1U49A

Adenine-8oxoguanine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u49A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u49A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u49A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u49A01
2R8JA 2JEGA 1S1TA 2BCQA 5HHIA 1XO1A 4O9MA 4J9KA 1LWFA 3SQ4A 7ICMA 1ASVA 1Q9XA 3OS0A 2OPSA 3RRHA 2X6NA 3VQQA 1BIUA 4Q8FA 2BQUA 4QZCA 1C1CA 3LALA 3QO9A 4Q45A 1ZQBA 3AU6A 4ID5A 1HMVA 2PFOA 1QS4A 3T3FA 4R8UA 5DBAA 3BGRA 3QZ7A 4CEQA 3VQ4A 8ICSA 3GV5B 4DSKA 1ZQCA 4FJNA 3KLIA 4EYIB 4JS4A 3B6PA 1S9GA 3C6TA 4DTUA 3RR7A 4UBBA 2HHSA 1SZPA 1HYZA 2W9AA 3HVRA 4O3PA 3HWTA 1GOBA 4J9SA 3MDCA 4DU3A 4FZXC 9ICCA 3KD1E 3BDPA 4F92B 4EZ9A 3B0XA 1WCNA 3TAQA 2JGUA 4XA5A 1XHZA 4DFJA 4ECWA 3JYTA 2KQ2A 1SKSA 1VSJA 2FPMA 8ICXA 3RB0A 2H5XA 4KHQA 1EKEA 4QWDA 2ZTEA 4G3IA 3RWUA 4GW6A 4CJQA 1TK8A 4NLKA 1BCOA 1KEJA 2BPGA 5KFCA 5HRNA 5HP1A 2RF2A 3AA5X 3KLHA 4ECYA 2HHUA 4PGQA 4DTMA 2D0AA 5J0SA 3THVA 4YMMA 3SUOA 3KK1A 3OYJA 3CFRA 4PGYA 1YVUA 3AA4A 4FLTA 3OYDA 1UWBA 4C8LA 4FVMA 3JPNA 3QNOA 4IG3A 3ISDA 2VA8A 3NH2A 2PI5A 4W5QA 4KLUA 4IDKA 2VWKA 5J0XA 4CJ4A 7ICKA 3AVHA 4HUEA 5C25A 4KLFA 2LSNA 4DTXA 1S1XA 1CEZA 5IIOA 3QEAZ 1XSNA 3KHLA 1DGSA 1T4GA 1UA1A 4KLQA 4I2GA 4AILC 3CYMA 4R8UB 4K8XA 3HVTA 4CJ3A 3OYEA 1BPYA 1WCLA 9ICWA 3JPPA 1L3SA 2B21A 1ZQSA 3RMDA 4KN4A 1QSLA 1ZBUA 9ICOA 3GDXA 2Y1JA 4UB1A 3PR5B 1ZQTA 3EW9A 3HX0A 2W9BA 2KW4A 1XS9D 4CEZA 3AO5A 5CHGA 3VQ7A 5DGBA 3G6YA 4GC7A 3LAKA 4DLEA 4Z4CA 4B9SA 8ICEA 2HHQA 2BQ3A 5J29A 4J2DA 4J9RA 2ZE2A 4JK1A 4PHDA 4HYKA 3OJSA 3C2LA 8ICLA 4DS5A 2BPCA 4RQ2A 2ISPA 3V9WA 2O4IA 4BDPA 4J9QA 3UPQA 1X9WA 4M0AA 4M9HA 3ZSXA 1B43A 1B22A 2Q3SA 1C6VA 1FKOA 3VQEA 1S6PA 4I28A 5T7BA 4PGXA 2VG6A 4XQ8A 2ZTCA 3A2FA 3ZSRA 3RH6A 4W5TA 3SYZA 2P66A 1VRUA 3VA0A 4ELVA 1RT3A 1V9PA 2F1IA 4DO9A 1VRTA 2VA3A 5FROA 5KG3A 2YHAA 2D0CA 1BI4A 3NF7A 4EBDA 3SPZA 4NCGA 5HRSA 1BQNA 2QXFA 3K2PA 4CIEA 1F21A 8ICQA 4MQ3A 4RNNA 1CXUA 3ZT0A 1LV5A 4LZGA 4PHPA 2VA2A 1RTJA 3O3FA 3GIMA 2J6TA 1WSFA 4RQ0A 4M9JA 2P5OA 3MGIA 1X9MA 2O4GA 3TABA 3ZSVA 4M9GA 4RQ3A 2F1JA 4I9QA 1LW2A 4YD1A 3U3YA 5DB8A 4F4YA 3DOLA 5F9NA 4Z6CA 2HHVA 4DL3A 4IRCA 1JLEA 4FLZA 3LDSA 1WLJA 4I2QA 4CJUA 2BCVA 3LAMA 4ID1A 1C7YA 3K5NA 4O3QA 8ICPA 2FC0A 5J2HA 4XUSA 4W5RA 5DDMA 4RG8A 5KG5A 1BQMA 4N5SA 1QSSA 1UT5A 4ECUA 4B9NA 1X9SA 3ISCA 3V9SA 3AVCA 3V7JA 4AHVA 4BDYA 4UAYA 8ICKA 4RT3A 3PVXA 3QE9Y 4I9LA 1Z3EB 1KSPA 4QZFA 2XY7A 4DSLA 1JLAA 3RMCA 1KVBA 4CESA 8ICIA 3NH0A 3Q8KA 3C23A 4RNMA 4HTUA 3MXJA 1ZBFA 1FXXA 3E01A 2DPJA 3T1AA 4R65A 3PO5A 4UB3A 3O3GA 3SI6A 5BOLA 3Q8RB 4F4XA 1SL2A 7ICTA 4I2CA 3WNEA 4P2HA 5J0OA 4DQQA 3SUQA 3PR4A 4NCAA 4C8KA 4EP4A 3GFKB 3RJJA 4ECTA 2E4LA 4DOAA 3QESA 5J2BA 3SQ1A 3Q8MA 2R8HA 3C95A 3SUPA 1JXBA 3SNNA 1LWEA 2IAJA 5C5JA 3SCXA 1Z00B 1XWLA 4HUFA 1CZBA 1NJWA 1BPBA 1VSIA 2EX3A 3LP2A 2F8SA 1S6QA 1BHLA 4F93B 1IXRA 1I39A 5J0YA 1BI4B 3QZ8A 3M8SA 3TWHA 4M2YA 2ETJA 2FBXA 4CHZA 5FRMA 2J6SA 3DRPA 4QZGA 3P5JA 1S1UA 5SWMA 5KFGA 5DLGA 2JEIA 1LAVA 4CIFA 5KG6A 4IBNA 5HMMA 2XGPA 5DB9A 4FZZA 2IHNA 1RNHA 2F8TA 4J9NA 3AVJA 2G8HA 4XIUA 2V4RA 4DS4A 4PUOA 5EWFA 4YXJA 2DY4A 4FLYA 1KDHA 3IHQB 2XY8A 1TFRA 2ZUDA 2R8IA 9ICIA 1CZ9A 3D0PA 1BPXA 3QERA 4GXJA 1X1PA 3KLGA 2PZSA 2BANA 3NGYA 5D3GA 5HP4A 4QZHA 2JLEA 4DFMA 3RAXA 9ICMA 1NOMA 1HQEA 2E6MA 4DL4A 1XSPA 3RH4A 9ICRA 4KI4A 4Z0UA 2WONA 3AVIA 4KTWA 4I27A 3VQ8A 4CK2A 1IKXA 4KTQA 1A76A 3I8DA 4QAGA 5DDYA 2QKBA 1HNVA 2Z1IA 1RTDA 1KCFA 2IMWP 4JS5A 4GC6A 4QW8A 3LWLA 7ICPA 4YMNA 2DFLA 3KJVA 1KTQA 3QNNA 5KFMA 4O0JA 5EWEA 3OYAA 4KV8A 2IA6A 3AVBA 1RBUA 3MEDA 4IFYA 3TARA 5CP2A 1R0AA 4B9VA 3SJJA 4DFKA 4O5CA 3K5OA 4YNQA 3KIOA 2KZZA 3NDKA 3HK2A 4F5NA 2X74A 1S0OA 3Q8QB 4C8OA 4KLIA 4J2AA 5DBCA 4IR1A 4RW7A 4M3WA 3QEPA 2PYJA 4NYNA 4KAZA 4OGEA 1YTAA 3M9OB 3EZ5A 1MQ3A 4NYFA 4FLWA 1S9EA 3HM9A 3GILA 3ZDBA 3V9UA 2WOMA 4FM2A 4CFBA 4ED6A 4M3YA 5KFIA 2FMQA 7ICNA 1KVAA 3PMNA 5D4BA 4RPZA 4K8ZA 4M45A 4O4GA 3JPQA 3L2QA 5HROA 5KRSA 3HXMA 3OYFA 5KG0A 4DQPA 4B9LA 3MGHA 2GV9A 1L3TA 4F5QA 2ZJAA 3L2WA 1ZQDA 4YR0A 8ICZA 2FBVA 5D46A 1FK9A 4GLXA 1SKRA 5EWGA 4GXKA 2KFNA 5KFZA 4OKKA 4NY8A 3VN5A 3TI0A 3AVFA 3LANA 5KFHA 4KLEA 3LZJA 4MEYA 1NK0A 4DSJA 4DTSA 1RT1A 5J2CA 4KHSA 4B08A 4YP3A 4B9UA 4RW9A 1T7PA 4ICLA 5KFXA 5JS1A 3OYHA 5D49A 1BPZA 3V6DA 1IO2A 3ITHA 2YKMA 2XCAA 4TUSA 2ASJA 4AH9A 1UOCA 4M6WB 4F91B 1C0UA 3OY9A 2KZMA 2HNZA 1MC8A 4O55A 4PQUA 3NE6A 4QZDA 5CWRA 5KFPA 7ICHA 5L1LA 3IS9A 3RAQA 1ZQIA 2PFNA 3F73A 2FPLA 4DTRA 3MR6A 3ZDEA 2JEJA 1EETA 3VQCA 5KFVA 4M41A 4FZYA 3HPGA 3KTQA 1JLGA 3I0SA 2V9WA 2B4JA 4GXIA 1KFSA 1JLFA 1VSDA 4CF2A 1NJZA 5KI6A 4E1MA 3C94A 1DOQA 4QWEA 5J0RA 3AVGA 3LZIA 1ZQNA 5J2GA 2Z1HA 3LP0A 4LY7A 3QINA 4PHEA 3V7KA 1TKTA 2I9GA 4F3OA 4ELTA 2DFHA 4RPYA 2JZBB 1ZQJA 3DLKA 3JPOA 1WNSA 2M9NA 2FLLA 4OKJA 1TL3A 5KFSA 4RW6A 5KFUA 3WNFA 5EOZA 2VWJA 5HMLA 5CZ1A 4FJXA 4N47A 1QTMA 2HW3A 1WSEA 2DTUA 1N56A 3MEEA 1W9HA 2GWSA 1RXWA 4QZEA 1NK8A 1LW0A 4KHYA 1Z25A 1ZQLA 2G8IA 3RJHA 3RH5A 5KFJA 4YCXA 5HNKA 2RDJA 4C8MA 2G8FA 4P4PA 