKRA 3TUIC 1OQ6A 2CJAA 4KBOA 2Z56B 1N56A 4LJMA 3BREA 4BBYA 2P2CB 5IWAJ 3L4PA 4FYXB 4HUFA 7ICNA 1SQEA 5CR0A 5B0DA 1S48A 1Z25A 5AKZA 4B9QA 2CPIA 1I3AA 3AVGA 3B0YA 1XHXA 1MWMA 4EP4A 4H03B 4CGJA 4Q7AA 4ZN3A 1NLVA 3V6JA 3HPGA 1AUDA 2JH7A 2WVFA 2KXHA 4OD0A 5H9EJ 4ZPVR 2LHTA 3C1ZA 3W9HA 2OJ3A 4MO5A 2PC6A 4MFFA 3BZKA 2O8EA 5GAEI 3LDNA 3ZNJ1 5GAGU 3OL6A 1JXEA 1XMBA 3EY1A 1JI7A 4FJHA 3EDRB 3NF6A 4CJPA 2VDIA 1R8HA 3T1YJ 1RG6A 1U1LA 3LQVA 1AB8A 3U4LA 2Z7JA 3AQOA 3LGMA 3L2UA 1UEKA 3H8JA 3AD9C 2V9KA 5ALUA 3QZ8A 1Q82T 1PBAA 3H7HB 4DV6K 3UNYA 4ISGA 1VJ5A 1L7NA 1VS3A 4B3TJ 5K8NA 1GOBA 3FGVA 1VHXA 2E8OA 1RDDA 1UA1A 2CPXA 1HNZJ 4CFDA 1MW7A 3ZT0A 2OPSB 2QTDA 4H4KC 4DL4A 3VPZA 1KVBA 1ZQBA 3EKSA 5D78A 4XDCA 3TA1A 5AJ3K 1BDGA 3PIOL 1VJQA 1N5YA 4TYBA 1K8KA 2YBVA 4QZVB 1S8OA 1YJRA 2G08A 5ALHA 1KHWA 5F0XA 1VK0A 3VEWA 5J2PA 3CMAN 4IXCA 4L8RB 4ZVFA 1FT8A 1TAUA 1HPMA 4DUYK 5DQGA 3DYAA 4MFBA 5CP2A 2DK2A 1R0AA 1C0UB 3ISDA 1RHQB 3TSUA 2WF7A 2MSSA 2HOEA 2O8FA 3G0ZA 4I6WA 3PYDA 3BO3A 2D7SA 1GLLO 3VAFA 4CGFA 2FPMA 5J2AA 5IILA 2R8GA 5HQMA 2DNRA 1ZS6A 2AU0A 1UCVA 2FZCB 1KLNA 1IWGA 3NNAA 1HNZK 5I3PA 3J7YP 3O3FA 3UXOA 2B9WA 3RBZA 1BWFO 3NF9A 4O4RA 7ICMA 3SQIA 1OH8A 3ZSWA 3OL7A 2UXDF 2HG4A 3NAHA 1B0PA 4M5JA 2CRXA 3ILLA 5F8LA 1K1SA 3SDEA 1RYRA 3KNGA 4OLAA 2F8HA 4DV7K 3OXLA 4EO6A 2FJ6A 4KHYA 4DR2J 3C5FA 2IC3A 3DGVA 4UAUA 3H3NO 1H2UX 2I5JB 4B3SF 1RYSA 7ICSA 4HEA9 4DMZA 3F0NA 2BMBA 2YCHA 2IRUA 3KK1A 2QEXS 1Q18A 1F1BB 3HRDD 3KJVA 3LM2A 3OS1A 3K58A 1F0MA 2H3QA 1WC5A 4EAHD 4P4OA 2I7NA 1KRPA 5A8KB 1SAZA 3CCTA 5DBBA 4F0HA 5L1IA 2FLNA 2XNRA 2HI0A 2G8WA 3RH4A 4F9OA 1RTZA 2WF6A 3AGKA 1X5SA 1RHUB 3W2VA 4TU9A 2ZWOA 3WQTA 4CWBA 4CNYA 4B3MF 4KV8B 3K0JA 1TFRA 2VICA 4F7VA 4YOVA 1B3TA 4HUGA 5BRFA 1Y3JA 3VF0B 1N0VC 4TUQA 4FN5A 1U1PA 2QWRA 4I4BA 2XZWA 3F53A 4UB5A 1QY7A 3ULEB 3J7YI 5ETQA 3C6UA 4OLBA 3ZDEA 1RPLA 1W7WA 3BJYA 3T41A 1OH7A 3PJXA 3DXKB 1WORA 1MROB 4PL8A 1Q78A 1XNQF 3RR8A 5M1OA 3SBGA 2QL7B 2JV3A 3UCUP 4DF4A 5AQHA 4AYBD 2LYBA 2DR5A 5F8MA 4AM7A 1GMUA 3HD2A 3FRZA 2KOBA 3BO4A 3DV9A 4JKHA 4OYMA 2H1YA 3I0RA 4DR5F 4ELUA 4DV7F 2P9PB 4DR7J 2HZAA 2IRYA 3HPHA 1LW2B 4FXVA 3D9BA 4K0KJ 3C66A 2RF2B 4WJ3B 5HHIA 1XU4A 3TQ1A 3IKMA 1IKVA 4WU3A 4KLUA 