1L3VA

Crystal structure of bacillus dna polymerase i fragment product complex with 15 base pairs of duplex dna following addition of dttp, datp, dctp, and dgtp residues.
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*AP*CP*GP*TP*C)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3vA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3vA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3vA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3vA01
4ECYA 1XSPA 4I2AA 1S9FA 4G1QA 4IKFA 3QIOA 4ECRA 4ELVA 1BPBA 5KG4A 3DM2A 3HVTA 4Z6FA 5J0PA 3OYEA 3ISCA 5L1JA 4O3OA 3AVMA 5J0UA 4YN4A 4O5EA 1S6QA 1RT1A 4J9LA 4KLEA 1T3NA 1W9HA 5KI6A 4CJUA 4FJIA 1NK5A 1RXWA 1RBTA 1BQNA 2VG6A 3ZDDA 1EX4A 1H38A 1WNSA 3CYMA 1JLFA 8ICMA 1SL1A 3NH0A 2W42A 4YD1A 1MQ3A 4FJLA 3Q8KA 5J0QA 3B0XA 4C8MA 4C8OA 1NKCA 4KLIA 3RMCA 3ZSQA 1A77A 3GV7B 7ICFA 3I0SA 4FK2A 4FZZA 2X6SA 1BL3A 4IRCA 1RBVA 2FMPA 3RMBA 2Q0ZX 3O4NA 3I8DA 5DQIA 4Z0UA 4I2BA 3KHRA 4FJKA 2RDJA 4OKEA 3KLEA 4F5PA 2OPPA 3LZJA 1HQEA 1I39A 3AVAA 3OHAA 2I9GA 4FZYA 2IA6A 4L8RB 1S1WA 1Y88A 7ICSA 4DL5A 4MEYA 3RBEA 2YHBA 1ZQEA 1VSEA 2XY6A 3PW2A 2DY4A 3MEEA 3SI8A 5EWGA 3RAQA 2PY5A 1Z25A 1JL1A 1ZBUA 5DKWA 4KLFA 2AQ0A 4CHOA 5J0WA 3MDAA 4CHNA 4NM2A 4RT2A 9ICIA 3PW7A 1VRTA 2G8VA 3U6FA 3KLIA 1KSPA 2IBKA 1ZBHA 2ITGA 4DQPA 4CGGA 3JPSA 3QIPA 1JMSA 4KTZA 3QEXA 2MUTA 4LY7A 4EYHB 4DQSA 3Q8LA 3VQAA 5DMRA 4FLUA 5HHHA 4M2YA 3MECA 3AO2A 3VQ8A 4MF8A 4YD2A 1LAWA 4M41A 2OPQA 4OVLA 4FJHA 1RT2A 1EXNA 4FJXA 4C8LA 2F1IA 5E41A 9ICVA 4C8NA 9ICRA 4YVZA 2PI4A 1XO1A 4F5RA 1BPZA 4FM2A 5J1EA 5C5JA 1C7YA 4RQ6A 2D0AA 4B9LA 4UQGA 4DFJA 1JLBA 3AA3A 2O4GA 3VQ6A 3HP9A 1S1TA 1KTQA 4TQSA 2F8SA 4ZHRA 1Q9YA 1QLNA 4QZEA 2BCQA 2KTQA 3TANA 1IKXA 1UOCA 3AVLA 3AA5X 3Q8QB 4QWBA 5JS2A 2AGOA 4DS4A 4XIUA 3C1YA 8ICHA 3KHGA 2ALZA 3OYFA 4BWMA 4GLXA 4E3SA 9ICPA 4NCGA 2HHSA 5KT4A 2FBXA 5FRMA 1RCHA 4JLHA 3T5JA 2IS3A 1T8EA 2E4LA 7ICGA 7ICIA 1HPZA 8ICAA 4G3IA 3ZSXA 3T5KA 4LD0A 5KT3A 5DG8A 1B9FA 3IG1A 2A1JA 1UT8A 1RYRA 3AO4A 2VA2A 5KGXA 3K2PA 2OPSA 4M9NA 5HMMA 3UPQA 3HPGA 4F4KA 3TAPA 4KI6A 4FLYA 5KG0A 4PHAA 2BQ3A 1XSLA 5CA7A 1HRHA 1X2IA 8ICCA 1V9PA 4P4PA 4DL6A 3PVXA 2E6LA 5HRPA 9ICNA 2W9BA 3NH1A 4IR1A 4M3TA 7ICVA 1NK8A 2V4QA 3GV5B 1RXVA 3AO3A 3C95A 4KKOA 1UT5A 3K5NA 3VQ4A 3SYZA 4QZ9A 1YT3A 3HK2A 5HRNA 1S76D 4DTNA 4ED0A 3RMAA 3P83D 1HQUA 4IBNA 1HJPA 2OZSA 5J2HA 4K8ZA 2C22A 3DMJA 4DTMA 4N41A 2P66A 4Z4GA 3NF7A 3VA3A 3H4DA 3V1QA 2NUBA 8ICVA 8ICSA 1ZQCA 3L3VA 2ZD1A 2YNHA 4O44A 4CEBA 8ICPA 3TAFA 3AVCA 5KFBA 2OA8A 1RZTA 5KRTA 1C0TA 4MFCA 4DL2A 2ZUBA 4F2SA 2W8KA 4QZIA 8ICOA 1B9DA 3MDCA 2ATLA 3AVKA 4R65A 1RYSA 4KHQA 2PFQA 4F92B 3CQ8A 2IOCA 4FYDA 1TL1A 1JIHA 5J2GA 1Q8IA 2EHGA 4RPYA 4YP3A 2ASLA 4PPXA 4M0AA 3KIOA 1S10A 1ZQZA 5DB6A 4DSLA 4LSLA 4YNQA 3L2QA 5DQHA 3THVA 3UQ2A 3ZD9A 4GXKA 1S1VA 1KCFA 3NHGA 4KLGA 3RJFA 2XY7A 4DSKA 1RTHA 4E7HA 3ZT0A 4UB4A 1ZQHA 3OYKA 3RB0A 2OZMA 4H4MA 1TK5A 4CEFA 4B3OA 4CJQA 1BI4B 3ZT3A 2IDOA 3AUOA 3T5HA 5CYQA 7ICTA 1X9SA 2H5XA 5D3GA 4UBBA 3V6KA 3G10A 1VSKA 5DDYA 4KLUA 1KRPA 8ICUA 1ZBIA 9ICAA 5CR0A 2VANA 2BGGA 1BCMA 4DOBA 5J2FA 1S0VA 4IR9A 4CEDA 4KRFA 4FLZA 4E7KA 2D0CA 3RH6A 3ZDAA 3CFOA 4CGDA 2MAXA 4J2BA 2GV9A 4PH5A 2LSNA 1NJXA 4I9LA 2JEIA 3SV4A 4BE0A 1S6PA 1KLMA 2KQ2A 2FMSA 4KI4A 5D46A 4PUOA 1ZQVA 3K57A 4ID1A 3SV3A 3L2WA 2FLPA 3DRRA 5CZ1A 3QESA 2XGQA 3HM9A 4FJMA 1ZQNA 1ZQLA 3OS2A 2ASJA 4NLNA 4KAZA 1U04A 4ECQA 2W9AA 5KFXA 4J9OA 2Y1JA 4R64A 4K4GA 1FKPA 4RQ1A 9ICEA 1ZBLA 4RUAA 3DLHA 3K75D 4DL4A 4J9PA 4QW9A 4PGYA 3VQ5A 3HL8A 4OGCA 4O3SA 3EW9A 3GILA 4DMNA 5F9NA 3OYAA 3QEPA 3ZDCA 3OGUA 1JLQA 1SKRA 5CY4A 2PXIA 3JPRA 1RT3A 1TKXA 5IILA 7ICQA 8ICNA 3IM1A 1J54A 4LSNA 3HXMA 3S3MA 3JPTA 2DFHA 2ATQA 2RPIA 5FDLA 2KZMA 2I5JA 4O5KA 4RQ0A 4EP4A 1BPDA 4ELUA 3SQ1A 2YNGA 1CLQA 1RDDA 1S1UA 5DK5A 4B9UA 4F4WA 3D0PA 4W5OA 4CJPA 3KHHA 8ICBA 4O0JA 3V9XA 1ZQFA 1DTTA 4M45A 5KT7A 4OJRA 8ICGA 5CB1A 3MABA 4DSJA 3OJUA 4PHDA 4CJTA 4FK4A 1ASUA 3OYJA 3K5LA 3ISNC 2BKEA 4Z6CA 2JZBA 1XI1A 4FLWA 5HNKA 3DI6A 4QWCA 4KB1A 4GXJA 5J2PA 3M8PA 3C21A 3AA2A 5HP1A 1ZQRA 4QWDA 4ED6A 4FCYA 5KFMA 3T5LA 4DU4A 2FLNA 4RW4A 4Q43A 4UAYA 4Y1CA 3V6JA 3GFKB 3MEDA 2B4JA 1BIZA 3KK3A 3KKRA 2XCPA 3HX0A 4OLAA 3OY9A 4RQ3A 8ICKA 4I2PA 1TK8A 4BE1A 4LZGA 1MQ2A 4DF8A 3NDKA 2B6AA 1REVA 3V7KA 4J9MA 4ECUA 2ETJA 1HUZA 3OYNA 3SUQA 1WSFA 1WSIA 3HW8A 2C28A 4ED2A 4QZFA 3VQ9A 7ICEA 2J6UA 4CHPA 3DRSA 1HMVA 4CJKA 4FO6A 1RBSA 2ZUCA 4UB3A 3RTVA 4Z4CA 1ZQIA 1Z00B 4NXZA 4UB1A 1S5JA 3PW5A 4ID5A 3GIIA 3ZDEA 1S1XA 8ICXA 5KFJA 9ICJA 2NRXA 3Q8SB 3K59A 1SKWA 5D49A 3MR6A 4EZ6A 4Z4EA 2JLEA 4W5RA 5KFFA 3N4MB 4CJEA 3OYBA 3OYHA 4RPXA 1W0HA 4KLDA 3AO5A 4JUZA 3RRGA 9ICSA 4NM1A 4F4YA 1BCOA 1ZQPA 1C1BA 3QO9A 3EPIA 1BPYA 4RQ8A 3RJIA 4CFBA 2KZ3A 1ZQMA 4K4IA 2PI5A 4B9MA 5C24A 1BIUA 1MU2A 3OYDA 5J2JA 1IXRA 5J2EA 4RUCA 4YXMA 5J0XA 3LDSA 3QETA 4KLLA 3ZSYA 4R8UB 2R8IA 1XC9A 2KZZA 4OPKA 3MXMA 4H8KA 4CE9A 3IHQB 3NGYA 4O9MA 4QAGA 4DO9A 3NBPA 1ZQXA 4F50A 4CHYA 1MSWD 3TWHA 2AQ4A 5J0YA 3O3HA 4QZGA 2AGQA 1VSFA 5I42A 4FBUA 4KLQA 1NK0A 