2DGZA

Solution structure of the helicase and rnase d c-terminal domain in werner syndrome atp-dependent helicase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
GSSGSSGSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLWEVIKHFCQTNSVQTDLFSSTKPQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the Helicase and RNase D C-terminal domain in Werner syndrome ATP-dependent helicase
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Werner syndrome protein variant
total genus 24
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2dgzA01
2MA1A 2E1FA 3SAHA 2RHFA 5C0YA 4NLCA 4CGZA 1GO3F 4QJFB 3CYMA 2DGZA 4OO1J 2HBLA 1YT3A 4O3MA 2CPRA 3SAFA 4NLBA 2KV2A 3SAGA 4CDGA 2HBMA 2HBJA 4QIWF 1D8BA 2HBKA 2RRDA 2E1EA 1WUDA
chains in the Genus database with same CATH superfamily
2DQNB 2E8PA 9ICAA 2E8OA 2E8NA 3NVWA 1NJXA 4BX9C 1SZHA 3JPPA 4J9OA 2E8MA 5ALEA 4ICAA 1K1SA 4NL9C 5J2AA 2B6GA 2KK0A 5KG1A 3CW2C 1XSPA 7ICGA 2KSOB 1ZQSA 1J97A 1KLNA 5KFTA 1S5LU 1B22A 4ACOA 1IG6A 5ALOA 2AU0A 1NNLA 5J0TA 4USAA 3L4PA 4Y2UA 2F8KA 1D9FA 3M9OB 4C4SA 3H8WA 2BPFA 1JXLA 1LV5A 8ICNA 2EH9A 4C4RA 5J0XA 4QW8A 1COOA 1CUKA 3BS7A 2PFNA 4U6PA 4NLKA 2QKQA 5KFGA 4Y2XA 2J6UA 3NGDA 4YP3A 1IM4A 1NK4A 9ICSA 5DG8A 2F1HA 7ICPA 4M6WA 5AICA 4FFDA 3ED5A 4F4ZA 3DDHA 3N28A 4ECVA 9ICJA 1TVAA 5KTQA 5AM0A 3QEBZ 4MF2A 2E5SA 9ICMA 4KLTA 5J2IA 4DOAA 4ELVA 3ZDEA 3HWTA 3I28A 1NKCA 1OUQA 4P2HA 1J2NA 1X6JA 1NK5A 1HEKA 2KFNA 2LYAA 2QB1A 2V4RA 4IRKA 2ZIXB 5CEHA 5AKIA 2FMPA 2XI9A 2PFPA 1N62A 1IIPA 3U26A 3V7KA 1JALA 5KAFU 5G5GA 1ZQZA 3Q8QB 3RR8A 1S0NA 4K4IA 3H8JA 4Y2RA 4F92B 5ALQA 1L6NA 4QZAA 4J9NA 4KLIA 4F3OA 2KD1A 2YY6A 3E58A 4F93B 3BQ2A 2K8BB 5HHIA 4IL6U 1CI4A 3IRUA 4QZ9A 4ECRA 4UBBA 2Y1IA 1T3QA 1X9SA 4PPXA 2XY6A 1JI7A 3Q8SB 4CF4A 1VJ5A 1O03A 5DB9A 4RPYA 4DQRA 5AI6A 3PR4A 2NV3A 4Q45A 4F4WA 8ICJA 3UMCA 4JUZA 2WF6A 2XC9A 9ICRA 2G08A 4UB3A 3Q8LA 4M9GA 2G06A 2D8CA 1U48A 4O3RA 3C2MA 3SAGA 4UAYA 3HILA 4TUSA 4PHPA 2YMLA 2RLTA 2G07A 3UXOA 1B43A 2B0CA 1NK0A 2H3FA 7ICSA 1C20A 5ALGA 5ALNA 4K4GA 4QJFB 3KHLA 2GLEA 2BCVA 3TAQA 5J2FA 1UHUA 2WF8A 1PZNA 3IM1A 3QU4A 3M6ZA 2RDJA 5ALPA 3WK5A 5DGAA 1SB3C 2BPGA 5IINA 3QU7A 4ECQA 2C22A 5IIIA 4DQPA 2J6TA 1T94A 2H3QA 3TADC 4QWEA 3FM9A 2KV2A 3ORYA 3PVXA 3KD3A 4GIBA 4BXOB 2G5HB 3RB6A 3H4DA 1ZQIA 8ICCA 2ZIXA 2KZ3A 2FPKA 5ALXA 1Z00B 5DQIA 1U4BA 4FS1A 3V6KA 1TK0A 3SV4A 4YVZA 3N97B 2N1RA 1NK8A 1N5XA 4LJXA 1SL0A 8ICAA 5AM1A 2JEIA 2LM4A 3BS5A 1QQ7A 3IN5A 4C8NA 4B9TA 2FPLA 4KLMA 2ODGA 2IOFK 5J8YC 2E1FA 3E2EA 3HP6A 1UCVA 9ICOA 3CYMA 3AU2A 4GLXA 3JPOA 5FP0A 4M6WB 4FS2A 5J2EA 2MAXA 4HAIA 3SAFA 3QUQA 4KX5A 1ZQGA 2BPCA 4RQ1A 4ELUA 2JEFA 1JXEA 3RRHA 3ZDCA 1XU4A 5JTIA 5J2GA 4HYKA 4KLQA 2HBKA 3H0MB 2ZIVB 4YR2A 5J2BA 4RT2A 2W9BA 5AK6A 5KT5A 5C0YA 2K60A 5DB6A 2HHQA 4C7ZA 2VA3A 4OJPA 4R8UA 1JRPA 2OCEA 4Q8FA 4DLEA 4F71A 1NJZA 5EE1A 2JMGA 2FLPA 1DRGA 5L1IA 2F77X 2EAPA 2YB1A 1B4FA 4YQWA 5AIAA 1YZ7A 4Y2PA 5BOMA 1QLNA 3T5JA 2LYBA 1CRXA 2HHSA 1Y88A 2K4HA 4I2IA 9ICKA 4JV2A 1N61A 1V85A 3ZDBA 5KFIA 5EE9A 1ZQDA 4DFJA 4EEYA 1L7PA 3C5FA 3KZXA 2BDPA 3PR5B 2EZZA 4O3OA 3OJUA 3O0FA 3QU9A 4PGXA 2BQ3A 2KN7A 4J9MA 4NLCA 2G0AA 2H5XA 3QU2A 3PW5A 1Q3VA 1QTMA 4KTQA 5EE3A 3A0BU 5DB8A 2M0NA 5AKGA 3MDCA 3JPSA 4F50A 4M04A 4OD0A 2NRWA 1XO1A 4DLGA 5IIMA 2J6SA 4Y2TA 4QZGA 4YMNA 4UB5A 4DOBA 3TAPA 3V6JA 2BDUA 2MUTA 3H8SA 2DGZA 3PW7A 2UVRA 1QH9A 4I29A 8ICHA 2KSOA 2BKEA 4NLBA 4MFFA 1S0OA 1S77D 2AXTU 5AK3A 1T7PA 4XRHA 3N7PD 2MRLA 4B9SA 3SR6A 1XC9A 4DL3A 4KLFA 9ICWA 4NLZA 2B21A 8ICPA 4I2AA 4EBEA 4Q44A 4P0PB 4Z6FA 4EX7A 1QSLA 3ZD8A 3BQ7A 2NYVA 1D8BA 2ZIVA 4JWMA 1UPHA 3NVVA 2QARB 5K4LA 1BPXA 7ICIA 2C28A 1ZXIA 2K89A 2ZG6A 8ICEA 4Z6DA 5ALIA 1KDHA 2WAQC 8ICUA 2VANA 5CP2A 3NRWA 2PFOA 3KHRA 5J2HA 3QZ7A 5ALRA 1HJPA 4IQWA 5EE0A 4O5KA 2IHMA 2KEYA 1X9XA 4RQ3A 3KOOA 2WFAA 1DK3A 3G6XA 1RQLA 3MABA 1XNSA 5ALSA 2KJ5A 5GTIU 1ZQWA 4NY8A 1SWWA 1A76A 5KL8B 1GO3F 1SXEA 1FO4A 3CRXA 4OO1J 4K4HA 1NZBA 3NUQA 4R8UB 1S10A 5DDMA 2ZTEA 4KITB 9ICFA 4QWAA 4AYBC 2HHTA 2ISPA 4B9UA 2AGPA 1PUZA 2DF4B 2YQEA 2G5IB 3C1ZA 4UB1A 4LZDA 3IDWA 1TAUA 4ZH4A 4RQ4A 2MUTB 2EANA 1SXDA 9ICGA 2R8IA 4OJ5A 5L1MA 5F9NA 4DQSA 5E79U 3TACB 2PKEA 9ICVA 1V9PA 1U9LA 4C8KA 2FLNA 1KTQA 4RQ0A 4M9LA 4UAWA 1ZRNA 4DS4A 