2AQ4A 1UVNA 3IWNC 2IDLA 2ZJQL 2V7ZA 4RQ1A 4B1VA 4RQ4A 2KKPA 2MYFA 1JJHA 2DYAA 2P5GA 2XWYA 5HMLA 3QUQA 4YXJA 1WHVA 2JMGA 5ALJA 3BQTA 4Q44A 4EHTA 2F8KA 5C2CA 3R7SB 5IV4A 3RW6A 2OKQA 4DUZF 4MHVA 1CS4A 4XAKA 4Z4EA 3LGHA 2L9DA 5AIBA 1W2IA 5J2FA 3W62A 4DTJA 5AK6A 8ICYA 1YGYA 4CNZA 5HAOA 2CNNB 2Q4TA 4UB6U 4JI5K 1F9EB 2WB1D 1DGJA 4LBPA 4TUPA 4CGHA 3RF9A 4JN4A 1LWCA 2EXUA 4F4AA 4CHYA 2I5HA 1ZM4A 5KFKA 3AO3A 4I2QB 4DUYJ 1BA0A 1M5HA 2WSCC 3WNGA 1Y3KA 4WP9A 4DV2J 1X9MA 1R8BA 5AJ3J 3W64A 1IBKF 5KFLA 4I2GA 2KVIA 2WVBA 4DEZA 4FVMA 1TK0A 1F9HA 4OX9J 3ETMA 1PO6A 3A1YG 4YY3J 4DR4F 4CH0S 2IJNA 4QIEA 2DY1A 3VQ6A 2H51B 4PUOB 9ATCB 7ICLA 3Q2SC 3H45C 2RVJA 1JJ2R 1S6PB 4TQSA 3CJCA 2OSQA 2H4YB 3QRPA 4B3TK 5L1MA 4RUAA 1UJ5A 2ATLA 4K4HA 2RHKA 4DV3K 3TAGA 1KONA 3F44A 4L75A 4Q8FA 3O9QA 4IL6U 3KZXA 4QS8A 4OIXA 4KGXB 4OJPA 1X9WA 3TOQA 5B0CA 3QRRA 4NCGB 1RBSA 3IFEA 1T8EA 1NGAA 3WKDA 4KHUA 3VMFB 5LY3A 2EPIA 1YZ7A 2L9WA 4K2XA 5JLHA 5ALRA 1YITN 4OZ5A 4F5RA 1SKWA 2W4PA 9RUBA 4JI6J 1FNOA 3TO8A 4BRQA 1HQEB 3HXMA 1GOAA 2XI3A 4J2AA 4DTUA 5CY4A 4X62F 4Z6CA 4J03A 1L3SA 4QZAA 2PEHA 4RPZA 1CRXA 4KGKA 3LDQA 5B7WA 1I94J 3NHGA 3P49B 3NVYA 3OSPA 3R5DA 5AXLA 1SJ1A 4GC6A 2AJ1A 3MUVP 1SKUB 3W2VB 2DHXA 2XC9A 2A19A 2KQ2A 4IO8A 4KH1B 4FJNA 1ZQVA 3WXMB 2F9WA 2VWJA 2HOFA 5AK4A 1FWLA 4HR2A 2VQFK 1Q5VA 2W4CA 2HHHJ 1X0PA 1ZPVA 3MCMA 5GAHU 3QJPA 1LOTB 3EE9A 2CRLA 4P52A 2MJUA 1FA0A 1L7MA 4A8SA 3WXIA 2NLXA 1RDCA 1QQOA 1RLDA 1D8YA 4KQZA 4DL0C 2G0JA 5CQGA 3WX4A 4TU8A 3BSOA 1HNXJ 4FJJA 1MNEA 4DG1B 4DR1K 1N34F 3BS5A 1BUXA 1HYZA 2CGJA 4DV0K 3VGKA 1IG6A 1H98A 1X3MA 1WDDA 3GIRA 3F9KA 6AT1B 2XI9A 3LZIA 1U0HB 3UD3P 4XO0A 4FJGA 3GIJA 4R8UB 2G5IB 3IGVA 2ZG6A 1WD6A 4B3OB 5ADZA 4QS9A 4F4XA 4I2HA 5AI0A 2QLWA 3O44A 4CFBA 2XYHB 4IG3A 3T5HA 1YTAA 2MY7A 1IN0A 4ETZA 1SIWB 2O8CA 3O8WA 2JLGA 3V1QA 5KFEA 2BE9B 3KLHB 4QYRA 3O9SA 3C6AA 3JXUA 3KDOA 1BQXA 1CC8A 4GXJA 4BRIA 2YWFA 4XTTA 2JVRA 3H2UB 2Q3PA 1B92A 1UJ6A 2CQGA 2GAHC 2DGQA 4K8ZA 1ZRNA 4DSKA 2V6AA 2KFZA 2Y9TA 5ALDA 1IKVB 5C2GA 2DEJA 4FPRA 5AZIB 4CH1A 3W2WB 4JI1J 4KGVB 1ZPWX 3ZTQA 1UJ4A 5FRMA 5I42B 3QETA 2A1JA 4JWMA 5HI7A 3R3TA 3TW0A 4QW9A 1EKRA 2LECA 4KRFA 1SJ3P 5KT7A 2DTJA 3MOZA 5L1KA 3SQ2A 4E7KA 3GCXP 2P9PA 