1ZXIA

Reconstituted co dehydrogenase from oligotropha carboxidovorans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional reconstruction in situ of the [CuSMoO(2)] active site of carbon monoxide dehydrogenase from the carbon monoxide oxidizing eubacterium Oligotropha carboxidovorans
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
total genus 50
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1zxiA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zxiA01
1N63A 3AV8A 4HROA 1FXIA 1NI3A 1TKGA 1N60A 5MPOA 1SF0A 4N58A 1RYJA 4ZHPA 1JWAD 1XLNA 3SFEB 1N5WA 1WWTA 1IUEA 4YSZB 2L83A 2MH7A 1YJIA 1XLOA 2WDRB 1EWYC 1V8CA 1WXQA 1XLQA 1FRDA 3PO0A 4YSXB 1PDXA 2Y5CA 1WYGA 2CJNA 2QIEB 1OFFA 2PIAA 2K9XA 1FRRA 3VRBB 4HRSA 1AYFA 3AN1A 1JALA 2K22A 3AEBB 4N59A 2Q5WD 2BS2B 4C7ZA 3W5VB 2PVOD 1QF6A 3P4QB 1JQ4A 1SIJA 2W55A 1YJJA 3AEAB 3P63A 3CWIA 1N5XA 2DWQA 3WCQA 4YTNB 3AEFB 1YQ4B 2B76B 5C2TB 1J7BA 1NEKB 2HTME 1FIQA 5EE0A 3B2FA 2M19A 2W3SA 2PKOA 1RFKA 2BS4B 1QOAA 5H8YE 4ITKA 1V97A 1L6VA 1NVID 2K5PA 1WRIA 1QT9A 3DWMA 2MJEA 2E3TA 1CJEA 1JRPA 1L5PA 2ACZB 2CJOA 3AE8B 3AEEB 3P4SB 2WU5B 5G5GA 3NS1A 3AEDB 3AEGB 2KAJA 3FAHA 3ETRA 1KF6B 1N61A 1L0VB 5GXGB 1GPXA 3EUB2 3HRDD 3NVYA 1VLBA 1SB3C 3NVVA 2H88B 3KWLA 4KX6B 1F0ZA 1E10A 3SR6A 3B2GA 2BS3B 3AE9B 4N6EB 2AX5A 4USAA 4IDIA 2JX5A 3AE7B 4YSYB 3RPFC 2PVGC 1N62A 5EE3A 3FC4A 3AE1B 1JROA 4C80A 4JWUC 2WS3B 3ZYYX 4C7YA 1ZOYB 5EE9A 1KFYB 2BT6A 2WP9B 3BIID 4WWMA 5H92C 1RWSA 1TJEA 5C3JB 1FFUA 3LXFA 3AM9A 4ZOHC 4P6VF 1TKYA 3LB8C 1KRHA 2QJLA 3CIRB 1WGKA 1PUTA 1TKEA 1FO4A 1JWBD 3L4PA 4US9A 1CZPA 1QOGA 2OHFA 1J7AA 1A70A 1UWMA 1QLBB 1FMAD 5AUKA 1OQQA 3AE6B 2H89B 3AB5A 1QOBA 2CU3A 1QOFA 1TYGB 4WQMA 4YTPB 3VR8B 2W54A 3HUIA 2G1EA 4ZHOA 4YT0B 1DOYA 2WDVB 4JWSC 3AE5B 1RM6C 1DOIA 1ZXIA 3W5UB 4A9AA 1NENB 3AH7A 4YXDB 1JW9D 1NYRA 2MJ3A 1I7HA 1XO3A 1E7PB 2WQYB 1ROEA 3W9CB 2WU2B 3SFDB 3HVZA 1E6EB 1E9MA 2EKIA 5EE1A 1E0ZA 4JX1C 5G5HA 2WDQB 1DOXA 3B9JA 4LTUA 2WLBA 3P4RB 2N0SB 3AE3B 5AUIA 4YTMB 4US8A 1R7SA 3NRZA 2M56B 3AE4B 1J7CA 1NYQA 2LEKA 2MJDA 1VDVA 3ABVB 3P4PB 2W3RA 1B9RA 1AWDA 1ZP0B 2DBYA 1T3QA 3DWGC 3VRAB 1YQ3B 1FXAA 3P1MA 3AECB 1FM0D 3AE2B 1XLPA 2KMMA 3VR9B 1GAQB 1DGJA 1OQRA 3AMZA 3NVZA 4FXCA 2JQRB 1VJKA 2L52A 2FBWB 1ZUD2 1PFDA 1L6UA 1FFVA 3NVWA
chains in the Genus database with same CATH superfamily
5AK5A 3AV8A 2OH2A 1YX6B 4ELUA 2KN4A 3OJ4B 3RB6A 2R8KA 1WSPA 2ZJ8A 9ICAA 5BYQA 1KLVA 2BZFA 1E90A 4WAAA 4YSZB 5FR3A 1WYWB 4EE2A 1CEZA 2WDRB 3LJ3A 2XGQA 3D2SA 2HOQA 2CR5A 1ZW7A 4Y2TA 4EBCA 2SAKA 4GDKB 2C7NB 4P0QB 1PZNA 4C7ZA 4QZIA 1YMHE 4XE0A 4MDKE 4UB4A 4DSJA 3EFUA 4TMAB 1U47A 4ANVA 1N5XA 1WR1A 2K8AA 1NI2A 5HKHA 2WXIA 5IN7A 2AGPA 1BUIC 4BXOA 1SJHD 4G3XB 2NTSA 1PUZA 1ZQZA 5BYSA 3MR3A 1KLGD 1NJYA 2CS4A 3V62A 5DB8A 5LXIB 2E3TA 4YR2A 4GDKA 2Q4TA 1P3QU 5JXVA 3M8RA 1XS9D 1ZYQA 1N61A 1X9MA 2DLBA 2MSED 3HX0A 2PMVA 2HDOA 2FPLA 3B2GA 1NJZA 5AKHA 4KV2A 4YSYB 1L7OA 3GU3A 3RPFC 4NLGA 2LXAA 2N9EB 3TANA 5ALQA 3Q3OC 5EE9A 2XK5A 4DHJD 2LGSA 1IP9A 4KX5A 1MG4A 2KZRA 4LDTD 5HMLA 1QSSA 1DK3A 1RWSA 5C3JB 1SBBB 3W2DA 4BBNF 2F8LA 2V4QA 3MABA 2FIFA 1QZEA 1E8WA 3CIRB 3AUOA 5HHIA 5KT5A 2KVSA 1QOGA 4PPXA 4RQ5A 1WJUA 2LZ6A 4W9FA 2ZUBA 2IOHA 3FM9A 2KIWA 3MDAA 3EECA 2N7EA 4O5KA 2G1EA 1Q10A 4C4VA 2OM6A 3DBHI 3EGRA 3EA6A 3TBLD 3DV9A 2W9NA 3QHTA 4LNKA 4OZBA 1JW9D 2W9BB 1KTKA 4QJFB 4C0ZA 2BHNA 4KKJA 1F1HA 2V3NA 4MGKE 1Q1OA 4XUSA 1UH6A 5EE1A 5TR5A 1UQVA 1ZDXA 4LTUA 9ICXA 7ICSA 2UVWA 1H8CA 4C8OA 4KLDA 1TAUA 1C77A 1MHHE 2W3RA 2YMPA 2JSVX 4DHZB 1L0YB 3ETLA 4M9HA 1T3QA 4LDTB 4DOAA 2GWSA 2V1YA 1DXSA 3HM3A 3VTWA 3WU2U 2HHWA 4C4RA 2GRIA 3IVFA 2JEJA 3R3MA 3PREA 4IG7B 4YVZA 3DHIC 3M7DA 5AKEA 1MHXA 1BPYA 2N9XA 3H7PB 1RDFA 4NLBA 2LM1A 1UA1A 2PJHA 3KOOA 1C20A 4G11A 1XLOA 1YQBA 4RQ2A 4WJPA 5DLFA 3HW8A 1HIWA 3RYTA 2RDJA 4DFJA 4TSSA 1SEBD 3EYZA 1WJ4A 3D32A 3DVGX 3R66C 3AU2A 3ZDBA 2BYVE 5BOLA 2QEJC 4L23A 3A0BU 2WFAA 4F50A 1U4AA 3P4QB 1QF6A 2W55A 3AEAB 2DAFA 4IL6U 4EBDA 3BJYA 2KANA 1WXVA 2B76B 1VZ8A 5EE0A 5DBAA 2KKCA 1NK4A 5KAIU 4IWPA 1IV8A 5DQHA 3O65B 5KFBA 2X8XX 4NJ8A 2KIVA 1QT9A 4O5EA 1XO0A 1ZRMA 9ICGA 4GN1A 2WU5B 1S8OA 9ICFA 5KFHA 1MG8A 2C5LC 4I6PA 2AU0A 4OVVA 5J0XA 8ICKA 2KTRA 4E3CA 2IBKA 4OVUA 2O2VA 3N32A 4GXKA 1VCBA 2MRPA 2PVGC 2MBEA 3MJ5A 5KFUA 2LD9A 3U7ZA 4KLIA 5AI5A 9ICKA 5DB7A 4M9NA 3F5EA 3QU2A 1D9FA 4HVBA 2PFOA 1KFYB 3Q8KA 2H3IA 4FBJB 2G5IB 2CHXA 1WUDA 3RFZB 2ZTEA 5DDYA 5JHBA 3E9SA 5JHAA 1S97A 4HKZE 4REZA 2HTHA 5GTHU 1X9XA 8ICTA 4BUGA 4AOFA 4BZAA 2XY5A 1GJZA 2G45B 1TTNA 4I6LB 3GP7A 4HDQA 3LDAA 1ZJMA 3LWMA 1D8BA 1UF0A 3TFRA 3WKDA 5J2CA 1ZQMA 2AQ1B 1KJTA 2RPQA 3ML8A 3RI7C 2KTFA 3AE5B 3VQIA 3RT3B 3ML9A 5DB9A 5KFFA 1IM4A 4QZ9A 1RYSA 3DDCB 4EBEA 2VA8A 3HM6X 4BAXA 4ED6A 5TZVA 3MR5A 4XYCA 4JX1C 4ED3A 1HUZA 5D94A 4ZH4A 1CUKA 2LJ5A 5J2DA 3Q8SB 3ENEA 1OQYA 1XXGA 1KH0A 3AU5A 1EUVB 1ZQWA 2ZTCA 4XA5A 1F9JA 2KTRB 3EFCA 2KNJA 4NZLB 4UAVA 3WKEA 4ZRIA 3RNBC 3C0RB 2AL3A 3GE3C 4YG2A 1M4VA 4L1BA 5ALLA 2H3FA 1KEJA 3GS2A 2Z7JA 2C7HA 3AXCA 2WXQA 2YMQA 5C23A 8ICSA 2ONQA 2N1WA 2H3ZA 1LVHA 4P0PB 4FHJA 1SF0A 3ZUNA 1ZQRA 1T4GA 5J0TA 1XLNA 2C22A 2N1RA 1ZQJA 2BQQA 4DHZE 1RRBA 4B6JA 3HHMA 4RF0A 4NY0A 1D6EC 4W9DA 1O03A 1RYRA 3DCGA 3HKZC 1SE4A 2KYWA 4N59A 1EF1A 8ICOA 4PL2A 3PZPA 2R2OA 1XCTL 3IRUA 3QK0A 1K53A 3JYUA 4EZJA 3M9NB 2DWQA 5CJ7A 1STEA 2MAXA 2IGGA 4XC2A 1UHUA 2L3ZA 1MPEA 4RNNA 2AXTU 7ICVA 2MBOA 3WALA 1TK8A 4KLMA 1KFDA 1L7PA 3AE8B 3OJ3A 4A3PA 3T5HA 2IHNA 1B43A 2WHIA 5CRXA 1SWVA 4EYHB 3AEGB 2PE9A 2HMXA 3KZIU 1MC8A 2GH1A 1EF5A 3UXNA 3W1SC 2DZJA 1J0GA 2HBKA 5DG8A 1KTQA 1P0RA 1TZOA 4MACA 2AHOB 3BWUD 2BKFA 3RTVA 1VZ7A 4NJ6A 1ZQAA 2ZJAA 3AQFA 2TSSA 3LXFA 2PLPA 5AKZA 3ISCA 1PUTA 5ALPA 2IMWP 1GOZA 2XK5B 4HJGE 3QXGA 4DK5A 5KFNA 3WKCA 2ZVOA 5KFSA 5KFXA 3TACB 3ZDEA 1C9FA 5KFYA 4MF2A 4J6IA 2QARA 2ON8A 5DGBA 3PSIA 4Q43A 1CRXA 1A0PA 5AI8A 3ZRFA 3ZXVA 2RHFA 3ZKJC 4IRCA 4RFBA 3F5AA 3GOEA 4YXDB 2VJ5A 4J9QA 3RJJA 3PMNA 2NRXA 3N1XC 3MTNB 1K51A 2WQYB 3RB3A 4B9MA 2LYHA 2QSDA 4LNOA 2JY6A 2W9BA 2NBWB 4FE3A 1PK1A 4M0AA 1HTQA 2XY6A 3KWVA 1J7CA 2ZW0A 5HHHA 5KFZA 4JWNA 2C7MB 1VDVA 2O2VB 3P4PB 2WXOA 4DOBA 1KFSA 3VFKA 2JHDA 3UQBA 1ZP0B 3Q3FA 1AW7A 4BGDA 3RR7A 1WH3A 4JUZA 4DXAB 2ZIUA 4TQ0A 1PK3A 5E6NA 3TI0A 3AMZA 1X9WA 3GIIA 1OQRA 4DSEA 3QE9Y 7ICMA 1VJKA 5B66U 4KLJA 5L9XA 2J0MA 3M8SA 5HI1A 5KT4A 1PYWD 5KFMA 3L08A 2HHUA 4DFKA 1RYJA 1UA0A 2M1MA 1ZQBA 5HP4A 1LQBA 4M02A 5FK9C 3LDZE 4K3CA 5CHFA 1EWYC 2JRZA 5D4BA 8ICFA 5AM4A 4QWCA 2FUG1 4YSXB 2K4EA 4PHAA 3UQ2A 3WAMA 4ANWA 3BVMA 2CU1A 3W5VB 4BVUC 5KFRA 3Q8PB 2ZVNA 3NUHB 3VCBA 4MH8A 2LUMA 5L83A 1TS5A 3PNCA 1KM7A 1SL1A 4MGYE 5KT6A 4GOCA 4EYIB 4O9MA 1YQ4B 4WWPA 1D8LA 3GIJA 3SV3A 5J17A 3T5LA 1MJDA 2KVCA 2JT4B 5BMGA 3TADA 2KMDA 3HJEA 2BF8B 4FLHA 1P7EA 2IDYA 1CJEA 2G06A 4J9RA 2ALZA 2A19A 3SMVA 5EOZA 2R8HA 1SGHA 2AEHA 1B1ZA 4DWFA 3PHWB 4XDDA 2IGDA 2C60A 4YFKA 3C19A 3M63B 2H88B 4HWIB 4Y2JA 3G6VA 1CMXB 4OZCA 4MM3B 3PVXA 3RBEA 2VH1A 3NS8A 1G6JA 2HE7A 2NS5A 1N62A 2LGYA 4ACFA 3HP6A 5KFQA 2BB6A 2VH2A 1GB4A 4ZRKA 3LWLA 5KL1B 8ICCA 1KSPA 3A9JB 3ZXRA 4KLHA 1YN5A 4O5CA 1RYUA 1S0VA 1BPBA 3L4PA 4ECQA 2K8BB 5KT2A 1FNVA 3C5GA 4IQWA 3HT3A 2J42A 1QKZA 3RB0A 2WXNA 2W9AA 2DPJA 2W54A 1BPXA 1YD8U 4QZHA 4F93B 5G55A 3FYHA 1BVSA 4EENA 2BGFA 2W9CA 3Q8LA 9ICOA 2B3AA 1KLUD 2XEWA 4M04A 1JXLA 4OZAA 3AQEA 2D3BA 1WIAA 4I28A 2DUYA 1XO3A 2V0GA 2W7OA 1P7DA 1ZQGA 3ZRCA 4BKSD 1C78A 3PRZA 3D2QA 4RUAA 3KKAC 1ZOLA 7ICEA 2WDQB 3VUYA 5IIIA 3BQ7A 2UVVA 1S77D 4B9VA 4K7UA 4WWOA 4PK1A 4JL9A 2O6VB 3NG0A 2WXRA 4P2HA 1HEKA 3NOBA 4QAYA 4W9EA 2L05A 2VA2A 9ICLA 2NPTA 4YR3A 1HA5A 1I4GA 4B9LA 2WB1C 3DWGC 1ZKHA 3QUQA 2KFKB 8ICIA 3L5KA 1X40A 5IILA 3GDXA 3AE2B 3N1ZC 4NNJB 4MF8A 2WGSA 4IWOA 1GAQB 3R2TA 3PV1A 3ZNHB 3C5FA 4IR1A 1KFTA 2L52A 3A4RA 4PZOA 2FBWB 5EDSA 4M9JA 1R4NB 1N63A 2FI1A 3EPIA 3H8WA 2J6SA 2O6VA 2IGHA 1ZQKA 2ZNVC 1D5MC 5J29A 2Y1IA 4NL9C 3DHHC 4AYBC 2BCVA 3DQVA 3RBDA 2L83A 2KFKA 4LNFA 1S5LU 1I4PA 2IJ0A 1GC7A 2JZPA 4Q45A 4OJOA 3HWTA 5D3DA 4EZLA 4C4VB 1KOTA 2RD0A 3NHEB 1A6SA 2EAOA 4M00A 3QU5A 3PX4A 3IT6B 2JXXA 3K9PB 2F76X 2JXJA 5J2HA 4GC7A 2A3VA 2JYTA 3T5KA 2CKHB 1L8OA 1SE2A 1SIJA 3ZNZB 5E6OA 5L1MA 2XNAC 3ZQ4A 4UATA 5AM5A 1BNPA 3QU4A 3UXPA 4PHEA 3QEAZ 3ZTCA 4WJOA 4JK1A 4KZCA 5HHDG 3LK9A 2F1IA 2K6QA 1NVID 3U26A 4WH4A 1QILA 2DZMA 2WXGA 3QCAA 4J9SA 4AWJA 2K8CA 3KTQA 4F4KA 3V61A 4ECUA 3K1RB 3HRDD 1FCLA 1Q8KA 3C1ZA 4KX6B 1SL2A 3SR6A 2KXJA 3M9MB 3N9YC 3JPPA 1AN8A 1SGGA 2ZJDA 4ECRA 1HJPA 1BT0A 4CNQA 9ICJA 1HZ5A 1OEYJ 4IQUA 1IBXB 2BPFA 1JX4A 5ALYA 1JWMD 3TADC 4QWEA 2WS3B 3Q8MA 7ICFA 2HHVA 4IKGA 4F5NA 3RNEC 5H92C 1WCLA 5HR7A 4KSKC 1UT5A 4RQ7A 5J2AA 1TKDA 2KSOA 3V3XA 2ASQA 4A20A 3QU7A 3TEWA 1Z5SB 4HPPA 1TGZB 2L32A 4G0NB 1A70A 1IG6A 1F2RI 4WQOB 2FE9A 3ZJVA 4FJVB 4QIWC 2M0XA 2KK0A 2IPKD 3QWZB 3HUIA 4TQRA 5T8IA 2PFNA 1GNUA 9ICQA 4Y2VA 4Q44A 2BQUA 4DQQA 3P42A 3H0LB 1X6IA 1QLNA 4C8MA 2PFPA 1MI0A 3QQ8B 3W9CB 3MFHA 2MUTB 3Q8QB 2V4RA 2KJ5A 4D2KA 1P9DU 2MA9B 3MHZA 3A0HU 5ALWA 2R8IA 2KDEB 2DENB 2JZZA 1WWVA 2VJ4A 