4EENA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords Beta-phosphoglucomutase-related protein
total genus 82
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eenA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eenA01
5ALKA 5AW5A 1N9KA 1Z5GA 4RETA 3AR3A 3ET4A 1IWOA 4NAVA 3M1YA 5ALIA 3K1ZA 2YY6A 3SF0A 1RLMA 4EZEA 4UMDA 2I6XA 3ZVMA 2YBDA 3ZU6A 5AKEA 3RFUA 2MU2A 3ZX5A 4G63A 1QH9A 5ALDA 4XE5A 2WHEA 4EELA 2PQ0A 3UMBA 2FDRA 2B1RA 3BA6A 4HGQA 1Z4QA 1VFPA 1YMQA 4H1WA 3QUTA 4BEWA 1EK2A 3QXGA 5AI8A 2FPUA 3N1UA 1CQZA 1Q91A 2HX1A 1RMYA 2BDUA 4L6CA 2OA0A 1RDFA 1Z4MA 5A3RA 3U7FB 4RESA 1VJRA 2FUEA 3PCTA 1Z4NA 2EARA 3L0CA 2MSNA 3OTQA 4F71A 3OCZA 1RLOA 2HI0A 4ZEVA 4UMEA 1XVIA 4UU1A 2FPRA 2CFSA 3ET5A 3EF0A 1RMQA 4IFTA 2JAWA 3QU7A 3PGVA 1L8OA 5ALVA 4UAUA 4YIHA 3L1VA 5ALSA 2I54A 4B6JA 5ALNA 4NABA 5AM1A 1RKQA 2YMLA 3WK8A 3L8HA 3N5KA 2YMQA 3VAYA 3S6JA 3TLMA 4AP9A 3NRJA 1XPJA 3A1DA 4G9BA 3CNHA 4YCMA 3EWIA 3WK4A 1L7MA 3ZVLA 3QYPA 1VJ5A 3WKCA 2YMPA 1PW5A 3RF6A 3U19A 3HLTA 1NNLA 1QQ6A 5AVSA 4BX0A 4UARA 1U2SA 3KD3A 3L8EA 4L6AA 5AW6A 2NO4A 5ALPA 4XPZA 2CFRA 1YDFA 3ONNA 4HAIA 3WKEA 4C4TA 3CZ4A 1ZRMA 4C4SA 4CF3A 4OHFA 3ZWDA 3FPSA 4UM5A 2B8JA 2P27A 2WF7A 2YJ3A 5AI9A 5AW8A 2C4NA 4HGNA 3FGOA 3B9RA 4XOUA 4BX3A 3U7EB 3MPOA 4Y2TA 3QU5A 5AICA 4XQ0A 2D2VA 3U13A 3E58A 5AKXA 3E8MA 3E84A 4CF5A 1XP5A 2FEAA 5FP0A 4CE6A 5AK4A 3L5KA 5ALGA 2HSZA 4BBJA 5ALXA 2G06A 4FE3A 4OFZA 5AVUA 3NASA 5AI4A 3E81A 4FFDA 1J97A 4EX7A 4DFDA 1Z4KA 4EX6A 1TA0A 2W43A 5ALYA 2GMWA 1ZD5A 2G08A 3L1UA 3WGUA 2C88A 2R8XA 3QU2A 2GO7A 2CFTA 4C4RA 3WKDA 4DWOA 2P9JA 3A1CA 5ALEA 3ZTWA 3ZWKA 1NRWA 4UATA 5AKYA 5AVRA 1ZOLA 3B9BA 4UMFA 2AUTA 2Q4RA 3QUCA 2G07A 2P69A 2PR7A 3L8GA 4JDPA 4QQFA 3F9RA 3ED5A 4Y2SA 1U2TA 1L7NA 3QGMA 2FPXA 3EF1A 4YGYA 5ALUA 5AM5A 1J8DA 2OBBA 4ZEWA 1FEZA 1RMTA 3ESQA 4IG4A 1Z5UA 1WZCA 3NALA 2FI1A 2GFHA 3M9LA 4EEKA 5AM4A 3UMCA 4OD0A 3DAOA 4HGRA 3NIWA 3W5CA 2B82A 2B30A 1LVHA 5AW9A 4J03A 2I34A 4BNDA 3P96A 3SHQA 2FUCA 1YV9A 1Y8AA 1AQ6A 3A1EA 1RKVA 2HCFA 2WF5A 3UMGA 2C8LA 1SU4A 1N8NA 3R9KA 1KYTA 4AS2A 2IYEA 3GYGA 3OCXA 3AR6A 4UMVA 2IOFK 3I76A 2CN1A 3SKYA 5AVVA 2JGAA 3PDWA 2G0AA 5ALQA 3U7GA 2YJ5A 3IRUA 3AR2A 5AI6A 2RBKA 2NO5A 1L6RA 4YIKA 3WK7A 2B1QA 1X42A 5IS2A 1O08A 4E88A 4HYTA 4GIBA 1TJ5A 4UM7A 3QU4A 3EPRA 1WPGA 4KNVA 3MN1A 2WF6A 3FM9A 2WFAA 5AI0A 4NV0A 3SLRA 4UW9A 3AR8A 2ZXEA 2EATA 4KX3A 2I55A 2HDOA 3AR7A 1TE2A 5ALHA 3ZTYA 5AVTA 3I1YA 5AK3A 1TJ4A 1YJ5A 2B8EA 2O9JA 4YCLA 1U02A 2IA5A 3W5AA 2EAUA 1QQ5A 1L8LA 3ZVNA 1Z88A 3D6JA 5AW3A 1RPZA 1QQ7A 4AS3A 1RKUA 2RB5A 1O03A 5ALOA 1ZD2P 2RAVA 3I6BA 1K1EA 1Z4LA 3KDPA 2ZBDA 2BY4A 1Z4JA 1T5TA 2AMYA 3WK6A 4GXTA 3N07A 2QLTA 5AKKA 4J2TA 2B0CA 4CNQA 2W11A 5AM3A 5AVWA 4KX5A 4NWIA 2JARA 3WKBA 5AKGA 4L57A 3AR4A 2IOFA 3QUBA 1Q92A 3BWVA 4UASA 1QYIA 1ZD3A 4BKMA 3AR9A 2WM8A 2P11A 5AHXA 1ZJJA 4MWOA 3N28A 1SWVA 5E0OA 3WK9A 3OCYA 2G1AA 4Y2PA 3SMVA 5ALJA 4OCZA 4Y2VA 3ZI4A 2I7DA 4NFLA 5AVXA 3DDHA 2QYHA 1MH9A 3WK5A 4KNWA 3FPBA 1Z4OA 3FVVA 1L7PA 4UU0A 5AKJA 4F72A 3OCVA 3ZX4A 3WGVA 2YMMA 1ZD4A 1RQNA 1ZS9A 4BYGA 1JUDA 2WF9A 5AVQA 2OYCA 1YNSA 4I9GA 3QX7A 3OPXA 3NAMA 3OCUA 4BX2A 3MMZA 2YFYA 2BDEA 3I28A 5AK5A 3DV9A 3A3YA 4JB3A 3QNMA 1EK1A 3AR5A 2FPSA 3OCWA 3W5DA 1YS9A 3R09A 5JJBA 5ALMA 4I9FA 2GHTA 2PKEA 5IT0A 1ZRNA 2AH5A 3L0BA 1T5SA 3IB6A 2JAUA 5ALLA 5A3QA 1U7OA 1CR6A 3QU9A 3SD7A 2RARA 4Y3UA 4EENA 5AW2A 1F5SA 5AIBA 1WR8A 4Y2JA 5IT4A 4Y2YA 4BNDB 3DNPA 3N8GA 1S8OA 2MU1A 4Y2XA 4DW8A 4HGPA 2FPWA 5ALRA 2HOQA 2WF8A 2NYVA 1TJ3A 5AI5A 2AGVA 1T9ZA 3ESRA 5A3SA 4DCCA 5ALZA 5AW7A 5AKIA 1RQLA 4Y2UA 3IJ5A 2Q4TA 1RRCA 2YJ4A 3J7TA 2DQSA 2R8ZA 2ZBGA 3L7YA 3L0YA 1LTQA 4Y2RA 2JAOA 4ZEXA 4Y2QA 2ODAA 3ZW7A 5AW0A 2VKQA 1SWWA 2X4DA 5AKZA 2G80A 5AIAA 5AESA 2YJ6A 3NUQA 2R8EA 4HGOA 3B8EA 3UM9A 2HF2A 2IOHA 5ALWA 1WVIA 2I33A 3PGLA 3U26A 2Q5EA 2HO4A 1RC8A 1NF2A 4PNHA 2HEGA 4FYPA 2YN4A 3MC1A 2W4MA 2ZBEA 4KYTA 2GHQA 2ZOSA 2C8KA 2HHLA 3U7HB 1Z4PX 1S2OA 3FZQA 5AVYA 4YCNA 2G09A 5AW1A 3KC2A 1L7OA 1Z4IA 3HYCA 4UAVA 3QLEA 2ZG6A 3KZXA 2C9MA 5AKLA 3ZUPA 5AK6A 2R8YA 3KBBA 1RLTA 2HF7A 3QUQA 4QJBA 3R4CA 5AW4A 2OM6A 4YH1A 4BEVA 3KOOA 5ALTA 3L8FA 5AVZA 5ALFA 4MUMA 5T41A 3WKAA 2ZBFA 4CF4A 5AKHA 5AM2A 4KN8A 3NANA 1U7PA 3W5BA 5AM0A 3SKXA 2O2XA 4O8CA
chains in the Genus database with same CATH superfamily
