4EENA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase-related protein
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 82
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eenA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eenA01
4DW8A 5ALDA 1RKVA 5AK4A 1ZD5A 3U7FB 2YFYA 3N28A 3PGLA 1IWOA 4AS2A 1WVIA 4UATA 2YJ6A 2HOQA 2C9MA 4O8CA 2FUCA 1QYIA 5AI6A 3FZQA 1L8OA 3DV9A 2YMQA 4BX3A 4UW9A 3QUTA 2PR7A 3I1YA 4KNVA 4YIKA 4ZEXA 2WF8A 4C4SA 2I34A 1YV9A 4YIHA 3NUQA 3SLRA 2B0CA 5IS2A 3CZ4A 2MSNA 3ZVNA 5AKYA 4JDPA 1WZCA 2G06A 5ALYA 4Y2YA 1FEZA 2AMYA 1YNSA 4BX2A 2MU1A 2YJ5A 5ALQA 3ZWDA 3SKYA 4RETA 2G0AA 3R09A 1TA0A 2OM6A 4BNDB 3UMBA 1RLMA 4FE3A 3DNPA 4E88A 2ZXEA 5T41A 2B1QA 3U7HB 1ZD4A 2BDUA 1Z4KA 3A1DA 2YMLA 5ALXA 5AHXA 2ZBDA 2PKEA 3NASA 3A3YA 1U7PA 3FGOA 5AW7A 1RQNA 4UAVA 3HLTA 2WM8A 3AR2A 5AK5A 2WF9A 2G80A 2W43A 3KBBA 1ZJJA 1O03A 5ALLA 1VJRA 4HGQA 3ONNA 3OTQA 3WGVA 3WKEA 4NFLA 3U13A 2YMPA 3OCWA 4EEKA 2YMMA 1Y8AA 4OD0A 1Z4PX 4KX3A 4XE5A 1ZOLA 4BX0A 2RAVA 1F5SA 3I76A 5AM3A 5AM2A 1Q92A 1N8NA 2AUTA 3W5DA 2CFSA 5AW9A 2DQSA 2OA0A 3SF0A 4CF3A 1J97A 4HGPA 5AM1A 4Y2UA 4Y2XA 2PQ0A 2YJ4A 2HCFA 4CNQA 2AGVA 5AVSA 3EPRA 3B9RA 4Y2QA 4UMDA 4BEVA 1AQ6A 3M9LA 5ALKA 4OCZA 4QJBA 3WK5A 5A3SA 1RQLA 1NF2A 2R8EA 3WKCA 5AK3A 4L6AA 5AVYA 1U2TA 3UMGA 2FPSA 2ZG6A 5AW1A 3E58A 4Y3UA 5AESA 1RPZA 4B6JA 3OCZA 1S2OA 4I9GA 2FPWA 2I55A 3FM9A 3M1YA 5AKIA 3OCUA 3KD3A 4HGNA 5AVUA 1K1EA 1XP5A 3FPSA 2YBDA 4BYGA 4MWOA 1YJ5A 3ZVLA 2P69A 5AI0A 2HHLA 2ZBFA 1T5TA 2G1AA 5ALJA 5ALOA 3QU9A 5ALEA 2I33A 1RRCA 3QYPA 3SD7A 2I54A 3R4CA 3L8GA 2P9JA 5ALVA 1Z5GA 3R9KA 2WHEA 3D6JA 1X42A 2NO5A 2P11A 3VAYA 3L1VA 1U7OA 4YCNA 2IA5A 2ZOSA 1NNLA 2W4MA 4G9BA 2P27A 2JAWA 3TLMA 2G09A 5ALPA 3DDHA 2R8XA 3U7GA 3AR3A 5AVQA 3WK6A 3ZI4A 3IRUA 3L0CA 5AI8A 3ESQA 4UM5A 4OHFA 1Z5UA 3A1EA 3IJ5A 4C4TA 3ED5A 2CFTA 1U02A 3L7YA 5AVZA 3ZX5A 3IB6A 3S6JA 3U26A 4YCLA 5E0OA 5ALHA 3HYCA 2GO7A 2C4NA 2ZBGA 3RF6A 3AR7A 5AKLA 3K1ZA 3ZW7A 5AVTA 5AW4A 1TJ4A 5AW8A 4BEWA 2YN4A 4GIBA 4Y2SA 4GXTA 4RESA 3KZXA 5AKZA 1SWVA 1N9KA 2C88A 1ZD3A 1S8OA 1ZRMA 2EATA 1ZS9A 2HSZA 4Y2RA 4HGRA 2FPXA 2I7DA 4G63A 2Q5EA 2MU2A 1RMQA 3QU4A 1RLOA 3F9RA 1WR8A 4FFDA 2B8EA 4UM7A 2HDOA 1Z4NA 1U2SA 3L1UA 1Q91A 1L8LA 3U7EB 1NRWA 3QUCA 4MUMA 3AR6A 4Y2PA 5AKGA 1T9ZA 2D2VA 4YH1A 1L7OA 3QGMA 4NAVA 4FYPA 4HGOA 5AM5A 4EENA 3AR8A 5ALGA 5ALTA 3SKXA 3PCTA 5ALUA 1QQ6A 2HX1A 1XVIA 1LTQA 4EX7A 5ALWA 3WK4A 5AW2A 2JAOA 2FI1A 2NO4A 5AKXA 4UAUA 3L8EA 5ALNA 3GYGA 4YCMA 2IOFK 2NYVA 4KNWA 3UMCA 2FPRA 1Z4MA 2FEAA 3AR5A 4NABA 4UU1A 1SU4A 3DAOA 2RBKA 2Q4TA 1VFPA 5AVRA 2FPUA 1JUDA 5FP0A 4UARA 2X4DA 4AP9A 1PW5A 5AKJA 2JAUA 1L7NA 4NWIA 2B30A 3WKAA 2GMWA 2B1RA 2YJ3A 1LVHA 2WF6A 4J03A 5A3QA 4H1WA 1Z4LA 2BDEA 3MC1A 4L57A 5AI9A 4CF5A 3WKBA 2G08A 5A3RA 3BWVA 1CQZA 4UMFA 1EK2A 3PGVA 2JGAA 1RMYA 3ZUPA 3MMZA 2C8KA 2B82A 3ESRA 1Z4QA 3KDPA 2YY6A 2WF5A 4EELA 3W5BA 3N5KA 5AKKA 5AM4A 2QLTA 3B8EA 3I6BA 5ALFA 4L6CA 2C8LA 3E84A 5AW3A 3WK7A 4XOUA 3QU7A 2RARA 4EZEA 1RC8A 1YMQA 3OCVA 4DFDA 3QNMA 2G07A 3QU5A 2FUEA 4ZEVA 3N8GA 2HF7A 4C4RA 4HAIA 1XPJA 2WFAA 1Z4IA 5AI5A 1L7PA 1YDFA 3I28A 3SHQA 1ZRNA 1RMTA 3P96A 5AW6A 2B8JA 4CE6A 2OBBA 1O08A 3ZTYA 1KYTA 3CNHA 2GHQA 3EWIA 1L6RA 5AICA 4IG4A 3AR9A 3W5AA 2WF7A 4BBJA 4YGYA 5AI4A 3OCYA 3E81A 4DCCA 3PDWA 5ALZA 3NAMA 1TJ5A 3L0BA 4PNHA 5AIBA 5AVXA 3A1CA 5ALMA 4XQ0A 3WGUA 4J2TA 3SMVA 3KOOA 3EF1A 3UM9A 4BNDA 2ODAA 5AW5A 3WK9A 4AS3A 3U19A 1SWWA 3N07A 3EF0A 1RLTA 3OPXA 5AM0A 3BA6A 2HO4A 3ZVMA 2O2XA 2Q4RA 5AKHA 2IYEA 2VKQA 3QUBA 3J7TA 2RB5A 3FPBA 1QH9A 3L8HA 3OCXA 3QU2A 2BY4A 1Z4OA 2HEGA 3N1UA 5AVWA 1VJ5A 3AR4A 2CN1A 2GHTA 2EARA 3WK8A 2QYHA 3RFUA 2IOFA 4F72A 3NRJA 4UASA 5ALRA 3QLEA 4Y2TA 2EAUA 2ZBEA 1RKUA 1QQ5A 1Z4JA 1RDFA 4Y2VA 5IT0A 3ZWKA 3MPOA 4DWOA 4JB3A 2R8YA 4KYTA 5AVVA 1J8DA 5AIAA 3E8MA 5AKEA 4IFTA 2OYCA 4Y2JA 3QXGA 4KN8A 5AK6A 1T5SA 3NALA 4UMEA 2JARA 3QX7A 5ALSA 2O9JA 5JJBA 3W5CA 1EK1A 1RKQA 1YS9A 3MN1A 2I6XA 4XPZA 5IT4A 2IOHA 3ZTWA 1Z88A 1ZD2P 1MH9A 3QUQA 4BKMA 3ET4A 3ZX4A 4F71A 4UU0A 2HI0A 4QQFA 4EX6A 1QQ7A 4UMVA 3NIWA 5AW0A 4I9FA 3ET5A 3WKDA 4CF4A 3ZU6A 2CFRA 3L0YA 2W11A 1TE2A 1L7MA 3L8FA 4HYTA 3B9BA 5ALIA 1CR6A 4ZEWA 3FVVA 1TJ3A 2R8ZA 2AH5A 2HF2A 3KC2A 4KX5A 4OFZA 1WPGA 2FDRA 3L5KA 2GFHA 3NANA 4NV0A
chains in the Genus database with same CATH superfamily
