1NKBA

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after three rounds of primer extension, following incorporation of dctp, dgtp, and dttp.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkbA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkbA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkbA01
3NH0A 5IIMA 1X9WA 2VWKA 2QKBA 3LPUA 1R0AA 3C23A 4XA5A 4YXJA 4CHYA 2I1QA 4TSXA 2KN7A 2HMIA 1JLAA 4I29A 3Q8SB 3AO5A 1TVAA 4I2GA 3EPGA 3H8JA 2EHGA 1S9FA 3P83D 5J0RA 3C6TA 4CCHA 1RXVA 3TFRA 4MFFA 1CXUA 4EBDA 2P66A 5L1LA 3V9XA 4RQ6A 4QZBA 5DLFA 1KSPA 1DGSA 3KLIA 4O3QA 4K4IA 5J0PA 2ZJAA 3SV3A 1L5UA 3PY8A 5L1KA 7ICKA 9ICNA 3V9UA 4M3TA 3OSNA 4JRQA 1REVA 3RB4A 5EWGA 4CEEA 1BHLA 2G8HA 1A5WA 4KLTA 7ICNA 3L2QA 3DLHA 2KZ3A 2C2EA 3L2RA 5CWRA 1D8LA 3QIPA 1UOCA 1N5YA 9ICPA 3I0RA 5DGAA 1HNVA 2E6LA 4FS1A 4CJ4A 2ZTCA 4I2FA 1RTIA 4RT2A 5KT4A 2F8SA 3K75D 4MFAA 2OZSA 4FO6A 4DOBA 4DTMA 3O3GA 3TAMA 3DRSA 2DFLA 4Y1CA 3RH6A 4ID5A 4CEOA 1VRTA 4ED1A 3H4DA 4BDPA 4AHRA 3D45A 5KFOA 2KQ2A 4B9VA 1S1VA 4CJSA 3TR8A 2IHMA 4QCLA 1ZQFA 1A5VA 1Q8IA 3LAKA 2RPIA 1SL2A 1HJRA 4OKJA 3S3OA 5J0SA 9ICUA 3KD1E 1KRPA 4Z6DA 1VRUA 4QWDA 4Q45A 5IIIA 5KFTA 1ZYQA 4DWIA 1NKEA 1BISA 3SV4A 3FYHA 5J2AA 4O5EA 3TAPA 1ZQNA 5KFGA 3OHAA 8ICWA 2KTQA 1BPBA 4N41A 3FFIA 2BKEA 4KPYA 4I2AA 3SJJA 4BACA 3EZ5A 2Y1JA 4RW4A 5IILA 2AU0A 1RYSA 1TKXA 1Y88A 3UQ2A 5KFYA 4O3RA 4WE1A 1LAWA 1UA1A 3K57A 4Z6FA 3GIJA 1VK0A 2OPSA 2BPCA 2P51A 4J9OA 5KT2A 5DBAA 3NHGA 3AVBA 1S0VA 4I2BA 4NY8A 4I2CA 4I2EA 3ZSVA 1RDAA 1NJXA 3TWHA 3KK3A 3U3YA 5KTQA 1CXQA 2D0CA 4RQ2A 4LD0A 3WNGA 2ETJA 2BCVA 1TV6A 4E3SA 2Q3SA 5DG8A 2PFPA 4CGGA 4DL5A 5T7BA 1ZBIA 4F91B 4F4YA 4JUZA 3OYNA 3C5GA 3QEBZ 1C0MA 3B6OA 2IBKA 4B8CA 4FJ8A 1ZQKA 3BGRA 1RBVA 4P4MA 1ZQMA 1Z25A 4EBEA 1HUOA 3S3MA 1ZQYA 3BJYA 1UWBA 1W0HA 3TQ1A 5KFRA 3ETLA 5KFBA 1U45A 1ZQLA 1ZQPA 4NM1A 4KLLA 3RJHA 2BPGA 4LZGA 3TANA 1HRHA 1QQCA 1A5XA 3HPOA 5CHGA 3V1RA 1BPYA 4J9LA 3S3NA 2J6TA 3JPQA 3PW2A 3HPHA 3V6DA 3LK9A 1JN3A 1S0OA 2XCAA 1MU2A 3OGUA 4Q43A 2OPPA 3UXOA 2D5RA 4B8AB 2X78A 4KLUA 2ZUCA 2F96A 3RBEA 1VSIA 4Z4HA 1JL2A 2W9CA 4B9TA 5J2JA 3QIOA 1KFDA 5DBCA 3SPYA 4M2YA 2ZE2A 3AO1A 4Q8FA 1IO2A 2R8GA 4KO0A 4IG3A 3MR6A 4CK1A 3KKRA 3M8PA 3ZSQA 3V7KA 3OYJA 4BDYA 4RNOA 2G8KA 5HRNA 1HQUA 3UIQA 4AHUA 4FJLA 3JPOA 4ED7A 4GW6A 3Q8QB 5HHHA 4W5OA 3ZT2A 4KHUA 1JLFA 1CZBA 3O4QA 2BANA 4DSFA 2D0AA 1TKDA 3ALYA 3DLBA 5KG4A 2LYHA 4FK2A 5J0OA 4F4XA 3AVGA 4FVMA 3AVHA 1LWCA 2FBTA 3VQ5A 4CEZA 4M3XA 3KLFA 3QEXA 4ED2A 4JLHA 3V4IA 2DFFA 4W5QA 1XWLA 2A1RA 4RQ5A 2I9GA 4IDKA 3SQ4A 3PR4A 1LW2A 1RTHA 4MQ3A 5CP2A 1EETA 1RNHA 2HNYA 3T1AA 2ATLA 4CJ5A 1RCHA 4EYIB 1KVBA 1S1TA 2UVVA 3OSPA 1VSEA 3AA4A 4JS4A 1YVUA 3MFHA 1COOA 3K5LA 2P6UA 4R5PA 2BCRA 3KKSA 2FPLA 4HUEA 4BGDA 1LB2B 4NM2A 4QZHA 1ZQIA 4KI4A 9ICOA 4O44A 3V9ZA 4JWMA 4I27A 4CGFA 2XO7A 1HPZA 4OKKA 3QERA 3ZSZA 1J5OA 1RT1A 4XUSA 2RDIA 3LP2A 3AVIA 2V9WA 2E4LA 3V72A 3PX6A 5KFQA 3PW4A 1XU4A 4OJRA 1RT2A 4HVJA 1MSWD 3HP9A 4F93B 3H7IA 4O3PA 3DLEA 1X9MA 2R8HA 1GOAA 1L3UA 1TVRA 4QWEA 1RXWA 3ZDCA 2O4GA 2ZJ8A 3DM2A 5J2FA 1SL1A 4UB2A 5FDLA 2PFOA 4FJGA 3TAQA 1JLQA 2OPQA 1VSJA 1RBSA 3T19A 3NH2A 4CJVA 2M9NA 3G10A 4B08A 2BHNA 4ED3A 3VQPA 2DPIA 4GMJB 4RW7A 3GIIA 4DTSA 4J9SA 1C1BA 4R66A 5KG0A 5KFSA 4YFUA 2NRTA 2ASDA 4I2IA 1RTJA 2I5JA 3T5HA 4M3UA 1TKTA 2VA8A 4E7JA 9ICLA 1F21A 4IQTA 3AVAA 1KDHA 2BDPA 4E1MA 5DGBA 5KRSA 4CJEA 3AUOA 5J0QA 3L2UA 3NF6A 4DS5A 4KLEA 1KLMA 8ICHA 4CK2A 4NLZA 3H8SA 3KLEA 2R8JA 3RH5A 4M9HA 4LH4A 2HVHA 5KT3A 2WTFA 2B6AA 4PHPA 4FBTA 5D49A 3TFSA 2JEGA 4M9GA 4XIUA 1YTUA 4DSKA 4YR2A 4LSLA 1KCFA 3I0SA 3AVNA 1J54A 4UAWA 1ZQWA 2DFEA 4RW8A 2VG5A 3PMNA 3THVA 3DRPA 1QSLA 3VQ8A 2FLLA 4ECSA 4LSNA 3HWTA 3ZDAA 2IOCA 5CYMA 4ICLA 1VSKA 4CHOA 5J2DA 3LP0A 4UQGA 4DFKA 2AGPA 3H08A 4R8UB 4RNMA 1TAQA 1WAFA 4KLOA 3AVMA 1U04A 2E6MA 2JLEA 4ECWA 4TURA 2XRIA 8ICKA 4KAZA 3OYCA 2B21A 1EP4A 1RBRA 5KFDA 3C2KA 1IKXA 2O4IA 3DI6A 4KLFA 3VA0A 3NGDA 5KFWA 4KKOA 4O9MA 2W9AA 3SQ2A 3C1ZA 1ZQTA 3HP6A 4DL2A 8ICSA 1TL3A 4CF9A 5C42A 1K1SA 2FBXA 5CYQA 2KFZA 4GXKA 1NKCA 4IKFA 4J9PA 1BPZA 3PMLA 4P4PA 3BDPA 4CJQA 4DL4A 1DLOA 5KFHA 2YNHA 3ZT4A 4DQIA 3ISCA 3MEEA 3WNHA 3AVLA 5KG7A 8ICYA 1WAJA 1IH7A 1B9FA 4CFDA 3OYMA 4F3OA 1C1CA 1QSYA 3P5JA 3K5OA 3C5FA 3VQEA 2IHNA 3IAYA 4J9NA 4DU1A 3AO2A 5J2QA 4P4OA 5EU7A 4JV1A 4O4GA 1NK8A 4UBCA 1HMVA 1ZBLA 1Y97A 1TK0A 1HUZA 4EBCA 4FLTA 3ZCMA 1VSHA 3RMCA 1X1PA 3MR2A 1KLNA 5KT6A 3SI6A 3RRGA 1DOQA 2ZD1A 3LDSA 4E7LA 2OZMA 2BGGA 4N76A 1CUKA 1TL1A 2HB5A 1FK9A 5HP4A 3K58A 1UAXA 4CHQA 3SUNA 1BQMA 2LSNA 5HRSA 2FPKA 2VA2A 4KN7A 1K6YA 3VQ4A 1KEJA 4DLGA 4ELVA 4EZ9A 4F5OA 3V81A 4QZ9A 3SNNA 5J2NA 4BWMA 3JPTA 4CFCA 1IKVA 2NRWA 4ECVA 4MEXA 1BVSA 1ASWA 7ICTA 3DOKA 4IQVA 4AHTA 2AGOA 4DU4A 4TUSA 9ICEA 4QW9A 4F5RA 2PYLA 4CJTA 4N5SA 2X74A 1IKYA 5KFZA 3V6HA 1WN7A 1XSLA 4CE9A 4M42A 1ZQJA 4FZZA 4RQ7A 8ICRA 4DOAA 4YR0A 4DL6A 9ICWA 4E89A 1S9EA 5J2BA 1TK8A 1VSDA 5KFLA 4OLAA 4NLGA 3OJUA 1WCNA 3RB3A 5KGXA 4I9LA 4CHNA 3HT3A 3ISBA 1S1UA 7ICMA 3U3GA 4CEBA 3EWAA 1J9AA 