2AHOB

Structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
264
structure length
259
Chain Sequence
b'MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structural Switch of the gamma Subunit in an Archaeal aIF2alphagamma Heterodimer
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 60
structure length 259
sequence length 264
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00575 S1 S1 RNA binding domain
B PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2ahoB02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ahoB01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 2ahoB03
3CCLA 4AYBE 2VQEQ 3S17H 1WYDA 4TQUS 4AYBG 4YWKA 3RN5A 4JI1L 1H95A 4YCUA 3RLOA 4DNIA 3HOUG 3AFPA 4GLVB 1X3GA 4JI8L 3VDYA 4B3RQ 2ALYB 1VS0A 1VQ6A 2R6GA 2YTVA 2BA1A 2R7DA 4A3IH 3S1NH 4A3CG 2B63G 1PH2A 2D0OA 4BY1G 3GTQH 1VQ7A 4JI5Q 1VQFA 3AEVA 2ZTDA 3CQZH 2B29A 4DV4L 1LTLA 2UUAQ 4LFBL 1VQLA 5LMUQ 2ZJQA 2MO0A 2OCEA 1M90C 1PHJA 3RNUA 1S72A 1E1TA 1A62A 4NPSA 4A3MG 1IBLL 3A0JA 3CAMA 3H15A 2Q2TA 4BA2I 3STBD 1XTDA 2Y0SG 2XGTA 1K8AC 4A3GH 3S14H 2I5LX 2R92G 4OONA 4JI1Q 4IO9A 1M1KC 4BY7H 2UXCL 5IY0A 1YHBA 1BBWA 4X64L 2VQFQ 1RL2A 2K5NA 1UE6A 4OWTB 4YWLA 3CF5A 2OQKA 2CCZA 2JA5G 4LUVA 4GKKL 5IYDG 1FJGL 4P72A 1Y1VG 5FLMH 2RF4A 2A1AA 1SMXA 2F52A 1UE1A 5C0XG 5IP9H 4DV4Q 2PMZE 1YHQA 3CD6A 3KYHC 4GLXA 1GD7A 3J81j 4LFBQ 1E1OA 4A3FG 2PQAB 3CPWA 1XMQL 3PO2G 5GAEC 1AH9A 4GS3A 4O0AA 2D0PA 3F8TA 3UDIA 5AJ3Q 2ZJRA 4B3SQ 1JE5A 5ELNA 1TWCH 4DR3L 1HNWL 4HIKA 2L15A 1N32L 2UXBL 1VQGA 3T1YL 2NZOA 1AE2A 4LF4L 3GTGH 2PI2A 3K7AH 4YY3Q 4A3IG 2UUCQ 4JYAL 3M3YH 1P16A 1QUQA 2EIFA 1B70B 2UXCQ 1BVSA 1I3QH 5GAGC 1PFSA 4NXNL 4H02A 1QZGA 2DGYA 4DPGA 3OTOQ 4WJ3M 1L1OB 1FJGQ 2IHFA 4JI0L 1FGUA 4HIOA 2ID0A 1Q81C 4L5QA 4OWXB 2K14A 2KHJA 5JEAG 3JC66 4L5SA 2WB1E 2VL6A 4LUOA 3K7UC 2CQOA 2NN6G 1W3SA 1EUJA 4BY7G 4DR3Q 1I94Q 3EN2A 4JI7Q 2HT1A 2KCTA 1IZ6A 2QN6B 1KXLA 1VQAA 1YHAA 1N32Q 4R4OA 4POFA 1KQSA 2R7ZH 4DR7Q 1NTGA 2JE6I 2ASBA 2UXBQ 4AH6A 4BBRH 1J6QA 1KRTA 4B3TQ 1VQBA 2LXJA 1O7IA 5FLMG 4LFAQ 1L1OC 4LF4Q 2CWAA 5LMNW 4HIDA 2JA6G 3L0OA 5LMNL 4JYAQ 4A4IA 2JA9A 3CC2A 5IP9G 2GN5A 3S2HH 3TRZA 4JI6L 4JBWA 4NXNQ 4A93H 3A5UA 3WWVA 5C0XJ 3CCMA 4UP7A 3I2ZA 1N36L 2MQHA 4DV6L 4JI0Q 3K0XA 4POGA 4R4QA 3HOXG 2R93G 4IOCA 2Z6KA 2RHSB 3M9BA 4A76A 5H1SE 2VQEL 1XNRL 1U0LA 1CKNA 3PSIA 4GKJQ 1SRUA 1Q86C 1HR0W 3J80c 1OTCA 5GQOA 2VY3A 4FDBA 1PH6A 1X6OA 1JT8A 4DR1Q 1GM5A 2YTXA 2E2IH 1TWHH 3EIVA 3HOYG 3MEFA 2K52A 5GADC 5M5YH 1VQJA 1OXSC 3KDFA 1PV4A 1IBKL 5JJKA 1D7QA 2JA7H 3PIOA 3I4NH 5IT9c 5LMNQ 1Y14B 2E8GA 2QA4A 4QQBX 1B7YB 1XMOL 2WAQE 3OW2A 3W1BA 4JV5L 4JI6Q 5LMUL 5JEAJ 1N36Q 3HOVG 3J7A5 1A8VA 2YV5A 2N8NA 1KD1C 4QL5A 1CUKA 4A75A 1VQKA 4A3EH 1CSQA 1YEZA 1XNRQ 4BBRG 3F1ZA 4JI2Q 4A3FH 3PO2H 1XJVA 4LF5Q 2BH8A 2IX0A 2PNHA 1HR0Q 4J15A 1PYSB 4DAMA 4Y7NH 2VQFL 2NVYH 1P8LA 3E9IA 4A93G 3ERSX 4GN5A 4DKAC 2OTJA 2AHOB 2VUMH 3PUZA 2A8VA 3E0EA 4DR4L 1IBKQ 2VS1A 5EAYA 3GDEA 1YI2A 1K9MC 1YJNA 1XMOQ 4PZ6A 4JV5Q 4IPHA 3H3VI 3BZKA 5M3FH 4LF8Q 2CFMA 3GD7A 2N49A 2HIVA 5AJ3L 1VQPA 4DR6L 3EBEA 4B3SL 1HNZL 3QSYB 2XTIA 5JJLA 4Y52H 3S15H 1GO3E 3CCSA 4DUYL 2E5LL 1OXTA 1RIPA 1JMCA 1SE8A 2K75A 3J81c 2LXKA 2Q2HA 1Z47A 4YY3L 2UUCL 2JA7G 3SGIA 3I4NG 4IJHA 3KFUA 4ALPA 3G48A 2JA8H 2ZM6L 3F2BA 4LNQA 4C3JH 3UDFA 1QVCA 3OTOL 3D0FA 5M3MG 3G6EA 3PUVA 5GAHC 4AQYL 2JEAI 4DR4Q 3T1HQ 2JA6H 1NE3A 1MKHA 3FP9A 3BJUA 3KF6A 4DV2L 1EQQA 5C4JH 4A3EG 4LF8L 1SLJA 4DR5L 3I4MG 2YYZA 5IP7G 3ZJYC 4IOAA 1YIJA 1SN8A 1A0IA 1HJPA 4XIGS 2Q2IA 4DR6Q 4DV3L 1I94L 1HNZQ 4JI7L 3HOXH 3CMEA 4KI0A 3RLFA 1SR3A 2R93H 1EYGA 4DUYQ 4IPDA 2E5LQ 4DR7L 1VQHA 2PQAA 3W5OA 1VQ5A 2VUMG 4B3TL 4LFAL 2UUBL 2GVBA 3DM3A 2NVQH 1X65A 4L5TA 4JG2A 2ZM6Q 3HOYH 2H5XA 3PF5A 3FHWA 1B8AA 5M3FG 4OXPA 5HGQA 4XTCS 3U4VA 5IWAL 2ZJPA 4AQYQ 1X56A 1LYLA 2ZTEA 3I56A 4YHHL 4A3LH 2I0QA 4IFDG 1WFQA 1WOCA 1N8RC 3ULJA 1X54A 4ME3A 1KHIA 2QGQA 3AYHB 4DV2Q 5IYBH 1YITA 2WB1G 2AWOA 4QIWE 1QUQB 4JI4L 4DR5Q 1OXVA 3MXNB 4DV5L 4GOPA 4GKJL 3FKIG 2OTLA 3HOVH 1VQMA 4DV3Q 2JA8G 3S1QH 2IHEA 3CXCA 4DR1L 4B3MQ 3H3VH 1NJIC 1X55A 3PF4A 1BBUA 1YZ6A 1JJCB 3PUWA 2UUBQ 1IYJB 1YVCA 4R4IA 4JOIA 2LSSA 4IFDI 2VZAA 1UEBA 1L0WA 1TWGH 4R4CA 1NMFA 4MZ9A 5IWAQ 4R4TA 3PCOB 4LF9L 2KBNA 4YHHQ 2K5HA 1EFWA 1X9NA 1OXUA 3UE0A 3CPFA 3CCQA 1UE5A 4JI3L 4DUZQ 3RZOH 1JJGA 4JI4Q 2UXDL 1EIFA 4JI2L 4EQ5A 3UDGA 4DV5Q 3GTJH 4YWMA 4LF5L 2E2JH 2QEXA 4MNOA 3RR5A 1HR0L 1PA6A 4GNXA 4JBJA 1Z9FA 1EQRA 3G71A 4LWCA 2E2HH 1OXXK 3JAMi 4R1JA 3LGJA 4DV1L 4HJ8A 4LFCL 1GKHA 1KRSA 2R7ZG 4A3DG 4A3BH 3J7ZC 4KHPQ 2YTYA 5FJ8H 1YJ9A 2HHHL 4A3LG 1CKNB 4DAYB 3PIPA 3GTPH 3S1MH 4BBSG 3CC7A 3S2DH 2WAQG 5IYBG 1PH1A 2IT1A 2AKWB 3U4ZA 1K0RA 5M3MH 4LF9Q 4UY8C 2K4KA 2F3IA 3HFZB 1PH3A 5C44H 4C2MH 1X3EA 3KDFB 3S24A 4PG3A 1SFOH 4JI3Q 2WP8J 4P73A 3HKSA 1Q82C 2UXDQ 1C0AA 3I4MH 4DK3C 1G51A 2KENA 5IP7H 4LF6L 1PYBA 1NBWA 4OO1I 4UP9A 4X62L 4PZ8A 2Z6KC 1CKOA 2B3GA 2IY5B 1XPOA 5C4XG 1PH9A 1V1QA 4GLAC 1MJEA 4BXXH 4UP8A 4DV1Q 1S3OA 4LFCQ 3T1HL 1PH5A 2NZHA 3NEMA 3KF8B 3HKZE 2HHHQ 4LUZA 1A63A 4JBKA 1TWAH 4NXML 