4EENA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords Beta-phosphoglucomutase-related protein
total genus 82
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eenA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eenA01
4KN8A 5AVUA 1Z4QA 1YMQA 5AKJA 1XP5A 1ZS9A 1J8DA 4CF4A 1S2OA 2HHLA 3AR9A 3I6BA 4DCCA 2G07A 2B8JA 1EK2A 2R8ZA 2WF5A 4Y2TA 5IS2A 3U7HB 2QLTA 5ALKA 2RB5A 2R8EA 3U26A 2B1RA 3S6JA 3ZW7A 3W5CA 1NF2A 1RPZA 5AW1A 3EF1A 1ZD4A 5ALLA 3D6JA 3WKCA 3E58A 4YCNA 3L8FA 3UM9A 2W43A 4OFZA 1SWWA 4BYGA 5AM4A 3ESRA 5E0OA 4NV0A 3MN1A 5AKXA 4Y2RA 5AICA 5ALTA 1L6RA 1ZD5A 3A1EA 5AVVA 1FEZA 1Z4LA 3E81A 5AI6A 3AR8A 3EF0A 5AM1A 2B82A 4XE5A 3U7GA 2I7DA 4BEVA 1RKQA 1ZRMA 3R4CA 3BWVA 2ZXEA 2JAOA 1ZRNA 5ALOA 3QU9A 1Z5UA 4IFTA 1LTQA 3IRUA 3N28A 2Q4TA 5AW7A 5AKYA 1N8NA 3M9LA 2IA5A 5ALDA 5AKKA 4DWOA 4Y2XA 4UMDA 1AQ6A 4C4TA 3U19A 5AW6A 4XOUA 3L5KA 4O8CA 1YS9A 4BX2A 1Q91A 3QXGA 1Q92A 4GXTA 2X4DA 3M1YA 2RBKA 3L8GA 1TA0A 1O03A 3U13A 3QU4A 3VAYA 1IWOA 5ALFA 1YNSA 3KZXA 3QUQA 4ZEWA 4L6CA 4FFDA 1RRCA 3CNHA 2I34A 1ZOLA 3ZTYA 5JJBA 3SLRA 5AW4A 3OCVA 3QX7A 4MWOA 5AW8A 3NRJA 1L7MA 3QGMA 5AK3A 2OA0A 1MH9A 1Z4IA 2HX1A 2NO4A 3ZVNA 2YY6A 3J7TA 4UMVA 5ALYA 4Y2PA 3ZVMA 3AR5A 2B8EA 4HGOA 2GMWA 1RDFA 1CQZA 2I33A 2GFHA 2HF7A 3EPRA 3L1VA 4HYTA 4EZEA 1T9ZA 2HEGA 5AK5A 2FUEA 2DQSA 2YMQA 3E84A 5ALWA 4KYTA 3ZU6A 4QJBA 3KOOA 3OTQA 2P69A 4CF5A 4QQFA 4OHFA 2FI1A 2W11A 3QU2A 2YJ6A 2YJ3A 3DAOA 3ET4A 5ALIA 3HLTA 5AKEA 1QYIA 2CFTA 4YIHA 1YJ5A 5AM5A 3UMBA 1Z4KA 1QH9A 2PKEA 4HGNA 2JGAA 3AR2A 4UMFA 4RESA 4G9BA 3MPOA 3PCTA 1LVHA 3R09A 3HYCA 2O9JA 2OYCA 4Y2QA 3L1UA 3KD3A 3QUBA 4F71A 2JAWA 3PGVA 2FPXA 3WK7A 3WKAA 5ALUA 2PQ0A 2FUCA 4HGPA 5AW5A 4YCMA 3NUQA 1ZD3A 1RMYA 1ZD2P 4Y2YA 1L7NA 5AVRA 1JUDA 2VKQA 4ZEXA 2OM6A 2HSZA 3B9RA 5AESA 4HAIA 2GO7A 1TE2A 3KBBA 2Q4RA 3IB6A 3I28A 4B6JA 3ZVLA 2MU2A 2P11A 2NYVA 3ZI4A 3DV9A 2FEAA 2FPSA 1SWVA 5AVWA 5ALEA 3W5BA 4Y2VA 4UU1A 2GHQA 2YMPA 4XPZA 2CFRA 3E8MA 4E88A 4H1WA 5FP0A 3MMZA 2EARA 2MU1A 2YFYA 2JARA 4XQ0A 3OCXA 2FPUA 2O2XA 2EATA 2HF2A 3K1ZA 4C4SA 3F9RA 5AI9A 1XPJA 3ED5A 3AR3A 3FPBA 2G08A 3ZX4A 5A3RA 2WF9A 4JDPA 4FE3A 2YBDA 2IOHA 1Z4JA 3TLMA 4KNWA 4EELA 1RQNA 3FM9A 4BEWA 5AVXA 1X42A 3WGUA 3W5AA 3DDHA 2WM8A 4JB3A 1EK1A 4DFDA 3ZUPA 3ESQA 2HDOA 1QQ6A 4Y2UA 3PDWA 5AK4A 4ZEVA 5AM3A 3BA6A 2AMYA 2C8KA 2OBBA 5ALRA 5AI0A 4HGRA 2AGVA 3QU5A 5ALPA 5IT0A 4EENA 3NASA 1Y8AA 4YIKA 2FDRA 1WR8A 3MC1A 5ALNA 2WFAA 4KNVA 3ZX5A 1WZCA 1Z88A 3SF0A 5AW0A 3ZWDA 3QUTA 1T5SA 2C8LA 2C4NA 3NANA 3B9BA 3L0YA 3SHQA 3DNPA 4C4RA 2JAUA 4AS3A 1CR6A 3ET5A 2Q5EA 2NO5A 3FGOA 4NABA 5AM2A 3WK9A 3L0CA 5AVZA 5ALHA 4UMEA 2EAUA 2ZOSA 3NAMA 2MSNA 1U2TA 2G1AA 1RKUA 4UU0A 3A1CA 1K1EA 4BX0A 1VFPA 3CZ4A 4DW8A 1T5TA 3WK5A 2B0CA 3UMGA 4BX3A 4IG4A 1TJ4A 1SU4A 2WF7A 2BDUA 4UATA 4Y2JA 1RC8A 2HOQA 2BDEA 2IOFA 1TJ3A 3FPSA 1YV9A 3FVVA 2CN1A 5IT4A 1WPGA 3SKXA 4G63A 3WK6A 4UAVA 3B8EA 1Z4OA 3QU7A 4YCLA 5AVTA 3NALA 2QYHA 4AS2A 3WKBA 3GYGA 3ONNA 5AW2A 3WKEA 3OCZA 4CE6A 1RLTA 5ALXA 3P96A 1TJ5A 2I55A 1L7PA 2FPWA 2YMLA 4J03A 2RARA 5ALGA 4BNDA 4F72A 2C9MA 5AVQA 1Z4MA 5AHXA 1F5SA 3WKDA 5ALJA 5AKHA 3I1YA 4GIBA 3AR7A 3WGVA 1U7PA 1QQ7A 4UW9A 4EEKA 4NWIA 5A3QA 2P9JA 2ZBEA 2YJ5A 4UM5A 3A1DA 3OCUA 5A3SA 4Y2SA 3N07A 3N5KA 1VJ5A 3QYPA 3FZQA 3KC2A 4KX5A 4MUMA 4BNDB 4EX6A 2P27A 3U7FB 4BBJA 2G06A 1U7OA 3OCYA 4YH1A 2R8XA 3IJ5A 4NAVA 2YMMA 3L0BA 4UM7A 5T41A 4Y3UA 3W5DA 1L8OA 2R8YA 1RMQA 2W4MA 4CF3A 2HCFA 2YJ4A 4PNHA 2C88A 2PR7A 1NRWA 3SMVA 5AW9A 3RF6A 4CNQA 1VJRA 4OD0A 3AR6A 5AW3A 2ZBFA 1Z4NA 5AVYA 1XVIA 4L57A 2AH5A 3I76A 1PW5A 3OPXA 4UARA 3WK4A 3EWIA 4UAUA 4UASA 2WF6A 3QNMA 2WF8A 3SD7A 4J2TA 1NNLA 2IYEA 3L8EA 3NIWA 2ZBDA 3N1UA 5AKZA 3QUCA 4I9FA 2WHEA 3RFUA 1N9KA 5ALVA 4RETA 3N8GA 1Z4PX 4HGQA 3L8HA 3WK8A 2ZG6A 1O08A 5AKLA 2GHTA 2AUTA 5ALZA 2B30A 2G80A 4I9GA 1RQLA 2YN4A 2BY4A 5AIAA 5AIBA 2I54A 2I6XA 5AK6A 1L8LA 1WVIA 1U2SA 1Z5GA 2B1QA 4FYPA 3ZTWA 4OCZA 5ALSA 4BKMA 4EX7A 3OCWA 2G0AA 1RLOA 5AI5A 4L6AA 4KX3A 1QQ5A 5AKGA 4YGYA 1KYTA 1RLMA 5ALMA 3KDPA 4NFLA 2FPRA 4AP9A 2ZBGA 3L7YA 1RMTA 2D2VA 3PGLA 3QLEA 1J97A 2CFSA 3R9KA 5ALQA 1YDFA 5AVSA 1L7OA 5AI4A 1S8OA 2RAVA 2HI0A 5AM0A 1RKVA 2G09A 3U7EB 2IOFK 2HO4A 3A3YA 5AKIA 3UMCA 5AI8A 3SKYA 2ODAA 3AR4A 3ZWKA 1ZJJA 1U02A
chains in the Genus database with same CATH superfamily
