1U49A

Adenine-8oxoguanine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u49A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u49A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u49A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u49A01
3NBPA 4BGDA 3V4IA 4I7FA 1L3UA 4RQ8A 4ECQA 1C0TA 3AVBA 1UAXA 4RQ6A 1A76A 1BHLA 1UT8A 1JKHA 3KD5E 2HNYA 3ZDCA 3HXMA 2A1JB 4R8UA 3ASMA 4CGIA 2QKBA 1ITGA 3B0YA 4ED7A 4Z6FA 4BE0A 4KLTA 3SQ4A 4YCXA 4BXOA 3DLEA 3T5LA 3LDAA 3PR5B 7ICIA 4QZCA 9ICVA 2KN7A 4DL5A 4CK1A 3EYZA 3VQBA 5C42A 4GC6A 4PHDA 4CJPA 4J9OA 1X2IA 1KFSA 4KLMA 4K4HA 4JV1A 2JZBA 2DFHA 3N4MB 4TUPA 5HRRA 3RBEA 4ECTA 4MFAA 4F4YA 1JXLA 3TAFA 7ICJA 3OYCA 3ITHA 4CJFA 4FJHA 2BR0A 3C94A 3SQ0A 3JSMA 2XGQA 1S9EA 5KRSA 3SNNA 2H5XA 4RW4A 2RDJA 2JZBB 3TWHA 1TVAA 1VSJA 3KLEA 2KQ2A 4F3TA 2IA6A 1ZQRA 8ICCA 2FBYA 4JV0A 4FJXA 2XRIA 3Q8PB 4F5NA 2XY8A 3ZSXA 2PFPA 4AHSA 1RYSA 3K58A 1K6YA 4R65A 3UQ2A 1XSLA 1ZQCA 4CJWA 4PGYA 5HBMA 4YN4A 2MUTA 4GW6A 2IHNA 4CEZA 1ASWA 4NLZA 1NK0A 1JLGA 1BVSA 4KRFA 5KFYA 1ZQYA 4CK3A 3BQ0A 4KI6A 3LZJA 3CQ8A 1ZQJA 1ZQOA 4I2CA 1H38A 9ICXA 2B6AA 3D0PA 3OSNA 4KLDA 1RDBA 3PVXA 3RH5A 4ICLA 1SZPA 1VRUA 1CXUA 4O3PA 1LB2B 4KTZA 4YNQA 4P4MA 3B6OA 1IG9A 4DSLA 5IIKA 2BCRA 3NF8A 5J0QA 4BDPA 3PW2A 4NCAA 1JLAA 2Y1JA 2BKEA 4OKKA 5DKWA 1NK9A 3P83D 1VSMA 3PW4A 4FJ7A 4TUQA 4FZYA 3MFHA 1RT5A 2D0CA 4GC7A 7ICNA 4KHSA 4XIUA 1ZQSA 3TARA 4OLBA 3ZSQA 3G6YA 5KFVA 2W42A 4O5CA 2ASLA 9ICNA 1L3VA 4ELUA 2HVIA 2YKMA 2MUTB 1RTHA 4IRDA 3DRPA 2G8VA 2DY4A 3M8RA 5IIMA 3KD1E 1VSIA 1HYSA 2XCPA 4FJJA 4EYIB 3SPZA 4CHYA 1B9DA 4Z6DA 2HW3A 2E4LA 4RQ5A 8ICBA 4M6WA 1NK6A 3RB3A 4O3RA 5HROA 8ICUA 4ZTFA 4P4PA 2P1JA 3SPYA 3DRRA 2PYJA 3AU2A 4HTUA 3QLHA 1TAQA 4Z4FA 7ICOA 4DQSA 4J9LA 5DBAA 2R8KA 3O3FA 1RTDA 4FJ5A 3NTUA 4ECSA 2J6SA 1NK8A 3M8QA 1LWFA 3P1GA 1N56A 5KFPA 1XHZA 4ED6A 1S1VA 1ZQDA 3HSTB 2C2DA 3GIKA 3AA3A 4Z4HA 1J5OA 2V4QA 8ICWA 3SJJA 5L1JA 4JWMA 3TR8A 5KGWA 3HP9A 2G8KA 4XUSA 3ZSRA 4IQVA 3AO3A 5J0WA 5KFHA 4DTUA 4JS5A 2KFNA 1VSFA 4B3OA 4DO9A 3MR2A 4DG1A 5FDLA 2ZUBA 4RQ4A 3V9WA 3ZD8A 3T5HA 1CUKA 1EKEA 2NRVA 4LY7A 3KKSA 4DFJA 3K5MA 3U3YA 7ICRA 5FRMA 1BI4A 1Z00B 4CIGA 5KFJA 3EW9A 1XHXA 3FYHA 1LV5A 1BGXT 3MABA 5KFKA 5KFLA 1C1CA 4PA1A 4ZHRA 4R5PA 3FDSA 3C95A 4O44A 3V1RA 5DB8A 5IINA 4M3ZA 2NRZA 5I42A 4Y1CA 3A2FA 4QZ8A 1TV9A 4BDYA 3V7KA 4X5VA 3AO1A 4HHTA 4YVZA 3DLKA 4FS1A 5HHIA 5J2EA 1GOCA 1X9WA 1S0NA 2ZUDA 3GFKB 1BPXA 3U3GA 3RH4A 2W8LA 5J2CA 3AVAA 3ISBA 2ASJA 3OS1A 4J2AA 3KK3A 3TAQA 2PFNA 4E89A 2X6SA 2ZJ5A 1LAWA 1ZBLA 4MF8A 2XY5A 1VRTA 3T19A 5IILA 2I5JA 3CM5A 1HQEA 2G8WA 1SUQA 3Q8RB 5DQHA 1QS4A 5CWRA 4AH9A 3PMLA 1TKZA 5J2HA 2IOCA 3ISNC 2O4IA 2LYHA 4OKJA 4OJRA 2V9WA 2OWOA 7ICKA 4DL3A 2YNGA 3SZ2A 4JLHA 4KHUA 5KT5A 2XC9A 3K5NA 1S1TA 2RN2A 4FM2A 2VWJA 4FVMA 1KEJA 3V81A 1CZBA 1ZQBA 4EBCA 4N5SA 3QE9Y 4AHVA 4HVJA 2NRTA 5IIOA 7ICTA 2JEGA 3ZT0A 3HT3A 1TK0A 1Z3EB 5KT7A 1BL3A 1SL0A 5F9NA 4UB5A 2I9GA 2OPSA 1LWEA 1EXNA 4M9GA 1LW0A 4QAGA 1ZQMA 3EZ5A 2BANA 9ICGA 4CESA 2BPGA 3GIJA 1S9FA 3VQ5A 3PW0A 4R63A 3OYBA 4TURA 1XWLA 4QZFA 1ZBHA 1U49A 3V9UA 3C23A 3IHQB 5DDMA 1BI4B 2BQ3A 3G10A 4Z4CA 3TABA 4M3XA 4JS4A 8ICMA 3NH2A 3GIIA 3RAQA 3EPGA 4KHNA 3OYDA 4RW9A 2XO7A 5L1KA 4E1MA 1NK7A 1RTJA 5KFBA 2ZUCA 4RQ3A 3GV5B 4E7JA 3LWMA 7ICHA 4I9QA 2YNFA 1MQ3A 2P6UA 4HCBA 3JPOA 1TK8A 2DPIA 1A5WA 4NCGA 3UPQA 4KTQA 4ED2A 1SKRA 4YXMA 1WNSA 4I28A 3DMJA 3RJHA 2UVVA 2QK9A 2W9MA 1KDHA 4DL6A 3NE6A 2FPLA 4F5PA 3KHLA 3LAMA 4RW7A 4O0IA 4C8OA 3VQ4A 3ORYA 5DGBA 4PPXA 5HRSA 2FBVA 9ICUA 2IBKA 4FK0A 1JXEA 9ICAA 2JLEA 4RQ0A 4NM2A 1HUZA 3AVLA 1BPBA 3LP0A 3SI8A 1ZQKA 1RBSA 4YFKA 3O4QA 4Z4EA 1VSEA 4MFBA 1PZNA 2P66A 3MR6A 2HNDA 3CM6A 3NGDA 3OJUA 4BWJA 1SV5A 5KFWA 1S6PA 2HHTA 3BQTA 5I3UA 4ZTJA 1S0VA 4YR2A 4DSJA 3Q8MA 5KG1A 3QIOA 4BACA 1YVUA 3LP2A 1WSJA 3AVNA 4M42A 2PY5A 4Q8FA 4GVMA 4M6WB 1Q9XA 8ICJA 3SUNA 4CJ3A 4TQSA 3Q8LA 1T8EA 3NGIA 3JPTA 4RPZA 4I29A 2BGWA 2LSNA 4R66A 4NYFA 3VQ8A 2DPJA 1ZQQA 4O5BA 4B8AB 2NRWA 5DB9A 3S3OA 5CB1A 4DOAA 3QEAZ 3KKRA 4I2GA 4DFMA 4DFKA 4UB1A 1C1AA 1S97A 5L1IA 3C5GA 5KFCA 1JXBA 5J2AA 3EWAA 3V9SA 1TK5A 1T3NA 1F21A 5EWEA 3KLFA 2HHSA 4FM0A 2HVHA 3V1QA 4Z4GA 5IIJA 3S3MA 1C0UA 1EETA 5HNKA 1RT7A 4F8RA 4KLHA 7ICUA 4W5OA 4RPYA 3OYIA 1WLJA 3ZSVA 4MFFA 3CYMA 3CFPA 5J0YA 3OHAA 5J0UA 1YTAA 1T05A 4ELTA 2YNIA 2HHWA 4YMOA 4NLNA 4FO6A 3MR3A 1VSLA 1S1UA 5J1EA 1HQUA 4B9SA 3IAYA 2HMIA 7ICEA 3F73A 4UBBA 3AUOA 3DLRA 1IXRA 1RPLA 1ZQPA 2IGIA 4O0JA 4TUSA 3RMAA 4E7KA 2PI4A 1J54A 1HPZA 2HHVA 2IC3A 3ZCMA 2W9CA 3AA4A 4Q43A 3PW7A 2PFOA 4FLWA 4EBEA 3V9ZA 1KSPA 4DSIA 3PUFA 3RB4A 1MC8A 1IKYA 3QEBZ 2M9NA 4LSLA 2WTFA 3HM9A 1XU4A 3HJFA 3C5FA 1IM4A 2C22A 4G1QA 1CLQA 4I2IA 4PUOA 3AVMA 4BDZA 5KFAA 9ICCA 4JWNA 2PZSA 1U45A 5BPCA 3MEEA 3DOLA 2EX3A 1FXXA 1ZQFA 3RBDA 3QEIA 4CF9A 4QWAA 3GQCA 9ICTA 3JPNA 3HO1A 3ZT2A 4MEYA 9ICHA 5D4BA 4J2DA 4E7HA 8ICRA 4ED0A 3OS0A 5JUMA 2JGUA 4CGDA 4CF2A 1RT3A 1UA1A 3BJYA 3PY8A 5KT2A 3KLIA 4KHWA 5DMRA 3NF6A 4BXOB 4O55A 4CIEA 4QZDA 4Y1DA 4FK4A 2XY7A 2G8HA 4CEAA 2Z1JA 