1L3VA

Crystal structure of bacillus dna polymerase i fragment product complex with 15 base pairs of duplex dna following addition of dttp, datp, dctp, and dgtp residues.
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*AP*CP*GP*TP*C)-3'
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3vA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3vA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3vA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3vA01
4FK0A 3RB0A 4O0JA 4JS4A 3OYLA 4DTSA 2F1IA 2WOMA 3VQPA 4O55A 7ICRA 2F1JA 7ICEA 9ICXA 4B8CA 4QZCA 4ED6A 4BE0A 4DQQA 2FMPA 4BE1A 4FXDA 1BGXT 4FLTA 2FBYA 1WSJA 3RJKA 3MEDA 3ZT3A 5L1KA 3HPHA 1LV5A 1W0HA 3PX6A 1IG9A 5J2CA 3NGDA 4KLMA 1S1TA 3QEIA 3EPGA 3O3HA 5F9NA 3GQCA 3QZ8A 4FJNA 1NK7A 3SUNA 4M3YA 2DPIA 4QW8A 2IHMA 2FLNA 4UBBA 5L9XA 2IMWP 3AA5X 4AHCA 2FLLA 4H4MA 5J1EA 2I9GA 3OYHA 5DGAA 1KCFA 1JL2A 3V81A 1ZQRA 3CQ8A 2G8KA 2DFHA 3CFRA 1T7PA 4JLHA 1BPXA 4KLTA 4ED7A 5KFXA 4HYKA 1EXNA 4J9RA 5DKWA 4O5EA 4KLEA 2X6NA 4J2AA 9ICWA 3RBEA 2ISPA 1TKZA 2G8IA 4MFBA 4FM0A 4DEZA 2BDPA 1HQUA 4W5RA 1HUOA 3ZDCA 2PFQA 4CJPA 1FXXA 2C2DA 3VQAA 3VQDA 3V9UA 1XU4A 4DSEA 1VSIA 1NJXA 2KFNA 3PUFA 1K6YA 3OYFA 4FW2A 3SZ2A 4XIUA 3DOLA 5J2HA 3KLHA 3RB6A 1EXQA 3NHGA 3L2QA 4ED8A 9ICNA 1C1CA 2YKNA 1KSPA 3LZIA 3KKRA 1QQCA 1ZYQA 2J6UA 4RPZA 2YNFA 4IFVA 2VG6A 2YV0X 5KFLA 3RJFA 3HVRA 1ZQWA 2R8IA 3TAEA 1Z26A 4DFPA 4CHOA 5J0OA 1ZBHA 7ICIA 4F5QA 4PY5A 5IILA 5EWFA 3ZSYA 3NF9A 4E7KA 4LVSA 4LY7A 1I3AA 2R8JA 4RT2A 2ZUDA 4UQGA 4AHRA 1JMSA 4IR1A 4LD0A 3L3VA 1ITGA 8ICOA 5KGWA 2IAJA 3T5KA 4OJRA 4KREA 5KT7A 5KFDA 4F5NA 5KFAA 4PWDA 4BWJA 4Q8FA 5KFSA 3ZD8A 1NKBA 3KK1A 1U04A 4RZRA 5IIOA 4F3OA 1VRUA 3RWUA 4KTWA 4ELUA 5DDMA 3UXNA 1IH7A 1HNVA 3P5JA 2PYJA 2ZJ5A 3MXMA 2I1QA 4KITB 3VQ9A 5SWMA 8ICGA 1D8LA 4JWMA 4DF8A 4IG0A 4LH4A 5DBBA 4M9HA 7ICKA 4NCBA 5KFBA 3DMJA 4MQ3A 3WNFA 1ZQMA 2XY6A 3VN5A 5IIIA 4FJ9A 4DTMA 1F21A 3NF6A 4QZDA 3L2WA 1QTMA 4FBUA 4I28A 4YG2A 4KAZA 4JK1A 4RW7A 5CP2A 2G8FA 2X6SA 2RN2A 3QNNA 5BOMA 4AHSA 1VSJA 1HNIA 4RNNA 2BR0A 3GDXA 2XY5A 1S0OA 1B92A 3E01A 1N48A 5KT6A 4PQUA 1BIUA 4CJSA 5HHIA 4CFDA 5KFVA 2FBXA 5EOZA 1Z00A 4FZYA 5TZVA 5KT4A 3NAEA 3DLKA 4QZFA 9ICGA 4ECVA 1XSPA 2ZJ8A 1S77D 3KKSA 3T19A 3MR5A 2XCAA 1ZQSA 3DLRA 1SL0A 4KN4A 4M2YA 4MFCA 1RCHA 4RQ2A 3NF8A 2PFOA 5HNKA 4DQRA 3MGHA 4BDYA 2ASJA 3OYNA 3OS0A 1JLEA 4FLUA 5J2NA 3PVXA 8ICRA 5J2EA 4CF0A 1BQMA 4MFFA 4RUCA 2ASDA 3ZSQA 3K4GA 2VG5A 4Q44A 8ICZA 1BISA 1BPBA 4IDKA 2XGPA 3NH1A 4N76A 2QKKA 4QZEA 4DTJA 4I2EA 4DL3A 3EWAA 3U6FA 5DDYA 2B5JA 1DGSA 5DK5A 5CWRA 4OGCA 3AVAA 1RBTA 3S3NA 1ZQGA 2BPGA 1QSYA 8ICXA 5JS1A 9ICOA 4DQPA 2YHAA 1ZQNA 1X2IA 1TAUA 1RXWA 3NDKA 4B9VA 5J2AA 2HHTA 3IG1A 3ZSVA 4CGJA 2MAXA 4I27A 3CFOA 2G8WA 4KLHA 3TWHA 1TVAA 4RW9A 1HRHA 3KIOA 5F9LA 1S76D 4I2CA 4E7LA 4J9KA 3OYGA 4FW1A 3TANA 2F8SA 3H40A 1DTQA 2YHBA 3TABA 3JPRA 1YTAA 3BQ1A 3Q8MA 3DI6A 3KD1E 4JUZA 2BGWA 4EBDA 1VSHA 3TAQA 4F2SA 2JZBA 4GW6A 2HHUA 1EETA 4FLZA 3AA4A 2AU0A 4CJLA 4P4PA 4I7FA 5BOLA 3AO1A 3HT3A 4GLXA 9ICLA 1Y97A 2C22A 2X78A 1NJZA 3ZDEA 1T8EA 4Z4EA 4IRCA 1FKOA 3SQ2A 1BIZA 2Z1IA 4C8KA 1JLAA 4NXZA 3QO9A 9ICKA 4ECZA 4YR0A 1S1UA 1TK0A 3EYZA 1TV6A 4RNOA 7ICFA 1GOBA 4OKKA 3VQ6A 4EP4A 2A1RA 7ICNA 1YTUA 3RMDA 5KT3A 4I2HA 2KZZA 5KFIA 1QHTA 2IA6A 3HL8A 4PPXA 4GXKA 3UQ2A 4E7JA 3PW7A 5KI6A 1BPEA 4I2JA 5DQIA 2IDOA 1NK5A 4QOZB 3JPTA 5J2IA 3HVTA 2J6TA 4ED1A 3CFPA 4K4IA 1K1QA 3BJYA 4QWAA 3UXPA 1COOA 1AROP 4CK2A 5HHHA 3K5OA 4M6WB 2W9BA 8ICQA 4I2PA 5SZTA 4IKFA 3K59A 2ZTCA 3WNHA 3S3OA 5CYMA 1SKRA 7ICJA 4KI4A 1XSLA 4PHPA 2ZD1A 3H4DA 1BQNA 3OYDA 5DB9A 1QLNA 3PR4A 3C23A 4P4MA 2PYLA 1ZQYA 2IOCA 3C5FA 2HNDA 5DGBA 3LZJA 1L3UA 2F1HA 4FK2A 1S9EA 5CYQA 4B9LA 1UWBA 3KTQA 5IINA 2Q3SA 3MR3A 3LP0A 3H08A 4IBNA 4R63A 1RT3A 2A1SA 8ICVA 9ICCA 4N5SA 4O3SA 2D0BA 5J2MA 1RBSA 3BDPA 1X1PA 4GC7A 4RQ8A 4W5OA 5CA7A 4IRDA 4J9OA 3KHLA 1JLQA 4IR9A 3LK9A 4ECSA 5KG3A 1REVA 3KHGA 4JS5A 1MQ3A 3QLHA 2R8GA 1NKCA 9ICEA 5CZ1A 4YR3A 3TAFA 2BPFA 2AQ0A 3Q8QB 3ASMA 4KLIA 4KRFA 5DQGA 4DTRA 2XRIA 2Y1JA 1L5UA 1EP4A 3PX0A 2H5XA 5J0YA 1MU2A 3LAKA 2FPMA 1KEJA 1RT6A 4GVMA 4ECQA 1K1SA 2ETJA 5KFOA 4M3ZA 1A5XA 3PW5A 4MF2A 2HHVA 5CJ7A 5EWGA 4EYIB 2RDIA 2PI5A 2W9CB 4HCBA 4BDPA 1ZQVA 5HBMA 4CF1A 1JLCA 2BKEA 4YD2A 4YFKA 3HWTA 1RXVA 4KLQA 9ICSA 3ZT1A 4NYNA 3AVGA 2FBTA 5EU7A 1VSEA 1HJPA 3ZDBA 1CLQA 5L1IA 3AUOA 3L3UA 3KLIA 3OHAA 4KLJA 3V7JA 3QE9Y 4J2EA 4Z4GA 4N41A 1KRPA 2RF2A 3AO4A 4DLEA 1ZJMA 4HCCA 2B21A 4E1MA 3K5MA 1Q9XA 4FLYA 9ICRA 5KFTA 9ICVA 3HO1A 4QWBA 3T5LA 2BCVA 1D8YA 1RT1A 1ZQTA 4CFAA 9ICPA 2OPPA 4G3IA 5J2BA 4G1QA 4FK4A 1ZBIA 5KRTA 4E7HA 4FJMA 3IS9A 1R0AA 4IQWA 4W5TA 5KFKA 2ZUBA 4CEAA 1ZETA 1UA1A 4M3RA 4M3UA 3JPOA 3QEPA 1RDAA 4K4GA 1HYZA 5DMRA 4DTXA 5KG6A 3V7KA 8ICKA 1JKHA 5E41A 4CF8A 4AHTA 3HX0A 3NCIA 3B6OA 3V6HA 2IGIA 3LANA 3GV5B 5D49A 3T5JA 4KLGA 1TKXA 5J2PA 3AVBA 8ICTA 3TI0A 4CGHA 1S9FA 3FDSA 4TUPA 2XC9A 1WCNA 4DOBA 4DSFA 2O4GA 1KDHA 3QESA 1ZQOA 3SI6A 1W9HA 1EX4A 3H8SA 3C94A 3SPYA 1T03A 5CY4A 4ID1A 4P2HA 1FK9A 4QW9A 2OPRA 4W5QA 5KFRA 