4EENA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
b'DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
molecule keywords Beta-phosphoglucomutase-related protein
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 82
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eenA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eenA01
4DW8A 4KN8A 1NF2A 2HHLA 5AW4A 4O8CA 4QJBA 5AKEA 5AK5A 1ZS9A 2HI0A 1L6RA 3QU9A 4BYGA 2WFAA 1KYTA 3AR4A 4HYTA 3SMVA 2WF7A 3P96A 2HCFA 3L0BA 5AVTA 4KX3A 3SKYA 4YIKA 4BX3A 3N07A 5AVSA 3R4CA 4NFLA 3WK6A 2YMQA 3BA6A 2C8LA 1L7OA 4L57A 3L8HA 3E58A 4FYPA 3ET4A 5AKZA 5IT0A 2W11A 4XOUA 1SWVA 2G09A 2HF2A 1X42A 2BDEA 3QYPA 2ZBEA 4NWIA 3NIWA 3L1VA 3CNHA 5ALPA 2IOFK 4OCZA 3AR5A 3SHQA 3WKAA 3WGVA 2B8JA 2OA0A 5AIAA 3L0CA 2G06A 1L7PA 4Y2RA 3IRUA 1YJ5A 2BY4A 2AMYA 3B8EA 4E88A 1ZD5A 4NAVA 3SF0A 2Q4TA 4EELA 1MH9A 3KOOA 2P9JA 5JJBA 4JDPA 3OCYA 4XQ0A 3ZTYA 4ZEXA 5AESA 2B0CA 2O9JA 4C4TA 5AK4A 3KBBA 4EENA 2ZOSA 3MMZA 5AKKA 1EK2A 1YDFA 2CN1A 4G63A 4YH1A 4BX0A 4H1WA 2JAWA 3M9LA 1RKQA 5ALGA 4GXTA 5E0OA 2MSNA 1JUDA 2HOQA 5ALLA 4J03A 4GIBA 3KD3A 3WK4A 3OCUA 2HSZA 5IT4A 3N1UA 1Z88A 4YCLA 2I55A 4CF4A 2WHEA 1L7MA 1Z4QA 4DCCA 3ET5A 1IWOA 2C88A 3I6BA 5AW2A 2QLTA 4AS2A 1NRWA 3NRJA 2FPRA 2P27A 2QYHA 1K1EA 5A3QA 1RLTA 3WKDA 2IOFA 1RKUA 2B1RA 4Y2YA 3WK8A 2I7DA 5AKJA 4UMVA 4DWOA 1Z4IA 3UMCA 4YCMA 2I6XA 4YCNA 4UATA 5ALTA 5AW5A 4UMEA 3QGMA 4FE3A 4Y2UA 2ODAA 2R8YA 2EATA 3GYGA 3L1UA 3ZUPA 3W5AA 3AR9A 3L8FA 1PW5A 5AM2A 5AI0A 4CNQA 5AM5A 4G9BA 4UAUA 1EK1A 3MC1A 3QUBA 4Y3UA 5AM1A 2Q4RA 4KX5A 4AP9A 3E81A 2YY6A 5IS2A 5AI9A 3WGUA 4BX2A 4UASA 4Y2SA 5FP0A 4PNHA 3VAYA 3MN1A 3ESQA 1YS9A 3ZVLA 4RESA 1RMQA 4F71A 5A3SA 3OCVA 5ALEA 5ALRA 2R8EA 1T9ZA 1J97A 2FPUA 4UM5A 2AGVA 1RRCA 1RKVA 1QQ7A 3QXGA 3R9KA 2HX1A 2NO5A 2YFYA 3QU7A 3WK7A 4HGPA 2YMPA 2ZXEA 4B6JA 1WPGA 2IYEA 5AKIA 1TE2A 2JAOA 5ALKA 2B82A 1U2SA 1Z4PX 2EAUA 2NO4A 5AVWA 3WKBA 2YMLA 5ALIA 1RMTA 3FPBA 4OFZA 3W5DA 4HGOA 4Y2JA 5AVVA 3TLMA 3AR3A 3SKXA 2G07A 4UU0A 2HEGA 1RQLA 2FPXA 3I1YA 1XVIA 5AK3A 1ZD2P 1WR8A 1TJ4A 2YN4A 4Y2QA 1RC8A 4XE5A 1Z5UA 1U7OA 4AS3A 3I28A 4OD0A 1ZOLA 2FDRA 2PKEA 3EF0A 1N8NA 1VFPA 3N5KA 3CZ4A 4Y2PA 3QLEA 1LVHA 1F5SA 3S6JA 4BNDB 2GHTA 2ZG6A 2EARA 3DNPA 1O08A 3U7EB 5ALUA 1Z4MA 4EZEA 4ZEWA 1CR6A 2GHQA 4EX7A 2HO4A 1WVIA 5ALYA 5ALWA 3WK5A 4I9GA 3OCZA 5AI5A 3RF6A 3E8MA 2JGAA 3DAOA 3U19A 3EPRA 5AI4A 2Q5EA 4Y2XA 1TJ5A 1T5TA 1CQZA 3U13A 5AM0A 3PCTA 4C4SA 2RB5A 3KC2A 4UARA 3QUTA 2GFHA 5AVUA 1TJ3A 3FM9A 1RQNA 4L6CA 3AR8A 4IFTA 1QQ5A 2YJ6A 2G80A 3U7HB 4C4RA 3OTQA 2YJ5A 3ZTWA 4L6AA 3L8EA 3UMBA 5AK6A 2D2VA 1S8OA 2ZBDA 5AVQA 3ZX4A 3U26A 5AIBA 1U02A 2MU2A 2YBDA 3UM9A 2C8KA 5AKGA 5AVXA 2CFSA 4UMFA 3MPOA 2O2XA 3L5KA 2CFTA 3ZU6A 3WK9A 2G0AA 1T5SA 1Q92A 3HYCA 2IOHA 3SLRA 4ZEVA 4BBJA 1ZRNA 5AW1A 5ALVA 3ZI4A 2P11A 4NABA 3ZW7A 4UAVA 4MWOA 4OHFA 1N9KA 1O03A 5AHXA 3AR2A 3KDPA 3ZWDA 3DV9A 5ALZA 1YMQA 3WKCA 3NASA 2G1AA 1QQ6A 5AICA 3OCXA 3ONNA 2FI1A 1ZD4A 1LTQA 4BEWA 4IG4A 2AH5A 3U7GA 4UM7A 3N28A 2RAVA 3N8GA 3L7YA 2I54A 3NALA 5ALXA 5ALHA 2B30A 3L0YA 1FEZA 1J8DA 1Z4NA 4UMDA 3J7TA 3A1DA 1RPZA 2FEAA 1RMYA 1SU4A 1Z4KA 4KNWA 3AR7A 3QU4A 3F9RA 1Z4OA 5AKXA 1Z4JA 5AVZA 5AI8A 4BEVA 2RARA 5AW6A 2WF5A 5AKYA 3ZVNA 3SD7A 4Y2TA 4XPZA 2HF7A 2YMMA 2WF9A 3BWVA 3HLTA 3NUQA 1ZRMA 3B9BA 2ZBFA 4F72A 2X4DA 2PQ0A 2NYVA 3QNMA 3RFUA 1ZD3A 5AM4A 2YJ4A 3K1ZA 4QQFA 4J2TA 5AM3A 1YV9A 3U7FB 5AI6A 4HAIA 3OCWA 2WF6A 3FVVA 4MUMA 1WZCA 4RETA 1Q91A 4EX6A 3IJ5A 4CE6A 4HGQA 3PGLA 5AW9A 4HGRA 1YNSA 3I76A 3FGOA 2W4MA 5AW0A 2FPWA 5ALMA 2OM6A 4NV0A 5A3RA 2BDUA 2IA5A 3W5BA 5AKLA 4DFDA 5AKHA 2OYCA 3QU2A 2JARA 3M1YA 3B9RA 3QX7A 1U2TA 2R8ZA 4UW9A 4CF3A 4FFDA 3IB6A 2OBBA 3L8GA 1L8OA 5AW7A 3PDWA 4YIHA 4KYTA 2R8XA 3AR6A 3NANA 3DDHA 3ZWKA 5ALFA 2PR7A 2FUEA 2WM8A 3E84A 1XP5A 4BKMA 3A3YA 3D6JA 5ALQA 2I33A 2FPSA 5ALSA 2G08A 4CF5A 1Z4LA 5AVRA 3KZXA 1Z5GA 2GMWA 5AVYA 5ALJA 4Y2VA 3W5CA 4UU1A 5T41A 2WF8A 5AW3A 1S2OA 3WKEA 4EEKA 2CFRA 3EWIA 1RLOA 2W43A 3A1EA 4KNVA 1ZJJA 1NNLA 1AQ6A 2C4NA 4HGNA 4JB3A 2HDOA 2B8EA 3QUQA 3ZX5A 1QYIA 1L7NA 2B1QA 2FUCA 3R09A 1RLMA 2DQSA 2YJ3A 1VJRA 1L8LA 1TA0A 1SWWA 5ALOA 2I34A 2P69A 3ESRA 4YGYA 2AUTA 3UMGA 2ZBGA 1VJ5A 1XPJA 3QU5A 3PGVA 3EF1A 5ALDA 2GO7A 4BNDA 2RBKA 1RDFA 3A1CA 2MU1A 3QUCA 3FZQA 2VKQA 1U7PA 3FPSA 3ZVMA 3NAMA 5AW8A 3OPXA 5ALNA 2C9MA 3ED5A 2JAUA 1QH9A 1Y8AA 4I9FA
chains in the Genus database with same CATH superfamily
