1NKBA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after three rounds of primer extension, following incorporation of dctp, dgtp, and dttp.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkbA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkbA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkbA01
3KHRA 4MFFA 4FS1A 2HNDA 4CJEA 4KLFA 2RN2A 4ELVA 2D5RA 4E1MA 2HHQA 3KK2A 3NGIA 4CJUA 1WLJA 1VSDA 4B9NA 3JPOA 2ZTDA 2C2DA 1KLMA 1DLOA 4RW8A 4RNOA 2X74A 4KHUA 2Q3SA 2FC0A 1ZYQA 3PVXA 3QEXA 3LALA 1B92A 2W9CB 3OYDA 8ICVA 4E3SA 4R8UA 4K4IA 5KFJA 4DLGA 1WAJA 4FK0A 4Z4FA 5I42A 4ELUA 1S1WA 2QK9A 4RU9A 4FJ9A 5IIKA 4CFDA 5KG5A 3AA4A 4M2YA 4LH5A 2ASJA 4ED6A 5DB9A 5L1IA 1JLFA 4R8UB 3OYNA 3ZT2A 4DTSA 4YQWA 3ZDEA 1RTJA 4MF8A 3H08A 5HBMA 2D0BA 2FMSA 3B6OA 2WONA 4E1NA 2DFHA 1C0UA 3RMBA 1U04A 4W5TA 4CK3A 1RTDA 4QZIA 4CCHA 4J9QA 3NF8A 3L3UA 4KLQA 1EXQA 3K75D 4E7KA 4RQ4A 4CEOA 4EYIB 1ASVA 4RQ3A 1ZQKA 4ID1A 5JS2A 1YTUA 4J9SA 4F5QA 1J53A 3G10A 2ZUBA 1IKYA 1RT3A 3LP2A 3T19A 1HJRA 3FFIA 5BPCA 2C2EA 1LV5A 3H8SA 4YMOA 4YCXA 3JPPA 4I2GA 4G1QA 3IAYA 4DOAA 2O4GA 3P5JA 1BCOA 3C94A 3KD1E 1IXRA 1ZQTA 2MUTB 9ICJA 4JV2A 1RBTA 3K5MA 1U47A 1L3UA 3AA5X 4WE1A 1HRHA 2KFNA 4HCBA 3VQBA 3L2UA 9ICVA 5L1KA 4FCYA 1RBVA 1ASWA 5KFEA 7ICQA 5KG1A 4F3OA 4OLAA 4M3RA 3VQDA 3FYHA 2KZ3A 2FLLA 3NE6A 1D9FA 8ICSA 3VQPA 1IH7A 3TI0A 1JXBA 1KRPA 4CJSA 3VQ8A 4KAZA 2B6AA 2V4QA 1UOCA 4ID5A 1K6YA 4QZBA 3BQ0A 1KFSA 1WN7A 4FLZA 3TAQA 3RJJA 4DOBA 1NJWA 4KKOA 2JZBB 4GVMA 4R65A 5TZVA 4TQRA 3F73A 4Z4GA 1FKPA 4O55A 2OPQA 5CR0A 3CFPA 3V6KA 1S0VA 1C7YA 3RAQA 3EPGA 1S9EA 4CE9A 2AGQA 4QWDA 3VQCA 2HW3A 1K1QA 4MFCA 3MXIA 5FDLA 4CEBA 2AQ0A 3O4NA 1EP4A 1LW0A 1RT7A 4N76A 4F4ZA 4GMJB 1S0MA 3AV9A 1TFRA 3QEWA 4DTJA 2FBTA 2BCQA 1JIHA 3V72A 1SKWA 2BGWA 5KI6A 1HMVA 3BQTA 4CHNA 3MR3A 3MFHA 4MQ3A 2NRVA 1QHTA 4CJWA 2NRZA 1LB2B 5FRMA 4HVJA 3ZDDA 3ISDA 4IQWA 4RW9A 4DL5A 7ICHA 1ZQSA 3MGIA 2YHBA 2ZTEA 4RT2A 4F4WA 5J2AA 4PWDA 4BE1A 3DLKA 3JPRA 1JXEA 4DQPA 2BANA 3L3VA 7ICPA 1J9AA 4QZGA 1RT4A 2P51A 3KD5E 4KHYA 3JPNA 3K5NA 5DGBA 3SNNA 1ZQFA 1HPZA 4EP5A 4KTQA 3PO5A 3THVA 3GDXA 1XHZA 5IINA 5HP4A 2PFNA 4F2SA 4IRDA 2IC3A 4E89A 3VQ6A 3C1YA 2GUIA 5DQHA 9ICOA 4Q45A 4PPXA 8ICIA 3RTVA 4FM2A 1IKXA 3V6HA 3OYKA 3TAEA 3ZSRA 1GOAA 3WNHA 2IHNA 1HYSA 3ULDA 4TUPA 1NJZA 1Y97A 2MUTA 4RPZA 4M0AA 4OKJA 4KLMA 3RH5A 1A5VA 4PHDA 8ICRA 3EWAA 3B0XA 1BGXT 3ZSXA 3O3GA 4YD2A 4YD1A 4M42A 5J2GA 3K58A 4BWMA 2BQUA 4DTOA 3NFAA 4CEZA 2G8WA 3WNGA 5HNKA 4P4PA 3HXMA 4BXOB 1TGOA 7ICEA 5KT2A 3DM2A 5JUMA 1H38A 3BQ2A 3V81A 2G8VA 4CFBA 2W42A 4UAZA 2IBKA 4EP4A 1A77A 3TFRA 3JSMA 4CGIA 2W9AA 2ZJ5A 2LSNA 4K4GA 4Z6FA 1KTQA 1ZQEA 4P2HA 3MBYA 1NK8A 1HQEA 5CA7A 3C2MA 4EBCA 3OS2A 3H4DA 5BOLA 4QWBA 3ALYA 2V9WA 3OYIA 4YNQA 1V9PA 1CXUA 3KLEA 2P6UA 1ZQGA 4DTUA 5KG2A 3C6UA 4RPYA 2Z1GA 2XY6A 4XIUA 4KB1A 4EBDA 1UWBA 4I2IA 5DB7A 4O5CA 3N97B 4I2QA 1SL2A 2HHSA 5C25A 4Z6DA 2VA2A 3RR7A 3MECA 3U3GA 1YTAA 7ICNA 5KFLA 5FRNA 1S1VA 1S97A 4OKEA 1I39A 4EZ6A 4XRHA 4I2HA 1JMSA 4RPXA 3PMNA 2W9BA 2P66A 3ZSZA 4ECZA 2ZJ8A 1Z26A 1RT5A 1S9GA 4I2JA 5J2IA 3OSNA 4E19A 4TUSA 1KVCA 5HHIA 4KFBA 3TAGA 3RMCA 4E7HA 5J2NA 3K57A 4RW6A 1JN3A 2HVIA 2W9BB 1D8YA 4AHVA 2J6UA 3HPOA 4CF2A 5DGAA 4NLZA 3QE9Y 1MC8A 5DDYA 2VG5A 2G8FA 3SUOA 3PMLA 2BGGA 3LWLA 4I27A 1BI4A 4DTXA 4QZ8A 4YN4A 2KFZA 4E7LA 1ZJMA 4FZYA 1NK0A 2I1QA 4K8ZA 5KGXA 3KLGA 3SPYA 3D45A 1IG9A 1BVSA 1A5WA 3C23A 2OZMA 2OZSA 1S76D 4RNMA 2R8KA 4UB2A 2HHTA 4KB0A 3V6JA 4QWAA 2BE2A 1D9DA 4B9TA 2E6LA 4MF2A 4B9MA 1EKEA 9ICQA 2JGUA 2GBZA 4FJ8A 3SCXA 1L3SA 3AVIA 3N4MB 3JPSA 5KRTA 4CGHA 4B3OA 1NOYA 3IG1A 3QEVA 1RTHA 4RNNA 4KLLA 4FLTA 5KFUA 3QLHA 4F91B 3H4BA 4E7JA 5J29A 2BPCA 3ASMA 3VQ4A 4CIEA 2ATQA 4M9NA 2QXFA 1RDCA 2DTUA 4CJFA 1Q8IA 1RNHA 3MR2A 4CJLA 5KFKA 4FZZA 4PGXA 4UBBA 4CF1A 4CHQA 4ED0A 5CZ2A 4F5NA 3QEIA 4YMNA 1WSGA 2I5JA 3ORYA 3GILA 3D0PA 4Z4IA 3HP9A 3O4QA 4CESA 7ICFA 3BDPA 3Q8MA 4KLEA 5KFCA 2IAJA 4OKKA 3DMJA 1XS9D 4BXOA 5J1EA 4FLVA 4C8NA 3ZT4A 1IM4A 3M9NB 1B43A 2EX3A 3SUPA 1HYZA 4R66A 4F93B 1S0NA 4BDZA 2P6RA 2UVUA 5DG8A 3RRHA 4FLUA 5D4BA 3RB0A 1B9FA 2OWOA 3AO3A 1WAFA 1B9DA 3CM6A 1S1UA 4CIFA 1ASUA 2R8JA 1JXLA 3I8DA 3AVKA 4DG1A 3JPTA 2FMPA 4PUOA 3HT3A 4F4XA 4IQTA 4O5EA 2ISOA 1U49A 4QWEA 9ICGA 3V9UA 7ICRA 5C42A 4PHAA 1Z00A 4L8RB 1T05A 1XU4A 3AA3A 4BGDA 5J0OA 5J2CA 4XUSA 2PFQA 4FJJA 2ZTCA 2Z1JA 3C21A 1N6QA 4LD0A 5DLGA 4J9RA 4DSFA 5FROA 5L1LA 4BACA 9ICXA 3HJFA 2HVHA 3O3FA 4QZDA 4E7IA 5J2QA 3CM5A 4F5RA 2X78A 1RDBA 4NCAA 4J9OA 2VWJA 1Z3EB 5DB8A 1RXVA 1D8LA 1ZQOA 2XO7A 1ZQYA 5J0XA 1JLGA 2XGQA 4CGJA 1REVA 4ZTJA 4F5PA 3NBPA 5L1JA 4M3UA 2HHXA 3RBDA 3SV3A 1SUQA 4DF8A 1RBSA 1ZQVA 1HYVA 4KLUA 3EPIA 3S3OA 1RYSA 4YR3A 4K8XA 3G6VA 3RJGA 2YNGA 3ZT0A 8ICJA 5KFDA 3VQAA 1T7PA 1O1WA 2F8TA 4B9LA 4DFPA 2LYHA 1ZQRA 3V6DA 3MFIA 3RJFA 4OGCA 5HRNA 3LZIA 4KN4A 5KFPA 2YKMA 1UA0A 4M47A 5E41A 4CEQA 2ALZA 2R8IA 1JX4A 4UB4A 2KZZA 5D46A 4Z0UA 7ICJA 3PY8A 1LWCA 2ZUCA 1RPLA 2KZMA 4YR0A 4FJ7A 2PFOA 9ICNA 2F1JA 5HP1A 5HMLA 4IR9A 3OYJA 3WNEA 4AHRA 1HUZA 