2LBOA

Eimeria tenella microneme protein 3 mar_b domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
APTLQEALDRKCAQFGKESCNSGLASYCGAAIYARYDKGNSSQQTKEWRCYIEKELDFSKSGDGCVDDCGSMTSCRGSVSGPSTSHLTRPSELQAVIDSDKSNYCTDKSEQQPSQATPPPEIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Microneme protein 3
publication title The Role of Sialyl Glycan Recognition in Host Tissue Tropism of the Avian Parasite Eimeria tenella
pubmed doi rcsb
source organism Eimeria tenella
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10564 MAR_sialic_bdg Sialic-acid binding micronemal adhesive repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.580 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lboA00
3F5AA 2JH7A 2JHDA 2JH1A 3F5EA 2LBOA 3F53A
chains in the Genus database with same CATH superfamily
4RPZA 3GILA 3ZDAA 1ECWA 3UXOA 8ICGA 2KP7A 2RLTA 4KLJA 5KFWA 1FIQA 1KSPA 2HHWA 1L7PA 2LMRA 3WKEA 2KFZA 2WAQF 3NVWA 8ICAA 1K1SA 4IQVA 3GIMA 3Q8KA 2R8JA 1S0VA 5KT5A 4OJLA 2RDJA 2W3SA 1MSWD 2QARA 4DLEA 2P6RA 4RPXA 2HSZA 2D8CA 1ZJMA 4QZGA 2HMXA 4CCHA 2D6FC 2OXOA 1BNOA 4M9LA 5J2EA 2A1AA 4FBUA 1JN3A 5EE9A 7ICGA 3RJIA 4IQUA 3BS5B 4RQ8A 3QXGA 3PZPA 3SQIA 4KLDA 1BGXT 3KKAC 4DQIA 5J0QA 3MDAA 3TANA 2DGZA 4O5CA 4KLIA 1ZQOA 3HX0A 2PMZC 4M9GA 5CRXA 5IINA 1TAUA 2M0NA 3D2QA 2P35A 4DSFA 4DSIA 2IMWP 4JWMA 1XS9D 3QX7A 5J2DA 5KL1B 5AM4A 5IILA 5KG5A 4J9LA 2F1HA 2WF8A 3MFIA 1TFRA 1ZJNA 4DL5A 3RH6A 3VCBA 5J0UA 2OH2A 2FMSA 5KFGA 4R8UB 1O08A 5KFYA 4F4KA 2GO7A 1B43A 4FS1A 1XSNA 9ICVA 2LM4A 1Q46A 3IG8A 5D46A 2KD1A 5DBAA 5HR7A 9ICXA 2YMLA 4ECXA 2XY7A 5AM2A 3BQ1A 9ICUA 1RPLA 1TK5A 2ZIUB 3T5KA 4ELUA 5AHXA 1JALA 1QSSA 3RR8A 3MBYA 1N60A 5ALIA 1DGJA 4DFJA 1SL2A 2R8HA 3TI0A 1T4GA 7ICFA 3ZI4A 1BNPA 4NL9A 5IIKA 4KN4A 3Q8QB 2MUTA 3JPOA 2ZIWA 8ICQA 5IIOA 5DG7A 5DDYA 1QSYA 2PFNA 2Y1JA 4C7YA 3H8JA 2ZIVB 4GXKA 3HILA 2W9BA 2BPGA 2W04A 3BQ0A 3A0HU 4ECQA 2KJ5A 3M6KA 2YB4A 4B9TA 3RJEA 1S9FA 2BDPA 4NJ8A 1N56A 1OUQA 1IM4A 2C2RA 3OJUA 4UB5A 4AP9A 1DK3A 4Y2VA 2HVHA 2LI6A 9ICJA 4Q45A 3E0FA 2JR5A 1S97A 2KJ8A 4GC6A 4HYKA 4UAVA 2BCQA 2HVIA 3H8WA 2G09A 4Y2QA 3TACB 1PVRA 1CUKA 2QKQA 9ICGA 4UW9A 4PHEA 4QIWC 1L3VA 3EPIA 4DSJA 3PO4A 2ATLA 2C28A 1U49A 3LK9A 2KVSA 1RYSA 1ZQWA 4XQ8A 3RB6A 5KG6A 2XCPA 4ECSA 1ZQUA 3NGDA 2KOBA 4RT2A 4RQ7A 3M7DA 3EW9A 3BQTA 2Y1IA 5KG3A 3SAGA 4J9PA 4UB6U 5KG4A 5BOMA 4Y2SA 4Y2JA 1KN5A 4I2DA 4NV0A 2BQUA 4DF4A 4E0DA 4QIWF 1A77A 2DUYA 5KFMA 4RT3A 1ZQEA 3CRXA 1A76A 3NRWA 2AJQA 4MF8A 2XY6A 3IDWA 3QU9A 3QNMA 5KFDA 2DL0A 3MR5A 3GV8B 2HBKA 3UQ0A 2KZZA 1JIHA 5F9LA 2A19A 2R18A 2AQ0A 5KT3A 1DOQA 8ICKA 3BZKA 2R8KA 1JROA 4RNNA 4KN7A 3AEVA 1O03A 4F5PA 4DFMA 2PXIA 2A1JB 2QB0A 2ZUCA 3D2NA 1A6SA 5HNKA 3AUOA 1L3UA 2E5SA 5DB7A 1SKSA 2YMPA 5GTIU 4EEYA 1T3QA 5DGAA 2C22A 1X9SA 1ZQRA 2DFLA 1N5WA 1SZHA 4QZBA 3KD3A 3ZDDA 4O3PA 4BXOB 7ICVA 3H0LB 1NOMA 4Z6EA 8ICOA 3PR4A 2J6SA 4PGYA 4EYHB 3TARA 3ETRA 5IIIA 4ECWA 2GWSA 2HOIA 2JZBB 5AKKA 5J2KA 3PX4A 2BDUA 2EZZA 4CNQA 4YD1A 1J2NA 3C2KA 2F76X 3H4BA 2KKVA 4XRHA 2YMMA 4ECUA 1FFVA 2BPCA 1QQ6A 5DB9A 9ICKA 3RJKA 1S0NA 4IC9A 4NWIA 2ESEA 1VLBA 3N4MB 4RQ0A 3T3FA 3TFRA 3OGUA 1OXJA 4BWJA 3SV3A 4C8MA 3UPQA 4QW9A 4LZGA 5EWGA 3LVWA 1L6NA 8ICZA 4UAWA 1BPYA 3L4PA 2AGPA 3PMLA 1D8LA 4F4ZA 5J0TA 3A0BU 2DBYA 2H3QA 3G6VA 5CHGA 2KZ3A 4F4YA 2W03A 4KTQA 4KLGA 2HOFA 2OEHA 5ALWA 2XO7A 3T5JA 3ORYA 9ICAA 2Y9TA 1FEZA 3FM9A 1FFUA 3PW4A 4PGXA 3M6ZA 1RXWA 4O0IA 3EWAA 4QZ8A 5J0RA 1CEZA 4OJ5A 5AM0A 4ED2A 3TADA 2I9GA 4O3MA 3ZD9A 1SZPA 2W3RA 2H3IA 1KEJA 3SV4A 2PFPA 3C23A 2LYHA 4KX5A 2KZMA 8ICTA 3JPPA 3AL0B 3PR5B 8ICYA 1TKDA 2JEGA 4I29A 3GIKA 5J8YA 4RQ6A 2F2AB 5AK3A 1Z00B 1YT3A 4RQMA 2HDOA 4YP3A 3V6HA 4UB3A 4PHAA 2KNJA 2I1QA 1ZQDA 4P0PB 5ALJA 4RUCA 3G6YA 2ASDA 2ZIXB 3L3FX 4DS4A 4DSEA 3ICXA 3MR2A 1MN8A 1HUOA 5AKZA 4P0QA 2KKPA 1ZETA 3U26A 2FI1A 3R9KA 5KG0A 2EAMA 1N48A 5F9NA 1KFDA 4OJOA 4ED7A 5AKYA 9ICSA 4C4TA 3OJSA 1ZD4A 2KVCA 4B9LA 1X9MA 5ALMA 4B6JA 1ED1A 5DQGA 2FPLA 4IL6U 4DL7A 4GLXA 3KHHA 5J29A 5E79U 4MEXA 3D2SA 3FYHA 4Y2XA 1HEKA 5CWRA 1RXVA 1NJXA 3CW2C 2PI4A 4ED3A 5AKJA 3G6XA 2JEIA 3QUBA 1M6YA 1Y88A 3L5KA 2IA6A 4M6WB 1ZQ1C 1PZNA 4M47A 2LPEA 2FPKA 4NM1A 4DEZA 3QZ7A 3MDCA 5KFQA 4RZRA 4ECZA 1WCLA 4I2IA 5BPCA 5KT4A 