4NL9A

Crystal structure of the human anks3-sam/anks6-sam heterodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
APYSGPQDLAALLEQIGCLKYLQVFEEQDVDLREFLTLTESDLKEIGITLFGPKRKMTSAIARW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 18
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nl9A01
2QB1A 1SXDA 3BS7A 3HILA 2B6GA 5F3XB 2QARA 1SV4A 3SEIA 2QB0A 3KKAC 2LPEA 2D8CA 1LKYB 1X9XA 2KIVA 1Z1VA 2KE7A 2Y9TA 2KMDA 3IDWA 3SENA 4NL9A 1COKA 2EAOA 2ESEA 2F8KA 2LMRA 1KW4A 5JRTA 1WWVA 1SV0A 4MHVA 2K60A 2D3DA 1B0XA 2GLEA 1V85A 2E8NA 2DKXA 3K1RB 3TADC 3BS5B 2DL0A 1OXJA 5KNIA 2L5YA 1LKYA 2KSOB 5J8YC 3BS5A 4RQNA 1V38A 1X40A 4IS7A 1RG6A 1PK1B 5JTIA 1SV0C 2ES6A 2KG5A 2JV3A 1UCVA 2F44A 2Y9UA 1B4FA 2EAPA 2E8MA 2QARB 4PZNA 1PK3A 1WWUA 2QB0B 2E8OA 2EAMA 3TACB 4PZOA 4NL9C 5JU5A 3H8MA 2DKZA 4NJ8A 1JI7A 1F0MA 1DXSA 1SGGA 2KSOA 2F3NA 3KKAA 1X66A 2K4PA 3BQ7A 1PK1A 3TADA 2E8PA 2FE9A 1SXEA 2EANA 1UQVA 4RQMA 2YTUA 5L1MA 2QKQA 1OW5A 5J8YA
chains in the Genus database with same CATH superfamily
3BS7A 3WK6A 3Q8LA 3SV4A 4CF3A 5BPCA 4DCCA 3RB4A 1LKYB 1NOMA 5KG0A 5J0PA 1ZXIA 4XA5A 5DGBA 3PX6A 4J9PA 5KFNA 4M47A 3H7IA 2EZZA 4UB5A 2I6XA 3QUCA 3SR6A 4P0PB 4IC9A 3HT3A 3NTUA 4YFKA 8ICFA 1RPLA 1NZBA 2ZUDA 1BVSA 5IIMA 4Z6FA 3OJUA 1L3SA 2K8BB 3GZFA 4JV0A 4MHVA 8ICEA 4RQ0A 2BZFA 1V85A 4KN7A 2E8NA 1Y88A 2IMWP 4ECSA 3UMBA 3EYZA 5DGAA 1ZQWA 3GIJA 2ATLA 1RYUA 2H5XA 3NS1A 4M9HA 3TFRA 3M1YA 3JPRA 3EPGA 2H3VA 2ODGA 1N5WA 3ZD9A 1ZJNA 2VJ5A 1ZQYA 4KLMA 3NRZA 4ECRA 1SWWA 2ES6A 4BGDA 4M9LA 4NLKA 5CR0A 1J2NA 1TK0A 1MQ3A 4NLNA 2IOFA 4DL2A 2LI6A 4ECTA 5ALKA 4HYKA 2PFPA 5B66U 1S0NA 3WKAA 1WYGA 2YN4A 4R65A 5J0QA 3BZKA 1S9FA 1KN5A 5KFHA 4UQGA 3I1YA 3MFIA 2LKYA 4YN4A 4AYBF 4IQTA 1JI7A 3SMVA 2JRZA 2CN1A 1OUQA 1QQ5A 4GLXA 1SXEA 5KTQA 4RUCA 1ZQVA 3UPQA 5CJ7A 4ECZA 2GO7A 5AIAA 3KHGA 2R8KA 2QARA 4J9RA 2XY5A 9ICLA 4RQ7A 1F5SA 4FS2A 1TKDA 3QZ7A 3T3FA 2RDIA 1KLNA 5AKGA 4F4XA 2NRTA 3NVWA 4C8KA 4M6WA 1ZQQA 2Y0SF 2G5HB 2RHFA 5HR6A 1COKA 2Q0ZX 2HOFA 8ICTA 9ICMA 4UAYA 4DF4A 1B43A 2ZIUB 1XSPA 1KSPA 4OD0A 2G0AA 5J2AA 3BJYA 2VA3A 5IINA 3RAXA 1ZQFA 4F5PA 1ZETA 5KFRA 2J6TA 2BGWA 3RJIA 4PJ0U 4B6JA 2LM4A 4R66A 5ALNA 2YMMA 5KFSA 4QWAA 4KLJA 2UVUA 3FDSA 3IG5A 3GQCA 5JUMA 5EE1A 1CEZA 4C8NA 4DOBA 4F72A 3WK9A 2R8HA 2YMPA 4O5CA 1C20A 3BQTA 5ALHA 2QB0B 2OWOA 5IIIA 3H8MA 4O3PA 4EBDA 3GILA 1ZQEA 2KOBA 2NV3A 4YCXA 4QWCA 1XSNA 4CCHA 1TK5A 3T5LA 3I76A 1NK4A 3ZDBA 4C8LA 3ZD8A 1RZTA 4DFJA 1X6IA 1XWLA 1S0VA 4KMOB 4RQMA 5AKYA 4QWEA 5KFMA 7ICQA 1SXDA 2E5SA 3BQ2A 4ELTA 9ICVA 5KG6A 1CUKA 1NKCA 2W3RA 1Z00B 1ZQRA 2F76X 4WJ3B 3L4PA 4YP3A 2DF4B 4KLQA 4OJPA 4E0DA 1J97A 1U4BA 2ZXIA 2OCEA 3DDHA 1SIJA 2F8LA 1SKWA 4HAIA 2W9CB 2R18A 4LZDA 4NL9A 2KTQA 5CP2A 4RPZA 3QE9Y 4UW9A 3RFAA 2CXYA 2H3ZA 1L8LA 2HMXA 4M9GA 3D2QA 1XO0A 2GWSA 3QU9A 2N1RA 2ZG6A 3QXGA 3PW2A 5KFKA 1TE2A 3BS5B 4C4RA 2ZIUA 5KG5A 3V6JA 2CRXA 2W9BB 4KLOA 5DQGA 2C22A 3LWLA 3V6HA 1L5UA 2EQYA 4UB6U 4USAA 2PI5A 5DB8A 3EZ5A 1S76D 1ED1A 4MF8A 4TURA 4DQIA 5AHXA 1HUZA 2HHXA 1S10A 1SB3C 4F2SA 4G3IA 3MDCA 1L3UA 4Y2TA 1KEJA 3AN1A 9ICRA 2FPKA 5AI5A 3RH6A 5KFXA 3S6JA 5IIJA 4NM2A 4QZ8A 2XC9A 4NL9C 4KLLA 4F5RA 3HP6A 3RH5A 3ISBA 1C7YA 3H8WA 4DL5A 4QZCA 3TKAA 5DDMA 2RDJA 9ICPA 4XRHA 4I2IA 3TADA 1ZQCA 2PFNA 3C2KA 4F92B 3OSNA 9ICBA 4YG2A 4DLGA 3GV8B 3F5EA 1X2IA 3CYMA 4Q45A 2JR5A 4PGXA 1OW5A 5J0RA 1NNLA 4J9SA 4AP9A 3HILA 2D6FC 1TAMA 1TAQA 3C1ZA 3NUQA 3PX0A 1L3VA 2KD1A 2FLPA 4DO9A 8ICWA 3N7SC 1ZRMA 4Y2UA 4R63A 2Y9TA 5KFPA 3GDXA 1Z00A 1JUDA 4JMUA 1D8YA 4B9UA 2WAQF 3PR4A 5HR7A 5IILA 5KFYA 2LMRA 4O3SA 3OTQA 1NK0A 2W3SA 2D3DA 3K1ZA 5EWFA 5J2KA 3A0HU 1D9FA 4JK1A 3TADC 3F2DA 2GH1A 5TISU 3MR6A 4KLEA 4UBCA 5ALWA 3UM9A 3QZ8A 1FFUA 4ELUA 4NLBA 3BS5A 4QJFB 1RYRA 5AI4A 5KG4A 5KFEA 4JUZA 5JTIA 4P0QA 1SV0C 5ALPA 4QWBA 8ICIA 4ED3A 4I2AA 2HHUA 2WHEA 5ALYA 2FMQA 1KKXA 5DBBA 3O0FA 3G6XA 4GC7A 3ZI4A 4X5VA 4B9SA 3ETLA 3MR2A 1QH9A 5K4LA 5AI6A 2C2EA 1WWUA 1IV8A 1U48A 3T5JA 1ZQXA 4YQWA 2AQ0A 4MEXA 1QSSA 1FIQA 1JROA 2KP7A 2KVSA 2KHVA 4KLIA 4ECVA 5D49A 