4NL9A

Crystal structure of the human anks3-sam/anks6-sam heterodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
APYSGPQDLAALLEQIGCLKYLQVFEEQDVDLREFLTLTESDLKEIGITLFGPKRKMTSAIARW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nl9A01
3BS5B 2KMDA 4IS7A 1PK1B 2QKQA 1LKYB 3H8MA 5JU5A 3TADA 5JRTA 1SXDA 1V85A 1X40A 5J8YA 2QARB 3BS7A 3HILA 3SENA 1B4FA 2LMRA 2QB0B 2D8CA 2L5YA 2KSOB 1Z1VA 2KG5A 2E8PA 2Y9UA 2F8KA 4NJ8A 3K1RB 2E8NA 2GLEA 2QB1A 2F3NA 3SEIA 1OW5A 1SGGA 2EANA 2YTUA 4PZOA 1PK1A 2B6GA 1X9XA 1PK3A 2LPEA 2D3DA 2DKZA 2F44A 2Y9TA 1KW4A 2KE7A 1OXJA 2EAPA 1SXEA 4RQNA 2EAMA 4MHVA 1JI7A 2ES6A 1V38A 3KKAC 2EAOA 2K60A 2QARA 2JV3A 5JTIA 1WWUA 3IDWA 2QB0A 3BS5A 1COKA 1X66A 4PZNA 4NL9C 1DXSA 1B0XA 2FE9A 2DKXA 2E8MA 2KIVA 1LKYA 4RQMA 1SV0C 5F3XB 3KKAA 1F0MA 3TADC 3TACB 5KNIA 3BQ7A 4NL9A 1RG6A 1UQVA 2K4PA 1SV4A 5L1MA 1UCVA 2KSOA 5J8YC 2E8OA 2DL0A 1SV0A 1WWVA 2ESEA
chains in the Genus database with same CATH superfamily
4QZEA 4AYBF 4ED8A 3C5GA 5IIKA 5J0UA 3H8SA 5DB7A 1XS9D 4K4HA 2JZBA 2ZJAA 2NYVA 3BQ2A 2FLPA 4QZHA 4DSFA 2JH1A 3VC8A 3MFIA 4RUAA 5J2JA 4Q44A 4IRKA 4F5OA 4DFMA 4RQ7A 2AJQA 3F2DA 2ASLA 3ETLA 3N7RC 4PL1A 2G06A 1X6IA 2LYAA 1ZQLA 2IHMA 4NWIA 2W8LA 1HIWA 1MN8A 2W8KA 2DUYA 3RAQA 2EQYA 2Y9UA 3RR8A 1BNOA 4ICAA 2IBKA 4F4YA 4ED1A 5EE1A 2JHDA 2BCQA 3GV8B 3PW0A 5KFMA 1ZQOA 3ZD8A 3KHGA 5TZVA 4M9JA 2W7OA 3KBBA 4UAVA 2P6UA 5J0QA 4X5VA 2IA6A 5DBCA 2HBKA 2Z7JA 1X6JA 4YXMA 5AIBA 2LKYA 2ODGA 4DL3A 5ALSA 4ECWA 2DWQA 1RPLA 4ED2A 3T3FA 1SWWA 4YXJA 3D6JA 1NKEA 4FFDA 5AM1A 1B0XA 2RRDA 3HPOA 4KX5A 3V6JA 5CB1A 1JMSA 4RPZA 3V6HA 2HHWA 2FI1A 1SL1A 8ICYA 4Q43A 3PX6A 1S0OA 3UMCA 4B9UA 1JN3A 4P0PA 4PHPA 3RJEA 3I1YA 4EZ9A 2FJ6A 2HOIA 3WKDA 1RYSA 2W03A 1UQVA 3QZ8A 3QUBA 2DPJA 2WF6A 5J8YC 4DCCA 2ZIXB 3NVYA 1U4BA 2DL0A 1LVHA 4F93B 3HKZF 1PK1B 5KFGA 1QSSA 2QKQA 4F4KA 7ICMA 4TURA 5F9LA 4U6PA 2ZUDA 3H8MA 2ZXHA 9ICSA 2W9CB 3MGHA 1IM4A 1WCLA 3V72A 1JRPA 4YR3A 3RJJA 1X40A 3NS1A 3GU3A 2BPGA 2G5IB 2ZTCA 5ALXA 5ALNA 5J2AA 1HUOA 3ORYA 3PSFA 3JPPA 2L5YA 4RQ8A 4RT2A 5DLFA 4EBDA 5ALFA 3L3FX 5EWGA 1OW5A 2DQNB 2W04A 2FPLA 4KMUA 2MSNA 7ICVA 5AKGA 1F5SA 3BQ0A 8ICWA 1JIHA 2OWOA 2W54A 2PMZC 3PW2A 1ZQZA 5HR7A 4ZOHC 1TFRA 5J0OA 4O0IA 4DL7A 4YVZA 4RPYA 4J9SA 2K60A 5HR6A 2Q4TA 5CJ7A 1SKSA 4UBBA 1COKA 1TE2A 5J0TA 1A76A 1MQ3A 1UA0A 4OJOA 2KNJA 5J2KA 3ZD9A 1ZQUA 2JGAA 5KFKA 4Z6CA 4PGQA 2E1EA 4KN4A 1F0MA 2HBLA 8ICIA 5DQHA 1ZD2P 2KVSA 5KT7A 1S9FA 1UT8A 1QTMA 5K4LA 5KG4A 2K4IA 1NJZA 4RQ2A 2I5HA 1X9MA 3IP4B 4KTQA 3H8WA 4F5PA 4EBCA 2KJ5A 4IS7A 5DDYA 8ICMA 2W7PA 3B9JA 3MBYA 4QW8A 4F72A 5DBBA 1F44A 1N2XA 5J0YA 3CRXA 2K4EA 5J0PA 5GTIU 2YMMA 4DQIA 3AQEA 1KFTA 5KAFU 1HJPA 4MEXA 2XVTA 4WJ3B 5EWEA 1KL9A 2ZIVB 1Q46A 4UAUA 1BNPA 3ZDDA 1DGJA 4IQWA 2KSOB 1QLNA 2VKQA 4F92B 4O3SA 1QSLA 3PV8A 3TANA 4J9NA 1Q8KA 4C4RA 1VJ5A 1H38A 1SGGA 2EANA 4M2YA 1J97A 2K89A 3GQCA 1ZQNA 2Y9TA 2YMPA 4I2CA 3H8JA 2EAPA 3NUQA 3BDPA 3EUB2 5B5EU 4MHVA 3QNMA 2F1IA 4UB1A 3MR6A 2LBOA 1MA7A 3M1YA 3Q8KA 3N4MB 2F77X 1ZQDA 2P35A 2JRZA 3Q8MA 4MFAA 2HDOA 2E3TA 1U49A 4OD0A 4YD1A 2KD1A 5ALEA 1BPXA 2J6TA 1B43A 2AU0A 4UAYA 4BX9C 2VA8A 8ICUA 2ZIWB 3G6YA 3PVXA 1D8YA 2E8OA 1ZQWA 2ZIUB 1UT5A 3KHLA 1WWVA 3OSNA 2VA3A 1RZTA 1NJXA 4ZH4A 3M9OB 3C2KA 2BGWA 4RNNA 3U26A 1LKYB 2EDUA 5HNKA 2HI0A 4LJXA 4QW9A 1N5XA 4Y2YA 5JRTA 5J2EA 3M9MB 5CR0A 4J9MA 4YFKA 3A0BU 2R8KA 4IRCA 1RDFA 2NRTA 4CE6A 1K5OA 3BJYA 5HHHA 5KTQA 4DSKA 1ZOLA 2F1HA 5ALHA 1DGSA 5AKLA 4QWEA 2MUTB 4IC9A 4GLXA 1DK3A 2GO7A 1ZQJA 5ALTA 4EX6A 2D3DA 5EOZA 5CRXA 1ZQCA 3FC4A 1OXJA 4RQNA 2OHFA 3RBDA 1L7NA 5KT3A 3F5AA 3JPSA 4JB3A 5J2CA 4FBUA 4E0DA 2IMWP 2EZYA 1NK6A 2W43A 5KFDA 4KLIA 2C28A 4FE3A 3RR7A 1ZQEA 3BS5A 4ECYA 2AXTU 1X66A 3B0YA 3C29A 4NL9C 1PVRA 1XO1A 3RBEA 4DQQA 3Q8SB 4GXJA 2AQ4A 4QZ8A 5KFIA 1T8EA 5KFQA 2ZXIA 5ALWA 4Y2QA 5J2IA 3H0RB 4NLKA 2F8LA 1VLBA 2HHUA 9ICWA 4DS5A 1DOQA 5KNIA 8ICVA 1ZQVA 2OXOA 1ZQXA 1FFUA 5L1MA 5T14A 1HUZA 3AU6A 2R8IA 4ECRA 3OGUA 2WF5A 5DKWA 1ZRNA 1KSPA 3QUQA 1Z00A 3SYZA 1FEZA 4ECXA 5KFSA 1WCNA 