1NZPA 2WB1F 2MBHA 1OUQA 3AE3B 4LLGM 4P7IA 1NYQA 4BFRA 3QX1A 4RT2A 4KITB 3PSFA 5CHVC 2HHTA 1GO3F 3VRAB 1ZRNA 1YIWA 2EMSA 3UM9A 2RDBC 2KG5A 5IKCM 4UASA 1UBIA 4M0WB 3PSTA 3VR9B 2D5GA 2RSUA 1C1YB 1I4HA 3A9JA 1A76A 4DSKA 1IPGA 2KN7A 3P2BA 2L0FA 1T6BX 4MFCA 2J53A 1NI3A 8ICGA 3CYMA 4UAZA 4S17A 4WWNA 5MPOA 3KH0A 1YT3A 4J9LA 4DS4A 8ICQA 1F2RC 4Z6EA 2JWUA 2DKXA 4A55A 4P4MA 3M62B 2FAZA 4II2B 1SXTA 1Z00B 4UDUC 2MH7A 2Y0SC 4HKQA 1ACCA 4R66A 3MGVA 4QZAA 2OJWA 4YN4A 2PIAA 3VDZA 4KLEA 4DDGD 1ESFA 5ALFA 2G9HD 5CTRC 2GOLA 2QB0A 1EU3A 3TEYA 1SKWA 3QUTA 3BQTA 4IC7B 4I2GA 3ED5A 4AQ7A 3VC8A 3DEEA 2BDUA 1NKCA 2F8KA 1XD3B 2N9PC 4Z6FA 9ICRA 2F77X 1FIQA 4CE6A 4UB5A 4MEYA 1TIFA 2M19A 2E8PA 1T7PA 2WTFA 5JUMA 2KLGA 2M0AA 2CRXA 2RDHA 4KLGA 1CK1A 1L5PA 2CJOA 3P4SB 2DX5B 4S0RA 4F4YA 3NGDA 3TAQA 3PW2A 2IZVB 1SB3C 4IRDA 3RH4A 4DXGA 3DOWA 2IY1B 2D3GA 5KFJA 1J97A 4RU9A 3KW5B 4RGMA 3ZNGC 4EX7A 2YMMA 2ATLA 2N7JA 1F5SA 3PPAA 2KHVA 4KX3A 1L3UA 1DRGA 2WYQA 2BPGA 3OAWA 5KFWA 3WK6A 5KFOA 1D9DA 2BT6A 3LYSA 4ZRPA 1TY2A 3S2AA 3IXSA 1X66A 1TJEA 4DO9A 3S6JA 3ZJUA 5KFGA 2ZIVB 1L4DB 2RP5A 3WK5A 3TAPA 3BK2A 3TUOA 4KLUA 1TKEA 4AYBF 2HSZA 4DSLA 2LVOA 1UCVA 1ZD5A 3N3KB 1E8ZA 1XNSA 4C4TA 5AUKA 4Q8FA 5KFPA 2YB1A 3C2LA 4EZ9A 1HEZE 2CHWA 4CRXA 1XWLA 2DFLA 2RR9A 2REXA 2W82A 4YT0B 4IQTA 2WDVB 2ESEA 4AP9A 7ICHA 5AHXA 2MBQA 1DGSA 2K0PA 2KJHB 4I6NB 3VXWA 4YD1A 1E7PB 2LASA 3GIMA 1A77A 1IYFA 5CA7A 4IOIE 4W9IA 3JPSA 3ZI4A 2XBBC 5FKAC 1Y88A 4FZMA 2BPSA 2KFNA 5ALUA 7ICLA 1L3VA 5D3IB 4GXJA 2QKQA 1SSNA 5AZFA 5KFKA 2HVHA 2BQ3A 2MW5A 1NJWA 2J0JA 2MJDA 4TV3A 5L1IA 1E7UA 3L16A 3B0YA 1BXTA 4UARA 3PS6A 4QZFA 3AU4A 3O0FA 3X0WA 5ALZA 2J4XA 1FXAA 4JV0A 3AECB 4CQNA 1NKBA 8ICRA 4HLEA 4F2RA 2BPCA 2NPTB 3DVNU 1IXRA 4UB2A 2JQRB 2LGXA 2KE7A 4YXMA 1OEYA 2J7QB 2BTEA 3KHLA 5J0YA 4HROA 1L8LA 2KZZA 3RJIA 4HDOA 3RULA 2WDTB 1N5WA 1U4BA 1KRPA 3ZIMA 3PTFC 4JMUA 5KFAA 2OWOA 3ZLZA 4R65A 2J0KA 1DOQA 3DVGY 3A1QB 1SE9A 5ALOA 2G08A 1PDXA 3H0RB 4QZCA 5AKKA 3MC8A 4RT3A 2QIEB 4ICVA 3H8JA 5FR6A 3TSSA 1FRRA 1UGMA 2BB5A 2H3VA 1NDDA 4LZGA 1YJ1A 7ICJA 1O08A 4O1NA 1XCQL 2JRHA 3GV8B 3JPNA 1SJED 4FS1A 3Q2AC 2LYBA 4J9NA 3GZNB 2E1EA 4RPYA 2Y5PA 2IO0B 4YWGG 1QOAA 3FKYA 4IQVA 4MELA 2HHQA 4B0MA 2IOFA 3MC1A 3ECIA 2O6KA 3CSTA 3ZO5B 2JF5A 2AGOA 3GIKA 4KDLB 4E0DA 2KX0A 3FAHA 1R4MB 1KF6B 3PX6A 5AKGA 3TL5A 1F0ZA 2B0CA 1L3TA 4LZDA 2BKRB 1D3ZA 9ICSA 3RMKC 2DZKA 1NK7A 3APDA 1QQRA 4F4ZA 4A6QA 3C23A 2EZZA 5ALKA 4B9UA 4HAIA 1V6EA 1V81A 4EKUA 1LB2B 4P1BC 3QJZA 2I6XA 1FFUA 2KHQA 4RQNA 2FCQA 4UB8U 3ZVVA 3LB8C 2QJLA 9ICBA 1WGKA 4NJ7A 4AUQC 2NMQA 4ZDVA 2OHFA 2P6RA 1RZTA 2I38A 4YXJA 1D4BA 2PEAA 4QZEA 2AQ4A 2OJRA 2JWZA 3K75D 1KDHA 1YOVB 2SEBD 3DHGC 5KTQA 1C3TA 1YZ6A 5LNK1 2PMZC 5ALMA 2VIXA 1ECWA 3I76A 2BDPA 3R8BA 1DYQA 3K9OB 4UAUA 5AI0A 1MQ2A 4RQ1A 2CN1A 5ALXA 4B9NA 3T8MA 3ZDDA 2G3QB 4DQIA 2N0SB 1L7MA 4ZYNA 4YTMB 5D6JB 7ICPA 2I1KA 3IDWA 5FP0A 1Z4NA 2JYEA 4RNOA 2BW2A 4YMNA 2BGWA 4MHVA 5ALSA 5DGAA 2INNE 3N7RC 2LMCA 3DBSA 4I2DA 4JV1A 4ELVA 2DAJA 3GB1A 1HXYD 1RAXA 1RXWA 2IO3B 4B0EA 4JIOU 5JZEB 4MGIE 1ZQIA 4GIBA 3KYCD 1XT9B 4O3OA 1WI0A 1YN4A 3WIMA 3HPOA 5AM0A 2K6DB 3ICXA 8ICEA 3UMGA 2KEYA 2D3AA 1JMSA 2GO7A 1WWTA 2AQ0A 1KN5A 3HILA 2W43A 2Y9UA 5LLIA 4BOSC 2E8OA 2K4PA 2DQNB 1X42A 1ZQVA 1E5WA 2KK8A 1E7VA 4H2AA 5AIAA 2XIDA 2PE6B 2D8CA 3DBLI 3AN1A 4DSIA 2JGAA 5HNKA 4ACOA 4DCCA 2K60A 3JSVB 4DL2A 3P63A 1TS4A 3ZJTA 3LYYA 3IT4B 4B9TA 1HE8A 1SZPA 4QNLA 3WCQA 1UPHA 5AKIA 4M47A 4DL5A 2W3SA 1PK1B 5J2JA 2K1FA 1F44A 3V72A 3PRPB 2HOIA 3JW0X 5AK3A 4KLSA 5ALDA 3NS1A 5KG5A 2VZKB 3ETRA 5DBCA 4QWBA 3QEBZ 4ED7A 4AS1A 5DPSA 2KD0A 2V3PA 3H1UA 1URJA 2FJ6A 3IG8A 3UIOB 3T3NA 3NASA 3FDSA 2AX5A 2GLSA 4USAA 3V6JA 4GDLB 3AE7B 5C1ZA 3MDCA 4FN2A 4PH5A 3KHGA 2K8HA 3BVGA 2K39A 1XO1A 2BVCA 1V9JA 4KDIC 2KDIA 4GMVA 1K5OA 3ZDTA 5ALVA 1TAQA 2C2RA 2R61A 3AM9A 3IG5A 1XF5L 3AU6A 7ICKA 1TKYA 3SU8X 3CNHA 5KFVA 1FO4A 2ZIWB 1JWBD 3F53A 2AQ2B 4BWJA 2DNFA 1V38A 2QLTA 1FNUA 3AE6B 1ZQLA 3AB5A 2CU3A 4C00A 4RQMA 2G4DB 5CR0A 2ICIA 4LNNA 2NBVB 5JRTA 4JGHB 4K3BA 4KLOA 5C0YA 1RM6C 2FPMA 7ICIA 1WZ3A 2WF6A 3G6XA 4K4IA 2KDBA 3OHAA 4F3OA 4I2EA 3PT2B 3IFWB 4XWWA 4DF4A 1QSLA 1VZ6A 4DF8A 3UF8A 2PXIA 4RCOA 3SFDB 3Q8BA 1E6EB 3NZUA 4GLSC 3WKAA 5TSSA 1N2XA 2K8CB 4RPXA 3EZ5A 4ED2A 2J6TA 8ICXA 3PO5A 4EELA 5AUIA 2ZXHA 3C29A 2ZPYA 3AI5A 3VTUA 4Q2JA 4BJQA 4XX5A 3IV6A 1WG8A 4ECTA 1AWDA 2Z8LA 5EWGA 3ZD8A 4GXIA 2DZIA 1YQ3B 2D11A 4CO7A 4DXFA 2BWES 4Y2QA 1FM0D 3TEXA 1UGJA 2WHEA 2P6UA 4HPLB 4IUMB 1Q3VA 1NENB 5J2IA 4RPZA 3E58A 3AH7A 5C2TB 1L7NA 1KBUA 4B9SA 4XZ4A 2AYOB 4N58A 1TS2A 3DBRB 3MGHA 4DL4A 4PYZA 2ES6A 4DOCA 4FZLA 1UBQA 1PGBA 1ZE3D 3RNCC 4BKSA 5J0OA 2NO5A 8ICHA 4UBCA 4MGZE 1N48A 4NLCA 4RF1A 2CJNA 3NJTA 3OG5A 4DDID 1ZQEA 2KJRA 4LNIA 1WWUA 2BCUA 4M8NA 4NPNA 2K4IA 3CWIA 4M6WA 4J3OD 4TUUA 4KN7A 2LJIA 4YTNB 3BZKA 1D8YA 2ZZPB 4F92B 3QX7A 4URKA 3N20C 5D2MB 3N7SC 4XDCA 5AM3A 4F5OA 1C4CA 3AEEB 1ZQXA 5G5GA 4PGXA 5J2EA 1TK0A 5DQIA 3V6KA 3QIJA 4ED8A 2L5YA 1ZQHA 8ICJA 4M0WA 3WKBA 2JX5A 3RCZA 1JUDA 2ZUDA 5HFYA 2GB1A 1C7YA 2JEFA 4TQ1A 2K4HA 3SI8A 1V5TA 2INDC 4HPMB 3ZGZA 4K4GA 5ALEA 2QMTA 2WP9B 3RZFA 4I29A 7ICRA 4PS7A 2KNBA 5AI4A 4NAWA 2L0TA 2HJ8A 2A1JB 4CYEA 5AM1A 4XGAB 4IW0A 2LFIA 2HVIA 1ET6A 3C8YA 3PSPA 2W9CB 4IWQA 1OQQA 3V7KA 2H89B 4JB3A 2N7DA 5AIBA 2ZCCA 1TYGB 1Z19A 1V9PA 3PR4A 1ENFA 3D6JA 3K4GA 1SL0A 3RAXA 3PO4A 1ZQNA 3IM1A 4KLQA 1UD7A 2LVPA 4JWSC 3TEZA 1WRDB 2V9HA 2WX1A 4FADA 4E71A 2G0AA 4DEZA 4GIVA 2KC2A 3K1ZA 5L1JA 2FLNA 1NYRA 1T5XD 5AICA 1PVQA 2EKEC 1COKA 4MSQB 3KHRA 4MJSA 3WAOA 2BYEA 4I2IA 2R2QA 5AEKB 1E9MA 4LCDE 4J9OA 1WX9A 1ZJNA 2DYOA 1ZQYA 1WZ0A 1I42A 5G2NA 4KGRA 3H9DA 1ZD3A 2YLMA 2Z0DB 2JEGA 3ABVB 1YZ7A 3RF9A 4I27A 3PLVA 1B9RA 3IAS1 7ICUA 2BCQA 9ICVA 3KQ4A 4NQKE 3M9OB 3JPRA 2A4ZA 2ASLA 3CMMB 2PMZF 3A1QA 3DVNV 3PZ7A 3I9V1 4F8RA 2LM4A 2KOXA 2N9LA 3SENA 3U52E 3KUDB 1L6UA 1FFVA 4ANXA 3PW5A 2HBMA 4X57B 2MP2A 1N60A 2KMAA 2ZIWA 2W03A 2WF8A 1FXTB 4ZHPA 1JWAD 9ICUA 5KFTA 3J9CA 1H38A 3OWEB 2N1VA 4F1SA 1X1MA 5IINA 5KG4A 2JZ3B 3VUWA 2ZEQA 4RQ4A 3I28A 4HRSA 2KLCA 3EWAA 4MEXA 2KWVB 1L2NA 4UB6U 2PVOD 2LKYA 3U8ZA 1YJJA 3U4EG 2Q0ZX 8ICPA 3UIPB 2YVCA 2EH9A 2Y3AA 1LGRA 2IBIB 3RRGA 3U30A 4MSMB 3MC9A 2WF5A 5IO9A 3N97B 2F2AB 4ELTA 1C76A 5AKLA 5E79U 3RJEA 4O3NA 5DBBA 1Y8RC 3SD5A 4MT5A 1S0MA 4DHJB 2ACZB 2MX2A 3APFA 2CXYA 3GE8C 1K1SA 5ALIA 3GILA 1GPXA 1ZDVA 3E56A 3NVYA 4NV0A 3L17A 4QW9A 3NVVA 1JRUA 1WCNA 2D2QA 4XWTA 2FCSA 3QARA 3AE9B 2NRVA 4OO1J 1ISNA 3UXOA 2KC1A 3KUZA 4IDIA 3F2DA 2LXCA 2NBUA 4JPSA 2HDEA 2YQEA 2FUHB 5I4DA 2PPHA 2B21A 2W7PA 2OXOA 2LPEA 1JROA 2UWQA 3AE1B 4FBUA 3TIXA 5KHQA 4AJWA 1U9LA 3RH6A 4Y2RA 1C79A 4DL7A 2GOWA 2Z59B 4ICAA 4QZBA 4R64A 3PZ8A 4OJ5A 4PJ0U 1RQNA 3Q3MC 4PYUA 3T9LA 2V4IB 5IIKA 3URYA 1WJNA 3OTQA 4US9A 4C4SA 4NWIA 2EZXA 3UINB 1J7AA 2ZCBA 4U7CA 3DBLB 3SHQA 3M6KA 1WX8A 3H4BA 1QOFA 1EXNA 3ORYA 3ONNA 3GQCA 4LK0M 3ISDA 4JWMA 4CCHA 4Z6CA 2MQJA 4NM1A 3UI3A 5KFEA 3UPQA 5HG2A 3MC0B 3VH4B 3BDPA 7ICQA 4FZNA 1K50A 1ROEA 4EOYA 8ICZA 4KZ0A 3WAPA 2UVUA 3HVZA 3M6ZA 3TCAA 5G5HA 3CF6E 2DYMA 5AI9A 2R18A 4DWIA 4J9KA 4DFDA 5AKYA 3H8HA 2WXKA 3NRZA 3RNGC 2MUTA 3RB4A 2KZMA 2QCZA 4ECWA 4KGSA 2EANA 5F9NA 2KX3A 2WF9A 2YEPF 3DBHB 3OHBA 5KG1A 3TMPB 2NRZA 2KMCA 3RUIB 2R8JA 1UUPA 2QHOA 2JMGA 3MFIA 3SAHA 2XGPA 1C4AA 4YP3A 5KG0A 4G9BA 3T3FA 4EEWA 2FE8A 2PW9A 5J8YA 2OYYA 1PFDA 3D2NA 4J03A 3F2BA 3C1YA 4LVSA 1ZQUA 4KIKB 4GLXA 2W8KA 1UNSA 4KVGB 4BX9C 3RRHA 4BXOB 2FMQA 5J2FA 1YJIA 4NAWB 4KLLA 4MFFA 1U45A 3Q8AA 4RGNA 3PRMB 1V8CA 1QTMA 3NY5A 2ZTDA 3SV4A 5EWEA 2B6GA 2WWZA 2RQ5A 3J81j 8ICWA 1KW4A 2F1JA 1ZQPA 2K9XA 3VTVA 3MFGA 4MEMA 1YN3A 1JQ4A 7ICGA 4ICUA 2AL6A 3MR2A 2MA1A 5T14A 2NCNA 3N1YC 4OW0A 3H4DA 1LFDA 4DL3A 1NK6A 3SQIA 4I2HA 4TQSA 3M3JA 4ECVA 2KHWB 2HW3A 4PGQA 2LI5A 5DPWA 2KD1A 1OW5A 1E8YA 3R2IA 2J52A 2OCEA 1JMLA 1QQ6A 2W04A 5J0RA 5GXGB 4MFAA 1D5ZC 5BMIA 1SZHA 1XQQA 4CF3A 5D46A 1EU4A 4O3RA 2EAPA 4PS3A 2VANA 5AI6A 3B1LX 3V60A 1E10A 2WX0A 5KFCA 2IO1B 3PSEB 1JXEA 3F2CA 4A8XC 3I5JC 2HOFA 2ZIVA 4RQ8A 2MLBA 1XSLA 1Z00A 8ICVA 3BIID 4KIKA 9ICMA 5KT3A 2QC8A 2RRDA 1YNTE 1UZXB 3GZNI 8ICLA 1WM3A 3R7RA 1MVKA 5J0WA 3H8MA 4F91B 4P0PA 4GDLA 1JN3A 4UQGA 2DKZA 4YMOA 9ICCA 2KDFB 4QZGA 3QYPA 4NQLB 1KQQA 2LUEA 4QWAA 1LXDA 3A33B 1T0YA 4NLZA 3H7SA 1JIHA 1DOYA 4Y2SA 4F5PA 2HHXA 1JWSD 1WMHB 3R7QA 3PR5B 4Y2XA 3EC8A 1ZXIA 1KLNA 3KVFB 1AQ6A 2AWTA 4ZRJA 2L7RA 4KMUA 1WXMA 2RMMA 3VAWA 5CHWA 2W11A 1HQRD 2WU2B 3KHHA 2JXTA 3TQ1A 1WGHA 4ED0A 2WXMA 2EKIA 3I57A 4II3B 1SWWA 3W1YA 2WAQF 3Q8CA 4HYKA 4RQ0A 2FMSA 2M56B 1TVAA 2KP7A 2KWUB 1WX7A 4LJPB 2GBJA 1NNLA 4X5VA 4O3PA 1FEZA 3JVZX 1IBXA 4TUPA 1K8RB 1TFRA 3P1MA 2JH7A 3BINA 2YEPB 4K7WA 4L2YA 4RMAA 4J9MA 1DK2A 5DG9A 2YX8A 4RQ3A 2NV3A 3RJFA 3QC8B 4UBBA 4ECZA 2DPIA 3RAQA 2RDGA 2K8BA 1HUOA 3KFUF 2QILA 4FFDA 2C28A 1F0MA 4M6WB 4P1CC 1S0NA 1CI4A 2KWCA 5AZHA 1Y56A 2QB1A 1M94A 2KFJA 1ZETA 1I35A 2EMTA 4WAFA 4A3OA 1KL9A 2KJ9A 4GU2A 2D07B 4YD2A 2RGFA 3L0WB 3O13A 3DDHA 1WYGA 4HK2A 1NJXA 4B6WA 4M01A 3V7LA 2M4NA 2KT7A 4KN4A 3BS5B 2QARB 3QZ7A 1T0RC 