2DL0A

Solution structure of the sam-domain of the sam and sh3 domain containing protein 1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
GSSGSSGGGLTEICRKPVSPGCISSVSDWLISIGLPMYAGTLSTAGFSTLSQVPSLSHTCLQEAGITEERHIRKLLSAARLFKLPPGPEAMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SAM-domain of the SAM and SH3 domain containing protein 1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SAM and SH3 domain-containing protein 1
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2dl0A01
4NL9A 2E8MA 3BS7A 1V38A 1LKYB 5JU5A 3BS5A 2D3DA 3TADC 2E8OA 1SXEA 1WWVA 5J8YA 2F44A 2KSOB 1PK3A 2LPEA 3TADA 2F3NA 5J8YC 4RQMA 3H8MA 1X9XA 1PK1A 2D8CA 2KE7A 4NJ8A 3K1RB 2GLEA 2KIVA 2Y9TA 2QB0A 5JRTA 2E8PA 4RQNA 1SGGA 2JV3A 1OXJA 5JTIA 1JI7A 4MHVA 1B0XA 2ESEA 1UCVA 1SXDA 2LMRA 2L5YA 2K4PA 2KG5A 3SEIA 1UQVA 4PZNA 2EAMA 1B4FA 5L1MA 4NL9C 3KKAC 2QARA 2QB1A 3KKAA 4IS7A 1F0MA 1X40A 3IDWA 1LKYA 1COKA 2DKZA 2KMDA 1RG6A 2DKXA 1V85A 1WWUA 2FE9A 3BQ7A 2ES6A 2EAPA 2QARB 1OW5A 1PK1B 3HILA 2EAOA 2YTUA 5KNIA 2QB0B 2K60A 1SV4A 2EANA 1SV0A 2KSOA 1Z1VA 1KW4A 4PZOA 1X66A 2F8KA 1SV0C 5F3XB 2QKQA 2B6GA 3TACB 2E8NA 3BS5B 1DXSA 2DL0A 3SENA 2Y9UA
chains in the Genus database with same CATH superfamily
3GFKB 2ZIUB 4F4XA 2IOHA 1VDVA 2D3DA 1N5XA 5GTIU 4G9BA 1L3TA 1VLBA 5J8YC 1PUZA 3KFUF 4UB3A 4UW9A 5BOMA 4QWAA 4NLCA 4YMOA 9ICHA 2NRZA 4RNMA 4B9LA 3C23A 5AKEA 5ALTA 1U45A 1RQNA 1KFTA 2I1QA 2VKQA 1A6SA 1MSWD 4ED3A 3N7RC 1UQVA 1NK9A 4EX6A 2OYYA 3KKAC 4NM1A 2W9CB 4WJ3B 3QE9Y 4IS7A 4DF4A 3QZ7A 2BQRA 4MFAA 2RDJA 3GV8B 2J6TA 4DL5A 4DO9A 2RHFA 4ED0A 3HILA 4CF3A 2G06A 3MFHA 4KTQA 3OTQA 3QYPA 3KOOA 2BDPA 2I5HA 1O08A 2K60A 2LYHA 4JV2A 1JROA 3Q8MA 1N2XA 4Q43A 4I27A 4QZFA 4QZIA 3RB0A 2Z7JA 3DV9A 3H8WA 1ZRMA 1SV0A 2XICA 5HMMA 1URJA 1SL0A 9ICMA 2E5SA 8ICAA 5DG8A 4PGYA 2PI4A 2JGAA 5KG2A 5J0WA 4O3OA 1DXSA 3JPOA 2DL0A 2KJ9A 2FDRA 4RQ5A 1L3SA 3SENA 5ALWA 1JXLA 3I76A 4ED2A 4IL6U 4PHAA 5DGBA 2BGWA 1QSYA 1NK8A 5KG3A 3JPRA 3FAHA 5J0YA 5J8YA 2F44A 4YD2A 4F50A 5ALRA 4R8UB 3F2DA 2XIDA 7ICOA 1XU4A 5F9LA 3L3FX 1NK6A 3L5KA 4ED8A 2KJ8A 2KICA 4KMUA 3A0HU 5JRTA 4RQNA 3HJEA 2W11A 2A19A 3JPPA 3N97B 3HW8A 4DSIA 3C1ZA 4M6WB 1QSLA 5J0OA 3TARA 2OH2A 5J2JA 4K4HA 4NL9C 4J9QA 4KLOA 1SKWA 2A1JB 4J9MA 3Q8LA 1S8OA 2ZIWB 1NJYA 4Y2SA 4Y2XA 3F5EA 4QNLA 5HMLA 4C80A 1XO0A 4F4YA 1NNLA 2ZXHA 3QZ8A 5KFBA 2WF6A 4DFDA 5KFKA 5KT2A 1B43A 4EELA 3QUTA 1S5LU 2EZZA 2LBOA 4FBUA 2QB0B 2NYVA 8ICVA 5ALNA 3Q8PB 2BCQA 3T79A 3NVZA 2ZTDA 4M6WA 8ICJA 5F3XB 8ICNA 2QKQA 3PMLA 1UHUA 5AM3A 9ICIA 4FS1A 3MBYA 2AQ4A 3MGHA 1KFDA 4KITB 4B9VA 5J0PA 2K8CB 1F0MA 4RZRA 1ZQPA 2OM6A 1ZD3A 4EEKA 3PX0A 3BS5A 3N28A 4I2IA 4O3SA 1ZQYA 3EWAA 5TZVA 1N63A 3KZIU 2RP5A 4IQTA 2G5IB 4AYBC 2ZXIA 8ICOA 4RNNA 4Q44A 4MHVA 3UMGA 2C22A 4C4RA 1BVSA 4KLLA 4JMUA 2BQ3A 5AKZA 2EDUA 5KFUA 8ICKA 7ICSA 2UVRA 2W43A 3H7IA 4RQ4A 3GQCA 5AKKA 5ALPA 4ZOHC 2RRDA 4Z6FA 1L7PA 4UAWA 2BDUA 3WU2U 4QZ8A 2GOLA 3K75D 2WFAA 3JPSA 2KVCA 2W8LA 3MGVA 5IIKA 8ICCA 4QZBA 1Z4OA 5AKJA 4DSLA 5KNIA 3V7KA 5KG7A 5B5EU 5L1KA 4CE6A 1MQ2A 3NASA 4UQGA 4K4IA 2MUTA 4I2DA 2BPGA 1X2IA 3MDCA 2F77X 4YP3A 2FLNA 1X66A 4RUCA 4NLNA 1DGJA 4YD1A 4KLHA 3NUQA 3RBEA 8ICPA 2LM4A 2OEHA 4NXZA 2HBKA 2K89A 4GC7A 2M0NA 4RQ6A 2IBKA 2PFQA 3ZDCA 4F4ZA 2FMSA 3HX0A 5ALMA 1V9PA 4ED7A 5AI9A 3NVWA 3ED5A 4BX9C 4F5RA 1KEJA 1XSPA 3SAGA 4DSEA 1WWVA 4JWMA 5KL8B 4UAVA 2F3NA 4KN4A 3LWMA 3NS1A 2FPMA 5CA7A 3K1ZA 1PK1A 4P0QB 1WUDA 4PL1A 3RB3A 5IIJA 4ELUA 4YXMA 7ICFA 5AICA 1SGGA 4OJPA 4QWBA 3NRWA 2R18A 4F4WA 1D9DA 1SZHA 1Y88A 4RQ7A 3KHHA 3C2LA 4FBTA 4GLXA 1N56A 5C5JA 3AQEA 4JB3A 3PSIA 4Y2JA 1JX4A 2KJ5A 1S0NA 1TAUA 4PGQA 4NLZA 7ICTA 2EQYA 4F5QA 9ICOA 5KT7A 4R63A 1S10A 5CR0A 1ZQLA 1ZJNA 5EE1A 4QWEA 5DBAA 1L6NA 1ZQAA 1PK1B 1D9FA 1JALA 4X5VA 4DF8A 1ZQNA 2BPFA 1DK2A 3PR4A 4BWJA 5IINA 1JUDA 3TKAA 5T14A 3S6JA 5B66U 1L3VA 1XSNA 5AKLA 3TFSA 2HHVA 1KSPA 5KFAA 3SV3A 3TACB 2DF4B 5EE0A 3V6HA 4CGZA 1A76A 4TUQA 1YZ7A 2KIWA 4UB2A 3T5KA 4UAZA 2XVTA 5D4BA 1TK0A 3RH5A 3T5HA 4F4KA 5HR7A 3G6YA 4O5KA 1XSLA 1TV9A 4I2JA 2KOBA 4GXJA 