2AHOB

Structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
264
structure length
259
Chain Sequence
MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Switch of the gamma Subunit in an Archaeal aIF2alphagamma Heterodimer
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 60
structure length 259
sequence length 264
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00575 S1 S1 RNA binding domain
B PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2ahoB02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ahoB01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 2ahoB03
3UE0A 3J81c 2BA1A 1NBWA 4A3JH 2Q2TA 2UUCQ 4DR4Q 2D62A 5J3BA 2UUCL 1CSPA 1EFWA 3HKZE 3CAMA 1XMOL 1N36L 3I56A 4YY3Q 4KLKA 4HJ8A 2R93G 1NMFA 1JJCB 1P8LA 2N78A 2OQ0A 3I2ZA 2F4VQ 2JJQA 2ZM6Q 4LF8L 4MNOA 2AKWB 1X65A 3F2BA 1PHJA 1HZCA 2RHQB 4PMWA 3RZOH 1QZHA 4P73A 4DV4Q 1JB7A 1WOCA 4WJ4A 1VQFA 3FHWA 2IHEA 4PZ8A 1WI5A 5HY6A 3ZJYC 4AIMA 2D0OA 1YI2A 4X6AH 1HJPA 3I7FA 1VQ8A 3S2DH 2KCMA 2Q2HA 1L2FA 1Y1VH 2A19A 4UP7A 4X64Q 4X65L 1SFOH 2NN6G 4LF4L 4JI0L 1YVCA 3ERSX 4PZ6A 4B3TQ 2YTVA 4DV2L 1CKNA 5C4XH 2KCTA 2K14A 2K5NA 4DR2L 3W1BA 1NJIC 3PO2G 1HNWL 2EXDA 4X62Q 4A3FG 1QVGA 1TXYA 1PV4A 2UXBQ 2Z6KA 3I4MG 2LSSA 4JV5L 3S24A 1IBLL 3CMEA 1T9HA 2XGTA 1HNXL 5C0XJ 1QZGA 2GVBA 4AQYQ 2H5XA 1MJCA 4DR6Q 2R7ZG 2QMUB 4LFBQ 1XNQL 1YZ7A 3AFQA 1WCMH 2NZOA 4GN4B 4JI1L 1OXUA 3B6YA 3PV0A 4JYAQ 1C9OA 1YHAA 1A8VA 4LUZA 4B3MQ 2UXCL 4DR1Q 5IP7H 1EIYB 3GTLH 1OXXK 1RL2A 4HIOA 3HOXG 5IYDH 3L7ZC 1NE3A 3T1HL 1S40A 1XNRQ 4JBWA 2LXKA 1U0LA 1GM5A 1R9TH 3GD7A 4EQ5A 4DV6Q 3S1RH 1FL0A 1G291 2MFIA 2NVQH 4A75A 1VQCA 4LF7L 2JA8H 2NVTH 4O2DA 4HIMA 3I4NH 3AYHB 5AJ3L 4HJ7A 4BY7G 1GO3E 4DUZQ 2UUBQ 1QUQB 4A3CH 3CCEA 3CP0A 4MTNA 1N33Q 2N8NA 3E0EA 1VS0A 1HZ9A 2VY3A 4P71A 5LMUL 1IBKL 1N33L 4KHZA 4YWKA 2PNHA 1K9MC 3NENA 1HZAA 2KENA 2IHFA 1X9NA 2CCZA 1PA6A 4IPGA 2K4KA 3GTKH 3S1MH 3GDEA 1A0IA 4LF7Q 2R6GA 1E22A 1B7YB 3GO5A 3CC4A 4AYBE 5M3FH 2K52A 4JG2A 3M4PA 1ASZA 1SN8A 3PUZA 5IE8A 3J7ZC 3AQQA 5ELOA 1P16A 4DUYL 4GKJQ 1X54A 3S16H 3CMAA 2PI2E 1K73C 4NXML 4LF6L 2OTJA 4DV1Q 5C0XI 2I5HA 4DR3Q 1EIFA 5C4JH 4NB3A 2QA4A 1OTCA 3HOZH 2HT1A 4DR1L 4B3ML 4IFDJ 1VQ5A 2VS1A 4NPSA 3I55A 4JI3Q 3JC66 1Z9FA 4TQUS 1VQNA 1VQ9A 1KL9A 4GNXA 3ICEA 1K3RA 4Y52H 1B8AA 4BY1G 2E2IH 2PMZE 2OTLA 4DV7L 4JBMA 4YHHL 3OW2A 4DNIA 1Y14B 1Q82C 2BH8A 3NBHB 4JV5Q 3L2PA 1PVOA 1X3GA 1N32Q 3I4MH 3HOVH 5M3FG 3L0OA 1D8LA 4X62L 1X3FA 2Y0SE 2UUAQ 3PCOB 4L5SA 2VUMH 1HNWQ 1KD1C 3KDFA 1AH9A 1UE7A 4BXXG 1A62A 2N49A 3OTOQ 3PGZA 4YWLA 1UEBA 4JI8Q 1QVCA 1WCMG 3OYYA 4BBRG 4NXNL 4GOPA 2B63G 1WYDA 1Q86C 4UPAA 3KFUA 1JT8A 1HZBA 2E5LL 4B3RQ 2GN5A 2K75A 4DR7Q 1Q46A 4A93G 1LUZA 4MZ9A 3BZCA 3F1ZA 1CSQA 3A5ZB 3M85A 1J5EL 2ASBA 1TWHH 1DGSA 4YY3L 3G71A 1XMOQ 3TS2A 3MEFA 4IFDG 4IPCA 2ALYB 1FGUA 2EQSA 4JBJA 4P72A 2E2JH 3PUWA 2YYZA 1PH2A 1L1OB 4R4QA 4DR7L 4IJLA 3CF5A 5LMNQ 5GAEC 3U4ZA 4A3FH 1W2BA 5M5XH 1I6HH 1Y1VG 4AH6A 5JJKA 3PO2H 2ZJPA 3FKIH 5IYBG 1PFSA 4LF5Q 3HOUG 4A3EG 2LXJA 4JI6L 5IT9c 4JI5Q 1CUKA 4FDBA 3RLNA 4YCVA 5LMNL 2CFMA 4TVAB 4J15A 5HGQA 3U50C 2OWOA 4B3SQ 1Q7YC 4LUVA 4HIKA 4A3GH 4DV0L 1UE6A 4A3CG 4R4CA 5GROA 3F2CA 3G48A 3PSIA 2ZJRA 2HHHL 2F3IA 4LFAQ 5DLQE 2AMCB 5E7NA 3BZKA 1K8GA 4YHHQ 4IO9A 1J5EQ 3KJPA 3KF6A 3M4QA 1L1OC 1X6OA 3CCMA 3PO3G 3CW2C 5JEAJ 3G6EA 1PH6A 3RN5A 1E1TA 1VQ7A 2R92H 1X56A 4B3RL 1EWIA 5IYCH 3A74A 4BBSG 1NTGA 3EIVA 3HOXH 4NXNQ 1KHIA 4JI3L 4PZ7A 4R1JA 4HJAA 2IX1A 4LFCQ 1QVFA 1VQLA 3RLFA 3U4VA 5IYDG 4ALPA 2Z0SA 4OO1I 3OTOL 1SR3A 5GADC 1YJ9A 1VQOA 1UWVA 4NXMQ 2JA5G 4A3BG 4OXPA 5M3MG 1TWAH 1FVIA 4DUYQ 2JK8A 4GOPB 4EX5A 3S17H 3TEHB 1I50H 4A3DG 4WJ3M 1N32L 5C3EG 4JI4Q 4DPGA 3M7NA 2C35B 4DV7Q 4P74A 3D31A 5LMUQ 3E9HA 1NMGA 1IBKQ 3MXNB 4GN5A 3H3VI 3K81C 3K0XA 2DGYA 1KXLA 4GNXB 1XPUA 4JI2L 4IOCA 1BVSA 1Q81C 2RF4A 4APVA 2WB1G 2HIVA 1B70B 2ZTEA 1YEZA 1X55A 5M3MH 3CCRA 4C3IH 1YHQA 3CCJA 5IP9H 2I0QA 3PUYA 4DV6L 5IY0A 4A3DH 3LGJA 3M3YH 5GAHC 4QGUA 4HJ5A 3BU2A 4H02A 5K36G 3T1HQ 4GKJL 1J6QA 1TWCH 2VQFQ 4YWMA 1K0RA 3KYHC 3CQZH 4DAMA 2B3GA 3CCVA 4OWXB 1TWFH 4JI7L 2YTYA 1E7ZA 4JYAL 4XTCS 4QQBX 1WJJA 1YJNA 1XNQQ 1GVPA 1TWGH 3FKIG 1OXTA 5IYBH 3KJOA 1YJWA 1N34L 1BBUA 3F2DA 4UY8C 1N9WA 2R93H 2R7DA 2VUMG 4DR6L 3K7AH 2MO0A 2JEBI 2VL6A 3STBD 2NVXH 4POGA 3KF6B 5AJ3Q 2WB1E 4HIDA 4DR5L 3W1GA 4JOIC 4JI4L 2ZTDA 3J80c 3G4SA 2Q2UA 1KAWA 1XJVA 3M4OH 4BXXH 2E2HH 2UXBL 2A1AA 5FJ8G 1YHBA 5GAGC 3UDXA 4OWWB 2ES2A 1HH2P 3AFPA 1XNRL 2JA7H 1UE1A 1G6PA 3CPFA 1Q1EA 1VQIA 3CC7A 4IOAA 4A93H 1K83H 4A3KG 2WAQG 4LF4Q 4X64L 3JAMc 3RLOA 2WP8J 1N8RC 2UXDQ 3HOUH 2YV5A 4JCVE 4OONA 3CCUA 1KRTA 1VQ4A 4JI1Q 2NN6I 5C0XG 4L5RC 2GVAA 4A4IA 3CXCA 3EN2A 1EYGA 4QL5A 1JJGA 3NELA 2DUDA 1IZ6A 1YZ6A 2PQAB 2RHSB 4AQYL 3CC2A 3CCSA 3CPWA 3HOWG 4GLVB 1EUJA 3PF4A 1E1OA 5GQOA 4A3MH 1PH5A 4YCWA 1RIPA 2AWOA 1H95A 2IY5B 4O0AA 4LFAL 2HHHQ 4YCUA 2PI2A 4BBSH 2K5HA 3RN2A 4A3GG 4DV0Q 2JA6H 1OXSC 2CQOA 4A76A 4DR2Q 3ULLA 1XPRA 1I94Q 3HOYG 3EBEA 1E24A 1VQDA 1PYSB 2L15A 3HKZG 1IYJB 4LWCA 4PG3A 4B3TL 4JI0Q 4A3MG 2V1CC 4OX9L 4C3HH 2WAQE 