2DL0A

Solution structure of the sam-domain of the sam and sh3 domain containing protein 1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
GSSGSSGGGLTEICRKPVSPGCISSVSDWLISIGLPMYAGTLSTAGFSTLSQVPSLSHTCLQEAGITEERHIRKLLSAARLFKLPPGPEAMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SAM and SH3 domain-containing protein 1
publication title Solution structure of the SAM-domain of the SAM and SH3 domain containing protein 1
rcsb
source organism Homo sapiens
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2dl0A01
2QARB 2F8KA 2QB0B 2KE7A 2QKQA 3IDWA 2K60A 4RQMA 1V85A 1PK1A 1WWVA 1Z1VA 4PZOA 1JI7A 3KKAA 3BS5A 1LKYA 2QB1A 2ESEA 3SENA 1OXJA 2EAOA 3BS7A 3KKAC 3SEIA 1B0XA 2EAMA 2D8CA 2KSOA 2KMDA 5KNIA 2DL0A 2E8MA 1SGGA 2E8OA 2Y9TA 2F44A 4IS7A 2GLEA 1COKA 4PZNA 2F3NA 2EAPA 1PK3A 1OW5A 2DKXA 1SV0A 2LPEA 1X9XA 1X40A 3K1RB 2E8PA 3HILA 2KIVA 1WWUA 1PK1B 2Y9UA 5JTIA 2LMRA 1SV0C 1DXSA 1SXDA 3BS5B 5L1MA 2QARA 2QB0A 1LKYB 5JU5A 1B4FA 2EANA 4NL9A 5F3XB 2KG5A 2K4PA 5J8YA 2E8NA 4NL9C 2JV3A 2KSOB 1UCVA 4NJ8A 5J8YC 3H8MA 3TADA 2D3DA 4MHVA 2B6GA 2DKZA 1SXEA 2YTUA 1UQVA 1SV4A 2FE9A 1F0MA 1V38A 2ES6A 2L5YA 3TADC 1KW4A 1X66A 4RQNA 1RG6A 3TACB 3BQ7A 5JRTA
chains in the Genus database with same CATH superfamily
4KLDA 4ECUA 5F9LA 2LM1A 2PMZC 4JB3A 2B0CA 5KFAA 2HI0A 1ZD5A 5J2DA 9ICKA 5KT3A 4DFDA 1NJXA 2ALZA 4OJ6A 8ICBA 4UAUA 1L7OA 2F77X 4F4WA 2DWQA 2BPGA 8ICNA 9ICLA 1JXEA 5KFKA 2NV3A 2KHQA 4DQQA 3V7LA 2LBOA 9ICMA 3SV4A 3JPOA 3SR6A 4BWJA 1UT5A 3HKZF 5KFVA 4DWIA 1SV0A 2PMZF 4IQTA 5CA7A 2OHFA 7ICJA 2KTQA 2IHMA 3PW7A 4DFJA 4F72A 2WF8A 2HBKA 1T3QA 5EE0A 1FIQA 4UBCA 4NLCA 4MFCA 2BQUA 1GO3F 2C28A 3KHHA 2KG5A 2FJ6A 5J8YA 2HHXA 4Y2RA 4Q8FA 1S10A 3M9MB 4PHPA 2F1JA 2VJ4A 2J6UA 3GIKA 1NNLA 2PKEA 4O3RA 5KFEA 4NM2A 4FZMA 5ALMA 7ICFA 8ICEA 3HW8A 3ALRA 5EWGA 4PGXA 3O0FA 1ZQOA 1TE2A 1ZQYA 3RAQA 2HBMA 4PL2A 3RJHA 9ICXA 2PFQA 2YTUA 2ZJAA 4O3SA 2KK0A 5J2FA 3PO4A 1ZQUA 1ZXIA 3B0XA 2V4QA 1X66A 1L7MA 2IBKA 1T94A 2DPIA 1M6YA 3WKBA 3EPGA 5KFYA 4M9HA 3GIMA 3EW9A 9ICGA 1BNOA 1JI7A 4ELVA 4M9GA 3FDSA 3KKAA 4CGZA 3QX7A 4DL7A 2HHUA 2GH1A 3SV3A 3UXPA 4YXMA 2CRXA 1BPXA 3JPRA 4Q44A 4DL6A 8ICHA 2ODGA 2C2DA 1RXWA 4NLKA 1U4BA 4I2AA 4QWDA 2W9MA 1RQNA 1F5SA 5J2AA 3F2DA 2KFNA 3LVVA 2ZTCA 2R18A 3I28A 5KFNA 3PW5A 4KLMA 5KFQA 2G0AA 1PK3A 4DL3A 1CRXA 3WKEA 5AKLA 4J9NA 2AJQA 9ICFA 4C7ZA 5J2EA 3IV6A 9ICJA 3KHGA 4IRKA 5ALZA 4AYBF 2MRLA 1ZYQA 3PSIA 3RBDA 1PVPA 4OD0A 4J9OA 1Z4NA 5EOZA 3KTQA 3HPOA 1RM6C 5ALDA 2HMXA 3F2CA 3RAXA 5L1JA 3THVA 5DDMA 4ECYA 3H8MA 2VJ5A 5CB1A 3M9OB 1SXEA 5G5GA 2YMLA 3ED5A 4JUZA 4EZ9A 5IIKA 3WKAA 3E0FA 1JIHA 3MFIA 3MR5A 4O3PA 4YQWA 3QU4A 3GIJA 1K1SA 4KN4A 3AM9A 5EE1A 4PHEA 1NK0A 2K60A 1FFVA 4GXJA 4GIBA 1VDVA 4FBUA 3NGDA 3BS5A 1XNSA 3T3FA 3WK7A 4F8RA 2KICA 1DK2A 5AICA 3OJUA 1JUDA 5IIMA 4KX3A 1S76D 4J9QA 2E8MA 2Y9TA 4EEYA 2OWOA 5IIJA 1D9FA 2HVHA 3K4GA 2EQYA 5CP2A 1NKBA 2FMPA 5CRXA 1TAMA 4B9NA 9ICWA 2F1HA 3UMGA 1X9XA 2HHQA 4K4IA 4LZDA 5KG0A 4RT2A 4RQ2A 2Y9UA 2KN7A 1IG6A 3I1YA 2ZG6A 3BS5B 1ZQFA 5DGAA 3ZDDA 3UMCA 5KG2A 3RB4A 2K4PA 3MR6A 1XO1A 3G6VA 5ALEA 4DQIA 1ZQEA 3KD3A 5AKGA 3PO5A 4PGYA 4ICAA 4PL1A 3C1YA 3PW0A 4F71A 9ICIA 2I9GA 3ISCA 1KKXA 1VJ5A 4QWEA 2HOFA 5FP0A 4UQGA 5DG7A 1F0MA 2L5YA 3L5KA 3RRGA 1TVAA 2E5SA 3TACB 1KQQA 5JRTA 5J0UA 8ICKA 4US8A 1QLNA 9ICTA 4YMNA 1BGXT 1XC9A 1X9WA 4J03A 3ZDCA 3C2LA 3SI8A 4Y2JA 4JV1A 4NV0A 2JMGA 5HMLA 2IMWP 3AEVA 2Y0SC 2QB1A 3SENA 1A76A 5JUMA 4R66A 3PX0A 2JEJA 3LYSA 5HNKA 5CR0A 5L9XA 1KFSA 2YN4A 4F4XA 5CHGA 2JZBA 9ICSA 2RQ5A 4Z6EA 5KNIA 3T5JA 2J6TA 5K4LA 1S0VA 2JRZA 3N4MB 2HBJA 2KNJA 5DQIA 2JXJA 5J0WA 4GLXA 8ICPA 8ICQA 3GU3A 2Y0SF 1NK5A 3AL0B 3Q8RB 2WB1F 1XSPA 5KT2A 5EE3A 3PX4A 4KLQA 2FLLA 1X2IA 2BCQA 4HYKA 5DKWA 4F5RA 2KVCA 2DFLA 4ED8A 5J2JA 3HX0A 5J2IA 5ALIA 4O3OA 2HCFA 3RRHA 2JZBB 3QZ8A 4UAZA 2RP5A 4F4KA 2CN1A 4O3MA 3TANA 5D4BA 5AM3A 3OGUA 2UVUA 5AKYA 3AQFA 4EX6A 2M9NA 3L4PA 2KVSA 4K4HA 7ICPA 4NXZA 5J29A 1IV8A 4KMUA 4YN4A 4YFKA 2W3RA 5KT6A 3UMBA 1RG6A 5AM4A 4F92B 1BPDA 2XY7A 5J0YA 3T5LA 1NOMA 1U48A 1SWWA 