1ZXIA

Reconstituted co dehydrogenase from oligotropha carboxidovorans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional reconstruction in situ of the [CuSMoO(2)] active site of carbon monoxide dehydrogenase from the carbon monoxide oxidizing eubacterium Oligotropha carboxidovorans
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
total genus 50
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1zxiA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zxiA01
4KX6B 1L6UA 1JALA 5G5HA 1ZXIA 2WDRB 1NVID 5C2TB 3AN1A 3AM9A 3NVVA 1XLQA 4US8A 4YSXB 1PDXA 1L5PA 2HTME 4N59A 3LXFA 1FO4A 3AH7A 2JX5A 3AE9B 2K22A 1GPXA 4FXCA 4A9AA 1OQRA 3DWGC 2DWQA 4WQMA 3CWIA 1AYFA 1RM6C 1FRRA 2OHFA 1YJIA 2LEKA 3AE8B 4LTUA 3NRZA 2EKIA 1OFFA 2L52A 2Y5CA 5EE1A 1V8CA 2FBWB 1JRPA 2WDQB 4YTNB 3KWLA 1QOGA 1JQ4A 1L0VB 3FC4A 1FMAD 1SF0A 2WS3B 3P4SB 3W5VB 1WYGA 4HROA 1E7PB 2ACZB 3NVZA 1AWDA 2CJOA 2BS4B 4ITKA 1E10A 2KAJA 2N0SB 2WDVB 2W3RA 3ETRA 2BS3B 1DOIA 1L6VA 4IDIA 1YQ4B 1JWBD 1SB3C 1VJKA 4YSZB 1QOBA 5EE9A 5AUIA 3RPFC 2MJ3A 3AE2B 2Q5WD 2QJLA 1A70A 2WP9B 1FFVA 2WQYB 1JROA 1CJEA 1E9MA 3WCQA 1FM0D 3P4RB 1DOXA 3NS1A 2MJDA 2W54A 1DGJA 2MH7A 5C3JB 3AEFB 1YJJA 1QF6A 1TKEA 2PVOD 3AE5B 1V97A 2H89B 2BS2B 1GAQB 1VLBA 3P1MA 4YSYB 1TJEA 5EE3A 5GXGB 2PKOA 2E3TA 2WU2B 1VDVA 1J7BA 3B9JA 1RWSA 1QLBB 3HVZA 3AEBB 4N6EB 5H92C 1XLOA 3B2GA 2W55A 2L83A 1PFDA 3AEGB 2DBYA 3NVYA 1NYRA 3SFEB 1N5XA 4C7YA 2H88B 3LB8C 5AUKA 4JWUC 1PUTA 5EE0A 4YT0B 3HRDD 1QOFA 2BT6A 3AEAB 2G1EA 4C80A 3AMZA 1I7HA 2MJEA 1R7SA 1WXQA 3CIRB 3DWMA 2B76B 1WGKA 1XLPA 1N63A 5MPOA 1FXAA 2QIEB 1OQQA 4JWSC 4JX1C 1QT9A 2W3SA 2WLBA 3VR8B 2WU5B 1KF6B 2K5PA 1EWYC 4ZHPA 3HUIA 1TKYA 2CU3A 3AE1B 2K9XA 1FRDA 1RFKA 3AE3B 4ZOHC 1NYQA 2PVGC 3W5UB 1J7CA 3P63A 1JW9D 3BIID 3VRBB 3L4PA 1IUEA 1XLNA 2JQRB 1N60A 2CJNA 2PIAA 1NI3A 1UWMA 2M19A 3AECB 1ZOYB 3P4QB 1JWAD 3VRAB 1NEKB 3SR6A 3ZYYX 4USAA 1FFUA 1E6EB 1YQ3B 4YTPB 1FXIA 2KMMA 4YTMB 4HRSA 1TKGA 1WWTA 3VR9B 1T3QA 1WRIA 1ROEA 3EUB2 3FAHA 1N5WA 1NENB 3AV8A 1FIQA 1XO3A 4N58A 4P6VF 3W9CB 4YXDB 1DOYA 5H8YE 1ZP0B 2AX5A 3AEDB 1N61A 1SIJA 1N62A 2M56B 3P4PB 1F0ZA 3ABVB 1CZPA 3AE4B 1J7AA 3AB5A 4US9A 4ZHOA 1QOAA 3AE7B 3B2FA 1E0ZA 1RYJA 1TYGB 3AE6B 1B9RA 3NVWA 3SFDB 3AEEB 4WWMA 1KFYB 4C7ZA 3PO0A 1KRHA 1ZUD2 5G5GA
chains in the Genus database with same CATH superfamily
3AU5A 2K89A 1FNVA 5L1MA 2NBUA 5KL8B 5C2TB 8ICGA 2DYOA 4BGDA 1EU3A 4RGTA 3OSNA 3GIMA 4P1CC 4HKQA 4CE6A 1Z1BA 3RJGA 4QWAA 5AI8A 2GRIA 3PX4A 3SD7A 2NV3A 1D6EC 2J53A 5KFXA 3UI3A 4UARA 5J2RA 3QQ8B 3RNBC 4Y2SA 3HPOA 2OCEA 2YX8A 1CUKA 1ZQXA 4XRHA 2ASLA 1UQVA 2LVOA 4W9JA 3ZDAA 1QILA 5AK4A 2GI9A 3F53A 2W82A 2IO3B 4IG7B 4KLQA 2VA8A 3DDHA 2BKRB 2LGSA 4ANVA 4NNJB 5KFVA 1RRBA 1UF0A 3UPQA 2KTFA 5AI5A 4NQKE 2KVCA 2WDVB 4ANXA 3VFKA 4OZCA 2L5YA 1U45A 4XGAB 2EQYA 1HA5A 3DBLB 3N4MB 2WQYB 3RNGC 3MFIA 3KKAA 3P4RB 3BWUD 7ICQA 1DGJA 1P1AA 1XD3B 5C3JB 2K4EA 2JEFA 4M01A 3E0FA 4L1BA 4AP9A 2H89B 2BS2B 3Q8PB 4ARCA 1SWWA 2ON8A 2C2EA 1WMHB 4YXJA 4PK1A 4KLJA 4QZAA 3QWZB 7ICKA 1U4BA 3QARA 2W55A 4NY0A 2DBYA 4L2YA 1HJPA 4RQ5A 2Z0DB 1JCKB 4EYIB 5F9LA 3AL0B 1JXEA 2ZW1A 4ECUA 2D11A 2H88B 2BYEA 2PLPA 8ICHA 1TY0A 3LYSA 1E7UA 2W8KA 5A0LA 1L3SA 4I2EA 3TCAA 3ZDMC 2NVUI 4DLGA 4BBNC 2N7EA 4IUMB 3EA6A 5AK5A 4JWNA 2A3VA 3TEWA 5IINA 5D3DA 5AK3A 3Q8LA 3UXOA 2B3AA 2KYWA 2LKYA 2KDIA 2M4NA 2CHXA 4A8XC 1AARA 2KX0A 4A8EA 2G06A 3SYZA 3SU8X 2PVGC 1KH0A 1J7CA 4CQNA 3P63A 5AICA 4DFDA 5EWFA 2WXRA 2JQRB 1XLNA 2WHEA 3ZD9A 1ZQSA 4J9OA 3D32A 5KT2A 8ICYA 2HBMA 3LVWA 1JWAD 5AKZA 1WJ4A 2CU1A 1KL9A 2IO0B 1FEZA 2ZCCA 2BGWA 2EDUA 2F77X 5AM1A 3HHMA 3PV1A 3M6KA 1XO3A 3KW5B 2HOIA 2AX5A 3C28A 4PS3A 3KHRA 4KLMA 2WXMA 3T3FA 1RXWA 1E8YA 3TANA 4OHJA 5LXHA 2W03A 4Y2QA 4EENA 3GV8B 3R9KA 2HBJA 2KZZA 1R4MI 5HHHA 2RDHA 4LZGA 3AM9A 2H5XA 3L10B 2EAPA 9ICPA 4FHJA 1WF9A 2JEIA 4HAIA 4FJVB 5J17A 2IMWP 3WALA 3IXSA 2NRVA 3PRMB 1S0VA 4YMNA 3PMNA 2BPSA 1XSLA 1Y8RC 4MGZE 1MA7A 2OH2A 2M0NA 1F9JA 4BXOA 1YJIA 3KUDB 2OYYA 4TUUA 3GDXA 4TQRA 5CB1A 3NY5A 5CEHA 3LDAA 5J2FA 2Y0SC 4EX6A 3I63C 1WCLA 4NY8A 2FE9A 5C5JA 4F4KA 1XEEA 4PL1A 3RH5A 2DFLA 3TACB 1V49A 2ISOA 2JPHA 3D2QA 3NVZA 9ICMA 1UH6A 4F92B 3BDPA 3HW8A 5IIMA 2ES6A 1DOIA 2BS3B 1SKSA 1YQ4B 1J0GA 5KG5A 2DZJA 1Q0WB 4I2DA 3WK9A 4EYHB 8ICKA 1A70A 5HKHA 2PFPA 9ICLA 5L1LA 3WKDA 1JWMD 2KDMA 3GZNI 5LNK1 2QCZA 4F7ZA 2GLSA 5ALRA 2H3IA 2K25A 1NOMA 3ONNA 1OQYA 4JWMA 2NRXA 2DPJA 1IG6A 4YSYB 2V4QA 5FKAC 3Q2AC 3MC0B 2QLTA 1WI0A 4PH5A 5H92C 4DOAA 2N9XA 4OJ5A 4OJPA 4HPLB 1JN3A 4NZLB 3AEGB 8ICWA 3VC8A 1NK8A 3EPGA 1K51A 3E9SA 5BMGA 4WWOA 5DBCA 2KC2A 2AQ4A 4NLNA 4JWUC 5DB9A 1TAUA 2R61A 4IM3A 3RZFA 5DG7A 2R2OA 1DGSA 1BPYA 4DSIA 2NCNA 2G1EA 3PR4A 4WURA 2H3VA 2B76B 1XLPA 3TQ1A 4YQWA 1L8LA 3OPXA 1FXAA 1GB1A 4F4XA 4ELTA 4DOBA 5KT5A 4QWCA 3KOOA 3N20C 5TISU 3G6YA 4F4ZA 1DK2A 1FRDA 4TUSA 4YR0A 4DDID 4FADA 3E2EA 2BCUA 2KC1A 1KLVA 2K4PA 4YMMA 4DO9A 1MG8A 4EEKA 3VRAB 1MHXA 5IILA 5KHQA 1KLNA 2WF8A 4B9UA 2XCPA 4IRCA 1HEZE 3T3OA 3DVNU 5ALZA 3M9MB 1D8LA 3C2MA 1WWTA 2WXFA 4HYKA 1WZ0A 5L95C 3GQCA 4KLOA 3AV8A 2KWVB 2NMQA 5H8YE 3BQ2A 2KFKB 2ATLA 3AB5A 4FLHA 5EWGA 2G3QB 4FHKA 1C4CA 3NVWA 4C8OA 1WX9A 2FCNA 1KFYB 4IR9A 4MH0E 4K7SA 1SGHA 1ZXIA 2WDRB 1WRDB 2KQ7A 4WAAA 3TKAA 1Z1VA 4MDKE 3RBDA 1PDXA 2HTME 1YX5B 3LXFA 4XUSA 2K1FA 4PL2A 4LDTB 4A9AA 2MHJA 2A1JA 1NJXA 3DWGC 1ZQHA 4FN2A 2KQ4X 4M9JA 1DYQA 4Y2PA 3AE8B 2RDGA 4EZJA 4YCXA 3KVFB 3MHZA 5KFEA 2G07A 4ECYA 3RJKA 9ICQA 4KZ0A 1K5OA 1CK1A 4YTNB 3MDCA 4M00A 4A90A 5DDYA 1TBEA 3UIPB 4UATA 1SXDA 5H2FU 2D3CA 1WJ6A 2C28A 4HJKA 3PVXA 3RB6A 4DEZA 9ICSA 1L6VA 4ECQA 1SB3C 4YG2A 2E8NA 4RF0A 3W1YA 4P1BC 1EU4A 4G9BA 1HEKA 2H3QA 9ICWA 4KDIC 1FM0D 1DOXA 2M9NA 2W54A 2MEKA 4P7IA 3OJSA 1JMSA 2LJ5A 3QE9Y 1L4ZB 3RF9A 3H7PA 4Y2YA 4M0AA 3TEYA 3RJEA 8ICJA 4LJXA 5HR7A 4O3MA 1K1SA 4NM1A 2G0AA 1LGRA 3A1QB 3SI8A 4BOZB 4RQ8A 3HVZA 2KE7A 1ZQGA 3PNCA 3MGVA 1WGGA 1NK7A 3SHQA 5J0UA 4OVVA 2V9WA 3AQEA 7ICTA 1QQ5A 1PVQA 1MHHE 3HM3A 4TV3A 4MF8A 3N97B 3AEAB 4ANWA 1UZXB 3CRXA 1R7SA 1WXQA 2O6VD 2LMRA 4O9MA 3NTUA 4UB6U 2WXGA 1X42A 4JUZA 4CF4A 3RYTA 5AKYA 2HJ1A 3N30A 2F76X 2KJHB 3LYYA 1UBQA 3QEAZ 3SZ2A 3H4DA 3AE3B 1L0XB 1MFWA 3W5UB 3N7RC 1GC7A 1JW9D 1TY2A 2YTUA 4F5QA 4UAVA 2KKPA 4M04A 3L5KA 1IM4A 2E6XA 1NDDA 4OO1J 2HD5B 5CHWA 3PSFA 5ALWA 4YD2A 4AYBF 1XSNA 3ZKJC 2QEJC 4FS1A 1MI0A 4LJOB 2V0GA 3Q8FA 2VANA 1A6SA 1QQRA 2R18A 1DRGA 2KMMA 3QUTA 2RPVA 2HW3A 1L5UA 4I27A 1VR9A 4RM8A 3RNCC 4XZ4A 4PZNA 2YMPA 8ICSA 1SBBB 1WGHA 3KQ4A 1A76A 1Q8KA 3MR3A 2MSNA 1BNPA 5KT4A 4PS7A 3R7RA 1AW7A 4XC2A 3ECIA 2BYVE 3PREA 5I4DA 4PHDA 2ZZPB 4ECVA 4EZ9A 3L54A 5J2IA 2UVUA 5C0YA 3N1YC 3PO5A 3T8MA 2INCC 2KQSA 3ZQ4A 1F77A 3PRPB 3V6CB 4XWTA 4MF2A 2WB1F 2JUOA 3DHIC 5J2GA 4FXCA 2J0JA 3UIOB 1GB4A 5ALDA 5AKKA 4YFKA 1DXSA 3VCBA 1NJWA 4TKNA 3LWMA 3MC1A 4WWNA 2VRRB 3NJTA 1NK5A 1C79A 3PHXB 3PX0A 4LTUA 2EKIA 3KHLA 1S0MA 1OFFA 2L52A 3PV8A 4U7CA 4F2RA 2GBRA 2Y5BB 4GLXA 2I1JA 1FMAD 2V3NA 1ZQFA 1UNSA 5CRXA 5KG1A 1TFRA 1MG4A 4M6WB 8ICBA 1TE2A 2JEJA 2ACZB 2BCSA 8ICRA 1WH3A 2IJ0A 4LLGM 4BKGA 3ZNID 2F8KA 4ACOA 4J9LA 2E1FA 3TMPB 2GOLA 3NS8A 1DK3A 2WP9B 1Z4OA 3MABA 2L76A 2RQ5A 2D2QA 2W9MA 1ZJMA 1I42A 2JEGA 1ZOLA 3DHGC 4QWDA 1Q1OA 3ZJVA 4ELVA 1C77A 2KK8A 2G08A 4UDUC 4TQ1A 5EE3A 4KITB 3Q8SB 2WU2B 2EAOA 2CRXA 2PEAA 2ZIUB 3BS5B 4J03A 1T6BX 1YD8U 1WE7A 3AEBB 3U7DA 1QLNA 2V1YA 3OTQA 4J9SA 4MSMB 3V6KA 3BZDB 5J0RA 1SGGA 5ALLA 2C5LC 1XCTL 3QU2A 