2DL0A

Solution structure of the sam-domain of the sam and sh3 domain containing protein 1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
GSSGSSGGGLTEICRKPVSPGCISSVSDWLISIGLPMYAGTLSTAGFSTLSQVPSLSHTCLQEAGITEERHIRKLLSAARLFKLPPGPEAMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SAM-domain of the SAM and SH3 domain containing protein 1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SAM and SH3 domain-containing protein 1
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2dl0A01
2KE7A 2EANA 2EAPA 1SXDA 1V38A 5KNIA 3BS5A 1SXEA 3HILA 4PZNA 4IS7A 4NJ8A 2KIVA 4NL9A 2QB0A 1JI7A 2GLEA 2EAMA 3KKAC 1B0XA 1SGGA 3K1RB 3IDWA 1KW4A 4PZOA 2ESEA 2E8MA 2DKZA 2E8NA 5J8YA 1F0MA 2QARB 2QB0B 3TADA 2D3DA 2KMDA 1WWVA 1X66A 1OXJA 5F3XB 2QARA 1V85A 3TACB 2DKXA 3SEIA 1UQVA 4NL9C 1X9XA 2D8CA 2EAOA 2KSOA 2F3NA 1LKYB 2QB1A 1WWUA 4RQNA 1UCVA 2YTUA 3H8MA 3BS5B 2Y9UA 1SV0A 2B6GA 1SV4A 2ES6A 3TADC 2QKQA 4MHVA 5J8YC 5JU5A 1COKA 3BS7A 2DL0A 2Y9TA 2JV3A 5JRTA 2F8KA 2LMRA 2LPEA 2K60A 5L1MA 1OW5A 2F44A 3KKAA 4RQMA 1Z1VA 2E8PA 1RG6A 3BQ7A 1X40A 1SV0C 1PK1A 2K4PA 2L5YA 1B4FA 2KSOB 2E8OA 2KG5A 1DXSA 3SENA 1PK1B 1PK3A 5JTIA 2FE9A 1LKYA
chains in the Genus database with same CATH superfamily
2ZUCA 1Z19A 4C7YA 1QLNA 4ED0A 8ICKA 3RJIA 3VCBA 1J97A 4BXOA 3H0RB 3RRHA 4BJQA 3QEAZ 4OJ6A 5CHGA 3OSPA 4TUQA 3BQTA 4RQ3A 2KFNA 2I9GA 5AKLA 2ZIXB 3OSNA 2OEHA 4UBCA 1FEZA 1SZHA 2ESEA 2XC9A 3PY8A 2YX8A 5AI8A 2LHTA 5DLFA 2QB0B 1NKBA 2EQYA 1QSSA 2YB1A 3RJJA 4FBUA 5ALSA 2BCVA 1NK7A 2MU2A 3RRGA 3LWLA 4EYIB 3R9KA 1S0VA 3UPQA 4RT2A 1S0OA 4ECWA 3AL0B 2KP7A 4FS2A 4MFCA 4RNOA 3QUCA 3M9MB 3BQ2A 1KEJA 5ALJA 3D2QA 4I2IA 2K4IA 4KMOB 2Y0SF 1S76D 3ISCA 2W43A 3BS7A 1RQNA 4I2DA 3NS1A 5KFHA 2MRLA 2KZ3A 3OJUA 1L3TA 4ELUA 4M2YA 2MAXA 4UAZA 2W54A 2W9CA 3IHQB 2ISPA 8ICVA 2XCAA 1LB2B 1ZQAA 4I28A 4AYBC 1B43A 1PK1A 5AK4A 4DLEA 1D8YA 2WAQF 4RPXA 2HBMA 3S6JA 4QWAA 4J03A 4I2FA 4QIWF 1LKYA 1TE2A 4ELVA 1D8LA 2WF8A 4BX9C 1S10A 4ICAA 7ICEA 5KG5A 2ZIVB 4DQSA 4GC7A 5ALEA 4ED1A 9ICRA 4Y2SA 4YQWA 2MUTA 2E1FA 1BVSA 4IQUA 1NK0A 3ZDEA 3ORYA 2FMQA 4I2JA 4Q44A 1KW4A 3IM1A 5AKXA 2P66A 4R66A 3SD7A 1QH9A 5KG4A 9ICAA 4DQRA 1SIJA 4TQSA 1X66A 2BDUA 1QSLA 4DL5A 4F3OA 3F5EA 2G09A 4CF4A 4C8OA 4F4ZA 1ZETA 7ICVA 8ICPA 4KMUA 2YQEA 5KFWA 4F50A 3V7JA 4OCZA 3PMLA 2FI1A 2RP5A 5AM2A 3PSIA 2ZJAA 3ZD9A 1UCVA 2E3TA 1ZRMA 5DBCA 4UW9A 4NWIA 4J9OA 3MR6A 4UAUA 2KKVA 4KLFA 2JMGA 1NOMA 3M8SA 2FLLA 9ICBA 4DO9A 3RB4A 2HBLA 4RZRA 5DDYA 3PNCA 3GILA 4U7CA 2N1RA 3H8WA 7ICQA 1KKXA 3NUQA 3C2KA 1N5XA 4C4SA 2VA3A 5J0PA 2VA8A 3RB0A 1B4FA 1DXSA 4PPXA 2BGWA 3UXNA 1NNLA 2VA2A 4YD2A 3EYZA 2K4EA 8ICRA 2W8LA 4F8RA 4F5QA 1UA1A 2NRVA 1QQ5A 1SL2A 2KIVA 4YXMA 1KBUA 1P7DA 7ICUA 3IV6A 5KTQA 4ED7A 5IIIA 3LVWA 1ZQHA 7ICJA 1MA7A 4OO1J 4M6WB 2Z7JA 3SV4A 1QTMA 9ICEA 3FAHA 2GH1A 2HBKA 4FZMA 8ICNA 3ZDBA 1U45A 2BQ3A 2HHWA 5KFEA 4RQ4A 1ZJNA 4B9UA 4DSKA 4EEKA 4R8UB 4CRXA 1J2NA 4O3RA 3RR7A 5L1IA 7ICKA 4RQ0A 5KFUA 5C5JA 3T5KA 4UB4A 4TUSA 4M04A 4FS1A 5ALPA 1RZTA 2CXYA 1L7OA 3TFRA 3QU4A 8ICIA 2LBOA 1BPDA 1BNOA 2W3RA 2PXIA 5KFCA 3SAFA 3AEVA 4Z6CA 1V9PA 5L9XA 3NRZA 3OHBA 2LMRA 1UPHA 3N4MB 1OW5A 2WFAA 3L4PA 4IRDA 4C4TA 5DQGA 1NJZA 5ALDA 3KZIU 5KAFU 4QZHA 3TFSA 4R63A 3M7DA 4QIWC 1VDVA 3EW9A 1IXRA 9ICOA 3WKCA 4NY8A 3QU5A 8ICJA 5J2CA 4KTQA 3UQ0A 3N7PD 5HR7A 1SXEA 3HILA 2ZXIA 4ECXA 3B0XA 3KZXA 4ACOA 2YMPA 1BPXA 5L1KA 1MQ3A 1T8EA 2HBJA 5ALKA 5DLGA 5DGBA 2AGOA 2KV2A 2IHNA 2E8MA 1UA0A 3MGIA 1TKDA 3A0BU 5G5GA 2W7OA 4KLUA 2ZJ5A 4J9NA 3KHHA 2NRTA 9ICXA 2G5HB 4CCHA 1ZD4A 2D8CA 4NL9C 2AGQA 3AQFA 2FLPA 4QZEA 2KICA 5AKJA 5J0WA 2ZTEA 3HT3A 5DG7A 3CP8A 4NLKA 2R18A 5KFXA 3TI0A 1XC9A 1N5WA 2ODGA 3UM9A 9ICIA 1EXNA 4YCXA 1RXVA 4KLDA 3KOOA 2HOFA 3H8MA 3AM9A 1YT3A 1S97A 3JPPA 3GFKB 2ASJA 1CEZA 3TADC 2QKQA 3N7SC 5EE9A 4OJ5A 2G08A 2JEJA 7ICNA 9ICCA 4Q45A 2F1IA 4UQGA 1B22A 5DBAA 2F44A 3ZD8A 4Z6DA 4DL4A 1QCKA 3UMBA 5ALVA 5L1JA 4F4XA 1RPLA 8ICAA 2E8OA 2VKQA 5KL8B 4DFJA 3M9NB 5DB9A 2PFQA 2G0AA 4DF4A 5JTIA 3GDXA 1ZD3A 1ZQTA 4Q8FA 4QWEA 2YMMA 1HUOA 4QW9A 1SXDA 4MF2A 