2HNZA 4HUFA 2PFNA 4YXMA 2O4IA 1S97A 2QXFA 3DOKA 3IAYA 1KFTA 1HYSA 1U4BA 4PUOA 3HP9A 3N4MB 3V9ZA 4NM2A 3KHHA 4KHNA 1WAJA 3M9OB 4FBTA 2FPLA 4DSLA 1J54A 9ICMA 3V72A 4CECA 2M9NA 5J2GA 2BCRA 3GIIA 4LZDA 4R65A 1EKEA 3C2LA 4RQ0A 2BQUA 3H7IA 3MECA 5KFJA 3QEVA 4JRPA 3SCXA 4CK3A 1JL1A 1LAVA 3WNGA 1WSGA 3A2FA 4ECWA 4Z6EA 4J9SA 4XRHA 4N47A 2C28A 3MR2A 4O5KA 4DTPA 8ICFA 3OYCA 2KQ2A 1LW2A 2YNGA 2ZTEA 4CF9A 3UPQA 1IM4A 4DL2A 2F8TA 1VK0A 1A77A 1XS9D 3LWLA 3S9HA 2V4QA 4CJFA 1CZBA 1IKXA 3TFRA 3RH4A 4M3WA 2BCQA 4F5RA 3QEWA 1UOCA 4MEYA 1SZPA 1BL3A 3VQCA 4B9UA 4PA1A 4E3SA 4J9LA 1XWLA 4F8RA 5C24A 3I8DA 4ECXA 4OGEA 4E0DA 3B6PA 4I9QA 5KFMA 4C8NA 3OSNA 3L2RA 2FMQA 1C0UA 3Q8SB 4EP5A 4F3TA 2D0CA 3MEEA 2HVIA 4ZHRA 5KFGA 4FZXC 4J9NA 2P51A 3LDAA 1QE1A 1XC9A 4FJ5A 5D46A 1IKWA 2C2RA 4TQRA 2BCUA 2G8UA 3BQ0A 4KI6A 2W42A 3NF7A 3RAXA 3RH6A 2MUTA 3MEGA 4UAZA 2WONA 3OYBA 4E19A 4Q0BA 3RMBA 2LYHA 4RQ4A 3C21A 3N97B 4RT3A 8ICCA 2ZQBA 5HLFA 3V6DA 4B9SA 1ZQHA 3RBDA 3QEAZ 3LPTA 4FJXA 3NH0A 1DTTA 2D5RA 4DFJA 1LWEA 5JS2A 3P1GA 4LSNA 3V6JA 1U9LA 2XCPA 2XO7A 5J29A 3DM2A 1S6QA 5HRRA 1ZJNA 4C8MA 4MEXA 4KB1A 3RJJA 2OPQA 4FLWA 2EX3A 7ICHA 1ZQKA 3RB4A 3LPUA 3RRHA 4J9PA 3MGIA 4Z4HA 1KVCA 4KMUA 4DS4A 2D0AA 3QETA 4DS5A 1KVBA 4KV8A 4Z6DA 4RW6A 4QAGA 2RPIA 1L3VA 3ISCA 1Z3EB 3KLGA 4FJHA 4GXJA 3PO4A 3HYFA 3D45A 1ZQEA 4F4WA 1IO2A 1XI1A 3P83D 3GIMA 3OY9A 2ZJAA 3VQBA 3TAPA 4Q5VA 4DU1A 3KD5E 3GIKA 4F4YA 3DLBA 1D5AA 4FJLA 4B9NA 5DB7A 2ATQA 1WSEA 1MSWD 2F96A 4I9LA 1TL1A 3OS2A 2BANA 3K75D 2FBVA 2AGPA 1IKVA 2OPSA 1A5WA 3CYMA 2RKIA 4LSLA 5KFZA 4YFUA 1VSMA 4QZAA 4FJ7A 4CESA 2W9AA 3HW8A 2PFPA 1S1WA 9ICAA 5KRSA 5L1JA 3ZSZA 1J53A 2KZMA 1L3TA 5KG5A 1RT7A 4N56A 4FJJA 1PZNA 3C6TA 5L1LA 4CE9A 3LAMA 4CEOA 4CEQA 2BQRA 3CM6A 4CFCA 4YN4A 1ZQIA 4IRKA 3C1ZA 4GXIA 3ZDDA 3ULDA 1NKEA 3AO5A 4I2IA 2KFZA 1ZQZA 4DL5A 3SNNA 2Z1GA 7ICUA 4Y1CA 1HMVA 3C6UA 5KG2A 5KFEA 8ICEA 1LW0A 1BI4B 4BXOB 4YP3A 3MFHA 4IFYA 2I5JA 1TVRA 1GOAA 2HHWA 2VG7A 3FFIA 5C42A 5HRPA 4NLKA 4I2GA 3RB3A 1RNHA 4R5PA 4F92B 5J0SA 4TSXA 4M9JA 4OKJA 5J2FA 1RYRA 2Z1HA 4YMNA 3QIOA 1ZBLA 1V9PA 3ZDAA 4UB4A 8ICIA 7ICGA 2WTFA 4NM1A 1YT3A 1U47A 1RZTA 2ZUCA 4CEDA 4DMNA 2GWSA 3DRSA 2HNYA 4RUAA 2YNHA 2HHXA 4K4HA 4CERA 1SKSA 4O3QA 4R64A 4IQUA 2P5GA 3ZT4A 3OJUA 1ZQCA 3KLFA 2UVUA 1TGOA 3MDAA 5IIKA 1UT8A 3KHRA 4M6WA 2W9BB 1RBUA 4FJ8A 1ASVA 2UVWA 1S0NA 4DQIA 3H8WA 4ZH4A 5HMLA 1TK5A 4IG3A 5DG8A 4HHTA 4KHQA 3SV3A 1ZQAA 5DLFA 4O3PA 1C0MA 4FO6A 4O3NA 1SL2A 4GMJB 3RR8A 1BCMA 1LWFA 2G8HA 4OVLA 4AH9A 3MDCA 4FS2A 4KTZA 4KLSA 3ZD9A 3RAQA 4KLDA 1D9DA 3ORYA 3MBYA 3IM1A 3ZSRA 3RJGA 2NRVA 3AA2A 3MXIA 2NRWA 2GV9A 4CJVA 3OSPA 1BPYA 1TKTA 2A1JB 5KFWA 5DB6A 5KFQA 4DLGA 4BGDA 4CCHA 3RH5A 1RTDA 4RQ5A 1ZQFA 3ZSOA 1VSDA 1J5OA 4Z4IA 1I39A 1WSHA 4J9MA 4CJRA 4F4KA 4YMMA 2Q0ZX 2PY5A 1HJRA 5HRNA 3O3GA 4CJ3A 2PZSA 3NGYA 1UAXA 1Q9YA 5KG0A 1TKDA 4PHEA 5J2DA 3AU2A 3O3FA 1JLFA 3KK2A 2AQ4A 4JV1A 4CJKA 1DOQA 2NRXA 5CR0A 4C8OA 4XA5A 1KLMA 5FRMA 4KFBA 2XHBA 2VA2A 3V9SA 3VA0A 1TFRA 2IC3A 2B6AA 4DOCA 1MC8A 3AVJA 4AHUA 4ELVA 3TAMA 1C1AA 4UAWA 3G10A 3LP1A 4CHPA 4QZGA 4H4OA 1ZBFA 3QINA 4HTUA 5BPCA 3RR7A 2G8VA 4CJ4A 9ICHA 1SV5A 1C1BA 9ICIA 3JYTA 4CHNA 3V4IA 4QZ8A 1RTHA 4HVJA 3K58A 3LWMA 2ATLA 8ICUA 5DBAA 4AILC 3PO5A 4QWEA 1BI4A 1JLGA 1RT5A 4I29A 5KT5A 3UIQA 1Z00B 8ICSA 2QKBA 4YMOA 4O3RA 4M47A 1WSIA 1S0MA 3RMCA 2BE2A 4KKOA 5DQHA 7ICTA 2P66A 1TV9A 1T3NA 3HSTB 3ITHA 3EZ5A 4F5OA 2UVRA 4P4OA 4RQ3A 4NYFA 3NTUA 3MFIA 1TK8A 2OYQA 4M3XA 2AJQA 3DLHA 4YCXA 3TAGA 3NE6A 1U48A 1HUZA 3I0SA 2Y1IA 4R8UB 5KTQA 4I2BA 1Z25A 1WNSA 1JLBA 1WN7A 2Z1JA 1RDDA 5FROA 2JEIA 3H8JA 1KFSA 1A76A 1HQEA 4OPKA 4JWNA 7ICMA 2ITGA 4CGIA 4AHVA 4RW8A 4NLGA 3SUPA 3RJEA 3WNEA 4QZBA 4YNQA 4TUQA 3LALA 3VQ4A 3TR8A 4KHSA 4YR2A 3HP6A 1FKPA 3OGUA 2PXIA 3Q8LA 5EWEA 1RBRA 2HHQA 4ED3A 4RG8A 3PV8A 3T5HA 2YKMA 4O4GA 4O44A 4YQWA 4RPYA 3RMAA 4Y1DA 2VWKA 4UB5A 4DTUA 2KZ3A 3V7LA 3OYAA 3GV8B 4KPYA 4CJWA 4PHDA 3G6XA 1ZQLA 3PMNA 3EY1A 3L2UA 3L2VA 4ZTJA 4MF8A 3ETLA 3M8SA 1NOYA 4CGFA 4HUGA 2LSNA 3V9WA 5J0PA 4NLZA 2DFEA 5KFHA 1HYVA 1S6PA 1N6QA 3SPZA 3KLEA 4DWIA 3D0PA 4F50A 3G0ZA 4JV0A 3VQ5A 3SV4A 2XGQA 3B0YA 8ICLA 3GILA 3ZCMA 4R8UA 2P5OA 4BXOA 4CK1A 3ZSXA 3AVIA 4UAYA 4FM1A 3PNCA 4DL4A 1B9FA 2ALZA 3IRXA 4OKEA 3LP3A 5K14A 3ISNC 1KTQA 5DBCA 3U3YA 4DSKA 2HHSA 4RPXA 4NY8A 4ID5A 3O4QA 9ICTA 1TL3A 2JEGA 1B22A 2KN7A 4RU9A 3HPGA 1RBVA 1JIHA 4M3TA 3CG7A 2OA8A 4UB1A 5HRSA 5J2JA 4DOAA 4NLNA 2HW3A 2BCSA 3BQ2A 2DPJA 2HMIA 1L3SA 3ALYA 1WLJA 7ICQA 1LWCA 4M42A 2RDJA 3PX4A 1NK4A 4F93B 4KLOA 1NJWA 3O4NA 1JX4A 3BGRA 3ISDA 2FPKA 2HVHA 3SI8A 4ED0A 1CXQA 3AVFA 2IHNA 9ICFA 1XHXA 1U49A 1ZQUA 4RQ1A 2J6SA 4XUSA 4Z6FA 2GUIA 3AV9A 4TUSA 4HUEA 4KB0A 2XY7A 4EBCA 3V1QA 5J0XA 4KO0A 1T05A 1S9GA 2VANA 3AO3A 3Q8PB 5HP1A 2NRZA 4O0IA 4ECYA 4ECUA 4I2QA 3AU6A 1XHZA 4OLAA 3MXJA 9ICQA 1O1WA 5HROA 4F4XA 5DB8A 5CHGA 1VSKA 1UA0A 5T7BA 3SUQA 1VRTA 4FCYA 4BWMA 4FZZA 4DSJA 3NH2A 3F9KA 4CIFA 3SQ0A 1G15A 3E2EA 2NRTA 1S0VA 3AVHA 4RW4A 8ICMA 1GOCA 2DFFA 3L8BA 4QCLA 4KHUA 2GBZA 4IQVA 3PY8A 2W8KA 5J0WA 1JXEA 