2LBOA

Eimeria tenella microneme protein 3 mar_b domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
APTLQEALDRKCAQFGKESCNSGLASYCGAAIYARYDKGNSSQQTKEWRCYIEKELDFSKSGDGCVDDCGSMTSCRGSVSGPSTSHLTRPSELQAVIDSDKSNYCTDKSEQQPSQATPPPEIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microneme protein 3
publication title The Role of Sialyl Glycan Recognition in Host Tissue Tropism of the Avian Parasite Eimeria tenella
pubmed doi rcsb
source organism Eimeria tenella
molecule tags Cell adhesion
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10564 MAR_sialic_bdg Sialic-acid binding micronemal adhesive repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.580 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lboA00
2JHDA 3F5AA 2JH1A 2JH7A 3F53A 3F5EA 2LBOA
chains in the Genus database with same CATH superfamily
4EEYA 3HX0A 1Z3EB 1L7MA 1DK2A 5KFXA 3OHAA 4F50A 2GWSA 4PHPA 5CB1A 2LYAA 2LKYA 4YMOA 1TAQA 8ICRA 5AI9A 4UBBA 1BPZA 5CR0A 1F5SA 5J2DA 4O3SA 2G06A 4B9NA 9ICFA 4DSFA 4DCCA 2KMDA 1WWUA 3RRHA 5HHIA 4DSIA 4IQVA 4RQ0A 2LM1A 3GILA 2UVRA 4QJFB 3VCBA 5CWRA 5J2GA 1NK5A 2KSOA 2NO5A 5ALRA 1ZQCA 2JR5A 2YMMA 4RQ6A 4R65A 3HPOA 3ISBA 2QLTA 4ECVA 1XWLA 4FBUA 4QWBA 2HHXA 3KZXA 2C2EA 1J2NA 4MEXA 4Z6FA 2EAMA 2LMRA 2AXTU 4IRDA 2JEJA 1SZPA 4RPXA 4YXMA 5J2BA 4LZDA 5CJ7A 3RB3A 3HJEA 4CNQA 2DFLA 3IG8A 2E1FA 2FPLA 1U48A 2IMWP 2YTUA 4ELVA 2P6RA 4C7YA 3EPGA 3ETLA 4XRHA 5L9XA 2KZZA 2JEFA 2JZBA 1S0NA 3AEVA 4DF8A 3WKBA 2VJ4A 1UQVA 2EH9A 1ZYQA 5A0LA 1L8LA 3AU2A 4JMUA 2DKZA 4ECUA 2KHQA 2JMGA 1J97A 4UW9A 4KLJA 9ICNA 2GH1A 4DS5A 2OXOA 2WHEA 5AM1A 2H3IA 1OXJA 5F3XB 3F2BA 2HHTA 8ICOA 1X40A 1QQ6A 9ICMA 1A77A 5KFPA 3M8SA 1HUZA 1XS9D 5KG4A 3ZD8A 1KEJA 1AROP 1QQ5A 4JV1A 5T14A 4J9SA 3BQ1A 4QZAA 3TFRA 3ZDBA 8ICAA 4I28A 5KFKA 4MFAA 2OYYA 5BPCA 4EX6A 2W43A 4PL1A 1Z1VA 2B6GA 2R8KA 3J81j 3NASA 4EZ6A 5KFBA 5CA7A 2NRVA 3ZDEA 3EPIA 8ICQA 2MSNA 2QARA 1ZQXA 1NK6A 4KLSA 3BS7A 5J0XA 5TISU 5G5GA 2KJ9A 4QZDA 1CEZA 3RR8A 1ZQIA 1ZQUA 1X9XA 1DGJA 3RF9A 2KVCA 3UXPA 1TFRA 3GQCA 4BDPA 2WF6A 3RR7A 3KTQA 1N48A 4FE3A 3BS5A 1JN3A 3AL0B 3GV5B 4US8A 2WF8A 3QEAZ 2ES6A 4TQRA 1IV8A 4I2HA 2FLLA 5GTHU 3L4PA 1X42A 1Q3VA 4NLZA 3ORYA 3QU5A 1SGGA 3NRZA 3PZPA 3C2MA 4DFKA 4UAVA 1S9FA 3HW8A 4CE6A 4PZNA 1FO4A 1X2IA 9ICGA 1D8YA 5AKKA 2G5HB 2F1JA 3CNHA 2P66A 1ZQPA 1S8OA 8ICCA 2H3VA 2BGWA 4G9BA 4P0PB 5EE9A 5L1KA 4RU9A 1D9DA 3D2NA 9ICCA 5AI0A 2F1IA 4YD2A 3JPOA 3BQ0A 1SL2A 2M0NA 2QKQA 3PX4A 2BCVA 4M9GA 8ICUA 4RQ4A 5L1JA 1NOMA 2DGZA 4F2RA 4MFCA 1S97A 2R18A 2Y0SF 3C1YA 2KKPA 3IRUA 4R8UA 2RRDA 4AYBF 2ISPA 4CF4A 1IXRA 3Q8PB 3GZFA 2K8AA 3UQ2A 4DO9A 5ALDA 3UXOA 4K4HA 2HHQA 1JROA 3RJHA 4DSJA 4ELTA 4OJPA 4I2FA 4M9HA 2E8MA 9ICEA 2EAPA 5KG3A 2XC9A 3NVZA 5DDMA 4TUSA 4GFJA 4QW9A 3IN5A 3D2QA 5J2FA 5IINA 2XY7A 3WKEA 2A3VA 2JHDA 4QZ8A 1SV0C 5CHGA 2G5IB 3QUTA 2UVWA 2NRXA 2HVHA 2XGQA 2PI5A 1JUDA 5KNIA 5CP2A 2BPGA 3A0HU 4GIBA 1KRPA 4NJ8A 4C8MA 2FDRA 3KZIU 9ICHA 3H7IA 4QIWC 2EQYA 2WB1C 2HHSA 4DSLA 5J0PA 4ECYA 2DWQA 3L3FX 4RNOA 3F2DA 1U4BA 4ECWA 5AKLA 2AHOB 1AQ6A 2ASDA 1U49A 1HJPA 1NK7A 1L5UA 4KN4A 4NM2A 8ICEA 2W8KA 4KLOA 2MAXA 5J0WA 4EENA 3HWTA 4PZOA 5DBCA 2K4HA 4YR2A 5KFEA 1SB3C 4QZFA 4NWIA 2Y9TA 1ZQOA 8ICHA 2JEIA 5AI4A 4GXIA 4DOBA 4DOAA 3PVXA 4EBDA 9ICQA 5KFAA 1CUKA 2I1QA 5KG0A 2OWOA 3UQ0A 5AI6A 3GV8B 4B9LA 5BOLA 3SENA 4M47A 3ZDDA 1LVHA 3QU4A 1OW5A 4Q43A 1IG6A 3MR2A 3LWLA 4B9VA 1LKYA 3SAHA 5J29A 4K4GA 4Z6EA 5DG9A 3QU7A 2KE7A 3T5HA 5J2HA 4B9TA 5EE3A 4Z6DA 3FYHA 4RUCA 3G6VA 3BQTA 4QZGA 7ICMA 3BDPA 3ISDA 1JI7A 4UB2A 4NLNA 4YMNA 5KFCA 2VA3A 2VKQA 2ZTCA 4TQSA 5KFLA 4C80A 3RB4A 2F3NA 3M1YA 3PNCA 2ZUCA 5C5JA 3RH4A 2OM6A 4BGDA 3PMLA 3QUQA 5ALHA 1KKXA 3C5FA 7ICEA 1SKWA 3ZDAA 4OJ5A 3MGHA 2RDIA 3V7KA 7ICLA 2YQEA 4O3QA 2I5HA 1ZQVA 2HOIA 1ZJNA 3GIJA 3WKDA 4F72A 4PHEA 1A76A 7ICJA 3H8JA 3SQIA 1Q8KA 4J9OA 2CXYA 3C28A 1U9LA 2XY6A 5HR7A 7ICQA 3AM9A 3AUOA 1QTMA 4B9SA 4GXKA 4O3NA 8ICVA 3RJFA 3F5EA 3MBYA 3RB6A 2K4EA 5AK6A 3R9KA 3PW4A 1UA0A 3PW2A 3PW7A 2WB1F 3HP6A 3GDXA 9ICSA 2QB1A 3WK9A 1BPBA 2F2AB 3MFHA 2NO4A 1X66A 9ICWA 4PGYA 3BJYA 4M6WB 4B6JA 4DQRA 4USAA 4Y2TA 4Y2PA 2ZXIA 5DG8A 2W55A 4O3PA 2V9WA 4DFPA 8ICLA 4OJLA 3JPNA 3KHRA 2F8KA 3I76A 1PVQA 5KG6A 3MGIA 4CCHA 