1L3VA

Crystal structure of bacillus dna polymerase i fragment product complex with 15 base pairs of duplex dna following addition of dttp, datp, dctp, and dgtp residues.
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*AP*CP*GP*TP*C)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 217
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3vA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3vA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3vA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3vA01
5DQIA 3HPOA 4P4OA 1QTMA 2PFNA 5J2GA 4ECYA 5KFOA 3KIOA 3K4GA 4I29A 2X74A 3HL8A 2R8KA 4O4GA 5EOZA 2DPIA 3U3YA 4O3OA 2Z1GA 2XRIA 1S97A 8ICHA 4CK1A 4YNQA 4CJFA 2FPLA 2Z1IA 4CEBA 1YTUA 1J5OA 3O4QA 4CFCA 4ED0A 5EU7A 3TAMA 4IRDA 4Q8FA 5KFRA 3HM9A 3QIPA 1YT3A 3NGZA 8ICOA 4DFKA 4CCHA 1JL1A 2VG5A 3T5JA 3AVKA 7ICQA 4KLTA 2YV0X 4CEOA 2RN2A 1HQEA 4PY5A 4Z6DA 4AHVA 1ZQZA 2YHAA 4EZ6A 3ZD9A 5D49A 4QWEA 3UPQA 5HRSA 3QEPA 4OLAA 3T5KA 3PW0A 4HCBA 1XSPA 5JUMA 4R64A 1TAUA 4K4IA 4YP3A 4QWAA 4UB2A 3I0SA 1RXWA 3KLEA 3QEIA 2ZJ5A 2KZMA 1BISA 4RW7A 8ICEA 4MEXA 4KLFA 3OYNA 5J0TA 3F9KA 4BXOB 2WONA 5DBCA 2ATQA 1UT5A 3PX0A 1RXVA 3V9XA 9ICUA 3MEEA 3V1RA 4FJHA 5KFKA 3ZT4A 4LH4A 3SCXA 3MR2A 1S1WA 4ECTA 1RT4A 1W0HA 4FBUA 8ICGA 2B21A 3M8SA 2P51A 1KVAA 5KFNA 4Q8EA 4RU9A 3OYFA 4F92B 9ICJA 3L2WA 2XHBA 4DQRA 2H5XA 1WSIA 4KN4A 3AVCA 1JLBA 2A1RA 4DSEA 1WSFA 4AHSA 4DTUA 2Q3SA 4B9TA 1RZTA 3AA5X 2MUTA 5DKWA 3AO3A 3OYKA 3ZT0A 4GLXA 4CJ3A 9ICIA 3V9UA 4J2EA 4CF9A 2BCRA 3SPYA 4TUQA 1WAFA 2VA2A 5J0PA 2HHWA 4I28A 1CZBA 3MXIA 2BQ3A 3THVA 4FK4A 3OYGA 5DDYA 1TKDA 1BIUA 1RT7A 5DBBA 2YKNA 1MQ2A 2HHTA 4LSNA 4CESA 4HUFA 9ICPA 3AVHA 1ZQOA 4Z6EA 4CJRA 3KLGA 4N56A 2HNDA 3L8BA 3AVMA 4LVSA 4KFBA 5D46A 3KTQA 1C0MA 1ZQRA 3ZSYA 1K1SA 4BWMA 5SZTA 2ISOA 4XA5A 5C42A 1KFTA 5L1LA 4E89A 3SUOA 3GIIA 3MR5A 2WOMA 4IRKA 4EBDA 1NKCA 3RR8A 4I2FA 5IINA 3RAQA 3JPNA 4Z6FA 1IKYA 3D0PA 1RDDA 3B6PA 1BIZA 4O0JA 1VK0A 4LZDA 4MEYA 2GV9A 3ALYA 9ICSA 2P1JA 1Q9XA 4K4HA 3V1OA 5DMRA 4IG0A 2BR0A 1JXEA 3V6HA 3ZT3A 4RQ6A 5KG1A 2R7YA 4FZZA 3HO1A 1D9FA 1A5VA 8ICVA 4I2DA 3H4BA 3TFRA 4X5VA 4CGDA 4FJ5A 3NH2A 3NDKA 1TAQA 4F8RA 2W8KA 1T7PA 3TWHA 2OZMA 1YTAA 3AVGA 1YVUA 4M41A 2BQRA 1J9AA 2DFHA 4JS5A 4DQQA 5J0QA 1DOQA 1KRPA 3LDSA 3Q8PB 3M9OB 2B5JA 3OS1A 3LWLA 1NK9A 5KT5A 4FJ9A 4WE1A 4EYHB 4IQTA 3CG7A 4Q45A 4CHPA 4FK0A 3RJHA 1ZQAA 1D8YA 4DEZA 8ICUA 4JWNA 3Q8SB 1HNIA 9ICGA 1UA0A 4RPZA 1RCHA 4CJQA 4CHNA 4CHZA 5T7BA 5J0WA 1C7YA 4YD2A 4KB1A 4J9OA 4CEQA 3C5GA 4KB0A 1N5YA 3UXOA 2KW4A 3CFRA 3L2UA 2A1JB 2IS3A 3S3NA 3JPPA 2P6RA 4Z4CA 4W5TA 3OS2A 3SYZA 3NF8A 3OSPA 4DF4A 3L2RA 4DOCA 3MGIA 1LWEA 2Z1JA 1ZQYA 3RRHA 9ICEA 2G8WA 3AU6A 4KLLA 3DLEA 3OGUA 2RDIA 1KVCA 1RTDA 2IBKA 3H8JA 1I3AA 3Q8KA 5DB9A 4QWDA 1RNHA 5CWRA 2KZZA 1DLOA 4CEDA 1ZJNA 5FRNA 2E6MA 4YCXA 4OVLA 3AVJA 7ICSA 3ULDA 4UB4A 4O3NA 9ICWA 4N47A 4RQ0A 5I42A 4JRQA 1F21A 4IG3A 1TK5A 2DY4A 1T05A 4FLZA 4M9LA 3NH0A 4I2BA 2FBYA 4NCBA 3SUQA 4P4MA 4JLHA 3PNCA 4RNNA 3RBDA 5DG9A 3OYEA 2IDOA 4QWCA 2I9GA 3V72A 4F5RA 3VQ6A 4O5CA 3QEWA 1J53A 4CJSA 4CFAA 3K5LA 4YVZA 5DQGA 3L2QA 4W5OA 1CXUA 2W8LA 3RRGA 1HJRA 3ZSRA 2A1SA 4J9PA 3CFOA 5KFJA 1U04A 2VWKA 8ICYA 3NH1A 1Z3EB 4PHEA 2W42A 4KMUA 4ID1A 1SZPA 8ICTA 3KHGA 3ZSOA 4E7KA 1ZQKA 4IFYA 1ZQUA 2X78A 3C5FA 4KHUA 2BGGA 1IXRA 4FM1A 2ITGA 3VQ4A 2OPQA 4DOAA 2F8SA 5DB7A 4EP5A 4FW2A 2XY8A 3GV7B 1BPXA 4CJ5A 5J0UA 8ICKA 3IHQB 1ZQFA 1B43A 4CHOA 4UB1A 4EYIB 4RW9A 4FM0A 4DFPA 2V4RA 4YQWA 4O0IA 3NE6A 4CF2A 1RYRA 4MFFA 1U9LA 3GIMA 3PX6A 2BANA 2X6NA 4CECA 3WNFA 4R8UB 1A5WA 2IHMA 1JLQA 2ASLA 4Z0UA 3LPTA 2ETJA 2QKKA 7ICVA 1RTJA 4HYKA 1VSLA 5KG3A 2FPMA 1BCMA 4ZTFA 3B0XA 4KI6A 3DI6A 4PHAA 3RJJA 2E4LA 5KFAA 2FMSA 1QHTA 1C1CA 2G8FA 1CLQA 4K8XA 5L1JA 3S3OA 4OLBA 1JMSA 2F8TA 5F9NA 9ICRA 1Q9YA 3SJJA 4PPXA 2KFNA 3RB4A 4CJTA 1ZQVA 4FJIA 2QKBA 2UVRA 1WSEA 3O4NA 4FJMA 2X6SA 1G15A 3MAQA 1FKOA 4JK1A 2YNGA 5HP4A 1X2IA 1KFDA 2RF2A 4M3RA 1B9FA 3PO5A 1TKXA 4UAYA 3JPSA 5KFEA 2KQ2A 4FLYA 3ZDEA 1EXQA 2NRTA 4KTQA 3OYIA 4BDPA 1C0UA 3NF6A 1MC8A 4ZH4A 2XY6A 3QINA 5KFGA 2BCVA 2ZQBA 4DSIA 3UQ2A 1EETA 2YHBA 1NJZA 2P6UA 9ICHA 3RH5A 1D8LA 3RB6A 4M9GA 3UXPA 3ITHA 4TSXA 5E41A 3DOKA 5KG5A 4B3OA 1BQMA 1ASUA 7ICNA 2GUIA 5J29A 1N56A 2LYHA 3HP6A 4GXJA 4EZ9A 2OPRA 3GQCA 4YXMA 1WSHA 4E7IA 1VSHA 4OPJA 4IBNA 1T03A 2PYLA 5FDLA 2DFFA 4DL6A 4B9VA 4CJ4A 3ISDA 4F50A 4Z4GA 3U6FA 2BCUA 3GILA 5J2HA 4L8RB 2ASJA 3F73A 5BOMA 3DM2A 1ZQQA 3TR8A 3C2KA 3ZD8A 4M3YA 1BL3A 3MFIA 1LWFA 3HSTB 3SNNA 1SKSA 3LP1A 8ICMA 2NUBA 3WNGA 1D9DA 3AVBA 3V9ZA 2VA8A 2G8IA 2A1JA 1ZQNA 4K4GA 4GC7A 4KLEA 4QZCA 1EP4A 4E19A 1XHXA 3V6DA 4TUPA 2YNFA 3DMJA 1LWCA 2IA6A 4RQ3A 4KLHA 3M9MB 4PH5A 3RH4A 5I3UA 1XO1A 1LAWA 4KLOA 7ICPA 3SUPA 3ZSVA 4FK2A 5KFIA 3JYTA 4F93B 1L3SA 2KFZA 2PXIA 4FLVA 2AQ0A 3UXNA 4BE0A 2OWOA 4FBTA 3SZ2A 2JZBA 4IR9A 3MXJA 3TAQA 4ICLA 3GIJA 3RJFA 4M9NA 3VQ8A 1KFSA 9ICNA 3BJYA 2D0BA 1QQCA 4B9NA 4B08A 5D3GA 4PHPA 3VQ9A 3ZT2A 2Y1IA 4PHDA 2BDPA 2HHVA 3LANA 8ICNA 4QZ8A 3M9NB 4F3OA 3TAPA 3ZSZA 4ECQA 3IAYA 2Q0ZX 1NK4A 3LP2A 