3BS7A 3GDXA 3ZDDA 5KG1A 3GIJA 3OPXA 3RFAA 1PVQA 3FYHA 3V7JA 5AIAA 4IQWA 2H3ZA 3PSTA 2R8HA 4JV1A 2VA3A 3F5AA 3PR5B 2YMQA 5KFYA 4MFCA 2QB0A 4OD0A 1T8EA 2YMMA 3GIMA 2ISOA 4QZ9A 3BQ2A 3QUBA 2KG5A 3SEIA 5KFLA 2YMPA 4QZEA 2KFNA 4MEYA 1KTQA 5C0YA 2QB1A 4TUPA 9ICFA 1DK3A 2ZIXB 5KFXA 3BDPA 1FFUA 2BPCA 1T7PA 4F93B 2KV2A 3ZD8A 3TAPA 5AI5A 1S76D 2WF5A 5KL1B 4Q8EA 2K8AA 5DKWA 4J9OA 4I2CA 3PV8A 2H3IA 1NKEA 1SV4A 5DQIA 4PPXA 3IHQB 1BNPA 1SB3C 2EANA 2IA6A 4DL4A 1KW4A 4PZOA 4C7ZA 2CPRA 3QEBZ 1KLNA 7ICGA 4ECRA 1T3NA 1ZQMA 3RH4A 4EEYA 2F1JA 2Y1JA 1ZQKA 4O3QA 4KLFA 2ASDA 3MR6A 3ORYA 4YG2A 8ICIA 2PFOA 5KFJA 1DOQA 1JN3A 3PO4A 5DB8A 1ZETA 9ICKA 5JU5A 1ZYQA 5KT4A 1ZQDA 7ICLA 2ZJ8A 4UB4A 5ALQA 1NJWA 4XRHA 2OCEA 2AXTU 5KFPA 2ZIVB 2KSOB 4KLIA 4DSKA 3NVVA 4Z6CA 1UA0A 4Y2RA 1J2NA 3AEVA 2FMPA 3QUQA 5AKGA 4F5NA 3B0YA 2XGQA 4ECYA 1ED1A 4I2BA 4BDPA 2XCAA 3MR3A 3SAFA 1B0XA 3EUB2 5AKXA 2XY6A 3ETLA 3OJSA 2KZMA 3SR6A 1JIHA 4Y2PA 1B4FA 5L1MA 1KRPA 3PNCA 4JV0A 7ICPA 2HHSA 4O9MA 2V4RA 2KEYA 2DFLA 1ZQXA 3RRHA 2ZTEA 5J2CA 5ALUA 1LKYA 2BCVA 8ICLA 2C28A 4DQIA 3SAHA 3F53A 1T94A 3C2MA 1KL9A 4DL7A 2XCPA 9ICCA 5ALEA 4F72A 9ICJA 2JRZA 2H3FA 3OHAA 4YCXA 4RQ0A 1HUOA 7ICKA 4DS4A 3AU6A 2DUYA 3UPQA 2DPIA 3RH6A 3ZI4A 3FM9A 3A0BU 5ALLA 5D46A 3PX6A 2GWSA 4F71A 1NOMA 1SWWA 9ICEA 1HEKA 4C4SA 5ALHA 2HHWA 9ICRA 4G3IA 2NO5A 1SL2A 2K4IA 4BXOA 4P4OA 1TK5A 1OUQA 2NRXA 1U48A 1QTMA 2Y9UA 3BJYA 5KG6A 4BJQA 5AK6A 3SD7A 7ICMA 2K8BB 8ICGA 2JEJA 4IR1A 4DLEA 5J0UA 5DB6A 1BPZA 3VC8A 2E8OA 2XY5A 3WK7A 1AROP 1KFSA 2FJ6A 4DSJA 3H8MA 3E0FA 4RT2A 3M6KA 1DGSA 2Y9TA 2VJ5A 5AM0A 5KFEA 2HI0A 4FZLA 4R64A 2YY6A 3M8SA 1ZQ1C 1RYSA 2JV3A 3B9JA 5HHIA 4J9KA 1F44A 1JI7A 2PI5A 2VIXA 3CNHA 3BQ1A 4IC9A 4Q45A 4M47A 3UQ2A 5KFTA 3RJFA 1Z1BA 3ZD9A 4TQRA 2FMQA 1WYGA 5KT5A 3TAQA 4DCCA 2V9WA 1IM4A 5AIBA 5ALYA 2KMDA 1L3UA 4DFMA 2FE9A 4EYHB 3M9NB 3AM9A 3QU2A 5IIIA 1ZQFA 1ZQUA 2PFNA 4P0PA 4OJLA 4Y2YA 4DOAA 3EYZA 4M2YA 4PHDA 5ALDA 1ZQBA 4M9JA 2KKVA 2W04A 4JWNA 3Q8KA 1L7NA 1JXEA 4XUSA 1ZQOA 2XI9A 4P0QA 4QZHA 3T3FA 2AGPA 1BGXT 9ICSA 1UA1A 2HSZA 4YR2A 1L5UA 5TISU 1X9WA 2XO7A 2E8MA 5DQHA 3SI8A 2ATLA 3JPQA 5HP4A 2EZYA 2ZIVA 1PZNA 3TI0A 4JUZA 4TUSA 1SXEA 4QWDA 4F3OA 4U6PA 1ZQSA 4ELTA 1ZQGA 2K4EA 4IR9A 5AI8A 2JEFA 2D8CA 1LVHA 5KG0A 4NLBA 2N1RA 4FFDA 1ZQIA 1XWLA 2ASLA 3M9OB 5BPCA 4PJ0U 3M7DA 2Q0ZX 4Y2TA 4LJXA 4NV0A 4F5PA 5ALGA 5ALVA 2HBMA 2LMRA 4EBDA 4PZNA 2W3SA 3MR2A 4ECUA 7ICHA 2W9BA 4I2FA 5KFOA 5J2FA 4UBBA 1SWVA 1K5OA 1ZQWA 4XA5A 4B6JA 4ZH4A 2BQUA 1T4GA 2HW3A 9ICWA 4AP9A 2WB1C 1RG6A 3KD3A 2LI6A 2ISPA 4KLMA 1D8BA 2QLTA 5EE3A 2ES6A 2EAPA 3WK4A 3H0RB 5KTQA 5JUMA 7ICRA 4M9LA 2E1EA 4DWIA 3M8RA 4Z6EA 2Q4TA 2WB1F 3EZ5A 5G5GA 4RU9A 4CCHA 1GO3F 4Z6DA 2W9AA 2E3TA 2W54A 5AI6A 2FLLA 1FIQA 3H40A 4IRDA 2HDOA 3WKBA 1ZXIA 5AM2A 1NK7A 3ZDBA 3C28A 3G6XA 9ICAA 1SIJA 5AKHA 2PMZF 3ZDEA 4KX5A 4ICAA 3MABA 4RQ8A 5KFDA 1IG6A 4DFKA 4C8MA 8ICQA 3PSPA 2ZIXA 2IHMA 4I29A 3GILA 2JH7A 4EX7A 5EWFA 2KZZA 4J9SA 5KT6A 8ICWA 4DOCA 1MC8A 5J2BA 1RM6C 2GH1A 2VA8A 1M6YA 4NJ8A 4QZDA 5AM1A 2MAXA 3RB6A 3AMZA 4RUAA 3RR7A 2HHUA 3RB4A 2W7OA 4A8EA 2BR0A 4P4PA 1UCVA 3H0LB 2JZBB 3KTQA 2K4PA 2W03A 3UXNA 3HP6A 1K1QA 2JMGA 3F2CA 3WKDA 1D8LA 4I2AA 2F1IA 1N5WA 4U7CA 2KN7A 1RYUA 2V4QA 3GU3A 2W55A 1X9SA 1ZQHA 4TQSA 4QW9A 1Z19A 4QIWF 4DS5A 2JHDA 3RJEA 1QLNA 2BCUA 5AI0A 4QZAA 2KFZA 2KVSA 3HT3A 4EZ9A 4IQUA 3MC1A 2WF7A 1ZQZA 1S0OA 1BPEA 3KHGA 1N62A 3RR8A 4DL6A 2FI1A 9ICNA 1DRGA 2DBYA 3MFIA 5ALZA 2KK0A 5J2KA 4UB1A 7ICEA 4YMMA 1Z00B 3Q8SB 4B9NA 4QZCA 5L9XA 2W9CA 2W3RA 2JEGA 8ICTA 5J2HA 1QQ5A 4ECZA 1LKYB 2KHVA 2NRWA 4PHEA 1HIWA 7ICJA 1IIPA 1ZRNA 4M04A 2ZJ5A 4DEZA 1SKSA 9ICGA 2UVVA 5D49A 3GIIA 5DG7A 1L8LA 2DGZA 3PW7A 4Y2VA 3K1RB 5KFIA 5J0TA 5J2GA 4NWIA 4R8UA 2WAQF 3N4MB 3RTVA 2HBLA 5KFCA 2VJ4A 3T5JA 3RJGA 2ESEA 3UM9A 3ZDAA 3WK8A 1FO4A 1KBUA 4F91B 4R65A 3RAQA 2HVHA 4RQ2A 4USAA 4YXJA 2NV3A 1KQQA 2JZBA 2KZ3A 4OJ5A 2P35A 1QQ6A 4DFPA 1L7MA 1COKA 3B0XA 4EYIB 1WWUA 4Q8FA 1TAMA 3RBDA 3PSFA 1UT5A 3FDSA 1RXWA 4C8KA 5A0LA 3C1YA 3EW9A 3AQFA 4NM2A 4QJFB 4F92B 3HRDD 1JRPA 4MF2A 