1L3VA

Crystal structure of bacillus dna polymerase i fragment product complex with 15 base pairs of duplex dna following addition of dttp, datp, dctp, and dgtp residues.
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*AP*CP*GP*TP*C)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3vA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3vA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3vA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3vA01
5KG0A 4RQ5A 2FPKA 3RBDA 3O4QA 4NY8A 3NAEA 3S3OA 3HSTB 2G8VA 4NYNA 1JLBA 1ZBLA 3AA2A 1HJPA 4QWCA 3ZT3A 3PMNA 1EXQA 1ZQYA 3Q8PB 1MQ3A 4W5NA 3WNFA 1ZQGA 5T7BA 4HUGA 3AU6A 3THVA 4CEBA 3RB4A 1Q8IA 3BQTA 3ZDAA 4X5VA 4YN4A 3VQ6A 4BDYA 1T7PA 3LDAA 1J5OA 4UB4A 3RMAA 3HWTA 4ED3A 3KJVA 2HHTA 3ZSYA 4I9QA 5J2QA 4KTWA 1S6PA 3I0RA 1WCLA 1NJWA 4CGGA 3AVKA 3ZD8A 4CHQA 1NJXA 7ICJA 3AA3A 1WN7A 4DU3A 4ECVA 2FBVA 2AGOA 4CK1A 3OGUA 3PW7A 1RTDA 1XSNA 5DDMA 4J9PA 3ULDA 4ED7A 4CF8A 1KVCA 1CUKA 2W9BA 2UVWA 2DFLA 1BCOA 1S1UA 4O9MA 1L3SA 3QINA 3WNHA 1RXVA 3MEEA 3V6DA 3OJSA 3B6PA 4RUCA 4NLZA 3UIQA 4ECXA 3AO4A 1KVBA 5CZ2A 3DYAA 4CGJA 4N41A 3NGIA 3K57A 4AHSA 1HNIA 2IHMA 3C1ZA 3AVMA 5J2BA 1RBTA 4CK2A 1UWBA 3SV3A 1XWLA 3AVNA 2B5JA 3SUQA 2PYLA 1TV9A 1RYRA 1SKRA 3VQDA 5BPCA 1C0MA 3RTVA 1NKCA 4JV1A 4RW8A 3TWHA 4DS4A 5C25A 3SJJA 5KFAA 1S1XA 1BIUA 5DG9A 4Q5VA 2W9BB 3MR3A 1S0OA 2BCRA 3VA0A 1X9WA 3PUFA 4MEYA 3ALYA 4BWMA 5C42A 2NRXA 4I2HA 1BPXA 4FO6A 4MFAA 4GXKA 2Y1IA 1EKEA 5HRSA 4NLKA 3QEWA 3ZSZA 4CFDA 4GXIA 2B4JA 4OJRA 3ORYA 4O0JA 3K5LA 5KFSA 1RDBA 2BR0A 3LDSA 4ECQA 4EEYA 4CEEA 5DMRA 1NK4A 2Z1GA 3TAQA 4Q8FA 3QEXA 1CZ9A 4JRPA 1REVA 4R5PA 3AO2A 4C8MA 1TVAA 2BDPA 5TZVA 5D46A 1TL3A 4ELTA 3JPTA 4FBUA 4NCGA 4GMJB 2QKKA 2GV9A 3PX0A 3AVBA 5EWFA 3P5JA 1ZQJA 4UB1A 4KI6A 3SI8A 5KFXA 2NRWA 4ED0A 4KTQA 2DPIA 1EP4A 5KGXA 4BACA 3S3NA 4KB0A 4DL2A 5J0SA 2G8WA 4QZDA 4QZEA 3CYMA 1BIZA 1ZQTA 5C24A 1WSEA 2NUBA 3HM9A 1CLQA 4F5PA 5HMMA 3ITHA 4KPYA 5F9NA 4I2IA 3SCXA 4DTRA 4KV8A 1BCMA 2A1JB 1S97A 3VQ4A 1XI1A 3BGRA 5SZTA 3PR4A 1JLGA 2ZJAA 4C8LA 3GIJA 2HMIA 3OYDA 2W9AA 5L1LA 4YCXA 4F93B 3SQ0A 5SWMA 2ZTEA 3KK2A 3GV8B 4RQ6A 2VA2A 1VSMA 1JL1A 2BHNA 3SZ2A 1X2IA 3EW9A 4DTSA 1UA0A 5FRMA 3OSNA 5J0UA 3NGYA 4YMMA 4Y1DA 7ICOA 5J29A 3HPHA 4EP4A 2QKBA 3NF9A 1LWFA 4YR0A 3ZDCA 9ICTA 3VQQA 2BPCA 4I2PA 1NK9A 4PA1A 3M8PA 4KLLA 2E6MA 1ZBFA 2FBTA 3RJGA 4O3OA 4B3OA 1NK6A 3RMDA 5KG6A 1HPZA 2HNYA 2JEFA 3ZSVA 2XY5A 1C0TA 3TFRA 3UPQA 1XSPA 2R8KA 2BCQA 3LPTA 1NKEA 4TUSA 2VWKA 4C8NA 2OA8A 4UAWA 1BISA 4BE2A 3ZSWA 4FJKA 1ZETA 3C94A 5DBAA 4JUZA 3T5KA 3SUPA 3AVGA 1B9FA 4O5CA 1UT8A 7ICVA 1B92A 4QW8A 1S1WA 1JMSA 3OYCA 1I39A 4CESA 1MU2A 2G8HA 5FROA 1ZBIA 4UB3A 5CR0A 4DSKA 9ICKA 4UB2A 2RF2A 1TK8A 2WONA 4IQVA 4J2EA 1LV5A 4I2CA 4FM2A 3JPRA 1K6YA 1KRPA 2JGUA 3JPQA 3BQ1A 4FK4A 1U04A 2R8JA 8ICRA 2WTFA 4J2AA 7ICIA 4K4GA 4E7HA 3LAMA 3QZ8A 4DEZA 1VSLA 3QZ7A 4RU9A 5L1JA 3V9XA 2QXFA 1A76A 1JIHA 3KHRA 4B9VA 1WSFA 4O5EA 3VQEA 2XO7A 2Q3SA 4KLQA 1RDAA 4I2DA 4CEDA 4Z4CA 3QLHA 4NM1A 3DRSA 4KLDA 3FDSA 7ICHA 4B8AB 1LW0A 1NK7A 2Z1JA 5KFJA 2C28A 4JS5A 2BCSA 4CF2A 1RT4A 4KLSA 4IG0A 4CJUA 5EWEA 4O3PA 3KIOA 3TR8A 2IMWP 2BQ3A 5KFVA 4FW2A 3IAYA 4I2FA 4GXJA 2IC3A 3G6YA 2IA6A 2ZTCA 4CHNA 3PV8A 1TV6A 3K5MA 3TANA 3KTQA 4W5TA 4GVMA 1ZYQA 4LY7A 4KN7A 1TKXA 4N5SA 4KHYA 5J2KA 3KLGA 4CIFA 2FLLA 5DDYA 2BPGA 5HRPA 1JXBA 4W5RA 4OVLA 3C23A 3QEPA 1TKDA 1DTQA 5KG4A 3O3GA 4DO9A 2VG5A 3Q8LA 3ETLA 4Z4FA 2P51A 3KD1E 4DTNA 5KFPA 3SYZA 5CZ1A 1U4BA 5J2NA 2GUIA 5BOLA 1QSSA 5KFWA 1BQMA 2D0CA 3LANA 4CE9A 4O5BA 8ICLA 2J6TA 2ASDA 1HQEA 3JPNA 1DGSA 1D9FA 4J9LA 1K1SA 4O4GA 1ZQFA 2RN2A 2NRZA 4YXJA 1VSHA 4KFBA 3BJYA 1T03A 3T1AA 9ICXA 3UXNA 1C1AA 2G8FA 3LPUA 1SKSA 3TAMA 2UVRA 4DQRA 5DB6A 4QWEA 3OYGA 3AA4A 1C6VA 5KFNA 4KLIA 2EHGA 2Z1IA 4QW9A 2ZTDA 4MFFA 1BL3A 3B0XA 4FJNA 4KREA 5KFLA 4CGDA 4Z4HA 2OZMA 4M6WA 4GLXA 2PFOA 4IQTA 1SV5A 3T5HA 3CFOA 4IBNA 4CJRA 3HK2A 4EBEA 1X1PA 3RB6A 2FBYA 2KQ2A 8ICBA 1BGXT 5HRNA 3NHGA 3K2PA 4IKFA 5F9LA 5HNKA 1DLOA 3NDKA 1UA1A 4F5QA 2LYHA 8ICGA 1S5JA 1ZQBA 4RNNA 5IIKA 2HHUA 1RBUA 3OYAA 3QEVA 4E89A 1C0UA 1JLAA 2F96A 4DU4A 4FJ7A 1RYSA 3AVHA 1RT7A 3L8BA 3KHGA 1XHZA 4M6WB 8ICJA 4M9JA 2X78A 4M9NA 1QTMA 4M47A 1IKWA 4W5OA 2F8TA 4L8RB 5KFZA 4PUOA 9ICHA 4QZ8A 4LVSA 1NJYA 2AGQA 1DTTA 8ICAA 3GDXA 4QZGA 2V4RA 4F8RA 4HTUA 2HNDA 3A2FA 2H5XA 8ICEA 4YR3A 7ICMA 3OYLA 1TKZA 8ICUA 4LSLA 5J2PA 5L9XA 4DOCA 1RPLA 1RCHA 2I9GA 4F4YA 1SL0A 5FDLA 1ZQZA 1U45A 5DKWA 5KT7A 3RJIA 3RAQA 9ICAA 7ICFA 4TQSA 2ZE2A 4F3OA 2DTUA 1A77A 4IR9A 3OYBA 5KG3A 4Q8EA 4IFVA 3SPZA 2A1SA 8ICIA 4M9HA 3TABA 1NKBA 4RQ0A 3BQ0A 1L3UA 2R7YA 7ICPA 3OHAA 3NH0A 3VQCA 3PW2A 4FJJA 3VA3A 4KHQA 4B9MA 1TGOA 3HYFA 4CECA 4B8CA 2BQUA 2UVUA 5KFYA 4K4HA 5DBBA 3ZDDA 1S1VA 3H8SA 3QEIA 4RQ8A 4ECRA 4DTOA 3V9ZA 3QIPA 4J9RA 1RDDA 4AHUA 4ELUA 3E01A 4PPXA 3L2VA 1RXWA 1RZTA 2FBXA 3BQ2A 2X74A 3B0YA 4B08A 3HO1A 3D45A 3S3MA 3FYHA 1S9EA 1ZQWA 4AHVA 1ZQDA 2E6LA 3VQBA 5J2IA 3RH5A 3K75D 2EX3A 2NRVA 3ZT2A 1ZQCA 3RJJA 1JLEA 4J9SA 2XY6A 1RT5A 2YNFA 4FJIA 1X9SA 4RZRA 