2LBOA

Eimeria tenella microneme protein 3 mar_b domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
APTLQEALDRKCAQFGKESCNSGLASYCGAAIYARYDKGNSSQQTKEWRCYIEKELDFSKSGDGCVDDCGSMTSCRGSVSGPSTSHLTRPSELQAVIDSDKSNYCTDKSEQQPSQATPPPEIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Role of Sialyl Glycan Recognition in Host Tissue Tropism of the Avian Parasite Eimeria tenella
pubmed doi rcsb
source organism Eimeria tenella
molecule tags Cell adhesion
molecule keywords Microneme protein 3
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10564 MAR_sialic_bdg Sialic-acid binding micronemal adhesive repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.580 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lboA00
2LBOA 2JH7A 2JH1A 2JHDA 3F5EA 3F53A 3F5AA
chains in the Genus database with same CATH superfamily
4OJOA 2G06A 1BPYA 2HBLA 4DLEA 1V97A 5AKGA 3V7KA 1QH9A 3WK9A 5ALZA 2KEYA 2AQ0A 3PZPA 3TACB 3BS5B 9ICOA 4EBDA 3BZKA 1ZQHA 3PX6A 2R18A 1D9FA 1HIWA 1VJ5A 2MSNA 3JPTA 2R8KA 5AKHA 4F4XA 3RJJA 3QUQA 2R8HA 4J9OA 2EDUA 1X40A 4PHAA 1A76A 3NVVA 4QWCA 5KFBA 4P2HA 2A1JB 1NK4A 4IRCA 4NLCA 3G6XA 3FDSA 4JK1A 5DQHA 5KFEA 5HR7A 1ZRMA 4P4OA 2JV3A 1ZD3A 3UM9A 3PNCA 1DK2A 9ICHA 1U49A 1S0MA 2WF9A 4QJFB 4UASA 3AUOA 4DOAA 2RRDA 1WWVA 4UARA 1YZ6A 2NRVA 5KFVA 3V7JA 4O9MA 5J0TA 4DSFA 2K8CB 2UVWA 3EPGA 1N61A 4KLSA 2IHNA 4ECUA 3BQ0A 2YMPA 1KFSA 2RQ5A 4Y2RA 2Y1IA 2A1JA 2F76X 2HVHA 1TK5A 4K4HA 4O3NA 5J0WA 2PFQA 2Y9UA 4FE3A 1NK0A 1BNOA 3ZDAA 2WF5A 4NM2A 5DG7A 3RBEA 4BGDA 3T79A 5KFIA 3RH6A 2NRZA 3IM1A 4YR0A 2P6RA 1SL0A 4QZDA 4K4GA 3IRUA 3PSIA 3F53A 1D9DA 4C80A 3HILA 3OJUA 1K5OA 1JXLA 3IG8A 3H8SA 4EBEA 5BPCA 5J2HA 1MSWD 2W54A 3PV8A 4EZ9A 1XU4A 2ISOA 7ICQA 5HP4A 4E0DA 2GH1A 5AKYA 3T5LA 3QU4A 4RT3A 3MR2A 5D4BA 3PSTA 2XIDA 2A1AA 3Q8SB 3IHQB 4DS5A 3H8MA 3WKCA 4QWEA 2VANA 5AKIA 5IIOA 1S0VA 4DQQA 2H3VA 4R63A 1S0OA 1T3QA 3TADA 3UQ0A 3T5HA 1X9WA 2QARB 1RYUA 5L1LA 2LPEA 5DB7A 4US9A 2F77X 2JZBB 1Q3UA 2KVSA 3ONNA 5AKZA 5L1JA 2JEIA 9ICJA 2NRTA 4RNNA 2VJ5A 2FPMA 5HMMA 2R8JA 4M2YA 3JPOA 5JUMA 4R65A 3BQ7A 3MR3A 3QUCA 4M9HA 3LYSA 5KG3A 3ZDCA 4KMUA 2N1RA 3BQ2A 2G5HB 5ALUA 1K1SA 3QXGA 2EZXA 3RTVA 4I2BA 2UVUA 2MRLA 7ICFA 4Q8EA 4F5PA 2DKXA 1NK7A 1CI4A 1L5UA 1WYGA 5H2FU 2KHVA 5KFZA 2HCFA 1O08A 1ZQOA 2EANA 5KFUA 2MUTA 1SL2A 1U47A 3PX4A 2ZTEA 2FDRA 2BQUA 2DKZA 3PR4A 5KAFU 4M9NA 4F2RA 3M1YA 3WKDA 3BJYA 2JGAA 1D8YA 2KHQA 1Z19A 1FEZA 4P0PB 2HHTA 2H3ZA 4Q43A 4J9NA 2PI5A 3K1RB 5ALEA 5KNIA 3VCBA 3FYHA 4C8NA 7ICGA 1JI7A 2BQRA 4CCHA 2KMDA 2IOHA 1NZPA 3GV7B 4MF8A 4TURA 1NKCA 2KSOA 1IV8A 3C21A 1QSLA 4PJ0U 3UXPA 1COKA 1C7YA 4PGXA 3CNHA 4PGYA 5ALXA 2IOFK 4USAA 9ICIA 1PK3A 4ECYA 4F71A 3HWTA 1BPBA 5DQGA 5L1KA 4FZNA 4F72A 9ICLA 4X5VA 5A0LA 3Q8LA 4IL6U 4OD0A 5AK6A 1ZQZA 1X9SA 8ICSA 1X2IA 4KLQA 5ALTA 3D2QA 3WK5A 4DO9A 1KSPA 4O3MA 4M9GA 4YG2A 4NLGA 5IIKA 1DGSA 1S76D 1N56A 2M9NA 2JXJA 2WB1C 1Q8KA 8ICYA 1J2MA 5J8YC 2ODGA 4F5QA 3RB3A 3ORYA 2KP7A 4DL4A 1ZQDA 4RUAA 4CRXA 4Y2YA 1ZQLA 2HOQA 4M9JA 5GTIU 1NKBA 4G9BA 3RJIA 2XC9A 3PR5B 2PFOA 3RB4A 4DSJA 2LYHA 2I1QA 4FS1A 1B4FA 4C7YA 1JX4A 2ISPA 1KDHA 4UQGA 7ICJA 1KLNA 4QWBA 5DLFA 4C7ZA 1ZQTA 3JPQA 5EWFA 3C5FA 1Z00B 1ZQFA 2JH1A 1RZTA 5HHIA 4PL2A 1L3UA 3RH4A 4TUQA 5AI4A 2JEFA 2K4EA 4EBCA 3K75D 1ZQKA 1PVPA 4DCCA 4FO6A 3B0XA 2BGWA 2YN4A 4ED3A 2NV3A 1ZQRA 4F5RA 2XGPA 1T94A 5AM4A 4I2HA 2K8AA 3MFHA 4RQMA 3HP6A 4I2AA 2QARA 4MFFA 2CN1A 5CHGA 3NTUA 3HT3A 2GO7A 5L1MA 4O3PA 4NY8A 1ZQQA 3IG5A 3PW5A 1RM6C 5AKJA 1TAUA 1N2XA 1NK9A 5F3XB 3ALRA 2ZIWB 1CEZA 4F8RA 4M47A 3PSFA 4RQ0A 2Y1JA 2MAXA 1SKSA 1U9LA 4O5CA 4KLMA 4JUZA 4RQ2A 2HHXA 3OSPA 8ICOA 4YR3A 5EOZA 4ECVA 1GO3F 4F4KA 3GV8B 3F5AA 4J9RA 3QZ8A 2H3QA 5E79U 4YMNA 2AU0A 1LB2B 2DPIA 1Y88A 3RJFA 2LBOA 3RJKA 4KLDA 3T3FA 1SXEA 2DPJA 1MA7A 4DOBA 1NJYA 1ZQPA 1ZJMA 1N63A 4LZDA 4TQSA 4QZEA 9ICTA 3BQTA 3KD3A 3DV9A 4I2JA 2LHTA 1KFTA 5AI6A 1WUDA 3I1YA 1A6SA 5KFGA 2W7PA 5J2KA 4NM1A 2DF4B 2KZ3A 4O5KA 5AIAA 2ES6A 3RRHA 9ICVA 4UAVA 2KTQA 5J2EA 3HX0A 3MR5A 3QNMA 4FS2A 5J2GA 3BS7A 5B66U 5KG4A 1UQVA 3UMCA 1A77A 5ALOA 3N4MB 4KITB 5ALFA 2G07A 3Q8RB 3ISCA 4JWNA 7ICEA 7ICRA 1TAQA 2H3FA 3K4GA 3JPNA 5ALJA 4US8A 2W9BA 3AMZA 2YB1A 2E1EA 5DBAA 3QUTA 3JPRA 4OJLA 4PL1A 