1YR1A 2QKQA 4M6WB 2PXAA 1DI0A 5DISB 2OYRA 2GFQA 4HZIA 3OESA 5D84A 2FWBA 2VDRB 1J24A 1V85A 1TM2A 2Q3CA 2HOIA 4Z0HO 3QUTA 3PI6A 4P83A 2CT8A 4DWJA 2PX5A 1DEKA 2YZNA 3AL2A 2HJRA 1YZTA 3DTNA 3RHSA 3FHOA 3O75A 3ONDA 4OI0A 3Q9UA 1L3CA 5CYPA 2Z5GA 3G8DA 2G0AA 1TXGA 2J3EA 4E88A 4PANA 1I1NA 3IT0A 2B1IA 3RLIA 2W71A 3BFXA 2REOA 2XDWA 4L5IA 4DNOA 3RVRA 4W9MC 3ZH9B 2YIVX 1GGMA 3ONNA 5J43A 1Q7GA 4P2HA 2HBQA 5YASA 5E6SA 4WKBA 5GPBA 4OJYA 2ATXA 1ZK1A 3HWTA 3B6EA 5KT6A 1VMIA 1J2YA 2F8TA 2HPZA 4KGVA 4DIOA 1KEEB 4NYJQ 3LRPA 4XKJA 2XTMA 1U48A 1H8HA 2JLYA 4B7AA 5C4GB 2GCNA 1N7GA 4ID3A 4DKXA 2P6PA 1H66A 4F4ZA 4OJQA 4BO1A 1L6NA 3JS5A 1TMKA 3AOEC 5KTPA 4KLLA 5EWGA 1XMVA 2MYTA 2VAVA 4HH0A 2AZMA 1TI7A 1NR5A 1Z0AA 3SAHA 1E3IA 2FFRA 2AFHA 1ZRSA 4YUYA 1O57A 1DXYA 3EGXA 4C2UA 1PFQA 1K8YB 4HFMA 4AMYA 4AZ0B 4E32A 1T6NA 2GPNA 4UTRA 1F51E 1LS6A 2ISPA 4J7UA 5EWFA 2OOKA 1IM2A 1KFJB 3F2CA 2Y68A 4I1RA 4YRBA 2PUGA 3WIDA 3KTFA 5EIFA 5JVDA 2IKQA 4DILA 2PJUA 4KQMA 4IX9A 4IEFB 5CHEA 1T26A 4FINA 3C6YA 5HDQA 1DE0A 3PVXA 4HEQA 4G2TA 3EC7A 1F06A 1FOEB 2RBEA 4E0DA 2UYHA 4MCJA 3SG0A 1J0EA 4F3OA 2E21A 3NYRA 5FBRB 3LXXA 2R8HA 2P2CA 2A7XA 2BFFA 1EDEA 2HDOA 5JJKA 1X19A 4OBBA 4CM4B 5I9LA 2CBZA 3ZIDA 4BB6A 5B3KA 2YQZA 2VT3A 4MR9A 4HV4A 1ST3A 8ICNA 4LF4B 3M4NA 5BR8B 3S2EA 4K8OA 2OCKA 4Q1FA 4MV0A 4L8YA 3TR5A 4IF6A 4K9LA 1Q0TA 2GD1O 5FBKA 1G38A 5FULA 4MYHA 1Q8KA 3SDSA 5KAPA 1X7WA 1BWPA 1ZQMA 3NU1A 4PHFA 1RAEA 1UODA 4IEIA 3QH4A 3EXG1 5BR7A 1VPEA 4CEIB 4R31A 3AB8A 3TLKA 4ERNA 3FKQA 4ZAVA 3P71T 4OL9A 5DDMA 1CNEA 4U5QA 1KYXA 4P08A 2RGRA 1A9ZA 4HNAA 1FL9A 4M1QA 1KN5A 1IZZA 5BSKA 2I7TA 1Y9JA 4EZ9A 3WL3A 3H0LB 3SBOA 4OHPA 4YJ3B 2QI9C 1Y33E 3KJEA 3MINA 1UPHA 4UBLA 5KFRA 1DXSA 4C21A 2QRUA 4CE6A 4Q9AA 2ADOA 4B74A 4QWMA 3GL9A 1USKA 4BWYA 3SZLA 5FL7D 1ULUA 1VG0B 4ECYA 2A9KA 1CUJA 2X7HA 3QWBA 3TLGB 4CKWA 1ODIA 5JYBA 2FR1A 3RTAA 2Q07A 1GRNA 4U7FA 1UOOA 5K0SA 4U0KA 1L3UA 3CZ9A 1SOAA 2K4PA 4LDPA 1SC1A 3UHPA 1ZQVA 3OZ7A 2HY7A 3E03A 2IZZA 2X86A 5G4KB 5IMSA 2B6GA 1KI2A 3ADOA 5B4TA 4D4IA 2O2CA 5DHAA 1Y9AA 5IT0A 1BFDA 1BVRA 4N7MA 4YAKA 5F33A 4GYYA 1QM5A 4RF3A 2ACEA 4HDNB 4D8VA 3UV6A 4UU0A 1P0PA 3FY4A 4EX6A 4EVQA 1BD4A 5EGSA 2G4LA 3CX6A 6ABPA 1NJZA 3HR8A 2R7MA 3KB2A 5EXTA 5FQOA 3E22A 3QA9A 5CK4A 2P1DA 3B6MA 2ZIFA 3ZCQA 2QX6A 2W9CA 1B43A 3PR4A 3T1HB 1EFAA 4PQFA 5C34B 4TMZA 3T7KA 4GUDA 5JS1A 3PGKA 2CRXA 4LVOA 2HW8A 4C5AA 3MFQA 3IAM1 3FR8A 5I5GA 4XIGS 8ATCA 4DSAA 3I1YA 4CMKA 2I71A 3LY7A 4QRDA 5C8YB 5H5JA 1YNSA 3CLUC 4XD7A 3P52A 2RK6A 5LMNB 4XUCA 1L2TA 1XTSA 4G89A 1C1YA 2H4JA 1RE0A 3GARA 4AJHA 4OMUA 4OJLA 4ETMA 2DVMA 3UJ6A 4CUZA 4OXIA 4MYDA 1KSGA 1X1TA 5E4JA 1KFBB 4A2WA 5KYUA 2I2XB 4E70A 3EIUA 2H29A 4K4HA 5DP1A 3SXUB 4EUHA 2IUFA 1GRVA 3AKYA 2CV1A 2V7QD 3WSTA 5L3SB 3C14C 4CI0B 2AG1A 2AGVA 3HWWA 3M82A 3B9JA 3H87A 3UHFA 1NK7A 3GFTA 3TX6A 3ZBUA 2E3JA 4U7WA 5AESA 1R27A 1HUZA 5DOZA 5HR6A 3S81A 7ICSA 3NS7A 3F6SA 4HGNA 3EUFA 3PSAA 1VSBA 4N65A 1XDSA 4QIWC 1FJGB 1ISFA 1N5IA 4ZI7F 5EWMB 1XFAA 1EVKA 4OUDA 4I50A 1K7CA 5LZ8A 3FBGA 3NWEA 2ID4A 2ZTHA 4DTCA 3QLVA 3FDZA 1LC0A 4WINA 1PUXA 3WWCA 2N0SA 4AL4A 2EL9A 3A1EA 2ZRQA 4C5CA 2IF0A 1TZJA 3DO5A 3WBJA 4LXGA 4M88A 1FSFA 4FXPA 3OT1B 2BHSA 1RJEA 5AW8A 3S5JA 1QKIA 2RCYA 5BORA 3CVVA 4BLTA 2EP7A 4MS4B 1V7QA 2GPAA 5CP2A 2WUDA 2H4FA 1MABB 4O2BB 5KFOA 4C89A 4F92B 1XGKA 2XTNA 3PE6A 2X6TA 3O4JA 2PIAA 1SXJB 4ZK2A 5HZKA 3P9QA 4WLOA 2I2AA 5ALNA 1LI5A 1T5HX 1IK6A 2AFVA 2EW2A 4H31A 4J07A 5FWDA 2YYSA 1SHTX 4R6XA 4JLOA 5LLTA 1AS2A 4UAWA 4FB5A 4I14A 4ZDJA 1UBGA 1Y1QA 4V1CB 2O5VA 1W94A 1LLDA 2Y92A 2ZSKA 3DMFA 4NCNA 1FVHA 4BZXA 5SICE 2QLBA 4L85A 1Z2AA 3BGSA 4HNAB 3E5HA 2J3MA 4LRQA 5L1IA 2YV1A 3Q8XB 2G6TA 1GSHA 2QTNA 4DFDA 1X7YB 1JQEA 3MINB 1PDOA 2NNLD 2O1WA 5LXTB 4BWJA 1K89A 3FYUC 3ZU5A 5JCOC 1M83A 1EE1A 1LDBA 1AG9A 3ZJUA 4MF8A 2DFDA 2Q7DA 1IPEA 1CJMA 3RHTA 2H1WA 1GA6A 1CJVC 4B83A 4C43A 1W47A 3EULA 1RVV1 3TUJC 3WMEA 3QY9A 5E7QA 4O08A 4X62B 3UWDA 5E79U 4HMPA 5JTTA 3CURA 5CX1B 2HZBA 1P3Y1 2XCSB 1EP3B 2LVBA 3KHKA 4Y2TA 3CNBA 3KM0A 1T2FA 3CNEA 4OQPA 3THOA 4HUTA 4JB3A 2IWRA 2Q8PA 1EGVB 1MRSA 1E2GA 1FE8A 2VPQA 2RHLA 3QX7A 1IZ9A 3VPFA 1P60A 2H2GA 4I4TF 4R84A 3CR3C 2EIHA 5L53A 1MXFA 5LD2C 3K75D 5L3RA 3I9V6 2HCJB 3HZRA 4K86A 2GPJA 3F3KA 4Q4HB 4MFCA 1IQRA 7ICQA 3HA3A 1CDEA 1O97C 3UQYS 4BNZA 5KTOA 3S2YA 1CB7A 3MW8A 1Z0ZA 2O8VA 1NOMA 4XGNA 3AGPA 2ZUBA 1X40A 3RUAA 3DLTA 1D4FA 5JHHB 2IXGA 5F5LA 3PP8A 4U2FA 3NATA 4IHAA 3VVMA 5H80A 4WBSA 1MO3A 3DE2X 2IL1A 1QDUA 4Y7DA 2FDCA 1D2EA 4Q66C 3ZCPA 1U5BA 4UBKA 3DCNA 1Z75A 2OO5C 5DSXA 4CMGA 3LBAA 2QWXA 4CG2A 3GDGA 5KAIU 1I2CA 2IGTA 1VSVA 2QYSA 1BEUB 1U7PA 4NCHA 3UK1A 2V5AA 1OLSB 1K92A 3D2CA 2WTMA 5ALLA 4C05A 3RC3A 1NYTA 4KZPA 4I36A 4FYYA 1MV5A 2VRCD 1Q50A 1MLDA 1Q92A 2AUTA 5AWFC 4EMUA 2ZT6A 2ZYIA 2ZJFA 3TNJA 2XRMA 4Y2UA 1NU8A 1MUUA 4CDRA 3TLZA 4UMDA 4OLJA 4HPJB 1XKLA 3B5EA 5DMHA 3WRWA 3HC7A 2GAJA 1ULAA 2F8SA 4CMJA 1ZITA 2RGNC 2HD4A 3I32A 2AOUA 2EQAA 5EMJA 2PSJA 4LYEA 4P38A 4KLGA 2Z9DA 3C7CB 2WA2A 5IAKA 2EZXA 1E1RD 1ECBA 3LUFA 3TQFA 3FHJA 2WY2D 3IH5A 4PQGA 2OQ2A 1SVMA 621PA 2H1HA 1FMCA 5THQA 4ZCQA 3L6OO 4XFJA 3S2FA 1SN7A 2EG5A 2CJYA 2HBLA 4II3A 1NRXA 3LMKA 1OIXA 2VQSA 1SXGA 3FBTA 3AJAA 1XIVA 4TLDA 1PJQA 2ISQA 4DCUA 2OG1A 1R18A 3T4EA 5FV7A 3DAHA 2OOSA 3BJEA 4E4RA 4R4JA 3OD5A 1S1MA 2C88A 1X9XA 1NU6A 5ECYA 3I05A 5EXDA 5LZ4A 1PSZA 1KI7A 3B6IA 1YONA 2ZI7A 2UVWA 1NZPA 3PFCA 3MAGA 3M81A 4LQDA 1QH8B 4INAA 2DY0A 1AKEA 1L7AA 3A1TA 1SZDA 2IKSA 1SHJA 1YT5A 3ZDRA 1U8UA 2VJYA 4NMXB 4TSFA 1EGMB 1G4HA 4DV1B 3NMUF 1QKKA 5F78A 4QM6A 1P81A 3NWOA 3D3EA 4G41A 2W2NA 4DL2A 3HX0A 3MLBA 3KJHA 3RR7A 3QWHA 4F50A 2QTWB 4IEEA 3ZK8A 4RHYA 3CN7A 5ISMA 3HU1A 1QVRA 3H1PA 2ZJZA 4GPBA 3EMKA 1I9GA 1S6YA 2R1TA 3W8FA 4ESHA 3IL2A 