4B9VA 3EPGA 4F93B 4KLSA 2A1RA 1EETA 3NGZA 2GWSA 5KFNA 2HHQA 4OKJA 2PYJA 5KFOA 1TV9A 4IDKA 4R66A 4KB0A 5KFSA 2GBZA 2RDIA 3ISDA 4MFBA 2ZTEA 2X6NA 3BGRA 5HBMA 1B92A 5DB7A 1JLGA 5KG1A 2BPCA 3ULDA 1Z00A 3VA0A 5KFLA 3LDAA 4IFYA 1A5VA 4AHRA 4EBEA 1JX4A 3DLEA 3SQ2A 4GW6A 4M3RA 3QEVA 2HNDA 4NLKA 1YVUA 3OHBA 7ICPA 9ICFA 4Q5VA 3TI0A 2BR0A 1XU4A 4HCCA 5KFHA 1D9DA 1D9FA 4MQ3A 5J2NA 4DTOA 3CM5A 3OYLA 4DSEA 3VQPA 2BPGA 2UVVA 2VWJA 5L1LA 4NYNA 1UWBA 5SWMA 3LWMA 4QWAA 3HPOA 4KMUA 4M04A 2BANA 4UB5A 2IHNA 5HROA 3DLGA 4OLBA 4KPYA 5KFTA 4H4OA 2VG5A 1KDHA 4YQWA 7ICJA 4FJ9A 5DGAA 2XY8A 4XUSA 3MGIA 1JXEA 3RBDA 4M3XA 3LK9A 4BXOB 3S3OA 2C2RA 1S9EA 1O1WA 5KTQA 4M42A 1RTJA 3AVNA 4O55A 3PMNA 5KFQA 4CK1A 1JKHA 1HJRA 4I28A 2P6RA 2W9CB 3ZSOA 1LAVA 3BQ2A 4DTSA 1U48A 1ZJMA 3QEIA 4PHEA 1A5WA 2FBYA 1X9MA 3NF9A 2XRIA 1XSNA 3AVGA 1JLCA 4KTWA 5J0TA 4N5SA 3V81A 4RNOA 1K1QA 5IIKA 4YR0A 5J29A 1RPLA 3CM6A 2ZQBA 4RZRA 2XO7A 4B08A 4M3UA 3ZSVA 5J0SA 3PX0A 2HNYA 2M9NA 3NH2A 3OVNA 4DG1A 4PY5A 1VSIA 5CP2A 2Z1HA 1ZQYA 2B21A 2XHBA 4MEXA 3ORYA 4E19A 5BOMA 1L3UA 2KW4A 3NF6A 3UQ0A 1WSJA 3ZD8A 3TABA 1RNHA 4NLGA 4OPJA 2Z1IA 4E7IA 4FJ8A 1F21A 2D0BA 1IKVA 4EEYA 4ZTJA 4B9SA 4F8RA 1D8LA 2ZJ5A 1CZ9A 1ZJNA 3ALYA 2F1JA 4YMNA 5DG9A 9ICQA 3RH4A 2QKKA 1HYZA 2YKNA 2BGWA 5DBBA 4FJJA 5EWEA 3TARA 3GIKA 5J2AA 3KHLA 1PZNA 3LP0A 4TSXA 4ZTFA 4KHYA 5DDMA 2Z1JA 5KG5A 1TKDA 5T7BA 4FJ5A 1HYSA 7ICLA 3KLFA 4Q44A 2FBVA 1NKBA 1GOAA 5HRRA 2I1QA 5J0OA 3AU2A 1WN7A 1S77D 2ZUDA 1RBUA 3RR7A 5KT5A 3WNEA 3DLBA 2JEFA 4JRPA 5FRNA 4DSIA 4DFMA 4AHCA 7ICNA 3G0ZA 4RQ2A 4HTUA 4UAWA 2VA3A 3NGDA 3O3GA 1TFRA 1NK4A 4M9LA 3H8JA 1C0UA 3MEGA 3V72A 3KLHA 2BCVA 3OS1A 1T7PA 3VQQA 3QEBZ 3NGIA 8ICRA 4DS5A 3K5OA 4M3YA 3SJJA 4TUPA 4PQUA 1G15A 4E1NA 4DL3A 3GQCA 4CIGA 1IO2A 3DLRA 1RDBA 2NRWA 4BDYA 2FBTA 3RMDA 1QTMA 1FK9A 4UAZA 3HSTB 3PX6A 4QZCA 2UVUA 3BQTA 5L1KA 3M8QA 4CGFA 1NOZA 3Q8MA 1HYVA 3LPTA 5EU7A 3RH5A 5DGBA 4IQTA 4BGDA 4TUQA 4QWEA 3OYCA 3EWAA 1ZQQA 2HHUA 1RTDA 1ZQJA 3RB4A 3WNHA 5KFPA 4E0DA 4NCAA 4J9KA 1K1SA 4AH9A 4RQ5A 4CF9A 4R63A 4XRHA 4I2GA 4JV0A 2X78A 4KHWA 1ZQGA 3C5GA 3NCIA 4NCBA 4RQ7A 4GMJB 3KJVA 3GDXA 4E89A 4KITB 4K4HA 1CZBA 4PHPA 4HYKA 3A2FA 2ZTCA 5DG7A 3LAMA 3MR2A 5JS1A 4ECSA 3HVRA 3QEWA 3V4IA 4DQRA 2IGIA 2DFLA 1SKSA 2PFPA 2OWOA 1ZBFA 2FMQA 4CIEA 3QE9Y 5L9XA 1KVAA 4I2IA 3AVHA 2JGUA 5SZTA 3QZ8A 5KG2A 2XGPA 2HMIA 4IFVA 4E7LA 2V9WA 4O4GA 1RT4A 1B22A 3U3GA 3T19A 5KFKA 2PFNA 1S97A 9ICXA 2P6UA 1WSEA 5KFIA 4ECTA 4DTJA 4RPZA 5KFEA 8ICYA 4CERA 1QSSA 3ASMA 2VA8A 2XC9A 2DPJA 4WE1A 4PGQA 3OJSA 2AU0A 2P5OA 2BCRA 2X74A 4CESA 4Z6DA 2R8HA 4GC6A 3WNFA 2IMWP 4UB2A 3UIQA 2PYLA 1KFTA 4O3RA 1C1CA 2ZTDA 1K6YA 4R5PA 1WLJA 2A1SA 2O4IA 4BDZA 4KHUA 5HP4A 4DFKA 3SUPA 2BQUA 1BI4A 5EOZA 1R0AA 2IAJA 1C6VA 2ISOA 4CGIA 2DFEA 1C0MA 1CXQA 1U9LA 4F3OA 4CJLA 4IQVA 4E7JA 3SI6A 2F96A 3RWUA 1CXUA 4FW2A 5IIOA 1D5AA 4J2AA 1HUOA 3JPNA 1U4BA 4FJGA 4EBDA 1U45A 4CFCA 9ICCA 4M6WB 4I2CA 1N56A 4GXIA 4K8XA 1NKEA 4CK3A 2ASDA 9ICUA 3P5JA 3KD1E 2QKBA 2BCUA 4HVJA 1DTQA 3DOKA 4P2HA 2VWKA 3TAMA 4W5QA 3RRHA 5DLFA 4ICLA 4O5CA 4AHVA 4DU1A 4KN4A 3TAQA 3MXJA 4BACA 4JK1A 5C42A 2PFOA 2IHMA 1NJWA 3WNGA 3MFIA 1I3AA 3OSNA 4J9NA 1VSLA 2B5JA 4Y1DA 1QSYA 4W5TA 1J53A 4ED1A 3UXPA 4KREA 1VRUA 3QNNA 2XY5A 4JV2A 3OYGA 3S3NA 3GIJA 5J2KA 3G6VA 3O4QA 4DSFA 3LZIA 2HW3A 3B6PA 5IIJA 1XHZA 3DOLA 4TQRA 2D5RA 1X9WA 2FC0A 4B8CA 4O3NA 3AVFA 2UVWA 4KTQA 3NF8A 2V4RA 4B9TA 2J6TA 4B9NA 5J0RA 2KN7A 4ECWA 4YFUA 3JPQA 1KFSA 5KFAA 1ZQUA 3EY1A 1J9AA 1ZQBA 1BISA 3RR8A 4JV1A 2G8UA 9ICOA 4KO0A 4DLGA 3HP6A 1RT7A 1Y97A 1JXLA 4KLMA 5KFUA 3UXNA 1KFDA 3LP2A 4AHTA 4HHTA 1DLOA 5FROA 4J9SA 3PMLA 3BJYA 3LWLA 3VQEA 5EWFA 4IQWA 2G8KA 4DQQA 3C1ZA 1LV5A 5J2IA 4B8AB 1S0MA 3NFAA 4DWIA 1ZETA 4XQ8A 1L5UA 3FFIA 3QLHA 5K14A 2BE2A 3VQBA 3H8SA 2MUTB 3TFRA 4Z4FA 1TAUA 3AO1A 2HHTA 2ZJAA 2HHWA 3HPHA 2C2EA 4FS2A 5L1IA 8ICJA 3K5MA 2UVRA 2OPRA 2HB5A 3RJJA 4YG2A 4ED7A 5IINA 1A5XA 3H08A 1UA1A 4CHZA 4JS4A 1T05A 3KK2A 3PO5A 3SQ4A 4FLXA 3HO1A 1N6QA 4CEAA 4LZDA 4N76A 3QZ7A 4Q8EA 1RDCA 3VQDA 3B6OA 1RILA 1YTAA 4I2JA 1XWLA 5BOLA 3H8WA 3RJKA 4NYFA 5KFGA 8ICWA 3QERA 4RT3A 1AROP 2RF2A 4CJFA 3ZCMA 3TAEA 4I2DA 4GVMA 3M9NB 3E2EA 2Q3SA 8ICLA 1JLAA 1RDAA 2DTUA 3I0RA 5KFYA 5KFVA 2AJQA 3AA4A 3BQ1A 3VQ7A 1N5YA 4DTXA 3H40A 2W9MA 2AGPA 3OYMA 4I9QA 4CGJA 3S9HA 4F2RA 5CHGA 5KG3A 3UXOA 4JWMA 2A1JB 4M9JA 2JEJA 4YFKA 5KFWA 3M8SA 1VSJA 2DFFA 4JWNA 1RT6A 4YCXA 3RB3A 3E01A 1S0OA 2F1HA 4DTRA 4FM0A 4RG8A 2J6SA 1CUKA 1QE1A 4QZAA 9ICLA 4R8UA 3SCXA 1ASWA 4RW6A 3PV8A 3LPUA 4CF0A 2W9BB 3AV9A 3CFPA 1B43A 1ASVA 4FLVA 8ICTA 1COOA 2YKMA 4JRQA 1FXXA 2W8LA 4KLJA 3ZT4A 1U49A 1IM4A 2GUIA 2BDPA 4O0IA 5HLFA 2P51A 1VSDA 2VG7A 1L3TA 2C2DA 3MGHA 4FXDA 4RNNA 3C2MA 4FS1A 3V6DA 3TQ1A 1LWCA 1TAQA 5J2DA 4ZH4A 2R8KA 4LH5A 1TKTA 1UA0A 1KVBA 4NLZA 4CF2A 4TURA 4P4OA 4BWJA 3VN5A 1TV6A 3SUOA 5DLGA 3JPPA 4KHNA 5J2MA 4ECXA 3AVIA 4Z4HA 3FYHA 1YTUA 2FPMA 3HJFA 4Z4IA 4QZDA 3PUFA 9ICGA 5KFDA 4DF4A 4ECZA 1SZPA 1NJZA 2XCAA 2NRTA 5J2QA 1GOCA 2ZE2A 3C23A 5KG6A 1EKEA 4DTPA 3LANA 3HYFA 2BHNA 7ICOA 