2LBOA

Eimeria tenella microneme protein 3 mar_b domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
APTLQEALDRKCAQFGKESCNSGLASYCGAAIYARYDKGNSSQQTKEWRCYIEKELDFSKSGDGCVDDCGSMTSCRGSVSGPSTSHLTRPSELQAVIDSDKSNYCTDKSEQQPSQATPPPEIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Role of Sialyl Glycan Recognition in Host Tissue Tropism of the Avian Parasite Eimeria tenella
pubmed doi rcsb
source organism Eimeria tenella
molecule tags Cell adhesion
molecule keywords Microneme protein 3
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10564 MAR_sialic_bdg Sialic-acid binding micronemal adhesive repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.580 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lboA00
3F53A 2LBOA 3F5AA 2JH1A 2JHDA 3F5EA 2JH7A
chains in the Genus database with same CATH superfamily
1N61A 3V6KA 4BXOB 2W9BA 4P2HA 1ZETA 5KFMA 5KFYA 2BKEA 4JB3A 4GIBA 1CRXA 4NM1A 8ICHA 3TADA 3N28A 4EBCA 4FE3A 4P0PA 4PH5A 4C7ZA 2VJ4A 3K4GA 2RP5A 7ICPA 2UVRA 5GTHU 2XICA 3C29A 3V72A 5AIAA 5J2GA 3PW0A 2HMXA 3BS7A 3J81j 2E5SA 2G09A 4M9JA 3C1ZA 1Z1BA 9ICEA 4P0QB 4QZDA 5KNIA 1LVHA 2QB1A 4JV2A 5ALIA 2NO5A 1JXLA 1JI7A 1OXJA 5J8YC 5AM3A 2KEYA 1ED1A 4F5RA 2XVTA 4O3NA 3GIIA 4RQNA 5ALUA 2RQ5A 4QZCA 9ICKA 2KTQA 2B21A 3ISBA 4OJOA 1TAQA 3QUTA 4C7YA 4QZGA 4IQVA 5G5GA 1N2XA 4AYBC 7ICEA 1J2MA 1U45A 1BPEA 4KMUA 4C8MA 2XGQA 3N7RC 5AM5A 3WK8A 2Y9UA 4ECSA 1RZTA 3QEBZ 2KKVA 3H8JA 3AUOA 1UCVA 4UAYA 3MR3A 2LM4A 1X6IA 4QWDA 2EZXA 4UAZA 2L5YA 2KJ8A 3QUCA 3NVWA 5J29A 2BCSA 5H2FU 1PZNA 4I2AA 5AKHA 2NRXA 1UPHA 1SGGA 2BHNA 1HIWA 5KFTA 2EZYA 2AQ4A 5HHIA 2AJQA 3AL0B 5J2BA 2F1HA 2KZMA 4RU9A 1SV4A 2K8BB 1WYGA 4DSIA 2F1IA 2QKQA 5KG1A 2WFAA 4RQMA 3Q8RB 4US8A 5L1KA 1M6YA 1NK0A 2XY5A 5IILA 4EZ6A 4BJQA 4OJ5A 1ZXIA 4F5OA 3RRHA 3BQ0A 4MFFA 4UBBA 2JH7A 4J9QA 1Z3EB 1KLNA 4I29A 3SEIA 1TK8A 4YCXA 5AM0A 1N62A 4IC9A 3CRXA 4M0AA 2W04A 3M9MB 3E2EA 1MC8A 3RJIA 4O0IA 1SKWA 8ICBA 2KVSA 2DGZA 2Y0SF 2YY6A 1COOA 4NM2A 5CB1A 1F5SA 3MFHA 5KG6A 3G6VA 5KAFU 4DFDA 2EAMA 4PPXA 1U9LA 1HUOA 2HOFA 3V6JA 2CXYA 1U48A 5ALKA 3LDAA 2F8LA 1ZQIA 1RM6C 3LWLA 5J0WA 2FMQA 5AKZA 5KFIA 3M7DA 2AGQA 3JPPA 4PHAA 3SAHA 1WCNA 1T3NA 2ASJA 3HX0A 2F3NA 3HW8A 1S77D 1ZQWA 4XUSA 2K8CB 4B9TA 4EX6A 4M9GA 1RYUA 9ICLA 3A0BU 3RH4A 2JEGA 1KFDA 2E8MA 5ALYA 2KE7A 3C5FA 5AI9A 3KKAC 4GXKA 2JZBB 3V7LA 7ICMA 4DSEA 3N4MB 1V38A 1ZQHA 4J9MA 1CI4A 3RJKA 3MR5A 3B9JA 2VKQA 2KFNA 4RNMA 1L3UA 3OJSA 3WKBA 5J0XA 4Q45A 2MAXA 3AQFA 2ZIXB 2FLNA 4IRCA 1MQ3A 4F2RA 1JIHA 1ZQUA 4ELVA 1RYSA 1TK0A 3D2NA 2MSNA 2K8AA 2JRZA 2YB4A 2WF6A 3SV4A 3AEVA 4UB1A 4M9NA 1AROP 2FI1A 2JGAA 4DL7A 3H0LB 1KL9A 2W43A 4YMMA 1IV8A 3PSPA 3IG8A 1CEZA 3TARA 3RRGA 9ICIA 1S5LU 5J2KA 5KT7A 5J0OA 9ICWA 5DQGA 1XS9D 4O3MA 5KG0A 2YMMA 3GDXA 7ICOA 4Y2JA 4ECWA 3OSNA 1CUKA 1B0XA 3EW9A 3NRWA 3QU9A 4AYBF 1UHUA 2LYHA 3KHLA 4UASA 2C2RA 4P4MA 4M47A 4KN4A 3GV7B 5AI8A 5ALVA 4LZDA 1BNPA 4RT2A 2A1JA 4YG2A 4DWIA 5KFHA 3U26A 4CF3A 3UQ0A 2LYAA 4OJLA 5KL1B 4Z6FA 3FYHA 5KT2A 4NV0A 4YMNA 3RF9A 1ZQZA 4EZ9A 3NRZA 1ZQXA 4QW9A 1URJA 3QX7A 3TFSA 4BGDA 1Z00B 4ED7A 4GXIA 4DQQA 2KSOB 3RBEA 3LVVA 7ICQA 4FZLA 3F5EA 5AK4A 1NKCA 4JK1A 4R65A 2JXJA 2XGPA 2BPFA 4GLXA 1N60A 2ZUDA 3B0YA 2KKPA 1QLNA 5EWEA 2AQ0A 2F76X 5HR6A 1L6NA 1F0MA 5KG2A 5KFCA 1RG6A 3UPQA 4QW8A 5DB8A 4RUAA 4QZFA 3FDSA 4NLKA 3M9NB 1ZJMA 2KVCA 3SYZA 4DFPA 2P6UA 4C0ZA 8ICCA 1QQ7A 4RQ5A 4UAUA 1XNSA 3PX6A 4O3SA 3PVXA 2ZIUA 2ZJ8A 5L1IA 9ICJA 3PMNA 3H0RB 5DB7A 4YQWA 4BX9C 3N7SC 1Q8KA 4QWEA 5J8YA 5KFJA 4I28A 3ISCA 3KBBA 1Z1VA 2E8NA 2HOQA 3H4DA 5CP2A 1T8EA 2N1RA 3PSFA 5ALZA 3ISDA 3JPTA 2V9WA 1MN8A 4DL5A 4Y2PA 5L1MA 2DL0A 2KZ3A 3SAFA 1BPXA 3KTQA 3PW4A 1NK5A 1L8OA 3EWAA 2BDPA 3G6YA 5IIMA 2W8LA 1ZQEA 3JPOA 4LVSA 2HSZA 3EUB2 3Q8QB 2Q4TA 2DBYA 1DGJA 3CP8A 1L3TA 4GFJA 5AKEA 5HMMA 5EWGA 2XC9A 4DOAA 1X9WA 5AIBA 1YZ7A 1S0VA 2QARA 2ZIVB 2HDOA 3QYPA 3SV3A 5DG8A 4J9RA 2HOIA 3DDHA 2EH9A 4I2GA 4UBCA 4UAWA 2W11A 1X9XA 5DLGA 2P6RA 5ALXA 3IM1A 1ZQMA 3MFIA 5DB9A 1JALA 3OGUA 3ETLA 1XU4A 2WAQC 4GC6A 2C2EA 9ICSA 2PFQA 3PW2A 3K1RB 1SL2A 4Q8FA 2GLEA 3ZDEA 1TFRA 5C0YA 3NUQA 1XO1A 2I9GA 1NJYA 4J9NA 7ICLA 2JEIA 5ALJA 5KFQA 2DPIA 3ORYA 3WK9A 5J2FA 4MF2A 2K4PA 3V7KA 3KFUF 2XY7A 4I2HA 4KLUA 