4KMUA 3V6KA 4RXMA 5EJIA 3R7WA 5KT7A 1CIJA 2C8LA 2CHGA 4M21A 4LZWA 3AUAA 3OY2A 3IP1A 2FZWA 2JCSA 1XC7A 2R11A 1F3OA 4K6KA 4I66A 3LGSA 1YRLA 4B8WA 3EZNA 1UHUA 5KKAA 4Z7OB 2UZ3A 3KYDA 1FP2A 3U61B 2GHQA 3AY6A 3F5DA 4L72A 4PAGA 1IM8A 1M8KA 2QXUA 5IZCA 2YH2A 4BO7A 1NQOA 3R3YA 3PC8C 4HLNA 4Q4JA 3SHVA 1M75A 5EIOA 3FFAA 1JKIA 2PT6A 4MGYR 1ONPA 4DY6A 2VKQA 3P4XA 2DQZA 4G0ZA 1FUKA 1QAMA 3KDAA 4M87A 5D6NA 4B9MA 1EFCA 1DDGA 1FMJA 3I34X 4XDGA 3VGPA 1MQ8B 1BMQA 3ITKA 5GM2A 3AZPA 2J6BA 1G2PA 4G4GA 4BLRA 2I6XA 2FUG1 3O84A 3BXEA 3EIHA 3CUSA 4GE3A 3CEHA 4FQ8A 1O6ZA 3D0OA 4MS3A 3LX8A 1XJQA 3JYQA 5A4FS 5J2CA 4OQXA 4W8OA 5TC4A 1M5TA 2XBMA 4Y6OA 4ZEWA 4XCXA 4TZTA 2GPBA 4D6YA 1GL7A 4JXZA 3LUDA 1PJ2A 3OOYA 5ENVA 4XZ3A 3AVQA 3KOZA 3PQ3A 1DC8A 4Z5XA 2C7RA 2ZI5A 2CNDA 2Q3LA 1LF5A 3W2EA 3BFKA 3KEGA 2FUCA 5CFZA 2JR5A 2PNFA 2PUHA 4FN5A 4GPIB 4EOGA 1DUVG 2JA1A 1Y0BA 3SQDA 2E82A 2F2TA 1XLUA 2BOVA 4OL0A 1P0FA 3C1TA 2FW0A 3IUYA 1WNFA 3T5JA 2HL6A 4AJIA 2FLWA 2MSEB 2H7CA 3SX0A 1YQDA 3KOUA 1RM5A 3HHEA 2A1IA 4EARA 3C7TA 3PFHA 8ICIA 3PL1A 2JJMA 3K0AA 3EPLA 3BD8A 1KFCB 4D4MA 4EKDA 4O4JF 4HDSA 3JYHA 4NSNA 3RAQA 1Q83A 3G7UA 3COPA 3WAKA 3LLSA 4R2MA 5AW9A 4HGPA 3AG5A 4RPCA 3E1GA 3QI2A 4WBNF 5EESA 3G0BA 5EXXA 1QG4A 4X71A 5E7MA 4F1KA 2R8EA 4Z7NB 2QLLA 4DAEA 2KE7A 1E1KA 4RFSB 4DM7A 1SGGA 1I2ZA 3N7RC 3QMPA 2EBUA 1UBJS 4RKWA 1XZQA 1PZXA 4JWKA 3EWNA 4P22A 4DC0A 3LQ4A 4DM4A 4OQFA 3ETLA 1E9VA 2VT6A 2WSSA 3MMXA 1TCBA 4D0LB 1ZQKA 5JAIA 1VDVA 2A1TS 2AEEA 2GO1A 3VNUA 1BU5A 3VDXA 1ESNA 2JJ2D 4MWGA 4HRXA 1V1MB 4TT8A 2VI5A 3U4CA 5JRDS 1TEXA 4HQFA 3DVAB 4C1NA 3Q3CA 1MORA 3M7IA 1NK4A 1CG6A 2EWVA 4WQMA 4CMEC 1DIBA 1VMAA 4GEKA 2RGXA 1WUIS 2I7DA 2QB1A 2O2HA 3C3XA 2H4ZA 2RDIA 1PFYA 2QXYA 4EHJA 1I0LA 3M6LA 2C59A 2VJBA 3ZE2B 1UL1X 1D04A 4D46A 2R751 5C4MA 2PAFA 1XAIA 1OSNA 3H9BA 2AYYA 2G4VA 3HNPA 4O5EA 4G1CA 3ASUA 3PC6A 2BHRA 1TYDE 1CKEA 5JYDA 1PV4A 4QNNA 2L2QA 5B53A 4C8LA 4D9JA 3OLQA 1C20A 3EEIA 4CQLA 4CQMA 3WLLA 4DR2B 3Q8PB 1PFKA 4TWBA 1UK7A 5G41A 1QFJA 4QRIA 4DWVA 4JGGA 3OFJA 1WOYA 4ECXA 2VL7A 4ENRA 2PUAA 5EE0A 3V8NA 5HG0A 2O57A 3QBEA 5B4VA 2J0EA 3R9IA 4MEXA 2WPNA 5CM8B 2DUJA 5BNFA 1FX0A 2EFEB 4NOMA 1CP2A 2GNOA 2PGIA 2VWGA 1Q0SA 2QS9A 3U2QA 1PV2A 5K0CA 2HMYB 4WJLA 5KWVA 3CNHA 2BEWB 4BTLA 3E53A 4QSHA 3TB6A 4W63A 3AUKA 1C9JA 2JFVA 1FFYA 3AF4A 4P7GA 4FOOA 2CXTA 1DELA 3MUNA 5E6RB 2HV9A 5BMVF 1TQ8A 4B71A 1KO5A 3EXG2 2BY4A 3FJYA 3HR4A 1OAOA 1UPCA 4ND2A 1V97A 2C5EA 1QHFA 2OXOA 2ECOA 1AC5A 2LTAA 1N5WA 4ZDIA 3TPFA 1J09A 1ORDA 5MGNA 5AK6A 3QPAA 3NALA 1ZQIA 3O90A 2RG1A 1BHQ1 3ANTA 4N47A 1VLMA 3G6WA 2GZDA 4A0RA 4UM9D 4EJFA 2P2NA 1HZZA 3EH1A 4B80A 1ZI8A 3GBPA 3BMXA 2MMGA 3DXFA 2PQ2A 4C7MA 2PZEA 5I9SA 1CY1A 1NOKA 3A6KA 3L8YA 2BGGA 2LMRA 1GPNA 4MV5A 3ABZA 4YRIA 3PC4A 4Z99A 1L3BA 1XROA 5EJMA 2JHDA 3AT1A 1G21E 2Q0QA 5JMTA 4J8PA 4BBZA 3EIWA 1XXHE 5FR1A 4C0SA 2CNWA 3ND7A 3CF2A 5EJGA 2LM1A 3EW9A 4PSAA 2C7GA 1BXKA 1RXIA 3OLZA 2BHNA 4BFUA 3DW1X 3IP8A 1F4VA 1SU8A 4BU0A 2QBYB 1Q2UA 3I9JA 2GVDC 4KBYA 1CHDA 4BNFA 3SR4A 3SVTA 2GKGA 3FYDA 2OZEA 1OROA 3WGMA 2P9CA 4CMBA 3R44A 2VPTA 1P4HA 1PT5A 3PQCA 3ZV3A 4JL8A 3OTQA 2WHYA 2H3HA 4KX3A 5HK9A 2DWCA 4ESEA 2ZJAA 2IXTA 2Z43A 2CMGA 4FDVA 2KD1A 4IAOA 2I22A 1P0CA 2BFWA 4WNAA 4NCXA 1BX1A 4IQFA 3W4JA 1GXSB 3C23A 4FEAA 2FMSA 1X3LA 1VRCA 3TS1A 4PLVA 3KZ1E 1ZVMA 4UUOA 3UUGA 4MPRA 1RWWA 2BUCA 4FBMA 2PSSA 3GH3A 3BE5A 3ACDA 4YMVA 4EUNA 1VE9A 5DW0A 3TOCA 5TY0A 4JJZA 5BWLA 1PLKA 4A36A 3TADA 4HXYA 2NO5A 1LV7A 2HHHB 3KUUA 5KC8A 2JVJA 1ZJYA 2PL3A 5REQB 2ZRDA 4RVDA 1S2MA 4XA5A 4QG7A 3DF7A 3T4UA 2YNMD 1F2TB 1AZTA 5EJ8A 3L7BA 2ZIVB 5C32A 4UM5A 3ZU2A 5JC1A 2V8OA 2OYSA 1E3QA 3QPUA 3IKVA 1LRKA 4ED8A 3EIXA 1SWVA 1D6SA 3EOAI 2FEWB 2OORC 4QAQA 2PMEA 2WYIA 5E9JA 1KOFA 4XWYA 5K05A 2R6AA 1X9WA 4DADA 2CVQA 1UOEA 4TLEA 3JWEA 2QPLA 3TW6A 1GUBA 4UHHA 1X1BA 4JR1A 5ALTA 4HBZA 3T3GA 3RNLA 1MENA 1PHPA 5BSMA 3DTVA 4DYDA 1JLKA 4K6MA 4HJRA 3JQ7A 3E9RA 3TZBA 1XRRA 1XBTA 1V47A 1VJTA 1L7QA 2VJKA 2IE8A 3ZQ4A 3WQRA 2YY5A 4RT2A 1B0UA 1YFZA 4EYOA 2POQX 5K6AA 4WPGA 4A3SA 2X0KA 1RFGE 4KN7A 1WBBA 1QG2A 3BTVA 1RRPA 3PE3A 3PGVA 2C03A 2R84A 2YBEA 5L3QB 4R5MA 3WLNA 5DTJA 1DK2A 2R86A 2XXAA 4B45A 2XZTA 5EZYF 2ONJA 1FX0B 1KAHA 2FF5A 4ZEVA 4F4KA 2HF7A 2PA0A 4IP0A 3X44A 1Z4IA 1M2EA 1DSSG 2IY9A 2YHIB 5KX5A 1TVMA 3T5PA 1LRJA 3GEHA 4JI7B 3ABQB 1L4YA 1QYVA 3D3WA 4E4TA 1HMPA 1E5VA 1P7WA 2KZ3A 1ZCZA 5AIBA 1VDZA 2XR1A 1KFSA 1LX7A 2PLWA 4CLRA 4CDNA 4YRZA 2E4VA 3U3JA 3GPIA 4ZOBA 3A7EA 1NPDA 1OFIA 3VYUB 3QU2A 2H9IA 3CF6R 3D0KA 2CN1A 2JFBA 3DZBA 3VKHA 4WKCA 3CZQA 3E7WA 2CLFB 1UMDB 3HSKA 1OH8A 1UCVA 1PF7E 2HF9A 4XYLA 1ZQQA 4RSRA 4DUYB 1P80A 1OGIA 2VVTA 5IT4A 3PPXA 2J9FA 4QXPA 4IIGA 4I9FA 4PAWA 4PQRA 3BWEA 3HCNA 3KL4A 4DUGA 3W5VA 3CYMA 2E5WA 2ZRKA 3L07A 3LNTA 1IWOA 1YKGA 4OMFG 1G2IA 3MJHA 1P2VA 1F8GA 1OQAA 4BNHA 4YRPA 3B3AA 3GJZA 3K0FB 2PR2A 5BYBA 4Q4CA 2VTBA 5B1DA 3CF0A 4B17A 1ZETA 3F9IA 1E3LA 5TEVA 2E8NA 1N6KA 3B13B 3UUEA 3RB0A 5KYXB 2O54A 3I30X 1HK7A 1RLMA 3SI8A 3EVTA 2PQ6A 4B82A 3T3DA 4QYMA 4QZCA 1NURA 2QGNA 