2UVUA 8ICOA 4J9SA 2FLLA 4KLIA 4B9MA 5CP2A 2Q3SA 4EBDA 4B9LA 4EZ6A 3VQDA 4UBCA 1K1SA 5KTQA 4CF1A 3BQ1A 3C6TA 3V9XA 4IR9A 2BPCA 4AILC 4DLEA 2X6NA 8ICZA 1X1PA 1RBRA 2V4RA 3LP3A 4QCLA 9ICMA 4DQIA 2WONA 2RKIA 2VWKA 4OGCA 1HJRA 4CK2A 1LW2A 2GV9A 5KFFA 1ZQNA 2BDPA 4E19A 4DTJA 2OZMA 4FJLA 4XQ8A 1RDCA 4KLQA 3KHGA 3OYGA 4DF4A 4J9QA 1NKEA 1WSIA 5HMMA 3ZSZA 1NOYA 1BQMA 4CEDA 2RDIA 5DGAA 3OYJA 4HUGA 3IG1A 5HRPA 4FJGA 4LZGA 1QSSA 3AO2A 4H4OA 4CF8A 1S0MA 4H4MA 1QE1A 4CF0A 2ZD1A 2C2EA 3DLGA 4F50A 5J0TA 3I8DA 4I2DA 3V6KA 2ZJAA 3V72A 3QZ7A 3RRHA 5BOLA 3DYAA 4HYKA 5KFXA 3QNOA 4JUZA 3IM1A 3MEGA 1TKXA 4FZZA 4F91B 3M9OB 4HCCA 4Q44A 4NM1A 3HL8A 3PO4A 1RBTA 3AO5A 2BQRA 1Y97A 4CEQA 4NYNA 2FMSA 2D5RA 5KRTA 2VG7A 4EP5A 3JPRA 3PW5A 4J9RA 1RYRA 8ICXA 2IHMA 3EY1A 1WAJA 4ECUA 9ICWA 1IKWA 4YP3A 2OPQA 4C8NA 4KFBA 2QKKA 4QZ9A 5KFIA 3AVHA 8ICLA 3VQCA 3S9HA 1N6QA 1TGOA 3V6HA 5CY4A 3DRSA 4UAYA 4Q8EA 4Z6EA 1BCOA 4O4GA 1JMSA 9ICOA 4J9KA 4DTMA 3NCIA 4MFCA 3LP1A 4PWDA 3LWLA 3V7LA 3RJGA 4Q45A 3HK2A 3OHBA 3MFIA 3LANA 1ZQZA 2A1RA 2KW4A 3P5JA 5KFSA 5J2IA 1WSEA 8ICEA 4CJ4A 5KFGA 3MXMA 4DL7A 2OPRA 4NCBA 3M8SA 3V6JA 3C6UA 3BDPA 4FLZA 4DS5A 4J9NA 1MQ2A 3H8WA 3OYNA 1U4BA 2BCSA 2IDOA 4KKOA 4FLTA 1NKCA 4H8KA 4GLXA 1D8LA 4I2PA 1A5XA 3QEWA 4IDKA 4FLYA 4TQRA 3M9MB 3NGYA 3QETA 3AU6A 4HUFA 4DU1A 3MR5A 9ICPA 2ISOA 3PMNA 4M9HA 3AVIA 2OZSA 1KCFA 3MAQA 3FFIA 1KLNA 4DTPA 2ZTEA 3JPPA 3PX6A 4CEFA 3T3FA 1XO1A 2IS3A 3BQ2A 1QQCA 3E01A 5T7BA 3GILA 3RJFA 1DTTA 4E7LA 3GV8B 2ATQA 1D9DA 3K4GA 3SCXA 3TFSA 3OYLA 3O4NA 3HWTA 4CJ5A 4RQ7A 4DSKA 4C8LA 4CJEA 4IQTA 4CJVA 3C1ZA 5IIIA 4PGQA 4KTWA 1QTMA 1TV6A 2PI5A 4QZEA 5J2MA 8ICTA 2AJQA 4RNMA 4B9VA 3SQ1A 1DOQA 1JL2A 5J2DA 5HHHA 3LAKA 3RR8A 4KB1A 4CJUA 1JL1A 3NGZA 4HUEA 3ZDEA 3HVTA 3TAPA 4KAZA 4F4ZA 3NF7A 3KK2A 1X9SA 3F9KA 1I3AA 3U6FA 4MEXA 3VQ7A 3H40A 3K57A 4DLGA 1DGSA 3O3GA 5KG5A 3SYZA 3WNHA 4E7IA 3L2QA 4C8MA 3QEPA 4DOCA 1FKOA 3AA2A 3M8PA 4M41A 3QESA 4FXDA 4BE2A 4QOZB 4YD2A 5KFTA 3RJEA 5C24A 2AGPA 3ISDA 4J9PA 3V1OA 4CHZA 1QLNA 1GOBA 2PYLA 1WCNA 5FRNA 3Q8KA 4KLUA 1RBUA 3MGIA 4I2JA 3ISCA 4QZHA 1TKDA 2W9BB 4FW1A 4YXJA 3H08A 2BCVA 3VA0A 2FPMA 3TI0A 1VSDA 1C7YA 4KHYA 2C28A 1B43A 4JV2A 4DTNA 4RG8A 3VN5A 3ZSOA 4UQGA 4CFCA 1RT4A 9ICKA 1SKSA 3OS2A 2P6RA 4DFPA 4FLUA 4KN7A 1ZQXA 4E1NA 1XS9D 3AVGA 3VQPA 3MBYA 3AVFA 4RZRA 1HYVA 1IKVA 2BQUA 5CZ2A 1NJXA 3C2MA 1ZJMA 3RJIA 8ICYA 3HPOA 1FKPA 1S10A 1ZBFA 1Q9YA 4EYHB 3BGRA 1ZBIA 4LVSA 4I2QA 2F8TA 2HB5A 4KHQA 2HNZA 5JS1A 3RAXA 2R8GA 4I2AA 1BCMA 4KLJA 9ICSA 2VA3A 3QO9A 2ZJ8A 7ICGA 1KFDA 4CJQA 2I1QA 2J6TA 4KMUA 2BE2A 5KG2A 3OVNA 4CCHA 4KLGA 2GUIA 4O3OA 2OA8A 4J2EA 4RNNA 4ID5A 4TSXA 5KI6A 3AVJA 4C8KA 1O1WA 1W9HA 2OYQA 4O3NA 3AA5X 4GMJB 3CFOA 3B0XA 4K8ZA 5J2FA 1Q8IA 4O5KA 2B4JA 3TQ1A 4IFYA 4B08A 1ZQUA 5BOMA 4B8CA 3RTVA 5J0OA 2YNHA 4KLSA 3KLGA 4FJKA 4CGFA 2RPIA 3ZSYA 2G8UA 4PQUA 4FJIA 3SUOA 5CR0A 2KZZA 1NOZA 7ICFA 1WSFA 2D0AA 4CGJA 3ALYA 3QZ8A 4F4KA 5DG9A 5EWGA 1NJYA 1KVCA 9ICJA 4FS2A 2G8IA 3T5JA 4IQUA 5DLGA 2UVWA 3RB0A 2RF2A 5J2KA 4IG3A 5J0RA 4DU4A 1I39A 4RW6A 5DLFA 4ED1A 1TFRA 1N48A 8ICHA 3K5OA 2P51A 1RT6A 3JPSA 1RNHA 3H4BA 5KG7A 1S0OA 5J0SA 1XSNA 5CYMA 4J2BA 1ASVA 3C2KA 4IRCA 3S3NA 4G3IA 3KIOA 5DB6A 5DB7A 5DG8A 2JEIA 2KTQA 3AVKA 5KFUA 5DQIA 3OYAA 1ZYQA 1Y88A 3O3HA 4PH5A 1JX4A 2FPKA 4F2SA 4KLFA 4M2YA 1KTQA 4KITB 2OPPA 4DTXA 3OSPA 2BCQA 4QWEA 4YQWA 1ZQTA 4Z4IA 4Z6CA 7ICSA 4W5RA 4FW2A 3QINA 4KI4A 7ICPA 8ICIA 2ASDA 5SZTA 4UAZA 4CJLA 1S6QA 3NF9A 3VQAA 4JRQA 3SI6A 3THVA 5KFMA 3LZIA 4QZBA 4FZXC 3ULDA 3OYMA 4CE9A 2VA8A 5HP1A 1BISA 2ALZA 4FJ8A 3DM2A 4E0DA 1L5UA 3L3UA 3ZDBA 1BIUA 3G6VA 4GXJA 4KN4A 3MXJA 2AU0A 4LH5A 3QNNA 3JPQA 1RTIA 8ICNA 3OY9A 4B9UA 3I0SA 5CHGA 1SL1A 4M9JA 1B22A 5DG7A 3SUQA 3LPUA 3L2WA 4B9TA 4KO0A 4RT2A 1UOCA 4ELVA 1EP4A 1ZBUA 7ICQA 1J9AA 3H8SA 4CJKA 4RT3A 2UVRA 1BPZA 4AHTA 1BIZA 3QEVA 3UQ0A 8ICVA 2AQ0A 1RXWA 5FROA 1FK9A 1KVBA 1WN7A 4O3QA 4KREA 3MXIA 3E2EA 3GDXA 4ECXA 3NFAA 4EEYA 1ZQVA 3PR4A 4ED8A 2F1HA 3V7JA 5F9LA 4K4IA 4L8RB 4MF2A 1JLBA 3L2RA 4I2BA 4B9NA 4FJMA 1RXVA 1D8YA 3ZDAA 2YHBA 4RW8A 2BHNA 4XA5A 3LALA 3AV9A 2JEJA 4W5QA 4PGXA 2Y1IA 3H8JA 1RCHA 2C2RA 5TZVA 3Q8QB 3T5KA 4O5EA 4LSNA 2XHBA 1EXQA 1CZ9A 4P2HA 1COOA 2Z1HA 5HRNA 4ID1A 1AROP 2VG5A 3DLHA 2R8JA 2ISPA 1NOMA 1NK5A 1MSWD 8ICAA 1TL3A 4Z0UA 9ICEA 4YR3A 4QZAA 1DLOA 3VA3A 1REVA 1ZJNA 5KFZA 1RDDA 1ZQLA 5CA7A 4CHNA 4OLAA 5L9XA 9ICRA 2BGGA 4DQQA 4E3SA 1ZQEA 2ZTDA 1L3SA 5EU7A 3SV4A 8ICKA 4ECWA 4DS4A 5HMLA 4YMMA 1D9FA 8ICPA 4DL4A 4M9LA 2W8KA 5EOZA 4F5OA 3SV3A 4CIFA 4RUAA 4PHEA 2ITGA 4LD0A 1UT5A 1MU2A 4CHPA 3NDKA 2DTUA 5KFNA 4N47A 4FK2A 5KG3A 1B92A 4OVLA 1ZETA 7ICMA 4NY8A 5J29A 4YR0A 4CFDA 3RMBA 3KLHA 4FBUA 3MGHA 4CJSA 2W9BA 9ICFA 2FLNA 4NLKA 8ICGA 2WOMA 2FMQA 4ED3A 4I27A 3OGUA 3HX0A 3RWUA 1VSKA 3PNCA 4UB2A 3QEXA 4RPXA 3ETLA 2B5JA 1L3TA 2Z1GA 3OYKA 3UXPA 1VK0A 4F4XA 4F5QA 4IKFA 4FYDA 4CHOA 1C1BA 2KZMA 2YV0X 1HYZA 4RQ2A 4KB0A 2R7YA 1BPYA 4R8UB 1S1XA 5KG4A 1X9MA 3I0RA 4M3WA 2BCUA 1A5VA 1WSHA 2ETJA 2FBTA 1JLEA 4DOBA 1HRHA 5CYQA 1WAFA 