2AHOB

Structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
264
structure length
259
Chain Sequence
MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structural Switch of the gamma Subunit in an Archaeal aIF2alphagamma Heterodimer
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 60
structure length 259
sequence length 264
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00575 S1 S1 RNA binding domain
B PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2ahoB02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ahoB01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 2ahoB03
1E1OA 1KC8C 2HQLA 2K14A 2JA7G 3GTQH 1EIYB 3CCJA 4YWKA 2ALYB 3RN5A 4WJ3M 2L15A 3GTLH 1Q46A 2VNUD 2PMZE 4RMFA 3CCVA 1JJGA 4JYAQ 1FVIA 5DLQE 4QQBX 2UUAQ 5EAYA 3KJPA 1K8GA 4QGUA 3T1YL 1N32L 4DR3Q 4GS3A 2K50A 3KDFA 1BBWA 2B63H 1AH9A 1L1OC 4RG1A 3FKIG 1IBML 4IPHA 4A3EH 1PH3A 4UP9A 1HR0L 1BBUA 4AQYL 1IBKL 4GNXB 4P74A 1HNZL 3RZDH 2CWPA 1BVSA 3WWVA 3K7AH 3D0FA 2Y0SE 2QMUB 3I4NG 1K9MC 1XJVA 4UY8C 3U4ZA 3EN2A 3PO3H 2N3SA 1K3RA 2OTLA 1Y14B 3TEHB 2VW9A 5C0XI 1Q7YC 1YJ9A 5C4XH 1N32Q 3HOWG 2ZJQA 2F52A 3KFUA 1IBMQ 4L5TA 3RLOA 1HR0Q 3S1RH 4DNIA 4GOPA 4GNXC 1IBKQ 4DR7L 3KF6A 4OWTB 5IYBH 3CXCA 1LYLA 3PSIA 1G6PA 1ASZA 1JJ2A 2YV5A 3I56A 2R6GA 4ME3A 4DV4L 2JA8G 1S72A 3HKZG 2GVBA 2F3IA 1VQDA 5C0XG 1PH4A 1OTCA 1UEBA 1E3PA 4DR2L 3K80C 1RL2A 4IPDA 3DLLA 1IYJB 2PI2A 1J6QA 1JJCB 3EIVA 4BY1G 3PIPA 3OTOQ 3CCSA 4HJ7A 4NXML 4JI5L 4DR7Q 2CFMA 1L2FA 2R7DA 4JI1L 1GO3E 4OWXB 1S40A 4IOCA 1X56A 1V43A 2RF4A 1XPUA 1HNWL 2JA7H 3DM3A 4LUZA 1PYBA 4DV4Q 4A3CG 1NE3A 1V9PA 1R9TH 5IYCG 2AWOA 4PZ6A 2R92G 1VQBA 2KBNA 2UXBL 4TQUS 4DR2Q 2QA4A 1QVGA 4NPSA 5M5WH 3HKZE 3M4PA 1I94L 4MZ9A 4L5SA 4NXNL 3CCMA 3FKIH 1U0LA 1QUQA 4APVA 4JI5Q 4K0KL 1WJJA 2MQHA 3D31A 4A3MG 1UE6A 4C3HH 4JI1Q 3RLNA 1NMGA 1M90C 2DGYA 4DV1L 5IE8A 3CC7A 2H5XA 3KLWA 3F2BA 2FXQA 3CCQA 3RN2A 3I4NH 4B3RL 3GTKH 1ASYA 4QY7A 2Q2UA 3I2ZA 1OXXK 3J80i 2IX0A 1Q82C 1D8LA 2K5NA 3B6YA 3G48A 1PHJA 1HZCA 4OXPA 1VQ9A 2AWNA 3W1BA 4LF4Q 3A5UA 4EX5A 4AH6A 5FJ8G 3BZKA 1I50H 1I94Q 1O7IA 1OXUA 4HJ9A 1YJNA 4NXNQ 1KL9A 5IWAL 1SN8A 2RCNA 2F4VL 1X3EA 4IOAA 3G4SA 1IL2A 4KHPL 4DR6L 1K73C 4K0KQ 4JI4L 4YY3L 4OO1I 2GVAA 4DV1Q 3PUXA 1KHIA 5C4JH 4DUZL 3RR5A 2Z0SA 3CP0A 1VQJA 1XMOL 1EQRA 1Z47A 2UUBL 1PH6A 1FL0A 2C35B 2N78A 4KLKA 2VQFL 4LFCL 5E7NA 4PZ8A 3UDFA 4DAMA 1GM5A 1YVCA 1Z9FA 5IWAQ 4LF7L 4BY1H 4KHPQ 5C0XJ 3S1QH 4DR6Q 4JI4Q 2PNHA 4UPAA 4OO1G 1TWHH 4DR4L 3PCOB 1VQ7A 2AKWB 2NVYH 2JA9A 5IY0A 2E8GA 1YEZA 4AIMA 4DUZQ 2PQAA 1B70B 2Q2HA 1L0WA 1XMOQ 4A3CH 3A74A 4DR5L 1YIJA 1VQKA 5IYCH 4LFCQ 2R92H 3HOVG 2UXCQ 3E9IA 3PIOA 3ULJA 4JI8L 1Y1WH 1MJCA 4HJ8A 3KDFB 1NJIC 4A3DG 1HJPA 4LF7Q 3S1MH 1VQ5A 2A19A 4LW1A 1HH2P 2JE6I 1UE1A 4HJ5A 1VQEA 2I0QA 2HHHL 4A3MH 4DR4Q 2ZTEA 4DV5L 1SRUA 3GTPH 4LUOA 1N9WA 4DUYL 3ULLA 4IFDG 5JEAG 3JAMi 1Q81C 1X55A 4YWLA 3GTJH 2BH8A 3H0GG 2KHJA 5C3EG 1VQIA 1N8RC 4JI8Q 2IX1A 3TREA 5FJ8H 4BBRG 3CCUA 1KQSA 1N33L 1A63A 3HOXG 2VL6A 2K5VA 4A3IH 3J7ZC 1X6OA 1Y1VG 4JBJA 4GOPB 4HIKA 3KF6B 3K81C 2HHHQ 1P16A 1J5EQ 1TWCH 4DV5Q 4XIGS 4XTCS 4HIDA 2IY5B 4QL5A 4POFA 4DUYQ 3M4OH 2R93G 2LXJA 3NENA 2D0OA 1DGSA 1XPOA 1X54A 4DR1L 4BY7G 2K52A 3ULPA 2NVXH 3S1NH 1N33Q 3CPWA 2B29A 4QJFA 2YTVA 4LUVA 5IP9G 3NBHB 1Q8KA 1NMFA 1VQGA 2IT1A 4GOPC 4KI0A 5ELOA 3L2PA 2QN6B 3S24A 2V1CC 4Y7NH 1HZAA 4LF8L 4O0AA 4LWCA 3T1HL 4BBSG 4IPCA 1KRTA 3M7NA 2NN6I 2ES2A 2VS1A 3CQZH 3OTOL 4A75A 1JT8A 2YTXA 4X6AH 4DR1Q 3HOVH 2JEBI 1VQ6A 2DUDA 4IJLA 2JA5G 4X65Q 3GO5A 4A3KG 2JK8A 1JB7A 3PUVA 3G71A 4FDBA 4A3DH 1UE7A 1QUQB 1LUZA 4HIMA 1VQOA 2LXKA 1E1TA 1X65A 4DV6L 4LF8Q 2CKZB 3T1HQ 2LSSA 3HOUG 2JJQA 2MFIA 5HGQA 2NZHA 1Q1EA 3CAMA 5IP7G 2NN6G 3SGIA 2R7ZH 4KHZA 1U5KA 2KHIA 3AQQA 1QVFA 4QIWE 3UE0A 4DV3Q 4DV0L 3FP9A 3H0GH 2JA6G 3UE1A 5M3MG 4P75A 2YYZA 3NEMA 2JQOA 2RHSB 1JMCA 3HOXH 3NELA 1X3FA 3CCEA 4IO9A 4BXXG 4LF4L 1YBYA 2Z6KC 4PZ7A 4DV6Q 4DV7L 3J81c 2KENA 1VQLA 3CW2C 3PUZA 5AJ3L 1KXLA 4JBMA 4LF6L 2I5HA 3CPFA 3K8AA 3BZCA 3H3VI 2R93H 2OTJA 1HZ9A 1NBWA 4DV0Q 2Z6KA 2EXDA 2VQEL 2NZOA 2OQ0A 1VQ4A 1XTDA 5H1SE 3CMAA 1PFSA 4R4CA 1YI2A 4DKAC 3KF8B 1TWFH 1EFWA 5IP9H 2E2HH 4POGA 4R4QA 4A93G 3FHWA 4DV7Q 2E2JH 4A4IA 1SE8A 3HOWH 3F2DA 5AJ3Q 4GKKQ 4P71A 4LF6Q 1KD1C 3ER0A 2PQAB 1WCMG 1IBLL 4A3JG 1B8AA 5IYDG 2ZTCA 1PA6A 4X64L 2VQEQ 4GKJQ 3GTGH 2MNAA 1B7YB 3F2CA 2R7FA 1IXRA 4O2DA 2JA5H 3S17H 1K83H 5M5XH 4A3KH 1MJEA 3KJOA 2JA8H 4Y52H 1PVOA 3PUWA 2HIXA 4BA1I 4A3FG 2UXCL 5FLXc 1XNRL 3RLFA 1YHQA 3HOUH 3GD7A 1IBLQ 4EQ5A 2WFWA 5IP7H 3S16H 3L0OA 4X64Q 3PV0A 1A8VA 2XTIA 2E5LL 1IZ6A 1PH2A 5M3MH 1N36Q 4GN4B 2MO1A 4DK3C 4IFDI 3UDGA 3ICEA 1X3GA 1YITA 1CKOA 2NVTH 5GADC 4BXXH 3CC2A 3K7UC 4JI7L 1XNRQ 1GD7A 3J7A5 4JI0L 1AE3A 1CKNA 5GQOA 2GN5A 1E24A 4OONA 4YCWA 1BKBA 4L5RC 4DAYB 2I5LX 3CF5A 1I5FA 4IJHA 3BU2A 4JI6Q 3MEFA 1C0AA 1J5EL 1CSPA 2E5LQ 4JI2L 2IHFA 4OX9L 1XMQL 3CCLA 4NB3A 4JOIA 3QSYB 1T9HA 2WP8J 1MIUA 4JI7Q 3G6EA 3M3YH 1RIPA 1YHBA 4LNQA 4JI0Q 1I6HH 1SFOH 2K5HA 3M4QA 3U58A 3H3VH 3HKSA 1WCMH 3AEVA 4IPGA 1EYGA 4A3JH 3U4VA 2VY3A 