4EENA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase-related protein
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 82
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eenA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eenA01
1NF2A 3U7HB 4RESA 2YMLA 2CFSA 5IS2A 3OCYA 2W43A 3PGLA 3ZVNA 3R9KA 2I33A 3J7TA 3L8FA 3HLTA 4KYTA 1ZRMA 1TE2A 3SF0A 3WK8A 3M1YA 4UM5A 3NANA 1SU4A 4C4SA 2HI0A 1Z88A 4I9GA 3EPRA 5AHXA 4L6AA 5AI5A 5A3SA 3FGOA 4Y2XA 3QU5A 4C4TA 3W5AA 1Q91A 4QJBA 4ZEXA 2R8ZA 2G1AA 2Q5EA 3ESRA 2MU2A 3MMZA 2FPXA 4MUMA 4B6JA 4YGYA 4UM7A 1IWOA 3AR4A 3L1UA 2NO4A 2BDEA 5AVUA 1RRCA 1L6RA 4UW9A 5ALHA 5AVYA 4C4RA 3L1VA 1LVHA 1RQNA 3ET5A 2NYVA 5ALJA 2AUTA 3KZXA 3FVVA 1ZD3A 2YY6A 5AW4A 4KN8A 1L8OA 1NRWA 2FDRA 5AKZA 1L7PA 3OPXA 3L7YA 4OHFA 3DAOA 5ALDA 5T41A 2WHEA 4FYPA 4BX3A 2I55A 4Y2QA 4Y2TA 3L8EA 5AW9A 3CZ4A 1O03A 5AW0A 2HEGA 2I54A 5AKEA 3I76A 5AM0A 3S6JA 3U7FB 5AVWA 4J03A 3QLEA 2B8EA 5AM5A 3OCUA 3OCZA 4NFLA 1ZD4A 3ET4A 1AQ6A 1RLOA 2RAVA 3A1CA 3ZI4A 2FUEA 3SD7A 1EK1A 3FPBA 4UMDA 3QYPA 2YJ4A 2JAOA 4JDPA 3UMGA 3NRJA 3UM9A 2B82A 3OCXA 3AR2A 2EATA 1ZRNA 2OYCA 3L8HA 2FPUA 4CNQA 4UU0A 2C88A 5AVVA 3SHQA 3AR5A 4EZEA 3ZTWA 2C9MA 1LTQA 5JJBA 3SKYA 5AK6A 2HO4A 5ALMA 2ZBDA 4UU1A 1U2TA 3ZX4A 2ODAA 2CFRA 3WK7A 1L7NA 2VKQA 2C8KA 2R8EA 3QUCA 4EX7A 2B1RA 3BA6A 3L0CA 1RC8A 3WKDA 1XVIA 3QUBA 5AK4A 4BNDB 2HF7A 3MC1A 4NWIA 1Z4MA 1X42A 5AI0A 2IOHA 2MSNA 3KDPA 5ALOA 3E81A 1YS9A 1S8OA 1VFPA 4DWOA 4UAUA 3U13A 5AKIA 1ZOLA 3F9RA 4Y2JA 4FE3A 5ALVA 1SWVA 3N5KA 4KNVA 3WK6A 1RLTA 4NV0A 4BBJA 4CF5A 3W5BA 4XE5A 3L5KA 3VAYA 5AM3A 5AESA 2HOQA 5E0OA 3ONNA 1TA0A 2G08A 2ZBEA 5ALRA 2FPRA 4J2TA 3A1EA 3RFUA 3WKBA 2PKEA 5ALNA 4E88A 3OTQA 3AR8A 3SLRA 1RMYA 1YV9A 3PGVA 1Z4NA 3DV9A 1ZS9A 2I34A 2IYEA 3ESQA 4CF4A 3E8MA 2JARA 3N07A 1WVIA 1RDFA 4IG4A 2BDUA 1N8NA 1CR6A 1KYTA 5AVZA 4OFZA 3B9BA 3ZTYA 2IOFK 3N1UA 5ALKA 2MU1A 1QQ7A 3WKCA 2EAUA 2GO7A 2QLTA 2IOFA 4HYTA 4EX6A 2Q4RA 4RETA 4YCLA 3WGVA 2C8LA 1QQ6A 4Y2YA 5ALXA 2HF2A 5ALLA 4O8CA 3AR3A 3AR7A 2YMPA 3QU2A 3KD3A 2WM8A 4KX3A 2GHQA 3OCWA 5AW3A 4L57A 2AGVA 1VJRA 4DFDA 1RKUA 3OCVA 3BWVA 2OA0A 5AKKA 3DDHA 1U2SA 1WR8A 3WKAA 4YCNA 1O08A 5ALSA 5AVQA 1YMQA 4BYGA 4YIHA 2X4DA 3WGUA 3QU4A 1VJ5A 5ALGA 1Q92A 5AKYA 1XPJA 5AW7A 3FM9A 2OM6A 4Y2RA 4I9FA 2ZBGA 1FEZA 2P11A 3R09A 2AMYA 5AIBA 1T9ZA 1Z4PX 1Z4LA 4QQFA 1XP5A 3EF0A 5ALUA 2W11A 3QNMA 3MPOA 3RF6A 3QXGA 1CQZA 1QH9A 2HX1A 4UATA 1K1EA 2G07A 1YDFA 2YJ3A 2HHLA 4XPZA 2DQSA 1J97A 3TLMA 5AVRA 4XQ0A 1U02A 5AKJA 4DW8A 3ED5A 5FP0A 3QUTA 3MN1A 4NABA 4HGNA 2FPSA 5A3RA 5AK3A 2R8YA 1YNSA 2WF5A 5A3QA 3QX7A 3FPSA 1Z5GA 1RMQA 4BX2A 5AKHA 2CFTA 4XOUA 2FI1A 1RMTA 2FPWA 2G0AA 4ZEWA 2YJ6A 2AH5A 4GIBA 3SKXA 4EEKA 1ZJJA 2YBDA 4YH1A 5ALQA 2Q4TA 5ALIA 2B30A 5AW8A 2RB5A 5ALTA 1F5SA 1U7PA 2W4MA 4H1WA 5AW2A 3W5CA 4F71A 3NASA 2B8JA 2GFHA 1Z4OA 2WF7A 1Z4QA 2JGAA 3ZUPA 2P69A 3P96A 4Y2UA 3L0BA 3FZQA 1JUDA 3AR9A 4FFDA 4OD0A 4HGPA 2D2VA 4AS2A 3IB6A 5ALFA 2ZOSA 3CNHA 5ALZA 3ZWKA 3U7GA 1L7MA 2IA5A 1U7OA 2ZXEA 1RPZA 2NO5A 3NIWA 3AR6A 2G80A 3NAMA 4ZEVA 5AI9A 4KNWA 2YMMA 2RBKA 3QU9A 2ZBFA 4UASA 5IT0A 2QYHA 4CE6A 2O2XA 5AK5A 1T5SA 4HAIA 5IT4A 5ALEA 4BKMA 1ZD5A 4MWOA 3I1YA 1T5TA 4G63A 1QQ5A 2OBBA 3WK5A 2B0CA 5AI4A 3SMVA 3A1DA 1J8DA 3NUQA 3U19A 1TJ3A 2FEAA 2B1QA 3A3YA 3R4CA 3M9LA 2WF8A 1QYIA 4UMVA 3KOOA 3E58A 4HGOA 3U7EB 5AM1A 4BNDA 5AIAA 3IRUA 2CN1A 3B8EA 1TJ5A 1RKQA 1PW5A 3U26A 3EF1A 4L6CA 3QU7A 3IJ5A 5AKLA 3WK4A 5AI8A 5AI6A 4AS3A 1Z4IA 1MH9A 3I28A 4EENA 1NNLA 3W5DA 3E84A 3ZW7A 1N9KA 3QUQA 5AW6A 2EARA 2GHTA 4YIKA 3DNPA 4BEVA 2FUCA 5ALYA 3I6BA 4UAVA 2YN4A 3ZVMA 1ZD2P 5AVTA 1S2OA 3N8GA 4Y3UA 4HGQA 3ZU6A 2O9JA 4BEWA 3WKEA 5AICA 2R8XA 3PDWA 3KBBA 3UMCA 3D6JA 3GYGA 2JAUA 3K1ZA 2JAWA 1TJ4A 4Y2PA 5AM4A 1L7OA 2YJ5A 4UMEA 2HSZA 4GXTA 4AP9A 2RARA 4Y2VA 4F72A 4UARA 1EK2A 1Z5UA 1RLMA 4DCCA 4KX5A 4NAVA 4UMFA 5ALWA 4IFTA 4HGRA 1WZCA 2GMWA 5AKGA 2C4NA 4OCZA 3PCTA 2G06A 2HDOA 4Y2SA 5AKXA 2PR7A 2BY4A 3UMBA 3NALA 1YJ5A 1Z4JA 3L0YA 3QGMA 2YMQA 2WFAA 2HCFA 2I6XA 3EWIA 2YFYA 4PNHA 3KC2A 4YCMA 5AW1A 5ALPA 3ZVLA 1RKVA 2PQ0A 2ZG6A 1Y8AA 3ZWDA 5AVXA 5AVSA 1WPGA 4G9BA 4BX0A 3B9RA 2WF9A 1RQLA 3L8GA 1L8LA 2I7DA 3WK9A 2WF6A 5AM2A 1Z4KA 2G09A 4CF3A 3HYCA 2P27A 5AW5A 3N28A 1SWWA 4EELA 3ZX5A 2P9JA 4JB3A
chains in the Genus database with same CATH superfamily