5JS2A 2F8SA 4I2FA 1QSLA 2YKNA 1IKXA 5KG0A 1UWBA 5D3GA 5J0XA 4EP4A 3C21A 3ZT4A 1KLMA 1Z26A 1HNIA 3VQEA 4M3UA 7ICVA 2KFZA 2KZ3A 3HVRA 5KFRA 1DTQA 4CJTA 4LZDA 4GXKA 5J2NA 1S5JA 3EPIA 5KFQA 5D46A 3PX0A 1CXQA 4YMNA 2F1JA 4MQ3A 1EX4A 1ZQAA 4FLXA 4DU3A 5K14A 3ZDDA 2DFFA 5KGXA 9ICLA 3G6XA 4FCYA 1T4GA 4CFAA 4M3TA 3SQ2A 2NUBA 4IBNA 1Z25A 1S76D 5DBCA 1XI1A 3L8BA 4FBTA 4I9LA 2AQ4A 4NXZA 1S9GA 4F3OA 3AO4A 4F92B 3K59A 4DSEA 4CJRA 4PY5A 5C25A 2W9CB 2X74A 1SL2A 1WCLA 4M9NA 2Q0ZX 4KPYA 3VQ6A 2F96A 5KT6A 2R8HA 4IRKA 1A77A 3ZD9A 4IR1A 3MEDA 2XY6A 2ZQBA 8ICQA 1U47A 4I2EA 1ZQWA 5SWMA 4JK1A 4QWDA 5CZ1A 2HHQA 3NAEA 4OKEA 3UXNA 9ICIA 2W9AA 4RNOA 1XC9A 1J53A 1B9FA 3M9NB 1RBVA 5J2JA 3TAGA 2X78A 1BPEA 3TFRA 3NHGA 4F4WA 1HUOA 9ICQA 3SUPA 4QW9A 3TANA 4O3SA 1NK4A 5DQGA 5DDYA 2HHUA 2F1IA 2ZE2A 1HNVA 4QW8A 4DF8A 1RT2A 3L3VA 4UAWA 1JLQA 3RJJA 4QZIA 3MDCA 4M3YA 3OYHA 3V6DA 3KJVA 4ECVA 3MDAA 3K2PA 3LDSA 3T1AA 5J2QA 4CFBA 3KK1A 4ZH4A 5J0PA 4DQPA 1TAUA 3ZT1A 1Z00A 3H4DA 4P4OA 2ZTCA 1BPDA 2IAJA 4BWMA 5KT3A 4F93B 4K8XA 4CEEA 2DFLA 1KRPA 4CERA 2R8IA 4M04A 2FLPA 4BE1A 3ZSWA 4YG2A 4OGEA 4DTSA 1U48A 1NJWA 1NJZA 3WNFA 5HLFA 3IS9A 3UXOA 5DBBA 1RDAA 3L2UA 3L2VA 1C6VA 4UB3A 4DTOA 2VG6A 3KTQA 4AHUA 2AGOA 2B21A 4CGGA 1R0AA 4YFUA 1IH7A 4M0AA 3QERA 2MAXA 4OPKA 4CECA 1JLCA 8ICSA 4ECRA 4I2HA 4FLVA 2GWSA 1RILA 3OYFA 2FC0A 4NLGA 2P5OA 3HPGA 3KHRA 4N41A 1K1QA 4ECZA 3C2LA 4OPJA 5HP4A 4RU9A 3DI6A 3KHHA 4DTRA 3RJKA 4FJ9A 2J6UA 5KFOA 4M3RA 4EZ9A 4Q5VA 1JN3A 2NRXA 3CG7A 4PHAA 1D5AA 2D0BA 3OJSA 1IO2A 3B6PA 2A1JA 4YD1A 1HJPA 1YTUA 5KFDA 2E6MA 2HHXA 3QIPA 1C0MA 2EHGA 4XRHA 1ZQHA 4PHPA 1GOAA 4W5TA 4UB4A 5EWFA 4DMNA 4AHRA 2IMWP 4JRPA 3K5LA 4ECYA 2A1SA 2E6LA 1W0HA 1U04A 2G8FA 4KV8A 2BPFA 5KFEA 2PXIA 3C1YA 4DL2A 3D45A 2DFEA 2AGQA 7ICLA 3TAMA 2GBZA 5D49A 1RT1A 3GV7B 2VA2A 4J9MA 4KLEA 4IFVA 1T03A 3DLBA 4GXIA 3PX4A 5C5JA 4O9MA 3HYFA 1YT3A 4QZGA 2FMPA 3LK9A 2O4GA 3N97B 1TKTA 4CEOA 3VQ9A 1CEZA 4Q0BA 3RMCA 1G15A 4DQRA 3NH1A 3WNEA 3IRXA 1BQNA 2YHAA 4F2RA 4AHCA 9ICBA 4W5NA 3PO5A 1KFTA 4F5RA 1RZTA 4WE1A 4QWBA 1T7PA 3LPTA 4CHQA 1JIHA 2ATLA 2VANA 1U9LA 4LH4A 4DWIA 3JYTA 1TVRA 1KVAA 3Q8SB 3K75D 3G0ZA 1ZQGA 4IG0A 1JLFA 4FJNA 5KT4A 2XCAA 4K4GA 3RMDA 5J2GA 4M45A 4RUCA 4M47A 3HW8A 4RQ1A 5L1LA 1S1WA 1SKWA 4KLOA 5E41A 2Z1IA 1QSYA 3RB6A 1VSHA 1QHTA 3HP6A 1V9PA 3RRGA 4CEBA 5J2BA 2QXFA 5J2PA 4N56A 3PV8A 1N5YA 2FBXA 3RR7A 1LWCA 3MECA 3ZT3A 4DSFA 4IQWA 5KG6A 4FM1A 2PFQA 1WSGA 3VQQA 3OYEA 1TL1A 3NH0A 2P5GA 4N76A 3H7IA 3UIQA 5CJ7A 3HPHA 5DK5A 1HMVA 1XSPA 1UA0A 1S77D 4QWCA 3GIMA 3RH6A 4CGHA 4DEZA 1ASUA 2XGPA 3AVCA 1ZQIA 3DOKA 4R64A 1LAVA 4KLLA 3WNGA 3TAEA 2JEFA 8ICFA 3CFRA 1NKBA
chains in the Genus database with same CATH superfamily
2LECA 2GX9A 4I7FA 1L3UA 3VOVA 2YVSA 3C16B 3CCWA 2P2CB 3ZTSA 2GA7A 1FF2A 3CRXA 1GXTA 4RW7B 3TRGA 1UT8A 2CNLB 2NXJA 4Y0WA 3GJQB 1WWUA 3K8VA 3HXMA 2VUGA 3V5RA 2LXIA 4CGIA 1ITGA 4BE0A 4KLTA 3DLGB 5AQMA 3KBBA 2HGLA 4BXOA 3BREA 2EKYA 3T5LA 3OR1B 3PR5B 1KQSM 1X4DA 4QZCA 1S9EB 2KN7A 2MY7A 4A8SA 3CMES 2BW7A 2WF6A 5J2PB 3V6DB 1ZM3A 2XMKA 1UPHA 4PHDA 4CJPA 1KFSA 2H48B 4EX7A 3AQOA 3RBEA 1YZ7A 2R4FA 4MFAA 3F5TA 4EHTA 2PE8A 4RCHA 2ESEA 1NSAA 1RK8A 2RE2A 4ZJOA 2A1AA 3C94A 4P72A 2YTCA 2KXFA 1UJ6A 3G82B 1N4LA 3LH2S 1X40A 3H8MA 3K17A 2FHKA 3SNNA 4G1IA 3VAGA 2H5XA 3SMPA 4RQMA 1JRPA 2JZBB 2B43A 3KLEA 3QU7A 2MKIA 2IA6A 3FCVA 2CH5A 2CQ4A 4JV0A 3TUZC 5AE2A 1L7MA 3Q8PB 5BXIA 2BDUA 4K4WA 4QU7A 1Y0HA 1K6YA 4R65A 1XSLA 4CJWA 1B0VA 2HHPA 3TADA 4YN4A 3ID6A 2EK1A 4CEZA 4K25A 2J9CA 4KRFA 2Z57B 4WWSA 3F53A 3LZJA 3CQ8A 4WF9Q 1ZQJA 1VYAA 3CCVN 4CLSA 2IOFA 1YHQN 2GVDB 3D0PA 3ZEUB 2IOHA 4ICLA 1VRUA 2XWYA 4O3PA 4J91A 3B6OA 4ILJA 5IIKA 4QZVB 3M2RA 3PW2A 1HWIA 4NCAA 1QQMA 2YH1A 3D0HE 2BKEA 2JV3A 2XYPB 4NXNJ 5TISU 3J7AP 1NK9A 1NGDA 1W2BR 3P83D 2DNYA 4FJ7A 2GFFA 3MFHA 1RT5A 3E9PA 1X7VA 2K8CB 2QV6A 2XZWA 5TKWA 3MGJA 7ICNA 4A5BA 2EZYA 2DCUB 2D9OA 3TO8A 4KHSA 4DX7A 1ZQSA 3TARA 1IN0A 5J8YA 5KFVA 2W42A 3C28A 3CC4N 3R8YA 9ICNA 2CJBA 2DEIA 1SCJB 5D0GA 2GGPB 2YKMA 5DDPC 8RUCA 2DR9A 3PRBA 3KD1E 1HYSA 4KO0B 1FX4A 2GVZB 3VF0B 3CCQS 5LMNJ 1KQGB 3EEQA 4CHYA 4YOEA 2XSFA 4OX6A 4B3OB 4ES2A 4RQ5A 4QJVA 4J9UE 5B0BA 4CJ7A 3RB3A 3UKUB 8ICUA 1RAFB 3HHNB 3F2CA 2E1AA 2XSJB 2OH2A 2OEMA 4YMEA 5A2QY 4DQ8A 5DBAA 2R8KA 1ZBTA 1RTDA 4FJ5A 4OJ1A 3O5TB 2IM3A 1LWFA 3P1GA 1N56A 1S6QB 3CJKB 1S1VA 1XUPO 5ETPA 1J5OA 3QUCA 1U1KA 4Z4HA 1IG6A 2P6TA 2CQ3A 3HMJG 4JI3K 3ILLA 5L1JA 1QCKA 3ZZZA 5AI6A 1HR0F 4PKGA 5E26A 1VQ9S 1RT6B 3PZPA 4JAXA 1Q8BA 4XUSA 2RKIB 4BC2A 1YJTA 4IQVA 1UW4A 5J0WA 1DARA 5CZVA 4K0KJ 4DTUA 4USVA 4JS5A 2KFNA 1L7OA 1VSFA 1YTYA 2UU9K 4B3OA 4DO9A 3MR2A 5FDLA 3ZD8A 1CUKA 4M5DB 3OR2B 4UF4A 4LF5J 2QWPA 3LPYA 3B9JA 4RX6A 2XTJP 3C7NB 3U3YA 3Q24A 4JI0J 5JXSA 3H20A 5FJ4A 1Z00B 4CIGA 3EW9A 2E9ZA 2J0WA 3TPQA 3FYHA 3H0RB 1WF1A 3WEEB 3VQTA 1C1CA 4NYOA 4R5PA 1WNEA 2E2PA 4K7QA 2G1DA 4WK3A 4LF7F 4O44A 3V1RA 3CO9A 5IINA 5LJ3Y 3LUYA 3CJ2A 5AQWA 3IO1A 4QZ8A 1EZZB 2E5LJ 2RU3A 1H7XA 4HHTA 4YVZA 3DLKA 4G9ZA 5IT4A 5HHIA 1UCVA 3U3GA 