2LYBA 5K4LA 1PVRA 1XS9D 2Y0SC 4P2HA 2C2RA 5EWGA 1UT8A 3GIKA 2F8KA 2H3QA 3QU4A 3KHRA 4NLGA 1ZJMA 1CEZA 2ALZA 3I1YA 1HUZA 3NRZA 2BCSA 4NLKA 1KN5A 4CF5A 1BPXA 1RQLA 2WTFA 4EZ6A 3QX7A 1KKXA 4ACOA 5J0XA 1NI3A 3WK5A 4CF4A 1XNSA 5CJ7A 5J2DA 7ICVA 4ECVA 8ICYA 5F9NA 5KFNA 5DBCA 4US8A 2YQEA 2VA2A 1TKDA 5CWRA 3QUCA 3RAXA 3AN1A 8ICBA 5J0RA 4DQRA 3KHLA 4ED6A 9ICXA 4MEXA 4I2EA 4KLSA 1KDHA 4DL3A 1ZQJA 1EXNA 3BZCA 2RQ5A 2K4HA 2F2AB 1L7OA 2B21A 5L1IA 2MU2A 2KKPA 4J9PA 3N7PD 2BHNA 2EH9A 3O0FA 1BPDA 2R8IA 1WCNA 4C8LA 5FP0A 2MRLA 2HCFA 4KLDA 2PMZC 4DQSA 3WK9A 2CN1A 5AK4A 5KFSA 1YZ6A 3PMNA 4Y2QA 1BPYA 1N61A 1VJ5A 2PKEA 1CUKA 2VANA 4RPYA 2WF9A 5DDMA 1LV5A 8ICHA 1ZD4A 4O5CA 4O5EA 2KSOA 2XGPA 2UVWA 5G5HA 5KG4A 2G07A 3E2EA 4J9RA 3RJJA 2ZIWA 3H8SA 4C4TA 3LK9A 2JXJA 1X6JA 8ICUA 3OHBA 1MN8A 1IV8A 1V38A 4ED1A 3CYMA 3TQ1A 1QH9A 3D2NA 3QXGA 2B0CA 1Q3UA 1YT3A 3C2KA 3L4PA 2LPEA 3TADA 4ECWA 2HBJA 4RQMA 4YFKA 1X9XA 2R8JA 5DDYA 3WKEA 2H5XA 1QQ7A 4EBCA 3SQIA 2Y0SF 4KLQA 1J97A 3M9MB 2IMWP 4O3RA 1X6IA 1SXDA 5KG5A 4KLGA 1RPLA 3KZXA 4B9SA 1Q3VA 4GC6A 4PGXA 4YQWA 1C20A 2KD1A 1T3QA 3V6JA 2AGOA 3KKAA 1X9MA 4DQQA 1HJPA 4J9LA 3BZKA 4M9HA 4LVSA 2DWQA 2ZG6A 4I28A 3ISBA 2XC9A 3OJUA 2HHQA 1NJZA 2AHOB 2YB1A 4UB5A 2EAOA 2RLTA 5J2IA 1A77A 4MF8A 4ELVA 4F8RA 4RNOA 2A3VA 3SZ2A 3IP4B 4GIBA 2HOFA 8ICFA 4XQ8A 4UAYA 3ALRA 5DGAA 4PHPA 5KAFU 3SMVA 7ICNA 2ODGA 1XC9A 3CP8A 2W8KA 4O3NA 4OCZA 1RYRA 3WK6A 1TFRA 2C2EA 3LDAA 4FE3A 3C5FA 3Q8QB 3H4DA 9ICBA 3JPTA 2ZUCA 1MQ3A 1NJXA 3AL0B 2GO7A 2OXOA 2F76X 3H0MB 1ZQEA 4CDGA 4YR3A 4F5OA 1FFVA 1U47A 3OGUA 2A1JA 2AH5A 3C5GA 3RJKA 1JMSA 2LM1A 1NZBA 3PY8A 5J2EA 4F2SA 4DQPA 2XY7A 3OSPA 2M9NA 4YR0A 2GLEA 2KIVA 3M6ZA 3NTUA 3QU5A 4CRXA 2E8PA 1B22A 1OXJA 5JTIA 1IXRA 3ISDA 4KLUA 5KFGA 5CP2A 3NGDA 5BOLA 3MGIA 2AJQA 2L5YA 2KTQA 3HKZC 4I2GA 2G5HB 3PW0A 2J6UA 2FPKA 4UASA 4LZGA 4CNQA 1N48A 2G09A 2C2DA 4C7YA 3EPGA 1ZQCA 2PXIA 4KX3A 5AM4A 3ETRA 4LZDA 5KFHA 3QNMA 2UVUA 3PW2A 4KMOB 3IV6A 5KFWA 3QU9A 1A0PA 4UARA 3UQ0A 9ICPA 3GZFA 2R8GA 2BCRA 2YTUA 4FZMA 1UPHA 5J0QA 1CI4A 3MDAA 4DSFA 3WKAA 2YN4A 5CB1A 1LB2B 1RZTA 1H38A 4O3MA 1ZD2P 8ICRA 2KHQA 3MR5A 4PL2A 4GXIA 5J0SA 4P4MA 1NK0A 1ZD5A 3QU7A 1MA7A 2MUTB 3AU2A 4EBEA 2P66A 3T5LA 1SL1A 1SV0C 1RXVA 8ICZA 1NKBA 2FLPA 5AKIA 2HHXA 1ZQRA 2D6FC 2ZTCA 2ZJAA 3LWLA 4F2RA 4M9GA 1FEZA 3UXPA 5DBBA 2DPJA 2ZUBA 4E0DA 1ZOLA 3V7LA 3HPOA 2HOQA 5ALJA 2ZIUA 5AK5A 5AK3A 4J03A 1XO1A 5KFVA 1NKCA 4HAIA 4RT3A 2MSNA 1Q46A 3AUOA 2Y1IA 2W9MA 3LVVA 1RDFA 4KLJA 5J2AA 3K4GA 5AHXA 3G6VA 2JH1A 2IHNA 3I28A 3CRXA 9ICLA 2WF8A 4FS2A 5CRXA 4BGDA 1C7YA 4HYKA 5ALFA 2W9BB 2EAMA 3SYZA 2NO4A 3F2BA 4P0PB 4QWCA 3ICXA 2FPLA 2YMLA 1F5SA 2ZUDA 4C8OA 1SKRA 1X40A 3TFRA 5IILA 4DL2A 2OHFA 5EOZA 3IDWA 1WCLA 3ONNA 3OSNA 3D2SA 8ICEA 2CRXA 1PVPA 4QW8A 2W7PA 9ICUA 4MFFA 3EPIA 4ECTA 3KBBA 4YN4A 3SV4A 1Z3EB 5AM5A 3PW4A 3LVWA 2HHTA 2O6KA 4B9MA 3RJIA 1P7DA 3DDHA 3VCBA 4O3PA 1TK8A 4GFJA 3PX4A 4M9NA 3PO5A 2LHTA 2WAQC 4JK1A 3Q8RB 4TURA 4I2HA 2PFPA 5DQGA 4O0IA 3WKCA 5AI4A 3BS5B 2F1HA 4RQ1A 3M1YA 3HKZF 2A1AA 2AQ0A 3IG8A 5DB7A 1D8YA 2I6XA 7ICIA 5KFMA 3GV7B 4UB8U 1V97A 2EZXA 4UBCA 4NL9A 3IG5A 2J6SA 1TVAA 7ICUA 4B9UA 2R8KA 2JEIA 3D6JA 2F8LA 5L1JA 2H3VA 1TAQA 4UB6U 5KFQA 3UMCA 3IM1A 1PK3A 2BKEA 4KN7A 2KP7A 2I9GA 5DLFA 1TE2A 2AU0A 2KE7A 1ZQQA 4PH5A 3GV5B 5H2FU 2LYAA 1NZPA 1Z00A 1K1SA 1BPBA 5DG9A 3IN5A 2NRTA 4RQ3A 4GXKA 4OJOA 1SZPA 5E79U 4UATA 3PZPA 2QARA 2MA1A 4ECXA 4ECSA 3QEAZ 5DB9A 3CW2C 2RDIA 2DKZA 2NRVA 4KLEA 7ICQA 2DKXA 1BNOA 1V85A 3PVXA 3BQ7A 4YMNA 3E58A 1AQ6A 2ASJA 3V6KA 5EE9A 5HR6A 5KFFA 3BQ0A 9ICTA 5KAIU 9ICVA 1NK4A 5ALSA 4KLTA 4R66A 1ECWA 2CXYA 5KFRA 3ISCA 3C29A 3V72A 4B9TA 8ICSA 2OWOA 2IOFK 3JPNA 1QCKA 2B6GA 1CRXA 5AKYA 4AYBF 1S97A 4QIWC 2G0AA 3RF9A 3HWTA 4EENA 3RRGA 2E1FA 2LKYA 4J9NA 1L8OA 4C0ZA 4M0AA 3J81j 2YB4A 9ICQA 1ZQVA 5DLGA 5L1LA 2HVIA 5J29A 4OJ6A 4BXOB 5ALKA 4IQVA 3D2QA 4RPZA 8ICXA 5ALIA 5HNKA 4YVZA 4Y2UA 5ALOA 5IIOA 3TADC 1COOA 1Z4NA 2HOIA 2P6RA 5KFZA 5CEHA 3C21A 1S0VA 1S0MA 4FZNA 5ALXA 3UMBA 2WHEA 4QZGA 3TANA 3U26A 2HMXA 4FO6A 5CHGA 4OO1J 4IRCA 2P6UA 2AGQA 1S9FA 4K4GA 4UAUA 1S77D 1X42A 4BWMA 3N7SC 4RPXA 5KT3A 4ECQA 4DFJA 3PW5A 1U9LA 1QSSA 4C8NA 2QARB 5GTHU 1O03A 1OW5A 1N60A 3BQTA 5EWEA 3IRUA 3H4BA 5IIMA 2G08A 4US9A 3LYSA 1J2MA 5HHHA 4NY8A 1Z1VA 1U4BA 2DQNB 1U49A 3FC4A 2E8NA 3UXOA 2KNJA 3THVA 1NK5A 4DLGA 1WG8A 4BUGA 3NVYA 3RJHA 1Q8KA 2YX8A 4IRKA 8ICMA 2IOFA 3H8JA 4DOBA 2BZFA 1ZQTA 3DEEA 2JR5A 3R9KA