1CI4A 7ICNA 2KTQA 2B21A 5KT2A 1NKCA 3RRGA 4QZFA 9ICOA 1B4FA 5KFNA 1NK5A 3JPSA 2P6UA 3M1YA 3TAPA 1ZQPA 1SV0C 4B9VA 1LKYA 4XA5A 9ICBA 2WAQC 2RRDA 4QZDA 4MFCA 3HRDD 3BS7A 3HWTA 2WHEA 3E2EA 4I2JA 1QQ7A 4B9NA 1Q3UA 9ICTA 3ZD8A 2D3DA 3O0FA 2Z7JA 5ALEA 2FE9A 5EWFA 3OHBA 3N7PD 4C80A 1L8LA 2R8GA 4RQNA 2KN7A 2F8KA 3H8MA 5DLGA 2E1EA 1U47A 5J0WA 1A0PA 3PW2A 4HAIA 1BPXA 1JI7A 3QU5A 4IQTA 2BQRA 4FZMA 2K8AA 2HOQA 4JK1A 5KFXA 2AH5A 1HIWA 2BHNA 1ZQSA 2EDUA 3KZXA 3M8RA 4G3IA 5AK4A 3HP6A 3PX6A 4C4SA 5DGBA 2IHNA 1V38A 4DLGA 3RBDA 4IR9A 2E8PA 5EOZA 2W9MA 4P2HA 2B0CA 5DG9A 3F2DA 1XC9A 5DLFA 4Y2PA 4FFDA 3VC8A 2UVVA 3FAHA 4CF5A 5G5GA 3DV9A 4DFKA 1NNLA 3V7KA 4ZOHC 7ICJA 2LHTA 4O3NA 4ELVA 2FJ6A 8ICBA 4Z6FA 3AU2A 5J2IA 8ICCA 2DPIA 4F71A 3OSNA 1ZD5A 1JXEA 4PHPA 4DQRA 4TUPA 3KOOA 4F5QA 5CB1A 2AU0A 4R65A 4C7ZA 2EZYA 4YD2A 2AGOA 4F5NA 1S5LU 2FDRA 2MAXA 4OJPA 1RQNA 4UAZA 4P4PA 7ICQA 2QLTA 3F2BA 3HJEA 2DF4B 4YQWA 2ZTCA 7ICMA 2Q4TA 3EYZA 4M04A 8ICNA 3QU7A 2VJ4A 1SIJA 3ZDEA 8ICWA 4YN4A 1N5XA 3TKAA 3B0YA 5KFLA 1L5UA 5L1MA 2HBLA 4M2YA 2YMQA 1HUZA 2BCRA 3UXPA 3AM9A 3N7SC 5T14A 3RB0A 4I28A 2F3NA 5K4LA 4IR1A 3SD7A 1SWVA 1MC8A 3NS1A 4RU9A 3PO5A 2F77X 3UM9A 1RZTA 2MUTB 3MGIA 2ZIWB 3BQ7A 4K4GA 3JPTA 2YX8A 2G07A 2ZJ5A 2ISPA 2Y0SC 2W9BB 2ASJA 3HW8A 3V72A 3SZ2A 2KSOB 2W8KA 1X6JA 4NLBA 3GU3A 8ICHA 1ZQFA 3WK4A 5BOLA 5DB8A 1AROP 5AKEA 2OHFA 3LYSA 4AYBF 2LKYA 3PV8A 4CGZA 1BPDA 1ZQJA 2OYYA 3LVVA 4O3RA 5HR6A 5AK6A 4YFKA 9ICFA 2BGWA 4IS7A 2E3TA 2Y0SF 4GFJA 4I2HA 3TFSA 5AKLA 5J2JA 1ZRNA 4F8RA 5ALNA 4K4HA 3M9OB 3IN5A 8ICSA 3PSPA 9ICRA 4ACOA 5EE0A 1QQ5A 4KLFA 2KE7A 3RTVA 2KIWA 5EE1A 2ZXIA 2MRLA 4RQ4A 3K75D 1Z19A 2KMDA 3HKZC 2WTFA 1L7MA 1X6IA 2RP5A 3N7RC 4FZLA 5KFRA 4Y2UA 4YXJA 2BCVA 3H8SA 2KJ9A 9ICEA 1X42A 3WK9A 2JGAA 1QLNA 4Z6DA 9ICCA 4UARA 4Q43A 3AMZA 2F1IA 3KZIU 4C4RA 2EQYA 2EAOA 4M9JA 2P66A 1T94A 4DSLA 9ICPA 5HMMA 1SB3C 5AI5A 5J0YA 3SMVA 2CXYA 3ISDA 3HKZF 4DQQA 2C2EA 4CF3A 2W9CA 3V7LA 3LWMA 3I1YA 4GIBA 3V7JA 1UT5A 2PFQA 2DKXA 1ZRMA 4I27A 4DL6A 4PH5A 4MFAA 4PL1A 3PSTA 1HJPA 2VIXA 2W55A 1SKWA 2BCSA 2UVRA 3PX0A 5C5JA 3KKAA 1RQLA 1KW4A 4KLLA 1TK8A 4J9KA 4JB3A 3ISCA 1KKXA 4X5VA 1YZ6A 5CP2A 4CE6A 3GFKB 2WF9A 4UATA 2VKQA 2HW3A 2ZTEA 5AKHA 3SI8A 2YQEA 4DOBA 4BJQA 4KLMA 1B22A 1MQ2A 1RM6C 1QSLA 5L1JA 3B9JA 3UMCA 1TAQA 3UMGA 5ALQA 2CPRA 5TISU 4JWNA 2BCUA 7ICIA 4KLQA 4UBCA 4EBCA 8ICVA 1RDFA 1J97A 2ES6A 3H4DA 3QU4A 5KFEA 1ZQBA 3ALRA 2NRWA 2XI9A 5AKGA 1U48A 1Z1BA 1LB2B 3MGHA 2KEYA 2E8NA 3QUQA 3KHGA 3GDXA 3D6JA 8ICMA 3GIJA 5L9XA 1ZXIA 3RAQA 4BXOA 3H7IA 5IIJA 4PGQA 4F92B 4ED6A 1NJZA 4CDGA 1UA1A 1D8BA 1RG6A 4IRDA 5AI6A 3BDPA 4DS5A 1PVPA 5KG7A 2BZFA 1U4BA 1YZ7A 2IOFA 4TUQA 3ETLA 4U6PA 1Z3EB 1OW5A 1V85A 2IHMA 5CEHA 9ICHA 5ALPA 1ZQYA 4UQGA 1JMSA 4NLGA 3Q8MA 4C0ZA 3RJJA 1NK7A 3M9MB 5KFFA 5AKIA 4YVZA 1RYUA 3KHRA 2OM6A 4DCCA 4J9SA 1IV8A 4XUSA 4FO6A 3PW5A 4EZ9A 4PHDA 4EYIB 7ICSA 1TK0A 4A8EA 1QTMA 2YB1A 8ICFA 3AN1A 2ZXHA 5C0YA 4TURA 4J9OA 2K60A 3PSIA 5DBBA 3BQ2A 4J9RA 2K4HA 3NVVA 4QZIA 2JEJA 5AIBA 5KFSA 1N63A 5L1KA 2AHOB 4TQRA 5J0OA 3MFHA 4M0AA 3V6KA 3HPOA 2W8LA 2AXTU 3C21A 4USAA 3CNHA 1NZBA 3NRZA 2ISOA 4R66A 5J0SA 1N62A 4I2EA 5ALXA 4DOCA 4QJFB 5A0LA 1ZQXA 1NJWA 1ZQQA 4F3OA 4ECRA 2HCFA 4LZDA 3RH5A 4P0QB 2VA2A 3B0XA 2XCAA 1B0XA 1TE2A 2L5YA 4PZOA 1D9DA 1KRPA 4O3OA 1F0MA 3QE9Y 5H2FU 2F1JA 3QUTA 2PFOA 2Y9UA 2PKEA 1COKA 2VA8A 5KFCA 5B5EU 1XSPA 2Q0ZX 4F4XA 3M9NB 4B9UA 3TQ1A 5EE3A 3JPRA 5ALFA 4QZ9A 4NLZA 2WF7A 4QZHA 3MR6A 2I5HA 1JX4A 3ONNA 1NI3A 5J2AA 3C5GA 2B6GA 2FMQA 4I2CA 4F91B 2JH1A 4M9NA 2F8LA 3CP8A 4P0PA 4F72A 3PNCA 2NO4A 4I2BA 2G5HB 3QEAZ 2LYBA 3LDAA 3K4GA 4IRKA 4QWEA 4EZ6A 4DSKA 4ED8A 1TV9A 4JV1A 4PPXA 3Q8SB 2GH1A 4Q44A 1ZQIA 1LKYB 2HBMA 5AICA 5L1LA 4KLUA 3MABA 2NRZA 4MFFA 2K4PA 1PK1A 4NL9C 2W7PA 3LWLA 2GOLA 3RJGA 5J2HA 3SAFA 2BQ3A 2VANA 5AM3A 2NRTA 4K4IA 1PUZA 5DB6A 2UVUA 2JV3A 2KFNA 4TQSA 4RQ1A 5ALYA 5KG2A 2XGPA 4Q8EA 2IOHA 4J9NA 3WU2U 2G08A 1S0MA 1V9PA 4YR0A 4KLTA 5JTIA 1SGGA 2C2DA 2IBKA 2YN4A 4KMUA 1BPZA 2EZXA 5KT7A 5ALOA 5KFKA 1Q3VA 7ICUA 2F44A 2FPMA 3WK8A 4U7CA 2MU2A 2QARB 1SL0A 2RQ5A 9ICWA 2G06A 7ICHA 2K8CB 2W54A 4F50A 1NK0A 4EELA 5KFAA 3SENA 1ZQVA 3RBEA 7ICRA 1L3TA 1WCNA 3M8SA 3PW0A 2V9WA 1XO0A 5KAIU 5DG8A 3PSFA 