3HX0A 4Z0UA 1IKWA 3CG7A 4E7KA 3MGHA 4FM0A 4FLVA 4ECZA 4M04A 1B43A 2FLNA 4E0DA 1ZQSA 4F3TA 3ZT0A 1JL1A 4FJNA 4IQUA 1NK9A 2BE2A 3GIKA 2ZUBA 8ICOA 2ZUDA 4KN4A 5DLGA 4ECUA 4M6WB 4CJPA 1XI1A 3B6PA 4EZ6A 3M8RA 3F73A 4RPXA 1NOZA 1HYSA 2QXFA 4MFBA 3AA5X 2X6NA 5HRRA 3KLHA 4CK3A 4YMNA 3VQBA 3HXMA 1UT5A 8ICCA 3NF7A 1ITGA 5L1JA 1JIHA 2VG6A 1TFRA 3TI0A 3K5MA 3ZSXA 5DB9A 4F4ZA 3EW9A 4Z4GA 1N48A 2BR0A 1NK0A 4W5TA 5HMMA 3MBYA 1D5AA 1NK7A 3V9WA 4GXIA 3PX0A 3HJFA 4RQ3A 4M47A 9ICFA 2PI4A 3ZD9A 1C0TA 3CFRA 4FBUA 4H4MA 4DU3A 4OPKA 3MXIA 5KFAA 1BCMA 4QWAA 3CM6A 8ICAA 2RDJA 8ICUA 3V1QA 1U47A 3QLHA 1QTMA 4YG2A 3RTVA 2KW4A 3K2PA 4C8KA 7ICIA 4CIGA 1C7YA 1WCLA 4PQUA 3UQ0A 4DTXA 4FW2A 3K4GA 5JUMA 4RQ4A 2V4QA 2VG7A 2ZTEA 1MC8A 2HVIA 2XY7A 3V6JA 5DBBA 4CJ3A 3PO5A 1I39A 1WSFA 1ZQHA 4PH5A 3KHGA 2YKNA 9ICQA 5J2EA 1KFSA 2V4RA 1T05A 4Q8EA 5DB6A 9ICJA 2Q0ZX 1SZPA 2BQRA 1Z26A 5J0TA 3V7LA 2FBYA 3QZ7A 2G8WA 1JMSA 4DTPA 2IS3A 5J2CA 2PI5A 4BE2A 2HHXA 4R8UA 4F5PA 3HL8A 4AHSA 2ASLA 4M3YA 4PGQA 4Q0BA 1XO1A 2FC0A 4N56A 8ICTA 5J2PA 1ZBHA 4RPYA 1SL0A 9ICKA 5KFXA 4DMNA 3AA2A 4KB1A 4R64A 1O1WA 3OYDA 4FXDA 3OYKA 1C1AA 1D9DA 7ICUA 4KV8A 2VWJA 2Z1GA 3MEDA 2A1SA 4J2EA 2HHUA 5TZVA 5BOLA 4DF4A 3ZSRA 3G6YA 1FXXA 3VQ6A 1C0UA 2ZTDA 4FW1A 4NYFA 1IXRA 4KI6A 4ECRA 4CIFA 2UVRA 4YMMA 5J0YA 1ASUA 3L3VA 1NJZA 3RJKA 2C2DA 3SCXA 1RBTA 4EYHB 4GC6A 1NOMA 1ZQZA 1S10A 2FLPA 4OGEA 3OYHA 1AROP 4NCAA 2RKIA 5J1EA 1EXNA 1SKRA 1V9PA 4MFCA 3ZD8A 3G6VA 3C2MA 3SZ2A 4RT3A 2A1JB 3QZ8A 7ICRA 1L3VA 3DLGA 2BCUA 4DQQA 4CGHA 2X6SA 8ICZA 1RDBA 3MDCA 4JV0A 1BCOA 4RQ0A 1TKZA 4QZIA 4IBNA 2HW3A 4ZHRA 4G1QA 4HHTA 4KHNA 2G8FA 4DSLA 4LH5A 3TARA 3RR7A 1JLEA 2Z1HA 1BPEA 4YQWA 1NOYA 1DTTA 2MAXA 4IR9A 4PWDA 3MXMA 4YVZA 3KD5E 3MR5A 5DDMA 4CJFA 4BXOB 1BPDA 3AO3A 1J53A 4HUGA 4NCGA 3L3UA 4CF1A 3DLRA 4FJJA 5J2MA 3S9HA 4PGXA 3ZSYA 1CZ9A 3C6UA 3M9NB 4C8NA 3OYBA 3AU2A 3TAFA 2KFNA 2RF2A 1ZQOA 1K1QA 1ZJNA 1UT8A 1EXQA 3RJJA 3OYFA 4M3RA 3RB0A 4AHVA 1NK6A 1YTAA 4O0IA 3PW5A 4YD1A 5KT7A 3DLKA 1RBUA 5J2GA 3RR8A 3L2WA 4OPJA 4Z4IA 7ICSA 1U49A 2G8VA 3RJGA 3GV5B 4KLQA 4FJHA 9ICTA 3VQQA 4R65A 3JPNA 3KHLA 3AVJA 3ITHA 9ICGA 4K8ZA 2BQUA 4C8LA 3KK1A 3QEAZ 1W9HA 2NUBA 8ICPA 4F4KA 3GV8B 4RNNA 1BI4A 1BIUA 1JLBA 4LVSA 7ICQA 3LWMA 4M9LA 4F92B 2OWOA 5KFKA 2XY8A 3OYLA 9ICSA 1VSLA 3OY9A 3JSMA 7ICPA 1WSJA 4IG0A 2PZSA 3MGIA 4R63A 5J2IA 2Z1IA 1U4BA 3NGIA 3I8DA 1IG9A 4Q44A 4M6WA 3M9OB 5DMRA 3HO1A 2R8IA 5J29A 4E1NA 2IGIA 1MQ2A 1ZQCA 3K59A 4J2DA 2BCSA 3LZJA 1NK5A 4CGJA 4YN4A 4Z6EA 4O5KA 8ICJA 4KTQA 1S1WA 8ICIA 4RZRA 2HHTA 1LAVA 2IDOA 1KFTA 5HROA 1Z00B 3NGZA 3Q8LA 1X2IA 2ZQBA 4CJUA 5L1IA 2HHQA 4PUOA 2YNGA 8ICBA 2P6RA 4I2QA 4JS5A 3AVKA 3SQ0A 2GUIA 5CZ1A 2VA3A 4ZTJA 4X5VA 2P1JA 4DTNA 4F5QA 5D3GA 5BOMA 5KFCA 3RMDA 3SI8A 2IMWP 4PHEA 3SUOA 7ICJA 4J2AA 3MECA 1B22A 3BQ0A 3E01A 3NBPA 4KHSA 4IFVA 3OS2A 4FJKA 4DFJA 8ICXA 2ZJ5A 1WNSA 3QEWA 4Q5VA 3M8SA 3KTQA 1C6VA 1FKOA 1DTQA 3QINA 5KRTA 4YMOA 5IIOA 2ATQA 5CZ2A 4CGIA 2R7YA 5F9LA 1TK5A 4KITB 1KVAA 9ICRA 2F1JA 1LV5A 1JXLA 4GVMA 1XS9D 4DF8A 2DPJA 3JPRA 4M45A 5JS2A 4CJRA 2B5JA 2VANA 4QWBA 1BQNA 1JLGA 2JGUA 1B9DA 2YHAA 4NLKA 3RWUA 1ZQUA 2XC9A 1Q9YA 4UB3A 4KLMA 1JLCA 4IRDA 5SZTA 4CIEA 2Y1IA 3OJSA 1IM4A 4FJ7A 9ICCA 3ZDBA 3RBDA 4ID1A 2MUTB 1BPXA 1JKHA 3NF8A 1FKPA 5J0XA 1T3NA 5KFNA 4QZGA 2YHBA 1LW0A 5J0WA 4QZAA 2H5XA 4JV2A 2B4JA 4UAZA 9ICAA 1QE1A 1ZQXA 3RRHA 4RUAA 3AA3A 3LWLA 4KTZA 2PYJA 5FROA 3LP3A 4FLZA 3AVFA 4CJWA 3MAQA 1RT3A 2IAJA 4DFMA 5CA7A 3Q8PB 4M0AA 5KG6A 4JRPA 2PXIA 2YNIA 1CEZA 2BGWA 4KLJA 2W9MA 3RAXA 3BQ2A 3QE9Y 4FJ9A 3LP1A 1D9FA 2DFHA 3EY1A 1KVCA 4MF8A 2A1JA 4F4WA 2JZBA 5KG5A 3VQ9A 3DYAA 3DOLA 2W9BB 3ASMA 4DOCA 4UBBA 1ZQRA 3OYIA 8ICLA 1TAUA 4AHCA 1S1XA 3MABA 5DG7A 3OHBA 2AQ0A 5DQGA 2C22A 9ICXA 3LZIA 3VQAA 7ICLA 4NXZA 3KJVA 4HTUA 3MFIA 1Q9XA 3L2VA 8ICQA 3NFAA 4CFAA 1HQEA 5HMLA 2Z1JA 1EX4A 4DL3A 3OYAA 4BDZA 7ICOA 1S6PA 1RILA 5J2HA 4BXOA 3E2EA 3TAGA 4DSEA 3RMBA 2XGQA 4FJ5A 4M3ZA 1BI4B 1S0MA 1NK4A 4O0JA 5IINA 4B9LA 4FZXC 3RAQA 4K4HA 3ORYA 3RH4A 4B9UA 5DKWA 4RQ1A 3V7JA 9ICIA 3MXJA 3AO4A 4QWCA 5EOZA 1ZQGA 3UPQA 1I3AA 2F1IA 3C1YA 2HNZA 3ISNC 2G8UA 3SUQA 4M9JA 2NRVA 1N6QA 5DB7A 3WNFA 2XY6A 1G15A 4FM2A 4B3OA 4DQSA 1H38A 4UB5A 4ECXA 4I2PA 1XC9A 4F8RA 4HYKA 4XQ8A 3L8BA 4QOZB 1T8EA 4KMUA 3JPPA 8ICVA 4DQPA 4I2JA 4KLDA 1PZNA 1RPLA 4CF0A 1TV9A 3OS1A 4FJXA 4QZEA 5D46A 3HK2A 3Q8RB 1N56A 1ZQDA 2W8LA 3QESA 5EWEA 4CFBA 2G8IA 4DSIA 5KI6A 4DTJA 2IA6A 2J6SA 1NKBA 3PUFA 2FMQA 1X9SA 5KFFA 2IC3A 1RT5A 4YNQA 2FPMA 4ED6A 5I42A 2W8KA 5C25A 3IG1A 3QO9A 7ICFA 1QHTA 4RW9A 4TUPA 4ECTA 2YKMA 3K5NA 5HBMA 8ICMA 3B0YA 3QETA 5DG9A 3ZSOA 3V9SA 4KREA 4GXJA 4NCBA 4O5CA 4H4OA 2XHBA 3ZDEA 4ECYA 2XY5A 4Z6CA 4B9NA 1T03A 4EEYA 4KLSA 3PW7A 1CLQA 4RPZA 3PVXA 4FS2A 3NDKA 3NCIA 3QNNA 1ASVA 1B92A 3FDSA 3TABA 2BCQA 2HHWA 3ULDA 1Z00A 1S76D 2HHVA 3C2LA 4RG8A 1SV5A 4YD2A 1NJWA 4FLUA 3VQ7A 4Z4CA 5HRPA 1EKEA 3MDAA 4Z4FA 3T5LA 4B9MA 1HNIA 1BIZA 4DTOA 4DL7A 3VQDA 1ZQAA 4ELUA 4CEQA 4DG1A 1GOBA 3GILA 4I9QA 4B9SA 2ITGA 4I7FA 4FLYA 3B0XA 4AH9A 3VA3A 