1U49A

Adenine-8oxoguanine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u49A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u49A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u49A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u49A01
4ID5A 8ICKA 5KFJA 4Q44A 4DU3A 3C5FA 3KKRA 2W9AA 4KTZA 4B9VA 1LAVA 2JLEA 2YHAA 4Z0UA 1TL1A 8ICGA 1NK6A 1JX4A 3RJHA 3RR7A 3GV7B 1KFSA 1JXEA 3LDSA 2BE2A 3M9NB 4O44A 3TABA 2A1JA 3RH4A 4DOBA 3ISNC 4NCAA 4C8MA 2YHBA 4FLTA 4DFMA 1G15A 4FJ8A 3RR8A 1ZJMA 4PA1A 7ICVA 1HYVA 3WNGA 9ICGA 3ZD8A 1TK5A 3PNCA 5DQIA 2C2RA 1JLCA 3V4IA 1RTHA 3M9OB 5KFQA 2PYLA 2BQRA 2BGWA 4CF2A 5HROA 4HVJA 1JN3A 3ISCA 2BCSA 4C8OA 4LH5A 1S0MA 4FLWA 4IRCA 3QNNA 2KQ2A 2ZQBA 3ZSXA 5KFWA 1LB2B 4O3NA 3CG7A 3FFIA 3BGRA 5J2NA 2I9GA 5TZVA 5J0QA 4UQGA 5IIIA 5HMMA 2XO7A 9ICQA 2OYQA 4DL7A 2DFLA 5FROA 2HVIA 3ASMA 3QETA 4CEEA 4LH4A 4E1MA 3QERA 3ZDEA 4CJTA 4P4PA 4O0IA 5KFHA 4J9QA 2YNIA 3JPRA 3JSMA 3NH1A 5FRNA 1RT7A 4QZ9A 4EBDA 4P2HA 2R7YA 3V7JA 3Q8QB 4YVZA 5DK5A 3QEWA 4LZDA 1U45A 8ICCA 1KVCA 2JZBB 3G6XA 4KLEA 2E4LA 4GVMA 3NE6A 4DTOA 2OZSA 4PGYA 2HNDA 3AVGA 1HPZA 3K58A 2DFHA 4J2BA 5IIJA 4N47A 4DLGA 4UBBA 1C7YA 3KHHA 4Z4EA 4FJLA 4EEYA 4MFCA 3DLKA 4B9NA 4RU9A 3LDAA 3T3FA 4QZEA 4CHPA 7ICIA 4WE1A 3FDSA 5HHHA 3PO5A 3ULDA 4QZGA 4MFBA 4M3RA 4B9TA 2NRTA 1ZQHA 1T05A 4W5NA 4DS5A 3KLEA 4CJRA 5CZ1A 2I5JA 4DOCA 1WSEA 3HSTB 3WNEA 4CEBA 5J0RA 3LANA 1XO1A 4TURA 3BQ0A 2ZE2A 5KFGA 2IC3A 4O3PA 1WLJA 2B21A 4W5RA 5J2FA 4RQ6A 4O4GA 5L1KA 2XGQA 4IQWA 2ATLA 4CK3A 4Z4FA 3IRXA 5DDMA 1JLAA 4DQQA 4CK2A 1RDCA 5KFVA 4GXKA 3B0YA 8ICRA 3U3YA 3TANA 1WSIA 3UXOA 3KD1E 3SCXA 4EBCA 2WONA 3LPUA 4CEDA 5JS1A 2B6AA 4CJ5A 1ITGA 2EHGA 1U47A 3QINA 5DQGA 5EWGA 7ICHA 8ICVA 4KV8A 1QLNA 1VSIA 4I2CA 1JLQA 2ASJA 4DMNA 5HP1A 2FMPA 1KSPA 2A1JB 9ICUA 1BVSA 4AHSA 3TAFA 4IG3A 3DLRA 1TKZA 9ICLA 3MXJA 3V7LA 3QIOA 3ZDBA 4RNMA 4N56A 4IDKA 1EETA 4Q8EA 1W9HA 2XY7A 5IIMA 4E7IA 4GC7A 4BE1A 5C42A 3NDKA 9ICXA 5KT3A 3CYMA 4E19A 4MEXA 4CJSA 4MFAA 1ZBIA 3V9WA 4XUSA 4FS2A 3OS1A 3ISBA 5DG7A 2A1RA 3CFOA 2AGPA 1ZQYA 1RBTA 4RUCA 3RRHA 1LWCA 1TK0A 4IFYA 3K5MA 3PMLA 4BDYA 1REVA 2ZTDA 8ICMA 3H8SA 4NYFA 4KLHA 3UPQA 5J0TA 3N4MB 3K2PA 3AVIA 1CLQA 1VSDA 2FLPA 1RDDA 9ICRA 1WSJA 2D0AA 4M3XA 5D4BA 2DFFA 1Z26A 8ICWA 3HXMA 5KG4A 4NY8A 3ZSVA 3OYHA 2GV9A 1CXUA 4RPYA 4KHQA 3Q8SB 1T4GA 3C2LA 5KGXA 2HVHA 3TWHA 2XCPA 4OLAA 4QAGA 4PUOA 1CUKA 3MFIA 3ITHA 1QHTA 4DO9A 1S9FA 4YD1A 2PFOA 2GWSA 1S1VA 3S3OA 4ED2A 2W9BA 1NK9A 4FJKA 2UVWA 1YTAA 3RH5A 1RT2A 3NH0A 3OYAA 3RMCA 4KO0A 4KLQA 2P6UA 7ICEA 8ICNA 4JRQA 1WCNA 2VA2A 4BE2A 3NF6A 4QZHA 2V4RA 4M0AA 7ICNA 3HYFA 3UQ2A 3RJEA 3AVLA 4GXIA 1XC9A 4F5RA 4ECTA 3RJIA 3PX0A 1FKOA 8ICPA 2MAXA 2R8GA 4CK1A 3NTUA 2D5RA 3H4BA 3SQ0A 1KVAA 4RQ5A 1SL2A 3AVKA 3LAKA 4PHEA 3AVAA 3OYBA 4E1NA 3DOLA 2IGIA 2NRXA 4DL4A 5KRTA 3AA4A 5J2QA 7ICLA 4ECVA 1BPDA 2X6SA 3VQ7A 4DU4A 2ATQA 3DLBA 4KTQA 2G8KA 7ICQA 3AVCA 4CF8A 2KTQA 3HJFA 5KG0A 3EPIA 3SQ1A 5CB1A 5HRPA 4LZGA 3O4QA 5J2GA 4I29A 3GIKA 3MDCA 1S1WA 5KFPA 5IIKA 7ICRA 4I2JA 4KTWA 4KN4A 2W9CB 2W8LA 1Q8IA 9ICHA 3QEIA 4K8ZA 3K5OA 5J0YA 4M3UA 4OKEA 4DTMA 2GBZA 1IH7A 8ICAA 4YN4A 3VQQA 5KFIA 1HUZA 4ZH4A 3HPGA 4CJWA 1IKXA 2G8IA 2M9NA 4HHTA 2ISOA 2AGQA 2O4IA 4YR3A 1UWBA 5CHGA 8ICHA 5J0SA 5CYMA 1DLOA 2ZTEA 3MFHA 9ICCA 2ZJ5A 4NM1A 3C2KA 4BWJA 2V4QA 3OYNA 4FK4A 3OS0A 1RBSA 1NKEA 2C22A 2FLLA 1IG9A 2FBVA 1C1BA 4HYKA 4ED7A 1T8EA 1A77A 2FBYA 1ZQWA 1HNVA 4FJXA 1KLNA 2HNYA 3ZSRA 1HYSA 4ECUA 3NBPA 1B22A 4Q0BA 4KLOA 2F1HA 3LP2A 2BANA 4M9HA 3SPZA 3MABA 5KG2A 1S77D 3NCIA 2ALZA 8ICEA 1BISA 2JGUA 4HTUA 1PZNA 4FJHA 5J2EA 1C0UA 1LWFA 5K14A 3HT3A 4DQRA 1KFDA 5J2PA 4PH5A 2VANA 8ICOA 3VQ6A 2KZ3A 2PFQA 1WSHA 4QWDA 4DF4A 2BCQA 4K4IA 4BWMA 4NM2A 4E3SA 1NOYA 3WNHA 1QQCA 2I1QA 3AO3A 1XSLA 3C6TA 3TR8A 2ZUDA 3M8QA 4E89A 1WN7A 4I2QA 3CQ8A 2KFNA 4YXJA 1TAQA 3SUPA 5DBBA 1IKVA 3AO4A 1NK0A 4FS1A 3O3FA 1A5WA 3VQ8A 1TKDA 3PR5B 1RCHA 3MR6A 2AQ0A 2DTUA 2Y1JA 4KFBA 1ZYQA 3WNFA 1ZQEA 4PWDA 3RJKA 1WAFA 1ZQLA 2H5XA 1DTQA 3TAPA 1MQ3A 3TFSA 3TAEA 3QE9Y 4M47A 5KFOA 2ASDA 1KEJA 5J0OA 3G6VA 3EY1A 3RMBA 3H4DA 2W42A 2J6TA 3RJFA 3ZT4A 4RW4A 2IMWP 4YCXA 8ICUA 4FM1A 2XY8A 3OYKA 4KPYA 3LPTA 1HQUA 4Y1DA 1IXRA 2J6UA 4R8UB 3HP9A 4EP5A 1ZQXA 3V81A 4B8AB 1XHZA 3C23A 4DEZA 1ZBFA 4M6WA 3MAQA 1NK7A 3OYMA 3BQ1A 7ICTA 4XIUA 5KT2A 3D45A 1A76A 2AGOA 4F50A 4CFDA 5KFMA 3K75D 4K4GA 4J9PA 2JEJA 1RBRA 4JRPA 1H38A 3QNOA 2ZUCA 1TGOA 3DRPA 5DG9A 3AVNA 4HUFA 3AVMA 3MXIA 4O9MA 2R8HA 2X78A 4QWBA 3OVNA 4Z6FA 3JPOA 5C25A 5HLFA 4J2DA 3IHQB 5DB9A 2YNFA 2PZSA 1S6QA 4BACA 4X5VA 3H08A 1ZQIA 3QZ7A 4PHDA 4YG2A 4B9LA 3VQ4A 2IBKA 4ECXA 3GV8B 3PMNA 1EX4A 4JWMA 4DSFA 3MEDA 1RT6A 4OGEA 4CJFA 4QWEA 1YT3A 2NRWA 4M3WA 1ZQGA 3PX4A 4F5NA 4RQ0A 4DL3A 3O3HA 5J1EA 4IQVA 4HCCA 2Y1IA 1QE1A 5BOLA 4AHCA 3IG1A 3SQ4A 1XS9D 1S76D 3OYLA 4DTSA 5CYQA 5J2KA 1NKBA 3S3NA 3Q8PB 3NFAA 4LY7A 4QZBA 2MUTA 1RZTA 5D46A 2B5JA 4BDPA 3KK1A 4KI6A 2C28A 3SUNA 5KFDA 5F9LA 4CCHA 2HHVA 1T03A 7ICUA 4DOAA 9ICPA 4FJIA 3GFKB 3VQ5A 3L8BA 5DB6A 3Q8RB 