1U49A

Adenine-8oxoguanine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u49A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u49A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u49A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u49A01
4OGCA 9ICUA 2LYHA 2E6LA 5KFEA 4RQ1A 2FMQA 4FK0A 4JK1A 3KLIA 1ZQUA 4I2GA 1JLGA 1BGXT 4CF1A 4EBDA 3AO5A 3V81A 4PUOA 4QZCA 4RPXA 5IIIA 4DFMA 1ZQVA 2BANA 4PGXA 4CGIA 3EYZA 1XS9D 4RQ7A 2BCSA 4MF2A 2HHVA 2HMIA 4BDYA 2ASLA 3PO4A 4B8CA 3OHAA 1KCFA 2NRXA 5HROA 5CZ2A 1JXEA 1T4GA 4DTNA 2QXFA 4DU4A 2W9AA 1WSHA 1WCNA 1RDAA 5KFGA 3SV3A 3N97B 3IAYA 1BQNA 1BVSA 8ICFA 4QZHA 5CA7A 3LALA 2XCAA 4FM2A 5IILA 4EZ6A 3BQ1A 4KLTA 2R7YA 1QSLA 5J2KA 1BI4A 1IXRA 3NGIA 1TL1A 1XWLA 2P6RA 2GWSA 3OYJA 3KD5E 3SUPA 1WSGA 3AVKA 4Q8EA 1KSPA 8ICSA 4K8ZA 3LP3A 7ICEA 2XCPA 1X9MA 8ICOA 4DL4A 3ZSZA 7ICKA 2IHNA 9ICXA 3HWTA 4RQ4A 1ZQAA 3GDXA 5C25A 3OYMA 3M9NB 1D8LA 3K2PA 2WTFA 1IKWA 1FXXA 3L8BA 4FZXC 3TQ1A 1W0HA 3V9ZA 2FLLA 5KT3A 4BXOB 5KFOA 1QTMA 1GOBA 1LAVA 3RB4A 2EHGA 4CJFA 3D0PA 3KHHA 4DTUA 4RQ6A 4FW2A 4I2DA 5L9XA 4M9NA 3V7LA 1YTAA 2BCVA 4R8UB 4FJKA 1LAWA 5L1LA 5KFVA 9ICAA 3C23A 3GQCA 2AU0A 1HRHA 3AA2A 3KK1A 2Z1GA 4DTMA 4RW7A 2C28A 4CFDA 3G6YA 3ZSWA 4RNMA 1S76D 3CFOA 4BE2A 4ECSA 4DSFA 3VQ4A 4E3SA 4GW6A 3NDKA 9ICKA 4F4ZA 3PW4A 3K5NA 3NAEA 4DTJA 4J9OA 4E7HA 1RT1A 1JXBA 5KG3A 4XA5A 4I2QA 5KFDA 3P5JA 2FBYA 2BQ3A 4CF8A 2YHAA 1NKCA 5FRMA 1UOCA 1GOCA 4ZH4A 1S9EA 5L1KA 4KAZA 2XY5A 4AHTA 1WLJA 2W8KA 4C8KA 8ICNA 4CGHA 3AVLA 2X6NA 2KFNA 4EBEA 2ZQBA 2BGWA 3OYGA 3AVNA 4PPXA 3O3FA 4N41A 5KFBA 5KFSA 4F5OA 2JZBB 4FLVA 2KZMA 4LY7A 2HB5A 1NOZA 1LWEA 4PHAA 4CFCA 4Z4FA 1TKDA 2KW4A 4KN7A 1SL2A 2YNHA 1KFTA 4J2DA 4B9LA 1JLAA 1TV9A 4Q5VA 4IKFA 5CJ7A 4QZIA 1VSIA 4KHYA 4FM1A 4O3SA 1L3UA 3OYAA 4KLHA 2A1RA 1RT5A 3LP2A 2BGGA 1FK9A 3SPZA 3QO9A 4ECTA 4DSEA 1D9DA 4CJ3A 5DGAA 1C6VA 2X78A 3SQ1A 3RAXA 1XSLA 1D5AA 2DFEA 3ITHA 2HNZA 1ASWA 3TABA 5SZTA 3RJHA 5DBAA 4Q45A 5DQIA 1S9GA 2D0BA 4N47A 3NGYA 5CB1A 4CJTA 1LW2A 2ZTEA 3MDCA 3RJIA 2XY7A 7ICMA 3K59A 2YKMA 1KFDA 5J2JA 3V1OA 1KEJA 1TK0A 2PI4A 8ICUA 3SQ2A 3O3HA 1NJYA 4E1NA 4KHQA 3L3UA 3ZSXA 1SUQA 5JS2A 1K1SA 5DKWA 2BDPA 4IQVA 4CJQA 1ZQTA 3V6KA 4Y1DA 3Q8LA 4KITB 5C5JA 4YR3A 3GIIA 5KFFA 3KJVA 3KTQA 1BHLA 4Z6DA 1BPXA 3T1AA 5KFKA 3RMAA 3QERA 4FJ7A 1BISA 1W9HA 4DQSA 3ULDA 3BJYA 3RH5A 3MDAA 3N4MB 4QOZB 3SI8A 1S9FA 1N48A 3O4QA 4OLBA 3IG1A 9ICGA 1YVUA 3EWAA 2DFLA 5FRNA 3SNNA 3LAMA 3V4IA 3VQ7A 1KVBA 3AVFA 3ZT1A 4TQSA 2P5OA 4Z6FA 1ZQHA 4KFBA 4RNOA 9ICBA 1IKVA 1C7YA 2A1JB 2GV9A 8ICEA 1B9DA 3DRRA 5CP2A 5HRRA 3PW7A 2G8UA 4CEEA 1RNHA 4J9KA 8ICTA 4CK3A 4DTOA 3P1GA 3LWLA 3T5JA 4RQ3A 3NF9A 3HP9A 5DMRA 4J9PA 4CJLA 3KK2A 4MFCA 3Q8RB 1C0TA 2ITGA 3D45A 2VG6A 3QEIA 7ICJA 4CHYA 4BWJA 3UXOA 3GIJA 1MQ3A 4HHTA 1KLNA 8ICRA 2Y1IA 4ECXA 1KLMA 4F93B 1J5OA 1DLOA 2C22A 1U49A 1IH7A 1Y88A 2I5JA 1X9SA 1I3AA 4W5NA 1IKXA 4KLMA 4EYIB 2PFQA 4CJWA 3CM5A 4I29A 2BPCA 5J2AA 3HL8A 1ZQNA 1RBRA 2FMSA 2GBZA 1ZQQA 1ZJMA 4K8XA 4M45A 4CJVA 3AVBA 4AHCA 3GV5B 4IRDA 1VSLA 3RB0A 2JEJA 5KRTA 4QZ9A 8ICCA 5FROA 3M9MB 4F8RA 4KI4A 1A5WA 4KLSA 3V1RA 3JPSA 3B0YA 2G8VA 3ISCA 2IAJA 4PHDA 3Q8SB 1SZPA 2DFHA 3HSTB 4C8OA 1QSSA 1S6QA 4LSLA 2WOMA 2AGPA 4QZ8A 2B4JA 4QW8A 3ZDDA 4FLTA 3ZD8A 4ECQA 2E4LA 3DLEA 2QKBA 3E2EA 2OPQA 4ECWA 2HVIA 5KFUA 1RZTA 4OGEA 3VA0A 4EP4A 3MR6A 1C0UA 1L3SA 3OS2A 2J6SA 1WSEA 3TFRA 4UAYA 4J9RA 3TFSA 5DDMA 4RU9A 2IDOA 1S1WA 4H4MA 5KG7A 5EOZA 3C1ZA 3ZT4A 2ASJA 3P83D 2VWJA 4TQRA 5KFHA 4E19A 3I0SA 3SQ4A 1RDBA 3L2QA 3RBEA 1JN3A 4I2CA 3T5HA 2P66A 1SV5A 4MFBA 4FJNA 1EXQA 1BIZA 1Z3EB 2VA3A 4PWDA 1DTQA 3QNNA 2HVHA 3TAFA 1X9WA 4DSLA 4YNQA 2HNYA 4J9LA 5J0WA 3PMNA 2ALZA 4MEYA 4DSJA 3CFPA 3T5LA 2VA8A 1BPEA 3GFKB 2C2DA 2RDIA 2I9GA 2VA2A 3DOLA 4QZEA 3TARA 4K4HA 4Z6EA 3ORYA 1NJWA 3Q8QB 3AU6A 3ZT3A 1ZQEA 4RNNA 3PR5B 4DSKA 5J0QA 3K5MA 5JS1A 3PW0A 4O5CA 3VQCA 2F8SA 5KFQA 1REVA 4ELUA 3ZDEA 3NH2A 5J2FA 4O0IA 1XSNA 3C95A 8ICBA 4FJGA 4DFPA 4RUCA 4O55A 3JYTA 4JS4A 1TAQA 1YT3A 3RR7A 3HVRA 3RMDA 3KD1E 3VN5A 2B21A 1K6YA 4DU3A 4CHNA 1SL0A 1Y97A 4ECZA 1T7PA 1ASUA 4IQWA 3L2VA 4GXKA 1MSWD 5HRSA 3UPQA 1ZQGA 8ICKA 4FBUA 4DL3A 1TL3A 4CGFA 4M2YA 9ICFA 5CZ1A 4CEZA 1A77A 4FLWA 5L1IA 3QEWA 3G10A 2XO7A 3LZIA 4P2HA 3IRXA 4LD0A 5J0SA 2ZTCA 3V7JA 3OYHA 1B9FA 1Z00A 3EZ5A 3WNEA 3DLHA 3OSNA 3AVAA 5J29A 3EW9A 2ETJA 4Z4HA 4FYDA 4M9GA 1VSHA 2Z1HA 1XHXA 1J9AA 2HHTA 2FBVA 3PX6A 4LH4A 3LWMA 2JEIA 2JEFA 4KHUA 4BGDA 4O3OA 5KGXA 9ICEA 3QIOA 4QZBA 4ID5A 4LZDA 3RJEA 1EETA 5J2MA 4M6WA 3B6PA 7ICQA 3IS9A 5J2EA 3OY9A 2R8IA 5KG0A 5CWRA 4LZGA 4M04A 7ICUA 5KT5A 3ZD9A 4M9JA 4ZTFA 3FFIA 3M8PA 2PYLA 4RT3A 3RR8A 2BKEA 5BPCA 4Y1CA 3SPYA 1NK8A 3LAKA 1NJXA 1KDHA 4IQTA 4YFUA 4KLQA 1S1VA 4OKKA 3G6VA 4KTWA 4KTZA 7ICIA 4KB1A 1ZETA 1HUZA 4CEOA 2VG5A 4CF0A 4RW6A 4QZDA 1N6QA 4Z4IA 1ASVA 3VQ5A 1ZQMA 3OYLA 3UXPA 4PHEA 8ICIA 3ZSOA 3ZDCA 4F5NA 1Q9XA 5FDLA 4DF8A 1KRPA 3TAQA 3NF8A 3BQ2A 5DK5A 2BQRA 4Z0UA 4HUGA 4OPKA 9ICJA 4C8NA 4CJSA 1L5UA 3KIOA 3RRHA 4G1QA 2F1IA 4M0AA 4NXZA 9ICMA 4N76A 