1U49A

Adenine-8oxoguanine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u49A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u49A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u49A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u49A01
4BDPA 4Z0UA 4O3PA 1ZYQA 5KG1A 3GV8B 3H8JA 2ISOA 4BXOA 2ASJA 4DL2A 1RBVA 2XY6A 4DF8A 3VQCA 5J2KA 1ASWA 2W9CA 4ECXA 1KSPA 5KFSA 1C6VA 2X6SA 8ICIA 1Z00A 3K57A 3OHAA 2ZUBA 2KFZA 3AVBA 5KTQA 3SUNA 4LD0A 3G6XA 4YP3A 3RB3A 7ICUA 3MABA 4IQTA 2NRTA 7ICTA 1ZQQA 3EW9A 4OLBA 4RQ7A 4AILC 5DG8A 3G0ZA 5J2BA 3LAKA 4EZ9A 3OYBA 2W9MA 5KFBA 4GC6A 3B6OA 3RJKA 8ICLA 2A1JA 3MBYA 4YR0A 5CYQA 4ED8A 4PHPA 4LSNA 4PWDA 3RH5A 1XO1A 1QTMA 3HVTA 4KLFA 2Y1IA 1VSHA 4CF8A 5L1IA 4DQSA 1WAJA 4N41A 5BPCA 3I8DA 1ZJMA 4FZZA 5SZTA 4KAZA 2JZBA 5KG0A 4QWDA 5J0YA 2JGUA 3AVCA 1ITGA 3V7JA 4I2BA 3HO1A 4QZIA 4FBTA 3SUOA 5HRRA 3DLKA 1LW0A 1D8YA 2W8KA 5EWFA 4R64A 2XRIA 3HT3A 1J54A 1WAFA 4IG3A 4DFJA 5CZ2A 4O44A 1NOYA 2AU0A 1A76A 3O3FA 1FKOA 4OJRA 4M3TA 4RW4A 4O0JA 3LK9A 1T7PA 3AVJA 2DFHA 1PZNA 4E1NA 3H8WA 3RJHA 5KG7A 2YKNA 3OVNA 4CJSA 3QERA 3BQ1A 3QIOA 3QNNA 3SPZA 1ZBHA 3OYGA 3S3OA 7ICEA 2AJQA 3SI8A 1NK4A 3RRHA 3VQBA 1IKWA 1YTAA 2KFNA 3JPTA 4CJPA 1JN3A 2OPQA 3QEXA 4DSLA 3VQ4A 4KTZA 1KCFA 3DRPA 3PR4A 4B08A 4ZHRA 4E3SA 1S1WA 4O3OA 5KRSA 4QZFA 1BPZA 4EYHB 4JRPA 4CGFA 3AA2A 2I9GA 3HXMA 5DB9A 3TAGA 4N5SA 5J2HA 3C2MA 4KN7A 4PA1A 1RT6A 4F5PA 2BCVA 3QEIA 4UBCA 3SYZA 1BGXT 4OVLA 4CHOA 4DTXA 4RT2A 1RT3A 4FJ7A 8ICUA 5J2FA 4GXJA 3JPOA 3L2UA 3ZSVA 3MXMA 3PV8A 2VG5A 2B5JA 3O4NA 4HVJA 4OKJA 4DTJA 2F1JA 1J9AA 1EXQA 2OWOA 4FJLA 4AHCA 4GMJB 3ZD9A 3RAQA 2ZJ5A 3RB4A 4F4KA 9ICNA 4CEOA 1RYRA 4I2EA 2D5RA 4BDYA 5I42A 5KG4A 9ICKA 4YN4A 3M9MB 1WLJA 4IG0A 4C8OA 8ICCA 2GWSA 5EU7A 7ICQA 1RDDA 5FRNA 4E7JA 2P6RA 3OJUA 4QZ8A 3OSPA 4UB3A 8ICTA 1RBSA 4F5NA 1ZQAA 5KFEA 4RQ2A 1JLAA 4AHUA 1KVCA 4FYDA 3VA3A 3T19A 1HPZA 3SCXA 4YFKA 4CJRA 9ICXA 5DMRA 1U47A 3VQ6A 4GLXA 4NM2A 1SL0A 5JS1A 3AO1A 1U45A 3ZDDA 1TAUA 3V9WA 3NH0A 4GVMA 4Z6CA 5KFKA 1S5JA 1XI1A 4OLAA 3PW5A 9ICPA 5KFDA 3NGDA 3OHBA 2HHUA 3HW8A 4FLWA 3C6UA 1RNHA 2D0AA 3VA0A 1RCHA 4DTMA 4AHTA 9ICVA 4GC7A 3TWHA 3CFOA 3DLEA 3QEWA 1KVBA 1ZQTA 1NKEA 4Q0BA 4E7KA 3I0SA 8ICGA 4E19A 3QETA 4Z6EA 1I3AA 1KEJA 3UPQA 1CUKA 1ZQLA 4FJNA 1TKXA 4DO9A 1C0MA 3PMNA 2ASDA 2Z1JA 5CP2A 3K4GA 3Q8QB 1ZJNA 1JL2A 5J0PA 4Q43A 4O3SA 5J1EA 2WOMA 5L1LA 5KFTA 3NDKA 2BANA 1NK0A 3SPYA 3MFIA 1KFDA 8ICQA 1NJYA 3BDPA 5J2AA 1YTUA 8ICJA 3I0RA 3Q8RB 1SUQA 4I2QA 9ICEA 4CFDA 3DM2A 4DU3A 4E89A 4I7FA 2G8UA 5KFFA 1I39A 3C2LA 1XHZA 2UVUA 3OYDA 5HRNA 3TAFA 5J2JA 3E2EA 4KO0A 3IRXA 1K1SA 3UQ2A 3PW7A 3NHGA 4M3XA 3PW4A 3T3FA 9ICRA 3LWLA 3T5JA 1HJRA 1B22A 3NCIA 4J2BA 3NAEA 4KLSA 3KLIA 2XCAA 4UAYA 4FK2A 4J9QA 1RTIA 2ASLA 1ZQXA 9ICUA 1TK8A 2KTQA 3L3VA 1TGOA 3V4IA 3SQ0A 5KFQA 5KT3A 4O55A 2ETJA 3PW2A 4J2DA 5KT4A 1L3UA 4FBUA 2Y1JA 3ZDCA 5J2IA 3PY8A 5DQGA 3U3GA 3M8QA 1S1XA 1HQUA 5DLFA 1ZQSA 5HROA 3ZT4A 1SL1A 3U3YA 4UBBA 3FFIA 5CZ1A 4UB2A 4YG2A 4E1MA 5KG5A 2PYJA 4H4OA 3UXNA 3BGRA 4FZXC 4M2YA 4RUAA 3IM1A 3THVA 1MSWD 3K5LA 3AVNA 2BE2A 2BDPA 3EY1A 1BPEA 2W9BA 2XC9A 4K4IA 3QNOA 1BHLA 1XSNA 1QSYA 4TQSA 4DF4A 2KZ3A 4DFKA 4MFCA 2HVHA 2FMQA 1BIZA 1JXBA 2HMIA 4YR2A 4LSLA 3V6JA 5J2QA 1Q9YA 1K6YA 1JKHA 4TUSA 1BL3A 5KFRA 1BCMA 3BQTA 3PX6A 1TK0A 2X74A 1ZQBA 4CJ5A 1SZPA 2OYQA 3K75D 3RAXA 4I29A 5HRSA 5KFOA 3K2PA 2FPLA 3H4BA 1ZQGA 3UQ0A 4F4ZA 2D0BA 3KKSA 4CEFA 1XU4A 3JPPA 1Q8IA 4H4MA 4F8RA 4YQWA 3C23A 2XGQA 5IILA 2J6SA 1SKSA 3HP6A 4PUOA 1N56A 4KLIA 3DOLA 2HHTA 1NK9A 3IG1A 3Q8SB 2RPIA 1ZQCA 4I2AA 3ZDEA 1RTDA 1BI4B 4IRCA 1CXUA 4QWBA 5EWGA 3LP3A 2ZTEA 3HPGA 3ISBA 4J9LA 4KLJA 3NGZA 3AVLA 5IINA 1ZQKA 3GDXA 4IDKA 2ITGA 5C42A 3KLGA 3T5HA 3HK2A 4Z6DA 2O4GA 1JXLA 1HUZA 4FO6A 4C8MA 3LZIA 4FM0A 3AA4A 2A1RA 3ULDA 4ICLA 4B9SA 5HMMA 4FJXA 8ICVA 3OY9A 4B8CA 4YMMA 1VSKA 2OZSA 3VQDA 9ICIA 4FW2A 4KLLA 7ICHA 4CF0A 2NRVA 3LP2A 4LVSA 3RBDA 4FJMA 2V4RA 3V9SA 3PUFA 5J2MA 3V9ZA 4NLZA 5F9NA 4RQ1A 2Z1HA 3AVAA 5HHIA 4EBEA 5HBMA 2LSNA 3GV7B 4RU9A 4CFCA 1S0NA 2XY5A 4KI4A 1WCLA 3D0PA 4DQIA 5IIOA 4CE9A 5KFXA 5J2CA 1ZQUA 2Z1IA 2RDJA 2V9WA 2DPIA 3NF8A 2EX3A 3T1AA 2ZTDA 4KITB 4KN4A 2FLLA 1LW2A 4AH9A 3GIJA 4MF8A 2B6AA 3H40A 2XHBA 8ICNA 4I2HA 4G3IA 1T03A 1U04A 4CGHA 1TKZA 5KFLA 1BQMA 4CK1A 1IO2A 4I2JA 3MDAA 4J9KA 4DL5A 1D9FA 1S77D 1ZQWA 1TFRA 4DL6A 3ALYA 4O3RA 3F9KA 4ID1A 4DFPA 1KLMA 5J2NA 4FW1A 4LY7A 1WN7A 3SV4A 1S0VA 4I9QA 4C8LA 4KI6A 5HRPA 3MEEA 1IH7A 4CK3A 5HP4A 1A5VA 4FCYA 4JWMA 4DG1A 7ICOA 3DYAA 2RKIA 4R5PA 3HYFA 1T4GA 3ASMA 4RW9A 4OGCA 4DTPA 4P2HA 2F96A 9ICHA 7ICIA 3NGYA 5CA7A 1TAQA 4J9PA 3E01A 1RXWA 1ZBFA 1S9FA 4E0DA 4N56A 3WNFA 5BOMA 8ICHA 3SUPA 4CGGA 5KGWA 3LZJA 3T5LA 4WE1A 1FXXA 2WTFA 3QEAZ 4NM1A 3OS1A 4M6WB 1YT3A 4ED6A 1VK0A 4KPYA 4FS2A 8ICKA 4CEZA 1UT5A 1Z25A 1VSLA 1R0AA 7ICLA 3BQ0A 7ICKA 1EP4A 1C0UA 2KZMA 2HW3A 5KFCA 2C2RA 4DTNA 4HUEA 4DS4A 2NRXA 3C1YA 3O3HA 1BVSA 2HNZA 1QS4A 4DL7A 2X6NA 3MR3A 2BHNA 3SQ4A 4E7IA 3OYHA 2IA6A 3L8BA 1UA1A 1CLQA 3GIIA 1ZQYA 5IIKA 4ECRA 