1NKBA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after three rounds of primer extension, following incorporation of dctp, dgtp, and dttp.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkbA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkbA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkbA01
3PY8A 1K6YA 4DEZA 1Z00A 4FJGA 2P1JA 2HHSA 3Q8KA 5DBCA 5KFFA 3TABA 4J9SA 5KGXA 3V6HA 3CYMA 4Q0BA 4CJFA 1HPZA 1UA0A 3KLGA 3BQ2A 4O0JA 3T5JA 1J5OA 1S0OA 4OKKA 4FYDA 4XUSA 3BQ1A 1Z3EB 1S0VA 4OKJA 4F50A 1BPZA 4FM1A 4CEAA 3OS2A 1MC8A 1SKWA 3RRHA 3D0PA 3SV3A 2FLNA 1J54A 5KFJA 4RW9A 4Z4CA 1TKXA 4IRCA 3IHQB 8ICZA 3M8QA 3OGUA 2PFPA 3C2LA 3K58A 3RB0A 1YVUA 1UT8A 4W5QA 4HHTA 1F21A 4HCBA 4RQ7A 4K4GA 5JS1A 5D49A 2DFLA 2Y1IA 1TVAA 1TK5A 1IG9A 3LAMA 1JLEA 3KLHA 4J9PA 2YNFA 4MQ3A 5J2IA 4GLXA 1BGXT 4EEYA 1BCOA 2GBZA 1WAJA 9ICLA 4Z4FA 3MR5A 9ICAA 4DL5A 1XU4A 3ZSVA 4E3SA 1SL1A 7ICMA 4KN4A 4DTRA 5J0OA 4ECYA 1QTMA 4Q45A 5E41A 1ZQZA 5KG1A 2NRXA 4CJKA 1ZQGA 4O55A 1ZQKA 1C1CA 4CJSA 2AJQA 4QW9A 3RJKA 3LZJA 3SUOA 2BCQA 4RT3A 5DK5A 9ICNA 2PFOA 3AA2A 1S10A 4O3SA 4TSXA 3ZSZA 2YNHA 4C8MA 4M04A 2ISOA 4E7JA 4FBUA 2I1QA 2B5JA 4CFCA 2ZTEA 4B9MA 3SI8A 4UB1A 4OJRA 4FJ5A 4OKEA 3VQDA 5D3GA 3HVTA 1ZBIA 4F5RA 1GOBA 4DL7A 3ISCA 3AO1A 3QEXA 4E1NA 4KV8A 1NJZA 3JPTA 4KAZA 2BPGA 3RMCA 3KLFA 5CYMA 5BOLA 3MXJA 3B0YA 1HYSA 3CFRA 4RW4A 3G6XA 2A1JA 1ZYQA 4ELTA 2F1HA 5KFRA 9ICSA 3AVFA 2IHMA 4CHPA 3MFIA 2G8IA 1RNHA 2D0AA 4IQVA 1RCHA 4FLWA 4GW6A 4QZCA 3EWAA 4FJNA 4HCCA 1O1WA 2YKMA 5KFMA 4PY5A 4Q44A 3C1YA 2FPKA 5KFQA 1BHLA 4B9VA 3K2PA 1RBUA 4E7LA 2DFHA 1ZQHA 1XI1A 5KFIA 1S1WA 2P66A 4FJKA 4CHZA 4KHUA 9ICFA 3AA4A 2G8FA 2KFNA 1IM4A 4DFPA 2G8KA 4G3IA 4FM2A 3BQTA 4YVZA 3SQ2A 4CJEA 4QWCA 4RNOA 4I7FA 1ZQSA 3NFAA 4LSNA 4CGJA 4F3TA 4K4IA 2BR0A 1RXVA 5J0SA 4J2BA 5DLFA 2E4LA 4RPYA 1NJYA 3IS9A 4YMMA 1S6PA 4FM0A 1S9EA 3JPOA 2GV9A 4GVMA 4J2EA 3V72A 4FS1A 2XGQA 3H4DA 2OYQA 1H38A 1KLMA 5EOZA 5J2EA 4P2HA 9ICKA 5BOMA 5DQGA 1ZBLA 1TAUA 4ELVA 4DTNA 3OYHA 1ZJMA 3DOLA 1DTTA 3S3NA 4O3NA 2ASLA 4BWJA 2R8KA 4CIEA 2BDPA 4BDYA 1CEZA 4ECTA 1BIUA 1D5AA 2IS3A 4LSLA 2XRIA 3ZDCA 4J9OA 8ICJA 2VA8A 4LD0A 4KLMA 3V4IA 3OYEA 5KT7A 4EBCA 1LAVA 3ZSRA 4DFMA 4DS4A 4BXOB 3LP3A 3T1AA 4DTSA 1LW0A 3PUFA 2NRTA 5C24A 4M9LA 3SUQA 4QZ8A 1ZQLA 1BPXA 1WLJA 1QLNA 5T7BA 1S97A 2YHBA 2RF2A 1KVBA 3NH1A 5J0WA 3AVHA 1RTDA 2ZTCA 5HHIA 4QWEA 4DQIA 1T03A 1ZBFA 5L1KA 3UXPA 3N4MB 5J2MA 5IIMA 2AGOA 2FBYA 4FK0A 3AVLA 4Z6EA 2W9AA 1V9PA 4CFBA 1J9AA 1S9GA 5J2JA 4FO6A 5CY4A 3UPQA 4DL3A 4E1MA 3NGYA 1T3NA 1S0NA 3I0SA 5J2KA 3OJUA 1C0MA 4YD2A 1L5UA 3P83D 3QEIA 4M9HA 1JLGA 1XC9A 2ZJAA 4M6WA 3NGIA 2ZE2A 2A1SA 2W9BA 4B9NA 5I3UA 4B8CA 8ICGA 8ICAA 4YN4A 3AO2A 3PW5A 3OYGA 5K14A 3AO4A 4ED1A 2Z1IA 1VSDA 4HYKA 1VK0A 1Y88A 2BE2A 3RAQA 4FW1A 4G1QA 4AHCA 4QWAA 3LP1A 3K5MA 3RAXA 4QZHA 5D46A 3O3GA 4NLNA 4GXIA 4JLHA 3TAPA 1JLFA 4QZEA 1ZQDA 2G8VA 4F4WA 1TKDA 4GXJA 4KHYA 1HYVA 3RMBA 3AVKA 4R8UB 3C94A 4GXKA 1K1QA 4RNNA 4CIGA 2RKIA 3WNHA 2B6AA 2PYLA 2OZSA 4I2AA 1RYSA 9ICIA 3OYAA 3H08A 1WCNA 3G10A 3LDAA 2HMIA 1CLQA 4CF1A 4PH5A 2WONA 5CWRA 2ATLA 4OGCA 4CGDA 1ZETA 5CB1A 3V9UA 1NKEA 1RT1A 1WN7A 3AVGA 3ZD8A 4J9KA 2HVIA 4BE1A 5KG7A 4DU3A 1ZQXA 3HYFA 4ECQA 4F91B 5KT2A 2R8GA 3T3FA 1I39A 3M9MB 3HK2A 2BCUA 8ICHA 1U45A 3L2VA 4B3OA 1JL1A 2BGGA 7ICUA 2VG7A 2HW3A 1S5JA 1FKOA 2X6SA 3M8SA 5TZVA 4FJ7A 1J53A 4JV0A 4FJ8A 4MF2A 2OA8A 2F8SA 9ICJA 1TAQA 4XQ8A 4B08A 3NDKA 1S6QA 4DS5A 5KG0A 3GV8B 3OS0A 5CR0A 2RN2A 2JZBB 7ICFA 1L3TA 5J2PA 5KFKA 5DDMA 1EETA 4FJXA 4QWBA 2EX3A 4RQ1A 3QINA 4KO0A 2YV0X 2C28A 1A77A 4QOZB 1JIHA 2VA3A 1BISA 3LPUA 1A5WA 3TANA 1HRHA 4LVSA 4CGFA 3VQAA 8ICTA 1BVSA 1QSYA 4O3QA 2XO7A 4KTQA 4M2YA 4CECA 3K4GA 2YNIA 3V7KA 1KVCA 3WNGA 4HVJA 4CK1A 2OPSA 4O9MA 4Z4HA 2XHBA 3SUNA 4DTXA 4I2FA 5J2HA 4O4GA 4CEBA 3C21A 1B9FA 1ASUA 1NKBA 4DL2A 4PHDA 3NF8A 1L3SA 1BPEA 5J0PA 3PO5A 4CJRA 3MAQA 3HPHA 4QWDA 3RWUA 4M47A 4BACA 1BI4A 5CP2A 2XGPA 5C5JA 3C5GA 3RBEA 1KEJA 4UB4A 2ITGA 2KZ3A 2VA2A 4DU1A 3VQCA 3K5NA 4ED3A 3DLGA 9ICRA 8ICOA 4Q8FA 4IR1A 3VQ8A 3Q8LA 5FDLA 2KZMA 4W5TA 4I2CA 5J2NA 2BHNA 1XSPA 4RPZA 4YP3A 3RRGA 2JLEA 1NK4A 5J2QA 3NGDA 1U9LA 3DRRA 4PGYA 3V81A 4FJJA 4KLOA 8ICWA 4CERA 1S76D 4CIFA 7ICIA 4M45A 1IKWA 4TUSA 3AVIA 3RB4A 5EU7A 3KTQA 5L9XA 3KK1A 2FBVA 1KRPA 2FMSA 1NKCA 3CM6A 5HRSA 3N97B 3ULDA 1KCFA 3B6OA 7ICHA 3ORYA 4M0AA 2JEGA 8ICLA 1S1TA 3U3GA 4YD1A 5HRRA 4O5EA 2G8WA 7ICPA 1RTHA 4GC7A 5DG7A 1HJPA 9ICUA 1RILA 2HHXA 3H8WA 3F9KA 4ED0A 3V6KA 4B9LA 3L8BA 2ZUCA 4O3PA 4ID1A 1JL2A 2HHWA 2ASDA 1G15A 3B6PA 4YR2A 3VQ5A 1UWBA 4F8RA 3HP9A 5KT5A 4NYFA 1HNVA 2QKKA 4RZRA 4YMOA 4AILC 5KRTA 5DG9A 3LWMA 3ASMA 4N56A 3TAEA 5JS2A 3K5OA 4I28A 4YR3A 1FKPA 3TWHA 3TFRA 2BQUA 2Z1HA 2PI5A 4KLIA 1ZQUA 1NOYA 1ZQFA 1BL3A 3TAFA 5IIOA 4XA5A 2I5JA 3QZ7A 4EZ9A 3KJVA 1RDBA 1BPYA 4YR0A 4I2EA 3ISDA 2XCPA 4MFFA 9ICOA 1WSJA 4FLXA 2WTFA 3HVRA 4CF8A 3V7JA 4KLSA 4DF8A 1BPBA 3AO5A 3WNEA 1NOMA 3UQ2A 3E2EA 1HUZA 3ITHA 3UIQA 9ICEA 3AVCA 1CZBA 3MFHA 4F4KA 4MFBA 8ICKA 4O5BA 4YNQA 4NM2A 