2UVRA 1RBTA 4F5PA 2G8KA 4FS2A 4Y1CA 4NLGA 1K1QA 2ZQBA 4O0IA 1S76D 1XU4A 4RT2A 1DTQA 3O4NA 3ZSYA 4CF0A 4E3SA 1S0VA 5L9XA 3V1OA 2BGGA 4JRPA 5KFWA 4QWAA 4CE9A 3ETLA 3H8JA 5J2PA 1WSJA 1ZQUA 3KHGA 4DL5A 4E89A 4DU4A 2RPIA 5KG7A 1BCMA 5DB6A 9ICXA 4UBCA 3RB3A 1Y97A 2KFZA 9ICVA 4PH5A 3M8RA 4RQ4A 5F9LA 3SV3A 4LH4A 3ZDCA 1O1WA 1HRHA 4YR2A 3AV9A 4KO0A 2G8WA 2FMSA 3OS2A 1C1BA 2C2EA 4PHAA 5HBMA 1QQCA 1REVA 4FJGA 1S97A 3PO4A 3RTVA 4LD0A 1C0TA 1JKHA 1NK9A 4AHRA 2ZD1A 4M3ZA 3HT3A 4RNOA 4CFDA 3VQ5A 5DQHA 5DQIA 3OYNA 4FK4A 7ICRA 3ZD8A 1TVAA 3PW5A 3K5LA 4DSFA 4QOZB 4NXZA 3KHHA 1S77D 3H08A 1ITGA 2BCRA 4YXMA 4BGDA 3SI8A 5KFEA 4I2IA 2X78A 3D45A 4KLHA 3GQCA 4MFCA 2P6UA 4FYDA 1TVRA 4RQ6A 3N4MB 3O4QA 4DU1A 1K6YA 2B5JA 4QWBA 2IGIA 4OLBA 2YHBA 2LYHA 4CERA 3Q8LA 4UB4A 2Z1GA 4BE0A 4QZAA 3GIJA 3H4BA 1TAUA 1G15A 2OA8A 2PY5A 4RW8A 3DRRA 3UXPA 3AUOA 1AROP 2IBKA 4E7LA 1YT3A 2P1JA 3MXIA 2UVVA 4I2HA 4FBUA 5HRRA 5JS2A 4QW9A 1BPDA 3B0YA 3UQ2A 4E7JA 4RW4A 4B8AB 1WAFA 4ECVA 3TR8A 3M8QA 3IAYA 4O5EA 3AA3A 9ICBA 4ECQA 4M47A 4Z6EA 4OPJA 3K57A 2BQRA 2W8LA 1RBRA 4Z4EA 4UAZA 3C21A 3LPUA 3DYAA 4TQSA 4CGFA 5KFNA 3AVKA 4F2RA 1LWCA 2V4QA 4K4IA 3KLEA 1IKYA 4JUZA 2A1JB 1RDAA 2ASDA 3V6JA 4O5KA 1JIHA 4YR3A 3RJKA 4UAWA 4CJ5A 3C5FA 2G8VA 1YTUA 4IQWA 4R5PA 3CFPA 4ED7A 1K1SA 4DQRA 3AO3A 4HHTA 2VG5A 1RTIA 9ICGA 1ZYQA 3VQ9A 5KFKA 1QE1A 4TUPA 3CQ8A 4M9NA 1DLOA 5IIIA 1XI1A 5DGAA 3DI6A 2XCPA 3SPYA 1RDDA 3I0RA 5IIJA 1U48A 1ZQPA 2XGQA 1UT8A 4DFPA 4Z4FA 4DTJA 1A5VA 2OYQA 3JPRA 8ICRA 3AA2A 4CEBA 1U9LA 3ISBA 4FJ8A 1BGXT 1HNIA 4DTOA 1U4BA 3KHRA 4QZBA 9ICQA 2IHMA 1SKWA 2OZSA 2XY5A 4RQ7A 3LP1A 1ZQGA 1QHTA 4CGGA 4F2SA 2HB5A 4NLNA 4AHUA 4KLLA 4F4KA 5J2IA 3H7IA 1A5XA 3V1RA 3TANA 3BQTA 4MFBA 3Q8PB 1MSWD 4BWMA 1BL3A 1KRPA 5IINA 3U3GA 3EY1A 3QETA 4M3UA 2MUTA 3TAMA 4E7IA 1WN7A 2QK9A 8ICJA 2Z1JA 3LDAA 4CJRA 4DOBA 3Q8SB 3S3NA 1ZQOA 1RYSA 5KTQA 3PW0A 1KLMA 3TAGA 1CLQA 3ORYA 3C2KA 3RJFA 3G0ZA 4DTNA 1MU2A 5KFOA 4EZ6A 3L2UA 7ICJA 1S0NA 4QZ9A 4ECXA 4M04A 4CEAA 1A77A 4J9OA 2C2DA 4QZ8A 2C22A 4M6WA 2VG7A 1IM4A 2KZ3A 9ICAA 4CJSA 2AGQA 4DLGA 4F3TA 2C2RA 4KHWA 3NGDA 4CF9A 1B92A 4QWCA 3ULDA 3V9XA 5KFTA 1ZQQA 3MECA 4QZIA 4DOCA 8ICOA 1SL1A 2OPRA 3L3VA 2RKIA 4UB5A 3ISNC 1XHXA 3S3MA 1NJXA 3NBPA 3K75D 2YNIA 5DLFA 3MR2A 2BGWA 3ASMA 2ATQA 1ZQYA 4CCHA 3PMLA 4KI6A 3HO1A 2P51A 4DEZA 3PX4A 1D8LA 3VQPA 5E41A 1RYRA 4CHQA 3EPIA 1ZBHA 2OZMA 4M42A 5J0TA 3RMBA 1NK6A 3OYCA 3NF6A 4Z4IA 1C0MA 1JN3A 4KLDA 1KFDA 1JMSA 3ZSOA 2HNDA 1S9FA 2DPIA 2W8KA 4CHNA 3EWAA 1GOAA 8ICFA 1J54A 4RQ1A 4F50A 2W42A 1RTHA 2BKEA 4NM1A 7ICUA 1TKDA 2AJQA 4YFKA 2UVWA 3GIKA 1UA0A 5J2NA 1IKWA 4DQSA 4LSNA 4XRHA 5KFDA 1TV6A 2XY6A 5J2FA 4GVMA 4M3RA 3OYMA 3SZ2A 9ICSA 5DKWA 4J2EA 1B9DA 3QIOA 4ZTFA 3PW4A 4FJMA 4B9MA 1LAWA 5KGWA 4PPXA 2OPPA 4EP5A 3KKSA 3LP3A 4UB2A 2BCSA 5CYMA 5DG8A 3M9NB 3HL8A 4FLVA 5J1EA 5J2JA 3K4GA 5L1KA 1NKBA 2PFPA 2ALZA 4KRFA 5KT4A 3MABA 3SV4A 4KLTA 3DM2A 8ICGA 4EYHB 3C6UA 4BWJA 3FDSA 2IC3A 3T5LA 4R64A 1EXNA 5DQGA 3UIQA 4F5RA 4IQTA 3P1GA 4J9MA 3L3UA 1B9FA 1RT6A 3V6KA 2HMIA 2OPQA 4TSXA 4C8NA 1JLCA 3VQDA 4KTZA 3OYBA 4HCBA 4CIGA 5KFLA 8ICHA 3MBYA 5J2KA 2P5GA 9ICKA 3V4IA 4HCCA 3G6VA 4YFUA 3G6XA 4CGIA 4F5OA 4MF2A 2A1RA 4RQ8A 3NTUA 3LPTA 4KLGA 4TUQA 2BR0A 1HQUA 1SL0A 2PYLA 4X5VA 4YQWA 4I2DA 3TFRA 3OHBA 3RJGA 1ZQMA 3MR5A 4YMOA 4O3RA 4CJVA 2FPKA 2HHTA 3TAPA 4DL6A 1ZETA 4TURA 4QCLA 1HUZA 3CG7A 1VSEA 1RT4A 5J0WA 1Z00A 2YNFA 5J2EA 3DLEA 1BVSA 2W9CB 1H38A 1COOA 4ZH4A 8ICAA 1SV5A 4CJPA 4W5OA 9ICUA 1NOZA 3OYLA 3PW2A 3OYIA 5J2DA 4N41A 1RCHA 2QKKA 1RBVA 4J2BA 7ICGA 1S10A 3PW7A 4IRKA 2YNHA 4CF1A 4OLAA 2PXIA 3ZT1A 4JV2A 4FJIA 1ZQHA 3L2RA 5HHHA 5KT2A 4N76A 1C1AA 1Q9YA 4MEXA 3QEBZ 3HPOA 3EPGA 4Z6DA 1BISA 3JPSA 1CUKA 3U6FA 4I2BA 5J2AA 3QIPA 3RRGA 4DMNA 4KITB 2ZJ5A 3C2MA 3ZDAA 4FW2A 3PX6A 1CXQA 3V9ZA 4IQUA 4E0DA 2IS3A 1KFTA 5DB7A 3OJUA 1VK0A 3AO4A 4DL2A 9ICPA 4KMUA 1U04A 3NF9A 3SQ0A 3E2EA 2NRWA 3AO1A 4FLUA 5KG1A 2DFEA 1JXLA 4BE1A 3ZCMA 1ZQXA 2NRXA 3MFIA 4KB0A 4F4ZA 3TQ1A 2WTFA 1TKZA 4BACA 4CK3A 4L8RB 1TAQA 5HRPA 8ICWA 2HNYA 4KLJA 4Z6FA 2XRIA 3PV8A 1RILA 3NHGA 3TAEA 4YVZA 2PFQA 5KT7A 1GOCA 1TKXA 2YV0X 4KLMA 2G8UA 1DTTA 3B6OA 3HPHA 2R8GA 3RJEA 4B3OA 4ED1A 1JL1A 2X6SA 3OSPA 4DSEA 4FK2A 5KFRA 3DLGA 4OGCA 3C1YA 5J2MA 4O5BA 4J9PA 4FLXA 5DK5A 4CJKA 4DF8A 1HJPA 1J53A 4FM1A 4IRDA 4OVLA 2NRTA 1XSLA 4I7FA 4NM2A 3BQ0A 3GIIA 3TFSA 4ECSA 3ZSZA 1TK5A 1S5JA 1WSGA 3NH1A 3QEVA 4F8RA 4FCYA 4W5NA 7ICFA 1XC9A 1D8YA 3RBEA 4FJLA 4CGJA 2RDIA 4O3OA 1HUOA 4AHSA 3KKRA 2JZBA 5IIKA 3OSNA 3K58A 4CJTA 1N48A 3RB4A 3JSMA 8ICMA 4PY5A 4RU9A 4FS1A 2J6UA 4ELUA 3RMAA 3TAFA 4CF8A 3SQ2A 8ICNA 8ICVA 4BDZA 3V81A 4CECA 1ZQEA 2UVUA 1RDBA 2YKNA 1JXEA 2AU0A 3H40A 1ZJMA 1U45A 3NAEA 2ZUCA 4Y1DA 2DFFA 4B8CA 3ALYA 1T05A 2FLPA 3V1QA 3LK9A 3ZT3A 5KFAA 4H4MA 3MXMA 4FJ9A 4EEYA 3NCIA 4LZDA 3V72A 2F1HA 4CFCA 4Q44A 1RPLA 5JUMA 1D9DA 1IKVA 4DTPA 1TGOA 1TV9A 5SZTA 3S3OA 4YD2A 1QLNA 1L3VA 2XO7A 3HW8A 1QSYA 3M8PA 3NGIA 3OVNA 4LVSA 3SUNA 1T03A 3ZD9A 9ICLA 4YG2A 3AO2A 1ZQZA 4CGHA 4HUGA 4FK0A 1JLBA 