2EX3A 4I2PA 2IBKA 2H5XA 3TI0A 3SQ0A 2VANA 4PA1A 2JEGA 1Z26A 4YD2A 4F4YA 4FK2A 2D0CA 2W8LA 3GIKA 4DQRA 1ZQXA 2BE2A 2AGOA 3MEEA 3KKSA 1ZBHA 3OYCA 1H38A 1S0VA 4KHSA 2OPRA 1S1XA 3PW5A 1VK0A 3ISDA 1BCOA 3VQPA 4DQIA 4CEQA 2W42A 2DPJA 5KFXA 2W9MA 1EX4A 1JLFA 2W9CB 1S6PA 2G8FA 4BDPA 2W9BA 4PGYA 2ATQA 3PV8A 4WE1A 3AA3A 4UBCA 3T5KA 4R64A 4KLDA 2HHSA 3RWUA 4KN4A 4NLZA 5JUMA 1SKWA 3QZ8A 9ICCA 3OYBA 3SUNA 4I2EA 4W5QA 4CF2A 4E1MA 4F3TA 5EWEA 2IS3A 1QSYA 1RPLA 2PYJA 4M47A 1XHZA 4GC7A 3QZ7A 4K4GA 3SV4A 5BOMA 3ZSRA 5CR0A 2OYQA 1A5XA 1G15A 4CFBA 4Z4CA 4CIEA 9ICWA 4CFAA 3LZJA 4DOAA 2PFPA 4CEBA 5KG1A 4I2BA 4FLYA 1O1WA 1ZQLA 3MXIA 3RAQA 1B22A 5KTQA 1XSPA 4PGQA 4O5EA 2PFNA 3SZ2A 8ICXA 4FS2A 1ZQDA 4FW1A 1VSEA 3S9HA 4CF9A 4CHOA 4OLAA 4KI6A 4CJRA 1C1BA 3AA4A 1J54A 3NHGA 4CGDA 3DRSA 4QAGA 4QWBA 3C5FA 2KQ2A 2PXIA 3EY1A 1ZQFA 4MEXA 5J0XA 3PX0A 4MFFA 4JRPA 1HMVA 3AVGA 1HQEA 4ED3A 3MABA 4N5SA 3H8SA 2JGUA 2ATLA 1VSFA 1KTQA 1U47A 1DTTA 4IDKA 4KLUA 4UB3A 3NE6A 9ICQA 4IBNA 4YCXA 5D3GA 5J2GA 4I2AA 2ISPA 1B92A 1NKEA 4CECA 4JV1A 2J6TA 4ED7A 2P5GA 2HHXA 4IRCA 4QWCA 4QZGA 5DB7A 3OYDA 2ZTDA 4YN4A 1BL3A 3AVHA 3AV9A 1HNIA 3PY8A 1SL1A 4GXJA 3T19A 2RKIA 1MU2A 2X74A 3QLHA 4E7KA 3VQDA 3MR3A 2UVVA 1C1AA 4YR2A 1IKYA 1RTJA 3ISNC 2FPLA 5KG4A 1IO2A 5DLFA 4RG8A 3AO3A 3NF6A 1RTHA 3O3GA 3VQBA 5J2PA 2FPMA 4CJKA 4IRKA 2RF2A 4KTQA 3DOKA 4DTPA 4PHPA 1S0OA 1C1CA 5EWGA 2QKKA 4F2SA 3VQAA 2E6MA 1C0MA 1U9LA 3ZDBA 3L2RA 3LK9A 4YMNA 2BCUA 3RB3A 3VA3A 4R63A 4N56A 4DL6A 4TUPA 3M9OB 3MGIA 3RJKA 4O3NA 2AJQA 1FKOA 4FJ8A 1UT5A 2VWKA 4BE0A 1VSMA 3ZCMA 1TGOA 3AVJA 3KK3A 4FJ9A 4JRQA 4RT2A 2ZJ8A 4J9MA 4TURA 2ZJAA 3H8WA 5HNKA 3S3NA 1T03A 2ZD1A 3H7IA 5KFAA 5KT6A 1RT7A 5J2NA 4J2AA 3OHBA 2BPFA 3FYHA 2DY4A 3UXNA 5HHIA 5KT2A 4HUEA 8ICLA 1NK0A 1WSJA 3NF7A 3UIQA 3LANA 1JLCA 4R66A 4F4WA 5HHHA 4FVMA 1Q8IA 1UA0A 4UAZA 3V9SA 4IG0A 5F9LA 3F73A 5KFNA 4J2EA 1NK9A 4M9LA 3OYIA 4BWMA 1BI4B 2FBXA 3JPQA 4AH9A 4DMNA 4W5OA 3KKRA 2R8JA 2BPGA 4F92B 3C94A 2FBTA 3JPRA 2ZUDA 4RQ8A 4FLXA 4QCLA 3ETLA 1ZBUA 2OPSA 3MXJA 1LWCA 3CG7A 1AROP 4M3ZA 2OPPA 2DTUA 3RMBA 8ICHA 4FJXA 2AQ0A 1NJZA 3QEAZ 3AVIA 3LP0A 4FLZA 1ZBIA 3PX4A 4DTXA 3ZSVA 4GC6A 2NRWA 5HMLA 3GIMA 4O9MA 4MFAA 4JV2A 4OKJA 1KVCA 2HW3A 2VG7A 1CUKA 9ICRA 2OWOA 4OVLA 5DG7A 1ZQOA 2XY6A 1HJPA 4DL5A 3TAMA 5I3UA 4Z6CA 3ALYA 4F3OA 1LWFA 3H40A 4KLEA 1NOMA 1RBVA 1WAFA 2PI5A 4H8KA 1U45A 2HHUA 1NK4A 5J0OA 3EPIA 4BXOA 4E7JA 1HUOA 3VQQA 4R5PA 4KLOA 4TSXA 3L2WA 4R8UA 3AO1A 1TVRA 4JS5A 5EU7A 4I28A 1TK5A 3C2LA 4EBCA 4ECUA 2AQ4A 1S97A 4QWEA 4CEAA 5KFLA 4G3IA 4B9NA 3ZSQA 2NRZA 1TAUA 2ZUCA 3H08A 3OYKA 2O4IA 4FJIA 4DFJA 4UBBA 1S77D 4CGGA 3GV7B 3IHQB 8ICQA 5J2DA 3AO4A 3C1YA 7ICFA 3K5OA 4E7IA 4FJMA 1JXLA 1WSFA 4JWMA 1GOAA 4JLHA 4W5RA 4FJ5A 2OA8A 2YKNA 2FPKA 4X5VA 4DF4A 3C6TA 5J2BA 2BCQA 3NTUA 4FZZA 3QETA 3HP6A 2F1JA 5C42A 4FK4A 3OJUA 2UVWA 3DYAA 3ZT0A 4BACA 3KHRA 1RDCA 3THVA 4UB4A 4UB1A 1T8EA 1EP4A 4DQPA 2BQUA 4HTUA 4GLXA 3SJJA 4KKOA 3RJFA 3JPNA 1UT8A 4Z4EA 2JZBA 3H4DA 9ICSA 4M3YA 7ICSA 4DS4A 2ISOA 4DG1A 4LH5A 2HNDA 4YXJA 5IINA 1LB2B 2O4GA 3DLRA 4Q44A 3ZDAA 2R8KA 5EWFA 2J6UA 3NBPA 4F4XA 8ICMA 3DRPA 1JLQA 1K1QA 3OSPA 4KLGA 4ZHRA 5J0UA 4KO0A 5KG6A 3HVTA 3MR5A 1U04A 3JPTA 3JSMA 4M41A 8ICPA 3SI6A 9ICIA 2MAXA 2R8HA 5KI6A 5KFJA 3I0RA 1RTDA 3SCXA 4UB2A 5DB6A 1NKBA 4CJ4A 3QEBZ 4LSNA 1WN7A 4F2RA 4DQQA 3JPPA 2V9WA 5CYQA 3NGDA 4DOCA 2DFFA 4TUQA 5CYMA 3LPTA 4J9QA 1ZBLA 3KLGA 2XHBA 3PVXA 4CJEA 9ICNA 5HP1A 2XY8A 4AHUA 4EP5A 4H4OA 1X2IA 4UAWA 3MBYA 2DPIA 3S3OA 4ECVA 3BQTA 4ICLA 3V9XA 1PZNA 4RQ5A 1UAXA 3HYFA 4NYNA 5DG9A 3MXMA 1CLQA 3K58A 2P1JA 5DG8A 1LW0A 2NRVA 4M9HA 2Z1JA 3RJJA 1CXUA 1QHTA 5DLGA 4ECYA 2G8KA 2OZSA 3VQ6A 4J9SA 4FO6A 3RMCA 5DQHA 4I2IA 5DDYA 4O4GA 4ED0A 4I7FA 4NY8A 3MR2A 4MQ3A 1CZ9A 5F9NA 1RCHA 1RILA 4F5RA 5IIJA 3OYFA 4M3UA 3AA5X 4J9NA 3PR4A 4CIGA 3NH0A 5J0TA 5C24A 5DQGA 4RQ0A 3RTVA 1SKRA 4UQGA 3M8SA 1DGSA 7ICLA 1RTIA 4O0JA 2A1JA 4YD1A 2F96A 4ELVA 7ICHA 5DBBA 4B9TA 1TKTA 2F1HA 3I8DA 4KLFA 4CEDA 1JX4A 4IR9A 4QWDA 1ZJNA 5DBCA 1ZQSA 2YHBA 2P6UA 5CHGA 3G6XA 2C2RA 4O3PA 3DM2A 3DLKA 5HP4A 2RDJA 4ED1A 3U3YA 1BIUA 5D49A 2B5JA 1RXVA 5J0YA 3PUFA 4P4MA 1VSDA 2PZSA 2MUTB 4ECRA 4PY5A 5J0RA 4CEFA 2IC3A 3DLBA 5IIMA 3CQ8A 1I39A 4KREA 4YMMA 1S10A 8ICVA 1JL2A 4W5TA 3K5LA 4CHZA 1RT2A 1Q9YA 4I9LA 5DGBA 2WONA 3QIPA 4ED6A 4AHSA 4GXIA 4DWIA 2BHNA 4YXMA 3ZSYA 1HJRA 3HPOA 1TKXA 2OZMA 3HM9A 1UWBA 1XC9A 4P4OA 3GILA 4FCYA 4CHQA 2I1QA 1JL1A 3U3GA 3RBDA 3M8QA 1RT3A 3RH6A 3WNHA 4DOBA 4J2BA 2ASDA 1D8YA 5SWMA 2YNIA 5I42A 3TR8A 1QS4A 2KN7A 4EEYA 5DB9A 2FLNA 4RW4A 1N5YA 2HHQA 5E41A 4RW8A 3RJGA 2IA6A 4M3XA 3PMLA 2G8HA 2YNGA 3JPOA 3B0XA 5KRSA 3C5GA 4FLUA 8ICYA 3T3FA 4I2FA 3VQ9A 5HRNA 2V4RA 4KLIA 3UQ2A 4AHVA 3MGHA 3QNOA 4KMUA 4HCBA 3E01A 1ZQJA 4QW9A 8ICZA 1NOYA 1HNVA 1WSIA 1CEZA 1TV6A 4PQUA 2B6AA 3KHLA 9ICOA 3QEXA 4FJLA 2QK9A 7ICNA 1F21A 1ZBFA 3QEPA 4O5KA 4E89A 4NLGA 1BPBA 2ZJ5A 2C2EA 4BE1A 1HYVA 3U6FA 3BGRA 3RRGA 3MFIA 1B43A 4F50A 2Q3SA 2FMPA 4UB5A 3CM6A 3MAQA 4KRFA 4XIUA 3HXMA 5K14A 1TKZA 