4YFKA 2UVWA 4TQSA 1Z3EB 3IM1A 2DTUA 2J6UA 4O3NA 4QW8A 3UXNA 4CHPA 4E7IA 2AJQA 4KTWA 2NRXA 7ICHA 3DMJA 1JX4A 1LWEA 3ZT1A 3OS0A 4PA1A 4KLIA 3IS9A 1L3TA 2GWSA 3RJEA 3C21A 4RU9A 1ZBUA 3F9KA 4CECA 2GBZA 3T3FA 2AQ4A 4MEYA 5D4BA 1RTDA 5CJ7A 3ISDA 1XSNA 4DSJA 4LY7A 4CF8A 4QAGA 3HM9A 1MQ3A 3V6KA 4FJMA 3PV8A 8ICNA 5KGWA 3HW8A 4J9MA 4W5NA 4P2HA 3PR5B 4CF2A 4PHAA 3Q8MA 4I2DA 5DK5A 4DTUA 4O3SA 4F2SA 2QKKA 1U9LA 3CM5A 4PPXA 4K4GA 3CYMA 4DLEA 2F1HA 3H8WA 5CY4A 1S9GA 5SWMA 3AV9A 3KK2A 1GOCA 2MUTA 4ELTA 4FLXA 4QZFA 4YP3A 3HPGA 4F50A 5KG3A 2ASJA 2JZBB 3KHHA 4IRKA 3H4BA 9ICVA 3OVNA 4CGDA 4BE1A 1S5JA 1WSEA 3Q8KA 3KLGA 5EWFA 1A77A 4UB4A 1UA0A 3LALA 4CESA 5KG1A 2BQ3A 4TUQA 1HYZA 2WOMA 5KFEA 4KHYA 5F9NA 4K8XA 1WSHA 2R8KA 4UAYA 4M41A 2GV9A 4F2RA 2OPRA 4G3IA 3GQCA 3SUPA 5KFMA 2OYQA 2F8TA 2P5GA 4M3WA 4DTRA 9ICHA 4GLXA 4M9NA 5KG2A 3SYZA 1NJYA 1WSIA 5KFJA 5BPCA 5C5JA 1KTQA 4KLGA 4JK1A 9ICBA 3NGYA 4CEFA 3A2FA 3QEPA 2ALZA 5J2KA 4N47A 9ICMA 4BWJA 2D0BA 2W9BA 4Y1DA 4IFYA 3JYTA 4NYNA 3VQCA 3LANA 4E7HA 4TQRA 4RW6A 1S77D 5FRNA 3V1OA 3RMAA 3C94A 3VN5A 2WONA 3NTUA 4BE0A 4O3OA 8ICGA 4QZ8A 3G0ZA 3EPIA 3GV7B 5I3UA 4CJKA 3NAEA 2DY4A 5KFIA 1D8YA 4ED8A 1RDCA 1S0NA 2JEIA 1ZBFA 4FK4A 4J9RA 1SKWA 4E19A 4KRFA 1ZQQA 4F5NA 5L9XA 2YNFA 4ECQA 4CJLA 5C24A 2QK9A 1U48A 4RQ8A 1QS4A 3JPSA 3QNOA 4O55A 4HUFA 7ICGA 4FM1A 2JEJA 3ZT3A 1QLNA 2C28A 3H40A 2ISPA 4FCYA 4PGYA 4DEZA 3QEVA 2ISOA 3CQ8A 4MF2A 2FMPA 5CB1A 3HSTB 4XRHA 3O3HA 4IQWA 1BL3A 1RYRA 4KLHA 3RJFA 4W5RA 4KHQA 1HYVA 3NH1A 4C8OA 4HCCA 4YR3A 5IIJA 1JXBA 4DO9A 4FLWA 1LWFA 3M8QA 3AVCA 1WSGA 4DS4A 3PNCA 2FMSA 3T5KA 4C8MA 2PFQA 2UVUA 1XHZA 3ZSWA 4L8RB 1XSPA 5HNKA 5DB8A 3N97B 3NF9A 4KHWA 1RZTA 4H8KA 4Z4EA 4QZCA 1RT6A 1T4GA 3P1GA 2XGPA 3LAMA 3LDAA 3HVTA 1RDDA 4YCXA 1SKSA 1WLJA 2NRZA 5CR0A 3MR3A 3C95A 1S6QA 1S97A 4EP4A 3PX4A 1VSFA 4CEDA 2AGQA 3NE6A 4OGCA 3GIMA 3ZDDA 3EYZA 4AILC 3QEIA 1ZQBA 4KFBA 7ICEA 2KZZA 5IIKA 1TGOA 2FBVA 1RT7A 4J9KA 1ZETA 3PO4A 2W42A 1T7PA 1ZQEA 4CEAA 2P5OA 3TAEA 4GC7A 3KHRA 5K14A 3SQ1A 4NLNA 4PHDA 5HP1A 2BPFA 4IRCA 3WNEA 4KB0A 3G6XA 2W9CB 5HLFA 4FZYA 4I2HA 5DQIA 1XHXA 4LZDA 2HNDA 1A76A 3MEGA 4QZDA 3U6FA 3CFPA 3BQTA 2HHSA 3IRXA 4CHZA 5HHIA 4I28A 3RB6A 2OA8A 3PW0A 5DQHA 5KT5A 3OYGA 4DFPA 4ZH4A 4OKEA 3M9MB 1HJPA 1SUQA 3LPTA 3O4NA 2PY5A 8ICEA 4FK0A 1VSMA 4OVLA 2XCPA 4ED0A 2YV0X 1YT3A 7ICVA 5KFVA 3HVRA 3HYFA 3T5JA 4JWNA 4CERA 5E41A 2PFNA 1RT4A 4J9QA 4HCBA 5KFUA 4ZTFA 3OYEA 4DQRA 2RN2A 3CFOA 1ZJMA 2EX3A 3GFKB 3AU6A 4FYDA 4O5BA 4FJIA 4PY5A 3O3FA 3UXPA 4J2BA 4OLBA 5KFPA 5JS1A 2KZMA 3N4MB 3D0PA 5J0UA 3RJIA 2C2RA 4IR1A 2JEFA 3BQ1A 1L3SA 4UB1A 8ICFA 3SPZA 3DRRA 4RUCA 5FRMA 1JXEA 4EP5A 3GDXA 3IHQB 3KIOA 1ZQVA 5DDYA 1QSSA 1BGXT 4YXMA
chains in the Genus database with same CATH superfamily
3THXA 5IIMA 1IUJA 1X9WA 3LPUA 3ULEA 1NGAA 4UARA 2A6MA 4QIGA 4XA5A 1VQMS 2IBOA 4OYWA 3QUTA 4BVPA 2E8MA 3EPGA 3FSXA 3BF4A 4ERDA 2A10A 5J8YC 4EBDA 4U8VA 5L1LA 4QZBA 2NXCA 5T41A 2IRYA 1E3MA 2MA1A 4RW6B 3DGPA 3CEDA 1RGIA 3PY8A 4LQ3A 2C3UA 3OSNA 2WSEC 3CVKA 2D69A 3RB4A 3NMAA 4CEEA 3P8BB 2MRLA 5A2QO 2G8HA 2DCUB 4Z37A 4KLTA 2B4OA 2FIUA 5CWRA 1CJVA 4WFAQ 5A0YA 2G0IA 2IJRA 3I0RA 1QVFR 1BNPA 1W2BM 1HNVA 4NL5A 2E6LA 2P9PA 3SDEB 1TVRB 2M88A 4IXCA 2QB1A 3MM7A 2I6WA 3DM2B 4CWBA 3D6JA 2DNKA 3D67A 2MQLA 2OZSA 4DOBA 2OH2A 5B0DA 2N1RA 3TAMA 2FVPA 4HHHA 4JI1K 3SMPA 1ITPA 4TY9A 4BDPA 4WCEL 1RTJB 3R2DJ 3RUBL 2DNNA 2KQ2A 2R9LA 1CZAN 4WQ5C 3HFZB 2BOAA 3LAKA 4PZVA 1VJ5A 4OKJA 4DR2J 5J0SA 3PIOL 4M95A 4JI5K 4JKCA 3KD1E 4Z6DA 1PC5A 1LKYB 4Q45A 3AGKA 3Q89A 3QGGA 3NGSA 3OHAA 2UYTA 3A13A 2KTQA 1BPBA 2GO9A 1UVIA 4GKKJ 3SCLE 2PSZA 1VQNN 4C1NI 1Q86O 4LSLB 3HBTA 4CZMA 2K3IA 4K42A 3M2UB 1LAWA 1WHYA 3GE1A 1UA1A 3DRPB 4Z6FA 1RWXB 3GU0A 3ZTPA 5DBAA 4JK8A 3NEKA 3AVBA 3UCZP 1HR0J 3DJCA 1YTYA 1S0VA 2ZFHA 2JHEA 2WZ1A 3VGMA 2DVIA 3TWHA 3VVUA 2IVPA 5C12A 4I68A 3GLJA 2PFPA 1ZBIA 1RK8A 3QATA 4XDCA 2JJ4D 4FJ8A 4A46A 1N5SA 4P4MA 4JI0F 1ZQMA 2R4FA 4DV5F 4KKOB 3QFWA 5HN0A 4W4MA 4DR6K 1GXLA 2FGOA 1UWBA 2KVIA 4P0QA 2XI9A 7FDRA 1NGDA 3ETLA 1ZQLA 3IDHA 3CJKB 1NWKA 4LZGA 3TANA 2WHOA 1FXRA 4QYRA 5CHGA 5FLXU 2ZWPA 2H5IB 3V1RA 1CJUB 2FJEB 5AQRA 1S99A 1B0VA 1DBDA 4GVLA 1DLOB 1RAEB 1G4CA 4EU0A 1S0OA 4PG4A 2HVEA 3W65A 4CZEA 4DR7F 3W2VB 3CJRA 4B8AB 2X78A 1N32K 1U0HA 4KLUA 2HG4A 4Z7YA 5KOXA 3FEZA 5J2JA 3R6LB 1KFDA 5IC6B 2G5IB 2WVFA 3SPYA 4M2YA 1Q5YA 2P5VA 2ZOMA 1FJCA 4NWBA 2R8GA 4IG3A 1OY8A 4ZVPB 3MR6A 4CK1A 3M8PA 2OAUA 3OYJA 5B0CA 1ELOA 2QB0A 5HRNA 3THXB 3CD6S 4FJLA 3NVZA 3ULEB 4UY8O 5ETQA 4W5OA 3ZT2A 4NYZA 3SBMA 3M3ZA 5FLXY 3HVAA 1HUXA 2D0AA 4CI0B 1TKDA 1PYOB 2VBYA 1M90O 3QU5A 4A8MP 3DLBA 2LU2A 1SV0A 2GUPA 4F4XA 3H90A 1HX1A 2BJEA 1LWCA 2DKZA 4M3XA 5J2NB 5GAHU 2LXIA 5HMWA 1L7MA 2FF6A 3KMQA 3W5XA 2YX6A 1IQTA 1XC3A 1QH9A 2QMWA 3C6HA 4IDKA 3PR4A 1KNZA 3VAKA 1RTHA 3PFEA 2P9NB 5ALGA 4EGLA 1WDDA 3BKTA 5CP2A 1CJVB 5A0YB 4YORA 3BQ7A 5K20B 1F3FA 4EYIB 1HNVB 2GWKA 3ICXA 1XR6A 2DHAA 4NMLA 2UUCF 3ZTSA 5MLCV 5A8WA 3FJ2A 1NGCA 1SIJA 3OXGA 4FN5A 3VERA 3A8JA 2FPLA 3G8TA 4CLFA 3G8SA 