4I2GA 4NLZA 3GILA 1SKSA 4FBTA 3MEDA 3VQ9A 4PPXA 3TI0A 2OWOA 3MEGA 3LALA 4FLTA 4DL6A 1N6QA 5DB9A 2XC9A 3FFIA 2B21A 4ZH4A 4QZDA 3K5LA 5J0UA 1X9SA 3SCXA 3ZSWA 1NK0A 2ETJA 3ZT2A 9ICPA 1C0UA 3RMAA 1WCLA 4IRKA 2G8UA 4UQGA 1EX4A 3JYTA 3QEBZ 4EYIB 2OPRA 4RU9A 2J6UA 1GOAA 4CEDA 5KFZA 3V9SA 3ZT3A 1NK6A 4UAWA 2PFNA 2F8TA 4DQSA 5DGAA 5KG2A 4QZ9A 4QZGA 4DSIA 5KFOA 3GFKB 3LK9A 4KPYA 2GWSA 3Q8SB 2V4QA 2ATQA 2ZJ8A 1RTIA 4OVLA 1TL1A 4PGQA 1NK8A 4B9UA 4F5PA 5KFAA 4NLKA 3ZD9A 1DTQA 2DPIA 7ICGA 1Q9XA 4ECSA 2LYHA 2VWKA 3G6YA 4CEZA 1D8LA 5HP4A 4FVMA 2NRZA 2ZQBA 3GIJA 4RQ2A 3HJFA 3C2MA 3V1OA 3GIIA 4I9LA 3PX6A 4KLFA 4IRDA 3NHGA 3PW2A 4BDZA 4TQSA 4Q43A 1KFDA 5KRSA 4F5QA 1ZQCA 3MECA 3VQ6A 1VSJA 2V4RA 1SL2A 2HB5A 4DQPA 3LAKA 3HWTA 1VRTA 3TAGA 4YFKA 9ICBA 2E6LA 4JV1A 4CK3A 3AU2A 3QE9Y 1PZNA 4GC6A 4DLEA 4M41A 1ZQAA 3NH0A 4P4OA 3ZDDA 3EYZA 2FLLA 4CFDA 4M3YA 4DFKA 4OLAA 5DBBA 3ZSYA 3DLKA 4PWDA 5CA7A 2R8HA 5L1IA 5DMRA 4EYHB 4DTPA 3O4NA 1EXQA 2PY5A 4CJTA 2F1IA 2X74A 2MUTA 4OPJA 3IAYA 2RDIA 2PYJA 2WOMA 2ZUBA 3BGRA 4HTUA 4R64A 4YCXA 1T05A 1JLCA 1HJRA 1T8EA 1ZBUA 3GQCA 4MF8A 3L2WA 5DLGA 4KB0A 1HQUA 4PHAA 3CFPA 5J29A 3MR3A 2FMPA 4KRFA 2AU0A 5KFHA 4UAYA 1EKEA 2IAJA 3NH2A 3L2UA 5HP1A 7ICLA 3WNFA 3I8DA 1DLOA 3LZIA 3MXIA 1JLAA 2I9GA 3ZDBA 3OHBA 1YTAA 4OPKA 1ASVA 4RT2A 4NXZA 3L2RA 4MEYA 3CFOA 3JPSA 3OVNA 4EBDA 4DF4A 2BQRA 1SV5A 3OYDA 4EBEA 5FRNA 1NK9A 3S3OA 4B9SA 4DOAA 3BQ0A 5KFTA 1VSKA 1AROP 3RH4A 1ZQIA 4KTZA 2DFFA 1VRUA 2DTUA 1RT2A 3RH6A 4UBBA 1HMVA 4M3ZA 3KD1E 3C6TA 4E0DA 1BIZA 4BE0A 1L3UA 3TARA 4W5RA 5HHHA 4O0IA 1CXQA 2FMQA 3EY1A 3OJSA 4CHQA 5FROA 4K8XA 2Z1JA 2P51A 5KT3A 4M3UA 1RXWA 3AUOA 3V6DA 1KLNA 2IMWP 2QKBA 2W9MA 3VQEA 5CZ1A 1LV5A 4FZXC 4Z4EA 3MXMA 2P6UA 4RQ0A 4DFJA 4ECZA 4N47A 1TL3A 1ZQVA 4DTUA 5J0RA 2H5XA 5BPCA 3KKRA 4RG8A 3IRXA 3K57A 1KVAA 1RT5A 2A1JB 4RUAA 4JV2A 3MR6A 1N5YA 4P4MA 4IDKA 5KFSA 3V9XA 3T5KA 3VN5A 1VSLA 4CGGA 1IO2A 3ETLA 5KG4A 4Q5VA 3V9WA 1IKXA 1L3VA 2BCSA 2JEIA 4FLYA 4KFBA 3EZ5A 5KG6A 1Y97A 2IGIA 3PVXA 1K1SA 2HVHA 4PHEA 3I0RA 3T19A 2PZSA 2KW4A 3OSNA 1HQEA 3RJIA 4IFYA 4KLEA 2HNZA 4BE2A 3FYHA 5EWEA 1U04A 3L2QA 1S1UA 3OYCA 2C2EA 4JWNA 2O4IA 2J6SA 3RBDA 1KFSA 3NBPA 2UVRA 2A1RA 1RBSA 4Z0UA 7ICRA 4DTOA 4CJ4A 3QIPA 4QZFA 4FLVA 2NRWA 2HNYA 1QHTA 4BGDA 3KK3A 4Z6FA 2BPFA 3SV4A 1W0HA 4CEQA 7ICOA 4E7KA 1XWLA 4IQTA 1WSIA 3SNNA 1A5XA 3PMLA 4UBCA 1IH7A 3V1RA 5J2GA 1RBTA 3DLHA 3UXOA 2IDOA 2RPIA 1ZQOA 3OYFA 8ICPA 3JPRA 3MR2A 4R66A 2IOCA 3EPGA 3G6VA 1KSPA 4I2JA 4FLZA 1U48A 4F5OA 2G8HA 2NRVA 4FZZA 9ICCA 3H40A 1A76A 1WSHA 4CJ3A 1S9FA 3RJHA 4CHYA 3RR7A 3PMNA 2QXFA 5DQIA 2KN7A 3AVJA 4I9QA 3PX0A 1N48A 4NLGA 4O3OA 3ZCMA 2W8LA 9ICWA 1ZQBA 1RT3A 4I2HA 5EWFA 4XRHA 3DRSA 2ALZA 1LAWA 3KD5E 1KFTA 3Q8PB 1VSMA 5DB6A 4CF9A 4YXMA 3CG7A 3OYKA 2JEJA 3LPTA 4KHWA 8ICMA 5C25A 4UB5A 4DTJA 9ICTA 5I42A 3MGHA 1RT4A 2JEFA 1HUOA 4Z6DA 1BQMA 4RQ5A 1RT6A 4OGEA 3OYBA 7ICJA 3QO9A 1NOZA 3GIMA 1MU2A 2W9CB 3NGZA 4CJPA 4H8KA 4CJLA 5J2FA 3DMJA 1XSNA 3QEAZ 2ZJ5A 3L3UA 4YMNA 3PV8A 5IIJA 4HUGA 3CM5A 1N56A 7ICEA 5KFPA 2Z1GA 3NCIA 4FXDA 4IG3A 5KFEA 4KHNA 3MABA 3M8RA 4M6WB 2YKNA 3H7IA 4YQWA 2W9BB 5CYQA 3G0ZA 1ASWA 2PFQA 1JLQA 4ECXA 9ICHA 2IBKA 3DYAA 4IG0A 4KLGA 4NCAA 5KI6A 4I29A 5DBAA 3QEVA 3C1ZA 1LWCA 4DG1A 3KHRA 5HMLA 2XY6A 4ED6A 1ZQEA 3GDXA 4DSKA 1A5VA 1B9DA 4RQ3A 1Q8IA 3C95A 3K75D 4AHSA 3DOKA 9ICQA 1VSIA 1TFRA 4RNMA 4LY7A 2LSNA 3MEEA 3M9OB 3C6UA 3O3HA 1HYZA 4CHOA 2P5GA 1D8YA 3RTVA 3D45A 3QNNA 5KFDA 2AGPA 3HSTB 3ZSXA 7ICSA 4KI6A 1VSEA 4GMJB 5L1JA 4F2SA 3TFSA 2C2RA 8ICRA 4CGIA 4J9MA 4DLGA 3KK2A 4R65A 2JGUA 3S9HA 3ZSQA 1ZQTA 3DLBA 1C1AA 3LP2A 2KTQA 4FK2A 3U6FA 1X9WA 2BCRA 2R7YA 4AH9A 3RB6A 1I3AA 2FC0A 4KREA 2PXIA 5KFXA 1NJWA 4KITB 5HRPA 2UVUA 1TK0A 4B9TA 4KLTA 4QZBA 5HMMA 1X2IA 4R5PA 5HROA 3VA0A 3SJJA 5J0YA 2XCAA 1U47A 3V7LA 4QAGA 4C8KA 1LW2A 3HT3A 4MEXA 1C7YA 1REVA 4M3XA 4H4MA 3CQ8A 7ICTA 4FK4A 5J0XA 4EP4A 4QW8A 4J9LA 4NYNA 3SUPA 5J2DA 3Q8MA 1B92A 4N41A 1XO1A 3RMDA 2IC3A 3L3VA 4CE9A 4KTWA 1D9DA 3KIOA 3FDSA 5JUMA 4CF0A 4FJHA 9ICXA 4J9RA 4M9JA 1FXXA 5DG8A 3MDCA 1Z25A 7ICKA 5IIIA 2KQ2A 2DY4A 1QSSA 3RJGA 3KHGA 3OYIA 3EPIA 2IA6A 4E7HA 1ZJNA 4TURA 3LWLA 1MSWD 2HHUA 3C23A 2HHQA 1HNIA 3C2KA 2R8IA 3PW7A 2EHGA 1RDAA 2IHNA 4JS5A 1BI4B 2P6RA 1CUKA 5J0QA 3HPOA 4C8OA 3E01A 2D0CA 1T4GA 1RYRA 2AQ4A 1S0MA 1LB2B 2R8JA 4CHNA 3ZT4A 5KT4A 5J0TA 4FZYA 1JLBA 2OZMA 3M8PA 1TVRA 1NJXA 1JXLA 1CZ9A 2D0BA 4LH4A 4B8AB 2M9NA 2B4JA 5SWMA 3PX4A 1EP4A 5FRMA 4Y1CA 3RJEA 3LANA 3H8JA 4KI4A 2AQ0A 3K59A 4O5KA 4IFVA 3DLEA 3LDSA 5HNKA 3PW4A 1S1XA 4CGHA 4BWMA 3P5JA 3BJYA 9ICMA 4J9QA 4KLDA 5KFUA 4BXOA 1TV6A 2O4GA 4AHRA 1TKZA 3VA3A 4J2DA 5HLFA 2PI4A 4FCYA 3OYMA 1U49A 4CCHA 3NAEA 4HUFA 3SQ4A 3ZT1A 3VQBA 3THVA 1EXNA 3HL8A 2FBTA 4ZTFA 5KFVA 1SUQA 4DSJA 4DU4A 2X6NA 3AV9A 2KFZA 5IIKA 1RDCA 4F5NA 2BKEA 3HW8A 4CF2A 4F2RA 3EW9A 3JPPA 3QETA 4ICLA 1ZQQA 3OYJA 3H4BA 3C5FA 1Z26A 2VG6A 4F3OA 1Z00B 3DRPA 1ZBHA 1DGSA 3OYLA 4DOBA 4YG2A 8ICVA 2NUBA 1JN3A 3TQ1A 2KZZA 2XY7A 4ELUA 1JXBA 4MFAA 3H8SA 4NY8A 1T7PA 4AHUA 1NK5A 1WSEA 