4C0SA 2MOKA 1T29A 2X42A 2GILA 3AR4A 4GPTA 3REGA 2GCPA 4Z9FA 2QR3A 3DE0X 5EQTA 3IXMA 3K2IA 1ZGCA 5H02A 3RK4A 1EFHA 2OFFA 4ZKDA 2NLOA 2O5EA 3O03A 5DM1A 4LZWA 1AKMA 3E7XA 2Z04A 2UUBB 2H00A 1NBME 3IIEA 1L7PA 3ZCRA 1LDEA 1JDZA 3L1IA 3HA3A 4D4LA 2Q9AA 3WGMA 3WYEA 5JASA 1XMPA 2VLBA 3DFKA 1N9GB 4L73A 1B8NA 2M2IA 2HOQA 2JFVA 4PR0A 2IVZA 3V4VB 4O2AB 2BAGA 1IATA 1M7HA 4J9OA 5F9FA 1PNVA 2P90A 2IXTA 4X1OA 2FPRA 1VJGA 3RAXA 2C4WA 1KP9A 4D9IA 1UT8A 1AQNA 2ZT6A 1DG3A 4CEJA 2DMRA 1NN1A 2HXGA 2CL6X 3W5AA 4ZVSA 3N05A 1MNQA 1DL5A 1WUJS 1G7TA 1OY1A 1WXWA 1X8XA 3KPUA 2A86A 2DCUA 2ZSJA 5LPNA 2A1JA 2ATVA 4O4IB 4Y0NA 4EVIA 5KX5F 1JMKC 4PYKA 4E21A 4AYTA 1DQRA 4DSZA 1AV6A 4PTZA 2YFYA 2VQ6A 1SVOA 1C7EA 1PK9A 3L3FX 2VO1A 4A8TA 4YT2A 1SU7A 2W03A 4FE7A 1DWUA 3GZFA 3BAFA 2Y8EA 1C9MA 5TARA 1ODSA 2ZJOA 4I9HA 5TEVA 2ZR7A 1DAOA 4IOKA 5KTSA 2NP7A 3T79A 1JDBB 2PI5A 4HDKA 1WYGA 2RCNA 2VP6A 4TX1A 4RPIA 1G4AE 4QUJA 4UHHA 2GHTA 1NR7A 1CX9B 2BI7A 3DTTA 3CVWA 1SELA 3GH3A 3EEQA 1YZVA 3IDAA 2XT6A 1G5FA 1LBEA 4NLLA 1ZJYA 4CM8B 4FMCB 4B3DA 3DKKA 2O57A 3I72A 4YMNA 2WSSA 1YBFA 4E5KA 1YB7A 2J08A 3WYNA 3HUFA 4LBWA 4MVJA 4ARSA 4NXZA 1LQ2A 2O23A 4GP6A 1DV2A 1R66A 4QAJA 1Y8ZA 2H16A 4FZ5A 4GP9A 4N5LA 1XYGA 3IQHX 3DCJA 1XZAA 2W3SA 4D3ZA 1M8PA 5B1IA 1PZNA 5FNVA 1WMSA 1ABBA 1LLQA 4FPXA 4I1RA 4YHBA 4L5BA 1JN0A 4RPHA 1WSBA 5EHNA 5DPMA 3GGCA 2BHRA 2D1FA 2KWIA 1WUHS 5G0WA 2ZUUA 1R6UA 5AKXA 4MA5A 3VHLB 1WW2A 2QT0A 2EBUA 5AI8A 1GXSB 4O2BF 1U4OA 1CRXA 4CQNA 5FUWA 4UULA 4X6UA 4UB1A 2ILTA 3GDHA 2LYAA 2PT7A 1VGVA 4HVCA 2PJZA 1HLDA 4PX5A 3BB4A 2TMYA 3NJ8A 1YRBA 3D7KA 1IN5A 2FR1A 1BE6A 1GTG1 5EYPA 4YMWA 1ZRHA 2DECA 2P9QA 2WJWA 4ZKEA 2PUWA 3EOBI 1T8TA 1O0CA 4RU1A 5FPYA 1VE9A 3QVOA 3EISA 3OQBA 4CM9D 1E0DA 2Q3HA 3DZJA 5DGDA 4EB6B 1KAEA 4NV3A 3W79A 4QOJA 1JDPA 2NZXA 4ZIRA 3LKZA 4TKLA 1Q2UA 4ZAWA 3W8RA 1KR2A 1JL3A 4FWIB 3T1NA 1Y4UA 3C7AA 1MV5A 4Q1EA 3OKFA 4BJ3A 1I9GA 2AJQA 1PR5A 5GM2A 1QGYA 2VYVA 3LQRA 2I6SA 3GJRA 4MVXA 9ICPA 3BTUA 3C8HA 4R2KA 3DT9A 4BQFA 1ZQBA 3N0RA 3O3OB 3Q5GA 4I1PA 4E4YA 3A04A 3PJRA 1IB6A 5CHEA 4W4TA 3H5RA 3IHLA 4DTIA 4W7HA 2P2ZA 1Z2PX 1FRNA 3FDZB 4N5NA 1DLIA 1EP3B 2HF2A 2BDEA 4IX1A 1NY6A 5EHIA 1T9CA 4HYQA 4XGNA 5K4LA 3Q15C 2Y76A 1JTEA 4F5RA 3WL7A 2NYUA 2BR3A 1GFZA 5A4IS 1TC2A 1TZMA 2FP4A 3PFGA 1ODKA 2M9MA 3B5IA 1P19A 3PFNA 2B0CA 1OZAA 5DKWA 4KDRA 1SBHA 4NU0A 2P1RA 4JXJA 1NKSA 2BE7A 2FW8A 3TLAA 4ZOBA 4R8RA 1RP1A 4BDTA 4MB6A 2HK9A 4P22A 3ZY2A 3QW4B 3LF1A 5A0LA 4O4LF 3DVAB 5TVGA 4QU8A 2WEKA 3PNOA 4W5HA 3WK8A 1TO2E 2EU8A 4FYJA 4AYBC 2QX7A 1Q77A 2QM3A 3OCCA 1O8BA 1UOQA 5DHTA 3OAAD 1U8ZA 3FTFA 2OCEA 3PA8A 2C5FA 4WFQA 2WZCA 2GLXA 2QMUA 4KX5A 4V3CA 2FSPA 3C3BA 3C29A 4QDZA 4H60A 3DQZA 4YJ2B 5YASA 4DSKA 2ANCA 1OOEA 4RA9B 1HE4A 4YMOA 1KYWA 1UEJA 1FUEA 3NHFA 5FTMA 3C1AA 4DRXB 4DEVA 3GDXA 2YNMC 3HO1A 5FOXA 1V25A 1XQ6A 2FSFA 2B37A 4RUAA 5DN6A 4AIRA 3RIMA 3ZD6A 3A9RA 2R8OA 5L1IA 3I28A 4ABYA 3V8QA 5CDGA 3VSAA 3QLEA 2D6FC 3G23A 2HNKA 2R60A 4I5DA 2WLTA 1LKYA 4TV9B 1U0FA 2GHQA 1NMYA 3M1LA 2B5OA 5BW4A 4HB0A 3IBGA 4CUJA 1DSSG 3JD0A 3W3ZB 5JAPA 3RYHA 3A3KA 4H35A 1ZH0A 4PNEA 1LDMA 3URKA 4OJYA 3E3OA 1ONPA 1JHAA 1IUOA 3O2QB 3DBHA 3SI7A 3RM3A 1WE2A 2XIQA 3L49A 1IULA 1JLRA 4B32A 1MC4A 2QQFA 1SRQA 1X80B 4IWNA 3T3MB 5GM1A 5K1ZA 5HOQA 3SC4A 1ZNWA 1JZQA 2AOXA 4RJ2A 3RUFA 5KSYA 3DWGA 5EE1A 4EI7A 3DS8A 2YTUA 3ONWA 2FFQA 4LOJA 1LTQA 1Z0AA 2NACA 1Y81A 1E3EA 3ABSB 3BQ9A 3OEYA 3K73O 2IJGX 1P6XA 5CX4A 1DMSA 3ANXA 5L8VA 4CCAA 3T4EA 1X1AA 5LUBA 4TN1A 3GRVA 4LMAA 5EZYA 4IO1A 2RARA 5JH7B 3RIGA 4GH5A 4OI1A 5H68A 3IQFA 4G8BA 4WHMA 1BE1A 2FP3A 4H17A 3S0JA 5I3CA 3I1JA 5ICEA 3GJ8A 2AZTA 4ZYUA 5J0QA 1ZOPA 5E95A 3QELA 4X6YA 2ZBFA 3W8FA 4BXOB 5CLQA 2PAFA 2QUBA 1BDMA 4HGRA 3MTIA 3K6RA 2OPHA 1XKQA 2OM6A 3AYZB 1CS0A 1VIYA 4JBWA 1T2FA 2RH9B 1PYGA 4E5UA 3HKEB 4G0PA 2ZIWA 3IPRA 4DEXA 1NBMA 4Y6SA 1EVJA 2W7OA 3W77A 4RF4A 4TTPA 2P2DA 4M8KA 4ZK6A 5IAGA 3OOWA 3UTDA 2BELA 2QSUA 2QPLA 4WESB 1N0VC 4ZP1A 3S7TA 2LRHA 4DY6A 2XF2A 1Z5GA 4NRDA 1JT2A 2RGXA 1D4FA 3HYLA 4A16A 4RKWA 4TWIA 1XMOB 2FNAA 2O8VA 4MQFA 1WRBA 3V4FA 3S2IA 1WCNA 4BQIA 3QMMA 1I4OA 3ORSA 3PUZA 1HJPA 3QE9Y 4M1KA 2POCA 4BRWA 1EUDB 3QE4A 1H85A 1DBPA 2IV3A 4FHZA 3IPAA 1Z0SA 3LK9A 4PNPA 2YHUA 3TACB 1G3RA 4LI3X 1P73A 1XLVA 1Y0BA 1HE8B 3K70C 3E4CA 3AI1A 3SMVA 1PWZA 3WLNA 3H2BA 4PWZA 4FYPA 2KM1A 4HH0A 3HJEA 5T67A 2JPDA 3HHPA 2FPOA 2DRIA 5L3ZA 4NMHA 5C8VA 3BSWA 2UVWA 1KAQA 2BEUA 2WINI 5GJVC 3WKAA 2WFMA 1VHWA 5G4KA 2AMYA 3F5AA 5HQ3A 5JJBA 3KHLA 4UB6U 3LOQA 1N5WA 1Y9DA 3LPCA 2F9LA 2YWHA 4Y67A 3VTFA 5FWYA 2R1VB 1IM4A 2LIPA 1X6IA 2FPPB 1QV7A 1UKZA 4DLAA 5HIIA 2HNAA 2OO5C 1B6SA 3ETEA 5LM3A 1V43A 3D4NA 3I9OA 4Q9JA 2JLXA 2UYCA 4GR9A 1JXLA 4US2R 3UWOA 4XX1A 2C4MA 1RI3A 4Z2AA 2OGSA 3WYCA 4BEJA 1QPGA 1ONSA 3EVAA 4HB3A 1DRJA 5LP6F 2M98A 3L8DA 3AL2A 4DR6B 2VH5R 2CLLB 1C4OA 3QUBA 1ZI8A 4AUNA 4P9NA 3A6KA 4JI2B 3HDQA 5EUQB 1RE0A 4NMMA 4G0YA 1JPJA 1PZXA 2CNWA 2H2FA 3MD9A 1U48A 5IEJA 3JZFA 5J4HA 1ITZA 2Z0MA 3P9SA 5DI3B 1BKSB 5JAUA 1XNGA 2N75A 3NC0C 4OHYA 2YICA 3Q5EA 1N6PA 1BS9A 4ES6A 4QNLA 2WSBA 5FB3A 1BJKA 5L1LA 1M1YB 2UYHA 1NFRA 4UE2A 3A31A 4OQ4A 4HWKA 2LGJA 1H2AS 3DWFA 1ZM9A 3DQPA 1XLTC 3INRA 1TTHA 1U7HA 3H8MA 1OI4A 4QBTA 1Q1QA 4QW9A 1VHJA 5IC5A 3VMFA 3BIJA 2QZSA 3MB5A 1O95A 3FTDA 1E4EB 1XKLA 2QD1A 2I1VB 3ZIAA 2OFWA 4CV2A 3EZ7A 4P4TA 1WO8A 1OXVA 5FDFA 3C3CA 3VDQA 2AOTA 2PV7A 1Z5ZA 5JSKA 3EJWA 5HF9A 1Y88A 3LL4A 5CCXA 3DR5A 2WHPB 2DTEA 1CY1A 2ECPA 3VR4D 3MELA 3D5EA 4C8NA 1TK5A 5TPWB 2BZSA 2MWMA 3KKLA 3IUNA 3M82A 1KJ8A 2UVVA 4Z1MA 5CW2A 3TLGA 5C1BA 1ISPA 2ZIVA 2WWHA 3X1MA 1FRZA 4JX8A 3KB8A 3EYWA 1U8EA 5ARDA 5F1PA 2BR5A 4YAIA 3LV8A 4KRYA 4ALKA 1AN9A 3EXHA 