1U49A

Adenine-8oxoguanine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u49A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u49A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u49A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u49A01
1ZBLA 3V9UA 1S0OA 7ICRA 1YTUA 3VQ5A 2AJQA 2V4QA 3DMJA 3V9SA 4XA5A 5HNKA 5J29A 5L1JA 4DL2A 3T1AA 1BQMA 2OPSA 4Y1DA 1LW0A 1FKOA 3G6XA 4DSJA 1WCNA 1TV6A 1ZQAA 3PVXA 2VANA 3C1ZA 5KFJA 4MFAA 2ZJ8A 4ECSA 2C2DA 3GDXA 3V6KA 4AILC 2FMPA 5KFOA 1RZTA 4PY5A 3ZT0A 4JV2A 3PX0A 3K4GA 2NRTA 4R65A 1ZQGA 2BE2A 3ITHA 2Z1IA 2KTQA 5KG4A 3RJFA 2YNHA 3CM6A 5CP2A 5KG3A 1U04A 2NRVA 3NGDA 3LP0A 5KG1A 3AVHA 2IAJA 2UVWA 1BPZA 3MABA 5KFKA 4O5CA 4F2SA 3ZSZA 2GV9A 3H08A 2I5JA 2FBVA 5J1EA 4M3XA 5IINA 4JV1A 3ZSXA 3V81A 3VQEA 2J6SA 3UPQA 4UAZA 4O9MA 5IIJA 3ZSWA 3OJUA 4PGYA 3MGIA 3G6VA 3RR8A 1BQNA 4RQ2A 3ISBA 7ICJA 4KLUA 9ICLA 1A5WA 4G1QA 1REVA 1JN3A 4KLFA 5DGBA 5KFXA 4YD1A 3PMNA 4CESA 5DG7A 5KG2A 5FRMA 4DTMA 5DDYA 3SQ1A 1IO2A 4EYHB 5F9LA 4QZHA 1O1WA 3LP3A 2VA8A 3HL8A 1RT5A 1XU4A 4MQ3A 1IG9A 3S3NA 1SKWA 1Z26A 4WE1A 5IIIA 1DLOA 4BACA 4CJKA 3SV4A 3SPZA 4KITB 4F4XA 1QQCA 3TR8A 3MEDA 1NK4A 4RW6A 3K75D 4FJ9A 5KFBA 3ZDEA 2BCSA 9ICAA 2IHMA 2ASLA 1RT1A 4CEEA 2OYQA 4K8ZA 4TUQA 2ZTDA 4P4OA 1D9FA 5BOLA 1HPZA 5DQIA 5FROA 1RDDA 4F5OA 1S0VA 1NK7A 1F21A 1XHXA 2YHBA 4IRKA 4DSKA 4M3ZA 1SKSA 3PX4A 3T5KA 3VQBA 2D0AA 4J9OA 1S6PA 1ZQRA 1WNSA 8ICTA 1UT5A 1C7YA 1KVAA 4Q5VA 1QSYA 1ZYQA 1WSEA 4DU4A 5J2KA 2HNYA 4IRCA 3AU2A 4RQ4A 3KD5E 3SQ0A 2FC0A 2VG6A 1ZBUA 1S9FA 3NH2A 3KHRA 3VQQA 4LD0A 4PHAA 1GOBA 4DQSA 3ZSRA 1RYSA 1X9WA 1U4BA 4DSIA 5CHGA 3PW0A 4DLGA 1A77A 1ZJNA 1YTAA 9ICJA 3ISDA 4CJUA 2AQ4A 3HO1A 3NAEA 2R7YA 1QTMA 4IFYA 4ED7A 2HNZA 2HHQA 4KN7A 2Z1HA 3V9XA 2F8SA 4Q8EA 5HRNA 4ED0A 1J53A 5DB9A 2AGPA 4B9NA 3CFPA 3RMBA 4YD2A 4RNNA 3NF8A 2EX3A 4CJQA 1GOAA 5KFLA 3UQ2A 3JYTA 1FXXA 3ZT1A 4CFBA 3UIQA 4QWBA 9ICKA 3DM2A 4DTXA 4KLHA 4NM2A 3QZ8A 3QEPA 1AROP 3VA0A 1C1AA 3SQ2A 4M3TA 4K4GA 1LB2B 3D45A 4MEYA 1C0UA 2FBYA 2WTFA 2IMWP 3K5NA 4DOBA 4TUPA 7ICQA 1XWLA 3H7IA 2HW3A 4CHOA 1VSJA 4FZYA 2ASDA 4C8MA 4OLBA 1BPYA 5EWFA 5J2PA 4TSXA 2JEIA 2QKKA 2XY5A 3MDCA 3ZSYA 3CG7A 5D46A 1KVBA 3C1YA 4KMUA 1RT2A 5KRTA 4F92B 3EW9A 8ICPA 4FJNA 4DWIA 5HHHA 5C24A 3CM5A 4YMMA 1BCMA 2WONA 4JRPA 1Z3EB 3JPRA 3AUOA 1RBVA 4I2BA 3RMDA 4CGHA 8ICNA 1Q9YA 3BQ0A 1SL0A 4R8UA 4Z6FA 4KV8A 2XY7A 4GLXA 4O44A 1KFTA 4FJXA 4B3OA 5KFEA 3GILA 2G8FA 3T5HA 3GQCA 2ZE2A 3MEEA 4Z6EA 2C28A 2C2RA 5EOZA 3RJJA 7ICVA 4CGIA 1TFRA 2NRZA 4PUOA 1KSPA 3SCXA 2R8IA 4J9RA 3RH4A 4DFMA 1ZQFA 3FYHA 1S0NA 2HHSA 3NTUA 2JZBA 4E1NA 4FBTA 3BJYA 3RH5A 4M9LA 1SV5A 1A5XA 2PI4A 2FMQA 3SI8A 1TGOA 4ECQA 3C2LA 4HUFA 1DGSA 4DF4A 4RPYA 4F3OA 1RCHA 1EXNA 2HHWA 3LANA 2KZMA 3QEVA 1HUOA 1DTTA 2D0BA 3A2FA 4QW8A 4DTNA 4UAWA 4KLQA 3B0YA 3DRPA 1A5VA 2P1JA 1L3UA 4JWMA 4NLKA 4K8XA 1MQ3A 5HRSA 3ZSOA 3BDPA 4FK4A 5KFRA 1ZQHA 5JUMA 2BCVA 3KLGA 2I9GA 2F1JA 5JS2A 4ECUA 2A1JA 4F4KA 4N47A 2R8GA 3KK3A 1BI4A 1RXWA 3EPGA 1ASWA 5KT4A 3K58A 2F8TA 8ICIA 4CHZA 3VQCA 2NUBA 3K5LA 3KLIA 4IRDA 5J2FA 4PQUA 1T4GA 4NY8A 3MBYA 3RAXA 4FZXC 1IXRA 3HP9A 4I2DA 4CK3A 3AVLA 4Q8FA 1RPLA 1VSMA 1ZBHA 4M45A 4ECWA 1K6YA 4CE9A 4AHRA 4RPZA 3RR7A 2ZUBA 3ORYA 2Y1IA 4GXJA 4DTRA 5J2HA 1RILA 4RNOA 3L2UA 3OYBA 4F4ZA 4KTQA 4AHTA 3SQ4A 2RDIA 1QLNA 4CJLA 5KRSA 5HRRA 3TFSA 4W5NA 4K4IA 7ICSA 4QZIA 4MFCA 2J6TA 2KW4A 2JEJA 1ZQTA 2E6MA 3C5GA 3VQ4A 3KD1E 2BHNA 4YMOA 1FK9A 4JV0A 5KG6A 4GXKA 3RTVA 4RQ6A 4QWCA 1HNVA 3KK2A 3L3UA 1TKXA 2W9CA 4PWDA 8ICUA 3Q8LA 5J2EA 2X6NA 3IAYA 4YR2A 3HPOA 4R64A 1FKPA 2JEFA 2B6AA 1WN7A 2FLLA 1BPEA 3TAGA 3OHBA 2B4JA 3AVIA 2PFNA 1KRPA 3ZSQA 3CFRA 4QCLA 1XHZA 3OYJA 3QEAZ 4DOCA 3NDKA 4EBEA 4ELUA 4OGEA 4KHUA 3RMCA 4O5EA 3VQDA 3OSPA 4FM0A 3OYMA 3AO4A 4O3RA 4IDKA 2KFNA 3PR5B 2BPGA 4YMNA 2Z1GA 4I2PA 4OVLA 1JMSA 8ICQA 1ZQLA 3JSMA 4E7LA 2W42A 4RT3A 5CA7A 4K4HA 4FJ8A 1ZBFA 4EZ6A 4F5NA 3PV8A 5KT7A 2ITGA 4B8AB 1KEJA 4R66A 3HW8A 4CK2A 4IG3A 3PR4A 4M41A 4E7JA 3RB6A 5K14A 4FLYA 4FJ5A 1KLMA 4JRQA 4J9NA 8ICFA 4YXMA 4OKKA 8ICKA 4DTSA 4PHDA 1HJPA 5J2JA 4EZ9A 4CJ3A 4KTWA 4M47A 4J9PA 4DF8A 2G8WA 4I2FA 1CUKA 1HQUA 4CEBA 1W9HA 2QKBA 4CIFA 3DLKA 4N41A 4FZZA 4LSNA 4ZH4A 4DL7A 1JXBA 3ZD9A 3LAMA 8ICRA 2P6RA 3TAFA 3EYZA 3QNNA 4DSEA 3MR5A 4CGGA 2XC9A 2BQRA 4I2CA 4H8KA 3MEGA 2PZSA 9ICRA 2IS3A 2ZTEA 5DBCA 3G0ZA 1ZQQA 5DLFA 3VQ8A 3OYLA 2MUTA 4H4OA 3SPYA 1BPDA 5J0TA 5J0SA 4I9QA 2BKEA 3NGIA 3AVCA 1L3VA 4FJLA 2ATLA 4LY7A 4FK2A 4IQVA 3S3MA 3HXMA 4KHYA 3NGYA 5IILA 1IKWA 4ICLA 5KFYA 2W8LA 1LV5A 3HPHA 3Q8QB 2HHVA 1WSIA 3LZJA 2MUTB 3M9MB 4E3SA 3EPIA 1NK9A 3GFKB 1KCFA 1D8YA 1X2IA 4ECXA 1TKDA 2YNFA 4PHPA 7ICPA 4NXZA 2HHUA 1ZQPA 4I2AA 2IA6A 2KQ2A 1UOCA 4HUEA 2AGOA 1S1XA 3Q8SB 4I9LA 4BE0A 2UVUA 1BI4B 1S9EA 4J9KA 2ZQBA 2FBTA 4CGFA 4CGDA 2C22A 1V9PA 3OY9A 5D49A 1ZJMA 3RJKA 3CFOA 4ED6A 1NOMA 4EYIB 7ICHA 4FLUA 4RQ1A 4X5VA 3K57A 2O4GA 4RZRA 4HCBA 1RT6A 4BDYA 1CZ9A 4KI6A 2ASJA 2NRXA 1JLFA 4UB5A 9ICQA 5KG7A 1NOYA 2G8VA 2DFLA 5J0QA 5KFDA 4O5KA 4KB0A 4DL6A 1JIHA 4CEFA 