3FGOA 4LGCA 3ELUA 2M6SA 5JSHA 1YCHA 1XVUA 4FGLA 1H8EA 4N5HX 3DQPA 1E8DA 1IDN1 2AOWA 2DFTA 1K68A 4ITRC 1K2VN 2QN6A 3DAPA 3FVTA 3HKBB 2DTDA 1R6VA 4YQFA 5DP2A 2GJAA 2VO1A 5T7BA 5HZHA 4M8LA 2FEKA 2QX8A 1YC2A 4NLLA 3Q6IA 3W5IA 4DAOA 3FWPA 4C6TA 5CLFA 2XWPA 3K94A 1D6NA 2C4KA 1KE2A 1N7IA 2ADMA 2V4ZA 1AQLA 1X42A 1LJLA 4B6PA 4C03A 1UQUA 2WSIA 4L7VA 1PVQA 2CD7A 5LP6F 4PG4A 1Z15A 4NYMQ 3RDPA 3PU6A 3FLAA 3IJ5A 5I4IA 1NLFA 1ZJ4A 4L95C 3P4UA 5CJJA 1QMGA 2AT1A 1YZUA 4CN9A 1O9GA 1NLUA 1XALA 3A9CA 1TVKA 1OU4A 2HHCA 4BIIA 4YLGA 5D1HA 1KGDA 4LNAA 3CH7A 2GDZA 1KI6A 1AO3A 2Y0CA 3R3XA 1VA4A 4HPXB 2EG9A 1U99A 3IEIA 2REBA 2D0IA 1XLVA 4PAQA 4HC4A 3L7CA 3ZIUA 4GRIA 5EPEA 3VDMA 1T9AA 4KCGA 3EIEA 4L02A 3HJRA 5EIBD 2XA2A 4K46A 3EOBI 3HCBA 4DSJA 4GXQA 2V55B 1FBNA 1VIDA 4X97A 1WWVA 4E6EA 2ZCVA 4NULA 1L7NA 4H7DA 4Y0AA 4MGZR 1AKNA 4XEUA 4KHPB 1UBEA 2ZUEA 2B98A 2Y3IA 1G18A 3ZUPA 1M33A 2AFIE 5K1ZA 1JAHA 3L0PA 4Q9NA 3CE6A 1NBEA 1K2WA 2I8CA 3MIZA 2Q9AA 2QAGC 3KHHA 1N0VC 4M6WA 3R20A 1OT3A 3K70D 1D1QA 4BAUA 4N5DA 2FW6A 5LU8A 1ZOPA 3IKTA 3K53A 3FVWA 2PFNA 4ZQHA 1XXHB 1NK5A 2OBMA 1U7XA 1TCAA 2H4YA 2XOEA 2WVGA 1TVCA 2KHVA 1TYEB 5DBAA 1XKTA 2X0FA 4IUCS 1Y6FA 5E1DA 2JFFA 4F3TA 3AQFA 3VMFA 2ACWA 3DE3X 2VT7A 3UBMA 1C0KA 5I7HA 3D54D 4EKNB 1C0PA 4MPPA 4DNPA 1SIUA 3TCKA 3VI3B 4DR4B 4ZD6A 4V0LA 1BRMA 3RTVA 4A9AA 2H7XA 4BNKA 2RC6A 3WL6A 1DQRA 3KYCB 2PVSA 5EQJB 3A9WA 3U0BA 1NXXA 4K6FA 1H2FA 3W5CA 1JRLA 1YZYA 3ZTTA 1KEEA 1YE3A 4YXWA 2GA9A 4R54A 1FXWA 2VHWA 3OLVA 1KJZA 3P26A 3A9SA 1JTEA 3UATA 5AUOB 1R37A 2CVZA 3KJXA 2C3OA 1ND6A 3I2GA 1DBQA 3M5DA 1YZNA 1W96A 3SZ3A 3V1TC 1WP9A 1HLGA 4J9SA 4HYQA 4AZ0A 1ZN7A 2PGJA 2YX8A 4W5WA 4RPHA 1O6BA 4B8YA 1GM5A 4U63A 4NZZA 2NV0A 3R7LA 1E2LA 4LZOA 4PZUA 1JAXA 3DGEC 5HQTA 5H9WA 2MRLA 3T9CA 1UP7A 1K9VF 4D0SA 2O7VA 4M7PA 4JASB 1M2NA 3AV3A 4UTPA 1FDOA 1M2VB 2OBFA 2A5FA 4DLNA 1QCZA 2PCLA 2LKDA 2BP7B 1V8DA 2KTQA 4BAZA 4LZPA 1FYEA 4HNUA 1NY6A 3V4OA 3A6HA 1LF0A 4BN4A 4IH4A 4E7OA 4UBMA 2PANA 2XECA 1NAIA 2DQ4A 4CM4A 1BKSB 4MUNA 3A9RA 4HDRB 1E0SA 1CUBA 4W1QA 5DM0A 5CFLA 4UE3S 3HLKA 1XSEA 4D3FA 1GO3F 1ZQSA 3PGA1 5HIKA 4R3WA 4XVHA 3FUCA 3R41A 1FXUA 2W9BB 3WIUA 5JBIA 4AMBA 2GM3A 1T2CA 4GI7A 4RDXA 4F21A 4RS4A 1WVMA 2I3BA 5DYNA 5FLEX 4H0CA 3ADPA 4TS3A 1UDCA 1TKBA 3ZXSA 4CEIA 4TWAA 4IJQA 5FJIA 3KPVA 1R4ZA 4WMLA 2AW3A 4NESA 1HTWA 3P9ZA 1JROA 1KIFA 1YTLA 1IOWA 3TI9A 2JAXA 2R0QC 5HKLA 1VKOA 4PZ0A 1RM3A 5T4HA 3ZCRA 1GQ2A 2A2ZA 1I7SB 4PCAA 2L42A 1M2JA 1K5HA 1GLNA 2NRTA 1U04A 3QRWA 4W4TA 3CG4A 1NF8A 4PTZA 1SXIA 1VI6A 4LPKA 5JZOA 3JD3A 9ICIA 3H2ZA 4U9UA 2DG2A 3TLGA 2C2XA 4C8NA 1YRQA 1ESZA 4L8VA 4FFDA 5JNLA 1YR8A 2LCQA 2VQFB 4DIBA 4Q1CA 4CT0A 2RJOA 4JUIA 1H3FA 2DYKA 3ELDA 4EF4A 1UBLS 721PA 1WCYA 1YZVA 2XMDA 3E0QA 4M0MA 1ZD1A 3T9EA 5G4KA 4DQDA 3AI1A 4DUZB 1SUFA 1GL3A 4PG7A 3VO2A 9ICBA 2J0UB 4LZGA 3N87A 2JAUA 3AMZA 2WF6A 1X7ZB 2GYWA 4HDNA 3LH5A 1BD3A 4M9LA 3BYZA 3UW1A 2WU0A 1YGYA 1A6SA 4MHSA 4NNOA 2D8MA 3DLHA 2B82A 3RADC 5GIOE 3NBKA 1BRTA 2PWBA 4RYLA 5JY1A 1QIMA 3FSJX 4GZ6A 3AL0B 2Y27A 1AHHA 4XPIB 4HG2A 3IIMA 1RTKA 4TTJA 1Z8HA 3R0XA 3C8UA 4F93B 2EJVA 3Q3VA 4HNRA 1KS2A 2CL6X 4Y9UA 2D59A 4BQNA 5C8YA 3AVPA 2O1XA 1GNLA 1E3WB 3UWMA 2DH5A 3NAMA 4JJFA 2ZCJA 1BQEA 4HATA 1QTNA 3VJRA 3FUWA 3F5AA 3L01A 2BFAA 2GPWA 3W6OA 3RB4A 3PX6A 2BLNA 4M98A 3ILSA 3SYLA 3HKZF 4L27A 1BYUA 1L9KA 1DG3A 2HW3A 1CS0B 2RI6A 3WB0A 3SXUA 1VBNA 3U0VA 3D2AA 2R60A 3IBYA 3COVA 1P8JA 1XPRA 5L3SA 3WL7A 1KOLA 3LQRA 5DBCA 3PIRA 2R8BA 5BOMA 2H3IA 4FI3C 1P61B 4EY5A 4BJQA 3PXDA 2AN4A 3L0YA 5K2MA 2FE1A 2FK8A 4Y1RB 4KXFB 4NEQA 2ATLA 4YK7A 1P8AA 1USWA 4LKOA 4YJFB 2YS6A 3ZLJA 3PGLA 1K8ZB 1UINA 1XT6A 1SK9A 5EWMA 1UFOA 4GLOA 5KNLA 3FCSB 1PX0A 5D49A 3ZHBA 1N4DA 4JXXA 1A9OA 4NYIQ 1O6CA 4K9NA 1O2DA 4K1XA 4QPCA 4IVNA 3OZUA 2IITA 3ZHUA 5ALYA 1DJQA 1JSLA 4P5DA 3NAQA 3UJCA 8ICSA 4DMCA 1T0BA 3JYOA 2PEZA 4RJ2A 1Y3AA 4C0JA 2J3HA 3LWZA 2Q0HA 9LDBA 2WAAA 3WX0A 5CNIA 3ZY4A 1P18A 3OT1A 1Z0UA 2HMXA 3L6BA 5TXGA 1FMTA 1VYVA 3D3JA 2XBLA 9ICJA 4C4OA 4MS4A 5L7WA 4DQIA 5KJ1A 4FMCF 1MABA 4FZ3A 4Q19A 4O2BA 2J09A 4V0QA 3MGAA 4Q5IA 3TSOA 4O4HF 3EQ2A 3G0DA 1V43A 2A35A 4F12A 3PPWA 1SXJA 1PZHA 3VV2A 2ODEA 1OV6A 4UJ3A 2AJBA 1U45A 1GFIA 4CCHA 3PO4A 2FWMX 1JRPA 1HF3A 3QWFA 2YVQA 3HDTA 4UHKA 1LH0A 4INOA 1R00A 2QNRA 1GTG1 2HJVA 4IIDA 4J0IA 4V1CA 1K3UB 1Q3VA 3HDJA 1MQ2A 4X6XA 3QU9A 2RGBA 1QGOA 2SCUB 4K2HA 3W7BA 4PSVA 2G63A 2QA5A 4BIMA 2AMFA 4ETIA 1X7YA 4FONA 4QVKA 3ZU3A 3GBSA 3QVOA 4J29A 4NL9C 2QXTA 5LXTA 4RPLA 1XSLA 1G5TA 4HX9A 4PLHA 1CUYA 3DMPA 3KOMA 3HJGA 2QQ0A 2DAPA 3MOIA 1IUPA 3LC0A 1GZSA 4OOEA 4YWJA 5KG7A 1VG9B 2GVNA 2XUQA 4DMKA 1W4RA 2N47A 3F46A 5IUJC 4NLGA 4P3OA 5CX1A 2LHTA 3T5HA 3BHIA 2IUUA 1U4BA 1EAMA 3T99A 2HPHA 4R1NA 4EA7A 2X2FA 1J4AA 3D7SA 4IQGA 1QHNA 1BU8A 3PTLA 2EJWA 3SXPA 1O5OA 1P9RA 5FEUA 2FTKE 5HFAA 2YJ3A 3UH1A 4N7BA 5IULC 3H05A 2FY8A 1T9BA 5J40A 4I2CA 1CUHA 4A7PA 4Q4HA 2A5GA 2FRVA 3P9PA 3VYTB 3OEHA 4JKIA 1GR1A 4OA5A 2UZ4A 3W5BA 1I3NA 5F2EA 3IDFA 1HOTA 1FQOA 4KQJA 3ADCA 1G1MA 5ALFA 2Q29A 3AWIA 4RZSA 5EOVA 