1JLEA 2YV0X 3PR4A 3C6UA 3C2KA 8ICFA 2QXFA 3Q8RB 1GOBA 3SQ0A 3KD5E 4FJ7A 1RTIA 4CF1A 4ED3A 4FJNA 4J9RA 3DLKA 4W5NA 1WSGA 1ZQSA 3C2LA 4RW9A 2RN2A 4RU9A 4P4MA 1UAXA 5J2CA 4CEEA 4F4ZA 2FPLA 1BPEA 1MC8A 3FDSA 4IRDA 5IIMA 3L2RA 1IKYA 3L3UA 5DB8A 5DBAA 4LVSA 4CJ4A 1ZQAA 2YNFA 1NK7A 2G8IA 3H4BA 4M9HA 2YNIA 3ZT2A 3SNNA 4AILC 3SZ2A 2RKIA 1L3SA 2E6MA 4UBCA 2BPFA 2Y1IA 2FPKA 8ICEA 7ICRA 4BXOA 3PNCA 4CEQA 4F5NA 4I2FA 4CJ3A 4DLEA 1NK6A 1NK9A 4JS5A 4Q8FA 4CIFA 1DOQA 3KK1A 3JPOA 4MFFA 1SUQA 2W9CA 1CEZA 3DRPA 4YXJA 1WAFA 8ICIA 1XS9D 4C8KA 3L8BA 3QNOA 3RJHA 7ICKA 3HWTA 1ZQOA 3ISBA 8ICZA 4KV8A 3EYZA 3TR8A 3MR3A 2R8GA 3ZSRA 4M3WA 3LP1A 4DOCA 1C1AA 3G6XA 4CGHA 3IS9A 4DU3A 3V1RA 5BPCA 4EP5A 4Z6EA 3GIMA 4KLTA 5KFZA 3V9UA 4O3QA 2P5GA 4YMOA 1SL0A 2BCSA 1Z26A 4CJSA 1SL2A 5TZVA 1A76A 5CJ7A 9ICMA 3C6TA 4F3TA 1BHLA 3QINA 3F9KA 2KFNA 1DGSA 9ICHA 1LW2A 4CK2A 2G8HA 3PW4A 3KLGA 4Q0BA 3KTQA 4EYIB 4CJWA 1EXQA 4CECA 4O5BA 4I2QA 2Z1GA 5I3UA 5DBCA 3RJGA 4FK0A 4I27A 1NOYA 5D4BA 3LP3A 2R8JA 3IRXA 4GC7A 4KHSA 3V9SA 4RNMA 4PGXA 3BDPA 2NRZA 4QOZB 1KLNA 2HNZA 1LW0A 3V9ZA 2HHVA 3CFRA 1U47A 2P1JA 2YHAA 3OSPA 1JL2A 1VK0A 2QK9A 1T4GA 4HUGA 3JYTA 7ICUA 4RW8A 4I2HA 2G8FA 5KT6A 3NE6A 3T3FA 2JZBB 3V1OA 3ZT1A 1NJYA 4FZXC 9ICBA 1N48A 1IG9A 5KRSA 4X5VA 3PY8A 4QZHA 3G6YA 4HCBA 4EBCA 3D45A 4DOAA 2HVHA 1FKOA 1S0NA 2FLLA 4FM1A 4PA1A 2JEGA 4I2EA 2ZJ8A 5J2BA 3HT3A 4IG3A 4PWDA 3M8RA 3C5FA 3SPZA 1HNVA 2ISPA 7ICMA 3N97B 4CJ5A 1VSHA 3AVBA 1XHXA 3JSMA 1Z3EB 2KFZA 1BPXA 4RQ4A 2DPIA 3V9WA 5KGWA 4QZBA 4HUEA 4E1MA 3QEAZ 4N47A 4KLOA 5CZ2A 4CEZA 1LB2B 3RAXA 1BGXT 4BDPA 5IIIA 4CHQA 2R7YA 3PW0A 4YMMA 3RB6A 3ZDBA 1VSMA 1L3VA 9ICTA 5KG7A 3VQCA 4DQIA 1WSHA 4FVMA 5HMLA 4F91B 3L2VA 4M47A 4J2EA 3ETLA 4DFPA 4IQUA 3RJEA 5KFCA 3ITHA 3BQ0A 4KN7A 1IH7A 4IG0A 3ZSWA 4OKKA 4YR3A 2HHXA 3M9MB 1ITGA 3NAEA 1WCNA 2WOMA 3PO4A 3LAKA 4M9GA 4J9QA 2IC3A 2G8WA 3C94A 3PX4A 4MF2A 1RBRA 3U3YA 4FLTA 2PZSA 4IRKA 1ZQTA 4F5QA 1TVAA 3CG7A 1QS4A 3GV8B 1TK0A 4FW1A 8ICQA 1KEJA 4QZ8A 4NY8A 5F9LA 4BE2A 7ICHA 3K4GA 4CF8A 2OYQA 3V7LA 5DQGA 3PR5B 1LWFA 4QCLA 1ZQKA 3MXIA 2EX3A 4TUSA 3EZ5A 4ECVA 4CEOA 4OGEA 3DYAA 3NTUA 3OYIA 9ICWA 4F5OA 3MAQA 3ZSZA 4I7FA 3SPYA 1ZQDA 3AU6A 3V6HA 3L2UA 4Q45A 4KFBA 3O3FA 1S9GA 3MBYA 3F73A 4KLHA 3TFSA 4CCHA 4O3PA 3H7IA 3MFHA 3B0YA 1QHTA 4CJRA 1EP4A 1JXBA 5DB9A 4DEZA 1J5OA 1IKWA 3TAGA 3T1AA 1WCLA 4RW7A 4XA5A 1TL3A 4YR2A 1NOMA 2WONA 1X1PA 3Q8PB 4AHSA 3IAYA 1QSLA 3LALA 2F8TA 3KKSA 4LH4A 5HHIA 5KT2A 1HNIA 2WTFA 3M9OB 3SUNA 1Q9XA 1KVCA 5HRSA 4ELTA 1QQCA 4CJVA 4M3ZA 1T03A 5CWRA 5JUMA 4QW8A 4N56A 1LWEA 3MR5A 1WAJA 2BQRA 1TKZA 1RT5A 1TVRA 5C25A 1ZQWA 3OS0A 4MFAA 4I29A 3AVJA 5KFRA 4ED8A 9ICKA 1SV5A 4CFAA 4EZ9A 2NRVA 2LYHA 3V7JA 1BVSA 4J2DA 4HUFA 4F4XA 1TGOA 4FBTA 1JN3A 4DTUA 3P1GA 1D8YA 1BQMA 4CFDA 4AHUA 4M6WA 5CYMA 3K58A 2HVIA 1ZYQA 4DL7A
chains in the Genus database with same CATH superfamily
4KE5A 6FD1A 1X5OA 1QQNA 2G09A 1BPBA 5KG4A 3FVYA 4Z6FA 5J0PA 3OYEA 5L1JA 4O3OA 3AVMA 3WIVA 1UETA 1SV4A 4H4KC 4UTGA 3NVVA 4J9LA 5D4LA 2LA6A 1T3NA 4EEKA 5KI6A 2HPUA 1CBKA 1NBEB 4H0YB 3FK4A 2VG6A 1BQNA 4HL9A 1T9TA 5G4DA 3NH0A 2EBEA 4QYZK 4FJLA 4IH6A 3J7Z5 3Q8KA 5AQIA 3B0XA 3DRXA 2D74B 3CJ3A 3RMCA 4KH0B 4PRFA 3Q23A 2D41A 4JI5J 2QSWA 2FMPA 2Q0ZX 4CZLA 5A0YA 5HVHA 2HNYB 4OKEA 3E1YA 4F5PA 2OPPA 3LZJA 2GOLA 2ZNYA 3ZC4A 3CQXA 1RP5A 2K7KA 4X4RA 5B0FA 3RBEA 3HI9A 3R3LA 2DGWA 2XY6A 4DUZF 4NLQA 1RHJB 5LMUK 3W3SA 5F3XB 4YN3B 3NMRA 4PKHA 1DJ0A 3FBBA 2ZGZA 5DKWA 4KLFA 2AQ0A 2WVFA 5CRXA 5G0RA 2FF3B 1V3ZA 4URSA 2DKZA 1I5OB 2H1YA 3PW7A 2G8VA 3BKTA 1KSPA 3RFAA 1FEHA 2JOQA 2MQNA 1GLAG 4B3RK 4DQPA 1DQ9A 4KHMA 4CZKA 4KTZA 2VOPA 4JI1F 4P72A 3Q8LA 3VQAA 2DKXA 4H0VB 4JD2A 3KLFB 3NVMA 4Y34A 3MECA 1N33F 4G9BA 2OANA 4ZDNA 2F4FA 4OYIA 4O4RA 5T7LB 2ROPA 3CJQA 4MF8A 1CJTA 4DPXA 4CH7A 3CGIA 4FJHA 1VAZA 2R7QA 5AM4A 1VYAA 2H65B 3TJAA 2E5GA 5E41A 4MKBA 1OMSA 2ZD1B 4YVZA 2FZKB 4ICAA 4F5RA 1BPZA 3QGGA 4RQ6A 2OIHA 3KKFA 3WT0A 1AB8A 4I67A 2RRBA 1V4TA 4OPAA 3DLJA 2UP1A 1KTQA 1HWLA 1VQKN 3FZBA 4X64K 1Q9YA 1TL1B 4EFAC 4QZEA 2LM1A 2A2CA 3AA5X 1FF2A 1RWVB 2AGOA 2QO3A 8ICHA 2ALZA 3KFUF 3ENWA 4BWMA 1YK9A 3M8QB 2CPHA 4JLHA 1M5SA 3OL8A 1S79A 1S3XA 7ICGA 3FBEA 3VEOA 1WHVA 1RISA 3L0QA 2LQ9A 1IR2A 1H7XA 3IG1A 2A1JA 3BBBA 3K2PA 2FIUA 2OPSA 2Z58B 4M9NA 4TU8A 3HPGA 1A0OB 4KI6A 3C16A 3IBFB 1WUUA 4FLYA 5A8WA 3UNGC 3TSQA 4L76A 5KG0A 2HSEB 4A59A 1F1BB 2BQ3A 1RADB 1XSLA 2QA2A 2HLTA 8ICCA 4DJBA 5GAEU 3PVXA 9ICNA 1MMNA 1D1UA 2CQ4A 4P2XA 1N0VC 4DV6F 4M5KA 4QZ9A 4MLEA 4WBFA 1VHFA 2M88A 3MM8B 1JI7A 3TQEA 5KAKA 3D6HB 5D6GA 1HJPA 2C22A 3DMJA 4N41A 2P66A 1SI9A 2BDUA 3C2PA 4JI2J 4ZVRB 4Y2PA 2W6KA 4L74A 4CZEA 2CNNB 8ICSA 2Q79A 4M1KA 4O44A 2LXUA 2BJEA 3L3FX 3TAFA 2FGOA 1RT4B 5F0UA 2VJUA 3CCSN 5KFBA 2OA8A 2IM0A 2ZIWA 4MFCA 3DHWC 4ES1A 4X4UA 4QZIA 3U7JA 2F4VK 3MDCA 1ZS6A 3CQ8A 4GMKA 4F0HA 4HAIA 4TXSA 3T1YJ 2Z2MA 3Q8UA 4PHTX 1NXIA 4YP3A 1TR0A 2MY8A 3KIOA 3D68A 1VQMS 1T9UA 3CXCR 2VJVA 5DB6A 3VCBA 5K5MA 4FNIA 4GXKA 1GXUA 4AYBC 2VFVA 1PO6A 1JALA 1SBRA 2C2KB 2XY7A 1RTHA 4KX5A 1S1UB 3RB0A 2HFNA 