3E58A 4JV1A 1S77D 4PHEA 2DBYA 4P2HA 3RJKA 4KLLA 4KLMA 4P0PB 2QARB 3LYSA 4P0QB 1B4FA 3T5JA 1SZHA 2D8CA 5AI6A 3WK8A 5L1LA 2KG5A 3NRWA 3AL0B 4QZAA 4NLZA 2NRXA 5CWRA 8ICRA 5KT4A 4GXKA 1NK4A 1NZBA 2BR0A 4QZIA 5AI8A 2YTUA 2HHQA 1J2NA 4Q45A 4OJ6A 4DQPA 1X9XA 4ACOA 4F2RA 1Z4NA 3CP8A 5KG3A 3PO5A 5C0YA 3PW7A 2EAMA 4B9NA 5ALLA 7ICQA 1MQ2A 4YG2A 3OJSA 3C21A 5J2FA 3MDAA 2EAOA 2DGZA 1KRPA 1M6YA 5KT6A 3RB6A 2PFOA 2QB0A 2Y0SF 2ZJ5A 1IV8A 2KOBA 4I27A 2RHFA 4EENA 8ICTA 2H3VA 4C4SA 4FZNA 2WF9A 3RB3A 3KD3A 4FO6A 3C1YA 1NKBA 2HBJA 4GFJA 1AQ6A 1B22A 2KFZA 3OHBA 3BZCA 1NK8A 3AU2A 5KFLA 2YQEA 1UCVA 4CF4A 2VANA 4UBCA 1NK5A 4JV2A 1ZJNA 2F1JA 8ICGA 3QU5A 5AKHA 4UQGA 2KHQA 3JPOA 4Y2XA 4QZGA 3AN1A 5KG2A 2XY7A 4C0ZA 5JU5A 1JXLA 3OSPA 4DO9A 3L4PA 3PNCA 2LYBA 3IHQB 1PVQA 1PVPA 3GFKB 4UAZA 4MEYA 4P4PA 1Z4OA 3AQFA 2KN7A 5AI0A 5J8YA 4F50A 1BPZA 1XU4A 5ALIA 1MC8A 7ICNA 3DDHA 3NRZA 4Y2UA 4Z6FA 4FS2A 9ICMA 4NJ8A 2GLEA 2ALZA 3F5EA 3RH5A 2YB4A 3UXOA 2PKEA 4M9HA 2W11A 3CW2C 5D4BA 1ZQGA 2DKZA 2BZFA 1SXEA 2XIDA 2BPCA 4O3NA 2FDRA 2RDIA 2A3VA 2G5HB 1L3VA 4NY8A 4I2JA 3LK9A 4XA5A 3R9KA 1ZXIA 4IL6U 5E79U 4OO1J 5DLGA 5DG8A 8ICAA 5KFAA 3QXGA 4PZNA 2AHOB 2H3QA 2KKVA 5BOLA 2HMXA 4C8OA 4I2BA 1KFDA 5B66U 2KJ8A 1NNLA 3LVVA 1BGXT 4M6WB 3KZXA 1S97A 1LV5A 1COOA 2XC9A 5CA7A 1P7DA 4ED3A 2NO4A 1L3UA 3O0FA 5IINA 4B9LA 5KT2A 1XO0A 4PPXA 2HW3A 4QWBA 1PUZA 2G07A 2BQUA 3KOOA 9ICLA 1ED1A 3EWAA 3WK5A 1N60A 3EPIA 1XSNA 4B9VA 3ICXA 4NXZA 3ALRA 4DL4A 1SXDA 1VDVA 5AI4A 4F3OA 5AI9A 5ALVA 4DSEA 3BS7A 5DGAA 4YMNA 3EZ5A 1BPYA 4P4OA 5H2FU 4C8LA 4AP9A 5J2GA 2BPFA 5CEHA 2F3NA 2ZG6A 9ICNA 2J6SA 3GIMA 2B6GA 2HCFA 4KN7A 5L1IA 2KE7A 1JALA 9ICPA 1ZRMA 1C7YA 5CHGA 4M04A 3TFSA 1V9PA 5KFUA 2ZUCA 1ZQHA 7ICTA 3KKAC 5ALRA 4ECTA 2R8JA 4IQVA 5EWFA 4NLBA 3H0LB 1BVSA 3IN5A 1ZETA 3I76A 2PFNA 4BXOA 2UVWA 4NM1A 3MR2A 2R8HA 1SV0C 2UVUA 3M6ZA 2XO7A 2ISOA 9ICFA 2JEIA 2G09A 2M9NA 2JMGA 3LDAA 1LB2B 2HHTA 4KLHA 2G0AA 2IOFK 3Q8LA 5KG0A 1L8LA 3BQ7A 4DFDA 2WTFA 1KDHA 2BDPA 4O5EA 3BS5B 3B0XA 3JPQA 7ICKA 4DLGA 3V7KA 2HVHA 4TQRA 4C7YA 5C5JA 5KFWA 4PGYA 3K4GA 1KFSA 4DOBA 5KT5A 3WKEA 4DQSA 1RQNA 3TAQA 1ZJMA 1QCKA 3RJIA 8ICKA 5ALOA 3T5LA 4KX3A 4YQWA 2LMRA 9ICUA 3K75D 4BUGA 3G6XA 4ELTA 3V7LA 2YMLA 3RRGA 2QB1A 1Z00B 4QZ9A 2PMZF 4YP3A 3F2BA 4PZOA 2BHNA 2JEGA 2ZUBA 1N63A 2NV3A 1PZNA 4JV0A 4KLUA 1A0PA 3SMVA 2GWSA 4ED0A 2A1JB 3L5KA 4J9KA 1T7PA 1N62A 1D8LA 4O3MA 4QZFA 4TUPA 3UXPA 4B9SA 4EX7A 5TISU 3UQ0A 3SZ2A 3GV5B 8ICQA 1CUKA 3UXNA 4QWAA 2VIXA 4RQ6A 4CRXA 1KLNA 4F2SA 2HBMA 4F5RA 5F3XB 4EELA 3WK9A 4BJQA 4EYHB 2P6RA 8ICLA 3PZPA 8ICNA 5KG7A 4RQ4A 4LZGA 1L6NA 3PO4A 5IIMA 4NL9A 5J0SA 1T3QA 2UVRA 4KLGA 1D8BA 5KFRA 4UAWA 4O9MA 5AM4A 3V6KA 1CRXA 5IIOA 4OCZA 1TK0A 4HYKA 2FMQA 1QH9A 4UB3A 1BPEA 2PFQA 2CN1A 2KTQA 1UHUA 5J2HA 5D49A 2KJ9A 4R65A 3IM1A 4ECUA 1MSWD 4RU9A 4KLSA 4R8UA 2KIWA 2AH5A 2JH7A 4J9OA 1HEKA 8ICBA 2JEJA 2ZIXA 1K1QA 3MFHA 3IG5A 4PHDA 5KFHA 1NK0A 1ZQAA 1PK1A 1TKDA 3M8RA 1WUDA 1D9DA 2VJ5A 3Q8RB 8ICHA 5KG1A 9ICQA 2FPMA 4O3RA 4BWMA 4NLGA 4R64A 2BDUA 1WWUA 3A0HU 1S76D 1KBUA 4M0AA 2JZBB 2QLTA 1TV9A 9ICOA 2E8MA 4RZRA 4ECQA 2ZJ8A 4DF4A 3PR5B 1U45A 3GIIA 2MU2A 2K8BB 5DB6A 3RJHA 3MGIA 3SQIA 4JK1A 1RM6C 1Q3VA 2O6KA 4BWJA 4M9LA 4YR0A 5AM2A 2PFPA 3PW4A 4YN4A 3Q8QB 4Q8FA 9ICAA 2JXJA 2AGPA 1KEJA 2Q0ZX 1X9WA 2OYYA 5AM3A 3AUOA 2KHVA 3WK6A 1ZYQA 4OJLA 4A8EA 3M9NB 3RTVA 1SKWA 5D46A 4O5KA 2P66A 2CXYA 4PJ0U 5AK5A 2CPRA 5AKZA 8ICZA 3MDCA 5L1KA 4EBEA 1WG8A 2IOHA 4G9BA 3SENA 2MRLA 4XRHA 3QUCA 2WHEA 3KHRA 3QYPA 4TUQA 2R8GA 1DK2A 3FM9A 4EEYA 4UW9A 4GC6A 4Y2JA 3SI8A 8ICSA 4Y2PA 2FLNA 4U7CA 2MAXA 1ZQBA 2BQRA 3M8SA 1PK3A 4GXIA 5KL8B 3IRUA 4ECSA 3ZDEA 2BCVA 3ZDCA 2LI6A 3PX0A 9ICTA 2XCAA 3NVWA 2LYHA 3LWLA 2HHVA 1L7PA 4R66A 1RXVA 2J6UA 2RDJA 5ALQA 3UM9A 5AKKA 3MR3A 2FE9A 5IIJA 1QQ5A 4DFKA 2XCPA 4KLJA 4I2HA 4CF3A 1IG6A 3ISBA 4NLNA 5KG6A 5HMMA 7ICOA 4RUCA 1DRGA 4Z6EA 3WKBA 3N97B 4US8A 2EZZA 3OHAA 3TARA 3RH4A 4BDPA 5KFZA 4RQ5A 3EYZA 1TAQA 4MF8A 1T94A 3S6JA 3VCBA 3PX4A 4NM2A 2OCEA 1SIJA 4Z6DA 3NTUA 2KICA 2HVIA 