4B8AB 3NAEA 4FZXC 1GOBA 2HHVA 5J0TA 4RQ5A 4B9VA 2YNHA 3H40A 7ICSA 3HWTA 2A1JB 4YVZA 1J5OA 3BGRA 1S9FA 4R5PA 1RILA 5DDMA 2BKEA 1NK4A 2HHUA 4NCBA 2PYJA 3HX0A 4C8OA 1BQMA 2KW4A 3DRSA 1COOA 4CF9A 3KLHA 2VA8A 3AUOA 1U4BA 5HRSA 5J2EA 4H4OA 4J2EA 1HQUA 3M8SA 1ZQIA 2VA3A 4ECWA 3G0ZA 3NHGA 1TKDA 3EZ5A 4PGQA 4UB3A 3SPZA 5KT4A 5DG9A 3QEPA 5J0YA 1ZQHA 3Q8QB 8ICCA 3CG7A 4Z4HA 1JL2A 4CFCA 1TL3A 3BQ1A 3RB6A 7ICKA 4FJLA 3OS1A 2KTQA 1RBRA 3EW9A 8ICYA 5L9XA 5D49A 5J0UA 2D0AA 3CYMA 1L3TA 2V4RA 3NF6A 1VRUA 4F5OA 4G3IA 1SKRA 9ICCA 3V1RA 8ICWA 5KG0A 4Q8EA 4C8MA 4DTNA 3SQ1A 1SV5A 5KFFA 4DSLA 1NKBA 3EYZA 1QLNA 4FM0A 1J54A 3S9HA 4CF0A 4AHTA 3I0RA 1QE1A 2G8UA 3KJVA 3O3HA 4HUGA 4FBUA 4IKFA 3RR8A 3SQ2A 3IM1A 4ECVA 4BWJA 8ICOA 2A1SA 3GFKB 5CZ1A 3Q8PB 5DG7A 9ICRA 4CEFA 4M3WA 2VWKA 4FS2A 2OPPA 3LDAA 3VN5A 2W9MA 3LK9A 3ZCMA 2FPLA 4KLIA 4EBEA 4M3YA 1KCFA 2P1JA 2P5OA 1F21A 3AVBA 3OHBA 8ICGA 4O4GA 4DSIA 3GIIA 4JRPA 3QNNA 1XO1A 2VANA 4KRFA 4QOZB 4H8KA 4IQVA 3S3NA 2X6NA 3SUNA 2W9CA 4DS5A 4DO9A 4W5NA 4C8KA 1C1BA 4KPYA 4ED1A 3JYTA 5KG6A 3QESA 1X1PA 4J2DA 5HRRA 4UAWA 2JEFA 5F9LA 9ICTA 4Y1DA 4GXIA 3B0YA 3SQ0A 2IMWP 1KVBA 3OYFA 1C6VA 3NF7A 3V1QA 4N41A 2HMIA 4DSEA 4YXMA 4ED7A 2ZUDA 4KLTA 4J9MA 1T8EA 2NRXA 3KHLA 4DQIA 4OVLA 4F4YA 3NGYA 4C8LA 3LAMA 4PA1A 5BOMA 3VQQA 1ZBUA 4QCLA 2RDIA 1C0TA 2BCUA 4KMUA 5DBAA 4DQQA 4JV1A 4ECRA 1ZBIA 4FW1A 3M9OB 4M9HA 1BQNA 4RW4A 1ZQBA 1ZQZA 4N5SA 3Q8LA 2AJQA 3PR5B 3KK3A 5EWGA 3T1AA 4DU1A 1XI1A 4CHYA 4MEXA 4ZHRA 3MR5A 1BPXA 3PX0A 8ICZA 1SL0A 1RTIA 2OPSA 3M8PA 2D0CA 4CJ4A 1EXNA 3RJKA 3AVJA 2FBYA 4YMMA 3ZD8A 3GIMA 5DMRA 3LPTA 1BIZA 1QSLA 2ISPA 9ICSA 3OHAA 4NLKA 4CIGA 4FLWA 1ZQLA 2E4LA 4LY7A 3KKRA 3RB3A 2X6SA 3AVNA 5SWMA 4DTRA 1DGSA 5DLFA 3K59A 3QZ7A 5CWRA 4F92B 3RJIA 3RBEA 4ZTFA 4M45A 5IIJA 4DFMA 1A76A 3PR4A 3TAFA 4IFVA 2H5XA 2UVRA 1VSLA 4O0JA 1WSJA 3ZSWA 3TARA 4QZEA 2IGIA 3CFOA 3DI6A 4KHQA 2G8HA 3PV8A 2BCSA 5CY4A 2PZSA 3PW2A 4N47A 4M3XA 3EY1A 3ITHA 4J9KA 1XSLA 2GWSA 1TVRA 5I3UA 2C22A 2J6TA 3F9KA 3QINA 5CHGA 4NYNA 3LZJA 2JEIA 4KHSA 4QW9A 4JUZA 1B22A 3P83D 1NK5A 5KFAA 4QZCA 4CHOA 4CK2A 4CJ5A 4Y1CA 1KVAA 1BPBA 1QS4A 4CGGA 3UPQA 3GIJA 4I2DA 4GW6A 1ITGA 3DLRA 3V7JA 1X9MA 5KFHA 4GXKA 4KTWA 2B4JA 4DFKA 1RT6A 5EU7A 3A2FA 5KFSA 1ZQNA 1EX4A 4NY8A 1C1AA 4ED8A 2PXIA 1KFDA 2ATLA 1LW2A 4DL7A 4AILC 3ZDCA 1TK8A 1XWLA 4I2FA 5CYQA 5CB1A 1HNVA 5DBBA 4I2CA 3ZSVA 2R7YA 3C6TA 4YR2A 3OYBA 1TKZA 4HUFA 5C5JA 2FBVA 3NH0A 4IRKA 1TVAA 3RJEA 5DKWA 3MR6A 4FK4A 1MU2A 4DSJA 2BPGA 3AO2A 1NOZA 1S5JA 3SQ4A 1X9WA 1W9HA 3PW7A 3ISNC 1X2IA 1S6QA 1TAUA 1L5UA 4Z4CA 4BE0A 4KO0A 2Z1IA 4W5OA 4GC6A 4LZDA 4KLHA 4Q43A 3OYHA 4RQ6A 3NDKA 3PX4A 5J0SA 4RQ1A 4H4MA 4CJQA 4RT3A 4OJRA 1LWFA 4PHEA 5KFIA 4KI4A 3ZSQA 4FJMA 9ICPA 5CYMA 4J2AA 1JLEA 3RJHA 4FK2A 4PH5A 3C2KA 1NKEA 3OYGA 9ICIA 4KHNA 4QW8A 4I2PA 1TL1A 4TURA 5J2HA 1NJXA 5J0RA 1EETA 4FVMA 4ICLA 4IRCA 4FJIA 2YNIA 3HVRA 4KN7A 1VSKA 2ZJAA 1BPYA 1NKCA 1BL3A 4PY5A 4RUAA 3TQ1A 2W8KA 1RXWA 1BI4B 3CQ8A 5J2KA 1FXXA 3HSTB 1ZQCA 4YFKA 1BCMA 3TWHA 3MXJA 1TAQA 2KN7A 5IIIA 4EYHB 3Q8KA 1C1CA 4UAYA 4ZH4A 3UXPA 4DS4A 2HHWA 4LH4A 2XCPA 2RF2A 3L2QA 4LZGA 7ICLA 1TV6A 5J2FA 3T5LA 2O4IA 3L8BA 3DLEA 3GIKA 4Z4EA 4PQUA 3G6YA 3PX6A 4J9LA 2FLPA 4K4HA 1ZQMA 1JLBA 4FJKA 3V1OA 8ICUA 4J9NA 1QTMA 8ICQA 2F8SA 4YXJA 4OGEA 4MFAA 5KFQA 2UVVA 1ZQQA 4CECA 8ICNA 5EWEA 3TANA 2VG6A 4IFYA 2FBXA 5HHHA 1RDDA 3T5KA 2XGPA 3QIOA 4YG2A 5KT6A 3AA2A 2BHNA 5J0QA 1JLAA 3AU6A 3ETLA 4OPJA 4CJVA 1YVUA 5DK5A 3LANA 2XY8A 3KHHA 2AGOA 1RZTA 3OGUA 3UIQA 1N5YA 2YV0X 3DRPA 3NCIA 1CUKA 2BR0A 1Q9YA 1UT5A 3SJJA 4X5VA 1N56A 3WNFA 3MEDA 3V9ZA 8ICMA 1DTQA 3PW0A 7ICGA 9ICAA 3IS9A 3DLGA 4ELTA 2YKNA 2NRTA 2NRWA 1WSHA 2P5GA 5KFXA 2F1HA 2YNFA 1S1TA 3GV8B 1RCHA 3PW5A 4FYDA 1BISA 2I9GA 1IKVA 3PUFA 3LPUA 3NGZA 4DTMA 1KLNA 3GV7B 4CGDA 4GC7A 2JEJA 3V9SA 2A1JA 4ECYA 4O3PA 4O44A 4CHPA 1XC9A 3V4IA 1KFTA 3RH4A 3OYMA 2XCAA 2RDJA 3QIPA 2OA8A 4NM2A 4ED3A 5DBCA 4JS4A 9ICLA 4CFAA 4KITB 4I28A 5KGWA 4FJ5A 2IHMA 3V7KA 3VA0A 4IQUA 2R8HA 4I2AA 1BHLA 4BDYA 2ZQBA 1QSSA 4DL2A 1S6PA 1S1XA 4PGYA 1WNSA 2ASLA 4KHWA 3QZ8A 4MEYA 1IO2A 4Q5VA 3LP1A 3T5JA 4UB1A 4NXZA 1N48A 3L2WA 2PYLA 4HCCA 3HVTA 2FLNA 3H8JA 4ED2A 7ICTA 2XY7A 2XRIA 5J0PA 4P4OA 3KKSA 5KFBA 4NYFA 4Q44A 3HL8A 4F8RA 3KTQA 4CHZA 1U9LA 4QZAA 2XC9A 4J9PA 3AO5A 3CFRA 1IKWA 3T3FA 9ICBA 3BJYA 3GQCA 2F1IA 4ECSA 4JS5A 4HYKA 1VSFA 4HUEA 1VSIA 5KT5A 3UQ2A 3AO1A 4RQ7A 4GXJA 4I2EA 3OY9A 1KDHA 3ISBA 4KLSA 1VSMA 5KRSA 4CGFA 3L2VA 5DB6A 5HMMA 3L2RA 4DWIA 3DLBA 4KV8A 3RB4A 4Z6EA 5KT3A 4F50A 1ZQUA 2JZBA 1JKHA 3NH2A 4RUCA 2OYQA 3OVNA 2QKKA 4UB5A 4ECTA 2GV9A 4W5QA 4AH9A 9ICUA 1CXQA 4B8CA 8ICAA 4B9SA 2PI4A 7ICMA 3C95A 4NLNA 3E01A 3OYEA 3AO4A 8ICKA 3UQ0A 2RPIA 3QERA 4QZHA 4KREA 1NJYA 3NH1A 5KFTA 1UA1A 1T4GA 2FMQA 3E2EA 1WCLA 1TKXA 1UT8A 3HYFA 4I9LA 4O5KA 2ZD1A 3LWMA 4DU4A 4JK1A 5DQIA 4M3TA 4LSLA 4NLGA 4DF4A 4I9QA 1TK0A 3RMAA 1X9SA 8ICPA 1TV9A 2FPKA 2UVWA 2ASDA 4OPKA 2IOCA 1NK7A 3C5GA 2RKIA 4DL4A 1ZQJA 4KI6A 4M6WA 4TQSA 4NM1A 3C2LA 3OS0A 2DY4A 3Q8SB 4PHPA 1RT1A 4JLHA 