2AHOB

Structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
264
structure length
259
Chain Sequence
MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structural Switch of the gamma Subunit in an Archaeal aIF2alphagamma Heterodimer
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 60
structure length 259
sequence length 264
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00575 S1 S1 RNA binding domain
B PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2ahoB02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ahoB01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 2ahoB03
2JA8H 3JC66 2RF4A 1NBWA 4A3EG 2ZM6L 4IFDG 5JJIA 4DV1Q 4GOPB 4TVAB 4L5TA 1CKNA 4UY8C 1PYBA 4B3TL 4LF8Q 1ASZA 5C44G 4DK6C 2NVXH 5M3FH 4AIMA 1IBLQ 3PO3H 3M9BA 3F8TA 4AH6A 4GOPA 1FGUA 3G4SA 1VQFA 4KHPL 2AWNA 2JEBI 3HOXH 4LWCA 4IPDA 5IYCH 1NE3A 4B3RQ 1UE7A 3S1QH 2VS1A 3JAMc 1O7IA 3GDEA 3J80i 4XTCS 4A3IH 1JJCB 3GO5A 5AJ3Q 4X66Q 1OXUA 1BVSA 2YTXA 1EOVA 4IJHA 1I5FA 4GLAC 4DUYQ 2NVTH 4X64L 1PYSB 2MQHA 1GD7A 2XTIA 3TS0A 4A3BG 2UXBQ 3ER0A 4RMFA 3H0GG 1PH6A 3I4NG 2LXKA 2WB1G 3EIVA 1ASYA 1G51A 3S1NH 2ZJRA 3QSYB 4JI2L 2R6GA 1V1QA 1UEBA 3BJUA 2IHFA 1VQ5A 2UUAL 1H95A 2VW9A 3NBHB 1N36Q 2JA5H 3PUWA 1XNQL 5IYBG 1G6PA 1VQJA 4JYAL 3CP0A 5LMNQ 3RR5A 2JA7H 1X56A 3K0XA 1VQKA 4NXNQ 1HZAA 3PUXA 2OQKA 3CCUA 1QZGA 3PO2G 2VUMH 1LYLA 4JG2A 4JV5Q 1HR0W 1BKBA 3DLLA 4POGA 2NVQH 5FLMG 4GNXC 1PH3A 1I94L 4JI6L 3CCQA 3F1ZA 3NENA 4AQYL 2PNHA 1Y1WH 3CCJA 2K5NA 4GKKQ 4Y52H 5IP9G 3GTPH 4A3LG 2UU9Q 3TREA 3GTGH 2N78A 2Q2IA 1GVPA 4DR7L 1HZBA 4IPGA 4KLKA 1XNRL 4OO1G 4APVA 1YITA 1Q7YC 1XMOL 2F3IA 4IPCA 2QEXA 1SN8A 5C0XI 3F2DA 1LUZA 1WCMG 5IP7H 1VQCA 1Z47A 1GM5A 4GS3A 3RLNA 4DR2Q 1IL2A 3PIOA 5ELNA 1S3OA 3FHWA 1J5EQ 1JB7A 1V9PA 2K5VA 2HHHL 5C0XJ 3U58A 1XMQL 4A3DG 1N32Q 3I7FA 2BA0A 1X54A 1HJPA 3U4VA 1HNZL 3CXCA 2OTJA 2I0QA 3CPWA 2ZJPA 4BXXH 3GTLH 3M4QA 1WYDA 2CWPA 5HY6A 1PH8A 3KJOA 4HJ5A 4YY3Q 4LF9Q 1M90C 4JI3L 1XNQQ 3I4OA 1Q8KA 3PIPA 4JI7L 5GAGC 1Z9FA 1Y1VG 1YEZA 1IBMQ 2WAQG 2R92H 2WB1E 1JE5A 1QZHA 2IY5B 2YTYA 1NMGA 3J7A5 3W1BA 1EYGA 2L15A 4DV5L 2PMZE 1IBKL 3TEHB 4DV4Q 1GKHA 1PFSA 4LNQA 5BR8Q 1GO3E 3CCSA 1UE6A 3Q8DA 4DV0Q 2CKZB 2R93H 1C7YA 4B3SL 1FJGL 4BA1I 2YYZA 2AHOB 1A63A 2Y0SG 5GAEC 4X65Q 5E7NA 1XPUA 3GTQH 1HR0Q 1X55A 1KIXA 1I3QH 1N9WA 3HKSA 4C2MH 3PF5A 4LUVA 1HZ9A 3S2HH 4UP8A 1PA6A 4DR5L 4DV2Q 2VNUD 5C4XG 2IX1A 4NPSA 2VQFQ 2UUCL 4BBSH 1SMXA 1SFOH 3UDFA 5M5YH 2WP8J 3TQYA 2VQEQ 4A3JH 3K7UC 4PMWA 3J81i 4DPGA 1VQPA 4DR3Q 3A5UA 2JA9A 5GROA 3CW2C 2VL6A 4NXML 2Z6KC 1E1OA 4HJ7A 4JI1Q 4B3ML 2UXCL 4JOIA 4A3EH 1KAWA 3D0FA 4R4IA 4X62Q 1VQIA 2PI2E 1Q1EA 4POFA 3T1HL 4LFCQ 3L7ZC 1P8LA 5DLQE 1HNXQ 5C44H 2YU9H 3STBD 4IFDI 4HIOA 4LF6L 2ZTCA 4JI4L 2EQSA 3J7ZC 3M4OH 1E24A 1CSPA 2PQAB 4DV7L 4GLVB 2C35B 4HIMA 1VQBA 2ZTEA 1PH5A 1HNWL 2YTVA 5K36G 4HJAA 2LXJA 3FKIG 1PH7A 2OWOA 3M3YH 1L1OB 4YCUA 1VQ9A 2PQAA 1X9NA 2WAQE 3U50C 3KLWA 1N33L 4A3BH 3OYYA 4JOIC 1B7YB 1Q86C 1BBUA 1QVCA 3H0GH 2UUBL 4B3TQ 3I4NH 1N34L 3J81j 1FVIA 1L1OA 4PZ7A 5IT9c 1L2FA 4A75A 1PH2A 4UP7A 1NTGA 3VDYA 1A0IA 3OW2A 3EN2A 4QL5A 4KHPQ 1Q1BA 2R7ZH 4BA2I 4A4IA 1YJNA 4BY7G 4LFAL 1IZ6A 3CMEA 1WFQA 4LF4L 1WJJA 1J6QA 1KHIA 2Y0SE 4L5RC 2RHSB 3CCEA 2FXQA 4WJ3M 4JBWA 1E3PA 3K80C 1KD1C 4DUZL 1D7QA 5AJ3L 4J15A 4X64Q 3PO2H 2ZTDA 4A3KG 1OXTA 4GOPC 2JEAI 2E2IH 3M7NA 1U5KA 1UWVA 1UE5A 3GTOH 3ULPA 1QVFA 4AYBG 1IXRA 3AYHB 5IP9H 5IWAQ 4JI2Q 4DV3L 4A3LH 1B8AA 1JMCA 2UUAQ 4A93G 1YZ7A 4H02A 3K8AA 1N8RC 3KYHC 2JA6G 1QUQA 1X6OA 1VCIA 2HIXA 2K75A 3KF6B 4P72A 3HOXG 4R4OA 4DV6Q 4HIDA 1YIJA 3H3VH 4JYAQ 1EIFA 3L0OA 2A8VA 1WCMH 3GD7A 5JEAJ 3HOWG 2ALYB 4GKJQ 1S40A 1B70B 2QGQA 4JC0A 3CC2A 2F4VL 1EIYB 3OTOL 1RIPA 5FJ8G 3H3VI 4DR4Q 3HFZB 4C3JH 3KF6A 1LTLA 4JCVE 4LUOA 2MO0A 2NVYH 4YHHL 1I94Q 4JI6Q 1YBYA 5LMUL 1A8VA 4JI5L 3L2PA 4AQYQ 3U4ZA 4JI8L 4IOCA 4LUZA 1D8LA 2K14A 4JBKA 1XNRQ 1G291 1Y1VH 2DGYA 4DR7Q 2HIVA 4BBRG 2IHEA 4MNOA 4DR1L 2QN6B 1AH9A 1XMOQ 2JA5G 2B3GA 1PH4A 2PI2A 4P71A 5ELOA 5JJLA 2OCEA 3HKZG 1I50H 4LF5L 5M3MG 2HHHQ 4IOAA 1LM0A 4YCVA 1XMQQ 4DR2L 3E9HA 3CC4A 3PV0A 3CC7A 2VUMG 3PSIA 1S72A 1HNZQ 1PH1A 3KDFB 1XPRA 3RLFA 3BZCA 3PUZA 1KRTA 4OONA 5C3EH 3ZJYC 1PHJA 4YWLA 1TWGH 3E9IA 3I2ZA 4DR6L 3I4MH 4JI3Q 1CSQA 2ATWA 3HOYH 5M5XH 4JI7Q 3JAMi 2KHIA 4BY1G 2NN6G 3CQZH 5C4XH 5C0XG 3KDFA 5GADC 2E5LL 3A0JA 4HIKA 3RN5A 3J80c 3TRZA 2E2JH 1PVOA 1TWCH 1U0LA 4AYBE 2VZAA 3S15H 1CUKA 1VS0A 1E1TA 3A5ZB 2B63G 3HOZG 3CAMA 4DV5Q 3RLOA 2BH8A 5IP7G 1IBKQ 1SROA 4MTNA 4OXPA 1VQDA 3G48A 1UE1A 3AQQA 1KC8C 1TWHH 1A62A 4B3SQ 2ES2A 4WJ4A 2UXDL 1KXLA 5IYDH 1YHQA 1MKHA 2N49A 3A74A 3ULLA 2Q2HA 4JI0L 1TWAH 3RZOH 4LFBL 4YWMA 1C0AA 1VQNA 4DKAC 4DR5Q 1CKOA 4OX9L 3TS2A 2UUCQ 2LSSA 2I5LX 4FDBA 3I55A 3GTJH 2R92G 1JJ2A 3FKIH 4NXMQ 4A76A 4B3MQ 1MJCA 2K5HA 3PF4A 2UXCQ 4OWXB 3MXNB 5GAHC 1XPOA 2HT1A 2GVBA 4A3FG 1BBWA 1OXVA 3PUYA 4JI1L 3HOVG 3T1HQ 2Q2UA 4IJLA 4K0KL 4ALPA 4IFDJ 2A1AA 3HKZE 1PH9A 1DGSA 4LF6Q 2V1CC 4DAYB 4JI4Q 5IE8A 4DNIA 4LF7L 2EIFA 1SRUA 3ICEA 3UDGA 4DV7Q 1VQ8A 2CWAA 4HJ9A 3T1YL 3AEVA 4BY7H 