2VB6A 3S7RA 2EANA 2YQ0A 1LV5A 3M32B 3P6YC 2ERRA 3HJFA 3CJKB 2DR8A 3CCMS 2BE2A 2JSXA 2X78A 4QZEA 1SQGA 4LF1A 2F63A 4LSNA 4C97A 1TFYA 1KQFB 8ICVA 2YX7A 4P4MA 3THYA 5GTHU 4ED4A 2BRKA 1ZTWA 4NWBA 3ZETA 9ICMA 1JXLA 4YY3F 3BS7A 3NBPA 4KLHA 3MGVA 1NMDA 3BKTA 2B8PA 2MUTB 1PUZA 3HF5A 3D6RA 3NBPB 1VQ4S 2VD3A 4UY85 1J2NA 3M8PB 9ICEA 4D3HA 4FO6A 1HNIB 3FZLA 1ZETA 3RJIA 2ABYA 2X1AA 2Y0SF 1DBDA 5M2UA 4CJFA 2YMLA 2A1JB 1HNVA 1U26A 4S0MA 2AIRB 4H4OB 1WWUA 5TKYA 5CA7A 9ICLA 4DKWA 4ANCA 3PX0A 1QTNB 2M8HA 1SIJA 3CDBA 4HTLA 1YJTA 3LL3A 3LF0A 1KW4A 3A5OC 4OJ5A 3GG4A 3JS9A 3N28A 3DDKA 2YI1A 4USUA 2Z2MA 3C46A 1XERA 2CWXA 4JS5A 1XHZA 5GAEP 2BV3A 1OY6A 3VV2B 1YLXA 4CBWA 4NI2A 1WWVA 2O8DB 2ALZA 3CHWA 3P5JA 2D0AA 2HYIB 3FSYA 2W8LA 4LF4J 4XH5A 3C2MA 1EQ0A 1GQEA 5HROB 1SCJB 2W2NP 1GX6A 3VHQA 2H5EA 2HLTA 4J9LA 4ZHRB 1N32K 4UAYA 1YTYA 2Q0ZX 2G8UA 2ZD1A 3V6KA 1T3OA 3MAHA 4NMLA 3MDFA 3TJ9A 3PO4A 1U47A 3I56S 5CZ2A 2WTFA 2FTRA 2VC0A 3AAQA 3KJFB 1XR7A 1TV6B 2CGLA 2XMKA 2KTQA 2KT2A 1NK7A 2HNYA 1VDHA 3GG1A 1S0OA 4FXDA 2CJKA 1JXVA 2YX4A 5KFSA 4OYIA 2V8DA 4CYUB 1ZQZA 4A46A 1NUEA 2DL0A 5KQDA 2W2OP 2UZAA 4FOIA 4M45A 3RTVA 4RNHA 3NGDA 1JNZB 1FEHA 3LVVA 1PKUA 4TLRA 4X64J 2PMHA 3PYGA 3OYFA 1XBWA 3VGUA 3M30B 1ZQYA 4MLEA 3BQ1A 3W5XA 1IKYA 5J0UA 4JV0A 3PKYA 1U0SA 2LYHA 2V2QA 4K4SA 5C24A 3GB0A 2J6TA 4I7FB 1NGHA 1EP4A 1VIXA 1UT8A 4J9RA 3BF3A 4JI7F 4NXMK 4KTWA 3VVTA 1UVLA 2D3ZA 3GILA 3MPUB 5E3PA 3LPUA 3DXMA 3IAS9 5K8OA 4WF9L 5IM0A 2V8GA 4GV9A 2HFOA 9ICJA 2LCWA 4NE9C 2KVCA 3H4DA 1TKXB 1M6YA 1RILA 4WFNL 4HTJA 4ECYA 1L6NA 2Y9UA 4C4RA 3M7VA 4Q43A 5LXRA 1RAHB 3OXFA 1S6OA 1WCNA 2J0WA 1U7LA 3QFPA 2BM1A 3TYTA 4CERA 1MN9A 3EPIA 3B78A 4ZP8A 4BRLA 4Z4HA 5JVHQ 1FTRA 2JGUA 4YDDB 1ZD4A 3TNVA 1F2GA 2N4DA 1RGVA 1OPIA 5CXTA 5KFHA 1NHKL 1UL3A 2RHQB 3FBEA 5JVGL 2BGWA 3CJRA 3WIVA 3QIDA 4KB1A 4EX6A 3HZ6A 4CZCA 2YWEA 3KVGA 2HHPA 4HT7A 4RW6A 3EVWA 4LVSA 2QMXA 4U7UD 2XY5A 7ICVA 3ZTSA 1S1TA 4KFBA 3M9NB 2FY8A 1CJUB 4Y2MA 4FNIA 1X2IA 2G5HB 2V68A 1RBRA 3JTPA 4I2CA 3WNFA 1SZ2A 5ALYA 1TVRB 1AFJA 1W7AA 1YZ6A 3SAFA 3SEOA 1NJIT 5AICA 3SENA 3RRKA 5BR8J 3SFGA 5T7BA 1VOMA 1ZH5A 3E66A 3SMPA 3CP8A 2E8MA 1O03A 5JJBA 4OJLA 4PHEA 2J6UA 4R0EA 4ZCKA 4DR5K 2NUBA 2IJFA 2NV3A 