1D5AA 3AVLA 8ICLA 4LSNA 2HB5A 3ISCA 4O9MA 4IG0A 3SUQA 3C5FA 2NUBA 3MABA 4DSKA 1KSPA 3VQ9A 4M9LA 9ICMA 4FBTA 1RBUA 3SI6A 2BCRA 2G8KA 1ZQPA 4HHTA 1ZQDA 4LVSA 4CEEA 4DU3A 3H7IA 4CEAA 3C1ZA 4I2BA 4ECUA 3LP3A 5C24A 5KFYA 2YHAA 3MDAA 4KLJA 4MFBA 4M41A 2PFPA 5KFNA 1WCNA 3V9XA 3KLIA 3MEEA 4RW7A 4B9UA 4M3ZA 2WTFA 3TAMA 3OJUA 3VA3A 3H8WA 5J2MA 9ICHA 7ICVA 1ZBFA 1SL1A 4BDPA 2IS3A 3PO4A 3HPGA 4O3NA 4NCGA 3VQEA 4DOCA 3TR8A 4DQSA 1BPEA 2FPMA 1T03A 3AVGA 8ICEA 2WOMA 2J6SA 4JWNA 1JL1A 4DEZA 4IDKA 1QSYA 1VSEA 3QETA 3RMDA 1BIUA 4CJTA 4IBNA 3RRGA 5J2DA 2JEGA 3ZT1A 4DL3A 4FLYA 4TUQA 2EHGA 4ECXA 4HTUA 4RG8A 4QZFA 1YT3A 2ETJA 1DTTA 2F96A 2ZE2A 1BPDA 2KQ2A 3S3MA 4RZRA 8ICTA 7ICIA 2Z1HA 3KHGA 1NK9A 3SV4A 1ZQXA 2JLEA 4JWMA 3NGDA 2Q0ZX 2PY5A 4RQ0A 4AHUA 2XY5A 4EZ9A 3QEAZ 1VSHA 4JV0A 3AVMA 4KTZA 7ICUA 3KK1A 1JLCA 3LDSA 2PI5A 1S0OA 3GV5B 5KT7A 5KG7A 4CK1A 3HM9A 5EOZA 2VG7A 2OPRA 3OJSA 4M9JA 3TAPA 2BQ3A 5J0WA 3LP0A 3JPQA 4FJNA 1XSPA 1RDAA 4UBCA 3M8QA 1MSWD 2BPFA 1XHXA 3T5HA 1TK5A 5KFMA 4CEDA 3DYAA 4CJKA 1DOQA 1ZJNA 3VQ5A 1RT2A 1NOMA 2MAXA 3P1GA 5DQGA 3PW4A 2DFFA 1PZNA 4XA5A 4B08A 4CJ3A 4O3SA 1ZBLA 3FDSA 4AHSA 1T3NA 3K2PA 4JRQA 1LAWA 2G8IA 1QQCA 3UXNA 4O3OA 3V7LA 3SYZA 4OLBA 1NK6A 2R8GA 5HRPA 4R64A 3KIOA 4P4MA 4N56A 1W0HA 3HP6A 4FO6A 5F9NA 3KLFA 4RQ2A 1Q9XA 1ZQAA 1SZPA 4M6WB 3NTUA 2AU0A 3AVAA 3U6FA 4DLEA 8ICFA 2IA6A 2E6MA 5KFOA 3DRRA 4DQRA 4J2BA 5SZTA 5K14A 4O3QA 1KEJA 3G6XA 4CJRA 4EEYA 4IR1A 3K4GA 4F2RA 4M04A 4KLGA 3RWUA 4CJPA 4KLDA 3MXMA 4AHCA 3AU2A 3SZ2A 2DFEA 1HUOA 9ICKA 3TABA 7ICOA 1WSEA 3IRXA 5IIMA 1WSIA 3LAKA 3QEBZ 5KG3A 2BDPA 4KLOA 1WSFA 5EWFA 5JS1A 2AGPA 8ICBA 4UQGA 4FJGA 2A1RA 3ZDBA 1MQ2A 3RH6A 3AVFA 4YP3A 1AROP 1LWEA 4FW2A 2AQ4A 3OYCA 3TFSA 3M9MB 3MEGA 3K5LA 1ZQWA 5KFZA 1Z25A 5HLFA 4BE2A 8ICHA 3VQ7A 3ZT3A 1I3AA 2DPJA 5HROA 5KG4A 2Y1IA 1CLQA 2C28A 1RYRA 4GLXA 4E0DA 3MDCA 3ZDAA 3HPHA 2B5JA 4DTPA 4O5BA 4FLXA 4FJHA 1FKOA 4I29A 4DMNA 3Q8RB 5IILA 3QNOA 4Q0BA 2DFLA 1ZETA 1Z00B 1TKTA 1U45A 3IHQB 5J2PA 5CP2A 4O0IA 3HO1A 2ITGA 4R63A 3I0SA 1XSNA 1G15A 1JLQA 4CERA 3MGHA 2W8LA 4ECQA 2B21A 3ZD9A 3SI8A 2HNYA 4Q8FA 3DLHA 1BPZA 9ICFA 4TSXA 1CEZA 2M9NA 1LAVA 4Z6CA 4IG3A 3PNCA 5D3GA 5KFGA 1C0MA 4XQ8A 1CZBA 3K5OA 5KFWA 1S10A 4M9GA 1FK9A 3OSPA 5J2BA 1GOCA 1ZBHA 2QKBA 1HNIA 2IDOA 3AVHA 3UXOA 4FXDA 2C2RA 1CZ9A 3M8RA 1A5XA 4I7FA 4FJXA 2BCVA 4QZ9A 4DL6A 1R0AA 3ZSYA 9ICEA 5IIOA 4YFUA 2BQRA 3QO9A 4RQ8A 2XHBA 3DOLA 5KFRA 4CF8A 1MQ3A 3U3YA 1S77D 4FM1A 4DFJA 3AVCA 3RAXA 1UAXA 9ICWA 3V9WA 1U48A 5KFVA 3DOKA 1K1SA 8ICXA 1VSJA 5KTQA 1SKSA 5T7BA 5CJ7A 4O3RA 2DPIA 4QWCA 5J2JA 4F3TA 1VK0A 1HJPA 3B6PA 3ZSOA 2Y1JA 3NF9A 1VRTA 3MAQA 1Y88A 3OYLA 1L3VA 3OYAA 2HNZA 4F4KA 4QAGA 3HK2A 4W5RA 3HW8A
chains in the Genus database with same CATH superfamily
3A13A 3KHRA 4MFFA 4DR4F 2RHQB 1S7HA 4CJEA 2NXCA 3R3LA 3TJ9A 2D5RA 4E1MA 1VMBA 3ELHA 4BRKA 3N4WA 4C80A 1PBAA 4K59A 1VQMN 4I6YA 2EK1A 1SXLA 4JOUA 1WLJA 4PKHA 3WQPA 4CJUA 3KKFA 3GJQB 1I51B 3LGMA 3GU0A 4H03B 2RLTA 3MUMP 4RW8A 2FQQB 3B9JA 3QBCA 2FC0A 3LALA 3IWLA 3OYDA 4DPWA 2K89A 1UW4A 1CJKA 4NEZA 4ZCKA 4FK0A 3NCRA 2XI9A 2QK9A 4RJVA 4OJPA 1OKJA 2AX0A 4RU9A 4FJ9A 2B6AB 4CFDA 3AA4A 2UXBF 2J0WA 3V4IB 1OIAA 3L3CA 5L1IA 4R8UB 3QUTA 3ZDEA 4C7ZA 4ANEA 5IQQA 4EGLA 4AP9A 2WONA 2AYEA 4EAHD 2DFHA 1KKXA 3BS5B 2D1KA 3G9CA 1E3MA 3S6EA 1GMUA 1VHIA 4P2XA 2FJAB 4QZIA 3NF8A 2ESEA 1K73T 3MMVA 2YJEA 4WTOB 3NVZA 4RQ4A 4EYIB 1DY3A 5L9NA 2JWKA 4C98A 4ID1A 5JS2A 3UKUB 5AQWA 1YTUA 2V2QA 1U24A 3O1LA 1ZM2A 3FR0A 3PJ9A 1J5EK 4KGKA 3H5UA 5T7LB 3QT7A 3T19A 2H51B 4LSNB 5GMDA 2CQBA 1D8BA 1QD1A 1H7XA 5BPCA 2EFVA 1LV5A 4YMOA 4CLWA 4YCXA 1YXQA 3D9BA 1BCOA 3C94A 1FEEA 1IXRA 3OL6A 2L41A 3M8WA 2ASPA 3W62A 3M2VB 2XBPA 4M5DB 1WKJA 2OTJS 3L2UA 1FF2A 4JI0K 4FCYA 3AT1B 4LRAA 5KFEA 2D0PA 3H0MB 3FYHA 2KZ3A 2P9KB 1T9XA 4K25A 4KH0B 2RE2A 3VEWA 4JV5J 1KQQA 4X66F 2ASOA 1FD8A 1N88A 3MPVA 6AT1B 1R0CB 5ETMA 3PIOQ 2A40A 1UOCA 1K6YA 2DGXA 1HWIA 1KFSA 3NNCA 3RJJA 2JJ4D 4DOBA 4KKOA 4OX8A 4GVMA 3SAFA 2Q2RA 2KVIA 3HHNB 5CXTA 4K41A 4Z4GA 4ZVFA 1FKPA 4QPXA 5ALJA 1QDUB 1VQ4N 1WF2A 3V6KA 1S0VA 4JYAJ 2V94A 4CI6A 4QWDA 4X65F 1GLDG 3W1YC 4AT1B 1RTDB 4GY2B 3CUNA 2KE7A 4LF4K 2IY5B 1EP4A 1RT7A 4N76A 3O4NA 4IH6A 5AQFA 2GVDA 1XR7A 2BCQA 3W9IA 2LQ8A 2BGWA 5KI6A 4BRMA 5B0GA 5AJ3K 2KHDA 3H42A 4ZVQB 4KHMA 4MQ3A 2LFVA 1V9OA 2BJEA 1LB2B 1U1OA 2V67A 3QJLA 5F0XA 3B4MA 5FRMA 4BBYA 2Y0SF 7ICHA 3MGIA 3ED5A 2ZTEA 3SQGB 4TY8A 3QAUA 5AQRA 4Z94A 2J9DE 4NLSA 3CIMA 2GCFA 3ZTPA 4DQPA 2BANA 4DV5F 4FKXA 4LF9K 1RT4A 2P51A 3KD5E 1P9QC 1IQTA 2YWKA 4P71A 1ZQFA 5CH7B 3CCMS 1ED1A 2CRXA 1LK7A 2O8FA 4W92B 4ID8A 3FC9A 4IRDA 2QSFA 4DCPB 3C1YA 3UM9A 5FPDA 1VR6A 1IKXA 4IH5A 3DDIA 5BYQA 2GO7A 1NGEA 3ZSRA 3WNHA 2LXFA 1K9MO 5A8WB 1Y97A 4XDCA 5B7WA 4WFZA 4PHDA 8ICRA 4KAIA 2ZBIA 4JKGA 1BGXT 3ZSXA 2AF6A 4TU7A 4J9UE 4YD2A 3HM8A 1CBKA 2KL8A 4MO4A 2FVQA 3BZQA 3NFAA 3WNGA 4BXOB 2V4JA 7ICEA 3ZETA 1H38A 3BQ2A 3GYGA 2G09A 1TFYA 4CFBA 2DXFA 1UVMA 3H3NO 2F76X 4FWMA 1U2VB 2VHGA 3PLAA 3UKRA 1HHSA 4TY9A 2PO4A 4OJGA 1NM1A 1X5OA 3FZFA 1GX5A 4CLYA 1KTQA 4C3LA 2P9PB 2BACA 1EQYA 1ZQEA 2HSEB 4TVAB 3MBYA 1NK8A 2EAOA 3DGPB 1HQEA 2RH3A 5GADI 1ZOLA 5CA7A 1XC3A 2ZBCA 1WC4A 3OTOF 5FLXU 4QWBA 3T69A 1V9PA 2FHJA 1U6ZA 1RHMB 3KLEA 1S49A 2ILYA 3TA1A 5CA5A 1ZQGA 5KG2A 2I5JB 3C6UA 4XIUA 1RT5B 4EBDA 4ZS6A 4O5CA 1B4FA 1JJCB 3ZZZA 1SL2A 2HHSA 3EMTA 3U3GA 4PPDA 3GJRB 2H3IA 1VQ9N 2ATCB 4XRHA 5BPMA 4DR4K 4DUYF 4B9QA 1Z26A 4F4AA 3R9KA 4X4TA 1JNZB 3T41A 1XO0A 3QIPB 4TUSA 2R7UA 4U6PA 4USJC 3EE3A 3RMCA 2VIHA 4DFDA 2W4DA 4PCQA 4ISGA 2V34A 3MCNA 3HBTA 5L8RC 2P9LA 3A3OB 4AHVA 2J6UA 2PE8A 5DGAA 4NL9C 1IR1A 4JI2F 3CJTA 2B4PA 2L9NA 2XSJA 1AUDA 4I27A 2X3DA 3CCJN 3NP5A 1BI4A 4JN4A 3CJQA 4JB8B 4NZ7A 2OI2A 1CPZA 2VASA 2J0SD 1QQMA 4IOAQ 2IOFK 1WG8A 1M5PC 3D6FB 4DR5F 3LUYA 4BCAA 2A18A 2K3IA 3KLVA 3D45A 3DRYA 1A5WA 1NRKA 5AE1A 4KX5A 1AW0A 1S76D 5TISU 4RNMA 2DRBA 5D15A 3L4PA 5AFUH 1K44A 4BC5A 1QM9A 4KIAA 4LRFA 4B9TA 2KJWA 3FZ2A 4B9MA 1HNXJ 2MKIA 3HTVA 3QXGA 3W3DA 2CJQA 3JPSA 1VRQC 1NOYA 3QEVA 5AKEA 3OXGA 2WF9A 3J81Y 1MN9A 4KLLA 4FLTA 2DKZA 5KFUA 4YN3B 4FWKA 2ZUGA 4E7JA 5J29A 3WC2A 3SEOA 5LXYA 1IV0A 2QXFA 1RDCA 3L09A 2R7QA 1Q8IA 1RNHA 2IAJB 5KFKA 4FZZA 2UU9J 4PGXA 3G96A 2N82B 1YITN 1XERA 3CCRS 4YMNA 2LM1A 3CD6S 2EBGA 3WEEB 3D0PA 5A6WA 2ACYA 3SQIA 5AQUA 2OGUA 3A5OC 4KLEA 3SBGA 3DMJA 2HVDA 2MYFA 4BXOA 1HKBA 1NDCA 2PAVA 1B43A 1TVRB 3NMRA 3W8GA 3SUPA 2VBWA 1VK3A 1MROA 3X1LB 5A0YA 2DNMA 1NHKL 2PSZA 5AQNA 4JI5J 3PG9A 2HNYB 1XNRK 2KG1A 3N4PA 4FLUA 1XMQJ 2D9PA 2XZDB 3B8HA 1WAFA 4CNQA 2KHQA 1WORA 3LF0A 1B9DA 2DR9A 2ZBPA 4BVPA 1ASUA 1F9EB 3JQJA 3AVKA 2FMPA 1VC6A 4GKKK 4US8A 4DV4J 2NZTA 4OHXA 1RT4B 2ZJQL 1RDFA 4BRIA 4DR5K 2DGVA 7ICRA 2AJ0A 1Z00A 1NXIA 3CCSS 4M1KA 3FZLA 3A3PB 1D0EA 3CIZA 4DV4K 4BGDA 3EICA 1YDLA 2K8CB 1SJQA 4XUSA 2DO4A 5K8MA 2PFQA 4FJJA 2FF3B 2V52B 3IAS9 2Z1JA 3KXDA 4BRCA 1FJGF 3HFKA 3F2DA 5FROA 2B43A 3LP0B 4LVOP 5ETOA 1D09B 4PL1A 1PCAA 1U09A 2KXHA 4XDDA 1IBKF 2HPUA 3F5EA 5DB8A 1VQ4S 5AK5A 1FI4A 2CPZA 4LFCF 4I6WA 5EOYA 3AL0B 2HS4A 4KQZA 2XO7A 1JLGA 5J0XA 4B3RF 2BZ2A 3K1RB 2OAUA 1PAUB 2QTDA 4GKKF 1OSDA 2A41A 5H9EJ 4WYLA 3VGMA 3SV3A 3G4SS 4FWOA 2GHWA 2MLYA 1TL3B 4DF8A 2EVZA 1ZQVA 4ANDA 1RBSA 2VBYA 3LM2A 1RYSA 4YR3A 4K8XA 1NUEA 2O8BB 3PZPA 5AM0A 5CD4H 1GX6A 2VQEJ 1O1WA 3I0RB 4M7XA 4DFPA 4EMDA 2QA2A 4HACA 3WZ0A 1T9VA 5HRNA 3LZIA 1XMOK 4EFHA 3ONQA 5E41A 3I82A 3LDQA 1IWGA 3G71S 2ALZA 1DLOB 5IM0B 2EC2A 1JX4A 2KZZA 2ZUCA 2KZMA 2K4IA 4DR7J 9ICNA 1OH8A 1BUXA 4IOCQ 3R7NB 2PC6A 2A6OA 3WNEA 3GZ7A 1HUZA 1ZPVA 5C42B 2OYYA 4NLRA 1S22A 4B8AB 3CQXA 1GOBA 2HHVA 2HOEA 3HI0A 3KLEB 2XM3A 2OTLS 2A1JB 4YVZA 1KQSM 1FXLA 1RILA 2XVTA 5DDMA 2BKEA 1NK4A 2FVCA 2UUWA 1DGJA 3OUYA 1SB3C 5ALTA 2HS3A 2KW4A 4DR2F 2P9PA 1JB0C 2AEJA 5J2EA 2W25A 3ICLA 3UQSA 1FK9B 4J2EA 1ZQIA 5ALXA 4I4BA 2CPDA 2ZWOA 1R0BG 2VONA 4NLQA 2LQ5A 1SIWB 1ZQHA 1T02A 1XNQF 3OHRA 4CLPA 8ICCA 1VQ7S 3W5ZA 2WF5A 7ICKA 3FUYA 1HKGA 1AQ6A 5C15A 1FFUA 3BBBA 3OS1A 3J80O 4DN9A 4EWTA 4JK7A 2IHR1 3IAM9 5L9XA 2UUAJ 2D0AA 3CYMA 1X4HA 4F5OA 9ICCA 2HFOA 4C8MA 5EHHA 3JTOA 5ALUA 3BS5A 2E66A 3F9MA 3SCLE 1M5VC 3A4TA 4W4MA 4NL5A 4JI4F 1FFSB 1UFLA 2BA9A 1J54A 1RAAB 2UUBF 2MKSA 1PILA 4DR5J 4G1QB 4JI6K 3HHLA 5HQMA 3UDEA 2EFQA 2MQNA 3I8BA 3M7VA 1YJNN 3H20A 4ECVA 1V97A 3CGIA 2A1SA 3GFKB 1BA0A 4H5WA 1JNRB 1SBRA 4MMOA 5MLCV 1QAYA 3Q8PB 5DG7A 9ICRA 4CEFA 4OFZA 4M3WA 2QN6B 2VWKA 1QAIA 2CQPA 3JYTB 4CM2A 1PC5A 1F21A 4O4GA 4DSIA 3T9ZA 2Y0SC 4H4OB 3QNNA 3AB4B 2VANA 2MQQA 1M5OC 4KRFA 3EDQB 4TU9A 3PKMA 2JWLA 1KS2A 4DR3F 4C8KA 1I3OB 3OTEA 1WUUA 3FZHA 4BRNA 5KG6A 1VQSA 4CDIA 3QESA 1GT8A 2QMXA 5HRRA 4UAWA 4BG9A 5F9LA 1NNDA 5LL6Z 4G9BA 5ETKA 4DV6F 4Y1DA 3MEDB 4WFBL 4DUZK 3SQ0A 3BP8A 2IMWP 4PPZA 1NO8A 4G65A 2ZIXB 3OYFA 5GMEA 3VV2B 4DSEA 3SJHA 4ED7A 2XI3A 1FJGJ 2ZUDA 3I4PA 4KLTA 4J9MA 3CJAA 3KHLA 2N3OA 2OJ3A 1C0UB 4F4YA 2I0XA 4C8LA 2AZ1A 3VAKA 1ZRMA 1WG5A 3WK7A 4PA1A 1R27B 2HWHA 3VQQA 1M5HA 3NOCA 2Z58B 1WUDA 2UXDJ 3I28A 4JP8A 4CD1A 2XULA 3BN4A 5DBAA 4ECRA 1PO6A 1AB8A 1UKUA 4QU6A 3GYNA 1HNZF 2ZE2B 1HJOA 5A0YB 1ZQBA 1N5VA 2AV5A 3WQUA 3AJ2A 2AJ2A 3KK3A 2G5HB 4CHYA 4EO6A 3CCES 2NUHA 3LVWA 4Z7CA 3H1QA 3NL0A 4H5TA 1SL0A 4IO9Q 2XMJA 2OPSA 2VKZG 3W63A 3W65A 2D0CA 1EXNA 5GAHI 4KJIA 2FBYA 2EZZA 1IJFB 3AH6A 5DMRA 1H72C 4QIGA 1IUJA 2ZH9A 4FSVA 2VOOA 5LSOA 2PFUA 4FLWA 4LY7A 3KKRA 4L3KA 3AHPA 2YQ0A 4WTYA 1RGIA 2B9EA 1IR0A 2E8AA 1OVQA 3O1WA 3VALA 4DMZA 4CLKA 1DGSA 4Y0WA 2A10A 2FVRA 3X3UA 3UR3C 4F92B 4ZTFA 4M45A 3VEYA 1NDPA 4JV5F 5D0HA 2DNQA 4ZVRB 2BKNA 2UVRA 4KGVB 1T9WA 1ZOTA 3ZSWA 2FGOA 3TARA 2B9YA 2G8HA 1D1UA 1WWHA 2VG6B 2BCSA 1IWAA 2ZH4A 3OFGA 2HMIB 4Y2CA 4M3XA 3EY1A 3P5TL 4U95A 4ZLNA 4NXNF 1CULB 5AXMA 5BR8F 2GWSA 4OYZA 4M5KA 2J6TA 3F9KA 3QINA 5CHGA 3CETA 4K4SA 1VAZA 4KHSA 4UUWA 1N4LA 5JVHQ 3CC7N 4DV1F 4PG4A 4DV2F 3P6YC 2VKQA 1UQVA 1JQGA 3MN6A 4QIVA 2KG5A 4CHOA 1RHJB 4CK2A 2W4CA 5IV3A 3UPQA 2Y0SD 2B9XA 4GW6A 1ITGA 2LDYA 1GTEA 4DX8H 4RR5A 1PYTA 1GH8A 1X9MA 5B8HA 2B4JA 2VV5A 2YWFA 4NB4A 1VQON 5KFSA 5BN8A 1EX4A 4NY8A 3UKRB 2CQ1A 4FF4A 5CYJA 4ED8A 4IOAL 3SCIE 2ATLA 2A2DA 4CLUA 