4RNOA 1NK7A 3WK4A 5KFWA 4F4KA 4XA5A 4RUCA 4P4OA 2A3VA 1B0XA 2XY5A 4CF3A 9ICUA 4QZFA 3BZCA 4BUGA 4A8EA 1NI3A 4RU9A 7ICKA 2K4PA 3V7LA 5ALJA 2KG5A 1AROP 3PMNA 2C2DA 2ES6A 3KTQA 1WWVA 3F53A 2MSNA 1FEZA 8ICYA 1N48A 4F5RA 2DBYA 3FDSA 2G09A 4KLEA 8ICZA 1JIHA 3SEIA 3EPGA 2F44A 4PHAA 1X66A 1ZETA 1KKXA 1KRPA 2OXOA 3BQ1A 1VDVA 9ICLA 1HUOA 5KFYA 4DFMA 1KW4A 1T3NA 1L8LA 4UATA 1S9FA 1XSNA 3EW9A 4R64A 1UA1A 2UVUA 2JH1A 4FO6A 4RPZA 1Z3EB 3ETLA 5KFAA 3UPQA 1TE2A 3WK8A 1TFRA 4J9SA 4PJ0U 3LYSA 5F3XB 3RH6A 3BDPA 5F9LA 2H3ZA 3KZIU 2QARA 5KFUA 1SV0A 3PSPA 1PVRA 5KFFA 5J2JA 4P4MA 5J8YA 3UMGA 5J2KA 4MHVA 2KP7A 1NJWA 4DEZA 5ALZA 4C8LA 3K1ZA 2K8AA 4CE6A 2DL0A 3M8SA 4YN4A 5JRTA 3N7SC 5AKZA 3PX0A 4P0QB 1ED1A 1F0MA 3MFHA 4C0ZA 2HW3A 1FFUA 3QYPA 4EX6A 1TAMA 3MFIA 2JEJA 2ASJA 2JXJA 3QUTA 2PXIA 5KFQA 4C8MA 4PHEA 1PK1A 4ZOHC 2C2RA 4CF5A 3OHAA 4GXJA 2V9WA 1SL2A 3B0YA 3WKAA 4J9QA 2W7OA 2BCRA 4PL1A 3RB4A 4QWDA 2W8LA 4E0DA 4QZIA 3RFAA 8ICGA 7ICTA 4IQVA 4ED1A 3LVVA 3F5EA 3RB0A 1SIJA 3L5KA 4AP9A 3WK6A 3OSNA 3OGUA 4UBCA 1ZD3A 4BWMA 1AQ6A 1BPDA 1L3UA 1ZQJA 5AKXA 2F1IA 1SKRA 4EELA 2D3DA 8ICRA 8ICFA 4NV0A 2AGOA 5CHGA 1RZTA 4YCXA 2KJ9A 4O3PA 4BXOA 1L8OA 4OJ6A 1SKWA 2ZJAA 2KNJA 5IIOA 3SV3A 4BGDA 5DG9A 3SYZA 1JN3A 3GZFA 2ZJ5A 3MGIA 4NM1A 1ZQKA 1QQ6A 2AH5A 5AI0A 2OYYA 5B66U 3Q8PB 4M47A 5DLGA 1ZD2P 2FE9A 2W7PA 3F2DA 4DQQA 4C8OA 2A1JB 2W43A 2XICA 2KHVA 8ICLA 5AM3A 2YMPA 5KFBA 1HUZA 2HOQA 3GIKA 3TFSA 4RUAA 9ICCA 2MA1A 1Z1VA 5ALYA 2XGQA 8ICVA 2ZIWA 3UM9A 1PK1B 4KLSA 1ZQTA 1WG8A 4DSKA 2Y9TA 5KFPA 3RJGA 4ECUA 5KFEA 1BNOA 3NASA 3D6JA 5ALLA 2WHEA 2WF7A 4AYBF 3G6VA 2IBKA 2HVIA 4F2SA 3K4GA 1NKEA 3D2NA 2W3RA 2XIDA 2FMSA 1WYGA 3WKCA 3GIIA 1ZOLA 1O08A 1UQVA 2EAMA 7ICHA 3KHHA 2RQ5A 2ASDA 2A1JA 5HHHA 4PGYA 5KFHA 1DGSA 2V4QA 1NK6A 2HHXA 3ZDAA 4IR1A 3D2QA 2C2EA 3RBDA 1U45A 8ICMA 3UMBA 2LMRA 2FI1A 1JMSA 5CWRA 5EWEA 4ECXA 5HP4A 4OCZA 1S0MA 4B9MA 7ICLA 1N56A 8ICTA 3LDAA 2VIXA 1QSSA 4DSEA 3CP8A 3HKZC 2KICA 3FYHA 4ED0A 2IMWP 1IXRA 2ASLA 4UQGA 2F1JA 3C23A 1Q8KA 1SKSA 4KLOA 5J0OA 3PX4A 1C7YA 3N7RC 2HVHA 3H7IA 7ICFA 2NRVA 5DDYA 1Z4OA 3PZPA 2VJ5A 5D4BA 4PL2A 3PV8A 2DKXA 3RJFA 2W9AA 5KT2A 4QWCA 1KBUA 2OHFA 5J29A 1TAQA 3S6JA 2GO7A 2WAQF 2XVTA 3UQ2A 3PNCA 3H8MA 4O3NA 2CN1A 3PSIA 4O0IA 7ICVA 3ISCA 3Q8KA 4P0QA 4M0AA 1YZ6A 3TKAA 3VCBA 1S0VA 1JROA 1D9DA 2O6KA 2WTFA 3JPRA 4FZNA 2NO5A 3MDAA 3QX7A 4QZDA 1XWLA 2RP5A 4C80A 1KQQA 5AHXA 3JPTA 2VJ4A 3M7DA 3MR6A 5D49A 4YXMA 1KN5A 2Q0ZX 4I2DA 4ED6A 3SZ2A 3E0FA 8ICWA 4Y2YA 2DPIA 5J0QA 4CNQA 2JR5A 3RJKA 1LKYA 4ED2A 1BPYA 3L3FX 2R8JA 3TADA 5DBCA 1DK2A 3N4MB 5J2CA 3F2CA 1T4GA 1A77A 2PMZC 5DKWA 3AQFA 4M2YA 1NKBA 1ZQBA 1ZQNA 4YMOA 2RDIA 2ZTCA 2HOIA 4Y2VA 3SENA 4PHDA 4YR3A 3WU2U 4QZBA 2KKVA 2JRZA 1ZQHA 4B6JA 4YFKA 4UB4A 3HX0A 1COKA 2W9CA 3C2KA 3IG8A 1JUDA 5KG0A 1PVPA 5HNKA 2BCSA 4I2EA 4QZEA 3C2LA 3T5LA 3NVZA 1X6IA 3T5KA 4DSIA 2M9NA 1PVQA 3QUBA 4C4TA 5J0YA 4KN4A 5HR7A 2OWOA 3TARA 2KHQA 4RZRA 4RT3A 5HMMA 2W04A 5KFNA 2ZTDA 5KG2A 1QCKA 3T3FA 4RQ7A 5CA7A 2HHUA 3C21A 2R8KA 5AM4A 2IA6A 4P0PA 2EDUA 7ICUA 5DGBA 2BZFA 2WF5A 1XS9D 2HSZA 1NK9A 3ISBA 4DCCA 2R8HA 1NJYA 3MR5A 5DLFA 1L7MA 2NRZA 3PMLA 5J2DA 1ZRMA 2K4EA 4FZLA 3PSFA 4OJOA 5HR6A 2I5HA 4IC9A 1ECWA 3EYZA 2AQ0A 3I76A 5IILA 8ICKA 2HHWA 4JV1A 4IR9A 1KSPA 1K5OA 3ZI4A 5AM5A 4GC7A 2H3IA 3ISDA 3QE9Y 2ZIWB 5HMLA 1XSLA 1SGGA 5KFLA 1J2MA 1X2IA 1P7DA 3GILA 7ICJA 4QWBA 5KFJA 3TI0A 4F5QA 4DOCA 1UA0A 9ICEA 4DFPA 8ICOA 7ICEA 4I2FA 2LHTA 4P4PA 3IV6A 1RM6C 4UAUA 2XGPA 3MC1A 1ZJNA 2KE7A 4U7CA 3WKDA 2Y0SF 3SAHA 4GC6A 5KFDA 1D8LA 1RG6A 3HRDD 3THVA 1X42A 2L5YA 3LWLA 3BZKA 3ZD9A 4B9LA 3K1RB 1S76D 5KG5A 1ZQEA 4IQUA 3M6KA 2OH2A 3B0XA 5IIJA 3KHGA 4RQNA 4MFCA 2QB0A 5AKJA 2A19A 3H0LB 1URJA 2W8KA 2LM1A 2Y0SC 3RR7A 1ZQCA 3ALRA 4RQ2A 4DS5A 4F5NA 3PSTA 2VKQA 3ICXA 4RQ5A 3AEVA 4TQSA 4JMUA 3H4BA 1KEJA 4O3QA 4LVSA 1ZQOA 4YMMA 5ALFA 2BGWA 4IRCA 4F8RA 2HOFA 4RQMA 4ELTA 4R66A 2D6FC 1LKYB 3DEEA 5IIKA 4F4XA 4CDGA 2AJQA 2KKPA 5B5EU 3GV5B 2XO7A 2ALZA 2LYHA 2ESEA 5DBAA 1KFSA 3MGVA 5KFZA 4Q43A 5DQHA 3FC4A 5AI9A 3T79A 1RYUA 3FAHA 4QIWC 4J9RA 4EYIB 2HBLA 4KLHA 1YT3A 2DUYA 2I9GA 1SZPA 3ZDDA 1X9MA 3RJHA 2JZBB 2K4IA 4ECTA 2Y9UA 1PK3A 5L1JA 1QSYA 8ICBA 1L7OA 4JV0A 2EAOA 5ALUA 2WF9A 2R8GA 3GV8B 4F72A 2ZUCA 4O3SA 1ZQPA 