5IYCH 1D8LA 3CCVA 5C3EH 1VQ8A 4PMWA 4OX9L 2CKZB 1L2FA 1K73C 1E7ZA 2OQ0A 3IRBA 5GROA 3M4PA 1I50H 1W2BA 1J5EQ 1NMGA 5FLXc 4X6AH 4P75A 1IBML 3ULLA 2NVTH 3M7NA 3HOWH 3RZDH 4A3BG 1JJ2A 3CC4A 2OWOA 4LF6Q 2MNAA 5FJ8G 3TEHB 1XNQL 3PO3H 3CW2C 4X62Q 3FKIH 1KC8C 4IPGA 3UDXA 4C3IH 1IL2A 2D62A 3GTLH 3E9HA 1VQDA 1E3PA 1VQOA 4HJ5A 3I7FA 1KAWA 3CCEA 2ES2A 1HNXL 2Q2UA 1UE7A 1I5FA 2ZTCA 1QVGA 2JK8A 5C44G 3J81i 1K83H 3K8AA 3I55A 4JCVE 4NXMQ 1AE3A 1C9OA 1G291 4GN3B 2N3SA 1Q1EA 3ULPA 1HZBA 3PUXA 3M4QA 3S1RH 2V1CC 3CMAA 3DLLA 2Y0SE 1U5KA 1HZAA 1KL9A 4OX9Q 1Q46A 4B3ML 3A5ZB 4BXXG 1S40A 1ASZA 3S16H 1Q7YC 1IBMQ 5M5WH 3KF6B 1HH2P 4JI8Q 4KLKA 3CCJA 3NENA 1XNQQ 1WCMG 2VNUD 1XPUA 5JJIA 4QJFA 1HZCA 3K80C 3U50C 3TS2A 4APVA 4DK6C 5IYCG 1EIYB 1Q1BA 4P74A 4JC0A 3UE1A 5C3EG 4QGUA 1VQNA 4DR2L 4A3DH 2BA0A 1YJWA 1HNXQ 3GTKH 4K0KL 1UWVA 1VQ9A 3M85A 4X66L 1N9WA 4DUZL 2AMCB 1IBLQ 2KCMA 1Y1WH 4AIMA 2EXDA 2UU9L 4DV0L 4BBSH 5K36G 1L1OA 4HJ9A 3HOWG 5J3BA 5M5XH 4DV7L 1XPRA 3W1GA 1TXYA 3KJPA 3RN2A 1V43A 1ASYA 3PO3G 2F4VL 4X65L 4PZ7A 4QY7A 2N78A 1LM0A 3GTOH 3BZCA 1DGSA 1VQIA 4UPAA 2FXQA 3A74A 4X64Q 1N34L 4O2DA 1R9TH 4HIMA 5C0XI 4GKKQ 4KHPL 2GVAA 1YZ7A 1V9PA 4A3KH 1EWIA 3H0GH 1MJCA 4GOPB 3KLWA 5C4XH 1FVIA 1QVFA 1EOVA 1FL0A 2EQSA 2MO1A 3GO5A 4DR2Q 3BU2A 4OWWB 1HZ9A 2RHQB 1QZHA 3OYYA 3TQYA 4K0KQ 1N33L 3L2PA 1XMQQ 3ICEA 4A3GG 4A3JH 4X66Q 2K5VA 4KHZA 1YNXA 4L5RC 3RLNA 2BH2A 2I5MX 2UU9Q 3M4OH 3HOZH 4DV0Q 1Q12A 4NB3A 1HNWQ 3AFQA 4BA1I 1CSPA 2DUDA 4DV7Q 1YBYA 1BKBA 1T9HA 3T1YQ 2R7FA 3PUYA 3CCRA 2HIXA 4IJLA 2I5HA 4LF7L 2F4VQ 4X65Q 1I6HH 4HJ7A 3D31A 4GOPC 4JBMA 1Q8KA 3PGZA 1VQCA 2JJQA 2KHIA 1JB7A 3HOUH 5DLQE 1VCIA 5ELOA 3CCUA 2JQOA 4OO1G 1IXRA 3B6YA 1PH8A 1N34Q 2NVXH 3K81C 1PVOA 3STBC 1LUZA 3TREA 1PH7A 4C3HH 1X3FA 3L7ZC 1KIXA 1VQ4A 1WJJA 1CKMA 5BR8L 3JAMc 1Y1WG 4A3CH 2JEBI 2B63H 1VQEA 3U58A 2NN6I 3KOJA 4YCWA 3J80i 4GNXB 3NBHB 1SROA 4BY1H 3GTMH 1GVPA 3AQQA 3I4OA 1K3RA 4IFDJ 4TVAB 1N33Q 2WFWA 4JOIC 5HY6A 1E22A 2HQLA 4MTNA 5E7NA 1J5EL 4A3MH 2QMUB 2C35B 4IPCA 2ATWA 4YCVA 4LW1A 1C7YA 3CP0A 3ER0A 4B3RL 3Q8DA 4P71A 4A3KG 5IE8A 3F2DA 4WJ4A 1G6PA 1MIUA 3H0GG 4LF7Q 2VW9A 2R92H 4HJAA 2AWNA 4RMFA 1TWFH 2RCNA 4JI5L 4EX5A 3PV0A 2UUAL 2JA5H 2CWPA 4GNXC 1E24A 3F2CA 2PI2E 3KJOA 1PH4A 4A3JG 5IYDH 2A19A 1WCMH 3HKZG 5BR8Q 4DV6Q 1Y1VH 2IX1A 1WI5A 2MFIA 2Z0SA 3HOZG 4GN4B 3TS0A 3G4SA 1K8GA 1NY4A 2YU9H 2K50A 4RG1A 3NELA
chains in the Genus database with same CATH superfamily
3S17H 2BANB 3RZDB 4RAUC 2ZIXB 2RH3A 4FNIA 3PR4A 3VDYA 5ALXA 4ZVSB 4IQTA 4OO1J 1VQ6A 3S1NH 2FTRA 3DM2B 2B43A 2MO0A 3M4XA 3Q24A 3RNUA 2ACMA 3TA2A 3DRSB 1QVFR 3AM9A 2Y1RI 1F9RA 3KLGA 3H15A 4DG1A 1KRPA 1NBEB 2MY7A 2XGTA 3MURP 1U1MA 2I5LX 3NVVA 1OY9A 3T5JA 1UPMB 4OWTB 1UE6A 2CCZA 3PIPQ 4HDGA 4JUZA 1UZHA 4PMBA 1IKXA 3ISNC 1QTMA 4I2HA 3KYHC 3LA0A 3D8GA 4K5SA 2BPCA 3JQJA 3AD7C 3C2MA 2MSNA 3T1YL 2F4FA 2QLBB 4PXEA 3S9WA 1DGJA 1FJCA 2W9MA 3SQGB 9ICQA 1IKVB 2RMLA 2IA6A 1ACMB 3LQVA 1Q81C 4L5QA 3C6TB 2K14A 3RZOB 5JEAG 1VRUB 1RTHA 1VHFA 3RMHA 4Y2PA 2MLYA 4A47A 1JOQA 3K1RB 4PG6A 2F8MA 1I6HB 2MHVA 4O5KA 3WX4A 2E2HB 2DHHA 1O7IA 5J2HA 3ET6B 1L1OC 2OEMA 2JLGA 2ZJQQ 3S1MB 4I28A 2YY3A 3JPNA 3D6FB 4LMZA 1IQZA 2VASA 2LHTA 1DZ1A 3GFHA 4H7BA 1PTOF 4Z2XA 1IWAA 1CS4B 4BWJA 1I4XA 5KRUA 3L7UA 3WKAA 3OTQA 4G6VB 4Y2UA 5D4BA 4URGA 1VQJA 1ZQLA 5B0CA 1R4PB 1WTVA 3IXQA 1S6QB 4DV2J 4Y2VA 1GXUA 3VYUA 4DR5J 4DL3A 5A8RA 1SNMA 2YU9B 5ALDA 2QE5A 1QDUB 1IM4A 3GILA 5EUHA 4CH0S 1IR0A 4G1PA 3OW7A 2JX2A 2BPFA 4IQWA 1NPRA 1GNKA 1S6PB 2DGTA 2R2UA 3E6ZX 4A48A 3VZIA 4DKAC 2A3VA 3PUZA 2XM3A 2KL8A 4F0HA 1STYA 1K0VA 1YI2A 3F5EA 1RD9D 4J90A 1A3TA 3MUTP 2CAJA 4RUHA 1ULRA 4C6AA 2WINB 1WC5A 3RU0A 3MWBA 2EFNA 2RRBA 2JA7G 2QV6A 3D4RA 2QL5B 1NRKA 3VGUA 2QTWA 2XMWA 3CCRS 1D1UA 2KKPA 3UDFA 4BS9A 4L3NA 5E7OB 4ULLA 4LK1C 2XWBB 1GMWD 2HVDA 3CCMS 3S8SA 3KF6A 3PW0A 3QIAA 1R0CB 5J2NA 3J7A1 2PFNA 1EYGA 4F26A 2Q8IB 1XNQF 1RT4B 2SDFA 3DEOA 2DH8A 5HURA 2DNMA 4F5OA 4LFBF 1B8AA 1XR7A 3T53B 2ZJPA 4P0QA 5AKHA 1ITPA 1KS2A 5IYBH 3OMGA 2JHEA 1EZZB 1DTQB 2WB1F 4X62J 2DVIA 3D2SA 2MKHA 5F8HA 2BCQA 2CQ0A 1ZETA 1FNXH 4DL5A 3UDLA 4ZCKA 3HOUB 3RB6A 2LKZA 4FDFA 3NCRA 3GTYX 1U1PA 2G2ZA 4YXJA 1TUVA 2V4RA 5IT9L 4R4CA 5IM0B 3PYFA 4MZ9A 4KKOA 4R4TA 1YJNS 4QUFA 1UEUA 4LBHA 2X7IA 2ZE2B 4JI4Q 5FKAC 3LP2A 2O5JC 3CJ2A 1I4GA 2HVEA 1WKLA 5KT6A 4KR0B 4UAYA 4LWCA 5DG7A 5ALWA 4DV1L 4HJ8A 1YX2A 3GFKB 3J7ZC 1DTTB 2D1CA 1TL7A 3JAMY 3U4ZA 2YKNB 1JWUD 3NTIA 1SQEA 5K8OA 3S17B 3HSDA 3IFEA 5EQ0A 3HKSA 4F4AA 4OO1I 3FK4A 5IGCA 3S1NB 1MN8A 4DQQA 4GLAC 1WOPA 1D9DA 3OPKA 1M5OC 2YKMA 4ZRZA 4HTIA 2L55A 3KF8B 1HMVA 1CK1A 4DV0J 1ZQEA 3CDEA 5D3GB 2CKZB 4GXKA 4DPYA 4WWSA 2RQ4A 1P27B 5KFGA 2OTLS 4OJ1A 3WDOA 2RD5C 4ED8A 3CC4A 2MXYA 5J2PA 2C3MA 1KC8C 1RZTA 4EUVA 2FJWA 2OHFA 1I5FA 3RAXA 1DOKA 1MGSA 4WJWA 5GMEA 2XSJB 2ZXOA 4IKAA 3VAGA 3R1LA 3N01A 4OX9Q 5ALJA 3FQLA 4A46A 3M8PB 3MM7B 1A3UA 3A5ZB 2NVQB 2OKQA 1SC6A 4OYWA 2MU2A 4LJXA 4PEOA 1WCMG 2EFPA 2D9UA 1UEKA 5JJIA 1UCNA 3DV9A 4NM1A 4P74A 1N0UA 1PTOC 1B1ZA 4DPXA 2VL1A 1UWVA 3UVJB 2KOLA 2ZH4A 2AMCB 3DLJA 4DUYF 1RT6A 