4NL9A

Crystal structure of the human anks3-sam/anks6-sam heterodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
b'APYSGPQDLAALLEQIGCLKYLQVFEEQDVDLREFLTLTESDLKEIGITLFGPKRKMTSAIARW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 18
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nl9A01
2KSOB 3H8MA 2FE9A 2QARB 3HILA 2E8OA 4NL9C 2KSOA 1SV0A 2LPEA 4IS7A 2QB0B 1B4FA 2QARA 2B6GA 2D3DA 1PK3A 2KE7A 2EAPA 4RQNA 5KNIA 2QB0A 1F0MA 1KW4A 1X40A 2F3NA 2DKZA 3KKAA 3TACB 3TADC 2F44A 4RQMA 5F3XB 1V38A 5JRTA 1UCVA 3BS7A 4MHVA 5JTIA 4PZOA 1B0XA 1LKYB 5J8YC 1RG6A 1UQVA 3BQ7A 1OXJA 2LMRA 4NJ8A 1V85A 2ES6A 1JI7A 2K4PA 2E8PA 2DL0A 1SXEA 2KMDA 1PK1B 2KIVA 1OW5A 1LKYA 2KG5A 2Y9UA 2K60A 2E8NA 2EANA 1PK1A 4NL9A 1SV0C 1X66A 3SENA 3K1RB 2ESEA 1WWUA 2QKQA 1WWVA 2EAMA 1COKA 5L1MA 1SV4A 1Z1VA 2YTUA 2L5YA 3KKAC 2F8KA 3TADA 2JV3A 2DKXA 4PZNA 2EAOA 2Y9TA 2E8MA 3BS5B 1X9XA 5JU5A 2GLEA 2D8CA 1SXDA 2QB1A 5J8YA 1SGGA 1DXSA 3BS5A 3IDWA 3SEIA
chains in the Genus database with same CATH superfamily
2HOFA 2DFLA 2KICA 4US8A 4KLFA 1QLNA 1Z00A 3LWMA 5AK5A 2AXTU 4LJXA 3WK9A 5AKZA 4QJFB 2JEJA 3I1YA 8ICGA 2OEHA 4F4XA 4ED7A 3M6ZA 4F5RA 3N7RC 1TE2A 5TZVA 3FAHA 5AKYA 5KNIA 4P4MA 2D6FC 1KN5A 7ICNA 4C7ZA 1TVAA 1ZQSA 3H8JA 1QQ5A 4J9MA 2MUTB 3BS7A 5D46A 4C8MA 4U7CA 2BCSA 5GTHU 4RPZA 4CF3A 4F92B 2BCVA 3RRGA 3L3FX 3LDAA 2VA8A 4DS5A 2W3SA 8ICTA 1DGJA 4RQ3A 4R8UB 2Y9UA 1L3UA 4OJ6A 4A8EA 4RT3A 2W03A 4J9NA 5J0PA 4IRKA 4B9LA 4UBCA 3RB3A 1WUDA 2KV2A 2HBKA 3CW2C 2EZXA 7ICIA 3MGHA 4PHAA 4IR9A 1JXEA 4DL4A 3UMGA 1COKA 2KZZA 4C0ZA 2W9CB 4J9SA 1JROA 2E3TA 4KN4A 2KIWA 5AKEA 5KT6A 5TISU 3BQ2A 3HT3A 1ZQIA 4JUZA 1SL2A 8ICLA 1X9MA 5DG7A 4XA5A 4R66A 1NK8A 5EE1A 3F2BA 2ALZA 3KOOA 9ICQA 5J8YA 4KLTA 3F5AA 2EZYA 3RF9A 5KFVA 3SV3A 2ISPA 4Q45A 4CE6A 5KFCA 4I2FA 4IS7A 1SKRA 4KLUA 5KFNA 3ZI4A 4O3MA 9ICHA 3ZD8A 1S9FA 3UQ2A 3LVVA 4NLBA 2Q4TA 3RTVA 4JWNA 3WK6A 1NOMA 2GOLA 4CNQA 1F44A 2A19A 4XUSA 3SV4A 3ICXA 8ICOA 4K4GA 3TADC 4F72A 1ZQVA 3GFKB 5HHIA 5HR6A 2R8JA 2I1QA 3MGVA 4F3OA 4PL1A 3ONNA 3QU4A 2DUYA 1A6SA 3RJFA 4Z6DA 1HEKA 5KTQA 4EBEA 4RNMA 2VANA 2F8LA 2UVRA 2YMLA 1XSPA 5DQIA 2A3VA 5D49A 2FLNA 2WAQF 3B0XA 4BXOA 4LZGA 3J81j 8ICZA 5AM4A 3MR3A 4Q43A 4TQRA 4DLEA 3OPXA 3SR6A 5HNKA 3SD7A 5KFPA 2R8HA 2ASLA 2W9AA 4Y2YA 2KK0A 2BGWA 3SAFA 1N5XA 4NWIA 1ZXIA 4NY8A 4MFFA 5K4LA 4Z6FA 1M6YA 3RJKA 2JMGA 3JPQA 5G5HA 4CF5A 2OH2A 2PFPA 5ALTA 3NVYA 4ICAA 3CYMA 4YMOA 5KAIU 2J6UA 4I27A 3SZ2A 4OCZA 2LPEA 7ICHA 2K8CB 4O5EA 2QARA 3TKAA 2OM6A 1ZQZA 4QIWC 1L5UA 4NLCA 8ICIA 5KFOA 1ZQUA 1X40A 9ICWA 1XO1A 8ICEA 4M6WA 4O3PA 2DKZA 2B21A 1WCNA 5KFFA 1TK8A 3EPIA 4DF8A 5AIAA 2W8LA 2HW3A 3VC8A 2VA3A 1NK4A 5JUMA 9ICTA 1PVRA 1FFVA 4TQSA 1OXJA 3DEEA 2KHVA 2I9GA 1MC8A 2ES6A 2KIVA 1OW5A 2P6RA 2KG5A 5DDMA 2KFNA 2NRWA 4QZEA 2LM4A 5KFYA 3PW0A 4UAUA 8ICMA 5EOZA 1BPDA 2W7OA 5C5JA 3HX0A 7ICEA 2QKQA 3AQEA 4C4TA 4GFJA 2YMQA 3OGUA 2G08A 3WKCA 4BDPA 2AU0A 3RH6A 4HAIA 3KD3A 1XU4A 3GIJA 5CEHA 4KLSA 4EYIB 4B9TA 4F93B 3T5KA 3MDCA 4C4SA 4DOBA 5ALWA 5AICA 1BNPA 4FE3A 2GLEA 1FFUA 5DDYA 4QWDA 1K1SA 2YQEA 1HJPA 4XQ8A 5F9NA 1KSPA 1DK2A 1BPZA 5KT7A 4DOCA 4CDGA 3N28A 3PW7A 1YZ7A 2EZZA 3ZDCA 3L5KA 3V6KA 4B9MA 4PHPA 4OJOA 3JPTA 3PMLA 1RQLA 3HILA 3QUBA 3GIKA 1RXVA 1ZQAA 2W54A 3K4GA 3LVWA 1D9FA 4DSEA 4OD0A 5AK6A 3OJUA 1L3TA 1RYSA 5KL8B 4O5KA 2I5HA 5CJ7A 9ICOA 2PMZF 3RJEA 3GDXA 3IG5A 1T3QA 1QH9A 2FLPA 5AM5A 1MSWD 1B0XA 1NK0A 9ICPA 4J9OA 4MF8A 4I2BA 2W55A 4QWEA 2JEGA 1URJA 4B9NA 2Z7JA 3H4DA 7ICMA 1PK1B 2JH1A 2G5HB 4WJ3B 1ZYQA 4ELVA 8ICYA 4GC6A 2IOFA 1BPEA 1NJZA 2ZIUB 3UQ0A 2IMWP 3V6JA 1C20A 4ACOA 1U4BA 3MFHA 1PUZA 5EE9A 1L3SA 4FZLA 4YXMA 2UVUA 2K89A 2YX8A 3RJJA 4ECVA 4QW8A 3ETLA 5AHXA 4YMMA 4KX5A 3WKEA 4TURA 5DB6A 4YQWA 2E8MA 2WF7A 3QZ8A 5AIBA 4IL6U 2DF4B 4DQSA 3M9NB 5T14A 2GO7A 3MGIA 1Z1BA 2G07A 5KFZA 1FIQA 4J03A 2FI1A 3TI0A 3CRXA 2KEYA 4XRHA 4DSFA 4DO9A 5DGAA 4UB1A 3OHAA 4F5PA 3D2NA 3IHQB 1CI4A 1BPYA 1IV8A 3HRDD 4BJQA 1DGSA 4UB3A 1S97A 5KT4A 4EELA 1YT3A 9ICGA 4ECYA 2W3RA 3QU5A 4DOAA 1V9PA 2F3NA 1XWLA 