4BUGA 5HMLA 4BXOB 4JV2A 2UVVA 1T4GA 4QZBA 2OEHA 2KICA 4C8KA 3K1RB 5EE0A 1ZQMA 4Y2XA 5ALZA 4QZHA 7ICRA 3G6XA 3TFSA 2BCUA 1M6YA 2IHMA 5DBAA 2ZIXB 3WK5A 4R66A 3RJGA 1X9MA 3FM9A 2C2DA 7ICIA 1Z00A 2XVTA 4RQ3A 3M8RA 4P4OA 2HVIA 1BPEA 3MDAA 2DPIA 2FPKA 2KFNA 3K1ZA 5IIOA 1ZQZA 3WKAA 2I6XA 3SI8A 3T79A 2HBLA 3JPRA 2E8PA 4Z6CA 4KX3A 5JUMA 3QYPA 4MHVA 4C4RA 2XY5A 3QUCA 4DL6A 1ZQWA 1BVSA 5KG2A 2WTFA 5AI8A 2E3TA 2KKVA 1BNPA 2VA2A 4FFDA 1NKEA 3IG5A 3AQEA 5F9NA 3SV4A 4F5OA 9ICVA 9ICIA 4OO1J 5EOZA 2DQNB 3UPQA 5F9LA 3UXNA 4KTQA 2RHFA 1B22A 4BWJA 5ALGA 4PGQA 3IM1A 2ZJ5A 1VJ5A 4UAWA 1WUDA 4GLXA 4KLGA 4J9MA 2W7PA 5J0OA 5KL1B 2BHNA 3H0RB 5B5EU 3ICXA 1EXNA 4DL5A 2KEYA 2ESEA 3SR6A 4ECRA 2A19A 7ICGA 1JIHA 1N5XA 4KN7A 1OUQA 3F2CA 1MN8A 3N97B 4TUPA 3OSNA 2KV2A 2W8LA 2W9CB 4ED0A 1L3TA 4XUSA 2PMZF 3H4BA 3LDAA 1HUOA 9ICOA 5KFDA 2FMSA 4DFMA 3B9JA 3QXGA 3T5LA 5JTIA 3OJSA 3V6HA 8ICYA 5KFJA 1X9SA 5ALSA 2BPCA 3GIMA 4EYHB 3TANA 5ALMA 4P0QA 4QWCA 2ALZA 3SV3A 5DGBA 2KP7A 3WK6A 4LJXA 4I2JA 2BDUA 1N5WA 2E1EA 2MRLA 1LB2B 3ISCA 2YMQA 3KKAA 2WAQF 4RNNA 5KT6A 3V7LA 3EZ5A 2IA6A 2K8BB 4ED8A 5J8YC 1RYSA 3ONNA 5DLGA 2Z7JA 4I2CA 1S77D 4IL6U 3EW9A 2Y0SC 5L1MA 4RQ8A 3QZ8A 1TKDA 2F8LA 3KFUF 4KLIA 2ZIVA 4M9NA 2W9BB 4AYBC 4PL2A 4F5RA 5JRTA 4CGZA 1DOQA 1A6SA 2MUTB 4US9A 3RTVA 5AKEA 5ALLA 5KFOA 5AM2A 4ECXA 4WJ3B 2LPEA 4FS2A 4O9MA 1QSYA 3A0BU 2H5XA 4CRXA 7ICUA 1J2MA 4OD0A 3HILA 4ED7A 1TK8A 4NXZA 5ALKA 4LZGA 3H0LB 1ZD5A 2KIVA 4B9UA 4NLGA 4YMMA 5KT5A 2ASLA 5J0YA 3UMGA 2L5YA 1ZQGA 1UHUA 3H8WA 1RDFA 3L5KA 1ZQFA 3THVA 4IQUA 1A0PA 4G3IA 3KHGA 8ICBA 2E8NA 5KT7A 5J0UA 2HOFA 3HRDD 1WWVA 2ASJA 5KFVA 3RFAA 3MR5A 2V4RA 1U45A 1B0XA 2JGAA 2XCAA 3Q8MA 4ECQA 4QZEA 4DQPA 2JEGA 1XSLA 1PK1A 4KLMA 4I2BA 4ED1A 1UT5A 3ZI4A 9ICTA 2ZUBA 5ALOA 4RQ5A 4F8RA 1PUZA 1KBUA 2KSOB 1ZQLA 3CP8A 1L3SA 5CEHA 3WU2U 2W04A 1NK8A 5AKXA 5D46A 3F5AA 4DOCA 3JPQA 2Y9UA 4UB8U 2EZXA 4UATA 1HEKA 3H4DA 2R8IA 1ZQNA 3PO4A 1L3UA 8ICJA 4UAYA 4Q8EA 4OJ6A 3RBDA 7ICSA 1Z1BA 1WCNA 7ICNA 4ZOHC 3IP4B 3D6JA 1V97A 3I28A 4YD1A 3AU6A 5JU5A 1Z4NA 3LVVA 2ZIWA 3PX6A 4LVSA 2IBKA 3WK8A 4NV0A 3H8SA 2W3SA 2IOHA 5AICA 3KKAC 3V6JA 3HT3A 4YR3A 2HHWA 3GIIA 1TE2A 2JZBB 4ICAA 2YX8A 4UB3A 4HAIA 5TZVA 5EWFA 1X6IA 3OGUA 4XQ8A 4ECZA 2ATLA 5GTIU 4U6PA 1XNSA 4OCZA 5ALFA 1VLBA 3PY8A 2R8HA 2GO7A 4J9PA 2HSZA 2H3FA 3RBEA 3C21A 1NI3A 2KTQA 2ODGA 1ZD3A 1Q3UA 2J6UA 4ZH4A 2HHVA 4RQNA 2XGPA 1RQNA 4ED2A 1DK3A 5DQHA 4JB3A 1D8BA 2XIDA 3RAQA 3EWAA 2MA1A 5KFSA 3H40A 4KLFA 4DLEA 3RH5A 4I2DA 1QCKA 4KLEA 4P4MA 5J2AA 2NV3A 2W9AA 4F4ZA 5HNKA 4O5EA 2KN7A 5AIBA 2QARB 4DS4A 4Y2VA 3CW2C 9ICAA 2K89A 3I1YA 4RPZA 1NZPA 2KD1A 1L7PA 1NJZA 4I2GA 2VANA 3PW5A 4UAUA 4F3OA 2DUYA 3E0FA 1ZQEA 3BS5B 2BR0A 1SKSA 2YB4A 3Q8QB 3PSFA 3H0MB 3C2LA 3ED5A 1MQ3A 1RG6A 5IIIA 2IHNA 1SL1A 2G07A 5AKIA 3TADA 3ZDCA 3BQ7A 2FI1A 5J2IA 4PHDA 5J0SA 2ZIUA 5D4BA 1NKCA 1QLNA 2BQRA 4JV0A 2EZZA 9ICBA 3N4MB 1KN5A 3N7RC 2I9GA 1NJYA 5D49A 3M9NB 4QZ9A 2AH5A 3E58A 5DB9A 3FDSA 3V72A 1ZQHA 1ECWA 5H2FU 3MR6A 5AKGA 5J2KA 3Q8LA 1K1QA 2MU2A 4TUQA 3NTUA 3SAFA 4DLGA 3RJEA 3SMVA 4Q44A 1N61A 2W11A 3AN1A 4PHAA 2H3QA 2NRWA 3DEEA 4RT2A 3RRGA 5KT3A 4R8UB 4QWDA 3ETRA 2EAOA 1NJWA 4IRKA 8ICFA 1COOA 3FC4A 4PJ0U 5ALXA 3PSIA 3QNMA 4O3OA 4IR9A 1XO0A 7ICPA 1RYUA 5KFHA 4Y2QA 4F5NA 1WCLA 4DWIA 3QZ7A 2A1JA 2ZTDA 2DBYA 1URJA 5ALJA 1ED1A 4DL4A 5IIKA 3H8MA 2F1HA 4M04A 3DDHA 4E0DA 1ZD2P 3K4GA 2YMLA 4BX9C 3QEBZ 1COKA 2HHUA 3EYZA 2BPFA 1ZXIA 2KNJA 4O5CA 9ICLA 5AKJA 4EX7A 2ISOA 1ZQ1C 4I2EA 4YXJA 8ICIA 2PMZC 5ALIA 3PW0A 1K1SA 3D2SA 8ICZA 4DFJA 2P35A 4O3MA 2WF5A 1N62A 4J9NA 5CRXA 1PK3A 2K4IA 5IIMA 3QU2A 4MF8A 5BOMA 4J9RA 2F44A 1N2XA 7ICTA 4RQMA 1ZQJA 7ICKA 8ICTA 2CRXA 3LK9A 1SKRA 2WAQC 4C0ZA 1JXLA 3RJKA 5B66U 1X6JA 5IIJA 3TARA 2KZ3A 3AMZA 5EWGA 2Q0ZX 1ZD4A 4QWAA 2C2RA 4UQGA 3NUQA 3GV7B 3TADC 4IC9A 3MR3A 3OHBA 4J9KA 4MFFA 3TAQA 1T3QA 1ZRMA 2PI4A 4J9LA 2K8CB 4KITB 9ICKA 2EANA 3T3FA 5J2CA 2NYVA 2R8JA 1B43A 1LKYB 9ICRA 2AJQA 3QU9A 2LI6A 2Q4TA 4QWEA 4RNMA 5DDYA 1SL0A 4K4IA 5KFIA 1RPLA 4BJQA 5AI5A 4YVZA 3BZCA 1L6NA 4Q8FA 1TAMA 5G5HA 4CF5A 5KFMA 4DQIA 2M9NA 3V7JA 3PMNA 3EUB2 4ACOA 1UA1A 9ICPA 2DL0A 1JX4A 1MC8A 2PXIA 4QZIA 5AKYA 2BZFA 2C22A 2BQ3A 8ICGA 2W3RA 3IDWA 2VJ5A 4JWNA 2FLNA 2N1RA 