1RDFA 4GXIA 2IHNA 3WK9A 4DFDA 5KFRA 2DWQA 2LI6A 1Z4NA 2KVSA 3D2SA 1ZQUA 2MU2A 4NL9A 1CEZA 3PW0A 1RYSA 1FIQA 1Z19A 4KX3A 5EWFA 2E1EA 5AI5A 1OXJA 4I2JA 3AM9A 2BQRA 2LPEA 2W9CB 2W9BB 2KIWA 2XY7A 5ALKA 4UB6U 5KT4A 1ZD5A 5KL1B 3MGHA 2VA2A 1ZQRA 2ZUDA 4NLNA 2JHDA 1IV8A 4Z6EA 4F5PA 9ICBA 1FFVA 5ALDA 2BCUA 4FE3A 3JPQA 3PW2A 1MC8A 2P35A 2JEGA 2HDOA 4UASA 4FZMA 8ICQA 3K75D 4EBCA 1X9WA 2PMZF 1ZQXA 5T14A 7ICMA 2F3NA 9ICQA 2CXYA 3WK7A 2DFLA 3AUOA 3SQIA 2PI5A 1A6SA 4Y2JA 3NTUA 3F2BA 2JZBA 2K8CB 2JH7A 4QZCA 2KFZA 4KLLA 1N5WA 4YD1A 4XQ8A 3KBBA 1EXNA 4NLGA 3H40A 1RPLA 1TK8A 4UAZA 4NWIA 5BPCA 5KFKA 1L3VA 2I6XA 1N2XA 2EQYA 2RRDA 4TUPA 2I1QA 3A0HU 4X5VA 4I28A 5CB1A 3BQ0A 1ZQ1C 1ZQVA 2W55A 2YX8A 1TV9A 2FLLA 2GOLA 2KOBA 2F76X 2AQ4A 1KFTA 5ALHA 2E3TA 4O3MA 1WWUA 1ZQMA 1ZD4A 4CRXA 3M9NB 2Y1JA 4DL6A 4DL7A 2P66A 4O5EA 1VLBA 4YD2A 3UQ0A 4JWNA 2KVCA 5L1LA 1RYRA 4B9VA 4I2HA 3PW4A 1WCNA 1TKDA 3RH5A 3EWAA 1T8EA 4R65A 5KAIU 5CRXA 1Z00A 2HBJA 1BVSA 3GQCA 1N60A 2IOFA 9ICTA 3GV7B 3HT3A 4Z6CA 4B9NA 3NRZA 5DB7A 5J0PA 1SWVA 3AMZA 3Q8RB 4R63A 3DV9A 2RHFA 3BS5B 5GTHU 1SV0C 3IP4B 1L3TA 1BPZA 4J03A 2NRTA 3MR3A 1Q3UA 5AM2A 2BHNA 9ICNA 3HJEA 4QIWF 2W11A 5AKLA 3OPXA 1L3SA 1ZYQA 2F2AB 4RQ6A 1LVHA 1Z1BA 2Z7JA 2KZMA 4DWIA 2YTUA 4G3IA 1MN8A 1BPBA 5ALMA 4I27A 4I2CA 4EYHB 3UXPA 1KFDA 3LK9A 7ICOA 2DKZA 3BJYA 5TISU 5DQGA 3EUB2 3BQTA 2ZXHA 9ICPA 4GFJA 1ZQFA 4DF8A 3QU5A 5KG7A 5J0UA 1X40A 1WCLA 4UW9A 4UAVA 3CNHA 3GIJA 1ZQYA 4DF4A 3SMVA 4XUSA 4EENA 3PX6A 1NOMA 3NVYA 3M1YA 4IQTA 3EZ5A 5AKKA 2ZXIA 1TK5A 2GH1A 3ETRA 3MBYA 1MQ2A 3B9JA 1OW5A 5KNIA 4J9PA 3EPIA 2P6UA 4UB2A 1ZQLA 4QNLA 3OTQA 1WUDA 2HCFA 3QUCA 4J9LA 1L7NA 4CGZA 4PH5A 5CR0A 4IRDA 4DSFA 4DQIA 2ATLA 5DG7A 2WB1C 3WKEA 4F5OA 3RBEA 5KFMA 4OJLA 4ECSA 1ZJMA 1QQ5A 5KT7A 3RTVA 2HBMA 4F4YA 1LB2B 2HI0A 2HMXA 2W03A 2W9MA 4DL2A 5KFCA 2EZYA 5KFOA 1M6YA 2FMQA 4DO9A 7ICRA 4PZNA 2OM6A 5AKHA 1MSWD 3H0RB 2LKYA 3HPOA 3C29A 1U47A 3M8RA 2HHVA 1N63A 3RF9A 4TURA 3TANA 5EOZA 4NJ8A 4MEYA 3PO5A 5KT6A 4F91B 1Q46A 4IS7A 1F44A 1ZQQA 2YN4A 2QB0B 3GIMA 1XO0A 1S8OA 5KG3A 4KLJA 3C1YA 7ICNA 1JX4A 5AK5A 3AU6A 5J0WA 3VC8A 3IHQB 1V38A 2CPRA 4GXKA 3KFUF 1UT8A 2ZJ8A 4TQRA 1H38A 1F5SA 2AGQA 2FPMA 2FJ6A 4NM2A 4CCHA 9ICHA 3SI8A 1RQNA 2KMDA 5DBBA 1K1QA 2NO4A 3RAQA 4ECYA 1RXWA 3JPNA 4ECWA 1S97A 5KFSA 4LZGA 4ED8A 4KMOB 3AN1A 4UB8U 3PY8A 2A1AA 2JGAA 5KFXA 9ICXA 2BCQA 4WJ3B 2W3SA 2UVWA 3C5GA 2JV3A 3GFKB 5ALWA 5AKYA 3T5HA 4RNNA 4QZ8A 3QXGA 5G5HA 3R9KA 1SV4A 3RB3A 3V72A 7ICQA 4MEXA 4O9MA 4FBUA 4KLDA 2AHOB 4TUQA 1HIWA 5KFVA 5AIBA 2F8LA 2DPJA 3NS1A 5A0LA 9ICIA 5ALTA 3J81j 2CRXA 4BJQA 4RPXA 4M9HA 4UARA 5AI4A 4ED7A 4PZOA 3KKAA 5D46A 3C28A 4DSJA 3OHBA 5ALVA 4KLGA 4J9KA 2R18A 5AKEA 5JU5A 1BPEA 3IG5A 1MQ3A 2YB4A 4KN7A 2KJ8A 2ZUBA 4DSLA 4KMUA 2KIVA 3G6YA 4RQ8A 2EZXA 2ISOA 5EWGA 3RJEA 4US8A 3GU3A 1MA7A 4US9A 2Q4TA 2XCPA 3AL0B 4FBTA 4QZHA 2FDRA 3WKBA 1L5UA 2VA8A 3QZ8A 8ICXA 2GWSA 3QEAZ 2KZZA 3TQ1A 4EBDA 1DOQA 2YMMA 5KT3A 3F5AA 4EZ9A 1DGJA 4YG2A 3KKAC 1BNPA 3V6HA 5J0RA 3HKZF 4RNMA 2OEHA 1D8YA 4O5CA 3TFRA 5AI8A 2QLTA 2YMQA 4QW9A 3RJIA 3V7JA 2BR0A 1NZPA 4DFKA 3AQEA 3PO4A 5KG6A 5H2FU 4M9NA 4Q8EA 3LWMA 5J0SA 4DL4A 3MR2A 4Y2QA 1BGXT 4YXJA 2KTQA 1SL1A 3OJSA 2LBOA 3UXNA 1A0PA 1UT5A 4G9BA 2P6RA 4C7YA 5KG4A 4I2BA 3RH4A 5C5JA 8ICIA 4F2RA 4PGQA 4BWJA 2ZIUA 2H3VA 1ZQAA 4JB3A 3OSPA 5AK4A 8ICSA 1DXSA 5CJ7A 4YR0A 4ED3A 2NRXA 1RXVA 4EEKA 4ECZA 2PI4A 4MF8A 5JUMA 3HW8A 2PFQA 2BQUA 3RRGA 5BOLA 3ONNA 3Q8MA 2UVVA 4M9JA 4KLUA 2ZIUB 2WB1F 4EZ6A 3RJJA 3LVWA 4MFAA 3QNMA 3SD7A 2W54A 4NXZA 1U49A 4JK1A 2IOHA 4BDPA 1KL9A 3RAXA 3I1YA 4Y2SA 4I2GA 5L9XA 5L1KA 5TZVA 3M9MB 1V97A 2XCAA 3GDXA 4DL5A
chains in the Genus database with same CATH topology
