1ZXIA

Reconstituted co dehydrogenase from oligotropha carboxidovorans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional reconstruction in situ of the [CuSMoO(2)] active site of carbon monoxide dehydrogenase from the carbon monoxide oxidizing eubacterium Oligotropha carboxidovorans
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
total genus 50
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1zxiA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zxiA01
2W3SA 1E9MA 2WDQB 5C3JB 2CU3A 5AUIA 1DOIA 2WLBA 1JRPA 3AE9B 4YT0B 5EE0A 5C2TB 2DWQA 1KFYB 2WDVB 1PUTA 1FXIA 1JWAD 1RYJA 4ZHOA 3P63A 3NS1A 2M56B 4A9AA 2PVGC 1QT9A 3BIID 4JX1C 3AM9A 1PFDA 3AEDB 1FIQA 2G1EA 3NVVA 4YSZB 3VRAB 2K9XA 1N60A 3HRDD 4N59A 4HROA 1SIJA 4C80A 2MJEA 1PDXA 1TKGA 1V97A 4C7ZA 1VLBA 2BS3B 2WS3B 3AE8B 3AECB 3AH7A 4JWSC 3AE4B 3SFEB 1B9RA 3ETRA 1NENB 1RFKA 2WDRB 3VR9B 1T3QA 1AYFA 2WP9B 1FO4A 1YQ4B 1E10A 3NRZA 1NEKB 2AX5A 1TKYA 3HUIA 2K22A 3AEEB 3W5UB 3L4PA 2PVOD 3CIRB 5AUKA 4YSYB 1WYGA 2QIEB 2DBYA 1L6UA 1ZOYB 2FBWB 4N6EB 1UWMA 3WCQA 1VDVA 3AE5B 1SF0A 2CJNA 1E6EB 3P1MA 4WWMA 4C7YA 1RWSA 2CJOA 3AE1B 1L6VA 2N0SB 3FC4A 4YXDB 3AV8A 5MPOA 3B9JA 3NVYA 2MH7A 5G5HA 1CZPA 3KWLA 5EE9A 4US8A 1A70A 2M19A 1OQRA 4JWUC 3AN1A 5G5GA 1OFFA 3CWIA 2PIAA 3W9CB 1QOBA 1QOFA 3ZYYX 3B2FA 1ZUD2 1DOYA 1N5WA 1L5PA 1JALA 3NVZA 1F0ZA 1YQ3B 2BS4B 2ACZB 1GAQB 1NVID 1TJEA 2E3TA 2H88B 2Q5WD 1N5XA 4YTMB 1VJKA 3NVWA 1TKEA 3AEFB 1IUEA 3P4PB 4ZHPA 1QOGA 3AEBB 2MJ3A 3P4RB 4USAA 1FRRA 3AE3B 3AEGB 3RPFC 1QF6A 2WQYB 5H8YE 4N58A 3VRBB 3W5VB 4US9A 4P6VF 4YSXB 1FM0D 3DWMA 3DWGC 3SFDB 1SB3C 1R7SA 1YJIA 2OHFA 1FRDA 2KAJA 3AEAB 3P4QB 1E0ZA 1KRHA 1FXAA 1FFUA 1WWTA 1JW9D 3AE2B 4YTPB 3VR8B 1YJJA 1E7PB 3HVZA 5GXGB 1N63A 2EKIA 1AWDA 2PKOA 1JQ4A 4HRSA 1J7AA 3AB5A 1ZP0B 3P4SB 2H89B 4KX6B 1ZXIA 2B76B 1KF6B 1V8CA 2JX5A 1TYGB 2LEKA 2W55A 4YTNB 2Y5CA 1NI3A 1L0VB 4IDIA 3AE6B 4ZOHC 3B2GA 2WU2B 1CJEA 2BT6A 4FXCA 1NYRA 5EE1A 2L52A 3PO0A 1JROA 4ITKA 2K5PA 2QJLA 3SR6A 1WXQA 1EWYC 2MJDA 5EE3A 1WRIA 4LTUA 1XLOA 1FFVA 3AE7B 1GPXA 2W3RA 2BS2B 1XLPA 3ABVB 3AMZA 5H92C 1J7CA 1WGKA 3FAHA 1ROEA 1RM6C 1XO3A 3LXFA 1DOXA 2WU5B 1JWBD 4WQMA 2W54A 1J7BA 2L83A 1DGJA 1QLBB 1N61A 1N62A 1FMAD 1NYQA 1QOAA 1XLNA 1OQQA 2HTME 3LB8C 3EUB2 2JQRB 1XLQA 2KMMA 1I7HA
chains in the Genus database with same CATH superfamily
1E9MA 4DL7A 3AU6A 2E8NA 4YFKA 2CKHB 2UWQA 5HMMA 3QX7A 2ZJAA 5AI5A 4BZAA 4HKQA 4UAWA 4YWGG 1QQ7A 4ZHOA 2MBQA 4QWAA 3H1UA 2HE7A 4IC9A 4N9F4 4K7UA 1V80A 3N1YC 2A1AA 2ESEA 3RJFA 1DK3A 1FNVA 4DLGA 2KTRA 4ZRKA 3AQFA 4HAIA 2INDC 3MC0B 3NUQA 1PVPA 1SKWA 1JN3A 4F2SA 1PDXA 3AECB 1T5XD 3WK4A 3ISBA 4UW9A 2GBMA 1KFSA 4K4GA 1J97A 2WP9B 1ZRNA 1BPDA 9ICTA 4C8MA 3TAQA 1SWVA 1E90A 3DVGY 2KD1A 4DQSA 4N6EB 4K4HA 2O6VB 5ALXA 1XD3B 1UCVA 2KZMA 3F5AA 1E7VA 1URJA 5CWRA 3TANA 7ICNA 7ICVA 2ISPA 3E56A 1P98A 5D46A 1WJ4A 2M9NA 2OXOA 4IM2A 2D5GA 4JV0A 4DS5A 1CI4A 3AU4A 4AS1A 2KJ6A 3H6NA 4CF4A 2W9BB 4E71A 1EUVB 1KM7A 2YMLA 1WFYA 4BJQA 1HE8A 3VUWA 1PYWD 4IWPA 3RTVA 3BK2A 2DGZA 3H8MA 5J2AA 5DB9A 4DQPA 1XO0A 9ICKA 4R8UA 3Q8EA 1Z4NA 5BMHA 3ALRA 2D6FC 2IGHA 4S0RA 5KFBA 4M6WA 1KOTA 4DSFA 2JH7A 2QDFA 4MEMA 2BPSA 4AOFA 1UT5A 4EUTA 3GQCA 2YN4A 3RH6A 1DRGA 4DOCA 3U7ZA 7ICOA 2MSNA 1XSNA 2ZTCA 4OD0A 4DQIA 5IA7A 2BYFA 1FFUA 3V61A 4RQ1A 3BS5B 4PS3A 2L00B 4ARCA 5IINA 3UQ2A 2JEJA 3PW7A 4UAVA 5TISU 1IGCA 4TUUA 4YN4A 4OVZA 5DB7A 2ZUBA 4QAYA 2H5XA 2EMSA 4UB8U 1HXYD 1LVHA 5KFIA 2G09A 2INCC 3CF6E 2PE9A 4CRXA 3GS2A 5J29A 2K5PA 3H7SA 4FLHA 4Y2TA 1WXQA 1FCCC 4C8OA 2KJ5A 3NJTA 4BOSC 3Q3NC 4X57B 1MHXA 2ZCBA 5DPWA 2HMXA 2UVRA 2NTTA 3U2SC 2L1AA 2Z0EB 3IG5A 4EZLA 2L83A 5D2MB 5DB8A 4GDLA 3D2SA 5CRXA 5T14A 2MX2A 5AK4A 1XLQA 1WM3A 2W3SA 5D3DA 1UGJA 4NWIA 4M8MA 2WLBA 5KFTA 4MFFA 1C4PA 3ZNHB 3QXGA 2KDMA 1LKYB 5DBCA 1LGRA 1YX6B 2JVCA 1PGBA 1YD8U 1LFDA 4KLHA 3AM9A 3K1ZA 4Y2YA 3DV9A 2Y0SC 1NJYA 4C8LA 1GUAB 2MW5A 3HK0A 3R8BA 1UA0A 4J3OD 4YSZB 5KFDA 1TK0A 1TKDA 4RNMA 2XY7A 2PPHA 4HROA 3ONNA 5AI6A 4PH5A 1TIFA 2KX0A 5J0WA 4PYUA 1BPZA 2MJEA 3D2NA 2QEJC 4ED7A 1KFTA 4AJWA 2FMPA 4IOIE 4KLUA 3ETRA 1WGDA 2LXCA 2W8LA 3WAOA 3VTUA 3C1ZA 4J9LA 2W11A 2R18A 4M9LA 1D8LA 2AYOB 3LK9A 4QZCA 8ICIA 1WYGA 1BUIC 3MR3A 2Y1JA 1SGHA 4QNLA 2K8AA 3DBSA 3URYA 3A0HU 1MHHE 4EEWA 2BDPA 1SBBB 1ZD4A 2NBVB 3APFA 5CP2A 1MVKA 4XWWA 4DXFA 2G5IB 4US8A 1MJDA 3RCZA 2KSOB 4R8UB 3P42A 2VJ4A 1DOYA 3ZXVA 2F1JA 4U7CA 5FR3A 4DHJB 3MGHA 3Q69A 1GAQB 2YTUA 4WJNA 2NPTB 1IV8A 2H88B 2IJ0A 4YTMB 5J0TA 3GV8B 2EDUA 3ZJTA 2IY0B 4C8KA 1GC6A 2K4HA 3DCGA 3TL5A 3PLVA 3WKEA 3A1QA 4EX7A 4US9A 3JPSA 2J0JA 4PYZA 3V6KA 1WJNA 3HM3A 2AXTU 3O13A 4ARIA 2N9XA 3JPPA 1TZOA 3CSFA 3NZSA 3UMBA 1JW9D 1BPEA 4RNAA 2JH1A 4C0ZA 4C4TA 4F4YA 3RJIA 4DHJD 2IBIB 1AQ6A 2JX5A 1C3TA 3PHWB 1VZ8A 2FE8A 3BQ2A 2CS4A 3QJZA 2JZPA 4NPNA 1WGYA 3B2GA 1AN8A 3TIXA 3UXNA 2HVIA 1ZQRA 3R2TA 2HBMA 3HILA 2ZXHA 2C9WB 3NY5A 1KKXA 1FFVA 3WK5A 4YXJA 4KGRA 4UAUA 4QW9A 2FCQA 3MDAA 4DFPA 1X9WA 1WMHA 1J19A 1FXTB 3PZ7A 1J7BA 5FR6A 4XQ8A 2LYHA 2PI5A 4TMAB 4NXZA 2FJ6A 4PZOA 1T94A 1NYQA 3LB8C 4JV1A 1ZQQA 9ICBA 4RGTA 3SD7A 4RGOS 4ANVA 2ZZPB 4EZJA 4JB3A 2ZJ8A 4I2IA 4F5OA 3VUXA 3M7DA 4BAXA 5FKAC 2GO7A 2RDJA 3PPAA 2DPIA 1EM7A 1UBIA 2ZNVB 2JU6X 2PTLA 5C2TB 3Q14C 4BKGA 3PX0A 1T0SC 4Q43A 4DL4A 4BFRA 2ZTEA 3B08A 3A9JA 4F3OA 1SKSA 1C4CA 1D9FA 4MJSA 1WR1A 2JRHA 5LLIA 3RZWC 1PFDA 5CA7A 4DF4A 4WWOA 2DYOA 4LDTD 3HRDD 4UQGA 4DLEA 1X66A 1L3SA 2HD5B 4EEKA 2QB0A 2WTFA 4A55A 2PMZC 2CRXA 4C4VB 5L1JA 4F5NA 3ZJUA 4WJ3B 1Z1VA 1RFAA 3VR9B 3KKAA 1FO4A 4KN4A 5DPSA 1VZ7A 4GLSC 2BWES 2P6UA 3IM1A 2NRXA 2EMTA 2C28A 1ZE3D 3R66C 1LB2B 5AZFA 1PUZA 2N9PC 1L6UA 2BKRB 2ZPYA 2PKEA 9ICRA 1ZQZA 1X1MA 4W9GA 5F9LA 3B0XA 1TS2A 1QQ6A 1ET6A 9ICUA 5AM5A 1TAQA 4ICUA 3B9JA 2MH7A 1CZPA 4B0MA 1H8CA 1E8XA 3N28A 1OEYJ 2AWTA 4DL3A 4KGTA 2LGIA 2XGPA 2ZCCA 4YP3A 4XGAB 3RT3B 2KTQA 1ZQGA 3HKZF 4P7IA 4OO1J 2BS4B 1ZW7A 1IM4A 4DS4A 3TAPA 3ZNGC 8ICLA 3AEFB 3MC1A 1QSLA 4O3MA 2BW2A 3OHAA 5J2HA 2PMVA 5AKZA 4ELUA 2BQQA 3RAQA 2LYAA 5KG0A 1I4PA 1R4NB 4TKNA 4B9TA 3ZRFA 1ZQAA 3RNGC 4MGZE 2OHFA 5ALUA 3VH4B 4BXOB 3AU5A 2B0CA 4CF3A 4R66A 1WZ3A 4F4KA 3WKDA 1V5OA 1ZQUA 1RYUA 3IVFA 3QCAA 3TFRA 3VFKA 3PX6A 4QZHA 1SL0A 2NRVA 5AM0A 3R9KA 2BCRA 2PFPA 1OQYA 3F53A 4OCZA 3RUIB 3N97B 1SKRA 8ICXA 2NV3A 4RUAA 5JHAA 4R63A 3FDSA 3I5JC 3SR6A 1K1SA 2QB1A 3GIMA 2VRRB 2KHWB 3OLMD 2BCUA 3BVZA 1OTRB 1GPXA 5D7GA 4NM1A 1F0MA 2M8SA 3LXFA 1HJPA 3DVGX 1HTOA 1V85A 4ED3A 1QLBB 4FJZA 1V2YA 7ICIA 4OZAA 3EPGA 7ICPA 2G45B 2BB5A 4QIWF 4YD2A 2V3NA 2KMCA 2Z7JA 1DOQA 2ISOA 3SAHA 2BB6A 2WGSA 3S2AA 1ZQ1C 2XGQA 1ZQSA 1PUTA 7ICMA 4GGQA 1RYJA 1Q0WB 3A9JB 1ZQEA 2KOBA 1OXJA 4NY0A 5DG8A 3IG8A 3GZNB 3NOBA 5DCNA 4XA5A 2G1EA 2DUYA 5DGBA 4N59A 3KD3A 4UB1A 4NZLB 3W1SC 4HDOA 4HLEA 2LVOA 2AH5A 1VLBA 3SFEB 3ZTCA 4RT2A 3D32A 3RYTA 3E9SA 5KHQA 4FS2A 4GMVA 3QEAZ 4P2HA 2LGYA 2N7EA 2R8IA 5KFJA 1ZDXA 5J0PA 1F77A 3WIMA 4FZNA 8ICSA 3IHPC 5DG7A 1UWMA 3Q2AC 4QZ9A 1S77D 2UU7A 5BO4B 1X40A 3PO4A 4M0AA 3QUBA 2MRLA 4OJLA 4LJPB 2LBOA 3NVYA 1L5UA 5G5HA 4HPMB 2XI9A 2BQRA 4QWCA 2M19A 2MLBA 5G5GA 1S1QB 4ZYNA 3RZFA 2KNJA 4B95A 3QU2A 4GLXA 9ICWA 4KVGB 2LVPA 3WAMA 5BPCA 1L0YB 2GI9A 1TAMA 3NVZA 2AQ3B 1K5OA 2LM1A 2DAJA 3GILA 4S17A 2N1VA 4WJPA 5TZVA 4NJ8A 2HHVA 1TJEA 5AM2A 2XO7A 1HIWA 2B21A 4KDIC 3TMPB 3TEXA 2MJ3A 4USAA 1XCTL 2NVUI 1FEZA 4E74A 4FE3A 3DDHA 5AM1A 3DWGC 1S76D 3SFDB 2RDIA 4DL6A 2WDTB 1J0GA 2O6VD 2HOIA 4KSKC 5D94A 4I27A 2RDHA 4DF8A 3RFZB 2HBJA 5IIKA 2XY5A 2R8HA 4QZIA 3BQ7A 4RQ2A 4X5VA 4GXKA 1UNSA 1ZPSA 2M0NA 4ECQA 3HW8A 1D8YA 5AM4A 1P3QU 5AI0A 2E1FA 5C5JA 3OSNA 4PPXA 2H3VA 1YN3A 2EELA 5AI9A 1TAUA 2KDFB 9ICJA 3OGUA 1MI0A 1K1QA 2MJDA 4UBCA 5AK3A 3C28A 4M9NA 1EO6A 3WKAA 5AZGA 5AICA 3KVFB 1MN8A 1J7CA 1D5MC 4P16A 1JWBD 5E6JA 4MFAA 4I2AA 2MBBB 2REXA 3V6HA 1N61A 3PT2B 3M9OB 2KV2A 4LZDA 4IQTA 5DLFA 4GC7A 1CUKA 3HJEA 4MGYE 2V1YA 2HI0A 3IV6A 3ML9A 2VZKD 1C7YA 2FAZA 1C9FA 1WRDB 2MUTA 2D07B 4HJKA 4DXGA 1ZGUB 4RU9A 3WALA 2XVTA 2IO3B 4A3PA 1RQLA 1S10A 3Q3OC 4EYHB 4K7WA 4W9LA 2LVQA 4ZYSA 2IO2B 1ZQVA 4W9EA 3KH0A 4PT5A 5KFQA 2KFZA 8ICWA 4RQMA 3VRAB 5AM3A 4RM9A 1MFWA 3BZKA 5J0SA 3RJHA 1HA5A 3M95A 1TKGA 4DK5A 5DPTA 1WUDA 1AYFA 1YQ4B 2J52A 4G50A 1P1AA 3EWAA 3RJEA 2J0MA 4AJYB 4BVUC 4LNOA 3VVWB 5KFEA 3BJYA 4PL2A 4D2KA 1TS5A 3MC8A 4NNJB 5I4DA 3QK0A 3AI5A 5ALGA 3RNEC 4GN1A 2C5LC 2AQ2B 3HVDA 4C7YA 5CEHA 4J9OA 2CU1A 4NJ6A 4EZ9A 2K3UA 5KHOA 5MPOA 1TK8A 2MP2A 4IL6U 3KLSX 2K4IA 2WF8A 3R7QA 5CHWA 2YMQA 3AN1A 4BDPA 4CQNA 4WJQA 3TBLD 1TZ1A 2FPLA 2K0PA 1UF0A 1NK0A 5H2FU 2MBEA 3Q8SB 1XSPA 4RF0A 3TEZA 2K8HA 1IGDA 3ZIMA 4TUQA 1VJKA 4JIOU 3WK6A 2FCSA 4HEA1 4B6WA 2XCPA 3P4RB 3QEBZ 1Q3VA 3AE3B 3DDCB 2LHEA 1X9SA 5H8YE 3N4MB 2WF6A 2WX1A 2JV3A 2HJ1A 3LVWA 4CE6A 4FHKA 1FM0D 4C56C 3LWLA 5DB6A 5IIOA 2HDEA 2SAKA 3T79A 5KT2A 4DQOC 3ZLZA 1SE2A 1WCLA 3KYCD 1S97A 4G3XB 4HRSA 1BVSA 1WM2A 4IRCA 2WHEA 4IR9A 2GMIC 2W9BA 4XWTA 2Y5CA 4O3QA 1TY0A 4ZOHC 1U49A 1KLGD 4FXCA 2VA2A 5C0YA 3QWZB 1YOVB 3OTQA 1XQQA 2YEPB 3FKYA 1J2NA 3FYHA 1F52A 2KMDA 3OJSA 4CF5A 1N48A 