2ZM6Q 4A3GG 4GKJL 4O2DA 4QIWE 1HNWQ 2HQLA 4L5SA 4GN3B 2K52A 1VQAA 4EQ5A 1OXXK 1WOCA 2OTLA 3GTKH 3GTMH 5JJKA 2N8NA 4DV1L 4A3CG 2AWOA 1I6HH 4A3MG 2F52A 4LF8L 2YV5A 3PCOB 3H15A 4A3KH 3CCMA 1IBLL 3IRBA 3BU2A 2UUBQ 1WI5A 1N34Q 1VQMA 4PZ8A 5IYBH 3HOUG 3WWVA 1VQHA 1KQSA 3S14H 1T9HA 3D31A 3NELA 1KL9A 4B3RL 3CD6A 2ZJQA 4A93H 3LGJA 1EQQA 4LFAQ 1IYJB 2OQ0A 4LW1A 4X66L 4LF4Q 4DUYL 2JA6H 4PG3A 1MIUA 2JA8G 1K9MC 1YZ6A 1SLJA 5FLMH 2UXBL 1K83H 4GNXB 1QUQB 3HOWH 4DUZQ 3S16H 3PGZA 1E22A 1W2BA 4P74A 1EQRA 1L1OC 5FJ8H 1X3FA 1VQEA 5M3FG 2BH2A 4QQBX 3PO3G 4RG1A 1P16A 3F2CA 4GNXA 4YCWA 3NEMA 4GN5A 3M85A 4DV3Q 2IT1A 4QY7A 5IYCG 1AE3A 2R7FA 1N36L 3I56A 2JQOA 2ASBA 5LMNL 4A3IG 1OXSC 5IWAL 4OO1I 4QJFA 4O0AA 4NXNL 4BBRH 2D0PA 3M4PA 4JBMA 2R7ZG 2BA1A 4A3DH 1NJIC 3J81c 1W3SA 3SGIA 2B29A 4DAMA 2Z0SA 2VY3A 3UE1A 4DV6L 4JV5L 1YNXA 1K73C 1EWIA 2MO1A 4HJ8A 2ID0A 2F4VQ 2K50A 3OTOQ 5M3MH 4P75A 1C9OA 1EUJA 4GLXA 4GKKL 3BZKA 1CKMA 4OWWB 2R7DA 1X3GA 2JK8A 1MJEA 4YHHQ 2UU9L 4DR4L 5LMUQ 1EFWA 4JI5Q 1YVCA 1E7ZA 3S24A 3G6EA 4JI8Q 5JEAG 1SR3A 1L0WA 3B6YA 1R9TH 1RL2A 1VQGA 5FLXc 3RZDH 4KHZA 2MNAA 2AMCB 3S1RH 2JA7G 5EAYA 4BY1H 1HZCA 4YWKA 4XIGS 3STBC 3K81C 2EXDA 4DR1Q 3K7AH 2JE6I 5M5WH 3CMAA 1M1KC 1VQ6A 3UDIA 5HGQA 1VQLA 1J5EL 1N32L 4R1JA 2GN5A 3ERSX 2B63H 2MFIA 2NN6I 3HOZH 2RHQB 1OTCA 4LF5Q 2XGTA 2CQOA 3CPFA 3W5OA 3CF5A 3S2DH 1X3EA 1Y1WG 1Q82C 1Q81C 4DK3C 2A19A 2D62A 3MEFA 4YY3L 3F2BA 4IO9A 4LF9L 1XJVA 4R4TA 4UP9A 3AFPA 3W1GA 1IBML 1TXYA 4DR6Q 1HH2P 2IX0A 2E8GA 4UPAA 2QA4A 3CCLA 2E2HH 1YHAA 2DUDA 3DM3A 3FP9A 2E5LQ 5H1SE 1FL0A 3PUVA 5C4JH 4P73A 1JJGA 2I5MX 3E0EA 4DV4L 2JJQA 3RNUA 1TWFH 1FJGQ 5BR8L 2KCTA 2KENA 1VQ4A 4R4QA 1K8GA 2I5HA 3UDXA 2Z6KA 4DV0L 4BXXG 3CCVA 1JT8A 2CFMA 3UE0A 4PZ6A 4NB3A 3EBEA 4X65L 4A3FH 1HR0L 2WFWA 3ULJA 3HOVH 5GQOA 4EX5A 2K4KA 2UXDQ 1Q12A 2Q2TA 1X65A 1YI2A 4R4CA 3RN2A 4DV2L 1QVGA 2NZHA 2VQFL 4JI0Q 4L5QA 5J3BA 1VQ7A 5C3EG 1K3RA 1K8AC 1XTDA 4LFBQ 3S1MH 2VQEL 1YHBA 4OWTB 4OX9Q 4DR3L 1V43A 3I4MG 4QGUA 1NY4A 1SE8A 3G71A 2KBNA 3HOYG 4A3GH 4GN4B 3KF8B 2CCZA 2AKWB 2GVAA 4TQUS 2H5XA 5IY0A 4A3CH 1NMFA 4C3HH 4X62L 2KHJA 1KRSA 2R93G 2QMUB 1VQOA 4KI0A 1Y14B 4LFCL 4A3MH 4X6AH 3S17H 1HNXL 3KFUA 2NZOA 1Q46A 2D0OA 4MZ9A 2RCNA 3AFQA 4K0KQ 5LMNW 4ME3A 1AE2A 1YJWA 4LF7Q 3HOUH 4BBSG 4Y7NH 4IPHA 5IYDG 4A3JG 3KOJA 1CKNB 4JBJA 2KCMA 2N3SA 3CCRA 1PV4A 3T1YQ 3KJPA 1YJ9A 1K0RA 1N33Q 4C3IH
chains in the Genus database with same CATH superfamily
4M6WA 4DV0J 1CJTA 2HSEB 3MM8A 1OMSA 1MQ3A 4UBBA 4UY8C 1SNDA 3M7GA 5J2MA 4AH6A 3MMCB 3R97A 5EX0A 2CVEA 2RE1A 1KBRA 4DR3J 1RZTA 2F1FA 1RTNA 2PD1A 3RJGA 3OGUA 2EDGA 4NLYA 4A3BG 3TS0A 4U9RA 2KEEA 3ENVA 1SXTA 3MM5A 2D3UA 1L6NA 3IC1A 3QSYB 2IHFA 3D3CJ 4H4MB 2EG1A 3UVJB 4PWDA 5LMNQ 3LAKA 1RG6A 1I4PA 3A8KE 4QYRA 3GILA 5HQ8A 4KH0B 3RG6A 3B8HA 1RT5A 1B9NA 2NVQH 2RQCA 1Y1WH 2YWFA 3NGRA 3LP1A 2FFKB 5KG3A 3VR5A 5T7LA 4RLEA 4BJQA 5BYRA 3FC4A 3H2UB 4X64J 1P1LA 1OO9B 2ZUCA 4Y2CA 4K14A 2RBMA 1NDKA 3RZDB 4JWNA 2HHHL 1BPXA 2MAXA 4A3DG 1D7QA 2OTJA 5I42B 3CPWA 4KGMA 3B0XA 4Q0BB 1NSQA 3P8BB 4CLWA 2QDLA 2WOMB 3KJOA 2WF9A 3IP0A 2QFJA 3Q8SB 1LKZA 1IBMQ 4X4TA 1CVJA 4DL6A 3RH5A 1QQ7A 2EAPA 2QB0B 2K05A 2ZKTA 3MFIA 3HKZC 5E1FA 2GA7A 5KFBA 1UETA 1VQ4S 5K8OA 2Y0SG 2V8PA 1N9WA 2NYZD 1KP6A 1FKPB 3KUHA 1TE2A 2FI1A 4UP8A 1PRTD 3HHNB 2UUCL 3P45B 3CD7A 2G0AA 1QTMA 5G0RA 4RHSA 3SK5A 4A3EH 2DNYA 4KYZA 3KOOA 4POFA 2ZJRQ 1EARA 4KX3A 3PM9A 4CQ1A 3L7ZC 2FHKA 5ELDA 4IFDI 3K1RB 3EICA 3GYXB 4Y6IA 5IIMA 1DQAA 2QX0A 4XRHA 4WYWA 3NE5B 1IBKJ 8ICMA 1TL5A 1Q53A 3TO8A 2J0SD 5JTIA 1S1UA 4CGYB 3Q8UA 1BBUA 2F9DA 3DYAB 2CQPA 3FGVA 2Q8IB 5HBMB 5KOWA 1N34L 4A75A 4DQSA 3D6JA 1WWHA 3GFZA 4WCEQ 5KFHA 5BN5A 4IFYB 4MKAA 2DWQA 4QL5A 4ZP9A 1D5XC 1Q1BA 2W2NP 1TS4A 3TQ1A 5H9FJ 4UOCA 2CW0C 2F5GA 1KNAA 4KLFA 2PMZF 1JB0C 5AJ3L 3ITHA 1P9YA 2D5DA 2V34A 4A8QA 1X5PA 4KMUA 2JFDA 3JQJA 3C14A 3RJKA 4KJIA 1ICWA 3WK6A 4DNRB 2HMXA 1S79A 3QG1A 4ZPTR 4DV1F 3RGIA 2K8GA 4P72A 2HIXA 1XNQQ 2K75A 1FT8A 4R25A 1B70B 3H3VI 1N5SA 1UP1A 3HFZB 4USAA 2ISOA 2UVRA 1T9WA 4JI5L 4FNFA 2QW7A 3MWYW 3H40A 3AD9C 4IOCA 2DL0A 2LQJA 1E2WA 1XNRQ 2IHEA 4MNOA 1H73A 5D3DA 1ZQYA 2IM3A 4O4RA 2OCEA 4LSLB 1H7WA 2YMMA 4LF5L 3UPQA 4HACA 4ZHRA 2VUMG 4OLPA 4YMNA 2EYFA 1XPRA 3PUZA 1YNND 3ZJYC 5L46A 3E9IA 2RRBA 5CH7B 1GTHA 1LTBD 1S12A 1B0TA 2MB0B 5ALUA 4AYBE 2F8LA 1VOMA 1VS0A 1E1TA 4GKKF 4FZNA 2UU9F 4OXPA 3MABA 2DGXA 2WKCA 5C2GA 5M5XB 4B3SQ 5EWFA 3QJPA 5IYDH 3W3AA 2JZBA 4MMOA 5I6WA 1RAJA 4JI0L 2RDDA 4YWMA 3OUYB 2XLJA 5L1IA 8ICNA 4U673 3JTPA 4ZCMA 2B2TC 1OY6A 4S0MA 5ALWA 4A8XA 4K4UA 2CWKA 4B3MQ 1LW0A 5G4DA 4P0QA 7ICOA 2QTWA 1JLEB 1TQLA 4WKYA 4JI4Q 4M8LA 4PGQA 3MXNA 4DV7Q 1R4PB 4ZVQB 3N4MB 2BW7A 4DPUA 1P8GA 1TY0A 1S9GB 1I1GA 2EYHA 8ICTA 2M8HA 1E6YA 2OSQA 3RF9A 1XEZA 2IM1A 4RW8B 3GIIA 3GCXP 2GGPB 3HRDD 1HBUA 1J2VA 4ZMMA 5AKZA 1VRUB 4URGA 1PYOB 3VQTA 3KK2B 3C5GA 3DMJB 4PZ8A 5EN1A 5IILA 3ZZYA 1NZAA 3K5PA 1NR4A 1WELA 2RP5A 4B02A 4KLTA 3BQ1A 4IH7A 2YMLA 1H2VZ 5CZXA 4UQGA 2N88A 3PNIA 2VKQA 3FRZA 5KFIA 2BH2A 1D5MC 1T5EA 4QJFB 5LSRA 3QQCD 4YCXA 4F02A 4K5XA 1AE3A 3MEGA 