4K4HA 5E6JA 4NLNA 3A9KA 2IO2B 1JI7A 2IY0B 1S10A 3WA0A 9ICPA 1PVRA 1Z3EB 5KG3A 4Y2PA 1LM8B 1L7YA 2YMLA 2I1QA 3JPQA 3CRXA 8ICNA 1WXSA 4K1RB 3B08A 2FCNA 4WIPA 4AJYB 1FCCC 4YCXA 3M95A 1GC6A 2V3SA 2LYAA 4PHDA 4RZRA 2KO3A 2VRRB 4GB9A 5DPRA 5ALGA 3MHSD 3V6CB 1YX5B 3H7IA 3ZNID 4JWUC 3ZYYX 1ZOYB 2G5HB 5KNIA 3N28A 2KQSA 1MQ3A 4HXDA 4NXZA 2BKEA 3KBBA 2OOBB 5KG7A 2FIDA 4DLGA 3PY8A 1PGAA 3HIZA 1I4QA 5KT7A 5JU5A 1NK9A 3Q14C 4KSLC 3X23A 2QDFA 1UELA 3PMLA 3VR8B 4EZ6A 1E8XA 3PLUA 4DQPA 1GB1A 3PX0A 5KFLA 2CHZA 3KYDD 2F3NA 3CW2C 3PW7A 1PQSA 3MGIA 1MFWA 9ICIA 4ED1A 3RZWC 2WXJA 4OJPA 2NO4A 5AKJA 2I1JA 1E0ZA 1L0XB 4I2CA 3VH3B 2HJ1A 1ZD4A 5AM2A 1LKYB 2WAQC 3RR8A 2M8SA 5ALHA 2MWSB 5L1LA 1N6ZA 3G6YA 2BYTA 1COOA 5GTIU 8ICYA 3MR6A 1SV0A 2K3UA 3AE4B 4HCPB 4HEA1 4I2BA 2MCNB 4IRKA 2KN5A 1S0OA 2IOFK 4BDPA 1WFYA 2AGQA 3TJPA 5J0QA 4FBTA 2DYBA 1SV0C 2D3DA 2LBOA 1WY8A 4OCZA 4RGOS 2KFZA 4F5RA 4DQRA 4MM3A 1QQ5A 1H4RA 5B5EU 2HHSA 2LRWA 4PHPA 1ZUD2 3QUCA 1SXEA 2ISOA 4OD0A 2EDUA 1FXIA 1ZD2P 4F2SA 1GG3A 5IP4D 1Z2MA 2ZIXA 4NL9A 2E8NA 1PGXA 4BBNC 3THVA 3N30A 3GV7B 1WGRA 1WXQA 4PL1A 1FRDA 3PO0A 1L3SA 3JSVA 1S1QB 3SAGA 5D49A 2WNMA 3C2KA 1AYFA 1JALA 3GZFA 2Q5WD 2XCPA 4I2JA 2KOBA 5J0PA 2D6FC 2DF4B 5IIJA 2KJ6A 2A1AA 1VD2A 1NEKB 2JPHA 3MJWA 3QZ8A 2EQYA 4C8KA 9ICWA 3HK0A 3ISBA 4R8UA 1M6YA 2H5XA 1TBEA 2NTTA 2NYVA 4WJNA 4ITKA 2Y9TA 3Q3NC 3Q8EA 8ICAA 2PI5A 3NZ3A 1JRPA 4A90A 2KAJA 4GXBA 9ICNA 4OHJA 3EUB2 5J18A 4AP4C 4F4XA 4QWDA 1RPLA 4WJQA 2F1HA 2INCC 3MP9A 4DS5A 2XN9C 5TISU 1J19A 1P1AA 1WJ6A 3PV8A 3BY4B 1B4FA 4PGYA 2I9GA 2WXFA 5AK6A 5K4LA 3V6HA 4F4WA 2NR2A 3E2EA 3BYYB 4P6VF 4B95A 4G3IA 4NAMA 3KZXA 2GMIC 2N9KA 1NZBA 2LRUA 1K52A 1R4NI 1Z1BA 2BR0A 1UWMA 4N9F4 3V6EB 1S9FA 4FO6A 2FLPA 1QOBA 1SE3A 1V5OA 3L54A 3H8SA 1GUAB 3EPGA 1ZPSA 1WE7A 4KTQA 2MBBB 2UU7A 2ZW1A 3L10B 3ZDAA 3T79A 2BQRA 4BKGA 2MJ3A 1I7HA 4UB1A 2C2DA 1VRAB 1WR6E 2KVRA 3RNAC 3SDLC 4M2YA 4EUTA 2XCAA 3VUXA 1TV9A 2XO7A 1XC9A 5IIOA 1ZQTA 2FNJB 4GSWA 2EELA 3ZW3A 1DOXA 3B9JA 2LVQA 1QSYA 2F44A 3RJHA 3B0XA 4IS7A 3RH5A 4O3SA 2ZPNA 2JUOA 3WANA 5DPTA 2I2YA 3RNFC 2M17A 4O3QA 3NTUA 5BO4B 3QAQA 4DL6A 1WM2A 3ALRA 2XVTA 2NVUI 5E6PA 3H40A 3UMCA 4LJXA 1Q0WB 2WXHA 4NY8A 4W9CA 2G09A 5JTIA 4KMOB 4FXCA 1L5UA 2I5HA 2K25A 1T0SC 4OJLA 2ZXIA 5J0SA 5F3XB 4RNMA 1IGDA 1B0XA 3SEIA 3EHVA 2D3CA 4U6PA 3NZSA 2FDRA 2MEKA 3SFEB 2VKQA 3BQ1A 2XC9A 2E8MA 2LI6A 5KFDA 4KLFA 3TARA 4MH0E 2KTQA 2NRWA 2FCMA 5IIMA 1VJ5A 2QB0B 1XLQA 1NOMA 4QZ8A 1B22A 2Y5CA 2CPRA 2ZG6A 8ICUA 2L1AA 4BWMA 1BPDA 4IR9A 2K22A 3AEBB 2WXLA 4RUCA 2BS2B 3H6NA 4RNAA 2JVCA 1OXJA 3BS7A 2V9WA 3VHTC 3SEBA 3AEFB 4M9LA 5EWFA 5LXHA 2J6UA 1LKYA 3SZ2A 3KLSX 2BCSA 1RFAA 1V1PB 4YQWA 4W9GA 1L6VA 5KHOA 2K5PA 1U48A 2IA6A 4LJOB 2YY6A 3BZDB 1L0VB 4ANUA 1IIPA 3BZCA 7ICTA 2AH5A 3W1SA 3IAM1 5BOMA 3ZD9A 1JCKB 2BS3B 3RD2A 1TZ1A 9ICTA 1AARA 2DHZA 2IHMA 3WK8A 3IBEA 4YL8A 4ECYA 3BQ0A 4IM2A 3SD7A 5CWRA 1J2MA 3EW9A 5EE3A 3FC4A 4JV2A 2HD5B 2O6VD 4K81A 2A1JA 4DFPA 4C7YA 2X38A 4QW8A 4F72A 4PT5A 4W9LA 5A0LA 3PW4A 4IM0A 4WWMA 5IOIA 3KD3A 5AZGA 9ICHA 4EEKA 3KUCB 4OJ6A 5AK4A 3FILA 4W9JA 1OTRB 3MBYA 4C8NA 4UB3A 2EAMA 5C5JA 4EFOA 1FMAD 1U49A 4OVZA 3BQ2A 4YTPB 3OGUA 3ONSA 2GLEA 1QCKA 4M8MA 1FD6A 2RPVA 4RGTA 2DL0A 2HCFA 2P35A 4ZHOA 2HBJA 5J0UA 3OLMD 4F7ZA 5J8YC 2GBRA 2KVZA 2XI9A 4CF4A 1NK8A 2R8GA 3W5UB 3AEVA 1NK5A 1RXVA 1V86A 4HJKA 4ASWC 4O0IA 5CB1A 4CF5A 3IN5A 4RM9A 4E74A 3JPTA 3I1YA 5J2KA 1NKEA 5CX3A 1Q3UA 5DQGA 4MJSB 4R8UB 4PS8A 4W9HA 5IAAC 4DBGA 4EX6A 1EWCA 3Q3JA 2LEKA 2V4LA 4RM8A 2H3QA 1XSNA 3PGEA 3OJSA 2ZIUB 4Z6DA 1L4ZB 2KKPA 5GMVA 2FLLA 5KL8B 5DB6A 3BYTB 4WURA 1ZQ1C 2A5UA 1XSPA 5KG2A 2KMMA 7ICNA 3U7DA 5ALTA 1F52A 2AJQA 3NVWA 2NRTA 1WE6A 1TKGA 1P98A 4CHKA 4UW9A 3A9KB 4FJYA 2C9WB 2Y1JA 2BCRA 1XEEA 3IG3A 3ZDMC 2P66A 4P4PA 1EM7A 1T0QC 5DDMA 2MSNA 2KQ7A 1MSWD 1TT5B 2LHEA 5CEHA 1WMHA 1V2YA 1OFFA 2L76A 4KKIA 3VRBB 4ARCA 3QU9A 5ALJA 2RDIA 1C4PA 3DPDA 3N4MB 1OGWA 4P4OA 2LHTA 5DLGA 3ALBA 3LVWA 2VA3A 5J2RA 3CSFA 1I4RA 4FS2A 1F77A 2HTME 3JPOA 4RH6A 3WK9A 3PHXB 3NRWA 2YN4A 2PKOA 2JR5A 5H8YE 1S76D 3ZTDA 1XU4A 5BPCA 3DWMA 1Q46A 1ZQDA 1RLFA 2UVRA 4UAWA 1V85A 3Q8RB 3AEDB 4QZDA 3B0AA 1TAMA 1CQVA 1V80A 3GV5B 5DG7A 1VLBA 4I2AA 4FULA 1T8EA 4GC6A 4N6EB 4IC9A 3CP8A 2W9MA 4TUQA 3A4SC 2JZBA 1R4MI 4A8EA 3C2MA 1N56A 5DCNA 4R63A 4JLCA 3LVVA 1S3SG 2GBKA 4C56C 4B9KA 3I3TB 1ED1A 4NM2A 4IM3A 2KQ4X 1TK5A 3OJUA 1TS3A 2L00B 1Q5WB 1D5XC 4ZOHC 1JWUD 1VR9A 1KRHA 3WK7A 2YTUA 3IP4B 2Z0EB 2PKEA 1X9SA 4C8LA 1CZPA 1QQ7A 5HR6A 2JRIB 1KKXA 3BK1A 5HMMA 2G4SA 1AROP 2LGDA 1QLBB 1P7FA 4P0QA 4Q8EA 1ZXHA 2JV3A 3BS5A 2YB4A 5DKWA 4DFMA 2KZ3A 2FMPA 2WF7A 2KACA 3BVZA 2FPKA 4NLKA 4O3MA 1J2NA 3H0MB 3HVDA 1K1QA 3R9KA 2MU2A 3L13A 4A9AA 3DBRI 3IHQB 1T94A 3RJGA 2N4FA 3KKAA 5CP2A 3OSPA 2LGIA 1Z1VA 1ET9A 1A5RA 4YR0A 2OEHA 4JQWC 2WLBA 2LWPA 1HTOA 4US8A 5IA7A 1V1PA 1UWXA 1R7SA 5L1KA 1WGYA 3TFSA 2WXPA 3IHPC 3U2SC 2DBYA 4Y2YA 3WK4A 2GI9A 4W9KA 5ALRA 2ZJ5A 1WF9A 2JU6X 1SKRA 3UGBB 4DQOC 2PFQA 4TURA 1ZQSA 1BPEA 1Z4OA 1XLPA 2KICA 3NUQA 1X6JA 3NVZA 1QH9A 3H7PA 3V05A 1I4XA 4XQ8A 4F71A 1WGGA 1FPYA 4F5QA 4QIWF 3VVWB 3T5JA 3FILB 2K89A 2XICA 1TY0A 4EEYA 4ARIA 3ZDCA 3M1YA 4G50A 4PZNA 2G07A 2MRLA 2ASJA 1IUEA 5KG6A 3AL0B 4F8CB 1UT8A 2INPE 2BYFA 1ZQQA 1MN8A 3SYZA 2BBCA 1SIFA 2PTLA 3APCA 2RLTA 1LO5D 2ZNVB 5ALNA 3C28A 1T3NA 4WJ3B 4Y2UA 2JH1A 4ZRQA 1V49A 3QNMA 1ZQFA 5KAFU 3RFAA 5J2BA 1J7BA 1TE2A 2ZIXB 1SKSA 2BWFA 3B2FA 3C21A 2HI0A 1RFKA 2BS4B 1FEHA 1V97A 5J2GA 2XY7A 4KLTA 1WRIA 2LMRA 4FA6A 4TUSA 4YMMA 2MJEA 1V1OA 4ECXA 1L6NA 4CGZA 4WQMA 2KJ8A 4R3DA 2DGZA 4I2FA 3SAFA 3KWLA 5JH5C 2JEIA 1BNOA 2D10A 3PVLA 1LV5A 1ZQOA 1ZQCA 5L95C 4P16A 1BPZA 5AKXA 2ISPA 4GFJA 1RG6A 2GBNA 3GFKB 1SV4A 3OSNA 2KSOB 4C80A 1BMLC 1HZ6A 1WXAA 2MP2B 2HBLA 4NJCA 1X2IA 1RQLA 5F9LA 2OEDA 1MA7A 2C2EA 4EZKA 2UYZB 5KFIA 2ASDA 3QUBA 1J8CA 2L8JA 3HKZF 2VZKD 3PW0A 4ECSA 2E1FA 4CDGA 2KDMA 2M9NA 4GGQA 2ODGA 3TKAA 3Q8FA 3E0FA 1PVPA 3UMBA 2IYDB 2Y0SF 5H2FU 1EO6A 2AQ3B 5D7GA 2ZUCA 4UAYA 4FJZA 4DSFA 3UQ0A 8ICBA 1DOIA 2KKVA 2KWDA 3N7PD 4M9GA 3QA8A 3PZDA 1FNWA 1WGDA 1NK0A 3AULA 9ICEA 3OPXA 2GBMA 4J9PA 4BKTA 4K7SA 4DLEA 4JE3B 4XRHA 5BYRA 4KGTA 3P4RB 2MHJA 4HCNB 4TKNA 2W8LA 4DQSA 3RJKA 3RN9C 1ZGUB 3T3OA 3Q69A 2Y5BB 1NBFC 2E6XA 2JZBB 3V7JA 2PI4A 4BOZB 1SXDA 3UQAA 3Q6BA 2EZYA 2E5SA 1IGCA 4ZYSA 7ICOA 4FHKA 1DGJA 2M0NA 2LHDA 8ICMA 3L3FX 3I63C 5BMHA 2KV2A 1BGXT 4RQ6A 5CHGA
chains in the Genus database with same CATH topology
1N63A 3AV8A 1FXIA 2IGHA 2KN4A 4N58A 1D5MC 1TS2A 1WSPA 5BYQA 4YSZB 5FR3A 2L83A 4EE2A 2WDRB 1PGXA 1I4PA 1PGBA 1ZE3D 1WXQA 2IJ0A 1FRDA 2JZPA 3PO0A 5D3DA 4RF1A 2CJNA 2WNMA 1AYFA 2SAKA 1JALA 4GDKB 3IT6B 2Q5WD 4C7ZA 2JYTA 1YMHE 4XE0A 1SE2A 1SIJA 4TMAB 2XNAC 3CWIA 1N5XA 4J3OD 2WXIA 2LJIA 4YTNB 3ZQ4A 1BUIC 1SJHD 1NEKB 2NTSA 5BYSA 2NTTA 1KLGD 5HHDG 4ITKA 3Q8EA 1NVID 4XDCA 4WH4A 1QILA 3NZ3A 2WXGA 2E3TA 1JRPA 1C4CA 3AEEB 4A90A 5G5GA 5JXVA 2KAJA 2DLBA 4OHJA 1N61A 3EUB2 3HRDD 1FCLA 2PMVA 4KX6B 3N9YC 3SR6A 3B2GA 4M0WA 1AN8A 3MP9A 2JX5A 4YSYB 2XN9C 3RPFC 5HFYA 1HZ5A 2GB1A 1IBXB 1JWMD 4TQ1A 2WS3B 3ZGZA 4IKGA 5EE9A 2WXFA 2QMTA 2WP9B 5H92C 1RWSA 5C3JB 1SBBB 3BYYB 3W2DA 3V3XA 4P6VF 4NAMA 3CIRB 2N9KA 3TEWA 2LFIA 2L32A 1ET6A 1K52A 1QOGA 3C8YA 1A70A 1F2RI 1UWMA 1OQQA 3ZJVA 2H89B 1QOBA 1TYGB 1SE3A 1ENFA 2IPKD 3HUIA 5T8IA 2G1EA 1Q10A 1ZPSA 3TEZA 4JWSC 3EGRA 3EA6A 2ZW1A 4OZBA 1JW9D 3P42A 1NYRA 1T5XD 1KTKA 2MJ3A 1I7HA 1MI0A 1VRAB 2V3NA 4KKJA 3W9CB 4D2KA 1E9MA 5EE1A 3MHZA 2EELA 1DOXA 3B9JA 1ZDXA 4LTUA 3AE3B 2DYOA 4LLGM 1NYQA 4KGRA 3ABVB 1C77A 1MHHE 2I2YA 2W3RA 2JSVX 1B9RA 1L0YB 3IAS1 3KQ4A 1T3QA 3VRAB 3PZ7A 2WXHA 3VR9B 3I9V1 2D5GA 1I4HA 2GRIA 2N9LA 4FXCA 3U52E 1L6UA 1FFVA 1T6BX 2J53A 1NI3A 1N60A 5MPOA 1IGDA 1MHXA 1F2RC 2JWUA 4A55A 4ZHPA 1JWAD 2MEKA 3J9CA 3SFEB 1SXTA 4UDUC 2MH7A 1XLOA 3OWEB 1ACCA 4HKQA 1XLQA 2Y5CA 1SEBD 4TSSA 2L1AA 2PIAA 4HRSA 2K22A 3AEBB 1ESFA 2WXLA 2G9HD 2BS2B 4RNAA 2QEJC 4L23A 2PVOD 1EU3A 3P4QB 3TEYA 1QF6A 2W55A 1YJJA 3U4EG 3AEAB 4AQ7A 3SEBA 3AEFB 2B76B 1VZ8A 2Y3AA 1FIQA 5EE0A 2M19A 3KLSX 1V1PB 2M0AA 1C76A 1L6VA 2K5PA 1QT9A 2RDHA 4MT5A 1CK1A 1L5PA 2ACZB 2CJOA 3P4SB 2WU5B 3BZDB 1L0VB 1GPXA 1ZDVA 3E56A 3W1SA 3NVYA 3IAM1 1SB3C 3NVVA 4DXGA 1JCKB 4XWTA 2BS3B 3AE9B 4JPSA 4IDIA 4RGMA 2HDEA 2PVGC 3MJ5A 2N7JA 5I4DA 3U7ZA 5EE3A 3FC4A 3AE1B 1JROA 4C7YA 2X38A 4PT5A 4ZRPA 1KFYB 2BT6A 1TY2A 4WWMA 3IXSA 1C79A 3PZ8A 1TJEA 3ZJUA 3RFZB 1L4DB 2V4IB 3E9SA 3BK2A 3TUOA 4REZA 4HKZE 1TKEA 3URYA 3FILA 4US9A 1J7AA 5AUKA 1FMAD 4OVZA 1QOFA 4YTPB 1HEZE 3GP7A 4LK0M 1FD6A 2RPVA 4RGTA 2W82A 4ZHOA 2AQ1B 4YT0B 2WDVB 3AE5B 3VQIA 3UI3A 5HG2A 2K0PA 3W5UB 3MC0B 1K50A 1E7PB 1ROEA 4IOIE 3HVZA 5FKAC 4JX1C 5G5HA 2DYMA 5D3IB 1SSNA 1XXGA 1KH0A 3H8HA 2WXKA 3NRZA 1EWCA 2LEKA 2MJDA 4KGSA 4NZLB 1BXTA 1L4ZB 2YEPF 3BYTB 4WURA 2J4XA 1M4VA 1FXAA 4L1BA 4CQNA 3AECB 3GS2A 1UUPA 2KMMA 1C4AA 2WXQA 2FE8A 2JQRB 2PW9A 2ONQA 1PFDA 2BTEA 3NVWA 4HROA 1TKGA 1SF0A 1XLNA 1N5WA 1UNSA 1XEEA 1YJIA 4NAWB 4RF0A 3Q8AA 4RGNA 1EM7A 1D6EC 1V8CA 2LHEA 1PDXA 3TSSA 2QIEB 1OFFA 4KKIA 2K9XA 