3PSFA 1HBNB 2P9KB 3RH4A 1RBAA 3OS1A 4J2AA 3KK3A 2PFNA 3OVAA 1N6QB 3HF5A 2XO6A 3G4SN 4PWWA 2ZJ5A 2XY5A 3T19A 4ATNA 4BVPA 4NV0A 1SUQA 1M90T 1QQNA 2M8HA 2BA9A 1TKZA 5J2HA 2O4IA 2LYHA 2CVEA 2V9WA 5FPMA 1TUWA 7ICKA 2ZF5O 3SZ2A 4JLHA 5CHIA 3M6GA 3ADAC 2W03A 1RHUB 3C0BA 1LKYB 2F1FA 1KEJA 3QFWA 3AB4B 4LVOP 1KAYA 3D2NA 2X51A 2BZ2A 2UUCJ 3PYEA 4EBCA 4LF2A 4FP9A 2RB7A 3DRRB 5FLXU 3ZT0A 3HT3A 1TK0A 5AKIA 4JD2A 2HMXA 3WK9A 4JI6F 2OPSA 4ZVTB 4M9GA 2EI5A 1LW0A 3S6EA 5K14B 1ZQMA 3NOCA 3QT8A 2I1RA 1RE1B 5AQXA 5LMNF 2BANA 3PNIA 2A42A 4NXMF 4CW7B 1QJHA 2YQ3A 1CULA 2WHOA 3POTA 1Y5LB 4F0HA 4KHPF 1VRTB 2ZH5A 4Q0BB 4DUYF 4DR4F 1JJ4A 4JKAA 1HARA 3LVWA 3OYBA 1PSDA 3O8WA 1ZBHA 3AXMA 4FDFA 2EH9A 2CPJA 3A5NC 2BQ3A 3TABA 4EO6A 4JS4A 4OHYA 5AXMA 2GX8A 3JQJA 4K4XA 1IJFB 5CR4A 3KUEA 4KHNA 4B1ZA 4RW9A 2FHMA 5KFBA 3QUBA 2YHWA 1R8BA 5HJYA 1QH9A 3GV5B 2IJFA 3P3DA 1SQEA 4I9QA 1JNZB 1YXQA 2L9WA 4ZPBA 2DPIA 1A5WA 2E1FA 2VJUA 2EEYA 2QLFB 3PDNA 3AA8A 4WQ4A 5B0CA 1T11A 5ALDA 3O6WA 3X1LB 3BSNA 1L8LA 1IXKA 3NE6A 1SB6A 1HHQA 3KHLA 3HVTB 3LAMA 2XMTA 2ZC4A 4RW7A 3DGPA 3AAWB 4DR7J 2ZJPL 4K5SA 1QAJA 1HQEB 5DGBA 2MQOA 1YAGA 4DR7K 4FWMA 5HRSA 4FK0A 3DV9A 4NM2A 3AVLA 2I5HA 4X4NA 3CJ1A 2WBRA 3N7RC 2RQ5A 1ZQKA 1CZAN 3JSMB 4JYAF 3T69A 4Z4EA 3FGVA 2FVRA 1U0HB 1FDDA 3H8YA 3LW5C 1J5EF 2P66A 4KHMA 2W2OP 3OV7A 1JI7A 5LT5A 4BS2A 1NZBA 3OJUA 1FRLA 3E51A 1SV5A 5AJ3J 1NGHA 1S6PA 5D0RA 2FSJA 2HHTA 5I3UA 3MMAB 4ZTJA 4YR2A 1HPZB 4P2SA 1RTZA 5KG1A 1YVUA 1M90O 1SH0A 4DR5J 2YQ0A 3DLJA 4M5HA 4ZK7M 2MSNA 3G86A 2U2FA 3SBGA 3RSEB 1GLJO 1UCNA 5F0XA 2O8DA 8ICJA 5F0UA 2YQEA 2R3VA 3B4DA 3AQPA 5HMWA 3J7ZT 1NSKL 4KIAA 4ILRA 4DU8A 5HATA 4NLXA 5GTHU 1YKWA 3VQ8A 2K06A 2KK0A 1VI7A 3J80Y 4EELA 2CJQA 1YSJA 2NRWA 3S3OA 3VEZA 4OJHA 4DOAA 2DVIA 1CVJA 2ZKUA 3ZZPA 3KKRA 2LXFA 3A12A 1C1AA 2YI1A 5J1NA 3FZLA 4OYZA 4MJKA 2HFOA 5J2AA 1VQ9N 3EWAA 2EFGA 3V9SA 2HHSA 3GPAA 2HVHA 1V3SA 1S99A 3GOIA 3ZO7A 2MA1A 2LXUA 1IQZA 5IIJA 1WOSA 3S3MA 5FPEA 1QVGR 3PM9A 1IKYB 2MJUA 2ZWPA 3LPEA 2OTLN 1XBWA 3LDNA 4NI2B 3BSCA 3N0VA 3NNHA 5J0YA 3OHAA 4OX8A 3EVMA 3QQCD 2HGMA 5J0UA 4O4RA 2HBJA 1YTAA 3QBCA 4LRDA 1YJNS 3WC2A 3DDKA 2IM2A 3AGKA 1M1GA 3BY5A 1HQUA 3IAYA 4EAHD 2XMWA 3B78A 1MWMA 1MLAA 1RTHB 1R59O 3VGTA 1ZQPA 4RWWA 4C80A 2OLWA 2HS3A 2WB1F 3ALRA 2KKPA 2HBMA 2KFYA 1Y5NB 2YNGB 3PSPA 1H3DA 2HHVA 3ZETA 3W2VB 4I6MB 3PW7A 2PFOA 3JTNA 4FLWA 4EBEA 4OZLA 4DSIA 3PUFA 3RB4A 1S48A 1IKYA 2RRBA 3A8YA 2M9NA 3EZOA 1XU4A 4P2FA 2C22A 3QICA 1G6BA 3CUNA 4PUOA 1U8WA 2V2QA 2ASOA 4UY8O 1X5SA 4BR9A 3IMXA 1U45A 5HVHA 2YWFA 1ZD5A 1FXXA 3RBDA 4Y6IA 5CD4A 1RHRB 1LK7A 3MOJB 9ICTA 3CDAA 2HGNA 3HO1A 1V5IB 9ICHA 4CNYA 1U2VA 1ULRA 5CYMB 5D4BA 3PG9A 1DTQB 4MH8A 4K41A 2V8PA 2EBEA 2OM6A 1RAGB 3UPFA 4CF2A 4Y2SA 1UA1A 3HBTA 5KT2A 4CZLA 5DMRA 3F9MA 3NF6A 1NNLA 4O55A 2KG5A 4DG1B 2W3SA 4Y1DA 3PFOA 4FK4A 4CEAA 2XMUA 4B9MA 5CP2A 4EZ6A 2YWHA 2E5LF 5AQVA 4LT6A 1K1SA 1S22A 2EDUA 3C6TA 4YORA 5MAOA 2ZJRQ 3V9XA 1WELA 2BPCA 1V85A 4DLEA 2Q79A 3BYRA 3TADC 1FRJA 2K7KA 1Z19A 8ICZA 3IC1A 3F2BA 2FC8A 2GHPA 1ZD4A 3LP3A 2WONA 2KJVA 1HJRA 2RJZA 3VEVA 3ET6B 2HS0A 4E19A 3P38A 1U6BA 4OCZA 4JI8K 4FJLA 4XQ8A 2XHWA 3HHDA 1Z2LA 2W2NP 4KLQA 2UV8G 1N52B 2UUWA 2IVOA 3KHGA 4DF4A 5JICA 4RO0A 4BRQA 1SGGA 1PO6A 3ULHA 1BQMA 2MKHA 4CEDA 2RDIA 2WB4A 2P9IB 3IG1A 3G6ES 4IEEA 4LZGA 2HHHJ 1HEKA 5CHCB 3OD2A 3NMAA 2FIUA 4OZ1A 4CF0A 3DLGA 4CNQA 4I2DA 1YZ6A 4HDHA 2ZJAA 3HZ6A 5M1QA 2RP5A 2M52A 4CZJA 4WP9A 3QNOA 1REVB 4JUZA 3CJ8A 3CJSA 1I94K 1TKXA 4FZZA 2I8EA 3NVYA 2AF6A 2DGTA 1RBTA 3AO5A 2A18A 4ZCIA 2CJXB 4FYYB 4NYNA 2CGJA 3BQ7A 4BC4A 5KRTA 4DU7A 4NLRA 3JPRA 3PW5A 3HJEA 1RYRA 8ICXA 3QGPA 4FWRA 3EY1A 4ECUA 2HSZA 1VRQC 4WFAQ 1V4TA 1RCXB 2AZ3A 2G9OA 2OPQA 2PFUA 5G0RB 2CPZA 2EC2A 4C1NI 2W11A 1F3FA 1UVNA 3H1VX 1JMSA 9ICOA 4J9KA 3HHLA 1ZM9A 3DYAB 3BEXA 4MFCA 4DUZJ 1DK2A 5ETTA 1T94A 1YDLA 3WX8A 3LP1A 4WZQA 4BGAA 4PWDA 3P5TL 4EHUA 1JJHA 3KUGA 3FCHA 1ED1A 4Y2UA 3MUTP 4JKCA 5KFSA 3FQLA 4HH1A 2VJVA 2DY9A 4FPBA 1FD8A 2HOFA 8ICEA 3OT9A 5M2PA 2VZ9A 3Q7BA 2O67A 2KD1A 4FLZA 2GWKA 3B82A 2HBQB 1SV4A 2B9YA 5B0GA 1NMNA 3E8OA 3EKSA 4Y2XA 3DM2B 5BJRA 2V4JB 5ALPA 1D8LA 3O3LA 5F1XA 3FMBA 4IDKA 1VIXA 1K5OA 4TQRA 4ZVGA 2RLTA 1L7NA 2ADBA 2ISOA 3M1FA 3QYPA 3PMNA 4M9HA 1KCFA 3MAQA 4BRPA 2K1RA 3W61A 4DHVA 3VF4A 3BQ2A 1QQCA 2QYCA 5T7BA 4PXDA 3O9TA 1DTTA 2JX2A 1LFWA 5AJ3K 3K4GA 3MDFA 3O4NA 3HWTA 4CJ5A 4LRFA 4USHA 3DLLL 3CWJA 4FWKA 4IQTA 4PGQA 4KTWA 3T6BA 1C4CA 3D2SA 2WB1C 2OI2A 1E6YA 3HDSA 2PFFB 3IKMA 3R9KA 4B9VA 3N7PD 3DMJB 2BJ8A 5ALFA 5HHHA 5J2DA 1F60B 2RU9A 2CPXA 3ILOA 4LF1A 2K8AA 1OJ4A 1JL1A 3NGZA 4KAZA 2JDJA 1S5LU 2X3DA 3KK2A 4B3TK 4MEXA 4DLGA 2L3MA 3ZZOA 1OMSA 1DGSA 5A8WA 3HM8A 4LF4K 5AKXA 4E7IA 2G5IB 4E98A 4C8MA 4DOCA 2B4PA 4JI4F 3AA2A 2QEXS 2V6AA 1FE4A 2DRAA 3HI9A 5KFTA 4NI2A 3ENBA 3BGOP 4R79A 4JK8A 1RYUA 1WG8A 5EHHA 4K4ZA 3OTBA 2GMLA 2F7TA 4KLUA 3CJQA 3EVWA 4X4PA 1X4AA 4K5RA 4DFDA 2KYZA 3H08A 4NX9A 1VR6A 2B9XA 1C7YA 1B43A 5F8IA 3B6BA 4GKJF 4UQGA 4ANDA 3IUCA 1XTZA 2VBZA 9ICKA 1SKSA 2P6RA 4ZVPB 4URQU 5DM7Q 