4TUQA 3ZSOA 2V9WA 4DQQA 3Q8RB 4O44A 1BQNA 3HXMA 3PR5B 3KHHA 5F9LA 4CK2A 4FJLA 4C8LA 4PA1A 3ISNC 3UQ0A 4E19A 4CJWA 3QLHA 3VQQA 3PR4A 1ZQMA 2UVVA 4BDPA 4JS4A 2ISPA 4FLUA 4I2QA 2ASJA 2HNDA 1XHZA 3RR8A 5EWGA 4E7IA 4O3RA 3M9NB 4ED8A 2FBXA 5L1LA 4R8UA 4DWIA 7ICNA 3GIKA 5J2CA 4ECUA 4KLQA 2W42A 2Y1JA 1IKYA 1BCMA 2MAXA 1LWFA 3QEPA 3NF9A 4PGXA 4LZGA 3RJFA 2DPJA 1ZQYA 1VSFA 2OPPA 4Z6CA 4I2BA 3DI6A 4LH5A 5D4BA 1D9FA 1RZTA 3NTUA 5J1EA 5KTQA 3U3YA 4EP5A 1C1BA 5CZ2A 7ICVA 5KFWA 5F9NA 4J2AA 1QE1A 4NCBA 2HHVA 1YTUA 4I27A 4AHVA 1X9MA 5IINA 1TKTA 4Y1DA 1JXEA 4DSEA 4RW8A 4RQ4A 1U4BA 4QCLA 3NE6A 4KKOA 4OLBA 3OS1A 2JZBA 2FLPA 1KTQA 2BCVA 3BDPA 3VQPA 5KT6A 4DOCA 3OY9A 1ITGA 1XS9D 4CJVA 4DQRA 3GV5B 3OSPA 3V1QA 4M3TA 3TR8A 5KGWA 3AVAA 1B22A 4CJQA 1FK9A 2Q3SA 4K8ZA 3RH5A 5HRNA 3HPGA 2QK9A 4R63A 4PHPA 1TK8A 4YFUA 3O4QA 4IBNA 8ICYA 4H4OA 4AHTA 3MBYA 4EZ6A 1SZPA 5DDYA 5KFGA 2W9CA 3SPYA 3T5HA 3AVBA 2XY5A 1BPDA 1XHXA 1QS4A 4KLLA 1X1PA 4M3RA 5CJ7A 3DM2A 3QERA 1MQ2A 4ECVA 1C6VA 3AVMA 1Q9YA 1QSLA 1ZQNA 3ISBA 2BPCA 4UB3A 4RW7A 3JSMA 1TV9A 4ZHRA 5KFBA 3JPQA 1XSLA 1NK7A 4KB1A 2ZD1A 4UAZA 4N76A 4P4PA 1WNSA 5DB8A 2MUTB 2RDJA 4KLJA 4JRQA 2BGWA 1WSFA 5KFYA 4JK1A 3SYZA 2DFEA 5IILA 2VANA 4CJ5A 3AVNA 2C22A 3NF7A 4LZDA 4DSLA 4F92B 3QESA 1S1VA 3MGIA 4N5SA 2UVWA 4Z4GA 1UT5A 3PW0A 1R0AA 4WE1A 3DLRA 5SZTA 2YNGA 4IKFA 3UXNA 1SKRA 4KHQA 4IR9A 8ICIA 4M42A 3ZT0A 4J9NA 4M9GA 8ICUA 2YHAA 2VG5A 4CJUA 3B0XA 3PNCA 1RPLA 4QZIA 1SL0A 8ICQA 1LWEA 5J2AA 4RUCA 3AO3A 3IM1A 1CXUA 3NF6A 1JMSA 4RQ8A 2BQ3A 1QQCA 1RBVA 3ZDAA 9ICGA 4DSFA 1TGOA 2ZUDA 4CEEA 4DMNA 4PQUA 4IQWA 4E89A 8ICCA 3KLEA 4F93B 4KHSA 4ED7A 2FPLA 4FJMA 5KFCA 4CESA 1RBRA 3QIOA 1KDHA 3KKSA 8ICFA 4DO9A 1W9HA 2BANA 8ICXA 1S77D 4F4YA 2F1JA 3KHLA 4RW6A 4CFAA 5DB7A 1UAXA 3HX0A 3T5LA 1ZQWA 4Q8EA 1VSHA 2E6MA 1WAFA 2Q0ZX 4C8NA 4JUZA 5J2BA 1ZQRA 3RB3A 3MDAA 3O3FA 1RDDA 4FS2A 3SPZA 5CHGA 3VQ4A 3HM9A 1JX4A 4DL4A 3ZDEA 4ZTJA 4FJIA 3QEWA 3QNOA 3GV7B 5DKWA 4MFCA 4I2DA 1YT3A 5KFNA 3SQ0A 1WSGA 1IXRA 3S3MA 5KG3A 4DTMA 4O5CA 2P5OA 4M3WA 3SZ2A 3KLIA 5KG5A 8ICEA 2FPMA 2J6TA 4RPXA 3P1GA 4QZAA 4UB2A 5DQHA 7ICQA 4HUEA 3F73A 4ID5A 2X78A 1UOCA 3AA5X 3HO1A 1ZQJA 4CEOA 8ICNA 3TAMA 3JPNA 4XIUA 5DGBA 3TAQA 2GUIA 1IKVA 4W5NA 1RT7A 2ZTDA 4ECWA 3VQ7A 3AU6A 4KN7A 4JRPA 9ICVA 4CEFA 1DOQA 2VWJA 4IQUA 3IG1A 5C42A 2AGQA 4YXJA 3Q8QB 4F4XA 8ICSA 4FW2A 2XY8A 4I2IA 4X5VA 4K4HA 3OHAA 3SI6A 3SQ1A 3ALYA 1UA1A 4PUOA 4F4ZA 4M9NA 3QZ8A 1C0TA 3V9ZA 2HHTA 1RTJA 1GOCA 1COOA 5KFLA 8ICBA 4TUPA 3PO4A 1MQ3A 2W8KA 2OPQA 2D5RA 4ED2A 2C2DA 4KLHA 1JKHA 4KMUA 5HBMA 4JWMA 4TQRA 4I2PA 4RQ6A 3AA3A 4FJ9A 1ZQPA 4Z4IA 4NCGA 4KLUA 3HP6A 4L8RB 3V6JA 3LP0A 3OYNA 4W5OA 4NM1A 3RJJA 2F96A 3A2FA 4ECRA 1B43A
chains in the Genus database with same CATH superfamily
3PY8A 4MIBA 1IBMF 1K6YA 2V52B 3K0JA 1KXPA 1B64A 5KQDA 3Q8KA 5DBCA 5KFFA 3AQOA 5D15A 5EE9A 1BA0A 1NAQA 3CYMA 2OMOA 4UZCA 3CJQA 4Q0BA 1UA0A 3BQ2A 4O0JA 1U1KA 1J5OA 2UYTA 4XUSA 3MMBA 3FCWA 3KG4A 2HLUA 2A19A 3K2YA 3D1QA 1Z3EB 4OKJA 3TJ8A 1U1NA 1KKHA 4FM1A 3RRHA 1SJFA 1ZBTA 3CMQA 3SV3A 4PKHA 1J54A 3JSBA 5KFJA 4RW9A 3IHQB 2UUAF 2PFPA 2CPJA 3C2LA 3TX8A 3K58A 3MOZA 1EKRA 1RM6C 4RQ7A 2FVSA 3U27A 4K4GA 3CJ0A 3PJXA 5JS1A 2J7UA 1FFGB 2UXBF 3DMJB 2Y1IA 1TK5A 2VPYB 4K5RA 4QJFB 3F0NA 2P9IA 4OZ2A 1JLEA 4BG8A 1MLAA 4J9PA 3P5BP 3U9DA 5L1MA 4M5IA 9ICLA 4IEIA 2WSEC 2ZIXB 1ILYA 3N9UC 3ZSVA 3MD3A 4YUDA 3W8GA 4CLUA 3AH6A 2PC6A 1JNRB 1Y3KA 1RDRA 4ACOA 3GYXB 5GAHU 4ECYA 1JLQB 4WFAQ 3EXYA 3NG8A 4Q45A 4IOAL 2K06A 1Q53A 3QJJA 1VJ5A 4DG1B 2NRXA 3ED5A 1XR6A 4O55A 4WYBA 1C1CA 4CJSA 3SUOA 4RT3A 5DK5A 4K4WA 1NUEA 1UVIA 1NH8A 3ZSZA 1NGFA 2HRYA 4BR7A 4M04A 5E3AA 1EQMA 1GMUA 4FBUA 1ZZFA 4ZPVR 2V63A 2Q43A 4NLUA 1BQXA 5F3XB 4UB1A 2HAIA 4OKEA 3WKCA 4ZLNA 3WEEB 1PVRA 1ZBIA 5CZXA 1DHMA 4B9QA 3BYRA 4JNEA 1DBDA 2E5JA 3CJ8A 1VQNS 4K41A 3CF5L 1IWAA 4AL6A 2MGZB 2CJQA 2XMKA 2OFGX 3KLFA 5CYMA 5BOLA 7AT1B 4IDHA 4AQYF 4MHVA 5AZJB 1O8BA 3HHKA 4UOHA 4UW2A 2HFNA 2CZ9A 3O5BA 2OFHX 3WC2A 3C14B 2F1HA 5KFRA 4B1VA 2J7KA 3MFIA 1N8RT 2G8IA 2MYFA 3PTWA 4NLTA 4US8A 1NSAA 2CPXA 4MAKA 5T7LA 1FCAA 4HCCA 3MX5A 3K8WA 1O1WA 2NYVA 5KFMA 1NB7A 1OSCA 1E6YA 4B9VA 3K2PA 2M9KA 2DFHA 2NREA 1WOQA 1ZQHA 3C0BA 4FJKA 1MWMA 3B8AX 2CGKA 1YZ6A 3CCRN 2G8KA 3OW2M 3BF4A 2WAQD 2MPUA 3EL2A 5D77A 3R9LA 2VQFJ 1DJ0A 3SQ2A 3CC7S 3ULEB 4RNOA 3NFAA 1Q82O 3THWA 4V19S 4K4IA 3A13A 5DDRC 3G82B 2GIQA 2WAQF 2GVDA 3IS9A 4YMMA 1S6PA 3ZETA 3QBCA 4CZJA 4K4SA 2GCFA 1HI0P 3Q7CA 2LLZA 5K4LA 4GVMA 1NU4A 4D3GA 1YTYA 4J2EA 4HACB 3E01B 3QBXA 4CYUA 3V72A 3U1NA 2XGQA 2KE7A 2OYQA 2LFVA 1X6JA 2G2OA 2XIDA 2DBBA 1JB0C 4CZLA 2F44A 5BOMA 1C0UB 5EE1A 5DQGA 2FHJA 2RQ4A 1TVRB 3RJMB 4GVEA 1Q7LB 3OD2A 3VAJA 3SD7A 4Y65A 4KGZB 3S3NA 4ZLPA 2ACYA 4P6QA 2IS3A 4IFVB 8ICJA 2JR5A 2EPIA 2OTLN 3OYEA 3R1HA 1Y4ZB 2ZVSA 2PFUA 4PKGA 4EBCA 1LAVA 1TV6B 1J97A 3T1AA 1JQGA 4DTSA 1TKZB 4RQNA 3MN6A 4JYAF 1Y5LB 4M9LA 5HLFB 1U1OA 3IR7B 1BPXA 2F8HA 2K2PA 4UOGA 2Y1LB 2D3OR 1NDCA 4KH6A 1C20A 3EDRB 5J0WA 3AVHA 2K8GA 2CNKB 1ZBFA 4OI4A 3NWRA 3UXPA 4CLSA 3QAUA 