4RPXA 7ICKA 3C1YA 1WCLA 4FZMA 3H40A 5J29A 5CWRA 5AK6A 2AU0A 4QZ9A 2LBOA 2K8AA 8ICZA 1T4GA 1TV9A 9ICJA 2A3VA 3EW9A 2I5HA 1S77D 3G6YA 1SV4A 4FS1A 5CEHA 3PZPA 1TFRA 4OJ5A 3QU7A 2KIVA 1Z1VA 5ALXA 5ALIA 2Y1IA 1XO1A 3M8RA 4BDPA 3Q8PB 4I2EA 2HHVA 4KITB 1HEKA 4EX6A 1WG8A 3SI8A 3PSFA 3E0FA 2B21A 2AHOB 4ED1A 2W8KA 4DFPA 2AGOA 5EWGA 4DS5A 1TVAA 1MSWD 1B0XA 3AMZA 2V9WA 2F1JA 3RRHA 2BPCA 4GXKA 2DL0A 3RBDA 5CB1A 2WTFA 1NJZA 2ZTEA 1P7DA 4DL4A 8ICQA 4YR0A 1A77A 2KSOB 1EXNA 1N62A 2ZJAA 3L5KA 5KFOA 1B22A 5DB6A 2JH1A 1V38A 3LVWA 2R8GA 3BQ1A 2DFLA 4TQRA 5BOMA 2JV3A 4NY8A 2JZBA 3N97B 5L1IA 2Y9UA 2DUYA 3RTVA 5KFWA 4YMMA 1NI3A 4ED2A 2W54A 2RRDA 2W11A 4J9OA 5ALOA 4IR9A 2ZIVA 2YB1A 4KX5A 8ICMA 4RQ2A 5KFJA 3TAQA 2F3NA 1S5LU 5EE0A 2J6SA 5C0YA 2OM6A 3HW8A 1PUZA 2KZMA 3GFKB 2EZYA 3B0XA 5J0TA 5L1MA 3KHHA 3Q8RB 2KJ9A 4FBUA 3D2NA 4I27A 2HHSA 4CGZA 4I2FA 5KT2A 3QYPA 3GIKA 1FEZA 2BKEA 4RNOA 4EX7A 1L8OA 2EZXA 4ZOHC 7ICFA 8ICAA 2KE7A 1ZQSA 2BQUA 5ALSA 1X9SA 2RP5A 2MUTB 4I28A 5KG7A 4F50A 3MC1A 1D9DA 7ICIA 3RH4A 3JPNA 4DFDA 1QQ6A 2HDOA 5AI8A 1SWVA 1ZQUA 3FM9A 4ECQA 1SL1A 5AM0A 4C7ZA 4QZHA 5AKZA 3M6KA 2PMZF 4O5KA 3PO4A 4IQWA 1K1QA 1NK8A 1IG6A 3MR3A 4NWIA 1DOQA 4Y2JA 4C4TA 4KTQA 2IOFK 3OPXA 5E79U 3RR8A 4NV0A 4ED8A 3AU6A 3RR7A 1BPBA 2FPMA 2GOLA 2BCSA 2M9NA 2MA1A 4PL1A 3PVXA 1L7NA 2BPFA 4PZOA 5KL1B 3RAQA 3NRWA 1ZQPA 1S0MA 4UAZA 2XIDA 1AROP 2WF9A 3AU2A 4ECWA 7ICLA 4XQ8A 3BQ7A 2ALZA 1LVHA 9ICAA 3ISDA 1L7OA 3HRDD 4CF4A 2KICA 1BPZA 2E1FA 2PFQA 4FBTA 2NRWA 1A0PA 3LWMA 1Q8KA 3ORYA 3PO5A 5ALJA 1QQ7A 1CI4A 4ICAA 4K4IA 3NASA 7ICJA 2PFOA 4J9NA 1N63A 1ZJMA 2YMLA 5DKWA 3SYZA 4B9LA 2ISOA 1ZD4A 1U49A 2G06A 2XO7A 2XGQA 7ICUA 2Q4TA 2P6RA 3VCBA 4I2CA 4TUQA 2XY7A 1BPXA 1IIPA 2KVCA 3DEEA 4B9NA 1JXEA 4F4KA 1ZD2P 5KAFU 1U9LA 4DS4A 2HW3A 4YXMA 3PSIA 4GXIA 4MFAA 1X9MA 1LKYA 1KRPA 1UT5A 4PHDA 1BGXT 5KT7A 4Q44A 2FLNA 1PK1B 3H4DA 4R64A 4BWJA 5ALFA 3EPIA 4P0PA 1UCVA 3KHLA 2XI9A 2C2RA 3OHAA 1UA1A 1A76A 2F1IA 5AK3A 2KIWA 3C5GA 1ZD5A 3OHBA 2OXOA 1ZQDA 1PVQA 4P4PA 5J0XA 5ALEA 4CE6A 5J0SA 1Q46A 3RJFA 2W7OA 2HI0A 3TI0A 5JU5A 1SKSA 5J2IA 2YB4A 1JX4A 4NJ8A 1UHUA 4I2GA 3CW2C 1SGGA 3Q8QB 3C23A 4UB1A 3OGUA 4UATA 4DLEA 1YT3A 5FP0A 2P35A 3DV9A 2G5IB 3UXPA 5KFCA 5EWEA 3PR5B 3M8SA 4FFDA 1ZQLA 3RJGA 5F3XB 3N4MB 3RJHA 4Q8FA 9ICHA 2UVVA 2QLTA 4YD2A 3N7PD 8ICRA 4EBEA 4KLGA 8ICSA 1ZRNA 2EDUA 2M0NA 5KT4A 2XVTA 3F2BA 2HOIA 2DBYA 4F5QA 3CRXA 3WK7A 2H3IA 2F8KA 2FMPA 4CDGA 3WKBA 2MU2A 4R8UB 5J2CA 5HMLA 5DQHA 3N28A 3H8SA 2G09A 2WAQC 2W8LA 1RM6C 2AJQA 7ICGA 7ICNA 3Q8MA 4B9TA 3E58A 4O3NA 1J2MA 5DQIA 1QSYA 5AIBA 1ZQGA 2ZUCA 4IR1A 4O5EA 1B4FA 2EAPA 1U47A 9ICWA 3PMLA 4YR3A 1L7PA 2JMGA 2V4QA 2A1JB 4DFMA 1N61A 1IXRA 3C28A 3TACB 2R8IA 5IIKA 5DG9A 3WK8A 4EEYA 5AM4A 4LVSA 3V7JA 4F4YA 5ALUA 5ALVA 1F0MA 5J2JA 4PHAA 2WB1F 2LM1A 7ICSA 5AM2A 4PHPA 2WF5A 3M9NB 4J03A 2HVIA 2YTUA 3QU5A 5KFZA 4I2JA 3BZCA 1QCKA 3IV6A 2KNJA 1AQ6A 2VJ4A 2HCFA 1O08A 1S8OA 2KZZA 2QB0A 1LB2B 2A19A 5BOLA 5ALDA 2WF7A 3VC8A 5CRXA 4U7CA 2ZIXB 7ICTA 3UXOA 5CA7A 1SV0A 3HJEA 5D46A 4C7YA 4DQPA 2JEFA 1Q3VA 5F9NA 2DPIA 8ICLA 4C80A 2RQ5A 3TAPA 1GO3F 1KQQA 2ZJ5A 3KOOA 5DG8A 3T5KA 1RDFA 4RQNA 1D8BA 1X6JA 3IM1A 4RZRA 4DF8A 2ZJ8A 3IHQB 4DSFA 1YZ7A 1XS9D 2ZTDA 4RT3A 4US8A 2W9CA 3PMNA 1ZQTA 1XNSA 2H3FA 3RBEA 2K4IA 1UT8A 8ICKA 3JPSA 2KK0A 4F4ZA 2E8MA 3KZXA 3PX4A 1NK6A 4Y2SA 3QU2A 5ALTA 1H38A 4F4WA 3MR5A 1KFTA 3LDAA 1V9PA 2E8OA 3HKZF 3NGDA 4M9JA 5HMMA 1PZNA 2A1JA 5HHIA 4Q43A 3AQFA 2W9BA 2LYBA 9ICKA 9ICEA 5AICA 1KFSA 2JEJA 1QSLA 4RPYA 5J0WA 4QIWF 4TQSA 4F3OA 3SAHA 4M2YA 2VA8A 1UA0A 4KLDA 4O3RA 4UARA 2XCAA 4DQRA 4MF2A 8ICBA 2KZ3A 4KN4A 4KLSA 3M6ZA 3WK4A 3PW5A 2J6UA 3RJJA 4NLCA 5ALLA 4KLFA 2JXJA 4K4HA 3IDWA 4ELVA 4M04A 7ICOA 2AQ4A 2HHWA 5KG3A 5AM5A 3OJSA 5J2FA 3C2MA 2ZTCA 4C0ZA 1SZHA 2ZIXA 1ZYQA 4M9NA 9ICSA 2BR0A 2FI1A 3KBBA 1VDVA 1MQ2A 4F91B 4FZNA 4ECUA 1YZ6A 1WCNA 3FAHA 1HUOA 5J2EA 3KD3A 3Q8SB 1NJXA 4TUSA 2IA6A 3ZDAA 3OSPA 5DDYA 3UMGA 2IHNA 2NO4A 4RQ6A 5KFFA 4EENA 4J9LA 4O9MA 1RXVA 9ICTA 3PSTA 8ICUA 4OCZA 4NLGA 4BX9C 