3BS5A 2A1AA 2NRXA 4FE3A 4NJ8A 4B6JA 4F2RA 5DDMA 4JWMA 5KG6A 1TV9A 1XU4A 3TAPA 4M9JA 4Y2TA 2WAQC 1NK6A 4QZ9A 1JX4A 1YZ6A 2BKEA 4EBCA 5CB1A 1S0MA 4RUCA 3G6YA 4ECUA 1JN3A 1MC8A 4RNNA 1N60A 3AN1A 3OPXA 4I2HA 1N61A 3SMVA 4G9BA 1BPYA 2JEFA 1RM6C 5KT3A 4ED6A 5GTIU 3ED5A 4DQQA 4NM2A 5DG9A 2NV3A 4U6PA 4I2BA 5ALFA 4YN4A 5KG1A 3OHAA 1N56A 4KLOA 5AI5A 4GC6A 2KJ9A 3V7LA 4NLCA 9ICTA 3ZI4A 4PGYA 4YR0A 5KG7A 4JB3A 2HHSA 3JPNA 4GIBA 5BPCA 3VC8A 4J9KA 4PHPA 2FPKA 1L7NA 2W9CB 1TAQA 1U47A 2VANA 9ICPA 4KLIA 2I5HA 3HKZF 1L3VA 2UVUA 2KK0A 3M6ZA 5D46A 4US9A 5KFYA 1ZQOA 3KHGA 2BDPA 5E79U 5DQIA 4XUSA 1ECWA 3AQEA 9ICSA 2HSZA 4PZNA 2F1HA 1TK5A 1JI7A 1S9FA 1JXLA 5ALTA 3E0FA 3C1ZA 5AI0A 1F44A 2AQ4A 1RDFA 2J6TA 1T94A 5AICA 5F9NA 1PUZA 2VIXA 5KT7A 4FFDA 2IOFK 1RXWA 2ZXHA 2OXOA 1XSPA 4EZ6A 2KNJA 3KHLA 1UT5A 2JEIA 5KFTA 1CRXA 4BWMA 1ZQUA 4FZLA 4DS5A 5J29A 1C20A 5EE1A 5KFKA 4YMOA 4YXJA 5EWFA 3RBEA 2AHOB 7ICFA 1X9WA 4UB1A 1ZQFA 3AU2A 1JALA 7ICTA 3PSTA 1V97A 5EWGA 4O0IA 3J81j 3PVXA 3C2MA 2BHNA 4RQNA 3NTUA 2JZBA 3UMCA 2RDJA 2YTUA 1HUZA 3E58A 3WKDA 3IN5A 1KFSA 8ICFA 2ES6A 4P0QA 5KFFA 2DWQA 4KLTA 2ASDA 1COKA 2DL0A 1TAUA 3H7IA 3WU2U 4YG2A 3IRUA 2HHVA 5L1MA 4JV2A 2EZYA 2UVVA 4OJOA 1VJ5A 1WYGA 3BQ7A 4P4PA 1X40A 4M0AA 3UMGA 3F5AA 7ICOA 4O3OA 4QW8A 2KSOB 2NYVA 1S0NA 4ZOHC 4DWIA 2HHXA 5KT6A 4YR2A 1KSPA 2EAPA 4MFFA 2XCPA 4Y2PA 3F53A 5ALUA 5KG3A 1L6NA 2ZUDA 4PJ0U 5FP0A 1HIWA 4DOBA 4F72A 1Z4NA 3GV8B 3PV8A 3O0FA 2C2RA 2GLEA 2JR5A 4JUZA 2H3IA 5ALYA 1MSWD 3NGDA 5ALIA 2G5IB 2CN1A 2ALZA 4P0QB 3C21A 1N62A 1S77D 5AHXA 5J2AA 3PMNA 2R8HA 2AU0A 4E0DA 2DKZA 1SKSA 1ZQNA 8ICTA 3CRXA 5DQHA 8ICZA 4J9PA 3JPOA 2W04A 3RJFA 5KL1B 4Q43A 2WHEA 4ED3A 2W11A 1JROA 2Q4TA 2G06A 2IBKA 2ASLA 3JPTA 1Z00A 2DKXA 5CJ7A 2PFPA 4QZDA 3ZDAA 5KFQA 4ECRA 4GXIA 1ZQXA 1H38A 3MR5A 2XY7A 1RYSA 2WB1C 2HDOA 3WK7A 2XY6A 2DQNB 4LJXA 4LZGA 4RPYA 1ZQZA 4C80A 1ZQ1C 4M47A 4QWBA 2NO4A 4F5OA 5DB6A 3RH6A 3AU6A 4EENA 5KFPA 4DSIA 2B6GA 1TK8A 4F4KA 4YR3A 7ICHA 5KFZA 5J8YC 2M9NA 2G07A 2PMZC 4PHAA 4KLJA 4GLXA 3EUB2 3SAHA 5A0LA 3RB3A 4F92B 2NRZA 4P0PB 2H3ZA 1SB3C 5HHIA 3WK5A 5J2DA 9ICLA 2OHFA 4EEYA 1MN8A 2JEGA 1ZQWA 9ICKA 1KFTA 5J2FA 3V7KA 2KG5A 4DSEA 1JRPA 5KFMA 2C2DA 1NZBA 3SI8A 3D2SA 4AYBF 2E1EA 9ICUA 2A1JB 4DS4A 1NK9A 1Q8KA 3QEBZ 1X6JA 1ED1A 3HKZC 3LVVA 1X9SA 4YFKA 2DF4B 3A0HU 1KDHA 1X6IA 5AKHA 2OM6A 2R8KA 5BOMA 3T3FA 4Y2RA 5J0XA 2XY5A 4PZOA 2PFOA 5J2GA 5EWEA 3M6KA 3MDAA 2D3DA 1BPZA 5KAIU 3NVWA 2V9WA 5IINA 4QZIA 2JXJA 4IL6U 4P4OA 3K4GA 1A6SA 4QZCA 5JUMA 2PFNA 2EAOA 2F76X 8ICCA 1JMSA 4DQIA 4DCCA 1XO0A 2XGQA 3RJEA 5AM0A 3N28A 2QB1A 4ECSA 4GFJA 4KITB 4CF3A 8ICHA 3K75D 4RQ6A 4DQPA 5KFRA 2J6SA 2DUYA 2WF6A 4EX7A 1XS9D 3NVVA 2KTQA 5KFGA 2HVHA 3ISBA 4EELA 2HHUA 4NLGA 2Y9TA 3C23A 3I1YA 5JRTA 5ALOA 4JMUA 5ALQA 4OJLA 4M6WA 2ZIUA 3KKAA 3AUOA 1L5UA 2E8PA 4I29A 5J0YA 5J2JA 4I2EA 4O5EA 2HI0A 5AIAA 5ALNA 1RYUA 3G6XA 4PL2A 3ETRA 4B9SA 5HMMA 3WK6A 3I76A 2KHQA 5J0TA 5ALXA 3UXPA 2KOBA 5AI6A 2R8GA 2F8LA 2W3SA 4EBDA 3PW4A 3FYHA 4I2CA 4C7ZA 4JWNA 4CNQA 4B9NA 4K4IA 3MR2A 3K1RB 4OJPA 4LVSA 4NLNA 3H0LB 3OGUA 3MGHA 1Y88A 5KT4A 4J9QA 3MDCA 2GO7A 3QNMA 4RQ2A 3N97B 3PR5B 3B9JA 1WWVA 3HW8A 1ZYQA 9ICQA 2W9BB 1V85A 1WUDA 3JPSA 2XGPA 3GV7B 4ED8A 5AI9A 4AP9A 2PKEA 4CGZA 4EYHB 3TANA 4Z6EA 2KSOA 1LKYB 4M9NA 7ICLA 4ELTA 9ICGA 1WWUA 4NXZA 1SWWA 5TZVA 2EH9A 3FM9A 5AKEA 4QJFB 5AKZA 5KFDA 3KHRA 1FFUA 4C8LA 4RPZA 1J2MA 1DGJA 4Q8EA 2C2EA 3IP4B 1TK0A 4PGXA 2A1JA 2KZZA 4LZDA 1WG8A 3PX4A 1QSYA 3LYSA 4F4YA 4QZAA 4K4HA 1CI4A 4ECYA 3RAXA 1U4BA 1NJXA 5CEHA 3RH5A 1LVHA 5HR6A 1Q3VA 2KHVA 5IIKA 2L5YA 3BZKA 3HP6A 3PX6A 3GIMA 2XIDA 5G5HA 3PO5A 1XSNA 4MF8A 8ICGA 4C8MA 4Y2XA 5DKWA 2LYHA 1TAMA 3GU3A 2BR0A 3QZ8A 4KLMA 4J9LA 2LI6A 2HCFA 2KJ8A 1NK5A 1L8OA 4EZ9A 5KFJA 4PHEA 4DSJA 1SWVA 2KN7A 4FZNA 3PW2A 8ICUA 2NO5A 8ICMA 4USAA 3RBDA 1ZQBA 5IIJA 1CUKA 2LM1A 5KFVA 2H5XA 4M9HA 1N48A 4DL2A 4NLZA 2Q0ZX 3QUBA 5J0UA 5AKGA 4C8NA 4I2GA 4JV1A 1SL1A 3MR3A 1UQVA 1NKCA 1T4GA 4MEYA 2HW3A 5AK3A 2JHDA 3H0MB 4IRKA 3G6VA 4PH5A 3EZ5A 3DDHA 1JXEA 5AKYA 4F71A 1SV0A 4OD0A 1ZQEA 