2DGZA

Solution structure of the helicase and rnase d c-terminal domain in werner syndrome atp-dependent helicase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
GSSGSSGSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLWEVIKHFCQTNSVQTDLFSSTKPQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Werner syndrome protein variant
publication title Solution structure of the Helicase and RNase D C-terminal domain in Werner syndrome ATP-dependent helicase
rcsb
source organism Homo sapiens
total genus 24
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2dgzA01
3SAGA 3SAHA 1GO3F 2HBLA 2HBKA 2HBJA 2E1FA 4NLBA 2KV2A 4QJFB 2MA1A 4O3MA 4CGZA 3CYMA 2RHFA 3SAFA 4OO1J 2HBMA 4NLCA 4CDGA 1D8BA 2RRDA 1YT3A 4QIWF 2DGZA 2E1EA 5C0YA 1WUDA 2CPRA
chains in the Genus database with same CATH superfamily
1UQVA 8ICZA 2LYBA 3S6JA 3E2EA 9ICUA 2J6UA 2KP7A 2WB1C 2RHFA 2BQRA 1CRXA 5IINA 1KKXA 2KZZA 1DOQA 1V38A 3KZIU 4J9RA 3ISBA 2DGZA 4PGYA 2I9GA 3QE9Y 4PZOA 4OJ5A 4J9LA 2V4RA 4OCZA 2J6SA 1ZETA 1IV8A 4DFJA 4KLJA 3TFSA 2RDJA 4F2RA 1KN5A 1ZOLA 5AM4A 2W7OA 4QNLA 4ECTA 3PR5B 2K4IA 4MHVA 3MR2A 3UQ2A 2YN4A 4O3RA 1PVPA 1XO1A 3MFIA 3PY8A 3AU6A 2G08A 3UPQA 1UPHA 3K1RB 3RJIA 1BPXA 2FI1A 3SAHA 4NM2A 4C4RA 2ZJ8A 3AQEA 1BGXT 4DLEA 2XO7A 4DO9A 2GWSA 3RB6A 4UBBA 5CA7A 4F5QA 3BS5A 3BDPA 4YMMA 3CW2C 3MABA 4FZMA 5ALVA 1SV4A 1QSYA 1DRGA 1U49A 5DKWA 2HCFA 2LYHA 2C2DA 5J8YA 4M9NA 1SGGA 2KKPA 2IHMA 2W7PA 1ZRNA 3KD3A 2HBMA 2MUTA 1L3SA 3ISCA 3GIIA 4AYBF 5KT2A 1RQLA 1SL1A 1V9PA 3UXOA 2KJ5A 5CB1A 3M6KA 3NRWA 3LYSA 2HVIA 4RZRA 1PUZA 1ZD5A 2DPJA 4CRXA 8ICNA 4Q45A 2E1FA 4O3PA 2P6UA 2AHOB 4UATA 2NRXA 1KBUA 3M1YA 2A19A 1ECWA 5CRXA 3ZD8A 4GXKA 4P0QB 1Z00B 3RB4A 1KEJA 4DFDA 1XS9D 3C2KA 5J2JA 2IOHA 3L4PA 1IM4A 4IRCA 5ALTA 3GIJA 4GXJA 2G07A 5KFZA 4ELVA 4NLGA 1XU4A 8ICJA 3ORYA 4C7ZA 1EXNA 1HEKA 4G3IA 2KVSA 4LJXA 3RRGA 3KBBA 2KHQA 1NOMA 3NVVA 1QQ5A 8ICXA 2WTFA 8ICKA 4TURA 2ISOA 4DL2A 3V72A 7ICRA 2ZJ5A 8ICVA 4OJLA 1HUOA 4UB3A 2A1AA 1ZQWA 4O0IA 2K4PA 2ALZA 1QLNA 4QIWF 4C0ZA 2KICA 4M6WA 4A8EA 5C0YA 3JPTA 3UM9A 2QB0A 3HWTA 1U47A 4BDPA 4E0DA 2DF4B 2O6KA 2JZBB 5TISU 5JUMA 3NVZA 4QZBA 2ZIWB 5KFJA 2KTQA 2V4QA 4PL1A 1SXEA 3KKAA 4MF2A 4JWNA 2KFNA 3RTVA 2PFNA 4IRDA 4PPXA 5ALYA 3IM1A 3JPPA 4RT3A 4KLDA 2KNJA 1N63A 4AYBC 1N61A 2KIVA 3NGDA 3M9MB 1X6JA 3F2CA 1ED1A 4M04A 3V6HA 4GXIA 2G5HB 2W54A 4KLEA 4ED0A 4EELA 3VCBA 3SZ2A 4EZ9A 9ICTA 3TQ1A 4F93B 2WHEA 3OTQA 2E8NA 1J97A 5DGAA 1O08A 2XCAA 3BQ2A 4I2IA 2HVHA 1A76A 1HJPA 2KZ3A 3ICXA 4J9PA 5CR0A 1ZQAA 1JX4A 3WK6A 3JPOA 2ESEA 5KFCA 4PJ0U 4UAVA 2KN7A 5T14A 5KFGA 2BCQA 1X9WA 4M9HA 4OJPA 5EWGA 2ATLA 5AKGA 1Q3VA 4NLKA 3C21A 3OJSA 4UB1A 3QYPA 2NO4A 2E5SA 2NYVA 9ICPA 1SV0C 1JUDA 4C4SA 3GV7B 5J0TA 5J0WA 1T3QA 4I2FA 5AK4A 2LYAA 3NS1A 8ICOA 2YMMA 4F4YA 1JXLA 5KG1A 2GLEA 2BGWA 7ICOA 4U7CA 3KTQA 2PFOA 4UAYA 4I28A 3M9OB 1ZQMA 5AKEA 5HR6A 5ALQA 4QIWC 4RQ7A 2JEJA 5KG0A 4DOCA 5AM3A 3M8RA 2JEFA 2WF7A 1KFSA 2AGQA 3RJKA 3HX0A 7ICLA 2DWQA 9ICIA 4JUZA 2KZMA 4YR0A 9ICHA 4DQPA 1FEZA 3H8SA 1TVAA 4QZAA 2BDPA 2K89A 7ICUA 2KG5A 3H8JA 4QWAA 4KLLA 4PHPA 5J0RA 5DQHA 2HOFA 2ODGA 1JRPA 4LZGA 2VKQA 5G5HA 4O3OA 2AQ4A 1CEZA 4GC6A 2K8BB 3C5FA 1L7NA 2HOIA 4Y2TA 3LVWA 2L5YA 2LBOA 2OXOA 2D8CA 3Q8PB 4NL9A 2PI4A 4EEKA 5ALHA 5KFFA 4M9LA 3BQTA 2ZIUB 5DQIA 4J9OA 3UMGA 3RJFA 2ZIVA 3TADC 4ELTA 2E8MA 2FE9A 4YQWA 4KTQA 2FJ6A 3O0FA 3ISDA 2W3SA 3QUQA 5DDYA 5ALRA 4YMNA 9ICVA 4NXZA 1RYUA 4J9QA 3F53A 2R8GA 3MGHA 1BPEA 2RRDA 4IQWA 4GC7A 8ICQA 1S0OA 1X40A 3AEVA 3GV8B 5AKZA 4TUPA 4IQVA 3LWLA 2ZIXB 9ICEA 3H0LB 4JWMA 5EE0A 4ICAA 1HIWA 4BUGA 1M6YA 1YT3A 4MEYA 3SMVA 4Z6DA 2YB1A 2ZG6A 2P35A 3HW8A 5KFXA 4F5PA 4UB2A 3F5AA 3PW2A 2UVUA 3RJEA 2K8AA 1BPBA 4Q8EA 1ZQBA 4GLXA 2KV2A 3PR4A 4Y2UA 1NKEA 1B22A 2W3RA 4NLCA 1JI7A 1WCLA 4KLTA 2F3NA 4NLNA 1KW4A 3I76A 4PGQA 2DPIA 5KFMA 3KOOA 2R8HA 2Y0SF 1FIQA 3L3FX 1JN3A 2ISPA 8ICHA 3BZKA 4ZOHC 2P6RA 2IA6A 3V6KA 1NZBA 4ECQA 2JGAA 7ICMA 5J8YC 7ICNA 2JRZA 3RH5A 4ECYA 3UXPA 3RH4A 3AUOA 3V7JA 2AGOA 4Y2YA 1WUDA 3KFUF 1NKBA 1IG6A 3JPNA 1A6SA 3QU9A 5J2GA 3QX7A 4ZH4A 5J2HA 2ZXHA 5ALLA 2VJ4A 4EEYA 3VC8A 1KFTA 1IIPA 2Y1JA 3PSPA 3E0FA 1FO4A 1ZQEA 4Z6FA 4CF4A 3RAQA 2JH7A 1QCKA 2Q0ZX 3BS7A 4RPYA 1COKA 7ICIA 3TAPA 1SKWA 2HHWA 2PI5A 1JROA 