5HRSA 4F5QA 2IA6A 2IHNA 4YFUA 1JLFA 2ASLA 3VN5A 4CJ4A 4I9QA 3OS2A 1ZQUA 1QSSA 3T19A 4MF2A 1L3VA 4FJMA 4CF0A 4OVLA 5E41A 3PO4A 3ZSZA 4ED0A 5BOMA 4F2RA 4M6WB 4GMJB 1D8YA 2HHTA 4Z6DA 3OYDA 9ICSA 3VQ9A 2F1JA 3B0XA 1JXLA 1A5VA 4Z6CA 1JLEA 4FJGA 2P51A 1ZBLA 3LALA 2PFPA 3RAQA 3OHBA 3KHLA 2BGGA 3NH2A 2AJQA 3LAMA 1J5OA 1BL3A 4F4ZA 1Z25A 1N56A 1SUQA 1LW2A 1C0TA 4E0DA 1Q9XA 2P66A 1TK8A 4OPKA 5J2AA 4RZRA 4NLNA 4CHYA 3MXMA 3C1ZA 2Z1JA 4DG1A 2VG7A 5CJ7A 3V6DA 5I3UA 5EWFA 2HB5A 4RT2A 4C8LA 4FW1A 4DTXA 1XSPA 2O4GA 1U9LA 3RBDA 4I2DA 1RYSA 3TAGA 3DYAA 4FM2A 4NCBA 4EP4A 2BCUA 3S3MA 4KLFA 4O3SA 1S5JA 4HUGA 4B08A 3KLGA 4RQ7A 4KHUA 4OKJA 3RMAA 1SKWA 4F2SA 5T7BA 7ICMA 4IBNA 5HBMA 9ICFA 4ZHRA 4UBCA 3SZ2A 3TAMA 4C8NA 1WSFA 2FC0A 4LSLA 4JK1A 4KI4A 3RJJA 4QWAA 4H4OA 3H40A 3QLHA 3C94A 1DTTA 4ECRA 2NRVA 1UA0A 1KFTA 1K1SA 3JYTA 4J2AA 4QZCA 5HRNA 3LP0A 3L2QA 3HM9A 4CJKA 4B9MA 3GDXA 5KFFA 5KG1A 3ALYA 1GOBA 1BPEA 8ICBA 4CGJA 4DWIA 4JUZA 4CJUA 4YR2A 2FBXA 4KKOA 4J9SA 2VWKA 1ZQBA 4FLVA 2Q0ZX 1WSGA 1N5YA 4FJ7A 3KTQA 1MSWD 4RNOA 4FJJA 3ORYA 5CWRA 2F8SA 2QK9A 1RT4A 3AU2A 5CA7A 4IKFA 2ISPA 1KCFA 7ICSA 5SZTA 1Y97A 4YFKA 2VG6A 7ICFA 8ICJA 1S9EA 2G8UA 3OJSA 4J9LA 2BQ3A 4F5PA 3SUOA 4O3QA 1UT5A 1QSYA 4Z4GA 1Z00A 4M3TA 5IILA 2RDJA 4H4MA 2ZUBA 2OA8A 1MQ2A 3Q8MA 1YVUA 8ICFA 4LD0A 3VA0A 4OLBA 1RPLA 3E2EA 4MF8A 3K57A 3SV3A 4CECA 3KHGA 2G8WA 3AO2A 4GLXA 1ZQCA 4FZZA 2P1JA 3AVFA 3I0SA 2HHWA 4UB4A 5KG7A 3UQ0A 2RKIA 4KHNA 2YV0X 1J54A 1S6PA 2FMSA 4KB1A 3U3GA 3PW2A 5DB7A 4O5KA 4AHTA 4B8CA 1NK5A 3LZJA 1SL0A 1BPZA 3V9ZA 1GOCA 3RRGA 1JLGA 2X74A 4TUQA 1VSLA 3MGHA 4J9OA 4YNQA 2KZZA 1D8LA 2BPCA 1U04A 8ICSA 9ICBA 2RPIA 4RQ1A 3QZ8A 1UA1A 1MU2A 5KFLA 4UAWA 5CR0A 8ICZA 4B9UA 5IINA 4KAZA 3VQDA 5D3GA 2KFZA 2W9BB 2FPMA 4DL5A 3GV5B 1HJPA 1ZQQA 3HX0A 1T7PA 4GC6A 4W5TA 4O55A 1RBUA 1VSHA 1S10A 4PPXA 4F91B 3KK3A 2F96A 3OSPA 2IAJA 1I3AA 4ECWA 4RNNA 5KFAA 1XSNA 1S0OA 2OPQA 2JZBA 3I8DA 1I39A 2P5OA 3ZSWA 4CEZA 4CJLA 3HO1A 2HHXA 3RB0A 4FJNA 5DMRA 3IM1A 4R64A 1BQMA 3M8PA 1HMVA 2RF2A 4O3RA 3H8WA 4FK0A 1KRPA 1BPBA 4I2IA 4FK2A 2P5GA 2FLNA 3RH6A 2BCRA 3ZD9A 2W9MA 1VK0A 4RPZA 1TFRA 2DPIA 4PGXA 5KG5A 4ECZA 3CM5A 4F4YA 1RT3A 2BQUA 1S1XA 7ICOA 4YD2A 5JS2A 3VQPA 3G0ZA 1ZQKA 1GOAA 2ETJA 2NUBA 4UB2A 4GW6A 4E7JA 3EW9A 1K1QA 3HWTA 3O3GA 1VRUA 3MR2A 4ELVA 1N6QA 4ED8A 5KFNA 4M9LA 2YNGA 4KITB 3QESA 1X9MA 1RILA 5KFUA 5J29A 3UXNA 4JV0A 1ZQFA 4FW2A 4HUEA 3OY9A 4G3IA 1ZQVA 9ICIA 1LWEA 1VRTA 4IRDA 3ETLA 4CIGA 3H8JA 2QKBA 4ID1A 3DI6A 2B4JA 3QIPA 2F8TA 1NKCA 3QEVA 1L3UA 4BDZA 3AVJA 3IS9A 4I2GA 4ZTFA 4QWCA 4I2EA 1NJYA 3FYHA 1XU4A 2R8IA 2E6LA 2DFEA 4DF8A 3T5HA 4KLGA 4IQTA 4ELUA 4YMNA 5L9XA 5DDYA 5J2CA 4TUPA 1QSLA 5CY4A 3V1OA 1BHLA 3KKSA 3CFPA 4NLGA 4BGDA 3D0PA 4FVMA 3KK2A 4DQSA 4F5OA 1BCOA 3Q8KA 3VQCA 1HUOA 3MEGA 3A2FA 4Z6EA 5DG8A 3TAQA 9ICMA 3HPOA 2HHQA 1R0AA 4CERA 4ICLA 3EWAA 4P4OA 4AHVA 2HMIA 2XGPA 4IR9A 2HW3A 3F73A 4DSLA 3AV9A 4R63A 2G8VA 5J2MA 4OJRA 1KDHA 4DSEA 4FM0A 3Q8LA 4BXOB 4Y1CA 4DTJA 5KT4A 3N97B 5KI6A 4PY5A 3ZT3A 4ECSA 4CGHA 3RWUA 3HPHA 3DLEA 4N5SA 1CZ9A 5KFSA 3THVA 3PW5A 1VSFA 4M9JA 4B3OA 3HVRA 2ZJAA 3HW8A 3GIIA 3BJYA 5KFZA 3HP6A 3B6PA 5KT5A 3RBEA 3L2UA 3ZT2A 1TL3A 2FBTA 4K4HA 2P6RA 3DRRA 2RDIA 3L2RA 4CFBA 4J9NA 1NJWA 4ECQA 4DTRA 5HRRA 3H7IA 9ICJA 4CJEA 4KLUA 1C0MA 3AVHA 1RTIA 1BI4A 3K59A 1RT5A 3NGZA 3NGYA 4QW8A 4RQ4A 4AHRA 3RTVA 3HK2A 2VA8A 5KFBA 1SV5A 2Z1IA 1RDBA 4FLZA 1ZETA 4HCBA 1C6VA 3V72A 4CGIA 3PW7A 4ED1A 8ICQA 4OPJA 4F8RA 1LW0A 4YMMA 3QEAZ 1ZQPA 3M9MB 2IOCA 3GIJA 3G6YA 3C1YA 3RB4A 3RAXA 3C2MA 5JUMA 1XWLA 1BIUA 1CXQA 1JXBA 1ZQAA 5HP4A 3MDAA 3E01A 3OYEA 1JLBA 1ZQDA 4RW8A 4CEAA 1S1UA 3V7KA 1X9WA 9ICKA 4KLMA 4I9LA 3SUQA 2C2EA 1DGSA 1J53A 2BKEA 1SKSA 3KLIA 3L3UA 2R8KA 1FXXA 2Z1HA 3AVBA 4YXMA 4CIFA 4PQUA 5J0WA 2XCAA 3PUFA 4RW7A 3DMJA 4MFFA 1IKWA 2FPLA 4KREA 3SNNA 4J2EA 4M2YA 3GIMA 4M42A 1WNSA 3AA3A 1CZBA 4YP3A 4EZ6A 5HMLA 3ZSOA 3LZIA 4CJQA 1S9GA 1JMSA 4O0JA 4CE9A 4CESA 1V9PA 1D9FA 4I2FA 4KLIA 2Q3SA 1ZQOA 4JS5A 4ZTJA 4JWNA 2YKMA 4BE0A 2OPSA 2ITGA 4C8KA 2HHSA 1BIZA 2IHMA 1Q9YA 4F92B 5DKWA 2QXFA 4CGFA 4KLLA 4DU1A 4FJ9A 4YMOA 1ZQSA 4QCLA 5BPCA 3DLGA 2G8FA 2PXIA 5KFRA 4IFVA 1IKYA 3P5JA 2OWOA 5DGBA 1ASWA 4TSXA 2WTFA 4RQ3A 4E7KA 2BDPA 4I2HA 1UAXA 4XRHA 2R8JA 1WAJA 3PR4A 3V9UA 4UAZA 5EWEA 3MGIA 3KLHA 1BCMA 2VG5A 4CHQA 1TV9A 3T5KA 3NAEA 3SPYA 5J2DA 3QEXA 4F93B 1VSEA 9ICAA 3OYFA 3SV4A 4NLZA 1Z3EB 5DLGA 3V9XA 4UB1A 3SYZA 2J6SA 2VWJA 3I0RA 4FZYA 4M9NA 3DLHA 7ICPA 2DY4A 5KG6A 1B43A 3KLFA 2BHNA 4QZIA 4CHNA 5L1LA 2QKKA 4FLXA 4RG8A 4E7LA 5KFYA 2NRZA 4IR1A 2D0BA 3AUOA 4M3YA 5KFXA 1VSMA 4EYHB 2PYJA 3TI0A 4ED3A 9ICNA 3B6OA 5DLFA 3TQ1A 3RMDA 3PVXA 5SWMA 2D0CA 3LWLA 1NJXA 2KZMA 3RB3A 1UOCA 4I7FA 4YQWA 1B9DA 3C21A 1BI4B 4KLJA 4CGDA 3KD5E 3GQCA 2YKNA 3NHGA 4DL2A 1ZBHA 4DTNA 4LVSA 1BPYA 3C5GA 5DQHA 1ASVA 2YNHA 1IM4A 1LAWA 1BQNA 4I2BA 4OKKA 4LSNA 3MBYA 3P1GA 3DM2A 3IAYA 3NF8A 8ICTA 1ASUA 4FXDA 3V6JA 3SJJA 4KRFA 4O3OA 3HL8A 3LK9A 4R65A 3AU6A 1RTJA 4OGCA 4IQUA 1HNIA 8ICIA 2UVVA 9ICOA 3T1AA 1N48A 3ZT0A 