2DYBA 1LFDA 3Q8CA 3M7DA 3BY4B 4HPMB 2D3BA 3A4RA 4DQSA 1YQBA 4LCDE 4KLTA 1WMHA 3OG5A 3G6VA 2YB4A 3NG0A 1BUIC 2FUHB 3NUQA 4J6IA 5ALUA 4KLUA 3B0YA 4KGSA 1PGXA 5CJ7A 1RDFA 2K5PA 2VKQA 4RM9A 4GXKA 1V2YA 2KJ5A 2HOFA 2PFQA 3PZ8A 2KK0A 2MA9B 4IWOA 4YR3A 4NM2A 2QB1A 4PGQA 2ZCBA 4LNOA 3H8SA 4LK0M 4QZIA 1IBXB 2LZ6A 3CSTA 3ORYA 2BCRA 2IO2B 3DVGX 4BKSD 5BPCA 4DQRA 1U47A 3TARA 3QU9A 3HWTA 1TKGA 4ZRKA 1Q3UA 5CHVC 1QTMA 2UVRA 2D07B 4RGOS 5JZEB 4P0PB 5J8YC 1X1MA 1N62A 2KFZA 2V4IB 4UB8U 4ZRPA 2J7QB 2LI5A 3QC8B 4BFRA 1RYJA 5ALTA 1ZQJA 4I2AA 2L0FA 4ACFA 4M47A 1L4DB 4RQMA 4WH4A 4ICAA 9ICUA 5GMVA 4MH8A 1N56A 5KAFU 1EXNA 5KFIA 1KQQA 4W9HA 5DLGA 3S6JA 4UB3A 4WIPA 9ICKA 1BGXT 1EWCA 4N59A 1FO4A 3NHEB 1IBXA 4DHJD 1IGDA 2F3NA 2MBQA 3QXGA 4CHKA 2B6GA 2K39A 4OCZA 3UXNA 3PGEA 4PYUA 4WJPA 2JMGA 1TS4A 2XY7A 3WANA 2DKZA 5KG2A 3I28A 3GIIA 1PK1A 3KFUF 3ZXRA 3QZ8A 3GFKB 3EYZA 4I6PA 3EW9A 2Y9UA 2W9CA 1NK4A 2LWPA 1J97A 3M8RA 3W5VB 2W43A 1U48A 1XNSA 4WWPA 1VJ5A 3ISDA 2ZG6A 1S0NA 4W9GA 4BKSA 1ZETA 4PGXA 4IDIA 1ZQIA 4JGHB 4BXOB 1B1ZA 2QC8A 4JLCA 4RU9A 1UGMA 3AE2B 4ZYSA 4EUTA 5IA7A 7ICSA 3SDLC 1ZQNA 1EF1A 3W2DA 2KKVA 1QF6A 2PVOD 4ED6A 3PZ7A 2GH1A 3DDCB 1ZQQA 3KKAC 4ED2A 2M17A 3B08A 3D2NA 2LGYA 4K7UA 3ZNHB 1GUAB 1TKDA 2WNMA 3ZUNA 4R3DA 1OTRB 2J0MA 2SAKA 4HXDA 2W9BB 4BWJA 2D5GA 1UWXA 1XXGA 1H8CA 2ODGA 1QZEA 5J2EA 3RB4A 4F1SA 2RLTA 2BT6A 2WXHA 4WJQA 1X66A 8ICTA 1YZ7A 2M0XA 1LXDA 4MELA 1YNTE 3PSEB 5MPOA 2KSOA 1RQLA 3AUOA 4ZYNA 3CP8A 2KHQA 2PFOA 3VR8B 2Y1JA 5DPSA 1C9FA 3M62B 5L1JA 1PQSA 5AI6A 3QYPA 4AJYB 4EFOA 2WF5A 1K1QA 2B0CA 3THVA 1WJNA 2AQ0A 1IIPA 1V9PA 3MR5A 3EPIA 3AEVA 3A9JB 3WA0A 1D5ZC 3M95A 4GXIA 3RR7A 4UAYA 1RYUA 4MFAA 2KJ9A 2GB1A 4HRSA 3NGDA 4QIWF 3K1ZA 3I1YA 5J0PA 2R8KA 2WFAA 2P6RA 2MA1A 2NRZA 4EBEA 2D10A 5JU5A 4ED7A 2NBWB 1Z00B 1V5OA 2KTRA 2V4LA 1VRAB 5AM2A 3K9PB 3AU2A 3V7JA 1NKEA 5J2AA 1JXLA 3HT3A 3PW2A 7ICRA 1F1HA 3A0BU 1KRHA 4I2BA 1V5TA 4MFFA 7ICEA 2Z0EB 3QHTA 2HHQA 1JX4A 2KT7A 2HVHA 5J0TA 2O2VA 3OAWA 1RZTA 3K1RB 4FJYA 1WFYA 3L13A 4IQUA 1Q10A 2ZIUA 2K6DB 3VUYA 3APDA 4DF8A 3IT4B 2GMIC 5C23A 4W9LA 1SXTA 1ZJNA 3A33B 4FO6A 4K4HA 3MJWA 4WQMA 2RPQA 1GO3F 4JIOU 3EFUA 1I4XA 2Y1IA 1E7VA 3BQ7A 1S0OA 1YJ1A 2XIDA 2L05A 2EELA 1AN8A 4UB5A 2JF5A 1V81A 5ALEA 1WIAA 1PVRA 1WJUA 2A1JB 2HMXA 2FNJB 2KLGA 1F2RC 5BMHA 1IXRA 4B9VA 3M1YA 2XK5B 3RNFC 4F8RA 5DB6A 3OLMD 1FCCC 2C2RA 2Q5WD 1CJEA 3KBBA 2MH7A 3MDAA 1WY8A 4Y2UA 7ICGA 3UMGA 4F71A 3EECA 4NPNA 5HHDG 4Z6EA 1I4PA 3GZNB 4QZFA 4Q8FA 4B9TA 3OJ3A 5J2DA 1TJEA 2DNFA 4BX9C 2KOXA 5CWRA 2EKEC 2UU7A 5KFAA 4R8UA 3AXCA 4KSLC 3JPPA 1YN4A 1XLOA 1HUOA 4E0DA 4LNFA 4RPXA 1TT5B 4DDGD 2FI1A 4DQPA 2DLBA 4KLHA 3Q69A 5HR6A 1WYWB 2NYVA 3LB8C 1JIHA 4C4VB 1S97A 5ALYA 5EE0A 4TMAB 2OM6A 3DCGA 4Q43A 2L00B 2KN7A 3IV6A 2KSOB 1V38A 2LUMA 2KIWA 5ALSA 2X8XX 4W9DA 2VJ5A 1WSPA 2J4XA 1AROP 2KJRA 4JX1C 1QT9A 2C9WB 2F1IA 2MP2A 3HUIA 2QHOA 1E5WA 3U52E 3PO4A 1HE8A 1ZQVA 1FEHA 4OZBA 3C21A 5CP2A 3C2KA 3KYDD 4I2GA 1VZ7A 5JTIA 1K8RB 1V1OA 2AYOB 3M8SA 4NJCA 3CW2C 2DL0A 4FZMA 4H2AA 2DUYA 2E8PA 1STEA 4JE3B 1L7MA 2RD0A 4IOIE 2KG5A 4RNNA 3ZDBA 3GILA 2RDBC 1U4AA 3BZCA 3VR9B 5KG6A 5KG7A 1QSSA 8ICAA 3W9CB 5IKCM 4Q2JA 5KFSA 2W11A 1HTOA 2JRZA 4AQ7A 5J18A 5AHXA 4BWMA 1KDHA 5CTRC 4OVZA 4IQTA 2HOQA 2YB1A 3EFCA 3U26A 2PMZF 2CN1A 1Z4NA 3KLSX 1VD2A 4E71A 3K75D 1V85A 3GE8C 1COOA 2YN4A 3VAWA 3VTVA 2BKFA 4D2KA 4QZ8A 4URKA 1LKYA 2ZTDA 3VUXA 3AE9B 3QAQA 1ESFA 1RPLA 3KH0A 2AQ1B 2GOWA 5KFTA 1WGYA 3WK4A 4DCCA 4EX7A 1ZXHA 2KVRA 5J2JA 1AYFA 3IG3A 3IT6B 4OD0A 5K4LA 2C60A 1V8CA 5FP0A 3CF6E 2ONQA 1JRPA 4WJ3B 1J8CA 2WDQB 4Y2VA 3KWLA 1BPEA 1ZQ1C 3GP7A 4EE2A 2WS3B 4KMUA 1YZ6A 3FILA 4ITKA 4A3OA 1M6YA 1VZ6A 4GIVA 2WAQC 4KV2A 3IG8A 1VJKA 2CHWA 2DZKA 1FPYA 2IGHA 7ICFA 1TZOA 4A55A 4RQ1A 3M3JA 2ZIXB 3PT2B 4NAWA 4JB3A 3C8YA 2MJDA 8ICZA 5F3XB 3UM9A 1LQBA 3W1SA 1S5LU 4O5KA 4S17A 2E3TA 3R8BA 3RJHA 1J2MA 3QUCA 1QQ7A 3RRHA 5AEKB 3RJIA 3B2GA 2LFIA 4QZHA 3TEZA 1ZQZA 4KN4A 3SFEB 3AU4A 2K8HA 4ZDVA 4DQOC 2R8JA 2KX3A 5KL1B 1CMXB 3NOBA 1BPXA 8ICLA 2EMSA 3WK7A 4IRDA 2EZYA 1ZD4A 1EM7A 2L1AA 5D6JB 2W3SA 2F1HA 3A0HU 2ZNVB 5E6OA 2MUTA 2K8BB 3APFA 1SZHA 4QJFB 1S10A 1KBUA 3HJEA 3RAQA 3ZRFA 1LO5D 4IM0A 4E3CA 5ALIA 4DL3A 4BBNF 1L2NA 2MQJA 1YOVB 2ZIVB 2LRWA 2OJRA 2QMTA 4RMAA 2JR5A 3HM6X 3RAXA 4AP4C 4JV0A 2XY5A 3BQTA 1P7EA 4HEA1 4GB9A 4KKJA 4N58A 3IN5A 3FAHA 1FIQA 2JH1A 4M02A 1F0ZA 1N2XA 2KACA 1NI2A 4RPYA 3AE7B 2QB0A 1P98A 3ML9A 1E0ZA 3CYMA 3QA8A 1PUZA 2WDTB 4QZDA 5FK9C 5J0WA 2AGQA 3BYTB 1SV4A 4YP3A 1Y88A 3Q3FA 2PXIA 1V80A 2AGOA 1P3QU 1ZQRA 4IS7A 3SENA 2XN9C 5HG2A 2ZVOA 3KZXA 3Q3OC 4FULA 5E6NA 1GPXA 2GO7A 2L8JA 2K8CA 2W7OA 4DL6A 4I2HA 2RP5A 3TFRA 4NLKA 3KWVA 2G5HB 1SZPA 1BPZA 1FRRA 1V86A 4C00A 3H4BA 4ARIA 4X57B 3UGBB 1HQRD 1C4PA 1FNWA 4IM2A 5KAIU 4B9SA 3AQFA 3N9YC 4IL6U 2MBBB 1OXJA 2JY6A 1D3ZA 4I2IA 5AM5A 2HI0A 2BKEA 2IOFK 1QOBA 2JWUA 4J9NA 2EANA 2LD9A 4KMOB 2KFJA 2MJ3A 1T4GA 2QJLA 4K1RB 4NAWB 1E9MA 1D9DA 1RQNA 1KJTA 4G11A 4EBDA 2KJ6A 2O6KA 2HHSA 3BVGA 5KFJA 1T3NA 5KFZA 3TSSA 3WK6A 1T0SC 1MQ3A 3JPSA 2N9LA 5AK6A 3W1SC 3B9JA 3PMLA 1QLBB 2JZBB 3OJUA 3LDZE 4YWGG 1JWSD 1NZPA 4O3RA 1XF5L 1NYRA 4C7YA 3Q3JA 1ZD5A 3UMCA 2JXTA 4DXFA 4DSFA 3RBEA 1S77D 2DENB 2N7DA 1ZW7A 4M9LA 1QOFA 8ICQA 3PSPA 7ICVA 5ALHA 3H6NA 1B4FA 3R2TA 3ZVVA 1KN5A 4Y2RA 1X2IA 3NRWA 2MJEA 4O5EA 3PLUA 1WGKA 4WJOA 4XE0A 3H0MB 2VZKD 4QZ9A 2CHZA 2HBLA 3HP6A 3VDZA 3JSVB 2AU0A 1L3VA 1EWYC 3MR6A 4ZHPA 1WWVA 1UA1A 2IOFA 2RRDA 2K9XA 1C76A 3DBLI 2HHXA 5L9XA 2L32A 4Q8EA 2ZIWA 3AECB 1ZOYB 4KLLA 4BUGA 4EZ6A 2CKHB 1NEKB 2IBIB 3A9JA 4K4IA 1YQ3B 4UB4A 1CQVA 3SEIA 1G6JA 3APCA 1N5WA 3OHBA 4ED3A 2HSZA 2OXOA 2BWES 1KTKA 2VIXA 2KDEB 2AWTA 1J2NA 1L8OA 1PGBA 4RCOA 4OJLA 5CHGA 1C78A 1ZGUB 1TYGB 2FLNA 2KTRB 4JPSA 4FA6A 5DB7A 1WZ3A 4LNKA 4C7ZA 1BMLC 4BAXA 4KX6B 3KHGA 1K50A 3ZD8A 3P42A 2FMQA 3E58A 2EH9A 4A6QA 1PZNA 4IRKA 1ZE3D 4EBCA 4MEYA 3V7KA 2KOBA 3UQBA 1L5PA 1Z00A 5AIAA 4UBCA 4F5RA 1NKBA 4P0PA 3VQIA 3BVZA 4O3QA 1FD6A 2BDUA 4FBTA 2JU6X 5AKJA 4ED8A 4RH6A 3D6JA 3TAPA 1HXYD 2XC9A 4JV1A 4KX3A 2MBOA 1JRUA 2XICA 2O2VB 4O3NA 9ICNA 3WU2U 4KN7A 4AYBC 3G6XA 1SF0A 2N1VA 4AUQC 1WYGA 4DHZE 2KIVA 4RPZA 9ICXA 4LNIA 2I5HA 4E74A 3ETRA 4DLEA 2BZFA 2INPE 2ZVNA 4I6LB 1ZQCA 2KNJA 3C5GA 3ONSA 3GE3C 4M8MA 3HKZF 2XK5A 5AI0A 4UAWA 4XWWA 5J2HA 3QCAA 4GXBA 3RFZB 4Y2XA 2XEWA 4NJ6A 3C1YA 3RCZA 4EELA 1BXTA 3WAMA 4YD1A 1I4QA 4IC7B 2EAMA 3P2BA 1V97A 1ZYQA 1NK0A 2KP7A 2NTTA 5D94A 5BOLA 4O3OA 3JPQA 1D8BA 1ZQYA 3BQ0A 1XO0A 9ICVA 2DHZA 4DL4A 4KDLB 5CHFA 3V6HA 5AZFA 2BYTA 8ICPA 5KFKA 2GWSA 2IBKA 2NR2A 3L17A 3I76A 2L3ZA 4NXZA 1UBIA 1KRPA 5ALPA 1RFAA 4QIWC 3IG5A 4NJ7A 4RQ3A 3UF8A 2KKCA 3L3FX 2KMAA 7ICUA 2P35A 4RQ7A 3ALRA 1RYSA 1UCVA 5KG3A 1T0RC 3Q8AA 5KFQA 1PUTA 4YT0B 4MJSA 2A1AA 2KEYA 3CSFA 3JPNA 4IR1A 2L7RA 2J52A 4DSLA 4IKGA 3H8JA 2JV3A 1OQQA 3R7QA 4EEYA 2INNE 3I3TB 3MR2A 3ZDCA 3O0FA 4ZRJA 1TK8A 3IFWB 5AI4A 1C1YB 3IHPC 1QSLA 2LASA 3JVZX 2KWUB 4LDTD 2K8AA 1X6IA 1ZQBA 1T5XD 2WF6A 4FBUA 1SJHD 3H7SA 4DWIA 4ZRIA 1FXIA 1N48A 1SV0C 4YTMB 2RDJA 4C8MA 1WRIA 4N9F4 2HHUA 2WHIA 4P6VF 5HMLA 4F4YA 2C22A 7ICOA 2I9GA 3ZDDA 4KIKA 5EDSA 4FZLA 2Q4TA 1PYWD 2QSDA 1QOAA 1T94A 3GS2A 2FPKA 2RGFA 5BYQA 5CX3A 1TAQA 4RFBA 3V3XA 3SQIA 3QU5A 2BF8B 1SEBD 2JYTA 1PK3A 4PZOA 8ICXA 4OW0A 4FZNA 4QWEA 4B9MA 5KFLA 2JRIB 1BT0A 2DF4B 7ICHA 2YLMA 2JZBA 2G4SA 2W9AA 7ICMA 2J0KA 4GDLB 1OQRA 4GDKA 2JRHA 4Z6FA 1NJZA 4B9LA 4KLEA 1WX8A 5LLIA 2WXIA 3GOEA 5ALQA 4OJOA 