2WAQC 5J2BA 2V9WA 1A77A 5HMLA 5AK4A 4I2EA 3KFUF 3JPNA 1JX4A 2XGPA 4C8MA 4AYBC 9ICRA 2RLTA 4C4TA 7ICEA 5ALPA 3PMNA 2ASDA 4DSLA 3QU9A 3TFRA 5KFXA 1QSYA 9ICIA 4ELUA 2ZIWA 4R63A 5AKYA 2A19A 4DWIA 3NASA 2NRZA 2ZIUA 3F2CA 8ICEA 2M0NA 3ED5A 2KEYA 4C80A 4FS1A 4JUZA 2W9BA 3WK7A 4QWDA 3GDXA 4Q8EA 3TI0A 1KW4A 1FO4A 2EH9A 3RRHA 1O08A 5HHIA 4YR2A 5AIAA 4O3PA 3N28A 4UB6U 2PXIA 1S0MA 2R18A 4F8RA 3BQ1A 2AQ0A 1V38A 1NK7A 2NRWA 5DQGA 3UPQA 2DFLA 2WAQF 4I28A 1DXSA 1FFVA 4QJFB 4BGDA 5JUMA 1ZQIA 1S0NA 4F5QA 4J9LA 2MUTA 5AM5A 3WKCA 2OM6A 5FP0A 1ZQQA 3KKAA 3TADC 1N5WA 4RNOA 2GH1A 3TACB 4DOAA 9ICHA 2F76X 4YMOA 3RB4A 3WKAA 3QU7A 7ICIA 2K4PA 2LM4A 5F9NA 9ICCA 5DG9A 1SV0A 2RP5A 3QEAZ 4QZDA 1ZQMA 2KV2A 4J9QA 3I28A 5AKEA 5DB9A 4LVSA 1JUDA 7ICSA 3D2SA 3OJUA 3JPRA 4ELVA 3M6KA 3JPTA 2H3ZA 3HKZC 2E5SA 2B21A 2BCUA 4Y2RA 8ICCA 2VJ4A 1XSPA 1Q3UA 3E0FA 4QZCA 5IILA 5J2DA 1KQQA 3SAFA 4PH5A 5ALMA 1K1SA 4KMOB 4KITB 4J9PA 1U47A 4TUSA 4M9NA 4Y2TA 5G5GA 2AGQA 1IXRA 3KTQA 3RH6A 4EZ6A 2ISPA 4K4IA 3K1ZA 4PGXA 1ZQYA 8ICXA 5J29A 1SB3C 3PW5A 5A0LA 1X2IA 2I9GA 3N7SC 1CI4A 3AM9A 2IOFA 3PY8A 2KP7A 4DL2A 4YMMA 1OUQA 1QQ6A 2QARA 4DLEA 3DEEA 4P0QA 5EE0A 3WU2U 5DDMA 4GIBA 3IDWA 5DBAA 1XNSA 4R8UB 1IIPA 4I2AA 2YMQA 7ICLA 5J0RA 2W3RA 5KFFA 7ICPA 2RQ5A 2K8AA 3SV3A 1KKXA 4UASA 5ALKA 1YZ7A 3FDSA 3CNHA 2KZZA 5ALGA 1YT3A 2KFNA 3BQTA 2DF4B 4JWNA 4M9GA 9ICVA 1S0VA 4CDGA 2YN4A 2WF8A 3HT3A 3E2EA 4DFPA 2KK0A 2KKPA 2W55A 1RYUA 1SWVA 2ESEA 9ICKA 3ZI4A 4UARA 4ED7A 4ECZA 2BCRA 3D2NA 4F91B 3HJEA 3ETRA 4UB4A 1UA1A 4KLOA 2I6XA 2PI4A 4KLEA 4K4GA 3AEVA 3HW8A 5AI5A 4Y2SA 4YCXA 5KFBA 3GIJA 2FLLA 1ZQTA 4EYIB 3J81j 5ALDA 4OJ5A 3HRDD 5KAIU 5AM0A 7ICHA 3QUTA 2AGOA 2IHNA 4C8KA 4PHAA 1Z1VA 9ICXA 4JWMA 5BPCA 1A6SA 2YB1A 5AKXA 4I2DA 2F2AB 4O3QA 3RJFA 4DS4A 2H3FA 3OPXA 2LPEA 3QU2A 4O5CA 4IQUA 3MGVA 4NLCA 5HP4A 2HHSA 1X9SA 1S5LU 2FMPA 1JI7A 2E1FA 4I2IA 4OJPA 2ES6A 7ICRA 5ALJA 4HAIA 4F5NA 5JTIA 4B6JA 3N7PD 1TK5A 4Y2VA 3FAHA 1N56A 2DKXA 4RQMA 5AKJA 2ZTDA 4RT3A 3MC1A 2D6FC 4CGZA 3WK4A 7ICGA 4FZLA 4CF5A 5BOMA 2NO5A 4DF8A 4KLFA 4F4ZA 4FBTA 5J0XA 3C23A 2W3SA 1J2MA 4KLQA 3G6VA 3RFAA 2BKEA 1RG6A 3BZKA 1TK8A 2VA2A 1NJWA 2C2DA 5KG5A 4QNLA 4XUSA 5AK6A 3EPGA 4KLTA 4US9A 4KLDA 3QEBZ 2C2RA 4LZDA 1ZD5A 1S10A 2FMSA 3TQ1A 5L1JA 3NVVA 2OH2A 1NJYA 1L5UA 1SL0A 2ASJA 4M6WA 4DL5A 2HOFA 4PL2A 2XY5A 3QU4A 3IV6A 4RQ3A 3TAPA 1XSLA 3F53A 1TAMA 4I2FA 1O03A 2EZXA 2QB0B 3QE9Y 4J9RA 3ZDAA 4CCHA 4F4XA 3HP6A 2F8KA 3IG8A 1AROP 1ZD4A 2E8NA 4RPXA 1NI3A 3SEIA 4G3IA 3QZ7A 5KFCA 2FPKA 3HWTA 3MR5A 4C7ZA 2CRXA 1Z3EB 5EE9A 4UB5A 2MA1A 1KN5A 2WF7A 5KFJA 2XGQA 4I29A 2LM1A 2H3IA 3H7IA 4UATA 1ZQ1C 3RF9A 5J0WA 9ICGA 4C8NA 1U9LA 2W9CA 2W9BB 5EE3A 4DL6A 2UVVA 1N61A 1V97A 4CNQA 1NOMA 1ZD3A 2B0CA 4USAA 3ZDBA 1CEZA 2G08A 4IR1A 3M7DA 2LHTA 3V7JA 2A1AA 5G5HA 2C22A 2NRVA 2XY6A 2KMDA 8ICOA 2GOLA 4MFFA 3DV9A 5AKIA 5ALYA 3PSIA 3C2LA 3SD7A 2XICA 4DQRA 1ECWA 1BPDA 3GV7B 3T5KA 1T3NA 1SZPA 4M47A 1UPHA 1RXWA 3H40A 2YY6A 4ED6A 4F71A 1N48A 2HSZA 3C2MA 3T79A 1GO3F 2JEFA 4TQSA 4UB8U 1C20A 3SAGA 1JROA 8ICFA 3RJGA 3K1RB 7ICUA 3GZFA 5KFTA 3PR4A 1S8OA 2HOQA 2KZ3A 4F4WA 3ISDA 1Y88A 3LWMA 2JR5A 5GTHU 2ATLA 3GILA 2Y1IA 4DSJA 5KFNA 4NV0A 5ALUA 2V4QA 5DGBA 1KTQA 3ISCA 4ECVA 9ICEA 3SV4A 4QIWC 1WYGA 2JV3A 2XI9A 3H0MB 4O3OA 5L9XA 1ZQPA 4J03A 3Q8PB 3SR6A 1Z1BA 4MFCA 4RQ0A 1TVAA 2Y0SC 1EXNA 1ZQRA 3UMBA 4QZBA 3PMLA 3C5FA 5KL1B 3PSPA 2YX8A 3GIKA 1RYRA 2ZIVA 1L3TA 4UB2A 1XWLA 4DFJA 2WB1C 1X42A 4IQTA 2KSOA 2A1JA 3THVA 5CP2A 4YD2A 3NVZA 1ZQFA 5AICA 2I1QA 5KFYA 3RAXA 1ZQSA 3UMGA 9ICJA 4IRDA 2BCSA 1U48A 3ONNA 5KFPA 1NK9A 3QX7A 3RB0A 3TADA 4B9MA 4I2GA 3MABA 1V85A 1YZ6A 1BPBA 4QIWF 1XC9A 3T5HA 2K4HA 9ICBA 3HILA 1T4GA 5AK3A 3H4DA 4B9TA 4DOCA 3TKAA 4BXOB 2E8PA 5ALZA 2KVCA 1TAUA 3KZIU 4P4MA 2KZMA 5KFEA 3CYMA 2W9MA 3NGDA 5DB8A 3C1ZA 7ICJA 7ICFA 3PSTA 2BQ3A 4QWCA 1L8OA 2N1RA 3FYHA 1NKCA 3D2QA 4IR9A 4FZMA 2F44A 3KHHA 5KFOA 1D9FA 4DSIA 1L7OA 2PI5A 1RQLA 1SKRA 2WB1F 2C2EA 4GC7A 1SL2A 2HHXA 3C28A 1URJA 4MF2A 3HX0A 3H4BA 1QQ7A 4JMUA 2WFAA 1L3SA 2OEHA 4RQ1A 3LVWA 4EEKA 5AHXA 3AMZA 3SAHA 1JXEA 3OTQA 2W9AA 4DEZA 1FIQA 4RNMA 1L7MA 1LKYA 2KIVA 3UQ2A 2Y1JA 5IIIA 2DPIA 5KFVA 1ZQKA 2V4RA 2K8CB 2H5XA 3EW9A 5DQIA 1Z19A 1SV4A 1NZPA 8ICJA 2ZTEA 4XQ8A 8ICPA 5DG7A