9ICWA 4DQPA 4I27A 4KMUA 2W8KA 3T5JA 5D49A 2UVRA 1NK4A 3V9SA 3PW4A 2AQ4A 2EX3A 2X6NA 1EKEA 4DSKA 1ZQTA 1A5XA 3O4NA 4I2AA 4RQ2A 4AH9A 2LYHA 3EZ5A 3HVTA 3V1RA 3QO9A 1HYZA 5F9NA 4CHOA 3AA5X 2DPJA 5KT7A 4Q45A 4FCYA 3AA2A 2WOMA 3L2VA 3V1QA 1S0NA 4DTPA 3OHAA 3K4GA 4M9GA 3JPQA 4CHZA 5EU7A 3M8SA 2FPKA 2BPFA 3JPPA 2KN7A 4JS4A 1KLMA 1EXNA 3ZDDA 1RTDA 3EPGA 1NOMA 2XRIA 3RB6A 4KHWA 3C95A 3U6FA 4CEQA 1B9FA 4F4KA 1F21A 2C2DA 4RUAA 4DL6A 4W5OA 5DB8A 3VQBA 1SZPA 4JV1A 3F9KA 4IRKA 4CIEA 4J9KA 3JPTA 4F4WA 7ICGA 1FK9A 5IIOA 2XY5A 4FBTA 1X1PA 4GXJA 2ZJ8A 4Z4HA 2XC9A 3ZT1A 4L8RB 4DS4A 4CF9A 1Z00B 4Q8FA 1RT1A 1T3NA 4DSIA 1BGXT 5KFTA 4KN7A 4CFCA 3OYCA 2MUTB 2XY6A 3PW0A 1D5AA 3SI6A 1YTUA 1MC8A 1RNHA 4M45A 2BCVA 8ICXA 2PFNA 3SI8A 4CJVA 4QOZB 5DBAA 5CZ2A 4J9RA 9ICTA 3RJGA 4M3ZA 1TVAA 1X9SA 4DFJA 3M8RA 4QW9A 2A1SA 1RXVA 2JEFA 4O5CA 1EP4A 2BR0A 4RT3A 3QEPA 5C24A 3NGDA 4KLTA 7ICJA 5L1JA 4YR0A 1JIHA 3NF7A 1RXWA 2PY5A 1DOQA 1QS4A 5L1IA 5HNKA 1NJZA 1SKRA 2OZMA 3MR5A 2GUIA 4TQRA 1KTQA 5J0XA 1TAUA 1C1CA 4TQSA 2PI5A 4DQIA 1XHXA 3OYGA 1CEZA 4PHAA 3VQAA 1X2IA 1B92A 4FO6A 2JEIA 1RBVA 5J2JA 1TKXA 3BDPA 3KJVA 2W9CA 4XQ8A 3ZDAA 5CP2A 1RDAA 4IG0A 3K5NA 3NF9A 3PX6A 1TVRA 4Z4IA 1BPXA 1JL1A 3ZSYA 1ZQRA 1NOZA 1L5UA 4M04A 4E7HA 3ISDA 1ZQNA 1J9AA 3GILA 1EXQA 4NCGA 1RYRA 5J2HA 4KLSA 3L2WA 4N76A 4FLYA 1ZQZA 4QZFA 1O1WA 4CJ3A 4I28A 1COOA 5J0PA 4PHPA 4PGQA 4N41A 4W5QA 5EOZA 4EYIB 4UB3A 4O5BA 4KB0A 4P4MA 4EBEA 4F4XA 3DRSA 2KW4A 3BQTA 1HQEA 4MQ3A 9ICVA 2IDOA 4Q43A 3MR3A 4FBUA 5HHIA 2AU0A 5KTQA 3KHRA 5KFEA 3JPSA 3V6HA 1HRHA 3OYJA 3OSNA 3UIQA 3ZSQA 4O5EA 5KFKA 2BPGA 3MECA 4ELTA 4CF1A 1C1AA 4KHSA 3CM6A 3DOKA 3OGUA 3V6KA 4RQ8A 2LSNA 3BQ2A 5I42A 3S9HA 2ZD1A 3QEBZ 1L3SA 4B9SA 3OJUA 4FYDA 4NXZA 2RN2A 3AO1A 2VA3A 4AHUA 1S0VA 5J2BA 4J9MA 2V9WA 3ZDCA 4R66A 4TUSA 4AILC 2HHUA 1VSJA 4I2PA 4NYNA 1KVBA 3KIOA 3PV8A 4UAYA 1HJRA 2HNZA 4DTUA 3PY8A 1U4BA 2JEGA 4M41A 1LV5A 4CFAA 4JV2A 1S1TA 5C5JA 3LP3A 4F3TA 3G10A 3EYZA 3JPNA 4XA5A 4EZ9A 3VA3A 4QZDA 1JL2A 4ED6A 4FJ5A 3CFRA 4KHYA 2E6MA 1ZQJA 5KT6A 3L3VA 2ZTCA 4F3OA 3P83D 1UT8A 4NLKA 1L3TA 2FMQA 5KFCA 4DFKA 1FKPA 4ECYA 4H8KA 2F1IA 3TARA 3LP1A 3OYIA 3C6UA 1XI1A 4JLHA 4RPXA 5J2IA 2OPRA 1AROP 4QZAA 1U49A 1D9DA 4BXOA 4R8UA 4CEOA 4K8XA 4G1QA 2G8HA 4KLDA 4CEFA 3K5LA 4CJPA 3AO5A 3SQ2A 3UXPA 8ICLA 1WCLA 5FDLA 2OPPA 4RW9A 3TFRA 4FZXC 1ZBUA 3T5LA 4DFPA 3MEEA 2XHBA 3LWMA 1W0HA 9ICEA 1ZJNA 5FRMA 4Z4CA 1JKHA 1QTMA 1TKTA 4QZ8A 4MEYA 1S97A 5KG3A 1NK8A 4DSJA 5J0UA 1K6YA 4R5PA 2PI4A 1Y88A 4FLUA 4UB5A 7ICKA 1ZQMA 8ICYA 5DGAA 3NGIA 4RW6A 3VQEA 4DLEA 1VSKA 2IS3A 1SL1A 1IO2A 4Q5VA 5KGWA 4CGGA 1U48A 2Z1GA 5DBCA 3ZCMA 5KRSA 2UVUA 1TV6A
chains in the Genus database with same CATH superfamily
1B0VA 2V8GA 3IR6B 4KHPJ 3KKRA 2W9AA 4B9VA 1LAVA 2JLEA 2YHAA 1NZAA 3NVZA 3RJHA 3GV7B 5B8HA 1O0PA 3M9NB 2ZJPQ 2A1JA 3VHQA 2D1CA 3VESA 2NV3A 4NCAA 2YHBA 3R3TA 4RWXA 4LFCJ 4F72A 3IP0A 2AWZA 4NOHA 9ICGA 2HZAA 3PNCA 1AZSB 1K8KA 4RJVA 1VIOA 1QVGR 4KE5A 2IJFA 3CJTA 2WVBA 3MCOA 1WEYA 3HHKA 5HROA 5JXSA 4HVJA 4ZVOB 2J0QD 4WFNL 2BCSA 4C8OA 2MGZA 4LH5A 3QMLA 4BGAA 4P0PB 3W63A 4FLWA 3WEEB 1AW0A 1KQSM 3EZOA 3R7BB 2CZVC 2NLWA 3CG7A 3FFIA 4OYBA 5CRXA 2D41A 4EENA 1NO8A 2V8DA 1UJ5A 2QMXA 4JP8A 5TZVA 3N6MA 3K5PA 2UUAK 1YJRA 4DL7A 2WAQD 1N34K 2DFLA 5FROA 3PG9A 3ASMA 2KG1A 4CJTA 1DBDA 2EW9A 1E6VB 3HHNB 2OPPB 4IH5A 4J91A 3SSSA 1RT7A 3IS9B 4P2HA 3Q8QB 3HRDD 4A8YA 1EKRA 4JN4A 4ZPVR 4I6YA 2F1FA 3CDEA 4LF8K 4M8LA 1HKGA 3G6XA 3SAFA 4DV0F 1D0EA 1R89A 1OY6A 5GAEU 3NE6A 2HNDA 2VDHA 5IIJA 1C7YA 3KHHA 4Z4EA 4MFCA 2XG8A 2CJ9A 1FO4A 4B9NA 4RU9A 4CHPA 3PO5A 4MFBA 3K1ZA 3T69A 3CI5A 4DS5A 1T94A 2GJ2A 1NGJA 1Q18A 4YB5A 4CJRA 4W5NA 5CZ1A 2I5JA 1JI7A 4DV1F 1XO1A 5K4LA 3GJRB 2WBNA 1C4CA 2P9EA 4XPEA 1TUYA 4DR4F 3NY0A 3ATVA 2ZIXB 2MKJA 1BU6O 1Q3VA 4W5RA 5J2FA 2B9XA 2JLFA 2BJ1A 4Y2JA 1LFPA 1RAJA 4NMXA 4IQWA 3CCRS 1UHUA 3AOAA 3BO3A 4CK3A 3IRXA 5DDMA 3PYGA 1ULRA 1RDCA 5KFVA 1XERA 8ICRA 2DKOB 2CGLA 2KSOA 4YOXA 3UXOA 3MM7B 3LPUA 2KIWA 2MLXA 2BUNA 2Z8QA 4P2SA 5HR7A 2B6AA 4CJ5A 2ZC3A 1AXQA 4OZ1A 5E26A 1VISA 2IDEA 1QLNA 2ZWOA 1VC0A 1JLQA 2JDJA 2ASJA 1NZPA 5HP1A 2ZH2A 1FEHA 1HX1A 3NAIA 5FLXO 4AHSA 3TAFA 1DAXA 3DLRA 3U9DA 2QA4N 3G9CA 2QLTA 3QIOA 3FBBA 3KJQB 1WORA 4TU8A 4CZCA 1SWWA 4RR5A 5BRHA 4FPBA 4DUYJ 4DUZK 3CCJS 2Z30B 2XY7A 4D3GA 4WFBQ 1E6VA 1RSCA 1XMOF 4BE1A 5C42A 1JMTA 1NSQA 1RT7B 4ES3A 3Q7BA 4CJSA 4MFAA 1ZBIA 1F3VA 4XUSA 1I94F 2YMMA 1FJGF 4FS2A 2VBYA 3K7RA 1WI8A 3B4DA 2VF3A 5DG7A 3KG0A 2PN6A 1HWJA 3SLCA 3QSIA 1RBTA 5BR8F 1VR6A 4ICLB 4GKJJ 2RHKA 1FJCA 1LCUA 2O67A 2O8EB 5TKWA 1WB9A 4OJPA 2E7WA 2ZTDA 4DU8A 3DCAA 4H0OA 4KLHA 4E1JA 3UPQA 3N4MB 4NL9C 3QWUA 3UDVA 3K2PA 3AVIA 1CLQA 9RUBA 1RDDA 3KBBA 4M3XA 3ENBA 2FZCB 4C3MA 1S4EA 2R7RA 3H0RB 2OMOA 3X3UA 4RWTA 3D67A 5CYMB 3H42A 5KG4A 1RHQB 2Y8WA 1OVYA 3R6GB 4Z7CA 4IO9Q 2HVHA 1BLUA 3WKCA 4PUOA 1RYUA 2N7CA 1CUKA 4FWLA 1YHQS 1S9FA 2FZKB 2FZGB 4JKBA 1RT1B 2HRTA 4ED2A 2W9BA 1NK9A 3DOMA 3N01A 2UVWA 1RT2A 2M0NA 3E51A 2DVIA 7ICEA 3QRQA 2XLKA 1X60A 2BV3A 4EAHD 