2LSNA 9ICVA 4FS2A 4R5PA 3NF9A 3LK9A 2PZSA 3TFSA 8ICQA 2Z1HA 3LP0A 4DO9A 4KLSA 3PW2A 4DTRA 3PR4A 4R63A 4DTMA 3K5OA 3ORYA 7ICRA 3G6XA 1O1WA 4EEYA 3PW7A 3TANA 4J9SA 4I2IA 4E1MA 4H4MA 2ATLA 5HRNA 1JX4A 4CJEA 4QZEA 1U48A 1Z25A 3TAEA 4I2CA 5J2AA 1BCOA 4RQ2A 1VSFA 2XGPA 5CA7A 2ZTEA 4NY8A 5JS1A 3QNNA 5DGAA 3PV8A 4FJ8A 4DTNA 2VA3A 4LSLA 3T5LA 4NM2A 2BHNA 1AROP 5HMMA 1XSNA 5KFPA 2JGUA 1QE1A 3KLIA 4AHRA 4M6WB 3QEAZ 7ICMA 3LP3A 2P5GA 8ICRA 1JLCA 4UAZA 1ZQMA 2AJQA 2BQUA 1QLNA 1L5UA 3MDAA 3PVXA 1FXXA 3NGYA 2YKMA 3AUOA 4KAZA 5KRTA 3K59A 1HUZA 4FJJA 1RTHA 2XC9A 3MXMA 4QZGA 4M3UA 2PI4A 5CZ2A 4G3IA 3TQ1A 8ICIA 3DRPA 4ED1A 4GVMA 2Y1JA 3HX0A 4DFJA 4ED2A 2OA8A 7ICFA 4NXZA 1Y88A 2R8GA 4J9NA 2QXFA 4CF0A 4FLWA 3AO4A 3E2EA 1H38A 1C1AA 5J2KA 5KFZA 2XY7A 4M2YA 2IC3A 3C1ZA 1T4GA 5J1EA 4P2HA 3SUNA 4YFKA 5KFBA 4I2QA 1HYZA 5HHIA 4DTXA 1HUOA 4M47A 4FW1A 1SUQA 4RQ8A 1JXBA 8ICCA 3DLHA 2F1IA 4DSKA 4KKOA 3IRXA 1RDBA 1ZQSA 4OPKA 4HUEA 4KLJA 3Q8RB 7ICTA 1HNVA 4DU3A 3M8PA 1T8EA 2WTFA 3NF7A 1RT1A 3MBYA 4RW8A 4JWMA 3OYDA 4AILC 2HB5A 1UOCA 2BGWA 4C8LA 1IH7A 1ZQHA 4G1QA 1IG9A 4BACA 4W5NA 4DL7A 4J9QA 5IIOA 4ECZA 4RQ1A 1ZQPA 4E3SA 8ICXA 2PI5A 2FMQA 4GC6A 3C2LA 3RBEA 2UVVA 4BE1A 2HHQA 4HVJA 3VQEA 4HCCA 1C0TA 1V9PA 1W9HA 2C2RA 2V9WA 3PX4A 1TVRA 1VSMA 7ICIA 1WCNA 3MECA 1ZQBA 5J2JA 3ZDDA 4Q5VA 1RT5A 3JPOA 1K6YA 1BGXT 2KTQA 5HRRA 4YMOA 1S6PA 4M9HA 3Q8MA 1RTIA 3V7KA 1HJPA 4I2JA 4J9LA 3OJUA 1ZQDA 3OYMA 4PQUA 2IOCA 3ZSWA 2HVIA 7ICEA 4RPYA 4QW9A 1KCFA 4BWJA 4DMNA 4N41A 5HRPA 5DDMA 3BQ2A 3NHGA 4DTPA 4BGDA 3QEVA 5KGXA 3MFHA 3H08A 5KFDA 2VWJA 4KLIA 4DQPA 3S3MA 3RH6A 1JLFA 1S0OA 4QOZB 4KTZA 4OJRA 3CM6A 1JKHA 4PA1A 1RT2A 3T1AA 4RQ7A 2JEFA 5CYMA 1NKBA 5FRMA 2C2EA 4O3RA 4F4ZA 1D5AA 5BPCA 1NKEA 2V4QA 4ELUA 5KG2A 2M9NA 4QZ9A 2GBZA 1VSKA 4Y1CA 1ZQIA 3MR6A 1Z26A 3N97B 5HMLA 4QZDA 3OYCA 2PFPA 1VSDA 3C95A 1SL0A 8ICAA 2J6TA 2BPCA 3AA2A 1ZQEA 2I5JA 3V81A 1HRHA 4QZBA 3ZDAA 2UVUA 4I9LA 4QAGA 2J6SA 1NOZA 3K2PA 1ZBIA 3DLRA 4PGYA 3QLHA 1BI4B 1KTQA 4PGQA 2DFEA 4FCYA 1TL3A 1RT3A 5DGBA 2HNZA 4BXOA 2E6LA 3CM5A 1VRUA 3KJVA 1RT6A 3ISCA 2R8IA 3TI0A 1DTTA 4F5QA 4MQ3A 4I9QA 4YR0A 4I2GA 1HQUA 2BPGA 4CERA 4O3PA 5J0YA 4N76A 2O4IA 2W9AA 9ICAA 5KRSA 4KITB 4RQ4A 4RZRA 5J2DA 1ZQLA 1QSSA 3RAXA 3K5MA 4CJKA 3JPTA 5C24A 3C6TA 4FLXA 2ZE2A 2B4JA 3G10A 2JEGA 3OSNA 4RUCA 4LZGA 3B0YA 1L3UA 3EW9A 5CR0A 4MF8A 4CE9A 2W9BB 3OJSA 3AO5A 2FBTA 3FYHA 4KHSA 3KK3A 4HTUA 3DOLA 2P66A 2AQ4A 4PUOA 2RDJA 3LAMA 4W5QA 4PWDA 3HP9A 4F5OA 1BPBA 2HW3A 3KHHA 5KFYA 3C94A 3HJFA 5KT6A 4RQ5A 3G6YA 3VQPA 4RW6A 3GV8B 3QZ8A 4Z6CA 4KN7A 4F5NA 3MEGA 4M3TA 3HK2A 4YD1A 1XS9D 1NK7A 4M6WA 4CGJA 2ZUCA 4Q43A 3RMDA 3DLKA 3AO1A 2UVWA 1KVBA 4DL4A 1VRTA 1X9MA 3KHRA 3HWTA 4KLUA 3FFIA 2BCSA 3VQQA 4E7JA 1RYSA 3BDPA 4XQ8A 1TK8A 2O4GA 1UAXA 1SL2A 3C2MA 2J6UA 4YN4A 2I1QA 4DF8A 1N48A 3Q8LA 2C22A 3SI8A 3I8DA 3ZT1A 3TARA 7ICKA 3V4IA 4M0AA 2HMIA 3RR7A 4FJLA 3KLFA 1EXNA 2IAJA 4N5SA 4FZYA 3Q8QB 1VSEA 5DB6A 3K5NA 4EBEA 4DU1A 3EZ5A 3V1QA 1IM4A 4JV2A 3AVIA 1LB2B 4B9LA 2G8VA 1NK8A 5KFUA 1S5JA 5KFXA 4ID5A 2FC0A 5IIKA 4QWBA 3IM1A 3KK2A 3QETA 2VG6A 1XC9A 2BCQA 4CK3A 2HVHA 3HW8A 1WCLA 3V6KA 5KFTA 2ISPA 9ICQA 1BHLA 1ZQGA 2DTUA 3ETLA 4J9RA 3DLBA 3OYLA 5C5JA 1MSWD 4NLGA 1XWLA 5CY4A 4QZAA 1KSPA 1WAJA 1JXLA 4KREA 4JV1A 3T19A 1XI1A 5J0SA 5KFVA 5L1KA 5KTQA 4DSFA 1IKXA 4FYDA 2RPIA 1I39A 3QNOA 4R65A 2KN7A 4Z4EA 4ECXA 3SQ4A 1VSJA 2F1HA 9ICTA 1RBRA 4FS1A 4F91B 5CYQA 3HT3A 9ICBA 4LY7A 4JS4A 8ICBA 3HPGA 3AVNA 3NGDA 3G6VA 3JPRA 5J2NA 4DQSA 4GXIA 4IQUA 2NRWA 3K75D 2IMWP 1S0NA 1SKRA 3OY9A 4NLZA 4ED6A 4KI4A 2R8HA 5K14A 2GWSA 2ZJAA 2PYJA 9ICXA 1Q8IA 4MFCA 1COOA 1FK9A 4EBCA 1HYVA 4E7HA 4CJPA 1BQNA 5EWEA 2ASDA 3IG1A 4DWIA 3PMLA 3LALA 3C23A 1CXQA 1X1PA 3N4MB 1T3NA 4IQWA 4RUAA 1U47A 4Z4HA 1S1TA 4F4WA 5CZ1A 1S76D 1U4BA 4QCLA 2BKEA 3NCIA 2OPSA 3C6UA 5J2BA 7ICJA 5KFWA 4NM1A 4E7LA 4KLQA 5HP1A 1EKEA 1ZQCA 4W5RA 4OKEA 4CFBA 3QE9Y 3RJEA 1TGOA 3QERA 3V7LA 5CP2A 4DFMA 1BVSA 2JLEA 5DLGA 4RNMA 2ZTCA 1NOYA 3ZDBA 3AA3A 3QO9A 2FMPA 4YXJA 1VSIA 3VQAA 4AHCA 2FPKA 3AV9A 2D5RA 2F1JA 1XSLA 4KLDA 3WNHA 4Z4FA 1ITGA 1NK0A 4AHTA 1HMVA 4ELVA 1QSYA 3QEBZ 3V9SA 5HBMA 1BI4A 4ZTJA 4FZXC 5J0RA 5D4BA 3RMAA 4FJKA 4YR3A 3TAFA 3NTUA 4GMJB 3HYFA 2W9CB 3ISBA 4DL3A 4B8AB 3RJGA 4NYNA 7ICLA 2G8KA 4ECSA 1LW2A 4I2HA 3SV4A 4E0DA 4FLTA 4B9UA 4YFUA 1FKPA 2C2DA 4BDYA 2HHUA 4DG1A 3UIQA 4LH5A 4M42A 3AO2A 3V9WA 1NK5A 1TL1A 1LAVA 2W9BA 4CF8A 1LV5A 1WN7A 2XGQA 1Z00B 3VQBA 3H4DA 5DK5A 3VN5A 4CJLA 4YMMA 1S77D 1DTQA 4I7FA 4Q0BA 2FLPA 1CZ9A 4DTOA 3K58A 4O3SA 1IKWA 4M9JA 1S10A 3RWUA 4RNOA 1ZQTA 3T5HA 3NAEA 5DQHA 3OVNA 4AHUA 1GOBA 2FLNA 1WNSA 4HUGA 4R8UA 3QIOA 9ICOA 3L3UA 5SWMA 7ICUA 4IRCA 1A5XA 5BOLA 2HHSA 8ICJA 1EX4A 5DG7A 4FVMA 4H8KA 2RKIA 4J9KA 3GFKB 4GXKA 1RDAA 2P5OA 8ICSA 4PGXA 3OYJA 3V6JA 1NJYA 9ICCA 1JIHA 5CHGA 3LDAA 1Y97A 5J2IA 3H7IA 4KLGA 1WSJA 4P4PA 2XCPA 4JRPA 1ZBFA 5J2EA 1ZJMA 3VQ5A 1TV6A 2ZD1A 4YMNA 4OKJA 3OYHA 5CB1A 1NK6A 4KHWA 1HYSA 3RB0A 4J9MA 4IDKA 1ZBHA 1QS4A 5CJ7A 4FLUA 3AA4A 4RT3A 3G0ZA 1JL2A 3MDCA 1TKZA 1TKTA 2VG7A 4YG2A 4NYFA 