5AOBA 3TH5A 1ZJ5A 3J7TA 1PFYA 1QHIA 1PNVA 1DC3A 1K5HA 1A5AB 3CNNA 3CIOA 2H63A 1PUJA 1T24A 1U2GA 4YXWA 4WFQA 2HC9A 3PE4A 5F5XA 2BPOA 4PLVA 3D6UA 1NF3A 1E94E 2C1EA 5DCLA 3HKDB 6ADHA 5F9LA 3L1VA 1RQNA 4AG5A 2K89A 3LUJA 2ACEA 2H2IA 1R64A 3T3OA 5DLEA 3K6SA 3T4EA 2F3PA 3C97A 1E99A 3PX2A 3A04A 1UBUS 1ADBA 2PT7A 4N76A 1GAQA 5ISMA 2E4YA 1DQRA 4IS3A 2RB4A 2JAXA 5DTIA 5E4TA 3VDNB 4Q9JA 3E9CA 5KSYA 3QW4B 3NDBB 1KY4A 1XD2B 3B53X 1QQAA 4US8A 4BNXA 3PKIA 1ZKMA 2JRCA 5FA5A 2HLHA 3LL7A 1RC8A 3U3JA 2UUBB 3L7LA 1ORHA 2V4RA 3CPEA 1HYGA 3W1VA 1YE5A 1MIHA 1IY2A 4JMPA 8ICSA 4XVRA 3EA5A 2GD1O 1ZESA 3COJA 1XAIA 5AM3A 3X1JA 4WLOA 4YYEA 4BRUA 1YDEA 2BAGA 1N34B 3SYNA 1UA1A 4EUHA 1DZIA 1H42A 1QOZA 3I5MA 1GY8A 2RDJA 2BCGY 1XMIA 2AG6A 4ETIA 2BR0A 3CVXA 3WLPA 2OEHA 4GWLA 5DM1A 2PGLA 1T8SA 1L3IA 2Q0XA 4B3MB 5AVJA 4IYJA 1GADO 1Z2OX 5KFJA 3CIFA 2AEMA 4URHA 4LWPA 4GR5A 4PWZA 2CBGA 3QG1A 1VPEA 4C14A 3SZRA 1DKNA 2X9LA 3QLVC 3UUEA 2RQ5A 2X4DA 2I8CA 1PJQA 1BFUA 1UCVA 1PT9A 4P4SB 3JPRA 2FZGA 2VZ0A 1SVSA 3WYEA 4M9HA 1VCMA 5G0VA 3MTGA 3EF0A 3L1KA 4BCDA 1NONA 4K9PA 3JZDA 1WCV1 3Q5EA 1Z0AA 4I4TF 4MLDA 5DGXA 4O5CA 4G0UA 2JFGA 5TISU 2E4WA 2VPYA 4Y6SA 2I62A 1DKLA 4FT2A 4B9AA 4B44A 4O5AA 4IPTA 4MQFB 1JIJA 2WF7A 1KAEA 1Z4QA 1U2DA 2PFPA 1BA2A 3THXB 3G1WA 5J59A 3H0LB 2JCYA 4OBWA 1UHUA 2GS9A 4BGEA 2GAAA 1CQXA 3CINA 1MDBA 1P91A 3CVVA 2PLRA 1S5LU 2LW7A 5BNTA 4R8SA 3N7AA 5BSHA 3GDFA 4QUGA 1NYRA 3WNZA 1C2YA 1WO8A 5AIAA 3WP1B 2ZJOA 3FMIA 3T3IA 4ZCRA 3S1SA 4WZBE 3IBYA 1US8B 1Z0UA 3P2OA 1MH9A 2YJNA 2GHTA 5HTOA 5H3CA 1SHZA 2YY5A 3P19A 2ZPAA 1EX1A 1U04A 3NOXA 4BUCA 3K9GA 2C2MA 2FFRA 4G5SA 2JAWA 5EESA 1U99A 4E5VA 2V6MA 2FOXA 2QSUA 4Z9YA 2JEZA 2G82A 4ED6A 4O8ZA 2IV3A 4B75A 1Z5UA 4C8NA 1F20A 2W7OA 4M1EA 2C98A 2W6MA 4IDDA 2WHQA 1Q1NA 2AA3A 2E4UA 1O0BA 1OBFO 3RJHA 5AVSA 3UC5A 4B9LA 4RY8A 1LBHA 4FXOA 5PGMA 4CF7A 4N0MA 2FEOA 4D3SA 1GO2A 1PR6A 1D2MA 3PP8A 2X9QA 4YV0A 4FHZA 2WSSA 1A77A 2ZYGA 4QUBA 1P29A 1U0FA 3VKFA 2Y71A 2VWQA 4KXQA 5JT1A 4R8RA 4MGHA 2JKYA 3ROQA 3GLRA 3RB4A 3Q88A 4LJ8A 2XBUA 2ASVA 4QUDA 7ICLA 2Q5CA 4EHIA 2DH6A 5G3ZA 4QT4A 2J0UA 3GRKA 2YZNA 1JE0A 3UG7A 2DEUA 4FZMA 2QY6A 4NFSA 3A14A 3DFFA 4PBTA 5CEHA 1N2OA 1L5WA 4W8OA 3BMXA 3JZIA 2FMUA 4KLLA 2QYTA 4QG7A 4CM9A 1VIDA 4GMHA 2C94A 4H60A 4X24A 1NUHA 3QF4B 9ICWA 1RJGA 4JC5A 2JAOA 1RZRD 1WETA 3OCXA 5K0JA 3VBEA 4MJLA 2QTTA 1PT7A 4YP3A 3Q72A 1N0VC 2EFHB 2WHXA 3A6GA 1BH2A 4AYBF 4V38A 1A1VA 3QUCA 4GL2A 4J1NA 1FFDA 4CV0A 1M2OB 3FNQA 5ALOA 4LRQA 4DL4A 6GPBA 3AESB 4OBBA 4QYWA 4ZCLA 1AXRA 4QVKA 5AUOB 3CZCA 5JSHA 4FTWA 2PKCA 5IJ0A 1QHFA 3TQ1A 4R51A 2B9EA 1Y5IA 3QMMA 5D1NA 3D7KA 1D9XA 1GIAA 3SC2A 3LSTA 5IVPA 5K0NA 4DIUA 3PGVA 2W9CA 4EL5A 3O4HA 2XCRB 1RDFA 3DKKA 4DLPA 3O75A 1DWPA 2YQEA 2FF5A 4YQYA 4EFDA 5TQ2A 2MINA 3D6MA 2XMGA 3A2MA 1UCFA 1ZQUA 3H4IA 4KREA 4BUGA 3GNSA 2HHQA 3MBIA 5ERXA 1RXEA 3P45A 3DTYA 4YJDA 4OK6A 2B6NA 2P4SA 1IPHA 3PF8A 1C30B 3E6AA 4NCAA 3F5QA 5FPHA 2NU7A 4DYDA 2HSGA 2HV9A 1WCNA 4X92A 1BGVA 3KSMA 2PH3A 4IQGA 3OLQA 3GFPA 1XDGA 2GZMA 3CV3A 3UHJA 4D9JA 4MUKA 5DB7A 3ZZ1A 3COPA 4KO1S 3SQOA 4URFA 5D85A 2OXOA 4Q47A 4EK9A 2ZSUA 4QELA 3DDUA 3AFIA 3K6SB 3MGVA 3N87A 4JQOA 4DPKA 3PFWO 1PFUA 2GDJA 3EWSA 4A8JA 2OHGA 2BM1A 2DUWA 3P9QA 4EKYA 3O8DA 5FBHA 3T7DA 4B9MA 4ALJA 4N01A 2P1DA 4LWOA 1LNQA 7REQA 2HL6A 4Q3DA 2CLFB 1GPH1 1YI8A 2R62A 1G38A 4BYMA 1UZUA 3HV0A 3E58A 2WPDA 1ZQIA 4PLTA 3KHKA 3JATB 4J0KA 5HIMA 1JQKA 1OQAA 4MR9A 3EG5A 1DO2A 1A9OA 1P4JA 4Q48A 4MRMA 1XNSA 4X71A 3WLFA 2F3QA 3GAFA 3F6CA 4YASA 2R1VA 1CB0A 2YHSA 3LWLA 3RS8A 2C7PA 1OUMA 1YH3A 1P6UA 4V39A 4M0DA 4OHKA 4RGYA 4EA8A 3FF4A 2R0QC 4UMEA 1K7CA 3OIGA 1EK2A 4EKEA 3JQFA 5IDYA 1H2HA 1B2RA 2HDOA 2OHVA 1V4NA 3RFXA 1SCBA 1XPRA 3DVSX 4ERXA 4UNSA 1RWNA 3CKMA 4PRYA 3H75A 5FWNA 4KLIA 1RQLA 1YDHA 3EX7C 4OHYA 2HHCA 3C3PA 4MYTA 2ACWA 4FHDA 3F7TA 3P0JA 4WERA 2OCKA 3B7WA 1N2JA 4NNPA 4I2EA 1P7ZA 1AQLA 3I2FA 2ESRA 4RV5A 1MIOA 3DCNA 3H0KA 3FIUA 3D0KA 1XTTA 4P2HA 1P72A 2BGIA 1U90A 3I09A 4B3SB 4KXVA 4E09A 1JLLA 1Y7HA 3MCWA 2F2TA 4H3KB 1WCXA 3QFTA 2C2EA 4EHFA 1Z2AA 3PXEA 5CH3A 2DKFA 1F44A 2ZTEA 4ON9A 2UVPA 5L3ZA 1CFJA 5FPQA 3SYKA 3CNEA 3M9OB 3LLCA 4FJ2A 3TAXA 3O83A 5M04A 1PIWA 1X9WA 3H5WA 4EBBA 4XJSA 4LA4A 2ZRPA 4XARA 2FZ5A 5E2AA 1FS5A 1K92A 5KQSA 3M4JA 3TQCA 3G79A 1ZGZA 3H9CA 1ZH8A 1Q1ZA 1PL6A 4YD1A 4ZV7A 3G9TA 1P60A 3D4PA 4JA2A 1NVDA 3SIWA 2C1ZA 2XLBA 7AT1A 3TX2A 2RHWA 4X20A 1RXIA 1H4SA 1IY9A 3KDPA 2D8MA 3NP7A 1X14A 1ZI6A 3B60A 3U09A 5ELXA 3SAHA 2A9FA 3KCNA 3HJUA 1KJJA 4BZZA 3LW7A 2H9YA 2JFVA 2CEKA 8ICFA 1AZSC 1DAPA 1TJYA 5EZ6B 1IXKA 3SLRA 4LJ6A 3A2LA 2AZ4A 5CITA 3M7DA 2FQYA 1QK4A 2G70A 2Q28A 3B9BA 2FMPA 2JEOA 2ZUDA 1U3UA 1SCAA 4QFDA 1QDEA 2C03A 3ZZMA 2HF2A 1B74A 4IDPA 1Q3TA 1HIWA 1H2YA 4UAYA 1BVUA 2I8LA 1CY4A 4C30A 1M73E 4C20A 1UF9A 4LXUA 3KQNA 3VO8A 3GEDA 4X6XA 3AY0A 5ILQA 3RC3A 2QM7A 4DA8A 1SU6A 1C2TA 4CKWA 4ZOQI 5AIBA 4RUKA 4F04A 1M34A 1F7VA 5FI0B 3OQMA 6ABPA 4B6SA 2H48A 3JCZA 3S4YA 3WRWA 2J9ZB 4RYDA 4FYJA 1FFEA 3GN2A 1E7MA 4C06A 1T2DA 4CKBA 4YNBA 3N3BC 3COVA 2FSHA 1P45A 1XZJA 2Q3DA 3Q8XB 3SKXA 5FPKA 2FFQA 5AYVA 1G16A 1U4OA 2J0UB 4A3SA 2V1XA 4CMBA 3R5JA 2RFLA 3L0BA 4QODA 2JKVA 2WOJA 3RU3A 1K8XB 4NTZA 2LPMA 3DR5A 4TMKA 3H8MA 5FI3A 1SG6A 4ER6A 2GZ2A 4FN4A 2QYHA 3V8NA 4YMTA 2XOKD 8MHTA 1Z2EA 5J2CA 1Z1VA 3REOA 2R11A 1ZJMA 5C7OO 5AM1A 1VFNA 1SQ6A 4X97A 4BO5A 2H3QA 4HSEA 2VJLA 3Q4GA 4MVJF 3WC4A 4R9VA 1S8NA 4KZPA 3RVDA 1ORIA 3MIIA 4N7BA 3NIGB 4BEVA 2EV9A 3IBCA 1EZZA 1VB5A 3IVCA 5JISA 1WW2A 5J8YC 1EFPA 1QFSA 2KMLA 4WAUA 1PS8A 1KI4A 5TF4A 1X9IA 5IJ0B 2LD4A 1PNTA 1OROA 2E4AA 3VZBA 4EFKA 3NAQA 1CV2A 2OD7A 2MRLA 1RYNA 2QTVB 3SC2B 1E3DA 1H0HA 2W2MA 1ZU5A 2W9CB 3C3DA 1SL1A 4GE0A 3KYIB 1G7RA 4OQQA 2WT8A 5CYGA 2WVHA 1WVGA 2E3JA 4LOKA 