4CEEA 2RDIA 4ED2A 3C1ZA 1WSFA 4LH5A 5KFNA 3AU2A 4RNOA 1S6PA 5KRTA 3AV9A 1TKDA 1JLGA 2DFEA 3TQ1A 1FKPA 5DB8A 3KIOA 3AVGA 4CF9A 1DTQA 3V1QA 8ICBA 2XGPA 8ICYA 4CIEA 4K4GA 3BQ2A 1S97A 5KFMA 4HYKA 3QEPA 2G8IA 4GW6A 4KTWA 4YNQA 2PZSA 5DBBA 4FZYA 5L1KA 5JUMA 1VRTA 1RILA 3D45A 2QK9A 3HSTB 4KFBA 4KREA 1YVUA 4J9OA 1UOCA 3A2FA 3RTVA 2MUTB 5DDMA 3LP0A 3KLFA 4F50A 5DK5A 3MXJA 5CY4A 4O0IA 1TV6A 4QZCA 5J0UA 1RBRA 2NRWA 3AA3A 1KDHA 3C21A 2GUIA 3HL8A 3KTQA 4F4XA 3AVHA 3KD5E 1B92A 1T3NA 2AQ0A 1NOZA 5CHGA 1DLOA 4B9MA 4R65A 5L9XA 1N5YA 5BOLA 1X9SA 4P4OA 1ZBUA 1C1AA 3RMCA 4PY5A 4AHSA 4CERA 4Y1DA 3M8RA 2XY7A 1NKBA 4HUGA 4YVZA 4Q8FA 4YFUA 4HCBA 3CFRA 2OPPA 5DBCA 5DKWA 3TI0A 3RB0A 3MR5A 4DQQA 3G10A 1LV5A 3PMLA 3RJJA 3KD1E 4EZ6A 1S10A 3M9NB 4NYNA 3PVXA 4JV1A 4IQUA 3KJVA 3OSNA 4R63A 2PY5A 2PYLA 4H8KA 2IS3A 4B9UA 3OYNA 4DL3A 2BCUA 1ZQJA 4QZEA 3N97B 3DI6A 1TL3A 3K5NA 5J2DA 4XA5A 3LPTA 3RMDA 3RMBA 2YNFA 1ZQZA 1SKWA 4M04A 3NE6A 4Q8EA 4UQGA 4ED0A 3HWTA 4J2EA 3N4MB 4FS1A 4TUPA 2P6UA 2J6TA 4QZ9A 4B8AB 4YD2A 3TARA 5DBAA 2ZE2A 4M9NA 4Q5VA 3RWUA 2PFNA 4MFFA 3ETLA 4JV0A 2ATQA 5DQHA 4IQWA 4BE1A 2KN7A 5K14A 4JWNA 3RB6A 2BCQA 3AO2A 2W42A 4Z4HA 4HTUA 9ICCA 4RQ4A 2KZZA 5IIJA 1JIHA 4KLEA 3RJGA 4DTUA 4Y1CA 4YXJA 4KLTA 7ICVA 4IRKA 4J9RA 4DQPA 4AHVA 5KFUA 4RUCA 1NKCA 1MU2A 4FK4A 1RYSA 4UAWA 2UVRA 1RT5A 3BJYA 4I2CA 4YMOA 1ZETA 3VN5A 4CJFA 3LDSA 5J0QA 3T5KA 4FLXA 3RJIA 1WSGA 1ZQEA 3ZCMA 3NF9A 5DQIA 4CGJA 3NGIA 4XQ8A 3QEBZ 4RW6A 2WONA 3VQQA 3HPOA 1JXEA 4Z4FA 4RW7A 3JPRA 1EXNA 4KHYA 1VSFA 5C24A 1HYVA 4M41A 4CIGA 3SQ2A 4NYFA 2VA2A 2P51A 5HNKA 3QE9Y 1V9PA 4IFVA 4HCCA 3P5JA 4CJTA 4LZGA 2ZUCA 4BWMA 4DU1A 1BI4A 3KHRA 3EPIA 4I2FA 2I1QA 1NK6A 4ZTJA 4KB0A 5DDYA 4TSXA 4QZHA 5J2EA 2FBXA 4O5EA 1RTHA 1XSPA 3ZDAA 4LH4A 1D5AA 1X9WA 3NH2A 1DTTA 3OS2A 3C95A 4DFMA 1HYSA 3KHGA 4YCXA 5KFIA 9ICAA 5J0TA 1ZQVA 4NLKA 3QO9A 3AVFA 4DSEA 4KLDA 1ZQFA 4F4YA 1S1TA 3Q8PB 1ZBLA 2FBYA 4NLGA 1WSHA 5KFGA 2BQ3A 3ZT0A 4UAZA 1TV9A 3ZSQA 4NLNA 3F73A 1ZQPA 4O4GA 1W0HA 4FXDA 1ZQHA 3QZ7A 4Z4IA 1EX4A 2PFPA 4UB4A 5HHHA 3HX0A 3SI6A 5D46A 3WNEA 1IKXA 1IKYA 4YR3A 1LAVA 4DTSA 4FVMA 4FLUA 1RPLA 4ECTA 1WSJA 4JS4A 4M3YA 3PR5B 3ZD8A 1RDBA 4FM1A 4O9MA 2P66A 3C6TA 3IHQB 3DRSA 9ICJA 4AHRA 1HNIA 3TABA 1LB2B 4HUFA 1QLNA 3ZSZA 4FJ5A 4NCBA 4Z4GA 5D3GA 4PGQA 4W5TA 2ZD1A 4TQRA 2VG7A 3GIKA 3GQCA 1JLEA 1L5UA 2V4QA 2ZQBA 2IBKA 3MR2A 2IMWP 4CF2A 2G8HA 5I3UA 3PNCA 1ZQRA 2J6UA 2P1JA 1BQNA 4P4MA 1VSIA 4FM2A 4RNMA 3SQ1A 1DGSA 3QINA 1JMSA 3QZ8A 4YMNA 8ICWA 1MC8A 1NK7A 4B9VA 4B3OA 1COOA 1ZQDA 3NF6A 2YNHA 3MECA 3SJJA 4CJ4A 4KLGA 1K1QA 4CEDA 3GV5B 1KLNA 4F93B 4Q45A 2G8FA 1QSSA 3OYJA 4FLVA 5J0XA 3TAMA 2JEJA 5J0SA 3NF7A 3OYLA 1C0TA 3OYAA 4ECUA 2IHNA 3GIMA 4M6WA 4F92B 4CGDA 4OKKA 3DLBA 5CYMA 3VQ7A 1TL1A 4M9LA 3VQ9A 2QXFA 4KHNA 4OGEA 1X9MA 2KW4A 4M3RA 4CK2A 5T7BA 4QOZB 1BIUA 3G6VA 1JLFA 5KT5A 4I2IA 3QESA 1D9DA 1RT2A 1KFTA 4F2RA 3P83D 3V9XA 4DOCA 1U49A 3OYFA 2ISPA 1J53A 3H4DA 3FYHA 3TR8A 5E41A 2BQUA 5IIMA 3LPUA 3AO5A 5J29A 2D0CA 4MQ3A 4IKFA 3ZSWA 4ELUA 4F3OA 4KLHA 4OKEA 4QZAA 4MFBA 3OYCA 3V81A 1RT1A 4KHSA 3QEVA 2DPJA 3M8PA 1BPXA 3LAMA 5J2PA 4ED7A 5EWEA 4I28A 5KFHA 4X5VA 5C5JA 3OYEA 4DTRA 2ALZA 3M8SA 4DOBA 4QZGA 4RW8A 4M3UA 2HNDA 4F5OA 4CCHA 2JLEA 3B6PA 3UXOA 3AVMA 1MQ3A 2OA8A 3QLHA 1IXRA 2MUTA 4RNNA 4QWCA 1X2IA 2YHAA 4RG8A 1VSMA 4Z6FA 2ATLA 4ZH4A 1SV5A 2MAXA 5HLFA 4PGXA 8ICFA 1UWBA 2ZJAA 2YHBA 2E6MA 3OJSA 5D4BA 3KKRA 8ICXA 2R8IA 4EP5A 2FBVA 3ITHA 3EWAA 3MGHA 2AQ4A 4JLHA 4CJUA 2FBTA 4M42A 1S0MA 3CQ8A 2FMSA 3ZSXA 4R8UB 1IKVA 1Z3EB 1T05A 3GFKB 2E4LA 3LDAA 1NK8A 2W8LA 1U4BA 3ZT1A 1QQCA 2B21A 4DTOA 4QZBA 4M3WA 4M0AA 2W9AA 4DSFA 1XS9D 4CFBA 4FLYA 3AO3A 9ICWA 1X1PA 4ID5A 5HMLA 1S76D 5KFYA 3DLGA 2VWKA 4QWEA 2A1SA 4KB1A 4LZDA 3IS9A 2R8GA 4CECA 4IQVA 4ED3A 4E7LA 2BPCA 3EZ5A 4BDZA 3H7IA 4KLUA 3OGUA 4IFYA 2PI4A 4BGDA 1HRHA 4ECWA 4M3ZA 3SV3A 2B4JA 1HJPA 3L2WA 1BPBA 2DFFA 4PHDA 4CHNA 3RMAA 4EP4A 2IDOA 1HMVA 3L2QA 2X78A 5J0WA 3LP1A 5EOZA 4B9TA 4FK0A 4IBNA 3JPQA 4FJGA 4Q44A 1BISA 3FDSA 1U48A 3Q8LA 3PX4A 1CZBA 4ELVA 1ASVA 1JLBA 3L2RA 3O4QA 4UB5A 4I2GA 3MFHA 3RJFA 8ICAA 4IR9A 1S9EA 1JL1A 1L3TA 1L3SA 4NXZA 4JS5A 1QE1A 4KRFA 3KK2A 4DS5A 3H08A 3ZT2A 2AGQA 4IR1A 9ICQA 4N76A 1KRPA 4MEYA 5KFAA 1UA0A 4W5OA 3V7LA 4E7HA 5FRMA 3JSMA 3VQPA 2OZMA 1S1UA 3ISCA 3KHLA 1GOBA 3MXIA 2R8JA 2LYHA 2OPSA 4IRDA 3DRRA 2C2EA 3U6FA 1SKRA 8ICPA 3RRGA 1KTQA 2HNYA 3K5OA 4HHTA 3RH4A 1RT4A 4GXKA 1JX4A 4XRHA 3OYMA 5KFPA 3AU6A 3L3UA 4W5NA 4RZRA 2C2DA 4BACA 2EHGA 4K4HA 3MDCA 1JLQA 1AROP 1NK5A 1VRUA 5KI6A 3B0YA 2KQ2A 2AGOA 3VQ8A 3G6YA 7ICFA 2JEIA 4KKOA 2M9NA 1JLCA 2FC0A 3V6DA 2RN2A 1S0OA 4BXOB 9ICBA 4EYIB 4C8NA 7ICRA 4FLZA 2VANA 2BR0A 4CJKA 3JPSA 2W9CB 3VQAA 3TFRA 2O4IA 1IM4A 8ICMA 1Z00B 2IOCA 1NJZA 4P4PA 4F4WA 3VQ5A 4O5CA 2VA8A 4PPXA 1CZ9A 4J9MA 2XCPA 5KT6A 4I2DA 5C25A 2PI5A 2F1IA 4DMNA 4RQ8A 2R8HA 2HVIA 1L3VA 1UAXA 4ECYA 4FJJA 4I2PA 2A1JB 1S1VA 4BWJA 5DGBA 3M9OB 3DOKA 2XY8A 2VA3A 4Z4CA 2DFLA 3UXPA 2BCRA 9ICFA 3MAQA 1VSEA 4CHZA 4O5KA 1ASUA 4J2AA 2FPKA 2BGWA 