1ZXIA

Reconstituted co dehydrogenase from oligotropha carboxidovorans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Structural and functional reconstruction in situ of the [CuSMoO(2)] active site of carbon monoxide dehydrogenase from the carbon monoxide oxidizing eubacterium Oligotropha carboxidovorans
pubmed doi rcsb
total genus 50
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1zxiA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zxiA01
5H92C 1NYQA 2E3TA 1DOXA 3NVVA 2BS2B 1N63A 3AE1B 4WWMA 2MJ3A 1ROEA 1FM0D 1ZP0B 3AMZA 1RWSA 5G5HA 2FBWB 2WP9B 3AECB 2W55A 4C80A 1WXQA 2K5PA 2K9XA 1FMAD 1FIQA 1FXAA 1JROA 1YQ3B 2PVOD 2WLBA 2W3SA 2K22A 3AEEB 2QIEB 1QOBA 4N58A 1QOFA 5EE3A 3VR8B 3W5UB 3CIRB 5GXGB 3ZYYX 1B9RA 1E10A 1JRPA 1FO4A 2MJDA 1QOGA 1TYGB 1ZUD2 2PIAA 3B2FA 2ACZB 1OQQA 1VJKA 1E7PB 2DWQA 1XLOA 2L83A 2MJEA 1OQRA 3FC4A 1DOIA 2MH7A 2WQYB 2N0SB 1CZPA 2QJLA 5EE1A 1NEKB 3SFDB 4ZHOA 2DBYA 3ABVB 3SFEB 2W3RA 1L6UA 2OHFA 1ZXIA 3B9JA 1GAQB 1FRDA 1JWAD 2PVGC 3AE9B 1N61A 5AUIA 1JW9D 3AE3B 3VRBB 1WGKA 2M56B 1FFVA 5H8YE 4YSYB 1VLBA 1JQ4A 5G5GA 4YTPB 5EE0A 1TKGA 2H89B 2B76B 3AE5B 4FXCA 4IDIA 4P6VF 3WCQA 3AEFB 1RYJA 1YQ4B 3AN1A 1OFFA 1ZOYB 1KF6B 2M19A 2PKOA 4LTUA 1SB3C 1FXIA 1WRIA 2CJNA 1VDVA 2WU2B 3VR9B 1E6EB 1PUTA 4YSZB 1E0ZA 3HRDD 1PFDA 4US9A 2BT6A 3AE4B 4HROA 1T3QA 1GPXA 3P1MA 1DOYA 4US8A 1PDXA 2KMMA 1J7BA 1TKYA 2WDRB 2WU5B 3AE6B 3DWMA 4WQMA 5AUKA 2HTME 4ZHPA 3AEGB 3ETRA 3AEAB 4JX1C 5MPOA 1DGJA 3LXFA 1QT9A 1NVID 2JQRB 3P4PB 3AM9A 1R7SA 1V97A 1UWMA 2LEKA 1NI3A 1QOAA 1XLQA 5C2TB 2H88B 3BIID 1NENB 4A9AA 3AB5A 3NVWA 3FAHA 1RFKA 1EWYC 4KX6B 1RM6C 2WS3B 3AEDB 3HVZA 4YTNB 1L5PA 3W9CB 4N6EB 1FFUA 1N5XA 1YJJA 1SF0A 1TKEA 1WYGA 1AWDA 1WWTA 1I7HA 2WDQB 1JWBD 4USAA 1A70A 2JX5A 2WDVB 3P4QB 1AYFA 1L6VA 3AH7A 3DWGC 2AX5A 1QLBB 4JWUC 1CJEA 2W54A 1TJEA 3B2GA 3EUB2 1SIJA 1NYRA 3W5VB 1N62A 1KFYB 1L0VB 1XO3A 5EE9A 4YTMB 2L52A 3AE7B 1KRHA 1J7CA 3P4SB 3KWLA 3AE2B 5C3JB 3PO0A 3NVZA 3VRAB 1YJIA 4N59A 1XLNA 3P63A 3L4PA 3HUIA 3CWIA 3P4RB 2EKIA 4YSXB 1JALA 1FRRA 3AEBB 1N5WA 1QF6A 3AV8A 2BS4B 1IUEA 4ZOHC 2G1EA 4YT0B 4C7YA 3NVYA 3RPFC 3AE8B 4YXDB 3SR6A 4JWSC 1F0ZA 2Q5WD 3NS1A 2BS3B 1XLPA 1V8CA 1N60A 3NRZA 1J7AA 3LB8C 4HRSA 2CU3A 4C7ZA 1E9MA 2KAJA 4ITKA 2CJOA 2Y5CA
chains in the Genus database with same CATH superfamily
4A8EA 2E3TA 4NJ8A 2WHEA 1SXDA 1FM0D 1JX4A 2NRXA 3Q8FA 1Q46A 2AQ0A 1WXQA 2IJ0A 4IL6U 2LVPA 1FMAD 3T8MA 5C1ZA 2BYTA 5JRTA 1JROA 1U47A 4M6WB 4FZLA 3KLSX 4CCHA 3OLMD 2CN1A 2NR2A 5KT4A 3W5UB 3CIRB 2JZBB 5BYSA 7ICFA 7ICKA 4K7SA 5KFNA 3UQ0A 4KLMA 3DVNU 9ICMA 5KG0A 2ZJ5A 1F9JA 4ZRJA 1T0RC 2QB0A 1UQVA 1NK6A 8ICKA 4EEKA 2X8XX 5J2KA 1V38A 3IBEA 1ZQFA 4EX7A 2OHFA 5F9NA 1L6UA 3NZSA 2XGPA 1FRDA 2NO5A 2OH2A 2W9MA 3APFA 1S3SG 3PVXA 1KLNA 3ISCA 1OXJA 1TS2A 3WK8A 5J2EA 4F5QA 4M9HA 1QZEA 2BBCA 3APCA 4EEYA 3RJKA 3FILA 3MC8A 4J3OD 2KV2A 3TJPA 2UVRA 4KN7A 5ALJA 1BNPA 3A0BU 2L3ZA 3GE8C 4P6VF 3MR6A 2ISOA 2IGGA 5G55A 4Q8FA 4F4KA 2WXOA 5KT7A 4DL4A 8ICIA 2ZIXB 9ICGA 1SXTA 3DHIC 4LTUA 3T3OA 1JI7A 4IQTA 4CRXA 5AI4A 3H1UA 2E8NA 4DLEA 3HRDD 2D3GA 4CQNA 1EM7A 4ECVA 4B0MA 4WWPA 5H2FU 4M9LA 4FE3A 4ECUA 3PREA 5AUKA 1L8LA 3ZTDA 3C19A 4P4OA 2ZIUB 2YQEA 1XLQA 1X1MA 2CS4A 4NQLB 3W2DA 3GIMA 1GUAB 4HVBA 2KJ9A 4CF3A 2LRWA 5KFVA 1PZNA 4FBUA 3G6XA 1YMHE 2W82A 5KNIA 4HCPB 4IM2A 2CPRA 3W9CB 4ARCA 5CJ7A 2EH9A 3C0RB 5DQIA 4NV0A 4AP9A 4X5VA 1A70A 2CHZA 3I63C 1LKYA 1IBXA 1V2YA 4K81A 3ZJTA 3HPOA 1RYUA 3AULA 3RAQA 4W9FA 4J9MA 4YMNA 1TE2A 3NG0A 4NAMA 1D8LA 3TEWA 2E6XA 4QWEA 5JH5C 2JUOA 3VQIA 2B21A 1TIFA 3L4PA 2ZW1A 1HE8A 4DS5A 3GV5B 4W9KA 3EPGA 3CWIA 4DOCA 1K52A 5E6OA 4PGQA 4RQ6A 2LM1A 2WAQF 1L3UA 1C7YA 3RPFC 5KL1B 2M1MA 2EKEC 3PX6A 2KX0A 2O6KA 2FCSA 3NRZA 3DQVA 4UB3A 2IY0B 3MBYA 5AKXA 1L6NA 2LUEA 3VTWA 4BAXA 3GILA 1I4PA 2G45B 4DHZB 1RZTA 3RNAC 1WM3A 5IA7A 4B9MA 5J2HA 1EF5A 2BZFA 4I2BA 2D3CA 3OAWA 5IP4D 3AMZA 1RWSA 2R2QA 2FPMA 3ZDBA 4P0QB 4OO1J 2K9XA 4F5NA 2GO7A 4RQNA 1FEHA 5J2RA 2I1JA 1A76A 3SMVA 4AUQC 2O6VB 3PW2A 3DV9A 3VTVA 1K8RB 3U2SC 2H3QA 3PSTA 1UA1A 3B0XA 1X9WA 1ZQPA 2JEJA 1TYGB 4H2AA 5G2NA 1NKBA 5KFRA 1YX6B 1XLOA 5ALHA 2RD0A 3PR4A 3LVWA 2WFAA 1DOIA 4M04A 1NBFC 3MHZA 4TQRA 2HW3A 1J97A 8ICPA 8ICRA 3X0WA 2W7OA 4TUSA 4DWIA 5KFQA 2DZKA 3PNCA 5D3IB 2W8KA 1N61A 4B9SA 2UU7A 1XO1A 3KUDB 1D3ZA 2NMQA 3VRBB 2DFLA 2KSOB 2KO3A 4ED2A 2WF5A 3GV8B 3X23A 5HFYA 3PX0A 1EO6A 4GXIA 1TKGA 2YMQA 3WU2U 3QNMA 4G9BA 3AEFB 3N1YC 3G6VA 4MFCA 2K25A 4A90A 1MFWA 2EELA 3M62B 4DFDA 3JSVA 2L0TA 2Q0ZX 5AK4A 4MJSA 3VXWA 4HAIA 4KLUA 2AQ2B 3NZ3A 1ZYQA 2NVUI 3PV8A 1NKCA 2VJ4A 9ICAA 2QB1A 1GNUA 2RDHA 3RBDA 4QZCA 5L1KA 4FHKA 4KIKB 3BVZA 1CEZA 5J0TA 2WNMA 4MACA 5AM0A 2R18A 4HJKA 3GOEA 1VR9A 2FUG1 4GXKA 3LDZE 4LNOA 2MU2A 4JPSA 2BDUA 8ICSA 2HBMA 1QOAA 5BOMA 2LMRA 1SE4A 3R2IA 3RMKC 4C8MA 3BQ2A 2K4HA 1KDHA 3UF8A 2KJRA 3WK4A 2M9NA 3OJ3A 2D8CA 5HHHA 1KRPA 2FMQA 5A0LA 1D5MC 1Q10A 2K6DB 2KNBA 2XO7A 1QQRA 4ECTA 5ALWA 2KIWA 4RQ8A 2HDOA 1N62A 2L1AA 1UHUA 4YTMB 3KTQA 2L52A 1QSLA 4URKA 5ALOA 3RD2A 2QLTA 3PO0A 1ZQOA 3CSTA 3RB0A 1S10A 1KTKA 2B6GA 3BK2A 3TEZA 7ICOA 4QAYA 4P7IA 1JALA 2KWVB 3HHMA 2LI6A 3RCZA 8ICJA 3PRPB 4F5OA 4FA6A 4C7YA 1Z00A 3H8WA 1UBIA 2L05A 4I29A 3ML9A 4K7UA 4ED0A 3I76A 2K6QA 2MBHA 2ZNVB 1HEZE 3D32A 3L17A 2FI1A 2MRPA 1BPDA 3LB8C 2KACA 4GU2A 8ICQA 4W9DA 5D4BA 4RPZA 3IDWA 4DDID 3F2DA 2Y5CA 2W43A 3VTUA 5ALNA 1HEKA 2N7DA 2L7RA 2I6XA 5J2BA 3BS7A 5G5HA 2FBWB 2MHJA 5GMVA 2KJ8A 3OWEB 4O3MA 1WJ6A 3H8MA 4TMAB 4NWIA 4M2YA 4R63A 1PUZA 5IIMA 4NJ7A 2FJ6A 5T8IA 3Q8EA 5L9XA 1UNSA 1C3TA 2DKZA 5EE3A 9ICIA 3EC8A 5J2IA 4YFKA 4WQOB 1Y8RC 2LRUA 4QW9A 3WANA 4OVZA 4PK1A 4XWWA 2MBEA 2PIAA 4QZEA 2YB4A 1C20A 4IQUA 4OJOA 5KFXA 3DVGX 4TV3A 1N2XA 1E8XA 4IRKA 2KDBA 2Y9TA 2QJLA 2J6UA 3ZTCA 4YD2A 2BB6A 2J53A 2A4ZA 3QIJA 1JN3A 4BFRA 5AKGA 2BCVA 3QU2A 3PLUA 2EAMA 4W9IA 3L0WB 4NQKE 2JZPA 2QDFA 2KWCA 2KTRB 3A9JB 1WGKA 1T0SC 1J2MA 4ZRIA 4RUAA 2V4RA 3QK0A 2NTTA 1MHHE 4EYIB 1ZQHA 4PYZA 2BDPA 1ISNA 2NPTA 4KLSA 4MFAA 2WDTB 4W9LA 4DSIA 3WKEA 3Q8LA 3EHVA 2FDRA 4NLZA 2GOWA 4RF1A 3TACB 4F5RA 4ED1A 2DYBA 3ZRFA 1WRIA 2JT4B 3V72A 3IT6B 1IM4A 4WJOA 1ET9A 1DYQA 9ICPA 1JXLA 4ANXA 3P1MA 2JRIB 4KX3A 2HI0A 4J9LA 2R8KA 8ICEA 4WQMA 2DNFA 3OPXA 2LWPA 2INDC 2HTME 4UB2A 1WCNA 4ICAA 2K8CB 5AM2A 1P7DA 2AGPA 1KLVA 1XSLA 3M6ZA 4UAYA 3KYCD 8ICCA 2MW5A 3LYYA 3RNBC 3N97B 4BOZB 2BPFA 2PPHA 1AARA 3N1ZC 4PPXA 5BPCA 3N28A 5KFJA 1C77A 2WS3B 2ZEQA 2DZIA 4YN4A 5HR6A 4LVSA 2MP2B 3A9KB 1EF1A 3W1SA 1BGXT 2GWSA 5CEHA 2ZTEA 4M02A 2Q4TA 1JWMD 4FJVB 3D6JA 3I57A 3R7QA 1P98A 2XIDA 3AE7B 2V9HA 1K1QA 1WX9A 4N59A 1MC8A 2MAXA 2HVHA 1WM2A 4W9CA 3ZJVA 4BVUC 1RYSA 2F8KA 4FZMA 7ICLA 2OEDA 5ALVA 4ARIA 3IVFA 1TAUA 3AE8B 1KFSA 9ICEA 1WMHB 4AP4C 2AGQA 1N60A 4ECYA 2O6VD 4ED8A 2KWUB 2W9BB 2HBLA 5KG2A 3HVDA 3QUQA 2G08A 7ICRA 1Z1VA 1FD6A 4M0WB 5J2AA 4IG7B 2LGYA 1KJTA 4II3B 4P1CC 4A3PA 4NLBA 4A20A 3M9NB 5DLFA 1SJHD 1ZQXA 2J7QB 1YQ3B 1ECWA 2INPE 5L1JA 4HPMB 2NCNA 4KLLA 4JQWC 2PFPA 2V3SA 1QOFA 1D4BA 5D46A 1ZQIA 3UMGA 4KLQA 3GIKA 4DL7A 3WALA 3ZYYX 1Q0WB 4XC2A 3ZDDA 1D9DA 1L0XB 2ACZB 3EZ5A 2GBRA 5HHDG 2UWQA 3BS5B 1ZOLA 9ICOA 3AU4A 5AI8A 3T5KA 2WQYB 4GDLA 4IC7B 4KZCA 2BQRA 1HIWA 1IV8A 2XVTA 2C2RA 2RPVA 4AQ7A 2KANA 1ZXIA 2Z0EB 4GFJA 4PYUA 2P66A 1WGHA 1SIFA 3I28A 1KQQA 5H8YE 3SAHA 3VUWA 5AZFA 3I5JC 1ENFA 1KTQA 2JGAA 3HX0A 3GP7A 3EFUA 3ZNGC 1PGAA 2KFJA 1S0MA 4RU9A 4ECZA 1L4ZB 2G09A 3W1SC 1Z3EB 5HP4A 2LMCA 4CF4A 4P2HA 4F92B 7ICQA 4RQ7A 2JVCA 5KFAA 1WRDB 2V4LA 1I35A 3KQ4A 3PW5A 3IT4B 4YSZB 1KOTA 3RZFA 1TY2A 3V61A 4DOBA 5FR6A 5EDSA 2NYVA 2XICA 2WU5B 4P0PA 2LXCA 3HILA 2AGOA 3UXNA 1LB2B 5AEKB 5JHAA 3Q3OC 5TR5A 2K8BB 4K4IA 3R66C 1FEZA 5MPOA 1DGJA 1SL2A 3DHHC 1NVID 3NGDA 3SV3A 2LEKA 4GN1A 3NOBA 4Y2PA 3VUYA 2LYHA 1QSYA 2K1FA 4HPPA 4M8MA 4ECSA 4QZ9A 1RFKA 1FCLA 2MUTA 1BPZA 1ZRMA 3QA8A 3VH4B 4OCZA 4P4PA 2ZUDA 4I2AA 2CU1A 3L54A 4JWUC 1WF9A 4M6WA 5ALPA 1VRAB 3RRHA 1KW4A 1F5SA 2D6FC 4NLKA 2JYEA 1DK3A 2JZBA 5J8YA 3P4SB 4QWDA 4KMUA 3ZDEA 3QJZA 3VH3B 4O3NA 4EKUA 5AI0A 2JEIA 2ZJAA 2FCMA 2BCSA 1ZQEA 1GO3F 3WAOA 4MSMB 1N5WA 4XDCA 1JMSA 1LV5A 5BO4B 3KUCB 1XNSA 4X57B 4JWSC 2KN4A 2IA6A 2BS3B 1V8CA 1L8OA 4CNQA 2LD9A 5FKAC 1SWVA 2ZIVB 3U30A 2G06A 4R8UA 4ITKA 1I4GA 1WJ4A 3SEIA 3IAS1 4QZIA 3NUHB 3OJ4B 2H3ZA 3AE1B 5HKHA 4J9QA 2KQ4X 4LNFA 3Q3JA 1I4RA 4AYBF 2HVIA 3ECIA 3ZDAA 5BYQA 1P7EA 3S6JA 2W55A 1SL1A 2ZIXA 3TKAA 9ICVA 1XU4A 2D3BA 2K22A 5D3DA 2CRXA 1TFRA 4FJZA 1IIPA 4BZAA 3HT3A 3OHBA 1R4MB 2KX3A 2L0FA 3K1ZA 4GLXA 4F2RA 1QOGA 2Y1JA 2VA3A 2HSZA 2HHWA 3N30A 4Y2VA 4RQ2A 1IP9A 2CHWA 4IRCA 2ZIUA 2HHUA 1IYFA 1UCVA 3KBBA 2ZTCA 3SFDB 1NEKB 2R2OA 3VUXA 5DQHA 2C7MB 3SFEB 4O5KA 2OJRA 1JWAD 2C22A 5J17A 2LM4A 3NZUA 4IOIE 1X6JA 2GLEA 5AM1A 1SV0C 2MA1A 4PS3A 2LYBA 1SE2A 2PEAA 4EOYA 1A0PA 1FFVA 2LVQA 2WF6A 1X9SA 2IBKA 4O3SA 2C28A 4IM0A 2LHDA 3HW8A 4UB4A 1WI0A 4YSYB 1NJXA 2K0PA 1ZD4A 1C4CA 2Y0SF 2H89B 4KV2A 4CO7A 4KN4A 4EX6A 2A3VA 1YT3A 1KBUA 1ZQYA 3AN1A 2KN7A 9ICRA 1HTQA 3L13A 3SDLC 2W9AA 3SQIA 3C2KA 2DKXA 4AWJA 2DLBA 1FXTB 3IFWB 4HKZE 