4WFIA 1PHRA 2W4MA 3WRXC 4BNXA 2RAPA 1R9JA 3QXXA 2OLJA 1U9IC 4FGUA 3GDFA 2F2AB 1UK7A 1J5PA 2JEOA 2YVLA 4R8KA 2I33A 3C3JA 3DOEA 3RAFC 2WF8A 3TLZA 2H57A 3L77A 1X7HA 1DWOA 4K87A 3KNZA 4IDCA 2WWYA 3GF4A 1T15A 4G0QA 3QUQA 5DB8A 1T7PA 1O8CA 2YNMA 4KVZA 2DQSA 2XODA 3IQIX 3NWPA 3AY6A 4MSUA 3LIIA 4EDFA 1AXGA 3T52A 3B1YA 3OP4A 2FJUA 1BFDA 2YFKA 3NVAA 5IDYA 3UT5A 1DJPA 4FW9A 2CBZA 2HHXA 2ZBRA 3MGHA 2KMLA 3G6YA 3BDIA 4B74A 4EW2A 4E32A 2D6FA 1AKNA 3K6SA 1OI2A 4J3NA 4ND5A 4NKRA 5DWDA 4QX6A 3CRVA 5HS6A 2QARA 3R75A 2KIVA 4J91A 4RDIA 1ZQIA 2AD1A 2GD0A 2HHAA 3PG5A 3UBMA 4II3A 5F35A 3A1UA 1JQEA 4JQOA 3DZCA 3NONA 1PUJA 5FR2A 1WTCA 4MW5A 5BXQC 5JCJA 2WR8A 5KDDA 2HA0A 4KYVA 2R97A 2JGNA 4P4SA 1QHSA 2HIHA 3I2HA 5DH9A 2PUBA 1O6FA 4YI5A 1VBFA 1WKVA 3H4MA 1RE1A 3GILA 1XTJA 3F71A 4YREA 2X14A 2P7HA 4RHFA 7ICHA 4LSMA 4R1TA 2XIJA 3PLAE 1QHEA 2YZNA 3UHJA 1T4MA 5C8DA 4NZMA 1CR0A 5CH3A 3KT8A 3U4DA 5JMOA 1GY8A 2CLFB 1Z4IA 3EGXA 4Q66C 1JQKA 1ZI9A 4HADA 3GLKA 4Q6BA 1JIVA 1E2IA 3VNBA 3KT3A 1H0KA 4ENUA 3CEPB 4ENQA 1MVLA 1BE0A 5DOVA 3CRRA 4KUEA 2R5WA 1FU7A 3V1MA 3C5GA 4PPGA 2AOVA 4EQ6A 3D4OA 5F98A 4MAFA 3TWOA 2XOKA 6CHYA 4R9RA 3UXMA 2GN9A 5AVOA 4Q4AB 2C99A 1OQAA 5K0BA 1G9SA 2XY4A 3K09C 4HLQB 2AFIE 4H4EA 4MEXA 3OJEA 3Q6NA 2NVUB 3P20A 1PV4A 4JP3A 2B1IA 1XRQA 1S4QA 1NDUA 3DAOA 1SXJE 2R1UA 4KFTA 4KXMA 2XOEA 3V9PA 3WTBA 1ZZGA 3LBIA 1QO0A 8ICNA 3UW3A 4K4GA 1TJ3A 2A9KA 4WLEA 3NQ41 3WNDA 4YAJA 3L8EA 5KNBH 3B7PA 5LZ9A 4DVJA 3PNYA 5I48A 3TI7A 2YBDA 3AHIA 4LJ6A 3M2TA 5AKGA 2PX8A 5DHFA 1ZSNA 4O5OA 3ILVA 3EQ8A 3GD7A 2D7DA 3NASA 3R7DA 1L7AA 1GQYA 1BROA 4JYBA 5BV0A 3BAZA 1N6HA 5IKOA 3U7GA 1K7YA 3YASA 5CBPA 5EOVA 1GCAA 1E3IA 1W36D 4C9BA 1PK7A 3JWEA 1L3IA 4M9GA 1G6KA 3HUTA 5HWSA 2XADA 1XYYA 4HWGA 1P62B 3M4JA 1C4WA 1T34A 4MUHA 1M74A 4U9IS 3FH0A 3ZC3A 4MGEA 2MR6A 4V0KA 2OO5A 4B76A 2P4UA 1D8BA 5ICSA 1FP1D 3I58A 1MJGM 3NBKA 3BORA 4OSPA 4LY3A 2BGUA 1A5ZA 3O84A 1M2OA 4KXYA 5GWXA 1QGZA 5HP4A 2P6RA 5K3DA 4XX0A 4ESOA 3SJCA 1DX4A 2ZZNA 1RXWA 3M6MD 5L4SA 2XUFA 3RJIA 2LV8A 5DWVA 3IILA 5HF6A 4HWPA 1XDWA 5J1TB 1JJFA 4L8FA 2L82A 4I19A 3TO5A 3UXNA 5IF9A 1IMJA 3TXAA 2DU8A 3DL2A 2BZ1A 3I9LA 3K2QA 1NY5A 2XZPA 3VR6H 4PXYA 2ZYDA 9ICLA 1BCSA 1Q0ZA 4IX9A 4UVDA 4DSNA 3W6OA 2J30A 1K27A 2FETA 4ENSA 1DPGA 3I6IA 4Q16A 2AGOA 2JIPA 1EWVA 3FHLA 2HRDA 1GU0A 5JDCC 3IYLW 3P2OA 3KKKA 4Q44A 4K05A 3U3ZA 4ON9A 4DQXA 2BCJQ 4CKZA 3MEQA 4RY9A 5J2JA 3LC1O 2YRFA 2IUUA 1H0RA 2HQOA 1XLTA 5LUAA 2ZWAA 1EGAA 1L8XA 2PH7A 1YK1A 1UK6A 3MPUA 3AR5A 3OMLA 4K9KA 4YR2A 2A14A 1NJ8A 4IZHA 1YJ5A 2A7QA 1VKZA 2V6BA 3KUUA 2XY6A 1T0IA 4DZZA 2NZYA 1GZ4A 4RIIA 4QD3A 3SXPA 4LZPA 3FCYA 2RMKA 3DLIA 5EWMA 1QG4A 4OGGA 4N49A 4IY1A 1NC3A 1FFYA 4Q47A 4HRVA 8ICYA 3L46A 2GPWA 1UBSB 3WSWA 1JBKA 5SY9A 2BLLA 1SKYB 4MRRA 1S0VA 4H3HB 2PZFA 4UNIA 5AXBA 4A1FA 3GYGA 2G83A 3HXKA 2QTMA 3S99A 3K53A 4I5IA 4Q7QA 3H9EO 1ZA1A 1E8NA 1FP4A 1P2SA 4F4DA 1B8OA 5KYWB 4G5FA 1MAHA 1DT3A 4X8LA 4MH0R 1F8UA 5CNJA 3LL7A 1OX4A 3KYDB 3VPFA 4KAXA 1SQ6A 2O8BA 2CDRA 3C70A 1Z26A 4N3AA 3RABA 4LFAB 5HZHA 1U9IA 2HJHA 3HVIA 4LWPA 4ECXA 2GTHA 3BQNB 5B6IA 4PHDA 3SKXA 1T8YA 2FQWA 6YASA 1X7XA 3WGKA 1HKHA 2AW5A 4UOQA 2JZOA 3V5NA 3VV3A 4MLPA 4AWBA 3SG0A 2Q8QA 1W4BA 1MKYA 4EYIB 1NGSA 1Y5NA 1YVPA 1F5SA 1M8FA 4UZSA 2W6CX 1FUIA 3HMKA 1T8PA 1XKXA 1W88B 4KRGA 4EMBA 4MP3A 1ZQRA 1ZJMA 4I9GA 4RPZA 3HVHA 4P54A 1AUVA 5GGXA 2GVDC 3A6GA 3HGMA 1PSWA 3UXOA 1RW4A 4F2RA 3GCGA 3SYZA 1KDZA 4LF9B 2Q7OE 4K86A 3PFWO 2ZWIA 5BN5A 1Q3UA 3WHLA 3ZOKA 2H1FA 4NJ8A 1JROA 5IN4A 1K5DA 2PS0A 1X6JA 1KIFA 2CDNA 4LDPA 1OB5A 2P35A 2WNSA 2R8KA 3NHKA 5IARA 1UIMA 3NPMA 3O7WA 1M2JA 5ALVA 2WWTA 3EBLA 3OQIB 2WMNB 1GPYA 4JP1A 1VPWA 2O8FB 4ARIA 9ICUA 3H0CA 4RSRA 4J16C 3OUZA 3BMXA 1PT9A 4PRLA 1QOZA 4J9SA 1X9HA 2CE7A 4ZOLF 3MHPA 5CA1F 4NQZA 4DIFA 5J2BA 1S02A 2GHRA 3HGTA 4OLAA 1LRJA 4UJ5A 4DSOA 1KI3A 5DXJA 2XCSB 1L5YA 1VE1A 4HZUB 4HEA6 3DHYA 2H3QA 2GBGA 4LS3A 3PC3A 1I6WA 3MSCA 4YAOA 3W6ZA 1AKYA 4ML3A 1N2HA 4PICA 5FI1B 5CEEA 2AJTA 3CEMA 2QL6A 2ETVA 4TLDA 2ALZA 3JYNA 2KZMA 3FCXA 1FTGA 2BDUA 1WF6A 3Q87B 4EF4A 3ZH9B 2PQ6A 4EUHA 1A04A 3UUEA 1BGWA 2Y27A 1E7MA 2FWIA 3CNBA 2AT1A 4IQ8A 3IE0A 4R2HA 2ZRKA 5BRNA 2VDLB 4B2YA 3ROMA 2NXJA 2EZTA 2PZMA 4JBLA 1PGQA 3JQEA 3TX6A 5DASA 2DWCA 5EEGA 2JLYA 4MKIA 2K8CB 3ZDRA 3VU1A 3HABA 3VC2A 3UMGA 4X71A 2B3TA 2GO7A 2FX2A 1ZHFA 3DT6A 3PSAA 4UDXX 1F9AA 3Q88A 1QH8A 3K09A 4LJYA 4JK3A 1X39A 3VYRB 4LGCA 2L5YA 3GJ0A 1Y3CE 4C6HA 2ES6A 4DV6B 4GFDA 4OHUA 4FQ5A 1UL1X 1VYHA 3MT9A 4LZLA 3T3PB 5HCNA 3BE5A 2X2PA 2QVCA 4L4SA 1KAMA 1V48A 4DLRA 4NL9A 1MAUA 5TJHA 4CN8A 1IM8A 4GRAA 3R23A 2UYOA 3OPQA 2XMCA 1NQTA 3R3YA 1FB5A 1JHDA 4XGQA 5HX7A 4MEBA 4YI3A 5ES3A 4W7SA 3CP8A 5CFZA 2AFIA 4K9OA 3JPTA 3JWHA 2H7CA 4X8HA 1SY7A 4P2GA 2V6MA 5K0CA 4G01B 2WA1A 1E5QA 3NGMA 2DWQA 1LWOA 4UU7A 1J24A 4PPNA 3ABZA 3VU9B 2GZ1A 3WOVA 2HA3A 2OZVA 4DWVA 1P2TA 4C03A 3H9JA 4UFOA 2W8ZA 2OM2A 3ND6A 5EJIA 3HN6A 4RK7A 3FMVA 1T26A 1YQXA 4MUNA 3TM5A 5FOVA 1KOGA 5B4UA 3NHZA 4ZQHA 5BNFA 4J75A 3EGDA 4KJXA 1P5RA 3CX6A 3TMAA 3E2EA 1Z2AA 4OH7A 2J85A 3TL3A 