chains in the Genus database with same CATH topology
4NL9A 2E8MA 3BS7A 1V38A 1LKYB 5JU5A 3BS5A 2D3DA 3TADC 2E8OA 1SXEA 1WWVA 5J8YA 2F44A 2KSOB 1PK3A 2LPEA 3TADA 2F3NA 5J8YC 4RQMA 3H8MA 1X9XA 1PK1A 2D8CA 2KE7A 4NJ8A 3K1RB 2GLEA 2KIVA 2Y9TA 2QB0A 5JRTA 2E8PA 4RQNA 1SGGA 2JV3A 1OXJA 5JTIA 1JI7A 4MHVA 1B0XA 2ESEA 1UCVA 1SXDA 2LMRA 2L5YA 2K4PA 2KG5A 3SEIA 1UQVA 4PZNA 2EAMA 1B4FA 5L1MA 4NL9C 3KKAC 2QARA 2QB1A 3KKAA 4IS7A 1F0MA 1X40A 3IDWA 1LKYA 1COKA 2DKZA 2KMDA 1RG6A 2DKXA 1V85A 1WWUA 2FE9A 3BQ7A 2ES6A 2EAPA 2QARB 1OW5A 1PK1B 3HILA 2EAOA 2YTUA 5KNIA 2QB0B 2K60A 1SV4A 2EANA 1SV0A 2KSOA 1Z1VA 1KW4A 4PZOA 1X66A 2F8KA 1SV0C 5F3XB 2QKQA 2B6GA 3TACB 2E8NA 3BS5B 1DXSA 2DL0A 3SENA 2Y9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL9 A;  2E8M A;  3BS7 A;  1V38 A;  1LKY B;  5JU5 A;  3BS5 A;  2D3D A;  3TAD C;  2E8O A;  1SXE A;  1WWV A;  5J8Y A;  2F44 A;  2KSO B;  1PK3 A;  2LPE A;  3TAD A;  2F3N A;  5J8Y C;  4RQM A;  3H8M A;  1X9X A;  1PK1 A;  2D8C A;  2KE7 A;  4NJ8 A;  3K1R B;  2GLE A;  2KIV A;  2Y9T A;  2QB0 A;  5JRT A;  2E8P A;  4RQN A;  1SGG A;  2JV3 A;  1OXJ A;  5JTI A;  1JI7 A;  4MHV A;  1B0X A;  2ESE A;  1UCV A;  1SXD A;  2LMR A;  2L5Y A;  2K4P A;  2KG5 A;  3SEI A;  1UQV A;  4PZN A;  2EAM A;  1B4F A;  5L1M A;  4NL9 C;  3KKA C;  2QAR A;  2QB1 A;  3KKA A;  4IS7 A;  1F0M A;  1X40 A;  3IDW A;  1LKY A;  1COK A;  2DKZ A;  2KMD A;  1RG6 A;  2DKX A;  1V85 A;  1WWU A;  2FE9 A;  3BQ7 A;  2ES6 A;  2EAP A;  2QAR B;  1OW5 A;  1PK1 B;  3HIL A;  2EAO A;  2YTU A;  5KNI A;  2QB0 B;  2K60 A;  1SV4 A;  2EAN A;  1SV0 A;  2KSO A;  1Z1V A;  1KW4 A;  4PZO A;  1X66 A;  2F8K A;  1SV0 C;  5F3X B;  2QKQ A;  2B6G A;  3TAC B;  2E8N A;  3BS5 B;  1DXS A;  2DL0 A;  3SEN A;  2Y9U A; 
#chains in the Genus database with same CATH topology
 3GFK B;  2ZIU B;  4F4X A;  2IOH A;  1VDV A;  2D3D A;  1N5X A;  5GTI U;  4G9B A;  1L3T A;  1VLB A;  5J8Y C;  1PUZ A;  3KFU F;  4UB3 A;  4UW9 A;  5BOM A;  4QWA A;  4NLC A;  4YMO A;  9ICH A;  2NRZ A;  4RNM A;  4B9L A;  3C23 A;  5AKE A;  5ALT A;  1U45 A;  1RQN A;  1KFT A;  2I1Q A;  2VKQ A;  1A6S A;  1MSW D;  4ED3 A;  3N7R C;  1UQV A;  1NK9 A;  4EX6 A;  2OYY A;  3KKA C;  4NM1 A;  2W9C B;  4WJ3 B;  3QE9 Y;  4IS7 A;  4DF4 A;  3QZ7 A;  2BQR A;  4MFA A;  2RDJ A;  3GV8 B;  2J6T A;  4DL5 A;  4DO9 A;  2RHF A;  4ED0 A;  3HIL A;  4CF3 A;  2G06 A;  3MFH A;  4KTQ A;  3OTQ A;  3QYP A;  3KOO A;  2BDP A;  2I5H A;  1O08 A;  2K60 A;  2LYH A;  4JV2 A;  1JRO A;  3Q8M A;  1N2X A;  4Q43 A;  4I27 A;  4QZF A;  4QZI A;  3RB0 A;  2Z7J A;  3DV9 A;  3H8W A;  1ZRM A;  1SV0 A;  2XIC A;  5HMM A;  1URJ A;  1SL0 A;  9ICM A;  2E5S A;  8ICA A;  5DG8 A;  4PGY A;  2PI4 A;  2JGA A;  5KG2 A;  5J0W A;  4O3O A;  1DXS A;  3JPO A;  2DL0 A;  2KJ9 A;  2FDR A;  4RQ5 A;  1L3S A;  3SEN A;  5ALW A;  1JXL A;  3I76 A;  4ED2 A;  4IL6 U;  4PHA A;  5DGB A;  2BGW A;  1QSY A;  1NK8 A;  5KG3 A;  3JPR A;  3FAH A;  5J0Y A;  5J8Y A;  2F44 A;  4YD2 A;  4F50 A;  5ALR A;  4R8U B;  3F2D A;  2XID A;  7ICO A;  1XU4 A;  5F9L A;  3L3F X;  1NK6 A;  3L5K A;  4ED8 A;  2KJ8 A;  2KIC A;  4KMU A;  3A0H U;  5JRT A;  4RQN A;  3HJE A;  2W11 A;  2A19 A;  3JPP A;  3N97 B;  3HW8 A;  4DSI A;  3C1Z A;  4M6W B;  1QSL A;  5J0O A;  3TAR A;  2OH2 A;  5J2J A;  4K4H A;  4NL9 C;  4J9Q A;  4KLO A;  1SKW A;  2A1J B;  4J9M A;  3Q8L A;  1S8O A;  2ZIW B;  1NJY A;  4Y2S A;  4Y2X A;  3F5E A;  4QNL A;  5HML A;  4C80 A;  1XO0 A;  4F4Y A;  1NNL A;  2ZXH A;  3QZ8 A;  5KFB A;  2WF6 A;  4DFD A;  5KFK A;  5KT2 A;  1B43 A;  4EEL A;  3QUT A;  1S5L U;  2EZZ A;  2LBO A;  4FBU A;  2QB0 B;  2NYV A;  8ICV A;  5ALN A;  3Q8P B;  2BCQ A;  3T79 