4NX9A 3ILLA 4KX5A 1YLXA 3M6UA 2OPQB 7ICNA 3HYFA 3UQ2A 2FJVA 4ZOHC 3R2CJ 5THWA 4F5RA 4ECTA 4BVOA 3RJIA 3M7DA 1YX2A 2MAXA 1VQSA 5HP1B 2A6OA 1ZRNA 1VQYA 2CQDA 1X4HA 3H4BA 3SQ0A 3CCQS 3D6FB 1SL2A 2OEJA 1WBDA 4OI0A 4PHEA 4Y00A 3AVAA 4E1NA 4JI0J 3F5AA 3DOLA 2J76E 4K4XA 1X6JA 4DL4A 3AA4A 4ECVA 3CJBA 1KHVA 4BC2A 1BPDA 3TUIC 3OD2A 1PC4A 4PRFA 3DLBA 4KTQA 1FXLA 1H98A 1YJVA 3AVCA 4CF8A 1FRLA 2DCUB 4BC3A 4LIRA 4DR2J 4CDGA 1X40A 3EPIA 2X3GA 3SQ1A 2IVOA 2IVYA 3O4QA 3QGIA 4C11A 2FGOA 2LP4A 2P9SB 2Q1LA 3MDCA 1S1WA 5ALZA 5IIKA 2W3SA 3AJDA 2W9CB 1Q82O 2R4FA 5FLXY 4QIWF 1Y00A 2E1FA 9ICHA 1RAGB 2OM6A 3QEIA 2F2AB 2W01A 3K5OA 5ALDA 2ASMA 2ZH4A 1Y5NB 1IH7A 3VQQA 4YN4A 4OL8A 4UZBA 3I4HX 4K0KK 2ZZNA 2ISOA 4NA1A 4IEIA 5IT0A 5CYMA 2EZZA 3D6RA 1ZM2A 4ZVEA 4OLOA 2HMXA 3IUCA 3C2KA 4NM1A 2FJWA 5I3PA 2IHR1 1HNIB 5J8YC 2FHMA 5D0EA 2D8CA 2UXBJ 1NKEA 2DNLA 2FLLA 4OJ3A 2FBVA 5AKJA 4ED7A 1T8EA 2BW2A 1HWIA 1GLAG 3TQEA 2HFNA 5CAAA 4Q0BA 2YTCA 4FP9A 2Z58B 2HYIB 1XMOK 5KG2A 3NCIA 3DOKB 1X42A 2G09A 8ICEA 1BISA 1ZD3A 1DGKN 3MPDA 1FTRA 2RDDA 1PZNA 1RLDA 4XEIA 3A8JA 5GADP 3HT3A 1I3OB 2H4WB 2GQ2A 5AR0A 3LM9A 4YY3F 4RQNA 2BCQA 3J8AA 3OHRA 1QQCA 3C6TA 3CQ8A 4OHWA 4WTOB 1Q78A 3M05A 4WXOA 2GS8A 5DBBA 4KH4A 4ACOA 5A0YB 2FY8A 3P45B 3MPUB 3VEWA 1LKZA 5LSRA 1A5WA 3JAMY 3BN4A 3VQ8A 3MR6A 5AXMA 3K9KA 4IJAA 1OQ6A 2RHSB 2Y1JA 2V7ZA 5FP0A 1WAFA 2E5JA 3LVWA 3G8QA 4V19X 2RSQA 1MQ3A 4OI1A 1Z1VA 3TAEA 3QE9Y 3LPYA 1YRTA 2YNHB 3T7ZA 1KEJA 3KK7A 4CO4A 1DT9A 4I6WA 1FKPB 5ALIA 2AIRB 1XC3A 3FE1A 1J5OB 3EY1A 4O0NA 3CJ0A 2CIMA 4NXMJ 5M1FA 1UPPA 1ZXOA 4IFEA 3OYKA 1IXRA 2J6UA 2HOFA 2IVNA 1IWGA 3V81A 1XUPO 3BGOP 1Z1BA 5F0WA 1MWKA 1H7XA 4HH1A 4USTA 2QWRA 1L6NA 5IXUA 1SZHA 3ULHA 3WC2A 4M6WA 3IBCB 1TELA 3MAQA 1NK7A 3OYMA 3M2RB 3BQ1A 4JKGA 4XIUA 5KT2A 2UXDK 4F50A 2ADCA 2RNEA 4JBCA 2O6KA 2Y9HA 1UTAA 4J9PA 5GMDA 4USHA 3MHYA 1H38A 4C0HA 3QNOA 3PDNA 5K8MA 2FE9A 5IWAJ 1H72C 4YS2A 2EC0A 4PKDB 4NLPA 3DLLQ 3MXIA 4KHRA 4O9MA 5D77A 2R8HA 2RS2A 1C0TB 3OVNA 3JPOA 3E66A 1ICEB 3PRDA 1M1GA 4J2DA 2PZSA 2QLFB 3THWB 3KFWX 3DAWA 2EZXA 3G6ES 3D28A 1BNPA 4M7YA 4NEYA 1HR0J 3E9PA 5AQZA 3VQ4A 1OH7A 3I31A 2IBKA 1FE4A 4A59A 2PD1A 3I96A 1EX4A 2CGJA 4GKKK 4JI7J 3I55N 3GFYA 4QWEA 4AQYJ 1N5WA 4KT0C 2NRWA 2V4JB 1YBTA 1ZQGA 1SV0A 4TY8B 3M6ZA 5U47A 3PX4A 3C15B 2B8QA 3F41A 5ETTA 2KI2A 3T1HK 5BOLA 4AHCA 3CCVN 4FKXA 1XS9D 1XR5A 4A2BA 3OYLA 1WF2A 1GT8A 1NGBA 5AM0A 2P9NA 1QAJA 4CTAB 1JUDA 2FY1A 4PWDB 1H2UX 1REGX 5HMZA 5HROB 4IOXA 3CO9A 1DTQB 1R31A 1UZDA 7ICUA 3ELHA 3OXGA 9ICPA 4B9QA 4FJIA 4OZ3A 4Y2YA 4NLBA 3MPVA 5C10A 3L8BA 1BWVA 2ZGZA 5HRSA 4P9SA 2NO4A 3LVVA 5C2DA 4TLQA 1WF1A 3OS2A 1ZQUA 3M8QB 1L3VA 4FJMA 4OX9K 1S6PB 4AXJA 3NLCA 3FGUA 1ZA2B 4MKYA 5BOMA 1JNZB 3DU6A 3PHTA 1V4TA 1D8YA 2HHTA 4Z6DA 3U27A 2F1JA 3N4WA 2AXTU 4ZPDA 2XIDA 5HL7L 2DGTA 2P51A 1L8LA 1JJHA 1ZBLA 4UY85 2CA9A 1R6YA 3LALA 2PFPA 2MLZA 1YJTA 4MTPA 2UXBK 2EPIA 3LAMA 2MKKA 1YJWS 4IOCL 2B51A 1N56A 1H6KX 1SUQA 3WX8A 1UVNA 5AQQA 2LA6A 1LW2A 5MLCQ 1SXLA 5B09A 2FXUA 1OYEA 4B1XB 1Q9XA 2KJVA 4JAXA 4RZRA 1NLVA 4CHYA 1KAZA 2YHWA 1MN9A 2LQ9A 3GJTB 5LY3A 5HSPA 3V6DA 3D54A 3DXKB 2ZNZA 4ZVSB 4RT2A 4C8LA 4DTXA 1XSPA 1SZ2A 2O4GA 3RBDA 4DV5F 1ZOTA 4NWIA 1UJ4A 1OH8A 2AP6A 2J9EA 3FQLA 1M5KC 4EP4A 2BCUA 4IXCA 3S3MA 3QU9A 4O3SA 3I76A 3PNIA 4LJMA 1U2VA 1I1GA 3NRWA 4KHUA 4OKJA 2O8FA 3RMAA 4PG4A 2HHHJ 3E9OA 5E7OB 1OXJA 2P9NB 4M5MA 4IBNA 3DC2A 3QU7A 4ZHRA 3HM8A 1N4LA 2QARA 4UBCA 4CRXA 3CJ5A 3TAMA 3M32B 2FC0A 4LSLA 1FKAF 2YNFB 3MMCA 2ZXHA 4QIFA 1RT3B 4GVBA 2E5LK 4USUA 1V3ZA 4DMZA 2HF3A 4PZOA 2CNOB 2WOMB 5ALLA 1FRMA 2B6AB 2Q1NA 3DGPB 1K1SA 3N7PD 4J2AA 3GZ7A 3RAMA 3L2QA 3HM9A 4IQMA 2PMZC 1Q81T 3GDXA 4ZVTB 3AB4B 3TNVA 2L08A 1GOBA 4CIOA 5LMNK 3O8MA 4DWIA 1GLCG 3R5CA 4CJUA 1KC8T 1BDGA 2IVPA 3MGJA 1PBUA 3D2EA 1EETB 4WXWA 1N5YA 3NAHA 3N5BA 4NLOA 4ZPBA 1MSWD 3QIPB 4FJJA 4B3TJ 2F8SA 3AU2A 5AE1A 4IKFA 2YQEA 5KOWA 7ICSA 4HH0A 1KCFA 4GNIA 1MMDA 1Y97A 3UE5A 1NRKA 1WUUA 2VG6A 5DETA 4PXDA 8ICJA 3CJ3A 2W2NP 1RI7A 3KJFB 3JQJA 5KQ8A 3CCRN 3SUOA 1QSYA 3N7RC 5EE3A 4DUZJ 4DUYK 3FBEA 4MAKA 4JHDA 2ZUBA 4LD0A 3Q8MA 1YVUA 1H2TZ 1Q5YA 3L4QA 4MF8A 2DHSA 4USIA 3SV3A 2YXLA 1K8AT 3LYSA 2G8WA 2FIUA 1ZQCA 3AVFA 2CFXA 1CJTB 2KMDA 3M6KA 5AZIA 1XMOJ 3MM8A 5A6PA 5L1MA 3KXDA 3F53A 5DB7A 2CH6A 1MROA 4B8CA 1CJUA 4X2BA 3EN9A 1UP1A 1NDLA 4NL5A 3CCES 1VDVA 1ITPA 5BR8K 5AFUA 3V9ZA 1JLGA 5J2MB 2BH1A 3DHWC 4TUQA 4MDAA 1VSLA 5AQMA 1TU0B 4YNQA 5BR9A 4KHMA 4WU3A 4F04B 4R5PB 3L9ZA 3DNCA 5CR0A 1HNZJ 8ICZA 2M88A 3VQDA 5DZ6A 2YNIB 5D3GA 2HIYA 3Q0AA 5AQNA 5MLCV 1U09A 3GV5B 1HJPA 5GAHU 4DR5F 2AYMA 2AX0A 4PPXA 2E3TA 3OSPA 1RJJA 4DG1B 4FFDA 3FLCO 3B78A 1KD1T 2VD3A 1XTZA 4EMDA 5BRFA 1X9XA 3I8DA 5B5EU 4RO0A 4ES1A 1K0TA 4WJBA 4JI6J 2ZZTA 2A1BA 1GXTA 4PWWA 1UQVA 3TZZA 2E7VA 2IRYA 3HO1A 3DLKB 1KKHA 4CNZA 2BJEA 2LEAA 1L7PA 2ZHBA 4PYDA 4O3RA 1RBOB 3H8WA 1JRPA 2C2ZB 3WK4A 3VAFA 5KOXA 1FTCA 2FLNA 4DFDA 5J2QB 4DCHA 1RDRA 4KY3A 2PEHA 4OI2A 1RACB 2W9MA 1WC3A 2ZUGA 4PGXA 1X6IA 4CWBA 4OIXA 3NASA 3HJEA 4H4OB 3TU5A 1C4AA 1H0HB 2CQ0A 