chains in the Genus database with same CATH topology
3BS5B 2KMDA 4IS7A 1PK1B 2QKQA 1LKYB 3H8MA 5JU5A 3TADA 5JRTA 1SXDA 1V85A 1X40A 5J8YA 2QARB 3BS7A 3HILA 3SENA 1B4FA 2LMRA 2QB0B 2D8CA 2L5YA 2KSOB 1Z1VA 2KG5A 2E8PA 2Y9UA 2F8KA 4NJ8A 3K1RB 2E8NA 2GLEA 2QB1A 2F3NA 3SEIA 1OW5A 1SGGA 2EANA 2YTUA 4PZOA 1PK1A 2B6GA 1X9XA 1PK3A 2LPEA 2D3DA 2DKZA 2F44A 2Y9TA 1KW4A 2KE7A 1OXJA 2EAPA 1SXEA 4RQNA 2EAMA 4MHVA 1JI7A 2ES6A 1V38A 3KKAC 2EAOA 2K60A 2QARA 2JV3A 5JTIA 1WWUA 3IDWA 2QB0A 3BS5A 1COKA 1X66A 4PZNA 4NL9C 1DXSA 1B0XA 2FE9A 2DKXA 2E8MA 2KIVA 1LKYA 4RQMA 1SV0C 5F3XB 3KKAA 1F0MA 3TADC 3TACB 5KNIA 3BQ7A 4NL9A 1RG6A 1UQVA 2K4PA 1SV4A 5L1MA 1UCVA 2KSOA 5J8YC 2E8OA 2DL0A 1SV0A 1WWVA 2ESEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS5 B;  2KMD A;  4IS7 A;  1PK1 B;  2QKQ A;  1LKY B;  3H8M A;  5JU5 A;  3TAD A;  5JRT A;  1SXD A;  1V85 A;  1X40 A;  5J8Y A;  2QAR B;  3BS7 A;  3HIL A;  3SEN A;  1B4F A;  2LMR A;  2QB0 B;  2D8C A;  2L5Y A;  2KSO B;  1Z1V A;  2KG5 A;  2E8P A;  2Y9U A;  2F8K A;  4NJ8 A;  3K1R B;  2E8N A;  2GLE A;  2QB1 A;  2F3N A;  3SEI A;  1OW5 A;  1SGG A;  2EAN A;  2YTU A;  4PZO A;  1PK1 A;  2B6G A;  1X9X A;  1PK3 A;  2LPE A;  2D3D A;  2DKZ A;  2F44 A;  2Y9T A;  1KW4 A;  2KE7 A;  1OXJ A;  2EAP A;  1SXE A;  4RQN A;  2EAM A;  4MHV A;  1JI7 A;  2ES6 A;  1V38 A;  3KKA C;  2EAO A;  2K60 A;  2QAR A;  2JV3 A;  5JTI A;  1WWU A;  3IDW A;  2QB0 A;  3BS5 A;  1COK A;  1X66 A;  4PZN A;  4NL9 C;  1DXS A;  1B0X A;  2FE9 A;  2DKX A;  2E8M A;  2KIV A;  1LKY A;  4RQM A;  1SV0 C;  5F3X B;  3KKA A;  1F0M A;  3TAD C;  3TAC B;  5KNI A;  3BQ7 A;  4NL9 A;  1RG6 A;  1UQV A;  2K4P A;  1SV4 A;  5L1M A;  1UCV A;  2KSO A;  5J8Y C;  2E8O A;  2DL0 A;  1SV0 A;  1WWV A;  2ESE A; 
#chains in the Genus database with same CATH topology
 4QZE A;  4AYB F;  4ED8 A;  3C5G A;  5IIK A;  5J0U A;  3H8S A;  5DB7 A;  1XS9 D;  4K4H A;  2JZB A;  2ZJA A;  2NYV A;  3BQ2 A;  2FLP A;  4QZH A;  4DSF A;  2JH1 A;  3VC8 A;  3MFI A;  4RUA A;  5J2J A;  4Q44 A;  4IRK A;  4F5O A;  4DFM A;  4RQ7 A;  2AJQ A;  3F2D A;  2ASL A;  3ETL A;  3N7R C;  4PL1 A;  2G06 A;  1X6I A;  2LYA A;  1ZQL A;  2IHM A;  4NWI A;  2W8L A;  1HIW A;  1MN8 A;  2W8K A;  2DUY A;  3RAQ A;  2EQY A;  2Y9U A;  3RR8 A;  1BNO A;  4ICA A;  2IBK A;  4F4Y A;  4ED1 A;  5EE1 A;  2JHD A;  2BCQ A;  3GV8 B;  3PW0 A;  5KFM A;  1ZQO A;  3ZD8 A;  3KHG A;  5TZV A;  4M9J A;  2W7O A;  3KBB A;  4UAV A;  2P6U A;  5J0Q A;  4X5V A;  2IA6 A;  5DBC A;  2HBK A;  2Z7J A;  1X6J A;  4YXM A;  5AIB A;  2LKY A;  2ODG A;  4DL3 A;  5ALS A;  4ECW A;  2DWQ A;  1RPL A;  4ED2 A;  3T3F A;  1SWW A;  4YXJ A;  3D6J A;  1NKE A;  4FFD A;  5AM1 A;  1B0X A;  2RRD A;  3HPO A;  4KX5 A;  3V6J A;  5CB1 A;  1JMS A;  4RPZ A;  3V6H A;  2HHW A;  2FI1 A;  1SL1 A;  8ICY A;  4Q43 A;  3PX6 A;  1S0O A;  3UMC A;  4B9U A;  1JN3 A;  4P0P A;  4PHP A;  3RJE A;  3I1Y A;  4EZ9 A;  2FJ6 A;  2HOI A;  3WKD A;  1RYS A;  2W03 A;  1UQV A;  3QZ8 A;  3QUB A;  2DPJ A;  2WF6 A;  5J8Y C;  4DCC A;  2ZIX B;  3NVY A;  1U4B A;  2DL0 A;  1LVH A;  4F93 B;  3HKZ F;  1PK1 B;  5KFG A;  1QSS A;  2QKQ A;  4F4K A;  7ICM A;  4TUR A;  5F9L A;  4U6P A;  2ZUD A;  3H8M A;  2ZXH A;  9ICS A;  2W9C B;  3MGH A;  1IM4 A;  1WCL A;  3V72 A;  1JRP A;  4YR3 A;  3RJJ A;  1X40 A;  3NS1 A;  3GU3 A;  2BPG A;  2G5I B;  2ZTC A;  5ALX A;  5ALN A;  5J2A A;  1HUO A;  3ORY A;  3PSF A;  3JPP A;  2L5Y A;  4RQ8 A;  4RT2 A;  5DLF A;  4EBD A;  5ALF A;  3L3F X;  5EWG A;  1OW5 A;  2DQN B;  2W04 A;  2FPL A;  4KMU A;  2MSN A;  7ICV A;  5AKG A;  1F5S A;  3BQ0 A;  8ICW A;  1JIH A;  2OWO A;  2W54 A;  2PMZ C;  3PW2 A;  1ZQZ A;  5HR7 A;  4ZOH C;  1TFR A;  5J0O A;  4O0I A;  4DL7 A;  4YVZ A;  4RPY A;  4J9S A;  2K60 A;  5HR6 A;  2Q4T A;  5CJ7 A;  1SKS A;  4UBB A;  1COK