3GLHA 5FNZA 3V8NA 1EHIA 1K88A 3IVGA 4KJZA 3RK4A 2ANCA 4OBWA 2GR9A 4EH1A 1OH5A 1OROA 2P1DA 1LDNA 5DKFA 4OHWA 5IBPA 3MFYA 3KQPA 5I7SA 1WX1A 5IWAB 1UXGA 2Q3LA 1Q46A 3BJIC 3ET4A 3EG9A 2HRDA 2PRKA 4YQYA 2WE7A 3T9FA 1HKHA 1YZ7A 5L1IA 3HCPA 2SKCA 1G8SA 4P4GA 3VU0A 3RYHB 3X3HA 3BXEA 1FQWA 1MJGM 1N2BA 1DE0A 1RAAA 3BS4A 4BV9A 3KZMA 3ZEAA 4KPFC 5L9AA 4HQ0A 1Z37A 4I9NA 3VVCA 5G0WA 4P58A 3NI2A 3OHPA 1GN9A 5KAMA 4PHFA 4XB1A 2H5LA 5HF8A 3UQZA 4JEHA 3MOSA 2I5HA 2DZDA 1OIVA 4GFDA 3VR0A 1RQXA 1EFHA 4OOFA 4WZZA 2CFIA 1P1RA 3KG2A 1RZ3A 3PUHA 4XCVA 5HF9A 1EVLA 2D5CA 2KV2A 4JLUA 4OEHA 4XFDA 4A9AA 1YVPA 4ZU1X 5KYVA 1LBEA 1RFLA 1UIRA 2FMSA 8ICJA 1AS0A 1XTIA 2DSNA 2GEFA 2I8AA 2R1TA 3DEJA 4R40A 5EXDA 1M8FA 1J4AA 4UTNA 2XTMA 4MR8B 1EI9A 4W9MC 3C7DB 1JEEA 1LPPA 1ZQ1A 3F6EX 4AJ4A 4EOGA 2NOAA 2OXRA 2ZROA 1JJAA 3L04A 3MZ0A 3QXGA 4JIMA 4PG7A 5D01A 3RYIB 4DCGA 3CNBA 1KE1A 5IASA 2P3SA 2QRJA 1FNCA 1XNRB 3CF4G 4GQBA 3OIUA 1XQVA 3I2HA 2O4UX 1L4HA 2H4HA 3HA3A 1SUBA 1VDZA 2O6HA 2OSBA 5BNWA 3X44A 4BFWA 2NZ8A 5E6RB 3DJYA 5C52B 3OSNA 1QJ4A 2EARA 2J3QA 3P4UA 4J3JA 1U3FA 3O0TA 3PBKA 1DKPA 2E1RA 4KIJA 2NM0A 3HABA 3PQ4A 4UVHA 2H3ZA 1U0OC 4MLCA 5FNVF 3KKNA 1HZZC 3DDSA 4L8FA 1VHQA 2IYQA 5F12A 2YINC 1SPBS 3HZRA 3COWA 5JCZA 1RYFA 3I9NA 3I39X 2I7VA 4YMVA 4USAA 3T95A 3TNYA 1Z12A 2EP8A 3U7IA 4MDEA 4XSVA 3BS5A 3DD5A 1RZUA 5CVJA 4NU8X 1QV7A 2AVNA 2RI0A 2ZYUX 1CHNA 1J0DA 1V3TA 2HU2A 2QF7A 4KQKA 4FLFA 1MRNA 4MRPA 2Q0XA 3OPYB 3SXUA 4C06A 3HDYA 3ZY4A 1W48A 8ICPA 3N5KA 1P1HA 3E53A 4ZXFA 3ESYA 3PD0A 4INOA 4D9KA 2EQ5A 2DY1A 3FROA 3M2TA 4LJ9A 1VDMA 4P82A 3TLMA 5I3CA 1H4QA 3PSIA 4K6FA 4C4OA 2XADA 3NTUA 4U7JA 1VLMA 3DCYA 1FUIA 1KORA 3GLTA 1L7MA 3KB1A 3G0CA 2HVHA 1IEWA 1LX6A 3TYXA 2WNSA 4BP1A 2GH1A 2QXTA 4ZCLA 2ILVA 1PYDA 2XE8A 4PEVA 1D2RA 3E61A 2PQ2A 1T1EA 5EVCA 4TN1A 1A1VA 2HO5A 4UQOA 1RJ9B 3F7OA 3OJCA 1X94A 2A3NA 4WZBB 3BIFA 3UMMA 4XA8A 2IYTA 1XDWA 2C59A 2EKDA 3K35A 4WXYB 3HEAA 2DUYA 1R6TA 2QMHA 4LVUA 4EG3A 4JMUA 3F5EA 4HL6A 13PKA 1L8AA 1RADA 221PA 1VMIA 2CJYA 3OMXA 3QJ5A 4GR5A 4RHEA 5KI6A 2JFPA 3G0IA 1SPXA 4MYUA 2PUAA 2QUAA 1VHWA 5DCLA 3HVJA 2OCPA 3DBRA 4QVKA 5IULC 1XZDA 2EZZA 4UB3A 2ZIWB 1D6JA 2ANBA 2WJ4A 3OEHA 4MRVA 3HO1A 1T6NA 2FX3A 3KUDA 1Z38A 2HOIA 4C7JA 2RCNA 1FY2A 2RGBA 3HCNA 2Q9BA 3EDOA 1BE6A 4G1BA 4RY9A 3ZE0B 1U2GA 2OYSA 2RJ3A 2C7VA 4NX2A 4WOCA 1CEYA 2R7MA 2AGOA 1MLDA 2ZS8A 4BV3A 4YV0A 4RTKA 1HNNA 3HM2A 3V3KA 5I5EA 4L7QA 2OGSA 3GN2A 5KG0A 4ZRMA 3FNEA 5LXTF 5JSYA 1UZAA 2O2ZA 2Z2YA 1WXWA 4OFZA 1SVNA 4XM1A 4FGZA 1NV8A 4DA4A 2QRMA 4BBAA 4IY1A 3V6LA 4DOAA 2QTGA 2XXAB 1U7WA 4WDRA 4WOBA 4IQGA 3UUWA 3MYRA 4D98A 1VKHA 2D1FA 4W1SA 1XMOB 1I2BA 4CR7A 1JWBB 1F8GA 1ODKA 4BNNA 2O6KA 1EA7A 3Q3HA 1OIWA 1TMKA 3QLTA 4HTAA 2NXNA 5I8WA 3NVKI 2H65A 3C3XA 3L43A 4HDRA 4EJ0A 2RFLA 2GWRA 2QA5A 2QN1A 4PY2A 3STWA 4EA8A 1IJFA 1VJTA 2O2GA 5DBEX 4EG8A 1T5HX 4L4UA 4DR7B 4KGVA 4IZOA 3V7WA 1MQSA 2A9FA 2R6GA 2VRCA 1HWYA 4PR0A 4EKNB 4TMZA 4F3KA 4N41A 5JXIA 3ENZA 4G4IA 4PRZA 4QX6A 1T0IA 4PAQA 4YVFA 1CW2B 1MEJA 5DP2A 1N2OA 3NVZA 4KUGA 2X7JA 4G07A 3H1TA 4RQ7A 5GJCA 2IZ1A 1XX6A 2Q7OE 1U0TA 3G5TA 3M6LA 1EYZA 1QX4A 4PAWA 5FBWB 3O8RA 3OTIA 1E9EA 3BXXA 2FZCA 3CUTA 4AKSA 3TXXA 4F06A 5FUWA 4XX1A 2JIZA 4IUDS 4ER3A 5KKNB 1W36B 1J20A 3RREA 1Y1TA 4DV2B 3EXEB 4A2QA 2DB3A 3E18A 5DM1A 2QP4A 4W6QA 2O8NA 3EEIA 3EXIA 4EGJA 1II8B 3NVVA 1JHDA 4QWBA 3IX7A 3W8FA 1BXRA 4HZUB 4GXNA 4PO9A 3I4LA 5BQXA 3L2OB 3RT1A 3I8SA 2W9CA 4B82A 1NI4A 5B5SA 4FZRA 3M6FA 4IO1A 5IC5A 2ASEA 4ODIA 2VIIA 3FMPB 1DBIA 1C30A 2B5WA 3RB4A 3HGMA 2EYQA 4L3VA 5E4JA 3FMGA 1LUAA 1NPTO 1SA0A 2P9GA 3BVPA 2GCIA 5GJVC 3W2GA 3BSSA 2A3RA 4XARA 1GPMA 1AGNA 5JPIA 1MX3A 2Q6VA 4NDAA 2WK1A 1SL1A 5E4YA 5TF4A 4WVLA 3WVNA 2F62A 4RQNA 1H8HD 1PZNA 4FFBA 3M49A 3N2IA 3GFKB 2P67A 1N7IA 3EGOA 4N12A 4HAXA 3U48A 2DLCX 3EVGA 4KNYA 4GG1A 2O8CA 2HCFA 4B1FA 1SU4A 2ASVA 3GMSA 3BERA 4AMBA 1DXYA 3KQNA 2ZUVA 4DG9A 5DLYA 2QV7A 1UHUA 2EBHX 4OYLA 4CJXA 3OLXA 1FZQA 3L8ZA 1VCNA 1UT8A 4KLZA 3C3MA 2GRAA 4ES6A 1ZXIA 1X80A 1K27A 4OBEA 4QDJA 5DULA 2PX5A 1E4OA 1DDIA 3H2GA 3V97A 1NF3A 3OQVA 5DI3A 3ZU3A 2VBGA 2QN2A 1G5FA 1HLDA 1NNUA 2V55B 2NRVA 1TX4B 3LUPA 5FTKA 4JI7B 4GU5A 4MDFA 2W98A 3V1MA 3QG5A 5L9XA 3V46A 4IR1A 3GAMA 3D81A 4YIKA 1P62B 2FLLA 1RVV1 2B1QA 3O8OA 4O2RA 4WBNA 3TQQA 3G2QA 4CPDA 3NVAA 2RGXA 3GMIA 5EA2A 1GGEA 3NWPA 3M6UA 4PL1A 3G8AA 4FUQA 2KJQA 1PT9A 2AJBA 1LZKA 1SG6A 2XVAA 3Q2KA 1MB2A 1WF6A 2OR3A 4P33A 2PS0A 1U98A 3FTFA 1HQDA 2IHMA 5EKTA 5KCMA 1R2QA 2HRZA 2WHRA 4PHPA 2ZVQX 3OURA 3SN6A 3UTDA 3GDFA 4ED1A 1SZHA 1QUEA 2DWPA 2WJAA 2WAQC 2ZZKA 4RPZA 4G23A 3EZ9A 5G1OA 4NV0A 1LI4A 1J42A 2PFSA 3LIPA 4OMCA 1BCSB 3SAGA 3BB1A 2HBLA 3HGQA 3N0XA 1V4BA 1P91A 1T0UA 2EATA 3W9SA 1AN0A 4G0UA 4DY4A 4MDYA 4CIYA 1XS9D 1NMXA 2Q2NA 2RGWA 1P1JA 3I9KA 3MMPA 2JK1A 3RJZA 4QWWA 3LP5A 3K5PA 4GC7A 1PTKA 1A8QA 1D6SA 1TVKA 4FE4A 4QG3A 1XJCA 1D5WA 1QQ5A 2YWHA 1OOEA 3W5AA 1YOBA 4WOKA 4ND8B 4F2GA 5LQJA 4QUKA 5GONB 1AZLA 3NBKA 1ZSVA 3GD5A 4DJTA 1ZQTA 1NJ5A 1XQ9A 1ZOOA 2RHJA 1NT2A 4FD3A 4MUGA 1D4ZA 1RM5A 2PZMA 1YZNA 5DOVA 2FZLA 2YQ4A 3VX4A 1X8XA 2WFLA 3WMXA 2JR5A 3ETDA 1KK1A 2G28A 2OV2A 3I6BA 3LYLA 4F8JA 3UFXA 1ZN9A 1JHZA 4KKXB 4XFKA 3ISDA 1XO1A 4YWHA 4E3ZA 5CM8B 3K1RB 3CF2A 5LZ9A 3UKOA 5G41A 2HM7A 1UPXA 3AM5A 2QRVA 1KFDA 4RPYA 3W2EA 4AY6A 1WW2A 1X1EA 3EJ6A 4OSOA 1FB5A 4PNPA 1MW9X 4C43A 2EZXA 1U4OA 1DMRA 2MYUA 2O2YA 3HKDA 3L0PA 1UKZA 1RWOA 5FI0B 4B3FX 4CTOA 2PD3A 4YP6A 4ALMA 1HR0B 3BWVA 3ECSA 1T5DX 1VKRA 3IODA 3TIVA 2XLCA 2KZ3A 5EWGA 1E2IA 1QYIA 2GCOB 2L2QA 2WD9A 1I5EA 1GL7A 2Q3BA 2VP0A 3F6BX 4IZIA 4NE2A 3GP8A 4DC9A 3FOFC 1JAHA 2ZSAA 1GAEO 3FBWA 1W5EA 2QTMA 1OWMA 3BTOA 3II6X 1ODFA 5LB2A 2ONJA 1UBLS 1P72A 1JLMA 1NRXA 3VC3A 5E0OA 4CMBA 2A59A 1NMYA 1TK3A 1O6ZA 1VP3A 1A77A 