2AHOB

Structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
264
structure length
259
Chain Sequence
MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Switch of the gamma Subunit in an Archaeal aIF2alphagamma Heterodimer
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 60
structure length 259
sequence length 264
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00575 S1 S1 RNA binding domain
B PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2ahoB02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ahoB01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 2ahoB03
5FJ8H 5FJ8G 3HOYH 3HOYG 1PH5A 3PF4A 4DR5Q 2R93H 1HZBA 3PUVA 2WB1E 3HOXG 5FLMH 2E2HH 3S2DH 4K0KL 4DUZL 2UXDQ 2K5HA 4QY7A 5IP7G 4B3SL 2F4VL 2YTXA 2QEXA 4A3CH 1X6OA 3FP9A 4PZ7A 5IE8A 1PH1A 3K7UC 2MFIA 5C3EG 1LUZA 1IBKQ 1WOCA 4DV1L 3TQYA 1VQ7A 3U4ZA 1IBLQ 4JI3Q 1A0IA 1UEBA 3IRBA 3L7ZC 4X66L 1HZCA 4HJ9A 5M3FG 1XMOQ 1Y1VG 2D62A 4BA2I 4A93H 2ATWA 2DGYA 4DPGA 2OQ0A 4LUVA 1OXTA 5H1SE 3LGJA 2VQEL 4DAYB 3CCEA 4OX9L 3M4OH 2E5LL 5IYBH 4GLVB 2K75A 1VQDA 4JC0A 3NENA 4KHPL 1SMXA 1V9PA 1VS0A 4YHHL 4DV1Q 1AE3A 3HOVG 5IP7H 2VQFQ 3M7NA 1XPOA 2IY5B 3CW2C 1CKMA 2NVXH 4R4QA 1PVOA 4IPCA 1XMOL 1SFOH 5DLQE 5C0XI 1BBWA 1ASYA 2ZM6Q 1VQOA 4LWCA 1VQEA 3I4MH 1X3EA 3CP0A 1PH2A 4YWKA 1XPUA 2YYZA 1N32Q 2AWOA 3BU2A 1E1OA 3KF8B 5M3MG 3J81i 1CKNA 2K5NA 1QVFA 4UP9A 4YWLA 3HOZG 1YITA 1KL9A 4LF4Q 1TWCH 1VQCA 1XNQQ 4NXMQ 1Q8KA 5GQOA 3GTLH 4O2DA 4OWWB 1QUQA 3PO3G 3PSIA 1PH8A 2ZJRA 5IWAQ 4DV0L 4LF9Q 2JA8H 2WB1G 1IYJB 1K0RA 3KOJA 1YZ6A 3NELA 4X64Q 3OTOL 3G71A 1FGUA 1VQBA 1YEZA 3I56A 1YJ9A 4UY8C 1CSPA 5HY6A 4LF6L 3GTJH 4JV5Q 2JA9A 1MIUA 4JI2Q 1XTDA 4B3MQ 3S14H 4DR7Q 4DK3C 4LFCQ 4P75A 4NXML 4Y52H 3WWVA 2EXDA 2NN6G 2KHJA 4DR3L 3BZCA 1Y14B 4LF5L 1N33L 4A75A 2K14A 1UE6A 2N78A 2CFMA 3HOWG 3KF6A 3Q8DA 1VQFA 3VDYA 1WI5A 4DR2L 3UE0A 2RF4A 2N49A 1NJIC 1E22A 2JA5H 2UUCQ 4B3RL 1HNWL 3EN2A 3F1ZA 3CPWA 4A3BG 2F52A 4A3KG 3NBHB 4C2MH 1Q1BA 2D0OA 1L2FA 2FXQA 1G291 4GN4B 3T1HQ 5JJIA 4DAMA 2E2JH 5GROA 2E5LQ 3K7AH 4R1JA 1TWGH 3HOZH 1K3RA 3STBD 1PYSB 2YV5A 4UP8A 4YCVA 2VS1A 3M85A 4HJ8A 5ELOA 1Q46A 2Q2UA 5FLMG 4YHHQ 1WCMG 2HQLA 4AQYQ 1VQJA 4XTCS 4A3IH 3GD7A 4WJ3M 2UUBQ 4IPDA 3B6YA 3HOUG 1N34L 2ZM6L 1SE8A 4JI7L 4QJFA 3KLWA 2MQHA 1EWIA 2CQOA 3NEMA 3PUWA 1N9WA 1EQQA 1N32L 3BZKA 4IO9A 4YY3Q 4JI8Q 1K9MC 3ULJA 3RNUA 1IBLL 4A3EH 1VQPA 3I2ZA 3S2HH 2XTIA 2OTLA 4O0AA 4JI6Q 2HHHL 3CD6A 2N3SA 5AJ3L 3RN5A 3TS2A 4DUYQ 1BKBA 2UU9Q 1R9TH 5J3BA 2VY3A 3CQZH 5JEAG 2H5XA 3CPFA 3TREA 1PH7A 4BBSG 3AFQA 4IOAA 2VZAA 1EYGA 1VQHA 3AFPA 1LM0A 4BY7G 2BA0A 3ULLA 2B29A 2CKZB 4NPSA 1V1QA 5LMNL 1YHBA 2LXKA 3GO5A 5FLXc 3D31A 1TWAH 4DV6Q 2B63G 3OW2A 1E1TA 2F3IA 3JC66 4QL5A 1EOVA 2PI2A 4JI3L 1WYDA 3RLNA 3J7A5 1KXLA 1SROA 4DUYL 3TEHB 2V1CC 4J15A 4OO1G 1MJCA 2K50A 3CCLA 4L5RC 1IZ6A 3CMEA 4ME3A 2Q2HA 4YCUA 5M5XH 1Y1WH 1QZGA 4JI1L 1K8GA 5IYDH 4NXNQ 1HR0Q 4P73A 2CCZA 2UXDL 3FHWA 4DV4L 2Q2TA 4A3KH 4BBSH 4DR5L 4IPGA 2VQFL 3L0OA 2F4VQ 3T1HL 3G48A 1QVCA 1I5FA 1CKOA 2GVBA 4JI5L 5IYDG 4X64L 4LFBQ 2VNUD 1HZAA 1IXRA 1HNZL 2VL6A 2E2IH 4DV5L 2R92H 1NMGA 2OQKA 4LUOA 4A3FG 3AEVA 1VQ9A 3CC2A 2Z6KC 1VQLA 1X54A 2ZJQA 2CWPA 3GTPH 4X66Q 1KC8C 4POGA 3K81C 2A19A 2WFWA 4DV3L 1HNXL 4HJ5A 2BH2A 3GTOH 3A5ZB 1N36Q 1B70B 2KCTA 3S1MH 1J5EL 1IBMQ 3KDFB 2D0PA 3AQQA 4AYBG 3K80C 3UDXA 3S24A 1WJJA 3HKZE 1C9OA 4PZ6A 5C0XJ 4JI7Q 3CXCA 2JA7H 2NZOA 2R7FA 2Z6KA 1FJGL 5C0XG 2Y0SE 4FDBA 4JI8L 3GTGH 3S16H 4LF8L 1VQKA 2JK8A 4MTNA 4LF6Q 1A62A 3KF6B 3PV0A 3GTKH 4RMFA 5IYCH 4APVA 2UXCQ 1VQAA 1GVPA 3CF5A 3W1BA 3CMAA 4HIDA 2HIVA 4JI0Q 1YBYA 4DK6C 3CC4A 1EIYB 3F2CA 2AMCB 2YTVA 3H3VI 1Q81C 3CCJA 3CCSA 1PA6A 1GM5A 4QGUA 1XPRA 1V43A 1LYLA 1Z9FA 2Q2IA 3HOVH 1L0WA 1XJVA 1S3OA 4OONA 5HGQA 3J80c 3MXNB 3M4PA 2ZTCA 1K73C 1I50H 2LXJA 4BY1H 2KBNA 3F8TA 2VUMH 3DLLA 4GLAC 3W1GA 1CKNB 4XIGS 4P74A 1YZ7A 4NXNL 1OXXK 3RLOA 1IBKL 4A3BH 2OTJA 3U58A 5GAHC 5GAEC 2NZHA 2AKWB 3RLFA 1OXUA 4LF5Q 1N33Q 4DR4L 3S1QH 4GN3B 4C3JH 4AQYL 1D7QA 1WFQA 3I4NH 5JJKA 2VUMG 3PUZA 5M5WH 1EUJA 4AIMA 4LFBL 4KHZA 4UP7A 2NVTH 1SN8A 3GDEA 1NY4A 4C3HH 1IL2A 4DR6Q 4KHPQ 1PYBA 4JBJA 1I6HH 1NTGA 2I5LX 4A3JG 1A8VA 3U4VA 1O7IA 2UXBQ 2L15A 2R93G 3HOUH 4DR4Q 2I5MX 3RN2A 3E9IA 4A3IG 3S17H 1PH6A 3K0XA 2C35B 4GKKL 1NBWA 1QZHA 1X56A 1B8AA 4GOPC 1HR0L 1EFWA 1VQ5A 4IJHA 4NB3A 1E24A 1K83H 5ELNA 1MJEA 1AH9A 3TRZA 1L1OC 4B3TL 4JOIA 3CCRA 5IYBG 1Q7YC 2RHQB 5LMNQ 3A5UA 1FJGQ 1KRSA 1N34Q 5K36G 3ZJYC 3ICEA 2HT1A 1J6QA 1EQRA 1HZ9A 1Z47A 1YHAA 2DUDA 2MO0A 2QGQA 3SGIA 1TWFH 2GN5A 1LTLA 4DV5Q 4Y7NH 2JA5G 1JE5A 4L5SA 4OX9Q 1YJWA 4TVAB 3FKIH 1T9HA 1L1OB 4BY1G 1L1OA 3F2DA 4B3TQ 3HOWH 1SRUA 3KFUA 4PZ8A 1DGSA 4X62Q 5C3EH 4IOCA 4HJ7A 1GO3E 1Q1EA 5AJ3Q 4LFAL 2ASBA 3PO2G 3PO2H 1RIPA 2IHEA 4A3CG 4JYAL 5C4XG 4DV4Q 4PG3A 2R92G 1CUKA 3MEFA 1MKHA 3J7ZC 3D0FA 1PH4A 3EIVA 2HHHQ 2IX1A 2JJQA 3HOXH 4JBWA 2Y0SG 2K52A 5LMNW 1U0LA 2KHIA 1E3PA 4BA1I 4C3IH 1X9NA 1N8RC 3H3VH 2GVAA 5C4JH 4DR2Q 2R6GA 3TS0A 3GTQH 1VCIA 3T1YL 1H95A 4GNXC 1KHIA 1FL0A 4OO1I 3K8AA 3G4SA 2UUAL 3CCVA 3PO3H 4JYAQ 