1IR2A 4NCAA 2XHCA 3DRPB 3OPKA 1FXLA 2OEKA 4MKAA 4DR7F 2DNLA 2AX0A 2GGPA 5DDMA 4EIAA 3VTIA 3S41A 3WK7A 2CNKB 1AYEA 3FQLA 1NH7A 3TVKA 8ICRA 3OV7A 2M2BA 7ICQA 2J5AA 5AQGA 3JB9k 3QMQA 1K73T 2LMIA 3KJNB 4CLWA 4WQ5C 3EE8A 1NKCA 1W0HA 2G0CA 2A5XA 3F2CA 3JQMA 2MKIA 3MZIA 4ER8A 2XLJA 3UCGA 1CEZA 4QZHA 3T5KA 2L48A 4GVBA 3HHLC 3KG1A 2XY6A 4V19X 1OS5A 3MWPA 4PWUA 1L8LA 1N52B 4PH5A 2YQEA 5BR8K 4CJEA 4PWWA 2HFNA 4Y2SA 2HAIA 2JFKA 2FBXA 3KKSA 2DNKA 1X6IA 1T3NA 4IDKA 5IZHA 1T3QA 2ZF5O 4HHUA 2B5JA 3L3VA 2H3EB 2G1DA 5FPDA 1MLAA 2KSOB 1MROA 2K2PA 4KAIA 4M9HA 3G6ES 4I9LA 1BNPA 2Y0SC 4BLGA 5AQOA 1PK3A 4C8ZA 3NGYA 2ZIXA 3LZJA 1ZQFA 1U1NA 1EIYB 9ICKA 2E5IA 3OBWA 2FMQA 1VR6A 4L73A 4BWMA 1K9MO 3A0HU 2JZ5A 2ZHOA 3SQ4A 4XPCA 1ZQAA 3KZIU 4Y2VA 1P1LA 3C1YA 1XR6A 5KFPA 2HQDA 3IBFB 1IBKJ 4O5FA 5AE2A 4P2SA 1ASWA 5C24B 3O5TB 4AXIA 4JI7J 3QJJA 4LUBA 5BPCA 4QYZK 3QBWA 4UBCA 2QYCA 5LMUJ 1QQCA 2AH5A 2AW0A 1BHNA 1JCEA 1KBRA 5J0QA 4B1ZA 5CCMA 4F0MA 2KL8A 2RQCA 1W9HA 2VIHA 1JN3A 4WFAQ 2F9JA 2I38A 2M9KA 3SUQA 4YS2A 3HPOA 1LWEB 3T69A 1Z1BA 5ALMA 4F36A 4ANEA 5BRHA 3ISBA 1KC8T 4CJ7A 3UMGA 5KG0A 5DG7A 4KPCA 5B0FA 1TMMA 5F9NA 1R7IA 3V9SA 3G2XA 1Q95G 4E1MA 1N48A 1D8ZA 2PA3A 5A0YA 3VAKA 1XJWB 1YJNN 2GWKA 4CF3A 4DJBA 1U2VA 3OHAA 4U8VA 1W2BR 2V9WA 3WXKA 2HQGA 1COKA 3W0LA 3QGPA 4Z7YA 1EQYA 1YJWN 2AJQA 1HX1A 3GFZA 4AQYF 3TA2A 4CI6A 3S01A 5ALXA 3S3OA 4WYBA 2YKNA 3MMCB 2PBDA 1L8OA 2KXFA 1VRTB 3PW7A 4ACOA 1VQPS 3KD5E 2B4PA 1JLQA 1T94A 1E4GT 4DG1A 1OQ3A 5A8WB 4HUEA 1P90A 2R18A 4URGA 2Z30B 4O3QA 2W1BA 1XMOF 5DM6L 3OJSA 4CGZA 2KM8C 3QFHA 2HPUA 3KHLA 4YR2A 3QUCA 2E5LJ 1MMLA 2O01C 3DYAB 3E01B 5ETMA 2Q79A 2YX1A 5AQWA 1RHRB 2WW4A 2VJUA 1KLMB 3L2VA 3FZKA 4M3XA 3IG1A 4ZLJA 1X0FA 3C65A 2P6UA 2UVWA 3UB5A 4JI5J 1KQQA 2W03A 4ZKAA 8ICMA 2IMWP 2W42A 3L3CA 3CCVN 1SZPA 3N7RC 1B4FA 3BBBA 4DV6F 1RUSA 4A5BA 2R7YA 2FJWA 2WF5A 4DV5K 2XI2A 1J54A 2F2AB 3HM9A 1QDUB 1XO1A 1VSMA 2XWXA 3SK3A 2FJAB 2Z2LA 1YKWA 5AJ3F 5FLXO 5C25A 2APOA 4QZ9A 4IDKB 3MD1A 4NYNA 3JSRA 5AKIA 5HP1B 3LM9A 2QWQA 4DV1K 2DR7A 2KP7A 5GAHP 5HNKA 3G8TA 4K4WA 1KTVA 4U6PA 5D6GA 1RTIB 1WUDA 2RQMA 1B7FA 4CNQA 2HHQA 4M1KA 3G8SA 3NMAA 1ATNA 3KTQA 3IM8A 4NV0A 5J1NA 2QL5B 5DB9A 2VGMA 7ICPA 4NXZA 4CO1A 