2DQNB 3F5AA 4GFJA 2Y0SF 4KMOB 2MA1A 4P0QB 1ED1A 3SAHA 1T94A 3N7RC 2H3QA 2LYBA 2ZIXB 4C0ZA 1ZQ1C 2JGAA 1CRXA 2ZIWA 2YX8A 4BX9C 1SZHA 2A3VA 2GOLA 2KOBA 2F76X 4WJ3B 2K89A 2ZG6A 2XI9A 3HKZF 3SMVA 4ICAA 2K4HA 3PZPA 4O3MA 4BUGA 1TAMA 2VJ5A 2KV2A 1IIPA 2WAQC 4CRXA 4PL2A 4A8EA 2ZXIA 2GH1A 1PVQA 1KBUA 3D2SA 3NRWA 3AQEA 5HR7A 1Z19A 4KX3A 2KVCA 2G5HB 3KZXA 2E1EA 3M6KA 2OH2A 4QNLA 1WUDA 3O0FA 1L6NA 3F53A 2WAQF 2ZIXA 2XVTA 4NLCA 4CGZA 2G0AA 2KHQA 1Z1BA 2KIWA 1HIWA 2CN1A 4ACOA 4AYBF 2KD1A 3PSIA 2F8LA 2W7OA 2WB1C 1Q3VA 2KEYA 5A0LA 2K8BB 2W04A 4PL1A 2ZXHA 3H0LB 1URJA 2N1RA 3D2NA 4P0QA 5CRXA 4OJLA 2Y0SC 5KL1B 2LBOA 2CRXA 2G09A 2XIDA 2HBMA 2M0NA 1A0PA 2HBJA 3RFAA 3ALRA 3VCBA 2HMXA 4BJQA 4P0PA 2JHDA 2W03A 4FZNA 3PSTA 3LVVA 2VKQA 3ICXA 1XNSA 3F5EA 2OXOA 2RP5A 4FE3A 3IN5A 4JMUA 2KJ5A 2OM6A 2E1FA 2NV3A 2RHFA 2H3VA 2VJ4A 2ZIUA 3M7DA 3C28A 3H0RB 5KL8B 1GO3F 2LKYA 3IP4B 3C29A 2BDUA 3CYMA 4U6PA 2G08A 2DGZA 2HOFA 3CRXA 4OO1J 2JH1A 4NV0A 1NZBA 3D2QA 3RF9A 3NUQA 2G06A 2D6FC 4FZMA 3DEEA 1Q3UA 2R18A 2K4EA 2KJ9A 3E0FA 2PMZF 3PSFA 4FZLA 3IG5A 4KX5A 4NLBA 4OJOA 3SAGA 4OJ6A 4CDGA 2YB4A 5T14A 2KNJA 5HR6A 4IC9A 2KKPA 1ECWA 2KJ8A 4AYBC 3SAFA 4QIWF 3SQIA 3ONNA 3OPXA 3GZFA 3LYSA 2G07A 3L3FX 1F44A 2HBKA 3H0MB 3MGVA 2ZIVB 2F2AB 2DF4B 1A6SA 2H3FA 1XO0A 2G5IB 3F2CA 2H3ZA 2OYYA 2PMZC 3F2BA 2K8CB 2H3IA 3N7PD 2VIXA 2ZIWB 3T79A 3PSPA 3AQFA 3GU3A 2MRLA 2ZIUB 4U7CA 1PVRA 1MA7A 2JH7A 4QJFB 3VC8A 4QIWC 2Q4TA 2WB1F 3AL0B 1P7DA 4OJPA 2HBLA 2Z7JA 3LVWA 3CP8A 2W7PA 3HKZC 2HOIA 1YT3A 2KICA 3F2DA 2E5SA 2CPRA 2KKVA 4OJ5A 4P0PB 3KFUF 3K1ZA 2K8AA 2JMGA 1OUQA 2LHTA 2K4IA 1DRGA 2XICA 3M6ZA 2F77X 2KHVA 4NWIA 2YB1A 1D8BA 2ZIVA 5C0YA 1UPHA 2RRDA 2HOQA 3IG8A 3N7SC 1HEKA 1PVPA 2LYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MA1 A;  2E1F A;  3SAH A;  2RHF A;  5C0Y A;  4NLC A;  4CGZ A;  1GO3 F;  4QJF B;  3CYM A;  2DGZ A;  4OO1 J;  2HBL A;  1YT3 A;  4O3M A;  2CPR A;  3SAF A;  4NLB A;  2KV2 A;  3SAG A;  4CDG A;  2HBM A;  2HBJ A;  4QIW F;  1D8B A;  2HBK A;  2RRD A;  2E1E A;  1WUD A; 
#chains in the Genus database with same CATH topology
 2DQN B;  2E8P A;  9ICA A;  2E8O A;  2E8N A;  3NVW A;  1NJX A;  4BX9 C;  1SZH A;  3JPP A;  4J9O A;  2E8M A;  5ALE A;  4ICA A;  1K1S A;  4NL9 C;  5J2A A;  2B6G A;  2KK0 A;  5KG1 A;  3CW2 C;  1XSP A;  7ICG A;  2KSO B;  1ZQS A;  1J97 A;  1KLN A;  5KFT A;  1S5L U;  1B22 A;  4ACO A;  1IG6 A;  5ALO A;  2AU0 A;  1NNL A;  5J0T A;  4USA A;  3L4P A;  4Y2U A;  2F8K A;  1D9F A;  3M9O B;  4C4S A;  3H8W A;  2BPF A;  1JXL A;  1LV5 A;  8ICN A;  2EH9 A;  4C4R A;  5J0X A;  4QW8 A;  1COO A;  1CUK A;  3BS7 A;  2PFN A;  4U6P A;  4NLK A;  2QKQ A;  5KFG A;  4Y2X A;  2J6U A;  3NGD A;  4YP3 A;  1IM4 A;  1NK4 A;  9ICS A;  5DG8 A;  2F1H A;  7ICP A;  4M6W A;  5AIC A;  4FFD A;  3ED5 A;  4F4Z A;  3DDH A;  3N28 A;  4ECV A;  9ICJ A;  1TVA A;  5KTQ A;  5AM0 A;  3QEB Z;  4MF2 A;  2E5S A;  9ICM A;  4KLT A;  5J2I A;  4DOA A;  4ELV A;  3ZDE A;  3HWT A;  3I28 A;  1NKC A;  1OUQ A;  4P2H A;  1J2N A;  1X6J A;  1NK5 A;  1HEK A;  2KFN A;  2LYA A;  2QB1 A;  2V4R A;  4IRK A;  2ZIX B;  5CEH A;  5AKI A;  2FMP A;  2XI9 A;  2PFP A;  1N62 A;  1IIP A;  3U26 A;  3V7K A;  1JAL A;  5KAF U;  5G5G A;  1ZQZ A;  3Q8Q B;  3RR8 A;  1S0N A;  4K4I A;  3H8J A;  4Y2R A;  4F92 B;  5ALQ A;  1L6N A;  4QZA A;  4J9N A;  4KLI A;  4F3O A;  2KD1 A;  2YY6 A;  3E58 A;  4F93 B;  3BQ2 A;  2K8B B;  5HHI A;  4IL6 U;  1CI4 A;  3IRU A;  4QZ9 A;  4ECR A;  4UBB A;  2Y1I A;  1T3Q A;  1X9S A;  4PPX A;  2XY6 A;  1JI7 A;  3Q8S B;  4CF4 A;  1VJ5 A;  1O03 A;  5DB9 A;  4RPY A;  4DQR A;  5AI6 A;  3PR4 A;  2NV3 A;  4Q45 A;  4F4W A;  8ICJ A;  3UMC A;  4JUZ A;  2WF6 A;  2XC9 A;  9ICR A;  2G08 A;  4UB3 A;  3Q8L A;  4M9G A;  2G06 A;  2D8C A;  1U48 A;  4O3R A;  3C2M A;  3SAG A;  4UAY A;  3HIL A;  4TUS A;  4PHP A;  2YML A;  2RLT A;  2G07 A;  3UXO A;  1B43 A;  2B0C A;  1NK0 A;  2H3F A;  7ICS A;  1C20 A;  5ALG A;  5ALN A;  4K4G A;  4QJF B;  3KHL A;  2GLE A;  2BCV A;  3TAQ A;  5J2F A;  1UHU A;  2WF8 A;  1PZN A;  3IM1 A;  3QU4 A;  3M6Z A;  2RDJ A;  5ALP A;  3WK5 A;  5DGA A;  1SB3 C;  2BPG A;  5IIN A;  3QU7 A;  4ECQ A;  2C22 A;  5III A;  4DQP A;  2J6T A;  1T94 A;  2H3Q A;  3TAD C;  4QWE A;  3FM9 A;  2KV2 A;  3ORY A;  3PVX A;  3KD3 A;  4GIB A;  4BXO B;  2G5H B;  3RB6 A;  3H4D A;  1ZQI A;  8ICC A;  2ZIX A;  2KZ3 A;  2FPK A;  5ALX A;  1Z00 B;  5DQI A;  1U4B A;  4FS1 A;  3V6K A;  1TK0 A;  3SV4 A;  4YVZ A;  3N97 B;  2N1R A;  1NK8 A;  1N5X A;  4LJX A;  1SL0 A;  8ICA A;  5AM1 A;  2JEI A;  2LM4 A;  3BS5 A;  1QQ7 A;  3IN5 A;  4C8N A;  4B9T A;  2FPL A;  4KLM A;  2ODG A;  2IOF K;  5J8Y C;  2E1F A;  3E2E A;  3HP6 A;  1UCV A;  9ICO A;  3CYM A;  3AU2 A;  4GLX A;  3JPO A;  5FP0 A;  4M6W B;  4FS2 A;  5J2E A;  2MAX A;  4HAI A;  