2PFQA 1ZQIA 4RPYA 4DLEA 5J2GA 4O5BA 2JZBB 9ICLA 5KGXA 3HJFA 2JEGA 4BE0A 4Z4EA 4DL4A 2FLNA 4FJIA 2HB5A 4OPJA 1KVAA 1SL2A 8ICEA 2XO7A 4O3NA 3CFPA 5CR0A 3V7KA 4CHQA 3V1OA 1QHTA 4KV8A 3RJEA 1XC9A 1WNSA 2Q3SA 1N6QA 4RQ3A 3C94A 2VWJA 2QKBA 5DLGA 2F8SA 4OPKA 3KLHA 1J5OA 1RZTA 1IG9A 3HVRA 3TAPA 1G15A 5J0RA 3ORYA 4MEXA 4K8ZA 1RT7A 2GBZA 3AO4A 8ICOA 2HHWA 2Z1GA 1A77A 3SNNA 4KLMA 5KFVA 3KK1A 3UIQA 2YKMA 4NY8A 2BGGA 3NH1A 2ZUDA 2IGIA 4RT3A 2I5JA 4NCGA 3K5MA 4RQ6A 3LANA 5TZVA 1U9LA 4CHYA 3PX0A 3K59A 5DGAA 2HHXA 1CXQA 4QCLA 4R66A 1BPDA 4EBCA 5KFZA 1DOQA 4M9HA 3NTUA 4M9JA 4JRQA 4F5QA 3JYTA 3ISNC 3KLEA 1NOMA 7ICPA 5KFWA 4CESA 1HYZA 2HHVA 4G1QA 7ICGA 1NJWA 3OYKA 1RDCA 2PXIA 3AVKA 4JV2A 4RPXA 3C5GA 3AA5X 1RDAA 3Q8KA 5KG2A 1HNVA 4KHUA 2UVVA 2IHMA 3ZDBA 4DU4A 4B9LA 1RTJA 2H5XA 9ICGA 3AVIA 2BQRA 4CJ3A 4CJEA 2NUBA 8ICZA 3MGIA 5DG9A 4CIFA 1Y88A 3B0XA 2E6LA 4QZDA 3DLHA 3K58A 5J0OA 2AGPA 5DB6A 4XIUA 3JPNA 4TUQA 3ZT3A 1S9GA 5KFJA 9ICOA 3V72A 1ZQNA 4RPZA 1WSEA 3S9HA 1XSLA 2G8VA 4BE2A 4F91B 3ISDA 2DY4A 4EEYA 2G8KA 1XHXA 3HM9A 1RBTA 7ICSA 3H8SA 3V9UA 1C7YA 2C28A 1KFSA 1B43A 1A5XA 4CEQA 3TAEA 5DB7A 3KHHA 2ZTCA 4KTQA 4ECVA 4DOAA 5CWRA 4PGYA 9ICTA 4PHEA 1LAWA 5L1JA 1VSDA 3OYIA 2NRZA 1UT8A 1C1CA 5CJ7A 4MF2A 3WNGA 7ICMA 2FMPA 3SUQA 5FDLA 2BKEA 4ECQA 1NJXA 3CG7A 1LWCA 1W9HA 4M9GA 3AUOA 2IC3A 9ICSA 4GXIA 3EYZA 1MQ2A 1A5WA 2OPRA 5KG6A 1RBUA 4EBDA 8ICSA 4MFAA 4ECSA 1ZQOA 4YXMA 4CJWA 5KT2A 4CHPA 4PHAA 4KMUA 3V6HA 3RR8A 4J9SA 5DG7A 5F9LA 1ZQMA 4FLTA 3NFAA 1Z26A 4O3QA 4FJHA 4QW9A 1B9FA 1EKEA 1QSLA 4DLGA 5IIIA 1S6QA 4F5RA 3P1GA 4B9NA 3V6KA 4R8UA 4ELTA 2DTUA 2ZJ8A 4QAGA 2VG6A 3EPGA 4UB1A 3WNHA 4YD1A 3ZSOA 2R7YA 4L8RB 3HPHA 3GILA 1FK9A 4ZTFA 1TK5A 3TFSA 2G8WA 3S3MA 1HUOA 4J9NA 5KT7A 1XWLA 5FROA 3CM5A 5JS2A 3QIPA 4QWAA 3PW0A 3S3NA 2FPMA 2BPFA 2GV9A 3IAYA 4FJKA 2BPGA 2F1HA 3PO5A 4ED1A 4DSKA 4M45A 2UVWA 4DSIA 4NCAA 1RXVA 4RQ0A 3SZ2A 2FLPA 2P5GA 3Q8MA 1T8EA 1VSJA 3PO4A 5HP1A 4RQ5A 2YNIA 2HHQA 2P5OA 4PH5A 4CJVA 1F21A 2YNGA 2BCSA 4CF1A 1TVRA 3NBPA 4K8XA 3ZSYA 1GOAA 1WCNA 3O3GA 2RF2A 3RH6A 4KHWA 1Y97A 2F8TA 8ICRA 4XUSA 2YV0X 3MEGA 2R8KA 3L2VA 4N47A 1WSIA 5SWMA 4CJLA 3KK3A 4FJ8A 2Q0ZX 3C5FA 4KLQA 3CM6A 3DMJA 4JUZA 1TVAA 3MEDA 7ICNA 9ICMA 4CGIA 1ZBIA 4PQUA 3MR6A 4W5RA 3LALA 5KG3A 3DLRA 4FJ9A 3C2KA 4TURA 4CFAA 2W9BB 3CYMA 7ICJA 2JEFA 3VQEA 1BCOA 4F2SA 1O1WA 4CJQA 4ECZA 1HQEA 1REVA 3RR7A 5D49A 3OS0A 1LWEA 4DEZA 1H38A 2HHSA 4F3TA 4KLOA 3ZSRA 3HP9A 3TAQA 4I9LA 4DWIA 5CB1A 4CEAA 4DSJA 3V1RA 4CEBA 1N48A 4I27A 1Q9XA 4JK1A 3RBEA 1EETA 1TKTA 2C22A 1B9DA 1BPYA 2PFOA 1LWFA 1D8LA 4M47A 3LWMA 3TANA 1CEZA 4C8KA 4DQRA 1GOCA 4KHQA 4W5QA 4QW8A 2IAJA 1C1BA 2QKKA
chains in the Genus database with same CATH superfamily
3ZO7A 4O3PA 5KPTA 2AV5A 1X6JA 5A8RB 4FF4A 5KG1A 4CZMA 1F1BB 2KDOA 4IDKB 1E6YA 5C42B 3KLGB 3VQCA 5J2KA 2W9CA 5HATA 2H48B 4ICLB 3AXKA 2HBKA 2MB0B 8ICIA 1Z00A 2G2YA 1BA0A 5KTQA 3SUNA 2RHFA 1U1LA 1X60A 1B0TA 5F8GA 4YDUC 2NRTA 4F3QA 2BH1A 2F65A 3PSPA 3G0ZA 3OYBA 2W9MA 5KFBA 1GT8A 3FKBA 3CTRA 2OHFA 2MLXA 2V4JA 3SK3A 1HWUA 3MBYA 2OGUA 5HBMB 3UN2A 4PWDA 1HHQA 3QJPA 3HVTA 3CERA 2FVQA 5TKWA 1SC6A 1XJWB 2ZBIA 5L1IA 4PXEA 1N0UA 4N41A 2DGZA 3AOAA 3GBTA 3I8DA 4JI2F 4KAZA 2JZBA 3SAGA 2JGUA 3T1YF 2CADA 4GKKF 1FW6A 3HO1A 5ALTA 3SUOA 2P5VA 1LW0A 3PXGa 5EWFA 1LW2B 3FMBA 4B1XB 5M1NA 1ZA1B 4PHTX 3HT3A 2KKZA 1T03B 4DFJA 5CZ2A 3LL3A 3O3FA 2EKNA 3LK9A 1IVZA 1BU6O 2F9WA 4J9UE 3OUYB 5L8RC 2EWHA 5AI4A 3QERA 1TE2A 2AYGA 3CCQN 2UUAK 3C29A 4OI1A 2HAIA 3OYGA 3QSYB 3S3OA 2BOPA 4MYTA 1HNXK 4Y65A 3KJFB 4BRMA 4FXWA 4CI0B 4X4VA 4OX7A 3Q22A 1KQSM 3BBFA 3ID6A 3UNYA 2OPQA 3QEXA 3VQ4A 2ZH8A 4KTZA 2MHNA 4WYLA 4IOAQ 4QZFA 3TJ8A 4DR3F 5DO2A 2LYAA 1RHKB 2L9WA 2MU2A 4C23A 3H5SA 2NYHA 4WE1B 3J80Y 3CCLN 1XERA 3DXKA 3C2MA 1KNZA 1YK9A 3VPZA 3IGNA 2ZJRL 3NGUA 2BCVA 4X62F 3SYZA 2DKXA 4OVLA 2GFFA 4RT2A 3R7BB 3U1LA 1T95A 1XEZA 4LRFA 5A0LA 1R0AB 3F2BA 3RG6A 3H0MB 3A8IA 3MXMA 3BGOP 3PV8A 4HVJA 4J37A 2GV1A 1C4AA 4DTJA 1EXQA 2VJ5A 2UUBJ 1QZ6A 2E9ZA 3NKYA 3RB4A 2W04A 3AQPA 3D67A 5E33A 4CEOA 3SCIE 5I42A 3FSIA 5KG4A 3VTHA 4ILMA 3PSTA 2IY5B 4AYBC 1S59A 3OVBA 1DT9A 3FVYA 3OSPA 3VGSA 4ZITA 1RBSA 8ICTA 3O4WA 3PHTA 2LEAA 1WEYA 1FDDA 1WBBA 1KVCA 4FWOA 3P4IA 3T19A 2HQGA 2DNLA 2P2CB 3U1MA 3K0JA 4NMXA 3QNMA 9ICXA 5DMRA 2HWIA 4RPFA 3EX7B 2CZVC 4QIWF 5AM0A 2AJ2A 1E3MA 3H8YA 4MT1A 4USUA 4KGXB 3KVGA 2J9EA 2ZIUA 3ZDDA 3JSBA 1HEKA 3NH0A 4GVMA 4Z6CA 5AM5A 2X3GA 2C3UA 2KHQA 2MQPA 3TEHB 2EXUA 5KFDA 1RWUA 3OHBA 3LP0B 2HHUA 1WC1A 1JROA 2UU9J 2E3TA 1VMBA 4LRAA 3HW8A 4FLWA 1VQ9S 2PMZD 1V85A 4AHTA 3TKAA 9ICVA 5IT9Y 4PL8A 1XR7A 1TV6B 4WWSA 1U1OA 3DLLQ 3VETA 2K06A 4Y2VA 4ZVPB 4E19A 3QETA 1V3ZA 1HNWK 4O23A 3UPQA 5D4OA 4LF4K 1CUKA 1ZQLA 1LFWA 1UKUA 1DLOB 4KRWA 4U95A 5F0WA 1PILA 2GW8A 4Y2TA 5J0PA 3H46O 2MQMA 4JK9A 1OSDA 2WOMA 4ZPCA 5LMUK 5L1LA 1FCAA 2P35A 2KD1A 2A2CA 3SJHA 2MJUA 2BANA 1HJOA 1M5HA 3A13A 5IXUA 1NJYA 5J2AA 4A5AA 3UKUB 2IRUA 5CAAA 4UQTA 3Q8RB 2QM1A 1FJEB 4I2QA 3KJVB 1M1KO 4CFDA 3EZOA 2X1GA 2Z2LA 4C9DA 3K9JA 1I39A 3C2LA 