1F5CA 4LSLA 2NXEA 1WSGA 4JK8A 4MH8A 4X66F 2ZNZA 2YB1A 3NS1A 5F3ZA 3RB3A 2E1PA 1S1UA 1ZJMA 1A5WA 5HLFB 1VQLS 2QB1A 2PDAA 1HBOB 3AAWB 1NK8A 2QX0A 4AHUA 4CK1A 3RR7A 1S10A 3AHPA 3SZ2A 2RKIB 3I96A 3O6QA 2W9BA 3S3MA 1E4FT 4A2BA 1NG9A 2AQ0A 2BHNA 4IQVA 5IFMA 2FBYA 1S7IA 2CQDA 5LSOA 2MTLA 4RPYA 3QFWA 4KLTA 3TRGA 3RRGA 3UE2A 3SQ0A 5KFWA 4UQGA 2BDUA 4PHAA 1S9GB 1NU0A 2YVSA 4PL7A 3KNAA 2ASYA 1RTJA 4X4QA 1UPHA 1Q7YT 2XMJA 5DRKA 5AQKA 3UVJA 2YHYA 1HWKA 3EXCX 2YNFA 3JAMO 3BYRA 3IAM9 2X1GA 5IT9U 3ED5A 3OFHA 3CCMN 1HJRA 3DJCA 3BF4A 2BOAA 1B0VA 4QR0A 4JK7A 2GCFA 4TNOA 2UUTA 4DTNA 1TL3B 2IVYA 2IVMA 3LDSA 2IVFB 1BPBA 3T9ZA 4MTPA 4UB3A 5BPMA 1RWWB 1KFDA 5HVGA 9ICUA 1LW2A 4JI0K 4YMMA 1NDKA 1VQNS 4EEKA 1QQ7A 2V5HG 2QV6A 3D45A 1AXQA 2YQ1A 1K6YA 3JTNA 3OR1B 4FF4A 4BROA 4PG8A 3MXJA 3SR6A 1YJ9N 3M8SA 1F2HA 2U2FA 2IDEA 3EZOA 3WKCA 4RQ0A 4AXJA 3FVYA 3CFRA 3AUOA 1X4GA 3QWUA 3T1YF 1KTQA 1HJOA 2P9SA 4IQWA 2BBEA 1UT5A 4GNIA 4RG8A 3JSYA 2YMMA 4CEZA 2DQNB 3GJTB 1VQYA 3I0RB 2EBGA 4N41A 1FRJA 2F4VJ 3BSAA 1O51A 3SCIE 2Y3YA 2KJ9A 4LBHA 4FDFA 3R9LA 1H2TZ 1FO1A 3BB5A 5EY4A 5FPEA 2M7SA 5BREA 3TJ8A 4FPAA 1ZQTA 4QOTA 1MWKA 1GT8A 2W9AA 1QM9A 4A47A 2KJVA 3PYEA 3CIMA 5U47A 1QJHA 1VSKA 4R5PB 4DR6F 5B8HA 3OQ2A 1TUWA 4GMKA 4ZP7A 2PXIA 2I6XA 1X42A 3EM1A 2UUBF 1N0UA 1ZQPA 2IM2A 3QIPA 2HDOA 4M6WB 2GX8A 3V81A 3QRQA 2D3OR 1EXNA 3H5UA 2JXJA 2UUWA 4DMNA 4HTIA 4DSFA 1Z2ZA 2ACYA 2NUHA 3BGLA 3CDWA 2P9KB 2YH0A 3FGUA 4YFKA 3WNEA 2Y0BB 2PE8A 4K8RA 3NGIA 4YN4A 3KKRA 1NI3A 4ISEA 2KIWA 2VV5A 4GFJA 3DCAA 5CYQB 3ZSXA 1RXVA 4C8KA 5DDRC 1E6YB 3AU2A 1G2EA 2QLFB 4M5DB 3CCZA 1YBAA 1HR0J 1NOMA 4UB2A 2AGPA 4A4JA 3SMVA 1U24A 1PGZA 2ZUDA 2CJ9A 1K5OA 1I51B 3C29A 2NYHA 2JNJA 3NMRA 4C2MA 4RQ8A 4MK9A 1HPZA 4UY8O 1G1XA 4HHJA 1BPXA 4F50A 2HBLA 1XS9D 1ZAWA 3HVWA 1Q16B 4KR0B 3QGGA 1DLOB 5ADXA 3MM6B 2OPRB 2KW4A 1IVZA 4L6V3 1J5EF 4ILMA 1SJ4P 4FJKA 1V5IB 3DM2A 3IC1A 3BPSP 2E44A 1V6HA 1V5VA 3CJ5A 1T3VA 1PBUA 4G6VB 4RW7A 3R5CA 4GVMA 4PG7A 3ZTPA 3M6KA 2BCUA 1C1BB 4EFAC 3K0SA 1DTQA 4HVJA 1RAJA 3IS9B 5MLCV 4CECA 3D2SA 3TU5A 2BM0A 2UVUA 2MKYA 4ISFA 2ATQA 4J2BA 2JDJA 4ECTA 4PA1A 2BQ3A 2KI2A 4C4SA 1SH2A 2PSZA 1KOHA 4DU1A 3M8RA 3IBCB 5AT1B 4YHHF 1Y9OA 3R5AA 1KVAA 2X74A 4PYAA 