4JAXA 3U9DA 2NS1B 2HF3A 4ZIVA 2XLJA 3CJBA 2R7YA 1VQ8S 4BHQA 3OYBA 4B1VA 2ZH8A 3DN9A 3CMAS 4MIWA 3CVKA 5EX0A 1Q5YA 5DKWA 2BPGA 2CGLA 5F2RA 1NOZA 3MPDA 4KPCA 3ISNC 1KOHA 1X2IA 4KO0A 1WEYA 4LZDA 2MGZA 4Y65A 5J1PA 3OYHA 5M1FA 3M32B 2R2SA 4LFBJ 2HQIA 1RWNB 5JLFA 2HBYB 1AA1B 4RT3A 1LWFA 1YGYA 1ZTWA 4K0KK 4KI4A 2EG2A 2WSEC 1UTAA 2XNRA 3V5RA 3AD7C 4TLQA 3OBWA 1NKEA 2N7CA 9ICIA 1CJTB 2E1RA 2R9LA 3ZX0A 4I2PA 5H1SV 2F7TA 1N8RO 5J2HA 4FVMA 4F04B 2ZIUB 1B0VA 1WKKA 3HHLB 4KN7A 1VSKA 3TZZA 4USAA 3BR9A 2ZJAA 4BC3A 5KL8B 4RUAA 3TQ1A 1UW9A 3ID8A 1BI4B 2OPSB 1NAQA 1FXXA 3HSTB 4QZVB 4XK8C 4UZBA 5F8LA 5C2GA 3KWGA 4CZLA 2KN7A 2NZCA 2WVBA 4F0HA 1ECWA 3PYFA 1EQMA 4OZ5A 4UAYA 2G0JA 4ZH4A 3TEHB 1BNPA 2X1AA 2HHWA 1RQ0A 5B0FA 2UXCK 4LH4A 2RF2A 3L2QA 4LZGA 2E9TA 5J2FA 2O4IA 3BO4A 3K9KA 3L8BA 5JJBA 4UY8O 5AQJA 4Z4EA 4PQUA 1F2HA 3D3BJ 3AY9A 4PYAA 1JLBA 1XNRJ 2OLWA 4J9NA 3NS6A 3CEDA 3HZGA 2F8SA 2IYGA 4YXJA 4DPTA 4MFAA 2R2RA 4LF6J 8ICNA 2VG6A 1RWKB 1Q95G 4YEAA 1RDDA 3AARA 2HOQA 1U0SA 5HP1B 3QIOA 2F3JA 1XNSA 2BHNA 1JLAA 4AQYJ 4CJVA 1NWKA 4PG6A 5GIOA 3UCGA 3DGPA 2XY8A 3LVVA 3DLGB 2UU9K 4K5SA 4CH7A 2AYMA 5B0AA 2BX6A 2OTLN 1N5YA 1TKTB 1S4FA 2VYPA 2YV0X 1IBMJ 1N0VC 4L76A 5C2FA 4ZOHC 1J2VA 3SJJA 2XS2A 3NNHA 3MEDA 3WNFA 4CI0B 2C2MB 3PW0A 5AM2A 9ICAA 5G5HA 5BRDA 1UJ4A 4JKHA 4ELTA 1X66A 1U25A 4OI2A 2NRTA 3N6NA 2EFPA 2F1HA 3U27A 5ALGA 5LMUJ 1RCHA 3PW5A 4FYDA 2Q1NA 3LPEA 2I9GA 4C0HA 1I94F 1FCAA 4Y2MA 1S12A 3L7PA 3FQKA 1NPKA 3NS1A 1UAWA 4O3PA 3TZWA 4NO7A 4CHPA 1KVKA 3QIPA 2BVZA 3MGVA 1TTHB 3HI9A 4JS4A 2CQDA 1QTNB 2ZVSA 4L73A 4K42A 1U02A 4K2XA 5E3AA 4KITB 4I28A 2Y3YA 5KGWA 1N60A 3DOMB 2Y9UA 1BHLA 3KK3B 1YWXA 2K4HA 3Q89A 4PGYA 2V8VA 4MEYA 4RWTA 4UB8U 3LP1A 3HHKA 1NG9A 4NXZA 4KGZB 3KKAA 2PYLA 4HCCA 1KKHA 3G4SN 4ED2A 3J80U 2DT9A 5J0PA 4Y2SA 5M1QA 3R9PA 4A62A 1FDBA 1HW8A 4Q44A 2OHFA 4F8RA 5A8RB 4NMLA 3IBCB 4U8VA 3N28A 2XC9A 3N9UC 1V5IB 2J7KA 3CRXA 3T3FA 3GDQA 3BJYA 5MAOA 4HYKA 4UQTA 4HUEA 2X3GA 2EG1A 3MI7X 2I1RA 1G4CA 3I1YA 4P6QA 1WDDA 1RG6A 4RQ7A 4ZA1A 4GXJA 4I2EA 3QRPA 3OY9A 5HVGA 2OPQB 2KXFA 5EN1A 2ZJPL 2LMRA 5HMMA 4ZLJA 4DZ6A 3DLBA 3TJ8A 4CNZA 3BZCA 3TU5A 4Z6EA 2RD5C 2JZBA 2A3JA 3NH2A 2ROEA 1JLFB 3AFGA 2ZDPA 2OYQA 1R6YA 3OVNA 1VIXA 4W5QA 4AH9A 3ONNA 1CXQA 4B8CA 3O80A 3I56N 2VFUA 4HEA9 2GGPA 7ICMA 4ERDA 3C95A 3WEEA 4LQ9A 1NGGA 4G1IA 4B02A 1YJ9S 2R2TA 3UQ0A 2Q1LA 2Z2YB 2LVWA 3WXIA 1UA1A 4WK3A 3E2EA 4RUBA 4IOBA 1UHUA 3KLGB 4JI2J 4DR7K 5AQVA 4I9LA 4O5KA 2QYCA 1CRXA 2E9RX 1L3KA 3ZTSA 4CRXA 4CBWA 5DQIA 4LSLA 2QA1A 4NLGA 2L9DA 3F41A 4I9QA 3KWMA 1EKSA 3MC1A 3R3TA 2HMXA 3CMEN 5LMNF 2YCHA 4JD2B 4DPOA 1Y7PA 4LBHA 4P9SA 1WI6A 4JI2K 5IWAJ 4FKYA 1M90O 1NK7A 2H3ZA 4LFAK 2KJVA 3Q8SB 4JLHA 1RWMB 4I67A 3MPUB 8ICLA 1C0TB 2HB5A 2B51A 3SUQA 3AMZA 4LF6K 1RK8A 4FXVA 3BH6B 3TA2A 1KSPA 1WF0A 4CH0S 4Z7YA 3C8YA 1IBLF 4M9LA 9ICMA 2X1BA 1RBUA 4JKFA 3MWTA 2P9CA 2BCRA 2AMCB 4L75A 4LF1A 4GV9A 4DU3A 1YJWN 3ENVA 1WB9A 1WTFA 4I2BA 2GQQA 5EX3A 4MTPA 1PC4A 3D28A 3KVGA 3D5MA 3PSTA 3MDAA 4MFBA 2PFPA 5KFNA 4MIBA 4J37A 5THWA 1LOTB 3KOOA 4EELA 2VJ5A 1FNXH 5GAGI 3PYDA 4DV3F 5DZ6A 3A8EA 3CJ0A 1HR0J 3O44A 3PSIA 2DXEA 3VA3A 1FEHA 3H8WA 4ILJA 1ESVA 4Q2MA 2WAQD 1SL1A 4Y00A 4EHUA 2AYBA 3UMGA 5K8NA 4HTIA 4NCGA 4MK9A 4MT1A 3BR8A 4XO0A 3AXMA 2HHPA 2IVYA 1XIQA 4DOCA 2W01A 1BPEA 2FPMA 5D4PA 1T03A 2UXBJ 8ICEA 3L0QA 3WKEA 1JL1A 4DEZA 1FWPA 2WB1D 4IDKA 1QSYA 3FSXA 3RMDA 3R1LA 3DU5A 2JEGA 1O51A 2NXUA 4DL3A 1HI0P 3ZT1A 4AYBF 2ZVIA 3MCPA 3D67A 3WU2U 3D2QA 3JTPA 4M94A 2RU3A 4RG8A 4QZFA 3IV6A 3I5CA 2G1DA 2BKPA 1PK1B 2JLEA 2PY5A 1Y10A 3IRWP 5HQLA 1VSHA 1J2NA 3LGNA 4JI8J 1P27B 4I68A 2EC0A 3KK1A 1SZ2A 4DUZJ 2XMVA 2PI5A 3CWJA 1COKA 2ZIVA 1VLBA 3TOQA 1RTZA 1AYEA 5GAHP 3QU5A 1L7NA 3I5AA 2QXLA 1PJ5A 1CVJA 3P38A 2KYXA 4RBUA 1U0HA 3I5BA 2NLXA 3D66A 3IM9A 4QNLA 3JPQA 1UZDA 1XSPA 3DC2A 1RDAA 2KM8C 4USTA 3M8QA 3H7HB 2BPFA 3DOMA 3T5HA 1TK5A 2FPHX 5AQLA 1HEKA 1R8PA 2R3VA 1DOQA 3VQ5A 1TU0B 5DQGA 1PZNA 4C48A 3D6MB 2EI5A 3Q8YA 3SQGA 3HDSA 1LEOA 3H59A 3M05A 2BJ1A 3CJKB 5K8OA 4P2MA 1X7VA 1JROA 4JD2A 1ZD5A 2G8IA 3UXNA 1YQHA 5D77A 3EE9A 4P4MA 4N56A 1X4GA 4FO6A 5F9NA 4RQ2A 2LEAA 1Q9XA 1ZQAA 3TEGA 1WHYA 1PJ7A 4DLEA 1JWWA 2E6MA 1XMBA 3DRRA 4DQRA 4Y2XA 1IJJA 5E26A 4CJRA 4EEYA 3T1YK 2RAQA 2W24A 5AQZA 3CC7S 2OANA 3AU2A 4OO1J 4CO1A 1NSKL 1L8OA 9ICKA 2F4VF 2AYGA 3MUVP 3M1YA 1QZ5A 3LAKA 1TR0A 1WSFA 3QUBA 5EWFA 4X62J 3W5YA 1XMQF 2V2ZA 4BUGA 4FVUA 4ES1A 1CS4A 1YLXA 4DV0J 2NR0A 1ATSA 2O01C 1ZQWA 3FEXB 5HLFA 4GKJJ 5EX5A 4IEIA 2MSNA 1I3AA 5ALHA 3HCXA 2DPJA 2NXEA 2WF7A 1C20A 3CPEA 5KG4A 3OXFA 2Y1IA 2C3PA 3OVAA 1CLQA 2C28A 1HIYA 1GQEA 1Y0HA 1OO0B 1U2CA 1H2VZ 5H1SQ 3ZDAA 1RFQA 2QX0A 3HPHA 2G13A 5JXSA 2BBEA 4ATNA 5AI8A 4O5BA 3CMAN 2QL7B 4FLXA 2YHXA 5KAIU 2UU9F 1ZETA 5I42B 1LXNA 3M7DA 1RCOB 2BH1A 4P72A 4JK8A 1XR5A 3CD7A 5J2PA 5CP2A 1VQ6S 2DNNA 4O0IA 3HO1A 3MPWA 1GXLA 2EAMA 4R63A 5HVHA 3QMLA 2WRMA 1WG1A 3ZZYA 1G15A 3MGHA 2CUYA 2CNKB 2EWSA 5DRKA 1SAZA 3TYTA 3ZD9A 3NWRA 1RU2A 5C0YA 4TSXA 1DARA 4CZGA 5CE3A 3C6AA 5KFGA 1BLUA 3MMCA 4IWVA 1C0MA 