3BWUD 2EAOA 2KYWA 1NDDA 5J8YC 4PHPA 1M6YA 2A19A 3LWMA 2YMLA 3SENA 2WX1A 1TKYA 4ELTA 4C56C 2ZVNA 2JZZA 2BF8B 3PRZA 3K4GA 4GOCA 5IINA 4HLEA 5DPTA 3AM9A 4C4RA 1GG3A 1SV4A 2GBNA 1NI3A 2DPIA 3BIID 1O03A 3THVA 1T94A 4EUTA 8ICVA 1C79A 3MTNB 5EWEA 1XSNA 1FFUA 4NPNA 4P0QA 3OJUA 1TV9A 2ZCCA 3MR5A 1JUDA 5J0PA 1SE9A 3NS8A 5DPSA 4DQQA 2OWOA 1KFYB 4F50A 2D10A 4YVZA 4DHZE 1LXDA 2O6VA 3ENEA 1KRHA 2Y1IA 3PMLA 3UINB 1ZPSA 2FE9A 3PW4A 1CUKA 3ONNA 1I4XA 4EBEA 1S0OA 4YG2A 3ZJUA 3AU5A 5AKZA 1EWCA 3N9YC 4UB1A 4QZAA 5J18A 1WCLA 2BPGA 1SKWA 2HOFA 1BXTA 2DAJA 1QF6A 4WJNA 3FYHA 2BS4B 2MRLA 4QJFB 2ZUBA 1A77A 3IG5A 4I2EA 4WAAA 3V6HA 4YXDB 4MF8A 4J9RA 3Q8SB 8ICOA 1CMXB 4U7CA 5LLIA 4UB8U 1L7PA 2YX8A 3PS6A 2KSOA 4F72A 4G3XB 1E9MA 3MFHA 4JGHB 2CJOA 1UGJA 1ZQ1C 4HEA1 2KDFB 1KN5A 2F44A 4DFPA 1LVHA 4Y2TA 5KFEA 1ZQSA 1WXVA 4C00A 1K5OA 1X66A 5D94A 1FXAA 5HMLA 2RDIA 1NJYA 4N58A 2WXFA 3EA6A 4KGRA 3WKAA 3M9OB 3KZXA 1Z5SB 4KIKA 2LJ5A 3PRMB 2FCNA 2A1JB 3PVLA 5AKYA 3RJFA 2HOIA 2VA2A 2MJEA 1OQRA 1JMLA 2BGWA 2EZYA 2W11A 1CZPA 1VZ6A 4FZNA 8ICYA 5J29A 1HTOA 1SE3A 3U4EG 2MA9B 2OOBB 3CW2C 1WY8A 2XK5B 4UAUA 3RNFC 2ISPA 3WAPA 1HZ6A 4BXOB 1V85A 4NXZA 5DBCA 1YN4A 3AU2A 4JV1A 4CGZA 1TK0A 4DHJB 2KICA 5G5GA 2J52A 5EE0A 3EFCA 2IPKD 4FXCA 1ZQTA 1V5TA 2FE8A 2FIDA 3UM9A 2A1AA 4PS8A 3D2NA 1RAXA 1ZOYB 3TARA 2XGQA 2G3QB 2KZZA 2J42A 2HJ1A 3R9KA 5J0QA 3VR9B 3ZQ4A 4TUPA 4FFDA 1JRUA 2ICIA 1T4GA 4UDUC 3RYTA 4E3CA 2ZPYA 4A55A 4CE6A 2E1FA 3M1YA 1TKDA 4J9KA 2KVCA 3H4DA 3MR2A 1ZQQA 4B9VA 1VCBA 4NY0A 2JY6A 2O2VB 1RYRA 3NJTA 2JYTA 4EZKA 1U9LA 2GI9A 2LGDA 2GBKA 1WR6E 2D3DA 3JW0X 5DDYA 3C5GA 2JMGA 3MGHA 1SKSA 5KTQA 2FMPA 3KH0A 4LK0M 4BJQA 3V60A 3J9CA 2NV3A 3EUB2 1IGDA 1GC6A 1NYRA 1N6ZA 3IAM1 3ZD8A 5L1LA 2AQ1B 2GLSA 1J8CA 4WAFA 3RT3B 3C23A 4KLFA 2JEGA 2C7NB 5HHIA 2SEBD 1X40A 4MGIE 5ALEA 3PR5B 4PHEA 4RNOA 1K50A 1L4DB 3MDAA 3SR6A 3BQTA 1NZPA 4OHJA 4R3DA 4F91B 3HWTA 4PH5A 2GOLA 1E5WA 3Q8CA 2KTRA 1JWUD 3A9JA 3FDSA 2WAQC 3HKZC 4O5CA 1WZ3A 4HK2A 1UA0A 3IRUA 4I2DA 4OZAA 2JEFA 4IW0A 4HXDA 1U4BA 4P16A 2B0CA 3RJHA 1KLUD 1ZP0B 2JXXA 1KSPA 2XC9A 2BGFA 3V6JA 2QIEB 2HMXA 4ECWA 5KFDA 5IAAC 1E10A 3HKZF 1JRPA 4MEMA 4A3OA 2NRZA 3RRGA 1ZKHA 2K8CA 4GB9A 4JMUA 9ICUA 3H4BA 3W1YA 1ZQVA 3UPQA 2LHEA 2ZIWB 3JPPA 1OUQA 2OXOA 1R4NI 2PFQA 3L10B 1P1AA 4LZGA 2TSSA 2AU0A 1TVAA 2ZNVC 1TGZB 2MP2A 3FM9A 3A9KA 1Z19A 3AE9B 3AQEA 1C4AA 2RGFA 2KKVA 2UVUA 2K39A 3IN5A 2M56B 2C9WB 1VLBA 4LNIA 2WXJA 2KZ3A 3ZIMA 3DHGC 1Q3UA 1KFTA 3GE3C 3N7PD 3PTFC 4U6PA 3C28A 1B22A 3AE5B 2ODGA 3EWAA 4YR3A 5KG7A 1OFFA 3LYSA 1T7PA 1J2NA 1VDVA 2REXA 3PW0A 1NK7A 3BQ7A 2J4XA 2J0KA 2MBBB 2KTQA 2BQUA 2E8PA 2WB1F 3E9SA 4KX5A 2ZXIA 3AE4B 2PE9A 4ECRA 1PDXA 1WMHA 3OTQA 3Q69A 1UD7A 2EZZA 2W9BA 2YB1A 3P4PB 2M4NA 1YX5B 2WX0A 3IXSA 4E0DA 3E2EA 2AHOB 4UB6U 5J0XA 1NENB 2M8SA 4M0WA 3M95A 4ZYSA 5J0RA 2GMIC 3CYMA 2KP7A 2R61A 1YJ1A 3SU8X 5J2DA 2LI5A 5LXHA 4MH0E 2G5IB 5J2CA 3TAQA 4HDOA 5L1IA 3RUIB 4Y2JA 4GDKB 3OGUA 3RZWC 4J6IA 3PV1A 1S5LU 4F71A 1Z4OA 4ASWC 3WK5A 5BMGA 1ZD5A 4FN2A 2KQSA 4MSQB 4QIWC 2HCFA 1B43A 5AHXA 5E6NA 5JZEB 1SGHA 4TURA 4O3OA 4O3PA 3P63A 4Y2XA 2N1RA 1AQ6A 3BS5A 2VH2A 3JPTA 3F53A 1T5XD 5CX3A 5CWRA 2KHVA 5L83A 3T3FA 3PLVA 3PO4A 4DSEA 1SKRA 4C4SA 2W7PA 3WKBA 2WHIA 2IO2B 4QIWF 2BHNA 4F4XA 2LHTA 4BWJA 3QARA 4ELUA 1Z2MA 4DSKA 2V3PA 3SD5A 2L00B 1MG8A 1DOXA 3NVVA 1P3QU 4NNJB 4WWMA 2MJ3A 1ROEA 4FBTA 3VFKA 2LGSA 3L5KA 1ZQDA 3Q6BA 3DBHB 5AI9A 3QAQA 5J2JA 2WLBA 1ZJNA 4EZ6A 2RP5A 3ICXA 2V4QA 3DBLB 3KVFB 1ZRNA 1KEJA 2JWZA 4ED3A 2EDUA 5GXGB 1B9RA 4DHJD 3B0YA 2MJDA 5DDMA 3B2FA 4OZCA 2K8BA 2OJWA 5TSSA 4NLCA 2DQNB 4O3QA 3JPNA 2JRZA 3RR8A 3M7DA 2XCPA 1WH3A 2FUHB 3ZDMC 4DCCA 2RPQA 1XEEA 1NJZA 4YP3A 2DZMA 4CYEA 5LNK1 2KHQA 4FJYA 2KFZA 3BVMA 1TZ1A 1EU3A 1MG4A 2KMAA 5KFMA 4RUCA 5AK6A 1R4NB 4GSWA 1C9FA 4TKNA 2V3NA 1P0RA 4Q2JA 1YQ4B 3A0HU 4YWGG 2OEHA 3GZNB 1NOMA 2RMMA 4ICVA 3SAGA 4RQ5A 1ZE3D 4GXBA 4PS7A 3C5FA 1GPXA 4I6PA 2GBMA 5BMIA 1DOYA 3T5LA 2KMMA 3QXGA 4ZHPA 3AEGB 3WK9A 2A5UA 3AEAB 4XWTA 5J0WA 4JIOU 2ZIVA 3MHSD 9ICJA 2EZXA 4F8RA 1LO5D 2HTHA 2H88B 2Y5PA 1X2IA 2QCZA 5ALRA 7ICPA 2ZXHA 7ICMA 1RM6C 2JWUA 4KX6B 4LJOB 4DDGD 2VJ5A 1N5XA 1UBQA 3KHHA 2WF9A 1WE6A 1F0MA 1ZGUB 2KKPA 4IR1A 4USAA 2XI9A 1LFDA 4TUUA 2KWDA 2MEKA 1SBBB 1G6JA 4C4VB 3H7IA 3RR7A 2NRTA 4M0AA 5KFTA 2IBIB 4A6QA 1XLNA 1WWUA 2XY6A 1LKYB 4IC9A 2EKIA 4MGKE 1FRRA 3U8ZA 1ZQNA 3AEBB 3WKCA 1F1HA 2KVSA 4I27A 3SD7A 4F4WA 8ICWA 4KDIC 9ICFA 3F5AA 3RJIA 1J7AA 5HMMA 1YN3A 4AJWA 1S8OA 2AYOB 4ZRQA 4NJCA 2CU3A 2IDYA 5AM4A 5KL8B 2FNJB 1U4AA 2KQ7A 1IG6A 4IS7A 2N1VA 1MQ3A 5CRXA 3UI3A 4KGSA 4XDDA 3OJSA 4F7ZA 1X6IA 4KLJA 3AECB 3OG5A 2C5LC 1U49A 3E56A 4II2B 2XNAC 5DCNA 5AKEA 3ISDA 4P1BC 2DYMA 2AL3A 1S1QB 1PK3A 1V1PB 4EELA 1DK2A 4DXFA 8ICUA 3BZKA 2K4EA 5EWFA 1V1OA 3KHGA 2VA8A 2W8LA 4K3CA 2W04A 1QKZA 4LDTB 4JWMA 2PJHA 4XRHA 3PSEB 3ZNID 1Q3VA 1UH6A 2BKRB 3HM3A 4KITB 2EMSA 4RCOA 3AL0B 4K3BA 3ZKJC 3WIMA 2KD0A 2PVGC 3T5HA 3UMBA 1B1ZA 1R4MI 1K1SA 3NRWA 2V9WA 4KLDA 1TAMA 5ALQA 1WWVA 3TSSA 3C8YA 1XC9A 2AH5A 4BBNF 2JXJA 2V4IB 4QZFA 3PZPA 4LNNA 1QCKA 3DDHA 2YTUA 4DSFA 1L3SA 3WCQA 2JZ3B 4K1RB 2WXPA 2DYOA 3DVNV 2PMZC 4DL5A 5ALKA 2CKHB 4F93B 3JPRA 1FXIA 1OTRB 5HR7A 1PGBA 4M47A 4S0RA 5CHVC 2Y9UA 4YR0A 3ZXRA 3UIPB 1ZQAA 2INNE 1UWXA 3GV7B 2D3AA 5DBBA 3RN9C 3QEBZ 3AE6B 3ZNHB 4OJ5A 3QC8B 2X38A 5KT3A 1UT8A 2KK0A 4MEYA 5AICA 5DKWA 3PMNA 4DF8A 2MCNB 3H6NA 5ALUA 3T5JA 2PMZF 1SGGA 5HNKA 4HYKA 5CTRC 1UPHA 2QEJC 3V7JA 1A6SA 2DX5B 2SAKA 3V6KA 3AU6A 3QQ8B 4XZ4A 4HWIB 1Q5WB 1XSPA 1WXAA 3QU5A 3AH7A 2QC8A 4LJPB 3DEEA 4PZNA 3Q2AC 1PK1B 1XO3A 2P6RA 4JV2A 3SEBA 3TADC 2K3UA 3TL5A 1XS9D 4JV0A 2A1JA 3LVVA 3ZDCA 1YJIA 4DEZA 1H38A 1SV0A 3ORYA 4QZDA 1ZQCA 1WIAA 1WJUA 2PXIA 1WE7A 3UXPA 3LDAA 2WTFA 1GJZA 3M3JA 1EXNA 5ALYA 3TUOA 3L16A 3IG8A 2LXAA 1L7NA 1RXWA 3GU3A 3H8SA 9ICXA 3HP6A 1D5XC 3NTUA 4M9JA 4BXOA 3G6YA 1WZ0A 4AS1A 4RQMA 2WXRA 5DB6A 2AX5A 2KAJA 1L5UA 3LJ3A 4GLSC 2IO0B 3BK1A 3CF6E 2HDEA 2Z8LA 1SL0A 4GIBA 4C80A 1U45A 4ZYNA 4DOAA 1ZQUA 2QHOA 3MFGA 2RR9A 1OEYA 4DBGA 2EAPA 2PVOD 1FCCC 1BUIC 7ICIA 9ICNA 3H7SA 3AEEB 3UGBB 4AYBC 4M00A 5AKIA 4DFJA 2KDIA 4RM8A 5ALTA 1UZXB 3ALBA 2HHTA 1TTNA 1XT9B 2ZG6A 3QX1A 4JK1A 2DWQA 1E7PB 1OQQA 1VJKA 1YNTE 2L83A 4QWAA 1DRGA 4F4ZA 3P42A 3ZVVA 3RBEA 4G50A 4E71A 2N0SB 2F76X 2O2VA 3QZ8A 2WXGA 1CK1A 4RNNA 8ICTA 2DBYA 2NBVB 4Y2UA 4RQ0A 1GAQB 2IOFA 3LK9A 3PZ8A 1V6EA 3U7DA 2ZJDA 3V7LA 1MSWD 1JW9D 4XA5A 3A33B 3PT2B 2LPEA 4YXMA 1JQ4A 2E1EA 4Y2SA 5L95C 1NK9A 4CF5A 2N9PC 3T3NA 4O9MA 8ICFA 2B76B 3VHTC 2XY5A 1UGMA 2MX2A 2EMTA 4AOFA 5AKLA 1OGWA 1PYWD 3Q14C 2WXQA 2DENB 4RQ1A 1DOQA 1XO0A 5KFOA 1NK0A 1L3VA 9ICTA 4B0EA 3TAPA 4F8CB 2N7EA 2Y0SC 1OQYA 5BYRA 2JXTA 3RJGA 4KZ0A 4ZDVA 4DO9A 4I6LB 4BWMA 3RH4A 4J03A 3M8SA 1BPEA 4O3RA 3JPQA 3U7ZA 4K4GA 4DFKA 2HHQA 3ZD9A 3W5VB 2AEHA 3AQFA 5DG9A 1BMLC 2INCC 2E8MA 2ZCBA 4JL9A 2I2YA 5D2MB 4MEXA 4BX9C 2D5GA 3N7RC 4RNMA 3HJEA 4B95A 2KE7A 3RNCC 2Y5BB 1T3NA 4FBJB 2KLGA 1ZJMA 4KKIA 2D07B 1MQ2A 5AKKA 4K4HA 1AWDA 2KC1A 2WDVB 2FPLA 2WWZA 3DWGC 4KTQA 3RFAA 3KZIU 2ZTDA 4Z6EA 2F1IA 4O0IA 5KFCA 4PGXA 4KLEA 1D6EC 2HD5B 3H7PB 3ZW3A 4RMAA 4I2HA 2KJ6A 5AM3A 2G4SA 4O5EA 3RB6A 5BOLA 2UYZB 2AJQA 2JV3A 4I28A 1TT5B 4DK5A 5JXVA 3MC1A 4IQVA 3BQ0A 4MELA 5AIAA 4J9PA 2K4IA 2ZIWA 3QUTA 5E6JA 4UB5A 1X9MA 3L3FX 4M8NA 5E79U 1H4RA 2I9GA 1RPLA 3I3TB 2LJIA 2MSED 2N7JA 4XUSA 3EGRA 3MGVA 4PHDA 5ALZA 2W03A 2K8HA 3ZO5B 2EANA 4L2YA 7ICEA 4LDTD 2DAFA 1TBEA 2KLCA 4OJ6A 3VCBA 1N63A 2BS2B 2WXHA 4MGZE 1CI4A 1C76A 3TMPB 3BZCA 2UVWA 1SXEA 2ASJA 3BYTB 3H8JA 3URYA 4DL3A 3AEVA 5KT5A 4NL9C 4FS2A 4UBCA 3JYUA 3RNGC 4YR2A 3VR8B 5JHBA 2CXYA 2KOBA 4DXAB 5KFLA 5IIOA 2KTFA 3PHXB 3Q8KA 3BJYA 3U52E 4XQ8A 5ALDA 4RGTA 4F1SA 3H40A 4GXJA 3H9DA 1NKEA 1PQSA 5DQGA 2YEPF 4RGOS 1AW7A 4OW0A 4PL2A 2DUYA 4ACOA 1HXYD 2RHFA 1QQ6A 4C4TA 4HPLB 4KMOB 3C2LA 9ICWA 3TI0A 8ICMA 4CDGA 4MHVA 2FCQA 4GDKA 1A5RA 4QZGA 3MGIA 2F8LA 2Z7JA 4KSKC 1F44A 1WFYA 2M19A 1FNUA 3JPSA 2ZZPB 2F1JA 3Q8QB 2BB5A 2BKFA 4UASA 4DL6A 2LYAA 1E6EB 1PUTA 4RPXA 2BPSA 5FK9C 3H0MB 4Q44A 5AK3A 7ICVA 1J7BA 1VD2A 2WDRB 2PTLA 3MC0B 5B5EU 2YMMA 2PI4A 3F5EA 3ETRA 4NLNA 2P35A 1WXSA 2M0NA 2D11A 4PJ0U 1XXGA 4RQ4A 2J0JA 3PHWB 1QT9A 4HCNB 1L0YB 4Z6FA 2H3VA 2ATLA 3UIOB 3ISBA 4ZH4A 5CB1A 5KFZA 4C8LA 3AEDB 3ZDTA 3WK6A 4YMMA 4F2SA 3UQBA 5J0UA 1WYGA 5BMHA 3IHPC 1V9PA 3PSIA 2K60A 1QLNA 2BQ3A 3NHEB 1AYFA 1T0YA 2W9CB 4B9TA 4G3IA 1CJEA 1TJEA 2M0XA 5KFKA 4OZBA 4BUGA 1WGDA 1SIJA 2RDGA 3TCAA 1WG8A 3DBRB 1C4PA 1L0VB 2MUTB 3PSPA 1RQNA 1SZPA 9ICSA 3IM1A 3BDPA 1I4HA 2DGZA 1QTMA 3A4SC 2KN5A 1IUEA 4ZOHC 3EPIA 5FP0A 2GBJA 2LGXA 8ICBA 3N7SC 2P6UA 2Q5WD 5KG6A 4R65A 1P9DU 4KLTA 8ICZA 5GTHU 3ZRCA 4HKQA 4F5PA 3VAWA 3DPDA 2K89A 2YEPB 3V62A 2XN9C 9ICQA 1FNVA 2WXMA 4I2FA 3H0RB 3AE2B 2ZUCA 4Z6CA 3EYZA 3MC9A 2GRIA 5H92C 3ZI4A 1NYQA 2Z0DB 2BKEA 2FLNA 2BCUA 2WXIA 3MJ5A 2YN4A 3KHRA 1T8EA 2MWSB 4DQOC 4B6JA 4DQIA 1L3TA 1AN8A 4R8UB 4NZLB 2W3SA 4EZJA 4GIVA 1E8ZA 4UQGA 1WSPA 4HJGE 4WJPA 4UAVA 3DVGY 5DPRA 5J0OA 3MDCA 3BYYB 1FO4A 2C7HA 2QILA 2FIFA 2RLTA 1V81A 2QSDA 