3ZSXA 4CEAA 1BPEA 3P1GA 1ZYQA 1RDCA 4R66A 3AU2A 4KV8A 5J0OA 3KKSA 4DTSA 2G8UA 5J0XA 1GOCA 4F2RA 4QZFA 3OYAA 4J2DA 1ASVA 2IHNA 4MFBA 5JS2A 3V7JA 3EPIA 4NLNA 4YR2A 3VQ7A 3OS0A 1ZQXA 3TAGA 2YNHA 3HVTA 2XY5A 5EWGA 4FJGA 4FXDA 1X9SA 3KKRA 4CIEA 1CEZA 4F4XA 4NLKA 3A2FA 4J2AA 3VQCA 3HPHA 3O3HA 3EWAA 3O3GA 3BQ1A 1MU2A 5KFQA 4Y1DA 5KT7A 1S6QA 1S1VA 5DB8A 5J2QA 1B92A 4F5PA 1RILA 4CEZA 1SKWA 5KGWA 1GOAA 2EHGA 4ED3A 3BQTA 4QZIA 3DLGA 3VQDA 3LAKA 5IIIA 2PY5A 3NGIA 4UQGA 1C1BA 3DRRA 1TK0A 1XHZA 3LZIA 2ZUBA 1JLGA 3GIKA 4KPYA 5KI6A 4ECVA 1UA1A 4JV0A 3HVRA 1ZQJA 4CK2A 3KD1E 1BPDA 5C25A 3O3FA 3SQ2A 7ICHA 4H4OA 4IFVA 4O44A 2KZ3A 4LD0A 5KT4A 4Z4IA 5KT3A 2OPPA 5IILA 3E01A 3MABA 4CGIA 3FDSA 2EX3A 3KLHA 3SQ1A 1U49A 3L3VA 3NBPA 1B22A 2YNIA 3DYAA 2FLLA 5KG4A 4B9SA 2D0AA 3H40A 7ICOA 4I2EA 2G8HA 3SI6A 4C8OA 1L3VA 4E1NA 1JLAA 2F96A 2IGIA 3ZDCA 1SL1A 5KFMA 2QK9A 1N6QA 4CIGA 4C8KA 2FBXA 2D0CA 4FM2A 4ECUA 4BE2A 4F4KA 4EP4A 4J2BA 4DL2A 1JN3A 3PW5A 4CGFA 2AU0A 9ICMA 2BE2A 3UQ0A 4XRHA 4RT2A 2JZBB 5L9XA 4CFDA 2ZTDA 2DPJA 3KHLA 4OGEA 3S9HA 5KG6A 1J54A 1IKVA 4CHYA 1QSLA 2VANA 2PFQA 4M04A 7ICGA 3CYMA 4DSJA 4DSLA 4HHTA 4JUZA 3C1YA 5KFLA 5HHHA 3T3FA 1TV9A 3PMNA 1KLMA 2ZUDA 3KK1A 4FJXA 2ZJ8A 4CJVA 4TQRA 1WLJA 2OZSA 1A76A 5HNKA 1XU4A 3M8RA 1ZETA 5KFCA 1ASWA 5J2MA 4MFAA 4UBCA 2W9CA 4DOBA 3OHAA 2NRXA 3ZSQA 4DTJA 3RB3A 3TABA 2W9MA 1B9DA 3IS9A 2FBVA 4FJ7A 2MAXA 4OGCA 5IIJA 5IIMA 1S9FA 4DS5A 1RBUA 4TUSA 4FO6A 4KHQA 4DLGA 2DFLA 5J2FA 2PFOA 2C28A 3L2VA 3OYBA 5HLFA 2ALZA 4NCAA 2AGOA 3SPZA 3JPQA 4O5EA 4I2PA 1LW0A 3VA0A 3RTVA 4KLMA 3PO4A 1Z00A 3AVFA 1ZBLA 3LPUA 4DU4A 2XO7A 3KD5E 5F9LA 4F4YA 1X9WA 4DS4A 1UWBA 4O3QA 1ZBUA 3AVLA 3QESA 4CGGA 1R0AA 4B9MA 2BPFA 4XIUA 3M8QA 3MEDA 9ICKA 1RBVA 4C8MA 1L3TA 1UT8A 5J2CA 4M3XA 4KRFA 2MUTB 3MR3A 4F2SA 2JEIA 3VA3A 4DLEA 4ELTA 3RJKA 8ICLA 4M3ZA 1KEJA 2AGPA 4CGHA 5KT2A 1RPLA 4DQIA 3D45A 4UBBA 4GW6A 4B8CA 4F3TA 3JSMA 4IKFA 3LWMA 3ZCMA 4O55A 5TZVA 4CJWA 4ED7A 4O5KA 1S1UA 4DL5A 5KG7A 4I2AA 3CFPA 1S0VA 1TFRA 1NOMA 3EY1A 1S1XA 1K1QA 3RJIA 3PR5B 5HROA 1ZQWA 3AVAA 4CEEA 3OHBA 1JLEA 5KFSA 3GV5B 3H8SA 1HPZA 5EWFA 5DLFA 8ICFA 3SQ0A 3MGHA 3PW4A 1S9EA 1REVA 3PUFA 4RG8A 4KHYA 2NRZA 8ICZA 3SV3A 1KLNA 3U3GA 1PZNA 2JEJA 3GDXA 3BGRA 5DBAA 4Q44A 4CHQA 1NJXA 4CJUA 2XCAA 1MQ3A 2AGQA 3RMBA 1DGSA 1RBSA 4FJNA 1BPZA 5L1IA 4M45A 3EPGA 9ICLA 1TVAA 2R8JA 4ECRA 4KHNA 5KG0A 1SV5A 4K8ZA 4QZHA 3WNEA 3PY8A 3EYZA 3B6OA 1U45A 3QEXA 4QW8A 2OYQA 3I0RA 1RBTA 3HXMA 1A77A 3C21A 3LZJA 2NRVA 1BPYA 2HHXA 4RW4A 5J2PA 4NCGA 4CEFA 4IR1A 3K57A 5KFHA 4C8NA 3QZ7A 3CQ8A 2B6AA 4XUSA 5DG8A 5FROA 3RMCA 4UAWA 4UB3A 9ICFA 4O5BA 1NJWA 8ICWA 8ICPA 4CF1A 1S9GA 3P5JA 4ED8A 4IQVA 4M3WA 4ZHRA 1CUKA 1WSGA 4BDZA 1C6VA 3H8WA 3ASMA 3DRSA 4ECWA 3NFAA 5KFFA 3BQ0A 3P83D 4TURA 1S0MA 4MF2A 4OKKA 3ISNC 4O9MA 1IO2A 4CIFA 2HNYA 4I27A 4KTWA 4RPXA 4AH9A 4KO0A 4TQSA 4UB5A 1KDHA
chains in the Genus database with same CATH superfamily
4UUWA 2W4CA 3EEQA 4WIQA 4JK7A 4JKAA 1CJVB 4KMOB 3DLEB 4K5RA 2X74A 2R8KA 5BR8F 2DPIA 2BW7A 8ICHA 3M1VB 3EMTA 3BB5A 2DL0A 2Z1IA 3A8YA 4CDGA 1J5OA 4JI5K 4Q8FA 2X1AA 1DQ9A 2YN4A 5KFRA 3HM9A 1VC0A 3J80U 2XBPA 3F2BA 1V85A 1FE0A 1T05B 2KNJA 3T5JA 5AKIA 3AVKA 3S7RA 1HQEA 1RWVB 2VBYA 1VLYA 1TL7A 4EZ6A 1RWMB 5D49A 2KK0A 4FZVA 3UPQA 3FEYB 1MLAA 2MQPA 5HRSA 1HNZJ 4OLAA 5G0RA 4A8KA 2WSCC 1NDPA 2JFKA 1BU6O 4WXOA 4RW7A 3N6LA 4X62F 2ZBCA 2H5JB 3OFHA 1FFWB 2KEYA 3LGNA 5DBCA 3OQ2A 3M7VA 2V9KA 1S6OA 3PX0A 4BR4A 3PXGa 9ICUA 4Y0WA 3G8TA 3V1RA 5KFKA 3QUCA 4JAXA 3VGMA 3JXOA 5B66U 2ALYB 2B9EA 4LF6J 2VJ5A 2AEJA 4C2MA 2Y1LB 2P51A 2QKQA 1XIQA 2ZJRL 5KFNA 4E98A 4F92B 9ICJA 2Z4PA 2LYVA 2DNPA 3MM7A 2EK6A 5CHCB 1FJ7A 2LA4A 2E3TA 4KN4A 3BGUA 2APOA 5EUHA 5AK6A 1M5SA 4RW9B 3ZEUA 4DSEA 1WSFA 3ONQA 4AHSA 3SSSA 4BBYA 1RAIB 1RZTA 4TNOA 3AA5X 1IJJA 3ZT0A 2YMQA 4B1WB 2D6FC 2RT3A 2DH9A 4LFCJ 3TA0A 4J2EA 4CF9A 2RP5A 1HLUA 4TUQA 2VGNA 3KNAA 4UZCA 1CQNA 3NNCA 4KHMA 1PGZA 2ZDPA 5E3CA 1BQXA 3OYGA 1TKDA 5DBBA 1KHWA 1SIJA 4HUFA 4HTJA 3AVHA 4CZEA 4JK9A 4AXIA 4WCEQ 1CJTA 4LVSA 3TZZA 1CJKA 2DO4A 3TR5A 3ZSYA 2EBEA 2HBLA 2VHGA 5SZTA 4XA5A 5L1LA 2CPXA 4E89A 2KDOA 4WFZA 1VFJA 2M9KA 3PM9A 3I55N 3ENOA 5IINA 5EE9A 1FKOB 5A8KA 2E1ZA 4I68A 1BIZA 1VK0A 2BZFA 4WU2A 2I7NA 1GMWA 1VQ4N 5F8GA 4NLTA 2GAHC 3ALYA 2GV1A 2M52A 1VGYA 2CVEA 5DMRA 1FA0A 3OR1A 4CZMA 1PBUA 3B54A 2KYZA 4RQ6A 1D9FA 2MSTA 4I2DA 4CGDA 5B0EA 2W2MP 3EO3A 3UKRB 3CJSA 4F8RA 3AY9A 3DOKB 5ALZA 1BQMB 4A46A 2ESEA 2OZMA 3CMQA 3AVGA 3VGUA 4M41A 3ELHA 2LM1A 1Y5LB 1KRPA 3QJLA 3Q8PB 2B5JA 3ZXWA 3OS1A 2Z0GA 3PFEA 1Q79A 4WFAL 3G2XA 5L1MA 1N0UA 2HBYB 4EYHB 1KOOA 1VAZA 2GH1A 2DITA 4JBCA 5DM6L 1S72N 4DEZA 2PEHA 3W2VB 4A48A 3Q8SB 3WKCA 2HQDA 5LJ5Y 5AKXA 1YJ9S 2DYAA 3SQGB 4KAIA 5ADXA 4OZ1A 1XNQK 3GCXP 4CJQA 3W61A 4CHZA 5J0WA 4KB1A 4LFAJ 4J9OA 3AD8C 4DV5F 3ILIA 5ETPA 4DV4J 3U4LA 5LMUF 3UXOA 1RGIA 1X5PA 2KW4A 2CNNB 1NNLA 3L2UA 2AYBA 3NMAA 5GAHI 3VERA 1IN0A 3ZX2A 4Y2CA 4Z4CA 5IZHA 4W5TA 4B3MK 3V6DB 3IDWA 3DMJB 3BSOA 2UUAF 2KSOB 1QAJA 3SYZA 1APSA 1KQFB 2CG8A 5AE1A 1YRXA 4AL7A 2IVFB 4DOCA 2ZM6F 2M8HA 