2KFNA 1VRAB 2UVUA 1ZRMA 1XO3A 2IDYA 5AIBA 8ICPA 2W9CA 5KFAA 1WE7A 1DGJA 3TFSA 1XCQL 3JPOA 1FMAD 1OQQA 1SE3A 2PFQA 4QZAA 1QILA 2HHTA 4Y2JA 1D6EC 3BQ1A 1L7YA 3DBHI 2J53A 4ZRPA 5AUIA 3M8SA 2HSZA 4ECXA 1FNUA 4DWIA 2HOQA 3TJPA 1IP9A 1IXRA 2KNBA 1ET9A 2W43A 4RQ8A 5D6JB 3SHQA 4FZMA 2Y1IA 1ZQIA 2J0KA 2Y0SF 3DHHC 4URKA 5B5EU 1QT9A 3BQTA 4OZCA 3QU4A 9ICOA 2AHOB 2YEPF 2MWSB 3B0AA 5JZEB 5DG9A 4Y2PA 4RPXA 1QLNA 3EECA 3HIZA 3RNCC 1NK9A 3PSTA 1SV0A 2W9CB 4KLOA 4JL9A 2RLTA 4KLDA 8ICNA 4Y2QA 5KG3A 3KFUF 1BNOA 1ZQTA 3SV3A 1ZQJA 8ICQA 1WE6A 3LDAA 4MDKE 3BINA 4ANXA 4MEYA 2EQYA 2ZJDA 5L9XA 1WMHB 2PVOD 3IP4B 2ZUDA 5J0QA 1R4MI 9ICGA 1JWUD 2WXMA 2XCAA 5J2IA 2ASDA 5G2NA 3IT6B 3M63B 2N9LA 2KK0A 4AP9A 5A0LA 2AQ0A 2DZMA 2BCVA 3PSPA 7ICKA 1BT0A 4DHZB 2WF5A 3MTNB 1N2XA 3CWIA 2CHZA 2WXGA 4U6PA 1ZXHA 1ZUD2 3MGIA 2DKXA 1JALA 2JWUA 5IN7A 4IQWA 1GOZA 1V9JA 2ZIUA 1WI0A 1QQRA 2PFNA 5KFPA 2ZIXA 3MJWA 4WJOA 2F2AB 3H4BA 4G9BA 1V86A 5ALSA 3V6CB 2FDRA 3RULA 3WAPA 5AIAA 4P6VF 3QA8A 3SU8X 1AARA 3ZQ4A 4DDID 4ECTA 2BVCA 3N9YC 1NJXA 3SMVA 3NS8A 4AQ7A 3QZ8A 3L10B 1NKEA 2LJIA 1T0YA 4YQWA 1PVQA 2B76B 2SEBD 4KN7A 4Y2UA 1S3SG 2KVCA 2LZ6A 3B1LX 1TE2A 4IQUA 1L6NA 4I2CA 1WZ0A 2DENB 3LDZE 2ZIVA 4MT5A 5CHGA 2OEHA 4OW0A 5L83A 3L08A 2QJLA 4K3CA 4LLGM 2J6SA 3ISCA 2Y5PA 2BS2B 3A33B 1WGKA 3FAHA 1KQQA 1PVRA 2BDUA 2HHUA 4WQMA 2W54A 1WX9A 2OM6A 2VJ5A 4FHJA 2K60A 1L8LA 2BKFA 2HTME 1WX7A 2VZKB 2V9HA 2KMMA 2P35A 3IHQB 3N1ZC 7ICGA 3N1XC 4B9VA 3NGDA 1DOIA 4YT0B 3RRGA 2VA8A 4JK1A 2AL3A 4F4XA 1MQ3A 3TQ1A 1F5SA 2O2VA 3PW2A 1FXIA 2Y9TA 4JMUA 4KLIA 4BOZB 3NS1A 5KFYA 3LYYA 8ICGA 8ICRA 2FPKA 1IIPA 5L95C 1KFDA 2PXIA 1KBUA 3ZNZB 2JGAA 1ZQLA 3MHSD 5CX3A 5ALHA 8ICJA 3SV4A 5G55A 3RRHA 4C80A 4DFMA 1SE9A 2WS3B 3TADC 2BS3B 2N1WA 2OJRA 2XK5B 1ZQYA 3AE8B 4YMMA 3AE4B 3AH7A 1KSPA 1JWMD 1RFKA 3VQIA 1T3QA 1OW5A 3T3OA 2HHXA 4Y2XA 4QZGA 3C2KA 4L23A 4EZ6A 1KN5A 4RQ7A 3AEEB 1FCLA 1UBQA 3JSVA 1WY8A 2LWPA 3U30A 5C1ZA 2DBYA 2KP7A 9ICNA 2MQJA 3DBRB 2L32A 2EAPA 2CJOA 2KKCA 4YXDB 3HP6A 4NQKE 3NASA 2LM4A 5KFOA 2LHTA 4F93B 3QUQA 1WCNA 7ICJA 4TQRA 1QOFA 2ASLA 3B2FA 1Y8RC 2LGDA 4ECVA 1M6YA 5GMVA 3ALBA 2H3ZA 3RBEA 1NVID 5DGAA 2Q5WD 2XICA 2LRWA 2JZZA 8ICMA 1KLNA 2L5YA 2YY6A 1QCKA 5E6OA 3AEBB 2RDGA 4BXOA 4YL8A 4PGXA 1FEHA 1K52A 2Y9UA 2ZIXB 4N58A 4TQ1A 3VRBB 3PR4A 4KLEA 7ICLA 3BDPA 4BGDA 9ICXA 1UUPA 4L1BA 5AK6A 4FO6A 3V72A 1FRDA 4GFJA 2CPRA 3A9KA 1K50A 5HHDG 3NUHB 3X0WA 2FMSA 4ANWA 4ANUA 1WWTA 2NTSA 2G9HD 2ZPNA 5KAFU 1COOA 1YJJA 1V1PA 2KN7A 3C21A 5GXGB 4ELTA 5ALOA 4ACOA 2KTRB 4DEZA 4P4OA 3SAGA 2KICA 3GZFA 2R61A 1WGHA 3L0WB 3PVLA 4ED6A 2QARA 1QSSA 1A5RA 4I2BA 3UINB 1NI3A 2C2RA 1BXTA 3GDXA 3QX1A 5AI4A 3OWEB 5EE1A 3RNBC 3EYZA 3LJ3A 2WXLA 1UGMA 4MACA 2N9KA 2J6UA 1WRIA 1P7EA 4LTUA 1ZD3A 4LK0M 2W3RA 2F1IA 3IAM1 4UASA 1DYQA 4GC6A 1ROEA 1XSLA 5J0YA 3TI0A 2KQ7A 1ZQCA 2F76X 2G0AA 2J6TA 4M01A 1X6IA 3C1YA 5ALIA 5KL8B 2WXHA 1K8RB 3G6XA 1IBXB 1PGXA 2KZZA 2R8KA 1ZJMA 1KTKA 1S5LU 2HOFA 3PW5A 2V3SA 3C8YA 4TSSA 1B22A 2Q0ZX 3QARA 4JUZA 2KLCA 3D6JA 5KNIA 1ZQHA 1TT5B 2KN5A 2QCZA 1Z4OA 7ICTA 3I57A 1LV5A 4RF1A 1SZHA 5B66U 1J8CA 2R8JA 2V0GA 3IXSA 1T4GA 2HW3A 4P0QB 3QU9A 2KK8A 2RD0A 2ZVNA 5GTHU 3APCA 3IBEA 2IMWP 4PGQA 4CYEA 5DQIA 1TY2A 3JVZX 3G6VA 1TKYA 2ZJ5A 4FBUA 1ZJNA 1NBFC 3UM9A 2G4SA 2K22A 3L13A 4HWIB 1ZOLA 5J18A 1C4AA 4NJ7A 5AKGA 3VCBA 2C7MB 3C23A 1E8YA 1SF0A 4OJPA 4TUSA 2BGWA 1COKA 3WU2U 5ALKA 1Q10A 3DQVA 4IWQA 4J6IA 3N30A 2K25A 5IIMA 2ES6A 5DPRA 7ICQA 1LXDA 3PS6A 1HZ5A 1QOBA 5HMLA 3ZYYX 2VKQA 1L7NA 3A9KB 2C2DA 4EEYA 1GB4A 4DSJA 2FLNA 2DZJA 2ZUCA 1VR9A 3PMNA 1Z19A 1E8WA 1WX8A 3T5JA 3Q8PB 3NVWA 3P4PB 3H0MB 8ICYA 2INPE 2V3PA 3J81j 3VXWA 4YR0A 1QOGA 5J8YC 3GFKB 5AKYA 5J0XA 3P2BA 4ASWC 4B0EA 5KG1A 3M6ZA 2FUHB 1SV0C 1NOMA 2X38A 4PGYA 5J2BA 5LNK1 3MR5A 4WWPA 3SD5A 3V7KA 2FCNA 4F4ZA 3C2MA 2AGQA 1E7PB 3IT4B 4AWJA 2K8BA 2ZW0A 1U45A 2L0FA 3BYYB 4BBNF 4Y2RA 4NL9A 1ZP0B 4KLGA 4PHPA 4O5KA 3KKAC 3ECIA 2W55A 5BYSA 3W2DA 1CMXB 2V4IB 3EA6A 3BVGA 4EKUA 3R2IA 8ICZA 1WJUA 4RQNA 1EWYC 2KDBA 3EGRA 1MSWD 2WAQF 1ZYQA 1JMLA 3QNMA 5KFVA 1ZQMA 1F44A 1YN4A 2XNAC 2WF7A 3RFAA 1BGXT 2WXIA 3HT3A 3PV1A 3ETLA 1RM6C 2AJQA 4K3BA 9ICCA 4JLCA 1XF5L 2AQ4A 3QYPA 1JX4A 4AYBC 1XLNA 3BZDB 3EUB2 1WIAA 3RF9A 4TV3A 4F4WA 1I7HA 2RSUA 5J0RA 4W9JA 4IUMB 5CJ7A 2G06A 3RR8A 2RPQA 2O2VB 1EF5A 3Q8AA 3S6JA 2MUTB 3M9NB 3JYUA 3E2EA 1KFYB 4I6LB 4ED8A 2DAFA 5JU5A 1NI2A 4GXJA 3H4DA 2NRWA 4ECZA 3TADA 4EBDA 2GLSA 2HTHA 2I38A 3GE3C 1X9XA 2L76A 1V1OA 3W1SA 2C2EA 3A4RA 4RPZA 2JXJA 5KFMA 4Y2VA 2K9XA 3IRUA 1Z3EB 4KLMA 2QHOA 4C7ZA 2ON8A 5KG7A 3ZDMC 4LNFA 3V6JA 5C23A 9ICFA 1LQBA 3VUYA 2YQEA 4YMOA 1XC9A 5IIIA 2BKEA 1RYRA 2ZVOA 5J8YA 1NEKB 4KMOB 5ALZA 3KZXA 1NKCA 4OZBA 3KW5B 1QH9A 9ICEA 4YSYB 2RQ5A 3WCQA 2CJNA 1E6EB 2LGSA 2WXJA 4WWMA 1BPYA 3PTFC 2KVRA 4ACFA 3ORYA 3PHXB 3KWLA 5EE9A 1WWVA 4EZKA 4IQVA 1NNLA 2D10A 3DBLB 4GSWA 2ATLA 5E79U 1PK1A 4F71A 1T0QC 4GDKB 2TSSA 2WXRA 2GH1A 2VH2A 4F5PA 3K1RB 4YG2A 1TKEA 1C79A 1IUEA 2D11A 4DQRA 4UDUC 2LXAA 1SJHD 4CHKA 5J2EA 2JZ3B 2YX8A 4LZGA 5F9NA 3W5VB 4XZ4A 4KV2A 5KFUA 4FJVB 3D2QA 2NPTA 1SB3C 2PMZF 2JR5A 3PW0A 4B9MA 5DDMA 3NRWA 4XC2A 2LHDA 4RH6A 4ZDVA 1BPBA 2LFIA 1D5ZC 2XN9C 4UB3A 5IO9A 4ECRA 1D3ZA 4RUCA 3SDLC 2MA9B 2EAOA 4Q8EA 1KF6B 2LEKA 4MSQB 1TFRA 3N7RC 4QWBA 3KQ4A 1GG3A 3HM6X 1EU3A 3I63C 3PGEA 2YLMA 4II3B 4QW8A 3KHRA 2MBHA 3MJ5A 1SSNA 1TVAA 3N3KB 5GTIU 1QTMA 2W9AA 2LUMA 3AXCA 5J0OA 2BYTA 1NK7A 2BWFA 2BBCA 3KWVA 4A3OA 4AP4C 4O3PA 4P0QA 4OHJA 3T5HA 3RNAC 3F2DA 3V7JA 5HFYA 2DZIA 4DL5A 1UQVA 2LKYA 5IIJA 4P4MA 1JWSD 3R7RA 1N62A 2ZIUB 5KG4A 1NJZA 1I4RA 2WXFA 4FULA 2MAXA 1A77A 4UB2A 1TV9A 4LJXA 4KLFA 2WHIA 4C4VA 4EE2A 3WKBA 3LYSA 2VIXA 3A0BU 2I1QA 5E6NA 2JYTA 5KFNA 1C77A 4IS7A 5KG5A 3E0FA 2CXYA 2WB1C 3AEVA 4XRHA 1KLUD 4MJSB 3ZJVA 3MABA 2BR0A 3X23A 4A9AA 5AKHA 2OH2A 1ZDVA 3Q3FA 2X8XX 1ZQDA 1YIWA 1ZD2P 3RJJA 4C4SA 3GIKA 3QIJA 4LDTB 4MH0E 2BZFA 1N60A 4TQSA 4BKSD 1I42A 3CSTA 4MELA 1K51A 4I2JA 3C19A 4Q2JA 2V9WA 2KJRA 3QU7A 2J42A 3PSFA 3PV8A 2ZTDA 3WK8A 1EF1A 4MGKE 2JZBB 3IFWB 1E10A 5KG6A 5KFZA 3GZNI 4BUGA 3NRZA 2HHSA 1S0NA 4I28A 3WA0A 1L3UA 4Z6EA 3UGBB 4KMUA 1P7DA 2M1MA 4LJOB 2OEDA 5TR5A 1ZOYB 2MA1A 4E3CA 2QARB 2BQ3A 2XEWA 2KFJA 3QQ8B 1KDHA 4R64A 4F50A 1L6VA 1RWSA 3QU5A 3SAFA 5ALMA 1JUDA 4HPLB 2JEFA 5CHFA 3ZDEA 1F2RI 2KIVA 1PGAA 4W9FA 2Y5BB 4R65A 1ZQFA 4JWUC 4Z6DA 1O03A 4QZFA 3MGVA 1ZQPA 3LVVA 4BX9C 1HZ6A 3U26A 5FK9C 3ZDAA 1VZ6A 9ICMA 4TQ0A 5ALFA 4RQ0A 2IGGA 2K6QA 8ICCA 2G08A 5CHVC 2UVWA 3OHBA 3RR7A 3PR5B 4KX5A 1E7UA 3AEGB 5BMIA 4HJGE 5J2RA 3Q6BA 1HUOA 2AQ1B 1TBEA 3UMGA 1B0XA 5HG2A 5KFLA 2WXQA 3A1QB 5LXHA 2W82A 1Z00A 1KL9A 2OCEA 3Q8RB 2HBLA 4GIBA 1KRHA 1RAXA 1RRBA 1WSPA 2C22A 4BBNC 5J17A 1N63A 1V5TA 3ZD8A 4B9KA 3EZ5A 4CDGA 4B9UA 2KDEB 3L17A 3NTUA 4KX6B 1ZXIA 4DFKA 1U4AA 4DL2A 2E8MA 4YTNB 2A5UA 4IDIA 4ZRQA 4NLBA 4FA6A 4IG7B 1O08A 2L52A 4XX5A 1Y88A 5IILA 4IWOA 3V3XA 3ZXRA 1P9DU 4DFJA 3I9V1 4C8NA 2VA3A 5JH5C 1ZQWA 1UZXB 4OVVA 1Q5WB 1HEZE 4A8EA 5HR7A 1WR6E 8ICKA 2W7OA 4P1BC 5BOMA 4XDDA 3I28A 1CRXA 1XNSA 3HHMA 3AQEA 2JPHA 1FPYA 2Z59B 1XU4A 2HCFA 3SQIA 1Q3UA 2KKVA 2J7QB 5JXVA 2N7JA 4FBTA 3JW0X 2E1EA 1JXEA 2CU3A 4NY8A 3V05A 5DKWA 3JPNA 3C5GA 3Q8BA 2EKEC 1UA1A 2NO5A 1F2RC 1FNWA 9ICIA 4M02A 3EC8A 1DXSA 2FCMA 2GRIA 4OVUA 3GE8C 1XXGA 5E6PA 4M9GA 1D5XC 2IZVB 3THVA 5KT3A 4H2AA 2QMTA 1KRPA 1XEEA 1B9RA 4RT3A 2BCSA 2JEGA 4IR1A 1TGZB 5KT7A 3PRPB 2RP5A 4PZNA 1GJZA 1DK2A 3N32A 2YB4A 3H7PA 4XE0A 3L4PA 5AEKB 2M0AA 5ALWA 4KTQA 2DZKA 1LM8B 1AROP 2KWDA 2LMRA 4M2YA 4GU2A 2E6XA 1DGSA 1SIFA 3AE1B 4ECUA 2NMQA 3I76A 2KQ4X 4KDLB 1OFFA 1S0MA 1KTQA 2MCNB 1I35A 2K6DB 3UXOA 3IAS1 4DOAA 3ZDBA 2ZG6A 4RQ5A 1A76A 1WH3A 4ZHPA 2YMMA 7ICFA 5L1MA 2LI5A 2E8OA 1FRRA 3RPFC 4NM2A 2WQYB 2RHFA 1Z5SB 5HHHA 3NHEB 4FBJB 1XO1A 3H8SA 2RR9A 4RGMA 5AI8A 2I2YA 3Q8KA 4MEXA 4KGSA 5KTQA 4DWFA 4XDCA 3U52E 1HTQA 2K89A 1FXAA 2M0XA 4J03A 4BWMA 2AL6A 4J9QA 3VH3B 5DQHA 3MDCA 1AWDA 2PKOA 3M8RA 3OJ3A 3DHIC 4UB6U 4RMAA 1SL2A 2PEAA 3L16A 3TSSA 3V60A 1TYGB 4UATA 5KFXA 2W8KA 1L0VB 1YN5A 1Q46A 2A1JB 8ICFA 3H8JA 3LWMA 1MG4A 7ICUA 4REZA 3PO0A 3QZ7A 4YMNA 4KLQA 4M0WB 2GOWA 4K4IA 4E0DA 1B1ZA 3GU3A 3GIJA 3MR6A 5JUMA 1PK1B 4GDKA 8ICOA 5J2GA 2ONQA 1N6ZA 3ZDDA 3GOEA 1X42A 4G0NB 3DBLI 4HXDA 1NK5A 4KZCA 2A4ZA 4YXMA 1YZ6A 1V9PA 2JF5A 1WXMA 3ZGZA 4I2DA 5AKLA 4ECYA 4JWMA 3R3MA 3V62A 4FJYA 2FI1A 4O5CA 4GOCA 5CR0A 3SEIA 3V7LA 2NBWB 3AE9B 3I3TB 1NZBA 5HNKA 4QWEA 3DVNU 3BQ0A 1JXLA 1TTNA 2K8CB 4QWDA 4K7SA 1ECWA 3PREA 2PVGC 2BYVE 3T3NA 4JWNA 3DVNV 1S9FA 3RD2A 4CNQA 1FIQA 3MFHA 2F8KA 3K9OB 3PNCA 2AU0A 4KLJA 4PK1A 2KKPA 1DOXA 2CHWA 2I1JA 2QKQA 2F3NA 4UAZA 2KZRA 1U48A 1C1YB 3PRZA 2C7NB 1ESFA 4KSLC 4KLLA 4LVSA 1V49A 4RNNA 4DSEA 3RB4A 4OJ6A 5ALEA 4P1CC 3RN9C 3W5UB 1L7PA 3IDWA 5HHIA 3GB1A 1WXVA 3N7SC 5CB1A 3WKCA 3EFCA 2FIDA 3ICXA 2QIEB 8ICVA 4G11A 4Y2SA 4Q45A 2J4XA 1XWLA 3KYDD 4MGIE 1T8EA 2C60A 4JPSA 4M9HA 4W9KA 3AV8A 1RDFA 4PJ0U 1RG6A 4WURA 3J9CA 2KX3A 1U9LA 1V38A 1SJED 4HCPB 1Q1OA 3BYTB 3WK7A 2JUOA 3W9CB 2KEYA 1WXAA 1B4FA 3H9DA 4RGNA 1C20A 4IW0A 4EBEA 