9ICVA 4PHDA 4UB6U 3HWTA 3Q8MA 4Y2YA 1O08A 2K89A 2LPEA 1T3NA 2WB1F 4KX3A 3V6HA 2IOFA 2JH7A 5AM1A 1KFDA 3H40A 3SQIA 1ZQQA 4F91B 2BPFA 4Y2VA 2RLTA 1SV0C 4RT3A 1COOA 1FO4A 2HVIA 3SV3A 2FMPA 5KT5A 4P0PA 4FO6A 9ICJA 5HHHA 7ICMA 2KVCA 8ICXA 3I28A 3BQ1A 3T5HA 3QZ7A 1HEKA 1V38A 1ZJMA 4F5RA 4C0ZA 4P2HA 5DB7A 1SKRA 4PGQA 1ZQVA 4XRHA 2RDIA 3ALRA 1ZQLA 3KKAC 1KQQA 4RUAA 4KN4A 1ZQKA 2DBYA 2K8BB 5KT2A 1KRPA 2KFZA 3PW7A 2PI4A 5J8YA 5T14A 2AH5A 1L7PA 3TADA 1PVQA 1OXJA 5IIOA 2PI5A 1Z00B 2WF7A 3Q8PB 5H2FU 9ICMA 2B21A 4Y2QA 1BNPA 1Z1BA 2KKPA 4F5NA 2PMZF 3QU7A 3U26A 1ZRNA 4HYKA 2OCEA 5ALWA 2O6KA 4DL7A 2V4QA 3B0YA 1SZPA 4O9MA 3CNHA 2ZUBA 3Q8QB 4I27A 1L3SA 2IHMA 5KFSA 1T7PA 2FPMA 3BZCA 2ISOA 5EOZA 4X5VA 4GXKA 3GZFA 5GTHU 2W9MA 4J9RA 4O3PA 5ALLA 5AI4A 4B9TA 2K4HA 4US8A 4QZBA 2KIWA 2ZIVA 8ICOA 3Q8KA 4RQMA 1RG6A 5BOLA 2BCSA 1U9LA 2K8AA 4F4WA 2FJ6A 5J0QA 1GO3F 2AXTU 1BGXT 3N7RC 3WKEA 4BGDA 2WTFA 4DFKA 1IG6A 9ICNA 2I6XA 2AGPA 3MC1A 5D4BA 8ICSA 4UAWA 5KFBA 4RQ8A 1U48A 3WKBA 3PR4A 1ZD5A 3ETLA 5J0SA 4NL9A 4DSLA 4QNLA 2LYBA 5J2BA 2OYYA 2YB4A 2FLNA 5HNKA 2WF5A 2YMLA 3HPOA 2YMQA 3WK8A 3K1ZA 5ALZA 4UAVA 2IA6A 4Z6FA 2E8NA 4UB2A 3TARA 1F0MA 2QARB 4IRCA 2FPLA 4C4RA 1L8LA 1ZQGA 3MABA 5ALMA 2HMXA 5J2HA 3DEEA 3TAQA 3QYPA 2JRZA 1X9XA 5EE3A 1Q3UA 3SZ2A 3UXOA 3QE9Y 5J2EA 4WJ3B 2P6UA 2HHQA 3BJYA 1L7MA 5DG8A 2YY6A 4C8KA 4XA5A 1NZPA 5KG2A 1F5SA 5AIBA 2V4RA 2Y1IA 1N2XA 4DLGA 1PVRA 1KN5A 4IQVA 3SAGA 8ICLA 1N63A 2H3VA 5AM3A 1K5OA 2H3FA 2JV3A 4J9MA 4K4GA 3C28A 1YZ7A 4A8EA 3PX0A 1U49A 3T5LA 5ALGA 3EPIA 3RFAA 1A76A 5KFLA 2BQRA 3RJKA 2A3VA 7ICSA 2NRWA 2K4PA 3RTVA 3D2NA 4F93B 5CR0A 4IQTA 3SENA 3DV9A 4KLLA 2I1QA 2XVTA 4P4MA 2JGAA 4QWDA 3L3FX 4DL3A 3NRWA 3TKAA 3M9OB 3EWAA 2FMSA 5CP2A 2HOIA 2W9AA 2LKYA 1S5LU 3MFIA 3KFUF 1ZQMA 1BPEA 1IV8A 1ZQRA 1B0XA 3HRDD 1MQ2A 1AROP 1ZQDA 3MGVA 3PO4A 4UARA 5J2IA 4MEXA 4UATA 4Y2JA 1O03A 2R8IA 3LWMA 4CE6A 4I2AA 2BCQA 5AM5A 4RQ7A 3C1YA 5ALRA 5KFOA 2QARA 3PW0A 1ZOLA 3SR6A 3GIIA 5AK5A 2D6FC 5J0OA 4RNMA 5IILA 2DPJA 7ICIA 3PSFA 1K1SA 2ZIWA 4TUPA 3WK9A 3V6KA 4KLGA 1QQ6A 3H8JA 2GWSA 2VJ4A 1RYRA 3RAQA 4UBBA 3CW2C 1Z4OA 4CF5A 3KD3A 3C2LA 3QU2A 2KJ5A 4DFPA 1SV4A 4DL6A 7ICGA 5J0RA 4BWJA 2XO7A 2BCUA 2CPRA 3KBBA 5K4LA 1PVPA 4DF8A 1JIHA 4QWCA 3F2CA 1M6YA 4IR9A 1NJYA 2K60A 5AKIA 2BPGA 1D9FA 1DRGA 4UASA 5L1LA 1VLBA 1XWLA 1X2IA 4GXJA 5DGAA 4NM1A 5KFNA 3L5KA 5D49A 4YP3A 2UVRA 4DOCA 2EZZA 1ZXIA 4DSFA 3RJHA 4M9LA 2FE9A 1XNSA 1TVAA 5KFIA 3OJSA 4B9VA 1S8OA 3HX0A 2B0CA 2JZBB 4IS7A 4ECVA 1DK2A 4NV0A 1KLNA 2H3QA 2OH2A 2EAMA 3ZDCA 1ZD2P 2RHFA 3QX7A 4F5PA 3BDPA 5IIMA 2BZFA 1X9MA 3T79A 3TQ1A 3M8RA 2MUTB 2F77X 2BPCA 2W9BA 1JUDA 3AMZA 4ECTA 4O3MA 1BPBA 4UB3A 3T5JA 1ZQIA 2W8KA 4QZ8A 4O3NA 3BQ0A 4RU9A 3ICXA 1A0PA 1D8BA 4IQWA 4MFAA 4O3QA 3M1YA 1XO1A 1NK8A 3MFHA 3JPQA 2W7PA 3PSPA 3RF9A 1DGSA 2LM4A 4ZH4A 1K1QA 4RQ5A 2JH1A 1XSLA 4O5KA 2IOHA 5JU5A 3FC4A 3F2BA 2A19A 4F2SA 2QLTA 1FFVA 4R65A 8ICWA 4Y2UA 4DOAA 3FDSA 2F8KA 5AM4A 4RQ1A 3RJGA 4EX6A 2YN4A 2UVWA 2W55A 4YVZA 1A77A 4KLQA 3NVYA 2FDRA 2MSNA 3V72A 1WCLA 4UAYA 1PK1B 2VJ5A 1PK3A 2KE7A 2EANA 3ZDDA 4DFMA 8ICEA 3LK9A 5EE0A 2QB0A 9ICFA 1KTQA 1KL9A 3LDAA 1ZQJA 3H4DA 2K8CB 4IC9A 3NVZA 4EBEA 4O5CA 4ECQA 4PL1A 8ICQA 3Q8SB 1HJPA 1OUQA 2ZIXA 3F2DA 4YMNA 1NJWA 4ED2A 4JK1A 2W03A 4O3SA 5F3XB 5B5EU 4KLSA 8ICYA 1RQLA 4R8UA 3GIKA 1SKWA 3TACB 4XQ8A 2RQ5A 3SEIA 5HP4A 2HHTA 2BQUA 5J2KA 2GOLA 3QUTA 1ZQPA 3SYZA 4JV0A 2AQ0A 4QZGA 2DFLA 3Q8RB 3GIJA 2ZTCA 3BS5B 2Y9UA 2DPIA 9ICHA 4MHVA 2CRXA 3E2EA 2C22A 5CA7A 2E5SA 4IR1A 4KN7A 2P35A 3Q8LA 4KLEA 2R8JA 3IG8A 2KVSA 1NK4A 4BUGA 2ZJ8A 5TISU 2ZTDA 1NKEA 5KG0A 3HJEA 3ISDA 4DFDA 3KTQA 4TURA 2Y0SC 3V6JA 2ZIWB 4FBTA 1SL0A 1PZNA 2RRDA 3UQ2A 1Z3EB 5KNIA 3H8SA 2IMWP 1ZQSA 5AKKA 4M9GA 2EDUA 2Y1JA 5F9LA 1QQ7A 3CYMA 2LYAA 1C7YA 2ZIUB 1SGGA 3ONNA 3GQCA 1WCNA 3IDWA 3MBYA 3PW5A 3WK4A 5B66U 1IM4A 4R64A 3RR8A 5DBBA 4KX5A 2HOQA 2KZMA 2KEYA 2KMDA 4NLBA 3OTQA 2P6RA 1T3QA 2F1JA 4CDGA 1UT8A 2F2AB 3QUQA 8ICBA 5DB8A 2XICA 4J9SA 3NASA 3THVA 7ICRA 2KD1A 2WF9A 9ICWA 4B9LA 4BDPA 3WKAA 2EZXA 2ZG6A 5ALHA 1AQ6A 2F3NA 4QZFA 2BCRA 3EPGA 1DK3A 2XI9A 7ICPA 2DGZA 1FIQA 4YMMA 3QU9A 4BXOB 5C0YA 4UB8U 5HMLA 1IIPA 3RH4A 4UB5A 3C5FA 3IG5A 3C5GA 3PZPA 3RB6A 1LV5A 5AK6A 3JPRA 3GV5B 4DEZA 4ECZA 3H4BA 2MA1A 1TFRA 2M0NA 1UHUA 4HAIA 4KLHA 3QXGA 3C29A 4B9MA 4G3IA 1Z1VA 1X42A 2J6UA 1ZQYA 2AJQA 2ATLA 1DOQA 2OWOA 5CWRA 4YD1A 1Q46A 1URJA 5CRXA 1NI3A 1ZQCA 1L3UA 1D9DA 3D6JA 5KFAA 4TQRA 2C28A