1HLUA 1NG9A 2KH9A 1TK5A 1YRXA 1R8CA 4CJQA 2XHCA 3A8IA 2ZWPA 1X9SA 1R8HA 3G10A 1GMVA 3FC4A 1VSKA 1D8BA 3M6WA 4FZMA 1XR7A 3ENAA 4Z7YA 4NXMK 2QLBB 1HNXJ 2CXYA 4DR5F 2BGGA 1BCMA 2V34A 4FF3A 4IR9A 1MROA 4EMDA 2D0CA 3EUNA 1TL4A 2VIHA 3R8YA 3ZDAA 1Q82O 2GCFA 1U1MA 1CLFA 1X0FA 2HGMA 2MLXA 1M1KO 2JEIA 1NZBA 3NS6A 1DTQB 4OX9F 3W1YC 3DXSX 1E3MA 2FMSA 4KI4A 1BY9A 3SV3A 2IRXA 1HNZK 1RWOB 4C0OC 5C42B 5CZ1A 4YB1P 1OY8A 3HM9A 4FJMA 3UVJB 2ASJA 4NLNA 4JAXA 3QT6A 2W9AA 2Y1JA 1VHIA 1FWLA 5CQGA 9ICEA 2YY3A 4DL4A 4GKKF 5DM7L 4QW9A 3D6FB 3IWLA 4X4TA 4PGYA 2JL9A 2B56A 3OYAA 3R1LA 3QEPA 4PKDB 1JLQA 1I3OB 1X4GA 2PXIA 4DU7A 3M30B 1BXNA 1RT3A 5GMKa 2YQ1A 5IILA 3SQOP 2A2DA 1J54A 3X1LB 3JPTA 3FC9A 2RPIA 4IEEA 4NA2A 2KIWA 1K8AO 2I5JA 1T3QA 2YNGA 3JS9A 2Z8QA 2WVCA 4W5OA 2BUNA 2HAIA 4CJPA 3QT5A 4UZBA 1RBOB 4O0JA 1U6ZA 3V9XA 5C24B 4USMA 1ZTWA 4C11A 4GVEA 1MN8A 1EHWA 1EX8A 2LQ5A 4PHDA 1OQ3A 4URQU 2ZH6A 3N9UC 3Q7CA 4FLWA 5HNKA 4O0NA 4Z37A 2O8BB 2C2NA 5J2PA 4OHVA 2ZJQL 3OTOF 3FFIB 1NLKL 2BJDA 2BE2B 4QS8A 4QZVB 4DU4A 1XEZA 3SDEA 3JTNA 4NYPA 4NOHA 3PJXA 2CPZA 1H1VA 1Q7YO 2F76X 2MSSA 2VHGA 2OPRB 2K8CB 3HX0A 4Y2XA 1EETB 3OY9A 4P2SA 1IQZA 4CO0A 4DF8A 3DOMB 2JR5A 3AGKA 5D78A 3CB4A 3OYNA 3SUQA 5AR0A 3CC7N 3QU5A 1N6QB 1VDVA 2BRLA 3T41A 4WJ3B 2WHEA 2M70A 4MTPA 3VQ9A 3BGRB 4DDFA 3K5PA 2CAJA 5GAHU 2ZUCA 1ZA2B 1EWQA 1ZQIA 1UTAA 4UB1A 3MOJB 3PW5A 1S5JA 1CI4A 1T6CA 1S1XA 5ALSA 2AW0A 2RHFA 2E1YA 1VK3A 3W5ZA 9ICJA 3Q8SB 4B3MJ 1Q53A 4WTYA 3PXGa 2JLEA 4LIRA 4OZ5A 1S4EA 5I3QA 2HG4A 2VIXA 2KHOA 2QMXA 2E20A 4YEAA 1JNZB 4NM1A 1N5YB 3IMXA 2P35A 3TU5A 3G4SN 2GX9A 1X9JA 2W2MP 5ALQA 3ZZTA 3CCMS 1HNWJ 2YWKA 2PI5A 4B9MA 1V38A 3TUIC 3W2WB 2GQ2A 2FJ6A 2OAUA 3M1VB 3R5GA 5HROB 3DDKA 3FZMA 5J2JA 2KD1A 4ZPWR 3GFYA 3A3OB 2D6FC 4A57A 2YKQA 4KLLA 4G1IA 2R8IA 2PA3A 2J8AA 2VG5B 2VDHA 4C48A 4OYMA 3OW2R 4DO9A 5A2QU 2GELA 2KKZA 2ZH8A 1L7NA 2XNQA 2YCHA 1R0BG 4HLBA 4C8YA 1QVGM 3R6MA 1MSWD 3TWHA 2AA4A 1DBDA 3O3HA 1CS4A 3ENBA 1ROFA 1UJ5A 3C6AA 4RNHA 3OVAA 1VSFA 3IRUA 3E58A 4FBUA 3V6DB 1OVYA 2W4CA 3EPGA 1FVSA 3W2VB 3JQJA 3ZX0A 3M2RB 2YMPA 4LC9B 2POKA 2GWSA 3CMES 2KHCA 5KFNA 3E8OA 3R1HA 4JI0K 1XNRJ 4KB0A 2DNNA 2DCUB 2GBZA 4PL1A 3JXUA 3S41A 2X6NA 2V8DA 1Z1ZA 4ZVPB 1B92A 2X51A 5DB7A 4JKAA 4V1Ak 1D9AA 5ALTA 2QWOA 3LDAA 1RGIA 3QGIA 3W9HA 5CXTA 1WKLA 1WSRA 4F0MA 1BA0A 3OHBA 4RU2A 7ICPA 4DR4F 2CGJA 1OW5A 3DLKB 1F5SA 3TI0A 2BR0A 2ERRA 4HCCA 2LFVA 5J2NA 3O44A 4DSEA 2GMJA 3VQPA 4DV7K 5HQ8A 5L1LA 4NYNA 1P7DA 1U0HA 2FXUA 3U4LA 2ZHAA 4C7ZA 5SWMA 2QEXN 2HBLA 2OSQA 1RGVA 3HPOA 4K4YA 4UB5A 3CCRS 1WEXA 1NO8A 2YNFB 1ZRMA 2HS4A 3QXGA 3NP5A 2Y0SD 5KFTA 2CDQA 2XICA 3BN4A 1IUJA 2RKIB 2GNKA 2MKYA 2XY8A 2WTUA 2DHSA 2DHAA 4XUSA 1HHTP 4UOFA 2F40A 4LR7A 4KH6A 3S3OA 4QR2A 4A61A 3BYPA 1VBXA 2YN4A 3SSRA 4ZVQB 1YLXA 1I94F 3AVNA 2JRZA 3P39A 5KFQA 3ZSOA 4JI3F 4UT4A 3DRPB 1ZJMA 2WSEC 1F44A 2YX7A 2I9SA 2XSFA 1H6KX 4BG8A 1W2BM 3UR3C 3DN9A 4BQZA 3AVGA 1H72C 3DNCA 4RNOA 2Y0SC 5GAEI 5AQVA 1S6UA 1TTHB 2R7UA 2QWPA 3CM6A 4EGLA 4RZRA 3NGSA 1Q8BA 2KYZA 4M3UA 3ZSVA 4M5LA 5J0SA 3P5TL 4GVBA 2HNYA 2Q36A 3N0VA 1RAIB 4USWA 4DPWA 5BOMA 3TX8A 2KW4A 3NF6A 3KLGB 2C3UA 3UQ0A 3C19A 3ZTQA 1RBAA 4I2QB 3DGVA 1UFLA 3N7SC 4YHHJ 1XMBA 2FHJA 5HR7A 3DGPB 4B9SA 3C46A 4CTAA 5FLXO 2WF7A 3ALYA 4ITSA 1W2IA 3CD7A 3IRXB 2F1JA 4YMNA 3KYLA 1Z19A 3OTBA 3RH4A 3OBIA 2YKNA 4JI1K 5DBBA 1WDTA 4I69A 2UU9J 3M7VA 4M95A 4ZVUB 1N33K 1YJ9S 1MG7A 1OO0B 3KLFA 2FBVA 5HRRA 2G0CA 3KD3A 1G99A 2UUBF 2Q3PA 1YJNS 5T7LA 2C42A 1V97A 5AQGA 1FKOB 1R8BA 1FTCA 4MIWA 3M6XA 2WF6A 4OX8A 1Y00A 3EDQB 2VA3A 3AD7C 4IFVB 3A5NC 4M9LA 3QJLA 3MEGA 3N01A 3KLHA 1L8LA 3OS1A 1FW6A 2KHQA 1S48A 2E1AA 2KHVA 2YH0A 3EM1A 3SJJA 1ZA1B 4C4RA 2YWFA 4TUPA 2FE9A 2LI6A 2D69A 5AQMA 1IO2A 3EZUA 4Y3CA 4BDYA 2EXUA 4NL9A 4OD0A 1FRJA 3TVKA 2QKQA 2Y3YA 3F5EA 1YITN 5L1KA 3M8QA 3PHEA 4R5PB 2Q43A 1K8KB 5HK4A 5EU7A 1ZD3A 4BGDA 2AV5A 4A8KA 1V3SA 3QGHA 1RWXB 3KDOA 2PMHA 5BPNA 1RTDA 4JI8F 3I5CA 3KOAA 3WNHA 4UAUA 1OY6A 4NCAA 2N4DA 2MZRA 3I56N 2OM6A 4PL7A 2JVOA 5AKHA 4CF9A 4DV6K 3GE1A 1IBLF 1HARA 3R3TA 4CDGA 2OHFA 1ZQGA 4U7UK 4USAA 4RQ7A 3EZOA 5I3PA 5BJRA 4QS9A 5GTHU 5ETVA 4E89A 1VOMA 4HYKA 3A2FA 4EENA 5EGYA 4LFBJ 3MM8A 3P8BB 2DISA 4DQRA 4KIAA 4HT5A 2PFPA 4MDBA 1GTEA 5KL1B 4Y0FA 4FKXA 4DXLA 5BYSA 2VFSA 1QQ5A 3FUYA 1WELA 2JDJA 3AA8A 3MUTP 5SZTA 2VWBA 1O13A 4DUYJ 3BN7A 1HKBA 5CHCB 1YKWA 2I2YA 2DCLA 2HIQA 2NXCA 4O4GA 2GUPA 1RT4A 1IJEB 3NL0A 2PFNA 3Q89A 1KHVA 3OPKA 2BYCA 3MN7A 4DR2F 4ECTA 3KUHA 2NXNA 5KFEA 3BH7B 8ICYA 4CERA 3ASMA 2VA8A 1VBZA 2BABA 2XMTA 2P5OA 4NLUA 4BC4A 5IM0A 4WF9Q 2X74A 1J6ZA 4CESA 4Z6DA 2FDRA 2R8HA 2GAHC 5HMWA 1JQGA 3M6GA 1N36J 1LQ9A 1URRA 4FOEA 4FYXB 1NJIT 3KLVA 1KOOA 4C3MA 2ZTDA 2O66A 1K6YA 3NWGA 2O4IA 4BDZA 1LWEB 3UM9A 2IHR1 2WAQC 3CCZA 1IXKA 1C6VA 2W7PA 4CGIA 4WP3A 4WXWA 2G0JA 3VEXA 4DR5K 2BKPA 3R9PA 4L72B 3LP2B 1LOTB 4KHPK 1HQ2A 2NZTA 3MCPA 3O1BA 3AQEA 2VQEK 4BRHA 1DGKN 4CLSA 3F5AA 1KHWA 3C0BA 2V2VA 1D8ZA 2B9EA 3KZXA 5BPLA 1J2VA 4A2BA 5JLHA 2D0PA 4JKFA 3CO9A 4LR9A 1Y4ZB 3FEZA 3CC4N 1WACA 5GAHI 3NAIA 2P9GA 