2DGZA

Solution structure of the helicase and rnase d c-terminal domain in werner syndrome atp-dependent helicase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
GSSGSSGSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLWEVIKHFCQTNSVQTDLFSSTKPQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Werner syndrome protein variant
publication title Solution structure of the Helicase and RNase D C-terminal domain in Werner syndrome ATP-dependent helicase
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 24
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2dgzA01
2HBLA 3CYMA 2CPRA 4CGZA 1D8BA 2HBJA 2MA1A 2E1EA 2RRDA 1YT3A 3SAGA 2KV2A 2E1FA 5C0YA 3SAFA 2HBKA 1GO3F 4QIWF 4NLCA 4O3MA 4QJFB 3SAHA 2RHFA 1WUDA 4CDGA 4NLBA 4OO1J 2HBMA 2DGZA
chains in the Genus database with same CATH superfamily
2BCRA 3QNMA 2CPRA 4IC9A 3SENA 3GFKB 2PI4A 2GH1A 1SL0A 1UPHA 1NI3A 1WWUA 4XQ8A 3M1YA 5KFJA 2XIDA 2DL0A 3MR3A 4KLOA 2JEGA 3WKEA 4EBDA 1X66A 1SV0A 4PHEA 2ZIWB 2AQ0A 3RJKA 1F0MA 3PW0A 4KLSA 4EEYA 3PX6A 1ECWA 2E8NA 4KLDA 4P0QB 5KFNA 1PK3A 3FAHA 1QQ6A 5AK4A 5B5EU 2YY6A 4IS7A 4AP9A 4YG2A 2DKXA 4RQ6A 4QZ8A 3NTUA 2E5SA 2L5YA 3PSPA 5CP2A 1A0PA 4QZIA 4ECSA 1S0OA 1ZQYA 3WKAA 2HBJA 3PSIA 5KG7A 2KJ9A 4F91B 5AKKA 2BR0A 2BGWA 3D2QA 5J0PA 5AM5A 2DBYA 4KLMA 3U26A 4DLGA 4JB3A 2VJ4A 1PVQA 2Q4TA 2W03A 5ALIA 5KFGA 3UXPA 4JWMA 2HMXA 2D3DA 2AGOA 2JZBB 5E79U 5J0UA 2WB1F 8ICPA 3Q8PB 2ALZA 4MF2A 1DK2A 2JHDA 3RFAA 2A1JB 2W9MA 2ZIUA 1BPZA 4P4OA 5KNIA 3RR8A 3CP8A 2DPJA 1BNPA 2PMZF 3F2CA 4DSJA 4I27A 3V7LA 2HHWA 2CRXA 2YTUA 4OJ5A 3HT3A 9ICXA 1XNSA 1FIQA 3WK6A 3RB0A 1XO0A 4Y2XA 2BKEA 5KT7A 1QSSA 3BQ1A 4IR1A 2AJQA 9ICFA 2FI1A 1ZQDA 1Q3VA 3GIMA 4M6WB 4A8EA 4FE3A 1L7OA 2ZUDA 4DQQA 3RB3A 4CNQA 2W04A 3MGHA 5GTIU 2XCPA 1ZRMA 2BCVA 5KFPA 2KZMA 3RBDA 1J2NA 2ZJ5A 3AU6A 5ALNA 4DFMA 4U7CA 4C7ZA 4ECVA 4UB8U 1RYRA 2ZIWA 4DFJA 1ED1A 1ZQHA 1CEZA 5DG9A 1T8EA 3TI0A 1RPLA 2E1EA 2F8KA 2CN1A 5J29A 2G5HB 2Y9UA 3GIJA 3BDPA 5CEHA 3ONNA 2RHFA 2JEIA 4RQ5A 2KZ3A 3F2BA 1N61A 7ICGA 3ZI4A 1N5XA 3JPOA 2W9BA 5J0QA 1KBUA 3SV4A 4B9NA 5KFUA 4PGQA 5J0SA 4I2EA 1VLBA 2A1AA 3AM9A 3GQCA 5IIMA 5KAFU 4QJFB 4HYKA 1OUQA 3V7KA 5KFVA 3RH4A 4O3OA 2ISPA 1L3VA 1S8OA 3G6YA 5KG2A 5AKYA 2HHSA 2QB1A 2KNJA 4UAZA 1L8OA 2EQYA 2JZBA 4CF5A 1DRGA 1T3NA 4NY8A 5KFKA 5ALRA 4ED6A 1ZQXA 4LJXA 7ICIA 3QUBA 3LWLA 1SZHA 4MFCA 3ORYA 1V9PA 1ZQRA 1KW4A 2AGQA 1V97A 1XC9A 4CE6A 2GOLA 5AI4A 2HHVA 2KTQA 5ALSA 2LMRA 2H3QA 4IL6U 2RLTA 4Y2PA 5AM1A 4ELVA 4F5PA 1RXVA 3TAQA 5EE9A 3SMVA 4DOBA 2JXJA 2RQ5A 4RQ3A 3KBBA 1ZETA 3MBYA 4ED2A 4F50A 2K4EA 1B22A 2RRDA 1C7YA 4EBEA 2R8GA 2FMPA 5AKHA 5J8YC 4B6JA 1KLNA 3PR5B 4HAIA 3PR4A 5IILA 2DFLA 1CI4A 4C80A 1F5SA 2KHVA 1KRPA 3SYZA 1ZQGA 9ICKA 8ICXA 3H40A 5IINA 4OJ6A 3M9OB 1ZQOA 1ZQVA 3NVZA 2Y0SF 2KFZA 2BQRA 3KKAA 2E8PA 3PMNA 4J9SA 4F4WA 4DSIA 3H7IA 3UMGA 5KFAA 4R66A 4JV2A 3E0FA 1QQ7A 4F2RA 5DB7A 2W43A 4KLQA 2ZJ8A 4BWMA 3DDHA 3ZDAA 4JMUA 4FZNA 1TAUA 1T3QA 3PW5A 4KN7A 4B9UA 5KT3A 3C5FA 2UVVA 5CA7A 1H38A 3HKZC 4EEKA 2F8LA 2K8BB 1X6IA 4FS1A 5L1KA 1RYSA 2KKPA 4B9LA 3RR7A 7ICTA 5DDYA 5DG8A 3Q8SB 2EAOA 3FM9A 5DQGA 2OEHA 4EYHB 2YMPA 1X9WA 8ICMA 8ICCA 3Q8KA 4NV0A 3J81j 3IDWA 3OGUA 4BDPA 4NL9A 4Y2TA 4PPXA 3KKAC 1MC8A 1N56A 2LYBA 2K8AA 2HDOA 2WF8A 4UB1A 5EE3A 4NLKA 2DKZA 2P6UA 3GV5B 2KFNA 3KTQA 3PO4A 4F4ZA 4KMUA 1ZQ1C 4YMNA 2G08A 3PX4A 5ALTA 1ZQUA 4EX6A 4RPYA 2P35A 2RP5A 3WK4A 4B9VA 4OD0A 4RNNA 1NKCA 4KLUA 2OHFA 4RQ4A 5KFYA 2H3ZA 2LPEA 2HSZA 4ECRA 2P66A 1L7MA 4UAYA 3H8MA 4G9BA 1ZQBA 4DOCA 2W8KA 4ECZA 2W7PA 2HW3A 1Z1VA 9ICVA 4R65A 4ED1A 3NRZA 1TAQA 5DBAA 1BPEA 1JIHA 5KTQA 1C20A 2HHQA 4RQ8A 4QIWC 1Q3UA 2DQNB 2LM4A 2NRVA 1IG6A 1Q46A 1QCKA 4RPXA 5J2FA 1LV5A 1NK0A 4NM1A 3QU9A 4DF8A 3V7JA 2C28A 4IQVA 3TAPA 1WG8A 5HP4A 4C8OA 2F77X 7ICJA 2K8CB 4CF3A 4NJ8A 1SKRA 3QEAZ 5AI5A 1S0MA 4RU9A 4K4GA 5J2JA 5ALZA 4Z6CA 3L3FX 2F3NA 1BPBA 8ICOA 3EWAA 4GXKA 5D46A 3FC4A 3FDSA 2W9CA 7ICUA 2H3VA 4FBUA 2EZXA 3G6VA 3UPQA 4C0ZA 3RF9A 2XICA 2LI6A 2WAQC 5AIBA 2G5IB 3EUB2 9ICUA 3F2DA 3B0YA 1UA0A 5EE1A 3TADC 5DQIA 3EYZA 3IG5A 5ALGA 3WK9A 4GC6A 4DL4A 1DGSA 5F9NA 4M0AA 1J2MA 1ZD3A 5AIAA 5BPCA 2AH5A 1RXWA 1ZQLA 4Z6EA 3Q8MA 5AI6A 4LZGA 8ICZA 3C29A 3C21A 4EX7A 2P6RA 3V6KA 3UQ0A 1PZNA 3D2NA 4YFKA 