4OPAA 4M42A 3DWLA 2ZTEA 1JALA 3FE1A 2DB1A 4LFAF 4J9QA 2FPLA 3AH6A 3ZSYA 3MUMP 5KT2A 5J2GA 5CYJA 5C7PA 2NR0A 3UKUB 3HK2A 3L2RA 3E9OA 1BQMB 1B70B 4WTOB 3RMAA 4UAWA 2D3DA 3K17A 1MWZA 1SC3B 1SJFA 5DG9A 3IFRA 4E7LA 1HKAA 2GWJA 1N8RO 4RUCA 3PO5A 1YIJS 3UKRB 2BPCA 1CUKA 4LRFA 2ISPA 4DPXA 1Q7LB 2HNZB 1I5OB 2DRBA 3M1VB 2IPOB 4H4KA 2YTCA 1BPZA 2EVZA 4FBTA 2U1AA 1CQNA 2CA9A 4O5KA 2J0QD 1YIJN 2M0NA 3MABA 4NEZA 2ZWPA 1ZD3A 2RKIA 2DHAA 3JS6A 4M3YA 4G65A 1M5PC 2PZSA 2RQ5A 4FKYA 1P27B 5CEHA 4NY8A 1YSJA 3MF5A 1KL9A 3IDWA 2KYXA 4KHNA 3UMBA 3QO9B 3K5LA 3E9LA 4OI0A 4CZHA 4LF5K 1VQSA 1M5KC 4OJGA 1JLAA 4IOXA 3SAHA 1Y88A 4N8NA 4I2FA 3RBDA 1NH8A 4ILGB 2BCRA 3NCIA 4NXNJ 3CCES 1J6ZA 4W5RA 4Z0UA 1COOA 3C28A 3C7NA 2AZ1A 4A8YA 3CC2S 4R8UA 2OPQB 3KUEA 1H3DA 4ZTJA 3UD4P 1U8SA 2JOQA 3QNMA 4LVNP 5LJWA 3N4MB 1S7HA 1NHVA 4OV6A 1IG8A 3MPVA 1WBDA 2AP1A 1M1HA 1R0AB 8ICJA 1P6TA 2IYGA 4OGEA 4KO0A 1U4BA 1Z4OA 3NWGA 3CO9A 2ITGA 3VQ5A 1WOQA 4OX8A 1ITPA 4RNMA 2CQPA 4GKKJ 3SCXA 4B3RF 3UO0A 1M1KT 2A1SA 1V9PA 4LFBJ 1B9DA 4ANDA 3GG0A 2Y1JA 3M2UA 1KVKA 1RT6B 5B5EU 2DGTA 3P39A 2CVEA 4X4RA 4QIWD 2BEFA 5LM7E 5KG6A 4MIBA 3AA4A 1RAIB 1C4AA 4CZEA 1B43A 1NJZA 3D2FA 1S6QB 3ITHA 1U09A 2KB2A 4BG9A 4FM1A 8ICPA 2YWHA 3AODA 4YR3A 3UKUA 3SUNA 2IM3A 2YKOA 2Z2ZA 2DNMA 1RE1B 4MJKA 3QXGA 3IA0A 4BC7A 4YB7A 4QW8A 3FSXA 4NO7A 3MGJA 3A8EA 3MFIA 1H2VZ 1VI7A 2H4WB 1TMJA 3J80Y 4P7VA 3NVVA 3Q24A 4BE1A 4JWNA 4AL7A 2D1KA 2ZJPL 3EYZA 5CHIA 5EWEA 3PUFA 3U3GA 4DPTA 1RAOA 4K0KF 3JPRA 1FERA 3NOCA 5J0XA 2QJ3A 5KPZA 2AJ0A 2RU9A 5SWMA 3DOMA 1RWMB 4EFHA 1WSHA 3M6VA 4FKXA 4A8OA 1L3VA 2CZVC 3RAXA 5EDWA 4P2HA 5EX3A 1YVFA 1Q82O 3FBBA 4IDHA 3C5GA 1JB0C 1T9VA 3MGHA 2JLEA 8ICSA 1Q5YA 2RRDA 4JLHA 1RT1A 2ZZNA 8ICNA 1XMQF 4GKJK 1NO8A 3IR6B 4GXIA 1AUSL 5A0YB 3CG7A 1QSLA 1RKIA 2ZDOA 4UT4A 4U7UK 2ZM6F 5AQPA 3O5BA 3L6QA 4UY8T 3PFOA 4JKGA 2OMOA 2HF4A 3NDKA 3A5LC 2VFVA 5AQFA 4J9NA 3GJRB 4RQ3A 3LP2B 2BX6A 1WI6A 4FZVA 3TADC 2V0NA 2F96A 5BPLA 1LK7A 1R0BG 1TP7A 1J9AA 3KDNA 4ED0A 1KNZA 2NRTA 3IP0A 3I4HX 2O8DA 2ROPA 5B0AA 2UXBJ 2P66A 4YQWA 3PG9A 3HKZF 4YORA 2ROGA 1S0NA 2H3ZA 5BJRA 3N0VA 4C48A 4C8OA 4WKYA 1T6CA 2OZMA 3A3NB 4P0QA 4JP8A 1RAGB 2F4VK 1N5YB 1EP4B 4MAKA 1CC7A 2YNHA 4JK9A 2FB0A 