3D2FB 2FJWA 3K8WA 4OI4A 4KYZA 2HOEA 4BR0A 4DV2F 3HKWA 1FERA 1DTQA 4P2HA 3AOBA 2QJ3A 5DLFA 5E84A 4O5CA 4LSZB 3M1FA 3TAQA 1S6QB 4BACA 4WIIA 5D77A 5C42A 2PFOA 3K1RB 4GKKK 3VGUA 3UVJA 1IG6A 4Y1DA 2ROGA 2MZSA 2KEYA 4ED1A 1T05B 2ZEJA 3UXPA 4KREA 3QNNA 2XY5A 3D0GE 2QFJA 4JK7A 4DX5A 3GIJA 1YJ7A 5L9NA 4CO4A 3PG9A 3ONNA 3W65A 3O4QA 2ZOFA 4DSFA 3LZIA 1NPKA 4BRLA 3SCKE 3J7AP 3ED5A 3JS6A 2ACYA 2KT5A 2H3QA 3M30A 2ZIXB 3KWMA 2W03A 4ZJOA 1ULRA 2ZFHA 2D5RA 4Y2CA 2UVWA 3NF8A 1RAFB 1NNEA 4NO7A 2B6GA 1UL3A 4OX9J 2KN7A 4ECWA 1KFSA 3J7A1 1ZQUA 3MC1A 3IBPA 1J9AA 5ETPA 4JI5K 4DPTA 1Z1BA 2AX0A 8AT1B 2G8UA 3MM6B 4NZ7A 9ICOA 2ZVIA 3MAHA 2ODGA 4HKQA 3O2IA 3IN5A 2O5DA 3E01B 2C3OA 4AHTA 4ETXA 3PMLA 4CLPA 2R2RA 5CD4A 1QQ6A 5M1NA 4RW6B 1VRTB 1XK8A 4B8AB 3NFAA 4E1JA 3ILJA 2FHJD 2L9NA 4DV0J 1ZETA 2CQIA 2O8BA 2FJXA 2GO9A 3O80A 3FFIA 4B9QA 5EE0A 2BE2A 2V94A 2MUTB 4OHWA 4EHTA 3TFRA 5HLFB 2FHMA 2N4CA 2HURA 3VF2A 2KJVA 3HPHA 2MQPA 3OVSA 5AQQA 3RBXA 1LWCB 2UVRA 2OPRA 3AH6A 1T3VA 4WFNL 3RJJA 1UW9A 4YG2A 1I51B 1X4DA 3O8MA 3CULA 2DKOB 1UA1A 3O1LA 1HWKA 4FLXA 4NEYA 1VS3A 1N6QA 3VESA 1JLBB 2CXEA 3VAKA 1Q7YT 5AM1A 2RE1A 4QIWF 2VU5A 3B54A 3SMZA 1EQYA 1RAGB 4ZHRB 4HI2A 3H8WA 4NYFA 5KFGA 1T9XA 4JNEA 1WUAA 4C97A 4I2DA 1RTIB 1ZD5A 2QLWA 1NPRA 4NCGB 4JOUA 5RUBA 5B0CA 2MKHA 1JLAA 3DEEA 3N6MA 5KFVA 1N5YA 3OLAA 3H40A 3D6MB 5DDPC 3WDOA 4CGJA 1Z05A 2PMZD 4DV3J 5IZHA 1J2MA 2JEJA 4IDHA 4BROA 4Y2MA 4USTA 4YFKA 2OUGA 1IKYB 3H59A 1RI7A 5JVGQ 1T9VA 2ZJPQ 1GEHA 4IKAA 1NBWA 3GJSB 1N5TA 2V2ZA 1TU0B 3H45C 3H0RB 2KOBA 3O9TA 2G13A 3GOIA 4LF5F 5AIAA 5KAIU 2PD1A 5CH7B 1YX2A 3NNHA 4FOIA 4NB4A 3HDSA 1ASVA 2EEYA 5E2QA 4NZ0A 1COOA 1QAYA 4KKOB 1X5PA 2RE2A 4WFAQ 1U49A 3B82A 3CW2C 2XZTB 3HOTA 2BDPA 2F9WA 2N82B 3RUBL 1PVPA 4NL9C 2P51A 3GDQA 4A8WA 1KAZA 4C0BA 2PMZC 4FXDA 3V6DA 4FS1A 2RD5C 1HBMA 5AXMA 5J2DA 2H9ZA 3W2VA 3M32B 3ET6A 3Q2TC 1SC6A 2B4VA 1TAMA 1KVBA 1DARA 3IRWP 4C7YA 3VGTA 1ZM2A 5DETA 1VFJA 4LF8F 1M1GA 3BF4A 1C0TB 3CCES 1TV6A 2CA9A 3JPPA 2MYFA 4ECXA 3AVIA 3N7RC 3HJFA 1YTUA 2P9UB 1IN0A 1RHUB 4MDAA 9ICGA 3C23A 3CJSA 4DTPA 3LANA 1ATRA 4PJ0U 2WW8A 4IOCQ 4DR4K 3NCPA 4HACB 3C2KA 8ICFA 1QVFR 2CJXB 3P4UB 3Q8RB 3SQ0A 3DC2A 4CF1A 1S1VB 4NRTA 3PIPQ 3IBWA 4FJNA 1HWUA 3DLKA 5DS7A 1NGEA 3C2LA 3P31A 3N6LA 3ZTRA 2QB1A 4B3SJ 3I5BA 1MDUB 5J2CA 2MQ8A 2HF3A 2FPLA 4JV5F 2RS2A 1TMMA 3I32A 5IIMA 4J03A 3Q24A 1RB0A 4BRFA 3KMQA 3PJWA 4PXCA 7FD1A 2YNFA 3SCLE 4DR6F 4U67Q 2DR6A 2BJ3A 3H4BA 3DU6A 3I31A 4RW8B 2CPJA 4M9HA 3AHPA 1T6DA 5B0BA 2RKIA 4A8FA 2E6MA 2LHTA 4FP9A 5BRDA 1H74A 2QLTA 2FPKA 2CQDA 2JC0A 2DEIA 4JI3K 1A6LA 2LA4A 5CABA 5ALWA 4DLEA 4WTOB 3H1VX 1HNXK 3D6JA 3AGRA 4FF4A 3JPOA 4ZPBA 4FZVA 3GFXA 1N32J 3DRPA 3R7NB 1WAFA 5AM3A 8ICIA 1HNVB 2NR0A 5EOYA 1X5SA 2WBNA 7ICKA 5CZVA 2DPNA 4RCHA 4KV8A 2GEMA 4XTTA 2PO4A 2R8GA 4M3WA 5K8MA 2IFXA 4CGHA 2DNLA 4DU3A 4ID8A 5BPCA 2P9IB 5KFZA 3GBTA 4DX7A 4FO0A 3IGNA 3LDNA 3GU3A 2KRRA 3QU7A 1SL2A 5TZVA 4S0MA 3AXMA 9ICMA 3C6TA 2HOFA 3EVMA 4F3TA 2JVRA 1BHLA 3QINA 3BYRA 1DGSA 3ZETB 2X3DA 3KLGA 2YX8A 2V0NA 1EXQA 5E26A 4CECA 2ZIUA 5LJ5Y 2IOFA 4I2QA 4NV0A 3NGUA 4BY9C 1DK2A 3D0IE 4MLHA 3DGPA 4BRKA 1NOYA 5AQYA 3EMTA 2Q2RA 1S7HA 2R8JA 3QX7A 3IRXA 2VGNA 1W25A 1KLNA 2HNZA 2GQCA 1VQ9S 1SC4B 2QX0A 3L5KA 2YHAA 3ZLJA 3OSPA 1T9YA 3TZWA 4L3QA 2UUBK 1HKGA 5D0EA 3L3CA 4PZOA 3NE6A 5AM0A 3T3FA 2I7NA 3OFFA 4CT9A 4FZXC 9ICBA 5GADP 4I7FB 5KRSA 3PY8A 1NRKA 4QZHA 1YQHA 1AZSA 3POTB 5K8PA 2UUCF 2GX8A 2IRYA 3D45A 3CRXA 4DOAA 1FKOA 3HZGA 1S0NA 3FCVA 3QFHA 3O9SA 3IR5B 2JEGA 2HQCA 1R0CB 1SAZA 2BJ1A 3BEXA 3WKDA 3NY0A 1FX2A 2YMMA 4UOCA 2A6MA 7ICMA 1VQNS 3RW7A 1UWAA 4CZMA 1VSHA 4I2PB 3AVBA 1XHXA 1HBNB 4M7XA 2KFZA 3I5AA 5AQUA 5DO2A 1MNEA 2B6AB 1REVB 4Y6IA 4RQ4A 4K4VA 1RACB 2FHOB 5D15A 4MO4A 5KGWA 1Z2LA 4QZBA 3BUZB 2XMKA 3KXDA 2G9OA 4NI2B 3DRSB 2E29A 1LB2B 4AE5A 1V9OA 4IWVA 4CHQA 2R7YA 3FZLA 3OXGA 2DT9A 3RB6A 3S6EA 3ZDBA 4KH4A 4ID5B 5KG7A 4JI8K 3VQCA 2WW4A 4FVMA 2L9WA 1OY9A 4UB8U 4BRAA 2RDDA 3NRBA 1IQTA 1IH7A 2CJYB 4ERDA 4JYAF 1IBLK 3PO4A 1LXNA 1Q8KA 2QA4S 3WZ0A 3PX4A 2AMCB 3U3YA 4BG9A 1PCAA 2CJ9A 4OMFG 4BC5A 4B3MK 4FW1A 1TK0A 1G7CB 3UB5A 4LF9F 4QZ8A 1MU2B 3R6LB 4BVOA 2KXNB 1IR1A 2Q6CA 3M7DA 5C0YA 4BE2A 2O01C 2J76E 5CCMA 2ZJRL 1HIWA 3HVTB 1LWFA 3K1ZA 4K4SA 3IUCA 3O4WA 4M5MA 4CEOA 1IBKF 4IYQA 1MWMA 1WSVA 3M6VA 4R0JA 3NBPB 3SPYA 4BHQA 2ZM6F 3L2UA 2ASYA 3VERA 2O67A 2KN4A 3W5XA 3Q0AA 3ID8A 3TFSA 4CCHA 3MFHA 1QHTA 4DR2K 5I42B 4KR0B 4CJRA 1ZPWX 4ZJQA 4DR1F 2BKNA 2V69A 3KZBA 1Y5NB 4B1UB 1RDUA 3F9MA 1RHQB 1FJGF 1TL3A 4YOWA 2H4YB 2V50A 3I0SB 1RCXB 3TADA 2D9OA 3Q8PB 3OW2M 2B43A 4AHSA 2F8TA 4LH4A 4IOAL 4USUA 2NPFA 3M9OB 3KJNB 3SUNA 2YKAA 5H2FU 1VDHA 2VICA 1ZZNA 4LVOP 1FRMA 1ZRNA 4ZK7M 2YJFA 4F3QA 4JHDB 4PL8A 2MHEA 4QW8A 3M8WA 1M6YA 1CJUA 4BRDA 4N56A 1LWEA 2CG8A 1Z6RA 2FYXA 1F6TA 3EUB2 2R18A 1X4CA 3M6UA 4MJKA 1IVZA 4ZMMA 4DKWA 4MFAA 2JC1A 2R4FA 2UXBF 2Z2ZA 4PEOA 2FD2A 3PIOL 1EARA 4ED8A 5HR6A 3P38A 2V67A 4YY3F 2JMGA 4J2DA 4FPRA 2ZZTA 2MY7A 1PILA 1JN3A 3P1GA 2GQQA 3KLIB 2GVDB 4A8EA 1Q95G 3UDVA 4J91A 1JNRB 1RQNA 4OZ2A 3QIPB 