4BGDA 3QEBZ 4UBBA 2ZUDA 3KHLA 3NUQA 1P7DA 2ZJ8A 3RB3A 1N61A 5L1IA 1UCVA 1UA0A 1L8OA 4WJ3B 3OTQA 4GC7A 5KL8B 2JHDA 1SWWA 9ICQA 5ALGA 3E58A 1S10A 4C8OA 1NKEA 1VJ5A 4DO9A 3KTQA 4BWMA 3HT3A 2EANA 4FS2A 4ECTA 1V97A 4RNOA 1SL1A 3GIIA 2GLEA 4EX7A 3DEEA 4BUGA 3K1ZA 3SYZA 2YTUA 2RHFA 5GTHU 3EUB2 2JMGA 2M9NA 2EH9A 5HMLA 5DKWA 1XSLA 3UXNA 2O6KA 3F5AA 1MQ3A 1XNSA 5ALVA 1XU4A 1BPEA 2K4EA 1BPBA 4OJ6A 5ALUA 4YMMA 1ZQHA 4IQWA 3BS5A 4M9HA 2V4QA 4OD0A 2HHVA 1Z4NA 2E8MA 1FO4A 1ZQNA 5CR0A 1H38A 2WB1C 4F5OA 5KTQA 2NRXA 2G0AA 5D4BA 2WF5A 3QU2A 9ICLA 2AQ4A 1LV5A 1WUDA 2XVTA 5G5HA 3ED5A 5TZVA 5HHIA 3WK5A 4KLHA 3F53A 4F5RA 3T5LA 4I2FA 1S76D 5DBCA 4US9A 1T3NA 1QH9A 3N28A 3I28A 1F5SA 2QB1A 3GZFA 4AYBC 4F93B 3F5EA 2PMZF 2I6XA 1N2XA 5J2BA 2WB1F 2KG5A 1SKRA 1S8OA 4C8NA 3WK6A 4R8UA 4UB1A 4O3SA 2XGQA 2XY5A 4NLNA 1NK8A 1J2MA 5CA7A 4DL4A 2VA3A 5J2FA 1DK2A 4UAUA 2MSNA 2MA1A 1Z1VA 4EX6A 4O9MA 1ZD3A 3C29A 1GO3F 2EAPA 1X40A 1UPHA 3SAHA 4DF8A 1COOA 2ZIUA 1SV4A 2NO5A 3N97B 1WWVA 4DFDA 1D9FA 1JUDA 3MC1A 2KIVA 1CRXA 1SV0A 8ICLA 5F3XB 1NK6A 2NRVA 5ALTA 4YMOA 3MGVA 3Q8LA 4YR2A 2KSOA 2XC9A 2H3ZA 3V6JA 2PI5A 2FLNA 3QUCA 3IHQB 4P4OA 5KFJA 3JPQA 4B9SA 3T5HA 2ZIVA 4O5KA 4F2SA 5DQIA 5KAFU 2CRXA 3PVXA 2K8BB 5D49A 4J9MA 1NZPA 1UQVA 4QZAA 2WF6A 1BVSA 4UB8U 1TAMA 4JUZA 4TUSA 5ALHA 4MF2A 2KICA 2KK0A 3PY8A 1KFSA 4FBTA 3OSPA 3RJHA 4ED1A 2HHSA 2ALZA 1ZD2P 2W11A 1AQ6A 1KBUA 4P4MA 2W9CB 4JV2A 4O3QA 3TADC 1MA7A 5ALKA 3OHAA 5AI9A 1EXNA 5AI0A 8ICUA 1S77D 4QW8A 5IIMA 3BZCA 5KFTA 3ZDCA 3RRHA 4NY8A 1ZYQA 2HHQA 7ICTA 2JEFA 2HBJA 9ICMA 5J8YC 2JH7A 3WKCA 1X9XA 3S6JA 1NJYA 4RQ5A 4RNMA 4UB4A 4ZH4A 2K4IA 3RF9A 3EPGA 1ZQGA 4Z6CA 1UT8A 3IP4B 2QB0B 4IRCA 8ICXA 4GXIA 5J2CA 4EBEA 1T8EA 4Q8FA 2BR0A 2N1RA 4QZCA 2AGQA 3ZDBA 2W9AA 2H5XA 2BKEA 4PJ0U 2NV3A 3QZ8A 4MHVA 1PVQA 1XO1A 2HHTA 5ALRA 4RQ3A 4O5EA 4R63A 3GQCA 3Q8PB 1C20A 1LVHA 3RH4A 4YMNA 5KFOA 8ICJA 5B66U 2FMPA 5AIAA 5JU5A 1JXLA 5AKXA 7ICPA 5ALDA 5ALLA 4KMOB 4ED0A 4YR3A 1L7NA 2XIDA 3RFAA 1ZQTA 4ELTA 3C2MA 1X2IA 3RB4A 4US8A 3JPNA 2HHXA 3NTUA 2G5IB 3OPXA 3WKDA 3RJFA 3RR7A 3C2LA 5KFVA 2A1JA 3AU6A 3WKBA 5AM1A 3C28A 3RAXA 5J0XA 1K5OA 7ICEA 1Z4OA 4DQSA 1KQQA 3IM1A 4UASA 3C5FA 1URJA 4YXMA 4NLCA 4YCXA 3EZ5A 4DOAA 1UHUA 5CJ7A 1C7YA 4G9BA 4MEYA 1DXSA 1X9WA 4J03A 4ECYA 2CN1A 4I2AA 3IG5A 1L7OA 1L3SA 3UMBA 4KLSA 4JV0A 5HHHA 5JUMA 2HHUA 3AQFA 3SR6A 1KLNA 1QCKA 2ASLA 4F4WA 1ZQZA 3NVZA 3GV7B 4KLOA 5DQHA 1JRPA 3THVA 2DQNB 4YG2A 2JZBA 1D8YA 2BPFA 9ICIA 5KFHA 2W43A 1NKBA 5AK5A 1ZOLA 1XWLA 3TAQA 4DFPA 5JRTA 2R8IA 4PZNA 3WK7A 4B9MA 1K1QA 5ALZA 3FC4A 3AQEA 3KFUF 2E1FA 4RQ2A 4ICAA 2VJ5A 1WWUA 2WFAA 1NK4A 1ZQMA 2K89A 4BDPA 4BX9C 2HI0A 3J81j 1S0OA 4PL2A 4DL3A 7ICLA 4ECVA 1KL9A 4KLEA 5EWEA 4EBDA 4RUAA 5KFIA 1X66A 3FDSA 2YY6A 3SEIA 5DDMA 3K1RB 3QYPA 4UB2A 1RYRA 4QWCA 2H3FA 3CYMA 2LBOA 4Y2RA 8ICRA 4QZEA 5AI4A 4R64A 7ICKA 3NVYA 2ZJAA 4OCZA 1ZQAA 2JRZA 3ISBA 2DWQA 4DL2A 1F44A 1IIPA 1WG8A 2ZUBA 5FP0A 2E8OA 4FZNA 5KFZA 1TVAA 2LYAA 1DGSA 4NXZA 9ICNA 2FLPA 4QWDA 2JXJA 5KT6A 2KV2A 8ICEA 2ZTDA 4I2GA 2ZG6A 4DQPA 4NM2A 4DWIA 3GV5B 1Z00A 2V4RA 4J9QA 4CRXA 3WKAA 5AM5A 7ICOA 5KFBA 3H40A 4FE3A 4QNLA 5HP4A 3I76A 4LVSA 2ZIXA 4RPYA 4JMUA 4OO1J 3Q8RB 2H3VA 2IOFK 1PK3A 1U9LA 2LM1A 1SXEA 3KBBA 4QWAA 1KDHA 4GXJA 1NK9A 1PK1B 4NLKA 4C8LA 4QWBA 3H0MB 2NYVA 5KFUA 4LJXA 2DKZA 3T79A 8ICIA 2ODGA 4EEKA 5KFPA 1T7PA 1SXDA 5KNIA 2OWOA 1U45A 4F2RA 3F2CA 2KHVA 2DPJA 2UVWA 4Y2YA 8ICPA 2W7OA 5AI8A 5ALSA 5KG1A 4C8KA 1VDVA 3H0RB 4Y2TA 3C1YA 2XICA 3MR3A 1WYGA 3PMNA 2KHQA 2FLLA 5J2GA 1DRGA 3BJYA 2OCEA 2A3VA 2J6TA 2RDIA 1KTQA 1IG6A 3DDHA 4M6WA 1Q8KA 3UQ2A 1ZQKA 3IV6A 3IRUA 1IXRA 3C1ZA 4UAYA 1ZQCA 5J0PA 4KITB 4KX3A 3NASA 1ZQLA 1KFTA 3PW7A 4EENA 2J6UA 4CF4A
chains in the Genus database with same CATH topology