2MY8A 1LK7A 3OYDA 1DHMA 1X4GA 1U2FA 3UVJA 4CTAA 4EIAA 3TVZA 3IRXA 2LVWA 1FRKA 1SJFA 3UQ2A 3PW7A 2E5LJ 3NHGA 4M3XA 1F9FA 2G0AA 1HJRA 2DWQA 4KLSA 4Z94A 4UAYA 2DNZA 4HEA9 2ASLA 1HQ2A 3TR5A 4CLUA 9ICUA 3NNHA 2Y1LB 1TK8A 3V4IA 5KFQA 5KT3A 3NCPA 3M2UA 4O55A 3GSIA 1T3VA 1ZAWA 2QV6A 2CVIA 3H59A 1HD0A 3TU5A 3Q89A 1XMOK 3CHWA 2ATCB 5DLFA 1ZQSA 4P75A 1SL1A 4UBBA 3NWGA 1VQSA 3JTOA 2PYJA 3UXNA 1Q0NA 3P49B 1MDUB 5KL8B 3EXYA 2BE2A 2IVYA 2BDPA 4IH5A 3Q83A 1IWGA 4CZGA 2KHVA 1BHLA 1XSNA 1QSYA 2KZ3A 3PRVA 1BIZA 3HBTA 2KJ9A 4DX8H 1PO6A 8RUCA 5CD4H 1RT5B 2AT1B 4DMZA 3F2KA 2ZKTA 2C2OB 4B02A 3WK4A 2ALYB 3PX6A 3B4DA 1DAXA 2IRYA 1SIWB 3AY9A 3E3XA 2D3ZA 2MZJA 3EE8A 2LM4A 5AKLA 2DGWA 1B3TA 4G6VB 3H4BA 3NEKA 4M8LA 4QR1A 3UQ0A 4CEFA 3DXMB 1T9WA 3I5CA 1ITPA 2O3DA 1KVIA 3DXBA 2WONB 4ED4A 4EHUA 4RW7B 1FFSB 2E8OA 1Z1BA 3ENQA 2YMQA 1SKSA 4A8XA 1FXDA 4PUOA 4YS2A 3ZLJA 2K1RB 1IBLK 3T1HF 3MMVA 3MAAB 3Q8SB 1Q79A 1NM2A 2MSSA 1UFKA 4I2AA 3ZDEA 5HVHA 2WVEA 4H0TB 1CXUA 2F4VJ 1XUPO 1PVRA 4DFDA 5F3ZA 3LP3A 3ISBA 3L95X 5IINA 3GDXA 3UB5A 1HI1A 3HI9A 3LZIA 3AA4A 3ULDA 1R8PA 3D6TB 4ZKAA 4FJXA 3G6ES 4LF5K 3LVVA 1MMNA 3PTWA 4YMMA 2CYYA 2OZSA 9ICIA 1ACMB 4ID8A 3L09A 4CF0A 2BRLA 2MGZB 2ZGZA 2DO4A 5BXIA 1SXDA 2V4RA 3EVMA 4LF7F 3UKRB 5F9NA 2Z1HA 3DJCA 3AVAA 5F8NA 4LUBA 3M7VA 3O1WA 4EBEA 2LSNA 2ZNYA 1KTVA 1Z6RA 3OVAA 2I7NA 2XY5A 3D3BJ 4OI6A 2WB1C 1XNRJ 1ZPWX 1IKYB 4CE9A 3W0LA 2KVCA 3ATUA 4K5SA 2V9WA 1E6VA 2X1AA 3NF8A 4BC7A 4HI2A 5B8HA 3CJ3A 2ZTDA 5KL1B 3ZI4A 1FEZA 3GFYA 3KDNA 2VFSA 4CO5A 5ALVA 4RQNA 1U1NA 2R7RA 4IC9A 1P90A 2AZ1A 1CQNA 1HNIB 3VV2B 3R5CA 2VASA 4NX9A 3Q8VA 1TKZA 2DNQA 2PMZF 2WW4A 1BQMA 4JHDA 3GJSB 4HAIA 1IM6A 4I2JA 2N3LA 1S77D 4X66J 1IO2A 3C6AA 1N52B 1TFRA 3F9KA 1BY9A 3C28A 4DFPA 5J2NA 2L9NA 3QBCA 2QA1A 3SQGB 2E1MC 3TVKA 1FKAF 4C8LA 3OBYA 2CPHA 3NVWA 4Y6IA 4CK3A 3M6KA 1A5VA 1GX6A 4DG1A 1S4FA 3W1YC 4R5PA 2RKIA 1FRHA 2EWSA 2P6TA 1D9AA 1T4GA 2YXLA 1X5TA 1T44A 3ASMA 3MECB 2DJWA 3TX8A 4DTPA 4OYZA 4P2HA 3H98A 2IIHA 2A41A 7ICIA 3HHKA 1WYGA 1U09A 1RXWA 3TAMB 4MAKA 4CGGA 4TY9A 3N4QA 4FN5A 4X4UA 1CPZA 3F5AA 2OTJN 3LA0A 1SC1B 2OSRA 3OS1A 4M6WB 2VKQA 4KPYA 8ICKA 4I6YA 2RIJA 2R42A 1NI3A 3MD3A 4LF8K 1UT5A 2F9JA 1VSLA 1NSKL 2KZMA 4DTNA 4DS4A 2QB1A 2WF6A 3O3HA 3GZFA 1RT2B 2E8AA 2ILYA 3WK9A 5KNIA 3BKUA 3P8BB 2X6NA 3MR3A 5AM3A 4OZ5A 1YLXA 2R7SA 5IC6B 2BJEA 4OX9F 5AE2A 2RDIA 2X51A 4A8OA 1JALA 3FBEA 1D1UA 3CVKA 1GXTA 3VAIA 4TU8A 3AV9A 1FX2A 4LFBF 2KI2A 1YJ9S 4FP9A 5DB8A 4DR4F 3V1QA 5J2PB 2VFRA 1F60B 3RRKA 2O8FB 4MKYA 2X1BA 1O0PA 1SJ4P 4EHTA 1HWJA 4BG9A 4LBPA 1SQGA 2PZSA 2XZWA 4FZYA 5L1KA 4CZHA 1VRTA 5HSPA 1RILA 1QVGR 2CDRB 4AM7A 3A1YG 3NVVA 1N54B 3QLHB 4NMLA 3AY0A 3RTVA 5F1XA 1VQOS 2B9WA 3F56A 4OJ3A 4XDDA 4F50A 4AYBD 5ETSA 1SV5B 3MXJA 1ZBTA 2JHEA 4LREA 3HSZA 2F40A 2DYAA 1RBRA 5HMZA 2ADBA 2EAMA 1DK3A 2Y9UA 3AA3A 1KDHA 4V19J 4K42A 4LFAF 3FRYA 4BRNA 1FRXA 2HEKA 2I1RA 2QO3A 1COKA 4DV7J 3HL8A 2IVPA 1U6FA 5H9EJ 4HI1A 1IKVB 1TL4A 4K4UA 1B92A 4K0KK 3A8EA 4TKTA 5BOLA 5K8OA 2FVRA 3HZ6A 4GVBA 1NKBA 3EGZA 3R9KA 5D6GA 1IBKK 3N79A 5E84A 4Q8FA 1TP7A 2YH0A 4HCBA 4LF6F 2HBMA 1WHWA 2QLXA 2Y8YA 1XC3A 4ZOSA 2N82B 1LV5A 3PMLA 4DR5F 3IS9B 3RJJA 4R0EA 3GLJA 3BO2A 3KD1E 1I94K 4EZ6A 5H9FJ 1S10A 3M9NB 4CO3A 3GL1A 4UW2A 3OSNA 4R63A 4F26A 3D2FA 5AK4A 3SEIA 5C15A 3OFGA 3TW0A 2HHHK 3ETOA 4NEYA 3M2RA 3NMUA 3LP1B 1YGYA 1K5OA 2DBBA 2GELA 3R6MA 3PCOB 4HACB 1IBMJ 1J2NA 3KWGA 4BGAA 1TL3A 3K5NA 1N61A 2HS0A 2COLA 5HR7A 1ROFA 3MUVP 1RHMB 2Q66A 4DV6K 4M5DB 2P9UB 3ONQA 4M04A 3NE6A 4ICAA 4Q8EA 4UQGA 5K5MA 4OPAA 1FNXH 3N4MB 4FS1A 1FA0A 1YJ9N 1U2VA 3PM9A 5BN8A 1MROA 2HF4A 1Q5YA 5GAEU 4PG8A 2BJ9A 4O5FA 3RWUA 1GFWB 4JV0A 2GMLA 2OTLN 2MKSA 2JV3A 1Q8KA 4DN9A 1NBWA 3RUBL 4NLXA 1FDAA 4Z4HA 4HTUA 2EG1A 9ICCA 1FT8A 3RJGA 2QX0A 1HKBA 4Y1CA 1VQON 2WSCC 3IG5A 7ICVA 2O8CA 1EJ7L 4J9RA 2IYIA 2JHDA 4ATNA 2JH3A 4RUCA 4KHMA 2V51B 4NWIA 3MHYA 2LXIA 1SC3B 1QAIA 3MN5A 2E7WA 2Z58B 3ZZYA 2ZJPL 1VRUB 2ES6A 2OEJA 5FPDA 3VN5A 3KG1A 3CNHA 3T5KA 4JOUA 3HTVA 1RAJA 4YY3K 2JVOA 4CGJA 3BSAA 1Q7LB 2MZTA 3QEBZ 3WDOA 5F0UA 3U26A 1JXEA 2WUSA 4Z4FA 4RBUA 3JPRA 5HMWA 1EXNA 1KS2A 1Q95G 1HYVA 1YRXA 3L3CA 1NDPA 2WFBA 1KW4A 1KC8O 2VV5A 3UE2A 3HZEA 3QE9Y 4NZ6A 1BE4A 3O8MA 4AD6A 4U7CA 3P5JA 3FRZA 4LZGA 2CQIA 4NB4A 1VQ8S 4D3GA 2NYIA 2C3MA 5B08A 2Y0BB 2G5HB 1N34J 2NSBA 5C25B 2XI9A 2ZG6A 3LM9A 3ZETA 3CCTA 2GC8A 3UWTA 3CQYA 4M95A 4QZHA 5J2EA 3F41A 2XMMA 1RTHA 3DOKB 1E4GT 4WYBA 1HW8A 1BQXA 1RBLA 3S01A 4CVNE 1SH3A 5ALOA 4NXMF 2VPZB 2KJWA 3P5TL 2B7BB 5IOLA 1ZQVA 2E8PA 4DPXA 1KR4A 2XI3A 1ZQFA 3BDEA 2DR9A 4B1WB 3HDSA 2K4EA 2H54B 1WSHA 2C2MB 4C7QA 5K8MA 4DR1K 4I56A 4UAZA 3GB0A 3R7SB 1TV9A 3ZSQA 2IVOA 5ALDA 4NLNA 1WOSA 3P31A 1XTZA 4FXDA 2W40A 2P9PA 1WC0A 5AKKA 1Y0HA 1WC5A 1RWPB 3QYYA 1WEZA 1N32J 3SD7A 1IKXA 4M63C 4YR3A 1J5OB 4FLUA 2LI6A 4ECTA 4YDDB 4JS4A 2IM2A 2OJ3A 3H3NO 4M3YA 4A61A 3M8YA 1RDBA 3POTA 3ZZ0A 1YBAA 1VQ6N 4Y2UA 2U2FA 4H4KA 2Z57B 2BX6A 4AHRA 2YWFA 1EQ0A 1RAFB 3PYEA 4UAVA 4FJ5A 4Z4GA 5D3GA 1DY3A 3MN7A 4W5TA 3AJ1A 4WZMA 4M5GA 