4UB2A 2NQPA 2KM8B 2AH5A 3O3GA 3HWTA 3OXFA 5K8OA 2BKPA 2P9SA 3MR2A 1N6QA 3K0SA 2V8HA 2VODA 1JLAB 1NU4A 4M9LA 1RWOB 4CLTA 4QR2A 5KFUA 2QXLA 1OYDA 5B66U 3TADA 4RW7B 4J9VA 3RVCA 3B8HA 3H8JA 4DDFA 2QKBA 4OX9F 3DI6A 3OFGA 3QFWA 1AFIA 4LF7K 1Z6RA 1AA1B 4OQJA 3THPA 3QEVA 4V19S 4IKAA 1NGHA 4ZTFA 3WIVA 1NJYA 2QTDA 1XU4A 2R8IA 4WU2A 5AQXA 5ALMA 2HFSA 2BJ7A 4C4SA 2NLXA 3T5HA 4IQTA 1WTBA 2YKMB 3ILOA 4S0MA 3Q23A 1DGJA 3B4MA 2B9WA 1H3DA 3KKSA 4FXWA 3IGVA 3BZKA 2RQMA 3D0PA 2YB4A 2YQ3A 4DQSA 3FBCA 1HLWA 4LFCK 4BR2A 5ADXH 4DV3J 2PE8A 2IIRA 5KPRA 4Z6EA 4CGZA 3TAQA 5HO4A 4BR4A 2HHQA 2UU9F 3OTOJ 4PKHA 4DR6F 4EK2A 4D3HA 3G4SS 2HQIA 4B3RJ 2KJWA 2OLWA 1I6JA 3O1BA 4U6PA 3UKRB 5I9EB 4OJRA 1ZXIA 4LRDA 2VU5A 3CCMN 3CCUS 4FM0A 3Q8LA 3QQCD 2OCEA 4BUGA 3VAIA 2QEXN 4AXIA 3ZT3A 3R1HA 3RWUA 1WWVA 4M5JA 2Z7JA 1SQFA 3DLEA 4M5DB 4PG5A 2A41A 3PW5A 3M30A 4ZDNA 2MZTA 3GG1A 3HVRA 3IDHA 1KNZA 5CZVA 2ZBRA 4X4SA 5KFZA 2DRAA 5KT5A 1GX5A 3RBEA 1M5PC 4DR3K 2E8PA 4JI7K 3L09A 1IKYB 3ZT2A 1TL3A 5D4LA 4FZMA 2XSJB 2FBTA 1Z19A 4ILRA 2D4WA 1SIZA 2CKWA 1WG1A 3L2RA 3EX7B 4CFBA 1HL6A 4I0WA 2ZH3A 4ZPWR 5F2RA 1NJWA 2V2VA 1TMMA 4DTRA 2F4VF 1MWMA 3BF3A 4UOGA 9ICJA 4I7FB 1OO0B 2GTDA 2DNOA 5HJYA 1APSA 1RTIA 2E1PA 3K59A 1RT5A 2RRDA 2G1DA 4M95A 4RQ4A 1ZTTA 5KFBA 1T9UA 1U1NA 4ANDA 2MEWA 1W7AA 3CCSN 3DI6B 3GE9A 1C6VA 3V72A 2ITMA 2RUSA 3DM2B 4YN3B 2RD5C 4ED1A 5BXIA 5ALVA 4OPJA 4F8RA 4FWPA 3VAGA 4YMMA 3QEAZ 1IV8A 4OYWA 1S22A 1S5ZA 1ZQPA 4XH1A 4TU9A 2IA0A 2XZWA 3GIJA 3D2FB 3MWPA 3RB4A 2MB0B 4X62K 3OR2A 4CLLA 3SSQA 4OI3A 1IJEB 1ZQAA 2HWIA 1ZQDA 1FVQA 3RG6A 3A8KA 9ICKA 3S6JA 3R7SB 2NXJA 4UY8T 1VS3A 5LXYA 4DQ8A 3KLIA 2R8KA 2Z1HA 3KUHA 2ODGA 5AZJB 1GTHA 2IVMA 1RAAB 2E1ZA 3BY5A 1IV0A 1VQKS 3PUFA 3ETMA 1DJ0A 2YX8A 3BQ7A 4KREA 5AI9A 1WBBA 1WELA 2CPJA 4BJQA 1VC6A 2HFZA 1CZBA 4LREA 3TJ8A 2P9CA 3ZSOA 1S9GA 4ILGB 3D1HA 4C48A 2K06A 4KLIA 2K8GA 3CDUA 4CP5A 4OHYA 4JWNA 3W3DA 2GQQA 2OPSA 3H0LB 1VBYA 4CLKA 1BIZA 4DV1K 2NRRA 3AB2B 3M30B 4EWTA 2QXFA 4CGFA 4YMOA 2VKQA 3QFPA 4IO1A 2KL8A 1OH6A 3PFOA 1M6YA 1RUSA 2OWOA 4TSXA 4KR0B 3ZZPA 5JVGQ 3GFXA 4RQ3A 1W7WA 4E7KA 1RQ0A 2BDPA 2DXEA 2HURA 2L3MA 2OSQA 4XRHA 3OV7A 1WAJA 1WC5A 3MDQA 4IJNA 2DB1A 1T95A 3ZX2A 3QXGA 2W6LA 4CHQA 4TLRA 3NAEA 4PG8A 4CZLA 5J2DA 4CYUA 2XYHB 3T6BA 1FFUA 3OYFA 2DHHA 2KKPA 1M90T 1KQFB 4MFBB 2VWJA 4FZYA 4M9NA 2HF4A 1Q7LB 4TNOA 2RU9A 2I5JB 1TP7A 4FXVA 2GVDA 3GU3A 4CI6A 5L1LA 2QKKA 3U9ZA 3NVMA 4E7LA 4X4UA 2CQ2A 5KFYA 4IR1A 3UWTA 3AUOA 3OW2R 2AMCB 4M3YA 1NSPA 4EYHB 3DJCA 2WF7A 4PG7A 2XNRA 4U7UK 5DLFA 3R5DA 4HT5A 1HJOA 4CLPA 4RLEA 4JI2J 5AM1A 3F2BA 3RB3A 2XMMA 2F3JA 1B9DA 1JROA 3QJPA 4KLJA 5AQYA 1Z2LA 5ELZA 3NHGA 2HEKA 2WFAA 2E29A 1UW9A 3N28A 5LJ5Y 2WONB 1JALA 2CQ3A 2WF6A 3DN9A 4U8VA 3NNHA 3BO4A 4I2BA 1IKXB 3P1GA 3IAYA 3KFUF 1ZPWX 4ZVRB 3IN5A 5AI0A 2FHOB 2W2QP 1M5VC 3HL8A 3LK9A 3CJAA 1S9GB 4IQUA 3O1WA 3FZMA 2JVOA 3ZT0A 4BHQA 3M2UA 4QYZJ 4KMUA 5HL7Q 2UXDF 2KH9A 3ZZZA 4BLGA 1YJ9S 3V9SA 2KD1A 2EX3A 2EFQA 3O08A 1EKEA 2FUG9 3MM6A 4DSKA 1EWQA 1ZQTA 3O4NA 1NH7A 4NLTA 2D3UA 3NBPB 4DR1K 5IQ6A 4LF5F 4ZVHA 4X66K 2P9IB 3O9UA 4JI1K 2ZOGA 4PKIA 3D2NA 4JI5J 3WDOA 2WOMA 3V1QA 4PXEA 3G82B 3DRPB 4DTPA 3K4GA 3DGPA 4M9GA 1J5EK 3AY9A 1SQEA 4DJBA 2KN7A 1UWAA 3QT7A 3L4BC 5AQSA 3IMXA 4ZIVA 1RHJB 3VEXA 5JTIA 3PLAA 2EAMA 5BN8A 4DL6A 3T41A 1LXJA 3NCPA 2OKQA 1IBLJ 4BRMA 4IRKA 4DCCA 3HSZA 2W2OP 1EO1A 3JPTA 1FK9A 4JI8F 1N33K 3MM9A 1QE1B 1X1PA 1Y64A 2YX4A 2XC9A 4L8RB 4CF9A 2G1HA 1RT1A 4OV1A 1BGXT 1RT2B 4BG8A 2VFVA 1N8RO 5J8YA 4AUKA 2O66A 2A2DA 5GIOA 3G4SN 4DV2J 1CJTA 2GHVC 4JOUA 2IVFB 4ZIWA 9ICTA 2ZIVB 2KK0A 5AIBA 4FDFA 1TVAA 1WSVA 2OI2A 2QTWA 4DFJA 2GQCA 2CPZA 2WUSA 2MA1A 3MR7A 3MWTA 1EP4A 3WU2U 2GNKA 1FJGJ 2NCKL 4QZVB 3LH2S 3QEPA 3I9ZA 2UXCK 1D8BA 2X3DA 3E58A 1O8BA 2MTLA 5AXNA 1IXKA 5L1JA 2HWTA 3N7SC 1JIHA 4DV3F 1RXWA 2YY6A 2EFNA 3MMJA 3MPWA 2I9SA 1OSDA 5L1IA 1SVDA 5HK4A 3OL6A 5D3GB 4CZGA 2OZMA 2H3FA 1B0TA 1LOTB 4CZIA 3TOQA 3ZNUA 1QUVA 3KMQA 4ZK7M 4TQSA 2V50A 4HAIA 3QO9B 1KS2A 2E1YA 3OYGA 1CEZA 1KONA 4A5BA 1X2IA 4FO6A 2JEIA 1RBVA 2JX2A 1FIQA 3HT0A 3F9MA 3CW2C 3KJVA 2W9CA 3ZDAA 1URNA 5AJ3K 3QUTA 3PX6A 1TVRA 2OD4A 3ZO7A 3C6UB 3A12A 1KTVA 4E7HA 4K5SA 2DO0A 1ZAXA 2VG7B 5D0GA 2EFVA 1VQLS 1ZS6A 1EXQA 2BE7D 1Y9OA 4FLYA 2BEFA 1O1WA 4I28A 3MEEB 2HPUA 3D7SB 3L7UA 5EOZA 4UB3A 1TKTB 5TISU 2F7TA 3IAM9 1NPPA 3OR1B 5ALPA 2DGSA 3UM9A 2KW4A 3BQTA 3B6BA 2QWOA 1HQEA 4MQ3A 2IBOA 3QFUA 4FSVA 5KFEA 4J90A 2V2ZA 2WSCC 2R2UA 2LHTA 1T9TA 3OSNA 3UIQA 1XMBA 3THXA 3QNMA 3FSYA 5F3ZA 3AJ2A 1HNXJ 2OAUA 3UD5A 1C1AA 3CM6A 5LMUJ 2G5IB 3DOKA 1LKYA 3OGUA 3IXQA 3BQ2A 1CJKB 4P0PA 2ZD1A 1L3SA 4FYDA 4NXZA 3AO1A 3LP0B 4MLHA 2JR5A 3D2SA 4J9MA 3MUTP 1LK5A 4K4TA 4C97A 5H1SQ 4TUSA 3ZXWA 4XK8C 3TW0A 4NYNA 2FVCA 1KVBA 1CLFA 3KIOA 3TTFA 1R8AA 2HNZA 4LR7A 2EZYA 4W98A 1LV5A 1A7GE 4CFAA 3LP3A 2DHXA 4QPXA 3EYZA 2JSXA 4B3SK 4QZDA 4FJ5A 4ZVPB 2GMHA 1QCKA 2A6MA 2W04A 2YJFA 2V63A 3P83D 4NLKA 1GTEA 2MQNA 3U1NA 1NLKL 3FNNA 3FUYA 4HLBA 2JFKA 2AEMA 3IM9A 5KFCA 4DFKA 1RG6A 1F3FA 5M1PA 1TUGB 2OTJN 