5ELNA 4A3BG 2MO0A 4A3GG 1MKHA 4JI2Q 1A62A 2QEXA 4DV2Q 1LTLA 1C7YA 4OX9Q 4LFAL 1W2BA 1XMQQ 4P72A 2UUCL 5JJIA 1FGUA 4GN3B 1HZBA 1OXVA 3PUYA 2AMCB 4TVAB 1K8AC 4J15A 1AE2A 1P8LA 2Y0SG 2QGQA 1NY4A 3PGZA 3ZJYC 4A3FH 2K75A 3RNUA 3S14H 1I3QH 1E7ZA 2ZTDA 4X65L 4UP8A 2RHQB 5C44G 1H95A 4GLVB 1PH7A 2HT1A 3I4MG 4YCUA 4LF9Q 1QVCA 3W5OA 3PF5A 3UDXA 1PV4A 1PH9A 4GLXA 4YCVA 1VQCA 4GLAC 4LFAQ 4L5QA 2UUCQ 1W3SA 3M9BA 3OW2A 2Q2IA 5GROA 3J80c 3OYYA 4DV3L 1VQHA 3ERSX 4DK6C 4B3SL 1TXYA 1HNXL 3GDEA 2UXDL 4B3ML 4PMWA 2UU9L 1QZHA 2WAQG 3EBEA 3TRZA 3VDYA 4JV5L 3U50C 1VCIA 1VQPA 1L1OA 3M85A 5LMNW 1Q1BA 4A3LG 4DPGA 2KCMA 1NTGA 4JBWA 4JBKA 2WB1G 3PO2G 2N49A 3AFQA 3T1YQ 2KCTA 1TWGH 1XNQL 5BR8L 3E0EA 2YU9H 1X9NA 4OWWB 1EIFA 4B3SQ 2N8NA 4JC0A 2VUMG 4AQYQ 1HNXQ 1YZ6A 1SMXA 3S2DH 5C3EH 1OXSC 1HNZQ 4B3MQ 2UU9Q 2UXDQ 1KAWA 1WI5A 4YWMA 3GTMH 2ZJPA 2BA1A 4R4OA 5JEAJ 4BBRH 4JI3L 4JV5Q 4IFDJ 2A1AA 2WAQE 2ID0A 3A5ZB 2OCEA 3Q8DA 4A76A 1Y1VH 3HOZG 4GNXA 3H15A 4A3BH 3I55A 4A3GH 3STBD 4GKKL 1XNQQ 3AYHB 1Q12A 5BR8Q 1V1QA 1KRSA 2WB1E 1WYDA 1WFQA 2BA0A 3CMEA 2E2IH 1SLJA 4GKJL 4BY7H 5K36G 2EIFA 1EUJA 5IT9c 1VQFA 3BJUA 4JI3Q 4X66L 2I5MX 5C44H 1CUKA 5FLMG 5M3FG 3MXNB 1PH8A 3I4MH 5JJLA 3K0XA 1YJWA 1HNWQ 3HFZB 4BBSH 1WOCA 1Y1WG 2IHEA 3JC66 4ALPA 2BH2A 3E9HA 3JAMc 1SR3A 2HIVA 1QZGA 4NXMQ 1YZ7A 3W1GA 3GTOH 2ATWA 2NVQH 5GAEC 1N36L 3PF4A 1EOVA 1CKNB 1A0IA 4PG3A 4X66Q 1JE5A 4HJAA 2Q2TA 1EQQA 4BA2I 3KOJA 4LF5L 3CD6A 4A3LH 4MTNA 4X62L 4H02A 2YTYA 3IRBA 2EQSA 1XPRA 3HOYG 2UXBQ 5C4XG 1UWVA 1C9OA 5LMNL 1G51A 1SROA 1PH1A 3PO2H 3A0JA 4JCVE 2AHOB 5J3BA 4JI6L 4A3IG 1PYSB 5JJKA 2VUMH 3L7ZC 3TS2A 4R1JA 2JA6H 3TQYA 4YHHL 2JEAI 5LMUL 3CCRA 1OXTA 1LM0A 2CQOA 4P73A 1Q86C 1HR0W 4B3RQ 1YHAA 2B63G 3I7FA 4A3EG 1VS0A 4LF5Q 3F1ZA 4MNOA 4X62Q 1GVPA 3HOZH 2VZAA 1VQMA 5LMNQ 1EWIA 4JOIC 3PO3G 2CCZA 1S3OA 4JG2A 4LFBL 2A8VA 2D62A 2F4VQ 2D0PA 4C3IH 4YHHQ 1YNXA 3AFPA 2CWAA 1VQAA 3I4OA 3KYHC 4YY3Q 2XGTA 5GAHC 3J81i 2ZM6L 4DV2L 2OWOA 3STBC 2PI2E 2K4KA 1CSQA 2B3GA 4AYBG 4C3JH 5FLMH 5M3FH 3CC4A 3RZOH 4A93H 1G291 4R4IA 4WJ4A 1PH5A 5IYBG 2UUBQ 3TS0A 1N34L 2VQFQ 4B3TL 3F8TA 1FJGL 5LMUQ 1M1KC 1E22A 1D7QA 5IYDH 5GAGC 4LF9L 5HY6A 4R4TA 4LFBQ 1UE5A 3J81j 4C2MH 1VQ8A 4JYAL 2ZM6Q 3LGJA 4UP7A 5M5YH 2UUAL 2ZJRA 4DR3L 2OQKA 4GN5A 2ASBA 3S15H 1K0RA 1TWAH 1L1OB 2R7ZG 1CKMA 1N34Q 1GKHA 4AYBE 4DR5Q 1KIXA 4B3TQ 3S2HH 3UDIA 4HIOA 1VQNA 3HOYH 1FJGQ
chains in the Genus database with same CATH superfamily
1YBUA 2DITA 2L15A 2CH4A 2CHBD 4B9SA 2BJ9A 2LPEA 1UEVA 4GS3A 4HMJA 2GO9A 1CFMA 1OYEA 1BBUA 2A6MA 3TZZA 1SWVA 5D3GB 5AK4A 4YEAA 3RJFA 3IFTA 4RKUC 2UUCF 1K3RA 1N5WA 1RLCL 2R7WA 2CJYB 3RUBL 1NPKA 4H4KC 4LRDA 2CXEA 1SV5B 4DU7A 1RAHB 2MSTA 4CJ2C 8ICVA 2DKOB 1G6PA 1LEOA 1LT3D 2R6GA 3H0MB 3PHTA 5C4XB 1TWGB 1S72A 5DB9A 3TFRA 1E3PA 3U7JA 1SI9A 3M6KA 3S2DB 4JV5F 2HBYB 4CHTB 3JYTB 1JJCB 2JH1A 1RHMB 3F5AA 4NXML 4CM0A 1TAMA 3PMLA 3AJ1A 4PYAA 1V43A 3KUPA 2HQ3A 1JB0C 3W7BA 5KFDA 2WK4A 4M47A 4C8ZA 2WBMA 2R92G 1EY5A 2EZZA 2CQBA 3OVSA 4Y2MA 4BUGA 5AFWA 4JI5Q 2EXUA 4ZVPB 1KVJA 4DL0C 2LXUA 1WTFA 5IE8A 4DSJA 3R5DA 4GFJA 1PVQA 4RL1A 1EZZB 3NS1A 1OXXK 4GVBB 3PYFA 2YB4A 2DNPA 1H9SB 1I94Q 1NR2A 1YJNA 1Y0HA 4DUTA 3OL9A 4OL8A 5DM63 3O44A 5JPNC 4K0KQ 2DK2A 4ZVFA 1NM2A 4ALZA 3RRHA 4J6HA 5BR8J 2Z0SA 1GX5A 2JSXA 2UUBL 2MMYA 1AT1B 1KNEA 2AEMA 1EIGA 1K28A 1T5XD 1EKSA 4LF5F 3PYDA 4TLQA 1SC3B 5FLXE 2ZUGA 4DUZQ 2ICIA 5B0AA 2VOOA 4GO5X 3HO1A 4LFCQ 4GC6A 1WKKA 4C4WA 4I2HA 1UPHA 3JAMY 5E3CA 3JAMU 3RH4A 4EI2A 1TAUA 4A8OA 1VQEA 3UXPA 1KBUA 4X4TA 4DR4Q 1Y7PA 4J9RA 2ZJ8A 3T5HA 8ICZA 3HKZC 5TZVA 1URNA 3DU5A 4CF3A 5IT4A 1FWLA 5DDMA 1GXUA 1PDQA 5AHXA 3EDQB 2YX8A 4XIGS 4B3TF 1XR5A 4POFA 5DRKA 4K8RA 2VH7A 1DGSA 1V3SA 1NHKL 4RGOS 2KK0A 4QIGA 1RZMA 2EYOA 1O7LA 4UB8U 2LQ5A 4P0PA 4OO1H 4PXCA 1EAYC 1CJVA 2CPDA 1SBBB 7ICVA 8ICEA 4ZAIA 1RKNA 2JEBI 2HD3A 3WX4A 3CJSA 4RHRA 3CDBA 4X65Q 1SEBD 3G71A 2XMMA 2DN8A 1E1TA 3CIMA 2LSSA 2JJQA 3M8RA 1E6VB 4OHWA 4ID6A 1HNVA 4O44B 4QIWE 2Z2YB 4DV3Q 1TV6B 3LPEA 5J1NA 1S97A 2EAPA 4ZKAA 4JYAJ 3UE1A 5L38A 1DTQB 2P9GA 4QIWF 2RQXA 5D14A 1VR6A 4M5MA 1EJ7L 1RTNA 4IO9A 2B6AB 4DV6Q 5L8RC 2DGOA 2OTJA 3SQGB 3KLHA 3OWEB 3JAML 1FT8A 3UI2A 3AD8C 1AUSL 3S6EA 3T3FA 3GIKA 3MBYA 4P71A 1S9FA 4KTQA 4KV8A 5HROB 2Q8RE 1NHVA 3TOQA 1XTZA 1WF2A 1U4MA 2E2JB 1PAUB 1OSDA 5KFFA 1G8ZD 3TNVA 4A3FG 3POTA 3PFEA 1NNXA 4RWWA 2ESEA 3J7YI 4PGYA 2NREA 2ZJQQ 3CCUS 1N56A 3V4IB 3UE2A 4DV4J 4DPOA 1FRMA 4AD6A 1IZ6A 4Z6FA 4DR2J 2ZE2A 1VHIA 2K5WA 5E2QA 1XNRQ 1FE0A 1CKNA 4C8NA 1E24A 1HNWJ 4FF3A 2CQ4A 5I3QA 5CABA 2WW4A 3BB5A 4V19J 2AEFA 2OPRA 4CT8A 4QJFB 4HDHA 1U0HB 4OYIA 4DF4A 4DSEA 4HT5A 3C28A 3MFIA 1YHBA 3LAKA 5L46A 4OI6A 4WF9Q 3BZQA 4BXOB 1DQ8A 3U4VA 4O3SA 2EVBA 3FC9A 2QEXA 4CF5A 5CBAE 4UUXA 2PE8A 2LEAA 2H5IB 3P5BP 3PYGA 3PUYA 4TVAB 1D0EA 4DFKA 3QWNA 4DR6J 2OEMA 1Y4ZB 2EYMA 2HDOA 1QSYA 4GLVB 1ZM2A 5ALVA 4DUYF 4YCUA 2XMKA 4PXDA 2XI3A 1EWCA 3WC0A 1Y3JA 2IM0A 1TFWA 1FKPA 2DFLA 1HHQA 2HFVA 2O01C 4PMWA 2LY7A 2UU9L 5I3UB 3EBEA 3AD7C 1AZSB 3G6YA 1RBOB 3TA0A 3QRRA 2KCTA 2BGWA 1AFIA 4DO9A 1BNZA 3RJJA 5FO8B 3D4DA 