2IHMA 2PFOA 5ALOA 4BXOB 4I28A 2NRXA 4F92B 5J0XA 2E8MA 2LYAA 4P4MA 4KLIA 4DOAA 1YT3A 1MA7A 2KSOB 1L3SA 3T5JA 1GO3F 2WF7A 4EYIB 5J0TA 2XGPA 3VC8A 3WKBA 1VDVA 1KFTA 2VA3A 4ICAA 2R18A 3K75D 4Y2QA 1KFDA 1IXRA 3MABA 3LVWA 5DG7A 5AM2A 5ALPA 2FJ6A 4KLFA 4YMOA 2HHXA 2VKQA 3NVVA 2EAMA 1RM6C 2ZUCA 3TFSA 1ZQTA 4M9NA 5IIKA 7ICFA 3QEBZ 2LYHA 2KEYA 3HILA 3QYPA 4BWJA 3SI8A 5J0OA 5KFCA 4I2BA 5AKEA 5KFLA 4CF4A 4F5RA 3MFIA 4R64A 3KHGA 2ZXHA 1T94A 2KICA 3AMZA 1FFVA 3C2MA 4AYBC 9ICEA 4E0DA 4O3MA 2WTFA 2IA6A 1IM4A 1L7PA 2XCAA 2AXTU 4O0IA 2W9BB 3C23A 1YZ6A 4PGXA 5CWRA 2OM6A 5AM3A 1CRXA 2D6FC 3MGVA 1LVHA 5KL1B 2NO4A 2AHOB 3RAQA 1HEKA 2KD1A 3C1ZA 2EANA 4Q44A 3IN5A 4C7YA 1NK5A 1SV4A 5TISU 5KT5A 5DGAA 1D8LA 2PFPA 4YD1A 3GV7B 9ICQA 1COOA 4WJ3B 4YR0A 2JH7A 4ECWA 1TK8A 1NKBA 2KOBA 4M2YA 2VANA 4J03A 4US9A 1NJXA 1JMSA 3N4MB 8ICFA 5J2KA 1NK8A 2Q0ZX 3WK8A 1SL2A 2IHNA 8ICJA 5HMLA 2F44A 1WCLA 3K1RB 4BXOA 5J2IA 4QZFA 4C8KA 2BPCA 1UCVA 3I28A 3RJFA 5DGBA 4KLGA 4TUSA 3K4GA 2KSOA 3IRUA 2VJ5A 5KFTA 5D49A 1LB2B 4R8UA 1X42A 2E3TA 4LVSA 5L1IA 5IIJA 3JPTA 5F9LA 4ECYA 1MQ2A 2QB0B 5EOZA 2KVCA 4DL6A 5ALHA 3UM9A 3MDAA 4UB2A 4J9RA 2ZIVA 3H0LB 4NM2A 3PW4A 3RB6A 1PK1A 4F2SA 3OTQA 2GLEA 5KFWA 9ICAA 5ALVA 2NRWA 5L1MA 5KG4A 1U9LA 4F71A 4UQGA 3KFUF 2YMQA 2XY6A 1QQ5A 1ZXIA 1ZQJA 4QZAA 1M6YA 4NLNA 1N2XA 1MSWD 3UMCA 2BDPA 3KZIU 2XY7A 1NJZA 2K4PA 3JPSA 5KFZA 5IIIA 9ICJA 5CRXA 3Q8QB 3B9JA 4KX3A 2NRZA 4PJ0U 2JEFA 2WB1C 2DGZA 5DDMA 4GLXA 4F8RA 5ALEA 5CHGA 5EWGA 3UXNA 4UB4A 4P2HA 2W3SA 5ALFA 1SKWA 3MFHA 4NWIA 4J9MA 4MEXA 3H8JA 1HIWA 2PMZC 5KFEA 2W55A 3SR6A 2BCUA 5AI9A 1NJYA 1SL1A 1ZQMA 2EDUA 2HVIA 2IOFK 1IV8A 2HBLA 3TQ1A 9ICMA 3M7DA 5EE0A 3GV8B 4I2CA 3H8SA 3QUQA 1X40A 1EXNA 8ICTA 1P7DA 1ZJMA 3KHLA 3C1YA 5J8YA 2BCSA 4DL3A 2PXIA 5J0RA 4TURA 3QE9Y 3NRWA 3WU2U 1ZQZA 4M47A 4RQ0A 8ICSA 4JV1A 2GO7A 3GIIA 2ZTDA 4QWEA 2ASJA 5J2CA 1OW5A 4DCCA 3MC1A 2YN4A 2FPKA 1DGJA 2E1FA 1N62A 2JR5A 4UAUA 1XU4A 2G0AA 1ZRNA 4KITB 4GFJA 1N60A 3E58A 1L3UA 1ZQAA 7ICNA 2FLLA 5AK5A 2DF4B 2QB0A 2QKQA 4F72A 4I2FA 2FMQA 3PW2A 4CRXA 3Q8LA 8ICGA 1NJWA 2VA8A 3S6JA 2FPLA 4DL7A 9ICOA 4KLLA 3RH5A 1MQ3A 9ICCA 3M6KA 4QZHA 1XSPA 3WKCA 4MFAA 3N7RC 5DLGA 1K1SA 4O3PA 4EBCA 4PH5A 3ISDA 1K5OA 4F5NA 2PFQA 3JPRA 1K1QA 3DV9A 5K4LA 2YMLA 4ED7A 4DO9A 8ICUA 3K1ZA 3PSTA 2AU0A 1F44A 5HMMA 1HJPA 2OYYA 3AN1A 4O3SA 1KSPA 4J9QA 2FMSA 4GC7A 2KJ5A 2EH9A 4ACOA 4FFDA 1NOMA 1ZQPA 3RAXA 1KL9A 5DQHA 2ZG6A 4RPZA 3FYHA 4BJQA 2I5HA 1LKYA 3QUTA 9ICNA 1S10A 4P0PA 1DXSA 4B9TA 4O3RA 2PI5A 1TFRA 3MGIA 4IQUA 2KVSA 2F1HA 2W9CB 2NRTA 4RZRA 5DLFA 5C0YA 7ICPA 1JROA 4QIWF 9ICGA 5J2BA 1ZQNA 5KFDA 2QLTA 4Y2VA 4DQIA 4RUAA 1BPYA 1TVAA 3WK5A 5AICA 2E8OA 4F4YA 2PFNA 2R8IA 1ZQEA 5DBCA 2YB4A 4EELA 2K4IA 2WF6A 3JPQA 1TKDA 5L9XA 1L5UA 2V4QA 4O9MA 5ALDA 5JRTA 2I6XA 4ECTA 2PKEA 7ICRA 5KAIU 4KMOB 5AK3A 4C8MA 2XVTA 5KFSA 1J97A 3KOOA 3QU7A 2KMDA 5AKLA 5FP0A 1V38A 1SXEA 2B0CA 2XGQA 3NASA 9ICBA 2WAQF 1D9FA 2IOHA 4F5OA 5EWEA 1X9MA 1NK4A 1RYUA 2ISOA 4J9PA 3OHBA 3B0XA 4M9LA 5GTHU 4M9HA 5KFBA 3T3FA 3QXGA 9ICPA 3PSFA 2FPMA 2W11A 1ZJNA 4OCZA 5DBBA 2WF5A 1L3TA 1U47A 2WF9A 3SAGA 3E2EA 2IOFA 4MFFA 1B0XA 1U4BA 3SD7A 8ICQA 2MAXA 4RUCA 1AROP 3TADA 1VJ5A 4DLEA 2JRZA 4OO1J 4QW9A 3MR6A 2XY5A 2C2RA 1KKXA 2DPIA 4GIBA 3F5AA 4I2AA 2AGPA 1ZQCA 4GXIA 4CGZA 4USAA 3AUOA 3NGDA 4DSEA 4TQRA 4JK1A 1NKEA 4QW8A 8ICRA 1XO1A 2D8CA 1SZPA 4QWDA 8ICVA 1QLNA 2F1JA 1KQQA 5ALJA 1T4GA 1IIPA 1MN8A 4CDGA 2K4HA 4Q43A 2KZZA 3BZKA 3D6JA 1BGXT 2HI0A 4UB3A 3ICXA 4UBCA 3RJJA 2WHEA 3NS1A 2IMWP 2KIVA 2OCEA 3EZ5A 3LYSA 3TANA 1Z00A 4BUGA 3TKAA 2RDIA 3MR5A 4ED0A 3H4BA 8ICHA 3OJSA 4PHDA 3OSPA 3EPIA 5HNKA 2ZUBA 5A0LA 3JPNA 7ICSA 2ZJAA 3LDAA 3C2KA 1L8LA 3LWMA 4YXJA 5HHIA 1SXDA 2BCQA 4Q45A 2CXYA 1Z1BA 4DFKA 4UARA 5AM4A 1WYGA 3M9MB 4DQRA 3ZDDA 3RRGA 4O5CA 5J2AA 2LBOA 1TK5A 1X6JA 5EWFA 4YXMA 3VCBA 2XO7A 3C28A 4PZOA 1XS9D 3IV6A 4IRCA 4QWBA 1NK7A 4DEZA 5KFOA 1URJA 4PGYA 1RZTA 4DF4A 5DB9A 2KJ8A 1SB3C 2B6GA 5ALMA 1PUZA 4I2IA 8ICBA 1AQ6A 3EPGA 1WCNA 4X5VA 4R8UB 3H0MB 2LM1A 4IRDA 3V72A 5ALQA 4O5KA 3N7PD 4UAVA 2BZFA 3L4PA 5AKXA 2A3VA 1FFUA 1ZOLA 1QTMA 4I2GA 2EZYA 2ZIVB 1OXJA 1PK1B 9ICRA 4PHAA 3QZ8A 3BS7A 4MHVA 5BOMA 2W9AA 1SGGA 4C4SA 4G3IA 5AKIA 4KLJA 2HHUA 3RJIA 2F2AB 4FBTA 2C22A 4NXZA 4YQWA 