3OPMA 4F2GA 1W52X 5I4BA 3N6XA 3CNNA 5B5EU 3SBDA 5BSEA 5IVHA 2P2CA 3PE4A 4W8GA 2FMSA 3VHQA 3L8MA 2B61A 1E7WA 4N0EA 5ER6A 4OXQA 2YHIA 4D5EA 1RC8A 3OJFA 1RYRA 1QCZA 1BQEA 1E59A 2HGZA 1ZM3A 3FDJA 1TA9A 2Z6UA 4BV9A 3W9UA 3CJTA 1NF8A 4HQ6A 4BVLA 1EESA 2ERXA 3EIHA 2JJ1D 3U4HA 1I9CA 1B0PA 3SNKA 1FNBA 1W5EA 3CTMA 3U13A 3ZHUA 5JVDB 2MUTA 3EXFA 3CCCA 5I9TA 3NW9A 5JFTA 1S8OA 1EVEA 1UJ5A 2J3EA 1G7SA 1KI6A 3PXDA 1EFAA 3PXAA 1A88A 3BF7A 2AEFA 4EBFA 3O2SB 2J7KA 4FDLA 1QMPA 4TYMA 3AKCA 1ZP6A 1PJ8A 1GAWA 2NM0A 4IHAA 4N41A 1J00A 3O1LA 3SEIA 4Q9AA 3JPOA 4KLCA 2QP9X 2JIDA 1MFPA 2WHQA 4WZ6A 4D1YA 4B09A 2KK0A 1ZN7A 4LW8A 1I6LA 2A5DA 1P0QA 2Y9TA 1XG5A 1YHYA 4EZ6A 4FEEA 1KYXA 3L93A 2VBFA 2WG2A 5KNDD 3G2LA 4C7BA 3AFOA 1IQRA 1K66A 2GD2A 1NW3A 4LV5B 1SBIA 2V45A 2O8DA 2Y2UA 3Q3CA 1UC9A 5BSVA 2B9VA 2V4MA 3AZPA 3HLTA 1TAUA 3D7NA 5JZOA 2XPCA 3LAWA 1Q3TA 3LWLA 4EX6A 4YMSA 1WXQA 1MA3A 3T7JA 9ICIA 1VKNA 2Y68A 3VISA 4FFOA 1FBTA 4NYMR 1NDHA 3EGWA 4Q1CA 2FFHA 1ZQNA 1SVSA 3LM8A 4F5DA 1C8KA 5KX5A 3SIPA 2C8VA 3GX1A 3UHFA 4QZAA 1V41E 2VPPA 4DQUA 3N2YA 1XX6A 2NZ8A 1TKAA 4IUCS 2FJPA 2H18A 2RGRA 5HRUA 3GELA 1QFXA 4N7BA 2OL4A 1ZJJA 4OFXA 3R7NA 2IYRA 4QHYA 1TV9A 3AP3A 4UBIA 1VJRA 2OESA 4GZ5A 5C8YB 1FOEB 1N36B 2RHTA 3EGCA 5GQSA 3I9KA 1KBOA 2QRGA 3VH3A 2XMSA 3I6MA 3FZQA 2NXCA 5IANA 1L4YA 3MW8A 3F1KA 4EK9A 4L27A 3C7DB 3FOAA 4NPCA 5L4LA 1LC3A 5A0VA 3HNRA 4F9FA 1FJ2A 5DI9A 3H5OA 2R84A 4LE2A 3MSXA 1FFUA 2YWFA 2G5IB 2R4TA 1I01A 1ZMOA 1GGJA 5IAAA 3ET4A 3IQWA 4IL5A 3VUFA 4L78A 3SDBA 2ZBEA 4JI8B 3NBFA 4DUGD 2HIGA 5B4VA 1L7BA 1VHQA 2FLNA 3HCCA 4QRHA 2WILA 1NJ5A 3NHRA 1AF7A 4HHEA 4EELA 3KFUF 3M34A 4CZ2A 5INTA 1D8TA 1QZXA 3TIXB 3SHOA 5JECA 2VUSA 1DKQA 3A26A 3ZY4A 3RNOA 2CHUA 5JMTA 2E3TA 4JR2A 3TECE 4GG1A 3UV6A 4J16A 2VXYA 3DHNA 3DMDA 2W6OA 4UAZA 1F8GA 1D2GA 3LPNA 1V35A 3I62A 5LP6C 1VM6A 3VR3D 2ACEA 4GLFA 2GA8A 4RCVA 2FR0A 3WXBA 1E7YA 4WACA 4O2BA 1NJYA 4FM9A 3RAQA 3RJJA 1B4FA 1HL7A 2B20A 2OZLA 2JVKA 4JJGA 4RVDA 4R4JA 2ZRQA 4EY6A 4I3FA 2OV6A 1GYRA 2FFJA 2GWSA 1L9XA 3EZYA 4P86A 4MR8A 2ZUVA 4AZ0A 2GN6A 1R4NB 3ZGZA 1IU9A 4WY5A 1L8QA 2HX1A 3LP6A 3SX4A 4RZQA 3K5WA 3K8QA 4QZDA 3KTQA 1NUUA 1NW8A 5EUMA 1V8FA 3VZCA 3OZWA 4LQDA 3BSYA 1GO2A 4ZHQF 3PUIA 4LRQA 4O3QA 4PZNA 3UJ9A 3ZCUA 4FSHA 3ASZA 3QTLA 4J2HA 2H6EA 3KVNA 3PDHA 3EXEA 4LOLA 3QPAA 1YO6A 3K31A 5JROA 4RZHA 4JYAB 1UFKA 2FW0A 1LPOA 1PUZA 1QNLA 2ZQYA 4LBYA 3JATB 4F2SA 3W8DA 4C20A 1WVIA 1SUEA 2F6RA 1PNQA 4YD1A 3NFRA 1J2EA 4ACAA 8MHTA 2VPWA 2JIBA 3B2QA 1U99A 2IYQA 5BV7A 2FW1A 1T10A 3DKRA 2JRLA 5AVUA 4BVKA 3F4BA 1XSLA 5AUNB 1I3MA 2H51A 1UPFA 1U8FO 4P84A 4D97A 2JKZA 3F47A 1FFVA 1ML3A 3CPJB 1GUZA 3OIFA 3QHQA 4EA6A 3DFMA 2C0QA 5KMGA 4QUGA 4J0DA 2R8BA 3OJWA 1OYVA 3LUKA 2JDID 1CI4A 1ST2A 3W2HA 1J21A 1RRFA 4O63O 3CPEA 4FFRA 1RVDA 2NV0A 2C9YA 4IIHA 2NPOA 2OSVA 4XPIB 1S3GA 2CLEB 1F6DA 4RGVA 1Z5NA 1CY4A 3V00A 4UU8A 2BCGY 3M9OB 4CPDA 3L0YA 4R3NA 5JI2E 4B48A 4KQEA 4TLEA 1EYZA 3WDLA 3TQFA 5KFSA 1XZFA 1R3UA 4MYTA 3LX5A 1QTIA 1ULZA 1XRLA 1IY9A 3LT1A 4O4LA 4ND7A 3U44B 4QICA 1M1XB 1NJWA 4FZLA 2R8IA 2QRLA 3K2BA 4YVZA 4WXRA 2IHBA 3CT6A 3AEUA 2WG1A 1HE3A 3J81A 2QQGA 2A7XA 1F12A 1OXSC 1DPFA 3MUFA 1DBRA 2WHYA 3B38A 2XZOA 1U98A 3FYUC 3SC6A 1O5TA 4MPDA 1TUEA 4AN4A 3HYSA 4G1FA 3PU6A 1GL9B 4BFZA 4MVYA 1FYFA 1NL3A 1N78A 2BEWB 1TAHA 2IYSA 4N39A 3LPLA 3GEGA 4ZHSA 4LNAA 4KKXB 1O94A 3UHPA 3RBAA 4QW8A 1V7ZA 1A9RA 3IEMA 2R62A 3KR1A 1M75A 1NF9A 2GKOA 5BVHA 1ODLA 5A0TA 1HEYA 4C0AC 4J7XA 3N74A 1PKEA 3ZYCA 2J7PA 5TMBA 5B1EA 2C77A 1HFJA 2OXFA 2ESEA 3NAMA 1Y3HA 1ZICA 3NDIA 4D3FA 2GUWA 3ED5A 4I27A 3REOA 2HLDA 4EO4A 3JPPA 1WWUA 2FPLA 4QJBA 5IABA 2XDQB 1HORA 1OTXA 4US1R 4HDRB 3L7LA 2C3PA 3ZE6A 9ICMA 1MJNA 3VKWA 4KQ2A 1H8HD 4GR4A 4OXRA 4JYCA 2FMQA 1SWVA 2OP0A 3JAWA 1L5NA 3IQGX 1GA4A 1E1CA 4L76A 2O5CA 4OCZA 1DDIA 2NOAA 4IJ5A 3WDMA 3O4HA 2QYSA 4OL9A 4KO4S 1QHGA 4GOLD 1N5DA 4MF8A 2I22A 3LY8A 1CQPA 1YB4A 2EL9A 5L53A 1VMIA 4MV5A 4YCLA 1W44A 2CLMB 3OGUA 3TAQA 3LT4A 5IG2A 2CB9A 1WD7A 4EVQA 1QQTA 3P45A 1T36B 2FMPA 4RPLA 4EPTA 3G8AA 1JG1A 5GJBA 1VLBA 8ICZA 2ZJYA 3AKZA 1FDVA 5AHOA 4ZAXA 5J9FA 1QYVA 5EGNA 3U61B 4JUZA 5M04A 2K2WA 3W1EA 2YRWA 4HQOA 2PA3A 5F77A 4I4NA 1XIVA 1E8DA 3DTVA 3KKPA 2BQ3A 2JGKA 5KCMA 4QO7A 5ECWA 4I55B 1O6GA 5DB4A 2F4NA 3HB1A 4R9UC 3WBBA 2XXAA 3R9KA 4D9MA 2BCSA 3UJ3X 4BP1A 3PNCA 2D1YA 5A7GA 1V11A 2BBSA 1MJGA 4X94A 2EAUA 4LNHA 2IYLD 1T2CA 2XD9A 2G07A 2CKMA 1Y3IA 2Q46A 5C7OO 1FZQA 2BFBB 3AHDA 3BFJA 5KFDA 1NE2A 3I6YA 1JHYA 5FPQA 3C3YA 2IU0A 4BNTA 3S7ZA 5B5SA 4Q15A 3LXRA 1BDIA 1XZIA 4YAKA 3U7EB 2PRSA 3R9WA 3L0OA 3IHTA 4OQXA 4HVTA 1YFJA 2H3ZA 1ZQHA 5EIEA 5LIRA 3G7NA 1NW7A 1TK0A 2ZK7A 1IIBA 5A4AA 3QPUA 3RRZA 4BATA 3IKTA 2CXSA 3H0RB 4C01A 1QH1B 3L4PA 3BSFA 2JANA 5KTNA 1N32B 1L3UA 5B55A 2RH4A 3H86A 4KMSA 5JYCA 2ASEA 4P3YA 3OICA 2L19A 4DJDC 3D5QA 3KDPA 1S5PA 5FWXA 4BO3A 1YMQA 3IP9A 3OM8A 4R6WA 1KSHA 4JJAA 3OU2A 3A2KA 2EH9A 1NUPA 3L6OO 2O0MA 1OYOA 3R7FA 3PUVA 2IUEA 1UMBB 3MRVA 4DADA 1FMJA 2V3WA 1O95C 2FEAA 3UGQA 2GN8A 3JQPA 5KU1A 2I4MA 2PFKA 3C41J 1ICEA 2UZ0A 2RGAA 