1ZQWA 3N7PD 3SAGA 5DGBA 5AKXA 5EE1A 2JH7A 4R65A 4Q44A 4DF4A 2G4DB 2Z8LA 5BYSA 5DPRA 1D4BA 3LWLA 3MTNB 2WB1C 1ECWA 4X5VA 3UQAA 1L0VB 2P6UA 3PRZA 3F5EA 4HROA 4G3XB 5KG0A 2QARA 4DQQA 2DAFA 3VVWB 1F0MA 2KAJA 3NUHB 3MC9A 1MJDA 4I2JA 3PR5B 3H7IA 1MQ2A 3WCQA 3GU3A 1JROA 2LPEA 3NS1A 1WG8A 2PMVA 1I4GA 3SV4A 3AEFB 4F4WA 5KFFA 8ICMA 4ASWC 4TUPA 4RNOA 3N1XC 3PTFC 3WKEA 1GAQB 4HLEA 5CR0A 4HPPA 4WAFA 2DKXA 1PVPA 5J0XA 3QIJA 1VDVA 5KG4A 4KLFA 3UINB 1ET6A 3BVMA 5KT6A 3MHSD 4N6EB 2WXKA 5JHBA 1ZQKA 4YN4A 2ZIXA 3OWEB 2K4IA 2LHTA 4JK1A 1U49A 3BQ1A 4F91B 3H7PB 4GOCA 4P4OA 4K7WA 3J9CA 2BPCA 3RMKC 3HRDD 3F2BA 4JQWC 3BINA 3T9LA 2R2QA 2WAQF 4DSJA 3ZDTA 1D8YA 1O03A 4YXMA 1ZQEA 3KUZA 4J9PA 3NZSA 5DLFA 4KZCA 2XI9A 2VA3A 4BDPA 5J0YA 4FFDA 2IHMA 3AI5A 2VA2A 3FDSA 2YEPF 1KF6B 4P4MA 9ICTA 4CO7A 4P0QA 4P2HA 2SEBD 4PHAA 1ZQLA 1E8XA 3AE1B 4Q45A 2KICA 3JW0X 3RJJA 5ALKA 1K53A 2K3UA 5BOMA 3HVDA 2I1QA 3ED5A 3L4PA 1IUEA 2NPTA 4DXAB 3C5FA 2IY0B 1X9XA 3SR6A 2WYQA 3X0WA 3ZW3A 1P7FA 1SL1A 4J3OD 1T3QA 3TI0A 9ICCA 1COKA 4MACA 3PZDA 1MVKA 3VXWA 2AH5A 2JWZA 4II3B 2YQEA 2Y9TA 1CZPA 3ABVB 2ZIVA 3R66C 5BO4B 3Q3NC 4RT2A 3IAM1 4YMOA 2AGPA 1ZQUA 1RLFA 4A20A 4B6WA 3PO0A 1ACCA 2BB5A 9ICJA 4NLCA 5G5HA 4AOFA 3B0XA 4B6JA 3CMMB 1ED1A 4BJQA 4O5CA 2HDOA 2LHEA 1SJED 2AL6A 2AEHA 4US8A 1OEYA 3BK1A 1GJZA 2KZRA 3ZJUA 1YMHE 4QZEA 3RT3B 4ECZA 4IQVA 2R8IA 2LJIA 1Q46A 4AWJA 4ELUA 1FNUA 2LXAA 2K8CB 2W9BA 5ALXA 2YVCA 3PVLA 4DHZB 2FMPA 3H8MA 2Y0SF 3ISBA 1Q5WB 1S9FA 8ICIA 1A0PA 4C8LA 2ASJA 1ZQDA 3I57A 2Y5PA 3WAOA 3C1ZA 2KDFB 1SKRA 3MC8A 1ZRMA 1ZQOA 2M1MA 2ZPNA 2ZUCA 4M2YA 2XY6A 1LKYB 1P9DU 4M8NA 5KFBA 5J0OA 1JWBD 1FCLA 5D7GA 9ICBA 2ZJ5A 5DDMA 2BQ3A 3T5KA 2PKEA 5HP4A 3ISCA 4DL7A 2ISPA 4DL2A 2CPRA 3QU7A 2I38A 2JGAA 3Q8EA 1R4NB 2WF7A 4REZA 4DWFA 3MP9A 1O08A 4KTQA 4TUQA 2DZIA 5KFUA 1NZBA 2UVVA 9ICRA 2DAJA 2LGXA 4F50A 2ZXHA 1U9LA 4M9NA 1BNOA 1Y56A 3PX6A 2ZTEA 2N1RA 5KFRA 8ICEA 3A4SC 2RDIA 3QUBA 2J6UA 2FMSA 2D3DA 1LB2B 3JPRA 1ZQTA 2HHTA 2FCMA 3AMZA 4QW8A 5D49A 4GSWA 4AS1A 3BS5A 1SE4A 1TAMA 2WXJA 5DBAA 3EWAA 2CR5A 5ALOA 1WR1A 2GLEA 4GDKB 4LNNA 7ICNA 3PW4A 1TGZB 2K4HA 4ECRA 4ZOHC 2PE6B 2PJHA 1HTQA 5JRTA 2E1EA 1QCKA 2AHOB 2IOHA 4PPXA 5AKEA 5CA7A 1KKXA 3UXPA 1L0YB 1NI3A 2IY1B 4R66A 1FFUA 2KNBA 3FM9A 3QK0A 3VTUA 5KFYA 5AI9A 1GC6A 5C1ZA 5DB8A 1KW4A 2F1JA 2G09A 4RQ2A 3HK0A 2REXA 1PGAA 5DPWA 3K9OB 2BR0A 1N61A 8ICCA 1WXSA 3L16A 1TK5A 1B9RA 4YVZA 2BWFA 4Y2JA 1D9FA 1KM7A 4EOYA 2INDC 1QSYA 2IA6A 3ZXVA 4G50A 2XVTA 1L6UA 5DQHA 1MPEA 3DV9A 2CS4A 3BZKA 3AULA 1I4HA 1TTNA 4F8CB 1ISNA 2PMZC 3PLVA 2J42A 2AXTU 2NBVB 2DZMA 2Z59B 1WX7A 2HHVA 4KVGB 4JMUA 1WXAA 3PHWB 2C7NB 2PW9A 5IP4D 2BCQA 2DYMA 4I6NB 5KHOA 4B9NA 4UASA 2G45B 1WGRA 3I9V1 4CF3A 4G3IA 1YT3A 3IRUA 5B5EU 3GIKA 2GBJA 3TADA 1QOGA 5ALNA 2MBHA 2RSUA 2HBKA 2N9PC 4ICVA 2W04A 4R63A 2NRWA 2CJOA 2KN5A 5BYRA 4CYEA 2N0SB 5DKWA 2XGQA 2BDPA 4CRXA 5EE9A 3O65B 5AUIA 3SEBA 4KLGA 2JYEA 2FAZA 1C3TA 2YMQA 4XYCA 4DXGA 4RQ4A 2W9CB 2LHDA 4QW9A 4I2FA 3HX0A 1EO6A 1B0XA 2YMMA 4C8KA 9ICGA 3TL5A 4AJWA 4M9GA 1VLBA 3P1MA 5GXGB 4XA5A 2GBMA 5IAAC 3MFHA 1J7BA 3MJ5A 3T5LA 7ICIA 2Z7JA 4XDCA 5DPTA 2V9HA 1NBFC 4FBJB 3F2CA 9ICAA 4PGYA 3OJ4B 3BJYA 3N1ZC 4XX5A 2KV2A 4QZGA 2LI6A 2ZEQA 2UYZB 1NNLA 3PSTA 4KGTA 3CNHA 4GLSC 3J81j 2DGZA 2IGGA 4JV2A 3FYHA 1P0RA 1FXTB 2ICIA 2PE9A 3V62A 3ZRCA 3RULA 2F2AB 4RT3A 2M8SA 3KYCD 2O6VB 4CDGA 3QJZA 3TEXA 4IC9A 1V1PB 5JXVA 4QNLA 1A5RA 4JWSC 3TUOA 2WLBA 2WU5B 4OJ6A 5HHIA 2EZZA 4BOSC 1TK0A 1Z2MA 1KFDA 1J19A 3KUCB 2QILA 2ZXIA 2BPGA 1CRXA 1SE9A 1XSPA 1UD7A 4KLDA 1ZQAA 2PPHA 9ICIA 2FJ6A 4TSSA 3S2AA 3P4QB 1E90A 3U4EG 3LK9A 3QX7A 3GV7B 1SKWA 4O1NA 4UB2A 3PSIA 1RAXA 2JVCA 2FLLA 3V6JA 4NLGA 2I6XA 3MGIA 4RQ6A 3L0WB 5E6JA 4NQLB 3T5HA 1ZD3A 3AEDB 5DBBA 4F5PA 2DPIA 3E56A 4K4GA 4W9FA 4QWBA 5AZGA 2JZZA 3B2FA 4ED0A 4HJGE 1ZQPA 3QNMA 4PYZA 1PK1B 2KN4A 1ZUD2 4WWMA 1KLGD 4RNAA 1UT5A 2NTSA 3SAHA 1JALA 5J2KA 2ALZA 4QAYA 5E6PA 2VJ4A 2GBNA 4F72A 2BBCA 3RFAA 4FS2A 3NVVA 4IW0A 1XS9D 1RYRA 2KDBA 4F2SA 3MFGA 4O0IA 3ZGZA 4KGRA 1X6JA 2B21A 2YMLA 1C20A 2D3GA 4LJPB 4OVUA 3IP4B 4HDQA 4ECTA 5F9NA 3B1LX 3X23A 1QH9A 1F5SA 2JXXA 2QDFA 3UQ2A 2BQUA 4DSKA 2LGIA 4CF5A 1KSPA 1YN3A 3BYYB 3V60A 3NRZA 4NLBA 2Y5CA 4HWIB 4XQ8A 2HJ8A 4HK2A 3HIZA 1SSNA 3RN9C 4GC7A 3VH4B 2BW2A 5AKHA 4J9QA 1GOZA 2C7HA 2H3FA 1R4MB 2JT4B 3DHHC 2LYBA 1IYFA 2PI4A 2E8OA 3V05A 4J9KA 2QARB 4DFJA 2XO7A 2HHWA 4HDOA 1S1QB 4LVSA 5KFCA 3RPFC 4DS4A 1BVSA 2LVQA 3EC8A 1D5XC 3WK5A 2HE7A 3U2SC 1D5MC 1YJJA 3ALBA 3AE5B 2WXLA 2FDRA 2BTEA 5L83A 5G55A 2ZPYA 4MT5A 3OGUA 2P66A 3JPOA 4B95A 2PKOA 7ICLA 3R2IA 3M63B 3N32A 4HVBA 1RWSA 4NV0A 4M0WB 3DQVA 4MM3B 4HCPB 2MRPA 2IZVB 2N1WA 5AKLA 2LM1A 3K4GA 1PFDA 3NVYA 5KFDA 5IIOA 5ALVA 1E8ZA 1N5XA 1XWLA 5TSSA 4GU2A 5AUKA 9ICHA 2Q0ZX 3URYA 1IV8A 2YEPB 4FE3A 4O3PA 3ZO5B 3KD3A 2LXCA 4C80A 1X9MA 2KMDA 1UPHA 1V9JA 3R3MA 3H0LB 1T7PA 2WXPA 3Q8MA 2PFNA 1T0YA 1KTQA 2LYAA 3HKZC 2KHVA 4RUCA 2KLCA 3IBEA 4EEWA 1TKYA 4F93B 1Z3EB 2WGSA 3ML8A 5TZVA 4P0QB 2G5IB 4U6PA 1NYQA 5FR6A 4PHEA 1YN5A 3GZFA 4C4VA 4UBBA 8ICNA 4L23A 3MBYA 4DFKA 2PIAA 2IPKD 3JPTA 1CEZA 4HKZE 4USAA 5GTHU 4DK5A 1XO1A 4NAMA 1L7NA 2LUEA 4RGNA 1L7OA 2BYFA 1E8WA 4ANUA 1T0QC 3EHVA 1UHUA 2TSSA 4NLZA 1NENB 2I1KA 1XCQL 1LV5A 4UAZA 3ZI4A 3PY8A 2MX2A 3OSPA 4YXDB 2M56B 1SIJA 3P4PB 4US9A 3EGRA 2NPTB 1RG6A 5LXIB 2VH1A 3WIMA 3BS7A 5FR3A 5DCNA 3SFDB 2WX0A 4NWIA 2HTHA 2I2YA 4K81A 3RNAC 4RUAA 3ZDEA 2FPLA 8ICFA 2BGFA 1NVID 3RNEC 5KFHA 2ASDA 4ZH4A 4A3PA 1OUQA 7ICJA 2OEDA 3AH7A 2JX5A 4MGKE 4W9IA 3KTQA 4KIKB 1AQ6A 3H1UA 2MBEA 1A77A 2A19A 2LEKA 1L3UA 3H0RB 2AJQA 2IYDB 2BQRA 3TIXA 4DS5A 1MC8A 1RXVA 2FBWB 1HIWA 3V6EB 3TBLD 4HCNB 3T3NA 2XGPA 1TV9A 2OWOA 2MWSB 4IWQA 3RUIB 2WXQA 5ALFA 5J8YA 1QKZA 1KFTA 4ECXA 1R4NI 1AWDA 2BS4B 2KWCA 1X9WA 3SV3A 2W3RA 5KT3A 1C4AA 4DFMA 8ICVA 4ECSA 2DX5B 4GDLA 2NO5A 4NL9C 2UVWA 1WXVA 4RQ0A 2ZJDA 1NK9A 4B0EA 1FFVA 4RZRA 5HFYA 1BPBA 5IOIA 2A5UA 1S76D 1B22A 1BPDA 2BQQA 4DFPA 1TKEA 4R64A 1IGCA 2FIDA 2N7JA 4CNQA 3U8ZA 3ZNGC 4ECWA 3HILA 2YY6A 3C23A 5KFPA 4M0WA 4MM3A 4NL9A 1ZD2P 5DG8A 2D3AA 4ZRQA 2FPMA 3N3KB 2FCQA 3PW7A 2ASQA 1ET9A 2PI5A 2XCAA 3OHAA 2BCVA 3RRGA 2IO1B 1UUPA 3RJFA 3H9DA 1HZ5A 2KVZA 3A9KA 3DBSA 2RMMA 8ICUA 4J9MA 2HCFA 3PW0A 3CIRB 3M9NB 2D6FC 4I28A 2LGDA 3NZ3A 2BHNA 4GC6A 5AKIA 1ZDXA 3FKYA 3RH6A 3H8WA 4TURA 5T14A 4YR2A 5AM4A 3RB0A 4Y2TA 1KEJA 5IIJA 5DQGA 1RFKA 3VTWA 4DL5A 3DVNV 3GIJA 1M4VA 3VH3B 3BIID 4O3SA 3GB1A 4K3CA 5JH5C 5HMMA 4S0RA 2CJNA 4F3OA 3NZUA 3DEEA 4NJ8A 4PJ0U 4RQNA 5J2BA 5D46A 3PPAA 4K3BA 2MSED 4DQIA 2JZ3B 2HVIA 9ICEA 5EWEA 1JWUD 2JXJA 4OZAA 1ROEA 1C7YA 4F5NA 5BMIA 9ICFA 2AQ2B 5DQIA 3TADC 5KFOA 3WK8A 2MCNB 5AKGA 3DVGY 5E79U 1ZKHA 1WWUA 1SIFA 2JZPA 4MHVA 3SMVA 4UAUA 2KXJA 5G5GA 1JI7A 3EZ5A 3DBHB 1H4RA 2WXNA 5B66U 4MGYE 2NO4A 3IVFA 2J6TA 3ZLZA 7ICPA 5IN7A 4KLSA 1IPGA 3TJPA 1K52A 4YSXB 2FLPA 5ALGA 1UA0A 1KLUD 3DBHI 3IDWA 3D2SA 4W9KA 2K22A 4Z6DA 1M94A 4I2CA 3SD5A 1F52A 3L08A 3O13A 2DWQA 4TQ0A 1TZ1A 5AIBA 4JL9A 3CWIA 4G0NB 3BK2A 5J29A 3U30A 1SXEA 2R8GA 3IAS1 2KANA 1GG3A 1Z5SB 2KZ3A 4DOCA 2ZTCA 2K60A 4BKTA 3SAFA 1MSWD 3FC4A 3P4SB 4W9EA 2NS5A 1HUZA 2ZJ8A 2MU2A 4ICUA 1E7PB 2KTQA 2X38A 2KMCA 5D4BA 4C0ZA 2KJ8A 4II2B 1I35A 5AM3A 1OW5A 3WKAA 1UGJA 1EUVB 2RHFA 2M0AA 3ZJTA 4R8UB 2LYHA 3TAQA 3I5JC 1L6NA 2LMCA 2EZXA 4GXJA 3QEBZ 2WWZA 1VCBA 1KFSA 3RR8A 2J6SA 4KLIA 2ZJAA 2GBKA 4GFJA 3H8HA 3N28A 2W7PA 4Z6CA 1I4RA 1H38A 2V3PA 2K8BA 3FILB 2C2DA 2L83A 