3Q8RB 2KK0A 4I2IA 3PR5B 1CI4A 3M9MB 2FMPA 3PV8A 3RAXA 3PSPA 4UB6U 8ICMA 5DG7A 3NVVA 5KFGA 2PFOA 1O03A 4UB4A 3MC1A 4TURA 3MGVA 1YZ7A 2AQ4A 3OTQA 1NK0A 1XU4A 3JPTA 3IHQB 4P2HA 4FBTA 1ZQQA 3T5KA 2G09A 5ALQA 1DRGA 2DKXA 3CRXA 7ICHA 3F53A 2D6FC 4NY8A 2HI0A 1JXEA 4I2AA 3RJJA 1QSLA 4O3RA 2KOBA 2JXJA 4M2YA 5KG5A 2EDUA 3PO5A 1P7DA 4KLDA 3T5JA 1RM6C 4P0PA 1SZHA 4NL9A 1ZETA 5DBBA 2BCRA 1Z4OA 1KLNA 1Z00B 1FEZA 4FZMA 4C4TA 1KFTA 2HW3A 1NK9A 4F93B 7ICOA 9ICXA 3UMCA 2F77X 2GLEA 3C23A 3BQ2A 4YFKA 1GO3F 4Q45A 3V6KA 3E2EA 1QSSA 3NRWA 5KFQA 1KTQA 2HBMA 1ZRNA 1SIJA 3U26A 3SEIA 2RP5A 1Q46A 4CDGA 2KFZA 4KLLA 2G08A 3Q8KA 9ICUA 1B4FA 5AK5A 3PSTA 3PR4A 4DSEA 3C29A 2XCPA 5HR6A 1BNOA 3RH6A 5EE1A 1SV0A 4JUZA 4DF4A 4PGXA 5AM4A 1WYGA 4F5PA 3SD7A 2AGPA 1SXEA 1V85A 2ZJ8A 3QE9Y 1TVAA 1F0MA 1QQ7A 2IOFA 1KFDA 5DQIA 2IOFK 5AIAA 4Y2YA 2W9MA 2FPMA 2O6KA 3LVWA 4QZCA 2E8OA 1N60A 1MA7A 2RDJA 1XSNA 2JH1A 2E5SA 5DKWA 4IQWA 5AM0A 1Y88A 4I29A 2BCQA 4NLKA 4KLUA 3TACB 2AGOA 2LHTA 4RQ7A 3CYMA 4O0IA 1QH9A 4KMUA 3G6YA 5KFTA 3NGDA 8ICWA 4NM1A 4DFDA 4UB1A 1N56A 3JPPA 4NLBA 2YB1A 1N63A 2OHFA 1JMSA 3M7DA 5DQGA 4DQSA 4QNLA 2GOLA 2ZTEA 1KQQA 4ELUA 2LM4A 2HOQA 3OJUA 5ALPA 4O5KA 2ZXHA 3M6ZA 4P0QB 4Y2JA 4ECTA 3B0XA 5J0TA 1TK5A 2LYHA 3QUBA 1H38A 2WFAA 1DXSA 2RQ5A 3KD3A 4IQTA 5ALUA 1SV4A 1S0OA 4YN4A 2PFNA 2KIWA 4HYKA 3O0FA 5FP0A 4ED3A 4UASA 5AK3A 5DB7A 4F4XA 1KFSA 3TI0A 1NK4A 1JALA 4I27A 5DLFA 1TAUA 2FMQA 2KHVA 4YCXA 4R64A 4C7ZA 2ZIVB 4NL9C 2CPRA 3C5GA 4F2SA 3BZKA 1Z19A 1U47A 4DL7A 3N28A 5KAFU 5E79U 1C7YA 2OH2A 1BPXA 1RYRA 3K75D 1YZ6A 2JV3A 1NNLA 2BQUA 3HKZC 1SWVA 2KJ5A 3N7SC 2C28A 1WG8A 4GXJA 3KHLA 4Y2UA 5J0RA 2P6UA 4C8NA 2HDOA 5KL8B 3KHHA 5ALNA 2K4PA 2HBKA 4F92B 1FIQA 2W03A 3QX7A 1SWWA 4RPYA 1RZTA 3B0YA 1FFVA 1T8EA 2KJ8A 4F4WA 5HP4A 4AP9A 4IRCA 1RXVA 4KLTA 2CN1A 2AU0A 2LBOA 1UPHA 3SZ2A 4F4KA 4C8OA 3MDCA 1D9FA 4MF2A 2BCSA 1ZQAA 4RUAA 2QB0A 4KX5A 2H3ZA 4GC6A 4FO6A 1X9WA 3UMBA 1S5LU 4R63A 2W54A 3OSPA 4BWMA 1DGSA 2G0AA 5J2EA 1HIWA 4QW8A 5KT2A 5KG1A 1PK1B 5ALYA 3ZD9A 1ZJMA 5DB6A 4M9JA 4M6WA 3RB0A 3GFKB 1UCVA 2ZUDA 4ED6A 2UVUA 3PX0A 3Q8SB 2YN4A 3TKAA 1ZQDA 3C2KA 1PZNA 2KZMA 2OCEA 1T94A 2B0CA 4BXOA 2JH7A 2PFPA 4ECSA 2ZG6A 1C20A 1BGXT 2FE9A 2Y1JA 5ALVA 5ALTA 2DF4B 5ALWA 2RLTA 2ZIXA 5HMMA 4Y2RA 5KG7A 4KMOB 2FJ6A 2ZIWB 3JPSA 4F5QA 1S0MA 5DB8A 2AGQA 4RQ2A 2D8CA 1S0VA 4IR1A 2HCFA 2FLPA 4XA5A 4EBCA 4F4YA 4RQ1A 7ICFA 8ICNA 2BDPA 3WKCA 4X5VA 4KLQA 2XO7A 4F91B 3C1ZA 4RZRA 3MABA 2W7OA 3AQFA 1RQLA 1XO1A 1MSWD 4YQWA 1XC9A 3HKZF 1ZQRA 5KAIU 3M6KA 1TV9A 3NS1A 1MQ2A 4KLHA 1T3NA 4F71A 1YT3A 1KSPA 3NVYA 4OJOA 4IS7A 1V38A 2YMPA 4CF3A 5KFYA 1XSPA 2R8GA 3NVWA 3SAGA 3DV9A 1ZOLA 4B9MA 3UM9A 4MEYA 5KFUA 3IV6A 3VC8A 4YP3A 1NJXA 3LWMA 1K5OA 4UBCA 2NRTA 4DEZA 5AKHA 4NLCA 4DL3A 5KFZA 2J6SA 4P4PA 1V9PA 1BPDA 5EWEA 2D3DA 4C4SA 4EBEA 1NKBA 2XICA 1F44A 4DQQA 3N7PD 1ZQYA 5KFNA 2QB0B 1D8LA 2KVSA 5KTQA 3M9OB 2W9CA 8ICSA 1UT8A 2A1AA 1S76D 4JK1A 5KFWA 4QIWF 5K4LA 4M0AA 4PH5A 3OPXA 1BPYA 1SXDA 4GC7A 5KFFA 4YR0A 4DL2A 1CRXA 2J6TA 1PVPA 2HMXA 1L7OA 2F76X 3WK7A 4J9QA 4EYIB 3FAHA 1IIPA 1KDHA 2PKEA 4Y2SA 2B21A 2VIXA 5AKZA 4FZNA 4RT3A 3RJIA 2HBJA 1S10A 2AQ0A 4A8EA 3KBBA 5J8YA 1KL9A 1PVRA 2ZIUB 3SYZA 5IILA 5AM3A 3WK4A 2V4QA 2LYBA 2YY6A 4UB5A 3MFIA 1ZQBA 5ALEA 5J0QA 5C0YA 2PFQA 5J2JA 3LYSA 1O08A 2WF7A 3GIKA 4DSKA 9ICJA 1L7NA 4UAZA 5AHXA 2Y1IA 5L1LA 1ZQKA 5DGAA 1LV5A 4EEKA 2W9BA 3TAPA 4M9LA 1IM4A 1JRPA 3GU3A 3S6JA 2XI9A 4C8LA 2MUTA 4JWMA 5AK4A 1RXWA 1KW4A 7ICVA 4PPXA 2BKEA 2NRZA 5L1IA 4J03A 2ZJAA 1TK0A 4FZLA 4YG2A 3TQ1A 8ICXA 1ZQTA 1L8OA 1ZQSA 2VA8A 1L3VA 2EZYA 2DPJA 5AM5A 5HHHA 8ICKA 3ALRA 1NZBA 2A1JB 1T7PA 2K60A 5KFRA 4EELA 4EZ9A 2KG5A 5KT4A 4FS1A 2JRZA 1FFUA 4UARA 4U7CA 2WF9A 1VDVA 3KOOA 8ICPA
chains in the Genus database with same CATH topology