3QUQA 2C1EB 2ZD1A 4BC2A 2VG7A 3QMQA 3GQCA 2O6KA 2IBKA 1HPMA 3QU7A 4CF2A 3MAHA 4JYAF 3PNCA 1VSIA 1P8GA 1JMSA 2UUAJ 3JYTB 3KLEB 4FZLA 2ZJQQ 3WT0A 2WB1D 4WK3A 1MN7A 3THWA 3QDKA 3NF6A 2VFUA 4MLHA 5EN1A 3SJJA 4KLGA 4X84A 1O51A 2BV3A 2LQ5A 1SXEA 4F93B 3CW2C 4Q45A 3EE3A 2HURA 2KNJA 4KX5A 3MOJB 1WSRA 2L48A 2JC0A 3L4PA 4YDXA 2L41A 2CQBA 5AQZA 3DU5A 1C0TA 3OYAA 4CO2A 4ECUA 3GIMA 3UI3A 3UVJB 3THPA 3SAHA 5CYMA 3J81Y 1QY7A 1TL1A 3VQ9A 2QXFA 2DGSA 4DR7K 4DCJB 1BIUA 4DV5F 1S9GB 3PEHA 1YIJS 4DZDA 3QESA 3WIUA 1VQLN 2EZZA 1KFTA 3P83D 1NGAA 3PSFA 3TUJC 3WXJA 4KX3A 1I1GA 4B1UB 4UZBA 1RDUA 2BYCA 2DEJA 4IOXA 4ZVGA 3FYHA 3M8ZA 4JI7F 3ZSWA 2W24A 4ELUA 3W2VA 2JXJA 4MFBA 3V81A 3O6QA 1QQMA 3QEVA 1SJQA 2DPJA 2UUCF 3M8PA 4BCAA 4ED7A 3Q8UA 4I28A 5KFHA 3CUNA 5C5JA 2YMLA 3QWPA 5HK4A 2EFPA 3CJ9A 2ZF5O 4YMEA 4JI4K 2D7SA 3L7PA 4RW8A 2P9NB 1YVNA 4M3UA 3C15A 4QS9A 3MD1A 4F5OA 2AKWB 1KD1T 5AT1B 4YOWA 3UXOA 2V34A 4FOIA 4C4RA 1IXRA 2W4PA 2MUTA 4GRSA 4QWCA 1FVQA 4M5MA 4RG8A 2QB0B 4OYPA 1UWBA 2E6MA 2Q3PA 5D4BA 4RUBA 3BS5B 2R8IA 3JAMO 2FBVA 2O8BB 3ITHA 1HW9A 2A6AA 3MGHA 2AQ4A 3J7YU 4IFEA 4BVPA 1S0MA 2EFGA 3ZSXA 2YN4A 3D2SA 2YVSA 4JI6F 1Z3EB 4GKJF 3FEZA 2E4LA 4DCCA 1HNWJ 1NK8A 2VFVA 5IZHA 4QU6A 4P2MA 5LXYA 2B21A 4DTOA 2DHXA 1Y00A 1JJ2M 2QEXS 3AFGA 5LY3A 1XS9D 4JI0F 3BUZB 3AO3A 1X1PA 3O5BA 1FI4A 2RRBA 3G9CA 4QIGA 5F8HA 4DUYK 3IN5A 4NWBA 5KFYA 5E5NA 3AN1A 4QWEA 3R5AA 4P0PB 5ETNA 4IQVA 3EZ5A 3BF3A 1FESA 3CC2S 4BDZA 3OGUA 2PI4A 5HP1B 4C3LA 2CNLB 2FJXA 4EUVA 3SV3A 3T9ZA 3L2WA 1BPBA 3OFFA 2FJBB 2KT5A 2VKZG 4PHDA 3NBPB 3RAMA 1Y5LB 1N5TA 2IDOA 3KFWX 1HMVA 2CXEA 3HCXA 2RF2B 3UR3C 4AQYK 2VJ4A 2GWKA 3BR9A 3FDSA 1U48A 4E2FB 1YIJN 1JLBA 1T9VA 2PKEA 1V5VA 3L4BC 3I33A 2E5HA 3MFHA 1WF0A 4RR5A 1LEOA 2GX8A 1M6YA 4IR9A 1RDRA 2OAUA 4UOCA 3ZTOA 4NXZA 2MSTA 3VF0B 5B5EU 3KK2A 2DTJA 4DS5A 2CPFA 4FYWB 1N33J 1OIAA 2W01A 5KFAA 1B7YB 2DR5A 2R7TA 2KG5A 3MUTP 2U1AA 3PYDA 2XSJB 5F41A 4AL5A 3ISCA 2BOAA 2LYHA 3AAWB 1REVB 4IRDA 3EEQA 3RYLA 1NEEA 1MWKA 4LC9B 1OQ3A 5D15A 1XMOJ 4HH0A 3RRGA 2YB4A 5LT5A 1KAYA 3MM6A 4MKAA 3K5OA 2AXTU 3RH4A 2VC1A 1T9XA 2LMRA 4QPXA 3OYMA 2YPZA 2KXFA 2CDQA 3AU6A 4P7TA 2G4BA 2EAOA 1Q4RA 4RZRA 1SC4B 3K2YA 1ZAVA 4K4HA 1Y5IB 4BY9C 3OBWA 1NK5A 1UCVA 3B0YA 4CIOA 3OV7A 3F5EA 1IXKA 1NLVA 2VQEK 3RU0A 7ICFA 5GMKa 2QRRA 3BREA 1N8RT 2ZXIA 3QJLA 5D0RA 2PGCA 3HKZF 1DXSA 1R8AA 2WB1F 2UUTA 3M32B 4BXOB 5AQNA 4CJ7A 4C8NA 4FLZA 4B3RJ 4CD1A 3T6BA 3TFRA 4F7VA 3C65A 3TSUA 1BO5O 5IWAK 2QEXN 3F44A 3C7NA 2ABYA 1WI8A 2ASMA 4F4WA 4O5CA 1VJWA 2XYGB 1IBLJ 5HOOA 3A5OC 4GV3A 3HSCA 1RM6C 4IQXA 2JC1A 1VQPS 2JVRA 3CCRS 3HHNB 1SV0C 1CJUA 4ECYA 4FJJA 2P9CA 2I5HA 3HMJG 5CYQB 4DV0K 2VA3A 3CMAS 1L7OA 2BCRA 9ICFA 4ZCKA 4CHZA 2B7CB 3R5DA 2R7WA 4ILJA 4DLEA 9ICLA 2JEGA 5M1FA 1ZH5A 3TPQA 2H65B 1K73T 4BE0A 4FJIA 3DLKB 1M90T 4ILGB 2CQ2A 1WG1A 3HHLC 1O08A 5EUHA 1H6KX 2CQCA 1R8BA 3TZXA 3CFPA 4IO9Q 4CHQA 3V1OA 4KV8A 4RW4B 3UN5A 4RJVA 3UD4P 1N6QA 4RQ3A 3C94A 4WF9L 2ZWHA 4IJNA 1W7WA 1HWLA 5DLGA 5KPRA 2QE5A 3O8WA 4FDFA 4CM2A 2MRLA 1OJ4A 5J0RA 4MEXA 1N5QA 1Z4NA 2ROEA 1R6VA 5AKEA 3D54A 2GJIA 1A77A 5HMYA 5KFVA 2P9EA 3TACB 4DUZJ 1ATSA 3KHYA 3I56S 3NH1A 4DR2J 2DXDA 2I5JA 4WFZA 3J7A1 4RQ6A 4ZHRB 1BXNA 4B17A 3F2DA 3SDEB 4GMKA 5AQYA 4PQAA 3K59A 2W25A 3CC4N 4R66A 4WJBA 1JJHA 2N4CA 5KFZA 3IBWA 2MZSA 5AQGA 2F4FA 4CESA 1JCEA 4G1QA 1BC6A 4DI6A 7ICGA 3NRBA 3Q2SC 4W4MA 2B5JB 4P10A 1Q3UA 2OM6A 3VOVA 4GIBA 2M0GB 2E44A 4JV2A 1PYTA 2QA4G 5CXTA 2DGOA 1DJ0A 1Q53A 2VDIA 4YB5A 4QS8A 2UVVA 2HVDA 2IHMA 1RTJA 4IOBA 2D0OA 3FZLA 2DHSA 3WXKA 1YUWA 2NUBA 2NXNA 1V4TA 1VGYA 4CIFA 1SQEA 2XYHB 1PAEX 5HL7Q 3UN3A 4CLPA 4QZDA 5E7OB 2FPHX 2NUHA 3CCRN 3N28A 3JPNA 3SBTA 2KV2A 4ZDNA 2FB0A 3S9HA 1XSLA 2XQCA 3CMAN 5KAIU 5GTHU 4FYVB 1LXNA 3DXSX 3UM9A 4B3SK 4EEYA 1J5EK 3MM5B 3LVWA 1RBTA 4PKDB 2A5XA 2ZOGA 4CLKA 4Y2MA 2RHSB 1RHJB 2DRAA 2YWWA 5DB7A 4IO1A 4FF1A 2ZTCA 4ECVA 4DOAA 4JI3K 3W2WA 1N36K 4PHEA 4J5OA 2HQIA 1UT8A 1C1CA 1UEKA 2YJEA 4MF2A 3WNGA 2FMPA 4F0KA 5FDLA 1YJVA 5AKYA 1W97L 4ECQA 3CG7A 3CULA 4LJXA 2KHCA 4Q0BB 3T7ZA 4X4OA 3OTEA 1DFDA 3GOIA 1OPZA 3R5GA 2WCXA 4GXIA 2KG0A 1S5ZA 3VAMA 1HHTP 3J7AN 1TKXB 3VQTA 2OPRA 2GVDA 2DEIA 1T02A 1RBUA 4OZ1A 8ICSA 3FZBA 4IYQA 5EDWA 1RP5A 4YXMA 3R1XA 2WVDA 3HM8A 1TL5A 2WBRA 2N3OA 3HSJA 1HL6A 5AQOA 4PHAA 4CHPA 4KMUA 3PACA 1QVGM 5DG7A 2AX0A 5F9LA 4FLTA 2P9LB 4BRAA 3NFAA 1QAXA 4P0QB 1VS3A 1SIJA 1EKEA 2WBNA 3QQCD 2O8EA 1VLBA 2DTUA 1Z1VA 1SUQB 2ZDPA 3HPHA 4YOXA 1TK5A 4LFCF 5AR0A 1FF2A 2G8WA 4P2SA 3PYFA 1TELA 1HUOA 2ZJRQ 4BUGA 5T41A 2DISA 4XK8C 5JS2A 3E0FA 3QIPA 3WU2U 4OX8A 4QWAA 2VIXA 2V63A 1U02A 2ILZA 5E3QA 3PW0A 2BPGA 2KYXA 2UVWA 4NCAA 4OJGA 4N8NA 2FUG9 2X7IA 1NGHA 1IG8A 2MXYA 4NLCA 3KLIB 2I7PA 2A19A 3GR1A 1OS5A 2VBZA 4J8FA 5AM2A 3Q8MA 1RTIB 3VQSA 2YNIA 3S8SA 3P96A 3IRUA 3AH6A 2YNGA 1NSPA 4MIAA 3FFKB 3NASA 3MCSA 3M1VA 4K8XA 4L3QA 1GOAA 1UL3A 1MNEA 3WKBA 3O3GA 2LFVA 3A12A 4UUWA 2F8TA 3Q7BA 3N6LA 8ICRA 2HAFA 2R8KA 2LBOA 4BS2A 4B3MJ 3GIRA 2B8PA 4KIAA 5ADXA 2UXDF 4G1IA 2D9PA 5E79U 4KLQA 4CO0A 1Z05A 4WTYA 