2LBOA

Eimeria tenella microneme protein 3 mar_b domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
APTLQEALDRKCAQFGKESCNSGLASYCGAAIYARYDKGNSSQQTKEWRCYIEKELDFSKSGDGCVDDCGSMTSCRGSVSGPSTSHLTRPSELQAVIDSDKSNYCTDKSEQQPSQATPPPEIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microneme protein 3
publication title The Role of Sialyl Glycan Recognition in Host Tissue Tropism of the Avian Parasite Eimeria tenella
pubmed doi rcsb
source organism Eimeria tenella
molecule tags Cell adhesion
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10564 MAR_sialic_bdg Sialic-acid binding micronemal adhesive repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.580 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lboA00
2JH7A 3F53A 2JHDA 3F5AA 2LBOA 3F5EA 2JH1A
chains in the Genus database with same CATH superfamily
2E5SA 2EDUA 1SZHA 1ZQVA 3FAHA 4YD1A 1HIWA 1VLBA 3WKEA 8ICOA 1X9WA 5CJ7A 4F4XA 4Q8FA 2V4RA 8ICZA 4EZ6A 2P6RA 4DFMA 4C8LA 1SV0A 4M9JA 5KFVA 1X42A 5B5EU 1LKYB 1UHUA 3RB3A 5DQIA 5KAIU 1ZQUA 5DDYA 4DS5A 3RB0A 4KLGA 2IOFK 5EE9A 5IILA 5IIJA 3KZXA 4IL6U 4J9PA 5DGAA 2IHMA 1QSSA 2E8NA 2A19A 4CE6A 3QYPA 2QLTA 4R66A 1ZRMA 4BWMA 4YCXA 5KFEA 9ICLA 4QWCA 3AU2A 4KLHA 3C2KA 4RQ7A 4ECZA 2W9AA 4EEYA 9ICHA 4CGZA 5KFKA 2P66A 2H5XA 2HMXA 1CEZA 1WCNA 1T94A 9ICGA 4C4RA 4ED1A 2E8OA 2Z7JA 2KJ9A 1EXNA 2FE9A 4FFDA 1AROP 3SQIA 1COKA 3F2DA 4FZLA 5ALSA 7ICRA 3S6JA 4RUAA 4DL5A 1XNSA 2KZZA 4DO9A 3NVZA 3NUQA 3ZI4A 2K89A 2KZMA 2F44A 1XSPA 1T8EA 4TUSA 3JPTA 2BKEA 8ICQA 4U6PA 5KT5A 1XU4A 2KNJA 2V4QA 2ATLA 4CCHA 7ICFA 1DK3A 1K5OA 1RYSA 3AUOA 4DL2A 3C28A 4F4YA 5KG6A 3L3FX 4F5RA 4KLEA 5KG0A 3LVVA 2KKPA 2W3RA 3ZDDA 1ZOLA 2YQEA 4EBCA 2KSOA 5DLFA 1NK7A 2R8HA 2XIDA 1URJA 3V6HA 4NLZA 4ZOHC 5D4BA 4RPZA 1S0VA 1WYGA 4NWIA 3V6JA 3EYZA 2DQNB 2CN1A 4I2JA 2R18A 4TUPA 1X6IA 4DWIA 5AI8A 5J2DA 1AQ6A 1TVAA 1LVHA 3H4BA 3RAXA 2FLNA 7ICEA 3F2CA 2NRTA 3PVXA 3KKAC 1N63A 3NGDA 3RJIA 1B4FA 4DSKA 3RAQA 4IQTA 5KT7A 8ICHA 1ZQJA 1PK1A 4FZMA 5KG2A 1N5XA 4IRDA 3GQCA 2C2DA 5KFNA 1X6JA 2ZIVA 3WK8A 2HSZA 1U49A 2IOHA 1DK2A 1JXEA 2QARB 3T5LA 2BCSA 2LPEA 4KX3A 3Q8LA 3C1YA 4NLKA 2F1HA 3NRWA 1X40A 3I76A 4J03A 1TAMA 7ICIA 1ZQPA 5KFTA 3V7KA 4KTQA 4DFKA 3VCBA 4O5CA 4K4GA 5AHXA 3CP8A 3IN5A 3BQ1A 4IQVA 3SR6A 2DFLA 3B0XA 3AQEA 2GWSA 4KLFA 3RRGA 3V72A 3H0MB 1SV4A 1SV0C 3TKAA 3D2NA 3FC4A 4DQIA 3JPSA 2C28A 3KBBA 5ALNA 1SWVA 5J2HA 4J9KA 1RQLA 3OHAA 4DSEA 2BCVA 1HEKA 3WKDA 4RPYA 4F4ZA 1XO0A 4F50A 4X5VA 1ZQHA 1Q3VA 3UXOA 2HOFA 3THVA 4BX9C 4DSJA 4C8KA 3OSPA 5KT2A 3RJEA 1JIHA 1JMSA 3SMVA 4BJQA 1RG6A 1NK4A 4YVZA 1L3UA 4I2BA 4QZ8A 7ICJA 3KFUF 3WK4A 1RQNA 2ISPA 2ODGA 4DQSA 1COOA 4NM2A 5B66U 4MEXA 3ETRA 1U47A 4UASA 5J0SA 2HBKA 9ICTA 4F93B 3UM9A 4ED6A 2IOFA 3M9MB 2A3VA 9ICRA 3MR6A 1L8OA 2FMQA 4CRXA 2JEGA 4MFFA 5KFQA 3QUCA 1X2IA 4PL1A 4DF8A 3R9KA 2W3SA 5AI4A 2W9BB 2MUTA 1FO4A 3ISBA 2I6XA 3H8JA 3NTUA 4Z6CA 4EBDA 4GLXA 3RF9A 1S0OA 4M04A 3HKZC 2E8MA 3AL0B 2KMDA 1Z00A 5AI9A 4QZEA 4UW9A 2VJ5A 9ICJA 1XWLA 4P0QB 1SWWA 1RDFA 3AM9A 2FI1A 2HHQA 4J9SA 3IHQB 4XQ8A 2A1JA 2ZJAA 5KFXA 1XSNA 3Q8KA 1XC9A 3ZDBA 1DOQA 2PFPA 3TACB 4KLLA 5BOMA 2XCPA 3K75D 2D8CA 4F5QA 1PUZA 4PL2A 3C29A 5IIIA 3KOOA 5AKXA 4IR1A 4DSFA 2WAQC 3C2MA 1LV5A 1F0MA 4KMOB 4DCCA 3M6KA 5AK5A 1U4BA 4C8MA 2YB1A 4BDPA 2ZIXB 4G9BA 2BQUA 4O3RA 2ZG6A 4DQPA 5ALRA 4B9VA 4IR9A 4DL6A 4FZNA 3M8SA 5F9LA 2AJQA 1ZQQA 2Y1JA 1T7PA 9ICXA 3FYHA 4M9HA 3PW0A 3QE9Y 5AK3A 3Q8SB 5ALOA 3B0YA 3DV9A 1L3VA 2HHVA 5CEHA 3IP4B 3EPIA 4YFKA 3UMGA 1MN8A 1ZETA 2RQ5A 4ECVA 4KN7A 1L7NA 2EAMA 4C80A 4Y2YA 3AN1A 5BOLA 1SGGA 1V38A 3EPGA 3M9NB 2G09A 1TE2A 4RNNA 4PH5A 4NLGA 2OXOA 5J0TA 2KJ8A 2AXTU 3RR7A 4QW9A 2FMPA 3C5FA 2XCAA 4M9LA 2ZXIA 3RBDA 4F72A 2AGQA 3RRHA 2JRZA 1GO3F 2ZJ5A 5CA7A 5CB1A 4QZCA 1SIJA 4PJ0U 4UB4A 1A6SA 1O03A 5DQGA 2ASDA 4I2GA 2HHSA 2JZBB 3WK9A 1MC8A 3PW7A 2K8BB 1D9DA 4M0AA 4Z6FA 4YR2A 3N28A 2W9CB 3BQ7A 3PMNA 1NI3A 4M9GA 2F1IA 1BPBA 1T4GA 4KN4A 2DBYA 3RJKA 1ZQSA 4QZFA 4YN4A 3PW2A 3Q8PB 4RT2A 2KKVA 1TAQA 3E0FA 4ECTA 3QU5A 3AMZA 4M6WB 5TISU 1D9FA 5KAFU 2VIXA 3N4MB 1UA0A 1UA1A 1NKCA 3NVWA 5IINA 3KKAA 5A0LA 8ICCA 4DSLA 1ZQXA 4CNQA 3OJSA 5ALPA 2EAPA 1LB2B 5DBBA 2M9NA 3DDHA 4USAA 2UVWA 1TFRA 4F4KA 1BPDA 3NVYA 4KLJA 