1DADA 1P3Y1 1IQ0A 1CQIB 1QIJA 1Q44A 4OYYA 4D3FA 4F2WA 4DLZA 4JT4A 1H4SA 4H1TA 1XLWA 1J0EA 1H5UA 1XEWY 3H3JA 1GCOA 3NTLA 1QVAA 4NBWA 4Q9JA 3VZCA 5GVSA 3U60B 1MKYA 2BHRA 1P18A 3KQKA 2BEUA 3ZS8A 2PU7A 4DTIA 2CCKA 3PE6A 2C2EA 2ROQA 4HDNB 1FIQA 3NGDA 4IIYA 3S8EA 3KVRA 8ICXA 3TSOA 2WKPA 4F5DA 1RYMA 3OPQA 1WZIA 5H80A 5K0TA 3HCFA 4MW6A 3SKVA 1M10A 2ZSFA 4PX3A 2K89A 3GZNB 3SX4A 5FHQA 4WESA 5C1PA 1NK9A 3F49S 2PX0A 4NCKA 3IKTA 3MLBA 2HT1A 4AO6A 2O3SA 4ZVTA 2P6OA 1EXWA 3B3AA 4RIIA 3G0HA 3O1IC 2REQA 3P32A 1H6CA 1ZCAA 4IQ8A 4NM1A 1USVA 2Y4OA 5AK5A 3FF4A 4DF8A 1CF9A 3PFGA 4EBCA 2VT6A 4FEYA 2BCVA 1I4OA 3PSHA 3NVWA 5CXUA 3IDSA 4HS4A 3KHTA 2L0XA 3HR7A 1JBKA 1JEJA 3AYZB 2H2GA 5ALMA 2E6UX 4C3VA 4EG5A 4MHTA 2QMEA 2X0IA 4C0BA 1IHDA 3ZHYA 4ZREA 1PVVA 1F4LA 2YVKA 4ECUA 3REFA 5F3DA 3E27A 1V5IA 1GNVA 1RBYA 4UAZA 2O2DA 3A9RA 3SYNA 3L7AA 3RAJA 3V2UA 2FJ6A 2IBTA 4JK3A 2F48A 3PR3A 1BMQA 4AJ9A 4JXZA 1U0FA 3CN9A 2C4WA 2C5BA 3ITEA 3WB0A 4L8LA 3UAOA 1NHGA 2Y67A 1YZHA 4MUAA 5EC8A 1MB0A 2VRBA 1YB7A 3T4PA 2C9OA 1TYBE 4V0OA 1MOQA 1U8YA 1JT2A 3FR8A 1IYZA 2E89A 4KGZA 4EYEA 3HKCB 4DSOA 1YL7A 2WUFA 2QHXA 2I03A 2C99A 3MINB 1O9HA 1L5UA 4DCCA 4HYEA 4URYR 4O5CA 3IP4B 1ZCFA 1B0PA 1KVSA 4HADA 4KP7A 5B7QA 1C9MA 4OXQA 3KZNA 3NHUA 1EG2A 4J2HA 2R8ZA 2HHXA 4J0JA 5K6TA 5LQCA 3ZWAA 5LDDC 4AF8A 4IH4A 3MOIA 2A4KA 2HA0A 3NDJA 3KXLA 3T0IA 5KCZA 2VL7A 1C3EA 3H5WA 4KODA 1T1IA 2QZZA 1N1DA 2HH9A 1KZ6A 1UPTA 2YXLA 5ECDA 2ZE5A 4I2FA 3D5QA 4XGQA 1HF3A 3EWNA 1SRQA 2D7CA 3D0OA 3DP7A 3R7LA 5F2OA 3K0BA 4F3NA 2BJWA 3NW9A 5BURA 1SKQA 4EHJA 3B8EA 3S99A 3O8QA 3WIDA 2IOHA 1U0RA 3DKKA 1L3UA 1AVTA 3DDCA 3KJGA 3PS9A 3LVWA 3TO5A 2IF0A 1E0JA 1Z34A 3V8VA 1IC6A 2AOTA 3DE3X 2Z04A 1NXXA 4U8HA 5D1NA 2AI3A 4GPEA 3U49A 4AMUA 1UBKS 3CZ9A 4CEHA 3SI8A 1B2LA 2QYSA 3O4HA 2GEKA 1XZKA 1WXFA 1V9PA 4Q1DA 1ETHA 1MHTA 4CEJB 4KIWA 2B2NA 4DMHA 2C8KA 2IQIA 4QXQA 1WDWB 3NKFA 3F7NA 3CXUA 5JXHA 3FZQA 4YPOA 1ZQ9A 3ZKAA 2D8AA 3IIEA 4KN9S 4OUDA 1OWLA 2NU9B 4NS4A 2IFTA 1FLDA 1SHUX 1Z16A 4HEQA 4TLLB 5T64A 4BJ3A 1MO2A 3KKQA 1H0SA 1Q1GA 1G8GA 5FOWA 2VEDA 3IHKA 3PHBE 4TXHA 3GIDA 4QO8A 3GFOA 1T5IA 3UEOA 5HQ3A 1WOYA 1PBNA 2CVFA 5F64A 1NMEA 3BFXA 4W1PA 5EIFA 2W9MA 2FR8C 2WVJA 3UUEA 4AZWA 2HXYA 1IBSA 3DO6A 3LGSA 1R9NA 3KKOA 5IBQA 5IVPA 3A6LA 3PFBA 4Y2GA 3RRGA 1PR0A 3Q6MA 5F21A 1UMCB 1ZQOA 2IU4A 5GZ6A 4AWAA 5EHIA 4OO1J 5ALTA 2Q3EA 3MBKA 4OXRA 3ASVA 1ADCA 1I33A 3IUEA 4KR2A 4M0AA 2VJQA 2PNFA 5KVCA 3ROPA 2J3EA 1F14A 2G04A 1BQ3A 1N6RA 2PZLA 1KAQA 3D3WB 3FKSA 2QX4A 1KPIA 1RQRA 5KT2A 4MS3B 5BMVF 3MABA 1FMJA 3CUYA 3UAZA 5KVAA 2WG0A 3MCAA 4K9KA 4M9LA 1YI1A 5I7AA 2OFFA 1GCGA 2H2FA 1J8VA 1O95C 4EPTA 4P6VF 1K1QA 1IXRA 1SQ6A 3OFNA 2CLDX 2KSOB 4PS0A 4UBKA 1R10A 2O57A 3TGWA 5JAUA 4ASUA 3AY0A 3WRXC 3VSDA 1GSOA 1SXHA 4ENTA 1XDZA 2XXJA 1UKCA 3OIDA 4FYIA 2HR1A 1P9OA 1UBSB 1CS0B 1ZQNA 4TUYA 3TXAA 2I7XA 1ST3A 2RGGA 2TS1A 2WB1F 2V5AA 1W4CA 3AVPA 3JW8A 4M87A 2JEJA 2XWPA 3CGGA 1EQ2A 4EYOA 4AXBA 1IMOA 1UBNA 2HQOA 4JKOA 1K89A 4QDZA 2BYTA 1KJ8A 2I6XA 2J6CA 2P2ZA 2JHPA 3ZU6A 2RHBA 5IWCA 2IXTA 4ZHQB 5K0FA 3GLGE 1P2TA 3N8NA 2ES6A 2PRZA 1BWRA 4Z9BA 3RC8A 4EELA 3ZHBA 3ER6A 5GAJA 2ISQA 4NJMB 1JLLA 2JD0A 1Z17A 2QMQA 3OFND 3BAZA 1KI4A 3DMFA 3NATA 3U3MA 4A0RA 4UREA 5KFRA 4KFRA 3FAKA 3AX6A 2AW3A 2V7BA 4M86A 3VHXA 2RGDA 5HA5A 3RTVA 3O90A 4KW7A 3OKPA 4DL6A 1COWA 1DBRA 1EK2A 4WKCA 1UXJA 1JYSA 3FCEA 3TTYA 3CRNA 4A8JC 4C0LA 1I3MA 3WRVA 4KXUA 1RMYA 2W5UA 2BDUA 4YXWD 4DSIA 4IRUB 4GW3A 5AOCA 3RIXA 4Z99A 2RI6A 1NFRA 1XYYA 3I2YX 4QFDA 1ZWLA 4NBTA 2QTLA 1U2EA 2VPYA 3NNSA 4J94A 5EPEA 1XTVA 4F8YA 3SVLA 4I9UA 5DM70 4L78A 4Y6QA 3SK0A 4ZEVA 3AHHA 1YRYE 2OWEA 2HI0A 2VCYA 5G3YA 5DGCA 4HWTA 3P1JA 2WTNA 1JU3A 4I36A 4JQCA 2V0GA 5KU7A 3JQFC 3KSDO 4EUHA 5BR7A 1OVGA 3RAPR 4GDFA 1BHO1 1KQPA 4IFTA 1JP7A 2PVSA 4ARVA 3OC0A 1XEFA 1E3TA 4URWR 3EUWA 2GGSA 2J59A 5JARA 4OBBA 4KN6A 2FZWA 5TT0A 4F04A 1LLQA 4Y0NA 5LNK6 2HWXA 3VDMA 2BFDB 1CJSA 5FDFA 3ADBA 4B6JA 2ZRNA 4HATA 3ZDAA 1A4UA 1RKQA 2R62A 3KYDB 1C1DA 4OJPA 3SAFA 1PNOA 2C61A 1J2JA 3O4IA 4JKYA 2CBXA 1T26A 4M99A 3FNBA 5KSYA 4KJXA 3E1SA 1WTAA 5DYWA 1Q19A 1U7UA 2FH5B 2XXBA 2FEWB 2A4MA 1P5ZB 4L1KA 2JLUA 2DM6A 2OENG 5J0WA 1YZGA 3UICA 1BDIA 5L95A 2JHAA 2ZIWA 4BNYA 3A32A 3L0ZA 4YCSA 5B58C 1QONA 3O84A 3UUGA 3BF8A 1AZTA 1LCIA 3EISA 2PMFA 1L4LA 4IXMA 4MRRA 3FIUA 4DJFC 5CA1B 2QNRA 2GPBA 2QD2A 3CCBA 3FH0A 4OGGA 5AW6A 1O8CA 4G8CA 2F90A 1RWNA 2E48A 9ICSA 2QL7A 3JASB 2BQUA 3JARB 4ZCRA 9ATCA 1IPEA 4Q66C 1PS0A 2GZRA 4AZ0B 4M1OA 3PKJA 5D49A 1EFVB 3CEJA 3I6IA 3H5TA 3T1YB 2FNAA 2CLFB 1AT1A 1RXSA 2DH5A 2CUTA 3IHTA 4RFSA 2Q07A 4ACAA 4BGUA 2W8LA 3H87A 1KSJA 3O9ZA 4IJKA 2C4NA 1FFEA 4HGNA 1J2EA 1JNXX 3SE7A 1K3FA 3MGVA 4ZCQA 4Q8EA 1MAWA 4BNKA 2Q7XA 4G5XA 4K6GA 4PLFA 3ZR4B 5I7WA 4F4ZA 2A57A 4FGWA 4PO8A 1Z0JA 2D0IA 4XAQA 8ICOA 3K6RA 2YXNA 3EGWA 4AF6A 1BVYF 2FF7A 2JA2A 3UKJA 4A4DA 2YJZA 5FUMA 1YONA 3ADDA 2TYSB 3S1SA 1NOJA 4LSGA 3SYKA 4DJDC 1LVUA 3WWYA 2HQRA 5ALXA 5B2EA 3OU2A 3I62A 1PS8A 3U4QB 1OW5A 5AXDA 5AI4A 2BBSA 1P8AA 3H1EA 3SJZA 1Z8FA 4URUR 2PXIA 