3TFRA 4I2DA 2UVUA 4DS4A 2UVRA 1QH9A 4JUZA 2BQUA 5ALXA 2FLNA 4UAWA 4EENA 3SAHA 4BGDA 5AM0A 4ZOHC 2F1IA 4MEYA 3AL0B 1T7PA 3RBEA 1D8BA 1HUOA 3ZD9A 3I76A 4K4IA 4Y2YA 3PMLA 3KD3A 9ICLA 1DOQA 3DEEA 2KP7A 7ICMA 2A19A 3AQEA 4OJLA 3PNCA 4KLTA 3M6ZA 4YN4A 1ZD5A 7ICLA 3BQ7A 4US8A 8ICLA 4R63A 5HHHA 4U6PA 8ICYA 4UW9A 3UQ2A 5L1LA 3GILA 7ICQA 5AI8A 1SV0C 2Y1IA 3HW8A 2KK0A 5KT4A 4P4PA 2VIXA 9ICWA 1JX4A 5AKJA 2ASLA 1UA1A 8ICAA 1JALA 2H3IA 5ALUA 4I2HA 1S0VA 3IP4B 4YMMA 2W7OA 9ICIA 1JN3A 3QU5A 3HJEA 1UT8A 5HR7A 1BVSA 4DSLA 4B9SA 4UASA 4PL1A 2J6SA 4RQ2A 5KFXA 3V6HA 4EZ9A 2J6TA 3PW7A 4QZGA 2QARB 2KE7A 4IRKA 2W8LA 3QU2A 3HPOA 3PX0A 4NLGA 2C2DA 4DL2A 2OXOA 2ZXIA 3IM1A 3THVA 3TACB 3O0FA 5DB8A 1ZQSA 3M8SA 5JU5A 4RQ7A 4RT2A 1TE2A 9ICTA 4Z6FA 3NUQA 8ICKA 3CYMA 4GXJA 1A76A 2F76X 1S5LU 3RH6A 3NVWA 4Q8EA 2DUYA 2ATLA 1DK3A 1ZQKA 5KG6A 4RNOA 1B4FA 3N28A 5AI0A 4DL5A 4NLCA 3BQTA 5CJ7A 4ED3A 5ALKA 5KFIA 3A0BU 4RQMA 5JUMA 2V9WA 1S77D 1SWWA 4RQ1A 1QSLA 4ED8A 3SQIA 1ZD4A 4XA5A 4KLEA 3C5GA 4DSKA 4OJOA 4QZDA 3H4DA 3ISBA 4KTQA 2HOQA 4M04A 1TAMA 2ESEA 4CCHA 2N1RA 4P0QA 1KDHA 1D8YA 4MF8A 1LKYB 3WKDA 2ODGA 4C4TA 2YMMA 2IBKA 4P0PB 2R8HA 1WWVA 2I1QA 4DSFA 3V6JA 1A77A 2FE9A 5KT6A 5D4BA 4F5QA 4KN4A 2AQ4A 5KFMA 4ECUA 3NVYA 1U45A 3BQ2A 3I1YA 1S76D 5AKGA 2NV3A 3Q8RB 3LVVA 2C2EA 3OSNA 4PHPA 5BOLA 1WUDA 2Y1JA 4BX9C 1S97A 3H8WA 1V85A 4FZMA 3ETLA 2MSNA 2Y9TA 1UQVA 2M9NA 1BPDA 3N7SC 2HVHA 2M0NA 3WK7A 2HOFA 3HRDD 2FDRA 5KL8B 2A1JA 1BPXA 4YD2A 4RT3A 1UT5A 5H2FU 3HKZF 1COKA 3N97B 2G07A 3HX0A 1L7NA 2QARA 3TARA 5KFRA 4O5EA 4FS2A 3T5KA 1TV9A 2J6UA 5ALLA 1U49A 2BPGA 1U48A 4QZBA 4Y2JA 5L1JA 1PVRA 3CRXA 4NLBA 2MRLA 1NK9A 2ZIXB 4F4XA 3KHHA 3QUCA 2BQ3A 4M6WA 4DWIA 1X2IA 3GU3A 4YCXA 1Y88A 3EW9A 1SWVA 3F5EA 4Y2SA 5KFHA 2I9GA 7ICKA 1Q8KA 1KFSA 3RJGA 4F3OA 3SEIA 3UXOA 2G09A 4QZ9A 7ICOA 4Y2UA 2R8JA 1XSNA 3AU2A 4KX5A 2YX8A 2KIWA 2KN7A 5AHXA 4DFPA 1HUZA 3QU4A 2JGAA 2JV3A 4OJPA 5G5HA 5KG5A 3BZCA 4JWNA 2YQEA 1NZPA 3ZDBA 4FO6A 5KG3A 3AQFA 4YP3A 1O03A 2YB1A 1ZD2P 3AEVA 2H5XA 1PVPA 2MUTB 1ZQIA 4XUSA 5J0YA 4DQPA 2KKVA 1Z00B 2WFAA 2Z7JA 4DS5A 2JMGA 3QZ7A 3PY8A 3HP6A 3PZPA 4B9MA 1JI7A 1RDFA 1Z19A 4O3NA 3IG8A 1Z3EB 3C2LA 1JRPA 3T5HA 4M9JA 4XRHA 4J9LA 2JEJA 3F53A 3JPPA 2KHQA 3GZFA 1QSYA 3R9KA 5C5JA 1KN5A 2G06A 4TUPA 2GWSA 2W3RA 5KT2A 3ISCA 5F3XB 2FLPA 1RQLA 5AK6A 2V4RA 2EZZA 4I29A 8ICWA 1N63A 4QWCA 5DKWA 3KZXA 1ZQWA 9ICHA 2H3FA 5AKZA 5KG1A 4J9KA 1N5WA 4KLHA 4J9OA 2R8KA 2XC9A 4C8NA 2Y0SC 5KFFA 3CNHA 3SZ2A 2KV2A 2HCFA 3D2SA 3SAFA 4ZH4A 4IQTA 5J2HA 4RNMA 3BQ0A 3RJEA 5ALWA 1L6NA 3LK9A 2ZIXA 3G6XA 1NK6A 1A6SA 3QX7A 1X9XA 3BS5B 3ZDCA 3PO5A 4O3QA 1ZQFA 1FEZA 2ES6A 1ZYQA 2HBKA 2UVWA 2K60A 4NL9C 5J2EA 3OPXA 1B43A 1S9FA 1XSLA 3HWTA 2MU2A 2MA1A 4J9NA 7ICEA 1SKSA 1NZBA 2VA2A 3ED5A 2LKYA 5B66U 3H0RB 4PL2A 4F4KA 2BHNA 2JH1A 4UB6U 7ICHA 4YVZA 4DFDA 3MR2A 4Z6DA 4UBBA 1Z4NA 3SV3A 2KG5A 3ZD8A 4YR2A 5CB1A 2B21A 8ICIA 3IHQB 1N48A 2NYVA 1YZ7A 2MUTA 4QNLA 4JV0A 4DQSA 1UHUA 5KG0A 4RQNA 3ETRA 1X9SA 3M9NB 4IR9A 3GIKA 3CW2C 3BJYA 1KTQA 1NNLA 4F93B 5DB6A 4Q8FA 4I2JA 2ASDA 5KFQA 1JXLA 2ZTEA 2NO5A 3OJUA 2EAPA 1O08A 4FZLA 3PVXA 3UMBA 3MDCA 4ECXA 8ICNA 5J2GA 5HR6A 1TK0A 2XI9A 5CR0A 2DWQA 1BNOA 9ICSA 3T5LA 4M9GA 4EZ6A 3RJHA 3L5KA 4ELUA 4AYBF 1Z4OA 4Y2RA 5T14A 5TZVA 3T79A 1JXEA 2HOIA 5J0WA 2K89A 4QZEA 1S0NA 2LHTA 5J2DA 4YR3A 3RB4A 3RRHA 2ZIUB 2W54A 2HHTA 1RQNA 1D9DA 8ICEA 4QZCA 5ALYA 1XWLA 4TQSA 4NLZA 4LZDA 3PV8A 4IQWA 1CUKA 1FO4A 1ZQQA 1SIJA 1KEJA 2OWOA 4PZNA 2OH2A 4C8LA 4ECQA 7ICVA 2O6KA 3M8RA 2BDUA 3A0HU 2RDJA 5G5GA 4ELTA 2ZTCA 3GDXA 4C4RA 3ALRA 3BS5A 4UATA 3ZDEA 5JTIA 5IIOA 4K4HA 1JUDA 3KHRA 1RG6A 3OHAA 2HBMA 4QWAA 4TUQA 3RTVA 4UB5A 2BPFA
chains in the Genus database with same CATH topology