2ZJAA 4CNQA 2KMDA 4DF4A 5DQGA 5J0SA 5J2KA 3H8MA 1ZQUA 4UARA 3Q8KA 5ALMA 3QUCA 3M7DA 5DGBA 3KHRA 5KNIA 4ED8A 3QUTA 1C7YA 4IQTA 4DSKA 1L5UA 2DQNB 2BKEA 2CN1A 1GO3F 2FPMA 2K4EA 2BPGA 1RXVA 3HPOA 2YMPA 1BPZA 2IBKA 2M9NA 1N60A 4YN4A 2FLPA 1SZPA 2JMGA 4O3NA 4DF8A 2F76X 4DL5A 1Z1BA 3GZFA 2XY5A 2UVVA 3KHLA 4F4ZA 4P0PB 2HHUA 2ZIUA 4DSFA 4P4OA 1D8LA 3F2DA 4UB8U 1Z4OA 4M0AA 2CRXA 2DFLA 1RQNA 1ZQIA 3GFKB 2Y0SC 5DBAA 2BZFA 2NO5A 2EAPA 4C8KA 4I2AA 1RYRA 2JXJA 1X9MA 1T7PA 4F4XA 3KZXA 3KKAC 4NV0A 3SD7A 2BCSA 4JMUA 3SAGA 4EBEA 3MR6A 5KFAA 3R9KA 1TAMA 1JXEA 3RJHA 5AK5A 5IIJA 1ZQCA 4UAZA 2R8IA 4I29A 2G0AA 4RQ2A 8ICRA 2BDUA 4JV2A 5AKLA 1NZPA 3PW4A 2EZZA 4JK1A 1Q3UA 2LMRA 4KMUA 3PW7A 1LKYA 2G09A 3GU3A 4Y2QA 2FMPA 2UVWA 1XWLA 4EYIB 3N28A 2JEGA 3PO4A 4RQ6A 9ICCA 1JALA 4ECSA 3GILA 2IMWP 2EQYA 1TFRA 5AK6A 8ICGA 5CHGA 1N5WA 3FC4A 3PW0A 1UCVA 5L1JA 2N1RA 5AI4A 3EYZA 3BQ1A 4F91B 4C8LA 4YXJA 8ICCA 2FPKA 7ICEA 3HKZF 2C28A 1N2XA 4YG2A 3MR5A 2BQ3A 4M9GA 2JHDA 3RBEA 1L3VA 5AIBA 2YMLA 1SWVA 2KSOB 4UASA 9ICXA 4NLZA 5F3XB 3TFRA 4KLUA 1Q46A 3UMBA 1PK1A 4F3OA 1KLNA 1ZD4A 1DXSA 7ICVA 9ICOA 3FM9A 3GV5B 2KHVA 4DOBA 5HP4A 4LZDA 9ICRA 1WG8A 9ICGA 1XNSA 4F71A 5DB7A 3RB3A 5KG4A 4UBCA 1U9LA 5KT4A 1A0PA 4ELUA 5KFKA 4RNNA 4Q43A 1LVHA 5KFQA 1KDHA 4Y2SA 3MGIA 2D3DA 4CDGA 2WF9A 2PFQA 2B0CA 2FMQA 4DSJA 3PSFA 5A0LA 3ED5A 3GDXA 3JPQA 4MF8A 2PKEA 4O3SA 5AHXA 3B0YA 2UVRA 2W9CB 4QWDA 3NVYA 3WKEA 4F92B 5J2FA 5KG5A 4FE3A 4O9MA 1F0MA 1SIJA 3DDHA 2KKVA 2H3FA 3N7PD 1J2MA 1NK8A 3LK9A 2DL0A 2K4HA 4NL9C 5IIIA 4KLMA 2DKZA 4O3QA 3AMZA 4UB5A 3C29A 4ECRA 5J2CA 3RBDA 3T5LA 1RDFA 4BXOB 4P0PA 1U48A 3B0XA 3C28A 3IP4B 5KTQA 3QXGA 3HKZC 4BX9C 3EZ5A 4XA5A 5GTHU 2EAOA 2RP5A 1L7MA 3FDSA 5DB6A 1QQ7A 1SZHA 3EW9A 3ZD9A 1PZNA 3ZDEA 4C8MA 1N5XA 5HHHA 4FS1A 2FLLA 1QSLA 4DLGA 3KHGA 5KFRA 4P4PA 4Y2JA 2LKYA 9ICAA 4TUQA 2OEHA 2HBKA 2ASLA 3AQFA 2F1IA 1BPYA 2Y1IA 5J2DA 3UQ0A 3HRDD 5F9LA 3RR8A 2XI9A 5K4LA 3ZI4A 5AKXA 4F4KA 5ALEA 3N7RC 3RB0A 3HILA 5KFNA 1ZQHA 4IR9A 4B9NA 2AJQA 5J0UA 4QZIA 1ZQTA 2E3TA 2A1JB 3EPIA 1A77A 2W11A 2W8LA 2KIWA 5AIAA 5KFUA 1ZQKA 3LDAA 5DG9A 4IRKA 3TKAA 1TK5A 3WKBA 5ALFA 2YX8A 1L7OA 1D8YA 3ETLA 2RQ5A 2ZXIA 1X9SA 1S0NA 1L7PA 2H3ZA 1UT8A 1PK3A 2BR0A 5L1LA 5IIMA 4QZ8A 3WU2U 5DLGA 4B9SA 1S97A 2YB4A 1COOA 4RU9A 1RG6A 3MGVA 3M6ZA 3AM9A 2GOLA 1MSWD 3ZDCA 1XO0A 4F5NA 1NK7A 4J9SA 4F5RA 5J2BA 4FS2A 3PMNA 1K5OA 5J0OA 3AU2A 2R8JA 4F8RA 3F5EA 2KEYA 1NNLA 5KFSA 2DBYA 4RNMA 5G5GA 4KLGA 1VLBA 4DL3A 4I27A 5KT6A 4I2HA 4X5VA 3H8WA 4EYHB 4I2JA 4P0QA 4F50A 1X9XA 1Z00A 4CF3A 2AQ0A 3PZPA 2W9BB 4NLBA 3SENA 5J2AA 1L3TA 8ICWA 1N56A 9ICNA 5H2FU 1SB3C 3Q8QB 2DKXA 4OD0A 4TQSA 8ICEA 2BPCA 1TKDA 3RFAA 1ZXIA 4ECUA 3PX6A 1UA0A 3FYHA 2C22A 2NV3A 1RPLA 3QEAZ 2MU2A 3IDWA 2I6XA 4Q8FA 4RQ3A 3C2LA 1SL0A 5AKYA 3K1ZA 1ZRMA 5ALGA 4LVSA 4YVZA 4NJ8A 3H4BA 5ALNA 2PFPA 2XGPA 2ZUDA 3TACB 4FBUA 5AI5A 2PMZF 2OH2A 1NJXA 1ZQ1C 4KX5A 5KFHA 1X42A 2FMSA 4KLQA 8ICYA 5DLFA 1UHUA 5DG7A 3TARA 4BXOA 7ICGA 4KX3A 1NK4A 2JZBA 4JB3A 4HAIA 2ZIWA 3DEEA 1T3NA 3B9JA 5J29A 9ICMA 4C7YA 1B4FA 1XSNA 3RAXA 7ICFA 5C5JA 2NRZA 1H38A 2IOFA 1F5SA 1ZQNA 5KFLA 1ZQYA 5BOMA 3OJUA 3RR7A 4DQRA 2XC9A 4UQGA 2BCRA 3E58A 2W43A 1ZQGA 2HMXA 5KG2A 5JTIA 1NJWA 1NKCA 5TZVA 4QWCA 2LPEA 2YQEA 9ICKA 4DSIA 4K4HA 1L3UA 5AI8A 2MA1A 4PGXA 3PO5A 4Y2XA 1S0MA 5CEHA 1IXRA 3LWMA 3HJEA 3PX0A 3QZ8A 4EZ6A 4Q44A 2GO7A 2HI0A 4Y2RA 3SQIA 2OWOA 9ICSA 5J0PA 4QZEA 2FLNA 2NRWA 3BS5B 4RQ5A 5BOLA 3H7IA 1LB2B 5KFEA 4F72A 3I28A 3U26A 3KHHA 2ZTDA 3ZDBA 2BCUA 3WK7A 4WJ3B 4DOAA 5ALXA 1MQ3A 1TE2A 4O5KA 2HHSA 4EX6A 4CF5A 1S10A 2F1JA 4ECWA 1FFUA 3WKCA 1KSPA 1FFVA 2JV3A 2K60A 4U6PA 3PVXA 4RPXA 7ICQA 2WAQF 3SAFA 2PMZC 4RUAA 3F2BA 4J9NA 3T5KA 2EZXA 2YY6A 5AM0A 1RZTA 5HNKA 4ECXA 4ED6A 3NASA 4DL4A 2VA3A 3UXNA 4KLSA 4DS5A 3Q8RB 2KK0A 5ALKA 1MC8A 4B9MA 2B21A 1X66A 3MDAA 3MDCA 2RLTA 5HHIA 2W9BA 5E79U 3D2QA 3HT3A 3C5GA 3OGUA 1WCNA 4RQNA 4C4TA 4KITB 3OHAA 1SL2A 4I2GA 3Q8SB 3M8SA 4DL6A 2HBLA 4DFMA 2R8KA 1NK9A 2ES6A 1HUZA 5F9NA 3RJGA 2W9AA 1ZQDA 2AH5A 2KE7A 5AI6A 4I2EA 5AK3A 1NJZA 3PSIA 4FZNA 2YMQA 4DSLA 7ICPA 3SYZA 3GQCA 4KN7A 4I2BA 2MAXA 4BGDA 1RXWA 5KFPA 3EUB2 2XIDA 4QWEA 2DUYA 1WYGA 1T94A 4M6WB 4GFJA 4IR1A 4M47A 4TUSA 3ONNA 2QB0B 3QEBZ 1NK5A 1KFDA 1UT5A 1B43A 5J2EA 