3WK5A 1TVAA 1F9EB 3MEDA 5ALIA 7ICNA 4DU8A 2RQMA 1ZBIA 1MWZA 4PQUA 4CFAA 4JB3A 2MEWA 2W9BB 1F5AA 4PWWA 4RQMA 4CJQA 4IUFA 5J2QB 3THYA 2DGVA 2BKNA 2FIUA 1AA1B 3OTOJ 1KN6A 4WXWA 4JI5F 5GAGU 4K50A 4I9LA 1IQZA 2UYTA 3V1RA 4CEBA 4CLWA 3ET6A 1RGVA 3FZ2A 1N48A 1Q9XA 2C22A 1U2RA 4CZIA 1BPYA 1LWFA 3ID8A 3AMZA 2HPUA 2HGMA 4H4MB 2C3YA 4F04B 5J8YA 2QLWA 3EGVA 3OL9A 1CEZA 5ALEA 5BRFA 3MMBA 4DQRA 4DR6J 3IG1B 4W5QA 2QKKA 1S3XA 4WFNL 1RTDB 4BDPA 3I28A 3WEEB 4C1NI 2LDIA 4EFHA 5ALWA 3HOTA 4P7VA 4DL2A 1RBVA 1YHQN 3M4XA 3MMAA 4DF8A 4X4TA 5D4PA 1ASWA 2HK3A 1TUVA 1F3VA 5GVQA 1W2BR 2X6SA 1WOPA 2F8HA 2HYIB 1R59O 3Q24A 3QBXA 5G0RA 3G6XA 3JB9k 4IQTA 7ICTA 4ANEA 3EW9A 4RQ7A 3MOZA 5J2BA 5A2QU 1R31A 5E0OA 4GC6A 5MLCQ 4LF9K 5J2MB 3RJKA 2L5YA 1B70B 4ED8A 5AFUA 1XO1A 3GPAA 1XIQA 1L3KA 1ZOLA 4Y2JA 2ZZTA 4FO0A 1CRXA 3CJ1A 3G4SN 4DV3K 3HFZB 4FZZA 5SZTA 3G96A 5KG0A 1VQNN 4QWDA 5HO4A 2ZM6J 5J0YA 2AZ3A 4TU7A 3TO8A 1FJGF 2JH7A 4QZIA 2BJ3A 5A8KA 2B6AB 2YMPA 1CSJA 2XRIA 3DFEA 2GHWA 2ZIWB 2YI1A 3I76A 4OJRA 5T7LB 4M3TA 4WFBL 4O0JA 4TY8B 1KBUA 3CJAA 3RJHA 3ZFVA 2YKNA 4CJSA 3J7ZO 1KLMB 4Q2MA 1ZBHA 2QWQA 2ZFHA 1ATNA 4CZJA 1V3SA 2HS4A 5C2DA 3DYAB 3THXA 2N7YA 4FSVA 1NK4A 4D3HA 3VQBA 4BRPA 1HLWA 2EC2A 2KFNA 2WB4A 4HDHA 2ZH9A 3DRPA 2DPNA 2IOFK 5KRSA 3HHLD 4EYHB 4JRPA 4CGFA 2I9GA 3LYSA 5DB9A 2M5YA 3HXMA 4I6MB 4N5SA 5J2HA 1CJTB 4KN7A 1RT6A 4KSEB 1T9UA 3BGFA 2QWRA 4EWTA 3MM7B 2H51B 4L75A 4CHOA 1RT3A 3AA9A 8ICUA 5G5GA 3HRGA 1N62A 3JPOA 3L2UA 3ICXA 1RYUA 3O4NA 4OKJA 1J9AA 2OWOA 1G4CA 4AHCA 3RAQA 2ZJ5A 3HILA 4I2EA 1QVFR 3JXOA 4BDYA 2OANA 9ICKA 3GDQA 5FPMA 4YN4A 4IG0A 1WLJA 3SSRA 4C8OA 1OQ6A 2XWYA 4ILHA 1RDDA 2NSCA 3IGVA 2J0SD 4E7JA 3B82A 1ZXOA 4QZ8A 4X65K 2ZH5A 4UB3A 4FF2A 1S6PB 1ZQAA 2PE8A 2Z0GA 3MPWA 3V5RA 1FKPB 5BPMA 4DHYA 3SCXA 1VDVA 2IIRA 5AXKA 4YFKA 4CJRA 2QC3A 5D8HB 1RAGB 2K7KA 1XMQJ 1QAJA 3BM7A 3QYPA 2CJYB 2LCWA 2HFNA 2QN6B 1SB6A 1SAZA 1SIZA 3E9PA 3KKAA 3EGWB 4OQJA 2ZH1A 2GGPA 4FWQA 3PJ9A 1RQLA 3FQLA 4KFBB 1KVJA 2F7TA 5AZJB 2ZNZA 1S5JA 1HNXF 3KJQB 2HBRB 1C2PA 4OV1A 1HKGA 3GR0A 3C6UA 3QFHA 4USJC 5HQ8A 4HTIA 3TWHA 1N63A 2KIVA 4NRTA 1FERA 4JKGB 3QEWA 3M6VA 1UAWA 1ZQTA 4ACOA 1F3FA 4YHHK 8ICGA 4KHPJ 4EAHD 3G82B 3DNCA 1I3AA 4JI4J 1KEJA 1FJCA 3U02A 1N5YB 3TX0A 4DO9A 3PMNA 2ASDA 4IOCL 3C16A 5CP2A 3K4GA 3Q8QB 1JL2A 1SJ1A 5KPZA 4LR8A 5J1EA 1DQAA 3K7RA 2ZHAA 3WHIA 3WK7A 4Z7YA 2JLGA 2HMXA 2E5GA 4JV5J 1WDDA 3SPYA 4KH1B 4YUDA 8ICQA 1P6TA 4HTLA 1SWVA 3TADA 4OYWA 2MJNA 3QT5A 2QJ3A 2LQ8A 5IT0A 2VJVA 3CJ7A 2WHOA 3W5YA 3HHLB 4I7FA 2PFFB 1Z4UA 2QIFA 1F5CA 1U6ZA 2WBMA 1RDWX 5J2JA 4RNHA 4ZVEA 3E2EA 3S1TA 3I82A 4KO0A 3A5LC 2H9ZA 3PW4A 3DI6B 3NGKA 3ZTSA 3UD5A 1QJHA 1GTEA 2D3UA 4CLSA 3W9JA 3MDQA 2QARA 4DUYJ 4FK2A 2DXEA 3F9MA 2JMGA 5AKIA 2JDJA 3SQ0A 2RJZA 4WP3A 5A0YB 4GY2B 2RE1A 2ETJA 2NRHA 5GIPA 4N8OA 2FC8A 2ZE2B 1WJ9A 4FBUA 2Y1JA 3GYXB 2DKOB 1YJWS 3PY8A 2Y9TA 2XMKA 3AQFA 3CCEN 2BZFA 2MZ1A 3M8QA 4AQYJ 1S1XA 5HROA 5F2RA 3U3YA 2GLEA 3FFIA 2A2DA 3V2UC 5HVFA 2ZUGA 2QG9B 2EAPA 3BGRA 3B8HA 3D66A 1MSWD 4LF4F 4ITSA 5ETKA 3U9ZA 2C2KB 4BRDA 4MK8A 4CLLA 2HDOA 2AJFE 3QNOA 4NO7A 4MFCA 3A3PB 1MU2B 3NLCA 4LSLA 5LJWA 1Q9YA 1JKHA 3HULA 1BL3A 1DBDA 4RWXA 2DNNA 1KD1O 1RXOB 4ZN1A 3K8VA 4UUXA 5LMUF 2FY8A 5ALNA 3W66A 1ZQBA 3CCSN 3ZZPA 1SZPA 4Z37A 3OA9A 3BGLA 3RAXA 4I29A 3D2WA 3L9ZA 2I6XA 4OZLA 3WKEA 3CCUS 5GAHP 4ES2A 3IXQA 3CCJN 2J0XA 1Q82T 5AM1A 1Q8IA 4EEKA 4YQWA 3C23A 4LIWA 5TKYA 2RHQB 3D0HE 1YJNS 4KLIA 2J7KA 2UXBJ 3CJ8A 2GJ2A 5CCLA 1X5OA 2B4VA 2VKRA 3G8TA 4IFVB 2UUBK 1NNDA 4ZP8A 1ZQCA 2WFAA 1JXVA 1HLUA 4IRCA 3MGVA 1GMWD 3W8PA 4FWSA 2DL0A 5EWGA 2ZTEA 2BJ1A 3D1OA 5A8RA 2VQEJ 3NGZA 2YX1A 3AVLA 1ZQKA 4IDKA 2ITGA 5C42A 3KLGA 3HK2A 2BW2A 4C0HA 2O4GA 4FE3A 1JXLA 1HUZA 2A3ZA 3H42A 1DTTB 4ICLA 5EE0A 1W7AA 1PVPA 4UY8T 1HYSB 1ZM4A 1OYEA 3L0QA 1PSDA 3VQDA 4FW2A 3QO9B 1S72S 1H0HB 5G5HA 2XIDA 1S1TB 1BOTO 3RBZA 5AQSA 2NRVA 3RBDA 4FJMA 3RZAA 4K2JA 5HJYA 2OHDA 2XG8A 4ZVTB 2ZZMA 5B66U 4JK7A 2N7CA 1NSAA 3KXDA 4JI8J 4O4GB 1RGIA 1ESVA 5HBMA 1HBMB 2UU9K 2E1CA 5AZIB 3CSKA 4BRGA 1J97A 5IIOA 2O01C 1ZQUA 2Z1IA 3M6GA 4DQ8A 3M7DA 3T1AA 2QL7B 1OY9A 4KN4A 3W65A 4JI2K 2FLLA 1MG7A 1SI9A 1YVFA 1LW2A 3H40A 3DRSB 4DV4F 3TQEA 2F3NA 3T1YK 4FPRA 1T03A 3W60A 2NZCA 2CJBA 4Y28C 5KFLA 4US8A 4CK1A 4J9KA 3D7SB 4DL6A 1JLEB 3OUYA 2MA1A 1HNZJ 4FKXA 3VVTA 3UDEA 4IWVA 2FZGB 3SV4A 3QT8A 1S0VA 2EBEA 3QUTA 1BQNB 5HRPA 2GZOA 1GTHA 2WF9A 5D0HA 4FCYA 4OI2A 3IG8A 3SFUA 7ICOA 4WYWA 4C7ZA 1H2UX 2KFYA 3CPEA 4PKIA 3MGJA 5I3PA 2YNHB 5MAOA 9ICHA 3NGYA 3NCQA 2ZH6A 3SMSA 1FRIA 2KSOB 4I68A 5BOMA 8ICHA 1GAOA 2KRBA 2XMWA 3UW1A 1N8RO 3LZJA 3CJQA 4LF5F 5GADP 2HBZB 4ZPDA 4WE1A 1FXXA 2WSEC 2PD1A 1WHYA 3QEAZ 3RBXA 4NM1A 4M5NA 4BR5A 2CQHA 1VK0A 4FS2A 3NP5A 1QH9A 2QKQA 5DM6L 4CEZA 2PEBA 1RAOA 3VMFB 5AXNA 1Z25A 4FOEA 3GFHA 3SCJE 3GYNA 1R0AA 7ICLA 7ICKA 2B51A 2HW3A 4FL9A 4HUEA 1ZZNA 2NRXA 4ISEA 1R0CB 2W41A 1UZHA 3CF5Q 3D9BA 3CPWM 3QXGA 2QMUB 4E7IA 3DDKA 2IA6A 3CJTA 4JAXA 4CEEA 4ECRA 2RS8A 4NI2B 3C1ZA 2DKZA 4LH5A 2QLBB 3AU2A 2J7UA 5KRTA 4U67L 1TKDA 3T9NA 