3CYMA 2F76X 2KHQA 2CPRA 2XVTA 3N7RC 3GZFA 1D8BA 2G07A 4IC9A 2KNJA 2GH1A 4NWIA 1UPHA 1Z1BA 2G06A 1XNSA 1DRGA 4QNLA 4JMUA 2LYAA 4FZNA 1HIWA 2XIDA 1YT3A 1MA7A 1XO0A 4QIWC 2PMZC 1Q3UA 4WJ3B 2DQNB 2LBOA 1GO3F 2JH7A 3DEEA 3K1ZA 3PSTA 4NLCA 2WAQF 1F44A 3KZXA 3AQEA 2KOBA 3HKZC 4OJLA 2OYYA 3VC8A 2F8LA 2H3FA 2K8BB 1PVRA 3CRXA 3VCBA 4NLBA 1SZHA 2ZIWB 2KKPA 2KJ5A 2MRLA 4ICAA 1Q3VA 2ZIXB 4ACOA 4A8EA 3C28A 2HBLA 2R18A 3SQIA 3M6ZA 3M7DA 4FE3A 3GU3A 4FZLA 2GOLA 3LVWA 1ECWA 4OJOA 1URJA 2Y0SC 2W04A 2KJ8A 2ZG6A 3PSFA 1P7DA 5HR6A 2H3QA 2F77X 2HOQA 2XI9A 4P0QB 4BJQA 3F5EA 2VKQA 2K8CB 4NV0A 1TAMA 3SAGA 2N1RA 4P0QA 2KV2A 3D2SA 3SAFA 4U6PA 3NRWA 4P0PB 3H0MB 4P0PA 2VJ5A 4AYBF 2G09A 4U7CA 4OJ5A 3SMVA 5T14A 3T79A 2LYBA 2E5SA 2K8AA 2KEYA 3PSPA 3N7PD 2HOIA 3L3FX 4OO1J 2VIXA 1A0PA 2K89A 3F5AA 4KX5A 1L6NA 2ZIWA 2KVCA 2YX8A 2A3VA 2KIWA 1ED1A 2LHTA 4CGZA 2HBJA 2ZIXA 3PSIA 2H3IA 2KJ9A 1A6SA 2ZXHA 3IP4B 2ZIVB 2JGAA 2K4EA 2W7OA 2E1EA 1T94A 2KICA 2RRDA 2ZIUB 4OJPA 2H3VA 2ZIVA 3D2QA 3H0LB 4C0ZA 1ZQ1C 2E1FA 5C0YA 3RF9A 2HBKA 2NV3A 2XICA 2WAQC 4AYBC 2CN1A 3LVVA 2G08A 2G5HB 5HR7A 2G0AA 2G5IB 4QIWF 4O3MA 3ONNA 2VJ4A 2RHFA 1IIPA 2Q4TA 1WUDA 3OPXA 4PL1A 3F2DA 1PVQA 2W03A 4GFJA 2K4HA 4BX9C 4CDGA 3F2BA 2KHVA 2RP5A 3IG5A 4FZMA 3AQFA 3ICXA 2OH2A 2HMXA 2F2AB 2YB1A 3KFUF 2WB1F 2MA1A 2DF4B 1PVPA 3N7SC 3LYSA 4OJ6A 2H3ZA 2BDUA 2OM6A 2KKVA 1NZBA 1KBUA 4CRXA 2JHDA 2M0NA 2LKYA 2OXOA 2Z7JA 2ZXIA 2YB4A 2Y0SF 3H0RB 2HOFA 3RFAA 2JMGA 4PL2A 4BUGA 2K4IA 1CRXA 3ALRA 3NUQA 3PZPA 2D6FC 2ZIUA 3MGVA 1Z19A 3O0FA 5KL8B 3C29A 3IG8A 5KL1B 3CP8A 4QJFB 3SAHA 1HEKA 2KD1A 2PMZF 1OUQA 5CRXA 2JH1A 3F2CA 3D2NA 4KX3A 2W7PA 3IN5A 2HBMA 5A0LA 2CRXA 2WB1C 2DGZA 4KMOB 3M6KA 3HKZF 3AL0B 3F53A 3E0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBL A;  3CYM A;  2CPR A;  4CGZ A;  1D8B A;  2HBJ A;  2MA1 A;  2E1E A;  2RRD A;  1YT3 A;  3SAG A;  2KV2 A;  2E1F A;  5C0Y A;  3SAF A;  2HBK A;  1GO3 F;  4QIW F;  4NLC A;  4O3M A;  4QJF B;  3SAH A;  2RHF A;  1WUD A;  4CDG A;  4NLB A;  4OO1 J;  2HBM A;  2DGZ A; 
#chains in the Genus database with same CATH topology
 2BCR A;  3QNM A;  2CPR A;  4IC9 A;  3SEN A;  3GFK B;  2PI4 A;  2GH1 A;  1SL0 A;  1UPH A;  1NI3 A;  1WWU A;  4XQ8 A;  3M1Y A;  5KFJ A;  2XID A;  2DL0 A;  3MR3 A;  4KLO A;  2JEG A;  3WKE A;  4EBD A;  1X66 A;  1SV0 A;  4PHE A;  2ZIW B;  2AQ0 A;  3RJK A;  1F0M A;  3PW0 A;  4KLS A;  4EEY A;  3PX6 A;  1ECW A;  2E8N A;  4KLD A;  4P0Q B;  5KFN A;  1PK3 A;  3FAH A;  1QQ6 A;  5AK4 A;  5B5E U;  2YY6 A;  4IS7 A;  4AP9 A;  4YG2 A;  2DKX A;  4RQ6 A;  4QZ8 A;  3NTU A;  2E5S A;  2L5Y A;  3PSP A;  5CP2 A;  1A0P A;  4QZI A;  4ECS A;  1S0O A;  1ZQY A;  3WKA A;  2HBJ A;  3PSI A;  5KG7 A;  2KJ9 A;  4F91 B;  5AKK A;  2BR0 A;  2BGW A;  3D2Q A;  5J0P A;  5AM5 A;  2DBY A;  4KLM A;  3U26 A;  4DLG A;  4JB3 A;  2VJ4 A;  1PVQ A;  2Q4T A;  2W03 A;  5ALI A;  5KFG A;  3UXP A;  4JWM A;  2HMX A;  2D3D A;  2AGO A;  2JZB B;  5E79 U;  5J0U A;  2WB1 F;  8ICP A;  3Q8P B;  2ALZ A;  4MF2 A;  1DK2 A;  2JHD A;  3RFA A;  2A1J B;  2W9M A;  2ZIU A;  1BPZ A;  4P4O A;  5KNI A;  3RR8 A;  3CP8 A;  2DPJ A;  1BNP A;  2PMZ F;  3F2C A;  4DSJ A;  4I27 A;  3V7L A;  2HHW A;  2CRX A;  2YTU A;  4OJ5 A;  3HT3 A;  9ICX A;  1XNS A;  1FIQ A;  3WK6 A;  3RB0 A;  1XO0 A;  4Y2X A;  2BKE A;  5KT7 A;  1QSS A;  3BQ1 A;  4IR1 A;  2AJQ A;  9ICF A;  2FI1 A;  1ZQD A;  1Q3V A;  3GIM A;  4M6W B;  4A8E A;  4FE3 A;  1L7O A;  2ZUD A;  4DQQ A;  3RB3 A;  4CNQ A;  2W04 A;  3MGH A;  5GTI U;  2XCP A;  1ZRM A;  2BCV A;  5KFP A;  2KZM A;  3RBD A;  1J2N A;  2ZJ5 A;  3AU6 A;  5ALN A;  4DFM A;  4U7C A;  4C7Z A;  4ECV A;  4UB8 U;  1RYR A;  2ZIW A;  4DFJ A;  1ED1 A;  1ZQH A;  1CEZ A;  5DG9 A;  1T8E A;  3TI0 A;  1RPL A;  2E1E A;  2F8K A;  2CN1 A;  5J29 A;  2G5H B;  2Y9U A;  3GIJ A;  3BDP A;  5CEH A;  3ONN A;  2RHF A;  2JEI A;  4RQ5 A;  2KZ3 A;  3F2B A;  1N61 A;  7ICG A;  3ZI4 A;  1N5X A;  3JPO A;  2W9B A;  5J0Q A;  1KBU A;  3SV4 A;  4B9N A;  5KFU A;  4PGQ A;  5J0S A;  4I2E A;  1VLB A;  2A1A A;  3AM9 A;  3GQC A;  5IIM A;  5KAF U;  4QJF B;  4HYK A;  1OUQ A;  3V7K A;  5KFV A;  3RH4 A;  4O3O A;  2ISP A;  1L3V A;  1S8O A;  3G6Y A;  5KG2 A;  5AKY A;  2HHS A;  2QB1 A;  2KNJ A;  4UAZ A;  1L8O A;  2EQY A;  2JZB A;  4CF5 A;  1DRG A;  1T3N A;  4NY8 A;  5KFK A;  5ALR A;  4ED6 A;  1ZQX A;  4LJX A;  7ICI A;  3QUB A;  3LWL A;  1SZH A;  4MFC A;  3ORY A;  1V9P A;  1ZQR A;  1KW4 A;  2AGQ A;  1V97 A;  1XC9 A;  4CE6 A;  2GOL A;  5AI4 A;  2HHV A;  2KTQ A;  5ALS A;  2LMR A;  2H3Q A;  4IL6 U;  2RLT A;  4Y2P A;  5AM1 A;  4ELV A;  4F5P A;  1RXV A;  3TAQ A;  5EE9 A;  3SMV A;  4DOB A;  2JXJ A;  2RQ5 A;  4RQ3 A;  3KBB A;  1ZET A;  3MBY A;  4ED2 A;  4F50 A;  2K4E A;  1B22 A;  2RRD A;  1C7Y A;  4EBE A;  2R8G A;  2FMP