5DLFA 5AI8A 4YG2A 2ODGA 3H4BA 4QWCA 5ALSA 2DWQA 2AJQA 1AQ6A 2IHMA 2JZBB 1KTQA 2P35A 3GV5B 1ECWA 2C22A 1B22A 4KLOA 4F4KA 1BPBA 2G09A 1A77A 2JEFA 9ICUA 1ZQCA 1RYRA 1S8OA 3QNMA 1XC9A 2HHWA 2KNJA 1KFTA 1LKYA 3AM9A 5J2CA 3RB0A 3M9OB 2VKQA 2ZIXB 2F76X 5J0SA 2W9BB 1X66A 4G9BA 3MR6A 2M9NA 5KFRA 3NS1A 2UVVA 8ICWA 1AROP 2WAQC 3NTUA 3BZKA 1IXRA 5G5GA 1SV4A 2WF5A 4I29A 1O03A 4Y2SA 3UMBA 1J2MA 3C21A 4GLXA 1ZQNA 3O0FA 1NI3A 4DQPA 4BGDA 3UXOA 3AN1A 1KBUA 4F5OA 1TAQA 4QNLA 4Y2VA 5ALIA 3T3FA 1Z4NA 4NXZA 3H0MB 4GXJA 3RB4A 2D8CA 1MQ3A 4PGQA 3KHHA 4DL6A 3D2SA 5HMMA 5CA7A 4FS1A 5KFXA 3D6JA 4DFKA 8ICCA 3AUOA 3B9JA 5ALXA 2OHFA 2LBOA 3H40A 5AM1A 4B9UA 1PVQA 2E8OA 1TK5A 2BQUA 2OWOA 2KSOA 3TANA 3K1ZA 2ZIWB 4C4RA 5ALKA 3M1YA 1X2IA 3ZDAA 5J0XA 1L7NA 4ELTA 5AI6A 1NJWA 4QZCA 1Z4OA 3SMVA 5F3XB 2ASJA 3C1YA 4CF4A 1UCVA 3E0FA 2OYYA 5KAFU 8ICFA 8ICXA 4RQ5A 3PZPA 1ZQMA 4PZOA 5KFHA 3PR5B 3TARA 1PZNA 4PH5A 2PI4A 4UAWA 3C2LA 5IIOA 4PL2A 5ALNA 3RJHA 5AKJA 4NM2A 4ELUA 1S76D 3M6KA 3RJGA 5DB8A 2XC9A 4DL7A 4DQRA 2BHNA 3SAGA 2HSZA 5ALYA 3IV6A 5J2AA 1UA0A 1LVHA 5CHGA 4J9QA 3TFSA 2HVIA 3EZ5A 1ZQPA 5J2EA 2FLLA 1K1QA 5KL1B 3TADA 2HHTA 3QUQA 4YCXA 2ZIVA 4R64A 4ECSA 2PFNA 1UHUA 2AH5A 4C8OA 1L8LA 4CGZA 3EYZA 4P4OA 2QLTA 4DL2A 4DLGA 5J0OA 3BS5A 4B9SA 4AP9A 2WF6A 3ETRA 5J0RA 3JPOA 2XIDA 1F5SA 4DCCA 2XY5A 4KLQA 9ICXA 4GXIA 2KP7A 4M9GA 4JB3A 9ICFA 3U26A 1CUKA 3KBBA 5DQHA 2LKYA 1D8LA 4FZNA 2D3DA 2LM1A 5E79U 3WK4A 3UXNA 5ALVA 3OHBA 1VJ5A 1ZQ1C 4ECZA 4QW9A 2H5XA 2R8GA 2V4RA 1S0MA 8ICRA 3NVVA 4I2DA 4EX6A 2KJ9A 3MR5A 8ICKA 1WG8A 1JUDA 5DGBA 3HPOA 4ED6A 3N7PD 2PMZC 3OSPA 4IR1A 4QWAA 2A1JB 1RG6A 1ED1A 2MUTA 4M9NA 1FO4A 1BVSA 1T7PA 5J2FA 2BQRA 2K4PA 2JH7A 4LVSA 5J0QA 2XCAA 3E58A 4YXJA 3AU2A 2EH9A 2HHQA 1SV0C 4DSJA 2HBMA 4R8UA 3QU2A 3GV8B 1H38A 4AYBF 4J9PA 5ALLA 4RQ6A 2BCUA 3QX7A 2XGQA 8ICPA 5L1MA 3UXPA 2A1AA 3QEBZ 2YTUA 2Y1JA 3JPRA 4QWBA 5F9LA 1NK7A 3M9MB 4ECXA 4IQTA 4NLGA 2W9CA 2ISOA 3C23A 2YY6A 2DPJA 1TFRA 2MU2A 1TAUA 4C8KA 1SGGA 4DWIA 2W11A 3RH5A 2BPFA 4USAA 1RZTA 1A76A 4CRXA 5AKXA 2C28A 5EE3A 4ECTA 2CXYA 1XNSA 4KITB 1SWWA 2QB0B 1JN3A 3PO4A 4EX7A 4E0DA 1ZQGA 5J2HA 4ECUA 5IIJA 5DG9A 1CEZA 2ZXIA 3HW8A 4UW9A 2RQ5A 4RQMA 8ICQA 2KD1A 3BQ1A 4GC7A 4JV0A 4KLLA 3OTQA 2HDOA 5ALRA 5HR7A 9ICAA 1ZQBA 4K4IA 3AL0B 4NJ8A 3WKDA 1JI7A 1S10A 1RDFA 9ICBA 2ZXHA 4PGYA 4R65A 4O3SA 1XSLA 2KOBA 2RP5A 5J2BA 3BJYA 4US9A 2FPMA 1MQ2A 5J0TA 2H3ZA 2W04A 3SENA 7ICRA 1HUOA 3PSFA 2G06A 4GIBA 4KLMA 1JIHA 3AU6A 2MRLA 4DQIA 1C7YA 3OJSA 2F77X 4J9KA 4IC9A 1RYUA 2FMPA 1N61A 1SL1A 2K4IA 3E2EA 2FJ6A 1PVPA 2BCQA 3A0BU 4P0QB 2NRXA 3MABA 4FBTA 3NRZA 3WK8A 1X9XA 4J9LA 2QB1A 9ICRA 7ICGA 3MBYA 1N60A 5H2FU 4I28A 3PSTA 4FZMA 9ICMA 3RJIA 3KZIU 4U6PA 4FFDA 4YP3A 3CNHA 3H7IA 4RZRA 8ICUA 3PV8A 1HIWA 3NGDA 4UASA 5ALGA 1L7OA 5DBAA 4YD2A 1ZQRA 3N97B 3RRHA 2KJ5A 1JXLA 4F2SA 4UB5A 9ICKA 3QE9Y 3BQ0A 5AM2A 4C7YA 5AK4A 4UATA 3MR2A 2HBLA 8ICVA 1U47A 3Q8LA 4EYHB 4PJ0U 1X9WA 1WYGA 2YB1A 3H0LB 3GV7B 1HUZA 1VDVA 2P66A 4DEZA 1TKDA 4F5NA 4Y2XA 5CB1A 4KLDA 2ATLA 4Y2RA 1K5OA 2XY7A 5J2KA 5KFKA 2KMDA 1SXEA 5DG8A 4PPXA 5L1KA 4M9JA 3MFIA 5KFLA 2ZTCA 3QU9A 2FPKA 4UB2A 2HMXA 2OXOA 2Q0ZX 1RPLA 3ED5A 9ICLA 3RB6A 4Y2TA 2XCPA 1U9LA 3GIMA 5KFDA 4BWJA 1ZRNA 1B43A 2YMMA 4O0IA 1ZQJA 3PNCA 1RM6C 3KKAC 2DPIA 2JV3A 3V7LA 1Q46A 2KHQA 2RLTA 3M7DA 2ZUBA 2KZMA 1YZ6A 1TV9A 1S0NA 4PHEA 5CRXA 1U45A 1U49A 4ED8A 5DB9A 4ZH4A 3RBDA 7ICJA 1NJYA 2IOFK 4MFCA 4UARA 5BOMA 5AI9A 3Q8KA 3ZDBA 5KFJA 1L7MA 2Y0SF 3ISBA 5HP4A 3PSPA 4G3IA 3HKZF 2FMQA 2ZG6A 3M8RA 4RT2A 3F5EA 1N2XA 2B0CA 4DFPA 2EAPA 3LK9A 2ASDA 5AM0A 5KG6A 1DRGA 4F4ZA 2KKVA 4PGXA 1UPHA 4DQQA 3Q8PB 1BGXT 5CR0A 3FM9A 5JRTA 4MHVA 2F1IA 3Q8QB 3WKAA 5KFIA 3IN5A 2FMSA 3HJEA 3QUCA 4KN7A 4ED3A 2K8BB 1UQVA 3BQ7A 3VCBA 5ALUA 3RFAA 1TK0A 3UM9A 8ICAA 5J0YA 2DQNB 4EBDA 3TQ1A 3HP6A 2R8IA 2E5SA 4B6JA 4BX9C 1PK1A 4IQUA 2IBKA 3ZDDA 2G0AA 5J29A 3K1RB 2JHDA 1KKXA 4DSKA 2HBJA 4RQ7A 3BDPA 3WK7A 5J2GA 3A0HU 1A0PA 4DS4A 2ZIUA 4IRDA 4AYBC 3L4PA 4P0PB 3IM1A 2HI0A 1KFSA 5J0UA 4I2HA 5KG2A 2PKEA 