2QARB 5ALTA 1XS9D 4IJAA 1CC8A 3VQPA 3BV8A 3BS9A 3RW6A 5C2DA 2BOAA 3OW2M 2VPWB 1Q5YA 2BQUA 2IJNA 3CMAS 3WQUA 1DRGA 5AQQA 2NUHA 3RJIA 4S0MA 8ICYA 1ZBFA 1S10A 2YKAA 2BM0A 2OO4A 3TVKA 1ZS6A 3R9PA 5CRXA 3KG1A 5JLFA 1QZ5A 2P9EA 2HB5A 1Z4NA 5HR6A 2DNOA 1WHVA 4BR5A 4HT5A 5GVQA 1HUXA 2R8GA 2CNKB 3CIZA 2QWNA 4K8RA 7ICGA 1KFDA 4XDDA 2DGZA 2PMWA 2I1QA 2J6TA 2BE2A 5KG2A 4Y2IA 5B0FA 3UDEA 2QN6B 2OA8A 2R2SA 4RNNA 5KI6A 2EKNA 3D6MB 4BRDA 4K2JA 2QM1A 2UXBJ 3F5AA 3UD3P 1Q8IA 3M6XA 4IH5A 4PR6A 4MIAA 1VQ8S 1X9JA 3PIPQ 4A59A 4B08A 1VS3A 5BOMA 1G3OA 3RTVA 3NWGA 4YHHJ 4B1WB 4KLSA 4FKYA 4ZHRB 2RPIA 2K4IA 4LIRA 2JFDA 2WONB 1WDDA 2VF3A 2MLYA 1NOZA 1WSFA 4BC5A 1GK8A 1QE1B 4F4KA 3O44A 1UVKA 5DG9A 3IDWA 2VFTA 4US8A 3NXZA 3WK5A 2W6LA 1DAXA 4FS2A 3T5JA 1DY3A 1F9FA 2XLJA 4TLRA 1BQMB 4ZVRB 1XMQK 5GAHU 5J2KA 1LEOA 2CGKA 3I56N 4ED1A 3QU2A 3ENQA 3TZZA 1RT3B 3GFHA 4OHZA 2CPDA 3K5OA 2VKQA 3DJCA 1RNHA 2HIYA 5KG7A 1XSNA 1NGEA 4LJMA 4NOHA 1ASVA 3CE8A 4OYOA 4G3IA 2G0JA 2B6GA 2JEIA 3HOSA 5KFUA 5DQIA 3A3PB 3ZX0A 4FF4A 4MT1A 3CJKA 2QGFB 2HEKA 2DUYA 4WK1A 2BCQA 3ONQA 1U0HA 3GB0A 4FW2A 2ASDA 4UAZA 4CJLA 4MIBA 1VQ8N 4O8UA 3BN7A 1S6QA 1KN6A 2F77X 3SI6A 4FZXC 4RU2A 2BUNA 4DCJB 2A10A 2OAUA 2JLFA 2UUBF 2RDDA 2MEWA 3NS7B 1TL7A 2WAQF 4CLFA 4J5OA 3J7A1 3G6VA 4GXJA 6FD1A 4KN4A 3MXJA 4LH5A 2FYXA 1GMUA 2F9WA 1GNKA 2VV5A 1SL1A 3ZI4A 5B0DA 4HHJA 5D4NA 3M6UA 4OIXA 4B9TA 3U8XA 5ITHA 5ETNA 4NXMK 1ZBUA 4A47A 2E7VA 3I6PA 3IR5B 1W26A 1VBZA 2H3EB 3H8SA 4PXEA 1KNZA 4RT3A 1HLUA 1VBYA 3KLFB 1U2CA 3UQ0A 2QB1A 1MA7A 3CD5A 5FROA 1FK9A 2I5JB 3QO9B 4KYZA 3S6JA 4KREA 2ZH3A 3MXIA 1CSJA 2WSEC 4BRHA 3GDXA 4ECXA 3NFAA 2P6SA 3PR4A 4EGLA 1Z05A 4OPHA 2VPXB 4AM6A 5F9LA 3P4IA 5E79U 4B9NA 4FJMA 1E6VB 3ZDAA 2FJBB 4FWOA 1G99A 2BHNA 3AV9A 3VALA 3Q22A 3UR0A 2Y1IA 2C2RA 4O5EA 4B3TJ 3I4HX 1CZ9A 3R7NB 2WHEA 3OUYA 4I56A 3SDEA 4PG6A 2B8PA 2A40A 5AI9A 3KNGA 1OVYA 1NK5A 4P7TA 1MSWD 1TL3A 5HQ8A 4QZAA 1UPPA 1ROFA 2R7VA 4BC3A 8ATCB 4UB6U 3D2FA 2DB1A 4YB7A 4YB5A 9ICRA 3D7EO 2HFNA 1UP1A 4OZ5A 2MKKA 4QIWD 1MWKA 4JKGB 4JBCA 4BR0A 8ICKA 2FD2A 2OD4A 2P8IA 1SUQB 4YMMA 4LRAA 1D9FA 1N34J 1J97A 2PC6A 3SV3A 3LP2B 3HI0A 3G8SA 4PHEA 2V5HG 4LF7J 2QA4S 3WC0A 4OX7A 4JI1K 1UFLA 4FK2A 4WIIA 3CD7A 1Y9OA 3MD1A 1J2VA 4C11A 7ICMA 3RMBA 4JHDA 3KLHA 3UVJA 3CCES 1OO0B 4NLKA 2Q31A 8ICGA 3H2VE 3WUHA 5BRHA 4MFBB 4I27A 3KOOA 2HQFA 3AY0A 1EIYB 4OHWA 5D8HB 3HX0A 1K8KB 1VSKA 3PNCA 2GCFA 4LBPA 3WU2U 3JB9k 2J5AA 1T9TA 4CLPA 4IQXA 1KLMB 4WU3A 1GLDG 4CHOA 2WBNA 4X62J 2DISA 5DZ6A 3R2DJ 2DNPA 4KB0A 5CYQB 2RQMA 1VHXA 4CZEA 4X4TA 4A57A 2YMPA 4DOBA 4JI3F 2YKNA 3KMQA 4UTGA 2PFDA 2VU5A 1UWBA 1Q7LB 3C21A 1SVDA 1OY9A 1Z26A 5E3RA 2KFZA 2A1BA 3EE8A 4LZDA 3DOKB 4FO0A 2U1AA 1RWMB 3FM9A 3EPIA 5D46A 5IWAK 5AKLA 2CJKA 1GLEG 2SXLA 3T1YF 4QIGA 5HK4A 3GYXB 4WFBL 3QRRA 1EX4A 1K47A 3JQKA 3A5MC 4V19S 4FLXA 1GFWB 1ZC6A 5ALLA 4CM0A 2NXNA 3I9ZA 1TUYA 3SQ2A 4M1KA 4DN9A 2BABA 1S76D 5DBCA 2Q2RA 2AQ4A 3LGMA 5L1MA 3A5LC 3AO4A 3K59A 2I2YA 1SH3A 2UUBJ 1BUPA 2M70A 2QXLA 5C25A 2GMJA 3BN4A 3SAFA 2OTLS 1WCLA 4M9NA 2Q0ZX 1F5AA 2MJNA 1T02A 1Y4ZB 4FWSA 4Y34A 3DWLA 2QLWA 3THYB 1A77A 4YN3B 4C9DA 1DURA 3SJHA 2C2MB 1NGJA 2KRRA 2ZDPA 2ZBQA 1HWJA 2KO1A 2KKHA 2VC0A 4JK1A 3IWNC 4CVNE 4USUA 5CZ1A 4C4RA 2HHQA 3NAEA 3MZIA 2H5IB 2YX1A 1PVPA 2R42A 4RNOA 1XC9A 2CN1A 3M9NB 2E5SA 1RBVA 3QSIA 1RTJB 2H9ZA 3TAGA 1S8OA 4F0KA 3GMGA 5DRKA 3NGRA 4H4OB 1NXIA 5GTIU 3QGGA 3D68A 2FZKB 2CZVC 3PRDA 4QW9A 4F9OA 1HKGA 5DQGA 2ERRA 1VGYA 1IG8A 1HNVA 5BPLA 4PPZA 3L3VA 4XAKA 1T03B 4UAWA 1T9WA 2FGCA 2RILA 1N8RO 3T9NA 5H2FU 5A2QU 2A41A 2LFVA 1HWLA 3V6DA 3OTDA 3P6YC 3MGVA 3KJVA 2F3JA 4LVNP 5G4DA 2NO5A 5F3ZA 3MDAA 3T1AA 4TLQA 1NZPA 3EICA 2IVMA 1HBMB 4MKAA 5J2QA 3KK1A 3ENAA 1AZSB 1TAUA 1S4EA 3ZT1A 3JS9A 1Z00A 3M8PB 4QYRA 2XYHB 1BPDA 4FWQA 2JH3A 4XK8C 1PK3A 2OPQB 2YX4A 4FXWA 1WBBA 3RUBL 1GXLA 4BRLA 3BPSP 5AQOA 1N32J 4M04A 4H0OA 3VAIA 1NJWA 1BC6A 5IC4B 1RDAA 4OV6A 1FJ7A 3L2VA 1R8PA 4UB3A 1HNXK 2WAQC 2VG6A 4DR3F 3H2UB 1SB3C 3KK3B 2YB1A 3MAHA 4UOFA 4YFUA 3QRQA 2KU7A 1LFPA 2ZH8A 1JXVA 4CECA 3VZIA 2GWSA 3OYFA 4NLGA 1WEXA 1I1GA 5ALZA 3HPGA 3QT5A 4OPJA 2Z30B 2RF2B 2N4DA 1QVFM 5HLFB 4FJ9A 2BTFA 2XLKA 2O8FA 2WSFC 4ISGA 2D0BA 1SIJA 4U96A 1MN7A 1IO2A 2RS8A 4YD1A 5C42B 3N4QA 1HJPA 4JI1F 4IWVA 4JI2J 5KFDA 1WORA 3BF4A 1VC6A 4LJXA 4UB4A 5EWFA 2ZZTA 2NNWA 4BRIA 2JH1A 2IMOA 2L41A 3L6QA 3D6TB 4EO8A 2E6LA 3CO0P 2G8FA 2CVIA 3FQKA 2OFHX 2PXIA 1Q16B 3D45A 2DNQA 2ZIWA 5AICA 2AGQA 2G08A 3I55N 1RT1A 3G96A 4J9MA 4HLBA 5D0HA 4H5RA 3QMLA 3DLBA 5C5JA 4O9MA 1XNQJ 2HNZB 1YT3A 4QZGA 2B5JB 5E7OB 3CF5Q 2VDIA 1HKCA 1VJWA 1CJTA 3VETA 1HNVB 1YQHA 4ZLPA 2C3YA 2K3KA 2CQ0A 2XSJA 4DQRA 3H42A 3NH1A 2LKZA 2ZH1A 3WNEA 1HPMA 1VDVA 3OPKA 2YHAA 2YJEA 3E9LA 3RBZA 2KHQA 4JI5J 1RBOB 4F5RA 1RZTA 2NS1B 3NCRA 4QWBA 1T7PA 3AOAA 3C15A 1ZPWX 1N62A 2QWLA 3D2WA 4LFCF 2ATLA 1OQ6A 2VANA 1U9LA 3QDKA 1HLWA 3ZTOA 4DV7J 1T0TV 3MEGB 4NLYA 3S7RA 2RRAA 1FESA 1V6HA 5K8MA 4KLOA 4ZPCA 2O8CA 1QHTA 1FTCA 1N5VA 4IH7A 3ILIA 4RBUA 4WU2A 1Q46A 2MSSA 1V9PA 4LF4F 2EQYA 