4ED6A 3IG8A 4IRCA 4YXJA 5J0YA 3IN5A 1LV5A 1NK9A 3RJEA 1BNOA 3H0RB 3SV3A 1HJPA 4PL2A 5L1LA 3ALRA 2HHQA 4QW8A 2ASLA 1NKEA 2FE9A 3I28A 3QEAZ 3V72A 2ZUBA 4QZBA 3JPOA 3QUBA 2Y1JA 9ICUA 3WKCA 2LYAA 2AXTU 4ECYA 2KEYA 1QTMA 4O0IA 5ALQA 3M7DA 4Y2XA 4UB2A 4B9MA 4QZAA 4Y2RA 4RUAA 5KT3A 4C8MA 7ICHA 8ICNA 4AYBC 2W9AA 2EAOA 2BCRA 4UB4A 1KW4A 4F8RA 4GC6A 2RLTA 3FYHA 3ONNA 5EOZA 3M9MB 2F77X 5KFAA 3CNHA 3CP8A 5KAIU 4JWMA 3JPQA 1JRPA 5KNIA 4RQ1A 4QZFA 3KZIU 3FC4A 4JV2A 4RNNA 4Z6DA 3SAFA 5AKHA 3UQ0A 4IL6U 1X40A 1Z19A 1N60A 3WK5A 3GIIA 4LJXA 2BPGA 3NVVA 4IQUA 3IP4B 4F5OA 5AKLA 4PHEA 2IBKA 1PVRA 1RQLA 1ZQKA 3KFUF 2Y0SC 2QARB 5AI0A 5J2BA 5AKIA 9ICOA 4BXOB 3WKEA 3RF9A 2JH7A 3EUB2 3C21A 4FZLA 3AQEA 5AM1A 5KFVA 1SKRA 1JALA 1DXSA 2KSOA 2DPJA 3HX0A 1NK5A 1ZQMA 4M6WB 4QWDA 1N2XA 3N7RC 9ICGA 8ICGA 2E8PA 2DGZA 2DQNB 4YR2A 2KKVA 2MSNA 5J8YA 1BPEA 2QB1A 3NVZA 5KFGA 1JIHA 5AKXA 3E2EA 2V4RA 3V6KA 2NRXA 5C5JA 1ECWA 1ZQBA 4RQ5A 3KKAC 2LPEA 2XCPA 1UPHA 2A1AA 4OJ6A 5AI9A 4TUPA 4G9BA 4RU9A 2ISPA 3Q8KA 1T94A 5AM3A 5HNKA 3HWTA 2E1EA 4ACOA 1VJ5A 5KG1A 2ESEA 5JRTA 4QZDA 2MAXA 5AK4A 4GIBA 4BJQA 1FFVA 3A0BU 2WFAA 3QNMA 4PPXA 1URJA 2HBKA 4FO6A 2KN7A 2PI4A 4DWIA 5J8YC 2ASDA 3LK9A 4Y2VA 2PKEA 5EE3A 3R9KA 5DBAA 2XY6A 2OH2A 1RG6A 4BUGA 2MUTA 1KTQA 3EWAA 3J81j 4J9MA 2F44A 1L3TA 4CF5A 2BHNA 2HSZA 5ALMA 3L3FX 1PK3A 1ZOLA 1N5XA 2UVRA 3T79A 3LYSA 4RQ8A 8ICXA 3GIMA 1NK7A 8ICPA 1DK2A 2K4EA 2W55A 4JWNA 2F2AB 1VLBA 4BXOA 1PVPA 4YMOA 2ZXHA 2IHMA 9ICQA 4QNLA 4Z6CA 4YVZA 7ICPA 1X9WA 3H0MB 2LYHA 3LVVA 4C4SA 1RXWA 1JXLA 3D2SA 2K89A 2F1HA 1MN8A 4IRDA 2B6GA 2WB1C 5L9XA 4US9A 4YD1A 1S97A 1CRXA 1ZQNA 3GU3A 4UASA 4PGYA 5KFUA 3ZDCA 1ZQHA 1NJYA 2MRLA 2HVHA 3F2CA 1KBUA 3UQ2A 3B9JA 5CHGA 5KFQA 3MFHA 2KMDA 2YX8A 4ED7A 3PW4A 2ASJA 3SENA 5B5EU 3K4GA 4ED0A 5AK5A 3THVA 1ZQOA 2JEGA 3ISCA 1RQNA 4QZIA 3PW0A 4UAVA 1TAUA 3MGVA 2JHDA 8ICOA 2ZIWB 2GLEA 2W04A 3TANA 1T3NA 4MEYA 2P66A 2OHFA 2IOHA 3WKDA 1T7PA 1XSLA 1HIWA 9ICNA 2FJ6A 1K1SA 4Y2YA 2VA2A 4K4GA 4BWMA 3ZDEA 3SAGA 4Q8EA 4LZGA 1BPDA 1SL2A 4QZGA 4DQQA 4F71A 2XICA 5DBCA 2WF6A 5KFDA 5KG2A 3PV8A 2W03A 4F5NA 3H0LB 5T14A 2O6KA 1N48A 2C2DA 4JB3A 4O3OA 1PK1A 2HBMA 4I2HA 4NLZA 5GTHU 2VANA 4O3MA 1UQVA 2NO5A 3HKZC 2JGAA 1ZQIA 3UMCA 4EEKA 3KHRA 5EE9A 3F53A 2KJ8A 5L1KA 1ZQZA 4F93B 3TQ1A 1DGSA 1NZPA 4MFCA 3SEIA 5L1JA 2AGQA 4CNQA 4EZ6A 3QX7A 3GV7B 4EELA 5G5GA 4MFFA 4F2RA 2EH9A 5KT6A 3PW7A 8ICCA 1IM4A 1X42A 5A0LA 5HP4A 4OO1J 3V7KA 2PXIA 4QIWC 3MABA 3G6VA 5ALZA 3QEBZ 1MA7A 4P0QB 7ICVA 4JV1A 1T3QA 4Z6EA 5KL8B 4DL7A 2JEIA 3K75D 4UB8U 5KT5A 4PGQA 1DK3A 8ICJA 7ICRA 3QUTA 3RJKA 5F9LA 8ICYA 3MBYA 4J9KA 1KL9A 5KFBA 2NYVA 2L5YA 2E3TA 3AL0B 4NM1A 2ZIWA 2NRVA 3ED5A 3U26A 1S0OA 4DFKA 5IIOA 1O03A 4KLUA 1ZQJA 2B0CA 2YMQA 5AKJA 3WU2U 2BDPA 4R8UA 4PZNA 4PH5A 2WF8A 4Y2QA 4DSLA 5TZVA 5GTIU 4EZ9A 5KFLA 4B9VA 2HHTA 3B0YA 5DLFA 5AKEA 9ICXA 1SL0A 2W7PA 4DQSA 5J2HA 4KMUA 3T5HA 1V97A 2AH5A 4U6PA 2FPLA 3H8JA 2VIXA 3KTQA 1M6YA 5J2DA 4DEZA 4DSEA 4I2DA 5G5HA 3PY8A 2P6UA 4UB3A 4ZH4A 2YQEA 2HBLA 2H3QA 4DSJA 1JMSA 4DL3A 5ALRA 3PNCA 2KFZA 1X9XA 3AEVA 2G08A 3MDAA 1Q3UA 3C29A 3QU4A 4UBBA 5KFIA 2BQ3A 4IRKA 1KFDA 1WUDA 4RQ4A 8ICVA 4P4OA 2FMSA 2JZBB 4EYIB 2OEHA 3C2LA 1RYSA 1N56A 1WWVA 4KLHA 2OYYA 2K60A 1K5OA 5DLGA 2KKPA 4EYHB 1XC9A 4DSKA 9ICCA 2DKXA 2K8CB 3K1RB 2ZIVB 2BCUA 2W9MA 1BNPA 4QW9A 3HPOA 2BCQA 4RNMA 3V7LA 1BPYA 5AKKA 9ICIA 1NJWA 1NKBA 4KX3A 5DB7A 5J0UA 2XGPA 4O3QA 3JPTA 4QZEA 8ICHA 2EAMA 1D8LA 2FLLA 4GXJA 1A6SA 5KFTA 2DKZA 1Z4NA 3F5AA 2BCVA 1QLNA 4DOCA 1COOA 2KFNA 4RQ3A 3C5FA 3GV5B 1Z1BA 4CRXA 2K4HA 1X66A 2K4PA 2W43A 2PMZC 3BDPA 1TK8A 1KDHA 2G07A 4P2HA 1L7MA 2EANA 1ZQ1C 4OJLA 2QKQA 4C8OA 3TFSA 1L6NA 3RRGA 4ECXA 1F44A 3MGHA 3IRUA 2CPRA 4DOAA 7ICEA 2D8CA 2AGPA 4YMNA 4OJOA 3SQIA 4FE3A 1MC8A 3UXNA 4I2BA 2BDUA 4P4MA 1U45A 2I9GA 5J0OA 4NXZA 2UVWA 2BQRA 3NVYA 3ZDDA 4GFJA 3ICXA 2KHQA 3M9OB 1ZQAA 3QUQA 2FDRA 3ETRA 2R8JA 2LHTA 4XUSA 3JPPA 5D4BA 2NRZA 3AM9A 4IS7A 1ZD3A 3AUOA 1DRGA 5DG7A 4UAWA 1SZPA 3BQ0A 4A8EA 4J9QA 2KG5A 5DB9A 2HBJA 4IQVA 1FO4A 2C28A 1DGJA 3SZ2A 3RB3A 2KV2A 3MGIA 3RB6A 4KLTA 2VKQA 1Z4OA 1T8EA 3PSPA 3RB0A 3D6JA 1Z3EB 4RT2A 1XU4A 2I1QA 4M0AA 2DWQA 3H4BA 4DL6A 4Y2PA 5ALGA 2KJ5A 3TARA 4I29A 3KKAA 4EBCA 2Z7JA 5J2GA 9ICFA 1JN3A 4DSIA 2HOQA 5HHHA 5H2FU 1OXJA 3SD7A 2YY6A 7ICMA 4UAUA