3M8RA 1S1VA 3KHLA 4F5QA 3HVRA 2P5GA 1RBTA 4MF2A 1WSJA 1C0TA 4QZEA 4ECRA 4W5TA 2PYJA 9ICNA 1BPBA 3DLBA 4ED2A 4XUSA 8ICLA 4DEZA 5C42A 3MDAA 4HCCA 1L3SA 2IOCA 4RU9A 3DOKA 4E1MA 1JLAA 3C95A 5KFCA 4UAYA 3QIOA 4I2EA 4DFKA 3KLHA 3GV5B 4PPXA 4YFUA 1U9LA 4YN4A 9ICFA 2YNGA 5DGAA 5KT6A 2VG5A 3IHQB 4KLOA 2HHXA 5J0YA 3M8QA 2FPLA 9ICUA 4EBDA 5DLGA 3AA5X 5KGWA 4HVJA 4QWDA 2KZ3A 4DL4A 3HYFA 2XCPA 4Z6DA 4DTUA 1LAVA 2G8KA 2DFEA 3AA4A 1SL2A 4UB4A 1ZQJA 3QO9A 3SV3A 4CJRA 3T5LA 3PW7A 1IM4A 1IKVA 3KLEA 3SNNA 4Q44A 1ZQEA 3RMAA 5J0XA 3OVNA 1EP4A 5KFPA 2IC3A 3LP2A 1ZQVA 4DTPA 4RW8A 2ZUCA 3I0SA 3AO2A 4I29A 4JS4A 3TAEA 2VA2A 4BDZA 4QZFA 4QZGA 5KGXA 4QZ9A 4F50A 4EP5A 1ZQWA 1RBRA 4F4WA 4GC7A 2V9WA 4B9MA 2A1RA 4CJSA 1YVUA 5FDLA 1ZQKA 4P2HA 2FBXA 2X78A 4QWEA 4Z4HA 4FM1A 4CHNA 4BWMA 1ZQOA 4QZAA 2BPCA 4CFDA 7ICLA 4DQQA 3P5JA 3QEIA 4DQPA 4IFVA 1NK5A 2YNIA 2UVRA 2F96A 1RT3A 5J2QA 2QK9A 8ICSA 3OYDA 4IR1A 4DSFA 2HVHA 3M8PA 1EXQA 2LSNA 2W9BB 4CJTA 5KT2A 2ALZA 1TV9A 3NFAA 5F9NA 1VSKA 3BQTA 5KFSA 3T19A 5KT5A 3ZDCA 3WNGA 4DFPA 3OYNA 3V7LA 1WCLA 3SJJA 4DTOA 3AVBA 4UB1A 4MEXA 5BOMA 3DYAA 4C8KA 4AHSA 4KLTA 2HB5A 8ICAA 4O4GA 4F5RA 5HP1A 2ZTCA 3DOLA 2BQ3A 4MFBA 3M8SA 3CYMA 1IKXA 1LWFA 3V4IA 2O4IA 1G15A 3BGRA 3V6DA 5DKWA 4F91B 1ZETA 2BDPA 3GIIA 3H4DA 1JXLA 2QXFA 4N76A 3PX6A 1TAUA 1BGXT 4AH9A 2E4LA 5KFZA 5KFIA 4RQ3A 3ZDAA 3EZ5A 4CEQA 1RTIA 1Y88A 4KLJA 1NK0A 3M9NB 2P6UA 2I1QA 3PY8A 3MXMA 3FDSA 3TAPA 1S97A 3I8DA 1D9DA 1EKEA 1KVCA 1S1TA 5C5JA 4M04A 5D3GA 4H4MA 3V9ZA 3VQ9A 4OLAA 2JZBB 3ETLA 3QEXA 3L2QA 1T8EA 3ISNC 4O0IA 3OYKA 4YVZA 4FJIA 3CQ8A 2IDOA 7ICEA 5KT3A 3JPOA 4ID1A 2PY5A 4UB3A 1JKHA 4ELTA 1RYRA 3LAKA 1UA0A 3AVMA 3SUQA 3OS2A 1JLEA 4KRFA 4CK1A 1BL3A 2VWJA 4M9JA 4OKJA 3KIOA 4HYKA 4KHNA 4I7FA 4KFBA 4J2BA 3EWAA 4IQUA 1ZQDA 9ICMA 1SL1A 1Z00B 3C2KA 1BIZA 3ZDDA 4FS2A 4KI4A 1RDCA 1WSHA 1TK5A 5DDMA 4GXIA 4ECTA 3ASMA 5DMRA 1U49A 3LZIA 3MFHA 4DG1A 4Q45A 3LPUA 5KFUA 4DS4A 4J2EA 1HYZA 3T3FA 4GMJB 4I2JA 3HP6A 3P1GA 2DPJA 4HUGA 1S5JA 3QETA 3AO5A 3HJFA 5C25A 3V7JA 3V6HA 4B9LA 4E0DA 4CGJA 5HBMA 1MSWD 4YQWA 3AU6A 3GIJA 3KK1A 1J5OA 1WSFA 5J0PA 3LP1A 1S1WA 9ICXA 5SZTA 2JLEA 4PGQA 3DLRA 4ECYA 5I3UA 8ICBA 4CF1A 4EBCA 5KTQA 3HX0A 3DRRA 4Q0BA 1N48A 1RT4A 4ED8A 3MXIA 4I2IA 4QZ8A 4CJFA 3V1QA 3HSTB 7ICKA 4M2YA 2M9NA 4JWNA 4E7HA 4NLGA 1KFSA 1TL3A 3TI0A 2PFOA 2FMSA 1T03A 3RH6A 4DLEA 1TKTA 7ICNA 4F5PA 2BGWA 5DB6A 3N97B 4PA1A 2KZZA 4AHCA 4FJJA 4JLHA 4CERA 2A1SA 3IS9A 1T05A 2C2EA 4KHSA 3PMLA 1B92A 2PXIA 4W5RA 3QINA 3QEWA 1VSHA 2OPRA 4C8LA 8ICVA 8ICHA 5HP4A 2F1IA 4QZBA 4CFAA 1S6QA 2BR0A 3MXJA 3NF9A 4HHTA 3PW4A 4OKEA 3SYZA 4R5PA 4EEYA 2Y1JA 1IH7A 1HNIA 5KFNA 1D5AA 1NJZA 5L1IA 7ICIA 3ISCA 1DTQA 4RUAA 1ASUA 3VQPA 4XIUA 4CJVA 2G8IA 5JS1A 4KREA 3ZT3A 4FLZA 1JL1A 2R8JA 4UBCA 1C0MA 3DLGA 2WOMA 2ISPA 2R8KA 3IM1A 3AA3A 1I39A 1IKYA 4DO9A 3D0PA 1Q9XA 3OJSA 1TKZA 1XSLA 3HT3A 2YKMA 4Z4IA 4KB1A 1NJXA 4YNQA 1C6VA 2RN2A 4YFKA 2W9MA 9ICGA 3H4BA 2RDJA 4B9UA 3MECA 1CLQA 5J0RA 3IRXA 5HHIA 2B21A 3RB0A 1ZQNA 3L3VA 4M3RA 5KFTA 2FPKA 3AVGA 4EP4A 3O3HA 2RPIA 1GOCA 1ITGA 4FCYA 4RNMA 4QZDA 4C8OA 3TQ1A 4NLNA 5KFAA 3NF6A 4RW4A 4RW7A 3VN5A 1VSIA 1JLBA 3OYEA 3V1RA 4FJGA 9ICSA 4F4YA 3QLHA 4LZGA 3GIMA 4BE1A 1RXVA 2HHTA 4RQ5A 3AO3A 4FW1A 1HRHA 5DK5A 3HVTA 1A76A 1UT8A 4I2HA 4J9MA 4QZCA 4RQ7A 1WSGA 3NH1A 1D8LA 4RQ8A 3VQAA 5HRPA 8ICEA 1CXUA 2OPQA 3EY1A 1MQ2A 1Z25A 4B9VA 1HQEA 4P4PA 1S1UA 5BPCA 4ZTFA 2BQUA 3LWMA 5EU7A 5KFWA 3H8SA 5CZ2A 1L3TA 2G8UA 3DRSA 4FK0A 3Q8PB 4KLGA 4CEZA 2AQ0A 5T7BA 4KAZA 3NF7A 4CF2A 5J2NA 1EX4A 4Y1CA 4FO6A 5DB7A 4PGXA 3JPPA 2IHNA 3O4NA 4FXDA 3TWHA 3RB3A 9ICOA 1S76D 3M9OB 1CZBA 5J2AA 3U3GA 2OWOA 2X74A 4RUCA 2W8KA 3GV7B 3RAQA 3L2VA 4M0AA 3SUPA 1NKEA 4F8RA 1TL1A 2XY6A 3OS1A 1WLJA 5HMMA 3OS0A 3QNOA 1N6QA 1N56A 1EETA 4Z0UA 4CIEA 4KHQA 5HROA 3RRGA 3TFRA 3RJHA 3KJVA 2PFQA 1HYVA 2D5RA 2KN7A 1BIUA 1K1SA 1QSLA 4M9GA 3E2EA 1RBSA 3KLFA 4CHYA 4LH4A 2E6LA 5EWEA 4CCHA 1ZQYA 2R8HA 3AVNA 2KFZA 1J54A 2DFFA 1VRTA 3ZDBA 3LWLA 1X9MA 2NRWA 4KLMA 2DTUA 4CF9A 2RF2A 3QEBZ 4CF8A 4YXJA 3PO5A 4TUSA 4KLLA 3LDSA 3K59A 9ICPA 1NKCA 5CJ7A 1NJWA 3L2RA 1XC9A 4GW6A 4CIGA 1TVAA 3ZSVA 4IBNA 4AHVA 2IGIA 5DG9A 2XO7A 3WNHA 3NCIA 5D4BA 4CF0A 9ICVA 4IQTA 3B6PA 1TK8A 3ULDA 5CR0A 3MR3A 4KPYA 3SZ2A 1TVRA 4Z4CA 1XO1A 1VSLA 4ED3A 3TABA 5HLFA 3RBEA 3PUFA 4J9SA 4JK1A 4KO0A 5KFGA 4M9NA 5CY4A 3ZCMA 2PFPA 3LPTA 5J2GA 2A1JB 3KHHA 4E19A 5L1LA 1HMVA 2Q0ZX 8ICZA 2FLNA 4BWJA 1LWCA 1ZQUA 4FM2A 4BE2A 3MR6A 5KFMA 5KFFA 1ZQZA 1XS9D 8ICGA 2F1HA 4IKFA 2XGPA 2YKNA 2Q3SA 5DQHA 4E89A 7ICFA 1QHTA 8ICYA 1ZQMA 1LW2A 4KKOA 4ECZA 4M3UA 4YCXA 1B9FA 4UQGA 1RNHA 3JPTA 3JPQA 5L9XA 4YR0A 2OZSA 3VQ6A 1BPXA 3I0RA 5E41A 4FJ7A 4IG0A 3UXPA 4KTZA 4Q43A 3KTQA 4CEAA 1YT3A 8ICOA 4O5BA 5KFHA 4GVMA 1SKRA 1R0AA 4CJWA 3ALYA 4O3QA 1UWBA 5J0OA 4CEDA 3C94A 2ETJA 1U48A 3QERA 2DY4A 5I42A 1JXEA 4TQRA 1NK8A 4KLDA 1Y97A 4ECVA 3K5MA 1RDAA 4J2AA 3PW5A 4RQ0A 9ICIA 4NLZA 1CXQA 5J2MA 3WNFA 3T5JA 1K1QA 4NCBA 3JPSA 4DL5A 3KKRA 1B22A 4XQ8A 3VA3A 4Z6CA 1S0MA 4B8CA 2BCRA 3UXNA 3O3FA 