A;  1TE2 A;  5J0T A;  1A76 A;  1MQ3 A;  1UA0 A;  4OJO A;  2KNJ A;  5J2K A;  3ZD9 A;  1ZQU A;  2JGA A;  5KFK A;  4Z6C A;  4PGQ A;  2E1E A;  4KN4 A;  1F0M A;  2HBL A;  8ICI A;  5DQH A;  1ZD2 P;  2KVS A;  5KT7 A;  1S9F A;  1UT8 A;  1QTM A;  5K4L A;  5KG4 A;  2K4I A;  1NJZ A;  4RQ2 A;  2I5H A;  1X9M A;  3IP4 B;  4KTQ A;  3H8W A;  4F5P A;  4EBC A;  2KJ5 A;  4IS7 A;  5DDY A;  8ICM A;  2W7P A;  3B9J A;  3MBY A;  4QW8 A;  4F72 A;  5DBB A;  1F44 A;  1N2X A;  5J0Y A;  3CRX A;  2K4E A;  5J0P A;  5GTI U;  2YMM A;  4DQI A;  3AQE A;  1KFT A;  5KAF U;  1HJP A;  4MEX A;  2XVT A;  4WJ3 B;  5EWE A;  1KL9 A;  2ZIV B;  1Q46 A;  4UAU A;  1BNP A;  3ZDD A;  1DGJ A;  4IQW A;  2KSO B;  1QLN A;  2VKQ A;  4F92 B;  4O3S A;  1QSL A;  3PV8 A;  3TAN A;  4J9N A;  1Q8K A;  4C4R A;  1VJ5 A;  1H38 A;  1SGG A;  2EAN A;  4M2Y A;  1J97 A;  2K89 A;  3GQC A;  1ZQN A;  2Y9T A;  2YMP A;  4I2C A;  3H8J A;  2EAP A;  3NUQ A;  3BDP A;  3EUB 2;  5B5E U;  4MHV A;  3QNM A;  2F1I A;  4UB1 A;  3MR6 A;  2LBO A;  1MA7 A;  3M1Y A;  3Q8K A;  3N4M B;  2F77 X;  1ZQD A;  2P35 A;  2JRZ A;  3Q8M A;  4MFA A;  2HDO A;  2E3T A;  1U49 A;  4OD0 A;  4YD1 A;  2KD1 A;  5ALE A;  1BPX A;  2J6T A;  1B43 A;  2AU0 A;  4UAY A;  4BX9 C;  2VA8 A;  8ICU A;  2ZIW B;  3G6Y A;  3PVX A;  1D8Y A;  2E8O A;  1ZQW A;  2ZIU B;  1UT5 A;  3KHL A;  1WWV A;  3OSN A;  2VA3 A;  1RZT A;  1NJX A;  4ZH4 A;  3M9O B;  3C2K A;  2BGW A;  4RNN A;  3U26 A;  1LKY B;  2EDU A;  5HNK A;  2HI0 A;  4LJX A;  4QW9 A;  1N5X A;  4Y2Y A;  5JRT A;  5J2E A;  3M9M B;  5CR0 A;  4J9M A;  4YFK A;  3A0B U;  2R8K A;  4IRC A;  1RDF A;  2NRT A;  4CE6 A;  1K5O A;  3BJY A;  5HHH A;  5KTQ A;  4DSK A;  1ZOL A;  2F1H A;  5ALH A;  1DGS A;  5AKL A;  4QWE A;  2MUT B;  4IC9 A;  4GLX A;  1DK3 A;  2GO7 A;  1ZQJ A;  5ALT A;  4EX6 A;  2D3D A;  5EOZ A;  5CRX A;  1ZQC A;  3FC4 A;  1OXJ A;  4RQN A;  2OHF A;  3RBD A;  1L7N A;  5KT3 A;  3F5A A;  3JPS A;  4JB3 A;  5J2C A;  4FBU A;  4E0D A;  2IMW P;  2EZY A;  1NK6 A;  2W43 A;  5KFD A;  4KLI A;  2C28 A;  4FE3 A;  3RR7 A;  1ZQE A;  3BS5 A;  4ECY A;  2AXT U;  1X66 A;  3B0Y A;  3C29 A;  4NL9 C;  1PVR A;  1XO1 A;  3RBE A;  4DQQ A;  3Q8S B;  4GXJ A;  2AQ4 A;  4QZ8 A;  5KFI A;  1T8E A;  5KFQ A;  2ZXI A;  5ALW A;  4Y2Q A;  5J2I A;  3H0R B;  4NLK A;  2F8L A;  1VLB A;  2HHU A;  9ICW A;  4DS5 A;  1DOQ A;  5KNI A;  8ICV A;  1ZQV A;  2OXO A;  1ZQX A;  1FFU A;  5L1M A;  5T14 A;  1HUZ A;  3AU6 A;  2R8I A;  4ECR A;  3OGU A;  2WF5 A;  5DKW A;  1ZRN A;  1KSP A;  3QUQ A;  1Z00 A;  3SYZ A;  1FEZ A;  4ECX A;  5KFS A;  1WCN A;  3E58 A;  4JV1 A;  1S77 D;  4PHE A;  2DBY A;  4P2H A;  3RJK A;  4KLL A;  4KLM A;  4P0P B;  2QAR B;  3LYS A;  4P0Q B;  1B4F A;  3T5J A;  1SZH A;  2D8C A;  5AI6 A;  3WK8 A;  5L1L A;  2KG5 A;  3NRW A;  3AL0 B;  4QZA A;  4NLZ A;  2NRX A;  5CWR A;  8ICR A;  5KT4 A;  4GXK A;  1NK4 A;  1NZB A;  2BR0 A;  4QZI A;  5AI8 A;  2YTU A;  2HHQ A;  1J2N A;  4Q45 A;  4OJ6 A;  4DQP A;  1X9X A;  4ACO A;  4F2R A;  1Z4N A;  3CP8 A;  5KG3 A;  3PO5 A;  5C0Y A;  3PW7 A;  2EAM A;  4B9N A;  5ALL A;  7ICQ A;  1MQ2 A;  4YG2 A;  3OJS A;  3C21 A;  5J2F A;  3MDA A;  2EAO A;  2DGZ A;  1KRP A;  1M6Y A;  5KT6 A;  3RB6 A;  2PFO A;  2QB0 A;  2Y0S F;  2ZJ5 A;  1IV8 A;  2KOB A;  4I27 A;  2RHF A;  4EEN A;  8ICT A;  2H3V A;  4C4S A;  4FZN A;  2WF9 A;  3RB3 A;  3KD3 A;  4FO6 A;  3C1Y A;  1NKB A;  2HBJ A;  4GFJ A;  1AQ6 A;  1B22 A;  2KFZ A;  3OHB A;  3BZC A;  1NK8 A;  3AU2 A;  5KFL A;  2YQE A;  1UCV A;  4CF4 A;  2VAN A;  4UBC A;  1NK5 A;  4JV2 A;  1ZJN A;  2F1J A;  8ICG A;  3QU5 A;  5AKH A;  4UQG A;  2KHQ A;  3JPO A;  4Y2X A;  4QZG A;  3AN1 A;  5KG2 A;  2XY7 A;  4C0Z A;  5JU5 A;  1JXL A;  3OSP A;  4DO9 A;  3L4P A;  3PNC A;  2LYB A;  3IHQ B;  1PVQ A;  1PVP A;  3GFK B;  4UAZ A;  4MEY A;  4P4P A;  1Z4O A;  3AQF A;  2KN7 A;  5AI0 A;  5J8Y A;  4F50 A;  1BPZ A;  1XU4 A;  5ALI A;  1MC8 A;  7ICN A;  3DDH A;  3NRZ A;  4Y2U A;  4Z6F A;  4FS2 A;  9ICM A;  4NJ8 A;  2GLE A;  2ALZ A;  3F5E A;  3RH5 A;  