A;  5AKH A;  5J8Y C;  4B6J A;  1KLN A;  3PR5 B;  4HAI A;  3PR4 A;  5IIL A;  2DFL A;  1CI4 A;  4C80 A;  1F5S A;  2KHV A;  1KRP A;  3SYZ A;  1ZQG A;  9ICK A;  8ICX A;  3H40 A;  5IIN A;  4OJ6 A;  3M9O B;  1ZQO A;  1ZQV A;  3NVZ A;  2Y0S F;  2KFZ A;  2BQR A;  3KKA A;  2E8P A;  3PMN A;  4J9S A;  4F4W A;  4DSI A;  3H7I A;  3UMG A;  5KFA A;  4R66 A;  4JV2 A;  3E0F A;  1QQ7 A;  4F2R A;  5DB7 A;  2W43 A;  4KLQ A;  2ZJ8 A;  4BWM A;  3DDH A;  3ZDA A;  4JMU A;  4FZN A;  1TAU A;  1T3Q A;  3PW5 A;  4KN7 A;  4B9U A;  5KT3 A;  3C5F A;  2UVV A;  5CA7 A;  1H38 A;  3HKZ C;  4EEK A;  2F8L A;  2K8B B;  1X6I A;  4FS1 A;  5L1K A;  1RYS A;  2KKP A;  4B9L A;  3RR7 A;  7ICT A;  5DDY A;  5DG8 A;  3Q8S B;  2EAO A;  3FM9 A;  5DQG A;  2OEH A;  4EYH B;  2YMP A;  1X9W A;  8ICM A;  8ICC A;  3Q8K A;  4NV0 A;  3J81 j;  3IDW A;  3OGU A;  4BDP A;  4NL9 A;  4Y2T A;  4PPX A;  3KKA C;  1MC8 A;  1N56 A;  2LYB A;  2K8A A;  2HDO A;  2WF8 A;  4UB1 A;  5EE3 A;  4NLK A;  2DKZ A;  2P6U A;  3GV5 B;  2KFN A;  3KTQ A;  3PO4 A;  4F4Z A;  4KMU A;  1ZQ1 C;  4YMN A;  2G08 A;  3PX4 A;  5ALT A;  1ZQU A;  4EX6 A;  4RPY A;  2P35 A;  2RP5 A;  3WK4 A;  4B9V A;  4OD0 A;  4RNN A;  1NKC A;  4KLU A;  2OHF A;  4RQ4 A;  5KFY A;  2H3Z A;  2LPE A;  2HSZ A;  4ECR A;  2P66 A;  1L7M A;  4UAY A;  3H8M A;  4G9B A;  1ZQB A;  4DOC A;  2W8K A;  4ECZ A;  2W7P A;  2HW3 A;  1Z1V A;  9ICV A;  4R65 A;  4ED1 A;  3NRZ A;  1TAQ A;  5DBA A;  1BPE A;  1JIH A;  5KTQ A;  1C20 A;  2HHQ A;  4RQ8 A;  4QIW C;  1Q3U A;  2DQN B;  2LM4 A;  2NRV A;  1IG6 A;  1Q46 A;  1QCK A;  4RPX A;  5J2F A;  1LV5 A;  1NK0 A;  4NM1 A;  3QU9 A;  4DF8 A;  3V7J A;  2C28 A;  4IQV A;  3TAP A;  1WG8 A;  5HP4 A;  4C8O A;  2F77 X;  7ICJ A;  2K8C B;  4CF3 A;  4NJ8 A;  1SKR A;  3QEA Z;  5AI5 A;  1S0M A;  4RU9 A;  4K4G A;  5J2J A;  5ALZ A;  4Z6C A;  3L3F X;  2F3N A;  1BPB A;  8ICO A;  3EWA A;  4GXK A;  5D46 A;  3FC4 A;  3FDS A;  2W9C A;  7ICU A;  2H3V A;  4FBU A;  2EZX A;  3G6V A;  3UPQ A;  4C0Z A;  3RF9 A;  2XIC A;  2LI6 A;  2WAQ C;  5AIB A;  2G5I B;  3EUB 2;  9ICU A;  3F2D A;  3B0Y A;  1UA0 A;  5EE1 A;  3TAD C;  5DQI A;  3EYZ A;  3IG5 A;  5ALG A;  3WK9 A;  4GC6 A;  4DL4 A;  1DGS A;  5F9N A;  4M0A A;  1J2M A;  1ZD3 A;  5AIA A;  5BPC A;  2AH5 A;  1RXW A;  1ZQL A;  4Z6E A;  3Q8M A;  5AI6 A;  4LZG A;  8ICZ A;  3C29 A;  3C21 A;  4EX7 A;  2P6R A;  3V6K A;  3UQ0 A;  1PZN A;  3D2N A;  4YFK A;  2IHM A;  2PFO A;  5ALO A;  4BXO B;  4I28 A;  2NRX A;  4F92 B;  5J0X A;  2E8M A;  2LYA A;  4P4M A;  4KLI A;  4DOA A;  1YT3 A;  1MA7 A;  2KSO B;  1L3S A;  3T5J A;  1GO3 F;  2WF7 A;  4EYI B;  5J0T A;  2XGP A;  3VC8 A;  3WKB A;  1VDV A;  1KFT A;  2VA3 A;  4ICA A;  2R18 A;  3K75 D;  4Y2Q A;  1KFD A;  1IXR A;  3MAB A;  3LVW A;  5DG7 A;  5AM2 A;  5ALP A;  2FJ6 A;  4KLF A;  4YMO A;  2HHX A;  2VKQ A;  3NVV A;  2EAM A;  1RM6 C;  2ZUC A;  3TFS A;  1ZQT A;  4M9N A;  5IIK A;  7ICF A;  3QEB Z;  2LYH A;  2KEY A;  3HIL A;  3QYP A;  4BWJ A;  3SI8 A;  5J0O A;  5KFC A;  4I2B A;  5AKE A;  5KFL A;  4CF4 A;  4F5R A;  3MFI A;  4R64 A;  3KHG A;  2ZXH A;  1T94 A;  2KIC A;  3AMZ A;  1FFV A;  3C2M A;  4AYB C;  9ICE A;  4E0D A;  4O3M A;  2WTF A;  2IA6 A;  1IM4 A;  1L7P A;  2XCA A;  2AXT U;  4O0I A;  2W9B B;  3C23 A;  1YZ6 A;  4PGX A;  5CWR A;  2OM6 A;  5AM3 A;  1CRX A;  2D6F C;  3MGV A;  1LVH A;  5KL1 B;  2NO4 A;  2AHO B;  3RAQ A;  1HEK A;  2KD1 A;  3C1Z A;  2EAN A;  4Q44 A;  3IN5 A;  4C7Y A;  1NK5 A;  1SV4 A;  5TIS U;  5KT5 A;  5DGA A;  1D8L A;  2PFP A;  4YD1 A;  3GV7 B;  9ICQ A;  1COO A;  4WJ3 B;  4YR0 A;  2JH7 A;  4ECW A;  1TK8 A;  1NKB A;  2KOB A;  4M2Y A;  2VAN A;  4J03 A;  4US9 A;  1NJX A;  1JMS A;  3N4M B;  8ICF A;  5J2K A;  1NK8 A;  2Q0Z X;  3WK8 A;  1SL2 A;  2IHN A;  8ICJ A;  5HML A;  2F44 A;  1WCL A;  3K1R B;  4BXO A;  5J2I A;  4QZF A;  4C8K A;  2BPC A;  1UCV A;  3I28 A;  3RJF A;  5DGB A;  4KLG A;  4TUS A;  3K4G A;  2KSO A;  3IRU A;  2VJ5 A;  5KFT A;  5D49 A;  1LB2 B;  4R8U A;  1X42 A;  2E3T A;  4LVS A;  5L1I A;  5IIJ A;  3JPT A;  5F9L A;  4ECY A;  1MQ2 A;  2QB0 B;  5EOZ A;  2KVC A;  4DL6 A;  5ALH A;  3UM9 A;  3MDA A;  4UB2 A;  4J9R A;  2ZIV A;  3H0L B;  4NM2 A;  3PW4 A;  3RB6 A;  1PK1 A;  4F2S A;  3OTQ A;  2GLE A;  5KFW A;  