1NKBA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after three rounds of primer extension, following incorporation of dctp, dgtp, and dttp.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkbA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkbA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkbA01
4RW8A 3OYEA 4E7LA 4N76A 5KFGA 4JS5A 1ZJNA 5FRNA 3I0RA 2FBXA 3TFSA 3PW0A 1HQEA 3MGHA 3JYTA 4FM2A 4K8ZA 4IQUA 4N56A 3M8RA 5D46A 4IFVA 4F4XA 5KG3A 5JS2A 3QE9Y 1V9PA 3O4NA 5CYQA 3ZSXA 2F8TA 1S0VA 3VQBA 1HRHA 4JV0A 3AA5X 3OGUA 4M9GA 3VQ4A 4PHAA 2UVWA 5CWRA 3DRRA 1IKWA 4DL5A 4LZDA 5J0SA 3JPRA 5L1IA 4I28A 5J2KA 1RILA 4RW9A 2V4RA 4IG3A 4K4HA 1VSIA 7ICKA 1RDDA 3AVAA 4UB1A 2BQ3A 4Z4FA 1HQUA 2R8HA 3OYDA 4TQSA 2BCRA 1VSFA 5KFQA 3GV5B 3F9KA 3KKRA 7ICLA 2RDIA 4DWIA 4J9MA 2RKIA 4HHTA 1Y97A 4AILC 4ECRA 1C0UA 4FJIA 5BPCA 4K8XA 1ZJMA 2XHBA 3U6FA 1S6PA 4EEYA 4CE9A 4DSLA 1NOZA 3HSTB 3AA3A 4FW2A 2ITGA 3ZT4A 1ZQKA 4CJPA 3GIIA 8ICNA 4KB1A 3D45A 1EXNA 3PUFA 4BXOB 4YMMA 3DOKA 5C24A 3OYKA 2AU0A 3GV8B 2BQRA 2AGPA 4CHQA 4ID1A 5KFEA 2ZJ8A 3PMLA 4RQ8A 5EWEA 4RPXA 4CGJA 4CEOA 3RB6A 1ASVA 2YHBA 1J53A 3C6UA 4O4GA 4RQ3A 3C2MA 4E7JA 5J2QA 1BCOA 4MF2A 4CIGA 4Z0UA 3OYMA 2OA8A 5J2PA 3VA0A 3HL8A 3ULDA 3RMDA 5CB1A 2F1HA 4RNNA 1A5WA 4KHQA 2ZJAA 1C7YA 1RBVA 4Z6CA 7ICOA 4CJRA 3SQ0A 4UAWA 4KO0A 4F4WA 1A77A 3LDSA 4ED6A 3OYBA 3SUNA 2YNIA 3AA4A 4QZ9A 5FRMA 5IIOA 4GC7A 4RQ4A 3WNHA 3NBPA 1L3UA 1KCFA 1TK5A 4DS5A 4KI4A 2WTFA 3M8QA 3QEVA 4LSNA 3L2WA 3RBDA 2VG6A 4HUGA 3MR2A 3KD1E 5KFSA 3MAQA 2IC3A 3MBYA 2G8IA 1TL1A 1RNHA 1S5JA 3V6JA 5J1EA 4IFYA 4RG8A 4J9SA 1Z00B 1RT4A 2E6LA 4FZZA 3OYIA 2VWKA 3NF7A 4KHNA 5J2IA 3ASMA 3ZSYA 4CJWA 4RNOA 1C1AA 3O3HA 2NRZA 2HNYA 1SL0A 4I27A 5KFBA 4N47A 4M0AA 4CHPA 3B6PA 4Z4GA 3WNGA 4C8KA 2IHNA 8ICGA 1RT2A 4KLLA 4FYDA 2O4GA 1ASWA 5DKWA 7ICPA 2XGPA 3C1YA 4CJUA 1ZQHA 1XSPA 4CEZA 4E1NA 3HT3A 3T5HA 1ZQFA 4ELVA 1SUQA 4DTUA 1ZBUA 3O3GA 2JEJA 1ZQYA 2GV9A 3QNOA 4DL2A 8ICPA 4CJTA 5DG7A 1D9DA 4F3OA 2O4IA 3L2VA 1EKEA 4O5EA 3VQQA 2PFPA 1KRPA 1T4GA 5KFRA 1QE1A 2Z1HA 3RJFA 3QEAZ 4FK2A 4UB2A 4CFDA 1ZQLA 3AVFA 2R8GA 4M6WA 1XU4A 4BDZA 2A1RA 9ICGA 5KFNA 1ZQDA 4CIFA 4H8KA 4O55A 4CF1A 4DOBA 4YNQA 1Y88A 2QKKA 2ETJA 4YXMA 3T5KA 5I3UA 4UBCA 2XCAA 3BDPA 1NK8A 4RT2A 1DOQA 3SNNA 3V7KA 4CK1A 1JXLA 2V9WA 3OJSA 4NXZA 2G8HA 1JLAA 4NLZA 4KLOA 1MU2A 4I2BA 4CEEA 4BWJA 3S3NA 4M3TA 4I2QA 2HHVA 4IRDA 3OVNA 4CFCA 2FLNA 5KFYA 3ISBA 3RH5A 1YTUA 4KLUA 1BVSA 2GWSA 4OKJA 1WSGA 2XGQA 1J54A 3PW5A 3T19A 2BGGA 1S1WA 4CECA 3PO5A 2Z1IA 3SUQA 4PWDA 1C0MA 4DL7A 1LB2B 3AUOA 4B9SA 1EX4A 2YV0X 3TANA 1NK6A 1UAXA 3K58A 1GOAA 2I9GA 3QO9A 4FJ9A 5HNKA 3ETLA 1NJZA 1VSMA 1ITGA 4CJQA 3AVLA 5DBAA 5KI6A 4DQPA 3V9ZA 1L3SA 5KRTA 5J0RA 4DTOA 3NTUA 3K2PA 2ZD1A 1BPBA 5J29A 3ZDDA 5J2HA 4F5QA 2FPKA 5SWMA 1YVUA 4M3WA 1S1TA 4I2CA 4QW8A 3IAYA 1NK5A 1WNSA 1T8EA 3E2EA 3GQCA 4YMNA 2HHQA 5L1LA 4YP3A 1JL1A 4DTSA 3OYHA 4ELUA 4UB4A 1HYZA 4KTQA 8ICFA 1RTJA 2W8LA 4RQ5A 4M41A 3K5LA 3UXOA 4KB0A 4F3TA 5DQIA 2D5RA 5KFDA 1F21A 2DFHA 4JK1A 4G1QA 8ICAA 4O3NA 1XWLA 4M3RA 3K57A 4YQWA 3EYZA 3RR8A 4FJNA 7ICIA 4CEDA 2F1JA 1UA1A 8ICKA 5J2BA 2BKEA 4RUAA 4DOAA 4C8MA 1UOCA 3RBEA 2P66A 1TKDA 3JPNA 2BANA 1WSIA 4CF0A 4EYIB 2PZSA 4FCYA 4Q8EA 2OYQA 8ICEA 4KLSA 3Q8KA 3RR7A 2PFQA 4MEYA 3O4QA 2Y1IA 3ZSWA 3QEPA 1DGSA 3KD5E 3BQ1A 3ZD8A 1WSFA 4DTNA 2QXFA 3G10A 4KPYA 8ICVA 4KITB 1LV5A 4CERA 3IM1A 1CZ9A 2FMPA 2XY6A 4DFPA 1WSHA 3Q8LA 4IBNA 2PY5A 3M9OB 4BDPA 1PZNA 1RZTA 2JEIA 4KHYA 1ZQGA 2ZUDA 5F9LA 3KHGA 4ZTJA 3FYHA 4KLIA 3CM5A 2ZTEA 1XSNA 1MSWD 1RT3A 1D5AA 4UQGA 5J2CA 4BWMA 1S1XA 1JLFA 5C42A 3UIQA 4QWCA 4M45A 3PX4A 4LY7A 4M9NA 4RNMA 1ZQTA 4EP4A 3ZT2A 5KFWA 1HJPA 3RJKA 1ZYQA 4YXJA 4FS2A 5HRNA 4NLGA 2OPRA 3OHAA 1CXQA 3FDSA 1UT8A 3ISCA 4FJXA 3UQ2A 4EBEA 3N4MB 7ICUA 1D8YA 3EWAA 3MR6A 2ZE2A 5EWFA 2A1JB 5HRRA 8ICBA 5DG9A 3AA2A 4QZCA 2P6UA 4CJKA 4GC6A 2HHTA 4W5TA 1N48A 4B8AB 2ZUBA 3RTVA 2R8JA 1C1BA 1U47A 4F4ZA 1ZBFA 3V81A 4TUQA 4YMOA 1S9EA 4ZH4A 4ED1A 4Z4CA 1TV9A 3NF9A 3C5FA 3M9MB 4YFUA 3JPQA 4K4IA 3HPHA 3ZDCA 2WOMA 2OZSA 2V4QA 1NKCA 2DTUA 1TAUA 2G8WA 2VANA 3PV8A 3V9SA 4DSKA 4O3QA 2PFNA 1MQ3A 3A2FA 2P1JA 5J0XA 3RAQA 2MUTA 1UA0A 2BHNA 3B0YA 4RQ7A 5HMLA 1RCHA 4Y1DA 4ICLA 5J0YA 7ICNA 5CJ7A 4RQ0A 3P5JA 3RRHA 3MABA 2XY7A 3MXMA 4RQ1A 4CEBA 4O0JA 2IBKA 3QZ8A 3ZCMA 1BL3A 2Z1JA 4AHUA 1A76A 1QQCA 3O3FA 4M3XA 1BI4B 3RB4A 1X9MA 4I2JA 2XY5A 2FMSA 5D49A 1RT5A 4LZGA 2HVHA 3JPPA 4FJHA 1YTAA 1HNVA 5EU7A 3H7IA 9ICBA 1NJWA 3OYNA 3K5NA 1WN7A 1ZETA 3GILA 4CF9A 1QLNA 1ZQIA 2JZBA 4UAYA 1LWEA 2VG7A 5J0UA 4BE1A 1Z3EB 4CK3A 9ICTA 4M9JA 4M42A 3MEGA 1TKTA 5DB9A 4CJVA 4PUOA 1DLOA 3RB0A 2FLLA 4DTPA 4KREA 4TSXA 5HROA 9ICMA 1O1WA 1BPXA 4QZIA 4C8OA 4B08A 4IQVA 3NGDA 4M2YA 1RTHA 4OKEA 1L3VA 3GIJA 5KG0A 1RTIA 3Q8RB 2BPFA 3QIOA 4CF2A 4ZHRA 1QSSA 1B43A 3K4GA 3V7LA 4QZBA 3DYAA 3TAPA 5DBCA 4CFBA 4R5PA 3OY9A 4F4YA 1IKYA 4AHVA 4CEAA 5J0TA 4BE0A 1HYVA 1XO1A 4I2GA 2C2EA 5J0WA 4AHSA 4JUZA 3E01A 5KFVA 1XI1A 3AO5A 4QCLA 1ZBLA 3H08A 1JN3A 3MXJA 4ED0A 5HP1A 4HCCA 3PY8A 