1X60A 3PLAA 2JR5A 5J2BA 3IRXB 1VC5A 4A8EA 1XR5A 3MECA 5F8HA 5C2GA 3I28A 2FF3B 4EFHA 3L09A 4LF8F 3UIQA 2XHCA 1RP5A 2QWMA 2UUBK 1RWPB 3HRGA 5BR8F 1XNSA 4ACOA 2PSZA 4O3MA 1S77D 4JMUA 3RH6A 1PK1A 2P9KA 1JLAB 2F8MA 1ZQIA 1RB0A 1B64A 4AT1B 2BJDA 4CZFA 3TAEA 4KLLA 8ICFA 3U9ZA 1JLBB 1NPKA 2CQPA 4OZNA 4YOXA 3QGIA 5JVHL 1E4GT 3NBPA 4BGDA 4ZCMA 1C1CB 1NPPA 4CP5A 4WFNL 4RQ8A 4KGXB 3KJFB 1M5OC 3NVMA 1BHLA 4PEOA 1JKHA 5AXKA 4CBXA 4EEKA 3U1NA 3ZDCA 1UTAA 5GADP 3HULA 4DX6A 5LJ5Y 1B99A 3ASMA 4CRXA 4Z6FA 3SQ4A 4YCXA 4AF1A 3RSEA 3MEEB 3DLEA 1X66A 2NPFA 1PJ5A 4DL5A 3EYZA 1YBAA 3VQBA 4LFBK 4WFYA 4GC6A 3Q8VA 1ITPA 5IFMA 3I96A 4KLMA 2JZBA 2G2YA 1BA1A 2YWEA 4TUPA 4CH7A 4DV4K 2MY8A 4OYXA 4CTAB 2OYYA 7ICJA 2EC0A 2FF6A 3OXFA 4CJFA 4IDKB 3UDLA 2ZGZA 2DD8S 3CMEN 1PCAA 3ZZYA 2O1PA 1VQKN 3F2DA 2O8BB 1FTRA 1S9EA 5KRSA 3MM8B 3VGSA 5F8JA 3KUHA 3ZZ0A 2GELA 2P9LB 1SJ1A 3C29A 2E1ZA 4A8XA 2KQ2A 1GX5A 2W7AA 4HACB 3KWIA 3FEYB 3VTIA 4DR2K 4B17A 4ZDNA 1U2FA 2B3TB 2QC3A 4LIWA 4KH0B 5AQZA 3JXUA 1F0XA 4MK9A 3TUIC 1T9UA 3FC4A 3EZUA 3UQ2A 1ZQCA 1RADB 3PEHA 5U47A 4AXJA 3MDQA 2ZM6F 2R2UA 2MUTA 4GW6A 2IHNA 5KFYA 3DDIA 1ZQYA 2VQEF 4CK3A 2AJ2A 5FIIA 3BQ0A 1HQUB 3UR3C 3KJNB 5THWA 4Y00A 1ZQOA 3BZCA 1S9GB 5IS2A 1YIJN 5IT0A 2B6AA 2IAJB 4DV6F 1F0MA 2ZJQL 1RDBA 1SZPA 2GUPA 2R2TA 3D2EB 1LB2B 4KTZA 4P4MA 3GG4A 1T3QA 4JI3J 4BDPA 1C0UB 2DRDA 2I7NA 4FF3A 4L3QA 4OKKA 3HTVA 5DKWA 4Z7YA 1SWVA 3W5XA 2VD3A 2OHDA 3ZLJA 1VSMA 2KP7A 4KFBB 4FZYA 5K8OA 3H90A 3F0NA 2D0CA 4XIUA 3CW2C 1VRUB 3JTOA 1RACB 5BR9A 4MKYA 3G6YA 2PGCA 3A8IA 4L76A 4O5CA 4KB7A 1CS4B 3SQGA 4HKQA 3U9DA 3KFWX 1RDRA 2XWXA 3R27A 3NVZA 4C1NK 2DY4A 4DV3J 4B3MF 2F8KA 4RJVA 2G0AA 1U25A 3RZAA 2XCPA 2YKOA 5AI4A 3VESA 4TYBA 2MZSA 2VCPA 4DV1J 2HW3A 3C2PA 2BH1A 4Y2RA 4NA1A 3CPWR 3D6JA 4GKKK 3HFVA 5HROA 4XH5A 3PHEA 4O23A 2E5LK 1S1TB 4ZTFA 5GAHI 3UN2A 2P1JA 3M4XA 2GH1A 4UT4A 3AU2A 3QLHA 2RHQB 2VOOA 3NWRA 3TEGA 4Z4FA 7ICOA 4DQSA 3V4MA 3FVYA 4ECSA 1YRXA 1PBAA 3CHWA 3CCJS 3OTCA 2HG4A 3KLEB 5KFPA 3WKAA 1ZQDA 2CPHA 1UFWA 8ICWA 4B3TF 3ONNA 4P0PA 1A0PA 1SJ4P 2AMCB 5DJBA 3A3NB 1O6XA 5BPMA 4AP9A 4DV5K 2QWOA 1AYEA 3CT9A 3ZSRA 4OHVA 1P27B 5KFHA 3K2YA 4BCAA 2UXCK 3C66A 1RTDB 1FRKA 2KMDA 2H3VA 5A8RA 3IBCB 4K4SA 1HNWK 2NRVA 2FJ6A 1SPBP 1AFJA 2E5GA 3OW2R 5HI7A 3W2WA 3EDRB 5L38A 3G8QA 1HNIB 2ZIXA 1N34F 3Q23A 4PWDB 2NLXA 1LV5A 5IT9U 1IVZA 1BGXT 5KFKA 4ZHRA 4IXCA 3QIPB 2KM8C 3FDSA 3UMCA 3IBWA 3ELHA 1OH5A 1TTHB 4U7CA 2J9DE 4Y1CA 1X4HA 3A2FA 4X5VA 1TFWA 3AO1A 2HFUA 2OSRA 3EE3A 3FBCA 1BQXA 2IRUA 3VCDA 3HHLB 4L3KA 2UUTA 1QM9A 3C6HA 1XMQF 1NBWA 3GFKB 4CYUB 3BM7A 4DX5A 2W8LA 2DGVA 1QTNB 2GW8A 2AA4A 3ISBA 2ASJA 3KWGA 4E89A 4X4UA 2R18A 2ZEJA 3O6QA 4ED4A 2D3O1 1FW6A 4B3SJ 4ZVOB 5IILA 3NGTA 2GJFA 1T44A 3IR7B 3Q8RB 3MWBA 3MN5A 4I64A 2KIWA 5CWRA 4AH9A 3PMLA 3WKEA 4WYLA 3IAM9 4FYWB 4A46A 4OJRA 2Y3YA 2YNGA 5KT5A 3I33A 1Q4RA 2MQNA 2RN2A 2RRNA 1CZBA 2BRLA 2LEBA 4FKXA 4ZVUB 2MPUA 1O13A 4HVJA 2NRTA 1EX8A 5AK5A 1A7GE 7ICTA 2JEGA 5HN0A 2HZVA 1Z3EB 1WOOA 5KT7A 2XS2A 1SXDA 5HROB 2ZBPA 1TMMA 5F9NA 5RUBA 4UB5A 2I9GA 2POKA 2A5XA 2KJ5A 1OQ3A 2WCXA 4QAGA 1URRA 4AL6A 4OI2A 3NAIA 2EWHA 2HWHA 1HYSB 4DUTA 2UXDJ 1KEKA 1NSPA 4PKDB 2BPGA 1ZA1B 3NL0A 3GIJA 1SI9A 5M1PA 4HVZA 2CPIA 5IT9O 4CQ1A 2Z2LA 2E1RA 4ILHA 3TUPA 4Y2CA 4OJOA 1W2IA 1T95A 1NNDA 3L4PA 3RVCA 5E3PA 1WI6A 4DPTA 1YBTA 4GFJA 1U49A 3DLEB 5HL7L 2PEBA 4WF9L 3SCIE 2KHOA 3G10A 1P8GA 2RQCA 4M3XA 3DRSB 4BR2A 4AQYJ 3RAQA 1A0OB 3EPGA 2PT0A 2BRKA 4B3SF 1ILYA 3FZHA 2HRUA 5HO4A 5L1KA 4E1MA 1NK7A 1RTJA 2DGOA 4OYPA 1RA7A 2BJ3A 2HSTA 4O44B 1MQ3A 1M5SA 3JPOA 2JGAA 1YVFA 4KTQA 4ED2A 5AKGA 1XMQJ 1IWAA 1A9NB 5ALGA 2N82B 4I28A 4KPCA 1EAYC 3I55S 4ILGB 3RJHA 3NBPB 2DWQA 1LVHA 1NH7A 1XJWB 2KT5A 2OP5A 2HBYB 1VJ5A 4D3GA 1TV6B 2C1EB 1CJKA 2IPOB 4C8OA 3MAAA 3FBFA 5AI0A 4W4MA 4U67Q 3VQ4A 3C7NA 2B9WA 2JC1A 9ICUA 3IG8A 2IBKA 3THXA 2BE7D 9ICAA 1P9YA 3BGUA 3MM5A 4RQ0A 2VQFK 2QL5B 1NU4A 3FMWA 1OSDA 5FDLB 3ICXA 3UCUP 2VBWA 1NGGA 1VSEA 3MWTA 5I4MA 5HOOA 2WVDA 3DU6A 3NGDA 3PJWA 2RUGA 4NLQA 4PXCA 2KHVA 3BQTA 2K89A 2GVZA 2GO9A 1S0VA 2XI9A 5GADI 3OVBA 4DSJA 1JLEB 3Q8MA 3I31A 1HD1A 2LQ5A 1WSJA 3VAFA 5ETVA 4GVMA 3CCLN 4NXMJ 4KGZB 4TQSA 3H1QA 2Q1NA 3Q8LA 1T8EA 3NGIA 4V1Ak 1RI7A 3JPTA 3GL1A 4RTFD 2BGWA 2CPFA 3BSOA 2B0GA 2Y8YA 4ZVSB 2OSQA 3U27A 2RRDA 2DPJA 1ATNA 2VL1A 2YXLA 4B8AB 4B3RF 4PZOA 3QEAZ 4I2GA 3BSAA 2JVOA 5KFCA 1MWQA 4AXIA 2KLAA 4KH1B 1T3NA 1S1VB 2Z2YB 4MYTA 3VEXA 4FM0A 3LA0A 1BXNA 3HHEA 2VQEJ 1VK3A 4UUXA 1EETA 5HNKA 1RT7A 4YOUA 4W5OA 2XMVA 5HL7Q 3OYIA 2Z8QA 3ZSVA 5M1OA 3T6JA 3CFPA 2DXDA 4UZBA 3KZIU 2HFVA 2YNIA 4LMZA 2HHWA 3FR0A 4YMOA 4WTOB 2OEKA 3U1MA 1Q86O 4KH6A 2WBMA 4I6MA 3B8AX 4HH0A 5H9EJ 2HBZB 3OLBA 2QE5A 4XDCA 1QQ6A 3F73A 3DLRA 3F44A 4CI0B 1RPLA 3M30B 3AM9A 2OTJN 4UW2A 4A8YA 1RDWX 4K43A 4TUSA 4W98A 4E7KA 1R43A 1ZTWA 2CQ1A 1VQ5N 3MWPA 4FZNA 5C7PA 1KSPA 1XN9A 4C6AA 1XNRK 1MC8A 1RBLA 1IBLF 4BBYA 3MPDA 3O0FA 4TY8B 4CZKA 4MTPA 4MMOA 4JI0F 2OEHA 2YWWA 5EY4A 1KL9A 4DV3F 3MN6A 2AT1B 2WF7A 3AVMA 2KB2A 1R6YA 1YLXA 9ICCA 5IOLA 5BPCA 