1LWEA 3R1LA 3CJ9A 1RBOB 2HQCA 2G8WA 5EE1A 1JJ2R 4DR5K 4EI2A 6FD1A 2RDIA 2VFVA 2KHCA 1I3AA 4RWWA 4ZLNA 4CEDA 4DV0F 2V94A 4K4VA 3WK8A 5AI5A 7ICSA 4UB4A 4O3NA 4N47A 5I42A 4DZDA 5DDQC 4JRQA 3TTFA 2P8IA 4IG3A 1TK5A 4RWXA 4CJ7A 2QARA 1HD0A 4ILRA 2IA0A 3J7AP 4B1ZA 5D3GB 5CR4A 3AQEA 2BKPA 4NCBA 3SUQA 3PNCA 4RNNA 3C66A 5LXYA 1AW0A 3VALA 1W97L 1ZTTA 2IDOA 1RBLA 2XICA 4DR7F 4DR2K 3VQ6A 4NLUA 1I94K 3W7BA 5I3PA 3L09A 2CQGA 5AM4A 5DQGA 4RLEA 1YJ7A 4W5OA 3CCSN 2A0FB 4P2MA 1NM1A 1OPZA 4OJ6A 1JCFA 2PN6A 5KAIU 4J9PA 3CQYA 2G06A 1HFEL 2UUCF 2UXCF 4HVZA 3LP0B 2W42A 2V4JA 4X2BA 4O0NA 4KMUA 2UZAA 3RRKA 2OO4A 3ZSOA 1M90O 3OXFA 2OXOA 4EK2A 1ZQUA 2GX8A 5AQIA 3U1MA 4I6WA 3C5FA 3NS6A 1DAXA 1IBMJ 2BGGA 1WC6A 4FM1A 2ITGA 4ZVRB 5IV3A 2MZ1A 2F8SA 4K43A 4FW2A 1P90A 1BPXA 3DKDA 1E4GT 8ICKA 5AQTA 1ZA2B 3SAFA 2YX7A 2MJUA 5HAOA 2VWBA 4OJGA 2ASOA 4TY9A 4FM0A 2DNMA 3C0BA 5F8IA 2JC1A 3AQFA 4L3QA 2KFYA 4CF2A 3CCLS 2K4HA 3GIMA 4CF5A 1W2BR 1U6FA 3GMGA 2BANA 3FZFA 1RDRA 3FMWA 3GFHA 3WNFA 5JTIA 2QTWA 5SUHA 4RBUA 2ETJA 1RTJA 3SENA 2D3OR 5D78A 2P9GA 3IMQJ 3B0XA 4KI6A 2BVZA 2XMUA 2UV8G 4PHAA 2KU7A 2K3IA 2FGCA 4CNZA 2FMSA 2CQ3A 2LEAA 2D3DA 1C1CA 4IQXA 1HNXK 1CLQA 2LYBA 3DRPB 3LYSA 1TYQA 5F9NA 5E3AA 1R89A 4KHPF 3POTA 1RK8A 1XR5A 2KFNA 1VQON 3KZXA 2HWHA 4IS7A 1HBOB 3FK4A 4FJIA 1RCOB 1WKLA 3SCKE 1F5BA 4BR7A 3M32A 4EX6A 5D4NA 3GFZA 1X2IA 3RYLA 2RQMA 4CNYA 1SV4A 1TKXA 1H7WA 3JPSA 3D2QA 3ULHA 3S41A 3NF6A 2U2FA 4KV8B 2P6SA 2ZQBA 3OFFA 2DEIA 3OTDA 1EWRA 2J7WA 2HWIA 4KKOB 2YHBA 1X5TA 3HX9A 4M9GA 3ITHA 3P39A 1L7MA 1ASUA 1Y3JA 7ICNA 2Q6BA 4ISFA 3M1FA 2LYHA 1OKJA 4EZ9A 3W66A 4YOEA 3QU9A 4WXWA 1WSHA 1F3VA 1C2PA 2VUGA 4WYLA 2DFFA 2ES6A 2E8PA 3NVVA 3KG0A 3WXJA 4QR1A 2GO8A 3THYA 4F50A 1YSJA 3B82A 5F2RA 4L8RB 4JI1K 4IOXA 4J8FA 1ZQQA 3CJKA 2KT3A 3D66A 1QQNA 2YWKA 3ZD8A 3K1RB 4JYAJ 1BL3A 2YKOA 2BUPA 4CH0S 3MECB 3SNNA 2P9PA 4DV6F 3LP1A 4LF4F 3HBTA 1CULB 3VR1A 4ZIWA 3I5BA 1PK3A 1S6PB 3AVBA 4PPDA 5ALUA 2VA8A 2G8IA 1BUPA 3EVMA 4GC7A 1EP4A 1XHXA 4DCPB 1OJ4A 2IA6A 4RQ3A 3SDEA 3BUZB 1XO1A 2E5HA 3GSIA 1LAWA 2E8NA 1F3FA 4K4SA 3GLJA 2PMZC 4PG5A 3UR3C 4CD1A 1Z2ZA 4FK2A 2YCHA 3N9UC 2KFZA 1JKHB 1RXOB 2HPUA 2F76X 1GH8A 1RT2B 2MEWA 3UXNA 2KKZA 4CT9A 4BE0A 1WDDA 3N4WA 4ERDA 2G13A 2ZHAA 2F63A 3O9UA 4JI4K 2OAUA 1YZ7A 2KKHA 4JI0F 3RJFA 2V68A 3BJYA 4MO5A 1QQCA 2JH3A 2YB1A 2MY8A 2K8BB 4PHDA 5E7OB 2NQPA 2HHVA 2I5JB 4RKUC 4U96A 3V81B 3ZSZA 4RTFD 2M0NA 3IAYA 3LP2A 1IKVB 3KUEA 2JVOA 2KJVA 3QLHB 2LSNA 1Q7YO 2J9DE 4R5PA 2CZ9A 2WTUA 4CZLA 3CJCA 4IEEA 3FC4A 3HI0A 1RT6B 2IM2A 8ICQA 3D6TB 3JTPA 1DTTB 4DO9A 4KLSA 4UT4A 1UEUA 5GAGP 3KD3A 4ZCMA 1HQUB 2ADCA 3GBTA 3G6XA 5BXIA 2QWLA 2HOIA 1YJNS 3F2DA 4EEYA 1Q53A 4JP8A 5JVHQ 1FJGF 4OHYA 4JD2A 4Y2QA 4JHDA 3C6TB 3ZZTA 3IS9B 4WP9A 3SMZA 3O8WA 2ATLA 1SCJB 2Y9TA 1RLDA 3NAIA 4A2AA 1JX4A 4CJEA 2LXIA 3CCUS 3F9MA 4QZEA 1U48A 2HFUA 1Z25A 1PYSB 2A6OA 3TAEA 4WWSA 1U1NA 2B9YA 1VSFA 5D4LA 2JH7A 2OLWA 5A0YA 5DGAA 4BLGA 3QQCD 3R6MA 4R79A 4LQ3A 2V8PA 4LSLA 3M2VA 3T5LA 8ATCB 3H1QA 1AROP 5HMMA 1UPPA 1ZM4A 1HNZK 5KFPA 2JGUA 4BR9A 5B5EU 3KLIA 3GU0A 1M5PC 3LVVA 3N7SC 8ICRA 1JLCA 1R0BG 2UYTA 4Y0FA 1ZQMA 1Z19A 2AJQA 1KR4A 2CXYA 3C29A 2X3DA 5AXLA 3PVXA 1FXXA 1R8HA 1UVMA 4UOCA 4LF7J 2XSJA 1WC0A 3VAHA 1TP7A 4FJJA 2QJ3A 1V6HA 3MXMA 2O8FB 5CZ2A 1LOUA 4IDHA 4G3IA 2EPIA 3MN5A 1EQYA 3TQ1A 2FJVA 3PDNA 1KC8O 4YOTA 2ROGA 3HX0A 4LF6K 3M5RA 3KLFB 2MQ8A 4C3MA 1Y88A 3D2SA 4LF8J 4IO8A 4OD0A 3QWPA 5AZJA 4XTTA 2G5HB 3H8YA 3F2CA 1WUAA 1C1AA 4M5MA 1UTAA 4GV6A 4G65A 5AFUA 3PZPA 3C1ZA 2MMYA 3EE8A 4C0BA 4P2HA 5J1EA 3SUNA 2O8CB 4I2QA 1HYZA 1Q82O 4DV7J 4FW1A 5IXUA 3NNHA 5JICA 4RQ8A 2CPYA 2CPFA 2K7KA 1X0PA 1R59O 8ICCA 4MKBA 2VQFJ 2N3OA 3PSTA 3IRXA 3R8YA 4A8OA 4OJ5A 3M8PA 2VC0A 4XH5A 2YWEA 3UI3A 4DV3F 3U1NA 2Q0RA 2R7WA 1HBMB 2FHMA 4RW8A 4PXDA 4L6V3 1UEKA 2I0XA 4G1QA 3ENWA 4E3SA 3AH6A 1KDNA 2AJ4A 1OXJA 2FMQA 2MKCA 4C4SA 5CYQB 2R7TA 4BE1A 1PJ5A 1GLBG 3DHXA 1P1LA 5D4PA 1TVRA 1VSMA 2GX9A 2YMMA 3PRDA 2J4RA 3WC2A 4PR6A 5LJVA 2VU5A 1ZQBA 3ZDDA 1RT5A 2N7CA 1N33J 2H3QA 2MQQA 3R1HA 3Q8MA 2E1AA 1J2NA 2RSQA 1RE1B 4PQUA 3MCAB 5K4LA 4V1Ak 1WHWA 4QNLA 2RE2A 2HVIA 3PYEA 2A3VA 1T6CA 2YY3A 4DMNA 3IA0A 4CTAB 4N41A 4DTPA 5K8NA 3MFHA 5EGYA 3H08A 2ZIXB 2GHPA 1TU0B 3BN7A 2AX0A 2Y0SC 4KTZA 4G1IA 3S1TA 3DXKB 1V3ZA 1PVQA 5F3XB 5AI4A 3C6UB 1ZZFA 3M7DA 2RRBA 4UAVA 1NKBA 4IUFA 5BJRA 3KJQB 2C2EA 4F4ZA 1NKEA 4ELUA 3M30A 1H1VA 4DV2F 3ZZYA 4NV0A 3KXDA 3MR6A 1Z26A 3I76A 3N97B 4DUYJ 1DXSA 1ZD4A 2BJEA 3QT8A 2J6TA 5IQQA 5ALRA 4BJQA 4LT6A 1AQ6A 3ZNJ1 4M5LA 3ZDAA 1ILYA 4I9LA 2I7PA 2J6SA 1NOZA 4DV4K 1HBUB 2A3ZA 2WFBA 2W11A 4NXNF 3DLRA 3PACA 2VIXA 3H8MA 5HBMB 1BI4B 1CI4A 5HN0A 1WG4A 5DM7L 2C2NA 2CKWA 5DGBA 3CM5A 2R8IA 1IV8A 4J37A 4F5QA 1NGJA 2R18A 3BF1A 4DCHA 3CIMA 2FXUA 4I9QA 4YR0A 4I2GA 4KB7A 1D09B 4O3PA 2WONB 3P8BB 1IWGA 2VICA 4RQ4A 3MCPA 3O8MA 1MMLA 3JPTA 4OJLA 1HQ2A 5AIBA 2FHKA 1GX6A 5AQZA 3D1OA 1K73T 2F1FA 3EN9A 5HI7A 3OSNA 4LZGA 3KWIA 1IG6A 3EW9A 5CR0A 4MF8A 1JNRB 3DU6A 2GFFA 3FYHA 4AYBC 3DOLA 4TVAB 3OTOJ 3ZZUA 2RDJA 4PWDA 3HP9A 4WTOB 5IWAF 3C94A 3LA0A 