2FPLA 2R8KA 3QZ7A 5J0PA 3IDWA 1S97A 1T4GA 5KFPA 4PZOA 1A0PA 4XA5A 4NM1A 4R65A 3CP8A 3V72A 2ZIXA 5AI8A 1T8EA 5DGBA 3GZFA 2IOFA 1AQ6A 7ICRA 4YR3A 1RPLA 4FZLA 4ELTA 2HVIA 2QLTA 1CUKA 2K8BB 5L1IA 5DG8A 4C8KA 1IXRA 4KLFA 3NS1A 1QH9A 4O3NA 3OTQA 9ICVA 1L7NA 4ED7A 2KFZA 1DOQA 2A1AA 1ZD4A 2EAPA 2JEIA 5AKXA 2ZIUA 1BNPA 3K1RB 4KX5A 3V6JA 3GDXA 3NVYA 1B4FA 2M0NA 1ZQAA 2XO7A 2ZUBA 3NASA 3M6ZA 3FM9A 2ZIXB 1QTMA 4DFKA 3F53A 3C23A 3H4DA 3T5KA 1S0NA 5AI6A 3PX6A 4U6PA 4X5VA 4QZGA 5AHXA 3ZDAA 1ZQHA 3UXOA 4MHVA 4IRDA 1U45A 3MBYA 3KHLA 4M6WA 3JPTA 1L8OA 5E79U 3GV8B 3KFUF 4KLOA 4J9LA 2ZIUB 3PR5B 4C4SA 4UASA 2WF9A 4UAVA 3LVWA 2ASDA 5L1LA 2K4IA 4IL6U 3WKCA 2KZZA 2W7PA 5DDYA 2KIWA 1S0MA 3OHAA 4RQMA 5DB8A 4P2HA 4TUSA 3MR3A 9ICRA 2OEHA 2G06A 4QW9A 3M6KA 4GFJA 4QZBA 1ZQLA 3GFKB 1XO0A 4M9NA 2YB4A 4KMOB 4GC6A 4EX7A 3FC4A 3BS7A 4O5CA 4YD2A 1CI4A 5IIOA 1B0XA 4DLGA 5KTQA 4QWBA 4M6WB 5BOLA 2VIXA 3QU5A 5T14A 4Y2UA 4KN7A 2H3ZA 4RPZA 2AGOA 1RYSA 5KFMA 2GLEA 3UXNA 4UB4A 2KHVA 3WK9A 3NUQA 3K75D 1X40A 2RHFA 3ISDA 3H0RB 5KFXA 1KRPA 2NRWA 4ECRA 2YQEA 3DV9A 1ZD2P 2EZZA 4QW8A 4BUGA 1DGSA 2KV2A 1S77D 4IR9A 1AROP 2XCPA 4FZNA 7ICGA 2K4EA 2ISOA 2NO4A 3GQCA 1RDFA 4P0QA 3OPXA 4UB6U 8ICXA 3NTUA 2V9WA 4YG2A 3UM9A 4RNMA 1SIJA 1FFUA 2D3DA 4I2HA 2ZUCA 4IR1A 3HRDD 1WYGA 1X9MA 2OXOA 4DQPA 4M04A 4I2DA 4Y2YA 4UAYA 1Q3VA 5ALLA 1IIPA 1D8LA 4ECTA 4QZ8A 1ZOLA 3PW2A 1ZJMA 4FBTA 2G5IB 3NRWA 1ZQJA 2PI4A 5KAIU 3WK6A 2BQRA 1V85A 1HUZA 3ISBA 4CCHA 8ICGA 1TK5A 4I28A 4TUQA 1TV9A 4ED6A 5KFSA 5DG9A 2BCUA 4P0QB 4UB3A 2ZJ5A 1N60A 4P4MA 4KLEA 4YMMA 5D46A 2P35A 4DL5A 4UAWA 4C8LA 1RXVA 2DGZA 2KZMA 3RJGA 4XRHA 4C0ZA 5KFJA 2E8OA 1S9FA 5BOMA 1BPYA 2ISPA 4PZNA 4I2FA 5AM5A 1OW5A 2DKXA 3RR8A 3C21A 2ZTDA 4QZEA 1QCKA 2UVRA 5DQGA 3BJYA 4AP9A 1ZQNA 5DLGA 3RJIA 1Z4OA 5AI5A 3NVVA 3C5GA 3NRZA 3RB6A 4QWAA 1ZQ1C 2OCEA 3Q8LA 5ALOA 1ZQXA 7ICLA 3JPPA 2W8LA 5G5HA 3QNMA 3IP4B 2HHSA 5DLFA 1JN3A 3QXGA 3RR7A 3CNHA 5KT4A 4KLLA 1UQVA 1QSSA 2ES6A 3KZXA 4CF5A 2N1RA 4YR2A 3H0LB 2ATLA 5KG7A 4KTQA 5ALTA 1ECWA 1IM4A 3BQ2A 4UATA 5KAFU 3K1ZA 3QEBZ 3N7PD 1WWVA 3N7RC 3H40A 3RTVA 4FS2A 4QZCA 5ALNA 1OXJA 4OO1J 4M9LA 2W8KA 2W03A 4OJPA 4QNLA 2HOIA 3TI0A 1YZ6A 1QQ5A 4R8UA 3BQTA 2K4HA 5B5EU 2GOLA 5KFUA 3V6HA 4A8EA 2W11A 3ZDEA 1SZHA 4DSEA 4EBCA 7ICOA 2C22A 1D8YA 1NK9A 5KT7A 2NRTA 2YB1A 4F2RA 1Q46A 2BDUA 5L1KA 1A6SA 1T3NA 3SAHA 3M8RA 5DBBA 4FS1A 2FDRA 3SD7A 3BDPA 3ZD8A 2LMRA 4TQSA 2F2AB 1SXDA 4BJQA 3RB3A 3RH5A 1JRPA 1ZQTA 5AKJA 4IQUA 1ZQQA 5AM0A 3IG5A 3PW4A 3T79A 4O0IA 2WF6A 2Q0ZX 5ALVA 2E8NA 3Q8SB 4R8UB 4RT3A 4KLTA 1UCVA 4KITB 1N63A 2EH9A 5KFHA 1TK0A 4F5QA 4EBDA 3QE9Y 1Q3UA 2R8JA 1ZD3A 2H3FA 3RFAA 5KG4A 3ORYA 2EZYA 4FFDA 1B22A 2OM6A 3VCBA 4EYHB 3T5HA 2BQ3A 5TISU 5KL8B 3JPNA 3WK4A 4O5EA 1KEJA 2HOQA 4KLJA 3QUCA 3D6JA 2GO7A 2IOHA 2JHDA 2KE7A 2D6FC 1P7DA 2QKQA 4I2EA 4BX9C 2G07A 4QZFA 2LYAA 4LJXA 2XY5A 3KBBA 4ECXA 2MSNA 5ALUA 1C20A 2EAOA 4DOAA 4QZHA 5TZVA 8ICRA 4GC7A 1ZQRA 1WUDA 5KFOA 1NK7A 2FMSA 4ACOA 4C4TA 1TKDA 4B6JA 5J0XA 2C2RA 5AI4A 4IC9A 3SYZA 5KFBA 4MFFA 2WHEA 2H5XA 2ZUDA 1NK4A 3B0YA 2OYYA 4DL4A 1ZQGA 2JH7A 4I27A 1B43A 5BPCA 2IHNA 5D49A 5KG6A 3EPIA 2F1IA 2BCSA 3MFHA 3M8SA 1JMSA 3ETLA 4RZRA 4CF4A 1NJWA 2C2EA 5J2GA 4LZGA 4O3QA 1PZNA 4PH5A 3QYPA 1L3SA 3PV8A 1N2XA 4PJ0U 2XIDA 2BCVA 3UQ2A 5KFRA 4F5PA 3C5FA 3ZDBA 4U7CA 5EWEA 4BGDA 3C2MA 5J0SA 1L5UA 2CXYA 2XGQA 7ICUA 1UHUA 5DB7A 4ECWA 3RJFA 4OCZA 3M7DA 3C28A 4B9SA 2NO5A 4QZ9A 7ICKA 1TK8A 3LWLA 4RQ1A 3PZPA 1UPHA 2B21A 1Q8KA 5ALXA 4Y2XA 1S8OA 8ICVA 1SL0A 3V7JA 2KSOA 1VLBA 1SB3C 4B9UA 2JH1A 4IQVA 1BVSA 4P0PA 3QU2A 5KFIA 2F3NA 3QUQA 1HUOA 2HW3A 3N7SC 4OJLA 2G5HB 4J9KA 1C7YA 3BQ0A 5AKHA 9ICBA 3C29A 4F5NA 3GILA 1KFTA 5IILA 1RQLA 1N5XA 1ZRMA 2QARA 3Q8MA 4RU9A 2FLPA 2Q4TA 3RJJA 2BDPA 4ED2A 5AKIA 5DQHA 1S0OA 1NJZA 3RB0A 1QQ6A 4F50A 4ECZA 3CRXA 8ICCA 1ZQSA 4DS5A 1LVHA 4USAA 4NL9C 2LM4A 2JV3A 2KSOB 3NVZA 4KLGA 2IA6A 4DQSA 1V97A 3H0MB 4Q45A 1HIWA 4DEZA 4P0PB 4M9JA 4C8MA 4RQ4A 1KN5A 2FE9A 2XICA 5ALKA 3JPQA 1ZQBA 7ICIA 5AK5A 4EEKA 2AU0A 4XQ8A 3SAFA 8ICAA 2GWSA 4RNOA 3B9JA 2HBLA 