3JQCA 1KQGA 1JYFA 2CMFA 2JJQA 3CPSA 4FDMA 4GEGA 1YMQA 1XZHA 1MBZA 2MHCA 3DLPX 3KKOA 4G24A 4ZTUB 5LB2A 3UWOA 1TCUA 3MS2A 4H3SA 4CF4A 4EB0A 4YWHA 3TADC 1AQNA 2VJCA 2DPGA 1JMKC 5ESDA 4DCCA 1YU6A 4HV4A 4LJYA 4B81A 1O9BA 1BDBA 3EXHC 1L6IA 4FUTA 5DK4A 5IAEA 4ERXA 2ZSJA 2QLTA 5D6OA 5TXGA 5AUPB 4LZZA 3I2YX 3QELA 1DV1A 4RM2A 1U2DC 1G42A 3OJUA 3WSWA 4HATA 1T4CB 3I3SR 3FJ1A 4GW3A 4LHWA 1D9DA 1MUUA 1XMOB 4QG3A 3D0KA 3LE8A 1PDVA 1X2EA 4LWPA 4XW2A 1SWWA 3A11A 2J59A 2AOTB 2HJVA 5BOSB 3EIFA 1YC2A 2W55A 5LA6F 3MABA 2D7DA 4F5EA 2X5NA 1R6AA 3A9UA 3IBFA 4HNHA 5J4HA 4X1YB 1TK8A 4JUBA 1DLJA 4RADA 3JQBC 5LQMA 1RW4A 4YR9A 4A0SA 1JFFB 1U8TA 2XQJA 4PGYA 1FEZA 3CZPA 1Z0AA 2D4HA 3V55A 4BC0A 3ZXIA 4PYOA 1EKXA 3NVZA 2ANBA 1A3CA 1J24A 4ZVLA 4EL0A 4UUOA 3T7AA 3PNQA 7ICHA 3VYRB 4ZI7A 2MUTB 1KYVA 2FMUA 4XE5A 4TKLA 1UF9A 4LYEA 1NV9A 5KFEA 3WWYA 5G3YA 1DWUA 5E4FA 3OEYA 4QL3A 1C7YA 3F4LA 5DDYA 1EDOA 2FMIA 4KXUA 1XZNA 5CFPA 3E0XA 4DCUA 4ICAA 3QZUA 2PBLA 3GUUA 5IM4A 3P0RA 1T8EA 2C3OA 1O54A 4KQGA 4QARA 3B1KA 1AOXA 5BV7A 3M82A 8ICQA 3LPDA 3IP4B 4HT3B 1AURA 4MVCA 1L4UA 2D0OB 2PNFA 1IYZA 2RFLA 4GBMA 3U7QB 3OAAA 2PQMA 2OVBA 4C0JA 1U9JA 4FJ1A 4V0QA 3RROA 5E79U 2I5HA 3H9EO 4OH7A 4YHBA 3VHQA 3HJTA 2MRLA 3VR5H 2IYRA 1KMHA 2JKVA 1GO3F 1ZM9A 3L05A 3KT0A 2HCTA 4MO2A 4NFSA 2PXAA 2YNMD 2P2LA 4GBGA 4YMTA 4ND5A 2X4DA 3JAWA 4MYRA 5JO9A 4BNVA 5KDDA 1A04A 2KJQA 4EBEA 1Q3KA 2ZQZA 3VVMA 4DRXA 4XOIA 3T4UA 3KZXA 1EXVA 1BFUA 4TZKA 5LZ4A 1IIRA 1LLCA 1P18A 2QI9C 2JD0A 3BM5A 3O38A 4W9RA 1EUDA 4XWTA 2G1KA 2YZNA 5C1OA 4NS1A 5FULA 3ZTYA 2GRJA 4YV0A 1Z25A 2OE2A 3R3ZA 3VSAA 4DSOA 2OQ2A 4AUMA 2NUAA 4MA0A 4N9WA 1E20A 3AX6A 4R0MA 4L5IA 2CLHB 3B3GA 3ZBUA 1KW4A 1O77A 4XWYA 1SKBA 3G68A 3RB8A 2R8BA 2FE9A 4CEJB 2H1RA 3E1GA 4RULA 4DV2B 4D99A 3KTAA 1JL3A 2V65A 2QZZA 2NRXA 1NNI1 2P2DA 3NHYA 3OWXA 3QEJA 1M0TA 1T36A 3T1QA 3QZ7A 4RFSA 4YRRA 3WLAA 2H07A 3B1FA 4MR8B 2ZIFA 5FTJA 3B0YA 2IHVA 1PWXA 4J16C 1R27A 3RSFA 4LF9B 1A27A 4O4HA 4F8RA 4QJBA 1S01A 3AESB 2GA9A 4KLUA 4GC9A 1OBFO 3QWAA 4DFJA 4KLAA 1XO0A 1G21B 1A1SA 1MOZA 1SVNA 3OTQA 2WHPA 4FUQA 4WNAA 5LQCA 5CTAA 3OZWA 1ZQOA 4C2AA 4OHFA 3CZCA 1OXSC 3FVRA 4ENVA 3SYNA 3IUQA 1U0GA 1KC3A 2Q0SA 5TE9A 4ZVQA 1ZK3A 3SU8A 4DJJA 4OI2A 4GUDA 1I1QB 1OXMA 1Q2UA 2WWWA 2CHQA 4GHWA 4IEIA 4POOA 4EBDA 1FDSA 1UBSB 1WY7A 1H5UA 2AOWA 1EVZA 3HN2A 3KFUF 4M6WA 3UMBA 3GIMA 2XITA 3LGSA 1SIJA 4WT7A 5DCUA 3RBZA 2FR8A 3MUFA 4HOYA 3UUEA 3I62A 3FYUB 1Z0UA 5F4ZA 4YASA 1DXSA 2IE8A 4DBZA 2PSEA 2OC9A 5GWXA 4BQFA 1RWWA 4UTOA 3VO8A 4LF4B 1ND6A 1OJLA 5T14A 2AD5A 3C0KA 1NPDA 4RQ2A 2OYCA 3Q85A 3FFBA 3W05A 4ESEA 1JYEA 3F9CA 3U1VA 4FIZA 4FPXA 2XCAA 5KVCA 2W6JA 6YASA 1KKMA 1QRTA 3WK7A 5CWRA 3AU9A 1FBTA 2NO0A 3FCOA 2MINB 3HL0A 4NHEA 1N0UA 5FWXA 3VVLA 5IT9A 2XVZA 2VHYA 3I9LA 3MPUA 4P82A 2Z2ZA 2O2SA 2B8NA 4J8PA 3O1LA 1GFIA 1XTQA 4G0ZA 2LDXA 3M6AA 2VKQA 2J3IA 3NAZA 2OYYA 4U7CA 3KUKA 2OM6A 1M0WA 3O91A 1KE2A 1I10A 3SC2A 5BSGA 2E1RA 5CEEA 2PZAA 3NBZC 1XB2A 4JZYA 3EIWA 2J09A 4RHEA 1HDIA 2XGPA 2H5IA 3I28A 5K9ZA 1G8SA 4MB6A 5TT1A 1Y9ZA 4MW4A 5B57C 1P1FA 2Z04A 3OEEA 1AN0A 3NTRA 2D8AA 4KXFB 1ILEA 1A9XB 3BJRA 4E5DA 4PU0A 5E7MA 1E2NA 5SY4A 4PVCA 5CGZA 3CNLA 3ZS8A 1FTWA 2GM3A 3BAZA 4P4LA 1TYEB 2GHQA 1M2KA 9ICFA 3D54D 5A9RA 2DR2A 2WFLB 2Z8ZA 4DLGA 1Y9JA 2ZKIA 2O2JA 5T3UA 3Q88A 4EKEA 1JTEA 1Z35A 4ISBA 5I9SA 1UPBA 5A2QA 4BP9A 3GNLA 4GPD1 2ZTHA 3OQVA 4ZYTA 2PTGA 4Q4LA 2FPUA 2R6JA 3PXGA 3SS7X 2SKDA 3VRHA 3E5NA 1QVRA 1SEVA 2C4WA 4QJ4A 4DLSA 1ZK1A 2I2DA 1U9CA 2BPGA 4TTIA 2N3ZA 3G6YA 5GTHU 1G64A 1HK7A 2R8OA 3KXDA 5D1HA 3NYWA 1W52X 3R0JA 4R9SA 5JAHA 3ZCTA 4W6QA 1IJFA 2ERCA 2W2OA 4HH4A 5HA5A 3HRIA 1T5DX 1EX9A 3C3YA 4N6OA 4RK4A 1PLKA 3TLMA 1JAYA 2WWGA 4ZEOA 3F6RA 4BQIA 2D3DA 4KKXB 3FHTA 3JWPA 4ND6A 3DZKA 3HW8A 2F67A 3FCCA 4L3WA 3SDBA 4DEVA 4RSHA 1VIYA 3WGUA 3ZZ1A 2WQ7A 4DUZB 1YAJA 4KTVE 4OQDA 1DB3A 4YUWA 1AU9A 4NOKA 1E58A 4NU5A 1N34B 3CMCO 1Z07A 1MEEA 3NO4A 4PCUA 1L5YA 1KVQA 3DD5A 3N0XA 4NZOA 5KTMA 2C20A 1MSWD 3ELYA 3P9RA 4C0SA 5EIHA 4E4YA 3HY4A 3FA2A 2AEJA 2ZCUA 3SZRA 2HJ9A 1ZXBA 2E5WA 1L1EA 2V0CA 1V2HE 4YXWA 1WBDA 5ANRB 1LW7A 3C14C 3AHJA 5ALPA 3PL5A 3NUZA 3TLZA 4XD7A 3U81A 3USCS 2VYVD 8ADHA 1GTJ1 2VH5R 4Y1RA 4HVLA 4X6LA 4WOBA 5FWYA 4RLHA 3RBXA 3BWDD 3IURA 1TJPB 1S2NA 3FTPA 1EFRD 4IHQA 1JJFA 1OV6A 3T1NA 1YZVA 3G82C 4XM2A 1LLFA 4RFLA 4WK4B 5BSUA 3WRXA 4FM9A 2LKYA 2YFHA 4H6WA 3FDIA 3OM0A 3C41J 2YDYA 4LF5B 4LF8B 1H5QA 2QN8A 4BLTA 5B4UA 3QSYA 3T41A 2QT0A 4AS3A 4RWEA 4LHSA 4O2BA 1K5OA 1QS0B 3PXUA 4K4HA 1E2UA 3NV9A 1GGMA 1HE5A 4YFVA 2P0EA 4CL3A 5I4BA 2GPJA 5ALHA 3PD7A 4MAFA 4TRJA 3NYQA 2EAUA 2YOFA 4PO3X 5REQB 1VZ2A 2MSNA 2J6TA 2AK2A 3U3KA 421PA 4IDFA 2AOXA 5EIXA 2ZUEA 2A7XA 3QMVA 2DBZA 4QTTB 1XWIA 2RHBA 1R4MB 3IILA 2ZUTA 1T5TA 3BFJA 3UUGA 4Q82A 2ATEA 1ESMA 2F77X 3F8WA 1I4DD 4RKQA 1G6HA 3KLBA 1D4FA 3LUGA 4G5XA 2QTVB 3MCWA 4N3NA 1RC8A 5LLTA 5IC5A 3VI3B 3B1ZA 5KT3A 4RV4A 2P79A 2P6NA 2CN1A 2P4QA 4DC1A 1X7WB 3OJOA 2R96A 1UP4A 4G63A 1LRJA 3G5AA 1ECWA 4Y67A 3U4GA 4QYWA 3PNKA 1Z4OA 3ROEA 4DCMA 2FG6C 3D3JA 5KTKA 4ZD6A 1O94C 4OEHA 4ZFNA 1UZLA 1XHFA 1NX6A 4GM4A 1B8OA 3VH4A 1TVAA 5C5DA 3LBYA 1Y7PA 3BFPA 4EW2A 3CF0A 3GUZA 4F2GA 2GT1A 1PQWA 1XNRB 3B12A 1QIJA 1OHHA 3A70A 1OLXA 4LI0A 3EZFA 3KSUA 4K1XA 4WXMA 3VTKA 4TRNA 4ZCTA 5A06A 1L1FA 2OO3A 4PHHA 1YBVA 3CRZA 4GRDA 2XMPA 5DSZA 3SFVA 4CGYA 2OCLA 2YXEA 3CEHA 3HA2A 4QKQA 3DO6A 4DV1B 4EUNA 1ODTC 2PFQA 3JYPA 4RIEA 2JG3A 3E82A 4R1TA 4HHEA 1XFDA 4UEOA 1RJWA 4QC2A 3OTWA 4AQDA 3KEQA 7ICPA 1D3AA 3LSTA 1L1RA 3HNOA 4GOMD 1Y7HA 3EXFA 1U4OA 2OV4A 3B6MA 3D2CA 4LKRA 3V33A 1P31A 3KTQA 3DBRA 2WJIA 3ABSB 3DFKA 3J81j 3DXZA 4M9CA 3R7WA 1ZN2A 4P58A 3SMQA 4AJNA 5FPKA 2VL7A 3L6DA 2IGTA 3LXUX 2REOA 2PU7A 3AUYA 2UV8A 4GGMX 3U44A 5G2OA 1DL5A 4TZ6A 1U0LA 3ITDA 