1FRRA 3VRBB 4ARCA 1SE4A 2BB5A 4N59A 3MFGA 1C4PA 1YN3A 4O1NA 1JQ4A 1XCTL 1XCQL 1SJED 1K53A 4OW0A 2DWQA 1STEA 1I4RA 2IGGA 1F77A 2HTME 4RH6A 1MPEA 2Y5PA 2PKOA 4YWGG 5H8YE 1QOAA 4B0MA 3DWMA 3AE8B 3R2IA 2J52A 1JMLA 3AEDB 3AEGB 5GXGB 3FAHA 1D5ZC 1KF6B 1CQVA 5BMIA 1VLBA 1EU4A 1F0ZA 1E10A 4N6EB 1QQRA 1TZOA 4A8XC 4A6QA 4MACA 3BWUD 4C56C 1VZ7A 3BIID 2KQ4X 1TS3A 1FFUA 2TSSA 3LXFA 1YNTE 1D5XC 4ZOHC 1JWUD 1VR9A 3LB8C 2PLPA 1KRHA 2QJLA 1MVKA 1WGKA 1PUTA 4HJGE 1GOZA 2NMQA 1CZPA 3BK1A 2OHFA 1QLBB 1P7FA 2I38A 1D4BA 1C9FA 1ZXHA 2ON8A 2SEBD 1DOYA 2KACA 1JWSD 3BVZA 4RFBA 5LNK1 3HVDA 1ZXIA 4YXDB 4A9AA 3R8BA 1DYQA 2RMMA 1K51A 2WQYB 1HQRD 2WU2B 2JXTA 2LGIA 2QSDA 2EKIA 2WXMA 3I57A 1ET9A 2WLBA 2N0SB 4YTMB 3Q8CA 4US8A 1V1PA 1UWXA 1R7SA 3KWVA 2M56B 1J7CA 2ZW0A 2WXPA 1VDVA 3P4PB 2WXOA 2JYEA 3U2SC 1ZP0B 2BW2A 2DBYA 1AW7A 2GI9A 1IBXA 2INNE 2JU6X 3P1MA 2LMCA 4DQOC 4TQ0A 1XLPA 3GB1A 1HXYD 2YEPB 4L2YA 4B0EA 1OQRA 3AMZA 3NVZA 3V05A 1VJKA 1I4XA 5HI1A 1YN4A 1PYWD 3FILB 2RDGA 1TY0A 2QILA 1RYJA 4ARIA 1WWTA 1IUEA 1Y56A 5FK9C 1EWYC 4WAFA 2FUG1 2INPE 3O13A 4YSXB 1WYGA 4H2AA 2BBCA 2PTLA 3BVMA 3AN1A 1LO5D 3W5VB 3NUHB 4MH8A 2LUMA 5E6JA 1TS5A 3ZJTA 3P63A 1TS4A 4ZRQA 3LYYA 3IT4B 3WCQA 1YQ4B 1J7BA 3B2FA 2W3SA 5BMGA 1RFKA 2BS4B 1FEHA 1V97A 1P7EA 1WRIA 2IDYA 2MJEA 1CJEA 1V1OA 4WQMA 3NS1A 2VZKB 1B1ZA 3ETRA 4R3DA 4WIPA 2IGDA 1FCCC 4XDDA 3KWLA 2H88B 4AS1A 2V3PA 3T3NA 4OZCA 2AX5A 4GDLB 4USAA 4MM3B 3AE7B 4P16A 1N62A 3BVGA 1BMLC 4C80A 1HZ6A 2BB6A 4JWUC 4NJCA 3ZYYX 1ZOYB 2OEDA 1GB4A 2R61A 3AM9A 1XF5L 1YN5A 1TKYA 1PGAA 1FO4A 1JWBD 3L4PA 1I4QA 2VZKD 2AQ2B 2KDMA 1FNVA 1FNUA 3Q8FA 2J42A 3AE6B 1QKZA 3AB5A 2CU3A 2WXNA 3VR8B 2W54A 2ICIA 1GB1A 2AQ3B 5D7GA 1RM6C 1DOIA 1KLUD 2KWDA 3AH7A 4OZAA 4XWWA 1FNWA 1XO3A 2V0GA 1VZ6A 2WXJA 4RCOA 3SFDB 3Q8BA 1C78A 1E6EB 4GLSC 5TSSA 1E0ZA 1L0XB 4JE3B 5BYRA 2WDQB 4KGTA 3P4RB 5AUIA 2BYTA 2K3UA 4HEA1 2WXRA 3AE4B 3T3OA 3Q69A 4Q2JA 2E6XA 1HA5A 1I4GA 1AWDA 2Z8LA 3DWGC 1YQ3B 4DXFA 4RGOS 3TEXA 1FM0D 1IGCA 3AE2B 4ZYSA 1UGJA 1GAQB 1DGJA 2LHDA 3R2TA 2L52A 5BMHA 2FBWB 1ZUD2 1NENB 5C2TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N63 A;  3AV8 A;  4HRO A;  1FXI A;  1NI3 A;  1TKG A;  1N60 A;  5MPO A;  1SF0 A;  4N58 A;  1RYJ A;  4ZHP A;  1JWA D;  1XLN A;  3SFE B;  1N5W A;  1WWT A;  1IUE A;  4YSZ B;  2L83 A;  2MH7 A;  1YJI A;  1XLO A;  2WDR B;  1EWY C;  1V8C A;  1WXQ A;  1XLQ A;  1FRD A;  3PO0 A;  4YSX B;  1PDX A;  2Y5C A;  1WYG A;  2CJN A;  2QIE B;  1OFF A;  2PIA A;  2K9X A;  1FRR A;  3VRB B;  4HRS A;  1AYF A;  3AN1 A;  1JAL A;  2K22 A;  3AEB B;  4N59 A;  2Q5W D;  2BS2 B;  4C7Z A;  3W5V B;  2PVO D;  1QF6 A;  3P4Q B;  1JQ4 A;  1SIJ A;  2W55 A;  1YJJ A;  3AEA B;  3P63 A;  3CWI A;  1N5X A;  2DWQ A;  3WCQ A;  4YTN B;  3AEF B;  1YQ4 B;  2B76 B;  5C2T B;  1J7B A;  1NEK B;  2HTM E;  1FIQ A;  5EE0 A;  3B2F A;  2M19 A;  2W3S A;  2PKO A;  1RFK A;  2BS4 B;  1QOA A;  5H8Y E;  4ITK A;  1V97 A;  1L6V A;  1NVI D;  2K5P A;  1WRI A;  1QT9 A;  3DWM A;  2MJE A;  2E3T A;  1CJE A;  1JRP A;  1L5P A;  2ACZ B;  2CJO A;  3AE8 B;  3AEE B;  3P4S B;  2WU5 B;  5G5G A;  3NS1 A;  3AED B;  3AEG B;  2KAJ A;  3FAH A;  3ETR A;  1KF6 B;  1N61 A;  1L0V B;  5GXG B;  1GPX A;  3EUB 2;  3HRD D;  3NVY A;  1VLB A;  1SB3 C;  3NVV A;  2H88 B;  3KWL A;  4KX6 B;  1F0Z A;  1E10 A;  3SR6 A;  3B2G A;  2BS3 B;  3AE9 B;  4N6E B;  2AX5 A;  4USA A;  4IDI A;  2JX5 A;  3AE7 B;  4YSY B;  3RPF C;  2PVG C;  1N62 A;  5EE3 A;  3FC4 A;  3AE1 B;  1JRO A;  4C80 A;  4JWU C;  2WS3 B;  3ZYY X;  4C7Y A;  1ZOY B;  5EE9 A;  1KFY B;  2BT6 A;  2WP9 B;  3BII D;  4WWM A;  5H92 C;  1RWS A;  1TJE A;  5C3J B;  1FFU A;  3LXF A;  3AM9 A;  4ZOH C;  4P6V F;  1TKY A;  3LB8 C;  1KRH A;  2QJL A;  3CIR B;  1WGK A;  1PUT A;  1TKE A;  1FO4 A;  1JWB D;  3L4P A;  4US9 A;  1CZP A;  1QOG A;  2OHF A;  1J7A A;  1A70 A;  1UWM A;  1QLB B;  1FMA D;  5AUK A;  1OQQ A;  3AE6 B;  2H89 B;  3AB5 A;  1QOB A;  2CU3 A;  1QOF A;  1TYG B;  4WQM A;  4YTP B;  3VR8 B;  2W54 A;  3HUI A;  2G1E A;  4ZHO A;  4YT0 B;  1DOY A;  2WDV B;  4JWS C;  3AE5 B;  1RM6 C;  1DOI A;  1ZXI A;  3W5U B;  4A9A A;  1NEN B;  3AH7 A;  4YXD B;  1JW9 D;  1NYR A;  2MJ3 A;  1I7H A;  1XO3 A;  1E7P B;  2WQY B;  1ROE A;  3W9C B;  2WU2 B;  3SFD B;  3HVZ A;  1E6E B;  1E9M A;  2EKI A;  5EE1 A;  1E0Z A;  4JX1 C;  5G5H A;  2WDQ B;  1DOX A;  3B9J A;  4LTU A;  2WLB A;  3P4R B;  2N0S B;  3AE3 B;  5AUI A;  4YTM B;  4US8 A;  1R7S A;  3NRZ A;  2M56 B;  3AE4 B;  1J7C A;  1NYQ A;  2LEK A;  2MJD A;  1VDV A;  3ABV B;  3P4P B;  2W3R A;  1B9R A;  1AWD A;  1ZP0 B;  2DBY A;  1T3Q A;  3DWG C;  3VRA B;  1YQ3 B;  1FXA A;  3P1M A;  3AEC B;  1FM0 D;  3AE2 B;  1XLP A;  2KMM A;  3VR9 B;  1GAQ B;  1DGJ A;  1OQR A;  3AMZ A;  3NVZ A;  4FXC A;  2JQR B;  1VJK A;  2L52 A;  2FBW B;  1ZUD 2;  1PFD A;  1L6U A;  1FFV A;  3NVW A; 
#chains in the Genus database with same CATH topology
 5AK5 A;  3AV8 A;  2OH2 A;  1YX6 B;  4ELU A;  2KN4 A;  3OJ4 B;  3RB6 A;  2R8K A;  1WSP A;  2ZJ8 A;  9ICA A;  5BYQ A;  1KLV A;  2BZF A;  1E90 A;  4WAA A;  4YSZ B;  5FR3 A;  1WYW B;  4EE2 A;  1CEZ A;  2WDR B;  3LJ3 A;  2XGQ A;  3D2S A;  2HOQ A;  2CR5 A;  1ZW7 A;  4Y2T A;  4EBC A;  2SAK A;  4GDK B;  2C7N B;  4P0Q B;  1PZN A;  4C7Z A;  4QZI A;  1YMH E;  4XE0 A;  4MDK E;  4UB4 A;  4DSJ A;  3EFU A;  4TMA B;  1U47 A;  4ANV A;  1N5X A;  1WR1 A;  2K8A A;  1NI2 A;  5HKH A;  2WXI A;  5IN7 A;  2AGP A;  1BUI C;  4BXO A;  1SJH D;  4G3X B;  2NTS A;  1PUZ A;  1ZQZ A;  5BYS A;  3MR3 A;  1KLG D;  1NJY A;  2CS4 A;  3V62 A;  5DB8 A;  5LXI B;  2E3T A;  4YR2 A;  4GDK A;  2Q4T A;  1P3Q U;  5JXV A;  3M8R A;  1XS9 D;  1ZYQ A;  1N61 A;  1X9M A;  2DLB A;  2MSE D;  3HX0 A;  2PMV A;  2HDO A;  2FPL A;  3B2G A;  1NJZ A;  5AKH A;  4KV2 A;  4YSY B;  1L7O A;  3GU3 A;  3RPF C;  4NLG A;  2LXA A;  2N9E B;  3TAN A;  5ALQ A;  3Q3O C;  5EE9 A;  2XK5 A;  4DHJ D;  2LGS A;  1IP9 A;  4KX5 A;  1MG4 A;  2KZR A;  4LDT D;  5HML A;  1QSS A;  1DK3 A;  1RWS A;  5C3J B;  1SBB B;  3W2D A;  4BBN F;  2F8L A;  2V4Q A;  3MAB A;  2FIF A;  1QZE A;  1E8W A;  3CIR B;  3AUO A;  5HHI A;  5KT5 A;  2KVS A;  1QOG A;  4PPX A;  4RQ5 A;  1WJU A;  2LZ6 A;  4W9F A;  2ZUB A;  2IOH A;  3FM9 A;  2KIW A;  3MDA A;  3EEC A;  2N7E A;  4O5K A;  2G1E A;  1Q10 A;  4C4V A;  2OM6 A;  3DBH I;  3EGR A;  3EA6 A;  3TBL D;  3DV9 A;  2W9N A;  3QHT A;  4LNK A;  4OZB A;  1JW9 D;  2W9B B;  1KTK A;  4QJF B;  4C0Z A;  2BHN A;  4KKJ A;  1F1H A;  2V3N A;  4MGK E;  1Q1O A;  4XUS A;  1UH6 A;  5EE1 A;  5TR5 A;  1UQV A;  1ZDX A;  4LTU A;  9ICX A;  7ICS A;  2UVW A;  1H8C A;  4C8O A;  4KLD A;  1TAU A;  1C77 A;  1MHH E;  2W3R A;  2YMP A;  2JSV X;  4DHZ B;  1L0Y B;  3ETL A;  4M9H A;  1T3Q A;  4LDT B;  4DOA A;  2GWS A;  2V1Y A;  1DXS A;  3HM3 A;  3VTW A;  3WU2 U;  2HHW A;  4C4R A;  2GRI A;  3IVF A;  2JEJ A;  3R3M A;  3PRE A;  4IG7 B;  4YVZ A;  3DHI C;  3M7D A;  5AKE A;  1MHX A;  1BPY A;  2N9X A;  3H7P B;  1RDF A;  4NLB A;  2LM1 A;  1UA1 A;  2PJH A;  3KOO A;  1C20 A;  4G11 A;  1XLO A;  1YQB A;  4RQ2 A;  4WJP A;  5DLF A;  3HW8 A;  1HIW A;  3RYT A;  2RDJ A;  4DFJ A;  4TSS A;  1SEB D;  3EYZ A;  1WJ4 A;  3D32 A;  3DVG X;  3R66 C;  3AU2 A;  3ZDB A;  2BYV E;  5BOL A;  2QEJ C;  4L23 A;  3A0B U;  2WFA A;  4F50 A;  1U4A A;  3P4Q B;  1QF6 A;  2W55 A;  3AEA B;  2DAF A;  4IL6 U;  4EBD A;  3BJY A;  2KAN A;  1WXV A;  2B76 B;  1VZ8 A;  5EE0 A;  5DBA A;  2KKC A;  1NK4 A;  5KAI U;  4IWP A;  1IV8 A;  5DQH A;  3O65 B;  5KFB A;  2X8X X;  4NJ8 A;  2KIV A;  1QT9 A;  4O5E A;  1XO0 A;  1ZRM A;  9ICG A;  4GN1 A;  2WU5 B;  1S8O A;  9ICF A;  5KFH A;  1MG8 A;  2C5L C;  4I6P A;  2AU0 A;  4OVV A;  5J0X A;  8ICK A;  2KTR A;  4E3C A;  2IBK A;  4OVU A;  2O2V A;  3N32 A;  4GXK A;  1VCB A;  2MRP A;  2PVG C;  2MBE A;  3MJ5 A;  5KFU A;  2LD9 A;  3U7Z A;  4KLI A;  5AI5 A;  9ICK A;  5DB7 A;  4M9N A;  3F5E A;  3QU2 A;  1D9F A;  4HVB A;  2PFO A;  1KFY B;  3Q8K A;  2H3I A;  4FBJ B;  2G5I B;  2CHX A;  1WUD A;  3RFZ B;  2ZTE A;  5DDY A;  5JHB A;  3E9S A;  5JHA A;  1S97 A;  4HKZ E;  4REZ A;  2HTH A;  5GTH U;  1X9X A;  8ICT A;  4BUG A;  4AOF A;  4BZA A;  2XY5 A;  1GJZ A;  2G45 B;  1TTN A;  4I6L B;  3GP7 A;  4HDQ A;  3LDA A;  1ZJM A;  3LWM A;  1D8B A;  1UF0 A;  3TFR A;  3WKD A;  5J2C A;  1ZQM A;  2AQ1 B;  1KJT A;  2RPQ A;  3ML8 A;  3RI7 C;  2KTF A;  3AE5 B;  3VQI A;  3RT3 B;  3ML9 A;  5DB9 A;  5KFF A;  1IM4 A;  4QZ9 A;  1RYS A;  3DDC B;  4EBE A;  2VA8 A;  3HM6 X;  4BAX A;  4ED6 A;  5TZV A;  3MR5 A;  4XYC A;  4JX1 C;  4ED3 A;  1HUZ A;  5D94 A;  4ZH4 A;  1CUK A;  2LJ5 A;  5J2D A;  3Q8S B;  3ENE A;  1OQY A;  1XXG A;  1KH0 A;  3AU5 A;  1EUV B;  1ZQW A;  2ZTC A;  4XA5 A;  1F9J A;  2KTR B;  3EFC A;  2KNJ A;  4NZL B;  4UAV A;  3WKE A;  4ZRI A;  3RNB C;  3C0R B;  2AL3 A;  3GE3 C;  4YG2 A;  1M4V A;  4L1B A;  5ALL A;  2H3F A;  1KEJ A;  3GS2 A;  2Z7J A;  2C7H A;  3AXC A;  2WXQ A;  2YMQ A;  5C23 A;  8ICS A;  2ONQ A;  2N1W A;  2H3Z A;  1LVH A;  4P0P B;  4FHJ A;  1SF0 A;  3ZUN A;  1ZQR A;  