3D2FA 3DLGB 1S9FA 2A18A 4IKFA 4ELVA 3MN9A 1LXJA 4KQZA 1KQSM 3KKAA 4C1NI 5J0UA 5AI6A 5IWAF 3TZYA 3HZEA 1S6QA 1HWIA 4KLEA 3IO1A 2VUGA 2OPQB 4ZCMA 4CJUA 4FJIA 1FRIA 5M1KA 1HFEL 1RXWA 2LDYA 1GMWA 4OV6A 1X7VA 4X65F 3ZDDA 1EX4A 5ALUA 3WK5A 1H38A 1MWYA 1MA7A 3GONA 3KG0A 2CJQA 3M2VB 2W42A 1VQPN 1MQ3A 2KVIA 3MMVA 1C2PA 1WHXA 1XUPO 3EXCX 5M2PA 4K5SA 4C8OA 4C8MA 1JLCB 1QD1A 2RS8A 1A77A 2CQGA 3CD5A 3V81B 1IKXB 3L95X 3QQCD 2EANA 5DQIA 2KSOB 1TMJA 2CIMA 4DV2J 4I2BA 2QG9B 4C2MA 3GPAA 1HQEA 3SMSA 3CEDA 1D09B 2Q0UA 3OHAA 1M1HA 1AUSL 2IA6A 4L8RB 1T0TV 2QM1A 1HPZB 4PAAA 1G1XA 3O9QA 4CZCA 2M5YA 4EHUA 3HULA 3RZAA 2FY8A 3HM8A 5AICA 1Z25A 3CJKB 1XMOF 1JL1A 1NGCA 4CHOA 1WORA 5J0WA 5H9EK 9ICIA 4C6AA 4W98A 2EW9A 4XPCA 1VRTA 2OD4A 5LMNF 1ZBHA 4OJOA 2ITGA 3SAFA 2I6XA 3QEXA 2MUTA 1ILYA 5LT5A 4NYZA 3HKZF 2GH1A 2F9JA 1N8RT 4CJ7A 1VQ5N 4JI6J 1AUDA 3HHNB 3ONQA 1GQEA 4LRDA 4K7QA 4MN4C 2NO4A 1X6IA 4OVLA 3ATVA 4FJXA 4NASA 2EFGA 2F1IA 3AJ1A 4C8NA 1MMDA 1HHQA 2YNHB 2LKYA 2PI4A 3JQMA 4LUBA 4PL2A 1PC5A 1C0UB 4AL5A 3TSUA 3VGMA 2CKWA 4B9LA 4CYUB 4CLUA 1JLBA 3MD3A 4DR7J 3AARA 1U8SA 3D7EO 2O4GA 3VZIA 4TQSA 1FD8A 4IO8A 4ZHRA 2MB0B 4UW9A 3TANA 2BMBA 2V51B 3AVLA 3Q8QB 4QWBA 2CVEA 4RUHA 1S22A 3KZIU 5JS2A 4I68A 1WBBA 4JKGA 5AI9A 3OYFA 4GLXA 3M6KA 3CIZA 1W26A 4NCGA 5FRMA 5KT4A 4LVNP 1WOSA 4OJ6A 3EGVA 1JRPA 1YZ7A 1KN6A 2A3ZA 3KUGA 8ICAA 3ZSXA 1B64A 3T5KA 4LD0A 5CYQB 5DG8A 1B9FA 5KGXA 3CF5Q 3QPIA 4DV4J 3UPQA 4C9DA 2YHXA 3VEZA 3SQGB 2I38A 1V9PA 4P4PA 2C3MA 2COLA 4USIA 4TNOA 3CCJN 2PAVA 2LPEA 1RXVA 3GR0A 3C95A 2XMJA 3UR0A 4KKOA 5LSOA 3K5NA 2Q97A 2HS3A 5ETMA 1YT3A 4NLTA 3U26A 1YBTA 5HRNA 2YBVA 4BC3A 4NL5A 1KLMB 1DY3A 1KVIA 4IBNA 3V4IB 4QIFA 1D4XA 4WYBA 3BR8A 4QR0A 2OZSA 4DTMA 5IT9O 3FM9A 1WUDA 3NF7A 3M32A 3QUTA 2F8EX 3VA3A 2GGPA 2NUBA 3TWZA 2KLAA 8ICVA 4I1TA 5B08A 1ZQCA 3L3VA 4ES2A 1FDNA 1R6YA 5IXUA 8ICPA 3NG8A 4WQ4A 2J5AA 3AVCA 3MM7B 3LVWA 3MPWA 3KK7A 1RZTA 5KRTA 1C0TA 1FDDA 2Y0BB 3D2QA 1N5VA 2W8KA 1YHQS 2E1CA 1B9DA 3QT7A 4I56A 3FGUA 1RYSA 2P9UA 1Y0HA 1KWMA 4KHQA 2PFQA 2WHOA 2IOCA 1JIHA 2RILA 5J2GA 3CC2S 4DUYK 4M0AA 1K5OA 1CQMA 3L2QA 3THVA 2G08A 3ZD9A 2FJAB 1S1VA 2Q6BA 3DV9A 4A8MP 4BBYA 4JV5K 3E9PA 2HHPA 3EGWB 1MN7A 3U1LA 3W8GA 2QI2A 2OZMA 1CJKB 1F5BA 4B3OA 4L6V3 3T9NA 1BI4B 5AT1B 1UZDA 3T69A 2NXJA 2IDOA 3ZT3A 2QSFA 2QWLA 2V8HA 3T5HA 4DR6K 2GFFA 4K4ZA 7ICTA 2H5XA 1OQ6A 2DH9A 5DDYA 1DTTB 1JK9B 4TY8A 3QWPA 4DL0C 1YWXA 2E5LJ 2VYPA 3R9KA 1PIEA 1ZBIA 3BO4A 4DOBA 2WF9A 1R27B 1S0VA 1BWFO 2YTUA 3CIMA 3DI6B 1M5OC 5AQZA 5SUHA 1U2FA 3TADC 3R2DJ 3CFOA 2FJEB 3H90A 4ZVFA 2AHOB 2MAXA 2GV9A 2EFNA 2LSNA 4CO1A 4I9LA 4BE0A 2XYGB 1S6PA 3DOKB 4QOTA 2KKHA 3HHLB 2EG2A 3BO2A 2E9TA 2AP1A 4PUOA 2HI0A 1R31A 3MEDB 3L2WA 2OTLN 5FPNA 5AE2A 2QWRA 4ZVSB 1M0SA 4OO1J 1U1PA 3CVKA 2XGQA 3B4DA 2VJ5A 2E2NA 4BC2A 1ZQLA 1PJ5A 2OLWA 4WWSA 3V2UC 3OS2A 5ALJA 1Q81O 4KAZA 4ECQA 4LFCJ 4J9OA 1VRUB 4OHYA 1J97A 4R64A 4K4GA 1Q5VA 2HVEA 1ZBLA 3DLHA 3K75D 4P6QA 1UEUA 2XI2A 4J9PA 4Y28C 2P9IA 1FTRA 5E79U 1AXQA 3RAMA 1HMVB 4XAKA 4OHZA 3PHTA 4WXOA 3OGUA 2MSTA 1SKRA 1UFWA 2I7PA 3QBXA 3KG1A 3DOLB 2DK2A 3PZPA 2XM3A 4F7VA 7ICQA 3D0HE 4X66J 8ICNA 2IVNA 3IM1A 3VTHA 4KH5A 4LSNA 3HXMA 3S3MA 1E6YB 2B4UA 3NNCA 4EP4A 2BM0A 3QB0A 2AF6A 2JFKA 4I6MB 1CLQA 3J7ZO 5C15A 4A4JA 3D0PA 2YWEA 2DHXA 4QNLA 5FIIA 4H0PA 2EI5A 3C28A 3U02A 1T11A 2A6OA 2D3DA 2DQNB 8ICBA 1WC3A 4NLCA 3C29A 3A3PB 3D1HA 1SZ2A 3EICA 1HR0F 2QB0A 1K47A 1XIQA 4OJRA 8ICGA 4XPEA 4FVUA 5CB1A 4IZ9A 1IR0A 3UO0A 1WJ9A 3OJUA 4CJTA 4Z6CA 4A8SA 2L41A 1VQ6N 3GYNA 3IBCB 3PSPA 4UUWA 1FFVA 1KC8O 1BNOA 1OH7A 3C21A 3POTA 3AA2A 3QLHB 4B1ZA 4QWDA 4ED6A 5KFMA 2XI3A 4U7CA 4NXNF 3BH6B 2FLNA 2VBYA 4Q43A 1N2XA 4UAYA 1Q1KA 4FPIA 1EIYB 1YBAA 3V6JA 3M6ZA 2OGUA 4TYBA 5JRTA 4KPCA 5ETLA 4DV0K 2B4JA 3KK3A 2OD6A 1BIZA 2UUAJ 5EY4A 2XCPA 4BC9A 4I2PA 1TK8A 2E2OA 1RA7A 1HBNA 4LZGA 3A8EA 1XMQJ 1NDKA 3R97A 4QU6A 1SPBP 3NDKA 2B6AA 1REVA 3V7KA 2ILZA 3F0NA 1ZBSA 4ECUA 4KGKA 2ETJA 3D5MA 1QQMA 1WSIA 3OXFA 1OH5A 2FJVA 3GE9A 3MN5A 2F5GA 4QZFA 4ZCIA 4K4XA 4NI2A 3DRSA 4LF4J 4ISFA 1X31C 4UB3A 1Z00B 2BJ8A 3ZTOA 4ID5A 2E1ZA 3M8ZA 3ZDEA 3O6QA 3DLEB 4JYAK 5KFJA 2I6WA 2HYIB 2HNDB 3MI7X 4UASA 3UN5A 4EZ6A 1RM6C 4W5RA 3OYBA 2LU2A 5BRHA 4P52A 3LDLA 3T79A 1CJVB 1Y64A 2RHSB 3AXKA 4AFFA 2DGUA 3RRGA 9ICSA 3H20A 2UXCJ 5AZIA 1Q3VA 1S57A 4IS7A 1X9XA 2XQCA 1BPYA 8RUCA 3UKUB 2P6SA 3C65A 4PPDA 1XQSC 2BANB 2UXDJ 5K8OA 1BIUA 1XNQJ 2A42A 1MU2A 3VALA 3OYDA 4B1WB 2V7YA 1IBKK 4H03B 1IXRA 2B7CB 2DNZA 2W2PP 3ZSYA 2ZM6K 3RF9A 3GSDA 4OZLA 5LMUF 2CQBA 1AFIA 3MXMA 1DQAA 4F4AA 4CE9A 2RH3A 5AE1A 3TUPA 2V2KA 4O9MA 3AOAA 3CHWA 5F8IA 5AQJA 3NBPA 5A2QO 1Q16B 1PBAA 5KNIA 5J0YA 5CEHA 1RU1A 3CUNA 3UKRB 1H2TZ 2AGQA 3LDPA 5I42A 2VFUA 1Z4NA 1ESVA 4E98A 1N61A 4B9VA 2A1RA 2G5IB 2QTWA 4CT8A 4P0QB 3B4MA 1LVHA 3CD6N 2E1EA 2OEHA 2YKPA 5B0DA 2HHQA 4OKJA 5KFOA 1TV9A 4IDKA 4WQ5A 3JB9k 3ICXA 2LLZA 3ISDA 4MK8A 2YX1A 2DYAA 4MFBA 2PT0A 4GKJF 3JAMO 5HBMA 2GHWA 2WVBA 1JLGA 3ULDA 5DM6L 1IM6A 1U2RA 4JHDA 3CWJA 3VA0A 1D3WA 5KFLA 2EDUA 1A5VA 4FDFA 2UXBK 2G4BA 3NASA 3RRKA 3CCLS 