4CCHA 8ICMA 5KFIA 5L1KA 1Y88A 1JN3A 1VRUA 4IFYA 4JWMA 1RT2A 4ED8A 3U3GA 2O4IA 4I2EA 4HCBA 4KHWA 4DTXA 4ZH4A 1C1CA 1Q9XA 3PNCA 2F1HA 5J0XA 2VA3A 4OGCA 1N56A 3CFRA 4EBDA 2AQ0A 3KLFA 4I7FA 3V9SA 1TK5A 5KFOA 4NLGA 8ICSA 1JLCA 4MF8A 3OYFA 3JPPA 4CJFA 3PO5A 4DSJA 4NCAA 4DFKA 4KAZA 8ICTA 1HYVA 3LK9A 1BHLA 2ISOA 3C2LA 1NOMA 4R65A 1VSDA 1AROP 4KTZA 4YXMA 2ZD1A 4PHEA 4RQ7A 3K4GA 3K5NA 3AVIA 4M3ZA 1KVAA 3SUNA 2I1QA 3PW5A 1FKOA 3E2EA 1U49A 4J9KA 1ZQQA 3DMJA 3MBYA 5HROA 2C2DA 5DQIA 2ITGA 1RT3A 1S0NA 2PFQA 5DLFA 4FLVA 2FLNA 2JZBA 4DQQA 2Q0ZX 3PO4A 1D5AA 3MR5A 3RRHA 2PI5A 4F4ZA 2F1IA 4ECSA 2IGIA 1JKHA 3L2RA 4E1NA 4QOZB 1ASUA 2JEGA 2YNGA 2OPPA 4CIEA 4N76A 4JWNA 3DLEA 2IHNA 5J0RA 1VSIA 3DLGA 5K14A 4HUFA 1NOYA 4Z4EA 4Z4IA 3UXPA 2PZSA 3KLEA 4YFKA 3KLIA 3LP1A 7ICRA 3NTUA 5DG8A 1SUQA 3DLRA 5IIOA 1BPYA 3T5LA 3LWLA 4M42A 2AGPA 3IG1A 1Z26A 5J2MA 3AV9A 2JZBB 3H8WA 4RUAA 2XGQA 1B22A 4IRCA 4OLBA 1HMVA 4CHPA 3M9MB 3UXOA 2BQRA 4ECYA 4FJ8A 3DM2A 2KN7A 2YNHA 1QQCA 5JS2A 3V7LA 3AVFA 2VG6A 3C95A 4FZXC 2MAXA 8ICWA 1KSPA 2YHBA 1ZQXA 3V4IA 4RQ4A 1HJRA 2IBKA 4KHUA 2FMQA 4XIUA 3QESA 1CEZA 1X9MA 4KB1A 4O55A 1XS9D 5JUMA 3DLKA 4YR2A 4DSIA 2P6UA 1T05A 2X6NA 4J9MA 3SPYA 4DTMA 4NXZA 5IIIA 1F21A 8ICPA 3LP0A 3OYEA 2PY5A 5KFKA 1JL2A 1PZNA 2UVVA 2OYQA 1YTAA 1L5UA 3C6UA 4JS4A 5J2FA 4Y1CA 1DOQA 2IAJA 3OYIA 9ICNA 4KMUA 3MGHA 4CGHA 8ICCA 5CB1A 4TUPA 3RJKA 4FLTA 5KGWA 1S9GA 3C21A 2IOCA 3VQ7A 2BCUA 4RT3A 3AUOA 3JYTA 4RQ3A 5KFRA 4R64A 3PVXA 4CFCA 3ZSRA 4UB5A 5HP4A 3H08A 1N6QA 2G8KA 4E0DA 1N48A 2OPSA 4QWBA 4QWAA 1NK5A 2X6SA 4M04A 3F9KA 3VQ8A 5KFGA 4KLMA 4PY5A 4KHSA 4PWDA 3CG7A 4DG1A 3AA5X 4N56A 4KLFA 3IRXA 1U47A 2RPIA 7ICKA 4FJHA 1D9DA 1JX4A 4J2BA 4DSLA 2YNIA 5D3GA 3L2WA 3Q8QB 3LAKA 3MFHA 3LP3A 4YMOA 4DTUA 3MR2A 2BCVA 4DQSA 4RW9A 3PX6A 5CP2A 4EYIB 4O44A 9ICJA 2V4QA 4DU1A 1IXRA 4CJQA 3OYHA 4RW6A 4KKOA 2A1RA 5CY4A 4M0AA 4AILC 1XC9A 4I29A 4CERA 4OGEA 1KDHA 5FRNA 4Z6DA 3RJHA 1G15A 3T3FA 5IIJA 5D49A 1L3TA 4CJ5A 5J0YA 4CK3A 4ID5A 5HLFA 4FJLA 4Z4GA 4QAGA 4I27A 2P5OA 5EU7A 4RW7A 3EPIA 2C2RA 1RDCA 3ISDA 7ICNA 3L2UA 4M3YA 4FS1A 3UQ2A 3KLHA 4IQUA 4UBBA 4ZHRA 2NRTA 4RPXA 4DL6A 4WE1A 4ED6A 4F4XA 1WSIA 2XHBA 4Q44A 4DL7A 4NCBA 3TQ1A 4LZDA 4DQPA 3V6JA 4GC6A 8ICKA 2YHAA 4DQIA 1FKPA 2J6UA 5KFEA 4DMNA 4IRKA 5DB7A 2HHWA 3QEAZ 4FJXA 4YVZA 4YP3A 3TI0A 1S10A 4CJKA 5IILA 4H4OA 4BDZA 1IKXA 1T8EA 3L2QA 1JLFA 1LW2A 4IG3A 3CM5A 1KEJA 4LH5A 4E19A 4RQ1A 4KITB 3RR8A 4P4OA 1WAJA 2XC9A 4YFUA 1ASVA 5J0OA 1VSEA 7ICGA 4PQUA 3TAFA 3GV7B 3MXMA 3MXIA 3CFPA 3AVCA 2P6RA 3ZT4A 2F1JA 1FK9A 3ZCMA 4F5RA 3ZSXA 3LZJA 4FK2A 4KHNA 1IKYA 1LB2B 1ZQPA 2Z1HA 3QERA 4DL5A 8ICXA 4DSFA 5KFMA 2BE2A 3FFIA 3MABA 5J2JA 5HMLA 2VWJA 4QZBA 4IR1A 4CGFA 1S76D 1BI4A 4CEQA 3AVAA 2ZJ5A 5DGBA 3M8QA 5KG7A 4DFMA 4CEFA 4P2HA 4FM1A 3C1YA 1B43A 1C1BA 1V9PA 1ZJNA 1XHXA 4KLUA 4CHYA 5CYMA 1MSWD 4H4MA 3RWUA 3AO3A 3TARA 1S6QA 4AHRA 8ICNA 4R63A 4M45A 2ZJ8A 1HNVA 3VQ5A 4Q43A 3MEDA 4BE0A 8ICOA 3KK3A 4CFAA 4YQWA 3WNGA 2ASJA 4UBCA 3DLBA 4CFBA 2PXIA 4KLHA 5DBCA 4CF0A 3NH2A 1Z3EB 4HCCA 3MEGA 3B6OA 1VSKA 3BDPA 4YD2A 1W9HA 1YT3A 1RBVA 2PFNA 4RNMA 9ICVA 3CQ8A 1RTIA 4OPKA 1RNHA 4HHTA 1WSGA 1ZQHA 3RMCA 4ELVA 1FXXA 4JV0A 4UQGA 1VSFA 4LH4A 1BI4B 2P5GA 2DY4A 3V81A 2XCPA 3NBPA 1K1QA 5KT6A 2JLEA 3UQ0A 4O3SA 3ZD9A 4Q45A 2OPQA 1ZQKA 1KFTA 3HVRA 1IKVA 3GIKA 3QEBZ 3O3FA 1SKWA 1BPZA 3OJUA 3C5GA 1MC8A 1IO2A 3HPOA 2YKNA 1CXUA 1GOCA 3GIMA 2XGPA 1C7YA 5I42A 3GFKB 2RDJA 4N47A 9ICBA 1KFSA 5J0QA 1A5XA 4FJGA 1IH7A 5BOMA 1JXLA 4PGQA 5DLGA 1S9FA 4RNOA 4CJSA 4QZAA 2D0BA 5KRTA 2J6SA 3IS9A 4BWJA 1GOAA 3VQ9A 4I28A 4BDPA 3NGDA 1ZQEA 4F2SA 1YVUA 4FCYA 4PHAA 2AQ4A 4O0IA 1HYZA 3RRGA 3QETA 1VK0A 2LSNA 4IQWA 1R0AA 3K59A 1MQ2A 1Q9YA 4RW4A 1HYSA 2BANA 2P66A 4PGXA 4W5QA 1U48A 4PH5A 1HRHA 1Y97A 3AVLA 3PY8A 3OVNA 1NK0A 1ZQMA 1LAWA 3TFSA 2MUTA 5DB9A 3KHLA 4F2RA 7ICQA 3H7IA 4CGIA 4M3WA 3JSMA 3ZDBA 4CJPA 2FPMA 4PGYA 4QZ9A 3V7KA 3LALA 3V1OA 4LD0A 3V6HA 3AU2A 4ICLA 1W0HA 4FVMA 4DLGA 2B6AA 2DFEA 8ICFA 4KLTA 9ICQA 3QNNA 3AO1A 4QWDA 3ISNC 4FLUA 2G8IA 4EZ6A 3C5FA 3KK1A 1KFDA 2ISPA 2ZUCA 4I2QA 4I2GA 3PX4A 2FLPA 4M3XA 2OPRA 4M41A 3QIOA 2IDOA 5J2DA 3HL8A 4UAZA 2AJQA 3C6TA 1ZBUA 2MUTB 8ICHA 2M9NA 3HP6A 4NYFA 4E7LA 1WSHA 1QSYA 9ICEA 3ISCA 3MR6A 2ETJA 4YD1A 4P4PA 1WLJA 3PMLA 3MECA 1ZQVA 1S0VA 3SI6A 3NE6A 3RH4A 2OWOA 4CJVA 2QK9A 4XRHA 5C5JA 5KG1A 4B9UA 1L3VA 3M8SA 4G3IA 9ICRA 3G6VA 3L3VA 3OHBA 5J2AA 3ZDEA 4DFJA 4IRDA 2W9MA 4Z0UA 4KLOA 3NF7A 1IG9A 1KCFA 5J2GA 5KG5A 1TL1A 1ZQRA 4KLJA 4FLZA 1IM4A 4O3NA 4QZIA 3PR5B 4J9NA 3T5JA 3H4DA 5KI6A 3EYZA 4J2DA 3LWMA 4P4MA 4EZ9A 5DK5A 3Q8SB 3HT3A 3ZT1A 1RILA 3RJFA 2KFNA 3M9OB 5E41A 7ICTA 1BPEA 4FBTA 2DPJA 3Q8KA 3SUOA 4QZCA 4K8XA 1JLQA 4G1QA 2XY7A 4RPYA 3MDCA 3MGIA 3EY1A 5J0PA 5KG2A 5IIMA 3NFAA 9ICMA 4GW6A 1S0MA 4Z6EA 4CF1A 5HHIA 4ED1A 4RPZA 2O4GA 3ASMA 2V9WA 3KD5E 5L1IA 2XRIA 8ICQA 4JLHA 5CHGA 4KO0A 3V9UA 1KLNA 3N97B 4ECZA 4B9LA 1LWCA 4O5KA 4C8KA 7ICLA 2A1JA 4F50A 2HHSA 5DQGA 1GOBA 1BPBA 5HHHA 4KRFA 3DLHA 3GV5B 2E4LA 3RBEA 5CYQA 4CEZA 3OYKA 7ICUA 4FXDA 1ZBHA 4FJ5A 8ICVA 