1T6BX 1S97A 1TK8A 4NAWB 3T79A 2MH7A 3DBHI 3C29A 3KD3A 5EE1A 7ICUA 4FADA 4YXJA 3B9JA 3DBLI 2F3NA 4TUQA 1YOVB 1UT5A 3VDZA 1V5OA 5AUIA 4NLGA 1TAQA 3SI8A 5KFGA 1UELA 5AIBA 2JH1A 4KLGA 3Q8BA 5IN7A 1WGYA 2QARB 4I2GA 4C4VA 1S0NA 1F77A 5J2FA 2V1YA 4ZRKA 5J2GA 5JUMA 4B9UA 3WAMA 2PKEA 4Z6DA 2N1WA 1O08A 1SB3C 1GB4A 2WU2B 2VANA 1E90A 1COOA 7ICNA 2ESEA 3O65B 3V6EB 2AL6A 3C21A 3E58A 2ZW0A 2LGIA 5IIIA 1L7MA 3H0LB 2BQQA 1BVSA 1NI2A 3V6CB 2WF8A 2RRDA 1D9FA 2J6SA 3N3KB 4KKJA 4JX1C 3LXFA 5ALSA 2WB1C 4WJ3B 5LXIB 3F2CA 2M17A 5IIKA 2OM6A 3ZUNA 5FR3A 3RAXA 3GZNI 1PVQA 5E6PA 3AB5A 5ALGA 1Z1BA 1SWWA 5DB8A 4FO6A 5CHFA 1EWYC 5AI6A 3WKDA 1X9XA 1RG6A 5J0YA 2R8HA 3V7KA 7ICTA 1SF0A 1TKEA 1WWTA 2JR5A 9ICCA 2NBWB 1ZD2P 3QU4A 1VJ5A 1TZOA 1K51A 3C1ZA 5EWGA 1ZQGA 1V1PA 2K8AA 1ZXHA 2WXLA 4FLHA 5KT6A 2VIXA 2YY6A 4OVUA 3RB3A 1NK8A 1JXEA 2KDEB 1MN8A 4LLGM 1IPGA 4RFBA 3CNHA 3GDXA 2BWFA 2F1HA 4PHAA 3DDCB 3P4RB 2BR0A 4Q8EA 4KDLB 2ASDA 4Y2YA 3TQ1A 3Q3FA 1QILA 5IOIA 3K75D 5DGBA 1IXRA 1F0ZA 2N4FA 4IWQA 3CSFA 2G07A 4XYCA 3AUOA 4EZ9A 1WYWB 4LNKA 2BCRA 1DGSA 4HRSA 3M9MB 2B3AA 1TY0A 2ON8A 3PX4A 2HJ8A 3WA0A 2LFIA 3TANA 4C8NA 1X42A 5IO9A 5KFUA 4MM3B 4EBDA 3A1QB 4MFFA 1EUVB 4YMOA 4IQWA 4IWPA 4M01A 3ED5A 2KFKB 2R8IA 2HHVA 1QOBA 1RRBA 3F2BA 1BNOA 1ESFA 3N20C 2VZKB 5F9LA 3ML8A 5B66U 3RH6A 2DZJA 5J0SA 7ICHA 2HHSA 4JE3B 2LKYA 3B08A 3TBLD 1ZD3A 3QHTA 8ICXA 2CR5A 1EU4A 1HA5A 2KNJA 5KFSA 5DB9A 4BOSC 2HHXA 5DB7A 8ICNA 4EBCA 1QSSA 3AE3B 1RDFA 1ZQRA 4PT5A 5KG1A 4WH4A 4J9SA 2PLPA 1XD3B 4OJLA 2JU6X 3H8HA 1PK1A 2IO3B 3M8RA 1BPXA 4ED6A 2AXTU 1I4QA 4G11A 3M63B 4KLOA 2BWES 3V05A 5CHGA 2IY1B 4IUMB 4ED7A 4PZOA 1OEYJ 3KYDD 1LQBA 1FPYA 3B0AA 2YVCA 1E0ZA 4US9A 3O0FA 3VC8A 2MBQA 3VVWB 5AM5A 2KG5A 1S76D 3QUBA 2PFNA 1M94A 3D2SA 4ZRPA 3C1YA 2QB0B 1R7SA 1UWMA 5C2TB 1HUOA 3GQCA 2ZPNA 3FAHA 2JH7A 2L76A 2AWTA 3HVZA 1L5PA 5AI5A 4P4MA 1E7VA 1XQQA 2N9EB 2KC2A 3KW5B 4N6EB 5KFYA 2WDQB 1PVRA 1JWBD 1N56A 3APDA 4XE0A 1AROP 2ES6A 3FILB 4KLIA 4GC7A 4LJXA 3KFUF 1Q8KA 3Q8AA 3M6KA 1J19A 2C60A 5C3JB 1QQ7A 3GZFA 4O1NA 3R7RA 4ACFA 4I6NB 5KHOA 3C2MA 3QWZB 4BKSD 4M9GA 3HUIA 4YSXB 3RH5A 5CA7A 4M9NA 3AI5A 4I2JA 5AK5A 4OJPA 3NVYA 3N32A 3GB1A 1KH0A 5ALFA 1HUZA 1XLPA 2DPJA 4LCDE 3EW9A 3PY8A 4MDKE 3PSFA 1ZQWA 2LBOA 2NBUA 5IIJA 3TFRA 4YT0B 5KFIA 4W9HA 3P2BA 1KFDA 3PGEA 5JTIA 1L2NA 2MQJA 1ZQLA 4I2IA 4R66A 2JF5A 1V80A 2MLBA 4NM2A 2PW9A 1NNLA 1IBXB 4WJQA 1ZW7A 2YLMA 4RH6A 4JB3A 2GB1A 1WJNA 2I1QA 3TEXA 1ZDXA 2IHMA 4RGMA 1FNWA 2J0MA 9ICBA 3U26A 1ZUD2 2ZJ8A 4ANUA 3MFIA 4RT3A 5DLGA 3IP4B 1D8YA 1VZ8A 2KIVA 3K1RB 1ET6A 1COKA 4DXGA 1ZETA 4AJYB 5C23A 3ETLA 4DWFA 1BPBA 8ICHA 4B9KA 2BCQA 3TADA 4Y2RA 7ICGA 2OCEA 2BYVE 1TS4A 2KT7A 2KVRA 5K4LA 2KZMA 2VH1A 4N9F4 1U48A 1E7UA 5ALXA 3JVZX 3K9OB 1CQVA 1YD8U 3RFZB 5KG4A 3H7PA 3I1YA 4F4YA 4IDIA 4R64A 5HG2A 4WURA 4NM1A 2QMTA 2E8OA 9ICLA 1M4VA 3NUQA 1KF6B 1XCTL 4QZHA 4QW8A 4BBNC 4IM3A 1JCKB 2IO1B 1PFDA 4C8KA 1JWSD 3RJJA 4HROA 2UVVA 4XGAB 4BKTA 3RF9A 4US8A 5DG7A 4FULA 5CHWA 4CHKA 3ZNZB 1F52A 2EQYA 3A4RA 1WR1A 1DXSA 3ZLZA 2JQRB 4DSLA 3O13A 5TISU 5KAFU 2RQ5A 9ICKA 1KM7A 2F77X 2NRVA 4A9AA 4LZDA 2KFNA 1MVKA 1ZQKA 5CP2A 5GTIU 3OHAA 3RB4A 2VKQA 2I5HA 2JRHA 3J81j 1YJJA 3TFSA 4NY8A 2WXKA 5C5JA 4FHJA 2G5HB 4W9EA 4UAWA 5T14A 4TQ0A 4EFOA 3MP9A 2DL0A 5KT2A 1LM8B 4DLGA 8ICGA 2D2QA 4RZRA 1XF5L 2VRRB 3I9V1 3K9PB 4QWBA 3DOWA 3KWLA 3SYZA 1YIWA 3NVZA 4D2KA 1GB1A 1WX8A 4DFMA 3JSVB 5KFPA 2WXNA 2KJHB 1H8CA 4MJSB 4EYHB 2LASA 1N48A 4YD1A 2N9XA 3N1XC 2G1EA 1UUPA 5KG5A 4ELVA 3BY4B 1S77D 2KVZA 5KFWA 2Y3AA 3PZ7A 1I42A 4REZA 1V9JA 4I2CA 2VZKD 1MJDA 2BW2A 4B6WA 3QUCA 4J9NA 1RFAA 4DQRA 3Q8PB 5EOZA 5AKJA 3IHQB 4C7ZA 3OSPA 1ZQJA 2J6TA 1D8BA 1QQ5A 3IG3A 2WF7A 2IYDB 4DL2A 5C0YA 3PZDA 2HOQA 1IGCA 2WP9B 3ALRA 4PGYA 3QCAA 3N4MB 4PL1A 2C2EA 1STEA 4S17A 4E74A 1CRXA 4BGDA 5AZHA 1OW5A 4WWOA 2WGSA 2NO4A 2KHWB 2IGHA 5DBAA 2ZVOA 2KMDA 3GIJA 3B1LX 1WX7A 2XK5A 3KWVA 1WGGA 2FPKA 1F2RI 2G0AA 5IILA 3R8BA 7ICSA 3CMMB 2KDMA 4FS1A 4DS4A 1HJPA 8ICLA 2DF4B 1K53A 3UXOA 4C8OA 3V3XA 4G0NB 3ABVB 4IR9A 2W3RA 1WGRA 2DHZA 2IOHA 1Z00B 4RPYA 4EE2A 4ECXA 5KAIU 2NS5A 1Q1OA 1RLFA 4GC6A 2I1KA 1Y56A 3RI7C 2IZVB 3RULA 2YMPA 2W9CA 2KJ5A 2L8JA 5F3XB 1PVPA 4GGQA 1MPEA 1KKXA 1TS3A 4ICUA 1SZHA 4JUZA 1UF0A 4RGNA 1HQRD 3GS2A 2ASLA 2R8GA 3QEAZ 1F2RC 2XEWA 1RYJA 1Z4NA 1SJED 1NZBA 1VZ7A 2PKOA 3IV6A 2BPCA 2MBOA 1HZ5A 1B4FA 3UMCA 3CRXA 2CJNA 2CHXA 2LVOA 1TK5A 3LWLA 1URJA 2IHNA 8ICAA 2BT6A 4ANVA 4B9NA 3MABA 1KLGD 2Z59B 4W9JA 3BQ1A 1WUDA 2AQ4A 2HBJA 5CR0A 4EENA 4YCXA 2KKCA 4KSLC 1V97A 1BT0A 1V49A 3BVGA 1SEBD 1PGXA 1XWLA 3RTVA 2GH1A 3PO5A 2KXJA 4NL9A 4BKSA 4YTNB 4J9OA 1LGRA 5KFHA 4KGTA 1SSNA 4UBBA 4DSJA 3BINA 5I4DA 1QLBB 3EECA 4W9GA 4A8XC 4BKGA 3B2GA 2H3FA 2BVCA 3KKAA 2JPHA 4YL8A 3OSNA 3Q8MA 4L23A 5D6JB 4EZLA 5EE9A 2NPTB 2KZRA 2HBKA 4QZ8A 4TQSA 4DQSA 2KEYA 4OVVA 1GOZA 5AZGA 3KUZA 4NAWA 4BDPA 2JSVX 2LZ6A 3ZXVA 1E8WA 1NK5A 1GC7A 3AV8A 4B9LA 2PE6B 2FAZA 3DBSA 1MHXA 3JPOA 3DBRI 4L1BA 1E8YA 2IMWP 3MJWA 5KFFA 4MH8A 1V86A 2N9KA 2ALZA 4HDQA 2KMCA 3HIZA 1RQLA 4YQWA 1YZ7A 4DQPA 2E5SA 5AKHA 3WK7A 5DPWA 2QARA 4IRDA 4DF4A 4K7WA 4UATA 2PFOA 2RDBC 4QZBA 2KD1A 1MI0A 3L08A 3FKYA 1WXMA 1TS5A 2R8JA 1P7FA 2BYEA 2K5PA 1FIQA 2C2DA 5DGAA 3QX7A 4XX5A 3TIXA 3PW7A 4QWCA 1YN5A 3QE9Y 4GMVA 2XCAA 3E0FA 2FLPA 7ICJA 2H3IA 2G4DB 2OYYA 3AXCA 5D7GA 4WWNA 3KHLA 3FC4A 2AQ3B 3Q3NC 4Q43A 9ICHA 2K4PA 2V0GA 3HM6X 1YQBA 4ZHOA 4C0ZA 2FMSA 2PMVA 1BPYA 1C78A 4ECQA 1NK4A 3T9LA 3RNEC 3SAFA 2BTEA 2I38A 4Q45A 5L1MA 3R2TA 1L7YA 1KL9A 1ZQMA 2H5XA 4YTPB 3Q8RB 2L5YA 3QU7A 1S0VA 5JU5A 4MF2A 3QZ7A 2M0AA 4JLCA 4KLHA 3PPAA 1ZDVA 2NRWA 4TSSA 4UARA 2L32A 3KOOA 2ASQA 2IGDA 3NY5A 4RQ3A 2PI5A 4Y2QA 4RF0A 1QH9A 3KKAC 1Y88A 5ALMA 1T3QA 5KFBA 2XBBC 2ONQA 3MR3A 1ZQBA 3DWMA 2KOXA 4MGYE 1RXVA 3QU9A 1C1YB 3ZGZA 3HK0A 5IKCM 1D5ZC 1ACCA 4GDLB 3NASA 5TZVA 2XY7A 3NVWA 2FLLA 4MM3A 2WYQA 2LUMA 3A1QA 1JIHA 4JWNA 3BZDB 3D2QA 2QKQA 1I7HA 1NJWA 5HI1A 2RDJA 2JX5A 3GIIA 3P4QB 1L6VA 2BYFA 3SHQA 4MT5A 2W54A 2KFKA 5DG8A 4IKGA 2KK8A 5KHQA 2G9HD 1J7CA 1T0QC 4NJ6A 3UQAA 3QYPA 3S2AA 2F2AB 4QNLA 4ANWA 2NTSA 1YZ6A 3VRAB 1S9FA 2N9LA 4WIPA 1XCQL 3Q3MC 3SZ2A 2MSNA 3DCGA 1L7OA 5ALIA 3CP8A 4UAZA 4RT2A 2HE7A 5D49A 2RSUA 4EEWA 4TQ1A 4UW9A 3RJEA 3R3MA 4IWOA 4RNAA 4P0PB 4F3OA 3NS1A 3TEYA 5ALLA 3UQ2A 2W9NA 4KVGB 1ZQZA 4RM9A 1MA7A 2JHDA 5KG3A 1J0GA 3GFKB 2IOFK 1ED1A 4OD0A 1B0XA 3SV4A 3ONSA
chains in the Genus database with same CATH topology
2LFIA 3NUHB 2E3TA 4MM3B 3AE1B 2KQ4X 3UI3A 1FM0D 1I4RA 4KGSA 4XDDA 3Q8FA 3AECB 1P7EA 5BYQA 2W55A 1WXQA 2IJ0A 2BYTA 1FMAD 1JROA 3E56A 2XNAC 2K22A 3KLSX 5D3DA 2DYMA 1QOBA 1V1PB 4DXFA 1ESFA 3CIRB 3W5UB 2VZKB 5BYSA 1V1OA 1QOGA 4JE3B 1QKZA 1EU4A 1HA5A 3SFDB 1NEKB 4RCOA 3SFEB 1L6UA 2OHFA 1FRDA 1JWAD 4IOIE 2PVGC 1B1ZA 3AE3B 1SE2A 1FFVA 4PT5A 1TS2A 4WH4A 4YSYB 3TSSA 2LHDA 2PLPA 3FILA 2BBCA 3C8YA 4J3OD 2K0PA 2JU6X 1C4CA 2V4IB 3H8HA 2H89B 1I4QA 4P6VF 3WCQA 2IGGA 2WXPA 2WXOA 3V05A 3AN1A 2DYOA 1SXTA 4LTUA 3T3OA 1FXIA 1PGBA 2DLBA 1E0ZA 4HKZE 3HRDD 4US9A 2INNE 3BWUD 1EM7A 4B0MA 4CQNA 1UWXA 3AE6B 1TKYA 4C56C 5AUKA 2X38A 4ZRPA 3AM9A 1R7SA 1UWMA 5C2TB 1NI3A 1XLQA 3W2DA 3BIID 3FAHA 1C79A 2QEJC 1YMHE 2W82A 3HVZA 4ARCA 1L5PA 3W9CB 2SAKA 4N6EB 1FFUA 2WDQB 1JWBD 1A70A 4XE0A 3AH7A 1IBXA 3FILB 3ZJTA 1KFYB 1XO3A 3SEBA 1KRHA 2K3UA 3Q8AA 4NAMA 5C3JB 1ZPSA 3TEWA 2E6XA 1I4XA 4O1NA 1YJIA 3VQIA 3ZJUA 3L4PA 1EWCA 2ZW1A 3N9YC 3HUIA 3CWIA 4YSXB 1BXTA 1K52A 1QF6A 2BS4B 3TUOA 3NVYA 3RPFC 3GB1A 4YXDB 1KH0A 1D5XC 1XLPA 3NRZA 4AS1A 2WXRA 2AX5A 1E9MA 2KAJA 2CJOA 4YT0B 1I4PA 4GLSC 3BK1A 1UGJA 4HEA1 2HDEA 2Z8LA 3AMZA 1RWSA 4C80A 2K9XA 3MFGA 1FXAA 2PW9A 2PVOD 1FCCC 1BUIC 1FEHA 1IBXB 3AEEB 4N58A 2WXFA 3EA6A 4KGRA 4RH6A 2GB1A 3TEXA 1ZDXA 4RGMA 3U2SC 1FNWA 1TYGB 4H2AA 1ZUD2 1OQQA 1VJKA 1E7PB 2DWQA 3P42A 1XLOA 1YNTE 2L83A 2MJEA 1OQRA 1DOIA 1VZ8A 1JMLA 1ET6A 2N0SB 4DXGA 2WXGA 3MHZA 1CZPA 1VZ6A 1CK1A 1SE3A 2DBYA 3U4EG 1GAQB 5D3IB 3PZ8A 1N61A 1JW9D 1TS4A 2NMQA 3VRBB 1HZ6A 1YN4A 1JQ4A 5G5GA 2J52A 5EE0A 1CQVA 5HFYA 3RFZB 2IPKD 3T3NA 1TKGA 2B76B 4FXCA 4IDIA 5HG2A 2FE8A 4WURA 3AEFB 4A90A 2QMTA 1M4VA 1PYWD 1ZOYB 1KF6B 1XCTL 2EELA 2WXQA 4B0EA 2J42A 1JCKB 3VR9B 5BYRA 3ZQ4A 2JXTA 2ICIA 2AQ2B 1PFDA 3NZ3A 4HROA 1JWSD 2RDHA 4UDUC 4US8A 4A55A 3BVZA 2WNMA 3U7ZA 4MACA 1VR9A 2FUG1 4JPSA 2JQRB 3W5VB 2I2YA 1BMLC 3O13A 1QOAA 1SE4A 2JYTA 2D5GA 4A9AA 3R2IA 1MVKA 2GI9A 2WXKA 1YJJA 4KKIA 1AWDA 1D5MC 1Q10A 2WDVB 4TQ0A 1QQRA 3DWGC 3MP9A 4LK0M 3J9CA 1XF5L 3EUB2 1IGDA 1NYRA 3I9V1 1N62A 2L1AA 4YTMB 1D6EC 2L52A 3IAM1 3KWLA 1GB1A 3PO0A 3NVZA 2AQ1B 4D2KA 4WAFA 5JXVA 1KTKA 2WXNA 3BK2A 3TEZA 1JALA 2SEBD 5E6JA 1K50A 2G1EA 4C7YA 1L4DB 1UUPA 3SR6A 2Y3AA 4OHJA 4R3DA 1HEZE 3PZ7A 4REZA 3LB8C 3Q8CA 2VZKD 1JWUD 2KACA 2LJIA 2BW2A 2N7JA 3EGRA 4C7ZA 2Y5CA 4L2YA 4OZAA 2BS2B 1N63A 4P16A 2WXHA 1KLUD 1ZP0B 1IGCA 5G5HA 1C76A 2FBWB 2WP9B 3OWEB 1STEA 4TMAB 3BYTB 5T8IA 3Q8EA 3URYA 1UNSA 2QIEB 5EE3A 3VR8B 2IGHA 1E10A 1JRPA 4OVZA 4XWWA 3KWVA 2PIAA 3U52E 1F2RI 4RGTA 3R8BA 2KDMA 1K53A 2LHEA 2QJLA 3V3XA 2YEPF 2BB6A 4RGOS 