4QW8A 7ICMA 2JH1A 4DOCA 1OXJA 1JX4A 4O5EA 2ES6A 2BPCA 5G5HA 4GFJA 9ICQA 5KFZA 1Q3UA 4M2YA 1Z4OA 1RXVA 2FMSA 2BQ3A 2C22A 4I2IA 5KG3A 1N62A 3T79A 4JV2A 2YMLA 3WU2U 4KLTA 4DLEA 1XS9D 4LJXA 1KLNA 2W8LA 3OHBA 4O3SA 4MF8A 1KFTA 1IXRA 4CF4A 1BPEA 4CF3A 1ZQWA 3T3FA 4RU9A 9ICPA 1ZQRA 4DEZA 2F8KA 8ICEA 4QIWC 2G06A 1KFDA 1L7MA 3HKZF 4ELUA 3QUTA 4IRCA 4MFAA 2AQ0A 4M47A 1ZQLA 4CDGA 4RQ0A 2HVIA 5J0QA 1BPYA 1C7YA 3JPQA 1S0MA 3L4PA 3IDWA 4Y2UA 4ECQA 1JI7A 4A8EA 1L3TA 1KSPA 3PZPA 5KFJA 3PR5B 4EELA 1TV9A 2DGZA 2ASJA 1SKRA 3I1YA 5KFDA 2WAQF 4ACOA 4OD0A 2PMZC 4K4HA 2UVUA 2W03A 5H2FU 4ECSA 5EE3A 5ALQA 2B6GA 3PSTA 1JALA 4JMUA 5KFHA 2PXIA 1S76D 3Q8RB 2R8KA 5AKLA 4DQQA 1ZJMA 3CYMA 2ZUDA 1A76A 4O3MA 4QZHA 2HHXA 1SXDA 4PZOA 7ICLA 1VJ5A 3IG8A 2KSOB 2DF4B 5HMLA 4RQ1A 3H0RB 9ICAA 3I28A 4J9LA 3FM9A 5G5GA 1YT3A 4UBBA 3KD3A 4P0PA 4MEYA 8ICUA 3HW8A 1HJPA 1Q46A 5ALEA 4ELTA 4UAUA 1T3NA 4J9QA 3RB4A 5DDMA 3ZDCA 2LYBA 5KFSA 4UBCA 2IBKA 1SB3C 9ICCA 4C0ZA 3H7IA 3QUQA 2GH1A 4B9SA 3GV7B 1PK1B 5IIOA 1FFUA 2LM1A 2DPJA 4UB1A 2ZIVB 4I2HA 4IQWA 5KFYA 5AKZA 3V7LA 1SL1A 5KG7A 3JPNA 4J9MA 3TARA 4DLGA 2K4IA 4I2EA 1XO1A 4O0IA 1RZTA 4Q44A 2PFNA 7ICSA 1OUQA 5J0PA 3ZD9A 4AYBC 1ECWA 1F5SA 2BHNA 4ED8A 5DBAA 1KBUA 8ICGA 3F5AA 4KX5A 4TUQA 3IV6A 4GC6A 1NJWA 2NV3A 3HRDD 4LVSA 3ZD8A 4C4TA 3E2EA 5L9XA 3KHGA 5IIMA 4JV0A 9ICKA 4PHEA 1WWUA 3H4DA 2OEHA 3SI8A 4FE3A 2D3DA 5J2GA 4F92B 4DL7A 5DG9A 2DWQA 2BDPA 4C4SA 1ZD5A 2XVTA 1UPHA 2JV3A 2JXJA 3F2BA 1L7OA 4PGXA 2HVHA 2Y1IA 2ZTEA 2NYVA 4RQ8A 4Y2PA 3PX4A 2FJ6A 3HPOA 5IIKA 2MAXA 1IIPA 5JRTA 3WKAA 2AH5A 1S5LU 2AU0A 2FDRA 4UB2A 1L7PA 3TFRA 4Y2RA 1N5WA 3HJEA 2BPFA 5CP2A 3ZDEA 1QLNA 1HUOA 2JR5A 1X9SA 4EEKA 5HP4A 9ICIA 1NK8A 4Y2QA 2LMRA 3K4GA 7ICHA 3NASA 2ZIUA 4NXZA 3IM1A 5J2BA 4NLBA 3MFIA 4EZ9A 4OO1J 1ZQGA 2QB1A 3OJUA 4DFDA 2GO7A 2NRZA 4O3PA 3RH5A 2XY7A 3PW5A 4ED7A 4OJPA 4MFCA 5AIAA 4K4IA 2E1FA 2YX8A 3SYZA 2M0NA 3C23A 4EYIB 5JTIA 1ZQOA 9ICBA 3M6ZA 5ALWA 2NRXA 2ZIWA 4YMNA 3H8MA 5DGBA 5DG8A 1MSWD 3TADC 2P35A 4RUCA 5KFCA 2NRVA 4DFJA 2YMMA 4KLIA 2AHOB 2KV2A 3V6KA 5L1IA 2H3ZA 4DOAA 2MUTB 3MBYA 8ICRA 4QIWF 2FPMA 4BWJA 1SL0A 2VKQA 2AQ4A 5ALGA 3HT3A 2QB0A 5KT4A 3PW4A 2WF7A 2ZUBA 4GXIA 4QZAA 4NJ8A 2AGOA 4OJLA 5AM1A 3K1ZA 1PVRA 4Y2JA 1ZQNA 4UB3A 4PHDA 1BNPA 4I2DA 2W7PA 2PKEA 3MDCA 3LK9A 5KFWA 1TK5A 5DQHA 1Z00B 3UMCA 2R8GA 4YQWA 4AP9A 3WKBA 2N1RA 5DB7A 2ASLA 4I2CA 2W9MA 5KT6A 1Y88A 4HYKA 2A1JB 2YN4A 2XC9A 2F3NA 2H3IA 2PMZF 5AI0A 4NY8A 3U26A 3GU3A 2JEIA 4DF4A 5CWRA 4C7YA 1ZJNA 2UVRA 1DXSA 1SKSA 2CPRA 5KT3A 2V9WA 4ECRA 5DBCA 4ELVA 2Q4TA 4RZRA 7ICGA 4QNLA 1CI4A 5AKGA 4YXMA 2RHFA 3GFKB 2Y9TA 4IRKA 4UARA 2G5HB 3SEIA 4FS1A 5BPCA 2NRWA 3CRXA 3SAFA 5KFIA 3KHHA 1ZQTA 4QWBA 1NJYA 1J2NA 2JMGA 5AK4A 5CRXA 2P6UA 3PV8A 4FBUA 3N7PD 3KHLA 4PHPA 1DRGA 2JEFA 1IV8A 1ZQFA 2L5YA 4KLQA 4XA5A 3MR5A 5KFAA 2MRLA 2ZTCA 2KZ3A 1BPZA 2ESEA 2F1JA 2IMWP 3G6YA 2HHUA 5AK6A 3HX0A 1ZQYA 2KTQA 2BDUA 1KRPA 4YR0A 5ALMA 1JUDA 2W11A 3M1YA 4Y2XA 1QSYA 3LYSA 1ZYQA 2NO4A 5AKEA 1ZQIA 1NK9A 3D2QA 2BGWA 3LVWA 2KFZA 4ECWA 5DLGA 1PVPA 8ICKA 5ALDA 5KG4A 4AYBF 2YTUA 2B21A 2LKYA 3SAGA 3QZ8A 3BS5A 1WCLA 1NZBA 3N97B 5KFOA 4PGQA 1ZD3A 1KFSA 4UB6U 4WJ3B 3PSIA 1Q8KA 2KOBA 2VA2A 5L1LA 4Y2VA 4NL9A 2KE7A 4R8UA 1Z1BA 4Y2SA 3PR4A 2DL0A 5DB9A 3UPQA 3AEVA 1QH9A 2WF8A 2HW3A 5ALXA 1D8LA 3RB6A 5D46A 3WK5A 4R64A 1KTQA 2XY6A 1S77D 5J29A 3BDPA 4EYHB 5AM4A 1ZQAA 2I9GA 5HHIA 4F5PA 4YXJA 4ED0A 2HOIA 5J8YC 1KW4A 4XRHA 3BQ2A 2EZXA 2Y0SC 5HHHA 5AKIA 8ICXA 4EENA 5ALFA 3D2SA 2HHTA 1ZD4A 2GOLA 4OJ6A 1QQ5A 3O0FA 2VA8A 1XSLA 2OCEA 2JHDA 3F53A 4YR3A 4UAVA 1N60A 3C21A 4NLNA 5CR0A 2HBMA 2K8AA 4ZH4A 1VDVA 2QKQA 4IS7A 2XICA 2XGPA 2BR0A 9ICFA 2K4PA 3SENA 5KL8B 4Q45A 1JXLA 3H8SA 1KKXA 3IG5A 4KLOA 3ETLA 1UT5A 1J2MA 2DUYA 3GDXA 3MFHA 4EX7A 3PX0A 2I5HA 7ICPA 4BXOA 4JK1A 1NKEA 4ECXA 1ZQMA 4MF2A 2KP7A 3RTVA 5AKKA 4DOBA 3NS1A 2HBJA 1NK5A 3IRUA 1F44A 3MGVA 5ALIA 4Q43A 3H0LB 2E3TA 2FLLA 5ALYA 1NJZA 4JWMA 8ICIA 3L5KA 3SV4A 3OPXA 8ICVA 2KVSA 2WB1C 1KL9A 3HILA 4B9UA 3CNHA 3SD7A 2WF5A 2W55A 1N56A 3QX7A 5ALVA 3QUBA 3CW2C 2H3QA 2PI4A 3OGUA 9ICUA 3JPRA 3PO5A 2KICA 1WUDA 2YY6A 1UT8A 5DKWA 3KTQA 4CF5A 4RNMA 4KLMA 3AU6A 5E79U 3ISDA 2ZTDA 1L6NA 1NKBA 3LDAA 1RPLA 1L3SA 4YG2A 3PO4A 5HMMA 