2HB5A 3KJVA 4BDZA 4DSIA 1ZBUA 5J2QA 4M9GA 5KFPA 3IHQB 4CJTA 4DU3A 2AGOA 4LZGA 4DTOA 4M9NA 1RT4A 1CXUA 4B3OA 3OYJA 3Q8KA 1BCOA 5JUMA 3TFSA 4B8AB 4DO9A 3ZSWA 4QZ9A 4W5NA 3G6VA 3Q8RB 3MR6A 3ZT2A 8ICWA 3C2KA 2E6MA 4PH5A 2KTQA 1H38A 5J0QA 1NK8A 3OYKA 5J0TA 4J2BA 5KFFA 1UT5A 4I2FA 3S3MA 3PR5B 2V9WA 3RJHA 3OVNA 5KG1A 1C7YA 1VSFA 5KG7A 1S1XA 3VQQA 1XO1A 4YD1A 4ZTFA 4Q43A 3GIJA 5HMMA 5C5JA 3QEXA 1NOMA 5D3GA 3UQ0A 3M8PA 1KLNA 5KFCA 2MUTB 1SUQA 4QWCA 4QWDA 4KLUA 4Q8EA 4CIGA 3PW0A 1Q8IA 3AA3A 4OLBA 3G6YA 4PHAA 4ED2A 4ECTA 2XY8A 2VWJA 8ICJA 1ASWA 4E89A 1ZQPA 3DRPA 3OS1A 3B0XA 3V1OA 4R66A 4KLFA 3C5GA 1Y88A 4FLXA 3JPNA 2BGGA 3CM5A 1YVUA 4CGGA 4Z4FA 3QERA 1ZQJA 3RJIA 4Z0UA 2IBKA 3AVNA 9ICBA 4CEEA 1S5JA 4DG1A 3FYHA 1X9WA 4CFBA 1NK9A 4FYDA 4ELTA 3RRGA 3AVMA 3QNOA 1JXBA 3K5NA 3TQ1A 2OZMA 1D9FA 2BPCA 3PMLA 4FLVA 4IQTA 3M8RA 3VA3A 3SQ4A 2DTUA 1J9AA 1ZQXA 8ICNA 1C6VA 1NK0A 4O3OA 4M9LA 4JRQA 3T1AA 4E1NA 2NUBA 3V9XA 5DG7A 3GV7B 3K2PA 5FDLA 3M9MB 3LP2A 4K8ZA 4K8XA 2C2EA 1VSLA 4DL7A 4CIEA 1RTJA 4UB3A 4RQ7A 3VQEA 1LB2B 5J0UA 4M41A 2W9MA 1BPDA 1KVAA 3HXMA 4E7IA 5DG9A 1JXLA 1B9DA 3C1YA 4WE1A 4ICLA 4B9MA 3NGZA 3TARA 1CZ9A 2JEFA 2FC0A 5J2KA 1NJYA 4I2DA 4DQSA 4M04A 3C2MA 7ICVA 2BQ3A 5DLGA 4UBCA 4I2AA 5CB1A 1IKYA 2P6RA 3UXOA 4CEFA 3LDSA 4F4ZA 4M45A 1CEZA 1LAWA 5KG4A 1BHLA 1T4GA 2UVVA 4J2DA 5D4BA 4YVZA 4FM2A 4BE2A 8ICYA 3EW9A 2FMSA 4FJKA 2EHGA 5I3UA 7ICPA 2AGQA 4JV2A 1RDCA 3AVCA 3F73A 2JZBB 1XSNA 1SKWA 8ICHA 1X9SA 1RYSA 4Z6CA 4RNMA 8ICPA 1X9MA 4BACA 3OYEA 4O5BA 5CZ2A 3MAQA 2JLEA 4J9QA 4H8KA 3SJJA 3NGIA 1BPZA 8ICBA 2QK9A 3M8QA 3QEBZ 4KN7A 1ZQDA 3SYZA 5KT2A 2X74A 3AVLA 1MQ2A 4CJUA 3AO2A 9ICJA 7ICSA 5KFNA 5I42A 2W8LA 1B43A 1JN3A 1N5YA 4OPJA 1RILA 1CUKA 1KFDA 4C8LA 2ASLA 5IIMA 3V6KA 2BHNA 3JPQA 4MFAA 2E6LA 3NFAA 1NK6A 3QZ7A 4TURA 4QZHA 3K57A 3DLEA 3C95A 2PI4A 4CJEA 3H4BA 3JPPA 2OWOA 4CHZA 4DL6A 3KK3A 2ZTDA 4CF2A 4KTQA 3K5LA 4CEBA 4O9MA 3HK2A 3THVA 5KFYA 1U45A 3DRRA 3PW4A 2P6UA 4YXJA 3U3GA 1S1VA 9ICUA 2ISOA 7ICOA 5FRNA 2VA3A 4ECRA 3V1RA 2A1JA 4KLLA 4CEZA 5J0RA 3EPIA 4M0AA 4CHQA 4F2RA 1A5VA 2JEJA 3OJSA 3OHBA 2FLPA 4O5CA 2OZSA 1N56A 4CJ5A 3NBPA 4Z4CA 2B4JA 1DLOA 1C0TA 4LH5A 1WAFA 4EYHB 4FS1A 4NCAA 1RPLA 4CJQA 2JGUA 3PW2A 1WSFA 4NCGA 4DU4A 2DFLA 4EZ6A 4DF4A 1ZQQA 3SQ1A 5HP4A 2DY4A 4GC6A 4B9TA 1WCLA 4UB2A 3BQTA 1SL1A 4FJGA 4PGQA 4KHWA 4XQ8A 4DFKA 7ICLA 5KFUA 2R7YA 2R8KA 4DTNA 3DYAA 3DLGA 1HPZA 3VQ8A 4L8RB 3JPSA 4X5VA 3QIPA 3GFKB 1ZQBA 1BVSA 2V4RA 1S10A 4EZ9A 3JSMA 3HM9A 1RDBA 2VA8A 2P1JA 2R8HA 4B08A 4TQSA 1IXRA 4PGYA 4KHYA 1TAQA 2E4LA 8ICAA 4DFMA 3SUOA 5IIJA 3HPOA 2IS3A 4QZIA 3I0RA 4EBEA 2W9CA 3OYIA 1NOZA 4EEYA 3ISBA 4Q45A 4RQ6A 2ZE2A 1QSSA 2KW4A 3VQ7A 4FJIA 1RT2A 4CGDA 4FVMA 4F5PA 3RTVA 3T3FA 3AVKA 3ZT0A 4PGXA 4F91B 1QSLA 3M9NB 4CHYA 3MABA 1ASUA 5KGXA 3OYMA 1QS4A 5C25A 1RTIA 3HJFA 2YNIA
chains in the Genus database with same CATH superfamily
4JS4A 4O0JA 5E3AA 3OYLA 2RQ4A 4X66K 2WOMA 5AQWA 1K8AT 1XNQF 4OD0A 1O8BA 1GMUA 2MQ8A 1X4AA 3QXGA 2FJDB 4X4TA 3R7SB 1TR0A 2FMPA 4FWOA 1FT8A 4BE1A 4FXDA 3QRQA 2MQLA 4BUGA 4TKTA 1HNVB 1GK8A 3CCVS 3ZT3A 3HPHA 4JI6F 3PX6A 1OH5A 3NGDA 3I5BA 3G82B 4QIWC 1LW0B 2M0NA 3MUMP 1E6VB 3E9OA 2W54A 4PWWA 1SJ1A 4QW8A 1XNQJ 2IHMA 5HAOA 5L9XA 2QL5B 9RUBA 1SQGA 4RWWA 1S6OA 1QHAA 3I4PA 5J1EA 2I9GA 3MMCB 2HIYA 5JMVA 4P0PA 1UP1A 1WC1A 3KJQB 2WB1C 2MQNA 4LBPA 1GAOA 5G4DA 2BV3A 3DEEA 4DV7K 2DFHA 3NS7B 5AQLA 2NYHA 1VIOA 2FDNA 4HYKA 3D1QA 4DV0F 4UW2A 5DKWA 3DMJB 2IYGA 2DTJA 4KLEA 2X6NA 5E84A 4BREA 1LEOA 1BO5O 2HBYB 9ICWA 4LF9J 3QMQA 1DY3A 3C6AA 4TLQA 4CJPA 3CMES 4DSEA 1VSIA 3ILJA 2QGFB 4A8MP 1NMDA 2Z2YB 2DT9A 3PUFA 2YPYA 1K6YA 2HBZB 2POKA 4K41A 1I94J 3SZ2A 2VQEJ 1VHXA 4AXJA 3KLHA 2G07A 2E20A 3EE3A 2AD9A 2HFVA 2R7WA 2HGLA 1W97L 4LF1A 1R8AA 9ICNA 2DF4B 4BGBA 1KSPA 3TPQA 1HNZK 2KHVA 4L72B 4I4BA 3BF4A 2LQ8A 4LF6K 2XSJB 4IFVA 2HPUA 4BS2A 4FKXA 1GLLO 3TAEA 4DUZK 5ADXA 5J0OA 4QPXA 4F5QA 2ACYA 3D2WA 4ED5A 4NWBA 2HS0A 4LY7A 2ZUGA 1U1RA 2R8JA 5ALOA 3D0IE 3EWGA 1P7DA 8ICOA 5KGWA 2BMBA 5LMUK 1FXLA 3WKBA 3HVWA 1F9FA 3D7SB 4F5NA 5D78A 1TL1B 5KFSA 3ZD8A 2ROGA 2AMCB 2CPFA 1U04A 4I6YA 5HATA 3F0NA 3UCZP 3E01B 2HZAA 2BW7A 1RSCA 1IH7A 1N5XA 2HS4A 3P5JA 2LDYA 4KITB 4BRNA 4RUBA 3N7SC 2P9EA 1EQYA 3US5A 1S5ZA 5DBBA 1HQEB 2D3DA 1ILYA 4LSNB 5LMNK 1MMLA 2AJ0A 1W25A 2KN4A 5AE2A 1UPPA 3WNFA 1ZQMA 2QMUB 3VN5A 3VGKA 5AQFA 3O9UA 2RQCA 1FFVA 1URNA 4WYLA 2MJUA 2NYVA 3DU5A 4ILHA 2D1CA 2HQIA 4EK2A 3MMCA 1F0XA 2ZH5A 4KX3A 2RN2A 3QJJA 1MN7A 3RU0A 1EO1A 1NGEA 5BOMA 4AHSA 2GO7A 3ITHB 3GDXA 1WG1A 2K7KA 1YHQS 1S0OA 1NJIO 3MX5A 3Q89A 3ZZYA 4CJSA 3NS1A 5KFVA 2FBXA 4FZYA 4QZFA 9ICGA 2P2CB 4IG0B 2DVIA 1GMVA 2UUCJ 1S77D 5E3PA 1Y11A 2Q0RA 1ZQSA 4MO4A 1SL0A 3WK6A 2DGSA 2LKZA 3C3LA 4KN4A 3SSQA 2OYYA 4MIBA 3ATVA 4E8UA 1RCHA 2N3LA 4EHUA 2F40A 2ASJA 4KKOB 5RUBA 3OS0A 1J5EK 5AXKA 2ADBA 8ICRA 1TE2A 5J2EA 4OHZA 3WBZA 3VWSA 3CJ3A 3TVKA 3K4GA 8ICZA 3MN7A 4CZMA 4AQYJ 1IBLK 3CJBA 1AFJA 3HSZA 2EZXA 5GMKa 1RLDA 2YNIB 2RQMA 1RWOB 1PC5A 2XGPA 3NH1A 5ALJA 1WNEA 4QZEA 2FTRA 2YY3A 1CJKA 4X2BA 3EWAA 4IO9L 