2DL0A

Solution structure of the sam-domain of the sam and sh3 domain containing protein 1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
GSSGSSGGGLTEICRKPVSPGCISSVSDWLISIGLPMYAGTLSTAGFSTLSQVPSLSHTCLQEAGITEERHIRKLLSAARLFKLPPGPEAMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM and SH3 domain-containing protein 1
publication title Solution structure of the SAM-domain of the SAM and SH3 domain containing protein 1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2dl0A01
1UQVA 2QKQA 2YTUA 3SEIA 5J8YA 1SV4A 2JV3A 1F0MA 2QB0B 2Y9UA 2KSOB 2Y9TA 2ES6A 2F44A 1Z1VA 4IS7A 1DXSA 1RG6A 5KNIA 2EAPA 1LKYB 2DKXA 2FE9A 4NJ8A 2F8KA 1PK1A 1OW5A 3BS5B 3TACB 1UCVA 5JTIA 1X40A 1B4FA 2B6GA 4NL9C 2F3NA 2DKZA 2GLEA 1X66A 2LPEA 2DL0A 3H8MA 1WWUA 2KE7A 1PK3A 2QARB 1SGGA 5F3XB 4NL9A 2QB0A 3HILA 2KSOA 2E8MA 2KMDA 3KKAC 4PZNA 2EAMA 1SV0C 2L5YA 1OXJA 1SXDA 3BS5A 1V38A 2K60A 1SXEA 4MHVA 1V85A 3K1RB 3KKAA 2QB1A 4PZOA 3BS7A 2EANA 1SV0A 1WWVA 1X9XA 5JRTA 3SENA 2E8NA 2LMRA 2QARA 3IDWA 1LKYA 3TADC 5JU5A 2E8OA 1PK1B 3BQ7A 1JI7A 2D8CA 4RQMA 5J8YC 2E8PA 1COKA 1B0XA 2ESEA 5L1MA 4RQNA 2D3DA 2KIVA 2EAOA 3TADA 1KW4A 2K4PA 2KG5A
chains in the Genus database with same CATH superfamily
4KTQA 2F1IA 1RYRA 1NOMA 2KSOB 1TFRA 3WK8A 2LYAA 3PW2A 4GC7A 4Y2VA 5KG6A 2R18A 5KNIA 4DLEA 2A19A 3OJSA 3IP4B 3PW7A 4ECTA 5JTIA 1Z19A 1FFUA 1Y88A 2R8IA 3FC4A 2W9MA 4KLQA 1UT5A 3TAQA 4Y2QA 5E79U 5DQIA 2HSZA 2XY6A 4XQ8A 1ZQAA 4G3IA 4UQGA 5KAIU 3KFUF 5A0LA 5C0YA 4ACOA 5AM1A 4MFCA 3HILA 4KITB 5IIKA 3TFRA 4K4HA 3SAGA 4UATA 3C5FA 4DS4A 5ALPA 1X42A 2ZXIA 3VCBA 1ZJNA 1YZ6A 8ICTA 1ZOLA 4NM1A 2G07A 5B5EU 2KKVA 1C7YA 3PV8A 2BDPA 5GTIU 2QLTA 4RNNA 5CR0A 8ICQA 1L3TA 4I2IA 5CA7A 3SENA 4QIWF 4US8A 2JEIA 8ICMA 5JU5A 2Y1IA 3QUBA 1CEZA 3BQ0A 5AKGA 3F2BA 5J2CA 5EE0A 5CEHA 3GILA 5ALRA 2MUTB 1ZQRA 4KLLA 1KTQA 2AGOA 2E8PA 1IIPA 1RYSA 4G9BA 2V9WA 3D6JA 7ICPA 9ICPA 1QSSA 4Y2RA 1SWVA 3F5EA 4Y2SA 5HMLA 2WB1F 4M9HA 2K4HA 4B9NA 1XS9D 3UQ0A 1MQ2A 5J2FA 4FZLA 1SV4A 1ZQJA 2QB0B 2ZIWA 1NI3A 4UB2A 5J2DA 1ZQQA 2NRXA 2YY6A 4P2HA 7ICFA 4WJ3B 4RZRA 5DBAA 4FE3A 3HKZF 1KLNA 3T5JA 3BS5B 3QE9Y 3AL0B 2G0AA 1MSWD 5ALEA 4DEZA 3JPTA 1NK5A 1JXEA 3F2DA 3M8SA 1S0OA 2KHQA 3QU4A 4EZ6A 2IOHA 4MF2A 2LPEA 1JN3A 3RTVA 3RJFA 2NYVA 5DKWA 4KLIA 4Y2UA 2WF8A 1KBUA 2KP7A 3ZD9A 4DL5A 5ALJA 4RNOA 4Z6CA 5L9XA 2FDRA 3ISBA 4EBCA 1WCNA 3GZFA 3JPQA 2W9CA 4ED3A 3PX0A 2KICA 4UBBA 4J03A 4ZOHC 3D2QA 2PFPA 2Y0SC 2HI0A 5ALWA 3GIJA 2G09A 4JB3A 4UB6U 4DFPA 1WWVA 3C1YA 4M6WA 4DQQA 1V97A 4R8UB 3KHLA 3RFAA 2VA2A 1S76D 4P4OA 9ICWA 3OSPA 8ICSA 5L1KA 2K4EA 4IRCA 1DK2A 1TVAA 2N1RA 2E1FA 3AEVA 1J2MA 2WTFA 2ASLA 4AP9A 4Q8EA 3AU6A 3MGIA 3PSIA 1L7OA 2BCRA 3ICXA 4F72A 2WAQC 2F76X 3JPPA 3GIKA 4B9SA 2DBYA 2KZMA 4B9LA 1PZNA 4HYKA 1JX4A 4I2JA 3UXOA 1X9MA 5CRXA 5BOLA 1T7PA 1D9DA 8ICVA 1DXSA 4PHDA 9ICGA 4KLJA 4IC9A 3IG5A 1LB2B 1QLNA 3JPSA 1OW5A 2HOFA 1N56A 3BJYA 2PMZF 2B0CA 4EEKA 3QNMA 1ZQMA 4DFJA 2NV3A 1DGSA 4C80A 3D2SA 1X66A 4JWNA 2KFZA 1FFVA 3KBBA 2R8JA 3M7DA 1WWUA 2HOQA 4BX9C 3GIIA 5DGAA 3DEEA 2ZIVA 4KN7A 8ICKA 3JPRA 1JIHA 3N7RC 3NVWA 2VJ5A 2LHTA 3FYHA 3CYMA 5ALYA 4ECQA 2I1QA 2Q0ZX 3MR2A 2HCFA 5JUMA 5DB8A 3T5LA 1XO1A 4Y2PA 1ZQUA 1QSYA 3OTQA 3F53A 2AHOB 5AK3A 5AI4A 4RPZA 2DWQA 8ICGA 2WFAA 4B6JA 5KFFA 4IRDA 4CCHA 5DG8A 2UVWA 2ESEA 5KL1B 2KNJA 1ZETA 1S0VA 1SKRA 3BQ2A 1QQ6A 4GC6A 1ZD2P 4DSJA 5G5GA 1UQVA 2QKQA 2B21A 5J29A 3WK7A 3KZXA 3RJJA 4QNLA 3RBDA 4RT2A 8ICHA 2Y9TA 2HVIA 2XGPA 5FP0A 4C4SA 1SIJA 3QU5A 2ES6A 2AJQA 5CWRA 9ICNA 1TK5A 5IIJA 2BCSA 2ASJA 2KOBA 1XWLA 2RDJA 3MR3A 5ALLA 5ALGA 4ED8A 5IIMA 4P0PA 4IL6U 4J9NA 1KDHA 3B0XA 1NK8A 5J2KA 4ICAA 5AKYA 4NXZA 5DB9A 1KFSA 5KFKA 4BWJA 5AKXA 1K5OA 2PI5A 5AM0A 1VLBA 5AI9A 3ZDAA 4DOBA 9ICEA 1Z00A 8ICEA 4JV2A 2EDUA 2YMLA 3UXNA 3ALRA 4ECXA 2W9BA 4QZ9A 3SAFA 1BPXA 1ZQTA 1KRPA 4UAVA 4IR1A 5K4LA 3WKAA 7ICMA 2BPGA 1XNSA 4MF8A 2OXOA 1ZQPA 4F93B 7ICJA 3RAQA 9ICJA 9ICAA 7ICEA 2M0NA 2QB1A 2YN4A 5D49A 1NK4A 4IQWA 1ZXIA 4RQ1A 5KT6A 2P35A 1H38A 1QSLA 1X9XA 4KLDA 1X6JA 1S0NA 2E8NA 3B0YA 8ICCA 3SMVA 4QZIA 