2PI5A 5IIKA 5CYQA 1LAWA 3NBPA 2P66A 8ICCA 5CB1A 3H8JA 2YHAA 3OYAA 1JLGA 3BQ2A 4KLIA 1SUQA 3O3GA 7ICTA 2AU0A 4Z4FA 3NH0A 3ZT4A 1RDBA 4B9TA 1QS4A 3AV9A 9ICHA 3Q8MA 3OYFA 1JLQA 2BPFA 4W5QA 3BQ1A 4FJKA 7ICMA 3V9WA 8ICWA 3AVAA 1HUZA 2XCAA 5J2CA 9ICTA 3ZD8A 1Z00A 3P83D 4DS5A 3HPGA 4TURA 1QE1A 5J0UA 3GV8B 3V72A 3U6FA 4FYDA 2IBKA 1WAJA 4O3OA 4OGCA 5FRNA 4E7KA 1UA1A 3TAQA 4YP3A 3WNEA 4FLVA 4QOZB 4DQRA 4RG8A 5L1KA 3QIPA 1H38A 4YG2A 8ICMA 4FLXA 5KFQA 5KG5A 1VRUA 2UVVA 4BGDA 3MAQA 3MR2A 3C2MA 1CEZA 5DBAA 5TZVA 4E7IA 3KHGA 1S9GA 2YV0X 1COOA 2XRIA 5J2DA 1NOZA 4KLSA 3DI6A 3OYGA 1U45A 4DTJA 4OJRA 4O3NA 2GUIA 5J2IA 3S3OA 4B9SA 1XSNA 4MF8A 5CZ1A 2VG7A 4IR9A 4G3IA 4I27A 1HJRA 3RBDA 1VK0A 4M42A 3B0XA 3PW2A 4O0JA 2B5JA 4F2RA 2XHBA 2Z1JA 4TQSA 1JLCA 4J2DA 5DB8A 9ICBA 3QESA 4BDPA 3O4QA 3H8WA 1RTJA 1ZQBA 2BGGA 3RJGA 4Z4GA 4KHWA 1PZNA 1S77D 4R63A 5EWGA 4LVSA 3L2WA 1U47A 3H40A 4PH5A 4CECA 4B08A 4F93B 1JL2A 1RTHA 1BISA 4JS5A 3AVJA 5J0WA 1J9AA 3TAMA 2X6SA 3GIKA 3OHAA 1HYSA 2AGQA 3UQ0A 3RWUA 4RT2A 4DOAA 1KLNA 2OA8A 4O3PA 3QE9Y 1SZPA 3LK9A 3E01A 4QAGA 4M3YA 4LSLA 2LYHA 4R8UB 4N56A 5IIOA 8ICJA 4M6WB 2ZUDA 7ICUA 1T3NA 2GBZA 5KFVA 3PNCA 3NGZA 3OSNA 1N5YA 1BVSA 5DG8A 5IIMA 1W0HA 3V6JA 4NCAA 1KTQA 3MGHA 4CEOA 4CHPA 3RRHA 1QSSA 3THVA 2OZMA 2JEGA 1I3AA 5CYMA 2W9CB 4ID5A 1LWEA 5CWRA 2VWKA 4KN4A 2ZJAA 1ZQXA 4LH5A 4OPKA 3N4MB 4F3TA 4FVMA 2BANA 4M3WA 4L8RB 4I2QA 1ZBIA 1TK0A 3OYHA 1ASVA 3NE6A 3C23A 3RB4A 9ICEA 4FJMA 4NM1A 3AA2A 2ZJ5A 4DU3A 3OYIA 3DLEA 2RKIA 1NK6A 3VQ7A 2PYLA 4UB2A 1ZQIA 4JUZA 3K2PA 1KDHA 4FW2A 4KLEA 4FLTA 2DFHA 3MFIA 2G8HA 1KFDA 3AVKA 3G6YA 3QZ7A 1JX4A 4UBBA 4FBUA 5DQGA 4DU1A 4M6WA 4BXOB 2H5XA 4XRHA 4FS1A 4DFJA 1B9DA 3F9KA 2XY8A 2HMIA 2VA3A 3DLHA 4CJ5A 2J6UA 3TARA 3SUNA 5SWMA 1RBUA 4IQWA 3C21A 3KKSA 3OYCA 2GWSA 3K5OA 2OPPA 3V1OA 4O3SA 1X1PA 4LZDA 3UXOA 1TAQA 4Z4EA 2FLPA 1C1BA 5J2BA 2DPIA 4GC6A 1VSFA 3S9HA 2ATQA 4ZTJA 4RW9A 2W9BA 4CFCA 4BXOA 3HM9A 1L5UA 2P51A 3OGUA 3RJIA 4DQIA 5DBBA 4I2GA 1XSPA 3V7KA 1B43A 4ZHRA 4P4MA 4NCGA 4O55A 1RT7A 4AHUA 2JGUA 4CHQA 3Q8RB 9ICWA 5HMLA 3SI6A 4CJPA 3JPNA 3LDAA 4ED1A 2EHGA 2FPMA 7ICGA 4W5OA 1NJYA 4C8NA 1ZQCA 3PO4A 4NYNA 1ZQSA 2ZD1A 4FJHA 2BCUA 1S10A 1C1CA 4CJ4A 4DSLA 2P5OA 2HNDA 1DOQA 3ZT2A 2W9AA 3C5FA 4DMNA 3AO1A 3G10A 1WAFA 4J9LA 3NHGA 3L8BA 4ELVA 4MFFA 3B6OA 1BHLA 8ICXA 1BCOA 9ICCA 3C6TA 3HWTA 4QWAA 4J9QA 4N5SA 3AVFA 3LALA 1MC8A 1XI1A 2V4RA 2D0CA 1VSDA 4RPXA 1T7PA 3F73A 4NYFA 1NKBA 3Q8KA 3TANA 3IG1A 2MAXA 2HVIA 4CJEA 4FLWA 3U3YA 4PHEA 4QW9A 4M9HA 4YR3A 3SUOA 3RJEA 3HK2A 1UAXA 4HTUA 7ICOA 5KI6A 1RTDA 4DL3A 4I28A 2BCQA 2ISOA 1MU2A 1VSEA 3C6UA 1X9SA 2XGQA 4OPJA 3FFIA 5KG0A 1Q8IA
chains in the Genus database with same CATH superfamily
1YZ7A 2PKEA 1ZBLA 2AJ1A 1VQ7N 2DNZA 5GAEI 1S0OA 1S49A 2MQLA 2BV3A 2PSZA 3VQ5A 4C0ZA 2DKXA 3QBXA 5J29A 2HZVA 1FJGJ 2OPSA 1RU1A 2RHFA 2QLTA 3G6XA 3E66A 1NNLA 1YITS 3PHEA 1U1RA 3VEZA 3THXB 2YKOA 2LHTA 3I31A 2RSQA 3V6KA 4OI4A 2FMPA 3BB5A 4B3RJ 1RBAA 2COLA 2KKPA 3K4GA 3PKYA 3GL1A 3P8BB 1N5QA 2KD1A 3DN9A 3TTFA 2D8CA 2KTQA 5KG4A 4OL8A 1E4GT 1U04A 3TADC 1NLVA 3PIOL 2XQCA 3LP0A 5KG1A 3OL8A 4P0QB 3CCMS 4F2SA 5E3QA 2GV9A 4H03B 4ZS6A 3GCXP 4NEYA 5J1EA 2FBVA 4EFAC 3IG8A 4IC9A 4JB3A 3ZSXA 4YY3F 5IZHA 2I0XA 3UPQA 1Q3UA 4UAZA 3JYTB 4TLRA 3CC7S 2UYTA 3ZSWA 3BZCA 3MGIA 3MGJA 1LWXA 2LQ9A 2P9KB 3GYNA 2KXNB 2CXYA 3NXZA 1Q7LB 1QTNB 3MM6B 7ICJA 2HOQA 4CWBA 4G1QA 2BACA 2YY6A 3P96A 1O03A 5KFXA 3H98A 1VQ6N 1OY6A 3FM9A 3D6FB 3BO2A 1IWAA 3CD0A 5KG2A 3TUJC 5FRMA 4PEOA 1LFWA 1U7LA 5DDYA 5CHCB 4X2BA 3IRUA 1O1WA 2BX6A 1FDNA 4GVEA 4JD2B 2ZHAA 1YITN 3HL8A 2QN6B 1RT5A 2AJ2A 4MQ3A 2J9DE 1NEEA 3S3NA 2X1AA 1DGKN 3EO3A 2XLIA 1QAIA 3N6LA 1N88A 5AI6A 5IIIA 3AD9C 2J0QD 4O8KA 2K8AA 1RBOB 4PYDA 1HPMA 3F9MA 1T3QA 1HR0J 3K75D 3ZDEA 3ISZA 3VEWA 2BCSA 3O1LA 3D2NA 1RWNB 4G9BA 2LQ8A 4J91A 2ACYA 1ZM9A 4PWUA 1TVRB 1TKZB 4K8ZA 4TUQA 2ZTDA 1D9FA 3A8YA 2ZM6J 2GUPA 2QA4G 2KRRA 3CO0P 4B3TF 1F60B 4F5OA 2J7KA 1NK7A 1VQNS 4BRLA 4OHYA 1R59O 5D0HA 2H3FA 2YHBA 3U1LA 2ZZTA 2FE9A 2A3VA 4M3ZA 2MJNA 3PX4A 3T5KA 2HS3A 2R4FA 2DKZA 1RKJA 4DV5F 2EK6A 1TUWA 1HI8A 4NLSA 1C7YA 4Q5VA 1KVAA 2CNLB 4F3QA 2R18A 3OLBA 1SCJB 2ITMA 4IEEA 2HEKA 3LDNA 2ZNZA 4DV7J 4H0VB 5GAEP 1S9FA 2GZOA 3FQLA 4JI6F 4AL5A 3VQQA 4LD0A 4PCQA 1X4DA 2WCXA 4DQSA 5IQQA 3F2BA 3AMZA 2LFVA 2XYHB 3HMJG 4DLGA 4CJUA 1VQLN 3FEXB 1QTMA 4IFYA 1U24A 2MZJA 4KX3A 3P39A 4ED7A 4NLQA 4O5FA 1JLFB 1RAFB 3GG4A 2LEPA 4Q8EA 5HRNA 2FPHX 3BP8A 1J53A 3HZGA 4C1NK 3CFPA 2C3OA 1L3KA 3ZX0A 3ILLA 4CJQA 2WF6A 2ZH5A 4JI1J 1GOAA 2AYEA 2YKQA 4K4YA 3GBTA 1FXXA 1EJ7L 3PXGa 1ZBSA 5ALHA 4C80A 4DTXA 2UXCJ 2XSJB 4X65F 5J2QB 3O5TB 4YDXA 4M3TA 4G1PA 4K4GA 3ATUA 4WQ5C 2KM8C 2R7XA 1LB2B 2JFDA 4DV4K 3EVOA 1YRUA 3VGUA 4IFYB 4U67L 2UV8A 2FBYA 1JUDA 1RAHB 3MCOA 3MMBB 2IMWP 3K5NA 2CPDA 4WFBQ 2KKHA 3A3PB 3MF5A 5AQLA 4L76A 1VSJA 3EEQA 2XYGB 3NS1A 5HBMB 1UCNA 1N32F 3N5BA 1BPYA 5J2PA 3VVUA 4Z7YA 4OPHA 2QKKA 1D3WA 4EX7A 1NZAA 2YTCA 2XY5A 3ZSYA 3CG7A 3MPVA 2QA1A 4F92B 1RWPB 3FCHA 4OX9F 1RA6A 3FSIA 8ICPA 