5KFTA 2FDRA 2HSZA 4BWJA 2RDIA 4QWBA 1MA7A 2G06A 3BQ7A 3IRUA 1U4BA 3CP8A 3D6JA 3ZDDA 5HMLA 3WK9A 1KQQA 8ICAA 3SI8A 4UB6U 2ZIXA 3H4DA 2E8PA 2AU0A 1BNOA 3N7SC 3WK5A 5KFDA 2WAQC 2NRVA 3PV8A 5KFIA 4YFKA 4NM1A 2WF8A 3BZCA 1JIHA 4C80A 3Q8LA 5J0QA 2Y9TA 5KG3A 5B66U 4RQ8A 1UA1A 4RQ4A 1F44A 1TK0A 2EZYA 7ICHA 5DB9A 2XY7A 3D2NA 1JMSA 1PVQA 3V6JA 2W8KA 1N62A 2QB1A 2C2RA 4RQ0A 3NRZA 2QARB 4DQSA 3SV4A 2I1QA 2H5XA 3IV6A 9ICBA 4IS7A 2E1EA 4YXMA 7ICSA 1U45A 5D46A 1URJA 4ED2A 1SKSA 1RYSA 2HOQA 3DV9A 4QZHA 2OM6A 2W55A 5AM1A 2I5HA 3MR3A 4PHAA 4HYKA 5HMMA 5HR7A 3RF9A 3WK4A 1ZQSA 1ZQRA 2VIXA 3ALRA 1ZD3A 5BPCA 4ACOA 1ZD2P 4I2CA 5ALDA 8ICUA 3OSNA 3Q8MA 2AGPA 5KFYA 2H3QA 5KT7A 4YMOA 4K4IA 5DG8A 7ICKA 1NJYA 1T8EA 4C8OA 1Q8KA 9ICQA 2HHXA 1TK8A 1ZJNA 2QKQA 5JU5A 4PHDA 2KD1A 2VANA 2JH1A 2HW3A 5KL1B 4Z6EA 4DL7A 2ZUCA 4O5CA 2KFZA 9ICJA 4Y2PA 1AROP 2IHNA 1WWVA 4QZGA 1OXJA 7ICJA 3HP6A 1DK3A 5D4BA 1NK0A 1L8LA 4CE6A 2P66A 1ZQOA 5IILA 4ECVA 2LM4A 4B6JA 1BPDA 4P4MA 4R63A 4QZ9A 4TQRA 4F4WA 5B5EU 4M2YA 2BQUA 2Q4TA 4QJFB 4PZNA 3CYMA 4EX7A 2ZTCA 3J81j 4MFFA 1ZQLA 1Z3EB 3G6YA 1T4GA 3A0HU 4GIBA 2ZIVB 3QUBA 4RQMA 3UMCA 5ALOA 1SWWA 4F5OA 3C1ZA 3PMLA 4FO6A 5AKKA 1D9DA 3C2MA 4OJ6A 3LVVA 5AKJA 5KT5A 1X6IA 3C1YA 1QH9A 2KJ8A 1X2IA 1KRPA 3WK8A 3PW5A 4FZLA 1ZQXA 2HBJA 1L6NA 5CJ7A 3NTUA 2H3IA 1ZQZA 4CGZA 8ICFA 4O5EA 2D6FC 8ICPA 4KLFA 5GTIU 5KFOA 1K1QA 1VJ5A 3CNHA 1S5LU 3TI0A 1SKRA 4J9KA 3RJJA 3IHQB 4MEXA 1KTQA 5L1KA 3GIMA 1D9FA 3M9NB 2IOFK 2M0NA 2BCVA 4JV1A 2CXYA 3H0RB 4ED3A 4DCCA 2HHVA 4ED1A 3JPSA 5ALWA 4QW8A 4B9VA 4XUSA 4FBTA 2KOBA 4RT2A 2QARA 3EWAA 4QZFA 4J9MA 4EBCA 2ZTEA 2KSOA 5DBBA 1ZQVA 2OYYA 3NVWA 4Y2VA 3WKAA 1L8OA 4B9UA 4G9BA 5DBCA 3QU7A 4F2SA 5JRTA 1S77D 4MFCA 1B0XA 2KJ9A 2C2EA 4KLHA 5EWEA 4KLOA 1Y88A 3ETRA 4YD2A 5ALZA 2XICA 2W9MA 4YD1A 1VDVA 4FFDA 4R66A 4R8UB 4QZCA 4UB4A 3H0MB 5KG6A 1NI3A 5ALIA 5FP0A 2Y9UA 2F8LA 3OSPA 1CI4A 3CRXA 4YR2A 1Z1VA 4RPZA 2OCEA 1TV9A 1Z19A 2EDUA 2B6GA 2F44A 5AKIA 1ZJMA 2LHTA 3A0BU 5KG7A 1BNPA 2VA2A 4IQUA 4I2DA 4C8NA 3ZDAA 5EE1A 2W9CA 2WFAA 4YR3A 4UW9A 1O03A 4RUCA 4RNOA 5AICA 1DGSA 2Z7JA 4US9A 2ASJA 3MFHA 1ZYQA 2A3VA 5IIKA 3T5JA 2R18A 4J03A 4AP9A 4IC9A 4CCHA 3GIKA 3L5KA 3G6XA 3IN5A 5L9XA 5EE3A 3PSTA 4EENA 3OPXA 4Z6CA 5AM2A 3V7LA 5KAIU 4QW9A 3SV3A 2QLTA 1ZQJA 1K1SA 1ZQQA 2NRTA 2ASDA 3K75D 4DEZA 3QZ7A 2JEIA 3QU4A 2CPRA 5D49A 4PHEA 1KL9A 2OHFA 5CP2A 5L1MA 3BJYA 1S9FA 1ZQPA 1S0VA 3JPRA 3BQ0A 3PX4A 1NK6A 9ICWA 4O3MA 1SXDA 8ICTA 2XGQA 2K8CB 4JV0A 4DFKA 4NY8A 2PXIA 4KMOB 2MSNA 1OUQA 3NUQA 2YTUA 5ALSA 4EBDA 5ALUA 5L1IA 2HHTA 3TAQA 4BWMA 4DQIA 2H3VA 4OJOA 2WF5A 5ALPA 1PVRA 2A1JA 2HHQA 2EH9A 2ZUBA 5AM5A 1LKYB 3IG5A 1XC9A 2WF6A 4RQ1A 1ZQFA 2VJ5A 5J0YA 3SR6A 4YCXA 2G5IB 2F2AB 1MN8A 3I1YA 4R64A 4PL2A 4MFAA 5AI0A 1AQ6A 1XSPA 1TAQA 5EOZA 5IIOA 3MC1A 4BJQA 3T79A 2F8KA 3N97B 3RRHA 2FPLA 4B9TA 2WB1F 3D2SA 3QU2A 3AN1A 1V85A 3T5HA 4XQ8A 4US8A 8ICBA 3EPGA 1SV0A 2MUTB 2VA8A 5J2IA 1Z4NA 1YZ6A 4DFPA 1RM6C 5KFVA 1N48A 1D8BA 7ICTA 4M9JA 1C20A 1S8OA 1XSLA 1QSSA 5J0XA 8ICIA 1OW5A 3QNMA 5DDMA 1CUKA 2KVCA 3H40A 2V9WA 1PK1B 4ED7A 4DS4A 3C23A 3TANA 1DK2A 4ECZA 3K4GA 3T3FA 5EWFA 2W04A 1WWUA 2XCPA 1J2NA 4UAUA 1QQ6A 5AI9A 4R8UA 5CWRA 3PNCA 5AKHA 2E8OA 2F1HA 2HDOA 1S76D 4UAWA 2BPFA 2EANA 5ALJA 2EAMA 4P2HA 5KFBA 4KN4A 5DB8A 2XVTA 1BVSA 1LV5A 2LM1A 9ICLA 1V97A 2LI6A 1P7DA 1YZ7A 4R65A 4IL6U 4YP3A 5KFWA 4B9LA 3G6VA 3THVA 4K4GA 4KLIA 3OHBA 3IG8A 3RH6A 8ICLA 1MQ2A 1TAUA 3MBYA 3SEIA 4QZDA 4DWIA 1DGJA 3V7KA 2AXTU 2XY6A 1QTMA 5KT3A 3AL0B 3QU5A 4PH5A 2BHNA 4OO1J 2GH1A 8ICMA 4DQQA 2J6TA 3FAHA 5KL8B 2W03A 2JR5A 4USAA 4NWIA 3WKDA 4XRHA 5EE9A 4DSEA 8ICSA 9ICFA 3TADA 2F77X 2MRLA 3N4MB 5KAFU
chains in the Genus database with same CATH topology