5HR6A 2LYBA 3VCBA 1PVRA 1SZHA 4WJ3B 2OH2A 2OM6A 2MA1A 4QIWC 2Y0SF 4GFJA 4OJ5A 2KV2A 5KL8B 3C29A 2JHDA 3H0LB 1ECWA 4O3MA 1GO3F 2ZG6A 2K4IA 3RF9A 3M6ZA 1UPHA 3IN5A 2DQNB 3SAHA 2GH1A 2H3IA 3IG8A 3PSPA 4KX5A 4ACOA 2WAQC 2RRDA 3IP4B 2VKQA 4A8EA 4CRXA 2ZIUA 2KD1A 2YB1A 3AL0B 2HBMA 2KIWA 4OJPA 4BJQA 5HR7A 2KOBA 2ZXHA 4FE3A 2ZXIA 4QNLA 5C0YA 2HOIA 2WAQF 1Q3UA 2F2AB 2MRLA 2ZIXA 2N1RA 3M7DA 3PSIA 3DEEA 4JMUA 1YT3A 4BUGA 4OO1J 2ZIUB 3K1ZA 3O0FA 2H3VA 2Z7JA 2W7PA 2K4HA 2RHFA 1Z19A 3SAGA 3F2BA 2JMGA 2KNJA 4P0PB 2DF4B 3N7PD 2BDUA 2GOLA 2NV3A 3HKZC 4OJLA 1CRXA 2CPRA 2Q4TA 3SAFA 2ZIXB 3AQEA 3L3FX 3KFUF 1PVQA 2E1FA 2RP5A 3MGVA 4ICAA 4NV0A 2VJ5A 2F76X 2E1EA 3F5AA 2VJ4A 3ICXA 3N7RC 4FZLA 4QIWF 1A0PA 3H0MB 3AQFA 1NZBA 1XNSA 2HMXA 2H3ZA 2KKVA 4P0QA 2D6FC 2KJ9A 2HBLA 2KKPA 3T79A 3CRXA 3NRWA 2JGAA 2G08A 2K4EA 3ALRA 3N7SC 4QJFB 2OXOA 4FZMA 5A0LA 5T14A 4OJ6A 2XI9A 2K8AA 2ZIVA 4IC9A 4NWIA 2HOQA 2ZIWA 4P0QB 2K89A 1Z1BA 4BX9C 2HBKA 4KMOB 4OJOA 2WB1C 1T94A 1HIWA 2F77X 2KHVA 2XIDA 2KEYA 4PL2A 3RFAA 3F2CA 2CRXA 3KZXA 2G0AA 2K8BB 2W7OA 2ZIVB 2KVCA 2R18A 2ZIWB 2G5IB 3SMVA 3OPXA 2W04A 3HKZF 3PZPA 3SQIA 3LVWA 1Q3VA 1L6NA 1WUDA 1TAMA 3H0RB 2XVTA 2XICA 2YX8A 1ED1A 2G07A 2KJ5A 4U7CA 3C28A 3M6KA 2YB4A 4CDGA 2Y0SC 3F2DA 2KICA 3F53A 2KHQA 2DGZA 2G06A 1DRGA 2A3VA 1D8BA 2K8CB 3D2SA 1OUQA 3VC8A 2H3QA 2H3FA 3CYMA 2PMZC 2LBOA 1HEKA 1URJA 4NLCA 3GZFA 4NLBA 4AYBC 1PVPA 3GU3A 1KBUA 1MA7A 5CRXA 2M0NA 2LHTA 3D2QA 3D2NA 1A6SA 3F5EA 2W03A 2PMZF 3ONNA 3LYSA 2E5SA 1XO0A 4AYBF 2LKYA 4U6PA 5KL1B 2HOFA 3E0FA 3PSFA 2CN1A 2WB1F 4KX3A 4PL1A 2JH1A 1F44A 2KJ8A 3PSTA 4CGZA 1ZQ1C 1IIPA 2F8LA 3CP8A 4P0PA 2VIXA 2OYYA 3NUQA 1P7DA 2HBJA 3IG5A 4C0ZA 4FZNA 3LVVA 2JH7A 2G09A 2G5HB 2LYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5A A;  2JH7 A;  2JHD A;  2JH1 A;  3F5E A;  2LBO A;  3F53 A; 
#chains in the Genus database with same CATH topology
 4RPZ A;  3GIL A;  3ZDA A;  1ECW A;  3UXO A;  8ICG A;  2KP7 A;  2RLT A;  4KLJ A;  5KFW A;  1FIQ A;  1KSP A;  2HHW A;  1L7P A;  2LMR A;  3WKE A;  2KFZ A;  2WAQ F;  3NVW A;  8ICA A;  1K1S A;  4IQV A;  3GIM A;  3Q8K A;  2R8J A;  1S0V A;  5KT5 A;  4OJL A;  2RDJ A;  2W3S A;  1MSW D;  2QAR A;  4DLE A;  2P6R A;  4RPX A;  2HSZ A;  2D8C A;  1ZJM A;  4QZG A;  2HMX A;  4CCH A;  2D6F C;  2OXO A;  1BNO A;  4M9L A;  5J2E A;  2A1A A;  4FBU A;  1JN3 A;  5EE9 A;  7ICG A;  3RJI A;  4IQU A;  3BS5 B;  4RQ8 A;  3QXG A;  3PZP A;  3SQI A;  4KLD A;  1BGX T;  3KKA C;  4DQI A;  5J0Q A;  3MDA A;  3TAN A;  2DGZ A;  4O5C A;  4KLI A;  1ZQO A;  3HX0 A;  2PMZ C;  4M9G A;  5CRX A;  5IIN A;  1TAU A;  2M0N A;  3D2Q A;  2P35 A;  4DSF A;  4DSI A;  2IMW P;  4JWM A;  1XS9 D;  3QX7 A;  5J2D A;  5KL1 B;  5AM4 A;  5IIL A;  5KG5 A;  4J9L A;  2F1H A;  2WF8 A;  3MFI A;  1TFR A;  1ZJN A;  4DL5 A;  3RH6 A;  3VCB A;  5J0U A;  2OH2 A;  2FMS A;  5KFG A;  4R8U B;  1O08 A;  5KFY A;  4F4K A;  2GO7 A;  1B43 A;  4FS1 A;  1XSN A;  9ICV A;  2LM4 A;  1Q46 A;  3IG8 A;  5D46 A;  2KD1 A;  5DBA A;  5HR7 A;  9ICX A;  2YML A;  4ECX A;  2XY7 A;  5AM2 A;  3BQ1 A;  9ICU A;  1RPL A;  1TK5 A;  2ZIU B;  3T5K A;  4ELU A;  5AHX A;  1JAL A;  1QSS A;  3RR8 A;  3MBY A;  1N60 A;  5ALI A;  1DGJ A;  4DFJ A;  1SL2 A;  2R8H A;  3TI0 A;  1T4G A;  7ICF A;  3ZI4 A;  1BNP A;  4NL9 A;  5IIK A;  4KN4 A;  3Q8Q B;  2MUT A;  3JPO A;  2ZIW A;  8ICQ A;  5IIO A;  5DG7 A;  5DDY A;  1QSY A;  2PFN A;  2Y1J A;  4C7Y A;  3H8J A;  2ZIV B;  4GXK A;  3HIL A;  2W9B A;  2BPG A;  2W04 A;  3BQ0 A;  3A0H U;  4ECQ A;  2KJ5 A;  3M6K A;  2YB4 A;  4B9T A;  3RJE A;  1S9F A;  2BDP A;  4NJ8 A;  1N56 A;  1OUQ A;  1IM4 A;  2C2R A;  3OJU A;  4UB5 A;  4AP9 A;  1DK3 A;  4Y2V A;  2HVH A;  2LI6 A;  9ICJ A;  4Q45 A;  3E0F A;  2JR5 A;  1S97 A;  2KJ8 A;  4GC6 A;  4HYK A;  4UAV A;  2BCQ A;  2HVI A;  3H8W A;  2G09 A;  4Y2Q A;  3TAC B;  1PVR A;  1CUK A;  2QKQ A;  9ICG A;  4UW9 A;  4PHE A;  4QIW C;  1L3V A;  3EPI A;  4DSJ A;  3PO4 A;  2ATL A;  2C28 A;  1U49 A;  3LK9 A;  2KVS A;  1RYS A;  1ZQW A;  4XQ8 A;  3RB6 A;  5KG6 A;  2XCP A;  4ECS A;  1ZQU A;  3NGD A;  2KOB A;  4RT2 A;  4RQ7 A;  3M7D A;  3EW9 A;  3BQT A;  2Y1I A;  5KG3 A;  3SAG A;  4J9P A;  4UB6 U;  5KG4 A;  5BOM A;  4Y2S A;  4Y2J A;  1KN5 A;  4I2D A;  4NV0 A;  2BQU A;  4DF4 A;  4E0D A;  4QIW F;  1A77 A;  2DUY A;  5KFM A;  4RT3 A;  1ZQE A;  3CRX A;  1A76 A;  3NRW A;  2AJQ A;  4MF8 A;  2XY6 A;  3IDW A;  3QU9 A;  3QNM A;  5KFD A;  2DL0 A;  3MR5 A;  3GV8 B;  2HBK A;  3UQ0 A;  2KZZ A;  1JIH A;  5F9L A;  2A19 A;  2R18 A;  2AQ0 A;  5KT3 A;  1DOQ A;  8ICK A;  3BZK A;  2R8K A;  1JRO A;  4RNN A;  4KN7 A;  3AEV A;  1O03 A;  4F5P A;  4DFM A;  2PXI A;  2A1J B;  2QB0 A;  2ZUC A;  