chains in the Genus database with same CATH topology
2QB1A 1SXDA 3BS7A 3HILA 2B6GA 5F3XB 2QARA 1SV4A 3SEIA 2QB0A 3KKAC 2LPEA 2D8CA 1LKYB 1X9XA 2KIVA 1Z1VA 2KE7A 2Y9TA 2KMDA 3IDWA 3SENA 4NL9A 1COKA 2EAOA 2ESEA 2F8KA 2LMRA 1KW4A 5JRTA 1WWVA 1SV0A 4MHVA 2K60A 2D3DA 1B0XA 2GLEA 1V85A 2E8NA 2DKXA 3K1RB 3TADC 3BS5B 2DL0A 1OXJA 5KNIA 2L5YA 1LKYA 2KSOB 5J8YC 3BS5A 4RQNA 1V38A 1X40A 4IS7A 1RG6A 1PK1B 5JTIA 1SV0C 2ES6A 2KG5A 2JV3A 1UCVA 2F44A 2Y9UA 1B4FA 2EAPA 2E8MA 2QARB 4PZNA 1PK3A 1WWUA 2QB0B 2E8OA 2EAMA 3TACB 4PZOA 4NL9C 5JU5A 3H8MA 2DKZA 4NJ8A 1JI7A 1F0MA 1DXSA 1SGGA 2KSOA 2F3NA 3KKAA 1X66A 2K4PA 3BQ7A 1PK1A 3TADA 2E8PA 2FE9A 1SXEA 2EANA 1UQVA 4RQMA 2YTUA 5L1MA 2QKQA 1OW5A 5J8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB1 A;  1SXD A;  3BS7 A;  3HIL A;  2B6G A;  5F3X B;  2QAR A;  1SV4 A;  3SEI A;  2QB0 A;  3KKA C;  2LPE A;  2D8C A;  1LKY B;  1X9X A;  2KIV A;  1Z1V A;  2KE7 A;  2Y9T A;  2KMD A;  3IDW A;  3SEN A;  4NL9 A;  1COK A;  2EAO A;  2ESE A;  2F8K A;  2LMR A;  1KW4 A;  5JRT A;  1WWV A;  1SV0 A;  4MHV A;  2K60 A;  2D3D A;  1B0X A;  2GLE A;  1V85 A;  2E8N A;  2DKX A;  3K1R B;  3TAD C;  3BS5 B;  2DL0 A;  1OXJ A;  5KNI A;  2L5Y A;  1LKY A;  2KSO B;  5J8Y C;  3BS5 A;  4RQN A;  1V38 A;  1X40 A;  4IS7 A;  1RG6 A;  1PK1 B;  5JTI A;  1SV0 C;  2ES6 A;  2KG5 A;  2JV3 A;  1UCV A;  2F44 A;  2Y9U A;  1B4F A;  2EAP A;  2E8M A;  2QAR B;  4PZN A;  1PK3 A;  1WWU A;  2QB0 B;  2E8O A;  2EAM A;  3TAC B;  4PZO A;  4NL9 C;  5JU5 A;  3H8M A;  2DKZ A;  4NJ8 A;  1JI7 A;  1F0M A;  1DXS A;  1SGG A;  2KSO A;  2F3N A;  3KKA A;  1X66 A;  2K4P A;  3BQ7 A;  1PK1 A;  3TAD A;  2E8P A;  2FE9 A;  1SXE A;  2EAN A;  1UQV A;  4RQM A;  2YTU A;  5L1M A;  2QKQ A;  1OW5 A;  5J8Y A; 
#chains in the Genus database with same CATH topology
 3BS7 A;  3WK6 A;  3Q8L A;  3SV4 A;  4CF3 A;  5BPC A;  4DCC A;  3RB4 A;  1LKY B;  1NOM A;  5KG0 A;  5J0P A;  1ZXI A;  4XA5 A;  5DGB A;  3PX6 A;  4J9P A;  5KFN A;  4M47 A;  3H7I A;  2EZZ A;  4UB5 A;  2I6X A;  3QUC A;  3SR6 A;  4P0P B;  4IC9 A;  3HT3 A;  3NTU A;  4YFK A;  8ICF A;  1RPL A;  1NZB A;  2ZUD A;  1BVS A;  5IIM A;  4Z6F A;  3OJU A;  1L3S A;  2K8B B;  3GZF A;  4JV0 A;  4MHV A;  8ICE A;  4RQ0 A;  2BZF A;  1V85 A;  4KN7 A;  2E8N A;  1Y88 A;  2IMW P;  4ECS A;  3UMB A;  3EYZ A;  5DGA A;  1ZQW A;  3GIJ A;  2ATL A;  1RYU A;  2H5X A;  3NS1 A;  4M9H A;  3TFR A;  3M1Y A;  3JPR A;  3EPG A;  2H3V A;  2ODG A;  1N5W A;  3ZD9 A;  1ZJN A;  2VJ5 A;  1ZQY A;  4KLM A;  3NRZ A;  4ECR A;  1SWW A;  2ES6 A;  4BGD A;  4M9L A;  4NLK A;  5CR0 A;  1J2N A;  1TK0 A;  1MQ3 A;  4NLN A;  2IOF A;  4DL2 A;  2LI6 A;  4ECT A;  5ALK A;  4HYK A;  2PFP A;  5B66 U;  1S0N A;  3WKA A;  1WYG A;  2YN4 A;  4R65 A;  5J0Q A;  3BZK A;  1S9F A;  1KN5 A;  5KFH A;  4UQG A;  3I1Y A;  3MFI A;  2LKY A;  4YN4 A;  4AYB F;  4IQT A;  1JI7 A;  3SMV A;  2JRZ A;  2CN1 A;  1OUQ A;  1QQ5 A;  4GLX A;  1SXE A;  5KTQ A;  4RUC A;  1ZQV A;  3UPQ A;  5CJ7 A;  4ECZ A;  2GO7 A;  5AIA A;  3KHG A;  2R8K A;  2QAR A;  4J9R A;  2XY5 A;  9ICL A;  4RQ7 A;  1F5S A;  4FS2 A;  1TKD A;  3QZ7 A;  3T3F A;  2RDI A;  1KLN A;  5AKG A;  4F4X A;  2NRT A;  3NVW A;  4C8K A;  4M6W A;  1ZQQ A;  2Y0S F;  2G5H B;  2RHF A;  5HR6 A;  1COK A;  2Q0Z X;  2HOF A;  8ICT A;  9ICM A;  4UAY A;  4DF4 A;  1B43 A;  2ZIU B;  1XSP A;  1KSP A;  4OD0 A;  2G0A A;  5J2A A;  3BJY A;  2VA3 A;  5IIN A;  3RAX A;  1ZQF A;  4F5P A;  1ZET A;  5KFR A;  2J6T A;  2BGW A;  3RJI A;  4PJ0 U;  4B6J A;  2LM4 A;  4R66 A;  5ALN A;  2YMM A;  5KFS A;  4QWA A;  4KLJ A;  2UVU A;  3FDS A;  3IG5 A;  3GQC A;  5JUM A;  5EE1 A;  1CEZ A;  4C8N A;  4DOB A;  4F72 A;  3WK9 A;  2R8H A;  2YMP A;  4O5C A;  1C20 A;  3BQT A;  5ALH A;  2QB0 B;  2OWO A;  5III A;  3H8M