4FJNA 3NCQA 4DWIA 2J9CA 5HHHA 5C24A 2WONA 2CG4A 1KEKA 1IR2A 4RQMA 2R7QA 2HBJA 4JRPA 2NLXA 3WX8A 5KPZA 3AUOA 3H46O 4I2BA 2NSBA 3QNWB 2YWEA 2VUGA 4GVBA 4CGHA 4LF6J 2HVZA 3BQ0A 3E9LA 4M5KA 4R8UA 4KV8A 1EZZB 4ILJA 2XY7A 4GLXA 3TJAA 4D3HA 4B3OA 5F2RA 1IKVB 1VLYA 4CBUA 3EX7B 4NZ0A 4Z6EA 2I5HA 1H7WA 4JI8J 1EETB 2JC1A 2C2RA 2YNGB 2AJFE 2AEJA 3WIUA 2DH8A 4OYXA 2H3IA 3CO9A 3TZXA 3FE1A 1CC7A 3G9CA 3DOMB 3GU0A 1KBRA 2O5DA 1BWEA 4KHPJ 2Q4TA 3WK9A 2NUUG 3NTUA 2JZBA 1N0UA 1VQMN 5HVFA 3RH5A 1U6FA 3BR8A 1ZS6A 5C2DA 1HIWA 1N5VA 4X4SA 3CJKB 4NXNJ 4QJVA 3PG9A 2F5GA 5IT4A 1TGOA 1SC1B 4HUFA 2V69A 1DGSA 4YS2A 2EEYA 3NRWA 1UEVA 3LANA 1KQFB 3QU5A 4RCHA 1HUOA 3OXFA 3JSMB 2D0BA 4DTNA 4DR7F 2K1RA 1Q7YT 1U1NA 3B0YA 3DI6B 1DAXA 4DR6K 3NUQA 1KQKA 3CCSN 2JC0A 2EG1A 3H3OB 5A8WB 4PG5A 4K8XA 4MFBB 2DF4B 3CCJN 5KFRA 2GO8A 5M1QA 1ZQHA 5E3PA 5AXLA 2DGUA 3KLGA 4NLUA 1HJOA 2I9GA 5F3XB 1HWKA 2O8DB 4DHYA 5JS2A 4ECUA 3ZZZA 4IH7A 2FQQB 3AARA 3O8MA 3G8SA 1FEZA 3AQEA 2KKZA 4CLLA 1BI4A 1GLLO 2DNNA 3EPGA 2NUBA 3TPQA 2CPEA 5J2FA 4PQUA 1X4EA 3W2WA 4TU7A 5IT9O 4PWWA 2Q43A 2HYIB 4PL7A 5BYRA 3E51A 1H0HB 5GAGP 4GVBB 1RPLA 3C66A 4M45A 4ECWA 1NLKL 3DGVA 2MSNA 1K6YA 1X8DA 1TYQA 5FPMA 3A5MC 4XH4A 5LJ5Y 3CC2N 3HHLA 2YWWA 2HAFA 2RQMA 2CJBA 5HI7A 3SQ4A 5A76A 2R2RA 3TO8A 3R97A 4JMUA 3TZYA 1X31C 5HRRA 3SSSA 2E2PA 4K4IA 2HCFA 4AL6A 7ICSA 4LT6A 4QZIA 1H6KX 1PBAA 4MFCA 2E6MA 2CQBA 3C5GA 3R9LA 2WBNA 4YMOA 1HNVA 3KK2A 4PWDA 3QT7A 1Z19A 3G71S 1RT1B 4BY9C 3D3BJ 2DBBA 3O3LA 3P6YC 3HPOA 2XSJA 3CTRA 2B6AA 3CDUA 4YOEA 3D67A 2FLLA 2HLTA 4EMDA 3ZZYA 3TAGA 4KBOA 1N36K 1KR4A 1U2RA 5LMNJ 1N54B 3BKUA 3CD6S 3ZSQA 4JBCA 2H3ZA 1N0VC 1JXVA 3QEAZ 4DOCA 1UEKA 2LVWA 1FKAF 1NGEA 4X4VA 3P5BP 4ELUA 4GKJF 3EUB2 3TZWA 4O5EA 4NA3A 4CRJA 3M8QB 4FM0A 3SEOA 3AO4A 4I2PA 3M6UA 1FDAA 1ZAWA 4OVLA 8ICQA 2FJWA 4CW7B 1ZQLA 2W42A 2CXEA 2P9PB 2QARA 4RT3A 1NGGA 3LP1B 4K4HA 4FJ8A 4EZ6A 1B70B 3PV8A 2E5LK 2BYCA 5KT7A 3MMBA 1NNEA 2XVTA 4PG7A 4MIAA 4BCAA 5RUBA 3CCTA 1T05B 5K14A 2HBRB 6AT1B 2F4VJ 1KLMA 2V8DA 1SV0C 2FHOB 8ICKA 4JKAA 2YMMA 1HJPA 4IH6A 4MT1A 2UUBF 2G8WA 4IOBA 1CUKA 4UB6U 3CPWM 2FYXA 4DR1F 2H4YB 4CE6A 1W9HA 5BN8A 1LWCB 4DV6J 4CIFA 1VBZA 1LKYA 3DLKA 1WWVA 2K3KA 3IR7B 1RABB 4ZH4A 4DL7A 2FJAB 3LAMA 4S0MA 2HQCA 3EYZA 3U4LA 1RHJB 2DR7A 2CQGA 4DSEA 4CGGA 1HNVB 3AB4B 1XMOF 2BQRA 2P9LA 5LMNF 4KC5A 5A2QY 3MEGA 2QYCA 9ICRA 2HWIA 2KU7A 5IT0A 5KOXA 4YOTA 1FKPB 4B9QA 2MUTA 4H4OA 3SPYA 4ZPCA 3G2XA 4HKQA 5J0SA 2GAHC 1UFKA 3H7HB 1H2TZ 3THWA 1U26A 4FK2A 2ATLA 1TV6B 4LY7A 1YG0A 4ZDNA 2ZJRL 3S3MA 3G25A 2RAQA 3TNVA 3UPFA 2P5VA 1RFQA 2W8LA 5GAGI 4DR3K 2CGLA 5JLFA 3CMEN 2HHVA 2VBYA 2ASMA 1XNRK 3EPIA 2HBLA 1NO8A 2YNFA 2ROGA 2DNQA 3BH6B 2WF9A 5GIOA 4LF9K 1XK8A 2KQ2A 4ES3A 3PEHA 2Y1LB 3M6XA 1UKUA 4RWWA 4WCEQ 3QJJA 5HATA 1ZQ1C 1RACB 3D54A 2XMUA 5AKKA 3WK8A 4YHHF 4UW2A 2GHWA 3OY9A 4KGZB 4LF9J 3CFOA 5HP1B 4FLUA 1T95A 2Q2RA 3T79A 3OFGA 5AZIB 2LYAA 5CAAA 4BDYA 1CZ9A 2ZJQQ 2EK1A 2YB4A 2MYFA 3U26A 3ATVA 1HW8A 4K25A 2HIYA 4BRMA 4KGMA 1AYEA 2QLJB 5KG7A 5EGYA 4LFAF 1GTHA 3J8AA 4QS9A 4O5KA 4DV5J 1FVSA 3JB9k 4F5QA 4MF2A 3OR2B 1RT7B 3T9ZA 3FGUA 9ICNA 4B1WB 4OX7A 3WUHA 1GAOA 4FWMA 8ICLA 4OZ2A 2YKNB 4ZVSB 3MDAA 4HCCA 1L3SA 4BRHA 5JU5A 4JI2K 2B5JB 2MQOA 3I32A 3QYYA 4LRFA 3DOKA 3FSYA 3C95A 5KFCA 4I2EA 1WF0A 4IOCQ 1S6PB 4CNYA 2Z30B 3KOOA 5IC6B 2YNGA 5DGAA 4KLOA 5J0YA 2GO9A 3M8QA 4U8VA 3WBZA 2FPLA 2MLXA 3UN2A 3B4MA 4EBDA 2KFYA 1U2CA 3GU3A 4NLYA 4DOZA 4QWDA 2R2UA 2KZ3A 4DL4A 4QYZK 4X4NA 4I69A 5D4OA 1NGHA 2DNKA 4LJMA 2E1PA 2CPHA 4DTUA 2BJ3A 4EX6A 2BRLA 2CVEA 3A4TA 3K8VA 1N4LA 1H72C 1NHVA 5AM3A 1YJ9N 3IDHA 3CJ9A 4UZCA 3SV3A 3TEHB 4MH8A 3KJNB 4V19J 1J5EJ 3NVVA 3QUBA 3SNNA 4WQ4C 2CZ9A 4ANCA 4LF7J 4R79A 1EP4A 1TKXB 4WE1B 2P9IB 5ALZA 3R9PA 4DTPA 1XNSA 3X1LB 1ZTWA 2BM0A 1VDHA 4F0KA 2PMZD 3N6MA 3IP4B 2VF3A 4JS4A 2VA2A 4ZA1A 3HSDA 2ZC3A 2FVSA 4F50A 3WKBA 5J2PB 2B9WA 4F4WA 5ALEA 1WHVA 4GC7A 1S72N 2L9NA 1XBWA 1YVUA 1ZQKA 1IKWB 2X78A 1MWZA 4QWEA 4ZLNA 2QA2A 4BWMA 4QZAA 4ALZA 1SIJA 3PCOB 3DJCA 4IFVA 2YNIA 3RSEA 5M2UA 1PILA 4WQ4A 3OYDA 2NXEA 5ALIA 4L3NA 1V85A 1VQ6S 2HURA 3PIPL 2K89A 4EELA 1L7NA 1CULA 4BC3A 3NNHA 1RUSA 1NPKA 2ZHBA 1HYSB 5F9NA 4F71A 1NH8A 3UDEA 4Q0BB 3H0PA 4DTOA 1FXDA 2AYBA 3HZEA 4DV1J 5ETOA 3VHQA 3AVBA 4UB1A 2GQQA 3DYAA 4C8KA 2ZD1B 1IG6A 8ICAA 3BBFA 5HP1A 3HVAA 1MN9A 4BRNA 2MDAA 3TWZA 1LWFA 5FPDA 3EZOA 2ASOA 1E6YA 1G15A 4MHVA 4LF8F 3GIIA 1PAUB 1HQEB 2QXFA 4N76A 3PYDA 4DL0C 4AH9A 1RLDA 3CCZA 1U2VB 1HFEL 4GIBA 1F9HA 2FY8A 3TAPA 1RWWB 1WHYA 3O9RA 2W40A 1S97A 3I8DA 1PK3A 2OFGX 3LGHA 1O8BA 3OTQA 5C5JA 4F67A 1IR1A 3GG0A 2VQFJ 2RQKA 1R8PA 3QEXA 2YQEA 3L2QA 4ID8A 3B6BA 1UHUA 3OYKA 1DQAA 4JHDA 1R3NA 2HGMA 1Q0NA 2DRAA 4NLTA 2IDOA 2HK2A 3NY0A 4JAXA 4WYBA 4ID1A 2PY5A 1KVKA 2Y9HA 3HSJA 4CO2A 1UA0A 3AVMA 1PC5A 3AEVA 3N9UC 3SUQA 4KRFA 3GR1A 5AKEA 2VWJA 4Q7AA 4H0OA 3D9BA 4HYKA 2D3DA 4ILHA 4O44B 4X4QA 4RLEA 4DI6A 2V67A 4J90A 4J2BA 1FK9B 1UQVA 3MMCB 1ZQDA 1SL1A 1Z00B 1A0PA 5IV3A 4ZVEA 2CG8A 4FS2A 3UKRB 2LQBA 1WACA 4KI4A 2YKAA 5DDMA 4ECTA 3ASMA 