1WC4A 4JWMA 4I27A 2I2YA 2FDNA 1HPZA 2FHMA 1O5JA 3SEOA 1FJGF 1JCEA 4B02A 2RDIA 2V9WA 1DY3A 3VV2B 3ZC4A 3V72A 2CN1A 3OA9A 1CQMA 2YX4A 2BE2B 4WF9L 2K89A 4MLHA 3KUGA 2IFXA 2HAFA 4LR8A 4BRQA 1MSWD 1B4SA 1B0TA 1T9WA 1X7VA 4O3PA 1NEEA 1L3UA 2V51B 2F3NA 3KDNA 3SFUA 3IWXA 4QQBA 1YBAA 3H6EA 2KICA 2QLXA 4C7YA 2WK4A 1DQAA 3NH2A 3QSIA 4NPOA 4Y2AA 1WWVA 3TTDA 4EX6A 2BE7D 4RQMA 1MWMA 1C1BA 2F44A 4PWWA 2CJYB 1T6CA 2WRMA 4ILJA 5KG0A 3M1VB 2OSRA 5DM7Q 2ASDA 4NO7A 3FGUA 2P9LB 3T5HA 4LF5K 4M3UA 2HMXA 1S7HA 3MM5A 4NYOA 4DV4K 2W7PA 4JKBA 2BDPA 2OIHA 4AUKA 1R8PA 4CO3A 4WZMA 4PL1A 5KRSA 1VBZA 4CJEA 3D2NA 3AUOA 1NPPA 5BYQA 2DNGA 1KD1T 3CJCA 4KLEA 3G9CA 1FA0A 1KLMA 8ICHA 4DV7F 2KJ5A 1Q18A 3SK3A 3NL0A 1SWWA 1HW8A 4PHPA 4FBTA 5AE2A 5AJ3K 4DV3F 1G6BA 4LF7F 2GH1A 1YTUA 3M4XA 3M8YA 2E5LK 4AFFA 1KCFA 3IFEA 4UAWA 2DFEA 4RW8A 2VG5A 1N5TA 5D4PA 2RLTA 4G65A 1HNWJ 5D78A 3ZDAA 2CQBA 2X51A 1VSKA 5JTIA 3LP0A 2AGPA 1Q3VA 3H08A 4R8UB 3GG4A 5L38A 2ZIUB 2HOQA 4LFCJ 1NXIA 1U04A 2XRIA 1CC8A 2B21A 1WOSA 5KFDA 3A8YA 1N33F 1Q3UA 1IKXA 1PCAA 1EWQA 3ZZTA 3NS7B 3CULA 2RHFA 2O1PA 3IR6B 3VA0A 5KFWA 1RWOB 4X4OA 4JD2A 1Y9OA 4IG3B 3BUZB 3MEDB 5IM0A 2QX0A 8ICSA 4CF9A 4LF4J 5HR6A 3ZX0A 5C42A 1K1SA 1Q82T 4FSVA 1N8RO 4NA3A 4U6PA 1NKCA 2JV3A 4IKFA 4DV0K 1JI7A 4K4VA 4BGAA 1XNRK 5ETNA 2KH9A 4B1XB 3PHTA 3NNCA 2CQGA 3BV8A 2UV8A 4H4KA 1U6ZA 5KFHA 2YNHA 4CDIA 3NCPA 1BWEA 5G0RA 4FOIA 4DQIA 1QM9A 2A42A 8ICYA 2KXFA 1U1NA 3J7Z5 2ZXHA 4A59A 3PYGA 4NASA 4DPXA 2A41A 3I5CA 3P5JA 3VQEA 1VS3A 2P9IA 1OH7A 2IRXA 2F5GA 1VOMA 4O4GA 4TLRA 2MQPA 1NK8A 3KXDA 1YF5L 4KB7A 3KJNB 1T9VA 3P6YC 1TKZB 2YQ0A 2RT3A 2KKZA 4IDKB 5T14A 1TTHB 3LOUA 3F2DA 5FP0A 1X60A 3G82B 4RWXA 4NWIA 3LDSA 4E7LA 3F5TA 1EQMA 4B3MF 3R1HA 4DFDA 1TL1A 2MDAA 2HB5A 4DR3K 2LCWA 2KKVA 2NPIA 3R5BA 2QLBB 2OFHX 2LSNA 2FPKA 1FNOA 1K6YA 3ELHA 4URGA 2D7SA 5EE3A 5B66U 4AYBD 1HLUA 2N4DA 3VAGA 1IKVA 2NRWA 3N6MA 2HURA 2HKEA 3KJFB 2Y1RI 3DOKA 3Q83A 1UJ6A 4QW9A 2KG5A 2K7JA 2Y1LB 3CCLN 3E0FA 2X74A 1SAZA 3FZFA 3ILOA 1WN7A 1XSLA 2FSJA 2WB4A 4JV5F 4RQ7A 2MZ1A 2HHHF 3CJ0A 4AM6A 3KK1B 4OO1J 3WXKA 9ICWA 3TEHB 1NGJA 5J2BA 4PZNA 4FWRA 3FSYA 2E1CA 1NSAA 1U1LA 3RB3A 2V2VA 1S6UA 3NGRA 1EQYA 3IWLA 1JLBB 1S1UA 3EWAA 3DXKB 5BN8A 4LJMA 3HX0A 4Z0UA 2Y3YA 3MCSA 2XYHB 3CG7A 1AXQA 2DR8A 4E7KA 5I3PA 2M8HA 1LOUA 4FLVA 2B56A 1RA6A 3GR1A 1VQ5S 2FLNA 4E0DA 1J2VA 3WZ0A 1JL1A 4A48A 4HI2A 2QWNA 4FJNA 2QG9B 3RAMA 5K8MA 5HMYA 1RDRA 3OPXA 3TW0A 3S6JA 4ZIWA 3UR0A 2Q66A 2CQDA 3H2LA 3SD7A 2ZUDA 3E3XA 1S22A 5FIIA 3FM9A 1YQHA 3F73A 1KDNA 4LSZB 1SH0A 4RPXA 4X64F 1B99A 2ADCA 3I8BA 2GVDA 2VASA 1NCLA 5BN9A 3ALRA 2KD1A 5DDOC 1GQEA 1IBMK 1UT5A 2HBQB 2HYIB 1HWUA 5HROB 1H74A 3WK5A 4OYIA 3C2PA 4N8OA 4RQNA 1N48A 2NXNA 4CLYA 4PUOB 5HMMA 3NGKA 1NK7A 3TO8A 5CXTA 4M47A 1Q7YO 5AZIA 2X7IA 3P3DA 2W4PA 4OPKA 3O0FA 3MXIA 2GELA 5KFAA 3LP0B 1APSA 2E1YA 4GKKK 3IC1A 2W24A 1OY6A 2W6LA 1DK2A 3F44A 3DDIA 4NLCA 3NBPB 2EZZA 2KW4A 1KAXA 1YRXA 7ICIA 4HI1A 5EHHA 4OI0A 1WCLA 4JKFA 2ALYB 3UQ0A 2OXOA 3K4GA 5JUMA 3CCQN 1J2NA 2VG7A 3GTYX 3ONQA 2MTLA 2XY7A 1QCKA 2VDIA 2VQEF 1E6VB 2XLJA 1IVZA 1RCOB 3H45C 1ZQHA 2LI6A 1YSJA 2YKNA 4J03A 5B09A 1XR7A 4BR2A 4JI2J 5HATA 5DB6A 2ZM6J 2Q0ZX 2FC9A 1XMQF 2NO4A 2BTFA 3BZKA 1Z26A 3BGUA 2P9GA 1JLGB 3WC0A 3QZ7A 4ZPAA 5GAGU 1JMSA 3P39A 5G0RB 1QQ7A 4Q0BA 1UVKA 5KOWA 3KNGA 1FNXH 3H25A 4OQJA 2VDHA 2A6AA 8ICTA 2WW8A 1ZBHA 2YPYA 3J7YU 2XVTA 9ICKA 3L6QA 5CR4A 4KB1A 4R64A 4O4GB 3OYDA 2VKZG 3TX8A 2HS3A 2YX8A 5ADXH 1RE1B 1D4XA 4PYDA 2Z2MA 1QQOA 4J2EA 3H20A 1AZSB 5TZVA 3EVWA 3ZSRA 3VQ6A 5THWA 1AYEA 5LXYA 4PPZA 4NYFA 3DRYA 3M6ZA 1ASUA 4A2AA 2IAJB 1NJZA 4MDAA 5D0HA 3SCXA 5AZJB 3AQFA 5FLXO 4GC6A 1NOMA 3BYPA 4DV2F 1S10A 3CC4S 3NRZA 1FFVA 2POKA 5LSOA 3R3TA 3CJ7A 2ACMA 4URQU 3U9ZA 4TNOA 3BM7A 3N7RC 2LFVA 4WFXA 3TNVA 4QBUA 2NZCA 3G6VA 3LP1B 3SZ2A 1HBMA 2EC0A 4RT3A 2ITMA 4LFBF 5IWAF 3NMRA 1VYAA 3DYAB 4WIIA 2E8AA 3ZZOA 1X6IA 2MKSA 4CGHA 1HD0A 2X6SA 3UMCA 8ICZA 3MDCA 1A0PA 2DXDA 4X62K 2WF9A 1S1XB 2WAQF 5L8RC 4M63A 2GEMA 4G1QA 4B6JA 3E51A 4TVAB 2DR5A 1HBOA 4GVBA 4LH5A 2W03A 4KHRA 3EUB2 3CJ3A 5E7OB 1X40A 3CCJS 4YB1P 2MAXA 1VQ8S 2QO3A 3KD5E 5K4LA 1WDTA 2JOQA 3PDNA 5B8HA 4CJFA 1TL7A 3FZHA 2X1AA 1J53A 2BUPA 4JI8F 5AKEA 4FPIA 5J2MA 4ZCIA 4PGXA 4MIAA 4FWOA 3C6UA 4IYQA 3M9NB 4HHJA 3IMQJ 2M5YA 2V8GA 3DU5A 2DQNB 1UEUA 1PKUA 4XPCA 3OYFA 1YJ7A 2HNZB 4RBUA 3B6BA 4FFDA 2F7TA 2IOHA 1RBUA 3L2WA 2DKXA 2IMOA 2CG4A 2DNMA 4HACA 4FJHA 3VQQA 3JQKA 2BQUA 2WFBA 3UCUP 5G4DA 1NSQA 2Q0RA 2MY8A 3U4LA 2Z30B 8ICPA 3GV8B 4IUFA 2FSNA 5GTHU 1ZD4A 1XNQJ 1VC6A 2CQ4A 2Q31A 4LVSA 7ICQA 3MDQA 2L9NA 2OWOA 4DV6F 1BUPA 2XBPA 2QA1A 2ZITA 4LF1A 5K8NA 3LGMA 5AZIB 1WSJA 2LXFA 4YOYA 3MGIA 3PZPA 3S8SA 1U4BA 3IG1B 1WG4A 4RW9B 3BREA 4CP5A 4IFEA 2AA4A 1FJEB 2R8IA 5J29A 2LEBA 1VFJA 4G1PA 4E1NA 5GMKa 2Q3PA 4WFAL 1ZQCA 3L4PA 3SENA 4H4OB 1BD6A 3GYGA 3CP8A 1NK5A 2BMBA 1D0EA 3N6LA 4GKJJ 2RNEA 4F0KA 5E5NA 4NXNJ 8ICJA 3KOOA 2ZC3A 4DR5K 3ENWA 4GIBA 2V8VA 3C16B 4LFAJ 5AQGA 1BMQB 3NGZA 2BBEA 5LMNK 2ZH1A 1BUXA 1X2IA 1SV5B 3VGVA 2ZQBA 3H1QA 2QWPA 