1NW9B 5FFFA 1YQUA 5IJWA 3N8GA 2MJLA 2OCIA 5G0VA 1KFEB 1G5QA 1O08A 4ZQGA 3UTCA 5AICA 2VPPA 3MTDA 5DG9A 1CZLA 5FBQB 3ZHRA 4BVEA 5BQOA 5LWHA 3WDKA 1IM5A 3ROMA 4B6QA 2CFOA 2ODAA 2W48A 4E15A 3TRFA 5GTDA 3FLEA 2ZB2A 1EVEA 2IA6A 3MBYA 3P7MA 2GZMA 2UXBB 1OLSA 2EARA 5D8DA 1M34E 1T4DA 2ZM6B 4PL2A 2ZM5A 3GWGA 5B3JA 4DF8A 4J7CA 1H05A 2VUHB 3X3HA 5H2FU 2IHJA 2OMKA 3I04M 9ICOA 5KIAA 4TM8A 3MN1A 1NMSA 1KSFX 3RPEA 3T3EA 2GD6A 4LJSA 2FUNB 1DX9A 5JDIC 3AIKA 1YDHA 4IDGA 1W2WB 2F3SA 3AP2A 1IUNA 1U4SA 3NBZC 2NVWA 4JVOA 1XFDA 3M6AA 1FCJA 7ICFA 4B75A 4NLBA 4BL5A 2QE6A 1WXQA 1QYIA 1OC4A 4WEOA 3OVMA 3DR3A 4OU5A 1FLDA 1OZGA 1SQ6A 1Y3DE 4DSNA 1RYEA 5J63A 2VH1A 4G56A 4CODB 1GTRA 1NTOA 1YVDA 1VLQA 2G06A 3DEKA 2FWIA 1FEZA 3L84A 1CFZA 5J3JA 3FHCB 2J6HA 5MN6A 1Q19A 4YFKA 2ODTX 3RODA 3L79A 1XQVA 4B9UA 3O91A 2C54A 1UJMA 2WJ4A 4PXYA 2GSWA 4BO5A 2A0YA 2GN1A 1WM1A 4RE5A 3F4LA 3VBEA 4W1SA 2UVQA 2GRAA 4IO1A 2B2XA 2B8TA 3LX4A 4KXWA 4BCCA 2YMMA 1K6JA 4BX0A 2XVXA 4KOAA 1RZUA 1ZM4A 3JWGA 1ICIA 2F77X 5EIEA 4B3HA 1QH8A 2I8AA 1HPLA 3G9TA 4LYJA 3HDYA 4MVJH 3JQFA 3OQNA 4EI2A 3F1LA 1Q1EA 1NVAA 1NJFA 4RK0A 3HILA 4WN3A 5EKTA 5LCXA 3WWEA 3GYBA 2H7YA 3RAFC 4IMPA 3OEWA 3NPAA 3F7TA 1OHHD 4KNYA 4CETA 1WDKA 3ENNA 2CLOB 3PGJA 4ENUA 4U7CA 4JSRA 4M8NE 1P45A 4US1R 5HFJA 5K01A 3A6EA 2ZQ5A 4UCXA 4MP6A 3KFVA 4O2RA 2ZATA 2ZJ6A 4B4WA 5G1PA 1NPYA 2O7SA 2GN4A 5EXEA 2FN3A 3K6KA 1TZKA 3PC2A 5DGDA 1AK9A 2YYZA 4RGVA 3NYWA 5AVZA 2WKSA 4EJ0A 1QHSA 5ALHA 5SZJA 1ZQXA 2DUUA 2B6HA 3JQ9A 4IG9A 1F1JA 1KSJA 2EV9A 3RRJA 3UPQA 1G2QA 2G83A 5GJBA 5EUCA 1W5TA 1TV9A 5CB4B 4B0OA 5EXSA 3OMLA 4MUEA 3EZ7A 1GQQA 4IL5A 2IVFA 3DNMA 1SL0A 3K92A 1A77A 3BGVA 1KVRA 1R4MB 4GNRA 4X8HA 5K8JB 3NNSA 2E85A 2IU0A 4F5YA 3CLHA 1JHXA 3D59A 3VR4A 4PSUA 2WABA 5K6TA 3OM0A 4Y6SA 1PFVA 3Q1KA 2C20A 1DWOA 2BCGY 3NHAA 1W35A 1ILEA 2QN8A 2O19A 2E5FA 4GC6A 5C4IA 2BR0A 1W76A 4P4MA 4FQ7A 5LDGA 4KH0A 1SD1A 1PD0A 2DBQA 1EUDB 2MOKA 4BB9A 3KZKA 3C7DB 3BXHA 1TUIA 1WQ1R 2A9FA 4HK4A 4LRSB 2I3GA 1O9BA 2EKBA 3ROTA 4C14A 2PRIA 3D6FA 4BQOA 3MAAC 3OIYA 4N8EA 4AUEA 9LDTA 3UJNA 2HNKA 4E31A 3PIDA 1SKSA 1WZNA 2QW1A 3ZNPA 3DOCA 4GSKA 3EA4A 2JIDA 1Y8QB 3L7DA 4JIMA 1CT9A 4J49A 4LY6A 3ZNNA 2J3DA 3M4JA 1EINA 1J8YF 3BZKA 4BLUA 1U8YA 5GJCA 4IVPA 4V2IA 2KVCA 2QUIA 3UA4A 1QFSA 5KQLA 3HT3A 1NUTA 4HAUA 2CDBA 2Z5FA 4BWVA 1WB9A 3G6YA 4EYSA 4X6UA 3NTVA 1LKZA 1WDLA 4A2PA 5KPJA 4MINA 2CXHA 2J4DA 1LDYA 1ICEA 4AY6A 5JUMA 2PD4A 1KL9A 4IRUB 5FOUA 3MGVA 2JARA 4JFRA 2EIXA 4NIMA 1QSYA 5BYAA 1B15A 3PSIA 1E1QD 5EEGA 2C9BA 1SVIA 4ZVMA 2RH4A 4RFSA 4LRYA 3PNKA 3ZD6A 2BLLA 3A1FA 3V7YA 4LRUA 4ZMRA 1COKA 4B48A 2OO3A 2C84A 3OGUA 3ST7A 2E49A 2WJ3A 3RH4A 4RVNA 3OC6A 2DFVA 1Y3CE 1CQXA 5CHGA 2DWOA 2YMQA 2FN9A 2O8EB 4QXAA 4L4ZA 3HJAA 3GEIA 5H4GA 2HIGA 3MCUA 1G17A 3AIOA 2UYYA 4L7QA 1D1PA 4OHVA 1Q16A 2Q5JA 1W5EA 2O3SA 3AKEA 5I8PA 1OXBB 1BTOA 4TMVA 2XAUA 2LKYA 4QZIA 4JYMA 1HEYA 4TYPA 4J16A 1H3NA 1V1MA 3WB9A 3WRXA 2N1MA 3T0GA 2XUAA 3DVAA 1YIOA 2OSBA 3AL3A 3QE3A 1ID1A 2FB9A 1EK5A 4GRDA 5KI6A 2P66A 3IDZA 5KOJB 4X95A 4YEDA 3I0ZA 2KFZA 1EXDA 3DVSX 4D02A 1PZMA 3SZMA 3MR5A 2YXLA 3GWZA 1A8IA 1LSJA 4UD6A 1ZOOA 2AMJA 3E2EA 4X8OA 4N3AA 2JH8A 4B9VA 3PZBA 5A1JA 4TL9A 1KL7A 3OSUA 2PMDA 2HLHA 1U0OC 1QOPB 1Z3IX 1KC3A 3T3IA 4C0XA 1XP5A 3TI0A 2I3ZA 1J8QA 4PPXA 4UPEA 9ICUA 3WO1A 1WUHS 3UEOA 1RRCA 2J33A 4KUEA 2P9JA 1GG5A 2CXSA 2Z1MA 3PHLA 2VC2B 3UPUA 1KPIA 4QQRA 5JY6A 2HSDA 1CERA 4M4SA 1YNOA 3JWHA 2DJ5A 1ENYA 1KSPA 3IJEB 5BWCA 2ISOA 4MUHA 2ZSJA 4XWWA 2OY0A 2GKSA 2WJYA 1JGTA 1YJAA 2P5SA 2PJRA 3GNTA 3HYLA 3UPDA 1LWOA 5GZ3A 2BR3A 2KICA 4R8KA 3RJTA 2BEWA 2GCOB 2NOAA 4ZARA 4BMNA 1T0HB 2CD9A 4CF7A 2YN2A 4WZ6A 3RFFA 4UZEA 3MZ0A 1XMXA 3GFGA 5E6RA 4A5OA 1WR8A 5CBKA 1BE6A 2FSUA 1X6JA 3MVEA 5AKGA 4CKZA 1H69A 2W6JA 5B58C 3JRNA 4Q93A 1OAKA 4EO9A 3W9SA 2H57A 3C4QA 3M8SA 1J06A 5D5QA 5F7ZA 3COJA 4XDYA 5LZ5A 1N36B 5KFNA 2EX1A 1AMOA 2C5AA 4AZTA 2H9YA 3H0EA 1W36D 4YRAA 4TOIA 5LSAA 4N41A 4RTMA 3VISA 4P4GA 5I7WA 1Q7TA 4TXLA 2P7IA 1OREA 3NORA 4KHZA 4R2WA 3WKBA 1WMEA 5M04A 5HRAA 2WSLA 1D2AA 1QRUA 1FQJA 3ROGA 1E3JA 2Y9UA 3PUXA 3FRJA 1ZESA 3D9QX 3DTYA 5GP1A 5CXSA 4HI0E 4WNCA 4ZQFA 2P62A 3GJ4A 1KAQA 4YLYA 3F3MA 1UWVA 2Y2VA 4HAIA 3JZDA 4MQBA 4JH0A 2G9VA 4JJKA 3Q15C 3CX4A 4PINA 5KT3A 4CIAA 1QIDA 3LIIA 3K9BA 4JV2A 3WFJA 2ZT8A 2JK1A 3QIVA 1TYZA 3D5EA 5L9AA 2XB4A 2QBYA 9ICLA 2XOKA 3WSWA 3GELA 1TEVA 3RJMA 4NBVA 3PWTA 4PW0A 1GILA 1AK2A 3URKA 1L4FA 3GPBA 1VKRA 2NZUG 3OG9A 3ISJA 1YB1A 2R7KA 5M3BA 1FUEA 3EEOA 1ZL0A 4QRHA 4IPTA 1AO0A 4B2YA 3BDIA 5EMLA 4QEKA 4BFTA 2XAAA 1P91A 1QJ4A 4WTOA 2QMEA 3PHJA 2IK8A 2FQWA 3ET4A 3GJSA 4XH9B 1EFTA 1TF7A 4CF4A 4B6FA 3UXPA 1GXSA 2W9MA 4LGMA 1J0CA 4RLSA 3A6DA 4P82A 3KCQA 3GLGE 5EIWA 3CBQA 2V6BA 4UHCA 2X19A 1DDOA 5T3YA 4JENA 4OFZA 5IVIA 5E2IA 4R68A 4AG5A 1J9ZA 4L0DA 4D9IA 1DV2A 3IIIA 5MFPA 1XSPA 3DZDA 3HR7A 4HN9A 2WINI 1WXEA 5HKKD 4HVLA 4DSEA 2PMZF 4FCTA 3S28A 5REQA 2PGAA 4EATA 4EEXA 1H85A 1F2TA 4E5UA 4LRTB 1AKWA 2ZIVA 1DT5A 1JG6A 1NJXA 2HK9A 5BOSA 4HVAA 1Z0IA 3DNPA 5LNK1 4BE9A 3LS2A 5T41A 