1WE6A 2MP2B 4DSEA 4ED1A 3Q8KA 5JHAA 3QUQA 3Q14C 3C0RB 1L7PA 1VZ8A 5HI1A 3JYUA 2JSVX 1SV0A 1SE2A 3Q3MC 2MRLA 5IIKA 5L1KA 3DBRI 1F2RI 4B0MA 1I7HA 5EOZA 2OJWA 2AQ3B 3M6ZA 5ALJA 1Z19A 4EKUA 5DG9A 5ALMA 2O6VA 4QZCA 2QIEB 1V1PA 2XNAC 4B9KA 1XQQA 4LZDA 1WGDA 3C2LA 3MGHA 2BPFA 5D2MB 3T5JA 5GTIU 4WJNA 2K6QA 5J2CA 1SE3A 2AL3A 2KZMA 3RI7C 2F8LA 1WCNA 5DGAA 2FE8A 4MSQB 3VRBB 4FJZA 4GIBA 1N60A 2N9EB 1UWMA 2M19A 3V61A 2D8CA 4DHJB 4RNMA 2NRTA 5KFNA 2E5SA 1HZ6A 1X40A 1E6EB 2WTFA 4I29A 3B0AA 1L3TA 2HDEA 3JSVA 1WUDA 1XC9A 1GNUA 4BZAA 5KFWA 4J9RA 1QQ6A 3RH4A 3VUWA 2OEHA 1Q3VA 2ZW0A 4GMVA 4CCHA 8ICOA 1OGWA 2KFKA 1XU4A 2MAXA 4IQWA 1ENFA 1XT9B 1ZP0B 1URJA 3C29A 1S3SG 2FIFA 5KFGA 2KD0A 2V3SA 1EF5A 1F44A 5G2NA 4ZHOA 3AE6B 5T8IA 3RZWC 3AEEB 5HNKA 2LRUA 4KKIA 3ZTCA 2G9HD 2BB6A 3AE4B 1TVAA 1L7YA 4C4RA 1IP9A 3Q8BA 2KFNA 4UW9A 3AN1A 1XLQA 4M6WA 4BVUC 3ZTDA 2W9NA 4GGQA 3WKCA 3RTVA 5J0QA 3LJ3A 3F2DA 3ENEA 3Q6BA 1UT8A 2OOBB 1DOQA 3KHHA 9ICOA 2L0TA 1KOTA 2N4FA 4MEMA 3PW5A 3DOWA 3H40A 1RM6C 2H3ZA 2OHFA 3M9OB 3V72A 1ZQMA 1WM2A 5JUMA 2QB0B 4UQGA 5KTQA 3A9KB 5D3IB 3QZ7A 3N7SC 5TR5A 2ZUDA 3ICXA 1JQ4A 5IIIA 2ESEA 2VZKB 2DQNB 1SL0A 4F5OA 4C4TA 3KZIU 1E10A 1S8OA 2KO3A 1WM3A 5AM0A 4YSZB 4PT5A 3ZNZB 1YIWA 3QX1A 4MGIE 1ZDVA 3ZIMA 4C8NA 2IHNA 3WAPA 1OEYJ 1CI4A 4YL8A 2WXOA 3RD2A 3F5AA 3V7LA 2V4RA 1TS3A 3AU6A 4EZKA 4RGMA 4KSKC 3LVVA 1YX6B 1WR6E 2WX1A 3ETLA 3T79A 3IM1A 2ZNVC 1TS5A 1SL2A 3A1QA 3QU4A 2KHWB 1TIFA 3PZPA 4C4SA 1N6ZA 2RR9A 4UB1A 2MW5A 2BVCA 3WKBA 3U7ZA 3TFSA 3DPDA 1NJYA 3NASA 1TS2A 1V6EA 1MN8A 4TQSA 4XDDA 1LVHA 2MUTB 2CXYA 2ZIWB 2UWQA 2VH2A 2LM4A 2XBBC 3UQ0A 2WF9A 1P7DA 1JMLA 2C7MB 2EMTA 4MFCA 1ZRNA 4M9HA 3DWMA 5IO9A 2Y3AA 2MLBA 1N63A 4EZLA 1T8EA 1JUDA 3Q8QB 1NKCA 1LM8B 3PS6A 5KFMA 4PHPA 2K0PA 2W8LA 2CU3A 3GV5B 2IDYA 1ZPSA 3C19A 4DBGA 5AZHA 5KNIA 1SWVA 2QKQA 4P16A 4PS8A 2F44A 2LBOA 1X9SA 4MEXA 4MJSB 2ZUBA 2A4ZA 3VHTC 4P4PA 3UMBA 3ZYYX 1NK6A 2PTLA 4C56C 2JHDA 3IHQB 4RF1A 4WQOB 4YTPB 2E8MA 2KD1A 1UELA 2LVPA 4W9CA 3EUB2 1B43A 5L1IA 4GN1A 5KT7A 2FUG1 2KVSA 1DOYA 4QZBA 4CGZA 2FCSA 2KWDA 3DBRB 1WXMA 1J7AA 4IWPA 2N9KA 3RB3A 3Q8RB 2R8HA 5J0SA 2IGDA 4KX5A
chains in the Genus database with same CATH topology
4KX6B 1FNVA 3P42A 1K50A 2NTSA 1JALA 4MH8A 4A6QA 2BBCA 1ZE3D 2DYOA 5C2TB 3NVVA 1EU3A 4RGTA 4HKQA 4WIPA 1L5PA 1EWCA 3MFGA 4N59A 1FO4A 3ZGZA 4KGRA 2GRIA 1D6EC 1IGDA 2J53A 3BVZA 3VQIA 1FD6A 3UI3A 2JU6X 4RH6A 1TS4A 1HXYD 1YN3A 2LGIA 3BYYB 3NRZA 2Y5CA 1QILA 1SSNA 2GI9A 2W82A 2BW2A 1GOZA 1SF0A 3W5VB 1WYGA 3V05A 2WDVB 3ETRA 2INPE 4IDIA 4OZCA 1B1ZA 1HA5A 4ZYSA 3RPFC 3AE2B 2WQYB 4XWWA 3RFZB 3P4RB 1D5XC 3BWUD 1DGJA 3W2DA 3U2SC 5C3JB 1D5MC 1YJJA 1QF6A 1BXTA 2PVOD 2WXLA 1I4QA 3AE5B 2BTEA 3PZ7A 1V97A 4L1BA 2H89B 2BS2B 4MT5A 2NTTA 4ARCA 3U7ZA 2ON8A 2PKOA 3R2IA 2BYTA 1RWSA 4MM3B 2WNMA 2W55A 1PFDA 4R3DA 2DBYA 4L2YA 3NVYA 1JCKB 1N5XA 2SAKA 5TSSA 2ZW1A 2H88B 5AUKA 2PLPA 3Q8AA 2D5GA 1UWXA 1XXGA 3URYA 1TY0A 1PUTA 2YEPB 4YT0B 2BT6A 2WXHA 4C80A 1YNTE 2J52A 2WXPA 3EA6A 4IKGA 5MPOA 3TEWA 5D3DA 1OQQA 3VR8B 2INNE 1TKYA 1C9FA 4A8XC 1NYQA 1KH0A 2PVGC 1J7CA 4CQNA 1YN5A 3P63A 2WXRA 2JQRB 4L23A 1XLNA 2PIAA 4HKZE 2IPKD 1JWAD 1T5XD 4USAA 4NAMA 1D5ZC 1SJHD 4RGNA 2GB1A 1FXIA 4YTMB 4HRSA 2TSSA 1WRIA 1NENB 1XCQL 1XO3A 4P6VF 4YXDB 2AX5A 2M56B 1SIJA 3P4PB 1PYWD 2WXMA 4US9A 1VRAB 1QOAA 2QSDA 3EGRA 3GS2A 5BYQA 4RFBA 4OHJA 5FR3A 3SFDB 3V3XA 1KRHA 2I2YA 1SEBD 2JYTA 4OW0A 1NVID 2RDHA 3AM9A 1Q10A 3IT4B 2OEDA 3AH7A 3IXSA 2JX5A 1SXTA 4GDLB 1OQRA 4WQMA 2WXIA 1YJIA 2LEKA 5EE1A 1I4XA 2FBWB 3T3NA 5BYSA 2Z8LA 1D4BA 1L0VB 2EELA 2WXQA 1XEEA 1AN8A 4HROA 1QKZA 3NVZA 1AWDA 2BS4B 2KAJA 5BMHA 2W3RA 1F2RC 1C4AA 2BS3B 1DOIA 3NUHB 1YQ4B 4B0EA 1FCCC 2Q5WD 3WCQA 1A70A 1FFVA 1JROA 1CJEA 5HFYA 2KDMA 1JWMD 3NS1A 5LNK1 2PMVA 1I4GA 2MH7A 3AEFB 1TKEA 5HHDG 1I4PA 1IGCA 2N7JA 1GAQB 4WAFA 4YSYB 5FKAC 1TJEA 4M0WA 1VDVA 3MC0B 4ZRQA 1ET6A 3BVMA 5H92C 4N6EB 1YN4A 1XLOA 2WXKA 4NZLB 3AEGB 1ET9A 3OWEB 1K51A 2DLBA 3Q69A 3E9SA 5BMGA 1UUPA 3LB8C 3J9CA 4JWUC 1HZ5A 2R61A 5EE0A 2RMMA 3HRDD 4TMAB 2G1EA 4WURA 3CIRB 3NZ3A 2B76B 1XLPA 2LUMA 1FXAA 1ZDXA 1WSPA 2J4XA 4JX1C 1QT9A 1GB1A 2YEPF 1KF6B 3HUIA 3U52E 2SEBD 3AE1B 1FEHA 4OZBA 1FRDA 1RFKA 1K53A 1M4VA 2K3UA 1VZ7A 1V1OA 4NJCA 3BIID 3HVDA 3GB1A 3L4PA 1IUEA 4H2AA 2CJNA 3VRAB 1MHXA 1STEA 4JE3B 4IOIE 3SR6A 1HEZE 3T3OA 1P7FA 1JWUD 2WXFA 1WWTA 4J3OD 4OZAA 1T3QA 3VR9B 1ROEA 4MACA 3W9CB 3AV8A 4Q2JA 5BMIA 2NMQA 1MVKA 5H8YE 4AQ7A 2AQ2B 3ABVB 1CZPA 3AB5A 4OVZA 2JZPA 1C4CA 3IAM1 3NVWA 1KFYB 3PO0A 5G5GA 3KLSX 1ACCA 2BB5A 2WXNA 5G5HA 1ZXIA 2WDRB 2LHEA 1SJED 4D2KA 3BK1A 4US8A 1K52A 4YSXB 1PDXA 1KLUD 2HTME 3LXFA 3ZJUA 1YMHE 3AE9B 2K22A 1ESFA 4A9AA 2AQ1B 2LJIA 3O13A 3DWGC 2DWQA 4TQ0A 1FNUA 2KQ4X 1ZXHA 3CWIA 1DYQA 1AYFA 3AE8B 2RDGA 3BK2A 3IT6B 3MHZA 1V8CA 3IAS1 2ONQA 1IBXA 1JRPA 1CK1A 2WDQB 4YTNB 4A90A 3KWLA 3FC4A 3GP7A 3I57A 2Y5PA 2WS3B 3P4SB 4EE2A 1E7PB 2X38A 3FILA 4ITKA 1VZ6A 1L6VA 1UGJA 1JWBD 1SB3C 1VJKA 2IGHA 2M0AA 4A55A 3ZJTA 4RF0A 1TZOA 4RNAA 5D7GA 1FCLA 1EU4A 2LMCA 1FM0D 1DOXA 3C8YA 2MJDA 2W54A 2MEKA 1L4ZB 3TEYA 2I38A 3Q8EA 3W1SA 4REZA 3MP9A 2E3TA 3R8BA 3H8HA 1I4RA 3HVZA 2V3PA 3B2GA 2LFIA 3FILB 2L83A 3TEZA 3SFEB 1Y56A 1VZ8A 5HI1A 4DQOC 2JSVX 1MHHE 1SE2A 3AEAB 1F2RI 4B0MA 3AMZA 1I7HA 4AS1A 1R7SA 1WXQA 2WXGA 1SE4A 2AQ3B 2WXJA 1EM7A 2L1AA 2QIEB 2W3SA 1V1PA 2XNAC 4GDKB 3LYYA 3AE3B 4ZOHC 1L0XB 1SE3A 3W5UB 1LO5D 1JW9D 1TY2A 2E6XA 2FE8A 3VRBB 1N60A 1L0YB 1NI3A 1UWMA 2M19A 2QMTA 1HZ6A 2QEJC 1FFUA 1E6EB 1MI0A 2V0GA 3Q8FA 1QQRA 2HDEA 2KMMA 2RPVA 1P7EA 4HEA1 1VR9A 4KKJA 4N58A 3FAHA 1PGAA 2ZW0A 3KQ4A 1FIQA 1SBBB 1ENFA 1ZP0B 1N61A 1F0ZA 4ZHOA 2KACA 1E0ZA 3AE7B 1AW7A 5I4DA 3AE6B 5T8IA 1B9RA 3AEEB 4KKIA 2G9HD 2BB6A 3AE4B 5FK9C 3BYTB 1L6UA 3Q8BA 1MPEA 3ZQ4A 3AN1A 1F77A 1I4HA 1XLQA 2J42A 4XWTA 2XN9C 5HG2A 1GPXA 1GB4A 4FXCA 2PW9A 2DYMA 3KWVA 1RM6C 1FRRA 2OHFA 1C79A 4ARIA 5D3IB 4LTUA 2EKIA 1HQRD 1OFFA 1C4PA 1FNWA 2L52A 3I9V1 3N9YC 1QOGA 1JQ4A 1FMAD 2V3NA 2VZKB 1UNSA 2ACZB 2CJOA 5BYRA 2IJ0A 1E10A 4LLGM 2N0SB 4YSZB 4PT5A 1QOBA 2JWUA 1ZDVA 5EE9A 5AUIA 2MJ3A 2QJLA 4NAWB 2WP9B 3SEBA 2WXOA 1E9MA 2JYEA 1TS3A 4RGMA 4DXGA 3ZJVA 2LHDA 1C77A 3BVGA 1TS5A 4UDUC 3TSSA 4TQ1A 1VLBA 3P1MA 5EE3A 5GXGB 2N9LA 2WU2B 1J7BA 3MJ5A 4XDCA 1T6BX 3B9JA 1QLBB 3AEBB 4YWGG 1JWSD 1XF5L 3BZDB 1NYRA 1TS2A 4C7YA 1XCTL 4XDDA 4KGTA 2JXTA 3Q8CA 4GLSC 1JMLA 4DXFA 2IGGA 1QOFA 2ICIA 3R2TA 3DWMA 2MJEA 2Y3AA 1WGKA 3TEXA 1N63A 1BUIC 1V1PB 4XE0A 2VZKD 5JXVA 4JWSC 4KGSA 3TUOA 1PGXA 2WLBA 2WU5B 2K0PA 1EWYC 2K5PA 4ZHPA 1BMLC 2CU3A 2IDYA 1ZPSA 2K9XA 2QILA 1C76A 3PZ8A 4P16A 2L32A 4TSSA 4LK0M 3P4QB 3AECB 1IBXB 1ZOYB 3U4EG 1NEKB 3ZYYX 1YQ3B 2PTLA 4C56C 4O1NA 1CQVA 4RF1A 4YTPB 1TKGA 4RGOS 3EUB2 1N5WA 2FUG1 1DOYA 5E6JA 3AEDB 1N62A 1KTKA 2KWDA 2V4IB 3E56A 1J7AA 1PGBA 4RCOA 4ZRPA 2N9KA 3B2FA 1C78A 1RYJA 1TYGB 4HJGE 4JPSA 2KN4A 4WWMA 2IGDA 1L4DB 4C7ZA 1KLGD 4WH4A 1ZUD2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KX6 B;  1L6U A;  1JAL A;  5G5H A;  1ZXI A;  2WDR B;  1NVI D;  5C2T B;  3AN1 A;  3AM9 A;  3NVV A;  1XLQ A;  4US8 A;  4YSX B;  1PDX A;  1L5P A;  2HTM E;  4N59 A;  3LXF A;  1FO4 A;  3AH7 A;  2JX5 A;  3AE9 B;  2K22 A;  1GPX A;  4FXC A;  4A9A A;  1OQR A;  3DWG C;  2DWQ A;  4WQM A;  3CWI A;  1AYF A;  1RM6 C;  1FRR A;  2OHF A;  1YJI A;  2LEK A;  3AE8 B;  4LTU A;  3NRZ A;  2EKI A;  1OFF A;  2L52 A;  2Y5C A;  5EE1 A;  1V8C A;  2FBW B;  1JRP A;  2WDQ B;  4YTN B;  3KWL A;  