1N63A 1MA7A 5MLCV 4OZ5A 1V1OA 4NPOA 5ALSA 2YNGB 1JOQA 5ELFA 4AP9A 3A5ZB 3DKDA 2V63A 1PK1B 4HVZA 4QZBA 3QT8A 2YU9B 5GMEA 1FRJA 2RSQA 3BS9A 7ICPA 3G86A 1ZQ1C 3WK6A 1HPZB 2A1BA 3KK2A 2EDGA 5CHGA 3D54A 2LM1A 5CEHA 1YJWA 3J7YW 1YITS 2W4PA 4IUTA 2M5YA 1L7NA 1WOCA 1Y1WG 2BH2A 1EEFD 1SXDA 5EX0A 2XS7A 2MDAA 4M04A 5KFYA 3T1HJ 2GHWA 2G08A 2DTJA 1JE5A 4C11B 3LTOA 4DX7A 4H02A 2YTYA 3C19A 1NH7A 2W7OA 2RF2A 1SROA 5J2AA 2OIHA 4JI6L 1K83B 2BRKA 1OXTA 1TKWB 1F9QA 3FSXA 3IGNA 3ZNJ1 1SXTA 4C97A 1SH3A 3F44A 2BYCA 4KLSA 2XMWA 2D6FC 4ECZA 3ISNC 1SYGA 7ICGA 4USKA 4IFVB 1B64A 8ICTA 2A8VA 4CLFA 2RDIA 3I90A 2OWOA 3RD4A 3TW0A 5AJ3J 1HQMC 1N6QB 1EARA 1G291 1JKHB 4F3MA 3WKEA 1D7QA 1GUGA 1MWZA 2FVRA 1NB7A 1EETA 1ZM9A 1CK1A 2P35A 1HA5A 4DR3L 3QJPA 5L1LA 5HATA 1EY4A 1F2HA 8RUCA 1UUPA 2Q4TA 2DIUA 4IQMA 2BANA 4NKLA 3EXYA 4Y2KA 2CQ2A 1E1OA 7ICTA 2HQLA 4K14A 5IT0A 2VNUD 3HJEA 2DF4B 1FVIA 3NY0A 2OPSB 2DR5A 2B43A 1J5OB 2B63H 3FMBA 1P1TA 1JE4A 1KR4A 2DHHA 4RBTA 2XRQD 5F41A 2IX3A 1BVSA 2OHDA 4TRDA 1WC1A 2W54A 2D3OR 2CKWA 5KG2A 1I4QA 2HK3A 1OXJA 5KOXA 4KN4C 2A69D 1R6YA 4C2MA 4PXBA 2BDPA 5J2KA 5CD4H 4KN4A 1N62A 1IKLA 3CXCA 3PSIA 1JJ2A 3TP8A 4OX9J 3M8PA 3T1YF 5GVQA 2WF5A 5A8RA 1X40A 4ZUIA 5KL1B 5E1FA 1F9FA 5GAEU 4FNIA 1I5OB 4Y2RA 5B09A 1XNQF 2JA7H 3CJKA 1PCAA 1TVRB 4B9MA 2CQ1A 2RDDA 2JZBB 3PX4A 4DWIA 1B22A 2QA4A 5M5WH 1XJWB 2WHOA 4I69A 1NSPA 4IDKA 1HWLA 5ALXA 5C44B 2E1FA 3ZC4A 4IYQA 2JRSA 3A3OB 4DSKA 4LREA 3RN2A 2F03A 1SVDA 3CCLS 4FYYB 1I4HA 3IAYA 4NJ8A 3W1BA 5J0YA 1JWWA 2NPIA 3DHWC 2C2RA 5D49A 4USWA 3FEXB 2RDJA 1IL2A 4KLJA 4CLYA 5CXTA 4DDFA 2KJ9A 3CP0A 2HBJA 2K4IA 2HLTA 3C6TB 3WDOA 4YR0A 2LEBA 4BY1H 3AD9C 3IWLA 2KVIA 1TY2A 2L5YA 4A8XA 2R8JA 1JNZB 2MKHA 2V2KA 4A3CH 5IWAF 4DR5L 1YIJA 5C5JA 1MMNA 2UXCQ 1M4VA 1NAQA 4P4OA 4JI8L 1R8PA 1JMSA 1PC5A 1WEXA 3AA9A 4LW1A 1OPIA 4DPTA 4C3JB 1MNEA 5IM0B 1SB6A 1RSCA 2HWIA 2IWHA 1A15A 1AFPA 4AFFA 3IKJA 4RQ3A 5KG5A 4G7HC 2VC1A 3DXBA 1RK8A 1LFPA 1X55A 1XO1A 1KHVA 4CCHA 1DOLA 3JXOA 3TREA 4E0DA 4HHHA 4Q44A 5J2HA 4JBJA 1PFBA 2X6LA 3M2VA 4FO2A 1SYDA 4ZP8A 2QB1A 4FP5D 1BLUA 5KNDA 1FD7D 5KFKA 3DRRA 4KGZB 2Q3PA 4J9NA 2KKVA 4K2JA 3PQIA 3MM5A 4GOPC 4IURA 3RW6A 3N6MA 9ICNA 2KM8B 4LF8L 5LM7E 1JXLA 4IPCA 3LVWA 3R1HA 5DAUA 3OTOL 4KMOB 1DXSA 4OZ2A 5G5HA 4DR1Q 3PO3B 1IIPA 1QNKA 1M5SA 2VA2A 1FFUA 2ERRA 3CCQS 1RTDB 1N34J 2ZG6A 4CH7A 1K1QA 1ZQDA 2PEHA 2NN6G 1Q86T 4IALA 1U5KA 3US5A 5KFNA 1NBEB 4WORA 4DV0L 4OZ3A 1V9OA 3ICXA 1CLFA 1RWOB 4F25A 3MAAB 4RQ2A 3BH7B 4DV7L 2C22A 2BOSA 1WTOA 2VB2X 4LF6L 3BZCA 2ZJRQ 2C3PA 1NAPA 1NBWA 1RHRB 3HRDD 2K2PA 7ICKA 3QFHA 1ZD3A 4F72A 5H1SE 3T41A 1Z00A 2Y1LB 1SC1B 1WOPA 5T41A 3FHWA 2KJ5A 2VANA 4A4IA 3JS9A 4WTOB 4Y2VA 4A3JG 6AT1B 1ZQIA 3WOEA 5IYDG 3TX0A 4X64L 5CQGA 4OZLA 1VRUA 4LF4F 2R7FA 8ICOA 2GLEA 3MWBA 2H1EA 1K0VA 2IFXA 2VJUA 4JMUA 1RHUB 2PO4A 4YFUA 1HW9A 4BA1I 3NGDA 4J9PA 4Q45A 1KKXA 3OPKA 3DOKB 2JEGA 4F5QA 2WFWA 2J9DE 3S16H 3L0OA 3TQEA 2ZVIA 2E5LL 1QD1A 2HQDA 1KLMA 5M3MH 1X4AA 4O5EA 3BREA 3DYAB 3ISZA 3OR1A 1B0PA 4JI5J 4UY85 5JAVA 2MJUA 3LAMA 3J7A5 1Z1VA 1LO5D 4TYAA 2RILA 4DCJB 3OPXA 3NWRA 4J9MA 4QNLA 2OTLS 2W9CB 2V0NA 2DEJA 1I94J 3AOCA 3CMQA 2DHGA 3QSYB 2H48B 4O3PA 3VR3A 4K0KJ 1BGXT 2VDIA 4KPCA 1N5TA 4RGNA 5DDQC 1XO0A 3V4MA 1ZD2P 1LVHA 4RUCA 1S1VA 2PA3A 4EEKA 3DDIA 3QO2A 4ILLA 1UVKA 4V1Ak 1VHFA 2VHGA 4JB8B 5ETRA 2UUCL 5HO4A 1QAXA 1HZBA 3GSIA 1BE4A 2XS2A 3UCZP 3C8YA 8AT1B 1B1ZA 3PGZA 1JOOA 2KCCA 4DUZJ 1SV4A 2D2CC 1PH7A 4Y6IA 4R8NA 4LFCJ 4GLAC 4L5QA 3S14B 3ITPA 4NZ7A 1RT1B 5C25A 4WZMA 4DR4J 2KA7A 2RQMA 5GAGI 4XUSA 1YVFA 3ENQA 5BOLA 4JV5L 4I65A 1XX8A 1N54B 5E3PA 4FPIA 1BPYA 3IMQJ 2XIDA 1IL8A 3EICA 3VC8A 4ZKBB 4JBKA 3ISCA 3N01A 3KK3A 5CYJA 1BQMA 3AMUA 1D1UA 2DGQA 1ZQUA 1FE4A 4DZDA 1RI7A 4ZVTB 5IC6B 3IRXA 4X3SA 4M5DA 2AYMA 3KNGA 4TU8A 2BA0A 1U02A 8ICMA 2AYGA 4L3KA 3PIP3 3N7PD 2I5MX 1S7HA 2JNJA 5J2MA 2V9KA 2YQ3A 4U8VA 1I4RA 3BV8A 2IHEA 4X65J 1Z3EB 2L9DA 5DQHA 3HDSA 1B4SA 1X9XA 2WSEC 2B2TC 3QMQA 3DXJC 2HNDA 2FLNA 4GKKF 2W55A 4LF5L 4JOUA 2VFVA 3EGNA 5DDPC 4DV3J 5J1EA 3C3LA 2HFUA 5DDYA 3OL6A 2F1MA 3M4XA 5JJKA 3P49B 2ASLA 1BCPC 2JA6H 3QWPA 4DV6J 3M30A 4ED3A 1Q86C 1Z4NA 5AIAA 3I7FA 4WFXA 1AW7A 3HOZH 4OLPA 1FNOA 1FEZA 4R8UB 2E8NA 4JOIC 2RQ4A 2F0NA 1F9HA 2F4VQ 4WU3A 3KWMA 2PN6A 5AE2A 3G8QA 3EUNA 1SE2A 3JTOA 1NZAA 1R7IA 1ZQCA 4FPRA 2O1PA 2D9UA 4B3TL 1O51A 5A6WA 1R8BA 2A3VA 1STEA 2U2FA 4ANDA 1C0TA 2W9BB 8ICPA 3RZOB 3LGJA 1GUWA 4U68A 4A93B 3OTEA 3RFAA 4NYZA 3M3YB 3BR8A 3TVKA 2IRYA 4BWGB 2OQKA 5IFMA 2FLPA 2IBOA 2R7QA 5HLFB 5EKKA 4KX5A 1H2VZ 1KC8C 4QYZJ 3RN5A 5T14A 3Q8KA 1XNRJ 1FDBA 3KDFA 4W4MA 3FKIG 4Q0BB 2FVPA 3BGRB 4E8UA 2F44A 2Y0SD 3HHLA 1RAOA 1UP1A 4Y2SA 2QLJB 4RW7B 5CA7A 4QCLA 2NRVA 3EN2A 3TZXA 4PYDA 2UUTA 4I2BA 2CDRB 3KFUA 1ZAWA 1RT2A 3RLOA 3S7RA 1STAA 4N56A 5MAOA 3I76A 3M1YA 1W26A 4YR2A 4RW4B 4O4GB 1UFWA 3WKCA 4ZS6A 2PIIA 3MEEA 4B3SF 2JA8G 5D0GA 3S1TA 1RZTA 4YMMA 3M8SA 1UEBA 3T56B 2V67A 1NKCA 1PZNA 2DGWA 2F0TA 2OMLA 3PIPA 2MQQA 3GDXA 1HBUA 1RBAA 2XWJB 3MDFA 3N5FA 1B0XA 2GCFA 1PYBA 1QNUA 4QZHA 2W4CA 3KLFA 2ZT9C 1QUVA 2HBKA 4TQUS 4RBVA 2M7SA 