chains in the Genus database with same CATH topology
2KE7A 2EANA 2EAPA 1SXDA 1V38A 5KNIA 3BS5A 1SXEA 3HILA 4PZNA 4IS7A 4NJ8A 2KIVA 4NL9A 2QB0A 1JI7A 2GLEA 2EAMA 3KKAC 1B0XA 1SGGA 3K1RB 3IDWA 1KW4A 4PZOA 2ESEA 2E8MA 2DKZA 2E8NA 5J8YA 1F0MA 2QARB 2QB0B 3TADA 2D3DA 2KMDA 1WWVA 1X66A 1OXJA 5F3XB 2QARA 1V85A 3TACB 2DKXA 3SEIA 1UQVA 4NL9C 1X9XA 2D8CA 2EAOA 2KSOA 2F3NA 1LKYB 2QB1A 1WWUA 4RQNA 1UCVA 2YTUA 3H8MA 3BS5B 2Y9UA 1SV0A 2B6GA 1SV4A 2ES6A 3TADC 2QKQA 4MHVA 5J8YC 5JU5A 1COKA 3BS7A 2DL0A 2Y9TA 2JV3A 5JRTA 2F8KA 2LMRA 2LPEA 2K60A 5L1MA 1OW5A 2F44A 3KKAA 4RQMA 1Z1VA 2E8PA 1RG6A 3BQ7A 1X40A 1SV0C 1PK1A 2K4PA 2L5YA 1B4FA 2KSOB 2E8OA 2KG5A 1DXSA 3SENA 1PK1B 1PK3A 5JTIA 2FE9A 1LKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE7 A;  2EAN A;  2EAP A;  1SXD A;  1V38 A;  5KNI A;  3BS5 A;  1SXE A;  3HIL A;  4PZN A;  4IS7 A;  4NJ8 A;  2KIV A;  4NL9 A;  2QB0 A;  1JI7 A;  2GLE A;  2EAM A;  3KKA C;  1B0X A;  1SGG A;  3K1R B;  3IDW A;  1KW4 A;  4PZO A;  2ESE A;  2E8M A;  2DKZ A;  2E8N A;  5J8Y A;  1F0M A;  2QAR B;  2QB0 B;  3TAD A;  2D3D A;  2KMD A;  1WWV A;  1X66 A;  1OXJ A;  5F3X B;  2QAR A;  1V85 A;  3TAC B;  2DKX A;  3SEI A;  1UQV A;  4NL9 C;  1X9X A;  2D8C A;  2EAO A;  2KSO A;  2F3N A;  1LKY B;  2QB1 A;  1WWU A;  4RQN A;  1UCV A;  2YTU A;  3H8M A;  3BS5 B;  2Y9U A;  1SV0 A;  2B6G A;  1SV4 A;  2ES6 A;  3TAD C;  2QKQ A;  4MHV A;  5J8Y C;  5JU5 A;  1COK A;  3BS7 A;  2DL0 A;  2Y9T A;  2JV3 A;  5JRT A;  2F8K A;  2LMR A;  2LPE A;  2K60 A;  5L1M A;  1OW5 A;  2F44 A;  3KKA A;  4RQM A;  1Z1V A;  2E8P A;  1RG6 A;  3BQ7 A;  1X40 A;  1SV0 C;  1PK1 A;  2K4P A;  2L5Y A;  1B4F A;  2KSO B;  2E8O A;  2KG5 A;  1DXS A;  3SEN A;  1PK1 B;  1PK3 A;  5JTI A;  2FE9 A;  1LKY A; 
#chains in the Genus database with same CATH topology
 2ZUC A;  1Z19 A;  4C7Y A;  1QLN A;  4ED0 A;  8ICK A;  3RJI A;  3VCB A;  1J97 A;  4BXO A;  3H0R B;  3RRH A;  4BJQ A;  3QEA Z;  4OJ6 A;  5CHG A;  3OSP A;  4TUQ A;  3BQT A;  4RQ3 A;  2KFN A;  2I9G A;  5AKL A;  2ZIX B;  3OSN A;  2OEH A;  4UBC A;  1FEZ A;  1SZH A;  2ESE A;  2XC9 A;  3PY8 A;  2YX8 A;  5AI8 A;  2LHT A;  5DLF A;  2QB0 B;  1NKB A;  2EQY A;  1QSS A;  2YB1 A;  3RJJ A;  4FBU A;  5ALS A;  2BCV A;  1NK7 A;  2MU2 A;  3RRG A;  3LWL A;  4EYI B;  3R9K A;  1S0V A;  3UPQ A;  4RT2 A;  1S0O A;  4ECW A;  3AL0 B;  2KP7 A;  4FS2 A;  4MFC A;  4RNO A;  3QUC A;  3M9M B;  3BQ2 A;  1KEJ A;  5ALJ A;  3D2Q A;  4I2I A;  2K4I A;  4KMO B;  2Y0S F;  1S76 D;  3ISC A;  2W43 A;  3BS7 A;  1RQN A;  4I2D A;  3NS1 A;  5KFH A;  2MRL A;  2KZ3 A;  3OJU A;  1L3T A;  4ELU A;  4M2Y A;  2MAX A;  4UAZ A;  2W54 A;  2W9C A;  3IHQ B;  2ISP A;  8ICV A;  2XCA A;  1LB2 B;  1ZQA A;  4I28 A;  4AYB C;  1B43 A;  1PK1 A;  5AK4 A;  4DLE A;  1D8Y A;  2WAQ F;  4RPX A;  2HBM A;  3S6J A;  4QWA A;  4J03 A;  4I2F A;  4QIW F;  1LKY A;  1TE2 A;  4ELV A;  1D8L A;  2WF8 A;  4BX9 C;  1S10 A;  4ICA A;  7ICE A;  5KG5 A;  2ZIV B;  4DQS A;  4GC7 A;  5ALE A;  4ED1 A;  9ICR A;  4Y2S A;  4YQW A;  2MUT A;  2E1F A;  1BVS A;  4IQU A;  1NK0 A;  3ZDE A;  3ORY A;  2FMQ A;  4I2J A;  4Q44 A;  1KW4 A;  3IM1 A;  5AKX A;  2P66 A;  4R66 A;  3SD7 A;  1QH9 A;  5KG4 A;  9ICA A;  4DQR A;  1SIJ A;  4TQS A;  1X66 A;  2BDU A;  1QSL A;  4DL5 A;  4F3O A;  3F5E A;  2G09 A;  4CF4 A;  4C8O A;  4F4Z A;  1ZET A;  7ICV A;  8ICP A;  4KMU A;  2YQE A;  5KFW A;  4F50 A;  3V7J A;  4OCZ A;  3PML A;  2FI1 A;  2RP5 A;  5AM2 A;  3PSI A;  2ZJA A;  3ZD9 A;  1UCV A;  2E3T A;  1ZRM A;  5DBC A;  4UW9 A;  4NWI A;  4J9O A;  3MR6 A;  4UAU A;  2KKV A;  4KLF A;  2JMG A;  1NOM A;  3M8S A;  2FLL A;  9ICB A;  4DO9 A;  3RB4 A;  2HBL A;  4RZR