4B17A 5DMRA 2MKSA 1U1KA 3QAUA 3CD5A 3DXKA 1K73T 1YK9A 2CZ4A 4DG1A 4EHTA 4Q45A 2LMIA 4YEAA 1ZTTA 2C2MB 2RU3A 3OL9A 3CJBA 2WW8A 2FIUA 3T3FA 4GMJB 4I2JA 4CT8A 3O6WA 4YDUC 3QETA 3HJFA 1LOTB 4RNHA 3V7JA 5M1KA 3VGLA 3HKZF 3I6PA 4IOXA 1MSWD 3A8JA 5ETTA 3VF0B 3JTOA 9ICXA 4P7TA 1IV8A 1FDDA 4PGQA 3DLRA 3VGVA 1N63A 4ZN1A 4Q0BA 1N48A 2KN4A 2I1RA 3UDLA 2UUCK 5AQJA 4ED8A 3QPIA 3HSTB 1CZAN 4CH7A 2M9NA 4E7HA 4NLGA 3CDAA 3BPDA 4F4AA 1WUUA 3AY9A 4O4RA 1NGBA 1V38A 5IWAF 2A6OA 2WB1C 2R7UA 2UUWA 7ICNA 4CO4A 4LF7K 1PIEA 1RI7A 1YI2N 1ZZNA 4PA1A 4AHCA 2DGOA 4JLHA 3QFHA 3ET6B 3AB2B 2PXIA 3P4IA 2AP6A 4IOAL 4C8LA 4QZBA 3ZO7A 4CFAA 3MXJA 4HHTA 3NF9A 4YMEA 4FN5A 4R5PA 3L4IA 2HDOA 2Y1JA 2MGZA 1KONA 2QFJA 3UNGC 1C2PA 3ZX3A 3ISCA 4I2PB 5JS1A 4XIUA 4IQXA 4KREA 3ZT3A 1C0MA 2YVSA 1G99A 4J03A 4JV5J 1OIAA 1I39A 3J81j 3MCPA 4I0WA 3PSFA 3KD3A 2ZUGA 1FWPA 5GTIU 2WVDA 4CO0A 4NASA 4K41A 5AK5A 4Z4IA 4KB1A 3TOQA 2KXHA 4LREA 2PMZC 2RN2A 2QI2A 1AZSB 9ICGA 5DDQC 3H4BA 2RDJA 3T7ZA 3MAHA 2ZBIA 4A57A 2A5XA 2B21A 4FNHA 3RB0A 2E1AA 2E5JA 2YWFA 3CI5A 1YJTA 4EP4A 1D0EA 2R3VA 3OTOF 1GLAG 4PR6A 2VONA 1GOCA 2O8BA 3WU2U 4RNMA 2HPUA 3CC2S 4NLNA 4RW4A 3ONNA 1JLBA 1KQSR 4F4YA 3KBBA 4KH4A 2GHVC 1XC3A 4UAVA 2KG0A 2BA9A 4BE1A 1RXVA 4W92B 2YBVA 4DPTA 4FW1A 5B09A 1VIXA 4NB4A 5DK5A 3M3ZA 3HVTA 4ISGA 1UT8A 4U7CA 4I2HA 3NH1A 1D8LA 3VQAA 4OFZA 3M1FA 4ER8A 3M2VA 1Q5YA 1B4FA 4B3TJ 1IJEB 3BS7A 1S1UA 4YN3B 4ZTFA 1VHXA 5AQMA 3LWMA 4QPXA 3V4IB 4FWQA 3M2RB 3DRSA 1WORA 4TY9A 2YHWA 1DZ5A 4FYWB 3Q8PB 2GJ2A 4KAZA 4NV0A 4AFFA 4C97A 3NF7A 4MYTA 4FO6A 1KN5A 5DB7A 5CRXA 3AH6A 4BLGA 1RQ0A 4NCGB 2HQDA 4OCZA 4KH1B 4LR8A 1U09A 3R27A 2X74A 2W8KA 1QQ6A 1YJWS 4AXIA 1SI9A 2YNHB 1X40A 2DITA 3FBFA 2VV5A 5F8GA 3QNOA 2RT3A 5HROA 2EFNA 4CLTA 3KJVA 2VD3A 4IG0B 4JI4J 1BIUA 1QSLA 3RAMA 4ISFA 1BA1A 2E6LA 3C19A 4CCHA 1OH5A 4DV7F 4NL9A 1VQLS 1K44A 2V2VA 2OANA 2XIDA 3AVNA 4HACB 1J54A 4YDUA 2E2NA 3ZDBA 3LWLA 4D3GA 3UE2A 2NRWA 3UI3A 1Q95G 2UXCF 1F5AA 2DTUA 3M2VB 3C6HA 4IFVB 1HNWJ 2RF2A 5CA5A 3HSGA 2EZZA 3O1BA 2ILYA 5C24B 3SR6A 3B9JA 9ICPA 1NKCA 2OPSB 2VPYB 3MM9B 3X3UA 5CJ7A 4PUOB 5JVHQ 4CIGA 2KT3A 1TVAA 3PIOQ 4IBNA 5MLCQ 4DR5F 1HEKA 1TUYA 3I55N 5DG9A 2P9SA 3BR9A 3M8WA 5D4BA 1Q3VA 4CF0A 3AXKA 2OHFA 4QIWF 2XHCA 4FWKA 2JR5A 4OI1A 3B6PA 1N5WA 3EGVA 3L5KA 3D6HB 3ULDA 1FNXH 2ZH4A 2NREA 2Q3PA 4Z4CA 4A8XA 1YSJA 2ZC4A 4J9SA 2ZIVA 5KFGA 1VJWA 1OQ3A 4ZJLA 1LK7A 2A1JB 3SBGA 4KH5A 3SJHA 4JKEA 3KHHA 1C1CB 1DLOB 1HMVA 3KMQA 1LWCA 4BWJA 1TMMA 4QR0A 1ZQUA 5CR4A 4DV1K 4UZBA 4KAIA 2KJVA 4ZVGA 1OH7A 3BS5B 8ICYA 2K8CB 4MLEA 1SAZA 4NWIA 4KKOA 3SQOP 1NBEB 4YCXA 4JI8F 1I5OB 4AT1B 2B7BB 1B9FA 4L75A 2KVIA 3BYPA 4NLXA 2VPWB 3CC4N 2OZSA 5GMDA 2H5JB 3FAHA 2OPRB 1BPXA 3I0RA 5A6PA 1DBDA 4JI5F 3TUZC 2CNNB 2QWOA 4Q43A 2GIFA 5AQTA 3KTQA 1FNMA 2WHEA 1SKRA 3W64A 2IVMA 3ALYA 4O3QA 1SIWB 5CCLA 3HT0A 5J0OA 3C94A 2DY4A 1QH9A 3MD3A 1M1HA 3B54A 4C6AA 5I42A 1NB7A 4HL9A 3UVJA 1TU0B 1B99A 4CNQA 1NK8A 3MPYA 4I6MA 4OI0A 2XZWA 4J2AA 1COKA 3A5OC 1BUXA 2DNLA 5C12A 2ZZNA 2DGZA 4JI3J 1CXQA 5BPLA 3A8KA 2V94A 1RWXB 1O51A 2FHJA 2CJ9A 3FUYA 4NCBA 3L7OA 4Z6CA 1FA0A 4MKYA 1WF2A 4IYQA 4ZPDA 5CYQA 1LAWA 1MLAA 3NBPA 3N4WA 1MA7A 2J0WA 3W3SA 8ICCA 1SUQA 3O3GA 2DHSA 1WC6A 7ICTA 3GDQA 4Z4FA 4ICAA 2CWXA 5GAHP 1ZD3A 2HI0A 3OYFA 1JLQA 1WC1A 5AR0A 4W5QA 1I1GA 2U1AA 3Q8UA 4ZCIA 5K20B 5J2CA 5E33A 4X64J 1Z00A 3P83D 4C8ZA 1QE1A 2B4UA 4I7FB 2CNKB 3VGKA 4O3OA 5FRNA 2GS8A 3WXLA 4YP3A 1ULRA 5ALYA 4OI3A 4M5DA 2QWLA 1XR5A 2JL9A 4DQRA 3C14B 4J9UE 1OS5A 2OH2A 2LMRA 3KG4A 4LFBF 3W3DA 1JJ2R 1SJRA 4OJGA 4BGDA 4DV4F 3MAQA 4JHDB 5GAGU 1P1LA 5DBAA 3M5RA 4E7IA 1RCXB 1S9GA 1GXTA 1X9JA 4KLSA 3OL6A 3VEXA 4O3NA 2GUIA 5J2IA 1JLCB 5CZ1A 1TL4A 2VGMA 4XTTA 3OA9A 4AXJA 2HSZA 1HQUB 4K0KF 4KGKA 1JLAB 2VKZG 3O0FA 3B0XA 1N61A 3CWJA 3PW2A 3PJ9A 3CCVS 5H9FJ 3EM1A 2F9DA 2A10A 2Z1JA 5LJWA 3CCRS 4AUKA 3H8WA 2VOOA 4LBPA 5KAKA 1ZQBA 2BGGA 2PA8D 1FJGF 3U1MA 1SC3B 4KHWA 2E8OA 4R63A 1X5SA 1T0TV 2XO6A 1WEZA 1M0SA 3IO1A 3I33A 3THXA 3RBXA 3BY5A 4C7ZA 1U47A 2KB2A 4FOEA 3HVTB 3H40A 1P8GA 2HHHF 4B08A 1FRMA 1VC0A 3H1VX 4F93B 1L6NA 3CJ7A 5MLCV 4IQMA 3ALRA 4NMXA 3FJ2A 4CLFA 4I56A 3VZIA 3RBZA 2ZIWB 3WKAA 4N7TA 4JKGA 1HYSA 1KLNA 1WDDA 2EANA 1SZPA 3E01A 3UNYA 2WB4A 1N2XA 4X4TA 1VQKS 3LA0A 2ATCB 4R8UB 4N56A 5IIOA 5KFVA 5ETNA 4ENOA 3OTBA 4RUBA 3TADA 4B1ZA 1W0HA 2YPZA 4KHPF 2HQ3A 2UU9F 4BRCA 1SJFA 3THVA 3UDCA 2JEGA 4K2XA 1OXJA 4ZPTR 2W9CB 4ID5A 1LWEA 1Q16B 2IOHA 2VWKA 4KSEB 2ASPA 3CETA 3N4MB 2KICA 3GPAA 3PM9A 3OL7A 2X3DA 2F40A 4I2QA 2CDRB 2P8IA 2RHQB 3NAIA 1F5BA 2KSOB 4Y2CA 4DV3J 1N34F 1CC8A 2BZ2A 2RKIA 4EENA 5CYMB 3ENOA 1LVHA 4FZNA 2G0CA 1CSJA 5ALQA 1ZQIA 3UD3P 1WOOA 1NGDA 1OH6A 4QS7A 3MFIA 3I9ZA 2BABA 3G6YA 1SBRA 1B3TA 5B0DA 5AI4A 1B9DA 4FS1A 2J6UA 5D4PA 5SWMA 4URGA 2Q66A 1G3OA 2R7RA 3R5DA 2MLZA 2OHDA 4M5JA 4ZPVR 3K5OA 3MCAB 3V1OA 1X1PA 4C11B 4TKTA 1O5JA 2FLPA 1C1BA 5J2BA 3N79A 5J2NB 5KOWA 4B02A 1VSFA 2WW4A 2ATQA 4FZVA 2W9BA 4BR0A 4BUGA 2R2SA 1UWBB 3HM9A 1L5UA 3SIPB 3PNIA 3RJIA 1P27B 4CVNE 1KVIA 1YBTA 4K5RA 