1AW7A 2J53A 3ABVB 4OW0A 2W3RA 1HXYD 4EE2A 2TSSA 3AE9B 2JZPA 1C4AA 1Y56A 1WGKA 2M56B 1VLBA 2NTTA 1MHHE 2WXJA 1MPEA 1TS3A 4RGNA 1HQRD 3GS2A 3AE5B 1F2RC 1RYJA 2M19A 1OFFA 1FNUA 1SJED 1VZ7A 2PKOA 4RF1A 2BB5A 1HZ5A 1WRIA 2CJNA 1VDVA 2J4XA 1E6EB 1PUTA 2BT6A 3IT6B 3E9SA 1ET9A 1DYQA 3AE4B 5FK9C 3P1MA 1KLGD 1PDXA 1J7BA 2WDRB 4WQMA 2PTLA 3MC0B 2HTME 3Q69A 3ETRA 1XXGA 1QT9A 3P4PB 1L0YB 3LYYA 1V97A 3BVGA 3IXSA 1SEBD 1PGXA 1NENB 4M0WA 4ZYSA 1C77A 2WS3B 3AEDB 4YTNB 1WYGA 4KGTA 2R61A 1SSNA 3W1SA 5BMHA 1AYFA 5I4DA 1QLBB 1CJEA 4GDKB 1TJEA 4OZBA 4A8XC 3B2GA 1SIJA 1JWMD 2RDGA 1C4PA 1L0VB 3I57A 4L23A 5EE9A 5BMGA 3AE7B 4N59A 1GOZA 3P63A 1I4HA 2JSVX 3ZJVA 2OEDA 4ARIA 3AV8A 1IUEA 4ZOHC 1MHXA 1T5XD 3AE8B 4L1BA 2Q5WD 4MH8A 1N60A 4HKQA 2N9KA 2YEPB 2XN9C 3HVDA 1FNVA 2WXMA 2V3PA 3AE2B 1FD6A 2GRIA 5H92C 1NYQA 1DOXA 3NVVA 4WWMA 2MJ3A 1ROEA 2WXIA 3MJ5A 1MI0A 1TS5A 1P7FA 4DQOC 1SJHD 2K5PA 1FIQA 1AN8A 1YQ3B 2WLBA 2INPE 2W3SA 4NZLB 1QOFA 1WSPA 1YN5A 4HJGE 1D4BA 5GXGB 3ZYYX 1B9RA 3BYYB 1FO4A 2QILA 2MJDA 3B2FA 1L0XB 2ACZB 4OZCA 5D7GA 2QSDA 5HHDG 1T6BX 5TSSA 4NAWB 3FC4A 2AQ3B 2MH7A 2WQYB 2V0GA 2RPVA 5EE1A 4ZHOA 4AQ7A 1ZXIA 3B9JA 1XEEA 2PMVA 5LNK1 1C78A 5AUIA 2BTEA 2I38A 5H8YE 3R2TA 3BVMA 3Q8BA 1ENFA 1EU3A 4YTPB 3GP7A 1PGAA 1C9FA 1F77A 1L4ZB 2V3NA 2M0AA 4Q2JA 1YQ4B 1ZDVA 2LMCA 4TSSA 4YWGG 1SB3C 2L32A 2IGDA 1GB4A 2WU2B 2RMMA 4RF0A 1ZE3D 3KQ4A 3IT4B 4YSZB 1GPXA 1TY2A 2ZW0A 2LGIA 1T3QA 5BMIA 2ONQA 1DOYA 2KMMA 2WU5B 3DWMA 4ZHPA 3AEGB 3AEAB 4KKJA 4JX1C 4XWTA 5MPOA 1DGJA 3LXFA 3ZGZA 1NVID 1D5ZC 2LEKA 1ACCA 4GDLB 1LO5D 5FR3A 2H88B 2Y5PA 3AB5A 3NVWA 1FCLA 1RFKA 1EWYC 2JWUA 4KX6B 1RM6C 2LUMA 1N5XA 1SF0A 1TKEA 3BZDB 1WWTA 1I7HA 5HI1A 4USAA 2JX5A 3P4QB 1L6VA 4JWUC 1TZOA 2KWDA 1K51A 2MEKA 2W54A 1SBBB 4MT5A 1VRAB 4IKGA 1V1PA 1ZXHA 2JYEA 2WXLA 2G9HD 3P4SB 1J7CA 4A6QA 4LLGM 2NTSA 4RFBA 3VRAB 2N9LA 4WIPA 1XCQL 1XLNA 3P4RB 2EKIA 1FRRA 3AEBB 1N5WA 4XDCA 4TQ1A 1QILA 4RNAA 1F0ZA 4JWSC 2KN4A 3NS1A 3TEYA 2BS3B 1V8CA 1J7AA 1YN3A 5FKAC 4HRSA 4ZRQA 4NJCA 2CU3A 1TY0A 2IDYA 2ON8A 4ITKA 1I4GA 3IAS1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H92 C;  1NYQ A;  2E3T A;  1DOX A;  3NVV A;  2BS2 B;  1N63 A;  3AE1 B;  4WWM A;  2MJ3 A;  1ROE A;  1FM0 D;  1ZP0 B;  3AMZ A;  1RWS A;  5G5H A;  2FBW B;  2WP9 B;  3AEC B;  2W55 A;  4C80 A;  1WXQ A;  2K5P A;  2K9X A;  1FMA D;  1FIQ A;  1FXA A;  1JRO A;  1YQ3 B;  2PVO D;  2WLB A;  2W3S A;  2K22 A;  3AEE B;  2QIE B;  1QOB A;  4N58 A;  1QOF A;  5EE3 A;  3VR8 B;  3W5U B;  3CIR B;  5GXG B;  3ZYY X;  1B9R A;  1E10 A;  1JRP A;  1FO4 A;  2MJD A;  1QOG A;  1TYG B;  1ZUD 2;  2PIA A;  3B2F A;  2ACZ B;  1OQQ A;  1VJK A;  1E7P B;  2DWQ A;  1XLO A;  2L83 A;  2MJE A;  1OQR A;  3FC4 A;  1DOI A;  2MH7 A;  2WQY B;  2N0S B;  1CZP A;  2QJL A;  5EE1 A;  1NEK B;  3SFD B;  4ZHO A;  2DBY A;  3ABV B;  3SFE B;  2W3R A;  1L6U A;  2OHF A;  1ZXI A;  3B9J A;  1GAQ B;  1FRD A;  1JWA D;  2PVG C;  3AE9 B;  1N61 A;  5AUI A;  1JW9 D;  3AE3 B;  3VRB B;  1WGK A;  2M56 B;  1FFV A;  5H8Y E;  4YSY B;  1VLB A;  1JQ4 A;  5G5G A;  4YTP B;  5EE0 A;  1TKG A;  2H89 B;  2B76 B;  3AE5 B;  4FXC A;  4IDI A;  4P6V F;  3WCQ A;  3AEF B;  1RYJ A;  1YQ4 B;  3AN1 A;  1OFF A;  1ZOY B;  1KF6 B;  2M19 A;  2PKO A;  4LTU A;  1SB3 C;  1FXI A;  1WRI A;  2CJN A;  1VDV A;  2WU2 B;  3VR9 B;  1E6E B;  1PUT A;  4YSZ B;  1E0Z A;  3HRD D;  1PFD A;  4US9 A;  2BT6 A;  3AE4 B;  4HRO A;  1T3Q A;  1GPX A;  3P1M A;  1DOY A;  4US8 A;  1PDX A;  2KMM A;  1J7B A;  1TKY A;  2WDR B;  2WU5 B;  3AE6 B;  3DWM A;  4WQM A;  5AUK A;  2HTM E;  4ZHP A;  3AEG B;  3ETR A;  3AEA B;  4JX1 C;  5MPO A;  1DGJ A;  3LXF A;  1QT9 A;  1NVI D;  2JQR B;  3P4P B;  3AM9 A;  1R7S A;  1V97 A;  1UWM A;  2LEK A;  1NI3 A;  1QOA A;  1XLQ A;  5C2T B;  2H88 B;  3BII D;  1NEN B;  4A9A A;  3AB5 A;  3NVW A;  3FAH A;  1RFK A;  1EWY C;  4KX6 B;  1RM6 C;  2WS3 B;  3AED B;  3HVZ A;  4YTN B;  1L5P A;  3W9C B;  4N6E B;  1FFU A;  1N5X A;  1YJJ A;  1SF0 A;  1TKE A;  1WYG A;  1AWD A;  1WWT A;  1I7H A;  2WDQ B;  1JWB D;  4USA A;  1A70 A;  2JX5 A;  2WDV B;  3P4Q B;  1AYF A;  1L6V A;  3AH7 A;  3DWG C;  2AX5 A;  1QLB B;  4JWU C;  1CJE A;  2W54 A;  1TJE A;  3B2G A;  3EUB 2;  1SIJ A;  1NYR A;  3W5V B;  1N62 A;  1KFY B;  1L0V B;  1XO3 A;  5EE9 A;  4YTM B;  2L52 A;  3AE7 B;  1KRH A;  1J7C A;  3P4S B;  3KWL A;  3AE2 B;  5C3J B;  3PO0 A;  3NVZ A;  3VRA B;  1YJI A;  4N59 A;  1XLN A;  3P63 A;  3L4P A;  3HUI A;  3CWI A;  3P4R B;  2EKI A;  4YSX B;  1JAL A;  1FRR A;  3AEB B;  1N5W A;  1QF6 A;  3AV8 A;  2BS4 B;  1IUE A;  4ZOH C;  2G1E A;  4YT0 B;  4C7Y A;  3NVY A;  3RPF C;  3AE8 B;  4YXD B;  3SR6 A;  4JWS C;  1F0Z A;  2Q5W D;  3NS1 A;  2BS3 B;  1XLP A;  1V8C A;  1N60 A;  3NRZ A;  1J7A A;  3LB8 C;  4HRS A;  2CU3 A;  4C7Z A;  1E9M A;  2KAJ A;  4ITK A;  2CJO A;  2Y5C A; 
#chains in the Genus database with same CATH topology
 4A8E A;  2E3T A;  4NJ8 A;  2WHE A;  1SXD A;  1FM0 D;  1JX4 A;  2NRX A;  3Q8F A;  1Q46 A;  2AQ0 A;  1WXQ A;  2IJ0 A;  4IL6 U;  2LVP A;  1FMA D;  3T8M A;  5C1Z A;  2BYT A;  5JRT A;  1JRO A;  1U47 A;  4M6W B;  4FZL A;  3KLS X;  4CCH A;  3OLM D;  2CN1 A;  2NR2 A;  5KT4 A;  3W5U B;  3CIR B;  2JZB B;  5BYS A;  7ICF A;  7ICK A;  4K7S A;  5KFN A;  3UQ0 A;  4KLM A;  3DVN U;  9ICM A;  5KG0 A;  2ZJ5 A;  1F9J A;  4ZRJ A;  1T0R C;  2QB0 A;  1UQV A;  1NK6 A;  8ICK A;  4EEK A;  2X8X X;  5J2K A;  1V38 A;  3IBE A;  1ZQF A;  4EX7 A;  2OHF A;  5F9N A;  1L6U A;  3NZS A;  2XGP A;  1FRD A;  2NO5 A;  2OH2 A;  2W9M A;  3APF A;  1S3S G;  3PVX A;  1KLN A;  3ISC A;  1OXJ A;  1TS2 A;  3WK8 A;  5J2E A;  4F5Q A;  4M9H A;  1QZE A;  2BBC A;  3APC A;  4EEY A;  3RJK A;  3FIL A;  3MC8 A;  4J3O D;  2KV2 A;  3TJP A;  2UVR A;  4KN7 A;  5ALJ A;  1BNP A;  3A0B U;  2L3Z A;  3GE8 C;  4P6V F;  3MR6 A;  2ISO A;  2IGG A;  5G55 A;  4Q8F A;  4F4K A;  2WXO A;  5KT7 A;  4DL4 A;  8ICI A;  2ZIX B;  9ICG A;  1SXT A;  3DHI C;  4LTU A;  3T3O A;  1JI7 A;  4IQT A;  4CRX A;  5AI4 A;  3H1U A;  2E8N A;  4DLE A;  3HRD D;  2D3G A;  4CQN A;  1EM7 A;  4ECV A;  4B0M A;  4WWP A;  5H2F U;  4M9L A;  4FE3 A;  4ECU A;  3PRE A;  5AUK A;  1L8L A;  3ZTD A;  3C19 A;  4P4O A;  2ZIU B;  2YQE A;  1XLQ A;  1X1M A;  2CS4 A;  4NQL B;  3W2D A;  3GIM A;  1GUA B;  4HVB A;  2KJ9 A;  4CF3 A;  2LRW A;  5KFV A;  1PZN A;  4FBU A;  3G6X A;  1YMH E;  2W82 A;  5KNI A;  4HCP B;  4IM2 A;  2CPR A;  3W9C B;  4ARC A;  5CJ7 A;  2EH9 A;  3C0R B;  5DQI A;  4NV0 A;  4AP9 A;  4X5V A;  1A70 A;  2CHZ A;  3I63 C;  1LKY A;  1IBX A;  1V2Y A;  4K81 A;  3ZJT A;  3HPO A;  1RYU A;  3AUL A;  3RAQ A;  4W9F A;  4J9M A;  4YMN A;  1TE2 A;  3NG0 A;  4NAM A;  1D8L A;  3TEW A;  2E6X A;  4QWE A;  5JH5 C;  2JUO A;  3VQI A;  2B21 A;  1TIF A;  3L4P A;  2ZW1 A;  1HE8 A;  4DS5 A;  3GV5 B;  4W9K A;  3EPG A;  3CWI A;  4DOC A;  1K52 A;  5E6O A;  4PGQ A;  4RQ6 A;  2LM1 A;  2WAQ F;  1L3U A;  1C7Y A;  3RPF C;  5KL1 B;  2M1M A;  2EKE C;  3PX6 A;  2KX0 A;  2O6K A;  2FCS A;  3NRZ A;  3DQV A;  4UB3 A;  2IY0 B;  3MBY A;  5AKX A;  1L6N A;  2LUE A;  3VTW A;  4BAX A;  3GIL A;  1I4P A;  2G45 B;  4DHZ B;  1RZT A;  3RNA C;  1WM3 A;  5IA7 A;  4B9M A;  5J2H A;  1EF5 A;  2BZF A;  4I2B A;  2D3C A;  3OAW A;  5IP4 D;  3AMZ A;  1RWS A;  2R2Q A;  2FPM A;  3ZDB A;  4P0Q B;  4OO1 J;  2K9X A;  4F5N A;  2GO7 A;  4RQN A;  1FEH A;  5J2R A;  2I1J A;  1A76 A;  3SMV A;  4AUQ C;  2O6V B;  3PW2 A;  3DV9 A;  3VTV A;  1K8R B;  3U2S C;  2H3Q A;  3PST A;  1UA1 A;  3B0X A;  1X9W A;  1ZQP A;  2JEJ A;  1TYG B;  4H2A A;  5G2N A;  1NKB A;  5KFR A;  1YX6 B;  1XLO A;  5ALH A;  2RD0 A;  3PR4 A;  3LVW A;  2WFA A;  1DOI A;  4M04 A;  1NBF C;  3MHZ A;  4TQR A;  2HW3 A;  1J97 A;  8ICP A;  8ICR A;  3X0W A;  2W7O A;  4TUS A;  4DWI A;  5KFQ A;  2DZK A;  3PNC A;  5D3I B;  2W8K A;  1N61 A;  4B9S A;  2UU7 A;  1XO1 A;  3KUD B;  1D3Z A;  2NMQ A;  3VRB B;  2DFL A;  2KSO B;  2KO3 A;  4ED2 A;  2WF5 A;  3GV8 B;  3X23 A;  5HFY A;  3PX0 A;  1EO6 A;  4GXI A;  1TKG A;  2YMQ A;  3WU2 U;  3QNM A;  4G9B A;  3AEF B;  3N1Y C;  3G6V A;  4MFC A;  2K25 A;  4A90 A;  1MFW A;  2EEL A;  3M62 B;  4DFD A;  3JSV A;  2L0T A;  2Q0Z X;  5AK4 A;  4MJS A;  3VXW A;  4HAI A;  4KLU A;  2AQ2 B;  3NZ3 A;  1ZYQ A;  2NVU I;  3PV8 A;  1NKC A;  2VJ4 A;  9ICA A;  2QB1 A;  1GNU A;  2RDH A;  3RBD A;  4QZC A;  5L1K A;  4FHK A;  4KIK B;  3BVZ A;  1CEZ A;  5J0T A;  2WNM A;  4MAC A;  5AM0 A;  2R18 A;  4HJK A;  3GOE A;  1VR9 A;  2FUG 1;  4GXK A;  3LDZ E;  4LNO A;  2MU2 A;  4JPS A;  2BDU A;  8ICS A;  2HBM A;  1QOA A;  5BOM A;  2LMR A;  1SE4 A;  3R2I A;  3RMK C;  4C8M A;  3BQ2 A;  2K4H A;  1KDH A;  3UF8 A;  2KJR A;  3WK4 A;  2M9N A;  3OJ3 A;  2D8C A;  5HHH A;  1KRP A;  2FMQ A;  5A0L A;  1D5M C;  1Q10 A;  2K6D B;  2KNB A;  2XO7 A;  1QQR A;  4ECT A;  5ALW A;  2KIW A;  4RQ8 A;  2HDO A;  1N62 A;  2L1A A;  1UHU A;  4YTM B;  3KTQ A;  2L52 A;  1QSL A;  4URK A;  5ALO A;  3RD2 A;  2QLT A;  3PO0 A;  1ZQO A;  3CST A;  3RB0 A;  1S10 A;  1KTK A;  2B6G A;  3BK2 A;  3TEZ A;  