1QOG A;  1JQ4 A;  1L0V B;  3FC4 A;  1FMA D;  1SF0 A;  2WS3 B;  3P4S B;  3W5V B;  1WYG A;  4HRO A;  1E7P B;  2ACZ B;  3NVZ A;  1AWD A;  2CJO A;  2BS4 B;  4ITK A;  1E10 A;  2KAJ A;  2N0S B;  2WDV B;  2W3R A;  3ETR A;  2BS3 B;  1DOI A;  1L6V A;  4IDI A;  1YQ4 B;  1JWB D;  1SB3 C;  1VJK A;  4YSZ B;  1QOB A;  5EE9 A;  5AUI A;  3RPF C;  2MJ3 A;  3AE2 B;  2Q5W D;  2QJL A;  1A70 A;  2WP9 B;  1FFV A;  2WQY B;  1JRO A;  1CJE A;  1E9M A;  3WCQ A;  1FM0 D;  3P4R B;  1DOX A;  3NS1 A;  2MJD A;  2W54 A;  1DGJ A;  2MH7 A;  5C3J B;  3AEF B;  1YJJ A;  1QF6 A;  1TKE A;  2PVO D;  3AE5 B;  1V97 A;  2H89 B;  2BS2 B;  1GAQ B;  1VLB A;  3P1M A;  4YSY B;  1TJE A;  5EE3 A;  5GXG B;  2PKO A;  2E3T A;  2WU2 B;  1VDV A;  1J7B A;  3B9J A;  1RWS A;  1QLB B;  3HVZ A;  3AEB B;  4N6E B;  5H92 C;  1XLO A;  3B2G A;  2W55 A;  2L83 A;  1PFD A;  3AEG B;  2DBY A;  3NVY A;  1NYR A;  3SFE B;  1N5X A;  4C7Y A;  2H88 B;  3LB8 C;  5AUK A;  4JWU C;  1PUT A;  5EE0 A;  4YT0 B;  3HRD D;  1QOF A;  2BT6 A;  3AEA B;  2G1E A;  4C80 A;  3AMZ A;  1I7H A;  2MJE A;  1R7S A;  1WXQ A;  3CIR B;  3DWM A;  2B76 B;  1WGK A;  1XLP A;  1N63 A;  5MPO A;  1FXA A;  2QIE B;  1OQQ A;  4JWS C;  4JX1 C;  1QT9 A;  2W3S A;  2WLB A;  3VR8 B;  2WU5 B;  1KF6 B;  2K5P A;  1EWY C;  4ZHP A;  3HUI A;  1TKY A;  2CU3 A;  3AE1 B;  2K9X A;  1FRD A;  1RFK A;  3AE3 B;  4ZOH C;  1NYQ A;  2PVG C;  3W5U B;  1J7C A;  3P63 A;  1JW9 D;  3BII D;  3VRB B;  3L4P A;  1IUE A;  1XLN A;  2JQR B;  1N60 A;  2CJN A;  2PIA A;  1NI3 A;  1UWM A;  2M19 A;  3AEC B;  1ZOY B;  3P4Q B;  1JWA D;  3VRA B;  1NEK B;  3SR6 A;  3ZYY X;  4USA A;  1FFU A;  1E6E B;  1YQ3 B;  4YTP B;  1FXI A;  2KMM A;  4YTM B;  4HRS A;  1TKG A;  1WWT A;  3VR9 B;  1T3Q A;  1WRI A;  1ROE A;  3EUB 2;  3FAH A;  1N5W A;  1NEN B;  3AV8 A;  1FIQ A;  1XO3 A;  4N58 A;  4P6V F;  3W9C B;  4YXD B;  1DOY A;  5H8Y E;  1ZP0 B;  2AX5 A;  3AED B;  1N61 A;  1SIJ A;  1N62 A;  2M56 B;  3P4P B;  1F0Z A;  3ABV B;  1CZP A;  3AE4 B;  1J7A A;  3AB5 A;  4US9 A;  4ZHO A;  1QOA A;  3AE7 B;  3B2F A;  1E0Z A;  1RYJ A;  1TYG B;  3AE6 B;  1B9R A;  3NVW A;  3SFD B;  3AEE B;  4WWM A;  1KFY B;  4C7Z A;  3PO0 A;  1KRH A;  1ZUD 2;  5G5G A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  2K89 A;  1FNV A;  5L1M A;  2NBU A;  5KL8 B;  5C2T B;  8ICG A;  2DYO A;  4BGD A;  1EU3 A;  4RGT A;  3OSN A;  3GIM A;  4P1C C;  4HKQ A;  4CE6 A;  1Z1B A;  3RJG A;  4QWA A;  5AI8 A;  2GRI A;  3PX4 A;  3SD7 A;  2NV3 A;  1D6E C;  2J53 A;  5KFX A;  3UI3 A;  4UAR A;  5J2R A;  3QQ8 B;  3RNB C;  4Y2S A;  3HPO A;  2OCE A;  2YX8 A;  1CUK A;  1ZQX A;  4XRH A;  2ASL A;  1UQV A;  2LVO A;  4W9J A;  3ZDA A;  1QIL A;  5AK4 A;  2GI9 A;  3F53 A;  2W82 A;  2IO3 B;  4IG7 B;  4KLQ A;  2VA8 A;  3DDH A;  2BKR B;  2LGS A;  4ANV A;  4NNJ B;  5KFV A;  1RRB A;  1UF0 A;  3UPQ A;  2KTF A;  5AI5 A;  4NQK E;  2KVC A;  2WDV B;  4ANX A;  3VFK A;  4OZC A;  2L5Y A;  1U45 A;  4XGA B;  2EQY A;  1HA5 A;  3DBL B;  3N4M B;  2WQY B;  3RNG C;  3MFI A;  3KKA A;  3P4R B;  3BWU D;  7ICQ A;  1DGJ A;  1P1A A;  1XD3 B;  5C3J B;  2K4E A;  2JEF A;  4M01 A;  3E0F A;  4L1B A;  4AP9 A;  2H89 B;  2BS2 B;  3Q8P B;  4ARC A;  1SWW A;  2ON8 A;  2C2E A;  1WMH B;  4YXJ A;  4PK1 A;  4KLJ A;  4QZA A;  3QWZ B;  7ICK A;  1U4B A;  3QAR A;  2W55 A;  4NY0 A;  2DBY A;  4L2Y A;  1HJP A;  4RQ5 A;  2Z0D B;  1JCK B;  4EYI B;  5F9L A;  3AL0 B;  1JXE A;  2ZW1 A;  4ECU A;  2D11 A;  2H88 B;  2BYE A;  2PLP A;  8ICH A;  1TY0 A;  3LYS A;  1E7U A;  2W8K A;  5A0L A;  1L3S A;  4I2E A;  3TCA A;  3ZDM C;  2NVU I;  4DLG A;  4BBN C;  2N7E A;  4IUM B;  3EA6 A;  5AK5 A;  4JWN A;  2A3V A;  3TEW A;  5IIN A;  5D3D A;  5AK3 A;  3Q8L A;  3UXO A;  2B3A A;  2KYW A;  2LKY A;  2KDI A;  2M4N A;  2CHX A;  4A8X C;  1AAR A;  2KX0 A;  4A8E A;  2G06 A;  3SYZ A;  3SU8 X;  2PVG C;  1KH0 A;  1J7C A;  4CQN A;  3P63 A;  5AIC A;  4DFD A;  5EWF A;  2WXR A;  2JQR B;  1XLN A;  2WHE A;  3ZD9 A;  1ZQS A;  4J9O A;  3D32 A;  5KT2 A;  8ICY A;  2HBM A;  3LVW A;  1JWA D;  5AKZ A;  1WJ4 A;  2CU1 A;  1KL9 A;  2IO0 B;  1FEZ A;  2ZCC A;  2BGW A;  2EDU A;  2F77 X;  5AM1 A;  3HHM A;  3PV1 A;  3M6K A;  1XO3 A;  3KW5 B;  2HOI A;  2AX5 A;  3C28 A;  4PS3 A;  3KHR A;  4KLM A;  2WXM A;  3T3F A;  1RXW A;  1E8Y A;  3TAN A;  4OHJ A;  5LXH A;  2W03 A;  4Y2Q A;  4EEN A;  3GV8 B;  3R9K A;  2HBJ A;  2KZZ A;  1R4M I;  5HHH A;  2RDH A;  4LZG A;  3AM9 A;  2H5X A;  3L10 B;  2EAP A;  9ICP A;  4FHJ A;  1WF9 A;  2JEI A;  4HAI A;  4FJV B;  5J17 A;  2IMW P;  3WAL A;  3IXS A;  2NRV A;  3PRM B;  1S0V A;  4YMN A;  3PMN A;  2BPS A;  1XSL A;  1Y8R C;  4MGZ E;  1MA7 A;  2OH2 A;  2M0N A;  1F9J A;  4BXO A;  1YJI A;  3KUD B;  2OYY A;  4TUU A;  3GDX A;  4TQR A;  5CB1 A;  3NY5 A;  5CEH A;  3LDA A;  5J2F A;  2Y0S C;  4EX6 A;  3I63 C;  1WCL A;  4NY8 A;  2FE9 A;  5C5J A;  4F4K A;  1XEE A;  4PL1 A;  3RH5 A;  2DFL A;  3TAC B;  1V49 A;  2ISO A;  2JPH A;  3D2Q A;  3NVZ A;  9ICM A;  1UH6 A;  4F92 B;  3BDP A;  3HW8 A;  5IIM A;  2ES6 A;  1DOI A;  2BS3 B;  1SKS A;  1YQ4 B;  1J0G A;  5KG5 A;  2DZJ A;  1Q0W B;  4I2D A;  3WK9 A;  4EYH B;  8ICK A;  1A70 A;  5HKH A;  2PFP A;  9ICL A;  5L1L A;  3WKD A;  1JWM D;  2KDM A;  3GZN I;  5LNK 1;  2QCZ A;  4F7Z A;  2GLS A;  5ALR A;  2H3I A;  2K25 A;  1NOM A;  3ONN A;  1OQY A;  4JWM A;  2NRX A;  2DPJ A;  1IG6 A;  4YSY B;  2V4Q A;  5FKA C;  3Q2A C;  3MC0 B;  2QLT A;  1WI0 A;  4PH5 A;  5H92 C;  4DOA A;  2N9X A;  4OJ5 A;  4OJP A;  4HPL B;  1JN3 A;  4NZL B;  3AEG B;  8ICW A;  3VC8 A;  1NK8 A;  3EPG A;  1K51 A;  3E9S A;  5BMG A;  4WWO A;  5DBC A;  2KC2 A;  2AQ4 A;  4NLN A;  4JWU C;  5DB9 A;  1TAU A;  2R61 A;  4IM3 A;  3RZF A;  5DG7 A;  2R2O A;  1DGS A;  1BPY A;  4DSI A;  2NCN A;  2G1E A;  3PR4 A;  4WUR A;  2H3V A;  2B76 B;  1XLP A;  3TQ1 A;  4YQW A;  1L8L A;  3OPX A;  1FXA A;  1GB1 A;  4F4X A;  4ELT A;  4DOB A;  5KT5 A;  4QWC A;  3KOO A;  3N20 C;  5TIS U;  3G6Y A;  4F4Z A;  1DK2 A;  1FRD A;  4TUS A;  4YR0 A;  4DDI D;  4FAD A;  3E2E A;  2BCU A;  2KC1 A;  1KLV A;  2K4P A;  4YMM A;  4DO9 A;  1MG8 A;  4EEK A;  3VRA B;  1MHX A;  5IIL A;  5KHQ A;  1KLN A;  2WF8 A;  4B9U A;  2XCP A;  4IRC A;  1HEZ E;  3T3O A;  3DVN U;  5ALZ A;  3M9M B;  1D8L A;  3C2M A;  1WWT A;  2WXF A;  4HYK A;  1WZ0 A;  5L95 C;  3GQC A;  4KLO A;  3AV8 A;  2KWV B;  2NMQ A;  5H8Y E;  3BQ2 A;  2KFK B;  2ATL A;  3AB5 A;  4FLH A;  5EWG A;  2G3Q B;  4FHK A;  1C4C A;  3NVW A;  4C8O A;  1WX9 A;  2FCN A;  1KFY B;  4IR9 A;  4MH0 E;  4K7S A;  1SGH A;  1ZXI A;  2WDR B;  1WRD B;  2KQ7 A;  4WAA A;  3TKA A;  1Z1V A;  4MDK E;  3RBD A;  1PDX A;  2HTM E;  1YX5 B;  3LXF A;  4XUS A;  2K1F A;  4PL2 A;  4LDT B;  4A9A A;  2MHJ A;  2A1J A;  1NJX A;  3DWG C;  1ZQH A;  4FN2 A;  2KQ4 X;  4M9J A;  1DYQ A;  4Y2P A;  3AE8 B;  2RDG A;  4EZJ A;  4YCX A;  3KVF B;  3MHZ A;  5KFE A;  2G07 A;  4ECY A;  3RJK A;  9ICQ A;  4KZ0 A;  1K5O A;  1CK1 A;  4YTN B;  3MDC A;  4M00 A;  4A90 A;  5DDY A;  1TBE A;  3UIP B;  4UAT A;  1SXD A;  5H2F U;  2D3C A;  1WJ6 A;  2C28 A;  4HJK A;  3PVX A;  3RB6 A;  4DEZ A;  9ICS A;  1L6V A;  4ECQ A;  1SB3 C;  4YG2 A;  2E8N A;  4RF0 A;  3W1Y A;  4P1B C;  1EU4 A;  4G9B A;  1HEK A;  2H3Q A;  9ICW A;  4KDI C;  1FM0 D;  1DOX A;  2M9N A;  2W54 A;  2MEK A;  4P7I A;  3OJS A;  1JMS A;  2LJ5 A;  3QE9 Y;  1L4Z B;  3RF9 A;  3H7P A;  4Y2Y A;  4M0A A;  3TEY A;  3RJE A;  8ICJ A;  4LJX A;  5HR7 