2RDJA 3R0ZA 4M9CA 1NK7A 4E5NA 4WNYA 1E2PA 2O1XA 3T38A 3J81j 1SG6A 4JFRA 4JENA 5E1MA 1BXKA 4NJEB 3DFUA 4QE3A 2FJ0A 1TYBE 1M2VA 5AI6A 2C04A 3ZXUB 5LP6A 5TQVA 4OKSA 2AEMA 1YOVB 3FAKA 1OKKA 2J3JA 2HMYB 3NRBA 3BRWD 2XSZD 4EECA 5CB8A 5ITZA 4WFJA 1RPTA 2WABA 3EXIB 5KWSA 4WXPA 1B43A 1FYDA 2ZAYA 1DXSA 4PLZA 4EUEA 3H2GA 4UUNA 2PWAA 1BSVA 3FTEA 2I1LA 121PA 1NC1A 1OTHA 3PP8A 4JHXA 3OIYA 4F9GA 3SZMA 3EXHC 4G1BA 2A9FA 3VNRA 2QIOA 1SCJA 4JB3A 5C5DA 2BBWA 1SWWA 1JPUA 2Z4SA 3IP1A 4UM9D 3ABOB 3A3PA 2IF0A 1EX9A 2BW0A 1MN8A 2P4QA 4YUAA 1RDFA 2MU1A 5TY0A 4DMMA 1ZYUA 3C1YA 2I4LA 1ZVKA 3WFIA 3EAQA 1AUQA 2X8JA 2LI6A 2H4JA 2CXTA 3HVKA 4RQMA 1LI4A 4AD8A 5JCZA 2LWIA 4KLAA 3FW1A 3KXLA 4FGSA 2NG1A 3CLTD 2QG6A 3O1IC 3OIUA 4URZR 4BX3A 3I37X 2WJVA 2IX9A 2VDOB 4FUTA 2C4KA 1FS4A 2PX3A 4KCGA 1E2KA 1U5BA 5EZ5A 1SKRA 3BE4A 3MINB 4B3MB 2BPCA 1KJWA 1IBKB 2H31A 2W70A 4F3OA 3AIKA 2GCNA 3IMGA 1C3JA 3INGA 3FOWA 3OCYA 2IZ5A 3KBBA 3OBIA 5J0RA 4PONA 1J8YF 4QUAA 3LT0A 1UDWA 4HBGA 2V0NA 3SR0A 1WQ1R 2DHDA 3HG7A 5KAMA 1NVXQ 1KFEB 4PGAA 4G23A 4YP0A 2ZUSA 3VPCA 2QL9A 3OY7A 3I1IA 2OHJA 1XZCA 3ZUPA 3WGZA 1N48A 3CZCA 1E9RA 1WU7A 2BPFA 5JEEA 1NP3A 3MLBA 3HN2A 4RVFA 1QRDA 1AJEA 4AC9A 2X40A 5HHIA 3TCXB 4F21A 4ECUA 3UB2A 4PU0A 4DUZB 2G5CA 2FVXA 3NGXA 1V7CA 1RG6A 4R8UB 1I2AA 4ZC1A 3FYUA 3CVJA 3ZDBA 2ZU6A 1G7CA 3JX9A 2ES4A 4E08A 1Z0FA 1JG7A 1HEKA 4DIOA 2VHEA 5EOZA 3G9QA 3KSZO 3WLKX 3KQSA 3IQDB 2ID9A 2I0FA 5DYTA 1D2MA 2NTEA 2QZPA 2W2OA 2Q0ZX 2ZG6A 2FF7A 1GUDA 8ICUA 2DB3A 1A9XB 4M0FA 3HR8A 3EDMA 3BJEA 2HM7A 1KSFX 1LBTA 2OV4A 1UPUA 4AWXA 2JFFA 3QXCA 1Q95A 1KVUA 2BHNA 1ZQSA 4IICA 9ICVA 1W36B 1BU8A 5GONF 5HR7A 3TZHA 2IEAA 2B92A 4GXQA 2E21A 2YJ5A 3KJFA 5IC6A 5ANRB 2Q8PA 1E6UA 5K8IA 5CG1A 3I9MA 1MC8A 1GTMA 4TM7A 1E7SA 3C97A 3DULA 1LI5A 3NBQA 3M33A 3EPJA 3MFIA 2BFPA 4J0QA 1TD9A 4N3GA 3NNDA 5IKXA 4EQZA 3SM9A 2FK8A 1I7SB 1J6UA 1ZHHA 1G18A 4J4TA 4B7UA 4U8GA 3EHEA 3OF2A 4AMGA 4ZAGA 2IOYA 3AUUA 4DO9A 5EKTA 4ILKA 4O1HA 3OWHA 3HADA 2WV7A 2W04A 4QREA 1NBEA 4H6XA 3WNQA 3RUIA 3H3JA 5CH8A 2BJWA 3HSSA 4D3SA 3AU9A 3ETLA 5I7RA 3E9NA 4OSEA 4C6TA 2GZ2A 1P4HA 3DPIA 1P4JA 2JW5A 3HPQA 4OSOA 3MK31 1C2TA 4AZTA 1X1QA 5CYGA 5KAIU 2YY7A 5CWRA 3D7LA 1ZCBA 3F6BX 1GRRA 3KUDA 4AX4A 1OFHA 4G24A 1EXDA 4F5WA 4RD1A 5DNWA 1O97D 5IP5A 2XRYA 4QTTB 3EGOA 2JGEA 1DBWA 3WLRA 2CV0A 2C98A 5I45A 3CZ9A 1SB8A 3PDWA 4E11A 1JKJB 1EWQA 3PV0A 4ZPXA 3F98A 4MUJA 5KNBA 1FJGB 4HJXA 3THWB 3H04A 3A1NA 5AVRA 3OT5A 3D8UA 5JDIA 4Y2VA 2CLCX 1NVUQ 4XLLA 1TJYA 1S2OA 4Y2GA 5DGAA 4BRZA 3HEBA 4ZI5A 1VCMA 1MO5A 2WFLA 3X2EA 3R2JA 1XNSA 3PXCX 1DC3A 3JQGA 4KYUA 4KQ6A 5J2DA 2VP2A 2Y9MB 3D6NB 2PEYA 1LX7A 2OFXA 2VWPA 1QH9A 4YRTA 4B81A 3D2BA 1I1OA 4DL5A 3RC2A 4GT1A 1H4SA 1KVQA 3KTFA 4H1TA 3X44A 1Z28A 3AM9A 5CK4A 1DUSA 4GZ3A 2DQKA 1C9DB 2F8KA 3QV1A 3SHWA 2H7VA 1WB4A 1GPJA 3K0AA 4PG4A 5AUOB 1SNYA 5EEHA 1X42A 1U1IA 1V8OA 4XJXA 4NYIQ 2X6QA 3L1VA 2BEKA 4O3PA 5MDHA 1MXHA 1I10A 4LXGA 4P4PA 3GLVA 4D26A 1G5RA 1PNRA 3D6FA 4CT4B 1W0KD 3WRWA 4X6LA 3TTTA 4E33A 1SZCA 2DPYA 3R3UA 3WE7A 4FFPA 4BFSA 1Z2CA 1Y3BE 2ZJ2A 4GXJA 2EHJA 3KHGA 4RK4A 1M2NA 1YFLA 2DAPA 5EE9A 3AJDA 3KELA 5FUXA 3QNWA 4CYMA 3H99A 2KMDA 2GS9A 2C20A 3NVKI 3WP0A 4J0FA 2XKBA 3VR6A 3DXZA 1ZAYA 1DLJA 1FFGA 4DR2B 3GLRA 4G9BA 3BRQA 3MC1A 3ND7A 2VP5A 4G4SO 4FR0A 5IS2A 3DE7X 3DBIA 5BT8A 4M0MA 1F8YA 3BXXA 3SEZA 3BMQB 1NJZA 2VTVA 3BB3A 3JR7A 3WQHA 4MVJP 2YV1A 2IYFA 1F38A 5U4QA 2JJ8A 3WK7A 4Q18A 4EYGA 4XDYA 1XF9A 3HVRA 4B6JA 1PL6A 2Q3LA 1K9VF 4BQSA 1U2SA 5DNYB 3B6EA 3EA4A 1GKIA 1WZNA 4NAHA 4JT9A 3RRMA 4LBVA 2PJRA 2R8HA 4A6EA 3LWNA 5D4BA 1NR1A 5LA6B 2ZE6A 3VNQA 4XUDA 2GCIA 1CUBA 5F3XB 2DQYA 4ZV9A 2JMGA 3VSBA 5EWJB 2HGSA 1XMXA 4AWAA 2BGWA 1M1NB 4B9TA 5ECGC 4RIGA 1G19A 1CUCA 1MFZA 4I1OA 5IBRA 3GBPA 3QF4A 4KQGA 4MVCA 3AEKA 1X1EA 5KOIA 5J43A 3ANYB 1T0HB 1NQWA 4AMYA 5DT9A 1C3OB 4G89A 5JJIA 4HXEB 1X92A 2X15A 3KUXA 5LFAA 3SSAA 3VR2D 3HDJA 5IIKA 1T3SA 1Z47A 3SV4A 2O2EA 1AO0A 2P4SA 2A0FA 4HRYA 2PE5A 2D0PB 4D9EA 4F2DA 4FEYA 2O2HA 1Q0PA 1WWKA 4QDXA 3O3MB 4R5HA 3ZDEA 5FO0A 2ZIXB 4EFMA 4B3FX 3X3HA 3R8FA 4BTLA 3JXEA 1KKMA 1XZGA 2G25A 2AXPA 2PI4A 4CRWB 3F9RA 2RGBA 3Q2OA 5F78A 2B4KA 1HQKA 3THXB 3FJYA 1VB5A 3GLIE 4HB2A 3EQ2A 4K81B 2PLRA 5FULA 1OBCA 3HCPA 5AOVA 1MO2A 4XIFA 3T5MA 4MZDA 5ALMA 2XT9A 3C5VA 1KRXA 2X76A 3QU2A 1RVV1 4LX0A 3PFHA 5KFZA 3PKIA 5G40A 3VA7A 4JJIA 4AQYB 1GTVA 3GJ3A 4ZZ1A 1Z45A 4URFA 4FLFA 2IT1A 3TEJA 4JQCA 4AJIA 2WVAA 3O8LA 5F7OA 3O82A 3HB5X 1O57A 1TTPB 2W6MA 1OV4A 4WCVA 1F4LA 2JRCA 3BCSA 3B2NA 3BGDA 4KWIA 3H9BA 3F90A 1G6OA 3EC1A 3IAM6 2W2KA 2DBYA 5F3WB 1JFFB 1IG0A 2C5BA 4ZGBA 3VTZA 1WBDA 1BNCA 2Q3FA 1IQ0A 1DC5A 1ULAA 1KZ4A 4YCAA 3MQ4A 2PFSA 2ZRMA 4FHFA 3Q8KA 1XQWA 3NP7A 1R4AA 2HHQA 2A35A 4YIKA 2ERYA 1YOBA 1P2FA 3BXPA 2OG2A 5CDFE 3NHJA 3RW9A 3AF3A 1LLCA 4L0DA 2C2ZA 4LJKA 3ZCTA 5EVJA 2NT3A 4ZQCB 4HWOA 4XWGA 2REQB 3BGSA 3I0ZA 3TQCA 5C1OA 4L9AA 4I2DA 1DKRA 1O4VA 5KHLB 3KJIA 4FW8A 4U9UA 1KN5A 1H22A 1E2MA 5FTKA 4DSUA 3IBTA 4J03A 4GIBA 3TQHA 2WQ7A 1R8SA 2GBCA 4MQEA 4ZOLA 3TBKA 1KPHA 1YF3A 5CA1A 3PPVA 4TTJA 