4LF6J 1KOOA 2XG8A 4I64A 4PWUA 3RRKA 5F0UA 4WYLA 4ICLB 2W9AA 1V9PA 1S9GA 4WFNL 5J2JA 5CY4A 3UPQA 1N34F 1YBUA 3NGYA 4WK1A 2DR5A 1GX6A 2V4JB 3RZAA 3KKAC 3QEIA 3KG0A 2QTDA 4M6WA 4DPUA 5LJVA 4JI8K 1ZRMA 2A1SA 2K4IA 3DXSX 2FB0A 3H0RB 4NRUA 4OL8A 4OPHA 4ZA1A 1H2UX 1GAOA 3CUNA 1PYOB 3W8PA 3D7EO 3AO4A 4ED1A 1UWAA 2MQOA 4IOXA 4M1KA 1Y88A 1YJUA 4DV3K 3BH6B 3AQFA 4DV6K 2WOMB 1IBMJ 4I6YA 4I6AA 1IG8A 3BGRB 2JFDA 4FXWA 4QZHA 1T05B 4HTJA 2MKCA 4USKA 2KV2A 1Q7YT 2G8VA 3VGMA 4JI2K 5HN0A 1HQUB 2ZH1A 3BS5A 1SPBP 1TKDA 4R8UB 4GXKA 5K8OA 5A8KA 1RYSA 1ZM4A 2F4FA 2KN4A 3H08A 4JD2B 1LWFB 4YB6A 2BJ1A 4A61A 2HMIA 1CLQA 2WONA 3GB0A 2UUAJ 4CGDA 4NZ6A 3DI6B 4ZITA 3U7JA 3B4MA 3C29A 4ANDA 4J9KA 3RSEA 5KG7A 4DU3A 4X4UA 2PFFB 1ZQXA 5THWA 1HNWF 1H2TZ 1WWHA 4JBCA 2R8GA 2IBOA 4ZCLA 3FM9A 5M2RA 2ZJRL 3M9MB 3FBEA 3P38A 2KJ8A 1JCEA 4OZ3A 1BU6O 3D0GE 3HI0A 1HA1A 2BGGA 3M6WA 4X4PA 2HW3A 2KHDA 2RE1A 2X6SA 4RW8B 5TZVA 4JV0A 2VKQA 3BS9A 2F8SA 1TAQA 2N4DA 1WHVA 5EN1A 1JXVA 2E7VA 4ZJQA 3TZWA 7ICFA 3J7A1 4JB8B 4ZN1A 2HMPA 5J2PA 1EETA 4B3RF 4FJXA 2YV0X 3OFGA 4DBQA 1JIHA 1BISA 3GCWP 1YITN 4Z94A 2E2NA 3TANA 4LVSA 2BVZA 3VQAA 2Z2ZA 1SH3A 2HGMA 4M2YA 4YDXA 4CECA 2ZIUB 1XQIA 1X4HA 1T9VA 4WP8A 4I2FA 3KWGA 4CEBA 3C21A 1YAGA 1B9FA 5HJXA 2E1FA 3NF8A 1FE0A 1DFDA 1ZS6A 5J0PA 3MAQA 1HKCA 3RWUA 3IRUA 1CC8A 5CP2A 1MNEA 5HL7L 2F7TA 3C5GA 5B0FA 3W63A 3FSYA 3H8MA 1M1HA 2VA2A 2OP5A 3EGVA 4AE5A 2FI1A 4ED3A 4DN0A 3K5NA 4QS9A 4RW7B 2EFQA 3JSMB 4IR1A 1URRA 2DBYA 5AI4A 2KZMA 3VVTA 4DV7F 5J2NA 2BHNA 1Z4OA 2HPUA 4QR0A 3RRGA 5IOLA 3NGDA 1X4EA 4GIBA 2NCKL 3DRRA 1Z6RA 4I68A 1PO6A 2HNZB 4CERA 1LFWA 7ICIA 4CZEA 4M45A 3KNAA 1IKWA 1R0AB 2QWMA 2AH5A 1L7NA 3AVIA 3MWBA 2Z7JA 1P7DA 3KTQA 5L9XA 2FBVA 2L48A 3O5TB 2ZKTA 2JC0A 2FMSA 1NKCA 1TL7A 4U8VA 3CM6A 3N97B 2VDHA 3ULDA 5IC6B 2GJIA 4M0AA 1S1TA 2Y0BB 1LK7A 4ZVTB 5IT9U 4HT5A 3U3GA 2JWLA 3HD2A 4MK7A 4LF5F 1HUXA 4IXCA 1RTHA 1YGYA 5DG7A 2KNJA 3HHLC 3BR8A 4EELA 4YN3B 2AEMA 4O3PA 2ASDA 2HMXA 3QRRA 3FEYB 1UWBA 3KNGA 4NYFA 1HNVA 2ZH2A 1PC5A 4Y2CA 5AJ3F 3TAEA 5E3QA 2RIJA 1SXEA 3TWHA 8ATCB 2BANB 2J8SA 3GCXP 2DKZA 1NOYA 4DQ8A 3TAFA 2P9GA 3M2VB 3T9ZA 1RK8A 3CULA 2HEKA 1DY3A 3H5XA 2VWBA 3MI7X 4ATNA 4M5MA 1KQFB 4P2XA 4EZ9A 4C80A 3KUEA 4WKYA 3KJVA 2UU9F 2PAVA 3KWMA 2R7SA 9ICOA 1B0PA 4LF7F 3FEZA 1F2GA 1WC0A 2KH9A 3MTKA 2O67A 4CF8A 4K50A 3D9BA 1LOUA 3UPFA 1QVGR 1P8GA 2CPDA 4KGXB 1Y0HA 1CZBA 2NXNA 5K9FA 3MM8B 1BXNA 4JYAJ 1Q0NA 3VGTA 4JHDB 4RCHA 2FHKA 1CC7A 4H0OA 2WK4A 4NLZA 3GILA 1GMVA 3MEDA 1UPMB 4Y2RA 3FC9A 2APOA 3SAHA 1OH8A 3PDNA 5DB9A 1NHVA 2B21A 1JNZB 3DGPB 1DZ5A 3VWSA 4UQTA 5A76A 4USJC 4AT1B 1NK0A 5A8RB 2BEFA 5A6WA 1VQLS 1N34J 2NXEA 2FLOA 2CQHA 1RU1A 2D74B 1M90T 2KEYA 2W7AA 2G8UA 5JMNA 4UQGA 3JYTA 1QTNB 1HLWA 2ZOGA 3OV7A 1RGVA 1HW8A 3EWGA 5AKIA 5KFZA 3V9SA 2PFNA 4M5NA 3CJCA 2F8TA 3GG0A 5KG2A 1C4AA 2JWKA 2EBEA 4GKKJ 3FQKA 2XBPA 4RR5A 2V4QA 1U2FA 4OVLA 1Q78A 4PQAA 3SSRA 1C0TB 1NK8A 2CPYA 3KVGA 4Z37A 5A0YA 1DTQA 1Q9XA 4K4VA 3DXBA 4ECSA 3CIPA 1NNEA 3G6YA 2Y0SD 1RABB 2NRZA 3GIJA 2ZM6K 3SMZA 1WC4A 1MN8A 4DR1K 2KT2A 3D2FB 2E1RA 3R8EA 1S7HA 3CC2S 3KXDA 3G4SS 1N5SA 4MIWA 5KPZA 3TRGA 4ZP8A 5KRSA 4C23A 2Y0SF 5H1SV 4WFZA 5AQZA 1H2VZ 2AJ2A 3WQUA 3ID6A 3VPZA 4ITSA 1VSJA 5HROB 1T11A 2V4RA 2XZDB 3TAGA 2CJBA 2CWKA 2VQEJ 4OCZA 4CI0B 3AU2A 4NWBA 1T0TV 3QE9Y 1PZNA 3I96A 2DHXA 3NH0A 1HNWJ 4S0MA 3ZDDA 3VGVA 2FLLA 2MZ1A 1QAJA 4OLAA 4WTOB 3G71N 1UETA 5CA7A 2R8HA 5L1IA 5DMRA 1J5OB 3HM8A 2F1IA 3MMBB 3UE2A 1P27B 1HWJA 2RHFA 2IDEA 2PD1A 5BJRA 4YB7A 2CDRB 1A0PA 3UMBA 3QRQA 4RW9B 1JLCA 2W4CA 3A8JA 2MSTA 1D3WA 5HQ8A 3OTQA 5DLGA 4B3RJ 3CFPA 1FFSB 3MR3A 2FMPA 4UY8T 4CLPA 2VBXA 4EHUA 2FDNA 4UAYA 4BR2A 4Y6IA 1NBEB 3TP2A 2CZVC 1NHKL 1Y00A 5HP1A 1JLEB 4M63A 3WNFA 2LM4A 3LZIA 1JLAA 3NUQA 4K2XA 5BRDA 2MLYA 5BYSA 4OHWA 3DFEA 1BUPA 4RT2A 3GPAA 1XEZA 3CHWA 3OVNA 3SMPA 3O9SA 1SV5A 1WELA 2FPHX 3MMVA 4WXOA 3HULA 4F67A 2E29A 4TXSA 4WTYA 3QT8A 3OHRA 1VSKA 1C2PA 1C1CB 2QJ3A 4NWIA 3N6NA 3HVWA 2DFFA 4A48A 1NBWA 3VF6A 1EB0A 1T9TA 1NPPA 5B0DA 4WP9A 1HMVA 3NVKA 5K20B 4E0DA 5GINA 4DV7J 1K73O 4OJ1A 4RO0A 5HQMA 4H0TB 5HHHA 4O0IA 2KM8C 1F0MA 5FROA 1M5OC 4K8XA 5KT3A 4M3UA 1YJNS 2XSJB 1RQ0A 1H6KX 2IMWP 4WFXA 4IUFA 1NLVA 3GJTB 2V69A 2NO4A 1LV5A 1OVQA 4FZXC 4Z4EA 1WF1A 1F9HA 3MXMA 2P6UA 4RQ0A 4DFJA 4FXVA 1O13A 2DNKA 3KLFB 1HR0F 1RAFB 3CD6N 3IRXA 2QWLA 4BC5A 4KE5A 1VJWA 1JALA 1RT5A 1SC6A 2V7YA 3SDEA 4LF5J 2G9OA 2G0AA 4DCOB 3MR6A 2FGCA 1UW4A 2DNGA 4ZOHC 5G0RA 3CCEN 2FY1A 4DCJB 3AY0A 3QT5A 4LFBF 4ETZA 3DJCA 2O8FB 2ZJPQ 1S79A 1MMDA 1SXDA 2VJ5A 2ZG6A 1E6YB 3WIUA 1K1SA 4CZCA 3JXOA 5LL6d 4B3MF 3GDQA 3I0RA 1QQNA 4DKWA 2PZSA 4C11B 1SKUB 1FWKA 2XLIA 3T6BA 1RCOB 4IFYA 1GLFO 4KLEA 4DUZF 1IKYB 1NM1A 1U04A 1PYTA 3H20A 3Q8YA 1ZAWA 4JWNA 4CF3A 1QQ7A 4H4KC 4V1Ak 1KFSA 4LF7J 2DQNB 3NBPA 1LEOA 3CCQS 2W4DA 3NCPA 4CJ4A 4QZFA 2Z0GA 2YJEA 3IS9B 3JS6A 1S6PB 3GONA 3ZETB 4BGDA 5ALKA 4EK2A 2BPFA 2Q79A 1ZOLA 5GADU 4FPAA 1WSIA 2BRLA 1J5EF 2DR7A 1A5XA 4B3SK 1MROB 4CDIA 4FOIA 5J2GA 1RBTA 3DLHA 3ZNJ1 2GHVC 1ZQOA 3OYFA 3JPRA 4CF5A 