1F0ZA 4O3NA 5EWEA 4I29A 2ASJA 1L8OA 4MFCA 5HR6A 2ACZB 3K9PB 2JSVX 2JWZA 3HKZC 1C76A 3MFIA 1S8OA 4I2GA 4GIVA 1IPGA 4KIKB 3U4EG 2IHMA 4K81A 1YQBA 4M9JA 2Y3AA 4M00A 4C00A 2QC8A 3M62B 1WWUA 3JPQA 2FMQA 2DKZA 1UT8A 1KH0A 1TS4A 4FS1A 9ICSA 3KUDB 4J9KA 2JEIA 1RXVA 2WX0A 1E8ZA 3QAQA 2N9EB 2H3QA 4GXIA 4L2YA 3HVZA 3WANA 2PW9A 4RFBA 3DEEA 2KC1A 1J7AA 7ICSA 3H0LB 2AEHA 4WAFA 4B9LA 2H89B 1M4VA 4KKIA 1V1PB 2QB0B 2NR2A 4ICAA 4PHDA 2D8CA 1SXTA 1ED1A 1WGGA 4QZ8A 2BT6A 2DYMA 2V4RA 4KIKA 1J2MA 3VTVA 1JROA 1TK5A 2L8JA 2A3VA 4HDQA 5TSSA 2H3IA 4P4PA 1SV4A 4EBCA 1OEYA 2F77X 2DPJA 5H92C 3CP8A 1RQNA 2L05A 2WXNA 5KG2A 2D3BA 1UHUA 5J0UA 2B3AA 3VHTC 4WWNA 1QOAA 1TS3A 1X9MA 2FLLA 4J9SA 2WXPA 4RZRA 3Q8LA 2C7HA 1QSYA 4KKJA 4IRDA 2FNJB 1EWCA 4QZEA 4MSMB 4MH8A 3TACB 5FP0A 4QIWC 3ZD9A 3FILA 3M6KA 2DWQA 2ASQA 5DBBA 2LRUA 1YNTE 1ZQNA 5KFKA 1QQ5A 3MFGA 4NLKA 1KEJA 2K8CA 3P63A 1WXSA 4JX1C 3CW2C 2RGFA 3EHVA 2AGPA 1V81A 8ICBA 1ENFA 2IHNA 4O9MA 5ALLA 3V6EB 2PFOA 1AW7A 2G4DB 4HVBA 1V97A 2LI6A 2DNFA 3ZRCA 4F91B 2P66A 2D2QA 2VANA 2LJ5A 8ICEA 7ICHA 2A19A 2KWVB 1MC8A 5J2DA 4ZH4A 4BWJA 3TEYA 4PHAA 5JTIA 3UPQA 4BKSA 3H8WA 3W1YA 1SEBD 2IPKD 3OJUA 5D3IB 3U8ZA 4QJFB 3AU2A 1VDVA 2ZNVC 2KT7A 3P1MA 5F3XB 1IBXA 2IOHA 2QSDA 1D9DA 2PI4A 1L0XB 1B43A 2GBNA 2CR5A 2A1JA 1I4GA 1R4MB 4A6QA 4P0PB 3ZDCA 1RYSA 1G6JA 2FUG1 4YCXA 2HHWA 1UELA 1C78A 2JY6A 3DBHB 3L3FX 3UXPA 3ENEA 2I5HA 2JXXA 2ALZA 4MF8A 2M4NA 2KVSA 5AK5A 2V4QA 3KOOA 1N5XA 3MP9A 1VJ5A 2W9MA 2HHQA 9ICVA 5ALVA 4M0WA 4DBGA 9ICAA 2KSOA 3O0FA 4II2B 2WWZA 4DSLA 3Q3JA 4IKGA 1S0VA 3PZ8A 3ZO5B 2NCNA 5L1LA 3K4GA 2LUEA 2D3DA 2E5SA 2CHXA 3DOWA 1YJIA 2BGFA 5BYQA 3C29A 3Q8MA 1JIHA 2XK5A 3PW4A 2IOFK 4RQ3A 2RPVA 2KE7A 2ZXIA 4BKTA 2G07A 2ZEQA 4IM0A 1HQRD 4EELA 4NJCA 2L7RA 4IRKA 1SGGA 4NLZA 1RPLA 1YJ1A 4HCNB 2KZ3A 3AE6B 5EWGA 1Z2MA 4F8CB 3CRXA 4P0PA 3VDZA 1CJEA 3TUOA 1NYRA 5KFHA 4F7ZA 1A0PA 5J2KA 4UBBA 2EH9A 4F2RA 3MR2A 1K53A 4ITKA 4HYKA 2EZXA 4DQQA 4B6JA 5AKEA 5KFRA 2I1KA 1ZETA 2KDIA 3AMZA 5CTRC 4A90A 2D3GA 3Q3MC 3H7PB 5KT6A 2WU5B 2XIDA 2R2QA 4G3IA 4R3DA 8ICHA 1I4QA 4J9NA 5DQGA 2QLTA 4NLCA 2IGDA 5KAIU 2F8LA 2BPCA 4Q44A 4LNNA 5KFWA 2YVCA 5AZHA 2JQRB 1NJWA 2JRZA 3BS7A 4M8NA 2KG5A 2MHJA 5JHBA 2EANA 3UQ0A 2WDQB 3T9LA 1CEZA 1JRPA 2WF9A 4WAAA 1VD2A 4UB5A 2KYWA 2HJ8A 4ELVA 2F1HA 2ZIVB 3JSVB 2KN4A 1LKYA 4F5RA 1JRUA 2MRPA 3M1YA 5ALDA 3BZCA 4NLGA 1X2IA 2M56B 2KACA 2NRTA 2G5HB 1H4RA 1OUQA 2GWSA 4DHZE 3ISDA 4B9SA 3RJGA 2OOBB 2RDBC 1IG6A 3F2CA 2OWOA 5HKHA 1JCKB 3FILB 1ZD5A 4GDLB 2KJHB 3PSEB 4J9PA 4A20A 3T8MA 3RJKA 2MU2A 1F1HA 2LGXA 1ISNA 4FN2A 4I2EA 4F72A 4NAWA 1D4BA 2XY6A 3F2BA 2WDRB 2RRDA 2LYBA 1S0OA 2ODGA 2DHZA 2ICIA 4YVZA 2AGOA 3NZ3A 3HUIA 3PRMB 5IAAC 4XYCA 3CIRB 5AUKA 2KQSA 3BWUD 3OPXA 2IA6A 4O3SA 2L0TA 4AUQC 1Q8KA 3U7DA 5LXIB 2CN1A 2W03A 1XS9D 1U4BA 3H40A 5IKCM 1WF9A 8ICTA 2PE6B 2JRIB 4A8XC 3ZW3A 5DBAA 1A70A 3ZTDA 1L4ZB 3UMCA 1SXDA 4EYIB 2R2OA 4EX6A 4ICVA 1L5PA 4NV0A 1YX5B 4CO7A 5EDSA 3KHGA 1YQ3B 5L1IA 3GIIA 5IP4D 8ICUA 3KUZA 2E3TA 3DPDA 2YMPA 4HK2A 4XUSA 5IOIA 3DHGC 3TEWA 4YR2A 3PZPA 1MQ2A 1GNUA 3PO5A 1RLFA 3NG0A 3EFUA 2FE9A 1STEA 4B9NA 4O5EA 2KC2A 2KJ9A 1QF6A 3PMLA 4UB4A 4KLSA 2K4EA 3PX4A 2KANA 2OJWA 4WIPA 4ZRJA 5ALNA 1Y56A 4DOBA 1E0ZA 3AEAB 1HEKA 2RMMA 2KHQA 1SWWA 4C4RA 1NKBA 3QHTA 5ALRA 1HUZA 3AE2B 2E8PA 4FZLA 3SI8A 2LD9A 2FLPA 1JQ4A 2JYEA 1Z00B 3RMKC 5D4BA 4RNOA 3K75D 5KFFA 5BOLA 3H8HA 3P4SB 4KZ0A 4Z6CA 1Z1BA 4W9HA 2W04A 1SXEA 3BS5A 3I1YA 2O6VA 1OGWA 3AULA 4ZRIA 2N1RA 2DQNB 2W7PA 4GXBA 3OG5A 3ZNID 2KMAA 3IN5A 1P7FA 1NZPA 4WQOB 2GBRA 3GP7A 3RB3A 1MA7A 4PS7A 5KT5A 3ZKJC 3APDA 4EOYA 1T7PA 3M9MB 2W9NA 1BPXA 2N7DA 2WFAA 4NAWB 2WB1F 4J9RA 2DLBA 3KBBA 4RCOA 2Z8LA 3PLUA 3KZIU 3OSPA 8ICAA 2HDOA 4W9DA 1JWAD 2GLEA 2BHNA 2LPEA 2DYBA 1PZNA 1QKZA 2JZBA 4MF2A 2DFLA 3RB0A 2IOFA 4UARA 3AEDB 2IO1B 5AKKA 5AKIA 1L7OA 4JV2A 2GBKA 2KD0A 3QUTA 3RNFC 5J2CA 1CK1A 3JPRA 2PJHA 2GB1A 1L7MA 2B6GA 4MHVA 3M3JA 3MHZA 5DDYA 1UD7A 2BYEA 4RM8A 2V4LA 9ICQA 2PLPA 3TKAA 5HP4A 2DL0A 1GO3F 4KX3A 1RXWA 2IYDB 5EOZA 3ZDTA 7ICRA 1YT3A 4F5QA 2FBWB 4DO9A 1A6SA 1YZ7A 3QUCA 2JMGA 4RPYA 1I4HA 1H38A 9ICLA 4RQ4A 4ED1A 2N0SB 1RZTA 3L5KA 2YB1A 3F5EA 3N20C 4GB9A 5BMGA 1U47A 2I9GA 1OQRA 3C5FA 2PIAA 5JRTA 4O3OA 1GC7A 3OAWA 3ONSA 1UPHA 4W9IA 1N5WA 2MP2B 2ZIWA 4TURA 4FFDA 5K4LA 1T3NA 1UWXA 5KL1B 5J2FA 1WG8A 2WXKA 4Z6FA 4I6NB 1NK4A 2KJ8A 1N56A 1BMLC 2KTFA 2IY1B 5DLGA 2BTEA 1KJTA 3GV5B 4YR3A 3EW9A 2JT4B 4OJOA 4ED0A 1FD6A 4QZDA 3DWMA 2LASA 4OJ5A 3BK1A 1R7SA 1MG8A 3ED5A 2EZZA 9ICPA 2KAJA 2K4PA 4ECSA 1SZPA 4O1NA 4QZBA 1ZQKA 4YTPB 4MM3B 1QZEA 4DDGD 4I2FA 2QILA 3C2LA 4WH4A 3TCAA 3ZUNA 3FM9A 5ALQA 3AB5A 3VTWA 2MEKA 9ICHA 2NS5A 4DXAB 2P6RA 2ZW1A 1EU4A 2BF8B 2XBBC 4IM3A 3PVXA 1JMSA 4RQ6A 4IC7B 2BPFA 2Q4TA 4EENA 3SZ2A 3IG3A 3RBDA 1EXNA 5EE3A 3N7PD 3SENA 1WYWB 3E58A 1XLOA 3PSIA 3AE7B 5T8IA 4KITB 2GOLA 5BYRA 3ABVB 2M17A 3MBYA 2I6XA 2D3CA 4LNIA 2UYZB 3C0RB 5ALJA 2FIFA 2IO0B 3UI3A 3HX0A 1CQVA 1UH6A 2G3QB 1E5WA 2NBUA 5L1KA 4DSKA 5C3JB 4I6PA 4LCDE 4J9MA 3UF8A 1I4XA 1SE4A 5EE0A 3SEBA 4F8RA 3AL0B 2NYVA 4LNKA 2GBJA 2WDVB 2EAMA 2EZYA 1P0RA 2KFKB 1IYFA 5D49A 2VH1A 1JI7A 2H3FA 3BIID 4JQWC 1R4NI 2WXOA 3A4SC 2IBKA 2JHDA 1YMHE 2N4FA 3NVVA 4CCHA 1PQSA 1L2NA 4TUPA 3Q8QB 3PZDA 1SIJA 2Z0DB 4JE3B 1ZQOA 5ALPA 5KFGA 3KHLA 1BNPA 3JPTA 3UQBA 4JWSC 2K1FA 2KOXA 3RI7C 1NENB 4HKZE 3VC8A 5KT4A 1X6JA 3DBRI 2DX5B 2OYYA 2AX5A 4NL9C 3KUCB 2BCQA 3BY4B 2NRZA 4CGZA 2JXTA 4MM3A 4DSIA 1VCBA 4DCCA 3MC9A 3RH5A 3UIOB 3AE5B 3SYZA 2KFKA 2NO4A 3WK9A 3RAXA 1ZQBA 4AYBF 2BPGA 1NDDA 2K39A 3QC8B 3FC4A 3VAWA 3TARA 2MBOA 2F44A 2O6KA 3T3FA 5AKXA 4M47A 4I2HA 3O65B 3H7IA 3T5KA 5EWFA 1MPEA 1V6EA 2D3AA 2KO3A 4W9CA 3PY8A 1NK8A 1F9JA 3H0RB 4O0IA 2UVVA 3ML8A 4F92B 2WNMA 3NZUA 5AKJA 2ZIWB 1ACCA 4UAYA 5KFSA 1L3TA 2KXJA 1KW4A 3ZI4A 4YD1A 3B0YA 4M6WB 3L54A 3HWTA 2KHVA 4NQLB 4PHEA 5AHXA 4HPPA 2WYQA 5KFCA 4PL1A 3G6YA 3GV7B 1GB1A 2HVHA 3CMMB 4NLNA 1SL1A 4YSXB 3UQAA 1WJ6A 1ZKHA 3CYMA 3UIPB 4Q8FA 4NAMA 2MSED 5HI1A 5ALTA 4DFDA 3P4QB 1KLVA 2K8BB 4ECWA 4JGHB 3EPIA 4KLTA 1T0RC 3VR8B 1ZQXA 4M04A 1WGRA 2EKIA 3Q8CA 1PK3A 3RH4A 2R8GA 5ALYA 1L3VA 3AUOA 2KLGA 2KVZA 1V8CA 3QE9Y 7ICEA 4K1RB 1L4DB 2WU2B 3CNHA 2XC9A 2BQUA 3KTQA 1T6BX 1NK6A 5J2JA 4ED2A 2KIWA 4PS8A 1LO5D 2LMCA 2INNE 2KWUB 1XLPA 3OJ4B 4FADA 2WAQC 4EFOA 3RB6A 3T5LA 2FPMA 1M94A 3BVMA 2L3ZA 4F1SA 3Q8FA 2KWCA 3HPOA 1D8BA 3KHHA 3ZVVA 2HBKA 1XT9B 2DF4B 4O3RA
chains in the Genus database with same CATH topology
1E9MA 1EWCA 4MH8A 2VZKD 1C9FA 3Q8AA 3FILA 2DWQA 1KFYB 4HKQA 1YNTE 4DXGA 4YWGG 3MFGA 4ZHOA 3P63A 2I38A 4JX1C 3W1SA 1V1OA 4ZYSA 4PT5A 1FNVA 3VRAB 2K9XA 1ENFA 3MC0B 1AW7A 1HA5A 1PDXA 1TKGA 1V97A 4C7ZA 1T5XD 2ON8A 3AECB 1AYFA 2WP9B 1YQ4B 2J52A 1NEKB 3TEYA 4OZBA 4YSYB 4D2KA 1TS5A 5I4DA 1SEBD 2IPKD 5D3IB 4N6EB 3WCQA 1VDVA 2AQ2B 2CJNA 1E6EB 3P1MA 2WXJA 3HVDA 4C7YA 4WWMA 2QSDA 1IBXA 2K3UA 5MPOA 1L0XB 3E56A 3KLSX 1I4GA 3KWLA 5EE9A 2D5GA 4AS1A 3AN1A 2FUG1 4CQNA 1C78A 2K0PA 4GDKB 2TSSA 1PYWD 4RF0A 2WXRA 3BK2A 3TEZA 1IGDA 1N5XA 3MP9A 1VJKA 4M0WA 1TKEA 1C79A 4HEA1 1IUEA 4UDUC 3Q8EA 1SJHD 5BMHA 3P4RB 2IGHA 3AE3B 5H8YE 2LHEA 3W5VB 4IKGA 3PZ8A 4C56C 1FM0D 3U7ZA 1SB3C 2HDEA 2SAKA 1YJIA 5BYQA 4DQOC 2LHDA 1FFUA 4RH6A 1SE2A 2LFIA 2RPVA 1D5ZC 2XN9C 4ARCA 1HQRD 4NJCA 4HRSA 1IGCA 1KF6B 4OVZA 2LEKA 4XWTA 2Y5CA 1TY0A 3KQ4A 3AE6B 4ZOHC 1KLGD 1HXYD 1EU3A 1CJEA 4FXCA 3TUOA 1NYRA 3MJ5A 1SSNA 1K53A 4ITKA 3GS2A 2K5PA 2YEPB 1WXQA 1FCCC 2LUMA 2BYTA 1MHXA 3KWVA 2BBCA 2NTTA 3U2SC 3AMZA 4OHJA 2L1AA 4A90A 1VRAB 1XO3A 2IDYA 2WU5B 5HFYA 2L83A 4R3DA 1I4QA 1DGJA 1JWSD 1XCQL 1N62A 2IGDA 1FMAD 1I4RA 2WXFA 1OQQA 1SE3A 2JQRB 1XLQA 1QILA 2W3SA 5D3DA 4EE2A 1D6EC 2WDQB 1UGJA 5AUIA 2J53A 2JYTA 2WLBA 1C77A 4ZRPA 1JRPA 1C4PA 2KDMA 1FNUA 2KN4A 1KLUD 3ZJVA 1ET9A 1PGBA 2M56B 4A9AA 1ZDVA 2KACA 1QT9A 4OZCA 3AM9A 2YEPF 3R8BA 4YSZB 1JCKB 4J3OD 3FILB 1N60A 4HROA 4GDLB 1K51A 2MJEA 4Q2JA 2QEJC 2J42A 1D4BA 4IOIE 3ETRA 2WDRB 1E10A 3NRZA 2ICIA 3NZ3A 3HUIA 2PVOD 3CIRB 5AUKA 3BWUD 1BUIC 1WYGA 1JWUD 2OEDA 2WXMA 1ZOYB 3IT6B 3URYA 2N9LA 1RWSA 1L6VA 1MHHE 4A8XC 1SBBB 1MVKA 4XWWA 4DXFA 1F2RI 1PGAA 4US8A 1A70A 4JWUC 3P42A 3CWIA 2WXGA 1L4ZB 1DOYA 1ZXHA 1ZUD2 1L5PA 1JALA 1HZ6A 2JWUA 5FR3A 1YQ3B 5FK9C 1GOZA 1VZ6A 3Q69A 1GAQB 1QQRA 4TQ0A 2E3TA 2H88B 2IGGA 2IJ0A 4YTMB 3TEWA 3ZJTA 1STEA 3AEGB 5BMIA 1QF6A 4HJGE 4US9A 2AQ1B 4P6VF 5HG2A 2WXQA 4WIPA 3ZQ4A 3O13A 4ARIA 1Y56A 2W82A 1E0ZA 3AEAB 3N9YC 2RMMA 1KRHA 1TZOA 1WSPA 1JW9D 3AE2B 4AQ7A 1N63A 4RNAA 1JQ4A 2JYEA 3H8HA 2LJIA 3P4SB 4KX6B 1ZXIA 2B76B 2SEBD 2JX5A 1VZ8A 4YTNB 2FE8A 4IDIA 2JZPA 4ZRQA 3B2GA 1AN8A 4MT5A 2L52A 3V3XA 4OW0A 3I9V1 2QJLA 4LLGM 3R2TA 1HEZE 1P7FA 1FFVA 2Y5PA 4KGRA 2BS2B 3GP7A 1WGKA 3FAHA 4XDDA 4WQMA 3PZ7A 2W54A 1J7BA 4TMAB 1NYQA 3LB8C 4RGTA 2HTME 2VZKB 4RGOS 4NAWB 5JXVA 2KMMA 2N7JA 5FKAC 2CU3A 1DOIA 1EM7A 2DLBA 4YT0B 3V05A 4RCOA 2JU6X 2Z8LA 2PTLA 5C2TB 3Q8BA 1F2RC 1FXIA 1JWAD 1FNWA 3NS1A 1QKZA 1C4CA 3LYYA 2GRIA 1PFDA 3AEDB 1XXGA 2DYOA 1D5XC 3HRDD 4H2AA 2QMTA 4C80A 1CK1A 3AE8B 2WS3B 1XEEA 2BS3B 2GB1A 3MHZA 3AH7A 4A55A 