3H8MA 3WXIA 1RT1B 3T69A 2HHPA 4NJ8A 2KVSA 8ICYA 1X4BA 3VGLA 4A59A 4QS7A 4HYKA 1WWHA 4MJKA 3QEPA 5BPLA 1SXLA 4YB7A 4YNQA 3PYGA 2RDDA 3M6ZA 1JJ4A 3LDLA 3HSTB 1Z2ZA 2PDAA 2DNKA 1J5EJ 3G86A 3UDLA 5CR4A 5DDMA 6FDRA 4L6V3 3LP0A 1IR0A 3EZUA 5DK5A 4NPOA 3QGPA 5HLFB 4BR0A 5DJBA 2QWPA 1N36J 4USWA 1TV6A 1NGGA 5J0UA 3VTIA 3EGNA 5F3XB 2AP1A 2NRWA 2YHWA 2CQDA 2UXCJ 4F4XA 5BJRA 3W5ZA 2FQQB 5AQPA 3L6QA 1HARA 2FHOB 1T05B 5CHGA 1DLOA 5JJBA 4LRBA 5CRXA 4Y3CA 1T3OA 4P4OA 1C1AA 2ZBQA 3PNIA 4PY5A 2F4VK 4UOHA 4LF8F 3IDHA 5ALYA 1RAHB 3A0HU 3FCVA 1SQKA 4XO0A 3MM9B 4KBOA 3TI0A 5C2GA 3MR5A 4DQQA 3DLGB 5BRHA 3N4WA 1FXLA 4NYNA 3UKUA 3C6HA 4B6JA 4IFYB 2VIHA 3CD6N 2GVZB 3KJVA 1K8KB 1UPPA 2WZ1A 4CI6A 3N01A 1S4EA 2FVCA 5A2QO 2PY5A 2EFQA 4ZP6A 1GH8A 3MZIA 2DNYA 2IS3A 4H8KA 3NS7B 2WW8A 4CLTA 3VC8A 3OYNA 2J9CA 4JK8A 4OJ1A 2OLWA 4DZ6A 2BCUA 4QZEA 1WSVA 3N97B 3RSEB 3KWMA 1V5IB 2LA4A 5JU5A 2VPYB 2BXJA 5J2DA 3QB0A 1NU0A 4TXSA 1S9EB 3RMDA 1XNRK 3WX8A 3CDWA 3C3LA 2XYPB 1ZQZA 1QE1B 2EDUA 1S22A 2KHOA 5AQLA 4ZVRB 4TUPA 4C4SA 4F36A 2J6TA 4P2XA 4DB3A 3TARA 3JSMB 4M9NA 2QSWA 3CJRA 2PFNA 4MFFA 2A18A 2ATQA 3DRRB 1WWVA 3LO3A 3LPEA 4X66K 1JRPA 4JWNA 5AKJA 2HNYB 3W63A 3WQUA 3AO2A 2W42A 1AT1B 2E7VA 2M52A 1X5PA 1RT4B 1F5SA 4RQ4A 4K0KF 2VHGA 1JIHA 3CDUA 3QGIA 4OD0A 1U7LA 4KLTA 1REGX 4DQPA 5KFUA 1KOHA 2CPDA 2WAQC 1RYSA 1IBKF 1RT5A 2BBEA 2CA9A 1UVKA 3BPDA 5BYRA 4BRKA 4I2CA 1PK1B 4LT6A 1ZETA 3FZFA 4CJFA 1H2VZ 3J81O 1EO1A 3JXUA 2QYCA 5J0QA 4OCZA 5GAHU 3VERA 4EX7A 1I51B 1I94F 2ZIVB 4KKOB 1ICEB 2RQKA 4DDFA 4HKQA 3V6DB 1X6IA 1DGKN 5LMNJ 1VOMA 3DXMA 2BUNA 2FHKA 2VONA 2WONA 3SMPA 2OFHX 3HPOA 1JNZB 3VAKA 4RW7A 1K9MT 3W3SA 2HQFA 4KHYA 3BO3A 2HHHF 2O8DB 2XS2A 4I6AA 3LTOA 4CIGA 2K1RA 3WXLA 4AM6A 4QNLA 2VA2A 3MAAA 5HAOA 4HCCA 2P9KB 2ZUCA 4BWMA 1VQKS 4DU1A 3PJXA 4J7CA 3UQSA 5AQHA 2H4WB 3KHRA 1U1KA 3OR2B 1IR1A 1YAGA 3EPIA 2EVZA 5KOXA 4KH4A 2I1QA 4DV6F 1NK6A 4L3NA 3C8YA 2OP5A 1Q8BA 2Y9HA 4FFDA 1VC6A 2FBXA 3MWTA 3ONNA 1S1VB 1XSPA 3ZDAA 1X9WA 2Q0RA 4RWTA 3C95A 4DFMA 2E2PA 2QA4S 1GLFO 2V6AA 3QAUA 4ISGA 2RT3A 4ZP7A 5L1MA 5KFIA 3CMQA 4F4YA 3QNWB 1ZBLA 2MGZA 1FDNA 3VHQA 1NPPA 1JB0C 4NA3A 5F8MA 2E2QA 2RD5C 2DGQA 1H74A 1M5KC 3QRRA 3UKRA 2VODA 1DURA 3R2CJ 1W0HA 4P71A 2APOA 4Z4IA 3FLCO 1EX4A 3K17A 4UB4A 3HX0A 1IR2A 1CULB 1YJ7A 3WNEA 4NXNJ 5AE3A 2WF7A 3NNCA 1IKYA 2P8IA 4DTSA 2CNNB 4UAUA 1RBAA 2CPJA 3WKDA 2I38A 3S6EA 3PIPL 3ZD8A 4DPTA 5RUBA 4IS7A 1WF2A 2V8DA 4O9MA 4DV7K 2FJDB 4YY3F 2P66A 4BRQA 5H9EK 3IHQB 1EHWA 2KXNB 1TUWA 1OSCA 1HNIA 1LOTB 3JQJA 1RWWB 2YKMB 4US9A 3ZSZA 3GYGA 1Q78A 3AAPA 4NCBA 3C0BA 4PGQA 5K8NA 4DPWA 3FEXB 3G8SA 4NCGB 2Y1RI 3IMXA 2VBXA 4TQRA 2OD4A 1PCAA 1L5UA 4H0VB 2V4QA 2ZQBA 2VGNA 3CIZA 3SQGA 2KIWA 1ZQRA 2J6UA 2JZ5A 2P1JA 3NWRA 4RNMA 1DGSA 2BJ7A 2O67A 4YMNA 1BHNA 3UDVA 2WHEA 4PG5A 4BGBA 1COOA 1ZQDA 3U9DA 3MECA 4CJ4A 3MR7A 1K1QA 4CEDA 1Z2LA 3GV5B 4OZ3A 2CRXA 8AT1B 3OYJA 5GADU 1U1PA 4FLVA 5AICA 5J0XA 3TAMA 5J0SA 2XWXA 1NAQA 3VF4A 2LU2A 2IHNA 1VQKN 4M6WA 3J7AP 1Q86O 3DLBA 3R97A 1CBKA 2V5HG 2CPRA 3NVKA 4UT4A 4DR1F 5AQQA 2KP7A 4M3RA 4CK2A 4QOZB 4UOGA 4CZFA 2BM0A 1D9DA 1RT2A 2V68A 4F2RA 1RISA 2EK6A 3V9XA 4EO6A 4FWPA 2OEKA 1R8HA 1DRGA 2HQCA 2JGAA 2A0FB 5ETQA 4DPUA 4K7QA 1X4AA 2XEXA 3M6UA 4IKFA 4OKEA 2F9DA 4E1JA 1QVFM 3TZYA 5HROB 4MIWA 1WKLA 2R7QA 4W90B 5J2PA 4LFBK 4UY85 4X5VA 2O8FA 2HOIA 1AW0A 4NLTA 4C0BA 1SBRA 2ALZA 3M8SA 4CNZA 3QRQA 1LWCB 3DLLL 2RU9A 1RWVB 3TVYA 2IC3B 3NY0A 1U8SA 4CCHA 1V4SA 2K8CB 4BX9C 1OUQA 4WF9Q 1GLLO 2VGMA 1NG9A 3QLHA 4Y2KA 4HHHA 2MY7A 2HWTA 2EBGA 4MDAA 4Z6FA 2ATLA 1SV5A 4P6QA 5EX0A 4PGXA 1KN5A 2I9SA 1RKJA 3M1YA 4GO7X 2XTJP 2GO9A 2IOFA 4EP5A 3QU9A 4CYUB 2QWLA 4H5RA 3EWAA 4YDUA 2VOOA 2J5AA 2FBTA 2FMSA 2ZBPA 4PEOA 3MUMP 1IKVA 4TN2A 2VG6B 4YHHJ 2E88A 2ZH3A 1FK9B 2IHR1 3EWGA 3MN6A 3CWJA 2DGUA 2M8DB 2W8LA 3WKCA 3ZT1A 2GA7A 1QQCA 1T6DA 1JJCB 2O66A 2LDYA 2ZITA 3HSDA 1PBUA 4FLYA 4CRJA 4DR7F 4J03A 1WUDA 1GNKA 3TUZC 2ZOMA 3IBCB 1FO1A 3GONA 2A1SA 1NZAA 2KHDA 4KB1A 3IS9A 4O4RA 4P2FA 1DQ9A 4CECA 4MN4C 1Y3KA 3BZCA 1VIOA 4BGDA 5CHCB 1HRHA 4X64J 4DR5K 4ECWA 2B4JA 2P9GA 1HJPA 1TVRB 2JNJA 1TMMA 3K0SA 4NA2A 2D0PA 2NXCA 1B4SA 2NYVA 3LP1A 5EOZA 3BYPA 4FK0A 4DV1F 3I5AA 3LQVA 4IBNA 3VGKA 4FJGA 1S48A 1BISA 3HSGA 2KK0A 4URSA 4FWKA 4HACA 1ASVA 1Y9OA 3O4QA 4UB5A 2FSNA 3KK3B 4P73A 3RJFA 3RF9A 1N32K 8ICAA 2EPIA 4CF4A 1JL1A 4M5DA 1L3SA 2P9UA 2OIHA 3DMJB 4HLBA 4URGA 3H5YA 2BTFA 5B0AA 1OW5A 3W3DA 9ICQA 1XNQF 2YKOA 4Y2IA 5CZXA 1RQNA 4H0OA 1LWXA 4PXCA 3TSPA 3VQPA 2OZMA 1KKXA 1LKYB 3CGIA 4AFFA 3IWXA 3CC7N 3KHLA 1WD6A 2PAVA 1HQEB 1FFWB 4BR4A 1X4EA 5B7WA 1LWEB 1EQYA 3TUIC 2LECA 2FGCA 3LGNA 1C0GA 4GXKA 1EETB 3GE9A 4LR7A 1NSQA 3AOBA 3L3UA 1AZSB 3HFKA 3UNGC 2QMWA 3OTQA 3VEYA 5HJXA 4OYOA 3MDCA 5K20B 4RTFD 4J90A 1VQMN 1WTFA 1VRUA 5KI6A 1L7PA 4IJAA 4DUYF 2KQ2A 3QGHA 5ALZA 2ZH2A 3K8WA 1BUXA 1C1BB 3G6YA 2MMYA 1V9OA 2JEIA 1D8ZA 1DARA 4EX6A 4ZN3A 3EN9A 2PEHA 2M9NA 2R2TA 2OH2A 1FRJA 1S0OA 4EYIB 4CJKA 2L08A 4PL2A 3VQAA 4EMDA 5DDOC 4I67A 2UP1A 5GAHI 1HR0K 3PDNA 3O1LA 2IOCA 3VQ5A 