2HOIA 4OO1J 2GH1A 2H3FA 5DKWA 4C8NA 2HHUA 3ALRA 4P4PA 4PHDA 2IOHA 1Z00B 4OJPA 2I6XA 2VA2A 4LZDA 3G6YA 1U48A 2UVWA 2VIXA 3EWAA 1ZQLA 5KFTA 1X6IA 3DV9A 3AMZA 3THVA 4F4WA 2E1EA 4YR2A 2V4QA 3V7JA 1ZJNA 3QYPA 2WF8A 4OJ5A 4F50A 4I2JA 1X42A 3SAHA 4NL9C 2AGOA 3G6XA 2EQYA 3C5GA 3PX6A 3ISDA 4UBBA 3N7SC 1PK3A 5EWGA 3KTQA 4NLZA 3I76A 3PW5A 3PX0A 1Q8KA 2LYAA 3GIIA 2F44A 3ZD9A 1SL0A 4M47A 4I2IA 4F8RA 1Y88A 1JRPA 4F91B 5EWEA 2JEIA 1ZQEA 2WB1F 1JX4A 4I2CA 3CP8A 2JZBA 4YVZA 3C29A 5FP0A 4ED2A 2GWSA 1WCLA 4I2EA 4UQGA 1TAMA 1Z19A 8ICSA 2HCFA 2VJ4A 5KG4A 1L6NA 1T94A 1UT5A 5KG7A 2ZJ8A 3V7KA 5D4BA 5ALHA 1NK6A 2ZIXA 2BKEA 2BDUA 2W9BA 2BR0A 4I2AA 2W7PA 1N48A 1MA7A 2G5IB 3R9KA 4O3NA 7ICUA 4F2RA 2PFQA 3NRWA 1ZD2P 4PZNA 2EAOA 3KZXA 7ICVA 1ZJMA 5HMLA 3N4MB 4Q8EA 2LYBA 1O08A 3C2KA 3IDWA 2ZTDA 3PR4A 3H8WA 5AKIA 2H3VA 8ICJA 5AI0A 5AKHA 3NVWA 4KLJA 4O3QA 1ZQOA 3HWTA 1N56A 1SV0A 2ZTEA 3KHGA 2W43A 3WU2U 1B4FA 3LWLA 2ZJ5A 4RQ2A 2KE7A 4M2YA 3K75D 5IINA 1NKEA 3PX4A 3ISCA 3BZCA 4RPYA 4KLIA 3C2MA 1MN8A 4DFDA 1KW4A 2ZIWA 4DSIA 2NRVA 3DDHA 3EUB2 5L1JA 3M8SA 4Z6EA 2XI9A 5A0LA 1NKBA 5AKGA 4YD1A 5AI4A 2AQ0A 5KFEA 3B0YA 3Q8SB 2H3QA 4KLEA 2DGZA 7ICPA 2E8PA 2HHSA 5KG0A 2M0NA 3V72A 4BXOB 2YB4A 2K60A 5KFBA 2AHOB 2CRXA 2JR5A 4QZ9A 1S0VA 4KMOB 1D8YA 3G6VA 2ESEA 3LYSA 4Y2JA 1V97A 4O9MA 3GQCA 4DSLA 2OCEA 5J0WA 2DBYA 5L1LA 5KFSA 4FO6A 9ICSA 1ZQHA 8ICNA 4UAVA 2F8KA 1KRPA 5KT2A 2KFZA 2YN4A 2XICA 4C8LA 2ZUDA 2ZUCA 1QTMA 3NASA 1ZQWA 5IIMA 4F71A 1D9DA 7ICFA 3AEVA 4NLKA 1SZHA 4MFAA 3SEIA 3JPNA 4FS2A 2RRDA 2FDRA 4DFJA 5B5EU 3FYHA 2NRZA 3SYZA 1NZBA 2QARB 3PSIA 4P2HA 1ZQXA 2Y0SC 5GTIU 4QZGA 3FC4A 2KVSA 1Q3VA 4F4YA 3F2CA 4M6WB 1ZRMA 3HKZC 4RQNA 2J6TA 3RAXA 5DB7A 4JMUA 4YMNA 4O5CA 5AKKA 1NKCA 1XSNA 2WHEA 5AK3A 5J2IA 4KX3A 4F5QA 5J2JA 5ALPA 1NK9A 4NV0A 3KHRA 5JTIA 1P7DA 2BPGA 3T5HA 5BOLA 2BQ3A 5J8YC 4Y2QA 4CCHA 3PVXA 2LMRA 4TUQA 1NJXA 3PY8A 1GO3F 4YR0A 2KTQA 2PFOA 4UAZA 2W8KA 2A1JA 2XO7A 4IQVA 5DLGA 4UB6U 5IIKA 5AI5A 5KFAA 4TUSA 3Q8MA 1Q3UA 3ORYA 1RXWA 1S0OA 1L3VA 9ICCA 1T8EA 1NK5A 1SKSA 1WWUA 4RUAA 3PO5A 5CP2A 4NLNA 1S77D 3GZFA 1LB2B 4YN4A 1IIPA 5ALQA 4IQWA 4Y2PA 2DKXA 5KG3A 1UT8A 1ZD3A 3RH4A 4I2GA 3FDSA 3T5LA 4KLHA 3TAPA 3UMCA 4QZAA 1VLBA 5JU5A 4RQ0A 3F53A 2F2AB 1JMSA 1DOQA 5KFWA 3SQIA 1DXSA 1LV5A 3JPPA 1KFDA 3IRUA 3QU7A 2KKPA 4TUPA 4UB8U 4OJLA 2KZ3A 3H8MA 2FE9A 5EWFA 2LYHA 2AGPA 4JV1A 2F1HA 2BDPA 3H8SA 5CWRA 2C2RA 1N62A 3QEAZ 2B6GA 4FBUA 1NZPA 2PI5A 2O6KA 4MEYA 2W9MA 2XGPA 2QB0A 3ZDEA 4ZOHC 4DL3A 3WK5A 3I28A 3KKAA 2HHXA 9ICEA 3QXGA 3IG8A 5KT5A 3JPSA 3EW9A 4RU9A 1ZD4A 2YMPA 2NV3A 4JWMA 4K4HA 2AQ4A 4ED0A 7ICOA 2V9WA 5ALEA 5C0YA 4ECQA 2WB1C 4Z6CA 4HYKA 3T79A 2IHNA 4RQ8A 1S5LU 5ALDA 4ED1A 2JRZA 2HVHA 5KT3A 1XO0A 4NM1A 2EANA 4X5VA 1KLNA 4M0AA 2P6UA 4KMUA 4EZ9A 3WKBA 1WWVA 2EAMA 2NYVA 4MEXA 4RNNA 3RR7A 1D8BA 5KG1A 7ICSA 1Z1VA 3KHLA 2VJ5A 2L5YA 4YFKA 2K8AA 3EPGA 5DBBA 2BPCA 4O3OA 2KN7A 1SWVA 2NRTA 3Q8RB 3MDAA 4JK1A 3PMNA 8ICHA 3IP4B 3H0RB 5ALFA 5AKLA 5DQGA 4M9LA 4P0QA 4Q44A 1XS9D 4M9HA 3QZ7A 2KJ8A 3AQFA 3RAQA 5L9XA 4KTQA 1IM4A 2K4EA 7ICQA 2LHTA 1QQ7A 2J6SA 1ZOLA 4QZBA 3V6HA 2IA6A 5KFGA 3UPQA 7ICKA 4EBCA 3C28A 3NVZA 1ZETA 1QSSA 2CN1A 1KDHA 3MC1A 2XVTA 1ZQDA 4EEKA 1T4GA 1J2NA 3NUQA 1F0MA 3C5FA 2HOQA 3TACB 1SIJA 2C2DA 1ZQYA 3TFRA 5KFQA 3RBEA 5KFUA 2F1JA 2WF9A 3PW4A 3BQTA 4JV2A 1LKYB 3GU3A 2ZJAA 1UA1A 4QZHA 4RQ1A 4QZDA 1V85A 2MSNA 1OUQA 2DL0A 1N5WA 2BCRA 2H3IA 9ICNA 2FPLA 2E8NA 5ALZA 2RDIA 4BWMA 4RQ4A 4NL9A 4J9RA 5DBCA 5AM3A 3QUTA 2C2EA 1JALA 1QSLA 3PW2A 4QZ8A 4QZIA 1T3NA 4B9VA 5L1IA 1RQNA 2MA1A 4EENA 3F2DA 1DK3A 1QCKA 5BPCA 5IILA 4EEYA 5IIIA 1ZD5A 4ECWA 2KVCA 2E1FA 1SZPA 5ALMA 1KQQA 1NNLA 4UB4A 1Z3EB 2Y1IA 5KG5A 3GILA 3D2QA 4YR3A 4DFMA 2KSOB 1ZQFA 1FEZA 1L7PA 2WTFA 1N63A 8ICBA 2CPRA 4BUGA 4QZFA 4QIWF 2NO4A 4O3RA 3RR8A 1SKWA 4RUCA 1CRXA 1QSYA 5J2DA 7ICTA 2NO5A 3KFUF 3TAQA 3S6JA 1V38A 3SI8A 2MAXA 1ZQKA 1IG6A 4DL5A 1BNOA 1ZQQA 4EZ6A 1J97A 1SB3C 4KLGA 3T5JA 1L8OA 9ICIA 2R18A 7ICLA 1KEJA 1X6JA 1ZQTA 4GXKA 5EE0A 1KL9A 4M04A 3OSNA 2K4HA 5ALJA 2PXIA 1EXNA 1QQ6A 5KFMA 2XY6A 4DF4A 1X9SA 4Q8FA 1COOA 5ALOA 4RNOA 5B66U 2BZFA 2ZIVB 4ECRA 2EDUA 4Y2UA 4C80A 2LI6A 2WFAA 2R8KA 9ICJA 4IRCA 2JXJA 2AGQA 1BPXA 2Y9TA 4P0PA 2HHVA 4MF2A 4UAYA 2JGAA 3BS5B 4RPXA 5HHHA 3C1ZA 9ICVA 1SXDA 4R63A 2RDJA 2RHFA 2N1RA