A;  4O3M A;  1K1S A;  4NM1 A;  2G0A A;  1LGR A;  3A1Q B;  3SI8 A;  4BOZ B;  4RQ8 A;  3HVZ A;  2KE7 A;  1ZQG A;  3PNC A;  3MGV A;  1WGG A;  1NK7 A;  3SHQ A;  5J0U A;  4OVV A;  2V9W A;  3AQE A;  7ICT A;  1QQ5 A;  1PVQ A;  1MHH E;  3HM3 A;  4TV3 A;  4MF8 A;  3N97 B;  3AEA B;  4ANW A;  1UZX B;  3CRX A;  1R7S A;  1WXQ A;  2O6V D;  2LMR A;  4O9M A;  3NTU A;  4UB6 U;  2WXG A;  1X42 A;  4JUZ A;  4CF4 A;  3RYT A;  5AKY A;  2HJ1 A;  3N30 A;  2F76 X;  2KJH B;  3LYY A;  1UBQ A;  3QEA Z;  3SZ2 A;  3H4D A;  3AE3 B;  1L0X B;  1MFW A;  3W5U B;  3N7R C;  1GC7 A;  1JW9 D;  1TY2 A;  2YTU A;  4F5Q A;  4UAV A;  2KKP A;  4M04 A;  3L5K A;  1IM4 A;  2E6X A;  1NDD A;  4OO1 J;  2HD5 B;  5CHW A;  3PSF A;  5ALW A;  4YD2 A;  4AYB F;  1XSN A;  3ZKJ C;  2QEJ C;  4FS1 A;  1MI0 A;  4LJO B;  2V0G A;  3Q8F A;  2VAN A;  1A6S A;  1QQR A;  2R18 A;  1DRG A;  2KMM A;  3QUT A;  2RPV A;  2HW3 A;  1L5U A;  4I27 A;  1VR9 A;  4RM8 A;  3RNC C;  4XZ4 A;  4PZN A;  2YMP A;  8ICS A;  1SBB B;  1WGH A;  3KQ4 A;  1A76 A;  1Q8K A;  3MR3 A;  2MSN A;  1BNP A;  5KT4 A;  4PS7 A;  3R7R A;  1AW7 A;  4XC2 A;  3ECI A;  2BYV E;  3PRE A;  5I4D A;  4PHD A;  2ZZP B;  4ECV A;  4EZ9 A;  3L54 A;  5J2I A;  2UVU A;  5C0Y A;  3N1Y C;  3PO5 A;  3T8M A;  2INC C;  2KQS A;  3ZQ4 A;  1F77 A;  3PRP B;  3V6C B;  4XWT A;  4MF2 A;  2WB1 F;  2JUO A;  3DHI C;  5J2G A;  4FXC A;  2J0J A;  3UIO B;  1GB4 A;  5ALD A;  5AKK A;  4YFK A;  1DXS A;  3VCB A;  1NJW A;  4TKN A;  3LWM A;  3MC1 A;  4WWN A;  2VRR B;  3NJT A;  1NK5 A;  1C79 A;  3PHX B;  3PX0 A;  4LTU A;  2EKI A;  3KHL A;  1S0M A;  1OFF A;  2L52 A;  3PV8 A;  4U7C A;  4F2R A;  2GBR A;  2Y5B B;  4GLX A;  2I1J A;  1FMA D;  2V3N A;  1ZQF A;  1UNS A;  5CRX A;  5KG1 A;  1TFR A;  1MG4 A;  4M6W B;  8ICB A;  1TE2 A;  2JEJ A;  2ACZ B;  2BCS A;  8ICR A;  1WH3 A;  2IJ0 A;  4LLG M;  4BKG A;  3ZNI D;  2F8K A;  4ACO A;  4J9L A;  2E1F A;  3TMP B;  2GOL A;  3NS8 A;  1DK3 A;  2WP9 B;  1Z4O A;  3MAB A;  2L76 A;  2RQ5 A;  2D2Q A;  2W9M A;  1ZJM A;  1I42 A;  2JEG A;  1ZOL A;  3DHG C;  4QWD A;  1Q1O A;  3ZJV A;  4ELV A;  1C77 A;  2KK8 A;  2G08 A;  4UDU C;  4TQ1 A;  5EE3 A;  4KIT B;  3Q8S B;  2WU2 B;  2EAO A;  2CRX A;  2PEA A;  2ZIU B;  3BS5 B;  4J03 A;  1T6B X;  1YD8 U;  1WE7 A;  3AEB B;  3U7D A;  1QLN A;  2V1Y A;  3OTQ A;  4J9S A;  4MSM B;  3V6K A;  3BZD B;  5J0R A;  1SGG A;  5ALL A;  2C5L C;  1XCT L;  3QU2 A;  2DYB A;  1LFD A;  3Q8C A;  3M7D A;  3BY4 B;  4HPM B;  2D3B A;  3A4R A;  4DQS A;  1YQB A;  4LCD E;  4KLT A;  1WMH A;  3OG5 A;  3G6V A;  2YB4 A;  3NG0 A;  1BUI C;  2FUH B;  3NUQ A;  4J6I A;  5ALU A;  4KLU A;  3B0Y A;  4KGS A;  1PGX A;  5CJ7 A;  1RDF A;  2K5P A;  2VKQ A;  4RM9 A;  4GXK A;  1V2Y A;  2KJ5 A;  2HOF A;  2PFQ A;  3PZ8 A;  2KK0 A;  2MA9 B;  4IWO A;  4YR3 A;  4NM2 A;  2QB1 A;  4PGQ A;  2ZCB A;  4LNO A;  3H8S A;  4LK0 M;  4QZI A;  1IBX B;  2LZ6 A;  3CST A;  3ORY A;  2BCR A;  2IO2 B;  3DVG X;  4BKS D;  5BPC A;  4DQR A;  1U47 A;  3TAR A;  3QU9 A;  3HWT A;  1TKG A;  4ZRK A;  1Q3U A;  5CHV C;  1QTM A;  2UVR A;  2D07 B;  4RGO S;  5JZE B;  4P0P B;  5J8Y C;  1X1M A;  1N62 A;  2KFZ A;  2V4I B;  4UB8 U;  4ZRP A;  2J7Q B;  2LI5 A;  3QC8 B;  4BFR A;  1RYJ A;  5ALT A;  1ZQJ A;  4I2A A;  2L0F A;  4ACF A;  4M47 A;  1L4D B;  4RQM A;  4WH4 A;  4ICA A;  9ICU A;  5GMV A;  4MH8 A;  1N56 A;  5KAF U;  1EXN A;  5KFI A;  1KQQ A;  4W9H A;  5DLG A;  3S6J A;  4UB3 A;  4WIP A;  9ICK A;  1BGX T;  1EWC A;  4N59 A;  1FO4 A;  3NHE B;  1IBX A;  4DHJ D;  1IGD A;  2F3N A;  2MBQ A;  3QXG A;  4CHK A;  2B6G A;  2K39 A;  4OCZ A;  3UXN A;  3PGE A;  4PYU A;  4WJP A;  2JMG A;  1TS4 A;  2XY7 A;  3WAN A;  2DKZ A;  5KG2 A;  3I28 A;  3GII A;  1PK1 A;  3KFU F;  3ZXR A;  3QZ8 A;  3GFK B;  3EYZ A;  4I6P A;  3EW9 A;  2Y9U A;  2W9C A;  1NK4 A;  2LWP A;  1J97 A;  3M8R A;  3W5V B;  2W43 A;  1U48 A;  1XNS A;  4WWP A;  1VJ5 A;  3ISD A;  2ZG6 A;  1S0N A;  4W9G A;  4BKS A;  1ZET A;  4PGX A;  4IDI A;  1ZQI A;  4JGH B;  4BXO B;  1B1Z A;  2QC8 A;  4JLC A;  4RU9 A;  1UGM A;  3AE2 B;  4ZYS A;  4EUT A;  5IA7 A;  7ICS A;  3SDL C;  1ZQN A;  1EF1 A;  3W2D A;  2KKV A;  1QF6 A;  2PVO D;  4ED6 A;  3PZ7 A;  2GH1 A;  3DDC B;  1ZQQ A;  3KKA C;  4ED2 A;  2M17 A;  3B08 A;  3D2N A;  2LGY A;  4K7U A;  3ZNH B;  1GUA B;  1TKD A;  2WNM A;  3ZUN A;  4R3D A;  1OTR B;  2J0M A;  2SAK A;  4HXD A;  2W9B B;  4BWJ A;  2D5G A;  1UWX A;  1XXG A;  1H8C A;  2ODG A;  1QZE A;  5J2E A;  3RB4 A;  4F1S A;  2RLT A;  2BT6 A;  2WXH A;  4WJQ A;  1X66 A;  8ICT A;  1YZ7 A;  2M0X A;  1LXD A;  4MEL A;  1YNT E;  3PSE B;  5MPO A;  2KSO A;  1RQL A;  3AUO A;  4ZYN A;  3CP8 A;  2KHQ A;  2PFO A;  3VR8 B;  2Y1J A;  5DPS A;  1C9F A;  3M62 B;  5L1J A;  1PQS A;  5AI6 A;  3QYP A;  4AJY B;  4EFO A;  2WF5 A;  1K1Q A;  2B0C A;  3THV A;  1WJN A;  2AQ0 A;  1IIP A;  1V9P A;  3MR5 A;  3EPI A;  3AEV A;  3A9J B;  3WA0 A;  1D5Z C;  3M95 A;  4GXI A;  3RR7 A;  4UAY A;  1RYU A;  4MFA A;  2KJ9 A;  2GB1 A;  4HRS A;  3NGD A;  4QIW F;  3K1Z A;  3I1Y A;  5J0P A;  2R8K A;  2WFA A;  2P6R A;  2MA1 A;  2NRZ A;  4EBE A;  2D10 A;  5JU5 A;  4ED7 A;  2NBW B;  1Z00 B;  1V5O A;  2KTR A;  2V4L A;  1VRA B;  5AM2 A;  3K9P B;  3AU2 A;  3V7J A;  1NKE A;  5J2A A;  1JXL A;  3HT3 A;  3PW2 A;  7ICR A;  1F1H A;  3A0B U;  1KRH A;  4I2B A;  1V5T A;  4MFF A;  7ICE A;  2Z0E B;  3QHT A;  2HHQ A;  1JX4 A;  2KT7 A;  2HVH A;  5J0T A;  2O2V A;  3OAW A;  1RZT A;  3K1R B;  4FJY A;  1WFY A;  3L13 A;  4IQU A;  1Q10 A;  2ZIU A;  2K6D B;  3VUY A;  3APD A;  4DF8 A;  3IT4 B;  2GMI C;  5C23 A;  4W9L A;  1SXT A;  1ZJN A;  3A33 B;  4FO6 A;  4K4H A;  3MJW A;  4WQM A;  2RPQ A;  1GO3 F;  4JIO U;  3EFU A;  1I4X A;  2Y1I A;  1E7V A;  3BQ7 A;  1S0O A;  1YJ1 A;  2XID A;  2L05 A;  2EEL A;  1AN8 A;  4UB5 A;  2JF5 A;  1V81 A;  5ALE A;  1WIA A;  1PVR A;  1WJU A;  2A1J B;  2HMX A;  2FNJ B;  2KLG A;  1F2R C;  5BMH A;  1IXR A;  4B9V A;  3M1Y A;  2XK5 B;  3RNF C;  4F8R A;  5DB6 A;  3OLM D;  1FCC C;  2C2R A;  2Q5W D;  1CJE A;  3KBB A;  2MH7 A;  3MDA A;  1WY8 A;  4Y2U A;  7ICG A;  3UMG A;  4F71 A;  3EEC A;  4NPN A;  5HHD G;  4Z6E A;  1I4P A;  3GZN B;  4QZF A;  4Q8F A;  4B9T A;  3OJ3 A;  5J2D A;  1TJE A;  2DNF A;  4BX9 C;  2KOX A;  5CWR A;  2EKE C;  2UU7 A;  5KFA A;  4R8U A;  3AXC A;  4KSL C;  3JPP A;  1YN4 A;  1XLO A;  1HUO A;  4E0D A;  4LNF A;  4RPX A;  1TT5 B;  4DDG D;  2FI1 A;  4DQP A;  2DLB A;  4KLH A;  3Q69 A;  5HR6 A;  1WYW B;  2NYV A;  3LB8 C;  1JIH A;  4C4V B;  1S97 A;  5ALY A;  5EE0 A;  4TMA B;  2OM6 A;  3DCG A;  4Q43 A;  2L00 B;  2KN7 A;  3IV6 A;  2KSO B;  1V38 A;  2LUM A;  2KIW A;  5ALS A;  2X8X X;  4W9D A;  2VJ5 A;  1WSP A;  2J4X A;  1ARO P;  2KJR A;  4JX1 C;  1QT9 A;  2C9W B;  2F1I A;  2MP2 A;  3HUI A;  2QHO A;  1E5W A;  3U52 E;  3PO4 A;  1HE8 A;  1ZQV A;  1FEH A;  4OZB A;  3C21 A;  5CP2 A;  3C2K A;  3KYD D;  4I2G A;  1VZ7 A;  5JTI A;  1K8R B;  1V1O A;  2AYO B;  3M8S A;  4NJC A;  3CW2 C;  2DL0 A;  4FZM A;  4H2A A;  2DUY A;  2E8P A;  1STE A;  4JE3 B;  1L7M A;  2RD0 A;  4IOI E;  2KG5 A;  4RNN A;  3ZDB A;  3GIL A;  2RDB C;  1U4A A;  3BZC A;  3VR9 B;  5KG6 A;  5KG7 A;  1QSS A;  8ICA A;  3W9C B;  5IKC M;  4Q2J A;  5KFS A;  2W11 A;  1HTO A;  2JRZ A;  4AQ7 A;  5J18 A;  5AHX A;  4BWM A;  1KDH A;  5CTR C;  4OVZ A;  4IQT A;  2HOQ A;  2YB1 A;  3EFC A;  3U26 A;  2PMZ F;  2CN1 A;  1Z4N A;  3KLS X;  1VD2 A;  4E71 A;  3K75 D;  1V85 A;  