5IC4B 1DT9A 4K5SA 2P6RA 3NGTA 4X4NA 5CZ1A 2VA3A 4ZTJA 4Y65A 4X5VA 3NNAA 3H2VE 1VQNS 5D3GA 5A6PA 5JMNA 2G9OA 4PHEA 5ITHA 3KKAA 1Y5IB 3VETA 4NZ0A 2IYIA 2KN4A 1TYQA 4KHSA 1NGIA 2QN6B 2R7WA 4FWQA 3AJ1A 2MYFA 1N34F 5ALSA 3MXHP 1R0CB 4CZLA 5I9EB 1XNSA 3IS9B 2AX1A 3D68A 1VHXA 3QINA 4YOXA 1R0BG 2GX9A 5KRTA 2EVZA 5GIPA 3H5XA 2R7YA 5F9LA 3AOCA 2VGNA 2F1JA 1VI7A 1LV5A 1RAAB 4LFCK 4M7YA 4GVMA 1I1GA 1RTDB 1FRLA 4V19S 2KP7A 4BHQA 2WB1D 1ED1A 4NLKA 1ZQUA 1Q9YA 3B8HA 4IRDA 5T7LB 4C0OC 1CPZA 2Q79A 3ADAC 2YY3A 5K9FA 4ILGB 4LF4K 4OHYA 3IR5B 1FRKA 1NHUA 2ZIWA 2KL8A 4UATA 4PKGA 3G4SN 1K47A 4F71A 1MWZA 3BGFA 1HIWA 1FKPA 2ZVIA 1HW9A 2JC1A 3LQVA 3ZEUB 1OYEA 2NR0A 2XQCA 5HJXA 2BOPA 4UAZA 2B51A 3BSNA 2WOMB 5SUHA 1ZQXA 4KTZA 4RUAA 4GVBB 3L3FX 5FROA 3OXLA 1WG1A 1M5PC 4OZ3A 3EXYA 4ZPTR 2PIIA 4ZP6A 2MKYA 4P2MA 4GRSA 1U6FA 3PRBA 4Y2VA 3O4WA 4YS2A 1QQNA 1CEZA 2FF3B 4Y2YA 1IBKJ 2DFHA 3EY1A 3P38A 5M1OA 3ETRA 5KG5A 5FD1A 4DUTA 3ASMA 4UBBA 8ICLA 1TAUA 3I1YA 2O67A 2C22A 2CJBA 3D28A 3LZIA 7ICLA 1H72C 3KJVA 3IN5A 3ZETB 1Q9XA 3L2VA 8ICQA 4CFAA 2C3PA 1HQEA 4WPAA 2WONB 5HMLA 3OVSA 3OYAA 2JVOA 7ICOA 1S6PA 4ZS6A 3VPZA 2EK6A 3TAGA 4DSEA 4IL6U 2NNWA 4FJ5A 2DYAA 1NK4A 4O0JA 5IINA 1FRHA 5A76A 4K4HA 2Y0SD 3JXUA 4HT5A 3O9UA 2ZZTA 2W7OA 3V7JA 9ICIA 3OL7A 5C24B 4YDDB 4QWCA 5K8OA 1RWVB 4DV7J 2UXCF 3ISNC 3C1YA 1QTNB 2DO4A 2YX7A 3HHLC 5AXMA 3ETOA 3FZBA 4U9RA 1XTZA 5DB7A 5ALRA 2E5IA 3EUNA 3JTOA 2XY6A 4G6VB 1V3SA 3R5DA 4Z2XA 1G15A 2UXDJ 5CZVA 4UB5A 4BC5A 4F8RA 3WK8A 3L8BA 1FRMA 3CC7N 1HBUB 3NRBA 8ICVA 2BKNA 3OFGA 4I2JA 4KLDA 1Q8KA 1RPLA 5D8HB 4WYBA 3Q8RB 4KGXB 1RQNA 1N56A 2GWJA 3CB4A 1WG8A 4F26A 4MN4C 3GG0A 2G8IA 3ETMA 2YVSA 3AQPA 2KJVA 2CPJA 5KI6A 5EE0A 4JEPA 2Q6BA 2P9EA 2CVEA 2J6SA 1X9JA 2LDIA 3MUMP 3A5MC 1IR1A 4TLQA 2FPMA 3EGZA 1YRUA 5D3GB 4ECTA 1YJWN 1H2UX 4FNHA 3B0YA 1NU4A 3V9SA 4MKYA 1QUVA 3L3CA 5B5EU 3UM9A 3ZDEA 2OTJN 4Z6CA 4EEYA 1NGBA 3PW7A 1IJEB 1CLQA 3QYPA 4BS2A 4OZLA 3VGLA 3EVMA 2QRRA 4FE3A 1ASVA 3EICA 4OYPA 3MN7A 5K14B 2BCQA 4Y2CA 4NL9C 4CLTA 2YKQA 3VEWA 2QWOA 2FHOB 2HFZA 3RF9A 1U2FA 3C2LA 1IG6A 5ALWA 3TU5A 3W3SA 3M32B 1RWNB 1ZM2A 4L3KA 3UVJB 2ZZMA 4Z4FA 3LVVA 1JCFA 5DM7L 3S01A 1FERA 2NCKL 1BIZA 3P96A 4CRJA 4Y2UA 4CIOA 2OHFA 3R5JB 4A62A 5ALNA 3O9SA 3S1TA 3CETA 1RWWB 2M3DA 3FLCO 2CKWA 4HTIA 2ROPA 1Z3EB 1VDHA 3MOJB 3D2FA 2DTUA 1RWPB 4JI2K 2QWLA 1XUPO 2MJUA 3B78A 4CHPA 2ZM6K 2G2OA 2ZIWB 3KD3A 4V19J 2AJQA 1U1QA 3DMJA 1N5QA 1LWEA 1IXKA 2PEBA 1FKPB 2D3O1 4KLIA 3OTQA 2AXTU 2ZH8A 4B3MJ 1YJRA 3AT1B 2VHGA 2VKRA 5IT0A 3W5YA 3G2XA 5IT9Y 1RU1A 4ES1A 5AI9A 3WIUA 3E66A 2O8EB 4FYYB 1SH3A 1XSNA 4ISEA 4QAGA 2KG0A 2YN4A 2PMZD 3HM9A 1T95A 4KHPF 1S7IA 3V4MA 1VQ7N 4P2HA 1FF2A 2HSTA 4CF2A 4PHAA 4XTTA 1H0HB 1CJTA 2QWQA 4DTUA 1T9TA 1NH8A 4ZVTB 2LKYA 4PKDB 3CYMA 4DLEA 2G1DA 1QQ6A 1M0SA 3H8WA 1URRA 1R0AB 5KL8B 5SWMA 3EKSA 4KYZA 2LDYA 5D6GA 4ELTA 1YX2A 1FCAA 1AFJA 1N52B 4NLXA 4C11B 5TKWA 1O0PA 9ICVA 1SZ2A 4BE1A 2VBXA 1P8ZA 3MPVA 2E20A 5F8JA 3THPA 4JKEA 1A77A 3LALA 1MWYA 1M1KO 1WEZA 3TKAA 2BQ3A 4TUQA 4J91A 1ZS6A 1HYZA 5KFEA 3CTRA 2K3KA 4PABA 5BR8K 4K8XA 1TP7A 5HR7A 1HJOA 2V9KA 2GV9A 2OPRA 4CRXA 4OX6A 2Y9TA 2GAHC 1S6PB 2OYQA 3GU3A 2UZAA 3R6GB 5F0XA 4OL8A 2W3RA 2C2ZB 3ZTOA 3CJAA 4DTRA 2AW0A 4M9NA 4D3HA 3W2WB 1KHWA 5J1PA 3VMFB 3QIPB 2F9WA 2OKQA 1CS4B 5KFJA 2QFJA 5BPCA 1FFUA 3VGUA 1ICEB 4KLGA 4ZITA 4CEFA 3LTOA 2ZJRQ 1RTIB 3CIZA 5GAHP 2ALZA 5E79U 4ED5A 5DDRC 3D1OA 3UO0A 4DUZJ 2W9BA 1NJIT 3VEOA 2DRDA 2DRBA 5AQSA 3NAIA 1GTHA 1FX4A 2FJVA 2GCFA 5ETMA 3I6PA 4BRIA 2NYIA 4CZJA 5FRNA 2CXYA 4HTJA 3VN5A 4S0MA 2FVRA 4CLZA 3CJ2A 2BW7A 2XZDB 4ANEA 2ZEJA 4K4YA 5I3UA 2YI1A 3NAEA 3CCLS 2X3GA 1K73T 4ED8A 2JX2A 1RDCA 2JEIA 5HSPA 5KAFU 1EQ0A 1HFEL 4KRFA 3EZUA 3Q22A 3DLJA 1VRUB 3I56N 2M2BA 5L9XA 4BQLA 5F3TA 2V2KA 2JR5A 1I94J 4KGVB 3JPSA 3LDQA 4O55A 5IQ6A 2FZKB 2ZWHA 3FFIB 1QLNA 2JRSA 2XYGB 2ZBQA 5JLFA 3MGVA 3BO3A 5GTIU 3U1LA 4JI7J 1WHVA 2B7BB 2DNOA 3HSTB 4OZJA 3A4TA 3UR3C 1NO8A 4C4TA 1RYRA 2OPSB 4KLHA 4JB3A 1L7PA 4W5RA 1SBRA 5IIJA 1MLAA 4FLWA 1WF0A 1LWFA 3M8QA 3AVCA 3QJPA 1BG3A 2FMSA 3KK3B 4MJKA 4L8RB 4ES2A 3A12A 4J5OA 1FEEA 5HNKA 3UD4P 3PJ9A 4QYZK 4KHWA 4H8KA 4Z4EA 3U27A 3OTOK 4L75A 1Y11A 1DHMA 3JQJA 3LAMA 2QL5B 3CT9A 4Q2MA 4UT4A 1ZRNA 4OX9K 4YCXA 2DL0A 2XYPB 4IKAA 5A8RA 4GKJK 3C95A 4NXNK 5B7WA 4YDUA 1S6QA 1S97A 5F3XB 2AGQA 3AEVA 1ATRA 5E2QA 1OXJA 2E29A 4LFAK 2VPYB 1UPHA 3GIRA 3LF0A 4KFBA 2NXJA 2BXJA 3QT7A 2VD3A 2KOBA 2FBVA 4J9VA 1ZQEA 1LWEB 4CEAA 2P5OA 1MU2B 3KHRA 5F8GA 2OPPB 4WTYA 2BPFA 5AKIA 1OH6A 1TL5A 4ZN3A 3G6XA 2E1RA 3CCQS 2HNDA 2VIHA 1A76A 3MEGA 5E3CA 5LY3A 3BQTA 5BPNA 4CNZA 4GY2B 1QAIA 2FD2A 4C8ZA 3IP4B 3IRXA 2OA8A 5AIAA 5HMXA 3EJMA 4FXWA 5EE9A 4BRKA 3DXSX 4DFPA 4ZH4A 1WTFA 1PUZA 1KOOA 4XAKA 1HJPA 1SUQA 2PY5A 2KJ9A 4DBQA 4DPTA 2YV0X 1JLFB 2WF5A 7ICVA 2OD4A 3T5JA 4JWNA 2BANB 3DOMA 5JU5A 4ILMA 3OYEA 2D0PA 2RN2A 2VB6A 4GNIA 1DK3A 3OPKA 3QJJA 3W1YC 5BR9A 2V50A 2J9EA 4PY5A 1UETA 4J2BA 3PNIA 5KFPA 4YHHJ 2ZC4A 3D0PA 1G7CB 4A8SA 1MWKA 1S48A 3BQ1A 2ZHAA 3UI3A 4UB1A 1N32F 8ICFA 1SJFA 3DRRA 