1TAQA 1A5VA 2IS3A 3SV4A 3DRPA 1BQNA 9ICUA 4RG8A 1JXEA 1S1TA 2PYJA 3DOKA 4NM2A 4RQ2A 2RDIA 1ASWA 5HP1A 9ICOA 2FMSA 1ZQNA 3NF8A 3OS0A 4ID1A 4MF2A 4CJTA 3H8JA 4FLWA 3OYJA 5I3UA 2ATQA 2FC0A 3O3HA 1VRTA 1N5YA 5KFQA 1S77D 2HHQA 3HVTA 2XCAA 3K5OA 4CJEA 4M2YA 1XU4A 3OYMA 1RBSA 2ATLA 1RT1A 2BGWA 1QSLA 3RMBA 4AHTA 4DFPA 1TFRA 1B9DA 4YMNA 4F3TA 3HPGA 4K8ZA 4XUSA 2YKMA 1J9AA 4JK1A 1A5WA 1XO1A 3H4BA 3G0ZA 5KFHA 4OKKA 2XY8A 1SL1A 5KFBA 2C22A 2RKIA 3HJFA 3Q8RB 2W9CA 3IM1A 4YNQA 2HHVA 2F8SA 2ZUBA 4DWIA 3S9HA 4J9QA 2OZSA 9ICPA 4DL3A 4FJMA 1LWEA 1U9LA 4EYHB 4CJLA 4Z6FA 1NK8A 9ICCA 2WOMA 1ZQIA 2HVIA 3MDAA 3V1RA 1RTHA 1Z00A 4KLEA 1TKTA 5KFFA 2D5RA 2BPFA 3I8DA 4BE1A 1CZBA 1SL2A 5KTQA 1BVSA 4CHZA 1ITGA 3MXJA 4DL4A 1HUOA 4H8KA 3QNOA 3H40A 1ZQAA 2R8GA 3D0PA 4CIGA 3P83D 4QCLA 5KRSA 3V7JA 3LP2A 5J0TA 2R8HA 4CF9A 4FLYA 4FK0A 1BPDA 4MFBA 3V1QA 2W9CB 1ZQOA 4E7IA 3L3UA 4DOBA 1TVRA 4B9TA 5KFDA 4O3RA 1ZQUA 5J0WA 3V9WA 2JEIA 1VSJA 5D4BA 3NH1A 1J54A 1WCNA 3PW4A 4B9SA 3EWAA 5KFCA 5JS1A 3P1GA 4UAYA 1UAXA 2DFHA 1Z00B 2VG7A 4TUQA 3TAPA 2HVHA 4ED2A 2W8KA 4M9GA 1O1WA 2G8UA 2W8LA 3CM6A 3QE9Y 4MFCA 2GBZA 5DGAA 4OLAA 5HRRA 1EXNA 3OS1A 9ICGA 3HXMA 4E7JA 9ICSA 3RAXA 8ICYA 2ALZA 5J2HA 3NGZA 4DF8A 2JEJA 1D8YA 4C8OA 4FZYA 4QZHA 1J53A 2DFFA 3GILA 4JRQA 1EETA 4F91B 3KKSA 2BKEA 4FW1A 2ZUDA 3DOLA 2VANA 3G6XA 4HUEA 4MQ3A 1KTQA 4RT2A 2HB5A 3AO5A 3WNEA 4ZTFA 3RJEA 4BXOA 2KFZA 1RBRA 4DLEA 3JPOA 3GQCA 2PI4A 3F73A 3NF6A 2ASLA 2KTQA 4CHOA 4FLXA 4HVJA 2FMPA 4OKEA 4I9LA 9ICLA 3NCIA 8ICZA 4E1MA 4MEXA 2R8IA 1D8LA 1H38A 1ZQSA 1SZPA 4LSNA 3OY9A 3ISBA 3DI6A 3OSPA 5IINA 5EWGA 4LZGA 5HBMA 2Y1JA 4I2JA 5KFUA 4CEAA 2KZ3A 3RR7A 1HUZA 4M3RA 4XA5A 4BXOB 4QZFA 5CWRA 5J2CA 4PHPA 3ZT0A 4FJ9A 3K58A 4ZTJA 4CJWA 1WNSA 3AVJA 3V72A 1UT5A 4PHDA 3V6KA 7ICSA 4FM0A 4BGDA 4DS5A 2BGGA 1Z25A 2P1JA 4F5OA 1COOA 1ZJMA 4E7KA 1WSJA 5KT5A 4NLNA 5J1EA 4AHCA 3N4MB 3RB3A 3HX0A 2VA8A 3LZIA 3ZSQA 2HNZA 5KT2A 4J9OA 2PFPA 3TAEA 4F4KA 3QO9A 3OYNA 4I2BA 3HP9A 1QE1A 3KKRA 5KT3A 4DOAA 4DTPA 3OS2A 3MAQA 4HYKA 4YG2A 3C2MA 1HQUA 4K4IA 1RT6A 4OKJA 3GIIA 1T3NA 4CJ4A 3SQ1A 5DG7A 3HW8A 1NOZA 1ZQLA 3PW0A 4DTJA 3ZSOA 4R66A 5DQHA 1YTUA 4EP5A 4ECTA 1RTJA 3C2KA 1TAUA 4F4WA 4I2AA 5KFTA 2B21A 4DSEA 3VQAA 4M3UA 2W42A 4CEOA 4JV2A 3G10A 3RB0A 3I0SA 2I5JA 4O3QA 4Q0BA 2KZZA 3MFIA 2KW4A 3SQ2A 4M9LA 3VQPA 5EOZA 3VN5A 1LAVA 3M8RA 5CA7A 3EZ5A 2HW3A 1QHTA 4Z6CA 3SNNA 2C2EA 3SQ4A 1EX4A 5J2EA 2D0AA 1XSLA 5KT4A 2GWSA 3U6FA 4IDKA 4CJ3A 3DRRA 3U3YA 4FS2A 1TK0A 1NJZA 3JPSA 2HHXA 4TSXA 3T19A 1T4GA 4R8UA 4FZZA 1QLNA 5DB8A 2FPLA 3IHQB 9ICFA 3O4NA 1CXQA 1WAFA 4F92B 1QS4A 1KLMA 4F5NA 2KZMA 4TQRA 2YV0X 4AH9A 5CJ7A 3KHHA 3Q8MA 4M3TA 4EBCA 4ECUA 4DF4A 1UOCA 4FYDA 4KN4A 4E3SA 3EPGA 2ZQBA 1I3AA 4ECWA 2AU0A 4KI4A 4XQ8A 3RH6A 4GC7A 4B9NA 7ICEA 9ICWA 3M9NB 4TURA 9ICIA 3TAGA 4OPJA 4KLGA 4R8UB
chains in the Genus database with same CATH superfamily
4ZVEA 2FPKA 1RBOB 2DHGA 1WG1A 2IJNA 3S3OA 4K59A 2CZ4A 3AA2A 1T9UA 3ATUA 2IDLA 1KLMB 4CD1A 2YHYA 5DM6L 3RB4A 4EGLA 2VKRA 1IJEB 2F7TA 3A0IX 3VQ6A 3LDAA 4ZS6A 1K47A 2RQ5A 3RMAA 2DR8A 2R7OA 4OV1A 3H0LB 3KJVA 2FD2A 2DKXA 3ZSYA 4UASA 3D9BA 3PDNA 3D2EB 2F65A 1KN6A 4CHQA 3TVYA 4OMFG 2KVCA 1WN7A 1ZPWX 4CO4A 2FBVA 1NM2A 1TL4A 3D6TB 2ATCB 2HIYA 1XSNA 1OWXA 2J0QD 1VJWA 3MUTP 2W9BA 1WUAA 2Z0GA 4ILLA 1L3SA 3QINA 1RZMA 1RXVA 3OJSA 3RW7A 3GOIA 4BRPA 3A5NC 2R3VA 1EHWA 4I68A 3OUYB 3T1HJ 1KVBA 5CZ2A 2MKIA 4AHSA 1HNIA 5LMNK 1VJQA 4YY3K 4CK2A 3MM7A 5J2QB 2M70A 2C2NA 5KQDA 3SV3A 1UWAA 1B0XA 1QVGR 3SUQA 2DNMA 1TV9A 3VQDA 2WAQC 5BPCA 1RAEB 5HOOA 1IIPA 4QS8A 1N33K 3SJJA 4NZ7A 5KFAA 3DXMB 1XIQA 4M8LA 3H5YA 1QVFM 4Q5VA 3VA0A 1X9WA 3PUFA 3KD3A 4X66J 5F8LA 4UB6U 1S1UB 2NRXA 4I2HA 4LBIA 5ETKA 3B4DA 4JKHA 4MFAA 2KXNB 2Y1IA 2EW9A 4NLKA 4CFDA 1M1KO 4Z37A 2VC1A 2FJXA 2QLWA 2UUCK 3K5LA 2EK1A 4TXSA 2CADA 4IO1A 1RDBA 2BR0A 1S7HA 2LU1A 4ECQA 3CD0A 1N8RT 2B5JB 5AIBA 1NK4A 3QEXA 4LFCF 4FDFA 2PFUA 4JRPA 1REVA 3KUEA 1WEYA 4C8MA 3HT0A 3NCPA 3QU9A 4MK9A 5ALQA 5C25B 1V3SA 1TL3A 4GMJB 3N5BA 2QKKA 4FWNA 4TU8A 2M4MA 3BF3A 3JS6A 1NEEA 3AVBA 5EWFA 4DV3K 3TZYA 2DR5A 5A8KB 4MO4A 1EP4A 3S3NA 5AE3A 4DL2A 5J0SA 3PFOA 1Q81T 3UN2A 5D0RA 4BY9C 1FX2A 3HM9A 5HMMA 3QJJA 5AQHA 2MEWA 1WD6A 4F26A 3CMAN 5F9NA 1R31A 2O8FA 3SCXA 1K9MT 1IQTA 3BGRA 4TY9A 3PR4A 2ZJAA 2WW4A 4DV5J 4CO3A 3Q7BA 3QAEA 2HMIA 1DBDA 4F93B 4NCGB 4DR2K 3GV8B 1N34J 1XK8A 1FNXH 5ETPA 3DOKB 1UA0A 1N61A 1QAIA 1X5PA 1ZRMA 1EZZB 5GIOA 5J0UA 2KHVA 1ZZFA 2A18A 2KG5A 7ICOA 3CJ1A 3ZEUA 3R5CA 1LKYA 1E6VA 2QKBA 1QQ5A 2EC0A 3NF9A 1OO0B 3C15B 4YR0A 1VQ6S 3O44A 4RUBA 3QFPA 3M8PA 3RJGA 4B3OA 2FTRA 4KV8B 2E8AA 2Q43A 2HNYA 8ATCB 1JLGB 2BRLA 2DBYA 1RDRA 1C0TA 2KJ5A 3UPQA 1TELA 2UUTA 3JB9k 2JVOA 3LPTA 3E0FA 3M2RA 1NKEA 1FERA 4TUSA 3MPWA 2VWKA 4C8NA 1JALA 1XMOK 4BE2A 1CULA 4NA1A 3MMCB 1ZETA 3SUPA 1B9FA 2NV3A 7ICVA 1B92A 4DBQA 1FDBA 3OBWA 3AGRA 3OYCA 1MU2A 1HHQA 1LWFB 3N4PA 5FROA 4UB3A 3JS9A 3SEIA 4I2PB 4BRQA 1VHIA 1VQ7N 1WSRA 4UB2A 2RF2A 4B1XB 4J2EA 5D77A 4I2CA 2GJFA 2QXLA 4TU9A 3KJQB 3BQ1A 2R8JA 5HR6A 2P9GA 1K5OA 1TUWA 3LAMA 3VF2A 