9ICA A;  5ALV A;  2NRW A;  5L1M A;  5KG4 A;  1U9L A;  4F71 A;  4UQG A;  3KFU F;  2YMQ A;  2XY6 A;  1QQ5 A;  1ZXI A;  1ZQJ A;  4QZA A;  1M6Y A;  4NLN A;  1N2X A;  1MSW D;  3UMC A;  2BDP A;  3KZI U;  2XY7 A;  1NJZ A;  2K4P A;  3JPS A;  5KFZ A;  5III A;  9ICJ A;  5CRX A;  3Q8Q B;  3B9J A;  4KX3 A;  2NRZ A;  4PJ0 U;  2JEF A;  2WB1 C;  2DGZ A;  5DDM A;  4GLX A;  4F8R A;  5ALE A;  5CHG A;  5EWG A;  3UXN A;  4UB4 A;  4P2H A;  2W3S A;  5ALF A;  1SKW A;  3MFH A;  4NWI A;  4J9M A;  4MEX A;  3H8J A;  1HIW A;  2PMZ C;  5KFE A;  2W55 A;  3SR6 A;  2BCU A;  5AI9 A;  1NJY A;  1SL1 A;  1ZQM A;  2EDU A;  2HVI A;  2IOF K;  1IV8 A;  2HBL A;  3TQ1 A;  9ICM A;  3M7D A;  5EE0 A;  3GV8 B;  4I2C A;  3H8S A;  3QUQ A;  1X40 A;  1EXN A;  8ICT A;  1P7D A;  1ZJM A;  3KHL A;  3C1Y A;  5J8Y A;  2BCS A;  4DL3 A;  2PXI A;  5J0R A;  4TUR A;  3QE9 Y;  3NRW A;  3WU2 U;  1ZQZ A;  4M47 A;  4RQ0 A;  8ICS A;  4JV1 A;  2GO7 A;  3GII A;  2ZTD A;  4QWE A;  2ASJ A;  5J2C A;  1OW5 A;  4DCC A;  3MC1 A;  2YN4 A;  2FPK A;  1DGJ A;  2E1F A;  1N62 A;  2JR5 A;  4UAU A;  1XU4 A;  2G0A A;  1ZRN A;  4KIT B;  4GFJ A;  1N60 A;  3E58 A;  1L3U A;  1ZQA A;  7ICN A;  2FLL A;  5AK5 A;  2DF4 B;  2QB0 A;  2QKQ A;  4F72 A;  4I2F A;  2FMQ A;  3PW2 A;  4CRX A;  3Q8L A;  8ICG A;  1NJW A;  2VA8 A;  3S6J A;  2FPL A;  4DL7 A;  9ICO A;  4KLL A;  3RH5 A;  1MQ3 A;  9ICC A;  3M6K A;  4QZH A;  1XSP A;  3WKC A;  4MFA A;  3N7R C;  5DLG A;  1K1S A;  4O3P A;  4EBC A;  4PH5 A;  3ISD A;  1K5O A;  4F5N A;  2PFQ A;  3JPR A;  1K1Q A;  3DV9 A;  5K4L A;  2YML A;  4ED7 A;  4DO9 A;  8ICU A;  3K1Z A;  3PST A;  2AU0 A;  1F44 A;  5HMM A;  1HJP A;  2OYY A;  3AN1 A;  4O3S A;  1KSP A;  4J9Q A;  2FMS A;  4GC7 A;  2KJ5 A;  2EH9 A;  4ACO A;  4FFD A;  1NOM A;  1ZQP A;  3RAX A;  1KL9 A;  5DQH A;  2ZG6 A;  4RPZ A;  3FYH A;  4BJQ A;  2I5H A;  1LKY A;  3QUT A;  9ICN A;  1S10 A;  4P0P A;  1DXS A;  4B9T A;  4O3R A;  2PI5 A;  1TFR A;  3MGI A;  4IQU A;  2KVS A;  2F1H A;  2W9C B;  2NRT A;  4RZR A;  5DLF A;  5C0Y A;  7ICP A;  1JRO A;  4QIW F;  9ICG A;  5J2B A;  1ZQN A;  5KFD A;  2QLT A;  4Y2V A;  4DQI A;  4RUA A;  1BPY A;  1TVA A;  3WK5 A;  5AIC A;  2E8O A;  4F4Y A;  2PFN A;  2R8I A;  1ZQE A;  5DBC A;  2YB4 A;  4EEL A;  2K4I A;  2WF6 A;  3JPQ A;  1TKD A;  5L9X A;  1L5U A;  2V4Q A;  4O9M A;  5ALD A;  5JRT A;  2I6X A;  4ECT A;  2PKE A;  7ICR A;  5KAI U;  4KMO B;  5AK3 A;  4C8M A;  2XVT A;  5KFS A;  1J97 A;  3KOO A;  3QU7 A;  2KMD A;  5AKL A;  5FP0 A;  1V38 A;  1SXE A;  2B0C A;  2XGQ A;  3NAS A;  9ICB A;  2WAQ F;  1D9F A;  2IOH A;  4F5O A;  5EWE A;  1X9M A;  1NK4 A;  1RYU A;  2ISO A;  4J9P A;  3OHB A;  3B0X A;  4M9L A;  5GTH U;  4M9H A;  5KFB A;  3T3F A;  3QXG A;  9ICP A;  3PSF A;  2FPM A;  2W11 A;  1ZJN A;  4OCZ A;  5DBB A;  2WF5 A;  1L3T A;  1U47 A;  2WF9 A;  3SAG A;  3E2E A;  2IOF A;  4MFF A;  1B0X A;  1U4B A;  3SD7 A;  8ICQ A;  2MAX A;  4RUC A;  1ARO P;  3TAD A;  1VJ5 A;  4DLE A;  2JRZ A;  4OO1 J;  4QW9 A;  3MR6 A;  2XY5 A;  2C2R A;  1KKX A;  2DPI A;  4GIB A;  3F5A A;  4I2A A;  2AGP A;  1ZQC A;  4GXI A;  4CGZ A;  4USA A;  3AUO A;  3NGD A;  4DSE A;  4TQR A;  4JK1 A;  1NKE A;  4QW8 A;  8ICR A;  1XO1 A;  2D8C A;  1SZP A;  4QWD A;  8ICV A;  1QLN A;  2F1J A;  1KQQ A;  5ALJ A;  1T4G A;  1IIP A;  1MN8 A;  4CDG A;  2K4H A;  4Q43 A;  2KZZ A;  3BZK A;  3D6J A;  1BGX T;  2HI0 A;  4UB3 A;  3ICX A;  4UBC A;  3RJJ A;  2WHE A;  3NS1 A;  2IMW P;  2KIV A;  2OCE A;  3EZ5 A;  3LYS A;  3TAN A;  1Z00 A;  4BUG A;  3TKA A;  2RDI A;  3MR5 A;  4ED0 A;  3H4B A;  8ICH A;  3OJS A;  4PHD A;  3OSP A;  3EPI A;  5HNK A;  2ZUB A;  5A0L A;  3JPN A;  7ICS A;  2ZJA A;  3LDA A;  3C2K A;  1L8L A;  3LWM A;  4YXJ A;  5HHI A;  1SXD A;  2BCQ A;  4Q45 A;  2CXY A;  1Z1B A;  4DFK A;  4UAR A;  5AM4 A;  1WYG A;  3M9M B;  4DQR A;  3ZDD A;  3RRG A;  4O5C A;  5J2A A;  2LBO A;  1TK5 A;  1X6J A;  5EWF A;  4YXM A;  3VCB A;  2XO7 A;  3C28 A;  4PZO A;  1XS9 D;  3IV6 A;  4IRC A;  4QWB A;  1NK7 A;  4DEZ A;  5KFO A;  1URJ A;  4PGY A;  1RZT A;  4DF4 A;  5DB9 A;  2KJ8 A;  1SB3 C;  2B6G A;  5ALM A;  1PUZ A;  4I2I A;  8ICB A;  1AQ6 A;  3EPG A;  1WCN A;  4X5V A;  4R8U B;  3H0M B;  2LM1 A;  4IRD A;  3V72 A;  5ALQ A;  4O5K A;  3N7P D;  4UAV