3FOAA 3PITA 4OAPA 2H1SA 1V5EA 5DFAA 5K3OA 1FCJA 2UYHA 4MQFB 3VYRB 4DVGA 4GKBA 4BE7B 2VDQB 1HGXA 4MVWA 4ELTA 2PXHA 1NKTA 5A9SA 4GPBA 2QZ9A 3ZK9A 3QE3A 4MR7B 3EEQA 4GLXA 3ADPA 1L5SA 3MSXA 4RDXA 9ICWA 1GG5A 4C8LA 2BR5A 2XPCA 5AYVA 3RF7A 3M70A 4JYAB 2HA3A 4I1PA 3ZN2A 3IMGA 2OKCA 3HVKA 3THWB 4KBFA 4MO9A 1ESMA 4OKNA 1FMCA 3LBIA 3VR6H 1I6WA 2H3IA 1UBMS 2O05A 4S04A 2POCA 4IIBA 3K3PA 5IIOA 1YJCA 2ZWOA 1R64A 1KMHB 4KQMA 3MJSA 3OLZA 3RBXA 2AKAB 3RASA 4KWHA 4YACA 3LZ6A 5A3JA 5KNLA 2ID9A 1D6MA 5J2JA 5E2IA 2XUIA 2YN2A 2IYUA 3DTTA 1KZ4A 2BKAA 3R7WB 2YIVX 4CIWA 4K4IA 5JZ9A 2RD2A 3PPXA 3F2BA 1OI3A 9LDBA 1BDHA 2CHVA 1T6YA 2WMNB 3VYWA 4CTJA 3KETA 2UZ1A 4D3SA 4WNYA 3L8GA 4AI6A 4QQFA 5HNKA 1VLQA 1I6LA 4Y2SA 1NN5A 1FXSA 2Q49A 3BXHA 3FPGA 2GI4A 3EF1A 4FMDF 4KGXA 4YGYA 5DSZA 2WVGA 3RS3A 1P2SA 2GHIA 4EWLA 2FPIA 4GT1A 2D59A 2H08A 4P0QB 4DL9A 3T61A 1CX9B 1WW3A 4UPEA 1EFRD 2OCIA 2CXQA 3GFQA 3T1QA 3LY7A 4K9DA 2XZTA 4F9TA 2PIDA 2E8OA 2NTNA 1N5XA 4BKRA 1E1CB 1OGIA 1AQIA 2G72A 3RBEA 1E3LA 1G21A 4G25A 1VYHA 1SVLA 3WLQA 4UBBA 1PGOA 3OOYA 2G1KA 3BD8A 3JR3A 4ZWNA 3WGHA 3AEQB 4NULA 3D6UA 4WUTA 5IHXA 5AW9A 1JJVA 1G1AA 1V25A 3VPXA 4JV0A 4ICIA 3V72A 1JKXA 4IJUA 3KZIU 4KLLA 4YP3A 4MLZA 3UJPA 5M04A 4PBTA 3VHRA 2QARB 4A2CA 4DIMA 2WTXA 2ATIA 4TV9A 4DDMA 1SVIA 1W49A 1XCOA 2VQFB 4S0XA 1RHQA 4N54A 5F33A 1I9GA 1U8FO 3JU3A 1BHSA 1K5HA 1ZOPA 2VP4A 3FJOA 3BH6A 4ALKA 5T4EA 1AGXA 2GK6A 5DDIP 3BTVA 1Y6ZA 5DN6A 2AK3A 3ULKA 5BWOA 4JEUA 4Y1RA 4LBVA 3TFOA 2JLWA 1AOXA 1A5SB 4FO6A 5EP2A 1ZVKA 2CLCX 3U7GA 1XZGA 3IAHA 3PIRA 3AR2A 4CFZA 5IJXA 6LDHA 4BBPA 3EXHB 4MWZA 5BORA 5AUPB 2AZDA 2PO7A 3ICPA 4CM9D 1T1GA 2G9RA 2PT6A 4B7ZA 3TIFA 2DR2A 1AHIA 2Z0MA 3OP4A 2ZTUA 4RZ3A 2HWUA 2QGNA 2XKAA 3AJ9A 2VG8A 3HPQA 5EP1A 4NCAA 4ENUA 4UE2A 3OOEA 3OE5A 1JG7A 3K9BA 3RU9A 3DMYA 1XSNA 3I9LA 2H48A 5LQAA 4ALNA 1XHFA 4ALIA 3GCXA 1YJBA 2J9GA 2P9FA 2BCQA 3RVLA 2BMFA 5H4HA 1FJHA 3GHHA 4BO7A 4NQRA 2YWDA 3L07A 3SEIA 3LC1O 4BCCA 3UJ7A 5FO1A 4BLWA 5H68A 1CUDA 3AB3A 3KQQA 4FQ7A 2FFJA 3I8OA 3VSBA 5L4LA 1T9GS 4O3OA 2D3DA 2X9LA 3DXFA 1SUDA 1UOOA 2P2CA 4RFLA 1EE2A 1R5JA 2CJWB 5TE9A 3VKVA 1Z3IX 3E15A 2XWBF 4KAAA 1GQFA 3L7IA 1RM6C 4KPUA 1T9DA 1W75A 5K4LA 4M1EA 3TOXA 1Y3IA 1P4HA 2GT1A 3DE5X 1RLIA 1XVTA 4QRHA 3S70A 1BWPA 1P1BA 5A62A 3MJVA 3BGVA 2QT9A 3SIPA 2Z58A 2HD4A 3B89A 2YRXA 2OZLA 4GM4A 4O2BF 3HKZF 2RG1A 4TN5A 1G3UA 4H60A 1AV6A 1JGTA 4BWFB 3O2NA 2QTCA 1A9OA 2B4TO 3CRRA 2NVUA 3KDPA 5EHGA 1NR5A 1TVMA 3TZ6A 3LVBA 2FP4B 4M8LA 4AKEA 2ZITA 3CF4A 4HX5A 5LDGA 2KSOA 4JT2A 2V1XA 3S8YA 4MW1A 1IN7A 2BKUA 2R00C 4MNTA 4BMYA 5BNZA 1WEKA 3KEFA 1K97A 4OI2A 3OJWA 1M2VB 2MMGA 2XD9A 4YMLA 1V2HE 2OWOA 3WRWA 1SXIA 3WLJA 4ROTA 1MG5A 1GD1O 1JEOA 4QC2A 3TFWA 4RTNA 1XZPA 2D2FA 3ZV7A 3FPAA 1YRWA 5B4VA 3QUBA 3UCFA 1ECFA 2GSWA 4IS3A 2IWHA 2I6UA 1PUJA 1P1KA 1ABEA 2BBWA 3HKCA 3JSXA 3KQSA 3O4RA 1EBBA 1QOPB 2H0QA 1DJMA 7MHTA 2R8PA 4MWOA 1N33B 3N28A 1UOEA 3TTXA 3DZKA 2H9YA 2AZMA 5JRDS 3ED1A 5JZOA 1T36A 2XD4A 3ANNA 5AUOB 1CDZA 4M3NA 1OASA 4DFJA 3EXG2 1PK1A 1IZ0A 3UJ6A 2FDXA 3E5NA 1DRVA 3IO5A 3RDPA 3C7AA 5IJZA 1C29B 5JD4A 2NV0A 3D3NA 2LM1A 2P6NA 1D8TA 1UMBA 1ESCA 2O3RA 4PN3A 2J0UA 5HZKA 1MX9A 3DEEA 3H2SA 3WK5A 2IVFA 5KNCH 1UXHA 4BBZA 1KDPA 1QNLA 1HLGA 4Y6PA 1ECCA 2ZXUA 4ZC8A 5EQTA 4OQFA 4F4XA 5EJIA 1V43A 3RUDA 5KQRA 3DCIA 4JJZA 4F84A 5KNBD 3PEUA 2C84A 3M6VA 3TNJA 3FAHA 1YR1A 1DAMA 3JPPA 3W6UA 1AO3A 2DKZA 2W6JD 2WZQA 3H1FA 2LKCA 2P68A 2CNBA 1IM8A 2AHOA 4P3YA 1FDSA 3IUPA 4CMKA 1U1EA 1DOHA 1L4FA 3OPXA 4QXRA 1AQUA 1DC4A 2X15A 4BXOB 3I04M 4US2R 1JIXA 4R66A 2PT9A 1DKUA 3OO0A 1MOZA 3ASUA 2BTQA 3BGSA 4JB3A 2YBEA 3CNEA 4X1YA 5EJMA 3SR3A 3V7NA 5KFNA 3OCWA 3EZXA 2FJPA 4N82A 5FUVA 1VDVA 4RNNA 2A3VA 1JE1A 5DXFA 3RG2A 4B6OA 4ATNA 2O7NA 2QE6A 4QGBA 2XVTA 3IP1A 4G4JA 5GADl 1T6XA 3PNSA 1NSTA 2A9VA 1QMPA 2FFAA 2WHQA 2HMXA 1RM3A 2VJ5A 1C2TA 2C9DA 3INGA 3JPYA 1VL1A 4D6PA 2AZXA 4WKNA 4LQ4A 5A3QA 1NVMB 1QOQB 2J6HA 3K31A 1NU6A 3QU9A 4J9OA 3EEOA 1PG2A 2OQIA 4MGHA 4XD7D 4CGYA 2FUNB 2VN8A 3ZNNA 3HXQA 1X2BA 4L7VA 1WR8A 4DR6B 2OH2A 2CE2X 4Y2YA 2C5FA 3U2QA 3ABIA 2V9WA 3D2LA 3LUFA 4ZAVA 5T7BA 4I7EA 2MSWA 2NTVA 4RQ4A 3L3BA 1E8DA 2G77B 2F6RA 3K53A 3I30X 4KV7A 4MHSA 1YI8A 1QKKA 1NYTA 2IOQA 5J2GA 2PT7A 2VSYA 1PZXA 2DQZA 2XMRA 3W79A 3SJBA 4AN0A 1NZBA 1C7IA 1TCBA 1BGWA 1DCFA 3ESRA 3O8QB 2LI6A 3OETA 4QJ3A 2GLEA 2O14A 3O8CA 4JVSB 2XB4A 2YIDA 3GFGA 2GBFA 2B5VA 3DMTA 3K8YA 3Q3GE 1ZQRA 2XOKA 3ZCVA 5JQGF 1U5BA 4IXDA 2FE4A 2OVBA 2VDKB 1TK8A 5EEHA 4AMGA 3J7AC 5DM60 3HMQA 2ZBGA 2G25A 3L0YA 2DQKA 4Y2RA 1E2LA 2FGJA 3U9SA 3U56A 1KP3A 2JIDA 2AQ8A 3HN6A 2P0YA 4U7PB 1UXIA 5EE9A 5KHAA 3ZCRA 2ISOA 1DZ3A 3CVJA 3UFXB 2VKQA 5JSHA 5C2JB 3IV9A 3HNOA 4DWWA 3MF4A 1FRQA 5ANRB 2H5XA 4Z5XA 4HVAA 3GRKA 5IZCC 2RAPA 5BNTA 1MRZA 1E2GA 3QIAA 3NUQA 4JGGA 3PUXA 4BU1A 1NR7A 5KC9A 3HWX1 2ZKIA 4KYIB 5LP6A 4C5AA 5DNUA 2ZJ0A 3EYWA 2HCBA 3B5EA 4ZJZA 2I4IA 2ZEJA 4LI0A 5HIIA 3TAPA 4U7WA 2V4MA 3DWGA 1RD4A 2X0DA 5HMMA 4RKWA 3WZLA 5A71A 4U7FA 3VXKA 3KTQA 3SC2B 2A9PA 3ZKWB 3OZAA 4PR3A 4BFCA 1WB6A 2HHLA 