1K68A 5A0VA 4E08A 1LC0A 1FS5A 4FX5A 1I01A 1HEKA 3EZ7A 4EAAA 2OZPA 1X3SA 1T8UA 3T5PA 1H4VB 3G0GA 2BFAA 1MHPA 1F4VA 2G06A 3GU3A 1P7DA 1HQCA 2OQIA 3SICE 1L9KA 3FB4A 2Z6VA 3K31A 1LBTA 3G6KA 3VDXA 3KFVA 1UINA 1ARZA 4E21A 1WF3A 4LCJA 4I2FA 3GLTA 1LUAA 3SF8A 5AFSA 2E5SA 3DMTC 5CD9A 1TF2A 1KGSA 1NLZA 1UJNA 4OFWA 1YQGA 3OM8A 1J8FA 1KIAA 3N8IA 1Z37A 2PFGA 4W6ZA 1XU4A 3UG7A 3AJDA 4C5BA 2O7VA 1E4VA 2IH5A 4X0EA 2YKGA 3OF5A 4WAUA 3HP4A 3LY5A 1JHOA 4JUAA 4EECA 4QLAA 2K8CB 2PGXA 3QX3A 5EJ4A 3IQHX 1ZD8A 3L6RA 4L73A 5D01A 5FI0B 2OXTA 5LSAA 1GZSA 1FQJA 1E7WA 5IKPA 2WJJA 1R0WA 1FDUA 1CS0A 1QGUB 4PJ0U 1Y1QA 2A5DA 3BXZA 4NFYA 4O2AF 4UOZA 1NJXA 2K2WA 2XNDA 4DYVA 1JKXA 4CNBA 3VAAA 3DL7A 3WK4A 4BE4A 2BGNA 4UAUA 5DH9A 4JV5B 1DC3A 1MN8A 3NRCA 1SVOA 5IAKA 4BVBA 1VRCA 2HMAA 4RVCA 4MI9A 4E30A 2BFBA 5LBIA 2GDJA 3S8EA 1YL6A 3DWGA 2IEBA 3JCZA 4MB2A 1NF8A 4NZ9A 3U4DA 3NIWA 3VQTA 3BYZA 1O94D 1DQRA 1VMAA 3DS8A 3RRJA 3D2LA 5K8UA 5KI6A 9GPBA 4K2AA 2GN2A 4JJFA 4OIFA 5K99A 5IXSA 3HXQA 4V2IA 3ZCPA 3JQFA 3K5WA 1OTYA 1Z7BA 4PLTA 5LVAA 1XF1A 1KJ9A 4X44A 2X14A 5KFPA 2R68A 1AQYA 3QW4B 5CDSA 4B3MB 4OXNA 1P29A 1C0PA 3AETA 3EG9B 3GNSA 1KL7A 1RWVA 5G4LA 4TYWA 2Q9AA 3T3DA 2EZYA 3I9V1 1ECGA 1G2QA 1ORVA 1DAMA 1XZCA 4B6PA 1D0IA 2E3TA 3C6KA 4AMZA 3SWWA 3NX4A 2F1KA 3DJFA 1K8RA 1LLQA 1Y3IA 1ZA1A 4NXNB 1CS4C 1JQAA 2C82A 3QRWA 4RVFA 1W75A 3FF1A 4BFVA 4CV3A 1QWOA 3INTA 2WD8A 1OLOA 1QG4A 1KDYA 3WL5A 5KFGA 1PR9A 4GMKA 3ZZMA 1U47A 3ASVA 1N33B 4QPPA 3BTSA 4RKWA 3SHVA 2YXDA 4EJSB 1SKQA 1T2NA 2JCXA 2UUAB 3M2TA 3UKOA 4EO9A 2XKKA 2EANA 5FUWA 4HNUA 4PNZA 3B6ZA 4KMUA 3DQQA 2OFOA 2CB0A 3LVWA 4NCJA 4RVGA 5TEVA 3V4VB 1XEXA 3VR5A 3W9BA 3QE3A 3ZBQA 1MGPA 4PQRA 1T0JB 2QBYB 1J97A 1FRQA 4M83A 1TO6A 4ZA2A 3MTBA 2JJ8A 5AVSA 4QGGA 3M6KA 3GQBB 2D5IA 3WHKA 2XMQA 3CX7A 2BONA 1U3TA 4CR7A 5D86A 4XRGA 4NNPA 4EZBA 2HBMA 2VP4A 2ZT5A 4RD3A 2IXGA 2QB0B 4QSMA 3RIMA 5JCOC 5KQRA 4QOFA 1IZYA 1XHEA 1N2CE 3RSOA 2OV6A 5KREA 1C3LA 1IJBA 1YCDA 2ODAA 2XTNA 3WGGA 4R71A 3G7UA 3QXHA 1QU3A 2CMDA 1P7CA 3NATA 5JXGA 1AJEA 1OKKA 2GPSA 2R00A 5AVUA 1WUHS 4WK2B 3LY8A 4Z1MA 3IAXA 1XP5A 3IOCA 4DIEA 4PO8A 3HVRA 4WFKA 1T3LA 2R6AA 3G2OA 4N3CA 5EN4A 4IF6A 5F35A 2ZXHA 5KT2A 5D3KA 1IXRC 2V58A 3LV8A 2IWHA 5LOVA 4J9UE 4U0KA 3ZR4B 3M9MB 1W2WB 1ZA2A 1OXXK 3CF2A 3M89A 1RXEA 2PKXA 3DW1X 1AA9A 4H35A 1QH8A 1M73E 2VPZA 1QQTA 2O0KA 1ZGGA 2CLKB 4B85A 4AT1A 3SJCA 3QXCA 4DF3A 2TMGA 1TCVA 4GUAA 4ZAYA 1ZD4A 2WPNA 1LB2B 1PGJA 1ZIYA 1C7QA 4J0CA 3PDCA 3B9PA 1EE9A 2OVFA 2PXIA 3A06A 4M54A 4NBKA 4BO0A 4KLRA 1KFBB 3MHTA 4F2PA 3H5WA 5EGNA 3PK0A 2GESA 3AWIA 4D9FA 4JJGA 3ESRA 3F3KA 4GI1A 2WFLA 2QGFA 3DDZX 3G2QA 4QVKA 3JYOA 4PZLA 4TSKA 3UZUA 3X1WA 1G59A 2Q07A 5IANA 2IY7A 4Q7EA 2SKEA 4L76A 4TS1A 1H3EA 3PC8A 1PHPA 2C8VA 4KR0A 3OE7A 2IU3A 3MM4A 1RTKA 1DWQA 5EG5A 1C0EA 2XZOA 1SJ9A 1Z73A 3O9MA 2B2XA 3E81A 1JAIA 4KI0A 4AX8A 2WQ6A 2QE6A 2O23A 4HEJA 2IIQA 5A3JA 4QO7A 3WZ2A 4D0NA 4IW3B 2I7DA 3F67A 4GYJA 3TKLA 4BO1A 3T7KA 1H93A 2WJ3A 3FKQA 5G5GA 2OD2A 3IYLW 3QU9A 3K1AB 3R2JA 4EFMA 1DAOA 2DETA 2G63A 1DBVO 2X5KO 1G1MA 3MLEA 2GYWA 4BFLA 3HUEA 1XPOA 4NL9C 1KP3A 2B1GA 2V5VA 2BCQA 3EEYA 3VR6H 1F1JA 3B1VA 4Y2XA 4QT0A 3NKFA 3CKLA 3N7SC 3IUPA 3V1KA 2XVTA 1AQ6A 4ED6A 2V6FA 4F96A 4XB6B 1EVIA 2DCUA 2RMKA 2CCKA 3DMRA 1FSPA 2WU1A 1FNDA 2C5HA 4NBRA 5TF0A 1KY5A 3E9YA 5EKSA 4BX2A 3WGIA 3ND5A 2GXUA 1G5TA 2GPWA 5FAKA 2C97A 4BAGA 1S2GA 4KXQA 4BUJA 4TL9A 1Q92A 4UHBA 3NHBA 4YP3A 2PO5A 4JJKA 4GLFA 5TNXA 3WLMA 3SZUA 3CPJB 2XSZD 2KE7A 3VAYA 1AH2A 3DJYA 1KPGA 3LVQE 2ODEA 2WD9A 5E0KB 5FADA 2IDMA 4HGZA 3W3ZB 5HKOA 1MO5A 4B3TB 2YXBA 5JJKA 1EWRA 1UDAA 2QTTA 3O1IC 4WY2A 2XCLA 2JH3A 3E9ZA 4WNAB 4BLRA 2C31A 2QTGA 2GHRA 5KTNA 3D6UA 1M9NA 2JIQA 1IPEA 4ARZA 3AY7A 4F84A 4PX2A 1R0BA 3HXPA 4FBUA 4IJKA 4I55A 2OA0A 4IQWA 8MHTA 4BXOA 2B6GA 1ATZA 3BD9A 3RS5A 4IDAA 2ZRCA 1SAYA 3FRJA 2WYIA 5KT4A 1XC7A 5MFZA 3QOXA 1LNZA 1CJMA 4UMVA 2RQ5A 1VKOA 1MVOA 2Y68A 2PKWA 5DEOA 5FNZA 1F2UB 2LRHA 2PD6A 4RQBA 5FAXA 5EXXA 5SZIA 2B8EA 3FOFC 2HHCA 5F9HA 3PKZA 1E2PA 2CD9A 2CZGA 4JXJA 1DO2A 4RZSA 3TX6A 3WJAA 4FFPA 1IBCA 3CF6R 1SOUA 1TZ2A 3B1XA 4H15A 4EY6A 1YBFA 1M3SA 4MGZR 1T13A 4B2LA 1KFTA 3PEWA 3JD1A 1A4RA 1EVEA 1QGAA 4YQFA 3DB2A 4OKIA 5FHRA 3RKUA 3UOAB 3GCWA 1VJGA 3DMNA 1LI5A 4G0VA 3PWTA 9LDBA 3ZUGA 1UADA 4GQAA 4JL5A 5C3UA 6AT1A 4WESB 1ML3A 1HDXA 2FWNA 2I2CA 2QRUA 2Y6UA 4R16A 5AMXA 3NIFB 1NMSA 1RYEA 3GGCA 2QE7A 4JLWA 2B6HA 5HMMA 1AXGA 1FJGB 4MCIA 1TM2A 1PNRA 3A3PA 5I9BA 3PC7A 1E1YA 2ASVA 2B21A 2ZUUA 4O08A 3UJ6A 4HNAB 5H8WA 4QVGA 3TMYA 1FTSA 3K15A 3KOXA 1SOWA 4JASB 2C3PA 3R0ZA 4OGGA 5DI3B 4E0BA 2HBZA 4C8NA 4UBOA 5ELMA 4EPYA 1QTNA 2NQTA 5EIWA 1LRLA 2CJPA 2Y1WA 4KCGA 5DSXA 1U4BA 4JUFA 5T64A 3MJDA 3HSKA 4KODA 4HYEA 1QZZA 5ARBA 3E5MA 2MYNA 3KHKA 4C4PA 1DQNA 3NUQA 1SBYA 3GNTA 1IQUA 1OFHA 1V25A 3PHHA 3WGLA 4M04A 1RYYA 1L7NA 1T1EA 4F2SA 1BRMA 1ZOOA 3AJ8A 4GG1A 3NHAA 4KXNA 4QRIA 4R41A 4RMIA 3ZWVA 3BD6A 3VR6A 3P5BA 2XB6A 2P5SA 4JL8A 3UAZA 1NLFA 5MN4A 1JNYA 1B73A 1VBMA 4DCNA 3KXKA 13PKA 1A5ZA 1A9OA 4MW9A 1NLUA 3R3UA 