4MVJD 1JN0A 2R6AA 2A14A 4DXDA 5KOJB 1RZTA 2PMKA 3IQWA 3UWKA 1GTJ1 5TQ2B 2MINB 1R8QA 1XYVA 2NRXA 2P5UA 2R1UA 4R0NA 2H2HA 2E87A 3BSYA 1JHAA 3N6XA 2VN8A 2P65A 3TAQA 4PX9A 3W8DA 1M1YA 2ZDQA 2I7DA 4G8CA 4OSPA 1CUWA 1XLUA 4G8JA 4CZ2A 3ANTA 3E61A 3ORSA 1OXSC 5T4BA 3T5BA 4D26A 2JZOA 2ZU0C 5JG7A 4Q02A 5EEGA 1ZJWA 1M0EA 2ONZA 5AI5A 3H5LA 3SI7A 1V41E 3FWZA 2V9ZA 2PBRA 3IMKA 3K0HA 1YS7A 1PKXA 3LX4A 2XX3A 4JR0A 4MO9A 1QMGA 3EQ8A 1YCHA 4KMUA 3HDQA 5DYNA 3U49A 3I58A 1FS4A 2IHJA 4F21A 1RYSA 1QF7A 3H42B 4JD5A 2ZAYA 1HORA 4D25A 1VA5A 1NDHA 4PPYA 3A9CA 4NDZA 3Q9NA 4FNGA 4RO0A 2J67A 3UMMA 5TC4A 1J70A 5CDFE 2OFFA 2D7DA 2O6KA 4YCJA 4Z1MD 1SA0B 2ZKLA 4PAWA 3ZE1B 3JQQA 4A8JB 3PEVA 3HS3A 5EIFA 3LBIA 3OE5A 1OX6A 2XVMA 4MFCA 2YN0A 1WCIA 4QUIA 2YV1A 5HOEA 2WTUA 3HABA 4YY3B 3DPIA 4PU0A 1AB6A 1SBQA 1G8HA 1ZINA 2P2YA 3BFPA 3FE2A 3PIDA 4PZDA 2XCQA 7REQB 2DKZA 2FEKA 2JNWA 3I0MA 4LNUA 2YIVX 4YMUA 2EFEB 5IC5A 1KAQA 3I04A 2HF7A 4XB2A 3FCSB 4XDYA 3ZBQA 2VQFB 4PLPA 3AFOA 1Z0JA 2FGJA 3KQKA 1WNTA 4MNTA 4GPD1 1ZQGA 4MR9B 4CUKA 1NVKA 5GPBA 5IBPA 1MXHA 3V7FA 2O2EA 1T1IA 2Z04A 4S0ZA 1XKQA 1RAEA 4P4PA 4MRMB 2R1VB 2PXXA 4P3NA 3L5OA 1JHUA 1XHFA 1W4LA 1QAOA 1N8TA 3L0IB 1RE1A 4AJ2A 4LFBB 3TO5A 3KQUA 1BHO1 1BPXA 2QRMA 5BOVA 2VSYA 5EP2A 4YCLA 3I1IA 1ZQQA 4MKZA 2G72A 1NVVQ 3PTZA 2AC4A 3PPVA 1QB7A 3T3DA 2RAUA 2AFHE 2XJ4A 2RIPA 2CB0A 5BN4A 3PQ6A 3ETGA 1NMYA 3WRYC 3BWBA 1AKEA 4BV8A 3VX3A 3FVTA 2AVNA 5JNTA 2J3DA 5A9SA 2FE9A 1XROA 1XV5A 3VYSB 4ANFA 1KQ3A 4YC7A 2WZDA 1SM4A 3QNMA 3QIVA 1K1EA 1MIOB 2FP4B 1I4EB 3LK6A 4DANA 1ZQSA 4CWAA 3AK4A 1JHYA 3C6XA 4AKSA 4RMIA 1JLLB 1YC2A 4IM7A 1UBTS 4AF8A 4KLCA 5D8DA 2CYBA 2EKLA 4F71A 2VZ8A 4B6FA 3I9OA 4H3SA 4C05A 2EX0A 3N8DA 4Y1RA 3DWEX 1ZXXA 4HYEA 5HTKA 1XHEA 2UVPB 4IDEA 1LTKA 3D8UA 3STUA 4M4SA 3DPSA 3AR6A 5I9BA 3Q2OA 1PVDA 4YFVA 4QAJA 3PW4A 5REQA 4CRXA 2C07A 1ADFA 3WK5A 5EAIA 3EYAA 1BWQA 1GZ4A 2EFCB 4BWFB 3JQ6A 3ZDQA 4KO3S 3MT0A 5JCZA 3PVZA 3DMYA 2XE4A 4AQDA 2HQSA 1V97A 4EG8A 4E94A 1VHLA 4X20B 2NACA 4REOA 1C4XA 2EZ8A 4I19A 2GUWA 1N6HA 4OB7A 4L6IA 1KL9A 1YR9A 4V0LA 1T6XA 5AHKA 4HWSA 3CVOA 3CM0A 2Z0MA 4QU5A 3CRXA 3WJAA 1IM8A 3PLAE 1XC7A 2XA9A 2CMGA 4ASUA 3LC2O 1KLNA 3N39C 1U5AA 1W5EA 3DO8A 4ITVA 3IULA 4Q1BA 2KBFA 2ZSKA 3MOIA 1KSPA 4Y2SA 4Q21A 4YJGA 2DQZA 1WHSB 5JI3E 1N5RA 1VLHA 4ZYZA 4W7HA 2B3DA 5BURA 1UBEA 3EHEA 4S24A 4KLAA 4RAOA 3QK7A 3BQ9A 1MX9A 3M5PA 2QU8A 3OSUA 4BVLA 3OU2A 4D9EA 4XYGA 3HFSA 4YJ3A 3BUSA 3GGJA 2NLOA 1ZRMA 4OHZA 2PIDA 1SCIA 4MVJP 4GMGA 2WIFA 4CKWB 2IF0A 3K2IA 3PUXA 3GPLA 1K88A 1NVAA 4IV0A 3ELDA 3I2KA 1S89A 1M34B 1Y33E 2GPJA 1Z38A 3HH8A 2JG3A 3VUEA 3GLHE 1Q0TA 4CKBB 1GR0A 3PX0A 3EOAI 3HYLA 2W00A 1YHNA 2ZYIA 2WKRA 2Z30A 9MHTA 2C2ZA 3ENKA 4HL6A 5IVDA 3X1WA 1Q2UA 1SBYA 1PR3A 3HJRA 5FBKA 4OOEA 1XZPA 4D98A 4QWEA 1KPHA 5CFMA 3PPWA 1U4BA 3TLCA 4X60A 1ATIA 1FP1D 3HHEA 1XWWA 5BNWA 3CCCA 4KDCA 3Q6IA 1QV7A 2ENUA 3ZWCA 2RI1A 5ALMA 3QFRA 4UBKA 2Y1CA 4C78A 2J31A 1RP1A 2XWQA 1ODLA 2YBEA 2WLSA 3PNVA 4U6PA 5IP5A 3LUHA 2LMRA 1SB9A 5FUBA 3T1TA 1JL3A 3P0FA 1Y3BE 3LRTA 2OT3B 2R6ZA 1IONA 3HGTA 4N9WA 1NM5C 3CW8X 3SQDA 3NWPA 3KQSA 3H1AA 2IYFA 3L18A 2HOQA 4U02A 3ILYA 3LJKA 4C4AA 1EFPB 5M5BA 4B46A 3C98A 4NH0A 4DLZA 4Z7NB 3QMPA 3OQHA 5EI5A 3RFFA 2IOFK 3MWLA 3AL3A 3AEYA 4WXHA 1FTGA 1DG1G 3KD3A 3ECSA 1W75A 2CUZA 1JEOA 1NKEA 4LW8A 4TRMA 3ZZUA 3MG9A 3UCXA 4DMCA 2Q3EA 2YYAA 4MZXA 2XGQA 1K6MA 3R5KA 2CVPA 1M1YB 3NNDA 3WGUA 2VDKB 3HNRA 2OSVA 3FKSA 4RVHA 1II9A 3KEOA 1KJWA 2FU5C 3K5IA 4HNQA 1Y3IA 4W6ZA 1IK6A 2OORC 4EYGA 3W9YA 2HW8A 2W9AA 3IUMA 4BQSA 3ED5A 1ZSNA 2N9UA 5JZVA 5DKWA 3V8VA 3KAJA 1IN5A 3J80A 3WIUA 3HUFA 1E3MA 3SBOA 1QFJA 4FBLA 4FOSA 4W8HA 2VP5A 4QJ4A 3DE3X 3AF2A 2Y1GA 1W36B 3A3NA 2C28A 4UHCA 1EHCA 1NJ6A 2E1EA 3A3OA 3FZQA 4GHWA 2QZ4A 1E96A 2IFTA 3OMXA 3PR2B 3T3GA 4EI7A 4X65B 2Z43A 4HRVA 2G0TA 4K6HA 4K26A 3MJVA 1WXWA 5A0FA 3SEAA 5JNVA 3U61B 2FRVA 1BWSA 1VJTA 4U8HA 3VR4H 4DYHA 4X3PA 4CLOA 1WCIB 3ZGVA 2ZI7A 2AW3A 5IT5A 2ADMA 4IDNA 1T0JB 3HT3A 4A9AA 4LHVA 1OFHA 1P1CA 1XLTA 4YRLA 1O58A 4QOIA 2QUIA 5KG1A 4AUEA 4I46A 2IU4A 1GGKA 3E84A 2QARB 4NATA 1JT2A 1FNMA 3ZHTA 1UDAA 2N1MA 2ERYA 4RK1A 2JCXA 1KJQA 2UYYA 1ZONA 4XEHA 2VTBA 4DSFA 1JVSA 5HMLA 1YR6A 5L53A 2CNWD 2CHGA 1TUBA 3S8MA 4OJQA 4GDFA 3QLTA 1ZAKA 3UJ8A 2GA9A 1T3HA 3UEOA 4XDZA 2M6LA 3IHLA 3PCTA 4MRSA 3VDMA 2EKZA 2A1AA 1L3VA 5AQEA 1XJCA 1CY7A 3DOFA 3R5TA 3FX2A 2H08A 1V2HE 1NC1A 4KQXA 3IA7A 1JT9A 4PXAA 2G09A 1TK0A 1U11A 2AE2A 2MHCA 1Y3HA 5BN4B 3KJFA 3L07A 1H6DA 1TKRA 3LQ2A 2PXIA 1OH5A 2R97A 1JTFA 1JYFA 3QXXA 5A9SB 3R9IA 2FLNA 1RG6A 4I2AA 2GXSA 1EK0A 5KVSA 1KH1A 1VPLA 3AR4A 4EGSA 2EP8A 1W4AA 1YTUA 4DSJA 2CMHA 2YV4A 3MR5A 3EVDA 1E1RA 2J5BA 5KOYA 5AW4A 4XLTA 1HJPA 1UXHA 1XVUA 2GESA 1KIFA 3MTAA 5KCZA 3L8EA 3HVRA 3LBAA 5JARA 4H7HA 3HUUA 3UMSA 4QULA 1NLYA 4XWWA 3VI3B 4WVFA 4KIGA 2YXEA 3UH0A 2HSJA 2VS1A 3DGEC 5JSZA 3WLMA 2OM2A 1S3GA 4DDKA 2PL3A 3TD9A 1KQNA 2XWBF 1X87A 4D3FA 3PO5A 3KFVA 4J9PA 2Z1MA 1E3QA 3NJRA 3HB9A 3OPVA 2Q9BA 4TPKA 4I5DA 4DY4A 2AEJA 2OTCA 3DMTA 1CXZA 421PA 3PC3A 1NN5A 