5ANRB 3EDOA 4FR0A 2KM1A 1EDZA 3O93A 2OFPA 3V1UA 3DL2A 4JLBA 3WWDA 5CXQA 2IGBA 1JT9A 5SY4A 1A9QA 1THTA 2WSMA 3OQJA 4W5HA 2ZYWX 4NDAA 2XZPA 2D7CA 3E9ZA 3NGDA 3K0HA 4IS3A 2W4QA 1N9ZA 3LUCA 2OA0A 3M1LA 4F5EA 3V2GA 4QZ9A 3U7IA 1IOVA 4IUDS 3MUOA 1WB5A 4H1UA 1ORRA 3QVTA 1DAGA 5CNJA 4YAIA 5K8UA 3HCRA 4XD2A 1K7FB 2FZKA 5IUNC 3OJOA 4NENB 1O1YA 4ZHQB 1J5EB 3VR4H 1LNSA 5IKOA 4DQUA 5L3QA 2I33A 5DG7A 1QX3A 1WVGA 3ASVA 2HHWA 3A2LA 2RH9B 4JQCA 4PGHA 2II6A 3ONEA 4FN4A 1YRBA 3WMFA 1NNLA 4EZ6A 4I5EA 4UBCA 5L1LA 3U7GA 3R7SA 5GV7A 3PO5A 2CVOA 4QU0A 4NE7A 2YHIA 2H00A 4Q3BA 1R2QA 3SOPA 3ZW7A 4NZPA 1FFBA 1U2GA 4DE5A 3RH6A 4LJ5A 1NC1A 2M6RA 3VCBA 4JC8A 4PRYA 5FWXB 4BWMA 4LXHA 1XS9D 4HGRA 1PS9A 4F8JA 3GRFA 5FO0A 1U0LA 2OV2A 4MMZB 4RA6B 2NU6B 2JHAA 3PNYA 5AM5A 5J29A 3IG5A 2HU8A 4LBZA 5LA6F 4J2OA 4D4LA 1TUBB 3Q7EA 1OWMA 2O4UX 3NOQA 2OKCA 4NONA 3AUOA 1UMDA 3C6KA 4K4GA 3PW7A 2O0JA 2JGNA 2DF4B 3FOZA 3WGKA 1ZYQA 3KJZA 3MIIA 3IVCA 3NZEA 2QVYX 4IXMA 4LSZA 4MQFB 2Y93A 2N1RA 2AJTA 3A9TA 1SELA 4DMRA 1KLNA 2PWAA 3MEQA 3BF7A 4F2RA 3S1AB 2R6FA 4Y30A 1KE1A 2P9EA 3RR2A 2SKDA 4JC0A 4F5RA 1N32B 1RPLA 4QEZA 3FBWA 4P58A 3C21A 3RFTA 5IK2D 1NW3A 1I01A 2GZ3A 1U28A 2SKCA 3K0FA 4LECA 3U80A 4US2R 4AG6A 3IMFA 4HLUA 1A1SA 1N4AA 2K8CB 3DC7A 1WCXA 3U49A 1ESCA 4LJ6A 3PQEA 2AI2A 5ALMA 3LSTA 5KYXA 2RHMA 2G0NA 4X1OA 5DHTA 2D2XA 3N07A 3IVGA 5KFMA 3FTPA 1BPXA 3TTYA 2C9CA 2ZE7A 3BILA 3RTDA 2Z2KA 4U7PB 1PEYA 4RFLA 3VI4B 3AERB 3A4VA 5DULA 1EJ2A 1MTOA 5CJPA 2QYHA 1WBJB 3IKMB 4P36A 1VPVA 3M3DA 2VNKA 3ZWXA 4X1YB 1E69A 1PV1A 3T0IA 4LFCB 5CVTA 4FEEA 2FZLA 5CDFA 4KFSA 5EE9A 1YE8A 3NWBA 4A6DA 3L9WA 4XOIA 3CP8A 3HKBA 3I2YX 3BQTA 3GDOA 2ZB3A 5AT1A 2VQEB 4HYTA 3H4DA 6NULA 3IERA 1KBZA 3LQYA 3ELWA 3O8CA 1TQHA 4X60A 3K9FC 4DVGA 4XUGB 1OXTA 2K4HA 3OE1A 1UPXA 1HG1A 2AJ8A 3VOSA 3EVDA 1U7ZA 3UCXA 1C4KA 3TTWA 4KXVA 1PL0A 1K1QA 1C0LA 2JJ1A 1XTRA 4UEOA 5D85A 5BOSB 1FUIA 1RLUA 4I55F 5HJ7A 4E1VA 2NU7B 1T8EA 4TPKA 2PZKA 2OEPA 1U6KA 3A3YA 2PMKA 3THVA 5EMKA 5J2UF 2G1UA 1P1IA 4LF7B 5DGIA 1YOVB 4AB1A 4G0XA 4UEKA 3OMWA 1DNPA 5DJ5A 1JWAB 1OWPA 3TDMA 2GOYA 4LJAA 3KUXA 3KJQA 3SEAA 3GPLA 3W5DA 1UXHA 1Y98A 3LBNA 3W2GA 2PS9A 3SQNA 4BLPA 3RRMA 4RLQA 2HTFA 5JZVA 1PQWA 1NJ5A 1XNSA 4TQRA 1TZCA 1ISSA 3WK5A 3FF1A 2FPGB 1P5HA 2C3UA 1SV0A 4YBRA 2ZDHA 3BORA 3LHKA 8ICEA 2VDPB 1SQ0A 2PH1A 3J7AC 3BWDD 3UAOA 2WTBA 3G2KA 2WNHA 3WFZA 1VRVA 4G84A 5KL1B 5FA8A 2EKZA 4BGVA 1B3RA 2DBRA 1AXGA 2OAEA 1MDFA 3KQNA 1II0A 4AP5A 4IHJA 3RSOA 3R9KA 4IBOA 3C74A 1Y5NA 3D6JA 1FRZA 2GPTA 2ISCA 4I1VA 2ZRLA 5I9TA 5EZ5A 3EGCA 5K03A 1MFZA 1ZHOA 4PHTA 4H7JA 2AX4A 4KWEA 1Z5UA 2B1GA 3V4FA 4RK5A 3IESA 3ZGYA 4AF7A 3I9FA 1TZ2A 1XXHA 2F3PA 4MMXB 4S3MA 3IE0A 3KIPA 1RQ7A 4KOEC 1P1CA 3GP8A 3VYSB 1JR3D 3E8SA 2DULA 3RVLA 2QR3A 3PDHA 2V1XA 1BWRA 3W8DA 4PC6A 1NDHA 2FFAA 3CINA 4PYIA 2XUIA 5DX1A 4XLTA 5L3VA 2IDKA 1NIPA 2GAOA 1NQTA 5C3MA 4DV0B 3GP3A 1BDMA 2R7NA 2ZE5A 4YUXA 5CA0B 3L7MA 3L2OB 1QFZA 3KYCA 2IP1A 1FYDA 3K9CA 5DBOA 2I67A 3BPSA 3CSDA 1NM5A 2XUDA 6AT1A 4M99A 4ED2A 3TVTA 3OJXA 4RK4A 5DBFA 4KR7A 3LWLA 4GXJA 4KMMA 2C04A 2VHVA 5J58A 4RL4A 4MIEA 3HTXA 4O4IB 2W42A 2ZTUA 2CXNA 1OA0A 5LZ9A 3B12A 2OV8A 4BLQA 4XCVA 3KXLA 4QJ4A 1E9CA 5A04A 2XA9A 1OX4B 1BJRE 1OWOA 4PBRA 5KB3A 3G1UA 5M34A 3AM3A 4KWIA 1HURA 3U3MA 2B61A 5E0KB 2YRXA 2QZ9A 1N63A 3TBFA 5EG5A 3W5AA 2EZZA 4RCZA 5IKEA 3WQSB 2K4EA 2Q1XA 2CJXA 1R6BX 4AXXA 1EIZA 2Q9BA 4CIYA 1TQ4A 4II7A 4AW9A 2GK4A 4HT3B 4PIVA 2HJ9A 1M2VA 2I4IA 1DC6A 1O0BA 5MDHA 2GHTA 4P31A 4NH0A 3PX0A 2BP7A 4UOEA 1XX6A 4LSMA 3HXOA 4WAUA 2QORA 3LLUA 4ZAWA 3KAPA 1TADA 4HDRA 2VSFA 1EI9A 2HVHA 1BE8A 3GRCA 1MNAA 4X20B 5KNDA 5K6RA 3U37A 2WYHA 2VHQA 3SPXA 2IYSA 1SKUA 4QC2A 4S12A 1JN3A 2OQVA 4BXOB 5LB4A 1AV7A 2XVZA 3PPVA 2W9BA 3TMKA 2VAXA 1JI3A 2FWNA 3CKYA 2QR5A 4XJSA 1DXOA 3PXAA 1N9GB 2AYZA 2EFJA 4LJ8A 1E6KA 3WISA 4KLQA 4YUAA 4D8UA 4RTNA 1CR1A 1C4OA 1U11A 3FW1A 4HX2A 1T25A 2WTFA 1L7RA 4YRCA 2MSNA 4RV4A 3N97B 1XP8A 2VQ6A 3S3TA 4H59A 4JLWA 2COEA 4QQ8A 2BDPA 3GLRA 1UBMS 4F8RA 3AF5A 3GCZA 3TAHA 1I10A 1PGNA 1J33A 1KK0A 2WJJA 2FHSA 1N2OA 521PA 4XUSA 1IHYA 1VHJA 4LGVA 4E3WA 4KZKA 4FNGA 2OG2A 2VTVA 1W36C 1NA5A 4Y2GA 2ES6A 3LDUA 2QROA 4PCVA 4LVUA 1NUSA 2H51A 1I4DD 5DCYA 4DOMA 1PGQA 2FX3A 4B2IA 4YRJA 2QN7A 2QZ4A 3M83A 2ZIZA 3B5IA 2J0UA 4L9AA 5FI1B 1S2OA 3LYUA 1SEVA 4EDFA 3NBUA 1X7ZA 1P1BA 4ZVOA 4K9OA 4Q9JA 4Z54A 5T57A 1X0XA 1EFVB 1UBRS 4IHJB 1LV8A 3TINA 2DXIA 3ORFA 1DWQA 3A36A 4MO2A 4B9SA 3AF0A 5LOVF 3VAYA 4YMLA 3K9LA 4XPIA 4B40A 1G21B 4WY5A 1TIKA 3JZAA 3ZX5A 4LN1A 5JDCC 4X3CA 5KYYB 2ZGVA 1E3WA 5DTIA 3VFDA 3A3OA 2WHPB 5ERXA 4GR9A 4Q0MA 1MOQA 3K9WA 5H68A 3H83A 2EATA 5JS7A 3QU4A 3N0VA 4KLDA 1EG7A 2H7VA 5FTWA 1NIJA 2PS0A 2H2WA 3UT5A 3W6PA 4N6NA 3AR6A 2GS9A 4YH1A 4ALJA 4U2CA 1F3LA 1FFEA 2C57A 2JAOA 4FBTA 2CXXA 4ZPJA 3RSGA 1QVZA 1CS0A 3M6VA 3DKIA 1ODJA 1Q21A 4L8FA 3WOHA 4Q1VA 1BXZA 4LHSA 4OJTA 1GZ3A 2HKIA 2IZ6A 3P9IA 1J56A 3PWKA 3KVYA 1G8YA 4IOLA 4MW6A 1FTQA 3ERCA 3QLUA 4HDQB 1LK0A 3BICA 4LGYA 4Y1RA 4U2GA 2PGOA 4MUYA 5KQSA 1XQ9A 4DMGA 2JFWA 3DLPX 2PKRA 