4A3EH 2JEAI 4LF5L 2KBNA 1M1KC 3GTQH 3I4OA 3HOWH 3S1NH 4LNQA 4GKKL 1MJEA 2R92G 1LYLA 3JAMi 2JA6G 3S1QH 5EAYA 3DM3A 1JMCA 4KHPQ 4DV4L 2XTIA 4IPHA 3K80C 3H15A 2UU9Q 3KF8B 2A8VA 4OX9Q 1CKNB 4IPDA 1L0WA 2EIFA 1AE2A 5H1SE 1LTLA 4JC0A 1PH8A 2I5MX 1GKHA 3D0FA 3NEMA 1NY4A 3E9IA 1KIXA 1SRUA 1ASYA 3PF5A 1BKBA 1KQSA 1BBWA 4DR4L 3S2HH 1KC8C 1S3OA 2IX0A 1SROA 1MIUA 1GD7A 1PH3A 3ULPA 3H3VH 1XTDA 1D7QA 2BH2A 3CD6A 2N3SA 2E5LQ 3PIPA 4IJHA 3TREA 2ID0A 1X3EA 2RCNA 2NVYH 4JI8L 2ZJQA 3GTJH 4C2MH 2E8GA 3W5OA 1V43A 4QIWE 4OWTB 2ZTCA 4RG1A 3HOZG 2QEXA 2MO1A 1CKMA 1V1QA 3DLLA 1Z47A 3VDYA 1OXVA 3KDFB 3UDIA 2UXDL 1U5KA 2HQLA 1E3PA 4POFA 5BR8L 3T1YQ 1C7YA 1EOVA 2CKZB 4GLAC 2UUAL 5FLXc 2FXQA 1HR0Q 1VQPA 3S14H 1IBMQ 3HFZB 1C0AA 1VQGA 1KRSA 1G51A 3TQYA 4BBRH 4DKAC 1YIJA 2CWPA 3GTGH 3GTOH 3UDFA 4JBKA 4A3JG 3J81j 2YU9H 3GTMH 1Q8KA 1YITA 2CWAA 3IRBA 2QN6B 3ER0A 4LF9Q 3PUXA 2KHJA 4DR5Q 2YTXA 1FJGL 2B29A 1QUQA 3AEVA 1CKOA 1VCIA 1PH7A 4DV3Q 4K0KQ 4DV5L 1VQMA 1SMXA 3PIOA 3HOVG 1N34Q 1YNXA 2K5VA 3HOYH 2VQEQ 1VQKA 4RMFA 4DR3L 1PH9A 4DV1L 2JE6I 4JI7Q 3KLWA 1L1OA 2HIXA 3RNUA 4A3IG 3TS0A 4LF6Q 4DK3C 3STBC 4R4TA 3TRZA 3S15H 4ME3A 3ULJA 2OCEA 4LUOA 2VQFL 4X66L 3U58A 3UE1A 5C4XG 2R7ZH 2MQHA 1W3SA 2MNAA 4L5TA 5IP7G 1HNZL 5JJLA 4IFDI 4R4OA 4GN3B 1Y1WH 3RZDH 2VQEL 1XMQQ 2F52A 5IWAQ 4GS3A 5ELNA 4C3JH 2AHOB 4A3KH 2AWNA 2OQKA 3WWVA 4DAYB 4DV5Q 1Y1WG 1XPOA 4DV3L 4XIGS 4JI2Q 5FJ8H 1Q12A 2UUBL 2WFWA 4DUZL 3SGIA 4GLXA 4A3IH 4BY7H 2K50A 1FJGQ 1M90C 2JA8G 3I4NG 4OO1G 3A0JA 2JQOA 2VW9A 5IWAL 3A5UA 1VQAA 4AYBG 1XMQL 2JA7G 3GTPH 2NZHA 2VNUD 1VQEA 4Y7NH 2Q2IA 1HNZQ 4BA2I 4LW1A 5M5YH 1PH4A 3KOJA 1HR0W 1EQRA 4X66Q 2B63H 3K8AA 4R4IA 4BA1I 1Q1BA 1UE5A 2BA0A 4P75A 5BR8Q 4KI0A 5LMNW 3T1YL 5IYCG 1MKHA 3BJUA 5IP9G 5M5WH 3Q8DA 2ATWA 2UXCQ 4HJ9A 3K7UC 2Z6KC 5FLMH 5C44G 4LFBL 1IXRA 1V9PA 4LFCL 5JEAG 2QGQA 4K0KL 4GOPC 3J80i 1YBYA 1SE8A 1LM0A 1O7IA 1HNXQ 2I5LX 4A3LH 3CCQA 1I5FA 3J81i 1VQJA 4DK6C 4LF9L 1IBLQ 3J7A5 4L5QA 4UP8A 1JE5A 4BY1H 2IT1A 1VQBA 1A63A 1K8AC 1PH1A 3PUVA 1VQ6A 1IBML 1WFQA 1SLJA 1HR0L 2JA5H 4UP9A 2KHIA 2JA9A 4DV2Q 3HKSA 4B3SL 3H0GG 4JOIA 2UU9L 4A3BH 5JJIA 3QSYB 4X65Q 4KHPL 2VZAA 2Y0SG 3H0GH 3M9BA 4JI5L 3F8TA 4JI6Q 2R7FA 5C3EH 1IL2A 1I3QH 4A3LG 4GKKQ 2D0PA 4QJFA 3FP9A 5FLMG 5C44H 1PYBA 4GNXC 1JJ2A 3CCLA 1EQQA 4QY7A 1AE3A 2ZM6L 1S72A 4LF8Q 2PQAA 2F4VL 1VQHA 1I94L 3PO3H 3RR5A 3UDGA 1N36Q
chains in the Genus database with same CATH superfamily
4DR4Q 7ICRA 2ZZTA 5AFWA 1RWNB 1SH2A 4RW6B 1HNZF 2GVDA 4DPYA 1ZQYA 1QSYA 2CPEA 5KG4A 1RU1A 4P6QA 3PM9A 4O3OA 3QR8A 1WOCA 3UDEA 2PDAA 2V8GA 4PAAA 1IYUA 2KCMA 1U4MA 2A6ED 1SH3A 2CW0C 3Q8PB 5AE1A 3MM6B 5C4XH 4BWJA 4DX8H 5DEHA 2LFVA 1ZAWA 1KLUD 4PZNA 2HBZB 3HDSA 3D6MB 3GIRA 1XJWB 4DOBA 3DM1A 3S6JA 5JJBA 2NXJA 1BPEA 2WONA 5EN1A 1X4HA 3GZFA 4JI1L 2JNJA 3PV0A 1C9OA 1DM0B 4B3MQ 5KFDA 3WK8A 3LTOA 4YY3F 3R1LA 5HHIA 1SUQA 2ZUDA 2Q3PA 2MGSA 1ZEQX 3R5AA 2HBLA 3HVRA 2F3WA 4DR5F 4IR1A 4OL8A 1QNKA 4HYKA 4C0BA 4NXZA 1VR6A 4A75A 2D3ZA 2KHQA 4CKCA 3MUVP 4J9QA 1D9DA 1Q95G 5IZHA 2QB1A 5DM63 4P71A 3HFKA 4HVZA 1RWMB 1CK1A 2CCZA 1KQSR 2WZ1A 2O1PA 4WJ3B 1S5ZA 2K4HA 1WD1A 3JPNA 2XN9C 1HQ2A 1RP5A 2ABYA 1E2WA 3HVTA 4ZVSB 2V8DA 5F8JA 1LACA 1U09A 1VQ5A 1SC1B 3I55A 1PYOB 2XMWA 3D7SB 1ZA2B 2QCPX 4OJGA 3KLIA 2ZUAA 1LEOA 1RHRB 4RQ8A 4CQ1A 2P9CA 1B0PA 1NDLA 5J0PA 3PO5A 3HOVH 3HHLD 2AUKA 3Q2SC 4M9JA 1M0SA 3MUMP 4DUZJ 5DJBA 3G82A 1A6XA 1FVQA 4NEYA 3SK4A 5AM4A 1A6LA 3I0RA 4QR2A 5AKYA 4EENA 2QT7A 3W5XA 1KNEA 4PR6A 4IRCA 2HFZA 4Q8EA 3HW8A 2MUTB 1A15A 3D4DA 3IG1A 2I38A 1XMOQ 3TS2A 1FGUA 2J7UA 4MIWA 1ZQUA 3NNHA 2NVYB 2BKPA 4JOUA 1Z2LA 5IC6B 5CYQA 3OTEA 2NYVA 2L08A 2A10A 1RF2D 2ENBA 2DPIA 2HBYB 3U50C 1TMJA 3AA9A 3JS9A 4R25A 1SV5A 5EE9A 2E75C 4RW7B 2A69C 1K8GA 3HO1A 3D2SA 3KJPA 2M8DB 1FNOA 3PO3G 1FNWA 1P9YA 4LJMA 1WUDA 2V4RA 3MXPA 4X4SA 1S7HA 3BPDA 1ZQLA 1EU4A 5FIIA 3ZZTA 3U4VA 5IYDG 2C3OA 4DPTA 4BC9A 1FI4A 4A48A 4I28A 2DNKA 3FPPA 1X6JA 4OXPA 2M7SA 3NG8A 1FFUA 3TANA 3DM2A 2G5HB 1O6XA 1HFNA 2CJYB 3I56S 3TA2A 2JC0A 2EZYA 5J2BA 1KHWA 3BV8A 1YJNS 2WW8A 5IIOA 3RBXA 3OPXA 5HMLA 1YDLA 1JXLA 1CHQD 1N63A 1FWLA 5E3PA 4QGUA 3H5YA 4A3MB 9ICPA 3GTYX 1G2EA 2F1JA 4NM1A 2DYAA 2B3GA 3C1EA 5C5JA 1WWVA 2DNZA 3TJ9A 3EVMA 4WKYA 1C20A 1N2XA 3TJ8A 4AL5A 1B22A 1N9WA 4UAVA 5DGAA 5E1FA 2XSJB 3C2LA 2CJ9A 2KVIA 2PA3A 4POGA 2Q2UA 4K4GA 4BXXH 5LM7E 3IG1B 1N5XA 1FEZA 4H13C 3VR3A 4N8OA 3AMUA 4RBVA 3NWSA 1A2TA 1VQIA 3AB2B 1HR0J 2G0IA 1FRJA 4DV4J 2Y1LB 1UZHA 2DF4B 1VMCA 1NJXA 5KFWA 5AE3A 4OONA 1UNSA 4ULLA 3H8WA 3NUCA 3T5KA 4AQYL 3KTQA 1BNPA 1RTIB 3PIP3 2X6LA 4ENOA 1D1KA 2JSOA 1O5JA 4Y7NB 1LW2A 3NBPB 3G8TA 5F41A 2ASDA 1SNMA 3CCUS 1BWVA 4A3EH 4IFYB 4ZVQB 1R6YA 2BJ9A 2XMTA 1LXJA 4H4OB 2BQUA 5J2MA 3U7JA 1GO3F 2YN4A 4B9VA 8ICNA 2DO4A 3GP9A 4ZIVA 1AE2A 3OIPA 2F2AB 2GVZA 2K4IA 1HNXJ 1SRUA 1RWWB 7ICGA 3S2HH 3KK1A 4LBIA 3C1ZA 4Y2XA 3UCGA 4C2MB 9ICIA 2WF6A 2LMIA 2F65A 3HHDA 2MGZA 3RJIA 1JICA 1BE4A 4C3KA 4BY1B 3JPTA 3EUNA 5I6WA 2E1PA 1N0VC 1C7YA 1DOLA 1EOVA 1PTOC 2QDBA 5BXIA 5BYRA 4GXJA 7AT1B 5ALLA 2V9KA 1Q3UA 1YRTA 2B4PA 3QQCD 3GTLB 3VHQA 