3HKZE 2QLBB 1KKHA 2C42A 3RJMB 1TQOA 1YJUA 3HKZF 3L09A 4MAKA 3SQOP 2DWQA 2EYLA 4C3HH 3DCAA 2KJXA 5G5GA 1JK9B 1ZA1B 4ZHRA 3J80i 3B6YA 2D69A 1W6KA 3GTOB 1DRGA 2CPFA 3OGUA 4NL9A 4IOAA 1UWBA 3GTKB 3BS1A 1Y8PB 3K5MA 1B53A 5T1GA 3NBIA 3RR5A 2XYHB 3C21A 1Z47A 3MOZA 5IWAQ 5DM7Q 4KHPQ 3V6JA 3KKFA 5CYMB 2AKWB 3CCVS 2EY1A 2Q2HA 4OYPA 2E1RA 3KDOA 2AJ0A 4DQQA 3I70A 3BKUA 4IFYB 4YY3F 5LMUF 2JLEA 3IR7B 1D2BA 3SCLE 1IJFB 5AM4A 4I4BA 1UE1A 2L9NA 3UW1A 3TZWA 1RCVD 1FTRA 1PZKD 2HKEA 3I0RB 4DUYL 1XSLA 7ICOA 2RE1A 4XT3B 4LFBF 2VBXA 2CQIA 5FJ8H 3A3NB 3HZEA 3OTQA 2VL6A 3HT0A 1NDCA 3QRPA 1X6OA 2HVZA 5KFOA 1J5EQ 4KGVB 2HNZB 1MROB 1RA7A 2YPYA 3BJYA 2ZC3A 2KT3A 3MM8B 3DLGA 2M3DA 1HL6A 2B29A 2WF9A 1GK8A 2ZJAA 4B9XA 1NMFA 4KD3A 2DH9A 3C2PA 2VXWA 4Y7NH 2CJAA 5J0RA 2K28A 2ES2A 4DG1A 2X1AA 2ES6A 1RT5A 3CCMS 3RAMA 1WWUA 4O5KA 1A9NB 4CKCA 3FK4A 1CQFA 3SK8A 3D0HE 2OPQA 4EMDA 3BBFA 4UAIA 4C4SA 3D6TB 3J7AV 2KJWA 2IVMA 3H0GH 2ZFHA 4N5SA 2OHFA 4P75A 1P27B 1HBOA 3NASA 2BMBA 9ICHA 1HUZA 1X3FA 2F0IA 4BXXG 3QU7A 2R7ZB 2Y0BB 1OY8A 2ZXOA 7ICIA 3VGSA 2H3QA 5A8KA 2QE5A 3MUMP 1R9TB 2RS2A 4QW8A 1DOMA 3D66A 4UW9A 4AL5A 2FDRA 4X84A 2DNCA 1EFWA 3KHGA 3H2LA 3UMBA 3PKMA 4F50A 5JJBA 3KKAA 1W2BR 3CYMA 3AQFA 1Y5NB 4YMOA 3AU2A 1SCJB 3D67A 4TN2A 3AB4B 4OI0A 4R5PB 1UCVA 1F5BA 4KT0C 2HIXA 3GB0A 2HVIA 5KFRA 1BQNA 1OS5A 1SJHD 3MXNA 3LP0B 3CDAA 2GHPA 2Y8WA 5AKYA 2F1IA 3ZZUA 3HVTB 4KLUA 4NLPA 2UP1A 3RG6A 1JALA 1GAOA 4UY8T 3Q0AA 2Y1JA 1X9SA 3A54A 3S1QB 2OUGA 5KYIA 5CGKA 4IL6U 1C0AA 4GXJA 5HMWA 2R92B 2QMWA 5HMMA 1HQUA 2B9WA 3HEJA 3MMJA 1T9HA 9ICUA 4IUVA 3TN2A 2B4PA 3A7AB 4CJ1B 1UTAA 2QARA 4IPGA 1RGVA 1XEZA 2JMGA 2EFOA 4DV2Q 1NSAA 1VQSA 4P72A 3KMSA 4GN3B 4OGQC 1G6BA 1UCNA 4K2KA 1XSPA 1ED1A 1EY7A 3I4MG 3M4OB 1IR2A 2BCSA 3IN5A 4H4OB 2F8MA 4IO1A 2UXCJ 1KOOA 3CCES 1DONA 1W3SA 3S1NB 4RGTA 1C4AA 2IJFA 4DPUA 2FJ2A 2FYXA 1YTYA 3DN9A 3NCPA 2EDUA 3TDQA 1DZ5A 3TRZA 2XWBB 4B9NA 1L1OA 4HEDA 3NBPB 4NLTA 2VODA 2HCFA 3HFVA 3ERQA 4MF2A 4Z7YA 4HYKA 5CAAA 3MCSA 4NZ0A 1XNQL 5KFQA 4NL5A 5JEAH 2DH8A 3G8SA 4ZMMA 2VUMG 3R5BA 3UD4P 3GTMH 5JUMA 4ILWA 4F4KA 2ID0A 4P2XA 2VBYA 2LXIA 2EY2A 3STBD 4CH0S 5CV9A 3EVWA 3KK1A 4NWBA 1WCNA 1UEKA 2V6AA 2VU5A 1HD0A 3UD5A 5JVG3 2IVFB 5HMLA 3RUZA 3BJUA 3ALRA 4A3BB 4C8KA 2JH7A 1DY3A 1MC8A 5LJ3Y 4DR1J 3FRPB 4MN3A 4DAPA 4ELUA 2NQPA 1LTTD 2YKNA 2HBMA 3Q2SC 4YB5A 4EO6A 1W2IA 1F2LA 5HVGA 1E0BA 4C3MA 2KHSA 2VQEF 2GAGC 4J9SA 3WX8A 1J97A 1J27A 1SNMA 2F1FA 4NLSA 2RHFA 3D1OA 3E8OA 4RO0A 4L76A 2EKNA 3GJRB 2V8HA 3IWXA 4EFAC 3ITHA 4RGMA 2KI2A 1H7XA 4H4MA 4FDFA 1VDZA 3S8SA 5LMNQ 3VYSA 1Z2LA 5KFZA 1N36F 2W25A 2VA8A 3TANA 2B2YC 3VAJA 4YHHQ 3PVXA 4K7QA 3J81i 1IKMA 1AA1B 1KLGD 2VQFQ 3OSOA 2XGPA 5KT7A 1LB2B 4A48A 3ZD9A 1KN5A 1DHMA 2QC3A 3P75A 3JSMB 4PQUB 3V7JA 2DBYA 3J81j 1I6VC 3RZAA 4R8IA 7AT1B 2XN9C 5DGBA 2Z9HA 1FERA 2F0LA 1QVGR 4OZNA 2PMZE 5EDWA 3KJPA 4A3FB 2PMZF 3QOJA 3V5RA 5BYQA 1N5VA 3ULHA 4PHDA 3MMCA 3TP2A 1B43A 2C2KB 3K7AH 3IAM9 2ZD1A 4M5KA 2RAQA 4LFAF 3BN7A 4UY8C 1JUDA 3C14A 4K4YA 3DI6A 5J2JA 4LAAA 4C56C 2F1JA 3RR8A 2RRAA 1R0AB 2FGCA 3S1RH 4Q2LA 3OTDA 3BS5A 5F8IA 4O0IA 1NB2A 3BPSP 1SKWA 1NEEA 3MEGA 1X4GA 1HNZF 1IYJB 5B7WA 4OJ1A 2WKCA 2E9RX 1PYOB 2R7DA 1RTIB 2KVQE 1GO3E 4WJWA 2BHNA 5L39A 3X3UA 5BYRA 4BLGA 1GO3F 1JJHA 2AWOA 3V96A 2D74B 2F65A 3K2YA 3OR2A 3EVMA 3F2UA 2CG4A 3OQ2A 3W2VA 5CA5A 3MUTP 3IFDA 4DXLA 3OXGA 1WG8A 1NK9A 1WSVA 2HFSA 3BEGB 3IO1A 3LWMA 4RR5A 2L11A 3E01B 2AD9A 3A5UA 4EX5A 1TE2A 9ICOA 4X66F 2HVDA 1ZOLA 2KO1A 2ZDPA 2FHJA 1I1GA 1MSGA 4B9WA 1PH6A 4KLKA 1A6LA 2JP1A 2HQIA 3DMJB 3MTSA 2GHVC 1RTJA 4F4AA 2W8KA 3THVA 2QO3A 5C4JB 4OO1G 2EQYA 1SNDA 3CRKC 3D4RA 5K36H 3ET6A 1YX2A 2FZKB 3PCOB 4FF2A 4OV1A 1NZ8A 3HKZB 9ICQA 1NK8A 1FJ7A 2DT9A 5HNKA 1VLOA 1WOSA 3NVYA 2F0GA 3E9IA 3PIOA 3NS6A 1JJ4A 1Q7YT 5ELCA 1FFVA 4U96A 1XN9A 2FGOA 2ASYA 4C98A 2LU2A 1NJWA 1Y1WB 1RT7A 2FC8A 2C5CA 2YMPA 5SZTA 3OWFA 2DD8S 2KHJA 5C3EG 2ZOFA 1RXVA 3CCUA 1WG5A 5DM6Q 1IHZA 2Z8QA 4A3IH 1NOMA 4BHQA 3KF6B 1R27B 2HHHQ 1S1TA 3MABA 1HUMA 3MM7A 3JTPA 4LSZB 3I91A 2F4VJ 3M2RA 2HSZA 2A3JA 4DPXA 2XHWA 4ACOA 1VGYA 3SR6A 4CT9A 3W5YA 4LWCA 1CI4A 1WKJA 1BO0A 4CBVA 1S1UA 1GH8A 5T1IA 3PKYA 2CZVC 3D6HB 4IJLA 1NRKA 3GCWP 1ZQYA 2UV8G 4DN0A 4HIMA 4KLGA 3J80E 4OQJA 1ICEB 3SGIA 2KHIA 1JWSD 1U1MA 2KFYA 1FJEB 3G4SS 3ISND 2ASJA 2JQOA 3IGVA 1O03A 5KGUA 3C15B 3WDNA 2A1JB 4NEYA 2CRXA 5F9LA 4F92B 2QYCA 1R4PB 1S6PA 3KFWX 2HI0A 4FXVA 1HYSA 1B3QA 2P2CB 4DPWA 2W3RA 1N5SA 3POTB 3Q8YA 3V2UC 5H9FK 1NJYA 1JLAA 2DXDA 5DJBA 3UPFA 4ZVEA 1X42A 2R7TA 3IG5A 1ZQWA 1B8AA 2B0GA 1S1XA 2HDLA 3HLUA 4Y0FA 3S17H 5ALRA 1PYWD 4NXNF 5ETMA 2Y8YA 5G3LD 4WXWA 5C24A 4Y34A 3CEDA 5BPCA 4EQ5A 2IJRA 3EZUA 1M5KC 1MGSA 3CCJS 1A8VA 3DUZA 4A3KB 2GX8A 1X3QA 4GN4B 4MKAA 3RB3A 2ZIXB 2KU7A 1YITA 4C4TA 4OL7A 4N76A 4CF4A 2OELA 2XO6A 5GQOA 4ED6A 5HVFA 3SXLA 4X4SA 1XMOF 4NLZA 2NVTB 3JPQA 4OI2A 4NB3A 2I38A 2XNRA 2CG8A 2NYIA 4JI7Q 5C42A 3IRWP 1AFJA 3MPUB 1H9JA 1QTNB 3GYXB 2JH3A 4KKOB 1R6VA 2V4RA 1WCMH 3IL8A 3MM6A 4Z6EA 2V8GA 2W7PA 4M5HA 2VFTA 1A62A 3MWYW 3HT3A 3E0FA 2KN4A 1XMQQ 1FO4A 5IWAJ 4NM2A 1KDHA 