7ICO A;  4QAY A;  4P7I A;  1JAL A;  2KWV B;  3HHM A;  2LI6 A;  3RCZ A;  8ICJ A;  3PRP B;  4F5O A;  4FA6 A;  4C7Y A;  1Z00 A;  3H8W A;  1UBI A;  2L05 A;  4I29 A;  3ML9 A;  4K7U A;  4ED0 A;  3I76 A;  2K6Q A;  2MBH A;  2ZNV B;  1HEZ E;  3D32 A;  3L17 A;  2FI1 A;  2MRP A;  1BPD A;  3LB8 C;  2KAC A;  4GU2 A;  8ICQ A;  4W9D A;  5D4B A;  4RPZ A;  3IDW A;  4DDI D;  3F2D A;  2Y5C A;  2W43 A;  3VTU A;  5ALN A;  1HEK A;  2N7D A;  2L7R A;  2I6X A;  5J2B A;  3BS7 A;  5G5H A;  2FBW B;  2MHJ A;  5GMV A;  2KJ8 A;  3OWE B;  4O3M A;  1WJ6 A;  3H8M A;  4TMA B;  4NWI A;  4M2Y A;  4R63 A;  1PUZ A;  5IIM A;  4NJ7 A;  2FJ6 A;  5T8I A;  3Q8E A;  5L9X A;  1UNS A;  1C3T A;  2DKZ A;  5EE3 A;  9ICI A;  3EC8 A;  5J2I A;  4YFK A;  4WQO B;  1Y8R C;  2LRU A;  4QW9 A;  3WAN A;  4OVZ A;  4PK1 A;  4XWW A;  2MBE A;  2PIA A;  4QZE A;  2YB4 A;  1C20 A;  4IQU A;  4OJO A;  5KFX A;  3DVG X;  4TV3 A;  1N2X A;  1E8X A;  4IRK A;  2KDB A;  2Y9T A;  2QJL A;  2J6U A;  3ZTC A;  4YD2 A;  2BB6 A;  2J53 A;  2A4Z A;  3QIJ A;  1JN3 A;  4BFR A;  5AKG A;  2BCV A;  3QU2 A;  3PLU A;  2EAM A;  4W9I A;  3L0W B;  4NQK E;  2JZP A;  2QDF A;  2KWC A;  2KTR B;  3A9J B;  1WGK A;  1T0S C;  1J2M A;  4ZRI A;  4RUA A;  2V4R A;  3QK0 A;  2NTT A;  1MHH E;  4EYI B;  1ZQH A;  4PYZ A;  2BDP A;  1ISN A;  2NPT A;  4KLS A;  4MFA A;  2WDT B;  4W9L A;  4DSI A;  3WKE A;  3Q8L A;  3EHV A;  2FDR A;  4NLZ A;  2GOW A;  4RF1 A;  3TAC B;  4F5R A;  4ED1 A;  2DYB A;  3ZRF A;  1WRI A;  2JT4 B;  3V72 A;  3IT6 B;  1IM4 A;  4WJO A;  1ET9 A;  1DYQ A;  9ICP A;  1JXL A;  4ANX A;  3P1M A;  2JRI B;  4KX3 A;  2HI0 A;  4J9L A;  2R8K A;  8ICE A;  4WQM A;  2DNF A;  3OPX A;  2LWP A;  2IND C;  2HTM E;  4UB2 A;  1WCN A;  4ICA A;  2K8C B;  5AM2 A;  1P7D A;  2AGP A;  1KLV A;  1XSL A;  3M6Z A;  4UAY A;  3KYC D;  8ICC A;  2MW5 A;  3LYY A;  3RNB C;  3N97 B;  4BOZ B;  2BPF A;  2PPH A;  1AAR A;  3N1Z C;  4PPX A;  5BPC A;  3N28 A;  5KFJ A;  1C77 A;  2WS3 B;  2ZEQ A;  2DZI A;  4YN4 A;  5HR6 A;  4LVS A;  2MP2 B;  3A9K B;  1EF1 A;  3W1S A;  1BGX T;  2GWS A;  5CEH A;  2ZTE A;  4M02 A;  2Q4T A;  1JWM D;  4FJV B;  3D6J A;  3I57 A;  3R7Q A;  1P98 A;  2XID A;  3AE7 B;  2V9H A;  1K1Q A;  1WX9 A;  4N59 A;  1MC8 A;  2MAX A;  2HVH A;  1WM2 A;  4W9C A;  3ZJV A;  4BVU C;  1RYS A;  2F8K A;  4FZM A;  7ICL A;  2OED A;  5ALV A;  4ARI A;  3IVF A;  1TAU A;  3AE8 B;  1KFS A;  9ICE A;  1WMH B;  4AP4 C;  2AGQ A;  1N60 A;  4ECY A;  2O6V D;  4ED8 A;  2KWU B;  2W9B B;  2HBL A;  5KG2 A;  3HVD A;  3QUQ A;  2G08 A;  7ICR A;  1Z1V A;  1FD6 A;  4M0W B;  5J2A A;  4IG7 B;  2LGY A;  1KJT A;  4II3 B;  4P1C C;  4A3P A;  4NLB A;  4A20 A;  3M9N B;  5DLF A;  1SJH D;  1ZQX A;  2J7Q B;  1YQ3 B;  1ECW A;  2INP E;  5L1J A;  4HPM B;  2NCN A;  4KLL A;  4JQW C;  2PFP A;  2V3S A;  1QOF A;  1D4B A;  5D46 A;  1ZQI A;  3UMG A;  4KLQ A;  3GIK A;  4DL7 A;  3WAL A;  3ZYY X;  1Q0W B;  4XC2 A;  3ZDD A;  1D9D A;  1L0X B;  2ACZ B;  3EZ5 A;  2GBR A;  5HHD G;  2UWQ A;  3BS5 B;  1ZOL A;  9ICO A;  3AU4 A;  5AI8 A;  3T5K A;  2WQY B;  4GDL A;  4IC7 B;  4KZC A;  2BQR A;  1HIW A;  1IV8 A;  2XVT A;  2C2R A;  2RPV A;  4AQ7 A;  2KAN A;  1ZXI A;  2Z0E B;  4GFJ A;  4PYU A;  2P66 A;  1WGH A;  1SIF A;  3I28 A;  1KQQ A;  5H8Y E;  3SAH A;  3VUW A;  5AZF A;  3I5J C;  1ENF A;  1KTQ A;  2JGA A;  3HX0 A;  3GP7 A;  3EFU A;  3ZNG C;  1PGA A;  2KFJ A;  1S0M A;  4RU9 A;  4ECZ A;  1L4Z B;  2G09 A;  3W1S C;  1Z3E B;  5HP4 A;  2LMC A;  4CF4 A;  4P2H A;  4F92 B;  7ICQ A;  4RQ7 A;  2JVC A;  5KFA A;  1WRD B;  2V4L A;  1I35 A;  3KQ4 A;  3PW5 A;  3IT4 B;  4YSZ B;  1KOT A;  3RZF A;  1TY2 A;  3V61 A;  4DOB A;  5FR6 A;  5EDS A;  2NYV A;  2XIC A;  2WU5 B;  4P0P A;  2LXC A;  3HIL A;  2AGO A;  3UXN A;  1LB2 B;  5AEK B;  5JHA A;  3Q3O C;  5TR5 A;  2K8B B;  4K4I A;  3R66 C;  1FEZ A;  5MPO A;  1DGJ A;  1SL2 A;  3DHH C;  1NVI D;  3NGD A;  3SV3 A;  2LEK A;  4GN1 A;  3NOB A;  4Y2P A;  3VUY A;  2LYH A;  1QSY A;  2K1F A;  4HPP A;  4M8M A;  4ECS A;  4QZ9 A;  1RFK A;  1FCL A;  2MUT A;  1BPZ A;  1ZRM A;  3QA8 A;  3VH4 B;  4OCZ A;  4P4P A;  2ZUD A;  4I2A A;  2CU1 A;  3L54 A;  4JWU C;  1WF9 A;  4M6W A;  5ALP A;  1VRA B;  3RRH A;  1KW4 A;  1F5S A;  2D6F C;  4NLK A;  2JYE A;  1DK3 A;  2JZB A;  5J8Y A;  3P4S B;  4QWD A;  4KMU A;  3ZDE A;  3QJZ A;  3VH3 B;  4O3N A;  4EKU A;  5AI0 A;  2JEI A;  2ZJA A;  2FCM A;  2BCS A;  1ZQE A;  1GO3 F;  3WAO A;  4MSM B;  1N5W A;  4XDC A;  1JMS A;  1LV5 A;  5BO4 B;  3KUC B;  1XNS A;  4X57 B;  4JWS C;  2KN4 A;  2IA6 A;  2BS3 B;  1V8C A;  1L8O A;  4CNQ A;  2LD9 A;  5FKA C;  1SWV A;  2ZIV B;  3U30 A;  2G06 A;  4R8U A;  4ITK A;  1I4G A;  1WJ4 A;  3SEI A;  3IAS 1;  4QZI A;  3NUH B;  3OJ4 B;  2H3Z A;  3AE1 B;  5HKH A;  4J9Q A;  2KQ4 X;  4LNF A;  3Q3J A;  1I4R A;  4AYB F;  2HVI A;  3ECI A;  3ZDA A;  5BYQ A;  1P7E A;  3S6J A;  2W55 A;  1SL1 A;  2ZIX A;  3TKA A;  9ICV A;  1XU4 A;  2D3B A;  2K22 A;  5D3D A;  2CRX A;  1TFR A;  4FJZ A;  1IIP A;  4BZA A;  3HT3 A;  3OHB A;  1R4M B;  2KX3 A;  2L0F A;  3K1Z A;  4GLX A;  4F2R A;  1QOG A;  2Y1J A;  2VA3 A;  2HSZ A;  2HHW A;  3N30 A;  4Y2V A;  4RQ2 A;  1IP9 A;  2CHW A;  4IRC A;  2ZIU A;  2HHU A;  1IYF A;  1UCV A;  3KBB A;  2ZTC A;  3SFD B;  1NEK B;  2R2O A;  3VUX A;  5DQH A;  2C7M B;  3SFE B;  4O5K A;  2OJR A;  1JWA D;  2C22 A;  5J17 A;  2LM4 A;  3NZU A;  4IOI E;  1X6J A;  2GLE A;  5AM1 A;  1SV0 C;  2MA1 A;  4PS3 A;  2LYB A;  1SE2 A;  2PEA A;  4EOY A;  1A0P A;  1FFV A;  2LVQ A;  2WF6 A;  1X9S A;  2IBK A;  4O3S A;  2C28 A;  4IM0 A;  2LHD A;  3HW8 A;  4UB4 A;  1WI0 A;  4YSY B;  1NJX A;  2K0P A;  1ZD4 A;  1C4C A;  2Y0S F;  2H89 B;  4KV2 A;  4CO7 A;  4KN4 A;  4EX6 A;  2A3V A;  1YT3 A;  1KBU A;  1ZQY A;  3AN1 A;  2KN7 A;  9ICR A;  1HTQ A;  3L13 A;  3SDL C;  2W9A A;  3SQI A;  3C2K A;  2DKX A;  4AWJ A;  2DLB A;  1FXT B;  3IFW B;  4HKZ E;  3BWU D;  2EAO A;  2KYW A;  1NDD A;  5J8Y C;  4PHP A;  1M6Y A;  2A19 A;  3LWM A;  2YML A;  3SEN A;  2WX1 A;  1TKY A;  4ELT A;  4C56 C;  2ZVN A;  2JZZ A;  2BF8 B;  3PRZ A;  3K4G A;  4GOC A;  5IIN A;  4HLE A;  5DPT A;  3AM9 A;  4C4R A;  1GG3 A;  1SV4 A;  2GBN A;  1NI3 A;  2DPI A;  3BII D;  1O03 A;  3THV A;  1T94 A;  4EUT A;  8ICV A;  1C79 A;  3MTN B;  5EWE A;  1XSN A;  1FFU A;  4NPN A;  4P0Q A;  3OJU A;  1TV9 A;  2ZCC A;  3MR5 A;  1JUD A;  5J0P A;  1SE9 A;  3NS8 A;  5DPS A;  4DQQ A;  2OWO A;  1KFY B;  4F50 A;  2D10 A;  4YVZ A;  4DHZ E;  1LXD A;  2O6V A;  3ENE A;  1KRH A;  2Y1I A;  3PML A;  3UIN B;  1ZPS A;  2FE9 A;  3PW4 A;  1CUK A;  3ONN A;  1I4X A;  4EBE A;  1S0O A;  4YG2 A;  3ZJU A;  3AU5 A;  5AKZ A;  1EWC A;  3N9Y C;  4UB1 A;  4QZA A;  5J18 A;  1WCL A;  2BPG A;  1SKW A;  2HOF A;  1BXT A;  2DAJ A;  1QF6 A;  4WJN A;  3FYH A;  2BS4 B;  2MRL A;  4QJF B;  2ZUB A;  1A77 A;  3IG5 A;  4I2E A;  4WAA A;  3V6H A;  4YXD B;  4MF8 A;  4J9R A;  3Q8S B;  8ICO A;  1CMX B;  4U7C A;  5LLI A;  4UB8 U;  1L7P A;  2YX8 A;  3PS6 A;  2KSO A;  4F72 A;  4G3X B;  1E9M A;  3MFH A;  4JGH B;  2CJO A;  1UGJ A;  1ZQ1 C;  4HEA 1;  2KDF B;  1KN5 A;  2F44 A;  4DFP A;  1LVH A;  4Y2T A;  5KFE A;  1ZQS A;  1WXV A;  4C00 A;  1K5O A;  1X66 A;  5D94 A;  1FXA A;  5HML A;  2RDI A;  1NJY A;  4N58 A;  2WXF A;  3EA6 A;  4KGR A;  3WKA A;  3M9O B;  3KZX A;  1Z5S B;  4KIK A;  2LJ5 A;  3PRM B;  2FCN A;  2A1J B;  3PVL A;  5AKY A;  3RJF A;  2HOI A;  2VA2 A;  2MJE A;  1OQR A;  1JML A;  2BGW A;  2EZY A;  2W11 A;  1CZP A;  1VZ6 A;  4FZN A;  8ICY A;  5J29 A;  1HTO A;  1SE3 A;  3U4E G;  2MA9 B;  2OOB B;  3CW2 C;  1WY8 A;  2XK5 B;  4UAU A;  3RNF C;  2ISP A;  3WAP A;  1HZ6 A;  4BXO B;  1V85 A;  4NXZ A;  5DBC A;  1YN4 A;  3AU2 A;  4JV1 A;  4CGZ A;  1TK0 A;  4DHJ B;  2KIC A;  5G5G A;  2J52 A;  5EE0 A;  3EFC A;  2IPK D;  4FXC A;  1ZQT A;  1V5T A;  2FE8 A;  2FID A;  3UM9 A;  2A1A A;  4PS8 A;  3D2N A;  1RAX A;  1ZOY B;  3TAR A;  2XGQ A;  2G3Q B;  2KZZ A;  2J42 A;  2HJ1 A;  3R9K A;  5J0Q A;  3VR9 B;  3ZQ4 A;  4TUP A;  4FFD A;  1JRU A;  2ICI A;  1T4G A;  4UDU C;  3RYT A;  4E3C A;  2ZPY A;  4A55 A;  4CE6 A;  2E1F A;  3M1Y A;  1TKD A;  4J9K A;  2KVC A;  3H4D A;  3MR2 A;  1ZQQ A;  4B9V A;  1VCB A;  4NY0 A;  2JY6 A;  2O2V B;  1RYR A;  3NJT A;  2JYT A;  4EZK A;  1U9L A;  2GI9 A;  2LGD A;  2GBK A;  1WR6 E;  2D3D A;  3JW0 X;  5DDY A;  3C5G A;  2JMG A;  3MGH A;  1SKS A;  5KTQ A;  2FMP A;  3KH0 A;  4LK0 M;  4BJQ A;  3V60 A;  3J9C A;  2NV3 A;  3EUB 2;  1IGD A;  1GC6 A;  1NYR A;  1N6Z A;  3IAM 1;  3ZD8 A;  5L1L A;  2AQ1 B;  2GLS A;  1J8C A;  4WAF A;  3RT3 B;  3C23 A;  4KLF A;  2JEG A;  2C7N B;  5HHI A;  2SEB D;  1X40 A;  4MGI E;  5ALE A;  3PR5 B;  4PHE A;  4RNO A;  1K50 A;  1L4D B;  3MDA A;  3SR6 A;  3BQT A;  1NZP A;  4OHJ A;  4R3D A;  4F91 B;  3HWT A;  4PH5 A;  2GOL A;  1E5W A;  3Q8C A;  2KTR A;  1JWU D;  3A9J A;  3FDS A;  2WAQ C;  3HKZ C;  4O5C A;  1WZ3 A;  4HK2 A;  1UA0 A;  3IRU A;  4I2D A;  4OZA A;  2JEF A;  4IW0 A;  4HXD A;  1U4B A;  4P16 A;  2B0C A;  3RJH A;  1KLU D;  1ZP0 B;  2JXX A;  1KSP A;  