2IYIA 4JLHA 3D7EO 2WRMA 5AQHA 2OPRA 4CNQA 2AJ0A 2MSTA 2MHEA 3ZEUB 2ROEA 2NS1B 4JMUA 5CHCB 2HHPA 4K8XA 3P39A 5D15A 3L0QA 2O8BB 1PYTA 4DCPB 1T3VA 2FHJD 3FZ2A 4KQZA 2HQCA 3AO5A 4Y0WA 3SQ2A 3UXPA 1P27B 3FR0A 4BC7A 3NUQA 3D0HE 1RM6C 1DRGA 4LF6K 1FJ7A 3LWMA 9ICEA 1FWKA 1ZJNA 2HIQA 4Z4CA 2OFHX 3ZX0A 1QTMA 1TKTA 4MEYA 5GAGP 2CN1A 3CJ7A 2K4IA 2NYHA 2EAOA 2VASA 1P1LA 4DSJA 5J0UA 2CXYA 2P9UA 2J7UA 2PI4A 4UW2A 1WKJA 3TVYA 3V4MA 8ICYA 5A2QY 4C0OC 1OJ4A 4DLEA 1SL1A 2AF6A 2P35A 5KGWA 2YWFA 1U48A 4NRUA 5DBCA 3ZCMA 3UMBA 1WF0A 8ICKA 3OXLA 2JZ5A 3C5FA 3L3FX 2X51A 1EQ0A 2Y9TA 1T3QA 4CLSA 3GL1A 4ISEA 4Z0UA 4P73A 4ZITA 8ICGA 1NK6A 4KH1B 1JX4A 1RQLA 1HNZK 1JXEA 2LYVA 1NH8A 4GY2B 3LDSA 2KE7A 4O44A 3SFGA 1NG9A 3F44A 4DOBA 3M6XA 1RDUA 3ISNC 4EELA 1HI0P 2BKOA 4HHUA 4FJ8A 3M8PB 4P74A 3ZETA 1G6BA 1TK5A 1I94J 4G6VB 4QYZK 4O4GB 3BKFA 3M9OB 2LLZA 1CJVA 2BQRA 2EFGA 4CF2A 3PKMA 2EBEA 3DGVA 5AZJA 4IRCA 2FB0A 2LYAA 3GG0A 3CERA 2ZQBA 5KFWA 1RWPB 1V3RA 4C4WA 4KSEB 1WDTA 4QU7A 2F65A 1S72S 4UQGA 2OPRB 5CD4A 1HI8A 2XS7A 4QR1A 1Q95G 1CS4A 4PKGA 1S1TB 2GUPA 4E1MA 2C3PA 3QERA 3CMEN 3BKUA 2E5IA 1UFLA 4X64K 5IT9Y 4XAKA 3JSMA 2AEFA 4ZPTR 2XI9A 3TZWA 3ATUA 4YVZA 4LRBA 2IOFK 2P9UB 4LZDA 1U45A 2JZBB 4KLEA 4CM2A 5FD1A 2XZDB 7FD1A 5HQMA 4GVMA 3KK2B 5AK6A 4N47A 4DLGA 2CH5A 1GLBG 1VQ9S 2AV5A 4O8UA 2XNQA 3FCVA 3CMAS 1VYAA 4DKWA 1XQSC 4QZEA 4WE1A 3QIDA 2RF2B 5HHHA 5CYJA 2ZJQQ 2O8CA 2HBYB 4M3RA 1VI7A 2OELA 2FJBB 1QH9A 2NRTA 5IM0A 3O2IA 1UEUA 1VDHA 3KLEA 2HZVA 2Q31A 3QYPA 1N36F 3HSTB 5AQGA 1XNRF 3LANA 2ROPA 2GVDB 2XQCA 2ZKUA 1U1RA 2YPYA 1NDCA 5HAOA 2B21A 3GG4A 4DV1J 4O4GA 5L1KA 1ZM3A 3C29A 2ATLA 4MKVA 4Z4FA 1X5TA 4A61A 4DQQA 3I55S 3B0YA 3U3YA 3TANA 5F41A 3VQTA 1N34F 3R5BA 2LMIA 3SCXA 3MXHP 4URGA 2WONA 4EX6A 3BS5A 2EHGA 3GE1A 1U47A 5DQGA 4LBPA 1VMBA 1FKOB 4DMNA 3M8ZA 2UXBF 2HOIA 3HMJG 2IPOB 2W41A 1TKZA 5M2UA 3D0GE 2XMJA 3P96A 4ES2A 3C66A 1Q1KA 4H5RA 2E88A 2GAGC 3TEHB 1EETA 4Q8EA 1EWRA 5EGYA 4DR1J 4GC7A 4WQ5A 3CETA 3NDKA 3CYMA 4E19A 5A8KA 1P9QC 2HMPA 5E3CA 2PC6A 3BEGB 5KAKA 4CH0S 2VBXA 2OTLS 4ZP9A 4NLSA 1JLBB 2A1RA 3CFOA 4RUCA 3AN1A 1LWCA 1TK0A 1G2EA 1YJUA 5IOLA 4BDYA 1VJ5A 1NJIT 2QV6A 8ICMA 4G9ZA 1GQEA 2MU2A 3AH6A 4USVA 1YWXA 5ALQA 2DD8S 3G71S 2ZM6K 1VSDA 5D4PA 3CJQA 1K44A 4FPAA 5D4BA 3PJXA 4ENOA 2KRBA 1RHMB 1Z26A 8ICWA 2HLUA 3HXMA 3PEJA 2ZEJA 3VAJA 2CPRA 2QIFA 1RE1B 3OYHA 1T4GA 4YHHJ 5KGXA 3MAAA 3TWHA 5ETPA 2XCPA 3X1LB 2DGXA 3VQSA 1FK9B 4OLAA 2UUBK 1GNKA 4QAGA 1HHQA 3MFIA 1PC5A 4DO9A 2PFOA 3O4WA 2YH1A 3RH5A 5JLHA 3NH0A 3OYAA 4KO0A 2I38A 5L9NA 4BRKA 3WIUA 2KKZA 4FF2A 3NS1A 4IOAQ 1WCNA 2WVCA 2DBBA 3BF4A 2VA2A 5E3PA 3AGKA 2J0WA 4QZHA 2V4RA 4LF6J 3BS5B 4GXIA 3NWGA 2ZHOA 3TVZA 3PX0A 4AYBD 1FKOA 1SS6A 3WX4A 2ZE2B 2KN4A 4ISGA 2QSFA 1H2VZ 3AVKA 4KGMA 3C6TB 1NGCA 1HMVB 3UNGC 1T9XA 2MJUA 3BB5A 2B43A 2PA8D 1IBKF 4X4VA 5J2QA 3D6JA 1OPZA 2D9PA 4DU4A 2A2CA 4O23A 2Q97A 1S1XB 4LBHA 2KTQA 1S6UA 5CB1A 5A2QU 5HRPA 2Q2RA 1FDAA 3FEYB 1VQ6S 4XDCA 3NG8A 3GIKA 5KFPA 3H0MB 4I2JA 4R0JA 4KTWA 4KN4A 2ZH9A 2W8LA 2AZ3A 2OD6A 2J9CA 2J5AA 1B70B 4RW4B 1FNMA 3CC4S 5JVHQ 3SD7A 2ZH8A 1HWUA 3KDOA 2KKHA 4K8ZA 2NRHA 2HI0A 5J0YA 1DK2A 3EWGA 2NZ4A 3QBWA 1HNZF 3H6EA 1KBRA 8ICAA 1T9WA 5KFIA 3HPGA 2MKYA 4A48A 2W11A 2B9YA 2QZ8A 3UMGA 2M4MA 4NZ0A 4YR3A 1ZZFA 3PIOL 4F25A 5CHGA 3NRBA 8ICHA 4JKGB 2DH8A 9ICCA 3ENAA 1F9EB 4FF1A 1RTJB 1IQZA 3MAAB 1QAXA 4L3QA 2C22A 1XNQK 2ILZA 4HYKA 3D68A 3S1TA 2E2PA 1ZQWA 4FO0A 4FJXA 1KLNA 1V6HA 2HNYA 3O44A 1SJ1A 3ZSRA 1B22A 1HIYA 2F1HA 4KO0B 2QA1A 4CTAA 3SPZA 2HSTA 4LFCF 3MABA 4BRCA 1PVQA 2X7IA 1L8OA 3M1FA 3MCPA 3NVYA 3AQFA 5M1NA 2ALZA 3CD5A 4YOYA 4ERDA 1CJKA 3PIOQ 4WIQA 4HTUA 1LWFA 5FPDA 3PSPA 4DQRA 2CJXB 1RHUB 3GCXP 4ETXA 1KFDA 4PH5A 2BX6A 2KT2A 5ITHA 3H7HB 2KZ3A 4R0EA 2PFQA 1WSHA 4QWDA 3TUPA 2V4JA 2QWPA 4TY8A 4E3SA 1EX8A 3AO3A 1XSLA 3M8QA 2ZIWB 3M4XA 4YXJA 6FD1A 5B0GA 2HBQB 1L3KA 4FWNA 4PABA 3AO4A 1F5BA 1NK0A 5I4MA 4FS1A 1VQ9N 3O3FA 1EAYC 2A0FB 5CHIA 1ATSA 1NGAA 1WEXA 4FF3A 3FQKA 2AQ0A 4M1KA 3OW2M 3WNFA 4UAUA 1ZQEA 4PWDA 3RJKA 1B64A 2R2RA 1DTQA 5BPLA 4M47A 5J1NA 1HD1A 1VGYA 3JQKA 5J0OA 3G25A 3LGNA 1FEZA 1U0HB 3EDRB 5ADXA 3G6VA 4WFAQ 5MAOA 1AT1B 3M3ZA 2J8SA 1E6YB 3RMBA 4JKHA 2W42A 4B3MJ 2F8LA 3RJFA 2KT5A 3Q2TC 2E44A 4RW4A 2FQQB 8ICUA 1MA9B 4FM1A 1JCGA 1X66A 4KPYA 2MY8A 2BXJA 4OZNA 4EP5A 3HP9A 4DU7A 2UYTA 3SAGA 2A3JA 2ZGYA 4DV0J 2MDAA 4DEZA 2NUUG 1CI4A 2OEKA 2P2CB 4JI0K 1Y5IB 1ZBFA 3R6MA 2MZQA 1YQHA 2UUCK 2KYXA 2IJRA 3CD7A 2NXCA 4H5VA 3D45A 2HFUA 1A76A 3WC0A 2AGOA 4ZJQA 2ZF5O 4FWOA 3KOOA 1HA1A 2ZFHA 2JEJA 3KJNB 2OSRA 2HRUA 4ZN1A 4BRFA 3J7AP 2ZUCA 1S1UB 1TGOA 4BR9A 1F44A 4BC5A 3FCWA 4HUFA 3AVMA 3I5CA 2X78A 4UOHA 4Z6FA 3NGKA 1U6FA 4FE3A 5HLFA 1N33J 3IHQB 3OFFA 3MK6A 3DDHA 1ZQIA 2HAFA 3QZ7A 2V34A 2MXYA 3CJSA 4YG2A 2FDNA 3ET6B 5AQUA 5LM7E 4OHVA 4B9LA 4ED4A 5DRKA 2QWNA 2XB2D 3KLVA 4OGEA 3V5RA 1YT3A 2AJ2A 3PACA 1Y0HA 1Y3JA 3O5BA 4M3WA 2K1RA 2V94A 4F5NA 4RQ0A 4H0YB 2OEMA 5J1EA 3MM5B 4HCCA 4EUVA 2EKNA 4QIWD 3SQ4A 2D69A 5ETSA 1N32J 4DTSA 5CYQA 1NKBA 2O8DB 5JRTA 1VQ8N 