4R66A 2YX6A 2FF3B 2MJNA 1KSPA 1NH7A 2KB2A 5A2QU 4FLZA 2IVYA 5TKWA 2NRVA 1SJ4P 1Y11A 4PHTX 3I56S 4FL9A 1HJOA 4CHYA 2QXFA 4MYUA 3AVJA 2K1RA 1FDAA 1ZQBA 4I2HA 2K8CB 2ALZA 2IM2A 1VK8A 3KD5E 5DETA 4FZMA 2GWKA 3AMZA 4CF9A 4YXMA 4FYVB 3OTEA 1U2RA 2GX9A 3CG7A 3LPTA 1KC8O 4C0OC 5AQXA 2OEKA 3VGUA 1DARA 5IT9O 3EMTA 3QATA 1HUOA 1BQMA 4ES3A 1DGKN 4OGEA 2NS1B 3SBGA 4H4OB 3QO9A 1G2EA 1NOZA 1MU2A 2W9CB 4ZVOB 4CJLA 4X62F 1GLJO 1XTZA 3CCLN 1S9GB 1WEYA 4DV1K 4YMNA 4USMA 2BJ8A 3CM5A 4HUGA 1N56A 5AK6A 3D6RA 1XMOF 5KPTA 2XS2A 5KFPA 3ID8A 1JJCB 2HOQA 2J9EA 2HVDA 4M6WB 2YKNA 3H7IA 3OTOF 1XQSC 3VVUA 1K8AT 1ASWA 1DRGA 4ED4A 2E88A 2A3ZA 3DYAA 4IG0A 4KLGA 2J0SD 4NCAA 2ZUAA 5DBAA 4CI6A 1LWCA 3CCMN 3BB5A 1FRXA 4DPTA 5ALMA 2XY6A 3UKUA 2E8PA 1XJWB 2QTWA 1UEKA 1PGZA 4WE1B 3CXCM 4P74A 1ZPWX 4QU7A 3A3PB 2HSEB 4RNMA 2WMMA 3BS5B 3L7PA 2DWQA 4LY7A 1FE4A 1YF5L 3M9OB 1NJIT 2BJEA 2XYGB 2XEXA 2D9OA 3HILA 4N8OA 3GR0A 4EWTA 4PXBA 5AKJA 4KI6A 1IBLF 4WQ4C 5IZHA 2HMIB 1VYAA 3TFSA 2WONB 8ICRA 3UMCA 2JL9A 4NL5A 4J9MA 4DR5K 2JGUA 2WF7A 2WBNA 2X51A 4DV0J 1Q3UA 5AQLA 4ZVSB 3RSEB 2HDOA 1C1AA 3U6FA 2GAHC 2VGMA 2BCRA 2RB7A 2R7YA 1I3AA 2J0XA 3AJDA 3TU5A 2KHVA 4KITB 4DV4F 3A8KA 2UVUA 5HRPA 1HQ2A 4WCEL 1RAHB 2MDAA 3OFFA 5J1NA 2ADBA 1X2IA 3OL6A 2R7WA 3MAAA 4ZCMA 1QQMA 3VA0A 3HT3A 1C7YA 4H03B 4U7UK 3GJQB 1PJ6A 7ICTA 4FK4A 1FERA 2F8LA 4J9LA 3SUPA 5J2PB 3UKRB 2HFOA 3AA9A 5F8IA 4V19X 3NS6A 5AI8A 2MRLA 4K0KF 2LBOA 4ZOSA 4PYAA 1RACB 3A8YA 1RTZA 1NSQA 3IBFB 3SCIE 1D9DA 2ZDOA 1RBAA 3TVZA 1BUXA 3MMCA 4OI2A 9ICXA 4TLRA 3KLVA 3N7SC 2Z30B 4LF1A 3LA0A 1N33K 1F44A 4YB5A 3EZWA 3KHGA 2RP5A 2IA6A 1FRJA 1ZJNA 4TURA 3LWLA 4BBYA 4OZLA 2HHQA 1HNIA 3C2KA 1RDAA 3FLCO 1ZD2P 2EBGA 2LKZA 5GAEP 3DN9A 4JKHA 2C3UA 5BR9A 3VCBA 4C8OA 1HR0J 2H4YB 2D0CA 2AQ4A 3TAMB 2R8JA 1QQOA 5HJYA 4CHNA 1VK3A 2NR0A 2F77X 2CQ2A 1JROA 1NJXA 4LH4A 5J2NB 2M9NA 3DLLQ 1H3DA 4ANCA 2B4VA 1CZAN 1N54B 2K4HA 3DRRB 4LFBJ 3LUYA 1Q8KA 1TL4A 2FSNA 2AQ0A 5IWAJ 5CRXA 4NLSA 3IWLA 1IKWB 1S1XA 4A4JA 4BWMA 3SR6A 4ZJLA 4K7QA 5F3ZA 1JJ2R 5KFUA 2BV3A 4JP8A 4C2MA 4CNZA 5M2UA 3CI5A 2H5EA 2IIRA 1VHFA 4FCYA 3OYMA 2WF5A 1NU0A 1VQ7S 1S1TB 3QUCA 4IKAA 3CDUA 3QSYB 1RTHB 4DUZJ 1C4CA 4DU4A 2RD5C 3GU0A 4OYPA 1ATNA 2YX7A 2I7PA 2KFZA 4CLFA 2K89A 4F5NA 5F8JA 1M6YA 1U0SA 2GV1A 1I94J 3PLAA 4CF2A 1UWBB 2ZHOA 3LP0B 3MOJB 3EW9A 3R7BB 3JPPA 4AL7A 1N5QA 1NGEA 2VG6A 1Z00B 4A8XA 1ZBHA 3OYLA 8ICVA 1JN3A 2ILYA 1RXOB 2DO0A 1J5EJ 4JKDA 1JXBA 2ZUGA 3H8SA 2PDAA 5M1PA 1NNDA 3ZTRA 1T7PA 1VQ6N 2AJ0A 3WQPA 4AYBD 4DQQA 4CZMA 3HXMA 2JH7A 1KQGB 2HZAA 3KJVB 5FLXO 3UQ0A 4E19A 1K0VA 5DRKA 3ZX2A 2XLKA 3QLHA 2Q97A 2XB2D 4AYBF 1ZQMA 4JS4A 1KBUA 2DD8S 2NQPA 4I2QA 4O3RA 5AKEA 3M9NB 4ED8A 4WFBQ 4DX6A 3GIKA 4K42A 4BROA 4KLQA 5BN9A 2W42A 3CVKA 1FEHA 4DR6K 3OBYA 1TUWA 1IR2A 4PKDB 2RRBA 1S5ZA 4RNFA 1BNOA 3ENVA 3G87A 2LA6A 3I5CA 2L9NA 2O1PA 4AF1A 3MEDB 1Q46A 2OPPA 4M5DA 3SQGA 3Q2SC 1D9FA 1FFVA 4I6WA 5J1EA 4WZQA 2W25A 5KTQA 3U3YA 2NNWA 3AODA 2HQFA 2DPNA 7ICVA 5JTIA 1HKGA 4O3MA 1OPZA 2Q0UA 3G8QA 2WFAA 3KZIU 2DITA 3AGKA 4I27A 2CNOB 4G6VB 4HLBA 3UFCX 1XMOJ 4Y1DA 5BREA 3JYTB 4YORA 3DDIA 1VHIA 4QBUA 2HAFA 3OTOJ 2GNKA 1NM2A 3GFZA 2AW0A 1VQNN 1TUUA 2NSCA 1KAYA 2Q1LA 2Z8QA 4QCLA 1IBKF 1FJGK 3NE6A 3K9KA 4KKOA 3OS1A 2FLPA 1KTQA 1NSPA 2C3YA 3H2LA 3IN5A 2CNLB 5F8GA 3MCPA 2CGJA 3MF5A 4DR3K 2ZBQA 2B51A 3OSPA 4OJ3A 2MU2A 5KGWA 5A0YB 1DTQB 5EHHA 1D09B 4CJQA 1LXNA 2Q3SA 1F9EB 2DH9A 5ADXA 1QQ6A 4JI0K 2W11A 2PT0A 2QK9A 3AAQA 5FP0A 3O4QA 5C2FA 4RWXA 1T9XA 2YWGA 3T79A 3U02A 1ZM3A 2MEWA 1BPDA 1Z19A 5C0YA 3LDNA 1NMEB 1SC3B 3K1RB 3AVMA 1OYDA 1RWMB 5A2QO 1F60B 1Q9YA 1ZQNA 3ISBA 3QRPA 4CRXA 4A8MP 3VQSA 4ZHRA 4JI3F 3JPQA 3CTRA 2QARB 4LFAK 4BR5A 4KB1A 4BX9C 3TUIC 3VR1A 3M1VA 1NRKA 2E1EA 4KLJA 5CE3A 4DR2J 3UD3P 5KFYA 1TAMA 3SYZA 1WSFA 5IILA 2VANA 1CG2A 2XSFA 2IOFA 1VQYA 3MGIA 1VR6A 1U6BA 1JLCB 1VLYA 4ZVRB 3NKYA 1O08A 3BSAA 5SZTA 2HWIA 2YNGA 5HSPA 3PZPA 3A5OC 4PEOA 3IC1A 4KHQA 1TFYA 8ICIA 4M42A 4M9GA 4K0KJ 2HBQB 8ICUA 2VG5A 2AYBA 3B0XA 3PNCA 4A8EA 1AYEA 5GAHI 2QIFA 2WVCA 3HFVA 1RQNA 4IQXA 1VCTA 1JLAB 3NF6A 4RQ8A 2BQ3A 4QIEA 2NXCA 3H46O 1KWMA 2HKEA 3ZDAA 2VZ9A 2R3VA 1G7CB 4PQUA 3NCQA 4FZNA 8ICCA 2XMVA 3W5XA 3WHIA 2RHKA 4F93B 4RBTA 1YRTA 2NPFA 3FCHA 1RWNB 3QIOA 5LMUF 3I5AA 1KDHA 3KKSA 4UZBA 1W9HA 1ZZNA 5F8LA 3H0LB 1S77D 4PZNA 1HKAA 2V2ZA 2W2QP 4U8YA 3VOVA 4CFAA 1MA9B 1YRUA 5GAGI 2DHGA 3IGVA 1HMVB 2GC8A 3HRDD 1B4SA 1CVJA 3EGZA 1N36F 1WEZA 3W5ZA 3RU0A 4FPBA 5FPNA 2OSQA 2YWHA 5J2BA 2AF6A 2B43A 1GEHA 1RDDA 2E5LF 4CM0A 3WK8A 5CHGA 4WKRA 2D7SA 4YOWA 2A18A 1T03B 3IFRA 4FJIA 4X64F 2Y0SC 3QNOA 2MQPA 1T6DA 2VU5A 3LOUA 4JV5J 1FFUA 4G1PA 4XH5A 2Z58B 3ZEUA 3GL1A 1IM6A 2XI2A 4IEEA 3R9KA 3IRXB 1JMTA 4MH8A 1RT5B 2EG2A 3SDEB 1WSGA 1IXRA 2JVRA 3S3MA 4A46A 3RVCA 1JLGB 4CO2A 4QU6A 4LBHA 5JVGQ 2FPMA 2W2OP 2R9LA 1S4FA 1ZQJA 1XNRJ 1DQ9A 3OPKA 2CRXA 2GUIA 1VDHA 1UCNA 2D1CA 2QSFA 3ZXWA 4FZVA 1SAZA 1SJ1A 4M7XA 4JRPA 3I0RB 3F5EA 4IQUA 3WK6A 5AM5A 3IG1A 4R0JA 1SZHA 3TWZA 4OLPA 4IFYB 3OQ2A 2IJNA 2R2TA 1NGDA 2PGCA 1FTCA 1IJEB 3SQ1A 