3QZ8A 4DPWA 3V9XA 1JIHA 4B9VA 1UVIA 4M5KA 4PL7A 1G7CB 1PJ5A 5AQSA 3VQEA 2HFSA 1UL3A 1SH2A 4KAIA 3MM6B 1U1MA 4I2DA 2N82B 1N32J 1EAYC 1NJIT 4NM1A 1UFWA 1S1WB 3WQTA 4A8OA 3ONNA 1HR0J 1NK7A 5L39A 5KFJA 2P9LA 3WQUA 1Z1VA 1RT4A 4CF2A 2WONB 5EWEA 4O3PA 1HBOB 2XICA 3TR8A 2IMWP 1FDAA 2CH5A 4I2FA 2W03A 4QR2A 2LYVA 1TYQB 3PV8A 4JI6J 2HLUA 4BRNA 1T3OA 1CS4A 1LEOA 4LY7A 3FEYB 1GT8A 2DB1A 1RB0A 1N8RO 2FHJA 2R4FA 4OZLA 2KM8C 5HRPA 3SD7A 2H1YA 3DEEA 4W5RA 3C7NA 3HBTA 1S99A 3UFCX 3GR0A 5CABA 3RZAA 4JI8J 1HNWK 3K1ZA 5DDRC 4H0XB 5K8MA 3QEPA 3QLHB 1TKDA 2OHFA 1XUPO 3DRSB 4UOFA 4DO9A 2ZDOA 3ETLA 3R2DJ 4Z4FA 2P51A 5EHHA 1GTEA 4LT6A 4NYPA 5T14A 3G9CA 3A0BU 5KFPA 5CZ1A 3LDLA 1U4BA 3G4SN 4QIEA 1BQMA 1HA1A 3H3NO 3QU2A 4CE9A 1D9AA 4GKJJ 4O5BA 3U1NA 2FDRA 1U26A 2O8EB 2DL0A 1K1SA 2RN2A 1TKXB 3NY0A 3KLGB 4RX6A 1FJEB 5E7OB 4U67Q 3NRBA 1RBAA 1K9MO 1ZD2P 4IO9Q 2VB6A 3FGUA 2V2VA 3TZXA 4WTYA 3RBXA 4URGA 3LPUA 1DTQB 2JLFA 4OJPA 3H2LA 4JI4K 4DQRA 4MK7A 4C2MA 3EEQA 3JSBA 3JAMY 2LP4A 4X4PA 4U95A 2Z2YB 2E5JA 3HMJG 1BL3A 2HKEA 4NI2B 1SXLA 3B0XA 4FJNA 4NL9C 4KREA 2E7WA 3O2IA 3W2WA 4GLXA 2PFOA 2E5GA 2EK6A 2ZG6A 3T5HA 4OPHA 1ELOA 4FWRA 2KXFA 2FBYA 5ADXH 4IKFA 5F9LA 3FAHA 5BR9A 4NLQA 1BNOA 3EXYA 1ZQBA 5AQZA 2WFAA 1SIJA 4RNNA 1WKKA 5BN8A 2HOFA 5IIKA 3WK8A 4TYAA 5BR8F 3H1VX 3RUBL 1YX2A 1VISA 2F96A 2OTJS 2NS1B 1JRPA 4CM0A 4DU4A 4FJ7A 2K4IA 3ENAA 3CJTA 5A6PA 2OUGA 1HIYA 3R5GA 3QQCD 1XHZA 4M6WB 2XLJA 1Q95G 1SBRA 3ISND 3NAHA 2AH5A 5GAEP 4W5OA 2F8TA 5AK4A 5KFZA 2A1AA 1NJYA 2AGQA 1DTTA 1PUZA 4OJOA 4F8RA 4HTUA 2CQIA 4XTTA 4CH1A 3C0BA 2VASA 2H5XA 3OYLA 4Z7YA 1L8LA 1J2VA 5L9XA 2FF3B 3PRBA 3HZEA 4DOCA 4O0NA 1SL0A 5FDLA 3NGUA 1TQLA 4BRMA 2P9SA 3R8EA 4FWMA 3C14A 5AKLA 5AQGA 3SBTA 9ICAA 3PYGA 4DV7K 7ICFA 2E1AA 5AKKA 2NRRA 4DU8A 4IR9A 3OYBA 2FHJD 4L76A 1IKWB 3UDEA 1NJIO 2D3O1 8ICIA 1R7IA 2HZVA 3TABA 3CIZA 2CG4A 2ZNZA 3CO9A 2G5IB 2IBOA 2HNDB 1YJNS 1URJA 3PW2A 3VQCA 2CQ4A 2PD1A 2LBOA 2HMXA 2CQ1A 4NLVA 4B9MA 4XEIA 3CHWA 2MKKA 2RMLA 4A4JA 4LF4F 4LSLB 1YJ7A 4QZVB 3UMGA 2AEJA 1SGGA 5E3PA 1VLOA 3N28A 1WKJA 2ZM6J 1KP6A 2WSEC 3Q8VA 4PPXA 1RZTA 4CZHA 2FBXA 4OX6A 3O5TB 3US5A 2BVZA 2VPYB 4B08A 3AY0A 3HO1A 3FZHA 2AZ3A 3S3MA 1MMNA 2LI6A 1N88A 4K0KF 5J2IA 2LQJA 2FY1A 2GQ2A 1NM1A 3RJJA 3VALA 4J9SA 3MCMA 1N36F 4FJIA 4DR7J 1HBUB 1X9SA 1UVMA 1DRZA 3TUIC 3DRXA 4ZK7M 1JN3A 2MZJA 4RWTA 4KH5A 4ED8A 2QV6A 3U3GA 4EWTA 3CEDA 3D2SA 1UFLA 2DYAA 4I2EA 3I76A 5A6WA 1C1CA 4OJLA 4GKKK 1Q9XA 2UXDF 2F1HA 5ALNA 3TZZA 4UTGA 5BYQA 3ED5A 2W11A 1BA1A 5M1PA 4NEZA 2M8HA 5AKHA 1CJTA 2EC2A 2Z2MA 3KBBA 4P52A 1S9EB 1UPHA 5KFOA 3DGVA 3JPPA 4DV2F 3QT7A 2AW0A 2P9UA 3GFZA 3A5MC 4KGVB 1RT5B 5IFMA 3LK9A 4Y2MA 2VKZG 5M1NA 2W2QP 4FKYA 2D1CA 4PG6A 2FI1A 4NJ8A 4R65A 4CYUB 4KTZA 2WTUA 4OYIA 4YY3J 4YXMA 1VRUB 4IFYB 3FZMA 4PHEA 1VGYA 1M5OC 3AVIA 4LFBF 2JHDA 3KK7A 4LF6K 2ZH4A 2QE5A 3ULEA 3EL2A 2MSSA 5J8YC 3L09A 4J9KA 3J7YP 3W8GA 3DHXA 4DV0F 2XIDA 2KV2A 3Q8YA 3MM7B 5DQIA 2BX6A 1N33J 2ITGA 2F1FA 2KKHA 4CZKA 5DLFA 3VCDA 4FLVA 1J5EF 3KLFB 3PO4A 1D5AA 3N5FA 3MR5A 4I7FB 2V8GA 2A41A 3L4BC 4F4ZA 4ECSA 1JLCB 4ZPTR 4OYOA 3OTBA 2BM1A 4N76A 2OPPA 2IM2A 3I32A 4JKFA 3HJVA 4J90A 4OV6A 3VAFA 1VSIA 1ICEB 2RSQA 2PC6A 2HVEA 4KGKA 2UUCJ 1KQSM 1N5VA 1OIAA 3UXPA 2PZSA 1SB6A 3LP1A 1FKOB 2MMYA 2CG8A 2Y8YA 1SUQA 5LT5A 1BPYA 1L7MA 4B3SF 4M42A 4A2BA 1RT3B 4USMA 1VQOS 5J2MA 5HANA 3AV9A 4OJ1A 3TZWA 2JZBB 2XGQA 1Y64A 4IRCA 1K0TA 4DV3J 3TX0A 1REVB 3OVBA 4DCHA 1R0BG 2XMUA 4P2SA 1IBLF 1FWPA 5D4NA 2YNGB 2KN7A 1YBUA 4M63C 3D67A 2NCKL 5K14B 1YRTA 5ALVA 3PIOL 8ICWA 4M7XA 3KWIA 3ZYYX 1HJRA 2WF6A 3N7PD 2BZ2A 4U9RA 2RE1A 2GVZB 2MYFA 3KLIB 1FE0A 4KB1A 3FGVA 3CMES 1XS9D 3DLKA 1CZAN 3AA9A 2DNNA 5G5HA 4DSIA 2MKYA 1T05A 3SPYA 2JWKA 4DTMA 3CCES 5BPNA 4DR2J 3LP0A 3OYEA 4OZ2A 1Q46A 3KUHA 3HVAA 2D3DA 3BP8A 2OEJA 2I5HA 2CPJA 4DPTA 2UVVA 1HMVB 2KFYA 3CJ9A 4C8YA 2MRLA 1L5UA 3DV9A 2HMIB 2KJWA 2J8SA 1CC7A 2G06A 4M5GA 2AA4A 4BR4A 2VG6B 1YVFA 4KMUA 5BR8K 3EM1A 3V4IB 5ETVA 5CB1A 4PYAA 3RJKA 2NYHA 3C21A 2OEMA 5K9FA 5AQKA 4WXWA 1KOOA 5HVFA 4JI7K 3O5BA 2MPUA 2KJVA 2QWOA 3D1HA 4CFCA 2N4CA 3H08A 4QWBA 3F9KA 2HAFA 4KLMA 4PY5A 4KHSA 1R8CA 4DUYF 4DG1A 3AA5X 1IBCB 3IRXA 1XMOJ 1MNEA 4OO1J 4BQLA 3QGPA 1GX5A 3SK3A 4QOTA 3VGVA 4FZLA 5M1QA 3GBTA 3Q8QB 2GFFA 3LAKA 2W4CA 4DTUA 1VK3A 2DGOA 3J7YU 3CVKA 4N77A 2MZRA 1JI7A 1IXRA 4X62K 5DZ7A 3OV7A 1FFSB 1XC9A 3J7AP 2V63A 4ENOA 1KDHA 3TJ8A 2KG1A 3RJHA 2XG8A 2YJEA 2NXEA 1N6QB 1GLFO 3MAAB 3M30A 4M5NA 4I27A 4ZP7A 1BOTO 4RW7A 3EPIA 2C2RA 1RDCA 4M3YA 2A10A 4PWDB 4DCCA 1Q53A 1JWWA 2BXJA 2R7UA 3D6MB 2KH9A 2NRTA 4DL6A 5DZ6A 1KKXA 4NCBA 4DL7A 3AQOA 2XHBA 4YOVA 4P0PA 3S6EA 1URNA 2YNIB 2YHAA 4LF4K 1NPRA 3BBCA 5AKJA 1YJRA 3RG6A 4FJXA 3QEAZ 4O44B 3QAUA 2U2FA 3CNQP 4RW6B 2HOQA 2XYHB 2IHR1 1S10A 1F1BB 3IDWA 1IKXA 3IG8A 3TA0A 4IG3A 3ZNJ1 3CM5A 4JI1F 4ID5B 4PABA 4L3QA 4IUFA 4E19A 1JXVA 3BYPA 2Y9HA 1WAJA 1C0FA 4NLOA 2XBPA 3G8QA 2FYXA 1RT4B 1VSEA 2OTJN 4ZHRB 1JUDA 2IVPA 4WPAA 4WE1B 4RCHA 3GDQA 3GV7B 3MXMA 3S1TA 2DJWA 1K8AT 1X31C 2Q97A 3IWXA 5K5MA 1FK9A 4DQ8A 5F1XA 5AK5A 