4O3QA 4JV0A 3TI0A 4DSJA 2ZTDA 2JV3A 2NRWA 5KFGA 4QIWC 2A1JB 1TKDA 3A0HU 4YR2A 4TQSA 2JMGA 8ICAA 4KLHA 4DLGA 1DK2A 4Y2RA 2QB0A 2HW3A 4J9SA 1ZYQA 2KICA 3KD3A 2OWOA 2VJ5A 1K1QA 4LZGA 2YQEA 4Z6DA 3RJGA 5B66U 2VIXA 4YP3A 4IRKA 3UXNA 5CJ7A 9ICOA 3AU6A 2QARB 4FBUA 5HP4A 3IRUA 3H8MA 5HNKA 2FLPA 1TVAA 3T5HA 4MFAA 4KLFA 4B9MA 2XO7A 4EYIB 4NJ8A 3QEAZ 2V4QA 3KHRA 4KN7A 4EBEA 5IIOA 1UT5A 4F5PA 3NS1A 2KZZA 4DOBA 4F50A 5DBCA 1JROA 3PR4A 5ALSA 4F3OA 3N97B 1ZRMA 3R9KA 4EEKA 3QUBA 1RXVA 3RJHA 1L8LA 2XCPA 2PI4A 4MEYA 5AI4A 3FM9A 2ZXIA 7ICIA 2IBKA 1ZQBA 5ALNA 5D49A 1HJPA 5CA7A 5ALFA 4UB4A 4CGZA 1DRGA 1RQLA 5EOZA 5DG7A 4IS7A 1ZQCA 2MU2A 3WKEA 1RXWA 2MRLA 4USAA 2HVIA 4EELA 3TANA 5AKIA 3HILA 2YB1A 2RDIA 5HR7A 3PW5A 3GFKB 3OHAA 4F72A 1ZQFA 4C80A 4ICAA 2NRVA 3MC1A 5CWRA 2KOBA 4NL9A 3PW7A 3M6KA 1LV5A 5J0SA 2WB1C 3C2MA 3I1YA 2XCAA 4RZRA 3T5LA 3UXOA 1FO4A 5KFKA 3ZD8A 8ICXA 2KSOA 3EPGA 2K4HA 4DL2A 4Y2YA 3WKAA 2AXTU 3ED5A 3SD7A 4ECQA 2KJ5A 3ZDCA 2IHMA 3RJJA 2J6SA 2KMDA 3AN1A 3CNHA 4UARA 2W8KA 3C28A 4EYHB 4DQIA 4KLJA 1RDFA 5TISU 3N7PD 2E8PA 4DEZA 4CDGA 4J9OA 4KLOA 3OJUA 8ICYA 4YXJA 4C8LA 2Z7JA 3T5JA 2IMWP 2A3VA 9ICBA 1X40A 5KFVA 4UB6U 3OPXA 3TACB 4FO6A 1NJWA 3SI8A 2HHTA 3M6ZA 4FBTA 3F53A 1L7NA 4NLCA 2W9MA 7ICGA 4NLZA 2HBKA 3BS5B 1K5OA 1NZPA 4Y2VA 3NASA 4UAVA 1L3SA 4ECZA 5L1JA 5KAIU 3T3FA 3MGHA 4OO1J 2DQNB 5AI0A 1QSSA 1SV0C 2HBLA 4YFKA 3JPNA 2KIWA 2Y1JA 3PO4A 4RPZA 4JWMA 3EYZA 3IP4B 3MDCA 8ICQA 4TURA 4CF5A 3UQ2A 1A6SA 4MFCA 5J2IA 2VA8A 2W3RA 3BQ2A 1RQNA 2GOLA 1V9PA 4ED1A 4GC7A 1D9DA 5J2EA 2C28A 2ES6A 3LYSA 2QLTA 4DL3A 5ALMA 3ONNA 4FZMA 5AKYA 4O3PA 3PO5A 3I28A 2KIVA 1C20A 2H3QA 1XSPA 3H40A 2ODGA 2HBJA 2IOFK 4KITB 4Y2XA 3F2CA 1BVSA 3OTQA 4IQUA 2AHOB 8ICIA 4A8EA 1JX4A 4QZHA 3NVVA 2ZIXA 3BDPA 2C22A 2LHTA 1MA7A 2WAQF 4O5EA 5ALPA 4F2SA 1KKXA 2Y0SC 2HCFA 1KTQA 4MEXA 2WB1F 4ACOA 1NK7A 4Y2QA 3JPQA 4ECYA 3Q8PB 1B22A 5BOLA 5J0YA 1ZQSA 2Q0ZX 1JXEA 3L3FX 2W7PA 4TQRA 1X6JA 3WK4A 5AK3A 1L7MA 4DQPA 2OCEA 2OM6A 1FIQA 4F71A 2AGPA 2WF9A 4RPXA 1ZQYA 1ZQTA 1XSNA 3F2DA 4QZAA 4P4PA 3KZIU 3D6JA 1Q3VA 3H4BA 1LB2B 1YZ6A 3MGIA 4C8OA 1COKA 9ICUA 1Q46A 4R64A 3BS5A 5J2CA 1A0PA 1A77A 3G6XA 4P0PB 8ICJA 2HHVA 4JUZA 5KFOA 4WJ3B 3M8RA 1UQVA 4XA5A 5EE3A 3RH6A 2OH2A 4IRDA 3HPOA 4BXOA 4EENA 4YR3A 5KFLA 4RQ7A 4JWNA 1SKSA 1L7OA 5J2AA 1AQ6A 4TUSA 1F44A 9ICTA 2AGOA 2BCRA 4YD1A 5KFSA 2ZJ5A 5IIKA 3C21A 5KFDA 4DS4A 5DQIA 4K4GA 3GILA 2G5HB 9ICRA 2IHNA 8ICEA 1ZD5A 5KG3A 3IN5A 3RBDA 5JUMA 4B9UA 3VCBA 9ICQA 3O0FA 3RB6A 2NRZA 3SAGA 4F93B 5ALDA 5BPCA 3MDAA 1ZQQA 2HHWA 5KFRA 5AM4A 2B6GA 2FE9A 4OJ6A 2KD1A 1ZD2P 2ZIVA 3MR2A 1ZQGA 3ZI4A 1U47A 3T5KA 2XY6A 2AH5A 2Y1IA 2E8OA 3PMLA 1ZQAA 2W7OA 3NVZA 4F4YA 2PKEA 8ICWA 4DSFA 3ZDBA 4UW9A 1VDVA 5J0QA 4U6PA 1BPDA 4BUGA 4IL6U 2DKZA 5KFNA 5HMLA 5AKXA 1YT3A 5CHGA 4KLMA 4NLGA 3M1YA 1T94A 5KT4A 1NJZA 4CF4A 4QZIA 4MF8A 5F9NA 2FPKA 2YN4A 4ECVA 3WK6A 4G9BA 4E0DA 1VJ5A 4RQ4A 4ED0A 4EBDA 5IINA 4QZEA 4UB2A 5KFAA 4G3IA 5D4BA 4DFKA 1SB3C 4UQGA 3I76A 4PHPA 3QU4A 1SIJA 2ZIUB 5DG9A 1D8YA 4RNOA 1ZQKA 4PJ0U 4I2FA 2J6TA 4RUCA 5DBBA 2RHFA 4Z6EA 1ZQDA 2ZIWA 3SR6A 7ICSA 4IQWA 1ZQRA 1SKRA 1GO3F 3MR6A 2R18A 2JEJA 2C2DA 1J97A 1NOMA 2MA1A 5FP0A 2QB0B 4R63A 8ICSA 3KZXA 4KLDA 3BZCA 2F2AB 3WK7A 3AMZA 3L5KA 2F77X 5KT5A 1WG8A 2VANA 4QWCA 2BR0A 2ZTEA 2NO4A 1NKEA 1ZQNA 4RT3A 4LJXA 8ICOA 2J6UA 2A19A 4DFMA 4FFDA 1RPLA 1Z00A 9ICMA 4ED2A 4RPYA 2WF7A 3RB4A 1N5XA 1TK5A 7ICVA 1D8LA 3PX0A 1S76D 4EX7A 1ZQVA 2NV3A 4KLLA 1FFVA 2ZXHA 2B0CA 2UVVA 5DDYA 3KHGA 1J2NA 4U7CA 2G06A 5KFWA 4I2BA 4PHDA 9ICFA 3LWMA 1KRPA 3ETRA 4DO9A 1O03A 2P66A 4UB3A 4M2YA 2DWQA 2PMZF 1IG6A 4DSKA 5KG7A 5DGAA 5IIIA 2BPGA 1VLBA 4DL6A 3UMBA 8ICNA 5KFBA 2LMRA 2GO7A 3PNCA 4RQ3A 5AI5A 4NLBA 3GV5B 1SWWA 4R8UB 4DQSA 1L3VA 5DQHA 3HKZF 4YVZA 2YMQA 1Y88A 1NK4A 2R8IA 1H38A 2W54A 3DV9A 5E79U 1P7DA 5ALLA 4BWMA 4Q8EA 3OHBA 5TZVA 3MBYA 5EE0A 2M0NA 2PFPA 5AM2A 2ASLA 4KLGA 1KN5A 1FEZA 1XWLA 3BZKA 5IIJA 1PVPA 5J0TA 4K4IA 5KT6A 4I2DA 3TADC 2ZUBA 1IXRA 2ZTCA 3FAHA 2KP7A 4ECXA 1SXDA 2ZUCA 5GTIU 5KFPA 3M8SA 1SV0A 7ICTA 2ZJAA 3S6JA 1ZOLA 4F8RA 9ICCA 3F5AA 2E3TA 2MUTB 3QUQA 1QSYA 4DF8A 4DOCA 3GZFA 4ZOHC 4ZH4A 9ICHA 4B9SA 1RYRA 9ICGA 2DKXA 2EDUA 2OEHA 2HHXA 2HHSA 2WF8A 4B9VA 4M9LA 1ZQPA 3CW2C 