A;  3NVZ A;  2ZTD A;  4M6W A;  8ICJ A;  5F3X B;  8ICN A;  2QKQ A;  3PML A;  1UHU A;  5AM3 A;  9ICI A;  4FS1 A;  3MBY A;  2AQ4 A;  3MGH A;  1KFD A;  4KIT B;  4B9V A;  5J0P A;  2K8C B;  1F0M A;  4RZR A;  1ZQP A;  2OM6 A;  1ZD3 A;  4EEK A;  3PX0 A;  3BS5 A;  3N28 A;  4I2I A;  4O3S A;  1ZQY A;  3EWA A;  5TZV A;  1N63 A;  3KZI U;  2RP5 A;  4IQT A;  2G5I B;  4AYB C;  2ZXI A;  8ICO A;  4RNN A;  4Q44 A;  4MHV A;  3UMG A;  2C22 A;  4C4R A;  1BVS A;  4KLL A;  4JMU A;  2BQ3 A;  5AKZ A;  2EDU A;  5KFU A;  8ICK A;  7ICS A;  2UVR A;  2W43 A;  3H7I A;  4RQ4 A;  3GQC A;  5AKK A;  5ALP A;  4ZOH C;  2RRD A;  4Z6F A;  1L7P A;  4UAW A;  2BDU A;  3WU2 U;  4QZ8 A;  2GOL A;  3K75 D;  2WFA A;  3JPS A;  2KVC A;  2W8L A;  3MGV A;  5IIK A;  8ICC A;  4QZB A;  1Z4O A;  5AKJ A;  4DSL A;  5KNI A;  3V7K A;  5KG7 A;  5B5E U;  5L1K A;  4CE6 A;  1MQ2 A;  3NAS A;  4UQG A;  4K4I A;  2MUT A;  4I2D A;  2BPG A;  1X2I A;  3MDC A;  2F77 X;  4YP3 A;  2FLN A;  1X66 A;  4RUC A;  4NLN A;  1DGJ A;  4YD1 A;  4KLH A;  3NUQ A;  3RBE A;  8ICP A;  2LM4 A;  2OEH A;  4NXZ A;  2HBK A;  2K89 A;  4GC7 A;  2M0N A;  4RQ6 A;  2IBK A;  2PFQ A;  3ZDC A;  4F4Z A;  2FMS A;  3HX0 A;  5ALM A;  1V9P A;  4ED7 A;  5AI9 A;  3NVW A;  3ED5 A;  4BX9 C;  4F5R A;  1KEJ A;  1XSP A;  3SAG A;  4DSE A;  1WWV A;  4JWM A;  5KL8 B;  4UAV A;  2F3N A;  4KN4 A;  3LWM A;  3NS1 A;  2FPM A;  5CA7 A;  3K1Z A;  1PK1 A;  4P0Q B;  1WUD A;  4PL1 A;  3RB3 A;  5IIJ A;  4ELU A;  4YXM A;  7ICF A;  5AIC A;  1SGG A;  4OJP A;  4QWB A;  3NRW A;  2R18 A;  4F4W A;  1D9D A;  1SZH A;  1Y88 A;  4RQ7 A;  3KHH A;  3C2L A;  4FBT A;  4GLX A;  1N56 A;  5C5J A;  3AQE A;  4JB3 A;  3PSI A;  4Y2J A;  1JX4 A;  2KJ5 A;  1S0N A;  1TAU A;  4PGQ A;  4NLZ A;  7ICT A;  2EQY A;  4F5Q A;  9ICO A;  5KT7 A;  4R63 A;  1S10 A;  5CR0 A;  1ZQL A;  1ZJN A;  5EE1 A;  4QWE A;  5DBA A;  1L6N A;  1ZQA A;  1PK1 B;  1D9F A;  1JAL A;  4X5V A;  4DF8 A;  1ZQN A;  2BPF A;  1DK2 A;  3PR4 A;  4BWJ A;  5IIN A;  1JUD A;  3TKA A;  5T14 A;  3S6J A;  5B66 U;  1L3V A;  1XSN A;  5AKL A;  3TFS A;  2HHV A;  1KSP A;  5KFA A;  3SV3 A;  3TAC B;  2DF4 B;  5EE0 A;  3V6H A;  4CGZ A;  1A76 A;  4TUQ A;  1YZ7 A;  2KIW A;  4UB2 A;  3T5K A;  4UAZ A;  2XVT A;  5D4B A;  1TK0 A;  3RH5 A;  3T5H A;  4F4K A;  5HR7 A;  3G6Y A;  4O5K A;  1XSL A;  1TV9 A;  4I2J A;  2KOB A;  4GXJ A;  3BS7 A;  3GDX A;  3ZDD A;  5KG1 A;  3GIJ A;  3OPX A;  3RFA A;  1PVQ A;  3FYH A;  3V7J A;  5AIA A;  4IQW A;  2H3Z A;  3PST A;  2R8H A;  4JV1 A;  2VA3 A;  3F5A A;  3PR5 B;  2YMQ A;  5KFY A;  4MFC A;  2QB0 A;  4OD0 A;  1T8E A;  2YMM A;  3GIM A;  2ISO A;  4QZ9 A;  3BQ2 A;  3QUB A;  2KG5 A;  3SEI A;  5KFL A;  2YMP A;  4QZE A;  2KFN A;  4MEY A;  1KTQ A;  5C0Y A;  2QB1 A;  4TUP A;  9ICF A;  1DK3 A;  2ZIX B;  5KFX A;  3BDP A;  1FFU A;  2BPC A;  1T7P A;  4F93 B;  2KV2 A;  3ZD8 A;  3TAP A;  5AI5 A;  1S76 D;  2WF5 A;  5KL1 B;  4Q8E A;  2K8A A;  5DKW A;  4J9O A;  4I2C A;  3PV8 A;  2H3I A;  1NKE A;  1SV4 A;  5DQI A;  4PPX A;  3IHQ B;  1BNP A;  1SB3 C;  2EAN A;  2IA6 A;  4DL4 A;  1KW4 A;  4PZO A;  4C7Z A;  2CPR A;  3QEB Z;  1KLN A;  7ICG A;  4ECR A;  1T3N A;  1ZQM A;  3RH4 A;  4EEY A;  2F1J A;  2Y1J A;  1ZQK A;  4O3Q A;  4KLF A;  2ASD A;  3MR6 A;  3ORY A;  4YG2 A;  8ICI A;  2PFO A;  5KFJ A;  1DOQ A;  1JN3 A;  3PO4 A;  5DB8 A;  1ZET A;  9ICK A;  5JU5 A;  1ZYQ A;  5KT4 A;  1ZQD A;  7ICL A;  2ZJ8 A;  4UB4 A;  5ALQ A;  1NJW A;  4XRH A;  2OCE A;  2AXT U;  5KFP A;  2ZIV B;  2KSO B;  4KLI A;  4DSK A;  3NVV A;  4Z6C A;  1UA0 A;  4Y2R A;  1J2N A;  3AEV A;  2FMP A;  3QUQ A;  5AKG A;  4F5N A;  3B0Y A;  2XGQ A;  4ECY A;  1ED1 A;  4I2B A;  4BDP A;  2XCA A;  3MR3 A;  3SAF A;  1B0X A;  3EUB 2;  5AKX A;  2XY6 A;  3ETL A;  3OJS A;  2KZM A;  3SR6 A;  1JIH A;  4Y2P A;  1B4F A;  5L1M A;  1KRP A;  3PNC A;  4JV0 A;  7ICP A;  2HHS A;  4O9M A;  2V4R A;  2KEY A;  2DFL A;  1ZQX A;  3RRH A;  2ZTE A;  5J2C A;  5ALU A;  1LKY A;  2BCV A;  8ICL A;  2C28 A;  4DQI A;  3SAH A;  3F53 A;  1T94 A;  3C2M A;  1KL9 A;  4DL7 A;  2XCP