2YB4 A;  3UXO A;  2PKE A;  4M9H A;  2W11 A;  3CW2 C;  5D4B A;  1ZQG A;  2DKZ A;  2BZF A;  1SXE A;  2XID A;  2BPC A;  4O3N A;  2FDR A;  2RDI A;  2A3V A;  2G5H B;  1L3V A;  4NY8 A;  4I2J A;  3LK9 A;  4XA5 A;  3R9K A;  1ZXI A;  4IL6 U;  5E79 U;  4OO1 J;  5DLG A;  5DG8 A;  8ICA A;  5KFA A;  3QXG A;  4PZN A;  2AHO B;  2H3Q A;  2KKV A;  5BOL A;  2HMX A;  4C8O A;  4I2B A;  1KFD A;  5B66 U;  2KJ8 A;  1NNL A;  3LVV A;  1BGX T;  4M6W B;  3KZX A;  1S97 A;  1LV5 A;  1COO A;  2XC9 A;  5CA7 A;  1P7D A;  4ED3 A;  2NO4 A;  1L3U A;  3O0F A;  5IIN A;  4B9L A;  5KT2 A;  1XO0 A;  4PPX A;  2HW3 A;  4QWB A;  1PUZ A;  2G07 A;  2BQU A;  3KOO A;  9ICL A;  1ED1 A;  3EWA A;  3WK5 A;  1N60 A;  3EPI A;  1XSN A;  4B9V A;  3ICX A;  4NXZ A;  3ALR A;  4DL4 A;  1SXD A;  1VDV A;  5AI4 A;  4F3O A;  5AI9 A;  5ALV A;  4DSE A;  3BS7 A;  5DGA A;  4YMN A;  3EZ5 A;  1BPY A;  4P4O A;  5H2F U;  4C8L A;  4AP9 A;  5J2G A;  2BPF A;  5CEH A;  2F3N A;  2ZG6 A;  9ICN A;  2J6S A;  3GIM A;  2B6G A;  2HCF A;  4KN7 A;  5L1I A;  2KE7 A;  1JAL A;  9ICP A;  1ZRM A;  1C7Y A;  5CHG A;  4M04 A;  3TFS A;  1V9P A;  5KFU A;  2ZUC A;  1ZQH A;  7ICT A;  3KKA C;  5ALR A;  4ECT A;  2R8J A;  4IQV A;  5EWF A;  4NLB A;  3H0L B;  1BVS A;  3IN5 A;  1ZET A;  3I76 A;  2PFN A;  4BXO A;  2UVW A;  4NM1 A;  3MR2 A;  2R8H A;  1SV0 C;  2UVU A;  3M6Z A;  2XO7 A;  2ISO A;  9ICF A;  2JEI A;  2G09 A;  2M9N A;  2JMG A;  3LDA A;  1LB2 B;  2HHT A;  4KLH A;  2G0A A;  2IOF K;  3Q8L A;  5KG0 A;  1L8L A;  3BQ7 A;  4DFD A;  2WTF A;  1KDH A;  2BDP A;  4O5E A;  3BS5 B;  3B0X A;  3JPQ A;  7ICK A;  4DLG A;  3V7K A;  2HVH A;  4TQR A;  4C7Y A;  5C5J A;  5KFW A;  4PGY A;  3K4G A;  1KFS A;  4DOB A;  5KT5 A;  3WKE A;  4DQS A;  1RQN A;  3TAQ A;  1ZJM A;  1QCK A;  3RJI A;  8ICK A;  5ALO A;  3T5L A;  4KX3 A;  4YQW A;  2LMR A;  9ICU A;  3K75 D;  4BUG A;  3G6X A;  4ELT A;  3V7L A;  2YML A;  3RRG A;  2QB1 A;  1Z00 B;  4QZ9 A;  2PMZ F;  4YP3 A;  3F2B A;  4PZO A;  2BHN A;  2JEG A;  2ZUB A;  1N63 A;  2NV3 A;  1PZN A;  4JV0 A;  4KLU A;  1A0P A;  3SMV A;  2GWS A;  4ED0 A;  2A1J B;  3L5K A;  4J9K A;  1T7P A;  1N62 A;  1D8L A;  4O3M A;  4QZF A;  4TUP A;  3UXP A;  4B9S A;  4EX7 A;  5TIS U;  3UQ0 A;  3SZ2 A;  3GV5 B;  8ICQ A;  1CUK A;  3UXN A;  4QWA A;  2VIX A;  4RQ6 A;  4CRX A;  1KLN A;  4F2S A;  2HBM A;  4F5R A;  5F3X B;  4EEL A;  3WK9 A;  4BJQ A;  4EYH B;  2P6R A;  8ICL A;  3PZP A;  8ICN A;  5KG7 A;  4RQ4 A;  4LZG A;  1L6N A;  3PO4 A;  5IIM A;  4NL9 A;  5J0S A;  1T3Q A;  2UVR A;  4KLG A;  1D8B A;  5KFR A;  4UAW A;  4O9M A;  5AM4 A;  3V6K A;  1CRX A;  5IIO A;  4OCZ A;  1TK0 A;  4HYK A;  2FMQ A;  1QH9 A;  4UB3 A;  1BPE A;  2PFQ A;  2CN1 A;  2KTQ A;  1UHU A;  5J2H A;  5D49 A;  2KJ9 A;  4R65 A;  3IM1 A;  4ECU A;  1MSW D;  4RU9 A;  4KLS A;  4R8U A;  2KIW A;  2AH5 A;  2JH7 A;  4J9O A;  1HEK A;  8ICB A;  2JEJ A;  2ZIX A;  1K1Q A;  3MFH A;  3IG5 A;  4PHD A;  5KFH A;  1NK0 A;  1ZQA A;  1PK1 A;  1TKD A;  3M8R A;  1WUD A;  1D9D A;  2VJ5 A;  3Q8R B;  8ICH A;  5KG1 A;  9ICQ A;  2FPM A;  4O3R A;  4BWM A;  4NLG A;  4R64 A;  2BDU A;  1WWU A;  3A0H U;  1S76 D;  1KBU A;  4M0A A;  2JZB B;  2QLT A;  1TV9 A;  9ICO A;  2E8M A;  4RZR A;  4ECQ A;  2ZJ8 A;  4DF4 A;  3PR5 B;  1U45 A;  3GII A;  2MU2 A;  2K8B B;  5DB6 A;  3RJH A;  3MGI A;  3SQI A;  4JK1 A;  1RM6 C;  1Q3V A;  2O6K A;  4BWJ A;  4M9L A;  4YR0 A;  5AM2 A;  2PFP A;  3PW4 A;  4YN4 A;  3Q8Q B;  4Q8F A;  9ICA A;  2JXJ A;  2AGP A;  1KEJ A;  2Q0Z X;  1X9W A;  2OYY A;  5AM3 A;  3AUO A;  2KHV A;  3WK6 A;  1ZYQ A;  4OJL A;  4A8E A;  3M9N B;  3RTV A;  1SKW A;  5D46 A;  4O5K A;  2P66 A;  2CXY A;  4PJ0 U;  5AK5 A;  2CPR A;  5AKZ A;  8ICZ A;  3MDC A;  5L1K A;  4EBE A;  1WG8 A;  2IOH A;  4G9B A;  3SEN A;  2MRL A;  4XRH A;  3QUC A;  2WHE A;  3KHR A;  3QYP A;  4TUQ A;  2R8G A;  1DK2 A;  3FM9 A;  4EEY A;  4UW9 A;  4GC6 A;  4Y2J A;  3SI8 A;  8ICS A;  4Y2P A;  2FLN A;  4U7C A;  2MAX A;  1ZQB A;  2BQR A;  3M8S A;  1PK3 A;  4GXI A;  5KL8 B;  3IRU A;  4ECS