1KQSA 4DUZQ 1XNRL 2PI2E 4DV3Q 4A3MH 1HNXQ 2KENA 3UE1A 3J81j 2MNAA 4OWTB 2EQSA 4K0KQ 4YCWA 4KI0A 1KD1C 2WAQG 4DV7Q 3S1RH 3CC7A 3OTOQ 3UDIA 2ZTEA 4GKJQ 5JJLA 1UE5A 3CCMA 3T1YQ 4DNIA 4AYBE 4GNXA 1PH9A 3RZOH 2QA4A 1I3QH 2B63H 1QUQB 3M9BA 2UUAQ 4KLKA 1VQ6A 2VW9A 5BR8L 3PIPA 1XNRQ 1KAWA 1PFSA 4A4IA 4A3JH 3QSYB 5M5YH 4PMWA 4ALPA 1KIXA 1JJ2A 3CAMA 4R4CA 2VQEQ 3M4QA 4A3LG 1ASZA 4JI5Q 1OXVA 3KDFA 4HIOA 4JI4Q 4GKKQ 1UE1A 2RHSB 4POFA 4TQUS 4X6AH 4JOIC 3JAMi 2OWOA 4GN5A 5E7NA 2JEAI 3I4NG 2ID0A 3FKIG 2UUCL 4B3RQ 1HNWQ 1N36L 5BR8Q 1VQGA 1Y1VH 2WAQE 5IP9H 4B3SQ 4MNOA 1UE7A 3G6EA 1IBML 4IFDJ 4IFDI 3PUXA 1G6PA 2BA1A 4GNXB 2R7DA 4IFDG 4BBRG 4YWMA 4LF8Q 2A8VA 2QMUB 4X65Q 4DV2Q 1Y1WG 1JT8A 1WCMH 5GADC 1PH3A 2BH8A 3W5OA 4DV6L 2I0QA 1SR3A 5C44H 2UXCL 1Q12A 1U5KA 2XGTA 1OXSC 4IJLA 5JEAJ 4A3DG 2YU9H 1GKHA 4L5QA 4LF4L 2IX0A 3PGZA 5IY0A 2LSSA 1RL2A 3PUYA 3KJOA 5IWAL 4BBRH 4WJ4A 1X55A 4QQBX 4DR1Q 4LUZA 2NVYH 1Q86C 1BBUA 2AWNA 4DKAC 4JI1Q 1X65A 4YY3L 3M3YH 4BY7H 1VQMA 3GTMH 1AE2A 4X65L 2JEBI 1SLJA 4OXPA 4JV5L 2RCNA 2JE6I 1S72A 4DR6L 4H02A 2E8GA 4R4OA 2JA6H 1S40A 2NN6I 4DR3Q 3PF5A 3PCOB 3H0GG 4UPAA 1VQ8A 4B3ML 4EQ5A 1X3GA 4JI2L 4LFCL 4DR7L 1X3FA 3I7FA 2JA7G 4A3EG 1YHQA 3BJUA 3E9HA 2R7ZG 1JJGA 3ERSX 1XMQL 4LFAQ 3RR5A 4RG1A 4DV7L 1E7ZA 4BXXH 2ZJPA 4GKJL 1PV4A 1C0AA 1NE3A 3ER0A 2Z0SA 4JCVE 4JG2A 1JMCA 1G51A 2JQOA 1HH2P 2R7ZH 1CSQA 1TXYA 5EAYA 5GAGC 1YJNA 2PNHA 1J5EQ 4GS3A 2PMZE 4A76A 4A3FH 1P16A 4QIWE 2B3GA 2PQAA 3S1NH 4A3GG 5C44G 2PQAB 4L5TA 2K5VA 2HIXA 3A0JA 1KRTA 1W3SA 4IPHA 2MO1A 1OTCA 5LMUQ 3UDFA 4AH6A 2EIFA 4EX5A 2I5HA 2K4KA 2AHOB 5M3MH 2WP8J 3J81c 3DM3A 2UUBL 4P71A 4JBMA 4GLXA 1BVSA 2NVQH 2UXBL 4LF7Q 3U50C 1A63A 1I94L 2IT1A 1UWVA 3OYYA 1HR0W 4HJAA 2CWAA 5IYCG 4HIKA 4LNQA 1B7YB 3I4MG 4R4IA 1HNZQ 1M90C 4GOPA 1FVIA 1P8LA 1NMFA 2ZTDA 3AYHB 4GOPB 4A3DH 4P72A 1VQIA 4MZ9A 4A3GH 5LMUL 3F2BA 3I55A 1EIFA 5C4XH 3S15H 4JI6L 1K8AC 4LW1A 1C7YA 3EBEA 4LF7L 1I94Q 1D8LA 3I4OA 2ES2A 3CCQA 3ULPA 4DR1L 4BXXG 3E0EA 4JI4L 3UDGA 2UU9L 1TWHH 3JAMc 1YI2A 3CCUA 5IT9c 3J80i 1W2BA 4A93G 1QVGA 3L2PA 5M3FH 2JA8G 1GD7A 1YNXA 5IP9G 3PIOA 4HIMA 1YVCA 1XNQL 2OCEA 2YTYA 4X62L 1VQ4A 1Q82C 1VQNA 3HKZG 3H0GH 1JB7A 2JA6G 4DV0Q 3HFZB 3STBC 3A74A 4A3MG 2QN6B 3RZDH 1HJPA 3HKSA 4R4TA 1YIJA 4A3LH 2IHFA 2ALYB 1PHJA 4JI0L 4LF9L 2N8NA 1XMQQ 1JJCB 2A1AA 2KCMA 3KYHC 4DV2L 4OWXB 1M1KC 3KJPA 3H15A 4JBKA
chains in the Genus database with same CATH superfamily
4H4OA 2KZZA 1ZZFA 1M5VC 4C8OA 2E2DC 4C3KA 1KBUA 4ZRZA 3JPNA 4KLLA 4CKBA 4RPZA 4LBIA 2J7UA 4FVCA 2IW3A 4MN3A 2PD1A 1UVLA 3MXHP 2DGTA 1L7OA 1URNA 1VYAA 2W55A 2XCPA 1EY6A 1QUPA 2DFLA 2EYHA 2BJEA 5F3TA 3M4OH 1RG6A 1UWAA 4GXKA 3KHRA 1V5VA 4C8NA 4WBFA 3ND8A 2W9CB 3HOVG 2YH1A 1D1IA 3A3OB 3ENAA 4N77A 1URRA 4LF8J 1Y1WB 2CDRB 4CDEC 4LF2A 4K8IA 3J7AF 1TUVA 1VQEA 3Q0AA 5KFIA 5LSLA 2DXDA 1B9NA 2NRWA 5LOQA 4KKOB 3PR4A 3MEDB 3D1OA 4UP9A 3HOZG 1RXOB 4RBVA 4O2DA 3URYA 3ENWA 2AUKA 4K5SA 3L3CA 5G4DA 7AT1B 2JA8H 1HD1A 3OTOL 1VQBA 3H0MB 1TVXA 3DDIA 4FXDA 2ZH5A 4LF6L 4KJIA 3VYTA 1KLUD 4Y52H 4DK3C 4LFCQ 2KM8C 3K89A 3C1FA 2KHJA 1Y14B 4Z6CA 4LZDA 4H4KC 4Y2XA 2PI5A 4QZ8A 4O0IA 3QGHA 4CI0B 2DY9A 2WFAA 2JA5H 3NS5A 1QE1A 3JPPA 4DAMA 1RU2A 2E5LQ 2CPJA 1TWGH 1X9WA 4ANDA 5DDQC 2MZJA 4NCAA 5C4ZA 3A8KE 1YHQS 4NDXA 4NL5A 2RF2B 2GQ2A 2WVDA 4XTCS 2VBWA 2UUBQ 2FY1A 3I0RA 3ZD8A 4JI7L 4UOCA 1KQFB 3NCRA 4AQYJ 1Y8NB 1I4QA 1DBDA 5EE0A 5JVHQ 1X4AA 1LT3D 4DUYF 4I2AA 3W65A 1MN9A 2LS01 3JPSA 4RBUA 1EYGA 3SIPB 2UUCJ 2HK2A 4WFYA 3QO9B 2DHGA 3OW2A 2ZWPA 2XEXA 1EOVA 4F8MA 3DRYA 3RLNA 4DV4J 2MSSA 4QPTA 2MKHA 3PYDA 2HCFA 3EQLC 2G9HD 3QB3A 3J7YI 1HR0Q 8ICFA 1SJQA 2IC3A 1FX4A 2VQFL 2WB4A 3DWQA 2RDDA 2JZBB 1FFUA 2W2NP 5L1LA 4ZN3A 4J9KA 4PMBA 2PMWA 5ETRA 3PMNA 1LV5A 3K0JA 3CF5Q 4P2MA 2VZ9A 1L0XB 1H74A 3CKIB 4I29A 3GIJA 4RW9B 4UB5A 2KJ8A 3QU4A 2AYMA 5CYQA 5KAKA 3VF0B 1Y5NB 3RR7A 2I9SA 1MMLA 4B9WA 4DZ6A 2UV8G 4FNIA 1N52B 1KQQA 3GTMB 2JK8A 4K4IA 4V19X 2CVIA 1D5ZC 4APVA 3PG9A 3RZDB 2DGSA 5HJXA 1STNA 1J2MA 4WWSA 1N61A 4CF3A 5J2MA 4A8EA 3O3LA 1LYLA 3O44A 3P96A 1E2WA 1LT5D 2HFOA 2RA4A 1X4EA 5M2PA 4Y2TA 3W1GA 1H9KA 4P74A 4UAUA 2DJWA 2R7OA 1VIXA 2JA7B 4GN3B 2G0IA 3H5YA 1VJWA 5M5WH 1U4PA 1JK9B 1QJHA 3SE0A 5D3IB 1EB0A 1FDBA 2OPRB 1KHWA 2ISOA 2XNQA 3LP2B 3TZZA 5J2HA 3BQ1A 3G6YA 5KYLA 3RN2A 4A3IG 3AQPA 2F63A 2B6AA 2GC8A 1WTQA 5IIIA 1ZAWA 1RAEB 2J6UA 1SNDA 2BCUA 1HQEB 4LR7A 3SGIA 4XIUA 4Y7NH 3H25A 2YTCA 5KRUA 2RS2A 3OMGA 2HFSA 3O6QA 4X62Q 2YNGA 1CJKB 4ZKBB 1XSPA 4C1NI 1PCAA 4DQSA 7ICIA 4PWDB 2EYLA 5E33A 3H20A 2KHIA 2RT3A 1UFWA 3AM9A 2GGPB 5LSRA 4KIAA 3WOFA 3OW7A 3K8AA 3M9MB 5CR3A 5J2CA 1UPPA 1I4PA 2YB1A 5D3DA 4YB5A 2V5HG 4OWTB 2G2YA 2VC0A 4K0KQ 1EYDA 4J9PA 4DV7Q 4JI8J 1ZQLA 3OTOQ 1QVFR 2ASLA 3M05A 5IFMA 4A8MP 2N4CA 4PKDB 3PSFA 4PZVA 2KVIA 1ZQKA 4IUPA 4A4IA 3Q23A 1FRMA 3SK5A 2YNFB 1YI2S 1UE1A 2H65B 2M52A 3QBCA 1NDKA 4FFDA 3MXGA 3FKIG 4B3RQ 3KBXA 1F9RA 1MWZA 2OPSA 1Y1VH 2ZC4A 4N41A 4ECYA 5KG7A 4DR2J 2F9JA 3C1YA 1G6PA 2HQGA 4YWMA 1AFPA 4LF8Q 2A8VA 5CORA 3M8ZA 1U1PA 4NL9C 4ENOA 5JEAJ 4X62J 4F0HA 2VU5A 2V67A 2GIFA 4B3MJ 1XN9A 