chains in the Genus database with same CATH topology
2KSOB 3H8MA 2FE9A 2QARB 3HILA 2E8OA 4NL9C 2KSOA 1SV0A 2LPEA 4IS7A 2QB0B 1B4FA 2QARA 2B6GA 2D3DA 1PK3A 2KE7A 2EAPA 4RQNA 5KNIA 2QB0A 1F0MA 1KW4A 1X40A 2F3NA 2DKZA 3KKAA 3TACB 3TADC 2F44A 4RQMA 5F3XB 1V38A 5JRTA 1UCVA 3BS7A 4MHVA 5JTIA 4PZOA 1B0XA 1LKYB 5J8YC 1RG6A 1UQVA 3BQ7A 1OXJA 2LMRA 4NJ8A 1V85A 2ES6A 1JI7A 2K4PA 2E8PA 2DL0A 1SXEA 2KMDA 1PK1B 2KIVA 1OW5A 1LKYA 2KG5A 2Y9UA 2K60A 2E8NA 2EANA 1PK1A 4NL9A 1SV0C 1X66A 3SENA 3K1RB 2ESEA 1WWUA 2QKQA 1WWVA 2EAMA 1COKA 5L1MA 1SV4A 1Z1VA 2YTUA 2L5YA 3KKAC 2F8KA 3TADA 2JV3A 2DKXA 4PZNA 2EAOA 2Y9TA 2E8MA 3BS5B 1X9XA 5JU5A 2GLEA 2D8CA 1SXDA 2QB1A 5J8YA 1SGGA 1DXSA 3BS5A 3IDWA 3SEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSO B;  3H8M A;  2FE9 A;  2QAR B;  3HIL A;  2E8O A;  4NL9 C;  2KSO A;  1SV0 A;  2LPE A;  4IS7 A;  2QB0 B;  1B4F A;  2QAR A;  2B6G A;  2D3D A;  1PK3 A;  2KE7 A;  2EAP A;  4RQN A;  5KNI A;  2QB0 A;  1F0M A;  1KW4 A;  1X40 A;  2F3N A;  2DKZ A;  3KKA A;  3TAC B;  3TAD C;  2F44 A;  4RQM A;  5F3X B;  1V38 A;  5JRT A;  1UCV A;  3BS7 A;  4MHV A;  5JTI A;  4PZO A;  1B0X A;  1LKY B;  5J8Y C;  1RG6 A;  1UQV A;  3BQ7 A;  1OXJ A;  2LMR A;  4NJ8 A;  1V85 A;  2ES6 A;  1JI7 A;  2K4P A;  2E8P A;  2DL0 A;  1SXE A;  2KMD A;  1PK1 B;  2KIV A;  1OW5 A;  1LKY A;  2KG5 A;  2Y9U A;  2K60 A;  2E8N A;  2EAN A;  1PK1 A;  4NL9 A;  1SV0 C;  1X66 A;  3SEN A;  3K1R B;  2ESE A;  1WWU A;  2QKQ A;  1WWV A;  2EAM A;  1COK A;  5L1M A;  1SV4 A;  1Z1V A;  2YTU A;  2L5Y A;  3KKA C;  2F8K A;  3TAD A;  2JV3 A;  2DKX A;  4PZN A;  2EAO A;  2Y9T A;  2E8M A;  3BS5 B;  1X9X A;  5JU5 A;  2GLE A;  2D8C A;  1SXD A;  2QB1 A;  5J8Y A;  1SGG A;  1DXS A;  3BS5 A;  3IDW A;  3SEI A; 
#chains in the Genus database with same CATH topology
 2HOF A;  2DFL A;  2KIC A;  4US8 A;  4KLF A;  1QLN A;  1Z00 A;  3LWM A;  5AK5 A;  2AXT U;  4LJX A;  3WK9 A;  5AKZ A;  4QJF B;  2JEJ A;  3I1Y A;  8ICG A;  2OEH A;  4F4X A;  4ED7 A;  3M6Z A;  4F5R A;  3N7R C;  1TE2 A;  5TZV A;  3FAH A;  5AKY A;  5KNI A;  4P4M A;  2D6F C;  1KN5 A;  7ICN A;  4C7Z A;  1TVA A;  1ZQS A;  3H8J A;  1QQ5 A;  4J9M A;  2MUT B;  3BS7 A;  5D46 A;  4C8M A;  4U7C A;  2BCS A;  5GTH U;  4RPZ A;  4CF3 A;  4F92 B;  2BCV A;  3RRG A;  3L3F X;  3LDA A;  2VA8 A;  4DS5 A;  2W3S A;  8ICT A;  1DGJ A;  4RQ3 A;  4R8U B;  2Y9U A;  1L3U A;  4OJ6 A;  4A8E A;  4RT3 A;  2W03 A;  4J9N A;  5J0P A;  4IRK A;  4B9L A;  4UBC A;  3RB3 A;  1WUD A;  2KV2 A;  2HBK A;  3CW2 C;  2EZX A;  7ICI A;  3MGH A;  4PHA A;  4IR9 A;  1JXE A;  4DL4 A;  3UMG A;  1COK A;  2KZZ A;  4C0Z A;  2W9C B;  4J9S A;  1JRO A;  2E3T A;  4KN4 A;  2KIW A;  5AKE A;  5KT6 A;  5TIS U;  3BQ2 A;  3HT3 A;  1ZQI A;  4JUZ A;  1SL2 A;  8ICL A;  1X9M A;  5DG7 A;  4XA5 A;  4R66 A;  1NK8 A;  5EE1 A;  3F2B A;  2ALZ A;  3KOO A;  9ICQ A;  5J8Y A;  4KLT A;  3F5A A;  2EZY A;  3RF9 A;  5KFV A;  3SV3 A;  2ISP A;  4Q45 A;  4CE6 A;  5KFC A;  4I2F A;  4IS7 A;  1SKR A;  4KLU A;  5KFN A;  3ZI4 A;  4O3M A;  9ICH A;  3ZD8 A;  1S9F A;  3UQ2 A;  3LVV A;  4NLB A;  2Q4T A;  3RTV A;  4JWN A;  3WK6 A;  1NOM A;  2GOL A;  4CNQ A;  1F44 A;  2A19 A;  4XUS A;  3SV4 A;  3ICX A;  8ICO A;  4K4G A;  3TAD C;  4F72 A;  1ZQV A;  3GFK B;  5HHI A;  5HR6 A;  2R8J A;  2I1Q A;  3MGV A;  4F3O A;  4PL1 A;  3ONN A;  3QU4 A;  2DUY A;  1A6S A;  3RJF A;  4Z6D A;  1HEK A;  5KTQ A;  4EBE A;  4RNM A;  2VAN A;  2F8L A;  2UVR A;  2YML A;  1XSP A;  5DQI A;  2A3V A;  5D49 A;  2FLN A;  2WAQ F;  3B0X A;  4BXO A;  4LZG A;  3J81 j;  8ICZ A;  5AM4 A;  3MR3 A;  4Q43 A;  4TQR A;  4DLE A;  3OPX A;  3SR6 A;  5HNK A;  3SD7 A;  5KFP A;  2R8H A;  2ASL A;  2W9A A;  4Y2Y A;  2KK0 A;  2BGW A;  3SAF A;  1N5X A;  4NWI A;  1ZXI A;  4NY8 A;  4MFF