3ZJUA 3AE4B 1B9RA 1JWMD 1RFKA 3VR9B 3VQIA 1T3QA 1FO4A 3T3OA 2PLPA 4L23A 1VZ7A 4GLSC 4XE0A 3AEEB 1FCLA 3L4PA 1ZE3D 2M0AA 2DBYA 1L6UA 2FBWB 2KWDA 2L32A 4KKJA 2E6XA 1I4HA 3AE1B 2CJOA 1TS2A 1ET6A 2N0SB 4YXDB 2NMQA 3B9JA 2MH7A 1CZPA 5BMGA 4B0MA 1OQRA 2KQ4X 4KGTA 1OFFA 2PIAA 2LGIA 1QOFA 3B2FA 1N5WA 3IAS1 1UWXA 2BS4B 1NVID 2WXKA 2Q5WD 3AEFB 4ZHPA 1BMLC 2BTEA 2BW2A 3AEBB 2RDGA 2PMVA 1FRRA 3RPFC 1FEHA 1K52A 2WQYB 1I4PA 4N58A 4TQ1A 3VRBB 1FD6A 3DWMA 4RGMA 2I2YA 1UUPA 4L1BA 3BK1A 1R7SA 4KGSA 2OHFA 1FRDA 2KAJA 4XDCA 1K50A 5HHDG 3NUHB 4O1NA 1FXAA 3U52E 1WWTA 2NTSA 2G9HD 4MM3B 4YTPB 1YJJA 1V1PA 5GXGB 2QILA 4WH4A 1AWDA 2PKOA 3AB5A 2MEKA 2R61A 3TSSA 1TYGB 2ZW1A 1EU4A 1NI3A 1L0VB 1YN5A 1BXTA 3OWEB 5EE1A 4REZA 3PO0A 2WXLA 3SR6A 4MACA 1B1ZA 2N9KA 5EE3A 1WRIA 1P7EA 1XLOA 3AE7B 3BVZA 4LTUA 5T8IA 4LK0M 1GPXA 2W3RA 5D7GA 3IAM1 5BYRA 1DYQA 3ABVB 2ONQA 1ROEA 3LXFA 1QLBB 3UI3A 2WXHA 4OZAA 1IBXB 3ZGZA 1PGXA 1CQVA 2BB5A 5C3JB 1KTKA 2V3NA 3AE9B 1I4XA 1SE4A 3C8YA 4TSSA 5EE0A 3SEBA 2BB6A 2WDVB 1PUTA 1RYJA 2PVGC 3BIID 2WXOA 3T3NA 1YMHE 1FIQA 2G1EA 3NVVA 3I57A 4N59A 4RF1A 4JE3B 1SIJA 4NZLB 2V0GA 3IXSA 1DOXA 1VLBA 4JWSC 3SFEB 1NENB 4HKZE 3E9SA 1ESFA 1TY2A 2AX5A 1TKYA 3W5UB 2K22A 1ZDXA 2JXTA 1F77A 3GB1A 1C4AA 2QIEB 1UWMA 2J4XA 3AE5B 1SF0A 1Q10A 4JPSA 3FC4A 3AV8A 3NVYA 4WURA 5G5HA 3J9CA 1SJED 2M19A 1MPEA 3BYTB 5G5GA 3W9CB 1HZ5A 1QOBA 3ZYYX 4RGNA 1L0YB 2WNMA 2GI9A 3NVZA 2AQ3B 1F0ZA 1GB4A 1ACCA 1VR9A 2ACZB 1TJEA 2JSVX 3NVWA 1C76A 3P4PB 3TEXA 2V3PA 2INPE 1QOGA 3U4EG 2MJ3A 4USAA 1XCTL 1GB1A 2Y3AA 4YSXB 3DWGC 4B0EA 3SFDB 4NAMA 1KH0A 1TS4A 2X38A 5HI1A 5LNK1 3P4QB 2RDHA 3RFZB 3VR8B 1E7PB 3IT4B 3HVZA 4L2YA 2PW9A 2ZW0A 2EKIA 3Q8CA 3BYYB 4RFBA 1J7AA 4WAFA 1UNSA 1ZP0B 1ZPSA 2H89B 1M4VA 4KKIA 1V8CA 1V1PB 2W55A 5BYSA 3W2DA 1L4DB 2V4IB 1SXTA 3EA6A 2WU2B 2BT6A 2DYMA 1T6BX 3BVGA 1YN3A 2EELA 3R2IA 1JROA 1MI0A 5TSSA 1EWYC 2MJDA 1LO5D 3EGRA 1JMLA 2LMCA 1YN4A 2XNAC 2INNE 1XLPA 5H92C 1J7CA 2WXIA 1RM6C 2WXNA 1D5MC 4P16A 1JWBD 5E6JA 3BVMA 1XF5L 1N61A 3Q8FA 1QOAA 1TS3A 1XLNA 3BZDB 3EUB2 4A6QA 2WXPA 1I7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3S A;  1E9M A;  2WDQ B;  5C3J B;  2CU3 A;  5AUI A;  1DOI A;  2WLB A;  1JRP A;  3AE9 B;  4YT0 B;  5EE0 A;  5C2T B;  2DWQ A;  1KFY B;  2WDV B;  1PUT A;  1FXI A;  1JWA D;  1RYJ A;  4ZHO A;  3P63 A;  3NS1 A;  2M56 B;  4A9A A;  2PVG C;  1QT9 A;  3BII D;  4JX1 C;  3AM9 A;  1PFD A;  3AED B;  1FIQ A;  2G1E A;  3NVV A;  4YSZ B;  3VRA B;  2K9X A;  1N60 A;  3HRD D;  4N59 A;  4HRO A;  1SIJ A;  4C80 A;  2MJE A;  1PDX A;  1TKG A;  1V97 A;  4C7Z A;  1VLB A;  2BS3 B;  2WS3 B;  3AE8 B;  3AEC B;  3AH7 A;  4JWS C;  3AE4 B;  3SFE B;  1B9R A;  3ETR A;  1NEN B;  1RFK A;  2WDR B;  3VR9 B;  1T3Q A;  1AYF A;  2WP9 B;  1FO4 A;  1YQ4 B;  1E10 A;  3NRZ A;  1NEK B;  2AX5 A;  1TKY A;  3HUI A;  2K22 A;  3AEE B;  3W5U B;  3L4P A;  2PVO D;  3CIR B;  5AUK A;  4YSY B;  1WYG A;  2QIE B;  2DBY A;  1L6U A;  1ZOY B;  2FBW B;  4N6E B;  1UWM A;  3WCQ A;  1VDV A;  3AE5 B;  1SF0 A;  2CJN A;  1E6E B;  3P1M A;  4WWM A;  4C7Y A;  1RWS A;  2CJO A;  3AE1 B;  1L6V A;  2N0S B;  3FC4 A;  4YXD B;  3AV8 A;  5MPO A;  3B9J A;  3NVY A;  2MH7 A;  5G5H A;  1CZP A;  3KWL A;  5EE9 A;  4US8 A;  1A70 A;  2M19 A;  1OQR A;  4JWU C;  3AN1 A;  5G5G A;  1OFF A;  3CWI A;  2PIA A;  3W9C B;  1QOB A;  1QOF A;  3ZYY X;  3B2F A;  1ZUD 2;  1DOY A;  1N5W A;  1L5P A;  1JAL A;  3NVZ A;  1F0Z A;  1YQ3 B;  2BS4 B;  2ACZ B;  1GAQ B;  1NVI D;  1TJE A;  2E3T A;  2H88 B;  2Q5W D;  1N5X A;  4YTM B;  1VJK A;  3NVW A;  1TKE A;  3AEF B;  1IUE A;  3P4P B;  4ZHP A;  1QOG A;  3AEB B;  2MJ3 A;  3P4R B;  4USA A;  1FRR A;  3AE3 B;  3AEG B;  3RPF C;  1QF6 A;  2WQY B;  5H8Y E;  4N58 A;  3VRB B;  3W5V B;  4US9 A;  4P6V F;  4YSX B;  1FM0 D;  3DWM A;  3DWG C;  3SFD B;  1SB3 C;  1R7S A;  1YJI A;  2OHF A;  1FRD A;  2KAJ A;  3AEA B;  3P4Q B;  1E0Z A;  1KRH A;  1FXA A;  1FFU A;  1WWT A;  1JW9 D;  3AE2 B;  4YTP B;  3VR8 B;  1YJJ A;  1E7P B;  3HVZ A;  5GXG B;  1N63 A;  2EKI A;  1AWD A;  2PKO A;  1JQ4 A;  4HRS A;  1J7A A;  3AB5 A;  1ZP0 B;  3P4S B;  2H89 B;  4KX6 B;  1ZXI A;  2B76 B;  1KF6 B;  1V8C A;  2JX5 A;  1TYG B;  2LEK A;  2W55 A;  4YTN B;  2Y5C A;  1NI3 A;  1L0V B;  4IDI A;  3AE6 B;  4ZOH C;  3B2G A;  2WU2 B;  1CJE A;  2BT6 A;  4FXC A;  1NYR A;  5EE1 A;  2L52 A;  3PO0 A;  1JRO A;  4ITK A;  2K5P A;  2QJL A;  3SR6 A;  1WXQ A;  1EWY C;  2MJD A;  5EE3 A;  1WRI A;  4LTU A;  1XLO A;  1FFV A;  3AE7 B;  1GPX A;  2W3R A;  2BS2 B;  1XLP A;  3ABV B;  3AMZ A;  5H92 C;  1J7C A;  1WGK A;  3FAH A;  1ROE A;  1RM6 C;  1XO3 A;  3LXF A;  1DOX A;  2WU5 B;  1JWB D;  4WQM A;  2W54 A;  1J7B A;  2L83 A;  1DGJ A;  1QLB B;  1N61 A;  1N62 A;  1FMA D;  1NYQ A;  1QOA A;  1XLN A;  1OQQ A;  2HTM E;  3LB8 C;  3EUB 2;  2JQR B;  1XLQ A;  2KMM A;  1I7H A; 
#chains in the Genus database with same CATH topology
 1E9M A;  4DL7 A;  3AU6 A;  2E8N A;  4YFK A;  2CKH B;  2UWQ A;  5HMM A;  3QX7 A;  2ZJA A;  5AI5 A;  4BZA A;  4HKQ A;  4UAW A;  4YWG G;  1QQ7 A;  4ZHO A;  2MBQ A;  4QWA A;  3H1U A;  2HE7 A;  4IC9 A;  4N9F 4;  4K7U A;  1V80 A;  3N1Y C;  2A1A A;  2ESE A;  3RJF A;  1DK3 A;  1FNV A;  4DLG A;  2KTR A;  4ZRK A;  3AQF A;  4HAI A;  2IND C;  3MC0 B;  3NUQ A;  1PVP A;  1SKW A;  1JN3 A;  4F2S A;  1PDX A;  3AEC B;  1T5X D;  3WK4 A;  3ISB A;  4UW9 A;  2GBM A;  1KFS A;  4K4G A;  1J97 A;  2WP9 B;  1ZRN A;  1BPD A;  9ICT A;  4C8M A;  3TAQ A;  1SWV A;  1E90 A;  3DVG Y;  2KD1 A;  4DQS A;  4N6E B;  4K4H A;  2O6V B;  5ALX A;  1XD3 B;  1UCV A;  2KZM A;  3F5A A;  1E7V A;  1URJ A;  5CWR A;  3TAN A;  7ICN A;  7ICV A;  2ISP A;  3E56 A;  1P98 A;  5D46 A;  1WJ4 A;  2M9N A;  2OXO A;  4IM2 A;  2D5G A;  4JV0 A;  4DS5 A;  1CI4 A;  3AU4 A;  4AS1 A;  2KJ6 A;  3H6N A;  4CF4 A;  2W9B B;  4E71 A;  1EUV B;  1KM7 A;  2YML A;  1WFY A;  4BJQ A;  1HE8 A;  3VUW A;  1PYW D;  4IWP A;  3RTV A;  3BK2 A;  2DGZ A;  3H8M A;  5J2A A;  5DB9 A;  4DQP A;  1XO0 A;  9ICK A;  4R8U A;  3Q8E A;  1Z4N A;  5BMH A;  3ALR A;  2D6F C;  2IGH A;  4S0R A;  5KFB A;  4M6W A;  1KOT A;  4DSF A;  2JH7 A;  2QDF A;  4MEM A;  2BPS A;  4AOF A;  1UT5 A;  4EUT A;  3GQC A;  2YN4 A;  3RH6 A;  1DRG A;  4DOC A;  3U7Z A;  7ICO A;  2MSN A;  1XSN A;  2ZTC A;  4OD0 A;  4DQI A;  5IA7 A;  2BYF A;  1FFU A;  3V61 A;  4RQ1 A;  3BS5 B;  4PS3 A;  2L00 B;  4ARC A;  5IIN A;  3UQ2 A;  2JEJ A;  3PW7 A;  4UAV A;  5TIS U;  1IGC A;  4TUU A;  4YN4 A;  4OVZ A;  5DB7 A;  2ZUB A;  4QAY A;  2H5X A;  2EMS A;  4UB8 U;  1HXY D;  1LVH A;  5KFI A;  2G09 A;  2INC C;  3CF6 E;  2PE9 A;  4CRX A;  3GS2 A;  5J29 A;  2K5P A;  3H7S A;  4FLH A;  4Y2T A;  1WXQ A;  1FCC C;  4C8O A;  2KJ5 A;  3NJT A;  4BOS C;  3Q3N C;  4X57 B;  1MHX A;  2ZCB A;  5DPW A;  2HMX A;  2UVR A;  2NTT A;  3U2S C;  2L1A A;  2Z0E B;  3IG5 A;  4EZL A;  2L83 A;  5D2M B;  5DB8 A;  4GDL A;  3D2S A;  5CRX A;  5T14 A;  2MX2 A;  5AK4 A;  1XLQ A;  1WM3 A;  2W3S A;  5D3D A;  1UGJ A;  4NWI A;  4M8M A;  2WLB A;  5KFT A;  4MFF A;  1C4P A;  3ZNH B;  3QXG A;  2KDM A;  1LKY B;  5DBC A;  1LGR A;  1YX6 B;  2JVC A;  1PGB A;  1YD8 U;  1LFD A;  4KLH A;  3AM9 A;  3K1Z A;  4Y2Y A;  3DV9 A;  2Y0S C;  1NJY A;  4C8L A;  1GUA B;  2MW5 A;  3HK0 A;  3R8B A;  1UA0 A;  4J3O D;  4YSZ B;  5KFD A;  1TK0 A;  1TKD A;  4RNM A;  2XY7 A;  2PPH A;  4HRO A;  3ONN A;  5AI6 A;  4PH5 A;  1TIF A;  2KX0 A;  5J0W A;  4PYU A;  1BPZ A;  2MJE A;  3D2N A;  2QEJ C;  4ED7 A;  1KFT A;  4AJW A;  2FMP A;  4IOI E;  4KLU A;  3ETR A;  1WGD A;  2LXC A;  2W8L A;  3WAO A;  3VTU A;  3C1Z A;  4J9L A;  2W11 A;  2R18 A;  4M9L A;  1D8L A;  2AYO B;  3LK9 A;  4QZC A;  8ICI A;  1WYG A;  1BUI C;  3MR3 A;  2Y1J A;  1SGH A;  4QNL A;  2K8A A;  3DBS A;  3URY A;  3A0H U;  1MHH E;  4EEW A;  2BDP A;  1SBB B;  1ZD4 A;  2NBV B;  3APF A;  5CP2 A;  1MVK A;  4XWW A;  4DXF A;  2G5I B;  4US8 A;  1MJD A;  3RCZ A;  2KSO B;  4R8U B;  3P42 A;  2VJ4 A;  1DOY A;  3ZXV A;  2F1J A;  4U7C A;  5FR3 A;  4DHJ B;  3MGH A;  3Q69 A;  1GAQ B;  2YTU A;  4WJN A;  2NPT B;  1IV8 A;  2H88 B;  2IJ0 A;  4YTM B;  5J0T A;  3GV8 B;  2EDU A;  3ZJT A;  2IY0 B;  4C8K A;  1GC6 A;  2K4H A;  3DCG A;  3TL5 A;  3PLV A;  3WKE A;  3A1Q A;  4EX7 A;  4US9 A;  3JPS A;  2J0J A;  4PYZ A;  3V6K A;  1WJN A;  3HM3 A;  2AXT U;  3O13 A;  4ARI A;  2N9X A;  3JPP A;  1TZO A;  3CSF A;  3NZS A;  3UMB A;  1JW9 D;  1BPE A;  4RNA A;  2JH1 A;  4C0Z A;  4C4T A;  4F4Y A;  3RJI A;  4DHJ D;  2IBI B;  1AQ6 A;  2JX5 A;  1C3T A;  3PHW B;  1VZ8 A;  2FE8 A;  3BQ2 A;  2CS4 A;  3QJZ A;  2JZP A;  4NPN A;  1WGY A;  3B2G A;  1AN8 A;  3TIX A;  3UXN A;  2HVI A;  1ZQR A;  3R2T A;  2HBM A;  3HIL A;  2ZXH A;  2C9W B;  3NY5 A;  1KKX A;  1FFV A;  3WK5 A;  4YXJ A;  4KGR A;  4UAU A;  4QW9 A;  2FCQ A;  3MDA A;  4DFP A;  1X9W A;  1WMH A;  1J19 A;  1FXT B;  3PZ7 A;  1J7B A;  5FR6 A;  4XQ8 A;  2LYH A;  2PI5 A;  4TMA B;  4NXZ A;  2FJ6 A;  4PZO A;  1T94 A;  1NYQ A;  3LB8 C;  4JV1 A;  1ZQQ A;  9ICB A;  4RGT A;  3SD7 A;  4RGO S;  4ANV A;  2ZZP