5ALGA 3R9KA 4DO9A 3LDAA 4F4ZA 2A19A 2QARB 1ZQPA 1RYUA 3DEEA 5AIAA 2AHOB 1PK1A 4BXOA 2IOFK 3VC8A 2ZJ8A 4EENA 1HEKA 1DRGA 1LKYA 1O08A 2KD1A 3AU2A 1QQ7A 1DGJA 1EXNA 3LK9A 4ECQA 1ZQZA 3H4BA 4QZIA 4Q43A 2ASLA 2BCRA 2D8CA 3M1YA 4G3IA 4ECSA 8ICTA 2YMMA 2FLNA 3PVXA 2JGAA 4IS7A 3OJSA 2YMPA 3AN1A 4FO6A 2WF5A 8ICIA 1COKA 5J2CA 4EELA 1RZTA 4B9VA 3I76A 3OHBA 2LPEA 4J9PA 2LKYA 1X6JA 4CF3A 5KFFA 4C80A 3H7IA 1PK1B 4BXOB 5L1MA 3AUOA 2HHWA 5KFWA 2QB0A 1LKYB 4F2SA 3H8JA 4C7YA 5AKZA 5CEHA 4DCCA 2NRXA 2W9AA 3QU7A 2ASJA 4GXIA 4ECVA 2HHTA 7ICHA 3H8SA 4DFMA 3UPQA 3HKZC 1SL2A 2K8CB 4F5OA 4ED0A 3QU9A 3EUB2 2KKVA 4FE3A 5AKEA 4P4OA 2E1FA 4YXJA 4HAIA 1SV4A 4NY8A 1U9LA 4EZ6A 1KLNA 1KW4A 4QJFB 4PHAA 3PY8A 4PHDA 3TKAA 8ICOA 1WG8A 2ZTEA 4ED1A 5KFCA 5EWFA 1KDHA 5IIIA 2F8KA 2QB0B 1JALA 2A3VA 2FMQA 8ICFA 2XY6A 8ICWA 1N62A 4DF8A 5KL1B 9ICCA 2R8IA 4DS4A 1ZQMA 2LI6A 4US9A 4RPYA 2W3SA 2RDIA 2JR5A 1U47A 2HSZA 2KJ8A 4QZDA 5F9NA 2I1QA 3SAGA 2XCAA 2Y1IA 2EAMA 2AH5A 1L7PA 1URJA 2EZXA 5ALJA 2P66A 2JEFA 9ICQA 3A0BU 2FPKA 5ALWA 5AI9A 5J0RA 4BDPA 3N28A 3MR2A 4JMUA 2W55A 5DBCA 2EDUA 2RDJA 1ZRNA 4GXKA 4YVZA 2KIVA 2WAQC 4CNQA 4Y2PA 4RNNA 5JTIA 1MQ2A 1NZPA 4MF2A 3TFRA 7ICMA 2KJ9A 3MC1A 3N97B 3KOOA 4NL9A 3C2KA 4P4PA 1YZ7A 2H3IA 1JXLA 1U49A 1S5LU 3MGVA 4EBEA 2PFOA 4JV0A 2K89A 2DUYA 4QWCA 3TFSA 9ICPA 1SKRA 2AGPA 4RQ7A 1LB2B 2BHNA 2Z7JA 1ZQCA 5GTHU 5KFGA 5J0OA 2B6GA 4MEXA 4F93B 1N5WA 4YP3A 1ZQKA 4C8OA 2WAQF 4YR0A 5J0QA 2YX8A 3F5EA 5H2FU 3PSPA 3DDHA 1SWVA 4J9MA 2WFAA 3BQ1A 4NLNA 4RQNA 4AYBC 1JROA 1UA0A 4E0DA 2XI9A 1QSYA 4DOBA 4UBBA 3M9NB 3IN5A 4DSFA 1OUQA 2V4RA 2MU2A 1TAQA 4EYIB 2BR0A 4DF4A 2NYVA 2H3VA 4Y2VA 1XWLA 1PVQA 2ESEA 3BZKA 1NKEA 3JPSA 3J81j 4MFAA 1WCLA 4J9SA 1KBUA 1J97A 3SEIA 2BKEA 2KZ3A 4TUPA 5ALFA 2AQ0A 4C4RA 4B9LA 8ICZA 3SZ2A 3D2NA 9ICHA 1NJYA 4RPXA 2ZXIA 2E1EA 3RH6A 4KLSA 4Y2SA 5KT5A 4KLUA 2RLTA 1PVRA 4DLEA 3HILA 4NWIA 1MQ3A 3PMNA 4O9MA 4DL2A 4R63A 3V7KA 3CW2C 1DXSA 2MA1A 2RRDA 2R8GA 1ZQWA 2DQNB 2FPMA 3V6KA 3HWTA 2R8HA 3D2SA 1ZJNA 3UQ0A 4XUSA 3BZCA 3L3FX 3FAHA 4YMOA 4R64A 4DSKA 2MUTA 3RH4A 3WU2U 1ZQDA 2G08A 3TARA 3KHRA 2KP7A 4KLHA 5DB6A 1RYRA 5AK4A 1H38A 1XSLA 1NKCA 5ALSA 4I29A 3PR4A 1FO4A 1LV5A 4PPXA 3IG8A 1TAUA 4UB5A 7ICQA 3TADC 4F3OA 1Z1BA 4QZAA 2W7OA 4NLGA 2W54A 3SMVA 1MN8A 4BWMA 3WK5A 1XSNA 4O5KA 9ICNA 3E58A 5ALRA 2G09A 3G6YA 2LHTA 5IINA 5HP4A 2I6XA 5ALYA 5CJ7A 4J9RA 4UB2A 5AKKA 4WJ3B 4IRCA 5AIBA 2MUTB 2ZIVA 5J2HA 5HHIA 4QIWC 1JX4A 3RBEA 4ZOHC 1K1QA 3ONNA 2KMDA 4I2JA 2VKQA 5AK6A 2DPJA 5HR6A 4TQRA 4ELUA 1T7PA 2HHVA 1ED1A 4Z6FA 3AU6A 3TAQA 1XU4A 2AQ4A 2A1JA 4M2YA 1L8LA 4F4YA 3ICXA 3HJEA 4Y2TA 3AMZA 2ZIWA 3QUBA 3Q8QB 2E3TA 3ZD9A 4B9TA 2OH2A 4UB1A 1L3TA 4B9MA 5JU5A 5HR7A 1KFDA 4DQRA 4RQ8A 1FEZA 3D2QA 5F3XB 3QUTA 4QIWF 2UVVA 2DF4B 1O03A 1QSLA 7ICEA 2ZIVB 3WK8A 7ICSA 5C0YA 3H8WA 2W9BA 4MEYA 5CWRA 4DSJA 4NLZA 1COOA 2YMQA 5AM2A 2LYHA 5C5JA 3TAPA 3OSPA 8ICUA 1NK6A 4NJ8A 4RQ0A 4CE6A 2Y1JA 3ETRA 5KFTA 2P6UA 8ICJA 1Z3EB 4RQ5A 2A1JB 3AQEA 9ICOA 3TQ1A 9ICEA 4ZH4A 2WB1C 3HT3A 2BPFA 2F8LA 4TURA 2ZIWB 2PFPA 3BQ7A 5HMMA 4RQ3A 4RQ6A 4Q8EA 3PSTA 2YY6A 5AK3A 4ED3A 1N56A 1KTQA 2NRVA 2XGPA 2P6RA 1L3VA 2AGQA 1Z1VA 5J2BA 4DOCA 2CPRA 2FI1A 2KEYA 3RJKA 2XC9A 2J6SA 4YCXA 2O6KA 2W9BB 3MGHA 4CRXA 3HP6A 4LVSA 5EE9A 5J2KA 3PSFA 3C1ZA 1XS9D 3G6XA 9ICAA 8ICMA 1K5OA 4PGQA 2BPCA 4F91B 5A0LA 4RUAA 2F44A 3S6JA 4OJ5A 1MSWD 5KG5A 2I5HA 2W9CA 1F44A 2PFNA 5J0TA 4UARA 1Y88A 4I2IA 1PUZA 5KFZA 2LYBA 3NVWA 2W04A 2VA8A 3PMLA 9ICUA 1J2NA 4C8NA 4JK1A 1SV0C 4OJOA 7ICVA 3MDCA 1Z19A 5AM1A 2XVTA 2EANA 3CYMA 8ICYA 4G9BA 1BPBA 1DK3A 4CDGA 1HJPA 2KKPA 3FYHA 4JWNA 1MC8A 2UVWA 7ICTA 5DBAA 1J2MA 5J8YC 1X6IA 3TADA 1CEZA 3PNCA 2W9CB 2DKZA 2JEGA 1A77A 3GV5B 4NLBA 5AI0A 2ZXHA 3MGIA 1V38A 3IHQB 5GTIU 1X42A 4YD1A 4UB8U 2F76X 1SKSA 3EYZA 2BGWA 2AXTU 2WF7A 1L3UA 4I2GA 1UT8A 2VA2A 2KJ5A 3RJEA 7ICNA 4I2BA 2H3QA 2BZFA 3Q8KA 5HHHA 4MF8A 5ALQA 5KFDA 1MA7A 1N48A 3MDAA 5ALPA 3OSNA 3QEAZ 8ICLA 4KLIA 3F5AA 3KKAC 1ZQIA 4M47A 1BPZA 1ZQVA 5KG3A 1WCNA 1NZBA 2DL0A 1SKWA 3EWAA 1SGGA 1ZETA 2HDOA 3U26A 1TFRA 3IRUA 3RF9A 2WTFA 5ALHA 3A0HU 3IM1A 2PI5A 1YT3A 2KOBA 3E2EA 4JV2A 2VA3A 4JWMA 8ICSA 2VANA 4UW9A 1KL9A 1SZPA 2E8PA 2PXIA 1Z00A 1WWUA 4RUCA 1NK8A 3ZI4A 3GIIA 1L6NA 3LWMA 3F2BA 3EZ5A 1KSPA 5B66U 1D8BA 2MAXA 5DB9A 5KFLA 4Y2QA 1BPEA 4DSLA 4DSIA 4M0AA 3MABA 1SL1A 1NI3A 2W43A 3SQIA 3GV7B 2NRZA 4IQWA 4Z6CA 1X9SA 4I2CA 1V9PA 4DFPA 5KG1A 4K4GA 4Z6DA 3Q8PB 1D9DA 3KZIU 2DBYA 1Z00B 1N61A 2K8AA 3WKDA 1UA1A