2WWVD 5LDHA 2XTAA 1M1ZA 1YJQA 3QEMA 5TJHA 4KQCA 2PU7A 5DQGA 1S4MA 4JXJA 3G2OA 4J7UA 3DW1X 2O1WA 5LYJA 5I01A 1KQFA 1LW6E 3HWWA 1X1TA 4MLCA 1K3TA 2WV9A 2I3GA 3NV7A 4E1BA 4BC1A 2IVZA 3FDSA 2HH9A 4Z86A 1R0WA 2BM8A 2JL1A 5ALSA 3M8KA 3RUDA 4KAJA 5DNYB 2VI5A 1JKJA 2EHJA 1EB8A 1KK0A 2VQSA 4YJ3B 4M9SA 3VC7A 1ZGHA 2E7ZA 2H7CA 2K8CB 1JAYA 3MK31 2ATVA 1J9GA 1O2DA 1UDCA 2VJAA 3AGQA 2NPIA 5E8RA 1Z6GA 1E69A 1UDBA 2VQ3A 3R0VA 3L4KA 1FFCA 2ORIA 4AUMA 6PFKA 3AONB 1LLDA 3C1OA 3C48A 3L05A 3V8RA 5FR1A 2HQ1A 4YP9A 5BNIA 5ALQA 2BQRA 1F5SA 3JWEA 3NVWA 3TAUA 4I29A 5KQMA 3FPLA 4JSYA 1G2IA 2IPOA 5IANA 1H85A 3NHRA 3LY7A 1VB3A 1E8NA 4F4WA 1RPZA 1HQKA 4EITA 4YV2A 4KQMA 3KWFA 4CE6A 2XA1A 1OLXA 2REQA 3ZWQA 2MYUA 1QGDA 2Z98A 3DCIA 1WXFA 4K03A 1E1LA 2FEAA 3K92A 4I5GA 3BCUA 1L3CA 4WOPA 3A7EA 2QRPA 4QARA 1TJ5A 4KO8A 4E14A 1DB3A 5KFMA 4LOAA 2WUFA 1JX4A 4OQ4A 1OY1A 1Q7EA 3UJDA 1N78A 1XCMA 3AI3A 4A7PA 4OJPA 1LKYA 3A06A 4F1JA 1M1NA 2FWBA 4TV8A 3SBEA 3KO8A 2P0YA 4ND1A 5M29A 4JHLA 4JS0A 4F84A 3ENNA 2ZVDA 5JCJD 1MEOA 3HKBA 3WWCA 3DLBA 3A1NA 4O4IA 5LB2A 1GFIA 1W36D 1DWUA 2RH5A 3KXDA 2VP2A 2YDXA 3OLZA 1CZHA 4QDOA 3LSYA 1FFBA 1FVXA 3PCXA 5BR7A 4OAOA 1S2MA 3NKLA 3FKJA 1NFFA 2VJPA 2D1RA 4KMSA 2AYXA 1KDYA 3RS2A 1I4DD 1SUDA 2W43A 1UPXA 2M98A 3WDLA 1NUQA 4AWAA 3IR6A 2CDAA 2D0PB 5E4JA 2F3UA 2FSGA 1JAHA 1PUZA 2P6PA 1SB3C 3HJEA 3N8HA 4QDTA 2YYZA 2JLSA 4EWLA 5J1SB 2D1FA 1AU9A 1ENZA 5DT9A 2J9YB 4MVCA 2V7QD 3NRBA 4RZXA 4DBVO 3E3MA 2XB9A 3LX6A 2IEAA 2XTZA 5JPIA 1UJMA 5C8VA 1E6LA 5BMOA 3ZD9A 4GOXA 4OHFA 4ZTUB 1CYDA 2I55A 2NU9A 1SOVA 3TZBA 3E1GA 1T9DA 3TJZA 4E31A 3ROGA 2AL7A 2FUEA 4MP8A 4JI0B 1WTAA 3V7WA 1X15A 4WZZA 2LRHA 3BULA 4QZFA 1E3EA 3VXKA 4JUIA 3AR2A 3CWZA 3O38A 3C7TA 1ULZA 2Z3VA 3I6IA 1TCVA 2FRXA 1NJXA 4GKBA 4CLOB 1F8YA 2I4MA 3CA8A 1QUFA 3AVOA 2NXJA 2G67A 1RWXA 4IHKA 4HB0A 5I48A 2CNBA 2NADA 1T15A 2P30A 1YZTA 3PUWA 3JQ8A 4QZ8A 1FVHA 2HN9A 1LDGA 3FLBA 1SXHA 5BSUA 1UR5A 1B93A 3REGA 1U0GA 2Y4OA 5E7IA 5CVCA 2FPRA 1YB6A 1GAWA 1ZS9A 1TUBB 1CT9A 4WECA 4PZZA 4IVNA 2V6IA 3N7SC 3UW3A 3IEVA 1R0KA 3R40A 4TT3D 4TSKA 1A8QA 2R2GA 3CT4A 2JLZA 1RWWA 2M6SA 3ZCQA 5T57A 3HXTA 4M8NE 1H3FA 4LYHA 2HMSA 3K1JA 1Q3VA 5C7IO 1ZQKA 5FNVF 1G60A 5BSGA 4MKGA 1P7DA 1U28A 3I61A 2FPKA 1E2LA 3V1LA 2AMYA 3H1EA 3WAGA 1ZZEA 3VU1A 3UYLA 3IP4B 4D5EA 4B40A 2XW6A 3BQ1A 5MN4A 4C1BA 3IDZA 3NTRA 2DX7A 3UK1A 1DE0A 4XQ0A 1RZ3A 3U40A 1UM9A 3VR0A 1MB2A 2X2FA 4HYQA 3DCYA 3KUUA 2AKAB 2E18A 3H5TA 4ETWA 3ENZA 3PT5A 4O4HF 1CS0A 1M7HA 5AJZA 4X90A 4EYSA 2KE5A 1T2UA 3F9IA 5KFSA 2A5YB 1Q44A 2EDCA 8ICNA 1CEXA 5E0KB 2B30A 1LF5A 1Y9DA 5GQSA 1SVKA 3WTBA 5DQHA 3QPAA 4BMZA 2KSQA 4LC1A 3FF1A 1XSLA 3U1VA 1MJGM 1WCLA 3V1TC 5ABPA 3HPRA 3CT6A 2ZRJA 4MA5A 3O95A 5LZ5A 4Z2YA 4PE5B 4RIHA 5CW2A 3WL7A 5TPZD 4K2HA 3L7MA 2F1JA 3TFSA 1J33A 4EQ6A 3CW2C 4DS4A 3ERCA 4K9QA 3H40A 4IH9A 5H16A 1NMQA 1CI4A 3LFTA 2I6FA 4KLZA 2JIMA 2H5JA 3KPUA 3FCYA 2PVPA 1DO8A 3Q41A 4C0LA 5KWIA 2I6UA 3I4FA 1M2KA 4HQKA 2EJVA 4CTNA 4WY2A 2G4CA 3HLKA 3VO2A 2FUCA 3D0QA 3PEYA 5KG7A 3B5IA 4TRNA 3GIKA 1NQAO 3D43A 4FX5A 1Z63A 2PUFA 1DAEA 4QBTA 2YR0A 3QFSA 1KMHA 3D6JA 4U3JA 5J0QA 5KQGA 2A59A 1NNUA 2F8SA 8ICMA 3JYQA 5FOSA 4HNHA 3VNSA 3ZDEA 1QYDA 3ADKA 2Z3WA 2Y8EA 1BE0A 4X1IB 2EYQA 4GKKB 5DIZA 1IVNA 1Q6ZA 5THKA 4MRAA 1WEHA 5CVDA 1D8YA 4ECSA 3O1LA 1Y1LA 4E7OA 1TM1E 1FDSA 4PJ0U 1N6NA 2YWHA 5TEVA 3WA6A 4BLPA 2XMZA 1J22A 3UPTA 3KPVA 5DBOA 4BCBA 4AT1A 1GPAA 1L4UA 3PX7A 1F0MA 4JJGA 1R27A 2PMBA 2QS9A 4PPXA 1UBGA 4RTJA 3KB2A 2W48A 1PDOA 3QNUA 2F17A 4JENA 1JKJB 3SZOA 3O74A 3PYMA 3CLKA 2NUTA 1ETUA 4PO3X 3I3OA 4FOLA 5LZ7A 1YZNA 4GZMA 2R7KA 2BKEA 4HH3C 3N59A 4CQJA 3MSCA 5K0FA 4Q05A 2WAOA 3C7AA 4YRRA 2CLEB 2EBWA 2CV1A 2ACKA 1RT9A 4JA0A 4RK6A 3G2PA 2OBMA 2HLDD 4MINA 3QVMA 3WE7A 3P2EA 3PHIA 5L6LB 4BQOA 1N3YA 4R7TA 3KZKA 3PX4A 4FP9A 4NZOA 4BVKA 1TDJA 3KTOA 2AGPA 5IHXA 5EMLA 5LB4A 5AM5A 8ADHA 2ZTUA 1YOVA 3MW8A 2OO3A 2PVSA 3PSHA 3ZLVA 2JJ8A 2CJYA 2R48A 4UU0A 5T8KA 3RC1A 2ZBDA 2REQB 1B76A 3CPHA 4YG2A 3NBUA 4N82A 3H4MA 4UEQA 3BIOA 2FPGA 3ZE6A 5H02A 1UWKA 2W2OA 2Y0DA 1KGDA 4UAZA 5F3XB 4ZOLA 5BWLA 2ZW9A 4QNNA 3RW9A 3G2LA 1FF9A 1KI2A 2YTUA 2VA9A 1ISPA 1SVLA 4A10A 2EZ9A 5K3BA 4U2FA 4EB0A 3JQRA 3FA2A 4WUVA 1X1AA 3S2YA 2DBZA 5P21A 3F8TA 1LKYB 2Q8PA 1ID8A 1M1NB 5FI1B 4LE2A 4TV8B 3FZNA 2R8GA 3NNNA 2ZTCA 1N2CE 5F5LA 2J1LA 3Q8MA 2JARA 1SCUA 1MAAA 4GBMA 1JMVA 4FDVA 1QTRA 3HKBB 4I3FA 4DCOA 2AZMA 4QJIA 1P62B 1XXLA 4O4IB 2A33A 4KGDA 3W5VA 4RQ3A 1O6GA 3RSSA 1YQUA 3BWVA 4NFYA 2PRIA 5AVQA 4IWNA 2JGEA 1ZMRA 1AV7A 3E3AA 1WXEA 4WY5A 3RV3A 3B3QA 3L41A 3PPXA 1RBQA 5KFVA 5BWMA 4DIFA 1Z35A 3LVWA 1BAPA 5T7BA 3WIDA 1RACA 1LLQA 2XMQA 4ZA2A 3Q0EA 4IDHA 3SKVA 1QZTA 1ODTC 1THMA 4Y6QA 3ZOZA 2O8BA 4TZTA 3NTXA 2RONA 4GIBA 1PQWA 3TQHA 5GV7A 3M5WA 2HCRA 4EDHA 2BD0A 4E4YA 4ZGWA 1Y6FA 1ZQHA 1CUVA 1I3MA 2BMEA 4CM6A 4J9UE 1XTSA 4QSHA 2YOHA 2PRSA 4EJSC 4ARBA 3EIOA 3CX6A 4GXRA 5DHSA 1XELA 2QJTA 1EJ6A 5TB5A 2NU9B 4QM6A 3LQKA 2MYNA 2FPMA 2QVXX 4ABYA 1NFQA 2DPHA 5CB8A 4ZTBA 3DEJA 2JEGA 4C6SA 3F2VA 3MJDA 2AMJA 2VNIA 3D8TA 