5DDYA 4ZVQB 5ETVA 5CWRA 2EAPA 3HJEA 1IV8A 3AVAA 4WWSA 5D4LA 2PAVA 1SXLA 4JKCA 1WHWA 2FJVA 1DHMA 2QC3A 2BJDA 3Q2SC 9ICOA 4DQPA 1ZBTA 4DPYA 2GWKA 1ZQNA 1S72N 2F4VJ 3M05A 1WEZA 3NDKA 3DOMA 3LYSA 1AZSB 4C48A 5KL1B 3ZSVA 4CGJA 3CFOA 2G8WA 3NLCA 1OS5A 3R5DA 4HL9A 4IXCA 4KLHA 3TWHA 4KHMA 2XMVA 3UDCA 4J9KA 1X0FA 2GIFA 1SC6A 2L5YA 3HD1A 3TANA 3THYB 2YHBA 4TLRA 3Q8VA 4ZN1A 5AK3A 3SAFA 3TOQA 2HRTA 3J80Y 2RRDA 2JZBA 3SR6A 5B09A 4FLZA 3AA4A 2AU0A 4AM6A 2QTWA 4GLXA 3EXYA 1Y97A 2JC1A 4CBXA 5ETNA 4CYUA 1NM2A 1QM9A 3ATUA 1C2PA 3VAKA 1JLAA 4NXZA 1BQXA 2C42A 3QO9A 2VU5A 2VICA 3HKZF 4ETXA 1RTJB 2W4DA 7ICFA 3NBPB 3QNWB 2OTLN 3VQ6A 4EP4A 2WONB 1F3VA 3VQTA 3QRPA 1K9MO 2RQKA 2XZWA 1QHTA 5L46A 2IA6A 4X65J 3HL8A 2B6GA 3UQ2A 4IFYB 4IDHA 1KAZA 4I2JA 1NK5A 1RT5B 1A7GE 2C2KB 1YBUA 2ZKTA 3MXHP 3VEXA 1RAJA 3N0VA 3WXKA 1COOA 2BJ1A 2A18A 1W2BR 3ENOA 1SJQA 2Y1RI 5SZTA 3K59A 4ZCMA 3R27A 3UDEA 5E3QA 4UW9A 2HKEA 4F4AA 7ICJA 3H4DA 1PYTA 3PR4A 3C23A 4NRTA 3I56N 3QGIA 4CDGA 3KHYA 4KRWA 3A1YG 3LZJA 3P39A 5LL6d 4FK2A 1S9EA 4B9LA 1UWBA 3CCMS 2GWJA 2WFAA 1DRZA 1UHUA 3AEVA 5CZXA 1R8CA 4WFZA 1RBSA 3BDPA 2O01C 2GQ2A 3CHWA 4YDXA 4GC7A 4FWNA 3MM9A 4NLBA 3ZNUA 4CZHA 3HSCA 3M2RB 5GAEI 5JXSA 3NVZA 2RUGA 1DQAA 3QU2A 3LK9A 1IG8A 5KG3A 4KGMA 2ZH6A 5CRXA 4JS5A 3GDQA 4F9OA 4JI3F 1K8AO 1YJ9S 2V2QA 4YR3A 5AQGA 3CMEN 4FP9A 4AQYK 4KRFA 1L6NA 2XRIA 3F53A 4C80A 3UR3C 5K4LA 3PX0A 3W64A 5J0YA 5CQGA 3KKAC 1MU2A 2IJRA 2FPMA 5ALHA 5H1SV 2RHQB 3ZO7A 1RT6A 4GVMA 3HRDD 4NXMK 1XERA 2JRZA 1QD1A 1VK3A 4CTAA 2HMIB 5TKWA 1FTCA 4B3MK 4WP8A 2DHXA 1N8RT 4NYPA 4YFKA 2KJ5A 3CJKA 4ID8A 4YHHJ 9ICSA 5BR9A 2KB2A 5GAGI 1CLQA 5L1IA 1ZAXA 3ET6A 3L3UA 1H73A 2UXCJ 3CCJN 1WWVA 2VFVA 3QE9Y 4WFAL 2E1RA 4YY3J 4ANEA 4FWPA 1YVFA 4DLEA 3NNHA 3MECB 2GJ2A 1SZHA 3K5MA 4OPHA 4FWRA 5TISU 2P9IA 1TL5A 5KFTA 9ICVA 1QUVA 3EZUA 2D3O1 3HO1A 3LA0A 3IS9B 3L7OA 3T5LA 3L4BC 2NZ4A 3FBBA 1JLBB 2ZJQQ 3UVJA 2F9JA 4CFAA 2OPPA 1ZD3A 2GHPA 4F72A 3KWMA 2ZIWA 3QWUA 1ZBIA 5KFKA 4LIWA 4B3TK 1RZMA 3LDOA 1UA1A 2E2PA 1LVHA 2UXDJ 4NMLA 1NPRA 3KD3A 1HYZA 3FZMA 1H2TZ 1O6XA 5DMRA 5KG6A 3V7KA 4CD3A 5L38A 3HX0A 3WKDA 4A8KA 2NRHA 3VEYA 2KIWA 4H4MB 4KSEB 1RDWX 3P31A 2FGOA 3GSIA 4XK8C 3MURP 2E5LK 5EE0A 3MM7A 5J2PA 3AVBA 3TI0A 2EFQA 3P5BP 2XC9A 5JLFA 2V63A 5HANA 3BKTA 2O4GA 1NSPA 3AFGA 1QVFR 3UWTA 5IT0A 5CY4A 2O8CA 3C6HA 5J1NA 3GYXB 4B1WB 3QB0A 4KB7A 4ZPTR 1KTVA 5K8PA 5KFRA 1RQ0A 3B78A 4HUFA 5A2QU 3DOKA 2D0PA 3IAYA 4DV5K 1U6ZA 3HP9A 1VISA 3TZYA 5AZIB 4KHNA 1NHUA 1M1KO 1HNWF 1FFSB 3DOLB 2FPLA 4DSLA 1J54A 2PIIA 2M9NA 4DL0C 3IA0A 5J2GA 3A12A 2ZE2B 2W41A 2WK4A 2LA4A 1DQ9A 1RWPB 4A8EA 2BQUA 5ALEA 2YWWA 3MPYA 4JKBA 4CNQA 1WSGA 5DETA 4Z6EA 4XRHA 4OJ1A 3LGMA 1RWWB 3F2CA 4ZLNA 3VAIA 1R89A 5ETOA 2E7WA 3CE8A 2YNGA 4CF9A 3UPQA 2F8TA 4F25A 3NS6A 1YK9A 2W43A 1C1BB 1CZBA 2O8FA 3TW0A 2ROEA 4MEYA 2FSNA 2KHCA 3UD4P 1BL3A 3VQCA 1FX2A 1VQMN 4J9LA 4LFAJ 1BWVA 4F8RA 5AQTA 1Y7PA 4OGEA 3B6PA 4I9QA 2PMZD 3BSOA 3L2RA 3Q8SB 3OLAA 1X3NA 4A2AA 2D0CA 4OI0A 3A3PB 3MEEA 4JKEA 3O9QA 1E6YB 4Y2YA 5KFGA 4FZXC 3SSSA 2J7UA 4Y2QA 3LDAA 1XC9A 4FYYB 4OX9K 4Y2TA 2ESEA 1IKWA 5B8HA 5JVGL 1Y3KA 3MDQA 2O8CB 4IZ9A 4G6VB 4KI6A 3BB5A 2ZBPA 1TUWA 3RAXA 2CQGA 3L9ZA 3NWRA 4GVBB 3B82A 3RH6A 2MUTA 5JVHQ 5L8RC 2OEJA 3CPEA 1VQ6S 3OYBA 4USUA 3WIUA 2BYCA 4ZPCA 2EFGA 4E19A 3RMBA 3C21A 5H9FJ 4RT3A 3KNAA 1J97A 1JUDA 2AF6A 4TVAB 1OQ6A 3BSAA 2EANA 3QEAZ 4OZ5A 5HBMB 4NLDA 1W2IA 3DC2A 5JS2A 1PIEA 1ZTWA 4LRCA 2ABYA 4ZJOA 3FZBA 2XCPA 3C28A 2A3ZA 5HRRA 2W4CA 2QN6B 2YKQA 1JROA 2N4DA 1RHRB 1X6JA 3R8YA 2Q2RA 4WE1B 1NJIT 3RJJA 1S48A 2LXFA 2EX3A 2CVIA 5ALXA 3TZXA 2DEIA 1NI3A 4DI6A 2RE1A 2JOQA 2D0AA 3QETA 4HDGA 4KV8A 2E8NA 2YN4A 4JI0K 4ZIVA 1Z3EB 4AXIA 4ES1A 4FJHA 4GXJA 3ZX3A 3QU9A 4Y28C 3HYFA 1S8OA 3HSGA 3IDWA 1SQKA 4JP8A 2PD1A 2ZJAA 3TAPA 1VQLS 2WW4A 1N33J 5GAHI 1TUVA 3IGNA 1D5AA 3CQXA 2EC2A 3U4LA 5KAKA 5DB7A 2ATQA 4ZVEA 2E2NA 3EX7B 2R7QA 2ZC4A 4C3MA 5A2QY 4B3MF 1TL1A 1Y0HA 3OS2A 2K1RB 2RKIB 3HM8A 5AE3A 3B8AX 4LF5K 2F3JA 5G5GA 1IM6A 2HQ3A 1XMOF 3THWB 4QZAA 4FJ7A 1S1WA 1Q1KA 2C2ZB 5L1JA 1VIXA 2PEHA 2KZMA 1L3TA 4X84A 4N56A 4DPTA 2BVZA 4CE9A 4CEOA 3P4UB 2ZIXA 3W62A 2VJ5A 4YN4A 1BWEA 2H3IA 3ULDA 2HBLA 4Y2VA 3H2VE 4JI3K 2DRDA 4I2IA 3W2VB 4TU9A 1NLKL 3LGHA 3FRZA 3DRRB 3SNNA 3HCXA 2F9DA 4ZVFA 2Z1GA 2EZYA 4Y1CA 4LJXA 4DKWA 4DR5K 2B9EA 3PKYA 1BA0A 3FFIA 2FHJA 2QLWA 5C42A 5HRPA 4K5SA 2XYHB 3FMWA 3D68A 1HWUA 2UXCK 3M6KA 4R25A 1TFWA 3H1VX 3OFHA 3ZEUB 1V9PA 4EI2A 1PK1B 2FE9A 1HBMA 4DV4F 2ZKUA 4CEDA 3O6QA 4DMNA 4QS8A 2HNYA 4DV6F 3RSEB 5ALUA 4WYWA 2HHXA 4K4HA 1R8HA 4B02A 1N6QB 2VIHA 5ALLA 3KWGA 4R64A 3AJ1A 5AXNA 1ZQCA 1CJVB 2R7RA 5FLXO 1TGOA 4DCJB 1RE1B 1FE0A 1M1GA 1UT8A 2W9BB 4FJ8A 2W04A 4JI5J 4EWTA 3BP8A 1PJ7A 4H0PA 3O6WA 2Y0SD 1XMQF 3QMLA 1TK5A 3BKUA 3GOIA 2HIQA 3HHLB 4DR7F 5DG8A 1GLEG 4H5RA 4UQTA 4KH6A 2NXCA 4O3PA 1WOSA 2BOPA 2KOBA 2A10A 2QLBB 4JD2B 3SBTA 3KJNB 2I6XA 2QWPA 3JTPA 2G8HA 4PABA 3CCEN 4ID5B 4FS2A 4ERDA 4KTZA 3I31A 1Y9OA 5LMNJ 4U8VA 4KLDA 2JGAA 3MM6A 1YKWA 3ZSRA 1GTEA 1YJNS 3AA2A 4ED4A 3MXIA 3CJ1A 4JKFA 5DRKA 3I4HX 