1S10A 4QJFB 4KLEA 4KLSA 5KFXA 3C5GA 1KBUA 4QZBA 8ICMA 3WKCA 1X9SA 3IDWA 3TQ1A 3RFAA 4F4ZA 2LPEA 3M9OB 8ICZA 2BGWA 7ICHA 2KK0A 1S0MA 4Z6CA 4M6WB 4IR9A 4US9A 3QNMA 2KHVA 2H3FA 4RQ6A 1Q3UA 4OD0A 2BDUA 5K4LA 5KFFA 3HWTA 2BCQA 2IOFA 1KEJA 5AKJA 3Q8MA 1IM4A 4B9NA 5CR0A 3KOOA 1QSLA 7ICNA 3TAPA 2ALZA 3GIKA 3K1ZA 5ALQA 4C4SA 3GIMA 5AKGA 1JMSA 4FS1A 5KT3A 1L5UA 2H3ZA 1FFUA 4AP9A 4QWAA 4BWJA 1EXNA 4GXJA 3VC8A 9ICNA 3QU7A 1WUDA 5EE1A 2W3SA 2WHEA 2LKYA 3NGDA 2D8CA 4UB8U 2JEFA 3NVYA 4FZNA 1NI3A 4Y2SA 1A76A 2I1QA 3ZD9A 3TKAA 2W03A 1HEKA 8ICKA 1UT8A 4PHEA 4C8KA 3UXPA 3TFRA 5DKWA 4ED8A 4CNQA 4KLIA 2D3DA 1DXSA 4DSLA 2OXOA 1NZBA 3HRDD 3ZDDA 4NLNA 3RB0A 4QNLA 2PXIA 3C1YA 5B5EU 1JRPA 3QZ7A 1L7PA 4TUQA 8ICLA 4QZ9A 1N63A 2KV2A 2DPJA 2R8GA 3PSTA 1S0OA 9ICXA 4BDPA 4O9MA 5AK6A 2FDRA 4I27A 4P4OA 4YMOA 4M04A 8ICTA 3SZ2A 4K4HA 2ESEA 3AU2A 5T14A 1Z19A 4R66A 4YXMA 2G5IB 3HP6A 1X66A 2JZBA 3BJYA 4O3RA 2H5XA 3EZ5A 3E0FA 3JPSA 2G0AA 2NRTA 3RR8A 3B0XA 2YTUA 1NNLA 2JR5A 1NKBA 3KKAA 1QTMA 4P0QA 2E1FA 3HKZC 2P35A 4F92B 5KFEA 1QH9A 3GQCA 1ZQJA 2A1AA 2ISOA 3F2BA 3ZDAA 4NL9C 1NK6A 4F5NA 4O5KA 8ICGA 1D9FA 4RQ8A 1V85A 4CRXA 1PVQA 2R8HA 2GH1A 2G07A 3QE9Y 2I6XA 5ALGA 2YX8A 1X42A 1TE2A 3IG5A 3PX4A 1MQ2A 4ECRA 5ALEA 2O6KA 2I5HA 2LYBA 1DGSA 3L4PA 1QQ6A 7ICKA 3PV8A 4OJPA 2R8JA 2BCUA 5J0RA 2V4RA 2FPMA 1B43A 2BCVA 2M9NA 1T4GA 4RQ1A 4IR1A 5KG5A 5D46A 3H8WA 4C4TA 2KG5A 1BPBA 4J9KA 2GWSA 4TUPA 4NY8A 1SZHA 2CPRA 3WKDA 5F9LA 1OUQA 4PGYA 4NXZA 4C8NA 7ICFA 3IV6A 1BPYA 2EAPA 4RQ2A 3RR7A 3UMCA 3Q8SB 1S97A 3GV8B 5AICA 4KLTA 3H8SA 4ED3A 1BGXT 5J0UA 4OCZA 2OHFA 5DB6A 2DFLA 4J03A 1LKYB 2DUYA 4JMUA 4HAIA 3IHQB 3RAXA 1O08A 4F4XA 1PK1B 4DLEA 4KLQA 1S0NA 4EEYA 3Q8KA 4DL4A 1NJXA 5DLFA 2NYVA 2HHQA 2K60A 2AU0A 1NK8A 1B4FA 4FS2A 1BPZA 1X9MA 2E1EA 1PUZA 3MABA 4DF4A 3MGVA 3RJFA 3PZPA 2CRXA 2ATLA 5ALWA 4RNNA 9ICVA 1QCKA 4F91B 1WWVA 1ZQLA 1T7PA 1UA0A 1SXEA 1KSPA 5DBAA 4QWBA 2ISPA 2VA3A 2MUTA 4UATA 3RAQA 5KTQA 1SL1A 5A0LA 2H3IA 3QXGA 4KX5A 3WU2U 3D2SA 1U4BA 5C5JA 1Z4NA 3SMVA 7ICUA 2HHUA 4PZNA 3GIJA 1S8OA 2YMPA 1N5WA 2DF4B 2EAOA 1WCLA 4PL1A 5JTIA 1TV9A 4ECTA 2W9BB 2JHDA 2K4EA 2F1JA 3OSPA 5EWFA 2H3VA 2RRDA 3H0MB 2F8KA 1T3QA 1XO0A 2IA6A 1N56A 2HI0A 5KL8B 3D2QA 5HHHA 1DK3A 8ICUA 5AKLA 3BQ7A 2CN1A 3RTVA 2BQUA 8ICVA 8ICPA 2LM1A 4C4RA 4NWIA 2K4IA 2W9CB 4YN4A 5ALOA 3E58A 4R8UA 1JUDA 4XRHA 4B9LA 4I2EA 1WWUA 4IQTA 4CE6A 2ZG6A 3DEEA 4CCHA 2FJ6A 4PZOA 4J9PA 5AK5A 3QU5A 3RB3A 4MHVA 2FLLA 4J9LA 1SZPA 2Y9TA 3HJEA 5KG4A 1SL0A 1V97A 3NTUA 1ZRNA 1U49A 2KN7A 3SQIA 2D6FC 5F3XB 1DOQA 5AKKA 3GU3A 2RDJA 1IIPA 1HUZA 3AM9A 3UM9A 4DS5A 1PVRA 4KX3A 2JH1A 3TAQA 1SWVA 2VA2A 4I2IA 2PI5A 5CEHA 1MSWD 3KHHA 1JN3A 4M6WA 2K89A 2RLTA 5ALTA 5KFZA 5EE9A 2YMLA 4M9HA 4HYKA 9ICPA 4ED6A 3FC4A 5DDMA 5AM1A 5ALHA 5AHXA 3SENA 1KFSA 5AI6A 2W55A 5DGBA 5JRTA 3BQTA 1PK3A 3UMGA 4Q44A 2BZFA 5BOMA 2ZIWB 2WF5A 5ALRA 3ICXA 3EPIA 5L9XA 4KMOB 1UA1A 4PGXA 3RH5A 3K75D 4PGQA 4F4WA 2KJ9A 1TAMA 1Z4OA 2XI9A 3THVA 2EZZA 4QZ8A 4DFJA 3RJEA 4ELUA 5JU5A 2KFZA 3PY8A 3JPRA 2FPLA 3C2KA 7ICRA 5G5HA 4PL2A 3BQ1A 2XIDA 5KFUA 4Y2TA 5J2HA 1X2IA 5J0PA 2EQYA 3C2LA 2FMPA 3PR5B 4O3OA 1PK1A 2PFOA 4F5QA 2W9AA 3WK5A 3V7JA 1LKYA 2G08A 5J2DA 4Y2UA 3LK9A 1KQQA 3LVWA 3V6HA 1NK9A 4JV1A 1C7YA 4Q43A 3CYMA 2LBOA 3HT3A 2HVHA 2IOHA 2WTFA 3QZ8A 3H7IA 4UB5A 2OYYA 4YD2A 5CRXA 3C23A 9ICAA 1KFTA 2BQRA 1ZQ1C 3T79A 4F4KA 2UVUA 4O5CA 4XQ8A 2BPCA 4QIWF 3AQEA 1N48A 2BQ3A 1ECWA 1ZQOA 2R8KA 4ELTA 1TAUA 4KTQA 2PMZC 4B6JA 2ASDA 2FMSA 4DQRA 5L1LA 4YR0A 1XSLA 1XC9A 2KHQA 1ZD4A 8ICRA 2W9CA 3QU2A 1S9FA 8ICFA 4X5VA 4DCCA 2LI6A 2HBMA 3ALRA 1KDHA 7ICJA 2PFNA 1D8BA 1K1SA 2UVWA 4I2JA 4ECUA 4I2CA 1OW5A 1ZJNA 4RQ0A 5J2JA 1QQ5A 1ZD3A 2EANA 3Q8LA 2F44A 3PSIA 2KNJA 1KW4A 1BNOA
chains in the Genus database with same CATH topology
