4EENA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
b'DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase-related protein
molecule tags Hydrolase
source organism Deinococcus radiodurans
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
total genus 82
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eenA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eenA01
3ESRA 3ZUPA 5AKXA 3ET5A 1JUDA 2NO5A 4J03A 1U2TA 3QUTA 2YY6A 2CFSA 4NAVA 3R4CA 3U7EB 2IOHA 5AHXA 3NIWA 4DW8A 1MH9A 3MMZA 4AS2A 1ZD3A 4L57A 4HYTA 4YIKA 2O2XA 2WFAA 4PNHA 3AR7A 3U7GA 4UM7A 2NYVA 4HGNA 3QYPA 2Q5EA 2ZBGA 5ALIA 1YV9A 2B82A 2B8JA 2RB5A 3VAYA 1AQ6A 5AKIA 2YMMA 3MN1A 3OCYA 3FVVA 3SD7A 1Z4KA 4G63A 2CN1A 3L8FA 2R8YA 2O9JA 1QQ6A 3WK7A 3A1DA 1RRCA 4UARA 1N9KA 1J97A 4C4TA 1QYIA 3F9RA 5AW8A 4NFLA 2YBDA 5ALYA 3AR8A 3R9KA 3L1VA 4HGRA 5AI5A 3WK4A 2IOFK 5ALNA 2MSNA 3NRJA 2JGAA 2HHLA 3KOOA 5AESA 3ZWDA 4BYGA 1IWOA 3ZU6A 4JDPA 1U7OA 1RPZA 1RQLA 4DFDA 5AVXA 2I6XA 5AVSA 3A1EA 2YFYA 3QU9A 1U02A 1Z4MA 3SHQA 1ZD5A 3N1UA 3AR9A 3AR3A 5AK6A 2I55A 2I54A 2I33A 5AI8A 2B1RA 3D6JA 3WK6A 5ALHA 5ALTA 1RLOA 1U2SA 5AKJA 3ZX4A 2W4MA 4KX3A 3QU2A 4KNWA 1VJ5A 4RESA 3W5AA 1YNSA 5ALOA 5ALPA 3ONNA 4EX6A 2C88A 3L5KA 2FPRA 1ZOLA 3QGMA 3WGVA 4OCZA 5ALEA 2OM6A 5IS2A 3BWVA 4E88A 3QXGA 2QYHA 4Y3UA 5A3RA 5AM5A 5AVUA 5ALKA 3HLTA 3L1UA 1X42A 4UMFA 1O08A 4KNVA 3E84A 4UW9A 3L7YA 1Y8AA 3FM9A 3FGOA 5ALUA 2WF9A 3SKXA 1L6RA 4CF3A 1RLTA 1XVIA 1N8NA 3ZVMA 3U26A 3E58A 3OPXA 5AI9A 2HI0A 3UMCA 3OCZA 3SLRA 3WKDA 2AMYA 3SMVA 4YCMA 3PGLA 2G06A 4O8CA 5AM4A 1Z4LA 4BEWA 2YMPA 3EF0A 3QU7A 3ZTWA 2BDEA 2JAWA 4Y2YA 4JB3A 2EATA 4BNDB 1RMQA 2FPWA 3ED5A 1Z4NA 5ALSA 2MU2A 2WF8A 3R09A 3I1YA 3WK5A 1T9ZA 1SWWA 2R8XA 2G07A 5AKKA 4Y2JA 5AI6A 5AW2A 2G0AA 3W5BA 4Y2VA 5AVWA 3I28A 1VJRA 3IJ5A 3KDPA 1SWVA 3KBBA 2ZOSA 1T5TA 2FI1A 4HAIA 4BEVA 2P11A 4GIBA 2YJ5A 1KYTA 2GMWA 3OTQA 3WK9A 4CNQA 3GYGA 4DCCA 1F5SA 2OYCA 3B9BA 1L8OA 3E81A 2W11A 4BBJA 3FZQA 1L7NA 4BX0A 3L0YA 1SU4A 4I9FA 2GO7A 2WHEA 4Y2TA 2I34A 2WM8A 4UMDA 2OBBA 1ZD4A 1ZJJA 5AKHA 4UU0A 1YS9A 2C8KA 1ZRNA 3UM9A 4DWOA 4C4RA 3FPSA 2YJ6A 2AH5A 1RMTA 5ALJA 1TJ5A 3WKCA 4MWOA 3I6BA 2YJ3A 3QNMA 3ZW7A 3EWIA 4BX2A 3KZXA 5AVYA 3UMBA 2B1QA 5ALLA 5ALDA 4KX5A 1Z4OA 2PKEA 4FYPA 1RDFA 1LTQA 2WF6A 4MUMA 1O03A 4Y2UA 2EARA 4RETA 3WKBA 2RARA 4KYTA 3N5KA 3EPRA 4L6AA 5AIBA 5AW6A 3U13A 5AVTA 1TA0A 1U7PA 2CFTA 2GFHA 3L8EA 2FEAA 5AK3A 3NALA 3FPBA 5AW7A 2JAUA 4CF4A 1Z4IA 1TJ4A 3PGVA 5AW1A 4OD0A 1Z4QA 4BNDA 1Q91A 4QQFA 4XE5A 2P9JA 5AM0A 3A3YA 4XPZA 2YN4A 1WR8A 1YJ5A 4UAUA 1RKQA 4ZEWA 5AW3A 3OCXA 2AGVA 4IFTA 5AK4A 5ALMA 2ODAA 4F71A 3L0CA 4I9GA 3ZX5A 4QJBA 1PW5A 4EX7A 4UU1A 2ZXEA 2WF5A 3OCUA 1ZD2P 2B8EA 5AM3A 1L7OA 1YMQA 2ZBFA 5AICA 5AKEA 2C8LA 2HOQA 3BA6A 3QLEA 2HO4A 3M9LA 3W5DA 2IYEA 2JARA 1RC8A 3QX7A 1Z88A 2C9MA 4UAVA 4ZEVA 1WPGA 4YIHA 5AW5A 4CE6A 5AKYA 4YH1A 3M1YA 4YGYA 4Y2RA 4UATA 5ALRA 1Z4PX 5FP0A 2IOFA 2QLTA 2W43A 2MU1A 2FPXA 5JJBA 4Y2QA 4ZEXA 1CQZA 3NAMA 3CNHA 3N07A 3DNPA 3W5CA 3ZVNA 1ZS9A 2R8EA 4Y2PA 3B8EA 3L8HA 1EK2A 4KN8A 3ZI4A 4Y2XA 2G09A 3NUQA 4IG4A 2NO4A 2G80A 4EEKA 3P96A 4Y2SA 3N8GA 3OCVA 2FUEA 5A3QA 5AVRA 3ZTYA 5AVQA 3PCTA 2HF7A 2AUTA 4EZEA 2FPSA 4L6CA 3WK8A 4GXTA 3UMGA 5AM1A 3WKAA 3SKYA 3NANA 1J8DA 5AI0A 5AKZA 3CZ4A 4C4SA 2ZBDA 4AS3A 1NNLA 2ZBEA 4H1WA 5T41A 3SF0A 5A3SA 2HEGA 1WVIA 1EK1A 2P69A 5AI4A 2VKQA 5AW4A 5AW0A 2FUCA 4HGOA 5ALQA 2HSZA 4NV0A 2G1AA 3MPOA 2P27A 2BDUA 3KC2A 2HF2A 1YDFA 1FEZA 3QU4A 5AVVA 5IT4A 2ZG6A 5E0OA 5AW9A 3HYCA 2HCFA 4BX3A 1NRWA 4NWIA 3I76A 2C4NA 5AIAA 4EELA 3ET4A 2BY4A 3AR2A 3U7HB 4BKMA 3NASA 3U19A 2GHTA 2R8ZA 2YJ4A 1RLMA 1L7PA 4XOUA 2JAOA 4OFZA 3OCWA 5ALVA 1Z5GA 2Q4RA 2B0CA 3ZVLA 4UASA 5IT0A 5AK5A 3TLMA 1Z5UA 1TE2A 4HGQA 5ALWA 2IA5A 2OA0A 2Q4TA 2DQSA 2PQ0A 4FE3A 1RQNA 4CF5A 2I7DA 1WZCA 3EF1A 3RF6A 2YMLA 4B6JA 3U7FB 4F72A 1TJ3A 1XP5A 2YMQA 1QH9A 3DDHA 5AKGA 4EENA 3K1ZA 2GHQA 3KD3A 1QQ5A 3AR4A 3QUCA 1RMYA 3L8GA 1ZRMA 4G9BA 2CFRA 3E8MA 1CR6A 1L8LA 5ALGA 1RKUA 4YCLA 1QQ7A 4OHFA 2HX1A 2D2VA 3PDWA 3AR6A 5AM2A 2PR7A 2HDOA 3QU5A 1K1EA 3WKEA 3ZWKA 3QUQA 3AR5A 3A1CA 3WGUA 2WF7A 5ALZA 3J7TA 2FDRA 1S8OA 1L7MA 3RFUA 3S6JA 1LVHA 5AKLA 3IB6A 1S2OA 4NABA 3ESQA 4YCNA 5AVZA 4UMEA 2B30A 3B9RA 3N28A 4XQ0A 4UM5A 1T5SA 4UMVA 3QUBA 1VFPA 2X4DA 3L0BA 2G08A 2RAVA 1RKVA 3DV9A 5ALFA 1Z4JA 4FFDA 4AP9A 3MC1A 2FPUA 5ALXA 1NF2A 4HGPA 1Q92A 2EAUA 1XPJA 4J2TA 2RBKA 3DAOA 3IRUA
chains in the Genus database with same CATH superfamily