3IN5A 2CN1A 3PSTA 2JH1A 1GO3F 2K8AA 2LYBA 2KNJA 3OPXA 2K4EA 5KL1B 4CRXA 4AYBC 2E1FA 2M0NA 2KV2A 3F2CA 4P0PA 1ED1A 2K89A 3C28A 3IP4B 1KBUA 2WB1C 2JMGA 2RHFA 3H0RB 3F5EA 2G5HB 2KEYA 2JHDA 4NLCA 1D8BA 3F5AA 1ECWA 3HKZC 4BX9C 1CRXA 5CRXA 3D2QA 2RP5A 2KOBA 4P0QB 2HOFA 1SZHA 2KVCA 3VCBA 2F76X 2DGZA 2HMXA 2VKQA 1Z1BA 1F44A 3GZFA 4OJ5A 2CPRA 2K8BB 2W04A 4P0QA 4P0PB 2OYYA 2Y0SF 3D2NA 2LKYA 2ZIUA 3L3FX 2HBLA 2HBKA 3PZPA 2HOIA 1PVQA 3AQFA 4NLBA 2Q4TA 3F2DA 4QJFB 2MA1A 3ICXA 4O3MA 2KHVA 3LVWA 1NZBA 2LBOA 3CYMA 4QNLA 2OXOA 2G07A 2W7OA 2JGAA 2CRXA 2K4IA 2XI9A 2K8CB 1PVPA 4KMOB 2KJ9A 2Y0SC 5T14A 1HEKA 1OUQA 1XNSA 3PSIA 3NUQA 4FZNA 2G08A 2ZIVB 3N7RC 4OJPA 1UPHA 2KHQA 2ZIUB 2E1EA 3RFAA 1Q3VA 1WUDA 2XICA 3KFUF 3KZXA 2XVTA 4NV0A 1URJA 1A6SA 4JMUA 3SAGA 3SAHA 2ZIVA 1A0PA 3AQEA 3SQIA 2HOQA 1P7DA 2E5SA 2ZXHA 3H0MB 2VJ4A 3O0FA 2NV3A 2OM6A 2H3VA 1TAMA 4OJLA 2XIDA 3VC8A 1IIPA 2KIWA 4OJOA 2F8LA 4OJ6A 4CDGA 1PVRA 3PSPA 3CRXA 3K1ZA 3E0FA 1T94A 3F53A 4GFJA 2G0AA 3PSFA 1Z19A 2RRDA 3LVVA 5A0LA 2JH7A 2BDUA 3IG5A 4QIWF 3ONNA 4C0ZA 4FZMA 4WJ3B 3IG8A 5HR7A 2KICA 2VJ5A 2YX8A 2PMZF 3RF9A 2LHTA 1Q3UA 4A8EA 2ZXIA 2OH2A 5C0YA 2LYAA 2G5IB 2F2AB 2KJ8A 1DRGA 2G09A 2VIXA 3GU3A 4PL2A 3ALRA 1ZQ1C 4KX5A 2H3ZA 4FE3A 4FZLA 4U7CA 1MA7A 2G06A 2HBJA 4U6PA 2DF4B 1L6NA 2ZIXB 2KKPA 4ACOA 3CP8A 4QIWC 2H3IA 3AL0B 5HR6A 2W7PA 4CGZA 2KKVA 2WAQF 3H0LB 2PMZC 3SAFA 2GH1A 2HBMA 4BJQA 2D6FC 4OO1J 2H3FA 3M7DA 2H3QA 2ZIWB 4ICAA 5KL8B 4KX3A 2W03A 2ZIXA 3N7PD 2YB4A 1HIWA 4NWIA 2N1RA 4AYBF 4BUGA 3F2BA 3T79A 4PL1A 2Z7JA 1YT3A 2KJ5A 3SMVA 2K4HA 2YB1A 2A3VA 2ZG6A 2WB1F 2ZIWA 3DEEA 3LYSA 3M6KA 2F77X 3N7SC 3NRWA 2R18A 2MRLA 3M6ZA 3MGVA 3D2SA 3HKZF 2GOLA 4IC9A 3C29A 2DQNB 2WAQC 1XO0A 2KD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAG A;  3SAH A;  1GO3 F;  2HBL A;  2HBK A;  2HBJ A;  2E1F A;  4NLB A;  2KV2 A;  4QJF B;  2MA1 A;  4O3M A;  4CGZ A;  3CYM A;  2RHF A;  3SAF A;  4OO1 J;  2HBM A;  4NLC A;  4CDG A;  1D8B A;  2RRD A;  1YT3 A;  4QIW F;  2DGZ A;  2E1E A;  5C0Y A;  1WUD A;  2CPR A; 
#chains in the Genus database with same CATH topology
 1UQV A;  8ICZ A;  2LYB A;  3S6J A;  3E2E A;  9ICU A;  2J6U A;  2KP7 A;  2WB1 C;  2RHF A;  2BQR A;  1CRX A;  5IIN A;  1KKX A;  2KZZ A;  1DOQ A;  1V38 A;  3KZI U;  4J9R A;  3ISB A;  2DGZ A;  4PGY A;  2I9G A;  3QE9 Y;  4PZO A;  4OJ5 A;  4J9L A;  2V4R A;  4OCZ A;  2J6S A;  1ZET A;  1IV8 A;  4DFJ A;  4KLJ A;  3TFS A;  2RDJ A;  4F2R A;  1KN5 A;  1ZOL A;  5AM4 A;  2W7O A;  4QNL A;  4ECT A;  3PR5 B;  2K4I A;  4MHV A;  3MR2 A;  3UQ2 A;  2YN4 A;  4O3R A;  1PVP A;  1XO1 A;  3MFI A;  3PY8 A;  3AU6 A;  2G08 A;  3UPQ A;  1UPH A;  3K1R B;  3RJI A;  1BPX A;  2FI1 A;  3SAH A;  4NM2 A;  4C4R A;  2ZJ8 A;  3AQE A;  1BGX T;  4DLE A;  2XO7 A;  4DO9 A;  2GWS A;  3RB6 A;  4UBB A;  5CA7 A;  4F5Q A;  3BS5 A;  3BDP A;  4YMM A;  3CW2 C;  3MAB A;  4FZM A;  5ALV A;  1SV4 A;  1QSY A;  1DRG A;  1U49 A;  5DKW A;  2HCF A;  2LYH A;  2C2D A;  5J8Y A;  4M9N A;  1SGG A;  2KKP A;  2IHM A;  2W7P A;  1ZRN A;  3KD3 A;  2HBM A;  2MUT A;  1L3S A;  3ISC A;  3GII A;  4AYB F;  5KT2 A;  1RQL A;  1SL1 A;  1V9P A;  3UXO A;  2KJ5 A;  5CB1 A;  3M6K A;  3NRW A;  3LYS A;  2HVI A;  4RZR A;  1PUZ A;  1ZD5 A;  2DPJ A;  4CRX A;  8ICN A;  4Q45 A;  2E1F A;  4O3P A;  2P6U A;  2AHO B;  4UAT A;  2NRX A;  1KBU A;  3M1Y A;  2A19 A;  1ECW A;  5CRX A;  3ZD8 A;  4GXK A;  4P0Q B;  1Z00 B;  3RB4 A;  1KEJ A;  4DFD A;  1XS9 D;  3C2K A;  5J2J A;  2IOH A;  3L4P A;  1IM4 A;  4IRC A;  5ALT A;  3GIJ A;  4GXJ A;  2G07 A;  5KFZ A;  4ELV A;  4NLG A;  1XU4 A;  8ICJ A;  3ORY A;  4C7Z A;  1EXN A;  1HEK A;  4G3I A;  2KVS A;  4LJX A;  3RRG A;  3KBB A;  2KHQ A;  1NOM A;  3NVV A;  1QQ5 A;  8ICX A;  2WTF A;  8ICK A;  4TUR A;  2ISO A;  4DL2 A;  3V72 A;  7ICR A;  2ZJ5 A;  8ICV A;  4OJL A;  1HUO A;  4UB3 A;  2A1A A;  1ZQW A;  4O0I A;  2K4P A;  2ALZ A;  1QLN A;  4QIW F;  4C0Z A;  2KIC A;  4M6W A;  4A8E A;  5C0Y A;  3JPT A;  3UM9 A;  2QB0 A;  3HWT A;  1U47 A;  4BDP A;  4E0D A;  2DF4 B;  2O6K A;  2JZB B;  5TIS U;  5JUM A;  3NVZ A;  4QZB A;  2ZIW B;  5KFJ A;  2KTQ A;  2V4Q A;  4PL1 A;  1SXE A;  3KKA A;  4MF2 A;  4JWN A;  2KFN A;  3RTV A;  2PFN A;  4IRD A;  4PPX A;  5ALY A;  3IM1 A;  3JPP A;  4RT3 A;  4KLD A;  2KNJ A;  1N63 A;  4AYB C;  1N61 A;  2KIV A;  3NGD A;  3M9M B;  1X6J A;  3F2C A;  1ED1 A;  4M04 A;  3V6H A;  4GXI A;  2G5H B;  2W54 A;  4KLE A;  4ED0 A;  4EEL A;  3VCB A;  3SZ2 A;  4EZ9 A;  9ICT A;  3TQ1 A;  4F93 B;  2WHE A;  3OTQ A;  2E8N A;  1J97 A;  5DGA A;  1O08 A;  2XCA A;  3BQ2 A;  4I2I A;  2HVH A;  1A76 A;  1HJP A;  2KZ3 A;  3ICX A;  4J9P A;  5CR0 A;  1ZQA A;  1JX4 A;  3WK6 A;  3JPO A;  2ESE A;  5KFC A;  4PJ0 U;  4UAV A;  2KN7 A;  5T14 A;  5KFG A;  2BCQ A;  1X9W A;  4M9H A;  4OJP A;  