2H3VA 2KJ5A 3N7SC 3CRXA 2ZIXA 4P0PB 2GH1A 2OXOA 3ONNA 1CRXA 1KBUA 3F53A 3PSIA 1PVPA 2H3IA 2HMXA 2KKVA 2LYAA 3D2NA 3CP8A 2LKYA 3F2BA 3SQIA 2D6FC 3LVWA 1XO0A 2F76X 4KMOB 2K8CB 2Z7JA 2ZIWB 5KL8B 2HOIA 1IIPA 2W04A 3IG5A 3C28A 3AQEA 1MA7A 5HR7A 2VIXA 2Y0SC 2JH1A 2K4HA 2M0NA 2E5SA 2HBKA 3F5AA 4FZNA 2W03A 4OO1J 2K89A 2HBJA 2KOBA 4NWIA 5T14A 2F8LA 1URJA 3F5EA 2DQNB 3KFUF 2K4EA 1ED1A 2G06A 2ZIVA 4A8EA 4AYBC 1HEKA 2KJ8A 2LHTA 3CYMA 2RHFA 2KD1A 2OYYA 2DGZA 2WB1F 2Q4TA 4PL1A 4PL2A 1PVRA 2ZIUB 2R18A 2Y0SF 4CGZA 1A6SA 4OJ6A 2CN1A 2KKPA 4BJQA 2F2AB 2W7OA 2LYBA 3AQFA 4NLBA 3E0FA 2YB1A 2RRDA 3M7DA 2LBOA 4AYBF 1WUDA 4BX9C 1Z1BA 4QJFB 5C0YA 1UPHA 1P7DA 4QNLA 3IP4B 2GOLA 3VCBA 1SZHA 4P0PA 4WJ3B 3LYSA 1L6NA 3HKZF 3GZFA 1TAMA 2K8AA 2W7PA 3M6KA 5KL1B 2YB4A 2KNJA 3H0RB 3H0MB 3PSFA 3ICXA 2ZXIA 3LVVA 2ZIWA 1YT3A 2HOQA 4KX5A 4OJOA 2KEYA 4OJLA 4NV0A 2H3ZA 2KJ9A 2ZXHA 3M6ZA 1PVQA 2G07A 4OJPA 4P0QB 4FZMA 1ZQ1C 4ACOA 4CRXA 3KZXA 4BUGA 2PMZC 1OUQA 2G0AA 3F2CA 1HIWA 3D2SA 3SAGA 3SAHA 4ICAA 2YX8A 2KV2A 2ZIUA 2XI9A 3GU3A 3RF9A 4O3MA 2KICA 2KVCA 2F77X 4GFJA 5CRXA 2VJ5A 3H0LB 2N1RA 1GO3F 3IN5A 3VC8A 3D2QA 2K4IA 2PMZF 1XNSA 4U6PA 4FE3A 3AL0B 2KIWA 3N7RC 3O0FA 3NRWA 2A3VA 4FZLA 2JHDA 2H3FA 2HBMA 4NLCA 2ZIXB 1A0PA 3IG8A 2E1FA 2G5IB 2VKQA 3PSPA 2HOFA 2XVTA 1Q3UA 1ECWA 1Q3VA 2RP5A 4P0QA 4CDGA 3RFAA 1DRGA 2G08A 2XICA 1F44A 2CRXA 1T94A 2JGAA 2KHVA 3ALRA 3SAFA 1NZBA 3N7PD 2OM6A 2JH7A 2WAQC 4C0ZA 4QIWC 3K1ZA 3PSTA 2WB1C 3SMVA 3PZPA 3MGVA 2ZIVB 2ZG6A 3C29A 2VJ4A 2XIDA 2BDUA 5HR6A 1D8BA 2CPRA 3T79A 1Z19A 2HBLA 4OJ5A 5A0LA 2E1EA 3L3FX 3F2DA 2H3QA 2MRLA 2G5HB 2MA1A 3DEEA 4KX3A 4JMUA 2OH2A 2WAQF 2DF4B 4QIWF 4U7CA 3NUQA 2JMGA 3HKZC 2G09A 3OPXA 2KHQA 2NV3A 4IC9A 2K8BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHD A;  3F5A A;  2JH1 A;  2JH7 A;  3F53 A;  3F5E A;  2LBO A; 
#chains in the Genus database with same CATH topology
 4EEY A;  3HX0 A;  1Z3E B;  1L7M A;  1DK2 A;  5KFX A;  3OHA A;  4F50 A;  2GWS A;  4PHP A;  5CB1 A;  2LYA A;  2LKY A;  4YMO A;  1TAQ A;  8ICR A;  5AI9 A;  4UBB A;  1BPZ A;  5CR0 A;  1F5S A;  5J2D A;  4O3S A;  2G06 A;  4B9N A;  9ICF A;  4DSF A;  4DCC A;  2KMD A;  1WWU A;  3RRH A;  5HHI A;  4DSI A;  4IQV A;  4RQ0 A;  2LM1 A;  3GIL A;  2UVR A;  4QJF B;  3VCB A;  5CWR A;  5J2G A;  1NK5 A;  2KSO A;  2NO5 A;  5ALR A;  1ZQC A;  2JR5 A;  2YMM A;  4RQ6 A;  4R65 A;  3HPO A;  3ISB A;  2QLT A;  4ECV A;  1XWL A;  4FBU A;  4QWB A;  2HHX A;  3KZX A;  2C2E A;  1J2N A;  4MEX A;  4Z6F A;  2EAM A;  2LMR A;  2AXT U;  4IRD A;  2JEJ A;  1SZP A;  4RPX A;  4YXM A;  5J2B A;  4LZD A;  5CJ7 A;  3RB3 A;  3HJE A;  4CNQ A;  2DFL A;  3IG8 A;  2E1F A;  2FPL A;  1U48 A;  2IMW P;  2YTU A;  4ELV A;  2P6R A;  4C7Y A;  3EPG A;  3ETL A;  4XRH A;  5L9X A;  2KZZ A;  2JEF A;  2JZB A;  1S0N A;  3AEV A;  4DF8 A;  3WKB A;  2VJ4 A;  1UQV A;  2EH9 A;  1ZYQ A;  5A0L A;  1L8L A;  3AU2 A;  4JMU A;  2DKZ A;  4ECU A;  2KHQ A;  2JMG A;  1J97 A;  4UW9 A;  4KLJ A;  9ICN A;  2GH1 A;  4DS5 A;  2OXO A;  2WHE A;  5AM1 A;  2H3I A;  1OXJ A;  5F3X B;  3F2B A;  2HHT A;  8ICO A;  1X40 A;  1QQ6 A;  9ICM A;  1A77 A;  5KFP A;  3M8S A;  1HUZ A;  1XS9 D;  5KG4 A;  3ZD8 A;  1KEJ A;  1ARO P;  1QQ5 A;  4JV1 A;  5T14 A;  4J9S A;  3BQ1 A;  4QZA A;  3TFR A;  3ZDB A;  8ICA A;  4I28 A;  5KFK A;  4MFA A;  2OYY A;  5BPC A;  4EX6 A;  2W43 A;  4PL1 A;  1Z1V A;  2B6G A;  2R8K A;  3J81 j;  3NAS A;  4EZ6 A;  5KFB A;  5CA7 A;  2NRV A;  3ZDE A;  3EPI A;  8ICQ A;  2MSN A;  2QAR A;  1ZQX A;  1NK6 A;  4KLS A;  3BS7 A;  5J0X A;  5TIS U;  5G5G A;  2KJ9 A;  4QZD A;  1CEZ A;  3RR8 A;  1ZQI A;  1ZQU A;  1X9X A;  1DGJ A;  3RF9 A;  2KVC A;  3UXP A;  1TFR A;  3GQC A;  4BDP A;  2WF6 A;  3RR7 A;  3KTQ A;  1N48 A;  4FE3 A;  3BS5 A;  1JN3 A;  3AL0 B;  3GV5 B;  4US8 A;  2WF8 A;  3QEA Z;  2ES6 A;  4TQR A;  1IV8 A;  4I2H A;  2FLL A;  5GTH U;  3L4P A;  1X42 A;  1Q3V A;  4NLZ A;  3ORY A;  3QU5 A;  1SGG A;  3NRZ A;  3PZP A;  3C2M A;  4DFK A;  4UAV A;  1S9F A;  3HW8 A;  4CE6 A;  4PZN A;  1FO4 A;  1X2I A;  9ICG A;  1D8Y A;  5AKK A;  2G5H B;  2F1J A;  3CNH A;  2P66 A;  1ZQP A;  1S8O A;  8ICC A;  2H3V A;  2BGW A;  4G9B A;  4P0P B;  5EE9 A;  5L1K A;  4RU9 A;  1D9D A;  3D2N A;  9ICC A;  5AI0 A;  2F1I A;  4YD2 A;  3JPO A;  3BQ0 A;  1SL2 A;  2M0N A;  2QKQ A;  3PX4 A;  2BCV A;  4M9G A;  8ICU A;  4RQ4 A;  5L1J A;  1NOM A;  2DGZ A;  4F2R A;  4MFC A;  1S97 A;  2R18 A;  2Y0S F;  3C1Y A;  2KKP A;  3IRU A;  4R8U A;  2RRD A;  4AYB F;  2ISP A;  4CF4 A;  1IXR A;  3Q8P B;  3GZF A;  2K8A A;  3UQ2 A;  4DO9 A;  5ALD A;  3UXO A;  4K4H A;  2HHQ A;  1JRO A;  3RJH A;  4DSJ A;  4ELT A;  4OJP A;  4I2F A;  4M9H A;  2E8M