2Y0SD 2HHTA 3PYEA 1HWJA 3FBCA 5D0EA 5J0OA 3D68A 4AT1B 4MK9A 5GAGI 2DNQA 4PYAA 1CEZA 3QWNA 3T9ZA 2XB2D 3K8WA 5J29A 3UQSA 4M9HA 3ITPA 4DR4L 1FFGB 4ZYSA 1I4XA 2AYMA 1R8HA 5JEAG 2XWBB 1L0WA 4C3JB 1R9TH 1VQGA 3RZDH 2GJIA 4MFBA 4DUYJ 3TAQA 2LECA 2GN5A 5LL6S 4RW6B 3BBFA 1XQIA 3LQVA 1U0HA 1TVXA 3ZD8A 1SYDA 5IGDA 1TUGB 5I3QA 2FC8A 2A2DA 1F60B 1IKVA 4DR6Q 1ET6A 3PX6A 3QSIA 3PUVA 5B0GA 3J7YI 3IR6B 4JI6F 1SB3C 4TUPA 1TKDA 1T0TV 7ICRA 4KV8B 4NYOA 2JSOA 3CCVA 2N7YA 4J9PA 5BN3A 4DR7F 4C48A 1ZQEA 2YKNB 2I0XA 2ZJQQ 3IAS9 5J2PA 1RYSA 2LA6A 2VQFL 2ACMA 1VCTA 2FGCA 2DHSA 4WYLA 5HSPA 4F3QA 2BRKA 4XT1B 2C1EB 4M9LA 3K58A 3TZDA 3R93A 2OFGX 3BVMA 1WTWA 1M5OC 4YY3J 2P2CB 4ZJOA 1N8RT 4K0KQ 3AXMA 4LRBA 1S48A 3H8YA 2EAMA 4ME3A 3NVWA 5DM7Q 2DUYA 2G0IA 2OPQB 3K0YA 2ACYA 4F91B 4A3JG 3WK9A 1SQEA 3H25A 2EFQA 2KCMA 3TOQA 1M5VC 5DS7A 1HWUA 5F3ZA 1R8CA 1XR7A 2OEJA 3MZ5A 1D1UA 2DGQA 2EJGC 3CJ4A 1HR0J 1M1HA 3RAMA 4PUOB 2EAOA 4OYAA 2ZJ5A 1JMSA 1N56A 3G4SA 1VQFA 1HTPA 4J7CA 4FNHA 5C4HA 2X7IA 1D2BA 2GMLA 4QIWD 1S1WA 1SUQA 2UP1A 1TV9A 1WD0A 1BQMA 2ZKUA 2Q8RE 2MEWA 1U25A 2FB0A 2HZCA 1LTRD 2ZOGA 3EIVA 3G8SA 5C0YA 4F25A 3N52A 2VW9A 2YNGB 4A47A 4AUKA 4OIJA 1WTRA 1RU2A 2CPYA 1VQKA 1WJ9A 3VQSA 4YMOA 1GFWB 1U1MA 2YBVA 3NASA 2HHPA 4POGA 3FZBA 4W4MA 4XA5A 5CHGA 4WWSA 4XAKA 1QH9A 5ETQA 4HR2A 5IT9Y 2K5NA 3NVVA 2M88A 3S01A 3GTGH 4RJVA 3HKZB 5J0SA 4IPGA 2E7WA 4RBVA 1MMDA 3WKEA 2QEXA 1JICA 2W25A 5CMDA 3C3LA 2RNEA 1Q0NA 2GAGC 4DR2Q 2C3PA 2YWHA 2F0SA 3GONA 4IRDA 4B9LA 1BOSA 1QCKA 4ZVHA 5HY6A 2UVVA 2JNJA 2GO8A 1EZ8A 1FTRA 9ICMA 1A2UA 1EZ6A 3ILIA 3KJVB 2DYAA 1S5CD 2DEJA 3A3OB 3MM9A 4GC6A 1X4CA 5AI4A 4ED1A 2QZ8A 2ZC3A 1T9XA 2FHJA 1FNMA 1RCXB 4QCLA 2EJFC 3D7SB 2ATCB 3P20A 4J5OA 1I94J 3PO4A 1R4QB 2B9YA 1GKHA 3A8JA 2CKZB 2KU7A 4JI8F 5JRTA 1X4EA 4XPEA 1R89A 4L6V3 2OPPA 3D54A 3JSBA 2F0LA 2VNUD 1X9SA 5IGGA 5IIFA 2F0DA 3UDFA 2KRRA 3ZTQA 3HJEA 2IDLA 3A5UA 4W92B 4E6IA 4WJBA 5AM4A 3N5FA 5K20B 1RF2D 4CJ0B 4R8NA 1P8LA 3DRRA 4RW7A 5M5YB 1JWSD 2CQ1A 1CSPA 5D77A 4GLVB 3IR7B 3ZDAA 5DDQC 2YTVA 4YN4A 2VIXA 4UY85 3QBCA 2CQ4A 4PHEA 3OYYA 5I4DA 1WF2A 1BWEA 2JA8B 1PH2A 3HVTA 2XIDA 2R7ZH 1T05B 3IKJA 1KHIA 2YNFA 1N0VC 4LF6F 2YX4A 2ZVIA 2KJXA 3PFOA 1G3OA 4RUBA 1ZRNA 5CWRA 1JWUD 3ISCA 3PMLA 2RDFA 3RTVA 3CYMA 3AYHB 2HVDA 2H51B 4GKJF 1CQMA 1HBMA 3KKAA 4I2GA 2V94A 1F5BA 3V7KA 5D46A 1S5BD 2K4EA 4M2YA 2JEGA 1IBLF 1F3FA 2M5YA 1LTID 4C3JH 5KFMA 1G2TA 1SVDA 2G0CA 5HVFA 1YVFA 4M5JA 2CPXA 1F0XA 5GMEA 3MMBB 2QLTA 4N56A 5A6PA 1CQFA 3AOAA 4DA2A 4C11B 3ND9A 2KM8C 2ZUGA 3AB4B 1FX2A 4OL8A 1CLFA 1HIWA 1PIEA 4DFJA 4NLUA 1PH1A 1RODA 2B2WA 3TX8A 5C3EH 1Y4ZB 3GV3A 4NXNF 4JI3Q 4JI7Q 1S49A 2HHXA 2Y9TA 3Q8RB 1HYSB 2IJFA 3KBGA 2DFLA 3KDOA 4JB3A 1VMCA 3A5ZB 3QLHA 4DV5Q 3NK9A 5LL6d 2VG5A 3JPOA 1UE1A 3I4MB 4K2LA 2YH0A 2HZVA 1KKXA 1VC5A 2N49A 2CH4W 2HWIA 5H9EJ 4LFBL 1ENFA 4ECQA 1WG4A 3SAGA 1F2HA 4FXDA 4DR5Q 3OWFA 3TS2A 1P6TA 4FDBA 4O4GA 2SNSA 1PBAA 3T6BA 2XMKA 2UXCQ 1A77A 2CXYA 3PEHA 2ZUAA 3Q22A 4IJLA 3FDTA 4ALPA 4DOAA 4NMZA 2XMUA 4IALA 2ASYA 1WHVA 2ABYA 1NI3A 4L5SA 4R9WA 5F8HA 2H5IB 2PO4A 1QAJA 1QTNB 3MXGA 1PK1B 1SC3B 3PCOB 2BKOA 2R2RA 1B44D 2DQNB 2JLEA 4XK8C 5AI6A 3D66A 4OX9J 1SC1B 5EKIA 3T53B 3HO1A 3BG3A 4OJPA 4OYBA 1K5OA 5ELFA 1Q78A 3NOGA 4F4YA 4LW1A 2GIFA 2FLPA 4I56A 4RUHA 2G08A 1BCPC 3HSDA 2BKNA 5ALOA 4IUFA 3POTA 1TAMA 2XY5A 5L1JA 4DV3Q 1F9SA 1RSCA 2MLYA 2YNIB 2JQOA 3UMGA 4GO5X 2YMPA 1NKEA 3EE3A 3ED5A 4B3TF 4JV5L 1K73C 1JLFA 4Z7YA 4KMUC 4OZLA 1GXUA 2D9OA 2MA1A 4NL9A 4DF8A 3ZI4A 1EUJA 4ES2A 5IIJA 5LMUQ 3QAEA 2YXLA 1Z7TA 1LW2B 3K7RA 2HAFA 1AYEA 3V96A 4MEXA 9ICFA 3R3OA 3ZZRA 3UWTA 4HYKA 3I4LA 3IBWA 1MWZA 1A3VA 3VR4A 5M2RA 2OEKA 4KE5A 3SMVA 4ELTA 3KUGA 2HQEA 1RT2B 1ECWA 2WINB 2E9RX 1A0PA 3B6BA 1SV4A 1N54B 3TZYA 3E8OA 2CQ0A 1H9SB 3KJQB 4I2EA 1KVIA 4Q8EA 1WVLA 1TUWA 3GIRA 4KPCA 5C4XB 1VQ4A 4FS1A 2MZTA 3KLRA 4DV0L 1F44A 1JT8A 4I2FA 4F04B 1HA5A 3DLKA 3H8SA 1PJ7A 2K4KA 4UW2A 1RAIB 2SXLA 3VZHA 5L1MA 2C2ZB 1TWFB 3K1ZA 4DR3L 4B6JA 1VMPA 2V9KA 1EWHA 1MSGA 1TWAB 3E3XA 4ECXA 4KFBA 1NZBA 1HXYD 2A69D 1Y8PB 3I55S 3CRLC 2F44A 1SYGA 4EX6A 1U2FA 8ICPA 3MECA 3HOUH 5GMDA 3SDZA 5C24B 1RXWA 4JV2A 2HWHA 5F0UA 1LT3D 2OO4A 1W2BR 3RBEA 3ILJA 2R7TA 2LVWA 2JA8H 3JC66 3M6VA 4RWXA 1NBWA 4IOCQ 2LDIA 4K4ZA 2G2YA 1IN0A 4TVAB 1URNA 2HBLA 7FDRA 1PYBA 4KGVB 4PXCA 3R5GA 4L76A 5B09A 4DV2J 3LPEA 3ISBA 3FQKA 1QCBD 2JEBI 3SEBA 1RWXB 1K1SA 2VFRA 1F3VA 3K0JA 4B3RQ 5AJ3Q 2DN8A 5AKYA 4RQ6A 1KVKA 4CF3A 5TZVA 4X64L 2MQHA 2UXBQ 5IV3A 3ER0A 2HQCA 5FP0A 4MTKA 1RBAA 3CDAA 3WZ0A 2F1JA 2LQBA 2OEOA 4ZRZA 1VQJA 2Q8TA 3MPWA 4HR7B 1GTEA 2WB1C 3HS0C 4CI0B 1U1KA 1PH3A 1ZQOA 4K4TA 3AODA 3OV7A 3G2XA 2M2LA 4Q44A 1SEBD 1KEJA 5IP9G 3MEDA 5LM7E 5IZHA 3IV6A 3OJSA 4UAVA 2MUYA 3L7UA 3J7ZT 4GVLA 1G2SA 1GM5A 3RLNA 3PW0A 2E5SA 3UW1A 2PFFB 3CMAS 3EW9A 4PL1A 1RT7B 4RWWA 3TNVA 5L8RC 3OBIA 3GFYA 3KLEA 1PJ5A 2H3ZA 4C3KA 4FZMA 4UAUA 4FE3A 1TL7A 2E1AA 3KLHB 2M9NA 4AQYF 5B0EA 2ROGA 2CPRA 1YRUA 1IBKL 2HNYA 4YHHF 4WXWA 1C0TA 2N4DA 4O3PA 1B64A 5HR7A 1NDLA 4OHXA 2PW7A 3C1EA 4ZVTB 4BBSH 4KTAA 1PFBA 4PPXA 3H7HB 1IYUA 3J81i 4CNQA 