A;  2BZF A;  3L4P A;  5AKX A;  2A3V A;  1FFU A;  1ZOL A;  1QTM A;  4I2G A;  2EZY A;  2ZIV B;  1OXJ A;  1PK1 B;  9ICR A;  4PHA A;  3QZ8 A;  3BS7 A;  4MHV A;  5BOM A;  2W9A A;  1SGG A;  4C4S A;  4G3I A;  5AKI A;  4KLJ A;  2HHU A;  3RJI A;  2F2A B;  4FBT A;  2C22 A;  4NXZ A;  4YQW A;  3TFR A;  4I2D A;  2UVU A;  4DS4 A;  2UVR A;  1QH9 A;  4JUZ A;  2BQU A;  5ALX A;  2FLN A;  4UAW A;  4EEN A;  3SAH A;  4BGD A;  5AM0 A;  4ZOH C;  2F1I A;  4MEY A;  3AL0 B;  1T7P A;  3RBE A;  1D8B A;  1HUO A;  3ZD9 A;  3I76 A;  4K4I A;  4Y2Y A;  3PML A;  3KD3 A;  9ICL A;  1DOQ A;  3DEE A;  2KP7 A;  7ICM A;  2A19 A;  3AQE A;  4OJL A;  3PNC A;  4KLT A;  3M6Z A;  4YN4 A;  1ZD5 A;  7ICL A;  3BQ7 A;  4US8 A;  8ICL A;  4R63 A;  5HHH A;  4U6P A;  8ICY A;  4UW9 A;  3UQ2 A;  5L1L A;  3GIL A;  7ICQ A;  5AI8 A;  1SV0 C;  2Y1I A;  3HW8 A;  2KK0 A;  5KT4 A;  4P4P A;  2VIX A;  9ICW A;  1JX4 A;  5AKJ A;  2ASL A;  1UA1 A;  8ICA A;  1JAL A;  2H3I A;  5ALU A;  4I2H A;  1S0V A;  3IP4 B;  4YMM A;  2W7O A;  9ICI A;  1JN3 A;  3QU5 A;  3HJE A;  1UT8 A;  5HR7 A;  1BVS A;  4DSL A;  4B9S A;  4UAS A;  4PL1 A;  2J6S A;  4RQ2 A;  5KFX A;  3V6H A;  4EZ9 A;  2J6T A;  3PW7 A;  4QZG A;  2QAR B;  2KE7 A;  4IRK A;  2W8L A;  3QU2 A;  3HPO A;  3PX0 A;  4NLG A;  2C2D A;  4DL2 A;  2OXO A;  2ZXI A;  3IM1 A;  3THV A;  3TAC B;  3O0F A;  5DB8 A;  1ZQS A;  3M8S A;  5JU5 A;  4RQ7 A;  4RT2 A;  1TE2 A;  9ICT A;  4Z6F A;  3NUQ A;  8ICK A;  3CYM A;  4GXJ A;  1A76 A;  2F76 X;  1S5L U;  3RH6 A;  3NVW A;  4Q8E A;  2DUY A;  2ATL A;  1DK3 A;  1ZQK A;  5KG6 A;  4RNO A;  1B4F A;  3N28 A;  5AI0 A;  4DL5 A;  4NLC A;  3BQT A;  5CJ7 A;  4ED3 A;  5ALK A;  5KFI A;  3A0B U;  4RQM A;  5JUM A;  2V9W A;  1S77 D;  1SWW A;  4RQ1 A;  1QSL A;  4ED8 A;  3SQI A;  1ZD4 A;  4XA5 A;  4KLE A;  3C5G A;  4DSK A;  4OJO A;  4QZD A;  3H4D A;  3ISB A;  4KTQ A;  2HOQ A;  4M04 A;  1TAM A;  2ESE A;  4CCH A;  2N1R A;  4P0Q A;  1KDH A;  1D8Y A;  4MF8 A;  1LKY B;  3WKD A;  2ODG A;  4C4T A;  2YMM A;  2IBK A;  4P0P B;  2R8H A;  1WWV A;  2I1Q A;  4DSF A;  3V6J A;  1A77 A;  2FE9 A;  5KT6 A;  5D4B A;  4F5Q A;  4KN4 A;  2AQ4 A;  5KFM A;  4ECU A;  3NVY A;  1U45 A;  3BQ2 A;  3I1Y A;  1S76 D;  5AKG A;  2NV3 A;  3Q8R B;  3LVV A;  2C2E A;  3OSN A;  4PHP A;  5BOL A;  1WUD A;  2Y1J A;  4BX9 C;  1S97 A;  3H8W A;  1V85 A;  4FZM A;  3ETL A;  2MSN A;  2Y9T A;  1UQV A;  2M9N A;  1BPD A;  3N7S C;  2HVH A;  2M0N A;  3WK7 A;  2HOF A;  3HRD D;  2FDR A;  5KL8 B;  2A1J A;  1BPX A;  4YD2 A;  4RT3 A;  1UT5 A;  5H2F U;  3HKZ F;  1COK A;  3N97 B;  2G07 A;  3HX0 A;  1L7N A;  2QAR A;  3TAR A;  5KFR A;  4O5E A;  4FS2 A;  3T5K A;  1TV9 A;  2J6U A;  5ALL A;  1U49 A;  2BPG A;  1U48 A;  4QZB A;  4Y2J A;  5L1J A;  1PVR A;  3CRX A;  4NLB A;  2MRL A;  1NK9 A;  2ZIX B;  4F4X A;  3KHH A;  3QUC A;  2BQ3 A;  4M6W A;  4DWI A;  1X2I A;  3GU3 A;  4YCX A;  1Y88 A;  3EW9 A;  1SWV A;  3F5E A;  4Y2S A;  5KFH A;  2I9G A;  7ICK A;  1Q8K A;  1KFS A;  3RJG A;  4F3O A;  3SEI A;  3UXO A;  2G09 A;  4QZ9 A;  7ICO A;  4Y2U A;  2R8J A;  1XSN A;  3AU2 A;  4KX5 A;  2YX8 A;  2KIW A;  2KN7 A;  5AHX A;  4DFP A;  1HUZ A;  3QU4 A;  2JGA A;  2JV3 A;  4OJP A;  5G5H A;  5KG5 A;  3BZC A;  4JWN A;  2YQE A;  1NZP A;  3ZDB A;  4FO6 A;  5KG3 A;  3AQF A;  4YP3 A;  1O03 A;  2YB1 A;  1ZD2 P;  3AEV A;  2H5X A;  1PVP A;  2MUT B;  1ZQI A;  4XUS A;  5J0Y A;  4DQP A;  2KKV A;  1Z00 B;  2WFA A;  2Z7J A;  4DS5 A;  2JMG A;  3QZ7 A;  3PY8 A;  3HP6 A;  3PZP A;  4B9M A;  1JI7 A;  1RDF A;  1Z19 A;  4O3N A;  3IG8 A;  1Z3E B;  3C2L A;  1JRP A;  3T5H A;  4M9J A;  4XRH A;  4J9L A;  2JEJ A;  3F53 A;  3JPP A;  2KHQ A;  3GZF A;  1QSY A;  3R9K A;  5C5J A;  1KN5 A;  2G06 A;  4TUP A;  2GWS A;  2W3R A;  5KT2 A;  3ISC A;  5F3X B;  2FLP A;  1RQL A;  5AK6 A;  2V4R A;  2EZZ A;  4I29 A;  8ICW A;  1N63 A;  4QWC A;  5DKW A;  3KZX A;  1ZQW A;  9ICH A;  2H3F A;  5AKZ A;  5KG1 A;  4J9K A;  1N5W A;  4KLH A;  4J9O A;  2R8K A;  2XC9 A;  4C8N A;  2Y0S C;  5KFF A;  3CNH A;  3SZ2 A;  2KV2 A;  2HCF A;  3D2S A;  3SAF A;  4ZH4 A;  4IQT A;  5J2H A;  4RNM A;  3BQ0 A;  3RJE A;  5ALW A;  1L6N A;  3LK9 A;  2ZIX A;  3G6X A;  1NK6 A;  1A6S A;  3QX7 A;  1X9X A;  3BS5 B;  3ZDC A;  3PO5 A;  4O3Q A;  1ZQF A;  