4RQ5A 2AWZA 1X4FA 2HZVA 3HZEA 4RW6A 1BC6A 2YY6A 3V2UC 4KN7A 3CTRA 2ZVIA 1N32J 4F5NA 3I56N 3KFUF 4M3TA 2MKIA 1NCLA 2HGMA 1NK7A 3M2UB 3TVYA 4M6WA 3A5LC 2QEXN 4CGJA 2FC9A 1GEHA 5CAAA 3HRDD 3DLKA 1MROB 3BBFA 2F4FA 2K4PA 3AEVA 3SCLE 5MAOA 1VRTA 2RKIB 1HNWF 1HD1A 2BCSA 1NH8A 2B8PA 4FDFA 2FY8A 1IBKJ 1TK8A 2O4GA 3CMEN 2HMPA 1OH5A 1QVGR 3CC7S 3C2MA 1HX1A 1M5KC 5DDOC 2I2YA 4LUBA 1WC4A 4AM6A 3UO0A 2E1RA 1IBMK 3VMFB 3V4IA 2VQEF 4FJLA 1MNEA 4CVNE 3NGRA 2ZD1B 2ZH2A 1Z6RA 3FGUA 3D6HB 4USMA 2ZVSA 1HYSB 4EBEA 3FR0A 3MOJB 3BPSP 3EZ5A 1FE4A 1NZAA 1IM4A 1Q8BA 2LFVA 1LB2B 1NK8A 5KFUA 2E1FA 2D0OA 1TELA 3IM1A 1HHTP 1N5QA 3KK2A 3PCOB 4QIWC 4C0ZA 1YLXA 4MFBB 3NVYA 3ZETA 5KFTA 4OJ3A 4FZNA 1M1KT 3DLBA 3QMLA 3OYLA 5C5JA 2WUSA 4F71A 1MSWD 4AUKA 4NLGA 1RWPB 4NLOA 5ETOA 3H5SA 3ZO7A 1WAJA 2ZJRQ 4KREA 2YHXA 4U6PA 2QZ8A 2QA4G 3DOMA 3BGLA 2R7SA 1FXLA 1Y5NB 1A7GE 1MU2B 5KTQA 4LRFA 4NA3A 1IKXA 2JZ5A 2GJ2A 3GJTB 2CH5A 3W3DA 1Y10A 4WZQA 2PT0A 5LMNK 4Y00A 1RBRA 1HBNB 5HMYA 3JS9A 1VISA 2FLOA 3T9ZA 3RVCA 1U25A 1U1PA 4QIEA 4LY7A 2LQ9A 5M1NA 8ICBA 2JRSA 3G6VA 1FDBA 5J2NA 4P0QB 4ZVHA 2FZKB 3HZ6A 3T1HJ 2L9NA 3K75D 2IMWP 3O9QA 3ZC4A 3OPXA 4KI4A 4HAIA 3C14B 5K14A 2AA4A 1Q8IA 2MSNA 4MFCA 1HYVA 4E7HA 4CJPA 1BQNA 2YTUA 4KBIA 4O5FA 5FPEA 1UJ5A 3UM9A 3IG1A 1SZ2A 4P10A 1LFPA 2UU9F 3H59A 1CXQA 1X1PA 3N4MB 3R5DA 3NBPB 2YNIB 4LFBF 8RUCA 4RQNA 1S1TA 1EO1A 1S76D 1U4BA 2BKEA 1JLAB 3N28A 3J81j 3KJFB 1SH2A 3OBYA 1N6QB 2MZJA 4E7LA 1CSJA 3NWRA 3NXZA 3M6XA 3K2YA 4I4BA 4W5RA 1MMNA 3OT9A 3QE9Y 2RLTA 4ZK7M 2RAQA 4F3MA 3V7LA 5CP2A 2CPRA 1KD1O 1B70B 3GFYA 1Y3KA 3GG4A 1W7WA 2RS2A 4JYAK 3IR6B 5GAGI 4V19X 4FZLA 2D5RA 3HI9A 1S7HA 3LO3A 1URJA 2EKNA 3ZZRA 4AHTA 5AQOA 4B9QA 5GMDA 5E84A 2ZIUA 2P5VA 4R0EA 3GZFA 2DNHA 3WK7A 2I8EA 2E9ZA 3HHLD 5AQYA 2IRYA 4GMJB 2YQ1A 1ULRA 2KE7A 4ZVQB 2CJKA 2W2NP 3R1XA 4Z37A 2WB1F 7ICLA 4ECSA 2GOLA 2M70A 1M5OC 2WSEC 3P4IA 2QB0A 4FLTA 4B9UA 2GW8A 3OVAA 3UIQA 4HI1A 3V9WA 1JJCB 3FCWA 3MDQA 1TE2A 2XMVA 1CS4B 5HLFB 2W9BA 1LV5A 1FW6A 1E6YA 3K9JA 3QU7A 4LF9J 4I2PB 2H1YA 1D9AA 3H4DA 2XS7A 5DK5A 3VN5A 4CJLA 4YDXA 1TFYA 1CZ9A 1RABB 1R0AB 4FF2A 2GO7A 3MEDB 5GAEU 4DTOA 3BH7B 3DXMA 3F5EA 3OVNA 1R8AA 1R31A 3IUCA 2FLNA 3R3LA 1WNSA 3QIOA 1GX5A 2Q79A 7ICUA 4IRCA 1A5XA 4UY8T 4RPFA 1D4XA 4MDBA 1VRQC 4GXKA 4PGXA 2W01A 4WQ5C 2V6AA 4K59A 9ICCA 2ZKUA 1JIHA 5ETSA 4B3TK 2O8DA 1SVDA 1DBDA 4KLGA 5G5GA 2CFXA 2XCPA 1UETA 2IYIA 4NLDA 3EL2A 1Y5IB 3D54A 1H73A 4AL6A 4OKJA 1WEZA 4BROA 3VENA 2OEHA 2AW0A 2DNNA 1NK6A 1JQGA 4UASA 2D69A 2XIDA 2CXEA 2ZKTA 1JL2A 1NJIO 1TKTA 1RG6A 5GTHU 3P1GA 4ER8A 2HHHF 1VC5A 1QVFR 2RQ4A 4M1KA 2ZJQL 3JTOA 1X4DA 5J0XA 1PYOB 2NXUA 5A8RA 1ASVA 1SQKA 2I9SA 3V7JA 3OS0A 3HJVA 4ZJQA 2HIQA 5AI9A 1N61A 3HVTA 5HQMA 1T3QA 2XY5A 1OIAA 3OUYB 4KGZB 4WQ5A 5CH7B 3TEGA 1FD8A 4NX9A 5H9FJ 5J2PB 4WYBA 3VQCA 4LF7K 3O3GA 4Y1DA 3SCJE 2A10A 4CF3A 1UQVA 1VBYA 4TU9A 5J2QA 2QYGA 1RSCA 1B92A 4TYBA 4F5PA 1RILA 3KWGA 2E5LJ 2AT1B 1NNDA 1TUWA 2R7VA 4LF8K 4QZIA 1V3SA 3EZOA 2OTJS 5C7PA 3WZ0A 1QY7A 3NGIA 4JI6J 2AKWB 1R27B 1VI7A 1C1BA 2R2TA 1S9GB 2ZWOA 2MKSA 4X66K 4JI5F 4ZP6A 1YJ9N 1TUUA 3EJMA 5KI6A 4NPOA 2ZG6A 2WFAA 2BE9B 3KD1E 1YF5L 2F8MA 1FRMA 3J7YU 2D1KA 2ZIWA 1RHJB 1H6KX 2R7QA 4DV7K 1XNSA 4O44A 2KZ3A 3DU5A 5KT4A 4G9ZA 4CZGA 3AMZA 3BKFA 2VQFK 5IILA 4OI4A 7AT1B 3CVKA 4YHHF 1A9NB 2E9TA 4BVOA 3MABA 2EX3A 3LM9A 3SQ1A 1U49A 3L3VA 2BJ1A 2IJRA 2FLLA 2IVYA 4BC5A 5AKEA 2DNQA 4I64A 2J9CA 4E1NA 5EX0A 2W3SA 3CXCM 1P7DA 3CGIA 5BR9A 1T44A 2QK9A 3DGVA 2XVTA 4ZVPB 4GKJF 1J5OB 4FM2A 4NL9C 4BE2A 3NP5A 3WX4A 5E5NA 4I67A 3GR1A 1T94A 1SIZA 2YWWA 5IV4A 2NXNA 2ZTDA 4BRGA 1FVQA 2C3UA 1HQEB 3S9HA 1TL7B 1J54A 3CNHA 2ZC3A 2B0GA 2JNJA 3CYMA 4FF4A 4LIRA 4C9DA 1WELA 4CI0B 1EIYB 1N33K 1N5WA 1TV9A 4A8FA 4RNHA 4PPZA 2HFOA 5G0RB 1KLMA 3CT9A 4H0PA 1TAMA 4KRWA 1D8BA 4LMZA 4NLCA 1ZETA 2CJAA 4RW7B 1ASWA 1ZD2P 3LW5C 4ZOHC 3MD3A 3HSCA 1N60A 5F3TA 2Z2YB 3MX2A 1MDUB 4M7XA 1GLEG 4NL9A 4A59A 3UVJA 1UJ6A 5IIJA 4OGCA 1S9FA 1NG9A 4TUSA 1E6VA 4KHQA 5ETMA 3S6EA 3MI7X 5IT9Y 3OYBA 2ALZA 4K0KF 5DDRC 4KH6A 5ADXH 2BMBA 4H4MB 4FWSA 4CD3A 2FJXA 3QT7A 3D0GE 4C48A 3SPZA 4ZDNA 1LW0A 2ZNZA 4KLMA 2H48B 4NLRA 3VAKA 1PO6A 3AVFA 4HI2A 2XO7A 3MM7B 3X3UA 4DUYK 3MURP 2D3UA 1Z05A 3AVLA 5F0XA 5CHIA 2W43A 4CGGA 2BPFA 3ZEUB 9ICKA 1B0PA 3G86A 2ZZMA 3T1YJ 4KRFA 3MR3A 3VA3A 2C3YA 3Q24A 1T02A 1KEJA 1FO4A 4CGHA 1AA1B 5KT2A 1RADB 3QU4A 4DQIA 4QOTA 3MM8A 4IKFA 3A4TA 3LWMA 5LSOA 4CJWA 4ED7A 1S1UA 2P9LA 4LF5J 2EWSA 4I2AA 1Z4NA 4DKWA 1FEEA 1X6IA 3BF3A 4B3RF 4ZJOA 1S1XA 1K1QA 4Y2UA 4DUTA 3SAGA 2QWOA 1CJTB 3PR5B 1H2UX 1CJKB 1YHQS 3WHIA 2OD4A 3AVAA 3BS5A 2M5YA 2XWYA 1YX2A 5KFSA 3GV5B 5F8NA 3MAAA 4BRNA 2QE5A 2W41A 2A19A 2W25A 3WIVA 2RJZA 2L5YA 5GIOA 3MCNA 2HBRB 3TW0A 4RG8A 3PW4A 1REVA 2HAIA 3OTOK 3CJ2A 3A3OB 3UCGA 5A8KB 1CPZA 3F2KA 1C0GA 2JEJA 3GDXA 5IT9U 2RHSB 1NJXA 4CJUA 5ITHA 4FL9A 2COLA 4QS8A 3AODA 2AGQA 3A13A 3OR1B 1RBSA 5FP0A 4D3HA 1N32K 4JEPA 4QBUA 4K42A 2F3NA 3DRYA 4ECRA 3LOUA 2XI3A 5L46A 1U45A 3JSRA 4NZ7A 2HS0A 4QW8A 4OJHA 5CZVA 1X3NA 1EKRA 5M1FA 4KT0C 1P8GA 2PMZF 5HMZA 4RO0A 