4KHPJ 2KVSA 3FJ2A 2WBRA 3QAUA 1ECWA 4X65L 2ZIVA 2K7JA 4KE5A 1VLYA 2CPYA 4UHVA 1N33F 4DV3L 3P6YC 4B3SL 1WUDA 5KG4A 5FKAC 4MIAA 4GMKA 1VCIA 3HILA 2LDYA 2KCMA 3QZ8A 1LKYA 3KK2B 4FBUA 1BCPF 2CNKB 1CTMA 3Q8UA 1JI7A 4JC0A 4CNZA 2DNHA 2Q79A 1C2PA 1J5EJ 3QEAZ 2BA1A 5B0BA 3MR6A 5AK6A 4I2EA 5ETVA 2DGVA 4YXJA 2HHWA 5D3GA 4M5IA 3UQ0A 3IBWA 1L0YB 2PQEA 3MD3A 4ECUA 1BD6A 1CS4B 2ZKUA 1GUSA 4HR7B 4IH5A 4D3HA 1SV5A 3EZ5A 2YNHB 3NVZA 1LFWA 4F04B 5L9NA 2VIHA 1SR3A 1KOHA 2D7SA 5F3XB 3V05A 3W1GA 4DK1A 2DNQA 4PG3A 4QZVB 4HJAA 3JYTA 2EFQA 2KFZA 2ZJ5A 3KHLA 2O2LD 4TSSA 1G51A 4F0HA 2M8HA 3QGIA 2QYGA 2EFNA 5LMUL 5GTIU 4B3RQ 1TAQA 2B63G 1WI6A 4NLNA 3L7UA 1TV9A 3KFUF 3JTNA 5FO9B 2QA1A 1P7DA 1BUXA 4LFBL 3QIPB 2XGTA 4K6LA 1H9SA 3PRBA 3LYSA 1RYUA 3MC1A 3VAMA 3TS0A 1B3AA 2J5AA 3D6CA 2I2YA 1M1KC 1E22A 2VV5A 3MPVA 1Q4RA 4U8YA 5GMKa 4UF4A 1VQPS 5K14B 3UNGC 1U26A 4UP7A 4JI0F 1P9QC 2ASBA 1IG6A 2E76C 1GX6A 4MF8A 4AYBE 4A3JB 1KIXA 2CPJA 2JA7G 3DEOA 3DOMB 4I29A 4IQTA 1SNCA 1M6YA 2K50A 1AH9A 4KGMA 4RG1A 1WHYA 4KLTA 3H8WA 1GMWA 5D6GA 4LF9F 2JV3A 2VDHA 3GTLB 2HGMA 3Q8VA 2RMLA 4DN4M 3DNCA 1IYUA 4OCZA 5C0XI 2ZIWB 5C4XH 2OKQA 2DGZA 3N6NA 1RUSA 1K3BC 1CC7A 2L3MA 4GNXC 2JLFA 2HG4A 1LYLA 4DV2J 1RT4B 5DLFA 5FDLA 1ILPA 1OTCA 1Y8OB 2W01A 3QUBA 3K80C 1PZJD 1RL2A 3DLLA 4G7OC 4A47A 1D5XC 1EYAA 4BY1G 1A76A 2CQPA 3S6JA 1NUEA 2RP5A 4LUBA 4IOCA 2V94A 1TY0A 2JOQA 2PI4A 1HI1A 4OHXA 3CCRS 4A3CG 2NB0A 5A6PA 3OUYB 4DSLA 1NSKL 2VG5B 3NL0A 1X2IA 2MQHA 5C5MA 1M90C 3CCQA 3NLCA 3I4NH 5BOMA 3J81E 4FZVA 2AJ4A 4O44A 1TV6A 1U48A 3ZDAA 3G48A 2ZXRA 4NM1A 1DTQA 5EQ0A 3BZKA 3PM9A 2F4FA 3JPRA 2NVQB 5J22A 5KFIA 2XLJA 2B6AA 2UXBF 3BQ7A 2DEIA 4RPXA 5K4LA 2PPBC 1JC7A 3SQGA 3U9OA 5E7NA 2EW9A 4ZLLA 1YVCA 2HIQA 2VJ4A 5AKXA 4QZ9A 3L7PA 3CJ3A 4JI4Q 5KFPA 1PJ6A 5IT9Y 4ENOA 5IT9U 2HUGA 2RS8A 1Z19A 1YEZA 1U8WA 1D5ZC 3LGMA 1L0WA 5HROA 3QO9B 2AT1B 3O8WA 2NO4A 2KE7A 1RISA 5DEHA 1V6HA 2ZTEA 1HLWA 2K4PA 2AGPA 3PNIA 1HCZA 1N9WA 1JLGB 3VQTA 3JAMi 3GQCA 1Q81C 4RNOA 4PGQA 4NLOA 3V4IA 3DLBA 2OXPA 1VQIA 4AUKA 4I2IA 1S0NA 4F87A 1OWXA 2W1BA 4P4PA 4ZJOA 3Q24A 3MPYA 1KAAA 3I56S 3SR1A 1B99A 4GOPB 5EX3A 4RW8B 4HIKA 2HBZB 5LOQA 3HHKA 5LMNJ 1MSHA 1LK5A 3UXOA 2N4DA 5H9EJ 2E7XA 3HJVA 4BY7G 2MQPA 4YHHJ 4H7BA 3ULPA 2MA1A 4QR1A 9ICFA 2K8BB 4QJFA 5EPKA 1U0HA 5IS2A 4C0BA 3L5KA 2WVEA 2VQFJ 5F8LA 4BXOA 5KT2A 3URYA 3MXHP 4DOBA 4OO1J 2B5JB 3FFIB 3TBIB 3Q22A 2YWEA 3J7AN 3CC7S 2WVFA 1YSJA 4NLKA 1TR5A 3IM9A 1Q1EA 1RWWB 1L5UA 1B7FA 3AQQA 3I8ZA 2P9EA 1LTSD 5M3MG 2GZOA 3FEZA 3NEMA 3C6UA 2KG0A 4LSLB 2XEXA 5IT9L 2DJWA 3ED5A 2E3TA 5I3UA 1F2GA 4FN5A 2I5HA 1ZAVA 1AZSA 2C3MA 2Q43A 2BJEA 2VQEL 1S5ZA 2IHMA 1Y10A 2NZOA 3OHAA 1VDVA 4UOFA 4X3TA 3SSQA 1F9RA 1H72C 3FKIB 1FR3A 3OD2A 2E2JH 2Q66A 1LOUA 2O5JC 2YNGA 1KD1C 3D4JA 3ER0A 1PA6A 1PK1A 4GKJQ 5ALMA 3IP4B 1F0XA 4M9NA 4DQRA 1VQ5S 1C1CA 1VQ8S 2OJ3A 5JMNA 1Q8IA 1HPZA 2UXCL 5FLXc 9ICWA 5J2QA 4N8FA 2B2WC 2RVJA 3HOUH 2DNYA 4RUBA 3NGSA 1JWMD 4L72B 3HWTA 2FFKB 1X4HA 2JA8B 4UOGA 2EBEA 3JPSA 1HIWA 2Z4HA 1D6EC 4EQNA 2HCIA 2NRWA 2MKYA 4YQWA 4C11A 1PTOD 2DXEA 3O5TB 2HWTA 1TIID 4PAAA 1O8BA 2HBQB 3ZTRA 2OH2A 4ZRZA 2VFSA 1A77A 1KFTA 3NNAA 4LMQD 1STBA 5DG9A 1YLXA 1TK5A 4HCEA 2FHKA 4JPBW 4FZLA 1HA6A 4Y2XA 4LFAL 4IFVA 2AU0A 1X4EA 3N4MB 3QE9Y 2MY7A 1N6QA 2CVRA 1FDNA 2FQQB 1JKHA 1COOA 3PF5A 1PH9A 4OZ0A 3LALA 2MKKA 5JPMC 1GQEA 4O5CA 5EE9A 2GIQA 3BZDB 3MFYA 2RLTA 4R66A 4OZJA 3MPDA 3U50C 3NS7B 2KT2A 4G1QB 3MMBB 5U47A 1Y8NB 3VAIA 1K73T 3AFQA 3R1LA 4R0EA 3FSIA 2YU9H 1VDHA 3SCKE 2DHSA 1NPRA 4AQYQ 4F67A 5J2MB 4B3MQ 2OPSA 2HHHJ 5IGBA 4TNOA 1J5OA 4BX9C 2ZUAA 5KIXA 2OCEA 4RT2A 3HOZG 5AXKA 2HCCA 1Q12A 1FX2A 3M8WA 2WB1E 2R2RA 2YB1A 2A18A 2QA2A 2WB1F 1M1GA 2KDOA 4KR0B 2MZTA 4X66L 1LXJA 3SHLA 3AL0B 2P6RA 4RCOA 1RCXB 2EG1A 5E3FA 1VK3A 2BZ2A 1EZ6A 2WONB 4UAYA 1BQXA 4ZP6A 3J80Y 2AZ1A 3P7JA 3J80U 2F0QA 4IC9A 1R43A 1U1RA 3FGVA 2B39A 2HMXA 1A6SA 2QMXA 1RTHB 1VJWA 2HNYB 5DETA 4LMZA 1PH1A 3WKBA 1CC8A 1E6YB 2MHVA 1TVRA 3G9CA 4JW0A 2BPCA 2MEWA 2JZBA 3OJUA 2KG1A 4KN7C 2NTTA 1HMVB 4HR2A 1BBXC 1DQAA 4KN7A 3J7AF 2SDFA 2KZ3A 4Q43A 3I4LA 2H65B 3K57A 5ETKA 5AI8A 2QF7A 3PIPQ 3H8JA 1JJ2R 3D3BJ 1IM4A 2GIRA 1VC0A 1A6XA 4X4PA 5HJYA 3C16B 1T9WA 1JLCB 2CPHA 4QZFA 4PG7A 2VF3A 2LYVA 2Y9TA 2FDNA 5HY6A 2R7XA 2J8AA 2MAXA 2QLTA 1WOOA 3C6TA 5IIMA 1J2MA 4QMGA 2O67A 3EGWB 2EWHA 1GKHA 3P45B 1VQNA 2QFIA 5CB1A 3GTQH 2YH0A 3CCVA 2MRLA 2UUAQ 2U1AA 5LL6S 4QGUA 4HACB 1I3QB 5AKHA 1PH3A 5IM0A 4C3HG 3QR8A 1T95A 1RHQB 1BPZA 1LABA 3MR2A 3J80L 4FYVB 2VB3X 4PMBA 4OLOA 3EPGA 3EFXD 4CH1A 4JI7J 2IM1A 2EAMA 3HOWG 3EJMA 2F52A 4OX7A 4PNYA 1HR0Q 2HK2A 1IBKQ 4DNIA 1TMMA 5AE3A 4F5PA 2EZVA 4BS2A 4PJ0U 1XMQJ 5NUCA 4ZPAA 1RDRA 1QQ6A 1REGX 1YNNC 3SK5A 2VKRA 1K8MA 4TUQA 2LQ9A 1G2SA 2LMCB 4J5OA 1J6QA 1ZKOA 4A8SA 1S9GB 2OD6A 5HURA 3DHXA 1X56A 3OMGA 3EM1A 4J03A 1S59A 1B44D 3AT1B 4N41A 1F5SA 3N4WA 3OL7A 2E5HA 4NPSA 2OT2A 3D3RA 4JI3F 3M32B 2L12A 4NXNL 3CCMA 1RTDA 2KUMA 1R0BG 1FCAA 3D31A 2D3O1 2FXQA 2EH9A 5EPLA 1C1BB 1J8IA 4NXMF 4RQNA 4NP5A 2F77X 5FJ8G 5ALUA 3IXQA 5D78A 1KW4A 3MAAA 2YNFB 2F4VL 1X3EA 4R64A 2R7UA 1K73C 