3D2N A;  1A6S A;  5HNK A;  3AUO A;  1L3U A;  2E5S A;  5DB7 A;  1SKS A;  2YMP A;  5GTI U;  4EEY A;  1T3Q A;  5DGA A;  2C22 A;  1X9S A;  1ZQR A;  2DFL A;  1N5W A;  1SZH A;  4QZB A;  3KD3 A;  3ZDD A;  4O3P A;  4BXO B;  7ICV A;  3H0L B;  1NOM A;  4Z6E A;  8ICO A;  3PR4 A;  2J6S A;  4PGY A;  4EYH B;  3TAR A;  3ETR A;  5III A;  4ECW A;  2GWS A;  2HOI A;  2JZB B;  5AKK A;  5J2K A;  3PX4 A;  2BDU A;  2EZZ A;  4CNQ A;  4YD1 A;  1J2N A;  3C2K A;  2F76 X;  3H4B A;  2KKV A;  4XRH A;  2YMM A;  4ECU A;  1FFV A;  2BPC A;  1QQ6 A;  5DB9 A;  9ICK A;  3RJK A;  1S0N A;  4IC9 A;  4NWI A;  2ESE A;  1VLB A;  3N4M B;  4RQ0 A;  3T3F A;  3TFR A;  3OGU A;  1OXJ A;  4BWJ A;  3SV3 A;  4C8M A;  3UPQ A;  4QW9 A;  4LZG A;  5EWG A;  3LVW A;  1L6N A;  8ICZ A;  4UAW A;  1BPY A;  3L4P A;  2AGP A;  3PML A;  1D8L A;  4F4Z A;  5J0T A;  3A0B U;  2DBY A;  2H3Q A;  3G6V A;  5CHG A;  2KZ3 A;  4F4Y A;  2W03 A;  4KTQ A;  4KLG A;  2HOF A;  2OEH A;  5ALW A;  2XO7 A;  3T5J A;  3ORY A;  9ICA A;  2Y9T A;  1FEZ A;  3FM9 A;  1FFU A;  3PW4 A;  4PGX A;  3M6Z A;  1RXW A;  4O0I A;  3EWA A;  4QZ8 A;  5J0R A;  1CEZ A;  4OJ5 A;  5AM0 A;  4ED2 A;  3TAD A;  2I9G A;  4O3M A;  3ZD9 A;  1SZP A;  2W3R A;  2H3I A;  1KEJ A;  3SV4 A;  2PFP A;  3C23 A;  2LYH A;  4KX5 A;  2KZM A;  8ICT A;  3JPP A;  3AL0 B;  3PR5 B;  8ICY A;  1TKD A;  2JEG A;  4I29 A;  3GIK A;  5J8Y A;  4RQ6 A;  2F2A B;  5AK3 A;  1Z00 B;  1YT3 A;  4RQM A;  2HDO A;  4YP3 A;  3V6H A;  4UB3 A;  4PHA A;  2KNJ A;  2I1Q A;  1ZQD A;  4P0P B;  5ALJ A;  4RUC A;  3G6Y A;  2ASD A;  2ZIX B;  3L3F X;  4DS4 A;  4DSE A;  3ICX A;  3MR2 A;  1MN8 A;  1HUO A;  5AKZ A;  4P0Q A;  2KKP A;  1ZET A;  3U26 A;  2FI1 A;  3R9K A;  5KG0 A;  2EAM A;  1N48 A;  5F9N A;  1KFD A;  4OJO A;  4ED7 A;  5AKY A;  9ICS A;  4C4T A;  3OJS A;  1ZD4 A;  2KVC A;  4B9L A;  1X9M A;  5ALM A;  4B6J A;  1ED1 A;  5DQG A;  2FPL A;  4IL6 U;  4DL7 A;  4GLX A;  3KHH A;  5J29 A;  5E79 U;  4MEX A;  3D2S A;  3FYH A;  4Y2X A;  1HEK A;  5CWR A;  1RXV A;  1NJX A;  3CW2 C;  2PI4 A;  4ED3 A;  5AKJ A;  3G6X A;  2JEI A;  3QUB A;  1M6Y A;  1Y88 A;  3L5K A;  2IA6 A;  4M6W B;  1ZQ1 C;  1PZN A;  4M47 A;  2LPE A;  2FPK A;  4NM1 A;  4DEZ A;  3QZ7 A;  3MDC A;  5KFQ A;  4RZR A;  4ECZ A;  1WCL A;  4I2I A;  5BPC A;  5KT4 A;  1CI4 A;  7ICN A;  2KTQ A;  2B21 A;  5KT2 A;  1NKC A;  3RRG A;  4QZF A;  9ICO A;  1B4F A;  5KFN A;  1NK5 A;  3JPS A;  2P6U A;  3M1Y A;  3TAP A;  1ZQP A;  1SV0 C;  4B9V A;  1LKY A;  4XA5 A;  9ICB A;  2WAQ C;  2RRD A;  4QZD A;  4MFC A;  3HRD D;  3BS7 A;  3HWT A;  2WHE A;  3E2E A;  4I2J A;  1QQ7 A;  4B9N A;  1Q3U A;  9ICT A;  3ZD8 A;  2D3D A;  3O0F A;  2Z7J A;  5ALE A;  2FE9 A;  5EWF A;  3OHB A;  3N7P D;  4C80 A;  1L8L A;  2R8G A;  4RQN A;  2KN7 A;  2F8K A;  3H8M A;  5DLG A;  2E1E A;  1U47 A;  5J0W A;  1A0P A;  3PW2 A;  4HAI A;  1BPX A;  1JI7 A;  3QU5 A;  4IQT A;  2BQR A;  4FZM A;  2K8A A;  2HOQ A;  4JK1 A;  5KFX A;  2AH5 A;  1HIW A;  2BHN A;  1ZQS A;  2EDU A;  3KZX A;  3M8R A;  4G3I A;  5AK4 A;  3HP6 A;  3PX6 A;  4C4S A;  5DGB A;  2IHN A;  1V38 A;  4DLG A;  3RBD A;  4IR9 A;  2E8P A;  5EOZ A;  2W9M A;  4P2H A;  2B0C A;  5DG9 A;  3F2D A;  1XC9 A;  5DLF A;  4Y2P A;  4FFD A;  3VC8 A;  2UVV A;  3FAH A;  4CF5 A;  5G5G A;  3DV9 A;  4DFK A;  1NNL A;  3V7K A;  4ZOH C;  7ICJ A;  2LHT A;  4O3N A;  4ELV A;  2FJ6 A;  8ICB A;  4Z6F A;  3AU2 A;  5J2I A;  8ICC A;  2DPI A;  4F71 A;  3OSN A;  1ZD5 A;  1JXE A;  4PHP A;  4DQR A;  4TUP A;  3KOO A;  4F5Q A;  5CB1 A;  2AU0 A;  4R65 A;  4C7Z A;  2EZY A;  4YD2 A;  2AGO A;  4F5N A;  1S5L U;  2FDR A;  2MAX A;  4OJP A;  1RQN A;  4UAZ A;  4P4P A;  7ICQ A;  2QLT A;  3F2B A;  3HJE A;  2DF4 B;  4YQW A;  2ZTC A;  7ICM A;  2Q4T A;  3EYZ A;  4M04 A;  8ICN A;  3QU7 A;  2VJ4 A;  1SIJ A;  3ZDE A;  8ICW A;  4YN4 A;  1N5X A;  3TKA A;  3B0Y A;  5KFL A;  1L5U A;  5L1M A;  2HBL A;  4M2Y A;  2YMQ A;  1HUZ A;  2BCR A;  3UXP A;  3AM9 A;  3N7S C;  5T14 A;  3RB0 A;  4I28 A;  2F3N A;  5K4L A;  4IR1 A;  3SD7 A;  1SWV A;  1MC8 A;  3NS1 A;  4RU9 A;  3PO5 A;  2F77 X;  3UM9 A;  1RZT A;  2MUT B;  3MGI A;  2ZIW B;  3BQ7 A;  4K4G A;  3JPT A;  2YX8 A;  2G07 A;  2ZJ5 A;  2ISP A;  2Y0S C;  2W9B B;  2ASJ A;  3HW8 