A;  4O3P A;  4EBD A;  3GIL A;  1ZQE A;  2KOB A;  2NV3 A;  4YCX A;  4QWC A;  1XSN A;  4CCH A;  1TK5 A;  3T5L A;  3I76 A;  1NK4 A;  3ZDB A;  4C8L A;  3ZD8 A;  1RZT A;  4DFJ A;  1X6I A;  1XWL A;  1S0V A;  4KMO B;  4RQM A;  5AKY A;  4QWE A;  5KFM A;  7ICQ A;  1SXD A;  2E5S A;  3BQ2 A;  4ELT A;  9ICV A;  5KG6 A;  1CUK A;  1NKC A;  2W3R A;  1Z00 B;  1ZQR A;  2F76 X;  4WJ3 B;  3L4P A;  4YP3 A;  2DF4 B;  4KLQ A;  4OJP A;  4E0D A;  1J97 A;  1U4B A;  2ZXI A;  2OCE A;  3DDH A;  1SIJ A;  2F8L A;  1SKW A;  4HAI A;  2W9C B;  2R18 A;  4LZD A;  4NL9 A;  2KTQ A;  5CP2 A;  4RPZ A;  3QE9 Y;  4UW9 A;  3RFA A;  2CXY A;  2H3Z A;  1L8L A;  2HMX A;  4M9G A;  3D2Q A;  1XO0 A;  2GWS A;  3QU9 A;  2N1R A;  2ZG6 A;  3QXG A;  3PW2 A;  5KFK A;  1TE2 A;  3BS5 B;  4C4R A;  2ZIU A;  5KG5 A;  3V6J A;  2CRX A;  2W9B B;  4KLO A;  5DQG A;  2C22 A;  3LWL A;  3V6H A;  1L5U A;  2EQY A;  4UB6 U;  4USA A;  2PI5 A;  5DB8 A;  3EZ5 A;  1S76 D;  1ED1 A;  4MF8 A;  4TUR A;  4DQI A;  5AHX A;  1HUZ A;  2HHX A;  1S10 A;  1SB3 C;  4F2S A;  4G3I A;  3MDC A;  1L3U A;  4Y2T A;  1KEJ A;  3AN1 A;  9ICR A;  2FPK A;  5AI5 A;  3RH6 A;  5KFX A;  3S6J A;  5IIJ A;  4NM2 A;  4QZ8 A;  2XC9 A;  4NL9 C;  4KLL A;  4F5R A;  3HP6 A;  3RH5 A;  3ISB A;  1C7Y A;  3H8W A;  4DL5 A;  4QZC A;  3TKA A;  5DDM A;  2RDJ A;  9ICP A;  4XRH A;  4I2I A;  3TAD A;  1ZQC A;  2PFN A;  3C2K A;  4F92 B;  3OSN A;  9ICB A;  4YG2 A;  4DLG A;  3GV8 B;  3F5E A;  1X2I A;  3CYM A;  4Q45 A;  2JR5 A;  4PGX A;  1OW5 A;  5J0R A;  1NNL A;  4J9S A;  4AP9 A;  3HIL A;  2D6F C;  1TAM A;  1TAQ A;  3C1Z A;  3NUQ A;  3PX0 A;  1L3V A;  2KD1 A;  2FLP A;  4DO9 A;  8ICW A;  3N7S C;  1ZRM A;  4Y2U A;  4R63 A;  2Y9T A;  5KFP A;  3GDX A;  1Z00 A;  1JUD A;  4JMU A;  1D8Y A;  4B9U A;  2WAQ F;  3PR4 A;  5HR7 A;  5IIL A;  5KFY A;  2LMR A;  4O3S A;  3OTQ A;  1NK0 A;  2W3S A;  2D3D A;  3K1Z A;  5EWF A;  5J2K A;  3A0H U;  1D9F A;  4JK1 A;  3TAD C;  3F2D A;  2GH1 A;  5TIS U;  3MR6 A;  4KLE A;  4UBC A;  5ALW A;  3UM9 A;  3QZ8 A;  1FFU A;  4ELU A;  4NLB A;  3BS5 A;  4QJF B;  1RYR A;  5AI4 A;  5KG4 A;  5KFE A;  4JUZ A;  5JTI A;  4P0Q A;  1SV0 C;  5ALP A;  4QWB A;  8ICI A;  4ED3 A;  4I2A A;  2HHU A;  2WHE A;  5ALY A;  2FMQ A;  1KKX A;  5DBB A;  3O0F A;  3G6X A;  4GC7 A;  3ZI4 A;  4X5V A;  4B9S A;  3ETL A;  3MR2 A;  1QH9 A;  5K4L A;  5AI6 A;  2C2E A;  1WWU A;  1IV8 A;  1U48 A;  3T5J A;  1ZQX A;  4YQW A;  2AQ0 A;  4MEX A;  1QSS A;  1FIQ A;  1JRO A;  2KP7 A;  2KVS A;  2KHV A;  4KLI A;  4ECV A;  5D49 A;  4RPX A;  7ICK A;  3C1Y A;  1WCL A;  4FZM A;  3H40 A;  5J29 A;  5CWR A;  5AK6 A;  2AU0 A;  4QZ9 A;  2LBO A;  2K8A A;  8ICZ A;  1T4G A;  1TV9 A;  9ICJ A;  2A3V A;  3EW9 A;  2I5H A;  1S77 D;  3G6Y A;  1SV4 A;  4FS1 A;  5CEH A;  3PZP A;  1TFR A;  4OJ5 A;  3QU7 A;  2KIV A;  1Z1V A;  5ALX A;  5ALI A;  2Y1I A;  1XO1 A;  3M8R A;  4BDP A;  3Q8P B;  4I2E A;  2HHV A;  4KIT B;  1HEK A;  4EX6 A;  1WG8 A;  3SI8 A;  3PSF A;  3E0F A;  2B21 A;  2AHO B;  4ED1 A;  2W8K A;  4DFP A;  2AGO A;  5EWG A;  4DS5 A;  1TVA A;  1MSW D;  1B0X A;  3AMZ A;  2V9W A;  2F1J A;  3RRH A;  2BPC A;  4GXK A;  2DL0 A;  3RBD A;  5CB1 A;  2WTF A;  1NJZ A;  2ZTE A;  1P7D A;  4DL4 A;  8ICQ A;  4YR0 A;  1A77 A;  2KSO B;  1EXN A;  1N62 A;  2ZJA A;  3L5K A;  5KFO A;  1B22 A;  5DB6 A;  2JH1 A;  1V38 A;  3LVW A;  2R8G A;  3BQ1 A;  2DFL A;  4TQR A;  5BOM A;  2JV3 A;  4NY8 A;  2JZB A;  3N97 B;  5L1I A;  2Y9U A;  2DUY A;  3RTV A;  5KFW A;  4YMM A;  1NI3 A;  4ED2 A;  2W54 A;  2RRD A;  2W11 A;  4J9O A;  5ALO A;  4IR9 A;  2ZIV A;  2YB1 A;  4KX5 A;  8ICM A;  4RQ2 A;  5KFJ A;  3TAQ A;  2F3N A;  1S5L U;  5EE0 A;  2J6S A;  5C0Y A;  2OM6 A;  3HW8 A;  1PUZ A;  2KZM A;  3GFK B;  2EZY A;  3B0X A;  5J0T A;  5L1M A;  3KHH A;  3Q8R B;  2KJ9 A;  4FBU A;  3D2N A;  4I27 A;  2HHS A;  4CGZ A;  4I2F A;  5KT2 A;  3QYP A;  3GIK A;  1FEZ A;  2BKE A;  4RNO A;  4EX7 A;  1L8O A;  2EZX A;  4ZOH C;  7ICF A;  8ICA A;  2KE7 A;  1ZQS A;  2BQU A;  5ALS A;  1X9S A;  2RP5 A;  2MUT B;  