2G8WA 3B6OA 4PH5A 1U48A 4I2HA 2KZ3A 4RPYA 2UVUA 2UVRA 4FM0A 5J2QA 5CY4A 2F8TA 4NLKA 3CYMA 2M9NA 1WNSA 3C2KA 4KB0A 5J2CA 4YG2A 4DO9A 2RN2A 3NCIA 4KLJA 2LSNA 4F4KA 4DS5A 3OYEA 4Q0BA 3M8RA 4HYKA 3K57A 1RBSA 1Z25A 2Q0ZX 1X1PA 3TANA 1XU4A 4K4IA 2YV0X 3WNGA 3AO2A 3SUQA 4JV0A 1S1UA 4DSIA 3KLHA 1QLNA 3LDSA 4IR1A 4YFKA 1JIHA 4C8MA 4IQUA 4FZYA 4IFYA 2D0AA 3DI6A 2IOCA 3PO5A 4CHPA 4RPZA 4CJ5A 1HQUA 1A5VA 5KFPA 4O44A 1NK5A 4AHRA 2IHMA 1WCLA 1Z00B 1KVAA 4DL7A 1UA1A 4FBTA 1ITGA 4CIFA 4EYHB 1ZQZA 3H4BA 4ELTA 2KZZA 1NK6A 1CXQA 4C8LA 1HYSA 1WAJA 1IM4A 7ICTA 3AVCA 2XGQA 4M6WB 8ICJA 1BPZA 4L8RB 1MQ2A 4YMOA 2G8IA 1ZQBA 3V72A 4XUSA 5BOLA 3LDAA 5KFRA 1RDDA 3UQ0A 2PFOA 3VQ8A 3V1QA 2V4QA 3OYNA 3OVNA 3V7KA 4CJUA 3TAEA 5KFIA 3MECA 4HVJA 3QE9Y 5DB8A 1SKSA 3LPUA 5J2IA 3OJSA 1EXNA 3OS1A 4I9QA 4QWAA 2AGQA 4F5QA 4CK1A 8ICGA 1ZQCA 3AVMA 1RXWA 2NRTA 4FJJA 1D9FA 4OPJA 3HO1A 1MC8A 3HJFA 1IG9A 4AILC 4NCGA 5IIKA 3NH1A 4CCHA 4YR0A 7ICRA 7ICGA 2IGIA 3DLGA 1YTUA 1ZQRA 1FKPA 4NCBA 2KFZA 4DTRA 3K75D 3LP1A 3HX0A 1U4BA 4R65A 1TK8A 4B8AB 1S0NA 3K4GA 4E0DA 7ICVA 3H8JA 1VSJA 5HRPA 5KG5A 1RBTA 5J1EA 3ZT2A 3L2UA 3V6JA 3OGUA 2ZUBA 3ASMA 3TAGA 1BQMA 3S3MA 1HPZA 1L3TA 4M3WA 4F91B 1A76A 9ICHA 5KFMA 3HT3A 3FDSA 4O5BA 3Q8KA 9ICTA 4MF8A 3PW2A 3VQEA 4Q43A 2MUTA 5HMMA 4CE9A 1QE1A 4CERA 2HHWA 2NUBA 4I2JA 1TFRA 2W9BB 4NM1A 1S5JA 5D4BA 1QQCA 3IM1A 4B9MA 3V6HA 3EPGA 1S1TA 4NLNA 4OKEA 1XI1A 3F9KA 4LVSA 4M3RA 2Y1JA 1ZQIA 4GMJB 4KHNA 2W9CA 5IIOA 2Z1IA 2P51A 4KLLA 3DMJA 3O4NA 1VRTA 1JLEA 1T3NA 9ICLA 1T05A 2BR0A 4GVMA 4JUZA 3TWHA 2FC0A 4FS1A 3RH4A 1CZBA 4B9UA 3CFRA 3QINA 4ID1A 2ZE2A 5KFZA 4DU1A 8ICAA 1N56A 5KFYA 2IMWP 3NGZA 1HYZA 3PNCA 4DEZA 1VSKA 1EKEA 1ZQYA 3HPGA 3TAPA 2KTQA 4NCAA 4JWNA 9ICVA 3C6UA 4NM2A 4CESA 4Q8FA 3NFAA 2FLPA 1RT4A 1RYSA 4FXDA 3AUOA 3BDPA 3A2FA 3SYZA 1R0AA 1ZYQA 4OJRA 1BPDA 3V9UA 3RB6A 1S0MA 3HK2A 2XC9A 4B9SA 2XRIA 4B3OA 4QZAA 2JLEA 5KGWA 2YNFA 4IFVA 2PY5A 1VRUA 1BCMA 1JKHA 4M42A 4DTSA 5KFCA 4DL2A 7ICPA 4DLEA 2X6SA 1XO1A 4XRHA 4CK2A 1L3VA 3HW8A 1ZQPA 2D5RA 4RZRA 4Z4GA 4QZFA 4EZ9A 1ZQKA 4YQWA 2BCRA 1KFSA 4E7LA 3KLFA 4HCCA 5KG2A 2XGPA 3Q8PB 4ED8A 4XQ8A 3ISBA 3SUOA 8ICWA 5KFTA 4NYFA 3V9WA 1DOQA 4IG3A 4YVZA 4DLGA 4YP3A 3C21A 3GV8B 1LV5A 3HPHA 3Q8MA 3MEDA 4KPYA 5KFWA 1TVAA 3AU2A 4ZTJA 3QEVA 1JMSA 3WNFA 4CJPA 5KT4A 4F5PA 4BDZA 3BQ0A 4B08A 3KLEA 3G0ZA 7ICOA 3V6DA 4P4PA 4DFKA 2A1SA 5J0PA 4KV8A 4RQ2A 4O3QA 3KHGA 3L3VA 1RYRA 4HUFA 1BPYA 4FJHA 5D46A 3MEGA 5L1JA 4M3TA 4TUSA 2RPIA 4CGJA 9ICPA 5J2HA 5HLFA 3OS0A 1JLBA 5HBMA 5T7BA 3MFHA 4O3RA 1RT6A 5TZVA 4RUAA 3C2MA 4KHWA 5KT7A 1NK7A 3QESA 4I27A 1J53A 1RBUA 1ZQWA 4B9VA 1COOA 1V9PA 4ED2A 2R8GA 4RW9A 2GUIA
chains in the Genus database with same CATH superfamily
4OGCA 3S01A 5KFEA 2VFRA 2FMQA 3D5MA 5EE3A 2Q36A 4F25A 1B3TA 1ZQUA 4I2GA 3F2CA 4JV5J 3NVKA 4I6MB 2OEJA 1RT7B 4PYDA 5E3PA 2BANA 4PGXA 4WKYA 3G82B 2BJEA 3QFUA 3LGMA 1A7GE 3FZFA 4U6PA 2HHVA 2HMIA 4BDYA 4WXWA 2ASLA 1T11A 2VDHA 2GMHA 2J0QD 4PXDA 5HROA 5FPDA 2KM8B 4DV2F 3F2KA 4IG0B 2PMZC 4DU4A 4FL9A 2W9AA 5LMNK 4CZEA 3SV3A 2YXLA 2V69A 4OJ5A 4OLPA 8ICFA 5AXLA 3ZTPA 3R97A 3LALA 4FM2A 5HN0A 2CQ4A 4KLTA 3FMWA 2DCLA 1QSLA 3CPEA 1AB8A 1IBMJ 1IXRA 1PVQA 3OYJA 2GWSA 2YHXA 2PT0A 2B4UA 1UMJA 2Z56B 4CM0A 2YMLA 3SR6A 3LP3A 7ICEA 4JI7J 3CPWR 4LF9F 4OHVA 2IIRA 4OPHA 3ZSZA 7ICKA 1X4FA 3R5AA 4HH0A 2IHNA 2HRUA 2J7KA 1YJNN 4OJPA 2O01C 4DPWA 4RQMA 3I5AA 1J5EK 3HWTA 3GDXA 1Z1VA 1FXXA 3L8BA 3I1YA 3CCES 5KT3A 4ZK7M 4PZNA 4BRHA 5KFOA 3DN9A 1SZHA 3D0PA 3NRBA 5BPMA 4I2DA 4R5PB 4M9NA 4NYOA 2C2NA 2BCVA 1BNOA 3FRYA 2GO8A 4CBUA 3CCRS 1GLDG 4KHPF 3ATUA 2LQBA 3C23A 4CLWA 1HHQA 2PFFB 2AU0A 2ZFHA 3TJ8A 4KH0B 4RW7A 2C28A 5AQFA 3QUCA 3WKCA 3NCPA 4IXCA 3NLCA 1TUGB 5D0RA 5F8JA 4GW6A 1EQ0A 1HUXA 3ENHA 1L7MA 1P1TA 2MQNA 4OZ3A 4P9SA 4RBUA 2CVEA 3OTOF 1LKYA 5D78A 2GJIA 4H5VA 1U09A 3ICLA 2ITMA 4UUWA 4GVBB 5D4LA 3FZLA 1NKCA 3AY9A 1RP5A 4DFDA 3MMAB 1BXNA 2XY5A 4AHTA 2H9ZA 5C42B 2V50A 4C8KA 1F9FA 2KFNA 2HVZA 4EBEA 2Y0SC 3FQKA 4DDFA 5K20B 4GVEA 3AVNA 4PPXA 4KHMA 3O3FA 1Q46A 7FDRA 2BX6A 2RUSA 3B9JA 5KFSA 2O8DB 1TFWA 2IRUA 1VHXA 3O08A 4LY7A 3VC8A 3NL0A 4CFCA 1NZAA 3ZEUB 4EI2A 1F0MA 4K43A 4CLZA 5GAGI 4J2DA 1IBLF 1RGIA 1GLBG 4NE9C 1JLQB 4O3SA 2A1RA 3LGNA 3ZFVA 3JSMB 3K2YA 3C19A 5ETSA 1RBLA 3QO9A 4KE5A 1D9DA 4DR1J 1D5AA 2JHEA 2KKZA 4ZPVR 5CYMB 4LF8K 2RQMA 2FE9A 3RJHA 3CJKA 4Q45A 5DQIA 2D0BA 2DNMA 1NBWA 3AAPA 5HVFA 3KLGB 3G9CA 1SKUB 3CD7A 4M5LA 1AZSB 5AT1B 1TK0A 2QW9A 1QD1A 1VLBA 3VEWA 1R7IA 3O3HA 3H59A 4KHQA 3L3UA 1SAZA 4BR5A 5LMNJ 4FO0A 5JS2A 2DHXA 3VAFA 1ZQTA 3A5LC 4WP9A 3V6KA 2WFBA 2A0FB 4Y00A 4KITB 2E1ZA 1X4BA 1XNQJ 1DARA 2Q97A 3T1AA 1BHLA 5KFKA 3QERA 3C16A 3A8KA 2C3OA 4DQSA 4USWA 3N4MB 4LIWA 1HJOA 2B8PA 1S9FA 3G6EN 4ZOSA 1NDKA 5IOLA 4OLBA 3EUB2 3IG1A 9ICGA 3FKBA 3CJ9A 4BVPA 2XMTA 1M5HA 3ZT1A 4TQSA 5A6PA 4KFBA 4U7BA 2R2SA 1ZBTA 3OUYB 2YWGA 3PJWA 2MLXA 1JJ4A 3CJ0A 2QA4N 2FDRA 1FNMA 1CULB 5KAIU 4CEEA 3KWMA 4Y2XA 3LWLA 4US8A 3O9TA 1I1GA 4RQ3A 2PMWA 4FWMA 4LRDA 4CJLA 1RHQB 3Q8RB 4YOVA 1QQ6A 3P39A 2DNGA 