1L3VA

Crystal structure of bacillus dna polymerase i fragment product complex with 15 base pairs of duplex dna following addition of dttp, datp, dctp, and dgtp residues.
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*AP*CP*GP*TP*C)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3vA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3vA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3vA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3vA01
1TKTA 3B6OA 3MFHA 4Q44A 3HP6A 3HL8A 9ICBA 1RT3A 1C6VA 1WAFA 2O4IA 4H4MA 5KFNA 3EY1A 2F1IA 2HHVA 2NRWA 1HMVA 3KD1E 1MSWD 1UOCA 2YNGA 1VRUA 1SKWA 2R7YA 4RG8A 4DTXA 7ICRA 5FROA 1F21A 3K5LA 1HJRA 3LAMA 1JLQA 2Q3SA 2JGUA 5J2HA 4CIGA 4Z4FA 1HPZA 3V72A 1UT5A 5IIJA 2ZTDA 3ZSQA 1LWFA 4PHPA 5J0UA 4DFMA 2OPQA 4M3YA 2QKKA 3SUNA 4PPXA 4HVJA 1DTTA 5KFJA 5KFKA 5L1LA 4FJIA 3MDAA 1ZYQA 4DTPA 3SQ0A 3AO4A 3SQ2A 3V9ZA 1RCHA 1UT8A 2EX3A 3SV3A 4PGXA 1TGOA 3S3OA 2QKBA 4KMUA 1TVRA 4UBCA 2C28A 2ALZA 4R63A 3RWUA 4Y1CA 3UQ0A 3DM2A 4TURA 2Z1GA 3LP1A 8ICYA 3MGIA 1C1CA 4I28A 2PYLA 4FS2A 4CJ5A 3G6VA 3FDSA 2XGQA 3Q8LA 4F92B 2GBZA 1NK4A 4IR1A 4PUOA 1QSYA 4CJSA 1RNHA 4YMOA 5KT6A 4BWMA 1A77A 4O4GA 1DOQA 9ICRA 9ICSA 3QERA 2P6UA 2Y1IA 1Q9XA 3SUPA 1K1SA 4DSIA 4ELTA 5C5JA 3CM6A 3M9OB 1RBTA 5DK5A 3V7JA 4IG3A 3UXPA 4W5RA 8ICAA 3CYMA 2FMSA 4AH9A 4KLTA 3NAEA 1ZQSA 1BHLA 4LH4A 1S1XA 1RYRA 3C95A 4EP5A 1Z00B 4LVSA 4CFDA 1RT4A 1VSLA 4CF0A 2I5JA 2HHSA 3MDCA 1FK9A 1X9MA 4NLZA 1UWBA 4KLDA 3V9WA 3JYTA 2ZUBA 3BQ1A 1KVAA 2HNYA 3OYBA 3DLGA 1NKBA 3MFIA 2JEGA 5J2KA 4KRFA 3TABA 4UB4A 1UAXA 2RDIA 1RBRA 4ECVA 4B8AB 3ZT0A 2W9MA 4RQ2A 2UVWA 2A1SA 4XIUA 2FBVA 4RW9A 1VRTA 4Q43A 3NF8A 4F50A 4I2QA 2YNIA 3V6HA 5HRPA 8ICEA 4BE0A 2F1JA 4E7IA 4JV0A 4DTOA 3VQ5A 5DLFA 1LV5A 2FPLA 4CGFA 8ICJA 1WCNA 1ZQPA 3HK2A 4I2GA 3GIKA 3OHBA 3OYFA 3L2WA 3DOKA 1S1VA 3C23A 1XI1A 4M41A 2JLEA 4CJWA 3HSTB 1BGXT 4R8UA 3LPTA 1S9GA 3ZSXA 1KSPA 2BCSA 4UB3A 8ICWA 5K14A 1EP4A 1BPEA 1H38A 4EP4A 3K57A 4FJMA 4QW9A 1WLJA 5KG0A 4I2HA 3CFPA 3EPGA 8ICVA 1QSLA 9ICJA 2VG6A 1RDCA 3NDKA 1BI4A 1KLMA 3CFOA 4ED3A 2P66A 4CECA 4RT2A 8ICGA 5KFXA 2DPJA 4RPYA 4CK1A 1HQUA 4ZTJA 2R8KA 4KHWA 2BPCA 1RTHA 3DLKA 1ZQOA 3O3GA 1YTUA 5CJ7A 3ZDDA 4DL6A 5DG7A 4MFCA 1KEJA 4CJUA 3ZSRA 1W0HA 3RH6A 3IS9A 4FW2A 4JS5A 3B0XA 1TV6A 4KLQA 1SKSA 5IINA 3ZDAA 3V1OA 4HTUA 3THVA 2FLLA 1L3TA 4NYFA 4Z6EA 4B3OA 4QWBA 3PNCA 4KLEA 3PW0A 4DTRA 3AVJA 4F91B 2MUTB 3OS1A 2GUIA 3ZSWA 3QESA 4BDPA 5J2FA 2BHNA 3H7IA 5KFUA 4ZHRA 7ICSA 2ZUCA 3T5LA 4KFBA 4IFVA 4I2AA 2C22A 2FMPA 4KV8A 4E1NA 3VQ9A 1UA0A 1L5UA 3T5KA 3K59A 2KZMA 3S3MA 5J2DA 1KRPA 2HW3A 4JWNA 3JSMA 4O5KA 4NCGA 4OVLA 3H40A 7ICUA 1LB2B 4FJJA 1JXEA 3KLEA 2OWOA 8ICBA 2PY5A 1SZPA 5KFMA 1JXBA 5DBBA 3TWHA 3H4DA 1IH7A 4KHQA 1XHXA 7ICOA 5J2IA 3OYGA 3ZSOA 1WSFA 2G8WA 4EZ9A 4PQUA 1XSNA 3RJGA 9ICUA 5SWMA 3U3YA 3NFAA 4DQIA 1EX4A 4O3NA 3RAQA 2YHAA 3QZ7A 2BCUA 4E7LA 1XU4A 3AVAA 4DU3A 4F5RA 3QNNA 4FLZA 4CEDA 3MXJA 4GXJA 4IQTA 1U48A 1QHTA 3VQ7A 3DMJA 1NKCA 4I27A 5J0TA 8ICKA 4TSXA 4KPYA 4FJ7A 4Y1DA 1RT6A 2MAXA 1TK5A 2HHUA 4O3PA 5CWRA 2JEJA 2ZE2A 2G8VA 5J2NA 3NTUA 4NM2A 4R8UB 4ECXA 4FM1A 4M0AA 8ICLA 3AU6A 1KTQA 1K6YA 4Q5VA 4KHYA 1V9PA 5J2EA 3MAQA 5JS2A 4LH5A 5J0SA 1ASUA 1ZBIA 4BXOA 1BI4B 1S1WA 2PI4A 3QINA 1L3SA 4RW4A 4KB1A 1VSMA 1WSGA 3LP3A 2DFHA 4KLIA 5KFPA 3OSNA 9ICQA 3PW5A 1L3VA 4F2SA 4DFPA 5KFHA 1G15A 2X74A 8ICNA 4M45A 8ICRA 5L1IA 3HO1A 4FW1A 4JRPA 4KREA 3KK2A 5KFWA 4J9PA 1Z26A 4DEZA 4CGJA 4IKFA 4QWEA 3OYNA 4K4IA 3P1GA 3GV5B 4DL3A 4E7KA 5J0XA 4CGIA 4EYHB 1T8EA 1B92A 4E89A 4XRHA 1T05A 3DRRA 5KG5A 4MEYA 2ATLA 4QZDA 5EOZA 1WAJA 2RF2A 4EZ6A 2ISPA 1WCLA 4GW6A 3FYHA 1A5WA 5DLGA 1S6QA 2V4QA 4ZTFA 2BGGA 3EPIA 5HP1A 4IRCA 4QW8A 2W9CB 2BE2A 4PGYA 4M47A 3C6UA 3RJEA 1D8LA 1TKDA 2IBKA 1WNSA 1ZBFA 4LZDA 4CJ4A 4MF8A 2VANA 5J2JA 1DTQA 4RQ7A 3L3UA 3V1RA 3ISCA 2DTUA 3B0YA 1XO1A 4KLFA 4DL7A 4M9HA 4CERA 4B08A 3C1YA 4KHNA 4RQ0A 3DLRA 1RTDA 3JPPA 5D46A 4NYNA 3LK9A 4F4KA 1ASWA 2ZJ8A 1GOCA 1S5JA 4FJ5A 1T3NA 3MR2A 3LDAA 2JEFA 2QXFA 3PUFA 5J2MA 3VQPA 4BDZA 4ED2A 2R8GA 4BACA 9ICEA 3H8JA 1N6QA 4YP3A 2M9NA 3HPHA 2A1JB 3BQ2A 4FM0A 4DTSA 2FPKA 4O5CA 2ZQBA 3ZSYA 1QSSA 4AHRA 4IDKA 2ZJAA 2B6AA 3OSPA 3L3VA 3C5FA 4M6WA 4F5OA 3RB0A 4UAZA 1SL0A 4UQGA 3NF7A 4GLXA 1ZQWA 4OJRA 1N56A 4FK2A 4J9NA 1ZQNA 3ISDA 1NK0A 1RBSA 2X78A 4YMNA 4J2EA 1RDAA 4BXOB 2NRXA 4I2CA 1U45A 2WONA 3NF9A 5BOMA 4DS5A 4FJGA 3H8WA 4EYIB 4M3XA 4DQSA 3T1AA 3OYEA 2QK9A 3PR4A 3V81A 3I8DA 1YT3A 4UB2A 3KHRA 3RR7A 5BOLA 3QEXA 3JPTA 2KFZA 3K5NA 5C24A 1BISA 3O3HA 5J29A 3RAXA 3SUOA 1D9FA 3OGUA 5CY4A 3M9NB 1IG9A 2ATQA 3TAQA 4FCYA 3JPQA 4HUGA 4CJTA 4FS1A 4O0JA 3WNEA 2KW4A 3PX4A 2VA3A 4YN4A 5EWEA 4IQWA 4K4GA 4KHUA 3L2QA 4FLUA 3NBPA 9ICAA 3VA0A 3OS2A 2KZ3A 2RDJA 4GMJB 4CEOA 1KLNA 3MEDA 2FC0A 4FLVA 3PMLA 2O4GA 3AO2A 4FLWA 4UB5A 4W5QA 5KFFA 2BQRA 1AROP 3OYLA 2IA6A 4CIFA 4MFBA 2A1RA 8ICPA 1XWLA 4FK0A 2ETJA 4Z4CA 4I29A 4CJKA 5DG8A 4FVMA 3VQ4A 5FDLA 5J2GA 1JLFA 3KLHA 3PR5B 3LDSA 1S9FA 4F4YA 1IO2A 4PHEA 4ECYA 5DQHA 3TQ1A 4B9VA 1KCFA 8ICFA 1FXXA 4DLGA 