4YMSA 4IHQA 3OJEA 4ZYVA 1T91A 2D54A 1ZGCA 1YRBA 5A0TA 2VKTA 1J21A 1FTYA 4LNUB 5FWNA 3GCXA 5K99A 4R9SA 5BOLA 3SAFA 4I2AA 2Q4OA 2ZT7A 2DPYA 2J09A 1C7IA 4P7GA 2Y77A 2V7GA 2ZP1A 5FOXA 5EE5B 3A58B 2IEDA 3IR7A 4YRLA 3TD2A 4RE6A 1YC5A 1G18A 3LD9A 4B9UA 3FZGA 4WZAA 1RPNA 5JSZA 4YRRA 4DFPA 1XEXA 3UW1A 5JT1A 2KHVA 3IQHX 2OC4A 5F52A 2F1JA 2VIXA 2OG2A 2MJLA 2Y8EA 5DZSA 3TBKA 3K9HA 1FP1D 4NJEA 3W79A 4XCXA 1TECE 2NO1A 4W6ZA 2DPGA 3DB2A 3W5SA 2C95A 4HQOA 1WG8A 3LCMA 3SYLA 3SEZA 1SD1A 2JD2A 3ISCA 2XSZD 3BMOA 4JH0A 4PFSA 2IMWP 3HY6A 4AY6A 4MVJE 2W4QA 4TM7A 3VPGA 4R1QA 2XT9A 1NSYA 1PEAA 2W9BA 1E5VA 1OWNA 5E95A 3ZZMA 3F6SA 3O26A 4X1KA 2R68A 3GCWA 3Q11A 1VRCA 2QN1A 1UK7A 4QQKA 5DOVA 5EVJA 2H07A 4BMDA 1ANKA 3KXPA 5GJVC 2M6LA 3MHTA 2Y4NA 3VDQA 4QPNA 4BAZA 4IHJF 2Y2UA 1CUJA 2SECE 3A1DA 4RQ1A 4NPHA 3SCZA 1K8YB 2QUHA 1YMVA 3I01M 3P5SA 3PXDA 5K3FB 1Z0KA 1L7QA 1Q11A 4NFLA 4PYLA 5TDHA 3TLZA 3VR2D 3LRXA 1L8AA 4X7PA 3OP1A 3W5IA 3LHIA 3LWBA 1B4FA 3KD2A 3CG0A 1RYHA 2N9UA 2ZIUA 2Y71A 3FHJA 4E3WA 4C5BA 1U47A 3N2LA 4RH3A 3HWX1 2GD2A 1SUBA 2VDJA 4TYMA 1MAAA 1UZUA 1G9SA 1W4RA 2QJTA 2CLHB 1T8RA 2QMQA 4INPA 3LGXA 5BPCA 1YUMA 2DR3A 2EX1A 3F2VA 1Q7BA 2QU7A 4H2DA 5CNKA 3EC1A 5EP1A 2YOHA 3ZHCA 4DM3A 1RCUA 3GZFA 4JDPA 4EYSA 3OOYA 3KHGA 3A4LA 4I55F 2KFNA 3AF4A 7ICIA 3I61A 5D6NA 5IINA 3LOUA 4GKVA 3TPFA 4MV6A 3WLRA 1VCMA 2AV6A 3TFQA 2BGRA 3IQEA 3PFFA 4JHXA 1WBDA 3OZIA 4BMNA 4Y1GA 1WS6A 4M99A 1CIJA 4DLUA 4X00A 3WYEA 4BU0A 4KBYA 4JENA 4UFNA 4YJ2B 5H02A 4Z2AA 1MBZA 4TXHA 2BI8A 2HPHA 1B6RA 2H5JA 3CZRA 3LHSA 3E82A 4DEYA 4KLNA 4ER7A 2WICA 2OXFA 2PGIA 3WV4A 4EK9A 3ADBA 3ER9A 4F12A 4P3OA 2UXBB 1P80A 3QXCA 3GU3A 1UXOA 4FYYA 5AKJA 3BICA 4CM4A 4DLPA 4QKQA 3KAQA 4FJ0A 2RDJA 3D8SA 4QWDA 2F3SA 4OU4A 2FMUA 3T15A 1O97D 4DZZA 1OH7A 3C5VA 4J6FA 4CKBA 1YR7A 1GNVA 3JQ8B 2PYDA 4TT3A 4BWFB 3F5DA 2D0OB 3E5MA 3CKYA 4O4HA 4F45A 3MPUA 1RAGA 2OV4A 5C46F 2ID4A 4YCAA 3RARA 4I2CA 2I7CA 1UBUS 1IB6A 2OV2A 1I24A 2R66A 1L5QA 4NZPA 4Q4CA 5HF9A 2I1VB 3KUDA 4JUBA 3OP4A 4KPGA 3WMGA 4C2AA 1ZFNA 2RFLA 4NTZA 2CXNA 4GNKA 4CLDA 5BMVB 4KNVA 4WFJA 3L7YA 1FFGA 4WN9A 4Y6LA 5BN5B 5ALUA 3NT4A 5KFZA 4BIIA 4B2YA 1EM8B 1G2QA 2XDWA 5K3AA 5KQMA 5EI5A 1UDWA 4KRXA 4X3PA 5JRTA 1N8NA 4PSCA 5JPDA 4H7PA 5BV7A 2FA9A 2ZDQA 4ZJUA 3S27A 4F3YA 4W9MC 4YJ2F 3PX6A 4OJYA 1SXJB 2I99A 1YZFA 4AJ1A 1J0XO 3BB4A 3E3NA 3Q9LA 3USCS 1N62A 5EZ6B 3PGLA 2NNLD 3OF3A 5IC4A 1NQVA 4MINA 2NU8A 3Q6NA 5A02A 5C7YA 1RADA 3QQPA 3ZTWA 1KSJA 2AX4A 2EOAA 2AU0A 3K0AB 4LE1A 1D8LA 1LRLA 2ODNA 3LKDA 1V7QA 3MGHA 1Y5RA 1ZOOA 1OR8A 3PKIA 4FFOA 2BM1A 2IGTA 4PHEA 5AVVA 1CRPA 4FPXA 3ED5A 1N6KA 1EFVA 3BH6A 2BI4A 3QY9A 4HAXA 4PS0A 4DLNA 4L4XA 1YJXA 1PTJA 2P90A 1T9ZA 4YGXB 1YT3A 3EUEA 4LRYA 3OIWA 4I14A 1L1RA 2VJMB 1KAGA 2O0LA 1QCCA 3DUFA 4ZAWA 2XVTA 1Y3BE 3V6KA 3C14C 3GJRA 1XMXA 4Q3OA 5AW2A 1HTTA 2G0AA 4HQFA 1UP6A 1NQOA 4HYYA 1KH1A 4I1SA 4XM1A 4E5KA 4H6PA 3NHLA 3KZ1E 3PQDA 4OHXA 1JHOA 4M7RA 4EW1A 3I5YA 3N97B 1C80A 1KY5A 1Z6YA 4I1RA 3CLSD 4Q82A 4XKJA 1YRAA 2W6IA 4DL5A 4L4YA 4Y9UA 3WR5A 1H9BA 3IAAA 2PMWB 4M0EA 2ZIVB 2PA3A 3VRHA 1ONSA 4KOAA 5KU1A 1WUTA 5H59A 2VP4A 5B7NA 2WD7B 1YDHA 5JCPA 1C3LA 2V7QA 3LECA 9ICKA 1XZQA 4BGEA 1YU6A 5IXJA 4O3OA 3ICPA 1L8OA 4EJ2A 2CB9A 3IFSA 3MHPA 1Y3DE 4GE3A 3QEBZ 3EFBA 2IELA 3ER6A 3H1EA 4IL6U 1LLCA 3OCCA 2DZDA 4OGLA 3VCBA 3MBYA 3PLRA 4N03A 4R7ZA 4XJVA 4YO7A 1XWFA 2F00A 4KWIA 2IHKA 3CBGA 2HJHA 4OREX 4QQ8A 1IJEA 3DYIA 2FWAA 2Q1UA 5F3DA 2ZIXB 2O8CA 3AL0B 1W8DA 3DS8A 5DNUA 3BFKA 4IJVA 2R2GA 4YQEA 3EQ7A 3IMEA 4ZYLA 3FXAA 1TQ2A 4EMSA 2R0QC 1T2CA 3SZMA 2NPIA 2RIRA 4ABYA 4A15A 3EA5A 3OSZA 3CCBA 5KFEA 3ECSA 3L79A 4NAHA 3KKAC 1WLYA 2PUDA 4OI0A 1UA1A 4IH9A 1MOZA 1D6JA 5LSAA 3IELA 2VLBA 4G0OA 5I9BA 2G9UA 3WGZA 4WQMA 3RIHA 1NNI1 2C7PA 2EKQA 2XPCA 4ZODA 1KOJA 3KOUA 2ZQYA 1BAPA 1G1MA 2YDXA 4WK4B 5DSTA 5FI0B 2WF6A 1RI1A 3A9VA 4J3NA 5KNCA 3UWSA 3ICEA 2O2EA 5HIIA 4KFCA 3QYAA 2AGQA 5EAIA 1YQ9A 2Z95A 5I4CA 3RB0A 5AR1A 3D4IA 4KYUA 3K2EA 3L6DA 5DGBA 3N7TA 1ED1A 3RUFA 2E7ZA 1XD2A 3HBMA 3ZG6A 3DLIA 3H18A 4OO3A 1JN0A 5AW6A 4V3BA 4B76A 5JW6A 4JYCA 4QTZA 4X95A 1U7PA 2GVDC 2J32A 3DO8A 4X63A 2B4TO 2RH4A 1U28A 4HDNA 1R27A 1U7WA 2YV1A 4FZ5A 4TL6A 3SFZA 5CA0B 4LZGA 4JVSB 1XTUA 2CHVA 3T7CA 1T8YA 1MG0A 4G0YA 5G0SA 5EJIA 1ZIOA 5ECWA 5ICEA 1L4FA 2XWQA 1WB6A 1F38A 4JYZA 1XYYA 1TQHA 1ZCZA 2D62A 3FAZA 1Z4QA 2EP5A 2ZTHA 4M86A 2X0DA 4ZI2A 4U6PA 1GNPA 1P1IA 2IUTA 4K86A 3I2YX 1L5LA 2FXIA 3ZQ6A 3VNVA 1SMKA 3THWB 5H9VA 3LZDA 2WHPB 3PGJA 2P9JA 1I4WA 3CPJB 3FVWA 1D9FA 3CPSA 3R6GA 5DPMA 4CQNA 1R6VA 3HGQA 1ZKDA 1RG6A 4MJLA 1TUGA 4RELA 5BORA 3I30X 1NM5C 1W1WA 2ZRKA 4UAUA 1GZ5A 3THXB 1EB9A 1YULA 4A6EA 5ICSA 3N75A 4OI4A 3QZ7A 3QA3E 5CW2A 1HX7A 5J4KA 1W34A 5K8VA 1NVUQ 5A1JA 5BWOA 4NL9A 4WMLA 3TEMA 3QKRA 1ZQHA 4I2VA 4WOKA 1PEDA 1SKYB 3PJRA 1RPJA 2V45A 3JQ9A 2YRXA 4YJHB 1N2CA 3FUTA 3GCDA 5DTEA 4N9WA 4P92A 4YPFA 3TLEA 1UJBA 3RR8A 1ZPDA 4R2HA 4YAJA 1VXRA 1V4VA 2NAFA 1YMQA 3M3PA 3NVDA 4CV2A 4KN7A 1ZZEA 1RWOA 1U0NA 1K6IA 4OEHA 3FSJX 2Q1SA 4I50B 4E08A 2QOEA 3BA6A 3GC6A 2DJIA 3H42B 1C4WA 2ACVA 3TQCA 1GPBA 1IHDA 2IYEA 2JARA 3Q41A 4F6CA 3HSSA 1YMUA 4JKOA 2HGZA 3BS5A 1Z0UA 3GJ8A 1T3QA 1C30B 4ACOA 5F1YA 4O3SA 1IY1A 1H8HD 2A5JA 4NMXB 5B3JA 4ENUA 8ABPA 3HYSA 4U5XA 6NULA 1QG4A 2AL7A 4OHPA 2XICA 1U0RA 2DBRA 3QWBA 4RUCA 4WLNA 3GJ6A 2E4UA 1BD4A 1X9HA 1KKXA 2VA8A 1PL6A 4O2BB 4F4UA 5HM6A 4Y2RA 1H2RS 3TARA 2C2KA 3NR2A 1ZSYA 4E5SA 1W5FA 4F97A 4NYIR 5JWRA 4PYNA 1V3UA 4M49A 3W90A 1ECGA 4C87A 1ACLA 1CU1A 3CPEA 3OLXA 2R7LA 3I2IA 4Z9FA 2VEOA 3UCXA 4D9JA 1Z7BA 4E7OA 3L6EA 4ZOEA 1OD6A 4DEZA 3KS9A 2Z6AA 3Q8WA 4I55B 5FFMA 2WEKA 4D1YA 1LDEA 4RANA 4DQVA 