A;  3V72 A;  3SZ2 A;  2KSO B;  2W8K A;  1X6J A;  4NLB A;  3GU3 A;  8ICH A;  1ZQF A;  3WK4 A;  5BOL A;  5DB8 A;  1ARO P;  5AKE A;  2OHF A;  3LYS A;  4AYB F;  2LKY A;  3PV8 A;  4CGZ A;  1BPD A;  1ZQJ A;  2OYY A;  3LVV A;  4O3R A;  5HR6 A;  5AK6 A;  4YFK A;  9ICF A;  2BGW A;  4IS7 A;  2E3T A;  2Y0S F;  4GFJ A;  4I2H A;  3TFS A;  5AKL A;  5J2J A;  1ZRN A;  4F8R A;  5ALN A;  4K4H A;  3M9O B;  3IN5 A;  8ICS A;  3PSP A;  9ICR A;  4ACO A;  5EE0 A;  1QQ5 A;  4KLF A;  2KE7 A;  3RTV A;  2KIW A;  5EE1 A;  2ZXI A;  2MRL A;  4RQ4 A;  3K75 D;  1Z19 A;  2KMD A;  3HKZ C;  2WTF A;  1L7M A;  1X6I A;  2RP5 A;  3N7R C;  4FZL A;  5KFR A;  4Y2U A;  4YXJ A;  2BCV A;  3H8S A;  2KJ9 A;  9ICE A;  1X42 A;  3WK9 A;  2JGA A;  1QLN A;  4Z6D A;  9ICC A;  4UAR A;  4Q43 A;  3AMZ A;  2F1I A;  3KZI U;  4C4R A;  2EQY A;  2EAO A;  4M9J A;  2P66 A;  1T94 A;  4DSL A;  9ICP A;  5HMM A;  1SB3 C;  5AI5 A;  5J0Y A;  3SMV A;  2CXY A;  3ISD A;  3HKZ F;  4DQQ A;  2C2E A;  4CF3 A;  2W9C A;  3V7L A;  3LWM A;  3I1Y A;  4GIB A;  3V7J A;  1UT5 A;  2PFQ A;  2DKX A;  1ZRM A;  4I27 A;  4DL6 A;  4PH5 A;  4MFA A;  4PL1 A;  3PST A;  1HJP A;  2VIX A;  2W55 A;  1SKW A;  2BCS A;  2UVR A;  3PX0 A;  5C5J A;  3KKA A;  1RQL A;  1KW4 A;  4KLL A;  1TK8 A;  4J9K A;  4JB3 A;  3ISC A;  1KKX A;  4X5V A;  1YZ6 A;  5CP2 A;  4CE6 A;  3GFK B;  2WF9 A;  4UAT A;  2VKQ A;  2HW3 A;  2ZTE A;  5AKH A;  3SI8 A;  2YQE A;  4DOB A;  4BJQ A;  4KLM A;  1B22 A;  1MQ2 A;  1RM6 C;  1QSL A;  5L1J A;  3B9J A;  3UMC A;  1TAQ A;  3UMG A;  5ALQ A;  2CPR A;  5TIS U;  4JWN A;  2BCU A;  7ICI A;  4KLQ A;  4UBC A;  4EBC A;  8ICV A;  1RDF A;  1J97 A;  2ES6 A;  3H4D A;  3QU4 A;  5KFE A;  1ZQB A;  3ALR A;  2NRW A;  2XI9 A;  5AKG A;  1U48 A;  1Z1B A;  1LB2 B;  3MGH A;  2KEY A;  2E8N A;  3QUQ A;  3KHG A;  3GDX A;  3D6J A;  8ICM A;  3GIJ A;  5L9X A;  1ZXI A;  3RAQ A;  4BXO A;  3H7I A;  5IIJ A;  4PGQ A;  4F92 B;  4ED6 A;  1NJZ A;  4CDG A;  1UA1 A;  1D8B A;  1RG6 A;  4IRD A;  5AI6 A;  3BDP A;  4DS5 A;  1PVP A;  5KG7 A;  2BZF A;  1U4B A;  1YZ7 A;  2IOF A;  4TUQ A;  3ETL A;  4U6P A;  1Z3E B;  1OW5 A;  1V85 A;  2IHM A;  5CEH A;  9ICH A;  5ALP A;  1ZQY A;  4UQG A;  1JMS A;  4NLG A;  3Q8M A;  4C0Z A;  3RJJ A;  1NK7 A;  3M9M B;  5KFF A;  5AKI A;  4YVZ A;  1RYU A;  3KHR A;  2OM6 A;  4DCC A;  4J9S A;  1IV8 A;  4XUS A;  4FO6 A;  3PW5 A;  4EZ9 A;  4PHD A;  4EYI B;  7ICS A;  1TK0 A;  4A8E A;  1QTM A;  2YB1 A;  8ICF A;  3AN1 A;  2ZXH A;  5C0Y A;  4TUR A;  4J9O A;  2K60 A;  3PSI A;  5DBB A;  3BQ2 A;  4J9R A;  2K4H A;  3NVV A;  4QZI A;  2JEJ A;  5AIB A;  5KFS A;  1N63 A;  5L1K A;  2AHO B;  4TQR A;  5J0O A;  3MFH A;  4M0A A;  3V6K A;  3HPO A;  2W8L A;  2AXT U;  3C21 A;  4USA A;  3CNH A;  1NZB A;  3NRZ A;  2ISO A;  4R66 A;  5J0S A;  1N62 A;  4I2E A;  5ALX A;  4DOC A;  4QJF B;  5A0L A;  1ZQX A;  1NJW A;  1ZQQ A;  4F3O A;  4ECR A;  2HCF A;  4LZD A;  3RH5 A;  4P0Q B;  2VA2 A;  3B0X A;  2XCA A;  1B0X A;  1TE2 A;  2L5Y A;  4PZO A;  1D9D A;  1KRP A;  4O3O A;  1F0M A;  3QE9 Y;  5H2F U;  2F1J A;  3QUT A;  2PFO A;  2Y9U A;  2PKE A;  1COK A;  2VA8 A;  5KFC A;  5B5E U;  1XSP A;  2Q0Z X;  4F4X A;  3M9N B;  4B9U A;  3TQ1 A;  5EE3 A;  3JPR A;  5ALF A;  4QZ9 A;  4NLZ A;  2WF7 A;  4QZH A;  3MR6 A;  2I5H A;  1JX4 A;  3ONN A;  1NI3 A;  5J2A A;  3C5G A;  2B6G A;  2FMQ A;  4I2C A;  4F91 B;  2JH1 A;  4M9N A;  2F8L A;  3CP8 A;  4P0P A;  4F72 A;  3PNC A;  2NO4 A;  4I2B A;  2G5H B;  3QEA Z;  2LYB A;  3LDA A;  3K4G A;  4IRK A;  4QWE A;  4EZ6 A;  4DSK A;  4ED8 A;  1TV9 A;  4JV1 A;  4PPX A;  3Q8S B;  2GH1 A;  4Q44 A;  1ZQI A;  1LKY B;  2HBM A;  5AIC A;  5L1L A;  4KLU A;  3MAB A;  2NRZ A;  4MFF A;  2K4P A;  1PK1 A;  4NL9 C;  2W7P A;  3LWL A;  2GOL A;  3RJG A;  5J2H A;  3SAF A;  2BQ3 A;  2VAN A;  5AM3 A;  2NRT A;  4K4I A;  1PUZ A;  5DB6 A;  2UVU A;  2JV3 A;  2KFN A;  4TQS A;  4RQ1 A;  5ALY A;  5KG2 A;  2XGP A;  4Q8E A;  2IOH A;  4J9N A;  3WU2 U;  2G08 A;  1S0M A;  1V9P A;  4YR0 A;  4KLT A;  5JTI A;  1SGG A;  2C2D A;  2IBK A;  2YN4 A;  4KMU A;  1BPZ A;  2EZX A;  5KT7 A;  5ALO A;  5KFK A;  1Q3V A;  7ICU A;  2F44 A;  2FPM A;  3WK8 A;  4U7C A;  2MU2 A;  2QAR B;  1SL0 A;  2RQ5 A;  9ICW A;  2G06 A;  7ICH