1YVFA 1YJ9N 4QIFA 3W0LA 1KVKA 3NBPB 5CCMA 2F9WA 1GXTA 1EAYC 4BGAA 5CH7B 1RTJA 5HMZA 1GOCA 4TUPA 2W2MP 1RADB 2I2YA 2PFDA 2OPQA 5AHXA 2RQCA 3G6ES 4L3NA 2Z2MA 4DCHA 4KLHA 3A0BU 3EE9A 3GE9A 4DUYK 1COKA 2LU2A 4RQ6A 3AA3A 1ZQPA 3MGJA 1M5PC 4BRLA 4L8RB 4IO1A 5DZ6A 2R2RA 1N0UA 3D2NA 3V6JA 2KK0A 3HHDA 4NL9A 2P9PA 4BRPA 2VG7B 1ELOA 2DGXA 4CW7B 3N5FA 5ETMA 4JKBA 2J5AA 4J5OA 4WWSA 5MAOA 4OMFG 5HOOA 2CGLA 3TABA 3TR5A 2WHEA 4L3KA 2K1RB 2F8MA 3RYLA 4CJFA 3ADAC 1Q81T 1S0OA 2B9XA 2BKOA 5D0HA 4LF4K 2NLXA 4PPZA 2DR8A 4RQMA 1X4CA 3LTOA 4F50A 1BPZA 3P6YC 1URJA 3PKMA 3OS2A 2ACMA 4QYZK 2YNIB 4P71A 1IBKJ 4Z2XA 2ZBCA 4IRCA 3M8QA 3OGUA 1Y64A 1BQMB 3RB0A 2I6XA 4W5QA 3QO9B 1E3MA 3SSQA 1MU2B 4X4VA 5CEHA 5D49A 5K5MA 2DFLA 3NS1A 3FK4A 3VAKA 3MPWA 1TVAA 3M2RA 4FWRA 3LAMA 1P1LA 1BGXT 4EEYA 2GA7A 3FRYA 2QMUB 2G5IB 3IA0A 4Z4FA 3MR5A 3PIOQ 3ZZOA 4BG9A 2YKNB 2O66A 3OLAA 1N60A 4DTRA 5J0OA 1M5HA 2QT7A 2E9RX 3A0IX 1RB0A 2C2OB 3DYAB 4IG0B 4USIA 1KNZA 1Q1KA 4FKYA 1LWCB 1ZQZA 5KG1A 2J9CA 1NPKA 1ZQGA 3UKUB 1ZQKA 3CD7A 1TUYA 4DUTA 4QW9A 3RJKA 3LZJA 3N6LA 1KS2A 3AA2A 5AKYA 3RGIA 4M95A 3E66A 3BF3A 4A8KA 3P96A 2YNHA 1RWVB 3J81O 3CQXA 2I1QA 2B5JA 1MA7A 3EXCX 3D3CJ 3SJHA 4OJRA 5B08A 1R89A 2DISA 2VJ4A 5G4DA 2VL1A 5D3GA 3HVTA 1T3VA 1WF2A 4PXDA 1GOBA 4DL7A 1ZXIA 4DV5K 4E1NA 1R8AA 2G1DA 2MTLA 4ENOA 4OLOA 3AQPA 2FXUA 1U0HA 4ZIWA 4NV0A 4BUGA 2CH6A 4RW4A 4QOTA 3PJWA 1NDPA 1ZYQA 3IAM9 4K4YA 4ELTA 3BN7A 1ECWA 3AVFA 3QMLA 2QA4G 2RHQB 1RNHA 2DH7A 4NLDA 3MAAB 3PNIA 1RCHA 1KN6A 1EX8A 2ZOFA 5EX0A 1V3RA 4WFAL 5C12A 4JI7K 3TADA 4PY5A 2KI2A 4Q44A 3A5LC 2OHDA 5KFQA 3UVJA 4ZVHA 1M1KO 1YI2S 1XI1A 5KFIA 2CNNB 4DB3A 3DAWA 3MWTA 2D3UA 4CHZA 4KHUA 4J9VA 3AY9A 5CR4A 2M0GB 9ICFA 3AA4A 2G8FA 1IM4A 2EANA 1Z4UA 3MMCB 5GVQA 4G3IA 4HDGA 1N36J 3ZZPA 1RJJA 3W2VA 4NLWA 1NZAA 5ALHA 3CNQP 3ZZYA 3SK3A 2CPRA 3D6HB 1LKYA 3ET6B 2ASOA 2LQ8A 2I1RA 3I1YA 2E5LJ 4JI8F 2BR0A 3OW2R 5D4NA 5J0SA 3NMUA 3HKZD 1N32K 1Z1VA 3D67A 4BRHA 2HBLA 1VQLN 1Y3JA 2CG4A 1HNIB 2QXLA 4KH0B 3T1YK 2CPZA 2MA1A 3JPOA 2OO4A 5AR0A 4X64J 4DV3F 5ADZA 2UUBK 5H9EJ 4DV6F 3CC4S 2DXEA 2E1CA 3HKZF 4F0MA 1Q16B 4FS1A 4ER8A 3H4DA 4YMEA 4F25A 2AX0A 2BX6A 3CDBA 2PMHA 4P2HA 3MUTP 9ICKA 5BPNA 4JI2F 5AE2A 3ZO7A 3R5JB 2X3GA 3VALA 2BBEA 1NGCA 2SXLA 2GFFA 2W03A 1CQNA 2O6KA 4DR4F 1BD6A 4OYXA 2BDPA 2ZF5O 4FNIA 2XRIA 3ZDCA 3VGLA 2W3RA 2AP6A 5AKLA 1S1XB 4L3QA 4LD0A 3V4IA 2H5IB 2PKEA 5KT7A 1D8ZA 3CC2N 1NGHA 1LW0A 2NRTA 1VQKS 5C24A 3MDQA 3WXIA 2VC1A 1ZQLA 1WLJA 1S97A 2NZTA 2BUPA 1YK9A 3KKFA 3P45B 5HANA 2HHHK 1KVBA 1F5SA 2OJ3A 2ZTCA 1R0BG 4Y2VA 1VQMN 4FWOA 3S6JA 3M2UA 3OTDA 4OIXA 2FBYA 2C2KB 3SIPB 3CJRA 1BO5O 4EFHA 2AJ1A 3BV8A 2GEMA 2HZVA 3DRYA 2VG6B 3L4BC 5F0XA 3BR9A 3PYDA 4E1MA 1GXLA 2PIIA 2CVIA 5J2KA 3P83D 4MKYA 4B3TJ 1YJWS 2IM1A 2LA4A 4TN2A 4B9NA 4PWDB 1X60A 5ALXA 2HQCA 2R7OA 4J7CA 1WB9A 2QLJB 2EK6A 3MTJA 4P0PA 1VSDA 4KHRA 3UR0A 2BE2A 4A5AA 1OH7A 3RAQA 4G1QA 2OUGA 4AHCA 3LP1A 3K5MA 2H3QA 3ZYYX 4NRTA 5D46A 1XNQJ 4BRAA 4OYOA 3L6QA 3O3GA 3HRGA 2CJ9A 3VEOA 3BDEA 4GXIA 4JLHA 1WBBA 2Q2RA 2RHSB 4I2QB 3WDOA 2CQ4A 1RWKB 4EU0A 1OSDA 2E1MC 3R1LA 4WBFA 1R0CB 1ZTTA 2P9CA 3C94A 2DH8A 4GO5X 1VQ9S 4CIGA 5ALWA 2CQGA 3KJFB 1T3OA 2QLXA 2IAJB 2AJFE 4WXWA 3NMAA 1WCNA 4HWIA 3G10A 4H5TA 3CJ7A 3WXKA 3O1WA 3TKAA 2XZTB 4KH5A 2ESEA 4B1YB 1FO1A 4OGCA 2ATLA 4BR4A 4M5DB 5CB1A 3V9UA 3SQGB 1WN7A 2HCFA 5J1EB 1URNA 2V50A 2A6OA 4HAIA 3CJ9A 3T3FA 1U6FA 2P8IA 2ZIVA 4C9DA 3L2VA 1YJNN 1JL1A 4LIRA 3ZZRA 1MWQA 5AIAA 2GMJA 1Q79A 1WSRA 1FKOA 3AD9C 3M8SA 4FJ7A 1FDDA 4UARA 1EQ0A 4XQ8A 4B08A 4FFDA 3L5KA 1L3TA 5M1OA 2LQ5A 1NWKA 3EVMA 4Y2AA 2O8EA 2RMLA 2I8EA 4H54A 2C3OA 4QWBA 2EX3A 1U24A 2O3DA 2DNZA 3A8EA 1VAZA 1A5WA 2FJEB 1HRHA 3FZ2A 3RAMA 3OBWA 4LBPA 3BY5A 3JS9A 4ZPBA 3LM9A 8ICTA 2WTUA 1BVSA 2EG1A 2AEJA 2G0JA 3WNGA 4HVJA 4CK1A 3D6FB 3I76A 2MY7A 3AOAA 2XHBA 4DTXA 1U2VA 3GZFA 1GFWB 1F9FA 1ASUA 2HF4A 3CEDA 1NKBA 1FDNA 3MAHA 1N5YB 4PHDA 3IWXA 4GNIA 3ALRA 3HPHA 3BGFA 5GMEA 4QWDA 4ZLLA 5DDOC 2C3MA 2FJXA 3RBEA 1D0EA 4FWLA 2BE7D 2B9YA 4HHHA 3W2WA 3VQCA 2CFXA 9ICRA 2IHR1 3ENWA 4AM6A 3Q8LA 4ZHRB 3IDWA 5FDLA 4OX7A 4W5TA 1YDLA 4AYBC 4YP3A 5J8YA 2CJYB 1WG5A 5ALGA 4GV3A 2JLEA 4RPFA 2KJVA 4JOUA 2HOFA 2YKQA 3CCQN 1U9LA 2HWHA 4HH1A 1RKJA 2J9DA 4KLOA 3UCZP 3C8YA 1TZ0A 3EVWA 3G8SA 1GNKA 2KHCA 2IOFK 3TJ9A 3RB4A 3TVKA 3WT0A 2YNGB 3FGUA 3FMWA 3EKUA 2YY6A 4CO3A 2O5DA 3B6OA 3ORYA 2VG5B 2HNYB 2KDOA 1DEJA 5HRRA 4O5EA 7ICPA 2JSXA 3QU2A 4IZ9A 4GC7A 5HMYA 1G3OA 4OX8A 3I56N 2LYAA 3F9KA 5E2QA 4ED0A 2K7KA 2KVSA 2ZUCA 1JL2A 1YIJS 3QUTA 2KL8A 1WNEA 1KKXA 5DO2A 3VAMA 3VENA 1N5WA 4PQUB 1AFJA 4F8RA 1NPRA 1PAUB 4AILC 1PC4A 3IP0A 2P9UB 2RQ5A 3IO1A 5DG9A 1LNQA 2V51B 4N56A 1UJ4A 1N5XA 4DV3J 3O6QA 1FKPA 3KJQB 2BQUA 4DV6J 2Z1HA 2PI5A 2U2FA 1ZQUA 3S41A 5E84A 4KAIA 3BPSP 4QS8A 3IBPA 2JC1A 4XA5A 2EC2A 2I5JA 1H1VA 4JI2J 4F72A 3EKSA 2ZM6F 3FZHA 5AI0A 3I87A 4QIWD 4RWTA 4U67Q 4YR0A 4DR4J 4FLXA 3EUNA 1PKUA 3QBWA 1RT4B 4DF8A 3D68A 2CPFA 1RT6B 2GO7A 5GAEU 1NDKA 2CPIA 2FY8A 2E44A 3ITHA 4QIWF 3UIQA 1M90O 3AVCA 4FF3A 3MFHA 4IOCQ 