1XUOA 4Y2SA 2VDWB 4ZDIA 4PSVA 4RF5A 1TO2E 4ZO4A 1I6KA 3NONA 2FLLA 4ECUA 2AHRA 2LI6A 2O52A 1PI3A 3AB7A 3PCTA 4FKZA 4IUYA 2HBYA 2FHSA 4KSBA 4OQQA 4XDGA 5G3ZA 2BCEA 2EX0A 3AY6A 2JXJA 4ZQCB 4GXTA 2ZRLA 1P72A 3IEVA 1P4HA 2Q3FA 3NHRA 4NCAA 3LT2A 4U6NA 5E7IA 1ZXIA 4ELVA 1EXWA 2FVXA 5GAJA 5CDHA 3SZLA 3A6PC 4QZ9A 5A05A 1EI9A 2DECA 3UCEA 2GKGA 3HO8A 1QZ3A 1FTQA 2DLNA 1PGNA 1B15A 1X1TA 2CHFA 4HUQB 2VSNA 3BXOA 3C6QA 2ID9A 4BVFA 3RR2A 3AFIA 2CC2A 5B2FA 2RG1A 2ENWA 4PSAA 1O6BA 5DLEA 2BW0A 2EJWA 4MV3A 4NV0A 4D3FA 1RWPA 2ORVA 3A10A 3M6WA 4MPPA 1JHPA 1FP4A 3H9GA 4HEQA 1KE1A 1OLUB 4TMTA 5IU6A 2PJDA 3LBFA 2Z4SA 4FGUA 4D9BA 4L0DA 4WY2A 3FSEA 3T3MB 4D9MA 1SOMA 1FSZA 4X45A 3AWDA 4KUHA 4LYGA 3HYCA 4ZO9A 2B4AA 3G13A 1F1BA 3D0KA 3HVIA 1CQJA 1XFDA 2E5FA 2MWMA 3FBTA 1KTVA 1PS0A 2CUZA 2HYDA 3AH8A 3FYUC 4GOND 2Z09A 5CVEA 3TLKA 5FUBA 2IV7A 1NI4B 3M6IA 1DDGA 3OPQA 4ERXA 9LDTA 4EIWA 4HAZA 5BNTA 3BZBA 5T3YA 1HI9A 5C53B 2GHTA 1QHEA 4C7VA 3K9BA 2GHRA 2JCVA 1BYUA 3FMGA 4NZMA 3DMTC 4CM1A 5JNWA 4U9HS 1SZHA 1NK6A 4JL5A 1JGTA 3MERA 4K6MA 1SKSA 4P36A 1NNSA 1E63A 2RHBA 2Y3IA 4XOUA 3HR4A 3RVBA 2O3TA 4TKZA 1L1QA 1U7HA 2VIIA 2QY9A 3TEFA 1QE3A 1E1CB 4ZOLA 3ROGA 4DEXA 3V72A 2G5PA 1BCRA 1TU4A 2DQZA 2I9PA 2B0JA 2A0UA 2Q4RA 3O74A 2A84A 4QVGA 4TMXA 3JS5A 5AK5A 5LZ8A 1QHNA 1S9HA 1JJ7A 3AMVA 4WNAA 4XW2A 1BXRA 2ZPTX 4LZJA 5SZHB 1CEXA 5GINE 4DF4A 2VUTA 3DMDA 3ZNOA 2Q4TA 3ISJA 1Z0IA 1XQ9A 4C0SA 4HB2A 5I9SA 1EZ1A 2ETVA 2VAXA 2HQSA 2ZT5A 4XTCS 3O3MB 2F1IA 2ZYRA 4YP0A 2QX7A 4GC9A 2G1JA 1D6MA 3G5LA 1RRPA 1QGAA 2AJCA 2Q5LA 3KV3O 1QYWA 2PBLA 3MR3A 1ZQLA 3ETDA 3SQIA 1CK4A 2CVOA 2XJ9A 4XLTA 4NCHA 3ZXXA 1WD5A 1N4DA 3SQNA 4KAJA 4S12A 121PA 3BHMA 4NFYA 4BLRA 3H6KA 1T1JA 1SBNE 4ED9A 3WNQA 4RF3A 3PTAA 2MAXA 2A9KA 2G6BA 3H1BA 2P3OA 3OURA 1T1IA 3PUIA 4GR4A 4NE7A 5EP2A 1IK6A 5HF5A 1E2MA 1JZQA 4R1LA 5EGNA 3KTDA 1OIVA 2PUFA 1QLHA 2JEYA 3M1AA 1RS0A 1NUSA 2BCRA 2PKXA 3CLUD 3PRJA 2QMEA 3T7DA 4BEBA 1E3JA 4BJHB 5B30A 2WHYA 1X7YA 1TX4B 4OKSA 3T0IA 3P45A 4EF6A 3VVCA 4AJEA 1Y1QA 5MN5A 2QTVB 1CR6A 4I4LA 1YZGA 3LT4A 4RJKA 3M9MB 5DHQA 3S2YA 1J9ZA 1EVIA 4NENB 3AIMA 3TZLA 4BO7A 3ZY2A 5TNXA 4KJZA 4JA0A 2VHJA 2HDOA 1K1EA 2C3UA 3IP8A 4W1QA 5KG2A 4H16A 5JCOA 3Q9UA 3ACCA 3W6NA 4P4MA 4AC9A 1WF3A 3NVKI 2Y1OA 1RYUA 1MXHA 2ONCA 1O3YA 1DKRA 3WHLA 2PUCA 1BW9B 1Q44A 3OJSA 1RBMA 1N61A 4IQTA 2ZRMA 2ZJ2A 4G09A 5AVZA 1N3IA 1KMIY 3PNBA 5IVPA 4P9NA 5HCUA 1AQNA 3FTFA 4F3NA 3GLHE 4RDXA 4E2ZA 1HRKA 5TEWA 4D4KA 5KFHA 1CUGA 4JVNA 2CXUA 4BV9A 4DLRA 4N0EA 3QVJA 3UAVA 3PX3A 4ZOQI 4DSJA 3CONA 4PSKA 3NBYC 5FL7D 4MRRA 2QTAA 1IMOA 3UHPA 3UB4A 4UEKA 4UTNA 4GEGA 1QBKC 2R86A 3RRNA 5LIRA 1NF2A 3INYA 1AGPA 2FPIA 5H3HA 5BN4B 1F8XA 5HS6A 3WZ2A 6LDHA 4DR6B 1X0XA 1QK4A 1XTBA 3MS7A 1E2HA 1JEYB 1E96A 1UZLA 2W2LA 4MVJP 2QMUA 2DETA 2FW6A 2PT9A 3PQ6A 2Y0BA 3PJGA 2QN2A 1D04A 1W0KD 1FMLA 3JARB 3WL3A 3L7OA 4B4OA 1DX6A 3PSFA 1WMDA 3P4XA 4I2NA 5E9JA 3R3YA 4BBAA 4ZZ0A 3DT9A 2D6FC 3FW1A 5HIKA 5K6AA 5FBVB 3FJ1A 4GVPA 5GONF 3CRRA 4CEHA 2HA3A 2EJCA 1NJ5A 3A28A 4RABA 3GD5A 4HDCA 4NMHA 2J9ZB 4YP9A 4UUBA 2AR9A 2XNDD 3IQWA 2ZRPA 3BSWA 1D2EA 1HDCA 3GP8A 2D5LA 2X8AA 3C3PA 5CU7A 4YIKA 2AW3A 4UUOA 2Y1JA 1ZOSA 2PX0A 1IJBA 4HO1X 3SVZA 5TE9A 3T6KA 3PEVA 5CLIA 3DV0A 3OLCX 4Z4QA 5FKJA 2BR3A 3MGGA 1MT3A 1LJUA 3L46A 1PT8A 1ZQBA 1L5ZA 2C04A 2P0YA 3PIIA 3TECE 3ZVKA 1UT5A 2FWPA 4B9NA 3IP3A 4OF4A 1KI1A 4RS3A 3RTBA 5TF0A 4Q05A 3MGCA 1F8FA 1PG2A 1KAOA 2LDXA 3BPSA 1GEEA 3GJTA 4R6XA 4D97A 5JUWA 4JBLA 3OX1A 3FNQA 4AVYA 4OXXA 2QLBA 3L5OA 4MTLA 4RHCA 1E2UA 4TTAA 2Q07A 1EJ6A 3EA0A 4FEAA 1T0UA 4H4EA 4ESOA 1V1MB 3DSRA 3EXAA 4ID9A 5E6RB 3PFWO 3V1NA 4B35A 1HKUA 1Q16A 1SOVA 2HF9A 1CCWA 1W0CA 3H0LB 2HCBA 4P5DA 2O19A 5FOUA 3WK7A 3RC2A 4RT3A 2XCUA 3SVLA 3JYPA 1X92A 3IN5A 4BJQA 4UUNA 1EGAA 4K88A 1KK1A 2F1HA 4YFVA 3ZV7A 1ZI8A 4AJIA 3EDYA 2TYSB 3D0RA 3KQNA 1SH7A 2DPLA 3LFHA 3T7RA 1Y34E 4M9SA 3VAZA 1WMFA 1SXHA 2FSSA 2I7XA 4RKEA 4XR9A 3RVQA 2C5EA 1G21A 2GLTA 5CYOA 3WMWA 1UMBA 2X6RA 2LKDA 3QYJA 5KCMA 1Z75A 3LBYA 1I8TA 1SHJA 1TM1E 2CNWD 2HA5A 2VTEA 3GZJA 1CJBA 3BDAA 4AUKA 2HBKA 4X7BA 2KE7A 2AZ4A 5JSYA 3VSCA 4Z7NB 2AQ0A 1TMOA 2K4MA 3CVUA 3W8EA 1S5PA 3RKUA 3U4QB 2OYSA 1J2JA 4WD3A 2I6XA 1LVGA 1C4OA 3GFGA 2JZBB 5AT1A 1IV8A 3WWYA 5AVSA 1NKSA 1XTJA 4RNCA 4UQOA 1U63A 2IYTA 4DL4A 3UT5A 1DC4A 1VCHA 1O95D 1ZG3A 2YIVX 3NWBA 2RJ3A 4CQJA 4L3VA 2I9KA 4JXKA 5AJZA 1TPYA 2A8YA 2NUAB 1P8AA 3RRZA 2O6LA 3WX0A 3A2MA 1JH9A 3NM5A 3WLMA 1SK9A 2B6HA 2GX6A 5CRIA 5DCUA 3QEKA 1N2OA 2P9TA 2V0NA 1ADFA 1R37A 3AF3A 3PENA 4HXGA 4JBNA 1F0KA 1IY2A 1FF9A 4WECA 3LDHA 4TYQA 3WFIA 3U7RA 4DL2A 9ICGA 2ZANA 4MVJI 5IJ9B 4L50A 4YECA 3HMKA 1D8YA 4G0NA 1EJBA 5A4AA 1I94B 3DE4X 1GG5A 3R3ZA 4YQWA 4NRDA 4EPTA 4D0GA 4M87A 3STXA 4YAKA 3EPLA 3JALB 4I8DA 5HUJA 4PNEA 3K94A 3KWMA 1DZ3A 2C2BA 4OU5A 3T4XA 5JY6A 3H9EO 4BXOA 5J29A 4WXMA 5AM5A 3DVQX 1YBAA 4I50A 1WL8A 3RUPA 4OI2A 1O2DA 4MUHA 3ZZTA 4BP3A 1NVBA 2P2YA 1L4MA 5CB4F 4B34A 4DIUA 2HXSA 1BPEA 2Z5GA 5FOSA 1Z6TA 5FNVA 1J7JA 2CZQA 1KJNA 1W4CA 2CUTA 1JIXA 1K3TA 4FP9A 4ABTA 4HZGA 1JBKA 9ICSA 2AB0A 