4TNOA 1KVJA 1ZTTA 1WC5A 3BO4A 3UCGA 4Y2PA 2NLXA 1N36K 4DV0K 5FIIA 4CCHA 1QQOA 9ATCB 1ZQFA 1DGJA 2FVQA 3ZSOA 1FEZA 2FHOB 2IVNA 4J9MA 3GFZA 4U6PA 4F4KA 2XS5A 1M5OC 3DRXA 2BZ2A 4EELA 4O8UA 1PAUB 4C1NI 2DIVA 1RWKB 1CQMA 5J2DA 4C9DA 3VPZA 1IIPA 2GH1A 2AQ4A 4JV1A 3KK2A 4CJKA 3B6BA 4HHHA 4C8OA 2HOIA 1MW7A 1SIJA 1HW8A 4FPRA 5F2RA 3P49B 3H8MA 2XHBA 4YB1P 1VQPS 2B6AA 5B0EA 1CJUA 5BN8A 4OI2A 3MPVA 3C29A 3AQPA 2G1DA 3IG8A 2E66A 2QJ3A 4W98A 4CHPA 2QEXN 4QZGA 1T3OA 4HTUA 4FNIA 4GVBA 5CZVA 5LXRA 4ZIWA 3W9HA 1XK8A 3DI6B 3FCVA 8ATCB 4QZ8A 3N6MA 4O5FA 1N34F 2G0JA 4AILC 5KAFU 1BI4A 1WB9A 2UYTA 3M8QB 4I29A 3ILIA 1Z00B 3DWLA 3T1HF 3DXMA 4WF9Q 1WSIA 2QG9B 5DQHA 7ICTA 4HACB 2MLYA 3LL3A 3ITHA 3EZ5A 1MMNA 3Q83A 4F5OA 4OJ6A 2XO6A 3R1LA 3CMAS 4NYFA 2UZAA 3MFIA 3H25A 5EX3A 3K0SA 4LRDA 3AB4B 2OYQA 1XMOK 5KPZA 4M3XA 4DV7J 4YCXA 3GJQB 4M5IA 1KBUA 1AUSL 4CLKA 1HUZA 2ZJPQ 3VGTA 3CCES 1BNOA 3I76A 4Y6IA 3SXLA 4WZMA 3J81O 1F2GA 2UU9F 3BDEA 3R9LA 1VMBA 3WXMB 3CO0P 3WKEA 3H8JA 4AYBD 2BE9B 4JWNA 7ICMA 4DPXA 1VOMA 4GFJA 5GAEP 4B3TF 2FD2A 4A8SA 3RW6A 4CM0A 3SUPA 1RBAA 4CW7B 3SBGA 3A5OC 1UVKA 4QYRA 3VQ4A 5JICA 1V4TA 4ILJA 5I42B 3OGUA 3IGVA 1NSKL 4GMKA 4RG8A 1WEYA 2DGWA 2XMWA 2JVOA 2XULA 4A8WA 3PYFA 2IM2A 3P96A 3S1TA 4Y1DA 1M6YA 2XMAA 2OD4A 3V7LA 4IO8A 3F5AA 4PHDA 2JWLA 3PMNA 2ZJRQ 2E8AA 3L2UA 3L2VA 4BR2A 1YJUA 4UARA 1XMQK 3U1LA 3W3DA 3CPWR 1DXSA 2LCWA 3V9WA 5J0PA 2DFEA 4OV6A 5KFHA 2HBJA 2J0XA 1WC3A 1HKAA 2LLZA 4Z7YA 4HI2A 3GP9A 2JX2A 3IMQJ 1H6KX 5EX0A 3KLEA 3QWPA 4F50A 3G0ZA 3SV4A 3B0YA 1VBZA 3BM7A 2Y0BB 2D6FC 4UAYA 4FM1A 1QUPA 1F60B 2ALZA 1RUSA 4OKEA 3LP3A 3ZX0A 4A5BA 1NDKA 2Q79A 4BVPA 3LDQA 2HHSA 2ZVSA 1QVFM 4ID5A 1S3XA 2AEFA 4IQXA 2K8BB 9ICTA 4QIWF 2V67A 1I1GA 3GU0A 4RU9A 2OKQA 5E2QA 3GE1A 2YB1A 1W2BM 4OYWA 4LF4F 2HCFA 4NLNA 2ZC3A 2DPJA 2MTLA 3OL9A 1U8WA 5M2RA 1BLUA 3C6UB 3UDVA 1LWCA 3QSYB 3THWA 4DV0J 1FWPA 3TADA 1BUPA 2RHFA 4OI4A 3AJ2A 1K0TA 5E5NA 5J1PA 5FDLB 3UKRA 1VJQA 2JMGA 4BQLA 3AVFA 1JKHB 1MWZA 3M6GA 4OO1J 4BROA 4XUSA 2VD3A 2ZDPA 3AQOA 1Y5NB 5GMEA 4C0OC 2GUIA 3AV9A 2WFBA 2HFZA 1QAJA 2JHDA 3I0RB 4LF8K 2B0CA 4NCGB 4PAAA 1Y5IB 2XSFA 4PYAA 2A19A 1MU2B 5AI5A 1X9JA 1N2XA 3BGLA 4C4WA 4BRQA 5C2FA 5HROA 1CZAN 3SCKE 4WXOA 5T7BA 3SUQA 2W1BA 4WFXA 2E5HA 3HOTA 1WG4A 1TL4A 1FRMA 3NH2A 3QJLA 1DQ8A 2BDUA 4CIFA 1G15A 2YMPA 5F8NA 4UUWA 2NRTA 4UOCA 1UVIA 3S01A 8ICMA 4HTJA 4AUKA 2GAHC 4GKJF 3G8TA 5J0WA 2G2YA 4I69A 2RS2A 1GMWD 1SUQB 4NLCA 1VQ8S 1ZBUA 3WQTA 5KFPA 3IHQB 5HJYA 2K3KA 4P2XA 4TYAA 3O9TA 3J7YU 3NCRA 1HD1A 3L09A 5H9EK 4PG5A 4M9NA 4X64K 2RRBA 2I8EA 4ZPVR 4H5VA 2CDQA 3OFEA 3OYJA 1BCOA 2GMLA 1URRA 2XM3A 5JUMA 1QQ6A 1RLCL 4W5NA 2UUAJ 1BG3A 2V4JB 8ICWA 4NA2A 5CAAA 2E6MA 4PH5A 1H38A 4QPTA 1NK8A 5CYMB 5FJ4A 4J2BA 3WQUA 2DR7A 4YOEA 4I2FA 3S3MA 3PR5B 3HDSA 1U1OA 5EGYA 1T03B 4OI1A 3UNYA 4FZMA 3LQVA 2XZDB 2Q1NA 2MZQA 2NPIA 2QO3A 4CRJA 1TMMA 3QEXA 3BGFA 1NOMA 5D3GA 3M8PA 3MEGB 4QWCA 4QWDA 3F2DA 4Q8EA 2JC0A 1FVQA 1X5SA 1D0EA 2O8DB 2PEBA 1P9YA 3NVWA 2AJ2A 1G6BA 2H3GX 2E9TA 2XY8A 4NLSA 2IVYA 8ICJA 3DRPA 1ZC6A 3M1FA 2KRBA 2ATCB 1LFWA 1RHQB 4KLFA 4AD6A 2JVRA 2FDRA 3EE8A 4GRSA 3CM5A 3WDOA 1IBMF 4IOAQ 4Z4FA 1QAIA 2E5IA 3DXSX 2VFUA 2IBKA 4DU7A 1VQ9S 3J7YP 1IXKA 1NK9A 4ELTA 1LW2B 4UOGA 1FK9B 2GW8A 2P9NA 3G96A 2BPCA 1MNEA 3CJ9A 2OAUA 3VEVA 4FLVA 4Y2RA 1L7NA 3VA3A 3NUQA 5EE9A 3SENA 3W5YA 3QLHB 4JRQA 2B43A 4C1NK 4QR2A 3T1AA 1HBNA 3A8JA 5D0EA 4CT8A 4LFBJ 3AB2B 2A40A 4UY8T 3KK1B 4XH1A 5GAHU 2C2EA 1XNRJ 1RTJA 3KJFB 2BBEA 4DV2F 4RQ7A 3VQEA 3ZTRA 2PA8D 1LB2B 2H4YB 2WHEA 1VQ4N 2F9TA 1P9QC 5J0UA 2EVZA 3CDUA 4GVLA 5CYJA 4IKAA 4F0KA 4EX7A 2QWLA 4JYAF 1SKUB 1BPDA 3HXMA 1KVAA 4E7IA 5A0YB 1JXLA 3DHWC 1B9DA 1HIYA 4QIGA 3A8EA 4ICLA 1FNMA 1X4EA 3JXUA 1CZ9A 2G0AA 3CTRA 4YDUC 5GIOA 4LR7A 5IT4A 4WU3A 2GZOA 4OX6A 2BQ3A 5DLGA 2UUBK 4I2AA 2VF3A 2CJ9A 1ATRA 2ZGZA 2IC3B 3UXOA 3AXKA 4F4ZA 1RT6B 1BHLA 2N7YA 4LVOP 3AXMA 5GVQA 1RGVA 1U7LA 2VPXB 2LYVA 5HI7A 3LVVA 4O23A 2AX1A 8ICYA 2P9IB 2FMSA 2E5LJ 2V68A 2EHGA 4JB8B 2CPJA 5I3UA 2VDIA 3C0BA 2AX0A 3F73A 4FN5A 1J5EF 1SKWA 1FFUA 4H0VB 2ZOFA 2H5IB 2DNKA 2ZOMA 4CZLA 3U7JA 4O3MA 4EMDA 5IC4B 4J9QA 5H1SQ 5D0HA 1BPZA 3KZXA 8ICBA 4I67A 4ISGA 4KN7A 2CGKA 3NRWA 1PVPA 1CQNA 5KT2A 1N60A 3CJ8A 2X74A 1R0CB 3CCRS 2CQIA 1MQ2A 1HKBA 1T6DA 4BRPA 1KAYA 4MN4C 4IJAA 1KC8T 2Y1LB 4OPJA 3DLGB 4KHPF 1ITPA 2BHNA 3DLLQ 5HVGA 3QZ7A 1RHKB 5E0OA 1IWGA 2AJ1A 1T6CA 4QZHA 2NUUG 2HOFA 3LO3A 1KEKA 4NEYA 4DL6A 4RL1A 2ZTDA 4KTQA 1WDDA 5AQRA 3L4IA 2ZF5O 2E7VA 2Y3YA 5KFYA 1HHQA 1YZ6A 2P6UA 3FGVA 9ICUA 2YCHA 2RT3A 4WP9A 1VR6A 3BS7A 4DX5A 4CHQA 2DNNA 4F2RA 4ZVRB 2FJAB 2OZSA 3IBCB 3IAM9 2UUAK 4CO4A 4CJ5A 1EKSA 3R5AA 2B4JA 2CH6A 1SZ2A 3OTQA 4JBCA 3D7EO 1WAFA 1RDUA 4EYHB 1LWFB 4P2FA 1RPLA 4CJQA 4IFVB 1P1TA 4WKRA 5F0UA 3M6ZA 2ZITA 4DU4A 1M0SA 2V69A 2MRLA 3P45B 1VBKA 2ZM6K 2BKNA 4OQJA 1IWAA 3HF5A 2CJBA 4WJBA 4NL9C 2FHKA 2N82B 4B9TA 3BQTA 3R9KA 4UT4A 5BPMA 4LRBA 3FSYA 1K44A 2KH9A 4OYIA 2R8KA 2FVRA 2UU9K 3PJXA 1HPZA 2MQOA 2V9KA 2RLTA 3GFKB 1ZQBA 1BVSA 1S10A 4EZ9A 1O0PA 1Q95G 2F65A 1X40A 3LOUA 2X1GA 2OJ3A 