4RQMA 4DF8A 2KCNA 4MKAA 3P49B 3JQKA 3N97B 5IT0A 1XNSA 4JI4F 3CJKB 2M9NA 3QB3A 4D3GA 4DV7F 2KT2A 4OJ5A 3NK9A 4EZ9A 3NBIA 4I68A 2ZH5A 3PW0A 2W9CA 1FF2A 2VQEL 2HLUA 3FSYA 1ITPA 3MMBA 1TR0A 2UU9J 5AIBA 4DV3L 4Q45A 4R5PA 5CCLA 2VANA 1S4ZA 2K50A 2MAXA 2JA8G 2MJUA 1EKSA 3PSFA 1OQ6A 4QU7A 3OOCA 1PFBA 5B0BA 1VQEA 2KMDA 1W2IA 4DQQA 4DXFA 3K8AA 1Q8IA 4H4KC 5TZVA 1ZQMA 1NJIT 2HHHJ 2IAJA 5EPJA 3RRHA 2YU9B 1ZD3A 2JA8B 2QGQA 5F3TA 2AGPA 1I4QA 1C1BA 1SYFA 1I5FA 2XCPA 4F0KA 2Z1CA 2C9OA 2BGWA 1KLMB 2IIHA 3FC9A 2IT1A 3Q8LA 1S1TA 3BQ7A 2OEMA 4UP9A 1T9UA 4HMJA 1WD6A 1EB0A 3UI2A 1TUVA 4ECQA 3W3SA 1OXJA 5FLMG 2ZIWA 1TQOA 1IV8A 2EY5A 2ZNYA 2JR5A 2HS0A 1TAQA 2EKYA 4WTOB 2M9VA 1N36Q 4XT3B 2BA1A 3GFKB 1SFOB 1EFWA 4JI7F 1Q8BA 2DY9A 5ALZA 3ZDBA 1HARA 2B5JA 2XS7A 2UVUA 2L9DA 5D0EA 5BOLA 1XERA 1HZCA 2ZIXA 2LP4A 4WFNQ 3R97A 2LA4A 1VQFA 1VQ4S 1K5OA 2Y0SC 4YHHJ 4K4VA 1HWIA 1KFSA 4JI0L 5FDLB 5AI4A 3QO9A 2YWGA 2HRYA 1Y1WB 2EXDA 1FK9A 2RUGA 1PV4A 2Z6KA 3CU7A 4LF5J 4FF3A 1IBLL 4JPBW 5IGEA 2KQ3A 3NCPA 2DIUA 3M4YA 4HH0A 4C8KA 2MSTA 5LHY1 4KO0A 4KJOA 1LKZA 3QWUA 3HFVA 1T03B 1AZPA 4QW8A 1RA7A 3BO2A 4JI7J 5DQGA 1SI9A 2RE1A 4K5SA 1Y5LB 3TVYA 2CADA 3H09A 3MXHP 2O2LD 1KW4A 4CCHA 5C24A 4OJ1A 1U0HB 2AUJD 1XNRQ 2BRLA 5CORA 1T9WA 3QJPA 5AK6A 1F1BB 3AHPA 3O2IA 3RUZA 4CLZA 1PKUA 1TKTA 1OYDA 1OUQA 4HJ7A 1WC4A 1IL8A 4KH0B 1U25A 5A8WB 4O3MA 4G1QA 2DGSA 2E5LF 1NK5A 3F44A 3H59A 3U1LA 1C48A 2IHFA 1SJ4P 4CF4A 3VR1A 3A7AB 3CC4A 5J22A 4AYBE 4DDFA 2DNNA 3PW2A 1Q78A 2EYJA 5GAHI 2RS2A 4RUAA 2X3DA 3ED5A 5CR3A 4LSLB 1LFWA 3QE9Y 2DNGA 3CRLC 1VQNA 3MCOA 3D2NA 2YNIA 1K3RA 5D0GA 5KOXA 2M88A 4KN7A 2BANB 3WKCA 4DV7L 2J7WA 3N7PD 2HOQA 3OV7A 1RAOA 3NBHB 4DL2A 4JV5Q 1X3GA 2QSFA 5M3FG 3P75A 4QZFA 1RAAB 2ERRA 1VLBA 2N1RA 3LUYA 2QA4S 4PG8A 4WF9Q 3X1LB 1FTCA 2N49A 1W2BR 3HJFA 2XYPB 4YWLA 3T51B 2G08A 4HR2A 3KK2B 3H0LB 2JDJA 4UPAA 3GCXP 2Z2ZA 4B3RQ 1RWPB 5L9NA 3SMZA 1Q46A 1NXIA 4NV0A 1AYEA 1J5EL 2GCFA 3HULA 4C1NK 1RISA 2JOQA 1ZQKA 1AA1B 5ALPA 2HFUA 5LMNQ 2MJ8A 2ZVIA 2AQ1B 5G4DA 2LCWA 3MD1A 3JSRA 3H42A 2YQEA 3AQFA 2JV3A 3KYLA 1VQLS 3E58A 2V4QA 1VCTA 2VJUA 3LP0B 2Q8IB 2ZJRA 3DKDA 3BZKA 1VBYA 4Y2UA 3NBHA 1CQMA 3EIVA 4RBTA 3V6JA 3EPGA 1F44A 1LTSD 2R2RA 2Z0GA 3V81B 1J5EJ 1LWXA 3D6TB 2LYBA 3M6UA 9ICLA 4NLQA 3EROA 2LM4A 3TO8A 4KFBB 4DUYQ 1CS4A 4EX5A 5D78A 1UVJA 4A3DG 1WHVA 4K5XA 4M6WB 4DPGA 4C8MA 2HG4A 1HBOA 3ZI4A 2DL0A 2H5JB 3K0XA 1U6BA 2RT3A 3QT8A 2YMMA 4CNQA 3N4WA 6FDRA 3GTJB 5IP9H 4I2EA 5LJ5Y 2F0PA 4XDXA 5E79U 2DISA 1KP6A 4TUQA 1LLRD 1TWCH 2HGNA 5EWFA 1IKLA 3JSMA 4QQBA 1HQEB 5BYSA 1TWGH 5IYBH 5EE3A 3MEGB 3F2DA 2VB6A 3TMEA 3M8WA 4CKEA 4EUVA 3W2DA 2SDFA 4BBYA 3W1GA 3J80c 3CCSS 2AU0A 2X1GA 5KFBA 1O08A 1HYSA 5CABA 5GAGC 1EY0A 3CPFA 3V81A 2VF3A 2P6SA 1KEJA 2BX6A 4JCVE 2ZM6J 2D8CA 5C0XG 2ZOFA 3KFUF 1JJGA 3NELA 5A6PA 8ICRA 2K05A 2IY5B 4LFAL 3Q8YA 3KG1A 4X4TA 5J2KA 4C56C 1K83B 3OXLA 2V69A 2YKNB 1AW0A 2B5JB 4ECZA 1XPRA 4CGZA 2KJ8A 4WPAA 1Y00A 2HVDA 4M5MA 1M1KC 4ICAA 3I4OA 2VBWA 2K1RA 4M9HA 5CZVA 3MOJB 2VBYA 5DDMA 3TR5A 1O80A 4B3OB 4CO4A 1KC8T 3S1RB 3PFOA 2XICA 3E9IA 2EYMA 4B02A 3H98A 1BBWA 2CWKA 2E7WA 1S1VA 3CD7A 4ZVUB 4KLQA 1SROA 4OJ3A 2CNLB 3LA0A 2N3SA 3B8HA 5KFJA 2QA2A 1HBUB 2R4FA 3H90A 1J5OA 4MJKA 2ZXHA 2ZM6F 3E5SA 5CZXA 3CT9A 1F0XA 3R3OA 1Y5NB 1X42A 3B4MA 2FMMA 5HMXA 1HR0Q 4EELA 4LSZB 4DKAC 1YIJA 1LWEB 2G9HD 2CXEA 1T3OA 5HN0A 3CDBA 3ZNJ1 5IT9L 4X62F 1EY4A 2EW9A 2FJ6A 1F2HA 1IQTA 4FF1A 2Z8QA 3LYSA 3L95X 3MGIA 2EFNA 4G6VB 1A76A 5BYQA 4P0PA 1PH9A 3HHKA 1RZTA 3B0YA 1VQPS 2DN8A 5ALXA 1R0BG 4NYOA 1UEUA 5E33A 3RR8A 2R7ZH 5IP7G 3HHLC 5IWAQ 4GS3A 3LAKA 4QIFA 4Z6FA 1ZQHA 2L48A 1VQMS 5FJ8H 3H3VC 4DUZL 4NLRA 1DY3A 2VL1A 3A8IA 3B4DA 4A3EB 5D77A 4EFAC 1NZ8A 3MPWA 4P4OA 4WORA 5KT5A 3ND9A 1UEAB 5DDOC 3RFAA 4Y7NH 2MHEA 1YNND 3RH6A 4USIA 1VQ6S 4X4QA 1ZBTA 5LMNW 3T1YL 2XCAA 5M5WH 3AQOA 4RQ1A 4KHVA 2UXCQ 5AKEA 2DQNB 4NXMJ 4AT1B 3GYNA 1HUMA 4NLGA 2QO3A 2PD1A 2JYOA 1WTVA 3OTCA 2AEMA 3MPVA 2ZJAA 2OIHA 3QUTA 4DK6C 5J39A 2PMWA 5HGTA 2R42A 2M00A 3KLFB 4F8MA 3KLSA 4DV2Q 2FYXA 9ICMA 2R18A 4A3BH 1S76D 1HQUA 1HQMC 1EFID 1V1OA 5DDQC 1NSAA 1JJ2A 4RU2A 4A3KB 3FGVA 2OPPA 1YJ9S 5GVQA 2QG9B 1L3VA 2F4VL 2G9OA 4ZIWA 4QOTA 2ZBCA 1NBWA 2UUCQ 2LS01 5JVHQ 1UVLA 4G1QB 4F4XA 3KUHA 8ICLA 1P1TA 2EOTA 3T3FA 2EC2A 4USUA 4YMMA 6AT1B 1HJPA 1YHQS 3UWTA 1CC8A 1KQKA 1N36F 4W4MA 4X64Q 4DG1B 4IO1A 2HQEA 1B44D 2YTVA 3H91A 4HLBA 2K14A 3QEAZ 4YOEA 2YTUA 4YVZA 2X69A 4UY85 3H2UB 2GVBA 3MM8B 2VQEF 2FJEB 2LYVA 2C2EA 2VBZA 1SZHA 4K2XA 1URNA 4F4WA 4C3JG 1TS3A 4I56A 1KTVA 2FI1A 1HHQA 3HOXG 2DNRA 3L7ZC 3ZZ0A 3WK4A 4UASA 4F88A 4KH1B 4M9LA 2Y1IA 4P2FA 1G291 4FNFA 1RAFB 5J0QA 2LDYA 5B0DA 2HZVA 3I5BA 9ICHA 2WF8A 4BY7G 1GO3E 5M5WB 1RT2A 3W8GA 2K8AA 4KKOB 4NLDA 2E8MA 4I2AA 4O1NA 4EQPA 2FLLA 3VQSA 1M1HA 2OSRA 4ZLNA 3J7ZC 5KNCA 3MTJA 3TX8A 5KFRA 4IQWA 1HTPA 2F3VA 2OHDA 1KLGD 3OHXC 4NXML 4PXBA 5AI0A 4DR3Q 1U02A 4NB3A 3HOZH 4B3ML 1WACA 4R63A 3MXNA 1KL9A 3L7OA 3ICEA 1RKNA 3OTOF 3R8BA 1FJ7A 2M0NA 2SNSA 2K01A 1NNDA 4JBMA 4YHHL 5KRUA 2Y8WA 4ZMMA 2V68A 3EMTA 5A0LA 4OV1A 3J7YW 1HNWQ 4N56A 3CD0A 