A;  5K4L A;  4Z6F A;  1M6Y A;  3RJK A;  2JMG A;  3JPQ A;  5G5H A;  4CF5 A;  2OH2 A;  2PFP A;  5ALT A;  3NVY A;  4ICA A;  3CYM A;  4YMO A;  5KAI U;  2J6U A;  4I27 A;  3SZ2 A;  4OCZ A;  2LPE A;  7ICH A;  2K8C B;  4O5E A;  2QAR A;  3TKA A;  2OM6 A;  1ZQZ A;  4QIW C;  1L5U A;  4NLC A;  8ICI A;  5KFO A;  1ZQU A;  1X40 A;  9ICW A;  1XO1 A;  8ICE A;  4M6W A;  4O3P A;  2DKZ A;  2B21 A;  1WCN A;  5KFF A;  1TK8 A;  3EPI A;  4DF8 A;  5AIA A;  2W8L A;  2HW3 A;  3VC8 A;  2VA3 A;  1NK4 A;  5JUM A;  9ICT A;  1PVR A;  1FFV A;  4TQS A;  1OXJ A;  3DEE A;  2KHV A;  2I9G A;  1MC8 A;  2ES6 A;  2KIV A;  1OW5 A;  2P6R A;  2KG5 A;  5DDM A;  2KFN A;  2NRW A;  4QZE A;  2LM4 A;  5KFY A;  3PW0 A;  4UAU A;  8ICM A;  5EOZ A;  1BPD A;  2W7O A;  5C5J A;  3HX0 A;  7ICE A;  2QKQ A;  3AQE A;  4C4T A;  4GFJ A;  2YMQ A;  3OGU A;  2G08 A;  3WKC A;  4BDP A;  2AU0 A;  3RH6 A;  4HAI A;  3KD3 A;  1XU4 A;  3GIJ A;  5CEH A;  4KLS A;  4EYI B;  4B9T A;  4F93 B;  3T5K A;  3MDC A;  4C4S A;  4DOB A;  5ALW A;  5AIC A;  1BNP A;  4FE3 A;  2GLE A;  1FFU A;  5DDY A;  4QWD A;  1K1S A;  2YQE A;  1HJP A;  4XQ8 A;  5F9N A;  1KSP A;  1DK2 A;  1BPZ A;  5KT7 A;  4DOC A;  4CDG A;  3N28 A;  3PW7 A;  1YZ7 A;  2EZZ A;  3ZDC A;  3L5K A;  3V6K A;  4B9M A;  4PHP A;  4OJO A;  3JPT A;  3PML A;  1RQL A;  3HIL A;  3QUB A;  3GIK A;  1RXV A;  1ZQA A;  2W54 A;  3K4G A;  3LVW A;  1D9F A;  4DSE A;  4OD0 A;  5AK6 A;  3OJU A;  1L3T A;  1RYS A;  5KL8 B;  4O5K A;  2I5H A;  5CJ7 A;  9ICO A;  2PMZ F;  3RJE A;  3GDX A;  3IG5 A;  1T3Q A;  1QH9 A;  2FLP A;  5AM5 A;  1MSW D;  1B0X A;  1NK0 A;  9ICP A;  4J9O A;  4MF8 A;  4I2B A;  2W55 A;  4QWE A;  2JEG A;  1URJ A;  4B9N A;  2Z7J A;  3H4D A;  7ICM A;  1PK1 B;  2JH1 A;  2G5H B;  4WJ3 B;  1ZYQ A;  4ELV A;  8ICY A;  4GC6 A;  2IOF A;  1BPE A;  1NJZ A;  2ZIU B;  3UQ0 A;  2IMW P;  3V6J A;  1C20 A;  4ACO A;  1U4B A;  3MFH A;  1PUZ A;  5EE9 A;  1L3S A;  4FZL A;  4YXM A;  2UVU A;  2K89 A;  2YX8 A;  3RJJ A;  4ECV A;  4QW8 A;  3ETL A;  5AHX A;  4YMM A;  4KX5 A;  3WKE A;  4TUR A;  5DB6 A;  4YQW A;  2E8M A;  2WF7 A;  3QZ8 A;  5AIB A;  4IL6 U;  2DF4 B;  4DQS A;  3M9N B;  5T14 A;  2GO7 A;  3MGI A;  1Z1B A;  2G07 A;  5KFZ A;  1FIQ A;  4J03 A;  2FI1 A;  3TI0 A;  3CRX A;  2KEY A;  4XRH A;  4DSF A;  4DO9 A;  5DGA A;  4UB1 A;  3OHA A;  4F5P A;  3D2N A;  3IHQ B;  1CI4 A;  1BPY A;  1IV8 A;  3HRD D;  4BJQ A;  1DGS A;  4UB3 A;  1S97 A;  5KT4 A;  4EEL A;  1YT3 A;  9ICG A;  4ECY A;  2W3R A;  3QU5 A;  4DOA A;  1V9P A;  2F3N A;  1XWL A;  5DLF A;  5AI8 A;  4YG2 A;  2ODG A;  3H4B A;  4QWC A;  5ALS A;  2DWQ A;  2AJQ A;  1AQ6 A;  2IHM A;  2JZB B;  1KTQ A;  2P35 A;  3GV5 B;  1ECW A;  2C22 A;  1B22 A;  4KLO A;  4F4K A;  1BPB A;  2G09 A;  1A77 A;  2JEF A;  9ICU A;  1ZQC A;  1RYR A;  1S8O A;  3QNM A;  1XC9 A;  2HHW A;  2KNJ A;  1KFT A;  1LKY A;  3AM9 A;  5J2C A;  3RB0 A;  3M9O B;  2VKQ A;  2ZIX B;  2F76 X;  5J0S A;  2W9B B;  1X66 A;  4G9B A;  3MR6 A;  2M9N A;  5KFR A;  3NS1 A;  2UVV A;  8ICW A;  1ARO P;  2WAQ C;  3NTU A;  3BZK A;  1IXR A;  5G5G A;  1SV4 A;  2WF5 A;  4I29 A;  1O03 A;  4Y2S A;  3UMB A;  1J2M A;  3C21 A;  4GLX A;  1ZQN A;  3O0F A;  1NI3 A;  4DQP A;  4BGD A;  3UXO A;  3AN1 A;  1KBU A;  4F5O A;  1TAQ A;  4QNL A;  4Y2V A;  5ALI A;  3T3F A;  1Z4N A;  4NXZ A;  3H0M B;  4GXJ A;  3RB4 A;  2D8C A;  1MQ3 A;  4PGQ A;  3KHH A;  4DL6 A;  3D2S A;  5HMM A;  5CA7 A;  4FS1 A;  5KFX A;  3D6J A;  4DFK A;  8ICC A;  3AUO A;  3B9J A;  5ALX A;  2OHF A;  2LBO A;  3H40 A;  5AM1 A;  4B9U A;  1PVQ A;  2E8O A;  1TK5 A;  2BQU A;  2OWO A;  2KSO A;  3TAN A;  3K1Z A;  2ZIW B;  4C4R A;  5ALK A;  3M1Y A;  1X2I A;  3ZDA A;  5J0X A;  1L7N A;  4ELT A;  5AI6 A;  1NJW A;  4QZC A;  1Z4O A;  3SMV A;  5F3X B;  2ASJ A;  3C1Y A;  4CF4 A;  1UCV A;  3E0F A;  2OYY A;  5KAF U;  8ICF A;  8ICX A;  4RQ5 A;  3PZP A;  1ZQM A;  4PZO A;  5KFH A;  3PR5 B;  3TAR A;  1PZN A;  4PH5 A;  2PI4 A;  4UAW A;  3C2L A;  5IIO A;  4PL2 A;  5ALN A;  3RJH A;  5AKJ A;  4NM2 A;  4ELU A;  1S76 