A;  9ICE A;  2EAP A;  5KG3 A;  2XC9 A;  3NVZ A;  5DDM A;  4TUS A;  4GFJ A;  4QW9 A;  3IN5 A;  3D2Q A;  5J2F A;  5IIN A;  2XY7 A;  3WKE A;  2A3V A;  2JHD A;  4QZ8 A;  1SV0 C;  5CHG A;  2G5I B;  3QUT A;  2UVW A;  2NRX A;  2HVH A;  2XGQ A;  2PI5 A;  1JUD A;  5KNI A;  5CP2 A;  2BPG A;  3A0H U;  4GIB A;  1KRP A;  4NJ8 A;  4C8M A;  2FDR A;  3KZI U;  9ICH A;  3H7I A;  4QIW C;  2EQY A;  2WB1 C;  2HHS A;  4DSL A;  5J0P A;  4ECY A;  2DWQ A;  3L3F X;  4RNO A;  3F2D A;  1U4B A;  4ECW A;  5AKL A;  2AHO B;  1AQ6 A;  2ASD A;  1U49 A;  1HJP A;  1NK7 A;  1L5U A;  4KN4 A;  4NM2 A;  8ICE A;  2W8K A;  4KLO A;  2MAX A;  5J0W A;  4EEN A;  3HWT A;  4PZO A;  5DBC A;  2K4H A;  4YR2 A;  5KFE A;  1SB3 C;  4QZF A;  4NWI A;  2Y9T A;  1ZQO A;  8ICH A;  2JEI A;  5AI4 A;  4GXI A;  4DOB A;  4DOA A;  3PVX A;  4EBD A;  9ICQ A;  5KFA A;  1CUK A;  2I1Q A;  5KG0 A;  2OWO A;  3UQ0 A;  5AI6 A;  3GV8 B;  4B9L A;  5BOL A;  3SEN A;  4M47 A;  3ZDD A;  1LVH A;  3QU4 A;  1OW5 A;  4Q43 A;  1IG6 A;  3MR2 A;  3LWL A;  4B9V A;  1LKY A;  3SAH A;  5J29 A;  4K4G A;  4Z6E A;  5DG9 A;  3QU7 A;  2KE7 A;  3T5H A;  5J2H A;  4B9T A;  5EE3 A;  4Z6D A;  3FYH A;  4RUC A;  3G6V A;  3BQT A;  4QZG A;  7ICM A;  3BDP A;  3ISD A;  1JI7 A;  4UB2 A;  4NLN A;  4YMN A;  5KFC A;  2VA3 A;  2VKQ A;  2ZTC A;  4TQS A;  5KFL A;  4C80 A;  3RB4 A;  2F3N A;  3M1Y A;  3PNC A;  2ZUC A;  5C5J A;  3RH4 A;  2OM6 A;  4BGD A;  3PML A;  3QUQ A;  5ALH A;  1KKX A;  3C5F A;  7ICE A;  1SKW A;  3ZDA A;  4OJ5 A;  3MGH A;  2RDI A;  3V7K A;  7ICL A;  2YQE A;  4O3Q A;  2I5H A;  1ZQV A;  2HOI A;  1ZJN A;  3GIJ A;  3WKD A;  4F72 A;  4PHE A;  1A76 A;  7ICJ A;  3H8J A;  3SQI A;  1Q8K A;  4J9O A;  2CXY A;  3C28 A;  1U9L A;  2XY6 A;  5HR7 A;  7ICQ A;  3AM9 A;  3AUO A;  1QTM A;  4B9S A;  4GXK A;  4O3N A;  8ICV A;  3RJF A;  3F5E A;  3MBY A;  3RB6 A;  2K4E A;  5AK6 A;  3R9K A;  3PW4 A;  1UA0 A;  3PW2 A;  3PW7 A;  2WB1 F;  3HP6 A;  3GDX A;  9ICS A;  2QB1 A;  3WK9 A;  1BPB A;  2F2A B;  3MFH A;  2NO4 A;  1X66 A;  9ICW A;  4PGY A;  3BJY A;  4M6W B;  4B6J A;  4DQR A;  4USA A;  4Y2T A;  4Y2P A;  2ZXI A;  5DG8 A;  2W55 A;  4O3P A;  2V9W A;  4DFP A;  8ICL A;  4OJL A;  3JPN A;  3KHR A;  2F8K A;  3I76 A;  1PVQ A;  5KG6 A;  3MGI A;  4CCH A;  4BUG A;  5HML A;  4BXO B;  4JV2 A;  2UVV A;  1T4G A;  4QZB A;  2OEH A;  2KIC A;  4C8K A;  3K1R B;  5EE0 A;  1ZQM A;  4Y2X A;  5ALZ A;  4QZH A;  7ICR A;  3G6X A;  3TFS A;  2BCU A;  1M6Y A;  2IHM A;  5DBA A;  2ZIX B;  3WK5 A;  4R66 A;  3RJG A;  1X9M A;  3FM9 A;  2C2D A;  7ICI A;  1Z00 A;  2XVT A;  4RQ3 A;  3M8R A;  4P4O A;  2HVI A;  1BPE A;  3MDA A;  2DPI A;  2FPK A;  2KFN A;  3K1Z A;  5IIO A;  1ZQZ A;  3WKA A;  2I6X A;  3SI8 A;  3T79 A;  2HBL A;  3JPR A;  2E8P A;  4Z6C A;  4KX3 A;  5JUM A;  3QYP A;  4MHV A;  4C4R A;  2XY5 A;  3QUC A;  4DL6 A;  1ZQW A;  1BVS A;  5KG2 A;  2WTF A;  5AI8 A;  2E3T A;  2KKV A;  1BNP A;  2VA2 A;  4FFD A;  1NKE A;  3IG5 A;  3AQE A;  5F9N A;  3SV4 A;  4F5O A;  9ICV A;  9ICI A;  4OO1 J;  5EOZ A;  2DQN B;  3UPQ A;  5F9L A;  3UXN A;  4KTQ A;  2RHF A;  1B22 A;  4BWJ A;  5ALG A;  4PGQ A;  3IM1 A;  2ZJ5 A;  1VJ5 A;  4UAW A;  1WUD A;  4GLX A;  4KLG A;  4J9M A;  2W7P A;  5J0O A;  5KL1 B;  2BHN A;  3H0R B;  5B5E U;  3ICX A;  1EXN A;  4DL5 A;  2KEY A;  2ESE A;  3SR6 A;  4ECR A;  2A19 A;  7ICG A;  1JIH A;  1N5X A;  4KN7 A;  1OUQ A;  3F2C A;  1MN8 A;  3N97 B;  4TUP A;  3OSN A;  2KV2 A;  2W8L A;  2W9C B;  4ED0 A;  1L3T A;  4XUS A;  2PMZ F;  3H4B A;  3LDA A;  1HUO A;  9ICO A;  5KFD A;  2FMS A;  4DFM A;  3B9J A;  3QXG A;  3T5L A;  5JTI A;  3OJS A;  3V6H A;  8ICY A;  5KFJ A;  1X9S A;  5ALS A;  2BPC A;  3GIM A;  4EYH B;  3TAN A;  5ALM A;  4P0Q A;  4QWC A;  2ALZ A;  3SV3 A;  5DGB A;  2KP7 A;  3WK6 A;  4LJX A;  4I2J A;  2BDU A;  1N5W A;  2E1E A;  2MRL A;  1LB2 B;  3ISC A;  2YMQ A;  3KKA A;  2WAQ F;  4RNN A;  5KT6 A;  3V7L A;  3EZ5 A;  2IA6 A;  2K8B B;  4ED8 A;  5J8Y C;  1RYS A;  3ONN A;  5DLG A;  2Z7J A;  4I2C A;  1S77 D;  4IL6 U;  3EW9 A;  2Y0S C;  5L1M A;  4RQ8 A;  3QZ8 A;  1TKD A;  2F8L A;  3KFU F;  4KLI A;  2ZIV A;  4M9N A;  2W9B B;  4AYB C;  4PL2 A;  4F5R A;  5JRT A;  4CGZ A;  1DOQ A;  1A6S A;  2MUT B;  4US9 A;  3RTV