3C66A 1XTZA 4FZLA 5HQLA 4QIWD 1F9EB 2JEBI 1SLJA 3DLJA 4LF7F 4M5KA 3PF5A 3PCOB 1I4XA 4FKXA 2N1RA 3NMRA 3V4IB 5HROB 4DL4A 1YHQA 1PC4A 3WDOA 1D8BA 1GHJA 2I0XA 4Q7AA 9ICHA 1S6OA 1REGX 4RG1A 5BN5A 1VJQA 4EYHB 3O0FA 3AAWB 3SR1A 2FINB 2ZWOA 1K0SA 4YMNA 1J5EQ 3SSQA 2PMZE 1T11A 1VQYA 3E01A 4O0NA 4ZPDA 4ZJLA 1MU2A 3HKWA 4LF5J 1UVJA 6FD1A 3LTOA 5JOBA 3OFEA 4BWJA 2AX0A 3IV6A 9ATCB 5IYCG 1G7CB 1VC5A 2LU1A 7ICRA 5DKWA 1IBKJ 4LSNB 1VLOA 1YJRA 1FIQA 2H3EB 2KMDA 3DHXA 1N5SA 5IILA 2HRUA 3M30A 2BOSA 2W01A 4P2FA 2LXIA 4M2YA 4C8KA 2BZFA 2FHJD 9ICAA 4PXEA 1NR2A 3K1ZA 3J80i 1Q16B 4IS7A 1XSNA 4RT3A 3I4LA 1UKUA 2BYCA 4X62L 3DEOA 3KK1A 1HA6A 2WF8A 3BKFA 4IDKA 2KJXA 1EZ6A 2OXPA 5ETLA 1X8DA 5GAGI 2I38A 4IOCQ 2CKWA 2HQIA 3LK9A 1HZBA 2BCSA 1V3RA 2VFVA 2E2HH 3MEHA 5FLMH 1E6YB 2K5HA 4J37A 4IZ8A 4M5HA 4F67A 5IE8A 2W11A 5C3EG 2C2MB 4DQIA 3TUIC 1LUZA 4JWNA 3TA2A 2C22A 3WK4A 4CE6A 4FE3A 3KFUF 1SV0A 1RTOA 5M3FG 4ZVSB 1B50A 1RTIB 3W61A 4A3FB 4DPGA 5JVGQ 2CVEA 2YKPA 3HX9A 4A3KB 3ZNUA 2E1CA 1Z7TA 3W9HA 1UA1A 4QYRA 1ZD3A 2V34A 5LL6S 4I6YA 4OJGA 2KJVA 2J8SA 1PVOA 2FDNA 3DOLA 4MHEA 1RDPD 2PKEA 2XULA 3UM9A 4OI3A 3KLGA 2MJ8A 2HSZA 3I4MH 3WK5A 3OGUA 1N32Q 2AWOA 2JA6B 2Z2ZA 4AFFA 4NLKA 2VPWB 2V4JA 4DX8H 5GQOA 3AB4B 4WIQA 5ELFA 3SENA 1S1WA 3OPXA 3I4MB 3AMZA 5AI9A 1WEYA 4OJOA 5D0HA 2W24A 4R8UB 3LPYA 3LWLA 3P7JA 2ZJPQ 3CCLS 4M5LA 4DV1F 1TWHB 1KHVA 2FJEB 3PM9A 3AFGA 4A93B 3PYGA 1VQFA 5CV7A 2AYBA 4DV6J 4A3DB 1TY2A 1FNXH 2HOQA 5ETQA 3SDEB 1VBXA 2NQPA 3KK2A 4R1JA 5GMEA 3GFYA 1FX2A 4TY8A 2Y1LB 3CJ8A 2DR5A 4K5WA 4C80A 2FJXA 2G5HB 3A0HU 2GX8A 4OX9J 3A13A 4QJFA 1R3NA 1G2TA 3VQSA 5KT5A 3MM7B 5HLFA 4U8VA 3BZKA 4GKJJ 3M6WA 3PZPA 1S1TB 3GV8B 1RT5A 4TYBA 2OTLA 1DQ9A 4DUYQ 2DNQA 1IQTA 3VYRA 3JQKA 1SE3A 3SEBA 1RBOB 9ICTA 1V1QA 1ZQSA 1Y9OA 4OZ3A 5AFWA 4G6VB 4LR8A 4IQMA 3BZQA 2BE7D 2PN6A 1UETA 1F9QA 1FD8A 2O01C 4K59A 5KG0A 1DRZA 1WHYA 5KNIA 1G91A 4C48A 2E7WA 4RNNA 1JRPA 3FHWA 1ENCA 1ZQMA 1ZQHA 2B21A 3PMFA 2I07B 5EJWA 4C3LA 1FEHA 4HSPA 3ZTOA 3P6YC 1FI4A 4WE1B 3RJEA 4A3FG 4N8NA 4WFAQ 1A3UA 4I2FA 2MHNA 2DB1A 3OBIA 3V6DA 2XRSD 1NZBA 1EY4A 2VANA 5JJZA 2KCTA 4AYBD 3S1MH 5GAHU 3AQQA 2NXCA 1FDDA 4XDXA 3HKZE 4KHPJ 3EZUA 2UUCF 1HL6A 4PG7A 2K1RB 1FJGL 3D0HE 1O8BA 1LNQA 1BLUA 2K32A 2YQ3A 1VQAA 3HD2A 4ZVTB 3SD7A 2A1BA 4GO7X 2W4PA 1IBLJ 2PIIA 4DV2F 2E44A 1I94J 4I27A 1PA6A 5JTIA 1WTOA 1B22A 3QYYA 2XM3A 1ZPVA 2F9DA 1J2VA 2JFDA 2W04A 1C4QA 1RT6A 3QT7A 2FTRA 3F8TA 1R6YA 3S15B 3HSGA 1ILQA 3HOWB 1IBKL 2JLGA 2V94A 1DZ5A 1S59A 3RLFA 5C2GA 4NM2A 4KKSA 1A0PA 2PEBA 5IQQA 1VQ7S 1YTYA 1CBKA 2NVTH 1M1GA 1HHSA 2VFUA 5KFFA 1NY4A 4C3HH 1IL2A 3TAMB 2RU3A 2MSNA 3MR2A 4KD3A 4IR9A 4QIWB 4YG2A 1GUNA 2DBYA 3KDOA 2ZH6A 2C2ZB 2FGOA 1QZHA 1S8OA 2DNGA 3J7ZT 4H0LC 2YY6A 3C23A 1CLFA 1AH9A 5IYBG 4C3HB 1MSGA 3IAM9 1GTHA 3ZJYC 2H51B 1P1LA 4RT2A 4NLDA 1B0VA 2IPKD 4EMDA 3IG8A 5EPJA 1Q86T 2WINB 4A3BB 3T53B 3K5LA 3HOWH 4IUFA 2QLXA 2XMKA 2DKXA 6FDRA 4FXGC 2MKKA 3CSKA 2R92G 1MKHA 4BBRB 4Y7NB 3CJKB 4HACB 3TJ8A 3HOXH 4A46A 5L9NA 3FUYA 3TNVA 2F0DA 1BGXT 5C4JH 4NXNF 5H2FU 1GMVA 2R7UA 3T19A 3BR8A 1ENFA 3WK6A 3G4SA 4EZ9A 1EU4A 2Q8TA 2UUAL 2XSFA 4KGVB 3VGSA 4DUZQ 2FMSA 3PX4A 3MZIA 1VMPA 3VVUA 2OUGA 1BD6A 3K5NA 4DX6A 2VG5A 2P8IA 1QQ7A 3OTQA 2OPQB 1ZEQX 1JJ2A 1RYRA 2KA7A 4HIOA 3TACB 2JHDA 4X6AH 1R31A 4IG0A 1ZTWA 2BE5C 5MAOA 3KLSX 1T3OA 2F0HA 4KLGA 1KDAA 4R8IA 2F65A 2HNZB 3MMCA 3ADAC 2Y0SF 1EQ0A 2VFSA 4DCJB 3A8IA 2WTFA 2BA1A 4J9SA 1RT3A 3MECB 2NWGA 5J0SA 2CQCA 5U47A 4MF2A 1NI3A 1PH3A 4LF8F 4DV6L 2FPHX 5J2AA 1GK8A 2G06A 2VQEJ 1SMYC 1S4EA 3LP0A 3FPUB 4F3QA 4O3NA 4YY3L 4OIKA 9ICWA 3GTMH 3M4YA 8ICUA 3OTEA 2E8GA 3KLEB 5SZTA 3MM5A 4JI2L 4DV5F 2RB7A 5KFGA 4RUHA 4DUZJ 3A56A 5HO4A 1F5BA 4MAKA 2QTWA 2VFTA 2XY7A 3NNAA 3PNCA 4YFKA 1STYA 1G51A 1RM6C 1OSDA 3V6JA 1CSQA 2PNHA 1TKXB 3QAUA 5IIOA 5AKGA 7ICVA 1XEZA 2VPXB 4F4WA 3R3TA 4RQ1A 1LT6D 3THTA 5KFUA 4DZDA 5J2QB 3UDFA 4C7ZA 3BSCA 4GLXA 2E8PA 2CA9A 2KB2A 3VQTA 3RAMA 2YWKA 4DL0C 2QF7A 2LECA 3LW5C 1EQTA 5K9FA 5J0YA 4C8YA 4CO2A 2EKYA 4A3GH 2F0KA 4KMUC 2GHVC 3J81Y 3UCUP 3I6PA 3EBEA 3IG5A 1FNOA 4A8XA 3KLEA 2CXYA 3BBFA 4K4YA 1TWHH 3W3SA 1HNWF 2QJ3A 3L2PA 2NPFA 1S72S 5MLCV 2G2ZA 1I4RA 5AI5A 4EX7A 2JOQA 3U1NA 4UUWA 2HNYB 2NV3A 1HJPA 2N8NA 3EDRB 3CYMA 4M8AA 2HFZA 4OWXB 1S99A 3HOYG 2JEGA 2G0JA 3M1VB 5B09A 1TWGB 4G1PA 4X66J 4QY7A 2WACA 4B3SL 4ZHRA 3BBBA 4V19J 1FKAF 4WTOB 4LIRA 4EFAC 2ZH2A 3LOUA 3AU6A 4ZJOA 1HNZJ 1ZQEA 4BC7A 4RPYA 1A0IA 4MFFA 4DWIA 2FE9A 3I72A 1AW7A 3D68A 3BSNA 4WTYA 4CIOA 4DK0A 4NA2A 4ZOSA 5AXNA 3RAQA 4ZVUB 2RRAA 4JB3A 2W43A 1KP6A 4B9XA 1CTMA 1WHVA 2K5QA 2IY5B 4S0MA 1SNCA 4ZLLA 4TN2A 1ASYA 4LWCA 2EBGA 1SKSA 3BEGB 1LTRD 3M2RB 2Y8YA 2TSSA 3KF8B 1B0TA 2M8DB 4ZIVA 3DXBA 2KSOB 3J81U 2UXCF 5DZ7A 2HVEA 2DR9A 1C1BB 2EYFA 3H0GB 2ZJ8A 1YNJD 2CW0C 3SDEA 5LM7E 1DXMA 4CT8A 1Z2LA 1HR0J 4ANCA 1F2ZA 1CZWA 2QL7B 1LFPA 3HZEA 2QL5B 3BJYA 2BANA 2EZYA 4L75A 3VDYA 1RF2D 3FMCA 1ZQVA 1KN6A 3TQEA 8ICYA 4DSIA 2MQMA 1NNXA 1X4GA 1S1VB 2E2JH 4NOHA 2I5JA 3K7AH 5M5YB 2I2YA 3RGIA 4GKKJ 4ED3A 2NRVA 1D9FA 1I1GA 2RRBA 1XR5A 2WHEA 1SWVA 3ZYYX 4AQYF 