D;  3M6K A;  3RJG A;  5DB8 A;  2XC9 A;  4DL7 A;  4DQR A;  2BHN A;  3SAG A;  2HSZ A;  5ALY A;  3IV6 A;  5J2A A;  1UA0 A;  1LVH A;  5CHG A;  4J9Q A;  3TFS A;  2HVI A;  3EZ5 A;  1ZQP A;  5J2E A;  2FLL A;  1K1Q A;  5KL1 B;  3TAD A;  2HHT A;  3QUQ A;  4YCX A;  2ZIV A;  4R64 A;  4ECS A;  2PFN A;  1UHU A;  2AH5 A;  4C8O A;  1L8L A;  4CGZ A;  3EYZ A;  4P4O A;  2QLT A;  4DL2 A;  4DLG A;  5J0O A;  3BS5 A;  4B9S A;  4AP9 A;  2WF6 A;  3ETR A;  5J0R A;  3JPO A;  2XID A;  1F5S A;  4DCC A;  2XY5 A;  4KLQ A;  9ICX A;  4GXI A;  2KP7 A;  4M9G A;  4JB3 A;  9ICF A;  3U26 A;  1CUK A;  3KBB A;  5DQH A;  2LKY A;  1D8L A;  4FZN A;  2D3D A;  2LM1 A;  5E79 U;  3WK4 A;  3UXN A;  5ALV A;  3OHB A;  1VJ5 A;  1ZQ1 C;  4ECZ A;  4QW9 A;  2H5X A;  2R8G A;  2V4R A;  1S0M A;  8ICR A;  3NVV A;  4I2D A;  4EX6 A;  2KJ9 A;  3MR5 A;  8ICK A;  1WG8 A;  1JUD A;  5DGB A;  3HPO A;  4ED6 A;  3N7P D;  2PMZ C;  3OSP A;  4IR1 A;  4QWA A;  2A1J B;  1RG6 A;  1ED1 A;  2MUT A;  4M9N A;  1FO4 A;  1BVS A;  1T7P A;  5J2F A;  2BQR A;  2K4P A;  2JH7 A;  4LVS A;  5J0Q A;  2XCA A;  3E58 A;  4YXJ A;  3AU2 A;  2EH9 A;  2HHQ A;  1SV0 C;  4DSJ A;  2HBM A;  4R8U A;  3QU2 A;  3GV8 B;  1H38 A;  4AYB F;  4J9P A;  5ALL A;  4RQ6 A;  2BCU A;  3QX7 A;  2XGQ A;  8ICP A;  5L1M A;  3UXP A;  2A1A A;  3QEB Z;  2YTU A;  2Y1J A;  3JPR A;  4QWB A;  5F9L A;  1NK7 A;  3M9M B;  4ECX A;  4IQT A;  4NLG A;  2W9C A;  2ISO A;  3C23 A;  2YY6 A;  2DPJ A;  1TFR A;  2MU2 A;  1TAU A;  4C8K A;  1SGG A;  4DWI A;  2W11 A;  3RH5 A;  2BPF A;  4USA A;  1RZT A;  1A76 A;  4CRX A;  5AKX A;  2C28 A;  5EE3 A;  4ECT A;  2CXY A;  1XNS A;  4KIT B;  1SWW A;  2QB0 B;  1JN3 A;  3PO4 A;  4EX7 A;  4E0D A;  1ZQG A;  5J2H A;  4ECU A;  5IIJ A;  5DG9 A;  1CEZ A;  2ZXI A;  3HW8 A;  4UW9 A;  2RQ5 A;  4RQM A;  8ICQ A;  2KD1 A;  3BQ1 A;  4GC7 A;  4JV0 A;  4KLL A;  3OTQ A;  2HDO A;  5ALR A;  5HR7 A;  9ICA A;  1ZQB A;  4K4I A;  3AL0 B;  4NJ8 A;  3WKD A;  1JI7 A;  1S10 A;  1RDF A;  9ICB A;  2ZXH A;  4PGY A;  4R65 A;  4O3S A;  1XSL A;  2KOB A;  2RP5 A;  5J2B A;  3BJY A;  4US9 A;  2FPM A;  1MQ2 A;  5J0T A;  2H3Z A;  2W04 A;  3SEN A;  7ICR A;  1HUO A;  3PSF A;  2G06 A;  4GIB A;  4KLM A;  1JIH A;  3AU6 A;  2MRL A;  4DQI A;  1C7Y A;  3OJS A;  2F77 X;  4J9K A;  4IC9 A;  1RYU A;  2FMP A;  1N61 A;  1SL1 A;  2K4I A;  3E2E A;  2FJ6 A;  1PVP A;  2BCQ A;  3A0B U;  4P0Q B;  2NRX A;  3MAB A;  4FBT A;  3NRZ A;  3WK8 A;  1X9X A;  4J9L A;  2QB1 A;  9ICR A;  7ICG A;  3MBY A;  1N60 A;  5H2F U;  4I28 A;  3PST A;  4FZM A;  9ICM A;  3RJI A;  3KZI U;  4U6P A;  4FFD A;  4YP3 A;  3CNH A;  3H7I A;  4RZR A;  8ICU A;  3PV8 A;  1HIW A;  3NGD A;  4UAS A;  5ALG A;  1L7O A;  5DBA A;  4YD2 A;  1ZQR A;  3N97 B;  3RRH A;  2KJ5 A;  1JXL A;  4F2S A;  4UB5 A;  9ICK A;  3QE9 Y;  3BQ0 A;  5AM2 A;  4C7Y A;  5AK4 A;  4UAT A;  3MR2 A;  2HBL A;  8ICV A;  1U47 A;  3Q8L A;  4EYH B;  4PJ0 U;  1X9W A;  1WYG A;  2YB1 A;  3H0L B;  3GV7 B;  1HUZ A;  1VDV A;  2P66 A;  4DEZ A;  1TKD A;  4F5N A;  4Y2X A;  5CB1 A;  4KLD A;  2ATL A;  4Y2R A;  1K5O A;  2XY7 A;  5J2K A;  5KFK A;  2KMD A;  1SXE A;  5DG8 A;  4PPX A;  5L1K A;  4M9J A;  3MFI A;  5KFL A;  2ZTC A;  3QU9 A;  2FPK A;  4UB2 A;  2HMX A;  2OXO A;  2Q0Z X;  1RPL A;  3ED5 A;  9ICL A;  3RB6 A;  4Y2T A;  2XCP A;  1U9L A;  3GIM A;  5KFD A;  4BWJ A;  1ZRN A;  1B43 A;  2YMM A;  4O0I A;  1ZQJ A;  3PNC A;  1RM6 C;  3KKA C;  2DPI A;  2JV3 A;  3V7L A;  1Q46 A;  2KHQ A;  2RLT A;  3M7D A;  2ZUB A;  2KZM A;  1YZ6 A;  1TV9 A;  1S0N A;  4PHE A;  5CRX A;  1U45 A;  1U49 A;  4ED8 A;  5DB9 A;  4ZH4 A;  3RBD A;  7ICJ A;  1NJY A;  2IOF K;  4MFC A;  4UAR A;  5BOM A;  5AI9 A;  3Q8K A;  3ZDB A;  5KFJ A;  1L7M A;  2Y0S F;  3ISB A;  5HP4 A;  3PSP A;  4G3I A;  3HKZ F;  2FMQ A;  2ZG6 A;  3M8R A;  4RT2 A;  3F5E A;  1N2X A;  2B0C A;  4DFP A;  2EAP A;  3LK9 A;  2ASD A;  5AM0 A;  5KG6 A;  1DRG A;  4F4Z A;  2KKV A;  4PGX A;  1UPH A;  4DQQ A;  3Q8P B;  1BGX T;  5CR0 A;  3FM9 A;  5JRT A;  4MHV A;  2F1I A;  3Q8Q B;  3WKA A;  