1ZQBA 4DV1Q 2A69C 4NI2B 2IOHA 4DNRB 1XMOL 1RU1A 1RA6A 5C0XH 2VUMB 1HIYA 3VAHA 2A10A 4NRUA 1ZQRA 4IQZA 4LF7L 1HPCA 1WCLA 1TWHH 3R2DJ 1RACB 1UT8A 1B70B 1VJQA 2AYEA 4X2BA 5KNIA 2H3VA 4C4RA 3R5JB 4DSFA 3CU7A 1T5EA 1SJFA 4U673 3FC4A 3H8YA 2GMLA 1S76D 1D1KA 1SQGA 4IG0B 2JDJA 4QR0A 2AXTU 4HJ5A 2YX7A 1NCLA 2UUBF 4NLBA 3SK4A 3ZDDA 3P1HA 5JXSA 3DOKA 3GTPH 3T53B 3ULLA 4IFDG 3M8YA 3D6MB 2ISPA 3H0GG 2H9ZA 2ZM6F 5G0RB 4RPFA 1RAFB 1N33L 1Y3KA 2Z2MA 4B3RJ 3IC1A 3TYTA 3DYAA 1DTTB 1L7PA 1P16A 4DV5Q 2MHNA 3NXZA 4USMA 3R2IA 2IY5B 2L08A 4Y2CA 3NTIA 3FCWA 3IG1B 2NRTA 1X4FA 2PZWA 1TWCB 4XQJA 5I3PA 5JVH3 2ZH2A 1L3UA 3KTQA 2YKMA 1MMLA 4A75A 4KLEA 5HMZA 1Q82T 3QT5A 4ITSA 1N32F 5H2FU 2UZAA 2LHTA 1IBMF 4UB3A 4OYOA 2N88A 2EXZA 1AZQA 2ZBCA 4A46A 4YMEA 3D1HA 1RWPB 4JB3A 3HOVB 3CAMA 1BPBA 3TJAA 3PNCA 4BCAA 4A3DB 1S4EA 1PK3A 4O3MA 4O1NA 5ELEA 2E8PA 3CCEA 1RT1A 1UVLA 4UQGA 4PZ7A 4C6AA 3P8BB 3V81B 7ICJA 4PHPA 4R9WA 4CTAA 2I5JB 1KONA 5J2IA 2B21A 2EXDA 2B7BB 4FS2A 4XDXA 3MR5A 9ICLA 1Y69U 2GQ2A 1FHTA 5I4MA 1MWYA 4WP8A 3UR3C 1UVNA 4FXKC 4WFYA 4ZH4A 2D5DA 3KLGB 1A7GE 5J0QA 3GTGH 4J9KA 3F2CA 2AGOA 4USTA 2F0JA 2LKYA 2FINB 4MHVA 4DQSA 4Y52H 3JAME 7ICHA 4MEYA 2VKZG 1VI7A 1IBLQ 2QFJA 5D46A 3UMGA 1RODA 2K33A 4A8EA 3TKAA 4OI4A 4X4VA 3ICEA 1CKOA 1U0SA 2BCUA 2QT7A 3SENA 3J81Y 4JI0L 3J81U 4C8YA 3WU2U 2OFHX 1AXQA 2BKEA 1J5EL 4CQ1A 2MXYA 5IC4B 1NDKA 9ICIA 2G2OA 3UR0A 3IP0A 5C6AA 5LSOA 1RCOB 3OMCA 4CO5A 1KSPA 4ZOHC 2VA3A 1YG0A 2OD4A 5FP0A 4R8UA 3ZZZA 4DFPA 2AF6A 3WK7A 1LTLA 2J9EA 2NPFA 4J9UE 3S14H 3Q8PB 1NY4A 4JI4J 2KKPA 5J0OA 4MFBB 1V5VA 2E1EA 5THWA 1ZPVA 4J9QA 5IGGA 5I42A 3HK2A 2RU9A 2Z0GA 2BE2A 1VQCA 4F4ZA 1F6TA 1VQLS 4J9VA 2DPJA 1G4CA 1TS5A 2MUTB 2BW7A 2W9BA 3WKAA 1MBYA 3PW7A 1RAGB 2VASA 5AI0A 2KHQA 3HVWA 2K1BA 1VQ4S 2XSCA 3T5JA 3M85A 4URSA 2F9JA 4DPGA 2DY8A 5HLFA 2ZIUB 2ZBIA 3T6JA 1JMTA 4PABA 2CQCA 4QOTA 1KAWA 2ZJPA 4PV1C 3WZ0A 2F0UA 3FRZA 4RWXA 4Q0BA 1SH0A 3BGRA 2CQ3A 4EZ6A 4KLQA 1GT8A 1ULRA 4RW7A 5C3EB 1KQKA 1IW7C 1FFSB 1DLOB 1WFQA 3QT7A 3J81L 3C66A 5DZ6A 3HM9A 2H3ZA 3A12A 3DMUA 1T3QA 7ICRA 3K0XA 3W2WB 3ZDBA 1JLBB 4RW4A 3KOAA 1VQKS 4O4GA 3VGTA 3DM2B 5FD1A 3QNWB 4AXJA 3E9HA 4DEZA 4DLGA 3SV3A 2HIVA 1YZ7A 3MD1A 2HVHA 1CZWA 3A3PB 2HHXA 2DH7A 4LRFA 3ZYYX 4B9TA 1KBRA 1JXVA 1TQLA 1DK3A 4W90B 5AM0A 3Q86A 1WHWA 4NLCA 4ETXA 4LVSA 2PC6A 4M5NA 4Z2XA 4X62Q 4ZIVA 1GNKA 4QBUA 3MEKA 3ZTOA 2SOBA 1O7YA 3HGBA 1X4CA 5JVGQ 3BQTA 1YNXA 4DV2L 4M63A 1RT6B 3R2CJ 1L7MA 3D2NA 3LVVA 1CSQA 3RZOH 2BDUA 4A93H 4JI6F 2F2AB 4GKJJ 2NR0A 4ZVSB 1DJRD 3RTVA 5E4WC 1FJGL 1QAJA 4ILMA 2KP7A 2A6HD 4F93B 4IUPA 2HOFA 4DS5A 3BYYB 3NTUA 5IGCA 4UB2A 1QG7A 3KUHA 3AXMA 2WF8A 5CYMA 4HIOA 4KY3A 4JI2F 4B9LA 2K14A 1GMUA 1EIYB 3KXDA 5M5YB 1Q46A 3G82B 2L4NA 4K8JA 3DLJA 4G4KA 5KEEA 4IFYA 1I3OB 5E79U 1PYTA 4IPHA 4A3EH 2IHR1 1ZQPA 2HZVA 1SNQA 3PO5A 4M0AA 2QMUB 4G9BA 4PQAA 4CE6A 2DNNA 3I0RA 4LRCA 1I4PA 3TEHB 2ZUDA 1CVJA 4DU8A 1XYIA 3U27A 4QZGA 4KO0B 4PEOA 5CBEE 2CZ4A 3C2LA 2HNZA 3OT9A 4KTAA 1MROA 1IKXA 1X66A 4KQZA 1UETA 3MM8A 1HNXF 4LF1A 3MCOA 4IPDA 4TU7A 4RNMA 2MQ8A 1E2WA 1HD1A 5ALFA 5I9OA 3SMVA 4L3NA 4LJXA 3SSRA 2E9ZA 1UMJA 3BS7A 2BQ3A 3LDAA 2M8DB 2CDQA 3G6VA 1KLUD 2VD3A 2D41A 2KCNA 4L5SA 5CP2A 5AKIA 4UUWA 5HP1B 2W04A 3KLWA 5GADU 3GTKH 5FK9C 2IX0A 4HH0A 4AQYJ 1Q95G 4B3MJ 4DOCA 2Y0SC 1MN7A 3BM7A 2FPKA 3G4SA 1U1OA 3PUXA 3AU7A 1EQRA 8ICFA 1RXOB 3QRQA 2VQFL 1HQRD 3FCVA 2MB0B 3SAFA 3Q6SA 3ILJA 4WFZA 2WINB 4C0OC 2VC0A 3C46A 1RAEB 2R7RA 2LYAA 3DC2A 2E8GA 2CQDA 3MTJA 2VZ9A 4QWBA 5IYCH 2FLOA 2I6XA 3X3NA 2XMVA 3H5SA 2MPUA 2PFDA 4YD1A 3G96A 4R5PA 3TARA 5AK5A 1HQEB 4KJOA 5EHHA 2ASDA 5IIFA 4JV2A 3LP0A 5KT5A 1JIHA 1IN0A 4X5VA 2RT3A 3MUVP 5ETSA 1XERA 4ABNA 3HVTA 3GV3A 4UW2A 3I5CA 1ZTWA 3NAIA 1PRTC 2ZVSA 1HWJA 4DR5F 5AM1A 3NSWA 3T9NA 3NENA 1RQLA 3KLIA 4MK8A 4JUZA 2B2UC 2IOFK 5LSLA 4LVOP 2OEKA 1MG7A 4MTPA 2CYYA 1V8QA 3BO4A 4XAKA 3RU0A 2HPUA 3MDAA 4O0AA 4QZDA 2R2TA 2BKOA 5ALTA 5HVHA 1RE1B 3ELHA 1Q1KA 2M9KA 1BUVT 1FWPA 4EK2A 1ZAXA 3PSTA 2OMOA 1DXMA 4HCSA 5ETLA 3CQZB 3TVZA 5C2CA 5HGQA 4KPYA 2R7ZH 4RUHA 5KFJA 4RNFA 4H4OA 4OELB 2EYFA 3VF0B 3ZZ0A 5LHY1 2UUAJ 4G65A 2CWKA 3KLSX 4XDCA 1F2YA 3OTOF 4J37A 4DR7F 1ZQVA 1EEID 2KENA 5C3WA 1KXLA 3W65A 3NBPA 3E3XA 5CWRA 3QLHB 1F9PA 3R5CA 4XK8C 3VYTA 1HR0J 4R4QA 1IBKJ 2AJ1A 4X4UA 4PQXA 3F2DA 3H20A 2X3GA 4JI1F 4XO0A 1BWEA 3PFOA 1WCMG 3E58A 8ICGA 4DXFA 2C1EB 1GUNA 4EENA 4DV7F 1LNQA 8ICSA 1WNEA 3QUCA 3NNHA 5I2XA 1PVOA 7FD1A 3Q23A 2FC9A 2C2EA 4QWCA 1NO8A 4DZ6A 3RLFA 3HD2A 2AQ4A 5IP7H 4QJVA 2ZHAA 3CE8A 2LA4A 1PXUA 2HOQA 1UW9A 5IGFA 1XWLA 5D4PA 1GTEA 3MM6B 3ADAC 3L4BC 1GXLA 5ALOA 5ETOA 3L9ZA 4PWDA 5KNBA 4QYRA 3MEFA 2HYIB 1CSPA 3VYRA 1MN9A 2PYKA 4Y2JA 1ZQZA 1ZD5A 2YKAA 3TP6A 4DV1J 1LTRD 3R2TA 2DNGA 1HHSA 2WOMB 3OV7A 3HSGA 1K1SA 2M4MA 3ZZRA 1I6HB 1CQNA 1K8AC 4KLDA 2DGUA 2Y0SG 1ZYRD 4K4IA 2CPRA 2MGSA 4MFFA 1REVB 3QZ7A 3O13A 1U45A 1CEZA 3W5OA 1STNA 1O7ZA 1V5IB 2V4JB 1Q3LA 4J90A 3I0SB 3JSMA 4LRAA 4PQUA 2X1FA 3RGIA 2UXDL 4RW9B 3SK6A 3HX9A 2WAQG 3BO2A 1SL0A 4RFBA 1VQPA 2ZWOA 1Q1BA 2P5VA 1SJQA 1H9RA 1NK6A 1RBLA 1Z4OA 2HWHA 2AV5A 