4XQ8A 3GPAA 3VEVA 3T6BA 4WJBA 4LF7F 3AVHA 4ES2A 4LFAJ 2R7RA 3ZI4A 1CZ9A 4RQNA 3RFAA 2BCVA 2ZFHA 4QZ9A 3BGOP 1DGKN 5IWAK 1DFDA 3ZSYA 3IG5A 4MN4C 9ICEA 2JH3A 4NLVA 1HLWA 4IQMA 5E84A 2D0OA 3MDQA 2OMLA 2XHBA 3GONA 3DOLA 1IVZA 3P4UB 4CF8A 5LOQA 4V19X 1RABB 4D3GA 3MMAA 2ZH3A 1JKHB 2KT3A 2H5EA 3LTOA 2RRAA 2EAPA 4L74A 3FBBA 1UAXA 9ICWA 2NCKL 3IG1B 4HI2A 2M5YA 5B09A 5KFVA 3OFFA 1XJWB 3CMES 4AD6A 5KPTA 5KTQA 3L3FX 2C2KB 1SQFA 4O3RA 2OEHA 3O6QA 2QYGA 4QWCA 4OV6A 4AQYF 4B1XB 1DAXA 3C16A 5LMNJ 1VRTA 2CPHA 3OYAA 4F4KA 5ALFA 4X65K 4HH0A 2G08A 4HDGA 3VF2A 1HBNA 4W5RA 3HW8A 2W3SA 3FMBA 4M5HA 4NL9A 4FS1A 4KLFA 4K4XA 2RN2A 4ELVA 1HI8A 5FLXY 2D6FC 2CJKA 3NGIA 3LM9A 2GWKA 1VSDA 3IFRA 2BJ7A 1VK8A 2QA4S 2GELA 3CXCM 1SC3B 1ROFA 4O3MA 2X74A 4NCGB 3G8QA 3QEXA 5AKYA 2LI6A 2VPYB 3BBFA 1R3NA 5KFJA 4DR6J 1RTJB 3AOCA 5I42A 4ELUA 1S1WA 4LR9A 4J03A 2LXUA 5M1KA 2JVRA 5KG5A 2CPEA 4GNIA 2VODA 1YI2S 5BYRA 2ASJA 4ED6A 3VQTA 1RWXB 2KT5A 3ZT2A 4DTSA 2GHVC 3J7ZO 3RG6A 5HBMA 1NJIT 2QRRA 1A0PA 1S99A 1N62A 1PK1A 1R8HA 2HBRB 5GADU 4JI3F 1JRPA 2NQPA 4JKEA 2HKEA 2JC0A 1Q7YT 4AL5A 4CWBA 5ALOA 3R1XA 4E7KA 4QPTA 3KK1B 2OD6A 3BKUA 4CEOA 1TL5A 1TMMA 1ASVA 1LXJA 2MSTA 3NVWA 1K8KB 3TADA 4HL9A 1X5PA 2GJIA 4J9SA 2Z4PA 3KLIB 3G10A 3UO0A 3K89A 2DH7A 2CZ4A 5D0RA 2K7JA 1RTHB 2C2EA 2CA9A 3H8SA 2YY3A 2RQMA 3SDEB 3IAYA 2O4GA 3P5JA 3KD1E 1YZ7A 5HK4A 3B54A 2XSFA 4IYQA 3K5MA 1RBTA 4JV2A 4XPCA 3BEGB 3FRYA 1N0UA 3F5TA 4GVBB 1Q5VA 3AA5X 4V1Ak 4ZP7A 2Y1RI 3VQBA 5F8HA 1QAJA 2IOHA 5L1KA 4HTJA 4MJKA 3IXQA 1S8OA 2VQFK 3NGKA 1ASWA 4OLAA 4M3RA 3NE6A 4C0OC 2E1MC 2G4BA 1IH7A 3TI0A 3PJXA 2CDQA 1FNOA 1TE2A 1WEZA 1VBXA 1MMDA 2E5LJ 5CHCB 4RL1A 2BEFA 4JI4J 1PYOB 2B6AA 2F7VA 1KONA 4ID5A 3VZHA 1W97L 4QZBA 1ZBTA 1SH0A 4WXWA 1RWVB 2CQ3A 4ZVOB 4R65A 1QVGR 2KHOA 3F73A 3R9LA 3VGTA 4ZVSB 5KQDA 2OPQA 1XK8A 1A0OB 3RAQA 3EPGA 4CE9A 2GA7A 4YHHF 4K4YA 2HW3A 1K1QA 4YOXA 2JVOA 2IM2A 3SR6A 2OP5A 8ATCB 4CEBA 4KH1B 3JS6A 1LW0A 4USKA 4F4ZA 2CPFA 3BM7A 3AV9A 3QEWA 4NZ0A 4A2BA 1MU2B 3HOTA 1SKWA 4UATA 1X0PA 3G6EN 1HMVA 1FW6A 1QHAA 2GLEA 3MR3A 3M6WA 1X6IA 2F8EX 3FJ2A 3H45C 2NRVA 1FVQA 2HBLA 1ATRA 2KXNB 4MYTA 4V19J 4A4JA 3WKAA 1ZQSA 2YHBA 4DL0C 3OT9A 4K2JA 4OZ0A 1FE4A 4X65J 4BE1A 1X42A 4P0PB 3JPRA 2YWGA 2YX1A 1K8AO 2F63A 3I9ZA 4C11A 5LMNK 1J9AA 4KHYA 2DR7A 5AKJA 1KN6A 3MTKA 3CD6N 4JYAK 4KTQA 3EVOA 1R43A 3PO5A 3R8EA 4IOXA 3AODA 3THVA 4A8YA 5IINA 1K8KA 3CPWM 2RRDA 5HP4A 1QVGM 4RPFA 4F2SA 5KAKA 4E89A 3UN5A 3W61A 5DQHA 4Q45A 1N5YB 4PPXA 4B3OB 3O4WA 1VQLS 4JMUA 1X3MA 4CF5A 3TAEA 4CZEA 4OI3A 4JKAA 1WC3A 2P9IA 2IHNA 1Y5NB 1YX2A 2KD1A 2BOPA 1NJZA 1WOQA 3J7AP 1O08A 2VQFJ 3R5JB 2NNWA 3TTDA 3B0XA 2PDAA 4KH5A 3CJ8A 3R5GA 4LF2A 1P1TA 4OHVA 3J80Y 4M63C 4M42A 5F3XB 3VF4A 5J2GA 2P6TA 5E33A 4CEZA 3HXMA 5J1EB 1Q16B 1EAYC 3NY0A 3MM5A 2R4FA 4Y2TA 2ZG6A 3QT5A 5IC4B 3IS9B 3IKMA 1A77A 4A8QA 2J8AA 1OPZA 1RB0A 2W9AA 2RIJA 2EPIA 2HOIA 4LQ3A 2XMKA 1SZHA 1JJ2R 1EARA 4K4GA 1NGBA 2VFRA 1RA7A 4Z6FA 3FRZA 3KLFB 4M95A 2ZKUA 2JLGA 3AEVA 2VL1A 3ENBA 1MG7A 3S41A 5BOLA 2CH5A 3DHWC 4OZNA 3OYIA 4Y2UA 3D2SA 5DM7L 1I94K 2O8FB 3O9RA 4DU8A 1FIQA 1M90T 4DTUA 3D6RA 2XHCA 1SIJA 3FSYA 4KB1A 4ZJOA 2EBEA 4I2QA 4F02A 4Z6DA 2VA2A 3RR7A 2LYVA 3MECA 4RCHA 2YKOA 2EQYA 5FRNA 1S97A 4OKEA 3GMGA 1JMSA 5HBMB 2WF8A 2W9BA 3ZSZA 3I87A 1RT1B 3SLCA 1MWYA 3FK4A 4M5LA 4E19A 3CC2S 2KJ9A 2K1RB 3BSCA 5J2NA 5ELZA 1H2TZ 4RW6A 1JN3A 2HVIA 2P8IA 4JEPA 3FMWA 3HJVA 4KH6A 4ED4A 3QE9Y 1MC8A 2YKQA 1T3QA 1FFWB 3DNCA 2G8FA 3PMLA 2BGGA 2VDIA 4RUHA 3LWLA 1HWUA 3ITHB 4GRSA 2MZJA 1TUGB 2EH9A 1HL6A 2QKQA 3M2UB 4QIFA 4QZ8A 4YN4A 1R8AA 1E6YB 4NEYA 1ZJMA 4P0PA 3KLGA 3PHEA 4PZNA 4UZCA 3T1HJ 4ISFA 5KPZA 4GVEA 2GUPA 2OZMA 4YOYA 2HHTA 3QX7A 4KHPK 3V6JA 5EE0A 1Z4UA 1EKEA 4FJ8A 3ISND 2XMTA 3EX7B 1L3SA 4LFCK 4PG5A 1CJVA 4WF9L 5KRTA 2G9OA 4B3OA 5KPRA 2M3DA 4DV3K 1RTHA 4ETZA 4YDUC 2LQ9A 5GIPA 1BE4A 5ALSA 1VQ7N 5KAFU 3QYYA 3H4BA 2P9IB 3ASMA 3VQ4A 1DT9A 4PKIA 2QO3A 4CJFA 3C6TB 2CG4A 4A46A 1QZ6A 3A5NC 3MR2A 1UWAA 3T79A 4UBBA 3RSEB 1QVFR 5CZ2A 4FWPA 4F5NA 5AKXA 3M6UA 3CJ7A 2ZIWB 5I3PA 2E88A 4Z4IA 3HP9A 1VYAA 4Y3CA 3O4QA 1FERA 4N77A 4WZMA 1BD6A 5KFCA 3DOKB 2O8EB 1XS9D 5J1EA 1J27A 4C8NA 2IFXA 3ZT4A 1F0XA 1RAOA 3M9NB 4N8OA 4R66A 4HHJA 2NLWA 4F93B 4I0WA 5CZXA 4ZLLA 4OL8A 5DG8A 2QLBB 2PFDA 3AQFA 5D4BA 1B9FA 2OWOA 3AO3A 4KHPF 4DJBA 1KDNA 1VS3A 5E7OB 2CQHA 3I8DA 1HWKA 4DG1A 3JPTA 3BGRB 4NXMK 2A42A 4PUOA 4F4XA 4O5EA 4IQTA 1S1TB 2BRKA 4X66J 3EGWB 2DY9A 1NSQA 2CPYA 3HRDD 4L8RB 5J0OA 4MKVA 4O23A 3SSRA 3HFVA 4KR0B 1FWKA 1N6QA 2A19A 1NZAA 4A8OA 3MM9A 4AXIA 2Q3PA 4JI4K 2I9SA 4BACA 3HJFA 1TZ0A 3NAHA 1UFKA 4JI5K 4C11B 3G6ES 3JS9A 3CP8A 2X78A 4WF9Q 1HARA 3H0RB 1UCNA 1O8BA 3GFZA 4B1ZA 1TMJA 3KDOA 2O6KA 1OJ4A 2RVJA 3BKFA 2WSFC 2R7VA 1ZQYA 1Y4ZB 2CFXA 2XGQA 4CGJA 4NWIA 4QBUA 4B17A 1MWKA 1OY6A 4M3UA 4XAKA 2G0CA 2N1RA 2QB0A 2HHXA 3RBDA 4DOZA 2KM8B 4JI6F 1RCXB 1HYVA 3QYPA 3P3DA 3RJGA 3QICA 4PAAA 2DO0A 3CCZA 8ICJA 5KFDA 3IG8A 2OCEA 3VQAA 2F8TA 5HATA 1KVIA 1QQOA 1QUVA 2BUPA 2EZXA 1ZQRA 4OGCA 4ZPCA 3POTA 4M47A 1HBMA 5C2CA 