2KEYA 2LI6A 3TQ1A 3RJJA 1NNLA 4UQGA 2RLTA 2RP5A 3MR3A 3T5KA 5EOZA 8ICTA 3KHRA 1ZXIA 1U9LA 2J6UA 2G07A 3TADA 5AM5A 1X9XA 1KN5A 3EZ5A 2W8KA 1SKWA 5J0WA 4F2RA 2MA1A 1RXWA 3MR2A 1B0XA 4P4PA 4P0PB 4DL3A 1TKDA 4GXJA 5DB6A 1PZNA 1CRXA 3BQ0A 2K60A 5AI5A 3GIKA 3BZKA 2EAOA 1N48A 4C8NA 3NVVA 1Z19A 1X66A 2OHFA 4F71A 2LHTA 4NL9C 5J2JA 4KLSA 2B0CA 4UAWA 1H38A 2KK0A 5AICA 7ICNA 8ICWA 3WK6A 1QQ7A 3BQTA 3HWTA 2AGPA 3V7JA 4G3IA 3DEEA 1SL2A 1LKYA 4C8OA 3TFSA 3QU9A 2BZFA 1A0PA 1TK8A 8ICSA 2ZXHA 3KZIU 4RPXA 3PSPA 4UAZA 2E8PA 2DKXA 5AKJA 2IA6A 2VJ4A 2GLEA 1S97A 1ZQEA 3M8RA 4UB5A 4OCZA 3GV8B 5J0OA 3QXGA 2WF9A 2NO5A 2OWOA 5KFPA 5ALKA 3ALRA 3T5HA 7ICQA 3A0BU 2BQRA 3C5GA 3LWLA 4PZNA 7ICTA 4RQ6A 5KG5A 1BVSA 2KIVA 4YP3A 2PFOA 2RRDA 3MDAA 4RQ5A 5T14A 4BUGA 4F8RA 1U45A 2KJ5A 3C2LA 3PX6A 8ICAA 3MGIA 5FP0A 4YMOA 4OJ5A 2DPIA 5AIBA 7ICKA 3ONNA 5JUMA 4O3QA 2D6FC 1WG8A 1X9MA 2Y0SF 8ICLA 2H3VA 3M7DA 4QZ9A 1CUKA 5ALHA 5C0YA 2HCFA 4P2HA 1D8YA 1MQ3A 4QWEA 5ALTA 4P4OA 2JH7A 4US9A 2XY5A 4DSIA 4QZIA 4Q8EA 4I28A 5HNKA 4O9MA 2O6KA 1NZPA 3BJYA 1IM4A 3WKCA 1U48A 2YB4A 2ZIUB 2EANA 1L5UA 1RYUA 3N7RC 1M6YA 1D8BA 2LBOA 4LZDA 4RQ4A 1BNOA 3C1ZA 8ICFA 3G6XA 4US8A 4PGYA 2PI5A 1DGJA 3HP6A 3RH4A 3GV5B 2A1AA 1BGXT 4R63A 8ICNA 2RDIA 4I2FA 4Z6DA 2ZIWB 3MABA 4GC7A 4DS4A 2ZJ8A 3J81j 2K8CB 1P7DA 2Q0ZX 4UAYA 5GTHU 2EZYA 3QU2A 4C7ZA 8ICBA 2H3FA 5KG1A 5DB8A 5KFLA 2WFAA 2PFQA 1ZQDA 4RT3A 3OTQA 4XUSA 4GXKA 3SZ2A 2QB0B 3BZCA 5J0XA 3UMBA 3AQFA 3E58A 3JPOA 3EUB2 2KN7A 2WB1F 5ALLA 3RFAA 2RDJA 1MA7A 7ICVA 1ZD2P 3GIIA 1ZQCA 1QSLA 3D6JA 3EW9A 3UXNA 4QZBA 1IG6A 2KG5A 5J8YA 4ECYA 4LZGA 1S9FA 2KHQA 1KEJA 4R65A 4PHAA 4FO6A 2QARA 2YMPA 5ALZA 1ZQZA 5KTQA 4TURA 5EE0A 4J9RA 5AM0A 3TI0A 3PSFA 5GTIU 3GILA 5JU5A 4DFPA 5J2CA 5HR7A 2G5IB 3UQ2A 3UXPA 5EWFA 2ALZA 4Z6EA 2KFNA 1S8OA 2JGAA 3RJGA 1Z1VA 5KL1B 4RQNA 3PY8A 4EX6A 1JRPA 2F77X 2FLPA 3F5EA 1Z4NA 5J2FA 2K4HA 4JB3A 2I1QA 4FBTA 9ICMA 2XO7A 2J6TA 1ZRNA 1N61A 4IC9A 5KFRA 3RR8A 4RQ2A 5J0YA 2FPLA 1KDHA 2IHNA 2VANA 3B9JA 3EWAA 4F4WA 3RJHA 9ICWA 8ICPA 4TQSA 4QZDA 2G0AA 2F2AB 5F3XB 3Q8QB 3TAPA 3PMLA 1JROA 1S0NA 4RQ3A 4I29A 4KITB 5L1KA 4B9MA 2Y9UA 3ED5A 2J6SA 4M9NA 9ICEA 4FS2A 1ZQKA 2EH9A 1PVQA 4E0DA 1MQ2A 1QTMA 1A77A 3WK7A 1KQQA 1V97A 5KFFA 2KD1A 2MU2A 4JUZA 4F3OA 1OW5A 4BGDA 4F5OA 5EE1A 3BS5B 4NLCA 1FEZA 2WHEA 2YMQA 7ICUA 4O3OA 2JEJA 2W9BA 2K4EA 1C20A 3MGHA 2KVCA 4UATA 2F76X 2OYYA 5J2AA 2KIWA 2CRXA 3SV3A 1V9PA 4YMMA 2XI9A 2ISOA 4R8UB 2W04A 1J97A 3M9OB 5J0RA 5J2KA 4GIBA 5KFMA 1SZPA 3ORYA 4NM1A 3QU4A 2BPGA 2WF6A 8ICMA 4TQRA 5KNIA 4KLUA 1N2XA 4J9OA 3VC8A 9ICSA 3RBEA 4P0QA 2E1EA 8ICJA 5C5JA 1NOMA 5KFUA 5KFBA 1Z3EB 3T5JA 1YZ7A 2OM6A 5DG7A 3BS7A 1HUZA 1UCVA 4F91B 4Y2TA 4JWNA 3H40A 4QJFB 4J9NA 4QWDA 4OJOA 1T3QA 4I2AA 4O5KA 2HBLA 1QQ6A 4DL4A 2C2EA 3UQ0A 2LYHA 7ICOA 4QWAA 4ED2A 2FPKA 2ZIXA 5J2EA 4RNOA 3PNCA 2VA3A 1O08A 1YZ6A 3G6VA 4B9LA 4B6JA 3RJFA 4YD2A 1RM6C 3K1RB 2G08A 1NK6A 1L8LA 5AKHA 9ICVA 3H8WA 5CHGA 2R8IA 4NV0A 1B22A 4BXOB 1JN3A 4U7CA 1S10A 5AM2A 3QNMA 3ICXA 3ISCA 1TAUA 5J0UA 2HOQA 2OH2A 1SXEA 4KLDA 1FIQA 2WTFA 3QU7A 4PPXA 3GIJA 3GZFA 3TANA 9ICNA 2CXYA 3ZDAA 3Q8MA 2R8JA 1NK0A 8ICYA 2KHVA 2BCQA 4B9TA 2BCUA 1ZQBA 1B43A 3MC1A 2EZZA 3GIMA 2LM4A 5HR6A 1ZQ1C 5AM3A 4KMUA 2MSNA 3N7SC 3OSNA 1WWVA 5ALJA 4EBEA 4DQRA 5KFGA 3NRZA 1K1SA 2EQYA 2UVVA 3FDSA 9ICOA 2HDOA 1UQVA 5TZVA 4IQUA 2F8LA 5D49A 4B9NA 1ED1A 2JZBA 5ALUA 5AKYA 2C2RA 5AI6A 3RH6A 2ZUCA 4MHVA 3QZ7A 3A0HU 2W54A 1NJXA 5F9NA 2W9CA 4F5NA 2XGQA 3JPPA 4ICAA 2HHWA 1V85A 5J2IA 2LYAA 5K4LA 4ED3A 4I27A 1DGSA 4QZGA 3LWMA 3QEBZ 3TAQA 5EWEA 3QEAZ 1PK3A 1TK0A 5L1MA 1QCKA 2DKZA 1BPXA 4P4MA 4JV1A 4M6WA 2W43A 2HI0A 4HAIA 4ECUA 5L1JA 1FFVA 4RQMA 5EWGA 4O3NA 4F2SA 1K1QA 1RYRA 2BCRA 4UB8U 3SAHA 2W7OA
chains in the Genus database with same CATH topology