1F44A 4J9LA 4QW9A 5AKZA 8ICRA 3L3FX 1ZRMA 4YR3A 3BQ7A 1KSPA 2K8CB 1JI7A 4UB1A 4UAWA 2KHVA 3HWTA 3MFHA 1COKA 3Q8QB 4DS5A 4DSFA 5KFBA 3V72A 1X9WA 1KEJA 2IOFA 1BPDA 2Q4TA 4K4IA 2IA6A 3B9JA 4KLHA 3H0MB 1ZQXA 3OJUA 2HHTA 3OHAA 4FBUA 7ICHA 2VJ4A 1SZPA 1U49A 2NRZA 2W9AA 3G6XA 4YXMA 5AKJA 3A0BU 4PH5A 4QZEA 4EX6A 4B9VA 4Q45A 4CGZA 2AH5A 1LV5A 2DFLA 8ICJA 2PXIA 4UASA 1UCVA 1SL2A 1N5XA 2B6GA 3V7JA 3H0RB 4NWIA 1ZD5A 4AYBC 1ZQBA 2KE7A 5AK4A 2LKYA 2NRWA 2K8BB 1FEZA 2OCEA 3LDAA 5KFXA 4F71A 1MN8A 2H3FA 2G5IB 4CRXA 2L5YA 1JRPA 4GFJA 3HW8A 4P0QA 1FIQA 7ICNA 4MFFA 4C8KA 1ZQGA 3NUQA 4XRHA 5J2HA 4YG2A 1B22A 2EZXA 2PKEA 5AM5A 5DBBA 1XSPA 1BPBA 1SKWA 2XY5A 4O3NA 4DSLA 3SAHA 5L1JA 3QUQA 1ZQEA 7ICVA 2XCPA 3IDWA 4PJ0U 1V9PA 3C5GA 4ECYA 1NK7A 5KAFU 4OJ5A 3H7IA 4FS1A 3E2EA 5J8YC 1XU4A 4NLZA 9ICUA 5KTQA 4ED2A 4PGXA 5DB7A 4OD0A 4CF5A 2IMWP 1K1QA 3H8JA 4O3PA 2KG5A 9ICSA 3RR7A 4OO1J 1HJPA 5ALMA 5KFCA 5J0WA 5J8YA 4BJQA 4DFMA 2EQYA 2LYHA 4F2RA 5EE1A 1RQLA 5DQHA 2ZIUB 1JXLA 2HVHA 7ICRA 5ALOA 2JXJA 2KFNA 4F4XA 3ONNA 3OPXA 4LVSA 3PW5A 1X40A 2HBLA 1B4FA 2HBKA 4M9NA 4B9MA 4M9LA 2JR5A 9ICOA 5KFPA 2DKZA 4I27A 4C8NA 2FPLA 3RH4A 4PHPA 1L8OA 3EW9A 3H8MA 3C2MA 4DL6A 1PVRA 1SGGA 2FLPA 3RB0A 5EE3A 2RHFA 3PZPA 2KMDA 3MGVA 8ICBA 4F4YA 5KG4A 1U47A 3N28A 3MR5A 1OXJA 2E3TA 4F3OA 1NK6A 3V6HA 3Q8LA 3ZDEA 8ICUA 2WF9A 2XO7A 4C8MA 2EANA 2KVSA 5KFLA 5HHHA 4KLTA 2DQNB 4F8RA 2ZG6A 2YMPA 2KJ5A 3K75D 3NASA 5KG2A 3T3FA 4ECUA 1LKYA 2RQ5A 3QU2A 3V7KA 1PK1B 4YXJA 4O3SA 2KTQA 4CDGA 4RT3A 1NJXA 3AQEA 4F4KA 8ICZA 5KG5A 2AQ4A 2JMGA 4RQNA 2HOIA 2HBMA 5KT7A 3TQ1A 2FPKA 3KTQA 2GH1A 3BDPA 2FMSA 8ICIA 1S9FA 2KD1A 1RYUA 1UPHA 4EBEA 4YD1A 5KFQA 3WK9A 1ZYQA 5ALUA 4IS7A 1QTMA 5KG3A 5EOZA 2BGWA 8ICYA 1Z4OA 5ALVA 1UHUA 2EAPA 2FE9A 4J9MA 1HEKA 3C21A 1NKBA 3T5HA 5J2EA 2GWSA 5DDYA 3UMBA 1M6YA 1BGXT 4NY8A 4NL9C 3H4DA 4QZAA 1S77D 4I2GA 3PO4A 3QEBZ 4DQSA 1BNPA 3KHGA 4I28A 2XICA 4I2AA 2E5SA 4O5CA 1DRGA 3C1ZA 3GIMA 4M2YA 4NL9A 1K1SA 4M47A 5CP2A 4BXOB 1WUDA 1NJYA 2C2DA 1JMSA 1S10A 3DDHA 1D8LA 1VJ5A 4TURA 2BCQA 1ZQCA 2PFQA 4KX3A 3U26A 2VIXA 1SXEA 3KHHA 1WG8A 2YX8A 3MFIA 3SV3A 8ICPA 5DLFA 2AGQA 4DSKA 2JGAA 3HRDD 9ICKA 2Y1JA 4KLGA 2MAXA 5BOMA 3RJEA 2R8GA 1L3SA 4RUCA 3GV8B 4DL7A 1YZ7A 2QARA 2XI9A 4J9QA 5J2IA 3MR6A 2VA3A 3ZI4A 3CP8A 1U4BA 4QZFA 2OWOA 2D8CA 7ICIA 1RZTA 5HMMA 2GO7A 4YMNA 3AMZA 4LZGA 9ICBA 5HR6A 2ZTDA 2BQUA 2KJ8A 4XA5A 2DPJA 3RR8A 3WKEA 2F8LA 3RB4A 2JH1A 2BKEA 5KFRA 1S0MA 2KJ9A 3WKBA 4EEYA 2NRTA 4C4RA 5EWEA 5AKLA 3RRGA 1QH9A 4I2BA 2ZIXA 3DV9A 2C22A 4JUZA 1SKSA 1ZQYA 5AI8A 1T94A 3M8RA 1X6IA 2G5HB 5AKHA 5KFDA 5DGBA 3CRXA 5AKKA 4ZH4A 4NM2A 1D8YA 1ZQZA 1A76A 4F5RA 2HW3A 4F5PA 4K4GA 2HHWA 5J2GA 2MU2A 4O3MA 4C4TA 3UMGA 4Y2TA 2YB1A 9ICXA 3JPNA 1ZQIA 1J2NA 4I2CA 7ICUA 2Y0SF 4KLEA 4DO9A 3TFSA 4Y2YA 2J6UA 3UMCA 1O03A 2Z7JA 3C29A 3OSNA 2AU0A 1J97A 4OJ6A 2I6XA 2LYBA 7ICSA 4O5KA 3N7PD 4P4MA 3GV7B 5AKIA 4DQRA 4C7ZA 4RUAA 4MFAA 4O5EA 3TKAA 1MC8A 4ECWA 4OJPA 3RB6A 4Y2XA 3QZ7A 3GDXA 2W04A 3MGHA 5CHGA 2GOLA 4NLBA 3AUOA 5EWGA 2LBOA 1X2IA 4NLCA 4DSEA 7ICGA 2D3DA 2BPFA 1DOQA 1RPLA 2JEGA 3ZD8A 1NK9A 3QXGA 3ZDBA 4BGDA 3LWLA 1L7MA 3A0HU 4GXKA 1LKYB 1ZD3A 2K8AA 2W54A 1QCKA 2W8KA 2JRZA 2W8LA 2A1JA 1S8OA 3N7SC 5ALSA 2F3NA 3OGUA 2PFNA 4KN4A 1U45A 2BQRA 3AQFA 4DFDA 2HBJA 5HHIA 2A1AA 4RQ8A 3OHBA 3IV6A 5IIOA 4PPXA 2NRVA 1JUDA 3E0FA 3SD7A 5AK5A 4DQPA 3PVXA 3IRUA 4QZ8A 2KSOA 2OM6A 5J0PA 1RXVA 4USAA 2W55A 3KKAC 4KMUA 3SZ2A 4QZCA 1ZQWA 3LYSA 1SZHA 4UBCA 2KIWA 5KT5A 4FO6A 2YMQA 5DQGA 4JWMA 4BUGA 4QWCA 5L1LA 4MHVA 4F5OA 2KK0A 3KKAA 2F77X 1OUQA 2ZIWB 4RQ4A 1P7DA 9ICMA 1ZD4A 2YQEA 4PGQA 2FMPA 1NNLA 1BVSA 2CXYA 1L8LA 1EXNA 3ED5A 4RQMA 5ALHA 3HP6A 2HHUA 1VDVA 1N60A 2P6UA 4QZDA 3RH5A 1KL9A 4UB4A 1CI4A 3MABA 9ICIA 4R63A 4EYHB 4ECZA 4DFKA 4DWIA 2FLNA 2JV3A 1CRXA 1F0MA 5C5JA 1Z3EB 9ICTA 3H40A 2CN1A 2F44A 2LM4A 2BHNA 4YMMA 1S5LU 2ZJ5A 2UVUA 2W9CB 4UB5A 5EE9A 3TACB 3QEAZ 4EZ9A 2MUTA 5T14A 2PFOA 2XVTA 2V4QA 5KFAA 1CUKA 1L5UA 3PMNA 5KFSA 4M6WB 2OH2A 3H8SA 5J0SA 3UPQA 2G08A 4J9PA 3AM9A 4F4WA 1IG6A 5KFZA 2QB0A 3M6KA 