3GE8 C;  1COO A;  2YN4 A;  3VAW A;  3VTV A;  2BKF A;  4D2K A;  4QZ8 A;  4URK A;  1LKY A;  2ZTD A;  3VUX A;  3AE9 B;  3QAQ A;  1ESF A;  1RPL A;  3KH0 A;  2AQ1 B;  2GOW A;  5KFT A;  1WGY A;  3WK4 A;  4DCC A;  4EX7 A;  1ZXH A;  2KVR A;  5J2J A;  1AYF A;  3IG3 A;  3IT6 B;  4OD0 A;  5K4L A;  2C60 A;  1V8C A;  5FP0 A;  3CF6 E;  2ONQ A;  1JRP A;  4WJ3 B;  1J8C A;  2WDQ B;  4Y2V A;  3KWL A;  1BPE A;  1ZQ1 C;  3GP7 A;  4EE2 A;  2WS3 B;  4KMU A;  1YZ6 A;  3FIL A;  4ITK A;  4A3O A;  1M6Y A;  1VZ6 A;  4GIV A;  2WAQ C;  4KV2 A;  3IG8 A;  1VJK A;  2CHW A;  2DZK A;  1FPY A;  2IGH A;  7ICF A;  1TZO A;  4A55 A;  4RQ1 A;  3M3J A;  2ZIX B;  3PT2 B;  4NAW A;  4JB3 A;  3C8Y A;  2MJD A;  8ICZ A;  5F3X B;  3UM9 A;  1LQB A;  3W1S A;  1S5L U;  4O5K A;  4S17 A;  2E3T A;  3R8B A;  3RJH A;  1J2M A;  3QUC A;  1QQ7 A;  3RRH A;  5AEK B;  3RJI A;  3B2G A;  2LFI A;  4QZH A;  3TEZ A;  1ZQZ A;  4KN4 A;  3SFE B;  3AU4 A;  2K8H A;  4ZDV A;  4DQO C;  2R8J A;  2KX3 A;  5KL1 B;  1CMX B;  3NOB A;  1BPX A;  8ICL A;  2EMS A;  3WK7 A;  4IRD A;  2EZY A;  1ZD4 A;  1EM7 A;  2L1A A;  5D6J B;  2W3S A;  2F1H A;  3A0H U;  2ZNV B;  5E6O A;  2MUT A;  2K8B B;  3APF A;  1SZH A;  4QJF B;  1S10 A;  1KBU A;  3HJE A;  3RAQ A;  3ZRF A;  1LO5 D;  4IM0 A;  4E3C A;  5ALI A;  4DL3 A;  4BBN F;  1L2N A;  2MQJ A;  1YOV B;  2ZIV B;  2LRW A;  2OJR A;  2QMT A;  4RMA A;  2JR5 A;  3HM6 X;  3RAX A;  4AP4 C;  4JV0 A;  2XY5 A;  3BQT A;  1P7E A;  4HEA 1;  4GB9 A;  4KKJ A;  4N58 A;  3IN5 A;  3FAH A;  1FIQ A;  2JH1 A;  4M02 A;  1F0Z A;  1N2X A;  2KAC A;  1NI2 A;  4RPY A;  3AE7 B;  2QB0 A;  1P98 A;  3ML9 A;  1E0Z A;  3CYM A;  3QA8 A;  1PUZ A;  2WDT B;  4QZD A;  5FK9 C;  5J0W A;  2AGQ A;  3BYT B;  1SV4 A;  4YP3 A;  1Y88 A;  3Q3F A;  2PXI A;  1V80 A;  2AGO A;  1P3Q U;  1ZQR A;  4IS7 A;  3SEN A;  2XN9 C;  5HG2 A;  2ZVO A;  3KZX A;  3Q3O C;  4FUL A;  5E6N A;  1GPX A;  2GO7 A;  2L8J A;  2K8C A;  2W7O A;  4DL6 A;  4I2H A;  2RP5 A;  3TFR A;  4NLK A;  3KWV A;  2G5H B;  1SZP A;  1BPZ A;  1FRR A;  1V86 A;  4C00 A;  3H4B A;  4ARI A;  4X57 B;  3UGB B;  1HQR D;  1C4P A;  1FNW A;  4IM2 A;  5KAI U;  4B9S A;  3AQF A;  3N9Y C;  4IL6 U;  2MBB B;  1OXJ A;  2JY6 A;  1D3Z A;  4I2I A;  5AM5 A;  2HI0 A;  2BKE A;  2IOF K;  1QOB A;  2JWU A;  4J9N A;  2EAN A;  2LD9 A;  4KMO B;  2KFJ A;  2MJ3 A;  1T4G A;  2QJL A;  4K1R B;  4NAW B;  1E9M A;  1D9D A;  1RQN A;  1KJT A;  4G11 A;  4EBD A;  2KJ6 A;  2O6K A;  2HHS A;  3BVG A;  5KFJ A;  1T3N A;  5KFZ A;  3TSS A;  3WK6 A;  1T0S C;  1MQ3 A;  3JPS A;  2N9L A;  5AK6 A;  3W1S C;  3B9J A;  3PML A;  1QLB B;  2JZB B;  3OJU A;  3LDZ E;  4YWG G;  1JWS D;  1NZP A;  4O3R A;  1XF5 L;  1NYR A;  4C7Y A;  3Q3J A;  1ZD5 A;  3UMC A;  2JXT A;  4DXF A;  4DSF A;  3RBE A;  1S77 D;  2DEN B;  2N7D A;  1ZW7 A;  4M9L A;  1QOF A;  8ICQ A;  3PSP A;  7ICV A;  5ALH A;  3H6N A;  1B4F A;  3R2T A;  3ZVV A;  1KN5 A;  4Y2R A;  1X2I A;  3NRW A;  2MJE A;  4O5E A;  3PLU A;  1WGK A;  4WJO A;  4XE0 A;  3H0M B;  2VZK D;  4QZ9 A;  2CHZ A;  2HBL A;  3HP6 A;  3VDZ A;  3JSV B;  2AU0 A;  1L3V A;  1EWY C;  3MR6 A;  4ZHP A;  1WWV A;  1UA1 A;  2IOF A;  2RRD A;  2K9X A;  1C76 A;  3DBL I;  2HHX A;  5L9X A;  2L32 A;  4Q8E A;  2ZIW A;  3AEC B;  1ZOY B;  4KLL A;  4BUG A;  4EZ6 A;  2CKH B;  1NEK B;  2IBI B;  3A9J A;  4K4I A;  1YQ3 B;  4UB4 A;  1CQV A;  3SEI A;  1G6J A;  3APC A;  1N5W A;  3OHB A;  4ED3 A;  2HSZ A;  2OXO A;  2BWE S;  1KTK A;  2VIX A;  2KDE B;  2AWT A;  1J2N A;  1L8O A;  1PGB A;  4RCO A;  4OJL A;  5CHG A;  1C78 A;  1ZGU B;  1TYG B;  2FLN A;  2KTR B;  4JPS A;  4FA6 A;  5DB7 A;  1WZ3 A;  4LNK A;  4C7Z A;  1BML C;  4BAX A;  4KX6 B;  3KHG A;  1K50 A;  3ZD8 A;  3P42 A;  2FMQ A;  3E58 A;  2EH9 A;  4A6Q A;  1PZN A;  4IRK A;  1ZE3 D;  4EBC A;  4MEY A;  3V7K A;  2KOB A;  3UQB A;  1L5P A;  1Z00 A;  5AIA A;  4UBC A;  4F5R A;  1NKB A;  4P0P A;  3VQI A;  3BVZ A;  4O3Q A;  1FD6 A;  2BDU A;  4FBT A;  2JU6 X;  5AKJ A;  4ED8 A;  4RH6 A;  3D6J A;  3TAP A;  1HXY D;  2XC9 A;  4JV1 A;  4KX3 A;  2MBO A;  1JRU A;  2XIC A;  2O2V B;  4O3N A;  9ICN A;  3WU2 U;  4KN7 A;  4AYB C;  3G6X A;  1SF0 A;  2N1V A;  4AUQ C;  1WYG A;  4DHZ E;  2KIV A;  4RPZ A;  9ICX A;  4LNI A;  2I5H A;  4E74 A;  3ETR A;  4DLE A;  2BZF A;  2INP E;  2ZVN A;  4I6L B;  1ZQC A;  2KNJ A;  3C5G A;  3ONS A;  3GE3 C;  4M8M A;  3HKZ F;  2XK5 A;  5AI0 A;  4UAW A;  4XWW A;  5J2H A;  3QCA A;  4GXB A;  3RFZ B;  4Y2X A;  2XEW A;  4NJ6 A;  3C1Y A;  3RCZ A;  4EEL A;  1BXT A;  3WAM A;  4YD1 A;  1I4Q A;  4IC7 B;  2EAM A;  3P2B A;  1V97 A;  1ZYQ A;  1NK0 A;  2KP7 A;  2NTT A;  5D94 A;  5BOL A;  4O3O A;  3JPQ A;  1D8B A;  1ZQY A;  3BQ0 A;  1XO0 A;  9ICV A;  2DHZ A;  4DL4 A;  4KDL B;  5CHF A;  3V6H A;  5AZF A;  2BYT A;  8ICP A;  5KFK A;  2GWS A;  2IBK A;  2NR2 A;  3L17 A;  3I76 A;  2L3Z A;  4NXZ A;  1UBI A;  1KRP A;  5ALP A;  1RFA A;  4QIW C;  3IG5 A;  4NJ7 A;  4RQ3 A;  3UF8 A;  2KKC A;  3L3F X;  2KMA A;  7ICU A;  2P35 A;  4RQ7 A;  3ALR A;  1RYS A;  1UCV A;  5KG3 A;  1T0R C;  3Q8A A;  5KFQ A;  1PUT A;  4YT0 B;  4MJS A;  2A1A A;  2KEY A;  3CSF A;  3JPN A;  4IR1 A;  2L7R A;  2J52 A;  4DSL A;  4IKG A;  3H8J A;  2JV3 A;  1OQQ A;  3R7Q A;  4EEY A;  2INN E;  3I3T B;  3MR2 A;  3ZDC A;  3O0F A;  4ZRJ A;  1TK8 A;  3IFW B;  5AI4 A;  1C1Y B;  3IHP C;  1QSL A;  2LAS A;  3JVZ X;  2KWU B;  4LDT D;  2K8A A;  1X6I A;  1ZQB A;  1T5X D;  2WF6 A;  4FBU A;  1SJH D;  3H7S A;  4DWI A;  4ZRI A;  1FXI A;  1N48 A;  1SV0 C;  4YTM B;  2RDJ A;  4C8M A;  1WRI A;  4N9F 4;  2HHU A;  2WHI A;  4P6V F;  5HML A;  4F4Y A;  2C22 A;  7ICO A;  2I9G A;  3ZDD A;  4KIK A;  5EDS A;  4FZL A;  2Q4T A;  1PYW D;  2QSD A;  1QOA A;  1T94 A;  3GS2 A;  2FPK A;  2RGF A;  5BYQ A;  5CX3 A;  1TAQ A;  4RFB A;  3V3X A;  3SQI A;  3QU5 A;  2BF8 B;  1SEB D;  2JYT A;  1PK3 A;  4PZO A;  8ICX A;  4OW0 A;  4FZN A;  4QWE A;  4B9M A;  5KFL A;  2JRI B;  1BT0 A;  2DF4 B;  7ICH A;  2YLM A;  2JZB A;  2G4S A;  2W9A A;  7ICM A;  2J0K A;  4GDL B;  1OQR A;  4GDK A;  2JRH A;  4Z6F A;  1NJZ A;  4B9L A;  4KLE A;  1WX8 A;  5LLI A;  2WXI A;  3GOE A;  5ALQ A;  4OJO A;  1ZQW A;  3N7P D;  3SAG A;  5DGB A;  5AKX A;  5EE1 A;  2JH7 A;  4R65 A;  4Q44 A;  4DF4 A;  2G4D B;  2Z8L A;  5BYS A;  5DPR A;  1D4B A;  3LWL A;  3MTN B;  2WB1 C;  1ECW A;  4X5V A;  3UQA A;  1L0V B;  2P6U A;  3PRZ A;  3F5E A;  4HRO A;  4G3X B;  5KG0 A;  2QAR A;  4DQQ A;  2DAF A;  3VVW B;  1F0M A;  2KAJ A;  3NUH B;  3MC9 A;  1MJD A;  4I2J A;  3PR5 B;  3H7I A;  1MQ2 A;  3WCQ A;  3GU3 A;  1JRO A;  2LPE A;  3NS1 A;  1WG8 A;  2PMV A;  1I4G A;  3SV4 A;  3AEF B;  4F4W A;  5KFF A;  8ICM A;  4ASW C;  4TUP A;  4RNO A;  3N1X C;  3PTF C;  3WKE A;  1GAQ B;  4HLE A;  5CR0 A;  4HPP A;  4WAF A;  2DKX A;  1PVP A;  5J0X A;  3QIJ A;  1VDV A;  5KG4 A;  4KLF A;  3UIN B;  1ET6 A;  3BVM A;  5KT6 A;  3MHS D;  4N6E B;  2WXK A;  5JHB A;  1ZQK A;  4YN4 A;  2ZIX A;  3OWE B;  2K4I A;  2LHT A;  4JK1 A;  1U49 A;  3BQ1 A;  4F91 B;  3H7P B;  4GOC A;  4P4O A;  4K7W A;  3J9C A;  2BPC A;  3RMK C;  3HRD D;  3F2B A;  4JQW C;  3BIN A;  3T9L A;  2R2Q A;  2WAQ F;  4DSJ A;  3ZDT A;  1D8Y A;  1O03 A;  4YXM A;  1ZQE A;  3KUZ A;  4J9P A;  3NZS A;  5DLF A;  4KZC A;  2XI9 A;  2VA3 A;  4BDP A;  5J0Y A;  4FFD A;  2IHM A;  3AI5 A;  2VA2 A;  3FDS A;  2YEP F;  1KF6 B;  4P4M A;  9ICT A;  4CO7 A;  4P0Q A;  4P2H A;  2SEB D;  4PHA A;  1ZQL A;  1E8X A;  3AE1 