9ICIA 1VI2A 1QVVA 5DDMA 4MMYB 5AQ1A 5I7UA 3NOQA 2YWFA 3B8EA 4L6CA 5F1YA 3HBMA 3KPWA 5H9VA 1IEVA 4KR0A 4FSDA 1JFRA 1QE5A 1ONSA 3S7ZA 1DWOA 1NK6A 1I94B 4E5SA 1Q17A 3JQ8B 4EHLA 1B7GO 3TX6A 3UMCA 1DLJA 4RXTA 5IBQA 3AHCA 1R8YA 1IG6A 1R16A 3F71A 3UC9A 2GWHA 2PA0A 4NAVA 3G8AA 5L95A 1UMBA 4BVFA 3GGGA 1FSZA 4XYLA 3PLNA 2G1PA 3GNQA 4L16A 3N3AC 5B7GA 1PK9A 5ALPA 2X19A 4ZVOA 2LI6A 4P3OA 4ID3A 4K28A 4EHKA 1MC1A 4PG7A 2M32A 1PHPA 2QI9F 2IKQA 5C7YA 5IWAB 1VL5A 1O6CA 2Y2VA 1BYUA 1P5JA 4EMBA 1FMCA 2C61A 4GKAA 1PSZA 3W8FA 4G26A 3PDIB 4MLPA 3RDPA 4UUAA 4F4ZA 4PSDA 3C5HA 3RF9A 1D0VA 4AN4A 2FVXA 1UM9B 3O94A 1CS0B 4H6PA 5KYWB 4LJ5A 1CRXA 2QVBA 3FCOA 1WJGA 4L1KA 1H1TA 5CM2Z 1WUJS 2AS0A 4LXQA 1E63A 3AB3A 1RQPA 4RDXA 1VSVA 2BFPA 2AI2A 2O23A 1Q46A 3EVBA 1JDBC 2MSKA 4V02A 3C1AA 4ND8A 3GVCA 2AZTA 1RHUA 4EQ6B 5C35A 4WLNA 5EPOA 3Q8SB 1V96A 3CZRA 2F1IA 1GCOA 5LKRA 1RYRA 2QG6A 2WJ3A 4MI1A 5J0XA 3U13A 5E3HA 3E0FA 2I7VA 4KH1A 4RMNA 4MTLA 3F9RA 2RHCA 4EG3A 2SECE 4NE2A 4AZTA 3UT6A 2LCQA 3KZMA 3RRXA 1TQDA 1H9BA 8ICWA 1COOA 2VZ9A 5B55A 1M2GA 1KMHB 4R3NA 4U3JB 5JRDS 5KFPA 4CL8A 4I3GA 4UE3S 1OFUX 1CR6A 3IVRA 1CUZA 5J2IA 3T4PA 1A8PA 1YB2A 2HBLA 1X66A 3DB2A 2VC2B 1BOFA 3OETA 1MV5A 3MJCA 4M0UA 3RRHA 2GZDA 4OQYA 4C4YA 5HEKA 1P3JA 2Z83A 1NK5A 4JWTA 2C4UA 2WWHA 4LXYA 3HYRA 2CSUA 5TDHA 1QR2A 3FY4A 2XQJA 3ONFA 1E2HA 2N46A 2XH8A 2AC7A 4HVAA 3OUTA 1QO9A 1YU9A 2EKQA 3SX4A 1WXQA 2PBZA 4Y9UA 3JD0A 5H68A 4UZFA 2H85A 3RABA 4J3NA 2CL7X 1O1YA 2WINI 3ZNNA 3K72B 2IHMA 1KP2A 1U8XX 2NUTB 3NWJA 3ZBPA 3DE1X 4TVKA 4WPGA 3DUFA 4HY3A 1AN0A 1JDVA 3K9CA 3EDCA 1T5IA 2LM1A 2W7TA 3LY8A 5B6IA 3C85A 4M46A 3NASA 2XYGA 5I9TA 4UEJA 5TF0A 3GWZA 1DIOB 4PFQA 4CCAA 3KJIA 1JUDA 2OZEA 2GH1A 4UNIA 4WACA 1Z16A 2PYIA 3HADA 1Y6RA 4Z51A 5EVJA 2FK8A 4K9SA 1XC9A 2IBMA 1E79D 4YJKA 3KB1A 4FHFA 1P8AA 1YOVB 2OCPA 1GPYA 1WYGA 4FD2A 4IIBA 1M2NA 2IE8A 3FH0A 1UEJA 2OMEA 3ICWA 1U3DA 2WF8A 2W58A 2GYWA 2VWGA 2CXUA 2HJ9A 3G7SA 2C3UA 4JMLA 3NU1A 2HMXA 4V0OA 3IJ5A 4YRMA 5JRTA 1SAYA 2FPGB 3C28A 3TQTA 1TGYA 4P7JA 1FUEA 2BGGA 3T9FA 2CF5A 4S1TA 1ZD2P 1VTKA 1R4NA 2ERXA 4MS4A 2W8KA 2QA5A 4OGKA 5B58T 1V8OA 4GNRA 3LQQA 1IQ0A 4M2LA 4UBNA 1IMJA 2BDTA 2ECPA 4PPGA 4CMEC 2Y67A 4PPFA 4JSRA 1SCUB 1IQPA 5SYNA 2E5LB 3BREA 1YRQA 3FKQA 1OXTA 2CVHA 1NA5A 5KMGA 4DJTA 1R0LA 4FYMA 1XZDA 4M37A 5KFXA 1JWBB 2HHHB 3AY6A 3BE8A 4KBGA 1OE0A 3R6LA 1SUCA 4IF6A 4RGQA 1HG1A 1DK2A 2EF1A 2CLSA 2FZ4A 2HEIA 5IS2A 2IUTA 1FLDA 2ZSFA 2A1IA 4LRUA 3JZAA 3BH7A 3ACDA 2KOBA 4NV3A 4MW2A 3N05A 3DDWA 4Q3KA 1GZSA 3K8YA 4Q1AA 1IQRA 3AF0A 2XWJI 4LQ4A 1Z5NA 2R9VA 3HB5X 3AUOA 3HA3A 4RCYA 4UREA 5TE9A 1WQ3A 2JFFA 4HI0E 4NV1A 3W8EA 4OXYA 4DLXA 3HE3A 1CWUA 1OWOA 4ZKEA 3X2SA 2B4TO 4LXTA 2YQZA 5CG2A 1M7GA 3UZUA 4IDBA 3WHKA 2RI0A 5K45A 3L8DA 2H54A 2Z4RA 5K09A 3MJFA 2AKEA 4KYUA 4U6QA 3ED1A 2JH8A 2KLBA 2PS0A 1T2AA 4JVLA 4HLNA 4DILA 1XFAA 4J1SA 3H8VA 3HCEA 3MD9A 3SSMA 1XRMA 5NULA 2VPPA 2ISPA 3JQBA 3C8MA 5CT5A 3EUAA 3AJEA 1LZLA 5CFNA 4M88A 3WMXA 3KQTA 3AT1A 2BZGA 2ZSIA 4DNQA 2E49A 5BNZA 1NZFA 2MSWA 4QOGA 3SAGA 4LEIA 3D2LA 4RQBA 4I7EA 5G1OA 4F3CA 2HD4A 2DF8A 4MROA 4R69A 3N58A 4C5AA 3ZWVA 1YV9A 4NC9A 2P5TB 1N6LA 5G41A 2Y1DA 4QGFA 2WKQA 1BYIA 3C8HA 4MV8A 3KZOA 4NMLA 2BCJQ 3QLUC 1B1CA 4MCAA 1UMBB 4FYKA 2FK7A 4OSEA 5JDIC 4P7BA 1ZIDA 4MUEA 4XWTA 3KOUA 4B73A 1AMUA 4CVNA 4QBFA 4HRXA 5AMXA 4ND7A 4TTIA 4DNFA 4D9KA 1V8ZA 4XCQA 1JAZA 1XN1A 3FFBA 3LYLA 4Q6WA 5G4KA 2KEYA 4IG9A 4LWQA 4KYIB 2AX4A 1X19A 1I36A 4Y9SA 1KFTA 2H7XA 2C9YA 2P4EA 1XP5A 1O9GA 4HVTA 1B3BA 1F48A 1ZQ1C 5MDHA 2QJFA 4YXWD 3V00A 4UATA 4KQWA 4N3CA 1SUSA 1GLVA 3G8DA 5BMVA 2JIPA 3ZS9A 4K2AA 5BXQC 2ZANA 2G9UA 1EXNA 1IUNA 1ZJJA 4Q7LA 2UAGA 4QOHA 4EG0A 5H2FU 1U7PA 2B8JA 2J08A 4M9UA 3L04A 3DXFA 2O07A 1DBRA 1QVWA 3CBQA 1I7PA 4RHEA 2IYNA 3GARA 1PCXA 5A5VA 1HYHA 4KP7A 1NE7A 2RG1A 1JH8A 1PG2A 5DNAA 1Y9JA 3VTFA 5KTPA 3CEMA 2NU7B 4OHPA 5TR9A 1RM0A 5FPTA 4ND8B 3BTOA 1EVZA 4IDCA 2B7BA 1KJ8A 2A4MA 2ZZNA 1ZQPA 3O3CA 3WOVA 1C5KA 4MV4A 2OQRA 3DG9A 3L02A 3W5DA 3BXPA 1YZVA 2GHIA 1BCRA 4YHHB 3EZGA 1VDMA 1JFFA 2O3SA 2FPOA 1FU4A 1T8WA 4DV2B 4YUZA 4EY8A 3I34X 4TTVA 3NDPA 3R6WA 5TJ9A 9ICOA 2HDWA 4BUJA 4YRBA 1UBSB 2N1RA 4UCFA 2H3FA 3D3WA 4UCXA 1R5OA 4GT1A 4GWKA 1JFLA 2PUWA 4PO8A 3NM5A 1FRVA 1YCFA 2ZVJA 2REXB 4GYKA 4JIGA 9ICBA 1TZ2A 3ZWXA 4EB3A 4JLWA 4YMNA 1EX7A 3WNBA 3NT5A 4CXMA 4YCCA 2BEVA 2BM9A 5EIAA 1ZD8A 3EXG1 3IPAA 4D9HA 3BGVA 2DH5A 2G7MC 3HCCA 1KP9A 5I9MA 2EJTA 1Y6GA 1XRPA 4OXRA 5DM0A 3RR2A 1M6YA 5KL8B 2AFRA 2I33A 2YRXA 1BO6A 1TD1A 4BLVA 3CR7A 2BGKA 4XSVA 3TJMA 2KJ9A 1N92A 3V8BA 3D6AA 1Q15A 2W04A 4B85A 4MYDA 4QECA 5EFOA 2RHFA 3LLUA 1CZNA 3Q3VA 1QX4A 2JIBA 4OP3A 3B12A 3GC6A 2IZ0A 2V7EA 4ALMA 2GM4A 2FFHA 3VPSA 4J0CA 5F76A 1DC6A 3G9ZA 1D1TA 3DUFB 1KOJA 1E5VA 3LPAA 2DU8A 1S96A 1AMOA 1Y4DE 5COAA 1CETA 3KTAA 5J4VA 1U47A 2QMEA 5B6JA 2I99A 5DP2A 1LDMA 2JEIA 4Z7JA 4I6GA 4QYTA 3KLNA 4UB3A 1CDDA 4UMDA 1VC2A 3EB9A 2AXEA 4NESA 2FAXA 3QIAA 1S5PA 3KHHA 2X8BA 1SL2A 5D86A 5FBRB 1Z47A 1RYBA 2BQ3A 3EVCA 4S1VA 4UU1A 3FYUA 4HKTA 2EZ4A 4QRIA 3LCRA 