5DG7A 1AQ6A 5AKEA 4ED1A 4UW9A 2XY7A 3BZKA 2IBKA 3TI0A 1SXDA 1UA1A 3BS5A 1V38A 1SB3C 2ZTCA 4J9SA 2YMMA 1NJWA 2J6TA 2K4IA 8ICOA 1ZQFA 5TISU 3NRWA 4BWMA 5JRTA 3HPOA 3K1ZA 8ICNA 1QQ5A 4US9A 4TUQA 5ALNA 3VC8A 4OJOA 3FDSA 3T79A 3TADC 3K4GA 4OCZA 4QWBA 3UXPA 1L6NA 5J0XA 4Z6EA 3H4BA 4QZHA 3C28A 1BPEA 4O9MA 3EUB2 4GXJA 2M9NA 2H3IA 1TK0A 1ZQHA 2JHDA 4QJFB 5KFOA 4C8LA 5IINA 3TADA 2K4PA 5AHXA 1YT3A 4PL2A 3C2KA 8ICAA 3MC1A 3SEIA 1NKEA 2ZIVB 2WF6A 1ZQKA 2VA8A 3RRHA 4O3QA 4R8UA 4O0IA 4DQIA 3RAXA 1GO3F 4ECRA 4ED7A 4TQSA 2ATLA 2RDIA 4AYBF 1B43A 2DF4B 5B66U 4KX5A 3RB3A 3WK4A 7ICQA 4KLSA 4C7YA 2IHNA 4JMUA 7ICOA 4RQ7A 4Q44A 2DL0A 3KZIU 1ZQOA 1IV8A 2XCAA 1PK3A 2LM1A 2G06A 5ALTA 3IHQB 3ISDA 2FI1A 2KKPA 5TZVA 4UAZA 4YR2A 4PZNA 2EAMA 1N62A 1ED1A 2EZYA 4QW8A 4RU9A 2OYYA 3L5KA 2BPCA 4F4ZA 3PY8A 5AK6A 4HAIA 4F92B 4BDPA 2H3ZA 3BS7A 9ICHA 3UQ2A 1XSNA 1A6SA 4R66A 3UM9A 1HIWA 3HX0A 4QIWC 2W3RA 4P0PB 5HNKA 3THVA 1JROA 4DLGA 3PSFA 3PX4A 3C23A 2XC9A 3PSPA 1NZPA 2YTUA 3I76A 2JH7A 2KEYA 5KFIA 4I2HA 3ZDCA 4EBDA 3SR6A 2P6RA 1Z00B 5D4BA 4DL2A 1Z1VA 1ZJMA 2W9BB 2WB1C 3RF9A 4Q43A 3QUCA 2BQ3A 5KG1A 2C2EA 2UVVA 4OJLA 2ALZA 3RH6A 2DUYA 2FMQA 4YCXA 2NO4A 2GLEA 1XC9A 1IM4A 3FAHA 3HKZC 9ICCA 4R64A 2WF5A 4M04A 3SV4A 2ISPA 3Q8PB 2I9GA 1TE2A 3MDAA 3EPIA 2CRXA 5F3XB 2NO5A 4DSIA 1D9FA 4IQTA 1A77A 4NLKA 5HR7A 3M6ZA 2ZJ8A 2FLLA 5J0OA 1TAQA 2OHFA 1KFTA 4M0AA 4KLUA 1ECWA 2W11A 1KQQA 1A0PA 1XO0A 2F2AB 4PHAA 3WKCA 1NJZA 5AM3A 3BQ1A 5DLGA 5HP4A 3EZ5A 1BPYA 2C28A 4FS2A 3PO5A 4M9GA 1UA0A 2ZUCA 1L7PA 4CE6A 3PNCA 4NV0A 4QWAA 3TAPA 3EWAA 3WK5A 1URJA 4NLGA 5IILA 1F5SA 1TK8A 2IOFK 3KD3A 2RP5A 1Z1BA 3NVVA 4YN4A 3V6KA 4EENA 3ORYA 2IHMA 5CB1A 2ZXHA 3SQIA 2F1JA 4A8EA 3G6VA 1LVHA 1PVQA 2EAOA 3M9OB 4ED0A 4RQ6A 1KW4A 5KL8B 1UT8A 3Q8RB 4JV1A 2R8HA 9ICLA 2EH9A 2C2RA 3Q8SB 5ALKA 4DF8A 3AU2A 2ODGA 4DL3A 5ALDA 4QWDA 4P0QB 3SI8A 4CF3A 2AGPA 1DK3A 1KFDA 3GV5B 1WCLA 2P66A 5AI5A 2DPIA 5F9NA 4F50A 1HUZA 5KG7A 4F91B 2JEJA 2W03A 3C2LA 5J2BA 2RRDA 2PMZC 1ZQSA 3PR4A 8ICWA 5IIIA 4J9OA 4F2SA 2H3QA 4TUSA 2E8MA 3HJEA 3N4MB 4I2EA 5J0YA 5GTHU 2MRLA 2W43A 5J0TA 3RBEA 1S97A 7ICLA 2K60A 1KN5A 2RLTA 3JPOA 3EYZA 4PZOA 4F5QA 3L4PA 4EX7A 4YP3A 2MA1A 3QZ8A 3QUTA 4U7CA 9ICRA 1N63A 2K89A 3GFKB 1PUZA 2BR0A 4UB3A 1Q8KA 4DL4A 1C20A 5KFNA 2FJ6A 3MDCA 4RQ0A 1RM6C 1X9SA 4JV0A 3ETRA 1JALA 3WK6A 5KFUA 2KVCA 5H2FU 4DF4A 1ZQ1C 3NS1A 4UARA 4R65A 2Y9UA 2YB4A 4FFDA 5KFMA 8ICXA 2WAQF 1AROP 1O08A 4YR0A 5KFHA 4RQ3A 4I2DA 4IQUA 3GQCA 2ZUBA 3IG8A 2JZBA 2HDOA 3WU2U 1HUOA 2WF7A 4E0DA 4IRKA 4KLFA 4RQ5A 1TV9A 1KKXA 3ZDDA 5J2JA 4RQ2A 3RJIA 4DOAA 1QQ7A 4TQRA 4QZBA 3I28A 4EYIB 1DGJA 3NRZA 5KT3A 4GIBA 3E58A 3S6JA 4JK1A 4PGYA 4CNQA 5AICA 3EPGA 3Q8MA 4YVZA 4CF4A 3T5KA 5AI6A 3PW4A 1T4GA 3KOOA 4F5NA 3BZCA 5KT4A 2ZTEA 2AXTU 2ZIUA 3KHRA 5KFYA 8ICFA 1IXRA 3CW2C 4I29A 5J0RA 3NTUA 4TUPA 2KN7A 1V85A 3R9KA 4YQWA 4X5VA 1NK0A 3LVVA 4ECVA 1MQ3A 1NZBA 5AIBA 5KG0A 1T3QA 1ZQVA 2VANA 3LVWA 2ZJAA 4J9KA 5ALIA 2BZFA 2BDUA 3RJGA 4UB8U 5J0QA 1U48A 4YMOA 1SL0A 1T8EA 1RDFA 5ALFA 1RXWA 2BCUA 1B0XA 3J81j 4PL1A 4B9TA 3AN1A 3WKDA 5KT2A 3PX6A 5L1MA 5DB6A 2E1EA 5J0UA 2FPMA 5KFWA 2O6KA 4QWEA 2ASDA 4MEXA 4C8OA 4FBTA 5DBCA 4ELUA 4FZNA 1TKDA 1BNOA 3NVYA 9ICFA 3V6JA 1L7NA 1N48A 1RG6A 5DDMA 4O3RA 2DGZA 2ISOA 2DKXA 3MBYA 3GU3A 4U6PA 4LZDA 4ELVA 1T3NA 1PK1A 1MA7A 4YD2A 2WHEA 1Q3VA 5KFEA 5J2AA 3TANA 2EZZA 2W3SA 5G5HA 4FZMA 2HHVA 4IQVA 3M1YA 2R8KA 2H5XA 4GLXA 2XGQA 8ICLA 3QU9A 4UAYA 2OEHA 2QARB 4O3OA 3NGDA 4RPXA 5AI0A 4ECSA 5L1IA 1ZQNA 5F9LA 2V4RA 5AM2A 3F2CA 2VKQA 1N2XA 1Q46A 4RNMA 4B9UA 2W7OA 2KZ3A 1TAUA 1WYGA 2HHXA 4C0ZA 5KFJA 1N61A 3O0FA 7ICTA 3M9NB 1U9LA 2I5HA 2A3VA 1D8BA 3D2NA 2ZIXB 5BPCA 7ICKA 3LK9A 3RJHA 2LMRA 4PHEA 1SWWA 1L3UA 2E8OA 5ALZA 4BXOA 3CNHA 3F5AA 4MEYA 3ISCA 4EELA 1Z4NA 3FM9A 4J9RA 4GXIA 3TARA 3N97B 4IR9A 4ED6A 4Z6DA 4I2FA 1ZRNA 1L3VA 4KLOA 2XIDA 3PW0A 5DG9A 1ZQDA 4LJXA 3PR5B 1N5WA 1RQNA 4XUSA 1COOA 1FO4A 2F1HA 2LI6A 2UVRA 2BCVA 2HMXA 4NJ8A 4Y2JA 2F8KA 3ETLA 4DCCA 2J6SA 4DOCA 4KLMA 9ICQA 1XSLA 3QX7A 3H0LB 1TAMA 5AM4A 4QZGA 3BQTA 5AIAA 1BPZA 3LWMA 2KZZA 4Q8FA 3SYZA 3QYPA 3IN5A 4Z6FA 3RJKA 4UAUA 4RPYA 3M9MB 2AQ0A 2MSNA 1SV0C 2HHSA 2ZUDA 3QU7A 1ZQLA 3V7LA 5KFTA 2W7PA 2JZBB 2CPRA 5D46A 1SL1A 5ALQA 9ICVA 3PMLA 3K1RB 5EWFA 1NKCA 1SV0A 4NLNA 2H3VA 2D6FC 4YFKA 4M9JA 5KFVA 5KFGA 4P4PA 3Q8KA 5CJ7A 5ALXA 1Q3UA 3HT3A 3PSTA 2A1JB 3I1YA 2KV2A 3IM1A 1PVPA 4ELTA 2KIVA 2HHQA 4KMOB 2JEFA 3NVZA 2PI4A 3G6YA 3H8WA