4I28 A;  5KG7 A;  4F50 A;  3MC1 A;  1D9D A;  7ICI A;  3RH4 A;  3JPN A;  4DFD A;  1QQ6 A;  2HDO A;  5AI8 A;  1SWV A;  1ZQU A;  3FM9 A;  4ECQ A;  1SL1 A;  5AM0 A;  4C7Z A;  4QZH A;  5AKZ A;  3M6K A;  2PMZ F;  4O5K A;  3PO4 A;  4IQW A;  1K1Q A;  1NK8 A;  1IG6 A;  3MR3 A;  4NWI A;  1DOQ A;  4Y2J A;  4C4T A;  4KTQ A;  2IOF K;  3OPX A;  5E79 U;  3RR8 A;  4NV0 A;  4ED8 A;  3AU6 A;  3RR7 A;  1BPB A;  2FPM A;  2GOL A;  2BCS A;  2M9N A;  2MA1 A;  4PL1 A;  3PVX A;  1L7N A;  2BPF A;  4PZO A;  5KL1 B;  3RAQ A;  3NRW A;  1ZQP A;  1S0M A;  4UAZ A;  2XID A;  1ARO P;  2WF9 A;  3AU2 A;  4ECW A;  7ICL A;  4XQ8 A;  3BQ7 A;  2ALZ A;  1LVH A;  9ICA A;  3ISD A;  1L7O A;  3HRD D;  4CF4 A;  2KIC A;  1BPZ A;  2E1F A;  2PFQ A;  4FBT A;  2NRW A;  1A0P A;  3LWM A;  1Q8K A;  3ORY A;  3PO5 A;  5ALJ A;  1QQ7 A;  1CI4 A;  4ICA A;  4K4I A;  3NAS A;  7ICJ A;  2PFO A;  4J9N A;  1N63 A;  1ZJM A;  2YML A;  5DKW A;  3SYZ A;  4B9L A;  2ISO A;  1ZD4 A;  1U49 A;  2G06 A;  2XO7 A;  2XGQ A;  7ICU A;  2Q4T A;  2P6R A;  3VCB A;  4I2C A;  4TUQ A;  2XY7 A;  1BPX A;  1IIP A;  2KVC A;  3DEE A;  4B9N A;  1JXE A;  4F4K A;  1ZD2 P;  5KAF U;  1U9L A;  4DS4 A;  2HW3 A;  4YXM A;  3PSI A;  4GXI A;  4MFA A;  1X9M A;  1LKY A;  1KRP A;  1UT5 A;  4PHD A;  1BGX T;  5KT7 A;  4Q44 A;  2FLN A;  1PK1 B;  3H4D A;  4R64 A;  4BWJ A;  5ALF A;  3EPI A;  4P0P A;  1UCV A;  3KHL A;  2XI9 A;  2C2R A;  3OHA A;  1UA1 A;  1A76 A;  2F1I A;  5AK3 A;  2KIW A;  3C5G A;  1ZD5 A;  3OHB A;  2OXO A;  1ZQD A;  1PVQ A;  4P4P A;  5J0X A;  5ALE A;  4CE6 A;  5J0S A;  1Q46 A;  3RJF A;  2W7O A;  2HI0 A;  3TI0 A;  5JU5 A;  1SKS A;  5J2I A;  2YB4 A;  1JX4 A;  4NJ8 A;  1UHU A;  4I2G A;  3CW2 C;  1SGG A;  3Q8Q B;  3C23 A;  4UB1 A;  3OGU A;  4UAT A;  4DLE A;  1YT3 A;  5FP0 A;  2P35 A;  3DV9 A;  2G5I B;  3UXP A;  5KFC A;  5EWE A;  3PR5 B;  3M8S A;  4FFD A;  1ZQL A;  3RJG A;  5F3X B;  3N4M B;  3RJH A;  4Q8F A;  9ICH A;  2UVV A;  2QLT A;  4YD2 A;  3N7P D;  8ICR A;  4EBE A;  4KLG A;  8ICS A;  1ZRN A;  2EDU A;  2M0N A;  5KT4 A;  2XVT A;  3F2B A;  2HOI A;  2DBY A;  4F5Q A;  3CRX A;  3WK7 A;  2H3I A;  2F8K A;  2FMP A;  4CDG A;  3WKB A;  2MU2 A;  4R8U B;  5J2C A;  5HML A;  5DQH A;  3N28 A;  3H8S A;  2G09 A;  2WAQ C;  2W8L A;  1RM6 C;  2AJQ A;  7ICG A;  7ICN A;  3Q8M A;  4B9T A;  3E58 A;  4O3N A;  1J2M A;  5DQI A;  1QSY A;  5AIB A;  1ZQG A;  2ZUC A;  4IR1 A;  4O5E A;  1B4F A;  2EAP A;  1U47 A;  9ICW A;  3PML A;  4YR3 A;  1L7P A;  2JMG A;  2V4Q A;  2A1J B;  4DFM A;  1N61 A;  1IXR A;  3C28 A;  3TAC B;  2R8I A;  5IIK A;  5DG9 A;  3WK8 A;  4EEY A;  5AM4 A;  4LVS A;  3V7J A;  4F4Y A;  5ALU A;  5ALV A;  1F0M A;  5J2J A;  4PHA A;  2WB1 F;  2LM1 A;  7ICS A;  5AM2 A;  4PHP A;  2WF5 A;  3M9N B;  4J03 A;  2HVI A;  2YTU A;  3QU5 A;  5KFZ A;  4I2J A;  3BZC A;  1QCK A;  3IV6 A;  2KNJ A;  1AQ6 A;  2VJ4 A;  2HCF A;  1O08 A;  1S8O A;  2KZZ A;  2QB0 A;  1LB2 B;  2A19 A;  5BOL A;  5ALD A;  2WF7 A;  3VC8 A;  5CRX A;  4U7C A;  2ZIX B;  7ICT A;  3UXO A;  5CA7 A;  1SV0 A;  3HJE A;  5D46 A;  4C7Y A;  4DQP A;  2JEF A;  1Q3V A;  5F9N A;  2DPI A;  8ICL A;  4C80 A;  2RQ5 A;  3TAP A;  1GO3 F;  1KQQ A;  2ZJ5 A;  3KOO A;  5DG8 A;  3T5K A;  1RDF A;  4RQN A;  1D8B A;  1X6J A;  3IM1 A;  4RZR A;  4DF8 A;  2ZJ8 A;  3IHQ B;  4DSF A;  1YZ7 A;  1XS9 D;  2ZTD A;  4RT3 A;  4US8 A;  2W9C A;  3PMN A;  1ZQT A;  1XNS A;  2H3F A;  3RBE A;  2K4I A;  1UT8 A;  8ICK A;  3JPS A;  2KK0 A;  4F4Z A;  2E8M A;  3KZX A;  3PX4 A;  1NK6 A;  4Y2S A;  3QU2 A;  5ALT A;  1H38 A;  4F4W A;  3MR5 A;  1KFT A;  3LDA A;  1V9P A;  2E8O A;  3HKZ F;  3NGD A;  4M9J A;  5HMM A;  1PZN A;  2A1J A;  5HHI A;  4Q43 A;  3AQF A;  2W9B A;  2LYB A;  9ICK A;  9ICE A;  5AIC A;  1KFS A;  2JEJ A;  1QSL A;  4RPY A;  5J0W A;  4QIW F;  4TQS A;  4F3O A;  3SAH A;  4M2Y A;  2VA8 A;  1UA0 A;  4KLD A;  4O3R A;  4UAR A;  2XCA A;  4DQR A;  4MF2 A;  8ICB A;  2KZ3 A;  4KN4 A;  4KLS A;  3M6Z A;  3WK4 A;  3PW5 A;  2J6U A;  3RJJ A;  4NLC A;  5ALL A;  4KLF A;  2JXJ A;  