chains in the Genus database with same CATH topology
2QARB 2F8KA 2QB0B 2KE7A 2QKQA 3IDWA 2K60A 4RQMA 1V85A 1PK1A 1WWVA 1Z1VA 4PZOA 1JI7A 3KKAA 3BS5A 1LKYA 2QB1A 2ESEA 3SENA 1OXJA 2EAOA 3BS7A 3KKAC 3SEIA 1B0XA 2EAMA 2D8CA 2KSOA 2KMDA 5KNIA 2DL0A 2E8MA 1SGGA 2E8OA 2Y9TA 2F44A 4IS7A 2GLEA 1COKA 4PZNA 2F3NA 2EAPA 1PK3A 1OW5A 2DKXA 1SV0A 2LPEA 1X9XA 1X40A 3K1RB 2E8PA 3HILA 2KIVA 1WWUA 1PK1B 2Y9UA 5JTIA 2LMRA 1SV0C 1DXSA 1SXDA 3BS5B 5L1MA 2QARA 2QB0A 1LKYB 5JU5A 1B4FA 2EANA 4NL9A 5F3XB 2KG5A 2K4PA 5J8YA 2E8NA 4NL9C 2JV3A 2KSOB 1UCVA 4NJ8A 5J8YC 3H8MA 3TADA 2D3DA 4MHVA 2B6GA 2DKZA 1SXEA 2YTUA 1UQVA 1SV4A 2FE9A 1F0MA 1V38A 2ES6A 2L5YA 3TADC 1KW4A 1X66A 4RQNA 1RG6A 3TACB 3BQ7A 5JRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAR B;  2F8K A;  2QB0 B;  2KE7 A;  2QKQ A;  3IDW A;  2K60 A;  4RQM A;  1V85 A;  1PK1 A;  1WWV A;  1Z1V A;  4PZO A;  1JI7 A;  3KKA A;  3BS5 A;  1LKY A;  2QB1 A;  2ESE A;  3SEN A;  1OXJ A;  2EAO A;  3BS7 A;  3KKA C;  3SEI A;  1B0X A;  2EAM A;  2D8C A;  2KSO A;  2KMD A;  5KNI A;  2DL0 A;  2E8M A;  1SGG A;  2E8O A;  2Y9T A;  2F44 A;  4IS7 A;  2GLE A;  1COK A;  4PZN A;  2F3N A;  2EAP A;  1PK3 A;  1OW5 A;  2DKX A;  1SV0 A;  2LPE A;  1X9X A;  1X40 A;  3K1R B;  2E8P A;  3HIL A;  2KIV A;  1WWU A;  1PK1 B;  2Y9U A;  5JTI A;  2LMR A;  1SV0 C;  1DXS A;  1SXD A;  3BS5 B;  5L1M A;  2QAR A;  2QB0 A;  1LKY B;  5JU5 A;  1B4F A;  2EAN A;  4NL9 A;  5F3X B;  2KG5 A;  2K4P A;  5J8Y A;  2E8N A;  4NL9 C;  2JV3 A;  2KSO B;  1UCV A;  4NJ8 A;  5J8Y C;  3H8M A;  3TAD A;  2D3D A;  4MHV A;  2B6G A;  2DKZ A;  1SXE A;  2YTU A;  1UQV A;  1SV4 A;  2FE9 A;  1F0M A;  1V38 A;  2ES6 A;  2L5Y A;  3TAD C;  1KW4 A;  1X66 A;  4RQN A;  1RG6 A;  3TAC B;  3BQ7 A;  5JRT A; 
#chains in the Genus database with same CATH topology
 4KLD A;  4ECU A;  5F9L A;  2LM1 A;  2PMZ C;  4JB3 A;  2B0C A;  5KFA A;  2HI0 A;  1ZD5 A;  5J2D A;  9ICK A;  5KT3 A;  4DFD A;  1NJX A;  2ALZ A;  4OJ6 A;  8ICB A;  4UAU A;  1L7O A;  2F77 X;  4F4W A;  2DWQ A;  2BPG A;  8ICN A;  9ICL A;  1JXE A;  5KFK A;  2NV3 A;  2KHQ A;  4DQQ A;  3V7L A;  2LBO A;  9ICM A;  3SV4 A;  3JPO A;  3SR6 A;  4BWJ A;  1UT5 A;  3HKZ F;  5KFV A;  4DWI A;  1SV0 A;  2PMZ F;  4IQT A;  5CA7 A;  2OHF A;  7ICJ A;  2KTQ A;  2IHM A;  3PW7 A;  4DFJ A;  4F72 A;  2WF8 A;  2HBK A;  1T3Q A;  5EE0 A;  1FIQ A;  4UBC A;  4NLC A;  4MFC A;  2BQU A;  1GO3 F;  2C28 A;  3KHH A;  2KG5 A;  2FJ6 A;  5J8Y A;  2HHX A;  4Y2R A;  4Q8F A;  1S10 A;  3M9M B;  4PHP A;  2F1J A;  2VJ4 A;  2J6U A;  3GIK A;  1NNL A;  2PKE A;  4O3R A;  5KFE A;  4NM2 A;  4FZM A;  5ALM A;  7ICF A;  8ICE A;  3HW8 A;  3ALR A;  5EWG A;  4PGX A;  3O0F A;  1ZQO A;  1TE2 A;  1ZQY A;  3RAQ A;  2HBM A;  4PL2 A;  3RJH A;  9ICX A;  2PFQ A;  2YTU A;  2ZJA A;  4O3S A;  2KK0 A;  5J2F A;  3PO4 A;  1ZQU A;  1ZXI A;  3B0X A;  2V4Q A;  1X66 A;  1L7M A;  2IBK A;  1T94 A;  2DPI A;  1M6Y A;  3WKB A;  3EPG A;  5KFY A;  4M9H A;  3GIM A;  3EW9 A;  9ICG A;  1BNO A;  1JI7 A;  4ELV A;  4M9G A;  3FDS A;  3KKA A;  4CGZ A;  3QX7 A;  4DL7 A;  2HHU A;  2GH1 A;  3SV3 A;  3UXP A;  4YXM A;  2CRX A;  1BPX A;  3JPR A;  4Q44 A;  4DL6 A;  8ICH A;  2ODG A;  2C2D A;  1RXW A;  4NLK A;  1U4B A;  4I2A A;  4QWD A;  2W9M A;  1RQN A;  1F5S A;  5J2A A;  3F2D A;  2KFN A;  3LVV A;  2ZTC A;  2R18 A;  3I28 A;  5KFN A;  3PW5 A;  4KLM A;  5KFQ A;  2G0A A;  1PK3 A;  4DL3 A;  1CRX A;  3WKE A;  5AKL A;  4J9N A;  2AJQ A;  9ICF A;  4C7Z A;  5J2E A;  3IV6 A;  9ICJ A;  3KHG A;  4IRK A;  5ALZ A;  4AYB F;  2MRL A;  1ZYQ A;  3PSI A;  3RBD A;  1PVP A;  4OD0 A;  4J9O A;  1Z4N A;  5EOZ A;  3KTQ A;  3HPO A;  1RM6 C;  