3SAFA 1PRTD 2Y9TA 1SJFA 1LW0B 1HNXF 5HROB 3GU0A 1QVCA 4GOPA 4ED8A 2G2ZA 2O6KA 1A2UA 4HAIA 2NRWA 3MC0B 4A8OA 2D2CC 4MZ9A 5C44B 2RRAA 4OZ5A 3PJXA 3RRGA 1YX2A 1NKBA 1I5OB 2KV2A 2NZ1D 4P0PB 4DR4J 4UF4A 1U4RA 1VMBA 5BN3A 1J8IA 4KLFA 4OYXA 3ZXWA 4KO0B 1U4BA 2MLZA 1RHPA 1AFJA 3LVWA 9ICNA 3FRZA 2XZTB 1U1RA 2F0KA 4QJVA 1ZM2A 2A6HD 3F2CA 3VC8A 2KJVA 2HDLA 2A18A 2AMCB 1MSHA 1ENFA 4DCPB 1RK8A 2K4PA 3CW2C 3G6EA 3D1HA 1IBLJ 3LNNA 2YKMB 3BGOP 3A74A 4DV2F 1KVJA 2EJFC 4LF9F 2BXJA 5C25B 2KKVA 5C42A 2A2CA 2YMPA 5BJRA 3J7YU 2W43A 4I2IA 2VPXB 2WOMB 4F2RA 4WJ3M 4ES1A 1EHWA 4WKRA 2EK1A 2C35B 4ID5A 5JPMC 1KXLA 3J7AV 2OXOA 1Q81C 2E9RX 5HL7Q 1MSWD 1VQYA 1MGSA 2JA6B 1ET6A 4YEAA 2HBMA 2KN7A 1SQFA 5GAHC 4KGZB 3T1HQ 4PHAA 1B9MA 2F4FA 4NRUA 2I6XA 2K5DA 4OHXA 3F73A 1G91A 3KNGA 2ATLA 3NVWA 4GMKA 4IURA 2H3ZA 1ML0D 3K7AH 2EAPA 4QNLA 2NVXH 1DCZA 3KF6B 2DKOB 1HD1A 3GIKA 1MD2D 3KDNA 3ILOA 4B3TJ 5A8RB 5ETTA 2MQLA 1G6PA 5SZTA 1WC1A 1LTRD 1FA0A 5J8YC 1B3AA 3DFEA 2GV1A 2FLPA 1IN0A 4X64L 2W3RA 3CE8A 1Y10A 1WF2A 3HOUH 5D15A 1L8LA 5DZ7A 5L37A 4ZVFA 2KZMA 1MW7A 4US9A 1U2CA 2GLEA 4EVOA 4HSPA 5JVGQ 1PH5A 5F2DA 2AWOA 3I3CA 3SFUA 3SK6A 2QLJB 4X66J 1J9OA 4J9VA 4F5NA 1K44A 1ICFB 2NSCA 3UO0A 3OW7A 2JSXA 5KAKA 1RG6A 2IX3A 5T41A 2KH9A 4N5SA 2EIFA 1S79A 3QG1A 3BREA 5D4OA 1GKHA 5C4JB 2KKHA 4H54A 4Z7YA 1D09B 2BUNA 2KXHA 3ETMA 2YQ1A 3ITHB 2OM6A 3PIPA 4LVNP 3WBZA 1R8HA 2AEJA 2J6UA 3G8SA 4JI8L 4KY7A 2CQCA 1JLCB 2FQQB 3HOZG 4OI4A 2WF9A 1D1UA 3PX0A 8ICEA 2EYPA 1WSRA 3DLGA 2JXJA 3FDSA 4J9UE 1OXVA 5KEEA 5AM0A 3AOBA 4OMFG 2UXCF 2YY6A 1VQGA 5C4ZA 1ZYRC 4PQUA 4XUSA 3CJRA 1WC6A 5DB7A 4A3JG 1YITA 2MJNA 4JP8A 4C48A 2R7ZB 1JORA 2GS8A 3BS5A 3SENA 1N6QA 2HQCA 4PWDB 2MZJA 1X3QA 3OMGA 3GJTB 2RDFA 4JI0F 2KDOA 2B8PA 4OFZA 3PNIA 2KOLA 4JI7Q 1QD1A 3TRZA 1RTJB 4HI1A 1S5DD 2OCEA 4LUOA 4CYUA 4X66L 5EKKA 3ENQA 4BWMA 1N56A 8ATCB 2EBEA 2NR0A 4ER8A 1DTQA 4U6PA 4B9LA 1BY9A 3NLCA 3OUYA 1RYSA 4X65F 3H0GB 4UAIA 4NE9C 2VW9A 2CJQA 4J6HA 1ZM9A 1X0PA 3M8PA 3IBCB 3KJVA 3M6ZA 3QT5A 2VNUD 1HNZQ 4Y0FA 3SR6A 2CQGA 4I2QB 1U1MA 3Q83A 1STBA 3S8SA 4PJ0U 4ES3A 1DJRD 4M5JA 3ZDEA 1NJZA 1AB8A 3I0SB 4Y2SA 1NSNS 1RAJA 3DU5A 3MDFA 1BQXA 2QLFB 4G4KA 1WHWA 1NO8A 1HNXQ 5HANA 3F5AA 4JB8B 2DNEA 4IUNA 3O1LA 1PH1A 4UB3A 1F0MA 4OZLA 1IR2A 2YBVA 1NZPA 1FESA 2DGZA 1R0AA 1ZQCA 4BXOA 3EVQA 3H0GH 5B0FA 2D0PA 1UJ5A 1X8DA 1EQQA 1MWYA 2ZM6L 2ZVSA 4URQU 3K58A 4F25A 3TSSA 1IKVA 2RQ5A 2YKOA 3M7DA 4PGQA 1E6YB 3CAMA 1CA6A 1JJCB 1R4PB 3M8PB 4C0ZA 3NS6A 1QZHA 4DR2F 1Z1ZA 2M3DA 4WJ4A 1MBYA 5ALGA 1QOHA 2K3IA 4Q8FA 1PRTF 3SSRA 4S0MA 2H9ZA 1DK3A 1SFOH 4LF4L 1WKJA 1YVCA 1TTHB 1N61A 2MZRA 2YMLA 3MEGA 4X3KA 4GO5X 4DV1F 1R89A 2HDMA 4RA8A 5D4LA 1TXYA 4I67A 2FC8A 3L09A 4DSFA 2O01C 3KUGA 2QB0A 2VKRA 3OVBA 4DHVA 3WK5A 5EWEA 1DRZA 3ZD8A 5KIXA 2XHCA 2GW8A 2QMUB 3DLKA 3CPWR 2FY1A 3M6VA 4X4OA 4ZK7M 3SSSA 2BCOA 1F9RA 1A8VA 1TK8A 5IP7H 1LWFB 1APSA 5IV3A 3C16B 3OD2A 1Y9OA 3ND8A 4IQMA 4JBWA 1ZM4A 1UEKA 4JI8F 3Q8QB 1HWJA 1KNAA 2D69A 3AYHB 5AJ3L 4QMGA 5B5EU 2RKIA 4LSNA 3CD6S 1QUQB 4FNIA 1VQ5S 5L39A 2VY3A 3T1YJ 4B9MA 3FBCA 3KLVA 2YY3A 4NL9C 3M3YB 3HRDD 1WVLA 2PMZF 1A0IA 1KDCA 3P3DA 3CTRA 2YX7A 1FEEA 2E1AA 1ED1A 1P16A 4DUYL 1X54A 3DI6B 1F5CA 4C4RA 5C4JH 3QFWA 5L1LA 1U6ZA 3IDWA 2VS1A 2J76E 2LY7A 3NP5A 2HVEA 2FMPA 3GTQB 3M32B 4BY1G 3HOWB 4X66F 3GSIA 4W90B 3M30A 4CIOA 2KT3A 5J2JA 1QDUB 5I2YA 4ECRA 2BCUA 2HQIA 3X3UA 1XQIA 3RR7A 2R92B 2VUMH 8ICKA 3KHRA 5DAUA 2BACA 5AKLA 5DG9A 4RQ0A 1REVA 2LMCB 3OYYA 2Z2MA 4IH7A 2L4NA 3HSGA 2GIRA 2AD9A 2QEXS 3LWMA 4QIVA 2QSWA 5IGFA 4X84A 2P66A 1WNEA 3M1VA 4J90A 3DEEA 3SXLA 5HMWA 1DGSA 2W2QP 3ZZZA 4EQNA 3RAQA 2MZSA 4KSEB 4FXDA 1AZSB 4USTA 4QIWC 1N52B 1N5VA 2XO6A 5KL8B 3QZ8A 3QATA 4L75A 2PSZA 4AH6A 4ECWA 4LRBA 1SKRA 3QRRA 4A3EG 1FWPA 2ZIWB 3QBCA 4I2JA 2E1MC 5HGQA 4YB1P 4LUVA 5AT1B 3OL7A 2YB1A 4DV0L 4HCSA 1FDDA 3HKZC 2JVOA 2QV6A 2R8HA 3T16A 1RAHB 4A3FB 3EGVA 3CJQA 4LF5F 1Y3KA 3D1QA 3SMVA 1U4PA 3CNQP 2WAQC 4O3PA 3P7JA 2MLYA 3MOZA 5F3ZA 2DIVA 4W92B 3OTOL 2XSFA 4ED3A 4BY7B 1QE1B 3RW6A 1H74A 1FVIA 2GZOA 2PIIA 3A3NB 2V2ZA 3RJHA 2ISOA 1LTGD 5CYMA 4GN5A 4P2SA 2CIMA 1XX8A 3KXDA 2ILYA 1RCOB 1RAGB 2F1HA 2I0QA 5HHHA 4RUBA 5IY0A 1H0HB 4ACOA 5HQMA 2DGUA 1U1PA 1T7PA 3IR5B 1PSDA 3FBBA 1Y8OB 1CJVA 3CMQA 4QZCA 3QJYA 1XXGA 1MN8A 1F2YA 1WJJA 3NTIA 2UXBF 4K5RA 1NMEB 1U1QA 4EBDA 2Q66A 2JEBI 2DR6A 3TFRA 4F26A 5CV5A 2BZFA 2WB1E 2WB1C 2B63B 1T95A 3I9ZA 3BH7B 3UDXA 3QOLA 1UE1A 2ZDOA 1TUWA 4PHEA 3AU7A 4A93H 3UN2A 2KB2A 4DAPA 2GO7A 3DMUA 3MDCA 3D6HB 2Z30B 3UXOA 1XMOJ 2Z56B 4FXKC 4WTYA 4IO9Q 4L76A 4R0EA 5KG1A 5KFZA 2RHSB 2W4DA 5IIMA 3JSBA 4ZPAA 1HRJA 3P96A 2HGLA 3IFDA 4PG4A 1RI7A 2HHHQ 5DGBA 3I9V9 4A3GG 2AJFE 4F3MA 3HOYG 3M1YA 4IUVA 4O9MA 1MN9A 4CJ1B 3S1NH 1IYVA 4Y28C 2MZTA 2HFNA 2JX2A 3S1QH 3CC2S 2PW5A 3GG0A 5C4HA 5KG0A 4MFCA 4KPYA 2MRLA 2FHOB 2HSEB 4JBCA 4Y65A 4M94A 1AQ6A 1PK1A 2NTSA 5LT5A 1BKBA 2KN4A 2ROPA 1F60B 1T5EA 3V5RA 3CNHA 1RGVA 3H3VH 1D7QA 2VOOA 4KLEA 3OJUA 4YD2A 4LFCF 2D5DA 1NI3A 8ICYA 4AXIA 1PMRA 1SWVA 1HNIB 1B53A 3IR6B 1BQQT 1TKXA 2F0HA 1ZH5A 2JEGA 9ICSA 4HTJA 1QE6A 4BBRH 