1CVJA 2GOLA 2MJNA 3FFIB 2CPFA 3MTJA 3T1HJ 1Q1KA 4E19A 3AVHA 3L09A 4K59A 1M5OC 4LFCJ 4KX5A 4DR2F 2F40A 5HJYA 3C2PA 3MMBB 3P83D 2EFNA 5E33A 2ZH8A 2F1HA 1DRGA 2DH9A 4TURA 4JV5K 1GFWB 4CJVA 2WUSA 1RTDA 1VQ7S 4U67L 3C15B 3MXMA 3OTBA 4CLUA 2RMLA 1MC8A 3RBXA 1ROFA 3Q8SB 3CCQS 3GFYA 5AM5A 4H54A 4YR0A 3O80A 2VG5B 3LO3A 4K4IA 3F2BA 1ZAVA 2WAQD 3SSQA 2DO4A 4Q0BB 4JK1A 2V69A 4F5QA 2O4IA 5AZJB 2G2OA 4A8WA 2D9PA 4OV1A 3L3UA 2V4RA 2BKPA 2BR0A 2A1BA 1SC1B 1EHWA 4J2DA 3RMBA 4CJ4A 1NM1A 4JKEA 4JV5F 3O1BA 1KKXA 3HMJG 3J7YU 2KRRA 3MEGB 1HBNB 2RT3A 3UW1A 4LH5A 1WEZA 4HWIA 1FKPA 1NBEB 3OYKA 4I29A 1TL3A 3POTB 2WAQF 1VQ9N 4OI3A 3L5KA 3H8SA 3C16A 2A1AA 4M3ZA 1S22A 2OO4A 7ICRA 9ICQA 3B8HA 3AVMA 3FFKB 3ZZZA 4CZGA 4PKDB 8ICIA 3TWHA 3SFUA 2E9TA 1F3VA 3K7RA 4NMXA 4FJ5A 1SL1A 2PO4A 4DFMA 2K1RA 2RRNA 4BQZA 1JLGB 2UVVA 4OX7A 2FGCA 4NLXA 3KJVB 2IY5B 1OXJA 3L9ZA 3A8IA 4O9MA 1TTHB 1NK0A 4OPHA 3B0XA 3ZDBA 4ECWA 4NA2A 1X4EA 2DFHA 2WRMA 1KHVA 1S97A 3B82A 1OVQA 2OTJS 1D1UA 3HZGA 1HBOA 3OHBA 4F2SA 2RUGA 4DTXA 3NGSA 4KLDA 2HFZA 2PGCA 4WFAL 2VDHA 1O0PA 1BOTO 2IVNA 2ZIUA 5J1EB 2C3YA 3MCSA 3TZZA 4Y1CA 3QQCD 2N3OA 4F5PA 3QU2A 3ZTOA 3TZYA 4KB7A 2Z1HA 3DRRB 5M2PA 2VQEF 2DR9A 5KT4A 5JRTA 4PGXA 1ZXIA 3GU3A 3LGNA 3W3SA 4A59A 2DO0A 3FEXB 1VSIA 1J5OB 1WC1A 2KE7A 2A1RA 2RP5A 5LL6d 2C2EA 1NPKA 5ETVA 3LANA 2EAOA 4DWIA 1JLEB 3M2UB 1F3FA 3VQPA 2OCEA 1TAMA 1K73O 4ID5B 5ALFA 2D0OA 3MR2A 3A5MC 1FWKA 2FJVA 5CZXA 2HBRB 4DCOB 4Q45A 5E41A 2ZC3A 4O4GA 3GYXB 4C7ZA 3O9UA 4BRHA 5TZVA 4DR3J 4IQXA 4DV5J 3D66A 3QO9A 1N32F 1FD2A 2V4JB 5E3CA 2YX8A 3D1QA 4MF8A 3C6UB 3A5NC 3NAIA 2ZIXB 2NLWA 4FPIA 4RQ7A 2FC9A 2OP5A 3GIIA 1DKGD 2YNFB 2B6AB 1I1GA 3W65A 2VC1A 5J2DA 2CPYA 2R7WA 3WNHA 1XC9A 3OUYA 4JI3F 1LQ9A 1HPZB 2AD9A 1A0OB 1X4FA 4Y2YA 4IZ9A 5DO2A 2O4GA 2R7XA 3CXCR 2Q36A 3OS0A 4WPAA 1R0CB 2OPSA 2JEGA 4OL8A 5AKEA 5LL6Z 1NLKL 4DU7A 1QCKA 3JXOA 1ZQ1C 2KJ8A 2WFAA 1HNXK 2HOIA 2DBBA 3Q23A 3U8XA 2HHUA 4JYAJ 3J81Y 3G9CA 5HANA 5IS2A 1HBMB 2BJ7A 1RBLA 3C0BA 2CPEA 4UAVA 3CCRS 2VKRA 3VEYA 4ZK7M 3D54A 1EAYC 2OUGA 3RJFA 5JLFA 2XMUA 5HATA 2CDQA 3BDEA 3THWA 4FJ9A 3AFGA 1L7OA 2HWIA 3MMAA 5GIOA 3CC2N 3VQCA 5DB8A 2HRYA 3ZEUB 5J2CA 4BRMA 3Q86A 1D8LA 3BGRA 4JI4K 2MHNA 4BRNA 2OEHA 