2XC9 A;  2BGF A;  3V6J A;  2QIE B;  2HMX A;  4ECW A;  5KFD A;  5IAA C;  1E10 A;  3HKZ F;  1JRP A;  4MEM A;  4A3O A;  2NRZ A;  3RRG A;  1ZKH A;  2K8C A;  4GB9 A;  4JMU A;  9ICU A;  3H4B A;  3W1Y A;  1ZQV A;  3UPQ A;  2LHE A;  2ZIW B;  3JPP A;  1OUQ A;  2OXO A;  1R4N I;  2PFQ A;  3L10 B;  1P1A A;  4LZG A;  2TSS A;  2AU0 A;  1TVA A;  2ZNV C;  1TGZ B;  2MP2 A;  3FM9 A;  3A9K A;  1Z19 A;  3AE9 B;  3AQE A;  1C4A A;  2RGF A;  2KKV A;  2UVU A;  2K39 A;  3IN5 A;  2M56 B;  2C9W B;  1VLB A;  4LNI A;  2WXJ A;  2KZ3 A;  3ZIM A;  3DHG C;  1Q3U A;  1KFT A;  3GE3 C;  3N7P D;  3PTF C;  4U6P A;  3C28 A;  1B22 A;  3AE5 B;  2ODG A;  3EWA A;  4YR3 A;  5KG7 A;  1OFF A;  3LYS A;  1T7P A;  1J2N A;  1VDV A;  2REX A;  3PW0 A;  1NK7 A;  3BQ7 A;  2J4X A;  2J0K A;  2MBB B;  2KTQ A;  2BQU A;  2E8P A;  2WB1 F;  3E9S A;  4KX5 A;  2ZXI A;  3AE4 B;  2PE9 A;  4ECR A;  1PDX A;  1WMH A;  3OTQ A;  3Q69 A;  1UD7 A;  2EZZ A;  2W9B A;  2YB1 A;  3P4P B;  2M4N A;  1YX5 B;  2WX0 A;  3IXS A;  4E0D A;  3E2E A;  2AHO B;  4UB6 U;  5J0X A;  1NEN B;  2M8S A;  4M0W A;  3M95 A;  4ZYS A;  5J0R A;  2GMI C;  3CYM A;  2KP7 A;  2R61 A;  1YJ1 A;  3SU8 X;  5J2D A;  2LI5 A;  5LXH A;  4MH0 E;  2G5I B;  5J2C A;  3TAQ A;  4HDO A;  5L1I A;  3RUI B;  4Y2J A;  4GDK B;  3OGU A;  3RZW C;  4J6I A;  3PV1 A;  1S5L U;  4F71 A;  1Z4O A;  4ASW C;  3WK5 A;  5BMG A;  1ZD5 A;  4FN2 A;  2KQS A;  4MSQ B;  4QIW C;  2HCF A;  1B43 A;  5AHX A;  5E6N A;  5JZE B;  1SGH A;  4TUR A;  4O3O A;  4O3P A;  3P63 A;  4Y2X A;  2N1R A;  1AQ6 A;  3BS5 A;  2VH2 A;  3JPT A;  3F53 A;  1T5X D;  5CX3 A;  5CWR A;  2KHV A;  5L83 A;  3T3F A;  3PLV A;  3PO4 A;  4DSE A;  1SKR A;  4C4S A;  2W7P A;  3WKB A;  2WHI A;  2IO2 B;  4QIW F;  2BHN A;  4F4X A;  2LHT A;  4BWJ A;  3QAR A;  4ELU A;  1Z2M A;  4DSK A;  2V3P A;  3SD5 A;  2L00 B;  1MG8 A;  1DOX A;  3NVV A;  1P3Q U;  4NNJ B;  4WWM A;  2MJ3 A;  1ROE A;  4FBT A;  3VFK A;  2LGS A;  3L5K A;  1ZQD A;  3Q6B A;  3DBH B;  5AI9 A;  3QAQ A;  5J2J A;  2WLB A;  1ZJN A;  4EZ6 A;  2RP5 A;  3ICX A;  2V4Q A;  3DBL B;  3KVF B;  1ZRN A;  1KEJ A;  2JWZ A;  4ED3 A;  2EDU A;  5GXG B;  1B9R A;  4DHJ D;  3B0Y A;  2MJD A;  5DDM A;  3B2F A;  4OZC A;  2K8B A;  2OJW A;  5TSS A;  4NLC A;  2DQN B;  4O3Q A;  3JPN A;  2JRZ A;  3RR8 A;  3M7D A;  2XCP A;  1WH3 A;  2FUH B;  3ZDM C;  4DCC A;  2RPQ A;  1XEE A;  1NJZ A;  4YP3 A;  2DZM A;  4CYE A;  5LNK 1;  2KHQ A;  4FJY A;  2KFZ A;  3BVM A;  1TZ1 A;  1EU3 A;  1MG4 A;  2KMA A;  5KFM A;  4RUC A;  5AK6 A;  1R4N B;  4GSW A;  1C9F A;  4TKN A;  2V3N A;  1P0R A;  4Q2J A;  1YQ4 B;  3A0H U;  4YWG G;  2OEH A;  3GZN B;  1NOM A;  2RMM A;  4ICV A;  3SAG A;  4RQ5 A;  1ZE3 D;  4GXB A;  4PS7 A;  3C5F A;  1GPX A;  4I6P A;  2GBM A;  5BMI A;  1DOY A;  3T5L A;  2KMM A;  3QXG A;  4ZHP A;  3AEG B;  3WK9 A;  2A5U A;  3AEA B;  4XWT A;  5J0W A;  4JIO U;  2ZIV A;  3MHS D;  9ICJ A;  2EZX A;  4F8R A;  1LO5 D;  2HTH A;  2H88 B;  2Y5P A;  1X2I A;  2QCZ A;  5ALR A;  7ICP A;  2ZXH A;  7ICM A;  1RM6 C;  2JWU A;  4KX6 B;  4LJO B;  4DDG D;  2VJ5 A;  1N5X A;  1UBQ A;  3KHH A;  2WF9 A;  1WE6 A;  1F0M A;  1ZGU B;  2KKP A;  4IR1 A;  4USA A;  2XI9 A;  1LFD A;  4TUU A;  2KWD A;  2MEK A;  1SBB B;  1G6J A;  4C4V B;  3H7I A;  3RR7 A;  2NRT A;  4M0A A;  5KFT A;  2IBI B;  4A6Q A;  1XLN A;  1WWU A;  2XY6 A;  1LKY B;  4IC9 A;  2EKI A;  4MGK E;  1FRR A;  3U8Z A;  1ZQN A;  3AEB B;  3WKC A;  1F1H A;  2KVS A;  4I27 A;  3SD7 A;  4F4W A;  8ICW A;  4KDI C;  9ICF A;  3F5A A;  3RJI A;  1J7A A;  5HMM A;  1YN3 A;  4AJW A;  1S8O A;  2AYO B;  4ZRQ A;  4NJC A;  2CU3 A;  2IDY A;  5AM4 A;  5KL8 B;  2FNJ B;  1U4A A;  2KQ7 A;  1IG6 A;  4IS7 A;  2N1V A;  1MQ3 A;  5CRX A;  3UI3 A;  4KGS A;  4XDD A;  3OJS A;  4F7Z A;  1X6I A;  4KLJ A;  3AEC B;  3OG5 A;  2C5L C;  1U49 A;  3E56 A;  4II2 B;  2XNA C;  5DCN A;  5AKE A;  3ISD A;  4P1B C;  2DYM A;  2AL3 A;  1S1Q B;  1PK3 A;  1V1P B;  4EEL A;  1DK2 A;  4DXF A;  8ICU A;  3BZK A;  2K4E A;  5EWF A;  1V1O A;  3KHG A;  2VA8 A;  2W8L A;  4K3C A;  2W04 A;  1QKZ A;  4LDT B;  4JWM A;  2PJH A;  4XRH A;  3PSE B;  3ZNI D;  1Q3V A;  1UH6 A;  2BKR B;  3HM3 A;  4KIT B;  2EMS A;  4RCO A;  3AL0 B;  4K3B A;  3ZKJ C;  3WIM A;  2KD0 A;  2PVG C;  3T5H A;  3UMB A;  1B1Z A;  1R4M I;  1K1S A;  3NRW A;  2V9W A;  4KLD A;  1TAM A;  5ALQ A;  1WWV A;  3TSS A;  3C8Y A;  1XC9 A;  2AH5 A;  4BBN F;  2JXJ A;  2V4I B;  4QZF A;  3PZP A;  4LNN A;  1QCK A;  3DDH A;  2YTU A;  4DSF A;  1L3S A;  3WCQ A;  2JZ3 B;  4K1R B;  2WXP A;  2DYO A;  3DVN V;  2PMZ C;  4DL5 A;  5ALK A;  2CKH B;  4F93 B;  3JPR A;  1FXI A;  1OTR B;  5HR7 A;  1PGB A;  4M47 A;  4S0R A;  5CHV C;  2Y9U A;  4YR0 A;  3ZXR A;  3UIP B;  1ZQA A;  2INN E;  1UWX A;  3GV7 B;  2D3A A;  5DBB A;  3RN9 C;  3QEB Z;  3AE6 B;  3ZNH B;  4OJ5 A;  3QC8 B;  2X38 A;  5KT3 A;  1UT8 A;  2KK0 A;  4MEY A;  5AIC A;  5DKW A;  3PMN A;  4DF8 A;  2MCN B;  3H6N A;  5ALU A;  3T5J A;  2PMZ F;  1SGG A;  5HNK A;  4HYK A;  5CTR C;  1UPH A;  2QEJ C;  3V7J A;  1A6S A;  2DX5 B;  2SAK A;  3V6K A;  3AU6 A;  3QQ8 B;  4XZ4 A;  4HWI B;  1Q5W B;  1XSP A;  1WXA A;  3QU5 A;  3AH7 A;  2QC8 A;  4LJP B;  3DEE A;  4PZN A;  3Q2A C;  1PK1 B;  1XO3 A;  2P6R A;  4JV2 A;  3SEB A;  3TAD C;  2K3U A;  3TL5 A;  1XS9 D;  4JV0 A;  2A1J A;  3LVV A;  3ZDC A;  1YJI A;  4DEZ A;  1H38 A;  1SV0 A;  3ORY A;  4QZD A;  1ZQC A;  1WIA A;  1WJU A;  2PXI A;  1WE7 A;  3UXP A;  3LDA A;  2WTF A;  1GJZ A;  3M3J A;  1EXN A;  5ALY A;  3TUO A;  3L16 A;  3IG8 A;  2LXA A;  1L7N A;  1RXW A;  3GU3 A;  3H8S A;  9ICX A;  3HP6 A;  1D5X C;  3NTU A;  4M9J A;  4BXO A;  3G6Y A;  1WZ0 A;  4AS1 A;  4RQM A;  2WXR A;  5DB6 A;  2AX5 A;  2KAJ A;  1L5U A;  3LJ3 A;  4GLS C;  2IO0 B;  3BK1 A;  3CF6 E;  2HDE A;  2Z8L A;  1SL0 A;  4GIB A;  4C80 A;  1U45 A;  4ZYN A;  4DOA A;  1ZQU A;  2QHO A;  3MFG A;  2RR9 A;  1OEY A;  4DBG A;  2EAP A;  2PVO D;  1FCC C;  1BUI C;  7ICI A;  9ICN A;  3H7S A;  3AEE B;  3UGB B;  4AYB C;  4M00 A;  5AKI A;  4DFJ A;  2KDI A;  4RM8 A;  5ALT A;  1UZX B;  3ALB A;  2HHT A;  1TTN A;  1XT9 B;  2ZG6 A;  3QX1 A;  4JK1 A;  2DWQ A;  1E7P B;  1OQQ A;  1VJK A;  1YNT E;  2L83 A;  4QWA A;  1DRG A;  4F4Z A;  3P42 A;  3ZVV A;  3RBE A;  4G50 A;  4E71 A;  2N0S B;  2F76 X;  2O2V A;  3QZ8 A;  2WXG A;  1CK1 A;  4RNN A;  8ICT A;  2DBY A;  2NBV B;  4Y2U A;  4RQ0 A;  1GAQ B;  2IOF A;  3LK9 A;  3PZ8 A;  1V6E A;  3U7D A;  2ZJD A;  3V7L A;  1MSW D;  1JW9 D;  4XA5 A;  3A33 B;  3PT2 B;  2LPE A;  4YXM A;  1JQ4 A;  2E1E A;  4Y2S A;  5L95 C;  1NK9 A;  4CF5 A;  2N9P C;  3T3N A;  4O9M A;  8ICF A;  2B76 B;  3VHT C;  2XY5 A;  1UGM A;  2MX2 A;  2EMT A;  4AOF A;  5AKL A;  1OGW A;  1PYW D;  3Q14 C;  2WXQ A;  2DEN B;  4RQ1 A;  1DOQ A;  1XO0 A;  5KFO A;  1NK0 A;  1L3V A;  9ICT A;  4B0E A;  3TAP A;  4F8C B;  2N7E A;  2Y0S C;  1OQY A;  5BYR A;  2JXT A;  3RJG A;  4KZ0 A;  4ZDV A;  4DO9 A;  4I6L B;  4BWM A;  3RH4 A;  4J03 A;  3M8S A;  1BPE A;  4O3R A;  3JPQ A;  3U7Z A;  4K4G A;  4DFK A;  2HHQ A;  3ZD9 A;  3W5V B;  2AEH A;  3AQF A;  5DG9 A;  1BML C;  2INC C;  2E8M A;  2ZCB A;  4JL9 A;  2I2Y A;  5D2M B;  4MEX A;  4BX9 C;  2D5G A;  3N7R C;  4RNM A;  3HJE A;  4B95 A;  2KE7 A;  3RNC C;  2Y5B B;  1T3N A;  4FBJ B;  2KLG A;  1ZJM A;  4KKI A;  2D07 B;  1MQ2 A;  5AKK A;  4K4H A;  1AWD A;  2KC1 A;  2WDV B;  2FPL A;  2WWZ A;  3DWG C;  4KTQ A;  3RFA A;  3KZI U;  2ZTD A;  4Z6E A;  2F1I A;  4O0I A;  5KFC A;  4PGX A;  4KLE A;  1D6E C;  2HD5 B;  3H7P B;  3ZW3 A;  4RMA A;  4I2H A;  2KJ6 A;  5AM3 A;  2G4S A;  4O5E A;  3RB6 A;  5BOL A;  2UYZ B;  2AJQ A;  2JV3 A;  4I28 A;  1TT5 B;  4DK5 A;  5JXV A;  3MC1 A;  4IQV A;  3BQ0 A;  4MEL A;  5AIA A;  4J9P A;  2K4I A;  2ZIW A;  3QUT A;  5E6J A;  4UB5 A;  1X9M A;  3L3F X;  4M8N A;  5E79 U;  1H4R A;  2I9G A;  1RPL A;  3I3T B;  2LJI A;  2MSE D;  2N7J A;  4XUS A;  3EGR A;  3MGV A;  4PHD A;  5ALZ A;  2W03 A;  2K8H A;  3ZO5 B;  2EAN A;  4L2Y A;  7ICE A;  4LDT D;  2DAF A;  1TBE A;  2KLC A;  4OJ6 A;  3VCB A;  1N63 A;  2BS2 B;  2WXH A;  4MGZ E;  1CI4 A;  1C76 A;  3TMP B;  3BZC A;  2UVW A;  1SXE A;  2ASJ A;  3BYT B;  3H8J A;  3URY A;  4DL3 A;  3AEV A;  5KT5 A;  4NL9 C;  4FS2 A;  4UBC A;  3JYU A;  3RNG C;  4YR2 A;  3VR8 B;  5JHB A;  2CXY A;  2KOB A;  4DXA B;  5KFL A;  5IIO A;  2KTF A;  3PHX B;  3Q8K A;  3BJY A;  3U52 E;  4XQ8 A;  5ALD A;  4RGT A;  4F1S A;  3H40 A;  4GXJ A;  3H9D A;  1NKE A;  1PQS A;  5DQG A;  2YEP F;  4RGO S;  1AW7 A;  4OW0 A;  4PL2 A;  2DUY A;  4ACO A;  1HXY D;  2RHF A;  1QQ6 A;  4C4T A;  4HPL B;  4KMO B;  3C2L A;  9ICW A;  3TI0 A;  8ICM A;  4CDG A;  4MHV A;  2FCQ A;  4GDK A;  1A5R A;  4QZG A;  3MGI A;  2F8L A;  2Z7J A;  4KSK C;  1F44 A;  1WFY A;  2M19 A;  1FNU A;  3JPS A;  2ZZP B;  2F1J A;  3Q8Q B;  2BB5 A;  2BKF A;  4UAS A;  4DL6 A;  2LYA A;  1E6E B;  1PUT A;  4RPX A;  2BPS A;  5FK9 C;  3H0M B;  4Q44 A;  5AK3 A;  7ICV A;  1J7B A;  1VD2 A;  2WDR B;  2PTL A;  3MC0 B;  5B5E U;  2YMM A;  2PI4 A;  3F5E A;  3ETR A;  4NLN A;  2P35 