1HPCA 1S1TB 4P2FA 3ENQA 1X60A 4CLLA 4HJ7A 2PDAA 1FGBD 3S1MB 4C0OC 3I8ZA 1CJTB 4OJ3A 4LFCQ 2A73B 1S9FA 1HNXQ 4HIOA 3FUYA 3G86A 4NV0A 2CG8A 2VG7A 1RADB 4IUVA 3MI7X 5FJ4A 3MPDA 1JKHB 3A7AB 4OV1A 2NYVA 3R3TA 4PV1C 3D6FB 5KFQA 4EQPA 2WAQE 3KLWA 1KNEA 4MEYA 4CO2A 1T95A 3BVZA 1PZKD 1QVCA 3MC0B 3DHWC 1L1OA 2OIHA 4X4VA 1M1KT 3UDVA 4KHPQ 4DSFA 3UDEA 3H5UA 1WFQA 3F56A 4NXMJ 2BZ2A 2TMPA 4OZ5A 3I4NB 2H3VA 1BC6A 2ZTDA 2RKSA 4A3IB 3H2VE 3FAHA 1U49A 3WQPA 1JLCB 2QF7A 4Q8FA 1VQSA 3L7OA 3AT1B 3V4IA 3NAHA 8ICZA 1HNWJ 3QIDA 2C2RA 2GLEA 3C5FA 4PRFA 5L9XA 3EZOA 3GQBA 2NZ1D 2AT1B 2BYCA 3KYHC 1FDDA 1KSPA 1N33J 3KDNA 5JEAJ 2L9WA 1X32A 2VFTA 1B4OA 1RA7A 2UUBJ 2POKA 4DR4Q 3TVKA 2EANA 5A8WA 3GSDA 1VMBA 4YB5A 4FYWB 4LFAJ 4UB6U 2QLJB 4XTTA 4EEYA 2A0FB 1RXVA 4F4XA 4DUZJ 4ITSA 1NKBA 1YITS 1PZJD 2Q1LA 4P71A 5ELOA 1DLOB 4I2PB 2FJWA 2LA4A 2W2MP 3UMCA 3OFHA 2AJQA 5A76A 3ISNC 3IM9A 1PHJA 5LMNF 1IJEB 3DHXA 4FP9A 5LJ3Y 2I46A 3SK8A 1CSQA 1LWFA 3HOYH 4KHMA 3D1OA 2J8AA 5C4XH 5MLCV 4PG7A 5AKEA 1NRKA 1YRXA 1ZZNA 5G0RB 1FESA 1RWPB 3OPKA 1VQDA 4FP5D 2ES2A 1X42A 4WJ4A 2DISA 4J6HA 3ULLA 4DR1J 5AICA 1TWAH 1TWCB 4KLLA 4N8FA 4C80A 5CAAA 1C0AA 3EVQA 1OW5A 2XNRA 3RR8A 3HHLA 4NA3A 3G82A 2PMZD 3BSCA 5HP1B 1LTGD 2HK2A 5M2PA 3TSSA 1L3VA 2APOA 4JI1L 2FDNA 3HOVG 3DDKA 3T1HQ 3RZOB 4QWCA 2ZBIA 3FRYA 1IBMF 4ZUJA 2UVWA 4ER8A 3GTJB 4OI6A 1CC7A 5A2QL 1JNZB 1GX6A 4A3GG 4ZPDA 2UXDF 3ILLA 2H3QA 4JBCA 4Y2VA 3GDXA 3EGZA 2JEJA 1B99A 2F52A 4E8UA 1D3WA 1LV9A 2FJDB 3THVA 1VQ9S 4B9TA 2KECA 4M47A 3C2PA 2NUCA 2XM3A 1OY9A 4I2AA 1T9HA 3NELA 1KL9A 4FKYA 3C14B 3TZWA 3FFIA 3JQMA 4C3IG 4DUYL 5HHIA 3PRBA 4MT1A 4ID6A 4A8FA 4OZ3A 3N28A 4DSKA 2BE7D 2HQGA 1E22A 4S3SA 1U26A 1SJFA 3X3NA 2GIQA 3VR1A 4DQRA 1S99A 4MJKA 1SKSA 3V6HA 1KEKA 4ZVFA 1PVPA 1UWBA 2B51A 5AE3A 4GNXA 2NO5A 2FTRA 4RAUC 1JLBB 2O66A 4I2DA 2ASBA 4RKUC 4EBDA 1K83B 3V5RA 1FVSA 2E29A 3CJRA 2B2UA 4AD6A 1TS5A 3J81c 4UOHA 2G5IB 4PQXA 5L39A 1PC4A 4HJ8A 4US8A 4TN2A 3OTOQ 3G87A 3AA9A 4GLXA 1KVJA 3PKMA 2LQ8A 5C6AA 3HKZF 4ZHRB 3KKAC 3O8WA 3MF5A 3SR1A 2BMBA 4UB4A 2DGZA 3ZNUA 2K32A 2NN6I 4P2CB 1L7MA 2XCAA 2XGTA 3CF5A 2BW2A 1Y1WG 2RVLA 1SCJB 7ICUA 3NGUA 4YY3L 1N36J 3LPYA 4HTHA 1XNQF 1FRIA 1WDTA 4NLQA 3FEWX 3A8IE 2O01C 2HPUA 1JJ2R 2E2HH 2MQOA 2K8CB 3FP9A 2CJKA 4OYZA 4OJ6A 2HVZA 5HQMA 3O6QA 3I96A 2B2WC 3Q83A 5B5EU 5J22A 1HR0L 1XNRF 1HWLA 3VAGA 2IYIA 4L5QA 3S1MH 1YHQS 2Y9UA 3DOMB 2VUGA 4FVCA 2ILYA 2ZIUA 2MKIA 2V9WA 2FPLA 7ICEA 3V4MA 4KRWA 1ENCA 2RIJA 4B9MA 2KHJA 1E6YB 2HFNA 1Y14B 4A3MH 2O5DA 1QSLA 4Y34A 1S1VB 1HBUB 3D2NA 3D2SA 4QZAA 1RQNA 1AE2A 4K5VA 1P9QC 2GW8A 3J81U 4NL5A 3GZ7A 5ELCA 3VGSA 4A3EG 3Q2TC 5DDRC 4BY7B 4A46A 5IINA 5IS2A 3MUVP 3FSIA 5AFWA 5AKXA 2KHCA 3CCMS 1JMTA 2VKRA 3FKBA 1RTJB 2EH9A 2D69A 5EPKA 4XDDA 1BPDA 4XTCS 4A3IH 2RU3A 4B3MF 4F4AA 4X62J 3VR2A 3MEGB 2L1BA 4MH8A 5M3FB 1LFPA 3JPNA 1T4GA 1HHQA 4JI4F 4P9SA 2XMAA 3VALA 3HOXB 3ETOA 3SMZA 3NBIA 4OJGA 1G51A 4DV7F 2MZRA 5FLXE 1RCVD 3S1QB 4Z37A 3BJUA 2B56A 2JA5H 4MHEA 1G6PA 3JSMB 2JA7H 3K0XA 5K14A 5J2EA 2GQQA 3R8BA 2OQKA 4EGLA 1NSPA 4CLTA 1DGJA 3ELHA 1ZQXA 5HROA 2ZXPA 1I94L 2HMIB 5GAEI 4UF4A 1RI7A 1KDCA 3KK3B 8ICUA 1LT4D 2RQ5A 5JVH3 1YNJD 2NSBA 3B4DA 2EBEA 4NL9C 1EWCA 2EFGA 4AFFA 4XO0A 3CC4S 3BGUA 2W11A 2B5JA 2PSZA 3EGNA 3GTLH 1GQEA 3BJYA 4K4YA 2CAJA 4DFPA 2JEFA 1ACMB 1LWEA 1TUVA 3PZPA 2BJ1A 1J97A 1QZHA 2E75C 1SH3A 1NMGA 1YRTA 3S7RA 2K4PA 1TMJA 4EELA 1P27B 4JV0A 3KWMA 1FWPA 4LNQA 3EUB2 6AT1B 5AKGA 4KSEB 3NHHA 3U26A 1XMOJ 1O51A 4V0BA 2B43A 3FVYA 1VRTB 2K1RB 5CHCB 3ZDCA 1ZQWA 5E0OA 3GTQB 4QUFA 4NRUA 4DR6F 4I2JA 2KXNB 2B9EA 5AI5A 1E24A 2PQAB 2CPEA 2MKJA 3AL0B 5ALEA 4LR7A 5A8RB 1GOZA 3GYNA 2LXJA 2BCQA 4KN4C 4PQAA 2OHDA 1BQMB 1NCLA 1RAEB 4CDIA 3U9OA 2F1MA 2QSWA 3MR2A 3THTA 5CJ7A 1L2FA 3I87A 3GP7A 3AJ2A 2BUNA 2FPKA 4OJOA 1WJJA 2RUGA 2CRXA 3PO3B 1HNVA 4A3BB 4WJ3M 5KT3A 2CNKB 3HD1A 4BGDA 5KNDA 2V0NA 4K0KF 3PO2H 2CPIA 1JJ4A 3EVWA 2YQ0A 2E1FA 4DN0A 2NTSA 2E2IH 4ZVOB 1RDRA 2VASA 2W9CA 8ICGA 1WTHA 4MHVA 2QMWA 2UUAQ 1N8RC 2AJ1A 2LCWA 3PACA 2UZAA 2IFXA 1QAIA 4QWDA 3QYPA 2BKEA 2Y3YA 3N7SC 4QBUA 4JC0A 2K03A 4LIWA 1RIPA 4LF4F 2Y8YA 5F3TA 2MP1A 4LREA 2OAUA 4V19X 4KLIA 4OX6A 1A8VA 3L2PA 1FEZA 3LWLA 1Z00B 1G291 3M2RA 5CYQA 2R8GA 2B2VA 4Q2LA 2DO0A 3H5YA 4WP3A 3S9WA 1Q5VA 2MXYA 2JZ5A 5CR3A 1ZPVA 4NM2A 3CJQA 4F88A 5CYJA 5EBCA 4IQXA 9ICPA 2XICA 1NDCA 2JSXA 3NUCA 3BZCA 2SDFA 3PFEA 3ULHA 3EXCX 3MM7A 2DITA 4EENA 3IGVA 3VR6A 3E5SA 3H5XA 3CCLS 2BDUA 3CQZH 4WE1B 2EXUA 5D4OA 2VPWB 1T03A 3TRZA 3EWGA 4RQ5A 1IR0A 2RQKA 5F0WA 4P2MA 2RB7A 2DGVA 4ETZA 4EK2A 2HD3A 2QGFB 4RNFA 4LJMA 4KGZB 3HLUA 3TACB 2OXOA 4WK1A 4G1IA 4HDHA 4IG3A 2F03A 4DR2F 1N6QA 3DRRB 4OX9L 4MFAA 2VDIA 4LRDA 3I55A 3TZZA 4A76A 2K5HA 2IPOB 3BN4A 3RRGA 2WCXA 3SYZA 2HHUA 1BBWA 1OXVA 2A2CA 4ZKBB 2A1BA 4F5RA 5KYIA 4WFNQ 1REGX 4I7ZC 4DNIA 3M4YA 3OTEA 3V7LA 1BF4A 4BY7H 2EZZA 4O2DA 1EZZB 4GXKA 5D14A 2R7UA 4M9NA 3KMQA 4C8ZA 5C7PA 2AJ4A 3IP4B 2K4IA 3DLEB 2PQEA 4KO0A 1IYJB 2OQ0A 2BQUA 1WI8A 4UQTA 5KAKA 2WW4A 2NRXA 2J5AA 1K9MC 1SLJA 4LF7F 2GO7A 1CQVA 2P6UA 3X3UA 1W2BA 1L1OC 4YR3A 4FVMA 2XQCA 