4TY8A 4B3SF 2DRAA 2YU9H 3CJ2A 2XI2A 3C5FA 2WB4A 3I70A 2E74C 4FYXB 4DL3A 4DS5A 1MN7A 4K0KQ 4ILWA 4NP5A 5TISU 2C3YA 1VQKA 4DXLA 5K8NA 4TUSA 1TU2B 1W6JA 1F9EB 3UE1A 3BQ2A 4IFDI 2PA8D 2NUUG 1JKHA 1YJTA 2RSOA 1JJHA 2AHOB 2OQKA 1ESFA 2XI9A 1XPOA 4DF4A 1HFEL 4J1MA 1IBMJ 8ICCA 4PXDA 1VQAA 1NHUA 3QWNA 3CRKC 1NPPA 2ZUBA 2NZHA 4DFDA 3CO0P 5JEAH 3KOJA 2F0NA 4A47A 5HR6A 4RQ4A 3Q8DA 3OQ2A 3K7UC 2F4IA 1DOQA 3ORYA 8ICFA 1DQ9A 4DO9A 5JU5A 4RWSC 1YKWA 5AI9A 2J6TA 1LM0A 5I4DA 4YB6A 1ZD5A 2GNKA 1QQ6A 1GUWA 1WTOA 2WVFA 2BA9A 3H2LA 4L6TB 1ZOTA 4QZDA 4IC9A 4YB7A 4PH5A 3ZD9A 2BHNA 1H38A 2RCFA 4Y2JA 3HKSA 4GXKA 3C6TA 5C3EH 4M5GA 3D8GA 3SFGA 3OSOA 4N9TA 4DNRB 3IV6A 2Z2LA 4A8SA 1LTID 3DUZA 1ZA1B 4DV5F 3NRBA 3NNAA 4RGMA 1FX4A 4N76A 3RTVA 2J7KA 2K8GA 1VK8A 4ANCA 5J3BA 1WTXA 4U7CA 4MF2A 5CV9A 3CJ3A 2CDRB 3I2ZA 4ICLB 2AKWB 1SXLA 2VD3A 1JLAA 4QW9A 5HY6A 1DYQA 2AW0A 1Q1KA 4O4RA 3I7FA 3S2DH 1STYA 2Q2HA 4X65L 1Y1VH 3NGUA 3J7YI 4ZS6A 2IPOB 2F0TA 3SQGB 5EQ0A 1TKZB 2ZIVB 4JI5F 2HI0A 4M1UB 5J2QA 3I4MG 2AJ0A 2KVQE 5H9EJ 1MSGA 5C2CA 3CMEA 1NKCA 1GUSA 4RGOS 5C0XJ 2K5WA 3G2XA 4ZUIA 2H5XA 4ZA1A 3L7UA 4AYBF 1NKEA 4JWNA 4IDKB 3SYZA 5I2XA 1S9EB 7ICEA 3Q8VA 2JLFA 1ZQVA 2E2JB 1SIJA 3FMCA 3PQIA 3DHXA 1C4AA 3THTA 2SNMA 1IM4A 1F5SA 3S1RH 2MTLA 4ITSA 2HCIA 2MFIA 1VQCA 1FE0A 1N88A 3DGVA 2DO0A 2UUBQ 3TYTA 3A12A 4MTNA 4JI5J 1I6JA 3JTNA 4NW2A 5HP1B 4ICLA 4GKKF 2F0MA 2SEBD 4E8UA 3LK9A 3KK7A 5J2PA 3EGWB 2RU3A 4XK8C 3PUZA 4WJWA 3ISDA 4RQ6A 1IG6A 2HQGA 2ZZNA 3CMAA 3WOEA 3DXBA 3GLJA 2N3LA 7ICUA 5JRTA 2JLEA 1Z4UA 3CQZB 3IP0A 2QA4G 2MEWA 3QGIA 5D46A 1KDAA 4DSJA 2BH8A 2BCSA 1JNZB 2XS5A 3BYTB 3R93A 4BBSB 1IBKF 3VAMA 2BOPA 3KDFA 2XM3A 1A62A 2QL7B 4DV0F 3HKZB 1S59A 1U49A 2LQBA 5KAFU 4BBRG 1WCMG 2C3MA 2E9TA 2E5LL 4HTIA 4PYDA 1WUUA 4A93G 3MAQA 1OJ4A 1TWHH 4DR3F 2KYZA 4IFDG 3M2RB 5B7WA 5CHGA 3JPSA 3MXUA 4DR7L 4OL7A 4A8WA 4RGNA 1MMDA 3K57A 2ZXOA 3PR4A 2DHGA 1LKYA 4IRDA 3MMAA 2RDIA 1L7NA 5IT9c 1CUKA 4JI5Q 1JKHB 1R31A 3RLNA 1VBKA 2RLTA 4G7ZC 3A1YG 1ET9A 1RAIB 3KBGA 3UNYA 5DLQE 4MFBB 2IOHA 5AM3A 4C3MA 1GXUA 3H8YA 2W11A 2MQMA 2GC8A 2QEJC 2DPJA 2NUHA 4TQRA 3C1FA 2HHSA 4ZVGA 3MEDA 1S48A 4QZEA 2ZJ5A 3CCLS 1SR3A 1SE3A 1XK8A 1TVRA 1S0MA 3OVAA 1F2LA 2JA5G 2RQ4A 4KITB 3D28A 3J7Z5 5M3MG 1J5EF 1PBAA 1M90T 1KOHA 3VVUA 3TEHB 5KAIU 3NTUA 2GMHA 3PO3B 1V85A 2HOFA 4CH0S 5CXTA 3SBMA 3D31A 2X51A 1NHVA 3MXNB 4CH7A 2QZ8A 1AXQA 4IOCA 5HVFA 2UXDF 5KFSA 1X55A 5M3MH 4C3IH 5IT9U 3U26A 3WDNA 4ZVPB 1KFTA 2VONA 1TAMA 1HPZB 2KZ3A 3Q6SA 1HI1A 2F8KA 2AP6A 1DRGA 4ZVRB 1Z4OA 4GKJJ 4B9SA 2B2YC 4UQGA 4UARA 3Q0AA 2MO0A 2GQQA 1U9LA 4AYBB 1QNUA 2XRSD 2JL9A 3TUZC 1WSVA 2UVRA 5U47A 4IFVA 5C0YA 4DNTB 2E2HH 2A1AA 4MK8A 4ED2A 2FJAB 2KEDA 1JMSA 3PTWA 2PKEA 3AUOA 4DV5J 1I1GA 4Y2TA 3P8BB 4ABNA 2HLTA 4KLTA 3HD2A 1OY8A 4NZ6A 1FKAF 3TI0A 1V3RA 5H9EK 1DFDA 3EZOA 4O4GA 2DUDA 1XWLA 2H5EA 3J7ZT 2R7XA 2HVZA 2E3TA 2QL5B 4AL6A 1ZQEA 2ZT9C 4O0AA 2PO4A 4YCUA 1FKPA 3N6LA 1RT2B 4FP5D 5CYJA 3MR3A 1I94Q 1NRKA 4FZNA 5F8LA 5D8HB 1Q3LA 3VCBA 3VA7A 3J80U 3VGTA 4LF5L 5F8HA 1YBUA 2AJ4A 5AK3A 2HW3A 1RHUB 1RT3B 2DHXA 3AJ2A 4LRCA 4HACA 1PK3A 4DQSA 2HHVA 4QWAA 5ALKA 3A8KE 1ZQGA 4IPDA 3S17B 4LF1A 4R8IA 2G1HA 1LTLA 4MT1A 4FVCA 2MY8A 3NVYA 3HSZA 2KECA 2AX1A 3QUBA 2LDIA 4FPRA 3UQ2A 3AQEA 5LSOA 9ICAA 5ETNA 1SQGA 1FD8A 4N8NA 2EYHA 4IJHA 1BC6A 4OYIA 2B9YA 1QQ5A 2P6RA 4RG1A 4CGYB 2ZH3A 5HQ8A 1A0OB 6FD1A 2UUAL 1HBNA 1FNVA 3BH6B 3IMQJ 5IGCA 2ZH2A 4DR7F 2LM1A 5B66U 1SV5B 4DPOA 4PZOA 4Q43A 1OQ3A 4KX5A 4ECUA 4X4VA 4ZLPA 2F8LA 2H3IA 5DBBA 1C0TB 2C3UA 1VC5A 2B29A 4TYAA 1ZOLA 2IHMA 2FDNA 3E3XA 1PH7A 2J5AA 1TU0B 4L3NA 4RH6A 5JPNC 4F4ZA 3VAJA 1AUDA 7ICIA 4RMFA 3RUBL 4J91A 2HIXA 5HSPA 1N5QA 4I2BA 1R6VA 1IW7D 3MF5A 1RXOB 2DY1A 5D65A 2VJVA 4WCEQ 4GN3B 2WHEA 1Y1WH 5CA5A 5ADZA 1QCKA 2GIQA 3WWVA 4DAYB 4DV5Q 2RUSA 3ISNC 2F03A 4JI2Q 4IALA 4DOCA 4A3IH 1WELA 4WXWA 3MR7A 1JLQA 5LMUJ 3A5UA 2AZ3A 4OO1J 2DXDA 5L1IA 1PH4A 5FLXE 4K50A 3MM9B 1DARA 2B63H 1L7PA 3U1NA 1D2BA 3AOCA 5BR8Q 4KI0A 2V4JA 5AI6A 2H3QA 3MDAA 1MKHA 4A3JB 3THVA 1L5UA 2JVRA 2E66A 1EY9A 3NOGA 3KKFA 3M6WA 5A2QU 2VV5A 1SYBA 3OR1A 4O44B 4LFCL 4FS2A 4U68A 1NUEA 2CYYA 1DLOA 3MCMA 1K8AC 1BHNA 2ZWPA 2AJ2A 1K0TA 2CQ2A 4PKDB 4C11B 4JI6Q 1V5IB 5ELDA 1MG7A 8RUCA 1KWMA 1SKWA 3GV5B 1NSQA 3RRKA 2FHJA 1MROB 3J81c 2LYHA 4ED0A 2V5HG 4PXEA 2PMZC 1P8LA 2C2NA 2F5GA 2ISPA 3RZAA 4X6AH 1RTDA 1YI2A 3DYAB 1EY5A 3M4OB 2WSFC 3PYGA 1WTBA 2ZD1A 4KN7C 1WCLA 4PZ6A 4AUKA 4O5CA 2RAQA 3GTGB 2WKDA 3GQBA 4RUCA 2ILZA 1X4BA 4NXMF 2BM0A 1RWXB 3S1NB 4M5LA 4QZ8A 4ZCMA 2KG0A 1N32J 5J2IA 1T9HA 4USKA 5IIIA 3KLFA 1LB2B 2NZ4A 4PG7A 1X4AA 4JMUA 2UUBF 1NUCA 2AH5A 5A0YA 1Z3EB 5GTIU 1K0SA 1EZ6A 2NLWA 1FRKA 3QZ7A 4RL1A 2DKZA 2IBKA 1U0LA 2J8AA 1EL0A 3ELHA 1M5PC 2NS1B 2DR7A 1H98A 1ZQIA 4L73A 1PVRA 3BS5B 4A93B 2G2YA 3E0EA 2R93B 1C4CA 2LI6A 2P9GA 4XA5A 4BC7A 3NENA 5ALWA 2K4KA 1DXMA 1DBDA 3GO5A 2DH9A 1ZQSA 5M3FH 3ZDDA 4C3IG 4KGXB 4KT0C 2ZHOA 2PI2E 1NHKL 1VK3A 5CV4A 5DLFA 2HT1A 2DJGC 2ZIVA 1JUDA 2CRLA 4PPZA 4IUQA 4OYOA 2IOFK 2QL9B 1PIEA 1T9TA 3TWZA 3KJNB 4Q2LA 5ETVA 3U9OA 2B21A 1ZQXA 1V38A 4F5RA 