4O3MA 2K4EA 2E5SA 3LVWA 5C0YA 1UPHA 1SZHA 4U6PA 3CP8A 3IN5A 3RF9A 3F2BA 2N1RA 2KVCA 1HIWA 2F76X 2MA1A 2KNJA 3PSFA 1PVPA 3GZFA 2JH1A 2OYYA 4P0PB 3AQEA 4AYBF 3IG8A 2LKYA 2JH7A 2OXOA 3SAGA 2KIWA 3HKZC 2CRXA 2DF4B 3H0MB 1CRXA 2KJ8A 1IIPA 2G5IB 4GFJA 2XI9A 3AL0B 3H0RB 1NZBA 2KHVA 1Q3UA 3C28A 2W04A 3D2NA 3L3FX 2H3IA 2JGAA 2ZXIA 2VJ5A 2PMZF 2YB4A 2KKPA 3LVVA 5KL1B 2ZIUB 1Z19A 4P0QB 1YT3A 2LHTA 4P0PA 4WJ3B 3GU3A 3N7RC 3PSIA 2KOBA 1D8BA 2LBOA 2F77X 3T79A 1HEKA 3F5EA 1GO3F 1XO0A 5HR6A 1ZQ1C 2XIDA 1URJA 2K4HA 2CPRA 2HBJA 1Q3VA 1Z1BA 2HOFA 1A6SA 1F44A 3VC8A 3MGVA 2Q4TA 3H0LB 2ZIUA 4P0QA 2E1EA 3N7SC 2LYBA 4BX9C 4NWIA 3DEEA 4IC9A 4QNLA 4NLBA 4OO1J 3KZXA 4PL2A 2RHFA 1A0PA 3SMVA 4BJQA 2ZXHA 3C29A 2DQNB 2ZIWB 3OPXA 4C0ZA 2G06A 2CN1A 4QIWC 2OM6A 3HKZF 2WB1C 2K8BB 2R18A 3PSPA 2GH1A 2WAQC 2F8LA 2G5HB 2K8CB 2VJ4A 4OJPA 1P7DA 2E1FA 2YX8A 3KFUF 4KMOB 2M0NA 1ED1A 3M6KA 4CDGA 4QJFB 2H3FA 3SAFA 3F2CA 2ZIVB 3CRXA 2G0AA 3M6ZA 2YB1A 4OJOA 2ZIWA 2F2AB 2ZIXB 2HOIA 2HBLA 2JMGA 3ALRA 5CRXA 2ZG6A 2H3QA 3N7PD 2Y0SC 4A8EA 4FZNA 1DRGA 4FZMA 2K4IA 3PZPA 2KICA 1WUDA 4ICAA 2HBKA 2ZIVA 2KKVA 3D2SA 2LYAA 3E0FA 1OUQA 1L6NA 2ZIXA 4CGZA 2GOLA 4OJ6A 2KV2A 2RRDA 3AQFA 2H3ZA 2DGZA 2MRLA 2A3VA 4AYBC 3O0FA 2VIXA 4CRXA 2HMXA 5T14A 4BUGA 1PVQA 1ECWA 4QIWF 3IG5A 1T94A 2KEYA 2WB1F 1KBUA 2JHDA 3F53A 3F5AA 3RFAA 2Z7JA 4KX5A 1MA7A 2KJ5A 2VKQA 2WAQF 4PL1A 2G08A 2KJ9A 4ACOA 3IP4B 2NV3A 2RP5A 2HBMA 4KX3A 5A0LA 2KD1A 2PMZC 3SQIA 3F2DA 4OJ5A 2K8AA 3NRWA 4FZLA 5HR7A 4OJLA 2BDUA 2W03A 3K1ZA 1PVRA 1TAMA 3ONNA 3PSTA 2KHQA 4JMUA 4NV0A 2D6FC 1XNSA 2XICA 4U7CA 4FE3A 3LYSA 2W7PA 2G07A 2Y0SF 3ICXA 4NLCA 5KL8B 2H3VA 3M7DA 3NUQA 3SAHA 2HOQA 2K89A 2OH2A 3VCBA 2G09A 3CYMA 3D2QA 2XVTA 2W7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JH7 A;  3F53 A;  2JHD A;  3F5A A;  2LBO A;  3F5E A;  2JH1 A; 
#chains in the Genus database with same CATH topology
 2E5S A;  2EDU A;  1SZH A;  1ZQV A;  3FAH A;  4YD1 A;  1HIW A;  1VLB A;  3WKE A;  8ICO A;  1X9W A;  5CJ7 A;  4F4X A;  4Q8F A;  2V4R A;  8ICZ A;  4EZ6 A;  2P6R A;  4DFM A;  4C8L A;  1SV0 A;  4M9J A;  5KFV A;  1X42 A;  5B5E U;  1LKY B;  1UHU A;  3RB3 A;  5DQI A;  5KAI U;  1ZQU A;  5DDY A;  4DS5 A;  3RB0 A;  4KLG A;  2IOF K;  5EE9 A;  5IIL A;  5IIJ A;  3KZX A;  4IL6 U;  4J9P A;  5DGA A;  2IHM A;  1QSS A;  2E8N A;  2A19 A;  4CE6 A;  3QYP A;  2QLT A;  4R66 A;  1ZRM A;  4BWM A;  4YCX A;  5KFE A;  9ICL A;  4QWC A;  3AU2 A;  4KLH A;  3C2K A;  4RQ7 A;  4ECZ A;  2W9A A;  4EEY A;  9ICH A;  4CGZ A;  5KFK A;  2P66 A;  2H5X A;  2HMX A;  1CEZ A;  1WCN A;  1T94 A;  9ICG A;  4C4R A;  4ED1 A;  2E8O A;  2Z7J A;  2KJ9 A;  1EXN A;  2FE9 A;  4FFD A;  1ARO P;  3SQI A;  1COK A;  3F2D A;  4FZL A;  5ALS A;  7ICR A;  3S6J A;  4RUA A;  4DL5 A;  1XNS A;  2KZZ A;  4DO9 A;  3NVZ A;  3NUQ A;  3ZI4 A;  2K89 A;  2KZM A;  2F44 A;  1XSP A;  1T8E A;  4TUS A;  3JPT A;  2BKE A;  8ICQ A;  4U6P A;  5KT5 A;  1XU4 A;  2KNJ A;  2V4Q A;  2ATL A;  4CCH A;  7ICF A;  1DK3 A;  1K5O A;  1RYS A;  3AUO A;  4DL2 A;  3C28 A;  4F4Y A;  5KG6 A;  3L3F X;  4F5R A;  4KLE A;  5KG0 A;  3LVV A;  2KKP A;  2W3R A;  3ZDD A;  1ZOL A;  2YQE A;  4EBC A;  2KSO A;  5DLF A;  1NK7 A;  2R8H A;  2XID A;  1URJ A;  3V6H A;  4NLZ A;  4ZOH C;  5D4B A;  4RPZ A;  1S0V A;  1WYG A;  4NWI A;  3V6J A;  3EYZ A;  2DQN B;  2CN1 A;  4I2J A;  2R18 A;  4TUP A;  1X6I A;  4DWI A;  5AI8 A;  5J2D A;  1AQ6 A;  1TVA A;  1LVH A;  3H4B A;  3RAX A;  2FLN A;  7ICE A;  3F2C A;  2NRT A;  3PVX A;  3KKA C;  1N63 A;  3NGD A;  3RJI A;  1B4F A;  4DSK A;  3RAQ A;  4IQT A;  5KT7 A;  8ICH A;  1ZQJ A;  1PK1 A;  4FZM A;  5KG2 A;  1N5X A;  4IRD A;  3GQC A;  2C2D A;  5KFN A;  1X6J A;  2ZIV A;  3WK8 A;  2HSZ A;  1U49 A;  2IOH A;  1DK2 A;  1JXE A;  2QAR B;  3T5L A;  2BCS A;  2LPE A;  4KX3 A;  3Q8L A;  3C1Y A;  4NLK A;  2F1H A;  3NRW A;  1X40 A;  3I76 A;  4J03 A;  1TAM A;  7ICI A;  1ZQP A;  5KFT A;  3V7K A;  4KTQ A;  4DFK A;  3VCB A;  4O5C A;  4K4G A;  5AHX A;  3CP8 A;  3IN5 A;  3BQ1 A;  4IQV A;  3SR6 A;  2DFL A;  3B0X A;  3AQE A;  2GWS A;  4KLF A;  3RRG A;  3V72 A;  3H0M B;  1SV4 A;  1SV0 C;  3TKA A;  3D2N A;  3FC4 A;  4DQI A;  3JPS A;  2C28 A;  3KBB A;  5ALN A;  1SWV A;  5J2H A;  4J9K A;  1RQL A;  3OHA A;  4DSE A;  2BCV A;  1HEK A;  3WKD A;  4RPY A;  4F4Z A;  1XO0 A;  4F50 A;  4X5V A;  1ZQH A;  1Q3V A;  3UXO A;  2HOF A;  3THV A;  4BX9 C;  4DSJ A;  4C8K A;  3OSP A;  5KT2 A;  3RJE A;  1JIH A;  1JMS A;  3SMV A;  4BJQ A;  1RG6 A;  1NK4 A;  4YVZ A;  1L3U A;  4I2B A;  4QZ8 A;  7ICJ A;  3KFU F;  3WK4 A;  1RQN A;  2ISP A;  2ODG A;  4DQS A;  1COO A;  4NM2 A;  5B66 U;  4MEX A;  3ETR A;  1U47 A;  4UAS A;  5J0S