4KKTA 3P75A 1PFMA 2KD1A 1HPZA 1M5HA 2FVPA 3M9OB 4OYMA 3J81L 1VJWA 1SJ1A 5CORA 3BQTA 2CJYB 5T41A 1OXSC 4DV1J 3GTOB 2GIRA 1RDPD 1NJIC 2GQ2A 3LGHA 1W3SA 3UE1A 2KRBA 1OUQA 4RUAA 1WKJA 2OEMA 4J8QA 4AP9A 1A0OB 4CH7A 1X3GA 2IAJA 5E3PA 4EI2A 1DOKA 4F0MA 2ZOFA 2BA9A 1U4RA 4A8KA 2BGWA 1Z19A 4BY1H 4XIGS 1LK5A 3CMAA 5KYLA 2CNNB 1AROP 2A6ED 4B9XA 2QV6A 3CPFA 2CPJA 3BSOA 2AX1A 3QLHB 1M6YA 2IOFK 2VG5B 1CSJA 5IWAJ 4Y2IA 1UL3A 3K7AB 4UPAA 1D09B 1ZQIA 4QZEA 3H3VC 2E5LQ 2VV5A 3QFWA 1IJFB 3NGTA 4ILMA 4GKKJ 3C6TA 2UU9J 4O4GB 2CFMA 1GXDC 4PZ6A 8ICYA 3ZZZA 1SBBB 3L3CA 1UCNA 1TL1B 1ESFA 1UJ5A 1TU2B 4DV2L 1QVGA 4BCAA 4G1QA 2J7ZA 4NLRA 3IAYA 5IY0A 4WFAQ 2AEFA 1KLNA 3D2WA 2DNPA 3EPGA 1Y5LB 3KFUA 4JI7F 1E2ZA 1WORA 2KI2A 5LMNW 5DZ6A 3DOLA 1CQNA 1LACA 2NV3A 1S1XB 3CP8A 3EFXD 4IPHA 3HHLC 3QMQA 5AE2A 4WIIA 3KJFB 4DV5F 3PDNA 2Z30B 2B3TB 5AK3A 4LF8Q 2BOAA 2YMQA 1O03A 4K4XA 4K4VA 3PO3H 4DR5F 4CTAA 1MN9A 4OHVA 4LWCA 1TMMA 9ATCB 5IYCH 1S5ZA 5KFRA 1BUVT 4N8NA 2UXCF 1NJXA 2DY8A 3CO9A 4F5NA 3GR0A 2V50A 3IFTA 4NWBA 5HMWA 1FA0A 2F0NA 4QJVA 2LKYA 6FD1A 2JV3A 1IQTA 2UUWA 2Z4PA 3CCZA 3AUOA 3I5BA 4CYUA 1G8ZD 5KFAA 2MHVA 1ZM2A 1KDAA 5JOBA 3T19A 3CP0A 1X56A 4EEKA 1FFUA 1SYFA 4TKOB 2WHEA 2N3LA 1NOMA 4GNXC 2V4DA 4IOBA 3NTHA 4Y52H 4K8IA 2PGCA 4M95A 2FMPA 1V3SA 1YLXA 4OJLA 1A2TA 1NSAA 3N01A 3NNAA 1QM9A 3UM9A 2B2UC 4OO1G 2CNLB 1YITA 5CC4A 2AXTU 1CHPD 4RGOS 1FDBA 2LQ5A 1J5EQ 1J9OA 1R7IA 4C3JG 2ZE2A 5I9PA 8ICJA 5JPMC 1L8OA 5EOZA 1HCZA 4DV3F 4BXXH 3I4PA 1BR9A 1PH8A 3IN5A 1UVMA 2QL5B 1EHWA 5GAGC 2DHXA 2WB1E 3MZIA 3J80L 1FFVA 3AQFA 3P96A 4YS2A 4JI6J 2OM6A 3GIMA 1PFSA 5LMUF 1R0CB 2A68D 4NZ7A 2C42A 1MW7A 3T4AC 2W2PP 4KFBB 4DR7J 1LTAD 2IA6A 1TS3A 9ICJA 4YUDA 3TP5A 2IX1A 1Z4NA 4OFZA 2EZVA 1VC6A 1SFOH 1BHNA 3VGUA 3ZC4A 2GMJA 3CW2C 4ZVEA 4NXML 4JI1Q 1RTZA 1C20A 5GAEU 3QZ8A 3VHQA 1RPLA 3H94A 1I3QB 4CDFC 3NNHA 3OW7A 1BCPF 1AA1B 3VCDA 4BX9C 2I07B 4WZQA 2V69A 4A3JB 2OEHA 4ES3A 1DAXA 2HLTA 4HIMA 1CZWA 1HNWL 4CWBA 4UB8U 1X4FA 3W2WA 5K36G 2QLXA 4RQ3A 3A55A 4CZCA 1NAPA 1VQ9A 5LL6X 1N33L 1EY9A 3PSPA 1FNOA 4NJ8A 3OR1A 4TRDA 2UUBL 3C2MA 4TNOA 3W7BA 2NXNA 4DG1A 2O67A 3CF5Q 4A4IA 2BPGA 1ZQGA 4LFAL 3ET6A 3GR1A 3NS7B 3VYSA 2PT0A 5IGEA 4USWA 1ZYRC 2Q79A 8ICBA 4DUZL 3NCPA 2Q43A 2GHPA 3GG1A 3HM9A 4UB2A 1UFKA 2XMWA 4P0PB 4ZP8A 2NVTB 2NTTA 1XN9A 2RKIB 1A6SA 2F77X 1UE5A 3GTOH 1NB7A 3C15B 3OLAA 5D78A 4OYWA 3QXGA 1S6QB 2B8PA 2Y0BB 9RUBA 5ALNA 1QUQA 1X6OA 1VCIA 1SNPA 1AFIA 1D9AA 2CPZA 1JIHA 4IKAA 4I67A 1STBA 3HD2A 3KF6A 2ZIVB 2IYGA 1KKHA 3JYTB 4RPZA 4B3RF 4HI2A 2BRLA 5J8YA 5AJ3F 4RQ0A 3CCJS 3MR7A 2J9DA 3C16B 2P9CA 4DR1L 2UXBF 4N9TA 1AH9A 4A4JA 1XNSA 4X2BA 5D3GB 3HKZG 5F8LA 3HK2A 3GU3A 4CLKA 2ADCA 1AN8A 3CEDA 2B8FA 5AKIA 5KNIA 1ZKOA 5JVG3 2R7OA 5AKJA 2ATWA 3D1QA 3JAMi 1Q90A 1EP4A 5KFVA 5B0CA 4CO1A 3W63A 9ICTA 2YVSA 2MPMA 1T8EA 2GVZA 3MM6A 4H4OA 4R8UB 1HQUA 2YWEA 4MTNA 4DL4A 3AQQA 4JI8J 3MTSA 2DR5A 1KXLA 3L3OC 1I5OB 1YHQA 3JPPA 2RQMA 4DKAC 4KLHA 3BGRA 1LXJA 1JJ2A 2FVCA 2VG7B 2E8MA 3TAMB 1RWUA 1EFID 4PXBA 2LMIA 3D5MA 5ETSA 2HGMA 2VBYA 2E5IA 2A1AA 2YH1A 1U09A 2C2NA 4DAYB 5DNFA 5IE8A 4OZ1A 2EIFA 4QWBA 2ZXIA 1VQ8A 3MAQA 4C98A 4ICLA 1MA7A 4ZK9B 3WU2U 4DPXA 2IBOA 2F1IA 3TX0A 1SNMA 1TL4A 3WK7A 2ASLA 1YJTA 3CCMA 2LKVA 1VDZA 4L75A 1TU0B 2HNDA 2DNMA 3MBYA 1TIID 3HOUG 3A8JE 8ICSA 4ZCIA 3D31A 1DOLA 2Y1RI 3LGJA 1JRPA 2JA6H 4DUTA 2JA8G 1BWVA 3P5TL 3BV8A 1KLUD 2KJ5A 4M9JA 4LFCF 1HNXF 3AA8A 1M90T 3UN5A 3UN3A 1LWCB 4DFKA 1RABB 4DNTB 3KYLA 2BZFA 1TR0A 2HFSA 4Y3CA 5AM3A 1SV5A 4DQQA 4GKJJ 2K5QA 1N36L 5A8WB 1YSJA 5KL8B 4PGXA 3OT9A 3S16B 1AXQA 4KAIA 3HXMA 1QQ5A 5ALPA 2Z0SA 2VY3A 3Q6SA 5C25B 1SXLA 1PRTC 1YIJS 1EWIA 1IBLJ 2F4VQ 5C42B 2FJXA 1ZJMA 1C9OA 8ICHA 4KHPF 4UW9A 1MG7A 4NDXA 2R7DA 1MJEA 2MDAA 4C4WA 4MN3A 4PG4A 1DK3A 2ZH7A 1XSNA 2F0OA 4H7BA 1TKWB 2RCFA 3IFEA 5C0XH 4XQNA 3JQKA 4FFDA 1M1KC 3M2VA 5HMXA 5DM73 3UQ2A 3W60A 1LEOA 3NUQA 3H5SA 1TFYA 1I6VC 1C8CA 3VAIA 3SQOP 1FXDA 5JU5A 2D62A 2QL9B 2ODGA 4GIBA 2Q6BA 2F0EA 1RTIA 1AUDA 2G09A 3LYSA 2B2VC 4NXNJ 2G5HB 4H4KC 4O3RA 1Q86T 4IQWA 4A8YA 1EAYC 4DR4F 2KHDA 3TA1A 3TP8A 2XVTA 2L55A 3CKIB 3MGVA 3G82B 4J9QA 2HCFA 2DH9A 1RLDA 5C4JB 1CULA 1L8LA 3I4MG 4KN7A 1SE8A 3NCQA 2KBNA 3UXNA 4GN4B 2MQMA 2AKWB 4P10A 2IX3A 4V1Ak 4X62L 4LRFA 2JEIA 3CCWA 1H0HB 1SJ4P 2UVUA 1I4HA 3GB0A 4XQQA 5C2CA 2ZC4A 2M7SA 1MSHA 4MKVA 3GJQB 4BBSG 2KYXA 9ICHA 3M30A 3SQGB 1MN7A 1RHKB 1X5SA 2A6OA 1Q7YT 3FFIB 1RHMB 3TWZA 5EHHA 3T5JA 2BE5C 3QU9A 4PHAA 3JPTA 4I2HA 5HATA 4DK6C 3HKZD 4LAAA 4L3KA 4LJZC 2EK6A 1K0TA 3JAMc 1O7YA 1YNNC 1X3QA 3LP0B 3KG0A 2QYCA 2KICA 3RBZA 3SI8A 2NVTH 1CFMA 3T1HF 4QZFA 3R5CA 2MYFA 5EX3A 2JHDA 1X31C 2PFQA 1STGA 2IVFB 3FDSA 3HOWB 2BQRA 2C22A 2R6GA 4J9LA 1CTMA 5HQLA 2IM2A 1IL8A 3ONAB 2CQDA 4OLOA 4B3TJ 3NBHA 5GADI 3CMQA 2XMTA 4JW0A 4RGMA 3KLFB 1SNCA 1RT3A 1V5VA 3I32A 1NHUA 2R9LA 4AYBC 1AB8A 4U7UD 4G4KA 2BJ8A 1DXSA 2YPZA 1XMOL 1GMWA 1X9WA 3JSYA 3UXPA 2HVHA 3LANA 2DXEA 2F0MA 3DDNA 2XZTB 3U4VA 3MEEA 1NB2A 1WWUA 3LVWA 1FD8A 4UZBA 1KN5A 1CJUA 5SUHA 2UV8A 3H0LB 5IFMA 1Z9FA 1U8WA 3LP2A 3A0BU 4HN7A 3PRDA 1FO1A 2DNZA 1KTQA 2K06A 2CUYA 3OTOF 4EZ9A 1GHKA 3VVTA 2LQ9A 3TEHB 2VG6A 3FSYA 2HRYA 1ROFA 4LF1A 3SAFA 5J1ZA 4PABA 1WCLA 1O7ZA 1V1OA 2EFPA 2RF2B 5C4XG 3FCVA 2CPFA 4IFVA 1JLAA 1DK2A 2VQEQ 2E8OA 2DTJA 2KH9A 1HNZJ 2D8CA 2MSSA 3G71S 4C0ZA 4IFDH 1WTBA 2J6UA 2V2ZA 1NJYA 4C2MB 8ICFA 4X4RA 1GX5A 3STBD 3GLJA 4NLCA 3KHRA 2BACA 3DM1A 4HEA9 2BCSA 5T14A 2ZBPA 1VI7A 3IRXB 3B78A 1DFDA 5LHY1 3FEXB 4DAPA 3DLLQ 4NZ6A 4TY8A 4DL0C 1A9NB 3BYYB 4LSNA 2DNLA 3DWPA 2A1JB 1AT1B 3QRQA 1MSWD 1VGYA 4ILWA 4FN5A 2L0CA 4M5NA 4O5EA 4U7UK 4NLSA 2Z58B 4F3MA 3RJMB 4G7HC 4ECUA 4L5RC 1IKWA 3N7PD 2RJZA 2ZH4A 3CVKA 3BS5A 4Q2MA 2ZJPQ 1NNLA 2OGUA 3NWTA 4IR1A 2WONA 3A54A 2KQ3A 3PIPQ 2DH8A 2LI6A 2YQ3A 1UWVA 4I6YA 2KTQA 3KHLA 2GC8A 4JI2Q 4DQIA 2NPIA 4H02A 2XHWA 2K8BB 5DG8A 3H3VH 2ZIXB 2A8VA 1X4DA 5KNCA 1SL1A 2BPCA 1BLUA 4I6WA 1EIYB 3MUMP 2FY8A 2PEBA 1LTLA 3B9JA 1S57A 3U1MA 4ECZA 4DEZA 5CV8A 2J0QD 3AN1A 2K14A 1QE1A 1LWEB 2IHMA 3OTCA 4ED2A 1H2UX 3OSPA 3IA0A 2WF5A 1EYCA 2EYJA 3IGNA 1IKXA 2CH4A 2CQIA 3HSGA 4YN3B 1S72A 1ZQMA 2PZUA 3OIQA 5MAOA 2ZXHA 4ZKAA 4CDDC 5EGYA 1QLNA 1RWVB 1JLGB 5CXTA 2C28A 1GXTA 3OQ2A 4ANDA 4Q7AA 3BB5A 2DBYA 2HLUA 3T13A 5AHXA 2EY5A 1N5YA 1FCAA 5EBDA 2PI4A 4OIKA 4QIWC 4YHHJ 3I3CA 5A0LA 3E6ZX 3Q8VA 2KDOA 4J9UE 2FZGB 2C2DA 1N5XA 2BV3A 2FJ2A 1ZXTA 2OELA 2Z0GA 1PVRA 2D1CA 2Q4TA 1ICFB 2Q2UA 2VC1A 1RT1A 2EZYA 2XC9A 3TW0A 4LF6Q 3I6PA 4DMZA 4M5DB 1SRUA 5D65A 2W1BA 1UPPA 2PMHA 3QJJA 1WD1A 1S0VA 4E2FB 5C44B 1U1NA 4HAEA 3RJJA 4HL9A 5JJKA 8ICCA 4DV1L 1W6JA 2PC6A 4CE6A 2N7CA 4A3MG 3HVRA 4ZK7M 3MUTP 4IUUA 2L11A 1RKIA 2EK1A 3GTMB 2QSFA 1A15A 1EQQA 2L12A 4RW4A 1HA1A 2Y9HA 2DCUB 3DRYA 2JN4A 4IOAQ 3CMES 5J0XA 3A12A 3HOWH 4FO6A 3GIJA 1V3RA 4P74A 2HFZA 1X3FA 4AXJA 5CRXA 3PEJA 2DY7A 2F0JA 1N61A 3WK8A 1EIHA 3QT7A 4XQJA 2R7FA 5IM0B 1RT6B 2VA8A 3BH6B 1TAQA 4A3IG 5IWAL 4OO1I 5EPJA 4M5KA 1W25A 3C21A 3SGIA 2B29A 2H3FA 3T5HA 4OO1J 4DOBA 1XJWB 3CJ0A 5ETPA 1PZNA 4P75A 2BQ3A 4GKKL 4I64A 4IURA 2UU9L 1IM6A 3ZDEA 3OSOA 1EFWA 3S24A 1DXMA 3BKUA 2PIIA 4KQZA 1V1PB 3E58A 4I27A 4DWIA 1GXLA 2JA7G 1KABA 3FJ2A 1OS5A 1D9DA 1LQ9A 3M32A 5J0TA 1BGXT 3JPSA 5J8YC 2UUAF 3M2UB 3M05A 4R4TA 1F9EB 5F8IA 5LMNJ 3W3SA 2YB4A 4L3NA 1RJJA 1UTAA 2HS4A 2DR7A 1HH2P 1CG2A 3TANA 1UEVA 2GVDB 5JAVA 4NY8A 1SJQA 1X5TA 2AQ1B 1JJGA 1N6QB 1UA1A 2FJ6A 3TUPA 2KENA 5EKKA 2BANB 3QGIA 3ND8A 2EG2A 1FE0A 5I9OA 2ZHBA 2JOQA 4PQUA 5DLGA 1K3RA 1TQOA 5I2YA 3TUJC 2FJBB 2VZ9A 3PYFA 4LZGA 3J7Z5 3H0PA 4C8NA 3TADC 1MU2B 4I2QA 1HLWA 2V63A 3HOVB 2KIVA 3K5MA 3WIUA 2HDMA 2U1AA 4GC7A 4ECVA 4X6AH 2KCNA 3FMBA 3NP5A 4UOFA 1HMVB 1IBMJ 4B9SA 4ID8A 4Z2XA 4PXEA 5M2UA 4JB8B 1H6KX 2GWSA 1PV4A 1N33Q 1CA6A 4DFMA 3UI2A 5JJIA 4A8SA 3E01B 2XVSA 3C29A 3AB2B 1QE6A 1S10A 4DR3F 2BE2A 3MPYA 3W5YA 4CLZA 3JAML 2YTUA 2E5HA 3R5BA 2W3SA 1XO1A 2HRTA 2KXHA 1X4BA 2KSOB 4A3KB 1HPZB 5IQ6A 5AM2A 2MY7A 3GO5A 3T5KA 1LKYB 1DTTA 4IJHA 3HI9A 1SZHA 2ZOMA 4AYBB 2GFFA 1PYSB 1GD7A 4U67Q 3HFVA 1MMNA 2QT7A 3W2VB 3BBCA 4UT4A 1HWKA 2G06A 2LKZA 2O5IC 2HRUA 4KR0B 3TRGA 1F2MA 3PMFA 2B9WA 4K2XA 1D9FA 1QJOA 3PQIA 3B4MA 3CRXA 4CO3A 3IXQA 4P7VA 2JFKA 2NQPA 5CV4A 1YQHA 2QARA 1F1BB 3CC2S 3PO2G 2G9DA 2Z9HA 2DVIA 5H2FU 4B3OA 3D6CA 1BKBA 4PYDA 5FLMG 4JI6L 2HK3A 2IL8A 3CCJA 2YWGA 2N78A 1TR5A 2ZXOA 4DR7L 1PXUA 1S0NA 1WOOA 2IMWP 4OZNA 3MMAA 1C0UB 5H9FK 3CUNA 3PHEA 2L9DA 2KZZA 5HLFA 4YOEA 1VLYA 2CWPA 2F0HA 2KOBA 2KZ3A 4LF9Q 1XNQJ 1YWXA 4EWTA 2GQCA 3EDRB 2R92H 4LBIA 1WSRA 4FXVA 4RNHA 2GOLA 4ID5A 3W1BA 3QGGA 3PJ9A 3OL7A 4DV4Q 2H48B 3TVYA 1GO3E 1HQEB 1LB2B 1A63A 2DNKA 5DBAA 3PIO3 4U8YA 4X65Q 1XPUA 1XNRJ 2XMVA 1M1GA 4CJ1B 1CPZA 5A2QE 3TFSA 1ILPA 4P4PA 4ILRA 2A10A 1UEKA 2MQPA 1SPBP 5FLXY 1JC7A 3MDCA 4HSPA 1MROA 4V19J 4RA8A 2OPRA 3TN2A 1NSNS 1K28A 3FVQA 2KFZA 5KFZA 5KFJA 3K5LA 4R0JA 2KNJA 3BQ7A 5C44H 3N6RA 3OFEA 2A5HA 2QC3A 2E5LF 3WBZA 2MUTA 2C35B 5J2KA 5KG7A 1SJHD 1HBNA 3IFDA 2QB1A 1PH7A 4YCUA 4L6TB 3EUNA 4B3SJ 1BQXA 4NOHA 2BJEA 1JORA 1S59A 4C9DA 1H7XA 4F0HA 3J81j 1I4RA 4BY7G 2QMXA 2NVXB 2EVZA 4B3MJ 2OLWA 2P8IA 5B7WA 2D3OR 3A3NB 1B4SA 3M8WA 4TLRA 1V85A 1RTHA 4JI4J 1TKTA 3M7NA 4DV7J 2KHVA 2Y8WA 3KMSA 5NUCA 2ZIWA 3F5EA 1PJ6A 4A3LH 3SQIA 1JCKB 2E8NA 5J2CA 1CJKB 4HIDA 2A74C 3HOXG 1YIJA 1RHPA 1EIFA 4X3SA 2X3GA 4LF8F 2ALYB 1S7HA 2G9OA 2F0KA 1RUSA 4ZAIA 5RUBA 1XO0A 1DD2A 1REVB 3MPVA 2GH1A 3ZD9A 1EU4A 4R5PB 5FO7B 3FRPB 1KS2A 5ETVA 3T79A 4AQYQ 1UCVA 4JI8L 2X1GA 3FCHA 3G7LA 2F63A 1NJZA 3K6OA 4OELB 3NLCA 4XDCA 4LSZB 2QIFA 2EFOA 1KHWA 1VLBA 1PGZA 4IS7A 4I1TA 2OPSB 1IHZA 2YX8A 3E9HA 3PSIA 1HHSA 1WOSA 1AUSL 3EYZA 1FXLA 4YWLA 2IVMA 1VISA 4CO4A 3H90A 1ZQFA 1J5OA 3M1VA 4BY1G 4QZGA 1UFWA 4DPWA 5AK4A 2MQNA 1CUKA 4CKCA 4GVBA 1ZA1B 4QZCA 1E6VB 1MKHA 2B39A 2ZD1A 2NRVA 3KZXA 2QE5A 1AP0A 1C1BA 2DGSA 4HMIA 5BOMA 2OHFA 1UEUA 2YY6A 5J2QB 3PMNA 1WF0A 3SDEB 1T5XD 2HT1A 2J9EA 5F41A 4NA2A 3H91A 3AU6A 4DR6J 1NK4A 3I72A 1RAFB 2YN4A 3MGJA 3K4GA 4RGTA 4ZVGA 1ZTTA 4R66A 4GKJL 2PYKA 4YVZA 2G9HD 2B21A 4YDDB 3QOJA 2N8NA 3ET6B 2Q3PA 3EQLC 3W8PA 2MZSA 3DGPA 3DWQA 1FEHA 4QWEA 3EWAA 3H15A 4A3KH 1HIYA 1IBLL 4QIEA 2QDBA 4ICAA 2IA0A 1AZSB 3CDWA 3W8GA 4E0DA 3WWVA 4UASA 4KH1B 3KFWX 