5BQPA 1TM5E 5TT0A 3NM6B 2BCUA 1ZOOA 4J49A 4MR8A 1J0BA 1UBMS 3SGLA 1V8FA 3Q3CA 3Q9SA 4PSKA 2WYIA 3PC2A 4QD3A 3QBTA 4ZCSA 3MERA 3CMMA 3DE2X 1XXHA 3WYNA 3RVNA 2Q1UA 1NW5A 3DYBA 2O6LA 4W1SA 1R4NB 4MS4B 1TTQB 4DUYB 5DB4A 3UK6A 1WTCA 5C37A 1KRHA 1QSYA 3C2KA 1H9CA 2YUTA 4LRWA 4RIGA 4O5EA 4XB1A 5J2KA 2PTGA 3I6YA 1F2DA 3PNYA 2ZK7A 5KMGB 4OLHA 3EFOA 3P97A 4RD6A 4P54A 2VT7A 2J45A 2DQKA 2FMTA 4YMHA 2OOKA 5ALGA 4XGNA 2WSSD 4PQFA 3GEEA 1MW8X 1Z62A 2PJRA 1GNLA 3K0FA 2W3RA 2X1MA 4A82A 1N63A 4U63A 2O1XA 5BQFA 1H0KA 4P4LA 5JD3A 1RQRA 1FO4A 1KDRA 1WD5A 3IT0A 5DW3A 5LQSA 3JQ9A 3K16A 2C42A 1OYYA 1C8VB 5E4YA 2RB5A 4RMHA 3QMVA 4DCNA 2EQYA 1NQTA 3JQ7A 1XL1A 1AA9A 3D4OA 4RH0A 4MKFA 2JFYA 4CM9D 4TWJA 1XJWA 2X0NA 3VHLB 2MSLA 2PBFA 1GAXA 3FFXA 5DI9A 3AQIA 3I39X 5J23A 4AXXA 5ELLA 2HIMA 4GSYA 1IZZA 5TS3A 4CNBA 3H8SA 4JJ4A 2RAFA 1TAMA 1D9FA 4YT2A 5JZ9A 1NC3A 5CTAA 3UGQA 4TX1A 1U65A 4L0DA 1A9PA 3RKUA 4FR0A 5DM2A 3JX9A 1NRXA 2Y0PA 1Y7LA 3FRJA 1NN0A 1PVVA 4E22A 3AM5A 2JFZA 2ZI4A 1ENYA 5JYDA 5KFHA 3Q8WA 3MB5A 2JCSA 4DLTA 4RT3A 3IUQA 1VPDA 1Q0UA 4FS3A 5DCYA 1ZU4A 4ARVA 1ZUD1 4G5OA 4NICA 1MB3A 2Q49A 1N0WA 5A4JA 1V38A 1EMDA 1SN7A 2NV6A 2F77X 1Y4ZA 3HDYA 1BG6A 4JI6B 2C0CA 1D4ZA 4TLBA 4ZFNA 2NZJA 3LXRA 1D2GA 3T34A 3LHKA 4US9A 2C9DA 1TZBA 3E9NA 1A3CA 4RQ4A 1YO6A 3CCBA 3RCBA 3HYTA 1YC5A 1GEEA 2GYUA 4BX0A 2A9QA 5SY9A 1ICIA 2Z4SA 2CFOA 2B2XA 3WLIA 4GNKA 2QQEA 3ZI7A 2RGGA 1CVRA 3DLIA 5FHQA 1HDOA 1VCIA 1B0AA 5G4KB 5EKTA 2PG3A 5CJ7A 2ZWOA 1EFDN 1ENPA 4DLYA 2J41A 3QVTA 4UTVA 2NZ8A 2QDXA 3OPNA 4R8VA 1TZCA 4B35A 3GCXA 1NUUA 4O3PA 5KX5A 2HHVA 1A2QA 3PFCA 4CLEA 1O95C 1TAUA 1FYXA 4K6FA 5BMVB 5AOCA 1DC7A 4X3OA 5G40A 1I4TD 2ZTDA 3DMFA 1DCTA 4BQEA 3SQWA 3JVEA 3RI3A 3CUEF 4LZOA 4LE1A 3U4HA 4ZOEA 3PS9A 2IYSA 1Z37A 1Q7TA 4RZRA 3CPJB 3L77A 3PICA 4DIBA 1QRRA 3BDVA 4DL7A 3K5PA 2GN9A 3EC1A 3OSPA 1FA9A 4KBYA 3GJXC 4BO0A 1I7NA 4PLZA 2HOIA 5KFKA 2WPDD 1E9AA 1CR2A 4EUSA 1UBJS 2LGJA 4INPA 3N0RA 3NGLA 2QJRA 1EGHA 4ZAVA 3D5TA 4M76B 4B43A 3PZPA 3OP1A 1Y8RA 3HXQA 2Q3FA 3Q3EA 5KTOA 1JHPA 4S1WA 3RJEA 1BCRB 1XEXA 4K0KB 1D04A 1JFFB 2C5SA 1QH1A 5DGHA 4KUHA 3ZCTA 2EX1A 3SEIA 1Z26A 5EZSA 5I8PA 2GM3A 2WC1A 3CLRD 4WWHA 3M70A 4HDQB 3D3WB 4C3OB 3RB0A 1RYUA 4QZIA 2EVWX 3ZNPA 4TLDA 1XK7A 4YMWA 5JCXA 2PUDA 2CV0A 3THWA 4J29A 4NYJR 4PC1A 1EHIA 4DZZA 5LQMA 5LQUA 1BHSA 4LNUB 1QGUA 2BEVB 4RLQA 1JQLB 3NBFA 3IP6A 1NASA 3QHPA 4IRKA 4I2CA 1NW7A 2O2IA 5LMUB 2OBXA 4QQRA 1E1NA 1R0CA 1AS2A 4A1OA 4JV0A 3DW3X 1U02A 4DL3A 4C0WA 5J0RA 3UUGA 4BLRA 4P3KA 1Z0ZA 4PNZA 1ZCBA 1G5IA 4UFOA 3F74A 4AK9A 2PX0A 4YP0A 4MV0A 1SRRA 4GLJA 3IPCA 1MAUA 3AIIA 2IK8A 4QZDA 4L8VA 3QMWA 3VR5A 5D84A 2GFHA 2QMYA 2YJTD 4TWIA 5FV4A 1FMTA 2X77A 4NXNB 4RORA 3L40A 2DFNA 2C8VA 1GP2A 1Q16A 1IBCA 4ENSA 3P8ZA 1U7TA 3KTAB 2VPQA 5B4VA 5BR1A 1Y34E 2VPWA 1F4PA 2C2OA 2W6JA 4MB6A 3RRMA 5K0TA 1HUZA 3WGIA 3V7UA 3HFRA 1KFDA 1E59A 4S05A 1LX6A 3TD2A 5IZ4A 1MAHA 1FNCA 5JY1A 1S4QA 1LLUA 4IDQA 5DJ5A 1AIPA 2XGJA 3M9LA 3NH9A 2WM3A 2I9GA 1G6KA 1GFZA 4TS1A 3FYUB 4XUCA 4RK5A 3RQSA 4QEZA 4RQ7A 4BHTA 3DM5A 4LGMA 4PG6A 4MR8B 1CDOA 3D7RA 1WQ1R 3H2IA 3NDIA 3WIBA 1UZNA 2QR3A 4BN0A 4GMFA 4ATNA 2QMHA 4A5OA 4D0NA 2JIRA 4Y1RB 2O5EA 5C53B 4JX8A 2I29A 3AVUA 2WB4A 2BMVA 4UARA 1XF9A 4DLAA 2BKAA 4ECAA 3GN1A 1VKHA 2IYWA 1WCWA 5KG2A 3HPQA 4E0BA 1JA9A 2PWAA 5REQB 3WWDA 3TOCA 5JXIA 4MEYA 3MHPA 4RMGA 1Y5NA 1ZVVA 1HZZC 5KNCH 3JQEA 1NJ5A 5EQFA 5AVXA 2K8AA 2Y1IA 3NX4A 3K2QA 3L8GA 4QAQA 2WHRA 4WK6A 2C3PA 1NM5A 5ECWA 3EFOB 4L72A 3DLCA 4C9BA 2DECA 3H87A 1X2BA 1T0UA 5SV2A 3S2ZA 4KPUA 4ARSA 5ECDA 1MA7A 2FJUA 3UIEA 3K0FB 3T7RA 4YRTA 4WCDA 3BK7A 1AF7A 2C0QA 5KSWB 2GM9A 2OKCA 3G8CA 5DYGA 1KRWA 4BMDA 4KN4A 2ES6A 3PHLA 4JLUA 1Z82A 5C7LO 3FWPA 2HK6A 3KU4A 5IVHA 3OPXA 4YJGB 1R1DA 3DDCA 1GPMA 2ZIEA 3KSRA 4EUFA 5FBWB 4ECTA 4FGZA 4HDCA 5AO9A 2G17A 5KJ6A 2XYRA 5J58A 3KKAA 3JQ7B 2CGEA 3A6EA 3ZJYA 4AP6A 3EPHA 4NJMA 4RGBA 1HUOA 4G1EB 2OORA 2AGQA 2JK0A 2VDVE 2PYZA 5G0SA 1T8PA 2Z1NA 1PR0A 3GRVA 1QP0A 2PLAA 4QG3A 1U8AA 1NUAA 1SVMA 2BGJA 1KJZA 4BB9A 1PEAA 1L5UA 1X1QA 3UF0A 3C1UA 2PR2A 2A9VA 3QW2A 4C8LA 4YP5A 4RWZA 1YULA 3THOA 2R86A 4LK3A 3PR1A 1RABA 2WD8A 3WVNA 3IR5A 3H2KA 1ZCZA 4G0XA 3PBKA 1V5EA 1IZ7A 4LQCA 3R3YA 1VIMA 3DOHA 2V3CC 1NNEA 4HX2A 5K0ZA 1QDUA 1VLBA 4DMMA 4OK5A 1HL3A 3WLQA 1WL8A 1UZMA 4NZZA 2E8OA 1DJPA 2AFVA 2X5NA 5EHNA 1AKMA 4AY4A 2HMVA 3E9MA 3MCUA 5LBUA 2C8LA 1V8BA 1DEOA 3LUCA 5AW3A 5JZSA 3H2ZA 3SYLA 3COSA 1SXGA 3TTSA 2FMXA 2QR2A 3MFIA 4G85A 3BS7A 3B48A 3D2BA 4KV9A 4J0DA 3SC3A 4OQLA 4X61A 1SKBA 2K7FA 2HK9A 3IR7A 5DYIA 4Y6PA 5GJVC 4OH1A 5C31A 2QR5A 3X44A 3IEUA 3FBGA 2QL7A 4B6QA 4FQ8A 3Q40A 2B36A 4M9CA 2QVLA 4RK7A 2QN9A 3ZHCA 4KDEA 4RF5A 4IBOA 3QM1A 1UOQA 3OPQA 5EL0A 2CLOB 5A9TA 3K15A 1UKCA 1RXWA 2DM6A 4XYMA 4ZREA 1XQVA 1ZICA 5JXJA 1XR3A 2W6PA 2NU6A 1HK7A 4MEXA 1E5DA 1CQJA 2HNAA 2B61A 4ZRDA 2Q3LA 3HY6A 3D4IA 2OR3A 3BICA 3K0BA 4BTLA 4DF8A 4OIFA 1N5LA 1ZKDA 3N76A 4PQRA 3AV0B 4YJ2A 4DLUA 4CYMA 1UT8A 3U4IA 3NUQA 3UANA 3WLJA 1Z13A 3W2FA 4EFNA 3IGFA 1TXGA 4IV8A 4J91A 4EVIA 2V6BA 3N2EA 4LFCB 