2Q4TA 3RF9A 2F77X 3C28A 3CP8A 3L3FX 3VC8A 1UPHA 2ZG6A 2W7PA 3DEEA 4GFJA 3N7PD 1CRXA 1HIWA 1WUDA 1URJA 4CDGA 4OJ6A 4CRXA 2KD1A 1PVQA 2LKYA 2GH1A 2ZIVA 2G07A 2ZIVB 2OM6A 2Z7JA 4PL2A 2XIDA 4FZNA 2A3VA 4FE3A 3AL0B 3F5AA 4P0PA 2VJ4A 2YX8A 2W7OA 3OPXA 2HOIA 2RP5A 2W03A 3IG5A 1HEKA 2VKQA 3LVVA 3GZFA 4FZLA 2K8BB 3F5EA 3M6ZA 2E1EA 2XICA 3C29A 3F53A 4NLCA 3AQFA 3SQIA 2NV3A 2ZIXB 3MGVA 2D6FC 4U6PA 2G08A 2HMXA 2LYBA 2ZXHA 4BUGA 3LVWA 3PZPA 2HBKA 3F2DA 2E5SA 3GU3A 2G09A 2CRXA 2KKPA 2OXOA 1IIPA 4U7CA 2G06A 1NZBA 1Z1BA 4BJQA 2F76X 4OJ5A 1YT3A 1Q3VA 5HR6A 4OJPA 1L6NA 4QJFB 2WAQC 3D2NA 1PVRA 4P0QB 3CYMA 2LBOA 2K8AA 2ZXIA 1T94A 2JH1A 4KX3A 4QNLA 2YB4A 2JH7A 4OO1J 1A0PA 2DQNB 1KBUA 2PMZF 4P0PB 5C0YA 2KEYA 3NUQA 2HBLA 2OYYA 2KVCA 2KV2A 1ED1A 4IC9A 2KIWA 3PSTA 2JGAA 5CRXA 3RFAA 5A0LA 2H3IA 3CRXA 4KX5A 3H0LB 3D2SA 2XVTA 3IP4B 4WJ3B 4C0ZA 2K89A 2W04A 1ZQ1C 3T79A 1DRGA 4CGZA 1XNSA 3PSPA 3SMVA 1A6SA 3IG8A 2ZIUA 2OH2A 3KFUF 4QIWF 3H0RB 4NLBA 4BX9C 3N7SC 2GOLA 3AQEA 4OJOA 2KHVA 2H3FA 5T14A 2MRLA 1Z19A 3HKZF 1Q3UA 1ECWA 1SZHA 2CPRA 2DGZA 2ZIUB 2DF4B 2G5IB 2Y0SF 3LYSA 2YB1A 4PL1A 4O3MA 2PMZC 5HR7A 2HOQA 3ONNA 2BDUA 4FZMA 4AYBC 1OUQA 1F44A 3E0FA 2G0AA 2JHDA 2K4EA 2N1RA 4QIWC 1P7DA 2H3QA 4ICAA 2RHFA 3NRWA 4AYBF 2HBJA 3PSFA 2KHQA 2H3VA 2KOBA 2ZIWA 3F2CA 2HOFA 2JMGA 2M0NA 3M6KA 2RRDA 3H0MB 2F8LA 2WB1C 1XO0A 1GO3F 3N7RC 2G5HB 5KL8B 3D2QA 4A8EA 2R18A 2KICA 2ZIWB 2HBMA 2ZIXA 3ALRA 3ICXA 2KKVA 3SAFA 4P0QA 3M7DA 3IN5A 2E1FA 3K1ZA 3HKZC 2LHTA 2CN1A 3SAHA 1D8BA 1MA7A 2VJ5A 2MA1A 2WAQF 4KMOB 4NWIA 3VCBA 1PVPA 2K4HA 2Y0SC 1TAMA 2K4IA 2K8CB 2KJ9A 2XI9A 3O0FA 2LYAA 2WB1F 4OJLA 2KJ8A 2KJ5A 4ACOA 3SAGA 3F2BA 2VIXA 2KNJA 3KZXA 3PSIA 5KL1B 2H3ZA 4JMUA 2F2AB 4NV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F53 A;  2LBO A;  3F5A A;  2JH1 A;  2JHD A;  3F5E A;  2JH7 A; 
#chains in the Genus database with same CATH topology
 1N61 A;  3V6K A;  4BXO B;  2W9B A;  4P2H A;  1ZET A;  5KFM A;  5KFY A;  2BKE A;  4JB3 A;  4GIB A;  1CRX A;  4NM1 A;  8ICH A;  3TAD A;  3N28 A;  4EBC A;  4FE3 A;  4P0P A;  4PH5 A;  4C7Z A;  2VJ4 A;  3K4G A;  2RP5 A;  7ICP A;  2UVR A;  5GTH U;  2XIC A;  3C29 A;  3V72 A;  5AIA A;  5J2G A;  3PW0 A;  2HMX A;  3BS7 A;  3J81 j;  2E5S A;  2G09 A;  4M9J A;  3C1Z A;  1Z1B A;  9ICE A;  4P0Q B;  4QZD A;  5KNI A;  1LVH A;  2QB1 A;  4JV2 A;  5ALI A;  2NO5 A;  1JXL A;  1JI7 A;  1OXJ A;  5J8Y C;  5AM3 A;  2KEY A;  1ED1 A;  4F5R A;  2XVT A;  4O3N A;  3GII A;  4RQN A;  5ALU A;  2RQ5 A;  4QZC A;  9ICK A;  2KTQ A;  2B21 A;  3ISB A;  4OJO A;  1TAQ A;  3QUT A;  4C7Y A;  4QZG A;  4IQV A;  5G5G A;  1N2X A;  4AYB C;  7ICE A;  1J2M A;  1U45 A;  1BPE A;  4KMU A;  4C8M A;  2XGQ A;  3N7R C;  5AM5 A;  3WK8 A;  2Y9U A;  4ECS A;  1RZT A;  3QEB Z;  2KKV A;  3H8J A;  3AUO A;  1UCV A;  4UAY A;  3MR3 A;  2LM4 A;  1X6I A;  4QWD A;  2EZX A;  4UAZ A;  2L5Y A;  2KJ8 A;  3QUC A;  3NVW A;  5J29 A;  2BCS A;  5H2F U;  1PZN A;  4I2A A;  5AKH A;  2NRX A;  1UPH A;  1SGG A;  2BHN A;  1HIW A;  5KFT A;  2EZY A;  2AQ4 A;  5HHI A;  2AJQ A;  3AL0 B;  5J2B A;  2F1H A;  2KZM A;  4RU9 A;  1SV4 A;  2K8B B;  1WYG A;  4DSI A;  2F1I A;  2QKQ A;  5KG1 A;  2WFA A;  4RQM A;  3Q8R B;  4US8 A;  5L1K A;  1M6Y A;  1NK0 A;  2XY5 A;  5IIL A;  4EZ6 A;  4BJQ A;  4OJ5 A;  1ZXI A;  4F5O A;  3RRH A;  3BQ0 A;  4MFF A;  4UBB A;  2JH7 A;  4J9Q A;  1Z3E B;  1KLN A;  4I29 A;  3SEI A;  1TK8 A;  4YCX A;  5AM0 A;  1N62 A;  4IC9 A;  3CRX A;  4M0A A;  2W04 A;  3M9M B;  3E2E A;  1MC8 A;  3RJI A;  4O0I A;  1SKW A;  8ICB A;  2KVS A;  2DGZ A;  2Y0S F;  2YY6 A;  1COO A;  4NM2 A;  5CB1 A;  1F5S A;  3MFH A;  5KG6 A;  3G6V A;  5KAF U;  4DFD A;  2EAM A;  4PPX A;  1U9L A;  1HUO A;  2HOF A;  3V6J A;  2CXY A;  1U48 A;  5ALK A;  3LDA A;  2F8L A;  1ZQI A;  1RM6 C;  3LWL A;  5J0W A;  2FMQ A;  5AKZ A;  5KFI A;  3M7D A;  2AGQ A;  3JPP A;  4PHA A;  3SAH A;  1WCN A;  1T3N A;  2ASJ A;  3HX0 A;  2F3N A;  3HW8 A;  1S77 D;  1ZQW A;  4XUS A;  2K8C B;  4B9T A;  4EX6 A;  4M9G A;  1RYU A;  9ICL A;  3A0B U;  3RH4 A;  2JEG A;  1KFD A;  2E8M A;  5ALY A;  2KE7 A;  3C5F A;  5AI9 A;  3KKA C;  4GXK A;  2JZB B;  3V7L A;  7ICM A;  4DSE A;  3N4M B;  1V38 A;  1ZQH A;  4J9M A;  1CI4 A;  3RJK A;  3MR5 A;  3B9J A;  2VKQ A;  2KFN A;  4RNM A;  1L3U A;  3OJS A;  3WKB A;  5J0X A;  4Q45 A;  2MAX A;  3AQF A;  2ZIX B;  2FLN A;  4IRC A;  1MQ3 A;  4F2R A;  1JIH A;  1ZQU A;  4ELV A;  1RYS A;  1TK0 A;  3D2N A;  2MSN A;  2K8A A;  2JRZ A;  2YB4 A;  2WF6 A;  3SV4 A;  3AEV A;  4UB1 A;  4M9N A;  1ARO P;  2FI1 A;  2JGA A;  4DL7 A;  3H0L B;  1KL9 A;  2W43 A;  4YMM A;  1IV8 A;  3PSP A;  3IG8 A;  1CEZ A;  3TAR A;  3RRG A;  9ICI