4B3RJ 1A9NB 2BOSA 5IC4B 1EY9A 3W1GA 3Q0AA 4FXKC 2LYAA 5L9NA 4F93B 1UWBA 3AH6A 1HFGA 4HIMA 1UWAA 5C2CA 3OIQA 4IFVA 4FYVB 4LF8F 2GVDB 3Q8KA 2EOTA 2ZXIA 3PDNA 2CUYA 2RHQB 3D6CA 2CQPA 3QB3A 4PL2A 4QUCA 1TUGB 4KLGA 2JVOA 2FJAB 4M8AA 3AFQA 2F63A 1CSPA 4RJVA 3K1ZA 4H4MB 4LF7L 3RAMA 1RWMB 5KL1B 9ICKA 1LTAD 1VCIA 1N34Q 2NVXH 4Y65A 3FPUB 2R7QA 1OQ3A 3MDAA 2KSOB 5K4LA 1CKMA 1KQKA 1Y1WG 3QATA 3G6VA 1RODA 1K3RA 5ALLA 2A69D 4CF3A 2B5JB 3I4MB 1IBCB 2VBXA 1Y11A 3CUNA 1NSNS 1RHMB 2QMUB 2RJZA 3P96A 5FLXL 2Y8YA 2UUWA 3GJTB 4QW9A 3H8MA 3JQKA 4D3GA 2CXEA 4IQMA 3DRRB 2YQ0A 2UUAL 1B3TA 5IT9Y 2R61A 2M0NA 2A19A 1YJUA 1SH3A 1FRHA 1QJHA 3B6BA 1Y1VH 1YRTA 4WK3A 3J7Z5 3BS5B 2OPQA 1NY4A 3TOQA 2J7KA 3JSMB 1SNCA 4LF4J 1PVPA 4YCUA 3AU2A 8ICYA 3IM1A 4PMCA 4NXNJ 2LYVA 3KK2B 4PPZA 2HHHF 3H90A 1ZAWA 5DDYA 3GONA 2QRRA 3ILLA 2CJKA 7ICGA 2NXNA 1SE3A 1LWEA 2WB1C 1H7XA 3W66A 3C1EA 5CB1A 2XNAC 4YXMA 1X5SA 2X69A 3STBD 3I32A 4FZLA 4TU9A 1EAYC 4IO9A 4WXOA 5AIAA 5EWFA 4NYOA 2NXEA 4YWLA 4P2SA 1SJED 1WDDA 3ND9A 1FKOA 3IP0A 3W2VA 3BN7A 2A1JA 3HSZA 2F52A 4BCAA 1RK8A 4USIA 3DN9A 4RL1A 2MQQA 3W9IA 2ZOMA 2LMCB 4ZN3A 4NLUA 2UXBL 3KLSA 2DNRA 3OL7A 2IMWP 2UUCQ 1XMOJ 1TS3A 1PFMA 3HX9A 4I2EA 4EMDA 2WKCA 1T9XA 2F8LA 5J22A 4QZVB 3H98A 3DU5A 3IWLA 1NOMA 2OXOA 2WB1E 3V81A 3RBDA 5DNFA 5M2RA 3NP8A 2QN6B 2FC9A 4HN7A 4X3UA 1KLUD 1N6QB 5JMNA 1W2IA 3IBWA 9ICXA 1ET6A 1S0MA 5LMNL 1RHPA 1HWJA 1PIEA 1TKTB 3TDQA 1RXWA 4BY1B 3EVOA 4CYUA 1VQOS 2BJ8A 1HPZA 1B0VA 4JI0Q 3K0XA 1X9WA 2P2CB 2Z9HA 4UB4A 2R93G 1A77A 3OTEA 3X1LB 1OYEA 2C2MB 4P0PA 5FO7B 4PXDA 4P2FA 2CVRA 5GQOA 2CJ9A 3MABA 4RBTA 1PRTB 1BGXT 2WOMB 5FO8B 3EIVA 2B2WC 4KHPF 3SCLE 5EWGA 1HUNA 4QQBX 2L0CA 1B2TA 1O5JA 2N7YA 2K4PA 1WD0A 1Y3KA 5ALVA 5AK3A 1N36Q 3L95X 4JI3F 2KG0A 5T41A 4DCCA 2QB0B 1ZD4A 4QL5A 4ZLJA 1V8QA 3SMZA 4TY9A 3KHLA 4JV2A 2HUGA 1SE4A 1QSYA 3UD5A 3U02A 4KMOB 3TN2A 3DOLA 3E9IA 1U8SA 3H0RB 5ALYA 3D3RA 2KH9A 3CB4A 2V68A 3FBFA 5EBCA 1IJFB 3BGFA 1HBNA 3KNGA 3O6QA 1UL3A 1U24A 2MKIA 4B3SL 1HLWA 5ETLA 2XYGB 1NKBA 3WKDA 4K4XA 1AZQA 5FLXY 3GV6A 4OJ5A 4KX3A 2EG2A 1RUSA 4NCGA 2D9OA 1NK7A 3KLGB 4DG1B 4AQYL 3CC2S 4DR4Q 3A55A 2K28A 5IOCA 4F91B 3BYTB 2PXIA 4JWMA 2KECA 3QJYA 1EQQA 2LKYA 3EGVA 3TJ9A 4FN5A 2HHPA 3TACB 2P6SA 2KVMA 2IM2A 2J4XA 1IKXB 4JI8F 4IPDA 7ICPA 4B3TL 4LFAL 5DDRC 3R9KA 3FNNA 1ICWA 2ZM6Q 3ZZ0A 4I0WA 4IR1A 2FDNA 3CJKB 5H9FJ 2W1BA 1ZQOA 3I56A 2VV5A 1XX8A 1TR5A 4MHVA 1WOCA 3R3TA 2L12A 1L7PA 4RWWA 2EJMA 3X3MA 1CZGA 1OXVA 2UP1A 2EBGA 7ICMA 2OXPA 1VQMA 4RQ3A 3HOVH 3OMCA 2YH1A 4X64F 3V4MA 4PZVA 2CZ4A 3M8ZA 1Q5YA 4K8RA 1V9OA 4OIKA 1RTHB 4NXMJ 1EY0A 1NNLA 4K0KF 2JLEA 1V6HA 3QU9A 3H20A 3D67A 2XMTA 5ELFA 1U02A 3BS9A 2F76X 4QIVA 4CDCC 1RHUB 3H5UA 3GTJH 4Q8FA 1EFID 4XQNA 3B0XA 2Y0SB 4XDDA 4EK2A 4JBJA 5AXNA 4XYOA 3KUHA 5ALMA 4BWMA 5KFNA 2Y9HA 2DKXA 1GKHA 1KRSA 3SI8A 2V63A 4DZ6A 3D6JA 1YJ9A 3M6UA 4FYYB 1MN9A 2DO4A 1Y1VB 4I2PA 2WAQF 4RO0A 3KUPA 3QOLA 3I96A 5C44H 1JK9B 4EQNA 2ZUCA 4A8EA 4TNOA 5IP7H 3MZIA 5A8RB 4PZ8A 3QZ7A 5J2FA 2CVIA 2A6ED 2OSQA 3AQEA 1BY9A 4NE9C 1WUUA 2GQ2A 3PHEA 2ZWPA 3IN5A 3HHLD 3JYTA 5ETPA 1TWAH 3J7AF 1HD0A 1B43A 4ZDNA 4NLBA 2HNDA 2K4HA 2LFVA 5CD4A 4C8YA 4LF6Q 1TAQA 4I2BA 2F3WA 3T3FA 1IL2A 3C3LA 3C46A 1C20A 5CYQA 4HJ5A 1KFTA 2K33A 3UQSA 4K2XA 1K83H 2PQEA 4NPOA 3MHBA 3HOXB 3H8SA 4CLLA 2ZKUA 2K8BB 2R7XA 1U5KA 1C1BA 3CCTA 1FKPA 2VFRA 2BKOA 2LEPA 1S40A 1SB3C 1TKDA 1IBMQ 4KE5A 3KF6B 5C2GA 2V8GA 1UQVA 3QFHA 1RU1A 1DZ5A 2FYXA 3ORYA 1DK2A 3TS2A 4APVA 1X4GA 5J2NB 3CU7A 4X2BA 9ICJA 4A3DH 3FDTA 4DF7A 2F40A 2RCFA 1IBLQ 4NL9C 4BBSH 4UBCA 3OVSA 2XNRA 4DPWA 2ZZMA 1HUMA 2V8PA 3RN2A 4X65L 5KOWA 4NJ8A 3BZCA 1HWKA 2HIQA 1VQIA 4P0QB 3GJSB 2VKZG 4XQJA 5BOLA 1BQXA 2GAGC 1KEKA 4CCHA 5EJWA 5BN3A 4ZJQA 8AT1B 4ZLTF 1ZD5A 4P6QA 2VHGA 2YVSA 1ZM9A 4F71A 1RXVA 4ANCA 3Q8UA 2Y9TA 5ELEA 2MZRA 2IRUA 3PRBA 4Y2XA 3ZXWA 3MCNA 3HOZH 3MXHP 2HBYB 2XY6A 4FYWB 3NGUA 4BA1I 4MH8A 2M3DA 4Y2RA 2KIWA 4H4KC 2Y3YA 1MQ3A 1JB7A 4ZK9B 3GU3A 3BEGB 4KB7A 1PH7A 1G91A 3LP2B 1IBLJ 3AMZA 2O5IC 2FPKA 2B2TA 3HLUA 2DISA 1SV0C 4GKJF 1FWKA 3PSPA 3CMAS 2A6OA 1DY3A 5RUBA 3J7YI 3KBGA 1TL7B 3SAGA 1G6PA 2JH1A 2OD6A 3KZIU 2FHKA 2WONA 1IG6A 3SK8A 2NTSA 2VPYB 1PLFA 1ZYRD 3ZO7A 1I94J 2HHQA 2A74C 3CRKC 4I7ZC 2K50A 1NDLA 3C15A 4LF5F 1Y00A 1SJ4P 4AYBE 2YKMB 4TQUS 3DI6A 2O6KA 3C2LA 1IVZA 1TL5A 3RLOA 4DNIA 1JQGA 2C22A 1HMVB 2K4EA 1AA1B 2ALYB 2G4BA 1ML0D 2B4PA 5AXMA 2BA1A 4R8UA 2ZXPA 4A3CG 2ZJ8A 3O13A 2FMQA 3ZDBA 4DV4L 1VLOA 4X4UA 4CDGA 1PZKD 1VQLA 2ZJQA 5IQ6A 5A2QY 2R3VA 5J2PB 1OIAA 1RU2A 3CO0P 5JEAH 4UOCA 4KC5A 2J76E 4CH7A 3VQSA 3JXOA 1K73T 1PAEX 1BBWA 1CHQD 4NLQA 1FCAA 2QLFB 4LUVA 1STHA 2ZZNA 3MZ5A 1YHQA 2WBRA 2BCUA 1GD7A 2FGOA 1CM9A 4RPXA 1G6ZA 2MRLA 5AJ3Q 3AMUA 3UI3A 3DDNA 1FT8A 1RZMA 3IR5B 2J9EA 5CABA 2VA8A 3K7AH 1KVIA 4JYAL 1FIQA 1S1XA 4XYQA 2D3ZA 5CCLA 2M8HA 8ICLA 1RT6B 5AK5A 3KLRA 2WAQC 1V5IB 2WTFA 2MZTA 5JUMA 1PXUA 3MPYA 1UWBB 3MPDA 5K5PA 1DOQA 1EIGA 2DPJA 4OELB 2GMJA 2AEMA 3GTJB 4DN9A 2GJFA 3CCLS 4IFVB 3BM7A 3GCXP 5B0AA 4ECXA 2RIJA 1FJ7A 2WVFA 1KRTA 3I76A 1MI2A 2KT3A 2FDRA 3ZTPA 1YBAA 2LCWA 3A13A 