1TKCA 1L6RA 2CNDA 5DI3B 2D2FA 4RHEA 3I3SR 2IH5A 3ZVMA 4HWPA 2XUQA 3GGDA 4BLPA 1E4YA 2HI0A 4RU9A 1OBHA 1IIBA 1KHHA 2V6FA 3M6XA 1ZHHA 4MIEA 3GG2A 4LW8A 3HL0A 2KVSA 1J90A 3Q8QB 4L27A 4WCDA 2BQRA 3MJEA 1OKKD 3WIDA 4B4UA 4CWAA 2D5IA 3PNLA 1VIVA 3GZNA 5JH7A 4Z2YA 2GBCA 2F3TA 3L05A 2ZAYA 1OWLA 1NL3A 4OKNA 5KC9A 1HLDA 4B83A 1ZQKA 5ESRA 4OK3A 2F43A 1T3TA 2OSVA 1LWOA 4E33A 3RIEA 1VBMA 3L3BA 1BOOA 4PWZA 4HH0A 3L8CA 3NBXX 3NDBB 4W5NA 4MV5A 2OV6A 3BVPA 1GG2A 1T6BY 4XD7A 3ZGOA 4CM9A 1JDTA 1IG0A 3V1UA 1CB7A 5KDDA 3W9YA 4B44A 4OMCA 5AI6A 3DV0B 3ZYCA 3PQCA 4HDNB 3AUJB 1C1DA 4J9VA 2XMDA 3H4IA 4EKNB 5CCBA 2MYNA 4DPMA 5JADA 4ZCRA 1AG9A 4DNOA 4M1TA 1T24A 1XN4A 3IJ5A 2RAPA 2XTJA 5IYZF 4UBBA 3KSBC 1H0HA 4X94A 1V0JA 1MNQA 3T5KA 2GLXA 2X40A 5JFOA 3OY7A 4EO7A 4Q66C 2GXQA 1P18A 2PQ6A 4RD2A 3PSPA 4IMJB 1WXEA 4CNQA 1ORRA 3ZLUA 5TLSA 4R8RA 5CB4A 4YR7A 1ZI9A 5EJAA 5A04A 3DEHA 2JZCA 3EFOB 1NIPA 3L7LA 1PBTA 4FBGA 4V0SA 4W63A 4HPXB 5MN6A 1EU1A 4ZJYA 2PVSA 4MVJM 1WZUA 4F56A 1Z8NA 2OBBA 1OX5A 1N2XA 5KS2A 1L4BA 1EWRA 2IUEA 3EPIA 1KA9H 1OF1A 3MABA 1T25A 1U7ZA 1C1DB 5AKHA 1KDRA 1GTMA 2G4LA 3M5PA 4UU0A 3QVGA 4RZIA 4LXGA 4Z8XA 4JC0A 3CMMA 3T1NA 1W36D 2OUIA 1T1RA 2BM8A 1S4QA 2W4IA 5BQXA 1TU0A 1LS1A 5LR6A 4PX5A 1PIWA 2JFQA 4ZT6A 4LTNA 3C8UA 3LS2A 3ZW7A 4BX2A 5KYNA 1LB1B 2YH2A 4FEEA 2RHOA 4YMUA 3D5TA 4I81A 4DDVA 2BPFA 4UHDA 2Z2YA 3ONDA 1CY0A 2ZJAA 2D59A 3JTMA 4KX5A 4LDRA 3ZDCA 3G0GA 4X64B 1L5FA 1QLWA 2F9FA 3TNFA 1A96A 3GPCA 3HLKA 3MRXA 4MUMA 2C5GA 2IU6A 2ONYA 4YRFA 1NBOA 2RARA 4HXYA 2DUWA 4EHKA 5I7HA 3C43A 3HA5A 4L6AA 5EMHA 1YB1A 3RUCA 1D1PA 3TZHA 1FRQA 4F4XA 1RKBA 1H38A 2NACA 3P4UA 2NNWB 3HP4A 3OX2A 4US2R 4NF2A 1YHYA 4JA2A 4RY2A 4L74A 4IQGA 3P5BA 1VB3A 5FO1A 2CDCA 2P4EA 4FGWA 4JT2A 2B4RO 3FWPA 4WOJA 3EEBA 2E5SA 2VA2A 3AW8A 4NBRA 3S81A 1V1MA 3UGKA 5AW7A 3FAKA 3NVVA 4X66B 3VO2A 4QSHA 4ILEA 4CF4A 1PZGA 3V7NA 5AW1A 1TFUA 1UXIA 2EKPA 4BNKA 1UKAA 2P2SA 4PZEA 5LQSA 2JFZA 4K3VA 3I8XA 3LOPA 4CMIA 4DBLE 2Q3MA 3DULA 4JUAA 3O8CA 4A10A 1Q91A 1SM4A 3H5AA 1HLPA 3EDRA 1NF8A 3HI4A 5COAA 4ALKA 4NLKA 1IATA 3TGLA 1UMDB 4HX5A 1V5FA 5DHAA 4QNLA 1K2VN 1P6XA 1AZTA 4KACA 4ZRNA 3Q8KA 1BNCA 2QRUA 4ISCA 4MP8A 4RFLA 4X92A 2FZ4A 4YS6A 3A0UA 4IVNA 3WYDA 1FTSA 1XEXB 4DJFC 4JYBA 1XF1A 2YN4A 2REQA 2EF1A 2MCFA 2QBYA 4KPUA 1JDPA 4B71A 2BN4A 3B48A 1XLVA 2NXJA 4RQMA 1U6IA 2GFIA 3PUXA 4GF5A 4CM5A 2ODAA 1E79A 4O25A 3WLPA 1Y7LA 4H7JA 4NR0A 2B2XA 1GV1A 3REQB 1Q17A 4MO9A 4WK2B 5B2ZA 4HR7A 3R24A 3OCUA 3E9ZA 4YDHB 1LUAA 5D5QA 1XWIA 3E3LA 1DWQA 5AM3A 1XZPA 3HB7A 1YZUA 2ZJYA 2TS1A 3WXMA 5CVTA 2PS1A 5AKEA 5EWGA 2VF2A 3H04A 3H9CA 3W5UA 4EEXA 1ADCA 4C3UA 2B9EA 2RGAA 3VYUB 3BIJA 4USAA 3IS3A 3N6RA 3H86A 4ESVA 5DGDA 3R5SA 3PEYA 4HX2A 4QUGA 3OZTA 3O2QB 3PFHA 4BNWA 7ICJA 1XYVA 3TINA 1S10A 2GYWA 3HA2A 3NMUF 1IEXA 4UQGA 2ZM6B 2VP3A 4IDGA 2X5KO 1OFUX 2HQBA 1PVRA 3DHWC 3DT6A 4EZBA 3RJEA 2F6RA 2H4XA 3UUWA 3AILA 5FFFA 4F5WA 4MB0A 4IR7A 1WPGA 2HLNA 2WB1F 3BXXA 4KIJA 4B3XA 5KWEA 5IAEA 1IXYA 3BAFA 3BTUA 1P1JA 4RD0A 4YH1A 1P5JA 9ICAA 2R1ZA 4QGGA 1M6WA 5JS6A 3F67A 4ZAYA 3CKKA 5LD2B 3IXMA 4IQ0A 1CQZA 2VK8A 2G36A 4FBTA 1TMGE 2XMQA 1EX1A 1YR2A 3BWMA 3CNHA 1WXWA 3E0XA 1J2MA 3NAMA 3FOAA 3OECA 4JJ8A 2EANA 3WB1A 3WVNA 3PRHA 2LW7A 4KN8A 1O5OA 3GN1A 4B3GA 2IS1A 3K4HA 4YMHA 3F78A 3KBOA 4XGQA 5G1NA 4F3CA 4L08A 4NS1A 4FHGA 1EUQA 2HUNA 4K26A 4AWXA 2ZJZA 1V11B 2IYUA 2HIHA 1X9SA 5HQ3A 2BKUA 5FV7A 1N6OA 4FBMA 4U2FA 3PQ4A 4KQMA 3DE6X 1FTWA 1MVLA 2FDCA 3B0YA 1E92A 1SOUA 1KVQA 5G4LA 5L3ZA 1QHXA 2DPHA 5ELMA 2QVCA 1K1SA 5E9QA 5F7XA 1C8LA 2EYQA 2E1EA 2P9EA 3DNMA 4R3UC 4OI1A 2PR2A 3SNHA 3U1TA 4A3SA 3GH3A 4Z8YA 2VR1A 1K75A 2A6PA 2H1SA 3DF9A 2H65A 2UUCB 5CA0A 2ZTCA 1NU8A 4K9MA 2DLDA 1Y5LA 2CGEA 1H2XA 1P9NA 5IWAB 2DH6A 1TMYA 2IX3A 4GP7A 1C0LA 2NLOA 2ZATA 4Y6OA 1RVDA 4CW7A 3THYB 1HE2A 3AM9A 2YN2A 3E05A 5TARA 3TB4A 4CKBB 2GZSA 5IIOA 2JK0A 1DIGA 2GD0A 5TQVA 3D6MA 3TRIA 4D9KA 1H4SA 2W7PA 5CRXA 2CLEB 3FWZA 4OGKA 4Z6DA 4QJFB 1K6JA 1SY7A 1WD7A 1ZQIA 2ECPA 2HCFA 3IBFA 2XYPA 3MQFA 1FUIA 3I2FA 2VK4A 3OE7A 2W2TA 2ZYVX 4D4IA 4EELA 2CK3D 3E6AA 4F9TA 2BY4A 1VYUA 2YCLA 3MGKA 1WUKS 2FCRA 4B8YA 3EDCA 1KQ3A 3AHIA 1BXKA 4R8LA 5DX8A 1UKEA 2I67A 2ZUCA 1NMZA 3I64A 2GEUA 3VC2A 4Y6RA 5KOIA 1F2UA 2QE7A 3DBIA 1UMKA 5I7WA 4B3RB 4NBTA 3JQ9C 2AG1A 2E21A 4LV6A 1SVMA 2Q3EA 4JD5A 4I5EA 2ADFA 3G2JA 4RSHA 3V8VA 4QDKA 3OTGA 3OCWA 1GO3F 2PWYA 5ALVA 1ZSVA 2JLBA 3FNEA 1ZW6A 1DBPA 4BB5A 4FOLA 1HORA 1LPPA 4CMGA 3ZXUB 3GG9A 4KLRA 4YYEA 1JI3A 1SBQA 5EKTA 1W35A 2W6NA 4HWTA 5BW6B 4ASUD 1COOA 4D4HA 1O97C 3X1JA 4BMPB 1CUXA 2QT0A 2JGDA 2XCAA 2QD1A 3K92A 4CF5A 1JIJA 2I7DA 3RVDA 2CXRA 2OV3A 2I6UA 2CNNA 3FUUA 4I2IA 1UIMA 4FR2A 2YINC 5B1SA 2YZ2A 1WY5A 1Y7HA 4HAYA 4BO2A 3R9XA 5KFFA 2WMDA 3LC2O 5KHAA 5L3VA 3OI7A 4XB6B 3LGSA 3G88A 3WDLA 2YMQA 3I83A 3IKLA 5M3BA 3N7AA 1KXJA 3B9JA 3QZ8A 4EENA 1DO0A 2O06A 4I4TF 1SC6A 3JAWB 1H2BA 4EYGA 3SEQA 1ZINA 1SKQA 3AGQA 4XPIB 1XRRA 2VDKB 2GN4A 2DG2A 4YR9A 3HUEA 3WGYA 3RVPA 3ZE2B 1PJ2A 1IPEA 4LRQA 2XVMA 1G60A 1KGDA 4YALA 3GEPA 4N8EA 3RK4A 5HSGA 1JQ5A 2EGUA 1SOWA 