3EA6A 1ONLA 4YN4A 1X9NA 1ZZNA 1EIFA 1YJNS 2UU9Q 1DURA 4YIJA 3D0IE 5AKJA 4DV5J 5JEAJ 4JI3L 4H4KA 2CAJA 2M2LA 3Q8DA 4A3BH 1F0MA 2NYHA 1ZM3A 5AI5A 1YHQS 1SIJA 1R8CA 3A4TA 5CORA 2WRMA 5IINA 1JLFB 2KHCA 3H0PA 1SZHA 1OQ6A 4Y3CA 1R0AA 1HBNB 3TZUA 2KYZA 4ZITA 4BY7B 3A55A 1RJJA 2QX0A 2OPPB 2ROGA 5IIOA 3RBEA 4P7TA 4MH8A 2XZWA 4DXGA 2YWWA 1FXRA 2PSZA 2B2VC 1RTIA 2BE5C 4F4XA 4M8AA 2OLWA 5EPJA 4L74A 1PYSB 3EVOA 4DX5A 1X3PA 2B2VA 4EWTA 2ZH1A 9ICKA 4M1KA 3C1ZA 3CCRA 4P73A 2MZSA 1Z1BA 2K1RB 3TSSA 3VR6A 1IR1A 3DWQA 4K5XA 4OEMB 3DEPA 2BRLA 5LL6d 3AQPA 5KFEA 5M3MB 2KRRA 3DRSB 1KDNA 3E01A 2BM0A 5C4XG 2ZM6L 1A0PA 3STBC 2DBBA 1X6IA 5M3FH 4MFAA 1Y00A 2YNIB 3MM9B 1TP7A 1SKUB 2CPZA 4LBIA 3ZZOA 4NYPA 3G71S 4OHJA 5E0OA 1QWYA 2GW8A 3DMJA 4DHVA 5ALJA 5KFTA 1IBLJ 2BXJA 2DGTA 3ZZPA 1V38A 1VBKA 4QZCA 5A0YA 3EYZA 4C0HA 4WZQA 5K8NA 3L3OC 1RT3B 2DNKA 1AN8A 4F26A 5DLQE 5CHCB 5EAYA 1N32L 1Z2ZA 4DR3Q 2XLKA 1Q0NA 4EBCA 2J7KA 1IBML 1GJXA 2YXLA 1TVAA 5FDLB 4RBUA 5F8MA 4GNXB 4DS4A 1WTPA 2B8GA 3H91A 2FMSA 3QUQA 3I4NG 4CLPA 2WVDA 4ZPWR 1QE1B 4CDEC 3M8ZA 2HLUA 3O0FA 2VIXA 2ZJQA 1S6OA 4KIAA 2YWKA 3KF6A 1HW8A 3I56A 2GC8A 2YX1A 3I9ZA 3SVMA 1Q53A 3OSNA 3CF5Q 2FVCA 2EFPA 2BA9A 2PI2A 2Y1IA 4Q8FA 2EJGC 1AP0A 1U4LA 1L2FA 4JK1C 2EI5A 1YGYA 4LF2A 5BR8F 2B7CB 2HGLA 3A13A 4X3UA 1VQBA 2YBVA 4ZIWA 5E3AA 4G7ZC 4A8WA 5DG7A 1P6TA 1S77D 4WYWA 4NRTA 3K7RA 3H59A 3HULA 3GJTB 3RLNA 2J6UA 1R8AA 3A7LA 2XY5A 3HW8A 3CC7A 4B3RL 4DF7A 4QY7A 2BEFA 4NXZA 1AYEA 3BDEA 2AWNA 4UOHA 3CC4S 2R7VA 4PPDA 4AH6A 5H9FJ 3NMAA 3X1LB 4HJ9A 1TFYA 3JSBA 3C15A 3VTIA 1B4FA 2A1JA 5AXMA 2ZH9A 3WIVA 2VPXB 5C4JH 4I6WA 4QW9A 5AI4A 1VRTB 2XULA 8ICJA 2C3UA 3AJ2A 1S1WB 3HSZA 1TS3A 2J4XA 2PNHA 4UPAA 1S6QB 1X31C 3HOZB 4PRFA 2GNKA 2DPIA 4Q8EA 2DNRA 1G2EA 1CHQD 4EBEA 1Y1WH 2MP1A 1FD8A 2DYAA 4ILRA 1N48A 5CYUA 2CJBA 1VQ5A 5CRXA 3GFKB 5T7LB 3QQCD 1LV9A 4NV0A 4P0QB 4JI8Q 3KYLA 2X7IA 1ZETA 1SGGA 2ZIXA 1L0XB 1NHUA 3IAS9 4X4RA 4X62J 4P2CB 5H9EK 4HIDA 2N4CA 3D6JA 2DR7A 5K20B 2LXJA 4H44C 5F2DA 4NLWA 1FKOB 7ICQA 4JYAF 1RF2D 1ZPWX 4MTKA 3GV8B 4U9RA 3LP1B 3RBDA 4G6VB 4JV0A 1Q8KA 1VQGA 3VR2A 3AB2B 2KV2A 1FIQA 1WELA 1YJWS 2JWNA 4KKOA 3QBCA 3C6UB 4KLLA 2BABA 2Q6CA 1LV5A 1OMSA 3N52A 1GTHA 2BE7D 4K4ZA 2IAJB 2XQCA 2DUDA 3GO5A 3FBCA 4EBDA 4KFBB 3DDKA 1KWMA 2WB4A 4FDBA 2F63A 1YNJD 3WQPA 1QUQB 3BKTA 2APOA 5HQ8A 2RVLA 4LF8Q 2IRUA 3HOUG 2M0GB 5HHIA 4ICAA 1QVFA 4U6PA 2X51A 1LWFB 2AYBA 1XWEA 2KRBA 1X8DA 3OHBA 1SYCA 3NELA 1YBYA 3U1NA 1X5PA 4QUCA 3F5EA 1C1CB 1TKDA 4Q7AA 3C23A 4DV0Q 1QDUB 4PUOB 2JR5A 4DR2F 3QAEA 5J2QB 4DFJA 2MSSA 2LQBA 3KF8B 7ICSA 4UAVA 2NXJA 2ZDOA 4DV7Q 3FRYA 2R18A 4LF6Q 5J29A 4YS2A 1HNWF 3Q8SB 2PQAB 2KB2A 4L8JA 3MF5A 4LSNB 4S0MA 2AQ1B 2YY3A 2ZUBA 1C0UA 2ZZMA 1ICFB 1CSJA 4A3KH 3HOWB 2CJ9A 2W3SA 2DUYA 1BPDA 1TS2A 3PUWA 4K4SA 2B56A 8ICAA 1RKIA 4RUAA 1CS4A 4BJQA 1Y5IB 4X64Q 5J39A 2YNHA 3K1ZA 1MQ3A 4K4TA 3ZI4A 2C2DA 4DBQA 3EX7B 4CKEA 1U6ZA 4MIBA 3UDGA 4ZK7M 3TR5A 2NVTH 4DR6F 2NZ1D 1M5OC 5KAKA 2N3LA 4L5RC 1RDPD 2I5LX 4CGYB 1GUOA 2E5LQ 2QLFB 4JI2L 2K5DA 1NXIA 2AWZA 1Q16B 1BXNA 1NDPA 1YNND 1MSWD 3RBZA 1HBMB 1K0TA 1YT3A 3BSOA 1SFOH 1OPZA 3K5LA 2ZBQA 3AEVA 2AJ2A 4GZYC 1QJHA 1C7YA 2V4DA 2QL5B 3RRKA 3T5KA 5J2FA 1VCTA 2G0JA 1FGUA 2OEHA 3OTBA 5E41A 4PL2A 2B8FA 3SEOA 4K4VA 3ZJYC 3QIPA 4YB1P 1H2TZ 2K32A 2ZTDA 7ICMA 2RSNA 2MQNA 2CQGA 3BG3A 3MCNA 2VKQA 2H3IA 4WIIA 3I28A 4CDDC 2LYHA 3LWEA 5DO2A 4F02A 2UUCQ 1DQ9A 4OJPA 3OW2A 3J80c 3ERSX 1HNXL 3H3VC 5K14A 2G5DA 2XYGB 1X7VA 2R8KA 4LJMA 3GR0A 1PZID 3WOFA 1XK8A 3NKYA 4ZJLA 4I2CA 4IQVA 3DOMA 3P5TL 2LEPA 1YZ6A 2AQ2B 4R4OA 1JXEA 3T1HF 4JV5Q 4J8QA 2Z58B 2W8LA 2DL0A 3F0NA 1HXYD 1CZGA 3H0GB 5J2NB 2F0DA 4GKJL 1WTXA 1SV0C 2BM1A 2ZIWA 1I4GA 3GIRA 4FKYA 4DLEA 1NJIT 4PG5A 1SV0A 1U2FA 2IC3B 2E2IB 3K5PA 4PG8A 1KFSA 1RT4A 4JWMA 3IS9B 2XYPB 4ZVHA 2BJ7A 3ILIA 1EOTA 2MGZB 3SIPB 5AJ3F 3CT9A 5EE1A 1ZA2B 1KEKA 2BQRA 5KNCA 2XVTA 2P6SA 2RDFA 3GG1A 3G6ES 4JCVE 1PUZA 1PC4A 1U9RA 3DLEB 3FBFA 3OUYA 3M2UB 2RBMA 5IV3A 2VG5A 4CLUA 2CVEA 4LF5Q 3B4DA 1ZJNA 2QB0A 1X60A 4RX6A 1CJUA 1FF2A 5KFMA 2YY6A 3ILOA 1SYEA 2RNEA 3LF0A 5KFBA 4PMCA 3N0VA 4A8MP 3BYTB 4UDUC 3D4WA 2M70A 1OQ3A 8ICHA 4WJ4A 3W8GA 5CCLA 4H0LC 2E5SA 1A2TA 3UD3P 2A68C 1B3TA 5IYDH 4IUUA 1G1XA 4C2MH 5HANA 1SJ4P 3M7VA 2ZJRA 3TZYA 3BVGA 1IKWB 4B3TQ 3UDIA 4IQUA 3IV6A 5B0FA 4OX9F 4U7UK 3SBMA 2A6OA 4EVOA 3R6GB 2ALYB 4WJ3M 3GTLH 5A35A 9ICSA 3QO9A 2FPMA 4KITB 1X9MA 5HGTA 3L9AX 4I2PB 3PR5B 1U1PA 3PACA 4UP9A 4AQYL 3BGFA 4Y65A 2CWPA 3G6XA 3BSCA 4YN3B 2Y0SE 2G5IB 1JLGA 2GA7A 3U4ZA 2BCRA 2Y0SF 1EL0A 3ORYA 3HJFA 4FNFA 1KLNA 1Q7LB 2BW2A 3KG4A 4USJC 5HJXA 3TUJC 3QX7A 4GOPA 4DR7L 3GWCA 4RW8A 1CRXA 2O5IC 3BR9A 1ASZA 3AJDA 4HDGA 1PAEX 1MQ2A 1QM9A 4L63B 1SQEA 2GVBA 5C0XG 1VQDA 2KECA 1T9XA 5CZVA 1WC5A 2X1BA 5TISU 3EIVA 4N77A 4HHUA 2B9EA 2MKJA 4ZPVR 3QIDA 1ZS6A 4JI1L 1XPUA 3VGVA 5J2PB 2B5JA 3FFIA 3VALA 3PR4A 4PZ6A 2KBNA 1TL5A 4I2AA 1BWVA 1F5AA 3MHYA 1TL4A 1U7LA 1V3ZA 2A0FB 3QGHA 4JV1A 3FYHA 1LWCB 2N82B 1ASYA 3I2ZA 2K5NA 4C3LA 3HHDA 2UU9J 1MW7A 5E3RA 2F0SA 2ZEJA 2FJWA 4LSLA 5AIBA 2K6AA 1SN8A 2C9OA 4OJGA 1ZQSA 