1Z3EB 3M8QA 3C2MA 4GC7A 1PZNA 4CJRA 3MR3A 4FJXA 4JK1A 4CJEA 8ICOA 3B6PA 4CHOA 3VQ6A 3MBYA 2R8HA 2BCRA 4RW6A 4CHYA 8ICHA 1S6PA 5DGAA 3JPRA 4J2AA 3KK1A 2XCPA 5J2QA 3NGYA 3PV8A 1J53A 5J0YA 1ZQBA 5KFVA 2BDPA 4WE1A 4Z4GA 4TQRA 1VSEA 3E2EA 1IXRA 2V4RA 3ZDEA 4DFKA 2G8KA 4FJLA 3KLFA 3ULDA 4KAZA 1A5XA 4M6WB 3GDXA 2ZD1A 1ZQVA 3S9HA 3V6KA 4CFCA 1LAVA 2ZTEA 3JPOA 2BCQA 1L3UA 3AO3A 1DGSA 3M8RA 3M8SA 4DFJA 5DQGA 3VQQA 2EHGA 4YXJA 4DTUA 4LSLA 4DSFA 5CB1A 1HUZA 3K2PA 2PFOA 2Z1IA 1TVAA 3DI6A 2UVVA 4R65A 3GIMA 4M9JA 5KT7A 2HVHA 2BQ3A 5CYMA 3KD5E 5D3GA 3ZT2A 2RPIA 2BGWA 1BPBA 3C21A 2RN2A 4ECRA 5KFYA 3SQ4A 4MFFA 4CE9A 5J1EA 4DU4A 2I9GA 3OYIA 3BDPA 1ZQEA 4HUFA 4H8KA 1TKZA 4NY8A 8ICCA 1C0TA 2FBTA 3VQ8A 1KDHA 5DDMA 2E6MA 3L2RA 2G8UA 4QZGA 4J9QA 7ICKA 7ICNA 1ZQHA 5DKWA 4KO0A 5J0RA 4KLGA 2NRVA 1BQMA 4JUZA 4N5SA 1NOZA 3KIOA 4YR2A 3HM9A 4CHNA 1ZBLA 5KG6A 4OLBA 1ZQIA 4CEZA 3G6YA 2X6NA 4F3OA 3BQTA 3I0RA 1X2IA 4BWJA 1ZJNA 2P5OA 1S0MA 5L1KA 3UXOA 4RQ3A 7ICLA 5TZVA 4ED7A 3QNOA 1IKXA 4DQPA 1ZQCA 3QEWA 5EWFA 2XY8A 1LW0A 3SI6A 2G8HA 3DYAA 4RT3A 7ICGA 4NXZA 3M8PA 1D5AA 4UB1A 1D8YA 3WNHA 1LW2A 1WSIA 3ORYA 3LALA 5KT3A 2VG7A 4M3RA 2D0CA 3HJFA 1VSJA 5EWGA 1NK7A 2HVIA 4I2EA 3K75D 1B9FA 1EXNA 1RZTA 1ZQTA 5KRTA 4ECZA 3QIOA 1BVSA 3GQCA 2ASLA 4HYKA 4CEBA 4DTJA 4KTWA 3AVFA 3HX0A 4F8RA 1Y88A 4I9LA 3Q8KA 5KI6A 4ID5A 2BCVA 1S76D 4QZAA 2PXIA 2W9BA 3G6XA 2FBXA 3GIJA 3Q8RB 1Y97A 4DWIA 1QS4A 1RT7A 4QAGA 5KG2A 1HYZA 4JS4A 5I3UA 4I2JA 3HT3A 5SZTA 2P5GA 4N56A 1RXVA 4OPJA 3ZT4A 4YVZA 1N5YA 4CEAA 1X9WA 2C2DA 3JPSA 3DLEA 3MR5A 3UXNA 3NH0A 4G3IA 1HNVA 2OZMA 1D9DA 3L2VA 1TV9A 9ICTA 3QETA 3FFIA 4IQVA 2JZBA 4BDYA 3VQBA 4QZ9A 3N97B 3QE9Y 3IAYA 4YXMA 3HPGA 1VSDA 4DOAA 5HHHA 3OJSA 3LAKA 3SI8A 9ICHA 4ED0A 1HRHA 1CZ9A 3KHHA 4P2HA 5E41A 3K5MA 4RNMA 4EBCA 2G8IA 4F4ZA 2VWKA 4PHAA 7ICFA 4ECSA 5DB8A 3TAGA 3IG1A 2WOMA 4J2BA 1JX4A 3I0SA 4CJLA 9ICKA 2F8SA 1C1AA 5I42A 5KRSA 3TFSA 4Z4EA 3ETLA 3HW8A 4ECUA 5DMRA 2NRZA 3KHLA 3TANA 4RUCA 1GOAA 3AU2A 4RW8A 1Z25A 4M9GA 3JPNA 5HRNA 3VQCA 3LPUA 5KFEA 5HHIA 7ICMA 9ICXA 1BPXA 9ICGA 4B9TA 4B9LA 3BJYA 4YQWA 1S77D 3K4GA 3AA4A 3T5JA 3U6FA 4Z0UA 2HHWA 1RT5A 4J9LA 1ZJMA 1QTMA 4CIEA 3EYZA 1ZQZA 4NLGA 1C7YA 4C8OA 3WNFA 7ICHA 3QEPA 3K58A 4M9NA 3RH5A 3KLGA 3L8BA 4Q0BA 4HUEA 1ZBHA 4CF8A 4O5EA 4I7FA 4F4WA 4W5OA 4KN7A 4K8ZA 2AGQA 2KZZA 3O3FA 3MEGA 3AVBA 1ZQDA 3HXMA 4FJ8A 4KLUA 5DB9A 4GC6A 4J2DA 2PFQA 4IQUA 5J0WA 4PY5A 1RDBA 3PY8A 3OVNA 3NH2A 2IDOA 2YV0X 3AA2A 5F9NA 2OA8A 1RT1A 3ZD9A 3KTQA 1HYVA 4KHSA 3RJKA 2AGPA 5CA7A 2PI5A 1NK8A 3MGHA 3V7LA 2HHTA 1NJZA 3VQAA 4Z6CA 4Q45A 2XGPA 1SL1A 1C0MA 1ZBUA 4RQ4A 4CF9A 3TAEA 4YFKA 1NJXA 3G10A 3RRGA 4AHUA 4YD1A 3OJUA 2ASJA 4RPZA 2FPMA 4RQ1A 2Y1JA 4CK3A 1S10A 5DQIA 3QEIA 3RTVA 7ICEA 3DRSA 2XY6A 4YMMA 2DY4A 3ZT1A 2BKEA 3C1ZA 3GV8B 9ICCA 3LWMA 2W8KA 2FLNA 3V9XA 5J0OA 4JV2A 4RNOA 1IKVA 1B9DA 4PA1A 4C8NA 5KG7A 4ZH4A 9ICFA 4CJVA 2RKIA 2HNDA 4Z6FA 3PW4A 1BCOA 2ZJ5A 1FKOA 2DFFA 2C2RA 1JL2A 5CHGA 5KFTA 2HB5A 4I2BA 5IIIA 2YKMA 4J9SA 4DQRA 1VSIA 2D0AA 5DGBA 3EWAA 4PHDA 3V6JA 5EU7A 3GFKB 3RJHA 1LWEA 4KI4A 1MQ2A 1HYSA 5CR0A 1RXWA 1RT2A 3RRHA 4YR3A 9ICWA 3RMAA 1CUKA 1ZQAA 2PYJA 3OYCA 1JN3A 2BR0A 2D0BA 3AVHA 3RB4A 1WSHA 3P83D 4E19A 3TAFA 4AILC 3VA3A 1S9EA 5HP4A 4XA5A 5KGWA 4QZFA 2XC9A 3QZ8A 2XHBA 1REVA 5DB7A 4CJPA 4KKOA 2FLPA 3ALYA 5IIMA 4FJ9A 4ID1A 2ZUDA 3PMNA 3QEVA 3NH1A 1Z00A 3ZDBA 4HCBA 1NK5A 4FJHA 4CEQA 1U04A 4BE1A 2XO7A 1NOMA 3CQ8A 2IHMA 5CP2A 1ITGA 1RILA 3DOLA 2IMWP 1SKRA 4QZBA 4DO9A 8ICUA 1WSJA 3OS0A 5DG9A 4EBDA 1SUQA 1JIHA 3VQDA 1BL3A 1NK9A 3UPQA 5KFOA 4CJ3A 4IG0A 4AHSA 2XY5A 3C94A 3SUQA 4CHPA 4YG2A 3CM5A 4OPKA 4E1MA 3T5HA 3HPOA 1W9HA 3GILA 4BE2A 4RZRA 4ED6A 2PZSA 4O3SA 4O3QA 2AQ0A 2OYQA 4J9KA 5J2PA 4TUPA 4CF1A 3LP2A 5KG4A 1ZQKA 4PH5A 2ZTCA 4DOBA 2FBYA 1ASVA 2KN7A 1IKYA 2J6SA 3AVCA 3H8SA 1ZQGA 5IIKA 1R0AA 3P5JA 4BGDA 3OYJA 4HCCA 2BANA 1U4BA 4M42A 3VQEA 1SL2A 4B8CA 3KLIA 2W9AA 2ITGA 3V6DA 4DOCA 3Q8MA 1I39A 5C25A 4OKEA 2VA2A 3HP9A 4LSNA 4J9MA 3QEBZ 1VK0A 9ICOA 5KGXA 4RPXA 4FLTA 3TFRA 1QLNA 3AO5A 5HBMA 4P4OA 4IR9A 3RMBA 2H5XA 1ZQJA 1VSHA 1KFSA 1HNIA 1TK0A 3N4MB 4B9SA 2KQ2A 4M9LA 5J0QA 3AA5X 2AGOA 2IC3A 4TUQA 1RTIA 2HMIA 3C6TA 4CFBA 4FYDA 5FRNA 1DLOA 3G0ZA 4W5NA 2XY7A 1MC8A 1ZQRA 4O9MA 4DL2A 4QZEA 3LWLA 3KKRA 5KFAA 4KLJA 3T19A 4CK2A 1BIZA 2BPFA 5HLFA 4I2DA 1A5VA 2G8FA 2XRIA 4MF2A 4KLLA 5KTQA 4FXDA 1S1TA 5JUMA 4Z4HA 2MUTA 3F73A 9ICPA 5DBCA 1KFTA 1ZQLA 3MABA 3GV7B 3NGZA 3PX0A 1ZQYA 2HHXA 3RBEA 5KFRA 3U3GA 2W42A 4KLMA 1CZBA 3RJIA 1EKEA 4IBNA 3PW7A 2XCAA 3SV4A 4CCHA 3AVKA 4QOZB 5C42A 1JKHA 5HROA 3QIPA 4F5PA 4DMNA 4B9NA 2E6LA 2IGIA 3AVLA 3ZSZA 4RU9A 2IHNA 1KVBA 3WNGA 2P1JA 8ICQA 4JLHA 4O3RA 4UAWA 3PW2A 4OGCA 2E4LA 1RDDA 2DPIA 4C8MA 4CEEA 5J2AA 8ICTA 3O4NA 1KVCA 3MR6A 4O44A 2F96A 4LD0A 3NHGA 4MQ3A 4ED1A 3D0PA 3MECA 1TL1A 1X9SA 3EW9A 3C2KA 4F2RA 2KTQA 3HVTA 3SCXA 1J54A 3QO9A 3OY9A 4R64A 4UAYA 3K5OA 4AHVA 4QZHA 3AVNA 4RW7A 3PX6A 2YKNA 4DF8A 3RJJA 3NF6A 1XSPA 5CYQA 4R66A 4TQSA 4DSKA 3NGIA 1JXLA 7ICJA 1IKWA 3SPYA 4QWDA 1GOBA 4Q8EA 4YCXA 2DFEA 