3LYSA 2NCKL 8ICVA 5IT9L 1PZID 5CV9A 2LQJA 3TX0A 2UUAJ 2DNOA 3C1EA 2MZRA 2Y9UA 1EQQA 4EGLA 5ALKA 1CQFA 4EYIB 3D7SB 3UN5A 3KMQA 4ZIWA 3I2ZA 3IFDA 5JVG3 4P6QA 3KLGB 1ZXIA 1WTXA 2GH1A 3CQZH 5L37A 4BBSG 2BGWA 3GTLB 3T1AA 3EROA 3G71S 3PY8A 2RQKA 3KJNB 1QQ6A 1KN5A 4NASA 4NPSA 4WE1A 2EFPA 3POTA 1D5XC 4F5QA 4OO1G 2B43A 5CB1A 1FXDA 2K50A 4DSEA 3CMEA 7ICHA 2RVLA 1ZQWA 5ALGA 2I6WA 3OJSA 4OJ5A 2H1EA 2Q2TA 2EAMA 3IRXB 1OUQA 2K60A 3SXLA 4EQNA 2JDJA 2C3PA 2CDQA 1ELOA 2DNLA 1Y0HA 3R7NB 3S17B 1XNQJ 4Q44A 3GILA 5C42B 3EPIA 3CC4A 1BCPF 2K8BB 2KEDA 1AZSA 1PAEX 1WC3A 1RISA 3KLHA 3L7OA 3VZHA 2DT9A 3WZ0A 2MU2A 2W54A 4FNHA 1LWFA 4U7UK 3JYTA 1CJUB 1GUWA 3K17A 4FF1A 5ALOA 1HI0P 3KD3A 3FFIB 5B0GA 4XT3B 4H4OB 5L1JA 3KHGA 3A8KA 2GV1A 5D0EA 2VJ4A 2AMCB 2DXFA 2NUHA 3OSPA 1GM5A 5A8WB 3UD4P 3M7DA 1S3OA 3I82A 3J81L 2HHSA 5C4XB 3LWMA 3ENVA 4NXNL 3VTIA 1OXXK 1QCBD 2IRYA 2F0QA 1IN0A 1FKOB 2KJWA 2YKQA 4ICLA 4RGMA 1SJED 2EXUA 2F0WA 2BR0A 2ZIVA 1EJ7L 5I3PA 4KHPF 2FJ2A 2FVQA 2U1AA 3PW0A 3DN9A 2PFDA 1I6VC 4X65F 3FDSA 3E9IA 1PTOH 3I9V9 2B4VA 3QNWB 4DXLA 4US8A 5HI7A 2LYVA 1SV5B 2HSEB 1RDFA 1WOOA 1ZQUA 5CYUA 5AKXA 3ELHA 3EJMA 1B3AA 3HCXA 3V6DB 2OFGX 1FHTA 2HT1A 1AEXA 1EQRA 1RWUA 3F56A 3Q2TC 2DUDA 4L73A 4IUVA 3ZTRA 1T9HA 1A77A 4R5PA 1GXDC 5HP1A 1Q1EA 4QWDA 1XSLA 4UAZA 3KZIU 2NN6H 4DV4Q 5C4HA 2K01A 2Y0SG 2YU9B 3AJDA 4YMEA 4CRXA 2WBRA 2ATLA 3LF0A 2ZIWA 2YX4A 3ISBA 2C5CA 1BBXC 2EBEA 2KV2A 4BCAA 2HYIB 1ZD5A 2J6SA 1N4LA 1L7NA 2CPYA 2KG5A 4ID6A 3FBCA 2CQAA 2AXTU 4PQUA 1JR0D 3CHBD 4A8KA 2OHFA 2IA0A 5JRTA 2VFRA 4KLKA 2HG4A 4NLRA 1PFSA 5G0RA 9ICQA 4A3LG 2PT0A 3DWPA 4C3JB 3S1QB 1MN7A 1RBAA 1H3DA 3V7KA 1HXYD 4IRCA 1VQGA 1RCVD 2WAQE 1HNIA 2VUMB 4PZNA 2V8PA 2HVZA 3VC8A 2B56A 1BQNB 1JLEB 3Q8SB 4DV0F 5ETSA 3TADA 3CVKA 3SSRA 4KMUA 3W2VB 2UXCL 4NZ0A 2LHTA 5E3PA 3NGSA 3VR3A 2YU9H 2ZG6A 1VF7A 2Z2YB 4PHAA 2JRSA 1VHFA 4K6LA 3WHIA 5EQ0A 1TS5A 3N97B 1SL0A 5G5GA 1X65A 4BY7H 1AE2A 2F2AB 3OTOJ 4JI3J 3FRPB 4PG5A 2WW4A 2ALZA 4KITB 1S57A 4ID5A 1WJ9A 3RW7A 3MR5A 4GMKA 4L3NA 2JQOA 3I31A 3CTRA 4A76A 3BQ2A 1Q3LA 1ZQNA 2IVFB 4Z37A 3NQIA 3QPIA 4ECUA 2VB2X 5L8RC 4YIJA 2Z7JA 2HS0A 1N33J 4JBMA 3ETRA 2UXBL 4IKAA 1F2HA 1HR0W 2LKYA 1STGA 3N5FA 2JEFA 4P72A 3AMUA 4YR2A 1EYAA 4J5OA 4JI6L 4NM1A 3O13A 7ICSA 4PXBA 1XQIA 3J7YU 3PRDA 3QLHA 8AT1B 5DDRC 2GA4B 3Q8RB 1FWLA 4HTIA 1ZOLA 2F0LA 2OCEA 2NZCA 4A3EB 5ITHA 1S5CD 1VQ4A 1VQNA 4WORA 3I4PA 1Y7PA 3T41A 5IGEA 2BDOA 3ETLA 4A3MG 3GE9A 2W03A 3UD3P 1S4ZA 5CJ7A 1A6XA 1ZYQA 2BQ3A 1M1KC 1VIOA 3HOYH 4I2QB 3FSXA 1PH5A 1SIWB 1JCKB 5M2UA 2C3OA 1M5KC 3PSPA 2IAJA 1HQRD 1RAFB 4U6PA 1DURA 3UPQA 2JYOA 4NLTA 4WFXA 1T5EA 1Q4RA 5T14A 4A8SA 1MGSA 4ID8A 4Y00A 1TK8A 4G7HC 3SMZA 2DGYA 1TKTB 2FMPA 4GXIA 3H2VE 2KVSA 1V9PA 1SMXA 1IKXB 5D3GB 2HVIA 3M7NA 2GGPA 3QJLA 4R4QA 2XWJB 2HMIB 2QA4S 2ZM6Q 1Z1VA 1VGYA 1KNAA 3HT3A 3ISDA 4NYPA 3X3UA 5KAIU 3OV7A 1U4BA 1XNQQ 1BE4A 3BS5A 2VC1A 2A68D 3GTLH 3J7AV 4PWUA 2F1HA 2J76E 2V2VA 3MECA 2JVRA 3R8BA 3OIQA 1X42A 4NA1A 1K0RA 3TDQA 3NELA 1BQXA 4UY8C 1CSPA 1XNSA 2LFVA 3DXJC 3FQLA 1HRJA 1RT7B 3S14H 2BE5D 5BYRA 2AJ2A 2QMWA 3MM9A 2ZH4A 8ICSA 4R63A 3BZCA 4MYUA 3N6MA 2XO7A 3TMEA 1WSRA 9ICSA 2GNKA 2KHSA 3UE0A 2RF4A 4YOEA 4WJ3B 1X4CA 2Q0ZX 2ZOGA 4P2XA 2F0PA 3WC0A 2V2ZA 4PG4A 4A3KG 5E3AA 5J2JA 2YKAA 4DEZA 5DO2A 4Z6EA 3PR5B 4JI6J 5D0RA 4C2MB 5GROA 3Q2SC 4HT7A 1UEUA 2QX0A 4ES2A 3IO1A 4UAWA 1DQAA 1WCMG 4AQYQ 4B3TJ 1KD1T 1SI9A 1HWIA 3IWNC 4ALZA 3M9OB 2CQOA 1LT4D 3NEMA 1D1KA 3C29A 4TNOA 1PRTB 5DM73 4FP5D 4H7BA 3DOKB 2ZD1A 4F5PA 2FHTA 4RH6A 3NEKA 1PH7A 2M9NA 2WOMB 4DPUA 1LM0A 2GVZA 5H1SV 1ZJNA 3D31A 1S1UB 3JC66 4DAYA 4OHZA 2FVCA 1KXLA 4FNFA 1VQMS 2JMGA 1Y5IB 2RRNA 4ABNA 1A6SA 3ISCA 1U45A 5IYDH 2CHBD 5ELEA 5J0RA 1WC1A 3EVOA 3H7HB 4USAA 2V8HA 1LWCB 2PPBC 3CEDA 9ICLA 2WIIB 4EELA 4LF4J 1HNZL 4TSSA 2VL6A 1SJHD 1GTEA 2R92H 4DR7F 5KEEA 5GMDA 3K81C 2MUYA 2FC9A 2QILA 2R9LA 4DPTA 1Q8IA 3V72A 3CRXA 2EZXA 3FSYA 3R6GB 1L7MA 2F0TA 2G1HA 3K80C 3S24A 1SC6A 2LFNA 1NOMA 3NGUA 4EK2A 2OEMA 5HP4A 4XYOA 1A62A 3CDBA 3IBCB 4JP8A 1QTNB 1IYUA 2ZXOA 4HTHA 2NO4A 1H38A 1ZQJA 8ICTA 4ZITA 2EZZA 3CCSA 4YD1A 3J7AN 2QFJA 2FVPA 3MXNB 1I50H 4BY1H 4GLAC 1BCPC 3D2WA 1V1PA 2OTJA 1TL4A 3FKIB 1PVPA 2EFNA 3CD0A 5DAUA 4KY3A 3T5LA 3N6LA 4NPOA 3S1MB 3GDEA 1AA1B 2OF1A 4KHPQ 3GJQB 4BLGA 5I3UB 4B9SA 1LABA 2UUBF 2CQHA 3EGWB 2AWZA 1B8AA 1JROA 3SDZA 1RTHA 2CYYA 2YY3A 1MJEA 4MEYA 2NBFA 2QRRA 3TZUA 4L8JA 1U8SA 3G4SS 5K36G 2YKNB 2M2BA 3BYPA 1VBZA 1UEKA 4ES3A 1PRTF 4UOHA 1JE5A 4OYOA 4QYZK 1DQ8A 2UUBJ 1L1OA 3TADC 2C1EB 2ASBA 3PO2G 4A3CG 1DCZA 2IX1A 4AYBF 1WACA 3OL6A 4WYWA 3RH4A 4LFAJ 1UMJA 1E2VA 1HKAA 2MQLA 1M5HA 1XWEA 2A1JB 3P3DA 4JYAQ 4WP8A 1TAQA 4JV1A 2CPRA 4DR3J 2MLYA 1RAOA 1R43A 4UB2A 4IALA 4FDFA 5HQMA 3RZOH 1JLEA 1OSCA 2QA4A 2RAQA 2HGMA 3PIPA 2WKDA 3PO5A 1QD1A 5EWGA 3L4BC 5ETPA 4I28A 4CO4A 3KZXA 1DFDA 4M1UB 1N5TA 3DRRA 4JI4Q 4GKKQ 1HWUA 2YH0A 3VV2B 4GN5A 4FPIA 1T5XD 4B17A 2RMLA 1S79A 1FF2A 3QRQA 2DHXA 1VDVA 2YMLA 2ZM6J 1BUVT 5DJBA 4IFDG 4BBRG 1JI7A 2QMUB 5BOLA 3CJRA 4QU7A 4RGTA 5ALTA 3MDFA 3HO1A 1NJXA 2XI2A 4DV1J 1BPZA 1GKHA 2IX0A 