2K1RB 2Y0SC 1B43A 4ZHRA 2CGKA 3BGRB 4NCGA 4O55A 1RT7A 4KT0C 4AHUA 4CHQA 3KHYA 3GFYA 2EHGA 3Q89A 2FPMA 3QUQA 4W5OA 4M94A 2C2NA 1LW0B 4NYNA 2NZCA 3BPSP 1C1CA 4YHHJ 2L9WA 2IIHA 4GO5X 2YJEA 1YJ7A 2ODGA 3C5FA 5HMWA 2RVJA 5CZXA 1WAFA 3A0IX 3QRRA 1HWUA 3UKRA 2C2OB 3KZXA 1BCOA 2HAIA 3C6TA 2CUYA 3C6UB 5AZJB 3I0SB 1RTDB 2W2NP 3NGTA 2X1GA 2X7IA 3J7A1 1VAZA 3LALA 1XI1A 3P4UB 2V4RA 4KY3A 3ZNJ1 1YJNS 4RPXA 2HRUA 3LVVA 3MMAB 1L7OA 3F73A 2QA4N 1P6TA 3S6EA 4XPEA 4A8OA 5AM5A 2CQ4A 2PEHA 3QT6A 3M32B 4RW6B 3LPYA 2DNYA 1RQLA 2MAXA 2D6FC 3MX5A 4PHEA 3W9HA 1UAXA 3GMGA 4HTUA 3UM9A 3DDHA 4AL7A 4RJVA 7ICOA 1NJIT 1JI7A 5KI6A 4DL3A 2BCQA 3C6UA 1RHQB 1VQON 4OPJA 1CS4B 5KG0A 3V9UA 1WKJA 7ICRA 3QYPA 2AJQA 3NWRA 4XA5A 2CQIA 2BOPA 1OMSA 3CB4A 3CCLN 4DL2A 3ZXWA 1BQMA 4DN0A 3A12A 1FHTA 1O08A 2PFFB 3D2FA 1Z4OA 2HBKA 4DSJA 3HLUA 4CO1A 1TV6A 2ZIXB 2YX1A 2HOEA 2WOMB 2JX2A 2NCKL 5HVGA 1F3FA 2MZRA 4OJHA 3GDXA 2Q31A 1RHUB 4PY5A 1HWIA 1RTZA 2FVPA 1Y00A 3PX0A 1ZOTA 1D09B 3GYGA 3BEGB 2HS0A 3NNCA 2Z1IA 2YNHA 5CP2A 3IGNA 2D3ZA 1CJVA 1WC4A 2JRSA 3D6RA 2LI6A 2IAJA 2PO4A 1VK3A 3KNAA 3ZSZA 3TU5A 3CCQS 1U6BA 1H74A 4I6MB 3BQ7A 2MTLA 3CDWA 1S3XA 3V81A 1RGIA 1BHNA 2O3DA 4U6PA 2YQ1A 2VYPA 3O1WA 2CGJA 1UW9A 2Y8WA 4BRQA 3RR8A 4ZITA 2L5YA 5AQOA 3ZTRA 1WF1A 3ISBA 4KLUA 1H73A 1A5WA 4FKYA 5BRDA 1REVA 4KLFA 2AW0A 1WC3A 3I0RB 5EXWA 4NYOA 4ZN3A 3FC9A 1R27B 2RUGA 1FFGB 3CMES 2HFNA 4I68A 4NXNF 1VIOA 4CD3A 3SQ1A 3D4JA 2NV3A 1IO2A 4B3RK 2NXJA 3LP3A 1BO5O 1E3MA 2W11A 2ZHOA 1XU4A 1IG9A 3AD8C 4B3MK 2P9NA 4M5IA 4KFBB 4WE1A 1Z26A 4RQNA 4BACA 4DKWA 4CJKA 1D1UA 3SCJE 1OSCA 3VGMA 3SPZA 1GH8A 1SQKA 2PDAA 3WT0A 4BVPA 2E5IA 2CAJA 3TR8A 3MEDA 1NK4A 1S48A 3OFEA 3MEDB 1CLFA 2BOAA 1Y3KA 2ZIVB 4F3MA 2IHMA 2ASLA 2KH9A 2R7VA 3K9JA 1RT1A 4Y2TA 2K8BB 1EQYA 1XMQK 5EUHA 2VPZB 4WIQA 1FRIA 5E84A 3I5AA 4QU7A 4P52A 3I4HX 2L08A 4DV0J 4H5RA 4DV0K 1F21A 2A40A 3ENVA 5KL8B 1M5KC 3DNCA 4DSKA 1JKHB 2MHEA 2XZDB 3Q8VA 2D0AA 5HQLA 1QCKA 2ZBQA 4J9OA 4IJAA 1RWMB 2QEXS 1S6PA 4NRTA 8ICTA 1R31A 2P9GA 5CE3A 2HLUA 1WSEA 1NHKL 3O8WA 3LDLA 4CZHA 4J37A 4RQ4A 3KD5E 2K7JA 3O9SA 4JI3K 4QPTA 3ONQA 3M8ZA 1ZBUA 1KBUA 3KHRA 4PHAA 1GOBA 2EC0A 2A1BA 5J1NA 3ZSRA 3L95X 4ERDA 4I1TA 3FZKA 3GSDA 3R6LB 3TYTA 3O08A 2YQ0A 1UL3A 4DSIA 5CHGA 1ZJNA 1NAQA 9ICJA 3MD1A 5AQSA 2G07A 2CQ0A 2R7YA 1X3NA 2Z1HA 1PO6A 2KIWA 1PJ7A 4BGAA 4M95A 2AGPA 4B9NA 3W60A 3BF3A 4YD2A 2D3UA 4OZNA 3NF8A 2R7SA 1F6TA 2FZKB 3N4PA 3JYTA 1NCLA 4QWBA 3LGMA 1RBLA 3F53A 4NM2A 3QEPA 1FWKA 2V2KA 1R0AB 1AROP 2EQYA 2E1RA 3RUBL 3D45A 1T9YA 3HFVA 4CLPA 2G0JA 1YQHA 2WTFA 2DGWA 3R5GA 4F72A 4TUPA 7ICQA 3H7IA 4FZYA 2GH1A 2ASDA 5JVGQ 2EZXA 4OLBA 4TU8A 5EWFA 2JEIA 1J2MA 2WAQF 4UF4A 3HOTA 2FJVA 3C1YA 4KMUA 3IFRA 4BX9C 2W25A 1RT2A 2FC9A 1ZRNA 3ETOA 1WC0A 2GMJA 1TAMA 2B0CA 4YMMA 3CM5A 1BCMA 2AX1A 1QHAA 1Z3EB 2PGCA 2JSXA 1X5PA 3DLLQ 3ENHA 4USIA 4C0OC 4CDIA 3DC2A 1L8LA 1SL0A 5AXMA 4JB8B 4Z6FA 1X0PA 1TTHB 2OEJA 5AXNA 3FEYB 2J7WA 2VFVA 3QGIA 1QAJA 2ZE2A 3GQCA 1RDUA 3IFEA 1JCFA 3QMQA 2QLFB 3WXIA 3QFPA 2XS5A 3RJJA 7ICVA 2NRZA 2A6MA 2WONB 4WP3A 2O67A 2P6SA 1QUPA 5AQNA 3SCXA 4Z2XA 2N7YA 3CCES 1IIPA 1FI4A 2IY5B 4DPOA 1M1GA 2FF3B 2AIRB 1WEXA 3BJYA 1SV5A 2RQ4A 3PEJA 1WTBA 2MJUA 1P8ZA 1A5XA 1K8AT 1GX5A 1UTAA 4G1IA 3F5EA 2CA9A 5BR8F 1QVFM 1Y11A 5D15A 1S5LU 3C2LA 2B4VA 2WVEA 3ZTOA 4M5MA 1ZM4A 4F3OA 2VQFF 2ZH9A 1YUWA 3VAGA 1EXNA 3RFAA 2HHWA 3A2FA 3CXCR 2W03A 4UY8O 1F5CA 1BNOA 4DFDA 3MI7X 4YHHK 2O8FA 4CZFA 2P1JA 1L3UA 5HRSA 1DK3A 4LF4K 2DGVA 1YGYA 5B0BA 5E26A 4FWPA 4YOYA 1A6SA 1BA0A 3TA1A 1HWLA 1K8KA 5AFUH 1RXOB 2HG4A 2Y3YA 5LT5A 4F4KA 4N47A 3CJ1A 2WVFA 3GYXB 2WF7A 1RWUA 3T69A 3AJ1A 1RXWA 2GC8A 3O80A 4CHZA 1S1WB 3K5LA 3KFUF 1VDVA 1N33F 4PJ0U 3NS7B 3MBYA 2CQ2A 1GMUA 3LO3A 1TP7A 1ZBHA 4R0JA 4CE9A 1AT1B 2YI1A 1RT3B 1TL7B 5HVHA 4AHRA 3I87A 3C16B 1WWHA 1GLFO 1R6YA 5A8RA 1RILA 4RNOA 2E29A 4P7VA 2IVOA 4AHTA 4CT9A 2C42A 5LMNK 4RUHA 1NWKA 4CJLA 3R2DJ 3H20A 4X4OA 2HBQB 1FX2A 3TFSA 5GINA 4W5NA 5EE9A 4NLBA 3TA0A 2ZWPA 2J6TA 5IQ6A 3S8SA 1ZQTA 1JB0C 2A18A 3VQ4A 3KD1E 2E5HA 1HQ2A 1TQLA 5KG6A 3IBFB 2RLTA 4QWCA 2DJWA 2PE8A 3L3UA 2GO7A 2BEFA 3QX7A 1ZA2B 3D66A 5IWAJ 3IAYA 4DR1J 1B0PA 3H5SA 4JKDA 2EBGA 4ZLJA 2DNOA 1RTHB 1P9QC 1REGX 2OD4A 4NLPA 5A8KB 3KLGB 2PFNA 2NO5A 4JP8A 4QCLA 2P9LB 3GOIA 2M3DA 3WDOA 4NX9A 1GT8A 3OYJA 2J7UA 2H1YA 2WVCA 4KHUA 3RMCA 5LXRA 2PFUA 4O3RA 3PR5B 4LF7F 1HBNA 2M52A 1Q81O 2GQ2A 1VJQA 2AYMA 2HNZB 1Z1BA 2G9OA 4DPYA 1HARA 2HBYB 3KOAA 3KK1B 4DR5J 4HHJA 4B8AB 4WCEL 1HA1A 1IN0A 1XR6A 4CK2A 4MK7A 1FFWB 2XZTB 3MN6A 3D68A 4CLKA 4FLYA 4IDKB 4YXMA 4OKKA 2KK0A 2KKVA 5J2JA 2CQCA 2WAQC 5JJBA 3HKZC 4J9PA 1XMOJ 5ALOA 3VQSA 4XH5A 4BRGA 3MAAA 2M0GB 1M90T 4FZZA 1WUAA 1JXBA 2P6RA 1OPIA 2ZJRQ 1HKCA 5LSRA 3QNNA 3HCXA 4RW4B 4B3OB 1RSCA 2YCHA 3GB0A 1RAIB 4H8KA 1U8WA 2OTLS 2PZSA 2JH3A 2VQEK 2ZTEA 5FPNA 1U0HB 1NZPA 3VQ8A 1FXRA 3MCMA 4ZIWA 2IRUA 1NM1A 1BPDA 4I9QA 4FZMA 4AP9A 1SC6A 5JLHA 4MIWA 3Q2SC 8AT1B 5HL7L 2KIVA 1L3VA 3GTYX 3OBYA 4K4WA 2XICA 3HRDD 4IQVA 3UW1A 3J7YP 2O8EB 3NGYA 4UATA 1IKWA 4Y65A 3CJ8A 