2H1FA 5H70A 5TARA 1GZDA 2RDMA 2RAPA 1E2DA 4TUPA 3C1OA 3CUWA 5JYEA 4CKBA 4PG8A 4JVOA 1FFCA 4J75A 1H2BA 3CGGA 3DV9A 3V3KA 2KBFA 2OSVA 3AKZA 4QEKA 5CXUA 1PJSA 4HUQA 1SWVA 5EE0A 4RTLA 3QEKA 3BMNB 1GG2A 8ICKA 2DBRA 3H1PA 3TLKA 5K7SA 3O3MB 4MUEA 3IN5A 1TMYA 1TFRA 4EYOA 1HE8B 1WXWA 5AYVA 2NUPB 1ZP6A 2EFHB 2VAVA 2I5PO 4P86A 1JALA 3GCZA 2J33A 1H94A 4H3KB 5EWMA 3QEAZ 4GLLA 3I1JA 2PZKA 4BZWA 3U3XA 3FBTA 4KYUA 1MAVA 1X94A 3OC0A 7ICFA 2AOUA 3QFTA 4I1OA 4O4JB 4RV5A 3UJ7A 3K1ZA 2ZVQX 1BG6A 5D3ZA 3P94A 4K9PA 1XHLA 5DT9A 2JFPA 3B5JA 3UB2A 1V9PA 1F44A 1SC6A 4G1VA 4L72A 2WNHA 2ZSDA 4QEDA 5EHGA 3RD5A 3HFSA 4CU5A 5TSDA 2XHEA 5EP1A 3LYUA 4P3NA 2PX5A 2PPLA 2FMSA 4DSTA 2COKA 3B6JA 3SQMA 4D0GA 1T8PA 1F8GA 2ZBUA 4PGHA 4WXEA 1UUFA 1Y9AA 3UWPA 2J87A 1RZVA 2GZHA 4E6EA 7GPBA 5IHPA 5A0TA 3PLAE 1RPTA 1H2WA 4ECTA 1W4ZA 2PWPA 1A1VA 3FWHA 2I7XA 4BEWA 4DR6B 4IQFA 1D8LA 3JZIA 3NXKA 4F6RA 3E9QA 3T3HA 5BMVF 3W5AA 4DJ5X 4TV8B 3RTAA 4B82A 4PAQA 1X6VA 5DNUA 5IM5A 1C41A 3C23A 3CE9A 3CUSA 3OOHA 4CDGA 1WF6A 1C80A 1GAWA 2Q2OA 4FTWA 3X2SA 4EWLA 5CP2A 5AM3A 1D1PA 1RHRA 2BFEA 3FWNA 2AMYA 4G1BA 4CL8A 2P7IA 1P81A 5CRIA 3BZUA 4LZWA 1Z2OX 5DLGA 2FK7A 4HRYA 4P35A 4PZZA 4TVBA 4YI3A 3ZEIA 3U49A 4P84A 5IT0A 1NWHA 2F8LA 3KQPA 4J7AA 1W94A 4YRIA 1I3LA 4WLEA 4YRKA 4K9KA 2ZSBA 5LUAA 4Z4GA 5I47A 2OBXA 4CM9D 1NXQA 1ZINA 5AW0A 1H2FA 4ZZIA 4M99A 5HYVA 1CNFA 1COOA 1P8JA 2XHZA 3NANA 1N3BA 4UUPA 3L6OO 4KHZA 3RUAA 2OMKA 5T4BA 1HKUA 1UMDB 1Z68A 4YPFA 1T36B 1NQTA 5DTQA 1GY8A 4D3YA 4DILA 1M1YB 2BFWA 3MWKA 2Q5EA 4DIFA 3D8SA 5K8JB 1FU4A 1RFGE 3BK7A 5LZ8A 5KNBD 3GWZA 5IJZA 4B48A 4GSYA 4O2AA 4NABA 4AYBC 2J0UB 1SV0A 1EM8A 1DBRA 3GIKA 2IXDA 1E60A 1EM6A 2OK8A 2W2LD 2JH7A 2ZRDA 1S76D 4IJ6A 3GJZA 1BJTA 4JNKA 4FBLA 4ER5A 1YD7A 2QW1A 4GMXA 5C1DA 5F3WB 1E6UA 1C7RA 3DAPA 1ZUWA 4DW8A 4G0UA 2W22A 3QFFA 4DJDC 2X7JA 1T4DA 3HM9A 2GN8A 5EWGA 1H9AA 2JZBB 3EQ8A 1PJ4A 3GDGA 3Q0EA 3RHFA 3UB3A 1X8LA 8ICSA 1DNPA 1CF2O 2QYTA 4M1YA 4ZOBA 2H1OA 2WAQF 2FFAA 1ZONA 2ZTUA 3NGMA 2HMTA 1MJGA 2I0FA 2GJSA 3GFOA 3H2HA 3LO5A 1I2CA 1Q84A 2VK8A 2VPYA 4RGQA 4ZVRA 5CJ7A 3EQ6A 3GXBA 4M38A 5EERA 1H4TA 5IJ9A 1OZHA 5BWCA 1TAGA 2AHOB 3RW9A 4JAVC 4G56A 4ARUA 2AGOA 1VL8A 3SJ7A 2WHYA 3R7DA 2YV2A 3ZJVA 1H0RA 1L5OA 2BFPA 4MVJM 5IAJA 1KL9A 3OP1A 4IIJB 4I4TA 2C7QA 2FN9A 3FOAA 3DLTA 3B20A 3QJYA 5HS6A 4D3ZA 3ZLUA 4O1HA 3Q6NA 4UNNA 3C4QA 4MKGA 4UHKA 1Y33E 3DB1A 4ZGWA 3D1JA 1V7QA 2B9VA 3GW8A 4YCBA 3ZCSA 4N39A 4NS4A 2UVVA 1HLGA 4U6QA 4A26A 3OQ6A 4A23A 1HE1C 4DZRA 3FYTA 3K2BA 4CKYA 2GNAA 2I3AA 2VJNA 2VH2A 1HEIA 1PNQA 3C3PA 2XUIA 3M6IA 1CNEA 3QA9A 4RJTA 4O3RA 4QVIA 1KRWA 1NVDA 1L5ZA 1POWA 1E9EA 1Z47A 2Q9UA 5ALJA 1Q1QA 5AKHA 2B5OA 4FD2A 2UZ4A 4C0BA 2Q6KA 3Q7SA 3M5DA 3T61A 1K5GA 3ERCA 3A26A 4LJ6A 3D3WA 2UZ1B 2ZBEA 4JUDX 4UM5A 4AJIA 4K6OA 1V6SA 2VUIB 3OZSA 1JFTA 1KMQA 2GK3A 3IOYA 1I7NA 3NHMA 1N2CA 5CYPA 5JJCA 4K9OA 4ZVPA 1Z15A 1QMPA 3MTIA 4WKGA 2JCGA 3IERA 2C2KA 3NOXA 4XUCA 1SCIA 3JVIA 1HRKA 3ISCA 2OP0A 4KBFA 4BNYA 3GLKA 1JXLA 2ZP1A 1OAAA 3JQFC 4L75A 4YH1A 3A1NA 3ZGXA 7ICKA 2CCJA 2E82A 4HQRA 3MUOA 1MT0A 3ENNA 3Q7RA 2GD6A 4IV0A 3ZDCA 4GX1A 2BE7A 2XXBA 1UEIA 1LNQA 5B5EU 2BFNA 2CFOA 1L7DA 5C5CA 5KFDA 2GBLA 3OVMA 1UAGA 2W4MA 4OL0A 4TTAA 5FA8A 1U0FA 4NULA 3RS4A 4QHTA 2IW1A 1JDPA 4WKNA 3ZWYA 3HSYA 4LXQA 3I72A 4GLOA 1WMSA 2DFKB 3SEFA 4EGQA 4N7MA 1MJGM 2FPKA 2BL4A 4ZC8A 1L8AA 5AUOB 4O3PA 3HYLA 1GPH1 2GN4A 4QXRA 4EB6A 3NM4A 3I09A 4GMGA 1JKFA 3Q8XB 3I9KA 5AVYA 4G5GA 5FNVA 2E1FA 1QIMA 2F8KA 1ZQRA 3JAKA 1GP2A 3KE8A 3R6LA 3FYHA 4WZBA 2F1RA 5KFVA 3OM1A 1FB5A 2CLOB 4BNMA 2WB2A 4PH5A 1LI7A 1M6EX 1K98A 2Z8XA 1RE0A 1O95C 2Z1DA 5DGDA 3S99A 2F2AB 3KYJB 1NJ1A 4S2EA 4DL4A 1P5ZB 3IAS6 4L07A 4LNUB 4NXZA 4N6NA 4J2TA 4V0ME 4PRYA 2XB2A 4XRRA 3HXKA 1NNLA 4J1TC 4HWGA 2VK1A 2VI5A 4EI8A 2R6FA 1G8GA 1A96A 3SEIA 3A1SA 1JQEA 2KJ5A 4N4AA 5E1OA 2DKXA 1UBHS 5FRDA 3G2PA 3N8GA 3N74A 5FUMA 1IHOA 4DPLA 1XZDA 1CERA 2W3SA 2PK3A 2C9YA 2Z3ZA 3PC3A 3AIOA 3ST7A 4YREA 1N9GA 2HK7A 2Q6OA 1DAFA 2QM0A 3LHFA 4AKTA 3QVMA 1H5NA 1XL0A 5KYKA 1KA9H 2P75A 5EIAA 3RTBA 1BMQA 3ZGYA 3TAHA 1QANA 1QHXA 3JPPA 2QPTA 4LOIA 4XIFA 5E4TA 5B6IA 2BM9A 3SZ2A 1QIIA 1A9YA 2AG0A 2ZXFA 4Y9UA 3R7AA 3RYCB 1RPNA 2J3DA 5HM6A 4MA5A 1MB9A 5I7UA 4YMSA 3AOEC 1KBOA 3HDVA 2JHAA 4DIKA 1TX4B 2CXTA 3QOYA 1CV2A 3ER6A 4U7HA 1YTUA 5JJLA 4YCDA 4V39A 1RHUA 4RCVA 4B9MA 1GJRA 2FMKA 1NLMA 3DL0A 2A5LA 5AXDA 1XS9D 2ZYSA 3NU1A 1VZ3A 3N0WA 4MQLA 2FUG6 5TQVA 4NFLA 2DECA 1K86A 2W2PA 2ZBGA 2ORWA 3PTAA 1JHAA 3LPMA 4BEBA 3MJVA 1QR2A 4O6VA 7ICGA 1OPRA 1YR2A 3NBFA 3QEOA 1QOPB 1CR1A 3ZV7A 1CI4A 4OYYA 2C7OA 4HYKA 3CRRA 5EEHA 2IHKA 4Q9KA 3TLCA 2JIOA 1K6IA 4U7GA 4BRZA 1ACJA 4IIYA 1PR6A 2GWSA 2YRWA 2OTCA 2QV7A 2AJLI 2HCJB 2XNDD 3I4LA 4MRRA 5G4KB 4BMZA 4Z51A 4I9NA 4UTZA 3A4LA 3GYBA 3BB4A 1SB8A 3IPXA 4HNRA 5KNCD 2VF7A 4MUNA 1Z6GA 3SJUA 1YZFA 5JEEA 5LMCA 2BVNA 5HIIA 1I13A 1ZJ4A 1GUBA 1UPTA 1KI4A 2FSSA 1P62B 2AR7A 3S44A 1R0XA 1U02A 1UXHA 4FMPA 1H2YA 3GLHE 1Z4QA 2WB4A 4DIMA 4CEHB 5KMGB 1GHTA 1OWOA 2IY9A 2VSYA 1DCFA 3JQAB 2GH1A 4S1OA 3ZJTA 1UANA 