A;  2HBK A;  9ICT A;  4F93 B;  3UM9 A;  4ED6 A;  2IOF A;  3M9M B;  2A3V A;  9ICR A;  3MR6 A;  1L8O A;  2FMQ A;  4CRX A;  2JEG A;  4MFF A;  5KFQ A;  3QUC A;  1X2I A;  4PL1 A;  4DF8 A;  3R9K A;  2W3S A;  5AI4 A;  2W9B B;  2MUT A;  1FO4 A;  3ISB A;  2I6X A;  3H8J A;  3NTU A;  4Z6C A;  4EBD A;  4GLX A;  3RF9 A;  1S0O A;  4M04 A;  3HKZ C;  2E8M A;  3AL0 B;  2KMD A;  1Z00 A;  5AI9 A;  4QZE A;  4UW9 A;  2VJ5 A;  9ICJ A;  1XWL A;  4P0Q B;  1SWW A;  1RDF A;  3AM9 A;  2FI1 A;  2HHQ A;  4J9S A;  3IHQ B;  4XQ8 A;  2A1J A;  2ZJA A;  5KFX A;  1XSN A;  3Q8K A;  1XC9 A;  3ZDB A;  1DOQ A;  2PFP A;  3TAC B;  4KLL A;  5BOM A;  2XCP A;  3K75 D;  2D8C A;  4F5Q A;  1PUZ A;  4PL2 A;  3C29 A;  5III A;  3KOO A;  5AKX A;  4IR1 A;  4DSF A;  2WAQ C;  3C2M A;  1LV5 A;  1F0M A;  4KMO B;  4DCC A;  3M6K A;  5AK5 A;  1U4B A;  4C8M A;  2YB1 A;  4BDP A;  2ZIX B;  4G9B A;  2BQU A;  4O3R A;  2ZG6 A;  4DQP A;  5ALR A;  4B9V A;  4IR9 A;  4DL6 A;  4FZN A;  3M8S A;  5F9L A;  2AJQ A;  1ZQQ A;  2Y1J A;  1T7P A;  9ICX A;  3FYH A;  4M9H A;  3PW0 A;  3QE9 Y;  5AK3 A;  3Q8S B;  5ALO A;  3B0Y A;  3DV9 A;  1L3V A;  2HHV A;  5CEH A;  3IP4 B;  3EPI A;  4YFK A;  3UMG A;  1MN8 A;  1ZET A;  2RQ5 A;  4ECV A;  4KN7 A;  1L7N A;  2EAM A;  4C80 A;  4Y2Y A;  3AN1 A;  5BOL A;  1SGG A;  1V38 A;  3EPG A;  3M9N B;  2G09 A;  1TE2 A;  4RNN A;  4PH5 A;  4NLG A;  2OXO A;  5J0T A;  2KJ8 A;  2AXT U;  3RR7 A;  4QW9 A;  2FMP A;  3C5F A;  2XCA A;  4M9L A;  2ZXI A;  3RBD A;  4F72 A;  2AGQ A;  3RRH A;  2JRZ A;  1GO3 F;  2ZJ5 A;  5CA7 A;  5CB1 A;  4QZC A;  1SIJ A;  4PJ0 U;  4UB4 A;  1A6S A;  1O03 A;  5DQG A;  2ASD A;  4I2G A;  2HHS A;  2JZB B;  3WK9 A;  1MC8 A;  3PW7 A;  2K8B B;  1D9D A;  4M0A A;  4Z6F A;  4YR2 A;  3N28 A;  2W9C B;  3BQ7 A;  3PMN A;  1NI3 A;  4M9G A;  2F1I A;  1BPB A;  1T4G A;  4KN4 A;  2DBY A;  3RJK A;  1ZQS A;  4QZF A;  4YN4 A;  3PW2 A;  3Q8P B;  4RT2 A;  2KKV A;  1TAQ A;  3E0F A;  4ECT A;  3QU5 A;  3AMZ A;  4M6W B;  5TIS U;  1D9F A;  5KAF U;  2VIX A;  3N4M B;  1UA0 A;  1UA1 A;  1NKC A;  3NVW A;  5IIN A;  3KKA A;  5A0L A;  8ICC A;  4DSL A;  1ZQX A;  4CNQ A;  3OJS A;  5ALP A;  2EAP A;  1LB2 B;  5DBB A;  2M9N A;  3DDH A;  4USA A;  2UVW A;  1TFR A;  4F4K A;  1BPD A;  3NVY A;  4KLJ A;  4QW8 A;  7ICM A;  2JH1 A;  4DOC A;  1OXJ A;  1JX4 A;  4O5E A;  2ES6 A;  2BPC A;  5G5H A;  4GFJ A;  9ICQ A;  5KFZ A;  1Q3U A;  4M2Y A;  1Z4O A;  1RXV A;  2FMS A;  2BQ3 A;  2C22 A;  4I2I A;  5KG3 A;  1N62 A;  3T79 A;  4JV2 A;  2YML A;  3WU2 U;  4KLT A;  4DLE A;  1XS9 D;  4LJX A;  1KLN A;  2W8L A;  3OHB A;  4O3S A;  4MF8 A;  1KFT A;  1IXR A;  4CF4 A;  1BPE A;  4CF3 A;  1ZQW A;  3T3F A;  4RU9 A;  9ICP A;  1ZQR A;  4DEZ A;  2F8K A;  8ICE A;  4QIW C;  2G06 A;  1KFD A;  1L7M A;  3HKZ F;  4ELU A;  3QUT A;  4IRC A;  4MFA A;  2AQ0 A;  4M47 A;  1ZQL A;  4CDG A;  4RQ0 A;  2HVI A;  5J0Q A;  1BPY A;  1C7Y A;  3JPQ A;  1S0M A;  3L4P A;  3IDW A;  4Y2U A;  4ECQ A;  1JI7 A;  4A8E A;  1L3T A;  1KSP A;  3PZP A;  5KFJ A;  3PR5 B;  4EEL A;  1TV9 A;  2DGZ A;  2ASJ A;  1SKR A;  3I1Y A;  5KFD A;  2WAQ F;  4ACO A;  4OD0 A;  2PMZ C;  4K4H A;  2UVU A;  2W03 A;  5H2F U;  4ECS A;  5EE3 A;  5ALQ A;  2B6G A;  3PST A;  1JAL A;  4JMU A;  5KFH A;  2PXI A;  1S76 D;  3Q8R B;  2R8K A;  5AKL A;  4DQQ A;  1ZJM A;  3CYM A;  2ZUD A;  1A76 A;  4O3M A;  4QZH A;  2HHX A;  1SXD A;  4PZO A;  7ICL A;  1VJ5 A;  3IG8 A;  2KSO B;  2DF4 B;  5HML A;  4RQ1 A;  3H0R B;  9ICA A;  3I28 A;  4J9L A;  3FM9 A;  5G5G A;  1YT3 A;  4UBB A;  3KD3 A;  4P0P A;  4MEY A;  8ICU A;  3HW8 A;  1HJP A;  1Q46 A;  5ALE A;  4ELT A;  4UAU A;  1T3N A;  4J9Q A;  3RB4 A;  5DDM A;  3ZDC A;  2LYB A;  5KFS A;  4UBC A;  2IBK A;  1SB3 C;  9ICC A;  4C0Z A;  3H7I A;  3QUQ A;  2GH1 A;  4B9S A;  3GV7 B;  1PK1 B;  5IIO A;  1FFU A;  2LM1 A;  2DPJ A;  4UB1 A;  2ZIV B;  4I2H A;  4IQW A;  5KFY A;  5AKZ A;  3V7L A;  1SL1 A;  5KG7 A;  3JPN A;  4J9M A;  3TAR A;  4DLG A;  2K4I A;  4I2E A;  1XO1 A;  4O0I A;  1RZT A;  4Q44 A;  2PFN A;  7ICS A;  1OUQ A;  5J0P A;  3ZD9 A;  4AYB C;  1ECW A;  1F5S A;  2BHN A;  4ED8 A;  5DBA A;  1KBU A;  8ICG A;  3F5A A;  4KX5 A;  4TUQ A;  3IV6 A;  4GC6 A;  1NJW A;  2NV3 A;  3HRD D;  4LVS A;  3ZD8 