2D8CA 1LK5A 1BQQT 4DN4M 2Z2MA 1BWEA 2VONA 4FS1A 1PK3A 5C44B 2E5LJ 5L1KA 1U0SA 1XJWB 4F0MA 5ALTA 2NSBA 4NLCA 4C4RA 3K7RA 3O2IA 4N8NA 2DGSA 4XPEA 3EDRB 3GP9A 4C1NI 3RW7A 1ZQVA 1TY2A 4YVZA 3VAJA 3OD2A 1D7QA 2JA7H 5CORA 2WAQE 3MECA 4B17A 1RQNA 4ZQ3A 5LMUL 1A0OB 3D1OA 4NEYA 1QCBD 4RQ6A 3PYGA 1RTJA 3S7RA 1N60A 4NMLA 3PO2H 4KH0B 2H3VA 1FESA 3W63A 1ZQPA 1YWXA 4LFCF 2OPQB 5HMZA 2AHOB 2BCVA 1S6UA 4YHHJ 3G8TA 2DHXA 4QJVA 3UR3C 2KD1A 1GUOA 2KG1A 1NJWA 1PJ7A 3KJVA 1XR6A 3DRPA 2ZUBA 2A5HA 2BJ9A 2KM8C 1S99A 1Y5NB 3M8WA 5HMLA 4X4QA 1OXTA 3KKAC 1U1LA 2FUG9 1S5DD 1LWEB 3K5NA 2AQ4A 4JI5F 4MIAA 5ETMA 1D5ZC 3C1ZA 3QUCA 3NEKA 2K6AA 2PDAA 1XO1A 5AM1A 1NE3A 4ZP7A 2FJBB 4USWA 1ZQSA 3IS9A 2VDHA 5CD4H 2DIUA 3R9LA 1UP1A 2I5JA 3ENQA 1GQEA 4DX7A 4JI7L 7ICOA 1YJ7A 1FKOB 3W2VB 2A1JB 5T7LA 4RW4A 4YUDA 3W5OA 5GADI 2OELA 2P35A 1NAQA 2ZOFA 1K0TA 2VUGA 2EXZA 3V2TA 5J0YA 9ICWA 4CM0A 2IJNA 2XCAA 3VR4A 4P2XA 1JQYD 4IQZA 1LLRD 1ICEB 4EQOA 4ECTA 3I73A 4DFAA 4ILWA 2IW3A 5C24A 1IV8A 1WHWA 3HOZB 1U1RA 3K5MA 3DC2A 3FMWA 2J7WA 1V3RA 1ROFA 4DR1L 2V94A 2H65B 5HHHA 2F0GA 2XYPB 4KRWA 2JWNA 1OUQA 5E5NA 4F5PA 4NRTA 3V81B 4R4IA 2CQBA 1BCPB 1MN7A 4O4RA 1PO6A 2DRAA 2W8LA 1M5HA 3M6XA 5B0DA 3RRHA 2HDMA 1YDLA 1Q81T 4J9RA 4G65A 1G3OA 1WTOA 4CYUB 2N1RA 2DBYA 1HPZB 3TVZA 3NBHA 2KZ3A 3I4NB 1HTPA 5AXLA 4PGQA 2AX1A 3KK1A 4XQQA 1ZQNA 1SWWA 3BZDB 4P0PB 3G6ES 1JNZB 3S6EA 4KLOA 3U1MA 4HSPA 3ILIA 3R2DJ 1K0RA 2HBLA 1HI1A 1Y88A 4UY8C 1W25A 3L9AX 2I1QA 2QJ3A 4IG3A 4DOZA 2DITA 5IIIA 2J6SA 1TL3A 2XI3A 1FWPA 2EY1A 3IRXA 1SDFA 5ALPA 1X3QA 5C4XG 1XPOA 4RQ4A 1G6BA 1MJEA 3D4DA 1JR0D 5CXTA 2OJ3A 1XMQJ 1FD8A 1X3PA 4EGLA 2G09A 4GRSA 1B44D 4L74A 2VQEF 5SUHA 2YPZA 3DOLB 3A8JE 4PMWA 3QOJA 5G4DA 3IFDA 1I51B 1Z2LA 2GNKA 1FK9A 3EDQB 1IW7D 1N5QA 1JCKB 2FLNA 1HBNB 2LP4A 1IBKF 2EANA 2YB4A 2D62A 4O44A 1E3PA 4ID8A 2KCNA 1QAYA 2Z4PA 1M1GA 3BDCA 3J81i 2Y1JA 1F2ZA 2HFNA 4IUVA 4NCGB 4KMUA 2XMAA 3LYSA 2IWHA 2HCCA 5CC4A 3FSIA 1XNQQ 3RJFA 2VB6A 3HSGA 3ZFVA 4QJFA 3NBPA 3POTA 4B9NA 4EFAC 3R2TA 4DR6F 2HCIA 3L9ZA 2F77X 4FYXB 2XGQA 5D65A 1Y1WH 2OPPA 3SDZA 3AY0A 4DV7L 1Y8NB 4PZ7A 1Q53A 2NB0A 2F9DA 4OI2A 3OTOF 5AI0A 2CJBA 4RA8A 4WZMA 1E2VA 1WI8A 4UB8U 1H9KA 1FVIA 3GO5A 3BU2A 3DNCA 3WC2A 4KGKA 8ATCB 3ICEA 3FCVA 4K8IA 1A0PA 4DR7F 3KDOA 1BKBA 3PUYA 4FO2A 5J2BA 3GYNA 2E1FA 2JA7B 4GOPC 3MMBA 4WFZA 1Q8KA 4LFBJ 1VLYA 1IXRA 3AB4B 3LWMA 1P6TA 1RAHB 1I6VC 2RQCA 4RH6A 2VFVA 3BGLA 1YJRA 4F67A 2M00A 3KHHA 1TFRA 4Z7CA 5GMDA 5B0BA 2BQUA 3N5BA 4YY3J 4MTNA 3EGZA 2XB2D 3MR7A 4QR0A 4UW2A 4F7VA 4I2PB 4QYRA 2DY8A 4CDEC 4KPYA 3OFGA 1X9MA 2V6AA 4OYAA 5KT7A 4ZOHC 2PW7A 3MVVA 3I1YA 5BR8Q 3K6OA 1IQTA 2DGXA 3HKZF 3J7ZT 3OR2A 4YDDB 3UDVA 3UN3A 5E2QA 2RILA 2R7ZG 1X42A 1PYTA 4UY85 1GUSA 2YMMA 3L7OA 3JYTB 4OFZA 1CI3M 3EYZA 3BREA 2KKHA 2QL7B 5GAGU 4FF1A 2KEYA 2H1EA 3BO3A 2HNDB 1CQFA 1M90C 1O7ZA 4A8KA 3G6JB 3QWUA 2KV2A 1D9FA 3GJQB 3R7NB 3TA1A 3UDEA 2ZBQA 5CYQB 4A3GH 3ETRA 1SJQA 2K7VA 3DOMA 1PDQA 4KHMA 3MC0B 2UXCL 3TA0A 3RZAA 3IRUA 1I4QA 4J9SA 4GKKL 2FZCB 2JDJA 1FJGL 3MWYW 4QR1A 1C1BB 1VC6A 3H8JA 2A68C 1KC8T 1FKPB 5CJ7A 2PQAB 3NASA 5KFRA 3UE2A 2HK3A 1HR0J 2D0PA 3F8TA 1N48A 4HIKA 1C48A 1B9MA 3GTGH 2QYCA 3PM9A 4A3IG 4QZIA 1MWYA 1EJ7L 3K0JA 1VF7A 3TP7A 2E1CA 2HFZA 2R7VA 2ZXRA 4DU7A 3G8QA 3TKAA 3NSWA 4MTPA 2EFOA 4AE5A 1A6SA 1OO0B 4ILMA 2BCOA 1U6BA 2CQOA 2BZFA 3ENVA 3WK7A 3AOCA 3TP2A 1VQAA 1PILA 1N32Q 1NTGA 1AT1B 3T1HJ 1VQBA 5LMNW 1E6YA 2U1AA 3MPVA 2DNCA 4JBWA 3P5BP 4QZ8A 3CYMA 4OQJA 2HURA 1OW5A 4DV6L 3IA0A 1NZPA 4NLXA 3QMQA 4DUYJ 4I29A 1RKNA 3NQTA 4Y0FA 1IL8A 1CKNA 1Y3JA 3EPIA 1KAAA 1OTCA 3AOBA 3M8YA 2NQPA 1GH8A 3CF5Q 4M6WA 3GCWP 1CA5A 4MK9A 5AIBA 4Y28C 3GU0A 1WCMB 4LF8J 1VMPA 2QLXA 1F0XA 3IHQB 2FINB 4K4GA 1N33F 3KWMA 1H9RA 3D0GE 2E3TA 5MLCV 3JTOA 4NLOA 4DNTB 2HIYA 3CD6S 2JRSA 1CSQA 3VR3A 1RQLA 2WONB 1RDRA 2P6UA 1JLFA 1B4SA 3VGVA 4C8MA 2NVYH 3VGSA 3I9ZA 4CDDC 3C15B 4TYAA 2EVZA 5EAYA 1EY8A 4DU9A 3DI6B 1Y4ZB 3AA8A 1K9MC 4TN2A 5AM3A 3V7KA 1SBRA 4IPHA 2E8MA 2EDGA 3C16A 1RM6C 4PZOA 2XZDB 3RUBL 3TZZA 1KFDA 2V8HA 1J5EF 3A8IE 1GXDC 1N4LA 3VV2B 2FJEB 4RU2A 4R8UB 4ZVFA 1PYWD 4WFNQ 2MLZA 4IJHA 4YG2A 3UCGA 1WC1A 4U7UD 3F2BA 3MGIA 4Z9CB 4WU3A 5BXIA 3HHNB 3MA2B 2WRMA 2WF6A 2R9LA 2N4DA 1A6LA 1WKJA 1F9QA 5ETOA 5J0QA 4DV2L 5DM63 1Y1WB 4DR5L 2EY5A 5KFAA 2J8AA 5EKLA 3O0FA 3M7DA 4HKQA 2R8IA 3AAWB 4XAKA 4RZRA 2RSQA 3F44A 1DURA 2HHHJ 3DUZA 2HQIA 4L5TA 2Z56B 3WOFA 5A35A 4PHPA 3HOYH 1E0BA 1NHKL 3HHKA 5M3FG 2RB7A 3B82A 5HGQA 1S12A 4C56C 4NRUA 2KZZA 3BDLA 3MM5A 2EZZA 4FS2A 1T0TV 2ZBCA 2AZ1A 2J5AA 1JC7A 4LSLA 3K5LA 1S1XB 1S5BD 2WB1G 3AU6A 5EBDA 2CHBD 1WEYA 4M94A 3SQOP 2CPFA 2JA8G 2NRTA 1UFKA 2ZD1A 4ECYA 1S9GA 3H3VH 4F25A 4HAIA 4I2QA 4M9JA 1EY6A 3IL8A 1JJCB 4I7AA 3GYGA 4WK1A 1K1QA 1IYJB 1F5BA 5HQMA 3K2YA 3PEJA 1DFDA 3HKZC 1TWGH 1SGGA 1W6KA 1EETA 3VA5A 4AXJA 2K5HA 2R4FA 3CPFA 1A3VA 2SXLA 4Y2TA 2EW9A 3D4JA 1I4RA 2CKWA 4LJMA 4F88A 4DCOB 1CJTA 2KNJA 4KHPQ 3EVMA 3MFYA 2ODGA 1NK9A 5E79U 2F3JA 4UOHA 1SXDA 2MDAA 2NO5A 2AKWB 4CHTB 1UTAA 3EZOA 1WF2A 2F8HA 2XHCA 1SJRA 4QIFA 2J9DE 1XSNA 3BBBA 1XR5A 4QMGA 4JI3Q 2PFPA 