3WLLA 1SVSA 1TD9A 2WM2A 5BPCA 4MAAA 2IYNA 1SOVA 4O4JB 5ER9A 1Z4PX 1AHNA 3RVPA 1ANKA 2KW5A 3W4KA 5C5IA 2FN8A 1CZHA 3I34X 4IGFA 1W2WB 2NUBA 5FWNA 4BDTA 2DOKA 3THSA 2GTPA 2E0IA 4TTQA 3RFFA 2XMBA 3FTEA 1U9CA 3BZWA 4L22A 4F1JA 1PT5A 2Q28A 3BH0A 4MF8A 1GLVA 9ICCA 3ZUPA 5I9LA 2I6QA 2IQ5A 5ADWA 1T3NA 1FSPA 3KBBA 1DIGA 3PC2A 3SLKA 4NHOA 4R2WA 4AL4A 3RTCA 4BNLA 1M66A 3RSOA 3FKQA 2BC9A 3C6BA 2NQ2C 4Q4HB 1T91A 1XYGA 4JCCA 4KIGA 2C07A 1GTVA 1WOMA 2X9QA 3BHMA 3CNLA 3EAQA 1P0FA 2ZBFA 5T41A 3T3MB 2WVHA 1ZSNA 4FSHA 3ZXSA 1DWOA 1JWLA 2VHWA 2OZKA 3PVSA 4NY1A 3K6SA 5IEBA 2ZB8A 3VZRA 4PGFA 3C1UA 4KR6A 4D26A 3KPWA 2JGFA 2JH3A 4QM6A 3DOJA 4CF7A 1MAAA 1THGA 1YRAA 4J9UE 5JH7F 3CW9A 4HN9A 1WWKA 1UFQA 4TUSA 1J39A 3KVNA 1Z5GA 4Q3OA 2VSFA 1WXEA 3OIWA 4Z1MA 3SQLA 2Y9PB 4L07A 3T79A 4FFBB 1Q6ZA 1X9HA 3G8BA 3NIFB 1PIWA 1BJKA 4QZCA 2E4VA 1DHRA 3U17A 5DM0A 3U9LA 4FXPA 5B3AA 3A0UA 1EGQA 3AF3A 3PXAA 5E4FA 1J2NA 5A6SB 1E2KA 5H9VA 2R1VA 4CMAA 4YHBA 1UC8A 1V1MA 2JCVA 1SXPA 3TIIA 1Q0HA 3WR5A 1I2AA 1JSXA 2GBIA 5JMTA 5A6SA 3M1AA 1BXGA 3JD1A 3LZCA 2X4GA 2IHZA 1XBTA 5KFQA 2YX1A 3IAXA 3O3NB 1Z8NA 1N63A 2BFAA 1TTTA 4BV8A 4MS1B 3C29A 1PL8A 3QX3A 4YRNA 1EJ6A 3LW8A 4KC0A 3OZUA 1O6FA 4BCDA 3BA6A 1O58A 3UT6A 1MO6A 3VSCA 5IZ4A 3E9YA 1BE8A 4U0KA 5IVHA 3OUZA 4QWDA 1JQBA 4FT2A 2OK7A 4RGQA 5EYPB 4WWHA 5TMBA 2OVFA 3Q3IA 1YTLA 2PX8A 4HWOA 4BU0A 2WB2A 1OILA 2G63A 2XCAA 3OWHA 4M7RA 2C3OA 4OJ5A 4OO3A 1JDPA 4QLAA 3RV4A 3GJ5A 4A1OA 1A7AA 1NW6A 5A06A 5KJ6A 1DUVG 1ZH0A 1HV8A 1K6JA 4FLMA 4KQ1A 4ANFA 1WZUA 3FUVA 4UBLA 3LWZA 3JZAA 3CR7A 4M83A 4JBYA 4MW9A 4OKSA 2GLUA 1NYLA 4MCJA 4DGSA 1AK9A 3ILHA 2EZ9A 2ZYSA 1N1MA 1K2WA 2VBFA 1A0PA 3F6RA 4FHFA 5EJAA 5TVGA 3TCKA 4EG4A 1XLVA 1PD1A 3MRSA 3ZE7A 4D9HA 4H7HA 4GOMD 5KFIA 3PO4A 4RKEA 1IAVA 1XKTA 2I6FA 2EFYA 4IMPA 1VHLA 2QU7A 2QVCA 5C34B 5DSTA 4AG3A 2XTJA 5FA8A 3NS7A 4BRSA 1ICEA 1K9VF 1DSSG 4J16C 3QELB 2ZSBA 1BA3A 4Q1FA 1LWNA 5FPYA 4TVKA 1LRKA 1N0VC 4QOIA 4QZVA 4UQLA 5IT5A 3ZH9B 2YV2A 4LF7B 3KXPA 5EZYF 5KMGB 2WKQA 3I73A 5IILA 2A6PA 1QDEA 2ZYTX 2M9MA 1G4HA 1SVKA 5KYYA 4FDUA 5T14A 3AMVA 3UW1A 2BFNA 4Z7OB 3EPLA 2OP1A 3IBYA 2XECA 2XMDA 2NSLA 3B3GA 3G8CA 1LLFA 1KMQA 2YZGA 1G20A 3ZGLA 4CKEA 1Q0TA 4MV9A 2QRZA 1ZK4A 2VNJA 3NAQA 4MGZR 3UV3A 4LZJA 4ZI7A 3BWBA 4HNSA 2XT6A 5K4AA 2IUUA 2DPXA 3LQ2A 1OXUA 3PLRA 4YXMA 2FLVA 3GVPA 4GL4A 2E21A 4AX8A 2PDAA 5A2GA 3KALA 3PFCA 3VTKA 3OM0A 3TZLA 3WWCA 4ZC1A 2YOFA 2YQZA 4QYWA 4Z2YA 2R00A 2C2XA 3L8EA 4PHTA 2NO4A 2ZP1A 4ZVMA 3VNBA 4B8WA 2ZWMA 3WKEA 4C4TA 3WNDA 5F9HA 1SKRA 3M9MB 3D7RA 3Q5EA 1R0BA 1PR1A 4JITA 1XAIA 4BUGA 1FDUA 2RONA 3GF4A 3PPVA 3HJHA 1L3CA 3A1VA 5F3XB 3GIIA 1NKSA 1X1SA 1N0IA 2K5UA 3LF2A 4KXXA 3WTCA 5C5DA 4R4JA 3ZBQA 1E9RA 4XEUA 4ZAXA 1ZQCA 1BHQ1 2ZUBA 4IUYA 1SKUA 2I3DA 1J2TA 1UPAA 3FDXA 1A8SA 1XK6A 5ESRA 4MGYR 4MWBA 2XYQA 3F46A 4OMUA 2O06A 3R7FA 3U3RA 3W1WA 4EFLA 3NDBB 4IMIB 2AWOA 3BQ2A 2BM1A 1KZ9A 4N3AA 4XQ0A 3U13A 4DE5A 2H8GA 1EK6A 2XH8A 3Q85A 3IUQA 4ZRDA 1P81A 1JG4A 9ICVA 1VYUA 5D3QA 3HB0A 4L8YA 5KYWA 1GV0A 4XJXA 2PX4A 4RTSA 4X64B 5AK4A 1GTG1 2IITA 2LBOA 2DT8A 3PE3A 1K4YA 1WBJB 4IVRA 4DIUA 1E61A 3SLGA 1DS6A 3CO5A 1DXQA 1RXIA 3Q6NA 2EXXA 3U1VA 5LOVA 1DQNA 3HR8A 4N0QA 3M5DA 4S1OA 2XXAA 3DHWC 3ND5A 2A88A 2D06A 1V7CA 3GFBA 4UM8B 1E59A 3CF6R 3U7JA 1DTEA 3AZOA 3FOCA 4MR9A 5G2OA 4BKUA 1T8EA 3RM3A 4X1KA 1L9KA 1E7YA 1M73E 4G1EB 3KFUF 2IYLD 4KO2S 1GPH1 1ZNWA 3VI3B 4OMFG 4BPRA 4DNOA 4PHCA 2JVKA 5TEWA 4PNEA 2O7SA 2YICA 2J4DA 3K0AB 4RWZA 1J1ZA 2AJLI 1S7CA 3CSUA 3QX9A 4WD3A 5JLJA 3L4KA 3BQ9A 1II9A 4DDWA 1ZD8A 4HLUC 1TF5A 1WD7A 3T12A 3Q0IA 1WE2A 4KYUA 5E1DA 3K0AA 4YAJA 4R9UC 1PL6A 2NU6B 4F12A 1N0WA 8LDHA 5HRCA 5GIOE 3FSGA 4C03A 2YV5A 2ERYA 2P3QA 4PX5A 4XXHA 2QXUA 4C4XA 2P2GA 1LSSA 1QLWA 5J23A 2H5EA 4HOYA 5CTJA 1OKKA 4ZQFA 4U02A 2WWHA 3D6MA 3GPBA 4JC0A 5IVDA 5JAOA 4ZDIA 1T0HB 3GDOA 1QQAA 7ICEA 1BX1A 4OJTA 1JI7A 4OXYA 3TD9A 1WJGA 1U2TA 3E1GA 1S0OA 2ODGA 1M5UA 4MRAA 2B6HA 4H15A 2Z8XA 3TSYA 2XUKA 3BPSA 4TV9B 5NULA 2R7LA 5C5JA 1U6JA 2CDNA 2FSPA 4FMDB 2ZTHA 1OTYA 2FSSA 7ICMA 2QAGC 2GZDA 4CKXA 1GR0A 1FTQA 5J4LA 1AUOA 3AF0A 3LC2O 4Q1BA 4N3GA 3R75A 2MJLA 3RJHA 5LVAA 3T7SA 2EL7A 1Q7RA 3DHYA 3F78A 3GNTA 4ZO7A 2YS7A 2MMCA 4G8JA 2OHIA 4QXMA 5K6RA 2JLAA 3G6XA 1L4KA 5B4TA 1NASA 4O9MA 1NK4A 3P96A 4J0EA 1CZOA 1GQQA 1VCMA 4YXWA 1UFRA 5K8LA 2IBSA 1NUTA 4RV9A 4K0KB 3A1EA 3KAKA 3BN3A 2YV1A 4RDHA 2I1WA 1XWWA 4NBNA 1PLKA 3GG9A 2EJWA 4O4IB 3Q41A 6REQB 4RTMA 2H1RA 3EGDA 4UHBA 3ZTTA 3AEXA 4CDNA 3NM5A 2Y1LA 3ITNA 3NS1A 1FBTA 2VVTA 3BXGA 2P4UA 1PR9A 1BIFA 1CY1A 3KB8A 3MT9A 4LMPA 4P31A 2Q3CA 2XBMA 3EMVA 1I24A 4XYLA 2OQ2A 1J00A 1ZJYA 4JAVC 2D1SA 3OESA 3PDWA 2XICA 2EH9A 1QC5B 4CQMB 2NPIA 3L1IA 5ALQA 2AMFA 3D8NA 3ZGZA 3W5VA 5IKEA 4RPGA 1L3IA 1OHHD 2Q5JA 3B6ZA 3EB9A 3IEIA 1Y98A 3PQ6A 3QEBZ 2H3EA 5JISA 4ZI7B 2N1BA 4WQMA 3T3NA 1CYDA 1L3TA 3EXHC 1S0NA 1EVJA 2HZBA 3UVEA 3V1YA 4JC4A 4E12A 1XXHA 2ZJYA 4GIBA 2ECPA 5CCDA 4UE3S 4EYSA 1VQ1A 3AIOA 3KQYA 4PGQA 1Z1BA 5DLFA 2KB0A 2XB6A 1IFXA 1O95D 3U4HA 3WIEA 3IP7A 2I91A 1CRWG 5IJWA 