4NCGA 2LBOA 1IBKK 1GXUA 2HQ3A 2B5JB 3DDNA 1QQ5A 3CQ8A 3Q23A 2AHOB 1UKUA 1B0VA 4UB3A 4C3LA 9ICFA 2EFGA 8ICWA 2BRKA 4QQBA 3UNYA 1VBXA 4O23A 1T95A 3W8PA 2VBZA 5AQMA 4ZITA 1B4FA 4IQVA 2E7XA 1UHUA 2FJDB 3ASMA 3VQSA 2XQCA 2PE8A 4A8XA 2UXDK 3BQ0A 1SH3A 3TUJC 2XNRA 2XMAA 2KI2A 1IO2A 1F5AA 4KTWA 4RPXA 4KO0A 4TQSA 1KDHA 1IWAA 3BEXA 3THXA 2OMLA 1J5EF 1LWEB 3BSAA 3HRGA 1IJFB 2D74B 5J2GA 2RQKA 2DIUA 2MQOA 4Y2IA 3TNVA 2Z1GA 2ASPA 4DR6F 4YNQA 4C8ZA 4CJFA 4CP5A 1JLFB 2CQDA 4YN3B 2HLUA 4CEBA 3VPZA 2KM8C 1NLKL 1ZH5A 4CFCA 3SLCA 5I42B 4AT1B 1Q86T 2DH8A 4DPXA 2O8BA 4BC4A 2QXLA 4IG3B 3H98A 4CLKA 1NHKL 2QARB 1YAGA 4JI3F 4IFEA 4KLTA 2YV0X 3UCZP 1DT9A 1CC7A 1VQ6S 2J9EA 1Z1ZA 2J8SA 1ZQZA 3T1HK 3IRUA 2KT2A 1OYDA 2A1BA 3QRPA 4OYZA 4WU3A 4X4VA 1MN8A 1RM6C 4HCBA 3OXGA 5E26A 5EVZA 3CCMS 5DRKA 3SQIA 2H3ZA 1R8PA 3I0SA 4UB2A 1RXWA 3KLEA 3OL7A 3BGFA 4P9SA 4MEXA 3G25A 2QIFA 1XQSC 1JB0C 1RDWX 3F9KA 2V4JB 1EQMA 2ATQA 1UT5A 1ZPVA 1T3OA 2J76E 3MF5A 3M8YA 4ZVFA 1XMQF 2KXNB 3HF5A 3O80A 2G07A 1YJNN 3F5TA 4ECTA 2UUBK 2YQ3A 1SWVA 4FBUA 4ANEA 2PFFB 1SQFA 3IBCB 4OJOA 1KVAA 4PG8A 2CZ4A 9RUBA 4Q8EA 6AT1B 2IVMA 1GLFO 3L2WA 3AJ2A 2H5XA 3CCUN 2G0CA 2HFNA 1HKGA 4PUOB 1WSIA 5A8WA 3AVCA 1JLBA 3L5KA 3ETRA 1OSDA 2O3DA 4P2FA 4B9TA 2MUTA 3AO3A 3N5BA 3O6WA 2BANB 3VAJA 4C1NI 2BCRA 1YQHA 1WAFA 5E3RA 2VA2A 5J0PA 3MXIA 3THVA 2FHOB 1RTJB 3D1HA 2YKNA 1KQSM 2QW9A 4MKAA 4CESA 3AM9A 4A62A 3BBBA 3I31A 3EGNA 3HKZF 4N56A 4UOFA 1D8ZA 3L8BA 4KFBA 1ZPWX 2ZC4A 5D46A 1C1CB 2DWQA 3L6QA 1TYQB 2ISOA 2NRHA 1UAWA 1KFTA 2DCUB 3POTB 1JXVA 1GQEA 4CLFA 2WOMA 5FD1A 3VCDA 3IM9A 1B64A 2BJ9A 3VHQA 3A3PB 5DM7Q 4X64J 4LF9K 3M32B 4KPCA 2IAJB 2F9WA 1OVQA 2WAQF 2E7VA 3B6PA 3LQVA 4O0JA 1TKXB 3FMBA 4DV1J 3CJBA 3CRXA 1H74A 2DNRA 4DCCA 4K4HA 1WG8A 5KQ8A 2OSRA 4IG0A 2EVZA 2BR0A 1IBCB 3V6HA 2ZBRA 1SJFA 3ZT3A 5AJ3J 4JV5K 3HO1A 8ICVA 1V4SA 4X5VA 4B3SJ 3JQJA 2V0NA 3E8OA 3QRRA 1AB8A 1PJ6A 2LKZA 1SC6A 3ITHB 2VPZB 2GQ2A 2W8KA 5GADP 3TWHA 2MSSA 1I5OB 1YK9A 1VBKA 2BQRA 1F1BB 4DQQA 3NG8A 4AE5A 3R2DJ 1DOQA 3BYPA 2BH1A 3DCAA 4Q7AA 5KT5A 4BRIA 4F25A 2QA4S 1JRPA 1VYAA 4DR1J 5KPTA 1KKXA 4A8QA 1K8KA 1HUXA 3AOBA 4FK0A 1IR0A 2B7BB 2JSXA 3ENBA 1CRXA 1RZMA 1D8YA 1UWAA 3CJKB 8ICUA 4WZMA 4JWNA 1HNIA 4OI0A 4M5IA 3HD2A 3WUHA 2DBYA 4RPZA 1HHQA 3AA8A 5AM5A 2P9PB 4YD2A 3LP1B 3NOGA 4CEQA 2MU2A 2YWFA 3C5GA 1TUGB 4JI8F 4X4SA 2VGMA 3O9RA 2XYPB 1JCEA 5BR8J 3G82A 1N5SA 3JPPA 2F65A 2CRXA 1EP4B 1H72C 1RKJA 2W3RA 3OS2A 3SDEB 4HWIA 2OIHA 4WFNL 5ETKA 2HRTA 2KXFA 3WEEB 5U47A 3KNGA 3MN9A 5H9FK 3EGVA 3BKTA 3OGUA 1RTDA 2KJ8A 3H8JA 2V63A 1RQ0A 4U95A 1RNHA 3UMGA 3UDVA 3UN3A 5AI6A 3C6HA 3ULDA 4CBWA 2F9TA 2ZUGA 2E5LK 4YB5A 5ALWA 1QUVA 4TKTA 2DRBA 1ZAWA 2F44A 2FHJD 3T6JA 1YJTA 4DJBA 4JI6K 2LYAA 1RFQA 5EY4A 5MLCQ 2HG4A 3NH0A 3SBTA 1IQZA 1WEXA 4X62J 3HSDA 2Q36A 2JWLA 2XM3A 3ID8A 3RBDA 5D0GA 1Q78A 3LP2B 3I82A 4O5CA 2FC8A 3QEWA 4CJSA 2CQBA 4ITSA 4DMZA 2KJ5A 4R25A 2AP1A 4R5PB 1CXUA 4NXMJ 1HJRA 4ZPAA 3ZSRA 4HHHA 2IRXA 4OV1A 5KFJA 1DGJA 2M8DB 3NH1A 5IS2A 3QYYA 3H20A 3IR7B 3SMVA 3JQMA 3M1YA 1X66A 5HQLA 1IQTA 3KHGA 2LU2A 4E7KA 1ZQKA 1OY6A 4OCZA 4NWBA 5HANA 2X78A 5E33A 4UB6U 4JD2B 1IXRA 4JHDB 3VQ4A 2OPQA 2RUSA 2EQYA 3R5BA 3VVTA 2C2KB 1T3VA 1B43A 4UB1A 2YX4A 4EYIB 4LSLB 3M2VB 3CCES 2PBDA 4QR2A 1LEOA 4O0IA 4FOEA 1FJCA 1LFWA 2WF6A 3NS5A 1U9LA 1JLCB 3P5BP 1SWWA 1EWQA 1GXLA 3GSDA 4Y28C 1OQ6A 4R8UB 1JLQA 3R7NB 2CYYA 3MTJA 3LPTA 2QKKA 4WF9Q 3ZTOA 2IYGA 2Q43A 2XSJB 3M6VA 2ASYA 1BCMA 3PIOQ 4QYRA 1FTRA 2AIRB 4LFCF 5A2QO 2E88A 3PTWA 1X9XA 2JC0A 3HHKA 5GAHU 1ATRA 5KFAA 2B0CA 1QHTA 2NV3A 3BO4A 2K8AA 2G8FA 3CC7N 3D6FB 4K8XA 2IFXA 2ZJPL 4OLBA 3K8WA 2HK2A 3SJJA 4CJTA 2CDQA 5AZJB 5F0UA 3DGPA 4FJMA 1RI7A 1NSQA 2QMWA 1FFVA 4MLEA 5E0OA 2YNGA 1S7IA 4M3RA 1ZD3A 3MPUB 5D0HA 5KFEA 3QGHA 4FLYA 4ZPBA 5J1EB 5E79U 1EXQA 4I2QB 4KTQA 1Q81O 1C0UA 1MC8A 4ZH4A 2XY6A 5KFGA 3T1YK 2BCVA 2ZXHA 1QZ5A 1Y9OA 5AQVA 1R7IA 1EETA 3IRXB 9ICHA 4ZVGA 2P9SA 2QA2A 1ZS6A 1YJRA 3RB6A 5F8LA 3UXPA 2WF8A 3F44A 4QPTA 4TSXA 3M8PB 3D28A 3H2UB 1TUYA 2OEKA 5J29A 4GXJA 2B56A 2OPRA 5JU5A 4LF5K 4P73A 4RW8B 3P96A 2WAQD 1U2VA 5D0EA 4IBNA 3EE9A 1WTFA 1P9QC 4USJC 2MXYA 4X4QA 4DL6A 4G1QB 4DV5J 2EAMA 4DUZF 4GKKF 3U6FA 2BCUA 5LMUJ 1RYUA 5J2HA 4CIOA 3RW7A 1FNXH 1MWYA 3DM2A 4MTPA 2UUAJ 1NB7A 5C2DA 4PG6A 3BZCA 2EI5A 4NLPA 2ZM6J 1HI0P 3MFIA 2G2OA 5EX5A 1RT5B 8ICMA 3FZBA 1RA7A 2DH7A 3V9ZA 2CQIA 4USAA 4V19J 2EEYA 2A1JA 4PQUB 3HFKA 1ZQNA 4KLEA 4E19A 2FSKA 4DV0J 4OLPA 1RA6A 1CG2A 1LKZA 2HSZA 2YNFA 3GYXB 3HFZB 2B4VA 5J8YC 4KLHA 2NXCA 2KHDA 3M9MB 4LFAF 2A2CA 3SJHA 5I3UA 1WBDA 3B8HA 3J81Y 2DO0A 4KLOA 7ICPA 3FZLA 2VASA 4IWVA 2DRDA 3BGOP 1UVKA 4NEZA 1YITS 3CMAS 5KFIA 3JYTA 1IUJA 2PXIA 4FLVA 4PZNA 2AQ0A 3ENVA 2ZJQQ 3SZ2A 3CCVS 1O08A 2JZBA 3W60A 3IWLA 1EJ7L 3MXJA 4QJVA 3M3ZA 4ICLA 4XDDA 2QRRA 3GIJA 2G2YA 2CGLA 3M30B 3WXLA 2D0BA 2VFUA 4B9NA 2W6LA 3PIPL 3NCQA 4B08A 3WX8A 2CJQA 1BXNA 1IJEB 2FVCA 4WKYA 2GLEA 2UUCJ 1LK5A 2BXJA 4NEYA 4E2FB 5DS7A 1KQKA 4KE5A 2FF3B 1NGBA 1WDTA 2E1EA 1RWXB 3VEZA 5J8YA 4FNIA 2ASMA 3H0PA 4ZLLA 3DDIA 2DNYA 4NLQA 3LK9A 2PZSA 4GIBA 