4CO2A 3LZJA 3GFHA 2WVCA 1SH3A 4KHNA 3H46O 1IKYA 2DH9A 4F71A 1ZQPA 4WCEQ 1RSCA 4DV1F 8ICXA 4DL0C 2BE2A 3MABA 3R7SB 2B6GA 1NH7A 3NNHA 5J2JA 3VWSA 5HMLA 4QZBA 1XMQK 1VLYA 2ZHAA 1M0SA 4B1WB 1JLFB 4U6PA 1BI4A 2Y0SC 4K4ZA 5HL7L 3M8QA 2QWMA 4J5OA 1ZOTA 2K4EA 3AQFA 4FM1A 1C1BA 1V9PA 4PQUB 3NS6A 4C1NI 3OL8A 2QA4N 3TARA 3CMQA 3OW2R 4AHRA 5BPLA 8ICNA 4R63A 1S6UA 2E1EA 1QD1A 1HNVA 1S48A 4Q43A 3T79A 4XO0A 8ICOA 2E8PA 2ACYA 2AT1B 2CJBA 4M5JA 2YN4A 4A8FA 3WNGA 1CRXA 2ASJA 2L5YA 3GG1A 4WYBA 3F9MA 2SXLA 4CFBA 4UAVA 2DGSA 3MWBA 4JI4J 3NH2A 3MEGA 2V6AA 3B6OA 3UCZP 4YD2A 1P1TA 1YJNN 3R5AA 4NV0A 1YT3A 3AFGA 5AXLA 2PFNA 2V7YA 3UR3C 1RKJA 4OPKA 4GVBB 1RNHA 4HHTA 3RMCA 3K9JA 4WP3A 2DY4A 4YDUC 1KVJA 3ADAC 3NBPA 3C28A 1K1QA 3RRKA 4ATNA 1NRKA 3CCRS 2YKQA 3TWZA 2JLEA 3UQ0A 2Y1RI 2H3IA 4HEA9 3CJ3A 3ZD9A 1HWJA 2QX0A 1V6HA 1ZQKA 4AXJA 2FJVA 3D0HE 1U1PA 5M1KA 3O3FA 5H1SQ 5C12A 1IO2A 1CXUA 5AM1A 3U9ZA 4BRFA 5AQRA 5AZIA 3GFKB 5EN1A 3G86A 3MN9A 1RABB 2B3TB 5BOMA 1ZBTA 1IXKA 4G9ZA 1RTIB 4FPBA 5I3PA 5KRTA 5BXIA 4BWJA 3VQ9A 4RNHA 2VPZB 4I28A 4BDPA 1RWXB 3DLLQ 3V81B 1ZQEA 2A19A 1P90A 3HSGA 4FF3A 2Q3PA 1IBLK 3MWPA 5C0YA 5IWAF 3RRGA 1SQGA 3MWTA 1F6TA 3FBBA 4PWWA 1R0AA 3W64A 1HYSA 4PGXA 4W5QA 1I3OB 2H4WB 1U48A 4FPIA 2FUG9 3E8OA 1Y97A 1NB2A 3DGPA 3OVNA 1NK0A 4J8FA 4B1UB 5A0YA 4F72A 3TFSA 2WAQF 4PG7A 2QB0B 1HARA 4P2XA 4KGXB 3ETOA 3WIUA 5ALRA 2EWHA 3JSMA 1U0HB 1WI8A 2NPIA 1OYDA 3V7KA 3IS9B 5I3QA 3V1OA 2O67A 3PSTA 1LFWA 1W0HA 2KKZA 2P9SB 3FK4A 4DXLA 4WFZA 4KLTA 5B09A 4BX9C 4X64F 3QT6A 4QWDA 2HQGA 3IWLA 5ALMA 2ZBQA 3C5FA 2ISPA 4RW4B 2BANB 1N4LA 4ZCKA 3EXCX 2MUTB 3VOVA 1GXLA 1NGHA 2E8NA 1DGJA 2K06A 1DKGD 2B8QA 3WKDA 4CLFA 4PKDB 2EPIA 2PO4A 1JJ4A 1K8AO 1F9FA 3OL7A 2AHOB 4K42A 3GU3A 2W55A 4CW7B 3PEHA 1Q7YT 2QK9A 1AW0A 4WU2A 5KG1A 4G3IA 3M8SA 4C98A 3L3VA 2QZ8A 3ZDEA 3A8EA 4DFJA 2H5EA 2XEXA 3BZQA 1TUYA 3HILA 1VQON 2OIHA 1SVDA 2HBLA 1K8KA 3NF7A 4UZBA 5KG5A 2HBZB 3I55S 1S4EA 1IM4A 2QWNA 2GOLA 3CNHA 4QZIA 3SMVA 3OTOF 5ALLA 4J9NA 5KI6A 3UW1A 4GKKJ 5KAFU 2HBYB 3SQGB 3BS7A 3OTEA 4DX8H 4IJNA 4HDHA 1AB8A 4BJQA 3MPVA 3LWMA 1GEHA 3Q8SB 4ZP9A 1L6NA 5ALGA 4O23A 1RILA 1OPZA 3RJFA 3M9OB 2QI2A 3MECB 4MHVA 4ILGB 1Q8KA 2A2DA 3Q8KA 3SUOA 3VESA 2YB1A 4V1Ak 2XY7A 3B4MA 2AIRB 2VYPA 2FVRA 1IM6A 1CJTB 5J0PA 5F8GA 5KG2A 1YHQS 2B4PA 4RBUA 5L1IA 3DDIA 1IWAA 2ILYA 2WMMA 1TL1B 1Q86T 3ZZ0A 4QU7A 2CXEA 2WSFC 4OYWA 2A2CA 1PIEA 4KO0A 3KVGA 5DRKA 4WQ4A 4ZPVR 3O1WA 3NRWA 1XQSC 1XQIA 2KM8B 4C8KA 3E66A 4JI1K 1VI7A 3BSCA 5AR0A 5DQGA 5AIAA 3RBEA 4CEZA 1ZBHA 2ZOGA 8ICVA 2F9DA 1TAQA 1Y10A 1JXEA 4R79A 1JLQB 2OSRA 5DM7L 2Q31A 2DRDA 4RQ2A 2AYBA 5HP1A 1SXDA 4Z7CA 3NF8A 1X40A 4KPCA 2XSJB 4PG4A 3OS0A 4FLWA 3CJ8A 2FVSA 6AT1B 5I3UA 4OX9F 4AP9A 1BDGA 1NGBA 1JROA 1RLCL 2QL7B 4LF9F 4CF4A 3NS7B 4KX3A 4J37A 3TA2A 3HVTA 2DNHA 2HZAA 4M2YA 1XU4A 2DY9A 1QSLA 1UKUA 4AHTA 3B78A 3R6GB 1TTHB 4ALZA 4YOYA 3IBCB 4DR5F 3HHNB 4YMNA 4F3TA 3HPGA 2XULA 2LFVA 3OVSA 2AZ1A 4JK1A 1A5WA 2V4JA 1AZSA 4KHPF 4YDUA 1SC3B 1KN5A 5LMUF 1T95A 4FZVA 4OZ3A 1KD1T 2RKIA 5KAKA 3HJFA 1TR0A 4LF1A 3H98A 2Q6BA 4IL6U 3BYRA 2CH6A 2XI3A 2FHKA 1B4FA 1HNXF 1NDPA 4WKRA 4OI4A 3S9HA 3PACA 1N5YB 2VFUA 2DHHA 4EYHB 5AQJA 2K89A 3Q24A 2VC0A 3MHYA 3SQOP 1ZQIA 1RTHA 5LJ3Y 3I8DA 5GAEI 4QJVA 4CZFA 3QNOA 1ITGA 1SV0A 2YX8A 2HQDA 1JMTA 3ZTQA 4BROA 1VBXA 1HW8A 3V7JA 3LP2A 4XH1A 4ILRA 2R8HA 4CF9A 2BH1A 1PK1A 4FYWB 4MFBA 5BR8J 4E7IA 4QU6A 1UETA 4Y65A 1PAUB 2WF5A 1TVRA 5AZJB 3ET6B 4O3RA 5J0WA 3FZLA 3V9WA 3F44A 3L3FX 3IN5A 5EX0A 3PW4A 3AA8A 1J6ZA 3EWAA 3VF4A 2DXFA 4C0BA 5JS1A 2K8AA 3H7HB 2CVEA 4UAYA 5M1OA 4BC2A 1MWZA 1WDTA 3RSEA 5CEHA 3W1YC 2ROPA 1O1WA 4H4KA 2H65B 1VQ9N 2GBZA 5B0DA 1VBYA 1EXNA 3DNCA 4FYVB 4FVUA 9ICSA 3RAXA 2QLFB 4QIWD 4PZNA 4DR4K 4YEAA 3MMJA 4CNYA 5HO4A 1SAZA 2CXYA 2RIJA 3FFKB 4A61A 1D8YA 1D8BA 1U8SA 1L3KA 4P74A 4EO8A 4X62J 5HI7A 2ZUDA 3DOLA 3CJSA 3KUGA 4MKAA 1OY8A 2M8DB 2C3PA 3R97A 2HB5A 3QDKA 2MLYA 4X4VA 2BEFA 2N4DA 1Q18A 3WNEA 2VG7B 3RJEA 2KFZA 4DLEA 3F73A 4BR7A 2ASLA 2KTQA 2IYGA 2FMPA 3O9SA 4I9LA 9ICLA 2UV8A 3E51A 1Q86O 1RDUA 2NLXA 4C11B 2R8IA 3M30B 2EFVA 5C7PA 3QRPA 4LF4J 1H38A 1ATRA 1KVKA 3NAIA 4LSNA 1D3WA 3CCRN 2Z2LA 3FBEA 5IINA 2W4PA 3SMZA 3VC8A 1KBRA 1N5WA 2Y1JA 4PG8A 1R43A 3M3ZA 4KQZA 5KFUA 5H9FK 4CEAA 4F7VA 1OVQA 3FR0A 3RR7A 2OHDA 4IEIA 1B7YB 3ZT0A 5HSPA 3OXFA 1N36J 2H3QA 4DR6F 1E4FT 2EKYA 1KW4A 1WNSA 3KMSA 4IS7A 5F3XB 4PHDA 1Z19A 3V6KA 2R9LA 2P1JA 4F5OA 1ZJMA 4YB6A 2DNZA 1WSJA 4OI0A 1CJUA 4OI3A 4XDDA 4LRCA 1HHSA 3PG9A 2E8MA 4NA3A 4L3KA 3J7YI 1OSCA 5HBMB 3SAFA 4J9OA 1XMQJ 5GADP 2PFPA 3FSIA 1OJ4A 3A13A 2FC9A 4DFDA 1KD1O 4DV6K 4LRFA 5KT3A 2ZHOA 1IKYB 4DOAA 2LEBA 1YK9A 3OS2A 2UU9F 3R6LB 3MAQA 3SBMA 2VQEK 5IV3A 4Q2MA 3VGTA 3E9PA 2VICA 4DTJA 3ZSOA 1YTUA 4EP5A 4CF3A 4I2AA 3QICA 1R59O 2B21A 5AKYA 3FRZA 2DCUB 4DX7A 4M3UA 5DM6Q 2W42A 3EUNA 3A3PB 1FRJA 2I5JA 4Q0BA 2NSCA 1BD6A 1WYGA 1XN9A 4DV0J 3L7UA 1RAOA 2QLJB 4JI5K 2M2BA 2DH7A 3M8RA 2CQGA 1TL7A 3WXIA 1QHTA 3SNNA 2C3OA 3QO9B 4CGZA 5B0GA 1W2BM 4OJ3A 3GG4A 2GWKA 2M0GB 3HD2A 4NLWA 2K8CB 2EH9A 2PA8D 4R8UA 1QLNA 