3RT7A 3QPAA 5LQJA 3I0ZA 2HHLA 4E0DA 5BMVA 3C70A 4FHGA 1FUUA 4IQVA 2MSLA 3BZWA 5LM3A 3L3FX 3THXB 1E77A 1W6RA 4ZCSA 3SE0A 3HTXA 1PBNA 1YB7A 1COKA 2WF5A 4Y2TA 1ZJ5A 3M1IA 3EXFB 5JIBA 4NMWA 3CCFA 1NOMA 3H3FA 1OZFA 2XDAA 5A4JA 4FO6A 3U26A 2I76A 3OSZA 5CXQA 1MC8A 3OPYA 4IRDA 1OLSB 2EJTA 2FKAA 3SYLA 4G23A 2RHDA 3M4NA 2HY7A 1A9TA 2KP7A 4GWLA 4NF2A 5EWJA 2IY8A 3E2IA 5KYVA 4BZQA 3H4IA 3Q3EA 1T8TA 4I2DA 3SYMA 2A59A 1PT8A 2C0PA 3NP7A 4MYTA 4ZOLB 1PJCA 1YAHA 2A1TS 3BRQA 3RFTA 3UMJA 4IIGA 3F5QA 2FP3A 5FTMA 2IYUA 3BIXA 4YJFA 2HWWA 3TIFA 5JTIA 3N6VA 1N2IA 3H9BA 1NN3A 1ZQAA 1Y89A 4RKFA 5EZ6B 1M74A 1UKZA 3WBBA 3PEFA 1F20A 4F1KA 4N7RA 1R9JA 3ED1A 4MDFA 5TPZD 2QMUA 5U4XA 5ISMA 1SZHA 3TZQA 1SXQA 3GJSA 3EDRA 5I8ZA 4FNGA 1DIBA 2IPNA 4ETIA 4UB2A 4LWQA 2WM2A 2X0DA 3GIJA 2YICA 3PQ5A 3HJNA 3NPAA 7ICNA 1OTXA 3KE9A 4OKSA 2KI5A 4TV9F 1ZFNA 2VFAA 1QHFA 2NLOA 4LHVA 6NULA 4J9SA 4GPZA 5L7WA 4DLUA 2YC4C 2LP4Y 4P0QB 3PUJA 1I9GA 1OY1A 2YXNA 1M8KA 4B5LA 1SZJG 5AJHA 3DYVA 3W6PA 4BRUA 4YR7A 4MCJA 4A0RA 1H9BA 3KHSA 1WCIA 4BYMA 4K3UA 1KTIA 1NJ5A 2Z5GA 1U7UA 2AXEA 1RACA 3DR5A 1B6GA 4KJXA 4P3OA 3WL3A 4DQ0A 5K05A 4KWHA 1DAIA 4HDMB 4MIYA 2NVWA 1K06A 3ZLTA 1NXTA 4KLHA 2HDNB 3V8NA 2HHTA 4C4TA 4R2JA 2IPOA 4FFVA 1VYTA 3MK31 1AKWA 5ETJA 3WVNA 3GT3A 2VZEA 3RC7A 4PINA 3KOWA 3L4BA 4CWAA 1NR7A 4M0MA 1SHTX 9ICOA 3QE4A 3P2KA 4YROA 1H0SA 1OASA 5F7OA 4B6FA 4WUVA 3Q15C 2GB4A 3GUVA 5HTKA 1O03A 1OYOA 4KDEA 2WTAA 1NDUA 2GOYA 2PYZA 3JQ6A 4GOKA 4IIHA 4LTMA 1J1IA 4XI9A 3NMUF 3QUQA 4ZEWA 3HKCB 4JT8A 2FQXA 3L9WA 3LDGA 4HPXB 3FSGD 1KQFA 3CX8A 3HG7A 4YRGA 3AM9A 4OBWA 4JBHA 4MW0A 2EP5A 4YPVA 2YXPX 3FMVA 1J56A 4Y1EA 4B7CA 4BBPA 3UAOA 3WIBA 4G26A 2QB5A 3GUCA 5DVZA 2FW1A 3ZQUA 2HQOA 5EY5B 3AQ4A 4JJ7A 4LOLA 4PF1A 3TLXA 2V6MA 3LD9A 5TEWA 4EG8A 1KI8A 2I66A 3IMCA 5A9SA 2WA1A 2IOQA 3PENA 2YY6A 5JSYA 3LRPA 5HXAA 3A4NA 3DLHA 5ALYA 1SVSA 1NMEA 1W1WA 4K88A 2ISOA 4UVDA 3IKJA 1N9GB 1RDFA 1YDEA 4XGKA 1TTTA 2BTEA 1EP9A 2GK4A 3WWOA 3JPQA 3O3NB 3DUWA 3MDCA 2ERXA 4FGWA 1GLVA 4NCHA 1MQSA 3W7BA 5L8VA 2RC6A 5BQXA 1T3NA 4I2EA 4DDKA 1E7MA 4U7WA 1KRXA 4MEXA 3DTNA 4OV6B 3LDFA 3P0JA 3GEMA 1LBHA 1OX4A 3UHOA 1KQQA 3P9ZA 4RHUA 3UJBA 3V7YA 3PUKA 3ODGA 1XQ6A 3STYA 1H65A 5LJIA 1I6LA 2I22A 2VPTA 3EPIA 3V32A 2GM4A 2QROA 1ZIDA 2PWZA 1JEEA 4X92A 3I34X 3K1RB 1D4AA 2A84A 5F78A 2QJFA 2LD4A 3EVCA 1IY0A 3WX0A 9ICGA 2ADFA 4EB8A 3AV3A 4B79A 3LBNA 3IDOA 4WBNA 4TMKA 2ZIUB 5D3QA 3VR3A 1GKLA 4J49A 4XDHA 5B6JA 2JGFA 7REQB 3HDHA 3EASA 3EBLA 2NXCA 3FPFA 1F14A 5G0UA 4WCFA 2AYZA 2LR0A 4MGKR 3A0HU 4OL9A 3N4MB 2WWRA 3C8UA 2VTBB 3ROZA 3C7AA 2R7KA 5JNWA 3UT6A 3MQFA 1Q83A 5A3VA 2B7CA 5IXYA 1PKXA 1XAHA 3LFUA 3O94A 1NR1A 3U1BA 2W98A 4HGPA 3GH1A 1M72A 2A35A 1Z18A 2HHXA 4Y2YA 3JQ7B 1L7VC 4DMGA 4ND1A 2NV2B 5IC4A 5LZ5A 5BSRA 5AVRA 5BR1A 3RIYA 2J3MA 1G3IA 1UDXA 2HSZA 2BCGY 4WXHA 5DHFA 4QZVA 1FDIA 3KLPX 5E1BA 1QGZA 3HKEA 3H11B 3RIHA 1SKSA 5C8YB 1L5HB 4YMHA 5I7AA 3K0AA 1BN6A 2DBYA 1I0ZA 1XZ8A 3KEOA 1A2BA 2WP0A 4L2IB 3QE2A 2VPQA 4P92A 3VSDA 2VAPA 3O2JA 3ZI4A 1JQJC 4M1SA 5K2MA 4U9IS 1EHYA 1P2DA 2FEAA 2O7QA 3C39A 5ALEA 3FAHA 1RBQA 1Y4SA 3HJRA 5JXJA 3H5NA 2J3JA 2VWPA 1BCRB 2CNLA 2WU4A 3NV7A 3QEMB 4CQLB 4WINA 1T25A 2PR2A 4ENWA 3GN1A 2FMHA 1PQ4A 2VHZA 4IIXA 4OHBA 3D2QA 4OJMX 1Z0KA 4N8DA 2A0KA 3SJBA 1L5GB 4EEXA 1PTJA 4URVR 3ZOZA 2A92A 1M2HA 2QL9A 4OHXA 1WCIB 3LDHA 4NOMA 3RC3A 3BTUA 4V0RA 1Y34E 2C3MA 2HF2A 2J6BA 5EFZA 3RS0A 4ETNA 2PUWA 4AF8A 1XPJA 1YB2A 4F7WA 2OXOA 1GG9A 4J4TA 4MV9A 5H4HA 5A3RA 1PD0A 3ANSA 5KDOA 2WIKA 4ZHQF 2D8MA 4BLOA 1G21A 4EARA 3GGOA 4IMRA 4R1LA 3RJIA 4D0LB 2R1VA 4CCWA 4DAEA 1FS4A 3DNFA 2YWDA 4KNWA 5K4HA 1AS2A 4EELA 4X66B 1KMCA 1N6LA 5J0XA 1MQ2A 1I3MA 2HU5A 4RDIA 3OCCA 1L7AA 1G7TA 4WW0A 3D5TA 2HO5A 4FGSA 1ZLYA 4G8CA 1XGKA 4IPTA 4NZMA 4X3OA 4ENQA 1WW8A 4DFDA 1NM5A 1SL0A 2FEXA 2UYGA 3KYIB 3ZUPA 1H1DA 4B3HA 1QHGA 3BRCA 1MXFA 2QU7A 2Y1FA 4MV1A 1ZM2A 3ZZUA 1OH6A 3UK6A 2FQYA 2AMLA 3O3CA 4IUBS 1USGA 1N1EA 5CGQB 5H83A 1VCIA 1W5AA 4KLNA 3TFRA 1O8BA 3E9NA 2Y4NA 4DNXA 2GPBA 5A0FA 2JGEA 5EZSA 5B3LA 2KSOA 3HY3A 3MLBA 4R1NA 5KSWB 2W0MA 2BJVA 3WLPA 3EAFA 3KVRA 1ZCZA 3E9DA 3PPXA 4Q18A 4GKAA 2CDRA 2NQ2C 3EMBA 2JGIA 2V0NA 4M8NE 5E3HA 2O8FB 5C8XA 1WZCA 2Y3IA 3BKXA 4DSJA 3JQBA 4YD2A 2B9EA 1QO9A 1E7QA 3SIXA 3THXA 1AS0A 5J2BA 4ZALA 4OUDA 3ITNA 3KEGA 4KUHA 5C0OE 3E3LA 5J2JA 4MFFA 3SHQA 1V1MB 4FQ8A 2JATA 1KVSA 2DLDA 2SNIE 3EA4A 3GEEA 3DFFA 3V4PB 4C1NA 3X1JA 2Q0QA 1MVLA 5KG3A 1PHRA 3TTUA 2NO5A 1Z33A 1UJ6A 3BFVA 3FD8A 4PC7A 2H7VA 2JLVA 5F2KA 2C61A 2HPZA 3X0DA 1NXOA 2E4YA 4BQNA 1CZLA 4J90A 5KVAA 1RXCA 1QCYA 1MU0A 3BE5A 3ZD8A 1THTA 4RZRA 3RE1A 1RQ7A 1J0XO 2FJUA 1V4BA 3LC2O 1K1EA 1N5OX 1EX6A 4NBUA 3WHPA 1Q21A 4AP5A 1VFPA 4EATA 2E55A 2I8AA 2O3SA 4P4TA 1TM3E 4MW2A 4ECVA 1I5EA 2I9KA 4PN3A 3RTEA 5LU8A 5CLQA 2LCFA 5TQ2B 1VIDA 2FRXA 2G7MC 4XYEA 1OMOA 3TAUA 4OI4A 3CT6A 4QZBA 1SU4A 2PMWB 5FUXA 2HT1A 1Y1LA 2DKFA 3PVCA 3QVTA 4YAOA 1ZPDA 1XEAA 2QOEA 3AB3A 3NWJA 4CDNA 2BCJQ 3P4YA 4RJ2A 2OP1A 3FPSA 3FVVA 4J0GA 4MRAA 1NSTA 4R2LA 2LZ0A 3OMXA 5SY9A 1PJ3A 