3FAHA 4YJFA 1OOEA 1LA2A 4DR3B 1C7JA 1EAYA 5IUKC 3BZBA 2XCAA 4ZRDA 1F0YA 4D92A 5CVJA 3GLHE 4YCSA 3QK7A 4PO8A 5AXCA 4AZVA 2C28A 4TN1A 5FPTA 5J0WA 3A6JA 4QEDA 5EWEA 3IQIX 4WWHA 3CJTA 4RIHA 2QRZA 4ARCA 2EJUA 4NBSA 2C29D 3BSWA 1H94A 1JJIA 2JANA 2G70A 3IV7A 3ZVMA 1V39A 4BMVA 1W0KD 4OLBA 2GN9A 5EMMA 4MV1A 3GLKA 2NV3A 4ENPA 3VPCA 4B79A 3PX3A 4UJ5A 5AVVA 1AQYA 3WYEA 4F6RB 3GRYA 2PX8A 3F7MA 1M1NB 4IIUA 3TFOA 4IVQA 1JI0A 4P54A 1A82A 4MFFA 4JEMA 2XQGA 4QQFA 5P21A 3H2JA 3HYNA 1PYGA 4L0MA 5DVZA 1WG8A 3ZXXA 4OXKA 4BMDA 4DG5A 2QRQA 3G5MA 4J4TA 3MB8A 4QXQA 1A04A 1UFKA 2GJ4A 3TW8B 3PPIA 5DQHA 1XVAA 2EGUA 4YUVA 1YBVA 4KRGA 4LZZA 4N7RA 2SCUA 5F9NA 3PC3A 1OB5A 3QVVA 3AI2A 4JJ6A 4EQ6B 3ISCA 4OFXA 1JDTA 4X94A 1AU9A 2GN0A 3M2TA 2XVAA 1Z18A 1TLLA 3UMBA 2ZSAA 4B3IA 2HAEA 5E8RA 3G68A 3QSYA 4C76A 1T8TA 3CWZA 3SSOA 1EA5A 1USUA 1ZJJA 4R9NA 2BM8A 121PA 1M5RA 3CM0A 1JTFA 5A9SB 4D74A 3RUCA 1Y89A 2BZ0A 4CFYA 3LVWA 2YL2A 4A8JC 3CVJA 4OYHA 3BIXA 3T41A 1C7YA 1ZH0A 5JS2A 2IZ1A 2QUZA 1X1DA 2FP4B 2HBJA 2XKAA 4HOYA 4N1AA 3F6RA 2BH9A 4AZWA 1JSCA 4B2LA 1VE5A 2CF6A 4HJXA 3TRKA 3K2IA 1A7AA 3B1XA 4JI8B 1LSUA 2GEFA 2R96A 3SGLA 4RTJA 2QI9F 3A05A 4A16A 1MRZA 3UT0A 2O23A 5F98A 4FFRA 4Y6GB 5E1OA 5KJ6A 1VLHA 1U3CA 3HP4A 1X80B 3LW7A 1AGYA 2Y9PB 1DBVO 4FZLA 1S3SA 2GPYA 4IH9A 4OAPA 1SRQA 1JI7A 4EKIA 1AXEA 5B37A 3UPTA 3QEMB 1MX9A 4B44A 3CSUA 5G1NA 3RE1A 4NHOA 2YHUA 4MP8A 3L1JA 5CCBA 3UT5B 4LOHA 3K1YA 2FA9A 4AECA 2QSZA 4H3KB 5FOSA 2PX2A 4WKOA 1NVBA 5IAOA 2O8BB 2J48A 3FCYA 3M5CA 4OVKA 4C2TA 5E3JA 3Q4GA 3U48A 5HJEA 4JUZA 3EEFA 2OHFA 4CKEB 3E5NA 3VNSA 1DC5A 3ILXA 2G17A 1VOTA 4FMPA 5IZ4A 4TLCA 2V74B 3MWFA 4NFSA 1JDVA 1UT5A 3BRQA 3Q6MA 3EBPA 2LPMA 3HJEA 5A3RA 4IIBA 4PVDA 3N8DA 1JHPA 1KEUA 1RJ9A 1OXXK 2P2ZA 1N8KA 3SBDA 4DWWA 1IG6A 3HWRA 1MEEA 3OA2A 2ET6A 3AHDA 1GRRA 1FU7A 4F5NA 2ZI3A 2YNMC 2YOGA 4C22A 3U60B 1E77A 1M73E 1XD8A 1AGXA 4TQGA 5EGNA 1I7PA 1P9OA 4PLPA 3MBIA 1C8VB 3BGOS 1IULA 4IGFA 4IDQA 4ELTA 2OBYA 5HKBA 4GHWA 4IG4A 1ZH6A 4URVR 4WRRA 5L4NA 3Q2KA 3L5OA 2GX6A 4IICA 1RXCA 1Z73A 1G6OA 4BFVA 2JHFA 4HGYA 3H0CA 2HDNB 3MTEA 3JTMA 2P75A 4NQZA 4YRNA 3ETNA 3E7FA 3DYIA 2UYQA 2QV0A 4C6SA 5DE3A 2JLSA 3G9QA 2R65A 2HHJA 2Q21A 2OHHA 3RARA 3HCAA 1UA1A 1GV1A 4FZMA 1RQXA 2HLDD 4NQRA 4JCOA 3LQFA 2R8JA 4NLZA 1ZPDA 4L9WA 4P35A 7MDHA 3L8MA 1A5SB 1SPBS 3O2JA 3LY8A 3K35A 4BE4A 1SC9A 1VJGA 1LPMA 4JBXA 2QM0A 3HU5A 2Q2OA 3KKAC 2HI0A 4ZU1X 4LSWA 4QIWF 3BXPA 4BEJA 2QKYA 5U1PA 3N76A 2CXYA 1ZOIA 3TAPA 1K98A 3EDQA 1ZGBA 2F9FA 1I13A 4DOAA 1NN5A 3N3BC 2UUCB 4RVGA 2AUNA 1E2QA 4C8OA 1J2EA 2YWBA 4U7GA 2VDUE 4CM9D 1N1EA 2IYZA 4LMAA 1D8LA 1EGQA 5D3QA 4G5QA 2AFIB 3BWBA 3X1WA 1OH5A 1T1SA 3WLHA 3OOEA 3LDAA 3WZLA 2WF8A 1NZJA 1KI3A 3M4ZA 3DHNA 4OIFA 4B6OA 3WHKA 3ICXA 3P0RA 3FNBA 1G291 3BXXA 1DQSA 1NVTA 2QG9A 3NC0C 1E89A 4XIYA 2CHVA 2QMZA 1MO6A 2XW6A 4LG1A 3HPQA 2F90A 1QWOA 4E2YA 3OJWA 1OY1A 5TB5A 1P31A 4ICAA 1XZPA 5CB4A 5FRDA 5HCIA 4CR8A 4PTLA 4ACOA 2YYAA 2DH6A 3QX3A 1P33A 2IIPA 2V3WA 2ZDGA 1SAYA 3SF0A 1R4MA 2X23A 4HWOA 4TTAA 3UGKA 2Q3EA 1RHUA 2GETA 4YP5A 4P34A 1RS0A 4ECTA 5FKJA 1XQXA 4KWTA 4AO6A 1GARA 1D8YA 1QAQA 2ZPAA 2Q5HA 1BGVA 3GEMA 1O5IA 1E4OA 1U1IA 1YZQA 2XE7A 5HP4A 4MROA 2BM1A 1EUDA 1XHEA 4DZZA 3L8GA 3B1ZA 3FPFA 4RVOA 3HP7A 3PFNA 3PDJA 3FOAA 2YWHA 3DDWA 2ILTA 2RHWA 1G8MA 1Y8QA 1EFDN 2HPVA 3K32A 1RXEA 4F04A 2Y1XA 3I53A 1ML3A 1T3HA 1WXGA 1RM4A 2PUJA 1PT9A 1ZRMA 1TK3A 5GOZA 5LBIA 4LI3X 3X1KA 4XJVA 3HVKA 5FBWB 3O74A 3PJFA 1LJUA 4AJ1A 4GG1A 3NBFA 4AQDA 2DWPA 3KEOA 1L1RA 2GESA 1MQ9A 3FROA 4Q18A 2RGEA 3BXZA 2R1VB 1DQPA 2Z8ZA 4D3DA 3OQ1A 4D9HA 3LO5A 4QBIA 2G5HB 1PWHA 2AIRA 1PR1A 1L5WA 2QU7A 2P6OA 1RJ9B 3GJTA 4X61A 4MV9A 2F1IA 3TLJA 1U8ZA 3V42A 8GPBA 5ITZB 3LQQA 4ZP1A 4F84A 4MGKR 3SP1A 2O3QA 4IOMA 4BUZA 5LFAA 4EFLA 1FNCA 4YPFA 1CVLA 4QREA 4TMWA 1MJNA 3SNHA 3ETGA 4ZOLF 2Z4RA 2I9KA 1TAUA 5C1BA 3GJ3A 4MX8A 4OJKA 2O8EA 2DBYA 3GMSA 3G85A 2XPCA 2G8NA 1XKQA 2PNJA 4R8LA 5SYAA 5ALZA 2CE2X 4AS1A 1W9MA 2JI7A 4NG5A 1RLTA 4RLHA 5IU6A 5J9FA 1VLBA 3WI7A 2V9ZA 1EGAA 3PYLA 2AEJA 2GXSA 2WB1C 1I3KA 3ASYA 5C9ZA 4OB8A 1WU8A 2Q1WA 2XNCA 2GH1A 2VYNA 5CT9A 5KOJA 2XUFA 3LC2O 5A7HA 5EIBC 1GN8A 2XIQA 4X92A 2W6NA 5LIRA 1DP4A 3BVPA 4O4LB 4Q1BA 3VTKA 1V3VA 2FGKA 2D1QA 3MCAA 3KR1A 2NZWA 1U4OA 2EJTA 1RHJA 4J0GA 3M34A 1I33A 4GDMA 4AZ3B 5C35A 4ECSA 1RHRA 1SB9A 1QRRA 3ZLTA 5EQDA 3RHZA 2AJQA 5JNVA 1R0CA 1ECPA 1IK4A 2BM9A 2PIDA 3E9CA 4RCYA 4GBED 1XAHA 4JN6B 3K70C 2NO1A 3U7FB 4NPCA 2O0HA 1WJGA 2JEYA 1KZ4A 3FNGA 1RNLA 4ARAA 3CRNA 1C9MA 5IS2A 5KWEA 4A8HA 2XOXA 4EG4A 3A70A 5DYIA 4HB2A 1J2NA 3NHFA 1Y6JA 1TX4B 3DULA 3L0ZA 2LI6A 3I9NA 2ES4A 1N3LA 5FNVF 2PAAA 5L4LA 4FE3A 1JG7A 4KL8S 1AUVA 2C9OA 3DE4X 3W04A 3ESXA 2Y4NA 5KKNB 3G0OA 3IURA 3PR3A 2GCOA 4ANFA 1AUXA 1EK0A 4TZ6A 2C9DA 3DLBA 1L5MA 3JPTA 3B9PA 1WUJS 3GP5A 1E7MA 2BFNA 1XNRB 3FMPB 2A78A 1NVDA 3SAJA 2J6CA 4H6VA 1W9HA 4FFBB 3I6MA 3Q3GE 3QYAA 2XUKA 3DD1A 4UVHA 1P7PA 3RS4A 3TIVA 1GCUA 4ND8B 3NRWA 4C0HA 1WW8A 3CFYA 4BPRA 4LYDA 1F4LA 5C0OE 3CG0A 3MS4A 4I8IA 4QHYA 4EKEA 4N6GA 4ZJPA 3A58B 