4LF8J 3C7NB 3Q7CA 4F0HA 4B3SK 1NZ8A 4OPAA 3CCSS 3S6JA 2WSCC 4OJ3A 1WSIA 3PFOA 4HT5A 2W54A 2MUTB 3M9MB 4P2FA 1KCFA 3IV6A 5HSPA 4BHQA 1D8YA 1X2IA 1TKDA 2WSFC 3WQTA 1KD1O 4MIBA 3EKUA 4R0EA 1IBLK 4I2AA 2IA6A 2W3SA 3Q8SB 4I9LA 3FZLA 3OV7A 2UVUA 4WWSA 4JI3F 1R8CA 2OI2A 5AFUA 2C1EB 4BGBA 2ZQBA 4WFAL 2ZBPA 4LFAJ 3DGPA 3QICA 1V9PA 1PVRA 3UVJB 1ZJMA 4M5LA 1VQ4S 4LSLB 4IL6U 2E7VA 4ED6A 1FEEA 4ED5A 3LM9A 1NOMA 4RQ1A 4X5VA 1A7GE 3H25A 4OQJA 1KDNA 2CQPA 3IA0A 4KI6A 2ASJA 3E9PA 5A2QO 1JLFA 2ZGYA 4UB5A 2Y0SF 2IMOA 3PDNA 9ICQA 5GAHI 2DL0A 2IM1A 3NS6A 5FLXO 1OYEA 2G8VA 1YX2A 5J0QA 4CH0S 2QB0A 2NZTA 4Y2QA 5JVGL 5H2FU 4KB0A 1H3DA 2HF3A 3M8RA 1S1VA 4BC2A 1Y10A 3CJ4A 2PYJA 1HNXK 1Z05A 2HFVA 1BPBA 5E0OA 3DLBA 3IN5A 4PZVA 2DHHA 4DEZA 3MPUB 5C42A 1WBDA 2F3NA 3JQKA 3OR2A 4B3MF 3PACA 1B0TA 4JI7J 5TISU 1R0BG 1S7IA 4DFKA 2BBEA 1BG3A 2RHSB 1U9LA 4C2MA 2CH6A 2KT5A 4US9A 1URNA 2OPPB 5KT6A 2WFAA 1G4CA 4OJPA 1PG5B 3DLJA 9ICUA 3CMAN 4MYUA 4MKAA 3SDEB 4ZP6A 4L72B 3HYFA 5JTIA 2QT7A 5CCMA 4QJFB 3SSRA 2G8KA 3ZZOA 4MTPA 1ZQJA 4UB4A 2JMGA 5F8NA 3R3LA 3D5MA 4Y3CA 5AQVA 2IRXA 1O6XA 2EFVA 3T5LA 4P73A 3PW7A 1EQMA 1GLDG 2AA4A 3KLEA 5BJRA 2DT9A 5J0XA 3OVNA 1Q78A 1N32K 3LP2A 4NXMF 4KV8B 3R5CA 1UETA 3NVMA 2JLGA 2ZGZA 5ALKA 2GVDB 2RRAA 2C3PA 4C7QA 1SXLA 4QZFA 4QZGA 3I8BA 1DTQB 3EXCX 4KQZA 2FSNA 4NA2A 2Z2YB 2N7CA 1ZQWA 2V9WA 4WXWA 1CQMA 2F77X 2A1RA 2F8EX 2FI1A 1V6HA 4FM1A 2OYYA 4CHNA 4JYAF 4Y2RA 2BPCA 3NMUA 3EE3A 3QEIA 4DQPA 2R7WA 4NOHA 4A8QA 1V3SA 1NK5A 1RWKB 3IS9B 2FC8A 1PBUA 4BJQA 3JSBA 3P5TL 8ICSA 2EKNA 3KXDA 2KJWA 2K60A 1UVLA 1FFSB 1RZMA 2DR6A 1X4FA 5EX0A 3K17A 2ZJPL 3KLFB 3CCQN 7FD1A 2DVIA 5I9EB 3ZDCA 1VLBA 1QY7A 4XDDA 4WFNL 4I6YA 4MEXA 2ZM6K 8ATCB 2QV6A 4F5RA 3M6KA 1J5OB 1TE2A 4U7UD 3DRSB 2BQ3A 3M8SA 3CYMA 5L9NA 3FQKA 3CF5Q 4USUA 1NDPA 3BGRA 3V6DA 3CPEA 4PXCA 1Q46A 4F91B 1ZETA 3IDWA 4Y28C 3VERA 2RRDA 1IV0A 3H4DA 2IHR1 2HMPA 4BS2A 1RKIA 3UDVA 3PX6A 1TAUA 2E4LA 5KFZA 2RKIB 2ZWHA 1OKJA 4PPZA 3U9DA 1AW0A 1RTIA 1HBUA 1Y88A 1T3VA 3M9NB 2F7VA 3G71N 2P6UA 3PY8A 5T14A 1EKEA 2X3GA 5THWA 2KHVA 4M04A 1S1TA 4M7YA 2UUCJ 5D3GA 2VG6B 4H4MA 3ADAC 3ISNC 3E1YA 4BG8A 1K5OA 5BR8K 2FHKA 3CCLS 1AUDA 2N4DA 7ICEA 2DPNA 3W9IA 4UB3A 2H48B 5L39A 3CULA 2JGAA 2WFBA 2D9OA 2B6AB 2MSSA 3GFHA 3OS2A 1JLEA 3P45B 2K3IA 4QIWC 4C4WA 1XNQF 4CK1A 2CPYA 3HZ6A 4OKJA 1NUEA 2CQ3A 4G65A 4KHNA 2AF6A 1P90A 1ACMB 4KFBA 1WG1A 1MN8A 4IQUA 5F0XA 1TZ0A 4KYZA 1S7HA 4FZLA 3TX0A 3C2KA 3FVYA 4H4MB 4JI4F 4AM7A 1URJA 3ZZPA 2W41A 4EGLA 1TK5A 3S41A 1MROB 3EL2A 1X3MA 2F9TA 2AHOB 5F8MA 2OELA 2L3MA 3MFHA 1PAEX 3T1HF 1YWXA 2M9KA 1CJUA 3CIPA 1IKYB 1PYOB 5KFUA 4DS4A 1RT5B 1HYZA 1ZD5A 3W8PA 1JJ4A 2DCUB 2APOA 3P1GA 2DPJA 3T41A 1S5JA 3AO5A 4HAIA 5K8MA 2AH5A 3D1OA 1YHQS 4KIAA 4IH5A 3LGNA 2MQPA 3AU6A 4JOUA 3KK1A 1S6QB 3FRZA 4YUDA 2HQIA 1JK9B 2VOPA 3IWXA 1MDUB 1SZ2A 5SZTA 1C0UB 2NXUA 2LDYA 1Y5NB 3BM7A 2F8HA 4Y2UA 5EE0A 5KTQA 3DRRA 3PRBA 2ZWOA 3CD6N 3MXIA 4WP9A 2P9KA 5G0RB 2XWYA 1B4SA 1WYGA 2PD1A 2LXUA 1J27A 3MAAB 2V8HA 2QX0A 3AL0B 1BMQB 3B4DA 3RH6A 4DLEA 4DQ8A 1TL3B 2BGWA 1KHWA 3O9TA 1S57A 4WTYA 3AFGA 2MA1A 2BVZA 5GMEA 1IJJA 3CVKA 4QIFA 2C2EA 4KHSA 1X7VA 3N7RC 4KH6A 4DR4F 1ZXOA 2DXDA 8ICHA 5HP4A 1B64A 1N5SA 2RIJA 4DX7A 2BR0A 3PW4A 5M1PA 2XMVA 1MMDA 1S1UB 5KFNA 2I7PA 3SMPA 2LM4A 1ASUA 4DX6A 2MQ8A 3VQPA 2G8IA 2K4EA 4UBCA 3DLGA 3CDEA 4WFYA 1ATNA 2B6GA 1IKYA 4TY8B 3D0PA 3OTEA 1K8AO 1EWQA 2IVPA 2L48A 5DM7Q 5HMYA 2CADA 1XSLA 2DKOB 1EWRA 1Y64A 3THWB 4YNQA 5ALGA 4YFKA 3FBBA 4B9UA 2ZF5O 2V6AA 5J0RA 5HHIA 5LL6Z 1WI6A 4KE5A 3EGWB 2FPKA 4LC9B 1NH7A 4DR5K 5HOOA 1FE0A 5DM6L 2RPIA 2Z2MA 1UJ6A 1ITGA 5E3RA 2QGFB 4ZVRB 4RW7A 3NF6A 3J81U 2O8CB 2V7ZA 4GKKF 3MGVA 3IRXB 3V1RA 1Z4NA 5I4MA 4IO8A 4OHXA 3TTCA 4FJGA 1JLQB 2AEMA 4C4TA 3MTJA 3ILOA 3QLHA 4B3SJ 4LZGA 1FD2A 5FJ4A 4PXDA 2VH7A 2HHTA 4RQ5A 2Q1LA 1X42A 4URSA 3AO3A 2QRRA 3NMAA 2V8GA 3U8XA 5TKYA 4NI2B 3ICXA 3PYGA 2LA4A 1PK1A 3M7DA 4N8OA 4QZCA 4RQ7A 5ETMA 3UMGA 4RQ8A 1CXUA 3QUCA 1FEHA 1MQ2A 2VCPA 3WKEA 1HQEA 4DR2J 2LBOA 5K14B 1EB0A 1YZ6A 2NRRA 5M1NA 3H8SA 3JS6A 1VQYA 2E9ZA 4FK0A 1X4GA 1SGGA 4CEZA 3SCIE 4DV2F 3DLLL 5AKZA 3SBMA 4CNZA 4PGXA 4GFJA 5G5GA 4FXDA 1CPZA 4X64F 2HFSA 4OZ3A 2H3EB 2Z2LA 1P7DA 1IBMJ 1RT6B 4H5WA 4OI6A 4P0QA 3IBWA 5J2AA 2OWOA 4X4RA 4RUCA 3GV7B 3DDKA 3MURP 3RAQA 4DX8H 1K8KB 2JHEA 3VWSA 3F5AA 1UJ5A 1NKEA 3MX2A 1TL1A 2XY6A 3OS1A 1WLJA 4K8RA 4QYRA 3T1YF 1DJ0A 1KHVA 1DURA 2E7XA 3KJFB 2ZH3A 1N6QA 3OW2M 1HL6A 3RRGA 4FWRA 5DO2A 1HYVA 4H4KC 4LRBA 4EFHA 1S1XB 4LF8K 3E2EA 4E8UA 4RBTA 1I94J 2F9WA 9RUBA 3I5BA 1QVGM 1CJKA 3W63A 2KM8B 2KFZA 2I6WA 2DFFA 1VQSA 5CQGA 1VRTA 3NMRA 1X9MA 4KLMA 1QDUB 1Q86O 1EX8A 2M7SA 4OYIA 3O6QA 3NRZA 1JQGA 2CN1A 1RADB 4FF2A 2IA0A 3QEBZ 2Y9UA 3CJRA 4TUSA 3BSNA 1Q81T 2MXYA 3LDSA 1YKWA 4DR7J 3SLCA 4OYOA 1QD1A 2MQMA 3U9ZA 2QLWA 4PKGA 2PAVA 3ZSVA 3NP5A 2IGIA 4PG8A 2XO7A 1VISA 2MSTA 5AKXA 4ANEA 9ICVA 3NVWA 5K9FA 3AA9A 1WEYA 3VCDA 1N34K 1XTZA 4KGVB 3WK4A 4AF1A 1VR6A 3PSIA 1KS2A 2GX9A 5MAOA 1TVRA 1GLBG 5F0UA 5HLFA 3RBEA 3O9QA 4KO0A 4LVNP 3UWTA 5CY4A 