1BOTO 4DV3J 4PXEA 1TAQA 1T11A 1JLFB 4DFMA 4MJKA 4O4GB 1VHFA 3HPOA 5LJVA 5D77A 1EARA 2IS3A 1FI4A 3LW5C 4IH5A 3I0RA 2W9CA 5DDQC 1FJCA 1VBYA 3OYIA 3FK4A 4DBQA 4EEYA 3DLLL 5ALVA 2GJFA 3ISBA 4Q45A 2PC6A 2DY9A 1VQOS 3BY5A 1V38A 2KW4A 3POTA 1LQ9A 1RT2A 5LJ3Y 1WHVA 5IT9U 3ZT0A 1QSLA 2DR6A 3VF4A 1QS4A 5C25A 4ZVOB 3O1LA 4PPDA 3VEZA 2QA4S 1SWWA 4DTSA 1ZD5A 1A6SA 2QI2A 3T1YJ 1NZPA 7ICEA 3O8WA 4B8CA 3QUCA 4MH8A 3PG9A 2HBKA 4ED6A 4F26A 1WELA 1WDTA 4LF7K 2DXDA 3VEOA 4FLTA 2OEHA 1KBRA 3RJKA 5ADXH 2CRLA 2VODA 4ES3A 3AAPA 1SXDA 1IG9A 3CT9A 4KLMA 2YKOA 1HARA 2BX6A 4DQ8A 1COKA 1S1TA 3ICXA 1N34K 3QZ8A 3CEDA 4MK9A 2QB0B 2VKRA 4IOCL 4I1TA 4UBBA 1KAXA 1Z2ZA 2IMWP 1DK2A 3CCUN 5CA5A 2C3OA 1B7FA 2YWKA 2FLLA 2MPUA 2XMTA 4H4MA 2VUGA 2CPDA 5DZ6A 4QIEA 1U2FA 1KCFA 2H5EA 1HBOB 3V81A 1JWWA 2HHHK 2E8OA 3H20A 3PIOQ 3KG0A 1PO6A 2CWXA 4IH7A 1D9AA 4JLHA 3M30A 4ED7A 5KFXA 3VALA 4J9RA 1B3TA 4OHYA 1VQKN 2NXNA 4JD2A 1FDBA 2ISPA 2V5HG 4J90A 1TKZA 4NLUA 1G3OA 4B9QA 4FM0A 3FC4A 4DEZA 1HQUA 1N5QA 5BRDA 3BS9A 4PXBA 5HMZA 5E79U 3VQAA 3VQDA 3CCZA 1XU4A 1G1XA 4MKBA 1NJXA 4B1ZA 4LRFA 3FC9A 4WFBQ 4XIUA 2W40A 3DOLA 4U8YA 5J2HA 3AH6A 3QBCA 3SCIE 3FSIA 5LL6Z 3NHGA 1PUZA 1T9WA 3L2QA 4ED8A 4UY85 2MY7A 4DR5J 3J8AA 4HWIA 1EIYB 1QQCA 1FDNA 1ZYQA 1J2MA 2VPWB 4CZCA 2Z2ZA 2YNFA 3CCLN 4N8NA 2YV0X 3EVWA 2GVZB 1Z26A 2WC9A 2XB2D 1ZBHA 4A48A 2X1AA 1YSJA 4EO6A 4ZA1A 3ZSYA 1HIWA 1Q3VA 3NF9A 4E7KA 3X1LB 4BRLA 5FPNA 4UQGA 1JLAB 2LYAA 4Y34A 4LD0A 4OYZA 2KG1A 3D6TB 2IAJA 4KREA 5KT7A 3WC0A 3PIPQ 4BWJA 4Q8FA 2UUCK 4OI3A 3DHXA 1FXDA 2KT2A 1NKBA 3AGKA 2MDAA 2J9DA 5IIOA 3BN7A 4F3OA 1VRUA 1OH7A 4WCEQ 2QFJA 4ELUA 2KV2A 3UXNA 1AFIA 3NAIA 1HNXK 3LM9A 2I1QA 4C0HA 1P27B 5AQZA 1Q82O 2O8BA 3N28A 5SWMA 3SQGA 1T3QA 4TYBA 4JWMA 5AQHA 2UUBJ 4M9HA 5B0DA 2YXLA 4NCBA 2R7UA 4UB8U 5KFBA 4MQ3A 4DX7A 3V4IB 2XY6A 2RHSB 1GNKA 4NB4A 1YBTA 1F21A 3QUQA 5D8HB 1F6TA 3TU5A 5BN9A 3OL8A 4CO2A 2CQCA 3BF1A 4DCOB 3FRYA 4KAZA 1OO0B 3ZEUA 4ICLB 4RW7A 4KX5A 5CP2A 2G8FA 1CSJA 3MGVA 2J9CA 3QNNA 5CCMA 1VSJA 2AKWB 4JKGA 2F5GA 5ETPA 5A6PA 1N48A 4PQUA 1BIUA 5HHIA 4CFDA 1H2VZ 2W2MP 4KH0B 1X4FA 5EOZA 5DO2A 1YJTA 3OR2A 5KT4A 3RBZA 3DLKA 4ECVA 5JU5A 2W3SA 2WF6A 1UPHA 1RB0A 3K89A 2ALYB 1KQFB 4K0KJ 3CF5L 3J7YI 1QY7A 4M2YA 3HMJG 4JI8F 2CJYB 1U2RA 2PFOA 2WSCC 4BDYA 1YXQA 2J0SD 4FLUA 2WB4A 1HNXF 2PKEA 1IBLF 4CF0A 4PWUA 4MFFA 2FZCB 3TUZC 4Q44A 4MIAA 1BPBA 3K1ZA 4ENOA 4HR2A 4RU2A 5AKZA 3C19A 3MM5B 4N76A 3EEQA 2QKKA 4LJMA 4DL3A 4KT0C 1FDDA 5DK5A 1QSYA 3AHPA 5EY4A 4LBIA 3OTEA 5AIAA 2AIRB 1RXWA 2O8FB 1NNLA 3UI3A 4B9VA 4I27A 4H0TB 1BUXA 1TVAA 4RW9A 1VLBA 3KIOA 4I2CA 4E7LA 2F8SA 1B99A 4CD1A 2XYPB 4I6AA 1N4LA 3BQ1A 4USVA 3DI6A 4X4OA 3N5FA 4JUZA 5BRHA 2XI3A 2XZTB 2P9LA 5EUHA 2O67A 3TAQA 3QT7A 4DUTA 2HHUA 4U7CA 3BZCA 4Q7AA 1EETA 4CDIA 2MY8A 4C6AA 1NUEA 4I7FA 5BOLA 2Q1LA 3AO1A 3HT3A 2W7AA 2X78A 1NJZA 2R3VA 5J1EB 1T8EA 2Q43A 5GAHP 4TY9A 3SQ2A 4C8KA 4QOTA 4BRHA 3THTA 4C0ZA 5HQMA 3CJAA 3KLIB 2C2MB 4IG3B 2B4OA 2I2YA 2CQ0A 4YS2A 4MT1A 1TK0A 2FF3B 1QQ5A 2R2UA 1ROFA 3D3CJ 4UATA 4UF4A 4BRMA 2A1RA 1YTUA 3RMDA 1T9XA 4BRDA 1H1VA 2XNQA 2KZZA 2CUYA 5KFIA 3ZNJ1 3OTDA 4PYDA 2YBVA 4WKYA 1RHJB 3PW7A 5KI6A 1EJ7L 3HHEA 1BPEA 5DQIA 2VFSA 2IDOA 4K8RA 4FWSA 4FZNA 4LF5J 2EI5A 2AXTU 2KRRA 5F3ZA 5AK5A 1UMJA 2OMOA 3UXPA 1T9TA 3DNCA 3M5RA 4AL5A 3WEEA 3K5OA 2W9BA 2ZTCA 5F8IA 3W66A 3VV2B 3QYYA 2BM0A 4KI4A 1XSLA 4ZLLA 2R4FA 1BQNA 3MN6A 2UXBK 5DB9A 4GO5X 2V8PA 4ZN3A 4DUZJ 3C5FA 3RGIA 2HNDA 5DGBA 1IVZA 3W8PA 1L3UA 3SEIA 4YOYA 2E1AA 2E9RX 2HQCA 2FJBB 3KTQA 4JV5J 2P35A 3H08A 1RT3A 3HTVA 3R5BA 3NMUA 2OELA 5J2QB 4O3SA 3QAEA 2D0BA 1WF1A 1N32F 2QTDA 5IWAF 4U7UK 2M52A 1X9XA 4IRDA 4O0NA 2QT7A 1JLQA 3IR6B 4IR9A 2XLKA 5SUHA 4LSZB 4K59A 5DS7A 4QNLA 1TL7A 2L08A 3CIZA 2D3UA 9ICEA 1R8PA 2BPFA 2AQ0A 4B1XB 3Q8QB 2V2VA 1QAYA 1VQNN 3VAFA 4DTRA 1EP4A 3MDFA 2KICA 1J2NA 3AY0A 3BBFA 2XICA 3QU4A 4QYZJ 2I7PA 2ETJA 5KFOA 3M8YA 1QDUB 3CC7S 1A5XA 4MF2A 1R8BA 3QATA 3SAGA 5IQQA 2RH3A 5HSPA 5CJ7A 4BR7A 3CC2N 1B0XA 4C7YA 1TU0B 2H3EB 2YQ3A 4JK8A 4BDPA 5ELZA 4AF1A 5HBMA 2AEJA 4CF1A 4B1VA 1VQ8N 1YTYA 3OTOK 3HWTA 2KXFA 2IIHA 3HVAA 1EP4B 2BJ8A 4ZCLA 3AVGA 5EU7A 2NO5A 2KMDA 2AWZA 1Q3UA 2ZEJA 3KLIA 2YWGA 4DR4K 2A42A 2F8HA 2OTJS 1AZSA 4J2EA 1WC0A 4LFCF 4HCCA 4CH7A 2KHOA 3R97A 4RW4B 3W60A 4FLYA 2CJQA 2U2FA 1S1UB 2BCVA 2QMWA 4X66J 1SH0A 3CUNA 3MMAB 3ENWA 1ZQTA 1KP6A 1RT3B 2BJ3A 5EE1A 3K5PA 1YJWS 3PDNA 1Q46A 3BEXA 2WTUA 3MPUB 5M1KA 3FZFA 4K25A 3IS9A 1R0AA 3OTBA 4OZ1A 4NX9A 1KQQA 4M3RA 4M3UA 4ZLJA 4K4GA 4OHXA 4JI2J 3HOSA 1RTZA 2CZ4A 5E41A 5AM2A 4CF8A 3NCIA 1PBUA 1N5VA 2N4CA 4CF3A 1DTQB 1Z1VA 1P8ZA 1EZZB 4PCQA 3LANA 2IGIA 5D49A 5IV4A 4DDFA 3R5JB 4BC5A 2DXFA 1TKXA 3ONQA 4RBTA 4U7BA 4U95A 3FDSA 4JI7J 3R3TA 5GIPA 2X3GA 2EH9A 4DOBA 4DSFA 1VK8A 1UL3A 2DNLA 4IYQA 1KDHA 2KIVA 3SI6A 1EX4A 1IQTA 2FYXA 1T03A 2LM1A 2YVSA 3RFAA 5CABA 1XR7A 2ZH2A 5IZHA 1ATNA 4B3RF 3L0QA 5AZIA 1WWHA 3G4SS 3VGVA 2QXFA 1FJGK 3H5SA 3UD3P 1KFTA 1HYSA 4DX6A 3N4MB 4NM2A 3H46O 3KHHA 2OFGX 4OJHA 2EAMA 2QARA 1NPKA 4FBTA 3OVSA 4M63A 2FVSA 4CECA 3WIVA 1F5CA 2BCRA 