A;  1S5L U;  5J2K A;  5KT7 A;  5J0O A;  9ICW A;  5DQG A;  1XS9 D;  4O3M A;  5KG0 A;  2YMM A;  3GDX A;  7ICO A;  4Y2J A;  4ECW A;  3OSN A;  1CUK A;  1B0X A;  3EW9 A;  3NRW A;  3QU9 A;  4AYB F;  1UHU A;  2LYH A;  3KHL A;  4UAS A;  2C2R A;  4P4M A;  4M47 A;  4KN4 A;  3GV7 B;  5AI8 A;  5ALV A;  4LZD A;  1BNP A;  4RT2 A;  2A1J A;  4YG2 A;  4DWI A;  5KFH A;  3U26 A;  4CF3 A;  3UQ0 A;  2LYA A;  4OJL A;  5KL1 B;  4Z6F A;  3FYH A;  5KT2 A;  4NV0 A;  4YMN A;  3RF9 A;  1ZQZ A;  4EZ9 A;  3NRZ A;  1ZQX A;  4QW9 A;  1URJ A;  3QX7 A;  3TFS A;  4BGD A;  1Z00 B;  4ED7 A;  4GXI A;  4DQQ A;  2KSO B;  3RBE A;  3LVV A;  7ICQ A;  4FZL A;  3F5E A;  5AK4 A;  1NKC A;  4JK1 A;  4R65 A;  2JXJ A;  2XGP A;  2BPF A;  4GLX A;  1N60 A;  2ZUD A;  3B0Y A;  2KKP A;  1QLN A;  5EWE A;  2AQ0 A;  2F76 X;  5HR6 A;  1L6N A;  1F0M A;  5KG2 A;  5KFC A;  1RG6 A;  3UPQ A;  4QW8 A;  5DB8 A;  4RUA A;  4QZF A;  3FDS A;  4NLK A;  3M9N B;  1ZJM A;  2KVC A;  3SYZ A;  4DFP A;  2P6U A;  4C0Z A;  8ICC A;  1QQ7 A;  4RQ5 A;  4UAU A;  1XNS A;  3PX6 A;  4O3S A;  3PVX A;  2ZIU A;  2ZJ8 A;  5L1I A;  9ICJ A;  3PMN A;  3H0R B;  5DB7 A;  4YQW A;  4BX9 C;  3N7S C;  1Q8K A;  4QWE A;  5J8Y A;  5KFJ A;  4I28 A;  3ISC A;  3KBB A;  1Z1V A;  2E8N A;  2HOQ A;  3H4D A;  5CP2 A;  1T8E A;  2N1R A;  3PSF A;  5ALZ A;  3ISD A;  3JPT A;  2V9W A;  1MN8 A;  4DL5 A;  4Y2P A;  5L1M A;  2DL0 A;  2KZ3 A;  3SAF A;  1BPX A;  3KTQ A;  3PW4 A;  1NK5 A;  1L8O A;  3EWA A;  2BDP A;  3G6Y A;  5IIM A;  2W8L A;  1ZQE A;  3JPO A;  4LVS A;  2HSZ A;  3EUB 2;  3Q8Q B;  2Q4T A;  2DBY A;  1DGJ A;  3CP8 A;  1L3T A;  4GFJ A;  5AKE A;  5HMM A;  5EWG A;  2XC9 A;  4DOA A;  1X9W A;  5AIB A;  1YZ7 A;  1S0V A;  2QAR A;  2ZIV B;  2HDO A;  3QYP A;  3SV3 A;  5DG8 A;  4J9R A;  2HOI A;  3DDH A;  2EH9 A;  4I2G A;  4UBC A;  4UAW A;  2W11 A;  1X9X A;  5DLG A;  2P6R A;  5ALX A;  3IM1 A;  1ZQM A;  3MFI A;  5DB9 A;  1JAL A;  3OGU A;  3ETL A;  1XU4 A;  2WAQ C;  4GC6 A;  2C2E A;  9ICS A;  2PFQ A;  3PW2 A;  3K1R B;  1SL2 A;  4Q8F A;  2GLE A;  3ZDE A;  1TFR A;  5C0Y A;  3NUQ A;  1XO1 A;  2I9G A;  1NJY A;  4J9N A;  7ICL A;  2JEI A;  5ALJ A;  5KFQ A;  2DPI A;  3ORY A;  3WK9 A;  5J2F A;  4MF2 A;  2K4P A;  3V7K A;  3KFU F;  2XY7 A;  4I2H A;  4KLU A;  4O3Q A;  4JV0 A;  3TI0 A;  4DSJ A;  2ZTD A;  2JV3 A;  2NRW A;  5KFG A;  4QIW C;  2A1J B;  1TKD A;  3A0H U;  4YR2 A;  4TQS A;  2JMG A;  8ICA A;  4KLH A;  4DLG A;  1DK2 A;  4Y2R A;  2QB0 A;  2HW3 A;  4J9S A;  1ZYQ A;  2KIC A;  3KD3 A;  2OWO A;  2VJ5 A;  1K1Q A;  4LZG A;  2YQE A;  4Z6D A;  3RJG A;  5B66 U;  2VIX A;  4YP3 A;  4IRK A;  3UXN A;  5CJ7 A;  9ICO A;  3AU6 A;  2QAR B;  4FBU A;  5HP4 A;  3IRU A;  3H8M A;  5HNK A;  2FLP A;  1TVA A;  3T5H A;  4MFA A;  4KLF A;  4B9M A;  2XO7 A;  4EYI B;  4NJ8 A;  3QEA Z;  2V4Q A;  3KHR A;  4KN7 A;  4EBE A;  5IIO A;  1UT5 A;  4F5P A;  3NS1 A;  2KZZ A;  4DOB A;  4F50 A;  5DBC A;  1JRO A;  3PR4 A;  5ALS A;  4F3O A;  3N97 B;  1ZRM A;  3R9K A;  4EEK A;  3QUB A;  1RXV A;  3RJH A;  1L8L A;  2XCP A;  2PI4 A;  4MEY A;  5AI4 A;  3FM9 A;  2ZXI A;  7ICI A;  2IBK A;  1ZQB A;  5ALN A;  5D49 A;  1HJP A;  5CA7 A;  5ALF A;  4UB4 A;  4CGZ A;  1DRG A;  1RQL A;  5EOZ A;  5DG7 A;  4IS7 A;  1ZQC A;  2MU2 A;  3WKE A;  1RXW A;  2MRL A;  4USA A;  2HVI A;  4EEL A;  3TAN A;  5AKI A;  3HIL A;  2YB1 A;  2RDI A;  5HR7 A;  3PW5 A;  3GFK B;  3OHA A;  4F72 A;  1ZQF A;  4C80 A;  4ICA A;  2NRV A;  3MC1 A;  5CWR A;  2KOB A;  4NL9 A;  3PW7 A;  3M6K A;  1LV5 A;  5J0S A;  2WB1 C;  3C2M A;  3I1Y A;  2XCA A;  4RZR A;  3T5L A;  3UXO A;  1FO4 A;  5KFK A;  3ZD8 A;  8ICX A;  2KSO A;  3EPG A;  2K4H A;  4DL2 A;  4Y2Y A;  3WKA A;  2AXT U;  3ED5 A;  3SD7 A;  4ECQ A;  2KJ5 A;  3ZDC A;  2IHM A;  3RJJ A;  2J6S A;  2KMD A;  3AN1 A;  3CNH A;  4UAR A;  2W8K A;  3C28 A;  4EYH B;  4DQI A;  4KLJ A;  1RDF A;  5TIS U;  3N7P D;  2E8P A;  4DEZ A;  4CDG A;  4J9O A;  4KLO A;  3OJU A;  8ICY A;  4YXJ A;  4C8L A;  2Z7J A;  3T5J A;  2IMW P;  2A3V A;  9ICB A;  1X40 A;  5KFV A;  4UB6 U;  3OPX A;  3TAC B;  4FO6 A;  1NJW A;  3SI8 A;  2HHT A;  3M6Z A;  4FBT A;  3F53 A;  1L7N A;  4NLC A;  2W9M A;  7ICG A;  4NLZ A;  2HBK A;  3BS5 B;  1K5O A;  1NZP A;  4Y2V A;  3NAS