A;  2K8C B;  2W54 A;  4F50 A;  1NK0 A;  4EEL A;  5KFA A;  3SEN A;  1ZQV A;  3RBE A;  7ICR A;  1L3T A;  1WCN A;  3M8S A;  3PW0 A;  2V9W A;  1XO0 A;  5KAI U;  5DG8 A;  3PSF A;  4BGD A;  3QEB Z;  4UBB A;  2ZUD A;  3KHL A;  3NUQ A;  1P7D A;  2ZJ8 A;  3RB3 A;  1N61 A;  5L1I A;  1UCV A;  1UA0 A;  1L8O A;  4WJ3 B;  3OTQ A;  4GC7 A;  5KL8 B;  2JHD A;  1SWW A;  9ICQ A;  5ALG A;  3E58 A;  1S10 A;  4C8O A;  1NKE A;  1VJ5 A;  4DO9 A;  3KTQ A;  4BWM A;  3HT3 A;  2EAN A;  4FS2 A;  4ECT A;  1V97 A;  4RNO A;  1SL1 A;  3GII A;  2GLE A;  4EX7 A;  3DEE A;  4BUG A;  3K1Z A;  3SYZ A;  2YTU A;  2RHF A;  5GTH U;  3EUB 2;  2JMG A;  2M9N A;  2EH9 A;  5HML A;  5DKW A;  1XSL A;  3UXN A;  2O6K A;  3F5A A;  1MQ3 A;  1XNS A;  5ALV A;  1XU4 A;  1BPE A;  2K4E A;  1BPB A;  4OJ6 A;  5ALU A;  4YMM A;  1ZQH A;  4IQW A;  3BS5 A;  4M9H A;  2V4Q A;  4OD0 A;  2HHV A;  1Z4N A;  2E8M A;  1FO4 A;  1ZQN A;  5CR0 A;  1H38 A;  2WB1 C;  4F5O A;  5KTQ A;  2NRX A;  2G0A A;  5D4B A;  2WF5 A;  3QU2 A;  9ICL A;  2AQ4 A;  1LV5 A;  1WUD A;  2XVT A;  5G5H A;  3ED5 A;  5TZV A;  5HHI A;  3WK5 A;  4KLH A;  3F53 A;  4F5R A;  3T5L A;  4I2F A;  1S76 D;  5DBC A;  4US9 A;  1T3N A;  1QH9 A;  3N28 A;  3I28 A;  1F5S A;  2QB1 A;  3GZF A;  4AYB C;  4F93 B;  3F5E A;  2PMZ F;  2I6X A;  1N2X A;  5J2B A;  2WB1 F;  2KG5 A;  1SKR A;  1S8O A;  4C8N A;  3WK6 A;  4R8U A;  4UB1 A;  4O3S A;  2XGQ A;  2XY5 A;  4NLN A;  1NK8 A;  1J2M A;  5CA7 A;  4DL4 A;  2VA3 A;  5J2F A;  1DK2 A;  4UAU A;  2MSN A;  2MA1 A;  1Z1V A;  4EX6 A;  4O9M A;  1ZD3 A;  3C29 A;  1GO3 F;  2EAP A;  1X40 A;  1UPH A;  3SAH A;  4DF8 A;  1COO A;  2ZIU A;  1SV4 A;  2NO5 A;  3N97 B;  1WWV A;  4DFD A;  1D9F A;  1JUD A;  3MC1 A;  2KIV A;  1CRX A;  1SV0 A;  8ICL A;  5F3X B;  1NK6 A;  2NRV A;  5ALT A;  4YMO A;  3MGV A;  3Q8L A;  4YR2 A;  2KSO A;  2XC9 A;  2H3Z A;  3V6J A;  2PI5 A;  2FLN A;  3QUC A;  3IHQ B;  4P4O A;  5KFJ A;  3JPQ A;  4B9S A;  3T5H A;  2ZIV A;  4O5K A;  4F2S A;  5DQI A;  5KAF U;  2CRX A;  3PVX A;  2K8B B;  5D49 A;  4J9M A;  1NZP A;  1UQV A;  4QZA A;  2WF6 A;  1BVS A;  4UB8 U;  1TAM A;  4JUZ A;  4TUS A;  5ALH A;  4MF2 A;  2KIC A;  2KK0 A;  3PY8 A;  1KFS A;  4FBT A;  3OSP A;  3RJH A;  4ED1 A;  2HHS A;  2ALZ A;  1ZD2 P;  2W11 A;  1AQ6 A;  1KBU A;  4P4M A;  2W9C B;  4JV2 A;  4O3Q A;  3TAD C;  1MA7 A;  5ALK A;  3OHA A;  5AI9 A;  1EXN A;  5AI0 A;  8ICU A;  1S77 D;  4QW8 A;  5IIM A;  3BZC A;  5KFT A;  3ZDC A;  3RRH A;  4NY8 A;  1ZYQ A;  2HHQ A;  7ICT A;  2JEF A;  2HBJ A;  9ICM A;  5J8Y C;  2JH7 A;  3WKC A;  1X9X A;  3S6J A;  1NJY A;  4RQ5 A;  4RNM A;  4UB4 A;  4ZH4 A;  2K4I A;  3RF9 A;  3EPG A;  1ZQG A;  4Z6C A;  1UT8 A;  3IP4 B;  2QB0 B;  4IRC A;  8ICX A;  4GXI A;  5J2C A;  4EBE A;  1T8E A;  4Q8F A;  2BR0 A;  2N1R A;  4QZC A;  2AGQ A;  3ZDB A;  2W9A A;  2H5X A;  2BKE A;  4PJ0 U;  2NV3 A;  3QZ8 A;  4MHV A;  1PVQ A;  1XO1 A;  2HHT A;  5ALR A;  4RQ3 A;  4O5E A;  4R63 A;  3GQC A;  3Q8P B;  1C20 A;  1LVH A;  3RH4 A;  4YMN A;  5KFO A;  8ICJ A;  5B66 U;  2FMP A;  5AIA A;  5JU5 A;  1JXL A;  5AKX A;  7ICP A;  5ALD A;  5ALL A;  4KMO B;  4ED0 A;  4YR3 A;  1L7N A;  2XID A;  3RFA A;  1ZQT A;  4ELT A;  3C2M A;  1X2I A;  3RB4 A;  4US8 A;  3JPN A;  2HHX A;  3NTU A;  2G5I B;  3OPX A;  3WKD A;  3RJF A;  3RR7 A;  3C2L A;  5KFV A;  2A1J A;  3AU6 A;  3WKB A;  5AM1 A;  3C28 A;  3RAX A;  5J0X A;  1K5O A;  7ICE A;  1Z4O A;  4DQS A;  1KQQ A;  3IM1 A;  4UAS A;  3C5F A;  1URJ A;  4YXM A;  4NLC A;  4YCX A;  3EZ5 A;  4DOA A;  1UHU A;  5CJ7 A;  1C7Y A;  4G9B A;  4MEY A;  1DXS A;  1X9W A;  4J03 A;  4ECY A;  2CN1 A;  4I2A A;  3IG5 A;  1L7O A;  1L3S A;  3UMB A;  4KLS A;  4JV0 A;  5HHH A;  5JUM A;  2HHU A;  3AQF A;  3SR6 A;  1KLN A;  1QCK A;  2ASL A;  4F4W A;  1ZQZ A;  3NVZ A;  3GV7 B;  4KLO A;  5DQH A;  1JRP A;  3THV A;  2DQN B;  4YG2 A;  2JZB A;  1D8Y A;  2BPF A;  9ICI A;  5KFH A;  2W43 A;  1NKB A;  5AK5 A;  1ZOL A;  1XWL A;  3TAQ A;  4DFP A;  5JRT A;  2R8I A;  4PZN A;  3WK7 A;  4B9M A;  1K1Q A;  5ALZ A;  3FC4 A;  3AQE A;  3KFU F;  2E1F A;  4RQ2 A;  4ICA A;  2VJ5 A;  1WWU A;  2WFA A;  1NK4 A;  1ZQM A;  2K89 A;  4BDP A;  4BX9 C;  2HI0 A;  3J81 j;  1S0O A;  4PL2 A;  4DL3 A;  7ICL A;  