1XNQK 2E20A 2R8IA 1IBMK 2YNHB 3GLJA 5M2UA 4Z0UA 2MZRA 4FJ7A 4JI8K 5HMLA 4IR9A 2D69A 1YRXA 4IUFA 5IV4A 2M2BA 2RF2B 2PBDA 2KVCA 2DGQA 4DR2K 2KKVA 7ICSA 4WU2A 3A8YA 2CJYB 4M5IA 3BYRA 1AT1B 3AA9A 1AZSB 4R5PA 3DFEA 2IDEA 2G5IB 4NCBA 4EO8A 1N32J 2VCPA 5J8YC 1BQMA 3US5A 1JMTA 3BGFA 4CF9A 3KLHA 1U4BA 5BRFA 2KJ5A 2ZZMA 3H25A 4ECWA 2NPFA 4GV6A 2XYGB 4MLEA 4UB3A 2ZD1B 5AI4A 4RW9B 3UD4P 4F71A 1U8WA 3QEPA 5SUHA 4BRGA 1B0XA 3GJSB 1B99A 3H5XA 2FVSA 2FJEB 5AQKA 4OHZA 2NYIA 4DUTA 4UUXA 4CFCA 4D3HA 2NO5A 1TL3A 3RB6A 1KL9A 1DXSA 1QQNA 2BE9B 1RBRA 3QB0A 3OR2B 3EW9A 3BF3A 4JYAF 5D49A 1Q86T 2KMDA 4G3IA 8ICWA 5KG0A 4Q8EA 3F2BA 4DTNA 5D6GA 2MB0B 3T1YJ 1SV5A 1TL7B 2ZEJA 4DSLA 2YX6A 1CJUA 4HAIA 1NKBA 4B3RJ 3DAWA 3VOVA 1NBWA 3EYZA 1QLNA 2YB1A 3FLCO 4CF0A 2BM1A 4AHTA 1QE1A 1NBEB 2D3ZA 4A5AA 3FM9A 2GMLA 3KJVA 1B4SA 1WKLA 2I2YA 1ITPA 3TUJC 3M2UA 4BWJA 2GNKA 2XHWA 3OQ2A 3HJEA 5CZ1A 1GTHA 4TYAA 4XH4A 2QI2A 2CQGA 1K0TA 1LWCB 2LMIA 3E01B 4WKRA 2O5DA 4FS2A 2OPPA 3VN5A 2W9MA 3ZCMA 2FPLA 4KLIA 2OD4A 4EBEA 2VQFF 3CCMN 1KCFA 4M3YA 4GVBA 2F8HA 3OHBA 8ICGA 3IDHA 4JRPA 4R79A 1IG8A 4FP9A 1Q81O 2I7PA 2QWNA 1RDRA 2RQ4A 4H8KA 3PEJA 3SUNA 2DEIA 2VZ9A 4ES3A 1C1BA 4AFFA 1WC6A 2PEBA 3MMJA 3W2VB 2Q97A 1WWUA 5K20B 2KHCA 1S4EA 3MMAB 9ICTA 3SMPA 5IXUA 1KVBA 2MSSA 4FYVB 1IG6A 1SQKA 3T7ZA 3OBYA 4FPRA 2UYTA 1D4XA 3WUHA 1FRKA 4DQIA 2A3ZA 1WJ9A 4RQMA 4Y2JA 3LAMA 2A5XA 3CCUN 5BOMA 5DM6Q 3KD3A 2QWLA 2ZC4A 2RDIA 3IMQJ 4USMA 2O8EA 2BCUA 2FGCA 3EO3A 1D8ZA 4MKAA 3M9OB 1TL1B 1EETB 2WAQC 5ALWA 1MWMA 1RHRB 2YQ3A 1ZQZA 5HVFA 2XTJP 2H3FA 1SV0A 1UJ6A 1XI1A 1B0PA 2XZTB 4ZHRA 1VJ5A 3OD2A 3GR0A 3AAQA 8ICZA 2F9DA 2QL5B 2Y0BB 2P35A 2RS2A 3AY0A 2UXCJ 3BO2A 2H1YA 4USVA 2EWHA 1ZS6A 4CE6A 2LYBA 3GIMA 1QSLA 4LMZA 2F9JA 3QATA 3QJPA 1LKYA 2VG7B 3AVNA 2YN4A 4OYIA 3LDOA 2P9KA 2QWPA 5DLFA 3Q2SC 1OY9A 2F4VJ 3K59A 5M1NA 5CWRA 3JSYA 1S6QB 4X4UA 1FRMA 4KFBB 3NVMA 2DNKA 1NHVA 4A59A 3SENA 3D3CJ 4P73A 4LFBF 2HFZA 3LDLA 4AXJA 4QZEA 3CFOA 4KHQA 2RHSB 3PV8A 4N47A 1F1BB 2E1YA 4L6V3 2OPPB 1DRZA 4J9KA 3GFHA 4IC9A 2LU1A 4ZCIA 5I3UA 2C22A 2QLWA 3MUTP 3E58A 1BY9A 5KOXA 2KKZA 3SSQA 1ELOA 1R8BA 2IOFA 2AXTU 5KNIA 1KBUA 3RBXA 1HKCA 3H8YA 3W5XA 5C12A 1BPBA 4PEOA 1QS4A 3VESA 2HF4A 1VJWA 3SDEA 1QQ7A 3V7JA 4ZKAA 2ZH5A 4CF4A 1FJGK 4AF1A 4KY3A 5HAOA 4KTWA 4DFKA 1RT6A 2C3UA 1A6SA 5EU7A 4NI2B 2PMWA 2RQ5A 1PKUA 4O5FA 1ZQNA 1PVQA 3BGLA 2IJRA 1KFDA 3H5SA 3UWTA 5GTIU 2EFOA 5FPEA 1LW2A 2GIQA 2BANB 4DL7A 2YH1A 2B9WA 3OXLA 2B5JB 3EKSA 4OJ6A 3DXSX 1EO1A 3WK8A 3C66A 5CB1A 1HNVA 3G8SA 3CD0A 4YR2A 1RAJA 1Q7YO 4CYUB 2QFIA 4HDHA 1Y3KA 4WIIA 4IRKA 2ALYB 1W2BR 4FK4A 3EZWA 1MU2A 2KRRA 3SBMA 3AO2A 2FSJA 3SQ4A 1X9WA 3PW7A 3CDUA 4BE0A 4DV4F 3VHQA 1Q1KA 4KLHA 3E9OA 4CZKA 4E8UA 3TO8A 4URGA 3LDNA 4C8YA 3QUQA 1Y5LB 5J0SA 1B0TA 4YB5A 4RQ1A 3K8VA 1Z1BA 4H4MA 4CJQA 3FEYB 1FXDA 2WFBA 1NCLA 3QSYB 5GAHU 2DK2A 3UN3A 1CJUB 4FE3A 3R6LB 2ZJRL 1TL1A 4A5BA 3ZX3A 4TURA 5J0RA 1EETA 4ICLA 2FJ6A 5HL7L 4IRCA 2O8CB 4JHDB 3VETA 2HFUA 4GKKJ 1FRXA 2YNIA 3HVRA 3PSPA 2GIRA 3S01A 2M52A 3ZETB 1BL3A 4PY5A 1RXWA 1RQNA 1N5TA 3P45B 2HFSA 2R7SA 3NG8A 5ALYA 4YFKA 2VH7A 5F1XA 1SS6A 1TAQA 3ENHA 4WK1A 1W2IA 1DBDA 4LF9F 3OTCA 3HVWA 7ICLA 3PXGa 5LJWA 5T41A 2D3DA 4K0KJ 3CO9A 5D4LA 4J9LA 5JVGQ 1B7YB 1PSDA 1C1BB 8ICUA 1YJUA 4CO4A 1QTMA 8ICQA 2FHKA 3C6UB 4RBTA 1F3VA 3M1VB 2E1CA 1N32K 2UVVA 4CECA 1BG3A 5A6PA 4LRDA 2IIHA 2E44A 4IFYA 2JX2A 1NEEA 3T5KA 3KBBA 2W7AA 3OTQA 4C4SA 3D0IE 4YG2A 1VQMS 2HIYA 4RW8B 3EXYA 1IQZA 3IGVA 2DVIA 5DK5A 2AW0A 3CI5A 1VISA 4URQU 3KHHA 1N32F 3PSFA 3OGUA 3NS7B 3P31A 5ADZA 1DTTB 3DRPA 1JCGA 3NCIA 2VPXB 1HNXK 5AQMA 2BR0A 2RMLA 5GMKa 1UT5A 2RQCA 4ZMMA 1RAHB 3V9ZA 8ICMA 5G0RA 1FFGB 3IS9A 1K0VA 3CNHA 4KGMA 1Y5IB 2ZXHA 3GV8B 3S1TA 4I2QB 2D9OA 1KHWA 2Z2MA 1IKVA 2JNJA 3G86A 1HR0F 1SQGA 1SVDA 4DTMA 1DTQB 3GV7B 4H4MB 4CGDA 4GC7A 3QWPA 3DEEA 1XC9A 3OYMA 2JC1A 2VUGA 2OA8A 1XTZA 4ZVGA 3TW0A 4ED3A 1S1XB 4XTTA 4ZPWR 1UEVA 4KSEB 4CFAA 5E3QA 4FJ5A 1T11A 5J2PB 5ALMA 3VA0A 5DJBA 2R8HA 4I2AA 3OTOJ 2A1BA 2HEKA 1IBLJ 4IG0B 4AE5A 1GLLO 4CD3A 1S6PA 1WNSA 2ASLA 3QZ8A 1V4TA 3W2WA 3QBWA 4QS8A 2V69A 1IO2A 2AHOB 5ALPA 3T5JA 3A0IX 3THXA 1N48A 3L2WA 4BVOA 3HVTA 2MDAA 5H9FK 7ICTA 3VGLA 1M1HA 4PG8A 4F3QA 2HSZA 5KFBA 5AQYA 1AFJA 1VQ8N 4WBFA 4P7VA 4QZAA 3NOGA 2B7CB 4JI7F 3R97A 3AO5A 3CFRA 3VEOA 3ET6B 2F1IA 4ECSA 3LA0A 9ATCB 2YNIB 4I69A 3IDWA 4UB6U 1VSIA 5K14B 2W04A 2E2NA 1T3OA 3C14A 2GMHA 1KDHA 1IV8A 3ISBA 4KLSA 3HSGA 4CGFA 3ICXA 1XNRF 1RACB 2IVMA 4DR2J 2WTUA 2HFVA 4BQZA 5K5MA 4KV8A 3AGRA 4KE5A 1MWQA 1JKHA 1Z1ZA 1RDUA 4BGAA 1PJ6A 1NH7A 3C19A 4CO3A 4NLXA 3SIPB 2QKKA 4UB5A 5AICA 4ZITA 2FXUA 1HBMB 8ICAA 2XI2A 2PI4A 1KW4A 2ZIWA 3OYEA 2C2NA 3AO4A 5CR4A 2YMMA 4P0QA 3CCQS 2CH6A 4KREA 5LMUF 3QRQA 1BMQB 4K5RA 3NH1A 3AAWB 3TUIC 3TJAA 2E5SA 3IFEA 4DPXA 2VQEK 2QM1A 4RO0A 3JB9k 2M88A 5G0RB 1FKOB 3R5BA 4B3TF 1RQLA 2MMYA 3VZIA 3LWMA 3UD3P 3VF0B 2DRAA 3CCEN 4C9DA 4DF4A 1KC8O 1TK0A 2CVEA 1UVJA 2XB2D 1V4SA 3FCHA 4P52A 2MY7A 2FPKA 2Q79A 6FD1A 4KGXB 3FAHA 3O9UA 4WCEQ 3NXZA 1HPMA 4DL4A 3CJ5A 4NLWA 