5KFI A;  3IN5 A;  2FMS A;  3HJE A;  3QUC A;  4KN7 A;  4ED3 A;  2K8B B;  1UQV A;  3BQ7 A;  3VCB A;  5ALU A;  3RFA A;  1TK0 A;  3UM9 A;  8ICA A;  5J0Y A;  2DQN B;  4EBD A;  3TQ1 A;  3HP6 A;  2R8I A;  2E5S A;  4B6J A;  4BX9 C;  1PK1 A;  4IQU A;  2IBK A;  3ZDD A;  2G0A A;  5J29 A;  3K1R B;  2JHD A;  1KKX A;  4DSK A;  2HBJ A;  4RQ7 A;  3BDP A;  3WK7 A;  5J2G A;  3A0H U;  1A0P A;  4DS4 A;  2ZIU A;  4IRD A;  4AYB C;  3L4P A;  4P0P B;  3IM1 A;  2HI0 A;  1KFS A;  5J0U A;  4I2H A;  5KG2 A;  2PKE A;  2HOI A;  4OO1 J;  2GH1 A;  2H3F A;  5DKW A;  4C8N A;  2HHU A;  3ALR A;  4P4P A;  4PHD A;  2IOH A;  1Z00 B;  4OJP A;  2I6X A;  2VA2 A;  4LZD A;  3G6Y A;  1U48 A;  2UVW A;  2VIX A;  3EWA A;  1ZQL A;  5KFT A;  1X6I A;  3DV9 A;  3AMZ A;  3THV A;  4F4W A;  2E1E A;  4YR2 A;  2V4Q A;  3V7J A;  1ZJN A;  3QYP A;  2WF8 A;  4OJ5 A;  4F50 A;  4I2J A;  1X42 A;  3SAH A;  4NL9 C;  2AGO A;  3G6X A;  2EQY A;  3C5G A;  3PX6 A;  3ISD A;  4UBB A;  3N7S C;  1PK3 A;  5EWG A;  3KTQ A;  4NLZ A;  3I76 A;  3PW5 A;  3PX0 A;  1Q8K A;  2LYA A;  3GII A;  2F44 A;  3ZD9 A;  1SL0 A;  4M47 A;  4I2I A;  4F8R A;  1Y88 A;  1JRP A;  4F91 B;  5EWE A;  2JEI A;  1ZQE A;  2WB1 F;  1JX4 A;  4I2C A;  3CP8 A;  2JZB A;  4YVZ A;  3C29 A;  5FP0 A;  4ED2 A;  2GWS A;  1WCL A;  4I2E A;  4UQG A;  1TAM A;  1Z19 A;  8ICS A;  2HCF A;  2VJ4 A;  5KG4 A;  1L6N A;  1T94 A;  1UT5 A;  5KG7 A;  2ZJ8 A;  3V7K A;  5D4B A;  5ALH A;  1NK6 A;  2ZIX A;  2BKE A;  2BDU A;  2W9B A;  2BR0 A;  4I2A A;  2W7P A;  1N48 A;  1MA7 A;  2G5I B;  3R9K A;  4O3N A;  7ICU A;  4F2R A;  2PFQ A;  3NRW A;  1ZD2 P;  4PZN A;  2EAO A;  3KZX A;  7ICV A;  1ZJM A;  5HML A;  3N4M B;  4Q8E A;  2LYB A;  1O08 A;  3C2K A;  3IDW A;  2ZTD A;  3PR4 A;  3H8W A;  5AKI A;  2H3V A;  8ICJ A;  5AI0 A;  5AKH A;  3NVW A;  4KLJ A;  4O3Q A;  1ZQO A;  3HWT A;  1N56 A;  1SV0 A;  2ZTE A;  3KHG A;  2W43 A;  3WU2 U;  1B4F A;  3LWL A;  2ZJ5 A;  4RQ2 A;  2KE7 A;  4M2Y A;  3K75 D;  5IIN A;  1NKE A;  3PX4 A;  3ISC A;  3BZC A;  4RPY A;  4KLI A;  3C2M A;  1MN8 A;  4DFD A;  1KW4 A;  2ZIW A;  4DSI A;  2NRV A;  3DDH A;  3EUB 2;  5L1J A;  3M8S A;  4Z6E A;  2XI9 A;  5A0L A;  1NKB A;  5AKG A;  4YD1 A;  5AI4 A;  2AQ0 A;  5KFE A;  3B0Y A;  3Q8S B;  2H3Q A;  4KLE A;  2DGZ A;  7ICP A;  2E8P A;  2HHS A;  5KG0 A;  2M0N A;  3V72 A;  4BXO B;  2YB4 A;  2K60 A;  5KFB A;  2AHO B;  2CRX A;  2JR5 A;  4QZ9 A;  1S0V A;  4KMO B;  1D8Y A;  3G6V A;  2ESE A;  3LYS A;  4Y2J A;  1V97 A;  4O9M A;  3GQC A;  4DSL A;  2OCE A;  5J0W A;  2DBY A;  5L1L A;  5KFS A;  4FO6 A;  9ICS A;  1ZQH A;  8ICN A;  4UAV A;  2F8K A;  1KRP A;  5KT2 A;  2KFZ A;  2YN4 A;  2XIC A;  4C8L A;  2ZUD A;  2ZUC A;  1QTM A;  3NAS A;  1ZQW A;  5IIM A;  4F71 A;  1D9D A;  7ICF A;  3AEV A;  4NLK A;  1SZH A;  4MFA A;  3SEI A;  3JPN A;  4FS2 A;  2RRD A;  2FDR A;  4DFJ A;  5B5E U;  3FYH A;  2NRZ A;  3SYZ A;  1NZB A;  2QAR B;  3PSI A;  4P2H A;  1ZQX A;  2Y0S C;  5GTI U;  4QZG A;  3FC4 A;  2KVS A;  1Q3V A;  4F4Y A;  3F2C A;  4M6W B;  1ZRM A;  3HKZ C;  4RQN A;  2J6T A;  3RAX A;  5DB7 A;  4JMU A;  4YMN A;  4O5C A;  5AKK A;  1NKC A;  1XSN A;  2WHE A;  5AK3 A;  5J2I A;  4KX3 A;  4F5Q A;  5J2J A;  5ALP A;  1NK9 A;  4NV0 A;  3KHR A;  5JTI A;  1P7D A;  2BPG A;  3T5H A;  5BOL A;  2BQ3 A;  5J8Y C;  4Y2Q A;  4CCH A;  3PVX A;  2LMR A;  4TUQ A;  1NJX A;  3PY8 A;  1GO3 F;  4YR0 A;  2KTQ A;  2PFO A;  4UAZ A;  2W8K A;  2A1J A;  2XO7 A;  4IQV A;  5DLG A;  4UB6 U;  5IIK A;  5AI5 A;  5KFA A;  4TUS A;  3Q8M A;  1Q3U A;  3ORY A;  1RXW A;  1S0O A;  1L3V A;  9ICC A;  1T8E A;  1NK5 A;  1SKS A;  1WWU A;  4RUA A;  3PO5 A;  5CP2 A;  4NLN A;  1S77 D;  3GZF A;  1LB2 B;  4YN4 A;  1IIP A;  5ALQ A;  4IQW A;  4Y2P A;  2DKX A;  5KG3 A;  1UT8 A;  1ZD3 A;  3RH4 A;  4I2G A;  3FDS A;  3T5L A;  4KLH A;  3TAP A;  3UMC A;  4QZA A;  1VLB A;  5JU5 A;  4RQ0 A;  3F53 A;  2F2A B;  1JMS A;  1DOQ A;  5KFW A;  3SQI A;  1DXS A;  1LV5 A;  3JPP A;  1KFD A;  3IRU A;  3QU7 A;  2KKP A;  4TUP A;  4UB8 U;  4OJL A;  2KZ3 A;  3H8M