4GV3A 4LY7A 4QZBA 2R9LA 4BS2A 1EQMA 2NYIA 2B5JA 3POTA 3HI0A 4KI6A 2C28A 3SBTA 1KP6A 3SUNA 4UTGA 4RWWA 2HHVA 2Y0SC 4JI6K 1RCXB 2BYCA 3QX7A 2NNWA 4F5QA 3W1YC 2QN6B 1JLFA 5ALWA 3C14A 2JHDA 3AA9A 4CYUB 4J5OA 3VN5A 4CJ4A 4I9QA 1BNOA 1QSSA 3T19A 5I42B 1KOOA 4MF2A 4CF0A 1DQ9A 1N5YB 3MX5A 4PWUA 3PO4A 3ZSZA 2EG1A 3MURP 2EG2A 3FZFA 3OYDA 4KFBB 1JXLA 4WP3A 4Z6CA 3QGGA 2DHAA 3FCHA 4DV6J 2DKXA 3BM7A 1UFKA 2P5VA 4NJ8A 4BQZA 1U1OA 3OHBA 3KHLA 4US8A 2HK3A 2GGPA 3H5XA 2HVDA 5AQKA 2QLBB 1X0FA 4DV6K 2B7CB 1B7FA 1TK8A 1IJFB 1HQUB 5J2AA 3MM8B 3C1ZA 4DG1A 1RWMB 2V7YA 4IUFA 3CCLN 4JKDA 2QYGA 3I5BA 5AKXA 2DT9A 1JJ2R 2AJ4A 4U7UD 3VGKA 1UVIA 1RYSA 3DRXA 2LKZA 1VBZA 3A5LC 3TAGA 1FXDA 3DYAA 3R1LA 1ZD2P 4NCBA 1KQKA 4AP9A 1QD1A 5ALOA 4LF6F 4QNLA 4HUGA 2HGNA 1O08A 3KLGA 4RQ7A 1FFSB 1S99A 1UMJA 3FZLA 4M7XA 3TADC 5T7BA 7ICMA 2GOLA 3TSQA 1KN6A 5HBMA 2RLTA 1FCAA 4NLDA 1GMVA 3KVGA 1WSFA 1R8PA 5G5HA 3AD7C 3IKMA 1TMJA 2ZBIA 5F1XA 3H40A 1MWZA 5I3QA 1DTTA 5JLFA 5ALFA 4ECRA 3R27A 3GIRA 2VDIA 2NRVA 1UA0A 3JYTA 1OVQA 4IDHA 1N6QB 4CJKA 3UKUA 4C1NI 4B9MA 1HI1A 3ALYA 3JB9k 3CDAA 3CWJA 2NSBA 3BEXA 4F7VA 2RU3A 1R43A 3D1OA 4B6JA 4PPDA 3UVJB 4KH0B 4P75A 4XPCA 1UVJA 3SSRA 4ITSA 3H5YA 4YY3K 3ENWA 1N36K 1X4CA 3KTQA 1BHNA 4RNOA 3ORYA 2DWQA 5CWRA 3G96A 1ECWA 1FD8A 5LMNJ 2ISPA 5SZTA 1LEOA 3KK1B 2LM1A 2LYBA 2LQ5A 5E84A 2GO9A 3UO0A 4OX9J 4DR7F 4OJ6A 4WZQA 1T03B 1S9EA 2G8UA 4J9LA 2AA4A 2E1RA 4O3QA 4AYBF 1RAOA 3IGNA 5HOOA 4M3TA 5IILA 1KW4A 4OLBA 3E2EA 3MCAB 4P2XA 3K57A 1IBKK 5KQDA 4CECA 2CJKA 3KHGA 3AO2A 4FZZA 1FT8A 2P1JA 3I0SA 4DR1F 1NNDA 4UB4A 1NM1A 4LQ9A 1G3OA 3UQ0A 2CWXA 4KHNA 1O13A 3ZI4A 4ZCIA 4GVEA 4GV9A 4KB1A 1NHUA 1NK5A 1QTNB 3LZJA 2RQKA 4GKJK 1BPZA 4BRIA 2LA4A 4LF2A 1GOCA 3RRGA 2WSFC 4JI5K 1JKHB 2GMJA 4RNFA 1YIJS 3NEKA 2VYPA 2KZZA 3SJHA 2M8DB 2WF5A 8ICSA 2Q6CA 4RQ1A 2RT3A 4K7QA 3L6QA 4B9UA 5M1QA 4EEKA 2RE2A 2FPMA 3Q8UA 4CO3A 3HX0A 3VGVA 1T7PA 3O1LA 3KZBA 2E66A 3H8YA 5AT1B 7FDRA 3K0JA 1VSHA 1S10A 4ID5B 3KK3A 2N1RA 1OQ3A 1YZ7A 1HNWF 2ZJPL 1ZBSA 4MK9A 4K41A 1XJWB 1KAXA 3VVUA 2E5SA 1DY3A 4J9UE 1X5OA 1TKXB 5F0XA 1I39A 5EE9A 1MNEA 3FRYA 4NA2A 1SB3C 1WNEA 3ZSWA 1T6CA 4Y2QA 4IOBA 3WUHA 3BYRA 2SXLA 1RT5B 3RB0A 1PBAA 1CPZA 4R64A 5DMRA 1R59O 1BQMA 1PJ7A 1NSKL 1HMVA 4KBIA 2DGUA 2YWHA 5BRDA 5E3RA 3ZD9A 2YQ1A 2HOQA 5GMEA 1SWVA 2CDRB 4RPZA 3EMTA 2DPIA 2XHWA 1B4SA 1TAMA 1S5LU 2G08A 7ICOA 2ZIXA 1HWKA 1S1XA 1X4DA 2JC1A 3D2FA 3HOTA 3QLHB 5JS2A 1TE2A 1V97A 1R6VA 1Z05A 5AE3A 3GSIA 2ETJA 1HIWA 1WUDA 2E9ZA 5FIIA 3EW9A 4U95A 4DHYA 3VMFB 4ELVA 2P9PB 4H4MB 2CRLA 3DXBA 3W66A 4FWQA 2VIXA 2CWKA 3H1QA 1FDBA 3MECB 2F44A 1X9MA 2ZOMA 1RILA 4Y2PA 3UXNA 4JV0A 2XLIA 2ZITA 4G3IA 5CCLA 4P7VA 4AQYF 1ZQVA 3KZXA 9ICIA 1LWEA 3HFVA 5JMNA 3TTCA 4FVUA 4HR2A 3FRZA 5T41A 4BRDA 3AQEA 1VIXA 4KV8B 2F8TA 1NKCA 4JB8B 3CCUN 1JLQB 1N60A 2CADA 3FMWA 2BE9B 4L73A 1NM2A 4WP9A 4I2PB 4KC5A 3GP9A 3PCOB 2IFXA 1X8DA 4ANCA 4QJVA 4LF9F 4DF8A 4WWSA 4KLGA 2QGFB 2VKRA 3M8YA 4P2MA 2E9RX 3M6GA 5ETOA 5CY4A 3OUYB 1OW5A 4CJ7A 3KUGA 3P3DA 2DKZA 1Q4RA 2HNYB 2ASOA 2B0CA 4R25A 3FSIA 2XZTB 3EM1A 1N52B 3Q8KA 1HUOA 5JVHL 1JXVA 2B4PA 4F36A 2EK1A 1YITN 2HBZB 3VERA 2KNJA 5DG8A 3DMJB 2HCFA 1MMNA 2EKYA 3D6TB 2BW7A 4ED5A 5G0RB 4P4OA 1S6OA 4BR5A 1NHVA 1T05B 1N32F 4YOEA 3SMVA 4ZLPA 2Q36A 2MQMA 1N88A 4LVOP 1Q53A 4QIEA 2A3VA 2O8BA 1TL7B 4PY5A 4ECSA 1FX2A 3A4TA 2P6SA 4OX6A 4NE9C 4CF5A 4OI4A 3HW8A 4OZ5A 3UNYA 3B6PA 2OANA 3RZAA 3L2UA 2PMZF 2XSFA 4YB7A 3KHYA 4I6MB 1P1TA 2VPXB 4MK8A 3TA1A 5EX3A 3HI9A 3TA0A 1G7CB 3ALRA 2RP5A 2NR0A 4ECQA 1Q7YT 3PYDA 5SUHA 4OYZA 2BM1A 3MMBA 3H7IA 3HHEA 5HQLA 1C0MA 3RGIA 3A5NC 1RU2A 1YK9A 1BI4A 3ZTRA 1BMQB 1HQ2A 3NGZA 3OFEA 4YDDB 4QW8A 2P9LB 4NO7A 1RDWX 3RTVA 1Q82T 1FDNA 3HK2A 1SV5A 4IDKB 1VQON 2Z1IA 1FF2A 1ZZNA 1RHRB 2K60A 3HVWA 3PXGa 5C42B 3VGSA 3KUEA 2ZNYA 1FA0A 4DBQA 2H9ZA 1SC1B 4K25A 3QBCA 1F2GA 1OS5A 1NDKA 2F77X 3T6JA 1JLCB 4ZVQB 8ATCB 3JTNA 5FJ4A 3RBZA 2K8AA 1S1UA 1X4AA 3LQVA 1X9WA 4DPYA 1WUAA 2E7XA 3FEXB 1WOSA 2C2EA 4AM7A 1J53A 5LMUK 1SKSA 5D6GA 1FXXA 2E20A 3AVBA 4YXMA 4CIFA 5J0WA 2C3YA 1HNWK 2RIJA 2IJNA 3HKZD 4C11B 3ENOA 1NDPA 3DMJA 3IRWP 4ZA1A 1UPHA 1IKWA 5DDQC 4MYTA 4J2EA 2JRZA 1EKSA 3GIMA 4F0MA 5F8HA 4M42A 3P4UB 3W5YA 3AA3A 1LWXA 4DV7K 4EZ6A 5HMLA 2QL7B 2UZAA 1T9VA 3SQGB 2LFVA 4YDUA 1V9PA 1KLMB 1VQOS 2K1RB 4U7CA 3G86A 2FF3B 1ZQOA 3M2UB 4ZTJA 3TSPA 4BE0A 3MM5A 1VLOA 3ISND 2Q66A 1S79A 4MKAA 4AL7A 3MTKA 1MMLA 1Q8BA 5DKWA 1S1VB 4ZJOA 3JSMB 5KNIA 4DU1A 5ALSA 1ZQSA 3N6NA 2P9IA 5AQWA 2PXIA 2BVZA 4U96A 5DGBA 2DR7A 1ASWA 5EUHA 1F6TA 2BABA 3MM9B 4DL0C 2QFIA 3C8YA 2FSJA 3RFAA 2R8JA 1MN7A 2HMIB 3QB0A 3PR4A 3V9UA 2Z2ZA 5EWEA 1BCMA 3KOAA 2VG5A 2W4CA 3AY0A 2VJVA 5IWAF 3QEXA 1RGVA 4F93B 3NS6A 1GFWB 1JJCB 4K4WA 3SV4A 2ZIVA 3V9XA 3SYZA 2J6SA 4C7ZA 3WHIA 3TUZC 3DOLB 3GFHA 3RSEA 3DLHA 5GADU 5CD4H 3KLEB 2LVWA 1W2BR 4WJ3B 2BHNA 4QZIA 2CVIA 3NGRA 3D0IE 1TUVA 1TYQA 3O9RA 1PSDA 1U7LA 3C28A 2C3UA 3DRRB 2R3VA 5KFXA 2YKOA 2PYJA 3DRYA 3TI0A 2LECA 5A0YA 2DH9A 3B6OA 1S7HA 3IMQJ 3KMSA 2D1KA 3ULEB 1UOCA 3RW6A 1QAYA 3BV8A 