A;  1WXS A;  2M0N A;  2D11 A;  4PJ0 U;  1XXG A;  4RQ4 A;  2J0J A;  3PHW B;  1QT9 A;  4HCN B;  1L0Y B;  4Z6F A;  2H3V A;  2ATL A;  3UIO B;  3ISB A;  4ZH4 A;  5CB1 A;  5KFZ A;  4C8L A;  3AED B;  3ZDT A;  3WK6 A;  4YMM A;  4F2S A;  3UQB A;  5J0U A;  1WYG A;  5BMH A;  3IHP C;  1V9P A;  3PSI A;  2K60 A;  1QLN A;  2BQ3 A;  3NHE B;  1AYF A;  1T0Y A;  2W9C B;  4B9T A;  4G3I A;  1CJE A;  1TJE A;  2M0X A;  5KFK A;  4OZB A;  4BUG A;  1WGD A;  1SIJ A;  2RDG A;  3TCA A;  1WG8 A;  3DBR B;  1C4P A;  1L0V B;  2MUT B;  3PSP A;  1RQN A;  1SZP A;  9ICS A;  3IM1 A;  3BDP A;  1I4H A;  2DGZ A;  1QTM A;  3A4S C;  2KN5 A;  1IUE A;  4ZOH C;  3EPI A;  5FP0 A;  2GBJ A;  2LGX A;  8ICB A;  3N7S C;  2P6U A;  2Q5W D;  5KG6 A;  4R65 A;  1P9D U;  4KLT A;  8ICZ A;  5GTH U;  3ZRC A;  4HKQ A;  4F5P A;  3VAW A;  3DPD A;  2K89 A;  2YEP B;  3V62 A;  2XN9 C;  9ICQ A;  1FNV A;  2WXM A;  4I2F A;  3H0R B;  3AE2 B;  2ZUC A;  4Z6C A;  3EYZ A;  3MC9 A;  2GRI A;  5H92 C;  3ZI4 A;  1NYQ A;  2Z0D B;  2BKE A;  2FLN A;  2BCU A;  2WXI A;  3MJ5 A;  2YN4 A;  3KHR A;  1T8E A;  2MWS B;  4DQO C;  4B6J A;  4DQI A;  1L3T A;  1AN8 A;  4R8U B;  4NZL B;  2W3S A;  4EZJ A;  4GIV A;  1E8Z A;  4UQG A;  1WSP A;  4HJG E;  4WJP A;  4UAV A;  3DVG Y;  5DPR A;  5J0O A;  3MDC A;  3BYY B;  1FO4 A;  2C7H A;  2QIL A;  2FIF A;  2RLT A;  1V81 A;  2QSD A;  1T6B X;  1S97 A;  1TK8 A;  4NAW B;  3T79 A;  2MH7 A;  3DBH I;  3C29 A;  3KD3 A;  5EE1 A;  7ICU A;  4FAD A;  4YXJ A;  3B9J A;  3DBL I;  2F3N A;  4TUQ A;  1YOV B;  1UT5 A;  3VDZ A;  1V5O A;  5AUI A;  4NLG A;  1TAQ A;  3SI8 A;  5KFG A;  1UEL A;  5AIB A;  2JH1 A;  4KLG A;  3Q8B A;  5IN7 A;  1WGY A;  2QAR B;  4I2G A;  4C4V A;  1S0N A;  1F77 A;  5J2F A;  2V1Y A;  4ZRK A;  5J2G A;  5JUM A;  4B9U A;  3WAM A;  2PKE A;  4Z6D A;  2N1W A;  1O08 A;  1SB3 C;  1GB4 A;  2WU2 B;  2VAN A;  1E90 A;  1COO A;  7ICN A;  2ESE A;  3O65 B;  3V6E B;  2AL6 A;  3C21 A;  3E58 A;  2ZW0 A;  2LGI A;  5III A;  1L7M A;  3H0L B;  2BQQ A;  1BVS A;  1NI2 A;  3V6C B;  2WF8 A;  2RRD A;  1D9F A;  2J6S A;  3N3K B;  4KKJ A;  4JX1 C;  3LXF A;  5ALS A;  2WB1 C;  4WJ3 B;  5LXI B;  3F2C A;  2M17 A;  5IIK A;  2OM6 A;  3ZUN A;  5FR3 A;  3RAX A;  3GZN I;  1PVQ A;  5E6P A;  3AB5 A;  5ALG A;  1Z1B A;  1SWW A;  5DB8 A;  4FO6 A;  5CHF A;  1EWY C;  5AI6 A;  3WKD A;  1X9X A;  1RG6 A;  5J0Y A;  2R8H A;  3V7K A;  7ICT A;  1SF0 A;  1TKE A;  1WWT A;  2JR5 A;  9ICC A;  2NBW B;  1ZD2 P;  3QU4 A;  1VJ5 A;  1TZO A;  1K51 A;  3C1Z A;  5EWG A;  1ZQG A;  1V1P A;  2K8A A;  1ZXH A;  2WXL A;  4FLH A;  5KT6 A;  2VIX A;  2YY6 A;  4OVU A;  3RB3 A;  1NK8 A;  1JXE A;  2KDE B;  1MN8 A;  4LLG M;  1IPG A;  4RFB A;  3CNH A;  3GDX A;  2BWF A;  2F1H A;  4PHA A;  3DDC B;  3P4R B;  2BR0 A;  4Q8E A;  4KDL B;  2ASD A;  4Y2Y A;  3TQ1 A;  3Q3F A;  1QIL A;  5IOI A;  3K75 D;  5DGB A;  1IXR A;  1F0Z A;  2N4F A;  4IWQ A;  3CSF A;  2G07 A;  4XYC A;  3AUO A;  4EZ9 A;  1WYW B;  4LNK A;  2BCR A;  1DGS A;  4HRS A;  3M9M B;  2B3A A;  1TY0 A;  2ON8 A;  3PX4 A;  2HJ8 A;  3WA0 A;  2LFI A;  3TAN A;  4C8N A;  1X42 A;  5IO9 A;  5KFU A;  4MM3 B;  4EBD A;  3A1Q B;  4MFF A;  1EUV B;  4YMO A;  4IQW A;  4IWP A;  4M01 A;  3ED5 A;  2KFK B;  2R8I A;  2HHV A;  1QOB A;  1RRB A;  3F2B A;  1BNO A;  1ESF A;  3N20 C;  2VZK B;  5F9L A;  3ML8 A;  5B66 U;  3RH6 A;  2DZJ A;  5J0S A;  7ICH A;  2HHS A;  4JE3 B;  2LKY A;  3B08 A;  3TBL D;  1ZD3 A;  3QHT A;  8ICX A;  2CR5 A;  1EU4 A;  1HA5 A;  2KNJ A;  5KFS A;  5DB9 A;  4BOS C;  2HHX A;  5DB7 A;  8ICN A;  4EBC A;  1QSS A;  3AE3 B;  1RDF A;  1ZQR A;  4PT5 A;  5KG1 A;  4WH4 A;  4J9S A;  2PLP A;  1XD3 B;  4OJL A;  2JU6 X;  3H8H A;  1PK1 A;  2IO3 B;  3M8R A;  1BPX A;  4ED6 A;  2AXT U;  1I4Q A;  4G11 A;  3M63 B;  4KLO A;  2BWE S;  3V05 A;  5CHG A;  2IY1 B;  4IUM B;  4ED7 A;  4PZO A;  1OEY J;  3KYD D;  1LQB A;  1FPY A;  3B0A A;  2YVC A;  1E0Z A;  4US9 A;  3O0F A;  3VC8 A;  2MBQ A;  3VVW B;  5AM5 A;  2KG5 A;  1S76 D;  3QUB A;  2PFN A;  1M94 A;  3D2S A;  4ZRP A;  3C1Y A;  2QB0 B;  1R7S A;  1UWM A;  5C2T B;  1HUO A;  3GQC A;  2ZPN A;  3FAH A;  2JH7 A;  2L76 A;  2AWT A;  3HVZ A;  1L5P A;  5AI5 A;  4P4M A;  1E7V A;  1XQQ A;  2N9E B;  2KC2 A;  3KW5 B;  4N6E B;  5KFY A;  2WDQ B;  1PVR A;  1JWB D;  1N56 A;  3APD A;  4XE0 A;  1ARO P;  2ES6 A;  3FIL B;  4KLI A;  4GC7 A;  4LJX A;  3KFU F;  1Q8K A;  3Q8A A;  3M6K A;  1J19 A;  2C60 A;  5C3J B;  1QQ7 A;  3GZF A;  4O1N A;  3R7R A;  4ACF A;  4I6N B;  5KHO A;  3C2M A;  3QWZ B;  4BKS D;  4M9G A;  3HUI A;  4YSX B;  3RH5 A;  5CA7 A;  4M9N A;  3AI5 A;  4I2J A;  5AK5 A;  4OJP A;  3NVY A;  3N32 A;  3GB1 A;  1KH0 A;  5ALF A;  1HUZ A;  1XLP A;  2DPJ A;  4LCD E;  3EW9 A;  3PY8 A;  4MDK E;  3PSF A;  1ZQW A;  2LBO A;  2NBU A;  5IIJ A;  3TFR A;  4YT0 B;  5KFI A;  4W9H A;  3P2B A;  1KFD A;  3PGE A;  5JTI A;  1L2N A;  2MQJ A;  1ZQL A;  4I2I A;  4R66 A;  2JF5 A;  1V80 A;  2MLB A;  4NM2 A;  2PW9 A;  1NNL A;  1IBX B;  4WJQ A;  1ZW7 A;  2YLM A;  4RH6 A;  4JB3 A;  2GB1 A;  1WJN A;  2I1Q A;  3TEX A;  1ZDX A;  2IHM A;  4RGM A;  1FNW A;  2J0M A;  9ICB A;  3U26 A;  1ZUD 2;  2ZJ8 A;  4ANU A;  3MFI A;  4RT3 A;  5DLG A;  3IP4 B;  1D8Y A;  1VZ8 A;  2KIV A;  3K1R B;  1ET6 A;  1COK A;  4DXG A;  1ZET A;  4AJY B;  5C23 A;  3ETL A;  4DWF A;  1BPB A;  8ICH A;  4B9K A;  2BCQ A;  3TAD A;  4Y2R A;  7ICG A;  2OCE A;  2BYV E;  1TS4 A;  2KT7 A;  2KVR A;  5K4L A;  2KZM A;  2VH1 A;  4N9F 4;  1U48 A;  1E7U A;  5ALX A;  3JVZ X;  3K9O B;  1CQV A;  1YD8 U;  3RFZ B;  5KG4 A;  3H7P A;  3I1Y A;  4F4Y A;  4IDI A;  4R64 A;  5HG2 A;  4WUR A;  4NM1 A;  2QMT A;  2E8O A;  9ICL A;  1M4V A;  3NUQ A;  1KF6 B;  1XCT L;  4QZH A;  4QW8 A;  4BBN C;  4IM3 A;  1JCK B;  2IO1 B;  1PFD A;  4C8K A;  1JWS D;  3RJJ A;  4HRO A;  2UVV A;  4XGA B;  4BKT A;  3RF9 A;  4US8 A;  5DG7 A;  4FUL A;  5CHW A;  4CHK A;  3ZNZ B;  1F52 A;  2EQY A;  3A4R A;  1WR1 A;  1DXS A;  3ZLZ A;  2JQR B;  4DSL A;  3O13 A;  5TIS U;  5KAF U;  2RQ5 A;  9ICK A;  1KM7 A;  2F77 X;  2NRV A;  4A9A A;  4LZD A;  2KFN A;  1MVK A;  1ZQK A;  5CP2 A;  5GTI U;  3OHA A;  3RB4 A;  2VKQ A;  2I5H A;  2JRH A;  3J81 j;  1YJJ A;  3TFS A;  4NY8 A;  2WXK A;  5C5J A;  4FHJ A;  2G5H B;  4W9E A;  4UAW A;  5T14 A;  4TQ0 A;  4EFO A;  3MP9 A;  2DL0 A;  5KT2 A;  1LM8 B;  4DLG A;  8ICG A;  2D2Q A;  4RZR A;  1XF5 L;  2VRR B;  3I9V 1;  3K9P B;  4QWB A;  3DOW A;  3KWL A;  3SYZ A;  1YIW A;  3NVZ A;  4D2K A;  1GB1 A;  1WX8 A;  4DFM A;  3JSV B;  5KFP A;  2WXN A;  2KJH B;  1H8C A;  4MJS B;  4EYH B;  2LAS A;  1N48 A;  4YD1 A;  2N9X A;  3N1X C;  2G1E A;  1UUP A;  5KG5 A;  4ELV A;  3BY4 B;  1S77 D;  2KVZ A;  5KFW A;  2Y3A A;  3PZ7 A;  1I42 A;  4REZ A;  1V9J A;  4I2C A;  2VZK D;  1MJD A;  2BW2 A;  4B6W A;  3QUC A;  4J9N A;  1RFA A;  4DQR A;  3Q8P B;  5EOZ A;  5AKJ A;  3IHQ B;  4C7Z A;  3OSP A;  1ZQJ A;  2J6T A;  1D8B A;  1QQ5 A;  3IG3 A;  2WF7 A;  2IYD B;  4DL2 A;  5C0Y A;  3PZD A;  2HOQ A;  1IGC A;  2WP9 B;  3ALR A;  4PGY A;  3QCA A;  3N4M B;  4PL1 A;  2C2E A;  1STE A;  4S17 A;  4E74 A;  1CRX A;  4BGD A;  5AZH A;  1OW5 A;  4WWO A;  2WGS A;  2NO4 A;  2KHW B;  2IGH A;  5DBA A;  2ZVO A;  2KMD A;  3GIJ A;  3B1L X;  1WX7 A;  2XK5 A;  3KWV A;  1WGG A;  2FPK A;  1F2R I;  2G0A A;  5IIL A;  3R8B A;  7ICS A;  3CMM B;  2KDM A;  4FS1 A;  4DS4 A;  1HJP A;  8ICL A;  2DF4 B;  1K53 A;  3UXO A;  4C8O A;  3V3X A;  4G0N B;  3ABV B;  4IR9 A;  2W3R A;  1WGR A;  2DHZ A;  2IOH A;  1Z00 B;  4RPY A;  4EE2 A;  4ECX A;  5KAI U;  2NS5 A;  1Q1O A;  1RLF A;  4GC6 A;  2I1K A;  1Y56 A;  3RI7 C;  2IZV B;  3RUL A;  2YMP A;  2W9C A;  2KJ5 A;  2L8J A;  5F3X B;  1PVP A;  4GGQ A;  1MPE A;  1KKX A;  1TS3 A;  4ICU A;  1SZH A;  4JUZ A;  1UF0 A;  4RGN A;  1HQR D;  3GS2 A;  2ASL A;  2R8G A;  3QEA Z;  1F2R C;  2XEW A;  1RYJ A;  1Z4N A;  1SJE D;  1NZB A;  1VZ7 A;  2PKO A;  3IV6 A;  2BPC A;  2MBO A;  1HZ5 A;  1B4F A;  3UMC A;  3CRX A;  2CJN A;  2CHX A;  2LVO A;  1TK5 A;  3LWL A;  1URJ A;  2IHN A;  8ICA A;  2BT6 A;  4ANV A;  4B9N A;  3MAB A;  1KLG D;  2Z59 B;  4W9J A;  3BQ1 A;  1WUD A;  2AQ4 A;  2HBJ A;  5CR0 A;  4EEN A;  4YCX A;  2KKC A;  4KSL C;  1V97 A;  1BT0 A;  1V49 A;  3BVG A;  1SEB D;  1PGX A;  1XWL A;  3RTV A;  2GH1 A;  3PO5 A;  2KXJ A;  4NL9 A;  4BKS A;  4YTN B;  4J9O A;  1LGR A;  5KFH A;  4KGT A;  1SSN A;  4UBB A;  4DSJ A;  3BIN A;  5I4D A;  1QLB B;  3EEC A;  4W9G A;  4A8X C;  4BKG A;  3B2G A;  2H3F A;  2BVC A;  3KKA A;  2JPH A;  4YL8 A;  3OSN A;  3Q8M A;  4L23 A;  5D6J B;  4EZL A;  5EE9 A;  2NPT B;  2KZR A;  2HBK A;  4QZ8 A;  4TQS A;  4DQS A;  2KEY A;  4OVV A;  1GOZ A;  5AZG A;  3KUZ A;  4NAW A;  4BDP A;  2JSV X;  2LZ6 A;  3ZXV A;  1E8W A;  1NK5 A;  1GC7 A;  3AV8 A;  4B9L A;  2PE6 B;  2FAZ A;  3DBS A;  1MHX A;  3JPO A;  3DBR I;  4L1B A;  1E8Y A;  2IMW P;  3MJW A;  5KFF A;  4MH8 A;  1V86 A;  2N9K A;  2ALZ A;  4HDQ A;  2KMC A;  3HIZ A;  1RQL A;  4YQW A;  1YZ7 A;  4DQP A;  2E5S A;  5AKH A;  3WK7 A;  5DPW A;  2QAR A;  4IRD A;  4DF4 A;  