4EP5A 4C1NK 2XMWA 1ZQVA 1LW2B 2PMHA 1EETB 3MMCB 1TU0B 4ED4A 2W01A 3VESA 4NZ7A 4YXJA 2I1QA 2KEYA 2KN7A 2HMIA 3T9ZA 5G5GA 1F5AA 3AO5A 3EE9A 1TVAA 3FFKB 3H8JA 1S9FA 2Q97A 5AICA 5J0RA 3C6TA 2HBRB 1RBLA 5AE3A 4R5PB 1CXUA 3EX7B 1HI1A 3A0BU 4WKRA 3H5YA 3M8ZA 4PJ0U 3UDVA 1DGSA 1U8SA 4X4QA 2EFQA 4O44B 4K4IA 1GO3F 4J7CA 7ICKA 4X66J 9ICNA 3ID6A 1Q7LB 4I6WA 2RUSA 3LP2B 2BKOA 4F0MA 2H3QA 2G13A 3D6MB 4G1IA 5I3UB 2YPZA 5HJYA 3BPSP 3OFHA 2P9CA 3L2QA 2KZ3A 3IKMA 3L2RA 1M6YA 2O66A 4Y2KA 4UY85 4CO1A 4EO8A 7FD1A 2DNLA 3DLEB 4FS1A 4CJ4A 3FZKA 1V4TA 4I69A 2EC2A 4BRLA 3EGVA 2E9RX 2K4PA 5KT4A 4MFAA 1KWMA 2V69A 4LIWA 4DTMA 3UWTA 2WAQC 1SXLA 3LGHA 3MD3A 3DRSA 5CABA 3AODA 2KNJA 5ALIA 4RW7B 2WBMA 4Y1CA 3QU7A 4K2XA 3WQUA 4OPHA 1VRTA 3JSBA 3H4DA 1K5OA 3IBCB 3D45A 3UKRA 5KFOA 1U2VB 1S1VA 1GXUA 4JHDB 1LWFB 1ATSA 4P2XA 3O44A 3WEEB 1Q8IA 3CIMA 3HFVA 2C2KB 4NI2B 1HJRA 3S3OA 4A5AA 9ICUA 3MPUB 1KRPA 1X8DA 3W7BA 4QWDA 2MSTA 2C42A 3U9DA 1BC6A 5KFTA 4KAIA 4DWIA 4KGKA 1NMDA 3FYHA 5J2AA 2YMPA 3KLEB 1ZQNA 2M52A 2ZUAA 4B3SF 4P52A 3US5A 3AA9A 3BN7A 2BKEA 4KPYA 1SPBP 3SJJA 4BACA 3W9HA 3CDAA 2Y1JA 4RW4A 3C19A 2CH6A 2AU0A 1Y88A 4HVZA 2ZWOA 3UQ2A 1CLFA 2KMDA 5KFYA 4HHUA 4WE1A 1UW4A 5JVHL 3K57A 1VK0A 2OMLA 2XMUA 2BPCA 3K0JA 2P51A 3OBYA 4LF8J 5ALUA 2MLYA 2DNQA 1KAZA 4A57A 4I2BA 4NY8A 2D1KA 3U3YA 2E66A 4RQ2A 2N4CA 1DGJA 1RI7A 4LF5F 4E3SA 2R18A 5DG8A 1NM1A 5T7BA 4F4YA 1NG9A 2NLWA 3QEBZ 2A6OA 1Q4RA 2DK2A 5GVQA 5HO4A 4DV4F 4HAIA 2LKZA 4WFBQ 2HOFA 1S79A 3BR8A 3CJ1A 1JXVA 1CQNA 1Z25A 5IZHA 1HUOA 5ALXA 4K4TA 1W0HA 4FYXB 5KFBA 4KLLA 2E1ZA 2FVSA 2BPGA 4C7QA 4UW9A 2Q6CA 1QQCA 5CYQB 1EAYC 4ACOA 1SUQB 5AJ3F 1BPYA 4J9LA 1UTAA 5FPMA 4NXMF 3S3NA 1M1HA 4RPFA 1FO1A 3DDHA 2E5LF 3HPHA 1HNZK 4H0TB 2XCAA 2VPZB 1REGX 1O03A 3GFYA 2NZTA 3OGUA 3N28A 3CCUN 4M5JA 3UW1A 4IOBA 3QBXA 2F96A 1E4GT 2W9CA 3G6ES 1N2XA 1RZMA 5M1KA 1Z4NA 3F41A 2DXFA 3J80U 2V4JA 4O23A 2QGFB 3OW2M 4KO0A 1ZTTA 3QDKA 3ZSQA 3DRRB 4K2JA 3CF5L 3MMAB 2G8KA 3NAHA 3UIQA 3FMWA 4ED7A 2B0GA 4G9ZA 4GW6A 4A8EA 2JFDA 5HHHA 2QT7A 2B9EA 1VQMN 4KHUA 4DR4K 1ZTWA 3O4QA 2RAQA 1MN7A 1FK9B 3MCMA 1SV0C 3C6TB 4DX6A 2W3SA 2E2NA 3ALYA 1YJTA 2LHTA 4OJOA 2LYHA 4FK2A 4DV0F 1XNRF 2FLOA 5J0OA 2R3VA 2H54B 3TR5A 1KBUA 3AVGA 4IEEA 4F04B 2G0AA 3V81B 1TMJA 1UPMB 3G4SS 3FC4A 4ED2A 2LQJA 2C1EB 3V4IA 2I1RA 3RZAA 4WWSA 2DFFA 2U1AA 1OH8A 1XWLA 4YOWA 2DTJA 2WFAA 4RQ5A 4R79A 3SQ4A 4OFZA 2UXCJ 3J80Y 3I96A 2F8MA 2WSFC 1TFYA 2HNYA 4WCEQ 2ATLA 5GMEA 4Y0FA 1R8BA 1A9NB 1S1TA 4USMA 3ZNJ1 4FWNA 4RTFD 2UU9J 4I0WA 3OSPA 2L3MA 1NZBA 3O1LA 1VSEA 3AA4A 3M2VA 4JS4A 3FKBA 4GVEA 4FF2A 1K8KA 3MX5A 4AQYK 2FVQA 4ZVUB 2BCRA 3KKSA 3HZ6A 2AKWB 4WP9A 5LSRA 1KVIA 4BGDA 4NM2A 4QZHA 1IKWB 3WXMB 3D2EA 3R5GA 1WWUA 2Z2YB 4DR3F 2MJNA 2XO7A 4IZ9A 4OKKA 3HOTA 1HNXK 3R9LA 1RT1A 4XUSA 2DGOA 3QMLA 1ZOTA 3AFGA 2E4LA 4B1WB 2RHKA 4OZ1A 5DZ7A 7AT1B 1HWKA 4OJRA 1RT2A 4HVJA 1HKBA 4F93B 1OSCA 4MKAA 2R8HA 1GOAA 4BG9A 3VTHA 1HYSB 3CERA 3ZDCA 3BBBA 4MFBB 2O4GA 1FD2A 2AEFA 3KLHB 3O1WA 5J2FA 3T6BA 1SL1A 3MM8A 1ULRA 5FDLA 2PFOA 1JLQA 2OPQA 4NLSA 4PQAA 2KYXA 3D54A 1VSJA 4B08A 2BHNA 1SQKA 4NE9C 4GMJB 3QICA 5CCLA 3QBWA 4DTSA 3ENHA 4YFUA 4QIWD 2I5JA 4P9SA 3TA2A 1FRIA 1I94K 2VA8A 4H4MB 2DHGA 3C6AA 3AGRA 3FGVA 4OZNA 1K9MO 3BS9A 3NOGA 3HZGA 4E1MA 1Q53A 4RNHA 2JRZA 1PGZA 4LRBA 1Y5LB 3CHWA 3CC7S 3GJSB 3L2UA 3NF6A 1SQEA 2UUTA 2DR7A 1Q8LA 3K1ZA 2QV6A 2EZXA 3AM9A 5KT3A 4USAA 2B6AA 4RO0A 3GL1A 1KVJA 4RUBA 5D49A 1MA7A 3TFSA 2JEGA 4XIUA 3ILJA 5GAEU 1RP5A 1OYDA 4OV6A 4LJXA 3I0SA 4IC9A 1J54A 5F8MA 3PYEA 3PMNA 4NA2A 2O6KA 3VQ8A 2FLLA 2ZGYA 1P1TA 4KH0B 3HWTA 4ICLA 5AKXA 4CHOA 4DR2F 4AYBF 3TUIC 4DFKA 2VZ9A 3QYYA 3PEHA 4ZN1A 3DU6A 2O5DA 2VWBA 4KLOA 3MCAB 1N5WA 3IGNA 4WIQA 4HTLA 3AOBA 2V6AA 2E6MA 2JLEA 4ECWA 4PXBA 3UKUB 3OYCA 2OTJS 5J2PB 1EP4A 2YJFA 3NLCA 2DEIA 4GKKF 5CCMA 2W2OP 5JLHA 2KV2A 2O4IA 3DI6A 2YJEA 2XMKA 4KLFA 3NGDA 2CPHA 3A8EA 4ZK7M 2V4JB 4O9MA 2HRUA 1VQ4N 3SQ2A 3E9OA 1ZQTA 5D0RA 3ENOA 3W8PA 4Y2PA 1TL3A 1ROFA 1X4GA 2Z2ZA 4QIEA 5D77A 1JNRB 1W97L 1C0UB 1UZHA 4AT1B 4J9PA 3CD6N 3BZQA 3QGHA 1HR0F 2R7VA 4GO7X 3M05A 5CEHA 4L72B 2V34A 4CJQA 3V5RA 2EFVA 3WNHA 3OUYB 2P9KA 1QY7A 3Q8UA 1B9FA 2RKIB 3HD2A 5J1EB 2MPUA 4BROA 3AQOA 3VF4A 3T9NA 5ADXA 2HIQA 3A0HU 4P4OA 1GLFO 4JV1A 2BACA 2EZYA 3V4IB 3QRPA 2UUBK 2IJNA 2JZ5A 1V85A 1HMVA 1RXOB 1X4FA 1SIWB 2FJWA 1HUZA 4EBCA 2HVZA 2DHSA 2DEJA 3O9RA 4QOTA 1VSHA 3RMCA 2AX0A 1XEZA 1ZD3A 5D0GA 3KWIA 2VONA 3CDBA 2GLEA 4X4RA 1RQ0A 2QL9B 2R42A 2XHWA 4OI1A 1KLNA 5KT6A 1IR2A 5BREA 1MWQA 1DOQA 3C66A 2XEXA 3M2VB 1VQ7S 1N0VC 5HP4A 4ZJOA 1UAXA 4LF6J 5AQFA 2EDUA 2E8PA 4NCGB 3ET6B 3PEJA 1BQMA 2RD5C 5A0LA 4JBCA 2QE5A 1KS2A 4ELVA 4EZ9A 1L6NA 5HMZA 3SNNA 5AIBA 2EWSA 3UMBA 4ECVA 1YZ7A 4LRAA 3AAWB 1BVSA 7ICTA 1KQSR 5AM1A 3CQYA 3TZZA 4OYBA 2AGOA 5GADP 2F4VK 9ICEA 1UJ4A 4F5RA 2PYLA 3DLKB 2BM1A 3MM6A 4PEOA 4BR5A 1U25A 1RHKB 4CE9A 2HI0A 3BYRA 3ITHB 5KQDA 8ICRA 5C2GA 4X66K 4DL6A 3OR1A 1S9EA 2LP4A 4NLWA 2YCHA 5KFLA 1OPZA 5FDLB 4OLAA 3CD7A 4NLGA 2K7KA 5KGXA 2OPQB 4JI1J 2PDAA 1NDKA 1IWGA 4CEBA 2QXLA 