1TAUA 3RBDA 4KN4A 4B9MA 3H08A 4CJQA 1VSKA 1CXUA 4I2PA 5KG3A 4EBEA 2R8IA 3AVGA 3SPZA 4CGDA 3IHQB 4P4PA 2J6TA 1A76A 2IAJA 4DS4A 5KT4A 2V9WA 5T7BA 3SNNA 4FLYA 1T4GA 4YD2A 5IILA 4QWCA 3RMCA 4IFYA 4L8RB 3SQ1A 3H4BA 2UVRA 1YVUA 2GWSA 1NJWA 1NK6A 3ZDCA 9ICIA 5HRRA 4IRDA 3ZSVA 3O4QA 4DG1A 2B4JA 2HHQA 4CESA 2UVUA 5KFQA 1X1PA 4O55A 4B9UA 1IM4A 3HYFA 1QE1A 4ICLA 4F4XA 2F8TA 4FJNA 1TFRA 3QLHA 2WTFA 1HJPA 1RPLA 3ITHA 4C8KA 4LZGA 5JS1A 2LYHA 5KFLA 3V9UA 3V7KA 4PGQA 4OKKA 3E01A 4GXKA 4R5PA 1K1QA 1UA1A 1JL1A 3MXMA 3NGDA 2IS3A 4N47A 3S3NA 1NKEA 1HUOA 2VA8A 4E7JA 1O1WA 1BIUA 4Z6DA 4HHTA 4YR0A 3RB3A 1EETA 2VG5A 1CLQA 2HNZA 2W9CA 1S1UA 3MXIA 4OKJA 4DQQA 3AV9A 1RTJA 3Q8PB 4MEXA 4I2IA 5HNKA 2PFPA 4JV1A 1COOA 2B21A 1BPDA 4M3WA 4XUSA 1FKPA 2OPSA 4QZCA 3AUOA 3AO1A 5KFCA 3KJVA 4F5QA 4X5VA 5HMLA 1JLEA 3ZT3A 4CHQA 2OPRA 2YNFA 3AA3A 4W5TA 3SJJA 3OYDA 4RUAA 3ISNC 4AHTA 2C2EA 3AVMA 1S0NA 3D45A 4N41A 2ASDA 1B22A 3OHAA 3TAMA 5HMMA 1TAQA 2NUBA 5FRMA 3L2UA 4DL5A 5IIOA 1BQNA 4E7HA 5HRSA 2BQUA 4OLAA 1N48A 1EXQA 1HQEA 3IRXA 4C8LA 3T3FA 2AJQA 8ICSA 1JMSA 3OYKA 2A1JA 4ECQA 4I2FA 4KI6A 2X6SA 1U49A 4FZXC 4ECTA 5KFDA 4RQ5A 3NCIA 3ZCMA 4NCBA 1MQ3A 4FBUA 3A2FA 3HVRA 4FK4A 3IM1A 3EZ5A 1B43A 4RNNA 1BPYA 4M3UA 4PWDA 4O5BA 1S0OA 3CG7A 9ICNA 2OZSA 5L1JA 5D4BA 3M9MB 3NE6A 4KTQA 5KT2A 2AQ4A 3DRPA 4LY7A 4CGHA 5DBAA 3BGRA 3KKSA 5CZ1A 1T7PA 3KHGA 4NLKA 4Z4IA 2OPPA 3ASMA 8ICXA 2B5JA 4M04A 2P6RA 2W9BB 3Q8QB 4GXIA 4M3ZA 1ZQFA 4ED8A 2J6UA 4QZIA 4FLXA 1ZQQA 4FJKA 4ELVA 2LSNA 4DL4A 4EEYA 9ICMA 1J9AA 4KTZA 1ZQMA 5KFBA 5J2CA 2JEIA 5KFSA 4RQ6A 3LP0A 5D49A 1CXQA 3HWTA 5F9LA 4DSLA 1YTAA 3UQ2A 4DSEA 4YFUA 1XHZA 4F93B 2JZBB 3RH4A 4E3SA 1MU2A 1S0VA 1TL3A 1Q9YA 1ZQUA 2YNHA 3KK3A 3ISBA 2YHBA 3PO5A 4KLSA 8ICIA 1JLBA 5L9XA 2I1QA 1JLGA 1JLCA 2DFLA 1LAWA 4K8XA 4P4MA 5KG1A 3SZ2A 1XS9D 3C2LA 2FMQA 1TK8A 1KFDA 4DSJA 3MEEA 3DLBA 4K4HA 3V9SA 4IRKA 4UBBA 4MFAA 3RMDA 1LWCA 3ZD8A 4M2YA 3LZIA 8ICMA 1ZETA 7ICQA 3GIIA 3V4IA 1U9LA 2BPGA 4FBTA 3RR8A 1TKXA 4NM1A 2VWJA 1XC9A 1U47A 5J2BA 7ICIA 4F3TA 4J9RA 4TUSA 2R8JA 3AVIA 4YNQA 4G1QA 3OYAA 4DF4A 3UIQA 4JRQA 1BCMA 2F1HA 5DB6A 4O3OA 2GV9A 9ICVA 3BQ0A 2Z1JA 1NOYA 4OGEA 9ICLA 4DU1A 4NCAA 4KLHA 3OYHA 3DLHA 4FZZA 1C0UA 3V1QA 1J5OA 1XSLA 5KFIA 2Q0ZX 1VSFA 4FM2A 2NRTA 1RBUA 5KFGA 4KITB 4I9QA 2P51A 4Q8FA 5DDYA 3Q8SB 4ELUA 4CJFA 1RYSA 4DLEA 4CGGA 1Q8IA 3OYMA 1WN7A 4CEFA 8ICZA 2Z1HA 5KT5A 3RJFA 2ISOA 2W8LA 4NLNA 4CFAA 4M3TA 3CFRA 4KB0A 2KFNA 1NJYA 4CF2A 1RBVA 1T03A 4AHCA 2D5RA 4QWAA 4CHZA 1BPZA 2PFNA 3F9KA 4GVMA 4O0IA 1JLAA 4QCLA 4KLOA 1SV5A 5KFZA 3PO4A 1QQCA 4E0DA 4DTNA 4FZYA 2AU0A 3QEAZ 3TI0A 4H4OA 7ICVA 3LANA 4DTMA 4FO6A 7ICPA 3SYZA 4JWMA 1C1BA 4XQ8A 1CEZA 4RQ8A 1ZQXA 3TARA 2IOCA 1I3AA 5CZ2A 4J9OA 4N76A 4QZ8A 3TAPA 3RB6A 5BPCA 4ECWA 3TR8A 4F5NA 1WSEA 1S97A 3LZJA 5J0PA 7ICTA 3VN5A 3PVXA 3C5GA
chains in the Genus database with same CATH superfamily
5K4LA 3FBCA 2W11A 4Q7AA 3SFGA 1GXUA 3SCIE 1WTBA 1KWMA 3IR7B 3EY1A 5KFNA 3PHEA 2F1IA 2QC3A 1QY7A 1HMVA 4HAIA 1WBDA 2YNGA 2I7PA 4RG8A 5IC6B 1HJRA 1JLQA 3OR1B 3NNAA 1RKJA 4CIGA 3V72A 4DB3A 5IIJA 5F8JA 4PHPA 4WFAL 4DFMA 4B3MF 2OPQA 4ZCLA 4Y2AA 4KHPK 3NXZA 3MDAA 3L6QA 3N4WA 3AO4A 1W7AA 5CABA 1RWVB 2EX3A 3SV3A 4AUKA 1KKHA 4DR2F 2P9UB 5M1NA 3S3OA 4KMUA 4UBCA 2Q0UA 2MQLA 1RI7A 2RU3A 1DGJA 1XMOK 1MNEA 1DQAA 4TURA 4M5IA 3MGIA 2KOBA 4AQYK 3G82B 5CYJA 1BA1A 3G6VA 2BE9B 4F92B 3A3OB 4CLPA 4N8OA 3NS6A 3G6EN 2YWKA 5B09A 4IR1A 2C3YA 1S7HA 3QBCA 3SIPB 1VDVA 3M2RB 1RNHA 5KT6A 1F5BA 1A77A 2GHWA 3GMGA 3ZZZA 4ZIWA 3DRYA 2OUGA 4DSIA 3CO9A 1S9EB 1RBTA 1YJWS 4URGA 4FL9A 2D0PA 4TY8B 2F9DA 5ALJA 5CEHA 3WXIA 4FSVA 1U02A 2FHOB 3NAEA 1ZQSA 1YBUA 4ISFA 3KMQA 1NGFA 4JI2J 3K7RA 2DGTA 3CW2C 1RT4A 2V68A 1VSLA 2B8PA 2I5JA 2HHSA 2F5GA 1NDCA 1W25A 3EVMA 4M94A 3MDCA 3OPKA 4LF8F 2QL7B 4A8XA 4BR4A 2OMOA 2FVSA 3JYTA 2ZUBA 1FXRA 1KVAA 2ZF5O 2V9KA 3MFIA 5DZ6A 3QJJA 5B08A 4PG6A 4ECVA 2O66A 4BR5A 1U1OA 2PMZD 1IBKJ 1HNZF 3CCRS 4DV6F 3BZKA 1FCAA 2GEMA 1DRZA 2GGPA 4F50A 4LRBA 2NZTA 3V6HA 3KNGA 3ZTPA 4M5DB 4H4MB 1HI0P 5HRPA 1VLOA 2LYVA 4JI7F 2F7TA 5DLFA 1LV5A 1XERA 1YTYA 3MPUB 8ICJA 1WCNA 2IM1A 5B0CA 1QCKA 3HK2A 1A0OB 2JWKA 5IS2A 3GIKA 1HPZB 3OYFA 2ASYA 3L2WA 1QVGM 1Z19A 1S1VA 2BDUA 2BACA 2AP1A 3W62A 2LYAA 2Y1LB 2QWRA 3J7AP 3J7YP 1DTTB 4F9OA 1Y5IB 1KAXA 5JXSA 2RRNA 3VTIA 1EP4A 4EP4A 5ALPA 4QW9A 4LFCJ 4I2HA 4I56A 4AM6A 4KMOB 3EPGA 2VFUA 1QSLA 4NI2A 1HIYA 4DR1F 1YJRA 1T9VA 2J9DA 1KLMA 1NGGA 3B9JA 1BG3A 3IDWA 2DPJA 2W4DA 5A2QU 4WK1A 4QZVB 1ZM4A 5GINA 4ZITA 1V5IB 2QTWA 3NWGA 3TR5A 1HR0K 2BKNA 4PUOB 1DLOB 2M3DA 3D1HA 1CJUA 1RJJA 2LHTA 5KQ8A 3B0XA 4KRWA 3H1VX 1SKSA 3ZDAA 5JRTA 1XJWB 4QS7A 3NS5A 1YIJN 4YOWA 4LJXA 1KHWA 4B3OA 1NG9A 3PW0A 1S1TB 3FQLA 4K0KJ 2MDAA 3HHKA 3IR5B 1YRUA 2JGAA 2OSQA 5J2FA 3MMAB 1U1LA 4CLFA 3H7IA 3E66A 7ICSA 3CIPA 3MF5A 2GQCA 2FY1A 4HACA 1JUDA 1HBOB 2C22A 2FMPA 1ICEB 2G2OA 2J76E 2XLKA 5KL1B 4JHDB 1UA0A 2BVZA 5FPEA 5GAGU 1KQSM 2NYHA 5H9EJ 4UARA 2BE7D 2OTLN 1Q0NA 4FJJA 7ICUA 1VLBA 1JXEA 5AJ3F 3PDNA 1PO6A 2H3ZA 4LF4F 2HWTA 3M32B 1JXBA 3M6UA 3TWHA 3UD5A 