3K8WA 1KLNA 3H90A 4F0MA 3WIUA 4DV2K 4LF6F 2JH1A 4ECXA 1YZ7A 1J5OA 3V2UC 3AOAA 4RWXA 4UASA 4QU7A 2GVDB 1PJ6A 1MROA 2IC3B 2DISA 2LYVA 2BABA 4A2BA 5F8LA 2PFQA 3VCDA 4I29A 3MM9B 3HL8A 1RBRA 1U1OA 4DJBA 1ZJMA 5AE1A 1MLAA 4CLTA 4M45A 4CJVA 1NGFA 2Y9HA 4AHCA 2JEJA 3HRDD 1KQFB 4QZ9A 2RQ5A 3M8QB 5LL6d 4LF9K 4CF4A 3V1RA 3JPSA 4EWTA 2G8VA 4LSZB 5I42B 3NVZA 2XWYA 4RW4B 1N5YB 2DIUA 2QYGA 3QRQA 2HQ3A 3W60A 2DFHA 2OTLN 3UDCA 3OXFA 3BGLA 2YNGB 1A0PA 2ZITA 1QSSA 3K7RA 5G5HA 2VU5A 3U9DA 1WKJA 2B4JA 4H4KC 4K2JA 2F9DA 1YJWN 1WC4A 4URSA 1SIJA 5A2QO 2OJ3A 3UWTA 4ECWA 2DRAA 2HVIA 2ZBIA 4OGEA 4KHPK 3LF0A 1E6VA 2BRKA 3H42A 2HIYA 3VCBA 4TVAB 2G06A 2VJ5A 5FLXU 3EEQA 4J9RA 2E8MA 3SENA 4Y2AA 4RU9A 2B6AB 2R9LA 1AFIA 1S1WA 2DNOA 4H4MA 4ZA1A 3FZ2A 3C1ZA 1ZAVA 3MM8A 3ZT4A 2VWJA 3I0SA 4LF8J 3SQ4A 1RDBA 3L2QA 2RLTA 3T5HA 3OTOK 2ZKUA 1VMBA 3CJ1A 2YI1A 4KC5A 2D3ZA 4WFXA 3VHQA 2PEBA 4MFBA 2NSCA 5M1NA 3WK4A 4CNQA 3EKSA 3FZKA 1GMWA 3SK3A 2P9EA 3F9MA 3SAFA 4YOXA 3G8SA 2V63A 3OT9A 4K4YA 1BO5O 2JX2A 4P7VA 3K0SA 2CRLA 1C0FA 4J9LA 2JZ5A 5J0WA 1FWPA 3DAWA 4MEYA 4DSJA 1OYDA 6FDRA 2JOQA 2C2DA 2HWIA 2Y0BB 3HHLC 2AEMA 5BRHA 4NLOA 3ORYA 1NJWA 3Q7CA 4P71A 3L95X 1Q86T 3ZT3A 2UXCJ 4NOHA 1RE1B 3VQCA 5ALTA 1X42A 4Q0BB 3NH2A 5J2FA 4O0IA 1PIEA 2GJ2A 1XNRF 1J97A 3OTEA 4DFPA 1ZZNA 2FVPA 4JS4A 1I6JA 1IBLK 2CQ2A 4GY2B 4RWTA 4TN2A 1K6YA 4DU3A 2ZJRQ 2CPYA 2COLA 1ASUA 4PXEA 3ZI4A 2O66A 3L2VA 1HQUB 4JI4F 3D2EB 4Y6IA 1PVRA 5ALUA 8ICKA 4GKJF 2RRAA 1C1CB 4DL3A 5I3QA 3K9KA 1P27B 5CZ1A 3BZCA 4IH6A 3QICA 2QL5B 4H0OA 4JEPA 5L1IA 3QEWA 3G10A 3ZTRA 3IRXA 9RUBA 5J0SA 4MK8A 4C8ZA 3LVVA 3OYHA 3I82A 1Z00A 2K3IA 1CJTB 4UY8T 3H45C 1S6OA 2VODA 5J29A 4AM7A 4M95A 1MN8A 2GWKA 2MZRA 2ETJA 3NAHA 4Z4HA 1JQGA 2Z1HA 1VGYA 1SH2A 4CJ7A 2YKOA 3U1MA 4K4ZA 3S6JA 4A8FA 5KGXA 3PIPQ 3IXQA 1NEEA 3RJEA 4WFAQ 2VQFF 1BA0A 4QS9A 4WTOB 1KR4A 1YLXA 7ICQA 2RH3A 3IS9A 2OIHA 2R8IA 3OY9A 5KG0A 1UW9A 4LZGA 7ICUA 5KT5A 1F2HA 1HWLA 3C15B 4M9JA 3IR6B 1HPMA 2PYLA 1WC1A 4PL8A 3RR8A 3LAKA 1NJXA 2Q66A 3Q89A 4IQTA 1T9VA 4KLQA 4LF9J 3FM9A 4OKKA 4NCGB 4KTWA 4KTZA 5AM0A 4LFCJ 2VBXA 3L4IA 1XMBA 2HK2A 3OBWA 2R7SA 5IM0B 4X64J 4CF0A 3UN5A 3LDQA 3CMES 4CLYA 4JYAJ 2MY8A 4Z4IA 2WRMA 1ZQMA 3AEVA 3VQ5A 2KB2A 1G6BA 3PTWA 1KAXA 4F5NA 4XTTA 1QZ6A 3SCJE 3NF8A 3DU6A 4C8NA 3CJ4A 1BWEA 4G1QA 4NXZA 9ICMA 1SI9A 2EX3A 1R8CA 1BQMB 1HPZB 3M6KA 4KHPJ 2HI0A 1Z26A 4YD2A 3QBXA 4JAXA 2MSNA 5GMDA 1JCGA 1M90O 4LF6K 2ZNZA 3OYCA 2FGCA 2Z2MA 4Y2PA 1BNPA 3IV6A 1BCOA 3VQPA 4CEQA 3K5PA 2AJFE 2GHWA 2G8FA 4BDPA 1WHXA 3AM9A 1T9UA 2D8CA 2QA2A 3TVZA 4WE1A 4M5DB 1TP7A 4WCEL 1OYEA 2BJ8A 1U6BA 2EW9A 4YN3B 1LK5A 4NZ0A 5EWEA 1QSYA 2YB4A 4DN9A 3L0QA 3D2SA 3CUNA 4IEIA 3UKRB 2L08A 3ZSRA 4HH1A 3W5YA 2OYQA 2IYIA 4OJ3A 3PEHA 2FZGB 2G2ZA 3HI9A 4CIEA 3P45B 2VASA 4CFAA 2E5LF 5KG1A 4I2BA 1FRXA 3CCLN 3DOMB 1O1WA 3RAQA 5KTQA 4FNIA 4O5EA 5AQHA 1F5CA 4M7XA 4B3OB 1FJ7A 1ZQDA 1IBLJ 4FW1A 1UZHA 5EVZA 1XR5A 1WF1A 4OX6A 2UUTA 4WQ5C 2X1FA 5D15A 3GU3A 2AXTU 2DNQA 4CHOA 4KI6A 3G8QA 2AMCB 2ZOGA 5BYRA 3E3XA 6AT1B 2ZWHA 2GELA 3DRSA 4L6V3 3MCMA 4QAGA 4QWBA 2MQPA 2V8VA 4MFFA 2DNHA 2C3UA 3VAMA 2NRRA 3NBPB 3MABA 5ADXA 2H3ZA 4C3LA 3L4PA 1VSFA 1U47A 3GMGA 3VZIA 2H4WB 3VALA 4KLUA 3HFVA 1RKIA 4IBNA 4YORA 3MK6A 4C6AA 1GQEA 2ISPA 4IG3B 1V97A 4YY3F 4CECA 2AJ4A 1NU4A 1M1KT 4ED7A 4O8UA 3OYDA 3MEDB 4YN4A 1BL3A 3AVHA 4F4AA 1B0VA 2YJFA 3PY8A 3CSKA 3M1FA 2UZAA 3T19A 1MU2A 5BR8K 2AYBA 4WXOA 3F5AA 2KV2A 5HP1B 3VQDA 2B9XA 3QQCD 3MR3A 3IM9A 3OQ2A 3V6DB 3HJEA 1UFKA 3NS7B 4DKWA 4TXSA 1X8DA 5KG4A 1N8RO 2HS0A 1UZDA 4CM2A 3O44A 2OEMA 3KUEA 3EUNA 4JI6F 4K8RA 5J2PA 4CJKA 4IRKA 1VBKA 3L4BC 3J7YP 4CO1A 4RL1A 1R27B 3BPSP 4DTPA 1JLBB 1XUPO 1FHTA 5EWGA 2QKKA 1RT6B 4F2SA 4JI4K 2FY8A 4ES1A 2WSCC 1OS5A 3ZTSA 4GKJK 3FMBA 1SJFA 4YMNA 4KIAA 2DQNB 3CI5A 4FN5A 4R63A 2IDEA 2MU2A 1F9HA 5GMKa 2I7PA 4I6WA 2MQQA 3MGIA 2HFVA 4FJ8A 3KJFB 1N32F 1UQVA 5I4MA 3CC4S 4PUOB 4H0PA 1ZH5A 4FJ9A 4JRQA 2ZJAA 3H8WA 3UMBA 3WXMB 2Z58B 3VQTA 3BKTA 4X65F 1HNZF 4I6MA 5KT6A 1K8AT 1FI4A 1RT7A 1HIWA 1JMTA 2BPFA 1CC8A 1YRTA 3C6HA 3ELHA 4CI0B 3G82A 3BGUA 4WYLA 1X0FA 1WSJA 1WG4A 5AKZA 4F4WA 1BQNB 2WMMA 1DXSA 1UA0A 2FJXA 2Y8WA 3V9SA 4IG0A 1WI8A 4ED4A 3F73A 3DLKB 4AYBF 2FJ6A 4W5OA 3KKRA 2QG9B 1DQ8A 2R8JA 2BPGA 3SEIA 4ILMA 1N61A 2K60A 4NLBA 1FKAF 4QCLA 5LXRA 8ICHA 4FJXA 1NJZA 2UUAF 4ILHA 2F9WA 2ZKTA 2FJEB 1DQ9A 4L76A 3IC1A 2ZH3A 3H6EA 4MFAA 3UD3P 4C7ZA 3PLAA 4LBPA 9ICRA 5CABA 5AKLA 1QVFR 5AQXA 1FVSA 2B51A 3G4SS 4PG7A 1KKXA 5AQUA 2XY6A 2KXHA 1HJPA 4DL5A 3AOCA 5I3UA 4CIOA 4KGMA 5HANA 2YNIB 1WAFA 4KLEA 1NOMA 2EG1A 2LP4A 1RBVA 3EPIA 3IUCA 4IFEA 1IR2A 1Y5IB 3KK1B 2R18A 2P9LA 3BF1A 2A41A 3VQQA 4C80A 1OIAA 4R5PA 5GINA 3NXZA 3AO1A 3MUTP 5AKJA 4I28A 1PC5A 3A3OB 5F8MA 2NNWA 2V2KA 5CHCB 3MWPA 4ECUA 4QWEA 4CEAA 4G3IA 4I2QB 4B9NA 3ZSQA 1VQLN 1D09B 3DJCA 2WW8A 2BKPA 3D6MB 2O4IA 3R9KA 4FJIA 4DFJA 5E3CA 1S77D 2JRZA 1IG6A 4UZCA 2YQ1A 2HFSA 2EANA 3IHQB 3AO4A 1VQ7N 3VENA 1KVKA 4GVBA 3U1NA 1Q81O 1BQXA 3MPUB 3MMAA 5BR8J 4HT7A 3U02A 2BCQA 1V9OA 5FJ4A 3NTUA 3HP6A 