4K4H A;  3IDW A;  4ELV A;  4M04 A;  7ICO A;  2AQ4 A;  2HHW A;  5KG3 A;  5AM5 A;  3OJS A;  5J2F A;  3C2M A;  2ZTC A;  4C0Z A;  1SZH A;  2ZIX A;  1ZYQ A;  4M9N A;  9ICS A;  2BR0 A;  2FI1 A;  3KBB A;  1VDV A;  1MQ2 A;  4F91 B;  4FZN A;  4ECU A;  1YZ6 A;  1WCN A;  3FAH A;  1HUO A;  5J2E A;  3KD3 A;  3Q8S B;  1NJX A;  4TUS A;  2IA6 A;  3ZDA A;  3OSP A;  5DDY A;  3UMG A;  2IHN A;  2NO4 A;  4RQ6 A;  5KFF A;  4EEN A;  4J9L A;  4O9M A;  1RXV A;  9ICT A;  3PST A;  8ICU A;  4OCZ A;  4NLG A;  4BX9 C;  4ED6 A;  3IG8 A;  4IRC A;  4YXJ A;  5J0Y A;  3IN5 A;  1LV5 A;  1NK9 A;  3RJE A;  1BNO A;  3H0R B;  3SV3 A;  1HJP A;  4PL2 A;  5L1L A;  3ALR A;  2HHQ A;  4QW8 A;  2ASL A;  1NKE A;  2FE9 A;  3I28 A;  3QEA Z;  3V72 A;  2ZUB A;  4QZB A;  3JPO A;  3QUB A;  2Y1J A;  9ICU A;  3WKC A;  2LYA A;  2AXT U;  4ECY A;  2KEY A;  1QTM A;  4O0I A;  5ALQ A;  3M7D A;  4Y2X A;  4UB2 A;  4B9M A;  4QZA A;  4Y2R A;  4RUA A;  5KT3 A;  4C8M A;  7ICH A;  8ICN A;  4AYB C;  2W9A A;  2EAO A;  2BCR A;  4UB4 A;  1KW4 A;  4F8R A;  4GC6 A;  2RLT A;  3FYH A;  3ONN A;  5EOZ A;  3M9M B;  2F77 X;  5KFA A;  3CNH A;  3CP8 A;  5KAI U;  4JWM A;  3JPQ A;  1JRP A;  5KNI A;  4RQ1 A;  4QZF A;  3KZI U;  3FC4 A;  4JV2 A;  4RNN A;  4Z6D A;  3SAF A;  5AKH A;  3UQ0 A;  4IL6 U;  1X40 A;  1Z19 A;  1N60 A;  3WK5 A;  3GII A;  4LJX A;  2BPG A;  3NVV A;  4IQU A;  3IP4 B;  4F5O A;  5AKL A;  4PHE A;  2IBK A;  1PVR A;  1RQL A;  1ZQK A;  3KFU F;  2Y0S C;  2QAR B;  5AI0 A;  5J2B A;  5AKI A;  9ICO A;  4BXO B;  3WKE A;  3RF9 A;  2JH7 A;  3EUB 2;  3C21 A;  4FZL A;  3AQE A;  5AM1 A;  5KFV A;  1SKR A;  1JAL A;  1DXS A;  2KSO A;  2DPJ A;  3HX0 A;  1NK5 A;  1ZQM A;  4M6W B;  4QWD A;  1N2X A;  3N7R C;  9ICG A;  8ICG A;  2E8P A;  2DGZ A;  2DQN B;  4YR2 A;  2KKV A;  2MSN A;  5J8Y A;  1BPE A;  2QB1 A;  3NVZ A;  5KFG A;  1JIH A;  5AKX A;  3E2E A;  2V4R A;  3V6K A;  2NRX A;  5C5J A;  1ECW A;  1ZQB A;  4RQ5 A;  3KKA C;  2LPE A;  2XCP A;  1UPH A;  2A1A A;  4OJ6 A;  5AI9 A;  4TUP A;  4G9B A;  4RU9 A;  2ISP A;  3Q8K A;  1T94 A;  5AM3 A;  5HNK A;  3HWT A;  2E1E A;  4ACO A;  1VJ5 A;  5KG1 A;  2ESE A;  5JRT A;  4QZD A;  2MAX A;  5AK4 A;  4GIB A;  4BJQ A;  1FFV A;  3A0B U;  2WFA A;  3QNM A;  4PPX A;  1URJ A;  2HBK A;  4FO6 A;  2KN7 A;  2PI4 A;  4DWI A;  5J8Y C;  2ASD A;  3LK9 A;  4Y2V A;  2PKE A;  5EE3 A;  3R9K A;  5DBA A;  2XY6 A;  2OH2 A;  1RG6 A;  4BUG A;  2MUT A;  1KTQ A;  3EWA A;  3J81 j;  4J9M A;  2F44 A;  1L3T A;  4CF5 A;  2BHN A;  2HSZ A;  5ALM A;  3L3F X;  1PK3 A;  1ZOL A;  1N5X A;  2UVR A;  3T79 A;  3LYS A;  4RQ8 A;  8ICX A;  3GIM A;  1NK7 A;  8ICP A;  1DK2 A;  2K4E A;  2W55 A;  4JWN A;  2F2A B;  1VLB A;  4BXO A;  1PVP A;  4YMO A;  2ZXH A;  2IHM A;  9ICQ A;  4QNL A;  4Z6C A;  4YVZ A;  7ICP A;  1X9W A;  3H0M B;  2LYH A;  3LVV A;  4C4S A;  1RXW A;  1JXL A;  3D2S A;  2K89 A;  2F1H A;  1MN8 A;  4IRD A;  2B6G A;  2WB1 C;  5L9X A;  4US9 A;  4YD1 A;  1S97 A;  1CRX A;  1ZQN A;  3GU3 A;  4UAS A;  4PGY A;  5KFU A;  3ZDC A;  1ZQH A;  1NJY A;  2MRL A;  2HVH A;  3F2C A;  1KBU A;  3UQ2 A;  3B9J A;  5CHG A;  5KFQ A;  3MFH A;  2KMD A;  2YX8 A;  4ED7 A;  3PW4 A;  2ASJ A;  3SEN A;  5B5E U;  3K4G A;  4ED0 A;  5AK5 A;  3THV A;  1ZQO A;  2JEG A;  3ISC A;  1RQN A;  4QZI A;  3PW0 A;  4UAV A;  1TAU A;  3MGV A;  2JHD A;  8ICO A;  2ZIW B;  2GLE A;  2W04 A;  3TAN A;  1T3N A;  4MEY A;  2P66 A;  2OHF A;  2IOH A;  3WKD A;  1T7P A;  1XSL A;  1HIW A;  9ICN A;  2FJ6 A;  1K1S A;  4Y2Y A;  2VA2 A;  4K4G A;  4BWM A;  3ZDE A;  3SAG A;  4Q8E A;  4LZG A;  1BPD A;  1SL2 A;  4QZG A;  4DQQ A;  4F71 A;  2XIC A;  5DBC A;  2WF6 A;  5KFD A;  5KG2 A;  3PV8 A;  2W03 A;  4F5N A;  3H0L B;  5T14 A;  2O6K A;  1N48 A;  2C2D A;  4JB3 A;  4O3O A;  1PK1 A;  2HBM A;  4I2H A;  4NLZ A;  5GTH U;  2VAN A;  4O3M A;  1UQV A;  2NO5 A;  3HKZ C;  2JGA A;  1ZQI A;  3UMC A;  4EEK A;  3KHR A;  5EE9 A;  3F53 A;  2KJ8 A;  5L1K A;  1ZQZ A;  4F93 B;  3TQ1 A;  1DGS A;  1NZP A;  4MFC A;  3SEI A;  5L1J A;  2AGQ A;  4CNQ A;  4EZ6 