7ICHA 1ZQMA 4DTMA 4M3ZA 3MFIA 3NGYA 5FROA 2JEFA 1S10A 4WE1A 3F73A 4L8RB 1FK9A 2JLEA 8ICJA 3LZIA 4Q44A 3DLEA 4FLZA 9ICKA 4DTXA 4GLXA 1ZQEA 3SUPA 3RB3A 5DDYA 1JLGA 1RDCA 2P6RA 3WNEA 4GW6A 3C5GA 4B9LA 7ICQA 1H38A 3RJIA 2YKNA 2PFOA 1IG9A 3IS9A 5KFAA 1RBRA 8ICHA 4DL6A 3OYGA 3B6OA 3GFKB 2DY4A 7ICEA 2KFZA 3QEXA 3JPTA 4CHZA 4J9PA 9ICVA 9ICCA 3QIPA 3VQCA 4M9HA 7ICRA 1IXRA 4M47A 4I9QA 1KVCA 4FS1A 2W9CA 4FBUA 4O0IA 3TAQA 1LWFA 1TVRA 3SCXA 3PR5B 4O5CA 3DM2A 3OYCA 4F5NA 4KKOA 4EZ6A 1KVBA 4OPKA 4PHPA 1RYRA 2XO7A 1S0NA 4KFBA 2OPSA 1R0AA 8ICMA 5DDMA 4KLHA 3PNCA 3TARA 4ECUA 1T7PA 1VRTA 1S1VA 5J0PA 3CFPA 3DLGA 3NGZA 3G6XA 2FMQA 3MDAA 4J9LA 1RT6A 4FLXA 2HHUA 3OYAA 4KLDA 1W0HA 1FKOA 3IG1A 2BCQA 1CUKA 1ZBIA 2G8UA 2F8SA 1Q9YA 4RUCA 3BQTA 4YD2A 3I0SA 2P51A 3ZT3A 1COOA 1ZQVA 4ED8A 2ALZA 2BCSA 4R8UB 1LW2A 3V9UA 4BDYA 1ZBHA 3ZDEA 5TZVA 4OLAA 1WAFA 1LW0A 1ZQZA 5EWGA 4IDKA 5DGAA 2X6NA 3VQ8A 3AV9A 1K1QA 4KN4A 4R65A 2DFEA 5DG8A 4Q0BA 3FFIA 4PY5A 4QZ8A 4JRPA 4J9OA 2DFLA 1ZQSA 4JV1A 3HO1A 4TQRA 5KG5A 3AU6A 4KAZA 1KFSA 4IG0A 8ICTA 4MFCA 3LP1A 3IRXA 3KHRA 8ICXA 1DTQA 4FLUA 4NYFA 1TGOA 2LYHA 4CFAA 3HXMA 4YVZA 5K14A 3HK2A 3RWUA 4KLTA 3C23A 4XQ8A 2H5XA 5KG2A 4ED3A 4I2IA 2BDPA 1CLQA 3HPGA 4M3UA 3NF6A 3SPZA 4BXOA 3T3FA 1G15A 5HBMA 4CGDA 3MDCA 4JRQA 4NLKA 2VG5A 4O5KA 4FJ8A 4TUPA 3BGRA 1BCMA 3AO4A 2BCVA 3H4BA 5IINA 1N6QA 4ECWA 4QW9A 1NJXA 2PYJA 4R66A 2VWJA 3DLBA 4MQ3A 4YFKA 4DMNA 4QWDA 4FLVA 3K75D 4KI6A 1JLEA 4F2SA 4F92B 4BGDA 3C6TA 4YCXA 4FM0A 1XSLA 2HHSA 4W5QA 3V6KA 3S9HA 2FPMA 4IQTA 1ZQQA 4TURA 1JLQA 3EY1A 3KIOA 1D9FA 1RT7A 1RTDA 5KTQA 4ID5A 3CFOA 4DU3A 4EBDA 3DI6A 5DLFA 4YR3A 5DQGA 4PHDA 3ORYA 4XA5A 4QWEA 4J9RA 3TAEA 3DOLA 2FC0A 5HRPA 3OJUA 4CGGA 4PHEA 4NCBA 3GV7B 2KW4A 4CJEA 2I1QA 7ICFA 7ICJA 1Z00A 4ECQA 4B9VA 4KLQA 2IOCA 3L2QA 4OLBA 4QZGA 5HHHA 4PPXA 3SQ1A 2JGUA 3VN5A 5HP4A 4IR1A 3KLIA 2BQUA 5DGBA 2X78A 5BOLA 4KLFA 2G8KA 2KFNA 3GDXA 2RPIA 2ZQBA 2QKBA 1JMSA 4JWMA 3G0ZA 1D8LA 1X9WA 3HP9A 4RPYA 3G6YA 2BGWA 1IKVA 3DRPA 4E89A 4CGFA 7ICVA 4ED2A 2G8VA 4O9MA 4GXKA 2RN2A 2W9BB 1RT1A 4F50A 1IKXA 3OSPA 1B9FA 3HM9A 4UBBA 2HB5A 3QEBZ 3CFRA 3L8BA 3DRSA 2IDOA 1I3AA 7ICSA 5HMMA 1K1SA 5KT4A 4AHCA 4YR0A 3RJHA 1QTMA 3LZJA 1HUZA 3P83D 1REVA 4FZYA 2X6SA 3LPTA 1QS4A 2BPCA 5J2DA 2MAXA 4K4GA 3SI8A 4G3IA 5DB6A 2OPPA 3EPGA 4FJJA 3PR4A 5KGWA 3QLHA 4MFBA 4DS4A 2R8KA 2NRTA 5DMRA 2XY8A 1S76D 1KDHA 4CGIA 4QZAA 2HHXA 3L2RA 4LH4A 2PI4A 5KGXA 5J2EA 2W42A 3KLGA 1ZQNA 1U4BA 8ICRA 3ZSRA 3V9XA 4CJFA 4J9QA 2ZUCA 4N5SA 4RU9A 1MQ2A 4J2BA 4QZDA 3NE6A 3VQPA 4B3OA 4E7IA 1HUOA 5HRSA 8ICCA 5E41A 4DTJA 1TVAA 4RT3A 3V6DA 3MEEA 4J2AA 4R64A 5KFZA 1BPEA 3V6HA 5J2GA 3SQ4A 1B92A 1U48A 1HMVA 2BE2A 5DB8A 4Z4HA 4I2AA 1AROP 2KZ3A 2JEGA 1WSEA 4FK0A 5DQHA 4B9TA 1S0OA 4C8NA 4CESA 3NHGA 1UWBA 4OJRA 4I2PA 4LVSA 2PI5A 4CF8A 5KG7A 2RF2A 4M9LA 1RBTA 1XHZA 3MECA 4XIUA 4CJ4A 4F93B 3SI6A 4I2FA 1MC8A 9ICPA 4FW1A 3G6VA 2OPQA 3L3VA 3WNFA 3Q8SB 3KKSA 4FLYA 4P4OA 3MGIA 2D0CA 7ICTA 4NM1A 1SZPA 3QERA 2Y1JA 3DLRA 4TUSA 1BQNA 3PW7A 3H8WA 4E1MA 1WCNA 5J2JA 4CJ3A 4FZXC 4MFAA 2UVVA 1S9GA 4F4KA 3OS2A 4KMUA 4AHRA 2XCPA 3V7JA 4B9UA 4EZ9A 3ALYA 3TWHA 1I39A 3L2UA 2IA6A 4DFKA 1N56A 1BPYA 4FBTA 4DU1A 5KFPA 3HP6A 4MF8A 3ISDA 2IHMA 3S3MA 3ZSOA 4DQQA 3PW2A 2G8FA 3OHBA 4ELTA 1KLMA 3OYFA 4OGEA 4B8CA 3KTQA 4DSEA 3UXNA 3QETA 9ICFA 9ICNA 3RH6A 3VQ7A 2Q0ZX 1NK9A 5KT7A 1S97A 3AO1A 3M8SA 3RH4A 1ZQWA 2ASJA 4JV2A 1BHLA 4M04A 2KZZA 5CYMA 4PGQA 9ICJA 3TR8A 4Y1CA 4I2DA 3LANA 4ECXA 9ICIA 4RW6A 3C2LA 4O3RA 8ICUA 4KV8A 2B6AA 1EXQA 4Z4IA 3CG7A 2IS3A 3NH2A 4FO6A 2VA3A 3U3GA 4KHUA 2EX3A 1XHXA 3SJJA 4FVMA 3L3UA 4LD0A 3IHQB 4FK4A 4M3YA 4KN7A 1SV5A 4NM2A 3JPOA 4I2EA 1WLJA 3AVHA 2E4LA 3MXIA 1TAQA 1RYSA 5DBBA 2BR0A 2J6TA 2A1JA 9ICOA 4DO9A 4KTWA 4DLGA 9ICUA 4NLNA 1WAJA 2QK9A 9ICWA 1TKXA 4CCHA 2FBYA 1S77D 4CJSA 5CR0A 2DPJA 2C2RA 5CA7A 1LWCA 2X74A 3PMNA 4J9NA 3CQ8A 4KLJA 1VSLA 1Z26A 1RPLA 4Q45A 4RQ6A 4YG2A 5J0QA 3V4IA 3KJVA 4YD1A 4RPZA 4DFMA 5JUMA 4HYKA 4JS4A 4DU4A 5J0OA 9ICRA 1K6YA 5EOZA 4PGXA 4ED7A 4YR2A 4CIEA 3C95A 1TK0A 4Z6EA 1J5OA 1IM4A 5DB7A 4DSIA 3LALA 5KFKA 3ZD9A 2KN7A 3S3OA 3TFRA 1C0TA 4DL4A 1BIZA 1X1PA 3AVNA 4F8RA 4Z6FA 3DLHA 5F9NA 5JS1A 1ZQXA 2WONA 3N97B 1QHTA 3C21A 2R7YA 2KQ2A 4W5RA 4PGYA 8ICYA 3AVCA 3V1OA 2R8IA 3ZSVA 3H8JA 4QOZB 9ICEA 4KLGA 5DK5A 4IRCA 3AVMA 3LP3A 1BI4A 4IRKA 3VQ9A 2XRIA 9ICLA 2W9MA 4M6WB 2J6UA 3K5OA 3NDKA 4FXDA 3TAGA 4FJ5A 3RMCA 3LWMA 1ZQPA 3H4DA 4RW7A 1HJRA 3KLHA 4KHWA 2NUBA 1S0MA 4W5OA 4DOCA 2VA8A 4ECTA 1SKSA 5SZTA 3KLEA 4CEFA 4EP5A 9ICXA 2B5JA 5KT3A 4F91B 2W9AA 1KFDA 4UB5A 4GXJA 4PH5A 4CHYA 1JLBA 5J2NA 4ECYA 4E3SA 3PO4A 3CYMA 4DFJA 1XC9A 4HCBA 9ICHA 2HNZA 5KFJA 5IIKA 2D0BA 2GBZA 4FJLA 3AVKA 4FLTA 1KEJA 4J9KA 4DQSA 3OS0A 2F1IA 1ZQAA 3SPYA 5KG1A 1KSPA 4RZRA 4P2HA 4KLMA 3JSMA 3Q8QB 3MEDA 4DG1A 4MEXA 3NAEA 3Q8MA 2ZTCA 4CEQA 4ECZA 3ITHA 1SL1A 1CEZA 4KLEA 2P5OA 2OZMA 3KK1A 3MR3A 1JXEA 3PW4A 2AGOA 5KT5A 1J9AA 3OYJA 3NGIA 5KFLA 4AHTA 4HTUA 4UAZA 4IR9A 4I9LA 1XS9D 3PVXA 4NY8A 2M9NA 2AQ0A 2RDJA 4C8LA 4DTRA 5KG4A 2HHWA 