4F71A 1IH7A 7ICOA 3R5AA 2K8AA 1TL1B 2XVTA 2G8WA 2D1CA 1XSNA 5SWMA 1KD1O 3U3YA 3HJEA 3NFAA 2YQEA 4DQIA 1EX4A 3KUGA 4HT5A 2YHAA 4KBIA 4RW7B 4CO3A 3D2EA 2UXBK 2J0WA 3I87A 3AVAA 4UY8O 4DU3A 4FWPA 2FYXA 3VQ7A 3LDPA 3SD7A 4TSXA 1SZHA 2MY8A 3MZIA 1RT6A 4AL5A 1TK5A 2HHUA 4O3PA 4R8UB 4FM1A 4A8KA 3AU6A 1KTQA 3FZ2A 2H3GX 3C65A 4K8RA 5HJXA 5F0WA 4LH5A 5J0SA 1NMEB 3ETRA 1BI4B 1S1WA 2EG1A 1L3SA 1VSMA 5F0XA 4KLIA 5KFPA 3OSNA 2L41A 1G15A 2X74A 8ICNA 3BN4A 3FCWA 1NHVA 3D2QA 4ZOHC 3VEOA 4JI3K 2XM3A 4CGJA 3SCKE 2OSRA 2ZXIA 3PCOB 2JDJA 5D4LA 3CGIA 3GV5B 4FPBA 1QE1B 3IBWA 4EWTA 5J0XA 3IS9B 1IXKA 5ALSA 2GOLA 3W3DA 3O0FA 4LVNP 3WK4A 3L4IA 1N60A 1QUPA 4DXLA 3EM1A 3DRRA 2PFUA 1KW4A 1B99A 4JYAK 5HK4A 1Y64A 3I6PA 4MEYA 5FPMA 3S8SA 2RS8A 2RLTA 1WAJA 2QB0A 1WCLA 4P72A 2GHPA 3SMVA 3FYHA 3SAGA 1AUDA 3FK4A 1KONA 3UE5A 3G2XA 4IFVB 2BE2A 4PGYA 3C6UA 4X4QA 1L6NA 2IBKA 1WNSA 1RWPB 1FIQA 4CJ4A 4MF8A 2XMMA 1NAQA 2CNNB 4X4NA 3BN7A 4NCGB 2WVEA 1JLEB 4M9HA 4B08A 4DPUA 2ZH3A 1QTNB 2CGKA 1KVKA 3CC2S 4YORA 3UB5A 3CXCM 2A41A 3LDAA 2JEFA 2VBZA 3PUFA 4H5TA 4BDZA 3VF0B 3PIPQ 3D6JA 9ICEA 3H8JA 2JMGA 4P0PA 3D67A 5AICA 3H20A 4PYDA 4TU8A 2FPKA 4CT8A 3HKZD 4IOCQ 1X66A 1WF0A 4QYRA 3Q8YA 1VQ9S 4LBPA 1TL7B 4CLLA 4IDKA 2ZJAA 4OX9J 3L3VA 4ZVGA 3EL2A 4M6WA 3RB0A 4UQGA 1U2RA 5IWAF 4QOTA 5AQUA 2FIUA 1ZQWA 4OJRA 3UCGA 4FK2A 3KZIU 4KGXB 5F8HA 3VGTA 1XNQK 2D3UA 4FJGA 3H8WA 2P9NA 1LVHA 4M3XA 2NYIA 1NUEA 3D6MB 2QK9A 3PR4A 3I8DA 1R7IA 4UB2A 3RR7A 5BOLA 3QEXA 3DGPB 4FKYA 3JPTA 2KFZA 3I5BA 1GLLO 3R5BA 5C24A 3T69A 1GK8A 4EHTA 2DTJA 2Q43A 2QT7A 3CDEA 1IG9A 2BW2A 3ICLA 2ATQA 4FCYA 1V3SA 3DHWC 4RUHA 2ZKUA 4LC9B 3M30A 1ZOLA 3FCVA 2ASOA 4CJTA 4FS1A 3ZZRA 1T05B 1VISA 4DV0F 4FWRA 1CC8A 3OR2A 3TZXA 3ZETA 2IRXA 5EWEA 1HWJA 2CIMA 2RF2B 1WC4A 4K4GA 3V2UC 2QW9A 4FLUA 3VA0A 2KZ3A 4GMJB 4NL5A 2VIHA 4CEOA 2FC0A 2E8NA 3AD8C 1G4CA 1X4GA 2UXCJ 4JI0K 2O4GA 2CADA 3Q89A 4IKAA 2KM8B 1JLGB 2KG0A 1JLCB 2JXJA 1VBYA 2A1RA 3R7SB 8ICPA 4M5KA 3MWBA 1CJTA 2GMLA 2I6WA 4HHUA 3VQ4A 5FDLA 4C4SA 1ZOTA 1JLFA 3E3XA 1NNEA 2QZ8A 3KLHA 5B0DA 3OTOK 4KJIA 5E7OB 3LDSA 1QQNA 3HD2A 2MGZB 1BC6A 3DXBA 3TA1A 3V4IB 4B9VA 3L9ZA 1VQ5S 4OYPA 3M8QA 3HHLD 4FJXA 4U7UD 4LBIA 3BSOA 5CHCB 3H3NO 3VQ6A 2R8HA 4NLVA 4CHYA 3JTPA 1GXLA 2XI3A 3EEQA 2CG8A 3M2UA 5J2QA 3BZQA 3NGYA 1N5SA 1SV0A 5KFVA 4MJKA 1OJ4A 1ZPWX 4FPRA 4TQRA 2MZSA 1VSEA 2HS0A 3HVAA 4B3TK 1U2VA 2G8KA 3W8PA 3W5ZA 2DR6A 3UVJA 3GDXA 2FTRA 4UT4A 5JICA 2AJ2A 1Y5LB 1H0HB 3OLBA 3V6KA 1GXTA 2OO4A 1NGJA 2HEKA 3ZTOA 4CFCA 2EAMA 5ALEA 1PK1A 1TYQB 3M8ZA 2BCQA 1Y11A 3QU9A 1UEUA 3AO3A 3DXMA 4C9DA 4NOHA 1SJ1A 1PK3A 3VAHA 5DQGA 1ZD2P 5EGYA 2BM0A 1U24A 2HAFA 2B4PA 5CB1A 4BBYA 2ZBIA 2LU1A 1TVAA 1N62A 4K4TA 5KT7A 5BJRA 3R3LA 2V94A 5CYMA 1N8RT 4NPOA 4CYUA 1Z6RA 4WCEQ 2C1EB 2P9CA 2X51A 1ZD5A 1N88A 5GAHU 4CE9A 1KP6A 3ENBA 5LXYA 4AM7A 4K5RA 4CF5A 1RAGB 3NNHA 1IBMJ 2UP1A 3R1XA 2VQFJ 2XICA 1C0TA 4KHMA 4LF5J 3VQ8A 3DDHA 5DDMA 2E6MA 3F2KA 3L2RA 2G8UA 4P73A 4J9QA 1VQ8N 3TUPA 3BR9A 3BF1A 3NBPB 2F1FA 1BQMA 1TKTB 4CHNA 3FUYA 2HBJA 3SAHA 3D5MA 3F53A 2P9SB 3DJCA 4OLBA 1N33K 4A62A 5F8GA 4F3OA 3RYLA 1L7OA 1ATSA 3I0RA 2UUBJ 2DK2A 4MFBB 4YDXA 2VCPA 3MM9B 4K4YA 2UUAJ 2COLA 3O6QA 2GZOA 2F7VA 2OD4A 3BBCA 3MMBA 3QNOA 4NASA 3WK6A 3K9KA 3P3DA 1ZQCA 3QEWA 4TLQA 4KGZB 1FFUA 5IQ6A 2YY6A 3SI6A 2G8HA 1XTZA 2VDIA 1RHUB 1ATNA 3DYAA 4ILGB 2LI6A 4JI8J 2Q1LA 1KQFB 3W2VA 1TVRB 1D5AA 4MK7A 3CCJN 1FI4A 2UU9K 2XS7A 3MUMP 2V50A 3NGRA 1F9EB 3D3CJ 3RSEB 4BC9A 4L74A 1NGEA 1VYAA 3WXMB 1VSJA 1NK7A 3KNAA 1IJFB 2CPIA 1O51A 4Y0WA 1ZQTA 1SC4B 5KRTA 4CM2A 4ECZA 2ASLA 5LJ3Y 4HYKA 2P5VA 2GTDA 2W3RA 5GAEU 4CLYA 5L8RC 3VETA 4B1UB 5A0YB 2AX1A 3AGKA 3KWMA 4CM0A 2LEAA 4A8FA 2W9BA 1TU0B 4DCHA 5F8LA 1QS4A 5I3UA 4QAGA 2VICA 4WP9A 4EEKA 3MXHP 1RXVA 1R89A 2V8HA 3KMSA 2P6TA 1VMBA 2EPIA 1SVDA 2JH7A 1MROB 4JP8A 1WJ9A 1X9WA 2V6AA 3JPSA 4ZVFA 4NEYA 2ZUGA 3K5PA 1WOSA 3TA2A 1N54B 1Y9OA 4OZJA 4G3IA 1HNVA 1S1XB 3JSRA 2I6XA 1VQOS 1TV9A 4P2XA 4F0MA 1VQLS 3IG5A 5BYRA 3VR1A 2F63A 4GY2B 1RHQB 2WSEC 2K1RB 4A4JA 3IAYA 1ZM2A 5HHHA 2CPJA 5EE1A 1AFJA 4ERDA 2AZ3A 2HNYB 1CZ9A 1QH9A 2HOEA 4OJ5A 1YQHA 2I38A 2JRSA 2NYVA 4KO0B 4J9VA 4RNMA 4PABA 2H48B 3G96A 3T1HF 7ICFA 1VRTB 1M5OC 1NSKL 3IG1A 4EELA 4J2BA 1JX4A 2YNIB 1RFQA 2OEMA 3WQTA 4CJLA 2F8SA 3D54A 5LJWA 2QEXN 4PWWA 1H98A 2CPYA 3N4QA 2NO5A 1F3VA 3HW8A 4ECUA 4FKXA 4WFBL 1VQPN 2EFVA 5DMRA 4JKCA 4CLSA 1NZPA 3DOKB 4GV3A 2E8OA 5KPRA 1ZD4A 1Z25A 4IWVA 3JPNA 4OI3A 3VQCA 1OQ3A 5KFEA 4GKJF 2A40A 2JC0A 3TEGA 4IEIA 5AI6A 3WC2A 1BPXA 1QJHA 4IOAL 4CT9A 1JJ2M 2HQIA 3T5JA 3U6FA 2XMWA 3QSYB 1RT5A 3TA0A 1TUGB 1ZQZA 4WKYA 1C7YA 5JMNA 2ZIWB 3WNFA 4X84A 1RM6C 2DNNA 2QG9B 3RH5A 1JNZB 4OZLA 3KLGA 1K8AT 3VVUA 2U1AA 4ZIVA 4F4WA 1E4GT 3HXMA 4KLUA 1WBBA 4WP3A 1EIYB 4OZ1A 3T6JA 2IM0A 4C4RA 2WSFC 1RDBA 3PY8A 4CZLA 4BS2A 1X9XA 4OV1A 1RYUA 4NLOA 3AD7C 2YV0X 1P90A 3AA2A 2H3IA 1QAXA 1PBAA 1YG0A 3KTQA 4B02A 1HYVA 3HM8A 1AA1B 2PI5A 2PE8A 1F5CA 3MGHA 3VQAA 5D78A 2O8DB 2AYEA 2HFOA 2LFVA 3HSGA 1SV0C 4KV8B 3MWPA 1NU0A 2QB1A 2WAQF 3BSAA 3D66A 4LIWA 3NOCA 4A5AA 