1FEZ A;  2ES6 A;  1ZYQ A;  2HBK A;  2UVW A;  2K60 A;  4NL9 C;  5J2E A;  3OPX A;  1B43 A;  1S9F A;  1XSL A;  3HWT A;  2MU2 A;  2MA1 A;  4J9N A;  7ICE A;  1SKS A;  1NZB A;  2VA2 A;  3ED5 A;  2LKY A;  5B66 U;  3H0R B;  4PL2 A;  4F4K A;  2BHN A;  2JH1 A;  4UB6 U;  7ICH A;  4YVZ A;  4DFD A;  3MR2 A;  4Z6D A;  4UBB A;  1Z4N A;  3SV3 A;  2KG5 A;  3ZD8 A;  4YR2 A;  5CB1 A;  2B21 A;  8ICI A;  3IHQ B;  1N48 A;  2NYV A;  1YZ7 A;  2MUT A;  4QNL A;  4JV0 A;  4DQS A;  1UHU A;  5KG0 A;  4RQN A;  3ETR A;  1X9S A;  3M9N B;  4IR9 A;  3GIK A;  3CW2 C;  3BJY A;  1KTQ A;  1NNL A;  4F93 B;  5DB6 A;  4Q8F A;  4I2J A;  2ASD A;  5KFQ A;  1JXL A;  2ZTE A;  2NO5 A;  3OJU A;  2EAP A;  1O08 A;  4FZL A;  3PVX A;  3UMB A;  3MDC A;  4ECX A;  8ICN A;  5J2G A;  5HR6 A;  1TK0 A;  2XI9 A;  5CR0 A;  2DWQ A;  1BNO A;  9ICS A;  3T5L A;  4M9G A;  4EZ6 A;  3RJH A;  3L5K A;  4ELU A;  4AYB F;  1Z4O A;  4Y2R A;  5T14 A;  5TZV A;  3T79 A;  1JXE A;  2HOI A;  5J0W A;  2K89 A;  4QZE A;  1S0N A;  2LHT A;  5J2D A;  4YR3 A;  3RB4 A;  3RRH A;  2ZIU B;  2W54 A;  2HHT A;  1RQN A;  1D9D A;  8ICE A;  4QZC A;  5ALY A;  1XWL A;  4TQS A;  4NLZ A;  4LZD A;  3PV8 A;  4IQW A;  1CUK A;  1FO4 A;  1ZQQ A;  1SIJ A;  1KEJ A;  2OWO A;  4PZN A;  2OH2 A;  4C8L A;  4ECQ A;  7ICV A;  2O6K A;  3M8R A;  2BDU A;  3A0H U;  2RDJ A;  5G5G A;  4ELT A;  2ZTC A;  3GDX A;  4C4R A;  3ALR A;  3BS5 A;  4UAT A;  3ZDE A;  5JTI A;  5IIO A;  4K4H A;  1JUD A;  3KHR A;  1RG6 A;  3OHA A;  2HBM A;  4QWA A;  4TUQ A;  3RTV A;  4UB5 A;  2BPF A; 
#chains in the Genus database with same CATH homology
 3CYM A;  2F76 X;  2KHQ A;  2CPR A;  2XVT A;  3N7R C;  3GZF A;  1D8B A;  2G07 A;  4IC9 A;  2KNJ A;  2GH1 A;  4NWI A;  1UPH A;  1Z1B A;  2G06 A;  1XNS A;  1DRG A;  4QNL A;  4JMU A;  2LYA A;  4FZN A;  1HIW A;  2XID A;  1YT3 A;  1MA7 A;  1XO0 A;  4QIW C;  2PMZ C;  1Q3U A;  4WJ3 B;  2DQN B;  2LBO A;  1GO3 F;  2JH7 A;  3DEE A;  3K1Z A;  3PST A;  4NLC A;  2WAQ F;  1F44 A;  3KZX A;  3AQE A;  2KOB A;  3HKZ C;  4OJL A;  2OYY A;  3VC8 A;  2F8L A;  2H3F A;  2K8B B;  1PVR A;  3CRX A;  3VCB A;  4NLB A;  1SZH A;  2ZIW B;  2KKP A;  2KJ5 A;  2MRL A;  4ICA A;  1Q3V A;  2ZIX B;  4ACO A;  4A8E A;  3C28 A;  2HBL A;  2R18 A;  3SQI A;  3M6Z A;  3M7D A;  4FE3 A;  3GU3 A;  4FZL A;  2GOL A;  3LVW A;  1ECW A;  4OJO A;  1URJ A;  2Y0S C;  2W04 A;  2KJ8 A;  2ZG6 A;  3PSF A;  1P7D A;  5HR6 A;  2H3Q A;  2F77 X;  2HOQ A;  2XI9 A;  4P0Q B;  4BJQ A;  3F5E A;  2VKQ A;  2K8C B;  4NV0 A;  1TAM A;  3SAG A;  2N1R A;  4P0Q A;  2KV2 A;  3D2S A;  3SAF A;  4U6P A;  3NRW A;  4P0P B;  3H0M B;  4P0P A;  2VJ5 A;  4AYB F;  2G09 A;  4U7C A;  4OJ5 A;  3SMV A;  5T14 A;  3T79 A;  2LYB A;  2E5S A;  2K8A A;  2KEY A;  3PSP A;  3N7P D;  2HOI A;  3L3F X;  4OO1 J;  2VIX A;  1A0P A;  2K89 A;  3F5A A;  4KX5 A;  1L6N A;  2ZIW A;  2KVC A;  2YX8 A;  2A3V A;  2KIW A;  1ED1 A;  2LHT A;  4CGZ A;  2HBJ A;  2ZIX A;  3PSI A;  2H3I A;  2KJ9 A;  1A6S A;  2ZXH A;  3IP4 B;  2ZIV B;  2JGA A;  2K4E A;  2W7O A;  2E1E A;  1T94 A;  2KIC A;  2RRD A;  2ZIU B;  4OJP A;  2H3V A;  2ZIV A;  3D2Q A;  3H0L B;  4C0Z A;  1ZQ1 C;  2E1F A;  5C0Y A;  3RF9 A;  2HBK A;  2NV3 A;  2XIC A;  2WAQ C;  4AYB C;  2CN1 A;  3LVV A;  2G08 A;  2G5H B;  5HR7 A;  2G0A A;  2G5I B;  4QIW F;  4O3M A;  3ONN A;  2VJ4 A;  2RHF A;  1IIP A;  2Q4T A;  1WUD A;  3OPX A;  4PL1 A;  3F2D A;  1PVQ A;  2W03 A;  4GFJ A;  2K4H A;  4BX9 C;  4CDG A;  3F2B A;  2KHV A;  2RP5 A;  3IG5 A;  4FZM A;  3AQF A;  3ICX A;  2OH2 A;  2HMX A;  2F2A B;  2YB1 A;  3KFU F;  2WB1 F;  2MA1 A;  2DF4 B;  1PVP A;  3N7S C;  3LYS A;  4OJ6 A;  2H3Z A;  2BDU A;  2OM6 A;  2KKV A;  1NZB A;  1KBU A;  4CRX A;  2JHD A;  2M0N A;  2LKY A;  2OXO A;  2Z7J A;  2ZXI A;  2YB4 A;  2Y0S F;  3H0R B;  2HOF A;  3RFA A;  2JMG A;  4PL2 A;  4BUG A;  2K4I A;  1CRX A;  3ALR A;  3NUQ A;  3PZP A;  2D6F C;  2ZIU A;  3MGV A;  1Z19 A;  3O0F A;  5KL8 B;  3C29 A;  3IG8 A;  5KL1 B;  3CP8 A;  4QJF B;  3SAH A;  1HEK A;  2KD1 A;  2PMZ F;  1OUQ A;  5CRX A;  2JH1 A;  3F2C A;  3D2N A;  4KX3 A;  2W7P A;  3IN5 A;  2HBM A;  5A0L A;  2CRX A;  2WB1 C;  2DGZ A;  4KMO B;  3M6K A;  3HKZ F;  3AL0 B;  3F53 A;  3E0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...