3E58A 4YQWA 4M6WB 4BUGA 4R66A 1XO1A 5J0PA 8ICVA 3QU2A 1SKWA 3SAHA 1XO0A 3E2EA 1WG8A 2CRXA 3Q8MA 2HVIA 4RPZA 3A0BU 1L7PA 3MR6A 3EUB2 2D3DA 2FJ6A 2KFZA 3WKAA 1SV0C 1TKDA 1ED1A 1FFVA 3EWAA 4A8EA 3TI0A 2AGPA 4GIBA 3N7SC 4RUCA 3CW2C 1Z3EB 5KFAA 4MFAA 3BS5A 4P4PA 3E0FA 1BPEA 5CR0A 1PVQA 7ICVA 1HUOA 4DFDA 4C8OA 2QB0A 3RJGA 3V7LA 2M0NA 1AROP 3IP4B 2ZIUB 5J0YA 4UB5A 1XC9A 2B21A 4ECZA 1B43A 2QKQA 2PI4A 2XY7A 1L7NA 5KT2A 8ICBA 3SQIA 1ZQWA 5KG1A 2H5XA 5AKXA 5KT7A 4Y2UA 4PHDA 5KL8B 5HR6A 1FIQA 1QLNA 3PX0A 3HW8A 4BWMA 2AXTU 5KFQA 3N7PD 1JXEA 2J6TA 2RHFA 2YQEA 3B0YA 3R9KA 8ICZA 9ICEA 3GFKB 4KLIA 5ALIA 1VDVA 2DFLA 1LKYB 1NZBA 1BNPA 5KFSA 1QQ7A 5CP2A 3LWLA 2C2DA 5J0UA 8ICEA 3UPQA 4QZFA 3KKAA 5AK4A 1S10A 2KG5A 4LZGA 4BJQA 2ZIUA 3AN1A 1SIJA 3RF9A 8ICPA 4FBUA 5JU5A 4DF4A 3F5EA 1UT5A 1KEJA 3FAHA 4Y2PA 4UAZA 2F1HA 4O3RA 4QIWF 2G09A 1COOA 1NJWA 2R8IA 3NVWA 9ICAA 1C20A 2HMXA 5CEHA 2A3VA 3RFAA 2Q0ZX 4C4TA 5DB8A 4CNQA 1X9MA 2KE7A 4ELVA 2OH2A 2LI6A 3HJEA 4NWIA 1L6NA 4DWIA 1QQ6A 4IQUA 5AM2A 5KG6A 3MFIA 5ALNA 4C8KA 1CUKA 4YMOA 3VC8A 5CB1A 5KFYA 1DGJA 2F2AB 4ECTA 4IRDA 4IR9A 5DDMA 3NS1A 2OXOA 3MDCA 5ALVA 3T5JA 5EWEA 2HBMA 2QB1A 4EENA 3LVWA 2AH5A 3QZ7A 4F50A 2ESEA 2UVRA 5G5HA 4J9MA 4YD2A 4UBBA 1KN5A 2BDPA 4C8LA 2FE9A 2HBJA 3LVVA 4QW9A 1D8BA 3IV6A 4LJXA 1PZNA 1ZD2P 9ICCA 3MC1A 3MGHA 3F2CA 3G6YA 8ICIA 4DSEA 2XVTA 2AQ4A 2W9AA 4ECSA 1RYSA 1NOMA 1ZD5A 1YT3A 9ICWA 3L5KA 5KFKA 4B9UA 4F92B 2E8PA 2W9BB 2E8NA 4KLEA 4GLXA 3PMLA 4ED7A 7ICPA 2BCSA 8ICGA 2ZJAA 1Q3VA 9ICRA 1RQLA 4M6WA 1LKYA 4F2SA 4RNOA 1BVSA 7ICNA 3GDXA 3BZCA 1L8OA 4Z6FA 2YMLA 2RLTA 2FI1A 3PSPA 2VA3A 3SEIA 4NLKA 2NYVA 2W04A 3H0LB 4QZIA 3QU7A 4DOCA 5CA7A 3GU3A 1N60A 1UA1A 5DQIA 2EAPA 2ZUCA 4ELUA 5C5JA 1TFRA 2WFAA 5J2BA 2Q4TA 3OGUA 2MUTB 2PXIA 1NK5A 1S9FA 4FFDA 4P4MA 5AKKA 4UB4A 4KTQA 3AL0B 2LMRA 2B6GA 3F2DA 3GIJA 1ZQSA 1RQNA 9ICSA 9ICGA 4UB3A 2YY6A 1KW4A 7ICOA 1FFUA 2F1JA 2NRWA 3ZDBA 5AI8A 5GTHU 2MA1A 2PMZF 4I28A 4EYIB 4DSIA 1QSSA 5J2IA 1U48A 3PVXA 4UB6U 2A19A 2EZZA 2I5HA 3KHLA 5ALQA 2JRZA 4KMOB 3QU5A 4YVZA 1ZQXA 4I2EA 2BHNA 5TZVA 3C29A 3EW9A 2W3SA 1JMSA 3N28A 4RPYA 1T7PA 5KG7A 4FBTA 1K1QA 5AK3A 5DB6A 1WWUA 3SMVA 2XY6A 2JEGA 1LV5A 5CJ7A 2BKEA 4YP3A 2G08A 4KLFA 2WF6A 4G3IA 4KLUA 4MF2A 3L3FX 1U45A 4O3QA 4B9MA 2IHMA 4CF5A 1DRGA 1OUQA 4I2IA 2DGZA 4JV0A 3N97B 4I2FA 5KFJA 2IA6A 4Z6DA 4Z6CA 3TFSA 3PW2A 4J03A 4KN7A 4UBCA 4DQRA 2GLEA 5L9XA 3SZ2A 4DQSA 2OYYA 4DFPA 4BWJA 3RR8A 2LM1A 3PY8A 1KFDA 4RPXA 3SAFA 1ZOLA 4YCXA 4KX5A 4FZLA 4DS4A 5ALDA 3WK4A 1Z4OA 4EX7A 2HW3A 2K4HA 4DEZA 5ALYA 5KL1B 5KT5A 2C28A 1J97A 4M9LA 8ICKA 4OJPA 4UW9A 4YFKA 1UA0A 3N7RC 2KZMA 1Z00A 3D2NA 1UCVA 2EZYA 1XSNA 5KFXA 4DL7A 4ECRA 3D2SA 3C2KA 8ICXA 4JB3A 5AICA 3MBYA 3ETRA 4ACOA 2W9CB 4DQIA 7ICHA 1JUDA 3SYZA 3O0FA 4ED0A 4O3SA 4DSLA 4DL2A 3UXOA 3TKAA 2HOIA 5BOMA 1ZQEA 4I27A 2KJ5A 1DXSA 5ALPA 4IS7A 1QSYA 1PUZA 3V72A 1JALA 3GZFA 5AKEA 4QZ9A 2BCUA 3M6ZA 4RQ8A 4RT2A 4UAYA 2KFNA 5KAIU 2FLPA 2KNJA 4ECXA 5KFTA 3M9OB 5TISU 7ICUA 2FLLA 1WCNA 4C0ZA 4GXKA 3NRWA 2PMZC 4CDGA 1NJXA 1ZQUA 4QIWC 4J9SA 5AM0A 5IILA 3PO4A 3KBBA 2W8KA 4RQ3A 2OM6A 2XO7A 3NRZA 4TQRA 4J9PA 3L4PA 4B9TA 3H8WA 4AYBF 1TVAA 3NVYA 1ZQ1C 1XS9D 1BPDA 2K8BB 2CXYA 3PO5A 5KFCA 5DG9A 1ZJNA 1URJA 2XCAA 4K4IA 1X42A 2G0AA 3QE9Y 3QYPA 3JPPA 4MFCA 4KLJA 3H0MB 2ASLA 1ZQCA 5AHXA 4Q44A 5KFLA 4QZHA 2NO5A 2OHFA 2E1FA 4P0PA 4ZOHC 5AK5A 2ZTCA 3EPIA 4I2GA 4TUSA 2F8LA 3JPSA 4QWAA 1UPHA 7ICIA 4Y2QA 2R8GA 4ECQA 1IXRA 4UB1A 3ISBA 2WF7A 3TARA 2BCVA 4ELTA 4F4YA 3C28A 3M9NB 1Z1BA 1L3VA 4ED1A 1U4BA 1T4GA 7ICSA 4B9NA 4NJ8A 4CF4A 4XA5A 3Q8QB 1DOQA 1KRPA 1ZQYA 3LDAA 4PGQA 9ICMA 5J2FA 5EE3A 1ZQVA 3Q8PB 3RRGA 4IQWA 2VKQA 5CWRA 3RAQA 5J2CA 3GIKA 4GFJA 3WK7A 2J6SA 1L7OA 1F5SA 3V6JA 4R8UA 5JTIA 3BDPA 2IBKA 1P7DA 3C2LA 2E8MA 3MABA 4NLZA 3EZ5A 1ZETA 3OHAA 5KTQA 2ATLA 2ASJA 5AI9A 5IINA 1NJZA 5KFPA 2HHUA 3SAGA 5AI0A 4YXMA 4KLHA 5J0QA 4KLOA 4GXJA 1V85A 3WK6A 1B22A 3WU2U 1ZQIA 2L5YA 3AM9A 4F93B 5DGBA 4DLGA 1KTQA 1OW5A 4QNLA 3CYMA 4Y2TA 4BDPA 2LYAA 1IIPA 3ED5A 8ICAA 1NNLA 2Z7JA 3ZD8A 3RJEA 2EQYA 2KKPA 9ICKA 4YXJA 2JHDA 3GV5B 3KHHA 4MEXA 3ETLA 4JV1A 3DDHA 5FP0A 4Z6EA 3HRDD 2FLNA 5D49A 4C4RA 4CF3A 1X9XA 2WB1F 3H0RB 3M6KA 7ICMA 2BDUA 4Y2JA 5KFOA 4M0AA 5J0OA 5KFWA 