4ZVOB 1YWXA 3LWUA 3RJKA 3I4MH 3WK6A 1KQQA 2BOSA 4ECXA 3ISND 1JLEB 3DRSB 1HBMA 3UVJA 2KXFA 3BQ0A 3T5JA 1SUQB 1FDBA 3OTOQ 1M5VC 1OWXA 2O67A 4DSKA 3WOFA 1ZETA 2XWXA 4DBQA 2HFVA 3PYFA 1TKDA 4HTHA 4B9UA 4NMLA 2R7UA 3M85A 4TQSA 3VAFA 4HL9A 1QJOA 4EGVA 3MC1A 3K8VA 3G86A 4JBJA 2QLWA 1Y8PB 1ECWA 5J0SA 4IZ8A 2U1AA 5EHHA 1O8BA 1JWSD 4NWBA 2YVSA 2FVSA 3FFIA 2XLJA 3ITPA 1FXDA 1T9XA 2LXJA 3BGFA 2NXNA 4TKTA 2UUCF 3M9NB 5D4BA 2CFMA 4TVAB 3J7A1 3QLHB 4MEXA 1Q7YC 2IVFB 3QSIA 4D3HA 4ED6A 2GIFA 5GROA 3BBCA 3MEKA 5L1KA 1NB2A 2W7OA 5C6AA 2DCLA 1EEFD 2QA1A 3VAKA 2LLZA 3JAMU 4DFPA 1RYUA 4NXNQ 5GAEU 1E2VA 2DHSA 1HBMB 4ALPA 3KF8A 3OR1B 3VAHA 4HKQA 1TWAH 2MUYA 2XYGB 4CNYA 4RU9A 4UT4A 5CBEE 1N32L 2J9DA 2NN6H 3M7NA 1GXLA 2P2CB 3IKJA 5I9PA 1L7MA 2QILA 4RW4A 3DRPB 2BV3A 3E9HA 1ZM3A 1IKYB 1XNQJ 1N8RT 1XPUA 2GAHC 1ZTWA 5AXNA 1PTOD 2CRXA 3MMJA 4M5NA 2W4CA 3EXYA 4PWWA 2R7QA 1SYDA 3MA2B 1U0HA 4RW9B 3PMNA 2DR5A 3BF4A 3WC2A 2BE5C 4P0QA 3OXGA 1U24A 5JJZA 1XNQQ 1ICEB 1N34L 2I5JA 4DR6L 5H2FU 2LXIA 2FINB 3D54A 3V7KA 1HTLD 2DK2A 2ZUCA 4GRSA 4KKOA 5E4XA 1S7IA 2DRBA 1LT6D 3R5BA 4O5KA 4OQJA 3IM1A 2UXBL 5J2CA 3IFEA 4K4HA 7ICMA 4K2LA 2AX0A 3OFFA 4ZVEA 2QARA 3FSIA 1FIQA 3MECB 2YWEA 2IM2A 2BKEA 1SAPA 3TP8A 3CXCA 1EYGA 1IZ6A 2PQAB 3W9JA 1Z1BA 2MMYA 3V2UC 5GQOA 2YKQA 2VJ5A 5G5HA 1NB7A 4NLVA 4BBSH 2NRXA 5ELCA 1RT1A 3R9LA 1DAXA 4TLRA 3QU7A 4F72A 1VQDA 3TBIB 2RA4A 3MWYW 3JQJA 2JEAI 5C24B 5K8PA 2D9OA 1BCPB 1CJVB 5J0WA 3H5UA 1X5SA 2XTIA 2XMKA 2BJ8A 2EBGA 2MZ1A 1QY7A 3RJMB 4KV8A 3ZTOA 3W9IA 2ZHBA 4O42A 2XVSA 1W25A 3MFHA 1GHJA 8ICJA 5GMDA 1XR5A 5FKAC 1REGX 1PH3A 1I6HB 2KFNA 1YITS 3D6CA 1P9QC 2A6HC 1R7IA 2HK2A 1RZMA 4DU8A 4C11A 3GTKB 2ZJQA 2N82B 2LKYA 2QARB 4OIJA 1QTMA 1GUOA 4ID6A 3KDFB 2CQPA 4USVA 1RQLA 3BDPA 7ICKA 5BN5A 3BKTA 3MPUB 1B0XA 4J7CA 3HFZB 2VPZB 1JLGA 3ISZA 3VGUA 3POTB 3VR4A 2V9WA 3BQ1A 4DS4A 4Z2XA 4IOAQ 3PUXA 2YTXA 4YCXA 3E8OA 3JYTB 3P45B 2Y0SB 4ZHRA 3ZZUA 4IL6U 1W26A 1RJTA 1WTRA 1UCNA 2EYOA 4UB8U 1SSOA 2W54A 5D0HA 4J9PA 2EE1A 1N54B 5EOZA 1MC8A 2EDGA 3CDEA 4X4RA 2HVHA 2ROGA 3BYRA 3ILJA 3ZYYX 3K4GA 3HHLB 3NSWA 1DXSA 5BR8F 5KYIA 1S9FA 3OFEA 4J37A 3IAS9 2R7SA 3SEBA 1FJGQ 2MSSA 1CT1D 3BN7A 4Y2KA 2A0FB 2RQKA 4NXNF 2W7AA 3M7GA 1Y11A 5EX3A 1HNWF 1YT3A 5DDRC 5GMEA 5E41A 3MCNA 1FJCA 4X66Q 1YLXA 3BDEA 2YWHA 3MMAB 4CP5A 4DZ6A 5ALEA 1XC9A 2ATWA 4LFBJ 2W9AA 2Z6KC 2ZH6A 1IXRA 3E01B 3K17A 4OHVA 3R3TA 4KLMA 4GOPC 1RTNA 1SE8A 2ZOGA 3J80E 2CH4W 1LXNA 3LX0A 3QU4A 2A68C 4YFKA 2M8HA 3GP7A 2H65B 4C3HB 2KHIA 1RXVA 5E2QA 4Y2CA 4WFYA 3MTSA 3H0GG 1N5YB 4Q7AA 4UB1A 2COLA 4KHPL 4Z7CA 4K4ZA 4YDDB 2DR9A 3RBZA 4GKKQ 3Q23A 4ED5A 4WZMA 1S0NA 4ZKCB 3NQTA 1KKXA 1ZD4A 4I65A 4F67A 1UETA 1L3KA 4RW9A 2V2KA 3DNCA 4BGDA 4NEZA 1CQFA 2HVIA 2B6GA 2JRSA 3GQCA 3QNMA 4KLKA 4MK7A 3SI8A 1RT1B 2PGCA 2N78A 5ALNA 3G8QA 4EGLA 3T5HA 1P6TA 1VRTB 2RHQB 2UZAA 1RT4B 3OSNA 2K1RB 2BCRA 5JAVA 1HR0F 2ZZMA 3ERSX 1IKXB 5IODA 2FJXA 1GEHA 2DNQA 1NNXA 4M5DB 2IRUA 1JNRB 4X62Q 4RKUC 2OPQB 2LKZA 1HCZA 4PZVA 4ANEA 1NDPA 4F0MA 4H4KA 3HOYB 2KHVA 2FMCA 3BM7A 1GMWA 1AFPA 4C8ZA 3BJYA 1OXUA 4JYAQ 5IQQA 2CPIA 5CD4A 3FEWX 1BBXC 3K7AB 3QLHA 2ASJA 9ATCB 1WG1A 4ANDA 3RYLA 3H94A 2R7RA 1KVIA 3D5MA 5J0RA 3CYMA 3C8YA 3S14B 3NKYA 2IAJB 2L3MA 1EYCA 3CULA 2XY6A 1QQ7A 1TV9A 2CFXA 1ILQA 3E51A 2DGTA 1PTOF 1N6QB 1LOUA 2X6GA 2B56A 2FHMA 4YWKA 2PNHA 7FDRA 5AKXA 2XSCA 3D1OA 2IWHA 3IAYA 3S6EA 1TS5A 3FEZA 1K73T 5A8RA 2J0QD 3VAIA 5CC4A 3TQEA 2BVZA 5KFQA 4QR0A 5KFUA 5IV4A 2PPBC 4DV1Q 4PPDA 4UAZA 2B9WA 2W9CB 1UW9A 3KBBA 2F1MA 3L3OC 4JI3Q 1L3TA 4TQUS 3LO3A 1B8AA 2PMZE 2G06A 4Q2MA 4AQYJ 4OLOA 2H51B 1DQ8A 3NGDA 1LW2B 2RS8A 2DNPA 5IM0A 4PMCA 3JSMB 3F53A 1SYCA 4KLSA 2A69D 2RJZA 3I0SA 3PW7A 1UEBA 8ICZA 5ALHA 3RZDB 3KFUA 2OTLS 2GN5A 1QAYA 3ZTQA 4LFCJ 2DHAA 4KD3A 3F1ZA 1TL7B 1CSQA 1JLFA 1Q86T 3R2DJ 2ZXPA 1PK1B 5BN4A 3AD7C 3MEFA 1ZPVA 1TUGB 3FVQA 2VUGA 3MR6A 3V72A 2QLXA 1T3QA 4R4QA 4MEYA 2R2TA 2CVIA 3H8JA 4LVSA 2OEHA 5CYUA 5IIFA 1I94F 3NS1A 4F3OA 3MEEA 4B3SJ 2ROEA 5IYBG 3DCAA 1UT5A 3UPQA 2HHQA 1JWMD 4F87A 1I94J 1UFLA 3TA0A 3D67A 3HHNB 1UTAA 3BDCA 2KTQA 2H1YA 2PQEA 3L3FX 4ZKBB 1Q79A 4A8FA 1U0SA 4R8UA 2XNQA 3H4BA 3KLHB 4Y2IA 3KJFB 4U8YA 3KF6A 4RAUC 3CCMA 1NCVA 1PH6A 4OX8A 1RDFA 5LSLA 2B9XA 5J1EA 4I2HA 4PZ7A 4IH6A 4Z37A 2B9EA 1R43A 4K7QA 3QMQA 2KHCA 4DV3F 5IFMA 4FF4A 5DM6Q 1SYGA 2HAIA 4RQ7A 3HVTB 2ICIA 2Q8RE 5DBCA 3HJVA 3ZC4A 2V2QA 3A8KA 4XQ8A 2FY8A 2K33A 4QZ9A 1IW7C 3S01A 4ED4A 4ZUJA 2FVPA 3S16B 1IBKQ 4DR1F 1KKHA 1HBUA 3QIPB 3M8YA 2YNHB 1S5CD 3EDRB 2D6FC 4AQYF 2HHHF 4GZYC 4DJBA 9ICOA 4DV6L 5LJ3Y 2HBKA 1ROFA 3M3YH 1T4GA 1TL1B 2VQFQ 1VIOA 5DDYA 1TWHB 4DAMA 3OL8A 4NCGA 1NPKA 1DTTB 5IOCA 5KT3A 3BEGB 5EBDA 5KFVA 1FCAA 2UXBJ 1R0CB 3K1ZA 1BLUA 2GQ2A 4RWWA 4NASA 3BGRA 2FJ2A 3DLJA 3KLSX 2YX8A 2FUG9 2CPRA 5KYLA 1IKWA 2CQAA 2FJVA 4TSSA 4IOAA 9ICBA 2VIXA 3KLEA 1CG2A 2GMLA 1YNJC 3DOKB 3NMAA 1LV5A 2H4WB 3BQTA 5I42A 1GMVA 2CQHA 1R8AA 2WSEC 2XEXA 3G4SS 1WKLA 1E1OA 4A3MH 2UXCJ 1SJQA 2BKNA 5FLXU 4PMBA 4DL4A 2CQOA 4DR2Q 4K2KA 2NRZA 4F02A 1PYSB 1BDOA 3OHBA 2EVBA 1JLAB 4OX9J 3CDWA 3HMJG 3UCUP 4C3LA 4JI3F 