3EKUA 2VA8A 3FBCA 3QU2A 3A3OB 5KT6A 4I2DA 4TNOA 4QIFA 5C25A 1KXPA 4RQ8A 2QL5B 1X7VA 4FKYA 1UAXA 1V3RA 2XS7A 2A1JB 3FC4A 3DOKA 1S12A 4LSNB 5B0EA 2DFLA 3VGTA 3UXPA 5ETVA 3MAQA 3AD7C 1ASUA 5AM4A 4K4XA 2KH9A 2FPKA 2BGWA 2PFQA 4RPYA 1RZMA 5J2GA 4O5BA 2VF3A 5KGXA 3WC2A 1I6JA 4NXMK 2QFJA 4C98A 1BWEA 2CJKA 4Z4EA 1UQVA 5LJ5Y 4YOYA 1VC0A 1Q16B 2B3TB 4KPCA 3MI7X 1KVAA 1RB0A 2YKPA 4O44B 2W4DA 1L8LA 1RBOB 2CGLA 4YB1P 1WG8A 1FKOB 1QHTA 2Q3SA 2VWJA 2HOFA 2PFDA 2W6KA 2BACA 4A8EA 5B0CA 1DRZA 4AE5A 3GG0A 1YX2A 1J5OA 4KH5A 4KGMA 4DKWA 4YN3B 4FVCA 1G15A 2GBZA 3MTJA 2BA9A 1T9YA 1ZTTA 3AO4A 8ICOA 2G2OA 2VQEF 4TYBA 1PAUB 4RX6A 2W03A 2LHTA 4KLMA 3SNNA 1JJ2R 1P1LA 1IKWB 2RRAA 2VPXB 4JI2J 2BGGA 5C0YA 5D0GA 5AQVA 1JI7A 1HWKA 2CJQA 3T1YJ 4GKKJ 1S1WB 2Q1NA 5TZVA 2PO4A 1PJ6A 4CW7B 5IWAF 4A2AA 1MA7A 2HHXA 4G9ZA 2VL1A 1IJEB 2WVBA 4EBCA 3NTUA 1QTNB 3A5NC 5K4LA 2XVTA 4F5QA 1RKIA 3JYTA 1Q82O 3KLEA 5KFWA 1QZ5A 3CJ5A 2Q36A 2GEMA 3DU6A 1YJTA 2VG5B 3OYKA 2GO7A 2ZZNA 2PXIA 3AVKA 1LVHA 3HD1A 2BW7A 4DV0F 3ZTPA 2G08A 1QCKA 3OBIA 4USKA 3LW5C 1SGGA 5LOQA 3KOAA 1P9YA 4CJ3A 1UVLA 2BDUA 3MGIA 5GADI 1FD8A 4UARA 3LUYA 3B0XA 2E6LA 1JLAB 4DR3J 3DLHA 2GHVC 3IC1A 1H7WA 3BYRA 1HPZB 3K58A 2AGPA 2WC9A 2V2ZA 4TUQA 4UY8O 1N33K 1I5OB 5JMNA 1S9GA 2JWKA 3MCPA 3ZT3A 5CA5A 5KFJA 1ZQNA 4X62J 3GJTB 2RUGA 1WSEA 3U1NA 4WFYA 4WKRA 4F91B 3K9KA 4B1VA 4DV5K 5LXRA 2DY4A 3SBGA 3CIPA 1O03A 4NOHA 2JSXA 3UMGA 3H8SA 3V9UA 2YWGA 5F8LA 3BV8A 1RSCA 3KHHA 2PFUA 2EI5A 5CWRA 9ICTA 3FJ2A 2V2KA 5L1JA 3OYIA 5IM0B 2VICA 2NRZA 1VFJA 1PJ5A 4FYXB 1UCNA 5LJ3Y 3QAEA 5E2QA 5DM7L 2B8QA 1X42A 3D6HB 3B6BA 3NAIA 3DLEB 5BYQA 2UUCK 1NJXA 1W9HA 2ZVSA 2ZC3A 2P9NA 4M9GA 3AUOA 3I0SB 2R2SA 2ADCA 1QUPA 4WFBQ 1YRUA 3Q0AA 5DZ6A 1PC5A 1VQ9N 1F0MA 1MQ2A 2BRKA 4PXBA 4BVOA 2M88A 2X3DA 4NRUA 3TTCA 3CJBA 4EBDA 3TA1A 2IM1A 5JXSA 4Y2SA 4MFAA 2QB0A 4CJWA 4AXIA 2GMHA 3V6HA 4AP9A 4J9SA 4B3RK 3CCWA 3BS5A 2HSEB 1XO0A 2O8BA 4FJHA 4UW9A 3P1GA 4DLGA 5IIIA 2V52B 3UO0A 2HFOA 7AT1B 4B9NA 1SJRA 4M1KA 1RHRB 2G5IB 3I0RB 2ZJ8A 3ZSOA 3A8YA 4L8RB 3JAMU 1YITS 3DM2B 4P9SA 4Z7CA 1TTHB 1TUGB 4JI6K 5KT7A 3VR1A 4IQMA 3I32A 2RS2A 2EQYA 5F8JA 3SIPB 4XPEA 1B99A 3S7RA 4EENA 2F1HA 3PO5A 4ED1A 1CJKB 4M45A 3ZXWA 4U9RA 1S7HA 4P0PA 1PGZA 3PJWA 3SZ2A 2FLPA 2MKCA 3ILLA 2P5GA 4B3SF 1VSJA 5HP1A 4RQ5A 2HHQA 2MPUA 1EZZB 1F21A 2BCSA 4CF1A 3NBPA 3ZSYA 3ZTRA 3N6NA 1CC8A 4JI3F 2F63A 1WCNA 2J76E 1KHVA 2RF2A 2EG2A 1KAXA 3M5RA 1Y97A 1Y11A 4S0MA 4OLPA 5ALLA 1SS6A 4CDGA 3MCAB 3L2VA 2BMBA 1HQUB 2W2PP 1WSIA 4FJ8A 4EK2A 2VB6A 3C5FA 3ZZUA 5JRTA 4B3TK 4H4OB 2C3OA 1Q5VA 1BWFO 3EVOA 9ICMA 4ZA1A 1JWWA 1ZD2P 3MR6A 4FZNA 1U26A 1Z4OA 3DLRA 4FJ9A 3C2KA 4TURA 3MPYA 3R3LA 2XSJA 4F2SA 1O1WA 3ENBA 1B0XA 3BBBA 2HMIB 4NLRA 2W55A 3OTBA 4LIRA 1GQEA 5AI5A 4DUZK 1WWUA 1REVA 3TP2A 5D49A 2FHJA 4DX5A 4DR2K 3HVAA 1URNA 3ZSRA 4FNIA 3TAQA 3ENHA 4M5LA 4OJPA 4DWIA 3MEKA 5AQIA 3I9ZA 4I27A 2AD9A 3RBEA 3J81j 4FWLA 3HHEA 2LM1A 2V7ZA 1GK8A 4M47A 4PYDA 2Z56B 2QLTA 3QT6A 3TANA 3DOLB 3MWPA 3M2VB 3IP0A 1NBEB 3KNAA 4QIWC 2HFUA 3QFPA 3CCVS 4QW8A 1P9QC 1ZYQA 4KGKA 3BSNA 5BPNA 3KUGA 3L3FX 3DDHA 5C12A 3GV8B 2ZEJA 3GCXP 2E66A 2NO4A 1RABB 4BXOA 3M32A 3M30B 1YITN 4MO5A 4BLGA 4OJOA 2M3DA 4X2BA 2DHHA 2J8AA 1YI2S 1C6VA 2CKWA 3NGSA 4QPTA 4DV2F 2DCLA 2ZUBA 2DNPA 2NNWA 3AVBA 4LD0A 1FD2A 7ICUA 4CNYA 1SWWA 4Y2AA 3AQEA 1ZQQA 3LP2B 4OLBA 4CH1A 4AILC 5DG8A 4KYZA 4OPHA 3N6MA 4QJVA 1UVJA 3T1HJ 6FD1A 5KAKA 1NHKL 2BABA 4OZNA 3G6EN 3B6OA 1U8WA 8ICLA 4ZOHC 3H45C 1YXQA 4YR0A 5CYQA 4PHPA 2ZIXB 3RH5A 1QTMA 1VDHA 5ETRA 5AJ3F 2E20A 4KLFA 4PWUA 5KAFU 2Y1IA 4CF8A 5MLCV 1VJ5A 4DPYA 3D1QA 2FVSA 3W9HA 1WF1A 3V7JA 3EUNA 5AQTA 2GMJA 4G9BA 5E3PA 3DLKA 2W8KA 4XH5A 4IG3A 1X8DA 1NOYA 2AU0A 1A76A 4RW4A 3HI0A 3H8WA 4GFJA 3SSQA 5KG7A 3BQ1A 4TLQA 3QIOA 4LF7J 3QNNA 1W2IA 3SPZA 3V4MA 5T14A 3RJMB 2LYVA 2NCKL 2H3QA 4R25A 3MEEB 3SI8A 3ZNUA 4ZPVR 2KKVA 2IPOB 3RRHA 4RW9B 5A6WA 2OMOA 4CJPA 2FDRA 4DSLA 4ZVHA 3PR4A 4ZHRA 3E01B 4C97A 2LEBA 4E3SA 2FJ6A 3CJKB 4O3OA 2QW9A 1BPZA 2CPZA 3SDEA 3U7JA 1URJA 3WUHA 3O2IA 2F3JA 4Y0WA 3QICA 3ZZZA 3PKYA 1F0XA 3EICA 4L76A 4ZVOB 4URQU 4CF5A 4F5PA 3CXCM 1VBZA 3CCVN 3QEIA 1LXJA 4PG6A 1BGXT 4C48A 1FTCA 2VWBA 3BO4A 5ETOA 2AJ4A 3LDQA 3MURP 3WK8A 1K9MO 3CJCA 1WDTA 4GXJA 1OWXA 1EP4B 1C0UB 1NPRA 4HR2A 2B5JA 4U8YA 4LF9F 5FLXU 1ZQ1C 3F2CA 2PA3A 1RDFA 3B4MA 4KGZB 5BR8F 1YI2N 2HNZB 5AK5A 3H5UA 4CZCA 8ICCA 4WFAL 2GWSA 5EU7A 7ICQA 4FPBA 4B3MK 4DV3F 4CH7A 2H5EA 4F5NA 3GJQB 3TEGA 5KFEA 4RQ2A 3OR1B 1JLGB 1M1GA 3VA3A 4JI1F 1DTQB 2I8EA 4EGLA 5AI6A 1EARA 5CCMA 4WFXA 5CE3A 4H5WA 1SVDA 3D6MB 2HVEA 2W2MP 3UMBA 2M0NA 4NM2A 2BM1A 2DHGA 3N5FA 2VQFF 5JS1A 2F9TA 1QAYA 3MM5A 4ES3A 1X3NA 1KQFB 1X31C 5F0XA 1A0OB 3AO1A 1U45A 2B4UA 3V9WA 3MF5A 1WOOA 4USVA 2Q6BA 3A0IX 5EX3A 3OTOK 4X4RA 1BDGA 4JD2B 3VEWA 4OLAA 9ICPA 3H6EA 1NWKA 3NGDA 3NVMA 3TZWA 3KLFB 1SPBP 4IXCA 5K8PA 4C3KA 3VA0A 2HZAA 5ADXH 2RSQA 4GC7A 4OX9J 3CFOA 3BN4A 1AUSL 2GHPA 4A5BA 4OZ0A 4LFBJ 1NKEA 3SXLA 4Q0BA 1AUDA 3KZXA 4Z6EA 4DR4J 1WORA 4G65A 1JMTA 4DR6K 3UPFA 4GNIA 4FJNA 3FM9A