4IO9L 4NLYA 3KLEB 4LMZA 3W9JA 4ED4A 3QEIA 3OBYA 2EAOA 2XY6A 2F8HA 1U7LA 2ZJRL 4Y65A 2BKEA 2ZIVB 3GZFA 3QQCD 1NHKL 5A8WB 1B0VA 3OR1A 2W3SA 2IJFA 2W8KA 2FLNA 3ONQA 2ZIXB 4PQUB 3L4QA 4JV2A 4PA1A 2B4UA 4YS2A 2KJWA 5KG7A 3D0GE 5AQFA 2CJAA 4CJVA 1HPMA 3HILA 1MW7A 3IP4B 2MQPA 4J5OA 4MYUA 4P7VA 5HN0A 2DUYA 5IIIA 3DMJB 4J9SA 2P9UA 2EVZA 4DQRA 3CF5L 4BR0A 2D7SA 1KQSR 4DR3K 5HJYA 2O67A 5EU7A 3NGUA 2K7KA 2DGVA 4RO0A 5CR0A 2LMIA 1RXWA 4AYBF 2ZH2A 1H2VZ 5D0RA 1KQQA 3G82A 3CDBA 9ICWA 4CP5A 1C0FA 1Z1ZA 5D8HB 4DPXA 1CUKA 4A8QA 2PYJA 3M2RA 1RHKB 4WYLA 3OTDA 3MM5A 3CPEA 3KD3A 2JLGA 3OFHA 3PRDA 4FZMA 2OMLA 2V5HG 3AVHA 2VOPA 1GQEA 3P83D 4U8VA 5HATA 4LF9F 4PYAA 2KJ5A 4DV7K 1YVNA 4USUA 1FJGF 4DV4K 3NCRA 3MEGB 1S9EA 2Z2ZA 4XA5A 3J8AA 5KGWA 1BLUA 2XC9A 4TY8A 1S4EA 2B51A 4GNIA 4RUBA 1WHXA 1T44A 4FJ9A 4ZPTR 4ID1A 5HR7A 1U26A 2GELA 4LFBF 5DM7Q 3D68A 2FDNA 1WOQA 3KWGA 5AZJB 3HSJA 4C97A 5G5GA 3LDQA 1ITGA 1RCXB 2Z2LA 1A7GE 5M1OA 3SQGB 3VMFB 1UHUA 8ICUA 5B0EA 2E2PA 3OBIA 3VQDA 1NK9A 1UVKA 2L3MA 1SI9A 4JKGA 4CJ3A 4X66F 4YDDB 3C94A 1RAAB 1K8KA 2AD9A 1VHIA 2LYBA 4UAUA 3CCVS 2I1RA 4BE2A 3P5TL 4YEAA 4OL8A 1G6BA 4ED6A 1ZAWA 2C3UA 1CJVA 5E3QA 1KHVA 4TUPA 3GONA 1RTDB 5H2FU 1N5QA 2FBYA 3KOAA 3NVZA 3TSPA 4U6PA 1QAJA 3HD1A 5AQSA 4O0NA 2KVQE 3T41A 4K43A 3MM7A 4NLXA 5J2MB 3AOCA 2BANA 4M42A 1APSA 4MIWA 4U7BA 3TZZA 5M2PA 3CJ4A 3CJCA 4JV5K 4USAA 2YTUA 1ELOA 3A0HU 5HL7Q 3EDQB 4LQ9A 3H5UA 5HBMA 4NXNF 2RQCA 3AO5A 4IR9A 3MM6B 2J4RA 3D2FB 3Q2SC 4OYMA 2WAQC 1WEXA 1URJA 4B9SA 2FJ6A 2KQ2A 4TVAB 3CJ3A 3IO1A 1YJNN 4ZCMA 4M9LA 4UF4A 1J5EF 2D3OR 3J81U 1VC0A 3IR6B 3OLAA 1T9WA 4CFBA 4DDFA 1DLOA 2R4FA 2XY7A 3W2WB 4DL2A 2Y8WA 4QZEA 2BW7A 3CP8A 2GH1A 3KKRA 2BUPA 2O1PA 3NGTA 4N77A 1HIWA 3T19A 4CK2A 4LF8K 4NEZA 3QRQA 4KLLA 2ZWOA 1S1TA 1FNMA 3F73A 3VF6A 3K1RB 1FERA 3IKMA 1KFTA 2M4MA 3H90A 2Z2YB 3GV7B 2P9GA 3PX0A 2E1YA 1HNZK 3MMAA 2WBNA 2V34A 3U3GA 2ASPA 4KLMA 2V2KA 1CZBA 2CG4A 4IBNA 3PW7A 1WHVA 2J0SD 3AVKA 2EH9A 1HBOA 1DAXA 4JI7K 4AYBC 2OHFA 4F5PA 4DMNA 3AARA 2IGIA 2YH0A 1UTAA 4RU9A 2IHNA 1MMDA 1G2EA 8ICQA 2LPEA 2MXYA 3TJ9A 4IO1A 3CNHA 3O4NA 1KVCA 3M32A 2CVIA 3F5EA 4LD0A 2MKYA 4TYAA 3D0PA 1TL1A 1X9SA 3TJAA 2C2NA 3EE8A 5AK5A 5SUHA 1X0PA 4EMDA 2EDUA 4R64A 4AHVA 3AVNA 4RW7A 2DB1A 4XH4A 3F0NA 4CH0S 3VCBA 1XSPA 4QQBA 1IKYB 4DPWA 4R66A 2RRAA 1NJIT 2CGLA 3A5LC 3PTWA 5JLHA 2NV3A 4L72B 3KOOA 1WD6A 2UXBJ 3FBEA 4ZVHA 4DV3J 3QSIA 2HSTA 5FPDA 3KJFB 3V6DB 4YCXA 2WVDA 2DFEA 1I3OB 3W9IA 1J2NA 2FB0A 3KK1B 5A0LA 4FZVA 3HCXA 2HCFA 4B9MA 2RNEA 5DM6L 1DFDA 3HI9A 1XNRF 4A8MP 4K59A 1S72S 4WKRA 1RAFB 4CGDA 3IHQB 1R3NA 4Y00A 4PJ0U 2J6TA 4AFFA 2HZVA 4FLYA 5IILA 5LMNJ 3RMCA 5CH7B 4L8RB 3SQ1A 1DURA 2UVRA 2H4YB 2RRBA 3WZ0A 1QD1A 1NK6A 4XK8C 2R2SA 4K4SA 3H3OB 1KC8T 4BGAA 3VAIA 2JFKA 3O4QA 2HHQA 5KFQA 4ZPBA 2W01A 2HMIB 3C6TB 4GO7X 4NA2A 4B9UA 1LFPA 3HYFA 4F0KA 2OIHA 1QE1A 2PN6A 3CJKB 4B3SJ 3KFWX 4HH0A 5HO4A 2WTFA 3OQ2A 3EZUA 3UE2A 1RSCA 2R42A 4LZGA 5JS1A 5AE1A 5IT9Y 5AFUA 3Q2TC 3DU5A 3V7KA 3GFZA 1A9NB 4PGQA 1G3OA 4DUZJ 3VGMA 3MXMA 2IS3A 2QLJB 1WI8A 3MPWA 4OHVA 2DGZA 4HL9A 1VQ7S 1U1PA 1EX8A 3NVKA 5HOOA 1N36F 2MY7A 1VQ4N 3Q8PB 4MEXA 2XZDB 1COOA 1LOUA 5L9NA 4J9UE 4RWTA 2Y0BB 1GLJO 5AI8A 1N4LA 3AUOA 2AW0A 4AXJA 2DHXA 3KJVA 4X5VA 5HMLA 1JLEA 1UEKA 4CHQA 3CIZA 1XMQK 1MLAA 4W5TA 4IDHA 1BY9A 3AVMA 3D45A 1HKBA 3I55N 2DKXA 1T9YA 1S22A 1TAQA 3OW2R 2OYYA 3F5TA 5IIOA 4Y2CA 2BQUA 4FOEA 3H0PA 2YKOA 1PYTA 1IKXB 5GAHI 1WHYA 4X2BA 2C2MB 3TADA 3WEEB 1LW0B 3OYKA 4CZEA 4KQZA 5I9EB 5KFDA 1Q81O 5L38A 4DR7F 4FYXB 1TL7A 3A2FA 2ZJPL 2CPFA 2IBOA 4PXDA 5AQMA 3POTB 1LW2B 3EZ5A 1B43A 4RNNA 1BPYA 4M3UA 1F60B 4F04B 3L0QA 3HFVA 4M1KA 2E7XA 1U2CA 4X62K 5KT2A 2ZWHA 2BOAA 4IZ9A 3BGRA 3NCPA 9ATCB 2W6LA 1T7PA 1EZZB 4USTA 2B0CA 3U27A 4ID5B 1IBLF 1N52B 2VIXA 8ICXA 2PFDA 3SFUA 5A8KA 3CD6S 2HBKA 2C3OA 5IM0B 2RE2A 4USVA 1CLFA 1PGZA 4BC7A 1R8AA 2WFBA 1RT7B 1RDRA 4ED8A 4UOGA 1L7PA 2J6UA 4QZIA 2ERRA 4FJKA 3R1HA 1WHWA 3E9OA 2LQBA 5AQJA 1N5YB 1J9AA 4USWA 3D7SB 1ZQMA 4KTZA 1PAUB 5C2DA 3DLEB 5AM4A 2YX4A 2VFSA 1VQMS 2RU9A 1TFWA 1NGAA 2NLXA 4R5PB 3H0RB 2FDRA 4ZVEA 3FFIB 4F72A 4DSEA 4YFUA 2Z2MA 1XHZA 1KVJA 2E1EA 4ZDNA 3CCSS 4E3SA 2QFJA 1S0VA 4F25A 1ZQUA 1X4DA 5GAEI 4QR0A 2ZH5A 1EETB 3BS5B 2I0XA 1JLGA 3AODA 1A6SA 1JLCA 5L39A 3M3ZA 1LAWA 3HMJG 1RXOB 3EZOA 4HHJA 5DRKA 3FZBA 4HHHA 3ENQA 3QU2A 1XS9D 3C2LA 5AKYA 2ZC3A 1W2BR 2P35A 3DLBA 5G4DA 2ATCB 1DEJA 4UUXA 1NXIA 4MLEA 3ZD8A 4M2YA 3EKSA 8ICMA 2MGZA 2I7NA 2CQIA 3DC2A 1F6TA 1T11A 3V4IA 4CIOA 2KVCA 2NCKL 5IV4A 4PEOA 5BN9A 2GIRA 2VWJA 4RQMA 5D0HA 2CJBA 1HQEB 2R8JA 3AVIA 4F4AA 2BOPA 5AK6A 3NS7B 9ICVA 3MCMA 2Y9TA 4QS8A 3DLJA 3I31A 4KLHA 1R27B 5CXTA 4FZZA 2FF3B 2IVMA 1XSLA 4W4MA 1VSFA 4FM2A 1RBUA 2R7SA 2DHGA 3FBBA 3PJWA 3CVKA 4TN2A 1TYQA 4US9A 1SJRA 3D6HB 2DNKA 4DV0K 2XWYA 2RUSA 3DRPB 1SC3B 4R0EA 2M8HA 8ATCB 3PKMA 3EJMA 2AEMA 2Z57B 2WZ1A 2E2NA 1RBVA 4QU7A 2DNRA 3WKCA 3QX7A 4QWAA 2PFNA 1FHTA 2DNZA 2ZVSA 2LM4A 1RUSA 7FD1A 5AQIA 2HURA 5AQYA 5ALGA 3I28A 3TI0A 1R59O 4FO6A 1YJ9N 7ICPA 1J27A 3SYZA 4JWMA 4CQ1A 1C1BA 5B8HA 1K8AO 