4OJRA 4GMJB 1A5WA 4E7KA 3IRXA 4FJHA 4IG0A 4G1QA 4KREA 3T19A 1WSHA 4Q5VA 3O3HA 4HVJA 1UAXA 1TL1A 3DLHA 4DWIA 2ITGA 4MFFA 1WSIA 3ZDDA 4IQVA 8ICCA 1WAJA 1S1VA 4H8KA 4LH5A 2NRVA 3KD5E 1BIZA 3BQ1A 3OYGA 1HYSA 2B6AA 3V7LA 4B9TA 4E7HA 4ECZA 1LB2B 9ICFA 1S0MA 4M9LA 4BXOB 4R63A 7ICIA 3NFAA 4LSLA 4RQ5A 3UQ0A 2F96A 3ZSWA 4NCBA 3CM5A 4CHPA 2OWOA 4DG1A 5I42A 5HLFA 1ZQRA 1ZBIA 3AVMA 5KRTA 4KN7A 4ED3A 2JEFA 1N5YA 3GV8B 1NK7A 2R7YA 1ZQFA 2VANA 5CYQA 2FMPA 1SUQA 3OYKA 2E6LA 2BHNA 2EHGA 3G10A 4KFBA 3PUFA 3EYZA 9ICHA 5I3UA 2KN7A 7ICOA 1NOYA 5FDLA 4EBEA 3OS1A 8ICYA 4F4WA 1ZQVA 5DMRA 2D5RA 4ED2A 3F9KA 4K4GA 3HSTB 2HVIA 2XC9A 1VSKA 4ED8A 2NRZA 3HP9A 3OGUA 5IILA 1NK5A 4YN4A 5KT6A 4TQRA 1Y88A 5CB1A 3DLRA 4R66A 7ICSA 3RR8A 3VQ6A 3GV7B 5EU7A 4KPYA 4FO6A 2IOCA 5L1IA 2BPFA 4JV1A 5CY4A 3VA3A 5CJ7A 3KLFA 2W9BB 1T3NA 2A1JA 4CEFA 3CFOA 2BDPA 4CEOA 3K5MA 1I3AA 1IH7A 1ZJNA 2GBZA 2BCUA 3P83D 4OPKA 2I5JA 4IR9A 1D5AA 2P6RA 2FLNA 3HYFA 2ZUBA 1NKCA 4OKEA 1TK0A 1S1WA 3RJIA 3H4DA 5TZVA 1J5OA 2R8KA 1Q8IA 1W0HA 4CJLA 1VSFA 2ATLA 3DOKA 1KVCA 1N6QA 3FFIA 3NGZA 1RT5A 2Y1IA 2W9MA 1NKEA 1VSHA 4KHUA 4Q0BA 4IKFA 3BJYA 4EBCA 7ICQA 1Z26A 4RPXA 2MAXA 4BXOA 4FJ5A 3ZT2A 1IG9A 5KG2A 1VSLA 4DSIA 4ED0A 3FYHA 3HJFA 4E1NA 4K4HA 2AGOA 4DL7A 4KKOA 3WNHA 4ZTJA 4RZRA 3JPTA 5FRNA 9ICNA 9ICJA 5KT3A 5KT5A 4P4OA 1L5UA 4UQGA 3PX0A 4PA1A 4NLZA 3CM6A 4CJEA 4CJWA 1HYVA 4P4MA 4DF4A 3L2VA 5CR0A 3MR3A 1JX4A 3T5HA 5J0PA 4O3NA 4ZHRA 1ZBLA 4BE2A 4IFVA 4KLOA 3LWMA 2NUBA 4O44A 1ASWA 5DG7A 1NJYA 4WE1A 4H4OA 3MEGA 5DG9A 4CJFA 2FBTA 4KB1A 3QLHA 5KFBA 2HHWA 4KLSA 1MQ2A 1X2IA 4JWNA 5C24A 1RZTA 5KG4A 3T5KA 5CZ2A 4JRQA 4N56A 3QEIA 1KLNA 3H8SA 3T5JA 3DRSA 3VQBA 4KHNA 9ICEA 5BOMA 4I2PA 3S9HA 1PZNA 1HJRA 4PWDA 2XHBA 5BPCA 3C5GA 3BQ2A 3N97B 2BE2A 2D0BA 4CEEA 4CEDA 1T8EA 2RN2A 1RBSA 1ZQKA 1L3UA 4JLHA 4E19A 9ICTA 2GUIA 8ICBA 2C28A 4FXDA 5J0UA 3QEXA 7ICEA 2AGPA 3ZT4A 1HPZA 1EXQA 4MF8A 1ZQWA 3L8BA 3PY8A 4Q8EA 4I2EA 5IIMA 3V6HA 2PI4A 4I2AA 4MFAA 5KFFA 3MDAA 3K59A 5KGXA 2W9CA 5J2QA 3IM1A 3H8WA 4AHCA 3HP6A 4I2JA 5DBBA 2FBYA 1U47A 2IDOA 3UXNA 5J0QA 1BPEA 2AQ4A 1VSMA 1RXVA 8ICTA 2MUTB 4FBTA 1ASUA 3VQAA 4ECRA 3RB6A 3MFHA 1D9FA 5KFYA 4Q43A 1NK4A 4CGDA 8ICUA 5K14A 3AVLA 2KTQA 3AU2A 3KK3A 3OHAA 3MAQA 4FJJA 4Z4GA 1RT7A 3DMJA 4DQIA 3PNCA 3M9MB 4JV0A 4RUCA 1JLQA 4CFAA 1EX4A 4JWMA 2AQ0A 4FW1A 4CHOA 2YNGA 3AVNA 3ZSQA 4FM0A 2HVHA 5CA7A 2ASLA 3DLBA 5L1JA 3C1ZA 4I29A 3QEWA 2ISOA 1EP4A 2I1QA 3WNGA 4O3SA 2A1SA 4FJ7A 3AVAA 2ZTDA 3IG1A 4CK1A 4Z4HA 4M3TA 1FKPA 2HHXA 2Q0ZX 4AHTA 1RT2A 7ICLA 4I2FA 1JL2A 1RDCA 5C42A 4J9LA 3RBDA 1U49A 4CHYA 3NF8A 4FJKA 7ICVA 5KFQA 4RUAA 4M3XA 3KK2A 1J9AA 2ZJ8A 3UXOA 1ZQAA
chains in the Genus database with same CATH superfamily
3WC2A 2WHEA 2JEGA 1S1TA 3QNMA 2BCQA 5HHIA 2J9EA 2IDEA 2RMLA 1VIXA 3N5BA 3SQ4A 3UN3A 1KAZA 4NZ7A 3UN2A 3OS0A 5ALVA 4S0MA 3N6LA 3VQQA 4OYMA 4CF5A 2Z7JA 3AU6A 1X3NA 1V4SA 1SXDA 1U6ZA 5H9FK 4CEQA 2C3UA 4RQMA 4GRSA 2DPNA 1ZQCA 1FVSA 5KPRA 4LF4J 5ALIA 1Q78A 1S9GA 1RA6A 4LF4K 2JH1A 3RR7A 1HLWA 1DK3A 5FPNA 1HYZA 2OLWA 4Y2SA 4O3PA 3TADA 2DCLA 3HX9A 1GOBA 1OPIA 2P9NB 4JI8F 1SV0A 1RAGB 3KD1E 4RWWA 4EZ9A 3B0XA 1TKZB 3W64A 1WCNA 1EETB 2HBJA 4XA5A 4DFJA 4ECWA 3CMES 2LVWA 2N82B 1JWWA 3E9PA 1D4XA 2X51A 1VSJA 1S5ZA 3KG0A 2XNRA 4H5TA 1EKEA 1U8SA 1NXIA 1Q8BA 1V3ZA 3RWUA 3C3LA 1XR6A 2HOEA 1MWZA 1HNWJ 3G96A 2MKIA 4M94A 1DTTB 1EO1A 3OTCA 4HT7A 5J8YC 5HP1A 2CPYA 3KLHA 1WJ9A 3OBIA 4DTMA 2D0AA 3PNIA 4LRCA 3KK1A 1ZD3A 3AAWB 3VAIA 3OYJA 3I56N 3E1YA 2QX0A 1YVUA 3AA4A 3EKSA 1IG8A 3N6MA 1HWLA 3JPNA 2VA8A 2PI5A 4ZP8A 3WIUA 2M9KA 5J0XA 3AVHA 5C25A 4ZVGA 4KLFA 3RUBL 2LSNA 4M5GA 1CEZA 3O80A 1JLBB 1XSNA 4OQJA 1U2CA 1T4GA 2QMWA 2W41A 3D5MA 3OR1A 4OI0A 4H5RA 2ZEJA 4CJ3A 5GINA 2QLJB 2CQCA 2KSOA 4QBUA 1WCLA 3JPPA 2YNIB 5D4LA 3RMDA 2ALYB 2E66A 1IR1A 2QSWA 5AQRA 4B9QA 1HEKA 1IBKF 1P9QC 2PMZF 2DY1A 5BREA 2ZXIA 4PG6A 4OYWA 2DRDA 2AZ3A 2W40A 1ZQTA 1XS9D 1FRLA 1IBMJ 4W4MA 4XO0A 1TZ0A 3H8MA 5LY3A 4DLEA 2QO3A 2POKA 3WX4A 2LECA 1WSVA 3SMPA 1OH5A 8ICEA 5LXRA 2BQ3A 3T1YJ 1Q53A 4J9RA 3NS6A 3WEEA 2IFXA 4HYKA 3CULA 3OJSA 4EHTA 2GMJA 7FD1A 1LW0B 4ZPCA 4ZHRB 2BPCA 3SSQA 3K0JA 1VQMN 3ZLJA 4KC5A 2O4IA 1X9WA 4M9HA 3ZSXA 3IP0A 1KQSM 2JX2A 1KP6A 3NCQA 4I28A 1KD1T 5T7BA 4PGXA 1WELA 3ELHA 4XQ8A 3ZSRA 3SYZA 1DGJA 5CYMB 2P66A 1WWHA 4LVNP 4ELVA 3TX8A 4CZCA 2WVBA 2VA3A 3R5JB 4ZVEA 5T7LA 3C7NB 4EBDA 3SPZA 2V2QA 3NGRA 3J80Y 2MZQA 5HRSA 4K4UA 5IV4A 3WK8A 1H73A 1X4AA 2IVFB 3K2PA 2PO4A 2AYMA 1VQ5S 1CXUA 2W54A 3E0FA 2QWMA 1U6FA 4NEYA 4OD0A 3F9MA 3GIMA 4WBFA 2HMPA 4C0HA 3MGIA 3UO0A 3ZSVA 4USHA 1FNOA 4PUOB 3R3TA 4I9QA 1XR5A 3DM2B 2E1YA 2Z57B 2DQNB 5F9NA 4Z6CA 3D2EB 3OW2M 1CJVA 3B4MA 4DL3A 2R7RA 5BN9A 2Y8YA 1YDLA 2Z58B 3OPXA 3RGIA 5ELZA 2OMOA 4I2QA 4FO0A 2ACYA 2DY9A 3LAMA 1ZRNA 4JB3A 3ZTSA 1PJ6A 4JNEA 2L9WA 1M1KT 4RG8A 5KG5A 1YJ9N 4N5SA 4WFXA 1UT5A 3P6YC 3DXMB 3S41A 4QYZK 1HFEL 1X9SA 4AQYK 1F2HA 3VEYA 1UAWA 1IKWB 3MMAA 3O8MA 3DWLA 1FJGJ 4ILHA 2W7AA 5B7WA 4C7YA 1LQ9A 5AE3A 3QE9Y 3AEVA 1FX4A 1XQIA 2OTLS 2KHVA 3RMCA 1QAYA 