4LYFA 5IRCD 4ID9A 3M4NA 4LHXA 1TIKA 2O8BA 1JSLA 2E8PA 1GEEA 5E3HA 2WFAA 5L3QA 2ZB2A 3KJXA 1SIJA 1TQ8A 4XTCS 3MB5A 1I94B 1PU2A 2AUMA 4B5KA 2XVMA 3LP8A 4X7RA 3FDFA 3ZZ0A 1F3OA 1FXWA 1NG1A 1LPSA 1O9GA 2QT0A 3KHUA 4YO8A 4ZIRA 3NT2A 3N8KA 3CW8X 3K2QA 1YZYA 3OC6A 4DSKA 4DZTA 4PPGA 3TZBA 3KKAC 1VC2A 4G37A 5AVJA 3RR7A 2AI1A 2EAUA 1F20A 3DLIA 5JAPA 1QGUB 1QK3A 3MSCA 4AY2A 1L8LA 1V4VA 5IF3A 2YDXA 2ARKA 2MT9A 5BWNA 3EEBA 5JAIA 2W6ZA 3DF9A 4QXPA 2HMSA 2J9RA 4RNDB 3BJRA 3OZXA 3GG2A 1W46A 1G5RA 5CFPA 1SOAA 2N1MA 3HBFA 1CVLA 1DKQA 1FFDA 2ZRAA 3A4TA 3OBIA 4L5BA 4BQPA 3I53A 3A6GA 4OJOA 3FDZA 4KR9A 2UUBB 2RJNA 4YRGA 4HK4A 1W4AA 5HZMA 1E4EA 1U0HC 1TT5A 4ECQA 1T5TA 1ZL0A 4G89A 1JQKA 3WK6A 4B83A 3ZGVA 3GILA 4YXJA 4CYMA 3TTWA 4C7OB 4YUXA 2B0CA 1TT5B 4FWIB 1M74A 1ZHHA 5BOSB 2G17A 3MHTA 4OG2A 2DHDA 2KNJA 2NUPB 2A5YB 1NNSA 2QNIA 3KSUA 4IVNA 3X1DA 1DAEA 3TWOA 3FZGA 5FBVB 1SIBE 1PUZA 2NVUB 4YP5A 1E77A 1GQYA 2ISSD 3C5WP 1YBMA 1M8PA 4NBLA 4YEDA 4IQ4A 1MIOB 5I7RA 2OLKA 1N6OA 1QNFA 2KJ9A 3AL0B 1ZPDA 2CHEA 2WM8A 4MUIA 1WB5A 5EFZA 4AVYA 4OU5A 4OHMA 2EZ4A 3F7TA 3B9PA 1WDMA 3FTDA 3EBOA 4L9AA 4M9XA 2ZR9A 4UUOA 5A4DA 1BNPA 4MYSA 4XGNA 2LMRA 1JQAA 4NLBA 3OCYA 1W5AA 2CUNA 1KYZA 4R5HA 5T3UA 1IBCA 2JKYA 4EK9A 5KBYA 2BSQA 3LCUA 2DBRA 1KJ9A 3AL2A 4OCZA 3HE3A 1P77A 1RQ7A 2C58A 2FWBA 3E05A 2DPMA 2EF1A 1EWRA 1DFIA 5D7BA 1LC3A 3ZHRA 5AVXA 2H31A 2YNMD 1EGMB 4J9KA 2VK2A 4IOKA 5EUQB 4AY3A 4F4UA 1GKIA 1CJMA 1SD1A 1APBA 4EGSA 3AI3A 2IX9A 5JNSA 1UBRS 4YMIA 1JFSA 2GPWA 3FWNA 4UEKA 1XEAA 2REOA 4G0PA 4PLHA 3G6VA 2HT6A 1HZJA 1ZCZA 4DEXA 4EJ6A 2BI7A 1XELA 4H6VA 3O1LA 1F2UB 4KR3A 1CR2A 1ISIA 5KTSA 2XGSA 1KMMA 4X61A 1ZS9A 4ZZ1A 5JAZA 1KSHA 2X1LA 3L1KA 1KLNA 2XMSA 5C5EA 2OAP1 3KWJA 4JLWA 3SYMA 1RHMA 3AWIA 4M0DA 4N03A 2SICE 1G291 4PRYA 4DREA 1UC9A 1SKYB 4AY4A 2D6FA 4GUDA 5B7NA 2BMWA 2JAPA 3DMHA 4ICAA 2I65A 3PENA 4GRDA 3TFRA 4C8KA 4I29A 3HL0A 4Q4HA 1IY1A 2FR8A 5CHEA 5IJ9B 1DDGA 1CE8A 5JDCC 3D8UA 4HRVA 4EO7A 4NYIQ 1B7GO 3IAS1 4J0QA 2RKBA 4W5TA 4JI1B 4RVOA 4L73A 1HJPA 3ISTA 1G7TA 2O54A 1XCBA 1B26A 1TQDA 4V24A 2ATXA 4FBLA 3DB2A 3TMAA 4EYKA 4S05A 2QTTA 3WLSA 3DPSA 4R8MA 3AG6A 4H0CA 2X8LA 1J7KA 1E5QA 2XCPA 1LPNA 4CI0B 1A7UA 1XU9A 3HNPA 4RX1A 1C1XB 1A98A 4QEZA 3R3XA 1F51E 4R71A 4EENA 1AB5A 2GCEA 3C2QA 3KOYA 1QB8A 4PGAA 3RARA 2CL7X 2CMKA 4M7PA 2PL3A 1JNYA 3ZJUA 3IG8A 4M76B 3O3CA 3ISBA 5J4HA 1S6YA 3QVOA 1FP2A 1NDHA 2EX0A 4DHWA 1XZFA 4GI5A 3RPEA 3LAWA 4E5SA 2HOQA 2W6NA 5IKPA 1EDZA 2C9YA 3G17A 2WF8A 2AGVA 3C6MA 5C8YB 3F98A 4FDTA 5KFUA 2Y0BA 4MV3A 3KQOA 4FSDA 1EQUA 4LMBA 5FV7A 1M34A 1Q5PA 3RB6A 4Q24A 1G5QA 1DIRA 3ZU5A 2Y0EA 2FWIA 3N0TA 1L4NA 4X41A 2IZZA 2UVWA 5GONA 4ZEXA 2PSJA 3ABSB 1TTHA 3JQPA 4PPFA 1K6EA 2G4VA 1N2CB 1SRRA 1PJ3A 2JI7A 5EERA 5EPOA 4YP9A 5BQ5A 1B3BA 5D00A 3SQNA 5B6JA 3QV2A 3ILVA 4LFAB 1WQ3A 2EKZA 5LBTA 2ZT7A 1JB9A 2UZ0A 1DC8A 4HNQA 4LVCA 3H11B 4V0ME 5KZMB 3FNGA 3HT3A 1X1BA 4B3DA 4F7DA 4WNAA 1PG5A 5KTKA 2ZIEA 2CXSA 1ZQJA 1KYVA 2O5RA 1OAAA 3A1SA 3E22A 3O31A 3WISA 4CV3A 5F7ZA 1N56A 2H5JA 1REQA 2X22A 2VBCA 5G02A 2JIPA 2QZPA 3IAAA 5TQ2B 3RS2A 1E1KA 2VJPA 3MMSA 4TWIA 2E7ZA 2ZBEA 3HU2A 4HQNA 3T1OA 4CG0A 4F38A 1POXA 3GW8A 1FSZA 2HMUA 3HUEA 4I6EA 2QLLA 4RIGA 3SQDA 5IN4A 2LIVA 3CIFA 1ZK3A 1SH7A 2GXSA 4UVIA 4YRRA 3IVCA 4EI2A 4YCNA 3CZPA 2JFYA 4G1CA 5DASA 3N6RA 4RJIA 4RH1A 5EHZA 1WMAA 4PWZA 2R5NA 4IDCA 3V7LA 4Y2HA 1GCAA 2Q62A 4U2BA 2UUAB 3RH0A 1JHAA 4DCPA 2ZRIA 4R2KA 2NO1A 1QB7A 3F90A 4IIXA 3BMNA 1XTUA 2FWAA 3FB4A 4RGVA 2VRWA 2VWPA 3T5MA 1YHZA 4HI0E 1WUYA 2X7HA 4YTEA 3ENVA 1S7GA 3W0LB 2ZTSA 1GQSA 2IYAA 3P45A 4ZVNA 4GVLA 4PQEA 5L3SA 1JKFA 1IOLA 3I23A 4Y1EA 1SVUA 2PH5A 2UAGA 3VVBA 3O74A 1KEUA 1CY7A 2LRHA 5AM2A 5FWDA 1GAWA 2RKOA 4YV2A 3LHIA 3O95A 4PLVA 2H4JA 4Q7QA 2P0EA 2JZBB 1TZJA 4XSGA 2GYUA 2VZ0A 4N5IX 2E1PA 4URZR 5JAHA 1P0MA 2WDPA 4YFVA 1FFBA 3FNHA 4K6OA 4G2TA 3N39C 3A6HA 3ES9A 3DO8A 5GTDA 1H66A 2YB1A 1S3FA 3EAFA 4V3CA 4M47A 3OTWA 4L2IB 4J16A 4REOA 1V1JA 2GJSA 4RETA 4C29A 1S0UA 4R2IA 4KHZA 5D5HA 3RVJA 3JWHA 2WJ3A 3KHSA 3OLWA 3RUCA 4UM9D 1C1YA 2IXBA 3DULA 5LSAA 4BFXA 5B6PA 5JD5A 3GRPA 4HFJA 5EJ8A 1ZJMA 8ICVA 1W2HA 4O4LA 4G3IA 3K1ZA 2ZTDA 3AKYA 3GFRA 3NHWA 3WRYA 2OYYA 5D6NA 5NLLA 2WKRA 4PC3A 5AUNB 3A0BU 3LPNA 1XFAA 2I3ZA 2GK4A 2PCLA 3DNFA 2UYYA 2OO5C 1JV2B 2AL7A 4UDYX 1GDDA 3F4BA 5KT4A 3VGPA 4ZIRB 2IS2A 4ZT3A 4LY0A 4D25A 4Z9AA 4E2FA 1TIBA 4LY9A 3LX6A 4OJ6A 1MN6A 1O5OA 1ZQLA 2Z8YA 4OHBA 1FVOA 2Y1IA 1G20E 3QELA 4ENPA 4DR2B 1Y3CE 4LOAA 5CA0A 3ZU2A 4EF4A 1E1NA 1YMQA 1E7MA 5E79U 3NVMB 3WG9A 3A6DA 3PPWA 1XL0A 2BAGA 3UJHA 1NVDA 5EIOA 4BNJA 3D8BA 4U2CA 2IV3A 3MWKA 3A0HU 4Z6FA 3MTDA 2GPNA 2NO7A 4OH7A 3DVLA 5CDGA 2WE8A 2Z9CA 5JY1A 1OXBB 4MHVA 1PJQA 4IIDA 3ROQA 2VK4A 3GPCA 4DOCA 2XR1A 4AURA 1RAEA 5A3RA 1ESDA 2A1UA 5HOEA 7ICPA 2F7SA 2JKVA 4WXMA 4YJ3A 1T3QA 3DZFA 1HI9A 4ER6A 3WGGA 5HK9A 3L0CA 2MSNA 5LWQA 1EM6A 4M49A 1LTHR 1M0EA 4GWLA 1DK3A 3I92A 4TUPA 4XB2A 3OZGA 1GFWA 5ESXA 1T1RA 4A6XA 5JSZA 2CD7A 3C48A 4TMFA 3LDHA 1VRWA 3BG5A 2UV8A 5B5EU 4CMJA 4QUAA 1YAHA 1OLUB 1ECLA 3HHPA 