A;  2FE9 A;  5EWF A;  2LYH A;  2AGP A;  4JV1 A;  2F1H A;  2BDP A;  3H8S A;  5CWR A;  2C2R A;  1N62 A;  3QEA Z;  2B6G A;  4FBU A;  1NZP A;  2PI5 A;  2O6K A;  4MEY A;  2W9M A;  2XGP A;  2QB0 A;  3ZDE A;  4ZOH C;  4DL3 A;  3WK5 A;  3I28 A;  3KKA A;  2HHX A;  9ICE A;  3QXG A;  3IG8 A;  5KT5 A;  3JPS A;  3EW9 A;  4RU9 A;  1ZD4 A;  2YMP A;  2NV3 A;  4JWM A;  4K4H A;  2AQ4 A;  4ED0 A;  7ICO A;  2V9W A;  5ALE A;  5C0Y A;  4ECQ A;  2WB1 C;  4Z6C A;  4HYK A;  3T79 A;  2IHN A;  4RQ8 A;  1S5L U;  5ALD A;  4ED1 A;  2JRZ A;  2HVH A;  5KT3 A;  1XO0 A;  4NM1 A;  2EAN A;  4X5V A;  1KLN A;  4M0A A;  2P6U A;  4KMU A;  4EZ9 A;  3WKB A;  1WWV A;  2EAM A;  2NYV A;  4MEX A;  4RNN A;  3RR7 A;  1D8B A;  5KG1 A;  7ICS A;  1Z1V A;  3KHL A;  2VJ5 A;  2L5Y A;  4YFK A;  2K8A A;  3EPG A;  5DBB A;  2BPC A;  4O3O A;  2KN7 A;  1SWV A;  2NRT A;  3Q8R B;  3MDA A;  4JK1 A;  3PMN A;  8ICH A;  3IP4 B;  3H0R B;  5ALF A;  5AKL A;  5DQG A;  4M9L A;  4P0Q A;  4Q44 A;  1XS9 D;  4M9H A;  3QZ7 A;  2KJ8 A;  3AQF A;  3RAQ A;  5L9X A;  4KTQ A;  1IM4 A;  2K4E A;  7ICQ A;  2LHT A;  1QQ7 A;  2J6S A;  1ZOL A;  4QZB A;  3V6H A;  2IA6 A;  5KFG A;  3UPQ A;  7ICK A;  4EBC A;  3C28 A;  3NVZ A;  1ZET A;  1QSS A;  2CN1 A;  1KDH A;  3MC1 A;  2XVT A;  1ZQD A;  4EEK A;  1T4G A;  1J2N A;  3NUQ A;  1F0M A;  3C5F A;  2HOQ A;  3TAC B;  1SIJ A;  2C2D A;  1ZQY A;  3TFR A;  5KFQ A;  3RBE A;  5KFU A;  2F1J A;  2WF9 A;  3PW4 A;  3BQT A;  4JV2 A;  1LKY B;  3GU3 A;  2ZJA A;  1UA1 A;  4QZH A;  4RQ1 A;  4QZD A;  1V85 A;  2MSN A;  1OUQ A;  2DL0 A;  1N5W A;  2BCR A;  2H3I A;  9ICN A;  2FPL A;  2E8N A;  5ALZ A;  2RDI A;  4BWM A;  4RQ4 A;  4NL9 A;  4J9R A;  5DBC A;  5AM3 A;  3QUT A;  2C2E A;  1JAL A;  1QSL A;  3PW2 A;  4QZ8 A;  4QZI A;  1T3N A;  4B9V A;  5L1I A;  1RQN A;  2MA1 A;  4EEN A;  3F2D A;  1DK3 A;  1QCK A;  5BPC A;  5IIL A;  4EEY A;  5III A;  1ZD5 A;  4ECW A;  2KVC A;  2E1F A;  1SZP A;  5ALM A;  1KQQ A;  1NNL A;  4UB4 A;  1Z3E B;  2Y1I A;  5KG5 A;  3GIL A;  3D2Q A;  4YR3 A;  4DFM A;  2KSO B;  1ZQF A;  1FEZ A;  1L7P A;  2WTF A;  1N63 A;  8ICB A;  2CPR A;  4BUG A;  4QZF A;  4QIW F;  2NO4 A;  4O3R A;  3RR8 A;  1SKW A;  4RUC A;  1CRX A;  1QSY A;  5J2D A;  7ICT A;  2NO5 A;  3KFU F;  3TAQ A;  3S6J A;  1V38 A;  3SI8 A;  2MAX A;  1ZQK A;  1IG6 A;  4DL5 A;  1BNO A;  1ZQQ A;  4EZ6 A;  1J97 A;  1SB3 C;  4KLG A;  3T5J A;  1L8O A;  9ICI A;  2R18 A;  7ICL A;  1KEJ A;  1X6J A;  1ZQT A;  4GXK A;  5EE0 A;  1KL9 A;  4M04 A;  3OSN A;  2K4H A;  5ALJ A;  2PXI A;  1EXN A;  1QQ6 A;  5KFM A;  2XY6 A;  4DF4 A;  1X9S A;  4Q8F A;  1COO A;  5ALO A;  4RNO A;  5B66 U;  2BZF A;  2ZIV B;  4ECR A;  2EDU A;  4Y2U A;  4C80 A;  2LI6 A;  2WFA A;  2R8K A;  9ICJ A;  4IRC A;  2JXJ A;  2AGQ A;  1BPX A;  2Y9T A;  4P0P A;  2HHV A;  4MF2 A;  4UAY A;  2JGA A;  3BS5 B;  4RPX A;  5HHH A;  3C1Z A;  9ICV A;  1SXD A;  4R63 A;  2RDJ A;  2RHF A;  2N1R A; 
#chains in the Genus database with same CATH homology
 2KSO B;  3H8M A;  2FE9 A;  2QAR B;  3HIL A;  2E8O A;  4NL9 C;  2KSO A;  1SV0 A;  2LPE A;  4IS7 A;  2QB0 B;  1B4F A;  2QAR A;  2B6G A;  2D3D A;  1PK3 A;  2KE7 A;  2EAP A;  4RQN A;  5KNI A;  2QB0 A;  1F0M A;  1KW4 A;  1X40 A;  2F3N A;  2DKZ A;  3KKA A;  3TAC B;  3TAD C;  2F44 A;  4RQM A;  5F3X B;  1V38 A;  5JRT A;  1UCV A;  3BS7 A;  4MHV A;  5JTI A;  4PZO A;  1B0X A;  1LKY B;  5J8Y C;  1RG6 A;  1UQV A;  3BQ7 A;  1OXJ A;  2LMR A;  4NJ8 A;  1V85 A;  2ES6 A;  1JI7 A;  2K4P A;  2E8P A;  2DL0 A;  1SXE A;  2KMD A;  1PK1 B;  2KIV A;  1OW5 A;  1LKY A;  2KG5 A;  2Y9U A;  2K60 A;  2E8N A;  2EAN A;  1PK1 A;  4NL9 A;  1SV0 C;  1X66 A;  3SEN A;  3K1R B;  2ESE A;  1WWU A;  2QKQ A;  1WWV A;  2EAM A;  1COK A;  5L1M A;  1SV4 A;  1Z1V A;  2YTU A;  2L5Y A;  3KKA C;  2F8K A;  3TAD A;  2JV3 A;  2DKX A;  4PZN A;  2EAO A;  2Y9T A;  2E8M A;  3BS5 B;  1X9X A;  5JU5 A;  2GLE A;  2D8C A;  1SXD A;  2QB1 A;  5J8Y A;  1SGG A;  1DXS A;  3BS5 A;  3IDW A;  3SEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...