3AO2A 4RQ2A 3U3YA 3D0PA 5L1JA 8ICSA 1NK0A 1VSEA 1NKBA 1QSLA 4XUSA 2FBTA 1B9DA 3LDAA 1BIUA 1Q8IA 3VQAA 4I7FA 3H8SA 3KK2A 1L3TA 3SQ2A 4E7HA 1KVAA 3HVRA 1UT5A 4DSFA 2AGQA 1SL2A 2YNGA 4HUFA 3AVBA 3QEIA 1IH7A 1HPZA 3MR5A 3B0XA 3KHHA 1TL3A 3HYFA 1GOCA 4RW4A 3HW8A 3QEWA 5J2MA 4QWAA 2ISOA 3HX0A 5KFIA 3OYLA 5I42A 3EZ5A 4DSJA 3EPIA 2DPIA 1VSDA 3TABA 8ICZA 4EBCA 2C22A 2HW3A 4I2HA 1S6QA 5CZ1A 5KFTA 4I29A 3KLFA 5C5JA 3QESA 3HJFA 1U49A 4F2RA 1YT3A 4DQRA 4DF8A 1RBSA 3H40A 1TK8A 1LAVA 1S1UA 2PXIA 7ICMA 3SZ2A 2E6MA 5KFOA 1CXUA 4PQUA 3TI0A 2C28A 2BPGA 2XC9A 1W9HA 4DQIA 5KFXA 1EETA 2AQ4A 3VQEA 4F5PA 5IILA 2FBVA 2FPLA 4CK2A 2HNDA 3SV3A 3LAMA 3VQ5A 1BQMA 1ASUA 3HVTA 3P1GA 2VA2A 5CY4A 5FDLA 4X5VA 3MFHA 4Q8FA 5KFHA 4CHNA 4R8UA 2NRVA 2ZTDA 2ASDA 2ASLA 1B22A 1NKEA 1JLCA 3LK9A 3M9NB 3ZSZA 2IGIA 1ZQBA 1U04A 3OSNA 3ZT0A 4CGHA 3BJYA 5KT2A 4B9NA 2YHAA 1HNIA 1ZQCA 2UVUA 4LH5A 1VSJA 3LP0A 4DEZA 4J2EA 4O3OA 2KTQA 4FLWA 3VQDA 2AJQA 3V9WA 4CJLA 3TAFA 4ECVA 1JKHA 3QNNA 4UB3A 3LWLA 2D0AA 1VSHA 4B9MA 4R63A 5D3GA 1RXVA 3V72A 4KTZA 1JX4A 3PX0A 1BPDA 4QZFA 2YKMA 1BGXT 3UQ0A 1EP4A 5IIMA 1ZQRA 4Q43A 1U9LA 4E19A 1L5UA 2FLPA 2ATLA 4OGCA 4IQWA 3RAXA 2HVIA 1DTTA 5IIIA 3KK3A 3PX6A 4DL3A 4GVMA 4FJ7A 1NK4A 2MUTB 9ICQA 2B4JA 4NYNA 4O3SA 3Q8PB 3ZT1A 2EHGA 1VK0A 2IAJA 2I5JA 3ISNC 4PA1A 3V1QA 2C2DA 2A1SA 2OWOA 3GIMA 5KFUA 3TQ1A 1VRUA 4QZEA 1JIHA 1LAWA 3AU2A 3AVJA 4BE2A 8ICLA 4ECSA 3RJEA 3EW9A 1ZQOA 3ZSQA 3CM6A 3UPQA 3SYZA 1BPZA 4P4MA 8ICIA 1JL2A 5BOMA 2BCUA 1A5VA 3NFAA 3DLKA 3OS1A 1Q9XA 5C25A 5KFCA 3QINA 1T3NA 2PYLA 4MFFA 1TFRA 1SKWA 1TV6A 5IIJA 2HMIA 1Z25A 1NOMA 3HWTA 4GXIA 2YNHA 4IKFA 5J2AA 5D4BA 5L9XA 3RMBA 3KHLA 4O3PA 2JZBB 2UVRA 2DFFA 5KG6A 2P5GA 4CJ5A 3SV4A 4NCAA 5J2FA 3JPSA 1ZQUA 1WCLA 1ZQJA 2ATQA 1U45A 3RJGA 1RDAA 2IMWP 3RRGA 1FKPA 4Q5VA 3AO3A 4QWBA 5KRSA 4ZTFA 4QZHA 8ICWA 3RJJA 3RMAA 5L1KA 5KFFA 3BQ0A 4YN4A 1JXBA 1KTQA 3C2KA 1KFTA 1X2IA 4JWNA 5KFMA 2W9BA 4FJKA 3DMJA 3NCIA 4OVLA 2ISPA 5CZ2A 2B21A 4J2DA 4FJGA 1QSYA 4FJMA 3T5LA 3LAKA 7ICGA 9ICAA 4O44A 1KLNA 4W5NA 2J6SA 1VSKA 4F5OA 2GUIA 3ZDBA 2ZJ5A 1WSJA 5HLFA 2W8KA 4CHOA 1RXWA 4KRFA 2Q3SA 3M8PA 3GIKA 3C94A 1NJYA 4Z4EA 5KT6A 4HVJA 3UXPA 1NK7A 1A5XA 1FXXA 4OPJA 1SKRA 8ICQA 3NF8A 9ICSA 4BACA 3T1AA 1CZBA 3C1ZA 3T5JA 4OKKA 4QAGA 5DLGA 4JLHA 2NRXA 4O5BA 1RDBA 3THVA 3TAMA 4LSLA 1BISA 3I8DA 3ZDAA 4XRHA 4EYHB 3LP2A 3V1RA 3AVIA 5CP2A 1T05A 4DF4A 2F96A 3VQ6A 2LSNA 4AH9A 1N5YA 3NH1A 4E7KA 2Z1GA 1C6VA 3LPUA 4N41A 3QZ7A 4Z6DA 3BQ2A 3HPOA 2KZMA 2NRWA 4H4OA 8ICOA 4HUEA 4P4PA 5HHIA 4E0DA 3SUOA 3K59A 4GMJB 1GOBA 4H4MA 1S9FA 1RBUA 5CHGA 4NCGA 1IO2A 1T03A 1NOYA 2YNFA 2W9CB 1C1CA 4FM1A 3K5MA 4F5RA 4DLEA 5T7BA 3NH0A 1HYSA 1X9SA 3AVGA 1TKZA 3VA3A 4KHSA
chains in the Genus database with same CATH superfamily
1JLBB 2IIRA 4RW8A 2NXUA 4WTOB 2M2BA 4ZCLA 3H3OB 4N76A 1R0AB 4JS5A 5FRNA 1HQEA 1VQ8S 2OTJN 1VRTB 1S1VB 2AYGA 4B3TF 2RS2A 2E2NA 1S57A 1VQNS 5C2CA 1ZM4A 2MY8A 2HFUA 3FZMA 5JS2A 1BWEA 3QE9Y 5T41A 1HNZJ 3O4NA 2XZTB 3QXGA 1Z4UA 4GV9A 1S0VA 4HT7A 3KG1A 2P6TA 5BRFA 1CI4A 1VGYA 2FLOA 3AA5X 3VEXA 1N63A 4UY8O 1WSVA 1FESA 2UVWA 2DTJA 2F4FA 4K0KF 4CYUB 2VGMA 2E88A 4A8WA 3I0SB 3JPRA 5L1IA 5FIIA 4RW9A 5TKWA 2V4RA 3C15B 1VSIA 2G5HB 1LW0B 3AVAA 4UB1A 2GFFA 2ZIVA 2R8HA 2V69A 2E1CA 2DNHA 1WG8A 3FQLA 2RDIA 1XMOF 3DKDA 4W98A 2WHEA 3VETA 1NM1A 2KHOA 4B3RJ 4V1Ak 1JNZB 2L9DA 3R7NB 2GAGC 4K8XA 3D0HE 4K7QA 4EENA 1HFEL 4DSLA 5HMYA 2UXDK 5K14B 4FW2A 4ZA1A 2ITGA 3DOMB 1SH2A 2CQ0A 2VFVA 2MLXA 4OJ5A 3IRUA 4DV4F 1PSDA 5EWEA 1X4FA 2OLWA 1Q8LA 4CEOA 1MA9B 2Z2MA 2YHBA 5GAGI 3C6UA 5FLXO 2DL0A 3QAEA 4LREA 4Y2AA 4DV1F 1FJ7A 3QUQA 3K9JA 4MF2A 1CZAN 4LF7K 3W9HA 5J2PA 5CB1A 1NGAA 2YB1A 4KHQA 2J0QD 2UXCF 4HVZA 5A0YB 3C6TB 3JAMO 3OQ2A 3SQ0A 3FCWA 4P0QA 4LRAA 5SUHA 1WG1A 4ED6A 3UO0A 4G1IA 3OYBA 4RO0A 3SUNA 3WEEB 3W3DA 1RTDB 2XSJA 4RQ4A 3TA2A 1HA1A 4P74A 1X4BA 2BJ3A 4KI4A 3M8QA 1YSJA 3PKMA 2FGCA 4ILHA 3A8YA 1VBZA 2FSNA 3X3UA 4DUYJ 2IC3A 4JI1J 3DOLB 5ALVA 2P9UB 2G8IA 3I56N 3SLCA 1LXJA 1AA1B 2J4RA 4IFYA 2Q97A 1WSRA 2ES6A 1Z00B 1RT4A 3E3XA 1VQON 3NF7A 2MYFA 2N82B 2P9KA 3PSPA 3I5BA 3ASMA 3L95X 5A8WB 5KFBA 1N5VA 4ZJOA 3WNGA 2OTJS 2IHNA 5HO4A 8ICGA 2JL9A 2FD2A 1Y3KA 1IKVB 4PL7A 2QWRA 2KEYA 4IDHA 5EN1A 7ICPA 2YWFA 3VCBA 3KZIU 4CJUA 1XSPA 3NNHA 1ZQFA 4CO2A 2P5VA 4XDCA 1RT1B 4ZIVA 1IKXB 4CO1A 2ZGYA 1EAYC 4CJTA 4ZJQA 5DG7A 4RCHA 3LO3A 4F3OA 2IM3A 2V51B 1NNLA 1Z2LA 2PFPA 5IWAK 3TZZA 1KKXA 5F8HA 4NYPA 3GZ7A 5LMNJ 2W7PA 1FCAA 1XU4A 2VASA 3HRDD 5KFNA 1ZQDA 4H8KA 4O55A 4CF1A 2XMMA 5ALLA 3Q7BA 1N61A 4J7CA 4K4WA 1T02A 4DUZK 3SNNA 1IVZA 3Q24A 3OJSA 3JB9k 3LDNA 4JOUA 1X7VA 5BR8J 4OL8A 3CCWA 2CZ4A 3S3NA 5GAHI 3RSEA 4M3TA 3OVNA 3E58A 3ISBA 1YTUA 3GFHA 1BVSA 2L9WA 3MEEB 3IWXA 4OKJA 4CBWA 4BRDA 3BBBA 2CQGA 5TKYA 3H20A 1S1WA 4BQZA 4GKJK 3CVKA 4L3KA 2X3DA 5HK4A 4JI5K 4PWDA 4DL7A 2LQ5A 4IJAA 3AUOA 1KOHA 3DLKB 2YV0X 3RU0A 1NK6A 1VCTA 5E5NA 1C4AA 2I9GA 2ABYA 4A8XA 4URGA 2V34A 2GIRA 4L76A 2NZ4A 2YNHB 2DXEA 1ITGA 2R7VA 5ETKA 2EZZA 1YBAA 3FZLA 2KDOA 1OVQA 1CC8A 2QKQA 3T9NA 1ZM2A 