2WTFA 4DL3A 5EWGA 2BCQA 3QEBZ 4QZCA 1L3TA 3V6KA 1SXDA 2XY5A 3ZDEA 3KOOA 2ZTDA 4DFJA 4EX6A 4IQVA 5AI5A 3TANA 1ZQJA 2ASDA 2KKVA 2Y0SF 1IG6A 3KZXA 4U7CA 2QB0B 5ALKA 2IMWP 4RZRA 5ALWA 4JWMA 2KV2A 2F8KA 2ZIVA 2XCPA 3GIIA 3J81j 4OCZA 3H4DA 4MHVA 5CRXA 4QWDA 3I76A 3OSNA 5DBBA 3V6HA 4IC9A 4QZBA 3F2BA 1NI3A 1V9PA 1D8LA 2HSZA 3C1YA 2PKEA 1VLBA 5DG8A 4RQ4A 5ALRA 5JRTA 1Q46A 8ICFA 2PFPA 3AEVA 3SD7A 4DSKA 1QTMA 5ALSA 4RQ7A 2DWQA 2WAQF 4F4WA 4PZOA 2VA2A 5J0SA 8ICLA 2HDOA 5B5EU 4ICAA 5G5GA 4HAIA 5DLGA 4DF8A 3KHRA 2HHQA 3PW0A 1ZQNA 5J29A 4XRHA 2YMMA 4ED8A 4DFKA 5IIIA 2ZG6A 2BPCA 2W43A 2P66A 1ZQGA 1S8OA 1SWVA 3QUBA 2KVCA 4EEKA 2E8OA 2EAMA 3LK9A 2W9MA 9ICFA 8ICWA 1RPLA 5J0RA 4LVSA 3TAQA 1S77D 4AYBC 2HHSA 4P0QA 5J2AA 3AQEA 3NGDA 3SI8A 1S97A 3U26A 9ICUA 1ZQBA 4O0IA 4ECWA 4WJ3B 3NVZA 2O6KA 3UMGA 3RB0A 3OPXA 9ICPA 2NO4A 1Z1VA 2W8LA 2BCRA 3C23A 3MDAA 2P6UA 2UVVA 4IRKA 4PH5A 4PHEA 2KK0A 4J9LA 1NKEA 2E5SA 3RBDA 2MU2A 3H4BA 3HPOA 4OJ5A 3QU9A 5J8YA 2V4QA 1PVRA 3WKEA 2RDJA 3UMBA 3DEEA 3NASA 2JH7A 2ZJ8A 7ICTA 3H40A 8ICQA 5L1IA 2DBYA 2KD1A 4ZH4A 4P0QB 5HHHA 1DK3A 3HKZF 2ZIXA 4B9VA 2J6UA 2WF8A 1FO4A 4FZMA 4NXZA 2EH9A 2K4PA 2B0CA 5DGAA 2D8CA 1N48A 4JV2A 1MQ3A 5AM3A 7ICLA 4DL6A 8ICNA 5DBCA 1SB3C 1XSPA 1T8EA 4I2CA 1JROA 4GC6A 4DFMA 2ZUBA 2C2EA 2JZBA 1SL1A 4KLLA 3GILA 3QX7A 3FM9A 1ZXIA 1MQ2A 1BPXA 1RYRA 1J2NA 2E3TA 1A0PA 2PFNA 8ICTA 3AU2A 2ZIWA 4C8MA 3OJSA 1QQ5A 3ZI4A 5IIMA 3CP8A 3SV4A 2AGOA 2HHVA 1SV4A 2DQNB 3G6VA 2V9WA 1JN3A 8ICRA 4EZ6A 4O3OA 1AQ6A 2W11A 1RXWA 4RQ5A 3BQ1A 1UT8A 3RAXA 3ZD9A 4CE6A 3Q8KA 2ZXIA 2FPKA 4UB2A 4JMUA 4YD1A 3A0HU 1S5LU 2HI0A 1EXNA 1TV9A 5KFHA 1X66A 3KHGA 1RXVA 2VJ4A 4HYKA 1O03A 2RDIA 1L8LA 4YN4A 4XQ8A 5AKLA 4F91B 2KJ9A 5EE0A 4MEYA 5KFRA 2WHEA 1MC8A 2JEJA 1N5WA 2XICA 2GOLA 3AU6A 4UAWA 4F4ZA 5J2JA 4NL9C 5EE9A 2JR5A 1N5XA 2ZIVB 2HOFA 3HKZC 2H3IA 2HBKA 5IIJA 3PMNA 4PPXA 4R8UB 5F9NA 2CPRA 2KOBA 5KFDA 4KLTA 5DDYA 2HHWA 2I9GA 2W7OA 4UATA 3S6JA 4J9QA 4PZNA 4QW8A 4B9LA 9ICBA 2D6FC 2YTUA 3ICXA 2XI9A 4KX3A 2NRXA 1HEKA 5J2DA 1ZYQA 4RQ1A 1F44A 4EELA 2G5IB 2BPGA 2KZZA 3PW4A 4BXOA 4GXIA 7ICKA 3GQCA 2ZIXB 2Y9TA 4IR1A 3KKAC 3GIMA 1X6IA 2LYBA 2F1IA 2K60A 5ALHA 3FC4A 2Y0SC 2KSOB 5K4LA 2KIVA 4Y2SA 2VIXA 4DL5A 2IOFA 9ICQA 4EEYA 4NV0A 9ICNA 5AIBA 2DUYA 4BXOB 2GWSA 1M6YA 4J9KA 4KLGA 4YMMA 1SGGA 4RNMA 9ICXA 3K1ZA 2VA8A 3IN5A 1RDFA 1L7MA 3UQ2A 2YX8A 2OWOA 3OHBA 3SENA 3RJHA 3OTQA 1IM4A 1OXJA 1XNSA 4O5EA 2ALZA 3TADC 3CRXA 2LM4A 5DB9A 3ISDA 1YZ7A 1ZRNA 1PK1A 5AM1A 1N62A 4OJ6A 3C1ZA 4NLBA 5KFMA 4AP9A 2ZJ5A 3TAPA 2FPLA 3EYZA 2BQ3A 2BPFA 4QZGA 2AJQA 4ED6A 1V38A 1L3SA 4Q8FA 2I6XA 3RH5A 1TAMA 5AM5A 4F5OA 2C22A 1TK8A 1JRPA 5ALGA 5KFNA 3KTQA 5KG0A 2XGQA 5HNKA 4R64A 3AQFA 3LWMA 3T5KA 2ZUDA 3WK8A 3TQ1A 4CGZA 3NUQA 3M9MB 2C2RA 2W9CA 2YMQA 1SV0A 1TK0A 4B6JA 2YB4A 5F9LA 4RU9A 1SWWA 1HJPA 4F3OA 1KQQA 3C2MA 4GC7A 4C4SA 2OEHA 3TFRA 5J0XA 3IDWA 5KG2A 4ED2A 1NK6A 2F3NA 2FMPA 1QCKA 4QZ8A 4Q45A 1Z4NA 5KG5A 2KJ8A 1UHUA 4RQ6A 3SV3A 1T3NA 1XSLA 1KL9A 1F0MA 2WAQC 4YR2A 1B0XA 4PHPA 4I2DA 4UAUA 5HMLA 8ICMA 1KBUA 5KT4A 2K89A 2KICA 2W03A 3SR6A 1TE2A 8ICUA 1JIHA 4B9SA 3M7DA 4RQNA 3ZDDA 4IQTA 1HUZA 2DL0A 1SZPA 3M8SA 1ZD4A 2FMSA 1BPZA 1MN8A 5DKWA 1XWLA 5BOLA 3QEAZ 2P35A 1ZQAA 5ALLA 4BX9C 3I28A 5D46A 3MGVA 3UXNA 3KFUF 2AGQA 2BR0A 5T14A 1SZHA 2QLTA 2BZFA 4U6PA 4NL9A 2LKYA 1X6JA 4M04A 3RB6A 4NLNA 4Y2VA 4TUPA 2AHOB 3B9JA 8ICHA 3RR7A 4EYHB 3H8JA 2V4RA 3H7IA 1WCLA 4DQPA 1RG6A 2F44A 1PK1B 3D6JA 3M8RA 2KN7A 3C5GA 3MGIA 2KIWA 5C0YA 5EE1A 1SKRA 4QZAA 4Y2XA 1S0NA 5KT3A 4UB8U 4OO1J 8ICCA 1KKXA 3WKBA 1ECWA 2FMQA 2K4IA 2JMGA 4KN4A 2OCEA 3THVA 5KT6A 2RP5A 1ZQMA 4I29A 1BGXT 2EAOA 3KZIU 4F5NA 4XUSA 1H38A 2ZXHA 1LVHA 1NK8A 3PW7A 5ALMA 8ICJA 5KFFA 2W3RA 2W55A 1CRXA
chains in the Genus database with same CATH topology