A;  5DDY A;  3PNC A;  3GIL A;  4U7C A;  2N1R A;  3H8W A;  7ICQ A;  1KKX A;  3NUQ A;  3C2K A;  1N5X A;  4C4S A;  2VA3 A;  5J0P A;  2VA8 A;  3RB0 A;  1B4F A;  1DXS A;  4PPX A;  2BGW A;  3UXN A;  1NNL A;  2VA2 A;  4YD2 A;  3EYZ A;  2K4E A;  8ICR A;  2W8L A;  4F8R A;  4F5Q A;  1UA1 A;  2NRV A;  1QQ5 A;  1SL2 A;  2KIV A;  4YXM A;  1KBU A;  1P7D A;  7ICU A;  3IV6 A;  5KTQ A;  4ED7 A;  5III A;  3LVW A;  1ZQH A;  7ICJ A;  1MA7 A;  4OO1 J;  4M6W B;  2Z7J A;  3SV4 A;  1QTM A;  9ICE A;  3FAH A;  2GH1 A;  2HBK A;  4FZM A;  8ICN A;  3ZDB A;  1U45 A;  2BQ3 A;  2HHW A;  5KFE A;  4RQ4 A;  1ZJN A;  4B9U A;  4DSK A;  4EEK A;  4R8U B;  4CRX A;  1J2N A;  4O3R A;  3RR7 A;  5L1I A;  7ICK A;  4RQ0 A;  5KFU A;  5C5J A;  3T5K A;  4UB4 A;  4TUS A;  4M04 A;  4FS1 A;  5ALP A;  1RZT A;  2CXY A;  1L7O A;  3TFR A;  3QU4 A;  8ICI A;  2LBO A;  1BPD A;  1BNO A;  2W3R A;  2PXI A;  5KFC A;  3SAF A;  3AEV A;  4Z6C A;  1V9P A;  5L9X A;  3NRZ A;  3OHB A;  2LMR A;  1UPH A;  3N4M B;  1OW5 A;  2WFA A;  3L4P A;  4IRD A;  4C4T A;  5DQG A;  1NJZ A;  5ALD A;  3KZI U;  5KAF U;  4QZH A;  3TFS A;  4R63 A;  3M7D A;  4QIW C;  1VDV A;  3EW9 A;  1IXR A;  9ICO A;  3WKC A;  4NY8 A;  3QU5 A;  8ICJ A;  5J2C A;  4KTQ A;  3UQ0 A;  3N7P D;  5HR7 A;  1SXE A;  3HIL A;  2ZXI A;  4ECX A;  3B0X A;  3KZX A;  4ACO A;  2YMP A;  1BPX A;  5L1K A;  1MQ3 A;  1T8E A;  2HBJ A;  5ALK A;  5DLG A;  5DGB A;  2AGO A;  2KV2 A;  2IHN A;  2E8M A;  1UA0 A;  3MGI A;  1TKD A;  3A0B U;  5G5G A;  2W7O A;  4KLU A;  2ZJ5 A;  4J9N A;  3KHH A;  2NRT A;  9ICX A;  2G5H B;  4CCH A;  1ZD4 A;  2D8C A;  4NL9 C;  2AGQ A;  3AQF A;  2FLP A;  4QZE A;  2KIC A;  5AKJ A;  5J0W A;  2ZTE A;  3HT3 A;  5DG7 A;  3CP8 A;  4NLK A;  2R18 A;  5KFX A;  3TI0 A;  1XC9 A;  1N5W A;  2ODG A;  3UM9 A;  9ICI A;  1EXN A;  4YCX A;  1RXV A;  4KLD A;  3KOO A;  2HOF A;  3H8M A;  3AM9 A;  1YT3 A;  1S97 A;  3JPP A;  3GFK B;  2ASJ A;  1CEZ A;  3TAD C;  2QKQ A;  3N7S C;  5EE9 A;  4OJ5 A;  2G08 A;  2JEJ A;  7ICN A;  9ICC A;  4Q45 A;  2F1I A;  4UQG A;  1B22 A;  5DBA A;  2F44 A;  3ZD8 A;  4Z6D A;  4DL4 A;  1QCK A;  3UMB A;  5ALV A;  5L1J A;  4F4X A;  1RPL A;  8ICA A;  2E8O A;  2VKQ A;  5KL8 B;  4DFJ A;  3M9N B;  5DB9 A;  2PFQ A;  2G0A A;  4DF4 A;  5JTI A;  3GDX A;  1ZD3 A;  1ZQT A;  4Q8F A;  4QWE A;  2YMM A;  1HUO A;  4QW9 A;  1SXD A;  4MF2 A;  3BS5 A;  2A1A A;  2NRX A;  4FE3 A;  4NJ8 A;  4B6J A;  4F2R A;  5DDM A;  4JWM A;  5KG6 A;  1TV9 A;  1XU4 A;  3TAP A;  4M9J A;  4Y2T A;  2WAQ C;  1NK6 A;  4QZ9 A;  1JX4 A;  1YZ6 A;  2BKE A;  4EBC A;  5CB1 A;  1S0M A;  4RUC A;  3G6Y A;  4ECU A;  1JN3 A;  1MC8 A;  4RNN A;  1N60 A;  3AN1 A;  3OPX A;  4I2H A;  1N61 A;  3SMV A;  4G9B A;  1BPY A;  2JEF A;  1RM6 C;  5KT3 A;  4ED6 A;  5GTI U;  3ED5 A;  4DQQ A;  4NM2 A;  5DG9 A;  2NV3 A;  4U6P A;  4I2B A;  5ALF A;  4YN4 A;  5KG1 A;  3OHA A;  1N56 A;  4KLO A;  5AI5 A;  4GC6 A;  2KJ9 A;  3V7L A;  4NLC A;  9ICT A;  3ZI4 A;  4PGY A;  4YR0 A;  5KG7 A;  4JB3 A;  2HHS A;  3JPN A;  4GIB A;  5BPC A;  3VC8 A;  4J9K A;  4PHP A;  2FPK A;  1L7N A;  2W9C B;  1TAQ A;  1U47 A;  2VAN A;  9ICP A;  4KLI A;  2I5H A;  3HKZ F;  1L3V A;  2UVU A;  2KK0 A;  3M6Z A;  5D46 A;  4US9 A;  5KFY A;  1ZQO A;  3KHG A;  2BDP A;  5E79 U;  5DQI A;  4XUS A;  1ECW A;  3AQE A;  9ICS A;  2HSZ A;  4PZN A;  2F1H A;  1TK5 A;  1JI7 A;  1S9F A;  1JXL A;  5ALT A;  3E0F A;  3C1Z A;  5AI0 A;  1F44 A;  2AQ4 A;  1RDF A;  2J6T A;  1T94 A;  5AIC A;  5F9N A;  1PUZ A;  2VIX A;  5KT7 A;  4FFD A;  2IOF K;  1RXW A;  2ZXH A;  2OXO A;  1XSP A;  4EZ6 A;  2KNJ A;  3KHL A;  1UT5 A;  2JEI A;  5KFT A;  1CRX A;  4BWM A;  1ZQU A;  4FZL A;  4DS5 A;  5J29 A;  1C20 A;  5EE1 A;  5KFK A;  4YMO A;  4YXJ A;  5EWF A;  3RBE A;  2AHO B;  7ICF A;  1X9W A;  4UB1 A;  1ZQF A;  3AU2 A;  1JAL A;  7ICT A;  3PST A;  1V97 A;  5EWG A;  4O0I A;  3J81 j;  3PVX A;  3C2M A;  2BHN A;  4RQN A;  3NTU A;  2JZB A;  3UMC A;  2RDJ A;  2YTU A;  1HUZ A;  3E58 A;  3WKD A;  3IN5 A;  1KFS A;  8ICF A;  2ES6 A;  4P0Q A;  5KFF A;  2DWQ A;  4KLT