4RJVA 1RUSA 4M3RA 3T9ZA 4YY3K 1VQLN 4P7TA 2O8CB 4USKA 1VGYA 9ICFA 4Q5VA 1ATNA 1HKAA 2HHHJ 5JICA 4MQ3A 5HJXA 1C0FA 2D4WA 3MWTA 2RSQA 3OYLA 2BPGA 3MUVP 3GIRA 2E8OA 4CRJA 4FXVA 1PK3A 1UWBA 3M2UA 2V4JA 4CLTA 4US9A 2GVDA 3TACB 2O8EB 3LWMA 4D3GA 2DO4A 4AQYF 4M04A 3HOSA 1OJ4A 3PJ9A 3DLGA 2DXEA 1QVFM 4I6AA 4WQ4C 5IWAK 4ILMA 3A8JA 2E66A 2I5HA 2Y1RI 1IJJA 4FJ9A 2KJ8A 2CJBA 3ZZ0A 4B17A 1JCEA 4X65K 3MGIA 3RBDA 3LK9A 4PABA 3W60A 3D2EB 2F7VA 2C2RA 3FSIA 2ZUAA 3OTDA 3PMNA 4CK1A 1JKHA 1HJRA 4I28A 4OYPA 2BW2A 1VQSA 3NS7B 2VONA 1LKZA 1M5VC 3QUBA 2P9NB 1FE0A 4FXWA 3QEIA 1YIJS 3M2VA 2K3KA 3EZWA 1A5WA 1DXSA 1VLOA 1WEZA 3D3CJ 1E4FT 2ZZNA 1JLCA 4AM6A 1X40A 4DCCA 5J0TA 4DV5K 4LF2A 4PQUB 1B99A 3V81A 1K1QA 2L9DA 1PK1A 3LP1B 4B6JA 3E0FA 1RPLA 2CPYA 3G87A 1P8ZA 2ZQBA 2F8LA 4DHYA 3H2UB 2MZTA 2FZCB 5FPMA 2KSOA 1BWEA 1KONA 3QU4A 3PX0A 5G5HA 3AJDA 2E3TA 1KOHA 4LRBA 3MAAB 2CDRB 2M9NA 3NH2A 2LMRA 3OVNA 4DG1A 1VSIA 3I33A 5CP2A 4FYVB 1VQ8S 5GVQA 2MRLA 2DNOA 2ZOGA 5DDRC 1LW2B 4E19A 1U6BA 1QJHA 1SXEA 3HTVA 3ZD8A 1TUUA 5AQTA 4NLGA 4E7IA 2RIJA 1F21A 3CJKA 2DGOA 4UY85 3EEQA 1IKVA 1VISA 2E44A 3C8YA 5LMNK 4ZTJA 1D8LA 4MYUA 2ZDOA 4Y00A 9ICQA 1S72S 3VC8A 8ATCB 3TARA 5J2AA 2CQPA 1SIJA 3KJVB 5E3RA 1KW4A 1OWXA 3JTOA 3LP0A 4TSXA 3ZI4A 3I1YA 2Z1JA 3F2BA 1TKDA 1F5AA 5GIPA 1HX1A 7ICLA 4AL6A 5AKJA 1GOAA 4NXMF 5EE3A 3ZX3A 1S77D 1RBUA 3RR7A 3AY0A 4ES3A 2KVCA 5BYRA 3DLBA 2JEFA 4RQ2A 4HTUA 1QHAA 4DUTA 4UAWA 1RQ0A 2KT2A 3NGDA 3PRVA 2ZVSA 4IG3B 1C0UA 1RKJA 4CYUA 1T7PA 1T02A 3VQQA 3QEBZ 1SJQA 2RT3A 2HWIA 4KHRA 2W40A 3K9JA 2H3VA 3K5OA 4X62J 1N34J 2FGCA 2Y9UA 1PYSB 1XO0A 2AJFE 4DL3A 2CQCA 4HTIA 3GQCA 2VASA 5B09A 3KWGA 4CIGA 5D4PA 3OD2A 5M2UA 3O8WA 5DM7Q 2NRWA 2C2OB 3EDRB 4WK1A 4Y2KA 3ENHA 3RMDA 5JU5A 2BRKA 1WDDA 3A0IX 2PEHA 3HSTB 3BQTA 3QWUA 4CGFA 1L3KA 1XN9A 3Q8MA 4DZDA 2DGZA 2HLUA 4B3TJ 1NAQA 5EX5A 5AXNA 3OYCA 4HI1A 2HOIA 3SENA 3ITHB 5ALLA 2W11A 2WK4A 4USHA 2QW9A 4FF1A 3OXLA 2JJ4D 2KG1A 1T44A 1ICEB 3B8AX 3ILOA 4AH9A 1ZTTA 2W55A 2DIUA 4R63A 4XRHA 5F8GA 1DKGD 2X78A 4CH1A 1VBKA 4HDGA 1URNA 4GMJB 4K4HA 4RQMA 3TX0A 1CZBA 4H0XB 5HSPA 3ETOA 3PLAA 4UUXA 4AUKA 2VQFJ 1ZAWA 3QEWA 3V4IA 2IGIA 1N4LA 5ETTA 1P27B 3CNHA 2K06A 1CQNA 3QE9Y 5L9XA 1KVAA 4KFBB 1NSPA 3AVHA 4FPAA 1T3OA 3QZ8A 2B5JB 1NGGA 3WK6A 1VQNN 3TA1A 2CNOB 4H5WA 2EWHA 1LKYB 2KB2A 2JH3A 1CC7A 6FDRA 4E7LA 3MM7A 3T19A 2M2BA 5KFKA 4NPOA 1S97A 2P6UA 3BM7A 1JMTA 2ACMA 2Z57B 1O03A 4RPZA 3ZZYA 4ANCA 1NMEB 2XC9A 3SD7A 4WP9A 1TL5A 2QLJB 4WE1A 4X84A 4TY9A 3OJSA 4ILGB 1HNIB 2BCRA 5GAEP 2DITA 2DNYA 5ITHA 1KR4A 1RAHB 4GC6A 3E9LA 1P1TA 3UIQA 5HMYA 4Y2UA 1MWZA 1KFTA 5ALDA 2HFOA 1R8PA 1WLJA 1NLVA 2A1SA 5FPEA 2LP4A 1W7WA 3ENOA 4DFKA 1H2UX 1CJKA 3BSOA 1BI4A 1BQXA 5EOZA 2DRAA 2ASOA 4P2MA 2KICA 2ISOA 1RT5B 1TVRB 2QIFA 5C2CA 2VPZB 5C25B 2O3DA 3M4XA 5KAFU 1KTVA 3SBTA 4M7YA 1CXUA 2EAPA 5IIOA 4CZFA 2NREA 3GG4A 3TSPA 4A8XA 4EBDA 9ICCA 1HL6A 4I4BA 1U2VB 1JJHA 4CK3A 4C7QA 4P9SA 2QYGA 5CA5A 3WQTA 3DAWA 2WFAA 2BE7D 2BCUA 1Q0NA 3DM2B 4CRXA 3RYLA 3DOKA 1SZHA 3HHLA 3H5YA 1N5QA 1HHSA 2K3IA 2B8PA 5F8LA 2DVIA 4DU1A 4AHVA 1UEKA 4ZN3A 1WC1A 1U1NA 2LBOA 2IBOA 4ISEA 2CUYA 3R5DA 4DV1F 1RAAB 3OSNA 4W5TA 2MQQA 1VRUA 4CVNE 1ZAXA 4BRCA 3AJ2A 1JLFB 5BR8K 4CWBA 1XERA 5J2KA 5THWA 3T6BA 2DNKA 4WF9L 2HW3A 4BRGA 3B6PA 1PJ6A 4EO6A 1A7GE 2G2OA 3GFHA 2CJKA 2YX6A 3DOLA 1Q81T 1KKHA 1VIXA 3SBMA 3G96A 1U8WA 2FC0A 4O3NA 1SH3A 4M5JA 3BY5A 3MDFA 3WK4A 1E6YA 4KY3A 2J6TA 4JI4J 2A10A 5B5EU 1WHWA 1TELA 2EFVA 3JPQA 2RVJA 4I6MA 2LEBA 2FF6A 2HBZB 3LVVA 3UMBA 2E8AA 1RG6A 1M5HA 1RT7A 1QQ7A 3LGHA 3H6EA 1IG8A 4KLMA 5AXLA 3UXNA 5AK6A 1RT6B 1KFDA 1BC6A 2H3EB 3NCQA 1DLOA 5FROA 1GMUA 4F36A 3J7ZT 3IM8A 2DNPA 2XWXA 3I4HX 3MTJA 4GV3A 1SVDA 3J7AN 1WBDA 5TKWA 1LV5A 1NWKA 1F2GA 1IBCB 2D1KA 3QLHA 3HVWA 3EO3A 4YB5A 2P9SB 3LL3A 2NLWA 3BP8A 2VG7B 2DWQA 1TAUA 4CNYA 2HHTA 1JUDA 5BXIA 4RWWA 2C2EA 4FS2A 4OI1A 5L1IA 8ICJA 1YI2N 9ATCB 4BLGA 3R5AA 4LBIA 1RT2B 3C14B 4QIEA 4JS4A 4DCHA 4BR5A 2AD9A 1GFWB 5J1EB 1ITPA 3SQ4A 2Q66A 2LXIA 4LZDA 5J2MB 3O08A 3FAHA 4XH1A 2NQPA 3WC0A 3MUMP 1NGBA 2EPIA 2YVSA 1S1TB 1PGZA 5J2QB 4IQXA 1VK8A 3ETRA 3UD5A 2F3JA 2MPUA 1YTAA 5L8RC 1XWLA 4ZLPA 3UMGA 3C6UB 3T1HF 3DCAA 3RJKA 2PSZA 5HQMA 8ICWA 1UJ6A 5HVGA 3QERA 4RT3A 4KC5A 2RF2A 4CJFA 3TAEA 2J0WA 4BRIA 3RU0A 2ATCB 3LPEA 1O0PA 4C0HA 2W2OP 2DTUA 1CJVA 3O3LA 5HL7Q 4ZP8A 2AJQA 3AA4A 3BQ1A 1FD2A 1GT8A 2HEKA 1UVMA 4PXEA 4DTXA 4NYOA 4C0ZA 4P0PB 1Z4OA 3BZCA 3OYMA 3ZZUA 2R7TA 4V19X 3UKUA 5CHGA 3UXOA 3H2VE 1EQMA 4M9JA 5AK3A 2LQJA 4CBWA 3M8SA 1VSJA 5AXKA 4Q7AA 2AXTU 4YCXA 4LFAJ 2F8HA 3RB3A 1S0OA 3HX9A 2F1HA 3MX2A 5AQXA 4RG8A 4QZAA 3JSBA 1JCFA 1L7MA 4YDXA 3SCXA 4Y65A 4C4TA 1ASWA 2P5VA 3LPUA 4CF0A 3AV9A 5AQSA 1B43A 4FLVA 3CQYA 2FC9A 4LJMA 4QYZJ 4DMZA 1ZOTA 4JRQA 2YKMA 5CAAA 4LRAA 5AK4A 4P71A 3CO0P 1FXXA 3ZT4A 4QQBA 2HGLA 2GUIA 3NGTA 5GAHP 3MM5B 2H5JB 2GC8A 2XLIA 3K0SA 4O0IA 4MIAA 3UKRA 1VSDA 1L3TA 1G4CA 2CZ9A 4RNNA 5ALRA 2GJ2A 1YBUA 3M5RA 1R6VA 2C1EB 4DN9A 2R8KA 3FBFA 1J5EJ 1H3DA 4LF6F 2EAMA 4P0QA 3DLLQ 4KT0C 2Z4PA 1VQON 4GKJK 1XC3A 4PG7A 3ETMA 5F2RA 