1T4G A;  5J0T A;  1XLN A;  2C22 A;  2N1R A;  1ZQJ A;  2BQQ A;  4DHZ E;  1RRB A;  4B6J A;  3HHM A;  4RF0 A;  4NY0 A;  1D6E C;  4W9D A;  1O03 A;  1RYR A;  3DCG A;  3HKZ C;  1SE4 A;  2KYW A;  4N59 A;  1EF1 A;  8ICO A;  4PL2 A;  3PZP A;  2R2O A;  1XCT L;  3IRU A;  3QK0 A;  1K53 A;  3JYU A;  4EZJ A;  3M9N B;  2DWQ A;  5CJ7 A;  1STE A;  2MAX A;  2IGG A;  4XC2 A;  1UHU A;  2L3Z A;  1MPE A;  4RNN A;  2AXT U;  7ICV A;  2MBO A;  3WAL A;  1TK8 A;  4KLM A;  1KFD A;  1L7P A;  3AE8 B;  3OJ3 A;  4A3P A;  3T5H A;  2IHN A;  1B43 A;  2WHI A;  5CRX A;  1SWV A;  4EYH B;  3AEG B;  2PE9 A;  2HMX A;  3KZI U;  1MC8 A;  2GH1 A;  1EF5 A;  3UXN A;  3W1S C;  2DZJ A;  1J0G A;  2HBK A;  5DG8 A;  1KTQ A;  1P0R A;  1TZO A;  4MAC A;  2AHO B;  3BWU D;  2BKF A;  3RTV A;  1VZ7 A;  4NJ6 A;  1ZQA A;  2ZJA A;  3AQF A;  2TSS A;  3LXF A;  2PLP A;  5AKZ A;  3ISC A;  1PUT A;  5ALP A;  2IMW P;  1GOZ A;  2XK5 B;  4HJG E;  3QXG A;  4DK5 A;  5KFN A;  3WKC A;  2ZVO A;  5KFS A;  5KFX A;  3TAC B;  3ZDE A;  1C9F A;  5KFY A;  4MF2 A;  4J6I A;  2QAR A;  2ON8 A;  5DGB A;  3PSI A;  4Q43 A;  1CRX A;  1A0P A;  5AI8 A;  3ZRF A;  3ZXV A;  2RHF A;  3ZKJ C;  4IRC A;  4RFB A;  3F5A A;  3GOE A;  4YXD B;  2VJ5 A;  4J9Q A;  3RJJ A;  3PMN A;  2NRX A;  3N1X C;  3MTN B;  1K51 A;  2WQY B;  3RB3 A;  4B9M A;  2LYH A;  2QSD A;  4LNO A;  2JY6 A;  2W9B A;  2NBW B;  4FE3 A;  1PK1 A;  4M0A A;  1HTQ A;  2XY6 A;  3KWV A;  1J7C A;  2ZW0 A;  5HHH A;  5KFZ A;  4JWN A;  2C7M B;  1VDV A;  2O2V B;  3P4P B;  2WXO A;  4DOB A;  1KFS A;  3VFK A;  2JHD A;  3UQB A;  1ZP0 B;  3Q3F A;  1AW7 A;  4BGD A;  3RR7 A;  1WH3 A;  4JUZ A;  4DXA B;  2ZIU A;  4TQ0 A;  1PK3 A;  5E6N A;  3TI0 A;  3AMZ A;  1X9W A;  3GII A;  1OQR A;  4DSE A;  3QE9 Y;  7ICM A;  1VJK A;  5B66 U;  4KLJ A;  5L9X A;  2J0M A;  3M8S A;  5HI1 A;  5KT4 A;  1PYW D;  5KFM A;  3L08 A;  2HHU A;  4DFK A;  1RYJ A;  1UA0 A;  2M1M A;  1ZQB A;  5HP4 A;  1LQB A;  4M02 A;  5FK9 C;  3LDZ E;  4K3C A;  5CHF A;  1EWY C;  2JRZ A;  5D4B A;  8ICF A;  5AM4 A;  4QWC A;  2FUG 1;  4YSX B;  2K4E A;  4PHA A;  3UQ2 A;  3WAM A;  4ANW A;  3BVM A;  2CU1 A;  3W5V B;  4BVU C;  5KFR A;  3Q8P B;  2ZVN A;  3NUH B;  3VCB A;  4MH8 A;  2LUM A;  5L83 A;  1TS5 A;  3PNC A;  1KM7 A;  1SL1 A;  4MGY E;  5KT6 A;  4GOC A;  4EYI B;  4O9M A;  1YQ4 B;  4WWP A;  1D8L A;  3GIJ A;  3SV3 A;  5J17 A;  3T5L A;  1MJD A;  2KVC A;  2JT4 B;  5BMG A;  3TAD A;  2KMD A;  3HJE A;  2BF8 B;  4FLH A;  1P7E A;  2IDY A;  1CJE A;  2G06 A;  4J9R A;  2ALZ A;  2A19 A;  3SMV A;  5EOZ A;  2R8H A;  1SGH A;  2AEH A;  1B1Z A;  4DWF A;  3PHW B;  4XDD A;  2IGD A;  2C60 A;  4YFK A;  3C19 A;  3M63 B;  2H88 B;  4HWI B;  4Y2J A;  3G6V A;  1CMX B;  4OZC A;  4MM3 B;  3PVX A;  3RBE A;  2VH1 A;  3NS8 A;  1G6J A;  2HE7 A;  2NS5 A;  1N62 A;  2LGY A;  4ACF A;  3HP6 A;  5KFQ A;  2BB6 A;  2VH2 A;  1GB4 A;  4ZRK A;  3LWL A;  5KL1 B;  8ICC A;  1KSP A;  3A9J B;  3ZXR A;  4KLH A;  1YN5 A;  4O5C A;  1RYU A;  1S0V A;  1BPB A;  3L4P A;  4ECQ A;  2K8B B;  5KT2 A;  1FNV A;  3C5G A;  4IQW A;  3HT3 A;  2J42 A;  1QKZ A;  3RB0 A;  2WXN A;  2W9A A;  2DPJ A;  2W54 A;  1BPX A;  1YD8 U;  4QZH A;  4F93 B;  5G55 A;  3FYH A;  1BVS A;  4EEN A;  2BGF A;  2W9C A;  3Q8L A;  9ICO A;  2B3A A;  1KLU D;  2XEW A;  4M04 A;  1JXL A;  4OZA A;  3AQE A;  2D3B A;  1WIA A;  4I28 A;  2DUY A;  1XO3 A;  2V0G A;  2W7O A;  1P7D A;  1ZQG A;  3ZRC A;  4BKS D;  1C78 A;  3PRZ A;  3D2Q A;  4RUA A;  3KKA C;  1ZOL A;  7ICE A;  2WDQ B;  3VUY A;  5III A;  3BQ7 A;  2UVV A;  1S77 D;  4B9V A;  4K7U A;  4WWO A;  4PK1 A;  4JL9 A;  2O6V B;  3NG0 A;  2WXR A;  4P2H A;  1HEK A;  3NOB A;  4QAY A;  4W9E A;  2L05 A;  2VA2 A;  9ICL A;  2NPT A;  4YR3 A;  1HA5 A;  1I4G A;  4B9L A;  2WB1 C;  3DWG C;  1ZKH A;  3QUQ A;  2KFK B;  8ICI A;  3L5K A;  1X40 A;  5IIL A;  3GDX A;  3AE2 B;  3N1Z C;  4NNJ B;  4MF8 A;  2WGS A;  4IWO A;  1GAQ B;  3R2T A;  3PV1 A;  3ZNH B;  3C5F A;  4IR1 A;  1KFT A;  2L52 A;  3A4R A;  4PZO A;  2FBW B;  5EDS A;  4M9J A;  1R4N B;  1N63 A;  2FI1 A;  3EPI A;  3H8W A;  2J6S A;  2O6V A;  2IGH A;  1ZQK A;  2ZNV C;  1D5M C;  5J29 A;  2Y1I A;  4NL9 C;  3DHH C;  4AYB C;  2BCV A;  3DQV A;  3RBD A;  2L83 A;  2KFK A;  4LNF A;  1S5L U;  1I4P A;  2IJ0 A;  1GC7 A;  2JZP A;  4Q45 A;  4OJO A;  3HWT A;  5D3D A;  4EZL A;  4C4V B;  1KOT A;  2RD0 A;  3NHE B;  1A6S A;  2EAO A;  4M00 A;  3QU5 A;  3PX4 A;  3IT6 B;  2JXX A;  3K9P B;  2F76 X;  2JXJ A;  5J2H A;  4GC7 A;  2A3V A;  2JYT A;  3T5K A;  2CKH B;  1L8O A;  1SE2 A;  1SIJ A;  3ZNZ B;  5E6O A;  5L1M A;  2XNA C;  3ZQ4 A;  4UAT A;  5AM5 A;  1BNP A;  3QU4 A;  3UXP A;  4PHE A;  3QEA Z;  3ZTC A;  4WJO A;  4JK1 A;  4KZC A;  5HHD G;  3LK9 A;  2F1I A;  2K6Q A;  1NVI D;  3U26 A;  4WH4 A;  1QIL A;  2DZM A;  2WXG A;  3QCA A;  4J9S A;  4AWJ A;  2K8C A;  3KTQ A;  4F4K A;  3V61 A;  4ECU A;  3K1R B;  3HRD D;  1FCL A;  1Q8K A;  3C1Z A;  4KX6 B;  1SL2 A;  3SR6 A;  2KXJ A;  3M9M B;  3N9Y C;  3JPP A;  1AN8 A;  1SGG A;  2ZJD A;  4ECR A;  1HJP A;  1BT0 A;  4CNQ A;  9ICJ A;  1HZ5 A;  1OEY J;  4IQU A;  1IBX B;  2BPF A;  1JX4 A;  5ALY A;  1JWM D;  3TAD C;  4QWE A;  2WS3 B;  3Q8M A;  7ICF A;  2HHV A;  4IKG A;  4F5N A;  3RNE C;  5H92 C;  1WCL A;  5HR7 A;  4KSK C;  1UT5 A;  4RQ7 A;  5J2A A;  1TKD A;  2KSO A;  3V3X A;  2ASQ A;  4A20 A;  3QU7 A;  3TEW A;  1Z5S B;  4HPP A;  1TGZ B;  2L32 A;  4G0N B;  1A70 A;  1IG6 A;  1F2R I;  4WQO B;  2FE9 A;  3ZJV A;  4FJV B;  4QIW C;  2M0X A;  2KK0 A;  2IPK D;  3QWZ B;  3HUI A;  4TQR A;  5T8I A;  2PFN A;  1GNU A;  9ICQ A;  4Y2V A;  4Q44 A;  2BQU A;  4DQQ A;  3P42 A;  3H0L B;  1X6I A;  1QLN A;  4C8M A;  2PFP A;  1MI0 A;  3QQ8 B;  3W9C B;  3MFH A;  2MUT B;  3Q8Q B;  2V4R A;  2KJ5 A;  4D2K A;  1P9D U;  2MA9 B;  3MHZ A;  3A0H U;  5ALW A;  2R8I A;  2KDE B;  2DEN B;  2JZZ A;  1WWV A;  2VJ4 A;  1NZP A;  2WB1 F;  2MBH A;  1OUQ A;  3AE3 B;  4LLG M;  4P7I A;  1NYQ A;  4BFR A;  3QX1 A;  4RT2 A;  4KIT B;  3PSF A;  5CHV C;  2HHT A;  1GO3 F;  3VRA B;  1ZRN A;  1YIW A;  2EMS A;  3UM9 A;  2RDB C;  2KG5 A;  5IKC M;  4UAS A;  1UBI A;  4M0W B;  3PST A;  3VR9 B;  2D5G A;  2RSU A;  1C1Y B;  1I4H A;  3A9J A;  1A76 A;  4DSK A;  1IPG A;  2KN7 A;  3P2B A;  2L0F A;  1T6B X;  4MFC A;  2J53 A;  1NI3 A;  8ICG A;  3CYM A;  4UAZ A;  4S17 A;  4WWN A;  5MPO A;  3KH0 A;  1YT3 A;  4J9L A;  4DS4 A;  8ICQ A;  1F2R C;  4Z6E A;  2JWU A;  2DKX A;  4A55 A;  4P4M A;  3M62 B;  2FAZ A;  4II2 B;  1SXT A;  1Z00 B;  4UDU C;  2MH7 A;  2Y0S C;  4HKQ A;  1ACC A;  4R66 A;  3MGV A;  4QZA A;  2OJW A;  4YN4 A;  2PIA A;  3VDZ A;  4KLE A;  4DDG D;  1ESF A;  5ALF A;  2G9H D;  5CTR C;  2GOL A;  2QB0 A;  1EU3 A;  3TEY A;  1SKW A;  3QUT A;  3BQT A;  4IC7 B;  4I2G A;  3ED5 A;  4AQ7 A;  3VC8 A;  3DEE A;  2BDU A;  1NKC A;  2F8K A;  1XD3 B;  2N9P C;  4Z6F A;  9ICR A;  2F77 X;  1FIQ A;  4CE6 A;  4UB5 A;  4MEY A;  1TIF A;  2M19 A;  2E8P A;  1T7P A;  2WTF A;  5JUM A;  2KLG A;  2M0A A;  2CRX A;  2RDH A;  4KLG A;  1CK1 A;  1L5P A;  2CJO A;  3P4S B;  2DX5 B;  4S0R A;  4F4Y A;  3NGD A;  3TAQ A;  3PW2 A;  2IZV B;  1SB3 C;  4IRD A;  3RH4 A;  4DXG A;  3DOW A;  2IY1 B;  2D3G A;  5KFJ A;  1J97 A;  4RU9 A;  3KW5 B;  4RGM A;  3ZNG C;  4EX7 A;  2YMM A;  2ATL A;  2N7J A;  1F5S A;  3PPA A;  2KHV A;  4KX3 A;  1L3U A;  1DRG A;  2WYQ A;  2BPG A;  3OAW A;  5KFW A;  3WK6 A;  5KFO A;  1D9D A;  2BT6 A;  3LYS A;  4ZRP A;  1TY2 A;  3S2A A;  3IXS A;  1X66 A;  1TJE A;  4DO9 A;  3S6J A;  3ZJU A;  5KFG A;  2ZIV B;  1L4D B;  2RP5 A;  3WK5 A;  3TAP A;  3BK2 A;  3TUO A;  4KLU A;  1TKE A;  4AYB F;  2HSZ A;  4DSL A;  2LVO A;  1UCV A;  1ZD5 A;  3N3K B;  1E8Z A;  1XNS A;  4C4T A;  5AUK A;  4Q8F A;  5KFP A;  2YB1 A;  3C2L A;  4EZ9 A;  1HEZ E;  2CHW A;  4CRX A;  1XWL A;  2DFL A;  2RR9 A;  2REX A;  2W82 A;  4YT0 B;  4IQT A;  2WDV B;  2ESE A;  4AP9 A;  7ICH A;  5AHX A;  2MBQ A;  1DGS A;  2K0P A;  2KJH B;  4I6N B;  3VXW A;  4YD1 A;  1E7P B;  2LAS A;  3GIM A;  1A77 A;  1IYF A;  5CA7 A;  4IOI E;  4W9I A;  3JPS A;  3ZI4 A;  2XBB C;  5FKA C;  1Y88 A;  4FZM A;  2BPS A;  2KFN A;  5ALU A;  7ICL A;  1L3V A;  5D3I B;  4GXJ A;  2QKQ A;  1SSN A;  5AZF A;  5KFK A;  2HVH A;  2BQ3 A;  2MW5 A;  1NJW A;  2J0J A;  2MJD A;  4TV3 A;  5L1I A;  1E7U A;  3L16 A;  3B0Y A;  1BXT A;  4UAR A;  3PS6 A;  4QZF A;  3AU4 A;  3O0F A;  3X0W A;  5ALZ A;  2J4X A;  1FXA A;  4JV0 A;  3AEC B;  4CQN A;  1NKB A;  8ICR A;  4HLE A;  4F2R A;  2BPC A;  2NPT B;  3DVN U;  1IXR A;  4UB2 A;  2JQR B;  2LGX A;  2KE7 A;  4YXM A;  1OEY A;  2J7Q B;  2BTE A;  3KHL A;  5J0Y A;  4HRO A;  1L8L A;  2KZZ A;  3RJI A;  4HDO A;  3RUL A;  2WDT B;  1N5W A;  1U4B A;  1KRP A;  3ZIM A;  3PTF C;  4JMU A;  5KFA A;  2OWO A;  3ZLZ A;  4R65 A;  2J0K A;  1DOQ A;  3DVG Y;  3A1Q B;  1SE9 A;  5ALO A;  2G08 A;  1PDX A;  3H0R B;  4QZC A;  5AKK A;  3MC8 A;  4RT3 A;  2QIE B;  4ICV A;  3H8J A;  5FR6 A;  3TSS A;  1FRR A;  1UGM A;  2BB5 A;  2H3V A;  1NDD A;  4LZG A;  1YJ1 A;  7ICJ A;  1O08 A;  4O1N A;  1XCQ L;  