2E5LK 2F1JA 5C42A 4JN4A 3OJUA 4J37A 5F3XB 2CZVC 3DYAA 4BC3A 4C4TA 1BG3A 1MW7A 1RDCA 3THVA 3OW2M 1VR6A 4GLXA 5G4DA 1B7FA 5ALLA 1CQMA 2WBNA 2IVYA 2O8DA 3BS5B 4M3YA 4A4JA 4BREA 3WXIA 4NL9C 2ZHBA 4U96A 4CO5A 3IR5B 5IINA 3ZEUA 2C3MA 3SFUA 1RT5B 2AEJA 4WK1A 4Y2KA 2O4GA 3DLRA 4IOCQ 3ZDAA 2R8KA 1QVGR 5EWFA 2J6UA 3MMVA 3TZYA 1Q3VA 3IN5A 1B0PA 3AJ2A 1JLQA 1K1QA 3CERA 3OSPA 3S1TA 5TISU 2DNYA 2BBEA 2L48A 2LPEA 1U04A 2K2PA 1F1BB 3JSMA 2CH6A 3TKAA 3AJ1A 2DNZA 3SI6A 9ICIA 2RMLA 3S7RA 4EX7A 2MAXA 3E51A 4CP5A 4H0TB 3BGFA 4AF1A 1W2BM 4ZITA 2HFNA 3SCXA 5DB6A 3WDOA 4F2RA 1QZ5A 2PFDA 5CYQA 4DOCA 4MYTA 5CYMA 4YY3K 3FEXB 5GIOA 4GNIA 4BR4A 2HG4A 3KLGA 4USAA 3PVXA 3Q8YA 2JH7A 5E2QA 1TQLA 3TA2A 3TUZC 1YKWA 1WC6A 1ZM9A 5LSLA 1X2IA 3KOAA 3MBYA 2DPIA 1QTNB 4ECVA 1AZSA 4NI2B 3V9XA 1ATSA 4RKUC 4NYNA 1F0XA 2OO4A 3HZEA 1TZ0A 4KX5A 4XPEA 3AD8C 2ILZA 4IKAA 2A1BA 4M9HA 3RJJA 1AFJA 3IMQJ 1VC0A 1QHTA 2E1MC 2CJYB 4JKFA 4JI6K 1L7OA 4WF9L 4ZIWA 5AFUA 2P2CB 4PHTX 5DQHA 4KGZB 2EBEA 5DDYA 4ED0A 4I7FA 5GAGU 3O1LA 3O0FA 1XK8A 2KVQE 2K89A 3F44A 5IIJA 3JTOA 1IKVB 4M3UA 4OYWA 8AT1B 3Q83A 3PR4A 2HOFA 4KBIA 3CCSS 2AHOB 1N32K 2D3OR 2KEYA 3OUYA 2DB1A 1PBUA 1RTIA 4DR6F 1RU2A 4X4TA 5AI9A 5A8WB 3KK2B 5HK4A 5AQVA 5AXNA 1C0TB 5DM7Q 2IJNA 3HSGA 5DBBA 2LDYA 1LXJA 1CULA 3AQOA 1Y7PA 2IM0A 4E2FB 1T44A 5AQNA 1BMQB 2NPFA 2OHDA 1HNZK 4NO7A 3LQVA 1JX4A 3O1WA 2KYXA 3ZXWA 2F40A 4H5TA 5E3AA 4ALZA 2P6UA 3BS7A 5CHGA 2C2RA 2GIQA 4O3PA 4BX9C 3OPXA 2GIRA 1UAWA 3U3YA 2IA0A 1ZRMA 5IQQA 1RWPB 5D49A 3KKAC 1M6YA 3PUFA 1XC3A 4MT1A 2GVDA 2KN4A 3SBMA 3CNHA 2IC3A 4X4UA 2XYHB 2CNOB 1J2VA 1QDUB 4W5TA 2H65B 2OKQA 4OCZA 4CHZA 1PK1B 3NCRA 4I9LA 2W4PA 3MM9A 5DGBA 2FZKB 3H3OB 3KKFA 3CJRA 4J9VA 1YX2A 2ZVSA 1HJRA 3HPOA 2W24A 2G5HB 2UUAK 2E5LJ 5FD1A 1S79A 3C3LA 3CVKA 2XLKA 4FCYA 2I1QA 3R1XA 1JL1A 3A3PB 1DFDA 1CVJA 3U3GA 3E66A 4AYBC 3M8QA 3CDBA 3VESA 2G09A 3VVUA 3WNHA 2X1GA 2OELA 4LSLB 5I42A 1Y4ZB 2KN7A 4EEYA 2D1CA 2HS4A 4RW4A 1N5YA 1SH3A 1FF2A 2AYEA 2MHNA 3RJGA 3DLEB 4LRCA 3NWGA 2OPQB 4JKGB 2D0OA 2G8HA 1RT4B 2YNGA 2AIRB 1FX4A 3MX5A 3SSQA 4MTPA 1UVJA 5LMUJ 2AX0A 5IXUA 5H9FK 1JXVA 3D2QA 3RZAA 4KAIA 2WHOA 3NGKA 1ZQJA 3TTFA 3ZZTA 3ZETB 3CDWA 1W25A 3WX4A 1SV5B 3MN6A 1VQ8S 4X4RA 4KGVB 2B6AA 3FCWA 3T6JA 1KS2A 2GMLA 3TZXA 1SV4A 3AODA 2DUYA 1F21A 1ZBFA 3OR2B 2DXFA 5AQZA 1H73A 3I96A 4E89A 1VQ9S 1APSA 3FJ2A 1BPBA 2ZJ5A 3NNCA 1HYVA 4Y2VA 5AQGA 3MFIA 1B43A 1FFSB 3GYXB 2FMPA 4UB5A 3CM6A 4ZLPA 3MAQA 3UR0A 2IPOB 2G8WA 1RQNA 3R6LB 1GNKA 5H9EK 4PH5A 2YWHA 2YX4A 3VMFB 2ZH7A 4FM0A 1ZAXA 5CY4A 1FT8A 3UMGA 3EVWA 2W43A 1WWHA 2Z30B 3O80A 3C2KA 4NXNF 4EHTA 3T41A 1PYTA 3C14B 4J9UE 4YG2A 4DO9A 4F4KA 4DS5A 2V67A 4I6YA 2C3YA 5M1PA 4Q0BA 3M8RA 2KKHA 3K57A 4BROA 2V8HA 2R7QA 3FCHA 1XU4A 2MXYA 4K4IA 4QYRA 1TMMA 3O1BA 1TL3B 3PNIA 2N3OA 1NZPA 2YKPA 4IFYA 1N32J 3OVSA 3FZHA 3TU5A 4IWVA 3UDVA 4RPZA 1HQUA 1VQON 5B7WA 3SMSA 3A5NC 3D2EA 3A8JA 5BPNA 1NK5A 3HHDA 2VHGA 1HEKA 3ILLA 2V8PA 5HBMB 2IHMA 2V52B 4LFBF 3IRUA 3J7AP 3AH6A 2OTJS 2JWLA 1UA1A 1HNZJ 2A18A 3IDHA 3TWZA 1N60A 3MCOA 2I6XA 1HD0A 2MQOA 3H4BA 3EZOA 1U8SA 4GO7X 5AKEA 2OSQA 4C8LA 1CJTA 3MMBB 1WAJA 1V5VA 2XGQA 3JS6A 5MLCV 4M6WB 4MKAA 5IS2A 3CD0A 2QWRA 4LMZA 3O8MA 5BOLA 3LDAA 4P52A 3UQ0A 4FF4A 2QRRA 3OVNA 5BYQA 3V7KA 4CJUA 2AP6A 5KOWA 3QE9Y 4UAVA 3KZBA 2KD1A 3C15A 3SIPB 3O9UA 4I9QA 5HL7L 2AGQA 4F5QA 2UUAJ 4DN0A 3W64A 3VAGA 2BE7D 1BE4A 3QJLA 2NRTA 1YJNS 2KIVA 1G4CA 3HO1A 4PKHA 1R8PA 3HJFA 3GR0A 2DGZA 4NCGA 3WC0A 5IIKA 2D3DA 4F72A 4CCHA 4UF4A 7ICRA 4BY9C 5CE3A 7ICGA 2IGIA 1YTUA 3D2WA 2B9YA 2KDOA 3K75D 5IM0A 2VICA 3GB0A 1U4BA 1HBMB 1RQLA 5T7LB 4W90B 3MD1A 1NLVA 1UVNA 4DR6K 2F3JA 3ULEB 2AX1A 1URRA 3AGKA 1VSJA 3GLJA 5B0BA 4DB3A 1Q7YT 3L2UA 4H54A 5ALHA 2KMDA 3TAGA 1YBUA 2ZH2A 3BO3A 2DR7A 1BQMA 1S12A 3S3MA 1HPZA 1A76A 5AXKA 3FDSA 4UOCA 1F9EB 4O5BA 3U26A 2WVBA 2KO1A 3D67A 3VQEA 5HMMA 4U7CA 2RHSB 4LIRA 1S6PB 2DKOB 3PZPA 3I76A 4CERA 2Y0SD 4LF4J 1QQMA 5A2QY 4P0PB 1RAJA 5JICA 1RSCA 4FWOA 4KGXB 2KH9A 2Z1IA 2P51A 1QY7A 3GOIA 1D9AA 4M5DA 1T05A 2QZ8A 2BR0A 3R7NB 3WKAA 1RABB 2FC0A 5H9EJ 1KONA 3DXBA 3RH4A 3PFEA 4ID1A 5ALQA 8ICAA 2AYGA 4OJHA 3KG0A 4Q2LA 3UKRA 2MSTA 2FF6A 1XR6A 2FSKA 3OTBA 4KGKA 3TAPA 2KTQA 4Q8FA 2Z0GA 2QEXS 4FXDA 2ACMA 3DOMA 4P10A 1ZA1B 1B4FA 1BPDA 1ZTWA 2W2QP 1HNXJ 1X5TA 2XRIA 4B3OA 5ETQA 2WSFC 2W7AA 1GMUA 4NLXA 2VQEJ 2PY5A 3HLUA 4NLQA 5GADP 5ALMA 4EO8A 3IM8A 4DTSA 2GC8A 4DL2A 3BO2A 1YIJN 2IIHA 3C7NB 2CYYA 4UUXA 1JLAB 3QBCA 1EO1A 3P5BP 4IDKB 3MDFA 1X60A 4FSVA 4RLEA 4AXIA 3PJXA 4XPCA 5D3GB 4Z4GA 2DNKA 4QZFA 4PCQA 2G1HA 3AT1B 3KK7A 4MO4A 1R59O 4CH1A 3M7DA 2LYAA 4LQ9A 2VIXA 2HSEB 2YWEA 5G5GA 1X4EA 3RBZA 2G0AA 2DD8S 4IH5A 3UVJB 5K8NA 3G8TA 4IG3A 1KVJA 2O6KA 1YJVA 3VGUA 3QLHB 4KH1B 3C21A 2EFOA 3HPHA 1YF5L 3OBYA 2W55A 3MEDA 3EVOA 2XNRA 2YPZA 1LEOA 4TY9A 4ZTJA 3QEVA 4FF3A 4NXNK 2RVJA 1ZRNA 4OYIA 3G6ES 5KT4A 2A3JA 3BQ0A 1SBRA 3G0ZA 4DV5F 7ICOA 4NXMJ 2X1BA 3V6DA 2XSJB 1R6VA 2A1SA 2DWQA 2W03A 5J0PA 4AL6A 3M4XA 3PYFA 5F2RA 5HMWA 5AQRA 4K0KF 1BPYA 3VAHA 1SJQA 3PRVA 2RPIA 4CGJA 