4JI1F 1FJEB 2EE1A 1KFSA 1HUOA 3HJVA 1YG0A 1QUQB 5G3LD 5HP4A 4K0KJ 1SC4B 1SB6A 4NCGA 1T11A 8ICOA 4TU8A 3PO3G 2LMRA 4ECRA 4RT2A 1NZPA 4JUZA 5E3QA 3IL8A 5IYCG 1QAYA 2ZJAA 4WTOB 4NXNL 3NG8A 3S1TA 1XR5A 4A3DH 2BA1A 3I70A 1Z4OA 2VJVA 2XRQD 1CBKA 2IOFA 1RWOB 3DRPB 5M3MH 1C1CA 3C1FA 4KLDA 3MTJA 3AQEA 3VA7A 2M70A 2TSSA 1WKKA 2ZDPA 1ZQSA 1UZDA 2AMCB 3S1RH 1PG5B 2W2OP 4PAAA 2ZITA 4CJ2C 2LBOA 2JE6I 3QGPA 4NW2A 8AT1B 3Q8LA 3ERSX 1OO0B 2IC3B 1EKSA 1R9TB 3PV8A 1YK9A 3SVMA 1HQUB 4PZVA 4RCOA 3DI6B 4C7ZA 5J2HA 3NOCA 4YEAA 2XG8A 2MZ1A 2LEPA 2YKMA 1U47A 3BPDA 4USIA 1Y11A 2ZVSA 5DQIA 1ZQQA 4BXXG 4ZUIA 3NNCA 4KLQA 4MIUA 1TVAA 2MZJA 2YNHB 3MCMA 2HS3A 2UXDQ 2Q2TA 1ZQJA 1H9KA 1F9QA 2F4IA 2WAQC 1FD2A 4IQUA 4C8KA 3EGWB 3G71A 3NRBA 2OD6A 2KKVA 4K7QA 4ZLLA 3O13A 2I6WA 1H72C 1QNKA 4F5QA 2E5GA 3FKIB 3AFQA 3UDCA 2ASDA 2EKYA 2I9GA 1CKNB 2P66A 3T1YQ 1UAWA 3RBDA 4QNLA 3G6VA 4NM1A 1HKAA 3MCOA 2N55A 2CVIA 5KFCA 1YJUA 4DAVA 3NAIA 4GOPB 4L5TA 1R6VA 2FJVA 4B3TL 1RA6A 1QOHA 2NB0A 2VBWA 2NVXH 4DL5A 3F8TA 2WV6D 3B54A 3SCLE 3H2LA 2BDOA 2VS1A 3GDEA 4IQVA 1BPYA 2C9OA 4X66Q 2YTXA 3MMCA 1RTOA 3S14B 4MTPA 1D8YA 4JV1A 3WDNA 2F1HA 1N4LA 2F3VA 1S4EA 1ASYA 2IHNA 3JPQA 4KLSA 4C3LA 3ZZOA 2R2SA 3MR5A 4F26A 2RRDA 4F72A 5KIXA 4RQNA 1Q3LA 4F2RA 2HS0A 5IYBG 2BXJA 5J2AA 1QUVA 5L1KA 4DN4M 2K5DA 2VUMH 3I0RA 2MGZB 2K28A 3UVJA 3BDLA 2OT2A 4J9OA 3O1LA 1Q8BA 2Z1CA 1OJ4A 5D4NA 4I7AA 1PKUA 1UNSA 3NMRA 3M9MB 3F2DA 2HHQA 2P35A 3KBBA 1S3OA 1HNIB 2VANA 3U58A 3CC7S 1HJPA 1HNZL 3W64A 1SKWA 3GTGB 1S0MA 4EQNA 5C4ZA 2AWZA 1H98A 5ALSA 1M90C 5J2IA 4A8EA 4K5RA 4JP8A 4DDFA 5I42A 2ROEA 3GFXA 3G6YA 2F4VF 2WOMA 3J7A5 1CULB 2QA4S 4NLXA 1EYGA 1BPEA 2FGOA 1VF5C 2V4JB 2NR0A 2QILA 5BR8Q 3GP9A 4G3IA 4KLEA 3B82A 2QB0A 3DGVA 2W4DA 3DU5A 2RSOA 5KFNA 3Q24A 1TKZB 5ALQA 7FD1A 3IS9B 4CDGA 5KTQA 3QAUA 3UD5A 2G4BA 1ZQVA 4XUSA 3K7UC 4PMWA 1DQ8A 1VQ7S 1KN6A 3W1YC 3M1YA 1ICEB 1FKPA 4DU7A 2HBQB 1XU4A 5FK9C 1JWWA 2IMOA 4R4IA 1URRA 2QKIC 4JI3J 2DRDA 3VTIA 4JI7J 3R6LB 1O78A 3EM1A 3L95X 3MFHA 3PW7A 2ZTCA 4TUSA 2ZH3A 3ISND 1VQBA 4DV5J 3OLBA 3VAMA 2FMMA 5T1GA 4WP9A 2KHQA 3U50C 4QZBA 2SOBA 2K89A 5GTIU 2W9AA 4JOIC 3T16A 1Q86C 4NASA 2XLIA 1PRTF 3J81E 4BHQA 4DR5J 2C5CA 3EN2A 5D0HA 5FDLB 5JJBA 3DYAA 5H9EK 1IZ6A 4ZCKA 3CMEA 3DRSA 4C3MA 2Y0SE 4ZLTF 5HBMA 5HGTA 1Q82T 2UXCJ 4Z6FA 4JBWA 4P6QA 4IFYA 4FNIA 1VJ5A 3K80C 2FHJD 2LYBA 1CJVB 2HOFA 5J1NA 2K60A 3RRHA 5JEAH 2R7ZB 3FEYB 3D67A 4CCHA 4M94A 3R9LA 3CNHA 3DDHA 3LK9A 5IWAQ 3UR0A 3RD4A 1STYA 1RT3B 2JA6G 4RBUA 1N5QA 4JYAQ 4NEYA 4O3QA 4I29A 1ZM9A 4ED7A 3DU6A 1EYDA 3H59A 4I68A 3PNCA 3HW8A 1FNUA 4LK1C 1FEEA 4YHHL 2IRXA 2W7PA 4EVOA 1NR2A 1CJUB 4WFZA 4JBKA 2DGYA 3H8WA 2OMOA 1GH8A 1PH4A 1Y5NB 2G07A 3I9ZA 1O5JA 1N60A 1XTCD 2DNOA 1XMQQ 2PXIA 1QSSA 1WKLA 4DV3J 3EX7B 3MCSA 1JLQA 4LSLA 1S6PB 1J2NA 3DXJC 1SH0A 1PVQA 1SE4A 5C0XG 2I5JB 4O5CA 4ZVRB 3RN5A 1UT8A 1D5ZC 4DSLA 4B9NA 1FKAF 3RLOA 4J90A 2BH8A 5IP7G 5C3EB 5LMUJ 1T3OA 3J7AN 4H54A 1A62A 4K4GA 3UCUP 4YR0A 4OHYA 3RJHA 2XS5A 5M9OA 2Q2HA 1AQ6A 2Z2LA 3FPUB 2R93B 2FHTA 4RT3A 1VQYA 5ALHA 2HG4A 5E79U 4ZLNA 3FKIH 4Y2SA 2JLFA 2V4QA 3PF4A 5LXYA 3P1HA 2E44A 2FY1A 2IBKA 4ABNA 3CIMA 3WKAA 1DGSA 1KNZA 4KJNA 2Q6CA 1CM9A 4PMBA 3UDGA 4YFKA 1FKOA 3RAQA 3L4PA 3AEVA 4QIWE 1JLEA 1WUDA 1VQAA 2L48A 5ALTA 1IKWB 3DXSX 2CQCA 2VH7A 3BS5B 1OQ6A 2W9BB 1PYWD 5EE3A 4EX7A 1S9GA 1OXJA 1JWMD 4K4WA 3OR2B 2BCVA 4ZS6A 1BMQB 4RW8A 3NRWA 2H3IA 4IG0B 2VQEF 2GGPA 3S14H 4L74A 1EETB 3MMJA 4CM2A 1R0AB 1VRUA 2P6TA 2Z8QA 4LF4Q 2WVCA 4AYBF 3DMJA 1R3NA 5KFLA 1SIJA 1ELOA 1IM4A 4US9A 2ZJ8A 4QQBX 4K59A 4LVNP 4GN5A 3M85A 4KLJA 2IT1A 3C6UB 3DEOA 3V2TA 5LMNL 4QJFA 1NBEB 2CPDA 4TYAA 5EQ0A 2H4WB 1W6KA 1EY5A 1X66A 2ID0A 2MKCA 4PL2A 3SV3A 2K8AA 3BZKA 1AZQA 1IKXB 1WCMB 2KVIA 3P3DA 5J2NB 4B3RJ 4O3MA 2BJDA 5AJ3J 3J80E 3B6YA 5FLXc 2NN6H 2UXBJ 1VK3A 4NLNA 3P7JA 4RCNA 4DX7A 3Q89A 5HGQA 4OI3A 4R1JA 2EY6A 2MQ8A 5KT5A 2KJ9A 1ZD4A 3QJLA 2WAQB 1N5YB 3W5OA 4JI2F 2DR9A 5J2JA 3HG9A 1MHWC 2A19A 2K7JA 1I50B 1CI4A 2FLLA 2WSFC 4K4SA 2XCPA 4RW6A 1IBML 5J1EB 2LEBA 3NVZA 3JB9k 2DGTA 4DV6J 3BVGA 2BABA 3KHGA 4J1MA 2VFVA 1AW7A 4HHUA 3UE0A 2ZNYA 3BGLA 3HJFA 4RQ7A 3KFUF 3SE0A 3R7BB 4C7YA 3MDFA 3RN2A 3N9UC 5AIBA 4KV8A 1IVZA 1XTDA 2QG9B 1TWHB 1SYCA 4QIFA 1QUPA 4K6LA 2YKNA 3U9SA 3KF8B 4EU0A 3KK1B 3W9HA 1PO6A 5IGCA 3M8RA 1K47A 3SD7A 2J9DE 1KQSR 1KBUA 2DRBA 1X8DA 3FC9A 3HSZA 2X1AA 4LF7Q 2VD3A 1S6UA 3D9BA 2Z2YB 4I0WA 2F0FA 1ZM4A 3R1HA 2MSTA 2V67A 4ZPAA 2MJUA 1DURA 2ZM6L 3B0YA 5KL1B 4IFDG 2OPQA 1S0OA 2OH2A 4ACOA 1B2TA 3HOUB 5ETNA 5FLXU 4NI2B 1LVHA 4NE9C 5E3CA 4C4RA 4PUOA 1ZQBA 5J1PA 2NXEA 7ICNA 3MAAB 3NXWA 3OTBA 2GZOA 4UAWA 1BVSA 2RQXA 4LFCJ 2R7RA 1HNXJ 3R6GB 4X4PA 4IO9Q 4KKOB 5HNKA 1H74A 1PH6A 3ZTRA 5IIIA 2LDYA 5KT7A 2ZJRA 4HMJA 1UEBA 5FOBB 2F0QA 2HQIA 5DDYA 1XNQL 5KFSA 2LFNA 3I56S 2V2QA 3AY0A 1PDQA 1LYLA 2YNGA 4CF5A 1DBDA 3H8MA 1EKRA 4N9PA 2WIIB 2BBEA 4KHPJ 1KDNA 3WKCA 3GTPH 4QIWF 3T6JA 1BNOA 2LM1A 1EY6A 1XNRL 3KLSX 1STEA 5CP2A 3K5NA 2GCFA 5A8KB 4IPCA 3QU5A 3I1YA 1RGVA 2X3DA 3OHBA 3NQTA 2M8DB 5CR0A 1N32Q 1V9PA 7ICTA 1OWXA 3NEKA 4DPYA 2CA9A 2BA0A 