2YWEA 2M52A 2WRMA 1YJVA 4QZ8A 3TAPA 1N32F 2H3QA 1RHRB 5ALQA 3CJ2A 1YZ6A 4F5NA 4ISGA 1Y00A 2GW8A 1WSEA 2D3O1 1XR5A 7ICTA 4CBXA 1FVQA 3PVXA 1CC7A 2E5HA 2OKQA 2Q97A 1TKTA 3PIOQ 4M63A 3G6ES 2QLTA 4HTLA 4KIAA 3MFHA 3FMWA 2HKEA 1UFLA 1M5SA 1X4BA 3HL8A 3QT7A 2P9SA 4NX9A 4PG7A 3CDAA 4QJFB 3KLVA 2HHVA 2NRWA 4HDHA 2K7JA 1UOCA 2YX8A 3KZXA 1UVLA 2WHOA 1SKWA 1D3WA 2O8BB 3KK7A 3K5LA 5FROA 4RNFA 2JGUA 5J2HA 4ZJQA 4TXSA 3BKUA 1V9OA 5J0UA 3WKAA 2V7YA 1LWCB 2J0QD 5AZIB 4M3YA 4KH4A 2HNDB 2L5YA 5AQPA 4HVJA 4QYZK 1PUZA 2VQEF 1CSJA 4V19J 4FJIA 1ZYQA 4DTPA 3FC9A 3SQ0A 1NZAA 4PKIA 3ZO7A 1RCHA 1NM1A 1TKXB 2W41A 3PJXA 2MZQA 3O5TB 4O5FA 2IVOA 1R43A 5ALTA 1TVRA 1JB0C 3MAAB 4Y1CA 4C2MA 4HI1A 4G1QB 1X0FA 3RSEA 4CLKA 1RA7A 2K3KA 2X1FA 1FNOA 2BKPA 2ZDPA 3FDSA 2XGQA 4I6WA 2UV8G 5ETSA 3MM8B 1NGIA 4LVOP 1NK4A 1HWLA 4KHPF 5A0YA 4X65F 1TMMA 1DOQA 9ICRA 2HOFA 4UW9A 3UDVA 3OD2A 2WB4A 1DK3A 2V63A 4BRMA 1HLWA 1RADB 3LTOA 3NMUA 1K1SA 2YVSA 4ELTA 1XMOF 5C5JA 3M9OB 2JH3A 4AQYF 3V7JA 3UXPA 4ZPAA 3VAMA 3CYMA 1REVB 4KKOB 2FMSA 5HQ8A 3VGVA 2CQBA 2QLBB 3TADC 1X31C 3MURP 3OFGA 4WXOA 3BDEA 1S1XA 1Q78A 3FNNA 3AQEA 3VF2A 1SZ2A 3EVWA 3NVYA 1KVIA 2DQNB 3IFEA 1FK9A 4LR7A 2K1RA 4NLZA 2ADCA 2YHWA 4UZBA 1X6IA 1O5JA 4YOTA 1ZC6A 2P9IB 1WKKA 4YMEA 1IR0A 4LRAA 1SUQB 2HNYA 3TUJC 3W5XA 3OYBA 3JSYA 1TUUA 3TABA 2H9ZA 1RBRA 1H74A 1VJ5A 4LF1A 2AYGA 4EI2A 3ZT0A 4IH6A 1NGBA 1Q82O 2GAHC 2A1SA 4NA1A 1VRTA 4CE6A 1DY3A 4I2QA 2YNIA 2YMLA 2O5DA 3EN9A 1OH5A 5J2PB 3LP2B 4DTOA 4YY3F 1LNQA 5C2FA 1IQTA 2FPLA 2YNGB 1YIJS 3N0VA 4LR9A 2ZNYA 3CO0P 2H4WB 1ZXIA 4O4RA 2ZH1A 3DOKA 3C23A 4M41A 4CJWA 4P9SA 3C16A 1BGXT 3U1NA 3W66A 1KSPA 4LSNB 1WDDA 1FNXH 3WU2U 4UB3A 2R2UA 5KG0A 4I64A 4A8OA 2L08A 3TTDA 1NO8A 1QDUB 1RDCA 2PEHA 1U1NA 4P2SA 2A3ZA 5KPZA 4K41A 4JB3A 2ZHOA 3CFOA 2P66A 4CECA 4RT2A 1HNIB 3U26A 2AEJA 4HH1A 2OTLS 1NDPA 1U0SA 1HQUA 4ZTJA 2E8AA 2R8KA 1TFYA 2ZIWA 4KH0B 3R2CJ 4KHWA 1YVFA 4ENOA 1B7YB 3WK5A 1ZQOA 2GIQA 2DVIA 5F3ZA 3SEOA 3ZDDA 3THTA 3OT9A 4JS5A 2ZH9A 2KE7A 3JQKA 1MA7A 3V1OA 4B1VA 2NXUA 4OMFG 3FQKA 1HNXK 3THVA 1FFGB 2MZJA 5HLFB 1L3TA 2DF4B 4QWBA 4KLEA 4WFNL 4K25A 3AVJA 4F91B 1RE1B 1TMJA 3PKYA 3NNCA 4C3MA 4IQMA 5LL6d 4RNHA 3ZSWA 4FN5A 4WZQA 4FZLA 3T1HK 2BHNA 1HR0F 1Y7PA 2O8DA 2LQJA 3MX5A 3FR0A 4I2AA 5C0YA 4KV8A 1H73A 1RT4B 1L5UA 3ENAA 2I5JB 3T5KA 5AK3A 3K59A 3ENOA 3NRWA 2O8EA 3L4BC 2MQNA 2B0GA 4K4UA 3BGUA 5AQKA 3UN5A 3JYTB 2O3DA 3SDEB 5LJVA 3KLEA 2GNKA 2PY5A 1SZPA 1OVYA 3FVYA 3TYTA 3JTNA 1SAZA 3H4DA 5ETMA 3ISND 5J2IA 2ZH6A 3OYGA 3A0BU 3IBCB 5M2UA 3QXGA 3WXLA 3ZSOA 1Q7YO 3FEYB 3Q0AA 2HFVA 2GGPB 4PQUA 2ZIXA 3BY5A 3H59A 1CZAN 2QE5A 1NSAA 2IVPA 2BABA 1FJEB 4GKKK 2BCUA 2D41A 3QDKA 1XU4A 3SMPA 2EXUA 3IP0A 4YOEA 4F5RA 1SH2A 2BZ2A 1U8SA 3CJRA 4FLZA 5CYQB 4CEDA 2YQ1A 1B70B 1U48A 2GX9A 3DMJA 8ICKA 3VEXA 4FJ7A 2B4OA 1S1VB 4MDBA 4P7TA 4Y1DA 2MAXA 1UKUA 2M70A 3AJDA 1NZBA 2ZE2A 1YJ7A 2J8SA 4NM2A 4M0AA 8ICLA 2QX0A 1K6YA 3AB2B 1QQ7A 4Y2IA 2APOA 1X40A 1KBRA 1V9PA 4DR3J 4YUDA 4X4RA 2ZUAA 1NNLA 3AM9A 2Z58B 2N82B 1ZBIA 4LFCF 1SIZA 2G0CA 1N63A 2EQYA 3QINA 4M63C 2F4VF 3FJ2A 2ZG6A 3LP3A 2WB1D 3WT0A 3KG0A 4DFPA 5KFHA 1FJ7A 1YI2N 1N0UA 2OHDA 5E33A 4USJC 4J03A 2G06A 3ATVA 4X4TA 4J9PA 4DEZA 2BTFA 1HUXA 4H4KC 2DT9A 4QWEA 4NO7A 4CDIA 4DX6A 1RBOB 1RBLA 4EYHB 1XBWA 2F8EX 4DV7J 4K4VA 1T8EA 2YY3A 3H7HB 1RAOA 2FVPA 4K4WA 5DDPC 4OZ3A 2Q66A 5KG5A 1BD6A 2YX7A 4B3OB 2E3TA 1FRMA 3HHLB 2CJ9A 1DARA 1PVQA 4EZ6A 5AZJA 2ISPA 4FZNA 2XS2A 4L3KA 2OAUA 3UD4P 4IH7A 1A5WA 5GIOA 4WZMA 4AL6A 1FX2A 4JI3F 2LXUA 3EPIA 1ZQ1C 5D0EA 4QW8A 4HACB 5HVGA 4M47A 3RJEA 3OTCA 4WXWA 1RTJB 1D8LA 1TKDA 1G7CB 1ZA2B 4H5RA 2D8CA 4MO4A 5J2JA 3BO3A 2XULA 3L3UA 4Y6IA 3CMEN 3GJRB 4B3MJ 2DTUA 1QAIA 2M7SA 3NP5A 4JMUA 2LQ8A 4DL7A 4X4OA 3CULA 1LWXA 3GYGA 1RTDA 3DLRA 4NYNA 4F4KA 2ZJ8A 4DZDA 4DR2J 3UFCX 2CWKA 1YITN 3H1QA 3A8IA 3MR2A 1K44A 2WFAA 3SQIA 1YWXA 1BQNB 4CD3A 2RJZA 1P27B 1XQSC 3Q7CA 2QXFA 2H5EA 5J2MA 4ED2A 4BACA 3GJQB 3S6JA 3PRVA 3A8JA 3D2EB 4KY3A 3BF3A 3QU5A 3BQ2A 3BSCA 4DR4K 2CZVC 2RVJA 2KYZA 3MM6A 3OSPA 5ETKA 1B3TA 3C5FA 1FJGK 2V2QA 3D2FA 1FO1A 3QPIA 4OHZA 4ZLJA 4GLXA 3SSQA 3N6LA 2F9TA 4QIWF 1N56A 5M1KA 1H3DA 3CIMA 3BGOP 1ZQNA 1NK0A 1D9AA 3ZTRA 3A5OC 4AXIA 2FI1A 4J2EA 1WG1A 1I5OB 2VPXB 5DDRC 3ET6B 1IN0A 1XK8A 4LFBK 1XUPO 3W2WA 3SBGA 4XPCA 3G8TA 3OYEA 2GO9A 3V81A 4IYQA 1RTZA 3KHRA 2CFXA 3K5NA 4R79A 2XSJA 4WFAQ 1D9FA 3OGUA 1H6KX 2PDAA 3M9NB 3ZZPA 3UDEA 2CGJA 2D6FC 4LF8J 4PL2A 3TAQA 3JAMO 3MAHA 3HVWA 1RACB 4ZN3A 4O0JA 1CG2A 3DRRB 4WFYA 1XNQF 5AKZA 4KH1B 4P2MA 4BROA 1GNKA 2MSTA 3WK9A 3G87A 3ZZ0A 4CNYA 4IQWA 2R2TA 4DV5K 1HNZJ 1FRXA 4DV6J 2OTJN 3W60A 4LRDA 1MU2B 2CH6A 4QNLA 2GAGC 2YNHB 4DUYF 4RR5A 1V4SA 3QBWA 5GMDA 4JI7J 3AO2A 4FLWA 4NXMK 1I6JA 2XNQA 2BE2B 3A1YG 2DGOA 3B82A 1HL6A 2NZCA 5CD4A 4FXWA 2VZ9A 2H5JB 5F3XB 3R5DA 1VFJA 3AT1B 5E26A 2HBZB 2J7WA 2QSWA 2ETJA 4Z4CA 4I29A 2DH8A 2E29A 2EC0A 5DG8A 3ALRA 3DDNA 4FVMA 5F8NA 2XYPB 4A8SA 3SMZA 3UM9A 3PR5B 1S9FA 4X64F 4F4YA 1IO2A 3F2DA 2XZWA 4ECYA 2XI2A 3TQ1A 3DHXA 1KCFA 1FXXA 2DGXA 4DR1J 5FLXO 4FF1A 1J5EK 4RLEA 2OANA 