3F56A 4X65F 4PKIA 2VYPA 3MWBA 1BY9A 4FKXA 4DTRA 3PR4A 5HOOA 7ICRA 2LQ8A 3VEXA 1TZ0A 3ZZPA 1O1WA 3RSEB 1F0XA 1NH7A 4RR5A 3IRWP 3J81U 4URSA 1P1TA 3PW7A 3MEKA 3TANA 1ZOTA 2KVIA 3DOLB 4QIGA 4IOAL 2DD8S 4PWDB 2DY9A 4LF2A 2GO9A 5EOYA 4Y2KA 1O13A 3ZLJA 1GLAG 2XGPA 3NMUA 1GFWB 1RWUA 4NY8A 3GU3A 4ZCLA 2DF4B 3AGRA 2HFZA 4RW6B 2VA3A 1NAQA 4BGBA 2B6GA 1YVFA 3QUQA 1QE1A 4M6WB 3QEAZ 2P5GA 3SIPB 4UAZA 2CQ0A 4M5DA 1UVNA 2BQUA 3DEEA 2DR6A 1CVJA 1KXPA 4MO4A 2B7CB 1VRTB 1KEKA 1ZC6A 3AUOA 4KAZA 3K59A 5KRTA 1HUZA 4L3KA 1G3OA 3BM7A 5LM7E 2XC9A 4QZGA 4MYUA 2H51B 4HLBA 4YORA 2SXLA 2D41A 8ICIA 3V4IB 5HROB 2OA8A 4NXZA 4ETZA 3O1BA 2I6XA 2FY1A 3IP0A 4CT8A 5D0RA 4J9NA 3C7NA 3R7BB 1ATSA 4CF0A 4FLWA 3AO4A 2LDIA 3E2EA 1H38A 2HRYA 1FIQA 5CZXA 3KG4A 2ERRA 2XY7A 2IC3A 4HR2A 2LQJA 1RU1A 4ZPCA 2IOFA 3GR0A 3IFEA 1KVJA 1FNMA 3EVWA 4DX5A 2W04A 5HHIA 3KK2B 3H0MB 2VFSA 2O5DA 2ZBQA 3NRBA 4OHVA 1V3RA 2W2PP 3WK9A 1R6VA 2GHVC 2O67A 2OEJA 3UDCA 4OPKA 3Q8RB 2XTJP 1HNVA 4EELA 2K1RA 2V8VA 3CJ7A 3DOMB 1DZ5A 1SZHA 2HFVA 2DNLA 2FVPA 3MBYA 2ROPA 1IKXB 3OYDA 4MMOA 4IOCL 4AILC 4FP9A 1N8RO 1FT8A 5KAFU 2YQ0A 2BGWA 1UOCA 2HB5A 3TTCA 1VLBA 4CQ1A 2DGQA 3OXLA 4C8LA 1ZQHA 1DURA 4DV6J 4LF4J 4BACA 4W5NA 4DL7A 1NGHA 5AI0A 4ECZA 2F7VA 2B6AB 3OVBA 2DXDA 2UVVA 2D9PA 1HKCA 2GIFA 3MOZA 5EHHA 2XS5A 4X64K 4UTGA 5J2NB 2OTJN 1WCNA 5JMVA 2WVEA 3NVWA 5HVGA 4DV1K 4Q5VA 3B4DA 3JPOA 2LXFA 2ZITA 1BGXT 1VC6A 4RU2A 5HRRA 2MA1A 5JVHL 1TQLA 5K14B 2HK3A 3D2EA 1RTIA 3V7KA 3OW2R 5AJ3K 3JS6A 4I2JA 1ZQDA 3OJUA 1X5OA 3C16A 1KKHA 4MK9A 2GGPA 2HYIB 1TMMA 4DR2J 2MRLA 4JYAF 7ICEA 1I94J 4RPYA 1BQNB 1BNOA 4QW9A 4Z7YA 4BWJA 1KCFA 4B3SK 1B7YB 3IG1B 5DDMA 3H1VX 1SIWB 1FWPA 4UZBA 5KGXA 4NLYA 4OHZA 3SD7A 4OZ0A 5IQ6A 3C2PA 1YVNA 5E2QA 1EKSA 1S59A 4C7YA 4K2XA 1S1TB 4IO9Q 5AQKA 4NYOA 2Q31A 4PA1A 2XZDB 3EUNA 4IO1A 3T1AA 2FSNA 2JEFA 3ET6A 3K8VA 2I6WA 4DR1K 3THWB 2YWHA 3RJMB 3N79A 1D5AA 5KG2A 3Q0AA 5AQRA 1KOHA 3DLLQ 3HVWA 1A6SA 2QC3A 4Y1CA 1K8AO 1M6YA 4GNIA 1ZQIA 1OVYA 1QDUB 4QZDA 3ADAC 4JOUA 1U7LA 3R7SB 2BPCA 1HRHA 3SEIA 1I1GA 1FEHA 2NZCA 5BR8K 1JMTA 1N5VA 3UKUA 1ZBIA 2ZIUB 1FJGJ 4PGQA 4L72B 3M6WA 2QLBB 1VQPS 1TL3A 2HNZA 4Z2XA 5B0DA 2E6LA 2EC0A 1VRUA 4TY8A 2KV2A 3SFGA 1V38A 2GVZA 3NVKA 3QU2A 2BPGA 1GMWD 2DHGA 5J0YA 1PUZA 4N76A 1NZBA 2QB0B 3TADC 2PMWA 4KITB 4U7UK 5J2DA 2K8GA 3RAXA 2CNLB 5C24A 4FLXA 1N0VC 2QL7B 3FRZA 2B4JA 1X4AA 1HNXJ 2JEGA 3G10A 3HHLC 1W7AA 1ZM2A 4CWBA 3B0YA 3L3FX 4BRHA 2NYIA 2W9BB 2VDHA 4WFXA 4C0HA 4KHSA 2FBTA 3KK3A 4AL5A 3VGKA 2ZOMA 2FSJA 1E6YB 1KQQA 1WBBA 2ZGYA 5LL6d 4L75A 2HW3A 3KHHA 5CCMA 5ALIA 1H3DA 2EFNA 4X62K 2AF6A 3VQPA 1ZOLA 1DRGA 4K4YA 2EFPA 4Z6CA 1L7OA 3MEGA 3BSCA 2ATCB 3DXMB 4P52A 2MHEA 3CD7A 3RMDA 5E3PA 1QHAA 2L3MA 3AO1A 4NXMK 3DJCA 2LP4A 3DRXA 3FZHA 3W9HA 4KLUA 3IM8A 2OKQA 1WOQA 1RYSA 3TADA 3BDPA 3MAHA 4XQ8A 3K17A 1SL2A 5I4MA 2MLYA 2I1QA 4DF8A 1N48A 4LSNB 4OLOA 2ZGZA 4QU6A 4EU0A 4O4RA 3SSQA 3HHLA 3SI8A 1FRIA 3I8DA 3ZT1A 2HMIA 4F0MA 1YHQN 2E8MA 3WBZA 4F72A 4N5SA 4FZYA 1VSEA 4JI1J 2V34A 3V1QA 3D6JA 4JV2A 4X4TA 1TKTB 4B9LA 4K25A 2G8VA 5ETVA 2YH1A 1SPBP 2JMGA 1SJ3P 4B17A 3NASA 4QWBA 1VQ8S 1SC4B 4FF1A 3QETA 1XC9A 5A8RB 3MM6A 2H5EA 3IV6A 5C2FA 1WCLA 4FF3A 5G5HA 2ISPA 4CZIA 3IBWA 4J9RA 1NSAA 3IR5B 1PBAA 2IMOA 3HVTB 3VGTA 2FE9A 2BYCA 5CY4A 2V50A 1JXLA 2J0WA 3BPDA 4JV1A 5J0SA 4AP9A 5M1PA 1GMUA 4DXLA 4U8VA 5JLHA 3ID6A 3VEOA 3QNOA 1F44A 2AJFE 4R65A 2VCPA 2KN7A 5J2QB 3SQ4A 1WHXA 9ICTA 4FS1A 3Q86A 3E66A 1FF2A 5C0YA 2ZFHA 3CI5A 3FSXA 1X31C 3HPGA 1C1BB 4JKBA 3UE2A 3JPRA 1J97A 4DQSA 2HLTA 4IQUA 4C7QA 2NRWA 3GJSB 1FI4A 5FLXO 2YMLA 2A2DA 2BA9A 4W92B 5AQXA 2WK4A 3VEWA 4MKVA 2PYJA 2ZIWB 3QBCA 1YJVA 4DR3F 4O44B 3I33A 1Y11A 3ILJA 3PFOA 5A6PA 1RWWB 5EWEA 2FJ6A 3IWXA 1OH8A 3H2LA 2HQIA 3PMLA 1N33F 2VKQA 3C23A 3WK5A 2JLGA 1Q46A 1QUPA 4NZ6A 1F6TA 3HJEA 1VDVA 3QIDA 4RUAA 3DC2A 2NLWA 1SJQA 4JB3A 2PD1A 2OPSA 5DETA 5J2BA 3BZQA 1DLOB 4DV5K 1XNRJ 3D67A 4ZVEA 5GINA 3BKUA 1S3XA 5LMUK 3CW2C 2F7TA 4Y2PA 2JLEA 3LDOA 4OJPA 5DLGA 4RNMA 3UB5A 4B1XB 3I4PA 2UUAK 3ZDBA 3B78A 3NOCA 1NBEB 3QO9A 2FMPA 3MCMA 2ZHBA 3VQAA 2FPKA 2ZM6K 4ZN3A 3LH2S 4KR0B 2W40A 1WSRA 1VQ6N 2X1BA 1XSLA 4KLDA 3WQPA 1MWQA 2PA3A 5ALLA 3CJ3A 4Z4FA 2LQ5A 4I69A 1HMVA 2FB0A 1QSYA 3V9SA 1VQSA 2A41A 3QT5A 4DUYF 1KLMB 2CAJA 4DV0K 5IM0A 4FZXC 5D4BA 3RMAA 4TLRA 1W2IA 3HYFA 3WC0A 3F5AA 3CCMN 3QGGA 3ISBA 4UQTA 4X4UA 3P31A 2GIQA 4NYNA 2WBMA 2G8KA 3HZGA 6FDRA 3SV4A 3T41A 2FF6A 4E0DA 3HOSA 4Y2XA 3OBIA 3UVJB 3H6EA 3ZFVA 4DG1A 2RDDA 3U9ZA 4CLLA 4I56A 4OYWA 4DR7K 2OUGA 4IJNA 1TL1A 3GZ7A 2HI0A 1SC3B 4XO0A 1FXDA 1WN7A 1LW0B 2VKZG 2XGQA 4WFNQ 3VQBA 4YMMA 4DHYA 5AXKA 3GL1A 2YX8A 1HNWJ 3CC2S 3H3NO 2UUCK 2UXCK 4I7FA 4EENA 3FFKB 4O3SA 4RNOA 5AQGA 1OMSA 2Z8QA 1RHQB 1PKUA 4AHUA 1FJEB 4ZVSB 1S22A 3AAPA 3MM8B 1VQ7S 4H8KA 1EX4A 3TTDA 4J9KA 3G4SS 2ZZNA 1N32F 1S1UB 2CWKA 1VQ5S 2P5OA 1S4EA 2P9LB 3A8JA 2E5GA 2E2OA 2GMHA 2VDIA 2OEMA 1S1XB 2WB1C 3JAMO 1N54B 4NRTA 1QCKA 2DKOB 1WSJA 2IM3A 5M1QA 3BS5B 4P4PA 5J2EA 2R2RA 2AMCB 2DB1A 1HIWA 3D7SB 3VQ5A 3MAAB 4YMNA 3FCHA 4EX7A 4FWOA 1HEKA 3VF4A 2N82B 4IDKA 