2A57A 3I2KA 2XHEA 3LPNA 3QKSA 5K8LA 1QQ7A 2FLPA 1HG1A 4CLRA 5DX1A 2P65A 5AWFC 4EYIB 1L5YA 1S2NA 4X8OA 5I7SA 2V6IA 1Y6RA 3HWSA 5AM2A 2L19A 3FRIA 1YR9A 1QTIA 2WJPA 2NVWA 4MIYA 1JFLA 4XRHA 5CDGA 5KIAA 3F73A 1XNRB 1E1YA 3W1EA 2ORWA 5DLGA 4WZAB 2XMSA 1SHKA 3I12A 5HM8A 4QYTA 2I5HA 3KLBA 5KNBA 2GVZC 2IYWA 4HPJB 4IRMA 1I4DD 5KT4A 4L5BA 3GARA 3ODGA 4TTPA 4CL0A 3HC7A 4PXSA 4UM5A 3H87A 3ND7A 5JS1A 4J7UA 4QZVA 5EA2A 1SUIA 4YRAA 4DE5A 1IULA 2R5FA 3GEBA 3MQ4A 2R1TA 1CIPA 2FPGB 3KO8A 1C7YA 4X65B 3ER8A 3KHHA 4CDNA 4ENSA 2NO7A 4AP9A 3RYFA 3MC1A 4KIGA 4DJTA 1NLYA 4MQEB 2EZXA 1Z17A 2QNIA 3M33A 3OU7A 5DBFA 3UMVA 3WA7A 2XBMA 3GGPA 2RH8A 1OXUA 5FWXA 3AFHA 5C52B 1GKYA 2IIBA 1SXQA 1IRXA 4YHBA 5A5EA 3C5GA 2JGJA 3DL7A 3ZJTA 2ASEA 1ZBQA 4PAGA 2NU6B 3UJ8A 5BPFA 1INLA 1Z7YA 3TF5A 1N5WA 3ZWVA 4V0KA 1IM4A 1RE1A 3HZRA 4NCJA 4TRNA 3TX2A 3TOXA 5C8DA 4YC7A 5MFZA 3MFIA 4BASA 1PSDA 2FF7A 4H6VA 5CYFA 2AOWA 4X90A 4EBCA 1XYGA 1MAWA 3HU3A 3G0IA 4HPWA 4Q03A 3RRBA 4B46A 1A1VA 4HRAA 1BA2A 1ZNYA 1E99A 1XJWA 4J0DA 1L3CA 3JPRA 4ZANA 1TA9A 3T06B 1D4AA 2J0SA 2C4UA 2QT9A 2AN1A 2D1SA 2IYOA 2HA4A 3HPOA 3SF8B 1E61A 1NJ2A 4J91A 4L95C 4O0MA 5K3DA 4C3VA 5KWJA 1EP9A 2D00A 1YASA 3GLRA 1LD3A 3EIFA 5TQ2A 3LKZA 2X9QA 3D31A 4IX9A 4DOBA 2OB1A 3OHAA 1AQ6A 1Y4AE 3AYXB 3FBGA 5H1YA 5C80A 2YRWA 3RDPA 1KFBB 4BRZA 4CG3A 4F8JA 5KJCA 4LSGA 1UKZA 4WNYA 5CH5A 3CVWA 5AH0A 3DVSX 1NYQA 3TZBA 3IM1A 1XP8A 4MI9A 2B5OA 2BP7B 3KTAA 2ASLA 2IA6A 3AF2A 3CC8A 4HWSA 4TYYA 2CN1A 3D6HA 1GU1A 3OLWA 3ZC3A 5LNK1 2XXJA 2RBGA 3L8FA 1GZ3A 1KH2A 2IODA 5I51A 3V9PA 5CAEA 4I8XA 5DASA 2A5GA 2MUTA 1YB7A 2GFQA 2JVJA 2R85A 3PIDA 5KYYB 1H6DA 2Q5FA 4RQ6A 4DLTA 1JLHA 1RABA 1N9GA 5KT7A 3OBIA 4X8HA 4XUCA 4DHWA 4HQLA 4KIUA 1WCXA 3H84A 3WS7A 5J0UA 2FEXA 2JFYA 3BXHA 1R50A 3KPJA 3O4FA 2MT9A 4HGRA 5CFQA 5IVHA 5AI5A 2IH2A 1XTVA 3CM0A 4GVLA 2IKQA 1FFWA 3FTQA 1JVBA 2CVZA 4QXQA 5A9TA 3ZWAA 5MF6A 3FYTA 1L7BA 4J9LA 1F44A 4Z6CA 4K4GA 1JDBC 1XX6A 2PXCA 3AI7A 3V2HA 3CSDA 4XM2A 2MSNA 1COKA 5EUBA 4FMPA 3QH4A 1NBMD 3Q7RA 5CTAA 3RVSA 5JASA 2K89A 1S1MA 4S1NA 2ZUVA 3T0FA 3O4HA 4RTPA 4J0JA 4DV5B 2ZWMA 5C8XA 5IXYA 4WBNF 1QPZA 1U8UA 2EW1A 3RJIA 1XRSB 4PQRA 1OB5A 1KDTA 5BSRA 4BP1A 5CH8A 2V3VA 5FR2A 4ND5A 4XYLA 3CG4A 2R4UA 4KYVA 2WAQC 4G5HA 5NULA 2EF0A 4EB6B 5DYNA 3FDFA 2B94A 2ANCA 1X66A 3D1JA 3CH5A 3F8TA 3FH0A 3IC5A 3IIIA 2Y1XA 4M1OA 4NYMQ 2F8KA 5J2KA 1FYFA 1QO7A 3N2EA 4GX1A 1YH3A 4N0QA 5FUQA 3FDSA 3AU9A 2HA6A 4IIXA 4P4TA 1L6IA 3PC6A 2G4VA 4CMKA 2P68A 3H13A 3ZGLA 3TNLA 4JZKA 2E8MA 3HCOA 2B1RA 3HJTA 3D3WB 1BX1A 2G6TA 3ZHTA 3D1VA 3W9BA 5ALTA 1YVUA 4RQ8A 2BM9A 2GASA 1YQTA 5ARBA 3LIIA 1F8YA 2Y27A 4INOA 2X41A 1XWLA 3LQFA 4OH1A 4V0OA 1NK7A 4RENA 3ZIDA 4EAQA 1JG1A 4GS5A 4V0LA 5ENZA 3SZ3A 5ALPA 1KPGA 3UGTA 1R9GA 3H2JA 3KVOA 3U49A 2R11A 2C2RA 2AXTU 4LHXA 2WPDD 4LK2A 4XIJA 5J4YA 3USZA 4DQXA 4P3XA 1IVYA 2HADA 3K09A 2IXGA 4JITA 2GXSA 4TV8F 3VGJA 1JJVA 1NP3A 4WK6A 2G82A 5KWSA 1XJCA 1DFIA 1JFSA 1V8FA 5KTTA 2V7EA 5TJHA 2PX3A 3DVRX 1KKMA 3L7NA 4ZAVA 3K9FC 1N3BA 1NAIA 2YVLA 3DMHA 2QXUA 3FF1A 4PEVA 3ZE7A 3U5ZB 6AT1A 5IM5A 1NG9A 3MXOA 1XNHA 3FI0A 3P9SA 2O1XA 2NXWA 5JDCC 3JQCA 1MPXA 2XYGA 3BXGA 2WF9A 3FGOA 5IPFA 1WXFA 2EP8A 2HL6A 3BSYA 3TD9A 3V8MA 3CKLA 2NGRA 3RAGA 1Y8RB 2DHDA 3EA4A 3MAGA 3H2HA 4OVKA 2FX2A 3BSFA 4ZI7B 4UBKA 3N8DA 3QQ5A 4ZCMA 5J0SA 4ADSG 5CB6A 2G71A 5F3RA 3WKDA 1ZMOA 3SMVA 4UAYA 2R8HA 2YXDA 3JAKB 3BRWA 3I9V6 5D3MA 5KFRA 4NZOA 1ISJA 2JANA 1IQPA 5IULC 1Z6PA 4XD2A 4QZ8A 3OSUA 4CKEA 2WJVA 1NBWB 2WZDA 2QB5A 3EF0A 2JCXA 1W9MA 4G41A 4DCTA 1X39A 3D5QA 3Q8MA 3GT7A 2PX8A 1S9DA 4JXJA 1KDOA 3HRDD 4LZNA 3W9UA 3GDOA 5DM70 2E2WA 1IB0A 4WVLA 1Q3UA 3A9SA 4KTVE 1EK0A 1Z4NA 2JGEA 1K8RA 2QN9A 4IRUB 5ALSA 4WOCA 4ZOLB 3AM1A 5SY9A 3X43A 3ZWWA 5BP7A 2P1RA 3Q8RB 1JAIA 2H0AA 2KJ8A 2NAPA 4RLQA 1DBVO 2ARKA 1E1MA 2FEOA 5AKKA 2C94A 1VL6A 2I3AA 5B1IA 4LFAB 2PBZA 3C3JA 5E6SB 2EZ8A 7GPBA 2YZNA 1AB5A 1O9HA 3FYDA 2XEDA 3PDCA 1AHNA 2C7QA 4GLXA 3MYYA 3UAXA 1NW8A 3PUKA 1H8ED 1RC0A 3T9FA 1JWBB 3HY4A 4LIPD 3V7UA 4R1SA 2PUBA 1H1DA 4M60A 3R7NA 5LQNA 1KZ6A 4GIBA 3C23A 2J3IA 1T3ZA 3L49A 2DH5A 1IN8A 3HADA 1W93A 2ORED 2YNMC 1P62B 2F3NA 4DCCA 1TYDE 2H9AA 3WV5A 5FBRB 4M9QA 3KUCA 1TA4A 4QM6A 5F78A 2YASA 5J0WA 2I6SA 3OZBA 4N6GA 3O03A 3ZHVA 1SU4A 4I9FA 2WHEA 2I34A 5FX2A 1F7UA 1DPGA 4FYIA 3NBQA 2PLAA 3QYFA 2NZVG 3P0FA 3IL2A 2XOKA 3QTLA 5DYGA 5LU9A 4GMDA 1ESZA 5ILGA 2C8KA 1CP3A 4C4OA 5GIPE 5JYCA 1F4VA 5JXGA 2L82A 5E3IA 1KI9A 1P39A 2P5YA 4YAOA 1Y4DE 2BBWA 3OVMA 4F5QA 2QDXA 2SCUA 1T94A 1OXVA 2FLVA 2UVVA 4BIMA 1Y33E 2OTCA 3UMBA 5I45A 3BN3A 2KJ9A 2A0FA 4KEAA 1BS9A 3A6KA 3S2EA 2FE4A 4QOEA 4TV8A 9ICRA 5L9AA 1TAMA 3ORRA 3DHEA 4ED1A 3GEIA 3ZBPA 1EGQA 3JPYA 1MH1A 4N01A 4DBZA 3DE0X 2Z56A 2BL4A 2C0CA 3DF7A 2I3BA 3DT8A 3EK2A 5FI3A 1GKIA 1Z1VA 1G7SA 5FBQB 4BTVA 1SKAA 4LE0A 1PJCA 4BZWA 3FCOA 2PY6A 4KDEA 2VNHA 2HMSA 1VDVA 3AY3A 4K46A 1U8CB 1FDWA 3GEHA 5H68A 4OTZA 3TQHA 3ZNNA 2DVMA 2VWPA 3P2EA 3RHZA 4DDMA 1E1LA 5FWDA 4ONEA 5FORA 3D3EA 5I9NA 2V55B 3AF5A 4W5TA 3LPCA 4FSHA 1DAHA 3IUSA 4JLNA 2CCJA 1KMQA 4CT0A 5INTA 