3SAF A;  3QUQ A;  4KX5 A;  1ZQG A;  2BPC A;  4RQ1 A;  4ELU A;  2JEF A;  1JXE A;  3RRH A;  3ZDC A;  1XU4 A;  5JTI A;  5J2G A;  4HYK A;  4KLQ A;  2HBK A;  3H0M B;  2ZIV B;  4YR2 A;  5J2B A;  4RT2 A;  2W9B A;  5AK6 A;  5KT5 A;  5C0Y A;  2K60 A;  5DB6 A;  2HHQ A;  4C7Z A;  2VA3 A;  4OJP A;  4R8U A;  1JRP A;  2OCE A;  4Q8F A;  4DLE A;  4F71 A;  1NJZ A;  5EE1 A;  2JMG A;  2FLP A;  1DRG A;  5L1I A;  2F77 X;  2EAP A;  2YB1 A;  1B4F A;  4YQW A;  5AIA A;  1YZ7 A;  4Y2P A;  5BOM A;  1QLN A;  3T5J A;  2LYB A;  1CRX A;  2HHS A;  1Y88 A;  2K4H A;  4I2I A;  9ICK A;  4JV2 A;  1N61 A;  1V85 A;  3ZDB A;  5KFI A;  5EE9 A;  1ZQD A;  4DFJ A;  4EEY A;  1L7P A;  3C5F A;  3KZX A;  2BDP A;  3PR5 B;  2EZZ A;  4O3O A;  3OJU A;  3O0F A;  3QU9 A;  4PGX A;  2BQ3 A;  2KN7 A;  4J9M A;  4NLC A;  2G0A A;  2H5X A;  3QU2 A;  3PW5 A;  1Q3V A;  1QTM A;  4KTQ A;  5EE3 A;  3A0B U;  5DB8 A;  2M0N A;  5AKG A;  3MDC A;  3JPS A;  4F50 A;  4M04 A;  4OD0 A;  2NRW A;  1XO1 A;  4DLG A;  5IIM A;  2J6S A;  4Y2T A;  4QZG A;  4YMN A;  4UB5 A;  4DOB A;  3TAP A;  3V6J A;  2BDU A;  2MUT A;  3H8S A;  2DGZ A;  3PW7 A;  2UVR A;  1QH9 A;  4I29 A;  8ICH A;  2KSO A;  2BKE A;  4NLB A;  4MFF A;  1S0O A;  1S77 D;  2AXT U;  5AK3 A;  1T7P A;  4XRH A;  3N7P D;  2MRL A;  4B9S A;  3SR6 A;  1XC9 A;  4DL3 A;  4KLF A;  9ICW A;  4NLZ A;  2B21 A;  8ICP A;  4I2A A;  4EBE A;  4Q44 A;  4P0P B;  4Z6F A;  4EX7 A;  1QSL A;  3ZD8 A;  3BQ7 A;  2NYV A;  1D8B A;  2ZIV A;  4JWM A;  1UPH A;  3NVV A;  2QAR B;  5K4L A;  1BPX A;  7ICI A;  2C28 A;  1ZXI A;  2K89 A;  2ZG6 A;  8ICE A;  4Z6D A;  5ALI A;  1KDH A;  2WAQ C;  8ICU A;  2VAN A;  5CP2 A;  3NRW A;  2PFO A;  3KHR A;  5J2H A;  3QZ7 A;  5ALR A;  1HJP A;  4IQW A;  5EE0 A;  4O5K A;  2IHM A;  2KEY A;  1X9X A;  4RQ3 A;  3KOO A;  2WFA A;  1DK3 A;  3G6X A;  1RQL A;  3MAB A;  1XNS A;  5ALS A;  2KJ5 A;  5GTI U;  1ZQW A;  4NY8 A;  1SWW A;  1A76 A;  5KL8 B;  1GO3 F;  1SXE A;  1FO4 A;  3CRX A;  4OO1 J;  4K4H A;  1NZB A;  3NUQ A;  4R8U B;  1S10 A;  5DDM A;  2ZTE A;  4KIT B;  9ICF A;  4QWA A;  4AYB C;  2HHT A;  2ISP A;  4B9U A;  2AGP A;  1PUZ A;  2DF4 B;  2YQE A;  2G5I B;  3C1Z A;  4UB1 A;  4LZD A;  3IDW A;  1TAU A;  4ZH4 A;  4RQ4 A;  2MUT B;  2EAN A;  1SXD A;  9ICG A;  2R8I A;  4OJ5 A;  5L1M A;  5F9N A;  4DQS A;  5E79 U;  3TAC B;  2PKE A;  9ICV A;  1V9P A;  1U9L A;  4C8K A;  2FLN A;  1KTQ A;  4RQ0 A;  4M9L A;  4UAW A;  1ZRN A;  4DS4 A;  4RNO A;  1NK7 A;  3WK4 A;  5KFW A;  4F4K A;  4XA5 A;  4RUC A;  4P4O A;  2A3V A;  1B0X A;  2XY5 A;  4CF3 A;  9ICU A;  4QZF A;  3BZC A;  4BUG A;  4A8E A;  1NI3 A;  4RU9 A;  7ICK A;  2K4P A;  3V7L A;  5ALJ A;  2KG5 A;  1ARO P;  3PMN A;  2C2D A;  2ES6 A;  3KTQ A;  1WWV A;  3F53 A;  2MSN A;  1FEZ A;  8ICY A;  1N48 A;  4F5R A;  2DBY A;  3FDS A;  2G09 A;  4KLE A;  8ICZ A;  1JIH A;  3SEI A;  3EPG A;  2F44 A;  4PHA A;  1X66 A;  1ZET A;  1KKX A;  1KRP A;  2OXO A;  3BQ1 A;  1VDV A;  9ICL A;  1HUO A;  5KFY A;  4DFM A;  1KW4 A;  1T3N A;  1L8L A;  4UAT A;  1S9F A;  1XSN A;  3EW9 A;  4R64 A;  1UA1 A;  2UVU A;  2JH1 A;  4FO6 A;  4RPZ A;  1Z3E B;  3ETL A;  5KFA A;  3UPQ A;  1TE2 A;  3WK8 A;  1TFR A;  4J9S A;  4PJ0 U;  3LYS A;  5F3X B;  3RH6 A;  3BDP A;  5F9L A;  2H3Z A;  3KZI U;  2QAR A;  5KFU A;  1SV0 A;  3PSP A;  1PVR A;  5KFF A;  5J2J A;  4P4M A;  5J8Y A;  3UMG A;  5J2K A;  4MHV A;  2KP7 A;  1NJW A;  4DEZ A;  5ALZ A;  4C8L A;  3K1Z A;  2K8A A;  4CE6 A;  2DL0 A;  3M8S A;  4YN4 A;  5JRT A;  3N7S C;  5AKZ A;  3PX0 A;  4P0Q B;  1ED1 A;  1F0M A;  3MFH A;  4C0Z A;  2HW3 A;  1FFU A;  3QYP A;  4EX6 A;  1TAM A;  3MFI A;  2JEJ A;  2ASJ A;  2JXJ A;  3QUT A;  2PXI A;  5KFQ A;  4C8M A;  4PHE A;  1PK1 A;  4ZOH C;  2C2R A;  4CF5 A;  3OHA A;  4GXJ A;  2V9W A;  1SL2 A;  3B0Y A;  3WKA A;  4J9Q A;  2W7O A;  2BCR A;  4PL1 A;  3RB4 A;  4QWD A;  2W8L A;  4E0D A;  4QZI A;  3RFA A;  8ICG A;  7ICT A;  4IQV A;  4ED1 A;  3LVV A;  3F5E A;  3RB0 A;  1SIJ A;  3L5K A;  4AP9 A;  3WK6 A;  3OSN A;  3OGU A;  4UBC A;  1ZD3 A;  4BWM A;  1AQ6 A;  1BPD A;  1L3U A;  1ZQJ A;  5AKX A;  2F1I A;  1SKR A;  4EEL A;  2D3D A;  8ICR A;  8ICF A;  4NV0 A;  2AGO A;  5CHG A;  1RZT A;  4YCX A;  2KJ9 A;  4O3P A;  4BXO A;  1L8O A;  4OJ6 A;  1SKW A;  