5EWG A;  2ATL A;  5AKG A;  1Q3V A;  4NLK A;  3C21 A;  3OJS A;  4UB1 A;  3QYP A;  2NO4 A;  2E5S A;  2NYV A;  9ICP A;  1SV0 C;  1JUD A;  4C4S A;  3GV7 B;  5J0T A;  5J0W A;  1T3Q A;  4I2F A;  5AK4 A;  2LYA A;  3NS1 A;  8ICO A;  2YMM A;  4F4Y A;  1JXL A;  5KG1 A;  2GLE A;  2BGW A;  7ICO A;  4U7C A;  3KTQ A;  2PFO A;  4UAY A;  4I28 A;  3M9O B;  1ZQM A;  5AKE A;  5HR6 A;  5ALQ A;  4QIW C;  4RQ7 A;  2JEJ A;  5KG0 A;  4DOC A;  5AM3 A;  3M8R A;  2JEF A;  2WF7 A;  1KFS A;  2AGQ A;  3RJK A;  3HX0 A;  7ICL A;  2DWQ A;  9ICI A;  4JUZ A;  2KZM A;  4YR0 A;  9ICH A;  4DQP A;  1FEZ A;  3H8S A;  1TVA A;  4QZA A;  2BDP A;  2K89 A;  7ICU A;  2KG5 A;  3H8J A;  4QWA A;  4KLL A;  4PHP A;  5J0R A;  5DQH A;  2HOF A;  2ODG A;  1JRP A;  4LZG A;  2VKQ A;  5G5H A;  4O3O A;  2AQ4 A;  1CEZ A;  4GC6 A;  2K8B B;  3C5F A;  1L7N A;  2HOI A;  4Y2T A;  3LVW A;  2L5Y A;  2LBO A;  2OXO A;  2D8C A;  3Q8P B;  4NL9 A;  2PI4 A;  4EEK A;  5ALH A;  5KFF A;  4M9L A;  3BQT A;  2ZIU B;  5DQI A;  4J9O A;  3UMG A;  3RJF A;  2ZIV A;  3TAD C;  4ELT A;  2E8M A;  2FE9 A;  4YQW A;  4KTQ A;  2FJ6 A;  3O0F A;  3ISD A;  2W3S A;  3QUQ A;  5DDY A;  5ALR A;  4YMN A;  9ICV A;  4NXZ A;  1RYU A;  4J9Q A;  3F53 A;  2R8G A;  3MGH A;  1BPE A;  2RRD A;  4IQW A;  4GC7 A;  8ICQ A;  1S0O A;  1X40 A;  3AEV A;  3GV8 B;  5AKZ A;  4TUP A;  4IQV A;  3LWL A;  2ZIX B;  9ICE A;  3H0L B;  4JWM A;  5EE0 A;  4ICA A;  1HIW A;  4BUG A;  1M6Y A;  1YT3 A;  4MEY A;  3SMV A;  4Z6D A;  2YB1 A;  2ZG6 A;  2P35 A;  3HW8 A;  5KFX A;  4F5P A;  4UB2 A;  3F5A A;  3PW2 A;  2UVU A;  3RJE A;  2K8A A;  1BPB A;  4Q8E A;  1ZQB A;  4GLX A;  2KV2 A;  3PR4 A;  4Y2U A;  1NKE A;  1B22 A;  2W3R A;  4NLC A;  1JI7 A;  1WCL A;  4KLT A;  2F3N A;  4NLN A;  1KW4 A;  3I76 A;  4PGQ A;  2DPI A;  5KFM A;  3KOO A;  2R8H A;  2Y0S F;  1FIQ A;  3L3F X;  1JN3 A;  2ISP A;  8ICH A;  3BZK A;  4ZOH C;  2P6R A;  2IA6 A;  3V6K A;  1NZB A;  4ECQ A;  2JGA A;  7ICM A;  5J8Y C;  7ICN A;  2JRZ A;  3RH5 A;  4ECY A;  3UXP A;  3RH4 A;  3AUO A;  3V7J A;  2AGO A;  4Y2Y A;  1WUD A;  3KFU F;  1NKB A;  1IG6 A;  3JPN A;  1A6S A;  3QU9 A;  5J2G A;  3QX7 A;  4ZH4 A;  5J2H A;  2ZXH A;  5ALL A;  2VJ4 A;  4EEY A;  3VC8 A;  1KFT A;  1IIP A;  2Y1J A;  3PSP A;  3E0F A;  1FO4 A;  1ZQE A;  4Z6F A;  4CF4 A;  3RAQ A;  2JH7 A;  1QCK A;  2Q0Z X;  3BS7 A;  4RPY A;  1COK A;  7ICI A;  3TAP A;  1SKW A;  2HHW A;  2PI5 A;  1JRO A;  2ZJA A;  4CNQ A;  2KMD A;  4DF4 A;  5DQG A;  5J0S A;  5J2K A;  3H8M A;  1ZQU A;  4UAR A;  3Q8K A;  5ALM A;  3QUC A;  3M7D A;  5DGB A;  3KHR A;  5KNI A;  4ED8 A;  3QUT A;  1C7Y A;  4IQT A;  4DSK A;  1L5U A;  2DQN B;  2BKE A;  2CN1 A;  1GO3 F;  2FPM A;  2K4E A;  2BPG A;  1RXV A;  3HPO A;  2YMP A;  1BPZ A;  2IBK A;  2M9N A;  1N60 A;  4YN4 A;  2FLP A;  1SZP A;  2JMG A;  4O3N A;  4DF8 A;  2F76 X;  4DL5 A;  1Z1B A;  3GZF A;  2XY5 A;  2UVV A;  3KHL A;  4F4Z A;  4P0P B;  2HHU A;  2ZIU A;  4DSF A;  4P4O A;  1D8L A;  3F2D A;  4UB8 U;  1Z4O A;  4M0A A;  2CRX A;  2DFL A;  1RQN A;  1ZQI A;  3GFK B;  2Y0S C;  5DBA A;  2BZF A;  2NO5 A;  2EAP A;  4C8K A;  4I2A A;  1RYR A;  2JXJ A;  1X9M A;  1T7P A;  4F4X A;  3KZX A;  3KKA C;  4NV0 A;  3SD7 A;  2BCS A;  4JMU A;  3SAG A;  4EBE A;  3MR6 A;  5KFA A;  3R9K A;  1TAM A;  1JXE A;  3RJH A;  5AK5 A;  5IIJ A;  1ZQC A;  4UAZ A;  2R8I A;  4I29 A;  2G0A A;  4RQ2 A;  8ICR A;  2BDU A;  4JV2 A;  5AKL A;  1NZP A;  3PW4 A;  2EZZ A;  4JK1 A;  1Q3U A;  2LMR A;  4KMU A;  3PW7 A;  1LKY A;  2G09 A;  3GU3 A;  4Y2Q A;  2FMP A;  2UVW A;  1XWL A;  4EYI B;  3N28 A;  2JEG A;  3PO4 A;  4RQ6 A;  9ICC A;  1JAL A;  4ECS A;  3GIL A;  2IMW P;  2EQY A;  1TFR A;  5AK6 A;  8ICG A;  5CHG A;  1N5W A;  3FC4 A;  3PW0 A;  1UCV A;  5L1J A;  2N1R A;  5AI4 A;  3EYZ A;  3BQ1 A;  4F91 B;  4C8L A;  4YXJ A;  8ICC A;  2FPK A;  7ICE A;  3HKZ F;  2C28 A;  1N2X A;  4YG2 A;  3MR5 A;  2BQ3 A;  4M9G A;  2JHD A;  3RBE A;  1L3V A;  5AIB A;  2YML A;  1SWV A;  2KSO B;  4UAS A;  9ICX A;  4NLZ A;  5F3X B;  3TFR A;  4KLU A;  1Q46 A;  3UMB A;  1PK1 A;  4F3O A;  1KLN A;  1ZD4 A;  1DXS A;  7ICV A;  9ICO A;  3FM9 A;  3GV5 B;  2KHV A;  4DOB A;  5HP4 A;  4LZD A;  9ICR A;  1WG8 A;  9ICG A;  1XNS A;  4F71 A;  5DB7 A;  3RB3 A;  5KG4 A;  4UBC