1SCIA 2C7GA 3JTEA 3JASA 2W3SA 4F6RB 4O4JA 4WN9B 2LDBA 1CZHA 1QSYA 1UZNA 4GQAA 4RIFA 2CWWA 1G8YA 2YN0A 3ETLA 3WP0A 1GPMA 2C97A 4IQWA 2WNIA 1RD4A 3FX2A 2JLWA 1L5NA 5WRFA 1O5IA 4L5IA 5KSOA 1N2ZA 4TMVA 3B85A 4WI1A 1I9CA 3ZWMA 1K4MA 4YMMA 1PR0A 4BNFA 1E3LA 4YRBA 3X2SA 1PS9A 4Z1MA 1PNQA 2J6TA 2R6ZA 3PJFA 3NRWA 5CGQB 3ZV6A 4HVTA 1TVKA 3O7MA 3IP5A 3EZFA 1YZ7A 3NW9A 4A4DA 8ICOA 1QHFA 1Z3IX 4ERNA 4MI3A 2O7NA 2YCBA 2ZSUA 4AIRA 1QP7A 1QTRA 3C3XA 3Q3EA 1JA1A 4GPZA 5IXSA 4XX0B 3WRYC 4MEAA 3RU3A 5AW3A 5KVSA 4NDZA 2OCGA 2GERA 2BHSA 3ETHA 3R41A 2PEYA 3HVKA 5CGZA 4LHWA 1I4TD 2A1TS 2NUAA 3KAKA 1T2DA 1SKBA 4BNUA 5JAPA 4DL3A 5BR8B 4IRKA 1R5JA 1PF7E 3CH4B 4G5OA 4WWHA 2DFKB 4X71A 1OPRA 3VZSA 1O6ZA 3A31A 4LDPA 4Y1RA 4CT4B 3QA9A 1FPMA 2OH2A 5BQFA 2H4HA 4TPKA 3NTUA 1JTEA 1NJFA 3NC4A 4UBNA 5EZQA 5EMJA 3TAUA 2OV1A 4C4XA 2C5HA 3B78A 2XZOA 2P40A 3KXKA 1ZW1A 4A9AA 2BHTA 4YR0A 2Y1GA 3K2BA 2EW2A 4BZQA 4Y9TA 1IQUA 3VYWA 1KI4A 1TIPA 4Q4DA 4FJ2A 1W59A 1XKQA 5KFPA 2B98A 3QOYA 5L7TA 2PKQO 3A4MA 2XCLA 1K8QA 1ZZGA 4J0KA 1D1SA 3DKIA 3DKRA 2WV9A 1ZQSA 3I2HA 4FUQA 3PNMA 4M76B 3R7DA 5BVGA 1R12A 2OYRA 4KPYA 1PZMA 5E9WA 1U2PA 4UATA 1E6UA 3ZU4A 3UJ7A 2MSDB 1FLVA 1E7RA 2CT8A 1Q20A 1V5IA 2ZSIA 5IVKA 4ND8B 4GBGA 2ODWA 5C31A 1HT3A 3FMIA 2YJNA 2ROQA 1SFRA 2QP3A 4GGOA 1JEQB 2P3SA 3L8HA 4HDMA 5E8JA 4J9OA 4C78A 2QL5A 3EXG1 5EXSA 3KDAA 2J3DA 2ZJOA 3Q2OA 1H23A 2MRLA 2BCQA 1H22A 4R7GA 3U7JA 3UNXA 3JATB 3TG2A 1ZQTA 1U4NA 2QD5A 3WB9A 3LP6A 4RAQA 4Q7LA 3U4CA 1U49A 4HATA 2C9BA 2J45A 4J1QA 2IIQA 1ADBA 3LQ2A 8ICQA 1X2EA 4JKYA 5JCJA 3GUHA 5CURA 3BJEA 4UNQA 5G1PA 2LKCA 2NQ8A 4PHFA 3PF8A 4YUVA 4CMHA 1ZI6A 3LW8A 1SR8A 3BF8A 3V2IA 1J0AA 4K3UA 2REBA 1R0BA 4WSOA 4WVFA 5EXTA 2FP3A 1G55A 3BMNA 3V4VB 4DG5A 4YXMA 4NJEB 2PLFA 2R7MA 3UBMA 4D3ZA 2OCBA 2JJ2D 2R1VB 4F4HA 2WPDA 5LDGA 4CIBA 4PCLA 4JQYA 4BFZA 3EH2A 3HG7A 5C8VA 2C99A 4WBNB 2OC9A 4UFPA 5TQ0B 5K3SA 1IBRA 5KG0A 3NVYA 3THSA 5DWQA 1RXUA 4C8MA 2VS1A 4Q4LA 2GKOA 3KC2A 1DK2A 1V7PC 3CHYA 4B9MA 1S2GA 4MR7A 1GZDA 1KU6A 5B1DA 1FEZA 3L4PA 5J59A 3SHTA 1K63A 3FSGD 3LX4A 4RQBA 1V8ZA 1HR0B 3VYRB 3WHPA 3HS3A 3QG1A 3AG5A 4QVKA 1TO1E 3HXQA 3W5JA 3LM8A 1WBJB 4KVAA 5FHQA 5T4HA 4UB1A 2W2KB 2D5AA 5FI5A 1M8GA 3ZJ4A 2QKYA 2B21A 2YY7A 4W5RA 1UPCA 2CCGA 2N42A 2P62A 621PA 2D0PB 4TVBA 5DBOA 5IX8A 2MMGA 3VOAA 1YHNA 4BECA 5JRZA 4PZAA 1A8QA 2FPIB 5BN4A 3EC2A 1P7CA 4RZUA 1Q57A 3PMLA 3QPAA 5KTOA 1UJCA 3QLUA 5IARA 2QLJA 3ANTA 3RVMA 3V7LA 3GZ4A 4FX5A 5IJWA 2D74A 1LK0A 3FETA 4PYQA 1L3TA 2WI8A 1A88A 3KFLA 1ISFA 2XD4A 2V59A 4EA9A 4KMRA 1PW7A 1H2YA 3LT1A 5EKUA 5A6SB 3FNBA 4HZIA 4RPGA 5D8DA 1Q6ZA 1NVAA 3UT0A 4I66A 4W1PA 2G9VA 2J9RA 2PLWA 4HTFA 3OJCA 4IZOA 2F67A 4NJMB 1YB2A 4LISA 4UHJA 8ADHA 1CZKA 3OO0A 4C7JA 1N6NA 5TPWB 2JGNA 4BWGA 1CE8A 3D43A 5GOZA 1Q1ZA 4U0JA 5FBWB 4Z5XA 2R8JA 1I2BA 2QRKA 4FGZA 4MPDA 1GT6A 2FFAA 2XV1A 3E53A 1XCLA 3G9UA 4KXFB 4E03A 5JWOA 3DG9A 2XE4A 3EQ6A 1R9NA 3SJUA 4F5DA 3ZHOA 1NXWA 2Z2ZA 4B6RA 5KVCA 1H8EA 2Q62A 3NP9A 8ICKA 1X13A 4UE2A 1NPYA 3F90A 1OV4A 4RA9A 4AU1A 5IUJC 4ZI3A 2WSIA 3O1LA 4J94A 2V7VA 2ZYGA 4ARCA 1N2EA 1ONOA 4GSYA 5AXDA 5ED4A 4LFCB 3V7KA 5I8ZA 4PG8A 1XU7A 1UDAA 1DBRA 2HHSA 2YZ7A 3IEXA 2FPPA 2P4SA 4IDFA 1SIOA 1DZIA 3BCUA 1VJDA 4FWBA 4Q5IA 1G6HA 3B6EA 4PIVA 5E38A 4EITA 5M5BA 1UBTS 1OCEA 3RQSA 2BMEA 1F51E 4R0MA 1IUKA 5HQTA 2LNDA 1RKUA 4EVSA 3OZDA 2OYYA 2E4ZA 3ASUA 4NPCA 4PZDA 4US0R 5K0EA 1I7DA 1SXJE 2V5UA 4EB3A 2HX1A 3C6BA 3CGWA 2IP1A 3FTCA 4PQEA 4B33A 3ZCTA 1OBOA 3O92A 1JFFB 4H0CA 3SXPA 4Q9JA 2HU2A 2HHAA 1WOMA 4P5PA 4EKYA 2R47A 3QFRA 1MB0A 2K7ZA 3A1TA 2XCSB 3LUGA 3LUHA 5D7NA 1K7EB 4PWYA 2CYAA 3FVTA 3QMMA 4ECZA 5K3OA 1S2OA 4NCBA 1GKUB 1VCOA 3OLYA 3R9IA 5HJEA 1RZRA 4MYRA 3LFUA 2ZTUA 4MYSA 4D8XA 4QIWC 2QZSA 1A9RA 3TMAA 1M8KA 2GN2A 1KVTA 2RHCA 2IBKA 4RD6A 4AJ2A 1ZQAA 1MQSA 3OPYB 4KL8S 1LQ2A 4B2IA 5KG4A 5G53C 3T7EA 3ANSA 2ZETA 4MROA 5DCYA 1DIOB 2WT8A 3EGOA 2VAMA 4X20A 5EL0A 4D0NA 4DJAA 1L7AA 4EJFA 1Z74A 4IWYA 4PVCA 1RKVA 2C83A 3I9LA 2MINB 4U2KA 4PFQA 3EW9A 4DOCA 1WP9A 4GR9A 4N4AA 2CWDA 3A26A 1E1DA 4JQSA 3CQ9A 1H2FA 1UXHA 1OVGA 1XPJA 1MJHA 3MWDA 3PTLA 4FYJA 3WNDA 4OMFG 2PFPA 1S89A 1Q84A 1TLTA 4R2KA 4TKMA 1Y6GA 3NHFA 2VPWA 2J3LA 2A19A 5F23A 3CZQA 4N8DA 3CRVA 3VH1A 3HDVA 5JSKA 3ESRA 3UWMA 4N65A 3ROTA 4UTVA 1OGYA 3TWOA 3V80A 1MOSA 1GGVA 3GQBB 1QF7A 4GMHA 4J03A 1Z12A 4HWRA 1G8FA 1ACMA 4NAVA 5JI3E 1MO4A 2VH1A 1P7PA 2DBZA 4YT2A 1OASA 3JQBA 1BU5A 2YBEA 3A1WA 3SYKA 1O4WA 2V6MA 3D6FA 4KDCA 5DB6A 2WFAA 3C6MA 4JJKA 4PNHA 2OR3A 1J6UA 3AT1A 3T38A 2LCQA 4BFVA 5JDCA 5JJKA 3TJMA 3UXYA 3G0BA 1M1YA 1YZ6A 2C2EA 3EXFA 4OMUA 2CKDA 1WABA 3EAQA 4WY5A 3WWDA 5B5EU 4DB2A 2BZ0A 3AKDA 1IN7A 1JU4A 1FJGB 4B3JA 2B82A 1F12A 1WSAA 2J3EA 3CF4G 4ZMBA 3A6JA 4V0RA 2J9YB 2WMOB 3T5DA 2UZ0A 3EZ9A 2XB2A 3ENNA 3ADOA 5C18A 1RYYA 3OQHA 3N8IA 2W2OA 2CMHA 1IXRA 1WWKA 4HT3B 3ISDA 5DHUA 4LZDA 3I42A 1L5SA 3TLBA 3GFVA 3TQFA 1KE2A 5DB4A 4YRTA 3ZY6A 3OIDA 1KEEB 1D3AA 2PYZA 1CHNA 2Q0QA 4KTTE 3IAUA 3ND6A 3OQNA 1MIHA 1QIKA 1W49A 4PPFA 4XA5A 1NW6A 4HDRA 2HLDD 3FC4A 1N9KA 4HN2A 1E0KA 1XJQA 2DSNA 