1XK8A 4H5VA 5C15A 4ECZA 4QR0A 2HRTA 1UVJA 2ZZNA 2I5JB 2J7UA 4IQUA 4IG0B 5KQ8A 3KG0A 2F9JA 4ZVHA 3I5AA 4JI5J 3GIKA 8ICOA 1Y0HA 2RVJA 2Z2LA 5DLGA 2WMMA 3R97A 4RJVA 4M6WB 4CJPA 2HFNA 1YJ9N 1U1PA 4EZ6A 3CJ8A 3M8RA 4JK7A 4X65K 3G87A 4H5NA 4P7VA 2QXFA 3DV9A 2F63A 3AA5X 2X6NA 5HRRA 2ZJRL 2VFSA 4WXOA 2ZDOA 3HXMA 1N62A 2B6AB 4OHXA 2F9DA 3ZYYX 1ITGA 1NM2A 4BC9A 2XULA 4CM0A 1T9YA 3K5MA 1UL3A 3AH6A 5DB9A 2L9DA 1ILYA 2YX1A 3I56S 3EW9A 2NYHA 2CWKA 3D6RA 4P2SA 4UAUA 5F8IA 5BYSA 6AT1B 5EN1A 4MIBA 4CT8A 3ZZUA 4CYUA 3CPEA 3MWBA 1C0TA 1RUSA 5ETVA 3CFRA 1GLBG 4FZNA 1P7DA 2V8PA 2VJ4A 2EQYA 1BCMA 3EZWA 3IM9A 4CH0S 4K41A 2RDJA 8ICUA 3GP9A 2UP1A 3QLHA 4GMKA 1QTMA 3K2PA 4C8KA 3ZTRA 4NJ8A 4CIGA 5AQJA 2CPRA 1C7YA 3LM9A 1W26A 2V8DA 2HVIA 3DI6B 4DR6J 4LT6A 4LF8K 1YBTA 3TTFA 1DTQB 4OYZA 2KHOA 1AUDA 3OD2A 4PH5A 2Q1NA 3KHGA 5F3ZA 1U1OA 4P2FA 5MLCQ 1NNLA 2CUYA 4LRFA 2V4RA 1T05A 4Q8EA 1LWXA 3VEZA 1SZPA 3LVWA 2RHSB 3MAAB 4XK8C 3C14A 4FYVB 1F5SA 4K4WA 5J0TA 3V7LA 2FBYA 2BDUA 4UOFA 1HI0P 2G8WA 2YMMA 5G5HA 4AF1A 5LMNF 5J2CA 1KN5A 4J8FA 1HWJA 3I55S 1K0VA 2P9SB 4F5PA 1VBKA 2C2MB 2LPEA 1ZBSA 4PGQA 3QNMA 3J81j 2QL7B 3D3BJ 3U02A 4RPYA 5KFXA 4FXDA 2EPIA 5DDQC 4KV8A 3NVMA 2Z1GA 3D2SA 3MEKA 5C0YA 2V2ZA 3WKEA 1M5VC 2A1SA 1SC4B 3D6FB 2OGUA 2HHUA 4WK1A 4DF4A 2W1BA 4KBOA 2W2NP 1YZ6A 4FW1A 2FC8A 4USHA 4KHMA 4CIFA 2UVRA 4USWA 3O3LA 2KKPA 3MM9A 1RT3B 3FMBA 2P2CB 4LFCF 2FLPA 3WIVA 2PKEA 4ZJQA 2NRRA 3B54A 4YOEA 4A2BA 6FD1A 3FZ2A 1VQLS 1SKRA 1V9PA 4BC7A 4N7TA 2BV3A 1NSPA 3ZD8A 4FXVA 4OX7A 5LOQA 2V5HG 3C2MA 2A1JB 3QZ8A 1J5EJ 1L3VA 1X6JA 1WC0A 2N3OA 4DQQA 4ZP9A 4DQ8A 3DOLB 4FWKA 3AD9C 2V68A 2J0SD 4LF4F 2GS8A 4JV0A 1BCOA 4QZIA 4M63C 4CLSA 1EWRA 2CXEA 1NDPA 2HW3A 3J80O 1PK1B 1RBAA 4C0BA 2OELA 4DSLA 1OJ4A 3RR7A 4P72A 3UCGA 2Z1HA 4YQWA 4I6MB 1T3OA 1DTTA 4Y2JA 1WHWA 3MXMA 3GG1A 3ZX3A 5DDMA 1H2TZ 3KK7A 3OR1B 1Z4OA 4AD6A 4HUGA 3L3UA 5JRTA 4CF1A 3A8KA 4BCAA 2D74B 1CZ9A 4W92B 3RFAA 3NVVA 2AZ3A 4EK2A 2YB1A 2I8EA 2QARA 3AU2A 3PTWA 3ZNUA 2RF2A 1ZQOA 3G86A 2UU9K 1EXQA 1UT8A 1EHWA 5A8KA 2MQQA 3RB0A 1HLWA 1NK6A 4KR0B 1YTAA 3HHLB 5J2GA 3RR8A 7ICSA 5DO2A 1U49A 4K5RA 2K8BB 1VJWA 3GV5B 4KLQA 2RHQB 4B3OB 3A1YG 3VF0B 2FQQB 4BRGA 3TPQA 3JPNA 2D3ZA 1NMEB 3BF1A 4K8ZA 4C8LA 3IFRA 1GMUA 1F2HA 2O8CB 2H3VA 2XS7A 3GONA 4WU2A 1BOTO 2B9YA 4F4KA 2HF3A 1LFWA 1U0SA 3IO1A 2YWEA 2BVZA 1N63A 4ZDNA 3UE5A 3ZZPA 3CJQA 1NLVA 9ICSA 2COLA 4BQZA 2MZQA 2K60A 3BS5B 4R63A 5J2IA 2Z1IA 3NGIA 3I8DA 1Q79A 1IG9A 3J81U 4JI0K 1LKZA 4YDXA 5DMRA 3UD5A 4DV5K 2IGIA 4NLYA 1MQ2A 2ASMA 4J2DA 5BRDA 1ZPVA 2NSCA 1GMWD 3ISND 4Z6EA 4O5KA 4BC2A 4KTQA 2D1CA 1S1WA 1NU0A 8ICIA 2EEYA 1U02A 4EIAA 2HHTA 1GFWB 1KFTA 1Z00B 2K8CB 2E7VA 5CHIA 4CJUA 2HHQA 1KP6A 1HHQA 4XH1A 5H9EK 2YNGA 3QXGA 4I2QA 3SQ0A 2D41A 1HHSA 3KKAC 1KC8O 2R7UA 2P1JA 3NOCA 2EFPA 4Y00A 2KYZA 3SUOA 1BU6O 4J2AA 3MECA 3BQ0A 3U1MA 1JNZB 4U8YA 5A6WA 3E01A 2KSOA 1T11A 4IFVA 2CPYA 2OMOA 5F2RA 4EUVA 3W64A 4DB3A 1VMBA 4FJKA 2QZ8A 2HK3A 3BDEA 3H0PA 1WNSA 1R6VA 2V52B 2M4MA 1FKOA 3UN2A 3IAM9 2J8AA 3H59A 5CZ2A 1L8OA 4CGIA 1Q86T 1TK5A 1KVAA 4P0PA 4NRUA 1VQPS 4Y2SA 4JAXA 4DV0J 5AXLA 4OJ3A 4USIA 1XS9D 2PD1A 1GK8A 4A8OA 2VU5A 4WP3A 4CF3A 3JPRA 4M45A 2ABYA 3U26A 2B5JA 5AQMA 5CE3A 2YWGA 1JJ4A 3MM9B 2MZJA 3CCEN 4WP8A 2Y0SF 1RDUA 4EAHD 2WF7A 2XC9A 1JLCA 1R43A 2ZJQQ 2NO5A 4CIEA 1RAJA 2Y1IA 1VRQC 2ZDPA 1AW0A 2HMPA 1DRGA 4UF4A 4OHWA 3ZDBA 4HH1A 3WK4A 4RUHA 3RBDA 3KK2B 4FP9A 2WW4A 2MUTB 1JKHA 3WX4A 2LQ9A 1H73A 4PAAA 4WFBL 5J0XA 5AKKA 4LQ9A 3KUEA 5KFNA 3KLGB 4NZ6A 1MW7A 3R5AA 3CCUS 5J0WA 4JI2F 3QAEA 3D3CJ 2ZM6F 2JFKA 1YIJS 2VH7A 2QYGA 9ICAA 4HKQA 1XO0A 3RRHA 2G2ZA 4CJ7A 4KGMA 2G07A 4CJWA 3MAQA 3UPFA 4A8FA 1WF2A 4KQZA 3CCJN 4DFMA 1RA7A 1VQ8N 2DH7A 1IBLJ 4JKAA 3AJ2A 2D6FC 1Y00A 2I7PA 2YNIA 1K8AO 4KLJA 1UJ5A 5HVFA 6FDRA 2LYBA 4MAKA 2M9KA 1X0FA 2CA9A 2XLKA 3O9TA 2JZBA 3VQ9A 1BWVA 2W55A 3QT5A 2B43A 3SBGA 4IFYB 3JYTB 2D4WA 4LF6K 1LXNA 2D3OR 5DG7A 3GBTA 2QI2A 9ICXA 4FZVA 3VQAA 2A1BA 1MMNA 2KXNB 2RU3A 4UY8T 3QU9A 4RL1A 5AQHA 3N6NA 4BXOA 3M30B 5H9FJ 2CG8A 1N88A 1M90T 4QR2A 3Q24A 2DT9A 4QS7A 1D8BA 4FZXC 3RAQA 4C6AA 3VCBA 5DKWA 2YNFB 4KBIA 3MMVA 4NB4A 2I6XA 3MXJA 3AO4A 3H0RB 1ZQGA 1YDLA 3UPQA 2F1IA 1A6LA 4M9JA 3WNFA 3C29A 4WFYA 3P4IA 3C46A 2OI2A 1XR5A 4OI4A 4FM2A 4DQSA 4ECXA 2XMTA 4I2PA 4QOZB 3SMZA 5AQWA 1RAIB 2H5JB 4DQPA 1IBMJ 1QVGR 5CD4A 3B82A 3CJ9A 3BZCA 5D46A 4FPBA 4DPOA 4CGZA 4C3MA 2J9DE 2PMZF 1N61A 3QESA 1FDAA 1F2GA 1F44A 3I76A 2OJ3A 4GFJA 3QRRA 3OL9A 3CCWA 3H3NO 1NKBA 1X9SA 5KFFA 2IC3A 3LO3A 3AAQA 1RT5A 5ALDA 5I42A 2MZTA 1RKJA 5LSLA 2HIYA 3OTCA 1QHTA 2YKMA 5HBMA 3MECB 8ICMA 3ZXWA 3QETA 5DG9A 4GXJA 4NCBA 4O5CA 1BWFO 3E01B 4E1JA 2L5YA 3J7ZO 3MMBA 2GJFA 2XY5A 1RT7B 3TZYA 4RPZA 3PVXA 4FS2A 2CQ2A 3HCXA 3NCIA 1XNQF 4EELA 3QNNA 2V67A 1B92A 3IBPA 1UKUA 3NNHA 5EUHA 1S12A 2B8PA 3POTB 3AB4B 2HHVA 4OPAA 4RG8A 4YD2A 3P5BP 4ZCLA 4O3MA 4KRWA 3VQ7A 4TY8A 4USVA 5HRPA 2CQIA 1P27B 2MLZA 3T5LA 1PIEA 1MDUB 1HNIA 5ALHA 2B5JB 2HS4A 3VQDA 4N77A 3UDLA 4DG1A 2DIVA 1GOBA 2YWFA 1SWVA 3VEVA 3F5AA 1D8ZA 2ITGA 4I7FA 