3EUB2 8ICIA 4JI2F 3CQXA 1XIQA 2MQMA 1ZBFA 1FXXA 3T1AA 4HH0A 5AQZA 3EO3A 3QMLA 3ISND 4BRGA 4F4XA 2MMYA 3MUTP 1YI2N 3D1OA 5J0OA 3MOJB 4YMEA 1FDDA 3PR4A 4NCAA 4C8KA 4YB5A 2U2FA 1VMBA 1T9YA 1RTZA 1B0XA 3BN7A 4OZNA 4OJ1A 2E5JA 1MA7A 5CEHA 2XYPB 2XLIA 3MOZA 1EQMA 3KDOA 1VS3A 1LWEA 3UD5A 3SCXA 3BBCA 1XWLA 2Y1RI 4X66F 1N62A 1VSIA 2EX3A 2F8SA 1K8KB 4F93B 3ZTPA 1IBKJ 5DM6L 3Q89A 4M2YA 2XQCA 2ETJA 2QB0B 4CNQA 2PBDA 3DRPA 3VTHA 1BLUA 3PIPQ 3P5JA 1S1UA 1P7DA 3ILOA 3LP1B 5ALGA 1SC6A 4K50A 1H7XA 1E4GT 3IRUA 3PYEA 2FUG9 2DKZA 1V3RA 3UPFA 5KG6A 4LMZA 5A6WA 4IBNA 3BZCA 2QIFA 3C16A 2VOPA 3P5TL 4FZZA 4CNZA 1RNHA 2F8TA 1XEZA 4H4MB 3OR2B 5K5MA 4XIUA 4PUOA 4QS9A 3WK5A 1SJQA 1IBMK 2XY8A 1TFRA 5ALKA 2R8IA 1OUQA 3A4TA 4GXJA 1X1PA 4FYWB 2PZSA 3AOCA 5E33A 5H9EJ 3UDVA 5HP4A 1K5OA 4JD2B 1NOMA 2MKYA 1T9UA 1YIJN 5D0HA 1IM6A 5GAGU 4EENA 2NSCA 2CPRA 3ULEB 2IVNA 4KTQA 1A76A 3DV9A 4QAGA 4K0KJ 3I8DA 2Z8QA 2QKBA 3J7A1 1RG6A 2KT5A 5F0XA 3CCLN 3GJSB 1YJVA 2DBBA 3HKWA 4JS5A 4GC6A 4EX6A 5EX3A 5C15A 5H9FJ 3SJHA 5ALQA 2HS3A 4ZS6A 5KFMA 4OLOA 1RDRA 4KV8A 3MK6A 4BJQA 3AVBA 3MEDA 1RBUA 3ET6A 3CMEN 3O1LA 3TARA 1HKAA 4DFKA 2MJNA 3ICXA 2BUPA 1DRGA 1IV0A 2QL7B 1NDKA 3Q8QB 3ENQA 2FJDB 1RKIA 4BBYA 3ZZUA 4PQUB 2O67A 1F1BB 4IR1A 4RW7A 3G2XA 3NY0A 1RUSA 5K8NA 2RRNA 2PMZD 2P35A 4FLWA 3FEXB 2V34A 2YMMA 1FEZA 4CFBA 3EGNA 1SZHA 1KW4A 4M3YA 4LF7F 3ENBA 4ZPDA 4LF6F 1FNXH 5B08A 3AD8C 2KB2A 3IAM9 3JPQA 4O4RA 2JHDA 3W60A 5HROA 1XNQK 3OYFA 5KG0A 3QRPA 2KHOA 2BE7D 4B9LA 3MXHP 1IIPA 3HFVA 4ZIWA 8AT1B 2ZJAA 2DIVA 4K4TA 1YG0A 1FK9A 5DS7A 1SKRA 2KJ5A 2KFNA 4AQYJ 4NY8A 3TI0A 5KFHA 4MEYA 2YY6A 4BRDA 4ZP9A 4DSJA 1RT1A 4OJHA 1RB0A 3B78A 1TQLA 4KHSA 2A2CA 4YP3A 1XNQF 4B9UA 4JK9A 3M6KA 4ICLA 2GELA 5KFXA 1MN8A 3VF0B 1M90T 4U9RA 3OYHA 1BPZA 3V6DA 1VQ7S 2CWXA 5AE2A 1KQGB 3B82A 5F1XA 4NLBA 2P5VA 4DV1J 3BS7A 2OFGX 4AH9A 1NHVA 3QSYB 1NZBA 4DDFA 2VCPA 3THWB 4WIIA 1CULA 3TR5A 3UVJB 4QZDA 2VWBA 1KVKA 3IS9A 3CNQP 1BQNB 1CJKB 2FPLA 4NMXA 2DGQA 3AMZA 1EETA 3V4MA 3ZETB 5B0EA 2YX7A 1JLGA 3I0SA 1VRUB 2C2OB 3D6JA 2AIRB 3J81U 4DV2F 3ONQA 2B4JA 1Q7YT 3OQ2A 4ZPTR 4JI5F 1DY3A 4NEZA 4H0OA 3G71S 4AL6A 5CAAA 1T95A 1LK7A 1H2VZ 1BHNA 3IP4B 1N34K 3P38A 3AB2B 3V7KA 1TKTA 2I9GA 2W4PA 4F3OA 2DFHA 1X42A 1XQSC 4PXDA 1ZQJA 3JPOA 5AI0A 1VYAA 2FYXA 2NXUA 1O08A 5F8LA 3W2VB 3MGJA 3OXLA 3FGUA 1WSEA 2DTUA 4L3NA 1L7PA 2HRYA 2VJUA 3CJ7A 3KK3B 4PXBA 3UKRA 4AL5A 5KFJA 5ALWA 4YCXA 4BRCA 2HFVA 4USKA 5AXMA 2RDJA 2EVZA 4IKAA 2G8FA 3EEQA 2F5GA 2ZDOA 1RBTA 4F5PA 4CLUA 2QTDA 1KN6A 4FS2A 4I64A 2DF4B 2B4PA 3NNCA 2AP1A 1E6YA 4JI1J 1K1QA 1HUXA 4FXWA 2CPFA 5JLFA 4JYAK 1S0VA 1HPZB 2KXHA 2ZBPA 3ETLA 2GUPA 3AY9A 4NB4A 4CE9A 2V8GA 3H8JA 4OZJA 2P9EA 5J2PA 1YAGA 3NGSA 4Y2AA 3QFWA 3FRZA 4WP9A 4UBCA 3RB3A 4ZDNA 1SAZA 3HSDA 5AZJB 2HSEB 4USIA 4PH5A 3HULA 3W61A 2HFZA 4L76A 4RQ4A 5F9LA 3SV3A 3ZDCA 2FHKA 1Y3JA 2G8WA 2FMSA 3NEKA 5D78A 1RWNB 2EPIA 1REVA 1QQCA 5ALZA 1S97A 1C20A 1ZM9A 1HWIA 4WTOB 1YBTA 2H48B 3L4PA 3HT3A 5A8KA 4USMA 3MTJA 4UF4A 5DQIA 3OYNA 3GE1A 7ICRA 2GX9A 3HKZF 1ZAXA 5E3QA 5F2RA 5E3PA 5DETA 5IQQA 4YXMA 5KFEA 1J2NA 1U25A 2X78A 3UDEA 4K5RA 4JKGA 4AFFA 4WCEL 4KLHA 4UY8O 3GQCA 5M1NA 1TVRA 3N4MB 2CXEA 3M30A 3A5OC 3O4QA 2B5JA 1K6YA 4QWBA 1AUSL 2IGIA 4A2AA 2WF5A 2FB0A 3P39A 2YHBA 3WQTA 1PO6A 2WVFA 2BJ1A 2HPUA 1SV0C 4UB4A 4DN0A 3H4BA 4NI2A 3VAFA 5A8WB 2E9ZA 1PGZA 3HKZD 2WF9A 3TZZA 4UW2A 2E5GA 3AFGA 2P1JA 3EE8A 3MXIA 2UVVA 5JS2A 2MZSA 5AJ3F 2E2PA 1GMWA 3V2UC 4QW9A 2PKEA 3B0YA 5A2QO 4I69A 4K2JA 4DUZF 1WAFA 5JMVA 1LXJA 4KO0B 3NVWA 1PC5A 3BYRA 5AQPA 3QUTA 4OPJA 2ZM6F 2W8LA 1YF5L 2HVDA 4M63A 2LXFA 1RBRA 3FR0A 1V5VA 3C21A 4TQSA 3ETMA 4A8WA 5KFNA 4CGFA 4F2RA 1HMVB 5HMYA 1WHVA 2DHSA 2MRLA 1IKYA 2JFDA 3OBWA 2ATCB 1RDAA 3AODA 2ASDA 1Y5LB 4MLEA 4R0JA 2XBPA 4E1JA 2FGOA 3CJRA 5IC4B 4LQ3A 2G8VA 4AL7A 4KH5A 4DV7K 4OZ0A 4DQRA 4HHTA 3TYTA 2KH9A 3CCEN 3VQ9A 1KKHA 2VG5B 4TUPA 4CBXA 1XI1A 5DGAA 4FPIA 3DI6A 3PEHA 4ZCLA 1RDDA 3I0RA 5IIJA 4Y2UA 2PMHA 3NGUA 1RWWB 4JV5F 4DTJA 2VC0A 3H1QA 3CP8A 3AA2A 5ALDA 4FVUA 3IBPA 1HNIA 4C23A 1U4BA 4P0PA 4QZBA 3M6XA 5AKZA 2OZSA 4RQ7A 2MU2A 3DDHA 3AM9A 3OLBA 1RHRB 3CDWA 2ZH5A 5AQGA 1IXKA 4Z7CA 3A3NB 5J2IA 4YOWA 3H7IA 2F9WA 2V6AA 1X9JA 5ETNA 2ZNZA 2KG5A 3PKMA 1SCJB 3MMBB 2GA7A 5D4PA 1Q18A 1KRPA 5IINA 4B1WB 3EY1A 2WFBA 3TAMA 2OELA 4E7IA 5F8JA 2X3DA 4NXMK 8ICJA 2Z1JA 3LDAA 2WVCA 1VQYA 3UE5A 2OKQA 3TO8A 5CRXA 3VTIA 5EXWA 3W3SA 3MTKA 3D6FB 4OYXA 3H3OB 1I1GA 1CLQA 2FVRA 2DHHA 4F3QA 4OV6A 2J4RA 4DTNA 2JRZA 4P2SA 4AXJA 2ZG6A 5KFOA 4NLVA 4JI4J 3H0RB 4EZ6A 4DCOB 3GLJA 4KY3A 3T41A 4M04A 4F7VA 2KG1A 4QZ8A 2IYIA 2X1AA 4M6WA 4FFDA 9ICAA 3DGPA 4O23A 3GPAA 2WSCC 1NGAA 2RHQB 2DVIA 4JI8J 1N88A 3AJ2A 2PA8D 2OO4A 3NGDA 4CF9A 4RU2A 2XG8A 5G0RA 5HQMA 4KT0C 1HBMB 5HN0A 3WXMB 2R2UA 4CYUA 8ICOA 1SL1A 3SD7A 2QB1A 4WKYA 2AYBA 3Q0AA 1RAJA 3DRRB 5M1FA 2ZF5O 2HIYA 5DLFA 1S57A 1ZC6A 3KJFB 1VK3A 4YB1P 5LMNK 2BGWA 3IWLA 3KLHB 1T3QA 4M7XA 3PJWA 3QPIA 4ZCKA 3CE8A 5DDQC 2G08A 4KE5A 3VQPA 4OIXA 2O66A 2QFJA 4CI0B 5CD4A 1C4CA 2OZMA 5GAGP 5B8HA 5J0TA 