1BPBA 4OJOA 5THWA 2UU9F 5BXIA 4LF4J 4F5QA 5AZJA 3J8AA 2M70A 5L38A 2XMJA 3DXKB 5SWMA 1S1TA 3IAYA 1NK5A 1BQNB 4DR4F 3ZZ0A 5GVQA 5E2QA 3WQPA 4YMNA 1JL1A 3I56S 3BKTA 3OYHA 4ES2A 4ELUA 4FKXA 2EBEA 3HHEA 4KTQA 2BKOA 4F3TA 4Y65A 5DQIA 1RAEB 2VDIA 3NRBA 2QSFA 3KWMA 1CJVB 3OTDA 5AI6A 1VQOS 3CCUN 2PFUA 1XWLA 1VC5A 5BREA 2ZH1A 2D69A 3K57A 7ICIA 4CEDA 3EUB2 3AT1B 8ICKA 1NMDA 3W64A 4NA3A 2BM0A 3AOAA 2ZIWB 3RBEA 4U7BA 4B6JA 3O1WA 4HTIA 4BBYA 4Q8EA 3HJEA 4Y34A 2D3O1 1FERA 4FPAA 2VKZG 1IJEB 3QEPA 1WSFA 1MN8A 5GAEU 2QXFA 1W97L 8ICVA 4KITB 3FAHA 1LV5A 1F1BB 4B02A 3MM6B 2KFYA 2LEAA 1OPIA 4FZNA 5IT4A 4WKRA 4DFPA 4X2BA 2JC1A 1OH6A 4IBNA 3HHLD 4K4VA 4BDPA 4NX9A 1EIYB 1ATNA 1LFWA 5HJXA 4ZPBA 4KHYA 1ZQGA 3MOJB 3AOBA 2Z0GA 1RKIA 3FYHA 4NL9C 4KLIA 1XSNA 4QQBA 5J2CA 2J8SA 4BWMA 1S1XA 2JLFA 1FVQA 2H65B 4QWCA 1K47A 5B0BA 2ZM6F 2RMLA 2ZZNA 1ZQTA 4LRDA 1RDRA 4JI1K 3EMTA 4X66J 3CJQA 5AQRA 3US5A 5DM6L 1ZYQA 4YXJA 4FS2A 1C1CB 5HRNA 1QCKA 1FFUA 1NSQA 1Y10A 2G2OA 1UT8A 4JI3K 2YMQA 3ISCA 4ERDA 2WC9A 1QJHA 3E66A 1JNRB 7ICUA 2LKZA 4BR7A 3EWAA 4M5KA 2AW0A 4NRUA 2RLTA 5C15A 3SMVA 1CULB 1O08A 3MGJA 3HZEA 2E9ZA 3CD7A 2WHOA 3J7ZO 3BKUA 2DWQA 3CNHA 4AP9A 1RADB 4EU0A 4BRNA 1DK3A 3AXMA 1Q53A 4JI0K 2ZUBA 3UN3A 3UWTA 3QJLA 1C1BA 4V19J 4F4ZA 3KFWX 1ZBFA 1T9UA 3BR8A 2OO4A 1L8OA 4ED1A 3CGIA 2EAPA 3D9BA 4EWTA 1ZXOA 1SWWA 2KXHA 5E26A 2M7SA 2YQEA 1N5SA 2CJBA 4K4IA 4Z7CA 3QGHA 2V4QA 2M9KA 3S6JA 4ZDNA 1VBYA 3H5UA 4DSKA 4O3QA 3T1YJ 1R89A 3BP8A 5JVGQ 1HKCA 5DDPC 2P1JA 3RYLA 2PBDA 5JLFA 2HFVA 1D8ZA 1YTYA 2MUTA 4CNYA 2C3MA 4X62K 2BHNA 1RCHA 1U26A 1V85A 4ICLA 3MCMA 5AQHA 5AQWA 2W6KA 2IRXA 1UVMA 2IBKA 2R7WA 4PL2A 2FZKB 1BL3A 3N7RC 4WPAA 4AHUA 1A76A 2KXFA 4B9QA 1IBKF 5AM4A 2QTWA 4CM0A 3OVBA 1X9MA 4A8YA 1RT5A 3HSDA 2HVHA 3Q0AA 2RDDA 2CH5A 3R9LA 3H7IA 1OSDA 9ICBA 1RUSA 1OY9A 2R2UA 3GDQA 3OYNA 1ZXIA 5ETVA 4PAAA 5AQSA 3GILA 2P9GA 5J2NB 1ZD2P 4CF9A 1Q7YO 3G86A 2CZ9A 5J0UA 1Z3EB 9ICTA 1EQMA 3SCLE 1N32K 2IM0A 2UUTA 2XIDA 2V4JB 2V7ZA 3FZBA 5DB9A 4CJVA 1FJGK 3VAKA 2HG4A 4NJ8A 1F0MA 4KRWA 1O1WA 3THYB 3NVWA 3JSMB 4IQVA 3MEDB 2F4VK 1VJ5A 3GIJA 4UF4A 1NEEA 3Q8RB 2YQ1A 4IH6A 3ITHB 2K4IA 2JZ5A 3K4GA 4DR3K 2A3VA 3V7LA 2QLWA 3CF5Q 3QPIA 1T0TV 4F4YA 3PRVA 4CEAA 1HNWK 4BE0A 2GJ2A 5H9FK 3UR3C 1HYVA 2J9CA 4I2GA 4AHSA 4D3GA 4PHTX 3E01A 5AI4A 2KT2A 1V3ZA 3HF5A 1QUPA 4WFXA 1ZRMA 3TVYA 5IC6B 4TYBA 1HUXA 5LT5A 3FEXB 3MXJA 2U2FA 3KNAA 3CRXA 1ZQMA 1JJ4A 4DTMA 3MFIA 3NGYA 2HBZB 2JEFA 1O03A 1GT8A 3SBTA 2LQ9A 1JK9B 8ICJA 1JQGA 1EJ7L 3PIOQ 4Q44A 3VEYA 3HVAA 3UVJA 4DTXA 4ZVQB 2JRZA 5LM7E 3CIPA 3SCKE 5DDYA 2PC6A 1N33K 4LR9A 2WB1C 4CDIA 4DZ6A 1BOTO 4JAXA 1N60A 3RJIA 2YKNA 4JHDA 3IS9A 2PMZC 3QNWB 2B9XA 3BS5A 4K50A 1XNQF 2KFZA 3FRYA 4GY2B 3SDEA 4J9PA 5I42B 3W1YC 5AQYA 3BGOP 3VGTA 3QIPA 2FVCA 3C8YA 1ZC6A 3FBFA 3OTOJ 4M9HA 4DR1J 1PGZA 3KLFB 4M47A 4RU2A 2OMOA 5E3CA 3SCXA 3DRXA 1DRGA 4RWXA 3OYCA 2HRYA 3M2UA 3IMXA 3L0QA 3P45B 4GKKK 4KJIA 1HBMB 3CCEN 1V6HA 2ZJPL 2O8EB 1R0AA 8ICMA 4W90B 4FOIA 3G25A 1J2VA 2A18A 3TARA 4ECUA 3FQKA 1VRTA 1S1VA 2AXTU 3NGZA 5CQGA 4FYWB 4OI4A 3G6XA 4FLXA 2HHUA 4QJFB 1ROFA 4KLDA 4BUGA 2W03A 4CI6A 2WBRA 3KZXA 4CYUA 1Q9YA 1YJRA 3MMAB 3FNNA 1BO5O 3I0SA 3GLJA 3QO9B 4U7UK 1ITPA 3C15A 3ZDEA 2H3GX 1WAFA 3KKAA 1LW0A 5DGAA 1VK8A 4KN4A 3IKMA 3K2YA 2DFEA 5DG8A 4KH1B 1PCAA 3GZFA 2HQ3A 2FC9A 4IL6U 4JV1A 3QICA 2LM4A 3AU6A 2FSKA 4G65A 1RQ0A 2W01A 4FF1A 2CJKA 4KE5A 2JHDA 2E5LF 1KFSA 4LF6F 2PKEA 4PQAA 3SAFA 3CIMA 4P9SA 3KHRA 2XSFA 4FLUA 5AQXA 5BYSA 1V97A 4H5WA 5K14A 4KLTA 1X4AA 2AX1A 2WVFA 3DOMA 3C23A 1JKHB 4K25A 4XQ8A 5KG2A 4JI8J 2BDPA 1VQ9N 2WVEA 2G9OA 4X64F 4M3UA 3VGMA 2W7AA 2DGVA 5HJYA 3C16B 3FK4A 2OP5A 4CI0B 4ZVRB 2XI3A 5EY4A 4PPZA 4DV6K 4JV5F 1R6YA 4JI2J 3AO4A 1VLYA 5J8YC 3GE1A 3NCRA 4QW9A 2E3TA 2C2MB 1UFWA 3X1LB 5ADXA 3R7BB 2GHWA 3CPWM 4NLRA 5A0YA 3C6TA 3UN5A 1IR0A 2GO7A 2CPZA 3UM9A 2FPMA 3WEEA 3AQEA 3C14B 3UMGA 3I9V9 1Q86T 3KIOA 3THWB 1RTDA 4HH0A 5KTQA 3D0GE 2XS7A 2MKYA 4KMOB 4YR3A 2QB0B 3ORYA 4OHWA 4ZN1A 3R5DA 2WZ1A 3CNQP 1X5PA 2HQGA 5B66U 5C25B 2GMJA 3DOLA 1N36J 2SXLA 2P9UA 3OJUA 5HRPA 1F44A 4ER8A 3GV7B 2CNKB 4CJEA 1R8BA 2DGZA 2I1QA 3TSPA 7ICJA 1Z00A 1VDHA 4ECQA 4KLQA 3L2QA 4OLBA 2ROGA 4DCHA 5HHHA 2VJUA 4JKCA 2JGUA 3UNGC 2CQBA 2VCPA 4IOXA 3VQTA 5U47A 2ZQBA 5A8WA 1N5XA 2ZHAA 1JMSA 3KYLA 1SPBP 1V9OA 4EO8A 1IKVA 3J7YP 1RQNA 3V4MA 4C1NI 4E89A 1MMNA 2G8VA 5AM0A 4GXKA 4PEOA 4CRXA 1RT1A 4X65K 4F50A 1IKXA 3C29A 2WBNA 3SCJE 1B9FA 1R27B 3HM9A 2Z8QA 3NMAA 3K8VA 3CFRA 1YWXA 3A3OB 2KIWA 4JK8A 4EX6A 4XK8C 1FNMA 4UW9A 3KZBA 5AQTA 3CETA 5AQLA 1HIYA 4AT1B 5J2DA 4QIWD 5JMNA 4K4GA 1TUWA 5DB6A 4CE6A 2PMZD 2AJ4A 2NLWA 3JS6A 4Z94A 2V2KA 3L2RA 4LF2A 4Y00A 1IBMJ 5KGXA 2B9YA 3MF5A 3ONQA 1QAJA 1JWWA 4DR1K 4C8YA 1ZQNA 3D6HB 2V68A 4LSLB 3TAMB 4JD2B 1N4LA 4LFAK 3KKFA 3UPFA 1NGHA 3A8JA 4QZDA 4JKBA 3HKZC 2AZ3A 3VQPA 1VQ9S 1HUOA 5K8OA 8ICCA 3NWRA 4NLUA 1Q79A 2FF3B 4KH0B 3MEEA 4WJ3B 3ZETB 2LEPA 2P9NB 7AT1B 1WUDA 3HHDA 1SQGA 4LFCF 3ZTQA 3V6HA 3NKYA 4OJHA 2ZJRQ 2YNFB 2RE2A 1VQ4S 4Z4HA 3VAIA 1HNXF 3SQGB 1GX5A 5AIBA 