3KD5E 3GQCA 1FW6A 4DTNA 1BPYA 5ALXA 1RP5A 1LAWA 1BQNA 2WFBA 4WQ5C 3SXLA 1MWYA 3EZUA 1P6TA 4OKKA 3IV6A 4LSNA 4DXLA 3MBYA 4RL1A 5L8RC 4JI4K 2XVTA 1A6LA 2CDQA 4KRFA 2EANA 2VQEJ 3AU6A 1RBAA 2EFPA 1HNIA 1NHKL 1RAHB 2RJZA 8ICIA 4HTIA 2UVVA 3T1AA 4DQPA 4I27A 2MQOA 1NK4A 1HBNA 4H0XB 4Y2IA 2F76X 2AQ4A 1A9NB 1X7VA 3NGTA 3QRRA 1QVGM 5ETRA 5AQFA 4Q0BB 2LDYA 3EZ5A 1L7NA 1RLCL 3HVTA 2OP5A 3MC1A 3S41A 3QO9A 2MPUA 1HYZA 1XMQF 5F9NA 1HNXF 3AA5X 2QMUB 2BKNA 3AA2A 2XS2A 3MN6A 3OHAA 3KJVB 1U1MA 1SH2A 2F3NA 3JPQA 4IG0B 3UDLA 1L7MA 5CA5A 2A42A 2BPFA 2ZIUA 3FKBA 4AF1A 3THXB 3QUCA 3ENVA 1EXNA 3ZDDA 1RTDA 1NOMA 3RB6A 4WYLA 2HS3A 4M5LA 2KU7A 3UVJA 2HQFA 2YBVA 1B7YB 5ALRA 2CPEA 4A57A 2A6AA 4W5OA 3HZ6A 2WBMA 3A3NB 2D0OA 5DB8A 1RTZA 3VQBA 3PSTA 2GMLA 2LU2A 1WI6A 5AXKA 4J9KA 4OLPA 4NL9A 3OR1A 2GLEA 1V5IB 4F4WA 7ICGA 1BUPA 5IIOA 2XY5A 1SC4B 3AD8C 1IG6A 3OTDA 1IBLF 2HVEA 2CXEA 5AQOA 4Z4HA 4L3NA 2P9KA 1NPRA 4Q8FA 4ZVUB 1T3NA 3KLHB 2HFVA 3OYCA 2MUTB 1BC6A 3VCBA 4TYBA 3IWLA 2XY6A 3WK8A 1VBKA 5BYRA 2XMVA 4DR2F 1K73O 1MC8A 8ICXA 2YMLA 1FWLA 5DBAA 2PDAA 3EKUA 4QS8A 4J9RA 5T14A 2K8CB 3IBWA 1ZPVA 4PCQA 3AXKA 3M8RA 4Y34A 4QW9A 4LF8J 3H45C 4XH5A 2JEFA 4MN4C 2BR0A 4DI6A 2Y1LB 5AXLA 2UUWA 5C24A 3J80U 3ZEUA 4KLTA 1R7IA 3L3CA 4M5KA 3SEOA 2WW8A 3BH6B 4PJ0U 2AJFE 1K0VA 2V51B 3NF7A 2V8PA 3R5GA 4NLQA 1DOQA 4FZLA 3I56S 2JGAA 2RRAA 1QS4A 2IRUA 2I2YA 2GIRA 3HKWA 3HF5A 2GUIA 1TAUA 3SDEB 3QGHA 2PI5A 3MN9A 2GVZA 2QWLA 1M90O 3THWA 2IDLA 1VLYA 4KAIA 3VQAA 2CYYA 1B92A 5AQIA 1TKXA 1HBOA 4RNHA 4XQ8A 3WK7A 5H9EJ 4IG0A 5CP2A 3NF9A 2M52A 4BQLA 5D0RA 4CO1A 1BPXA 1JL1A 1SH3A 3ZSYA 2ZIUB 1ZQRA 1NOZA 4M94A 2MMYA 4LRCA 1S3XA 1ZQNA 3W3SA 4GMKA 2G5HB 2P6TA 2GV1A 2KVQE 2GWJA 2APOA 4KLSA 4H5NA 4BRLA 4LJXA 4Y2TA 3L2WA 4B3MK 4LFAK 4CJ3A 2W24A 1COOA 1YJNS 1Q46A 4N41A 4A8EA 4O5BA 3E8OA 4O44B 2J9DA 5D0HA 3J81j 2DNRA 4FYYB 9ICVA 1PK1A 2BJ3A 5C15A 3JPSA 1RAIB 4BY9C 1ED1A 1J97A 2OTLN 2BANB 3ZSQA 5JJBA 1ELOA 2B7BB 2BPGA 3MECA 2E8NA 4ELTA 4CF1A 4CBWA 2RE1A 1RA6A 1JNRB 2HOEA 3S9HA 3UN3A 4B9SA 2G2ZA 4F71A 3OJUA 4LT6A 2ZHAA 2MZSA 5AKLA 2VA3A 2EDUA 2QL9B 3VEZA 1S0VA 4Z94A 4C0ZA 2W40A 3SFUA 4A8QA 3ZDCA 3GONA 4I2PA 3L7PA 4C2MA 3J7YI 1JWWA 2VFRA 3PV8A 4UAYA 1HHTP 1PO6A 2DRDA 3JTPA 3PY8A 1U4BA 2JEGA 4ZJLA 1COKA 2YPZA 4JV2A 5C5JA 3UD3P 2V5HG 4F3TA 4PZNA 3NKYA 2NUHA 8RUCA 3I56N 2IYGA 3G10A 3JPNA 1SAZA 4EZ9A 2AP1A 3VA3A 4WKYA 1JL2A 2N4CA 4KHYA 3CFRA 3W65A 3W8PA 4PR6A 3ONQA 1ZQJA 4CLFA 2WVDA 4ZS6A 3L3VA 3MZIA 1GXUA 3EE9A 1L3TA 1WTFA 2CQHA 1YBAA 4JI3K 1U0SA 3G71N 4O4RA 1IBLK 3WKEA 4KMOB 2L9DA 1N33F 2F1IA 3LDPA 3AQOA 3TARA 1XR7A 2R2SA 1N5XA 3LP1A 2E5LJ 3OYIA 4RPXA 4BRHA 2KXFA 2GC8A 2ILYA 2RUGA 4MT1A 4BXOA 4R8UA 4CEOA 5DO2A 2G8HA 4K59A 4CEFA 1CS4B 3IA0A 1O6XA 2O8FB 4LF7J 3EGZA 8ICLA 1WCLA 3W2WB 3TFRA 2BA9A 4FZXC 1U6BA 3A1YG 5EDWA 4IQXA 2XHBA 3QAEA 4I6AA 5FRMA 4NEZA 2QARB 4QR0A 4DV2K 5ALHA 1C1CB 3W9JA 2JH7A 1S97A 3W9IA 4A2AA 3C19A 2HBRB 3KG4A 4R5PA 2WVFA 1Y88A 5A2QO 3OL8A 4FLUA 4JI8J 2JLGA 1GLEG 2FGCA 1E4GT 5FPNA 2O5DA 1VSKA 2IS3A 1IO2A 4DN0A 3CJ4A 4NI2B 4Y2MA 4CGGA 2Z1GA 3HULA 1NCLA 2ERRA 3N4QA 1WHWA 1NMEB 5KFJA 2YY3A 3BGLA 3BSNA 4KTZA 2GCFA 4CBXA 1YIJN 4HDHA 4K8RA 1GK8A 3D3CJ 2W4PA 5C12A 1RT6B 2XI3A 2KHOA 1KFSA 4P0QB 2BE2A 1DEJA 1HBMA 4LC9B 3TABA 1IBMK 4IO8A 3RH4A 4HHJA 3J7A1 4Y28C 2JVRA 4RBVA 3HBTA 4DPTA 2FSNA 4LF9K 1SV4A 4PA1A 2EQYA 7ICVA 3J81Y 2MQPA 3CJ9A 2QT7A 1RFQA 2AT1B 1XNQF 2ZM6J 5DQIA 2C2RA 1JLCA 1Y3KA 3V4IA 1VQ7S 3VENA 2QX0A 4M63A 5KFQA 1HNWJ 3UB5A 2FVQA 2BGWA 2DYAA 1K8AO 1S57A 3AOBA 1JN3A 4CD1A 3ISCA 3LL3A 1OUQA 3QUBA 4O5FA 3HRGA 3QNNA 1HKAA 4TU7A 3MGVA 2X1AA 2O8EA 2BRKA 2ZC4A 5EN1A 2U2FA 5J2NA 3EVMA 4IG3B 2J0XA 1ZAVA 3LP1B 1TFWA 2I9GA 4MKBA 1WOQA 5IIIA 5HMMA 2J8AA 2XO7A 2OYQA 4GV6A 3QETA 1FFVA 4CEEA 5BPNA 4H03B 3ZDEA 3CTRA 2F40A 1RQNA 4G65A 3H46O 2VJ4A 4O0IA 5KFHA 4J9QA 3CDBA 4HHHA 3MCMA 5E33A 2HLTA 2R7YA 4K4UA 3V7JA 1V4SA 1SC3B 1KN5A 4LSZB 4WK1A 1B4FA 1B99A 3TJAA 5DK5A 1MG7A 3T1YK 8ICCA 1O03A 3CB4A 1KVCA 4DX6A 4IFYB 3DOMB 1N54B 3KG1A 2E4LA 1NGDA 2YWKA 4OHZA 1EB0A 3AVGA 1HPZA 4A4JA 3K58A 2BUPA 2LPEA 4UBBA 4NRTA 2N4DA 3PYFA 3DXMB 3SQOP 5DDPC 3LDAA 3T3FA 4NXMF 3DXSX 2NXUA 2V69A 3CJRA 3FDSA 5AK4A 1RWWB 1R0AB 1PGZA 3LUYA 4B17A 4B9TA 3RSEB 1SIJA 3CF5L 3P5TL 4LFAF 4WYBA 1WSEA 5J0RA 3FAHA 4P0QA 2BE2B 4TURA 3BQ0A 3FVYA 5C2CA 2R7VA 1ACMB 3J80O 5KFGA 2M8HA 3HLUA 2N3OA 4B1WB 1XNRJ 4DV3K 4DV2F 4CVNE 1M0SA 3F2CA 2XGQA 2PAVA 1N32K 2VICA 2IRXA 1JLAA 2KIVA 4CK2A 3GBTA 1D3WA 3NL0A 4GXKA 2CQGA 2CQ4A 1AQ6A 3H3OB 3BN7A 4CH7A 2B56A 2QEXS 1ITGA 3WQPA 3BH7B 1IG8A 5EWGA 5M2PA 2RQCA 7ICHA 4BR0A 4E98A 1DARA 3BZCA 1VSIA 4I2CA 2DGOA 5HMXA 2WAQF 2R7QA 1KSPA 5J2NB 1BVSA 4NLRA 4IG3A 1VQ8S 3MXJA 3V7LA 2G0IA 4USKA 2LXFA 3AJ1A 4I67A 3L5KA 4MLEA 4KH6A 1HBNB 2KFYA 5IIMA 1VFJA 2GFFA 3CO0P 3PIPL 4X66F 2B4OA 4AE5A 1NBWA 4M5HA 2QLJB 3OR2B 3IBFB 1I51B 3Q8YA 1NAQA 1D1UA 2EXUA 4CLUA 3DDNA 3ISBA 3E01B 1VJQA 4CW7B 5M1KA 5IQQA 2AGPA 3JXUA 2VQEF 3MX2A 3RRHA 4DR5J 4IFYA 3FFIB 3K5MA 2JXJA 3LDNA 1HPZB 3U1LA 5J0TA 5DDO