3C70A 2A3VA 1FUYB 3KAPA 4C4TA 3ABIA 4OQZA 2I66A 4X8MA 4ZAFA 2NX2A 2OO5C 221PA 3T9DA 2XWBF 3Q5GA 4M7WA 3HNOA 2Z2IA 2ZBRA 4FFRA 4TQ9A 3VPDA 1MZPA 2W2PA 2VQSA 3OM0A 4WY8A 1T5OA 5DW0A 5DBBA 1E8NA 4TL9A 1P3Y1 1DDIA 1C41A 3ENVA 2J48A 1UWKA 4PZCA 4UDXX 1AU9A 2HHLA 2O3RA 1Y42X 4NOJA 4N3AA 1AK2A 3KOOA 3E3AA 3PR1A 2W6JA 4XVHA 3W6PA 2C2XA 2WB4A 4EW2A 3LLMA 4LTMA 1HTWA 3OFVA 4R2MA 4AXBA 1GLGA 2Y2VA 2PQ2A 1LWNA 2HA7A 1JLKA 3GAZA 3PJEA 2Y0EA 4K9PA 5CIWA 4YEDA 3TQRA 3PITA 1DXSA 1U7OA 4P35A 3P19A 1ZN2A 3H6GA 1XDDA 3EXFB 1LBTA 2PWZA 3GFPA 1IEWA 5G5GA 1FYEA 4O9MA 4YN4A 1FYVA 1CVIA 1JB1A 4TT3D 2AVDA 2GAJA 4FOSA 4PPNA 5I4BA 1NKVA 1QP8A 4ALLA 2BMWA 1QDUA 1B73A 2FP4B 5KX5A 1CF4A 1N2CB 5ESDA 4Z4FA 4P4OA 4G25A 4NE9A 2VUHB 1V8PA 1KEUA 1V35A 1T43A 2EJBA 4O0IA 4MIKA 1TQDA 4MJ3A 4MRMA 1I4EB 4R9RA 3F5FA 5TS2A 4N47A 4CEJB 3SS8A 3EPPA 4Z6FA 5LPNA 4CZ2A 1IN1A 1XTKA 1DAPA 4QJ4A 1SXEA 1M5TA 3IG5A 2H08A 2LBPA 2QIOA 2WG2A 3FTNA 4YY3B 1ILWA 8ICIA 1EE2A 3ECCA 2M6KA 3PS9A 3U3OA 3UOGA 2QV7A 4OQXA 1B6GA 1GQFA 4MI6A 3W5AA 2Y9MB 4FDUA 1HL3A 1YNSA 1DOQA 3F7MA 1ODCA 4FZJA 2N1BA 2VJDA 4UUMA 5KT6A 4PHTA 1NXSA 1MA7A 2BFAA 3OZWA 5A7FA 3ZJUA 3TXYA 1W581 3TRHA 2ERYA 1TVMA 2FPRA 4BQSA 3IEMA 5J2FA 1JR6A 1IBCA 1Z08A 4PQGA 4U2GA 4JV5B 4F4YA 1G4AE 3DEKA 1S7CA 1PR9A 1CQXA 1RWWA 1HE5A 5BNZA 3OQOA 1FP2A 4JN6B 1GAEO 2QAGC 2PRIA 2OVBA 4TKVB 2I8CA 4IQ8A 5DYWA 1GAJA 2ZJ3A 4RMIA 1O08A 3OLZA 3OPYA 4R4JA 2B7BA 2FJUA 1KSGA 4RMNA 2DC1A 3SN6A 4AFNA 2HJWA 3UHAA 1OYOA 3D4BA 3D2BA 1ZL2A 3HKDB 2YHUA 4MYTA 2I4NA 3U26A 5CVVA 1VE6A 1U2ZA 2Q8PA 3CLTD 4IJKA 4XYBA 5BV0A 1OWPA 3OWHA 4F4JA 4ZVKA 3A4TA 1LU9A 2F55A 2BHLA 4LK3A 4BATA 1TM5E 5DH9A 4YCMA 1GPH1 2Q2WA 3GUVA 3WIVA 3Q5EA 4MHTA 5AM4A 2VHUA 3I6IA 1OW5A 5CIQA 4FHEA 2GPSA 4K8OA 2CDNA 2J5XA 1SCNE 2QJRA 2CRXA 3TRFA 4B09A 2XVXA 3JRNA 2I4RA 2XSZA 3RF7A 2R7KA 4LYJA 4WKPA 1KFEB 4FDVA 2HMTA 4QAQA 4AN1A 3Q9NA 2ZYTX 1Z8HA 3AOGA 1FQWA 2WD9A 1KMMA 2WUWE 3KT0A 4MTCA 4MUAA 1VG0B 4B85A 4RIIA 3OC6A 4ZIRA 5D1HA 5EHZA 5KKCA 1CX9B 4HDKB 4IS7A 2HMUA 4K9LA 3M9OB 5KTRA 2XNHA 1SWWA 1HXHA 5DU2A 3HCBA 4C2BA 4W9RA 3BJZA 3I37X 1NN0A 2FKAA 5L3QA 1XA0A 3M8KA 4KC0A 4QOIA 5I7EA 2M0NA 1ZRHA 4Y2JA 3EASA 2XQGA 3S1LA 4WA8A 4RACA 1NJSA 2YVKA 4HP8A 4L07A 5DNVA 1YE3A 4MUJA 4MXDA 5EKDA 3S28A 1ZC3A 2QRPA 3AF6A 4NK5A 3BMCB 5SZKB 3KBBA 2E4YA 2LMRA 4PL2A 4TLAA 4KQXA 1AGRA 1CI4A 2A30A 5DGIA 3GDWA 3T5GA 3B12A 4YRZA 5HPYB 1E77A 4J4TA 5I9MA 4ZK2A 1DC7A 5KNDA 4ZREA 2F1KA 2QORA 1DRUA 2BKEA 1PKEA 1DADA 2NTJA 3SR3A 3OZXA 5JFGA 2ZIVA 1A95A 2VPIA 2ZSFA 2O14A 3AGPA 3E81A 3RABA 1W8IA 2JGFA 2QXTA 4V0NA 3F2DA 3RH4A 2HMYB 4G5RA 4OYHA 4EZ6A 1MO6A 1RM6C 4U7JA 1ST2A 1TK9A 4M9ZA 4BFWA 5JR3A 2R9VA 4DFMA 3F6YA 5I7RA 1OLXA 1ZAKA 2AG8A 5KX5B 3FGZA 1OXJA 1ZJJA 2X1MA 3IPRA 1MC4A 2CUNA 5C0OE 2XVAA 5IWCA 2IXBA 2GSDA 4KO8A 3RBZA 1OFHA 4MH0R 2O7VA 2UYGA 1CJSA 4GQBA 3ZCRA 4DMGA 3KETA 3CW8X 4EFLA 2PVCA 3BILA 4QUDA 3G0HA 4CV0A 1N6PA 4AQ7A 2HIMA 4UM9D 4CDGA 2FSUA 4P53A 2AFIE 5EYPA 1B6SA 2XNJA 2X8JB 1VZ2A 4WXPA 5EKXA 3RHFA 2PQMA 2YX8A 3PMNA 4OBEA 4WXYB 4C76A 4RPLA 4ZIRB 4DQSA 1K8ZB 1PUXA 3TTTA 1R16A 3V6JA 4Q19A 5KWVA 2YVAA 4I2JA 1CVRA 3MS4A 4QIWF 2JW5A 5LWHA 3RI3A 3R9WA 5EWLA 2XCQA 3E4CA 4YAIA 3N5KA 5CH3A 1PNRA 4RH1A 4DSNA 1VDMA 5HFJA 4JI7B 3K35A 1PK8A 4KP7A 1GSIA 1DB3A 3AFNA 1QIFA 3GJ4A 5FQOA 1T0PA 3ZNQA 1R7RA 2OGUA 5G4KA 3L8EA 1VSQA 3OZGA 1SOAA 1U4SA 3K5HA 4BVGA 1H3FA 3IIMA 1AZLA 1G5PA 1VPDA 2DCUA 2PEZA 2QG6A 3QVTA 4FEYA 1U0LA 5FR1A 3RVRA 4BN4A 5J8YC 2IHVA 2M6SA 4RVGA 3KVNA 5T4BA 1GXSA 2Q5OA 2NTVA 1MMFB 2WFLA 2AZXA 3EGEA 3ZE1B 1PNTA 1KQFA 4CTNA 5HR5A 1DIHA 1WJGA 3B82A 4IKPA 5HRAA 4I1UA 3C5FA 4WLVA 4F6LA 3V34A 5C7LO 2PH7A 4DL7A 3QF4B 4OHMA 4QBIA 5FUMA 1EG2A 1BPZA 1DO2A 1XHFA 3SQOA 1SUCA 1V11A 4U7GA 4EEZA 1NPTO 1X80B 2ZZNA 1JBQA 1NXOA 2CXPA 3VSBA 4MOWA 1BKYA 1NP7A 1WTAA 1B2RA 4NSNA 2AFIA 5LL6P 3U3MA 2NW6A 2AUMA 1ICEA 3H8VA 2O3SA 4C01A 4ICAA 4IXDA 3UXHA 3E22B 1YZNA 1Q0UA 4L16A 3TTUA 3VV3A 4EG0A 3C1ZA 2HDNB 1MO5A 2W9CB 2KNJA 2EFCB 3QLVC 4L5CA 3ZOZA 3L0CA 4I9GA 1QIMA 4I8IA 3RIGA 3DAHA 2IFTA 1H3NA 4PZ9A 4Q43A 4RKFA 2WIKA 1CEEA 1QR2A 1XFAA 4ILKA 4QFMA 2AXEA 1OLOA 2FV8A 4ZDJA 3HJUA 4L0MA 5HWSA 5AICA 3OHPA 1JKXA 2HOQA 2FSFA 1KDHA 1IOZA 2Q5IA 1VPLA 4GI5A 2QZZA 4C0XA 1ADYA 1VYTA 1DRGA 4HQ0A 4MGKR 9ICJA 1ZUWA 2V74B 3H19A 2KSOA 1QH8B 3IXLA 3NH9A 4L22A 4E1BA 8ICHA 1XQYA 2ZXFA 3AY7A 3CISA 3RSZA 4A1OA 4JYPA 5I9LA 2WLSA 1TMKA 1SCAA 2VPYA 2X2FA 3R0XA 1G8JA 3T5AA 2H1LA 4IDPA 3K30A 1Z7WA 2X2PA 5AW5A 1PWXA 1SV0C 1EVKA 1JNYA 3MRSA 3DO6A 3CXRA 3ZK7A 4DAEA 5HIJA 4MRVA 1HY3A 3ZCQA 5LM3A 5KPJA 1BMDA 4ZEXA 2H9IA 5FL3A 3I72A 3DNPA 4J9KA 1MT0A 4Y2PA 2XGPA 1GRNA 3O5AA 1VA5A 7ICHA 3EEFA 1A5BB 5FTWA 4DYHA 1H4TA 1Z2AA 2A4KA 4JL8A 5AFSA 1M34B 2XVYA 4WZBA 5IEBA 1S76D 1R8YA 3JZIA 3KK0A 2IW1A 1K5DA 3MMNA 3PX0A 1L1EA 3MWYW 4O4IB 5LYYA 4PLCA 2PNJA 2FWBA 3M6LA 1DCKA 4LSWA 3ZTYA 4U7PB 1TL7C 1EBUA 3R8CA 2HAEA 4A8JB 2HF7A 4KO2S 4ARVA 1U0FA 2Y1FA 3GJXC 3H3XA 3W4JA 3WE7A 1SRRA 2AK3A 2ET6A 2VF4X 4FSDA 3TZEA 1Q0PA 5IH3A 4ECSA 1F48A 1YDEA 2OCEA 1OYWA 1TRKA 