2BX6A 2RH3A 3QUTA 2CFXA 3M4QA 1WYDA 1FFSB 2SNMA 3RRKA 5E4WC 4UAZA 4NMXA 5L1LA 3EROA 1UA0A 1I4QA 2RA4A 5B66U 4NLOA 1QD1A 1JE5A 3NP8A 1N5VA 4DR4J 3C46A 2ROPA 2WRMA 3UO0A 1RBLA 4I7FA 2JRSA 1BBXC 2HURA 3HT0A 2OYYA 1ZYQA 5JJZA 3CCSA 2KKHA 3Q8DA 2R93H 4B3SL 2RDHA 4N8X1 5E7NA 2HNZA 1SGGA 1H9MA 4OZ0A 4GZYC 3ETRA 3D8GA 2HHWA 1TKXB 4DX5A 2V2VA 5A0YB 4X84A 1RU1A 2JA9A 2Z4HA 1PFNA 1NHKL 4Y2UA 1D1KA 4B3ML 2XY6A 4ANEA 1SJRA 1VQIA 3PKYA 3QO9B 4ED6A 4BBSB 4JI4L 1AEXA 2CVRA 4DV7L 2NYHA 2WVEA 4P7TA 1WC6A 1Y0HA 5CYMA 2ZHAA 2OWOA 3J7YW 1HW9A 3V81B 1FRLA 2M4MA 2LEAA 3H0GH 2HDOA 4OIXA 4RFBA 1ZA2B 4YB1P 1FJCA 4CLFA 5DQGA 5HAOA 1F5AA 4BA2I 1UT5A 4USMA 5ELBA 4GFJA 5GMKa 3T1HJ 4KGXB 1GUSA 3BS9A 3H09A 4KY5A 1T05A 3D4RA 2QARB 1OXTA 1S9EB 1JQYD 1IUJA 3V6DB 2B0CA 2C3MA 2RUSA 3V72A 4HTIA 1N33F 5HR6A 4D3GA 1RAAB 1U45A 2FVQA 3R5JB 2RHFA 3MTKA 3L0OA 3US5A 1WCMH 3HOWG 3LGNA 4B17A 2VDHA 2IVYA 1T3NA 4UDUC 1K8AT 4F3OA 3IR5B 1WOPA 3RB0A 3QWPA 4BXOA 5B08A 3BEGB 4OYIA 3U4ZA 4P2XA 3I76A 2CYYA 3CCQS 3PR5B 3D4WA 3QB3A 1P7DA 1A7GE 4B08A 4PZOA 5F9NA 1I50H 3RR7A 2XI2A 3QUBA 2HHHQ 3CDBA 5F9LA 4YCVA 1HI1A 2EC0A 4C11A 3KDFB 3RLFA 3C23A 1QB5D 2QLBB 4IDKB 5EE1A 4DR6L 2XGPA 3PVXA 3IBCB 2CIMA 5GADC 1ULRA 2E2JH 4G7ZC 4HKQA 3OTOJ 4RQ1A 1M0SA 3JTOA 3NBPA 4CHTB 2C2OB 3BZDB 1MROB 4CKEA 2JXJA 1HYSA 2YKOA 2I8EA 3HP6A 1TWHH 3HOYB 4ES1A 2E7XA 3OWEB 1RZMA 1KW4A 4I2IA 2YX1A 4DHVA 4DBQA 2UUCQ 4N47A 2HVIA 3AB9A 3G96A 2F0TA 4J9RA 8ICXA 3QIPA 5JVHQ 4U68A 2VU5A 3S2HB 2LP4A 1RP5A 1K8MA 1MJCA 5GAHC 4LF9F 4L72B 4K0KL 2KN4A 3DM2A 4YG2A 4AL7A 4LMQD 2WSCC 2V1CC 1YGYA 3OTDA 1G6ZA 3M8QB 5KG0A 3L3FX 1DOMA 2R2TA 4DV4F 2E2DC 2YU9B 1MWQA 4ELUA 2HQLA 1HA6A 2QLFB 1HTLD 4C8YA 2MLZA 4X65F 8ICVA 2FJAB 2YKQA 5KT6A 2CG4A 2YTCA 2HBYB 1N34Q 4RPXA 1RTHB 1TKTB 1WDDA 7ICGA 2J76E 1PK1A 1R27B 2ZJQA 3PG9A 4QMGA 3U27A 1RWMB 2JWNA 4UZCA 3CCES 5GVQA 2LU1A 1BQNB 1HUMA 2WVDA 4KY7A 5BYQA 3U1LA 2RDIA 2JXMB 2A68C 4DK1A 1EJ7L 5JUMA 1RISA 1VQKS 2XSCA 3MWBA 3TYTA 4CKBA 5HMZA 1DJ0A 3OPOA 4RU9A 1WWVA 2PPBC 2AZ1A 4BDPA 1PK3A 5J2DA 4JI5Q 3JTNA 1JNRB 1NZ8A 2DH7A 4U96A 4G9BA 1L3SA 3ILOA 3BDEA 5KNBA 2QL7B 3VYRA 2DK2A 2W4CA 3M1VB 1BNZA 4DS5A 1OSDA 5H1SV 1N36F 1VRQC 4LMZA 4LF5Q 4NLVA 3RUZA 1WTFA 2DRAA 2VXWA 1WC4A 3QT5A 2DY9A 5DETA 3PX0A 4C8LA 2Y1IA 4USTA 3PW5A 2XI9A 2IX0A 2QA4A 3CD0A 1W26A 2DUDA 1MD2D 1TWGB 2FPMA 4P73A 1RT2A 4M8AA 2F8KA 2KCTA 1N5WA 1HBOB 3GZFA 1IYVA 5BPCA 3NWRA 4F7XA 1H9SA 3ICLA 4F87A 5J39A 2WFWA 1B7FA 3F73A 3AMZA 2E2HB 1X65A 4OI2A 1NJWA 1D8BA 3AQPA 4JI0Q 1VQ7A 4M5MA 3TUZC 3L9ZA 1NH7A 2FE9A 3RB6A 8ICQA 4LVSA 1O0PA 1VQNS 3HRZC 3NS5A 2H5XA 4PWUA 3I9V9 3K2YA 1KHVA 1FRXA 3DFEA 3VYUA 3DGPB 5ALYA 4BWMA 4M6WB 3KJNB 3MM8B 3OD2A 2DHHA 2MQQA 2UUTA 4A3MB 1FRMA 5J2MB 1Q4RA 4OV6A 1U4PA 2PFNA 3GTKB 5C44G 1ZS6A 3HF5A 5ETOA 2YKAA 4UHVA 2HOQA 1Q3VA 5CBAE 1HARA 2ZUBA 3OPXA 2RRAA 4RQMA 1UE7A 4I69A 4MK8A 5HK4A 2D2CC 1EOVA 3MM5B 3R2CJ 1GEHA 4HEDA 3LALA 1JK9B 4NLWA 1AZPA 5KFFA 1EOTA 3VR3A 4PWDB 2R7SA 1NDPA 4ENOA 1ZEQX 2KM8B 1GUNA 1ZQLA 2FLOA 1RT5B 1LLRD 5IGBA 1UJ6A 5HL7Q 4RQ4A 4IQMA 2COLA 2XTJP 3LP1B 5T7LB 3HSJA 2RLTA 4KBIA 2JA5B 4UATA 1F6TA 5DM63 4A3LG 3TREA 1EY8A 2JA7B 4KLKA 3M6XA 2AYBA 1HI8A 4N5SA 2MY8A 1X6IA 2CN1A 2I9SA 1JOQA 4ZIWA 5C0XI 1LUZA 3IG5A 2OF1A 4J03A 1JJHA 7AT1B 1WSVA 5C0XJ 1VQ6S 4EO6A 3LDAA 4O3SA 1U4BA 1KFTA 2UUAJ 4F4WA 2CRLA 5I2XA 5ALDA 3TFRA 4JI3L 1Y88A 4FPRA 3S2DB 4JI7L 4UAIA 5AK6A 2MGSA 4TQSA 1EXNA 1RT7A 3KXDA 2DNRA 4I28A 1HQ2A 1MWYA 5D8HB 4GMKA 1T02A 4ED8A 3GTLB 1RQ0A 4DV5L 2PMZE 2FYXA 3K89A 3KLHA 3HHDA 2Z56B 2BM0A 2AUKA 4OCZA 3HKSA 2FC9A 1UWAA 1XSPA 1Y00A 2KEDA 3NGDA 3TI0A 3RB3A 3S2HH 4DR5L 2OP5A 2VQFQ 4CLPA 1DRZA 1SMXA 2KHSA 3MOZA 4QUCA 3QOLA 4DPGA 3RFAA 2FLNA 2UXCL 1TV6A 1KLGD 3WHIA 2W04A 2YU9H 1VQOS 1PZID 1NLKL 4WZMA 1BCPB 1S1UB 4M63A 2W8LA 2JP1A 1S6OA 3VV2B 2DNEA 2X69A 3DXBA 4DLEA 3ONQA 3HZGA 4EQOA 3MPUB 2HBMA 1FJGJ 5C5MA 1JKHA 2FZCB 3N6MA 4ALZA 2W2QP 4PZ7A 5IT9c 2L08A 1JALA 1O08A 2CQ2A 4O42A 3ITHB 1RHUB 2ZHOA 3WKDA 1JXEA 1WC5A 2DNCA 1G91A 1ZPWX 2HI0A 3D0GE 3EVMA 1ZQCA 1RTDA 3G8QA 4A3KG 3QU4A 4BBYA 3I0RB 2JEAI 1B9MA 1U5KA 3PW4A 3M8SA 2B4PA 4AYBG 4DV3L 4UARA 3T1YF 2AQ4A 1B8AA 4R64A 1TK0A 1SC6A 3CIZA 1YZ7A 4J9KA 1JXVA 4OI4A 1APSA 1ITPA 1JLCA 1RHJB 3LWUA 1SAPA 1VQ5S 3PO2B 1B0PA 1HFEL 2R42A 3QGHA 5A2QY 5I6YA 1VF7A 2E2IB 3CCUS 1FRKA 4USHA 3QEBZ 2NVYH 2CJAA 1YBYA 5LMUL 1VDVA 2QO3A 1GHJA 4LUZA 4HDGA 4X66F 1B3QA 5I4MA 4M0AA 1BPZA 1C4AA 4HACB 5G5GA 3VA5A 2DGOA 2R3VA 1R6YA 3LW5C 2LXIA 2WAQF 2N4CA 5M3MG 3IHQB 7ICLA 2PFOA 4OYXA 1TWGH 1DLOA 4I2PA 5DG7A 3GSIA 4N41A 5HJYA 3S15H 2CQBA 1LT6D 2RS8A 2KN7A 2JZBB 1KDBA 2WKDA 3GE9A 4I6AA 3DDIA 5IT9U 3A13A 1SWWA 2JH1A 3DEEA 4Y2PA 3AU2A 3CQZB 2F76X 1KLMA 3V6KA 3QIAA 1LW0B 4P0QB 3CO0P 1YJRA 1F2YA 1WG5A 1U1OA 5HHHA 2DGUA 2AEJA 2MKKA 2QA2A 4IH6A 4KMOB 3MXNB 4Y2RA 3JAME 4XIUA 3BR8A 4CRJA 2HHVA 4ZH4A 2EY2A 5CV7A 4IFDJ 5HP1A 1A3TA 4TLQA 4MYTA 1PH9A 1U6BA 2AU0A 4W98A 2E5LJ 3ENWA 3UR3C 4O23A 4DU9A 2ZM6Q 5BR8F 3R7SB 3GTKH 3DRSB 3I91A 1KTKA 2JGAA 1C4QA 1U6ZA 2I1RA 1QVFR 1WD6A 5IIOA 4QR1A 3QO2A 3GFKB 1TFRA 1KQSA