4CJEA 8ICOA 5AHXA 3AJ1A 2KHQA 5GADP 2BCRA 5B66U 4JI4J 4J2AA 3KK1A 2XCPA 2KHOA 1GMWA 3PV8A 4A8WA 1EQYA 3IAS9 2N3LA 2BDPA 1VQ8S 4DQ8A 4CBWA 3TVYA 3VEVA 1IXRA 4CH1A 3OTOF 4FJLA 3KLFA 1J5OB 3ULDA 4KAZA 1A5XA 2B8QA 4M6WB 4UAVA 2R2RA 1ZQVA 3A0IX 2KYXA 3J7ZO 2KB2A 5BPMA 3QYYA 2E2OA 2M9KA 3MCNA 4EFAC 1DGSA 5B0FA 4EUVA 3H98A 1URRA 1ZD3A 4ZPDA 3VQQA 3VALA 4DTUA 4B1YB 4DSFA 1U0HB 3CJKA 1HI1A 4PR6A 2DY1A 4CO5A 2M0NA 1JLAB 2N4DA 3K9JA 3TSQA 4B3TF 1SV5B 2DR9A 2HVHA 2BQ3A 2G2YA 2FJWA 1SIWB 2RN2A 2KJVA 3BH7B 4MFFA 3LM9A 4DU4A 3QMQA 2XMKA 5AJ3J 3BDPA 1IWAA 1ZQEA 3R6GB 4HUFA 5KOXA 4LF4J 4H8KA 1CULB 4OFZA 2FBTA 3K8WA 1KDHA 1PILA 6FD1A 4QZGA 3OA9A 1L8OA 2W24A 7ICKA 7ICNA 1KD1T 2QTDA 5IQQA 2A42A 4QIWC 1HW8A 4JUZA 3OFFA 4JKHA 5GIPA 4DPYA 3TPQA 4YR2A 3HM9A 1ZBLA 3QFWA 5JLFA 2HQCA 1RT3B 4CEZA 2X6NA 4BC2A 3BQTA 4ETXA 3LGMA 3UI3A 1X2IA 4BWJA 2MU2A 1DZ5A 2JL9A 4OPAA 2W7OA 1S0MA 2PKEA 1YJWN 4AT1B 3P4UB 4RQ3A 3IMXA 3IDHA 3AXMA 4B17A 1B64A 3UMBA 5AKGA 4NRTA 1IKXA 1CBKA 1NB2A 3WEEA 1LW0A 1S5LU 4ANEA 1HWKA 3M8QB 1KR4A 1N33F 4NWBA 4P0QB 3EE9A 1LW2A 5L1MA 3ORYA 4M8LA 3LPEA 1URNA 3N6MA 2VG7A 3Q24A 4F0HA 2ROGA 3M2UB 3HJFA 5EWGA 4I2EA 3K75D 3H8YA 3SQOP 1B9FA 1EXNA 2CN1A 2FGOA 3QIOA 3VERA 1BVSA 3QIDA 1KQKA 4CEBA 2A2DA 1AT1B 3AVFA 3QJLA 3GZ7A 1O03A 3CCRN 1E6VB 4ZCIA 2QWOA 4I9LA 3Q8KA 1R0BG 2BMBA 4ID5A 2YX1A 4O4GB 3UR3C 1S76D 4X4SA 3AA9A 5IM0A 3ZTQA 3E8OA 3GIJA 1HKCA 2V69A 1RT7A 4I2JA 3HT3A 2UU9F 5EX5A 5SZTA 3KDOA 1N36K 1VQPS 2M5YA 4A57A 3PFEA 3VV2B 3ID8A 2MKKA 1D09B 3ZT4A 4IG3B 4BC5A 2MLYA 1N5YA 9RUBA 4CEAA 3BPDA 1N34K 2E2QA 2EANA 3DLEA 1T9XA 3X3UA 3CJAA 4V19S 4IJNA 2X1GA 2EG2A 3FZFA 2OZMA 1T3OA 1T6CA 3HTVA 3CMQA 3FFIA 2LMRA 5EVZA 4M5JA 4QR2A 4IQVA 1S49A 3GG1A 1JALA 3QE9Y 1UWBB 4KB7A 3HPGA 1VSDA 2VGMA 1UVJA 4NRUA 3SI8A 4WIQA 1NEEA 4H0PA 2DHHA 9ICHA 1C0TB 1HRHA 2F9WA 3BS5A 4C8YA 2ACMA 3KHHA 4WFZA 3UW1A 2VQFF 2J9EA 4R25A 2ZDOA 1BQMB 2G8IA 4RW9B 3TAGA 3DEEA 4DR7K 1I1GA 2LKZA 3SBMA 4ILLA 3NVWA 2RB7A 4ZVUB 3TU5A 3ATUA 1C1AA 2HZCA 1OPZA 1GLCG 2GQ2A 1MDUB 4Z4EA 1KXPA 1OY6A 3ETLA 3WKEA 3GCWP 3I5CA 4IL6U 2V8DA 4NYOA 1QHAA 2UUBF 5IWAJ 1GOAA 3MMBB 3AU2A 4FF4A 4RW8A 2DBBA 4M9GA 2A19A 1S9GB 1EAYC 3GG4A 1IBLK 5K14B 5HHIA 5ALIA 3VQTA 2IY5B 2YKQA 2RHQB 9ICGA 3BS9A 3FEXB 4H03B 3J80U 5TKWA 3R1LA 3CCZA 1WF2A 4Z0UA 4CTAA 4J7CA 3NVVA 4ZK7M 3WX4A 4J9LA 1QTMA 4XDDA 4CIEA 3EYZA 2QLXA 3CC7N 1F1BB 2QA4S 3ENHA 4NLGA 4Z7YA 4C8OA 2CPXA 2K60A 3K58A 1ECWA 1NZ8A 2CWXA 1WWHA 2Z56B 2GC8A 3BQ7A 4CF8A 1OKJA 4W5OA 3PFOA 3QRPA 4KN7A 2AGQA 4WQ5A 3Q8UA 4DN0A 3EGZA 5A2QO 4FJ8A 5DB9A 4UW2A 4DV0J 5ETLA 1FESA 3CMAS 1UVIA 4B3RK 1N0VC 3OVNA 1BNOA 2OELA 3NH2A 4ZKAA 5I3UB 2GHVC 5I3QA 3ZD9A 5AXKA 4KHSA 3VAKA 2AGPA 5HQLA 4OJPA 4O3MA 2B7CB 1NK8A 3V7LA 4LT6A 1P1TA 4ZHRB 4KFBB 3UCZP 1HNVB 2CKWA 4ZP9A 1FFVA 3NOGA 3WIUA 5ADZA 4CF9A 2PA3A 3TACB 4YFKA 2F3NA 1RHJB 2ZBCA 3GLJA 3CB4A 3RRGA 4YD1A 1LOTB 3VESA 4RPZA 3EMTA 2PO4A 4UUWA 4EK2A 2RD5C 3AMZA 7ICEA 4JI1F 3Q23A 4YMMA 2DY4A 4C8ZA 3BEGB 3JQJA 3C1ZA 4F3QA 4ZA1A 4DU8A 1VQ6N 1QAYA 2O8BA 2HQ3A 3K1ZA 3SAFA 4LF6K 5J0OA 4RNOA 3QFPA 1B9DA 1Z1BA 2HNDA 1HKAA 1BCOA 2IIHA 5AKIA 1SIJA 4PG5A 4QU6A 3U8XA 3TRGA 2ZJ5A 1U1RA 4JKAA 4YOVA 1NLVA 5CHGA 3QGPA 5AQZA 4OV6A 1TUWA 3MAAA 3V6JA 4PHDA 5J2NB 3VAJA 3OL7A 4KI4A 1MQ2A 5ETOA 4JK7A 1W97L 1YDLA 3VEYA 1ZS6A 4H5WA 2Q2RA 1UFKA 2HFUA 3CCEN 2HQFA 2GUPA 4C11B 3RMAA 1FRJA 2FJVA 4NMLA 4PKHA 1JN3A 1VQYA 2NR0A 2RE1A 5EY4A 1JXVA 1HD1A 2XNRA 2HVDA 1DKGD 3VEZA 1TUVA 2YWWA 4PAAA 2DNPA 1NBEB 5ALYA 4FPAA 3QYPA 1RWKB 3ZZUA 4ZOSA 3CERA 4XH5A 1HJOA 4JB8B 3QZ8A 2XHBA 2ZIUB 1REVA 5AIAA 4CJPA 4PKDB 4KKOA 4DHYA 3AD9C 5AKJA 3PYEA 5IT9O 2NQPA 3PMNA 2NUUG 3GFYA 5AI0A 1U04A 4BE1A 2Y9HA 3D9BA 2Q6CA 5KOWA 2IMWP 2P9IA 5GTIU 1RWXB 4OD0A 1M5PC 1WSJA 3PRBA 4DV4F 4BRLA 1SUQA 1YJNS 1X4HA 2JC1A 5KFOA 4AHSA 3QWUA 2VQEK 2RS2A 4GVLA 1DTQB 2RQMA 1VRQC 3BS7A 3T5HA 1W9HA 3GILA 2W25A 5C15A 4RZRA 1F5AA 3SCJE 2E1PA 1YJUA 3VGLA 2OYQA 5D6GA 5J2PA 4CF1A 3LP2A 5KG4A 3ZC4A 4E2FB 1NDKA 2DGQA 4PH5A 2F9JA 4KR0B 2KN7A 4L75A 1FDBA 1ASVA 3G25A 2J6SA 1ZBSA 3H8SA 1ZQGA 2WF5A 5IIKA 2VBYA 3D28A 3OTEA 2O8CB 1YJTA 2FPHX 5LMUK 3G71N 3VQEA 1IUJA 2ITGA 1UW9A 4DOCA 3Q8MA 4OKEA 4LSNA 3ULEA 4X65K 1YZ7A 9ICOA 4LRFA 5KGXA 3EKUA 1EWQA 1PYSB 1H72C 1SJ3P 3MR7A 3CETA 3NL0A 1VSHA 5LJ5Y 1KFSA 2Z0GA 1HNIA 2UUCK 3UN2A 4PKGA 2YXLA 3N7PD 3TO8A 3AA5X 4LFAK 1ROFA 1VJQA 4TUQA 4AD6A 1OO0B 4OHXA 1T6DA 2JR5A 3G0ZA 3WK7A 3ETOA 1FEEA 4JV5F 3MM5B 1Q53A 5CCLA 2K4EA 3M6ZA 2G9OA 1SBRA 2D74B 2UYTA 4O23A 1BIZA 5HLFA 4I2DA 2LA4A 2G8FA 4I69A 3VOVA 2XRIA 1VQ5N 3HZ6A 2HHHK 4FXDA 5JUMA 3SBTA 4BRNA 2EFQA 3MABA 2IYGA 2HHXA 3EWGA 2RT3A 1Q7LB 1LKYB 1NDLA 4QOZB 5D77A 2VPYB 2PMHA 2A18A 1OH8A 3ETMA 3QIPA 4YY3K 5AQHA 2E6LA 5D4PA 1WSVA 2GVDA 3CTRA 4MN4C 5ALUA 1KVBA 3WNGA 2HSZA 4UAWA 3PW2A 4DV2F 4OGCA 2E4LA 5HMZA 3LGNA 3SDEA 2VH7A 3G8SA 2PAVA 3BEXA 3MPDA 1KN5A 4N8NA 5ITHA 1R8BA 2FZKB 4P6QA 8ICTA 2PMZC 4JKGB 3MR6A 4O44A 3U9DA 2DIUA 4HEA9 1K8KB 5ALWA 3MECA 2XZTB 1SKUB 1RZMA 2R7QA 3EW9A 4WQ5C 2KTQA 3MGJA 2YPYA 3GSIA 4KT0C 3OY9A 1CJVB 