2JRH A;  3GV8 B;  3JPN A;  1SJE D;  4FS1 A;  3Q2A C;  2LYB A;  4J9N A;  3GZN B;  2E1E A;  4RPY A;  2Y5P A;  2IO0 B;  4YWG G;  1QOA A;  3FKY A;  4IQV A;  4MEL A;  2HHQ A;  4B0M A;  2IOF A;  3MC1 A;  3ECI A;  2O6K A;  3CST A;  3ZO5 B;  2JF5 A;  2AGO A;  3GIK A;  4KDL B;  4E0D A;  2KX0 A;  3FAH A;  1R4M B;  1KF6 B;  3PX6 A;  5AKG A;  3TL5 A;  1F0Z A;  2B0C A;  1L3T A;  4LZD A;  2BKR B;  1D3Z A;  9ICS A;  3RMK C;  2DZK A;  1NK7 A;  3APD A;  1QQR A;  4F4Z A;  4A6Q A;  3C23 A;  2EZZ A;  5ALK A;  4B9U A;  4HAI A;  1V6E A;  1V81 A;  4EKU A;  1LB2 B;  4P1B C;  3QJZ A;  2I6X A;  1FFU A;  2KHQ A;  4RQN A;  2FCQ A;  4UB8 U;  3ZVV A;  3LB8 C;  2QJL A;  9ICB A;  1WGK A;  4NJ7 A;  4AUQ C;  2NMQ A;  4ZDV A;  2OHF A;  2P6R A;  1RZT A;  2I38 A;  4YXJ A;  1D4B A;  2PEA A;  4QZE A;  2AQ4 A;  2OJR A;  2JWZ A;  3K75 D;  1KDH A;  1YOV B;  2SEB D;  3DHG C;  5KTQ A;  1C3T A;  1YZ6 A;  5LNK 1;  2PMZ C;  5ALM A;  2VIX A;  1ECW A;  3I76 A;  2BDP A;  3R8B A;  1DYQ A;  3K9O B;  4UAU A;  5AI0 A;  1MQ2 A;  4RQ1 A;  2CN1 A;  5ALX A;  4B9N A;  3T8M A;  3ZDD A;  2G3Q B;  4DQI A;  2N0S B;  1L7M A;  4ZYN A;  4YTM B;  5D6J B;  7ICP A;  2I1K A;  3IDW A;  5FP0 A;  1Z4N A;  2JYE A;  4RNO A;  2BW2 A;  4YMN A;  2BGW A;  4MHV A;  5ALS A;  5DGA A;  2INN E;  3N7R C;  2LMC A;  3DBS A;  4I2D A;  4JV1 A;  4ELV A;  2DAJ A;  3GB1 A;  1HXY D;  1RAX A;  1RXW A;  2IO3 B;  4B0E A;  4JIO U;  5JZE B;  4MGI E;  1ZQI A;  4GIB A;  3KYC D;  1XT9 B;  4O3O A;  1WI0 A;  1YN4 A;  3WIM A;  3HPO A;  5AM0 A;  2K6D B;  3ICX A;  8ICE A;  3UMG A;  2KEY A;  2D3A A;  1JMS A;  2GO7 A;  1WWT A;  2AQ0 A;  1KN5 A;  3HIL A;  2W43 A;  2Y9U A;  5LLI A;  4BOS C;  2E8O A;  2K4P A;  2DQN B;  1X42 A;  1ZQV A;  1E5W A;  2KK8 A;  1E7V A;  4H2A A;  5AIA A;  2XID A;  2PE6 B;  2D8C A;  3DBL I;  3AN1 A;  4DSI A;  2JGA A;  5HNK A;  4ACO A;  4DCC A;  2K60 A;  3JSV B;  4DL2 A;  3P63 A;  1TS4 A;  3ZJT A;  3LYY A;  3IT4 B;  4B9T A;  1HE8 A;  1SZP A;  4QNL A;  3WCQ A;  1UPH A;  5AKI A;  4M47 A;  4DL5 A;  2W3S A;  1PK1 B;  5J2J A;  2K1F A;  1F44 A;  3V72 A;  3PRP B;  2HOI A;  3JW0 X;  5AK3 A;  4KLS A;  5ALD A;  3NS1 A;  5KG5 A;  2VZK B;  3ETR A;  5DBC A;  4QWB A;  3QEB Z;  4ED7 A;  4AS1 A;  5DPS A;  2KD0 A;  2V3P A;  3H1U A;  1URJ A;  2FJ6 A;  3IG8 A;  3UIO B;  3T3N A;  3NAS A;  3FDS A;  2AX5 A;  2GLS A;  4USA A;  3V6J A;  4GDL B;  3AE7 B;  5C1Z A;  3MDC A;  4FN2 A;  4PH5 A;  3KHG A;  2K8H A;  3BVG A;  2K39 A;  1XO1 A;  2BVC A;  1V9J A;  4KDI C;  2KDI A;  4GMV A;  1K5O A;  3ZDT A;  5ALV A;  1TAQ A;  2C2R A;  2R61 A;  3AM9 A;  3IG5 A;  1XF5 L;  3AU6 A;  7ICK A;  1TKY A;  3SU8 X;  3CNH A;  5KFV A;  1FO4 A;  2ZIW B;  1JWB D;  3F53 A;  2AQ2 B;  4BWJ A;  2DNF A;  1V38 A;  2QLT A;  1FNU A;  3AE6 B;  1ZQL A;  3AB5 A;  2CU3 A;  4C00 A;  4RQM A;  2G4D B;  5CR0 A;  2ICI A;  4LNN A;  2NBV B;  5JRT A;  4JGH B;  4K3B A;  4KLO A;  5C0Y A;  1RM6 C;  2FPM A;  7ICI A;  1WZ3 A;  2WF6 A;  3G6X A;  4K4I A;  2KDB A;  3OHA A;  4F3O A;  4I2E A;  3PT2 B;  3IFW B;  4XWW A;  4DF4 A;  1QSL A;  1VZ6 A;  4DF8 A;  3UF8 A;  2PXI A;  4RCO A;  3SFD B;  3Q8B A;  1E6E B;  3NZU A;  4GLS C;  3WKA A;  5TSS A;  1N2X A;  2K8C B;  4RPX A;  3EZ5 A;  4ED2 A;  2J6T A;  8ICX A;  3PO5 A;  4EEL A;  5AUI A;  2ZXH A;  3C29 A;  2ZPY A;  3AI5 A;  3VTU A;  4Q2J A;  4BJQ A;  4XX5 A;  3IV6 A;  1WG8 A;  4ECT A;  1AWD A;  2Z8L A;  5EWG A;  3ZD8 A;  4GXI A;  2DZI A;  1YQ3 B;  2D11 A;  4CO7 A;  4DXF A;  2BWE S;  4Y2Q A;  1FM0 D;  3TEX A;  1UGJ A;  2WHE A;  2P6U A;  4HPL B;  4IUM B;  1Q3V A;  1NEN B;  5J2I A;  4RPZ A;  3E58 A;  3AH7 A;  5C2T B;  1L7N A;  1KBU A;  4B9S A;  4XZ4 A;  2AYO B;  4N58 A;  1TS2 A;  3DBR B;  3MGH A;  4DL4 A;  4PYZ A;  2ES6 A;  4DOC A;  4FZL A;  1UBQ A;  1PGB A;  1ZE3 D;  3RNC C;  4BKS A;  5J0O A;  2NO5 A;  8ICH A;  4UBC A;  4MGZ E;  1N48 A;  4NLC A;  4RF1 A;  2CJN A;  3NJT A;  3OG5 A;  4DDI D;  1ZQE A;  2KJR A;  4LNI A;  1WWU A;  2BCU A;  4M8N A;  4NPN A;  2K4I A;  3CWI A;  4M6W A;  4J3O D;  4TUU A;  4KN7 A;  2LJI A;  4YTN B;  3BZK A;  1D8Y A;  2ZZP B;  4F92 B;  3QX7 A;  4URK A;  3N20 C;  5D2M B;  3N7S C;  4XDC A;  5AM3 A;  4F5O A;  1C4C A;  3AEE B;  1ZQX A;  5G5G A;  4PGX A;  5J2E A;  1TK0 A;  5DQI A;  3V6K A;  3QIJ A;  4ED8 A;  2L5Y A;  1ZQH A;  8ICJ A;  4M0W A;  3WKB A;  2JX5 A;  3RCZ A;  1JUD A;  2ZUD A;  5HFY A;  2GB1 A;  1C7Y A;  2JEF A;  4TQ1 A;  2K4H A;  3SI8 A;  1V5T A;  2IND C;  4HPM B;  3ZGZ A;  4K4G A;  5ALE A;  2QMT A;  2WP9 B;  3RZF A;  4I29 A;  7ICR A;  4PS7 A;  2KNB A;  5AI4 A;  4NAW A;  2L0T A;  2HJ8 A;  2A1J B;  4CYE A;  5AM1 A;  4XGA B;  4IW0 A;  2LFI A;  2HVI A;  1ET6 A;  3C8Y A;  3PSP A;  2W9C B;  4IWQ A;  1OQQ A;  3V7K A;  2H89 B;  4JB3 A;  2N7D A;  5AIB A;  2ZCC A;  1TYG B;  1Z19 A;  1V9P A;  3PR4 A;  1ENF A;  3D6J A;  3K4G A;  1SL0 A;  3RAX A;  3PO4 A;  1ZQN A;  3IM1 A;  4KLQ A;  1UD7 A;  2LVP A;  4JWS C;  3TEZ A;  1WRD B;  2V9H A;  2WX1 A;  4FAD A;  4E71 A;  2G0A A;  4DEZ A;  4GIV A;  2KC2 A;  3K1Z A;  5L1J A;  2FLN A;  1NYR A;  1T5X D;  5AIC A;  1PVQ A;  2EKE C;  1COK A;  4MSQ B;  3KHR A;  4MJS A;  3WAO A;  2BYE A;  4I2I A;  2R2Q A;  5AEK B;  1E9M A;  4LCD E;  4J9O A;  1WX9 A;  1ZJN A;  2DYO A;  1ZQY A;  1WZ0 A;  1I42 A;  5G2N A;  4KGR A;  3H9D A;  1ZD3 A;  2YLM A;  2Z0D B;  2JEG A;  3ABV B;  1YZ7 A;  3RF9 A;  4I27 A;  3PLV A;  1B9R A;  3IAS 1;  7ICU A;  2BCQ A;  9ICV A;  3KQ4 A;  4NQK E;  3M9O B;  3JPR A;  2A4Z A;  2ASL A;  3CMM B;  2PMZ F;  3A1Q A;  3DVN V;  3PZ7 A;  3I9V 1;  4F8R A;  2LM4 A;  2KOX A;  2N9L A;  3SEN A;  3U52 E;  3KUD B;  1L6U A;  1FFV A;  4ANX A;  3PW5 A;  2HBM A;  4X57 B;  2MP2 A;  1N60 A;  2KMA A;  2ZIW A;  2W03 A;  2WF8 A;  1FXT B;  4ZHP A;  1JWA D;  9ICU A;  5KFT A;  3J9C A;  1H38 A;  3OWE B;  2N1V A;  4F1S A;  1X1M A;  5IIN A;  5KG4 A;  2JZ3 B;  3VUW A;  2ZEQ A;  4RQ4 A;  3I28 A;  4HRS A;  2KLC A;  3EWA A;  4MEX A;  2KWV B;  1L2N A;  4UB6 U;  2PVO D;  2LKY A;  3U8Z A;  1YJJ A;  3U4E G;  2Q0Z X;  8ICP A;  3UIP B;  2YVC A;  2EH9 A;  2Y3A A;  1LGR A;  2IBI B;  3RRG A;  3U30 A;  4MSM B;  3MC9 A;  2WF5 A;  5IO9 A;  3N97 B;  2F2A B;  4ELT A;  1C76 A;  5AKL A;  5E79 U;  3RJE A;  4O3N A;  5DBB A;  1Y8R C;  3SD5 A;  4MT5 A;  1S0M A;  4DHJ B;  2ACZ B;  2MX2 A;  3APF A;  2CXY A;  3GE8 C;  1K1S A;  5ALI A;  3GIL A;  1GPX A;  1ZDV A;  3E56 A;  3NVY A;  4NV0 A;  3L17 A;  4QW9 A;  3NVV A;  1JRU A;  1WCN A;  2D2Q A;  4XWT A;  2FCS A;  3QAR A;  3AE9 B;  2NRV A;  4OO1 J;  1ISN A;  3UXO A;  2KC1 A;  3KUZ A;  4IDI A;  3F2D A;  2LXC A;  2NBU A;  4JPS A;  2HDE A;  2YQE A;  2FUH B;  5I4D A;  2PPH A;  2B21 A;  2W7P A;  2OXO A;  2LPE A;  1JRO A;  2UWQ A;  3AE1 B;  4FBU A;  3TIX A;  5KHQ A;  4AJW A;  1U9L A;  3RH6 A;  4Y2R A;  1C79 A;  4DL7 A;  2GOW A;  2Z59 B;  4ICA A;  4QZB A;  4R64 A;  3PZ8 A;  4OJ5 A;  4PJ0 U;  1RQN A;  3Q3M C;  4PYU A;  3T9L A;  2V4I B;  5IIK A;  3URY A;  1WJN A;  3OTQ A;  4US9 A;  4C4S A;  4NWI A;  2EZX A;  3UIN B;  1J7A A;  2ZCB A;  4U7C A;  3DBL B;  3SHQ A;  3M6K A;  1WX8 A;  3H4B A;  1QOF A;  1EXN A;  3ORY A;  3ONN A;  3GQC A;  4LK0 M;  3ISD A;  4JWM A;  4CCH A;  4Z6C A;  2MQJ A;  4NM1 A;  3UI3 A;  5KFE A;  3UPQ A;  5HG2 A;  3MC0 B;  3VH4 B;  3BDP A;  7ICQ A;  4FZN A;  1K50 A;  1ROE A;  4EOY A;  8ICZ A;  4KZ0 A;  3WAP A;  2UVU A;  3HVZ A;  3M6Z A;  3TCA A;  5G5H A;  3CF6 E;  2DYM A;  5AI9 A;  2R18 A;  4DWI A;  4J9K A;  4DFD A;  5AKY A;  3H8H A;  2WXK A;  3NRZ A;  3RNG C;  2MUT A;  3RB4 A;  2KZM A;  2QCZ A;  4ECW A;  4KGS A;  2EAN A;  5F9N A;  2KX3 A;  2WF9 A;  2YEP F;  3DBH B;  3OHB A;  5KG1 A;  3TMP B;  2NRZ A;  2KMC A;  3RUI B;  2R8J A;  1UUP A;  2QHO A;  2JMG A;  3MFI A;  3SAH A;  2XGP A;  1C4A A;  4YP3 A;  5KG0 A;  4G9B A;  3T3F A;  4EEW A;  2FE8 A;  2PW9 A;  5J8Y A;  2OYY A;  1PFD A;  3D2N A;  4J03 A;  3F2B A;  3C1Y A;  4LVS A;  1ZQU A;  4KIK B;  4GLX A;  2W8K A;  1UNS A;  4KVG B;  4BX9 C;  3RRH A;  4BXO B;  2FMQ A;  5J2F A;  1YJI A;  4NAW B;  4KLL A;  4MFF A;  1U45 A;  3Q8A A;  4RGN A;  3PRM B;  1V8C A;  1QTM A;  3NY5 A;  2ZTD A;  3SV4 A;  5EWE A;  2B6G A;  2WWZ A;  2RQ5 A;  3J81 j;  8ICW A;  1KW4 A;  2F1J A;  1ZQP A;  2K9X A;  3VTV A;  3MFG A;  4MEM A;  1YN3 A;  1JQ4 A;  7ICG A;  4ICU A;  2AL6 A;  3MR2 A;  2MA1 A;  5T14 A;  2NCN A;  3N1Y C;  4OW0 A;  3H4D A;  1LFD A;  4DL3 A;  1NK6 A;  3SQI A;  4I2H A;  4TQS A;  3M3J A;  4ECV A;  2KHW B;  2HW3 A;  4PGQ A;  2LI5 A;  5DPW A;  2KD1 A;  1OW5 A;  1E8Y A;  3R2I A;  2J52 A;  2OCE A;  1JML A;  1QQ6 A;  2W04 A;  5J0R A;  5GXG B;  4MFA A;  1D5Z C;  5BMI A;  1SZH A;  1XQQ A;  4CF3 A;  5D46 A;  1EU4 A;  4O3R A;  2EAP A;  4PS3 A;  2VAN A;  5AI6 A;  3B1L X;  3V60 A;  1E10 A;  2WX0 A;  5KFC A;  2IO1 B;  3PSE B;  1JXE A;  3F2C A;  4A8X C;  3I5J C;  2HOF A;  2ZIV A;  4RQ8 A;  2MLB A;  1XSL A;  1Z00 A;  8ICV A;  3BII D;  4KIK A;  9ICM A;  5KT3 A;  2QC8 A;  2RRD A;  1YNT E;  1UZX B;  3GZN I;  8ICL A;  1WM3 A;  3R7R A;  1MVK A;  5J0W A;  