1KEKA 2GGPA 1RTJB 1SQFA 2K1RB 1O13A 2GQQA 4U67L 3UE2A 1U8WA 4HDGA 3UO0A 3KHHA 2KE7A 4CO0A 2ALYB 3H8MA 2OMOA 4IO9L 4UZCA 1TZ0A 2H3EB 4DF4A 2DGWA 3J8AA 4R25A 4H0VB 3CC7S 3MOZA 1I3AA 1H98A 4P2MA 2AU0A 4NEYA 3I55N 1NPKA 2W7OA 2ES6A 3FMBA 5LMUK 4B9NA 3QIDA 4HACA 1IBLJ 2CQHA 2Q0RA 3T1YF 2EFOA 5KG0A 1UZDA 2FC8A 2VOPA 1YJUA 2HIQA 3ZZRA 4NY8A 1MA9B 2L3MA 3NS5A 2G8VA 2GMLA 3H0RB 1V4SA 5K8OA 2VL1A 3FC9A 4CT8A 4QWCA 1HI1A 1EXQA 1VQPS 1ZQYA 3Q8PB 1MQ3A 2YVSA 3BF4A 1ZTTA 5T7BA 4HUGA 3AU6A 2FDNA 3THVA 2CYYA 1Q8IA 1GQEA 3ZDAA 4X5VA 4BDYA 3OVAA 3IRUA 4ED3A 4KH4A 1YHQN 3PEJA 4A2AA 2HHTA 2NQPA 1S6PA 3I0RA 1WCLA 4Y2TA 3ENBA 2IFXA 3AA3A 2OLWA 2YPZA 1X4CA 3R7BB 4ECVA 3HHDA 1RTDA 3CCWA 1M5HA 5DDMA 1S72S 1C2PA 2HSEB 4DUZK 4DR3K 1CUKA 2Y9TA 5D0GA 2UVWA 5CD4A 2HWTA 5ALZA 4HHHA 3WNHA 3MEEA 3V6DA 5IS2A 2JGAA 5KAIU 3B6PA 1PSDA 1T11A 3GWCA 5JICA 1E6YB 2OAUA 1Y0HA 2NXNA 2H9ZA 5RUBA 3N79A 4CGJA 3DYAA 1RA7A 2BJEA 2VQFF 2F77X 2IHMA 4QPXA 3EO3A 5J2BA 1GFWB 1UWBA 1S3XA 2ZC3A 4GFJA 3K1RB 1MA7A 1ZS6A 3LM9A 5K4LA 4HLBA 1C0MA 1A0PA 1KDNA 3RTVA 1NKCA 1RU1A 4RW8A 4K4SA 4DS4A 2XO6A 3WC2A 4PXEA 1UVLA 2GW8A 2D3UA 3U1MA 1BIUA 1U2CA 5DDPC 2FQQB 1S0OA 2BCRA 1RAGB 3ALYA 1Z05A 4PJ0U 4FO6A 3RGIA 3QEWA 3CE8A 2B4JA 4OJRA 4ISFA 1RHQB 4LREA 3ORYA 1FWLA 1HBNB 2LEPA 4K4VA 3N4QA 2PFDA 4YS2A 2QMXA 3QMQA 3OL6A 4EEYA 3X3UA 2Z1GA 3TAQA 4Q8FA 2G2YA 3R1LA 2HFZA 4X4OA 3SMPA 3AO2A 5L1MA 1F3VA 1TVAA 1PAEX 4OHZA 1FNOA 1Q79A 2RRAA 1R8AA 3HFKA 4ELTA 1S1XB 3U9DA 1KS2A 2OO4A 1DK3A 5LSLA 2WF9A 1RACB 3VEXA 1Q3VA 5C42B 1ZQJA 4UB1A 5KNIA 4MYUA 4JI3F 2NRWA 4KTQA 3UKRB 3WEEB 4JI1J 2G8WA 3THYB 4QZDA 3CYMA 4DR1F 2Z2ZA 3W66A 1BIZA 1W7AA 3HFVA 1CQMA 3TTFA 2ZF5O 2NUBA 2Q36A 3R27A 1CLQA 1X9JA 4Y6IA 2JL9A 3ITHA 2QG9B 4BLGA 1R89A 5ALDA 2J7UA 2A3VA 2B4VA 4R5PB 2MTLA 4AM6A 4C0OC 4C8LA 2Q1LA 1WG8A 3OYDA 3UVJA 1FFVA 2VPXB 2MQOA 5HN0A 4ILMA 3LYSA 3ZTSA 3KK2A 4KE5A 3DJCA 1LK5A 3BO4A 1XNRK 4FWLA 3P96A 3CCQN 2VPWB 2HSTA 4NRUA 4NXMK 1SJ1A 1WF2A 5GTHU 5J29A 5C24B 3HPHA 4XH4A 5GAGI 3F5EA 2BPCA 4PA1A 3Q83A 2W25A 2FBTA 2CUYA 3MMBA 2VJUA 3RMDA 1IVZA 3K5PA 4Y0FA 2W2MP 1SH0A 4EMDA 3M1VA 2MKCA 3IUCA 2XY5A 4YB1P 4JYAF 4DDFA 3GJTB 3KKAA 3LO3A 2V4JB 2EZXA 2FVQA 3CCSS 1PVQA 1N5TA 2UUAF 2ZVSA 4DN9A 1NAQA 2QMWA 3R9KA 3OR1A 4ZN1A 4DJBA 5EDWA 2KJ8A 1HL6A 2OA8A 3NRZA 4UAWA 4U7UD 3CW2C 3C94A 4JUZA 2R18A 2UP1A 5HJYA 4PL2A 1VCTA 1Z4UA 2O8CB 2A40A 3SENA 3CCUS 1I39A 1ZBIA 3T1HF 3HSJA 5ALUA 2IRUA 6FDRA 4OI2A 3OD2A 1TK8A 3VR1A 2JFKA 1YJWS 1HPZB 5JLHA 2UXCF 3QRRA 4PXBA 2JGUA 3JPQA 1HKAA 3PYDA 1U04A 1RQLA 2WTFA 4J2AA 3D3BJ 5FPEA 4DPYA 4K4GA 2JV3A 2PMWA 4ZP8A 1VSLA 3QZ7A 2F9WA 2QXFA 1A76A 2M5YA 4O5EA 2HF4A 2W7PA 4BCAA 4GVLA 1YITS 2Y0SF 3PIPL 2F4VK 1IBKK 4FVCA 2R7SA 3CPWR 1P8ZA 2FVPA 3CIPA 1XERA 4KLDA 5IWAJ 1EO1A 2EAPA 3H2VE 2C28A 1TE2A 2YX6A 4JS5A 1O8BA 4DR4J 3E1YA 2CFXA 3WT0A 1X4BA 4UAUA 1YDLA 5G0RB 3TUJC 3KIOA 2CJXB 1U1KA 3VTIA 2FXUA 4MN4C 1QUPA 1B7FA 2WUSA 4FW2A 2H3ZA 1A6SA 4GXJA 2ASOA 2ZKTA 1HBMB 1Y11A 1N62A 4GVMA 4LIWA 4N5SA 4CIFA 3MCPA 2V5HG 2BPGA 1N0VC 1JXBA 2NO5A 2CQDA 2HHHF 3DOMA 2P5VA 2B0GA 3NMUA 1WUDA 5KG4A 2B9WA 1F9HA 2VG5A 4PKHA 1EX8A 1LW0B 4O3MA 2HI0A 3BPDA 5AQFA 1QJHA 2IJFA 2E1PA 1MWMA 5J2NA 2XMWA 1HI0P 3EGNA 3AODA 3BY5A 1OH8A 3AEVA 3LANA 3H42A 3Q0AA 2ASDA 4HT7A 1TV6B 2E2QA 5AQTA 3A5LC 1HQEA 3JPNA 1KAXA 2BOAA 3NOGA 4OHWA 4KFBA 1Y4ZB 5H9FJ 2XMVA 3CCZA 3UE5A 1N0UA 3BB5A 3T1AA 2QTWA 1YXQA 1C1AA 1X6JA 2G8FA 4MIWA 5FPDA 1SKSA 4HHUA 2I9SA 3LGNA 2A3JA 4UT4A 4KLIA 1VQ8S 2Z1IA 4QW9A 3CJKA 3E3XA 2V94A 4LC9B 2G13A 2QSWA 3F2CA 4LRDA 1IG8A 2XQCA 3CC7N 4CGDA 1YJ9N 4IQTA 1NH8A 4IBNA 2YH0A 3SCIE 2CPYA 4EBEA 1A7GE 3BZKA 2GCFA 1H7WA 3VF6A 4LJMA 4O4GB 1S6OA 1WC5A 2WB4A 3NDKA 5JU5A 4NMLA 4F5QA 8ICGA 3PXGa 1T03B 2IJRA 2P6TA 1SWWA 1RWPB 2R2UA 3UMCA 1WDDA 3TAMB 3OYAA 3QEVA 2QWRA 4E89A 1C0UA 1JLAA 5AI5A 1Z1BA 1WUUA 1HNZF 4MLHA 2CQPA 3VHQA 5EOYA 3ILJA 2DXEA 1H0HB 1RT7A 3UKUA 3L8BA 2E1ZA 8ICJA 2QFIA 1HD1A 1SV5B 1QTMA 1LNQA 3VZIA 6FD1A 2AJ1A 3BS9A 4W92B 4X4RA 3OFEA 3AMZA 8ICAA 4LF8K 1YJTA 4JI5J 3RF9A 8ICEA 5AICA 1DLOB 1S72N 7ICMA 3BM7A 3EKUA 2NXUA 4X65K 4KR0B 5J2PA 4LFAK 2NRHA 2P9IB 2I9GA 5DKWA 3ID6A 2MLZA 3V2UC 2OYYA 5KT7A 3RJIA 3RAQA 1HR0F 4ES1A 2OD6A 2E7XA 5FIIA 4TQSA 4F04B 4OYPA 2EAMA 3D2FA 5KG3A 2NZ4A 1H7XA 4IFVA 4USVA 2GGPB 4JOUA 4NWIA 4I64A 1L3UA 1D0EA 2Q79A 2KT2A 2QLTA 2KKVA 1DARA 3OHAA 3VA3A 2QGFB 4JI6F 2ZFHA 1G1XA 4IH7A 1TKZB 4WK1A 3HYFA 4B8CA 3MAHA 4KHPJ 5DBBA 1S1VA 2ZH5A 2H51B 4IZ9A 5CYJA 4Y2SA 5LMUJ 4X4SA 1ZOLA 4ECRA 3QIPA 3MCAB 4YDDB 4ELUA 2CNOB 4JYAK 3BQ2A 3THXA 3D45A 1ILYA 2X51A 1HNXJ 4FNHA 2ZE2B 5T41A 1FRXA 3FYHA 5J1NA 5IM0B 1ZQWA 2KHCA 3CXCR 1PBAA 4ZOSA 2YJFA 1VQSA 3GYNA 1NNEA 4UOCA 1R8HA 3NP5A 4K2JA 1SC1B 1JLEA 3W2VB 2YNFA 5LSOA 2I1RA 1V85A 1NBEB 3EE3A 5KFIA 5L1KA 1PJ7A 1Y88A 2WB1C 5ADZA 2J76E 2G0CA 5AKZA 4FPRA 4BVOA 3ENHA 3AJDA 3BUZB 3JQJA 4P2FA 3HKZC 2CJYB 2O4IA 4DTXA 4CTAB 4ZJLA 3E01B 3DLLL 4QJFB 3LPYA 2VBZA 1RAIB 1Z2ZA 1WC4A 3BZCA 4GIBA 4NLGA 1LQ9A 4MF8A 3PO5A 4DSJA 4KB7A 2ZIUB 3SBGA 4KAZA 8ICTA 2E5HA 3PIOQ 1YSJA 3N4WA 