2B6AB 3N9UC 2QYCA 2IHR1 2GLEA 2SXLA 1NLKL 2XMMA 2KXNB 1X0FA 2DR8A 2GCFA 2RU3A 1OWXA 4TLQA 3IR6B 4DUYF 5CR4A 3T1HK 2ZDPA 2W8KA 2KU7A 4CHNA 3PKYA 4CH0S 1GOAA 3H7HB 2F63A 3W3DA 2V2KA 4F50A 1WBDA 2B7CB 2BKEA 1S1VB 3RF9A 3TWZA 1TUUA 3OTBA 1FDBA 1KAYA 4FYXB 5J2NA 2XTJP 5IT9Y 4DQSA 3QB0A 5BYRA 3QT6A 4XRHA 3WIVA 2XY6A 5J2FA 2U1AA 2ADCA 5LMUK 1YSJA 9ICSA 5L8RC 4J2EA 3QIOA 3CWJA 4EUVA 4BHQA 5KGWA 4J8FA 5EE1A 4L6V3 3MN9A 1OPZA 2FJBB 1U26A 3M1VA 3KKSA 1A0OB 5F8NA 4FF4A 4MO5A 5J1EA 3RBZA 2G4BA 3ZC4A 3HKZC 2PFPA 1HNXF 4ZPAA 2ALZA 1KXPA 5IWAJ 1VDHA 1LW2B 4XH5A 4DR2K 2HGNA 1M1HA 3T5LA 2G2YA 1EXNA 3F0NA 4IQTA 1O51A 2VQEK 1WBBA 3EZWA 4IO9L 3V6KA 3CJ3A 2HMIA 3I55N 4G6VB 3OYBA 3G82A 1QQ5A 1WC4A 4NJ8A 2P5GA 3O6WA 4M63C 4DHYA 2W25A 4TKTA 2CDQA 1GXUA 5ALLA 4JKHA 2IRUA 3LPTA 4KLGA 3JSBA 4XTTA 1XMQJ 4Y2IA 2UZAA 2KRRA 3FMBA 4XK8C 3QXGA 4BREA 3OHBA 1EWRA 5ALRA 2AJ4A 3MR5A 4YMOA 4F0HA 2FPKA 2GVDA 3TAPA 5AQYA 3BP8A 2D69A 1LWEB 3CMAN 2Q6CA 2VB6A 3M1FA 5EVZA 1WEYA 1ZD2P 2Y0SF 1TUYA 5J2EA 4UOGA 3DDIA 1H38A 4ZH4A 4CJPA 4W5OA 9ICUA 3OYLA 4DV5K 3SQGA 3UM9A 3NOGA 2KI2A 1RCHA 3GFXA 2UUCF 1UW4A 2JLGA 1B99A 4OLAA 1ZM2A 4PL1A 1ZQHA 1HYSB 2BJ9A 4B3MJ 3CJ8A 5KT2A 2HQGA 4CNYA 2E88A 3QEBZ 3HPOA 3FBCA 3U6FA 1T9TA 3BS9A 1V4TA 4YOTA 3OVSA 3PX6A 1CXQA 2EC2A 5AKKA 2IS3A 2R7QA 1VK0A 1Q82T 1N8RT 4ZN3A 2G13A 3P4UB 5BR8J 2NRRA 5BR8K 1UFKA 1V6HA 3E2EA 4NLTA 5MAOA 4DR3J 5KG1A 2ZHBA 1FI4A 4OV1A 1JXLA 3ZCMA 3SDEB 4DR1J 1ZQXA 4DX6A 3MFIA 2D1KA 1C2PA 2OH2A 4JI0K 2IOFA 4F4ZA 4IFEA 4IFVB 1YJNN 3CCZA 4CK3A 2FJXA 1Q8LA 8ICWA 2HFOA 3PJXA 1IBCB 3BR9A 2IY5B 3PV8A 3LOUA 1RILA 3NHGA 4NXMF 3HD1A 1TKXA 5CZXA 3GONA 3G8QA 4KLMA 1QZ6A 3B6OA 5AR0A 4Y2VA 7AT1B 4FF2A 1JL1A 3MN5A 4FK2A 5KFRA 2JMGA 5EE0A 4OGCA 1YJ9S 4O5BA 4EO6A 3LVVA 4J9PA 4FNIA 1DURA 3CCSS 4CZGA 2OPQB 4H5VA 1HJPA 3BF4A 1ICEB 3GE9A 2NRTA 2CQ3A 3HOTA 2WF6A 1XSLA 3OD2A 2W43A 5AQXA 3ZSZA 3W2WA 1WSGA 3QEVA 4RBVA 1B70B 4I4BA 1XMOK 2QMXA 3C6UB 7ICFA 1XC9A 3KD3A 2G0JA 3BGLA 1XC3A 2GJFA 3CETA 1HUOA 4AHSA 4UAVA 1SV5B 3MM6B 2O8BA 2FVCA 2JZBA 2QARA 1R0AB 4ZN1A 2R7SA 2GJIA 1R27B 2K4IA 4KX5A 4Y28C 4RU9A 1MROB 3TAFA 3SQ2A 4DV7F 4BDZA 3Q23A 2EDUA 5EHHA 4RNFA 1RDBA 5HAOA 4JD2A 2AU0A 4WYBA 5AT1B 2KKZA 1F5BA 3KZIU 4OI4A 1DHMA 2DEIA 3ILLA 1S99A 2DFFA 4B8CA 1LOUA 4P7VA 4DCJB 4JKDA 2J9CA 2F40A 4H4MA 1VQ8S 2E3TA 5F41A 1WNEA 2W2QP 3V72A 1EX8A 1SWWA 3CJTA 5JUMA 1LFWA 1SJ1A 1HPMA 1NZPA 3HCXA 2CJXB 4DTPA 1TV9A 1CQNA 4YD2A 4OYBA 4BS2A 5GMKa 2I2YA 2O3DA 4LR7A 3A1YG 3VC8A 4RCHA 3BH6B 3Q2SC 1ZQZA 5HQLA 4CGHA 4DR1K 4AD6A 1M5VC 3PRDA 4EMDA 3W0LA 2ITMA 3RJMB 3KKFA 2XULA 5B0AA 4C9DA 3A0HU 3IRXA 2A42A 2MKJA 1WOQA 3THXB 1BD6A 3QWUA 2K8BB 2XMUA 4DV6J 3IC1A 3DLHA 4DWIA 1DQAA 3MZIA 1RM6C 4MFFA 5HL7L 1NGFA 2O5DA 3UCZP 3ZDDA 4JKGB 2IM3A 3DOLB 2PN6A 2V2VA 2R2RA 4NRTA 1GO3F 4ZVTB 3C2PA 1ZD5A 4DCHA 4NL9A 3PLAA 4B9TA 4ECZA 1LB2B 2QYGA 1S0MA 4ZCMA 4M9LA 1S72N 4R63A 3BO4A 2FHJD 4DR5F 4LSLA 3NFAA 2J5AA 3AT1B 4RQNA 3HJVA 3ZSWA 2H3FA 3E01B 4DG1A 3THXA 3JAMU 5HLFA 3BF1A 5GADU 3FCHA 3SAHA 2VDIA 1Z2ZA 3C14B 4LRBA 2JZ5A 4F4AA 3GJQB 1JKHB 1JRPA 5E2QA 1PUZA 3Q24A 4OZLA 4ETXA 3TUPA 4AT1B 5CYQA 2FMPA 5ETMA 1XNRF 1WHXA 1S9GB 3G10A 5AKIA 1DAXA 2PDAA 4NLPA 5I3UA 1HHQA 4DV1F 4K4YA 1RACB 3A3OB 5FDLA 2A0FB 1EQ0A 3U1LA 4B3SF 3UKUA 5HSPA 1ZQVA 5HBMB 1SC4B 1JLCB 3C6AA 2XC9A 1VSKA 1KC8O 4US8A 4ISEA 1VOMA 3HP9A 3M8ZA 1GXLA 2ZJPQ 4NA2A 2LDIA 4DR7J 5KT6A 2F8LA 5CB1A 2C3OA 1IV8A 1IN0A 2QWOA 4F0KA 3H0PA 1RT6B 1UKUA 4QIWD 1C1CB 5AQLA 4JEPA 4FO6A 4ZA1A 4K43A 3I9V9 5HO4A 2K7JA 5L1IA 1FFWB 2BPFA 1R43A 1W2IA 4HI1A 4J37A 2OXOA 5CY4A 2YWWA 4MK7A 2NXNA 3SAFA 3BF3A 4H5NA 3KLFA 2AMCB 1MWKA 1S4EA 2K06A 3Q8VA 3K5MA 3CO0P 1UJ5A 4LBIA 4OPKA 2EK1A 4NCGB 2P6RA 5B0BA 3CCWA 4CM0A 1RTJB 1S1WA 4QYRA 3RJIA 4Z94A 3RSEB 4JI1F 1K9MT 4MLHA 1AXQA 3WUHA 4CJLA 2A6OA 2ATLA 4EFAC 3WK6A 2E8MA 1N6QA 1N8RO 4FPBA 1RT5A 1HNZK 4FKYA 5F3TA 3UW1A 3CDBA 2Y3YA 4EBCA 4NXMJ 2KLAA 3KG1A 5KG2A 1VSLA 3CCMN 4DSIA 1U2RA 3FYHA 4K4HA 3WNHA 4RZRA 2OAUA 4YOVA 5KT5A 4DR4F 1RZMA 4P4OA 1L5UA 3IMQJ 5JMNA 1UVNA 4P4MA 4WYWA 2VL1A 2HI0A 3O1WA 3T1YK 2C2KB 1WI8A 1H72C 1X5SA 1ZBLA 4IFVA 4KLOA 1VR6A 2GQ2A 4KH1B 3CJ4A 3MPWA 4O44A 1ASWA 4WE1A 3HFKA 4LRAA 1JCEA 3T69A 4HKQA 3MEGA 4CJFA 2FBTA 3QLHA 3BB5A 2H4WB 4KLSA 1ACMB 1OQ3A 1CI4A 3O3LA 2YVSA 4JI8K 5KG4A 2IIRA 2BE9B 3TUIC 1NJIO 4JRQA 1WI6A 4ITSA 3T5JA 1FRXA 1FXDA 1DXSA 2BDUA 3VQBA 1EQYA 2RKIB 4B3OB 4IOXA 1S6OA 5BOMA 2G1HA 4OMFG 3ZX3A 2AEJA 1WORA 3VETA 3EVWA 3N97B 3HSZA 2VBWA 1RWXB 1ZQKA 3M8PB 4ANCA 4P0QA 3FFKB 4FF3A 4IOAQ 2MLXA 1BWFO 2CQ0A 4WQ5A 2M8HA 7ICEA 2AGPA 3ZT4A 3D0HE 1EXQA 4MF8A 1WF1A 3QU2A 3ONNA 2LKYA 5BXIA 5AI4A 4JI7F 2OGUA 3O4WA 3MCAB 2EFNA 1VQKS 4I2AA 5B0FA 4MFAA 3NNHA 4CO4A 3MDAA 3DXKA 2JGAA 2DNMA 3BS5B 1NSAA 4I2JA 2FBYA 5J0QA 3KUHA 1VSMA 1RXVA 3TVYA 3IA0A 1ASUA 4OJ3A 2XMTA 4MDBA 1L7OA 1HHSA 3R7SB 3MFHA 4FPRA 4LJMA 1RADB 5K14A 3AVLA 1RT4B 5F0WA 2KTQA 3KMSA 1QVFM 2B7BB 4ISFA 1HNZJ 2WTUA 3DMJA 5IWAF 3TJ8A 5J1NA 4RUCA 3A0IX 3CJKA 1HKBA 4ZJOA 4FM0A 2QLBB 2ASLA 5L1JA 