4TURA 4P4OA 5CR4A 3VN5A 1VHXA 1NSAA 5FLXY 1VQKS 1NGFA 3CJ8A 2WSCC 1N5WA 2FPMA 3P3DA 3IR6B 4QZDA 3AQOA 5KFDA 4DF4A 4ECZA 5F8NA 1SZPA 1NJZA 2XCAA 4CW7B 2NRTA 1GOCA 2ZE2A 2H5IB 3RBZA 4JKDA 1Z1VA 3MGVA 2YV0X 3WC2A 3EKUA 1B7FA 4USVA 4YOTA 3UDEA 2O8CA 2W54A 2Y1LB 4B3RJ 1E6VB 4J9RA 1CC8A 5JVGL 3TP2A 1WSGA 1ZQSA 1N0UA 3H1QA 4RW9A 4H4MB 2ZJPL 4AQYK 5ALXA 3LO3A 4P4MA 1S12A 1BPEA 1YXQA 5DBAA 4KJIA 3IGVA 1N62A 1GLEG 3IXQA 3IMQJ 4RLEA 1ZQAA 3BF3A 3ILLA 4WFAL 4K5RA 3GP9A 3OFHA 3ZT2A 2VGMA 3L6QA 3SZ2A 3ZYYX 1SJ3P 1L3SA 2IM2A 4F04B 2Y0SF 1LK7A 2YTCA 7ICRA 4FNHA 5TKYA 3PNCA 4UF4A 4CEQA 4I2FA 4X64J 1FRXA 2UV8A 1NK6A 5KQDA 1FXLA 4H5RA 3QICA 2DHHA 2WVEA 4JKCA 5D4OA 1XS9D 2P9NA 3QT8A 1NU0A 4AYBD 1S8OA 3QNOA 4A8OA 1WTFA 1ZQOA 3QNWB 3ISBA 2RJZA 2G5HB 5AM5A 3HHLD 3EL2A 3CCSS 3EYZA 3TR8A 5KOWA 4YS2A 3FZKA 3LP1A 2BZ2A 2ZHOA 3VVUA 4L3NA 5TISU 1Q86O 4GO5X 2MQMA 4IOCL 4Z6EA 3GIMA 1DHMA 3V9UA 4YMOA 1SL0A 1U24A 3VETA 4BC7A 1P90A 1Z26A 1A76A 1AFJA 1L7PA 3PKMA 4WKRA 3PACA 3VENA 2BOPA 2BM1A 9ICHA 3BBFA 5AJ3J 1LW2A 3F2DA 3P49B 3PW4A 3IWNC 4KGZB 5AIBA 5FDLB 1K9MO 3AM9A 4O5BA 2Z1GA 2DGSA 5I3UA 3HHLC 2QTDA 2KDOA 4FK0A 1OKJA 1GAOA 4U67L 2XIDA 1PC4A 3PTWA 5ALNA 3V9SA 4PGXA 4C3LA 3BDPA 3ZEUA 5ADXH 2ZBQA 1LW0A 3V9ZA 3CFRA 2ZXIA 4F0KA 1RAEB 3H3OB 4BGBA 4KGXB 3DDNA 3VVTA 7ICUA 2IA0A 5EX3A 1K0VA 5KT6A 3MCAB 4KHPF 4EWTA 2BV3A 5ALYA 1NPPA 2VQEF 3DYAB 3ZT1A 2F4VJ 4X5VA 3G6YA 1Q8LA 4DR3F 3CJRA 2Z56B 4PZVA 1YF5L 1S9GB 3KVGA 4HHHA 4FM1A 3H8YA 1WKKA 1FEEA 4RW4B 3BGOP 4IG3A 5J1PA 4PWDA 3M8RA 1Q7LB 4DZ6A 1C4AA 2JX2A 3MMAB 3OTEA 2J9EA 5HI7A 4OIXA 2WONB 1N5SA 1BPXA 1O8BA 4ZLLA 3QFUA 2LU1A 1NZPA 2VKQA 2DPIA 3V9WA 2CVIA 4KMOB 4NMLA 4P73A 3OFEA 4E1MA 3QEAZ 2GHVC 3HRGA 5CZ2A 1SH2A 5ETSA 4CEZA 2F65A 3RAXA 1BGXT 3G82B 4BDPA 1FJ7A 4NXMJ 2GVZA 3PW0A 2P9EA 1JJ2R 5F8JA 2FVQA 4DQIA 4F91B 2F9DA 3L2VA 1N60A 4M47A 3LDOA 5JMNA 3ITHA 4LF7J 4KN7A 4IG0A 3ZSWA 1VQ7N 4OKKA 4YR3A 2HHXA 1WCNA 4DX8H 1HBUB 5DJBA 1U1KA 1C1BB 4TN2A 2W6LA 1KAXA 3QO9B 4ZS6A 1V5IB 3SR6A 2PZSA 4IJAA 3KJQB 3CG7A 5AKKA 2E8NA 1QS4A 3GV8B 3VAFA 1HNZJ 5CYMB 8ICQA 2GHPA 4JI5F 2NUUG 4G6VB 2D1CA 2VBXA 5D8HB 3L4BC 4CF8A 4R0EA 1Y5IB 5AQKA 3V7LA 2CH5A 3WXIA 3GCXP 5F3TA 4DHVA 1ZQKA 3MXIA 2EX3A 4TUSA 2GV1A 4GIBA 5I4MA 9ICWA 2FVCA 3OL6A 1V3RA 3G6EN 3AU6A 4Q45A 4KFBA 1IBMJ 5LJ3Y 4OJ1A 3C7NA 4WP8A 2VG6B 1BQNB 2B7BB 1LKYA 1X8DA 1D0EA 3NGKA 3EJMA 3LM2A 3A12A 3THYA 1U26A 3QUQA 2J9CA 3R5CA 1IKWA 3T1AA 3A3NB 3DJCA 1FDBA 3CC7S 1Q5YA 5HQLA 1X1PA 2EH9A 3R7BB 2QLXA 2ZWHA 1QSLA 3LALA 1KD1T 2XB2D 5KT2A 1HNIA 2WTFA 2FTRA 1TL7A 5FP0A 2R3VA 5A0YB 1B0PA 3EE8A 1Q9XA 2W25A 2EC2A 4TYAA 1QM9A 2KJWA 2OPPB 2JFDA 3UN2A 1QQCA 4CJVA 4M3ZA 3TTFA 1U1LA 3N4PA 5JUMA 3U9DA 2YB1A 2LYBA 1WAJA 1Y11A 3IC1A 3T7ZA 2BQRA 1TKZA 3G9CA 4K2JA 1RT5A 1TVRA 3G4SS 5C25A 2V5HG 2RRDA 3QYYA 4IXCA 2FLOA 1N88A 5K4LA 1SV5A 4NJ8A 4FYYB 2NRVA 1WTBA 2LYHA 1TGOA 1WC6A 3N79A 2G07A 3BB5A 4FBTA 3LW5C 1D8YA 2OEMA 4CFDA 1UVIA 2XLKA 1UW4A 4WCEQ 3THPA 3Q8VA 1U2VA 1ZYQA 1TFWA 3E51A 4DL7A 1ZZFA 2E8PA 4ECYA 1XSPA 2LCWA 1P9QC 4I2AA 1WEYA 3G71N 4G1QA 2FVSA 5GMDA 3QIOA 4ECRA 2HMPA 3DM2A 2M3DA 3CD0A 2YKOA 4DV1K 1Q79A 4JI7J 1FHTA 3NGRA 2R42A 4XH5A 2EQYA 1FJEB 2KK0A 1RT1A 3W61A 1S9EB 2PC6A 4DBQA 1RTJB 2LKZA 1RBTA 1IIPA 5T41A 3K8VA 4P74A 5GAGU 1GH8A 3VCDA 3CYMA 3QFWA 1JLFA 8ICMA 1UCVA 2M0GB 3AFGA 1SQGA 3D66A 4MKAA 3KBBA 4MYTA 5AI5A 3WQPA 1PAEX 1NKCA 2H3GX 5HMXA 3F41A 4H0OA 4ZOSA 7ICFA 3RSEB 2Q0RA 4OQJA 4IRCA 3RMBA 2KP7A 2RLTA 3BQ7A 1GNKA 2M52A 1L8OA 4FJKA 2W3SA 3A8KA 4AT1B 4FZYA 2DRDA 1S1WA 2V52B 7ICSA 2KVQE 5AKYA 1ZQEA 5FJ4A 3CJ2A 4JI2F 4A47A 2A1BA 2DY4A 2E5IA 5EWGA 2HBRB 1KQSR 1NGJA 4XH4A 3C16B 2HIYA 3FLCO 1ZBUA 3QBCA 2RQ5A 4CHNA 3MDAA 5ALZA 3I87A 4NM2A 4RT2A 2Y9HA 1RWMB 2ZC4A 3DDHA 2QEXS 4B1XB 3IM9A 5G5GA 3T1YF 3U6FA 2NZCA 1I6JA 4E2FB 3OT9A 3L7PA 3I9V9 2IBKA 1RSCA 3L4PA 4UZCA 1NSKL 4CGGA 3H5XA 1JMSA 2P9SA 4TKTA 1UVLA 4FLUA 4XEIA 4JI0J 4M2YA 1VQ4S 3EGNA 4X2BA 3EWGA 5ADZA 4OI3A 4F71A 2WMMA 2OSRA 5A8KB 2NUHA 4XDDA 3FZFA 3DMJB 3AO2A 3VQ8A 4J9VA 3D3BJ 5BYQA 3TUJC 4CLYA 2EKNA 1RT2A 2GIRA 3C14A 1EXNA 4A8YA 4OI0A 4C8LA 4ETZA 3WIUA 9ICVA 2M8HA 1BDGA 3BZKA 3AL0B 9ICRA 4O44B 3AY9A 1V4SA 3MWBA 5J1EA 5C5JA 4I6WA 2D0AA 4W90B 2U2FA 4JK9A 5CCLA 4UQGA 4DFJA 4ATNA 4K0KJ 1HNXF 3AA3A 5AQOA 1XNSA 1QY7A 3OLBA 3T1HK 1S1TA 2JRSA 3TVYA 2YY6A 1QLNA 2BCQA 2WRMA 2IIHA 4DV7J 1JCGA 4XIUA 5A76A 1FK9B 5LJWA 3KHGA 4BR7A 1M5PC 9ICPA 1ECWA 2JV3A 2CRLA 1GTHA 3IG8A 4OYZA 1RCHA 3T5JA 1WB9A 3CJ1A 3GU0A 4P0PA 1OXJA 5E33A 3CCUN 3H2LA 1FI4A 1Y3JA 4WU3A 4Z7CA 1KQFB 1NGIA 3H46O 2K4IA 4CZIA 1OPZA 4U95A 3AO4A 2VA2A 2MKCA 5AKIA 3H3NO 3PEHA 2O1PA 2PMZF 2RUSA 1R89A 4PHAA 2AEFA 3SFGA 2JHDA 2J9DE 5CA7A 1HRHA 1U6FA 4Q2LA 3TPQA 2G0IA 1A6SA 3RVCA 4DL6A 1GLBG 2E7XA 4BGAA 1MROB 7ICVA 1NK8A 2V4QA 3GV5B 3AO3A 3FGVA 1TZ0A 1UT5A 2Z2YB 3HK2A 3MM5A 3I4PA 2AJ1A 3N4WA 4DTNA 3UD4P 1RJJA 3SAHA 1JB0C 3RMAA 5M1FA 3WKEA 4C1NK 4LF6K 2Z7JA 4CLZA 1WI8A 5J2HA 4K8ZA 2OTJN 4CP5A 4Z4GA 3IV6A 4F9OA 1R59O 2B3TB 3H8MA 3UNYA 2MKJA 3H4DA 4DUZJ 4J90A 1CSJA 2HMIB 2FUG9 2ZD1A