2ZJA A;  2KNJ A;  5IIO A;  3SV3 A;  4BGD A;  5DG9 A;  3SYZ A;  1JN3 A;  3GZF A;  2ZJ5 A;  3MGI A;  4NM1 A;  1ZQK A;  1QQ6 A;  2AH5 A;  5AI0 A;  2OYY A;  5B66 U;  3Q8P B;  4M47 A;  5DLG A;  1ZD2 P;  2FE9 A;  2W7P A;  3F2D A;  4DQQ A;  4C8O A;  2A1J B;  2W43 A;  2XIC A;  2KHV A;  8ICL A;  5AM3 A;  2YMP A;  5KFB A;  1HUZ A;  2HOQ A;  3GIK A;  3TFS A;  4RUA A;  9ICC A;  2MA1 A;  1Z1V A;  5ALY A;  2XGQ A;  8ICV A;  2ZIW A;  3UM9 A;  1PK1 B;  4KLS A;  1ZQT A;  1WG8 A;  4DSK A;  2Y9T A;  5KFP A;  3RJG A;  4ECU A;  5KFE A;  1BNO A;  3NAS A;  3D6J A;  5ALL A;  2WHE A;  2WF7 A;  4AYB F;  3G6V A;  2IBK A;  2HVI A;  4F2S A;  3K4G A;  1NKE A;  3D2N A;  2W3R A;  2XID A;  2FMS A;  1WYG A;  3WKC A;  3GII A;  1ZOL A;  1O08 A;  1UQV A;  2EAM A;  7ICH A;  3KHH A;  2RQ5 A;  2ASD A;  2A1J A;  5HHH A;  4PGY A;  5KFH A;  1DGS A;  2V4Q A;  1NK6 A;  2HHX A;  3ZDA A;  4IR1 A;  3D2Q A;  2C2E A;  3RBD A;  1U45 A;  8ICM A;  3UMB A;  2LMR A;  2FI1 A;  1JMS A;  5CWR A;  5EWE A;  4ECX A;  5HP4 A;  4OCZ A;  1S0M A;  4B9M A;  7ICL A;  1N56 A;  8ICT A;  3LDA A;  2VIX A;  1QSS A;  4DSE A;  3CP8 A;  3HKZ C;  2KIC A;  3FYH A;  4ED0 A;  2IMW P;  1IXR A;  2ASL A;  4UQG A;  2F1J A;  3C23 A;  1Q8K A;  1SKS A;  4KLO A;  5J0O A;  3PX4 A;  1C7Y A;  3N7R C;  2HVH A;  3H7I A;  7ICF A;  2NRV A;  5DDY A;  1Z4O A;  3PZP A;  2VJ5 A;  5D4B A;  4PL2 A;  3PV8 A;  2DKX A;  3RJF A;  2W9A A;  5KT2 A;  4QWC A;  1KBU A;  2OHF A;  5J29 A;  1TAQ A;  3S6J A;  2GO7 A;  2WAQ F;  2XVT A;  3UQ2 A;  3PNC A;  3H8M A;  4O3N A;  2CN1 A;  3PSI A;  4O0I A;  7ICV A;  3ISC A;  3Q8K A;  4P0Q A;  4M0A A;  1YZ6 A;  3TKA A;  3VCB A;  1S0V A;  1JRO A;  1D9D A;  2O6K A;  2WTF A;  3JPR A;  4FZN A;  2NO5 A;  3MDA A;  3QX7 A;  4QZD A;  1XWL A;  2RP5 A;  4C80 A;  1KQQ A;  5AHX A;  3JPT A;  2VJ4 A;  3M7D A;  3MR6 A;  5D49 A;  4YXM A;  1KN5 A;  2Q0Z X;  4I2D A;  4ED6 A;  3SZ2 A;  3E0F A;  8ICW A;  4Y2Y A;  2DPI A;  5J0Q A;  4CNQ A;  2JR5 A;  3RJK A;  1LKY A;  4ED2 A;  1BPY A;  3L3F X;  2R8J A;  3TAD A;  5DBC A;  1DK2 A;  3N4M B;  5J2C A;  3F2C A;  1T4G A;  1A77 A;  2PMZ C;  5DKW A;  3AQF A;  4M2Y A;  1NKB A;  1ZQB A;  1ZQN A;  4YMO A;  2RDI A;  2ZTC A;  2HOI A;  4Y2V A;  3SEN A;  4PHD A;  4YR3 A;  3WU2 U;  4QZB A;  2KKV A;  2JRZ A;  1ZQH A;  4B6J A;  4YFK A;  4UB4 A;  3HX0 A;  1COK A;  2W9C A;  3C2K A;  3IG8 A;  1JUD A;  5KG0 A;  1PVP A;  5HNK A;  2BCS A;  4I2E A;  4QZE A;  3C2L A;  3T5L A;  3NVZ A;  1X6I A;  3T5K A;  4DSI A;  2M9N A;  1PVQ A;  3QUB A;  4C4T A;  5J0Y A;  4KN4 A;  5HR7 A;  2OWO A;  3TAR A;  2KHQ A;  4RZR A;  4RT3 A;  5HMM A;  2W04 A;  5KFN A;  2ZTD A;  5KG2 A;  1QCK A;  3T3F A;  4RQ7 A;  5CA7 A;  2HHU A;  3C21 A;  2R8K A;  5AM4 A;  2IA6 A;  4P0P A;  2EDU A;  7ICU A;  5DGB A;  2BZF A;  2WF5 A;  1XS9 D;  2HSZ A;  1NK9 A;  3ISB A;  4DCC A;  2R8H A;  1NJY A;  3MR5 A;  5DLF A;  1L7M A;  2NRZ A;  3PML A;  5J2D A;  1ZRM A;  2K4E A;  4FZL A;  3PSF A;  4OJO A;  5HR6 A;  2I5H A;  4IC9 A;  1ECW A;  3EYZ A;  2AQ0 A;  3I76 A;  5IIL A;  8ICK A;  2HHW A;  4JV1 A;  4IR9 A;  1KSP A;  1K5O A;  3ZI4 A;  5AM5 A;  4GC7 A;  2H3I A;  3ISD A;  3QE9 Y;  2ZIW B;  5HML A;  1XSL A;  1SGG A;  5KFL A;  1J2M A;  1X2I A;  1P7D A;  3GIL A;  7ICJ A;  4QWB A;  5KFJ A;  3TI0 A;  4F5Q A;  4DOC A;  1UA0 A;  9ICE A;  4DFP A;  8ICO A;  7ICE A;  4I2F A;  2LHT A;  4P4P A;  3IV6 A;  1RM6 C;  4UAU A;  2XGP A;  3MC1 A;  1ZJN A;  2KE7 A;  4U7C A;  3WKD A;  2Y0S F;  3SAH A;  4GC6 A;  5KFD A;  1D8L A;  1RG6 A;  3HRD D;  3THV A;  1X42 A;  2L5Y A;  3LWL A;  3BZK A;  3ZD9 A;  4B9L A;  3K1R B;  1S76 D;  5KG5 A;  1ZQE A;  4IQU A;  3M6K A;  2OH2 A;  3B0X A;  5IIJ A;  3KHG A;  4RQN A;  4MFC A;  2QB0 A;  5AKJ A;  2A19 A;  3H0L B;  1URJ A;  2W8K A;  2LM1 A;  2Y0S C;  3RR7 A;  1ZQC A;  3ALR A;  4RQ2 A;  4DS5 A;  4F5N A;  3PST A;  2VKQ A;  3ICX A;  4RQ5 A;  3AEV A;  4TQS A;  4JMU A;  3H4B A;  1KEJ A;  4O3Q A;  4LVS A;  1ZQO A;  4YMM A;  5ALF A;  2BGW A;  4IRC A;  4F8R A;  2HOF A;  4RQM A;  4ELT A;  4R66 A;  2D6F C;  1LKY B;  3DEE A;  5IIK A;  4F4X A;  4CDG A;  2AJQ A;  2KKP A;  5B5E U;  3GV5 B;  2XO7 A;  2ALZ A;  2LYH A;  2ESE A;  5DBA A;  1KFS A;  3MGV A;  5KFZ A;  4Q43 A;  5DQH A;  3FC4 A;  5AI9 