4PY2A 1Q5PA 1SQ0A 3G2NA 2XYPA 4UAVA 1CR2A 1HYQA 2VSOA 4YWJA 3KKAA 3Q8SB 1ZWKA 3T4PA 3NALA 3ZU4A 2RGGA 2FX5A 1ADBA 2ZYHA 3MCVA 3W5HA 3WDLA 4EYGA 4P1ZA 3Q8QB 1UKAA 2A5GA 3AV0B 4S0ZA 1GGVA 2BI7A 2IHZA 2VCHA 2IZOA 1M2OA 2W4QA 1N1GA 1PI3A 3B1JA 1NDHA 3P96A 3Q3JB 3FPEA 4HWKA 3ZEAA 3OIVA 3AB8A 3LHIA 2ZUBA 4IGFA 3G23A 4J03A 2PWAA 4CGZA 4PSAA 5H82A 1GA4A 2AOUB 1VLJA 2AQHA 1B41A 5ADVA 1WG8A 2R6ZA 3CO5A 4DV0B 4C7MA 1F5SA 3QPUA 3IT0A 1PAUA 2VRNA 1U48A 2XXJA 3K6JA 1U0RA 5G0TA 5JSKA 5CFLA 4CMIB 2C2RA 4JUZA 3QELB 3E0QA 1K0UA 3NWEA 1KFEB 1SHKA 4HKTA 3TCXB 2CEKA 4AYXA 1IWPB 2G1UA 3I3OA 2PX3A 4Q1FA 3OPVA 3VH1A 1A8IA 3IQGX 4BVKA 1NQ5A 4EEKA 1KFKB 1M7BA 1JVNA 3CUTA 1W2GA 1K4YA 4NOLA 1OOEA 5DLFA 3O4FA 4O1MA 1B14A 5EIFA 4UKDA 2FGJA 4EG0A 2BHNA 3DV0B 3FUVA 3H5TA 4C3OB 3EGEA 5FI1B 1M33A 1PP4A 2G04A 4LZJA 3UV7A 3E61A 1WVGA 9ICRA 2C0CA 1P0MA 2YW2A 5HZMA 3SAHA 3N7AA 4GR4A 1SUPA 3V34A 2BSQA 4OHUA 1U7OA 1QGED 2H6EA 1EVQA 1SCQA 2CPRA 5KPJA 4Q4JB 3SGLA 1E18A 2NZVG 2E8MA 1JHMA 2XJ9A 1VYHA 5T41A 4DDTA 4Y3UA 1C9KA 1TECE 3IG8A 3CEPB 5EGSA 1GNTA 3GMSA 1ZR4A 2P9BA 3B60A 4CF3A 2F90A 5HFNA 4AROA 3KR9A 3EC7A 2Z2YA 1DELA 2QNBA 1M0SA 3ZNOA 4YDRA 8ICVA 2XIQA 3R3SA 1Q12A 4LXTA 4TWJA 4R2WA 1RXYA 2QNRA 4YVZA 3TL2A 3AEKB 3VU9B 1ZOSA 3HLYA 2NSHA 3BF8A 4CMKA 2GXSA 3W1EA 1U8XX 4M60A 4KR3A 1Z16A 4GT1A 3WLTA 2FB9A 1FDVA 2FEPA 1JHQA 3U9LA 5GVSA 1G19A 1CIVA 4N0EA 3TI9A 3UN1A 1S3GA 4LQDA 4QWAA 4Q1CA 3CVWA 3OKPA 2ISQA 3KKZA 3T3MB 5JMWA 3E2EA 2P1ZA 3U0BA 3VDRA 2GFQA 4K6MA 2A4MA 5E7IA 5HUQA 2V4ZA 1R6XA 2DM6A 3E23A 4M1ZA 3H1BA 4PV7A 4EVRA 5B12A 2X76A 3ADKA 3ELUA 1X1EA 3HO8A 4FFSA 5JWOA 1WZ2A 3B48A 2V4QA 2OWDA 3L8EA 4OI0A 1HH4A 1E89A 1O5TA 1Z6YA 3IOBA 1PJTA 4RA9B 3SK0A 2FZGA 3CISA 4A15A 4BTVA 5ULLA 3PRJA 3A8TA 3IDSA 3MGKA 4TLAA 1G4UR 4ZYYA 3I9OA 4URWR 1M75A 3S40A 5JI2E 4WQMA 1DOQA 1ZUIA 3F8TA 3OZAA 3G79A 2YHIB 2H0RA 2AUTA 2XDWA 3TGLA 3VHXA 5FTLA 2M1ZA 4BZZA 2VT7A 2N1BA 1NDQA 2ZPUA 3TBHA 3GGDA 1G2IA 2A3RA 2JIRA 4TQSA 2BHTA 2EVWX 1RQLA 1VMEA 2E8NA 3RTVA 1RXWA 1CY8A 4NE2A 4WZBE 5KYGA 5EHQA 4ARCA 3L6UA 5AIAA 5BSWA 2N1MA 2ADOA 2ATXA 2O7SA 1BS9A 3HEBA 4Z3OA 4JKYA 2W3RA 1DHRA 2P2GA 4M0DA 3ZDQA 3ZLVA 2FSFA 4YP0A 4ARAA 1NK7A 4H16A 4QOEA 4KR6A 5CDGA 2P9TA 3IR5A 3PPIA 3I5UA 2ISPA 4RQ8A 1NG1A 4QGBA 4TV8F 4YXMA 1N3IA 3ANTA 3CNBA 3D6TB 5J2DA 3O84A 1NVFA 4LDQA 4F5ZA 3WA6A 4JI2B 1L1QA 4AN0A 3Q5DA 4DQDA 3A6PC 5L1MA 4TZTA 1QZTA 2P41A 1QLHA 2ES4A 2YWRA 4ZWNA 2B61A 5BXYA 2C54A 3WAGA 2Z6UA 1NMYA 4NZNA 1KDVA 1B00A 5HWSA 3OFNA 4ALLA 4KO2S 1L7OA 5AI4A 1IUOA 2AOVA 2Q27A 3K7EA 1YR9A 1OWNA 3JYLA 3LQ1A 3RNOA 4AZVA 5D46A 4JB0A 4RMJA 1N61A 3HKZF 5A05A 2GF9A 3A3YA 1AC5A 1JU9A 1VJ0A 1NK6A 3FPLA 2AX4A 3PD1A 1MB2A 2FRVA 4C08A 4Q4CA 1CT9A 3WSVA 3E2PA 1LD3A 1E9VA 4OMFG 5BPHA 3AM1A 3DF9A 1YOVA 2QQ0A 1VJ1A 2ISSD 3D5EA 3L41A 4I6GA 4KN8A 4D9JA 1ZBQA 4FLMA 2O59A 2NSDA 5CBPA 3AF4A 2ZAIA 4Y6GB 3F47A 2IEDA 4X71A 1NSYA 4ND8B 4TZ0A 1VKNA 1Z6PA 4HAUA 3AY0A 1E98A 1JR3A 3SM9A 4BU1A 4F5NA 5EZYF 2A9PA 1E9FA 1LK7A 2B4RO 4HG2A 2WJ6A 1QM5A 4XFKA 1G20B 5DMXA 5K3FB 1S1CA 2ZROA 3C43A 3P26A 3OFSA 4E4TA 1U2GA 1YFZA 1Q14A 2B1RA 4FEGA 2OGSA 2R62A 2J0VA 2YX8A 1C8BA 3K96A 3H6KA 4WKCA 1WDWB 4JI6B 3E3OA 5AUNB 1KZYC 2B4KA 4NJ8A 9ICLA 2GNPA 2R1TB 2YV1A 3WFIA 2W43A 2XNCA 5BSVA 3VNUA 4YJHB 3RUEA 1EVKA 1Z74A 3WYDA 5TT0A 2JVIA 3LX8A 3PL1A 4A6DA 3Q3GE 2XYRA 3KOMA 3RJHA 2YHSA 4FINA 2TRSB 3WYFA 2J6UA 2X0NA 3QI7A 4GXNA 4UPVA 3RANA 1R15A 2L19A 4L22A 2R8KA 4EFKA 3GLFA 1R50A 2C4MA 1I2AA 1AE1A 2UVQA 2C5AA 1AQLA 1S4MA 2Q6VA 1EP3B 4HYQA 5F76A 4RPLA 1XZIA 3OC6A 5DJ5A 1RHQA 1DBPA 1BPXA 3E9MA 3FDFA 1XYGA 2PUTA 1ESZA 2CMGA 3EHDA 2ZM5A 1G2OA 1PZXA 1W85A 4R51A 8AT1A 1ZEMA 3DE1X 2XKBA 3IHTA 3I9NA 4JU8A 1BJKA 1TUBB 1ZJYA 4BV3A 4NPAA 1ZNXA 1WNFA 1DX4A 2C98A 2YIDA 1KK1A 2ZSKA 4C2BA 5K8CA 1K7XB 2Q4TA 1SO8A 2VAWA 2V5UA 2VTKA 3OSNA 1IXKA 1WXXA 4I9UA 1JDBC 4B1FA 3AVXA 4MWDA 3K4PA 1SKYE 3KQNA 2QXUA 4LMBA 4RNDB 4YRCA 4O5KA 1CY2A 5LBUA 4BE9A 1TO2E 1LKYA 2IDZA 4QFBA 2Z1NA 4FEAA 3PVXA 1HDZA 1E62A 2VJQA 4WXPA 1Z28A 5BNZA 5AW6A 5K20A 5FPHA 3ZDEA 3ORYA 3CJQA 1SA0B 1BPDA 1D04A 2C03A 1K27A 3L40A 4MEJA 721PA 1TVKB 1RYNA 3T7TA 1SXHA 1NW8A 2PS9A 3BDIA 4MLZA 5E6UB 4BFUA 5F1OA 2JL1A 1ZQVA 4WNCA 3B89A 4PCLA 4WSOA 5ALFA 1Z5WA 4TM8A 5HK8A 1U98A 4MYUA 2QUBA 3IAM1 2FZEA 1QF7A 2VOEA 2X8AA 2XB8A 4NV1A 4FKBA 4DRYA 3GOQA 5IKMA 5KOHA 4AO6A 3K70C 3AHIA 5HDQA 2AFIE 3ESCA 2Q5CA 1GRCA 2QB1A 2QRKA 4G5SA 4YXJA 4RELA 3SY8A 4A2PA 5DP1A 5JH7B 3O03A 3WE7A 4U63A 3D4OA 3SJAA 1XZGA 3WAJA 3HFRA 4PTZA 1VM6A 4C0QC 1U80A 2FR0A 3HYNA 4LG1A 4JBNA 1FMCA 4JUCA 5DK6A 3F6PA 1E1KA 1OVMA 2XUZA 4G5YA 1NOKA 3QLVA 3GEHA 4N82A 1TZCA 2YVLA 3AR5A 3F1LA 4QO8A 3D8RA 4I50B 2PVCA 4TQAA 5BOVA 2RBGA 2OYSA 4YY3B 1OXVA 5BURA 4QASA 1SXGA 3TQQA 2XT9A 4HB0A 2FUEA 2ZYVX 4YK7A 5J0PA 2YMQA 2Y67A 1O57A 1TYBE 3GV0A 4ESVA 3KSAC 3LZ6A 3Q0TA 4Z8XA 1FFDA 4H7IA 4AN4A 2BFMA 2R6GA 1UMBB 4K9QA 2UXCB 1VYUA 2VDPB 1ORTA 1W0KA 3TXXA 5F9NA 4LXGA 1Q1AA 3A6GA 2QR3A 3BE8A 1MTZA 4LC1A 4OB8A 4WZZA 3GJ6A 3UK2A 4EKNB 3RI3A 2KS6A 2XXAB 