2DD8S 2RP5A 1WHXA 3N7RC 5HBMB 3FUYA 2DGQA 3JPPA 4KFBA 4GVBB 1LT4D 1CC7A 5HMMA 3U27A 1FRIA 2XZDB 1KC8C 2V6AA 2YQ0A 3ULPA 3PO2B 3Q89A 1D9AA 2KRBA 2HHWA 2RIJA 3TREA 2RCNA 4P4MA 3W5OA 5M9OA 2M70A 1VIXA 3MAAA 2L9HA 2H3VA 4RPYA 2B7BB 3UDIA 4POFA 2YPZA 1LNQA 5I4MA 9ICWA 1K0VA 2DNOA 3KFWX 2Y1JA 3N4MB 4X65J 5JUMA 2G5IB 5EE0A 4QR1A 1EOTA 1TE2A 1Y69U 3ETOA 2G9DA 1RUSA 4HT7A 2OUGA 1S1WA 4DL6A 4ILRA 4KMUC 7ICOA 4DR2J 3PIOA 3I4MB 3PV8A 4ECTA 3CJSA 3L9AX 3R8YA 2VHGA 3KLWA 4ZLJA 3G6VA 2RMLA 1QSSA 2OO4A 1Q4RA 1CTMA 2ZKTA 4R4TA 4KBIA 4CRJA 2E1FA 4ZPDA 2MQHA 1B9NA 1I50B 1SNOA 2AIRB 2F40A 5ETOA 3G6ES 2DCUB 1Z6HA 4XIGS 3SCLE 1NLKL 2UUBL 3GMGA 3K89A 4UOFA 4HH1A 1O7LA 2HHPA 3I4NG 5IWAL 4YFUA 1IQZA 5ISRA 3IRWP 4G3IA 3G71S 3KHLA 2IA0A 4JW0A 1C1CA 2CPFA 4ECVA 3AAWB 4IG0A 3ILIA 1YBAA 5GADI 2RNEA 3W1YC 5AI5A 3UQ0A 2NRVA 4KX3A 5HROA 1QE1A 1V9PA 4QIEA 2VC0A 3FCVA 3J81E 3J80i 4P2XA 5LL6d 2BE2A 5KFCA 1VQJA 3UPFA 3C2PA 3FKIB 2N7CA 2Q79A 5F8GA 1JE5A 2C2ZB 1ZQJA 2UUTA 5ALYA 2ZITA 1UZDA 1HR0L 3F0NA 4NPOA 3I6PA 3NASA 2EXUA 4USWA 5CA7A 4NA3A 1VQ7S 5JJIA 2RSQA 4CO0A 4X65Q 2YXLA 4F4YA 2R7FA 1A6SA 3A8IE 3FP9A 3CIZA 1H9KA 5CH7B 3SR1A 4F7VA 4GKJF 2OTJA 2HDOA 2D9PA 3MZIA 3HOZB 1N0UA 1LO5D 3SSQA 1F9QA 3SK5A 5D3GA 3HKZE 2E8NA 2XQCA 1P1LA 3C3LA 4OV6A 5B08A 2AJ1A 5HVGA 5ALUA 4DL7A 3O8WA 3DLBA 4DV3J 1E6VA 3PO4A 4CKBA 2G07A 4MHVA 2PW7A 5DB8A 2D0OA 4PEOA 4H4OA 5K5PA 3TJAA 1VQ8A 3DRRA 5F8IA 1L2FA 5J1ZA 4Y3CA 3LP1A 3OXFA 5DG8A 2OI2A 2B6AA 1TAUA 4EZ6A 3KJQB 2R61A 3A7LA 2FDRA 1QCBD 3VAGA 1R27B 3NXWA 1RTIA 4DAYA 2APOA 1PFMA 2A6MA 2G13A 4ZVTB 1X6IA 4BHQA 2G0CA 1S1TB 1WKKA 1S1UB 2DITA 1VRQC 3CB4A 1YGYA 4RBUA 3KKAA 4DR1Q 4C4SA 2QTWA 2F0LA 1QM9A 5M2PA 5H9FJ 4ZDNA 3TZWA 3W64A 1NE3A 4S3SA 4I2QA 5KT2A 3AA8A 3CSKA 1GQEA 1F9FA 2VZ9A 1TVAA 4PHPA 2DKXA 1JB3A 3F5EA 2Q43A 2Y0SF 4YXMA 2RRDA 1GNKA 4N7TA 4B3TF 3I55S 5LMUL 5J2HA 3PMLA 3KHHA 3ZTSA 1GFWB 1B4OA 1HZAA 2IL8A 3X3NA 5K8OA 2HBJA 4LF7Q 1NNLA 2X1AA 5ELOA 3CDUA 2EAOA 2Z6BA 3J7AN 1BCPD 2H48B 3T41A 4KB7A 3WKBA 4K8JA 4K0KJ 1NOMA 4IFDJ 3DLHA 3R2CJ 4PUOB 2KICA 5E5NA 3ULHA 4Q44A 1FFSB 1VBZA 5DDPC 1JWUD 3OW2A 1KQFB 4F7XA 4UB5A 5MLCV 2RVLA 3EFXD 4CT8A 3PCOB 2PT0A 2NYHA 3NE5B 2R9LA 5D6GA 2KRRA 3NWGA 1UE7A 3R5GA 1ILPA 4B9WA 1H9JA 3K59A 3IRXA 5KFMA 1HUOA 1OSCA 4Y2YA 1JLBA 2B63G 4JUZA 5AXKA 3R5CA 3QO2A 3A55A 1C0TA 3D4WA 2XNAC 2XS2A 2J0TD 4UB6U 2AGQA 3CRXA 2DRDA 4DEZA 4ECSA 4IQXA 1RB0A 1L1OB 4G1PA 1T5XD 5GAEC 4UQTA 3C6TB 5AJ3F 3T6JA 2L12A 2UUAJ 1K8AT 1SIWB 2OPPB 5LMNL 4MHEA 3HX0A 4B3SQ 2OYYA 1HPCA 3AT1B 4L72B 2UU9F 4I4BA 1YSJA 2HHHL 4RPZA 5E7NA 2HNDA 1XNRJ 2RF2A 1J5EQ 3R5JB 4MH8A 4NKLA 1S6QB 3TAPA 5EBCA 1AEXA 4K59A 3RN5A 2XMMA 1X56A 4B3RL 4BBSG 3CCZA 2FGCA 3MD3A 1H9MA 1KHIA 1XTCD 4NA1A 5HP1A 4R1JA 4LFCQ 1S0VA 2MU2A 3OWFA 5ALOA 3TADC 3RJJA 2AWZA 3G82B 1VQOA 4YDXA 2UUWA 1RTJA 2QLTA 3SQGA 3W63A 4RPXA 1EKRA 2G0AA 3LANA 5C4XB 1X4DA 5C3EG 2O5DA 4K4TA 4UY8T 1RWUA 1IBMF 5CRXA 1TK5A 1S9GB 2XLKA 4EBCA 1WOOA 2DGYA 4GC6A 3KLIB 1PZID 4WZQA 1J5OB 2L55A 2RF4A 1AW7A 1ZQBA 4NLSA 2V34A 3V4IA 4K0KF 3BB5A 7ICPA 4U7UD 3U9SA 4I7FA 1D8BA 3CQZH 1HXYD 5RUBA 1N33F 3CO9A 1RCXB 5A6WA 3BBBA 2RKIB 4LSNB 2JFKA 4H4MA 3JAML 3T4AC 4CI0B 2CQDA 1EAYC 1WTQA 2RVJA 3VZIA 5IC4B 1EQMA 1KAWA 3M4OH 2YKPA 2DH7A 1ZQAA 4DPUA 2VB2X 2ES6A 1F6TA 1AN8A 1XNRL 5G5GA 3CCVS 1H9RA 1MI2A 4P7TA 4BS2A 2JHEA 4OYMA 1STNA 3EVOA 1S5ED 3WZ0A 3CCUA 1KRTA 1UAPA 4ATNA 3MEEB 1WF0A 2Z4IA 3LW5C 2BRKA 3UR0A 3HOWG 4ZPTR 3GIIA 2BEFA 1ZRMA 2JMGA 3NXZA 3RN2A 1D8ZA 2FLOA 4OI2A 2ZJPQ 3K0YA 3GTPB 5ALQA 3CGIA 3D4RA 1FFWB 1RODA 4PG3A 1K28A 1TY2A 4L6V3 3D6WA 7ICJA 9ICUA 4YMEA 3FBFA 1LYLA 3V6HA 8ICBA 2JA6G 3RB6A 1KONA 4X64J 3CP8A 2UU9Q 3JPRA 4OX9Q 1HQEA 4IQUA 3US5A 4YP3A 2ZC4A 4ILMA 5A8WA 2H1EA 1KIXA 4MAKA 1FVSA 4CLWA 5LL6X 3MM7B 1A77A 1XSPA 3TKAA 1IBLF 3IWLA 3BS1A 2ZTCA 3B82A 2XC9A 3NAIA 4U95A 2QEXA 2EZZA 2AF6A 4WFAQ 3PIOQ 2PFPA 2EFOA 2OF1A 4KV6A 3J80L 5IQ6A 3S14H 5IGBA 1FJEB 1G51A 3TQYA 1ZQTA 3TVZA 1KDBA 2BANA 2NYZD 1EU3A 3IRBA 3OSPA 2M9KA 1DGJA 1O7ZA 2W4PA 1TWCB 2I1RA 1CKOA 4RNFA 4MKBA 5J2AA 1HEKA 1L0XB 3QJLA 4DR4F 3HPOA 2MQPA 1PYWD 3RNUA 4LF6Q 2J4XA 2E5LJ 8ICOA 2V0NA 4BXOB 1XU4A 2JN4A 4RR5A 3M2VB 5ETPA 4B9TA 4K5VA 4CDCC 2AWNA 1Y1WG 4A8KA 3ILLA 3LWLA 2UV8G 1D5MC 2WFWA 2J8SA 3Q8UA 2NREA 2DTJA 2FPKA 3IS9B 2XMVA 1ZQZA 2NO5A 5M5YH 1EQRA 2MA1A 4R4IA 3NRWA 4EYHB 2JH3A 8ICPA 4JI2F 4EWTA 2MDAA 3GJRB 2RDJA 1JLBB 3DEPA 4LFBL 3CCWA 1JIHA 1JX4A 4R8UB 2HNDB 1YBYA 2RD5C 9ICQA 1O7IA 5E0OA 3EGZA 4U7UK 3J7A5 4RT3A 1VISA 2D3O1 1M1GA 1VLOA 1VQBA 8ICUA 5KG6A 3W8PA 3NNCA 4MFAA 4ZKAA 1UT8A 5KFEA 2F0JA 2YWKA 5A0YB 1ZYRD 2L5YA 1I3QH 1JXEA 2OGUA 2RKSA 1UVIA 4PWUA 1S72A 1EP4B 2B2TC 2CA9A 1TKXB 1OPIA 2NSBA 2ZEJA 1XNRF 4HEA9 2CVRA 1WTFA 3RR5A 1OW5A 2Q2TA 1RCVD 1UHUA 1CEZA 4YY3Q 3HZXA 4O3NA 1NMFA 2OQ0A 5FO9B 3LGHA 4MKVA 3HOVB 5IM0B 2ZHAA 4PMWA 3W7BA 1QJHA 3ZJYC 4LZDA 3MFIA 1BQNB 1F2MA 2WVCA 2LEAA 1Q7LB 1BPBA 2POKA 3C21A 3MFGA 4CLLA 4DR2L 1WEYA 1SWWA 4OX9F 5AKHA 3S24A 4TRDA 3FDTA 2HQ3A 3I5AA 1J97A 2HQFA 4MFFA 3UI3A 1SNCA 1PC4A 2KSOB 3VYUA 5KT6A 4AQYQ 2DGWA 1QZGA 3OTQA 