4FXVA 4RU2A 1BHLA 2GHWA 4QYZK 4ZIVA 1VQNS 3VERA 2DRAA 4KT0C 5AFUA 3MMAB 3VTHA 2XNRA 1VSDA 2UUBK 1RT2B 2IDEA 3U7JA 5F8MA 3KZXA 4RQ7A 3V6DB 3K5NA 4ISGA 3AOAA 2MQ8A 4M3ZA 3AD7C 3HOSA 3D6HB 2AKWB 4NLTA 4JV5K 1U49A 2FHMA 3ZX2A 4ERDA 1FDDA 4WFNQ 2ZOMA 3F2DA 5AI9A 2P9KA 3EDQB 5D4PA 1J97A 1UAWA 2B43A 4DQQA 1RK8A 3RRHA 3ENOA 3R9PA 4USHA 3EX7B 3MN6A 2F1IA 3IFEA 5GMKa 3DXKA 1JKHA 2FJEB 3MEKA 4E1NA 3ZLJA 4U96A 2OEHA 3ZX3A 3CDBA 4JWNA 3AAPA 4M5DB 2IHNA 1YF5L 4HUFA 3I9V9 3K0SA 4Z4EA 2HVDA 3CCSN 4HVZA 3BGOP 1UQVA 1MWKA 5KPTA 3BPSP 2E88A 1BUPA 3EE9A 4YFKA 5DG8A 3NG8A 5C2GA 3CPWM 2ZBCA 2M52A 3DMJB 4EEKA 3M32A 4JBCA 1QAYA 5HROB 5HMWA 3E58A 1VC5A 4L6V3 4EUVA 4MKBA 4L72B 2AGPA 1CJVB 5K20B 2BW2A 3I1YA 4LUBA 4YORA 2KVSA 4OLBA 3BGFA 3QGGA 5AXKA 4CHPA 4LR8A 5F8JA 2RLTA 4LR9A 1X4AA 2BDUA 1YJWN 2BQRA 1EQYA 5GADI 4RWWA 2V69A 3DLEB 1QQCA 3DLGB 3RYLA 2MAXA 4IO8A 2JC0A 2YHBA 2D9OA 3FM9A 3S7RA 1SKUB 2IBKA 4DR6J 2FMQA 2PAVA 4XIUA 4CLUA 1CEZA 5L38A 3O9UA 5TISU 1G6BA 1KOHA 2Z30B 2E5LF 3M7VA 3CJ2A 3N7SC 2P6UA 3AHPA 5D8HB 3HD1A 5F3ZA 2X6NA 4CH0S 4NLXA 3HOTA 1DQ9A 1R27B 2WVFA 3IG1B 2ZM6F 8ICPA 2B8PA 4LF2A 4A48A 1RWUA 1X5SA 1XNRJ 4F25A 1JL2A 4BG9A 1V5VA 2MHNA 2YQ1A 2OYQA 1PVRA 4KX5A 2AJ2A 1JNRB 3C6UA 5AKEA 4JS4A 3HSDA 4NXMJ 3KNAA 3DM2B 2IAJA 2LXIA 4USIA 3OYIA 2YNHB 5DS7A 3OR2A 4A8SA 1SPBP 4HI2A 3MGHA 4BRCA 2UU9J 4CGHA 2J8AA 3F56A 4RNFA 4TUPA 3CETA 2ZIXA 2HF3A 3BKTA 2IOCA 3SMSA 3VQ7A 4B3MF 2BCUA 4RT3A 3GE9A 3Q23A 5KFRA 1W26A 1Y5IB 1NSQA 1KAYA 1OXJA 3SFUA 2E1YA 5HP4A 2G8KA 2OPSA 2WZ1A 1F2GA 3HCXA 2X6SA 4M04A 1CQNA 3VQ8A 4GNIA 2O1PA 3HHEA 3ZZZA 2CWKA 2RPIA 4BR9A 2F8EX 2PDAA 3L3CA 1U1NA 1P8GA 2K4HA 2JH7A 1WF1A 5E84A 4O5FA 4NO7A 2ROGA 5ETSA 4YMOA 5ALHA 1T0TV 3KLVA 4RLEA 3PX6A 5CP2A 2PMHA 4JK9A 4ZJQA 2KVIA 3H3OB 5LMNF 4BRAA 2A1RA 3MCOA 3JYTB 2RHFA 5IOLA 3D5MA 4OYAA 3J81O 4NE9C 5FPNA 3OBIA 3OQ2A 5HL7Q 5FRNA 4Z6DA 3VF0B 3T3FA 1RHJB 4L3NA 3E9LA 4CJ5A 5HLFA 3IAM9 4Z4GA 4QAGA 1KR4A 4OYMA 4E2FB 3FZBA 1N33F 4WJ3B 2CQ0A 4UBBA 1VQ8N 2IVFB 2G09A 1J27A 4ED6A 3PJWA 5HMXA 1NGFA 1I94K 3MGJA 1RCXB 3D2NA 4Q44A 4CNZA 3EVWA 2B9EA 4LZDA 8ICKA 2F4VJ 5D3GB 3NEKA 1IBKJ 2J0WA 2YWHA 2O8DB 1R8PA 4C7YA 1FKPA 2CZVC 4RW9B 2J6UA 2XLIA 5KFEA 1Q16B 4DMNA 2HHWA 4D3HA 4YVZA 1CVJA 2HFVA 4YP3A 3TI0A 3CCJN 4KKOB 2UUCF 4H4OA 2NO4A 1T8EA 3SSSA 3BQ7A 4LH5A 3RR8A 4P4OA 4Z2XA 5CZXA 2RT3A 5GINA 2JXJA 3TAFA 1W97L 4CZIA 3MXIA 3CFPA 4CDGA 2MGZA 2P6RA 2N7YA 4DV3F 2F1JA 1Z6RA 2P9PA 1X4EA 2JJ4D 3FEXB 1EWRA 4PXCA 4ILHA 1LB2B 2Z1HA 1MWYA 3DCAA 3QERA 4DL5A 1HWLA 3P3DA 5CHIA 4IR1A 2ZJQQ 4CGFA 1LW2B 4CEQA 5ETQA 1QQMA 5BYRA 1HLWA 1WOOA 2DO0A 3OFFA 4CLSA 2W6KA 4CLPA 2NUUG 1ZJNA 3ZZYA 4DR2F 4KLUA 5E2QA 5HATA 2HRYA 1MSWD 5CYMA 4H4MA 4ZPWR 1KQQA 2BJ9A 1S6QA 4OD0A 2FSNA 3CXCM 1VC6A 3VQ5A 2RB7A 1FXRA 2JWLA 3KK3A 2LQ8A 4DX6A 3BN7A 3VGKA 1NNDA 4JHDB 2GJ2A 1Z3EB 4KFBB 2F5GA 1VSKA 1FTCA 1W9HA 3FFIB 1RBVA 2KO1A 4FN5A 4UQGA 1RUSA 2HPUA 1VSFA 5E3AA 4JI2K 2NUHA 3O3LA 4MKVA 1XR7A 5KT6A 2BE9B 4DI6A 3CJKB 1XR6A 3K9KA 2EFGA 2OPQA 2RQCA 3EVOA 5A8WA 3RW6A 3PKMA 3WKCA 3MEDB 2VBYA 1XMOF 3LGHA 3OJUA 4EIAA 2QSFA 2BA9A 2FJBB 2YKNA 3W62A 2P35A 2CN1A 3TJ9A 1VR6A 4QPTA 4G65A 4OQJA 1PYTA 2GA7A 1A5XA 1IH7A 1FJ7A 3CCLS 5AJ3F 3R5JB 4DHVA 5HJXA 3NGDA 1UPPA 4F2SA 2EFNA 4L75A 3C3LA 1H74A 4FF2A 1YVUA 4JI3J 4FCYA 2LKYA 4EX7A 1KBUA 2IVOA 3QETA 4LF8J 1BO5O 4WWSA 3UDCA 3UKUB 3K59A 1IR1A 2WB1D 2N3OA 2P66A 1IKVB 3R8YA 5D78A 3U02A 3WK7A 4P71A 3PY8A 4X65J 4UW2A 3WK6A 3KOOA 3M6VA 5I42B 3DDHA 1VQNN 2FPMA 2V8VA 2QA2A 4QZ9A 5CXTA 1NI3A 3V6HA 3M2UB 4LR7A 2NNWA 1HKBA 2YTUA 4ICLA 5AQNA 1U1LA 4ZN3A 2B6AA 2DFEA 5I4MA 4KHMA 3QNNA 4KH0B 4USKA 2N3LA 3AO1A 2CPIA 5ALFA 5CRXA 3ISNC 3HFZB 4HH0A 3KK1A 2A5XA 2ZUCA 3UDLA 3D2FB 4I2QA 2Z58B 3PX4A 2HBMA 4QIFA 5G4DA 4QS7A 2OPRA 3L4IA 2KVQE 2ZZTA 1PYOB 1N2XA 2IDOA 3CC2N 3HL8A 4UAZA 2DITA 4B3MK 2D1KA 3QJLA 1YG0A 3O08A 1HNWF 2E9TA 2AWZA 3HP6A 1QM9A 4E7LA 3AAWB 2EI5A 3NVYA 1NU0A 4JYAJ 2KG0A 2UUAJ 1QSYA 1SV4A 3ISCA 3N9UC 2GZOA 3O9RA 1WLJA 3O80A 4OHXA 3PMLA 3MZIA 1S0VA 5DM7Q 3NE6A 1ED1A 4IYQA 4FF1A 3WK9A 2MZQA 1L3VA 9ICRA 3G6VA 3OHBA 3OPKA 4K43A 5EXWA 2WSCC 3HJEA 3D6RA 2W9MA 4Z0UA 5ALJA 2PMZD 1G3OA 2H3FA 2CQ2A 4IKAA 1KCFA 5J2GA 1H73A 1JLEB 4LIRA 1ZQRA 1NO8A 2G4BA 2BTFA 4PRFA 4O3NA 3C6TB 1WORA 2K7KA 4HR2A 4N7TA 2UXCJ 1B0PA 4J2DA 4JI4F 2M9KA 2KU7A 3A8JA 4P4MA 5DK5A 3ZT1A 2J9DE 2HVZA 2ZOFA 3GMGA 1ZC6A 1MW7A 5E41A 1Z4OA 7ICTA 1BPEA 4FBTA 1O0PA 4QZCA 4AL6A 2HLTA 3WXKA 3EY1A 2V8HA 1TAMA 3C66A 3TSPA 2BJ7A 2D6FC 4GW6A 1S0MA 1CSJA 2FZCB 4W98A 5HHIA 1RWNB 4CF1A 1XJWB 2ABYA 4ED1A 3ASMA 2V9WA 2GAGC 5L9NA 3KD5E 8ICQA 2V2QA 5T7LA 4JV5J 5CHGA 2VODA 2ZBRA 2EZYA 1OH6A 2R7QA 4LVNP 3N97B 4B9LA 2NXCA 1PGZA 1IG6A 4IOCL 4ZLLA 1GOBA 1BPBA 3QFWA 3F5AA 1WWVA 4ZPBA 3DLHA 2E3TA 2E4LA 2VFVA 4URSA 4FJ5A 1FXDA 3P45B 2AXTU 3ELHA 1WBBA 3I56N 4RG8A 2BABA 3FCVA 1BLUA 2HHHJ 3NKYA 1X7VA 3SXLA 9ICOA 5HK4A 2FMSA 1YVNA 3LL3A 1MMLA 4JP8A 2MZ1A 4PHTX 4O8KA 4A59A 2ATQA 2O3DA 2R2TA 5KFQA 2HHQA 2F7VA 2XCAA 4CJEA 1RGVA 2ATLA 1RT1A 1LWCB 3RMBA 2ZUGA 4DFPA 1TFRA 3D0GE 1B9DA 