2PO4A 2OD4A 4ZVGA 4WJ4A 2LY7A 2XG8A 2P6RA 3KLRA 2FMMA 2EWHA 4TQSA 1EOTA 5G3LF 1TV9A 2PDAA 4R4OA 4EEYA 1X3GA 3I7FA 4AYBC 1SXTA 5HJYA 4RW6B 3EUB2 1RABB 1WEXA 2ADBA 1HUOA 3ERSX 1VRUA 3RJJA 3KDNA 1NKBA 4PQAA 5KFZA 2EJFC 3IR5B 2N7CA 4UASA 2XVSA 2QE5A 4RNMA 5L38A 1S1XA 2KFNA 1B0PA 5A0YA 1QB5D 1AUDA 3QLHB 4IPHA 1OTCA 1Z3EB 4K8JA 3PJWA 5M3MH 2NVQH 3DM3A 3ZO7A 5T7LA 1K0VA 4PPDA 4CKCA 3I4MG 1Q79A 3SSSA 3MPDA 2E2HB 3MABA 1VQIA 4P52A 4YHHF 5ETVA 3SFUA 3F41A 2DBBA 4ZP9A 3Q8QB 4X62F 1HNIB 2VL1A 2F1FA 1I94Q 1MI2A 4WU3A 3M6ZA 3CULA 4CT9A 4WP9A 2G0AA 2BABA 3QZ8A 2UU9L 3PEJA 4ATNA 1IBKF 1QE1B 3LPEA 5IGDA 1NZ8A 5M3FH 2VG7A 5IP9G 1X66A 3H0RB 1J27A 1RHRB 1BQMA 4NEYA 3S6JA 4N7TA 2BQUA 1B53A 1JJ2R 3H0GH 2FJVA 5LMUF 4KLQA 2XIDA 3I96A 4I65A 2RF2A 3PRVA 5HP1B 3D2NA 3QFHA 3UMBA 2A1AA 1TKTA 4TQRA 1FNWA 1U2RA 2CPEA 4Z7YA 1BY9A 5A2QL 5IP7G 2F0MA 4RZRA 1X6OA 3IM9A 3C16B 2W9AA 4DFAA 4I2GA 1A76A 3W64A 3QU5A 1HZCA 2X6LA 3QR8A 1XMOQ 1BF4A 4DU9A 2ZUCA 3KYLA 2XHCA 4X4NA 2QCPX 2FB0A 3CCJS 2ACYA 2R8KA 4XYQA 4KHPL 3PJ9A 3Q8UA 3VGTA 4QZIA 4ZH4A 3RG6A 1HQEA 3UNGC 3M8QB 1CT1D 1ZM4A 2ATCB 3CP0A 3ET6A 1Q95G 1QAXA 2ZM6F 3RZAA 3I70A 2ESEA 4NW2A 4ULLA 4NXMQ 1Q8KA 2AJ1A 1O0PA 4F93B 4EQOA 3JAMU 5EPLA 2Z8LA 1YBUA 2UP1A 1U4LA 5HY6A 5G5HA 4I2PB 3K8VA 4QIEA 2IDEA 4IG0B 4ZPBA 1C1CB 4NWIA 1JX4A 2VUGA 7ICTA 8ICNA 5GADI 2MSTA 2N78A 3TX8A 1TS4A 2YKOA 4OJHA 2A73B 4O3OA 1WI5A 4DPOA 1NK4A 2C3YA 3C6UA 1N6QB 2UU9J 1L2FA 3AUOA 3MCMA 3U7JA 3STBD 4DV6F 2VG6A 2QSFA 4URQU 1QM9A 5EX3A 4X64F 3RZOB 2IM2A 1XYIA 4HDHA 5CQGA 4KX5A 3BM7A 3S6EA 2PZTA 1WWUA 2KN4A 4TLRA 3JTNA 5AHXA 2OI2A 1HA1A 4RUBA 3L7UA 3O5TB 2K3KA 5LMNJ 1Z19A 1MSWD 5T41A 3AOCA 3VCBA 4KN4C 3TS2A 3CPFA 1IUJA 1RT1A 3AFPA 3ITHA 4EBDA 3K6OA 4O23A 1CSJA 2ZXHA 2H9ZA 1N5YA 2JXMB 5LJ5Y 3H90A 1FVSA 2KKHA 3VALA 4I7FB 2E8MA 1ZM3A 1RT4A 3GCXP 3D4WA 2CADA 4PRFA 2B2TC 2HIYA 4KFBA 1AT1B 1RT7A 4HAEA 2Q1LA 4IPGA 1SZPA 4RWXA 1CS4A 2K33A 2VICA 1RPLA 4ZPWR 2YNGB 1CJKA 3M32A 5LL6X 5GAEI 4DV5L 3TFRA 2LEPA 2BJ9A 5ETMA 5GAGU 3P45B 2OKQA 2WFWA 1HNXL 3NRBA 4RX6A 4HDGA 2CVRA 3PACA 4RCOA 4PZ6A 2B0CA 4A8YA 2JA7H 2Z6KA 4DX5A 2I1QA 1S9GA 5F41A 4QMGA 4BY7B 3V7JA 2F0NA 1RTJA 5KT2A 1EHWA 2HQFA 1JLBB 2HFVA 1FJ7A 3MD1A 1YBYA 4C3IG 1RWKB 5C4JB 5M3FB 4F72A 3D4RA 3NXZA 5C25B 4KT0C 1WKJA 5E41A 3GG1A 2P35A 1X9MA 2V4DA 2VUMH 4MKBA 1PTOF 2AYGA 4PQXA 5I42B 5H9FK 3ONAB 2AKWB 1NXIA 2G9OA 4C3JH 4C11A 1WFQA 1R89A 2LYAA 1EUJA 5EPKA 3RJGA 4H4KA 3P1HA 4K4GA 3RBDA 2QEXS 1LWCA 5I9PA 1RKNA 2FPLA 2YNHA 4PV1C 1WF2A 4DOAA 2G07A 3TZXA 4V0BA 3WC2A 1EFWA 3FK4A 1K8MA 1E24A 2EW9A 1FJGF 5KG2A 4ZUIA 2ZHAA 2D2CC 3EPGA 2KI2A 5KFOA 2ICEC 2HVHA 1HZ9A 4XO0A 3PX6A 2AP6A 2KHQA 2GJIA 4Z6DA 2DKOB 2KRBA 4NI2B 4I6AA 3V7LA 2AD9A 4IFYB 2B7CB 1NAQA 4JYAL 5C4XG 1BCPD 5AKLA 3HMJG 4RA8A 2KL8A 3H8JA 5F0UA 2CNNB 4J1MA 3Q86A 3NAIA 2BRKA 5BR8F 3K59A 2IHR1 1SB3C 4K5XA 2LQ5A 1TL3A 4CH0S 1KQSA 2PI2E 2EY1A 2MNAA 1GEHA 2V50A 1VQLS 4K4UA 2KCNA 3W5YA 4ER8A 1W2IA 3U1MA 2F44A 4I2JA 4I4BA 4MIWA 5AI4A 5L9XA 1XNRQ 3NKYA 3HOZB 1JORA 1PGZA 4EO6A 3JAME 4JI5Q 3VWSA 4E6IA 3I0SA 2JSXA 1IBLF 1BWVA 2DH8A 1I6JA 1VMCA 2K4EA 4NI2A 1SXLA 4F3OA 2V2KA 3FZ2A 2IWHA 3G6EA 2VXWA 5KFLA 1EY7A 4B3RJ 3MEEA 4QIFA 1KEKA 3IS9B 5HR7A 4DV2Q 1JT8A 3U02A 5GADC 2I0QA 5C44H 5FKAC 1C0UA 1U5KA 3CCZA 4LF4L 1FKPA 1R0AA 4US9A 4I7ZC 5T1IA 3QEAZ 4CLTA 4C97A 4LF9J 5DNFA 2C3UA 1PFMA 5J0OA 1G4CA 3HS0C 2DJGC 5E4WC 1WWVA 1OXJA 1RI7A 1ZQYA 2KD1A 4C3MA 1S5DD 3GFHA 3V81B 3D6TB 1SNMA 2NYVA 3JPOA 2XSJA 1X31C 2JR5A 1NDCA 2ZJPA 2A1JA 4M04A 1JOOA 4LSLB 4OYIA 2PMZF 1SBRA 4R0EA 2IRUA 5AE1A 2M70A 3FCVA 1UVNA 4RW4B 1F0MA 5HBMA 1ZQAA 1N5XA 4KY6A 3BS1A 3CWJA 4ILWA 2W9CA 2JX2A 3M8PB 5ETOA 5K20B 1Q53A 2AX1A 1I94L 3HHLA 1SL1A 2CJYB 5A0LA 3BN7A 3UI2A 1VR6A 1FVIA 3AYHB 3O1LA 3PW2A 4N8OA 5JMNA 3LP1B 4A3DH 3DYAA 2B2WA 2DISA 2Z58B 2YPZA 1P6TA 4CLSA 2ZH1A 2BE2B 2H5IB 7ICPA 3NG8A 4OX7A 1PXUA 2GO9A 3CQZB 1YJ7A 2IA6A 4CO1A 2FVRA 2L0CA 4ED6A 4JI4L 4DR4J 2KKPA 1YI2A 1REVB 3UQ0A 5IT9c 1S76D 2G9DA 1YVCA 2PMZC 2Z2MA 5J2KA 4R0JA 5CZXA 3VAFA 4ILRA 3N4WA 2QN6B 3KMSA 2XN9C 2IHFA 1Y88A 1GUOA 4HMIA 3HX0A 3RB4A 3DOMB 2PA3A 4OGQC 4NV0A 1SBBB 2P2CB 4NLOA 5F8IA 4TKOB 1YJNS 2SEBD 2UXDQ 1LK7A 4FBUA 1S1TA 4H44C 2KHVA 3K7UC 2MFIA 1MN8A 4KJNA 1UJ5A 5J0QA 3KWMA 2R92B 4JI3Q 3TEGA 2RQMA 5FLXY 2ZKUA 1CJTB 9ICKA 1G8ZD 1ZQBA 1XMOF 1BPEA 3QFWA 4ZK7M 2KG0A 2JGAA 4GLVB 1VS0A 5BYSA 3KUPA 5CAAA 3JSYA 5FO8B 4P2HA 4KV8A 4CH7A 4RL1A 2PW5A 1UCNA 1ENAA 3AXMA 4IH7A 2FD2A 4YWLA 3FRZA 4JV2A 3EZ5A 5KFQA 3R97A 2VA3A 3I32A 4DV0L 1U6FA 5DETA 1NHVA 3A3NB 2PI4A 5KNDA 4GZYC 5F8MA 3MDAA 4USWA 1QAJA 3QXGA 5BN4A 5KFNA 3GTJH 1TFRA 4MK8A 5ELCA 1RUSA 8ICMA 4CDGA 1TKDA 1JJHA 1PZNA 4I2DA 2CFMA 3QNMA 3GV6A 2XMTA 4TUPA 1U1MA 5CP2A 1R8HA 3SYZA 4JK1A 3IDWA 5E3FA 3CD6S 3R5GA 4NLUA 2D0OA 2RDFA 2A6OA 3SAGA 4IUQA 2LVWA 1EKSA 2BKPA 1VRUB 2B2YC 3IWLA 1D2BA 4F04B 2GAGC 1Q3VA 5TISU 2B51A 2Q2UA 1AUSL 1UWBB 3E0JA 1SWWA 4CNQA 8ICLA 4LK1C 5GTIU 4YHHJ 1RLCL 2HEKA 3RUBL 1FXLA 5JU5A 1KRPA 1ZZNA 4UUXA 2L48A 2KG1A 1WKLA 3WK7A 2ROEA 3AQFA 5CRXA 1I4GA 3H40A 2HWHA 3M6XA 5J2MB 