A;  9ICC A;  5ALE A;  4F72 A;  9ICJ A;  2JRZ A;  2H3F A;  3OHA A;  4YCX A;  4RQ0 A;  1HUO A;  7ICK A;  4DS4 A;  3AU6 A;  2DUY A;  3UPQ A;  2DPI A;  3RH6 A;  3ZI4 A;  3FM9 A;  3A0B U;  5ALL A;  5D46 A;  3PX6 A;  2GWS A;  4F71 A;  1NOM A;  1SWW A;  9ICE A;  1HEK A;  4C4S A;  5ALH A;  2HHW A;  9ICR A;  4G3I A;  2NO5 A;  1SL2 A;  2K4I A;  4BXO A;  4P4O A;  1TK5 A;  1OUQ A;  2NRX A;  1U48 A;  1QTM A;  2Y9U A;  3BJY A;  5KG6 A;  4BJQ A;  5AK6 A;  3SD7 A;  7ICM A;  2K8B B;  8ICG A;  2JEJ A;  4IR1 A;  4DLE A;  5J0U A;  5DB6 A;  1BPZ A;  3VC8 A;  2E8O A;  2XY5 A;  3WK7 A;  1ARO P;  1KFS A;  2FJ6 A;  4DSJ A;  3H8M A;  3E0F A;  4RT2 A;  3M6K A;  1DGS A;  2Y9T A;  2VJ5 A;  5AM0 A;  5KFE A;  2HI0 A;  4FZL A;  4R64 A;  2YY6 A;  3M8S A;  1ZQ1 C;  1RYS A;  2JV3 A;  3B9J A;  5HHI A;  4J9K A;  1F44 A;  1JI7 A;  2PI5 A;  2VIX A;  3CNH A;  3BQ1 A;  4IC9 A;  4Q45 A;  4M47 A;  3UQ2 A;  5KFT A;  3RJF A;  1Z1B A;  3ZD9 A;  4TQR A;  2FMQ A;  1WYG A;  5KT5 A;  3TAQ A;  4DCC A;  2V9W A;  1IM4 A;  5AIB A;  5ALY A;  2KMD A;  1L3U A;  4DFM A;  2FE9 A;  4EYH B;  3M9N B;  3AM9 A;  3QU2 A;  5III A;  1ZQF A;  1ZQU A;  2PFN A;  4P0P A;  4OJL A;  4Y2Y A;  4DOA A;  3EYZ A;  4M2Y A;  4PHD A;  5ALD A;  1ZQB A;  4M9J A;  2KKV A;  2W04 A;  4JWN A;  3Q8K A;  1L7N A;  1JXE A;  4XUS A;  1ZQO A;  2XI9 A;  4P0Q A;  4QZH A;  3T3F A;  2AGP A;  1BGX T;  9ICS A;  1UA1 A;  2HSZ A;  4YR2 A;  1L5U A;  5TIS U;  1X9W A;  2XO7 A;  2E8M A;  5DQH A;  3SI8 A;  2ATL A;  3JPQ A;  5HP4 A;  2EZY A;  2ZIV A;  1PZN A;  3TI0 A;  4JUZ A;  4TUS A;  1SXE A;  4QWD A;  4F3O A;  4U6P A;  1ZQS A;  4ELT A;  1ZQG A;  2K4E A;  4IR9 A;  5AI8 A;  2JEF A;  2D8C A;  1LVH A;  5KG0 A;  4NLB A;  2N1R A;  4FFD A;  1ZQI A;  1XWL A;  2ASL A;  3M9O B;  5BPC A;  4PJ0 U;  3M7D A;  2Q0Z X;  4Y2T A;  4LJX A;  4NV0 A;  4F5P A;  5ALG A;  5ALV A;  2HBM A;  2LMR A;  4EBD A;  4PZN A;  2W3S A;  3MR2 A;  4ECU A;  7ICH A;  2W9B A;  4I2F A;  5KFO A;  5J2F A;  4UBB A;  1SWV A;  1K5O A;  1ZQW A;  4XA5 A;  4B6J A;  4ZH4 A;  2BQU A;  1T4G A;  2HW3 A;  9ICW A;  4AP9 A;  2WB1 C;  1RG6 A;  3KD3 A;  2LI6 A;  2ISP A;  4KLM A;  1D8B A;  2QLT A;  5EE3 A;  2ES6 A;  2EAP A;  3WK4 A;  3H0R B;  5KTQ A;  5JUM A;  7ICR A;  4M9L A;  2E1E A;  4DWI A;  3M8R A;  4Z6E A;  2Q4T A;  2WB1 F;  3EZ5 A;  5G5G A;  4RU9 A;  4CCH A;  1GO3 F;  4Z6D A;  2W9A A;  2E3T A;  2W54 A;  5AI6 A;  2FLL A;  1FIQ A;  3H40 A;  4IRD A;  2HDO A;  3WKB A;  1ZXI A;  5AM2 A;  1NK7 A;  3ZDB A;  3C28 A;  3G6X A;  9ICA A;  1SIJ A;  5AKH A;  2PMZ F;  3ZDE A;  4KX5 A;  4ICA A;  3MAB A;  4RQ8 A;  5KFD A;  1IG6 A;  4DFK A;  4C8M A;  8ICQ A;  3PSP A;  2ZIX A;  2IHM A;  4I29 A;  3GIL A;  2JH7 A;  4EX7 A;  5EWF A;  2KZZ A;  4J9S A;  5KT6 A;  8ICW A;  4DOC A;  1MC8 A;  5J2B A;  1RM6 C;  2GH1 A;  2VA8 A;  1M6Y A;  4NJ8 A;  4QZD A;  5AM1 A;  2MAX A;  3RB6 A;  3AMZ A;  4RUA A;  3RR7 A;  2HHU A;  3RB4 A;  2W7O A;  4A8E A;  2BR0 A;  4P4P A;  1UCV A;  3H0L B;  2JZB B;  3KTQ A;  2K4P A;  2W03 A;  3UXN A;  3HP6 A;  1K1Q A;  2JMG A;  3F2C A;  3WKD A;  1D8L A;  4I2A A;  2F1I A;  1N5W A;  4U7C A;  2KN7 A;  1RYU A;  2V4Q A;  3GU3 A;  2W55 A;  1X9S A;  1ZQH A;  4TQS A;  4QW9 A;  1Z19 A;  4QIW F;  4DS5 A;  2JHD A;  3RJE A;  1QLN A;  2BCU A;  5AI0 A;  4QZA A;  2KFZ A;  2KVS A;  3HT3 A;  4EZ9 A;  4IQU A;  3MC1 A;  2WF7 A;  1ZQZ A;  1S0O A;  1BPE A;  3KHG A;  1N62 A;  3RR8 A;  4DL6 A;  2FI1 A;  9ICN A;  1DRG A;  2DBY A;  3MFI A;  5ALZ A;  2KK0 A;  5J2K A;  4UB1 A;  7ICE A;  4YMM A;  1Z00 B;  3Q8S B;  4B9N A;  4QZC A;  5L9X A;  2W9C A;  2W3R A;  2JEG A;  8ICT A;  5J2H A;  1QQ5 A;  4ECZ A;  1LKY B;  2KHV A;  2NRW A;  4PHE A;  1HIW A;  7ICJ A;  1IIP A;  1ZRN A;  4M04 A;  2ZJ5 A;  4DEZ A;  1SKS A;  9ICG A;  2UVV A;  5D49 A;  3GII A;  5DG7 A;  1L8L A;  2DGZ A;  3PW7 A;  4Y2V A;  3K1R B;  5KFI A;  5J0T A;  5J2G A;  4NWI A;  4R8U A;  2WAQ F;  3N4M B;  3RTV A;  2HBL A;  5KFC A;  2VJ4 A;  3T5J A;  3RJG A;  2ESE A;  3UM9 A;  3ZDA A;  3WK8 A;  1FO4 A;  1KBU A;  4F91 B;  4R65 