A;  1U9L A;  5KT4 A;  1A0P A;  4ELU A;  5KFK A;  4RNN A;  4Q43 A;  1LVH A;  5KFQ A;  1KDH A;  4Y2S A;  3MGI A;  2D3D A;  4CDG A;  2WF9 A;  2PFQ A;  2B0C A;  2FMQ A;  4DSJ A;  3PSF A;  5A0L A;  3ED5 A;  3GDX A;  3JPQ A;  4MF8 A;  2PKE A;  4O3S A;  5AHX A;  3B0Y A;  2UVR A;  2W9C B;  4QWD A;  3NVY A;  3WKE A;  4F92 B;  5J2F A;  5KG5 A;  4FE3 A;  4O9M A;  1F0M A;  1SIJ A;  3DDH A;  2KKV A;  2H3F A;  3N7P D;  1J2M A;  1NK8 A;  3LK9 A;  2DL0 A;  2K4H A;  4NL9 C;  5III A;  4KLM A;  2DKZ A;  4O3Q A;  3AMZ A;  4UB5 A;  3C29 A;  4ECR A;  5J2C A;  3RBD A;  3T5L A;  1RDF A;  4BXO B;  4P0P A;  1U48 A;  3B0X A;  3C28 A;  3IP4 B;  5KTQ A;  3QXG A;  3HKZ C;  4BX9 C;  3EZ5 A;  4XA5 A;  5GTH U;  2EAO A;  2RP5 A;  1L7M A;  3FDS A;  5DB6 A;  1QQ7 A;  1SZH A;  3EW9 A;  3ZD9 A;  1PZN A;  3ZDE A;  4C8M A;  1N5X A;  5HHH A;  4FS1 A;  2FLL A;  1QSL A;  4DLG A;  3KHG A;  5KFR A;  4P4P A;  4Y2J A;  2LKY A;  9ICA A;  4TUQ A;  2OEH A;  2HBK A;  2ASL A;  3AQF A;  2F1I A;  1BPY A;  2Y1I A;  5J2D A;  3UQ0 A;  3HRD D;  5F9L A;  3RR8 A;  2XI9 A;  5K4L A;  3ZI4 A;  5AKX A;  4F4K A;  5ALE A;  3N7R C;  3RB0 A;  3HIL A;  5KFN A;  1ZQH A;  4IR9 A;  4B9N A;  2AJQ A;  5J0U A;  4QZI A;  1ZQT A;  2E3T A;  2A1J B;  3EPI A;  1A77 A;  2W11 A;  2W8L A;  2KIW A;  5AIA A;  5KFU A;  1ZQK A;  3LDA A;  5DG9 A;  4IRK A;  3TKA A;  1TK5 A;  3WKB A;  5ALF A;  2YX8 A;  1L7O A;  1D8Y A;  3ETL A;  2RQ5 A;  2ZXI A;  1X9S A;  1S0N A;  1L7P A;  2H3Z A;  1UT8 A;  1PK3 A;  2BR0 A;  5L1L A;  5IIM A;  4QZ8 A;  3WU2 U;  5DLG A;  4B9S A;  1S97 A;  2YB4 A;  1COO A;  4RU9 A;  1RG6 A;  3MGV A;  3M6Z A;  3AM9 A;  2GOL A;  1MSW D;  3ZDC A;  1XO0 A;  4F5N A;  1NK7 A;  4J9S A;  4F5R A;  5J2B A;  4FS2 A;  3PMN A;  1K5O A;  5J0O A;  3AU2 A;  2R8J A;  4F8R A;  3F5E A;  2KEY A;  1NNL A;  5KFS A;  2DBY A;  4RNM A;  5G5G A;  4KLG A;  1VLB A;  4DL3 A;  4I27 A;  5KT6 A;  4I2H A;  4X5V A;  3H8W A;  4EYH B;  4I2J A;  4P0Q A;  4F50 A;  1X9X A;  1Z00 A;  4CF3 A;  2AQ0 A;  3PZP A;  2W9B B;  4NLB A;  3SEN A;  5J2A A;  1L3T A;  8ICW A;  1N56 A;  9ICN A;  5H2F U;  1SB3 C;  3Q8Q B;  2DKX A;  4OD0 A;  4TQS A;  8ICE A;  2BPC A;  1TKD A;  3RFA A;  1ZXI A;  4ECU A;  3PX6 A;  1UA0 A;  3FYH A;  2C22 A;  2NV3 A;  1RPL A;  3QEA Z;  2MU2 A;  3IDW A;  2I6X A;  4Q8F A;  4RQ3 A;  3C2L A;  1SL0 A;  5AKY A;  3K1Z A;  1ZRM A;  5ALG A;  4LVS A;  4YVZ A;  4NJ8 A;  3H4B A;  5ALN A;  2PFP A;  2XGP A;  2ZUD A;  3TAC B;  4FBU A;  5AI5 A;  2PMZ F;  2OH2 A;  1NJX A;  1ZQ1 C;  4KX5 A;  5KFH A;  1X42 A;  2FMS A;  4KLQ A;  8ICY A;  5DLF A;  1UHU A;  5DG7 A;  3TAR A;  4BXO A;  7ICG A;  4KX3 A;  1NK4 A;  2JZB A;  4JB3 A;  4HAI A;  2ZIW A;  3DEE A;  1T3N A;  3B9J A;  5J29 A;  9ICM A;  4C7Y A;  1B4F A;  1XSN A;  3RAX A;  7ICF A;  5C5J A;  2NRZ A;  1H38 A;  2IOF A;  1F5S A;  1ZQN A;  5KFL A;  1ZQY A;  5BOM A;  3OJU A;  3RR7 A;  4DQR A;  2XC9 A;  4UQG A;  2BCR A;  3E58 A;  2W43 A;  1ZQG A;  2HMX A;  5KG2 A;  5JTI A;  1NJW A;  1NKC A;  5TZV A;  4QWC A;  2LPE A;  2YQE A;  9ICK A;  4DSI A;  4K4H A;  1L3U A;  5AI8 A;  2MA1 A;  4PGX A;  3PO5 A;  4Y2X A;  1S0M A;  5CEH A;  1IXR A;  3LWM A;  3HJE A;  3PX0 A;  3QZ8 A;  4EZ6 A;  4Q44 A;  2GO7 A;  2HI0 A;  4Y2R A;  3SQI A;  2OWO A;  9ICS A;  5J0P A;  4QZE A;  2FLN A;  2NRW A;  3BS5 B;  4RQ5 A;  5BOL A;  3H7I A;  1LB2 B;  5KFE A;  4F72 A;  3I28 A;  3U26 A;  3KHH A;  2ZTD A;  3ZDB A;  2BCU A;  3WK7 A;  4WJ3 B;  4DOA A;  5ALX A;  1MQ3 A;  1TE2 A;  4O5K A;  2HHS A;  4EX6 A;  4CF5 A;  1S10 A;  2F1J A;  4ECW A;  1FFU A;  3WKC A;  1KSP A;  1FFV A;  2JV3 A;  2K60 A;  4U6P A;  3PVX A;  4RPX A;  7ICQ A;  2WAQ F;  3SAF A;  2PMZ C;  4RUA A;  3F2B A;  4J9N A;  3T5K A;  2EZX A;  2YY6 A;  5AM0 A;  1RZT A;  5HNK A;  4ECX A;  4ED6 A;  3NAS A;  4DL4 A;  2VA3 A;  3UXN A;  4KLS A;  4DS5 A;  3Q8R B;  2KK0 A;  5ALK A;  1MC8 A;  4B9M A;  2B21 A;  1X66 A;  3MDA A;  3MDC A;  2RLT A;  5HHI A;  2W9B A;  5E79 U;  3D2Q A;  3HT3 A;  3C5G A;  3OGU A;  1WCN A;  4RQN A;  4C4T A;  4KIT B;  3OHA A;  1SL2 A;  4I2G A;  3Q8S B;  3M8S A;  4DL6 A;  2HBL A;  4DFM A;  2R8K A;  1NK9 A;  2ES6 A;  1HUZ A;  5F9N A;  3RJG A;  2W9A A;  1ZQD A;  2AH5 A;  2KE7 A;  5AI6 A;  4I2E A;  5AK3 A;  1NJZ A;  3PSI A;  4FZN A;  2YMQ A;  4DSL A;  7ICP A;  3SYZ A;  3GQC A;  4KN7 A;  4I2B A;  2MAX A;  4BGD A;  1RXW A;  5KFP A;  3EUB 2;  2XID A;  4QWE A;  2DUY A;  1WYG A;  1T94 A;  4M6W B;  4GFJ A;  4IR1 A;  4M47 A;  4TUS A;  3ONN A;  2QB0 B;  3QEB Z;  1NK5 A;  1KFD A;  1UT5 A;  1B43 A;  5J2E A;  5KFT A;  2FDR A;  2HSZ A;  4BWJ A;  2RDI A;  4QWB A;  1MA7 A;  2G06 A;  3BQ7 A;  3IRU A;  1U4B A;  3CP8 A;  3D6J A;  3ZDD A;  5HML A;  3WK9 A;  1KQQ A;  8ICA A;  3SI8 A;  4UB6 U;  2ZIX A;  3H4D A;  2E8P A;  2AU0 A;  1BNO A;  3N7S C;  3WK5 A;  5KFD A;  2WAQ C;  2NRV A;  3PV8 A;  5KFI A;  4YFK A;  4NM1 A;  2WF8 A;  3BZC A;  1JIH A;  4C80 A;  3Q8L A;  5J0Q A;  2Y9T A;  5KG3 A;  5B66 U;  4RQ8 A;  1UA1 A;  4RQ4 A;  1F44 A;  1TK0 A;  2EZY A;  7ICH A;  5DB9 A;  2XY7 A;  3D2N A;  1JMS A;  1PVQ A;  3V6J A;  2W8K A;  1N62 A;  2QB1 A;  2C2R A;  4RQ0 A;  3NRZ A;  2QAR B;  4DQS A;  3SV4 A;  2I1Q A;  2H5X A;  3IV6 A;  9ICB A;  4IS7 A;  2E1E A;  4YXM A;  7ICS A;  1U45 A;  5D46 A;  1URJ A;  4ED2 A;  1SKS A;  1RYS A;  2HOQ A;  3DV9 A;  4QZH A;  2OM6 A;  2W55 A;  5AM1 A;  2I5H A;  3MR3 A;  4PHA A;  4HYK A;  5HMM A;  5HR7 A;  3RF9 A;  3WK4 A;  1ZQS A;  1ZQR A;  2VIX A;  3ALR A;  1ZD3 A;  5BPC A;  4ACO A;  1ZD2 P;  4I2C A;  5ALD A;  8ICU A;  3OSN A;  3Q8M A;  2AGP A;  5KFY A;  2H3Q A;  5KT7 A;  4YMO A;  4K4I A;  5DG8 A;  7ICK A;  1NJY A;  1T8E A;  4C8O A;  1Q8K A;  9ICQ A;  2HHX A;  1TK8 A;  1ZJN A;  2QKQ A;  5JU5 A;  4PHD A;  2KD1 A;  2VAN A;  2JH1 A;  2HW3 A;  5KL1 B;  4Z6E A;  4DL7 A;  2ZUC A;  4O5C A;  2KFZ A;  9ICJ A;  4Y2P A;  1ARO P;  2IHN A;  1WWV A;  4QZG A;  1OXJ A;  7ICJ A;  3HP6 A;  1DK3 A;  5D4B A;  1NK0 A;  1L8L A;  4CE6 A;  2P66 A;  1ZQO A;  5IIL A;  4ECV A;  2LM4 A;  4B6J A;  1BPD A;  4P4M A;  4R63 A;  4QZ9 A;  4TQR A;  4F4W A;  5B5E U;  4M2Y A;  2BQU A;  2Q4T A;  4QJF B;  4PZN A;  3CYM A;  4EX7 A;  2ZTC A;  3J81 j;  4MFF A;  1ZQL A;  1Z3E B;  3G6Y A;  1T4G A;  3A0H U;  4GIB A;  2ZIV B;  3QUB A;  4RQM A;  3UMC A;  5ALO A;  1SWW A;  4F5O A;  3C1Z A;  3PML A;  4FO6 A;  5AKK A;  1D9D A;  3C2M A;  4OJ6 A;  3LVV A;  5AKJ A;  5KT5 A;  1X6I A;  3C1Y A;  1QH9 A;  2KJ8 A;  1X2I A;  1KRP A;  3WK8 A;  3PW5 A;  4FZL A;  1ZQX A;  2HBJ A;  1L6N A;  5CJ7 A;  3NTU A;  2H3I A;  1ZQZ A;  4CGZ A;  8ICF A;  4O5E A;  2D6F C;  8ICP A;  4KLF A;  5GTI U;  5KFO A;  1K1Q A;  1VJ5 A;  3CNH A;  1S5L U;  3TI0 A;  1SKR A;  4J9K A;  3RJJ A;  3IHQ B;  4MEX A;  1KTQ A;  5L1K A;  3GIM A;  1D9F A;  3M9N B;  2IOF K;  2M0N A;  2BCV A;  4JV1 A;  2CXY A;  3H0R B;  4ED3 A;  4DCC A;  2HHV A;  4ED1 A;  3JPS A;  5ALW A;  4QW8 A;  4B9V A;  4XUS A;  4FBT A;  2KOB A;  4RT2 A;  2QAR A;  3EWA A;  4QZF A;  4J9M A;  4EBC A;  2ZTE A;  2KSO A;  5DBB A;  1ZQV A;  2OYY A;  3NVW A;  4Y2V A;  3WKA A;  1L8O A;  4B9U A;  4G9B A;  5DBC A;  3QU7 A;  4F2S A;  5JRT A;  1S77 D;  4MFC A;  1B0X A;  2KJ9 A;  2C2E A;  4KLH A;  5EWE A;  4KLO A;  1Y88 A;  3ETR A;  4YD2 A;  5ALZ A;  2XIC A;  2W9M A;  4YD1 A;  1VDV A;  4FFD A;  4R66 A;  4R8U B;  4QZC A;  4UB4 A;  3H0M B;  5KG6 A;  1NI3 A;  5ALI A;  5FP0 A;  2Y9U A;  2F8L A;  3OSP A;  1CI4 A;  3CRX A;  4YR2 A;  1Z1V A;  4RPZ A;  2OCE A;  1TV9 A;  1Z19 A;  2EDU A;  2B6G A;  2F44 A;  5AKI A;  1ZJM A;  2LHT A;  3A0B U;  5KG7 A;  1BNP A;  2VA2 A;  4IQU A;  4I2D A;  4C8N A;  3ZDA A;  5EE1 A;  2W9C A;  2WFA A;  4YR3 A;  4UW9 A;  1O03 A;  4RUC A;  4RNO A;  5AIC A;  1DGS A;  2Z7J A;  4US9 A;  2ASJ A;  3MFH A;  1ZYQ A;  2A3V A;  5IIK A;  3T5J A;  2R18 A;  4J03 A;  4AP9 A;  4IC9 A;  4CCH A;  3GIK A;  3L5K A;  3G6X A;  3IN5 A;  5L9X A;  5EE3 A;  3PST A;  4EEN A;  3OPX A;  4Z6C A;  5AM2 A;  3V7L A;  5KAI U;  4QW9 A;  3SV3 A;  2QLT A;  1ZQJ A;  1K1S A;  1ZQQ A;  2NRT A;  2ASD A;  3K75 D;  4DEZ A;  3QZ7 A;  2JEI A;  3QU4 A;  2CPR A;  5D49 A;  4PHE A;  1KL9 A;  2OHF A;  5CP2 A;  5L1M A;  3BJY A;  1S9F A;  1ZQP A;  1S0V A;  3JPR A;  3BQ0 A;  3PX4 A;  1NK6 A;  9ICW A;  4O3M A;  1SXD A;  8ICT A;  2XGQ A;  2K8C B;  4JV0 A;  4DFK A;  4NY8 A;  2PXI A;  4KMO B;  2MSN A;  1OUQ A;  3NUQ A;  2YTU A;  5ALS A;  4EBD A;  5ALU A;  5L1I A;  2HHT A;  3TAQ A;  4BWM A;  4DQI A;  2H3V A;  4OJO A;  2WF5 A;  5ALP A;  1PVR A;  2A1J A;  2HHQ A;  