A;  4C4T A;  3E2E A;  5L9X A;  3KHG A;  5IIM A;  4JV0 A;  9ICK A;  4PHE A;  1WWU A;  3H4D A;  2OEH A;  3SI8 A;  4FE3 A;  2D3D A;  5J2G A;  4F92 B;  4DL7 A;  5DG9 A;  2DWQ A;  2BDP A;  4C4S A;  1ZD5 A;  2XVT A;  1UPH A;  2JV3 A;  2JXJ A;  3F2B A;  1L7O A;  4PGX A;  2HVH A;  2Y1I A;  2ZTE A;  2NYV A;  4RQ8 A;  4Y2P A;  3PX4 A;  2FJ6 A;  3HPO A;  5IIK A;  2MAX A;  1IIP A;  5JRT A;  3WKA A;  2AH5 A;  1S5L U;  2AU0 A;  2FDR A;  4UB2 A;  1L7P A;  3TFR A;  4Y2R A;  1N5W A;  3HJE A;  2BPF A;  5CP2 A;  3ZDE A;  1QLN A;  1HUO A;  2JR5 A;  1X9S A;  4EEK A;  5HP4 A;  9ICI A;  1NK8 A;  4Y2Q A;  2LMR A;  3K4G A;  7ICH A;  3NAS A;  2ZIU A;  4NXZ A;  3IM1 A;  5J2B A;  4NLB A;  3MFI A;  4EZ9 A;  4OO1 J;  1ZQG A;  2QB1 A;  3OJU A;  4DFD A;  2GO7 A;  2NRZ A;  4O3P A;  3RH5 A;  2XY7 A;  3PW5 A;  4ED7 A;  4OJP A;  4MFC A;  5AIA A;  4K4I A;  2E1F A;  2YX8 A;  3SYZ A;  2M0N A;  3C23 A;  4EYI B;  5JTI A;  1ZQO A;  9ICB A;  3M6Z A;  5ALW A;  2NRX A;  2ZIW A;  4YMN A;  3H8M A;  5DGB A;  5DG8 A;  1MSW D;  3TAD C;  2P35 A;  4RUC A;  5KFC A;  2NRV A;  4DFJ A;  2YMM A;  4KLI A;  2AHO B;  2KV2 A;  3V6K A;  5L1I A;  2H3Z A;  4DOA A;  2MUT B;  3MBY A;  8ICR A;  4QIW F;  2FPM A;  4BWJ A;  1SL0 A;  2VKQ A;  2AQ4 A;  5ALG A;  3HT3 A;  2QB0 A;  5KT4 A;  3PW4 A;  2WF7 A;  2ZUB A;  4GXI A;  4QZA A;  4NJ8 A;  2AGO A;  4OJL A;  5AM1 A;  3K1Z A;  1PVR A;  4Y2J A;  1ZQN A;  4UB3 A;  4PHD A;  1BNP A;  4I2D A;  2W7P A;  2PKE A;  3MDC A;  3LK9 A;  5KFW A;  1TK5 A;  5DQH A;  1Z00 B;  3UMC A;  2R8G A;  4YQW A;  4AP9 A;  3WKB A;  2N1R A;  5DB7 A;  2ASL A;  4I2C A;  2W9M A;  5KT6 A;  1Y88 A;  4HYK A;  2A1J B;  2YN4 A;  2XC9 A;  2F3N A;  2H3I A;  2PMZ F;  5AI0 A;  4NY8 A;  3U26 A;  3GU3 A;  2JEI A;  4DF4 A;  5CWR A;  4C7Y A;  1ZJN A;  2UVR A;  1DXS A;  1SKS A;  2CPR A;  5KT3 A;  2V9W A;  4ECR A;  5DBC A;  4ELV A;  2Q4T A;  4RZR A;  7ICG A;  4QNL A;  1CI4 A;  5AKG A;  4YXM A;  2RHF A;  3GFK B;  2Y9T A;  4IRK A;  4UAR A;  2G5H B;  3SEI A;  4FS1 A;  5BPC A;  2NRW A;  3CRX A;  3SAF A;  5KFI A;  3KHH A;  1ZQT A;  4QWB A;  1NJY A;  1J2N A;  2JMG A;  5AK4 A;  5CRX A;  2P6U A;  3PV8 A;  4FBU A;  3N7P D;  3KHL A;  4PHP A;  1DRG A;  2JEF A;  1IV8 A;  1ZQF A;  2L5Y A;  4KLQ A;  4XA5 A;  3MR5 A;  5KFA A;  2MRL A;  2ZTC A;  2KZ3 A;  1BPZ A;  2ESE A;  2F1J A;  2IMW P;  3G6Y A;  2HHU A;  5AK6 A;  3HX0 A;  1ZQY A;  2KTQ A;  2BDU A;  1KRP A;  4YR0 A;  5ALM A;  1JUD A;  2W11 A;  3M1Y A;  4Y2X A;  1QSY A;  3LYS A;  1ZYQ A;  2NO4 A;  5AKE A;  1ZQI A;  1NK9 A;  3D2Q A;  2BGW A;  3LVW A;  2KFZ A;  4ECW A;  5DLG A;  1PVP A;  8ICK A;  5ALD A;  5KG4 A;  4AYB F;  2YTU A;  2B21 A;  2LKY A;  3SAG A;  3QZ8 A;  3BS5 A;  1WCL A;  1NZB A;  3N97 B;  5KFO A;  4PGQ A;  1ZD3 A;  1KFS A;  4UB6 U;  4WJ3 B;  3PSI A;  1Q8K A;  2KOB A;  2VA2 A;  5L1L A;  4Y2V A;  4NL9 A;  2KE7 A;  4R8U A;  1Z1B A;  4Y2S A;  3PR4 A;  2DL0 A;  5DB9 A;  3UPQ A;  3AEV A;  1QH9 A;  2WF8 A;  2HW3 A;  5ALX A;  1D8L A;  3RB6 A;  5D46 A;  3WK5 A;  4R64 A;  1KTQ A;  2XY6 A;  1S77 D;  5J29 A;  3BDP A;  4EYH B;  5AM4 A;  1ZQA A;  2I9G A;  5HHI A;  4F5P A;  4YXJ A;  4ED0 A;  2HOI A;  5J8Y C;  1KW4 A;  4XRH A;  3BQ2 A;  2EZX A;  2Y0S C;  5HHH A;  5AKI A;  8ICX A;  4EEN A;  5ALF A;  3D2S A;  2HHT A;  1ZD4 A;  2GOL A;  4OJ6 A;  1QQ5 A;  3O0F A;  2VA8 A;  1XSL A;  2OCE A;  2JHD A;  3F53 A;  4YR3 A;  4UAV A;  1N60 A;  3C21 A;  4NLN A;  5CR0 A;  2HBM A;  2K8A A;  4ZH4 A;  1VDV A;  2QKQ A;  4IS7 A;  2XIC A;  2XGP A;  2BR0 A;  9ICF A;  2K4P A;  3SEN A;  5KL8 B;  4Q45 A;  1JXL A;  3H8S A;  1KKX A;  3IG5 A;  4KLO A;  3ETL A;  1UT5 A;  1J2M A;  2DUY A;  3GDX A;  3MFH A;  4EX7 A;  3PX0 A;  2I5H A;  7ICP A;  4BXO A;  4JK1 A;  1NKE A;  4ECX A;  1ZQM A;  4MF2 A;  2KP7 A;  3RTV A;  5AKK A;  4DOB A;  3NS1 A;  2HBJ A;  1NK5 A;  3IRU A;  1F44 A;  3MGV A;  5ALI A;  4Q43 A;  3H0L B;  2E3T A;  2FLL A;  5ALY A;  1NJZ A;  4JWM A;  8ICI A;  3L5K A;  3SV4 A;  3OPX A;  8ICV A;  2KVS A;  2WB1 C;  1KL9 A;  3HIL A;  4B9U A;  3CNH A;  3SD7 A;  2WF5 A;  2W55 A;  1N56 A;  3QX7 A;  5ALV A;  3QUB A;  3CW2 C;  2H3Q A;  2PI4 A;  3OGU A;  9ICU A;  3JPR A;  3PO5 A;  2KIC A;  1WUD A;  2YY6 A;  1UT8 A;  5DKW