5ALD A;  2HMX A;  3F2C A;  3RAX A;  5L1J A;  3THV A;  5DDM A;  4ECY A;  3H8M A;  2VJ5 A;  5CB1 A;  3M9O B;  1SXE A;  5G5G A;  2YML A;  3ED5 A;  4JUZ A;  4EZ9 A;  5IIK A;  3WKA A;  3E0F A;  1JIH A;  3MFI A;  3MR5 A;  4O3P A;  4YQW A;  3QU4 A;  3GIJ A;  1K1S A;  4KN4 A;  3AM9 A;  5EE1 A;  4PHE A;  1NK0 A;  2K60 A;  1FFV A;  4GXJ A;  4GIB A;  1VDV A;  4FBU A;  3NGD A;  3BS5 A;  1XNS A;  3T3F A;  3WK7 A;  4F8R A;  2KIC A;  1DK2 A;  5AIC A;  3OJU A;  1JUD A;  5IIM A;  4KX3 A;  1S76 D;  4J9Q A;  2E8M A;  2Y9T A;  4EEY A;  2OWO A;  5IIJ A;  1D9F A;  2HVH A;  3K4G A;  2EQY A;  5CP2 A;  1NKB A;  2FMP A;  5CRX A;  1TAM A;  4B9N A;  9ICW A;  2F1H A;  3UMG A;  1X9X A;  2HHQ A;  4K4I A;  4LZD A;  5KG0 A;  4RT2 A;  4RQ2 A;  2Y9U A;  2KN7 A;  1IG6 A;  3I1Y A;  2ZG6 A;  3BS5 B;  1ZQF A;  5DGA A;  3ZDD A;  3UMC A;  5KG2 A;  3RB4 A;  2K4P A;  3MR6 A;  1XO1 A;  3G6V A;  5ALE A;  4DQI A;  1ZQE A;  3KD3 A;  5AKG A;  3PO5 A;  4PGY A;  4ICA A;  4PL1 A;  3C1Y A;  3PW0 A;  4F71 A;  9ICI A;  2I9G A;  3ISC A;  1KKX A;  1VJ5 A;  4QWE A;  2HOF A;  5FP0 A;  4UQG A;  5DG7 A;  1F0M A;  2L5Y A;  3L5K A;  3RRG A;  1TVA A;  2E5S A;  3TAC B;  1KQQ A;  5JRT A;  5J0U A;  8ICK A;  4US8 A;  1QLN A;  9ICT A;  4YMN A;  1BGX T;  1XC9 A;  1X9W A;  4J03 A;  3ZDC A;  3C2L A;  3SI8 A;  4Y2J A;  4JV1 A;  4NV0 A;  2JMG A;  5HML A;  2IMW P;  3AEV A;  2Y0S C;  2QB1 A;  3SEN A;  1A76 A;  5JUM A;  4R66 A;  3PX0 A;  2JEJ A;  3LYS A;  5HNK A;  5CR0 A;  5L9X A;  1KFS A;  2YN4 A;  4F4X A;  5CHG A;  2JZB A;  9ICS A;  2RQ5 A;  4Z6E A;  5KNI A;  3T5J A;  2J6T A;  5K4L A;  1S0V A;  2JRZ A;  3N4M B;  2HBJ A;  2KNJ A;  5DQI A;  2JXJ A;  5J0W A;  4GLX A;  8ICP A;  8ICQ A;  3GU3 A;  2Y0S F;  1NK5 A;  3AL0 B;  3Q8R B;  2WB1 F;  1XSP A;  5KT2 A;  5EE3 A;  3PX4 A;  4KLQ A;  2FLL A;  1X2I A;  2BCQ A;  4HYK A;  5DKW A;  4F5R A;  2KVC A;  2DFL A;  4ED8 A;  5J2J A;  3HX0 A;  5J2I A;  5ALI A;  4O3O A;  2HCF A;  3RRH A;  2JZB B;  3QZ8 A;  4UAZ A;  2RP5 A;  4F4K A;  2CN1 A;  4O3M A;  3TAN A;  5D4B A;  5AM3 A;  3OGU A;  2UVU A;  5AKY A;  3AQF A;  4EX6 A;  2M9N A;  3L4P A;  2KVS A;  4K4H A;  7ICP A;  4NXZ A;  5J29 A;  1IV8 A;  4KMU A;  4YN4 A;  4YFK A;  2W3R A;  5KT6 A;  3UMB A;  1RG6 A;  5AM4 A;  4F92 B;  1BPD A;  2XY7 A;  5J0Y A;  3T5L A;  1NOM A;  1U48 A;  1SWW A;  2FPL A;  2R8K A;  3QZ7 A;  5J0P A;  3IDW A;  1S97 A;  1T4G A;  5KFP A;  4PZO A;  1A0P A;  4XA5 A;  4NM1 A;  4R65 A;  3CP8 A;  3V72 A;  2ZIX A;  5AI8 A;  1T8E A;  5DGB A;  3GZF A;  2IOF A;  1AQ6 A;  7ICR A;  4YR3 A;  1RPL A;  4FZL A;  4ELT A;  2HVI A;  2QLT A;  1CUK A;  2K8B B;  5L1I A;  5DG8 A;  4C8K A;  1IXR A;  4KLF A;  3NS1 A;  1QH9 A;  4O3N A;  3OTQ A;  9ICV A;  1L7N A;  4ED7 A;  2KFZ A;  1DOQ A;  2A1A A;  1ZD4 A;  2EAP A;  2JEI A;  5AKX A;  2ZIU A;  1BNP A;  3K1R B;  4KX5 A;  3V6J A;  3GDX A;  3NVY A;  1B4F A;  2M0N A;  1ZQA A;  2XO7 A;  2ZUB A;  3NAS A;  3M6Z A;  3FM9 A;  2ZIX B;  1QTM A;  4DFK A;  3F53 A;  3C23 A;  3H4D A;  3T5K A;  1S0N A;  5AI6 A;  3PX6 A;  4U6P A;  4X5V A;  4QZG A;  5AHX A;  3ZDA A;  1ZQH A;  3UXO A;  4MHV A;  4IRD A;  1U45 A;  3MBY A;  3KHL A;  4M6W A;  3JPT A;  1L8O A;  5E79 U;  3GV8 B;  3KFU F;  4KLO A;  4J9L A;  2ZIU B;  3PR5 B;  4C4S A;  4UAS A;  2WF9 A;  4UAV A;  3LVW A;  2ASD A;  5L1L A;  2K4I A;  4IL6 U;  3WKC A;  2KZZ A;  2W7P A;  5DDY A;  2KIW A;  1S0M A;  3OHA A;  4RQM A;  5DB8 A;  4P2H A;  4TUS A;  3MR3 A;  9ICR A;  2OEH A;  2G06 A;  4QW9 A;  3M6K A;  4GFJ A;  4QZB A;  1ZQL A;  3GFK B;  1XO0 A;  4M9N A;  2YB4 A;  4KMO B;  4GC6 A;  4EX7 A;  3FC4 A;  3BS7 A;  4O5C A;  4YD2 A;  1CI4 A;  5IIO A;  1B0X A;  4DLG A;  5KTQ A;  4QWB A;  4M6W B;  5BOL A;  2VIX A;  3QU5 A;  5T14 A;  4Y2U A;  4KN7 A;  2H3Z A;  4RPZ A;  2AGO A;  1RYS A;  5KFM A;  2GLE A;  3UXN A;  4UB4 A;  2KHV A;  3WK9 A;  3NUQ A;  3K75 D;  1X40 A;  2RHF A;  3ISD A;  3H0R B;  5KFX A;  1KRP A;  2NRW A;  4ECR A;  2YQE A;  3DV9 A;  1ZD2 P;  2EZZ A;  4QW8 A;  4BUG A;  1DGS A;  2KV2 A;  1S77 D;  4IR9 A;  1ARO P;  2XCP