3C1ZA 2ZC3A 4LF9F 3CD5A 1VHXA 4CT8A 1EP4A 1NBEB 3FRYA 4I7FB 4O3SA 5EDWA 4FJ7A 4QIGA 4B6JA 2QWLA 9RUBA 4L74A 3WK9A 2VIHA 1QE1B 5ETQA 4RR5A 1RT2A 5BRDA 2OANA 4M5LA 4CBUA 1TL7A 1RDCA 4J9LA 1RWMB 2YH1A 5B0GA 1RTDB 3M1VB 5KFQA 3OR2A 1JLFB 3KK2A 3EM1A 4TU7A 1SV5A 1ZQAA 2R8JA 3C16B 4I6MA 3F41A 2CWKA 4OI1A 1XO1A 4O9MA 2CA9A 7ICMA 4M1KA 1ASVA 4OJ6A 2ASOA 3GDQA 2OPSA 5CXTA 3RRHA 4Q8FA 1FKAF 5IV3A 3QO9A 4Q45A 1ZQBA 4ID5A 2CJBA 1SQFA 4WXOA 2PFOA 3TKAA 4R8UA 2E1MC 4B3RJ 3FM9A 3V81B 3H0LB 8ICSA 2ZIUA 2V67A 2RE2A 4DSKA 4FJNA 3M32A 3H5UA 4NRUA 4K0KF 4LF5J 1HBUA 4BRIA 2HHSA 2OMLA 3WX8A 2W9AA 5DJBA 3C0BA 4N7TA 3R1LA 4PWWA 3KOAA 3E3XA 4RW8B 4FZXC 4HDHA 2ZXHA 1F3VA 3BGFA 1N5WA 4ATNA 3H90A 1RI7A 2QWNA 1O0PA 2HVEA 2UUAK 8ICXA 1EHWA 2H5XA 1HBOA 2NYHA 4QWDA 3VGVA 2ZTEA 3FK4A 2KM8B 3JYTB 3C65A 4QR2A 4G3IA 3IR5B 3QT5A 1APSA 3PSTA 3MMCA 4CJQA 1TK8A 3WKBA 1ZH5A 2D0PA 5KFCA 4FF1A 3J81Y 5D8HB 4IOAL 2RF2A 1BMQB 4A8XA 3TADC 2F65A 2VICA 1UVMA 1NGCA 2BJDA 5J0SA 2HOFA 3WKDA 3SUOA 3L7UA 3CFRA 9ATCB 2HQDA 1ZZFA 1UWBA 3AXKA 3QNOA 4IG3A 3ISDA 5AK6A 2OM6A 3R6MA 3CQYA 4W5QA 3TJAA 2CPHA 4C48A 1HI0P 4HUEA 7ICKA 1U0HB 2P9LA 1VQLN 3QEAZ 5IIOA 3KHLA 2FJAB 4AILC 1AA1B 5AFUA 2MEWA 3OYEA 2EH9A 1Y5NB 9ICWA 3CCJN 2J7UA 1HQUB 2O8FA 5CCMA 2B21A 1ZQSA 3ULHA 1NU4A 4KN4A 3IGVA 1KL9A 1ZBUA 3ZZPA 4ZITA 3FEZA 2CH6A 4C8ZA 1FF2A 5IC6B 3BREA 1XERA 2Y1JA 1FKPB 3TVZA 4JKEA 4NV0A 3HX0A 2W9BA 3HHLB 4P6QA 4WP3A 3QU7A 1DEJA 2LQJA 3VQ7A 4GC7A 3G6YA 2OPSB 1X5TA 4Z4CA 2XICA 2XI2A 1TL3B 4X4UA 3M7VA 4CDGA 5JVHL 2W2OP 2Y9UA 3V9WA 1KDNA 4CD3A 1O03A 4JKFA 3UPQA 4M0AA 3ENAA 4CLTA 1E6VB 2VONA 2Q3SA 1C6VA 4KH4A 3VQEA 5KQDA 2DGZA 4F36A 1VQ8N 2ESEA 3DLKB 4TNOA 2VG6A 3OUYA 3VGKA 3FZHA 1S6PB 2RAQA 4CZKA 4M8LA 4M5HA 1RE1B 3VA0A 3LGHA 1RT3A 1V9PA 2F1IA 4DO9A 1YJRA 5FROA 5KG3A 3WHIA 2D0CA 2P9IA 3F53A 1LCUA 4DI6A 2VQFJ 4M5JA 3TA1A 1F21A 2NXEA 4RNNA 3AA9A 2ZIXB 1LV5A 4LZGA 1VQ6S 3FBEA 2R7TA 2KEYA 1WSFA 4PCQA 1S7IA 5HVGA 5ADZA 3PHEA 1ED1A 1C0UB 2FC8A 3D1HA 5AQUA 4RQ3A 3SSRA 2O8DA 4YD1A 3JSYA 3U3YA 2UV8A 5DB8A 1KNZA 2HHVA 4IRCA 3OR1B 1JLEA 2RRDA 2ILYA 3W5ZA 4M5KA 1HR0K 2QXLA 1JLAB 3LDSA 2RUGA 4UB8U 1TL1B 3TQEA 4A59A 4RLEA 3K9KA 3LF0A 1NPKA 4O3QA 3CCSN 3NVVA 1BQMA 2PMWA 3HVWA 3CJ5A 1UMJA 4P75A 4DR7F 2BOAA 1NGDA 3V7JA 3ISZA 3NMUA 3D1QA 4YDUA 2BKNA 4DJBA 4ZP6A 5LXYA 3PVXA 4PQAA 5AM2A 2PE8A 1KSPA 1NDCA 3VOVA 2QKQA 1YJWS 4C2MA 4LQ9A 5HMZA 4ER8A 1REGX 5AZIA 3EGWB 1C0FA 4GIBA 3GFYA 3Q8KA 3AJDA 4RNMA 5F8IA 1H0HB 3MXJA 1JALA 3VEWA 1UVKA 2DPJA 5A0LA 3I31A 5IQ6A 1FRIA 4LR9A 4PYAA 4UB3A 5IT0A 3J7ZT 3DGPB 4UZBA 1TUGB 4QS8A 5L39A 2E1CA 3SI6A 3HZ6A 2X1BA 3Q8RB 1SL2A 7ICTA 1VJQA 2DCUB 2HBZB 2QWPA 4I2CA 3BZQA 4P2HA 4DQQA 3AL0B 1HKCA 2WBNA 2DIUA 2V94A 3SIPB 1FJ7A 5I4MA 2E4LA 4K4ZA 4ZP7A 2I6XA 3QESA 2GFFA 2CQPA 2G0CA 5SUHA 1Q46A 4OJLA 1VRTB 1R89A 5C5JA 1CG2A 1R8HA 1Z00B 2B8QA 4G65A 4PZOA 2WFAA 1CZBA 1NJWA 4BRLA 3VF4A 1BHLA 5GTIU 4BC5A 3D0GE 2FJ6A 1ZPWX 2ZFHA 3M8SA 3TWHA 1H2UX 2KHDA 3TA2A 2JRSA 3H98A 5D4NA 2ZGZA 2GIRA 5SWMA 5GTHU 5KFGA 3MHYA 5DLGA 2JEIA 2WW4A 3OFFA 5CYJA 3EXYA 1E4FT 3MMBA 5AK4A 4CIFA 3PSPA 5HMMA 1O6XA 1CS4B 1DLOB 5CD4H 1YJUA 2E8NA 1OH8A 2IHNA 2D9PA 1BO5O 4OZ2A 2GIQA 2DNOA 3M3ZA 2V4RA 4DS4A 1T6CA 3I82A 2DY4A 4DUZJ 1IJEB 2ZUDA 2E29A 2ZOMA 3KLGB 4JI6K 3D0PA 3NAIA 5H1SQ 3CCUN 3QERA 2BANA 3NGYA 4MIBA 5BYSA 5D3GA 3KLEB 9ICRA 4Z0UA 2QLXA 3DJCA 2HOIA 4WFZA 1ZOTA 1Q81T 1UHUA 3VQ8A 3OTQA 4LFCF 1RU2A 3GZFA 5DDYA 4DU7A 1I6JA 1U1NA 2MGZB 1HNVA 3VEXA 1F5AA 4DX7A 3GSDA 3M8QB 2ZNYA 2J8AA 4HACA 4DR4K 1KCFA 1SB6A 3KZBA 3SXLA 1Q81O 2CQ2A 4B3RK 4C0ZA 4YMNA 2DFLA 3MCNA 4RW9B 3KJVA 3U4LA 4AE5A 1BUXA 3NS1A 2MKKA 1N5YB 1XNRK 1FX2A 2O8FB 3GG4A 3M2VA 1UCVA 4IFYA 4DV0K 1W26A 3TACB 1WHWA 2PMZC 2FE9A 4O5CA 5IOLA 3KIOA 1PK1B 1T9WA 1NRKA 4LVOP 4ZPWR 4C0BA 1OJ4A 2BW7A 2CQBA 1S0OA 2Y8WA 2BTFA 4DR7K 2FC9A 2WK4A 4M3WA 2AJ0A 3QEPA 2PYJA 2H5JB 4KAZA 4OGEA 4DR6J 1KVJA 3WXIA 2VYPA 1B64A 1UW9A 1MQ3A 4NYFA 1S9EA 3LP0B 2WOMA 5AQQA 5AM0A 1CVJA 1NSKL 5D15A 2WAQD 1JNRB 4X4SA 3VHQA 4H54A 5AQSA 3L2QA 3HXMA 1HJOA 4DQPA 3MGHA 2V4JA 3GYNA 3DDNA 1J27A 1L3TA 4F5QA 3L3CA 3WXJA 2XZDB 2FBVA 4GLXA 5KNIA 4GXKA 1OYEA 2Q0UA 4BR5A 1Z2LA 4Y2TA 1NGBA 1SWVA 5EX0A 4KLEA 4BY9C 3M2UB 4PKGA 1FFUA 3J7Z5 3TA0A 3HJEA 2EFQA 2V63A 1JJ4A 1F5SA 1IKVB 1Q5YA 3G25A 5AQJA 1RAIB 2DR7A 4K42A 4FWPA 1Y9OA 2BOPA 2NS1B 3FC9A 3CCVS 4RJVA 4A57A 1JCFA 3M32B 2MJUA 3PZPA 1KBRA 5C2DA 2RP5A 1FEEA 2ZWPA 3NGTA 3N7SC 3OY9A 2KZMA 4F02A 2HNZA 4PKIA 3A8EA 4O55A 2WONB 4RO0A 5CHCB 4PQUA 3MCMA 2UYTA 2MYFA 5CWRA 1B7FA 3AGKA 3VEVA 1UQVA 2YKNB 3BZKA 2PFNA 1CC8A 2NLXA 2G09A 1NHKL 3F73A 4TYAA 4OX9J 1VBKA 2EC0A 3Q7BA 3ET6B 3ALRA 3SCKE 3EE3A 4FZLA 1NDPA 4YDUC 4FZYA 4UZCA 2OEHA 2E44A 1FFGB 2V9WA 1BA0A 4GXIA 1VSDA 1JLFA 4CF2A 3AQOA 3CMQA 4X4VA 5KI6A 3A5MC 3GWCA 2E1RA 1ZBTA 1LEOA 4BC2A 5DM7L 3LL3A 4PABA 3C94A 2RLTA 1DOQA 4QWEA 2HSTA 4BC3A 5J2GA 5D0GA 2Z1HA 3LP0A 4LJXA 5JTIA 3MDQA 2QI2A 4ELTA 2NYVA 2FJVA 3DLKA 2YNFB 4RWXA 1OQ6A 3P49B 2YKAA 2NREA 2NQPA 4RW6A 5KFUA 2D0OA 2VWJA 5HMLA 1QTMA 