B;  4EZJ A;  4JB3 A;  2ZJ8 A;  4I2I A;  4F5O A;  3VUX A;  3M7D A;  4BAX A;  5FKA C;  2GO7 A;  2RDJ A;  3PPA A;  2DPI A;  1EM7 A;  1UBI A;  2ZNV B;  2JU6 X;  2PTL A;  5C2T B;  3Q14 C;  4BKG A;  3PX0 A;  1T0S C;  4Q43 A;  4DL4 A;  4BFR A;  2ZTE A;  3B08 A;  3A9J A;  4F3O A;  1SKS A;  1C4C A;  1D9F A;  4MJS A;  1WR1 A;  2JRH A;  5LLI A;  3RZW C;  1PFD A;  5CA7 A;  4DF4 A;  4WWO A;  2DYO A;  4LDT D;  3HRD D;  4UQG A;  4DLE A;  1X66 A;  1L3S A;  2HD5 B;  4EEK A;  2QB0 A;  2WTF A;  4A55 A;  2PMZ C;  2CRX A;  4C4V B;  5L1J A;  4F5N A;  3ZJU A;  4WJ3 B;  1Z1V A;  1RFA A;  3VR9 B;  3KKA A;  1FO4 A;  4KN4 A;  5DPS A;  1VZ7 A;  4GLS C;  2BWE S;  2P6U A;  3IM1 A;  2NRX A;  2EMT A;  2C28 A;  1ZE3 D;  3R66 C;  1LB2 B;  5AZF A;  1PUZ A;  2N9P C;  1L6U A;  2BKR B;  2ZPY A;  2PKE A;  9ICR A;  1ZQZ A;  1X1M A;  4W9G A;  5F9L A;  3B0X A;  1TS2 A;  1QQ6 A;  1ET6 A;  9ICU A;  5AM5 A;  1TAQ A;  4ICU A;  3B9J A;  2MH7 A;  1CZP A;  4B0M A;  1H8C A;  1E8X A;  3N28 A;  1OEY J;  2AWT A;  4DL3 A;  4KGT A;  2LGI A;  2XGP A;  2ZCC A;  4YP3 A;  4XGA B;  3RT3 B;  2KTQ A;  1ZQG A;  3HKZ F;  4P7I A;  4OO1 J;  2BS4 B;  1ZW7 A;  1IM4 A;  4DS4 A;  3TAP A;  3ZNG C;  8ICL A;  3AEF B;  3MC1 A;  1QSL A;  4O3M A;  2BW2 A;  3OHA A;  5J2H A;  2PMV A;  5AKZ A;  4ELU A;  2BQQ A;  3RAQ A;  2LYA A;  5KG0 A;  1I4P A;  1R4N B;  4TKN A;  4B9T A;  3ZRF A;  1ZQA A;  3RNG C;  4MGZ E;  2OHF A;  5ALU A;  3VH4 B;  4BXO B;  3AU5 A;  2B0C A;  4CF3 A;  4R66 A;  1WZ3 A;  4F4K A;  3WKD A;  1V5O A;  1ZQU A;  1RYU A;  3IVF A;  3QCA A;  3TFR A;  3VFK A;  3PX6 A;  4QZH A;  1SL0 A;  2NRV A;  5AM0 A;  3R9K A;  2BCR A;  2PFP A;  1OQY A;  3F53 A;  4OCZ A;  3RUI B;  3N97 B;  1SKR A;  8ICX A;  2NV3 A;  4RUA A;  5JHA A;  4R63 A;  3FDS A;  3I5J C;  3SR6 A;  1K1S A;  2QB1 A;  3GIM A;  2VRR B;  2KHW B;  3OLM D;  2BCU A;  3BVZ A;  1OTR B;  1GPX A;  5D7G A;  4NM1 A;  1F0M A;  2M8S A;  3LXF A;  1HJP A;  3DVG X;  1HTO A;  1V85 A;  4ED3 A;  1QLB B;  4FJZ A;  1V2Y A;  7ICI A;  4OZA A;  3EPG A;  7ICP A;  2G45 B;  2BB5 A;  4QIW F;  4YD2 A;  2V3N A;  2KMC A;  2Z7J A;  1DOQ A;  2ISO A;  3SAH A;  2BB6 A;  2WGS A;  3S2A A;  1ZQ1 C;  2XGQ A;  1ZQS A;  1PUT A;  7ICM A;  4GGQ A;  1RYJ A;  1Q0W B;  3A9J B;  1ZQE A;  2KOB A;  1OXJ A;  4NY0 A;  5DG8 A;  3IG8 A;  3GZN B;  3NOB A;  5DCN A;  4XA5 A;  2G1E A;  2DUY A;  5DGB A;  4N59 A;  3KD3 A;  4UB1 A;  4NZL B;  3W1S C;  4HDO A;  4HLE A;  2LVO A;  2AH5 A;  1VLB A;  3SFE B;  3ZTC A;  4RT2 A;  3D32 A;  3RYT A;  3E9S A;  5KHQ A;  4FS2 A;  4GMV A;  3QEA Z;  4P2H A;  2LGY A;  2N7E A;  2R8I A;  5KFJ A;  1ZDX A;  5J0P A;  1F77 A;  3WIM A;  4FZN A;  8ICS A;  3IHP C;  5DG7 A;  1UWM A;  3Q2A C;  4QZ9 A;  1S77 D;  2UU7 A;  5BO4 B;  1X40 A;  3PO4 A;  4M0A A;  3QUB A;  2MRL A;  4OJL A;  4LJP B;  2LBO A;  3NVY A;  1L5U A;  5G5H A;  4HPM B;  2XI9 A;  2BQR A;  4QWC A;  2M19 A;  2MLB A;  5G5G A;  1S1Q B;  4ZYN A;  3RZF A;  2KNJ A;  4B95 A;  3QU2 A;  4GLX A;  9ICW A;  4KVG B;  2LVP A;  3WAM A;  5BPC A;  1L0Y B;  2GI9 A;  1TAM A;  3NVZ A;  2AQ3 B;  1K5O A;  2LM1 A;  2DAJ A;  3GIL A;  4S17 A;  2N1V A;  4WJP A;  5TZV A;  4NJ8 A;  2HHV A;  1TJE A;  5AM2 A;  2XO7 A;  1HIW A;  2B21 A;  4KDI C;  3TMP B;  3TEX A;  2MJ3 A;  4USA A;  1XCT L;  2NVU I;  1FEZ A;  4E74 A;  4FE3 A;  3DDH A;  5AM1 A;  3DWG C;  1S76 D;  3SFD B;  2RDI A;  4DL6 A;  2WDT B;  1J0G A;  2O6V D;  2HOI A;  4KSK C;  5D94 A;  4I27 A;  2RDH A;  4DF8 A;  3RFZ B;  2HBJ A;  5IIK A;  2XY5 A;  2R8H A;  4QZI A;  3BQ7 A;  4RQ2 A;  4X5V A;  4GXK A;  1UNS A;  1ZPS A;  2M0N A;  4ECQ A;  3HW8 A;  1D8Y A;  5AM4 A;  1P3Q U;  5AI0 A;  2E1F A;  5C5J A;  3OSN A;  4PPX A;  2H3V A;  1YN3 A;  2EEL A;  5AI9 A;  1TAU A;  2KDF B;  9ICJ A;  3OGU A;  1MI0 A;  1K1Q A;  2MJD A;  4UBC A;  5AK3 A;  3C28 A;  4M9N A;  1EO6 A;  3WKA A;  5AZG A;  5AIC A;  3KVF B;  1MN8 A;  1J7C A;  1D5M C;  4P16 A;  1JWB D;  5E6J A;  4MFA A;  4I2A A;  2MBB B;  2REX A;  3V6H A;  1N61 A;  3PT2 B;  3M9O B;  2KV2 A;  4LZD A;  4IQT A;  5DLF A;  4GC7 A;  1CUK A;  3HJE A;  4MGY E;  2V1Y A;  2HI0 A;  3IV6 A;  3ML9 A;  2VZK D;  1C7Y A;  2FAZ A;  1C9F A;  1WRD B;  2MUT A;  2D07 B;  4HJK A;  4DXG A;  1ZGU B;  4RU9 A;  3WAL A;  2XVT A;  2IO3 B;  4A3P A;  1RQL A;  1S10 A;  3Q3O C;  4EYH B;  4K7W A;  4W9L A;  2LVQ A;  4ZYS A;  2IO2 B;  1ZQV A;  4W9E A;  3KH0 A;  4PT5 A;  5KFQ A;  2KFZ A;  8ICW A;  4RQM A;  3VRA B;  5AM3 A;  4RM9 A;  1MFW A;  3BZK A;  5J0S A;  3RJH A;  1HA5 A;  3M95 A;  1TKG A;  4DK5 A;  5DPT A;  1WUD A;  1AYF A;  1YQ4 B;  2J52 A;  4G50 A;  1P1A A;  3EWA A;  3RJE A;  2J0M A;  4AJY B;  4BVU C;  4LNO A;  3VVW B;  5KFE A;  3BJY A;  4PL2 A;  4D2K A;  1TS5 A;  3MC8 A;  4NNJ B;  5I4D A;  3QK0 A;  3AI5 A;  5ALG A;  3RNE C;  4GN1 A;  2C5L C;  2AQ2 B;  3HVD A;  4C7Y A;  5CEH A;  4J9O A;  2CU1 A;  4NJ6 A;  4EZ9 A;  2K3U A;  5KHO A;  5MPO A;  1TK8 A;  2MP2 A;  4IL6 U;  3KLS X;  2K4I A;  2WF8 A;  3R7Q A;  5CHW A;  2YMQ A;  3AN1 A;  4BDP A;  4CQN A;  4WJQ A;  3TBL D;  1TZ1 A;  2FPL A;  2K0P A;  1UF0 A;  1NK0 A;  5H2F U;  2MBE A;  3Q8S B;  1XSP A;  4RF0 A;  3TEZ A;  2K8H A;  1IGD A;  3ZIM A;  4TUQ A;  1VJK A;  4JIO U;  3WK6 A;  2FCS A;  4HEA 1;  4B6W A;  2XCP A;  3P4R B;  3QEB Z;  1Q3V A;  3AE3 B;  3DDC B;  2LHE A;  1X9S A;  5H8Y E;  3N4M B;  2WF6 A;  2WX1 A;  2JV3 A;  2HJ1 A;  3LVW A;  4CE6 A;  4FHK A;  1FM0 D;  4C56 C;  3LWL A;  5DB6 A;  5IIO A;  2HDE A;  2SAK A;  3T79 A;  5KT2 A;  4DQO C;  3ZLZ A;  1SE2 A;  1WCL A;  3KYC D;  1S97 A;  4G3X B;  4HRS A;  1BVS A;  1WM2 A;  4IRC A;  2WHE A;  4IR9 A;  2GMI C;  2W9B A;  4XWT A;  2Y5C A;  4O3Q A;  1TY0 A;  4ZOH C;  1U49 A;  1KLG D;  4FXC A;  2VA2 A;  5C0Y A;  3QWZ B;  1YOV B;  3OTQ A;  1XQQ A;  2YEP B;  3FKY A;  1J2N A;  3FYH A;  1F52 A;  2KMD A;  3OJS A;  4CF5 A;  1N48 A;  2KFN A;  1VRA B;  2UVU A;  1ZRM A;  1XO3 A;  2IDY A;  5AIB A;  8ICP A;  2W9C A;  5KFA A;  1WE7 A;  1DGJ A;  3TFS A;  1XCQ L;  3JPO A;  1FMA D;  1OQQ A;  1SE3 A;  2PFQ A;  4QZA A;  1QIL A;  2HHT A;  4Y2J A;  1D6E C;  3BQ1 A;  1L7Y A;  3DBH I;  2J53 A;  4ZRP A;  5AUI A;  3M8S A;  2HSZ A;  4ECX A;  1FNU A;  4DWI A;  2HOQ A;  3TJP A;  1IP9 A;  1IXR A;  2KNB A;  1ET9 A;  2W43 A;  4RQ8 A;  5D6J B;  3SHQ A;  4FZM A;  2Y1I A;  1ZQI A;  2J0K A;  2Y0S F;  3DHH C;  4URK A;  5B5E U;  1QT9 A;  3BQT A;  4OZC A;  3QU4 A;  9ICO A;  2AHO B;  2YEP F;  2MWS B;  3B0A A;  5JZE B;  5DG9 A;  4Y2P A;  4RPX A;  1QLN A;  3EEC A;  3HIZ A;  3RNC C;  1NK9 A;  3PST A;  1SV0 A;  2W9C B;  4KLO A;  4JL9 A;  2RLT A;  4KLD A;  8ICN A;  4Y2Q A;  5KG3 A;  3KFU F;  1BNO A;  1ZQT A;  3SV3 A;  1ZQJ A;  8ICQ A;  1WE6 A;  3LDA A;  4MDK E;  3BIN A;  4ANX A;  4MEY A;  2EQY A;  2ZJD A;  5L9X A;  1WMH B;  2PVO D;  3IP4 B;  2ZUD A;  5J0Q A;  1R4M I;  9ICG A;  1JWU D;  2WXM A;  2XCA A;  5J2I A;  2ASD A;  5G2N A;  3IT6 B;  3M63 B;  2N9L A;  2KK0 A;  4AP9 A;  5A0L A;  2AQ0 A;  2DZM A;  2BCV A;  3PSP A;  7ICK A;  1BT0 A;  4DHZ B;  2WF5 A;  3MTN B;  1N2X A;  3CWI A;  2CHZ A;  2WXG A;  4U6P A;  1ZXH A;  1ZUD 2;  3MGI A;  2DKX A;  1JAL A;  2JWU A;  5IN7 A;  4IQW A;  1GOZ A;  1V9J A;  2ZIU A;  1WI0 A;  1QQR A;  2PFN A;  5KFP A;  2ZIX A;  3MJW A;  4WJO A;  2F2A B;  3H4B A;  4G9B A;  1V86 A;  5ALS A;  3V6C B;  2FDR A;  3RUL A;  3WAP A;  5AIA A;  4P6V F;  3QA8 A;  3SU8 X;  1AAR A;  3ZQ4 A;  4DDI D;  4ECT A;  2BVC A;  3N9Y C;  1NJX A;  3SMV A;  3NS8 A;  4AQ7 A;  3QZ8 A;  3L10 B;  1NKE A;  2LJI A;  1T0Y A;  4YQW A;  1PVQ A;  2B76 B;  2SEB D;  4KN7 A;  4Y2U A;  1S3S G;  2KVC A;  2LZ6 A;  3B1L X;  1TE2 A;  4IQU A;  1L6N A;  4I2C A;  1WZ0 A;  2DEN B;  3LDZ E;  2ZIV A;  4MT5 A;  5CHG A;  2OEH A;  4OW0 A;  5L83 A;  3L08 A;  2QJL A;  4K3C A;  4LLG M;  2J6S A;  3ISC A;  2Y5P A;  2BS2 B;  3A33 B;  1WGK A;  3FAH A;  1KQQ A;  1PVR A;  2BDU A;  2HHU A;  4WQM A;  2W54 A;  1WX9 A;  2OM6 A;  2VJ5 A;  4FHJ A;  2K60 A;  1L8L A;  2BKF A;  2HTM E;  1WX7 A;  2VZK B;  2V9H A;  2KMM A;  2P35 A;  3IHQ B;  3N1Z C;  7ICG A;  3N1X C;  4B9V A;  3NGD A;  1DOI A;  4YT0 B;  3RRG A;  2VA8 A;  4JK1 A;  2AL3 A;  4F4X A;  1MQ3 A;  3TQ1 A;  1F5S A;  2O2V A;  3PW2 A;  1FXI A;  2Y9T A;  4JMU A;  4KLI A;  4BOZ B;  3NS1 A;  5KFY A;  3LYY A;  8ICG A;  8ICR A;  2FPK A;  1IIP A;  5L95 C;  1KFD A;  2PXI A;  1KBU A;  3ZNZ B;  2JGA A;  1ZQL A;  3MHS D;  5CX3 A;  5ALH A;  8ICJ A;  3SV4 A;  5G55 A;  3RRH A;  4C80 A;  4DFM A;  1SE9 A;  2WS3 B;  3TAD C;  2BS3 B;  2N1W A;  2OJR A;  2XK5 B;  1ZQY A;  3AE8 B;  4YMM A;  3AE4 B;  3AH7 A;  1KSP A;  1JWM D;  1RFK A;  3VQI A;  1T3Q A;  1OW5 A;  3T3O A;  2HHX A;  4Y2X A;  4QZG A;  3C2K A;  4L23 A;  4EZ6 A;  1KN5 A;  4RQ7 A;  3AEE B;  1FCL A;  1UBQ A;  3JSV A;  1WY8 A;  2LWP A;  3U30 A;  5C1Z A;  2DBY A;  2KP7 A;  9ICN A;  2MQJ A;  3DBR B;  2L32 A;  2EAP A;  2CJO A;  2KKC A;  4YXD B;  3HP6 A;  4NQK E;  3NAS A;  2LM4 A;  5KFO A;  2LHT A;  4F93 B;  3QUQ A;  1WCN A;  7ICJ A;  4TQR A;  1QOF A;  2ASL A;  3B2F A;  