chains in the Genus database with same CATH topology
1UQVA 2QKQA 2YTUA 3SEIA 5J8YA 1SV4A 2JV3A 1F0MA 2QB0B 2Y9UA 2KSOB 2Y9TA 2ES6A 2F44A 1Z1VA 4IS7A 1DXSA 1RG6A 5KNIA 2EAPA 1LKYB 2DKXA 2FE9A 4NJ8A 2F8KA 1PK1A 1OW5A 3BS5B 3TACB 1UCVA 5JTIA 1X40A 1B4FA 2B6GA 4NL9C 2F3NA 2DKZA 2GLEA 1X66A 2LPEA 2DL0A 3H8MA 1WWUA 2KE7A 1PK3A 2QARB 1SGGA 5F3XB 4NL9A 2QB0A 3HILA 2KSOA 2E8MA 2KMDA 3KKAC 4PZNA 2EAMA 1SV0C 2L5YA 1OXJA 1SXDA 3BS5A 1V38A 2K60A 1SXEA 4MHVA 1V85A 3K1RB 3KKAA 2QB1A 4PZOA 3BS7A 2EANA 1SV0A 1WWVA 1X9XA 5JRTA 3SENA 2E8NA 2LMRA 2QARA 3IDWA 1LKYA 3TADC 5JU5A 2E8OA 1PK1B 3BQ7A 1JI7A 2D8CA 4RQMA 5J8YC 2E8PA 1COKA 1B0XA 2ESEA 5L1MA 4RQNA 2D3DA 2KIVA 2EAOA 3TADA 1KW4A 2K4PA 2KG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UQV A;  2QKQ A;  2YTU A;  3SEI A;  5J8Y A;  1SV4 A;  2JV3 A;  1F0M A;  2QB0 B;  2Y9U A;  2KSO B;  2Y9T A;  2ES6 A;  2F44 A;  1Z1V A;  4IS7 A;  1DXS A;  1RG6 A;  5KNI A;  2EAP A;  1LKY B;  2DKX A;  2FE9 A;  4NJ8 A;  2F8K A;  1PK1 A;  1OW5 A;  3BS5 B;  3TAC B;  1UCV A;  5JTI A;  1X40 A;  1B4F A;  2B6G A;  4NL9 C;  2F3N A;  2DKZ A;  2GLE A;  1X66 A;  2LPE A;  2DL0 A;  3H8M A;  1WWU A;  2KE7 A;  1PK3 A;  2QAR B;  1SGG A;  5F3X B;  4NL9 A;  2QB0 A;  3HIL A;  2KSO A;  2E8M A;  2KMD A;  3KKA C;  4PZN A;  2EAM A;  1SV0 C;  2L5Y A;  1OXJ A;  1SXD A;  3BS5 A;  1V38 A;  2K60 A;  1SXE A;  4MHV A;  1V85 A;  3K1R B;  3KKA A;  2QB1 A;  4PZO A;  3BS7 A;  2EAN A;  1SV0 A;  1WWV A;  1X9X A;  5JRT A;  3SEN A;  2E8N A;  2LMR A;  2QAR A;  3IDW A;  1LKY A;  3TAD C;  5JU5 A;  2E8O A;  1PK1 B;  3BQ7 A;  1JI7 A;  2D8C A;  4RQM A;  5J8Y C;  2E8P A;  1COK A;  1B0X A;  2ESE A;  5L1M A;  4RQN A;  2D3D A;  2KIV A;  2EAO A;  3TAD A;  1KW4 A;  2K4P A;  2KG5 A; 
#chains in the Genus database with same CATH topology
 4KTQ A;  2F1I A;  1RYR A;  1NOM A;  2KSO B;  1TFR A;  3WK8 A;  2LYA A;  3PW2 A;  4GC7 A;  4Y2V A;  5KG6 A;  2R18 A;  5KNI A;  4DLE A;  2A19 A;  3OJS A;  3IP4 B;  3PW7 A;  4ECT A;  5JTI A;  1Z19 A;  1FFU A;  1Y88 A;  2R8I A;  3FC4 A;  2W9M A;  4KLQ A;  1UT5 A;  3TAQ A;  4Y2Q A;  5E79 U;  5DQI A;  2HSZ A;  2XY6 A;  4XQ8 A;  1ZQA A;  4G3I A;  4UQG A;  5KAI U;  3KFU F;  5A0L A;  5C0Y A;  4ACO A;  5AM1 A;  4MFC A;  3HIL A;  4KIT B;  5IIK A;  3TFR A;  4K4H A;  3SAG A;  4UAT A;  3C5F A;  4DS4 A;  5ALP A;  1X42 A;  2ZXI A;  3VCB A;  1ZJN A;  1YZ6 A;  8ICT A;  1ZOL A;  4NM1 A;  2G07 A;  5B5E U;  2KKV A;  1C7Y A;  3PV8 A;  2BDP A;  5GTI U;  2QLT A;  4RNN A;  5CR0 A;  8ICQ A;  1L3T A;  4I2I A;  5CA7 A;  3SEN A;  4QIW F;  4US8 A;  2JEI A;  8ICM A;  5JU5 A;  2Y1I A;  3QUB A;  1CEZ A;  3BQ0 A;  5AKG A;  3F2B A;  5J2C A;  5EE0 A;  5CEH A;  3GIL A;  5ALR A;  2MUT B;  1ZQR A;  4KLL A;  1KTQ A;  2AGO A;  2E8P A;  1IIP A;  1RYS A;  4G9B A;  2V9W A;  3D6J A;  7ICP A;  9ICP A;  1QSS A;  4Y2R A;  1SWV A;  3F5E A;  4Y2S A;  5HML A;  2WB1 F;  4M9H A;  2K4H A;  4B9N A;  1XS9 D;  3UQ0 A;  1MQ2 A;  5J2F A;  4FZL A;  1SV4 A;  1ZQJ A;  2QB0 B;  2ZIW A;  1NI3 A;  4UB2 A;  5J2D A;  1ZQQ A;  2NRX A;  2YY6 A;  4P2H A;  7ICF A;  4WJ3 B;  4RZR A;  5DBA A;  4FE3 A;  3HKZ F;  1KLN A;  3T5J A;  3BS5 B;  3QE9 Y;  3AL0 B;  2G0A A;  1MSW D;  5ALE A;  4DEZ A;  3JPT A;  1NK5 A;  1JXE A;  3F2D A;  3M8S A;  1S0O A;  2KHQ A;  3QU4 A;  4EZ6 A;  2IOH A;  4MF2 A;  2LPE A;  1JN3 A;  3RTV A;  3RJF A;  2NYV A;  5DKW A;  4KLI A;  4Y2U A;  2WF8 A;  1KBU A;  2KP7 A;  3ZD9 A;  4DL5 A;  5ALJ A;  4RNO A;  4Z6C A;  5L9X A;  2FDR A;  3ISB A;  4EBC A;  1WCN A;  3GZF A;  3JPQ A;  2W9C A;  4ED3 A;  3PX0 A;  2KIC A;  4UBB A;  4J03 A;  4ZOH C;  3D2Q A;  2PFP A;  2Y0S C;  2HI0 A;  5ALW A;  3GIJ A;  