5ALVA 2W7OA 4UUQA 3R6TA 3WNZA 4BMXA 2XVZA 4GX2A 2E4ZA 3G2IA 3FPFA 1KNXA 5D2CA 2H17A 5E0KB 2KG5A 3GQBA 2JKZA 2GUGA 1C0KA 2W2LA 3QKUA 4BC0A 3S6JA 2GF2A 3K0CC 2G0TA 3M8SA 3CMCO 4LGYA 1BJTA 1W9MA 1GXSB 3T4EA 1K5OA 1CRZA 3PO5A 1KEEB 1W44A 2NT4A 4YMMA 1RACA 2WNIA 2XDQA 2NSJA 2WA1A 3BIOA 3C1TA 3G85A 4L8GA 4TM8A 3UMFA 3NQ41 2FU5C 4G97A 1Z45A 3ZEIA 3ETNA 3HQ4O 2VJKA 2O0MA 4DDKA 1GPBA 1UDBA 3KPYA 1DAIA 3PNPA 3E9QA 2I7CA 2V8OA 1J22A 4F0JA 4XPZA 3GNSA 1NY6A 3PXDA 5ARDA 4AJ1A 2GXQA 5BOSA 1UWVA 2OK8A 2FP3A 1QH1A 2C0QA 1OAOC 3UA4A 3WHKA 4NK4A 4B8YA 1WDTA 3GQCA 3THVA 4G86A 4FDVA 2H4FA 1HE5A 3TPZA 4XIIA 2BFFB 4FW9A 5FTJA 2YJ3A 4MX8A 4UNQA 4EKIA 1BE0A 1IHXA 2VF8A 4WN3A 3V4VB 4BMPB 3C5FA 3FGOA 4MW7A 3B9RA 4BLRA 4CVNA 3UQYS 4ZK2A 1WHSA 1X1TA 2C3YA 3R24A 1J8QA 3IT0A 1T4BA 4JT9A 3SU8A 5CEJA 2O2EA 3O8BA 4KMMA 5BN3A 1TU3A 3E8MA 2FMQA 2UVDA 3LP6A 4LYYA 3UAGA 1OB2A 1HO3A 4RF4A 2ZI7A 2WWWA 4Q7JB 2R0QC 1VPWA 4N76A 2YOGA 2YYZA 2OBFA 3DUWA 2XCUA 4M4SA 5ALGA 1Y1SA 4HYYA 1IL0A 1ODCA 2PKCA 2V7TA 3R2JA 4IJVA 4UVGA 3SV3A 5L3RA 3RVNA 3U3XA 1VB5A 3W04A 2Q21A 1X7XA 1XQXA 3F9CA 4UTRA 3EVBA 4TMWA 3H13A 1EHCA 3JVDA 4O63O 3SVTA 3E5RA 5J2CA 4BNGA 4QO7A 4AT1A 3ABOB 1JR6A 3N6VA 2FB9A 5J2TA 2YY7A 1TCUA 4CT5A 3VYTB 4KLUA 1UPCA 1XTJA 5KQSA 3N75A 1V1RB 2GMWA 4GICA 2VNSA 1KFBB 3B70A 1XZLA 2RGYA 4PSVA 5TQ0A 1CZLA 4YLYA 5IXYA 2R4TA 3B6JA 4IOLA 4LI3X 2Y71A 3DT8A 3TINA 5JQGA 1J2YA 3WGOA 2XNKA 4YCCA 3E2PA 2DFKB 5DTMA 4CM4B 4IHJF 3HBJA 4ZI2A 3RVKA 1VPTA 3NJ4A 3UAVA 3ZPXA 3JQ7A 4M0KA 3B1ZA 5JROA 3O2SB 1RQGA 2JDIA 2VSNA 2OMKA 2I4NA 4IDHA 4QWMA 5HVNA 1SCBA 4WFQA 2E4UA 4R1TA 2IDMA 1SK8A 3ZJTA 3FW1A 2MSDB 3MQFA 1FFGA 2EJUA 2R97A 2VPXA 3LI2A 4WNCA 4XGKA 1EPUA 1U9YA 3N8IA 3MUEA 5AKYA 1F7VA 5H81A 2F59A 1BS2A 3HU5A 3H0LB 5J4VA 1E3JA 2PR7A 2WZDA 3SE0A 1SU7A 4R7TA 5T8KC 4M2YA 3CR3C 2FPXA 5COAA 4U7CA 2I62A 5LYJB 1TC2A 5JS6A 4I1VA 4ILEA 4B3JA 5CT4A 5EUCA 1T5BA 4QZAA 2VP3A 2FPPA 1ONSA 3JAKB 1Y1PA 1E6CA 3DKIA 3CHYA 4OLFA 2FXIA 4QJ4A 4WKPA 3WLPA 4EA9A 1QZTA 1QYDA 4L5IA 2JV3A 1IM2A 1G98A 2O52A 4MVJF 1ZXXA 1ZRSA 2F9MA 2W71A 2IKSA 2X9VA 1PEKE 3AY3A 3P52A 4I50B 2VIXA 2J9FA 1K7CA 1YR2A 1JN3A 1NKVA 5J2KA 2LGJA 2G4CA 3OD5A 4GI2A 1QAMA 3Q3JB 2OB1A 4PTLA 4ZOLA 3SX2A 3W3ZB 3IDAA 4ZI5A 1HEYA 4MVJE 4V2IA 1PT6A 4DSZA 3KTOA 4ND2A 4YDRA 2HIGA 2OCDA 4RIFA 3TN7A 1MAUA 1M2WA 4MRMB 4PGHA 1FYFA 2IIPA 1LI5A 3T3EA 1AQ6A 1FFVA 2EHJA 2R2AA 3AF4A 2BTEA 3KUXA 2PS9A 4XJTA 4IMJB 4ZQBA 1RJFA 2LTAA 5KQPA 4ESEA 2XCTB 4MCHA 3TECE 2Q2WA 3B2EA 3KT0A 5JNLA 1S4QA 4M38A 3BXPA 1KO7A 1WL8A 1Y8RB 3SWWA 3C6ZA 2BMVA 5C4GB 4EDFA 3D2QA 4I2AA 3Q9NA 4HDCA 5FPSA 3V55A 2GM3A 4AQYB 2RC5A 4DCMA 5F3RA 2JJQA 5E7MA 1VSVA 4A3SA 5DB8A 3L3FX 2GHRA 2NACA 2Y1WA 3U7QB 1M76A 1T2DA 1ZL2A 4QUEA 3Q6IA 2ZI6A 3S2SA 3V1UA 4LRSB 2QZ4A 1L5VA 1WPXA 3WGNA 4FDMA 1VLBA 3LM8A 1P7DA 3VKGA 1R4AA 1ZMRA 2JI4A 2JB9A 3AUKA 4E88A 1JIIA 1SBHA 1ZR2A 2P2DA 4HSGA 1Z6QA 1TJ5A 1QMGA 4OLHA 2BMEA 1PZHA 2GCGA 4X00A 3B0YA 3R0JA 3BMXA 2VUTA 3CM0A 3TI9A 1PS9A 3ZQKA 5L1JA 1NXTA 1WPGA 1ENZA 4XCXA 1RPLA 2WU3A 4KLAA 1TA9A 2QS9A 2XWJI 5CFMA 4YI5A 1ZC4A 4RHCA 1KMNA 1U0NA 4PXYA 5KVVA 4Z4IA 5HF5A 3LO8A 3KVOA 4F5QA 4JK1A 3MWLA 1PZMA 7ICQA 4NLGA 3GZ4A 4D0SA 5FH9A 5ALHA 1E32A 2NXEA 3OUUA 2J33A 2B35A 1JDVA 1OQAA 3E8SA 4H1UA 3HXLA 3SIXA 1AGPA 4IX9A 3QOXA 2XE7A 1NAHA 2PQMA 3KSBC 4BMOB 2QUKA 3JQRA 5D3ZA 3EY9A 2R8IA 1MC4A 1NATA 3BM5A 3R40A 5AW3A 4CLXA 1G7RA 1VECA 1XGKA 2OXIA 2W6IA 3WNBA 1MJ5A 4MVJD 3GDWA 4ND3A 3ZOKA 3BE5A 2XZLA 3MJCA 2GCOA 1R9JA 2JVJA 2KBEA 3ZV6A 5SYMA 4DIFA 1N61A 3PJDA 3Q7IA 5LN1A 1I32A 2IC5A 3I9JA 5IARA 3T7CA 1V7ZA 5JLAA 1ZISA 4RTJA 5JNTA 1L7AA 2OGTA 2NRWA 1VE6A 1FU8A 1I3KA 3N07A 5C8DA 1PFGA 2W2KA 2CMFA 2EYUA 4HWGA 3C8MA 4LQLA 1YCFA 1C1HA 3T7AA 3CUVA 5ARCA 4EM6A 3GP5A 5EZ5A 2HREA 4O3QA 1AKRA 2GWSA 3GLUA 3JSAA 1MA3A 5KDLA 1KL7A 2VK8A 4CETA 4Z53A 1VKNA 4IUBS 1EZ1A 1M33A 5CURA 1DAHA 3O7WA 2C2DA 3I83A 4EQ6A 2A58A 2XUQA 4Y6OA 1H85A 4PX2A 4BOYA 4LAFA 4U7DA 1D0IA 1XOIA 1XQWA 3ACDA 3D2CA 3AF2A 1FZTA 4LF8B 2AJQA 1RPNA 4H0NA 3WK9A 3CQ9A 2WB1C 2H2IA 1WB4A 1TGVA 2HJ9A 2C31A 4ROSA 3U3DA 4LE1A 3PRKE 3LBYA 2EV9A 1BXRB 3NC4A 4HZUA 1Z0ZA 4Y2VA 1ZN2A 1D1QA 1KSGA 3WLMA 3KLPX 1II8A 2C2KA 2I7DA 2YR0A 4OJKA 2HA7A 3V8BA 1XDDA 1PHRA 1AKTA 5BRNA 3L0SA 4HYKA 2JFWA 3ONVA 5CU7A 2DBZA 4K9RA 4YBZA 4QOFA 3A37A 3VKHA 4E31A 2WABA 1CUKA 1AKQA 3CUSA 2C3UA 3IC5A 1I7LA 2G6TA 3L7KA 5AD1A 2OC4A 2ZIXB 4LMRA 3LHDA 2JEZA 2UZ1B 2QTWB 4LSMA 3F71A 4GX1A 4QBHA 1PKXA 2GBGA 1JEYA 3HXMA 4XWTA 3I58A 2WNHA 1FPQA 3IERA 1IEVA 3PC3A 4GLLA 3OTGA 2PZKA 3MQ4A 3OE4A 2E37A 4MS4A 4HLQB 1A8PA 3KP1A 1JAXA 1P2VA 3D3QA 5J2UB 4RHUA 2XUHA 3JD4A 3EQ2A 4M7WA 3RUIA 4OFXA 3V7YA 2R751 5F1KA 3IAEA 4Q37A 2IYPA 2ORVA 2YFKA 2ZRLA 2IUEA 3L06A 3K1AB 3EQZA 4HDKB 1J0BA 1FYEA 4YRPA 3TSZA 1NVFA 1OLXB 2FPSA 3UGKA 4I2GA 3M9XA 4F6RA 1Z74A 3WSTA 5TJ9A 1PT8A 1VLVA 3CURA 2JLZA 1EG7A 3BD9A 4D8WA 5IT0A 3SS9X 1G17A 1IWBB 4QE3A 1L5FA 3A4MA 5JASA 4RPJA 4KCGA 5I7HA 2MRLA 1H93A 1IHOA 2PZBA 2GWHA 5ALLA 3C0KA 4CM6A 4EARA 5KSOA 4MV1A 1NQAO 4TWZA 