1Y8R C;  2LGD A;  4ECV A;  1M6Y A;  5GMV A;  3ALB A;  2H3Z A;  3RBE A;  1NVI D;  5DGA A;  2Q5W D;  2XIC A;  2LRW A;  2JZZ A;  8ICM A;  1KLN A;  2L5Y A;  2YY6 A;  1QCK A;  5E6O A;  3AEB B;  2RDG A;  4BXO A;  4YL8 A;  4PGX A;  1FEH A;  1K52 A;  2Y9U A;  2ZIX B;  4N58 A;  4TQ1 A;  3VRB B;  3PR4 A;  4KLE A;  7ICL A;  3BDP A;  4BGD A;  9ICX A;  1UUP A;  4L1B A;  5AK6 A;  4FO6 A;  3V72 A;  1FRD A;  4GFJ A;  2CPR A;  3A9K A;  1K50 A;  5HHD G;  3NUH B;  3X0W A;  2FMS A;  4ANW A;  4ANU A;  1WWT A;  2NTS A;  2G9H D;  2ZPN A;  5KAF U;  1COO A;  1YJJ A;  1V1P A;  2KN7 A;  3C21 A;  5GXG B;  4ELT A;  5ALO A;  4ACO A;  2KTR B;  4DEZ A;  4P4O A;  3SAG A;  2KIC A;  3GZF A;  2R61 A;  1WGH A;  3L0W B;  3PVL A;  4ED6 A;  2QAR A;  1QSS A;  1A5R A;  4I2B A;  3UIN B;  1NI3 A;  2C2R A;  1BXT A;  3GDX A;  3QX1 A;  5AI4 A;  3OWE B;  5EE1 A;  3RNB C;  3EYZ A;  3LJ3 A;  2WXL A;  1UGM A;  4MAC A;  2N9K A;  2J6U A;  1WRI A;  1P7E A;  4LTU A;  1ZD3 A;  4LK0 M;  2W3R A;  2F1I A;  3IAM 1;  4UAS A;  1DYQ A;  4GC6 A;  1ROE A;  1XSL A;  5J0Y A;  3TI0 A;  2KQ7 A;  1ZQC A;  2F76 X;  2G0A A;  2J6T A;  4M01 A;  1X6I A;  3C1Y A;  5ALI A;  5KL8 B;  2WXH A;  1K8R B;  3G6X A;  1IBX B;  1PGX A;  2KZZ A;  2R8K A;  1ZJM A;  1KTK A;  1S5L U;  2HOF A;  3PW5 A;  2V3S A;  3C8Y A;  4TSS A;  1B22 A;  2Q0Z X;  3QAR A;  4JUZ A;  2KLC A;  3D6J A;  5KNI A;  1ZQH A;  1TT5 B;  2KN5 A;  2QCZ A;  1Z4O A;  7ICT A;  3I57 A;  1LV5 A;  4RF1 A;  1SZH A;  5B66 U;  1J8C A;  2R8J A;  2V0G A;  3IXS A;  1T4G A;  2HW3 A;  4P0Q B;  3QU9 A;  2KK8 A;  2RD0 A;  2ZVN A;  5GTH U;  3APC A;  3IBE A;  2IMW P;  4PGQ A;  4CYE A;  5DQI A;  1TY2 A;  3JVZ X;  3G6V A;  1TKY A;  2ZJ5 A;  4FBU A;  1ZJN A;  1NBF C;  3UM9 A;  2G4S A;  2K22 A;  3L13 A;  4HWI B;  1ZOL A;  5J18 A;  1C4A A;  4NJ7 A;  5AKG A;  3VCB A;  2C7M B;  3C23 A;  1E8Y A;  1SF0 A;  4OJP A;  4TUS A;  2BGW A;  1COK A;  3WU2 U;  5ALK A;  1Q10 A;  3DQV A;  4IWQ A;  4J6I A;  3N30 A;  2K25 A;  5IIM A;  2ES6 A;  5DPR A;  7ICQ A;  1LXD A;  3PS6 A;  1HZ5 A;  1QOB A;  5HML A;  3ZYY X;  2VKQ A;  1L7N A;  3A9K B;  2C2D A;  4EEY A;  1GB4 A;  4DSJ A;  2FLN A;  2DZJ A;  2ZUC A;  1VR9 A;  3PMN A;  1Z19 A;  1E8W A;  1WX8 A;  3T5J A;  3Q8P B;  3NVW A;  3P4P B;  3H0M B;  8ICY A;  2INP E;  2V3P A;  3J81 j;  3VXW A;  4YR0 A;  1QOG A;  5J8Y C;  3GFK B;  5AKY A;  5J0X A;  3P2B A;  4ASW C;  4B0E A;  5KG1 A;  3M6Z A;  2FUH B;  1SV0 C;  1NOM A;  2X38 A;  4PGY A;  5J2B A;  5LNK 1;  3MR5 A;  4WWP A;  3SD5 A;  3V7K A;  2FCN A;  4F4Z A;  3C2M A;  2AGQ A;  1E7P B;  3IT4 B;  4AWJ A;  2K8B A;  2ZW0 A;  1U45 A;  2L0F A;  3BYY B;  4BBN F;  4Y2R A;  4NL9 A;  1ZP0 B;  4KLG A;  4PHP A;  4O5K A;  3KKA C;  3ECI A;  2W55 A;  5BYS A;  3W2D A;  1CMX B;  2V4I B;  3EA6 A;  3BVG A;  4EKU A;  3R2I A;  8ICZ A;  1WJU A;  4RQN A;  1EWY C;  2KDB A;  3EGR A;  1MSW D;  2WAQ F;  1ZYQ A;  1JML A;  3QNM A;  5KFV A;  1ZQM A;  1F44 A;  1YN4 A;  2XNA C;  2WF7 A;  3RFA A;  1BGX T;  2WXI A;  3HT3 A;  3PV1 A;  3ETL A;  1RM6 C;  2AJQ A;  4K3B A;  9ICC A;  4JLC A;  1XF5 L;  2AQ4 A;  3QYP A;  1JX4 A;  4AYB C;  1XLN A;  3BZD B;  3EUB 2;  1WIA A;  3RF9 A;  4TV3 A;  4F4W A;  1I7H A;  2RSU A;  5J0R A;  4W9J A;  4IUM B;  5CJ7 A;  2G06 A;  3RR8 A;  2RPQ A;  2O2V B;  1EF5 A;  3Q8A A;  3S6J A;  2MUT B;  3M9N B;  3JYU A;  3E2E A;  1KFY B;  4I6L B;  4ED8 A;  2DAF A;  5JU5 A;  1NI2 A;  4GXJ A;  3H4D A;  2NRW A;  4ECZ A;  3TAD A;  4EBD A;  2GLS A;  2HTH A;  2I38 A;  3GE3 C;  1X9X A;  2L76 A;  1V1O A;  3W1S A;  2C2E A;  3A4R A;  4RPZ A;  2JXJ A;  5KFM A;  4Y2V A;  2K9X A;  3IRU A;  1Z3E B;  4KLM A;  2QHO A;  4C7Z A;  2ON8 A;  5KG7 A;  3ZDM C;  4LNF A;  3V6J A;  5C23 A;  9ICF A;  1LQB A;  3VUY A;  2YQE A;  4YMO A;  1XC9 A;  5III A;  2BKE A;  1RYR A;  2ZVO A;  5J8Y A;  1NEK B;  4KMO B;  5ALZ A;  3KZX A;  1NKC A;  4OZB A;  3KW5 B;  1QH9 A;  9ICE A;  4YSY B;  2RQ5 A;  3WCQ A;  2CJN A;  1E6E B;  2LGS A;  2WXJ A;  4WWM A;  1BPY A;  3PTF C;  2KVR A;  4ACF A;  3ORY A;  3PHX B;  3KWL A;  5EE9 A;  1WWV A;  4EZK A;  4IQV A;  1NNL A;  2D10 A;  3DBL B;  4GSW A;  2ATL A;  5E79 U;  1PK1 A;  4F71 A;  1T0Q C;  4GDK B;  2TSS A;  2WXR A;  2GH1 A;  2VH2 A;  4F5P A;  3K1R B;  4YG2 A;  1TKE A;  1C79 A;  1IUE A;  2D11 A;  4DQR A;  4UDU C;  2LXA A;  1SJH D;  4CHK A;  5J2E A;  2JZ3 B;  2YX8 A;  4LZG A;  5F9N A;  3W5V B;  4XZ4 A;  4KV2 A;  5KFU A;  4FJV B;  3D2Q A;  2NPT A;  1SB3 C;  2PMZ F;  2JR5 A;  3PW0 A;  4B9M A;  5DDM A;  3NRW A;  4XC2 A;  2LHD A;  4RH6 A;  4ZDV A;  1BPB A;  2LFI A;  1D5Z C;  2XN9 C;  4UB3 A;  5IO9 A;  4ECR A;  1D3Z A;  4RUC A;  3SDL C;  2MA9 B;  2EAO A;  4Q8E A;  1KF6 B;  2LEK A;  4MSQ B;  1TFR A;  3N7R C;  4QWB A;  3KQ4 A;  1GG3 A;  3HM6 X;  1EU3 A;  3I63 C;  3PGE A;  2YLM A;  4II3 B;  4QW8 A;  3KHR A;  2MBH A;  3MJ5 A;  1SSN A;  1TVA A;  3N3K B;  5GTI U;  1QTM A;  2W9A A;  2LUM A;  3AXC A;  5J0O A;  2BYT A;  1NK7 A;  2BWF A;  2BBC A;  3KWV A;  4A3O A;  4AP4 C;  4O3P A;  4P0Q A;  4OHJ A;  3T5H A;  3RNA C;  3F2D A;  3V7J A;  5HFY A;  2DZI A;  4DL5 A;  1UQV A;  2LKY A;  5IIJ A;  4P4M A;  1JWS D;  3R7R A;  1N62 A;  2ZIU B;  5KG4 A;  1NJZ A;  1I4R A;  2WXF A;  4FUL A;  2MAX A;  1A77 A;  4UB2 A;  1TV9 A;  4LJX A;  4KLF A;  2WHI A;  4C4V A;  4EE2 A;  3WKB A;  3LYS A;  2VIX A;  3A0B U;  2I1Q A;  5E6N A;  2JYT A;  5KFN A;  1C77 A;  4IS7 A;  5KG5 A;  3E0F A;  2CXY A;  2WB1 C;  3AEV A;  4XRH A;  1KLU D;  4MJS B;  3ZJV A;  3MAB A;  2BR0 A;  3X23 A;  4A9A A;  5AKH A;  2OH2 A;  1ZDV A;  3Q3F A;  2X8X X;  1ZQD A;  1YIW A;  1ZD2 P;  3RJJ A;  4C4S A;  3GIK A;  3QIJ A;  4LDT B;  4MH0 E;  2BZF A;  1N60 A;  4TQS A;  4BKS D;  1I42 A;  3CST A;  4MEL A;  1K51 A;  4I2J A;  3C19 A;  4Q2J A;  2V9W A;  2KJR A;  3QU7 A;  2J42 A;  3PSF A;  3PV8 A;  2ZTD A;  3WK8 A;  1EF1 A;  4MGK E;  2JZB B;  3IFW B;  1E10 A;  5KG6 A;  5KFZ A;  3GZN I;  4BUG A;  3NRZ A;  2HHS A;  1S0N A;  4I28 A;  3WA0 A;  1L3U A;  4Z6E A;  3UGB B;  4KMU A;  1P7D A;  2M1M A;  4LJO B;  2OED A;  5TR5 A;  1ZOY B;  2MA1 A;  4E3C A;  2QAR B;  2BQ3 A;  2XEW A;  2KFJ A;  3QQ8 B;  1KDH A;  4R64 A;  4F50 A;  1L6V A;  1RWS A;  3QU5 A;  3SAF A;  5ALM A;  1JUD A;  4HPL B;  2JEF A;  5CHF A;  3ZDE A;  1F2R I;  2KIV A;  1PGA A;  4W9F A;  2Y5B B;  4R65 A;  1ZQF A;  4JWU C;  4Z6D A;  1O03 A;  4QZF A;  3MGV A;  1ZQP A;  3LVV A;  4BX9 C;  1HZ6 A;  3U26 A;  5FK9 C;  3ZDA A;  1VZ6 A;  9ICM A;  4TQ0 A;  5ALF A;  4RQ0 A;  2IGG A;  2K6Q A;  8ICC A;  2G08 A;  5CHV C;  2UVW A;  3OHB A;  3RR7 A;  3PR5 B;  4KX5 A;  1E7U A;  3AEG B;  5BMI A;  4HJG E;  5J2R A;  3Q6B A;  1HUO A;  2AQ1 B;  1TBE A;  3UMG A;  1B0X A;  5HG2 A;  5KFL A;  2WXQ A;  3A1Q B;  5LXH A;  2W82 A;  1Z00 A;  1KL9 A;  2OCE A;  3Q8R B;  2HBL A;  4GIB A;  1KRH A;  1RAX A;  1RRB A;  1WSP A;  2C22 A;  4BBN C;  5J17 A;  1N63 A;  1V5T A;  3ZD8 A;  4B9K A;  3EZ5 A;  4CDG A;  4B9U A;  2KDE B;  3L17 A;  3NTU A;  4KX6 B;  1ZXI A;  4DFK A;  1U4A A;  4DL2 A;  2E8M A;  4YTN B;  2A5U A;  4IDI A;  4ZRQ A;  4NLB A;  4FA6 A;  4IG7 B;  1O08 A;  2L52 A;  4XX5 A;  1Y88 A;  5IIL A;  4IWO A;  3V3X A;  3ZXR A;  1P9D U;  4DFJ A;  3I9V 1;  4C8N A;  2VA3 A;  5JH5 C;  1ZQW A;  1UZX B;  4OVV A;  1Q5W B;  1HEZ E;  4A8E A;  5HR7 A;  1WR6 E;  8ICK A;  2W7O A;  4P1B C;  5BOM A;  4XDD A;  3I28 A;  1CRX A;  1XNS A;  3HHM A;  3AQE A;  2JPH A;  1FPY A;  2Z59 B;  1XU4 A;  2HCF A;  3SQI A;  1Q3U A;  2KKV A;  2J7Q B;  5JXV A;  2N7J A;  4FBT A;  3JW0 X;  2E1E A;  1JXE A;  2CU3 A;  4NY8 A;  3V05 A;  5DKW A;  3JPN A;  3C5G A;  3Q8B A;  2EKE C;  1UA1 A;  2NO5 A;  1F2R C;  1FNW A;  9ICI A;  4M02 A;  3EC8 A;  1DXS A;  2FCM A;  2GRI A;  4OVU A;  3GE8 C;  1XXG A;  5E6P A;  4M9G A;  1D5X C;  2IZV B;  3THV A;  5KT3 A;  4H2A A;  2QMT A;  1KRP A;  1XEE A;  1B9R A;  4RT3 A;  2BCS A;  2JEG A;  4IR1 A;  1TGZ B;  5KT7 A;  3PRP B;  2RP5 A;  4PZN A;  1GJZ A;  1DK2 A;  3N32 A;  2YB4 A;  3H7P A;  4XE0 A;  3L4P A;  5AEK B;  2M0A A;  5ALW A;  4KTQ A;  2DZK A;  1LM8 B;  1ARO P;  2KWD A;  2LMR A;  4M2Y A;  4GU2 A;  2E6X A;  1DGS A;  1SIF A;  3AE1 B;  4ECU A;  2NMQ A;  3I76 A;  2KQ4 X;  4KDL B;  1OFF A;  1S0M A;  1KTQ A;  2MCN B;  1I35 A;  2K6D B;  3UXO A;  3IAS 1;  4DOA A;  3ZDB A;  2ZG6 A;  4RQ5 A;  1A76 A;  1WH3 A;  4ZHP A;  2YMM A;  7ICF A;  5L1M A;  2LI5 A;  2E8O A;  1FRR A;  3RPF C;  4NM2 A;  2WQY B;  2RHF A;  1Z5S B;  5HHH A;  3NHE B;  4FBJ B;  1XO1 A;  3H8S A;  2RR9 A;  4RGM A;  5AI8 A;  2I2Y A;  3Q8K A;  4MEX A;  4KGS A;  5KTQ A;  4DWF A;  4XDC A;  3U52 E;  1HTQ A;  2K89 A;  1FXA A;  2M0X A;  4J03 A;  4BWM A;  2AL6 A;  4J9Q A;  3VH3 B;  5DQH A;  3MDC A;  1AWD A;  2PKO A;  3M8R A;  3OJ3 A;  3DHI C;  4UB6 U;  4RMA A;  1SL2 A;  2PEA A;  3L16 A;  3TSS A;  3V60 A;  1TYG B;  4UAT A;  5KFX A;  2W8K A;  1L0V B;  1YN5 A;  1Q46 A;  2A1J B;  8ICF A;  3H8J A;  3LWM A;  1MG4 A;  7ICU A;  4REZ A;  3PO0 A;  3QZ7 A;  4YMN A;  4KLQ A;  4M0W B;  2GOW A;  4K4I A;  4E0D A;  1B1Z A;  3GU3 A;  