2G09 A;  4JB3 A;  4UB6 U;  4DFP A;  1WWV A;  3C1Y A;  4M6W A;  4DQQ A;  1V97 A;  4R8U B;  3KHL A;  3RFA A;  2VA2 A;  1S76 D;  4P4O A;  9ICW A;  3OSP A;  8ICS A;  5L1K A;  2K4E A;  4IRC A;  1DK2 A;  1TVA A;  2N1R A;  2E1F A;  3AEV A;  1J2M A;  2WTF A;  2ASL A;  4AP9 A;  4Q8E A;  3AU6 A;  3MGI A;  3PSI A;  1L7O A;  2BCR A;  3ICX A;  4F72 A;  2WAQ C;  2F76 X;  3JPP A;  3GIK A;  4B9S A;  2DBY A;  2KZM A;  4B9L A;  1PZN A;  4HYK A;  1JX4 A;  4I2J A;  3UXO A;  1X9M A;  5CRX A;  5BOL A;  1T7P A;  1D9D A;  8ICV A;  1DXS A;  4PHD A;  9ICG A;  4KLJ A;  4IC9 A;  3IG5 A;  1LB2 B;  1QLN A;  3JPS A;  1OW5 A;  2HOF A;  1N56 A;  3BJY A;  2PMZ F;  2B0C A;  4EEK A;  3QNM A;  1ZQM A;  4DFJ A;  2NV3 A;  1DGS A;  4C80 A;  3D2S A;  1X66 A;  4JWN A;  2KFZ A;  1FFV A;  3KBB A;  2R8J A;  3M7D A;  1WWU A;  2HOQ A;  4BX9 C;  3GII A;  5DGA A;  3DEE A;  2ZIV A;  4KN7 A;  8ICK A;  3JPR A;  1JIH A;  3N7R C;  3NVW A;  2VJ5 A;  2LHT A;  3FYH A;  3CYM A;  5ALY A;  4ECQ A;  2I1Q A;  2Q0Z X;  3MR2 A;  2HCF A;  5JUM A;  5DB8 A;  3T5L A;  1XO1 A;  4Y2P A;  1ZQU A;  1QSY A;  3OTQ A;  3F53 A;  2AHO B;  5AK3 A;  5AI4 A;  4RPZ A;  2DWQ A;  8ICG A;  2WFA A;  4B6J A;  5KFF A;  4IRD A;  4CCH A;  5DG8 A;  2UVW A;  2ESE A;  5KL1 B;  2KNJ A;  1ZET A;  1S0V A;  1SKR A;  3BQ2 A;  1QQ6 A;  4GC6 A;  1ZD2 P;  4DSJ A;  5G5G A;  1UQV A;  2QKQ A;  2B21 A;  5J29 A;  3WK7 A;  3KZX A;  3RJJ A;  4QNL A;  3RBD A;  4RT2 A;  8ICH A;  2Y9T A;  2HVI A;  2XGP A;  5FP0 A;  4C4S A;  1SIJ A;  3QU5 A;  2ES6 A;  2AJQ A;  5CWR A;  9ICN A;  1TK5 A;  5IIJ A;  2BCS A;  2ASJ A;  2KOB A;  1XWL A;  2RDJ A;  3MR3 A;  5ALL A;  5ALG A;  4ED8 A;  5IIM A;  4P0P A;  4IL6 U;  4J9N A;  1KDH A;  3B0X A;  1NK8 A;  5J2K A;  4ICA A;  5AKY A;  4NXZ A;  5DB9 A;  1KFS A;  5KFK A;  4BWJ A;  5AKX A;  1K5O A;  2PI5 A;  5AM0 A;  1VLB A;  5AI9 A;  3ZDA A;  4DOB A;  9ICE A;  1Z00 A;  8ICE A;  4JV2 A;  2EDU A;  2YML A;  3UXN A;  3ALR A;  4ECX A;  2W9B A;  4QZ9 A;  3SAF A;  1BPX A;  1ZQT A;  1KRP A;  4UAV A;  4IR1 A;  5K4L A;  3WKA A;  7ICM A;  2BPG A;  1XNS A;  4MF8 A;  2OXO A;  1ZQP A;  4F93 B;  7ICJ A;  3RAQ A;  9ICJ A;  9ICA A;  7ICE A;  2M0N A;  2QB1 A;  2YN4 A;  5D49 A;  1NK4 A;  4IQW A;  1ZXI A;  4RQ1 A;  5KT6 A;  2P35 A;  1H38 A;  1QSL A;  1X9X A;  4KLD A;  1X6J A;  1S0N A;  2E8N A;  3B0Y A;  8ICC A;  3SMV A;  4QZI A;  1F44 A;  4J9L A;  4QW9 A;  5AKZ A;  8ICR A;  3L3F X;  1ZRM A;  4YR3 A;  3BQ7 A;  1KSP A;  2K8C B;  1JI7 A;  4UB1 A;  4UAW A;  2KHV A;  3HWT A;  3MFH A;  1COK A;  3Q8Q B;  4DS5 A;  4DSF A;  5KFB A;  3V72 A;  1X9W A;  1KEJ A;  2IOF A;  1BPD A;  2Q4T A;  4K4I A;  2IA6 A;  3B9J A;  4KLH A;  3H0M B;  1ZQX A;  3OJU A;  2HHT A;  3OHA A;  4FBU A;  7ICH A;  2VJ4 A;  1SZP A;  1U49 A;  2NRZ A;  2W9A A;  3G6X A;  4YXM A;  5AKJ A;  3A0B U;  4PH5 A;  4QZE A;  4EX6 A;  4B9V A;  4Q45 A;  4CGZ A;  2AH5 A;  1LV5 A;  2DFL A;  8ICJ A;  2PXI A;  4UAS A;  1UCV A;  1SL2 A;  1N5X A;  2B6G A;  3V7J A;  3H0R B;  4NWI A;  1ZD5 A;  4AYB C;  1ZQB A;  2KE7 A;  5AK4 A;  2LKY A;  2NRW A;  2K8B B;  1FEZ A;  2OCE A;  3LDA A;  5KFX A;  4F71 A;  1MN8 A;  2H3F A;  2G5I B;  4CRX A;  2L5Y A;  1JRP A;  4GFJ A;  3HW8 A;  4P0Q A;  1FIQ A;  7ICN A;  4MFF A;  4C8K A;  1ZQG A;  3NUQ A;  4XRH A;  5J2H A;  4YG2 A;  1B22 A;  2EZX A;  2PKE A;  5AM5 A;  5DBB A;  1XSP A;  1BPB A;  1SKW A;  2XY5 A;  4O3N A;  4DSL A;  3SAH A;  5L1J A;  3QUQ A;  1ZQE A;  7ICV A;  2XCP A;  3IDW A;  4PJ0 U;  1V9P A;  3C5G A;  4ECY A;  1NK7 A;  5KAF U;  4OJ5 A;  3H7I A;  4FS1 A;  3E2E A;  5J8Y C;  1XU4 A;  4NLZ A;  9ICU A;  5KTQ A;  4ED2 A;  4PGX A;  5DB7 A;  4OD0 A;  4CF5 A;  2IMW P;  1K1Q A;  3H8J A;  4O3P A;  2KG5 A;  9ICS A;  3RR7 A;  4OO1 J;  1HJP A;  5ALM A;  5KFC A;  5J0W A;  5J8Y A;  4BJQ A;  4DFM A;  2EQY A;  2LYH A;  4F2R A;  5EE1 A;  1RQL A;  5DQH A;  2ZIU B;  1JXL A;  2HVH A;  7ICR A;  5ALO A;  2JXJ A;  2KFN A;  4F4X A;  3ONN A;  3OPX A;  4LVS A;  3PW5 A;  1X40 A;  2HBL A;  1B4F A;  2HBK A;  4M9N A;  4B9M A;  4M9L A;  2JR5 A;  