A;  2ASD A;  1COK A;  2DL0 A;  1TAU A;  3H7I A;  3WU2 U;  4YG2 A;  3IRU A;  2HHV A;  5L1M A;  4JV2 A;  2EZY A;  2UVV A;  4OJO A;  1VJ5 A;  1WYG A;  3BQ7 A;  4P4P A;  1X40 A;  4M0A A;  3UMG A;  3F5A A;  7ICO A;  4O3O A;  4QW8 A;  2KSO B;  2NYV A;  1S0N A;  4ZOH C;  4DWI A;  2HHX A;  5KT6 A;  4YR2 A;  1KSP A;  2EAP A;  4MFF A;  2XCP A;  4Y2P A;  3F53 A;  5ALU A;  5KG3 A;  1L6N A;  2ZUD A;  4PJ0 U;  5FP0 A;  1HIW A;  4DOB A;  4F72 A;  1Z4N A;  3GV8 B;  3PV8 A;  3O0F A;  2C2R A;  2GLE A;  2JR5 A;  4JUZ A;  2H3I A;  5ALY A;  1MSW D;  3NGD A;  5ALI A;  2G5I B;  2CN1 A;  2ALZ A;  4P0Q B;  3C21 A;  1N62 A;  1S77 D;  5AHX A;  5J2A A;  3PMN A;  2R8H A;  2AU0 A;  4E0D A;  2DKZ A;  1SKS A;  1ZQN A;  8ICT A;  3CRX A;  5DQH A;  8ICZ A;  4J9P A;  3JPO A;  2W04 A;  3RJF A;  5KL1 B;  4Q43 A;  2WHE A;  4ED3 A;  2W11 A;  1JRO A;  2Q4T A;  2G06 A;  2IBK A;  2ASL A;  3JPT A;  1Z00 A;  2DKX A;  5CJ7 A;  2PFP A;  4QZD A;  3ZDA A;  5KFQ A;  4ECR A;  4GXI A;  1ZQX A;  1H38 A;  3MR5 A;  2XY7 A;  1RYS A;  2WB1 C;  2HDO A;  3WK7 A;  2XY6 A;  2DQN B;  4LJX A;  4LZG A;  4RPY A;  1ZQZ A;  4C80 A;  1ZQ1 C;  4M47 A;  4QWB A;  2NO4 A;  4F5O A;  5DB6 A;  3RH6 A;  3AU6 A;  4EEN A;  5KFP A;  4DSI A;  2B6G A;  1TK8 A;  4F4K A;  4YR3 A;  7ICH A;  5KFZ A;  5J8Y C;  2M9N A;  2G07 A;  2PMZ C;  4PHA A;  4KLJ A;  4GLX A;  3EUB 2;  3SAH A;  5A0L A;  3RB3 A;  4F92 B;  2NRZ A;  4P0P B;  2H3Z A;  1SB3 C;  5HHI A;  3WK5 A;  5J2D A;  9ICL A;  2OHF A;  4EEY A;  1MN8 A;  2JEG A;  1ZQW A;  9ICK A;  1KFT A;  5J2F A;  3V7K A;  2KG5 A;  4DSE A;  1JRP A;  5KFM A;  2C2D A;  1NZB A;  3SI8 A;  3D2S A;  4AYB F;  2E1E A;  9ICU A;  2A1J B;  4DS4 A;  1NK9 A;  1Q8K A;  3QEB Z;  1X6J A;  1ED1 A;  3HKZ C;  3LVV A;  1X9S A;  4YFK A;  2DF4 B;  3A0H U;  1KDH A;  1X6I A;  5AKH A;  2OM6 A;  2R8K A;  5BOM A;  3T3F A;  4Y2R A;  5J0X A;  2XY5 A;  4PZO A;  2PFO A;  5J2G A;  5EWE A;  3M6K A;  3MDA A;  2D3D A;  1BPZ A;  5KAI U;  3NVW A;  2V9W A;  5IIN A;  4QZI A;  2JXJ A;  4IL6 U;  4P4O A;  3K4G A;  1A6S A;  4QZC A;  5JUM A;  2PFN A;  2EAO A;  2F76 X;  8ICC A;  1JMS A;  4DQI A;  4DCC A;  1XO0 A;  2XGQ A;  3RJE A;  5AM0 A;  3N28 A;  2QB1 A;  4ECS A;  4GFJ A;  4KIT B;  4CF3 A;  8ICH A;  3K75 D;  4RQ6 A;  4DQP A;  5KFR A;  2J6S A;  2DUY A;  2WF6 A;  4EX7 A;  1XS9 D;  3NVV A;  2KTQ A;  5KFG A;  2HVH A;  3ISB A;  4EEL A;  2HHU A;  4NLG A;  2Y9T A;  3C23 A;  3I1Y A;  5JRT A;  5ALO A;  4JMU A;  5ALQ A;  4OJL A;  4M6W A;  2ZIU A;  3KKA A;  3AUO A;  1L5U A;  2E8P A;  4I29 A;  5J0Y A;  5J2J A;  4I2E A;  4O5E A;  2HI0 A;  5AIA A;  5ALN A;  1RYU A;  3G6X A;  4PL2 A;  3ETR A;  4B9S A;  5HMM A;  3WK6 A;  3I76 A;  2KHQ A;  5J0T A;  5ALX A;  3UXP A;  2KOB A;  5AI6 A;  2R8G A;  2F8L A;  2W3S A;  4EBD A;  3PW4 A;  3FYH A;  4I2C A;  4C7Z A;  4JWN A;  4CNQ A;  4B9N A;  4K4I A;  3MR2 A;  3K1R B;  4OJP A;  4LVS A;  4NLN A;  3H0L B;  3OGU A;  3MGH A;  1Y88 A;  5KT4 A;  4J9Q A;  3MDC A;  2GO7 A;  3QNM A;  4RQ2 A;  3N97 B;  3PR5 B;  3B9J A;  1WWV A;  3HW8 A;  1ZYQ A;  9ICQ A;  2W9B B;  1V85 A;  1WUD A;  3JPS A;  2XGP A;  3GV7 B;  4ED8 A;  5AI9 A;  4AP9 A;  2PKE A;  4CGZ A;  4EYH B;  3TAN A;  4Z6E A;  2KSO A;  1LKY B;  4M9N A;  7ICL A;  4ELT A;  9ICG A;  1WWU A;  4NXZ A;  1SWW A;  5TZV A;  2EH9 A;  3FM9 A;  5AKE A;  4QJF B;  5AKZ A;  5KFD A;  3KHR A;  1FFU A;  4C8L A;  4RPZ A;  1J2M A;  1DGJ A;  4Q8E A;  2C2E A;  3IP4 B;  1TK0 A;  4PGX A;  2A1J A;  2KZZ A;  4LZD A;  1WG8 A;  3PX4 A;  1QSY A;  3LYS A;  4F4Y A;  4QZA A;  4K4H A;  1CI4 A;  4ECY A;  3RAX A;  1U4B A;  1NJX A;  5CEH A;  3RH5 A;  1LVH A;  5HR6 A;  1Q3V A;  2KHV A;  5IIK A;  2L5Y A;  3BZK A;  3HP6 A;  3PX6 A;  3GIM A;  2XID A;  5G5H A;  3PO5 A;  1XSN A;  4MF8 A;  8ICG A;  4C8M A;  4Y2X A;  5DKW A;  2LYH A;  1TAM A;  3GU3 A;  2BR0 A;  3QZ8 A;  4KLM A;  4J9L A;  2LI6 A;  2HCF A;  2KJ8 A;  1NK5 A;  1L8O A;  4EZ9 A;  5KFJ A;  4PHE A;  4DSJ A;  1SWV A;  2KN7 A;  4FZN A;  3PW2 A;  8ICU A;  2NO5 A;  8ICM A;  4USA A;  3RBD A;  1ZQB A;  5IIJ A;  1CUK A;  2LM1 A;  5KFV A;  2H5X A;  4M9H A;  1N48 A;  4DL2 A;  4NLZ A;  2Q0Z X;  3QUB A;  5J0U A;  5AKG A;  4C8N A;  4I2G A;  4JV1 A;  1SL1 A;  3MR3 A;  1UQV A;  1NKC A;  1T4G A;  4MEY A;  2HW3 A;  5AK3 A;  2JHD A;  3H0M B;  4IRK A;  3G6V A;  4PH5 A;  3EZ5 A;  3DDH A;  1JXE A;  5AKY A;  4F71 A;  1SV0 A;  4OD0 A;  1ZQE A;  9ICV A;  4PHD A;  4UB6 U;  3HWT A;  3Q8M A;  4Y2Y A;  1O08 A;  2K89 A;  2LPE A;  1T3N A;  2WB1 F;  4KX3 A;  3V6H A;  2IOF A;  2JH7 A;  5AM1 A;  1KFD A;  3H40 A;  3SQI A;  1ZQQ A;  4F91 B;  2BPF A;  4Y2V A;  2RLT A;  1SV0 C;  4RT3 A;  1COO A;  1FO4 A;  2HVI A;  3SV3 A;  2FMP A;  5KT5 A;  4P0P A;  4FO6 A;  9ICJ A;  5HHH A;  7ICM A;  2KVC A;  8ICX A;  3I28 A;  3BQ1 A;  3T5H A;  3QZ7 A;  1HEK A;  1V38 A;  1ZJM A;  4F5R A;  4C0Z A;  4P2H A;  5DB7 A;  1SKR A;  4PGQ A;  1ZQV A;  4XRH A;  2RDI A;  3ALR A;  1ZQL A;  3KKA C;  1KQQ A;  4RUA A;  4KN4 A;  1ZQK A;  2DBY A;  2K8B B;  5KT2 A;  1KRP A;  2KFZ A;  3PW7 A;  2PI4 A;  5J8Y A;  5T14 A;  2AH5 A;  1L7P A;  3TAD A;  1PVQ A;  1OXJ A;  5IIO A;  2PI5 A;  1Z00 B;  2WF7 A;  3Q8P B;  5H2F U;  9ICM A;  2B21 A;  4Y2Q A;  1BNP A;  1Z1B A;  2KKP A;  4F5N A;  2PMZ F;  3QU7 A;  3U26 A;  1ZRN A;  4HYK A;  2OCE A;  5ALW A;  2O6K A;  4DL7 A;  2V4Q A;  3B0Y A;  1SZP A;  4O9M A;  3CNH A;  2ZUB A;  3Q8Q B;  4I27 A;  1L3S A;  2IHM A;  5KFS A;  1T7P A;  2FPM A;  3BZC A;  2ISO A;  5EOZ A;  4X5V A;  4GXK A;  3GZF A;  5GTH U;  2W9M A;  4J9R A;  4O3P A;  5ALL A;  5AI4 A;  4B9T A;  2K4H A;  4US8 A;  4QZB A;  2KIW A;  2ZIV A;  8ICO A;  3Q8K A;  4RQM A;  1RG6 A;  5BOL A;  2BCS A;  1U9L A;  2K8A A;  4F4W A;  2FJ6 A;  5J0Q A;  1GO3 F;  2AXT U;  1BGX T;  3N7R C;  3WKE A;  4BGD A;  2WTF A;  4DFK A;  1IG6 A;  9ICN A;  2I6X A;  2AGP A;  3MC1 A;  5D4B A;  8ICS A;  4UAW A;  5KFB A;  4RQ8 A;  1U48 A;  3WKB A;  3PR4 A;  1ZD5 A;  3ETL A;  5J0S A;  4NL9 A;  4DSL A;  4QNL A;  2LYB A;  5J2B A;  2OYY A;  2YB4 A;  2FLN A;  5HNK A;  2WF5 A;  2YML A;  3HPO A;  2YMQ A;  3WK8 A;  3K1Z A;  5ALZ A;  4UAV A;  2IA6 A;  4Z6F A;  2E8N A;  4UB2 A;  3TAR A;  1F0M A;  2QAR B;  4IRC A;  2FPL A;  4C4R A;  1L8L A;  1ZQG A;  3MAB A;  5ALM A;  2HMX A;  5J2H A;  3DEE A;  3TAQ A;  3QYP A;  2JRZ A;  1X9X A;  5EE3 A;  1Q3U A;  3SZ2 A;  3UXO A;  3QE9 Y;  5J2E A;  4WJ3 B;  2P6U A;  2HHQ A;  3BJY A;  1L7M A;  5DG8 A;  2YY6 A;  4C8K A;  4XA5 A;  1NZP A;  5KG2 A;  1F5S A;  5AIB A;  2V4R A;  2Y1I A;  1N2X A;  4DLG A;  1PVR A;  1KN5 A;  4IQV A;  3SAG A;  8ICL A;  1N63 A;  2H3V A;  5AM3 A;  1K5O A;  2H3F A;  2JV3 A;  4J9M A;  4K4G A;  3C28 A;  1YZ7 A;  4A8E A;  3PX0 A;  1U49 A;  3T5L A;  5ALG A;  3EPI A;  3RFA A;  1A76 A;  5KFL A;  2BQR A;  3RJK A;  2A3V A;  7ICS A;  2NRW A;  2K4P A;  3RTV A;  3D2N A;  4F93 B;  5CR0 A;  4IQT A;  3SEN A;  3DV9 A;  4KLL A;  2I1Q A;  2XVT A;  4P4M A;  2JGA A;  4QWD A;  3L3F X;  4DL3 A;  3NRW A;  3TKA A;  3M9O B;  3EWA A;  2FMS A;  5CP2 A;  2HOI A;  2W9A A;  2LKY A;  1S5L U;  3MFI A;  3KFU F;  1ZQM A;  1BPE A;  1IV8 A;  1ZQR A;  1B0X A;  3HRD D;  1MQ2 A;  1ARO P;  1ZQD A;  3MGV A;  3PO4 A;  4UAR A;  5J2I A;  4MEX A;  4UAT A;  4Y2J A;  1O03 A;  2R8I A;  3LWM A;  4CE6 A;  4I2A A;  2BCQ A;  5AM5 A;  4RQ7 A;  3C1Y A;  5ALR A;  5KFO A;  2QAR A;  3PW0 A;  1ZOL A;  3SR6 A;  3GII A;  5AK5 A;  2D6F C;  5J0O A;  4RNM A;  5IIL A;  2DPJ A;  7ICI A;  3PSF A;  1K1S A;  2ZIW A;  4TUP A;  3WK9 A;  3V6K A;  4KLG A;  1QQ6 A;  3H8J A;  2GWS A;  2VJ4 A;  1RYR A;  3RAQ A;  4UBB A;  3CW2 C;  1Z4O A;  4CF5 A;  3KD3 A;  3C2L A;  3QU2 A;  2KJ5 A;  4DFP A;  1SV4 A;  4DL6 A;  7ICG A;  5J0R A;  4BWJ A;  2XO7 A;  2BCU A;  2CPR A;  3KBB A;  5K4L A;  1PVP A;  4DF8 A;  1JIH A;  4QWC A;  3F2C A;  1M6Y A;  4IR9 A;  1NJY A;  2K60 A;  5AKI A;  2BPG A;  1D9F A;  1DRG A;  4UAS A;  5L1L A;  1VLB A;  1XWL A;  1X2I A;  4GXJ A;  5DGA A;  4NM1 A;  5KFN A;  3L5K A;  5D49 A;  4YP3 A;  2UVR A;  4DOC A;  2EZZ A;  1ZXI A;  4DSF A;  3RJH A;  4M9L A;  2FE9 A;  1XNS A;  1TVA A;  5KFI A;  3OJS A;  4B9V A;  1S8O A;  3HX0 