4C80A 2CWXA 3HKWA 1SV0A 3NBPA 3ZTPA 3SD7A 1RDPD 2PC6A 1ZQOA 3UMCA 1EIYB 4USJC 3EX7B 4UBBA 1WD0A 2VPWB 1DURA 2NVTB 4RGTA 4O4GB 3TP2A 2LXKA 4JK1C 4I6AA 2E9ZA 3FAHA 2XTJP 3KBXA 4EQ5A 2VICA 1AZQA 2RF2B 3PHEA 1CM9A 4IUPA 1ENCA 5ITHA 1LTBD 4MIAA 1SE2A 2VFUA 3CP0A 2B8FA 2V2VA 1M5SA 1HZ9A 1IBKL 3NY0A 2KEYA 1VQNS 4K4YA 4IPGA 1BD6A 3GTKH 1KDHA 5M5YB 4IFVB 5CB1A 5KNDA 1B7YB 4UZCA 4P2CB 4ZLLA 1ASZA 1QUPA 1KD1T 4Z9CB 3DYAA 3AQQA 3ZO7A 1S4EA 1JK9B 5D14A 2EPIA 1CI4A 2QA4A 1SDFA 2A3VA 3OWEB 4TUPA 1ENAA 2OKQA 5KNIA 2OPQA 1EIHA 4ZN1A 1ZYQA 4DAVA 2F0WA 4F93B 1ZXTA 4Y6IA 1RT5A 2BBEA 1S5FD 2ZH8A 1B3QA 2KO1A 4KK7A 4IQZA 1F9HA 2D41A 2W01A 3GJSB 2CPJA 3MMCB 1D3WA 3CJ0A 3NVVA 1SB3C 3RMHA 3CXCR 4CDIA 5FJ4A 4J9OA 2LQJA 1ZS6A 4BCAA 2DJWA 1XR7A 1FD2A 4JI8Q 4HAEA 2PEBA 5DB6A 1UJ4A 4ZH4A 5THWA 3SXHA 4CLSA 1YNNC 1XS9D 2ZUGA 1KABA 4M47A 1GJXA 2IJNA 2FTRA 2IC3A 3TEGA 1BO0A 4JI6F 3QWPA 2Y3YA 1VFJA 2EYFA 2X1FA 3U4ZA 4A3FH 3AB9A 3WU2U 2Q1LA 4EMDA 1N5SA 5D3IB 3DOKA 2ATCB 2NCKL 4YCVA 3HCXA 4KGKA 3IHQB 2FGOA 1Z4NA 3AY0A 3E01A 3S7RA 3POTA 4CO3A 1ZAVA 3QIDA 5ETSA 1HWKA 4OI6A 2ZXIA 1N5TA 3NS7B 3M4QA 2RQXA 2VQFF 3BGRB 3WHIA 3DOMA 4ELVA 3AN1A 5IYCH 1X5TA 1CJTA 1QSLA 2NB0A 3AM9A 1EJ7L 2Z0SA 4PYAA 4QUFA 2KFZA 3HILA 4FF2A 1K3BC 2Y9UA 1BPXA 2OMLA 1YQHA 4JI4J 5HLFA 1S8OA 4ZJOA 4WXOA 4RNNA 4I27A 4C4WA 1MHWC 1RXWA 4UOHA 1PC5A 1GOZA 3K81C 2IVMA 1AP0A 1X4FA 2WB1G 3T1AA 5LXYA 3JB9k 2NUCA 4M63A 1FFVA 3D2QA 4HJ5A 4RFBA 2HNYA 2MP1A 4H02A 2A6OA 5CGKA 2K2PA 2OD6A 1K0RA 2JLGA 1RT7B 9ICXA 1URJA 5J2GA 3UW1A 2AQ0A 1IKVB 2NXCA 2CG8A 4DOZA 3TARA 2B4VA 4LF2A 3DHWC 3LP0A 2NWGA 3FKIG 1VS3A 2G1DA 2YWFA 5KFFA 5A8KA 4JV0A 2Y0BB 1U1LA 4ZOHC 1KRPA 2ZTDA 2B2UC 3TN2A 2W9BB 1GX5A 3EQLC 1NDKA 3LALA 3M2RA 2DNHA 4B3MF 1VJWA 3KOAA 1VGYA 2WF5A 1Z00A 1FRMA 2CAJA 2R3VA 4PHDA 3TACB 3OBIA 1EARA 3HKZD 3QAUA 5FOBB 4L5RC 3C14A 2E1CA 3ISBA 1LTAD 1PTOB 3UNGC 1I4HA 3ET6A 2MXYA 3AD9C 1XEZA 8ICSA 4YCWA 2HNZA 1Y1VB 4F5PA 2HHXA 4LF4F 2NO4A 1E6YA 4Y34A 2WB1F 5E4WC 3HD1A 4I2CA 3CKIB 3EBEA 3HKZG 3IWNC 3LQVA 4BS9A 3MM5B 2E2IB 1QILA 3I0RB 2GFFA 3I28A 1FT8A 4LJZC 4NCGB 2ICEC 1WWHA 4DCCA 1L0WA 2J9DE 4CH1A 2I5MX 3DN9A 2CNNB 5C7PA 1S3OA 1H9SB 2IX0A 1MIUA 1HI8A 1BGXT 3ENVA 4UB2A 1C4QA 1FRHA 3MURP 3KK3A 1TL3A 1N36J 1YRXA 4QJFB 1SXEA 5KT4A 1V43A 4DCJB 3DOLA 2XLIA 4L8JA 3VDYA 1E3PA 3J81L 4DU7A 4P4PA 2FXQA 5KFOA 1VQPA 2DUYA 1ZQDA 4HEDA 2FVCA 2XMJA 3GTGH 3GTOH 4A46A 3MZ5A 2PZTA 5AKIA 1J2MA 3H4DA 2WAQF 3H5XA 3N6RA 1VQMA 4A8XA 3NAHA 5FP0A 5G3LD 1M1KT 4DR3L 3A8EA 2A1BA 2GQCA 2OSQA 4LFBF 4CDFC 2JP1A 4KGVB 4RQ5A 1HQUB 4ME3A 2BDUA 2A2DA 1QUVA 2FJDB 2C3PA 1Z00B 2JGAA 2UVVA 4WU3A 3IL8A 2C2RA 1GXDC 2DVIA 2Q8TA 3M6XA 8ICVA 4BLGA 2IRXA 1X32A 2EDUA 1PYTA 2YB4A 1Q12A 3Q8KA 3WX8A 4OO1G 1BNZA 2PFDA 3G6JB 8ICGA 4AYBG 3L5KA 2Q2IA 5EJWA 5A35A 7ICLA 1RHMB 5JVG3 1TL1A 1HMVA 4BA1I 4C7YA 3C66A 5K5MA 3FK4A 3I73A 5ELEA 5FD1A 4M5HA 4K2JA 3V6DA 1DZ1A 3S2HB 1BQMB 3AB4B 1FJGF 4C7ZA 2NVQB 2YNFB 4YMOA 2F76X 2BPGA 3KLHA 1WC3A 1CS4B 3QEBZ 2DY8A 1KHVA 2VG7B 3J81i 3TUPA 1LT5D 1KEKA 2QF7A 2GVZB 1RSCA 2VFSA 4PWDA 2JA5H 1K1QA 2GJFA 3I90A 2MPUA 2WCXA 1HNVB 2VZAA 3H20A 1DJ0A 3HXMA 4KY6A 2VXWA 4QU6A 1S9GA 1VQHA 5ALJA 2RDDA 4OJLA 2UUCJ 4A3JH 1U2RA 5T14A 3WQPA 1CJKA 3BS7A 1ONLA 2EPBA 1S6OA 1JE4A 3K5MA 4G7HC 3VGSA 1TS2A 3S1MB 3RH5A 3CJ5A 4DLEA 4DUZF 4M04A 4DQIA 2R93H 2NN6G 4PPXA 2KHDA 3GYGA 1JLFB 3W1BA 2H4YB 2DFLA 2UXBQ 4KLJA 1JQYD 3HOUB 5CEHA 3PW4A 1Y7PA 5GAHU 2DXFA 3TAMB 1KSPA 2XGTA 4MIBA 1MJCA 4DR6Q 1B50A 1NK9A 4I69A 1EY7A 4LFBQ 3GE9A 3O5TB 1MQ2A 3AFQA 2NZOA 4GN4B 3NWRA 3DOLB 4ZCKA 1WTHA 2MQ8A 4DA2A 1HQRD 3UVJB 5EPKA 5IYDH 4OJPA 4YG2A 1KFDA 4MYTA 4JWMA 1FYCA 1AT1B 1H6KX 4X5VA 1JOQA 1FL0A 3A4TA 2IBOA 3OL9A 4LVOP 4DUZQ 5TSSA 2YH1A 3CCEA 1RT6B 2F44A 2QYGA 1P8GA 1JQGA 4RHSA 2KENA 3ZZOA 3RAMA 4YN3B 3OHAA 1RBLA 3OR2A 5IS2A 4Y2PA 1UFWA 1N60A 3C23A 4GKJQ 1YJUA 2HS4A 4LF6L 1XWEA 3LP1B 3TRGA 3D3BJ 5CJ7A 2J0SD 1JALA 1VDVA 1FX2A 3UMGA 2V8HA 1V9OA 1G6BA 3B6BA 4NM2A 1XNQF 4DOAA 2W1BA 3UQSA 2O5IC 2N4CA 3HRZC 2VU5A 2I9GA 2DY7A 3L2PA 1N32Q 1EYDA 2EEYA 5DB9A 4L5SA 3UM9A 4RW6A 3MM9A 4KRWA 2BDOA 2HUGA 1AH9A 1VRTA 8AT1B 1ZQ1C 1FHTA 3PGZA 4OYBA 4UAYA 4NXNL 1M5OC 2GMJA 2B2TA 5A8KB 5AICA 5AIAA 1FRLA 3BZCA 3A5ZB 2HMXA 3BBFA 2WBRA 4FXGC 4P72A 1Q0NA 1A0PA 3CIMA 4NCAA 1PH2A 1KOOA 2QIFA 4LRDA 1W6KA 4PNYA 2LFNA 2RBMA 1I6VC 4A4JA 3ZTRA 2HNYB 1JLCA 1S1UA 3PO2H 4I2PA 2EFGA 1QAJA 1B64A 2CDQA 3FVYA 3HT3A 4U9RA 2NYIA 1CI3M 2LQ5A 1ULRA 3NUQA 4A3GH 3N6MA 2I6WA 4R4CA 4OZJA 3L9ZA 3RJEA 3GJQB 4H0LC 1WHYA 1HHTP 5J2FA 4AFFA 4FZMA 4OEMB 2HCFA 2L41A 1ZQQA 3JSYA 3NHHA 1GHKA 3M7VA 5KFPA 2PEHA 2C42A 4A3BG 4YHHF 1YK9A 3QO9B 4GOPB 3O13A 1V97A 5IWAF 1PFNA 3FC4A 2SOBA 4O3RA 4OHZA 1XR6A 2PMHA 5AM5A 4P74A 4CO5A 4PUOA 4UOCA 3J81Y 1M5KC 4NLBA 2BQ3A 3PZPA 4JI2J 1B70B 3N6NA 4QWCA 2X3GA 5F8NA 2YTCA 2VC1A 4I64A 1QG7A 5F9LA 1L8OA 1AUSL 4FPIA 5F0WA 1J6QA 4YWMA 3KZXA 3CJTA 4YR2A 1N5WA 1KTQA 3KYHC 2B4UA 3GWCA 2D3UA 2P8IA 1BPDA 3IC1A 1T9YA 5FDLA 1VBXA 1MWQA 1YJNA 3EXCX 1GVPA 1PJ6A 2B6AB 5SUHA 3CCRS 5EGYA 2D74B 2VL6A 3LPYA 4X62J 4DUYF 3R6LB