3DOLA 3SENA 2EX3A 2DBYA 3QBWA 2ZH7A 3QEIA 3GQCA 1CJUA 4KSEB 1KBUA 5H9FJ 1VQPS 1HNWJ 8ICRA 3OS0A 1Q18A 2K3IA 4CGDA 3MM9A 3I56S 3QFHA 5GMDA 4NLSA 3BJYA 2ADCA 4DV4F 4ZJQA 4DDFA 4BXOB 3A0IX 3MN9A 4QZDA 1SQKA 5BYSA 2XY7A 2CWKA 2G8HA 1OPZA 8ICOA 1L3KA 3VWSA 1YJ9N 4EBDA 4B9LA 5AQGA 3CNHA 1XEZA 3CP8A 2DKXA 1NWKA 2X6NA 2K7JA 1WHWA 3D1HA 2V50A 3C16A 3KVGA 3K9JA 4QS9A 1J5OB 3I1YA 2V4RA 9ICMA 2BKPA 4DQIA 4JV5K 1Z4OA 4OGCA 4K59A 2VPZB 3G82A 4DTJA 3MMCB 4OJPA 2NSBA 2HVDA 2LQJA 4US9A 4IOBA 3JAMY 3OYGA 4J9QA 5EE1A 1VQ4N 4GIBA 5HMMA 2E1YA 3ZSZA 3BO3A 5DGAA 2DXEA 4WP8A 4TY9A 2P9CA 2CRXA 1HI0P 2VOPA 5GAHP 4DV5F 3Q83A 2ZWOA 5BR8K 2F76X 4DUYK 4DR4K 3VZHA 4F50A 3BP8A 5J0TA 1EWQA 2O66A 2FHJA 1R6VA 4OYWA 4LFAF 1C4AA 2LYVA 3V72A 1WOPA 2QLXA 4WE1B 4JKGA 4NO7A 5BOLA 3MPWA 1LKZA 2MKJA 3DYAA 1P1TA 1M6YA 2XG8A 3TYTA 3D6FB 3CJ5A 3HKZF 2C2KB 4RR5A 5LY3A 4XPCA 4IEIA 4CRJA 3PO4A 5CA5A 2RHSB 2BQRA 1Y97A 1E3MA 2FMSA 2D5RA 1HX1A 3DU5A 5E3CA 2Y0SC 5F3XB 2IHMA 1WAJA 3I5CA 3CCJN 1CLFA 9ICWA 1IKWA 3W0LA 5F8MA 2V68A 3AOBA 4FPIA 1LWXA 1O5JA 3MI7X 1N6QA 3V6HA 1TGOA 3S9HA 4MLEA 1X6IA 2RQ4A 1REGX 4ZKAA 1BCOA 1TL1B 4O4GA 2C3PA 4DTMA 1JCFA 3NCIA 4YOTA 4CF4A 3CCRN 4LF8K 4HEA9 3K1ZA 1L7PA 4C2MA 1KDNA 4X66J 3W63A 1O08A 1X4EA 3DDHA 3V7LA 1WC4A 3UNGC 3MFIA 1TYQB 4EWTA 3AN1A 4L74A 2KW4A 1HKBA 5J2IA 1S1WB 3WKBA 2QL7B 4A2BA 4DL7A 3ZXWA 3M8SA 4CBUA 1XMBA 1Y3KA 3BDPA 1E6YB 4M63C 2E5IA 3QU9A 2FE9A 1N5QA 1N5SA 4UASA 3R3LA 3OYNA 3DC2A 1U4BA 3ZZRA 2BCSA 3X3UA 1YUWA 4Y2QA 3QU5A 4P2XA 4WBFA 3D28A 1DFDA 2X1FA 1RFQA 1A5XA 5AI5A 1EB0A 3QEWA 3N5BA 3M9MB 4FLYA 3GBTA 3QETA 1IBCB 3MMVA 1NJIO 2VQEK 3AVIA 4H5NA 1Q7YO 2OZSA 2NRHA 4DV2K 1KLNA 2ZTEA 2K4HA 4RKUC 4CEFA 3T3FA 1XO1A 1WJ9A 4C3LA 3QAUA 1VQ4S 3CGIA 3MPVA 3GILA 1P7DA 5AQJA 4E7LA 1D9DA 3MD3A 3UKUA 3SCXA 3TFSA 3WHIA 4WQ4C 3B54A 4RQ7A 1TL4A 4F67A 4QPXA 4ANCA 4DSKA 2UXCJ 3MOZA 1NU0A 2FXUA 4CJVA 1QTMA 2HK2A 4HHUA 1TV6A 3MX2A 2K1RB 2PI5A 4QZEA 2B8QA 8ICTA 2AJQA 1DOQA 1RHMB 3SMVA 4CE6A 4RLEA 3W66A 3OXLA 4KB1A 4GO7X 1ZZNA 5HR7A 4HUEA 1Q81T 3HVTA 3TAPA 1RJJA 4OYMA 1HNXF 5GIPA 1X9SA 3U6FA 3VQ7A 3H40A 3K57A 1SBRA 3SYZA 4JYAK 1T9XA 4WFBQ 4ISEA 3QEPA 4AE5A 4FFDA 3M8PA 4M41A 3H5UA 4FXDA 4LSLB 4QOZB 4LQ3A 1U09A 5C24A 2NXUA 3H25A 1WG1A 2YQ1A 1HWUA 4CHZA 2D3OR 2GOLA 3KJVB 3MN7A 4LC9B 1OUQA 2XULA 3Q8KA 2EANA 4F26A 3MGIA 1U2VB 5F8LA 1JB0C 2W9BB 4FW1A 4EMDA 3BO2A 2FPMA 4CLWA 1IBMJ 1N36J 2C28A 3CJRA 1IJEB 4JV2A 2Z56B 5E3QA 3J7YP 3CC2S 3OTOJ 3ZSOA 1U1NA 1KAXA 4CO3A 5KNIA 1TL5A 2UZAA 5L9NA 2IIRA 5AM5A 4GRSA 4E1NA 3R2CJ 1UMJA 3TP2A 1PJ7A 2LM4A 3AJ1A 1KWMA 2LA4A 5K9FA 5J1EB 3C3LA 2N3LA 2LA6A 4RZRA 4DJBA 2QI2A 4I2QB 4HACA 3C2MA 1ZJMA 2P9LA 2OCEA 1FKPA 1Q9YA 3SFUA 1HW8A 4M95A 4LVSA 1ZH5A 1AZSA 3BKUA 3Q86A 5ALXA 5KPRA 3JSRA 4CNZA 2DKZA 4Z37A 3CCTA 3QO9A 2ZJ8A 4C8ZA 1B4FA 2MZQA 2HIQA 4F7VA 3FRZA 2EZZA 2UUCF 3CI5A 4R0EA 2H3QA 4CCHA 1X5TA 3K5PA 1J6ZA 4DMZA 4J2EA 1YX2A 3PJ9A 2QO3A 5E0OA 3AVJA 2WVCA 2X3GA 1BY9A 1Q7YT 4O3NA 2E66A 2FVPA 3CFOA 4K8ZA 2EWSA 5J2FA 1R89A 5AZJA 3DLLQ 1ESVA 4IFYA 1H74A 3SR6A 5J0OA 5AQLA 1UL3A 4CGFA 4EU0A 3AEVA 2ZKTA 3VF6A 4ILMA 4JKFA 4DKWA 3SUOA 7ICFA 2HLUA 5IQ6A 1WB9A 1S5ZA 5EWGA 3AJDA 3NEKA 1IWGA 2KNJA 1RZMA 4P0QA 4BREA 3FEZA 3MCNA 2K4EA 2P5VA 2ZHOA 1YRTA 4RW6A 1FXLA 5A8KA 4O8KA 3OQ2A 8ICHA 2QLTA 4N7TA 2LDIA 2AP6A 1RT6A 2DPNA 2IA0A 4WXWA 3AJ2A 2D3ZA 3KIOA 5DB7A 3OFGA 4FVUA 3AVKA 2GV1A 2H3IA 3M6KA 1JX4A 4F2SA 3T1YJ 3O9SA 3ATVA 2QTDA 1ZQTA 5LM7E 3QINA 4DCHA 7ICPA 5SZTA 2Y0SF 3CCMN 2R7WA 2QFIA 3NF9A 4F71A 2QMUB 2F4VJ 5CH7B 5BREA 2VA8A 5HP1A 2QL9B 4IFEA 3L7PA 3DM2A 5G5GA 2V51B 1ATRA 4AQYK 3NCQA 3KLGB 3L3UA 3ZDBA 2AYBA 3N28A 8ICNA 3OY9A 3OR1A 4ZLJA 3I0SA 2DH9A 3D66A 1HR0K 1OSCA 3H3OB 2FVSA 3SUQA 4C98A 4P71A 3LPUA 1S49A 2W4CA 1D4XA 1SWWA 2DK2A 2AV5A 4OX9K 4KMOB 4QS7A 2ZVSA 2NZTA 1KS2A 1EWRA 5JVGQ 2J8AA 3PXGa 2UYTA 1BPZA 2MKCA 3QEVA 1BQNB 1RLDA 2D0PA 1NLKL 4BY9C 3TAMB 1KVBA 4O3QA 1WN7A 3LP1B 1N60A 1ZQVA 3UMBA 4ED8A 2ITMA 3UNYA 2LQ9A 3V7JA 1N8RT 1JLBA 3L2RA 4AYBC 4O4GB 1FKAF 1JQGA 2W41A 4G1QB 4RW8A 4XA5A 5DM6L 4LF5K 4PGXA 3SMZA 1RCHA 4U7UD 1KQKA 4LSNA 3POTB 4A61A 4H5TA 2NUUG 1RUSA 2V94A 4ID1A 2VG5A 3UCZP 2ZIUA 3S8SA 3J81Y 4FNHA 8ICAA 9ICEA 5ELZA 3CIPA 4FE3A 5GADU 1DXSA 3SAHA 5ALWA 1GAOA 3VA3A 2ZFHA 1REVA 1ZJNA 2E1EA 3MMBB 3DCAA 3IBFB 5LSOA 2D4WA 3RAMA 4PZNA 4OLAA 5L9XA 2CGLA 2BGGA 4DQQA 4E3SA 1ZQEA 1L3SA 4L6V3 2G07A 3SV4A 1RG6A 4DS4A 5HMLA 2RIJA 1C20A 4Y2KA 2GAGC 3WIVA 5KL8B 3UMGA 2EAMA 1DGKN 4F5OA 1U0SA 2VPYB 3ETOA 4F04B 2CQGA 3P96A 2ZBCA 2E2OA 3QSYB 1FO1A 4CHPA 5F41A 3CJ7A 2QMWA 1WUAA 4YEAA 2CAJA 3HRDD 4RL1A 4OVLA 5I3UB 1ZETA 4NY8A 5J29A 3M32A 5HMZA 4CFDA 4FBUA 2QARA 4PRFA 4CJSA 1P9QC 9ICFA 2FGOA 5F8GA 2FMQA 1FFWB 2VKRA 4ED3A 3HD2A 3GJSB 3DKDA 3OGUA 2UUCK 1X4GA 4Q2LA 3LP0B 3AAQA 3CMAN 4UB2A 5GIOA 3ETLA 2HRTA 1VK0A 4F5QA 1U1QA 4U8YA 5C24B 4FYDA 4RQ2A 4FWLA 3PKYA 4LFAK 3KYLA 2R7YA 5AKEA 1S1XA 1YJWN 3C6TB 1X9MA 4BC9A 2KG0A 2BCUA 4WQ5A 3R5AA 3QUQA 4K4YA 3TX8A 1N33J 1X4FA 3CMQA 1KLMA 2V8GA 4FF1A 4M3UA 5GAGP 2VWBA 3KXDA 