A;  4UAV A;  1L3S A;  4ECZ A;  5L1J A;  5KAI U;  3T3F A;  3MGH A;  4OO1 J;  2DQN B;  5AI0 A;  1QSS A;  1SV0 C;  2HBL A;  4YFK A;  3JPN A;  2KIW A;  2Y1J A;  3PO4 A;  4RPZ A;  4JWM A;  3EYZ A;  3IP4 B;  3MDC A;  8ICQ A;  4TUR A;  4CF5 A;  3UQ2 A;  1A6S A;  4MFC A;  5J2I A;  2VA8 A;  2W3R A;  3BQ2 A;  1RQN A;  2GOL A;  1V9P A;  4ED1 A;  4GC7 A;  1D9D A;  5J2E A;  2C28 A;  2ES6 A;  3LYS A;  2QLT A;  4DL3 A;  5ALM A;  3ONN A;  4FZM A;  5AKY A;  4O3P A;  3PO5 A;  3I28 A;  2KIV A;  1C20 A;  2H3Q A;  1XSP A;  3H40 A;  2ODG A;  2HBJ A;  2IOF K;  4KIT B;  4Y2X A;  3F2C A;  1BVS A;  3OTQ A;  4IQU A;  2AHO B;  8ICI A;  4A8E A;  1JX4 A;  4QZH A;  3NVV A;  2ZIX A;  3BDP A;  2C22 A;  2LHT A;  1MA7 A;  2WAQ F;  4O5E A;  5ALP A;  4F2S A;  1KKX A;  2Y0S C;  2HCF A;  1KTQ A;  4MEX A;  2WB1 F;  4ACO A;  1NK7 A;  4Y2Q A;  3JPQ A;  4ECY A;  3Q8P B;  1B22 A;  5BOL A;  5J0Y A;  1ZQS A;  2Q0Z X;  1JXE A;  3L3F X;  2W7P A;  4TQR A;  1X6J A;  3WK4 A;  5AK3 A;  1L7M A;  4DQP A;  2OCE A;  2OM6 A;  1FIQ A;  4F71 A;  2AGP A;  2WF9 A;  4RPX A;  1ZQY A;  1ZQT A;  1XSN A;  3F2D A;  4QZA A;  4P4P A;  3KZI U;  3D6J A;  1Q3V A;  3H4B A;  1LB2 B;  1YZ6 A;  3MGI A;  4C8O A;  1COK A;  9ICU A;  1Q46 A;  4R64 A;  3BS5 A;  5J2C A;  1A0P A;  1A77 A;  3G6X A;  4P0P B;  8ICJ A;  2HHV A;  4JUZ A;  5KFO A;  4WJ3 B;  3M8R A;  1UQV A;  4XA5 A;  5EE3 A;  3RH6 A;  2OH2 A;  4IRD A;  3HPO A;  4BXO A;  4EEN A;  4YR3 A;  5KFL A;  4RQ7 A;  4JWN A;  1SKS A;  1L7O A;  5J2A A;  1AQ6 A;  4TUS A;  1F44 A;  9ICT A;  2AGO A;  2BCR A;  4YD1 A;  5KFS A;  2ZJ5 A;  5IIK A;  3C21 A;  5KFD A;  4DS4 A;  5DQI A;  4K4G A;  3GIL A;  2G5H B;  9ICR A;  2IHN A;  8ICE A;  1ZD5 A;  5KG3 A;  3IN5 A;  3RBD A;  5JUM A;  4B9U A;  3VCB A;  9ICQ A;  3O0F A;  3RB6 A;  2NRZ A;  3SAG A;  4F93 B;  5ALD A;  5BPC A;  3MDA A;  1ZQQ A;  2HHW A;  5KFR A;  5AM4 A;  2B6G A;  2FE9 A;  4OJ6 A;  2KD1 A;  1ZD2 P;  2ZIV A;  3MR2 A;  1ZQG A;  3ZI4 A;  1U47 A;  3T5K A;  2XY6 A;  2AH5 A;  2Y1I A;  2E8O A;  3PML A;  1ZQA A;  2W7O A;  3NVZ A;  4F4Y A;  2PKE A;  8ICW A;  4DSF A;  3ZDB A;  4UW9 A;  1VDV A;  5J0Q A;  4U6P A;  1BPD A;  4BUG A;  4IL6 U;  2DKZ A;  5KFN A;  5HML A;  5AKX A;  1YT3 A;  5CHG A;  4KLM A;  4NLG A;  3M1Y A;  1T94 A;  5KT4 A;  1NJZ A;  4CF4 A;  4QZI A;  4MF8 A;  5F9N A;  2FPK A;  2YN4 A;  4ECV A;  3WK6 A;  4G9B A;  4E0D A;  1VJ5 A;  4RQ4 A;  4ED0 A;  4EBD A;  5IIN A;  4QZE A;  4UB2 A;  5KFA A;  4G3I A;  5D4B A;  4DFK A;  1SB3 C;  4UQG A;  3I76 A;  4PHP A;  3QU4 A;  1SIJ A;  2ZIU B;  5DG9 A;  1D8Y A;  4RNO A;  1ZQK A;  4PJ0 U;  4I2F A;  2J6T A;  4RUC A;  5DBB A;  2RHF A;  4Z6E A;  1ZQD A;  2ZIW A;  3SR6 A;  7ICS A;  4IQW A;  1ZQR A;  1SKR A;  1GO3 F;  3MR6 A;  2R18 A;  2JEJ A;  2C2D A;  1J97 A;  1NOM A;  2MA1 A;  5FP0 A;  2QB0 B;  4R63 A;  8ICS A;  3KZX A;  4KLD A;  3BZC A;  2F2A B;  3WK7 A;  3AMZ A;  3L5K A;  2F77 X;  5KT5 A;  1WG8 A;  2VAN A;  4QWC A;  2BR0 A;  2ZTE A;  2NO4 A;  1NKE A;  1ZQN A;  4RT3 A;  4LJX A;  8ICO A;  2J6U A;  2A19 A;  4DFM A;  4FFD A;  1RPL A;  1Z00 A;  9ICM A;  4ED2 A;  4RPY A;  2WF7 A;  3RB4 A;  1N5X A;  1TK5 A;  7ICV A;  1D8L A;  3PX0 A;  1S76 D;  4EX7 A;  1ZQV A;  2NV3 A;  4KLL A;  1FFV A;  2ZXH A;  2B0C A;  2UVV A;  5DDY A;  3KHG A;  1J2N A;  4U7C A;  2G06 A;  5KFW A;  4I2B A;  4PHD A;  9ICF A;  3LWM A;  1KRP A;  3ETR A;  4DO9 A;  1O03 A;  2P66 A;  4UB3 A;  4M2Y A;  2DWQ A;  2PMZ F;  1IG6 A;  4DSK A;  5KG7 A;  5DGA A;  5III A;  2BPG A;  1VLB A;  4DL6 A;  3UMB A;  8ICN A;  5KFB A;  2LMR A;  2GO7 A;  3PNC A;  4RQ3 A;  5AI5 A;  4NLB A;  3GV5 B;  1SWW A;  4R8U B;  4DQS A;  1L3V A;  5DQH A;  3HKZ F;  4YVZ A;  2YMQ A;  1Y88 A;  1NK4 A;  2R8I A;  1H38 A;  2W54 A;  3DV9 A;  5E79 U;  1P7D A;  5ALL A;  4BWM A;  4Q8E A;  3OHB A;  5TZV A;  3MBY A;  5EE0 A;  2M0N A;  2PFP A;  5AM2 A;  2ASL A;  4KLG A;  1KN5 A;  1FEZ A;  1XWL A;  3BZK A;  5IIJ A;  1PVP A;  5J0T A;  4K4I A;  5KT6 A;  4I2D A;  3TAD C;  2ZUB A;  1IXR A;  2ZTC A;  3FAH A;  2KP7 A;  4ECX A;  1SXD A;  2ZUC A;  5GTI U;  5KFP A;  3M8S A;  1SV0 A;  7ICT A;  2ZJA A;  3S6J A;  1ZOL A;  4F8R A;  9ICC A;  3F5A A;  2E3T A;  2MUT B;  3QUQ A;  1QSY A;  4DF8 A;  4DOC