A;  3ZDE A;  2BCV A;  3ZDC A;  2LI6 A;  3PX0 A;  9ICT A;  2XCA A;  3NVW A;  2LYH A;  3LWL A;  2HHV A;  1L7P A;  4R66 A;  1RXV A;  2J6U A;  2RDJ A;  5ALQ A;  3UM9 A;  5AKK A;  3MR3 A;  2FE9 A;  5IIJ A;  1QQ5 A;  4DFK A;  2XCP A;  4KLJ A;  4I2H A;  4CF3 A;  1IG6 A;  3ISB A;  4NLN A;  5KG6 A;  5HMM A;  7ICO A;  4RUC A;  1DRG A;  4Z6E A;  3WKB A;  3N97 B;  4US8 A;  2EZZ A;  3OHA A;  3TAR A;  3RH4 A;  4BDP A;  5KFZ A;  4RQ5 A;  3EYZ A;  1TAQ A;  4MF8 A;  1T94 A;  3S6J A;  3VCB A;  3PX4 A;  4NM2 A;  2OCE A;  1SIJ A;  4Z6D A;  3NTU A;  2KIC A;  2HVI A;  2WAQ C;  5J2B A;  2V9W A;  1A77 A;  5HML A;  5AK4 A;  4I2E A;  3KFU F;  3JPN A;  1JX4 A;  2XGP A;  4C8M A;  4AYB C;  9ICR A;  2RLT A;  4C4T A;  7ICE A;  5ALP A;  3PMN A;  2ASD A;  4DSL A;  3QU9 A;  3TFR A;  5KFX A;  1QSY A;  9ICI A;  4ELU A;  2ZIW A;  4R63 A;  5AKY A;  2A19 A;  4DWI A;  3NAS A;  2NRZ A;  2ZIU A;  3F2C A;  8ICE A;  2M0N A;  3ED5 A;  2KEY A;  4C80 A;  4FS1 A;  4JUZ A;  2W9B A;  3WK7 A;  4QWD A;  3GDX A;  4Q8E A;  3TI0 A;  1KW4 A;  1FO4 A;  2EH9 A;  3RRH A;  1O08 A;  5HHI A;  4YR2 A;  5AIA A;  4O3P A;  3N28 A;  4UB6 U;  2PXI A;  1S0M A;  2R18 A;  4F8R A;  3BQ1 A;  2AQ0 A;  1V38 A;  1NK7 A;  2NRW A;  5DQG A;  3UPQ A;  2DFL A;  2WAQ F;  4I28 A;  1DXS A;  1FFV A;  4QJF B;  4BGD A;  5JUM A;  1ZQI A;  1S0N A;  4F5Q A;  4J9L A;  2MUT A;  5AM5 A;  3WKC A;  2OM6 A;  5FP0 A;  1ZQQ A;  3KKA A;  3TAD C;  1N5W A;  4RNO A;  2GH1 A;  3TAC B;  4DOA A;  9ICH A;  2F76 X;  4YMO A;  3RB4 A;  3WKA A;  3QU7 A;  7ICI A;  2K4P A;  2LM4 A;  5F9N A;  9ICC A;  5DG9 A;  1SV0 A;  2RP5 A;  3QEA Z;  4QZD A;  1ZQM A;  2KV2 A;  4J9Q A;  3I28 A;  5AKE A;  5DB9 A;  4LVS A;  1JUD A;  7ICS A;  3D2S A;  3OJU A;  3JPR A;  4ELV A;  3M6K A;  3JPT A;  2H3Z A;  3HKZ C;  2E5S A;  2B21 A;  2BCU A;  4Y2R A;  8ICC A;  2VJ4 A;  1XSP A;  1Q3U A;  3E0F A;  4QZC A;  5IIL A;  5J2D A;  1KQQ A;  3SAF A;  4PH5 A;  5ALM A;  1K1S A;  4KMO B;  4KIT B;  4J9P A;  1U47 A;  4TUS A;  4M9N A;  4Y2T A;  5G5G A;  2AGQ A;  1IXR A;  3KTQ A;  3RH6 A;  4EZ6 A;  2ISP A;  4K4I A;  3K1Z A;  4PGX A;  1ZQY A;  8ICX A;  5J29 A;  1SB3 C;  3PW5 A;  5A0L A;  1X2I A;  2I9G A;  3N7S C;  1CI4 A;  3AM9 A;  2IOF A;  3PY8 A;  2KP7 A;  4DL2 A;  4YMM A;  1OUQ A;  1QQ6 A;  2QAR A;  4DLE A;  3DEE A;  4P0Q A;  5EE0 A;  3WU2 U;  5DDM A;  4GIB A;  3IDW A;  5DBA A;  1XNS A;  4R8U B;  1IIP A;  4I2A A;  2YMQ A;  7ICL A;  5J0R A;  2W3R A;  5KFF A;  7ICP A;  2RQ5 A;  2K8A A;  3SV3 A;  1KKX A;  4UAS A;  5ALK A;  1YZ7 A;  3FDS A;  3CNH A;  2KZZ A;  5ALG A;  1YT3 A;  2KFN A;  3BQT A;  2DF4 B;  4JWN A;  4M9G A;  9ICV A;  1S0V A;  4CDG A;  2YN4 A;  2WF8 A;  3HT3 A;  3E2E A;  4DFP A;  2KK0 A;  2KKP A;  2W55 A;  1RYU A;  1SWV A;  2ESE A;  9ICK A;  3ZI4 A;  4UAR A;  4ED7 A;  4ECZ A;  2BCR A;  3D2N A;  4F91 B;  3HJE A;  3ETR A;  4UB4 A;  1UA1 A;  4KLO A;  2I6X A;  2PI4 A;  4KLE A;  4K4G A;  3AEV A;  3HW8 A;  5AI5 A;  4Y2S A;  4YCX A;  5KFB A;  3GIJ A;  2FLL A;  1ZQT A;  4EYI B;  3J81 j;  5ALD A;  4OJ5 A;  3HRD D;  5KAI U;  5AM0 A;  7ICH A;  3QUT A;  2AGO A;  2IHN A;  4C8K A;  4PHA A;  1Z1V A;  9ICX A;  4JWM A;  5BPC A;  1A6S A;  2YB1 A;  5AKX A;  4I2D A;  2F2A B;  4O3Q A;  3RJF A;  4DS4 A;  2H3F A;  3OPX A;  2LPE A;  3QU2 A;  4O5C A;  4IQU A;  3MGV A;  4NLC A;  5HP4 A;  2HHS A;  1X9S A;  1S5L U;  2FMP A;  1JI7 A;  2E1F A;  4I2I A;  4OJP A;  2ES6 A;  7ICR A;  5ALJ A;  4HAI A;  4F5N A;  5JTI A;  4B6J A;  3N7P D;  1TK5 A;  4Y2V A;  3FAH A;  1N56 A;  2DKX A;  4RQM A;  5AKJ A;  2ZTD A;  4RT3 A;  3MC1 A;  2D6F C;  4CGZ A;  3WK4 A;  7ICG A;  4FZL A;  4CF5 A;  5BOM A;  2NO5 A;  4DF8 A;  4KLF A;  4F4Z A;  4FBT A;  5J0X A;  3C23 A;  2W3S A;  1J2M A;  4KLQ A;  3G6V A;  3RFA A;  2BKE A;  1RG6 A;  3BZK A;  1TK8 A;  2VA2 A;  1NJW A;  2C2D A;  5KG5 A;  4QNL A;  4XUS A;  5AK6 A;  3EPG A;  4KLT A;  4US9 A;  4KLD A;  3QEB Z;  2C2R A;  4LZD A;  1ZD5 A;  1S10 A;  2FMS A;  3TQ1 A;  5L1J A;  3NVV A;  2OH2 A;  1NJY A;  1L5U A;  