A;  3KTQ A;  4CF5 A;  4RNM A;  4KLM A;  3AU6 A;  5E79 U;  3ISD A;  2ZTD A;  1L6N A;  1NKB A;  3LDA A;  1RPL A;  1L3S A;  4YG2 A;  3PO4 A;  5HMM A;  2KEY A;  2LI6 A;  3TQ1 A;  3RJJ A;  1NNL A;  4UQG A;  2RLT A;  2RP5 A;  3MR3 A;  3T5K A;  5EOZ A;  8ICT A;  3KHR A;  1ZXI A;  1U9L A;  2J6U A;  2G07 A;  3TAD A;  5AM5 A;  1X9X A;  1KN5 A;  3EZ5 A;  2W8K A;  1SKW A;  5J0W A;  4F2R A;  2MA1 A;  1RXW A;  3MR2 A;  1B0X A;  4P4P A;  4P0P B;  4DL3 A;  1TKD A;  4GXJ A;  5DB6 A;  1PZN A;  1CRX A;  3BQ0 A;  2K60 A;  5AI5 A;  3GIK A;  3BZK A;  2EAO A;  1N48 A;  4C8N A;  3NVV A;  1Z19 A;  1X66 A;  2OHF A;  4F71 A;  2LHT A;  4NL9 C;  5J2J A;  4KLS A;  2B0C A;  4UAW A;  1H38 A;  2KK0 A;  5AIC A;  7ICN A;  8ICW A;  3WK6 A;  1QQ7 A;  3BQT A;  3HWT A;  2AGP A;  3V7J A;  4G3I A;  3DEE A;  1SL2 A;  1LKY A;  4C8O A;  3TFS A;  3QU9 A;  2BZF A;  1A0P A;  1TK8 A;  8ICS A;  2ZXH A;  3KZI U;  4RPX A;  3PSP A;  4UAZ A;  2E8P A;  2DKX A;  5AKJ A;  2IA6 A;  2VJ4 A;  2GLE A;  1S97 A;  1ZQE A;  3M8R A;  4UB5 A;  4OCZ A;  3GV8 B;  5J0O A;  3QXG A;  2WF9 A;  2NO5 A;  2OWO A;  5KFP A;  5ALK A;  3ALR A;  3T5H A;  7ICQ A;  3A0B U;  2BQR A;  3C5G A;  3LWL A;  4PZN A;  7ICT A;  4RQ6 A;  5KG5 A;  1BVS A;  2KIV A;  4YP3 A;  2PFO A;  2RRD A;  3MDA A;  4RQ5 A;  5T14 A;  4BUG A;  4F8R A;  1U45 A;  2KJ5 A;  3C2L A;  3PX6 A;  8ICA A;  3MGI A;  5FP0 A;  4YMO A;  4OJ5 A;  2DPI A;  5AIB A;  7ICK A;  3ONN A;  5JUM A;  4O3Q A;  2D6F C;  1WG8 A;  1X9M A;  2Y0S F;  8ICL A;  2H3V A;  3M7D A;  4QZ9 A;  1CUK A;  5ALH A;  5C0Y A;  2HCF A;  4P2H A;  1D8Y A;  1MQ3 A;  4QWE A;  5ALT A;  4P4O A;  2JH7 A;  4US9 A;  2XY5 A;  4DSI A;  4QZI A;  4Q8E A;  4I28 A;  5HNK A;  4O9M A;  2O6K A;  1NZP A;  3BJY A;  1IM4 A;  3WKC A;  1U48 A;  2YB4 A;  2ZIU B;  2EAN A;  1L5U A;  1RYU A;  3N7R C;  1M6Y A;  1D8B A;  2LBO A;  4LZD A;  4RQ4 A;  1BNO A;  3C1Z A;  8ICF A;  3G6X A;  4US8 A;  4PGY A;  2PI5 A;  1DGJ A;  3HP6 A;  3RH4 A;  3GV5 B;  2A1A A;  1BGX T;  4R63 A;  8ICN A;  2RDI A;  4I2F A;  4Z6D A;  2ZIW B;  3MAB A;  4GC7 A;  4DS4 A;  2ZJ8 A;  3J81 j;  2K8C B;  1P7D A;  2Q0Z X;  4UAY A;  5GTH U;  2EZY A;  3QU2 A;  4C7Z A;  8ICB A;  2H3F A;  5KG1 A;  5DB8 A;  5KFL A;  2WFA A;  2PFQ A;  1ZQD A;  4RT3 A;  3OTQ A;  4XUS A;  4GXK A;  3SZ2 A;  2QB0 B;  3BZC A;  5J0X A;  3UMB A;  3AQF A;  3E58 A;  3JPO A;  3EUB 2;  2KN7 A;  2WB1 F;  5ALL A;  3RFA A;  2RDJ A;  1MA7 A;  7ICV A;  1ZD2 P;  3GII A;  1ZQC A;  1QSL A;  3D6J A;  3EW9 A;  3UXN A;  4QZB A;  1IG6 A;  2KG5 A;  5J8Y A;  4ECY A;  4LZG A;  1S9F A;  2KHQ A;  1KEJ A;  4R65 A;  4PHA A;  4FO6 A;  2QAR A;  2YMP A;  5ALZ A;  1ZQZ A;  5KTQ A;  4TUR A;  5EE0 A;  4J9R A;  5AM0 A;  3TI0 A;  3PSF A;  5GTI U;  3GIL A;  5JU5 A;  4DFP A;  5J2C A;  5HR7 A;  2G5I B;  3UQ2 A;  3UXP A;  5EWF A;  2ALZ A;  4Z6E A;  2KFN A;  1S8O A;  2JGA A;  3RJG A;  1Z1V A;  5KL1 B;  4RQN A;  3PY8 A;  4EX6 A;  1JRP A;  2F77 X;  2FLP A;  3F5E A;  1Z4N A;  5J2F A;  2K4H A;  4JB3 A;  2I1Q A;  4FBT A;  9ICM A;  2XO7 A;  2J6T A;  1ZRN A;  1N61 A;  4IC9 A;  5KFR A;  3RR8 A;  4RQ2 A;  5J0Y A;  2FPL A;  1KDH A;  2IHN A;  2VAN A;  3B9J A;  3EWA A;  4F4W A;  3RJH A;  9ICW A;  8ICP A;  4TQS A;  4QZD A;  2G0A A;  2F2A B;  5F3X B;  3Q8Q B;  3TAP A;  3PML A;  1JRO A;  1S0N A;  4RQ3 A;  4I29 A;  4KIT B;  5L1K A;  4B9M A;  2Y9U A;  3ED5 A;  2J6S A;  4M9N A;  9ICE A;  4FS2 A;  1ZQK A;  2EH9 A;  1PVQ A;  4E0D A;  1MQ2 A;  1QTM A;  1A77 A;  3WK7 A;  1KQQ A;  1V97 A;  5KFF A;  2KD1 A;  2MU2 A;  4JUZ A;  4F3O A;  1OW5 A;  4BGD A;  4F5O A;  5EE1 A;  3BS5 B;  4NLC A;  1FEZ A;  2WHE A;  2YMQ A;  7ICU A;  4O3O A;  2JEJ A;  2W9B A;  2K4E A;  1C20 A;  3MGH A;  2KVC A;  4UAT A;  2F76 X;  2OYY A;  5J2A A;  2KIW A;  2CRX A;  3SV3 A;  1V9P A;  4YMM A;  2XI9 A;  2ISO A;  4R8U B;  2W04 A;  1J97 A;  3M9O B;  5J0R A;  5J2K A;  4GIB A;  5KFM A;  1SZP A;  3ORY A;  4NM1 A;  3QU4 A;  2BPG A;  2WF6 A;  8ICM A;  4TQR A;  5KNI A;  4KLU A;  1N2X A;  4J9O A;  3VC8 A;  9ICS A;  3RBE A;  4P0Q A;  2E1E A;  8ICJ A;  5C5J A;  1NOM A;  5KFU A;  5KFB A;  1Z3E B;  3T5J A;  1YZ7 A;  2OM6 A;  5DG7 A;  3BS7 A;  1HUZ A;  1UCV A;  4F91 B;  4Y2T A;  4JWN A;  3H40 A;  4QJF