4WECA 4JKIA 2YYSA 2XBMA 4AKGA 5LUBA 2J9FA 3BL6A 2NG1A 5EWLB 2A1UA 2R8RA 1X66A 1AGPA 1VXRA 4LX8A 4TSFD 2CHEA 3W4IA 4ILEA 5EE9A 4M36A 1CS0B 3QA3E 4UE2A 2PKEA 4YQWA 2PSFA 4QJFB 1KDTA 1BIFA 1YZ3A 1R5NA 3R5HA 2MOKA 3UMMA 1BS2A 2D1FA 4J1TA 1Q19A 4JCOA 1K9VF 4XIYA 3C1YA 1LBSA 2XWQA 3OO0A 4ILKA 1NKTA 2ZIEA 4HQKA 1FVOA 1SIUA 2ZITA 1IB0A 1BFDA 1ITZA 2C4KA 2Y9PB 3JZFA 3QNUA 4NU0A 4ZO4A 4L0CA 5AHWA 3IHWA 2O4UX 3BC1A 4XLLA 1LV5A 2ZE7A 3GIWA 4F9EA 4UHFA 5CB4A 4K4IA 1I6WA 3E9EA 5BN4B 1WHSB 1K9SA 4CQJA 4ZV9A 2YS6A 3AI1A 2HIHA 3KOYA 4H60A 1E4EB 1E0AA 1AKYA 3GZJA 2O6HA 4ZVOA 4JK1A 1SK9A 2ATVA 1FP4B 4Q7JB 4D7AA 1P6XA 2Z6AA 1HDCA 1J7JA 1RI2A 2QF7A 3PX3A 3IAUA 1XWLA 3PVZA 5AD1A 5KQMA 2BGJA 1WXQA 1V5FA 3OIWA 1O4VA 3EVAA 1IM8A 1WMFA 2JEFA 1XMSA 3NT5A 3ZW8A 1LF0A 3RFCA 1JPJA 2E48A 4KSCA 3VI4B 4LJLA 1SUCA 3E7PA 4IX1A 1D7OA 1YF3A 3JARB 3R7WB 1D6NA 1JLMA 3W5BA 4P4PA 1ZVMA 4FSXA 5K3FA 4LQ4A 4UU1A 4Z86A 3SZMA 3B6KA 4TS4A 3EARA 4BNTA 4DVJA 5ITVA 3U6BA 4K6FA 1QXSA 3N87A 4YLGA 3JRWA 4TMWA 1XD2A 3BX1A 2XBUA 4WGGA 1ADGA 8ICYA 3OE7D 4XSVA 2PRZA 3I6MA 4Q3AA 4ZDKA 3NHLA 5KG4A 3EZGA 1B6SA 1X9IA 2JARA 3ZHXA 4DCOA 4E1BA 4EGJA 4F86A 3TLYA 3ZCVA 3OCXA 4MVJG 3NDPA 2H4ZA 3URKA 5CB0A 1SU8A 1Y3DE 2YWCA 3U9SA 5LYJB 4EQZA 3ECAA 1KK3A 3RR2A 5DNCA 4F3OA 1NVXQ 1T5HX 3H0EA 1DXYA 2SCUB 3HA5A 4HP8A 4GI2A 4O2RA 1W48A 4G07A 1HZZC 4IDCA 4KV7A 3S81A 5I5EA 4C2UA 2WWIA 5C8DA 1LCIA 2HZBA 5EUBA 4MEBA 1DOAA 4D97A 4LHYA 3AVQA 4CG1A 2W83A 1DIOB 4OHMA 5DM1A 2MAXA 2HPHA 5AT1A 1TDJA 1OFUX 3LQ4A 5SYMA 1X42A 1YDWA 1T1JA 5ED4A 1ZQKA 3GL9A 1JXEA 3O5AA 3QTTA 4I2VA 2DFLA 1KDPA 5B3KA 2NMVA 5LCXA 2YJTD 4TKUB 2AYXA 1KVUA 1WTCA 3ETRA 2OB1A 4GZLA 3EVZA 3JPSA 5DB6A 1T9BA 4MINA 1JI3A 5AK4A 1NWCA 5KJEA 1BSVA 1XXHE 4MP3A 3WYCA 1ZSNA 2Q7OE 2EZ4A 4D3DA 2QVLA 1CRLA 2WG2A 3OWOA 2BUAA 2FOIA 5LNK6 1Y5NA 1AKRA 5EE3A 3AFNA 1A9ZA 1GL9B 2V5AA 2D5BA 1HOXA 3UAWA 1YVEI 3V8BA 3NASA 1CRXA 1X1TA 4DLTA 4HK4A 4YIKA 3SN6A 1JDTA 1RAGA 2FCRA 4RGBA 4LVNA 2D6FA 1QH8B 4X62B 1W2HA 3MQ2A 4MARA 5GM2A 3LL4A 4ZZ2A 5HKBA 5KJ1A 3BK1A 1BKSB 3HJCA 3IODA 3SBOA 3K0EA 4IR7A 5IJXA 1SUWA 2ONKA 1D6JA 2HW8A 3MEQA 3K5IA 3PR3A 1JHDA 2QLJA 3V9AA 4C7JA 4CMAA 4DDMA 3H4MA 5A5GA 1BH2A 1E9RA 3QX9A 3L6BA 4LOKA 1RRGA 5AQEA 3ZIDA 3RFAA 1QSGA 4UB4A 1MZPA 1NVVR 1CJBA 5IARA 1UJ5A 1XEWY 4F56A 2BFCB 2BQUA 1ZGJA 3DE7X 5JUWA 3L1JA 3CLHA 3GVCA 2EGHA 3L0CA 3WIDA 3ZKAA 5AVZA 3D3EA 1G38A 3QUAA 2XXAA 4KPEC 4Y1RB 1B8NA 3IDAA 1U99A 1A8PA 1KSFX 1E1NA 3CBQA 5DU2A 1P4AA 2CD7A 2NU9B 2DPLA 3EXG1 5BVGA 2ZZNA 5LQSA 3ZY4A 2AWNA 3PEYA 3SBXA 3RVLA 3Q3IA 5JQWA 1EFHA 3HZRA 1Y3BE 3F4BA 1WE2A 1YDMA 4AZ0A 4GKKB 2FWJA 5KTRA 4FCTA 2VYQA 3ZV6A 2VR1A 1R8QA 3DC2A 3NHPA 4HWOA 2D8CA 1K08A 3L7KA 4V0OA 3D31A 4PYRA 3GAMA 2CCGA 1I4WA 4WA8A 4EBCA 3QVUA 1IV8A 4RK5A 4BCBA 1IXSB 4PLCA 1NP7A 4CV1A 3ZIAD 1QG2A 1WPGA 2OCGA 1C1YA 4RZUA 3HEAA 3SKXA 4GOXA 4HRXA 3LMKA 4G25A 3ZHSA 5TVGA 2FPGA 1RWKA 1SKUA 4ZCLA 3LWBA 1JA9A 3DGFC 1ACMA 1X9SA 3HKZC 1MO6A 4TWIA 5AH0A 1YCHA 1ODCA 4ECQA 2QLMA 1GN8A 5IEBA 3TW0A 3WKEA 2GPTA 4DJTA 3PV0A 3O95A 5L51A 3HJEA 4AKSA 1TFUA 4S1TA 4EGFA 4EHDA 1HT2E 2JGDA 3GD5A 3JW8A 3Q8KA 2W9XA 4OHPA 4RVDA 4BC1A 2GXAA 1IFXA 1UWVA 2ZETA 5DBEX 1REQA 3UTDA 4BZXA 2YWHA 4H17A 4Z9FA 4Y9RA 2GKOA 2FPWA 4JYPA 3D7SA 2GJ4A 4R8RA 4NYIQ 4WBXC 4P34A 2UVPA 3FW1A 3RRFA 1HZJA 2CXHA 1JG1A 3ELBA 4HH1A 1DKRA 3KRTA 4AC9A 4BV9A 4XRHA 2AQKA 2HNKA 5K3EA 1G17A 3JYNA 2VHWA 3N7RC 4D5GA 2AG1A 2J6HA 3UWDA 5ED0A 4TTTS 3CCCA 2I78A 4OK5A 5E8RA 5CT8A 3TRDA 5TMBA 4UBKA 4EG5A 5KWJA 3KTFA 1Y5RA 5EUMA 1Z45A 3WLJA 1JHUA 5BOLA 5G40A 2NO7A 4EZ6A 4BMOB 5LWQA 4GLXA 2W5UA 1A9XA 4W5TA 3HKBB 4DCGA 3A1DA 3FDXA 1W47A 2O50A 5KC9A 3N9IA 1KJIA 2BMVA 2HRBA 4G5RA 3SQWA 5J0OA 1QRAA 1ZRHA 2ZQ5A 1IN1A 2FN3A 3RRMA 2FDXA 2Z2XA 5C1IA 3V4LA 3WIVA 5JYBA 3CW2A 2AEEA 4R1UA 5JISA 1E6WA 2W70A 1AKTA 4FK8A 4ZU3A 3TSYA 1UEJA 2F6RA 3T5MA 1H2AS 5DHSA 2Z5LA 3SC2B 4G01B 4EHFA 3Q72A 3RH5A 3HBLA 3NPMA 1C4OA 1JU3A 3QVGA 4XM0A 3ZNPA 2ZRBA 3UENA 3A2KA 1O87A 2HSDA 3KOZA 4I1IA 4O0IA 3AOEA 3PCXA 5D49A 2R85A 1LV7A 4YN3A 5CCDA 5EIEA 1VRWA 1RMQA 4NMMA 4MWEA 1Z62A 1EWTA 4EDHA 5I7FA 3GLFB 3C29A 3BD8A 3CLRD 4IXMA 4QAJA 2C2ZA 2Q46A 4E07A 5J2TA 3SMVA 5HQJA 1G6OA 1IEXA 3QVKA 4Z0HO 3WI7A 4GXKA 2HA0A 3AGPA 4OXYA 4PBRA 1JYSA 2X2PA 4UUAA 4DARA 4F5YA 4CNQA 4X95A 3OEHA 4JS0A 4N3AA 3JPRA 1VLLA 4KLEA 4Q37A 4MPTA 3ZPXA 2J3LA 3MINB 4DEXA 2Q4BA 4OAQA 2O2HA 1H2HA 3SC3A 3I76A 1OZAA 1PW5A 3OPXA 1W59A 2MMGA 2QLBA 4UCQA 1BGVA 1WCNA 1EB9A 3HCRA 1E3LA 1Q3TA 3RLIA 3DZFA 3NTUA 2R87A 1KMIY 3EXHB 1IQPA 3RREA 1T29A 1A76A 4LRXA 4RJJA 2JANA 5H59A 5JATA 3B3AA 4BO3A 1DUIA 3A6ZA 1ECCA 2I1WA 3AHHA 3PXEA 4JT2A 2Z43A 1J5PA 3TLEA 2L0XA 4I4CA 4Q8EA 4IHAA 1BPYA 1XNGA 4RETA 3Q11A 2DT8A 1YZHA 2AFHE 5B36A 1X2BA 4DFPA 1PQYA 1WSBA 1JKJB 2FFHA 1RQGA 1P2BA 3FYCA 4TSRA 4EJ0A 2VQ3A 3A1VA 1O08A 1XKQA 2AXTU 1N5LA 2XPCA 1HTTA 2F43B 5EJ9A 1XRQA 3DCNA 4C01A 1N78A 1YOVB 4U2EA 2NTVA 2G80A 3RBEA 2HBLA 5CX4A 3RC9A 2BSXA 2AVDA 4KXXA 2H5XA 2B1JA 5A6VA 2FLKA 3OICA 3RAEC 4UB8U 4FWBA 1RYMA 3P0EA 4QDJA 