3B0XA 4AH9A 4FF4A 1OS5A 4JI6K 3NCRA 4OX9F 4YFKA 2UVWA 3ULHA 2HQCA 3IM1A 1YLXA 1TE2A 4GKJF 2J6UA 3E9LA 4O3NA 4NXNF 3UXNA 2B4PA 4A8XA 2KT3A 4CTAA 4MLEA 1SGGA 4BRMA 2CGLA 4I56A 4LFAF 2H4WB 4CI6A 4BR7A 4H5TA 5FPNA 4RU9A 4ER8A 2C3OA 4MMOA 5D4BA 4MDBA 3F9MA 1NI3A 3ISDA 2HPUA 4EWTA 4K4ZA 1VQ4S 4AYBC 4LF2A 3CDWA 1MQ3A 3CNHA 3V6KA 1I51B 5D15A 3HW8A 4J9MA 4GV9A 2GO8A 2EH9A 3D2WA 2O8FB 4W5NA 5CH7B 3PJXA 3PR5B 4TU8A 4I2DA 5DK5A 4P75A 5KAKA 2KHVA 1U9LA 2YNIB 4PPXA 1W2BR 1BY9A 1WORA 4CZCA 5CY4A 3GMGA 3AV9A 5GAHI 1B3TA 4ZVSB 4QZFA 1X5PA 3HPGA 4F50A 2ASJA 2JZBB 2Z0GA 3H4BA 3Q8KA 4X62J 2GMJA 3P45B 3A3NB 3BKFA 3SMSA 1UA0A 2HHHK 4M7XA 1IG8A 2IY5B 4C8YA 5KG1A 4OMFG 1OIAA 1H6KX 2RRDA 2X1FA 3DGPB 1N8RT 3HD1A 1WSHA 1O13A 1J2MA 1IN0A 5JICA 2O8BA 1SZHA 4M41A 3ZLJA 4RWTA 2W40A 3NS6A 1J5EK 2EAPA 2K4IA 3GR0A 3L7PA 2HQFA 3QUQA 2B3TB 2Q1LA 2F8EX 5AHXA 3SCKE 1DXSA 2LMIA 5JXSA 1WC5A 2J0QD 9ICHA 4FF3A 4GLXA 3KWMA 4E2FB 2RIJA 3HSCA 3VF6A 1NJYA 3SYZA 4DUYJ 1WTBA 3I0RB 1WSIA 1FRXA 3I31A 2P9PB 1KTQA 4JK1A 3A2FA 1FX2A 3FUYA 3MM7B 4IOXA 4N47A 4DR1J 2YMQA 4NA1A 3AY9A 9ICMA 2RS2A 2D0BA 3BSCA 2AMCB 3HHEA 3HSDA 3TAMB 1JK9B 4ILLA 3VQCA 4X64K 4O0NA 4PL2A 3ZX2A 3MTKA 3JAMY 2F8HA 2BRKA 4NLUA 2A1AA 3MX2A 3O80A 3I32A 5AQOA 2FJXA 3C94A 1OSDA 1H3DA 4BE0A 8ICGA 4PWUA 3Q2TC 1JJHA 1SC3B 4RCHA 2KKHA 1YRTA 4CJKA 1X5SA 2E8OA 1IBKF 4WQ4C 1SKWA 1YVFA 4E19A 4F0HA 3CDEA 2U2FA 3CMAS 1SQFA 4KE5A 4FVCA 1I6JA 1MMLA 1QS4A 3Q8YA 1P9YA 1P90A 4FM1A 2IC3B 4DU7A 1DFDA 3RU0A 2JEJA 2FHJD 4DEZA 3QEVA 2LEAA 3PKYA 1VQSA 3GCXP 5HBMB 3KJQB 4ZIVA 1VQKN 2GAGC 2VQEK 4XRHA 3IA0A 3MMBB 4H0XB 2EKNA 5AI4A 2VBWA 4QIFA 4KHQA 4DR5J 3NH1A 4YR3A 3H5UA 2WAQD 4X4UA 1NZAA 4B3RJ 3B9JA 1XMQK 1VQ9N 3PNCA 3SQGA 9ATCB 5LMNJ 2UVUA 4CH1A 1XHZA 1YJ9S 3HMJG 1NGHA 3N97B 4FL9A 2R2SA 4B9QA 1RT6A 1X3NA 3P1GA 1U1KA 3GFXA 3LDAA 2AZ1A 3HVTA 1RDDA 5CHCB 1WLJA 4YDUC 3M6UA 2NPFA 3N79A 3U7JA 1NGGA 3QAUA 2H48B 2PFDA 2V7ZA 1HARA 1NZ8A 2UXDF 1UWBB 4P0QB 4CEDA 4I7FB 3EGNA 2W2QP 1OVQA 2AHOB 3GIMA 1R3NA 5AI0A 4DX5A 5C7PA 3EYZA 2JC0A 1SB3C 3QEIA 1ZQBA 4K4SA 5LJ3Y 3J81O 2GGPA 2KZZA 5IIKA 4CTAB 4P10A 2BA9A 3A5OC 1ZETA 3NXZA 3GYXB 1T7PA 4PZOA 2DNPA 3TAEA 4GC7A 1ZM4A 4C2MA 3DCAA 1EB0A 3IGVA 4NYPA 2OO4A 2EBGA 1E6YA 1UW9A 2MZRA 1U0HB 4YB7A 2HBKA 4IRCA 5E33A 3R27A 5ALMA 5HLFA 5DQIA 4IDHA 4LZDA 1Q7YT 2HBJA 1ZC6A 3OL8A 5E26A 2ILYA 2VJ5A 2DGWA 3M8PB 3LDPA 4DX7A 4CHZA 4I28A 3RB6A 3GPAA 4UOCA 1JJ2M 5F8HA 2BH1A 5DQHA 2XIDA 4KSEB 3M1YA 2QTDA 2QB0B 1Z2LA 1X3MA 3LPTA 4OVLA 4A8YA 4ED0A 3WXJA 3HF5A 5C2CA 1F0XA 3HVRA 3IWNC 3HYFA 2PFNA 1RT4A 2DPNA 4ZTFA 2ZH2A 3D6HB 2XS5A 1NUEA 3CFOA 3K0SA 2KM8C 4WYWA 1ZAVA 4FZLA 2EX3A 1FO4A 1BXNA 3AU6A 4M5IA 4FYDA 4O5BA 2NUHA 2OP5A 3UXPA 1LWCB 4FKYA 3FQLA 2BM0A 5JS1A 4YB6A 3N4MB 1X4BA 2GIRA 5J0UA 5EXWA 2R7TA 1S4FA 1SJ1A 2ZIVA 3W0LA 1TQLA 1YKWA 3KMSA 4MTPA 2HWIA 1JXEA 5M2PA 4PKHA 1D1UA 1WNEA 5AKYA 1LNQA 3VZHA 1V6HA 1RTHB 3ED5A 5CAAA 5DDYA 3VZIA 3OLAA 3NH0A 4AXJA 1BNOA 2VWKA 2QKBA 4CM2A 3BSOA 5EDWA 1TUUA 3C23A 4CHYA 1JLAA 3T1HJ 2VIXA 4I29A 3Q8SB 5A8WB 2PA8D 4I2GA 2EHGA 3DLLQ 1WC6A 3ZO7A 4CCHA 4MO4A 1RXVA 3TFRA 4IH5A 1IBLK 3V9XA 4RQ6A 4LR7A 1KSPA 4LF9J 3MUVP 4DR4F 3T7ZA 3KLIA 1FE4A 2DRAA 4F02A 5J0PA 2ZJAA 3SV3A 1NNEA 1HPZB 2DD8S 5L1KA 4M3TA 4MT1A 4OYXA 3W62A 4TXSA 1BA1A 5BPLA 4ZA1A 1PILA 1REVA 2HRYA 5EWGA 1ZZFA 1A5WA 3HLUA 3DLHA 4PKIA 2C2EA 2RILA 3X1LB 1HKGA 1N5YA 2N82B 5AQZA 9ICPA 3K1RB 1EARA 1PVRA 5LM7E 1VLBA 2W2PP 1B7FA 2RRNA 4I2FA 2KVQE 4RT2A 4BRPA 2F8SA 1GXTA 3PSTA 2H3ZA 5AK5A 4YN3B 4DDFA 2O3DA 4R0JA 1NRKA 3O3GA 5H9FK 2ZH7A 2IYGA 3NUQA 4MK9A 2E5HA 1F3VA 1C1BB 3RH6A 2WVBA 4OYMA 2G0JA 1TELA 4X84A 2YTUA 4AHRA 1GMVA 1U1MA 2ACYA 4IWVA 4B9VA 4CJSA 3TR8A 3MM5B 1MROA 4QCLA 5LMUK 2RPIA 2ES6A 4HL9A 4DXLA 1HNXF 4OJLA 3BY5A 1L7NA 4DUZF 2P9UA 5IIIA 1ZYQA 1KLMB 1NKEA 3HVTB 1BISA 3SV4A 3TAPA 5KFGA 8ICWA 2DO0A 4N41A 2IPOB 4JI3J 2MGZA 4YMEA 2J7WA 4I2AA 1JJ2R 4ZCMA 1N34K 3EZ5A 2AT1B 2KK0A 2JLFA 1NSKL 3GDQA 1TKXA 4C0ZA 3I4HX 5HVGA 2RE2A 4RW8B 1X31C 2VG5B 2BUNA 3MCNA 3FNNA 4Q2LA 5KT2A 4H54A 3NHGA 3M6KA 3DN9A 4I2CA 1NJXA 2D0CA 3WNGA 2YXLA 1TV6A 1E6YB 2B4VA 2Q3SA 1I94F 4F91B 3FRYA 4JUZA 4IOCQ 1XBWA 1C0MA 3B6OA 4B8CA 4LC9B 3TX0A 1ZQKA 1IKXB 2GQQA 3BGRA 1MN9A 4PXEA 4Y2IA 3TRGA 9RUBA 3IRUA 4JD2B 5F0UA 4EBEA 4MK7A 1ZQYA 3NKYA 3BJYA 4JI7F 1IV0A 5IM0B 4ILRA 3TQ1A 2YKPA 4NM1A 2XHCA 5C42B 5LJWA 1WJ9A 2IDLA 2HZVA 1HRHA 1A5XA 3HPOA 4B3TK 3F2KA 3SMVA 1H7XA 1X5TA 4CVNE 2C2OB 2DR9A 2J6TA 3JPQA 3PSIA 1FHTA 2YNHB 2P8IA 3V6DA 1VK8A 1HKCA 5AT1B 5EE1A 5IV4A 1P6TA 2GVZA 3KNAA 3VAJA 1PAEX 4CD1A 2D5RA 3ILIA 2VC1A 2DISA 4XH4A 3RBEA 3T41A 5H1SQ 4Z4HA 2P9IB 3MN5A 1Y64A 2E1EA 5DBCA 3HRGA 2PA3A 3TWZA 2ZE2A 1IO2A 1L7OA 3EO3A 2CPZA 1BLUA 3KKRA 3V7KA 1YK9A 1UQVA 2W7AA 4BDYA 4RBTA 4EFHA 4RNOA 2XICA 2XWYA 3ZZRA 2PN6A 2K1RA 1HQUA 4MYTA 1R59O 4AHUA 2MSNA 4BG8A 3DXBA 3J8AA 3Q8QB 3CCES 1PK3A 1TL1B 3H8MA 5AFUH 4DSFA 3WDOA 1KQFB 4QIWF 5KG4A 3WK9A 4CT9A 5BR8J 4FVMA 3AVHA 4DV1J 2H3IA 1RYUA 3KLFA 2W25A 2YHXA 1IKVB 4HH0A 1V38A 4W5QA 1UCNA 5HK4A 2Y0SC 3DOKB </