B;  4J9N A;  4QWD A;  4OJO A;  1T3Q A;  4I2A A;  4O5K A;  2HBL A;  1QQ6 A;  4DL4 A;  2C2E A;  3UQ0 A;  2LYH A;  7ICO A;  4QWA A;  4ED2 A;  2FPK A;  2ZIX A;  5J2E A;  4RNO A;  3PNC A;  2VA3 A;  1O08 A;  1YZ6 A;  3G6V A;  4B9L A;  4B6J A;  3RJF A;  4YD2 A;  1RM6 C;  3K1R B;  2G08 A;  1NK6 A;  1L8L A;  5AKH A;  9ICV A;  3H8W A;  5CHG A;  2R8I A;  4NV0 A;  1B22 A;  4BXO B;  1JN3 A;  4U7C A;  1S10 A;  5AM2 A;  3QNM A;  3ICX A;  3ISC A;  1TAU A;  5J0U A;  2HOQ A;  2OH2 A;  1SXE A;  4KLD A;  1FIQ A;  2WTF A;  3QU7 A;  4PPX A;  3GIJ A;  3GZF A;  3TAN A;  9ICN A;  2CXY A;  3ZDA A;  3Q8M A;  2R8J A;  1NK0 A;  8ICY A;  2KHV A;  2BCQ A;  4B9T A;  2BCU A;  1ZQB A;  1B43 A;  3MC1 A;  2EZZ A;  3GIM A;  2LM4 A;  5HR6 A;  1ZQ1 C;  5AM3 A;  4KMU A;  2MSN A;  3N7S C;  3OSN A;  1WWV A;  5ALJ A;  4EBE A;  4DQR A;  5KFG A;  3NRZ A;  1K1S A;  2EQY A;  2UVV A;  3FDS A;  9ICO A;  2HDO A;  1UQV A;  5TZV A;  4IQU A;  2F8L A;  5D49 A;  4B9N A;  1ED1 A;  2JZB A;  5ALU A;  5AKY A;  2C2R A;  5AI6 A;  3RH6 A;  2ZUC A;  4MHV A;  3QZ7 A;  3A0H U;  2W54 A;  1NJX A;  5F9N A;  2W9C A;  4F5N A;  2XGQ A;  3JPP A;  4ICA A;  2HHW A;  1V85 A;  5J2I A;  2LYA A;  5K4L A;  4ED3 A;  4I27 A;  1DGS A;  4QZG A;  3LWM A;  3QEB Z;  3TAQ A;  5EWE A;  3QEA Z;  1PK3 A;  1TK0 A;  5L1M A;  1QCK A;  2DKZ A;  1BPX A;  4P4M A;  4JV1 A;  4M6W A;  2W43 A;  2HI0 A;  4HAI A;  4ECU A;  5L1J A;  1FFV A;  4RQM A;  5EWG A;  4O3N A;  4F2S A;  1K1Q A;  1RYR A;  2BCR A;  4UB8 U;  3SAH A;  2W7O A; 
#chains in the Genus database with same CATH homology
 4O3M A;  2K4E A;  2E5S A;  3LVW A;  5C0Y A;  1UPH A;  1SZH A;  4U6P A;  3CP8 A;  3IN5 A;  3RF9 A;  3F2B A;  2N1R A;  2KVC A;  1HIW A;  2F76 X;  2MA1 A;  2KNJ A;  3PSF A;  1PVP A;  3GZF A;  2JH1 A;  2OYY A;  4P0P B;  3AQE A;  4AYB F;  3IG8 A;  2LKY A;  2JH7 A;  2OXO A;  3SAG A;  2KIW A;  3HKZ C;  2CRX A;  2DF4 B;  3H0M B;  1CRX A;  2KJ8 A;  1IIP A;  2G5I B;  4GFJ A;  2XI9 A;  3AL0 B;  3H0R B;  1NZB A;  2KHV A;  1Q3U A;  3C28 A;  2W04 A;  3D2N A;  3L3F X;  2H3I A;  2JGA A;  2ZXI A;  2VJ5 A;  2PMZ F;  2YB4 A;  2KKP A;  3LVV A;  5KL1 B;  2ZIU B;  1Z19 A;  4P0Q B;  1YT3 A;  2LHT A;  4P0P A;  4WJ3 B;  3GU3 A;  3N7R C;  3PSI A;  2KOB A;  1D8B A;  2LBO A;  2F77 X;  3T79 A;  1HEK A;  3F5E A;  1GO3 F;  1XO0 A;  5HR6 A;  1ZQ1 C;  2XID A;  1URJ A;  2K4H A;  2CPR A;  2HBJ A;  1Q3V A;  1Z1B A;  2HOF A;  1A6S A;  1F44 A;  3VC8 A;  3MGV A;  2Q4T A;  3H0L B;  2ZIU A;  4P0Q A;  2E1E A;  3N7S C;  2LYB A;  4BX9 C;  4NWI A;  3DEE A;  4IC9 A;  4QNL A;  4NLB A;  4OO1 J;  3KZX A;  4PL2 A;  2RHF A;  1A0P A;  3SMV A;  4BJQ A;  2ZXH A;  3C29 A;  2DQN B;  2ZIW B;  3OPX A;  4C0Z A;  2G06 A;  2CN1 A;  4QIW C;  2OM6 A;  3HKZ F;  2WB1 C;  2K8B B;  2R18 A;  3PSP A;  2GH1 A;  2WAQ C;  2F8L A;  2G5H B;  2K8C B;  2VJ4 A;  4OJP A;  1P7D A;  2E1F A;  2YX8 A;  3KFU F;  4KMO B;  2M0N A;  1ED1 A;  3M6K A;  4CDG A;  4QJF B;  2H3F A;  3SAF A;  3F2C A;  2ZIV B;  3CRX A;  2G0A A;  3M6Z A;  2YB1 A;  4OJO A;  2ZIW A;  2F2A B;  2ZIX B;  2HOI A;  2HBL A;  2JMG A;  3ALR A;  5CRX A;  2ZG6 A;  2H3Q A;  3N7P D;  2Y0S C;  4A8E A;  4FZN A;  1DRG A;  4FZM A;  2K4I A;  3PZP A;  2KIC A;  1WUD A;  4ICA A;  2HBK A;  2ZIV A;  2KKV A;  3D2S A;  2LYA A;  3E0F A;  1OUQ A;  1L6N A;  2ZIX A;  4CGZ A;  2GOL A;  4OJ6 A;  2KV2 A;  2RRD A;  3AQF A;  2H3Z A;  2DGZ A;  2MRL A;  2A3V A;  4AYB C;  3O0F A;  2VIX A;  4CRX A;  2HMX A;  5T14 A;  4BUG A;  1PVQ A;  1ECW A;  4QIW F;  3IG5 A;  1T94 A;  2KEY A;  2WB1 F;  1KBU A;  2JHD A;  3F53 A;  3F5A A;  3RFA A;  2Z7J A;  4KX5 A;  1MA7 A;  2KJ5 A;  2VKQ A;  2WAQ F;  4PL1 A;  2G08 A;  2KJ9 A;  4ACO A;  3IP4 B;  2NV3 A;  2RP5 A;  2HBM A;  4KX3 A;  5A0L A;  2KD1 A;  2PMZ C;  3SQI A;  3F2D A;  4OJ5 A;  2K8A A;  3NRW A;  4FZL A;  5HR7 A;  4OJL A;  2BDU A;  2W03 A;  3K1Z A;  1PVR A;  1TAM A;  3ONN A;  3PST A;  2KHQ A;  4JMU A;  4NV0 A;  2D6F C;  1XNS A;  2XIC A;  4U7C A;  4FE3 A;  3LYS A;  2W7P A;  2G07 A;  2Y0S F;  3ICX A;  4NLC A;  5KL8 B;  2H3V A;  3M7D A;  3NUQ A;  3SAH A;  2HOQ A;  2K89 A;  2OH2 A;  3VCB A;  2G09 A;  3CYM A;  3D2Q A;  2XVT A;  2W7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...