A;  3T79 A;  1RYU A;  3FAH A;  4QIW C;  4J9R A;  4EYI B;  2HBL A;  4KLH A;  1YT3 A;  2DUY A;  2I9G A;  1SZP A;  3ZDD A;  1X9M A;  3RJH A;  2JZB B;  2K4I A;  4ECT A;  2Y9U A;  1PK3 A;  5L1J A;  1QSY A;  8ICB A;  1L7O A;  4JV0 A;  2EAO A;  5ALU A;  2WF9 A;  2R8G A;  3GV8 B;  4F72 A;  2ZUC A;  4O3S A;  1ZQP A;  1RDF A;  4GXI A;  2IHN A;  3WK9 A;  4DFD A;  5KFR A;  2DWQ A;  2LI6 A;  1Z4N A;  2KVS A;  3D2S A;  1ZQU A;  2MU2 A;  4NL9 A;  1CEZ A;  3PW0 A;  1RYS A;  1FIQ A;  1Z19 A;  4KX3 A;  5EWF A;  2E1E A;  5AI5 A;  1OXJ A;  4I2J A;  3AM9 A;  2BQR A;  2LPE A;  2W9C B;  2W9B B;  2KIW A;  2XY7 A;  5ALK A;  4UB6 U;  5KT4 A;  1ZD5 A;  5KL1 B;  3MGH A;  2VA2 A;  1ZQR A;  2ZUD A;  4NLN A;  2JHD A;  1IV8 A;  4Z6E A;  4F5P A;  9ICB A;  1FFV A;  5ALD A;  2BCU A;  4FE3 A;  3JPQ A;  3PW2 A;  1MC8 A;  2P35 A;  2JEG A;  2HDO A;  4UAS A;  4FZM A;  8ICQ A;  3K75 D;  4EBC A;  1X9W A;  2PMZ F;  1ZQX A;  5T14 A;  7ICM A;  2F3N A;  9ICQ A;  2CXY A;  3WK7 A;  2DFL A;  3AUO A;  3SQI A;  2PI5 A;  1A6S A;  4Y2J A;  3NTU A;  3F2B A;  2JZB A;  2K8C B;  2JH7 A;  4QZC A;  2KFZ A;  4KLL A;  1N5W A;  4YD1 A;  4XQ8 A;  3KBB A;  1EXN A;  4NLG A;  3H40 A;  1RPL A;  1TK8 A;  4UAZ A;  4NWI A;  5BPC A;  5KFK A;  1L3V A;  2I6X A;  1N2X A;  2EQY A;  2RRD A;  4TUP A;  2I1Q A;  3A0H U;  4X5V A;  4I28 A;  5CB1 A;  3BQ0 A;  1ZQ1 C;  1ZQV A;  2W55 A;  2YX8 A;  1TV9 A;  2FLL A;  2GOL A;  2KOB A;  2F76 X;  2AQ4 A;  1KFT A;  5ALH A;  2E3T A;  4O3M A;  1WWU A;  1ZQM A;  1ZD4 A;  4CRX A;  3M9N B;  2Y1J A;  4DL6 A;  4DL7 A;  2P66 A;  4O5E A;  1VLB A;  4YD2 A;  3UQ0 A;  4JWN A;  2KVC A;  5L1L A;  1RYR A;  4B9V A;  4I2H A;  3PW4 A;  1WCN A;  1TKD A;  3RH5 A;  3EWA A;  1T8E A;  4R65 A;  5KAI U;  5CRX A;  1Z00 A;  2HBJ A;  1BVS A;  3GQC A;  1N60 A;  2IOF A;  9ICT A;  3GV7 B;  3HT3 A;  4Z6C A;  4B9N A;  3NRZ A;  5DB7 A;  5J0P A;  1SWV A;  3AMZ A;  3Q8R B;  4R63 A;  3DV9 A;  2RHF A;  3BS5 B;  5GTH U;  1SV0 C;  3IP4 B;  1L3T A;  1BPZ A;  4J03 A;  2NRT A;  3MR3 A;  1Q3U A;  5AM2 A;  2BHN A;  9ICN A;  3HJE A;  4QIW F;  2W11 A;  5AKL A;  3OPX A;  1L3S A;  1ZYQ A;  2F2A B;  4RQ6 A;  1LVH A;  1Z1B A;  2Z7J A;  2KZM A;  4DWI A;  2YTU A;  4G3I A;  1MN8 A;  1BPB A;  5ALM A;  4I27 A;  4I2C A;  4EYH B;  3UXP A;  1KFD A;  3LK9 A;  7ICO A;  2DKZ A;  3BJY A;  5TIS U;  5DQG A;  3EUB 2;  3BQT A;  2ZXH A;  9ICP A;  4GFJ A;  1ZQF A;  4DF8 A;  3QU5 A;  5KG7 A;  5J0U A;  1X40 A;  1WCL A;  4UW9 A;  4UAV A;  3CNH A;  3GIJ A;  1ZQY A;  4DF4 A;  3SMV A;  4XUS A;  4EEN A;  3PX6 A;  1NOM A;  3NVY A;  3M1Y A;  4IQT A;  3EZ5 A;  5AKK A;  2ZXI A;  1TK5 A;  2GH1 A;  3ETR A;  3MBY A;  1MQ2 A;  3B9J A;  1OW5 A;  5KNI A;  4J9P A;  3EPI A;  2P6U A;  4UB2 A;  1ZQL A;  4QNL A;  3OTQ A;  1WUD A;  2HCF A;  3QUC A;  4J9L A;  1L7N A;  4CGZ A;  4PH5 A;  5CR0 A;  4IRD A;  4DSF A;  4DQI A;  2ATL A;  5DG7 A;  2WB1 C;  3WKE A;  4F5O A;  3RBE A;  5KFM A;  4OJL A;  4ECS A;  1ZJM A;  1QQ5 A;  5KT7 A;  3RTV A;  2HBM A;  4F4Y A;  1LB2 B;  2HI0 A;  2HMX A;  2W03 A;  2W9M A;  4DL2 A;  5KFC A;  2EZY A;  5KFO A;  1M6Y A;  2FMQ A;  4DO9 A;  7ICR A;  4PZN A;  2OM6 A;  5AKH A;  1MSW D;  3H0R B;  2LKY A;  3HPO A;  3C29 A;  1U47 A;  3M8R A;  2HHV A;  1N63 A;  3RF9 A;  4TUR A;  3TAN A;  5EOZ A;  4NJ8 A;  4MEY A;  3PO5 A;  5KT6 A;  4F91 B;  1Q46 A;  4IS7 A;  1F44 A;  1ZQQ A;  2YN4 A;  2QB0 B;  3GIM A;  1XO0 A;  1S8O A;  5KG3 A;  4KLJ A;  3C1Y A;  7ICN A;  1JX4 A;  5AK5 A;  3AU6 A;  5J0W A;  3VC8 A;  3IHQ B;  1V38 A;  2CPR A;  4GXK A;  3KFU F;  1UT8 A;  2ZJ8 A;  4TQR A;  1H38 A;  1F5S A;  2AGQ A;  2FPM A;  2FJ6 A;  4NM2 A;  4CCH A;  9ICH A;  3SI8 A;  1RQN A;  2KMD A;  5DBB A;  1K1Q A;  2NO4 A;  3RAQ A;  4ECY A;  1RXW A;  3JPN A;  4ECW A;  1S97 A;  5KFS A;  4LZG A;  4ED8 A;  4KMO B;  3AN1 A;  4UB8 U;  3PY8 A;  2A1A A;  2JGA A;  5KFX A;  9ICX A;  2BCQ A;  4WJ3 B;  2W3S A;  2UVW A;  3C5G A;  2JV3 A;  3GFK B;  5ALW A;  5AKY A;  3T5H A;  4RNN A;  4QZ8 A;  3QXG A;  5G5H A;  3R9K A;  1SV4 A;  3RB3 A;  3V72 A;  7ICQ A;  4MEX A;  4O9M A;  4FBU A;  4KLD A;  2AHO B;  4TUQ A;  1HIW A;  5KFV A;  5AIB A;  2F8L A;  2DPJ A;  3NS1 A;  5A0L A;  9ICI A;  5ALT A;  3J81 j;  2CRX A;  4BJQ A;  4RPX A;  4M9H