4PWDB 4KI6A 1N2XA 4TQSA 4ILGB 3C2LA 4PHPA 4K7QA 5DM6L 4NA1A 2HOFA 3PYGA 1FD2A 1YKWA 4LSNA 1KD1O 2W40A 4X64K 4PZVA 4IG0A 3M8YA 3HD2A 4DV1K 3SMVA 2ZNZA 1R0AB 3ZZTA 4DSKA 1TUVA 5GADP 2DH8A 2RILA 1FRJA 3TSUA 3QFUA 1PGZA 2M4MA 1ZQDA 3OPXA 4CEEA 3H7IA 4CEAA 2IVPA 4ECUA 3TAMB 2WAQF 5B08A 5ALNA 1Q8LA 3LP3A 2RSQA 3KOAA 2HQGA 1HLUA 5KFYA 3E0FA 4X4VA 4LF5J 4M41A 1WCNA 2YKAA 3KLIA 3MEEA 2GHPA 3N4QA 4RW7A 2G07A 4B9UA 4M3ZA 1K5OA 2CJXB 2ZWPA 4KC5A 5J2MA 1J6ZA 2VFTA 2DPNA 4ALZA 3ENAA 7ICVA 3HVTB 4KH4A 1U1PA 3NNAA 4RBVA 2F9TA 1QY7A 2C3YA 2ZZTA 3IMXA 1G99A 2CPIA 1HBOA 4F26A 1NGHA 1RWWB 3UN2A 3AVGA 1S59A 3WIUA 2WOMA 2Y8YA 2J6SA 4U9RA 2RT3A 2GWJA 3IGNA 1BIUA 4CJTA 3RRGA 2X1FA 2NSCA 5ADXH 2GVDB 2EHGA 1KAZA 2ZBRA 3C14B 1YT3A 2P9NB 3ENQA 1DTTA 2BYCA 3DRPB 4ZDNA 2ZE2A 3CCTA 2KG0A 4ILMA 3M1VA 2Z1HA 3KZXA 5IQ6A 1ZQXA 1X6JA 1YI2N 4RQ0A 2VD3A 3K0SA 4G6VB 2NV3A 1RAFB 5E3CA 3H0PA 4QS9A 3HSZA 2B4UA 3UD5A 2EK6A 2R7TA 7ICUA 1C4CA 4H0PA 2ZH1A 3Q24A 2LKYA 3MWBA 5KT7A 1MWZA 1EB0A 5I4MA 2OTJN 4UOCA 2ES6A 5M2PA 2RE1A 2Z7JA 4OX6A 5CAAA 1YAGA 5IS2A 2A1AA 4LF8J 4BRAA 1JLCB 2PN6A 4X2BA 2P9LB 4FJNA 2HQDA 2CXYA 4C6AA 4MFBB 3UMCA 2ADBA 4IS7A 4HI1A 2Q0RA 1RBAA 4BR0A 4ZIWA 5KFMA 5AXLA 2Q43A 5E79U 1HHQA 3UDLA 3UW1A 3V6DB 4CEDA 3DYAA 1KAYA 2MAXA 4BRDA 5TKWA 4EX6A 3TSQA 1V38A 4XA5A 2DGTA 4RTFD 3ZZPA 3VWSA 5AZJB 1ZBLA 2QARB 1OQ6A 3FDSA 4LT6A 4FWQA 4AHSA 1T3NA 5A8WA 5KL1B 1BU6O 4JRQA 2A0FB 1LAWA 3M30B 4BX9C 1QQCA 3SYZA 3NCQA 4WYBA 4OLBA 4DR1K 2IVNA 1WELA 4I7FB 3KIOA 2M7SA 3HP6A 1KHVA 3J7YI 2M0GB 2MKKA 3MF5A 3NTUA 2K8GA 2IA0A 1WC0A 1R7IA 3AVAA 3U6FA 1SQEA 8ICFA 3MM8A 4Z37A 1Q4RA 4H5VA 4J2BA 4UAVA 5K14A 3H5YA 4USHA 4IR1A 3K4GA 4M04A 3VVTA 2W2OP 4LF8F 4CJPA 2VC0A 4AHCA 2XQCA 2DFEA 4DV7J 4BJQA 3TABA 1L7PA 2JMGA 4LJXA 3D6JA 3OR1A 3IRXA 2E29A 1WSIA 2P6SA 4LF6F 4NX9A 3MCMA 3N79A 3THTA 3CF5Q 2SXLA 5JS1A 1RAGB 4MK7A 4ER8A 2QT7A 8ICBA 2GVZA 1FFVA 1MQ2A 3RH6A 1PIEA 3ET6A 4RWWA 4UOGA 2ZH7A 1QE1B 3M9MB 2I8EA 2IDLA 2ROGA 3KJVB 3CC4S 5KFZA 4U7UK 4BE2A 4UW2A 3MEEB 3AOAA 1VCTA 2IM1A 5HROA 4PZOA 1KLMB 3BV8A 1Q81T 1BA1A 1Q3UA 3PJWA 4KRWA 4C4TA 4DTPA 3U1NA 3MEGB 3IA0A 1TELA 2IPOB 3IO1A 5LY3A 2XZWA 1FKOA 4NYOA 2DFLA 2PMZD 5IT9O 3M6ZA 4DB3A 1U45A 2VIXA 1Y11A 5EE3A 5E2QA 3Q7BA 5AM5A 4TKTA 2C2OB 3I0SA 3ATVA 1LOUA 1JLQA 1NDLA 4ECQA 4ZVEA 1J5OB 2YKNB 2RNEA 4GIBA 2UXDK 3DLHA 4Q8FA 2P9NA 9ICFA 3IUCA 3SFUA 5AI0A 3DXBA 4Z6CA 5D3GA 4YUDA 3RAMA 2EFGA 3VGUA 4CTAA 2QA4G 1Q3VA 3UNYA 3MK6A 3O9QA 3OSPA 2QKBA 2IDOA 4NYPA 4XH5A 3UXOA 4FXDA 4B1WB 2FF6A 2C2RA 3M8RA 1V3RA 4DL6A 5AM4A 2CPJA 1R0AA 5CCLA 1C0FA 5D4NA 2KSOA 5EY4A 2G06A 9RUBA 3QO9A 4U67L 2MTLA 4Y2IA 2QLXA 2YNGB 5H9EK 3BDEA 1H0HB 1MQ3A 1T44A 4BY9C 2K60A 1FXRA 3MR7A 2LCWA 5LT5A 3UKUA 4FM1A 4DFJA 5HLFB 4EFAC 2DISA 3GR1A 4FL9A 3PFEA 1X4AA 3FVYA 1U48A 3R27A 3DMJB 1K1SA 3D1HA 2WW4A 1VSJA 1SKSA 5T7BA 3NVVA 2DPIA 4B3RK 2KKPA 5J2JA 1VK0A 1MROB 1HJPA 3HHLC 2CNLB 4OCZA 3NF9A 3EM1A 1L3VA 1IBKK 4I64A 4QR2A 4YB7A 1G7CB 4QJFB 5GAGU 2F3NA 3O1BA 1PBUA 1XEZA 2FC8A 3N0VA 2FTRA 2V9KA 3DLJA 1NPRA 1W26A 2HNDA 2QWQA 3G71N 2EXUA 3EVMA 5AKLA 4CO5A 4DV5J 2ZJQQ 3KK2A 3QT6A 1FRHA 2E1FA 4NXMJ 2DCUB 4DCHA 2FHJD 2KVQE 4OYPA 4B9NA 5HROB 4OIXA 3A5MC 2ZTDA 3ZZRA 1KLMA 2Q36A 2WVFA 2RRBA 2KOBA 3DDKA 2AP6A 3OVSA 5AKGA 3F5AA 5HN0A 1NHUA 3ZNUA 1X4EA 1B92A 2W9CB 8ICVA 4E3SA 4R8UA 1F5SA 4DLGA 3PM9A 3AB2B 1IBLK 4Z4FA 2Z0GA 3CJ4A 3KHYA 4QIWD 5IIKA 2DNRA 2LPEA 4CRJA 2MLZA 2E5JA 4LH5A 2DBYA 2F65A 5DB9A 3AD9C 1OH5A 4YQWA 4MF8A 3H08A 4FF1A 3ILOA 2XEXA 3DHXA 2HHHK 2FMSA 2HWIA 3QJJA 3B6OA 3MCSA 4E1NA 3EN9A 5AE2A 3RMBA 2GAHC 3GG1A 2KB2A 2DGSA 3L3UA 4KLQA 3H46O 1LWXA 3QIDA 4TY8B 4YOVA 3IRUA 3KJQB 4RQ3A 1ZQKA 3RUBL 1WHVA 1J53A 2WCXA 2ZUBA 1IKYA 1NLVA 1RT3A 5A8RA 4CO0A 1LVHA 1HBNB 1HJRA 3OL9A 3JPPA 2CQCA 4G1QA 1ILYA 5F8MA 2IRYA 3D68A 3KG0A 4OV1A 4FWRA 1ZQTA 1SI9A 1U47A 1L3UA 3OW2M 1P8GA 1OSCA 2BW2A 3DYAB 2O67A 4WE1A 4HCBA 4M5MA 3U4LA 3M8ZA 2BE2B 4QIEA 4JI8F 1ZA1B 2DR8A 3EGVA 3TVZA 2QV6A 2ZM6K 4YOUA 1YIJS 2EKYA 5KG1A 2LYAA 4C4WA 4PKDB 2W1BA 3QGPA 1D9FA 1X40A 3EZUA 1RA6A 3VQPA 3M3ZA 5LJVA 4JI1J 3M2RA 1KRPA 3VQ8A 2QSWA 4KAZA 4B1YB 2V4QA 1YUWA 4MDAA 3TWZA 2ZC3A 3C29A 4GV3A 4N7TA 3EGZA 1KVJA 3TAQA 1NH8A 3THWB 3DKDA 5CZVA 5LJ3Y 3A5LC 1SCJB 1M6YA 5EE9A 4TQRA 2AZ3A 3QNMA 2OO4A 2GX9A 2CQ2A 4CIOA 4O55A 3N5BA 2C1EB 4WPAA 3CFPA 4PKGA 4OX9J 1GLFO 1W7AA 2D3O1 2AQ0A 4A8WA 4GMJB 3BKTA 3KNGA 1S0MA 4M5GA 4DTJA 3HLUA 2FBTA 2HSTA 3BQTA 4CHNA 2MQOA 4MKBA 2FE9A 3CDEA 3DU6A 2E8MA 1QHTA 3BF4A 2YWEA 3P8BB 2DD8S 3I0SB 4HVJA 3ZDDA 3ISDA 2ZH6A 3C3LA 4FWLA 2AKWB 3R7SB 3I9V9 2POKA 1YBTA 5AK6A 2XG8A 4WKYA 4RT2A 4DV1J 4PXCA 1HNWJ 1F2GA 1JXEA 3QFPA 1U1KA 3TRGA 5AK4A 1CC8A 3L3VA 1N36F 1Q7LB 2FJBB 1FTCA 2DGZA 7ICPA 4QZGA 3JPNA 4C97A 3KZIU 2MKCA 4NXNJ 2JGAA 3Q2TC 2LECA 1JI7A 2HG4A 2E5IA 3NWGA 3B82A 4EP5A 4TXSA 1N63A 1REVB 3GDXA 1L8LA 1NNLA 1F44A 3RW7A 3K9JA 1SPBP 5LSLA 2LA6A 2GUIA 9ICOA 1PK3A 3BO3A 1NGFA 2NO4A 2DQNB 5HR6A 4FM2A 1LNQA 4DV2K 4DR3J 1GOAA 1HYSA 3ULDA 4TUPA 3A12A 1RU1A 3C65A 3KG4A 3VENA 4AL7A 4X4NA