4OJOA 2DGZA 2G06A 3K1ZA 2ZXIA 3SAHA 3IN5A 2HBLA 2WB1C 3PSFA 2VKQA 1XO0A 4JMUA 3PSIA 3F53A 4QIWF 2KEYA 2KKVA 2KNJA 2Y0SF 4GFJA 3KZXA 2YX8A 1KBUA 2CRXA 2K89A 4U7CA 3IG8A 2G09A 2E5SA 2KICA 2W03A 3PZPA 2KV2A 4CRXA 2OYYA 1P7DA 3M7DA 2ZIVA 3PSPA 2HOQA 2HMXA 2R18A 4C0ZA 1XNSA 1HIWA 3NRWA 1GO3F 2A3VA 2PMZC 3RFAA 3F5AA 4CDGA 1ED1A 2VJ4A 2W04A 2JGAA 3H0LB 4OJ5A 3CRXA 5CRXA 4A8EA 4QIWC 2H3QA 1PVRA 2KHQA 2GH1A 3GU3A 4IC9A 3DEEA 3SAFA 3F2BA 2OH2A 4NWIA 3N7SC 2LBOA 1Z19A 1L6NA 2JH7A 2OM6A 4KX5A 4FZLA 4P0PB 2H3ZA 3PSTA 2KJ9A 4BX9C 2XIDA 3SAGA 1MA7A 4OJ6A 3MGVA 2KD1A 3E0FA 4NLBA 3VCBA 4AYBF 3KFUF 4P0QB 3HKZF 1PVQA 3VC8A 5T14A 1SZHA 1ZQ1C 2ZIXA 4NLCA 2K8BB 2XICA 2F2AB 4U6PA 2GOLA 2H3VA 2LKYA 4FZMA 5HR7A 2K4HA 2JH1A 2Q4TA 1TAMA 2LHTA 2M0NA 3IP4B 2OXOA 1WUDA 2ZIUB 2ZIVB 2HOFA 3HKZC 4QNLA 2HBMA 3CYMA 2H3IA 2WAQF 2HBKA 1A6SA 3LVWA 4PL2A 5KL1B 2W7PA 2F77X 2CPRA 1Q3UA 2KOBA 2K4EA 1URJA 2DF4B 3ONNA 4OJPA 2LYAA 1IIPA 4ICAA 3SQIA 3AL0B 2W7OA 2Z7JA 3N7RC 4QJFB 1PVPA 2G0AA 3F2DA 3AQFA 5KL8B 2D6FC 2RRDA 5HR6A 2KIWA 3D2NA 5C0YA 2VJ5A 4CGZA 2KKPA 2HBJA 3ICXA 2XI9A 3LVVA 3NUQA 4KX3A 1D8BA 2JHDA 2NV3A 1HEKA 3N7PD 3D2SA 1F44A 4OO1J 3H0MB 2G5IB 2YB4A 2MA1A 2PMZF 2RHFA 2ZG6A 1T94A 3F2CA 1ECWA 2E1FA 2G07A 2K8CB 4ACOA 4P0PA 2K4IA 2K8AA 2JMGA 2ZIXB 2H3FA 2XVTA 4FZNA 1OUQA 2KVCA 2CN1A 3LYSA 1NZBA 5A0LA 3O0FA 2F8LA 1A0PA 2N1RA 2WB1F 4KMOB 2LYBA 2RP5A 3H0RB 1UPHA 2G5HB 3M6KA 2ZIWA 3C29A 2Y0SC 2F76X 2YB1A 1YT3A 2BDUA 2VIXA 2MRLA 2E1EA 4AYBC 3CP8A 2ZXHA 3D2QA 3OPXA 3AQEA 4P0QA 2HOIA 2DQNB 4OJLA 4NV0A 3SMVA 4PL1A 4FE3A 2KJ8A 4O3MA 3IG5A 3C28A 4BJQA 1Z1BA 2KJ5A 2ZIUA 2G08A 2KHVA 2WAQC 3T79A 4WJ3B 4BUGA 3RF9A 3L3FX 3GZFA 1Q3VA 3M6ZA 1CRXA 3F5EA 1DRGA 3ALRA 2ZIWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBO A;  2JH7 A;  2JH1 A;  2JHD A;  3F5E A;  3F53 A;  3F5A A; 
#chains in the Genus database with same CATH topology
 4OJO A;  2G06 A;  1BPY A;  2HBL A;  4DLE A;  1V97 A;  5AKG A;  3V7K A;  1QH9 A;  3WK9 A;  5ALZ A;  2KEY A;  2AQ0 A;  3PZP A;  3TAC B;  3BS5 B;  9ICO A;  4EBD A;  3BZK A;  1ZQH A;  3PX6 A;  2R18 A;  1D9F A;  1HIW A;  1VJ5 A;  2MSN A;  3JPT A;  2R8K A;  5AKH A;  4F4X A;  3RJJ A;  3QUQ A;  2R8H A;  4J9O A;  2EDU A;  1X40 A;  4PHA A;  1A76 A;  3NVV A;  4QWC A;  5KFB A;  4P2H A;  2A1J B;  1NK4 A;  4IRC A;  4NLC A;  3G6X A;  3FDS A;  4JK1 A;  5DQH A;  5KFE A;  5HR7 A;  1ZRM A;  4P4O A;  2JV3 A;  1ZD3 A;  3UM9 A;  3PNC A;  1DK2 A;  9ICH A;  1U49 A;  1S0M A;  2WF9 A;  4QJF B;  4UAS A;  3AUO A;  4DOA A;  2RRD A;  1WWV A;  4UAR A;  1YZ6 A;  2NRV A;  5KFV A;  3V7J A;  4O9M A;  5J0T A;  4DSF A;  2K8C B;  2UVW A;  3EPG A;  1N61 A;  4KLS A;  2IHN A;  4ECU A;  3BQ0 A;  2YMP A;  1KFS A;  2RQ5 A;  4Y2R A;  2Y1I A;  2A1J A;  2F76 X;  2HVH A;  1TK5 A;  4K4H A;  4O3N A;  5J0W A;  2PFQ A;  2Y9U A;  4FE3 A;  1NK0 A;  1BNO A;  3ZDA A;  2WF5 A;  4NM2 A;  5DG7 A;  3RBE A;  4BGD A;  3T79 A;  5KFI A;  3RH6 A;  2NRZ A;  3IM1 A;  4YR0 A;  2P6R A;  1SL0 A;  4QZD A;  4K4G A;  3IRU A;  3PSI A;  3F53 A;  1D9D A;  4C80 A;  3HIL A;  3OJU A;  1K5O A;  1JXL A;  3IG8 A;  3H8S A;  4EBE A;  5BPC A;  5J2H A;  1MSW D;  2W54 A;  3PV8 A;  4EZ9 A;  1XU4 A;  2ISO A;  7ICQ A;  5HP4 A;  4E0D A;  2GH1 A;  5AKY A;  3T5L A;  3QU4 A;  4RT3 A;  3MR2 A;  5D4B A;  3PST A;  2XID A;  2A1A A;  3Q8S B;  3IHQ B;  4DS5 A;  3H8M A;  3WKC A;  4QWE A;  2VAN A;  5AKI A;  5IIO A;  1S0V A;  4DQQ A;  2H3V A;  4R63 A;  1S0O A;  1T3Q A;  3TAD A;  3UQ0 A;  3T5H A;  1X9W A;  2QAR B;  1RYU A;  5L1L A;  2LPE A;  5DB7 A;  4US9 A;  2F77 X;  2JZB B;  1Q3U A;  2KVS A;  3ONN A;  5AKZ A;  5L1J A;  2JEI A;  9ICJ A;  2NRT A;  4RNN A;  2VJ5 A;  2FPM A;  5HMM A;  2R8J A;  4M2Y A;  3JPO A;  5JUM A;  4R65 A;  3BQ7 A;  3MR3 A;  3QUC A;  4M9H A;  3LYS A;  5KG3 A;  3ZDC A;  4KMU A;  2N1R A;  3BQ2 A;  2G5H B;  5ALU A;  1K1S A;  3QXG A;  2EZX A;  3RTV A;  4I2B A;  2UVU A;  2MRL A;  7ICF A;  4Q8E A;  4F5P A;  2DKX A;  1NK7 A;  1CI4 A;  1L5U A;  1WYG A;  5H2F U;  2KHV A;  5KFZ A;  2HCF A;  1O08 A;  1ZQO A;  2EAN A;  5KFU A;  2MUT A;  1SL2 A;  1U47 A;  3PX4 A;  2ZTE A;  2FDR A;  2BQU A;  2DKZ A;  3PR4 A;  5KAF U;  4M9N A;  4F2R A;  3M1Y A;  3WKD A;  3BJY A;  2JGA A;  1D8Y A;  2KHQ A;  1Z19 A;  1FEZ A;  4P0P B;  2HHT A;  2H3Z A;  4Q43 A;  4J9N A;  2PI5 A;  3K1R B;  5ALE A;  5KNI A;  3VCB A;  3FYH A;  4C8N A;  7ICG A;  1JI7 A;  2BQR A;  4CCH A;  2KMD A;  2IOH A;  1NZP A;  3GV7 B;  4MF8 A;  4TUR A;  1NKC A;  2KSO A;  1IV8 A;  3C21 A;  1QSL A;  4PJ0 U;  3UXP A;  1COK A;  1C7Y A;  4PGX A;  3CNH A;  4PGY A;  5ALX A;  2IOF K;  4USA A;  9ICI A;  1PK3 A;  4ECY A;  4F71 A;  3HWT A;  1BPB