A;  5AKE A;  5ALL A;  5KFO A;  5AM2 A;  4ECX A;  4WJ3 B;  2LPE A;  4FS2 A;  4O9M A;  1QSY A;  3A0B U;  2H5X A;  4CRX A;  7ICU A;  1J2M A;  4OD0 A;  3HIL A;  4ED7 A;  1TK8 A;  4NXZ A;  5ALK A;  4LZG A;  3H0L B;  1ZD5 A;  2KIV A;  4B9U A;  4NLG A;  4YMM A;  5KT5 A;  2ASL A;  5J0Y A;  3UMG A;  2L5Y A;  1ZQG A;  1UHU A;  3H8W A;  1RDF A;  3L5K A;  1ZQF A;  3THV A;  4IQU A;  1A0P A;  4G3I A;  3KHG A;  8ICB A;  2E8N A;  5KT7 A;  5J0U A;  2HOF A;  3HRD D;  1WWV A;  2ASJ A;  5KFV A;  3RFA A;  3MR5 A;  2V4R A;  1U45 A;  1B0X A;  2JGA A;  2XCA A;  3Q8M A;  4ECQ A;  4QZE A;  4DQP A;  2JEG A;  1XSL A;  1PK1 A;  4KLM A;  4I2B A;  4ED1 A;  1UT5 A;  3ZI4 A;  9ICT A;  2ZUB A;  5ALO A;  4RQ5 A;  4F8R A;  1PUZ A;  1KBU A;  2KSO B;  1ZQL A;  3CP8 A;  1L3S A;  5CEH A;  3WU2 U;  2W04 A;  1NK8 A;  5AKX A;  5D46 A;  3F5A A;  4DOC A;  3JPQ A;  2Y9U A;  4UB8 U;  2EZX A;  4UAT A;  1HEK A;  3H4D A;  2R8I A;  1ZQN A;  3PO4 A;  1L3U A;  8ICJ A;  4UAY A;  4Q8E A;  4OJ6 A;  3RBD A;  7ICS A;  1Z1B A;  1WCN A;  7ICN A;  4ZOH C;  3IP4 B;  3D6J A;  1V97 A;  3I28 A;  4YD1 A;  3AU6 A;  5JU5 A;  1Z4N A;  3LVV A;  2ZIW A;  3PX6 A;  4LVS A;  2IBK A;  3WK8 A;  4NV0 A;  3H8S A;  2W3S A;  2IOH A;  5AIC A;  3KKA C;  3V6J A;  3HT3 A;  4YR3 A;  2HHW A;  3GII A;  1TE2 A;  2JZB B;  4ICA A;  2YX8 A;  4UB3 A;  4HAI A;  5TZV A;  5EWF A;  1X6I A;  3OGU A;  4XQ8 A;  4ECZ A;  2ATL A;  5GTI U;  4U6P A;  1XNS A;  4OCZ A;  5ALF A;  1VLB A;  3PY8 A;  2R8H A;  2GO7 A;  4J9P A;  2HSZ A;  2H3F A;  3RBE A;  3C21 A;  1NI3 A;  2KTQ A;  2ODG A;  1ZD3 A;  1Q3U A;  2J6U A;  4ZH4 A;  2HHV A;  4RQN A;  2XGP A;  1RQN A;  4ED2 A;  1DK3 A;  5DQH A;  4JB3 A;  1D8B A;  2XID A;  3RAQ A;  3EWA A;  2MA1 A;  5KFS A;  3H40 A;  4KLF A;  4DLE A;  3RH5 A;  4I2D A;  1QCK A;  4KLE A;  4P4M A;  5J2A A;  2NV3 A;  2W9A A;  4F4Z A;  5HNK A;  4O5E A;  2KN7 A;  5AIB A;  2QAR B;  4DS4 A;  4Y2V A;  3CW2 C;  9ICA A;  2K89 A;  3I1Y A;  4RPZ A;  1NZP A;  2KD1 A;  1L7P A;  1NJZ A;  4I2G A;  2VAN A;  3PW5 A;  4UAU A;  4F3O A;  2DUY A;  3E0F A;  1ZQE A;  3BS5 B;  2BR0 A;  1SKS A;  2YB4 A;  3Q8Q B;  3PSF A;  3H0M B;  3C2L A;  3ED5 A;  1MQ3 A;  1RG6 A;  5III A;  2IHN A;  1SL1 A;  2G07 A;  5AKI A;  3TAD A;  3ZDC A;  3BQ7 A;  2FI1 A;  5J2I A;  4PHD A;  5J0S A;  2ZIU A;  5D4B A;  1NKC A;  1QLN A;  2BQR A;  4JV0 A;  2EZZ A;  9ICB A;  3N4M B;  1KN5 A;  3N7R C;  2I9G A;  1NJY A;  5D49 A;  3M9N B;  4QZ9 A;  2AH5 A;  3E58 A;  5DB9 A;  3FDS A;  3V72 A;  1ZQH A;  1ECW A;  5H2F U;  3MR6 A;  5AKG A;  5J2K A;  3Q8L A;  1K1Q A;  2MU2 A;  4TUQ A;  3NTU A;  3SAF A;  4DLG A;  3RJE A;  3SMV A;  4Q44 A;  1N61 A;  2W11 A;  3AN1 A;  4PHA A;  2H3Q A;  2NRW A;  3DEE A;  4RT2 A;  3RRG A;  5KT3 A;  4R8U B;  4QWD A;  3ETR A;  2EAO A;  1NJW A;  4IRK A;  8ICF A;  1COO A;  3FC4 A;  4PJ0 U;  5ALX A;  3PSI A;  3QNM A;  4O3O A;  4IR9 A;  1XO0 A;  7ICP A;  1RYU A;  5KFH A;  4Y2Q A;  4F5N A;  1WCL A;  4DWI A;  3QZ7 A;  2A1J A;  2ZTD A;  2DBY A;  1URJ A;  5ALJ A;  1ED1 A;  4DL4 A;  5IIK A;  3H8M A;  2F1H A;  4M04 A;  3DDH A;  4E0D A;  1ZD2 P;  3K4G A;  2YML A;  4BX9 C;  3QEB Z;  1COK A;  2HHU A;  3EYZ A;  2BPF A;  1ZXI A;  2KNJ A;  4O5C A;  9ICL A;  5AKJ A;  4EX7 A;  2ISO A;  1ZQ1 C;  4I2E A;  4YXJ A;  8ICI A;  2PMZ C;  5ALI A;  3PW0 A;  1K1S A;  3D2S A;  8ICZ A;  4DFJ A;  2P35 A;  4O3M A;  2WF5 A;  1N62 A;  4J9N A;  5CRX A;  1PK3 A;  2K4I A;  5IIM A;  3QU2 A;  4MF8 A;  5BOM A;  4J9R A;  2F44 A;  1N2X A;  7ICT A;  4RQM A;  1ZQJ A;  7ICK A;  8ICT A;  2CRX A;  3LK9 A;  1SKR A;  2WAQ C;  4C0Z A;  1JXL A;  3RJK A;  5B66 U;  1X6J A;  5IIJ A;  3TAR A;  2KZ3 A;  3AMZ A;  5EWG A;  2Q0Z X;  1ZD4 A;  4QWA A;  2C2R A;  4UQG A;  3NUQ A;  3GV7 B;  3TAD C;  4IC9 A;  3MR3 A;  3OHB A;  4J9K A;  4MFF A;  3TAQ A;  1T3Q A;  1ZRM A;  2PI4 A;  4J9L A;  2K8C B;  4KIT B;  9ICK A;  2EAN A;  3T3F A;  5J2C A;  2NYV A;  2R8J A;  1B43 A;  1LKY B;  9ICR A;  2AJQ A;  3QU9 A;  2LI6 A;  2Q4T A;  4QWE A;  4RNM A;  5DDY A;  1SL0 A;  4K4I A;  5KFI A;  1RPL A;  4BJQ A;  5AI5 A;  4YVZ A;  3BZC A;  1L6N A;  4Q8F A;  1TAM A;  5G5H A;  4CF5 A;  5KFM A;  4DQI A;  2M9N A;  3V7J A;  3PMN A;  3EUB 2;  4ACO A;  1UA1 A;  9ICP