2P9PA 2JEGA 4MMOA 5DQHA 4B9TA 4X4QA 4C8NA 1DZ5A 4LFBF 4OJRA 4QJVA 2YWKA 2H3FA 2Z57B 2UUAJ 3HOTA 1SC3B 4BLGA 3JYTB 1CLFA 5AI0A 4XIUA 4OI1A 3MCSA 2DT9A 2C3OA 2LA6A 1W7AA 2VH7A 4OLOA 2GTDA 3L3VA 2O66A 3WNFA 3DXKA 3Q8SB 4IFVB 2NXCA 4Z7YA 4NM1A 4AXJA 3G87A 3DLRA 1BQNA 1Y5IB 1NU0A 5AKJA 1APSA 4OMFG 1M5VC 5CXTA 4FZXC 4MFAA 1RHMB 4F4KA 3OS2A 2X1FA 2DK2A 5AQGA 2XS5A 1CJVA 4IG3B 3E51A 3QFHA 1SJRA 1NGGA 4OYXA 5M2RA 1BPYA 2JLGA 4DU1A 5KFPA 1P7DA 2O8CB 3ISDA 3CD5A 2E5JA 4RLEA 3QYYA 2GQQA 4Y2JA 2ZIWA 4W92B 3PW2A 2G8FA 3THXB 4OGEA 3KTQA 1DBDA 3H42A 3C7NB 1RGIA 9ICFA 5GADI 4X4RA 2Y9UA 3VQ7A 3IRWP 1S97A 2XZWA 5GAHU 3RH4A 1HW8A 5M2PA 3DNCA 5ETMA 2FTRA 3MM6A 2K8BB 4JV2A 2KZZA 1EX8A 5CYMA 2V7YA 9ICJA 1DHMA 3L3CA 1OO0B 4I2DA 3S6EA 3C2LA 4ES1A 3TNVA 4YY3J 1FEEA 2CUYA 1RZMA 3ILJA 4O3RA 8ICUA 3SD7A 1L3KA 1CJKB 5K5MA 4Z4IA 2KKPA 2VJ4A 2IS3A 2BW2A 5D0RA 2G0IA 1N36K 2KU7A 2EKNA 4H0TB 1RAJA 1BNOA 4ZLPA 1FFVA 3CCRN 1PJ5A 4Y0WA 4FVMA 4FFDA 1LQ9A 3P31A 2DGOA 2JX2A 2AZ1A 4KN7A 4H0VB 1NSPA 2E4LA 3MXIA 4I56A 2IDLA 1CULA 2BR0A 3CCVS 1U09A 4HACB 2LBOA 4DO9A 4KTWA 3UKUA 4B1ZA 4PKGA 3HD1A 1F9FA 2H3EB 5CA5A 3SJHA 4NLNA 4WFNL 1WAJA 3QGGA 2FBYA 3KDNA 1U0SA 4CJSA 2AYEA 2DPJA 2C2RA 4NXMJ 2GVZB 2HGNA 5J1EB 1YX2A 2R18A 2KO1A 4YG2A 2V67A 4FZVA 4P52A 2CH6A 4LRFA 4DFMA 3MCPA 4JS4A 4OJGA 3D2QA 2ADBA 2VF3A 5EOZA 2MMYA 4PGXA 3PIPQ 2MY7A 5AKYA 4YR2A 4CIEA 2B43A 3QWPA 3N7SC 4UASA 2V8PA 1TK0A 2JR5A 3J7Z5 1IM4A 5DB7A 2ZOFA 4IOAQ 2DEIA 3JTOA 5KFKA 3T1HJ 1FWLA 1QDUB 2DR8A 4FZMA 1TL4A 2F7TA 3JAMU 4Z6FA 5F9NA 4FYXB 5JS1A 3N97B 1HBOB 3I4PA 2VPZB 1HIWA 4P10A 5JU5A 2MA1A 2YI1A 1ACMB 2OAUA 3PKYA 4PGYA 1IBMK 1W2BM 9ICEA 3D6FB 5AK4A 4G6VB 4DN0A 2KLAA 3Q7CA 1QE1B 4HDHA 4LF5K 4IRKA 2XRIA 9ICLA 2QXLA 2M8DB 2J6UA 3BR9A 3K5OA 5I3QA 4J91A 3TAGA 1YRTA 3O5BA 4ZVUB 2B7BB 5F3TA 1QQOA 1S0MA 1LFPA 4ECTA 4PJ0U 1RU1A 4Y2KA 1KS2A 1NNDA 4N77A 2DCLA 1XEZA 1WC0A 3QU4A 1SJFA 1HARA 4F91B 1KFDA 5J2NA 4CHYA 2DGTA 3G71N 3PO4A 1L7NA 1XC9A 4C2MA 3MCAB 9ICHA 2HRUA 1UJ5A 4DV2F 4B3SJ 2ZH4A 1RB0A 1KQQA 4NRTA 4H0OA 3I55N 3FGUA 4FLTA 5D0GA 2DUYA 3W3SA 3A5NC 1GXUA 1Y00A 5M2UA 4H4KA 4O8UA 3P39A 2F1IA 3BH6B 3UN2A 5HN0A 3GCWP 4DR5J 1KSPA 4RZRA 4P2HA 1RWNB 2AHOB 2CN1A 1G1XA 1Q0NA 3JSMA 4MKBA 3MEDA 2L41A 3NAEA 3EKSA 1IR1A 3CCSS 3Q8MA 2ZTCA 4CEQA 3ITHA 4K4ZA 2NREA 3QSYB 4KLEA 4RNFA 3U1NA 3KD3A 3PW4A 4K43A 2AGOA 4BR9A 3J7YU 2A1AA 3FBBA 2H54B 3OYJA 1RLCL 5B0FA 2YKQA 4NMXA 4DR7J 1QVGR 2YQ0A 1B0XA 3CJ2A 1IUJA 2ZGZA 2AQ0A 4C8LA 1FRLA 5KG4A 4OJ3A 2V5HG 3U3YA 5KAIU 8ICSA 4OPHA 2QT7A 3K0SA 1NKBA 3CWJA 1QSLA 1D9AA 3GYGA 1KEKA 5ITHA 2B7CB 1HEKA 3SQOP 2O1PA 2Q1LA 3LYSA 5KNIA 2DISA 3M8YA 4GV6A 1A0OB 3SQ2A 8AT1B 3K1RB 2V0NA 4E7HA 2PFDA 1UT5A 2LQ8A 4NMLA 5B0CA 2Y0BB 2OXOA 1NB2A 3AVBA 2RQ5A 3ZZPA 5G4DA 1JCFA 4PWWA 1SIZA 4DV7F 2KL8A 1HQ2A 4QWAA 3QJJA 3OYLA 1REGX 5I42A 1SGGA 3AOCA 2YH1A 3EPIA 4B3MK 8ICZA 4BRIA 1OW5A 1DURA 4YY3K 2M3DA 4DX7A 4I29A 3KLFA 2E1YA 1F5AA 2E7WA 2N7YA 2MHNA 1XMQJ 3HRGA 3RFAA 1HPMA 2AEFA 3QU9A 1CXUA 5K8MA 1HBMA 4B1WB 2O8EA 5AQKA 2BPGA 1SZ2A 5ALRA 1O51A 1MROA 4NLXA 5ALGA 1QQNA 5AXNA 3SENA 2V52B 2V50A 3G6EN 2D3OR 2W2OP 4I64A 2FY8A 4ZVGA 4B1YB 3VQEA 5L1MA 2HSTA 4F5PA 1RT3B 3OXFA 1GLLO 1ATRA 3CJ5A 1OPZA 2AP1A 2FBVA 5B0GA 4GFJA 4CK2A 2QJ3A 1NBWA 1N0UA 3VGSA 3QT6A 2DXDA 4IOCQ 3DLLL 2J76E 4X4PA 6FDRA 3MK6A 1HL6A 2IVNA 2IOFA 3MMAA 3ZFVA 3G71S 2PEBA 3IP4B 2GJIA 5AQQA 2ASLA 3JSYA 2NV3A 2QEXN 3LK9A 2JH1A 4Y2UA 3ZSZA 2IGIA 2RQMA 2OSQA 3L7PA 3MECB 5LMUJ 5AJ3K 2HBYB 1HKAA 1ZQCA 4HKQA 3MPUB 1RYUA 2HZAA 1X4HA 3MAAB 4EO6A 4DV5F 3T1HK 2HKEA 4EI2A 2UXBJ 4FF2A 4J2EA 4O3OA 4KPCA 2CGLA 4FLWA 3PHEA 1T95A 1S9EB 3V9WA 4WTYA 3J81j 4I6AA 1JKHA 4UB3A 4HHUA 5IZHA 2P8IA 2PD1A 3CUNA 1JX4A 5B09A 4YB5A 3C16A 3QT8A 1AQ6A 2DH9A 1BGXT 1V5VA 3P8BB 5IIMA 4WF9L 4Q43A 1S6UA 2OFHX 1OH7A 1AUDA 3TA1A 2NSBA 5AXLA 4OGCA 3H59A 4IQWA 2HVIA 4F02A 2RHKA 1RAGB 4NLSA 4JI4F 4ZITA 2NPFA 3BEXA 2GHPA 4NYNA 2YVSA 3AH6A 1KLMB 4HL9A 2EHGA 3O9QA 2DGQA 1Q4RA 4PA1A 1RXOB 4USWA 3V1QA 2C2DA 4JP8A 2A1SA 3A0HU 3GIMA 3C14A 3UKRB 3THWA 3F44A 2HAFA 2YTUA 3QUBA 5HVHA 1I94K 1YJUA 4B3SK 4BE2A 8ICLA 4ECSA 2QX0A 1ZQOA 3ENWA 2QB0A 3UPQA 1T94A 2BCUA 4CQ1A 4QU7A 1A5VA 2J7WA 5C25A 4M94A 3SSRA 2DNRA 3B4DA 3VAJA 3QINA 2PYLA 1NH7A 2CPYA 2MKCA 5IIJA 3VVUA 4A5AA 4GXIA 4L3NA 3LGHA 5D4BA 2E1PA 3G2XA 4DR2K 3RMBA 3KHLA 2DVIA 1LWEB 4US8A 2AJ1A 4LF9J 3JPSA 1SCJB 1WCLA 1ZQJA 2ATQA 3D28A 1RDAA 3P6YC 4PUOB 1DLOB 1GMVA 3WK9A 4Q5VA 2ZJPQ 3AARA 5KRSA 4ZTFA 3WC0A 3G6ES 1OVYA 4WJBA 4JYAF 3RMAA 1ZD4A 3BSCA 3JTPA 5M1KA 2M52A 1WKKA 4DHYA 1VLOA 5HQMA 2QWNA 1KTQA 4YOWA 1X2IA 1RTIB 4OHXA 4CF5A 4JWNA 2H48B 4QS9A 3GFZA 2I5HA 4RR5A 3OL6A 4EUVA 2ISPA 3OD2A 1KQKA 2V9KA 4J2DA 4BVPA 1QSYA 7ICGA 3ENVA 2F3JA 3VR1A 2HVDA 5CCMA 1XJWB 3KFUF 2CXYA 1COKA 3OT9A 4F5OA 5LOQA 3O6QA 1L7OA 2W8KA 4LC9B 2B0GA 2QEXS 1FFWB 4UW2A 1ECWA 1PK1B 5M1QA 2WSCC 1Z1ZA 2JVOA 2XYGB 3DU5A 5IT0A 3JXOA 1Y64A 3B6BA 2WB1F 1WACA 4OPJA 2W3SA 5AKEA 4DV3K 1KQSM 1C0TB 4FPIA 4BACA 1CZBA 5AK5A 3T5JA 3L7UA 4JLHA 2PMZF 1M5KC 4USAA 4U67Q 1YF5L 3TAMA 4LSLA 4JD2A 1FT8A 2RHQB 5AXMA 1S5ZA 4EYHB 1UJ6A 2QMWA 2BVZA 3QRRA 5B0EA 3AVIA 1BDGA 4DF4A 5MAOA 2F96A 1JCEA 3NH1A 3HVWA 2Z1GA 1WHWA 1C6VA 3LPUA 1ESVA 2GLEA 2IHR1 3ZETA 4WCEL 2P9NA 1TUUA 4I4BA 3HPOA 2KZMA 3U1MA 1SXEA 4NV0A 8ICOA 4DR6F 1IQTA 1BUPA 4P4PA 4E0DA 4PKDB 5BJRA 5CCLA 2QW9A 1NZPA 1SZHA 2YNFA 2RRDA 5ALJA 1CG2A 1X5TA 3CJ4A 2AYMA 3SQGA 4RQMA 3DM2B 2KRRA 4KKOB 2MGZA 2K8AA 2B5JB 4PXEA 1N34J 4KHSA 4KFBB 1QM9A 2ZNZA 4GV3A 1NMNA 2NO4A 2OPSB 1ZJNA 1PBAA 2FBXA 3JYTA 5AIAA 3DLGB 3DFEA 3MGVA 1H6KX 3M8RA 4IFVA 1RT6B 5KG3A 3VZHA 2DRAA 2ZXIA 3HD2A 1R7IA 1FKOB 4PHAA 3IG1B 1RWWB 5BYQA 1ZOLA 1FHTA 1MWQA 3SSQA 2JWNA 5DETA 4DL5A 1T6CA 5J0SA 1S7IA 3MCOA 5KPZA 2OCEA 2MEWA 1RILA 4B3TJ 4IG3A 3O6WA 4ZK7M 2MTLA 2Q43A 4IDKB 1HKBA 2FDNA 3O4WA 1PUZA 1VSFA 2BCRA 1R31A 2O8CA 1U0HB 3FFIB 4LRCA 3KKRA 4F0MA 1Y97A 2KXNB 5AFUA 5AM3A 2NCKL 1VQ6N 2XI2A 3IG8A 4USKA 1VBKA 4K0KJ 3THXA 4OD0A 1ZJMA 3LP1B 3C7NA 3U6FA 3PSFA 2F9JA 4UUXA 3HSTB 1ZQKA 3GIIA 1XQIA 2F9TA 1XMOJ 3OYKA 2KD1A 2G06A 2BQRA 2OJ3A 5HSPA 4ID1A 1HPZB 5I9EB 2CRLA 3BN7A 4TU8A 2ZUGA 1NO8A 2ZG6A 3C2MA 4C7ZA 4E7JA 1VLBA 3QFPA 3N4QA 1HD1A 1RCOB 2CJXB 3OYMA 5B5EU 1OWXA 2OA8A 2DKZA 3RMDA 2QA4N 4RNNA 3GP9A 2ZJAA 4KHPK 5IT9O 4Z6CA 4IJNA 4DV4J 3PLAA 4F4WA 1A77A 1C20A 3LDSA 1JLQB 2K3KA 1RT7B 5FRMA 2F44A 4GC7A 4XDDA 3WNHA 4DV1J 3UNYA 1L3UA 4NXNK 1TK5A 1VHXA 2WTFA 3R2CJ 4HACA 2ZIXB 5MLCV 5DM7L 1FXLA 3CP8A 1U1KA 2NO5A 3GFXA 2RB7A 4J9UE 2UXCJ 3WK5A 2EEYA 3NCQA 1RNHA 2CQ1A 2Q1NA 2ZH9A 2GVZA 4NEZA 4ZPWR 4DV0K 1SJQA 3V6JA 2GAHC 4CP5A 4BRKA 2EG2A 4OYZA 5J1EA 1IBLF 4LJXA 4FZZA 3OYIA 3EDQB 2X7IA 1NDKA 5GTHU 2EFQA 4OX9F 2GCFA 4A59A 4ZCMA 1C1AA 3O3HA 3NL0A 2ZWHA 3AJDA 4N47A 2C3UA 1HX1A 3HZGA 5FP0A 4BRGA 1KD1T 4C4TA 4C8KA 5IOLA 3UCZP 2LLZA 3WK6A 2O4GA 2DF4B 1ASWA 5ETOA 3K89A 2XGPA 2KKZA 4E1NA 4ZCKA 2RRBA 4BRLA 4JK9A 1N2XA 4DTUA 1F60B 3NAIA 1ZBUA 3VZIA 3QBWA 2JEJA 3QNOA 4DL2A 8ICPA 2HOEA 1N8RO 5ALYA 1NGBA 1WF0A 1I6JA 1Y9OA 1X4EA 2O4IA 3L2VA 1ILYA 4O5EA 3VQQA 5KFRA 1NZBA 1QE1A 4U96A 3QEAZ 4FK2A 4JK7A 2ZKUA 3NRWA 4OX6A 1ZQLA 2H1YA 3LQVA 4A8KA 5C10A 4BDZA 3NOCA 2QWOA 2OPPB 3PDNA 4CIFA 1O13A 1JROA 2K1RB 4DOBA 1ZZFA 3HKZF 2HQCA 4K4SA 4J9VA 2D3UA 2ETJA 2FJVA 2PMWA 3KK3B 3BDPA 3L5KA 1NK8A 1DOQA 1J2NA 3V7KA 2IOHA 4CK1A 3OLBA 1AYEA 2LXUA 2V9WA 4FYYB 4NXZA 4YEAA 2GW8A 1Q18A 4I2BA 2GO9A 3K9KA 2WVBA 3OVSA 1ATSA 3TZXA 2HHVA 1NCLA 2A40A 4UARA 4IRDA 2LDIA 2ZZMA 4I1TA 1UVJA 3RH5A 3HT0A 4MTPA 2XGQA 1J54A 2FB0A 4DPWA 3F56A 1U1OA 3QUTA 2D0PA 1C0MA 2WMMA 3DXBA 3CPEA 1EX4A 3O8WA 3TANA 3K58A 1UAXA 1GOAA 4BRQA 5HNKA 2QA4S 1NJZA 2W2PP 2QA1A 3SFUA 3OXLA 5DBAA 1BWVA 1VQPN 4I2PB 2OMLA 4U6PA 1K8AO 1RTZA 1U6ZA 1FX2A 4CWBA 4DTOA 4CZIA 5B7WA 2ZKTA 3ZDDA 2KVIA 1URJA 3FLCO 4FWLA 1FDBA 3OXGA 4NZ7A 2OSRA 4F72A 4DDFA 2HEKA 1T9XA 1W26A 1YVUA 4M3WA 4NPOA 1UP1A 1WNSA 1TZ0A 3E2EA 4AM6A 5ETQA 4FNHA 3EVOA 2HHQA 3VTHA 2UXDF 4X4SA 5HMWA 1KQGB 4Y2QA 8ICFA 1RTJA 4M41A 3TU5A 2UU9J 2D5RA 4DX5A 3N6LA 5KFDA 2AF6A 4JK1A 4L6V3 2KMDA 3EL2A 2ATCB 3NAHA 3SMPA 2BKEA 3ETOA 2FJXA 1E4GT 3MOZA 4DR4J 3CJKA 2EFPA 3EO3A 3O5TB 2MKHA 1ZBTA 4TVAB 1WSIA 4LF7F 2LYVA 1FXRA 2OYQA 2Y0SC 2FZGB 5JXSA 2AH5A 4HR2A 3O4QA 3CJ9A 3JQMA 6FD1A 2KK0A 5L8RC 3BQ1A 3ZD8A 4DTNA 4KPYA 5EX3A 3IGVA 1TELA 2NLXA 2WTUA 1U6BA 2KYZA 2FF6A 3ENBA 2PY5A 2BJ8A 1RZTA 2E8OA 2W2MP 4LMZA 2B4PA 2ZUDA 5F9LA 4DV1K 1ZA2B 4CT9A 2CXEA 3IAS9 4A8MP 1RT3A 4BREA 3SBMA 4JI6K 2F77X 3JTNA 4CF3A 1EO1A 3PFOA 4LY7A 1PILA 3CQXA 2ZITA 1Y4ZB 4RNMA 2CVIA 4QR1A 2WCXA 1F5BA 5DDQC 5KFWA 3H5SA 2Q66A 2MZSA 4BJQA 3FDSA 1SH0A 4USJC 4FJXA 1IXKA 4A8FA 3F5AA 4JNEA 1SV5B 3E9OA 3E8OA 2AD9A 5LJVA 2QLJB 3J7A1 3IWLA 1QZ6A 3SR6A 1OKJA 5HRRA 4OCZA 2VFUA 3AA2A 1UZHA 2DD8S 3TSQA 4A48A 3MAAA 1YGYA 2XICA 4CJKA 4W5TA 1LWCB 2IA0A 1U47A 2K4PA 1UEVA 2Y1LB 1RWVB 4YMOA 4ILRA 1S9EA 1XQSC 2OFGX 3C66A 2NZTA 1QH9A 1EHWA 5D4PA 1RKJA 3GOIA 4NA2A 5IWAF 1VQPS 5AR0A 2HOIA 3OFEA 2DH7A 3JPQA 3E9PA 4USVA 3AL0B 4U7CA 3ZDCA 3VAGA 5AKKA 4DX6A 1H74A 2G8WA 1E6YB 1J5OB 1SC1B 2OUGA 5LJ3Y 3B0YA 3FZHA 1W2IA 5HMLA 1D3WA 1UEUA 4DUZF 4Y1DA 2KVSA 5J0YA 4NLOA 3VGUA 5BRDA 2HGMA 2DH8A 2V2VA 1D09B 4LBHA 3MXMA 4ENOA 4RQ1A 3F2DA 2WW4A 4CEBA 3ZYYX 3UKRA 3QZ8A 2AA4A 3ZCMA 1MN9A 1TU0B 2E7XA 2X1BA 2I8EA 3QBXA 1X4DA 2KJ9A 1QQCA 4K8RA 3RB4A 1GTHA 1HWJA 4GRSA 2A10A 4O4RA 4I2JA 2FMSA 3R6LB 2GHVC 2YXLA 4GKJF 4FJHA 2BH1A 1H7WA 4JI5F 2JOQA 1SV0C 4OHVA 4AL5A 3K5NA 2B51A 1ZETA 3CJRA 3F2CA 4PYAA 4O3MA 3RW6A 3F5TA 1QLNA 1LWEA 1MMLA 2HIYA 5HL7Q 1IBKJ 3VPZA 1X9XA 4CK3A 4P0QB 4M9JA 4C23A 4PUOA 1DLOA 2ZC3A 4ZS6A 2IRUA 2H5JB 4WYWA 1RBOB 9ICMA 1BNPA 4C8OA 4WXOA 3CO0P 4B08A 3EDRB 3NGDA 4M2YA 3D1HA 4IYQA 4DG1B 1WEZA 4LVOP 1RTIA 4DPOA 3IDHA 1QQ7A 4PCQA 1QSSA 1B43A 1H72C 2AKWB 4IO1A 2HPUA 2KRBA 2L48A 3ZZUA 3CEDA 2NS1B 3AD9C 3D0IE 3NY0A 4WU2A 3DLLQ 3TAPA 2LM1A 4CFBA 1S5LU 5J0TA 3ZXWA 2ZUAA 2LXFA 4PG5A 3AO5A 4QCLA 2BYCA 3MTKA 4BHQA 1PK3A 3H08A 4ED0A 3EE3A 3PY8A 1G2EA 4C6AA 2EKYA 4HTJA 2V8DA 1PAEX 3KK2B 2JLEA 2C2OB 2FJBB 3T41A 4WFAL 4FLZA 3SUPA 2Y0SD 3TQEA 2W2NP 4UY8T 5J1NA 2D6FC 