A;  3RAQ A;  2HVH A;  4RQ2 A;  4USA A;  4YXJ A;  2NV3 A;  1KQQ A;  2JZB A;  2KZ3 A;  4OJ5 A;  2P35 A;  1QQ6 A;  4DFP A;  1L7M A;  1COK A;  3B0X A;  4EYI B;  1WWU A;  4Q8F A;  1TAM A;  3RBD A;  3PSF A;  1UT5 A;  3FDS A;  1RXW A;  4C8K A;  5A0L A;  3C1Y A;  3EW9 A;  3AQF A;  4NM2 A;  4QJF B;  4F92 B;  3HRD D;  1JRP A;  4MF2 A;  2LYB A;  5K4L A;  1PVR A;  1XS9 D;  2Y0S C;  4P2H A;  2C2R A;  5EWG A;  1UT8 A;  3GIK A;  2F8K A;  2H3Q A;  3QU4 A;  3KHR A;  4NLG A;  1ZJM A;  1CEZ A;  2ALZ A;  3I1Y A;  1HUZ A;  3NRZ A;  2BCS A;  4NLK A;  1KN5 A;  4CF5 A;  1BPX A;  1RQL A;  2WTF A;  4EZ6 A;  3QX7 A;  1KKX A;  4ACO A;  5J0X A;  1NI3 A;  3WK5 A;  4CF4 A;  1XNS A;  5CJ7 A;  5J2D A;  7ICV A;  4ECV A;  8ICY A;  5F9N A;  5KFN A;  5DBC A;  4US8 A;  2YQE A;  2VA2 A;  1TKD A;  5CWR A;  3QUC A;  3RAX A;  3AN1 A;  8ICB A;  5J0R A;  4DQR A;  3KHL A;  4ED6 A;  9ICX A;  4MEX A;  4I2E A;  4KLS A;  1KDH A;  4DL3 A;  1ZQJ A;  1EXN A;  3BZC A;  2RQ5 A;  2K4H A;  2F2A B;  1L7O A;  2B21 A;  5L1I A;  2MU2 A;  2KKP A;  4J9P A;  3N7P D;  2BHN A;  2EH9 A;  3O0F A;  1BPD A;  2R8I A;  1WCN A;  4C8L A;  5FP0 A;  2MRL A;  2HCF A;  4KLD A;  2PMZ C;  4DQS A;  3WK9 A;  2CN1 A;  5AK4 A;  5KFS A;  1YZ6 A;  3PMN A;  4Y2Q A;  1BPY A;  1N61 A;  1VJ5 A;  2PKE A;  1CUK A;  2VAN A;  4RPY A;  2WF9 A;  5DDM A;  1LV5 A;  8ICH A;  1ZD4 A;  4O5C A;  4O5E A;  2KSO A;  2XGP A;  2UVW A;  5G5H A;  5KG4 A;  2G07 A;  3E2E A;  4J9R A;  3RJJ A;  2ZIW A;  3H8S A;  4C4T A;  3LK9 A;  2JXJ A;  1X6J A;  8ICU A;  3OHB A;  1MN8 A;  1IV8 A;  1V38 A;  4ED1 A;  3CYM A;  3TQ1 A;  1QH9 A;  3D2N A;  3QXG A;  2B0C A;  1Q3U A;  1YT3 A;  3C2K A;  3L4P A;  2LPE A;  3TAD A;  4ECW A;  2HBJ A;  4RQM A;  4YFK A;  1X9X A;  2R8J A;  5DDY A;  3WKE A;  2H5X A;  1QQ7 A;  4EBC A;  3SQI A;  2Y0S F;  4KLQ A;  1J97 A;  3M9M B;  2IMW P;  4O3R A;  1X6I A;  1SXD A;  5KG5 A;  4KLG A;  1RPL A;  3KZX A;  4B9S A;  1Q3V A;  4GC6 A;  4PGX A;  4YQW A;  1C20 A;  2KD1 A;  1T3Q A;  3V6J A;  2AGO A;  3KKA A;  1X9M A;  4DQQ A;  1HJP A;  4J9L A;  3BZK A;  4M9H A;  4LVS A;  2DWQ A;  2ZG6 A;  4I28 A;  3ISB A;  2XC9 A;  3OJU A;  2HHQ A;  1NJZ A;  2AHO B;  2YB1 A;  4UB5 A;  2EAO A;  2RLT A;  5J2I A;  1A77 A;  4MF8 A;  4ELV A;  4F8R A;  4RNO A;  2A3V A;  3SZ2 A;  3IP4 B;  4GIB A;  2HOF A;  8ICF A;  4XQ8 A;  4UAY A;  3ALR A;  5DGA A;  4PHP A;  5KAF U;  3SMV A;  7ICN A;  2ODG A;  1XC9 A;  3CP8 A;  2W8K A;  4O3N A;  4OCZ A;  1RYR A;  3WK6 A;  1TFR A;  2C2E A;  3LDA A;  4FE3 A;  3C5F A;  3Q8Q B;  3H4D A;  9ICB A;  3JPT A;  2ZUC A;  1MQ3 A;  1NJX A;  3AL0 B;  2GO7 A;  2OXO A;  2F76 X;  3H0M B;  1ZQE A;  4CDG A;  4YR3 A;  4F5O A;  1FFV A;  1U47 A;  3OGU A;  2A1J A;  2AH5 A;  3C5G A;  3RJK A;  1JMS A;  2LM1 A;  1NZB A;  3PY8 A;  5J2E A;  4F2S A;  4DQP A;  2XY7 A;  3OSP A;  2M9N A;  4YR0 A;  2GLE A;  2KIV A;  3M6Z A;  3NTU A;  3QU5 A;  4CRX A;  2E8P A;  1B22 A;  1OXJ A;  5JTI A;  1IXR A;  3ISD A;  4KLU A;  5KFG A;  5CP2 A;  3NGD A;  5BOL A;  3MGI A;  2AJQ A;  2L5Y A;  2KTQ A;  3HKZ C;  4I2G A;  2G5H B;  3PW0 A;  2J6U A;  2FPK A;  4UAS A;  4LZG A;  4CNQ A;  1N48 A;  2G09 A;  2C2D A;  4C7Y A;  3EPG A;  1ZQC A;  2PXI A;  4KX3 A;  5AM4 A;  3ETR A;  4LZD A;  5KFH A;  3QNM A;  2UVU A;  3PW2 A;  4KMO B;  3IV6 A;  5KFW A;  3QU9 A;  1A0P A;  4UAR A;  3UQ0 A;  9ICP A;  3GZF A;  2R8G A;  2BCR A;  2YTU A;  4FZM A;  1UPH A;  5J0Q A;  1CI4 A;  3MDA A;  4DSF A;  3WKA A;  2YN4 A;  5CB1 A;  1LB2 B;  1RZT A;  1H38 A;  4O3M A;  1ZD2 P;  8ICR A;  2KHQ A;  3MR5 A;  4PL2 A;  4GXI A;  5J0S A;  4P4M A;  1NK0 A;  1ZD5 A;  3QU7 A;  1MA7 A;  2MUT B;  3AU2 A;  4EBE A;  2P66 A;  3T5L A;  1SL1 A;  1SV0 C;  1RXV A;  8ICZ A;  1NKB A;  2FLP A;  5AKI A;  2HHX A;  1ZQR A;  2D6F C;  2ZTC A;  2ZJA A;  3LWL A;  4F2R A;  4M9G A;  1FEZ A;  3UXP A;  5DBB A;  2DPJ A;  2ZUB A;  4E0D A;  1ZOL A;  3V7L A;  3HPO A;  2HOQ A;  5ALJ A;  2ZIU A;  5AK5 A;  5AK3 A;  4J03 A;  1XO1 A;  5KFV A;  1NKC A;  4HAI A;  4RT3 A;  2MSN A;  1Q46 A;  3AUO A;  2Y1I A;  2W9M