4ECV A;  1KL9 A;  4KLE A;  5EWE A;  4EBD A;  4RUA A;  5KFI A;  1X66 A;  3FDS A;  2YY6 A;  3SEI A;  5DDM A;  3K1R B;  3QYP A;  4UB2 A;  1RYR A;  4QWC A;  2H3F A;  3CYM A;  2LBO A;  4Y2R A;  8ICR A;  4QZE A;  5AI4 A;  4R64 A;  7ICK A;  3NVY A;  2ZJA A;  4OCZ A;  1ZQA A;  2JRZ A;  3ISB A;  2DWQ A;  4DL2 A;  1F44 A;  1IIP A;  1WG8 A;  2ZUB A;  5FP0 A;  2E8O A;  4FZN A;  5KFZ A;  1TVA A;  2LYA A;  1DGS A;  4NXZ A;  9ICN A;  2FLP A;  4QWD A;  2JXJ A;  5KT6 A;  2KV2 A;  8ICE A;  2ZTD A;  4I2G A;  2ZG6 A;  4DQP A;  4NM2 A;  4DWI A;  3GV5 B;  1Z00 A;  2V4R A;  4J9Q A;  4CRX A;  3WKA A;  5AM5 A;  7ICO A;  5KFB A;  3H40 A;  4FE3 A;  4QNL A;  5HP4 A;  3I76 A;  4LVS A;  2ZIX A;  4RPY A;  4JMU A;  4OO1 J;  3Q8R B;  2H3V A;  2IOF K;  1PK3 A;  1U9L A;  2LM1 A;  1SXE A;  3KBB A;  4QWA A;  1KDH A;  4GXJ A;  1NK9 A;  1PK1 B;  4NLK A;  4C8L A;  4QWB A;  3H0M B;  2NYV A;  5KFU A;  4LJX A;  2DKZ A;  3T79 A;  8ICI A;  2ODG A;  4EEK A;  5KFP A;  1T7P A;  1SXD A;  5KNI A;  2OWO A;  1U45 A;  4F2R A;  3F2C A;  2KHV A;  2DPJ A;  2UVW A;  4Y2Y A;  8ICP A;  2W7O A;  5AI8 A;  5ALS A;  5KG1 A;  4C8K A;  1VDV A;  3H0R B;  4Y2T A;  3C1Y A;  2XIC A;  3MR3 A;  1WYG A;  3PMN A;  2KHQ A;  2FLL A;  5J2G A;  1DRG A;  3BJY A;  2OCE A;  2A3V A;  2J6T A;  2RDI A;  1KTQ A;  1IG6 A;  3DDH A;  4M6W A;  1Q8K A;  3UQ2 A;  1ZQK A;  3IV6 A;  3IRU A;  1IXR A;  3C1Z A;  4UAY A;  1ZQC A;  5J0P A;  4KIT B;  4KX3 A;  3NAS A;  1ZQL A;  1KFT A;  3PW7 A;  4EEN A;  2J6U A;  4CF4 A; 
#chains in the Genus database with same CATH homology
 5HR6 A;  2LYB A;  3VCB A;  1PVR A;  1SZH A;  4WJ3 B;  2OH2 A;  2OM6 A;  2MA1 A;  4QIW C;  2Y0S F;  4GFJ A;  4OJ5 A;  2KV2 A;  5KL8 B;  3C29 A;  2JHD A;  3H0L B;  1ECW A;  4O3M A;  1GO3 F;  2ZG6 A;  2K4I A;  3RF9 A;  3M6Z A;  1UPH A;  3IN5 A;  2DQN B;  3SAH A;  2GH1 A;  2H3I A;  3IG8 A;  3PSP A;  4KX5 A;  4ACO A;  2WAQ C;  2RRD A;  3IP4 B;  2VKQ A;  4A8E A;  4CRX A;  2ZIU A;  2KD1 A;  2YB1 A;  3AL0 B;  2HBM A;  2KIW A;  4OJP A;  4BJQ A;  5HR7 A;  2KOB A;  2ZXH A;  4FE3 A;  2ZXI A;  4QNL A;  5C0Y A;  2HOI A;  2WAQ F;  1Q3U A;  2F2A B;  2MRL A;  2ZIX A;  2N1R A;  3M7D A;  3PSI A;  3DEE A;  4JMU A;  1YT3 A;  4BUG A;  4OO1 J;  2ZIU B;  3K1Z A;  3O0F A;  2H3V A;  2Z7J A;  2W7P A;  2K4H A;  2RHF A;  1Z19 A;  3SAG A;  3F2B A;  2JMG A;  2KNJ A;  4P0P B;  2DF4 B;  3N7P D;  2BDU A;  2GOL A;  2NV3 A;  3HKZ C;  4OJL A;  1CRX A;  2CPR A;  2Q4T A;  3SAF A;  2ZIX B;  3AQE A;  3L3F X;  3KFU F;  1PVQ A;  2E1F A;  2RP5 A;  3MGV A;  4ICA A;  4NV0 A;  2VJ5 A;  2F76 X;  2E1E A;  3F5A A;  2VJ4 A;  3ICX A;  3N7R C;  4FZL A;  4QIW F;  1A0P A;  3H0M B;  3AQF A;  1NZB A;  1XNS A;  2HMX A;  2H3Z A;  2KKV A;  4P0Q A;  2D6F C;  2KJ9 A;  2HBL A;  2KKP A;  3T79 A;  3CRX A;  3NRW A;  2JGA A;  2G08 A;  2K4E A;  3ALR A;  3N7S C;  4QJF B;  2OXO A;  4FZM A;  5A0L A;  5T14 A;  4OJ6 A;  2XI9 A;  2K8A A;  2ZIV A;  4IC9 A;  4NWI A;  2HOQ A;  2ZIW A;  4P0Q B;  2K89 A;  1Z1B A;  4BX9 C;  2HBK A;  4KMO B;  4OJO A;  2WB1 C;  1T94 A;  1HIW A;  2F77 X;  2KHV A;  2XID A;  2KEY A;  4PL2 A;  3RFA A;  3F2C A;  2CRX A;  3KZX A;  2G0A A;  2K8B B;  2W7O A;  2ZIV B;  2KVC A;  2R18 A;  2ZIW B;  2G5I B;  3SMV A;  3OPX A;  2W04 A;  3HKZ F;  3PZP A;  3SQI A;  3LVW A;  1Q3V A;  1L6N A;  1WUD A;  1TAM A;  3H0R B;  2XVT A;  2XIC A;  2YX8 A;  1ED1 A;  2G07 A;  2KJ5 A;  4U7C A;  3C28 A;  3M6K A;  2YB4 A;  4CDG A;  2Y0S C;  3F2D A;  2KIC A;  3F53 A;  2KHQ A;  2DGZ A;  2G06 A;  1DRG A;  2A3V A;  1D8B A;  2K8C B;  3D2S A;  1OUQ A;  3VC8 A;  2H3Q A;  2H3F A;  3CYM A;  2PMZ C;  2LBO A;  1HEK A;  1URJ A;  4NLC A;  3GZF A;  4NLB A;  4AYB C;  1PVP A;  3GU3 A;  1KBU A;  1MA7 A;  5CRX A;  2M0N A;  2LHT A;  3D2Q A;  3D2N A;  1A6S A;  3F5E A;  2W03 A;  2PMZ F;  3ONN A;  3LYS A;  2E5S A;  1XO0 A;  4AYB F;  2LKY A;  4U6P A;  5KL1 B;  2HOF A;  3E0F A;  3PSF A;  2CN1 A;  2WB1 F;  4KX3 A;  4PL1 A;  2JH1 A;  1F44 A;  2KJ8 A;  3PST A;  4CGZ A;  1ZQ1 C;  1IIP A;  2F8L A;  3CP8 A;  4P0P A;  2VIX A;  2OYY A;  3NUQ A;  1P7D A;  2HBJ A;  3IG5 A;  4C0Z A;  4FZN A;  3LVV A;  2JH7 A;  2G09 A;  2G5H B;  2LYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...