3OPKA 5J2HA 2XM3A 3M32B 1BU6O 3H0MB 3GFHA 2RNEA 2QA4S 1VIXA 3IWNC 1M5SA 1OY6A 1JLBA 4RCHA 1RT6A 2L3MA 3Q86A 3C2MA 3TNVA 4DR6J 1YJTA 3VEXA 1RBUA 1COOA 4ED2A 2MZQA 4RW9A 4F3TA 4HKQA 9ICUA 4WFBL 2LYHA 2E6LA 2NYVA 3N7RC 4FK0A 2PIIA 2E2OA 4CF1A 5KQDA 4EBDA 2MRLA 4R0EA 2QWOA 4PUOA 4QZCA 4DFMA 2P9IA 3UKUB 1ZQVA 3A8YA 1IXKA 4DV7F 1LQ9A 1G3OA 4CGIA 1XS9D 5L38A 6FD1A 5M2UA 3W8GA 3O9RA 1CS4B 2H3FA 1KXPA 2AYMA 2P8IA 3Q22A 2NRXA 4L72B 2E5GA 3GDQA 4WIQA 1JXEA 4FZVA 1SQFA 4BRPA 2I1RA 2BACA 5C15A 2EFVA 4FZMA 3I9V9 4HR2A 1WSHA 1WCNA 2FJBB 5KFGA 3GJRB 3N97B 1IQTA 3N01A 1LFPA 2QFJA 4RBVA 1HQ2A 1BQNA 1DLOB 1R6YA 5AJ3J 5CA7A 3ONQA 3QRPA 2F4VJ 4X4PA 1JROA 3WQUA 4CRJA 4K59A 2V2QA 2CQ0A 2HQGA 1RDUA 4CO4A 5J2KA 4BRQA 1LWCB 3BN7A 4Y34A 2UYTA 3NGIA 1ZZFA 2VOPA 3C28A 3AVKA 5GMEA 3EWGA 4K8ZA 8ATCB 3TEGA 2H48B 3IGNA 2XCPA 2RS8A 1X9MA 1NGGA 3CDUA 4AUKA 1RQ0A 8ICOA 4OI4A 2ZHAA 2HRTA 9ICXA 4HWIA 2QLBB 4WIIA 4OX8A 1SVDA 3CPWM 1I94J 3TAMB 3DV9A 2WTFA 4FZXC 1LWFB 3TQ1A 4U7UK 1QTMA 3KFWX 1HW8A 3RB4A 4DTUA 2E1YA 4KSEB 2RD5C 2HS3A 2R7RA 4RQ6A 4FW2A 2KT3A 1N4LA 5HVHA 4R8UB 1LAWA 5L1LA 1TVRB 3HHNB 5KFVA 3VAJA 9ICAA 1N0VC 1VJQA 3TRGA 3QAUA 1B70B 4FFDA 3A5MC 3KK1A 3VVTA 2Z1GA 4KX3A 3PSTA 1S4FA 4M63A 3HHLD 3UNGC 3ZSWA 3KBBA 3W1YC 4RNMA 3N4PA 3CFOA 1NO8A 1C0UB 4ECSA 4P73A 2G07A 9ICKA 3PIOQ 3J7Z5 1QQ5A 2Q6BA 2O8BB 3MTJA 3NAEA 4DTJA 1BD6A 5EE0A 4I2QA 5E84A 3P5JA 2FBYA 3X3UA 5B0GA 4ES3A 4KQZA 1Q7LB 4ILRA 2MZ1A 4OZ1A 2BUPA 1VHIA 3P96A 2WBRA 2VUGA 5GTHU 3AVLA 5JRTA 1UEVA 2FLOA 4NXNJ 1EP4B 2HNYB 3VTHA 2CFXA 3M6GA 2EBGA 3D0GE 1DK2A 3QSYB 3JS9A 2HURA 3LDNA 2LXUA 3ET6B 3BF4A 3QPIA 1RZMA 2IVMA 1NOZA 2B3TB 4PHAA 4Z4FA 4YOTA 2HNDB 4CF5A 1RCXB 2KW4A 3GYGA 4USHA 4ZLNA 3FLCO 1SL2A 3M6VA 3BS5A 4B9LA 4YHHF 4JI3F 3CDEA 3LTOA 4IKFA 4AQYJ 4QZIA 4KO0B 1VSIA 3HZ6A 4KHYA 4FM1A 4U9RA 1RT5A 1UEKA 3LP2A 3TUJC 2BGGA 2E1FA 3SPZA 1SC3B 5IWAF 1YVFA 2CADA 4R79A 1KL9A 3O2IA 2M7SA 5DS7A 1DGKN 3A3NB 2KG0A 3A1YG 3VERA 1Q86O 1NMNA 3FK4A 3TABA 5SZTA 1V4TA 3AJDA 5DBAA 1SPBP 2DNNA 1CG2A 1FRKA 1WC3A 1VS3A 5EDWA 3P6YC 3NGYA 4ERDA 4IOAL 1OSDA 3RJIA 2XY7A 4ZCLA 7ICMA 2DGTA 4Y2SA 4H4OB 3A0HU 1KFDA 1U0SA 4ICLB 3NNAA 2GS8A 2PI4A 4JB3A 4JI5F 2LHTA 5ALRA 5T14A 4KB7A 3AARA 2W7OA 1K1SA 5DKWA 4CJQA 3BR8A 4JI0F 2BJ3A 2L9DA 3F56A 4NI2A 1WG1A 2UU9K 2DH7A 3THYB 4ZVQB 2QM1A 4YR3A 1SJ1A 4DV5K 3VETA 3D6HB 5KPRA 3KTQA 4Z6DA 2PA8D 4FXVA 1TR0A 1W9HA 3RH5A 3MDAA 5LY3A 3SI8A 2GOLA 4URGA 2QLTA 1DRGA 4AL5A 4K50A 3SNNA 3LAMA 4CYUB 3VQ7A 1KVBA 3BH6B 1YVNA 3AVFA 4RUHA 2CQIA 3SQGB 5B0DA 1NGCA 9ICBA 1IKVA 5AI0A 4ZVUB 4OYPA 2A1JB 1RAOA 1URNA 2IVNA 4BRNA 1B9DA 3ISZA 3DRRA 5CP2A 4ZVFA 4IOXA 5HRRA 1ROFA 2G8UA 1RNHA 8ICTA 2CGLA 4CK3A 3PACA 5HJXA 3H0RB 2KHDA 1AYEA 3NF9A 1OH8A 3HP9A 2GJFA 4DV7K 3D6JA 5A8WA 3KK2A 1C0TA 2WF6A 4OFZA 7ICJA 1KEKA 1NMDA 8ICRA 1EZZB 3HI0A 3RW6A 3BP8A 1Z6RA 1VQPS 4JD2B 4C4RA 2OMOA 4LC9B 3QGPA 4HAIA 1AUSL 1LOTB 1NG9A 2FSNA 3RBXA 1M90T 1MWMA 1U49A 2EZZA 1Y88A 4LF5F 1TYQB 1FRMA 3FC9A 4EYIB 4CJWA 2B0CA 7FD1A 3CM5A 1ZQNA 2ZH5A 3FBCA 4YUDA 2F3NA 2F9TA 3P38A 4LF1A 5AFUH 1TKXB 4CLFA 3AVBA 2Q79A 4CO3A 4B1WB 5CAAA 4IRDA 2BM1A 3RB0A 5L46A 3UCUP 2FZCB 2WF5A 5KRTA 1PK1A 1OH6A 2P9PB 2VPWB 2J4RA 3CCLS 3N6NA 3LM9A 2JHDA 2W41A 1WDTA 1IQZA 2G1DA 2E9RX 1RA7A 3AXMA 4QIEA 3Q8SB 1ICEB 2QMXA 2KHOA 1KN5A 3BSCA 3GIRA 3B4DA 3T1YJ 3HSTB 3F5TA 2F65A 5AKKA 2QL9B 1N54B 4LSLA 3D2FB 4QZ8A 3L09A 4QW8A 3MC1A 1SIZA 2BW2A 4FLTA 3DLLQ 2ALYB 1EX8A 3DLEA 2OCEA 4JKGA 2OPQA 2IBOA 3AA8A 4UQTA 4MYUA 3W9HA 3CQYA 2QJ3A 3PFOA 4DX7A 3E01B 1L7NA 5FPNA 1QAIA 1HNVB 4CVNE 3CWJA 2QB1A 3LYSA 4PQUB 5TKYA 2IDOA 3O9SA 2WB1C 2UXDJ 3P83D 4TQRA 1YG0A 1VQ6S 3NG8A 4XEIA 3ZETA 2ASMA 2H5IB 1SV5A 3BGRB 2EFNA 4DV3F 3KFUF 1BIZA 1RKJA 3OR2A 2GVZB 1GK8A 1T6CA 1Q8KA 2KL8A 3WZ0A 2J9CA 3GU0A 5D0GA 4A8XA 1HKGA 5K4LA 4YDUC 1X3MA 4O4RA 4MAKA 3RRKA 1QUVA 4PJ0U 2K8BB 3CMAN 2RDIA 2I9GA 3H98A 1X5PA 4D3GA 2UU9J 3Q8QB 2LYBA 3TR5A 4DV5J 1ZQEA 4RNNA 3J7YI 4AP9A 3PR5B 1FXRA 5JS1A 2F8LA 5ALWA 4O5CA 1YBTA 5KFQA 3VZHA 2Q4TA 2OI2A 3C65A 1L8OA 1S5LU 3PSFA 4FJGA 2OANA 4RUCA 3KDNA 4G9ZA 4O55A 3P49B 4A57A 3C14A 4YHHK 4JI3K 3W9JA 2E44A 3G96A 3RMDA 4K25A 2M8DB 1SL0A 2FUG9 2GCFA 4MMOA 3TADC 4FVCA 1T7PA 4DPUA 4IQWA 1Z4NA 2HWTA 4XH4A 4KMOB 4GXKA 4O44B 2IRYA 1M1KO 5IWAK 1TL3A 1OY8A 4M2YA 3NUQA 9ICFA 3MZIA 5D77A 2QWNA 4CEZA 3ILOA 2HAIA 4QJFB 2WVFA 4DBQA 4LF7J 1DRZA 4DV7J 1YITN 1LCUA 3LZIA 2ZTCA 3V7JA 1KOOA 2VDIA 4TY8B 3CNQP 2JDJA 1HYSB 2W2PP 3MOZA 4K42A 1JALA 3M3ZA 4M9GA 1GEHA 1XHXA 1J9AA 4JI5K 1I5OB 2JEFA 4B3RF 2IOHA 1YAGA 5CHIA 1H7XA 4KHUA 3MMBA 1T03B 2JGAA 4PG6A 3L9ZA 3T1HF 2FB0A 4JI0K 4YB5A 3UPFA 4M6WA 1PILA 4WFNQ 2F77X 3MECB 3D66A 3FVYA 4FPBA 2G13A 4FKXA 5HQ8A 3AMZA 3MM6B 4M04A 2DR5A 4OO1J 4ZTFA 4RT3A 4Y1CA 3J7ZO 3SAHA 1NK8A 4HACA 2V5HG 3O5TB 4ZJOA 5ALFA 4DV4F 3L7PA 3G6VA 1L3KA 2IY5B 2MSSA 1A6LA 2M2BA 4A46A 1K8AO 2DNLA 1JUDA 2M0GB 8ICIA 5ETOA 3ZSOA 4OYZA 4DX8H 1Q9XA 3GP9A 3TAQA 1M1HA 5DK5A 5J1EB 4Z0UA 4RR5A 4DL0C 9ICJA 3KIOA 1HBMA 3RRHA 1N33F 5B0EA 5T7LA 4M0AA 4NJ8A 3ULEA 