3LO3A 2NZCA 3LDQA 1WC5A 1RXWA 2LDYA 6FDRA 1HQEB 3ETOA 3NLCA 4Q2LA 3MD3A 3TJ9A 2HZCA 1ZQLA 5A8RB 4GMKA 2CJ9A 1JJ2M 5HNKA 4RWTA 2MY8A 2UVRA 1GTHA 2Q1LA 2G8KA 2GQCA 5GMEA 5E79U 4GO7X 5AXLA 4NL5A 4DPWA 3CMAS 5AKXA 2IM0A 4NLGA 1DT9A 1S76D 1N32K 1XU4A 2LMRA 4RT2A 2R18A 3ADAC 1DTQA 1OSCA 1HR0J 4E3SA 5FPMA 4WQ4A 1WF2A 5KFWA 4JRPA 4QWAA 1R8CA 3LGMA 1KEKA 2YMPA 1XNRJ 1WSJA 1ZQUA 4WFBQ 4DL5A 1XBWA 1BCMA 4LF5K 2CQHA 9ICXA 3NVKA 2KFZA 2Q2RA 9ICVA 2YH0A 1UP1A 3M8RA 1ZA2B 3S6EA 1TELA 5JXSA 4F0MA 4PPDA 4OFZA 3FAHA 1C1BA 4V1Ak 2C2EA 5IWAK 1SUQB 2N3LA 3PO4A 4QS7A 3ZTQA 1GH8A 4IG3B 4B3MK 1C0TA 1NK9A 5AQHA 4F26A 4GVLA 2ZD1A 1FNMA 4ICLB 3UI3A 4EEKA 2BYCA 2P9SB 3NAHA 4FZMA 1YLXA 2ZHOA 4QOZB 3MURP 3KHHA 1S77D 3NCPA 3FE1A 2VBYA 3GL1A 4PR6A 3SI8A 3E58A 1QD1A 3D45A 2RJZA 4FYDA 2F8MA 3BM7A 2YY3A 1F0MA 5FPEA 3O5BA 2DNKA 3CO9A 3CC4N 3CCQN 2Y0BB 2LEAA 2Z1GA 5KOWA 2IVPA 4BVPA 4QZAA 3GIJA 4WIQA 1TAUA 3PIPL 2W2NP 3R9LA 3F2BA 2ZOFA 3JS9A 3UXPA 4USUA 3J81j 4MFBB 4OPHA 1FRJA 1Q86O 4I2HA 5HRRA 1X66A 1WC6A 3NS5A 4EI2A 1FDAA 1BPDA 1U0SA 1CJVB 4E7JA 4ALZA 4NLRA 1FKOB 3D9BA 1SI9A 1WOOA 2CNNB 3IAYA 3AA3A 2BE2B 9ICBA 3QBWA 1K44A 2GV1A 2ASYA 2KG0A 3K57A 1N34F 1Q16B 2FD2A 4Z4EA 4UAZA 3LPUA 1RWUA 4CQ1A 3CERA 3SMZA 1LWCA 2V4QA 4HACB 4K4IA 1WC0A 2A1JB 1VQ6N 3V6JA 1N61A 4US9A 4URQU 2V69A 4R25A 4CJ5A 4C4RA 3C5FA 4IQWA 3PYGA 5BPLA 1SJ4P 3VAJA 3FLCO 3PSIA 2NPIA 1LFPA 9ICGA 2GC8A 4C11B 2LEBA 3DKDA 5KFKA 3RW7A 3FCWA 2EQYA 1NPPA 3VMFB 5IIIA 4EELA 2B43A 4ZLNA 1T6DA 3FC4A 4DR3K 1ZQPA 2XGQA 2QGFB 1UT8A 4Z4FA 4J9VA 4ZVRB 1A5VA 5DZ7A 2ZVIA 3A5NC 2D8CA 5KAIU 3D54A 1JCGA 2DEJA 2W55A 4ZVFA 3UMBA 1BGXT 1A7GE 1FWLA 2BKOA 2IHMA 1PYSB 1P90A 1U1KA 5E7OB 4BR9A 2PFUA 2DK2A 1GLCG 2OP5A 1VC6A 3IWXA 1ZQGA 4F2SA 4IH6A 4AHUA 2IYGA 2VKRA 4XDCA 3TANA 1SZ2A 3BQTA 3OBYA 2OUGA 3Q8PB 4MFBA 4FP9A 4BWMA 1NAQA 2V51B 4JHDB 4JI5J 4M3UA 2MUTA 4DU8A 2WSFC 1WN7A 3UR0A 3LPYA 2C3YA 5ALHA 4YY3F 4IC9A 2OSRA 1WKLA 2RRBA 1YJTA 3LPEA 2G06A 1X5PA 4QPTA 4X4PA 1Q7LB 1R6YA 1DJ0A 2YJFA 5KTQA 3TAGA 3C2KA 3JTOA 1A0PA 3L2UA 2CRXA 1S0NA 2XWYA 2ZBCA 1T11A 1B3TA 4ECXA 1BU6O 4C11A 4WYLA 1SIJA 4J9OA 2C2DA 2ROEA 5LSRA 4OX8A 4KHRA 2VG7A 1IM4A 1B7YB 2L5YA 4DUYK 2BZ2A 4ZVQB 1VQPS 5ALSA 3JS6A 1B4SA 5DM7Q 2ZUAA 5KFTA 3AD7C 1ZQQA 1PKUA 1X7VA 2K8CB 3U9ZA 2Z30B 3W65A 4BRPA 3MECA 4DOCA 2MSTA 3L3VA 5AXKA 2HAFA 4UB5A 1XHXA 3NBPA 3OL9A 1KHVA 2FSKA 4B3TK 2GMLA 1VQNS 3N5FA 2WVDA 4HTJA 1PJ7A 2ATQA 2K3KA 1J97A 4DXLA 2R2SA 1ZZNA 3Q7CA 3GP9A 3NKYA 3VERA 2O8EA 2P51A 1S4FA 3IFEA 5AXNA 1RWPB 1D8LA 1RYRA 4NLYA 1ZBHA 2QSFA 3VGLA 1YX2A 3RMBA 4DZDA 5F3ZA 1WUAA 3QT7A 2DISA 2CVIA 3QSIA 3OYCA 3NF6A 4LFBK 1JN3A 3ID8A 2KHQA 2MQ8A 1KFDA 2CQGA 3HLUA 4JI0J 3M8YA 2APOA 2HBYB 2XSFA 2DPIA 3EWAA 5U47A 1SBRA 3CD0A 2XMAA 1J54A 4NA3A 4JHDA 2XM3A 1RTHA 2YQEA 1G4CA 4ANDA 3NS7B 1TKDA 3R5AA 3KVGA 2PEHA 3GJRB 4DUYJ 1UA0A 2I5HA 4IQMA 5D6GA 4LSNA 5KFDA 2NLWA 1LKYB 2HWIA 5DKWA 5FJ4A 2VPZB 2DD8S 1RU1A 2P2CB 3AB4B 3BKTA 3P31A 3A13A 4DL0C 1HQ2A 3BSCA 5IT4A 4PPXA 3DFEA 3LP3A 3CJQA 5CYMA 3O9TA 1GFWB 5LJ5Y 3L95X 2XVTA 2IIHA 1J2VA 2R2TA 1NKBA 2IA0A 3RW6A 1VIOA 4KRFA 5KT4A 4X4RA 3SEIA 4KLTA 2FZGB 4B1VA 3QIDA 2OSQA 4JI2K 3C6UA 3FDSA 3K7RA 4FXVA 2ASPA 3D28A 2HBKA 1B0VA 3UIQA 1HNXJ 4DV2J 4X66K 2EWHA 5H2FU 2YWKA 3TRGA 2OPQA 4TSXA 5L9NA 4ZJQA 4AM6A 1KQSR 4L73A 5KFLA 2F4VK 5K4LA 1VQ9N 2E1FA 1QAXA 1WHYA 4PKDB 4KYZA 3UB5A 3V4IA 4HCCA 3CXCM 3CPWM 4MF2A 4Q7AA 2FVPA 2N4DA 4A47A 4U95A 1HQUA 2W7OA 1SL0A 4X5VA 4YQWA 2JC1A 3TFRA 1OVQA 1ZQMA 2CADA 4YEAA 4DV0J 2Z2YB 2QM1A 1FTRA 2GW8A 2HHTA 1TV6B 4DL6A 3UQSA 3H6EA 2M3DA 1S72S 1VSEA 2KICA 1Z00A 5GAGI 1N32F 2YNFA 4DPXA 3MCOA 3CGIA 3UFCX 3DLEA 1K73O 4KH6A 3N7RC 3C15B 1UFLA 2VFRA 3BGOP 5JLHA 1X6JA 3W66A 4RTFD 2IAJB 5J2DA 4GO5X 4URSA 1RBVA 4J2BA 7ICGA 5HVFA 4UOHA 2YMQA 3PIOL 2XYHB 2PXIA 1RWVB 3ZT1A 1V5IB 2OTJN 1NSQA 1URJA 1XMBA 4HHJA 1ATSA 2FZKB 2HS0A 2DUYA 3L2RA 3L4BC 1C1AA 4MYTA 5LM7E 2ZIVA 3SAGA 2EKYA 4Z6DA 1BISA 1CUKA 3H8YA 5AZIB 3RRGA 2WAQF 2ZJ5A 4FW2A 1SXLA 2QMUB 1H7WA 4NPOA 1S9EB 3MM9A 7FDRA 2QWQA 3C15A 3HM8A 3ITHB 3AO4A 4DL2A 3KNAA 1KOHA 1U04A 2VODA 3NF9A 2BX6A 1NGIA 5A8KB 2NRWA 4OZ5A 3AO1A 1U1OA 4Z7YA 3K2YA 3U9DA 5BRFA 1CPZA 1NHUA 1VGYA 1LK5A 4GVBB 4KB0A 2WTFA 3VENA 1TKZA 4BROA 4BACA 2E7XA 1K73T 1DRZA 2OCEA 2EKNA 1AZSA 3N28A 1PYTA 4KLJA 1RGVA 4FWMA 4I0WA 2DGSA 3P4IA 2DXFA 4LF1A 1QQOA 5EGYA 1GOCA 2AJ1A 2RRAA 2Y9HA 1FT8A 2H65B 1MU2B 2Q79A 3THYA 3RJEA 4OX9K 1GTEA 2EBGA 4B3OA 3GFHA 3ZZRA 2X6SA 3OSPA 4NLDA 4XDDA 1TP7A 4DSEA 3FQLA 2XB2D 1GX5A 4OLPA 1FA0A 2WB1D 4WFBL 5ALUA 2KIVA 4OJOA 2C3MA 4E8UA 2K4EA 3OVAA 1R6VA 1RDWX 2HZVA 4NM2A 1SH0A 3W63A 4F8RA 2J76E 4W5NA 1AFJA 2HG4A 2HRUA 3RBEA 4CGJA 3U1NA 2CFXA 2KM8C 3CJCA 3MWPA 1FIQA 4KGKA 2RDIA 3JSMB 3KKRA 3TNVA 2QC3A 4XEIA 3N01A 5M2PA 3OSNA 4CJTA 3RB4A 3JSMA 1MROA 4A8EA 2HFSA 4A2BA 2VBZA 4XH1A 3P3DA 3FGVA 1AB8A 2J6UA 4FS1A 4ELUA 4ZVHA 4KFBB 4CF8A 2Z0GA 1HL6A 1JXEA 3QRQA 2F8EX 1Z1VA 2RQ4A 1CJUB 2W1BA 2ZUCA 4DV3K 4Y1DA 4ZK7M 3SK3A 1WUUA 1X4BA 3P8BB 3V1QA 1YJNS 1KOOA 3FCVA 1KTVA 