3H8M A;  4F91 B;  4P0P A;  4GDL A;  1JN3 A;  4UQG A;  2DKZ A;  4YMO A;  9ICC A;  2KDF B;  4QZG A;  3QYP A;  4NQL B;  1KQQ A;  2LUE A;  4QWA A;  1LXD A;  3A33 B;  1T0Y A;  4NLZ A;  3H7S A;  1JIH A;  1DOY A;  4Y2S A;  4F5P A;  2HHX A;  1JWS D;  1WMH B;  3R7Q A;  3PR5 B;  4Y2X A;  3EC8 A;  1ZXI A;  1KLN A;  3KVF B;  1AQ6 A;  2AWT A;  4ZRJ A;  2L7R A;  4KMU A;  1WXM A;  2RMM A;  3VAW A;  5CHW A;  2W11 A;  1HQR D;  2WU2 B;  3KHH A;  2JXT A;  3TQ1 A;  1WGH A;  4ED0 A;  2WXM A;  2EKI A;  3I57 A;  4II3 B;  1SWW A;  3W1Y A;  2WAQ F;  3Q8C A;  4HYK A;  4RQ0 A;  2FMS A;  2M56 B;  1TVA A;  2KP7 A;  2KWU B;  1WX7 A;  4LJP B;  2GBJ A;  1NNL A;  4X5V A;  4O3P A;  1FEZ A;  3JVZ X;  1IBX A;  4TUP A;  1K8R B;  1TFR A;  3P1M A;  2JH7 A;  3BIN A;  2YEP B;  4K7W A;  4L2Y A;  4RMA A;  4J9M A;  1DK2 A;  5DG9 A;  2YX8 A;  4RQ3 A;  2NV3 A;  3RJF A;  3QC8 B;  4UBB A;  4ECZ A;  2DPI A;  3RAQ A;  2RDG A;  2K8B A;  1HUO A;  3KFU F;  2QIL A;  4FFD A;  2C28 A;  1F0M A;  4M6W B;  4P1C C;  1S0N A;  1CI4 A;  2KWC A;  5AZH A;  1Y56 A;  2QB1 A;  1M94 A;  2KFJ A;  1ZET A;  1I35 A;  2EMT A;  4WAF A;  4A3O A;  1KL9 A;  2KJ9 A;  4GU2 A;  2D07 B;  4YD2 A;  2RGF A;  3L0W B;  3O13 A;  3DDH A;  1WYG A;  4HK2 A;  1NJX A;  4B6W A;  4M01 A;  3V7L A;  2M4N A;  2KT7 A;  4KN4 A;  3BS5 B;  2QAR B;  3QZ7 A;  1T0R C;  4K4H A;  5E6J A;  4NLN A;  3A9K A;  2IO2 B;  1JI7 A;  2IY0 B;  1S10 A;  3WA0 A;  9ICP A;  1PVR A;  1Z3E B;  5KG3 A;  4Y2P A;  1LM8 B;  1L7Y A;  2YML A;  2I1Q A;  3JPQ A;  3CRX A;  8ICN A;  1WXS A;  4K1R B;  3B08 A;  2FCN A;  4WIP A;  4AJY B;  1FCC C;  4YCX A;  3M95 A;  1GC6 A;  2V3S A;  2LYA A;  4PHD A;  4RZR A;  2KO3 A;  2VRR B;  4GB9 A;  5DPR A;  5ALG A;  3MHS D;  3V6C B;  1YX5 B;  3H7I A;  3ZNI D;  4JWU C;  3ZYY X;  1ZOY B;  2G5H B;  5KNI A;  3N28 A;  2KQS A;  1MQ3 A;  4HXD A;  4NXZ A;  2BKE A;  3KBB A;  2OOB B;  5KG7 A;  2FID A;  4DLG A;  3PY8 A;  1PGA A;  3HIZ A;  1I4Q A;  5KT7 A;  5JU5 A;  1NK9 A;  3Q14 C;  4KSL C;  3X23 A;  2QDF A;  1UEL A;  3PML A;  3VR8 B;  4EZ6 A;  1E8X A;  3PLU A;  4DQP A;  1GB1 A;  3PX0 A;  5KFL A;  2CHZ A;  3KYD D;  2F3N A;  3CW2 C;  3PW7 A;  1PQS A;  3MGI A;  1MFW A;  9ICI A;  4ED1 A;  3RZW C;  2WXJ A;  4OJP A;  2NO4 A;  5AKJ A;  2I1J A;  1E0Z A;  1L0X B;  4I2C A;  3VH3 B;  2HJ1 A;  1ZD4 A;  5AM2 A;  1LKY B;  2WAQ C;  3RR8 A;  2M8S A;  5ALH A;  2MWS B;  5L1L A;  1N6Z A;  3G6Y A;  2BYT A;  1COO A;  5GTI U;  8ICY A;  3MR6 A;  1SV0 A;  2K3U A;  3AE4 B;  4HCP B;  4HEA 1;  4I2B A;  2MCN B;  4IRK A;  2KN5 A;  1S0O A;  2IOF K;  4BDP A;  1WFY A;  2AGQ A;  3TJP A;  5J0Q A;  4FBT A;  2DYB A;  1SV0 C;  2D3D A;  2LBO A;  1WY8 A;  4OCZ A;  4RGO S;  2KFZ A;  4F5R A;  4DQR A;  4MM3 A;  1QQ5 A;  1H4R A;  5B5E U;  2HHS A;  2LRW A;  4PHP A;  1ZUD 2;  3QUC A;  1SXE A;  2ISO A;  4OD0 A;  2EDU A;  1FXI A;  1ZD2 P;  4F2S A;  1GG3 A;  5IP4 D;  1Z2M A;  2ZIX A;  4NL9 A;  2E8N A;  1PGX A;  4BBN C;  3THV A;  3N30 A;  3GV7 B;  1WGR A;  1WXQ A;  4PL1 A;  1FRD A;  3PO0 A;  1L3S A;  3JSV A;  1S1Q B;  3SAG A;  5D49 A;  2WNM A;  3C2K A;  1AYF A;  1JAL A;  3GZF A;  2Q5W D;  2XCP A;  4I2J A;  2KOB A;  5J0P A;  2D6F C;  2DF4 B;  5IIJ A;  2KJ6 A;  2A1A A;  1VD2 A;  1NEK B;  2JPH A;  3MJW A;  3QZ8 A;  2EQY A;  4C8K A;  9ICW A;  3HK0 A;  3ISB A;  4R8U A;  1M6Y A;  2H5X A;  1TBE A;  2NTT A;  2NYV A;  4WJN A;  4ITK A;  2Y9T A;  3Q3N C;  3Q8E A;  8ICA A;  2PI5 A;  3NZ3 A;  1JRP A;  4A90 A;  2KAJ A;  4GXB A;  9ICN A;  4OHJ A;  3EUB 2;  5J18 A;  4AP4 C;  4F4X A;  4QWD A;  1RPL A;  4WJQ A;  2F1H A;  2INC C;  3MP9 A;  4DS5 A;  2XN9 C;  5TIS U;  1J19 A;  1P1A A;  1WJ6 A;  3PV8 A;  3BY4 B;  1B4F A;  4PGY A;  2I9G A;  2WXF A;  5AK6 A;  5K4L A;  3V6H A;  4F4W A;  2NR2 A;  3E2E A;  3BYY B;  4P6V F;  4B95 A;  4G3I A;  4NAM A;  3KZX A;  2GMI C;  2N9K A;  1NZB A;  2LRU A;  1K52 A;  1R4N I;  1Z1B A;  2BR0 A;  1UWM A;  4N9F 4;  3V6E B;  1S9F A;  4FO6 A;  2FLP A;  1QOB A;  1SE3 A;  1V5O A;  3L54 A;  3H8S A;  1GUA B;  3EPG A;  1ZPS A;  1WE7 A;  4KTQ A;  2MBB B;  2UU7 A;  2ZW1 A;  3L10 B;  3ZDA A;  3T79 A;  2BQR A;  4BKG A;  2MJ3 A;  1I7H A;  4UB1 A;  2C2D A;  1VRA B;  1WR6 E;  2KVR A;  3RNA C;  3SDL C;  4M2Y A;  4EUT A;  2XCA A;  3VUX A;  1TV9 A;  2XO7 A;  1XC9 A;  5IIO A;  1ZQT A;  2FNJ B;  4GSW A;  2EEL A;  3ZW3 A;  1DOX A;  3B9J A;  2LVQ A;  1QSY A;  2F44 A;  3RJH A;  3B0X A;  4IS7 A;  3RH5 A;  4O3S A;  2ZPN A;  2JUO A;  3WAN A;  5DPT A;  2I2Y A;  3RNF C;  2M17 A;  4O3Q A;  3NTU A;  5BO4 B;  3QAQ A;  4DL6 A;  1WM2 A;  3ALR A;  2XVT A;  2NVU I;  5E6P A;  3H40 A;  3UMC A;  4LJX A;  1Q0W B;  2WXH A;  4NY8 A;  4W9C A;  2G09 A;  5JTI A;  4KMO B;  4FXC A;  1L5U A;  2I5H A;  2K25 A;  1T0S C;  4OJL A;  2ZXI A;  5J0S A;  5F3X B;  4RNM A;  1IGD A;  1B0X A;  3SEI A;  3EHV A;  2D3C A;  4U6P A;  3NZS A;  2FDR A;  2MEK A;  3SFE B;  2VKQ A;  3BQ1 A;  2XC9 A;  2E8M A;  2LI6 A;  5KFD A;  4KLF A;  3TAR A;  4MH0 E;  2KTQ A;  2NRW A;  2FCM A;  5IIM A;  1VJ5 A;  2QB0 B;  1XLQ A;  1NOM A;  4QZ8 A;  1B22 A;  2Y5C A;  2CPR A;  2ZG6 A;  8ICU A;  2L1A A;  4BWM A;  1BPD A;  4IR9 A;  2K22 A;  3AEB B;  2WXL A;  4RUC A;  2BS2 B;  3H6N A;  4RNA A;  2JVC A;  1OXJ A;  3BS7 A;  2V9W A;  3VHT C;  3SEB A;  3AEF B;  4M9L A;  5EWF A;  5LXH A;  2J6U A;  1LKY A;  3SZ2 A;  3KLS X;  2BCS A;  1RFA A;  1V1P B;  4YQW A;  4W9G A;  1L6V A;  5KHO A;  2K5P A;  1U48 A;  2IA6 A;  4LJO B;  2YY6 A;  3BZD B;  1L0V B;  4ANU A;  1IIP A;  3BZC A;  7ICT A;  2AH5 A;  3W1S A;  3IAM 1;  5BOM A;  3ZD9 A;  1JCK B;  2BS3 B;  3RD2 A;  1TZ1 A;  9ICT A;  1AAR A;  2DHZ A;  2IHM A;  3WK8 A;  3IBE A;  4YL8 A;  4ECY A;  3BQ0 A;  4IM2 A;  3SD7 A;  5CWR A;  1J2M A;  3EW9 A;  5EE3 A;  3FC4 A;  4JV2 A;  2HD5 B;  2O6V D;  4K81 A;  2A1J A;  4DFP A;  4C7Y A;  2X38 A;  4QW8 A;  4F72 A;  4PT5 A;  4W9L A;  5A0L A;  3PW4 A;  4IM0 A;  4WWM A;  5IOI A;  3KD3 A;  5AZG A;  9ICH A;  4EEK A;  3KUC B;  4OJ6 A;  5AK4 A;  3FIL A;  4W9J A;  1OTR B;  3MBY A;  4C8N A;  4UB3 A;  2EAM A;  5C5J A;  4EFO A;  1FMA D;  1U49 A;  4OVZ A;  3BQ2 A;  4YTP B;  3OGU A;  3ONS A;  2GLE A;  1QCK A;  4M8M A;  1FD6 A;  2RPV A;  4RGT A;  2DL0 A;  2HCF A;  2P35 A;  4ZHO A;  2HBJ A;  5J0U A;  3OLM D;  4F7Z A;  5J8Y C;  2GBR A;  2KVZ A;  2XI9 A;  4CF4 A;  1NK8 A;  2R8G A;  3W5U B;  3AEV A;  1NK5 A;  1RXV A;  1V86 A;  4HJK A;  4ASW C;  4O0I A;  5CB1 A;  4CF5 A;  3IN5 A;  4RM9 A;  4E74 A;  3JPT A;  3I1Y A;  5J2K A;  1NKE A;  5CX3 A;  1Q3U A;  5DQG A;  4MJS B;  4R8U B;  4PS8 A;  4W9H A;  5IAA C;  4DBG A;  4EX6 A;  1EWC A;  3Q3J A;  2LEK A;  2V4L A;  4RM8 A;  2H3Q A;  1XSN A;  3PGE A;  3OJS A;  2ZIU B;  4Z6D A;  1L4Z B;  2KKP A;  5GMV A;  2FLL A;  5KL8 B;  5DB6 A;  3BYT B;  4WUR A;  1ZQ1 C;  2A5U A;  1XSP A;  5KG2 A;  2KMM A;  7ICN A;  3U7D A;  5ALT A;  1F52 A;  2AJQ A;  3NVW A;  2NRT A;  1WE6 A;  1TKG A;  1P98 A;  4CHK A;  4UW9 A;  3A9K B;  4FJY A;  2C9W B;  2Y1J A;  2BCR A;  1XEE A;  3IG3 A;  3ZDM C;  2P66 A;  4P4P A;  1EM7 A;  1T0Q C;  5DDM A;  2MSN A;  2KQ7 A;  1MSW D;  1TT5 B;  2LHE A;  5CEH A;  1WMH A;  1V2Y A;  1OFF A;  2L76 A;  4KKI A;  3VRB B;  4ARC A;  3QU9 A;  5ALJ A;  2RDI A;  1C4P A;  3DPD A;  3N4M B;  1OGW A;  4P4O A;  2LHT A;  5DLG A;  3ALB A;  3LVW A;  2VA3 A;  5J2R A;  3CSF A;  1I4R A;  4FS2 A;  1F77 A;  2HTM E;  3JPO A;  4RH6 A;  3WK9 A;  3PHX B;  3NRW A;  2YN4 A;  2PKO A;  2JR5 A;  5H8Y E;  1S76 D;  3ZTD A;  1XU4 A;  5BPC A;  3DWM A;  1Q46 A;  1ZQD A;  1RLF A;  2UVR A;  4UAW A;  1V85 A;  3Q8R B;  3AED B;  4QZD A;  3B0A A;  1TAM A;  1CQV A;  1V80 A;  3GV5 B;  5DG7 A;  1VLB A;  4I2A A;  4FUL A;  1T8E A;  4GC6 A;  4N6E B;  4IC9 A;  3CP8 A;  2W9M A;  4TUQ A;  3A4S C;  2JZB A;  1R4M I;  4A8E A;  3C2M A;  1N56 A;  5DCN A;  4R63 A;  4JLC A;  3LVV A;  1S3S G;  2GBK A;  4C56 C;  4B9K A;  3I3T B;  1ED1 A;  4NM2 A;  4IM3 A;  2KQ4 X;  1TK5 A;  3OJU A;  1TS3 A;  2L00 B;  1Q5W B;  1D5X C;  4ZOH C;  1JWU D;  1VR9 A;  1KRH A;  3WK7 A;  2YTU A;  3IP4 B;  2Z0E B;  2PKE A;  1X9S A;  4C8L A;  1CZP A;  1QQ7 A;  5HR6 A;  2JRI B;  1KKX A;  3BK1 A;  5HMM A;  2G4S A;  1ARO P;  2LGD A;  1QLB B;  1P7F A;  4P0Q A;  4Q8E A;  1ZXH A;  2JV3 A;  3BS5 A;  2YB4 A;  5DKW A;  4DFM A;  2KZ3 A;  2FMP A;  2WF7 A;  2KAC A;  3BVZ A;  2FPK A;  4NLK A;  4O3M A;  1J2N A;  3H0M B;  3HVD A;  1K1Q A;  3R9K A;  2MU2 A;  3L13 A;  4A9A A;  3DBR I;  3IHQ B;  1T94 A;  3RJG A;  2N4F A;  3KKA A;  5CP2 A;  3OSP A;  2LGI A;  1Z1V A;  1ET9 A;  1A5R A;  4YR0 A;  2OEH A;  4JQW C;  2WLB A;  2LWP A;  1HTO A;  4US8 A;  5IA7 A;  1V1P A;  1UWX A;  1R7S A;  5L1K A;  1WGY A;  3TFS A;  2WXP A;  3IHP C;  3U2S C;  2DBY A;  4Y2Y A;  3WK4 A;  2GI9 A;  4W9K A;  5ALR A;  2ZJ5 A;  1WF9 A;  2JU6 X;  1SKR A;  3UGB B;  4DQO C;  2PFQ A;  4TUR A;  1ZQS A;  1BPE A;  1Z4O A;  1XLP A;  2KIC A;  3NUQ A;  1X6J A;  3NVZ A;  1QH9 A;  3H7P A;  3V05 A;  1I4X A;  4XQ8 A;  4F71 A;  1WGG A;  1FPY A;  4F5Q A;  4QIW F;  3VVW B;  3T5J A;  3FIL B;  