2VYVA 3AEUA 4ND4A 3EMKA 4UB6U 3WMWA 2DHCA 5F12A 1EVIA 1YB7A 1NRIA 1FUKA 1H2XA 1PL0A 5DK6A 3PQ7A 2JI6A 1Y8RB 4ZQHA 2FFJA 1QORA 4D2IA 4WCVA 1XEXB 3O84A 2P3OA 4D9BA 1IVYA 1QH1B 2FPIA 4IEEA 3ORFA 5K3CA 1P74A 1J39A 2P0AA 3BX1A 5C3UA 5KFNA 3DE0X 2ZCUA 4DLGA 3CQ9A 2P75A 2GOLA 5J0YA 4YCMA 4I50A 5KREA 4JEIA 2WTFA 4C5CA 2B2NA 2I7TA 2PWBA 4GAEA 4MDEA 1XQ1A 1Z8FA 2FMQA 3THWB 1C9JA 3ZD6A 3ZX5A 3GJ6A 4UOZA 1QGUB 4FMDB 3DZIA 4H27A 1ZM3A 3H17A 3N2IA 3STHA 5JMTA 3PHGA 3IJPA 5IZCA 4CGYA 3H9UA 2VTBB 4WVLA 1XEWX 1HYBA 2H2WA 3AUXA 2FQ1A 1ISIA 1GL3A 3ASYA 4JOBA 3K5WA 3WWEA 4R0VA 1QOQB 4CEJA 3QOXA 1Z00A 1JFSA 2HZ7A 2D2XA 1B42A 4ALKA 1BEUB 3ADOA 4CKZA 1LRLA 5C1DA 4M8KA 2UZ1A 3AY7A 2A9RA 3BQ0A 2PO5A 2FZVA 4YQWA 1CQPA 4DNXA 4WZBA 2EG9A 3K0AA 2BFNA 1QIKA 4E3ZA 2WSLA 3X1ZA 4HLQB 4TMTA 4CIVA 3GJ5A 2ZUVA 4LPSA 2R8PA 1GQFA 1MNAA 3HGMA 2EQBA 3VPAA 5LWHA 1ZC4A 4TS4A 4EATA 3L4BA 1XIVA 2H1VA 1RWOA 1HSZA 2V3WA 3VU3A 1RVV1 2CLKB 4ZCPA 3RR8A 5HR5A 5CK4A 2ISQA 3PC7A 2BIFA 1YS9A 5J47A 2QNBA 4DJAA 2K4IA 1NXOA 2EANA 4ZV4A 2XDWA 2J4CA 3GPBA 1WDWB 3E48A 2QMOA 2CXQA 1MVNA 4Y9TA 1Y5MA 4RA6A 5DDIP 2D8AA 4YJ3F 4ED2A 1PEKE 1VLJA 3ELBA 3HA2A 4B83A 4XAQA 2NX2A 3CB2A 4ASUD 1ECFA 2C57A 2FUG6 5K8LA 3PKZA 4QWCA 2B99A 1GG2A 4XKJA 3BVPA 2BDUA 3URKA 5HRUA 4OFZA 1TLLA 4IS7A 3HVJA 4BWJA 2L82A 5H83A 1FNSA 4XGKA 2QZPA 1E5QA 3Q8RB 4MWSA 5JSZB 2WM8A 4LYJA 4BEBA 2AGVA 4H7FA 3VVBA 3IUNA 4MIYA 4RSMA 1UC8A 1DU4A 4G5HA 4TWZA 2GTHA 1P4HA 5IT9A 2ZIXA 3ZC3A 4PGAA 3OTIA 1XVAA 2SBTA 4JYCA 1L7RA 4KLUA 3FLAA 1R8XA 2HVIA 3G0IA 4XQ9A 5D5HA 4B87A 4EECA 3S44A 3RC8A 2GVZC 3ISVA 2RH4A 2Y9UA 2OO5A 1N7GA 3NWBA 3GIJA 2NTEA 2H9AA 4KPUB 3LGSA 3JVVA 2IGTA 5CGZA 4KQFA 1YR8A 3QEMB 3IQFA 4LVUA 2R84A 4I4IA 4KXXA 3G1TA 1V47A 2MYTA 1RMTA 3OECA 1LDEA 5LYJB 4QDZA 5EE9A 3NTOA 4H1WA 2EZUA 4XDHA 3NHYA 3TUJC 5JC8A 3U5TA 2RGCA 3ZV6A 3TGLA 4X7RA 3FZGA 3W6ZA 4OHVA 2C2KA 4QQNA 2JIQA 2C2DA 3T0GA 2ZXEA 1WXIA 2BN4A 5G0TA 1BQEA 1EP9A 1Z7YA 2JJYA 5DASA 4NJMB 1ZXLA 4C6HA 2VKTA 4YMIA 1PK3A 2I6QA 3BIXA 2BMAA 3MOGA 4MS3A 3MABA 2WMNB 3KFXA 4MUFA 3OJEA 2M1XA 2W2NA 3INYA 4LHYA 1K8YB 5CCBA 1U1GA 1IIRA 4CT0A 1KYYA 2OHOA 1YKSA 2RH8A 1HT0A 1Q1BA 4HFMA 1G0NA 3ICPA 4WN9A 1CUEA 3KKKA 4M0AA 1PWXA 4OI1A 4ZI7A 2L18A 1SVIA 3PUZA 4ELTA 5F7JA 3B1ZA 2JHPA 4O08A 2KX7A 4QIWC 3S8EA 3OJ0A 3KKLA 3TAPA 1EFTA 4NEHB 2ZVQX 4G5YA 4YRCA 4OM8A 4HBGA 4NCNA 1JPVA 4K87A 3RUHA 2FOLA 1OLXB 4MPDA 4RFLA 4B5LA 3OFJA 7ICGA 3GEBA 1DXYA 1ILWA 5L3SA 5BSVA 1P7WA 1QU2A 3DE4X 2AG0A 3WMGA 4EH1A 2BFCA 4NZ9A 4NE9A 2FMHA 3RM3A 3FKSD 2VDQB 2XY7A 2PN1A 3NIDB 2ODNA 1CVIA 4C2BA 3IAM1 4Z9BA 1ZZGA 1T25A 3AP2A 3FCEA 1LZKA 3ESRA 1T3GA 4P4GA 1B14A 1Y3FE 4YLEA 2PZGA 4UW9A 4BLSA 3ICCA 7ICIA 4IR1A 4B9TA 1BE6A 5HUQA 3KUKA 4R9SA 4EGAA 5B2EA 2QORA 3O1JC 2VH1A 2REOA 2ODWA 2D59A 3TZKA 4O1HA 4XJXA 1R2QA 4O2RA 3SMQA 1T94A 1XUOA 4U0JA 4QW8A 2NU6B 1H9AA 2WAQF 2D62A 5LJLA 1CQJB 1H66A 3LWNA 4ZAGA 3I9V6 5IIOA 2WSYB 1ZVQA 1U45A 3S2GA 3ZGOA 4EJMA 1NJGA 1B0XA 3P27A 3UAWA 4YJ2B 4DR5B 4QT0A 2QN7A 3I2IA 2C8KA 1KY2A 2Q0HA 1FNDA 5CIQA 4Z6DA 3HDGA 2H17A 5BT9A 4LTNA 4B3HA 1UJ6A 4JJEA 1D8TA 4LBYA 4W6QA 3HL4A 1CU1A 1VFPA 3H2JA 2ENWA 2VJKA 3AEUB 4PPNA 4ZVMA 2WIKA 4XIFA 3N2LA 5BV8A 2VP4A 4GD3Q 3W06A 1E4VA 2N1BA 2KTQA 3CSSA 1IN1A 2O8FA 1JBEA 4JASB 5LOVA 2EW1A 2SKEA 2VR1A 1UA0A 5J4LA 1X7XA 2X9GA 2IYEA 2XIDA 2ZQ5A 3OQPA 5F5NA 1WLSA 1W9HA 2FPIB 2A58A 4LZGA 3P9XA 4C3ZA 4LYEA 3A4YA 1GZUA 1CZRA 3GPDG 4KWCA 4A8PA 3P7MA 5SZHB 2F6RA 1GTMA 3BN3A 2OA0A 5KFAA 3G13A 4XW2A 7ICEA 3C5EA 2CKMA 1R4ZA 1UPBA 1AX9A 1PGNA 3MIZA 1S0UA 5DE3A 3CNLA 1L3SA 4R64A 3ACCA 1XALA 2JH1A 7ICVA 2DFLA 4RZ2A 2I1WA 1VG9B 1QTIA 1RYFA 3KUXA 5IAAA 1ORWA 2HJWA 3G88A 4UM9B 1E1RD 1YZFA 4WDQA 4DLEA 1BS9A 4PEVA 3LU1A 3EDQA 3V4VB 3A3KA 1KIMA 4O2BA 2IWRA 3F3MA 4N12A 2GZSA 1Z00B 4YREA 2W42A 3NRCA 2WKWA 1PBTA 1RPAA 2C20A 2PT6A 1UMDA 2P9QA 4GBJA 2ZIAA 2H3EA 2UZ1B 4UASA 3PK0A 4G23A 4TRRA 3K0AB 3E23A 4CL0A 2E5SA 1RC0A 1DBQA 1BQ4A 1MGOA 4F38A 5LYJF 5CLHA 4XTCS 4QBIA 1XKXA 1W87A 3RTDA 1U49A 1KBZA 4IHQA 2QIPA 1P9NA 3ML1A 2XAAA 1V9CA 1D8BA 1N25A 3DO6A 2KBEA 3DMHA 3OU7A 1HE8B 1PLLA 2NO7A 1L5MA 4AFNA 3TMKA 3ZVMA 4D8XA 1BMTA 2Z2XA 4EKDA 4BEWA 2JVJA 3L2OB 3QLVA 2P1RA 3GYGA 3RH6A 4EG4A 4FEYA 5AP9A 4GMKA 1JJBA 4RA6B 1XMVA 1ORVA 1OXXK 2XHEA 1G42A 2QBYA 2KG5A 1PJSA 2FE4A 4LJAA 1NW8A 3AKYA 2B1JA 5ELMA 3RU2A 4R2XA 3G0GA 5BN5A 1LRJA 1FYWA 4LI0A 4YUXA 4JR1A 3I37X 1RWKA 3OPYI 2AQHA 2OHJA 1N2HA 1J21A 2L5YA 3TRKA 4DLKA 1A4RA 4EELA 3S40A 1B8VA 5I3ZA 3GFOA 2NZ2A 2HXYA 5BW6B 1YZKA 3ETEA 2ZIXB 3RTBA 5L1IA 2QTHA 4PHAA 1OC4A 4EJ6A 1P2FA 2BUCA 2CXYA 1TVKA 1A5SB 2NSHA 3P9SA 4M0FA 3CZAA 5T3UA 3Q0TA 1RPTA 5DNWA 4WUTA 1SGWA 1XP8A 1XNRB 3IIEA 4UPVA 3WBJA 3LPMA 3IDOA 1DOQA 1L5OA 3RYTC 1JW9B 3Q2KA 2HSEA 4BX3A 1DBSA 5DGAA 3GT3A 2V7TA 4M8IA 4N6NA 4I36A 1P0PA 4NFLA 4TV8F 1ATZA 3V1UA 3R9XA 2J0EA 4E21A 3HSYA 3T38A 4OJLA 3FDJA 1ABBA 4X94A 2NRWA 4TKZA 4IXWA 2XLCA 3NVAA 1IK4A 4W5RA 5DYWA 1I4LD 4PG8A 3JS5A 5BSWA 4O4IF 3ZW8A 1NTOA 5F52A 1FJ2A 3UBMA 4WKCA 1MO2A 2VHZA 4BO3A 2GK6A 2LV8A 