2OO4A 2IJFA 4NO7A 5ALLA 4NLRA 3LPTA 4JI0J 2MMYA 2XNQA 2Q0ZX 5IV4A 1T9TA 1PKUA 3RF9A 2CJXB 4BRDA 4FM2A 4BE2A 4PRFA 5KFFA 2D74B 3SCKE 2Q79A 8ICGA 2F1HA 3M1VB 1QQOA 4KMOB 1LW2A 2H5IB 4AYBF 2WBMA 2MZ1A 4M3UA 4F7VA 2MY7A 1C0TB 4RBVA 5I3PA 4X66K 4Y0FA 4USAA 4UQGA 1W26A 2K2PA 3AGRA 4KGXB 1WTFA 1NSAA 4FJ7A 1VQ9N 2F2AB 1BY9A 4J8FA 3L4BC 4O5BA 4WPAA 4NMLA 4GVMA 4C4SA 4CJWA 1OY9A 2F65A 2DGQA 3TR5A 1GXLA 2HWTA 4QR1A 3N5FA 4WF9L 5ALPA 3DOMA 1FJGK 4U7BA 2QM1A 1PSDA 1SS6A 3M8YA 4TQRA 4KLDA 5HL7Q 3EICA 3K5MA 1WG4A 3K9KA 4DUTA 3L3CA 3PW5A 1P1TA 1P9YA 3BN4A 4RKUC 1S72S 4DV7K 9ICIA 3PIPQ 3WXMB 3M6VA 1LXJA 5IM0B 3ULHA 3KWGA 3G96A 4CRXA 2V4JB 2BW2A 3A5LC 1K1QA 4FVUA 3KKRA 4EWTA 5J8YC 4F02A 1XUPO 3WX4A 2M8HA 2QWPA 2LU2A 1V4SA 3G82A 5JVHL 2XMJA 5F8JA 5K4LA 2P66A 2VBZA 4LQ3A 5CB1A 4Q2LA 1VQOS 1FTRA 2YHAA 3OYAA 1JLGA 4KLIA 1PGZA 2WHOA 4OYZA 1X9XA 2WB1D 3AN1A 4TLQA 3ZT4A 3NH0A 2VZ9A 3AV9A 1ZM2A 2W4PA 3ENAA 5AT1B 1IXKA 2OIHA 3F2CA 2Z58B 2E9TA 1W7AA 4PXBA 2GJIA 7ICMA 3WK7A 2XCAA 3PSPA 3IXQA 4R5PB 1H2UX 4DS5A 3HPGA 4TURA 2OAUA 3GV8B 5J1PA 2I6XA 3Q83A 4FYVB 4FYDA 3MMVA 5ETLA 5ETQA 4DXLA 1V3ZA 3IG1B 3TAQA 5BPNA 4FLVA 4HTJA 1YXQA 1NJIO 3FSXA 4IFEA 4QOZB 4RG8A 1N6QB 3K0SA 2HMXA 1H38A 1F3VA 1FRXA 1LK5A 1VS3A 2AZ1A 1VRUA 2XMKA 5AQYA 2CPFA 4OYAA 2RU9A 2BE7D 5HR6A 4H5VA 2M5YA 2PIIA 1CEZA 2YV0X 2ZFHA 5LSOA 5J2DA 1NOZA 1HI0P 4ZMMA 4NYZA 5GTHU 3S3OA 2MHNA 4MF8A 2E88A 1S12A 5DDPC 2HHHJ 4PL2A 4FDFA 2BKOA 1HJRA 5AI5A 2AXTU 4WJ3B 3RBDA 1VK0A 1X66A 1ZH5A 2B5JA 3KG0A 2W4DA 3SAHA 1F0MA 2XHBA 9ICBA 3O4QA 2W6LA 4FWSA 2RJZA 3HHKA 1RTJA 4GY2B 2OTJS 3RJGA 4Z4GA 1Q53A 2D0PA 3E58A 1FESA 1S77D 4O23A 3GFZA 4X4PA 5EWGA 1NGJA 4LVSA 2E8NA 4KBIA 1F44A 3G4SN 3JAMU 4NI2A 4PZNA 4QYZJ 4OO1J 4ZVPB 4IEIA 3ENBA 1HMVB 1BISA 3QLHB 3TX8A 3DMJB 4WFXA 4ZPAA 2PN6A 5CZVA 3WK5A 3DRXA 4M63C 2AGQA 3LOUA 3UQ0A 2JWKA 4RT2A 2OA8A 2FJBB 1J97A 4O3PA 5B5EU 4QAGA 4AQYJ 4M3YA 2KMDA 2RP5A 4QOTA 1XN9A 8ICJA 2YB1A 4JYAK 4DUYK 1T3NA 2GBZA 3BYRA 2M2BA 3OSNA 3KK7A 5DG8A 3QMLA 5IIMA 3K2YA 1Z2ZA 3CE8A 4CHPA 2MU2A 3RRHA 1QSSA 2JRZA 1AFJA 3MMAA 2OZMA 2H65B 2W7PA 1I3AA 1VQNN 4Y2AA 1FRJA 5LSLA 4KN4A 3OTCA 4LH5A 3L4PA 3KWMA 3KNGA 4F3TA 4FVMA 3DLGB 1UVJA 1TK0A 3NVKA 1GXUA 1W2BR 1UAWA 1QZ5A 2FHMA 3MXHP 5D4NA 2H3QA 4FL9A 2MZQA 4DU3A 4Y00A 2OTLN 2FSKA 1RISA 1X4CA 1VHFA 5ETPA 1YLXA 1KDHA 3C16A 2DEJA 2DFHA 2MKKA 2JDJA 2LP4A 4Y2PA 1JX4A 4UBBA 2O8DA 4WQ5A 1S22A 2AZ3A 1IBLJ 4M6WA 3F9KA 1C0GA 1MNEA 1NMNA 2UXDK 5HO4A 3A8IA 3TARA 1YJRA 3OFHA 3SUNA 1YHQN 2F3JA 4OHZA 4NYPA 1RBUA 4IQWA 3J7YI 3C21A 1BE4A 2VGNA 3TSPA 2NPFA 3OYCA 2GWSA 1HNZF 1F9FA 5F8LA 2OPPA 3TTDA 5DRKA 4O3SA 1DEJA 4DCCA 4K4SA 2CNOB 3PYEA 3CHWA 2B9YA 3QJLA 3AOCA 4GC6A 4ZTJA 1E6VA 4ZP8A 3SBTA 1I3OB 1TUGB 5DDRC 1I94K 4Y0WA 2IBOA 4DQIA 3DRPB 3CCUN 2AD9A 3VAMA 5KPRA 3V7KA 1HW9A 2OJ3A 4P4MA 4TVAB 3NGSA 4ZJQA 4CJPA 3LDAA 2RE1A 2F7TA 1H2VZ 7ICGA 4H5TA 1NJYA 4C8NA 3PO4A 3NGRA 3QRQA 1F0XA 1ZQSA 1YBAA 3CCVN 3Q22A 2W9AA 4DMNA 4KKOB 2J9EA 3B6OA 4IUFA 2FGCA 5AQIA 1EQ0A 4LF1A 3QFWA 4B3MJ 1NSPA 5U47A 5AQRA 3IG5A 1VSDA 1VRUB 2GTDA 5D78A 1IBLF 3C46A 4GNIA 4CGZA 1OSDA 4LF9F 2JVRA 3D2QA 5LMUJ 4NYFA 1NKBA 2N3OA 4K42A 3MEEB 3TANA 2E1ZA 1JNZB 3IG1A 4ZVHA 4A46A 2JXJA 4FLWA 1S99A 1RLCL 2YY3A 4QW9A 2O8CA 2ILZA 4PL1A 1KWMA 3HK2A 8RUCA 1WDTA 3AD7C 2B8PA 2VB6A 4IDHA 1MU2A 4X62J 1X9SA 2HFOA 2KYXA 1Q8IA 4ZVUB 1S1TB 1NPRA 1DT9A 3V9SA 5HNKA 2WBRA 1UZHA 1BC6A 3H3NO 5L1JA 3T1AA 4Y1DA 1FKOA 4A8FA 4J7CA 1RCOB 1RAOA 2BM1A 2GFFA 2QLXA 1SZHA 5EX5A 2NYVA 2GLEA 2FZGB 5BRFA 3D7SB 1ZQAA 3W61A 4NLDA 3HKZD 4MMOA 4NLVA 3CJ2A 2WF8A 3CMQA 3VGTA 2KE7A 5KFOA 1RZTA 4UQTA 4JV2A 2NRTA 4R65A 1ZQGA 2KO1A 3ITHA 3H5YA 1HKGA 3CM6A 3SXLA 5KG3A 3E01B 2UVWA 3NOCA 4OX9J 3CCRN 2G5IB 4JKGB 3MABA 2E1MC 3MN9A 3KJVB 5D0EA 3H08A 3N4QA 3RVCA 4FO0A 2HKEA 2OM6A 5IINA 3OT9A 2KEYA 3VQEA 1QQ7A 4U67Q 3BREA 3QGHA 5HK4A 2ZXIA 4O9MA 4CQ1A 3OJUA 3G6VA 3A0BU 4QIGA 3KKAC 1BQNA 3CCMN 3C14A 1FJEB 1HD0A 2JNJA 2HZAA 3VESA 4CZEA 5CD4A 3GJQB 1IQTA 1JN3A 4KHPK 5D4LA 3HULA 3UR0A 4PPDA 1S6UA 3TP2A 1C20A 5CD4H 3H0MB 4CESA 3ELHA 3AQFA 1FO1A 3A3OB 1PJ6A 5H1SQ 2E1EA 5D0RA 1WG5A 4OLOA 5F9LA 4QZHA 2WC9A 1N36F 2V8PA 2Y1RI 2GMHA 2HGLA 2FSJA 2VA8A 3MEKA 1HPZB 4NWBA 5JMVA 3WZ0A 2BXJA 5CH7B 1RYUA 4XO0A 4KITB 1QQCA 1T9UA 4RW6A 4FJ9A 1WSVA 2VJUA 5KFBA 2ZBRA 1SPBP 5BYSA 4MO4A 3MEGB 1H7XA 3CJSA 1GEHA 2LM1A 5A2QU 1T6CA 3MWBA 1AQ6A 4P4OA 3K5PA 2K4PA 1HPZA 2IIRA 1RDDA 1XHXA 3VV2B 2CDQA 2CPJA 1SKSA 2UU9J 1IQZA 1SV0A 2F8LA 2I8EA 3GJSB 4MKVA 4MDAA 2WK4A 5AHXA 2HSEB 1ZQRA 1WNSA 1UT5A 3WKCA 5J2KA 2HNYA 3AU2A 5K8OA 4QU6A 5BYQA 4JKCA 2K7KA 2RS2A 1BUPA 2RRNA 2VG6A 2FC0A 5LJ3Y 2CQDA 3PSTA 4NZ6A 4I6AA 3KUEA 2UP1A 4LRAA 3DHWC 1RYSA 4LBIA 4C3LA 2HSTA 1BD6A 1R8AA 2UUAJ 4KHMA 2QXLA 1VJ5A 1U4BA 2K8GA 2IDEA 3ISDA 4FOIA 1MMLA 3BGUA 1RAJA 1XNRF 3HO1A 3Q86A 2KI2A 1HKAA 1C1BB 4B1YB 5G0RA 3NGUA 2NYHA 2I9SA 4WZMA 1I6JA 4WIIA 4ED0A 5DB9A 4P2MA 3RMBA 2I7NA 2A42A 3ZZRA 3CJ5A 4PQAA 3LP0B 4B3RF 3VALA 2Z57B 5KFLA 2W1BA 1F2GA 3FC4A 4LF2A 2UXBF 1H98A 5ALUA 2MQNA 2CJY