5FPDA 3CD5A 1REVB 1FRLA 1HW9A 3MUMP 4NRUA 4TYAA 3MM5B 4YG2A 3AXKA 3H5UA 1XMOJ 1BPEA 1RDCA 3MD1A 1H0HB 4KV8A 5J0OA 3M6ZA 2RF2B 1D0EA 3IKMA 4IZ9A 4QZFA 2IHNA 1S48A 3U26A 3EPIA 4YR2A 5CRXA 1VK3A 2YNHA 5EWGA 5ETNA 4C4WA 4OYAA 3D0HE 4KHPK 2HWTA 2NSBA 5GAGU 3A2FA 4JI2J 4ZKAA 4QPXA 4NCGB 5KFQA 2WHEA 2KVCA 5KT7A 4ZPVR 4Y2YA 3CJ4A 4PJ0U 1VQKS 3J7Z5 1W25A 4C80A 3MTKA 1XK8A 2QA4N 4ED3A 3BQTA 3VZHA 3G6ES 4HH1A 3GPAA 1UMJA 2XG8A 4ZVUB 2HOFA 1VQYA 3U7JA 3DRRA 2X1FA 3JSBA 3GG1A 1X42A 2UU9J 3IC1A 5G4DA 4KPYA 5ETTA 3L4IA 4US8A 2YX1A 2HDOA 4JV0A 3HVRA 1G7CB 4CK2A 4LFBJ 2K4IA 5C25A 3O3FA 2C3OA 3SQ2A 5HSPA 4H4OA 4IFVA 2P9UA 3CCWA 3K0JA 4RJVA 4Z4IA 5KT3A 1X7VA 5ALNA 2OPPA 1B0XA 2ZJPQ 4U8YA 1ZRNA 3TUZC 3E01A 3THXB 3W0LA 3KLHA 1NGFA 5H1SV 3CJ5A 2YHWA 3DYAA 3H40A 2FVRA 3QPIA 4I2EA 2G8HA 4YB1P 1WUUA 2R7OA 5HMXA 4FXWA 1WACA 2IGIA 1SL1A 2XO6A 4ID8A 1F2GA 1NLVA 4DV6K 2Z56B 2D0CA 4LF4K 1SJ4P 2AZ1A 3QBXA 1JN3A 2O8BB 3PW5A 2BE2A 4XRHA 1JROA 4XPEA 4BRKA 3CJ8A 5M1OA 2KD1A 1LWXA 3HILA 3MUVP 3O9TA 4OGEA 5AM3A 3NCPA 3QT6A 3PJ9A 1IKVA 1F5CA 1SXLA 3C1YA 4MK8A 2GJFA 2CNKB 2CPEA 5BPMA 2IPOB 2P35A 5AQPA 2ZUDA 4FJXA 2ZJ8A 2KB2A 2DNZA 3I0SB 4TQRA 1WLJA 1J2VA 1A76A 5DDPC 3M8RA 2E5SA 5KFCA 2W9CA 4UBCA 4DOBA 3VV2B 4QZVB 4JI0K 2CVIA 2RD5C 3ZSQA 2VFRA 3RB3A 3O44A 1BWVA 3SSRA 1LVHA 2KM8B 2QL9B 3IS9A 2FBVA 2MAXA 7FDRA 1Q5VA 1WOSA 3I28A 4DS5A 4DLGA 1SC1B 2E1PA 2QLJB 2DFLA 5J2FA 2O66A 2PFOA 2C28A 5EE0A 2AGOA 2H9ZA 4O5EA 4F67A 1Z00A 4DU4A 4CGZA 4F4YA 1YI2S 4A5BA 3KKFA 3EGZA 5A8WB 4QU7A 1ZBUA 1JLBB 1NGDA 4HDHA 2HF3A 4AXJA 4XIUA 2RRAA 3THPA 4KH1B 5B0FA 2OHDA 4M3XA 1X40A 2MUTB 2QO3A 3CCEN 2JEIA 5D77A 2MKHA 3L7OA 4PXEA 1RAOA 1FJGK 4DZ6A 4DLEA 2RUGA 3CHWA 1QAIA 5FIIA 3OD2A 4B8CA 4UBBA 2C2OB 3E3XA 3JSMA 4PG7A 4OHXA 2J7KA 2O8FA 4DL5A 2YKNB 3PIPQ 3F0NA 5KG7A 2GWJA 2HVEA 2QTDA 4BREA 5ALFA 4Q2LA 5JXSA 2WB4A 3HD1A 1ELOA 4KFBB 3RGIA 5ADZA 1ZQWA 2ZH4A 4USHA 1JLEA 2E66A 4OHWA 5LMNJ 2G5IB 3PSPA 1HPZA 2G2ZA 8ICFA 2C1EB 2BRLA 5AICA 4PQAA 3A0IX 2F8HA 3A3NB 3QJPA 4FSVA 3SV3A 1KLNA 5AKJA 5DBAA 1PVRA 3BGRA 3P38A 4CHQA 5I3QA 4GVBA 5KAKA 1NHVA 4ZJLA 1WC1A 1FRHA 4IG0B 4YOYA 4NB4A 3VQTA 3RMBA 2LQBA 4C23A 3SMPA 1BPZA 4LREA 5L1IA 4OI1A 2LEBA 3HSZA 4M45A 9ICLA 3CCJS 4KHNA 1SV5A 1TUVA 4QZHA 1RJJA 1URNA 1IBLF 4OYBA 3EYZA 1U1OA 1EARA 2FZGB 5EX3A 2ZXIA 4IOAQ 1A77A 3UD3P 2IRUA 5MLCV 3I32A 1NU4A 1YJWS 1BA1A 3CNQP 3CJAA 1OH6A 3K57A 5KFHA 5GAEI 2PA8D 2C42A 5ALMA 3DV9A 2DY1A 2UXBF 2AV5A 3RMCA 2DTJA 1K8KB 2BOAA 1X9JA 3MCSA 8ICPA 1E3MA 2AP6A 5BPNA 3TEHB 2MHNA 2OGUA 4CF1A 1HNIB 4YHHJ 4ENOA 3P5JA 4ED8A 2Y0SD 4ZHRA 2E5LF 4OIXA 1C6VA 4DV3K 2HBJA 4RCHA 5KFFA 3J7ZT 2R2SA 1XN9A 3HKWA 4RQMA 2KMDA 4BUGA 5ALPA 2F77X 5BRFA 4JI6F 1ICEB 3KK7A 2E8OA 3G82B 4N8OA 4BC2A 3FLCO 1FESA 3KOAA 4BG8A 2DNKA 2HS4A 5FJ4A 4P4OA 4DPWA 4YS2A 1AZSA 4H4KC 4DCJB 2PFNA 4ECYA 4ZLPA 2DGOA 4I29A 3KIOA 4P2XA 4PABA 3HL8A 5EOZA 1RTDB 4O3OA 4CZKA 3BF4A 2XRIA 1FDAA 2ZUAA 4CK1A 2FPLA 4JI7F 1YITN 3CMAN 3US5A 2DNOA 3FZMA 2CN1A 4ILJA 3TAMA 4IRDA 1L7PA 4B1VA 3OL6A 3C28A 3MGVA 3QIPA 1VQMS 3QNWB 3TP2A 3QFUA 3NGZA 3CCVN 2HBQB 3Q7BA 8ICOA 4IL6U 4NLXA 7ICQA 4CEOA 3M2RA 3H0RB 2V8GA 4Z6DA 4PY5A 3NGSA 1FX2A 4AHVA 3S6JA 2GMLA 4DOZA 1F0MA 2YHAA 2KRRA 2YKAA 4AQYF 4IOCQ 4LR9A 3T5KA 3AAQA 2NXJA 3PW0A 1DEJA 2OSQA 3GWCA 3FBCA 4K4IA 5F0WA 2Q0UA 3AQPA 3QEIA 1TR0A 4H4KA 4I6MA 3HM8A 1BNPA 4K0KJ 3OYNA 2R7RA 4BXOB 2WONA 1QJHA 1IG8A 3KJVB 3C3LA 1RXVA 5M1KA 1C4CA 1K0VA 4ETXA 2G08A 5IFMA 4FJHA 4ED5A 4F0HA 4LH4A 4B3TJ 4CE6A 3SCXA 1BMQB 2X7IA 3IXQA 2MJNA 3MR2A 3V4MA 1S1WA 4BC7A 3J7YI 4CNQA 4M8LA 4J9UE 3LDNA 2OPQB 2E2PA 1XNRK 2V8HA 4RWTA 5HR6A 8ICGA 2B21A 3K0SA 2E44A 2FYXA 2W7OA 5AQQA 5J1PA 3OYFA 2K2PA 4KQZA 1L8OA 4C97A 4YOVA 3AQOA 2UP1A 2HF4A 3DNCA 3SR6A 1NMEB 5KOWA 4PEOA 3RG6A 1HKBA 2A1RA 3CQXA 4GVLA 3PJWA 1U1KA 2AJ0A 5DKWA 1KWMA 2VH7A 2BJ8A 5ALDA 2FHJA 1WHVA 1RGVA 4GLXA 2HAFA 4FPBA 1JWWA 2VPYB 3LPYA 2IJFA 3KJNB 2HHWA 1JLQB 1CZBA 2ZOFA 2BQ3A 4ZVTB 5DDYA 1BIUA 1MMDA 2HZCA 1MQ2A 2HHTA 4YUDA 9ICPA 1V9OA 4WFYA 2W2QP 1ZQOA 3LGHA 3BDEA 4H0TB 3P49B 2AX1A 3FFIB 2CH6A 3WDOA 5AE2A 1KAXA 3KTQA 2RNEA 1K1SA 1EAYC 4BWMA 1N36F 4LF5F 1VHIA 2MKKA 3SUOA 2HZAA 3IFRA 5GTIU 4EBDA 1SQGA 1R6YA 4I2FA 3DGPB 3RAQA 2RE1A 1IKYA 3D0PA 4YOUA 4X4PA 2YNGB 1RDDA 3DN9A 1NRKA 4LZDA 2GV9A 9ICSA 2P1JA 1Q9XA 2A42A 1HNWK 4X66J 1B0TA 2PGCA 3OV7A 5DJBA 4QYZJ 1C0UB 2R7YA 4FZZA 4ALZA 4OJ1A 1A5VA 1JJHA 3H4BA 2EC2A 3TFRA 5CD4H 2KIVA 5K20B 1K73O 3J7AN 2D0PA 4FJ5A 4KY3A 3BN4A 2CQPA 2E5IA 1EETB 4A8EA 2P9SB 2VQEK 1T7PA 3GG0A 1XERA 1YVUA 5AQUA 1J9AA 2OPRB 3ZX0A 9ATCB 2MGZA 3LDSA 3M9OB 3LWLA 1U2VB 1NK9A 1Q1KA 4FJ9A 4L73A 2RVJA 4HKQA 2V7ZA 3FKBA 4MYTA 3HKZC 2C3PA 4WE1A 5FPNA 2ZWPA 1Y4ZB 3F41A 3ZNUA 3CG7A 1EB0A 4CHPA 4JMUA 3DM2B 2XNQA 2EAPA 2LKYA 3R3TA 3B8AX 9ICGA 3CDAA 4LBHA 2V5HG 2MZQA 1J5EJ 1ZBTA 1XMOK 2WAQC 3N01A 1C7YA 2VV5A 1WF2A 4FYXB 3CFRA 1SGGA 2A1JB 4DR6J 3S3NA 2YNFB 3DXBA 2PSZA 4L76A 4FYWB 3NF8A 3OSPA 4DF4A 5I3UB 2ZF5O 3MGIA 2GJIA 2LXUA 3EKUA 1ZQYA 2GNKA 4TN2A 3RRHA 9ICEA 4C8YA 4OZ2A 3KVGA 1X4EA 5AK4A 3AU6A 3M4XA 4KLLA