3WK8A 1LT4D 1PZID 1QE1B 2QIFA 1RQ0A 3MECB 1EWHA 2KENA 3O3LA 3CMES 4M0AA 4TY8A 9ICSA 4X62L 3LH2S 5I6YA 1MSWD 2IY5B 3L4PA 1RTJB 4X66J 1YG0A 3HKZE 1ZM2A 1ZQGA 1YGYA 3N4MB 3T1YJ 1CJKA 2F0KA 2F4VJ 5GAEU 1AW0A 1L2FA 3FRYA 4N8X1 4OMFG 2K89A 1WSRA 1I50H 2CH4A 4IOAQ 3EXCX 4K50A 4A3BG 2OWOA 2QDBA 1T9WA 3KJVB 2DJGC 3DRPB 4JV5F 1YRXA 3QT8A 1RADB 4MKYA 2ES2A 3RJKA 5KG1A 3K8AA 2MQOA 2L41A 3EWAA 2R93B 1ZTTA 4TKOB 3GTGB 5G3LD 3THVA 5M5WH 3TANA 4JI8Q 3QE9Y 2B7CB 3IS9B 2FVRA 3G71S 1X4HA 1XPUA 3QYYA 5BN4A 2I5JB 5IYCG 4IUNA 3UPQA 5B5EU 2R3ZA 2X6LA 5T7LB 3GTKH 4RW4B 2C2DA 2G9DA 3M85A 3D1HA 2QZ8A 1T11A 4US9A 3TQ1A 4DV0L 3VZHA 3R3OA 4AT1B 1L1OA 4HJ9A 2APOA 2R7OA 4OHXA 3H4BA 4HH1A 4ZP9A 1PBAA 1MWQA 2VBYA 5JU5A 2LFNA 4X64Q 5C24B 1IWGA 4QQBA 2Z7JA 1QSSA 3NGSA 4C8LA 2KJ8A 3VYSA 3H25A 2R8KA 1QVFA 4LBPA 4RGMA 2EVBA 2E74C 2AQ0A 3M6VA 1TY0A 4K0KQ 5KTQA 4JW0A 3L2PA 3CNQP 2VOPA 2HHSA 1ZOLA 4RQ1A 4L5RC 4KLQA 4UDUC 4QR2A 4C4WA 3LVWA 4IURA 2NYIA 2JH7A 3OTBA 3MR5A 9ICTA 2JJQA 4QZBA 3QX7A 2JZ5A 1WJJA 4A3CH 2RP5A 5L37A 1X9XA 1WTRA 4JPBW 4DUTA 3NBHB 1TR0A 2I9SA 2W4DA 2PMZB 4XRHA 1Z1BA 5HY6A 1E22A 2WB4A 2L11A 1OPZA 3VAFA 5I2XA 3KK1B 1OY8A 3K8WA 2NR0A 3Q2TC 2NVYB 3CP0A 4B3RL 4KGVB 3ETLA 3MUMP 2KVIA 3BVZA 2ROGA 4O23A 3MM9A 3BBFA 4OL7A 4IG3B 4YMMA 2FZGB 4QZCA 1TL3B 1YQHA 2RHFA 1RJJA 3IRXB 4Q2LA 1O0PA 1CVJA 1FEHA 4NLGA 4RUCA 2GHWA 2FJXA 3GDXA 2W9AA 1N56A 2OO4A 1YNNC 1SMYC 3TZUA 2F0TA 1D2BA 2D0OA 5CV4A 3L7PA 1ENFA 2HCFA 2ZTDA 2B29A 1FO4A 1FK9B 3HHEA 3FFIA 3AD9C 5LL6d 3R5DA 8ICCA 2HD3A 4NY8A 1JKHA 4NLPA 5EN1A 1A62A 5KYLA 1LT6D 2W2OP 3VC8A 4ZOSA 3E2EA 1EZ8A 2RF2A 3F56A 1ET9A 1HUOA 4ILLA 1Q90A 2Q2TA 4O44B 3HK2A 4HCEA 4JI1Q 2Q6BA 2X51A 4CRJA 3JPOA 2IA0A 1M5VC 3VTIA 3RF9A 3M6WA 4CO0A 5KFTA 1EY7A 1STNA 1ZQHA 4AL5A 5HO4A 4Y3CA 5J2DA 5D46A 2C5CA 2QB1A 3R5GA 3CC7S 1VQYA 4BJQA 4ELVA 3B4MA 2HSEB 4X4SA 1TWCH 4QJFB 3NBPB 3POTB 3FVYA 5H1SV 4LF4L 3SFGA 3GSDA 4L6TB 4WP9A 1WCNA 1HNXF 4NXNL 2OPPB 2PT0A 2ISPA 2FHOB 1H0HB 2HFSA 4HIOA 5LL6S 2BPGA 3SSQA 1J9OA 1TT2A 3NWSA 2A0FB 4NLYA 3L5KA 3K7UC 2ZKTA 3OV7A 3BQTA 1W3SA 4USVA 4DR3Q 4NXZA 2HT1A 2OM6A 2FHTA 4AH6A 4OYPA 4BBYA 5IS2A 2JA6G 3R5AA 3K89A 3L0OA 5EX0A 4A4IA 3WIVA 1KLGD 2UZAA 2BYCA 4J8QA 1MWZA 4RCOA 3CCMA 5C0XJ 4F36A 4UP7A 3W1YC 1EKRA 3ND8A 4DUZF 2HPUA 2F0VA 4K2JA 2EJFC 4PR6A 1LW0A 1D5MC 4PKDB 2DNOA 5ETNA 4GKJQ 2CA9A 4M95A 2DRDA 1PTOD 4QWBA 4U67Q 1WEZA 3MEHA 1RHRB 3QUQA 1K0SA 3LWLA 3KDFA 2YX1A 3W9HA 1XMOL 2ZBIA 2VA3A 1DHMA 3KJFB 3M30A 1XNRQ 4BBRG 4A3FH 2KO1A 4LF5Q 4OYXA 2Y0BB 3J81L 1FEZA 4FXVA 1PYSB 1K5OA 3HP3A 4JK1C 1PC5A 3ERSX 2AT1B 3M1YA 4KAIA 3E0EA 3QRPA 1CG2A 5EWEA 1YJNA 2DBBA 4TUSA 1SEBD 9ICLA 2CDRB 2IM1A 2FGCA 1M5SA 5JVGQ 3AU7A 2VKQA 2WF5A 5BYRA 3PW4A 3QG1A 2OMOA 2UUCL 4LZGA 1N88A 2HI0A 2NLWA 4LSZB 1UAWA 2LECA 3LUYA 2FHJA 4G1IA 4O5EA 4B9LA 4JBCA 3GTKB 2ZZTA 5KFJA 5KFXA 3DOMB 4J37A 1HIWA 2E8NA 3RH4A 3O1LA 1XYIA 1ZYQA 2M7SA 3Q8QB 1CJVA 1P9QC 2E5IA 1HNZQ 3RLFA 2QKIC 1NUEA 3ITPA 3PIOQ 3G6XA 5ETQA 4NMZA 3DDHA 4UASA 2DPIA 1NUCA 1R4QB 3D68A 3VF0B 1RPLA 5HNKA 2RDDA 4OXPA 2Z30B 1HTLD 5AM0A 7ICKA 1X56A 1TU0B 3MXUA 4K2KA 4YMOA 2I0QA 2Q1LA 1X54A 3UQ2A 1UKUA 5HAOA 4YMEA 5ALGA 1RYRA 1TV6A 1KQFB 2RRNA 2OTLA 3DHXA 4DV3Q 2IHEA 2QCPX 3E0FA 2C42A 1H6KX 2CXYA 4A93B 4QIWD 3H4DA 2UUBQ 5KFBA 4X4PA 1OJ4A 3F53A 1H3DA 1RF2D 1VDZA 3PX0A 4P9SA 5IC6B 5LM7E 3ZZRA 4YMNA 2K5WA 4Y2SA 2YMPA 1EFWA 2YMQA 2EZXA 1E6YB 1S72S 1TIID 2QG9B 2PD1A 3D0IE 4DV5Q 4DFJA 3OPOA 2FLPA 5I42A 4DXGA 1Z9FA 3GYXB 4WKYA 5CZXA 1O7YA 1NXIA 2BRKA 2D74B 4A3LG 4U8VA 2O67A 1CKNB 3GTPH 2WAQG 4OZ0A 1AROP 2IT1A 2YWKA 5AI4A 4M6WB 4A3EB 3KHGA 1ZD2P 4P73A 3G6YA 1JOKA 2WV6D 2DQNB 4LF7F 1FWLA 2MZSA 1NK8A 3D66A 2BX6A 2LPEA 4RUBA 3Q8MA 2CRXA 2VB3X 1S3OA 4LFCQ 1YK9A 1PH5A 5ELBA 4DI6A 3PYDA 3EZ5A 4NXML 1KNAA 1JLFB 4CLPA 2L5TA 2CJQA 4EWTA 2R7UA 4OIXA 3AFGA 5G5HA 9ICCA 4RBVA 4ZCIA 2IOFA 4JV1A 1D1IA 3M7NA 2KJ9A 4MYTA 3C16B 1JNRB 3FKIH 4IPGA 2RLTA 4B9MA 3GTLH 3SE0A 3N28A 2LEAA 2WBMA 3K5OA 2VFSA 4G57A 4N47A 5K9FA 1BPDA 1B7FA 1FNWA 4DX8H 2V2ZA 3ULPA 1NK5A 1MMNA 2LXIA 3V7LA 3T5KA 2Z58B 1GTEA 2BACA 4L72B 2AJ2A 1N5TA 1LXNA 3HSJA 3CCJA 2KU7A 5EE1A 5ELCA 2PPBC 5AE2A 1RYSA 3Q22A 2ZIWA 1G8ZD 4LUBA 1N9WA 2P9EA 4NL5A 2EE1A 4ZKCB 4AL7A 4USAA 1A15A 9ICRA 4C3IG 4JI5J 2CQGA 3MM5B 2EYMA 1OQ6A 4FXWA 4LSLB 5C0XI 1IHZA 4G1QA 4LREA 5CAAA 5CP2A 3GIRA 1FL0A 2ZD1B 1S9GB 4DR2Q 4PWUA 4GZYC 4I2QB 2EAOA 2JP1A 2B2WA 4LZDA 1Z00A 2UXBF 1Q12A 1IM6A 4NCBA 4X3TA 1EETB 2BE5C 4J91A 1KHVA 4JBMA 2G1HA 1RBAA 3LO3A 4DSKA 3RBZA 5DLQE 2ZVIA 1U4BA 3Q2SC 4TKTA 4ID6A 3BBCA 3P20A 2YWWA 3MDFA 4W4MA 3H2UB 4JI4F 3ZDAA 3GIIA 1SFOB 1SROA 3MXPA 2V9KA 1VR6A 2LQ5A 3I55S 2L08A 2XY5A 1NR2A 1CJTB 4ID5A 4JOIC 4PGXA 4M9LA 3HHDA 4OZ3A 9ICBA 3W65A 3WK5A 2XRQD 1C7YA 3GMGA 5LMNF 5IT9E 5D14A 1FNMA 2AWNA 1NK0A 3B4DA 1QUVA 2WVEA 4Q5VA 1F9EB 4CT8A 4ES3A 5C25A 2GS8A 3D2NA 1E24A 1HFEL 2PI2E 3KJOA 2B8FA 5KIXA 3PO4A 2HFUA 3RTVA 4TY8B 2R18A 1K8GA 1KQQA 4B3TJ 1LXJA 2VQEQ 1VBKA 4LFAJ 2EZYA 3MD3A 4UY8T 3EUB2 2H3FA 2KQ3A 1I5OB 4C3HG 2KB2A 4C0BA 1CJKB 4OCZA 4A3IH 3DOKA 3A8EA 2V67A 4S3SA 