3R7SB 2H5XA 1VK8A 4PA1A 4GKKF 4F4YA 2KVSA 1U02A 3SEOA 4DV0F 2W8LA 3GIKA 5J1NA 2KYZA 2FVQA 1PJ7A 3KKSA 1ZBHA 3GZFA 4MIWA 1S1TB 3W66A 3FZBA 4LF5K 4QQBA 3ISDA 3NWRA 1RM6C 5EY4A 3U1LA 5KFXA 2W9CB 1S6PA 2HBQB 2BV3A 4PGYA 3V4MA 3QUTA 3HHLB 3CIPA 3MX2A 3PV8A 1QCKA 1VQ7S 3T5KA 2VFTA 2HHSA 3ETMA 4P0PA 4LT6A 3KLVA 4M5MA 3HM8A 4NLZA 5JUMA 1SKWA 1YHQS 4ZVSB 2A19A 4E1MA 2KOBA 2IS3A 2H51B 4EX6A 4F0HA 1SQGA 3SV4A 2Q31A 3C6AA 3C6UB 2KP7A 1A5XA 2DGWA 5ETLA 3I5CA 4DOAA 1Q81T 1S57A 4FLYA 2LA6A 1ZBSA 2GV1A 1ZQLA 1R8HA 3PYEA 1R0AB 2VFUA 3W0LA 1XSPA 1Q3UA 4ITSA 2PFNA 4M5GA 3SZ2A 4A8EA 4J7CA 4JI3J 4FS2A 5GAHP 3S9HA 2YNFB 2H3IA 4G6VB 3TVYA 3ED5A 4OYBA 4DUZJ 2FI1A 4NA1A 3HOSA 3KOOA 2PC6A 2IOFA 4OLAA 4TLRA 1WEZA 3AA4A 5HVGA 2VIHA 3DGPB 2VBZA 3J7AN 1YK9A 2MQ8A 5MAOA 4CGDA 3J7A1 5BRFA 1RDFA 1IG8A 4HTLA 4ZVTB 2YX7A 1Q53A 4MEXA 1DT9A 5J0XA 3AD9C 3H2UB 4P2SA 3AVGA 3C7NA 3DRPB 4TYAA 4G9BA 2KHVA 2FD2A 4IDKA 3EZUA 4DV3K 3NE6A 9ICQA 5A8RB 4QS7A 4USIA 4YCXA 5D3GA 1VQMS 1Q82T 1NKEA 4BRAA 1X31C 4JV1A 2J6TA 2XZTB 1FVQA 4IRCA 4QZGA 5DB7A 4JI0J 1TAMA 2F8HA 3ENQA 2WCXA 1H98A 4FWPA 3UVJA 2K7KA 3QLHA 4FVUA 4E7KA 2V8GA 5GVQA 3HHKA 4X4OA 3ENWA 1PK3A 1C1AA 3M6UA 3ISNC 1UVKA 1IO2A 5M1FA 1TUUA 4RG8A 3AO3A 1RTHA 3MEGB 4CZCA 3OVAA 5HLFB 2LBOA 1KP6A 3IWLA 4DR2J 1E4GT 2I7NA 2XSJA 5DETA 1S0OA 1CZAN 4NLTA 1VYAA 3KWGA 5EX5A 3VQAA 3ZDBA 4RBTA 3L2RA 5HI7A 2XLJA 3WC2A 2RQCA 5JJBA 2ZXHA 1N5WA 3RB3A 3VA3A 3M32A 1HNWJ 1GTEA 2CVIA 4DL6A 2J7UA 1RLCL 1PYOB 3KG1A 3M5RA 1JLGB 2LM1A 3HSZA 4ILJA 4OX9J 4U95A 4XO0A 1N34J 5C10A 3M6ZA 2DEIA 3V81B 2VWKA 4EENA 2P9NB 1VSMA 1NSAA 2K4EA 3AVJA 3OV7A 2XSFA 2ES6A 2W4CA 3E1YA 3S3NA 1QM9A 1NHUA 5FP0A 2GX9A 3VGVA 2KK0A 5KFAA 2F8MA 4B3RK 3UKUA 2G4BA 1NM2A 2YX1A 3FYHA 2DY4A 1E3MA 5HHIA 4LF5J 2DRBA 4HUEA 3QRRA 4A8KA 8ICLA 3T1HK 1CS4A 3EE3A 3NF7A 2B8QA 3LANA 2A2CA 4R66A 2J9EA 4FOEA 2JJ4D 1HHTP 4A8YA 3H46O 4CBXA 4P0QB 5KFNA 1NK9A 4M9LA 3OYIA 2GW8A 3UD5A 2FBXA 3JPQA 1XMOJ 4BC4A 4DV4K 2V8DA 4C1NK 2EZYA 1GXLA 4DI6A 1M5VC 4UB6U 3ETLA 2XS7A 4OHZA 1LWCA 2LFVA 2DTUA 4M3ZA 4DHYA 1G7CB 3QEAZ 1FEZA 5C25B 3ZSVA 4GC6A 4LBIA 4JOUA 3BEGB 2JXJA 2NRWA 5HMLA 1URJA 4O9MA 2VFSA 4CZKA 3I55N 3M8ZA 1N33K 2OWOA 5JVGQ 4OVLA 2ZM6J 2IM2A 4DR4J 2WVDA 1ZQOA 2G0CA 3TAMA 2AA4A 2HFZA 1LWFA 5L1MA 4H8KA 1JK9B 2PI5A 1X0PA 2HOIA 4I1TA 4DV0K 1U45A 2HHUA 4CBWA 1NK4A 3MM7B 1LOUA 1UW4A 3QUQA 5ETKA 2N7YA 1HUOA 1FXLA 3MN7A 3SCKE 3BREA 3OTCA 2M9KA 1SC6A 3MN9A 3L2WA 3WIVA 4R8UA 1NSQA 4BHQA 4LR7A 1TVRA 1YI2S 2VKZG 4NWBA 4PWUA 3I8BA 4EBCA 4YDXA 2U1AA 2AT1B 2HZCA 2BJ1A 4ZVPB 1TAUA 4E98A 2BEFA 2JVOA 1TV6B 2M4MA 4UBBA 1S9EB 2N4DA 4Y2JA 2XI2A 2CJKA 3MD3A 1WD6A 4YB1P 3QJJA 3CCRN 1NH7A 3N9UC 5AK6A 4E7IA 1WSFA 5FPEA 3BH7B 3MPVA 4IJAA 2UUBK 4C9DA 1JCEA 4FZZA 2ZJPL 2ZDOA 3I56N 3GJQB 3CJ2A 3GSIA 1XQSC 3ZT0A 2FC8A 3DHWC 4UB4A 2DEJA 1EP4A 1O51A 1T9WA 4HTUA 1T9XA 5A2QU 3SJJA 2RHQB 2EAOA 4Z4EA 1M5PC 3ET6A 3H4DA 9ICSA 3VEVA 1F5SA 4DS4A 2ISOA 5DO2A 4NLWA 2F7VA 1NB7A 2HNDA 2RJZA 2FJAB 1FK9B 4Q44A 5C0YA 1WF0A 3M2UA 3BKUA 4F4XA 1TE2A 8ICMA 1WOSA 4F9OA 4KLGA 5J0UA 2ZIXB 4KO0A 3ZC4A 5KG6A 1RXOB 3MR5A 2F5GA 1QVGM 3IA0A 3FRZA 4LREA 4A62A 3DFEA 2CG8A 1LVHA 2XMWA 1S9GB 1ATNA 5KFJA 5AM4A 3HDSA 2A2DA 1WN7A 5AZJB 4LFAK 2XZDB 3OLAA 2P6SA 4K5SA 3NGDA 2DFFA 3WU2U 3N6LA 5IQ6A 5BPLA 4J9QA 2Y1LB 2Z8QA 3UQSA 1KAYA 1SUQB 3ZO7A 2XY8A 4AHUA 4H4OA 3S3OA 2E5IA 4ICLA 1NSKL 2I9SA 3HYFA 2ZJQQ 1IBKJ 4BG9A 3KJVB 3EDRB 3CHWA 1H1VA 4B1VA 3QYYA 1Z2LA 2CAJA 3Q24A 2AKWB 1O6XA 5B66U 3THYA 1YSJA 2G8KA 1WNEA 3AHPA 3RMCA 4JI2F 2ROPA 3CCMN 3RFAA 3CIMA 4ISFA 2QWPA 3MR2A 3QGGA 4MQ3A 3MCAB 2O8FB 2DVIA 3FC4A 2D6FC 4ZLLA 2RE2A 4FWLA 1G2EA 2NXCA 2P9UB 3IGVA 2YPYA 3FGVA 3NH0A 4CYUA 2E5SA 5J0TA 1N33J 1VAZA 5ETVA 2O8CB 2LA4A 2JH3A 3R7BB 1SKRA 1EKRA 4EO6A 4RPFA 7ICLA 4MO5A 3ENVA 1FKPB 4O0JA 3DHXA 2A1JA 2EEYA 4YD1A 3LO3A 2F96A 4QYZK 2YB1A 2VG6B 7ICHA 4B9TA 3KG4A 5F1XA 4NLCA 1U2RA 1Y3KA 3I8DA 2K06A 2FC9A 2BXJA 1HLUA 4QWDA 4PEOA 3OFFA 2E29A 1ZQSA 2YQ0A 2E7VA 2VJVA 2I5JB 5HP4A 2RDJA 4ED1A 4JD2A 1XJWB 1JNZB 5J0YA 4P4MA 2PZSA 2J9DE 2MUTB 2HBJA 3UCZP 4CEFA 4IL6U 3W2VB 3DLBA 5IIMA 1TYQA 1S10A 3KWIA 3K5LA 3JXOA 2VC0A 4UAUA 4ED6A 4AHSA 1Q7YO 4DWIA 2UUBJ 2GHVC 1V85A 3QWUA 1TKXA 2OH2A 1AT1B 3QSIA 4Y2QA 4P4OA 2QE5A 4DUYF 2P9PA 1RT3A 2DO0A 1KBRA 4J2BA 4AD6A 1GTHA 2WOMB 3FE1A 3TR8A 1QS4A 5DB9A 5GADI 4PL2A 1TL7B 4ISEA 2MHEA 1Y64A 4DMZA 5IT0A 3B0XA 1MN9A 3Q8UA 4X66J 3D2FA 1RAIB 4FLUA 8ICYA 3TJ9A 3A12A 3FEZA 2H1YA 2XWXA 4M5KA 4MKBA 3UQ2A 1X9XA 3QNOA 5E0OA 4KMUA 2CQ3A 3VWSA 3E01A 3NS6A 3B8AX 3Q2SC 4BLGA 5J8YC 4QW9A 4FPRA 2NV3A 1HNVA 1GO3F 3VEOA 1T6DA 2YX6A 4PQUA 2B4OA 3HILA 2D4WA 3KHLA 3QEXA 4DCPB 2QK9A 7ICNA 4LFAJ 2K8CB 1U0HB 1F3VA 3QEPA 2IFXA 4K5RA 1RHMB 4C4WA 2C2EA 3CCUS 3U6FA 3BGRA 3GYNA 2BJDA 2DY9A 4WQ4C 1F44A 2GVZA 4HHJA 3HXMA 3A5OC 3B6OA 3HD2A 3I28A 3G71S 3WQTA 3GONA 4M63C 3SCLE 3THXB 2ZIVB 5AQPA 2KZ3A 4RPYA 3MM5B 2A3ZA 2CN1A 1MN7A 2ZWOA 3SCIE 9ATCB 3CYMA 2M9NA 1WNSA 4UARA 1JNRB 1U2VB 4KB0A 3JYTB 1FO4A 5ALYA 4B1YB 4KLJA 2LSNA 5CR4A 2CZ4A 