2QWQA 4K42A 4GKJJ 3VGSA 4KYZA 4QZHA 2WF8A 2HBQB 2YKNA 3RW6A 4DF8A 1ZRNA 3NF6A 5CYQA 1Y0HA 4YDUC 1R8HA 1VAZA 3MM7B 2BANB 1HFEL 1GOBA 4UB6U 3AFGA 3C14B 1K73O 2HF4A 4LRCA 2DCLA 1MN8A 1S6PB 1TAUA 2LP4A 4KN4A 2Y9UA 2P8IA 3H08A 4FF2A 3O2IA 5KG3A 1VQ4S 5HBMB 3SPZA 4P4PA 1M5VC 1HHQA 2IAJA 4DS4A 5KT4A 3SNNA 1T4GA 4WF9L 3TEHB 2ZD1B 3VPZA 1HBMB 2G07A 1NJWA 3HSCA 1RLDA 1PBUA 3VF4A 2L48A 3ZSVA 1Q4RA 2RDDA 1BHNA 1O08A 4NLDA 4RJVA 2E5LF 2KIVA 3VENA 1WC3A 1PC4A 2G09A 2YQ3A 2JWLA 1ITPA 1ULRA 2PBDA 3BZCA 1RPLA 3M8WA 4WFBQ 4JI2K 3UN3A 3HT0A 3HZGA 5A8RB 1MA9B 1UWAA 2DNLA 2R7RA 3ILIA 3U1MA 4UOFA 2BXJA 2H3FA 4FWNA 2OFHX 4GXKA 5C2GA 3HHLA 4OLPA 3NGDA 4D3HA 1X4CA 1KN6A 5LT5A 1EKRA 1DK2A 1KQGB 4S0MA 3HKZF 2C2KB 4Z6DA 4HWIA 2ILYA 4IOAQ 2CQ0A 4YR0A 1TKZB 2EI5A 3RB3A 2ZZNA 1CLQA 2KSOB 3MXIA 4BRCA 1RTJA 3CI5A 2JLFA 4QPTA 3VQSA 4LREA 2GJFA 2MZ1A 3D6TB 1WC0A 2W43A 1WG8A 2MKHA 2UXDF 2DISA 4RUAA 2ILZA 1B7FA 1S0NA 2FSNA 4CI6A 2AXTU 4OI4A 5HMMA 2F2AB 4FWQA 5FRMA 3OUYB 3R7NB 4DL5A 1BQNA 4E7HA 1ZTWA 4NYZA 4LFCK 3K8VA 4C8LA 1Q79A 2F4VK 4M5LA 4ECQA 2X6SA 2XO6A 4DBQA 4NCBA 3PSFA 1MQ3A 3M8PB 3DLLL 4FBUA 3HVRA 3CJTA 2HBLA 1XMQF 3IM1A 1SWWA 1YRTA 5F2RA 2CZ4A 1S0OA 2CUYA 1XR6A 4LF9J 5ADXH 3CG7A 2OZSA 1QVFR 5D4BA 4IO9Q 2V4JA 4KTQA 3L7UA 4M95A 4CGHA 5DBAA 2NS1B 2ZJRQ 3ET6A 3KHGA 4NLKA 4Z4IA 3HLUA 4M04A 4ILMA 5IZHA 4K0KK 3O9RA 3NS1A 3ZX3A 4LFBJ 4M3ZA 1ZQFA 2E88A 3S41A 4H0XB 4FLXA 5LSRA 1ZQQA 3NWRA 1HEKA 1YBTA 2KV2A 4MO5A 2KRBA 4MH8A 4ELVA 2LSNA 4EEYA 3KG1A 3CJ0A 1TR0A 5KFBA 4WTOB 3CCQN 5HVHA 1RABB 5KFSA 4X62F 1FWKA 2F40A 5D49A 1YK9A 3CF5Q 2CQPA 3IM9A 1CXQA 4KHRA 4X66J 1YTAA 2DXDA 2JZBB 1E6YB 4YB1P 4FXVA 2CZ9A 8RUCA 3RH4A 1ZTTA 2MTLA 1MU2A 4GMKA 3F56A 2A6AA 2YNHA 4I6MA 1C20A 3ISBA 4DPOA 2RAQA 1HNWJ 1BUPA 3J7Z5 4KLSA 4DX8H 2UUWA 5BR8F 2P9KB 3QU4A 2HRTA 3DN9A 3M6WA 3QATA 3SZ2A 3MEKA 3RF9A 3FSIA 3R97A 4Y2KA 4EIAA 2KEYA 1TK8A 3KJVB 2V51B 2J8AA 4K4HA 2G08A 3C6AA 3V9SA 1HBNA 1Q3UA 4ED5A 5I42B 2NRRA 1BDGA 2AJ0A 3UPFA 3KG4A 1ZETA 1ZM9A 4NXNJ 3LVVA 1U9LA 2BPGA 4FBTA 2Y0SF 3RR8A 4NM1A 4OI2A 2EFGA 1U47A 1YJ9S 3R3TA 3ILOA 3CJ1A 1RU2A 4WWSA 3KFUF 4ZVQB 2R3VA 3MN6A 3IWLA 5D15A 2HIQA 3CJ8A 4DF4A 1J5EJ 3UIQA 3HKZC 2RH3A 1BCMA 2F1HA 2I8EA 4DX7A 2Z1JA 3BQ0A 1BE4A 3AAPA 4YN3B 2HHPA 3OYHA 4OZNA 4JBCA 1J5OA 4JD2B 2VB6A 2QA4G 5KFGA 2M0GB 1DBDA 2E5IA 4A46A 2P51A 1NBWA 2JH1A 2JSXA 3KJQB 1JJCB 1VQKS 3MGVA 1FVSA 4C0HA 2A6MA 3I96A 3WUHA 2Z1HA 4I7FB 1S5ZA 3WBZA 3BGRB 4LJMA 3PYDA 4CFAA 4M3TA 3CFRA 1U0HA 2KFNA 1NJYA 4J90A 2AF6A 1PIEA 5A8KB 2FC8A 1BPZA 3F9KA 4H0YB 4JI6F 4O0IA 1JLAA 4DUYK 2HFZA 3PM9A 4KLOA 1SV5A 4BRFA 2HRUA 3DDIA 4PZOA 4E0DA 4KAIA 3NGKA 3M1VB 1WF1A 2CRLA 3D2SA 3LANA 2JNJA 1N5TA 4YHHF 4C3KA 3TQEA 4JK8A 4XQ8A 2ZKTA 1VLYA 4RQ8A 1ZQXA 3TARA 3DXSX 4Z7CA 3SR6A 2VC0A 2E5JA 4ILHA 4PHTX 4NLQA 1CULA 4ECWA 2XS5A 3GU0A 2CQ3A 1HA1A 4FOIA 4O8KA 1S97A 3LZJA 5J0PA 1H2TZ 4A47A 4X64K 3VN5A 2R7TA 1YHQN 4I4BA 3B6OA 1MWKA 2NSBA 3D7EO 3I33A 3BKFA 5FPNA 4Q44A 3HP6A 3IXQA 9ICBA 1RT3A 4YB7A 1WAFA 1P6TA 1U6FA 5AFUH 4C80A 2XMUA 3KD1E 1MSWD 5H9FK 1VRUA 1FFSB 1OMSA 2R7YA 1U2FA 4DTXA 2FE9A 1F21A 3LAMA 1XC3A 3J7A1 2Q3SA 5AQNA 4HI2A 4A8YA 4Z4FA 1UT5A 1IKVB 2GIFA 4ZLPA 2NPFA 2WF7A 3SUNA 4PPXA 2QYCA 1XNRJ 5KFKA 2EFNA 2PEBA 5LSOA 2H51B 2PT0A 4F26A 3HHLC 2DO0A 4W98A 4DI6A 2MMYA 4CZCA 1TGOA 2QKBA 1ZZFA 2ALZA 4P0QA 3RWUA 1LWEB 2K2PA 1HYSB 2Z1GA 4IFEA 2PYLA 1RT2B 4CJ5A 3EGNA 3P39A 5ALNA 4LIRA 3Q8LA 3O8WA 2AV5A 2V8PA 2GBZA 1QSYA 1E6VA 2V7ZA 4DCPB 2VJ5A 3O8MA 4A5BA 3LDNA 4K2JA 4O8UA 4O4GA 4RPFA 2W2PP 2E1ZA 9ICSA 3QERA 2CVEA 3QGHA 3X1LB 3A13A 3SUPA 4QIEA 2B43A 2FQQB 3M6KA 2Y8YA 3CM6A 4OYOA 2WW8A 1YXQA 3IBFB 5DK5A 4BUGA 4IG3A 3IG8A 3FMBA 4OI6A 3D1QA 1JQGA 1N36J 2IVYA 2Y0SD 1V4TA 1X3MA 4KLTA 1Q95G 3J7YU 1GTHA 3OW2M 2Z8QA 3C95A 4NMXA 4LVSA 4CFDA 2RIJA 4CF0A 3MN5A 1B0PA 3AAQA 1C1BB 5DM6Q 1LXJA 2QKQA 2LM1A 1X9MA 1UWBA 4KLDA 1K9MO 2QLFB 2WK4A 1UFWA 3ZEUA 4FWLA 5TKYA 3M1YA 1NKBA 5AI4A 2FVQA 1IVZA 5J2KA 4KRFA 2KU7A 3HFZB 4UB4A 1QUVA 2RDIA 1TL5A 1U1MA 2DHAA 2EC2A 4B8AB 2W04A 2AWZA 4HR2A 2W9MA 4PL1A 5KAFU 2UVWA 4XIUA 4RW9A 1WYGA 4Q43A 4JK9A 3NF8A 3DOMB 1Q81T 2RRDA 1OWXA 1X42A 5AQRA 2HFSA 4BE0A 4NE9C 4WU3A 4BG8A 3VQ5A 5CHIA 3NGSA 4CGFA 4PPZA 3B54A 1ZH5A 2MHEA 2JOQA 2NXCA 4I2GA 5ALVA 4MKVA 5GADI 1WWVA 3OHBA 2FSKA 4MKBA 4DR6F 2IVNA 2JLEA 1AZSA 2EBGA 2ZOMA 3AQFA 2DRAA 3LPTA 1S9GA 8AT1B 4Y2XA 4BVOA 5K14A 2MHNA 1BPEA 1H38A 2FUG9 2EK1A 3CFPA 2JHDA 8ICVA 3FGVA 1B4SA 3MOJB 3ZX2A 9ICJA 2GWKA 1RQNA 2VG6A 1IBLJ 5DDQC 3RW7A 1W26A 2PFFB 3JQMA 3BH6B 2DR5A 5KFXA 2AYBA 4RPYA 2JX2A 4CK1A 2C42A 2ACYA 4USIA 2NXNA 1RTHA 4K4XA 3DLKA 1GEHA 1WKLA 3O3GA 1RTIB 1YTUA 4DKWA 3TWZA 2D4WA 2I9SA 4DL6A 5CZVA 3CCTA 1LK7A 3RH6A 2FSJA 4KLQA 2FVCA 2BJ3A 3J81O 2HOQA 2H65B 2FLLA 4NYFA 1BWEA 5BXIA 3UKRB 3P31A 3PNCA 4MYTA 4DTRA 3JAMY 1W2BM 5JVGL 3L7PA 4WJ3B 2VQFK 2KD1A 4LF5K 1VS3A 5J1NA 1FDAA 2A1BA 2ZJPQ 3OTQA 4ZHRA 3VWSA 2ZUCA 3BBBA 4KFBA 3C8YA 4CNZA 4ICAA 2U2FA 3QUQA 4E1NA 1S72N 4RU2A 1JKHB 1VJWA 2W55A 1AXQA 4XPEA 1FK9B 3S3MA 5J2DA 2ROPA 1HNXF 1JI7A 1KRPA 3LDOA