A;  4UAR A;  5AI4 A;  4ED7 A;  4PZO A;  3KKA A;  5D46 A;  3C28 A;  4DSJ A;  3OHB A;  5ALV A;  4KLG A;  4J9K A;  2R18 A;  5AKE A;  5JU5 A;  1BPE A;  3IG5 A;  1MQ3 A;  2YB4 A;  4KN7 A;  2KJ8 A;  2ZUB A;  4DSL A;  4KMU A;  2KIV A;  3G6Y A;  4RQ8 A;  2EZX A;  2ISO A;  5EWG A;  3RJE A;  4US8 A;  3GU3 A;  1MA7 A;  4US9 A;  2Q4T A;  2XCP A;  3AL0 B;  4FBT A;  4QZH A;  2FDR A;  3WKB A;  1L5U A;  2VA8 A;  3QZ8 A;  8ICX A;  2GWS A;  3QEA Z;  2KZZ A;  3TQ1 A;  4EBD A;  1DOQ A;  2YMM A;  5KT3 A;  3F5A A;  4EZ9 A;  1DGJ A;  4YG2 A;  3KKA C;  1BNP A;  3V6H A;  5J0R A;  3HKZ F;  4RNM A;  2OEH A;  1D8Y A;  4O5C A;  3TFR A;  5AI8 A;  2QLT A;  2YMQ A;  4QW9 A;  3RJI A;  3V7J A;  2BR0 A;  1NZP A;  4DFK A;  3AQE A;  3PO4 A;  5KG6 A;  5H2F U;  4M9N A;  4Q8E A;  3LWM A;  5J0S A;  4DL4 A;  3MR2 A;  4Y2Q A;  1BGX T;  4YXJ A;  2KTQ A;  1SL1 A;  3OJS A;  2LBO A;  3UXN A;  1A0P A;  1UT5 A;  4G9B A;  2P6R A;  4C7Y A;  5KG4 A;  4I2B A;  3RH4 A;  5C5J A;  8ICI A;  4F2R A;  4PGQ A;  4BWJ A;  2ZIU A;  2H3V A;  1ZQA A;  4JB3 A;  3OSP A;  5AK4 A;  8ICS A;  1DXS A;  5CJ7 A;  4YR0 A;  4ED3 A;  2NRX A;  1RXV A;  4EEK A;  4ECZ A;  2PI4 A;  4MF8 A;  5JUM A;  3HW8 A;  2PFQ A;  2BQU A;  3RRG A;  5BOL A;  3ONN A;  3Q8M A;  2UVV A;  4M9J A;  4KLU A;  2ZIU B;  2WB1 F;  4EZ6 A;  3RJJ A;  3LVW A;  4MFA A;  3QNM A;  3SD7 A;  2W54 A;  4NXZ A;  1U49 A;  4JK1 A;  2IOH A;  4BDP A;  1KL9 A;  3RAX A;  3I1Y A;  4Y2S A;  4I2G A;  5L9X A;  5L1K A;  5TZV A;  3M9M B;  1V97 A;  2XCA A;  3GDX A;  4DL5 A; 
#chains in the Genus database with same CATH homology
 2DQN B;  3F5A A;  4GFJ A;  2Y0S F;  4KMO B;  2MA1 A;  4P0Q B;  1ED1 A;  3SAH A;  1T94 A;  3N7R C;  2H3Q A;  2LYB A;  2ZIX B;  4C0Z A;  1ZQ1 C;  2JGA A;  1CRX A;  2ZIW A;  2YX8 A;  4BX9 C;  1SZH A;  2A3V A;  2GOL A;  2KOB A;  2F76 X;  4WJ3 B;  2K89 A;  2ZG6 A;  2XI9 A;  3HKZ F;  3SMV A;  4ICA A;  2K4H A;  3PZP A;  4O3M A;  4BUG A;  1TAM A;  2VJ5 A;  2KV2 A;  1IIP A;  2WAQ C;  4CRX A;  4PL2 A;  4A8E A;  2ZXI A;  2GH1 A;  1PVQ A;  1KBU A;  3D2S A;  3NRW A;  3AQE A;  5HR7 A;  1Z19 A;  4KX3 A;  2KVC A;  2G5H B;  3KZX A;  2E1E A;  3M6K A;  2OH2 A;  4QNL A;  1WUD A;  3O0F A;  1L6N A;  3F53 A;  2WAQ F;  2ZIX A;  2XVT A;  4NLC A;  4CGZ A;  2G0A A;  2KHQ A;  1Z1B A;  2KIW A;  1HIW A;  2CN1 A;  4ACO A;  4AYB F;  2KD1 A;  3PSI A;  2F8L A;  2W7O A;  2WB1 C;  1Q3V A;  2KEY A;  5A0L A;  2K8B B;  2W04 A;  4PL1 A;  2ZXH A;  3H0L B;  1URJ A;  2N1R A;  3D2N A;  4P0Q A;  5CRX A;  4OJL A;  2Y0S C;  5KL1 B;  2LBO A;  2CRX A;  2G09 A;  2XID A;  2HBM A;  2M0N A;  1A0P A;  2HBJ A;  3RFA A;  3ALR A;  3VCB A;  2HMX A;  4BJQ A;  4P0P A;  2JHD A;  2W03 A;  4FZN A;  3PST A;  3LVV A;  2VKQ A;  3ICX A;  1XNS A;  3F5E A;  2OXO A;  2RP5 A;  4FE3 A;  3IN5 A;  4JMU A;  2KJ5 A;  2OM6 A;  2E1F A;  2NV3 A;  2RHF A;  2H3V A;  2VJ4 A;  2ZIU A;  3M7D A;  3C28 A;  3H0R B;  5KL8 B;  1GO3 F;  2LKY A;  3IP4 B;  3C29 A;  2BDU A;  3CYM A;  4U6P A;  2G08 A;  2DGZ A;  2HOF A;  3CRX A;  4OO1 J;  2JH1 A;  4NV0 A;  1NZB A;  3D2Q A;  3RF9 A;  3NUQ A;  2G06 A;  2D6F C;  4FZM A;  3DEE A;  1Q3U A;  2R18 A;  2K4E A;  2KJ9 A;  3E0F A;  2PMZ F;  3PSF A;  4FZL A;  3IG5 A;  4KX5 A;  4NLB A;  4OJO A;  3SAG A;  4OJ6 A;  4CDG A;  2YB4 A;  5T14 A;  2KNJ A;  5HR6 A;  4IC9 A;  2KKP A;  1ECW A;  2KJ8 A;  4AYB C;  3SAF A;  4QIW F;  3SQI A;  3ONN A;  3OPX A;  3GZF A;  3LYS A;  2G07 A;  3L3F X;  1F44 A;  2HBK A;  3H0M B;  3MGV A;  2ZIV B;  2F2A B;  2DF4 B;  1A6S A;  2H3F A;  1XO0 A;  2G5I B;  3F2C A;  2H3Z A;  2OYY A;  2PMZ C;  3F2B A;  2K8C B;  2H3I A;  3N7P D;  2VIX A;  2ZIW B;  3T79 A;  3PSP A;  3AQF A;  3GU3 A;  2MRL A;  2ZIU B;  4U7C A;  1PVR A;  1MA7 A;  2JH7 A;  4QJF B;  3VC8 A;  4QIW C;  2Q4T A;  2WB1 F;  3AL0 B;  1P7D A;  4OJP A;  2HBL A;  2Z7J A;  3LVW A;  3CP8 A;  2W7P A;  3HKZ C;  2HOI A;  1YT3 A;  2KIC A;  3F2D A;  2E5S A;  2CPR A;  2KKV A;  4OJ5 A;  4P0P B;  3KFU F;  3K1Z A;  2K8A A;  2JMG A;  1OUQ A;  2LHT A;  2K4I A;  1DRG A;  2XIC A;  3M6Z A;  2F77 X;  2KHV A;  4NWI A;  2YB1 A;  1D8B A;  2ZIV A;  5C0Y A;  1UPH A;  2RRD A;  2HOQ A;  3IG8 A;  3N7S C;  1HEK A;  1PVP A;  2LYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...