A;  2DL0 A;  1JX4 A;  1MC8 A;  2PXI A;  4QZI A;  5AKY A;  2BZF A;  2C22 A;  2BQ3 A;  8ICG A;  2W3R A;  3IDW A;  2VJ5 A;  4JWN A;  2FLN A;  2N1R A;  3Q8R B;  2KK0 A;  4I2I A;  3PR5 B;  1CI4 A;  3M9M B;  2FMP A;  3PV8 A;  3RAX A;  3PSP A;  4UB6 U;  8ICM A;  5DG7 A;  3NVV A;  5KFG A;  2PFO A;  1O03 A;  4UB4 A;  3MC1 A;  4TUR A;  3MGV A;  1YZ7 A;  2AQ4 A;  3OTQ A;  1NK0 A;  1XU4 A;  3JPT A;  3IHQ B;  4P2H A;  4FBT A;  1ZQQ A;  3T5K A;  2G09 A;  5ALQ A;  1DRG A;  2DKX A;  3CRX A;  7ICH A;  3F53 A;  2D6F C;  4NY8 A;  2HI0 A;  1JXE A;  4I2A A;  3RJJ A;  1QSL A;  4O3R A;  2KOB A;  2JXJ A;  4M2Y A;  5KG5 A;  2EDU A;  3PO5 A;  1P7D A;  4KLD A;  3T5J A;  1RM6 C;  4P0P A;  1SZH A;  4NL9 A;  1ZET A;  5DBB A;  2BCR A;  1Z4O A;  1KLN A;  1Z00 B;  1FEZ A;  4FZM A;  4C4T A;  1KFT A;  2HW3 A;  1NK9 A;  4F93 B;  7ICO A;  9ICX A;  3UMC A;  2F77 X;  2GLE A;  3C23 A;  3BQ2 A;  4YFK A;  1GO3 F;  4Q45 A;  3V6K A;  3E2E A;  1QSS A;  3NRW A;  5KFQ A;  1KTQ A;  2HBM A;  1ZRN A;  1SIJ A;  3U26 A;  3SEI A;  2RP5 A;  1Q46 A;  4CDG A;  2KFZ A;  4KLL A;  2G08 A;  3Q8K A;  9ICU A;  1B4F A;  5AK5 A;  3PST A;  3PR4 A;  4DSE A;  3C29 A;  2XCP A;  5HR6 A;  1BNO A;  3RH6 A;  5EE1 A;  1SV0 A;  4JUZ A;  4DF4 A;  4PGX A;  5AM4 A;  1WYG A;  4F5P A;  3SD7 A;  2AGP A;  1SXE A;  1V85 A;  2ZJ8 A;  3QE9 Y;  1TVA A;  1F0M A;  1QQ7 A;  2IOF A;  1KFD A;  5DQI A;  2IOF K;  5AIA A;  4Y2Y A;  2W9M A;  2FPM A;  2O6K A;  3LVW A;  4QZC A;  2E8O A;  1N60 A;  1MA7 A;  2RDJ A;  1XSN A;  2JH1 A;  2E5S A;  5DKW A;  4IQW A;  5AM0 A;  1Y88 A;  4I29 A;  2BCQ A;  4NLK A;  4KLU A;  3TAC B;  2AGO A;  2LHT A;  4RQ7 A;  3CYM A;  4O0I A;  1QH9 A;  4KMU A;  3G6Y A;  5KFT A;  3NGD A;  8ICW A;  4NM1 A;  4DFD A;  4UB1 A;  1N56 A;  3JPP A;  4NLB A;  2YB1 A;  1N63 A;  2OHF A;  1JMS A;  3M7D A;  5DQG A;  4DQS A;  4QNL A;  2GOL A;  2ZTE A;  1KQQ A;  4ELU A;  2LM4 A;  2HOQ A;  3OJU A;  5ALP A;  4O5K A;  2ZXH A;  3M6Z A;  4P0Q B;  4Y2J A;  4ECT A;  3B0X A;  5J0T A;  1TK5 A;  2LYH A;  3QUB A;  1H38 A;  2WFA A;  1DXS A;  2RQ5 A;  3KD3 A;  4IQT A;  5ALU A;  1SV4 A;  1S0O A;  4YN4 A;  2PFN A;  2KIW A;  4HYK A;  3O0F A;  5FP0 A;  4ED3 A;  4UAS A;  5AK3 A;  5DB7 A;  4F4X A;  1KFS A;  3TI0 A;  1NK4 A;  1JAL A;  4I27 A;  5DLF A;  1TAU A;  2FMQ A;  2KHV A;  4YCX A;  4R64 A;  4C7Z A;  2ZIV B;  4NL9 C;  2CPR A;  3C5G A;  4F2S A;  3BZK A;  1Z19 A;  1U47 A;  4DL7 A;  3N28 A;  5KAF U;  5E79 U;  1C7Y A;  2OH2 A;  1BPX A;  1RYR A;  3K75 D;  1YZ6 A;  2JV3 A;  1NNL A;  2BQU A;  3HKZ C;  1SWV A;  2KJ5 A;  3N7S C;  2C28 A;  1WG8 A;  4GXJ A;  3KHL A;  4Y2U A;  5J0R A;  2P6U A;  4C8N A;  2HDO A;  5KL8 B;  3KHH A;  5ALN A;  2K4P A;  2HBK A;  4F92 B;  1FIQ A;  2W03 A;  3QX7 A;  1SWW A;  4RPY A;  1RZT A;  3B0Y A;  1FFV A;  1T8E A;  2KJ8 A;  4F4W A;  5HP4 A;  4AP9 A;  4IRC A;  1RXV A;  4KLT A;  2CN1 A;  2AU0 A;  2LBO A;  1UPH A;  3SZ2 A;  4F4K A;  4C8O A;  3MDC A;  1D9F A;  4MF2 A;  2BCS A;  1ZQA A;  4RUA A;  2QB0 A;  4KX5 A;  2H3Z A;  4GC6 A;  4FO6 A;  1X9W A;  3UMB A;  1S5L U;  4R63 A;  2W54 A;  3OSP A;  4BWM A;  1DGS A;  2G0A A;  5J2E A;  1HIW A;  4QW8 A;  5KT2 A;  5KG1 A;  1PK1 B;  5ALY A;  3ZD9 A;  1ZJM A;  5DB6 A;  4M9J A;  4M6W A;  3RB0 A;  3GFK B;  1UCV A;  2ZUD A;  4ED6 A;  2UVU A;  3PX0 A;  3Q8S B;  2YN4 A;  3TKA A;  1ZQD A;  3C2K A;  1PZN A;  2KZM A;  2OCE A;  1T94 A;  2B0C A;  4BXO A;  2JH7 A;  2PFP A;  4ECS A;  2ZG6 A;  1C20 A;  1BGX T;  2FE9 A;  2Y1J A;  5ALV A;  5ALT A;  2DF4 B;  5ALW A;  2RLT A;  2ZIX A;  5HMM A;  4Y2R A;  5KG7 A;  4KMO B;  2FJ6 A;  2ZIW B;  3JPS A;  4F5Q A;  1S0M A;  5DB8 A;  2AGQ A;  4RQ2 A;  2D8C A;  1S0V A;  4IR1 A;  2HCF A;  2FLP A;  4XA5 A;  4EBC A;  4F4Y A;  4RQ1 A;  7ICF A;  8ICN A;  2BDP A;  3WKC A;  4X5V A;  4KLQ A;  2XO7 A;  4F91 B;  3C1Z A;  4RZR A;  3MAB A;  2W7O A;  3AQF A;  1RQL A;  1XO1 A;  1MSW D;  4YQW A;  1XC9 A;  3HKZ F;  1ZQR A;  5KAI U;  3M6K A;  1TV9 A;  3NS1 A;  1MQ2 A;  4KLH A;  1T3N A;  4F71 A;  1YT3 A;  1KSP A;  3NVY A;  4OJO A;  4IS7 A;  1V38 A;  2YMP A;  4CF3 A;  5KFY A;  1XSP A;  2R8G A;  3NVW A;  3SAG A;  3DV9 A;  1ZOL A;  4B9M A;  3UM9 A;  4MEY A;  5KFU A;  3IV6 A;  3VC8 A;  4YP3 A;  1NJX