A;  4FZN A;  7ICG A;  2K4E A;  2ISO A;  2NO4 A;  3GQC A;  1RDF A;  4P0Q A;  3OPX A;  4UB6 U;  8ICX A;  3NTU A;  2V9W A;  4YG2 A;  3UM9 A;  4RNM A;  1SIJ A;  1FFU A;  2D3D A;  4I2H A;  2ZUC A;  4IR1 A;  3HRD D;  1WYG A;  1X9M A;  2OXO A;  4DQP A;  4M04 A;  4I2D A;  4Y2Y A;  4UAY A;  1Q3V A;  5ALL A;  1IIP A;  1D8L A;  4ECT A;  4QZ8 A;  1ZOL A;  3PW2 A;  1ZJM A;  4FBT A;  2G5I B;  3NRW A;  1ZQJ A;  2PI4 A;  5KAI U;  3WK6 A;  2BQR A;  1V85 A;  1HUZ A;  3ISB A;  4CCH A;  8ICG A;  1TK5 A;  4I28 A;  4TUQ A;  1TV9 A;  4ED6 A;  5KFS A;  5DG9 A;  2BCU A;  4P0Q B;  4UB3 A;  2ZJ5 A;  1N60 A;  4P4M A;  4KLE A;  4YMM A;  5D46 A;  2P35 A;  4DL5 A;  4UAW A;  4C8L A;  1RXV A;  2DGZ A;  2KZM A;  3RJG A;  4XRH A;  4C0Z A;  5KFJ A;  2E8O A;  1S9F A;  5BOM A;  1BPY A;  2ISP A;  4PZN A;  4I2F A;  5AM5 A;  1OW5 A;  2DKX A;  3RR8 A;  3C21 A;  2ZTD A;  4QZE A;  1QCK A;  2UVR A;  5DQG A;  3BJY A;  4AP9 A;  1ZQN A;  5DLG A;  3RJI A;  1Z4O A;  5AI5 A;  3NVV A;  3C5G A;  3NRZ A;  3RB6 A;  4QWA A;  1ZQ1 C;  2OCE A;  3Q8L A;  5ALO A;  1ZQX A;  7ICL A;  3JPP A;  2W8L A;  5G5H A;  3QNM A;  3IP4 B;  2HHS A;  5DLF A;  1JN3 A;  3QXG A;  3RR7 A;  3CNH A;  5KT4 A;  4KLL A;  1UQV A;  1QSS A;  2ES6 A;  3KZX A;  4CF5 A;  2N1R A;  4YR2 A;  3H0L B;  2ATL A;  5KG7 A;  4KTQ A;  5ALT A;  1ECW A;  1IM4 A;  3BQ2 A;  4UAT A;  5KAF U;  3K1Z A;  3QEB Z;  3N7P D;  1WWV A;  3N7R C;  3H40 A;  3RTV A;  4FS2 A;  4QZC A;  5ALN A;  1OXJ A;  4OO1 J;  4M9L A;  2W8K A;  2W03 A;  4OJP A;  4QNL A;  2HOI A;  3TI0 A;  1YZ6 A;  1QQ5 A;  4R8U A;  3BQT A;  2K4H A;  5B5E U;  2GOL A;  5KFU A;  3V6H A;  4A8E A;  2W11 A;  3ZDE A;  1SZH A;  4DSE A;  4EBC A;  7ICO A;  2C22 A;  1D8Y A;  1NK9 A;  5KT7 A;  2NRT A;  2YB1 A;  4F2R A;  1Q46 A;  2BDU A;  5L1K A;  1A6S A;  1T3N A;  3SAH A;  3M8R A;  5DBB A;  4FS1 A;  2FDR A;  3SD7 A;  3BDP A;  3ZD8 A;  2LMR A;  4TQS A;  2F2A B;  1SXD A;  4BJQ A;  3RB3 A;  3RH5 A;  1JRP A;  1ZQT A;  5AKJ A;  4IQU A;  1ZQQ A;  5AM0 A;  3IG5 A;  3PW4 A;  3T79 A;  4O0I A;  2WF6 A;  2Q0Z X;  5ALV A;  2E8N A;  3Q8S B;  4R8U B;  4RT3 A;  4KLT A;  1UCV A;  4KIT B;  1N63 A;  2EH9 A;  5KFH A;  1TK0 A;  4F5Q A;  4EBD A;  3QE9 Y;  1Q3U A;  2R8J A;  1ZD3 A;  2H3F A;  3RFA A;  5KG4 A;  3ORY A;  2EZY A;  4FFD A;  1B22 A;  2OM6 A;  3VCB A;  4EYH B;  3T5H A;  2BQ3 A;  5TIS U;  5KL8 B;  3JPN A;  3WK4 A;  4O5E A;  1KEJ A;  2HOQ A;  4KLJ A;  3QUC A;  3D6J A;  2GO7 A;  2IOH A;  2JHD A;  2KE7 A;  2D6F C;  1P7D A;  2QKQ A;  4I2E A;  4BX9 C;  2G07 A;  4QZF A;  2LYA A;  4LJX A;  2XY5 A;  3KBB A;  4ECX A;  2MSN A;  5ALU A;  1C20 A;  2EAO A;  4DOA A;  4QZH A;  5TZV A;  8ICR A;  4GC7 A;  1ZQR A;  1WUD A;  5KFO A;  1NK7 A;  2FMS A;  4ACO A;  4C4T A;  1TKD A;  4B6J A;  5J0X A;  2C2R A;  5AI4 A;  4IC9 A;  3SYZ A;  5KFB A;  4MFF A;  2WHE A;  2H5X A;  2ZUD A;  1NK4 A;  3B0Y A;  2OYY A;  4DL4 A;  1ZQG A;  2JH7 A;  4I27 A;  1B43 A;  5BPC A;  2IHN A;  5D49 A;  5KG6 A;  3EPI A;  2F1I A;  2BCS A;  3MFH A;  3M8S A;  1JMS A;  3ETL A;  4RZR A;  4CF4 A;  1NJW A;  2C2E A;  5J2G A;  4LZG A;  4O3Q A;  1PZN A;  4PH5 A;  3QYP A;  1L3S A;  3PV8 A;  1N2X A;  4PJ0 U;  2XID A;  2BCV A;  3UQ2 A;  5KFR A;  4F5P A;  3C5F A;  3ZDB A;  4U7C A;  5EWE A;  4BGD A;  3C2M A;  5J0S A;  1L5U A;  2CXY A;  2XGQ A;  7ICU A;  1UHU A;  5DB7 A;  4ECW A;  3RJF A;  4OCZ A;  3M7D A;  3C28 A;  4B9S A;  2NO5 A;  4QZ9 A;  7ICK A;  1TK8 A;  3LWL A;  4RQ1 A;  3PZP A;  1UPH A;  2B21 A;  1Q8K A;  5ALX A;  4Y2X A;  1S8O A;  8ICV A;  1SL0 A;  3V7J A;  2KSO A;  1VLB A;  1SB3 C;  4B9U A;  2JH1 A;  4IQV A;  1BVS A;  4P0P A;  3QU2 A;  5KFI A;  2F3N A;  3QUQ A;  1HUO A;  2HW3 A;  3N7S C;  4OJL A;  2G5H B;  4J9K A;  1C7Y A;  3BQ0 A;  5AKH A;  9ICB A;  3C29 A;  4F5N A;  3GIL A;  1KFT A;  5IIL A;  1RQL A;  1N5X A;  1ZRM A;  2QAR A;  3Q8M A;  4RU9 A;  2FLP A;  2Q4T A;  3RJJ A;  2BDP A;  4ED2 A;  5AKI A;  5DQH A;  1S0O A;  1NJZ A;  3RB0 A;  1QQ6 A;  4F50 A;  4ECZ A;  3CRX A;  8ICC A;  1ZQS A;  4DS5 A;  1LVH A;  4USA A;  4NL9 C;  