2EZYA 4DJBA 3NGKA 2L5TA 2RJZA 3EGZA 1ZTTA 1VQJA 2LQ8A 3R6LB 1KC8T 4C48A 4Y2TA 5AM2A 1RLDA 5CZXA 1Y5LB 3RF9A 2W2NP 2UVWA 4ECTA 1AUDA 2W43A 2ATCB 1YJVA 1UPMB 3CDEA 1WD1A 3TUPA 3KJNB 1B4OA 1NJIC 2N7YA 3JQMA 4YP3A 2E2DC 1QY7A 4CWBA 1IJEB 4O23A 1QB5D 1YJ9S 3C5GA 3GLJA 5RUBA 1RM6C 1P9YA 3CCZA 1JR0D 4BBRG 2HQCA 1IW7D 3OVAA 3Q8MA 3ZTPA 2YKMB 1Y1VG 3V6DB 2GVZB 5A8WA 3MMAB 1S10A 4DUYQ 3PEHA 4ES2A 4F3OA 4X4QA 2BQUA 2ZBRA 5SUHA 2PZTA 1WSRA 3Q2TC 1ML0D 2K52A 3SEBA 2NVXH 2YTVA 2V2ZA 3W66A 1GXDC 2RSOA 1RWKB 5GAHI 3G2XA 1SKSA 1U24A 1KRTA 1WF0A 3BPDA 4DL6A 2VS1A 4U67Q 3GU0A 4K2XA 1WF1A 1ZXIA 3MFHA 1UE7A 3R3OA 1LWEB 3MC0B 1Y9OA 3HKWA 4CTAB 4WFBQ 4C8MA 3K8WA 4ZCIA 3TACB 2MFIA 4RQ6A 1BDOA 5IGEA 2KVMA 4UTGA 5AI9A 3GONA 2G2ZA 1S49A 3F41A 3BYPA 4ELTA 1OY9A 4DR3J 3NXWA 2RHSB 5HMYA 3HOXH 4OJHA 2KNJA 4EGVA 4FBTA 3J81c 3NNCA 1VQLA 4UAZA 4Y00A 5DKWA 2EANA 4JBMA 4G1QA 2R93H 4IRKA 1LK7A 3MMBA 1PVPA 4CO0A 2WKDA 2HIYA 1BPXA 1VQ4A 3V7KA 5IQ6A 2YQ1A 4DKAC 2E2HH 2A2DA 3EW9A 1DD2A 1G6ZA 3JSYA 5JVHQ 3GJQB 2EYPA 4JI5F 5K5MA 3W61A 1CA6A 4A8QA 5I2YA 4KSEB 1TWFB 5CH7B 1BQQT 1IXRA 1I94F 3PMNA 3M9NB 2JA8H 1ESFA 2AUJD 4K0KF 4XRHA 1ZRNA 2B2TA 5K8PA 5HL7Q 4P2SA 2JC0A 1C4CA 2JA5B 4I1TA 3T51B 4HI1A 4ANCA 4FNHA 1S5DD 1TKZA 2WONA 5EWGA 2ZJPQ 2K5QA 3AY0A 4NLGA 1FRHA 3W9IA 1AE3A 1NK4A 1RPLA 4WRDA 2R8HA 1BKBA 4DUZF 4QF4A 3BU2A 2HBLA 5EUHA 1OIAA 4LFCF 1RTHA 2HNYA 1JLQB 1KDCA 4PL1A 2LBOA 2IMWP 3VA5A 1E6YA 4JOIA 3VAKA 1CJTB 2WP8J 2AH5A 3SSSA 5I42B 1FX4A 2YH1A 3FDTA 4DR4F 4PGXA 2BE2B 1C48A 4RNNA 2ISOA 3M4QA 1WTWA 2L55A 2W2QP 1VQ6S 1E2VA 3SMZA 1HMVA 4C1NI 2I6WA 3Q8QB 3B0XA 4CLKA 2AMCB 9ICEA 2K75A 2Z4IA 1MI2A 2E1CA 1H95A 3GJSB 1F77A 4KX3A 3C16A 1JLCA 2KQ3A 1K44A 5KAFU 1ROFA 1JX4A 1TUWA 4F4YA 3A56A 4N9TA 4Z6DA 1QZHA 4YFKA 4I2DA 1EP4B 2D3UA 4CO2A 1XR6A 3VDYA 1ZM4A 3H09A 5LMNW 1YI2S 4QZIA 1OY6A 4JI8J 3SEIA 3T1YQ 5BR8L 4X65F 4NA2A 4OWWB 3JPNA 2MU2A 1PTOC 4HACA 1KABA 3VVUA 1FRLA 1UFKA 2WAQD 4EQPA 3CJ8A 3IM1A 1HFEL 3NRBA 9ICCA 3T13A 1RKJA 3PMFA 4DV3F 2HRUA 3NOCA 4N8X1 3W1YC 4I0WA 1XNQQ 1BOSA 3OSPA 2DB1A 2R2SA 4FVMA 2VG7B 3AOBA 2B4UA 4DV6F 2VFRA 5F0UA 4A8FA 3K17A 4WXOA 1N88A 1A3TA 3JC66 1D9FA 4LZGA 2G2YA 2F0PA 2G13A 3KZIU 2NBFA 4LF8J 1EOVA 1N8RT 1IBCB 4HHJA 7ICUA 1PRTD 2DKZA 1S9GA 1NK5A 4MTNA 4DI6A 1U2CA 1UWVA 4KKSA 5HQMA 1U09A 4PH5A 1FDAA 3L7ZC 3TS2A 3TQYA 5JJZA 3M32A 2XY6A 4DU9A 4A3EG 1OW5A 3PO2B 4OYZA 2ILZA 4DV0J 4DL2A 4K50A 2P9CA 2XSJA 4A8KA 2N55A 2BJ8A 2F7VA 1EWIA 1C1BA 4MT1A 3M8QB 4CGZA 1UJ6A 1L3VA 4C3IH 1SJRA 1B9MA 1LTID 3DDNA 1XNRF 1WG4A 2H4WB 2PI2E 2K4KA 2B3GA 4LF6J 5FLMH 3VAFA 2XTJP 2YNFA 4FE3A 4NX9A 1JORA 1T7PA 1UL3A 2ICEC 4NI2A 3JQJA 5L1JA 1H38A 1ZQQA 1VJ5A 3H40A 4JYAL 2RQKA 2UVVA 4UQTA 3CNHA 3C1FA 2K3KA 1K0RA 3KJVB 3Q89A 1IQZA 4ER8A 2X69A 4X64J 4KKUA 3S2HH 3R93A 3Q8LA 1Y88A 2B0CA 4LQ9A 4IKAA 4EYIB 1IKVB 1S4FA 2OYYA 2QSFA 3MI7X 3VCBA 3SYZA 1SMYC 2F8LA 1HHTP 4CO1A 4IG0A 3TA2A 2VJ5A 3RMHA 2WSFC 1IKXB 3WWVA 2E5LJ 3OOCA 1EY0A 2BOAA 3AA8A 1DAXA 1Q8BA 2CFXA 2RQCA 3UDCA 5LXRA 2EOTA 4MK9A 2LKZA 1F9EB 2VW9A 3IG8A 5G0RA 1FA0A 2DR9A 3EUB2 2MJ8A 5E33A 4WWSA 3B0YA 1DTTA 1LW0B 3R3TA 4NEZA 2HAIA 1D8BA 3IG1A 3C5FA 3DRPB 4DV4L 1FK9A 5EKLA 3ETOA 4PHAA 1CM9A 4DR2L 3HF5A 4BC9A 5D3DA 2O4XA 4C0ZA 1HNWL 2UUCJ 3DM3A 4LUZA 4RQ5A 3M4YA 5IYCG 4DSIA 1TKXB 3PV8A 2ZOGA 2WSCC 1G2TA 3K6OA 2Y0SB 1ZRMA 2W03A 4HT7A 5KT6A 3ICLA 3PJXA 1PILA 1Q5YA 3DGPA 3RAXA 1WJJA 2FMCA 3HHNB 3MOJB 3WHIA 3BBBA 1HZCA 4LF4Q 3QPIA 1I50H 1NU4A 4JV5J 2XZDB 4GO7X 2WAQB 3SDEB 1LW2B 1Q5VA 4DR6L 3MPWA 3QG1A 2IA6A 4TYBA 2QGFB 3PXGa 2HFZA 3V81A 4PPXA 2MQLA 2QKIC 5LT5A 2I5JA 1BC6A 2IIHA 5DS7A 1FL0A 2N78A 2NXCA 3FUYA 4US9A 1UJ5A 5C3XA 4UB4A 2E1PA 1DM0B 2XS5A 5C0XJ 4J91A 3ZZTA 2CPEA 3K0JA 2NVYH 2WF7A 4AXIA 4ICLB 5IV4A 4OJOA 3ILLA 3KLGA 2D9OA 4KY7A 1RB0A 6FDRA 3OFHA 3ULJA 4CYUB 3KK7A 2H4OA 3V72A 2F0EA 3S1MH 2AEJA 1PRTB 2JE6I 2PT0A 3KLIB 4A3MH 1WWVA 1TMJA 1VBZA 1TL1B 3KJQB 4JP8A 3K75D 3OHXC 3GTJH 4CDCC 4ZA1A 5ITHA 1SIWB 1N8RC 3RYLA 2PNRC 3QEBZ 3UO0A 3H6MA 4LF5J 2XI9A 1LTAD 1KRPA 1TWCH 1SPBP 3K58A 1UVIA 3KJFB 4M94A 1XPOA 4Y2UA 1QQ5A 1WTRA 2R2UA 2IT1A 2KL8A 3S24A 5KL8B 3T1HL 4BBSG 2B4VA 3EZOA 2MQMA 1RQNA 2NWGA 1L3KA 4EO8A 5AE1A 3HOVH 2HOIA 2BE5D 4CLSA 1O6XA 4A3DH 1RYRA 4UB5A 1LUZA 3W64A 1X65A 4L6V3 4NLUA 2JL9A 4MFCA 4MFBA 4B3TJ 4X4NA 1UFLA 1KTVA 1IQTA 5IP7G 2LYBA 1NSNS 4DOAA 3TO8A 2FUG9 2R9LA 1VIXA 4FZNA 3H7IA 1RYSA 2KXHA 2MUTA 2F0WA 3CJTA 4PZNA 5AJ3L 4YDXA 1RHKB 2ZIUA 5EN1A 3AH6A 1PFSA 1KQSR 2NSBA 4R4CA 2DRAA 3LX0A 1JICA 1NNDA 4RAUC 1SE8A 4GKKQ 5IT9E 2YMLA 3I4NB 4WTYA 1V97A 2F8EX 4R0JA 3MZ5A 2WFAA 4OYBA 5KTQA 1DLOA 2GMJA 4PWDB 3E6ZX 1FNVA 4YOEA 1YHQA 2RRDA 4R65A 3W2WA 1XXGA 3ZZYA 1JLBA 5G3LF 3CHBD 3DM2A 2CXYA 2GV1A 2BCVA 2KD1A 2FJVA 5GADC 2YX4A 4QPXA 1SNPA 2FD2A 5KT4A 3DXSX 2F40A 1J9OA 5B0CA 3AB9A 5AM5A 4QWAA 1UWAA 2UXCF 1ZJMA 3BO3A 4OX9L 4HMIA 2K04A 2H54B 2B2YA 1RWNB 4I27A 2UV8A 1ZYQA 3B4MA 4M2YA 2FHTA 4HAEA 2D3DA 4KGXB 5KFLA 4A3BG 2H3EB 3PIO3 4GXKA 1MKHA 3GQBA 2DR8A 2KJ8A 3NEKA 5ALQA 2PFQA 1U6BA 3GIIA 4ECQA 3LO3A 1RT6A 1KQGB 1QE6A 1LXNA 2C2MB 4ANEA 4UP8A