2G2ZA 4Y2MA 1RA7A 4A8YA 8ICKA 3ZEUB 2F76X 4YNQA 4C7ZA 1GLEG 4I2GA 2K3IA 1KVIA 2F1FA 5ALZA 4FBTA 1UEUA 1IV0A 2BUNA 3TI0A 1BLUA 4DL6A 1RZMA 4U6PA 5AXNA 3UN3A 3HZGA 4OYIA 2YKPA 5AQIA 5A8WB 1X9SA 4HACA 3I4PA 4NPOA 5AQYA 3H5UA 4Q2LA 4RU2A 3ZSWA 3VF4A 3ZT2A 2O8CA 5MLCV 1N52B 3FNNA 1C0UA 3ZLJA 5AQWA 4J91A 3KZXA 1WDDA 1GX5A 1WCLA 8AT1B 3RMAA 1V4SA 1TU0B 2Z57B 2ZIWA 2QEXS 3H7HB 3QNMA 1FX4A 3IG1B 2JRZA 3CERA 5ELZA 1Q5VA 2LECA 3MEEB 2ZNZA 1JJ2M 3ZT3A 2ZC3A 2ZZNA 4QZGA 1QAXA 1KP6A 4DX7A 4FF4A 5GADI 3UE5A 1UTAA 3Q8SB 2PE8A 2ZWOA 1RTIA 2BJ9A 3MPVA 3LGHA 2JXJA 4PGQA 4B9UA 4F5PA 3T9NA 4X2BA 4NLKA 3ZD9A 1RTJB 3T1HF 1WOPA 2DGZA 4OV1A 2LYHA 3HJEA 1D8LA 1D8BA 3LVVA 3SMVA 4FVMA 4ZVUB 1NLKL 4YDUA 2IYGA 3P5TL 2ZJQQ 3HJFA 3C2MA 3LP2B 1XR5A 3GIIA 1R8HA 5I3PA 2ZH6A 3PX6A 4KLFA 2E2PA 1U25A 4IRDA 2YWFA 2UUAK 2OD4A 4ZPTR 4TQSA 4Q43A 1KFDA 3KUHA 2HBZB 1ZQCA 3MECA 2VKZG 2P9PB 1T9YA 1ZC6A 4A8QA 4WFYA 1VS3A 4DQPA 4UY8O 4F71A 4YFKA 3V2UC 4OYBA 1ZH5A 4DLEA 1OMSA 4M41A 2V4JA 1ZQAA 3GFHA 2QW9A 1YVNA 1XMQJ 4A8SA 4CFDA 4M3YA 1VOMA 1UVNA 4P7VA 4EYHB 1SS6A 3O4NA 1EXQA 2PY5A 2QA4N 4C3MA 4CJTA 3HCXA 4K8RA 3VTHA 3FBCA 1PILA 4WJBA 3TVYA 3Q89A 3CJTA 1PCAA 5ALSA 3J8AA 2HG4A 2WOMA 3EO3A 4JI4J 1ZD3A 3BGRA 4R64A 4YCXA 2X1GA 4NEYA 1T05A 3M8QB 1T8EA 1ZBUA 4MF8A 3L2WA 2DVIA 4GMKA 3P4IA 4KB0A 1HQUA 4C1NK 4KRFA 2Q4TA 3CETA 3KOOA 5KFHA 2RUSA 3NGTA 4U7BA 1HNXK 1BWEA 3M2RB 3L3CA 3LDQA 4NLCA 3O1BA 5AK3A 2I9GA 2FYXA 3ZDBA 1RWOB 3HHLD 1ASVA 4B1ZA 5FIIA 3CFOA 3M8PB 4EBDA 3D2QA 1HD1A 5FRNA 1NK9A 4KY3A 2R7QA 1CJVA 4L76A 3S3OA 4B9SA 1Q82T 2GH1A 4C7QA 2QKQA 2VJVA 1VQ7N 3SCKE 3DLEB 2JV3A 4CTAB 3IR6B 3MR7A 4YB1P 5CD4A 1D4XA 4PYDA 1BIZA 2YNHB 3QJLA 2W6LA 2DNLA 3I28A 1YJRA 1ZM9A 2KRRA 1L3UA 4WQ5A 3TARA 4BE0A 3VAGA 4NE9C 1CXQA 3EY1A 2B5JB 4KC5A 2G08A 3NNCA 2P51A 1X0PA 1U1LA 2W54A 3V6DA 1KLNA 1QAIA 4M7YA 5D3GB 4PL7A 3HVTB 4J8FA 2QKBA 2OCEA 2LDYA 2W9MA 4G65A 1M5VC 1UQVA 2P9KB 2KU7A 4ECZA 1U0HB 4N47A 1TL3A 2H5XA 1SQEA 1SC1B 3JAMY 4RW4B 3Q22A 2MKIA 4R25A 4UAUA 3SBTA 1H98A 4C8ZA 5HR6A 1NEEA 2HK3A 5LMNJ 4P4MA 4IDKA 1TP7A 4P72A 3V9XA 4MLEA 5SUHA 5D0EA 3T5KA 3RF9A 1K8KA 1T95A 2VASA 5GTHU 1VSLA 2W41A 3OXLA 3CMES 2WW8A 3MPUB 4HI2A 1BY9A 3HJVA 4NX9A 2JEIA 1VQOS 5AQQA 4KFBA 3EZ5A 1Y97A 3UVJB 3GG4A 2HVHA 2FIUA 1OXJA 5ADXH 2BZFA 1B7FA 1TQLA 5JLHA 3FCVA 2WFBA 1KBRA 2KW4A 5B0BA 4QPXA 2HNZA 4DV2J 3W2VB 3EZOA 2L08A 1LKYB 2ZM6J 2LXFA 5E26A 2C2EA 2F9DA 1WKJA 1RHKB 2YTUA 3TTDA 2QLWA 4Z0UA 5BYQA 3OL9A 2HFUA 2NRWA 2XO6A 1QHTA 2YWEA 2EI5A 3SV4A 1U8WA 4JYAK 7ICOA 1HPMA 3CW2C 1FIQA 1MWKA 4A47A 3M6GA 1C1BB 2R7TA 4IQTA 3QGHA 4NXNK 3UWTA 1HLUA 1IH7A 5EDWA 2NO5A 2RPIA 3MPDA 4TU8A 2IOCA 4OI6A 3MEKA 2G8HA 3OXFA 2R7XA 1LQ9A 9ICCA 3H40A 1A76A 1WSHA 2V5HG 4CJ3A 1S9FA 2N3LA 2MXYA 3RR7A 2HGNA 3EGNA 5K8PA 5DQIA 3H5SA 4BRGA 1N34K 4I9QA 1Q3VA 5HR7A 1OJ4A 2ZJPL 5AQGA 4K4ZA 3V4IB 3NWGA 4XRHA 4M5JA 3WZ0A 3ZTPA 4DR5F 4NA1A 3NRWA 1RHMB 2KD1A 4EEKA 2YQEA 2GGPA 3QUQA 1K8AO 2UXDK 2O8DA 5C24B 2O8BB 1LK5A 3B8HA 5DB6A 1FK9B 2JEJA 1RLDA 2BTFA 5C25A 4GKKK 2IVNA 3WXJA 1MN7A 4DN9A 3MGHA 3IRWP 4U7UD 4Z6DA 1X31C 7ICJA 1KN5A 2MZQA 2CH5A 2DNNA 3A5MC 3MC1A 1H73A 3TOQA 5AQNA 2CQIA 3T1HJ 1XSNA 3QEAZ 4O5FA 3FC4A 2H65B 4WIIA 4C3KA 1NJIO 2KLAA 3R7SB 1QY7A 4IG3A 3MABA 2BJDA 2MHNA 2D1KA 1DQAA 4YY3F 4YQWA 1Y9OA 3H2VE 9ICHA 2IBKA 3J7YP 2VQEK 4P0PB 1ZOTA 3OA9A 3QEVA 3EX7B 2XHCA 3KHRA 1FRMA 5EX3A 1U1RA 1N33F 1ZQEA 2RVJA 2WHOA 3ETOA 3GDXA 2AYMA 1OO0B 4KJIA 1B9DA 3LP1B 2EZXA 3NP5A 4QZVB 1ACMB 3VZIA 2C2ZB 3O80A 2IDLA 3C15B 1SIZA 2A41A 5H2FU 3JTPA 3CD5A 2LSNA 3C6UA 4GO7X 3O3HA 1HYZA 4CHOA 3J80O 1R7IA 5JMVA 1D8YA 2FZCB 3RTVA 3D45A 3QNNA 1GMWA 3LF0A 1FD8A 5AICA 2IM3A 2KKZA 1NSKL 3M6XA 2ALYB 1HX1A 4GMJB 3HKZC 3UO0A 4B3RK 4CGIA 2W04A 1ZBSA 4LF8J 2A6AA 3X3UA 2QWRA 1W7AA 3LPYA 4PG8A 4DLGA 3S9HA 3KMQA 4WF9Q 3H90A 3KLEB 3ZSQA 3O9RA 2WVBA 3ZZTA 1QVFR 4FK2A 3E3XA 4KX3A 1X9WA 3RB6A 4CT8A 5ETSA 4KREA 1HI8A 3FGVA 1TK0A 4B9TA 4KLTA 1P8ZA 5HMMA 4JI6J 4HTIA 5HROA 1SQFA 3SJJA 4KHMA 1SIWB 3V7LA 1FKOB 4NB4A 3DXKB 2BKPA 4C8KA 1LW2A 3QJPA 5BN8A 4MEXA 1FVQA 4M3XA 4H4MA 3CQ8A 1PYSB 1F1BB 4Y2KA 4QW8A 2O8EB 4NYNA 3I32A 5AKGA 3Q8MA 1UVKA 3C65A 1IR1A 1XO1A 4N41A 2ADCA 3RMDA 2IC3A 3L3VA 4CLYA 4DV7K 2QYCA 4KTWA 3FDSA 5JUMA 2EFNA 4J9RA 1WI8A 2OKQA 4HKQA 5DG8A 3VC8A 3MDCA 3LDPA 4ES1A 3IV6A 4NJ8A 2FJWA 5IIIA 3IM9A 2WF9A 2ITMA 5JU5A 3RJGA 2FTRA 5CA5A 1RAGB 1U2VB 4KT0C 2BOPA 4ZCKA 1OPIA 3K9JA 3EUB2 2HHUA 4YEAA 4XTTA 3NLCA 1NDLA 1GT8A 3OLBA 3NVZA 1YRXA 3K89A 1V9OA 2A0FB 4LF5K 3UCGA 3W2WB 1GQEA 1LB2B 4ZVFA 5KT4A 4FZYA 2OZMA 3CJSA 4UY85 5FDLB 1JXLA 2ATCB 4B8AB 4LUBA 4PG6A 2NYHA 1VQPN 2YKAA 4J03A 2FHMA 5CYJA 3WX4A 3RUBL 4DR6F 3ZNUA 2MSSA 2AZ1A 2MQMA 2WVDA 2EWSA 3Q86A 4KI4A 4CGZA 2WVEA 3LDSA 3G6EN 4LREA 7FDRA 3GSIA 4CGHA 2GJ2A 5C2DA 1YJ7A 1NI3A 2N7CA 5DS7A 4BXOA 2Q66A 2HBKA 3P39A 1XUPO 3B82A 4KPCA 4CDGA 4CCHA 2QWNA 4ILLA 3SQ4A 2DNMA 2XSJA 3THVA 3CCWA 3H42A 2E66A 5GAGU 2UV8G 2XMMA 3V5RA 2HRUA 4KHPK 1CJKA 2QA2A 4EAHD 3B9JA 1WKLA 4O8KA 4XH1A 2LKYA 1ZQQA 1I5OB 1FJGF 1UEVA 3KUGA 