2K89 A;  2XIC A;  1TY0 A;  4EEY A;  4ARI A;  3ZDC A;  3M1Y A;  4G50 A;  4PZN A;  2G07 A;  2MRL A;  2ASJ A;  1IUE A;  5KG6 A;  3AL0 B;  4F8C B;  1UT8 A;  2INP E;  2BYF A;  1ZQQ A;  1MN8 A;  3SYZ A;  2BBC A;  1SIF A;  2PTL A;  3APC A;  2RLT A;  1LO5 D;  2ZNV B;  5ALN A;  3C28 A;  1T3N A;  4WJ3 B;  4Y2U A;  2JH1 A;  4ZRQ A;  1V49 A;  3QNM A;  1ZQF A;  5KAF U;  3RFA A;  5J2B A;  1J7B A;  1TE2 A;  2ZIX B;  1SKS A;  2BWF A;  3B2F A;  3C21 A;  2HI0 A;  1RFK A;  2BS4 B;  1FEH A;  1V97 A;  5J2G A;  2XY7 A;  4KLT A;  1WRI A;  2LMR A;  4FA6 A;  4TUS A;  4YMM A;  2MJE A;  1V1O A;  4ECX A;  1L6N A;  4CGZ A;  4WQM A;  2KJ8 A;  4R3D A;  2DGZ A;  4I2F A;  3SAF A;  3KWL A;  5JH5 C;  2JEI A;  1BNO A;  2D10 A;  3PVL A;  1LV5 A;  1ZQO A;  1ZQC A;  5L95 C;  4P16 A;  1BPZ A;  5AKX A;  2ISP A;  4GFJ A;  1RG6 A;  2GBN A;  3GFK B;  1SV4 A;  3OSN A;  2KSO B;  4C80 A;  1BML C;  1HZ6 A;  1WXA A;  2MP2 B;  2HBL A;  4NJC A;  1X2I A;  1RQL A;  5F9L A;  2OED A;  1MA7 A;  2C2E A;  4EZK A;  2UYZ B;  5KFI A;  2ASD A;  3QUB A;  1J8C A;  2L8J A;  3HKZ F;  2VZK D;  3PW0 A;  4ECS A;  2E1F A;  4CDG A;  2KDM A;  2M9N A;  4GGQ A;  2ODG A;  3TKA A;  3Q8F A;  3E0F A;  1PVP A;  3UMB A;  2IYD B;  2Y0S F;  5H2F U;  1EO6 A;  2AQ3 B;  5D7G A;  2ZUC A;  4UAY A;  4FJZ A;  4DSF A;  3UQ0 A;  8ICB A;  1DOI A;  2KKV A;  2KWD A;  3N7P D;  4M9G A;  3QA8 A;  3PZD A;  1FNW A;  1WGD A;  1NK0 A;  3AUL A;  9ICE A;  3OPX A;  2GBM A;  4J9P A;  4BKT A;  4K7S A;  4DLE A;  4JE3 B;  4XRH A;  5BYR A;  4KGT A;  3P4R B;  2MHJ A;  4HCN B;  4TKN A;  2W8L A;  4DQS A;  3RJK A;  3RN9 C;  1ZGU B;  3T3O A;  3Q69 A;  2Y5B B;  1NBF C;  2E6X A;  2JZB B;  3V7J A;  2PI4 A;  4BOZ B;  1SXD A;  3UQA A;  3Q6B A;  2EZY A;  2E5S A;  1IGC A;  4ZYS A;  7ICO A;  4FHK A;  1DGJ A;  2M0N A;  2LHD A;  8ICM A;  3L3F X;  3I63 C;  5BMH A;  2KV2 A;  1BGX T;  4RQ6 A;  5CHG A; 
#chains in the Genus database with same CATH homology
 1N63 A;  3AV8 A;  1FXI A;  2IGH A;  2KN4 A;  4N58 A;  1D5M C;  1TS2 A;  1WSP A;  5BYQ A;  4YSZ B;  5FR3 A;  2L83 A;  4EE2 A;  2WDR B;  1PGX A;  1I4P A;  1PGB A;  1ZE3 D;  1WXQ A;  2IJ0 A;  1FRD A;  2JZP A;  3PO0 A;  5D3D A;  4RF1 A;  2CJN A;  2WNM A;  1AYF A;  2SAK A;  1JAL A;  4GDK B;  3IT6 B;  2Q5W D;  4C7Z A;  2JYT A;  1YMH E;  4XE0 A;  1SE2 A;  1SIJ A;  4TMA B;  2XNA C;  3CWI A;  1N5X A;  4J3O D;  2WXI A;  2LJI A;  4YTN B;  3ZQ4 A;  1BUI C;  1SJH D;  1NEK B;  2NTS A;  5BYS A;  2NTT A;  1KLG D;  5HHD G;  4ITK A;  3Q8E A;  1NVI D;  4XDC A;  4WH4 A;  1QIL A;  3NZ3 A;  2WXG A;  2E3T A;  1JRP A;  1C4C A;  3AEE B;  4A90 A;  5G5G A;  5JXV A;  2KAJ A;  2DLB A;  4OHJ A;  1N61 A;  3EUB 2;  3HRD D;  1FCL A;  2PMV A;  4KX6 B;  3N9Y C;  3SR6 A;  3B2G A;  4M0W A;  1AN8 A;  3MP9 A;  2JX5 A;  4YSY B;  2XN9 C;  3RPF C;  5HFY A;  1HZ5 A;  2GB1 A;  1IBX B;  1JWM D;  4TQ1 A;  2WS3 B;  3ZGZ A;  4IKG A;  5EE9 A;  2WXF A;  2QMT A;  2WP9 B;  5H92 C;  1RWS A;  5C3J B;  1SBB B;  3BYY B;  3W2D A;  3V3X A;  4P6V F;  4NAM A;  3CIR B;  2N9K A;  3TEW A;  2LFI A;  2L32 A;  1ET6 A;  1K52 A;  1QOG A;  3C8Y A;  1A70 A;  1F2R I;  1UWM A;  1OQQ A;  3ZJV A;  2H89 B;  1QOB A;  1TYG B;  1SE3 A;  1ENF A;  2IPK D;  3HUI A;  5T8I A;  2G1E A;  1Q10 A;  1ZPS A;  3TEZ A;  4JWS C;  3EGR A;  3EA6 A;  2ZW1 A;  4OZB A;  1JW9 D;  3P42 A;  1NYR A;  1T5X D;  1KTK A;  2MJ3 A;  1I7H A;  1MI0 A;  1VRA B;  2V3N A;  4KKJ A;  3W9C B;  4D2K A;  1E9M A;  5EE1 A;  3MHZ A;  2EEL A;  1DOX A;  3B9J A;  1ZDX A;  4LTU A;  3AE3 B;  2DYO A;  4LLG M;  1NYQ A;  4KGR A;  3ABV B;  1C77 A;  1MHH E;  2I2Y A;  2W3R A;  2JSV X;  1B9R A;  1L0Y B;  3IAS 1;  3KQ4 A;  1T3Q A;  3VRA B;  3PZ7 A;  2WXH A;  3VR9 B;  3I9V 1;  2D5G A;  1I4H A;  2GRI A;  2N9L A;  4FXC A;  3U52 E;  1L6U A;  1FFV A;  1T6B X;  2J53 A;  1NI3 A;  1N60 A;  5MPO A;  1IGD A;  1MHX A;  1F2R C;  2JWU A;  4A55 A;  4ZHP A;  1JWA D;  2MEK A;  3J9C A;  3SFE B;  1SXT A;  4UDU C;  2MH7 A;  1XLO A;  3OWE B;  1ACC A;  4HKQ A;  1XLQ A;  2Y5C A;  1SEB D;  4TSS A;  2L1A A;  2PIA A;  4HRS A;  2K22 A;  3AEB B;  1ESF A;  2WXL A;  2G9H D;  2BS2 B;  4RNA A;  2QEJ C;  4L23 A;  2PVO D;  1EU3 A;  3P4Q B;  3TEY A;  1QF6 A;  2W55 A;  1YJJ A;  3U4E G;  3AEA B;  4AQ7 A;  3SEB A;  3AEF B;  2B76 B;  1VZ8 A;  2Y3A A;  1FIQ A;  5EE0 A;  2M19 A;  3KLS X;  1V1P B;  2M0A A;  1C76 A;  1L6V A;  2K5P A;  1QT9 A;  2RDH A;  4MT5 A;  1CK1 A;  1L5P A;  2ACZ B;  2CJO A;  3P4S B;  2WU5 B;  3BZD B;  1L0V B;  1GPX A;  1ZDV A;  3E56 A;  3W1S A;  3NVY A;  3IAM 1;  1SB3 C;  3NVV A;  4DXG A;  1JCK B;  4XWT A;  2BS3 B;  3AE9 B;  4JPS A;  4IDI A;  4RGM A;  2HDE A;  2PVG C;  3MJ5 A;  2N7J A;  5I4D A;  3U7Z A;  5EE3 A;  3FC4 A;  3AE1 B;  1JRO A;  4C7Y A;  2X38 A;  4PT5 A;  4ZRP A;  1KFY B;  2BT6 A;  1TY2 A;  4WWM A;  3IXS A;  1C79 A;  3PZ8 A;  1TJE A;  3ZJU A;  3RFZ B;  1L4D B;  2V4I B;  3E9S A;  3BK2 A;  3TUO A;  4REZ A;  4HKZ E;  1TKE A;  3URY A;  3FIL A;  4US9 A;  1J7A A;  5AUK A;  1FMA D;  4OVZ A;  1QOF A;  4YTP B;  1HEZ E;  3GP7 A;  4LK0 M;  1FD6 A;  2RPV A;  4RGT A;  2W82 A;  4ZHO A;  2AQ1 B;  4YT0 B;  2WDV B;  3AE5 B;  3VQI A;  3UI3 A;  5HG2 A;  2K0P A;  3W5U B;  3MC0 B;  1K50 A;  1E7P B;  1ROE A;  4IOI E;  3HVZ A;  5FKA C;  4JX1 C;  5G5H A;  2DYM A;  5D3I B;  1SSN A;  1XXG A;  1KH0 A;  3H8H A;  2WXK A;  3NRZ A;  1EWC A;  2LEK A;  2MJD A;  4KGS A;  4NZL B;  1BXT A;  1L4Z B;  2YEP F;  3BYT B;  4WUR A;  2J4X A;  1M4V A;  1FXA A;  4L1B A;  4CQN A;  3AEC B;  3GS2 A;  1UUP A;  2KMM A;  1C4A A;  2WXQ A;  2FE8 A;  2JQR B;  2PW9 A;  2ONQ A;  1PFD A;  2BTE A;  3NVW A;  4HRO A;  1TKG A;  1SF0 A;  1XLN A;  1N5W A;  1UNS A;  1XEE A;  1YJI A;  4NAW B;  4RF0 A;  3Q8A A;  4RGN A;  1EM7 A;  1D6E C;  1V8C A;  2LHE A;  1PDX A;  3TSS A;  2QIE B;  1OFF A;  4KKI A;  2K9X A;  1FRR A;  3VRB B;  4ARC A;  1SE4 A;  2BB5 A;  4N59 A;  3MFG A;  1C4P A;  1YN3 A;  4O1N A;  1JQ4 A;  1XCT L;  1XCQ L;  1SJE D;  1K53 A;  4OW0 A;  2DWQ A;  1STE A;  1I4R A;  2IGG A;  1F77 A;  2HTM E;  4RH6 A;  1MPE A;  2Y5P A;  2PKO A;  4YWG G;  5H8Y E;  1QOA A;  4B0M A;  3DWM A;  3AE8 B;  3R2I A;  2J52 A;  1JML A;  3AED B;  3AEG B;  5GXG B;  3FAH A;  1D5Z C;  1KF6 B;  1CQV A;  5BMI A;  1VLB A;  1EU4 A;  1F0Z A;  1E10 A;  4N6E B;  1QQR A;  1TZO A;  4A8X C;  4A6Q A;  4MAC A;  3BWU D;  4C56 C;  1VZ7 A;  3BII D;  2KQ4 X;  1TS3 A;  1FFU A;  2TSS A;  3LXF A;  1YNT E;  1D5X C;  4ZOH C;  1JWU D;  1VR9 A;  3LB8 C;  2PLP A;  1KRH A;  2QJL A;  1MVK A;  1WGK A;  1PUT A;  4HJG E;  1GOZ A;  2NMQ A;  1CZP A;  3BK1 A;  2OHF A;  1QLB B;  1P7F A;  2I38 A;  1D4B A;  1C9F A;  1ZXH A;  2ON8 A;  2SEB D;  1DOY A;  2KAC A;  1JWS D;  3BVZ A;  4RFB A;  5LNK 1;  3HVD A;  1ZXI A;  4YXD B;  4A9A A;  3R8B A;  1DYQ A;  2RMM A;  1K51 A;  2WQY B;  1HQR D;  2WU2 B;  2JXT A;  2LGI A;  2QSD A;  2EKI A;  2WXM A;  3I57 A;  1ET9 A;  2WLB A;  2N0S B;  4YTM B;  3Q8C A;  4US8 A;  1V1P A;  1UWX A;  1R7S A;  3KWV A;  2M56 B;  1J7C A;  2ZW0 A;  2WXP A;  1VDV A;  3P4P B;  2WXO A;  2JYE A;  3U2S C;  1ZP0 B;  2BW2 A;  2DBY A;  1AW7 A;  2GI9 A;  1IBX A;  2INN E;  2JU6 X;  3P1M A;  2LMC A;  4DQO C;  4TQ0 A;  1XLP A;  3GB1 A;  1HXY D;  2YEP B;  4L2Y A;  4B0E A;  1OQR A;  3AMZ A;  3NVZ A;  3V05 A;  1VJK A;  1I4X A;  5HI1 A;  1YN4 A;  1PYW D;  3FIL B;  2RDG A;  1TY0 A;  2QIL A;  1RYJ A;  4ARI A;  1WWT A;  1IUE A;  1Y56 A;  5FK9 C;  1EWY C;  4WAF A;  2FUG 1;  2INP E;  3O13 A;  4YSX B;  1WYG A;  4H2A A;  2BBC A;  2PTL A;  3BVM A;  3AN1 A;  1LO5 D;  3W5V B;  3NUH B;  4MH8 A;  2LUM A;  5E6J A;  1TS5 A;  3ZJT A;  3P63 A;  1TS4 A;  4ZRQ A;  3LYY A;  3IT4 B;  3WCQ A;  1YQ4 B;  1J7B A;  3B2F A;  2W3S A;  5BMG A;  1RFK A;  2BS4 B;  1FEH A;  1V97 A;  1P7E A;  1WRI A;  2IDY A;  2MJE A;  1CJE A;  1V1O A;  4WQM A;  3NS1 A;  2VZK B;  1B1Z A;  3ETR A;  4R3D A;  4WIP A;  2IGD A;  1FCC C;  4XDD A;  3KWL A;  2H88 B;  4AS1 A;  2V3P A;  3T3N A;  4OZC A;  2AX5 A;  4GDL B;  4USA A;  4MM3 B;  3AE7 B;  4P16 A;  1N62 A;  3BVG A;  1BML C;  4C80 A;  1HZ6 A;  2BB6 A;  4JWU C;  4NJC A;  3ZYY X;  1ZOY B;  2OED A;  1GB4 A;  2R61 A;  3AM9 A;  1XF5 L;  1YN5 A;  1TKY A;  1PGA A;  1FO4 A;  1JWB D;  3L4P A;  1I4Q A;  2VZK D;  2AQ2 B;  2KDM A;  1FNV A;  1FNU A;  3Q8F A;  2J42 A;  3AE6 B;  1QKZ A;  3AB5 A;  2CU3 A;  2WXN A;  3VR8 B;  2W54 A;  2ICI A;  1GB1 A;  2AQ3 B;  5D7G A;  1RM6 C;  1DOI A;  1KLU D;  2KWD A;  3AH7 A;  4OZA A;  4XWW A;  1FNW A;  1XO3 A;  2V0G A;  1VZ6 A;  2WXJ A;  4RCO A;  3SFD B;  3Q8B A;  1C78 A;  1E6E B;  4GLS C;  5TSS A;  1E0Z A;  1L0X B;  4JE3 B;  5BYR A;  2WDQ B;  4KGT A;  3P4R B;  5AUI A;  2BYT A;  2K3U A;  4HEA 1;  2WXR A;  3AE4 B;  3T3O A;  3Q69 A;  4Q2J A;  2E6X A;  1HA5 A;  1I4G A;  1AWD A;  2Z8L A;  3DWG C;  1YQ3 B;  4DXF A;  4RGO S;  3TEX A;  1FM0 D;  1IGC A;  3AE2 B;  4ZYS A;  1UGJ A;  1GAQ B;  1DGJ A;  2LHD A;  3R2T A;  2L52 A;  5BMH A;  2FBW B;  1ZUD 2;  1NEN B;  5C2T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...