4DCJB 1JRPA 2VL1A 2V0NA 4HYKA 1NZ8A 2YMQA 3POTB 1RBSA 1O08A 1Y00A 1X1PA 2LI6A 1EHWA 4NPOA 2NUUG 3HOTA 3DEEA 2NYHA 2KHQA 2VH7A 4DSIA 4RUBA 1QLNA 2XVTA 1WHVA 4OZJA 4JKAA 4YFKA 5ALSA 4IQUA 4FZYA 3HULA 2D0AA 2IOCA 2NLXA 3PO5A 2I8EA 3UDEA 4CHPA 1S4EA 1ZC6A 4CJ5A 5C2FA 4O44A 1FRIA 2ADCA 4QYZJ 3WXJA 5ETRA 5AZIB 3R3LA 4X62F 4Z7CA 1W7AA 1S48A 3D6TB 4FBTA 5CCLA 4CIFA 3THWB 2HMPA 3HFKA 4FYYB 2JFKA 4DX6A 4ELTA 3MEKA 1NK6A 1S7IA 3UO0A 4TY8A 4DHVA 2DGUA 1HYSA 5BRDA 1IM4A 1RLDA 4YOUA 3JAMY 4ID5B 1EETB 5J2MB 2YY3A 3F2DA 5KPTA 3UD4P 4CWBA 1KBUA 1MQ2A 4U8YA 4YMOA 3L3FX 2IHR1 3CE8A 4EK2A 5KFRA 3NMRA 1NRKA 3FFIB 3M8PB 4KJIA 1RDDA 3MF5A 2U2FA 2PFOA 3J7YU 5L8RC 3EM1A 3OYNA 2RRDA 4NZ6A 2H3QA 2E1PA 3TAEA 4WZQA 3EE8A 3MECA 4HVJA 4MK9A 5DB8A 3MM6A 4CTAB 3LPUA 1J5EJ 2ZHOA 1EXNA 4MIBA 1I51B 5D4OA 1VC5A 4QWAA 4UOGA 2PBDA 2VG5B 2VB6A 4IO9Q 4RW6B 2QTDA 4FJJA 1N6QB 2CKWA 2QLJB 1WUDA 4OPJA 1HHSA 3UE2A 4H4KA 5FDLB 1YJUA 1ZQRA 2KFZA 4B9QA 1OQ3A 3HX0A 4NLPA 5AXMA 1GT8A 4B8AB 4U7UD 1WDDA 1IVZA 1S0NA 3K4GA 4I2PB 4USUA 2XMKA 7AT1B 1VHFA 1YJ9N 4WFZA 5KG5A 3KD3A 1RBTA 4KY3A 5J1EA 2VFVA 4DUTA 1W26A 1NHKL 1DURA 3TUPA 3CCVS 1FO1A 4GFJA 2J0XA 2Z2LA 3CMEN 4OLOA 1L3TA 4NZ7A 2OPRB 9ICHA 5KFMA 1S1XB 1ZD3A 4AM6A 4BRIA 3R6MA 3N7PD 3D2NA 3PW2A 3F53A 4PL7A 2XICA 4AXJA 4URQU 5JMVA 3SXLA 2HHWA 2NUBA 1UEUA 5D4BA 2HBKA 1RI7A 1QQCA 1BUXA 3IM1A 4FOIA 5IV4A 3V6HA 1S1TA 4NLNA 1XI1A 4LVSA 1OWXA 4JKBA 3EMTA 4M3RA 4OI2A 2GLEA 2Y1JA 1O0PA 1ZQ1C 4GMJB 4CT9A 2W9CA 1RHKB 3WKDA 3K1RB 3D6FB 5IIOA 4A5BA 4KLLA 3HHLA 4XH1A 3O4NA 2YMPA 3M1YA 4CZMA 3WHIA 1DKGD 4JUZA 2R7TA 1O8BA 2Q3PA 2X51A 2FHKA 3AB2B 3CFRA 5EXWA 2ZWPA 1VJWA 2ROGA 1RAEB 3V5RA 4DU1A 3CF5L 5KL1B 5H1SV 1Z4OA 5KFYA 4K4TA 4DUYK 3NGZA 4DEZA 1PBAA 3H8YA 1VSKA 4O3MA 1EKEA 1ZQYA 4USMA 5F8IA 1RWUA 4NCAA 3C6UA 4OV6A 2WAQD 2CQDA 3NFAA 2FLPA 2E1AA 3JQKA 4B3TF 3A2FA 4ZVRB 1P9QC 1R0AA 4ER8A 3CJ8A 3A0BU 1Q16B 2YWFA 1S0MA 1GH8A 1W2IA 3R27A 4X84A 3WK7A 3T7ZA 2YNFA 2E66A 1KDNA 1DBDA 3QU7A 3D1HA 4DX5A 7ICPA 3DGPA 4HI1A 2RT3A 3CJ3A 2F76X 1YUWA 1XO1A 1UPPA 1DTTB 2CUYA 2DNPA 2FF3B 2DJWA 4TNOA 1L3VA 5IV3A 3CCJN 2I2YA 2KG5A 1SXLA 2BCRA 1KFSA 5M2RA 4HCCA 1NI3A 2KNJA 2RQKA 4GMKA 4LQ3A 4ED8A 4XQ8A 2GTDA 2QC3A 4Y2IA 2ACYA 4QIFA 5A8RA 1SCJB 4LF2A 3V9WA 3MWTA 4NYFA 3T9ZA 4HTIA 4OQJA 2K8AA 5FPMA 3K89A 2R7UA 4YP3A 2H3GX 5IFMA 5LM7E 5LJWA 3HRGA 5KFWA 5F8GA 1FNOA 4CF3A 1JMSA 4CJPA 4DR3F 2Y9TA 1AXQA 1BWVA 3KLEA 5DM6L 2RF2B 4G65A 2HBMA 1B99A 3DDNA 4P4PA 3DOKB 2YQ3A 3L3VA 1RYRA 3BPDA 2VBWA 3MEGA 1B7YB 2CQBA 5HLFA 4IQMA 5E5NA 4OZ2A 4RUAA 4H0VB 1DEJA 4KHWA 5KT7A 1NK7A 3LPEA 4PABA 1J53A 4DOZA 1VQYA 5EE1A 2R8GA 4DV2J 2A40A 4C11B 4X62K 4WBFA 4X4SA 4M5NA 1JJ2R 1JLGA 1BGXT 1D1UA 1OO0B 4WJBA 3V81A 5IIIA 2P9NA 4X4QA 2OFHX 4HT5A 3HF5A 4RQ7A 2BCSA 2CWKA 2Q0RA 3JXUA 1JLCB 3H2VE 3PO4A 4FNHA 2K3KA 5CQGA 5CZ2A 2HWHA 1T4GA 3SMVA 3QMQA 1KVIA 3UR3C 3DKDA 1ULRA 1RDAA 2DNRA 4JV5F 1OVYA 2UV8G 4JB8B 2CXEA 1FDBA 4QZHA 1PVPA 2FHJD 2XCAA 4BC7A 3VF0B 4P0QA 4M1KA 3MI7X 3BQ1A 2R7YA 3ZZPA 2OPPB 1XWLA 1P7DA 2P6RA 4TU7A 3LP0B 3KD5E 4DUYJ 4FYVB 4Q8EA 2QI2A 2YVSA 5K8OA 2WF8A 2JWKA 5JVHL 4OIXA 3CB4A 1HWJA 1H74A 2BMBA 5CEHA 4WQ5A 3CGIA 3A8IA 1V4SA 1HWKA 2L9WA 5C25A 3OYMA 1D8LA 1VBZA 2GIFA 3H5YA 2HKEA 3CRXA 4MDBA 3V9ZA 2MA1A 1GOBA 1LAVA 2V68A 2EHGA 3KHHA 4ZOHC 3OTOJ 2WF7A 4WZMA 5L9XA 2VJUA 2ZBQA 4JI7F 4FDFA 3QB0A 3V7LA 3OFHA 1JWWA 2SXLA 5AM5A 4FJKA 3UE5A 2XB2D 2XO6A 3MM7A 3GQCA 2VOOA 1HRHA 3Q7BA 1UCVA 2CIMA 4DTMA 2LU2A 1RWOB 3EL2A 4CFDA 2MGZB 3G6YA 1F60B 4BE2A 1NGDA 3G4SN 5K5MA 3VGTA 4DSFA 3VQ4A 3NDKA 3HKZD 1VOMA 3K5NA 2ZIWB 3LGHA 4E7HA 4AL7A 4R0JA 1ESVA 1JXBA 5KG3A 4XA5A 2XI3A 5KFDA 2BQ3A 2BZFA 3GG1A 4FF1A 3IBCB 4ZLJA 2YKNB 2I6WA 1UOCA 4ZH4A 1S9EA 5L1KA 2EFGA 2W8KA 2HYIB 2MKCA 3QU4A 1OMSA 1LWXA 4CGHA 4F0KA 2X7IA 5KAKA 1N2XA 5KQ8A 3IFEA 5EUHA 2ZQBA 2IJRA 3GFYA 4P72A 2BGWA 1SC1B 2RQ4A 4CH7A 2QL7B 2NXJA 3H20A 3I6PA 2NXUA 5KFBA 4B3TK 2JZBB 2MKYA 3TJAA 2KZMA 5AM1A 3T69A 1FX2A 1U8WA 3O4WA 1TKDA 2XEXA 4KN7A 3CC7N 1KFTA 2W2MP 4AE5A 4BC9A 4OHWA 4ZHRB 4Q5VA 4NLYA 5CJ7A 2ZGYA 4NX9A 3EXCX 4XDCA 3HVTB 5CD4A 1FDAA 1MWZA 4PG8A 1FK9A 4C2MA 2XHWA 1YITS 3PHEA 4ECTA 3I0RB 5F8HA 1Q4RA 3D1OA 4DSEA 1RTDB 4CJ3A 2PSZA 3VQSA 1C6VA 1HWUA 1L7PA 2ZIXA 3SQ1A 3NOGA 2R7XA 1GLLO 2DFEA 2G08A 1RGVA 3GWCA 1R0CB 1S9GA 3NS1A 4N47A 4DXLA 1BUPA 1VQ4S 2ZTEA 3MDCA 5AZJA 2ASPA 3I5BA 1IJJA 1GLJO 5J2JA 5HOOA 3V1OA 1RWKB 5KPZA 5IT9U 5M1QA 1XNRK 3SQ2A 1NJYA 1YWXA 4E1NA 2FSJA 1SUQA 3ZSXA 4DR1F 2BDPA 1SJ4P 2BRLA 3CCWA 1MA7A 4DR3K 3Q8LA 3PYGA 1H2TZ 4LVOP 3QFHA 5C5JA 2OEHA 2MLYA 3E9OA 3HBTA 3KJVA 3EGZA 3RMAA 4LRFA 1DZ5A 4FJ7A 1BISA 3NRWA 4LR8A 2FVSA 4B1ZA 1LK7A 5BN8A 2CGKA 1N48A 3O4QA 1NDCA 2F1FA 1RWXB 1YVUA 1FA0A 3J7ZT 5FRNA 4BQZA 1ZM4A 3NMUA 1JCFA 2P5OA 1ZQHA 3MDQA 4LUBA 3KNGA 1XNQF 4LF6J 4OZNA 1C7YA 3U7JA 2GV9A 2P9UA 5ALZA 1RHUB 2WB4A 4C23A 2O8CA 1TKTB 4M5HA 2D3O1 1GFWB 3MUVP 2QYCA 4DTOA 2VQFK 1SJ3P 3DRXA 4H5WA 4P2FA 4Z37A 4J9PA 2KU7A 4MFCA 2VG6A 3QEIA 2NCKL 4BRFA 4CHYA 1S22A 4HHTA 3BBCA 1SWWA 3DM2B 1IJFB 4DPOA