2H5EA 3UFCX 2RU3A 3C28A 3NNAA 4EZ9A 2HRYA 3A12A 2I2YA 4LRBA 1IBLL 1Z7TA 2ES6A 3M2UA 4YCXA 1X9SA 3A0JA 5CGKA 1JLBA 2LDIA 3GR1A 4F50A 3QPIA 3IFTA 2YTCA 2C2RA 2K5NA 3WDNA 3CF5A 4CLSA 5ALZA 2NUUG 1H7WA 4IO1A 4C97A 3D1QA 5HGTA 1PGZA 3OFHA 3OFFA 1U1NA 3RW6A 3M32A 1E1OA 4G4KA 4GS3A 3UDIA 2ICEC 1WG4A 2I8EA 2V69A 1ZZFA 1FR3A 3R1HA 1IBKJ 1WD1A 5IT0A 5FDLA 3M7VA 4AQYF 5C4XB 4MJKA 4DPGA 1IR1A 3OTOQ 1YBUA 1L1OB 1V3ZA 4U7CA 5F8MA 1QTNB 7ICHA 1T3QA 2HBJA 4KLSA 1ZAXA 3MAAA 2AYMA 3EN2A 4MK7A 3HM9A 4KY7A 5CCMA 5M2UA 5CBEE 4QB4A 4DR7Q 1AZSA 2QX0A 1J2VA 1XTZA 1UZDA 3RUZA 4HR2A 3CC2A 3GTPB 5DG9A 2G9OA 2KP7A 4V190 3M9NB 2D9PA 4DR6J 4K8JA 1FDNA 3PW5A 2K06A 3CCES 4DL7A 4R4QA 4POGA 3H5XA 5ALOA 2NREA 4ED2A 3TARA 5TSSA 3BKTA 1N54B 1Q16B 2K5QA 2MP1A 5T1GA 5D4LA 1FRXA 4PHDA 2QLTA 4NLWA 9RUBA 1HA5A 3JTPA 4I7FA 1TFWA 4RW9A 1Y14B 2W24A 4ZPWR 1WTBA 8RUCA 4LT6A 1X32A 4JI6Q 3HX0A 3DHWC 3OQ2A 1RYUA 1CUKA 1NKCA 3MM9B 2COLA 2W04A 4YB7A 2BH8A 2PSZA 5A8KA 5F8JA 4EZ6A 1P8LA 4FF2A 3GTLB 5C4HA 2KT2A 1J5OA 1TVRA 3M8SA 3QIPA 3QJPA 2D2CC 1REVA 5F9NA 3Q8RB 1U1OA 3A0HU 2CZVC 4RNNA 5M3FH 1YBTA 1RBLA 5AJ3L 4TRDA 2BW2A 2E5LL 1SE8A 3HZGA 4I1TA 1GO3F 1Z47A 3FFIB 4L76A 2JA8H 3G48A 1JKHB 4PG8A 3QJLA 1HQEA 2RF2B 3DKDA 3A54A 1KR4A 2ZBRA 4NL9A 1NK6A 1TKZB 2PA3A 3CKIB 1MNEA 5LL6X 1L3VA 3RJEA 3UMGA 2CQHA 3FP9A 1O08A 3MCOA 2UXDJ 4C7ZA 2YYZA 5LSLA 1A0IA 1D3WA 2Q2IA 2BKEA 5AKKA 1RAFB 5BYSA 1M90T 3QIDA 2DNGA 4DX5A 4DQSA 5IODA 4DSFA 1PG5B 1K47A 1U4LA 3I0RA 2WW8A 2DWQA 4WZQA 2NZ4A 4YHHL 2BXJA 3C14A 1YNJC 4V19J 2KHDA 3ERQA 1WFQA 3PACA 1N8RC 1XN9A 2B39A 4H4KA 1TUWA 1URJA 1XO0A 2Y1LB 4ES2A 1DARA 1R7IA 2VFTA 3G4SS 2R7ZB 3UXOA 1F9FA 4Q8EA 1LTSD 5J0SA 4DXFA 2XG8A 4WIQA 4IL6U 1SV0A 3BN4A 3UQ0A 4IS7A 2PI4A 2B2VC 1FXRA 2EPIA 2DR9A 5KAIU 4ODGA 1T02A 1HNWF 1DXSA 4A8QA 1OXUA 2K8AA 4ZPAA 2B0GA 4RGOS 1IJEB 1VQPS 4AFFA 1L0YB 1B3QA 3R6LB 4X65F 2GWSA 4B9XA 1YT3A 1B99A 1RAEB 2YX8A 4G3IA 2JJ4D 1RAGB 3MMAA 4A3BH 1QUPA 1FNVA 1BHNA 3HVTA 1FA0A 1RWUA 2Y8WA 1KDNA 3BS7A 2E1PA 4LF9Q 3LWEA 4X4NA 3KDFB 4ZPTR 4IC9A 1YIJS 3W3AA 3BZQA 3ZDDA 5ALNA 1T3OA 2G0JA 4WFN3 1VQ5S 3GQBA 2B3GA 4A3IB 1N36F 3M30B 3IKJA 3BR9A 2NZHA 1T9UA 1UA0A 1N5XA 4B9WA 3M8QA 2P9CA 4LUZA 2KK0A 3FRZA 5IYCH 4UQTA 1GOZA 2RA4A 1RABB 4LQ3A 5GROA 2OQ0A 3TUZC 5ADZA 2FHMA 1J5EQ 1NMGA 5G0RA 1TZ0A 2AGPA 5A6PA 5D8HB 1Z6HA 2MQNA 4NP5A 2MNAA 4DA2A 1G2EA 4J9PA 5CYJA 1X6JA 2DEIA 3GE9A 4OZ2A 4MKAA 1N33J 1F5CA 2PE8A 4IOCQ 2MZQA 1TMJA 1PTOB 5KNCA 1EKSA 5DM73 3QUBA 2XEXA 4IRCA 2E76C 1HQUA 3CMAA 3DLLA 1K9MT 1SNQA 3C2PA 4OJHA 2CPDA 1KL9A 2H4OA 2GO8A 4DR4F 2G5IB 1HH2P 1NLKL 1KHWA 2BQRA 1HRJA 1DM0B 4DV4F 3K80C 1CJVB 2G07A 5J0UA 2YKOA 1WCLA 4JC0A 5C3EG 4QGUA 4FZVA 4QZFA 3PSFA 1F2MA 3WOEA 3I28A 2F1JA 1TVAA 9ICUA 4YP3A 1FEEA 9ICEA 4AIMA 1ZRMA 7ICLA 1KWMA 2CPZA 2ZM6F 1P1LA 2KUMA 1HA6A 2DK2A 3FYHA 4UPAA 5LMUJ 4Z6CA 1KOOA 4TU7A 5KG6A 2XN9C 3VYTA 1TV6B 3AL0B 4ILRA 1F2LA 2IJFA 1MQ2A 2OEHA 4YB1P 4M5LA 1YI2S 1QZHA 3OL8A 3OYYA 3H3VC 3BVMA 4C3MA 2QDLA 2Z4IA 4NZ7A 8ICHA 4JYAF 4TQRA 2HKEA 5CYMA 1JWSD 1HEKA 1LTGD 2GHPA 1JJ2R 3I31A 1SNPA 4QWCA 4QPXA 4F92B 3TREA 4C1NK 5I42B 4KO0A 5KFIA 5L1MA 3GTMH 1H2UX 2ZHOA 2A1BA 3QRRA 2MQLA 2KXFA 4GXIA 3K58A 4QWDA 2HS4A 4MAKA 4HR7B 1F2GA 1KW4A 3DWPA 5D0HA 1U2CA 3TADC 4GNXC 1B4OA 2W3RA 1GAOA 1PH4A 1DRZA 2VG7A 4CLYA 3HKZG 4ZCMA 3KKAA 1WI5A 5I2YA 1BNPA 1NAPA 4WTYA 1STEA 2K04A 1LQ9A 3SR6A 3CCLA 3EROA 2WB1B 1T03A 3GFZA 3FCHA 3S1TA 2JA8B 4GLVB 1JI7A 3NVYA 4A8FA 7ICFA 1U4MA 3VYRA 4OI6A 1CC7A 2YTVA 2B63G 4J9UE 3AEVA 3IM8A 3R6GB 4LFBL 5DS7A 3ZZZA 4NPSA 4DR1J 3TNVA 1U48A 4LF6F 3DEEA 3S14H 5JVHQ 4U7UK 5B08A 3NTUA 4OJ3A 1UVIA 1SYEA 4IALA 5KT3A 3MM7A 1HI0P 4WORA 4L8JA 3OJSA 5K14A 2F4IA 1UE1A 2LU1A 1BUVT 2XZTB 5D77A 2M0GB 2FMSA 3QR8A 5GAEC 2LY7A 2C3YA 2QA1A 1IBMF 1OSDA 4AD6A 4RCNA 3TRGA 3S6JA 3T79A 4ICLA 2ZIWB 2YTUA 2RVLA 1XBWA 4ZN1A 2KOBA 4JV5J 3ISCA 4HTHA 2AQ1B 4MT1A 3T1AA 3J81U 1W6JA 2QEJC 2NN6G 1BPYA 5J2KA 4G1QB 1EUJA 3HD2A 2KCTA 1TMMA 4OZ5A 2JFDA 1YHAA 3TZDA 4BBRH 3AHPA 5KG4A 3D3CJ 3N79A 5FLMG 4A3BB 3WC0A 2HS3A 1S77D 5J2QA 4WE1A 5IP9G 2OH2A 1Z00B 2BE2A 3OUYA 1LTID 4H4MA 3I2ZA 1Y69U 1VQ7S 4KLIA 2MQHA 4ICAA 1E6VA 3FRPB 3SEBA 1GFWB 1SI9A 1MG7A 4OJLA 3KFUF 3RR8A 4CF4A 2XS7A 2RHSB 3M9BA 3DXSX 3FMCA 2PFOA 3Q8PB 3CDUA 3NWRA 5B0EA 1Q78A 1PH6A 2QGFB 2XS5A 1RP5A 5D15A 2BQ3A 2WSFC 5ITHA 4M2YA 3TP8A 4YFKA 3K75D 4TURA 3PIOA 4ID5B 3RH5A 2JNJA 1B7YB 4BGDA 8ICVA 2X3DA 2BABA 1P7DA 1VC0A 4K4UA 4NWBA 5JEAJ 5KAKA 5D0RA 1SV5A 3HOVG 1WACA 2PA8D 4J9KA 1SV4A 2Q79A 3NWGA 2ZC4A 1PKUA 2JRZA 5ALSA 1NJZA 4AUKA 3F1ZA 3CTRA 2LS01 1HBUA 3BB5A 4IH5A 2PNHA 1S76D 1EXNA 4Y7NH 5HR6A 3AXKA 4P2HA 1NB2A 5IWAJ 3J7YU 1EY5A 4K59A 2B51A 5DQGA 1KN5A 2HRUA 2ASLA 2N49A 1FERA 1N2XA 2KDOA 2D69A 4URSA 1V3SA 1R8PA 1RDFA 5AKYA 3DOKB 4KK7A 4DUYL 3AJDA 3PKYA 2IL8A 3JQMA 4UZBA 2XGPA 2V34A 4MIBA 1KQSR 1AFIA 2B8QA 3M2UB 2LMIA 3G6EA 4UATA 1JLBB 1EQMA 2JEAI 1RT1A 4P2MA 1CFMA 3NG8A 1F6TA 4NCAA 4DCPB 4LF8L 5C4JH 2AQ3B 4OZLA 3KK7A 5IP7G 2CRLA 2Y1IA 4XIGS 2PN6A 2XMMA 4CKBA 3HJEA 4KI0A 1SR3A 1TK0A 3RFAA 4IRDA 1X66A 1FX4A 1Y0HA 3M32B 