1TVMA 1BD3A 5BV2P 1P1HA 3K0FA 1AMUA 3QKSA 1LD3A 3QEAZ 1EFRD 4ZYXA 2NUAA 4KIGA 5EWGA 2HU8A 4YPVA 4NL9C 4YCMA 5HPYB 1ZLXA 2QJFA 5JISA 4MTCA 1IEWA 1RZVA 4XVRA 4HUTA 2PUEA 5CB1A 1KQ3A 3AR9A 1DELA 2A5LA 2ZE5A 4B82A 3NVZA 3GQCA 2GFQA 5LB4A 3KZIU 1DHRA 4ZVUA 1IZ9A 5J0XA 4IJKA 1CJCA 3NWEA 4O2LA 2PT9A 3MJVA 5M7EA 4BMVA 4WRRA 1OGJA 4GSLA 3H9QA 4X41A 3S2UA 4DNPA 1SXJC 3I5XA 3KO8A 1SUSA 3OHMA 4QECA 4Q3CA 2D8CA 5KTQA 4FMDB 5BNTA 1RMTA 1N4AA 4NQRA 4L2IA 1EFKA 5J47A 2OCYC 3H18A 1HG1A 3DHEA 3KHRA 4TYPA 3H9GA 4EAAA 5C5EA 1TW2A 1RQGA 1CRPA 5A71A 4GNRA 3GQBB 3QLTA 4CM4B 3S6JA 5F4BA 1SC4A 1S10A 1XPOA 1K7FB 3PZBA 3CXUA 1JA1A 2UYYA 3G5LA 3SV3A 2XV1A 4MROA 3REQA 1V8ZA 1TZKA 5DLDA 4XWOA 2GNAA 4AJ9A 2HK6A 3U9TA 3DW3X 3F67A 3PR5B 1GRVA 2WUGA 7ICIA 4K46A 2ZI9A 5A6VA 1QB8A 3RCBA 1HG0A 1XEXB 3KQKA 2RHDA 1YNOA 4FGLA 4ZRMA 3D6MA 3IP5A 1II8B 3OSUA 1XVUA 2CFTA 3V4ZA 5T3YA 4MITA 2E2WA 1K7EB 1TVKA 2HPAA 1BDHA 3ML1A 2DP4E 5FUQA 2AN5A 2UZIR 5JU6A 3BMCA 4C7OB 3FMGA 1EU1A 3RFXA 1HSOA 2P3SA 1BPDA 4RNNA 1K5HA 3P2MA 5CURA 2H5XA 3OPYB 3HXQA 3H84A 5JZ9A 3UPUA 5JD6A 3CINA 3G9XA 2UUAB 2AXNA 4NBKA 3G2MA 1OW5A 3H40A 3H1FA 3ZIDA 3GFFA 3LX4A 1SUPA 5DGBA 1V5FA 1YJXA 5BPHA 3PE3A 1HR0B 4LISA 4ND2A 2YB4A 5DHSA 3RD5A 4YUWA 3FGOA 1JR4A 2VJ5A 1W8DA 3Q3GE 3W5BA 1JEOA 5K4AA 5A5GA 4MW4A 2NO0A 3PSIA 1OJ7A 4BO9A 3DM9B 3WL8A 4S35A 3EDRA 2CLHB 4GVLA 1PJLA 2KJ8A 3IP3A 3LO5A 1E2FA 4DF3A 1P7ZA 4A0GA 2H5IA 3GPIA 3HXPA 221PA 2F3UA 4E2WA 3SJ7A 1GL7A 2OLKA 3KLBA 1KSGA 1PFYA 3WWDA 2J3QA 5FL7A 4UUMA 4C5CA 4X1YB 4R40A 4JJZA 1VKJA 4LHYA 1L7NA 4LXQA 4YRLA 4UVHA 2QUAA 4JOQA 2FWRA 1K3UB 4S05A 1L5RA 3B78A 2C3YA 3O91A 4F84A 3MJCA 1S2LA 4MCJA 5P21A 1SQFA 5CBKA 1XAIA 3AGQA 1NZJA 5BR1A 1DCKA 2HVIA 2BTEA 4DWJA 3DLTA 4MUAA 3H16A 1G8GA 4J3FA 2HMXA 1ZJ4A 4C6RA 1QTQA 3OHSX 2RQ5A 3KYCB 3PJEA 3C5FA 4ZQEA 1RXVA 1E77A 1SPBS 1XDBA 2Q3DA 4QLOA 4R31A 5AKZA 5IMBA 1U3GA 5GTDA 1NI4B 4CG3A 2D2EA 2PL5A 4GECA 4LUCA 2HFJA 1RAFA 4ONEA 1B26A 2QSZA 1OUMA 1T9GS 4GKKB 4BO7A 4E94A 2QJOA 2TECE 4F96A 2C7BA 3ZUGA 8ICMA 3LCMA 1NJ1A 4Q19A 3BTOA 4RK6A 1CQJA 4YR9A 1IK6A 1VLZA 1JUDA 1WOYA 4K1XA 5FNZA 8ICKA 4YJHB 2OBNA 4Q0MA 3CMCO 4K3VA 4BLQA 1IWOA 3GGGA 2GXAA 5PGMA 4LQ4A 4CUKA 4FXPA 3DCNA 4FLMA 4K3UA 4LWOA 4FJ2A 4WWHA 1IYZA 3LHFA 3NHLA 4UMEA 2NGRA 4PF1A 5GADl 2PO5A 4KDEA 2H3VA 4G37A 1KVTA 2E1EA 2O7QA 2F1IA 1WDMA 3B48A 4D8XA 5LDHA 4B5KA 1SU8A 4M9ZA 4H7EA 4UTRA 1IZ7A 1RM0A 4Q21A 4ESVA 4ID9A 2ZB3A 4BX2A 2HT1A 1TYEB 4LTNA 4X90A 3IBCA 4GGOA 1V85A 2RHGB 1GVNB 2K4HA 1I32A 1LZLA 5KYXB 4K9SA 1MORA 3L7BA 4QEKA 3L18A 5DW0A 4NOLA 4JLAA 5HR5A 1UMCA 1ZA2A 2HL6A 4FKZA 3FX2A 2BDTA 4MWBA 3TSWA 2J07A 3PVXA 9ICHA 3RRXA 2P8JA 2WAQF 5TISU 2HEGA 3CONA 3D2LA 3GPCA 5FPKA 5IAKA 4QOEA 3H8JA 1GL3A 4JNKA 4MRMA 5B3JA 4QJIA 3ER8A 4EJMA 5ALUA 1J2UA 1VYTA 4QBGB 1TMOA 1FNSA 3GLIA 3ECSA 1J2RA 2C4UA 1IK4A 2JAHA 3DEHA 4P31A 4RAOA 5H70A 2QR2A 4EJ2A 2J3LA 1FMLA 4MS4B 3HKCB 4L6CA 2F8MA 4WKGA 1FL9A 4DARA 2YW2A 1WDTA 1J2MA 4E6PA 5JZVA 1U0BB 2C7PA 4WINA 5AHKA 3CLUD 2LNDA 4QBFA 4ZOCA 3PQCA 1AROP 2RG1A 5GJWC 4MWOA 4TUYB 4R9NA 2X8LA 3UANA 2DE0X 2WJ3A 5AICA 3C6ZA 3NDJA 1NUSA 2XUQA 2Q1XA 1ZVQA 1M2WA 5KPJA 1ELOA 1T3TA 1QS0A 4YJFB 3D4IA 2CLOB 4KL8S 1AUXA 4DDVA 2P5YA 4D99A 5SYNA 1JSXA 1PWEA 4B33A 1ZXBA 1U7DA 2AOUB 5D3MA 3U3KA 2G9NA 2JGDB 2QTTA 3Q10A 3V48A 1KYIA 4D9FA 4EBEA 4TVBA 1J20A 5IK2D 2B98A 2WZBA 2Z8YM 3GRZA 3FFBA 4V2UA 3HI4A 4PHFA 3EA0A 1N8KA 1HZZC 5CDFA 1V6CA 3RB3A 1D5CA 3ZHTA 1IQUA 4BO1A 3QEKA 1P2BA 1ZUNB 4ZK2A 1EFPB 5KJFA 5CEFA 3DVLA 2BUAA 2DR0A 1C81A 4KR3A 1VHLA 3VZBA 4ECVA 2NIPA 3SIRA 2IZ7A 1O5IA 1TM3E 3KVOA 1C3LA 1I5RA 2PNJA 4NXMB 1NRJB 3ZU2A 3AIMA 3T4PA 1SXJA 2D5CA 5HDBB 1GKUB 4M0EA 4ZHQA 4E15A 3ZNNA 3AEQA 2DH5A 4HAOA 1L5ZA 2HPZA 1RXCA 3AERB 2O6KA 3KQWA 3AOEA 3VGPA 7ICNA 5GGYA 1YHNA 1XD8A 1XNQB 2XT0A 4Z7OB 3NC4A 4E5YA 2W6ZA 4BNDA 4RQTA 2QX8A 1BXGA 2QX9A 2GZSA 2IEBA 4JASB 4FI3F 3SHFA 5C7IO 1H6DA 4IIGA 5SZIA 1O94C 1WCIA 3VNAA 3PI6A 2BN4A 1DOQA 1FQKA 4KX3A 2Y4NA 3T15A 2A0WA 2PRZA 1V3VA 1CZRA 2WIJA 4BFYA 3TUIC 3P52A 3CO0S 3O6VA 2QMHA 4PPFA 4KGZA 1J90A 4RDXA 1U1GA 1NZPA 3VO9A 4DIDA 3TD2A 1QPBA 2ZIEA 2H52A 4YN4A 5CCDA 3PD7A 4IJ6A 3W7BA 5KG2A 4NAVA 4PZAA 2JH3A 2ZYUX 5IBPA 4J43A 1ZU5A 1VYVA 3GFBA 2XNCA 1Z75A 5NULA 3HILA 1U0EA 4RV4A 2XMRA 1J7KA 3LW7A 4MKXA 2NO9A 3DLHA 3EZFA 3ILYA 1CBUA 4LXTA 5FOWA 1MO3A 1TEXA 2P27A 4NC9A 4K9PA 4HEQA 4Q02A 4ZZ2A 3UQ0A 4Y6OA 2FJ6A 3QYFA 3PCRB 3U6BA 3H5AA 2ZBQA 1PGOA 2PR2A 4O0LA 1RACA 5EFZA 2DF8A 4MI6A 1DKNA 3V46A 4GX2A 4I4CA 1FQJA 4Y1RB 3CIOA 2A5JA 3LZ6A 4FCWA 2GAJA 1R7RA 1GUAA 1MC1A 1J5XA 4AO8A 4ITVA 5BYAA 2R8EA 3LU1A 3HKZF 4M76B 4R2IA 2I3AA 3BS4A 4JGIA 3CCFA 3FNEA 3V1KA 1E5VA 2WNHA 1X15A 2OBLA 3T35A 4R63A 2CEAA 3DMFA 4Q7MB 2PIDA 2ODPA 4YRFA 4PO1A 4A23A 5AK3A 3UXPA 2FHSA 2FKNA 3ZKAA 3EDYA 4NEQA 1OFVA 4YCJA 4BMYA 2PX5A 2AGPA 1YJBA 2CHGA 3BWBA 2C96A 3UN1A 3OSZA 5G5HA 1UAYA 4NV1A 2YCBA 1ESNA 4QJ3A 4O4JB 4C0WA 1JQ5A 1KJ9A 1I13A 2B83A 4QZGA 1OILA 1L5HA 3U19A 4G26A 4E5PA 2I4NA 1AHIA 2ODQA 1W96A 2FZEA 3PUHA 5LB2A 4M1EA 4LF4B 3HU2A 3QUTA 