3L06A 3M4YA 4KYUA 3V80A 1X9MA 4C4ZA 4BGDA 1V5FA 3CZRA 1YRYE 3M6XA 5FNZA 1XK6A 1R0YA 4TUQA 5KSOA 4FOPA 1PL8A 4TSRA 1YS4A 1VGVA 4FKZA 2OAP1 1VJ1A 3ZIAD 3R7FA 1QQBA 1MT0A 2I4TA 4J9RA 1R5OA 1VDMA 2EF0A 1ULHA 4ABYA 1HNZB 5U9CA 4F3RA 5E7JA 2C7BA 1CD5A 5LQMA 4RY9A 3RF6A 3NOXA 2VDKB 3TQSA 1GQFA 2QL6A 3WTBA 5EJEA 4ER0A 2BMFA 3UOAB 4OHZA 5TGZA 3MWDB 3Q3JB 3K2QA 4E14A 4NBLA 2OZVA 4QOEA 3KLMX 3ZE6A 1P0IA 4UCFA 1R64A 4W7HA 3SU8A 1JFRA 5AVKA 4CKYA 3QYFA 1GTL1 1T9CA 4UAUA 4XW2A 4KAJA 4YMMA 3RANA 4NFYA 5CURA 5EYPB 4DCVA 2YVAA 1LUAA 5F5NA 4IFIA 1E3SA 1W85B 3QMWA 3HB7A 3KOWA 2B35A 4YPVA 1DU4A 2WWWA 2C8KA 4YJGB 2C07A 2AZDA 2EFYA 1GQYA 6ADHA 4EHLA 2O7NA 4OF4A 4G81A 5BW6B 2IIBA 1JWBB 4BNNA 2R3SA 3TECE 1RC8A 4CT4B 1YMQA 4N0QA 2F44A 5E9AA 1AZSC 3ETJA 1N60A 1JQBA 2J46A 3MT9A 2OMEA 2UVDA 1X74A 5A3JA 3QKTA 3I4LA 1W1WA 2PGLA 1YJBA 4KAFA 4D3YA 4N9WA 1IHOA 3ZYZA 4UVIA 1K1SA 2ZJ7A 9MHTA 1UKBA 1KYYA 3H2KA 4Z6FA 1HL3A 3QVMA 7ICRA 3CN9A 3PQ6A 3DMNA 4ALIA 3I9LA 5IF3A 3G5TA 3RFUA 5CM9C 1Y1SA 3NRJA 4ZO7A 1SUAA 4LCJA 3ZI0A 3DWGA 4IJ6A 5FPQA 1HSZA 3TLCA 4C0KA 4EFMA 2DGDA 4EMBA 4W1RA 1M8FA 1CI4A 3KSMA 1P7YA 8ICKA 1NY5A 4DQKA 1TC2A 3CUUA 1INLA 1Z12A 3GA0A 4WECA 1NXTA 3O4FA 3OSNA 4PVCA 2Z6AA 4TVOA 2FWPA 2F1OA 2P7HA 2IXAA 2P4QA 3GILA 2CXPA 1PW7A 4NENA 3ZK9A 4BASA 2P3OA 3FSRA 4ZHQA 2I1VB 3P2MA 4NNJA 4H35A 1L5FA 3IVAA 2ABWA 4NAUA 1MX3A 3D4LA 2G1PA 3MT8A 3G5AA 4IDCA 2OUIA 4NCKA 1XZMA 4CL8A 4ZVKA 2Y67A 2GCEA 1MC8A 2RHTA 4RD0A 5EJ2A 4YAGA 1SL1A 2VJCA 3SBEA 2O8NA 4OLAA 3HJBA 3TSCA 4WJ3B 2V7WA 3FFTA 2JGEA 3K72B 3O2NA 3UXYA 3ZHTA 4JFAA 1V6AA 1UK6A 5JBQA 1CY7A 2PGNA 3K7EA 3LVFO 1Y48E 1UM8A 5HE9A 1ORTA 3UMMA 1XCGB 3R2JA 1UEXC 2Y0SC 5ULLA 1VYUA 5FWXA 5DX0A 5L51A 4K1LA 5EL0A 5FPKA 1WPRA 2JIQA 1SL2A 4C0ZA 1L1FA 2KZZA 1UP6A 4RA6A 1JQDA 3FNFA 2NU6A 1CUZA 2A9QA 2IQIA 1P7CA 3MG9A 4O2LA 1TUBA 1AKRA 1K66A 2ZJ4A 3I3OA 1ORIA 1M34B 1C0EA 2PJZA 4PQYA 2AL7A 2DQKA 2ZVDA 5BWOA 2O59A 1HNXB 4IGAA 4BQFA 4C0BA 4EB0A 3HO8A 3Q8QB 1S4QA 1TPYA 1ZQAA 2YRWA 4FYJA 2QAJA 5DN6D 4LXQA 4UBJA 4L73A 2OGUA 5ALJA 3V7LA 2EKQA 4MQFA 3H1AA 4BP1A 3RT9A 1MW8X 5KWIA 1CE8B 2KSQA 2X5XA 3KUDA 3S1AA 1XSNA 5BR4A 3Q72A 1CZKA 1TLFA 2XJ4A 1CS4C 1Y8CA 3GI1A 1RI1A 1EUQA 5KFQA 2XVMA 2FLPA 2FJ6A 1AX9A 4PFSA 3U3DA 1U0HC 4DSZA 4EQZA 3EPKA 4M0PA 3T7JA 2ZBGA 3TARA 5FLKA 1RHQA 5MHTA 1IONA 3ZWOA 4FQ5A 1QIEA 3UBTA 3CUKA 1YCGA 6REQB 1CWUA 3AOGA 4DLTA 3QX8A 1UFQA 1BEEA 3BAFA 3QEJA 3TK1A 1ZQ1A 1XZHA 1ZO8A 4M9XA 2NQ2C 3HXMA 4KC0A 4EHNA 4F5OA 4OHWA 3AERA 2O1SA 3DVRX 4GI3A 4YMUA 5AO9A 3VR2D 4DN6A 2R6R1 1RWNA 3RK1A 3MGHA 2DR0A 3HB9A 4B2PA 3UMCA 2FPRA 1XL0A 2KVSA 1Y3BE 4YDQA 3PA6A 2IYOA 2BPCA 3NHUA 1M0SA 4X1YA 1ZI9A 3BE4A 4DJ5X 4RNOA 2HXYA 5IM4F 3DZKA 3BHJA 3RC9A 4NATA 3VZRA 2WV9A 1QP7A 4ZI7B 3EIFA 4RHEA 1VIYA 3TQCA 3W8NA 1XA0A 5DNCA 1WB6A 1YFLA 4M1OA 1QHHB 3C3KA 1PVOA 4WESB 3N7TA 2CBGA 3CMMA 2A84A 4Y0NA 3E84A 3R6DA 2INGX 1TM7E 3LC7O 5FXMA 4UXIA 4AYWA 4KIJA 4RZIA 2LWIA 1AKTA 4KKVA 3OA0A 2XA1A 3I42A 2NX2A 4M8KA 5C5IA 1Q0QA 2HWXA 3DHYA 2AN9A 1EZZA 4GC7A 1W44A 4XA8A 3E81A 4YR3A 4KRYA 1HH4A 3R6WA 5AQEA 3R5KA 2W2LA 5IBPA 5IINA 3SM9A 4AQYB 3EW7A 2NU7A 2NLOA 3KV3O 1M0TA 4J2HA 2BGMA 4LKRA 1N2HA 1JYSA 2HEGA 5F1PA 4M9JA 2WKPA 2G88A 4KIFA 3COZA 9ICQA 1YOVA 3RO7A 1IOLA 4X3OA 2IYYA 5J2KA 2NP6A 4M36A 1RE1A 1V8FA 3N2YA 4Z2AA 1TNDA 5B66U 2IXEA 4G5YA 1SXDA 1AS0A 4A0HA 2P9TA 2WOOA 2W6ZA 5HW0A 3VC1A 4R7ZA 4MA4A 4OMDA 2C7OA 3KKNA 5D3ZA 1ECLA 3GFPA 2FPGA 3OTWA 4HO1X 2DERA 2FE9A 4MYUA 3BRWA 3OTIA 3SJBA 3W8EA 3ZE9A 4BLOA 1W0CA 4AJEA 3OZBA 4TVKA 2FZGA 2QTAA 3PWZA 4N48A 1HDZA 3E9DA 2YFYA 4B32A 1PYOA 5CGQB 1A9SA 4KO3S 4V3CA 2WKRA 4BECA 3EODA 4UW9A 1SUWA 4NEHB 3GT0A 3TPCA 3R5TA 1YMUA 2PPVA 1DQZA 4EA6A 1ZH4A 3T52A 1N56A 5DGAA 2YWRA 1OXSC 1WA5A 1AUOA 1V4VA 1E2NA 3ZWAA 4ZK6A 2COKA 1RIFA 4XB2A 2OK8A 1U98A 1SB8A 2IEGA 3F53A 1Y4SA 3NR2A 3HZHA 3LCVB 1FP4B 3ESDA 1LXCA 2C22A 3UT6A 3N7AA 3SVLA 1J22A 4I4TB 4MJXA 2GBFA 3V4PB 1W2HA 5CIWA 3BERA 4RQ0A 4RVHA 3ECCA 3A2KA 4G24A 3RT1A 4GFDA 1U7WA 5CA0A 1GU0A 2HYIC 3T34A 2J5KA 1OXMA 1W5AA 2QUAA 4XUDA 4TKUB 4F9TA 4GC5A 2R4QA 2XIDA 1V9LA 4PRLA 3PNMA 1BO6A 6YASA 2G76A 4C7KA 4O4IA 1P2UA 3TOXA 4ZGGA 3LXUX 4NE2A 2EZ8A 3D1JA 1OX4A 2HDWA 3VTZA 3OU6A 4BATA 2O3UA 1NE2A 4QYXA 4YDSA 3NEJA 5C2JB 3L7YA 4OU4A 4D97A 1YVRA 2F67A 3IRVA 5AJVB 1XNJA 3CWQA 3OKAA 2I7VA 7ICKA 2BH2A 4B4DA 1F44A 4H9GA 3IELA 4HD8A 3MS7A 3UA3A 2JI9A 1GZUA 2JGIA 13PKA 1XZAA 5HFNA 5CYGA 3LUBA 1V9SA 3A3NA 3IAUA 4LYAA 3F8SA 2YY7A 1Y5MA 1VE3A 2XD4A 2HGSA 2BFOA 3C4JA 2QVXX 3N58A 2HA6A 2IY7A 3VJLA 4OQ4A 3QKWA 3TOSA 1TF2A 1DC4A 1GEEA 4HAZA 3LP8A 1E9DA 5IG2A 3I73A 3QG1A 1AV6A 1S96A 4E21A 3GUVA 2Z6VA 4YCBA 2DX7A 5AKJA 2BPFA 4M7RA 4GYJA 2Q4BA 2PA3A 4X20A 2CFCA 5EXPA 3CUEF 5B12A 1R0RE 1MRNA 4LV5B 2PX4A 3ESRA 4BXOA 1V8ZA 2ZJ0A 3KDPA 4XVRA 2R18A 2D3TA 3DB1A 4B3FX 3TX2A 3AHFA 1Y42X 4PAMA 4HAYA 4KLCA 2WICA 1AN0A 2F17A 4EZBA 4E5SA 1N9GA 1HMYA 3H8MA 4AK9A 3Q7RA 3LGXA 4D0RA 3BJRA 4MA5A 3V97A 1NFFA 1L8AA 1TB4A 1JIXA 1FRVA 2QENA 1RI3A 5J0PA 1R1DA 4E2ZA 2W6PA 2GT1A 3GEPA