A;  2B0C A;  2JZB B;  4IS7 A;  4ECV A;  1DK2 A;  4NV0 A;  1KLN A;  2H3Q A;  2OH2 A;  2EAM A;  3ZDC A;  1ZD2 P;  2RHF A;  3QX7 A;  4F5P A;  3BDP A;  5IIM A;  2BZF A;  1X9M A;  3T79 A;  3TQ1 A;  3M8R A;  2MUT B;  2F77 X;  2BPC A;  2W9B A;  1JUD A;  3AMZ A;  4ECT A;  4O3M A;  1BPB A;  4UB3 A;  3T5J A;  1ZQI A;  2W8K A;  4QZ8 A;  4O3N A;  3BQ0 A;  4RU9 A;  3ICX A;  1A0P A;  1D8B A;  4IQW A;  4MFA A;  4O3Q A;  3M1Y A;  1XO1 A;  1NK8 A;  3MFH A;  3JPQ A;  2W7P A;  3PSP A;  3RF9 A;  1DGS A;  2LM4 A;  4ZH4 A;  1K1Q A;  4RQ5 A;  2JH1 A;  1XSL A;  4O5K A;  2IOH A;  5JU5 A;  3FC4 A;  3F2B A;  2A19 A;  4F2S A;  2QLT A;  1FFV A;  4R65 A;  8ICW A;  4Y2U A;  4DOA A;  3FDS A;  2F8K A;  5AM4 A;  4RQ1 A;  3RJG A;  4EX6 A;  2YN4 A;  2UVW A;  2W55 A;  4YVZ A;  1A77 A;  4KLQ A;  3NVY A;  2FDR A;  2MSN A;  3V72 A;  1WCL A;  4UAY A;  1PK1 B;  2VJ5 A;  1PK3 A;  2KE7 A;  2EAN A;  3ZDD A;  4DFM A;  8ICE A;  3LK9 A;  5EE0 A;  2QB0 A;  9ICF A;  1KTQ A;  1KL9 A;  3LDA A;  1ZQJ A;  3H4D A;  2K8C B;  4IC9 A;  3NVZ A;  4EBE A;  4O5C A;  4ECQ A;  4PL1 A;  8ICQ A;  3Q8S B;  1HJP A;  1OUQ A;  2ZIX A;  3F2D A;  4YMN A;  1NJW A;  4ED2 A;  4JK1 A;  2W03 A;  4O3S A;  5F3X B;  5B5E U;  4KLS A;  8ICY A;  1RQL A;  4R8U A;  3GIK A;  1SKW A;  3TAC B;  4XQ8 A;  2RQ5 A;  3SEI A;  5HP4 A;  2HHT A;  2BQU A;  5J2K A;  2GOL A;  3QUT A;  1ZQP A;  3SYZ A;  4JV0 A;  2AQ0 A;  4QZG A;  2DFL A;  3Q8R B;  3GIJ A;  2ZTC A;  3BS5 B;  2Y9U A;  2DPI A;  9ICH A;  4MHV A;  2CRX A;  3E2E A;  2C22 A;  5CA7 A;  2E5S A;  4IR1 A;  4KN7 A;  2P35 A;  3Q8L A;  4KLE A;  2R8J A;  3IG8 A;  2KVS A;  1NK4 A;  4BUG A;  2ZJ8 A;  5TIS U;  2ZTD A;  1NKE A;  5KG0 A;  3HJE A;  3ISD A;  4DFD A;  3KTQ A;  4TUR A;  2Y0S C;  3V6J A;  2ZIW B;  4FBT A;  1SL0 A;  1PZN A;  2RRD A;  3UQ2 A;  1Z3E B;  5KNI A;  3H8S A;  2IMW P;  1ZQS A;  5AKK A;  4M9G A;  2EDU A;  2Y1J A;  5F9L A;  1QQ7 A;  3CYM A;  2LYA A;  1C7Y A;  2ZIU B;  1SGG A;  3ONN A;  3GQC A;  1WCN A;  3IDW A;  3MBY A;  3PW5 A;  3WK4 A;  5B66 U;  1IM4 A;  4R64 A;  3RR8 A;  5DBB A;  4KX5 A;  2HOQ A;  2KZM A;  2KEY A;  2KMD A;  4NLB A;  3OTQ A;  2P6R A;  1T3Q A;  2F1J A;  4CDG A;  1UT8 A;  2F2A B;  3QUQ A;  8ICB A;  5DB8 A;  2XIC A;  4J9S A;  3NAS A;  3THV A;  7ICR A;  2KD1 A;  2WF9 A;  9ICW A;  4B9L A;  4BDP A;  3WKA A;  2EZX A;  2ZG6 A;  5ALH A;  1AQ6 A;  2F3N A;  4QZF A;  2BCR A;  3EPG A;  1DK3 A;  2XI9 A;  7ICP A;  2DGZ A;  1FIQ A;  4YMM A;  3QU9 A;  4BXO B;  5C0Y A;  4UB8 U;  5HML A;  1IIP A;  3RH4 A;  4UB5 A;  3C5F A;  3IG5 A;  3C5G A;  3PZP A;  3RB6 A;  1LV5 A;  5AK6 A;  3JPR A;  3GV5 B;  4DEZ A;  4ECZ A;  3H4B A;  2MA1 A;  1TFR A;  2M0N A;  1UHU A;  4HAI A;  4KLH A;  3QXG A;  3C29 A;  4B9M A;  4G3I A;  1Z1V A;  1X42 A;  2J6U A;  1ZQY A;  2AJQ A;  2ATL A;  1DOQ A;  2OWO A;  5CWR A;  4YD1 A;  1Q46 A;  1URJ A;  5CRX A;  1NI3 A;  1ZQC A;  1L3U A;  1D9D A;  3D6J A;  5KFA A;  4TQR A;  2C28 A; 
#chains in the Genus database with same CATH homology
 2KE7 A;  2EAN A;  2EAP A;  1SXD A;  1V38 A;  5KNI A;  3BS5 A;  1SXE A;  3HIL A;  4PZN A;  4IS7 A;  4NJ8 A;  2KIV A;  4NL9 A;  2QB0 A;  1JI7 A;  2GLE A;  2EAM A;  3KKA C;  1B0X A;  1SGG A;  3K1R B;  3IDW A;  1KW4 A;  4PZO A;  2ESE A;  2E8M A;  2DKZ A;  2E8N A;  5J8Y A;  1F0M A;  2QAR B;  2QB0 B;  3TAD A;  2D3D A;  2KMD A;  1WWV A;  1X66 A;  1OXJ A;  5F3X B;  2QAR A;  1V85 A;  3TAC B;  2DKX A;  3SEI A;  1UQV A;  4NL9 C;  1X9X A;  2D8C A;  2EAO A;  2KSO A;  2F3N A;  1LKY B;  2QB1 A;  1WWU A;  4RQN A;  1UCV A;  2YTU A;  3H8M A;  3BS5 B;  2Y9U A;  1SV0 A;  2B6G A;  1SV4 A;  2ES6 A;  3TAD C;  2QKQ A;  4MHV A;  5J8Y C;  5JU5 A;  1COK A;  3BS7 A;  2DL0 A;  2Y9T A;  2JV3 A;  5JRT A;  2F8K A;  2LMR A;  2LPE A;  2K60 A;  5L1M A;  1OW5 A;  2F44 A;  3KKA A;  4RQM A;  1Z1V A;  2E8P A;  1RG6 A;  3BQ7 A;  1X40 A;  1SV0 C;  1PK1 A;  2K4P A;  2L5Y A;  1B4F A;  2KSO B;  2E8O A;  2KG5 A;  1DXS A;  3SEN A;  1PK1 B;  1PK3 A;  5JTI A;  2FE9 A;  1LKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...