1SL0 A;  2ASJ A;  4M6W A;  4DL5 A;  2HOF A;  4PL2 A;  2XY5 A;  3QU4 A;  3IV6 A;  4RQ3 A;  3TAP A;  1XSL A;  3F53 A;  1TAM A;  4I2F A;  1O03 A;  2EZX A;  2QB0 B;  3QE9 Y;  4J9R A;  3ZDA A;  4CCH A;  4F4X A;  3HP6 A;  2F8K A;  3IG8 A;  1ARO P;  1ZD4 A;  2E8N A;  4RPX A;  1NI3 A;  3SEI A;  4G3I A;  3QZ7 A;  5KFC A;  2FPK A;  3HWT A;  3MR5 A;  4C7Z A;  2CRX A;  1Z3E B;  5EE9 A;  4UB5 A;  2MA1 A;  1KN5 A;  2WF7 A;  5KFJ A;  2XGQ A;  4I29 A;  2LM1 A;  2H3I A;  3H7I A;  4UAT A;  1ZQ1 C;  3RF9 A;  5J0W A;  9ICG A;  4C8N A;  1U9L A;  2W9C A;  2W9B B;  5EE3 A;  4DL6 A;  2UVV A;  1N61 A;  1V97 A;  4CNQ A;  1NOM A;  1ZD3 A;  2B0C A;  4USA A;  3ZDB A;  1CEZ A;  2G08 A;  4IR1 A;  3M7D A;  2LHT A;  3V7J A;  2A1A A;  5G5H A;  2C22 A;  2NRV A;  2XY6 A;  2KMD A;  8ICO A;  2GOL A;  4MFF A;  3DV9 A;  5AKI A;  5ALY A;  3PSI A;  3C2L A;  3SD7 A;  2XIC A;  4DQR A;  1ECW A;  1BPD A;  3GV7 B;  3T5K A;  1T3N A;  1SZP A;  4M47 A;  1UPH A;  1RXW A;  3H40 A;  2YY6 A;  4ED6 A;  4F71 A;  1N48 A;  2HSZ A;  3C2M A;  3T79 A;  1GO3 F;  2JEF A;  4TQS A;  4UB8 U;  1C20 A;  3SAG A;  1JRO A;  8ICF A;  3RJG A;  3K1R B;  7ICU A;  3GZF A;  5KFT A;  3PR4 A;  1S8O A;  2HOQ A;  2KZ3 A;  4F4W A;  3ISD A;  1Y88 A;  3LWM A;  2JR5 A;  5GTH U;  2ATL A;  3GIL A;  2Y1I A;  4DSJ A;  5KFN A;  4NV0 A;  5ALU A;  2V4Q A;  5DGB A;  1KTQ A;  3ISC A;  4ECV A;  9ICE A;  3SV4 A;  4QIW C;  1WYG A;  2JV3 A;  2XI9 A;  3H0M B;  4O3O A;  5L9X A;  1ZQP A;  4J03 A;  3Q8P B;  3SR6 A;  1Z1B A;  4MFC A;  4RQ0 A;  1TVA A;  2Y0S C;  1EXN A;  1ZQR A;  3UMB A;  4QZB A;  3PML A;  3C5F A;  5KL1 B;  3PSP A;  2YX8 A;  3GIK A;  1RYR A;  2ZIV A;  1L3T A;  4UB2 A;  1XWL A;  4DFJ A;  2WB1 C;  1X42 A;  4IQT A;  2KSO A;  2A1J A;  3THV A;  5CP2 A;  4YD2 A;  3NVZ A;  1ZQF A;  5AIC A;  2I1Q A;  5KFY A;  3RAX A;  1ZQS A;  3UMG A;  9ICJ A;  4IRD A;  2BCS A;  1U48 A;  3ONN A;  5KFP A;  1NK9 A;  3QX7 A;  3RB0 A;  3TAD A;  4B9M A;  4I2G A;  3MAB A;  1V85 A;  1YZ6 A;  1BPB A;  4QIW F;  1XC9 A;  3T5H A;  2K4H A;  9ICB A;  3HIL A;  1T4G A;  5AK3 A;  3H4D A;  4B9T A;  4DOC A;  3TKA A;  4BXO B;  2E8P A;  5ALZ A;  2KVC A;  1TAU A;  3KZI U;  4P4M A;  2KZM A;  5KFE A;  3CYM A;  2W9M A;  3NGD A;  5DB8 A;  3C1Z A;  7ICJ A;  7ICF A;  3PST A;  2BQ3 A;  4QWC A;  1L8O A;  2N1R A;  3FYH A;  1NKC A;  3D2Q A;  4IR9 A;  4FZM A;  2F44 A;  3KHH A;  5KFO A;  1D9F A;  4DSI A;  1L7O A;  2PI5 A;  1RQL A;  1SKR A;  2WB1 F;  2C2E A;  4GC7 A;  1SL2 A;  2HHX A;  3C28 A;  1URJ A;  4MF2 A;  3HX0 A;  3H4B A;  1QQ7 A;  4JMU A;  2WFA A;  1L3S A;  2OEH A;  4RQ1 A;  3LVW A;  4EEK A;  5AHX A;  3AMZ A;  3SAH A;  1JXE A;  3OTQ A;  2W9A A;  4DEZ A;  1FIQ A;  4RNM A;  1L7M A;  1LKY A;  2KIV A;  3UQ2 A;  2Y1J A;  5III A;  2DPI A;  5KFV A;  1ZQK A;  2V4R A;  2K8C B;  2H5X A;  3EW9 A;  5DQI A;  1Z19 A;  1SV4 A;  1NZP A;  8ICJ A;  2ZTE A;  4XQ8 A;  8ICP A;  5DG7 A; 
#chains in the Genus database with same CATH homology
 3BS5 B;  2KMD A;  4IS7 A;  1PK1 B;  2QKQ A;  1LKY B;  3H8M A;  5JU5 A;  3TAD A;  5JRT A;  1SXD A;  1V85 A;  1X40 A;  5J8Y A;  2QAR B;  3BS7 A;  3HIL A;  3SEN A;  1B4F A;  2LMR A;  2QB0 B;  2D8C A;  2L5Y A;  2KSO B;  1Z1V A;  2KG5 A;  2E8P A;  2Y9U A;  2F8K A;  4NJ8 A;  3K1R B;  2E8N A;  2GLE A;  2QB1 A;  2F3N A;  3SEI A;  1OW5 A;  1SGG A;  2EAN A;  2YTU A;  4PZO A;  1PK1 A;  2B6G A;  1X9X A;  1PK3 A;  2LPE A;  2D3D A;  2DKZ A;  2F44 A;  2Y9T A;  1KW4 A;  2KE7 A;  1OXJ A;  2EAP A;  1SXE A;  4RQN A;  2EAM A;  4MHV A;  1JI7 A;  2ES6 A;  1V38 A;  3KKA C;  2EAO A;  2K60 A;  2QAR A;  2JV3 A;  5JTI A;  1WWU A;  3IDW A;  2QB0 A;  3BS5 A;  1COK A;  1X66 A;  4PZN A;  4NL9 C;  1DXS A;  1B0X A;  2FE9 A;  2DKX A;  2E8M A;  2KIV A;  1LKY A;  4RQM A;  1SV0 C;  5F3X B;  3KKA A;  1F0M A;  3TAD C;  3TAC B;  5KNI A;  3BQ7 A;  4NL9 A;  1RG6 A;  1UQV A;  2K4P A;  1SV4 A;  5L1M A;  1UCV A;  2KSO A;  5J8Y C;  2E8O A;  2DL0 A;  1SV0 A;  1WWV A;  2ESE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...