3GIJ A;  3MR6 A;  5JUM A;  1PK1 B;  4GDK A;  8ICO A;  5J2G A;  2ONQ A;  1N6Z A;  3ZDD A;  3GOE A;  1X42 A;  4G0N B;  3DBL I;  4HXD A;  1NK5 A;  4KZC A;  2A4Z A;  4YXM A;  1YZ6 A;  1V9P A;  2JF5 A;  1WXM A;  3ZGZ A;  4I2D A;  5AKL A;  4ECY A;  4JWM A;  3R3M A;  3V62 A;  4FJY A;  2FI1 A;  4O5C A;  4GOC A;  5CR0 A;  3SEI A;  3V7L A;  2NBW B;  3AE9 B;  3I3T B;  1NZB A;  5HNK A;  4QWE A;  3DVN U;  3BQ0 A;  1JXL A;  1TTN A;  2K8C B;  4QWD A;  4K7S A;  1ECW A;  3PRE A;  2PVG C;  2BYV E;  3T3N A;  4JWN A;  3DVN V;  1S9F A;  3RD2 A;  4CNQ A;  1FIQ A;  3MFH A;  2F8K A;  3K9O B;  3PNC A;  2AU0 A;  4KLJ A;  4PK1 A;  2KKP A;  1DOX A;  2CHW A;  2I1J A;  2QKQ A;  2F3N A;  4UAZ A;  2KZR A;  1U48 A;  1C1Y B;  3PRZ A;  2C7N B;  1ESF A;  4KSL C;  4KLL A;  4LVS A;  1V49 A;  4RNN A;  4DSE A;  3RB4 A;  4OJ6 A;  5ALE A;  4P1C C;  3RN9 C;  3W5U B;  1L7P A;  3IDW A;  5HHI A;  3GB1 A;  1WXV A;  3N7S C;  5CB1 A;  3WKC A;  3EFC A;  2FID A;  3ICX A;  2QIE B;  8ICV A;  4G11 A;  4Y2S A;  4Q45 A;  2J4X A;  1XWL A;  3KYD D;  4MGI E;  1T8E A;  2C60 A;  4JPS A;  4M9H A;  4W9K A;  3AV8 A;  1RDF A;  4PJ0 U;  1RG6 A;  4WUR A;  3J9C A;  2KX3 A;  1U9L A;  1V38 A;  1SJE D;  4HCP B;  1Q1O A;  3BYT B;  3WK7 A;  2JUO A;  3W9C B;  2KEY A;  1WXA A;  1B4F A;  3H9D A;  4RGN A;  1C20 A;  4IW0 A;  4EBE A;  1F0Z A;  4O3N A;  5EWE A;  4I29 A;  2ASJ A;  1L8O A;  4MFC A;  5HR6 A;  2ACZ B;  3K9P B;  2JSV X;  2JWZ A;  3HKZ C;  1C76 A;  3MFI A;  1S8O A;  4I2G A;  4GIV A;  1IPG A;  4KIK B;  3U4E G;  2IHM A;  4K81 A;  1YQB A;  4M9J A;  2Y3A A;  4M00 A;  4C00 A;  2QC8 A;  3M62 B;  1WWU A;  3JPQ A;  2FMQ A;  2DKZ A;  1UT8 A;  1KH0 A;  1TS4 A;  4FS1 A;  9ICS A;  3KUD B;  4J9K A;  2JEI A;  1RXV A;  2WX0 A;  1E8Z A;  3QAQ A;  2N9E B;  2H3Q A;  4GXI A;  4L2Y A;  3HVZ A;  3WAN A;  2PW9 A;  4RFB A;  3DEE A;  2KC1 A;  1J7A A;  7ICS A;  3H0L B;  2AEH A;  4WAF A;  4B9L A;  2H89 B;  1M4V A;  4KKI A;  1V1P B;  2QB0 B;  2NR2 A;  4ICA A;  4PHD A;  2D8C A;  1SXT A;  1ED1 A;  1WGG A;  4QZ8 A;  2BT6 A;  2DYM A;  2V4R A;  4KIK A;  1J2M A;  3VTV A;  1JRO A;  1TK5 A;  2L8J A;  2A3V A;  4HDQ A;  5TSS A;  2H3I A;  4P4P A;  1SV4 A;  4EBC A;  1OEY A;  2F77 X;  2DPJ A;  5H92 C;  3CP8 A;  1RQN A;  2L05 A;  2WXN A;  5KG2 A;  2D3B A;  1UHU A;  5J0U A;  2B3A A;  3VHT C;  4WWN A;  1QOA A;  1TS3 A;  1X9M A;  2FLL A;  4J9S A;  2WXP A;  4RZR A;  3Q8L A;  2C7H A;  1QSY A;  4KKJ A;  4IRD A;  2FNJ B;  1EWC A;  4QZE A;  4MSM B;  4MH8 A;  3TAC B;  5FP0 A;  4QIW C;  3ZD9 A;  3FIL A;  3M6K A;  2DWQ A;  2ASQ A;  5DBB A;  2LRU A;  1YNT E;  1ZQN A;  5KFK A;  1QQ5 A;  3MFG A;  4NLK A;  1KEJ A;  2K8C A;  3P63 A;  1WXS A;  4JX1 C;  3CW2 C;  2RGF A;  3EHV A;  2AGP A;  1V81 A;  8ICB A;  1ENF A;  2IHN A;  4O9M A;  5ALL A;  3V6E B;  2PFO A;  1AW7 A;  2G4D B;  4HVB A;  1V97 A;  2LI6 A;  2DNF A;  3ZRC A;  4F91 B;  2P66 A;  2D2Q A;  2VAN A;  2LJ5 A;  8ICE A;  7ICH A;  2A19 A;  2KWV B;  1MC8 A;  5J2D A;  4ZH4 A;  4BWJ A;  3TEY A;  4PHA A;  5JTI A;  3UPQ A;  4BKS A;  3H8W A;  3W1Y A;  1SEB D;  2IPK D;  3OJU A;  5D3I B;  3U8Z A;  4QJF B;  3AU2 A;  1VDV A;  2ZNV C;  2KT7 A;  3P1M A;  5F3X B;  1IBX A;  2IOH A;  2QSD A;  1D9D A;  2PI4 A;  1L0X B;  1B43 A;  2GBN A;  2CR5 A;  2A1J A;  1I4G A;  1R4M B;  4A6Q A;  4P0P B;  3ZDC A;  1RYS A;  1G6J A;  2FUG 1;  4YCX A;  2HHW A;  1UEL A;  1C78 A;  2JY6 A;  3DBH B;  3L3F X;  3UXP A;  3ENE A;  2I5H A;  2JXX A;  2ALZ A;  4MF8 A;  2M4N A;  2KVS A;  5AK5 A;  2V4Q A;  3KOO A;  1N5X A;  3MP9 A;  1VJ5 A;  2W9M A;  2HHQ A;  9ICV A;  5ALV A;  4M0W A;  4DBG A;  9ICA A;  2KSO A;  3O0F A;  4II2 B;  2WWZ A;  4DSL A;  3Q3J A;  4IKG A;  1S0V A;  3PZ8 A;  3ZO5 B;  2NCN A;  5L1L A;  3K4G A;  2LUE A;  2D3D A;  2E5S A;  2CHX A;  3DOW A;  1YJI A;  2BGF A;  5BYQ A;  3C29 A;  3Q8M A;  1JIH A;  2XK5 A;  3PW4 A;  2IOF K;  4RQ3 A;  2RPV A;  2KE7 A;  2ZXI A;  4BKT A;  2G07 A;  2ZEQ A;  4IM0 A;  1HQR D;  4EEL A;  4NJC A;  2L7R A;  4IRK A;  1SGG A;  4NLZ A;  1RPL A;  1YJ1 A;  4HCN B;  2KZ3 A;  3AE6 B;  5EWG A;  1Z2M A;  4F8C B;  3CRX A;  4P0P A;  3VDZ A;  1CJE A;  3TUO A;  1NYR A;  5KFH A;  4F7Z A;  1A0P A;  5J2K A;  4UBB A;  2EH9 A;  4F2R A;  3MR2 A;  1K53 A;  4ITK A;  4HYK A;  2EZX A;  4DQQ A;  4B6J A;  5AKE A;  5KFR A;  2I1K A;  1ZET A;  2KDI A;  3AMZ A;  5CTR C;  4A90 A;  2D3G A;  3Q3M C;  3H7P B;  5KT6 A;  2WU5 B;  2XID A;  2R2Q A;  4G3I A;  4R3D A;  8ICH A;  1I4Q A;  4J9N A;  5DQG A;  2QLT A;  4NLC A;  2IGD A;  5KAI U;  2F8L A;  2BPC A;  4Q44 A;  4LNN A;  5KFW A;  2YVC A;  5AZH A;  2JQR B;  1NJW A;  2JRZ A;  3BS7 A;  4M8N A;  2KG5 A;  2MHJ A;  5JHB A;  2EAN A;  3UQ0 A;  2WDQ B;  3T9L A;  1CEZ A;  1JRP A;  2WF9 A;  4WAA A;  1VD2 A;  4UB5 A;  2KYW A;  2HJ8 A;  4ELV A;  2F1H A;  2ZIV B;  3JSV B;  2KN4 A;  1LKY A;  4F5R A;  1JRU A;  2MRP A;  3M1Y A;  5ALD A;  3BZC A;  4NLG A;  1X2I A;  2M56 B;  2KAC A;  2NRT A;  2G5H B;  1H4R A;  1OUQ A;  2GWS A;  4DHZ E;  3ISD A;  4B9S A;  3RJG A;  2OOB B;  2RDB C;  1IG6 A;  3F2C A;  2OWO A;  5HKH A;  1JCK B;  3FIL B;  1ZD5 A;  4GDL B;  2KJH B;  3PSE B;  4J9P A;  4A20 A;  3T8M A;  3RJK A;  2MU2 A;  1F1H A;  2LGX A;  1ISN A;  4FN2 A;  4I2E A;  4F72 A;  4NAW A;  1D4B A;  2XY6 A;  3F2B A;  2WDR B;  2RRD A;  2LYB A;  1S0O A;  2ODG A;  2DHZ A;  2ICI A;  4YVZ A;  2AGO A;  3NZ3 A;  3HUI A;  3PRM B;  5IAA C;  4XYC A;  3CIR B;  5AUK A;  2KQS A;  3BWU D;  3OPX A;  2IA6 A;  4O3S A;  2L0T A;  4AUQ C;  1Q8K A;  3U7D A;  5LXI B;  2CN1 A;  2W03 A;  1XS9 D;  1U4B A;  3H40 A;  5IKC M;  1WF9 A;  8ICT A;  2PE6 B;  2JRI B;  4A8X C;  3ZW3 A;  5DBA A;  1A70 A;  3ZTD A;  1L4Z B;  3UMC A;  1SXD A;  4EYI B;  2R2O A;  4EX6 A;  4ICV A;  1L5P A;  4NV0 A;  1YX5 B;  4CO7 A;  5EDS A;  3KHG A;  1YQ3 B;  5L1I A;  3GII A;  5IP4 D;  8ICU A;  3KUZ A;  2E3T A;  3DPD A;  2YMP A;  4HK2 A;  4XUS A;  5IOI A;  3DHG C;  3TEW A;  4YR2 A;  3PZP A;  1MQ2 A;  1GNU A;  3PO5 A;  1RLF A;  3NG0 A;  3EFU A;  2FE9 A;  1STE A;  4B9N A;  4O5E A;  2KC2 A;  2KJ9 A;  1QF6 A;  3PML A;  4UB4 A;  4KLS A;  2K4E A;  3PX4 A;  2KAN A;  2OJW A;  4WIP A;  4ZRJ A;  5ALN A;  1Y56 A;  4DOB A;  1E0Z A;  3AEA B;  1HEK A;  2RMM A;  2KHQ A;  1SWW A;  4C4R A;  1NKB A;  3QHT A;  5ALR A;  1HUZ A;  3AE2 B;  2E8P A;  4FZL A;  3SI8 A;  2LD9 A;  2FLP A;  1JQ4 A;  2JYE A;  1Z00 B;  3RMK C;  5D4B A;  4RNO A;  3K75 D;  5KFF A;  5BOL A;  3H8H A;  3P4S B;  4KZ0 A;  4Z6C A;  1Z1B A;  4W9H A;  2W04 A;  1SXE A;  3BS5 A;  3I1Y A;  2O6V A;  1OGW A;  3AUL A;  4ZRI A;  2N1R A;  2DQN B;  2W7P A;  4GXB A;  3OG5 A;  3ZNI D;  2KMA A;  3IN5 A;  1P7F A;  1NZP A;  4WQO B;  2GBR A;  3GP7 A;  3RB3 A;  1MA7 A;  4PS7 A;  5KT5 A;  3ZKJ C;  3APD A;  4EOY A;  1T7P A;  3M9M B;  2W9N A;  1BPX A;  2N7D A;  2WFA A;  4NAW B;  2WB1 F;  4J9R A;  2DLB A;  3KBB A;  4RCO A;  2Z8L A;  3PLU A;  3KZI U;  3OSP A;  8ICA A;  2HDO A;  4W9D A;  1JWA D;  2GLE A;  2BHN A;  2LPE A;  2DYB A;  1PZN A;  1QKZ A;  2JZB A;  4MF2 A;  2DFL A;  3RB0 A;  2IOF A;  4UAR A;  3AED B;  2IO1 B;  5AKK A;  5AKI A;  1L7O A;  4JV2 A;  2GBK A;  2KD0 A;  3QUT A;  3RNF C;  5J2C A;  1CK1 A;  3JPR A;  2PJH A;  2GB1 A;  1L7M A;  2B6G A;  4MHV A;  3M3J A;  3MHZ A;  5DDY A;  1UD7 A;  2BYE A;  4RM8 A;  2V4L A;  9ICQ A;  2PLP A;  3TKA A;  5HP4 A;  2DL0 A;  1GO3 F;  4KX3 A;  1RXW A;  2IYD B;  5EOZ A;  3ZDT A;  7ICR A;  1YT3 A;  4F5Q A;  2FBW B;  4DO9 A;  1A6S A;  1YZ7 A;  3QUC A;  2JMG A;  4RPY A;  1I4H A;  1H38 A;  9ICL A;  4RQ4 A;  4ED1 A;  2N0S B;  1RZT A;  3L5K A;  2YB1 A;  3F5E A;  3N20 C;  4GB9 A;  5BMG A;  1U47 A;  2I9G A;  1OQR A;  3C5F A;  2PIA A;  5JRT A;  4O3O A;  1GC7 A;  3OAW A;  3ONS A;  1UPH A;  4W9I A;  1N5W A;  2MP2 B;  2ZIW A;  4TUR A;  4FFD A;  5K4L A;  1T3N A;  1UWX A;  5KL1 B;  5J2F A;  1WG8 A;  2WXK A;  4Z6F A;  4I6N B;  1NK4 A;  2KJ8 A;  1N56 A;  1BML C;  2KTF A;  2IY1 B;  5DLG A;  2BTE A;  1KJT A;  3GV5 B;  4YR3 A;  3EW9 A;  2JT4 B;  4OJO A;  4ED0 A;  1FD6 A;  4QZD A;  3DWM A;  2LAS A;  4OJ5 A;  3BK1 A;  1R7S A;  1MG8 A;  3ED5 A;  2EZZ A;  9ICP A;  2KAJ A;  2K4P A;  4ECS A;  1SZP A;  4O1N A;  4QZB A;  1ZQK A;  4YTP B;  4MM3 B;  1QZE A;  4DDG D;  4I2F A;  2QIL A;  3C2L A;  4WH4 A;  3TCA A;  3ZUN A;  3FM9 A;  5ALQ A;  3AB5 A;  3VTW A;  2MEK A;  9ICH A;  2NS5 A;  4DXA B;  2P6R A;  2ZW1 A;  1EU4 A;  2BF8 B;  2XBB C;  4IM3 A;  3PVX A;  1JMS A;  4RQ6 A;  4IC7 B;  2BPF A;  2Q4T A;  4EEN A;  3SZ2 A;  3IG3 A;  3RBD A;  1EXN A;  5EE3 A;  3N7P D;  3SEN A;  1WYW B;  3E58 A;  1XLO A;  3PSI A;  3AE7 B;  5T8I A;  4KIT B;  2GOL A;  5BYR A;  3ABV B;  2M17 A;  3MBY A;  2I6X A;  2D3C A;  4LNI A;  2UYZ B;  3C0R B;  5ALJ A;  2FIF A;  2IO0 B;  3UI3 A;  3HX0 A;  1CQV A;  1UH6 A;  2G3Q B;  1E5W A;  2NBU A;  5L1K A;  4DSK A;  5C3J B;  4I6P A;  4LCD E;  4J9M A;  3UF8 A;  1I4X A;  1SE4 A;  5EE0 A;  3SEB A;  4F8R A;  3AL0 B;  2NYV A;  4LNK A;  2GBJ A;  2WDV B;  2EAM A;  2EZY A;  1P0R A;  2KFK B;  1IYF A;  5D49 A;  2VH1 A;  