3OU7A 4TS9A 3QLUC 1M1NA 4UVDA 3CS3A 3HB7A 2ZU0C 2ONYA 3RSZA 2P91A 5AW2A 5EMNA 5AIBA 1ACMA 2JLQA 4DS5A 3HN7A 4X6XA 5KYWB 1ENPA 2WT9A 4BO2A 3OY7A 2FQWA 5H8WA 4PZAA 1YBAA 1SA0B 3D2AA 4BFUA 3WMRA 2CNNA 1H65A 4P4OA 3D4BA 1MDFA 1TJ3A 4A0SA 4AJ2A 5KEIA 2BSAA 2OBLA 3U3KA 4AYBC 4KQJA 1D8LA 5AP9A 3WMFA 4BNFA 1E3WB 3OM9A 5AW7A 3B6IA 3C3YA 3KDSE 4X6LA 4LCBA 4LNUA 2YXEA 2VF7A 4YRFA 1KGSA 3J7TA 5L7TA 4MV0A 1KKUA 4A03A 4EMTA 4JVNA 5E4TA 1Q7BA 2JAOA 1D07A 1EHYA 5A3VA 2WAAA 1XVVA 2BQRA 1YQQA 1V8OA 4FYWA 1FF9A 4A5SA 3H4MA 4DCVA 5BW5A 4C9BA 3NIGB 5AIAA 3LXMA 3T7TA 5JJLA 4O2AF 2YJ6A 4HB0A 1C81A 2X8AA 2NU6A 2I2XB 3DOEA 4EY3A 1WCIB 4P4UA 3FDIA 2V5VA 3MBIA 1W6RA 1Z2OX 1CLEA 1HYQA 3AQ4A 3ISJA 4YA6A 2CNWD 2CSUA 2CLOB 1BRMA 3I64A 1NJFA 3K8ZA 1E79D 1R1DA 1L5LA 2ZRHA 3HPRA 1UBJS 2XA9A 1FTSA 2GHQA 1K6MA 5CK5A 3L7BA 2JGIA 1JYEA 5JSUA 2HIHA 3N97B 4BLTA 4XIGS 2PWBA 3VYUB 1BOOA 2C04A 3DL4A 1HUOA 1P7VA 4URHA 4NMMA 4C5BA 3NHJA 3N7SC 1JMKC 3RFTA 4LRTB 2V7QD 1J8FA 4F4WA 5CNJA 4Z3DA 5B57C 5MGBA 2ZPAA 3HUTA 3WO0A 4KMOB 1F8XA 3QEAZ 3NRCA 5JXWA 3ZDDA 1EX9A 5F5XA 1G8HA 3H97A 1NVGA 3EOBI 1ZM9A 3ODGA 3RABA 1RLTA 4K2AA 4V2UA 3CT4A 1P4AA 1FK8A 5KPJA 2DPLA 1WXGA 2ICAA 4KN5A 3K1YA 4U7GA 1KL9A 1LW7A 4CUKA 4TLDA 3DZCA 1PEDA 3SZ2A 1V3QE 2HA2A 1JL3A 1F0KA 1KDTA 1PDWA 3QPCA 4BIIA 1HC7A 1Q1AA 1S9FA 1EVEA 2J5RA 1U2QA 5EJ2A 2ASLA 3WTBA 1NDQA 1VYTA 2EEZA 1IG6A 3MJDA 1KAGA 4RSHA 5IINA 3DZBA 4E4TA 3MTAA 4I2IA 2LDBA 3DLTA 3PHIA 1QCZA 2UXBB 1Y5MA 5AJZA 4NYJR 1XCPA 1PJTA 3PNCA 4PSCA 5HOQA 1OH8A 3EUEA 1I80A 3JARA 2Q6TA 5EIWA 3GIWA 1DL5A 4BC1A 2B83A 3U16A 3ZS9A 1E5XA 2AF3C 2WUEA 3EIUA 2H6EA 3RSFA 5I7VA 1XD9A 1ZQMA 1I14A 3CY6A 3DUFB 3N0VA 1RAHA 4M0FA 8ICNA 3ZWPA 4B73A 5K09A 4WFKA 3FFWA 2PRYA 3C5CA 2JGNA 4OM8A 4KQ6A 1QHNA 4YMHA 3EDQA 3LHFA 5KAFU 4UPDA 1QRSA 3OIYA 3IIKA 1KEEA 2PLNA 4TUYF 3DGFC 1X87A 2FZVA 3T1HB 2EFDB 4AMYA 2EBFX 2FG7C 3Q3VA 3K2EA 3N2LA 4Q45A 1FTYA 2A1AA 1RKXA 2H63A 4QYTA 2PHZA 4DJJA 2GPJA 1G7CA 5AKEA 2J3HA 1HXHA 1B8OA 1R5BA 3JY6A 4B9MA 2ST1A 3R7DA 4G0NA 2XCLA 3TJRA 1A50B 1X77A 5CR0A 4G63A 3IIMA 2ZDQA 4L4RA 5EKDA 5CCEA 2C7QA 3NEPX 1CY8A 3WLIA 1OV4A 4JS0A 3ROKA 3C3JA 4CMCA 4TYWA 3IKVA 4M9JA 4FI3C 4XUCA 1SIOA 4K88A 4CHGA 4JV5B 4ARBA 1EWKA 4LDJA 3UC5A 2GN4A 2R8OA 3EXAA 1QCCA 4I1UA 4BP8A 1Q0RA 2PA3A 3CUWA 4GP9A 2REBA 2IV2X 3O4GA 4UVEA 1YQDA 2HJSA 3KLOA 1OJLA 1JJFA 2VOEA 4I2VA 4BFTA 1YA6A 2HBKA 1EK5A 2Q1UA 5BR1A 5ENDA 3N1UA 2FPUA 1T9CA 3KLMX 4NICA 4XDZA 5LD2C 1EAYA 2K8AA 5IVKA 4R1SA 1UBTS 3DCJA 4PWYA 3DAPA 1GUDA 4I28A 1T3HA 2X3FA 3ICCA 2WWIA 2VHEA 3WSVA 2JEFA 3M8KA 5EVJA 3FF1A 2P9HA 1JKJB 1OI4A 5JQGB 2UU9B 4UHFA 3D2SA 5F2KA 1H6AA 5EZSA 1N5KA 2GOLA 1RXWA 4DF4A 2H4WA 3HCBA 4FCVA 1GUZA 3K0SA 4LXHA 2OHJA 5CLJA 2GJ8A 3ET5A 1LEHA 3Q5GA 1V5GA 4LTNA 4U6QA 3VHXB 4R8UB 3MG9A 1Z7EA 3GOHA 3PV0A 1R18A 1HMPA 4HG2A 3PVXA 3HCAA 1RQ2A 4EMBA 2X2EA 1OSNA 2ZK7A 3A3NA 3HBNA 4RZ2A 3SF8B 3THYA 4YT5A 1FU7A 5FUYA 4ZTUB 1TQ4A 2QRQA 3DFUA 3K70C 1SN7A 4JL6A 1AN9A 1SHTX 1X86B 1ZYQA 1E6UA 5F52A 4GS5A 1FDVA 1QYXA 3B48A 3C4JA 3GLRA 1UAYA 2CK3D 3G9ZA 4PYJA 4OREX 4GLBA 1UA0A 4QNRA 5F1YA 4EHAA 2Y1XA 4FHEA 3TW8A 5A1JA 4I66A 4M9ZA 1DOZA 3RKUA 3E3AA 4ARUA 3ZCUA 2O8VA 1RC1A 3R9WA 1L7EA 3H4VA 1M83A 5HHIA 4IDEA 5IT9A 4UHDA 1JAYA 4JV2A 1OA1A 1WHSB 4E1BA 2QLMA 3AP1A 3CLHA 3ZVLA 3UAWA 3QYPA 2PANA 1BOFA 2QTVA 3F0TA 3MUNA 5TRTA 3WDMA 1UM9B 4MI3A 1XE3A 2R8GA 2AN1A 1GA1A 1WMBA 2V7PA 4Y6SA 5A5GA 1WCNA 4Q9LA 1WD5A 3DFFA 5J43A 1Y5IA 2UVVA 3DCNA 1ORIA 4YS6A 2K8CB 5JECA 1H2FA 1Z6TA 5AMXA 4PNZA 1DC7A 1UKBA 1Z00A 3TGLA 3KQUA 4FHCA 1PUIA 5SZKB 3U80A 3TADC 4M0EA 2H0AA 3FTPA 2AOUA 1TW3A 1NXWA 2BJHA 2HQSA 3PW2A 2NO6A 1VG1A 4OHFA 1F0PA 5LA6B 4ZKDA 4B9NA 3FPSA 2JD1A 2XE4A 4IDFA 1SCNE 3NIBA 1GGMA 4OAQA 1WZEA 3F3YA 2JFHA 4PYNA 4TTIA 2PMZF 1USIA 3W3AH 2DEUA 4Q9KA 4YP1A 1PEYA 3HVRA 3BE6A 4FYYA 2LYBA 1VLHA 2GBLA 4KBYA 2Q0SA 1GFSA 5HKKA 1X9MA 5JADA 4TPKA 2M2IA 1KYQA 1DINA 1Y3BE 4NP6A 3NHFA 4NFHA 4YN4A 5EXSA 4ZHSA 2Q27A 4BMCA 4CMIB 3ZHZA 5C4IA 1L3SA 4DFPA 4JP8A 1NZJA 4GSYA 5HE8A 5FP0A 1OBOA 4DLBA 4JI5B 3HK2A 3HA2A 3L5KA 2HLDA 1LKYA 2F55A 1TZBA 2WSBA 1Q12A 1VXRA 4PYOA 2FAXA 3BWMA 4E22A 2JRZA 3ZHCA 3ORHA 1IVNA 2Y0CA 1TU0A 5KQLA 2GYYA 2B36A 4FFVA 3UCXA 3B1JA 4EX7A 3H5NA 1LKYB 2QU8A 1I0IA 3C3AA 4EJSC 2XODA 2HBRA 3CPHA 2PRJA 2MHCA 2PVPA 4N8EA 4C89A 2W7TA 1SO8A 3L1UA 1TKDA 4X1YB 1N6IA 4GC5A 1RBZA 2P6UA 3KOWA 3ZDFA 3T5HA 1NVWQ 2JAXA 1C3OB 1QS0A 1QVRA 1U9IA 2YJTD 5FI1B 3SBXA 1Q83A 4C4RA 4YAIA 2IY8A 1C50A 1IN5A 1JDBB 2VAMA 2IYYA 1AKMA 1EBUA 5DG8A 1L9XA 1IHYA 4PO3X 3K5WA 3HY6A 5CDFE 1JQEA 3A4NA 5ITSA 1E3DA 4HRXA 1V35A 1OXSC 4K26A 2ZRDA 4MUFA 1L5KA 1QHXA 1UZLA 1XF1A 3IPYA 1LLUA 3W7BA 4RZHA 4EG1A 4CLDA 4TTJA 1JKIA 1L5GB 5KFZA 3ED5A 2FFBA 2O6LA 4XWAA 3DHEA 2F1JA 3F5QA 5BQOA 3OVMA 4D8XA 5JZVA 3PFWO 1W0CA 1QR2A 1XNGA 2ESEA 1NL3A 2Z30A 4X3PA 4G0QA 3DLBA 3E6AA 1NXVA 4DNPA 3CC8A 3DE4X 4GHWA 4R63A 1E6KA 1SQSA 1Z5UA 5CX1B 5FT9A 4BATA 3QVTA 3X2EA 1HNWB 5COQA 4E07A 4E6PA 1JX6A 4EEKA 2A1JB 2D0PB 5FYQA 2XYPA 1EJ2A 3UMCA 3TI0A 4ME6A 3WJ1A