1SV0C 4F3OA 2BH1A 4IH5A 4FWSA 1FKPB 4H0PA 4F7VA 4DR3F 2GMHA 2NRRA 4OV6A 3UW1A 3BKUA 4NY8A 5AFUA 2MLXA 3AM9A 3TACB 3KD3A 1WSEA 4TUQA 2I5JB 3ZSOA 4UOFA 2V9WA 3Q8RB 4HT7A 2H54B 4O44A 2O8FA 3KHHA 4CK2A 5F9LA 1HD0A 2BXJA 4HHUA 4JI0F 3DLLL 5F1XA 1EWQA 4TY8A 4CJ7A 4MKAA 1WOOA 4CLLA 1TKXB 4BDPA 2ISPA 4FLUA 4NYOA 2KG0A 4OZ1A 4OQJA 2HNDA 4E2FB 1XHZA 2OI2A 4C11A 1WC3A 3ITHB 3HSJA 2CQPA 5H1SQ 7ICNA 4N8NA 4DR5J 2Y1JA 1IKYA 3F5TA 3SMSA 1Q8BA 3UI3A 2MAXA 2NRHA 2KVIA 4Q7AA 4LZGA 5ALDA 1ZQYA 2E9TA 4L75A 4LFAF 5J1PA 2VGNA 4H0VB 5G5GA 1WI6A 1T3QA 2L9DA 2DNHA 3NTUA 1Q18A 2AZ3A 5CZ2A 1YUWA 6AT1B 1MROA 3N28A 2JOQA 2O8CB 1QE1A 3ICXA 2HHVA 1OH5A 4AHVA 2QX0A 3GU3A 3CMAS 4USUA 5M1KA 5IINA 1JXEA 4DSEA 2ZIWB 4YY3J 1Z2LA 5D78A 4OX9K 2GELA 5AI6A 1U4BA 3PHEA 1VQ4S 5D4PA 1HWLA 1KW4A 1E4FT 3RG6A 1ATSA 1QZ5A 1XN9A 2LCWA 2PA3A 4PL8A 5AQHA 3GBTA 4BRCA 1N33J 4X65K 3QIDA 3TX0A 1RTIB 4CJVA 4DQRA 2YH1A 2DGWA 3JAMU 1P6TA 2MQQA 2VHGA 1KL9A 3HOTA 3AVAA 1B22A 2VB6A 2HF3A 2NUUG 2IJRA 1FWLA 2O01C 4K8ZA 4WFBL 4EX7A 5HRNA 3WKBA 4OX6A 3C6AA 3CRXA 4PHPA 1ZPVA 2RQKA 7FD1A 5L38A 4H4OA 3TA0A 3MBYA 4CZHA 3VF2A 1JJHA 1SZPA 1RWXB 2W9CA 3SPYA 3AVBA 2XY5A 1K73T 2OH2A 1QS4A 5F8NA 3MECB 1YI2N 3THTA 4DV0K 4CLWA 5DJBA 2QE5A 4FKXA 3F44A 1C6VA 2Y3YA 2F3JA 4C0ZA 2B3TB 2YI1A 2DXFA 2KT5A 4K5SA 2BPCA 2U1AA 1GLDG 3OVAA 3FMBA 2CKWA 1KTVA 3R6GB 3THYA 3CWJA 2P5VA 3N4QA 1VIOA 1KQQA 5AQPA 4OYMA 3TZZA 2BGWA 3C3LA 2DFEA 4QIWC 4CJ5A 3AVNA 4DSLA 3M6ZA 3CJ4A 1UT5A 2XNRA 4WE1A 3CC4N 2OTJS 1RHJB 1PVPA 4IKFA 3FQLA 1TUVA 1AUSL 2G2YA 2Q31A 4IR9A 1VBKA 4P2SA 2E1AA 1VMBA 2VODA 4FYWB 2L41A 5J2AA 2D3DA 3SCLE 3D7SB 1CSJA 1YXQA 3IM1A 3D1OA 4XEIA 1CXUA 1VQ5N 1QH9A 2QB0A 1JMSA 1QQCA 1RWPB 1A7GE 2QLBB 3OL7A 4BJQA 4LIWA 9ICGA 1RISA 1TGOA 4CEEA 4LSZB 4OYWA 1ZQ1C 2K8AA 2BJ3A 5AI9A 1NZ8A 3NASA 2FPLA 1RAOA 4ZP6A 4U9RA 5KFCA 1RBRA 1CJVB 2UXBJ 1ZAVA 8ICFA 4FF1A 2M8DB 2VUGA 8ICXA 2X1FA 2RLTA 1BDGA 2E5HA 3KHLA 4RW6A 5ALRA 3QU4A 2E3TA 3HX0A 4Q8EA 2EZYA 1VSHA 4X4QA 4ILMA 1WAFA 2B4PA 5IV3A 2ODGA 3M3ZA 3FJ2A 4B6JA 2Z4PA 2YB4A 3WXLA 5IWAK 5L46A 1WD6A 4DR6J 3RB3A 2Q0RA 3IG8A 3GFXA 3O3FA 2FSJA 3UKRA 3SPZA 4MJKA 3V6DB 1KDNA 1RKIA 1RHRB 4B1UB 3HM9A 4YOUA 1JX4A 5C2GA 3LGMA 4JI5K 4ETXA 4P0QA 3PFOA 2HYIB 3S6EA 3IXQA 1YJWN 3KHYA 3Q8UA 1TL3B 1FJ7A 1IJFB 3MMAB 2X7IA 4MFCA 3HBTA 3NOCA 4NLOA 4I2DA 4BC9A 1KONA 5LL6Z 4FO0A 1HI1A 3MX2A 1D9AA 4IDKB 4DTMA 1I94K 4M3WA 4LF4F 1RHUB 2GZOA 3W7BA 4OYZA 2A10A 1K8KB 5I3UB 1HKBA 4NA2A 1FDBA 3P1GA 2AYGA 5K14B 1H72C 4JK8A 4HUEA 4AQYJ 1UOCA 3AA5X 3HO1A 3RW6A 8ICNA 3H0MB 3TO8A 3TAMA 3OTCA 4PPDA 2DNYA 4XIUA 2HRTA 1VQ9N 4NO7A 1IKVA 4KFBB 3CCJS 2JLFA 1WC5A 2UUWA 4ECWA 4KN7A 3D5MA 1DOQA 2C42A 2VWJA 2KJ9A 1MDUB 2QWOA 3N4PA 3HF5A 5IV4A 4NMLA 2KIWA 3WQTA 1DK3A 5KL8B 5EGYA 2XY8A 2RKIB 3THXA 1M5KC 2G07A 1RE1B 4X5VA 4YOEA 3CCSS 3CPWM 1PSDA 4CH7A 2E5GA 5B0GA 5BYRA 4A62A 4F4ZA 4M9NA 3QZ8A 1AZSB 4F04B 2QA1A 3V9ZA 3F9MA 8ICBA 1FEEA 6FD1A 4OPAA 4OYAA 2W8KA 1Q81O 2IYIA 2G1HA 4ED2A 4LJMA 1KD1T 3CIMA 5HBMA 5BRHA 4JWMA 3K5PA 4TQRA 4CLKA 4NOHA 4Z4IA 2LM1A 4KLUA 3LW5C 3NRZA 3LP0A 5F8HA 3PHTA 4NM1A 3RJJA 3A2FA 4NCBA 2Q6BA 2XICA 1Z00A 4DEZA 4Y0WA 4KRWA 5JVGL 4FJGA 4L72B 4UT4A 3V6HA 1I3OB 3WU2U 2W1BA 1AFIA 1JCGA 1XMOK 1HPZA 3KLGA 2YKOA 2KICA 4FYDA 1W2IA 3BQ1A 3ENOA 1S0VA 2GGPB 2O8DB 5C25B 1F6TA 2FLNA 2K7JA 8ICZA 1Z05A 1K0TA 4LRFA 2ZNYA 3TW0A 4HR2A 2QB1A 1YVUA 4HHTA 2FZKB 1SV4A 3NS7B 3BO2A 3QU5A 3H98A 3EDQB 4DZDA 1O6XA 3ULHA 2NV3A 5AKKA 5LOQA 2IVPA 4F9OA 4JI7F 5C10A 3KLHA 1HBOA 2YNFA 5HVFA 2P2CB 1BCOA 1WAJA 1WSVA 2M2BA 4JI1F 3ELHA 5M1NA 4IG3B 4DL5A 3Q7BA 1XU4A 4E3SA 1SL1A 7ICMA 4IS7A 4MT1A 5E41A 1PAEX 3A3OB 5RUBA 4TU9A 4FYYB 3V81B 4H5RA 3QWUA 3CJ1A 2AYEA 2AJQA 3RW7A 2BCQA 9ICNA 5E5NA 4H5VA 1S10A 2M70A 4O3SA 4TSXA 1N32F 4C8MA 4Y2SA 3T1YF 1X9XA 4E7JA 4A5BA 4DR2K 4RL1A 1YIJN 4QYRA 4CFCA 4IO9Q 3C6UB 2UUBF 3U8XA 2ZTEA 4B9MA 3CD0A 5AQTA 1EJ7L 3SI8A 3POTB 1PK3A 2H3ZA 4F5RA 2PEBA 3ISCA 4LBIA 3AL0B 1NJZA 4KV8A 2RU9A 2FJVA 3NAHA 4KAZA 4GFJA 4KH4A 5LJWA 3MXJA 2VD3A 4CIOA 3J7AP 2AXTU 2C2NA 3ILIA 4NEZA 3C19A 1HYSA 3CFRA 4J9UE 4NYPA 2DO4A 2A1JA 1DAXA 1FNMA 5ETRA 4H5WA 4BC4A 2IHMA 4CHPA 2YN4A 4WJ3B 1P1TA 3K7RA 3PIOL 1VC6A 4FLWA 1XMBA 1LW2B 1SCJB 4FVCA 4QZCA 2IVOA 4IQMA 4FNHA 4H4MB 3C1YA 2HHHF 1BHLA 5AQVA 1RBUA 4E7LA 3O8MA 1TYQA 3CCES 1VC0A 2QARA 1S1WA 2DEJA 2HWTA 4Y2IA 5K8MA 2IC3B 2KYXA 5HAOA 1CULA 2KKHA 2UUTA 1DRZA 4DFPA 4FM2A 4C97A 2LQJA 4ZN3A 3MUMP 4U95A 1ZQSA 1Z2ZA 4LSNA 2OIHA 2OLWA 3WKEA 2ZXIA 3D6JA 1PG5B 2WVFA 4J2BA 2G06A 5DLFA 1V3ZA 2EFVA 4JV5K 1BWFO 3R5BA 4TLQA 3EEQA 1R27B 2QEXN 3QNWB 3PSTA 1LVHA 3MM9A 2GIFA 4NASA 4C4WA 3U4LA 3V4MA 1H38A 2LXIA 2EH9A 5EOZA 1WG8A 5J2EA 3DV9A 5B8HA 1ZBLA 3B54A 4M94A 3OYHA 1ZJMA 3DOLA 4LF4J 4PABA 5JXSA 1XNRK 4BWJA 4DMZA 4BDYA 4OJ6A 1D5AA 2UXCK 4LSLA 4J9OA 3BKFA 2RU3A 2VA8A 2E2QA 5A6PA 2F4VF 4KLMA 1X3NA 2YMMA 3EGWB 1TL1B 3PACA 3K0SA 3M7VA 4DFMA 4DS4A 4BXOB 1L8OA 3D2SA 3PUFA 2DXDA 3TQEA 2QYGA 3DDKA 4Y34A 4KX5A 4A8WA 3ZX3A 5T7BA 2YHBA 2NPIA 2F9JA 3C7NA 2BM0A 3MM5B 3RBZA 1RTDA 2B9WA </