4LQ9A 3R9LA 4RR5A 3UD4P 2LA4A 1I5OB 4HHJA 4K8ZA 2YKMA 1J9AA 4YDXA 2LCWA 5CYQB 5EE9A 1NLKL 4HI1A 3G0ZA 4DV7F 4OKKA 1ZM4A 3DRPB 1BQNB 1IWGA 1RCOB 1S1TB 3MTKA 2GMHA 2C22A 3MM8A 3MGVA 2GVDA 3Q8RB 3IM1A 1BG3A 4YNQA 4DWIA 3LF0A 2MQLA 5AT1B 4J9QA 4AYBD 1HQ2A 4LF5F 4BRLA 4FJMA 2RU9A 1N60A 4Z6FA 2V2ZA 2WOMA 5H9EJ 4PKGA 2DNLA 3LDNA 1S49A 1Z00A 4KLEA 4C4WA 5KFFA 4LJXA 2BPFA 2D5RA 3LW5C 1SL2A 4CHZA 1M1GA 4JKAA 1HUOA 3ZFVA 1H2UX 3VEYA 2R8GA 4ZIWA 4H5VA 2HFNA 4RO0A 3MCNA 3ILOA 1M6YA 4QCLA 5J0TA 1CG2A 2GELA 1BPDA 3V1QA 2W9CB 3BS5A 4IH6A 2D3OR 1Q1KA 1CLFA 1SXEA 1Y5LB 1MROA 2D8CA 1WC1A 3MUMP 3R5DA 2ASYA 5F41A 1HNZJ 1RWKB 3EZUA 3WZ0A 1VSJA 4CIOA 3NH1A 2DKZA 3IDHA 1LWEB 1TUVA 5AJ3K 1WCNA 4B9SA 2DNPA 4PCQA 3HHLD 1U0SA 1NDCA 2DFHA 2PEHA 1JJHA 1TKTB 4LRBA 4GKKF 3W9IA 4ED2A 2W8KA 3CWJA 5DGAA 5CR4A 3A8IA 5F2RA 2ROEA 2A6OA 4YHHK 2PGCA 4BC9A 3HXMA 3Q7CA 4EELA 1LXJA 2QEXS 3NGZA 3IXQA 4DF8A 1KQSR 3CJ7A 4ILJA 2BZFA 4C8OA 5ADXA 2DIUA 4QZHA 1NMDA 3E9OA 1J53A 3H5UA 4JRQA 3J80O 4F91B 4G6VB 3KKSA 2VANA 2W7AA 1FDNA 1OUQA 3UWTA 1KTQA 4RT2A 2GLEA 2W6LA 2Q6CA 3M1FA 4CZGA 2YI1A 4LF6F 2F9TA 1LOTB 2EDUA 5CE3A 3SAGA 5DJBA 4BXOA 3AARA 2F63A 3GQCA 2QRRA 2PI4A 2G1DA 3POTA 1DZ5A 3BEGB 3LVVA 4C0ZA 3CGIA 3NCIA 2PN6A 3M2VB 3HZGA 1DK2A 1NSAA 4WJBA 5KOWA 1UHUA 3KFWX 2YWKA 1QAJA 5LJWA 2ZH6A 1S22A 5E33A 1FNMA 5GMDA 3ISBA 3FUYA 3GCXP 1EETB 3GYGA 1WKLA 3C19A 4LZGA 4I2JA 3SIPB 4HH1A 2ZUAA 3PZPA 4JKGA 2EFQA 2R42A 2QT7A 4CO1A 1HUZA 2C1EB 2R7VA 2C3UA 5AM4A 1UVKA 2D3ZA 5CWRA 4PHPA 2ZH9A 2FVCA 2NYIA 2DR7A 2ZIVA 2YH1A 4ZTJA 3NCRA 4K41A 4DHYA 2P2CB 3EZOA 2H48B 4KIAA 3MM9B 5EX5A 3W5ZA 5D4LA 2W4DA 5GMEA 1COOA 2KKPA 2VOOA 2RDDA 3WX8A 2ADBA 4TVAB 5M2UA 4AHCA 3DI6B 2CGJA 3CJQA 3RB3A 2AP6A 1Q3UA 4IQXA 1JB0C 3AAQA 3ILLA 4TY8A 3IBPA 2LECA 2YHXA 3ZSQA 2HNZA 5KT2A 4RL1A 1CC8A 3G6EN 3R5BA 5FP0A 3ZETB 1QE1A 3KKRA 1IBMK 4V19X 2RHKA 1U2VA 3C2MA 3SCJE 2YY6A 4C4RA 8AT1B 3GIIA 4NLSA 1T3NA 1FJCA 1C20A 3SQ1A 3HW8A 1ZQLA 2OCEA 2ZIWB 2YBVA 4F4AA 2R2RA 2MZTA 3C2KA 1TAUA 4F4WA 5KFTA 5ETNA 3J7ZO 2HAIA 1NU4A 1FRMA 3H2UB 3VQAA 4MDAA 4YOUA 2WRMA 3RB0A 3I0SA 2D7SA 3BGUA 5J1EB 3PJXA 2F76X 2HGNA 2FY8A 3QATA 4RUHA 4AD6A 2CQCA 3IGVA 3VQPA 2RRDA 2HFOA 2RVJA 1C0GA 1LAVA 1ZPVA 4ICAA 3VCBA 1ZD4A 1JQGA 3R6MA 2HW3A 3THWA 4JI7F 1EX4A 3CQXA 1FO4A 2YWGA 1WF0A 5KT4A 4JD2B 4IDKA 2BJDA 1HHTP 3U3YA 3Q2SC 5A8RB 4FS2A 5LSRA 4B3RK 4QIGA 2HHXA 2E9ZA 1RI7A 4CQ1A 1RT6B 2KHDA 4FZZA 1VHFA 5DB8A 2ZXIA 3BBFA 9ICFA 3W9JA 5AI4A 1BU6O 2H4YB 4X84A 1WAFA 4F92B 3A3NB 5AI8A 1KLMA 3HKZF 1X4DA 4F5NA 2DO4A 4AQYF 3GJRB 4AH9A 1YJVA 3N6MA 2CPDA 2PFFB 4H0PA 1B64A 2FF6A 3Q8MA 3CD7A 3CTRA 1U6BA 4X62F 4WQ5A 3D2EA 3ZTPA 2QARB 1FT8A 4ECWA 4XQ8A 3RH6A 3J7A1 4GC7A 4WFAL 3DRRB 4TURA 9ICIA 2WCXA 5C2DA 3TAGA 4ANCA 4OPJA 3SCKE 4KLGA 3OTQA 3WK4A 3RBDA 3O4QA 3NAEA 2I38A 1JLBA 4P0QB 3JXUA 4Y2PA 4UW9A 1HJPA 2VU5A 3C16B 1QHAA 3GP9A 2C2OB 2P9NB 4W5NA 3WNFA 4LF5K 2E5LJ 4CEBA 1WTBA 4YN4A 2R7XA 3L4QA 2VHGA 1J5OA 3D54A 3OUYA 1X3MA 3PJ9A 3NGTA 3QB0A 4EO6A 3HWTA 4WK3A 2L41A 2GX9A 4IDHA 2XMKA 4OZJA 4RKUC 5J2QA 4KTWA 2Z4PA 3D6JA 1NJWA 4CGGA 3ZD8A 1NJXA 4QQBA 4NB4A 4DU3A 4JB8B 2AGOA 2XVTA 3OGUA 3PW7A 4IWVA 5LXYA 4C9DA 3CI5A 4BC5A 4C3KA 1U24A 3DXMA 1KVCA 2BV3A 2FJWA 2DFLA 5JRTA 1S1UA 4B3MJ 2J9EA 4RUCA 1X0FA 2GTDA 2P9EA 4A8WA 2D4WA 2EANA 1RAAB 2G2OA 1LXNA 3N01A 3GJSB 2HQCA 4F36A 2RNEA 3KJVB 4X66K 3HLUA 3AVMA 1GLBG 1RBTA 5EE0A 2RU3A 3TTDA 3I87A 3BEXA 4MT1A 1XWLA 1UFKA 3UN5A 1XMQF 1E4GT 1AFIA 2KHOA 3AVNA 2B5JA 2DHSA 2ZBIA 3SSQA 1NZAA 2YPYA 1SKRA 4Y2YA 1FRKA 1NLVA 5C15A 3HULA 3TWHA 2LPEA 3ALRA 5C25A 3I5BA 1FO1A 5IC4B 2M7SA 2CPZA 2RQMA 2W9BB 1BHNA 5B7WA 4MEYA 2NSBA 5LMNJ 4BWMA 3L6QA 2XMJA 1RADB 3BSOA 5A8KA 4QNLA 1BPXA 4GXKA 2G1HA 3A12A 5HRSA 5I9EB 3K8WA 1SJ4P 5AQQA 3K7RA 3QWPA 1P27B 1HNIB 4O0JA 3AJ1A 5KFSA 1QZ5A 3LDSA 1DJ0A 1VQ6N 1DEJA 3RBZA 4NLYA 3TO8A 1CZ9A 2FIUA 4EX6A 1M90O 4UY8T 1N5SA 4FBUA 4I6WA 4NCGA 5B0BA 2BJ8A 4Y2IA 4H0OA 1MMDA 4NWBA 4C23A 2ZJPQ 1VDHA 2XM3A 4KI6A 4DV5K 3SI8A 4ED0A 2DPIA 3MMVA 5KGXA 2KIVA 4XPCA 3BN4A 4QZEA 1N34K 4G9BA 2LQBA 3TUZC 3C15A 4L73A 3H0MB 3V4MA 1ZZNA 2RS2A 4KPYA 3QBWA 4A5AA 4DTRA 4O4RA 2OM6A 4KV8A 4IJAA 5SZTA 1JLGA 1RAJA 2EZZA 3GIJA 2W9AA 2GMJA 1TL3B 4CLLA 5L1LA 1UJ4A 2ZTEA 5KL1B 2FGCA 1VSMA 3D2WA 2BHNA 3SZ2A 1X2IA 1IJFB 3M8ZA 1OYEA 4ZVUB 1TP7A 4DTSA 2VFSA 5U47A 2QEXN 1YKWA 3PIPQ 3OSNA 1EP4B 2MHEA 3MMCA 2OMLA 1GTHA 2XI2A 3NGYA 1R3NA 4Y1DA 4P73A 1E3MA 1FEZA 4EP4A 3THTA 3IFRA 5C2FA 1LWFA 2COLA 1FFWB 4GVEA 3VQQA 4I2PA 3LA0A 4KLLA 2GJIA 2E6MA 4WFNL 3UNYA 2O8FB 1X4FA 5KG6A 2QN6B 1D1UA 3BGRB 2HOIA 2JEFA 1TUUA 2IVNA 3ZSVA 4FKXA 4DX5A 3TFRA 2KXHA 2CKWA 3EE8A 2R8KA 2BCQA 4ZVHA 4ZVPB 4MIAA 2OXOA 2FJ6A 4RQNA 1RISA 4R0EA 3QBXA 1WWHA 2CNKB 2Q66A 2W2OP 3SLCA 3ZSWA 3ZZTA 2DNGA 1GLJO 3AB2B 3MM6A 4C7ZA 3IR5B 3AVGA 1MDUB 5B08A 4CNQA 3H25A 4O5CA 3LVWA 4CM2A 3GR1A 2DIVA 2FPHX 3SDEA 3ZEUB 1S1WA 1LKYB 1E6VB 3CMAS 1IV0A 5F0WA 4CESA 2G8HA 2VIHA 1UMJA 4A57A 5E3QA 1HEKA 1SCJB 3M8PB 5CQGA 2WOMB 1SQKA 3DU6A 4LQ3A 9ICKA 3B6BA 4B3OB 3MD1A 2UXBF 4NASA 2WONA 5IXUA 1N32K