1ENAA 2KHCA 3AD8C 4W90B 4G9BA 3KG0A 1PRTD 2R7TA 2KT5A 1IKYA 1M1HA 4KLTA 1TAMA 1UEAB 1H74A 3J7YW 5ALKA 1HKAA 4L6V3 2HQEA 4A3LH 2MGZA 2CNKB 2V5HG 5AKZA 3D7SB 3OW2R 4ME3A 5COYA 5FDLB 2MKCA 4GOPA 5KFLA 1VC5A 2EYFA 2MTLA 2EYPA 4NV0A 3KLVA 4K4TA 4U673 3MAAB 5B09A 5AKLA 4WU2A 1HCZA 3ZI4A 2OP5A 4JVZA 3H5YA 1NMFA 3GTMB 1X4CA 4I2AA 2YKAA 4RQNA 3NBIA 1AZSB 2F0DA 2QKQA 1JJGA 4DUZQ 5IINA 2FI1A 4I2FA 4OHZA 3UDGA 1ZQJA 1PA6A 3PNCA 3GWCA 2RSOA 1HNXJ 4A3DG 2YTYA 2HHHL 1Z2ZA 4UBBA 4BBSG 3S2DH 3HRDD 3JPRA 3SBMA 4LMQD 5M3MH 3W62A 4LRDA 1R31A 4K4HA 9ICPA 5JTIA 4DPTA 1VJ5A 2GC8A 4HT5A 4OHJA 4ME5A 4QWEA 4I7FB 4RW9B 2AUJD 4GKKJ 1C0AA 2RRDA 4DK3C 3HEJA 1Z4NA 4O0NA 2KJVA 1PYBA 1WI6A 4PXBA 1EHWA 1HHVA 4EEKA 4DV1Q 1RT5A 4DUZJ 2UU9J 3OTDA 5A8KB 1KVKA 2K3KA 1WVLA 2EYOA 1F9SA 3SK6A 4KT0C 1J5OB 3S14B 4B3OA 1TVRB 2BE7D 3QIPB 3FBCA 1REVB 1SYDA 4X6AH 1NHUA 2AJ1A 2M2LA 4GVLA 3PIO3 4I4BA 4C3IH 4I56A 4DPOA 2JA6B 1VQDA 3T5HA 1KAWA 2Q2UA 3OJUA 1UE7A 5L8RC 3WKEA 3JB9k 1JOOA 4NWIA 4DMZA 3KHRA 3IAM9 1TS2A 2VG5A 4IZ8A 4ZYSA 1HQEB 1BOSA 1Q46A 5CA5A 1S10A 1NSQA 1QE6A 7ICEA 2H51B 4H4OA 4WTOB 4DV6J 1S57A 3U26A 2F0EA 2PC6A 4I67A 2Y0SD 4KLFA 3F0NA 1LFWA 1R8CA 2RT3A 4MFBA 4YB6A 4X66L 1GX6A 1U6FA 4O5CA 4ETZA 3CJKA 5J3BA 4NM2A 3I0RB 3AQPA 4BBRB 2F4VL 2UXCF 4DX6A 2N78A 3C14B 3ETOA 4DSJA 4RPFA 4K4VA 4WFAQ 4USTA 1FJGF 1RTDA 5GADU 4KHPL 3TAQA 4PQXA 5F0WA 3E0JA 3A8IA 8ICBA 3K8VA 2ASJA 1RKIA 2E5SA 2MKYA 3JAML 1FVQA 2GIRA 5C4ZA 1ZQKA 1A6XA 1LO5D 2IHMA 4WRDA 2LQ8A 2ZEJA 2QFJA 1ZXTA 4C2MA 5DDPC 2XLIA 4PZNA 3CCWA 5KYIA 4DL2A 3PG9A 3STBC 1LUZA 4XIUA 4C3HH 2DH7A 5F3XB 3C66A 4ECZA 2KEEA 2KRRA 4NYPA 1NNDA 5DKWA 3SSRA 1Q3VA 2HAIA 3MMAB 4WP8A 2DR7A 2BJDA 3HVTB 4D3HA 4Y7NB 4LW1A 2PFDA 3QRQA 2M8DB 4WJ4A 4LF7Q 3PYEA 1FFGB 4EELA 4RMFA 3F41A 4Q0BA 3LPYA 3BR8A 5ALIA 5CQGA 5SZTA 3BH6B 2F3VA 4CO2A 2NVTB 3CO9A 4MHEA 4YWKA 4YQWA 3AFPA 3M8QB 1WOSA 1U49A 4JI8L 4PJ0U 3KXDA 2BJ7A 4RKLA 4GMKA 3GTQH 1PVOA 1EX8A 2WACA 4MIWA 2VODA 2UUAQ 5G0RB 5C4JB 4DNRB 4XUSA 4FBUA 4CGZA 4DLEA 3MEDA 3GZFA 2VOOA 1ZQ1C 3PTWA 2LEBA 5GTHU 1RSCA 1L3KA 1N62A 4X64L 5M9OA 2HHVA 2VD3A 5IYDG 1VMCA 1HQUB 1FD7D 2J9DA 3FGVA 1ILQA 1PMRA 1YJ9S 4YN3B 3CD6A 2WAQB 3I9V9 2YNFA 3PO2G 1P9YA 2KYXA 1WD6A 3M7GA 3AA9A 1UFWA 4JOUA 2CQ2A 5KG5A 3KKFA 1LWFA 4CF5A 1FD2A 2OT2A 1QUQA 3CHBD 3WQPA 1SYGA 3MXNA 3QLHA 2E7XA 5M2PA 1FGUA 1FXDA 1CT1D 4LQ9A 4C8KA 2AYEA 5EPJA 4CLZA 2GA4B 1UNSA 4B3MF 5AK4A 3L3CA 2WW4A 2WVBA 2QMWA 3OXFA 4CNQA 8ICUA 4FO6A 2UXBQ 1BXTA 2SOBA 2GN5A 3PMFA 3S2DB 3ENAA 4N56A 2KIVA 3LALA 2IOFK 1BMQB 5CYMB 5K8MA 1UETA 1Q86C 4GO7X 3MUVP 8ICNA 2MGSA 2E2IH 5MAOA 1T9YA 2KYZA 4KO0B 2K8CB 1VBZA 4ECRA 2HLTA 3A1YG 5LMNQ 5CYUA 3P3DA 4I6YA 4MF8A 3FZBA 2AGQA 1DOMA 1NH8A 2B8GA 4K7QA 2G2OA 2N8NA 1U9RA 1X60A 2AWZA 3C1FA 3V05A 5DO2A 5F41A 2KM8B 2VG7B 3BJYA 4C3IB 4C8OA 2DNYA 3LVVA 2DUYA 5DGBA 4ECQA 5BR8F 1TK8A 1T03B 2F0WA 2OEJA 2M9KA 4JI4J 3D6WA 2MKKA 2FB0A 1KDBA 4PZ6A 3TJAA 2RKSA 2HQDA 1GUGA 3DLEA 2LA6A 2PNRC 3N52A 1QD1A 3UN2A 4LF2A 1U6ZA 4DOBA 4FXDA 2XSCA 1X5PA 2JZBA 1EWCA 5J2CA 1SL2A 2JLFA 3D0FA 3PUVA 5IOLA 3ISZA 1APSA 1XQIA 2A3JA 1S49A 3N97B 4UB2A 4CKEA 2WZ1A 4UAIA 5HBMA 4ER8A 4L3KA 2XI2A 3CMEA 5K14B 3M6KA 1KLNA 1VHIA 4P4PA 4UUWA 5K20B 2OFGX 1XSPA 4JG2A 2DNKA 3FHWA 2KXHA 3UM9A 4AQYQ 1ZAVA 4FFDA 3DLGA 2AV5A 3LDAA 3NMRA 4ICLB 3ULJA 3U27A 2JR5A 1C0TA 4Y6IA 1WKKA 2F1HA 4GKJL 4PV1C 4RQMA 3HHLC 8ICJA 2F0PA 3OOCA 1X5TA 5J39A 4C3HB 3AJ2A 2OTJS 3MPWA 2F0IA 2I0XA 2HBMA 1NSAA 1N63A 1SIZA 4OX9J 1AB8A 4GXJA 5F8LA 2KA7A 4J9VA 4DV0F 1VQLS 1U25A 2EBEA 1RHKB 5J2QB 1N32F 4WE1B 1B53A 1XMBA 4LF5L 2BE2B 3OUYB 1E6VB 1EQRA 1QQ6A 3G71A 1RWKB 4R0JA 4QF4A 4K4IA 1GXLA 3MEGA 3W2WA 2K4KA 1K3BC 2ZH5A 2EZVA 4C2MH 2KICA 4J9QA 4HYKA 3H42A 1RI7A 4MYUA 3QNMA 5KFPA 1SVDA 3B78A 3BYRA 4F5NA 4M5IA 1SV5B 3GTQB 5CV7A 4UP8A 3JSYA 1WNEA 1RT2A 3IMQJ 2EAMA 1HBUB 4PCQA 3THTA 1ZBTA 4KIAA 1Y5IB 2YMLA 5C3EH 1VQ8A 1SCJB 1FE0A 4CJ1B 2F0OA 1ESRA 3K4GA 5KFVA 5KFUA 4B3RF 1N34J 3ULLA 1B50A 3U1LA 1QNUA 2CPRA 5DEHA 4YR3A 4IFYA 2F1MA 4XQ8A 8ICKA 3I7FA 3BO4A 1NZBA 5IGFA 1LW2A 3ILJA 2JK8A 4PWDB 2HLUA 4KLEA 3D28A 1H2VZ 1C9OA 1BCPD 1HZBA 2NXUA 3M4QA 2V1CC 2ZJAA 1R8AA 2UVWA 5I3QA 1RT1B 4RQ8A 1E2WA 3CJQA 3HWTA 1GXTA 2DXFA 4PHEA 1FFUA 4KN7C 4DK6C 3G82A 2FJ2A 1G1XA 2JSOA 5E4WC 2I9GA 3PNIA 5EKKA 2KCMA 5DBBA 2HDOA 5HMYA 4QPTA 1IKYB 5DB6A 1HWUA 1ZYRC 3D9BA 3MCSA 4FKYA 2MGZB 2B4VA 2F9JA 1YJVA 1X0PA 1EWIA 4GOPB 3DYAA 8ICIA 2MQMA 3VCBA 4ECUA 4A3GG 3KLFA 4N5SA 2EJGC 3CCVS 2VFUA 1HNWQ 4E98A 4CLUA 1FVSA 5DZ7A 1N8RT 2HIXA 4LR7A 4X65Q 1W2BR 4NXNF 1WDTA 3CE8A 1C4CA 1VQCA 3R2IA 2NRVA 4CKCA 3K81C 4H54A 3NAIA 2F8KA 5KFOA 3QUTA 3GFXA 2B63H 2YWFA 3I4OA 1KNEA 4JK1A 2UUCJ 4E0DA 2FY1A 1ZQCA 5IE8A 1V5VA 1HD1A 1CRXA 2BJ3A 4JI5L 3IP4B 2NV3A 3A7LA 1M8AA 3F2CA 2KRBA 3A3OB 4AXIA 5DDMA 2IX1A 1HNWJ 4JI2F 1CULA 3EJMA 1H38A 2RE1A 5IGGA 1RT5B 4BS2A 4AYBF 1RB0A 3BPDA 5IIJA 4JI0J 2HBKA 4RX6A 2R7DA 4BY1G 3SVMA 3I5BA 4B3OB 3E8OA 1LTLA 1H72C 1NR4A 7ICUA 5AXKA 1E1TA 2W11A 1O80A 3J80U 4CH1A 3CAMA 4OZ1A 4RPYA 1LEOA 2RVJA 4OONA 1EL0A 1R0BG 3CMQA 2NN6H 1A76A 3W5XA 