4EPWA 2CWWA 4LDAA 1QAMA 3GG9A 3KXKA 5LP1A 1H2EA 2EBHX 1KI3A 1LI5A 1SC1A 3AVVA 4B76A 3G9UA 2AD5A 2DLNA 4K6GA 1EKXA 4KXUA 1JB1A 3ZN2A 2ZJYA 4A1FA 2P2GA 3WBFA 1HM5A 1CY6A 4P81A 4WN9B 3ZWBA 5D2CA 3QXCA 3B7PA 3NGXA 3IOBA 1NBIA 4Y9DA 4ZI7B 3B6IA 5FIUA 4YJ2F 4AD8A 2ZRMA 2BEUA 1WOYA 3GRFA 1Z9BA 4XRRA 1BJTA 2DTEA 4LCEA 4JAVC 4AP5A 3U56A 5HR6A 1KE1A 1QCZA 2YB4A 3C5CA 3ZZTA 2HFJA 3LXXA 4IIHA 5DG7A 1DDGA 1R0BA 2VH5R 3BJZA 4JWKA 5IINA 1PZMA 1FW8A 3MJHA 1ZQWA 4NL4H 3AUUA 5L3SB 1YMQA 1OBHA 3PVSA 1RAFA 2BFCB 4ZOLB 3SFZA 1XOIA 4F5QA 4KGZA 3RH0A 1BSVA 1AGXA 3H2GA 4NLZA 7ICFA 1NURA 1C1DA 4ODIA 4HEA1 1K6EA 4HWRA 1SELA 1DC5A 4DSZA 2VIIA 1F8XA 3DEIA 4TYMA 3I5YA 5CDFA 5AH0A 3U1BA 1GFSA 4F2WA 3VVCA 4QATA 4MWDA 4BC0A 1RXCA 3WAKA 4EYKA 4NE7A 5ITZA 4TTRA 2D74A 3WLAA 4EEKA 1LV8A 5I9NA 3DZDA 3C16C 2Y1FA 8ICQA 4LOIA 4Q3OA 4QJFB 4Z7QB 1AO3A 1L4HA 3O4VA 3VH2A 4B09A 2C3MA 1AJEA 2D4HA 3LBHA 3HBJA 1PZEA 2NO5A 4BFYA 1CHNA 4PHGA 5K9ZA 1ZJZA 4H59A 1T5SA 5EGSA 3KDAA 3NEAA 2O1SA 3Q3JB 2CT8A 3GD5A 2EIXA 3UJ6A 1J8YF 3CKKA 4BNDA 1DARA 5D5QA 1G3IA 1JS1X 1KAHA 1MC5A 3BKXA 5AXBA 4EO7A 2B9VA 1L5ZA 2JA2A 3CISA 3DYVA 3K32A 2O8BB 3AERA 1YE3A 4D4JA 2DR2A 1OKKA 2JD2A 3QTBA 2FDXA 1I7QB 3C4VA 3ICOA 3G2QA 1EE1A 4EI9A 3RAXA 1XRLA 2O8FB 1OC2A 1UK7A 1E2IA 5GGXA 3TLAA 5LOVB 2AFHA 1CERA 4GPZA 4KXLA 2VJBA 3TQQA 1MQSA 4PZ9A 1HYEA 2CE7A 2C4NA 2I9PA 4RJ2A 2REBA 3T1NA 4LBVA 1G2QA 1Y80A 3PGJA 1L5RA 5IUJC 2I1LA 4TN1A 2DTDA 3O3NB 1JDSA 2PCLA 1AC5A 3QEAZ 1MHPA 2KHQA 1KFSA 3PXDA 1HQCA 2IYYA 2EGHA 3D6HA 3VDQA 2E85A 2P3LA 4M9RA 3DYIA 4P36A 2P9TA 4G0YA 3OCYA 1LPBB 3O8CA 3HLTA 1JR3E 2JZBA 1L7AA 3WRXC 1OXBB 5I7AA 4FZLA 2O8VA 5F1KA 5HS4A 4W1QA 1N36B 3LE8A 3JSAA 3EOZA 3QU5A 1QF6A 5JLAA 2XSZA 2CZCA 5HUJA 1A9QA 1X7HA 2YWGA 4FBUA 2H51A 1C8KA 2EP7A 4RKEA 3WS7A 1SZCA 5EWGA 3MRSA 5EIOA 2H29A 1RRMA 4O2BB 5LNK6 2D5AA 4UULA 1ZG3A 4YMGA 2XGPA 1UXKA 5DHPA 1MR3F 1UMDB 1TV9A 1J2EA 3AUKA 1OGYA 3G49A 3VR3A 5KFFA 1RLJA 5AUNB 1BX1A 1W35A 5L4NA 3ZTWA 1LB2B 3A2NA 3G6XA 5D3QA 4OA8A 3EJ6A 3PXGA 3BA6A 3J81k 5FH9A 3O21A 2O59A 3UXHA 5J4KA 3EW7A 3ORYA 1EG2A 5FV7A 1B8PA 1UAAA 2OVFA 3D7LA 4WNAA 4LTMA 1VJ1A 2C4VA 3TZ6A 2B6HA 3P2KA 2VNAA 4L75A 4P9NA 2F9FA 2V7XA 1M9NA 4Y0NA 3OF5A 4UOEA 3VZQA 3V80A 5CHYA 4KHPB 4JXZA 4OL9A 2VF7A 2Z08A 2ZYUX 4B17A 2AXNA 1KZ9A 4RTSA 1YZLA 1ST3A 2QBYB 1KRPA 1WCYA 5CA0A 3IMCA 5IIJA 2G77B 1L7EA 3ELWA 4YHBA 4EX6A 1NV8A 1II8A 1GUFA 2BKLA 1AK2A 4KFRA 2TMKA 2G83A 1H22A 3AVXA 3D9QX 3E9RA 2HF9A 3OTHA 3EDRA 2PWYA 2R6JA 4UE2A 2AXQA 3GY0A 1ONNA 1YTLA 2TS1A 2W83A 2Y05A 4CHGA 1USKA 4R5HA 3MRVA 1W52X 3N75A 3BEOA 3GLHA 3AZQA 2VXCA 4QJ3A 2GSWA 2WJHA 2OEPA 4BGUA 4O1MA 3NC4A 3DOCA 3NT4A 2HTEA 2YYSA 1T2FA 2HHLA 1TVKB 5JASA 3HU1A 1JKMA 1S8FA 4IJKA 4W82A 5B1DA 3ZW9A 1KZ6A 4F5NA 5CTJA 4S1OA 1OZFA 2JFWA 3AEQA 3FTDA 1JR4A 5HKOA 3WSWA 4ZOLF 3G5LA 4UDNA 5K05A 4EEYA 1IZYA 3C6YA 1F3LA 3RSOA 4H9GA 3MFYA 4HCJA 3C15C 4GR4A 5IF3A 3KZIU 3RK0A 3RS3A 4KN7A 1LSUA 1Y6QA 3R9XB 2PX3A 3UV7A 4BKMA 2GVDC 1FRZA 2D7CA 3PD7A 3TIXB 4BAGA 4KR9A 3U6BA 4TYPA 3T15A 1ULBA 1YDGA 5F98A 4XVQA 1RR6A 3NIFB 3PSAA 1NY6A 2JLCA 1IM2A 1RKQA 2GLUA 4M38A 2NO0A 2VYQA 3OY7A 4MGKR 4DWIA 5WRFA 1E1YA 5G5GA 4JJKA 4BLWA 4C7MA 3NWEA 1NSFA 3D8RA 1DJOA 1RRKA 2OY0A 1T9HA 3SR0A 2DKOA 3KB6A 1RXVA 2IS6A 3TVTA 1A50B 3R2JA 3A0HU 2WK1A 1QZXA 4FC6A 3SEZA 4DFMA 3NXSA 5F78A 4GXTA 5BYKA 5L4SA 3E05A 1VLMA 2AN9A 3IKTA 5HMMA 1FCJA 2FX2A 1OWPA 1WWKA 2BEUB 2A9PA 1LDBA 2H7YA 3BE6A 2FWRA 3V1KA 1QG4A 3INTA 3ETDA 4OP2A 4NS1A 2IPNA 4G1UC 5C1BA 3HJFA 4HMOA 4DJJA 4KSCA 4OMFG 1QR6A 4GPEA 1ECWA 1MQ2A 3GI1A 2YQ5A 1NF2A 1TEXA 4WE3A 4LXIA 1XJ0A 2BBTA 4ZVVA 4KLTA 2D5CA 1C0IA 1HI9A 1GPUA 1AKYA 3TNLA 4F93B 5JATA 2O2ZA 3DZ8A 4QEKA 2R47A 3KZCA 3D3NA 4XOIA 5F9NA 4AWBA 1C1DB 1DIRA 2DPYA 3SIRA 4D9NA 4QPDA 3NT2A 1V5IA 4GYJA 3CZQA 1VLZA 5KG3A 3ET5A 3NC0C 2MTBA 3I23A 4RS4A 2CB9A 1GT91 4BKPA 1N5JA 1ZJNA 5B1HA 5ITZB 5T41A 4D4KA 5GTHU 2OCYC 3ZDAA 3TPZA 2UZ0A 3CLUC 2VEOA 1W2HA 2JLAA 4J03A 5A2QA 2V7PA 3E03A 1T1SA 1NVXQ 2B1IA 1IUKA 1N0IA 2OLKA 5B1SA 5J8YA 1EDOA 3L7AA 1H93A 3KVVA 1N6IA 3S0JA 3QQPA 4X0EA 3QVVA 3ZDRA 5CPBA 3EUEA 3KUDA 5DGIA 3RPEA 1K08A 1WMBA 2Z8YA 2PUBA 2XXJA 4Y30A 1VP3A 1PYDA 1K3UB 1HX7A 3WB2A 2QZ9A 2WHPA 4BNDB 4K8RB 4EMUA 4LYAA 3IERA 1WUHS 1HMYA 5E7QA 4GX2A 1U1FA 4TL7A 5EWLA 2C58A 4C22A 5A4AA 3UCEA 2R1TA 1HNXB 3AERB 2WTAA 3RQIA 4PG4A 1P6QA 3X1KA 4J8PA 1KIAA 3PU6A 2IP2A 3EYZA 4MFFA 4CV3A 3SOZA 2WAMA 4ELUA 2HDNB 1XCGB 5FUXA 2FGKA 3DAYA 1DUIA 3ZJTA 4HYTA 5FTWA 3BMOA 4D44A 5HFJA 1FQKA 4L08A 5EVCA 4AYWA 2XAUA 2XY6A 3HMQA 4E5NA 4N49A 4LDQA 3LVRE 1PJ2A 3OKCA 1YS4A 2O2DA 3QTTA 1ESMA 3L3FX 2OM6A 4II2A 3T0IA 2YDYA 2J6IA 3UT5A 2IIBA 3MWGA 5T3YA 3HU3A 1DAGA 2JZBB 5IASA 3H4BA 2HUNA 2FETA 1X74A 3H7AA 3ZY5A 5CP2A 2Z9DA 1T4BA 2V4MA 2V7BA 5MN5A 4O3QA 1UXGA 3MGAA 2I78A 1WDMA 4QFMA 1PQUA 3A0UA 1W30A 1Z56C 5IJ9A 1DINA 4CW7A 4DMUB 4RJKA 3R5HA 1XL0A 5IBRA 5HJ7A 4D81A 4EKIA 1LDYA 1EFCA 4Q9IA 4F9TA 1Y3DE 2FSVC 4NBRA 2X42A 3ZK9A 4HLUC 4KK4A 3BRCA 1GM5A 4HGZA 4U2CA 4DOAA 2I1QA 1NGSA 3PE3A 3DXYA