A;  3LVV A;  1RDF A;  4KLJ A;  5J2A A;  3K4G A;  5AHX A;  3G6V A;  2JH1 A;  2IHN A;  3I28 A;  3CRX A;  9ICL A;  2WF8 A;  4FS2 A;  5CRX A;  4BGD A;  1C7Y A;  4HYK A;  5ALF A;  2W9B B;  2EAM A;  3SYZ A;  2NO4 A;  3F2B A;  4P0P B;  4QWC A;  3ICX A;  2FPL A;  2YML A;  1F5S A;  2ZUD A;  4C8O A;  1SKR A;  1X40 A;  3TFR A;  5IIL A;  4DL2 A;  2OHF A;  5EOZ A;  3IDW A;  1WCL A;  3ONN A;  3OSN A;  3D2S A;  8ICE A;  2CRX A;  1PVP A;  4QW8 A;  2W7P A;  9ICU A;  4MFF A;  3EPI A;  4ECT A;  3KBB A;  4YN4 A;  3SV4 A;  1Z3E B;  5AM5 A;  3PW4 A;  3LVW A;  2HHT A;  2O6K A;  4B9M A;  3RJI A;  1P7D A;  3DDH A;  3VCB A;  4O3P A;  1TK8 A;  4GFJ A;  3PX4 A;  4M9N A;  3PO5 A;  2LHT A;  2WAQ C;  4JK1 A;  3Q8R B;  4TUR A;  4I2H A;  2PFP A;  5DQG A;  4O0I A;  3WKC A;  5AI4 A;  3BS5 B;  2F1H A;  4RQ1 A;  3M1Y A;  3HKZ F;  2A1A A;  2AQ0 A;  3IG8 A;  5DB7 A;  1D8Y A;  2I6X A;  7ICI A;  5KFM A;  3GV7 B;  4UB8 U;  1V97 A;  2EZX A;  4UBC A;  4NL9 A;  3IG5 A;  2J6S A;  1TVA A;  7ICU A;  4B9U A;  2R8K A;  2JEI A;  3D6J A;  2F8L A;  5L1J A;  2H3V A;  1TAQ A;  4UB6 U;  5KFQ A;  3UMC A;  3IM1 A;  1PK3 A;  2BKE A;  4KN7 A;  2KP7 A;  2I9G A;  5DLF A;  1TE2 A;  2AU0 A;  2KE7 A;  1ZQQ A;  4PH5 A;  3GV5 B;  5H2F U;  2LYA A;  1NZP A;  1Z00 A;  1K1S A;  1BPB A;  5DG9 A;  3IN5 A;  2NRT A;  4RQ3 A;  4GXK A;  4OJO A;  1SZP A;  5E79 U;  4UAT A;  3PZP A;  2QAR A;  2MA1 A;  4ECX A;  4ECS A;  3QEA Z;  5DB9 A;  3CW2 C;  2RDI A;  2DKZ A;  2NRV A;  4KLE A;  7ICQ A;  2DKX A;  1BNO A;  1V85 A;  3PVX A;  3BQ7 A;  4YMN A;  3E58 A;  1AQ6 A;  2ASJ A;  3V6K A;  5EE9 A;  5HR6 A;  5KFF A;  3BQ0 A;  9ICT A;  5KAI U;  9ICV A;  1NK4 A;  5ALS A;  4KLT A;  4R66 A;  1ECW A;  2CXY A;  5KFR A;  3ISC A;  3C29 A;  3V72 A;  4B9T A;  8ICS A;  2OWO A;  2IOF K;  3JPN A;  1QCK A;  2B6G A;  1CRX A;  5AKY A;  4AYB F;  1S97 A;  4QIW C;  2G0A A;  3RF9 A;  3HWT A;  4EEN A;  3RRG A;  2E1F A;  2LKY A;  4J9N A;  1L8O A;  4C0Z A;  4M0A A;  3J81 j;  2YB4 A;  9ICQ A;  1ZQV A;  5DLG A;  5L1L A;  2HVI A;  5J29 A;  4OJ6 A;  4BXO B;  5ALK A;  4IQV A;  3D2Q A;  4RPZ A;  8ICX A;  5ALI A;  5HNK A;  4YVZ A;  4Y2U A;  5ALO A;  5IIO A;  3TAD C;  1COO A;  1Z4N A;  2HOI A;  2P6R A;  5KFZ A;  5CEH A;  3C21 A;  1S0V A;  1S0M A;  4FZN A;  5ALX A;  3UMB A;  2WHE A;  4QZG A;  3TAN A;  3U26 A;  2HMX A;  4FO6 A;  5CHG A;  4OO1 J;  4IRC A;  2P6U A;  2AGQ A;  1S9F A;  4K4G A;  4UAU A;  1S77 D;  1X42 A;  4BWM A;  3N7S C;  4RPX A;  5KT3 A;  4ECQ A;  4DFJ A;  3PW5 A;  1U9L A;  1QSS A;  4C8N A;  2QAR B;  5GTH U;  1O03 A;  1OW5 A;  1N60 A;  3BQT A;  5EWE A;  3IRU A;  3H4B A;  5IIM A;  2G08 A;  4US9 A;  3LYS A;  1J2M A;  5HHH A;  4NY8 A;  1Z1V A;  1U4B A;  2DQN B;  1U49 A;  3FC4 A;  2E8N A;  3UXO A;  2KNJ A;  3THV A;  1NK5 A;  4DLG A;  1WG8 A;  4BUG A;  3NVY A;  3RJH A;  1Q8K A;  2YX8 A;  4IRK A;  8ICM A;  2IOF A;  3H8J A;  4DOB A;  2BZF A;  1ZQT A;  3DEE A;  2JR5 A;  3R9K A; 
#chains in the Genus database with same CATH homology
 4NL9 A;  2E8M A;  3BS7 A;  1V38 A;  1LKY B;  5JU5 A;  3BS5 A;  2D3D A;  3TAD C;  2E8O A;  1SXE A;  1WWV A;  5J8Y A;  2F44 A;  2KSO B;  1PK3 A;  2LPE A;  3TAD A;  2F3N A;  5J8Y C;  4RQM A;  3H8M A;  1X9X A;  1PK1 A;  2D8C A;  2KE7 A;  4NJ8 A;  3K1R B;  2GLE A;  2KIV A;  2Y9T A;  2QB0 A;  5JRT A;  2E8P A;  4RQN A;  1SGG A;  2JV3 A;  1OXJ A;  5JTI A;  1JI7 A;  4MHV A;  1B0X A;  2ESE A;  1UCV A;  1SXD A;  2LMR A;  2L5Y A;  2K4P A;  2KG5 A;  3SEI A;  1UQV A;  4PZN A;  2EAM A;  1B4F A;  5L1M A;  4NL9 C;  3KKA C;  2QAR A;  2QB1 A;  3KKA A;  4IS7 A;  1F0M A;  1X40 A;  3IDW A;  1LKY A;  1COK A;  2DKZ A;  2KMD A;  1RG6 A;  2DKX A;  1V85 A;  1WWU A;  2FE9 A;  3BQ7 A;  2ES6 A;  2EAP A;  2QAR B;  1OW5 A;  1PK1 B;  3HIL A;  2EAO A;  2YTU A;  5KNI A;  2QB0 B;  2K60 A;  1SV4 A;  2EAN A;  1SV0 A;  2KSO A;  1Z1V A;  1KW4 A;  4PZO A;  1X66 A;  2F8K A;  1SV0 C;  5F3X B;  2QKQ A;  2B6G A;  3TAC B;  2E8N A;  3BS5 B;  1DXS A;  2DL0 A;  3SEN A;  2Y9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...