2QIFA 2G1DA 2QE5A 3C5GA 4B9LA 7ICQA 1H38A 1CBKA 2PFOA 3HFZB 4M5HA 4C3LA 1IG9A 4USUA 5HMXA 5KFAA 1RBRA 4FO0A 3OYGA 4RW4B 2F9WA 1YRUA 4BC2A 2O67A 3A4TA 1RU2A 5AE1A 1RJJA 3JPTA 2DR6A 9ICVA 4WF9Q 3OW2M 2PT0A 4A57A 7ICRA 3LPYA 1IXRA 4I9QA 5EE0A 3RRKA 4FBUA 3CQYA 3PR5B 4O5CA 3DM2A 4NYOA 4KKOA 4IQXA 5KPRA 1S1UB 1RYRA 2XO7A 1S0NA 3O8MA 4KFBA 4JI3F 2W4PA 1KVIA 4PQUB 2OPSA 1XNQJ 5G5GA 1GNKA 3G4SN 2DNGA 1F2HA 1J5EK 4EELA 1HI1A 4ILLA 4CLUA 3H0PA 5J0PA 3DLGA 3M2RB 4Q2LA 3ZX3A 2O6KA 3W5YA 2V8GA 4C8ZA 2FMQA 4FWSA 1RT6A 1YG0A 2Q0UA 2NSCA 3Q86A 1FFGB 4DU7A 3OYAA 4JI0F 3NWGA 1Z4NA 1SBRA 1GLBG 3ZI4A 1FKOA 2GQ2A 3IG1A 1NLVA 2BCQA 1CUKA 3H0LB 5FDLB 2F8SA 3BQTA 5I3PA 4YD2A 2F7VA 1RHQB 2BCSA 3KUGA 4BDYA 4OLAA 2KIVA 3DC2A 1DGKN 1SIWB 4IDKA 2QI2A 3VQ8A 3AV9A 5ALSA 2C42A 4DKWA 1U0HA 2Y3YA 3FFIA 4WZMA 4PY5A 5F8GA 4QZ8A 2MHEA 4WZQA 1G7CB 3ET6B 5AZJB 4TQRA 4MKVA 1YJ7A 5M1PA 5K20B 2W11A 4X62F 4DPXA 1JJ2R 8ICTA 3LP1A 2OEKA 4K59A 4C7QA 1DJ0A 1DTQA 2MU2A 1K9MO 1TGOA 2LYHA 4UQTA 4CFAA 4NLDA 4CVNE 2YJEA 4P2SA 2YKOA 3MD1A 3IC1A 3M05A 1CLQA 5KQDA 4O8KA 4YN3B 3T3FA 1DARA 4JRQA 2YKMB 1EP4B 2NXEA 4ZPAA 1BCMA 2E5LJ 5E84A 3HFKA 5AI8A 2XLIA 4FF4A 3H4BA 5IINA 4ECWA 2KI2A 4QS7A 3MURP 4MQ3A 4YFKA 4DMNA 2DCUB 4FLVA 2IAJB 1JLEA 4F2SA 4X64J 4F92B 1XR7A 3GIRA 5KQ8A 2Q6BA 2HHSA 3V6KA 5G5HA 2VQFK 1ZQQA 3RBXA 2QWPA 1JLQA 2APOA 3MD3A 4JV5J 1N32F 1RT7A 1IBKK 2YY6A 1XUPO 2KYXA 3CFOA 1NZAA 1FJGF 5DLFA 2XB2D 4V19S 5DQGA 4PHDA 1HKGA 3LM2A 4FPBA 2ZIXA 4QYZJ 2QN6B 4XA5A 4QWEA 2F4VF 3TAEA 1RI7A 2HGLA 2HK3A 4WCEQ 3WDOA 5DO2A 5B0AA 4DR3F 1R8AA 1SIJA 2HBQB 3H1VX 7ICFA 4QZGA 2JV3A 1HNWF 3AQPA 3QYPA 3SQ1A 4IR1A 2BQUA 1ZD3A 3CCTA 2G8KA 1RA7A 2BM1A 1MN7A 3G4SS 1M5OC 1A6LA 5L46A 3HP9A 3G6YA 2HS4A 2BGWA 2CVEA 1NGEA 2AYBA 3VGVA 4JB3A 2D3ZA 2GC8A 3W8GA 2ZJQL 4CGFA 3AHPA 1FTCA 1VDVA 3PG9A 4CO4A 1H73A 2FC8A 2W9BB 1BC6A 3MUVP 4X4TA 3OSPA 1QZ5A 1NGFA 2ZBRA 2HB5A 3QEBZ 4OZLA 1N33F 3L8BA 1ZM9A 2Q2RA 3WIUA 1K1SA 4US9A 4AHCA 4CLPA 1QTMA 3LZJA 3H2VE 4FZYA 2WW8A 1ZH5A 1QVFM 1QS4A 1YJVA 4HEA9 1A6SA 3QATA 4G3IA 4FPRA 2OPPA 3EPGA 4OJPA 2K1RA 2O8DB 1D4XA 3M6WA 1RAHB 4DS4A 1AZSB 1KDHA 2DRDA 4E1JA 3TADA 4QZAA 3BREA 4LH4A 2RILA 5J2EA 3V9XA 3UFCX 4ETXA 4J9QA 3DDKA 2ZUCA 2W41A 4GKKF 4N5SA 1K73T 4RU9A 3UMBA 1ZAVA 1T05B 1Z6RA 2PEHA 4E7IA 3MPDA 5HRSA 5ALUA 1OQ3A 3UCUP 2DKOB 2HHPA 3W62A 4GVEA 4RT3A 5A2QO 4R64A 3W60A 2LU2A 5F8IA 4WFBQ 4H4OB 1NGCA 2R2SA 3IR5B 1UAWA 1P1TA 3CCLN 3NVZA 1RWMB 4DX8H 2WRMA 2FSJA 4WKYA 4FK0A 1WBBA 3N0VA 3NHGA 2YWWA 3PYEA 4I2PA 4CF8A 1RWXB 2NXJA 3IAM9 1PG5B 3G8TA 4ICAA 5KAFU 3J7AN 3QMLA 2YX6A 4LFCJ 4CJ4A 2NXNA 4M5MA 4M5GA 3SI6A 1MC8A 9ICPA 3G6VA 1SQFA 5GIPA 3KKSA 4P4OA 2D0CA 1FDDA 3ATUA 4C4WA 1HNXJ 3QERA 2Y1JA 3CJTA 1Q5VA 3VAMA 4OO1J 3PW7A 3H8WA 1M1GA 2W55A 4E1MA 5DM7Q 4LFBJ 2E2QA 3DRRB 1IKWB 5CD4H 2UVVA 3DDHA 4URQU 1X6IA 4DN9A 3AQFA 4EZ9A 3GTYX 4F71A 4EMDA 3R1LA 4M7XA 2KHCA 4A62A 2JDJA 3CB4A 1I39A 1U6FA 4AYBC 2O8FB 4WQ4C 1HQUB 1LOTB 4DV6F 3IDWA 2Z7JA 3AFGA 2XMTA 4DQ8A 1KNZA 2OTLN 4GO7X 4M95A 1FJEB 1C0UB 3NS7B 3OHBA 1U02A 5F0WA 3DLJA 3QETA 9ICNA 5LL6Z 2UUCK 2MXYA 2Q0ZX 2D41A 4QNLA 5KT7A 2XNQA 3AO1A 2Z4PA 3M8SA 3VAHA 3TZYA 4X64K 2ASJA 3PJXA 1IWGA 3DJCA 1WB9A 1WBDA 3QT5A 1NBEB 1S7HA 4PGQA 1XR5A 5C24B 4C1NK 3T6JA 5LSOA 4JV5K 2BJEA 2IMOA 3C6AA 9ICIA 3HI9A 2M0GB 3IUCA 2DNOA 4O4GB 2RU9A 5J2QB 5GAEP 3H2UB 4CLZA 4QU6A 3Q8YA 4WYBA 4Y28C 3IG5A 4FO6A 1X9JA 4HI2A 3U3GA 1T9TA 3VF2A 2EX3A 1XHXA 3SJJA 5DS7A 1EB0A 4MT1A 1WF2A 1SJ4P 2WAQC 2WF9A 2MQQA 1SV5A 2VBWA 4NM2A 3HOSA 1D0EA 3JPOA 2AEJA 3P38A 4L74A 4DI6A 1RYSA 1HR0K 4FWKA 4LSNB 1SI9A 5F8MA 2VG6B 2KM8C 4YOTA 9ICUA 1M90O 4AL6A 4X65F 1RWOB 3W5XA 1LWCA 2CYYA 3RJMB 5CA7A 2WSEC 3UR0A 4J9NA 2K7JA 3CCLS 1HW9A 1VSLA 1Z26A 3BSNA 4LQ3A 3VQSA 4TY8B 3OBWA 2CPRA 2XLJA 2C2NA 3P4IA 1GLAG 2P9SB 1Q7YT 1CJUB 4HYKA 4HH1A 3R7SB 1K6YA 3WXMB 2HNYB 4WYLA 2QTDA 3P5BP 3TJ8A 1RT2B 1E6YA 1J5OA 1U1NA 1VHFA 3H5XA 2A42A 4DL4A 3VC8A 3PEHA 3S8SA 1ZQXA 4KH4A 2PGCA 1HWKA 4LFAF 4NLTA 3T9ZA 3H8JA 2ZC4A 3MWPA 1RCXB 4KLGA 4TN2A 4IRCA 3AVMA 3WKBA 3ISND 5ALDA 2E8NA 2ZH6A 4MIWA 2W9MA 1F9EB 4FXDA 2IVYA 3RMCA 2OTLS 1HJRA 4OJLA 1LWXA 3C28A 1FNOA 1SKSA 1SB3C 5I3UB 3D4JA 9ICXA 3K5PA 4QR0A 3MZIA 2EWSA 4TKTA 4MHVA 3MC1A 3FVYA 3ZX2A 4PH5A 1E6VB 1RAFB 1UVIA 4C7YA 2KT5A 2Q4TA 4XH5A 3D6JA 4DFJA 3WXIA 3I87A 2KV2A 1B7YB 1OXJA 4NLVA 4OI0A 3C46A 5M1OA 5IIKA 3RVCA 3AVKA 3AN1A 1VQ7N 2CJYB 2EFVA 2PSZA 4H5VA 5B8HA 2YWHA 1ZQAA 1GX6A 3DGPB 1QUVA 4KLMA 1X66A 2Z30B 4ZPDA 3QU7A 5AQVA 4WQ4A 4ZOSA 1RDUA 4DG1A 4MEXA 1WWVA 4ECZA 2CA9A 2DHXA 5HI7A 1FD2A 3H0RB 3ZZZA 1SL1A 1OY6A 3LDQA 2KICA 2RNEA 4DV2J 2P5OA 4NLQA 2HWTA 4FSVA 2UZAA 5KT5A 2E1ZA 2Y9HA 4Q2MA 5KFLA 4DZDA 1U2VB 4HTUA 4UAZA 4I9LA 4BR2A 4TU7A 2GJFA 2HBKA 2RDJA 1WC4A 4DTRA 2ZBIA 4OQJA 3EN9A 4OJ6A 1Y11A 3BZQA 2E8PA 3O9RA 4AYBD 2K8GA 2FHJA 2E20A 1MWYA 4OV1A 1BIUA 1XR6A 1NU4A 3J80Y 2RUGA 5CABA 3KK2A 4FVUA 1KOOA 5IC4B 1ZRNA 5E7OB 1KVAA 2AGQA 1H3DA 1WDTA 3Q23A 1CJTB 4HUFA 1NHUA 1NUEA 4CD3A 4FOEA 3MR5A 4G1QB 1N52B 3TWZA 2Y0SF 4WP8A 2I1RA 5LJ5Y 