A;  3GZF A;  4ZOH C;  4ZH4 A;  9ICH A;  4B9S A;  1RYR A;  9ICG A;  2DKX A;  2EDU A;  2OEH A;  2HHX A;  2HHS A;  2WF8 A;  4B9V A;  4M9L A;  1ZQP A;  3CW2 C;  1S10 A;  4QJF B;  4KLE A;  4KLS A;  5KFX A;  3C5G A;  1KBU A;  4QZB A;  8ICM A;  3WKC A;  1X9S A;  3IDW A;  3TQ1 A;  3RFA A;  4F4Z A;  2LPE A;  3M9O B;  8ICZ A;  2BGW A;  7ICH A;  2KK0 A;  1S0M A;  4Z6C A;  4M6W B;  4IR9 A;  4US9 A;  3QNM A;  2KHV A;  2H3F A;  4RQ6 A;  1Q3U A;  4OD0 A;  2BDU A;  5K4L A;  5KFF A;  3HWT A;  2BCQ A;  2IOF A;  1KEJ A;  5AKJ A;  3Q8M A;  1IM4 A;  4B9N A;  5CR0 A;  3KOO A;  1QSL A;  7ICN A;  3TAP A;  2ALZ A;  3GIK A;  3K1Z A;  5ALQ A;  4C4S A;  3GIM A;  5AKG A;  1JMS A;  4FS1 A;  5KT3 A;  1L5U A;  2H3Z A;  1FFU A;  4AP9 A;  4QWA A;  4BWJ A;  1EXN A;  4GXJ A;  3VC8 A;  9ICN A;  3QU7 A;  1WUD A;  5EE1 A;  2W3S A;  2WHE A;  2LKY A;  3NGD A;  2D8C A;  4UB8 U;  2JEF A;  3NVY A;  4FZN A;  1NI3 A;  4Y2S A;  1A76 A;  2I1Q A;  3ZD9 A;  3TKA A;  2W03 A;  1HEK A;  8ICK A;  1UT8 A;  4PHE A;  4C8K A;  3UXP A;  3TFR A;  5DKW A;  4ED8 A;  4CNQ A;  4KLI A;  2D3D A;  1DXS A;  4DSL A;  2OXO A;  1NZB A;  3HRD D;  3ZDD A;  4NLN A;  3RB0 A;  4QNL A;  2PXI A;  3C1Y A;  5B5E U;  1JRP A;  3QZ7 A;  1L7P A;  4TUQ A;  8ICL A;  4QZ9 A;  1N63 A;  2KV2 A;  2DPJ A;  2R8G A;  3PST A;  1S0O A;  9ICX A;  4BDP A;  4O9M A;  5AK6 A;  2FDR A;  4I27 A;  4P4O A;  4YMO A;  4M04 A;  8ICT A;  3SZ2 A;  4K4H A;  2ESE A;  3AU2 A;  5T14 A;  1Z19 A;  4R66 A;  4YXM A;  2G5I B;  3HP6 A;  1X66 A;  2JZB A;  3BJY A;  4O3R A;  2H5X A;  3EZ5 A;  3E0F A;  3JPS A;  2G0A A;  2NRT A;  3RR8 A;  3B0X A;  2YTU A;  1NNL A;  2JR5 A;  1NKB A;  3KKA A;  1QTM A;  4P0Q A;  2E1F A;  3HKZ C;  2P35 A;  4F92 B;  5KFE A;  1QH9 A;  3GQC A;  1ZQJ A;  2A1A A;  2ISO A;  3F2B A;  3ZDA A;  4NL9 C;  1NK6 A;  4F5N A;  4O5K A;  8ICG A;  1D9F A;  4RQ8 A;  1V85 A;  4CRX A;  1PVQ A;  2R8H A;  2GH1 A;  2G07 A;  3QE9 Y;  2I6X A;  5ALG A;  2YX8 A;  1X42 A;  1TE2 A;  3IG5 A;  3PX4 A;  1MQ2 A;  4ECR A;  5ALE A;  2O6K A;  2I5H A;  2LYB A;  1DGS A;  3L4P A;  1QQ6 A;  7ICK A;  3PV8 A;  4OJP A;  2R8J A;  2BCU A;  5J0R A;  2V4R A;  2FPM A;  1B43 A;  2BCV A;  2M9N A;  1T4G A;  4RQ1 A;  4IR1 A;  5KG5 A;  5D46 A;  3H8W A;  4C4T A;  2KG5 A;  1BPB A;  4J9K A;  2GWS A;  4TUP A;  4NY8 A;  1SZH A;  2CPR A;  3WKD A;  5F9L A;  1OUQ A;  4PGY A;  4NXZ A;  4C8N A;  7ICF A;  3IV6 A;  1BPY A;  2EAP A;  4RQ2 A;  3RR7 A;  3UMC A;  3Q8S B;  1S97 A;  3GV8 B;  5AIC A;  4KLT A;  3H8S A;  4ED3 A;  1BGX T;  5J0U A;  4OCZ A;  2OHF A;  5DB6 A;  2DFL A;  4J03 A;  1LKY B;  2DUY A;  4JMU A;  4HAI A;  3IHQ B;  3RAX A;  1O08 A;  4F4X A;  1PK1 B;  4DLE A;  4KLQ A;  1S0N A;  4EEY A;  3Q8K A;  4DL4 A;  1NJX A;  5DLF A;  2NYV A;  2HHQ A;  2K60 A;  2AU0 A;  1NK8 A;  1B4F A;  4FS2 A;  1BPZ A;  1X9M A;  2E1E A;  1PUZ A;  3MAB A;  4DF4 A;  3MGV A;  3RJF A;  3PZP A;  2CRX A;  2ATL A;  5ALW A;  4RNN A;  9ICV A;  1QCK A;  4F91 B;  1WWV A;  1ZQL A;  1T7P A;  1UA0 A;  1SXE A;  1KSP A;  5DBA A;  4QWB A;  2ISP A;  2VA3 A;  2MUT A;  4UAT A;  3RAQ A;  5KTQ A;  1SL1 A;  5A0L A;  2H3I A;  3QXG A;  4KX5 A;  3WU2 U;  3D2S A;  1U4B A;  5C5J A;  1Z4N A;  3SMV A;  7ICU A;  2HHU A;  4PZN A;  3GIJ A;  1S8O A;  2YMP A;  1N5W A;  2DF4 B;  2EAO A;  1WCL A;  4PL1 A;  5JTI A;  1TV9 A;  4ECT A;  2W9B B;  2JHD A;  2K4E A;  2F1J A;  3OSP A;  5EWF A;  2H3V A;  2RRD A;  3H0M B;  2F8K A;  1T3Q A;  1XO0 A;  2IA6 A;  1N56 A;  2HI0 A;  5KL8 B;  3D2Q A;  5HHH A;  1DK3 A;  8ICU A;  5AKL A;  3BQ7 A;  2CN1 A;  3RTV A;  2BQU A;  8ICV A;  8ICP A;  2LM1 A;  4C4R A;  4NWI A;  2K4I A;  2W9C B;  4YN4 A;  5ALO A;  3E58 A;  4R8U A;  1JUD A;  4XRH A;  4B9L A;  4I2E A;  1WWU A;  4IQT A;  4CE6 A;  2ZG6 A;  3DEE A;  4CCH A;  2FJ6 A;  4PZO A;  4J9P A;  5AK5 A;  3QU5 A;  3RB3 A;  4MHV A;  2FLL A;  4J9L A;  1SZP A;  2Y9T A;  3HJE A;  5KG4 A;  1SL0 A;  1V97 A;  3NTU A;  1ZRN A;  1U49 A;  2KN7 A;  3SQI A;  2D6F C;  5F3X B;  1DOQ A;  5AKK A;  3GU3 A;  2RDJ A;  1IIP A;  1HUZ A;  3AM9 A;  3UM9 A;  4DS5 A;  1PVR A;  4KX3 A;  2JH1 A;  3TAQ A;  1SWV A;  2VA2 A;  4I2I A;  2PI5 A;  5CEH A;  1MSW D;  3KHH A;  1JN3 A;  4M6W A;  2K89 A;  2RLT A;  5ALT A;  5KFZ A;  5EE9 A;  2YML A;  4M9H A;  4HYK A;  9ICP A;  4ED6 A;  3FC4 A;  5DDM A;  5AM1 A;  5ALH A;  5AHX A;  3SEN A;  1KFS A;  5AI6 A;  2W55 A;  5DGB A;  5JRT A;  3BQT A;  1PK3 A;  3UMG A;  4Q44 A;  2BZF A;  5BOM A;  2ZIW B;  2WF5 A;  5ALR A;  3ICX A;  3EPI A;  5L9X A;  4KMO B;  1UA1 A;  4PGX A;  3RH5 A;  3K75 D;  4PGQ A;  4F4W A;  2KJ9 A;  1TAM A;  1Z4O A;  2XI9 A;  3THV A;  2EZZ A;  4QZ8 A;  4DFJ A;  3RJE A;  4ELU A;  5JU5 A;  2KFZ A;  3PY8 A;  3JPR A;  2FPL A;  3C2K A;  7ICR A;  5G5H A;  4PL2 A;  3BQ1 A;  2XID A;  5KFU A;  4Y2T A;  5J2H A;  1X2I A;  5J0P A;  2EQY A;  3C2L A;  2FMP A;  3PR5 B;  4O3O A;  1PK1 A;  2PFO A;  4F5Q A;  2W9A A;  3WK5 A;  3V7J A;  1LKY A;  2G08 A;  5J2D A;  4Y2U A;  3LK9 A;  1KQQ A;  3LVW A;  3V6H A;  1NK9 A;  4JV1 A;  1C7Y A;  4Q43 A;  3CYM A;  2LBO A;  3HT3 A;  2HVH A;  2IOH A;  2WTF A;  3QZ8 A;  3H7I A;  4UB5 A;  2OYY A;  4YD2 A;  5CRX A;  3C23 A;  9ICA A;  1KFT A;  2BQR A;  1ZQ1 C;  3T79 A;  4F4K A;  2UVU A;  4O5C A;  4XQ8 A;  2BPC A;  4QIW F;  3AQE A;  1N48 A;  2BQ3 A;  1ECW A;  1ZQO A;  2R8K A;  4ELT A;  1TAU A;  4KTQ A;  2PMZ C;  4B6J A;  2ASD A;  2FMS A;  4DQR A;  5L1L A;  4YR0 A;  1XSL A;  1XC9 A;  2KHQ A;  1ZD4 A;  8ICR A;  2W9C A;  3QU2 A;  1S9F A;  8ICF A;  4X5V A;  4DCC A;  2LI6 A;  2HBM A;  3ALR A;  1KDH A;  7ICJ A;  2PFN A;  1D8B A;  1K1S A;  2UVW A;  4I2J A;  4ECU A;  4I2C A;  1OW5 A;  1ZJN A;  4RQ0 A;  5J2J A;  1QQ5 A;  1ZD3 A;  2EAN A;  3Q8L A;  2F44 A;  3PSI A;  2KNJ A;  1KW4 A;  1BNO A; 
#chains in the Genus database with same CATH homology
 2Q4T A;  3RF9 A;  2F77 X;  3C28 A;  3CP8 A;  3L3F X;  3VC8 A;  1UPH A;  2ZG6 A;  2W7P A;  3DEE A;  4GFJ A;  3N7P D;  1CRX A;  1HIW A;  1WUD A;  1URJ A;  4CDG A;  4OJ6 A;  4CRX A;  2KD1 A;  1PVQ A;  2LKY A;  2GH1 A;  2ZIV A;  2G07 A;  2ZIV B;  2OM6 A;  2Z7J A;  4PL2 A;  2XID A;  4FZN A;  2A3V A;  4FE3 A;  3AL0 B;  3F5A A;  4P0P A;  2VJ4 A;  2YX8 A;  2W7O A;  3OPX A;  2HOI A;  2RP5 A;  2W03 A;  3IG5 A;  1HEK A;  2VKQ A;  3LVV A;  3GZF A;  4FZL A;  2K8B B;  3F5E A;  3M6Z A;  2E1E A;  2XIC A;  3C29 A;  3F53 A;  4NLC A;  3AQF A;  3SQI A;  2NV3 A;  2ZIX B;  3MGV A;  2D6F C;  4U6P A;  2G08 A;  2HMX A;  2LYB A;  2ZXH A;  4BUG A;  3LVW A;  3PZP A;  2HBK A;  3F2D A;  2E5S A;  3GU3 A;  2G09 A;  2CRX A;  2KKP A;  2OXO A;  1IIP A;  4U7C A;  2G06 A;  1NZB A;  1Z1B A;  4BJQ A;  2F76 X;  4OJ5 A;  1YT3 A;  1Q3V A;  5HR6 A;  4OJP A;  1L6N A;  4QJF B;  2WAQ C;  3D2N A;  1PVR A;  4P0Q B;  3CYM A;  2LBO A;  2K8A A;  2ZXI A;  1T94 A;  2JH1 A;  4KX3 A;  4QNL A;  2YB4 A;  2JH7 A;  4OO1 J;  1A0P A;  2DQN B;  1KBU A;  2PMZ F;  4P0P B;  5C0Y A;  2KEY A;  3NUQ A;  2HBL A;  2OYY A;  2KVC A;  2KV2 A;  1ED1 A;  4IC9 A;  2KIW A;  3PST A;  2JGA A;  5CRX A;  3RFA A;  5A0L A;  2H3I A;  3CRX A;  4KX5 A;  3H0L B;  3D2S A;  2XVT A;  3IP4 B;  4WJ3 B;  4C0Z A;  2K89 A;  2W04 A;  1ZQ1 C;  3T79 A;  1DRG A;  4CGZ A;  1XNS A;  3PSP A;  3SMV A;  1A6S A;  3IG8 A;  2ZIU A;  2OH2 A;  3KFU F;  4QIW F;  3H0R B;  4NLB A;  4BX9 C;  3N7S C;  2GOL A;  3AQE A;  4OJO A;  2KHV A;  2H3F A;  5T14 A;  2MRL A;  1Z19 A;  3HKZ F;  1Q3U A;  1ECW A;  1SZH A;  2CPR A;  2DGZ A;  2ZIU B;  2DF4 B;  2G5I B;  2Y0S F;  3LYS A;  2YB1 A;  4PL1 A;  4O3M A;  2PMZ C;  5HR7 A;  2HOQ A;  3ONN A;  2BDU A;  4FZM A;  4AYB C;  1OUQ A;  1F44 A;  3E0F A;  2G0A A;  2JHD A;  2K4E A;  2N1R A;  4QIW C;  1P7D A;  2H3Q A;  4ICA A;  2RHF A;  3NRW A;  4AYB F;  2HBJ A;  3PSF A;  2KHQ A;  2H3V A;  2KOB A;  2ZIW A;  3F2C A;  2HOF A;  2JMG A;  2M0N A;  3M6K A;  2RRD A;  3H0M B;  2F8L A;  2WB1 C;  1XO0 A;  1GO3 F;  3N7R C;  2G5H B;  5KL8 B;  3D2Q A;  4A8E A;  2R18 A;  2KIC A;  2ZIW B;  2HBM A;  2ZIX A;  3ALR A;  3ICX A;  2KKV A;  3SAF A;  4P0Q A;  3M7D A;  3IN5 A;  2E1F A;  3K1Z A;  3HKZ C;  2LHT A;  2CN1 A;  3SAH A;  1D8B A;  1MA7 A;  2VJ5 A;  2MA1 A;  2WAQ F;  4KMO B;  4NWI A;  3VCB A;  1PVP A;  2K4H A;  2Y0S C;  1TAM A;  2K4I A;  2K8C B;  2KJ9 A;  2XI9 A;  3O0F A;  2LYA A;  2WB1 F;  4OJL A;  2KJ8 A;  2KJ5 A;  4ACO A;  3SAG A;  3F2B A;  2VIX A;  2KNJ A;  3KZX A;  3PSI A;  5KL1 B;  2H3Z A;  4JMU A;  2F2A B;  4NV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...