4QW9A 1LVHA 2N3SA 2HNDA 2UU9Q 4IOAA 3IP4B 4C4TA 1GMWD 3UDCA 3HPOA 4M5IA 3RJIA 3M3YB 2MY7A 4CDDC 4DL3A 3KTQA 3MPUB 1NJYA 2VG7B 2GLEA 4L5RC 4ME3A 1Y1WH 1JMTA 1QZGA 2ZBPA 4PHEA 4M95A 4YY3F 3PYEA 5IWAF 3LP2A 4CNYA 1I51B 2DQNB 3R93A 5HHIA 1VQ4S 4PWWA 1KLNA 4LREA 1NB7A 4X64L 2WF6A 1IKYA 4PUOB 2QLFB 4BWMA 1EP4A 4MKYA 3AJ2A 1QWYA 2QDLA 2Z4IA 1R8CA 1GX5A 1UVMA 2X1FA 5CH7B 1LXNA 2YMMA 1HYSB 2AJ4A 3GMGA 4F5RA 2W2QP 2ZIUA 4NCBA 1B1ZA 3O2IA 5EBDA 2R7FA 2WCXA 4M8LA 3GTGH 2UUWA 1IR1A 1S6QB 1WTBA 1ZD4A 3VGUA 2UXCQ 1HBUB 2DPIA 3G86A 1VMBA 1PTOD 4BS2A 4R64A 5J1PA 2KM8B 1K5OA 4HIDA 1WYGA 4LJZC 3QJJA 2QARA 2UVUA 3TP8A 3B8HA 2PCFB 5DBAA 1FEEA 5F9LA 2C2NA 2HWIA 3CRKC 3RB6A 3KK7A 4J91A 1JQYD 4OX8A 3ZZYA 4A4JA 1VFJA 4MEXA 1KTKA 4KLHA 4X3TA 1K0TA 1JWUD 3NTHA 1RAAB 3C6TB 4I7FA 2NTTA 1S6UA 5ALDA 1FR3A 4AIMA 2KH9A 2EFQA 4DR6Q 3ICLA 3HLUA 2YQEA 1S77D 2RD5C 3U4VA 5B0FA 8ICKA 2PGCA 4TRDA 1EWHA 4IQZA 4ED1A 1X56A 1HR0L 3C6UB 4K2JA 2E1FA 4ZYSA 3X3MA 2B9WA 1NRKA 4OQJA 1VQOS 3KJVB 1F44A 2IMWP 1FJGQ 1IW7D 5C0XH 3IMQJ 2BACA 1N34Q 3EJIA 1V85A 1DJRD 3TAQA 3BSAA 3DFEA 1J6QA 4FP9A 5J1ZA 4WPAA 2XICA 2MQOA 3OHAA 1TL7B 2EQYA 1WI6A 4Q0BB 2F76X 5C3EB 2KSOA 2A2DA 2NYZD 1DGSA 2B2VC 2BX6A 1UCVA 4L3KA 4FBTA 4PG3A 4F91B 1A0OB 1U4MA 2IX3A 4WIIA 2BPFA 3M8RA 2CAJA 4RWWA 1Q8BA 2YBVA 4G65A 1BMQB 2C2EA 2WV6D 1ECWA 2EE1A 1VRTB 4JBCA 3VA5A 2PSZA 2D9UA 4NX9A 1ZKOA 1N0UA 5AI0A 2G1DA 2P9GA 3NWSA 3ERQA 2IHMA 1STAA 5EOZA 2UUAF 2A3VA 4KKUA 3QRRA 3AU2A 2B63H 1SUQB 1TVAA 2VW9A 2GOLA 1PJ7A 4C11B 1RWOB 5M5YH 4PMWA 1IJFB 3BGUA 3BYRA 4PG6A 2AQ3B 2ZD1B 4IH6A 5KG3A 2MJNA 4WFZA 5AK4A 4ZDNA 3GB0A 3R2TA 1R27B 5CYMA 2E5LJ 1NEEA 4BWGB 2UUCL 2XYPB 3H3VC 3TOQA 3BR9A 3M32B 1PUZA 1IBML 2LXUA 3BO2A 3V81A 1N5QA 1WTVA 1HNWJ 1HPZB 3DLEA 4CLYA 5DLGA 2BH8A 3AOBA 1Q12A 3LALA 2PC6A 5IIKA 1NUEA 3Q8YA 2ZOMA 2E66A 1X55A 4JI1Q 2R18A 2O5IC 4EWTA 4QW8A 2B2TA 1C4CA 4DR3Q 4MJKA 1VQ8A 5FIIA 1HNZF 4OL7A 4OFZA 3QSIA 4KSEB 3MGHA 1P1TA 1SNQA 2W7AA 2WONB 3HHLB 1X32A 1UPHA 2NVXB 2O1PA 4TY9A 3PSTA 1XMQL 1BO0A 5JAVA 2HKEA 2R3ZA 2AQ1B 5J1EA 1O7LA 1R4QB 7ICMA 3ZDBA 1PZJD 1EL0A 2JEIA 4GS3A 2DNRA 3S1NH 5C44G 3D54A 2CPDA 1KRTA 3BDEA 1AZSB 2AEJA 1SE4A 1XK8A 3PFOA 5F2DA 4C2MA 1T3NA 4R4IA 1TR5A 2YNIA 2A6MA 1EIFA 2W7PA 4CKEA 5KFKA 2BJ3A 2FIUA 4LF7L 1BNOA 1TU2B 4JV5F 2V4JB 5KFHA 4HLBA 2EANA 4KRWA 3DRXA 3KLSA 4JV0A 3QOJA 3TP7A 3QWNA 3F5AA 3BQTA 5K8MA 3OIPA 3TBIB 1NH8A 4OLPA 2YWHA 1C0UB 1Z4NA 3R7BB 1QAYA 2R7TA 2GAHC 4DF4A 1PYWD 3HKSA 1HLWA 2F0OA 2NR0A 5KFCA 4JI0L 1J5EJ 5F0WA 4NLGA 2CN1A 5IT9U 1IKWA 3UCGA 1KDNA 3T9NA 2F0VA 4DNTB 1TVRA 2JNJA 2RQXA 1EKRA 4OHXA 3HI9A 4OO1H 3CNQP 2ZDPA 3GTOB 1EY8A 1EXNA 1W26A 1CQMA 3JSMB 4FZMA 4LSLA 3IRBA 4LIWA 3M4OB 4BA2I 4A93H 2XS7A 2QW7A 1WG8A 4UBBA 4JPBW 4DS5A 3JAMY 4I67A 2DGUA 4LFCF 5HROA 1LFWA 2KIWA 2WSEC 1F5CA 4PH5A 4M63A 4AL6A 5C24A 1NBEB 4NLXA 2O3DA 5D46A 2ASJA 3FYHA 3X3NA 1SGGA 2P9CA 3IRUA 3T51B 1CKNA 4LJMA 4CM0A 5AKZA 4QWEA 1IKWB 4P0QB 1NSPA 4M5JA 2E5LF 1WOPA 3PSIA 1STBA 3MEEB 1HIWA 1PH8A 9ICIA 2DNKA 3U9SA 2WB1G 2IFXA 1FTRA 7ICKA 4KH0B 4UB1A 9ICBA 3CT9A 2FYXA 4TURA 4ZOHC 3UW1A 4QQBA 5KT7A 3KF6A 1J8IA 3QT5A 3EX7B 1QILA 2GHPA 1T4GA 3JQMA 4O5CA 1E22A 3J80L 5KFMA 3EFXD 4A3BG 2AJ0A 2YPYA 3K7AB 4RJVA 3GDXA 2FXQA 1M5OC 2OEHA 3AB2B 4Y28C 2FLOA 5EE9A 1NU4A 3KNAA 1RHKB 2R93B 1Q46A 1PRTD 3MI7X 5IGFA 2VJ5A 7ICLA 2YWWA 1VQJA 4N9PA 3KOOA 3GD7A 4J7CA 4IPDA 1SQGA 4CGZA 2OPPB 2R7ZB 4L6V3 2QA2A 1SCJB 1FKOA 1N32L 2LDYA 2XQCA 1OW5A 3HSDA 4EQPA 5F8LA 1N54B 3QMQA 1DYQA 3H09A 3GTQB 4UQTA 1E6VB 3L9AX 4OV6A 3PW4A 3CD6A 2J0SD 3FJ2A 1QDUB 5KT4A 2W3SA 1UQVA 2LM4A 3C21A 2RKSA 3ULLA 2KIVA 1PVQA 2CJBA 2KOBA 1YHBA 5M9OA 5AK5A 5A8KA 4DUYL 1LW2A 4AD6A 2DPJA 4LFCJ 2LA4A 3W8GA 1IKLA 2MKJA 3GYXB 2HMXA 1B7FA 2HHVA 2G13A 2UXDL 2NXUA 5J0PA 2G2OA 2F4VQ 2NPIA 3G48A 4LF9F 1I5FA 3SQIA 4QBUA 5IINA 4LFBQ 2VNUD 1GXLA 2KICA 2R42A 3A54A 1VQLA 2HK3A 5CV5A 1JOQA 2CNOB 1U0SA 2BH2A 3RJMB 4CGYB 3OMCA 3KUEA 2Q6BA 1NJZA 4RWSC 2DNZA 2CQDA 4EEKA 3C2KA 1FD7D 1MA7A 4ECZA 3CB4A 3W62A 2OMOA 1B4OA 4ECXA 3N7SC 2K8AA 1ZQPA 3W9IA 2BMBA 1TELA 2QG9B 5KG6A 5K8PA 3IR7B 1GNKA 2HIVA 4DK6C 4N8X1 2HFNA 4RQMA 3PVXA 2Z2LA 2ABYA 2ZUAA 3CCJA 2A5HA 3ONQA 3W60A 1FFVA 2Q2IA 1D09B 1XO0A 3A1YG 2L12A 2QLBB 2P9EA 4ANEA 1KOHA 4P10A 5H9EJ 3H0PA 1OXUA 4LF5Q 4C4SA 3ZXWA 4RNFA 4WZQA 2OPQA 4G3IA 2D41A 1T03B 4KHZA 2FQQB 2BJ7A 5K5PA 3C15A 2MGSA 3RFAA 4X5VA 2VJVA 4DR6F 1A8VA 2UXBQ 3CCQS 2XMVA 3FEZA 2R93G 3HOUH 3L3FX 2CPZA 3NWTA 3HHLC 1A6LA 3FCWA 2C35B 2VODA 3PIOQ 2FMQA 2VASA 1L1OC 2G4BA 2EJGC 3CCRA 5LMNQ 3DLGA 5A2QY 2LMIA 1N62A 4K0KF 2B4PA 1HYSA 2OPRA 2MO0A 3I3CA 5J39A 2GA7A 3BPSP 2RLTA 3SVMA 3OTOF 3MWBA 2HHUA 4ZJQA 2QV6A 1X9SA 2HDMA 1T0TV 1HHTP 4U8YA 4PZ8A 4ZCIA 2IBOA 1N0VC 1MROB 4HAIA 1PH4A 1G6ZA 3T4AC 3DUZA 3T1HJ 1FESA 1WCMB 5CV6A 3TS0A 3OXLA 4GNXC 4ED2A 1FL0A 1RTDB 4JK1C 2EAOA 1FEZA 1Z00B 1VCTA 4F02A 2HZAA 3JQJA 4IG3A 4ETZA 4TUSA 4GRSA 2R7RA 3SZ2A 2MKCA 4I1TA 3CC7A 3S16B 3UPFA 3U27A 2UUAQ 2ZITA 1XNRJ 5IC4B 2PZUA 1RSCA 2CH4A 4A3JH 4ALPA 4R4CA 3ENQA 1ASZA 1AW0A 5JJBA 2YKMB 1GHKA 1LV9A 2R7VA 1OO9B 