2LM4 A;  2JV3 A;  2KSO B;  3NVZ A;  4KLG A;  2IA6 A;  4DQS A;  1V97 A;  3H0M B;  4Q45 A;  1HIW A;  4DEZ A;  4P0P B;  4M9J A;  4C8M A;  4RQ4 A;  1KN5 A;  2FE9 A;  2XIC A;  5ALK A;  3JPQ A;  1ZQB A;  7ICI A;  5AK5 A;  4EEK A;  2AU0 A;  4XQ8 A;  3SAF A;  8ICA A;  2GWS A;  4RNO A;  3B9J A;  2HBL A;  5ALG A;  3R9K A;  4DO9 A;  3LDA A;  4F4Z A;  2A19 A;  2QAR B;  1ZQP A;  1RYU A;  3DEE A;  5AIA A;  2AHO B;  1PK1 A;  4BXO A;  2IOF K;  3VC8 A;  2ZJ8 A;  4EEN A;  1HEK A;  1DRG A;  1LKY A;  1O08 A;  2KD1 A;  3AU2 A;  1QQ7 A;  1DGJ A;  1EXN A;  3LK9 A;  4ECQ A;  1ZQZ A;  3H4B A;  4QZI A;  4Q43 A;  2ASL A;  2BCR A;  2D8C A;  3M1Y A;  4G3I A;  4ECS A;  8ICT A;  2YMM A;  2FLN A;  3PVX A;  2JGA A;  4IS7 A;  3OJS A;  2YMP A;  3AN1 A;  4FO6 A;  2WF5 A;  8ICI A;  1COK A;  5J2C A;  4EEL A;  1RZT A;  4B9V A;  3I76 A;  3OHB A;  2LPE A;  4J9P A;  2LKY A;  1X6J A;  4CF3 A;  5KFF A;  4C80 A;  3H7I A;  1PK1 B;  4BXO B;  5L1M A;  3AUO A;  2HHW A;  5KFW A;  2QB0 A;  1LKY B;  4F2S A;  3H8J A;  4C7Y A;  5AKZ A;  5CEH A;  4DCC A;  2NRX A;  2W9A A;  3QU7 A;  2ASJ A;  4GXI A;  4ECV A;  2HHT A;  7ICH A;  3H8S A;  4DFM A;  3UPQ A;  3HKZ C;  1SL2 A;  2K8C B;  4F5O A;  4ED0 A;  3QU9 A;  3EUB 2;  2KKV A;  4FE3 A;  5AKE A;  4P4O A;  2E1F A;  4YXJ A;  4HAI A;  1SV4 A;  4NY8 A;  1U9L A;  4EZ6 A;  1KLN A;  1KW4 A;  4QJF B;  4PHA A;  3PY8 A;  4PHD A;  3TKA A;  8ICO A;  1WG8 A;  2ZTE A;  4ED1 A;  5KFC A;  5EWF A;  1KDH A;  5III A;  2F8K A;  2QB0 B;  1JAL A;  2A3V A;  2FMQ A;  8ICF A;  2XY6 A;  8ICW A;  1N62 A;  4DF8 A;  5KL1 B;  9ICC A;  2R8I A;  4DS4 A;  1ZQM A;  2LI6 A;  4US9 A;  4RPY A;  2W3S A;  2RDI A;  2JR5 A;  1U47 A;  2HSZ A;  2KJ8 A;  4QZD A;  5F9N A;  2I1Q A;  3SAG A;  2XCA A;  2Y1I A;  2EAM A;  2AH5 A;  1L7P A;  1URJ A;  2EZX A;  5ALJ A;  2P66 A;  2JEF A;  9ICQ A;  3A0B U;  2FPK A;  5ALW A;  5AI9 A;  5J0R A;  4BDP A;  3N28 A;  3MR2 A;  4JMU A;  2W55 A;  5DBC A;  2EDU A;  2RDJ A;  1ZRN A;  4GXK A;  4YVZ A;  2KIV A;  2WAQ C;  4CNQ A;  4Y2P A;  4RNN A;  5JTI A;  1MQ2 A;  1NZP A;  4MF2 A;  3TFR A;  7ICM A;  2KJ9 A;  3MC1 A;  3N97 B;  3KOO A;  4NL9 A;  3C2K A;  4P4P A;  1YZ7 A;  2H3I A;  1JXL A;  1U49 A;  1S5L U;  3MGV A;  4EBE A;  2PFO A;  4JV0 A;  2K89 A;  2DUY A;  4QWC A;  3TFS A;  9ICP A;  1SKR A;  2AGP A;  4RQ7 A;  1LB2 B;  2BHN A;  2Z7J A;  1ZQC A;  5GTH U;  5KFG A;  5J0O A;  2B6G A;  4MEX A;  4F93 B;  1N5W A;  4YP3 A;  1ZQK A;  4C8O A;  2WAQ F;  4YR0 A;  5J0Q A;  2YX8 A;  3F5E A;  5H2F U;  3PSP A;  3DDH A;  1SWV A;  4J9M A;  2WFA A;  3BQ1 A;  4NLN A;  4RQN A;  4AYB C;  1JRO A;  1UA0 A;  4E0D A;  2XI9 A;  1QSY A;  4DOB A;  4UBB A;  3M9N B;  3IN5 A;  4DSF A;  1OUQ A;  2V4R A;  2MU2 A;  1TAQ A;  4EYI B;  2BR0 A;  4DF4 A;  2NYV A;  2H3V A;  4Y2V A;  1XWL A;  1PVQ A;  2ESE A;  3BZK A;  1NKE A;  3JPS A;  3J81 j;  4MFA A;  1WCL A;  4J9S A;  1KBU A;  1J97 A;  3SEI A;  2BKE A;  2KZ3 A;  4TUP A;  5ALF A;  2AQ0 A;  4C4R A;  4B9L A;  8ICZ A;  3SZ2 A;  3D2N A;  9ICH A;  1NJY A;  4RPX A;  2ZXI A;  2E1E A;  3RH6 A;  4KLS A;  4Y2S A;  5KT5 A;  4KLU A;  2RLT A;  1PVR A;  4DLE A;  3HIL A;  4NWI A;  1MQ3 A;  3PMN A;  4O9M A;  4DL2 A;  4R63 A;  3V7K A;  3CW2 C;  1DXS A;  2MA1 A;  2RRD A;  2R8G A;  1ZQW A;  2DQN B;  2FPM A;  3V6K A;  3HWT A;  2R8H A;  3D2S A;  1ZJN A;  3UQ0 A;  4XUS A;  3BZC A;  3L3F X;  3FAH A;  4YMO A;  4R64 A;  4DSK A;  2MUT A;  3RH4 A;  3WU2 U;  1ZQD A;  2G08 A;  3TAR A;  3KHR A;  2KP7 A;  4KLH A;  5DB6 A;  1RYR A;  5AK4 A;  1H38 A;  1XSL A;  1NKC A;  5ALS A;  4I29 A;  3PR4 A;  1FO4 A;  1LV5 A;  4PPX A;  3IG8 A;  1TAU A;  4UB5 A;  7ICQ A;  3TAD C;  4F3O A;  1Z1B A;  4QZA A;  2W7O A;  4NLG A;  2W54 A;  3SMV A;  1MN8 A;  4BWM A;  3WK5 A;  1XSN A;  4O5K A;  9ICN A;  3E58 A;  5ALR A;  2G09 A;  3G6Y A;  2LHT A;  5IIN A;  5HP4 A;  2I6X A;  5ALY A;  5CJ7 A;  4J9R A;  4UB2 A;  5AKK A;  4WJ3 B;  4IRC A;  5AIB A;  2MUT B;  2ZIV A;  5J2H A;  5HHI A;  4QIW C;  1JX4 A;  3RBE A;  4ZOH C;  1K1Q A;  3ONN A;  2KMD A;  4I2J A;  2VKQ A;  