9ICO A;  5KFP A;  2DKZ A;  4I27 A;  4C8N A;  2FPL A;  3RH4 A;  4PHP A;  1L8O A;  3EW9 A;  3H8M A;  3C2M A;  4DL6 A;  1PVR A;  1SGG A;  2FLP A;  3RB0 A;  5EE3 A;  2RHF A;  3PZP A;  2KMD A;  3MGV A;  8ICB A;  4F4Y A;  5KG4 A;  1U47 A;  3N28 A;  3MR5 A;  1OXJ A;  2E3T A;  4F3O A;  1NK6 A;  3V6H A;  3Q8L A;  3ZDE A;  8ICU A;  2WF9 A;  2XO7 A;  4C8M A;  2EAN A;  2KVS A;  5KFL A;  5HHH A;  4KLT A;  2DQN B;  4F8R A;  2ZG6 A;  2YMP A;  2KJ5 A;  3K75 D;  3NAS A;  5KG2 A;  3T3F A;  4ECU A;  1LKY A;  2RQ5 A;  3QU2 A;  3V7K A;  1PK1 B;  4YXJ A;  4O3S A;  2KTQ A;  4CDG A;  4RT3 A;  1NJX A;  3AQE A;  4F4K A;  8ICZ A;  5KG5 A;  2AQ4 A;  2JMG A;  4RQN A;  2HOI A;  2HBM A;  5KT7 A;  3TQ1 A;  2FPK A;  3KTQ A;  2GH1 A;  3BDP A;  2FMS A;  8ICI A;  1S9F A;  2KD1 A;  1RYU A;  1UPH A;  4EBE A;  4YD1 A;  5KFQ A;  3WK9 A;  1ZYQ A;  5ALU A;  4IS7 A;  1QTM A;  5KG3 A;  5EOZ A;  2BGW A;  8ICY A;  1Z4O A;  5ALV A;  1UHU A;  2EAP A;  2FE9 A;  4J9M A;  1HEK A;  3C21 A;  1NKB A;  3T5H A;  5J2E A;  2GWS A;  5DDY A;  3UMB A;  1M6Y A;  1BGX T;  4NY8 A;  4NL9 C;  3H4D A;  4QZA A;  1S77 D;  4I2G A;  3PO4 A;  3QEB Z;  4DQS A;  1BNP A;  3KHG A;  4I28 A;  2XIC A;  4I2A A;  2E5S A;  4O5C A;  1DRG A;  3C1Z A;  3GIM A;  4M2Y A;  4NL9 A;  1K1S A;  4M47 A;  5CP2 A;  4BXO B;  1WUD A;  1NJY A;  2C2D A;  1JMS A;  1S10 A;  3DDH A;  1D8L A;  1VJ5 A;  4TUR A;  2BCQ A;  1ZQC A;  2PFQ A;  4KX3 A;  3U26 A;  2VIX A;  1SXE A;  3KHH A;  1WG8 A;  2YX8 A;  3MFI A;  3SV3 A;  8ICP A;  5DLF A;  2AGQ A;  4DSK A;  2JGA A;  3HRD D;  9ICK A;  2Y1J A;  4KLG A;  2MAX A;  5BOM A;  3RJE A;  2R8G A;  1L3S A;  4RUC A;  3GV8 B;  4DL7 A;  1YZ7 A;  2QAR A;  2XI9 A;  4J9Q A;  5J2I A;  3MR6 A;  2VA3 A;  3ZI4 A;  3CP8 A;  1U4B A;  4QZF A;  2OWO A;  2D8C A;  7ICI A;  1RZT A;  5HMM A;  2GO7 A;  4YMN A;  3AMZ A;  4LZG A;  9ICB A;  5HR6 A;  2ZTD A;  2BQU A;  2KJ8 A;  4XA5 A;  2DPJ A;  3RR8 A;  3WKE A;  2F8L A;  3RB4 A;  2JH1 A;  2BKE A;  5KFR A;  1S0M A;  2KJ9 A;  3WKB A;  4EEY A;  2NRT A;  4C4R A;  5EWE A;  5AKL A;  3RRG A;  1QH9 A;  4I2B A;  2ZIX A;  3DV9 A;  2C22 A;  4JUZ A;  1SKS A;  1ZQY A;  5AI8 A;  1T94 A;  3M8R A;  1X6I A;  2G5H B;  5AKH A;  5KFD A;  5DGB A;  3CRX A;  5AKK A;  4ZH4 A;  4NM2 A;  1D8Y A;  1ZQZ A;  1A76 A;  4F5R A;  2HW3 A;  4F5P A;  4K4G A;  2HHW A;  5J2G A;  2MU2 A;  4O3M A;  4C4T A;  3UMG A;  4Y2T A;  2YB1 A;  9ICX A;  3JPN A;  1ZQI A;  1J2N A;  4I2C A;  7ICU A;  2Y0S F;  4KLE A;  4DO9 A;  3TFS A;  4Y2Y A;  2J6U A;  3UMC A;  1O03 A;  2Z7J A;  3C29 A;  3OSN A;  2AU0 A;  1J97 A;  4OJ6 A;  2I6X A;  2LYB A;  7ICS A;  4O5K A;  3N7P D;  4P4M A;  3GV7 B;  5AKI A;  4DQR A;  4C7Z A;  4RUA A;  4MFA A;  4O5E A;  3TKA A;  1MC8 A;  4ECW A;  4OJP A;  3RB6 A;  4Y2X A;  3QZ7 A;  3GDX A;  2W04 A;  3MGH A;  5CHG A;  2GOL A;  4NLB A;  3AUO A;  5EWG A;  2LBO A;  1X2I A;  4NLC A;  4DSE A;  7ICG A;  2D3D A;  2BPF A;  1DOQ A;  1RPL A;  2JEG A;  3ZD8 A;  1NK9 A;  3QXG A;  3ZDB A;  4BGD A;  3LWL A;  1L7M A;  3A0H U;  4GXK A;  1LKY B;  1ZD3 A;  2K8A A;  2W54 A;  1QCK A;  2W8K A;  2JRZ A;  2W8L A;  2A1J A;  1S8O A;  3N7S C;  5ALS A;  2F3N A;  3OGU A;  2PFN A;  4KN4 A;  1U45 A;  2BQR A;  3AQF A;  4DFD A;  2HBJ A;  5HHI A;  2A1A A;  4RQ8 A;  3OHB A;  3IV6 A;  5IIO A;  4PPX A;  2NRV A;  1JUD A;  3E0F A;  3SD7 A;  5AK5 A;  4DQP A;  3PVX A;  3IRU A;  4QZ8 A;  2KSO A;  2OM6 A;  5J0P A;  1RXV A;  4USA A;  2W55 A;  3KKA C;  4KMU A;  3SZ2 A;  4QZC A;  1ZQW A;  3LYS A;  1SZH A;  4UBC A;  2KIW A;  5KT5 A;  4FO6 A;  2YMQ A;  5DQG A;  4JWM A;  4BUG A;  4QWC A;  5L1L A;  4MHV A;  4F5O A;  2KK0 A;  3KKA A;  2F77 X;  1OUQ A;  2ZIW B;  4RQ4 A;  1P7D A;  9ICM A;  1ZD4 A;  2YQE A;  4PGQ A;  2FMP A;  1NNL A;  1BVS A;  2CXY A;  1L8L A;  1EXN A;  3ED5 A;  4RQM A;  5ALH A;  3HP6 A;  2HHU A;  1VDV A;  1N60 A;  2P6U A;  4QZD A;  3RH5 A;  1KL9 A;  4UB4 A;  1CI4 A;  3MAB A;  9ICI A;  4R63 A;  4EYH B;  4ECZ A;  4DFK A;  4DWI A;  2FLN A;  2JV3 A;  1CRX A;  1F0M A;  5C5J A;  1Z3E B;  9ICT A;  3H40 A;  