4K7W A;  4UAT A;  2PFO A;  2RDB C;  4QZB A;  2KD1 A;  1MI0 A;  3L08 A;  3FKY A;  1WXM A;  1TS5 A;  2R8J A;  1P7F A;  2BYE A;  2K5P A;  1FIQ A;  2C2D A;  5DGA A;  3QX7 A;  4XX5 A;  3TIX A;  3PW7 A;  4QWC A;  1YN5 A;  3QE9 Y;  4GMV A;  2XCA A;  3E0F A;  2FLP A;  7ICJ A;  2H3I A;  2G4D B;  2OYY A;  3AXC A;  5D7G A;  4WWN A;  3KHL A;  3FC4 A;  2AQ3 B;  3Q3N C;  4Q43 A;  9ICH A;  2K4P A;  2V0G A;  3HM6 X;  1YQB A;  4ZHO A;  4C0Z A;  2FMS A;  2PMV A;  1BPY A;  1C78 A;  4ECQ A;  1NK4 A;  3T9L A;  3RNE C;  3SAF A;  2BTE A;  2I38 A;  4Q45 A;  5L1M A;  3R2T A;  1L7Y A;  1KL9 A;  1ZQM A;  2H5X A;  4YTP B;  3Q8R B;  2L5Y A;  3QU7 A;  1S0V A;  5JU5 A;  4MF2 A;  3QZ7 A;  2M0A A;  4JLC A;  4KLH A;  3PPA A;  1ZDV A;  2NRW A;  4TSS A;  4UAR A;  2L32 A;  3KOO A;  2ASQ A;  2IGD A;  3NY5 A;  4RQ3 A;  2PI5 A;  4Y2Q A;  4RF0 A;  1QH9 A;  3KKA C;  1Y88 A;  5ALM A;  1T3Q A;  5KFB A;  2XBB C;  2ONQ A;  3MR3 A;  1ZQB A;  3DWM A;  2KOX A;  4MGY E;  1RXV A;  3QU9 A;  1C1Y B;  3ZGZ A;  3HK0 A;  5IKC M;  1D5Z C;  1ACC A;  4GDL B;  3NAS A;  5TZV A;  2XY7 A;  3NVW A;  2FLL A;  4MM3 A;  2WYQ A;  2LUM A;  3A1Q A;  1JIH A;  4JWN A;  3BZD B;  3D2Q A;  2QKQ A;  1I7H A;  1NJW A;  5HI1 A;  2RDJ A;  2JX5 A;  3GII A;  3P4Q B;  1L6V A;  2BYF A;  3SHQ A;  4MT5 A;  2W54 A;  2KFK A;  5DG8 A;  4IKG A;  2KK8 A;  5KHQ A;  2G9H D;  1J7C A;  1T0Q C;  4NJ6 A;  3UQA A;  3QYP A;  3S2A A;  2F2A B;  4QNL A;  4ANW A;  2NTS A;  1YZ6 A;  3VRA B;  1S9F A;  2N9L A;  4WIP A;  1XCQ L;  3Q3M C;  3SZ2 A;  2MSN A;  3DCG A;  1L7O A;  5ALI A;  3CP8 A;  4UAZ A;  4RT2 A;  2HE7 A;  5D49 A;  2RSU A;  4EEW A;  4TQ1 A;  4UW9 A;  3RJE A;  3R3M A;  4IWO A;  4RNA A;  4P0P B;  4F3O A;  3NS1 A;  3TEY A;  5ALL A;  3UQ2 A;  2W9N A;  4KVG B;  1ZQZ A;  4RM9 A;  1MA7 A;  2JHD A;  5KG3 A;  1J0G A;  3GFK B;  2IOF K;  1ED1 A;  4OD0 A;  1B0X A;  3SV4 A;  3ONS A; 
#chains in the Genus database with same CATH homology
 2LFI A;  3NUH B;  2E3T A;  4MM3 B;  3AE1 B;  2KQ4 X;  3UI3 A;  1FM0 D;  1I4R A;  4KGS A;  4XDD A;  3Q8F A;  3AEC B;  1P7E A;  5BYQ A;  2W55 A;  1WXQ A;  2IJ0 A;  2BYT A;  1FMA D;  1JRO A;  3E56 A;  2XNA C;  2K22 A;  3KLS X;  5D3D A;  2DYM A;  1QOB A;  1V1P B;  4DXF A;  1ESF A;  3CIR B;  3W5U B;  2VZK B;  5BYS A;  1V1O A;  1QOG A;  4JE3 B;  1QKZ A;  1EU4 A;  1HA5 A;  3SFD B;  1NEK B;  4RCO A;  3SFE B;  1L6U A;  2OHF A;  1FRD A;  1JWA D;  4IOI E;  2PVG C;  1B1Z A;  3AE3 B;  1SE2 A;  1FFV A;  4PT5 A;  1TS2 A;  4WH4 A;  4YSY B;  3TSS A;  2LHD A;  2PLP A;  3FIL A;  2BBC A;  3C8Y A;  4J3O D;  2K0P A;  2JU6 X;  1C4C A;  2V4I B;  3H8H A;  2H89 B;  1I4Q A;  4P6V F;  3WCQ A;  2IGG A;  2WXP A;  2WXO A;  3V05 A;  3AN1 A;  2DYO A;  1SXT A;  4LTU A;  3T3O A;  1FXI A;  1PGB A;  2DLB A;  1E0Z A;  4HKZ E;  3HRD D;  4US9 A;  2INN E;  3BWU D;  1EM7 A;  4B0M A;  4CQN A;  1UWX A;  3AE6 B;  1TKY A;  4C56 C;  5AUK A;  2X38 A;  4ZRP A;  3AM9 A;  1R7S A;  1UWM A;  5C2T B;  1NI3 A;  1XLQ A;  3W2D A;  3BII D;  3FAH A;  1C79 A;  2QEJ C;  1YMH E;  2W82 A;  3HVZ A;  4ARC A;  1L5P A;  3W9C B;  2SAK A;  4N6E B;  1FFU A;  2WDQ B;  1JWB D;  1A70 A;  4XE0 A;  3AH7 A;  1IBX A;  3FIL B;  3ZJT A;  1KFY B;  1XO3 A;  3SEB A;  1KRH A;  2K3U A;  3Q8A A;  4NAM A;  5C3J B;  1ZPS A;  3TEW A;  2E6X A;  1I4X A;  4O1N A;  1YJI A;  3VQI A;  3ZJU A;  3L4P A;  1EWC A;  2ZW1 A;  3N9Y C;  3HUI A;  3CWI A;  4YSX B;  1BXT A;  1K52 A;  1QF6 A;  2BS4 B;  3TUO A;  3NVY A;  3RPF C;  3GB1 A;  4YXD B;  1KH0 A;  1D5X C;  1XLP A;  3NRZ A;  4AS1 A;  2WXR A;  2AX5 A;  1E9M A;  2KAJ A;  2CJO A;  4YT0 B;  1I4P A;  4GLS C;  3BK1 A;  1UGJ A;  4HEA 1;  2HDE A;  2Z8L A;  3AMZ A;  1RWS A;  4C80 A;  2K9X A;  3MFG A;  1FXA A;  2PW9 A;  2PVO D;  1FCC C;  1BUI C;  1FEH A;  1IBX B;  3AEE B;  4N58 A;  2WXF A;  3EA6 A;  4KGR A;  4RH6 A;  2GB1 A;  3TEX A;  1ZDX A;  4RGM A;  3U2S C;  1FNW A;  1TYG B;  4H2A A;  1ZUD 2;  1OQQ A;  1VJK A;  1E7P B;  2DWQ A;  3P42 A;  1XLO A;  1YNT E;  2L83 A;  2MJE A;  1OQR A;  1DOI A;  1VZ8 A;  1JML A;  1ET6 A;  2N0S B;  4DXG A;  2WXG A;  3MHZ A;  1CZP A;  1VZ6 A;  1CK1 A;  1SE3 A;  2DBY A;  3U4E G;  1GAQ B;  5D3I B;  3PZ8 A;  1N61 A;  1JW9 D;  1TS4 A;  2NMQ A;  3VRB B;  1HZ6 A;  1YN4 A;  1JQ4 A;  5G5G A;  2J52 A;  5EE0 A;  1CQV A;  5HFY A;  3RFZ B;  2IPK D;  3T3N A;  1TKG A;  2B76 B;  4FXC A;  4IDI A;  5HG2 A;  2FE8 A;  4WUR A;  3AEF B;  4A90 A;  2QMT A;  1M4V A;  1PYW D;  1ZOY B;  1KF6 B;  1XCT L;  2EEL A;  2WXQ A;  4B0E A;  2J42 A;  1JCK B;  3VR9 B;  5BYR A;  3ZQ4 A;  2JXT A;  2ICI A;  2AQ2 B;  1PFD A;  3NZ3 A;  4HRO A;  1JWS D;  2RDH A;  4UDU C;  4US8 A;  4A55 A;  3BVZ A;  2WNM A;  3U7Z A;  4MAC A;  1VR9 A;  2FUG 1;  4JPS A;  2JQR B;  3W5V B;  2I2Y A;  1BML C;  3O13 A;  1QOA A;  1SE4 A;  2JYT A;  2D5G A;  4A9A A;  3R2I A;  1MVK A;  2GI9 A;  2WXK A;  1YJJ A;  4KKI A;  1AWD A;  1D5M C;  1Q10 A;  2WDV B;  4TQ0 A;  1QQR A;  3DWG C;  3MP9 A;  4LK0 M;  3J9C A;  1XF5 L;  3EUB 2;  1IGD A;  1NYR A;  3I9V 1;  1N62 A;  2L1A A;  4YTM B;  1D6E C;  2L52 A;  3IAM 1;  3KWL A;  1GB1 A;  3PO0 A;  3NVZ A;  2AQ1 B;  4D2K A;  4WAF A;  5JXV A;  1KTK A;  2WXN A;  3BK2 A;  3TEZ A;  1JAL A;  2SEB D;  5E6J A;  1K50 A;  2G1E A;  4C7Y A;  1L4D B;  1UUP A;  3SR6 A;  2Y3A A;  4OHJ A;  4R3D A;  1HEZ E;  3PZ7 A;  4REZ A;  3LB8 C;  3Q8C A;  2VZK D;  1JWU D;  2KAC A;  2LJI A;  2BW2 A;  2N7J A;  3EGR A;  4C7Z A;  2Y5C A;  4L2Y A;  4OZA A;  2BS2 B;  1N63 A;  4P16 A;  2WXH A;  1KLU D;  1ZP0 B;  1IGC A;  5G5H A;  1C76 A;  2FBW B;  2WP9 B;  3OWE B;  1STE A;  4TMA B;  3BYT B;  5T8I A;  3Q8E A;  3URY A;  1UNS A;  2QIE B;  5EE3 A;  3VR8 B;  2IGH A;  1E10 A;  1JRP A;  4OVZ A;  4XWW A;  3KWV A;  2PIA A;  3U52 E;  1F2R I;  4RGT A;  3R8B A;  2KDM A;  1K53 A;  2LHE A;  2QJL A;  3V3X A;  2YEP F;  2BB6 A;  4RGO S;  1AW7 A;  2J53 A;  3ABV B;  4OW0 A;  2W3R A;  1HXY D;  4EE2 A;  2TSS A;  3AE9 B;  2JZP A;  1C4A A;  1Y56 A;  1WGK A;  2M56 B;  1VLB A;  2NTT A;  1MHH E;  2WXJ A;  1MPE A;  1TS3 A;  4RGN A;  1HQR D;  3GS2 A;  3AE5 B;  1F2R C;  1RYJ A;  2M19 A;  1OFF A;  1FNU A;  1SJE D;  1VZ7 A;  2PKO A;  4RF1 A;  2BB5 A;  1HZ5 A;  1WRI A;  2CJN A;  1VDV A;  2J4X A;  1E6E B;  1PUT A;  2BT6 A;  3IT6 B;  3E9S A;  1ET9 A;  1DYQ A;  3AE4 B;  5FK9 C;  3P1M A;  1KLG D;  1PDX A;  1J7B A;  2WDR B;  4WQM A;  2PTL A;  3MC0 B;  2HTM E;  3Q69 A;  3ETR A;  1XXG A;  1QT9 A;  3P4P B;  1L0Y B;  3LYY A;  1V97 A;  3BVG A;  3IXS A;  1SEB D;  1PGX A;  1NEN B;  4M0W A;  4ZYS A;  1C77 A;  2WS3 B;  3AED B;  4YTN B;  1WYG A;  4KGT A;  2R61 A;  1SSN A;  3W1S A;  5BMH A;  1AYF A;  5I4D A;  1QLB B;  1CJE A;  4GDK B;  1TJE A;  4OZB A;  4A8X C;  3B2G A;  1SIJ A;  1JWM D;  2RDG A;  1C4P A;  1L0V B;  3I57 A;  4L23 A;  5EE9 A;  5BMG A;  3AE7 B;  4N59 A;  1GOZ A;  3P63 A;  1I4H A;  2JSV X;  3ZJV A;  2OED A;  4ARI A;  3AV8 A;  1IUE A;  4ZOH C;  1MHX A;  1T5X D;  3AE8 B;  4L1B A;  2Q5W D;  4MH8 A;  1N60 A;  4HKQ A;  2N9K A;  2YEP B;  2XN9 C;  3HVD A;  1FNV A;  2WXM A;  2V3P A;  3AE2 B;  1FD6 A;  2GRI A;  5H92 C;  1NYQ A;  1DOX A;  3NVV A;  4WWM A;  2MJ3 A;  1ROE A;  2WXI A;  3MJ5 A;  1MI0 A;  1TS5 A;  1P7F A;  4DQO C;  1SJH D;  2K5P A;  1FIQ A;  1AN8 A;  1YQ3 B;  2WLB A;  2INP E;  2W3S A;  4NZL B;  1QOF A;  1WSP A;  1YN5 A;  4HJG E;  1D4B A;  5GXG B;  3ZYY X;  1B9R A;  3BYY B;  1FO4 A;  2QIL A;  2MJD A;  3B2F A;  1L0X B;  2ACZ B;  4OZC A;  5D7G A;  2QSD A;  5HHD G;  1T6B X;  5TSS A;  4NAW B;  3FC4 A;  2AQ3 B;  2MH7 A;  2WQY B;  2V0G A;  2RPV A;  5EE1 A;  4ZHO A;  4AQ7 A;  1ZXI A;  3B9J A;  1XEE A;  2PMV A;  5LNK 1;  1C78 A;  5AUI A;  2BTE A;  2I38 A;  5H8Y E;  3R2T A;  3BVM A;  3Q8B A;  1ENF A;  1EU3 A;  4YTP B;  3GP7 A;  1PGA A;  1C9F A;  1F77 A;  1L4Z B;  2V3N A;  2M0A A;  4Q2J A;  1YQ4 B;  1ZDV A;  2LMC A;  4TSS A;  4YWG G;  1SB3 C;  2L32 A;  2IGD A;  1GB4 A;  2WU2 B;  2RMM A;  4RF0 A;  1ZE3 D;  3KQ4 A;  3IT4 B;  4YSZ B;  1GPX A;  1TY2 A;  2ZW0 A;  2LGI A;  1T3Q A;  5BMI A;  2ONQ A;  1DOY A;  2KMM A;  2WU5 B;  3DWM A;  4ZHP A;  3AEG B;  3AEA B;  4KKJ A;  4JX1 C;  4XWT A;  5MPO A;  1DGJ A;  3LXF A;  3ZGZ A;  1NVI D;  1D5Z C;  2LEK A;  1ACC A;  4GDL B;  1LO5 D;  5FR3 A;  2H88 B;  2Y5P A;  3AB5 A;  3NVW A;  1FCL A;  1RFK A;  1EWY C;  2JWU A;  4KX6 B;  1RM6 C;  2LUM A;  1N5X A;  1SF0 A;  1TKE A;  3BZD B;  1WWT A;  1I7H A;  5HI1 A;  4USA A;  2JX5 A;  3P4Q B;  1L6V A;  4JWU C;  1TZO A;  2KWD A;  1K51 A;  2MEK A;  2W54 A;  1SBB B;  4MT5 A;  1VRA B;  4IKG A;  1V1P A;  1ZXH A;  2JYE A;  2WXL A;  2G9H D;  3P4S B;  1J7C A;  4A6Q A;  4LLG M;  2NTS A;  4RFB A;  3VRA B;  2N9L A;  4WIP A;  1XCQ L;  1XLN A;  3P4R B;  2EKI A;  1FRR A;  3AEB B;  1N5W A;  4XDC A;  4TQ1 A;  1QIL A;  4RNA A;  1F0Z A;  4JWS C;  2KN4 A;  3NS1 A;  3TEY A;  2BS3 B;  1V8C A;  1J7A A;  1YN3 A;  5FKA C;  4HRS A;  4ZRQ A;  4NJC A;  2CU3 A;  1TY0 A;  2IDY A;  2ON8 A;  4ITK A;  1I4G A;  3IAS 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...