4GXKA 2A3ZA 2N1RA 3DDNA 4HL9A 3BKFA 2LM1A 4RW9B 1VQMN 1BDGA 4YMNA 1IBMF 1PKUA 4TY8A 4LR9A 2J0QD 5AQRA 2CADA 3LGHA 3MCAB 4U7BA 4NL5A 3ZDDA 4I2PB 9ICLA 2Q97A 1V97A 1T4GA 2M5YA 2HBRB 4IBNA 4YUDA 3SCKE 4DV0F 3LO3A 4M7XA 2IC3B 1RKJA 4NXZA 3KFUF 2DT9A 4WYBA 1ZZFA 4UATA 3BR8A 3JAMO 2LDYA 2KYXA 1IQTA 1SL2A 1X3MA 1WUUA 2VDHA 2Z4PA 1R7IA 3DRPB 3MEDA 2NV3A 2XY6A 2ZQBA 1ZQWA 5SWMA 2DBBA 4CO5A 2IDEA 1XNQF 3WXMB 1C0FA 5LXRA 1FD2A 2DNNA 1MA9B 3P4UB 1SV0A 9ICIA 5J2QB 1J53A 3UD5A 4OZ0A 4G65A 1S3XA 1VQMS 3K1RB 1F6TA 3D67A 2QSFA 1BPEA 2C3OA 3OTOF 3M2VB 2QA4N 2AJ1A 3C46A 4F4WA 4TU7A 9ICQA 3SUPA 3MXHP 2FJXA 3CJ4A 4O3SA 1PBUA 2HOEA 2DL0A 1NK4A 5DDYA 1RA6A 3WXIA 4DF8A 1RT2A 4CLUA 1WD6A 3RJJA 5GMEA 3VEOA 3FZBA 3I76A 4DV3K 3G4SS 4B1YB 3CJBA 1HNZF 3W2WB 1PAEX 1MROA 5J1PA 1TKTB 1U1LA 1R0CB 1FFVA 3LDLA 3K2PA 2ZE2B 3L95X 2WF5A 5ETKA 2UXBF 4CFBA 2IVNA 4ZH4A 5J0PA 3CCRS 3QATA 3I8BA 2W4PA 4P4OA 1OVQA 2IAJA 1FE0A 1RLCL 4BLGA 4K8XA 1FRXA 4CEEA 1KRPA 3E66A 2ZH9A 4CERA 3IFRA 3EKUA 3GU0A 3H0PA 3MX5A 2RMLA 1U48A 1SV5B 1NJZA 5HLFA 1UHUA 5ETRA 1WC3A 4JHDB 2VH7A 2WTUA 1U6ZA 2V52B 5F0WA 2VBXA 2RE1A 5JRTA 5D0EA 1OY6A 4GKJK 3AFGA 5FLXO 1JJCB 2DNHA 4OPKA 1N32F 1DRZA 1JLCA 5AIAA 1UKUA 4DR5F 5IV4A 4ECRA 3NP5A 1NI3A 1XO0A 3QFUA 2FC0A 3OHRA 5A8KB 2AIRB 1K1QA 3A3OB 4JK9A 3C2LA 2F4VK 5C12A 3BBFA 5HP4A 3DI6A 3KHHA 3HKWA 1FEZA 2XZDB 3RJKA 4PL8A 3UDCA 4Q5VA 3IGNA 3CG7A 4PHAA 4QQBA 2HMIB 5AQUA 1XERA 3B6PA 2A1JA 2LU1A 2WF9A 2E20A 1YTUA 4LBIA 2W04A 2HHXA 4R5PB 1C0MA 5A2QO 4NYZA 4DMNA 4AHRA 2VJ4A 2IMWP 1YBUA 3WK6A 4JRPA 2HYIB 3DXSX 3SEOA 4AL7A 2E8PA 4Y2TA 4ECYA 2DIVA 2A1SA 3VEWA 3CCQN 5F2RA 1W0HA 3OFHA 3BS5A 2F9DA 5KAFU 5KQ8A 3NG8A 3CCZA 3C1YA 4ZN1A 4JI8J 3EGWB 3M1YA 1R31A 4WQ5C 2V2ZA 7ICLA 2NREA 2GBZA 3KKAC 5GAEI 2VA2A 5CZXA 1RQ0A 2CQIA 4IFVA 3GR0A 5HMYA 3HILA 3HYFA 3DXMA 4O0NA 3T41A 2MZJA 2XZTB 3N97B 4PL7A 2F9TA 4CEOA 3VQ9A 5B08A 2K4PA 1G15A 2XI3A 1GXUA 1PUZA 3S01A 1BNOA 3IRXA 1BQNA 4DV5J 9ICBA 5ALJA 4U6PA 1N0UA 4LQ9A 2FJVA 4OJ3A 4CT8A 3L3FX 4RBVA 3T7ZA 1UPMB 1JIHA 1H72C 4X64J 3A0HU 4DWIA 1F3VA 4XTTA 1TVRA 1Z4UA 2VB6A 3K75D 2CPEA 1ZQGA 4IG0A 4EUVA 4FJNA 5AK6A 3CCSN 4DN0A 1TQLA 2QKQA 1O8BA 4WPAA 3U02A 2V34A 4N77A 4DUZK 3L5KA 2KN4A 1U1MA 2MDAA 1LCUA 3PIOL 5L1LA 4JOUA 2Z1IA 1VSHA 4X64F 1Q53A 1ZD3A 1OIAA 2ZC3A 3HP6A 5BN9A 1WHYA 2DR5A 1I94F 4OJ6A 4OZJA 2QXFA 3AMZA 2VYPA 4N56A 4LREA 1QVFR 1YHQS 2FBXA 2W55A 2OXOA 3VC8A 4C3KA 4DR6F 4FM1A 3GONA 1EQYA 4UOCA 2E5JA 2P5GA 5GAGI 4QIEA 5DK5A 1F2HA 1XSPA 2HHHK 2DGUA 4X4VA 2IBOA 3TTFA 4IS7A 5CYJA 4A8OA 2ILYA 4CO1A 1W97L 3TA1A 2XGPA 2EFNA 1I94J 2JEFA 3VGMA 1HBOB 3CFRA 1N2XA 1NKBA 1K73O 3UB5A 1M5KC 1DZ5A 1C0TA 2YKNB 3NRBA 3AVBA 1UAXA 1RDUA 1A76A 3G2XA 4DPWA 4JI8F 3KD5E 4NCGB 5HANA 4ED5A 2HNYA 3TWZA 2DXFA 1XR6A 2A1JB 2IDLA 1S1XB 1PK1B 5AQIA 2ZITA 4JKHA 4M8LA 2QKBA 4ED7A 1PILA 3W5YA 3GZFA 1GTHA 4L73A 3RGIA 2V7YA 3LDAA 4UZCA 4P9SA 2DH8A 4ZP9A 3HZEA 1WKKA 3J81U 2LHTA 2HRYA 1GT8A 3VVUA 5C42A 3BZQA 3GFZA 4CIOA 4I4BA 1X2IA 3P8BB 1ZAVA 4JV1A 1M1HA 2F5GA 3N4MB 2NYIA 1M1KO 5ALIA 2FDRA 3W3SA 1JXLA 4USAA 1Y00A 3OYCA 4DR1J 3AL0B 2BR0A 3BDEA 3AB2B 3JSMA 5AXNA 2AHOB 4DV7F 5IM0A 5ADZA 3BGRB 2HKEA 1ZOLA 4RW4A 4J9VA 3WK4A 5AQHA 1TVAA 4FZLA 3O9UA 5ALHA 4BRCA 2DGSA 1NJIT 5M1KA 2FBYA 4CZHA 2E1PA 1PYTA 3GCXP 2C2OB 2XRIA 3C65A 4ANEA 4F5NA 2D41A 3CD6N 2MU2A 3K58A 1SAZA 4YOWA 3N9UC 1M0SA 4UAVA 2Y8WA 2CIMA 4PGYA 2H4WB 5HBMA 4YY3J 3J81j 4NLZA 1NK0A 1N34K 1BVSA 1W2BM 2JFKA 5GAEP 2W1BA 3AA9A 3DGPB 4QIWF 1ZTTA 4MK7A 4I2CA 1MWZA 3M30A 1CS4A 5EX3A 2D7SA 9ICXA 2GNKA 5E5NA 4KLDA 3RFAA 2UXCF 2DNKA 2E8AA 1D8ZA 1CXUA 1IG9A 5AE3A 1BOTO 2MGZB 3UWTA 1Q82T 2AD9A 3AOCA 2Y1JA 3WQTA 1RSCA 3TSUA 3GFXA 3W8GA 1VQ6N 1P90A 1N5TA 1JLQB 4ER8A 2E8OA 3THYA 3MURP 1EP4B 3G71S 1S12A 4GKKF 1SS6A 4OLBA 3PTWA 3ZSQA 1BNPA 1FNXH 1M5VC 3CJCA 2O01C 3DNCA 2ASLA 1LXNA 1KONA 1L3VA 2O6KA 1LWEB 2W2QP 1S72N 4NLTA 2HVIA 4BQLA 4PJ0U 2BKNA 1RTHA 4IRDA 1WI8A 1Y5IB 1NDCA 4OL8A 1U02A 3M8RA 5IIMA 4JI1J 2RS2A 3WXJA 3DGVA 1IIPA 4ZCLA 1P1LA 4AYBF 4Z6DA 2E4LA 1RU1A 2FZCB 5CQGA 8ICBA 1HHSA 3VR1A 1NK6A 1WC1A 3N5FA 1NM1A 4P4PA 4JI5F 5A0LA 3SPYA 3DRRA 5HMXA 1HNZJ 4YDUA 4B3SK 2VASA 1TKZB 2DYAA 3NTUA 2J6SA 1FFUA 1Y7PA 1KC8T 1NK8A 1B7FA 2QA4G 1VQLS 4U9RA 3FEXB 1XHZA 4ED6A 3HSTB 2C2DA 3A4TA 3SSRA 3AA3A 4DV0J 4OZ3A 4FYVB 4JWMA 3W8PA 3TR8A 4PQAA 3GJTB 1WOQA 3AO3A 2YTUA 1C0GA 2B0CA 4P0QB 3WT0A 2Y0BB 4DG1A 2D3DA 3C14B 3V9WA 3FLCO 3T5HA 2ODGA 4C7ZA 1U24A 1EKEA 3CPWM 4K2XA 3GP9A 4LY7A 3KKSA 4DFJA 1URJA 2YKMB 7ICRA 1VK8A 5FRMA 4RPFA 1BI4A 3OA9A 2F8LA 3K0JA 3ULEB 2ZJRL 5KFJA 3DOMB 3M7VA 4A8QA 4BRNA 4ZA1A 1XHXA 2OMLA 3US5A 4DX8H 3BGLA 3MABA 4PQUB 5DETA 4PA1A 3VMFB 3MK6A 1TYQA 3BR9A 3OL8A 5DB8A 5MLCV 3TACB 1RCOB 4M3ZA 4ID8A 3NVKA 5I42A 1TV9A 4BDYA 4IFYB 3TTCA 2CG4A 1Z1ZA 4FS1A 2AYMA 1GOCA 1X4BA 2EG1A 1DTTB 2ZUDA 1BPXA 5J2CA 3AVAA 4GV9A 4PG4A 3TAQA 4EX6A 3KWMA 3E58A 2X6SA 3M3ZA 2VFVA 1VRTA 3LM9A 2WSCC 1Z6RA 3BPDA 3CM5A 1VQNN 2XVTA 5DQHA 2L5YA 4L75A 3QUTA 4WJBA 5JMVA 4FYXB 2IOCA 2NZ4A 2CXYA 2OWOA 4DL3A 4YB6