A;  3QX7 A;  3GV7 B;  4EEL A;  5G5G A;  4MFF A;  4F2R A;  2EH9 A;  5KT6 A;  3PW7 A;  8ICC A;  1IM4 A;  1X42 A;  5A0L A;  5HP4 A;  4OO1 J;  3V7K A;  2PXI A;  4QIW C;  3MAB A;  3G6V A;  5ALZ A;  3QEB Z;  1MA7 A;  4P0Q B;  7ICV A;  4JV1 A;  1T3Q A;  4Z6E A;  5KL8 B;  4DL7 A;  2JEI A;  3K75 D;  4UB8 U;  5KT5 A;  4PGQ A;  1DK3 A;  8ICJ A;  7ICR A;  3QUT A;  3RJK A;  5F9L A;  8ICY A;  3MBY A;  4J9K A;  1KL9 A;  5KFB A;  2NYV A;  2L5Y A;  2E3T A;  3AL0 B;  4NM1 A;  2ZIW A;  2NRV A;  3ED5 A;  3U26 A;  1S0O A;  4DFK A;  5IIO A;  1O03 A;  4KLU A;  1ZQJ A;  2B0C A;  2YMQ A;  5AKJ A;  3WU2 U;  2BDP A;  4R8U A;  4PZN A;  4PH5 A;  2WF8 A;  4Y2Q A;  4DSL A;  5TZV A;  5GTI U;  4EZ9 A;  5KFL A;  4B9V A;  2HHT A;  3B0Y A;  5DLF A;  5AKE A;  9ICX A;  1SL0 A;  2W7P A;  4DQS A;  5J2H A;  4KMU A;  3T5H A;  1V97 A;  2AH5 A;  4U6P A;  2FPL A;  3H8J A;  2VIX A;  3KTQ A;  1M6Y A;  5J2D A;  4DEZ A;  4DSE A;  4I2D A;  5G5H A;  3PY8 A;  2P6U A;  4UB3 A;  4ZH4 A;  2YQE A;  2HBL A;  2H3Q A;  4DSJ A;  1JMS A;  4DL3 A;  5ALR A;  3PNC A;  2KFZ A;  1X9X A;  3AEV A;  2G08 A;  3MDA A;  1Q3U A;  3C29 A;  3QU4 A;  4UBB A;  5KFI A;  2BQ3 A;  4IRK A;  1KFD A;  1WUD A;  4RQ4 A;  8ICV A;  4P4O A;  2FMS A;  2JZB B;  4EYI B;  2OEH A;  3C2L A;  1RYS A;  1N56 A;  1WWV A;  4KLH A;  2OYY A;  2K60 A;  1K5O A;  5DLG A;  2KKP A;  4EYH B;  1XC9 A;  4DSK A;  9ICC A;  2DKX A;  2K8C B;  3K1R B;  2ZIV B;  2BCU A;  2W9M A;  1BNP A;  4QW9 A;  3HPO A;  2BCQ A;  4RNM A;  3V7L A;  1BPY A;  5AKK A;  9ICI A;  1NJW A;  1NKB A;  4KX3 A;  5DB7 A;  5J0U A;  2XGP A;  4O3Q A;  3JPT A;  4QZE A;  8ICH A;  2EAM A;  1D8L A;  2FLL A;  4GXJ A;  1A6S A;  5KFT A;  2DKZ A;  1Z4N A;  3F5A A;  2BCV A;  1QLN A;  4DOC A;  1COO A;  2KFN A;  4RQ3 A;  3C5F A;  3GV5 B;  1Z1B A;  4CRX A;  2K4H A;  1X66 A;  2K4P A;  2W43 A;  2PMZ C;  3BDP A;  1TK8 A;  1KDH A;  2G07 A;  4P2H A;  1L7M A;  2EAN A;  1ZQ1 C;  4OJL A;  2QKQ A;  4C8O A;  3TFS A;  1L6N A;  3RRG A;  4ECX A;  1F44 A;  3MGH A;  3IRU A;  2CPR A;  4DOA A;  7ICE A;  2D8C A;  2AGP A;  4YMN A;  4OJO A;  3SQI A;  4FE3 A;  1MC8 A;  3UXN A;  4I2B A;  2BDU A;  4P4M A;  1U45 A;  2I9G A;  5J0O A;  4NXZ A;  2UVW A;  2BQR A;  3NVY A;  3ZDD A;  4GFJ A;  3ICX A;  2KHQ A;  3M9O B;  1ZQA A;  3QUQ A;  2FDR A;  3ETR A;  2R8J A;  2LHT A;  4XUS A;  3JPP A;  5D4B A;  2NRZ A;  3AM9 A;  4IS7 A;  1ZD3 A;  3AUO A;  1DRG A;  5DG7 A;  4UAW A;  1SZP A;  3BQ0 A;  4A8E A;  4J9Q A;  2KG5 A;  5DB9 A;  2HBJ A;  4IQV A;  1FO4 A;  2C28 A;  1DGJ A;  3SZ2 A;  3RB3 A;  2KV2 A;  3MGI A;  3RB6 A;  4KLT A;  2VKQ A;  1Z4O A;  1T8E A;  3PSP A;  3RB0 A;  3D6J A;  1Z3E B;  4RT2 A;  1XU4 A;  2I1Q A;  4M0A A;  2DWQ A;  3H4B A;  4DL6 A;  4Y2P A;  5ALG A;  2KJ5 A;  3TAR A;  4I29 A;  3KKA A;  4EBC A;  2Z7J A;  5J2G A;  9ICF A;  1JN3 A;  4DSI A;  2HOQ A;  5HHH A;  5H2F U;  1OXJ A;  3SD7 A;  2YY6 A;  7ICM A;  4UAU A; 
#chains in the Genus database with same CATH homology
 2QB1 A;  1SXD A;  3BS7 A;  3HIL A;  2B6G A;  5F3X B;  2QAR A;  1SV4 A;  3SEI A;  2QB0 A;  3KKA C;  2LPE A;  2D8C A;  1LKY B;  1X9X A;  2KIV A;  1Z1V A;  2KE7 A;  2Y9T A;  2KMD A;  3IDW A;  3SEN A;  4NL9 A;  1COK A;  2EAO A;  2ESE A;  2F8K A;  2LMR A;  1KW4 A;  5JRT A;  1WWV A;  1SV0 A;  4MHV A;  2K60 A;  2D3D A;  1B0X A;  2GLE A;  1V85 A;  2E8N A;  2DKX A;  3K1R B;  3TAD C;  3BS5 B;  2DL0 A;  1OXJ A;  5KNI A;  2L5Y A;  1LKY A;  2KSO B;  5J8Y C;  3BS5 A;  4RQN A;  1V38 A;  1X40 A;  4IS7 A;  1RG6 A;  1PK1 B;  5JTI A;  1SV0 C;  2ES6 A;  2KG5 A;  2JV3 A;  1UCV A;  2F44 A;  2Y9U A;  1B4F A;  2EAP A;  2E8M A;  2QAR B;  4PZN A;  1PK3 A;  1WWU A;  2QB0 B;  2E8O A;  2EAM A;  3TAC B;  4PZO A;  4NL9 C;  5JU5 A;  3H8M A;  2DKZ A;  4NJ8 A;  1JI7 A;  1F0M A;  1DXS A;  1SGG A;  2KSO A;  2F3N A;  3KKA A;  1X66 A;  2K4P A;  3BQ7 A;  1PK1 A;  3TAD A;  2E8P A;  2FE9 A;  1SXE A;  2EAN A;  1UQV A;  4RQM A;  2YTU A;  5L1M A;  2QKQ A;  1OW5 A;  5J8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...