2EH9 A;  2ZUB A;  5AM5 A;  1LKY B;  3IG5 A;  1XC9 A;  2WF6 A;  4RQ1 A;  1ZQF A;  2VJ5 A;  5J0Y A;  3SR6 A;  4YCX A;  2G5I B;  2F2A B;  1MN8 A;  3I1Y A;  4R64 A;  4PL2 A;  4MFA A;  5AI0 A;  1AQ6 A;  1XSP A;  1TAQ A;  5EOZ A;  5IIO A;  3MC1 A;  4BJQ A;  3T79 A;  2F8K A;  3N97 B;  3RRH A;  2FPL A;  4B9T A;  2WB1 F;  3D2S A;  3QU2 A;  3AN1 A;  1V85 A;  3T5H A;  4XQ8 A;  4US8 A;  8ICB A;  3EPG A;  1SV0 A;  2MUT B;  2VA8 A;  5J2I A;  1Z4N A;  1YZ6 A;  4DFP A;  1RM6 C;  5KFV A;  1N48 A;  1D8B A;  7ICT A;  4M9J A;  1C20 A;  1S8O A;  1XSL A;  1QSS A;  5J0X A;  8ICI A;  1OW5 A;  3QNM A;  5DDM A;  1CUK A;  2KVC A;  3H40 A;  2V9W A;  1PK1 B;  4ED7 A;  4DS4 A;  3C23 A;  3TAN A;  1DK2 A;  4ECZ A;  3K4G A;  3T3F A;  5EWF A;  2W04 A;  1WWU A;  2XCP A;  1J2N A;  4UAU A;  1QQ6 A;  5AI9 A;  4R8U A;  5CWR A;  3PNC A;  5AKH A;  2E8O A;  2F1H A;  2HDO A;  1S76 D;  4UAW A;  2BPF A;  2EAN A;  5ALJ A;  2EAM A;  4P2H A;  5KFB A;  4KN4 A;  5DB8 A;  2XVT A;  1BVS A;  1LV5 A;  2LM1 A;  9ICL A;  1V97 A;  2LI6 A;  1P7D A;  1YZ7 A;  4R65 A;  4IL6 U;  4YP3 A;  5KFW A;  4B9L A;  3G6V A;  3THV A;  4K4G A;  4KLI A;  3OHB A;  3IG8 A;  3RH6 A;  8ICL A;  1MQ2 A;  1TAU A;  3MBY A;  3SEI A;  4QZD A;  4DWI A;  1DGJ A;  3V7K A;  2AXT U;  2XY6 A;  1QTM A;  5KT3 A;  3AL0 B;  3QU5 A;  4PH5 A;  2BHN A;  4OO1 J;  2GH1 A;  8ICM A;  4DQQ A;  2J6T A;  3FAH A;  5KL8 B;  2W03 A;  2JR5 A;  4USA A;  4NWI A;  3WKD A;  4XRH A;  5EE9 A;  4DSE A;  8ICS A;  9ICF A;  3TAD A;  2F77 X;  2MRL A;  3N4M B;  5KAF U; 
#chains in the Genus database with same CATH homology
 3IN5 A;  2CN1 A;  3PST A;  2JH1 A;  1GO3 F;  2K8A A;  2LYB A;  2KNJ A;  3OPX A;  2K4E A;  5KL1 B;  4CRX A;  4AYB C;  2E1F A;  2M0N A;  2KV2 A;  3F2C A;  4P0P A;  1ED1 A;  2K89 A;  3C28 A;  3IP4 B;  1KBU A;  2WB1 C;  2JMG A;  2RHF A;  3H0R B;  3F5E A;  2G5H B;  2KEY A;  2JHD A;  4NLC A;  1D8B A;  3F5A A;  1ECW A;  3HKZ C;  4BX9 C;  1CRX A;  5CRX A;  3D2Q A;  2RP5 A;  2KOB A;  4P0Q B;  2HOF A;  1SZH A;  2KVC A;  3VCB A;  2F76 X;  2DGZ A;  2HMX A;  2VKQ A;  1Z1B A;  1F44 A;  3GZF A;  4OJ5 A;  2CPR A;  2K8B B;  2W04 A;  4P0Q A;  4P0P B;  2OYY A;  2Y0S F;  3D2N A;  2LKY A;  2ZIU A;  3L3F X;  2HBL A;  2HBK A;  3PZP A;  2HOI A;  1PVQ A;  3AQF A;  4NLB A;  2Q4T A;  3F2D A;  4QJF B;  2MA1 A;  3ICX A;  4O3M A;  2KHV A;  3LVW A;  1NZB A;  2LBO A;  3CYM A;  4QNL A;  2OXO A;  2G07 A;  2W7O A;  2JGA A;  2CRX A;  2K4I A;  2XI9 A;  2K8C B;  1PVP A;  4KMO B;  2KJ9 A;  2Y0S C;  5T14 A;  1HEK A;  1OUQ A;  1XNS A;  3PSI A;  3NUQ A;  4FZN A;  2G08 A;  2ZIV B;  3N7R C;  4OJP A;  1UPH A;  2KHQ A;  2ZIU B;  2E1E A;  3RFA A;  1Q3V A;  1WUD A;  2XIC A;  3KFU F;  3KZX A;  2XVT A;  4NV0 A;  1URJ A;  1A6S A;  4JMU A;  3SAG A;  3SAH A;  2ZIV A;  1A0P A;  3AQE A;  3SQI A;  2HOQ A;  1P7D A;  2E5S A;  2ZXH A;  3H0M B;  2VJ4 A;  3O0F A;  2NV3 A;  2OM6 A;  2H3V A;  1TAM A;  4OJL A;  2XID A;  3VC8 A;  1IIP A;  2KIW A;  4OJO A;  2F8L A;  4OJ6 A;  4CDG A;  1PVR A;  3PSP A;  3CRX A;  3K1Z A;  3E0F A;  1T94 A;  3F53 A;  4GFJ A;  2G0A A;  3PSF A;  1Z19 A;  2RRD A;  3LVV A;  5A0L A;  2JH7 A;  2BDU A;  3IG5 A;  4QIW F;  3ONN A;  4C0Z A;  4FZM A;  4WJ3 B;  3IG8 A;  5HR7 A;  2KIC A;  2VJ5 A;  2YX8 A;  2PMZ F;  3RF9 A;  2LHT A;  1Q3U A;  4A8E A;  2ZXI A;  2OH2 A;  5C0Y A;  2LYA A;  2G5I B;  2F2A B;  2KJ8 A;  1DRG A;  2G09 A;  2VIX A;  3GU3 A;  4PL2 A;  3ALR A;  1ZQ1 C;  4KX5 A;  2H3Z A;  4FE3 A;  4FZL A;  4U7C A;  1MA7 A;  2G06 A;  2HBJ A;  4U6P A;  2DF4 B;  1L6N A;  2ZIX B;  2KKP A;  4ACO A;  3CP8 A;  4QIW C;  2H3I A;  3AL0 B;  5HR6 A;  2W7P A;  4CGZ A;  2KKV A;  2WAQ F;  3H0L B;  2PMZ C;  3SAF A;  2GH1 A;  2HBM A;  4BJQ A;  2D6F C;  4OO1 J;  2H3F A;  3M7D A;  2H3Q A;  2ZIW B;  4ICA A;  5KL8 B;  4KX3 A;  2W03 A;  2ZIX A;  3N7P D;  2YB4 A;  1HIW A;  4NWI A;  2N1R A;  4AYB F;  4BUG A;  3F2B A;  3T79 A;  4PL1 A;  2Z7J A;  1YT3 A;  2KJ5 A;  3SMV A;  2K4H A;  2YB1 A;  2A3V A;  2ZG6 A;  2WB1 F;  2ZIW A;  3DEE A;  3LYS A;  3M6K A;  2F77 X;  3N7S C;  3NRW A;  2R18 A;  2MRL A;  3M6Z A;  3MGV A;  3D2S A;  3HKZ F;  2GOL A;  4IC9 A;  3C29 A;  2DQN B;  2WAQ C;  1XO0 A;  2KD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...