3HX0A 5IIOA 4MKBA 4AM6A 4KLSA 4I6MA 3T1HF 1QVGR 7ICHA 4C80A 1FRIA 4H5WA 4LR8A 1KC8O 8ATCB 1NB2A 3KG4A 5GAGP 3AO2A 2CNLB 2NYIA 3R5GA 2F4FA 2Y8YA 2FIUA 2I9SA 4WXWA 1F5SA 4YUDA 3V7JA 1TL7B 8ICCA 2BW2A 5KGWA 3A12A 3JPPA 4ENOA 1ILYA 2O8FB 5AK5A 4TXSA 4OI4A 3ZT3A 4NLBA 3BDPA 2VPWB 4WF9Q 4K50A 5LMUK 1CXQA 9ICCA 2UYTA 1RDBA 3VENA 5KPTA 1LXNA 5LJ5Y 2F1IA 2CQ1A 2D5RA 5ALWA 3BQ2A 2IBKA 2GVZB 4USVA 1U02A 2IA0A 2ZBCA 5B0EA 5BN8A 2JEFA 4M9GA 1HQ2A 4AHTA 4C6AA 1NU4A 2VBZA 5M2RA 4RTFD 3A4TA 4WFBL 9ICTA 3QB0A 4DU4A 3I1YA 3Q7BA 4NWIA 1Z05A 4IKFA 2LA6A 2EZXA 3ZX2A 2V8PA 2VG7A 3NF7A 4DN9A 4EP5A 4RNNA 5IIKA 4CTAB 5KFXA 2JX2A 4C8NA 4KTZA 4YB6A 2NXNA 3CCLN 1U6BA 4KH6A 1TR0A 3M7DA 3ZXWA 2KKZA 4RUHA 2XMAA 3KJQB 2KMDA 4IOBA 2Q0UA 2QA1A 4CVNE 1Z19A 4ZJLA 3F73A 1QVGM 1R6YA 4WTYA 1ZQHA 3OFFA 4BCAA 3UDLA 1AFIA 4YEAA 4JI8J 2B4JA 3DRYA 3WHIA 4F3QA 4CEOA 3RB0A 2PFNA 4RX6A 1XEZA 1RDUA 1CI4A 2VWBA 4H5TA 3ZSOA 3DI6A 4ZVGA 4OMFG 1Q8BA 4CRXA 3RRHA 2E7VA 3MR7A 2EAPA 4FK2A 4AHCA 4DQSA 4DV1J 2IIHA 2BKEA 1VBYA 4BGAA 3HHNB 4L3QA 4BR5A 2QKBA 1Q0NA 3CNQP 3RJMB 3BEXA 3SPYA 1MMDA 3CM5A 2VCPA 3HTVA 3MMBA 2NZCA 3MEEA 3CCEN 5AM1A 4WIQA 3T6JA 2KNJA 4KKOB 1LK5A 3W8PA 5HOOA 1NKBA 2GHPA 1X4BA 3K1RB 5HLFA 1G3OA 1RYUA 3FAHA 3VF6A 4P75A 2EH9A 3GV5B 3ZZRA 2P8IA 4CO4A 5AQSA 4CD1A 4JI2J 4XEIA 4A8KA 4DR7K 1HWUA 1LOUA 2B43A 2UUAF 2HGNA 2E66A 2HFVA 4KLFA 3DC2A 4USWA 1MU2A 2NZ4A 4F3MA 3HSZA 1XNSA 4FP9A 1QAIA 2RIJA 5DQHA 3FBCA 3G6YA 4WCEQ 2ASDA 1TVRA 1PIEA 5H9FJ 4ZVQB 2HK3A 1L7PA 2BANA 1LNQA 2BJ3A 3O9TA 3HULA 3PSIA 4FCYA 4FVCA 4CEFA 4EZ6A 4JI6K 3O6WA 4CLZA 3KK2B 2QWOA 1R8CA 2FVPA 4LF6K 3H0PA 4IS7A 3J7ZO 3ENAA 4CFAA 2EC2A 3OTCA 4KYZA 3Q0AA 5HBMB 5AM3A 3CVKA 3OYAA 2CWKA 2NPIA 2XULA 3NVMA 3D0IE 1ESVA 2QT7A 1SV0C 3CQXA 3M8PA 3X3UA 4KI6A 1X7VA 4YD2A 4W5NA 5HP4A 2DHSA 3OW2M 3JYTA 3T9NA 5DMRA 5EE1A 3KLGA 1FIQA 2V50A 3N01A 4HLBA 4U95A 2JR5A 1WC0A 4ZPCA 5C15A 2O8BB 4H5VA 1RBUA 1XNQJ 2MLZA 1HJPA 4LIWA 3M32A 5J2KA 3S6EA 4JYAK 1IKXA 2WOMB 2YNIB 3EXYA 2RHFA 3ZZUA 5JUMA 2GQQA 4TSXA 1V3RA 3C3LA 3SJJA 4RQ6A 2IAJA 4RCHA 4Z4IA 2RNEA 2YQ3A 4KLEA 2MKHA 5LMUF 5A76A 1SXEA 3M2VB 3IM1A 2K4HA 4QWAA 5EE3A 5H9FK 1NZBA 2FVQA 2F65A 3TEGA 2WF9A 2JWKA 3MM7A 4LF9J 3TFRA 1URJA