1DTQA 3ZZRA 1YRTA 3I4NG 1X60A 3D5MA 3RF9A 3JAML 3A12A 1CJVB 4DFMA 2XIWA 2OH2A 1IKYB 2L55A 1VQPS 3IR6B 3QGPA 2YB4A 7ICGA 1QJOA 2W7OA 3TA0A 3DI6A 3H0LB 1KDCA 4R25A 4C8LA 1Y69U 1HD0A 4BGDA 4OI6A 3PGZA 5IWAL 5B0AA 4PXDA 1ZQXA 3FGVA 1BBUA 2AWNA 4EVOA 4UB8U 4X4PA 3GTKB 2F1MA 2GIQA 3B0XA 5HMLA 1S72A 1S10A 3GZFA 2HBQB 2WB1C 1M5SA 3T79A 2JLFA 4HHUA 2Z56B 4TU9A 1BXTA 3V05A 3LANA 1LEOA 1X3FA 3FEYB 2J4XA 4O4GB 1HI1A 1TAUA 8ICQA 1W6JA 2B4OA 2F4FA 4W98A 5AICA 3NK9A 1FA0A 2MPMA 2XNRA 3CJTA 1CRXA 2V0NA 3R1HA 2UVWA 3ER0A 2EY2A 1A9NB 4UATA 2BVZA 1TXYA 1C8CA 1VQ5S 4CYUB 2V4RA 5DQHA 2BDPA 1AZQA 1NK9A 4L72B 4M0AA 5CZVA 1W3SA 1N88A 4HACA 1DTTA 4AE5A 2I5HA 1PK1A 3E3XA 2Z6BA 4XQNA 2M0NA 4LZGA 1VQ8S 3PHEA 3CC4S 3SV3A 2FJWA 2CIMA 5K14B 3J7YW 4QYZJ 2IJ0A 9ICVA 1PLFA 3F2BA 3S15H 2Q4TA 4TU8A 1K47A 4QR2A 3BH6B 3LAMA 4KBIA 5HN0A 1STEA 2IRXA 1EEID 5HVFA 4WYLA 4BXOB 2L11A 2LKZA 4DFDA 4MTPA 2VKRA 1XERA 4IH5A 3HKZG 2XTJP 3RH5A 5H9FJ 1NR4A 2OIHA 2ZH7A 2GVDB 1WTFA 1H7WA 1ZQ1C 1RQNA 2ICIA 2EXZA 3ZDCA 4O4RA 2XLIA 3M30B 1J5OA 4OV1A 2W8KA 2HNZA 1VQ6A 4JBKA 4YB7A 2WSFC 1YSJA 5J2NB 4PPZA 3IKJA 2HBKA 3QT8A 2QA1A 2FGCA 9ICRA 3H8YA 4A3CH 1FDNA 2YMQA 1KLMA 2VDIA 3TQ1A 1O08A 3KK1B 2RILA 1WTPA 3CGIA 5DG8A 4P4MA 1WOCA 1SKWA 4PGXA 1IKVB 2Z4HA 2JN4A 3AT1B 4PEOA 4ZLNA 3T5KA 3I5CA 4A8FA 2L1BA 3S1NB 4IFYA 2OHDA 4F7VA 5H1SE 4XDCA 2RU9A 5CBEE 4DAYB 3G8TA 3TP6A 3NVYA 5KG4A 2Y3YA 1WC4A 1VQDA 4ELUA 4YHHL 4DV1Q 4ZVFA 1GFWB 3NBHA 4ZN1A 3ZTSA 3CW2C 5D0GA 1IBMJ 1RXVA 3DDKA 4DR5F 4XAKA 8ICZA 4JI7F 5CYMB 1PH2A 4OYZA 4QZAA 3BS7A 3VR4A 4EZ6A 3J81i 3RJFA 3EDQB 1F5SA 1KW4A 5KFJA 3H4BA 2H4WB 3VVTA 3H5XA 3POTB 2Y1JA 4KN4A 5DM7Q 1PJ5A 1ZRNA 1HA5A 1LKYA 3AL0B 3G6ES 3BYYB 3G71A 3M2VB 1W6KA 1KFTA 2JA9A 4B3MQ 1XTDA 3IM1A 1K28A 4MH8A 4I2HA 3FDTA 1N33L 4L6TB 4KLOA 4FVMA 3E51A 4P0PB 1Y1VB 4NMXA 1N60A 3BO3A 1ICWA 2BW7A 5CHCB 2F52A 2Q66A 1R8BA 3T1HQ 5C3XA 1VI7A 2RHFA 1PYSB 1DGJA 4AP9A 4YCVA 3NGTA 4USHA 5I6WA 4CP5A 1ZQQA 2P66A 4DR4F 4RGOS 4YHHQ 2LA6A 2MYFA 3HOUG 4HR7B 1LK5A 4M9JA 2H1YA 2O66A 2K06A 1I94F 3KLWA 3D4JA 5K8NA 2RRDA 3M4XA 1KS2A 2CPIA 2FJ6A 3ULJA 1QQ5A 3DGVA 4U67Q 4A3EH 2MQ8A 1RHQB 3D2SA 2F8EX 3UE2A 3MTSA 2QGFB 2CJAA 2RP5A 1WHXA 4O0AA 3N0VA 3KBGA 5AJ3L 1BKBA 4O44B 2CJQA 4MFAA 2PMZD 1K73T 1T95A 4USIA 2PFPA 4QNLA 5CMDA 2WB1D 5FLXc 5KFVA 3NNHA 1PZKD 1B99A 1N5WA 4RW4A 3TEHB 3QRPA 1NK7A 3M8PA 4IYQA 1IZ6A 1TKZA 4N76A 4F8RA 1XMOJ 5HHHA 3PTWA 4DMZA 1CKOA 3MAHA 4I6WA 1BPYA 4HVZA 5CC4A 4LFBF 4JI2F 1NMGA 2Z6KC 3W2WB 4OX9F 4POGA 1U8WA 4YMOA 1J5EL 5AXMA 4JI0J 1ROFA 5KFTA 2BRLA 1HEKA 3RH6A 2D3DA 2DCUB 1LWFB 3H8MA 5ALXA 3S16H 3HZGA 3A7AB 2PNRC 1S48A 1X40A 1S9FA 4H13C 5IYCH 4ZPVR 1RAGB 2EFVA 2J7WA 2EK1A 1H6KX 2V8VA 1FXRA 1CHPD 1FO1A 3D3CJ 3TJAA 3CMAA 3MR6A 1S49A 3BBCA 2X1BA 3RYLA 3U1LA 3IWXA 2BDNA 1KKXA 2ZBIA 1H9JA 1DLOA 1IBCB 3MWYW 2UVRA 1VOMA 4NLNA 3OTCA 4LRDA 3B82A 3EGZA 3MEDA 4XIGS 5DS7A 3RLOA 1YZ7A 2OAUA 2VIHA 1X5TA 2IIHA 2ZEJA 4K6DA 2K4PA 5EUHA 2D1CA 3SCKE 4YXJA 2HGNA 3KUGA 2VDHA 5DZ6A 3VAHA 3GJTB 4IC9A 3BQ7A 5BOMA 3VA7A 2B4UA 3F5EA 2ZBQA 1SV5A 4GOPC 4QCLA 5LHY1 4A3MB 3HOUB 1L6NA 3MM7A 3TRZA 5I9OA 2RHQB 4QWAA 1KRSA 4J9NA 3M8QA 3DRPB 3ICEA 2KKVA 4CLKA 3LVVA 3HF5A 2BXJA 1MLAA 5EWFA 3LGHA 2ENBA 1HI8A 1ESFA 3NGRA 4B3TQ 1SRUA 1N36F 4WZMA 3OL8A 2J5AA 7ICNA 1A3TA 1RIPA 1E2ZA 2R4FA 3MEFA 5I4DA 2OEJA 1ZAVA 2RQ4A 9ICXA 5LMNW 5EGYA 1UT8A 1XWLA 4QIWC 7ICQA 2YKMA 3CCVA 1C1CA 1GX6A 2Z30B 4KI0A 1PTOB 3CJQA 3S1RH 3QO9A 4GKJQ 4PQUB 3SI8A 1U1OA 5HURA 3NNCA 1KC8T 2HQCA 5KFPA 2VQEQ 4O42A 1BQQT 3KJQB 3IGNA 2DNMA 1I3QB 3VR2A 2OWOA 2JEAI 3ZFVA 1S0MA 4OHVA 1J9OA 2QO3A 1RWVB 1F9HA 2IDLA 1ML0D 2Q8IB 4IQWA 1YWXA 4K8RA 5FLXU 2QB0A 1Y1WG 1U0HA 3T13A 2MQNA 1A7GE 3WK8A 1NKEA 2CZ4A 2HQDA 3L4PA 4R65A 2K7VA 5DG9A 4UQGA 5IY0A 3RAXA 2LSSA 1SNPA 3HXMA 4PYAA 2ODGA 9ICPA 5F8NA 1RJJA 3HWTA 3JS9A 1OWXA 3DLBA 5KTQA 3I0RB 2VKZG 3UMCA 4KGZB 1C2PA 3CDEA 4M1KA 2HBMA 4NXMJ 2JH1A 3NBPB 4HEDA 1SC1B 1HNXJ 1ESRA 3S01A 3K1RB 3C2LA 1RACB 4KHVA 1RAHB 3ORYA 3RR5A 1R7IA 1E7ZA 5L1MA 4GKJL 2CZ9A 4JG2A 2TMPA 3CJSA 4QOTA 1LW0A 4DX7A 2R7ZH 5GAGC 4AL7A 4BJQA 1P16A 2DNPA 1K8AT 7ICOA 1Y8OB 1WD0A 4UB6U 1YLXA 4K4VA 4KLUA 1JJ4A 2HBZB 2C9OA 2NYHA 2QARB 2DN8A 4O9MA 3HHDA 4QPXA 2CWAA 8ICBA 3MUTP 3PW7A 5FDLA 1UUPA 1M90C 1P8LA 1UFLA 1OY6A 2GZOA 1BWEA 3M6KA 4ES1A 4I69A 3ZZTA 1MD2D 4LW1A 1F2YA 1ZYRC 2QLTA 4PJ0U 3WKAA 3TP2A 4XDDA 1CVJA 2DNCA 2XWBB 1WG5A 4LR9A 1VQSA 3S8SA 5JEAH 4Y2AA 4PGYA 4UZCA 5G0RB 3B0YA 5HANA 1JB7A 1DK3A 2WAQF 1ZA1B 3OHBA 1N56A 1X6IA 1KWMA 4R4TA 5AM1A 3CCSS 4HMJA 2KCMA 3FM9A 3GTGB 3H8WA 1KVJA 5F8HA 3M8YA 1MU2B 4K0KL 2CRXA 3DHQA 1UJ4A 4OLOA 3OL9A 2HQ3A 4C4WA 4ED8A 3FP9A 2L9NA 1RXWA 2EG1A 3QQCD 1SYBA 4DV1L 3HZXA 3TQYA 5CR0A 4J8QA 1IBLQ 4ZVRB 3Q83A 4XPCA 1PK3A 1UEBA 5AKJA 2YNHB 2K04A 2N3LA 4IOAQ 3RR8A 2J0TD 5JPMC 3A4TA 3MMAB 1RT3B 3D6FB 2LLZA 3DMJB 1STHA 1FRKA 2DR6A 5DB9A 2RIJA 1CKMA 2N7YA 3W5XA 3IAS9 3AU7A 4IPCA 1ZRMA 1YK9A 4FF3A 2EYMA 4N9TA 1X3EA 4KFBB 2JSOA 4UT4A 2MPUA 4Y2UA 3GR1A 2B6AB 1NM2A 2MKSA 2KYXA 3KFWX 2RBMA 1NSQA 2OEKA 2JJ4D 2F3VA 4CF5A 2W4CA 1FE4A 2AQ0A 2E3TA 