2W6OA 2I6XA 3H5AA 2VDVE 1FC0A 4MV7A 5DYWA 2KSOB 2BGWA 2YN0A 3UJDA 1X86B 2GZAA 4MKRA 4P7GA 2BEWA 4FW8A 3LT2A 4MEYA 3AUUA 5GGYA 2ZSHA 3HV2A 1KJWA 4ZU1X 1VE9A 3UK1A 3ISJA 3WXBA 3I0MA 3EY9A 1DADA 2RG1A 9ICVA 2X42A 4Q66C 2XKJE 3MWJA 3VPGA 3HNPA 2L82A 2GJAA 1OI4A 1ZH8A 1TU3A 3PNMA 1L8XA 4MTLA 3R0VA 3HJBA 4U7JA 5J0QA 3N7UA 1LDMA 2QTVA 3TVDA 3EX7C 3T7SA 3U7IA 1YGYA 1XLUA 2VJMA 4KQJA 4AUKA 2NNWB 1L4GA 1YDFA 4FJ2A 2PLFA 3P9KA 5CDYA 3R75A 2BCSA 1KVRA 3K9LA 5AM0A 1HLDA 5FTNA 2UYHA 2XY5A 2XUQA 5AKIA 2D5CA 3CXRA 2G9VA 4DO9A 3SKYA 5CNIA 3OZEA 4H7KA 2YUTA 4PXSA 4EQ6A 1LZLA 1VG1A 1Z2CA 4KFSA 1DIRA 4MTCA 3P32A 2DHQA 2IPXA 2ZIZA 2QD3A 1X39A 3ABRB 1YC5A 3MCTA 1RYSA 1A5BB 4HSGA 3F46A 3TE7A 5JDIC 3PNYA 4CN9A 3WB0A 1OW3B 2D0IA 3E3NA 1D07A 4P4MA 4NC9A 1AX9A 2W6CX 3E1KA 4YN4A 2C95A 1JT2A 2FUG1 3EIUA 1VBKA 1S89A 2R8PA 4OK3A 2FP4B 4X1KB 5DLQC 1ZQ1C 3P9XA 1S2OA 3OZIA 1VDMA 2RGDA 4YAKA 4JOBA 5DN6D 1ZQUA 4NBLA 1EGQA 5IF9A 4HDNA 4IDOA 4PLPA 2OXFA 3HCFA 5EZQA 4IV5A 3WV4A 4ECRA 1FDTA 4JT4A 2W7TA 3Q2IA 2RB5A 4IJQA 4K8RB 4X61A 3RVBA 1ZNZA 5IJAA 3TIXB 5IHXA 2IUYA 2JJ2D 3C2QA 4JP2A 2BZSA 2I7TA 3D2AA 4J7UA 5G41A 3WWDA 3ZU2A 5M34A 2W6NA 2CMKA 3BDVA 4J1QA 2FTKE 5BW4A 2ADMA 3K6SA 4A36A 4WCVA 4Y0AA 1CUXA 1KY3A 1NXWA 4P2GA 4EKIA 4CTJA 1WUTA 2VSNA 2JGRA 3Q7QA 1NUSA 2VTEA 3C7TA 3KKEA 3P20A 4YP5A 2GAIA 4E3ZA 4FZ3A 2WABA 2NXNA 4JLOA 4AP6A 4YCCA 1EJ0A 2IEAA 3HRKA 5CU7A 3EPKA 4WJKB 4DGQA 3CZRA 1AROP 4BFTA 1PZNA 2HXSA 4NLKA 2JFHA 2EIXA 1U9IC 3DOIA 3GT0A 4L4UA 5F12A 4B33A 1T94A 5AKXA 4Y2RA 2PV7A 1T4CA 3KQSA 1Q7GA 1YULA 4L02A 5E9JA 1SN7A 3WISA 2FVYA 1M8JA 2YJZA 1BNCA 4JKOA 2ESRA 3E03A 3UH0A 3M2PA 3T06B 2PGOA 4E51A 2IUEA 2Q0HA 5B4TA 1ZQWA 1NY6A 1EK5A 3HC7A 2O8BB 1U0HC 2WU0A 2HIGA 5ECDA 2ZTLA 1KF0A 4OLAA 1UDWA 5CG1A 2BMJA 3UT0A 1T3GA 1ZRNA 1QYWA 4D6PA 8ICAA 1QX4A 5D85A 4C22A 5DGHA 1Y7IA 4IFTA 1M6NA 4P7BA 1W49A 3RYIB 4B3BA 4QODA 1RPAA 4DMLA 4QU8A 2DFPA 1NM5C 1RD4A 2IA5A 3G5UA 3MWLA 3I9MA 4M9UA 5BV8A 3BREA 2F76X 5AKKA 4OH1A 5E8JA 1VGRA 2NZJA 5IAGA 3L82B 1Q6ZA 3ZHZA 4UMDA 4YMOA 1NUAA 1CEXA 1NZJA 1TCCA 2VLBA 2V7GA 2KEYA 5JZVA 2Z6QA 3U19A 4QBFA 1H42A 1TC1A 4GOND 5DLPA 5AJYA 4D45A 1Z5ZA 2NSYA 2PXCA 3L5KA 1PRYA 2ZTMA 4IXWA 4QXMA 3SDSA 4KLQA 1K6EA 3QXGA 2I7CA 1Z29A 4U2CA 2QVYX 4L28A 2R2GA 4ACAA 4CODB 4I1YA 4OB6A 1NZBA 2W2LA 4F4IA 3PE3A 2XY7A 2AGQA 2IYTA 4IIFA 4ZREA 4OLJA 2C3UA 4GH5A 4MMZB 3ZD7A 1ENPA 3DL4A 4J9PA 2VQEB 2RGCA 4UZSA 2AKEA 2O52A 5FFNA 3KT6A 2Q6IA 4CKXA 1QCZA 4JA2A 3MCZA 1M2OB 1QHEA 2AI1A 2BELA 1RAIA 2B4AA 3E4CA 3HO6A 3CX4A 3C4VA 3QKRB 2FFJA 4LY0A 4V0LA 3SLRA 3FPJA 3WDKA 2WB1F 5JD4A 3T3OA 3O4JA 5DWDA 1QV6A 2JFFA 4F21A 5B5SA 1T8SA 1N0WA 3A9VA 1E1DA 1VE7A 2CJWB 3ICWA 5M3BA 3HPQA 3VKGA 2IHNA 2XRYA 3PD0A 3OSPA 1DOZA 2X58A 4LYAA 2FMXA 3LPCA 2OHFA 2C9OA 1XRRA 4AMBA 4Z8YA 1KO1A 2XIDA 2Q3MA 3RYFA 1NKEA 2TMYA 3VH3A 2LUOA 3K4QA 4JT9A 3MTAA 3TJZA 4EZEA 3DD1A 3PNPA 1A7AA 2EYUA 2DVMA 4LVOA 1XLVA 3CH7A 3GRUA 3GPBA 1NN5A 4W5WA 4YUYA 1UT5A 2YVUA 3OIUA 1IHXA 3LWMA 1XQVA 2BUBA 2CFCA 2JEOA 4O4JF 4K3VA 4NI5A 4E6PA 1N5KA 3SXUB 1ED1A 4HDSA 3BQ0A 1ZMTA 4CL2A 2YX1A 4NLGA 4C3UA 4EA7A 4R3UC 5H9VA 2HWUA 1YZ6A 2GN0A 1W25A 1QH1B 2G5CA 2QORA 2V7WA 4IR9A 3H3JA 3IE0A 3QWFA 4OXKA 1X7DA 4HDMA 4LSGA 5KX5B 3C98A 1E3DA 1X77A 2R6R1 3AZOA 3KV3O 2F9MA 2ZB7A 1B74A 3TIIA 1FLVA 3ZH2A 4ZT3A 2CSUA 1GYPA 3COPA 3C45A 5E9QA 3G8CA 3IP6A 2R9VA 4W8GA 1PJAA 1I7SB 1YJ5A 4KZKA 3EDCA 1S6YA 4DZZA 3O2NA 4P33A 2JGAA 1DTWA 3IIEA 4RFSB 1BVUA 3O9VA 3DLBA 1J5XA 3RB6A 3RH4A 4I27A 4V2UA 1BPBA 3GZFA 1GSAA 3BCUA 4LGYA 2PJDA 5B2ZA 4C0AC 1SBHA 2VP3A 4TL7A 5JR3A 4CT0A 1BU5A 2QU8A 5B64A 3HB4X 1GQQA 3S1LA 2ODNA 4IH4A 1P73A 5HHIA 1R4NB 4XVUA 1CUEA 4I55B 4WPGA 3LT4A 1FVHA 3T94A 2PQ0A 4O5CA 4YCMA 4BNWA 8ICXA 2IGBA 3W5IA 4CG2A 2H48A 3ZE7A 3GFVA 3OFKA 3WRYC 3GLGA 2CXSA 3L7CA 3OETA 1KH2A 3P7MA 5TLSA 2AZTA 2R4UA 1CP2A 2X4GA 4N54A 4TLMB 1H8ED 3PR2B 4GI3A 2O8CB 4PCVA 1FQKA 7ICLA 5CA1F 2FETA 1AKMA 4C6TB 1E2BA 3QLVC 5BR8B 1UBOS 3CH4B 3ZVLA 2QV0A 4QIWF 2PGDA 3RGGA 3R0QA 4NENA 3D64A 5KFMA 2CXPA 1I4LD 4AX4A 1OREA 4Q7LA 1XA4A 3DEFA 4B76A 3O74A 3K92A 4E2XA 3ZGZA 4X63A 3VKHA 4ZT2A 3ZWCA 3WQHA 3PQ4A 3TRIA 1R0ZA 4Q44A 1EZZA 2VWQA 5ECWA 1J33A 5DDIP 2XOXA 1SXJA 3JR3A 1B93A 5CT6A 3SFTA 3SSAA 2EOAA 5F3XB 1AV7A 1TB4A 1WRBA 2JZNA 2NYRA 3DEHA 3LZCA 2HWYA 1VA4A 4BWJA 3MMZA 3DULA 3GFFA 3UFBA 3RVSA 2ZJZA 3H13A 5KMGA 2LGJA 1E9AA 4TL6A 1WD5A 2OLJA 5IJWA 3ZY6A 2A3NA 4RYLA 4C89A 3QE0A 2C7GA 1FJ2A 1W35A 3QYFA 4WKPA 5G0VA 1Z6AA 3HQ4O 1V47A 2C0QA 2P4EA 4Q1AA 1ORHA 4JI1B 1GUYA 2B94A 1YB4A 4BFWA 4DSNA 3X43A 4YUAA 1FXWA 1QCDA 2PAFA 2MUTA 1J2TA 1NRXA 2HA3A 2J5BA 2XA9A 3DHEA 1W5TA 3EODA 1EMDA 3GEBA 4X8MA 4KHPB 2HPVA 5L4NA 1OBVA 4RPIA 4MKXA 4YECA 3A2MA 4BNFA 4DCPA 1WQ1R 1ZN7A 1OSNA 2IYYA 2OV1A 1CUFA 2XWBF 2ZREA 3AF5A 4MAAA 4D3SA 4EUFA 2ZKLA 5B1EA 3OJCA 1P3JA 3FJYA 3I45A 2KZZA 1VMDA 3CW8X 1JJIA 3K0AB 4MPDA 2GTPA 4QUIA 5JVDF 3VA7A 1D2AA 3H75A 3J81A 2O8DA 3H11A 4MVJA 2IZ5A 3OA0A 2JFWA 4KAJA 5IAAA 1SZCA 3BGDA 4WZAE 1ZLXA 3WGHA 5K0CA 1HT1E 4AWBA 1AMNA 2D1TA