3GIIA 1TFYA 4KYZA 3NVVA 2FC8A 1UVMA 1KL9A 1ATSA 3QEVA 5KFJA 4JRPA 1HHTP 1EKRA 4CK3A 2UXDK 1OPZA 3P6YC 1NB7A 1LAVA 3WNGA 3A2FA 1UWAA 2CWKA 4DV4K 1SV0C 2C28A 3MR2A 5LSOA 2QA2A 4DTPA 8ICFA 4PL1A 3DLKB 2NR0A 4FO0A 1VBXA 3OLBA 4DL2A 3MAHA 1VK0A 5J8YC 3E8OA 1XS9D 3LWLA 4WF9L 4CZKA 1B64A 2V4QA 2G08A 5M1NA 1WWUA 4BBYA 5ETSA 1NU4A 2WF9A 3RH4A 3ZI4A 5I3PA 4Y2AA 5AI8A 3QEWA 2J8SA 3CCWA 3PHTA 2DCLA 4OJ5A 3L4QA 2FC9A 4E3SA 3GB0A 4ECXA 4DR6F 1SC4B 5KFMA 4B3OB 4TU8A 2OM6A 3CJQA 2C3UA 1HKCA 5DM6Q 2PFFB 3QX7A 1PKUA 3GTYX 4ZHRA 3BZKA 1FD8A 4J9NA 2GHVC 4FJ5A 1ECWA 5D46A 2F8KA 2XHCA 3BQ0A 4ZLPA 4WYBA 2W42A 2WCXA 1HBNB 2YX4A 1TYQB 1S72S 2DEJA 4Y3CA 2J8AA 2FUG9 3PSTA 2WONA 4NASA 2N1RA 1HEKA 1FESA 3I33A 5EX5A 2QWRA 2ZQBA 5HP1B 2EWSA 2LKYA 4F3MA 4FF4A 3CJTA 1DTTA 2D5RA 2HSEB 4DFJA 1T94A 1C0UB 2H51B 3P1GA 4LSNA 1S99A 2OCEA 4UZCA 1D8BA 3OPKA 5AQXA 3UM9A 5J29A 3DM2A 1YIJN 1ZJNA 5A76A 4H03B 4LF4K 1OXJA 3GYNA 3N5BA 1OVQA 1JNZB 4FLWA 1BMQB 3F5TA 1C0GA 3RRHA 2DNYA 2RF2B 2B9XA 4J9PA 3MGIA 1M5PC 2EC0A 4Z4HA 2WAQF 3PRVA 3QU7A 3PYEA 2B51A 2R7OA 4Z6DA 4RW6A 3SFGA 4QAGA 1GQEA 1L3VA 3ISCA 3KLGA 3U1NA 1VDVA 4L6V3 2FGCA 3PO4A 1E4FT 3WK9A 4F4WA 1XI1A 4K0KK 2H4WB 2QX0A 3GIMA 1S4FA 3A8IA 4RPFA 4JKDA 1JLCB 3GR1A 2LI6A 3VQBA 3FKBA 3TWZA 1X0PA 3DLBA 2NS1B 2HRYA 1W26A 4K7QA 5IQ6A 1MSWD 2PMZC 4N77A 4LF6F 1G2EA 6FDRA 2KEYA 1N63A 2VG7B 3HHLC 4RQNA 3SDEA 2HSTA 3EKUA 3SAHA 3TA1A 4KHPK 4EUVA 4LSLA 4YFUA 1VLYA 4CESA 2EW9A 1WOOA 3LDNA 9ICAA 3ENVA 3SQIA 4FDFA 4FJJA 5KG5A 3I32A 3S41A 4NLVA 2HG4A 3M6VA 4JI1K 2HF4A 2BQRA 3CM6A 5AK6A 1M5VC 1ZQIA 3UKUA 3QT5A 2EEYA 2K4EA 2BJ7A 4NL5A 1UJ4A 3EICA 2KFZA 4DPUA 1ZQZA 4DL5A 4PG8A 4F71A 2HBQB 4E1JA 3T1HK 5ETKA 2I5HA 3MD1A 3JSMB 1LW0A 4BXOB 2ZBQA 4ILRA 4IFYA 4Y0FA 1GOAA 3PM9A 2HHWA 1KHWA 5AKYA 4NLKA 1X6IA 3IBPA 3CDBA 3RB3A 1V9OA 3PEHA 4F92B 2HNDB 5J0SA 2HURA 4TSXA 3OBWA 1BA1A 2ES6A 1RYRA 3HILA 2Z1HA 3UB5A 3QIOA 4UB4A 1NGHA 2B6AB 2M8HA 3DDHA 3I56S 4ITSA 3M7VA 4H4KA 4G1QB 1U47A 2CJXB 5LMUF 1YJRA 1RZTA 1S9GB 3PFOA 4BX9C 4MDBA 5ALWA 3JTOA 4JN4A 4CERA 1SKSA 5DDOC 4HHUA 4JI6K 2ZIVB 3AD8C 4NXNF 1WUDA 1R0BG 3ZT4A 2CQHA 5AKIA 3SJHA 4FWKA 5KAIU 1YI2S 3G8SA 1CS4B 2NPFA 5THWA 5F1XA 3OBIA 2MXYA 2YJFA 2H48B 4A61A 2Y0SF 3MPWA 1S0NA 3MM9B 4TXSA 4WK1A 4ZH4A 4FWLA 4YB6A 1C0FA 4ZK7M 4B3RK 4IG3A 3NOCA 3IAS9 3L95X 4ZHRB 2QSWA 3ZZUA 3SV3A 1ZQAA 5DLFA 2CXYA 2HWTA 3CNQP 4NI2A 2VQFF 2VHGA 3M2UB 4DR4F 5EOYA 1AXQA 1SL2A 3RR8A 3ETMA 3TTCA 1N61A 4OVLA 2BRKA 3F9MA 1RDRA 1GLAG 1D9DA 1VC0A 4OZLA 2B4PA 3W9JA 2IM0A 3O08A 2NRWA 4G1IA 3TP2A 4DR7K 2JZ5A 3OSPA 3V4MA 2KG0A 3J7ZO 5KFWA 4NI2B 2YI1A 2MKHA 1K9MT 1F5SA 3RJMB 1RTDA 4XDCA 1VSDA 2FHMA 3U26A 1GX6A 5LXYA 2F9WA 1N5WA 2PY5A 2F2AB 1KN6A 3BREA 4PXDA 5JJBA 2MKCA 1FKAF 1TKDA 4IQMA 3O3FA 5C2CA 4FPBA 3CW2C 4K4TA 2HLTA 4C2MA 2WSEC 2ZBCA 1AQ6A 3I82A 5CR0A 2F7TA 2B7CB 4K5RA 1KLMA 3MCAB 1S5LU 2WBMA 3N7PD 2OEMA 3MMBA 4AHUA 5D0RA 1HI0P 1CJTA 3PYDA 3T1YK 2IJNA 4QZVB 3LP1A 2HWHA 1RT2B 3C16B 1BQNB 3QINA 5BPCA 1RGIA 4CJ4A 9ICHA 1LK7A 4K4XA 3V4IA 3I0SB 2VH7A 3K58A 5ALIA 3LWMA 2NQPA 5DBAA 1BC6A 1IBCB 1BXNA 4UASA 3L7PA 3G82A 4DPOA 4F04B 3UIQA 4M95A 3U8XA 1ACMB 2CXEA 2CFXA 3K8VA 3M32B 4M47A 4HTIA 2VBYA 1S0MA 4QR1A 1L7MA 5HR7A 3MAAA 1HPZB 3H6EA 4PG7A 3HKWA 3ADAC 3KUEA 3GIRA 3N6NA 4P4OA 1NDPA 2C3MA 4CQ1A 3WXIA 2D7SA 4BR4A 2IRYA 4LR8A 2YMQA 3DLHA 1YHQN 2Z2MA 2DNPA 3PFEA 3NE6A 4MO5A 1HI1A 1U48A 1R27B 3QGHA 2FLOA 5AKKA 3KKFA 2K89A 2UXBF 1JLBA 2Z1JA 1RDDA 5FROA 2JEIA 2FPHX 1RWMB 1KFSA 2H9ZA 3KLEB 5GAGP 5HL7Q 4WU2A 3FM9A 5A8RA 4CGIA 3SQGB 4AT1B 5GMDA 4NLGA 2DGUA 3ONNA 1Q0NA 3VAGA 3WNEA 4QZBA 4NYOA 1MROB 2LMIA 3LALA 4YNQA 3TR8A 2YHXA 4KHSA 4YR2A 3HP6A 1FKPA 2IFXA 2PXIA 1NGBA 3NNAA 2DH9A 4E2FB 3PSIA 5EWEA 2HHQA 3ZZ0A 3KUGA 3T5HA 2YKMA 5MLCQ 1LK5A 3HHNB 2DBYA 4YQWA 2IRXA 3PSFA 3IV6A 2VWKA 2KZ3A 2CRXA 1FJGF 2QARB 2IY5B 5BYQA 3OYAA 3GV8B 2W24A 3CJRA 3EY1A 5F8LA 3TACB 2CQDA 5B08A 1XO0A 3D0GE 3CIPA 3DAWA 3AARA 4CGFA 4JAXA 4X62J 3SEOA 1ZD2P 4JNEA 4NLZA 1M5KC 3T9NA 3CCTA 2M88A 2PA3A 1S6PA 1XIQA 4P0PB 2DH7A 1M1KT 4CVNE 4DWIA 1YJ7A 2R2RA 1N88A 2DGTA 4JV0A 5A0YA 3VQ5A 3GILA 3R6GB 3OW2M 4R8UA 4BXOA 3EZWA 1VQ5S 4DL4A 3M8ZA 2KU7A 3IRXA 1GX5A 2G5IB 4X4NA 3ISNC 1KTQA 2G4BA 1L7OA 4PKIA 3OQ2A 4F36A 1PJ6A 4RPXA 4NY8A 3C14B 3O4QA 3OXFA 3TZWA 2WAQD 1B22A 5C2GA 3HPGA 1RBVA 3DDNA 2VQFJ 4M3TA 1S79A 2OA8A 1IKWB 1U1NA 1HR0F 3M6UA 2QYCA 1NM1A 3MMJA 1L3SA 4BY9C 1S7HA 1HMVB 7ICQA 3TSQA 4M42A 1ICEB 5FD1A 1DFDA 3CB4A 4R0JA 4BC3A 3PACA 5ITHA 4LF7J 5AQSA 1NK4A 5BJRA 1RT4B 4KLOA 4KY3A 4B6JA 1RAHB 1Q8LA 4M5JA 4PQAA 4NMXA 5T14A 2HVHA 1S6QB 3JAMY 1CXQA 3RVCA 3POTB 2IHNA 4RQ1A 3FQKA 2DO4A 1PCAA 3LUYA 3NG8A 3O8MA 4YOWA 4JI1F 3CJ7A 4KB0A 2HMXA 2XY7A 3T9ZA 2E3TA 1ZM3A 1FFWB 4MIWA 4KO0A 1T05A 3AO3A 5HP1A 3U27A 2NV3A 2EFVA 4OLAA 3MXJA 9ICQA 3DGPB 2UV8G 4KPCA 4PZNA 2ZWHA 5DB8A 4O44B 5CHGA 1WBDA 1VSKA 3ZYYX 4FCYA 5AI0A 1WBBA 1HHSA 2W03A 5AZJB 3SQ0A 1ZZFA 4KHRA 4X4PA 2NZTA 3QBWA 3AVHA 3BPDA 1GOCA 1FO4A 4EHTA 3AT1B 1RHMB 3L8BA 4QCLA 1CS4A 4IQVA 3QFUA 2W8KA 4YY3K 2HB5A 3KJVA 1X5OA 1OJ4A 