3B0XA 3I76A 4RW4A 5EGYA 2IOFK 3HW8A 3ENQA 5KFIA 2LDYA 5ADZA 2QSWA 1KR4A 5AQIA 4KIAA 3CCQN 2BANB 2BUNA 1FIQA 2C22A 2QARB 5CZ1A 5KAKA 3QESA 4FWOA 4DF8A 1HI8A 3CMAN 3VHQA 4FXVA 1XN9A 1LAVA 5KOXA 4B1UB 3U8XA 1RWUA 2EFGA 5IV4A 2FY1A 1S1UA 5TISU 4DV7J 1RAAB 4MIAA 3SZ2A 2E6MA 5KFOA 1WD6A 2BBEA 1K44A 4PQUA 3CC2N 2F8LA 2XC9A 1W9HA 3VVTA 3M2RA 5F0UA 3DDNA 2FGOA 2VBZA 4YMEA 2AQ4A 1VISA 3M1VB 3CCZA 4LF1A 4YDUC 1KC8O 2IYIA 3B8HA 3GU3A 3I1YA 1VQMN 2V94A 5FDLA 2POKA 1HNZK 5D6GA 2I6XA 4Q8FA 3NMRA 5KFHA 3D6MB 5DRKA 4CHNA 4CLWA 2P9PB 2ASDA 3JQJA 4PG6A 4C0ZA 1B22A 3CCJN 2MQMA 4G9BA 3M9NB 1U04A 5FPMA 2ZE2B 1VQ7S 5HMZA 3I28A 3MMJA 4ZPCA 4RWTA 3MM9B 3ET6A 1QAIA 3MM5B 3FZ2A 4LH5A 3EE8A 1YAGA 1AW0A 3SIPB 3VQDA 1VBXA 4B3RK 4WQ5A 4CJLA 3TAFA 3CXCM 4ECVA 2G0AA 3QNNA 3EGWB 4DMZA 2DR5A 1VSHA 4B9MA 4R63A 3KJNB 3KDOA 3V72A 1FX4A 3CCMN 1XERA 4LF5F 4Y2MA 4PKIA 1PVRA 2YKMA 4PG4A 1BU6O 3UQ0A 1EP4A 4XO0A 1VJQA 1ZQRA 3BN4A 4DFDA 4DV5J 1F5SA 3WKCA 4IQMA 4MK9A 2N1RA 2FJAB 2VGNA 2OH2A 3BKFA 4CLFA 4FXWA 3MX5A 5IIIA 1DQ9A 4DL3A 3D7SB 9ICQA 4O3SA 3SEOA 4YOXA 3IA0A 2IAJA 2KOBA 3A0BU 4RX6A 1N62A 3ZEUB 2Z58B 3OFHA 3TQ1A 2OI2A 2XWYA 4WFAQ 1VRUA 4QZEA 5D4LA 4IFEA 3AVJA 5CYMB 2F2AB 3RJEA 2HVEA 4KY3A 4L3QA 1F6TA 4JI4J 3CM6A 1F2GA 4JKDA 1X0PA 1CSJA 8ICIA 3OVAA 3NFAA 3OS1A 4CO3A 4CZEA 4BG9A 3NASA 5KFCA 4Y0FA 1IV0A 3MPYA 3CCQS 1TFRA 4QYRA 2EWHA 1SJ3P 4KGZB 4PG8A 3F53A 3CERA 1HHSA 4KC5A 1WDDA 3OBIA 5L9XA 3I33A 4DUYK 1NNEA 4I6MB 3CMAS 3VF0B 2JZBB 2UVRA 1EQ0A 2DFFA 4MN4C 1BLUA 2OELA 2I9SA 4CJ5A 3DHXA 5IQQA 3SV4A 2V8HA 5J2FA 4OX7A 4TLQA 1NDCA 1N54B 1KVKA 3CC2S 1MG7A 3MEGB 2IMWP 3RRGA 4PRFA 4BROA 4MKAA 3WHIA 3LDPA 3I96A 8ICWA 5AQZA 3RJJA 3HSZA 3M32B 3KWIA 1EWRA 3BQ0A 4CT8A 3ULEB 1RTHB 1FNXH 2BZ2A 2E1RA 3UKUB 3C2KA 1SXLA 4IOBA 2W9BA 4ZHRB 4HTLA 2BRLA 2C2ZB 3BSOA 2MRLA 2B21A 3G8QA 3Q8UA 2YHYA 2EC2A 3T5LA 4R5PB 1IKYB 3EWGA 2DR7A 5ALEA 1U1LA 1HLUA 1KL9A 3EGZA 4A61A 2ZJ5A 3HHKA 4J90A 2W54A 4JYAJ 2ODGA 1X40A 1NXIA 1AFIA 4CHOA 1TFYA 3CCJS 4KRFA 1P8GA 2Q3SA 2NUUG 1ED1A 4ZVOB 4B3MF 2N4CA 5KT6A 3AGRA 5BN8A 1VIXA 4YY3F 2O8DA 4U8VA 3ILIA 1SKRA 5LMNK 1TTHB 3RG6A 1AZSA 2RQKA 3NEKA 4PKHA 3VTIA 4HAIA 3M30B 2OEHA 3PRBA 4QAGA 3CJ0A 5IFMA 3DLEB 3N28A 2NRXA 3N01A 2XLKA 1RDBA 4O5BA 3MN9A 1FWPA 4YDUA 5GAGP 2B8PA 1BISA 5FPEA 3AAQA 2KHQA 3UD4P 1JLGB 3KKAC 5H9EJ 2JFKA 5FD1A 3V1RA 5FLXY 1OUQA 2BUPA 2ZH5A 1T05A 5K8PA 4CBXA 5AKGA 2R3VA 2EW9A 2MZ1A 3QZ7A 4H5RA 3NLCA 5BR8K 4Z6DA 3WKDA 3DRYA 1O8BA 1WWUA 3CCUS 3P3DA 1R8PA 3BQ2A 3CXCR 3HSCA 4H4OA 5ALWA 3JAMY 2K4EA 4HUEA 3K59A 4LT6A 3FMBA 1YI2N 2W9CB 4ETZA 1WKJA 3K5MA 4QIGA 4F5RA 2EZYA 1LWFB 3LH2S 2OEMA 2E1MC 2EH9A 2J5AA 1NGJA 1X9SA 3DCAA 4EX7A 1MMDA 4E7LA 1RA6A 3M5RA 2YMPA 3TFSA 3PW0A 3AJ1A 3MGHA 1C4CA 4FM2A 4DR6J 4K8ZA 2XZDB 4IQUA 2YPZA 2LMRA 1RM6C 4N56A 1S48A 5AJ3F 2OGUA 4F4XA 1V9PA 4N8NA 3ZSXA 3B54A 4LF4K 3VQBA 3OGUA 4M9GA 2DO4A 4ISFA 3MUTP 2F5GA 2ZH7A 4KGMA 4NZ6A 3DRRA 2Q3PA 1IKWA 3TVZA 4JMUA 3VWSA 4LZDA 3ZC4A 1NDPA 2XS2A 2E66A 2QGFB 3QJPA 2L3MA 3AJ2A 5HR6A 7ICKA 2BKPA 3GCXP 3M6XA 3B82A 1RDDA 2ILYA 3TTCA 2O8FA 2KG1A 2BQ3A 1HQUA 3OYDA 1VQ5N 4Q0BB 5KFQA 4OHYA 2XMVA 3PZPA 1JB0C 3A5OC 7ICLA 4DWIA 4J9MA 1S12A 4KQZA 4ECRA 1C0UA 4FJIA 2B3TB 4PXCA 3VCDA 5EDWA 4IG0B 4NWIA 3VGLA 4EEYA 1UW4A 4CE9A 1KTVA 3TKAA 5ALXA 2H3QA 3AA3A 4DCOB 4IUFA 3OTQA 4CJPA 5AHXA 2QB1A 2LYAA 4XH1A 3D45A 2AJ0A 1EXNA 3PUFA 5C24A 2AU0A 3WK7A 1I94F 3GV8B 3LA0A 2AGPA 5KFEA 2VG5B 4RQ8A 1ZTWA 1R8HA 4LIWA 3QNMA 1PYSB 1WOSA 4CGJA 1WI6A 3RB6A 4EK2A 4BS2A 1ASVA 3D3BJ 4O4GA 4RQ3A 2AV5A 4F36A 5J2QA 1BCOA 1R3NA 3CULA 3VEZA 4A8EA 4CIGA 4Z0UA 5GAHP 2VDHA 2P9LB 3VA0A 3D2EB 4JKFA 3ULDA 2F1HA 1A5WA 1C7YA 4DR2F 2Q6CA 3R1XA 2J7KA 1DRZA 4CJRA 1KD1O 2XMKA 3K0JA 3TRGA 3AA4A 4P2FA 4MLEA 4NASA 4QZ9A 4X66K 2BJ9A 5IIOA 1O6XA 2VU5A 2HFNA 3DI6B 1MWMA 2UV8G 1FO1A 2J7UA 1MROB 4LSNA 3L2WA 3RBDA 2VG6A 3CD6N 3MR2A 3MN6A 1X60A 3KD1E 2VHGA 3PEJA 5IS2A 4UAVA 3MBYA 3F9MA 2OHDA 3F41A 1WC3A 3AEVA 3IR7B 5AM5A 4NLPA 1S5JA 3POTB 2VQEF 3AXKA 4RG8A 4TY8A 3L09A 4KBIA 2E6LA 4F9OA 2HWIA 1WJ9A 4PXBA 4K42A 1C0FA 5ALZA 5J2IA 3ZSYA 1SC6A 5ALNA 1CJUA 2P9SA 4H0XB 2HCFA 3ETMA 2NRZA 2HNYA 1HWUA 4M0AA 2KJVA 4Z4GA 3QGIA 5HR7A 1RT2A 2OIHA 5DKWA 4DV3F 4CZJA 3ENAA 1IBLJ 4CEZA 1EQYA 3T5HA 1Y7PA 4ELVA 3U4LA 2BMBA 2EFOA 4OX9J 2GV9A 3T1YK 1P90A 2BZFA 2B0CA 4JI7F 3WQTA 4P7VA 3DRSB 2R42A 3FCVA 4CLSA 3VGKA 2VC1A 5RUBA 1EKEA 1TE2A 1PIEA 5A0LA 2HQIA 3HHLB 2MKKA 1REVB 2Z1HA 3RJFA 4FNIA 4S0MA 2CDRB 3AVFA 4YORA 3BUZB 2A1RA 1VQ5S 1E4FT 3TTFA 1XMBA 9ICGA 2ROEA 2RD5C 1NGDA 3CJ1A 2MQLA 4YNQA 3T7ZA 1Y88A 2QKKA 4KX3A 2KT3A 3T5KA 2CADA 4RKUC 5I3UA 2XCAA 3W7BA 3NUQA 4LIRA 1E6VA 2G8HA 1FRKA 4NLZA 1EKRA 2RH3A 2HMPA 2E5IA 1KW4A 4RWWA 4PG7A 3EVWA 1MW7A 4CFCA 2XBPA 2FLNA 1GLJO 3KG0A 3V6DB 4KLUA 2GWSA 3A8IA 3DGPA 1VK3A 3QGPA 4Y2VA 3CF5L 3TSUA 1NPRA 5GMEA 3PO5A 2Z1IA 1XC3A 4GVLA 1LB2B 4B9SA 2B56A 1X3NA 2M0NA 1HMVB 5ETPA 2BE2B 1GMWD 4MK7A 3SMZA 2F8EX 4FJ9A 3J80U 2OM6A 2HHHJ 3W66A 4ZLLA 4CJQA 5KI6A 4DQPA 3DN9A 3V9ZA 1ZA1B 1L3SA 3G82B 1X6JA 5J0RA 1U2VA