2DNLA 3HFZB 3NCIA 2P9KA 4LZDA 3H59A 4W92B 3FZLA 2J9DA 1OSDA 2F4VF 1Z6RA 4CFCA 4IJAA 4Q44A 4WXWA 3SMSA 1YHQS 4U67Q 3F5AA 1Z4OA 3HW8A 3JAMO 2NO4A 3EVMA 2UUCK 2WAQC 1T03A 3D2SA 2F9DA 9ICLA 5CCLA 4YG2A 2GVZB 1RBOB 2OEJA 3CCLS 5AI6A 4FK0A 1BOTO 2X1GA 4MYUA 4RKUC 2ABYA 4FJHA 3CF5L 2CG8A 2LKZA 2JC0A 4O8KA 5HR6A 3T19A 1WSHA 2ASMA 2YCHA 4NL9C 1BUPA 2AX1A 3JSRA 2H5EA 2ITGA 5AK3A 3QU9A 1BQMB 1DK2A 4OHXA 2V4JB 1YUWA 4DV4J 1N33J 2NRVA 3KD5E 3OYGA 3X3UA 1QJHA 3CDUA 2VZ9A 1N36K 4E7HA 2D3ZA 1T3OA 1NPRA 2ZC4A 4LIRA 4LREA 2H3VA 5KAFU 1N32J 1X40A 1WDTA 2OWOA 3D4JA 4H0VB 4LRDA 2NUHA 1CSJA 3TX0A 4A48A 5T14A 4UATA 2MSNA 3I76A 4KN7A 2B9WA 1SS6A 4P73A 2W3RA 4LFAK 2GOLA 1NK7A 2R7YA 2WZ1A 1ZQFA 4DG1B 2MZJA 1Q3VA 3CW2C 1P1LA 3IGNA 3C46A 2OPRB 2QLWA 1PK1A 3QJLA 5LMNF 5FLXO 4I6AA 3C6TB 4KFBA 4JK8A 3PUFA 3THTA 3EYZA 4FYYB 1KQQA 4DUTA 2VQFK 3V5RA 4EBEA 4X2BA 8ICYA 1A6SA 4F4WA 2CPIA 1G3OA 1YHQN 3QWPA 2QL5B 4H5WA 3MCSA 3EX7B 1Z4NA 1WKJA 3UDLA 1M5HA 3GR0A 5IM0B 3OGUA 5KOXA 1NK5A 2BM0A 4YN4A 1KS2A 2W6KA 4AYBC 1GMVA 1S8OA 2E5LJ 4R66A 1NGJA 1YJWN 2OTLN 3VQ6A 4PG4A 4RBUA 4X64F 2ZZNA 3VA3A 5CJ7A 1B0TA 2W9BB 3HHLA 2A1JA 1HD0A 2G07A 3B54A 4CEFA 2DKXA 2FI1A 4CEOA 1QQNA 3M8WA 3DOMA 1M5PC 1WC1A 1ZJNA 3FEYB 4DR4J 3EN9A 2CXYA 4DV1K 1N33F 4IR9A 2HK3A 1ZM4A 3LQVA 2G2OA 4OKEA 3P96A 1J5OA 2A1BA 2ZIXA 1VDVA 2GIFA 5CH7B 4GVBA 1KVCA 4KBOA 3FFIA 4U7BA 3VQTA 4OYZA 3NGZA 4EWTA 2Y1IA 2W9MA 1VSHA 4Q0BA 3EICA 1RLDA 3QFPA 3DMJB 1QHAA 3AN1A 3VZHA 1J5EK 2M4MA 5I3UB 1Z26A 4RPXA 4BXOA 4YORA 5ETOA 3MX2A 3GZ7A 1WF0A 3BGUA 3HJFA 1MW7A 2GHVC 4DL7A 3ZZTA 3JPTA 5FRNA 9ICJA 1FO4A 4ZVUB 1RTIB 4UQGA 3PX0A 4PA1A 3MM5A 1TMMA 3R6LB 1PBUA 3I4PA 2AJ2A 3L2VA 4B17A 3AOAA 4MKYA 4BGAA 1UZDA 3MR3A 1JX4A 4A4JA 3T5HA 2KP7A 5ETTA 4KGXB 3LWMA 2YKMB 3H25A 4WFNQ 1RAEB 3KJNB 5DG7A 2VPXB 2IM2A 2GO9A 5KFBA 2FHMA 4FWRA 3DHXA 2DGVA 4ANEA 1HBOB 1MN7A 1X2IA 1RZTA 5CZ2A 4FZNA 2BBEA 4N56A 1BC6A 3QFHA 3H8SA 2FJEB 1YWXA 4KHNA 3QGGA 2RH3A 3AQFA 1PZNA 1KKXA 4X62K 2ZKUA 4ZLPA 2BE2A 2AYGA 4CEDA 4LF8K 4BRKA 2RD5C 1RKJA 1RBSA 1L3UA 4O8UA 1BE4A 2KD1A 2Y1LB 2W24A 3QEXA 1BWVA 4NASA 2CNOB 1SIZA 3PYDA 2AEMA 2VJVA 1YVFA 2MQNA 3UD4P 3V6HA 2PI4A 4IXCA 2MZRA 3IR7B 5KGXA 1R7IA 2LA6A 1ZRMA 3D2FB 2G5IB 3L6QA 3HP6A 5DBBA 3UWTA 3M05A 1U47A 5FLXY 3FBBA 4JK7A 1L3KA 4GV9A 1UZHA 8ICTA 2MUTB 4FBTA 1VQLS 3VQAA 2DJWA 5GAEI 1HR0F 4ECRA 3RB6A 4ISGA 2HZAA 4I67A 2QTWA 5EX5A 2F4FA 3MN7A 4PEOA 1UFWA 3FSYA 3SMVA 8ICUA 4HT5A 3AU2A 2ZH7A 1RHUB 3KK3A 4FJJA 1RT3B 4Z4GA 3HRGA 4LF2A 1KR4A 1IBMF 5BYQA 1VISA 4NYZA 2E20A 3ZI4A 4CFAA 1J5EJ 1EX4A 2UP1A 1ATNA 4FW1A 2HOQA 2YNGA 3ZSQA 5CA7A 3N4PA 2RT3A 4KGZB 4A8MP 3QEWA 2ISOA 3GU0A 3FFIB 4BR2A 3FZKA 2L41A 5JICA 3TTDA 2HKEA 3R5DA 4NA1A 3WKCA 1LWFB 1WG8A 2D3OR 5HJXA 3MX5A 4Z4HA 4CF4A 4AHTA 1N34J 4Y2KA 2CPDA 1JL2A 4JMUA 1NMNA 2HBLA 4CHYA 1EAYC 2RQCA 3LUYA 1LXNA 7ICVA 4QZVB 2FF3B 4M3XA 4V19S 4YB7A 3UXOA 5E26A 1JLGB 2VC1A 4UARA 1SC3B 1BWEA 2ZVSA 3F5EA 1D09B 1YRXA 1ZPVA 4LIWA 1F9HA 2N7YA 2CJYB 2AF6A 5ETSA 2WCXA 1UCNA 1HARA 3JAMY 2ZHAA 2KJVA 2X6NA 2A40A 4IUFA 4QZCA 3LALA 4AXIA 3VVUA 5D3GB 2IBOA 2YKPA 2J0QD 3R9PA 3DRXA 3BO2A 3ZEUB 1SGGA 5FIIA 2H1YA 3DLLL 1HMVA 4PPZA 5HI7A 3CI5A 3T3FA 1VQ4N 3BGRA 3GCXP 2IRXA 3VQ4A 1VBXA 2BM1A 4GKKF 1HNWF 1HW8A 2X1FA 2E2OA 3SFUA 3LM2A 3WQPA 5TKYA 2RSQA 3KLIA 2JWNA 1LNQA 2YTCA 3B6PA 5GIPA 4DTUA 1GT8A 4DZ6A 3F2KA 3SEOA 4UBBA 1GLBG 1QVFR 1SZPA 2UU9K 1O5JA 1V9OA 2LU2A 4NXNF 2A2DA 3HVRA 4MTPA 4GKJJ 3H0MB 4J9SA 4LSNB 1G7CB 3RFAA 3BDPA 4CLZA 2CVEA 2G0AA 2CJQA 4A46A 3GYGA 2JGUA 1XHZA 4I56A 1SKSA 2GO7A 1X4EA 3LA0A 3ZZOA 4C97A 1N0VC 2EG1A 4QR1A 2F9JA 4OL8A 1GLDG 2V7ZA 1ZS6A 4JI2J 3D0IE 4KHQA 3ID6A 1Q79A 1NGGA 3ETRA 2J8SA 2F2AB 4X4NA 2KL8A 3LGNA 3U02A 1YZ7A 2QW9A 2E5SA 5K14B 1OH7A 4ILRA 2BPGA 2MY7A 3TPQA 3MM8A 1UPHA 2V7YA 3H45C 1KQFB 1IJJA 3AA5X 4H0XB 2HHUA 1VFJA 3HHLD 4PGQA 3HI0A 3R9KA 5BPMA 2B3TB 3C6HA 3THVA 3OW2R 4YMMA 2D4WA 4EIAA 2JJ4D 4PGYA 1F6TA 3PIOQ 3SQGB 3A8IA 4FWNA 4C8LA 4FVMA 1HX1A 2FLOA 5AQFA 3NH2A 1OXJA 3CCRN 2RHSB 4IFYB 3IDHA 3L9ZA 4KLUA 2VWKA 1MWQA 3RU0A 4CJ4A 4YHHJ 3HOSA 4TY9A 1DGSA 2GEMA 1MN9A 4I2GA 2OD4A 4R8UB 2XS7A 4K8XA 3HVTA 2DR9A 4PL2A 1BPYA 2I38A 2PT0A 2QA4G 3KFWX 1VC0A 3QUCA 4DV4K 4IOCQ 4DV5F 1CBKA 2JH3A 9ICOA 4DBQA 4YOEA 4CO2A 2B56A 4UB1A 4H03B 3PR5B 3UNYA 2DYAA 1BG3A 4CZJA 5DGBA 2MTLA 2VGMA 3LYSA 1R0BG 5ETKA 1NGEA 2VPWB 2IJFA 3MM5B 1SJ3P 2HHQA 1GAOA 5J29A 4J2DA 2JWKA 2WOMB 2JVOA 1OO0B 3UKRB 4O44B 4PHDA 2VV5A 3C2LA 8ICLA 4DS5A 1R8BA 4TLRA 2KRBA 4CO1A 1S6QB 2ISPA 3AQEA 5CQGA 4Y2QA 1LKYA 1U2FA 4BDPA 2KKPA 4J9QA 3AA8A 1Z19A 5D0EA 1B43A 1B22A 1NWKA 4CZLA 1FKOA 5M1QA 1HI8A 2E2NA 5B5EU 2OHFA 1QVGM 5C12A 2F9TA 2ZTCA 3ZTRA 4W5TA 3HZEA 2Q3PA 2ZBQA 1N5VA 2EWSA 3S7RA 1VRTA 1N63A 3T1HJ 2M5YA 1EKSA 2Q97A 4DV0F 3NF7A 3DLLQ 1VQ4S 2F1FA 3MWBA 3IN5A 3KKAC 8ICQA 4MQ3A 3SQOP 2WBMA 1IR0A 2EFOA 3ZT0A 1VQ7N 3RSEA 1FRHA 1F44A 4PHPA 3WZ0A 2VA2A 1RTJA 3PXGa 1PIEA 3O3FA 2KKVA 4M9JA 2P5OA 3R8YA 1MNEA 3TABA 2R4FA 2O4GA 3Q8UA 1QQ6A 3DXKB 4M9GA 2KMDA 2H9ZA 5J8YA 2F1JA 4NLQ