2CN1 A;  2F44 A;  2LM4 A;  2BHN A;  4YMM A;  1S5L U;  2ZJ5 A;  2UVU A;  2W9C B;  4UB5 A;  5EE9 A;  3TAC B;  3QEA Z;  4EZ9 A;  2MUT A;  5T14 A;  2PFO A;  2XVT A;  2V4Q A;  5KFA A;  1CUK A;  1L5U A;  3PMN A;  5KFS A;  4M6W B;  2OH2 A;  3H8S A;  5J0S A;  3UPQ A;  2G08 A;  4J9P A;  3AM9 A;  4F4W A;  1IG6 A;  5KFZ A;  2QB0 A;  3M6K A;  5DG7 A;  1AQ6 A;  5AKE A;  4ED1 A;  4UW9 A;  2XY7 A;  3BZK A;  2IBK A;  3TI0 A;  1SXD A;  1UA1 A;  3BS5 A;  1V38 A;  1SB3 C;  2ZTC A;  4J9S A;  2YMM A;  1NJW A;  2J6T A;  2K4I A;  8ICO A;  1ZQF A;  5TIS U;  3NRW A;  4BWM A;  5JRT A;  3HPO A;  3K1Z A;  8ICN A;  1QQ5 A;  4US9 A;  4TUQ A;  5ALN A;  3VC8 A;  4OJO A;  3FDS A;  3T79 A;  3TAD C;  3K4G A;  4OCZ A;  4QWB A;  3UXP A;  1L6N A;  5J0X A;  4Z6E A;  3H4B A;  4QZH A;  3C28 A;  1BPE A;  4O9M A;  3EUB 2;  4GXJ A;  2M9N A;  2H3I A;  1TK0 A;  1ZQH A;  2JHD A;  4QJF B;  5KFO A;  4C8L A;  5IIN A;  3TAD A;  2K4P A;  5AHX A;  1YT3 A;  4PL2 A;  3C2K A;  8ICA A;  3MC1 A;  3SEI A;  1NKE A;  2ZIV B;  2WF6 A;  1ZQK A;  2VA8 A;  3RRH A;  4O3Q A;  4R8U A;  4O0I A;  4DQI A;  3RAX A;  1GO3 F;  4ECR A;  4ED7 A;  4TQS A;  2ATL A;  2RDI A;  4AYB F;  1B43 A;  2DF4 B;  5B66 U;  4KX5 A;  3RB3 A;  3WK4 A;  7ICQ A;  4KLS A;  4C7Y A;  2IHN A;  4JMU A;  7ICO A;  4RQ7 A;  4Q44 A;  2DL0 A;  3KZI U;  1ZQO A;  1IV8 A;  2XCA A;  1PK3 A;  2LM1 A;  2G06 A;  5ALT A;  3IHQ B;  3ISD A;  2FI1 A;  2KKP A;  5TZV A;  4UAZ A;  4YR2 A;  4PZN A;  2EAM A;  1N62 A;  1ED1 A;  2EZY A;  4QW8 A;  4RU9 A;  2OYY A;  3L5K A;  2BPC A;  4F4Z A;  3PY8 A;  5AK6 A;  4HAI A;  4F92 B;  4BDP A;  2H3Z A;  3BS7 A;  9ICH A;  3UQ2 A;  1XSN A;  1A6S A;  4R66 A;  3UM9 A;  1HIW A;  3HX0 A;  4QIW C;  2W3R A;  4P0P B;  5HNK A;  3THV A;  1JRO A;  4DLG A;  3PSF A;  3PX4 A;  3C23 A;  2XC9 A;  3PSP A;  1NZP A;  2YTU A;  3I76 A;  2JH7 A;  2KEY A;  5KFI A;  4I2H A;  3ZDC A;  4EBD A;  3SR6 A;  2P6R A;  1Z00 B;  5D4B A;  4DL2 A;  1Z1V A;  1ZJM A;  2W9B B;  2WB1 C;  3RF9 A;  4Q43 A;  3QUC A;  2BQ3 A;  5KG1 A;  2C2E A;  2UVV A;  4OJL A;  2ALZ A;  3RH6 A;  2DUY A;  2FMQ A;  4YCX A;  2NO4 A;  2GLE A;  1XC9 A;  1IM4 A;  3FAH A;  3HKZ C;  9ICC A;  4R64 A;  2WF5 A;  4M04 A;  3SV4 A;  2ISP A;  3Q8P B;  2I9G A;  1TE2 A;  3MDA A;  3EPI A;  2CRX A;  5F3X B;  2NO5 A;  4DSI A;  1D9F A;  4IQT A;  1A77 A;  4NLK A;  5HR7 A;  3M6Z A;  2ZJ8 A;  2FLL A;  5J0O A;  1TAQ A;  2OHF A;  1KFT A;  4M0A A;  4KLU A;  1ECW A;  2W11 A;  1KQQ A;  1A0P A;  1XO0 A;  2F2A B;  4PHA A;  3WKC A;  1NJZ A;  5AM3 A;  3BQ1 A;  5DLG A;  5HP4 A;  3EZ5 A;  1BPY A;  2C28 A;  4FS2 A;  3PO5 A;  4M9G A;  1UA0 A;  2ZUC A;  1L7P A;  4CE6 A;  3PNC A;  4NV0 A;  4QWA A;  3TAP A;  3EWA A;  3WK5 A;  1URJ A;  4NLG A;  5IIL A;  1F5S A;  1TK8 A;  2IOF K;  3KD3 A;  2RP5 A;  1Z1B A;  3NVV A;  4YN4 A;  3V6K A;  4EEN A;  3ORY A;  2IHM A;  5CB1 A;  2ZXH A;  3SQI A;  2F1J A;  4A8E A;  3G6V A;  1LVH A;  1PVQ A;  2EAO A;  3M9O B;  4ED0 A;  4RQ6 A;  1KW4 A;  5KL8 B;  1UT8 A;  3Q8R B;  4JV1 A;  2R8H A;  9ICL A;  2EH9 A;  2C2R A;  3Q8S B;  5ALK A;  4DF8 A;  3AU2 A;  2ODG A;  4DL3 A;  5ALD A;  4QWD A;  4P0Q B;  3SI8 A;  4CF3 A;  2AGP A;  1DK3 A;  1KFD A;  3GV5 B;  1WCL A;  2P66 A;  5AI5 A;  2DPI A;  5F9N A;  4F50 A;  1HUZ A;  5KG7 A;  4F91 B;  2JEJ A;  2W03 A;  3C2L A;  5J2B A;  2RRD A;  2PMZ C;  1ZQS A;  3PR4 A;  8ICW A;  5III A;  4J9O A;  4F2S A;  2H3Q A;  4TUS A;  2E8M A;  3HJE A;  3N4M B;  4I2E A;  5J0Y A;  5GTH U;  2MRL A;  2W43 A;  5J0T A;  3RBE A;  1S97 A;  7ICL A;  2K60 A;  1KN5 A;  2RLT A;  3JPO A;  3EYZ A;  4PZO A;  4F5Q A;  3L4P A;  4EX7 A;  4YP3 A;  2MA1 A;  3QZ8 A;  3QUT A;  4U7C A;  9ICR A;  1N63 A;  2K89 A;  3GFK B;  1PUZ A;  2BR0 A;  4UB3 A;  1Q8K A;  4DL4 A;  1C20 A;  5KFN A;  2FJ6 A;  3MDC A;  4RQ0 A;  1RM6 C;  1X9S A;  4JV0 A;  3ETR A;  1JAL A;  3WK6 A;  5KFU A;  2KVC A;  5H2F U;  4DF4 A;  1ZQ1 C;  3NS1 A;  4UAR A;  4R65 A;  2Y9U A;  2YB4 A;  4FFD A;  5KFM A;  8ICX A;  2WAQ F;  1ARO P;  1O08 A;  4YR0 A;  5KFH A;  4RQ3 A;  4I2D A;  4IQU