1AXRA 1XKTA 3FGNA 4NCNA 4UB8U 2P6UA 4V24A 1BC5A 1ZQGA 1Q5PA 3OA2A 1YQDA 3KHUA 4HMPA 3FWHA 4R98A 4EJSB 1JFTA 4GYYA 5EE3A 3MPOA 2BCQA 3G5MA 3RJHA 2OORC 1PQYA 5DTQA 5DULA 3FOZA 4B4WA 5I4IA 1OBFO 2HUPA 4G1MB 1TX4B 4JFAA 2KICA 3SU8A 3OCXA 3EIXA 2VXCA 4RCZA 3DVQX 5JNRA 1A9QA 1NR5A 4Y9TA 4GUAA 1J07A 2JBAB 4KDFA 1U0RA 4YXMA 1JEYA 1J8DA 1SEPA 1AGYA 4PN3A 4RULA 1FFCA 1W6RA 2I5PO 3OD5A 1ZBDA 5LZ7A 3ROZA 2R6HA 3R7WB 3BWVA 2GJKA 1KZ7B 1Z6TA 4K88A 1SZJG 3H5WA 5EFOA 1OJLA 2X58A 2ZVDA 2XE6A 4QQFA 4O02B 4YS6A 2BBTA 3EEBA 1IOZA 1SVIA 4ZCRA 3WV5A 4UM9B 4NCAA 1F06A 7MHTA 4ZTZB 3GR6A 3TAXA 1CW2B 2BKLA 3LDUA 3QPCA 4GMXA 2YVAA 1JJIA 3R44A 2JAXA 3VZDA 1SC6A 2OXCA 5I7FA 3B1ZA 1ZJNA 1D6JA 3ZZTA 3F53A 3AVXA 2W43A 1THGA 2YX8A 2SCUA 3ICVA 1HURA 2AXTU 4R16A 1LF0A 4JY7A 1P91A 1PQ4A 4G5RA 4ED0A 2I34A 2JAPA 1YB1A 4HDSB 3LDAA 4WNAB 1GKLA 2P9FA 2GVZC 4HDNB 3NEAA 4ZZIA 3EFEA 2YN2A 4QXMA 5JHGB 1PJ2A 2ZJ8A 4Z54A 5TGTA 5FL3A 1R3DA 1JQAA 1Q3HA 5J0TA 2O2GA 2ODGA 1WAMA 4JGBA 2W6JA 2WAMA 4QU0A 1N2IA 3PGKA 1R2QA 1URPA 3PX0A 1H4VB 4F3YA 1F20A 1JKMA 4PGQA 4D4MA 1V9SA 1GG8A 1LDGA 1YZHA 1U65A 3D54D 1SV4A 1JMYA 4AUEA 1F6BA 4TT3A 2BCRA 2WSSD 2C1EA 5G4LA 3UB3A 3SBOA 6LDHA 2ZTSA 4WZAB 4EFDA 2W4QA 4MVJD 4JITA 4UPVA 2LW7A 3TJZA 1TQHA 3TQ1A 2J9FA 3DUFB 3ZY6A 4KW7A 1MIHA 4UZFA 4Q39A 2A4MA 1NNEA 5LOVB 2J67A 4RBNA 1WDWB 4PG5A 4JEHA 5I51A 2YXDA 3DBRB 3I73A 4O4HB 3OZFA 4O9MA 4LDZA 1P2DA 3H4VA 3R20A 1F3LA 2ZCUA 1WUKS 3NDRA 1HZZA 4YDRA 1CZUA 1XA4A 4FYMA 4E0BA 5JU5A 2YMLA 1R4MB 4R9VA 4PZ0A 4JKOA 2IPNA 3K5IA 5B4TA 1NIJA 1LK7A 4EJ6A 4CODB 2VPYA 3CKLA 1SB3C 4UUOA 4XVUA 4Z8YA 5FJJA 3LI2A 1E0SA 3IM1A 4AKGA 3I4LA 3MJHA 1Q6ZA 3OQHA 4BE4A 1E79D 5FH9A 1T8RA 2L18A 2UYQA 2JLCA 2OXOA 4NDAA 4YNBA 1VMEA 4NBRA 5IJWA 4J4BA 2IXBA 1JR3E 3L6BA 1GGVA 3AR8A 3RS2A 3K0CC 3UA3A 3FF1A 2ZCJA 3OZRA 2GNOA 3OOYA 2W2MA 2Z95A 3ZHYA 1TO1E 2W7TA 1IPEA 3GJ4A 2VH1A 3SSNA 4DOAA 2VYVD 1RI4A 2IK8A 4FNMA 5JHHB 3OC0A 1I24A 4PVCA 2OG1A 1UQRA 1A97A 4TWBA 1NVVQ 2CXOA 3ONNA 2GJ4A 1Q1ZA 2WQZA 2YJNA 1DTWA 3GZNA 5E4YA 2NXNA 3I5MA 3FWYA 1Q3KA 4Z0PA 2Z9DA 4JJEA 4RQAA 2HKIA 4MPPA 2V7VA 2X9LA 4BKQA 1JQDA 1T91A 4EKYA 8ICCA 1D03A 1MIOB 3GNQA 4RVHA 1E3DA 1UP4A 2J3IA 4CXMA 4NLBA 2AUMA 1D1SA 5JFGA 1XJ0A 5JC8A 4YMTA 3ITEA 2OC9A 4HNHA 2R6JA 2VA3A 4JHLA 1JEQA 1D6SA 4BAZA 3QUSA 1E3SA 5BN4B 4JC0A 3OHAA 3RUCA 1GNTA 2Q3CA 1TM2A 3V9AA 3IEIA 3SWWA 1CLUA 3D6JA 4J4HA 3I9NA 3VGJA 3WBKA 4CEHA 1QHIA 1TM7E 5F3DA 4PR3A 1RCTE 5EERA 3LRPA 3ENZA 4DF8A 3BIFA 3RJ9A 5B36A 1IZYA 1N63A 4G1VA 2JHAA 13PKA 1CJVC 1OXUA 4ODIA 3VX4A 4GDFA 4PN7A 4R1OA 1MW8X 2C29D 1G21B 2JLRA 2RJOA 3OLYA 3QXJA 5AKEA 5JDIC 4HMOA 3ZV6A 1DFHA 1QZ3A 2M1XA 4WBNB 4JK1A 2XQGA 3WLLA 4Q93A 5DN6D 3RS9A 3JV7A 2WTBA 5GONA 1A96A 4YMIA 2PMZF 1E9CA 3NP9A 4NDNE 2OQ2A 4PQYA 1DS6A 1MBZA 2X9GA 2Q6VA 2VCEA 4H15A 3SHTA 1S8NA 3FVQA 4BCBA 4QZIA 1SXHA 5HM8A 2N3ZA 4UBJA 4FFMA 1QAQA 2C9DA 2AL7A 3RK1A 7ICOA 2OORA 5JS7A 3CLVA 4IGAA 2C4VA 2BJHA 2W0MA 2BCUA 5GV7A 2HJVA 2WHEA 1VL2A 2NWQA 3TNDA 2GCEA 1CRQA 3TJMA 3MB8A 3A9CA 4LJLA 4FK8A 5HFAA 3VYTB 4R8MA 4BJ5A 2ORWA 4UNQA 1YASA 2ZRAA 4YPFA 4O6VA 5TS2A 4CM6A 3Q8MA 3VPAA 2CVOA 4W1PA 1PD1A 3DHWC 3NHWA 5ESRA 1YTLA 3DZBA 4UB3A 5A0FA 4HNSA 4L4UA 4NZNA 3T54A 5A05A 3V80A 4KH1A 1CY8A 2QTAA 2DOKA 3DL7A 3KJEA 1YKGA 5A9SA 3GGSA 2QW1A 2BKVA 3K70B 4TMWA 4MV4A 2AFHB 3TSOA 5I4CA 4M2YA 3WZMA 1T0PA 1IV8A 5C8ZA 3EFOB 4AQDA 1U1FA 2VZLA 1XVIA 4IIJF 2YJZA 1GNPA 4PLTA 3HKBA 2PZGA 1ND5A 3SZ2A 2QDXA 3K05A 3JTEA 2FXVA 3GHYA 4QT0A 5I5EA 3LWDA 1NBMD 1RYSA 3PRHA 1UWCA 1NLMA 3F78A 4HXFB 2IS2A 5K0NA 4F04A 1ZQUA 4ND8B 5L4NA 1YT3A 4ZD6A 1F60A 2GGSA 2JA2A 2W48A 1PZEA 2ZCVA 3LT2A 3PXEA 2PX2A 2KZ3A 3HY6A 3PQ5A 2R6ZA 1RTTA 1A82A 1S9FA 1W35A 4PGXA 3G49A 2ZJ7A 4RHUA 4KG7A 2ZBDA 1WPXA 3OE7A 1TDJA 3ROEA 3I6QA 5LYJB 4K8OA 5L7TA 1WY5A 3O47A 1AKEA 5LVAA 3IUYA 2K8AA 3AKDA 5BOMA 4CLEA 4JB2A 4TS1A 1U80A 3MJDA 3IUMA 3MR6A 2GWRA 3ZWDA 1T5DX 2PS1A 3AF5A 3A2LA 3B1WA 3W5IA 2BSXA 3QZ7A 1GSHA 4HGYA 5ELMA 3SR6A 3UAYA 3ZU3A 1ES9A 4EYKA 4I28A 2OV3A 1FF9A 4D4IA 4CMJA 4IF6A 2POQX 3DTYA 2E9SA 3HUEA 1BPZA 1DAIA 1UANA 1U6KA 4IHKA 3S2GA 2OEHA 1OA0A 1NBWB 3FMOB 3TYXA 3ZDCA 2DG2A 3R6LA 1QKJA 4KFCA 3QHPA 4BHTA 3GFTA 1WTAA 1BX1A 1KDOA 1E1LA 4KLIA 2AR7A 3E5RA 1XVVA 4Q8FA 4GYKA 2ICAA 2ZDQA 3D5TA 2A6PA 4GGMX 4IKOA 1YV9A 4Z4QA 3ZDAA 1UIRA 4HAIA 3VZQA 4Z0HO 5HXAA 4EL0A 1X9MA 1UBKS 1AK1A 4QYIA 3EPLA 5J2FA 3DFZA 3ADOA 1IWPB 2HO5A 3GFSA 1EFDN 3A4YA 5CVUA 4W9RA 2OB2A 1Y80A 1FIQA 4B3RB 2JATA 1RWMA 2NMVA 1OLUA 1S3FA 4Q3DA 2FG7C 1AOXA 5KREA 3VR5D 1E92A 1QVWA 4IDDA 1N1GA 3QY9A 4ZGWA 5H81A 2CNBA 2ZZMA 5EIBC 1EHCA 1XL1A 3UMMA 4RFSA 3WWYA 1ULBA 1WW8A 4B6EA 4BLUA 4DUPA 3RSOA 1DDGA 2GJAA 2AIRA 3ZDQA 2QLJA 5REQB 1JMVA 4B85A 2IGTA 4K26A 1XQYA 1N5OX 3LVRE 3KL4A 1M34E 2CNWD 2NX2A 4Q1FA 4AP5A 2M6SA 4F6RA 5LLTA 4E1VA 4LCBA 2BM1A 2WK1A 4KXUA 3KQMA 1A71A 1K8QA 1Y8QB 3D1VA 2P5TB 3HP7A 1KKLA 4CIVA 3R0JA 2A30A 5EC8A 2P5UA 4BGDA 2C2EA 4C87A 1VCHA 4G0MA 3IKVA 2FFAA 3K6JA 2ZIUB 1HDIA 3RRFA 1CY7A 5LD2C 2ZBVA 4FIZA 3A1FA 4UCFA 3K0CA 2Q29A 1KFSA 3WGVA 