2XYGB 2FVSA 2JVOA 1PBAA 3QU9A 2NN6G 3L3OC 5I6YA 3MGJA 3I8ZA 4RAUC 1JLCB 3PRBA 2AGOA 1X6JA 3RJKA 4Q8FA 1UEVA 2OMLA 2KVQE 3D0IE 5D14A 4KB7A 1HBMB 1QAIA 4UBCA 2LQBA 1JXLA 3U9OA 3F1ZA 3CPWA 5CABA 2CJKA 3DMJA 4WXOA 1G291 2W9BB 2NB0A 3LNNA 2M7SA 3HOZH 3S2DB 2CNLB 1EYCA 1U1QA 5ELOA 3MURP 5DDYA 4WJ3M 2MUTB 1PFNA 3CPWR 1T9VA 1P27B 1N34L 5B0BA 2LI6A 2LDIA 1WOSA 4P7VA 4NLYA 4JI8Q 1H9RA 2KFYA 7ICJA 2BKEA 3VAMA 1SXDA 1TKZB 4K0KJ 4GVBB 1L3SA 2ES6A 3W3AA 3QU2A 1RHPA 4K4TA 1R9TH 4J9RA 2WOMA 5JEAG 4P7TA 2A69C 3TREA 3R7SB 5HMXA 2HVDA 4X4TA 2N3OA 3OD2A 4B3OA 2F3IA 4ZAIA 1JXEA 5C5MA 2XCAA 2JH7A 3J7A5 4DR6J 4YDDB 3EGNA 4F26A 3IC1A 4ECRA 3OXGA 4OO1J 1GT8A 1IR2A 2HLTA 1MWYA 8RUCA 5DB7A 5AIAA 1QSLA 2E5SA 4DV3F 5I3UA 4FS1A 2PQEA 3T1HL 1QVCA 2DY7A 3G87A 5IT9Y 4JI5L 3OPOA 5FLXL 3HM9A 3CD7A 2ZUGA 3MAAB 1VBYA 3CC2A 2CJ9A 1RTNA 4X66Q 2A19A 3SK4A 3A5ZB 2RDHA 5KNCA 2DNHA 3ZZZA 1YJVA 4GVBA 3Q8MA 3KDFB 4UAIA 4NRTA 3MM9B 1F6TA 1CQVA 3A8IE 2QSWA 4JI8L 5CV4A 4MTNA 1NZAA 3UI3A 2NREA 2P6UA 4RMFA 1DM0B 1APSA 4OEMB 3BF4A 3DXSX 2H3IA 4KLSA 2R61A 3TW0A 4KPYA 2E1EA 3IBWA 5J2EA 2PFFB 3LWEA 4FXWA 4MMOA 1RKIA 1V43A 3JSMA 3MZ5A 2HDLA 3EICA 3MCNA 2RDJA 5J2BA 1N63A 4U673 2HOIA 2FY8A 3DLLA 1SYFA 2BANB 1XC9A 5JPNC 5DB8A 1V1PB 3HHNB 3A3PB 1I5OB 1S9EB 1E0BA 5GAHC 1SKUB 2Y0SB 1LTSD 1N33Q 4RQ5A 3AJ1A 3L7PA 1Z2ZA 4KTQA 3KG1A 4R8UA 3I55S 2DY8A 4MT1A 1X4BA 2FMCA 5J2PA 4OX6A 4EI2A 2I5MX 1N36J 1CJTA 1PRTC 3K58A 2W8LA 4P0PA 5LT5A 3PFEA 1D6EC 1VQ5A 3NTIA 3FMWA 3G9CA 1U1NA 3VR6A 5IGBA 4B3TL 1R8AA 1Q7YC 3HRDD 3I28A 2L41A 4NKLA 1DOMA 4FXKC 1YHAA 2CPHA 5K4LA 5KFAA 2ZJ5A 4NEZA 3QIPA 3HVAA 1L1OB 2XZTB 3BV8A 5ALVA 1YNJC 2CW0D 3KFUA 3ILJA 1CHQD 4B3TF 4ZPCA 2VOOA 5DQIA 1F2LA 3R5CA 3DM2B 3P20A 2DD8S 4IUNA 5C44B 3DOLB 3D6JA 2MP1A 3KXDA 2PXIA 1PJ6A 1Q82T 2WZ1A 4NXZA 2RQCA 5J2PB 3ZZ0A 4GC6A 1S5ZA 2KENA 5LJ3Y 1U47A 5I2XA 1IQZA 1JLQB 4F0MA 4HN7A 3QAEA 1MMDA 5JJLA 1UE5A 4U7CA 9ICNA 3OLBA 3T1YQ 1PH9A 1SH3A 3MFHA 1KAWA 2ZIWB 2E1AA 2NUUG 3QSYB 3GV5B 4LRFA 4ILMA 1SH2A 1QNUA 4A48A 3OUYB 2KEYA 1PMRA 1S0NA 2ID0A 4IURA 4DO9A 4K50A 3MXNA 4HR2A 3S1RB 2DK2A 5CD4A 4G7ZC 1CI4A 2F0UA 3E6ZX 1PSDA 3W7BA 2R3VA 2EYPA 4KPCA 1X2IA 3JTOA 1FERA 1M8AA 1HNVA 1UAPA 5HATA 4Z7CA 2G09A 2HDOA 3BDPA 3W5OA 3MMBA 3TAPA 2UUTA 4CLZA 3UFCX 2FUG9 1ZOTA 4JI2J 2L9HA 1ITPA 1Q86C 3M8WA 4DKAC 2K1RA 3H59A 2OTLS 3PKMA 2LXFA 1UZHA 3GZ7A 3MFGA 9ICFA 5IT4A 4DR6L 5H9EK 4QJFB 2WAQB 2NN6I 5FO7B 2XZDB 2HZVA 4RW8B 2JA7G 2JXJA 4A3EG 3BJUA 2K8GA 3FBFA 1R0CB 3DKDA 3E2EA 3A7LA 4QZDA 2I8EA 1PV4A 4M5MA 3SHLA 2CQ3A 1JMCA 5ALRA 4RGNA 1RLDA 1BNPA 3UQSA 1KEJA 1DOQA 3K8WA 2JV3A 4A3GG 3D0GE 4CQ1A 2K5VA 1FRHA 1NJIT 2H48B 4RHRA 1N32F 1ONLA 4PPXA 3V6KA 3OYYA 4DV7F 4HJAA 2D3UA 3ISND 2ZTDA 3TAMA 5IXUA 1TS3A 2WB1B 1H0HB 3DCAA 2M0GB 5LMUL 2PMZB 1S6QA 4MHVA 1HMVB 4UARA 4KH1B 2HRTA 3AA8A 2D3OR 3RUZA 1U7LA 3LAKA 4KN7A 3CCQA 3ULPA 1UNSA 4B3RF 3H8SA 1TL1A 3S2HB 1GD7A 3PIOA 1JKHB 2AQ2B 5CBAE 4MKVA 1UZDA 4FXVA 2GCFA 1COKA 2OLWA 1SYEA 5IV4A 3A74A 2H5JB 3OTBA 3HG9A 2HPUA 1UWBA 2VONA 4LF9L 3D1HA 4K4WA 5AKYA 3G6XA 3K57A 1PIEA 2R93H 1MQ3A 6AT1B 3QGIA 3PUVA 4DBQA 3HOXG 3HHKA 5C0YA 1LW2B 3EUNA 3IG1A 4KR0B 1XNQF 5CYQB 1RAIB 3PO4A 2E9ZA 1VQ7A 2HS4A 4HSVA 2IJRA 5HAOA 2PFNA 4KLMA 1H7XA 1HMVA 2N4DA 1X4HA 4F4XA 4NXNJ 4OX9L 2ZNYA 5IYBH 2VF3A 4ECSA 1P8GA 4WXWA 3QJYA 5IP7H 2VQFQ 4OI4A 2V9KA 1TUWA 5A8RA 1HQ2A 4ZKCB 3QU7A 2Z9HA 1WG1A 5GAHI 2K6AA 2HI0A 3V2TA 1JLCA 4NY8A 2YMPA 3QE9Y 1U6BA 1SJ1A 5D6GA 3UR0A 2OO4A 4YY3J 5D3GA 1VQNS 1ZTTA 4MIBA 4H4MB 1RADB 4M6WA 1R4PB 3PMLA 2APOA 3OTDA 3C8YA 4LF5L 3HOWG 4O5KA 5CYJA 3ZI4A 4DFKA 3KLVA 2F1JA 4A3GB 1X7VA 2UUCQ 3R9KA 1UFKA 3BKTA 2XVTA 4Y2SA 4WKYA 2EI5A 5F3ZA 2O5DA 3JSBA 5BR8J 4BC9A 3CU7A 1T03A 4B9NA 4BX9C 4O3MA 1YJ9S 1UJ6A 1U49A 3KF8A 3ZNJ1 1IL8A 2F40A 2JZBA 4XQQA 2BPGA 1HQUA 4KHMA 3VZIA 2RDGA 4TXSA 1OPZA 1QY7A 3NCPA 3MM6A 4C3HG 4WJWA 2HLUA 5J2QA 1IBLL 4EBEA 3PIP3 2NSBA 5J8YA 2XTIA 2CQ1A 4DU8A 4M6WB 2DIUA 3EM1A 1NHUA 2B6GA 1N32J 1O80A 2P5VA 2FJDB 4YR3A 3NVZA 4FYWB 4QL5A 3KJFB 3ONNA 2NVYB 3D3RA 1SZHA 2XSCA 2VB6A 4DXGA 1FE0A 4IO9Q 3I76A 1K8GA 1RT4B 2D7SA 3CDWA 3DOKA 3RBXA 5BXIA 4DV5J 1SC3B 4QIGA 1FYCA 3GU3A 1Y11A 2DYAA 1WWHA 2IM3A 2JFKA 4DR5L 2FI1A 3CCES 4Q0BA 3M7GA 2QYCA 3N01A 3OOCA 5AI6A 5F3XB 4ZCLA 1HQUB 2IVYA 4HHJA 1JUDA 3HVRA 3CMAS 1EIGA 4UAVA 3HW8A 1VQ9A 2ZJQA 3SQGA 1X4FA 4GVLA 1KKHA 4I0WA 4JVZA 3H7IA 1ET9A 1OYEA 4R66A 2KNJA 3OVSA 2EZVA 1SYGA 2FLNA 2HCIA 3LGNA 4DV0J 3FRYA 1TKXA 4LF6Q 1RJTA 2QB1A 5KFSA 1NK6A 3MMAA 5J2NA 8ICGA 2F3WA 8ICCA 2Y1RI 1RDRA 1VRQC 4JI0Q 2Q6CA 4K4ZA 4Y2MA 2EAPA 1HBNB 2N88A 1Q7LB 3H3VI 1TL5A 1ZQGA 3B78A 1IKMA 3KG0A 1O7YA 3HVWA 5HGQA 1ZPWX 5L39A 2ZTCA 4IFDH 1K73C 3P75A 5EX0A 2WVEA 3W5ZA 2CFXA 5AI8A 2KN7A 1WTRA 3D1QA 4UY85 2R7SA 4A3BH 1TVRB 4RQNA 3DV9A 3NUQA 1FD2A 2NUCA 3SQGB 5F8GA 3I4NH 1UHUA 5D4BA 3DLEB 1VDZA 5M3MB 2NVQB 1P9QC 1G2SA 3GIIA 5AIBA 2HNYA 2KVCA 2I5LX 2A6HD 4A3JG 1SYCA 1ZXTA 4YN3B 2ILYA 2KJ5A 4FYXB 2PE8A 3CCTA 1S5ED 2GQQA 2AZ3A 2E1RA 1URJA 3J80E 2FHJA 3NVVA 3D28A 1XIQA 5JXSA 4OZJA 1IIPA 3EA6A 1K83H 2F8MA 5ELNA 4JYAF 5D49A