A;  5DQG A;  5L1K A;  4FZN A;  4F72 A;  9ICL A;  4X5V A;  5A0L A;  3Q8L A;  4IL6 U;  4OD0 A;  5AK6 A;  1ZQZ A;  1X9S A;  8ICS A;  1X2I A;  4KLQ A;  5ALT A;  3D2Q A;  3WK5 A;  4DO9 A;  1KSP A;  4O3M A;  4M9G A;  4YG2 A;  4NLG A;  5IIK A;  1DGS A;  1S76 D;  1N56 A;  2M9N A;  2JXJ A;  2WB1 C;  1Q8K A;  8ICY A;  1J2M A;  5J8Y C;  2ODG A;  4F5Q A;  3RB3 A;  3ORY A;  2KP7 A;  4DL4 A;  1ZQD A;  4RUA A;  4CRX A;  4Y2Y A;  1ZQL A;  2HOQ A;  4M9J A;  5GTI U;  1NKB A;  4G9B A;  3RJI A;  2XC9 A;  3PR5 B;  2PFO A;  3RB4 A;  4DSJ A;  2LYH A;  2I1Q A;  4FS1 A;  1B4F A;  4C7Y A;  1JX4 A;  2ISP A;  1KDH A;  4UQG A;  7ICJ A;  1KLN A;  4QWB A;  5DLF A;  4C7Z A;  1ZQT A;  3JPQ A;  5EWF A;  3C5F A;  1Z00 B;  1ZQF A;  2JH1 A;  1RZT A;  5HHI A;  4PL2 A;  1L3U A;  3RH4 A;  4TUQ A;  5AI4 A;  2JEF A;  2K4E A;  4EBC A;  3K75 D;  1ZQK A;  1PVP A;  4DCC A;  4FO6 A;  3B0X A;  2BGW A;  2YN4 A;  4ED3 A;  2NV3 A;  1ZQR A;  4F5R A;  2XGP A;  1T94 A;  5AM4 A;  4I2H A;  2K8A A;  3MFH A;  4RQM A;  3HP6 A;  4I2A A;  2QAR A;  4MFF A;  2CN1 A;  5CHG A;  3NTU A;  3HT3 A;  2GO7 A;  5L1M A;  4O3P A;  4NY8 A;  1ZQQ A;  3IG5 A;  3PW5 A;  1RM6 C;  5AKJ A;  1TAU A;  1N2X A;  1NK9 A;  5F3X B;  3ALR A;  2ZIW B;  1CEZ A;  4F8R A;  4M47 A;  3PSF A;  4RQ0 A;  2Y1J A;  2MAX A;  1SKS A;  1U9L A;  4O5C A;  4KLM A;  4JUZ A;  4RQ2 A;  2HHX A;  3OSP A;  8ICO A;  4YR3 A;  5EOZ A;  4ECV A;  1GO3 F;  4F4K A;  3GV8 B;  3F5A A;  4J9R A;  3QZ8 A;  2H3Q A;  5E79 U;  4YMN A;  2AU0 A;  1LB2 B;  2DPI A;  1Y88 A;  3RJF A;  2LBO A;  3RJK A;  4KLD A;  3T3F A;  1SXE A;  2DPJ A;  1MA7 A;  4DOB A;  1NJY A;  1ZQP A;  1ZJM A;  1N63 A;  4LZD A;  4TQS A;  4QZE A;  9ICT A;  3BQT A;  3KD3 A;  3DV9 A;  4I2J A;  2LHT A;  1KFT A;  5AI6 A;  1WUD A;  3I1Y A;  1A6S A;  5KFG A;  2W7P A;  5J2K A;  4NM1 A;  2DF4 B;  2KZ3 A;  4O5K A;  5AIA A;  2ES6 A;  3RRH A;  9ICV A;  4UAV A;  2KTQ A;  5J2E A;  3HX0 A;  3MR5 A;  3QNM A;  4FS2 A;  5J2G A;  3BS7 A;  5B66 U;  5KG4 A;  1UQV A;  3UMC A;  1A77 A;  5ALO A;  3N4M B;  4KIT B;  5ALF A;  2G07 A;  3Q8R B;  3ISC A;  4JWN A;  7ICE A;  7ICR A;  1TAQ A;  2H3F A;  3K4G A;  3JPN A;  5ALJ A;  4US8 A;  2W9B A;  3AMZ A;  2YB1 A;  2E1E A;  5DBA A;  3QUT A;  3JPR A;  4OJL A;  4PL1 A;  3E58 A;  4YQW A;  4M6W B;  4BUG A;  4R66 A;  1XO1 A;  5J0P A;  8ICV A;  3QU2 A;  1SKW A;  3SAH A;  1XO0 A;  3E2E A;  1WG8 A;  2CRX A;  3Q8M A;  2HVI A;  4RPZ A;  3A0B U;  1L7P A;  3MR6 A;  3EUB 2;  2D3D A;  2FJ6 A;  2KFZ A;  3WKA A;  1SV0 C;  1TKD A;  1ED1 A;  1FFV A;  3EWA A;  4A8E A;  3TI0 A;  2AGP A;  4GIB A;  3N7S C;  4RUC A;  3CW2 C;  1Z3E B;  5KFA A;  4MFA A;  3BS5 A;  4P4P A;  3E0F A;  1BPE A;  5CR0 A;  1PVQ A;  7ICV A;  1HUO A;  4DFD A;  4C8O A;  2QB0 A;  3RJG A;  3V7L A;  2M0N A;  1ARO P;  3IP4 B;  2ZIU B;  5J0Y A;  4UB5 A;  1XC9 A;  2B21 A;  4ECZ A;  1B43 A;  2QKQ A;  2PI4 A;  2XY7 A;  1L7N A;  5KT2 A;  8ICB A;  3SQI A;  1ZQW A;  5KG1 A;  2H5X A;  5AKX A;  5KT7 A;  4Y2U A;  4PHD A;  5KL8 B;  5HR6 A;  1FIQ A;  1QLN A;  3PX0 A;  3HW8 A;  4BWM A;  2AXT U;  5KFQ A;  3N7P D;  1JXE A;  2J6T A;  2RHF A;  2YQE A;  3B0Y A;  3R9K A;  8ICZ A;  9ICE A;  3GFK B;  4KLI A;  5ALI A;  1VDV A;  2DFL A;  1LKY B;  1NZB A;  1BNP A;  5KFS A;  1QQ7 A;  5CP2 A;  3LWL A;  2C2D A;  5J0U A;  8ICE A;  3UPQ A;  4QZF A;  3KKA A;  5AK4 A;  1S10 A;  2KG5 A;  4LZG A;  4BJQ A;  2ZIU A;  3AN1 A;  1SIJ A;  3RF9 A;  8ICP A;  4FBU A;  5JU5 A;  4DF4 A;  3F5E A;  1UT5 A;  1KEJ A;  3FAH A;  4Y2P A;  4UAZ A;  2F1H A;  4O3R A;  4QIW F;  2G09 A;  1COO A;  1NJW A;  2R8I A;  3NVW A;  9ICA A;  1C20 A;  2HMX A;  5CEH A;  2A3V A;  3RFA A;  2Q0Z X;  4C4T A;  5DB8 A;  4CNQ A;  1X9M A;  2KE7 A;  4ELV A;  2OH2 A;  2LI6 A;  3HJE A;  4NWI A;  1L6N A;  4DWI A;  1QQ6 A;  4IQU A;  5AM2 A;  5KG6 A;  3MFI A;  5ALN A;  4C8K A;  1CUK A;  4YMO A;  3VC8 A;  5CB1 A;  5KFY A;  1DGJ A;  2F2A B;  4ECT A;  4IRD A;  4IR9 A;  5DDM A;  3NS1 A;  2OXO A;  3MDC A;  5ALV A;  3T5J A;  5EWE A;  2HBM A;  2QB1 A;  4EEN A;  3LVW A;  2AH5 A;  3QZ7 A;  4F50 A;  2ESE A;  2UVR A;  5G5H A;  4J9M A;  4YD2 A;  4UBB A;  1KN5 A;  2BDP A;  4C8L A;  2FE9 A;  2HBJ A;  3LVV A;  4QW9 A;  1D8B A;  3IV6 A;  4LJX