1YRWA 3EVDA 3NANA 4PZYA 3WXBA 2C07A 1OFGA 1ONPA 1VMKA 4S1VA 3BT7A 5GP1A 5HMMA 1OFUA 1WPXA 3KALA 2ZYHA 1QMGA 2YXPX 3G2QA 4IO0A 5FLYA 4RPKA 5ADHA 3KU1A 3RAQA 3K3PA 4I4IA 1E3DA 1Q1EA 2YYAA 5AO9A 5BWBA 3HJGA 4QSMA 2YWBA 1Q1AA 1BE1A 4Q01A 1YI0A 3L8MA 2FMFA 2BLLA 5K0ZA 4GYWA 4WFIA 4IR1A 1E59A 3USES 2FW7A 3B5JA 3O7WA 2J4CA 1BFDA 1HEUA 2OCLA 3ABOB 4PC6A 3V8BA 5KYWA 1KL9A 1L4EA 1VXOA 3HT3A 4MUIA 4FTWA 1UC5B 2QDKA 3LYSA 4JI5B 1H2EA 2LHTA 1SG9A 2XDAA 4ON9A 4KLFA 3WRYA 3BRSA 1FJ2A 4AYBF 2KQUA 4ZQIA 3MWDB 2FZGA 1XD9A 5DGAA 2AXQA 1ZM7A 2ZE8A 2P0EA 2V1XA 1S7GA 3LJKA 1W36C 2ZM5A 3GO4A 1GGNA 1B0PA 2A7XA 2QX4A 3M4XA 2C54A 1PWEA 4W4TA 3P9NA 1PR5A 2PMZC 1KMCA 1G3IA 1CJVC 2W8ZA 1I0LA 3JYLA 4JLPA 5EHIA 1DIBA 5LA6B 4DREA 4HNHA 2RP5A 1PT6A 1YAJA 2QQ0A 1UT6A 3F5QA 4F9EA 1Q8KA 4FUTA 3HEBA 3CF0A 1RP7A 5F1KA 1PS8A 1XKXA 1Z5VA 4MKRA 1WDLA 3T3IA 4KLGA 4OBXA 1UPUA 2XZLA 1MLDA 2B0CA 3LUKA 4TRJA 3E3MA 1T6XA 3UFBA 1RJFA 3TLMA 5J0RA 1NGSA 2W58A 3AZQA 4KV9A 4LHZA 3VDMA 4OXIA 4A2CA 4KHPB 4O0LA 4BWMA 1XZ8A 2PQ0A 3L1KA 3OMWA 2NRWA 1TF5A 3JWEA 5TMEA 4CODB 5BYJA 2HMXA 3H5WA 1LA2A 1PGPA 1Q95A 4HI0E 3C3WA 2X8BA 3EF1A 3IDZA 3FSRA 5B36A 2WKRA 5K5EA 1SCBA 4KO1S 1KQNA 4ZO7A 1ZD8A 4RK0A 1TAHA 3ZDZB 3OUUA 4PYRA 3VI4B 5BUQA 1AMUA 1RWMA 3GCZA 3LA6A 2BGWA 3L02A 4N40A 2AOVA 4LRSB 5KNDD 2JEOA 2H3ZA 2RGBA 1CB0A 1OAOC 3LXMA 1V2HE 4UBOA 1FMCA 3EAFA 2VZ0A 3GJSA 3TIXB 3GRVA 4KLDA 4L4UA 3ZS8A 1GNLA 4DIEA 3TPCA 4OMDA 5LQKA 2BYTA 1QC5A 4QXMA 1NNEA 3EMDA 4MAAA 3GRRA 4QYMA 5LA6F 1UJNA 1BQEA 1SQGA 1NLZA 5BY2A 1KI8A 5HYVA 2EBFX 1UJMA 3H0EA 3OFSA 1QIGA 5BSMA 5ALGA 3RJZA 2V8OA 3IURA 1MSWD 3Q88A 1RE0A 1WUYA 1JW9B 2YV3A 4OHFA 2BISA 2FY8A 3VKUA 1MN8A 2MSEB 1DELA 3WLQA 1QFXA 1PJQA 2PR7A 4K1XA 1K27A 3SDSA 3MJCA 1KR5A 3JW8A 2DT8A 2BJHA 3ZE8A 4I1PA 2W37A 4L6IA 3UENA 2UYHA 4G8BA 1U0TA 3OIYA 3RFUA 2JIQA 1LVHA 4LS3A 3JQGA 3PT9A 1FU8A 4EY6A 4GL2A 1YCHA 2W2LD 4JUFA 2WIFA 5B1YA 2VRWA 1P31A 1JG4A 3CWCA 1T9DA 3NU1A 3U7GA 2HHUA 4IM7A 1H0SA 4Q45A 3DCIA 2D8MA 4RE5A 5A6SA 1JKMA 4Q1EA 1VJ1A 2R84A 1MORA 2VRCA 3H5VA 4KE8A 4LDQA 2AFIB 2BBTA 3O2SB 1KH3A 4F7DA 3L0BA 4B3CA 1NP6A 2INGX 3C3AA 1U5BB 1ND5A 4HGYA 2C9OA 3KSRA 4OBWA 5EZYF 1B00A 3GLIB 4WX2B 2R97A 3PEEA 3C45A 3ZK8A 2ZUTA 2L5YA 3L3FX 4NL4H 3FFTA 4B2LA 1EE9A 1LKYB 4L7QA 1RAHA 4AKTA 3IP6A 3DMNA 4PYKA 3RRXA 1TZCA 4LBYA 4P4LA 3WA6A 5CBPB 5LQUA 4KRFA 3ROQA 4XZ3A 2V5VA 1LCIA 1KEZA 2K7FA 4DMHA 4QEDA 4UD6A 3IHKA 5B4VA 3M1LA 1II8A 4UU8A 4YJGA 2NZXA 3AW9A 4N0MA 1NR5A 2NO5A 1GARA 2FVYA 3DTVD 3GGJA 1I3OA 1RXIA 3DGEC 5KSPA 2ECFA 4EI2A 3K75D 4JT9A 3SM9A 4DW8A 2AI3A 1YFLA 1ZD3A 4DOAA 3TTYA 4ARBA 1KY4A 2K8CB 4QULA 4LHEA 1JBEA 2J08A 4NMWA 1XMPA 5JRDS 4X62B 1EFKA 3DL4A 4H27A 4L3WA 1M0SA 5G41A 4ZKEA 1LVUA 3AHEA 4FLEA 1JSRA 1ZIXA 1N9ZA 3EC7A 2YS6A 1XMIA 1LNZA 1HURA 2G9QA 2XMBA 4G6ZA 4HAWA 2JI4A 3RS0A 3KYCB 2Z43A 1G3RA 1Y1KE 1GSHA 2R7AA 3D8UA 1BA3A 3P71T 2LWIA 4YG2A 2B8JA 3PHJA 4AG5A 2OGZA 1HF3A 2G5CA 4EQZA 1XRPA 3QEMB 3ILYA 3G6WA 2DWPA 3FN4A 2HJ9A 2ODQA 1T5DX 2RKOA 1VBFA 3KP1A 3JXEA 1UCFA 3A4VA 3BIXA 3NT2A 4MF8A 4DSAA 1HT1E 4YPOA 2E6KA 5DGTA 3UXEA 3CGGA 3JD0A 1PU2A 1Q74A 2FZLA 1MN6A 1QG2A 1XSEA 1ZY2A 2ZR9A 3ASYA 4G63A 4P0TA 1SHZA 1TOAA 3RBXA 4G2TA 3V42A 1OU4A 1M33A 4C6TB 1B0ZA 2L2QA 2O2HA 3WBBA 1EEHA 1HA3A 1KARA 2IYYA 2R4TA 3H5LA 4NX2A 3VVLA 5EHGA 5JROA 4MKHA 3G8YA 3C48A 1HYQA 5KG3A 2PMBA 1PGJA 4Q3BA 5I3CA 4X84A 1GEGA 5J1SB 1Q0RA 4MWBA 4E0DA 4Y6SA 3KUKA 4L9WA 4BX8A 1QYIA 2DFPA 3AO0B 3G2NA 3ZDBA 1QVVA 1G66A 1U45A 1D1QA 2XF8A 4ZVVA 1XZHA 4HOYA 3ORSA 9ICXA 3ZE9A 2VA9A 1NFQA 1Z16A 4FBUA 1NBAA 9ICHA 1KO7A 1P4RA 2O2YA 5T6BA 2WVAA 1HMYA 2GPAA 5HCNA 4KODA 3IOBA 4E2FA 2FMTA 2C4KA 3OZRA 4AI6A 4E4RA 1UADA 4AMVA 5GTIU 1VHQA 5KMGA 4O59O 5KWIA 1ORVA 2UU9B 3LRPA 5FBHA 1XLTC 3B53X 4JK3A 3S7ZA 2VXBA 2X9VA 4RMGA 4RVHA 5KYGA 1G59A 2Y1WA 4DFDA 2ID7A 3CLTC 2H57A 3OWOA 3A1EA 4QATA 5G0UA 1NC1A 4Q8FA 1J8QA 4A2WA 5K8JB 1KZYC 1EQ2A 4Q18A 3VKGA 1WCLA 2GYVA 4YLGA 4MJXA 2BIFA 1RACA 3WG9A 1N5DA 1NVFA 3B5EA 3CLRC 3RS7A 3BCHA 3AR3A 2O6HA 4UBLA 4M9RA 2DTEA 4IYJA 2Y9PB 1L9KA 1TEHA 2BFPA 3IBYA 3QKWA 4DJDC 4D4JA 2ODGA 3OQVA 3GLVA 1P2TA 4KWTA 4RGVA 3W77A 4ZYWA 1NVVR 4WAUA 1VJ5A 4CM8A 2IS2A 3TUIC 3RFVA 3VZRA 4ARSA 2VP9A 2WINI 1N6IA 3ZD7A 5KBYA 4EY4A 1SXJC 5J2UF 4IRXA 4JC4A 1S01A 4EX6A 1DSSG 3WGVA 5G02A 4BLQA 2RGCA 4O5OA 3PI6A 4QWBA 2C7VA 3PNQA 3WADA 1DE0A 5GJBA 2P5UA 1EXMA 4BE9A 1ZQUA 3HP6A 1RZTA 1R9JA 4LJ9A 2JIZD 2VWGA 4FNAA 5JPIA 1VBKA 3PO4A 1OOEA 2HZ7A 3C2MA 3FRHA 3ICVA 1MABA 3UPTA 5CK4A 1JPUA 1Q1QA 1A7UA 1URJA 1YZLA 4K6HA 4HEJA 3Q98A 3JPWA 3W1WA 421PA 5F9NA 2QTZA 1CUHA 4CUKA 3WZMA 1UFQA 1V6AA 3EFEA 1BO6A 1AKRA 3II6X 1R64A 1XU9A 2HD4A 2XY4A 1SIBE 1B4DA 4JFRA 3RGGA 3SIXA 1PO7A 4Q8EA 2ZI3A 3SAHA 1UJ5A 5L1MA 1RPLA 1KBZA 1M2JA 1X1RA 3QVKA 2EFHB 1I33A 2EWMA 4XM0A 5KYYA 4BLVA 4PY2A 2X1LA 3L43A 5FBZA 4HH4A 2YMPA 2PGDA 2QSUA 3JYOA 3PEUA 3I73A 3PP8A 4OOEA 4XIYA 1YGPA 4B5LA 1M0EA 5IZCC 2VF5X 3M0EA 4JLOA 1EIZA 1NW3A 4Y2YA 1CRXA 2PZJA 2P9CA 2R5WA 2VWHA 3DZCA 3IPCA 4HNGA 1UC8A 3AHGA 1IUOA 3DE7X 3A4IA 2VC2B 3HP7