3CNHA 2K1RA 4C11A 2VG6A 1N36J 2E1RA 4ECWA 2VG5B 3PZPA 3IGVA 4U68A 3HG9A 5FLMH 1SMXA 1XNSA 4RW7A 4G7ZC 5D0GA 5IP9H 4DV4Q 2KG5A 1VQ4S 5D49A 2MAXA 2ATCB 1WF0A 4H4OB 2Z57B 5CA7A 2MLXA 4C3KA 2ROEA 5J8YC 3G8SA 2LMRA 1B0PA 4MFBB 3MDCA 2EIFA 2JOQA 3KTQA 2EKYA 4FPRA 2QF7A 3ADAC 3MFGA 4DAPA 1YLXA 4NI2A 5CR0A 1L5UA 2KHJA 3RBXA 3W2DA 8ICFA 3OBIA 5J2EA 1RTDB 3DMJA 1BXNA 2GVZA 2JE6I 4DR4J 2NVXB 4JYAQ 2PIIA 4XDXA 1VDVA 5ISRA 2JL9A 4USJC 3BSAA 2FPMA 3JSBA 4EO8A 3W7BA 5HMXA 4CO3A 1ZS6A 3OHAA 4C2MB 5LHY1 1RE1B 5J2AA 2VQEL 1F9HA 3D6HB 1KP6A 1SRUA 1HR0W 4PYDA 2EC2A 1ZH5A 2ZM6J 5EX3A 1GM5A 3HOYG 3L3FX 1MSHA 4KLUA 3MEFA 2AJFE 2C3OA 3GPAA 1IBKL 5KOXA 3QWPA 4M5KA 3D4WA 4DN0A 3LP1A 2JVRA 5C3EB 3NHHA 5FK9C 2C2ZB 5A2QL 2WVCA 5JPNC 3SK4A 4Q0BB 5A6WA 1XJVA 4RT2A 2W7AA 4J9NA 3MMJA 1CZWA 2G13A 5JVH3 2LQJA 1HWIA 2XO6A 4I69A 2KMDA 2VS1A 3A0BU 4F04B 5A0YA 3H3VI 1XIQA 2F0NA 2W25A 1MMLA 3BZKA 2CFMA 4KN4C 2AJQA 4DR6L 2NPIA 4YOEA 3FEWX 1ILPA 2V2VA 3K5PA 3GV3A 3J81c 2K75A 4ANDA 4NA2A 4ABNA 1PZJD 2GX8A 3LAKA 3MEDB 4C3JH 3ELHA 3OTOL 2DJWA 3BSNA 4DSLA 3QT6A 3DGPA 5T14A 1AEXA 4CO4A 3TUIC 4JI1F 1O78A 1HJPA 4F8RA 3MHYA 2GOLA 4CNZA 1MC8A 5C3XA 4DR7L 2PQAA 2BW7A 3H2LA 1S5LU 2VBWA 2YNFB 2OEKA 2HG4A 1EU4A 2DNLA 1XERA 1L8OA 3OT9A 5E3PA 4X4TA 3ZTQA 2ZTEA 5CV6A 3KLEA 1LWFB 1O03A 3HKZB 1MMDA 3AYHB 5L1IA 1QUQB 4LF6J 2MZJA 2CNOB 3MXNB 3QLHB 3F2UA 3DHQA 1GUWA 1ZQFA 3PUWA 3NS7B 3BG3A 3I4LA 2M2BA 4DZDA 4JOIA 3BF4A 2B63B 2FLOA 4IQVA 4DR3F 1T95A 2JSXA 2XSFA 4KLHA 4KLLA 4AYBC 1OPIA 1IBMJ 1MW7A 2UXDL 3TAPA 4IO9Q 4MK8A 3HDSA 5D4NA 3CCSS 5KEEA 5J1NA 5FO9B 2DR5A 4OZNA 1QSLA 5HJYA 3PIPA 2HW3A 2DNQA 3OSPA 2V2QA 2ZNYA 2VANA 1WOOA 5GAEI 4NZ0A 2PO4A 1Y8PB 4I2GA 3FEYB 1BDOA 2WP8J 1Q82C 3UD4P 5F3ZA 3BGOP 2H3ZA 1RDPD 4CO1A 3IG1A 3QGHA 1WEXA 4C0OC 1XK8A 3N5FA 2F0SA 1KTKA 2CJXB 3I8ZA 2HZCA 4RNFA 3MM8A 2DNEA 4JBKA 3C29A 3OLBA 1XNRF 1D8LA 2F65A 5F8GA 3VVTA 4OIJA 5H2FU 4N9PA 4LF1A 3P1HA 4M5NA 4ED7A 1N5VA 1GUNA 4P4OA 5DZ6A 3RZDH 2ZT9C 4BWGB 2F2AB 7ICNA 2MUTA 3DM1A 3UDXA 2QARA 5CR3A 2YNGA 1RT3A 3JAMU 3DLEB 2R2RA 3DRXA 4ZCLA 2X1BA 2ERRA 3HT3A 2M9VA 2LQ9A 3I55A 4JCVE 1C1CA 4IH6A 3NWTA 2N3SA 3J81E 2JZBB 5EOZA 1ZOTA 3MC1A 2ZHAA 2AYBA 2DRBA 3OSOA 1DAXA 4DOCA 2FC8A 3TX0A 5KFKA 2EY6A 2VQFF 3V6DA 3QU2A 3NGKA 2R2TA 2CPYA 2I07B 2H4YB 2VNUD 1N5WA 5HBMB 3M9MB 2A10A 3PXGa 2LA4A 2Z4HA 2CYYA 1S1WA 4YD1A 2X1AA 1FNUA 5KNBA 5JRTA 2DGVA 3DXBA 2XTJP 1HNZF 2ZC3A 3TX8A 3HOVB 2HBQB 4HEA9 1XPRA 3R5BA 1KLMA 1WTHA 3CVKA 1ZM4A 3KJPA 4I6WA 4HHJA 5LXRA 3R2CJ 3DLGB 1ELOA 4Y2CA 4EU0A 2I6XA 2G1DA 1C0TB 2LXUA 1YZ7A 4CRXA 2XICA 3K59A 4C8NA 3DLHA 5C5MA 2QC3A 3DGVA 1N33L 4DV3F 1I94F 3N9UC 1ZD3A 4URQU 2OLWA 3RLNA 1S9FA 4DV7Q 3WU2U 2UUBF 1P8GA 5ETSA 1ICFB 4F87A 3FSYA 1I6HH 5CEHA 4ED6A 1JE4A 2C2OB 3MAQA 2F1IA 2JQOA 1AP0A 2OI2A 4DHVA 4A8WA 4TQSA 2HDLA 1S4EA 4A8SA 5AJ3J 4PG7A 2AGOA 1NMEB 3C21A 1OYDA 2JEBI 1OY6A 1AW7A 3KOJA 2HVZA 5K5MA 2D3O1 4DV5F 1SYBA 3OR1A 3SCIE 4TVAB 7FD1A 1KQGB 1J5EL 4IPCA 5CHGA 3BDEA 2LI6A 2FVPA 1QH9A 3MEGB 3H0GG 3W2WB 2DFLA 4HJAA 3FC4A 2DEJA 4J7CA 1Z19A 1QE1A 8ICOA 1S5ZA 1TWAB 2CWPA 1RCXB 4I2JA 1FKAF 5IYDH 1VQNS 2R7RA 2GO7A 5EE3A 3C2KA 2JEGA 4R25A 4RW6A 3TS0A 1YJWS 5KT4A 3HILA 2YU9H 4RG1A 4ZUJA 2QLWA 4M9HA 5EKIA 2V4DA 1LACA 2XWYA 5K36H 1HW8A 1RT2B 4IUFA 2E75C 3IAYA 1SXLA 3TFRA 5EGYA 2V4QA 1RACB 2PEBA 2HK2A 2A6HD 2RSNA 2O66A 1VS0A 3PIP3 1H2TZ 1SIJA 1PH2A 5EHHA 2X1FA 1K83B 3SZ2A 3AOAA 4WPAA 2HYIB 1J2NA 8ICWA 4GVBA 1BE4A 3LGNA 1SAPA 2ALZA 4IFYB 4ITSA 2R8JA 4ZMMA 2R92G 1UUPA 3ZZPA 1M1KC 1LW2B 1YHBA 3D6MB 5IT9U 2RU9A 3VR6A 1SJFA 1WUDA 4O3MA 3M4YA 2YPYA 4A3DB 2BR0A 2BDNA 4F4WA 2IRYA 4C9DA 4BBSB 4OV6A 4Y00A 1VYAA 3J81j 1Y8OB 4A3FG 4KSEB 3IR6B 1D09B 4ZKBB 5ELNA 4F8MA 2J0TD 4NLTA 4HSVA 3TAMA 3G82B 3M1VA 5AKGA 4NLNA 1FHTA 2C9OA 2PMZD 4R63A 4MMOA 5KG2A 7ICQA 2B2VA 2PMWA 5KNIA 2UXCQ 1B70B 3LK9A 3CGIA 1ZRNA 4H02A 2J0WA 1FJGQ 3ITHA 4M5MA 4DPUA 1TP7A 4L5SA 5J2GA 2F1FA 4PPDA 3FJ2A 4WBFA 1CJUA 4WCEQ 4BHQA 4YIJA 1SUQA 2K3IA 3T51B 5J2MA 4NYZA 2H48B 3DYAB 1KXLA 4ZVQB 1T3NA 1G2TA 3VAKA 2ASBA 2XNQA 2YX4A 1DQ9A 2LXJA 2M9NA 2CWAA 4Q45A 3KLFB 4DAVA 3H0PA 4DR2F 2F3NA 5FP0A 2YNHA 3LF0A 3ZDCA 3IRWP 3PW2A 4A8OA 3DCAA 5D3DA 4A76A 5FJ4A 2EK1A 4OX6A 4DAYA 2XCPA 4B9TA 3PY8A 5JPMC 1VK8A 1CQMA 5GADC 1OXSC 5GTIU 1S97A 4JV5L 4LSNA 4CGYB 2H1YA 1HBOA 3URYA 4C98A 5KFSA 1BQMA 2L3MA 3CJ3A 3J7A5 3RH6A 1UVKA 2DNPA 3R27A 4IOBA 3BYYB 1GK8A 1HIYA 2BDPA 4PQAA 3H0MB 4K14A 3MFHA 1DLOA 2VH7A 4Z6EA 4HMIA 4GN5A 1FRJA 1X4BA 1CULB 4IUPA 4DO9A 1X4EA 1EQVA 3HP6A 1HPCA 1HW9A 1NU4A 3HT0A 3BGUA 3VA7A 4KV6A 4DSEA 5KNDA 1VQPA 1SIWB 3GP7A 4HMJA 2JH3A 3QSYB 2WSEC 1JMCA 1OWXA 2LXKA 3SDEA 4F5RA 2HHUA 2YKPA 3KZXA 2KKVA 3I4NG 5AI5A 4OYZA 1KKHA 4UZCA 3ZNUA 1Q7LB 3TBIB 1COOA 1OSCA 3OL9A 4Z6FA 5EGTA 1ZQUA 5HJXA 2IDEA 1SLJA 4I68A 3IM9A 3ZJYC 2K1RB 1YIJA 2VG6B 4ELUA 4C11B 3K7AB 4RW7B 1VQ5A 4EYHB 2NVQH 3C19A 2FMMA 4RQ0A 4BXOA 4XA5A 3M9OB 9ICAA 5C3WA 2LDYA 5IWAL 4XTCS 5L39A 3KBXA 4JV0A 1O6XA 2ZXHA 3AUOA 2QGQA 1EB0A 4DV2Q 1F5SA 1ZQTA 2AWOA 4KY5A 4DR5Q 4ZPBA 5FLXU 4KLDA 5IGBA 4LJZC 3FKIG 4UW9A 4B3MQ 5KFDA