A;  1PZN A;  1ZD2 P;  9ICC A;  3MC1 A;  3MGH A;  3F2C A;  3G6Y A;  8ICI A;  4DSE A;  2XVT A;  2AQ4 A;  2W9A A;  4ECS A;  1RYS A;  1NOM A;  1ZD5 A;  1YT3 A;  9ICW A;  3L5K A;  5KFK A;  4B9U A;  4F92 B;  2E8P A;  2W9B B;  2E8N A;  4KLE A;  4GLX A;  3PML A;  4ED7 A;  7ICP A;  2BCS A;  8ICG A;  2ZJA A;  1Q3V A;  9ICR A;  1RQL A;  4M6W A;  1LKY A;  4F2S A;  4RNO A;  1BVS A;  7ICN A;  3GDX A;  3BZC A;  1L8O A;  4Z6F A;  2YML A;  2RLT A;  2FI1 A;  3PSP A;  2VA3 A;  3SEI A;  4NLK A;  2NYV A;  2W04 A;  3H0L B;  4QZI A;  3QU7 A;  4DOC A;  5CA7 A;  3GU3 A;  1N60 A;  1UA1 A;  5DQI A;  2EAP A;  2ZUC A;  4ELU A;  5C5J A;  1TFR A;  2WFA A;  5J2B A;  2Q4T A;  3OGU A;  2MUT B;  2PXI A;  1NK5 A;  1S9F A;  4FFD A;  4P4M A;  5AKK A;  4UB4 A;  4KTQ A;  3AL0 B;  2LMR A;  2B6G A;  3F2D A;  3GIJ A;  1ZQS A;  1RQN A;  9ICS A;  9ICG A;  4UB3 A;  2YY6 A;  1KW4 A;  7ICO A;  1FFU A;  2F1J A;  2NRW A;  3ZDB A;  5AI8 A;  5GTH U;  2MA1 A;  2PMZ F;  4I28 A;  4EYI B;  4DSI A;  1QSS A;  5J2I A;  1U48 A;  3PVX A;  4UB6 U;  2A19 A;  2EZZ A;  2I5H A;  3KHL A;  5ALQ A;  2JRZ A;  4KMO B;  3QU5 A;  4YVZ A;  1ZQX A;  4I2E A;  2BHN A;  5TZV A;  3C29 A;  3EW9 A;  2W3S A;  1JMS A;  3N28 A;  4RPY A;  1T7P A;  5KG7 A;  4FBT A;  1K1Q A;  5AK3 A;  5DB6 A;  1WWU A;  3SMV A;  2XY6 A;  2JEG A;  1LV5 A;  5CJ7 A;  2BKE A;  4YP3 A;  2G08 A;  4KLF A;  2WF6 A;  4G3I A;  4KLU A;  4MF2 A;  3L3F X;  1U45 A;  4O3Q A;  4B9M A;  2IHM A;  4CF5 A;  1DRG A;  1OUQ A;  4I2I A;  2DGZ A;  4JV0 A;  3N97 B;  4I2F A;  5KFJ A;  2IA6 A;  4Z6D A;  4Z6C A;  3TFS A;  3PW2 A;  4J03 A;  4KN7 A;  4UBC A;  4DQR A;  2GLE A;  5L9X A;  3SZ2 A;  4DQS A;  2OYY A;  4DFP A;  4BWJ A;  3RR8 A;  2LM1 A;  3PY8 A;  1KFD A;  4RPX A;  3SAF A;  1ZOL A;  4YCX A;  4KX5 A;  4FZL A;  4DS4 A;  5ALD A;  3WK4 A;  1Z4O A;  4EX7 A;  2HW3 A;  2K4H A;  4DEZ A;  5ALY A;  5KL1 B;  5KT5 A;  2C28 A;  1J97 A;  4M9L A;  8ICK A;  4OJP A;  4UW9 A;  4YFK A;  1UA0 A;  3N7R C;  2KZM A;  1Z00 A;  3D2N A;  1UCV A;  2EZY A;  1XSN A;  5KFX A;  4DL7 A;  4ECR A;  3D2S A;  3C2K A;  8ICX A;  4JB3 A;  5AIC A;  3MBY A;  3ETR A;  4ACO A;  2W9C B;  4DQI A;  7ICH A;  1JUD A;  3SYZ A;  3O0F A;  4ED0 A;  4O3S A;  4DSL A;  4DL2 A;  3UXO A;  3TKA A;  2HOI A;  5BOM A;  1ZQE A;  4I27 A;  2KJ5 A;  1DXS A;  5ALP A;  4IS7 A;  1QSY A;  1PUZ A;  3V72 A;  1JAL A;  3GZF A;  5AKE A;  4QZ9 A;  2BCU A;  3M6Z A;  4RQ8 A;  4RT2 A;  4UAY A;  2KFN A;  5KAI U;  2FLP A;  2KNJ A;  4ECX A;  5KFT A;  3M9O B;  5TIS U;  7ICU A;  2FLL A;  1WCN A;  4C0Z A;  4GXK A;  3NRW A;  2PMZ C;  4CDG A;  1NJX A;  1ZQU A;  4QIW C;  4J9S A;  5AM0 A;  5IIL A;  3PO4 A;  3KBB A;  2W8K A;  4RQ3 A;  2OM6 A;  2XO7 A;  3NRZ A;  4TQR A;  4J9P A;  3L4P A;  4B9T A;  3H8W A;  4AYB F;  1TVA A;  3NVY A;  1ZQ1 C;  1XS9 D;  1BPD A;  2K8B B;  2CXY A;  3PO5 A;  5KFC A;  5DG9 A;  1ZJN A;  1URJ A;  2XCA A;  4K4I A;  1X42 A;  2G0A A;  3QE9 Y;  3QYP A;  3JPP A;  4MFC A;  4KLJ A;  3H0M B;  2ASL A;  1ZQC A;  5AHX A;  4Q44 A;  5KFL A;  4QZH A;  2NO5 A;  2OHF A;  2E1F A;  4P0P A;  4ZOH C;  5AK5 A;  2ZTC A;  3EPI A;  4I2G A;  4TUS A;  2F8L A;  3JPS A;  4QWA A;  1UPH A;  7ICI A;  4Y2Q A;  2R8G A;  4ECQ A;  1IXR A;  4UB1 A;  3ISB A;  2WF7 A;  3TAR A;  2BCV A;  4ELT A;  4F4Y A;  3C28 A;  3M9N B;  1Z1B A;  1L3V A;  4ED1 A;  1U4B A;  1T4G A;  7ICS A;  4B9N A;  4NJ8 A;  4CF4 A;  4XA5 A;  3Q8Q B;  1DOQ A;  1KRP A;  1ZQY A;  3LDA A;  4PGQ A;  9ICM A;  5J2F A;  5EE3 A;  1ZQV A;  3Q8P B;  3RRG A;  4IQW A;  2VKQ A;  5CWR A;  3RAQ A;  5J2C A;  3GIK A;  4GFJ A;  3WK7 A;  2J6S A;  1L7O A;  1F5S A;  3V6J A;  4R8U A;  5JTI A;  3BDP A;  2IBK A;  1P7D A;  3C2L A;  2E8M A;  3MAB A;  4NLZ A;  3EZ5 A;  1ZET A;  3OHA A;  5KTQ A;  2ATL A;  2ASJ A;  5AI9 A;  5IIN A;  1NJZ A;  5KFP A;  2HHU A;  3SAG A;  5AI0 A;  4YXM A;  4KLH A;  5J0Q A;  4KLO A;  4GXJ A;  1V85 A;  3WK6 A;  1B22 A;  3WU2 U;  1ZQI A;  2L5Y A;  3AM9 A;  4F93 B;  5DGB A;  4DLG A;  1KTQ A;  1OW5 A;  4QNL A;  3CYM A;  4Y2T A;  4BDP A;  2LYA A;  1IIP A;  3ED5 A;  8ICA A;  1NNL A;  2Z7J A;  3ZD8 A;  3RJE A;  2EQY A;  2KKP A;  9ICK A;  4YXJ A;  2JHD A;  3GV5 B;  3KHH A;  4MEX A;  3ETL A;  4JV1 A;  3DDH A;  5FP0 