2LMRA 2DIUA 3QSIA 5J2QA 4M9GA 1MDUB 1UW4A 1CC7A 4DU3A 2AGOA 5AE1A 4LZGA 2UXBJ 2MKJA 1CXUA 2XTJP 2H54B 4DG1B 3QGPA 1CULB 5JLHA 3NCQA 3EXCX 2K1RA 3C65A 4CO0A 2HGNA 4B8AB 5C24B 1RXOB 3BN4A 3G6VA 3Q8RB 2X7IA 4A8YA 5IV3A 5ALPA 4F67A 3OW2R 3C2KA 4JHDA 5J0TA 1KDNA 4LVNP 1UT5A 2Q66A 2V9WA 3TEHB 2CYYA 3RJHA 1HW9A 5KG1A 4DR2F 3H0LB 1S1XA 3VQQA 1XO1A 5DDPC 4YD1A 3DU6A 1ZM4A 3FUYA 3GIJA 3MI7X 5HMMA 2E2QA 4Q0BB 2H3ZA 4WJ3B 5KFCA 3FEYB 2NYIA 2MUTB 7FD1A 4QS7A 4CIGA 1Q8IA 4OLBA 3MTJA 1RAIB 3CI5A 1KKXA 2PBDA 3ELHA 1UZDA 2VWJA 4RNFA 2HBMA 4ER8A 2QE5A 4JB3A 1H0HB 3OS1A 3CCSS 2E1FA 4R66A 2B4VA 3C5GA 2WVDA 4W92B 2BGGA 1HQUB 3D6JA 1VRTB 1IBKK 1M90T 2JWKA 4L74A 4CGGA 3ZX2A 1YQHA 4NE9C 2AYEA 1JNRB 3UN2A 4HT7A 1KD1T 3GSDA 3RRGA 3H5YA 1QAXA 2DR5A 3AVMA 3HSDA 1B0VA 1Q53A 1JCEA 2OZMA 4I7FB 2DRBA 4DR4J 3PMLA 2QFIA 3SQ4A 5KQDA 3IG1B 3MK6A 4DCCA 2NXJA 5F3TA 1NK0A 3HFVA 3PIOL 1ZPVA 2F7VA 1JJCB 4M9LA 3KZBA 3G6EN 2QA4G 3NVYA 2W25A 3GE9A 3QFWA 4I64A 1H3DA 1ULRA 1AUDA 2FXUA 4BR0A 2QM1A 3M9MB 1ZZNA 2M70A 4K8XA 3K0JA 5EDWA 1SQEA 3THXB 2QRRA 4PG6A 1E6YA 4FF1A 4M41A 2FVPA 2W9MA 3HLUA 2L41A 4K2JA 3MOJB 3D54A 5DG9A 4TN2A 4AM7A 2YKPA 2FHJD 3G86A 4EFAC 4OYAA 3TARA 2FC0A 1FE4A 5J2KA 2CGJA 1P6TA 1GLDG 4M04A 2P6SA 3C2MA 3A0BU 4JEPA 4QJVA 4LF8J 4USTA 2CQ3A 3LDSA 1Y00A 4M45A 1LAWA 5KG4A 3U9DA 1T4GA 4J2DA 3ID6A 2BEFA 5T41A 1WOQA 1K5OA 4NL9A 3O9SA 1ZRMA 2QLJB 1H72C 1ESVA 1RAGB 3H90A 2YWHA 2AGQA 2XQCA 4JV2A 1REVB 3AVCA 1UJ6A 1AB8A 4WQ5A 4LF5F 2O8EB 3JS6A 3AODA 4Z6CA 1XTZA 1VAZA 4DV6K 2V7YA 2M8DB 1CJVA 4O5BA 3SMVA 3E1YA 3MAQA 3SJJA 2QK9A 2AZ3A 1MA7A 3RUBL 3DGPA 1I3OB 2XEXA 3IRUA 5CYQB 3AVLA 1NMEB 2LEAA 1JQGA 4CJUA 9ICJA 3NKYA 4A8XA 2CDRB 1N5YA 2RRAA 1L3KA 1RILA 4WCEL 4MYTA 1MROA 4B3SK 1DZ5A 1GXTA 1LXJA 3JPQA 1IJJA 4NLTA 3VVTA 3NFAA 2OHDA 4TURA 3K57A 3JSYA 3WZ0A 3C95A 2PI4A 4DMZA 3H4BA 3CD0A 2AP6A 4TY8A 4LF6J 2OWOA 3H98A 4CWBA 3EJMA 4ZP7A 1O08A 4CF2A 4L73A 4O9MA 4CJ7A 1WC4A 3HK2A 1QZ5A 3THVA 1U45A 2OPRB 2HVEA 3D0HE 4Y2IA 4M5KA 3W2VA 5FRNA 3V1RA 2HDOA 4KLLA 3L3CA 5C0YA 3QICA 3D2EB 6AT1B 3QU5A 3AD9C 3IRWP 3A8KA 1ZOTA 1N36F 3GLJA 4ISFA 3J80U 1GH8A 2VC1A 3CD5A 2IDLA 3GJSB 3CNHA 4FWMA 1RAAB 3GU3A 4FS1A 3MN9A 2EFOA 4M7XA 3PW2A 2DNQA 2YNFB 3SFUA 4LF9K 3EN9A 2P9SB 2DFLA 2PMWA 4I6MA 1U1QA 4KH5A 1IKYB 2I0XA 1T9VA 3W7BA 3UO0A 4EZ6A 2W6LA 5D15A 4GC6A 4C11A 4DV2K 4NLRA 2RU3A 2DHGA 4OL8A 4PGQA 4DFKA 2E1PA 1NGDA 2CQ4A 4ALZA 4DTNA 3TSPA 3SMPA 3DLGA 5CXTA 3JXOA 1YJVA 2EFNA 2MJNA 2JH7A 4NXMF 1RDBA 2R8HA 3AM9A 2XLIA 3CXCR 2CVEA 4QIWD 2E4LA 5I9EB 2W11A 2ZNYA 3RSEA 2FIUA 4DN0A 1NGIA 2NUHA 1FCAA 2F4FA 3UR0A 3U9ZA 4QZIA 2IYIA 3I1YA 4EBEA 4C97A 2MZSA 1OWXA 1NOZA 1WSVA 1B4FA 5FLXU 4M7YA 2MHNA 3L4PA 2GIQA 2G1HA 4RQ6A 3PKMA 2MZJA 2A2CA 3AOCA 3HX9A 3AAQA 4Y2UA 4FVMA 4F5PA 3RTVA 3F5EA 2GC8A 2Y0SC 4PGXA 1Y10A 4CHYA 2L9NA 3MABA 1RTIA 3HJFA 3VZHA 3K9JA 2JLFA 2YNIA 1SJRA 2KFYA 4FK0A 3RB0A 1ZM9A 3O5BA 4YB7A 3D6RA 2YKNB 2AP1A 2OH2A 1RA6A 2HVZA 4NPOA 2F1JA 1MWQA 3GFXA 4ZS6A 4JI0J 4YOUA 4QZCA 2ZH8A 3BSNA 3KFWX 5A8WB 4LC9B 1EWQA 3BH7B 2HZVA 4QBUA 4P73A 1HR0J 1Z19A 1OIAA 5L1KA 1W0HA 1ELOA 4DUYF 4QU6A 5J2CA 3JAMO 1HNZJ 3VAMA 3IUCA 3QEIA 2DHHA 3GQCA 2G0CA 3VOVA 4FJNA 3CD7A 2HF3A 3SUNA 4M3YA 2CJAA 2C3PA 2FLNA 5LOQA 1GLCG 5AQJA 3AA5X 2E1YA 2IAJB 5BREA 5J8YA 5BYSA 1KR4A 2ILYA 4H4OB 5DGAA 2HYIB 4OJPA 3W5ZA 3CQ8A 2G8KA 1S1WB 1Z4OA 4NEZA 1KQSM 1T7PA 1BPXA 1KONA 3I87A 4NO7A 2CPRA 1EXNA 3WEEB 2YQEA 4O5EA 3QUTA 4H5WA 2CN1A 3RBEA 2OPPB 2AYMA 3J81U 2KKVA 2QZ8A 2WUSA 1FJGJ 1FA0A 2G8IA 5DDRC 4MFBA 1PG5B 1W7WA 1RKJA 2BDPA 3NXZA 1HUOA 3ZDCA 2PSZA 3KJVB 4K42A 3QUBA 3CC4S 3V9UA 4K4SA 3DYAB 3Q7CA 4JKHA 1YGYA 4YMEA 5HJXA 5HO4A 2WHOA 4JKAA 3UMGA 2KFNA 3VGMA 5I3UB 2J0QD 1ZXIA 4RO0A 2O8DA 1RT7B 1ZS6A 3W65A 3SK3A 2O3DA 3RB6A 1EXQA 3ZLJA 4USHA 2B56A 2YKNA 3LZIA 4B1YB 3UMBA 3K2YA 5C15A 2J6UA 3ETRA 3CULA 4RPZA 2VCPA 5CCLA 1HBMB 5KFLA 3HVRA 1ZQWA 2R8IA 3OR1A 2HMPA 4CHOA 4CH1A 4PY5A 5IILA 1M5SA 2A3JA 2E9ZA 1UVNA 2LFVA 3CCRN 5ALQA 2PE8A 1I3AA 3L7UA 2ZUDA 4FFDA 4AHRA 2KL8A 2OTJN 4IR1A 3L3VA 1ITGA 4J37A 5HVHA 2IOFA 3M2UA 5BPLA 4MKYA 4K50A 4OJRA 5KFAA 1S1VB 4JI7F 3HHKA 1F5AA 4ZJQA 2FZGB 3KK1A 1DEJA 4PKDB 3BZQA 4RZRA 2BUNA 2QB1A 3ZC4A 2JFDA 3T6JA 2VBZA 3RWUA 1N52B 5DDMA 2IPOB 1HNVA 3AJDA 4WBFA 2Q4TA 2I7NA 2PYJA 2FF6A 2QSFA 4OX7A 3VQ9A 4DR2J 1KXPA 5AHXA 3CC7N 4DF8A 4IG0A 7ICKA 3I6PA 1CI4A 2CPZA 4DOZA 3DMJA 4PUOB 4IEEA 1U25A 3O9RA 1H7WA 3O1WA 3DOKB 3ICLA 3D66A 1WOPA 2P6TA 4NV0A 5IIIA 1UZHA 3R2DJ 2QLFB 4DTMA 1XNSA 2Q3PA 1K73T 3BO3A 4FBUA 4JI1J 4USAA 3MWTA 4UB6U 2VBXA 1KD1O 4I28A 2SXLA 1X4BA 2X6SA 3D9BA 3W3SA 2V8DA 2VC0A 4DHVA 3VQSA 1NZBA 3AL0B 1N8RO 3KDOA 2GV1A 1HNIA 4RNNA 2BR0A 2P9KA 2XY5A 4AE5A 2KVQE 3LM2A 3AOBA 2XLJA 2BTFA 2HFSA 5KT6A 1FWLA 1J5OB 4Q2MA 1EAYC 3OVAA 2GLEA 1XSPA 4IUFA 3T19A 3CWJA 1MN8A 2G06A 1C0TB 1JCFA 4K43A 2FZKB 1VHIA 2K8AA 3TX8A 2EKNA 2X1BA 4DUYJ 1GLFO 2KK0A 3NF8A 5B66U 4RQ2A 3QFPA 5BXIA 4DFDA 4WTOB 2F8EX 3VERA 3R5GA 3LVWA 5J2NA 4ANCA 3QBXA 5C2DA 2DR9A 1BQMA 4EGLA 1WKKA 4JI0F 3BKFA 4A57A 3CO9A 3TAMB 2OSQA 4X65K 3J81Y