A;  3GQC A;  2ZUB A;  3IG8 A;  2JZB A;  2HDO A;  3WU2 U;  1HUO A;  2WF7 A;  4E0D A;  4IRK A;  4KLF A;  4RQ5 A;  1TV9 A;  1KKX A;  3ZDD A;  5J2J A;  4RQ2 A;  3RJI A;  4DOA A;  1QQ7 A;  4TQR A;  4QZB A;  3I28 A;  4EYI B;  1DGJ A;  3NRZ A;  5KT3 A;  4GIB A;  3E58 A;  3S6J A;  4JK1 A;  4PGY A;  4CNQ A;  5AIC A;  3EPG A;  3Q8M A;  4YVZ A;  4CF4 A;  3T5K A;  5AI6 A;  3PW4 A;  1T4G A;  3KOO A;  4F5N A;  3BZC A;  5KT4 A;  2ZTE A;  2AXT U;  2ZIU A;  3KHR A;  5KFY A;  8ICF A;  1IXR A;  3CW2 C;  4I29 A;  5J0R A;  3NTU A;  4TUP A;  2KN7 A;  1V85 A;  3R9K A;  4YQW A;  4X5V A;  1NK0 A;  3LVV A;  4ECV A;  1MQ3 A;  1NZB A;  5AIB A;  5KG0 A;  1T3Q A;  1ZQV A;  2VAN A;  3LVW A;  2ZJA A;  4J9K A;  5ALI A;  2BZF A;  2BDU A;  3RJG A;  4UB8 U;  5J0Q A;  1U48 A;  4YMO A;  1SL0 A;  1T8E A;  1RDF A;  5ALF A;  1RXW A;  2BCU A;  1B0X A;  3J81 j;  4PL1 A;  4B9T A;  3AN1 A;  3WKD A;  5KT2 A;  3PX6 A;  5L1M A;  5DB6 A;  2E1E A;  5J0U A;  2FPM A;  5KFW A;  2O6K A;  4QWE A;  2ASD A;  4MEX A;  4C8O A;  4FBT A;  5DBC A;  4ELU A;  4FZN A;  1TKD A;  1BNO A;  3NVY A;  9ICF A;  3V6J A;  1L7N A;  1N48 A;  1RG6 A;  5DDM A;  4O3R A;  2DGZ A;  2ISO A;  2DKX A;  3MBY A;  3GU3 A;  4U6P A;  4LZD A;  4ELV A;  1T3N A;  1PK1 A;  1MA7 A;  4YD2 A;  2WHE A;  1Q3V A;  5KFE A;  5J2A A;  3TAN A;  2EZZ A;  2W3S A;  5G5H A;  4FZM A;  2HHV A;  4IQV A;  3M1Y A;  2R8K A;  2H5X A;  4GLX A;  2XGQ A;  8ICL A;  3QU9 A;  4UAY A;  2OEH A;  2QAR B;  4O3O A;  3NGD A;  4RPX A;  5AI0 A;  4ECS A;  5L1I A;  1ZQN A;  5F9L A;  2V4R A;  5AM2 A;  3F2C A;  2VKQ A;  1N2X A;  1Q46 A;  4RNM A;  4B9U A;  2W7O A;  2KZ3 A;  1TAU A;  1WYG A;  2HHX A;  4C0Z A;  5KFJ A;  1N61 A;  3O0F A;  7ICT A;  3M9N B;  1U9L A;  2I5H A;  2A3V A;  1D8B A;  3D2N A;  2ZIX B;  5BPC A;  7ICK A;  3LK9 A;  3RJH A;  2LMR A;  4PHE A;  1SWW A;  1L3U A;  2E8O A;  5ALZ A;  4BXO A;  3CNH A;  3F5A A;  4MEY A;  3ISC A;  4EEL A;  1Z4N A;  3FM9 A;  4J9R A;  4GXI A;  3TAR A;  3N97 B;  4IR9 A;  4ED6 A;  4Z6D A;  4I2F A;  1ZRN A;  1L3V A;  4KLO A;  2XID A;  3PW0 A;  5DG9 A;  1ZQD A;  4LJX A;  3PR5 B;  1N5W A;  1RQN A;  4XUS A;  1COO A;  1FO4 A;  2F1H A;  2LI6 A;  2UVR A;  2BCV A;  2HMX A;  4NJ8 A;  4Y2J A;  2F8K A;  3ETL A;  4DCC A;  2J6S A;  4DOC A;  4KLM A;  9ICQ A;  1XSL A;  3QX7 A;  3H0L B;  1TAM A;  5AM4 A;  4QZG A;  3BQT A;  5AIA A;  1BPZ A;  3LWM A;  2KZZ A;  4Q8F A;  3SYZ A;  3QYP A;  3IN5 A;  4Z6F A;  3RJK A;  4UAU A;  4RPY A;  3M9M B;  2AQ0 A;  2MSN A;  1SV0 C;  2HHS A;  2ZUD A;  3QU7 A;  1ZQL A;  3V7L A;  5KFT A;  2W7P A;  2JZB B;  2CPR A;  5D46 A;  1SL1 A;  5ALQ A;  9ICV A;  3PML A;  3K1R B;  5EWF A;  1NKC A;  1SV0 A;  4NLN A;  2H3V A;  2D6F C;  4YFK A;  4M9J A;  5KFV A;  5KFG A;  4P4P A;  3Q8K A;  5CJ7 A;  5ALX A;  1Q3U A;  3HT3 A;  3PST A;  2A1J B;  3I1Y A;  2KV2 A;  3IM1 A;  1PVP A;  4ELT A;  2KIV A;  2HHQ A;  4KMO B;  2JEF A;  3NVZ A;  2PI4 A;  3G6Y A;  3H8W A; 
#chains in the Genus database with same CATH homology
 1UQV A;  2QKQ A;  2YTU A;  3SEI A;  5J8Y A;  1SV4 A;  2JV3 A;  1F0M A;  2QB0 B;  2Y9U A;  2KSO B;  2Y9T A;  2ES6 A;  2F44 A;  1Z1V A;  4IS7 A;  1DXS A;  1RG6 A;  5KNI A;  2EAP A;  1LKY B;  2DKX A;  2FE9 A;  4NJ8 A;  2F8K A;  1PK1 A;  1OW5 A;  3BS5 B;  3TAC B;  1UCV A;  5JTI A;  1X40 A;  1B4F A;  2B6G A;  4NL9 C;  2F3N A;  2DKZ A;  2GLE A;  1X66 A;  2LPE A;  2DL0 A;  3H8M A;  1WWU A;  2KE7 A;  1PK3 A;  2QAR B;  1SGG A;  5F3X B;  4NL9 A;  2QB0 A;  3HIL A;  2KSO A;  2E8M A;  2KMD A;  3KKA C;  4PZN A;  2EAM A;  1SV0 C;  2L5Y A;  1OXJ A;  1SXD A;  3BS5 A;  1V38 A;  2K60 A;  1SXE A;  4MHV A;  1V85 A;  3K1R B;  3KKA A;  2QB1 A;  4PZO A;  3BS7 A;  2EAN A;  1SV0 A;  1WWV A;  1X9X A;  5JRT A;  3SEN A;  2E8N A;  2LMR A;  2QAR A;  3IDW A;  1LKY A;  3TAD C;  5JU5 A;  2E8O A;  1PK1 B;  3BQ7 A;  1JI7 A;  2D8C A;  4RQM A;  5J8Y C;  2E8P A;  1COK A;  1B0X A;  2ESE A;  5L1M A;  4RQN A;  2D3D A;  2KIV A;  2EAO A;  3TAD A;  1KW4 A;  2K4P A;  2KG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...