A;  4Z6E A;  3HRD D;  2FLN A;  5D49 A;  4C4R A;  4CF3 A;  1X9X A;  2WB1 F;  3H0R B;  3M6K A;  7ICM A;  2BDU A;  4Y2J A;  5KFO A;  4M0A A;  5J0O A;  5KFW A;  2WTF A;  4DL3 A;  5EWG A;  2BCQ A;  3QEB Z;  4QZC A;  1L3T A;  3V6K A;  1SXD A;  2XY5 A;  3ZDE A;  3KOO A;  2ZTD A;  4DFJ A;  4EX6 A;  4IQV A;  5AI5 A;  3TAN A;  1ZQJ A;  2ASD A;  2KKV A;  2Y0S F;  1IG6 A;  3KZX A;  4U7C A;  2QB0 B;  5ALK A;  2IMW P;  4RZR A;  5ALW A;  4JWM A;  2KV2 A;  2F8K A;  2ZIV A;  2XCP A;  3GII A;  3J81 j;  4OCZ A;  3H4D A;  4MHV A;  5CRX A;  4QWD A;  3I76 A;  3OSN A;  5DBB A;  3V6H A;  4IC9 A;  4QZB A;  3F2B A;  1NI3 A;  1V9P A;  1D8L A;  2HSZ A;  3C1Y A;  2PKE A;  1VLB A;  5DG8 A;  4RQ4 A;  5ALR A;  5JRT A;  1Q46 A;  8ICF A;  2PFP A;  3AEV A;  3SD7 A;  4DSK A;  1QTM A;  5ALS A;  4RQ7 A;  2DWQ A;  2WAQ F;  4F4W A;  4PZO A;  2VA2 A;  5J0S A;  8ICL A;  2HDO A;  5B5E U;  4ICA A;  5G5G A;  4HAI A;  5DLG A;  4DF8 A;  3KHR A;  2HHQ A;  3PW0 A;  1ZQN A;  5J29 A;  4XRH A;  2YMM A;  4ED8 A;  4DFK A;  5III A;  2ZG6 A;  2BPC A;  2W43 A;  2P66 A;  1ZQG A;  1S8O A;  1SWV A;  3QUB A;  2KVC A;  4EEK A;  2E8O A;  2EAM A;  3LK9 A;  2W9M A;  9ICF A;  8ICW A;  1RPL A;  5J0R A;  4LVS A;  3TAQ A;  1S77 D;  4AYB C;  2HHS A;  4P0Q A;  5J2A A;  3AQE A;  3NGD A;  3SI8 A;  1S97 A;  3U26 A;  9ICU A;  1ZQB A;  4O0I A;  4ECW A;  4WJ3 B;  3NVZ A;  2O6K A;  3UMG A;  3RB0 A;  3OPX A;  9ICP A;  2NO4 A;  1Z1V A;  2W8L A;  2BCR A;  3C23 A;  3MDA A;  2P6U A;  2UVV A;  4IRK A;  4PH5 A;  4PHE A;  2KK0 A;  4J9L A;  1NKE A;  2E5S A;  3RBD A;  2MU2 A;  3H4B A;  3HPO A;  4OJ5 A;  3QU9 A;  5J8Y A;  2V4Q A;  1PVR A;  3WKE A;  2RDJ A;  3UMB A;  3DEE A;  3NAS A;  2JH7 A;  2ZJ8 A;  7ICT A;  3H40 A;  8ICQ A;  5L1I A;  2DBY A;  2KD1 A;  4ZH4 A;  4P0Q B;  5HHH A;  1DK3 A;  3HKZ F;  2ZIX A;  4B9V A;  2J6U A;  2WF8 A;  1FO4 A;  4FZM A;  4NXZ A;  2EH9 A;  2K4P A;  2B0C A;  5DGA A;  2D8C A;  1N48 A;  4JV2 A;  1MQ3 A;  5AM3 A;  7ICL A;  4DL6 A;  8ICN A;  5DBC A;  1SB3 C;  1XSP A;  1T8E A;  4I2C A;  1JRO A;  4GC6 A;  4DFM A;  2ZUB A;  2C2E A;  2JZB A;  1SL1 A;  4KLL A;  3GIL A;  3QX7 A;  3FM9 A;  1ZXI A;  1MQ2 A;  1BPX A;  1RYR A;  1J2N A;  2E3T A;  1A0P A;  2PFN A;  8ICT A;  3AU2 A;  2ZIW A;  4C8M A;  3OJS A;  1QQ5 A;  3ZI4 A;  5IIM A;  3CP8 A;  3SV4 A;  2AGO A;  2HHV A;  1SV4 A;  2DQN B;  3G6V A;  2V9W A;  1JN3 A;  8ICR A;  4EZ6 A;  4O3O A;  1AQ6 A;  2W11 A;  1RXW A;  4RQ5 A;  3BQ1 A;  1UT8 A;  3RAX A;  3ZD9 A;  4CE6 A;  3Q8K A;  2ZXI A;  2FPK A;  4UB2 A;  4JMU A;  4YD1 A;  3A0H U;  1S5L U;  2HI0 A;  1EXN A;  1TV9 A;  5KFH A;  1X66 A;  3KHG A;  1RXV A;  2VJ4 A;  4HYK A;  1O03 A;  2RDI A;  1L8L A;  4YN4 A;  4XQ8 A;  5AKL A;  4F91 B;  2KJ9 A;  5EE0 A;  4MEY A;  5KFR A;  2WHE A;  1MC8 A;  2JEJ A;  1N5W A;  2XIC A;  2GOL A;  3AU6 A;  4UAW A;  4F4Z A;  5J2J A;  4NL9 C;  5EE9 A;  2JR5 A;  1N5X A;  2ZIV B;  2HOF A;  3HKZ C;  2H3I A;  2HBK A;  5IIJ A;  3PMN A;  4PPX A;  4R8U B;  5F9N A;  2CPR A;  2KOB A;  5KFD A;  4KLT A;  5DDY A;  2HHW A;  2I9G A;  2W7O A;  4UAT A;  3S6J A;  4J9Q A;  4PZN A;  4QW8 A;  4B9L A;  9ICB A;  2D6F C;  2YTU A;  3ICX A;  2XI9 A;  4KX3 A;  2NRX A;  1HEK A;  5J2D A;  1ZYQ A;  4RQ1 A;  1F44 A;  4EEL A;  2G5I B;  2BPG A;  2KZZ A;  3PW4 A;  4BXO A;  4GXI A;  7ICK A;  3GQC A;  2ZIX B;  2Y9T A;  4IR1 A;  3KKA C;  3GIM A;  1X6I A;  2LYB A;  2F1I A;  2K60 A;  5ALH A;  3FC4 A;  2Y0S C;  2KSO B;  5K4L A;  2KIV A;  4Y2S A;  2VIX A;  4DL5 A;  2IOF A;  9ICQ A;  4EEY A;  4NV0 A;  9ICN A;  5AIB A;  2DUY A;  4BXO B;  2GWS A;  1M6Y A;  4J9K A;  4KLG A;  4YMM A;  1SGG A;  4RNM A;  9ICX A;  3K1Z A;  2VA8 A;  3IN5 A;  1RDF A;  1L7M A;  3UQ2 A;  2YX8 A;  2OWO A;  3OHB A;  3SEN A;  3RJH A;  3OTQ A;  1IM4 A;  1OXJ A;  1XNS A;  4O5E A;  2ALZ A;  3TAD C;  3CRX A;  2LM4 A;  5DB9 A;  3ISD A;  1YZ7 A;  1ZRN A;  1PK1 A;  5AM1 A;  1N62 A;  4OJ6 A;  3C1Z A;  4NLB A;  5KFM A;  4AP9 A;  2ZJ5 A;  3TAP A;  2FPL A;  3EYZ A;  2BQ3 A;  2BPF A;  4QZG A;  2AJQ A;  4ED6 A;  1V38 A;  1L3S A;  4Q8F A;  2I6X A;  3RH5 A;  1TAM A;  5AM5 A;  4F5O A;  2C22 A;  1TK8 A;  1JRP A;  5ALG A;  5KFN A;  3KTQ A;  5KG0 A;  2XGQ A;  5HNK A;  4R64 A;  3AQF A;  3LWM