1JI7 A;  2H3F A;  3BII D;  4JQW C;  1R4N I;  2WXO A;  3A4S C;  2IBK A;  2JHD A;  1YMH E;  2N4F A;  3NVV A;  4CCH A;  1PQS A;  1L2N A;  4TUP A;  3Q8Q B;  3PZD A;  1SIJ A;  2Z0D B;  4JE3 B;  1ZQO A;  5ALP A;  5KFG A;  3KHL A;  1BNP A;  3JPT A;  3UQB A;  4JWS C;  2K1F A;  2KOX A;  3RI7 C;  1NEN B;  4HKZ E;  3VC8 A;  5KT4 A;  1X6J A;  3DBR I;  2DX5 B;  2OYY A;  2AX5 A;  4NL9 C;  3KUC B;  2BCQ A;  3BY4 B;  2NRZ A;  4CGZ A;  2JXT A;  4MM3 A;  4DSI A;  1VCB A;  4DCC A;  3MC9 A;  3RH5 A;  3UIO B;  3AE5 B;  3SYZ A;  2KFK A;  2NO4 A;  3WK9 A;  3RAX A;  1ZQB A;  4AYB F;  2BPG A;  1NDD A;  2K39 A;  3QC8 B;  3FC4 A;  3VAW A;  3TAR A;  2MBO A;  2F44 A;  2O6K A;  3T3F A;  5AKX A;  4M47 A;  4I2H A;  3O65 B;  3H7I A;  3T5K A;  5EWF A;  1MPE A;  1V6E A;  2D3A A;  2KO3 A;  4W9C A;  3PY8 A;  1NK8 A;  1F9J A;  3H0R B;  4O0I A;  2UVV A;  3ML8 A;  4F92 B;  2WNM A;  3NZU A;  5AKJ A;  2ZIW B;  1ACC A;  4UAY A;  5KFS A;  1L3T A;  2KXJ A;  1KW4 A;  3ZI4 A;  4YD1 A;  3B0Y A;  4M6W B;  3L54 A;  3HWT A;  2KHV A;  4NQL B;  4PHE A;  5AHX A;  4HPP A;  2WYQ A;  5KFC A;  4PL1 A;  3G6Y A;  3GV7 B;  1GB1 A;  2HVH A;  3CMM B;  4NLN A;  1SL1 A;  4YSX B;  3UQA A;  1WJ6 A;  1ZKH A;  3CYM A;  3UIP B;  4Q8F A;  4NAM A;  2MSE D;  5HI1 A;  5ALT A;  4DFD A;  3P4Q B;  1KLV A;  2K8B B;  4ECW A;  4JGH B;  3EPI A;  4KLT A;  1T0R C;  3VR8 B;  1ZQX A;  4M04 A;  1WGR A;  2EKI A;  3Q8C A;  1PK3 A;  3RH4 A;  2R8G A;  5ALY A;  1L3V A;  3AUO A;  2KLG A;  2KVZ A;  1V8C A;  3QE9 Y;  7ICE A;  4K1R B;  1L4D B;  2WU2 B;  3CNH A;  2XC9 A;  2BQU A;  3KTQ A;  1T6B X;  1NK6 A;  5J2J A;  4ED2 A;  2KIW A;  4PS8 A;  1LO5 D;  2LMC A;  2INN E;  2KWU B;  1XLP A;  3OJ4 B;  4FAD A;  2WAQ C;  4EFO A;  3RB6 A;  3T5L A;  2FPM A;  1M94 A;  3BVM A;  2L3Z A;  4F1S A;  3Q8F A;  2KWC A;  3HPO A;  1D8B A;  3KHH A;  3ZVV A;  2HBK A;  1XT9 B;  2DF4 B;  4O3R A; 
#chains in the Genus database with same CATH homology
 1E9M A;  1EWC A;  4MH8 A;  2VZK D;  1C9F A;  3Q8A A;  3FIL A;  2DWQ A;  1KFY B;  4HKQ A;  1YNT E;  4DXG A;  4YWG G;  3MFG A;  4ZHO A;  3P63 A;  2I38 A;  4JX1 C;  3W1S A;  1V1O A;  4ZYS A;  4PT5 A;  1FNV A;  3VRA B;  2K9X A;  1ENF A;  3MC0 B;  1AW7 A;  1HA5 A;  1PDX A;  1TKG A;  1V97 A;  4C7Z A;  1T5X D;  2ON8 A;  3AEC B;  1AYF A;  2WP9 B;  1YQ4 B;  2J52 A;  1NEK B;  3TEY A;  4OZB A;  4YSY B;  4D2K A;  1TS5 A;  5I4D A;  1SEB D;  2IPK D;  5D3I B;  4N6E B;  3WCQ A;  1VDV A;  2AQ2 B;  2CJN A;  1E6E B;  3P1M A;  2WXJ A;  3HVD A;  4C7Y A;  4WWM A;  2QSD A;  1IBX A;  2K3U A;  5MPO A;  1L0X B;  3E56 A;  3KLS X;  1I4G A;  3KWL A;  5EE9 A;  2D5G A;  4AS1 A;  3AN1 A;  2FUG 1;  4CQN A;  1C78 A;  2K0P A;  4GDK B;  2TSS A;  1PYW D;  4RF0 A;  2WXR A;  3BK2 A;  3TEZ A;  1IGD A;  1N5X A;  3MP9 A;  1VJK A;  4M0W A;  1TKE A;  1C79 A;  4HEA 1;  1IUE A;  4UDU C;  3Q8E A;  1SJH D;  5BMH A;  3P4R B;  2IGH A;  3AE3 B;  5H8Y E;  2LHE A;  3W5V B;  4IKG A;  3PZ8 A;  4C56 C;  1FM0 D;  3U7Z A;  1SB3 C;  2HDE A;  2SAK A;  1YJI A;  5BYQ A;  4DQO C;  2LHD A;  1FFU A;  4RH6 A;  1SE2 A;  2LFI A;  2RPV A;  1D5Z C;  2XN9 C;  4ARC A;  1HQR D;  4NJC A;  4HRS A;  1IGC A;  1KF6 B;  4OVZ A;  2LEK A;  4XWT A;  2Y5C A;  1TY0 A;  3KQ4 A;  3AE6 B;  4ZOH C;  1KLG D;  1HXY D;  1EU3 A;  1CJE A;  4FXC A;  3TUO A;  1NYR A;  3MJ5 A;  1SSN A;  1K53 A;  4ITK A;  3GS2 A;  2K5P A;  2YEP B;  1WXQ A;  1FCC C;  2LUM A;  2BYT A;  1MHX A;  3KWV A;  2BBC A;  2NTT A;  3U2S C;  3AMZ A;  4OHJ A;  2L1A A;  4A90 A;  1VRA B;  1XO3 A;  2IDY A;  2WU5 B;  5HFY A;  2L83 A;  4R3D A;  1I4Q A;  1DGJ A;  1JWS D;  1XCQ L;  1N62 A;  2IGD A;  1FMA D;  1I4R A;  2WXF A;  1OQQ A;  1SE3 A;  2JQR B;  1XLQ A;  1QIL A;  2W3S A;  5D3D A;  4EE2 A;  1D6E C;  2WDQ B;  1UGJ A;  5AUI A;  2J53 A;  2JYT A;  2WLB A;  1C77 A;  4ZRP A;  1JRP A;  1C4P A;  2KDM A;  1FNU A;  2KN4 A;  1KLU D;  3ZJV A;  1ET9 A;  1PGB A;  2M56 B;  4A9A A;  1ZDV A;  2KAC A;  1QT9 A;  4OZC A;  3AM9 A;  2YEP F;  3R8B A;  4YSZ B;  1JCK B;  4J3O D;  3FIL B;  1N60 A;  4HRO A;  4GDL B;  1K51 A;  2MJE A;  4Q2J A;  2QEJ C;  2J42 A;  1D4B A;  4IOI E;  3ETR A;  2WDR B;  1E10 A;  3NRZ A;  2ICI A;  3NZ3 A;  3HUI A;  2PVO D;  3CIR B;  5AUK A;  3BWU D;  1BUI C;  1WYG A;  1JWU D;  2OED A;  2WXM A;  1ZOY B;  3IT6 B;  3URY A;  2N9L A;  1RWS A;  1L6V A;  1MHH E;  4A8X C;  1SBB B;  1MVK A;  4XWW A;  4DXF A;  1F2R I;  1PGA A;  4US8 A;  1A70 A;  4JWU C;  3P42 A;  3CWI A;  2WXG A;  1L4Z B;  1DOY A;  1ZXH A;  1ZUD 2;  1L5P A;  1JAL A;  1HZ6 A;  2JWU A;  5FR3 A;  1YQ3 B;  5FK9 C;  1GOZ A;  1VZ6 A;  3Q69 A;  1GAQ B;  1QQR A;  4TQ0 A;  2E3T A;  2H88 B;  2IGG A;  2IJ0 A;  4YTM B;  3TEW A;  3ZJT A;  1STE A;  3AEG B;  5BMI A;  1QF6 A;  4HJG E;  4US9 A;  2AQ1 B;  4P6V F;  5HG2 A;  2WXQ A;  4WIP A;  3ZQ4 A;  3O13 A;  4ARI A;  1Y56 A;  2W82 A;  1E0Z A;  3AEA B;  3N9Y C;  2RMM A;  1KRH A;  1TZO A;  1WSP A;  1JW9 D;  3AE2 B;  4AQ7 A;  1N63 A;  4RNA A;  1JQ4 A;  2JYE A;  3H8H A;  2LJI A;  3P4S B;  4KX6 B;  1ZXI A;  2B76 B;  2SEB D;  2JX5 A;  1VZ8 A;  4YTN B;  2FE8 A;  4IDI A;  2JZP A;  4ZRQ A;  3B2G A;  1AN8 A;  4MT5 A;  2L52 A;  3V3X A;  4OW0 A;  3I9V 1;  2QJL A;  4LLG M;  3R2T A;  1HEZ E;  1P7F A;  1FFV A;  2Y5P A;  4KGR A;  2BS2 B;  3GP7 A;  1WGK A;  3FAH A;  4XDD A;  4WQM A;  3PZ7 A;  2W54 A;  1J7B A;  4TMA B;  1NYQ A;  3LB8 C;  4RGT A;  2HTM E;  2VZK B;  4RGO S;  4NAW B;  5JXV A;  2KMM A;  2N7J A;  5FKA C;  2CU3 A;  1DOI A;  1EM7 A;  2DLB A;  4YT0 B;  3V05 A;  4RCO A;  2JU6 X;  2Z8L A;  2PTL A;  5C2T B;  3Q8B A;  1F2R C;  1FXI A;  1JWA D;  1FNW A;  3NS1 A;  1QKZ A;  1C4C A;  3LYY A;  2GRI A;  1PFD A;  3AED B;  1XXG A;  2DYO A;  1D5X C;  3HRD D;  4H2A A;  2QMT A;  4C80 A;  1CK1 A;  3AE8 B;  2WS3 B;  1XEE A;  2BS3 B;  2GB1 A;  3MHZ A;  3AH7 A;  4A55 A;  3ZJU A;  3AE4 B;  1B9R A;  1JWM D;  1RFK A;  3VR9 B;  3VQI A;  1T3Q A;  1FO4 A;  3T3O A;  2PLP A;  4L23 A;  1VZ7 A;  4GLS C;  4XE0 A;  3AEE B;  1FCL A;  3L4P A;  1ZE3 D;  2M0A A;  2DBY A;  1L6U A;  2FBW B;  2KWD A;  2L32 A;  4KKJ A;  2E6X A;  1I4H A;  3AE1 B;  2CJO A;  1TS2 A;  1ET6 A;  2N0S B;  4YXD B;  2NMQ A;  3B9J A;  2MH7 A;  1CZP A;  5BMG A;  4B0M A;  1OQR A;  2KQ4 X;  4KGT A;  1OFF A;  2PIA A;  2LGI A;  1QOF A;  3B2F A;  1N5W A;  3IAS 1;  1UWX A;  2BS4 B;  1NVI D;  2WXK A;  2Q5W D;  3AEF B;  4ZHP A;  1BML C;  2BTE A;  2BW2 A;  3AEB B;  2RDG A;  2PMV A;  1FRR A;  3RPF C;  1FEH A;  1K52 A;  2WQY B;  1I4P A;  4N58 A;  4TQ1 A;  3VRB B;  1FD6 A;  3DWM A;  4RGM A;  2I2Y A;  1UUP A;  4L1B A;  3BK1 A;  1R7S A;  4KGS A;  2OHF A;  1FRD A;  2KAJ A;  4XDC A;  1K50 A;  5HHD G;  3NUH B;  4O1N A;  1FXA A;  3U52 E;  1WWT A;  2NTS A;  2G9H D;  4MM3 B;  4YTP B;  1YJJ A;  1V1P A;  5GXG B;  2QIL A;  4WH4 A;  1AWD A;  2PKO A;  3AB5 A;  2MEK A;  2R61 A;  3TSS A;  1TYG B;  2ZW1 A;  1EU4 A;  1NI3 A;  1L0V B;  1YN5 A;  1BXT A;  3OWE B;  5EE1 A;  4REZ A;  3PO0 A;  2WXL A;  3SR6 A;  4MAC A;  1B1Z A;  2N9K A;  5EE3 A;  1WRI A;  1P7E A;  1XLO A;  3AE7 B;  3BVZ A;  4LTU A;  5T8I A;  4LK0 M;  1GPX A;  2W3R A;  5D7G A;  3IAM 1;  5BYR A;  1DYQ A;  3ABV B;  2ONQ A;  1ROE A;  3LXF A;  1QLB B;  3UI3 A;  2WXH A;  4OZA A;  1IBX B;  3ZGZ A;  1PGX A;  1CQV A;  2BB5 A;  5C3J B;  1KTK A;  2V3N A;  3AE9 B;  1I4X A;  1SE4 A;  3C8Y A;  4TSS A;  5EE0 A;  3SEB A;  2BB6 A;  2WDV B;  1PUT A;  1RYJ A;  2PVG C;  3BII D;  2WXO A;  3T3N A;  1YMH E;  1FIQ A;  2G1E A;  3NVV A;  3I57 A;  4N59 A;  4RF1 A;  4JE3 B;  1SIJ A;  4NZL B;  2V0G A;  3IXS A;  1DOX A;  1VLB A;  4JWS C;  3SFE B;  1NEN B;  4HKZ E;  3E9S A;  1ESF A;  1TY2 A;  2AX5 A;  1TKY A;  3W5U B;  2K22 A;  1ZDX A;  2JXT A;  1F77 A;  3GB1 A;  1C4A A;  2QIE B;  1UWM A;  2J4X A;  3AE5 B;  1SF0 A;  1Q10 A;  4JPS A;  3FC4 A;  3AV8 A;  3NVY A;  4WUR A;  5G5H A;  3J9C A;  1SJE D;  2M19 A;  1MPE A;  3BYT B;  5G5G A;  3W9C B;  1HZ5 A;  1QOB A;  3ZYY X;  4RGN A;  1L0Y B;  2WNM A;  2GI9 A;  3NVZ A;  2AQ3 B;  1F0Z A;  1GB4 A;  1ACC A;  1VR9 A;  2ACZ B;  1TJE A;  2JSV X;  3NVW A;  1C76 A;  3P4P B;  3TEX A;  2V3P A;  2INP E;  1QOG A;  3U4E G;  2MJ3 A;  4USA A;  1XCT L;  1GB1 A;  2Y3A A;  4YSX B;  3DWG C;  4B0E A;  3SFD B;  4NAM A;  1KH0 A;  1TS4 A;  2X38 A;  5HI1 A;  5LNK 1;  3P4Q B;  2RDH A;  3RFZ B;  3VR8 B;  1E7P B;  3IT4 B;  3HVZ A;  4L2Y A;  2PW9 A;  2ZW0 A;  2EKI A;  3Q8C A;  3BYY B;  4RFB A;  1J7A A;  4WAF A;  1UNS A;  1ZP0 B;  1ZPS A;  2H89 B;  1M4V A;  4KKI A;  1V8C A;  1V1P B;  2W55 A;  5BYS A;  3W2D A;  1L4D B;  2V4I B;  1SXT A;  3EA6 A;  2WU2 B;  2BT6 A;  2DYM A;  1T6B X;  3BVG A;  1YN3 A;  2EEL A;  3R2I A;  1JRO A;  1MI0 A;  5TSS A;  1EWY C;  2MJD A;  1LO5 D;  3EGR A;  1JML A;  2LMC A;  1YN4 A;  2XNA C;  2INN E;  1XLP A;  5H92 C;  1J7C A;  2WXI A;  1RM6 C;  2WXN A;  1D5M C;  4P16 A;  1JWB D;  5E6J A;  3BVM A;  1XF5 L;  1N61 A;  3Q8F A;  1QOA A;  1TS3 A;  1XLN A;  3BZD B;  3EUB 2;  4A6Q A;  2WXP A;  1I7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...