4FNGA 5HJ7A 2YXLA 4K9LA 3X0DA 3MUOA 4JI6B 1CXZA 3L84A 4EENA 3UQZA 1YDFA 4F92B 3D6UA 4RM2A 3ZQ6A 3QKRA 2UU9B 4LVSA 5A9TA 2JGLA 4DL6A 4B6GA 1D5WA 3UPDA 1XBTA 3ZIAD 5JXWA 3NORA 3UYLA 1IC6A 1GFIA 3V7YA 4UHCA 5HZMA 4FGJA 4I7EA 3T7DA 2AKAB 5FBQB 4D82A 1Z82A 2W2PA 5M29A 5LQCA 4CM1A 1DJLA 2AE1A 2SKDA 4EG4A 2VYND 5E6RA 1JR3A 4AY6A 4BO4A 1UP6A 4QOFA 5IJ9A 1DAPA 3QOFA 1IUNA 1UJCA 3GXOA 4KXXA 4RHXA 2IHTA 3JVVA 1U7UA 2KSQA 4FOSA 4ELVA 5DBAA 4UBKA 2PZBA 2Q1YA 4AY5A 1Q17A 3BCHA 5B58C 4CKEB 2O0KA 3O8OB 1U11A 3OX4A 4JCOA 2HA7A 2Z8YA 1ZCAA 5JV5A 3WB1A 4UCWA 2JJ2D 3DF7A 1DG9A 4FCCA 2HYIC 2WAQC 3HLYA 3SC2A 4DQKA 3H5IA 4Z3OA 1VLJA 5E4TA 3RLIA 2DHEA 3SJBA 8ADHA 2BFFA 1OXJA 3OTGA 2VDRB 1XPUA 5AVKA 4A5OA 2WKRA 3NNSA 4O33A 2XI9A 2JIQA 3LYSA 3KTOA 2QK4A 1PZFA 4RL6A 5IDWA 1N5RA 2O8CB 3L82B 4YRZA 5KOHB 5SYAA 3OTHA 3NT4A 4A8HA 5CMLA 5JY6A 3EZ2A 5EXPA 1GD1O 2FN4A 1DO2A 2XB6A 4DDMA 1GUFA 1E69A 2YJ6A 1XK6A 1HKUA 4L6AA 2P79A 2QQ0A 1JECA 1OAOA 4N5DA 5ER9A 4RTPA 5K0JA 3EBOA 4H0NA 2YNMD 3M70A 2ZR8A 4CL3A 3UM9A 3QX9A 5CPBA 3OQOA 3I34X 1BQ3A 2Y1GA 4AU1A 4JJKA 2VZ0A 5EI5A 2WP8J 4HKTA 4R2XA 1LBQA 2ZB8A 4DMCA 1PFQA 1BOFA 1J5EB 7ICJA 1NSFA 2GAAA 2COKA 1GKKA 1I3KA 5EG5A 1SOVA 3N8GA 4XYLA 3GDGA 5C0OE 1JKFA 3DGEC 2AZ4A 1WKBA 3AQIA 4KRXA 4F91B 1ZUIA 3PK0A 3TZ6A 4P32A 4GBMA 5KFXA 1PG5A 5AKYA 3GCDA 4V38A 1YA4A 3DE2X 1P31A 1L4EA 4U2EA 4LRUA 3RKSA 3L9WA 1ZJ6A 3BH7A 3SYLA 2EW1A 5KYUA 1W1WA 3LYUA 4GOXA 3VJKA 1ID8A 4PBTA 1MA0A 2HCBA 3S68A 3GIMA 1Y1LA 4WASA 2BBOA 4GUDA 4C4AA 3WLTA 1CS4C 3WGIA 3UJAA 1LU9A 3IG5A 2Q6LA 4KE8A 3KD2A 4D2IA 1FO4A 4JN6B 4JOCA 2ABWA 2MSDB 4YLEA 3UH1A 2O8EA 3TIGA 2J48A 3D1JA 4Q4HB 2QTNA 2J9XB 3F3SA 3FVRA 3EA5A 1O96B 2F59A 4RNDB 1WXFA 2ZB7A 1DARA 3VVCA 1U0SY 2CNOA 4A0QA 3D6TB 3OT1B 2ISPA 1YB5A 3GA7A 2NN3C 3BL8A 1OFUX 5BOSB 2LIVA 1U31A 3MWFA 1KEVA 4FI3C 4X1IA 1UDXA 1VJCA 5AOAA 5IYZB 3TXYA 1AB6A 4X1KA 3IERA 1R6VA 3PJFA 2G17A 8ICTA 5E79U 4KB5A 5CNIA 1RYEA 2HU2A 1X7YB 5TIIA 4P92A 5C1DA 3NGDA 4KR2A 2XOKD 5DTMA 4DLGA 4KLUA 2C2KA 4RYDA 2JD1A 5TSDA 5DJ5A 2J33A 3FETA 5J2EA 5KYVA 1OLXB 2JKVA 4DMHA 1J2YA 3ETNA 5KYYA 5IVKA 2V4RA 3JALA 5IVIA 2QJTA 5IN5A 3H2HA 4QNNA 3B12A 1MH9A 2IZ1A 1QO0D 3IALA 5CLFA 1TZJA 4PYQA 1KI1A 4WIAA 3FBWA 3QP9A 1RKQA 5FA8A 1V8DA 2QS9A 4BZQA 5HHTA 1HDGO 3K70D 1XNRB 3F3YA 3HWX1 4DCCA 4FLEA 2HWXA 4EUFA 2VP4A 5GIPE 4UMVA 4R7ZA 1XHEA 3RBDA 1J7JA 2I6XA 1E7QA 1RXSA 2FXIA 2H3IA 4XGKA 4YRSA 1KBUA 2IPXA 4QNMA 3WIEA 4HZGA 2FOLA 2OB1A 3HRHA 1ZH8A 1TIPA 1WXXA 1ISIA 1AQIA 4ZI7B 2QLLA 4OF4A 3G82C 3HKZC 1C0KA 1CB0A 4KSCA 1ZD9A 3HR7A 3O0DA 9ICBA 3G68A 2ZYRA 2I6UA 4PZOA 3EULA 5FBWB 3NKLA 1CRWG 1JIJA 4RJIA 2O06A 3NMUF 1MJHA 1HETA 3UF0A 1DE0A 3ZWPA 1NN3A 1JYSA 2PAAA 3NRZA 2OAQ1 5H80A 5DT2A 1XEFA 3N0TA 5FPHA 1U7OA 3J81k 1GZ5A 1H2EA 4P1ZA 1TF2A 1UBTS 1BH2A 3WK5A 1C50A 5JSZB 4L08A 2DPGA 1XLWA 2GZHA 4QGGA 3ED1A 4OA8A 4N5HX 1P80A 3PCTA 4D44A 2JLBA 2PLFA 2VAXA 3NG1A 5I9SA 3T5KA 1RQNA 2WVGA 1QQ5A 3LP8A 3MYRA 4V0RA 3UGTA 2Z2XA 5B3JC 1UBGA 1U02A 2J6IA 5J0PA 1QIEA 2UDPA 2ZSHA 4NP6A 2BFWA 3COPA 2P6PA 3PE6A 5BUSA 3WK9A 4PCUA 2J8ZA 2JJQA 1YR1A 2O20A 1KNQA 3DBLB 2KJQA 4C7ZA 4IPTA 1Y7LA 3SJAA 3WKCA 1REQA 4LA4A 4B0OA 2OHGA 3OQJA 5JS1A 2ZAMA 2QEQA 5K4HA 4G5GA 4YT4A 1N6IA 3IH5A 5K6AC 3I9V1 3VBEA 3RU3A 3ZLTA 2VJOA 5CHYA 1M34A 4HNAA 2ODNA 2CCJA 4YO8A 5A1TA 5KFIA 1WOMA 5IXSA 4OQNA 3PSFA 1OX5A 4IDEA 4FVTA 5HJ2A 4HV4A 4PQFA 2PD3A 1PAUA 4AG5A 4JV1A 1NMZA 1OFGA 2JFZA 4F3CA 1RAGA 3MTDA 5F2KA 3PY8A 8ICPA 4FDMA 4J2TA 1SVWA 1URJA 5KQLA 3GV0A 3T34A 3PX4A 3N2GB 3F8WA 1ESMA 2X5XA 2EVWX 2VPZA 3NU1A 4RE5A 2R2AA 4UXHA 3F74A 5CRIA 4KQJA 1XCJA 3NI2A 4O08A 3MGBA 3H3FA 4CMIB 1RJDA 3C21A 3IXQA 2ATEA 2G8LA 3KG2A 4MYUA 3D43A 1T5OA 1G17A 1Z4LA 4IEIA 8ICBA 1TUGA 5HOEA 3PNVA 3UV3A 1DGSA 1SVMA 4L8LA 4P4MA 1JHVA 2PUAA 3EUEA 4B3HA 2A1UA 2XGJA 3TEMA 2Q21A 3USES 3ZX5A 1CR1A 1RLMA 4FDAA 1QFSA 2HXYA 3BPSA 5T4FA 1PK1B 2CHEA 3WQRA 4UCXA 1J2NA 5U1PA 2R8GA 4OUKX 4FZ3A 1PFVA 5JNVA 3A6ZA 1T3GA 2BYTA 1VJDA 1KARA 1VSBA 3OFKA 4M0CA 5G2OA 3WGHA 1LCIA 2PNFA 4B7AA 1XFDA 2HK7A 3IAUA 4RU9A 2YYYA 4XDZA 1EB8A 4S1PA 3UC9A 3S27A 3BA6A 3WISA 3FNRA 4YXFA 1ULUA 4LZDA 3KX2A 3KZKA 3MLAA 3C3PA 4BFWA 1NVMB 5BSKA 3AOEC 3IMFA 4ROTA 3JQBA 2FQXA 4H31A 5DHUA 1NOIA 2ZTVA 1YE5A 4M9QA 3GVPA 2KSOA 1CHDA 3QXHA 3ZH2A 3GVCA 1IN8A 4AXBA 1I94B 1KKXA 3ZY3A 4YK7A 5AESA 3E9EA 1G63A 4GOOD 2AW3A 2OP1A 4YMHA 5KC8A 3W1VA 1V1RB 2VPIA 5BSMA 5GZ3A 1G64A 1L4LA 3KD3A 1CK4A 1TLFA 1ZCJA 4TTAA 2UXCB 2XMBA 4QYMA 3JYHA 1JIXA 4ZRDA 1VB3A 4FD2A 3GT7A 5HK8A 3ZU5A 3PRYA 3T3NA 2HHJA 5CFNA 1U1EA 5K3OA 4DSIA 2OENG 3AVPA 3K4PA 4QTXA 1E6MA 4DMLA 2VAPA 1H23A 1IEVA 1Z0UA 4JC4A 1ZINA 1DAKA 2AC2A 3AQ4A 5J4KA 4ED8A 4MVJG 2EYQA 1VLHA 1QB7A 3ZU4A 5LLDA 3I5YA 3FNQA 3BS5B 1H38A 3PS9A 3MN1A 4FFBA 4ZT7A 4MJ3A 2CY0A 1PJCA 2P2YA 3DEZA 4J0IA 2BFCB 4HTFA 4OQEA 2XMDA 2AC4A 1QORA 1N75A 2ETXA 4QO8A 1WPGA 4DSFA 1QWSA 4Z6EA 4ZYWA 5KVQA 4LFCB 1UC5B 3HQ4O 3A0UA 5DGHA 1K63A 3HLKA 3ZJ5A 3W5UA 4Y2JA 3TNLA 1OWNA 3IVMA 1JJBA 3HRIA 3JYQA 4DA8A 2EZ8A 2I4RA 1BVRA 1DWQA 4XA8A 2JFQA 3KZ1E