5AK6 A;  2DPJ A;  5HR6 A;  4TQR A;  4ELU A;  1T7P A;  2HHV A;  1ED1 A;  4Z6F A;  3AU6 A;  3TAQ A;  1XU4 A;  2AQ4 A;  2A1J A;  4M2Y A;  1L8L A;  4F4Y A;  3ICX A;  3HJE A;  4Y2T A;  3AMZ A;  2ZIW A;  3QUB A;  3Q8Q B;  2E3T A;  3ZD9 A;  4B9T A;  2OH2 A;  4UB1 A;  1L3T A;  4B9M A;  5JU5 A;  5HR7 A;  1KFD A;  4DQR A;  4RQ8 A;  1FEZ A;  3D2Q A;  5F3X B;  3QUT A;  4QIW F;  2UVV A;  2DF4 B;  1O03 A;  1QSL A;  7ICE A;  2ZIV B;  3WK8 A;  7ICS A;  5C0Y A;  3H8W A;  2W9B A;  4MEY A;  5CWR A;  4DSJ A;  4NLZ A;  1COO A;  2YMQ A;  5AM2 A;  2LYH A;  5C5J A;  3TAP A;  3OSP A;  8ICU A;  1NK6 A;  4NJ8 A;  4RQ0 A;  4CE6 A;  2Y1J A;  3ETR A;  5KFT A;  2P6U A;  8ICJ A;  1Z3E B;  4RQ5 A;  2A1J B;  3AQE A;  9ICO A;  3TQ1 A;  9ICE A;  4ZH4 A;  2WB1 C;  3HT3 A;  2BPF A;  2F8L A;  4TUR A;  2ZIW B;  2PFP A;  3BQ7 A;  5HMM A;  4RQ3 A;  4RQ6 A;  4Q8E A;  3PST A;  2YY6 A;  5AK3 A;  4ED3 A;  1N56 A;  1KTQ A;  2NRV A;  2XGP A;  2P6R A;  1L3V A;  2AGQ A;  1Z1V A;  5J2B A;  4DOC A;  2CPR A;  2FI1 A;  2KEY A;  3RJK A;  2XC9 A;  2J6S A;  4YCX A;  2O6K A;  2W9B B;  3MGH A;  4CRX A;  3HP6 A;  4LVS A;  5EE9 A;  5J2K A;  3PSF A;  3C1Z A;  1XS9 D;  3G6X A;  9ICA A;  8ICM A;  1K5O A;  4PGQ A;  2BPC A;  4F91 B;  5A0L A;  4RUA A;  2F44 A;  3S6J A;  4OJ5 A;  1MSW D;  5KG5 A;  2I5H A;  2W9C A;  1F44 A;  2PFN A;  5J0T A;  4UAR A;  1Y88 A;  4I2I A;  1PUZ A;  5KFZ A;  2LYB A;  3NVW A;  2W04 A;  2VA8 A;  3PML A;  9ICU A;  1J2N A;  4C8N A;  4JK1 A;  1SV0 C;  4OJO A;  7ICV A;  3MDC A;  1Z19 A;  5AM1 A;  2XVT A;  2EAN A;  3CYM A;  8ICY A;  4G9B A;  1BPB A;  1DK3 A;  4CDG A;  1HJP A;  2KKP A;  3FYH A;  4JWN A;  1MC8 A;  2UVW A;  7ICT A;  5DBA A;  1J2M A;  5J8Y C;  1X6I A;  3TAD A;  1CEZ A;  3PNC A;  2W9C B;  2DKZ A;  2JEG A;  1A77 A;  3GV5 B;  4NLB A;  5AI0 A;  2ZXH A;  3MGI A;  1V38 A;  3IHQ B;  5GTI U;  1X42 A;  4YD1 A;  4UB8 U;  2F76 X;  1SKS A;  3EYZ A;  2BGW A;  2AXT U;  2WF7 A;  1L3U A;  4I2G A;  1UT8 A;  2VA2 A;  2KJ5 A;  3RJE A;  7ICN A;  4I2B A;  2H3Q A;  2BZF A;  3Q8K A;  5HHH A;  4MF8 A;  5ALQ A;  5KFD A;  1MA7 A;  1N48 A;  3MDA A;  5ALP A;  3OSN A;  3QEA Z;  8ICL A;  4KLI A;  3F5A A;  3KKA C;  1ZQI A;  4M47 A;  1BPZ A;  1ZQV A;  5KG3 A;  1WCN A;  1NZB A;  2DL0 A;  1SKW A;  3EWA A;  1SGG A;  1ZET A;  2HDO A;  3U26 A;  1TFR A;  3IRU A;  3RF9 A;  2WTF A;  5ALH A;  3A0H U;  3IM1 A;  2PI5 A;  1YT3 A;  2KOB A;  3E2E A;  4JV2 A;  2VA3 A;  4JWM A;  8ICS A;  2VAN A;  4UW9 A;  1KL9 A;  1SZP A;  2E8P A;  2PXI A;  1Z00 A;  1WWU A;  4RUC A;  1NK8 A;  3ZI4 A;  3GII A;  1L6N A;  3LWM A;  3F2B A;  3EZ5 A;  1KSP A;  5B66 U;  1D8B A;  2MAX A;  5DB9 A;  5KFL A;  4Y2Q A;  1BPE A;  4DSL A;  4DSI A;  4M0A A;  3MAB A;  1SL1 A;  1NI3 A;  2W43 A;  3SQI A;  3GV7 B;  2NRZ A;  4IQW A;  4Z6C A;  1X9S A;  4I2C A;  1V9P A;  4DFP A;  5KG1 A;  4K4G A;  4Z6D A;  3Q8P B;  1D9D A;  3KZI U;  2DBY A;  1Z00 B;  1N61 A;  2K8A A;  3WKD A;  1UA1 A; 
#chains in the Genus database with same CATH homology
 2QAR B;  2F8K A;  2QB0 B;  2KE7 A;  2QKQ A;  3IDW A;  2K60 A;  4RQM A;  1V85 A;  1PK1 A;  1WWV A;  1Z1V A;  4PZO A;  1JI7 A;  3KKA A;  3BS5 A;  1LKY A;  2QB1 A;  2ESE A;  3SEN A;  1OXJ A;  2EAO A;  3BS7 A;  3KKA C;  3SEI A;  1B0X A;  2EAM A;  2D8C A;  2KSO A;  2KMD A;  5KNI A;  2DL0 A;  2E8M A;  1SGG A;  2E8O A;  2Y9T A;  2F44 A;  4IS7 A;  2GLE A;  1COK A;  4PZN A;  2F3N A;  2EAP A;  1PK3 A;  1OW5 A;  2DKX A;  1SV0 A;  2LPE A;  1X9X A;  1X40 A;  3K1R B;  2E8P A;  3HIL A;  2KIV A;  1WWU A;  1PK1 B;  2Y9U A;  5JTI A;  2LMR A;  1SV0 C;  1DXS A;  1SXD A;  3BS5 B;  5L1M A;  2QAR A;  2QB0 A;  1LKY B;  5JU5 A;  1B4F A;  2EAN A;  4NL9 A;  5F3X B;  2KG5 A;  2K4P A;  5J8Y A;  2E8N A;  4NL9 C;  2JV3 A;  2KSO B;  1UCV A;  4NJ8 A;  5J8Y C;  3H8M A;  3TAD A;  2D3D A;  4MHV A;  2B6G A;  2DKZ A;  1SXE A;  2YTU A;  1UQV A;  1SV4 A;  2FE9 A;  1F0M A;  1V38 A;  2ES6 A;  2L5Y A;  3TAD C;  1KW4 A;  1X66 A;  4RQN A;  1RG6 A;  3TAC B;  3BQ7 A;  5JRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...