A;  3T5K A;  2ZUD A;  3WK8 A;  3TQ1 A;  4CGZ A;  3NUQ A;  3M9M B;  2C2R A;  2W9C A;  2YMQ A;  1SV0 A;  1TK0 A;  4B6J A;  2YB4 A;  5F9L A;  4RU9 A;  1SWW A;  1HJP A;  4F3O A;  1KQQ A;  3C2M A;  4GC7 A;  4C4S A;  2OEH A;  3TFR A;  5J0X A;  3IDW A;  5KG2 A;  4ED2 A;  1NK6 A;  2F3N A;  2FMP A;  1QCK A;  4QZ8 A;  4Q45 A;  1Z4N A;  5KG5 A;  2KJ8 A;  1UHU A;  4RQ6 A;  3SV3 A;  1T3N A;  1XSL A;  1KL9 A;  1F0M A;  2WAQ C;  4YR2 A;  1B0X A;  4PHP A;  4I2D A;  4UAU A;  5HML A;  8ICM A;  1KBU A;  5KT4 A;  2K89 A;  2KIC A;  2W03 A;  3SR6 A;  1TE2 A;  8ICU A;  1JIH A;  4B9S A;  3M7D A;  4RQN A;  3ZDD A;  4IQT A;  1HUZ A;  2DL0 A;  1SZP A;  3M8S A;  1ZD4 A;  2FMS A;  1BPZ A;  1MN8 A;  5DKW A;  1XWL A;  5BOL A;  3QEA Z;  2P35 A;  1ZQA A;  5ALL A;  4BX9 C;  3I28 A;  5D46 A;  3MGV A;  3UXN A;  3KFU F;  2AGQ A;  2BR0 A;  5T14 A;  1SZH A;  2QLT A;  2BZF A;  4U6P A;  4NL9 A;  2LKY A;  1X6J A;  4M04 A;  3RB6 A;  4NLN A;  4Y2V A;  4TUP A;  2AHO B;  3B9J A;  8ICH A;  3RR7 A;  4EYH B;  3H8J A;  2V4R A;  3H7I A;  1WCL A;  4DQP A;  1RG6 A;  2F44 A;  1PK1 B;  3D6J A;  3M8R A;  2KN7 A;  3C5G A;  3MGI A;  2KIW A;  5C0Y A;  5EE1 A;  1SKR A;  4QZA A;  4Y2X A;  1S0N A;  5KT3 A;  4UB8 U;  4OO1 J;  8ICC A;  1KKX A;  3WKB A;  1ECW A;  2FMQ A;  2K4I A;  2JMG A;  4KN4 A;  2OCE A;  3THV A;  5KT6 A;  2RP5 A;  1ZQM A;  4I29 A;  1BGX T;  2EAO A;  3KZI U;  4F5N A;  4XUS A;  1H38 A;  2ZXH A;  1LVH A;  1NK8 A;  3PW7 A;  5ALM A;  8ICJ A;  5KFF A;  2W3R A;  2W55 A;  1CRX A; 
#chains in the Genus database with same CATH homology
 4OJO A;  2DGZ A;  2G06 A;  3K1Z A;  2ZXI A;  3SAH A;  3IN5 A;  2HBL A;  2WB1 C;  3PSF A;  2VKQ A;  1XO0 A;  4JMU A;  3PSI A;  3F53 A;  4QIW F;  2KEY A;  2KKV A;  2KNJ A;  2Y0S F;  4GFJ A;  3KZX A;  2YX8 A;  1KBU A;  2CRX A;  2K89 A;  4U7C A;  3IG8 A;  2G09 A;  2E5S A;  2KIC A;  2W03 A;  3PZP A;  2KV2 A;  4CRX A;  2OYY A;  1P7D A;  3M7D A;  2ZIV A;  3PSP A;  2HOQ A;  2HMX A;  2R18 A;  4C0Z A;  1XNS A;  1HIW A;  3NRW A;  1GO3 F;  2A3V A;  2PMZ C;  3RFA A;  3F5A A;  4CDG A;  1ED1 A;  2VJ4 A;  2W04 A;  2JGA A;  3H0L B;  4OJ5 A;  3CRX A;  5CRX A;  4A8E A;  4QIW C;  2H3Q A;  1PVR A;  2KHQ A;  2GH1 A;  3GU3 A;  4IC9 A;  3DEE A;  3SAF A;  3F2B A;  2OH2 A;  4NWI A;  3N7S C;  2LBO A;  1Z19 A;  1L6N A;  2JH7 A;  2OM6 A;  4KX5 A;  4FZL A;  4P0P B;  2H3Z A;  3PST A;  2KJ9 A;  4BX9 C;  2XID A;  3SAG A;  1MA7 A;  4OJ6 A;  3MGV A;  2KD1 A;  3E0F A;  4NLB A;  3VCB A;  4AYB F;  3KFU F;  4P0Q B;  3HKZ F;  1PVQ A;  3VC8 A;  5T14 A;  1SZH A;  1ZQ1 C;  2ZIX A;  4NLC A;  2K8B B;  2XIC A;  2F2A B;  4U6P A;  2GOL A;  2H3V A;  2LKY A;  4FZM A;  5HR7 A;  2K4H A;  2JH1 A;  2Q4T A;  1TAM A;  2LHT A;  2M0N A;  3IP4 B;  2OXO A;  1WUD A;  2ZIU B;  2ZIV B;  2HOF A;  3HKZ C;  4QNL A;  2HBM A;  3CYM A;  2H3I A;  2WAQ F;  2HBK A;  1A6S A;  3LVW A;  4PL2 A;  5KL1 B;  2W7P A;  2F77 X;  2CPR A;  1Q3U A;  2KOB A;  2K4E A;  1URJ A;  2DF4 B;  3ONN A;  4OJP A;  2LYA A;  1IIP A;  4ICA A;  3SQI A;  3AL0 B;  2W7O A;  2Z7J A;  3N7R C;  4QJF B;  1PVP A;  2G0A A;  3F2D A;  3AQF A;  5KL8 B;  2D6F C;  2RRD A;  5HR6 A;  2KIW A;  3D2N A;  5C0Y A;  2VJ5 A;  4CGZ A;  2KKP A;  2HBJ A;  3ICX A;  2XI9 A;  3LVV A;  3NUQ A;  4KX3 A;  1D8B A;  2JHD A;  2NV3 A;  1HEK A;  3N7P D;  3D2S A;  1F44 A;  4OO1 J;  3H0M B;  2G5I B;  2YB4 A;  2MA1 A;  2PMZ F;  2RHF A;  2ZG6 A;  1T94 A;  3F2C A;  1ECW A;  2E1F A;  2G07 A;  2K8C B;  4ACO A;  4P0P A;  2K4I A;  2K8A A;  2JMG A;  2ZIX B;  2H3F A;  2XVT A;  4FZN A;  1OUQ A;  2KVC A;  2CN1 A;  3LYS A;  1NZB A;  5A0L A;  3O0F A;  2F8L A;  1A0P A;  2N1R A;  2WB1 F;  4KMO B;  2LYB A;  2RP5 A;  3H0R B;  1UPH A;  2G5H B;  3M6K A;  2ZIW A;  3C29 A;  2Y0S C;  2F76 X;  2YB1 A;  1YT3 A;  2BDU A;  2VIX A;  2MRL A;  2E1E A;  4AYB C;  3CP8 A;  2ZXH A;  3D2Q A;  3OPX A;  3AQE A;  4P0Q A;  2HOI A;  2DQN B;  4OJL A;  4NV0 A;  3SMV A;  4PL1 A;  4FE3 A;  2KJ8 A;  4O3M A;  3IG5 A;  3C28 A;  4BJQ A;  1Z1B A;  2KJ5 A;  2ZIU A;  2G08 A;  2KHV A;  2WAQ C;  3T79 A;  4WJ3 B;  4BUG A;  3RF9 A;  3L3F X;  3GZF A;  1Q3V A;  3M6Z A;  1CRX A;  3F5E A;  1DRG A;  3ALR A;  2ZIW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...