A;  3LWM A;  1K5O A;  4UBC A;  2NRT A;  4DEZ A;  5AKH A;  4NLC A;  4DL3 A;  5KFZ A;  2J6S A;  4P4P A;  1V9P A;  1BPD A;  5EWE A;  2D3D A;  4C4S A;  4EBE A;  1NKB A;  2XIC A;  1F44 A;  4DQQ A;  3N7P D;  1ZQY A;  5KFN A;  2QB0 B;  1D8L A;  2KVS A;  5KTQ A;  3M9O B;  2W9C A;  8ICS A;  1UT8 A;  2A1A A;  1S76 D;  4JK1 A;  5KFW A;  4QIW F;  5K4L A;  4M0A A;  4PH5 A;  3OPX A;  1BPY A;  1SXD A;  4GC7 A;  5KFF A;  4YR0 A;  4DL2 A;  1CRX A;  2J6T A;  1PVP A;  2HMX A;  1L7O A;  2F76 X;  3WK7 A;  4J9Q A;  4EYI B;  3FAH A;  1IIP A;  1KDH A;  2PKE A;  4Y2S A;  2B21 A;  2VIX A;  5AKZ A;  4FZN A;  4RT3 A;  3RJI A;  2HBJ A;  1S10 A;  2AQ0 A;  4A8E A;  3KBB A;  5J8Y A;  1KL9 A;  1PVR A;  2ZIU B;  3SYZ A;  5IIL A;  5AM3 A;  3WK4 A;  2V4Q A;  2LYB A;  2YY6 A;  4UB5 A;  3MFI A;  1ZQB A;  5ALE A;  5J0Q A;  5C0Y A;  2PFQ A;  5J2J A;  3LYS A;  1O08 A;  2WF7 A;  3GIK A;  4DSK A;  9ICJ A;  1L7N A;  4UAZ A;  5AHX A;  2Y1I A;  5L1L A;  1ZQK A;  5DGA A;  1LV5 A;  4EEK A;  2W9B A;  3TAP A;  4M9L A;  1IM4 A;  1JRP A;  3GU3 A;  3S6J A;  2XI9 A;  4C8L A;  2MUT A;  4JWM A;  5AK4 A;  1RXW A;  1KW4 A;  7ICV A;  4PPX A;  2BKE A;  2NRZ A;  5L1I A;  4J03 A;  2ZJA A;  1TK0 A;  4FZL A;  4YG2 A;  3TQ1 A;  8ICX A;  1ZQT A;  1L8O A;  1ZQS A;  2VA8 A;  1L3V A;  2EZY A;  2DPJ A;  5AM5 A;  5HHH A;  8ICK A;  3ALR A;  1NZB A;  2A1J B;  1T7P A;  2K60 A;  5KFR A;  4EEL A;  4EZ9 A;  2KG5 A;  5KT4 A;  4FS1 A;  2JRZ A;  1FFU A;  4UAR A;  4U7C A;  2WF9 A;  1VDV A;  3KOO A;  8ICP A; 
#chains in the Genus database with same CATH homology
 2H3V A;  2KJ5 A;  3N7S C;  3CRX A;  2ZIX A;  4P0P B;  2GH1 A;  2OXO A;  3ONN A;  1CRX A;  1KBU A;  3F53 A;  3PSI A;  1PVP A;  2H3I A;  2HMX A;  2KKV A;  2LYA A;  3D2N A;  3CP8 A;  2LKY A;  3F2B A;  3SQI A;  2D6F C;  3LVW A;  1XO0 A;  2F76 X;  4KMO B;  2K8C B;  2Z7J A;  2ZIW B;  5KL8 B;  2HOI A;  1IIP A;  2W04 A;  3IG5 A;  3C28 A;  3AQE A;  1MA7 A;  5HR7 A;  2VIX A;  2Y0S C;  2JH1 A;  2K4H A;  2M0N A;  2E5S A;  2HBK A;  3F5A A;  4FZN A;  2W03 A;  4OO1 J;  2K89 A;  2HBJ A;  2KOB A;  4NWI A;  5T14 A;  2F8L A;  1URJ A;  3F5E A;  2DQN B;  3KFU F;  2K4E A;  1ED1 A;  2G06 A;  2ZIV A;  4A8E A;  4AYB C;  1HEK A;  2KJ8 A;  2LHT A;  3CYM A;  2RHF A;  2KD1 A;  2OYY A;  2DGZ A;  2WB1 F;  2Q4T A;  4PL1 A;  4PL2 A;  1PVR A;  2ZIU B;  2R18 A;  2Y0S F;  4CGZ A;  1A6S A;  4OJ6 A;  2CN1 A;  2KKP A;  4BJQ A;  2F2A B;  2W7O A;  2LYB A;  3AQF A;  4NLB A;  3E0F A;  2YB1 A;  2RRD A;  3M7D A;  2LBO A;  4AYB F;  1WUD A;  4BX9 C;  1Z1B A;  4QJF B;  5C0Y A;  1UPH A;  1P7D A;  4QNL A;  3IP4 B;  2GOL A;  3VCB A;  1SZH A;  4P0P A;  4WJ3 B;  3LYS A;  1L6N A;  3HKZ F;  3GZF A;  1TAM A;  2K8A A;  2W7P A;  3M6K A;  5KL1 B;  2YB4 A;  2KNJ A;  3H0R B;  3H0M B;  3PSF A;  3ICX A;  2ZXI A;  3LVV A;  2ZIW A;  1YT3 A;  2HOQ A;  4KX5 A;  4OJO A;  2KEY A;  4OJL A;  4NV0 A;  2H3Z A;  2KJ9 A;  2ZXH A;  3M6Z A;  1PVQ A;  2G07 A;  4OJP A;  4P0Q B;  4FZM A;  1ZQ1 C;  4ACO A;  4CRX A;  3KZX A;  4BUG A;  2PMZ C;  1OUQ A;  2G0A A;  3F2C A;  1HIW A;  3D2S A;  3SAG A;  3SAH A;  4ICA A;  2YX8 A;  2KV2 A;  2ZIU A;  2XI9 A;  3GU3 A;  3RF9 A;  4O3M A;  2KIC A;  2KVC A;  2F77 X;  4GFJ A;  5CRX A;  2VJ5 A;  3H0L B;  2N1R A;  1GO3 F;  3IN5 A;  3VC8 A;  3D2Q A;  2K4I A;  2PMZ F;  1XNS A;  4U6P A;  4FE3 A;  3AL0 B;  2KIW A;  3N7R C;  3O0F A;  3NRW A;  2A3V A;  4FZL A;  2JHD A;  2H3F A;  2HBM A;  4NLC A;  2ZIX B;  1A0P A;  3IG8 A;  2E1F A;  2G5I B;  2VKQ A;  3PSP A;  2HOF A;  2XVT A;  1Q3U A;  1ECW A;  1Q3V A;  2RP5 A;  4P0Q A;  4CDG A;  3RFA A;  1DRG A;  2G08 A;  2XIC A;  1F44 A;  2CRX A;  1T94 A;  2JGA A;  2KHV A;  3ALR A;  3SAF A;  1NZB A;  3N7P D;  2OM6 A;  2JH7 A;  2WAQ C;  4C0Z A;  4QIW C;  3K1Z A;  3PST A;  2WB1 C;  3SMV A;  3PZP A;  3MGV A;  2ZIV B;  2ZG6 A;  3C29 A;  2VJ4 A;  2XID A;  2BDU A;  5HR6 A;  1D8B A;  2CPR A;  3T79 A;  1Z19 A;  2HBL A;  4OJ5 A;  5A0L A;  2E1E A;  3L3F X;  3F2D A;  2H3Q A;  2MRL A;  2G5H B;  2MA1 A;  3DEE A;  4KX3 A;  4JMU A;  2OH2 A;  2WAQ F;  2DF4 B;  4QIW F;  4U7C A;  3NUQ A;  2JMG A;  3HKZ C;  2G09 A;  3OPX A;  2KHQ A;  2NV3 A;  4IC9 A;  2K8B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...