B;  4Q45 A;  2KIC A;  3JW0 X;  3RJJ A;  5ALK A;  1K53 A;  2K3U A;  5BOM A;  3HVD A;  2I1Q A;  3ED5 A;  3L4P A;  1IUE A;  2NPT A;  4DXA B;  3C5F A;  2IY0 B;  1X9X A;  3SR6 A;  2WYQ A;  3X0W A;  3ZW3 A;  1P7F A;  1SL1 A;  4J3O D;  1T3Q A;  3TI0 A;  9ICC A;  1COK A;  4MAC A;  3PZD A;  1MVK A;  3VXW A;  2AH5 A;  2JWZ A;  4II3 B;  2YQE A;  2Y9T A;  1CZP A;  3ABV B;  2ZIV A;  3R66 C;  5BO4 B;  3Q3N C;  4RT2 A;  3IAM 1;  4YMO A;  2AGP A;  1ZQU A;  1RLF A;  4A20 A;  4B6W A;  3PO0 A;  1ACC A;  2BB5 A;  9ICJ A;  4NLC A;  5G5H A;  4AOF A;  3B0X A;  4B6J A;  3CMM B;  1ED1 A;  4BJQ A;  4O5C A;  2HDO A;  2LHE A;  1SJE D;  2AL6 A;  2AEH A;  4US8 A;  1OEY A;  3BK1 A;  1GJZ A;  2KZR A;  3ZJU A;  1YMH E;  4QZE A;  3RT3 B;  4ECZ A;  4IQV A;  2R8I A;  2LJI A;  1Q46 A;  4AWJ A;  4ELU A;  1FNU A;  2LXA A;  2K8C B;  2W9B A;  5ALX A;  2YVC A;  3PVL A;  4DHZ B;  2FMP A;  3H8M A;  2Y0S F;  3ISB A;  1Q5W B;  1S9F A;  8ICI A;  1A0P A;  4C8L A;  2ASJ A;  1ZQD A;  3I57 A;  2Y5P A;  3WAO A;  3C1Z A;  2KDF B;  1SKR A;  3MC8 A;  1ZRM A;  1ZQO A;  2M1M A;  2ZPN A;  2ZUC A;  4M2Y A;  2XY6 A;  1LKY B;  1P9D U;  4M8N A;  5KFB A;  5J0O A;  1JWB D;  1FCL A;  5D7G A;  9ICB A;  2ZJ5 A;  5DDM A;  2BQ3 A;  3T5K A;  2PKE A;  5HP4 A;  3ISC A;  4DL7 A;  2ISP A;  4DL2 A;  2CPR A;  3QU7 A;  2I38 A;  2JGA A;  3Q8E A;  1R4N B;  2WF7 A;  4REZ A;  4DWF A;  3MP9 A;  1O08 A;  4KTQ A;  4TUQ A;  2DZI A;  5KFU A;  1NZB A;  2UVV A;  9ICR A;  2DAJ A;  2LGX A;  4F50 A;  2ZXH A;  1U9L A;  4M9N A;  1BNO A;  1Y56 A;  3PX6 A;  2ZTE A;  2N1R A;  5KFR A;  8ICE A;  3A4S C;  2RDI A;  3QUB A;  2J6U A;  2FMS A;  2D3D A;  1LB2 B;  3JPR A;  1ZQT A;  2HHT A;  2FCM A;  3AMZ A;  4QW8 A;  5D49 A;  4GSW A;  4AS1 A;  3BS5 A;  1SE4 A;  1TAM A;  2WXJ A;  5DBA A;  3EWA A;  2CR5 A;  5ALO A;  1WR1 A;  2GLE A;  4GDK B;  4LNN A;  7ICN A;  3PW4 A;  1TGZ B;  2K4H A;  4ECR A;  4ZOH C;  2PE6 B;  2PJH A;  1HTQ A;  5JRT A;  2E1E A;  1QCK A;  2AHO B;  2IOH A;  4PPX A;  5AKE A;  5CA7 A;  1KKX A;  3UXP A;  1L0Y B;  1NI3 A;  2IY1 B;  4R66 A;  1FFU A;  2KNB A;  3FM9 A;  3QK0 A;  3VTU A;  5KFY A;  5AI9 A;  1GC6 A;  5C1Z A;  5DB8 A;  1KW4 A;  2F1J A;  2G09 A;  4RQ2 A;  3HK0 A;  2REX A;  1PGA A;  5DPW A;  3K9O B;  2BR0 A;  1N61 A;  8ICC A;  1WXS A;  3L16 A;  1TK5 A;  1B9R A;  4YVZ A;  2BWF A;  4Y2J A;  1D9F A;  1KM7 A;  4EOY A;  2IND C;  1QSY A;  2IA6 A;  3ZXV A;  4G50 A;  2XVT A;  1L6U A;  5DQH A;  1MPE A;  3DV9 A;  2CS4 A;  3BZK A;  3AUL A;  1I4H A;  1TTN A;  4F8C B;  1ISN A;  2PMZ C;  3PLV A;  2J42 A;  2AXT U;  2NBV B;  2DZM A;  2Z59 B;  1WX7 A;  2HHV A;  4KVG B;  4JMU A;  1WXA A;  3PHW B;  2C7N B;  2PW9 A;  5IP4 D;  2BCQ A;  2DYM A;  4I6N B;  5KHO A;  4B9N A;  4UAS A;  2G45 B;  1WGR A;  3I9V 1;  4CF3 A;  4G3I A;  1YT3 A;  3IRU A;  5B5E U;  3GIK A;  2GBJ A;  3TAD A;  1QOG A;  5ALN A;  2MBH A;  2RSU A;  2HBK A;  2N9P C;  4ICV A;  2W04 A;  4R63 A;  2NRW A;  2CJO A;  2KN5 A;  5BYR A;  4CYE A;  2N0S B;  5DKW A;  2XGQ A;  2BDP A;  4CRX A;  5EE9 A;  3O65 B;  5AUI A;  3SEB A;  4KLG A;  2JYE A;  2FAZ A;  1C3T A;  2YMQ A;  4XYC A;  4DXG A;  4RQ4 A;  2W9C B;  2LHD A;  4QW9 A;  4I2F A;  3HX0 A;  1EO6 A;  1B0X A;  2YMM A;  4C8K A;  9ICG A;  3TL5 A;  4AJW A;  4M9G A;  1VLB A;  3P1M A;  5GXG B;  4XA5 A;  2GBM A;  5IAA C;  3MFH A;  1J7B A;  3MJ5 A;  3T5L A;  7ICI A;  2Z7J A;  4XDC A;  5DPT A;  2V9H A;  1NBF C;  4FBJ B;  3F2C A;  9ICA A;  4PGY A;  3OJ4 B;  3BJY A;  3N1Z C;  4XX5 A;  2KV2 A;  4QZG A;  2LI6 A;  2ZEQ A;  2UYZ B;  1NNL A;  3PST A;  4KGT A;  3CNH A;  4GLS C;  3J81 j;  2DGZ A;  2IGG A;  4JV2 A;  3FYH A;  1P0R A;  1FXT B;  2ICI A;  2PE9 A;  3V62 A;  3ZRC A;  3RUL A;  2F2A B;  4RT3 A;  2M8S A;  3KYC D;  2O6V B;  4CDG A;  3QJZ A;  3TEX A;  4IC9 A;  1V1P B;  5JXV A;  4QNL A;  1A5R A;  4JWS C;  3TUO A;  2WLB A;  2WU5 B;  4OJ6 A;  5HHI A;  2EZZ A;  4BOS C;  1TK0 A;  1Z2M A;  1KFD A;  1J19 A;  3KUC B;  2QIL A;  2ZXI A;  2BPG A;  1CRX A;  1SE9 A;  1XSP A;  1UD7 A;  4KLD A;  1ZQA A;  2PPH A;  9ICI A;  2FJ6 A;  4TSS A;  3S2A A;  3P4Q B;  1E90 A;  3U4E G;  3LK9 A;  3QX7 A;  3GV7 B;  1SKW A;  4O1N A;  4UB2 A;  3PSI A;  1RAX A;  2JVC A;  2FLL A;  3V6J A;  4NLG A;  2I6X A;  3MGI A;  4RQ6 A;  3L0W B;  5E6J A;  4NQL B;  3T5H A;  1ZD3 A;  3AED B;  5DBB A;  4F5P A;  2DPI A;  3E56 A;  4K4G A;  4W9F A;  4QWB A;  5AZG A;  2JZZ A;  3B2F A;  4ED0 A;  4HJG E;  1ZQP A;  3QNM A;  4PYZ A;  1PK1 B;  2KN4 A;  1ZUD 2;  4WWM A;  1KLG D;  4RNA A;  1UT5 A;  2NTS A;  3SAH A;  1JAL A;  5J2K A;  2ALZ A;  4QAY A;  5E6P A;  2VJ4 A;  2GBN A;  4F72 A;  2BBC A;  3RFA A;  4FS2 A;  3NVV A;  4IW0 A;  1XS9 D;  1RYR A;  2KDB A;  4F2S A;  3MFG A;  4O0I A;  3ZGZ A;  4KGR A;  1X6J A;  2B21 A;  2YML A;  1C20 A;  2D3G A;  4LJP B;  4OVU A;  3IP4 B;  4HDQ A;  4ECT A;  5F9N A;  3B1L X;  3X23 A;  1QH9 A;  1F5S A;  2JXX A;  2QDF A;  3UQ2 A;  2BQU A;  4DSK A;  2LGI A;  4CF5 A;  1KSP A;  1YN3 A;  3BYY B;  3V60 A;  3NRZ A;  4NLB A;  2Y5C A;  4HWI B;  4XQ8 A;  2HJ8 A;  4HK2 A;  3HIZ A;  1SSN A;  3RN9 C;  4GC7 A;  3VH4 B;  2BW2 A;  5AKH A;  4J9Q A;  1GOZ A;  2C7H A;  2H3F A;  1R4M B;  2JT4 B;  3DHH C;  2LYB A;  1IYF A;  2PI4 A;  2E8O A;  3V05 A;  4J9K A;  2QAR B;  4DFJ A;  2XO7 A;  2HHW A;  4HDO A;  1S1Q B;  4LVS A;  5KFC A;  3RPF C;  4DS4 A;  1BVS A;  2LVQ A;  3EC8 A;  1D5X C;  3WK5 A;  2HE7 A;  3U2S C;  1D5M C;  1YJJ A;  3ALB A;  3AE5 B;  2WXL A;  2FDR A;  2BTE A;  5L83 A;  5G55 A;  2ZPY A;  4MT5 A;  3OGU A;  2P66 A;  3JPO A;  4B95 A;  2PKO A;  7ICL A;  3R2I A;  3M63 B;  3N32 A;  4HVB A;  1RWS A;  4NV0 A;  4M0W B;  3DQV A;  4MM3 B;  4HCP B;  2MRP A;  2IZV B;  2N1W A;  5AKL A;  2LM1 A;  3K4G A;  1PFD A;  3NVY A;  5KFD A;  5IIO A;  5ALV A;  1E8Z A;  1N5X A;  1XWL A;  5TSS A;  4GU2 A;  5AUK A;  9ICH A;  2Q0Z X;  3URY A;  1IV8 A;  2YEP B;  4FE3 A;  4O3P A;  3ZO5 B;  3KD3 A;  2LXC A;  4C80 A;  1X9M A;  2KMD A;  1UPH A;  1V9J A;  3R3M A;  3H0L B;  1T7P A;  2WXP A;  3Q8M A;  2PFN A;  1T0Y A;  1KTQ A;  2LYA A;  3HKZ C;  2KHV A;  4RUC A;  2KLC A;  3IBE A;  4EEW A;  1TKY A;  4F93 B;  1Z3E B;  2WGS A;  3ML8 A;  5TZV A;  4P0Q B;  2G5I B;  4U6P A;  1NYQ A;  5FR6 A;  4PHE A;  1YN5 A;  3GZF A;  4C4V A;  4UBB A;  8ICN A;  4L23 A;  3MBY A;  4DFK A;  2PIA A;  2IPK D;  3JPT A;  1CEZ A;  4HKZ E;  4USA A;  5GTH U;  4DK5 A;  1XO1 A;  4NAM A;  1L7N A;  2LUE A;  4RGN A;  1L7O A;  2BYF A;  1E8W A;  4ANU A;  1T0Q C;  3EHV A;  1UHU A;  2TSS A;  4NLZ A;  1NEN B;  2I1K A;  1XCQ L;  1LV5 A;  4UAZ A;  3ZI4 A;  3PY8 A;  2MX2 A;  3OSP A;  4YXD B;  2M56 B;  1SIJ A;  3P4P B;  4US9 A;  3EGR A;  2NPT B;  1RG6 A;  5LXI B;  2VH1 A;  3WIM A;  3BS7 A;  5FR3 A;  5DCN A;  3SFD B;  2WX0 A;  4NWI A;  2HTH A;  2I2Y A;  4K81 A;  3RNA C;  4RUA A;  3ZDE A;  2FPL A;  8ICF A;  2BGF A;  1NVI D;  3RNE C;  5KFH A;  2ASD A;  4ZH4 A;  4A3P A;  1OUQ A;  7ICJ A;  2OED A;  3AH7 A;  2JX5 A;  4MGK E;  4W9I A;  3KTQ A;  4KIK B;  1AQ6 A;  3H1U A;  2MBE A;  1A77 A;  2A19 A;  2LEK A;  1L3U A;  3H0R B;  2AJQ A;  2IYD B;  2BQR A;  3TIX A;  4DS5 A;  1MC8 A;  1RXV A;  2FBW B;  1HIW A;  3V6E B;  3TBL D;  4HCN B;  3T3N A;  2XGP A;  1TV9 A;  2OWO A;  2MWS B;  4IWQ A;  3RUI B;  2WXQ A;  5ALF A;  5J8Y A;  1QKZ A;  1KFT A;  4ECX A;  1R4N I;  1AWD A;  2BS4 B;  2KWC A;  1X9W A;  3SV3 A;  2W3R A;  5KT3 A;  1C4A A;  4DFM A;  8ICV A;  4ECS A;  2DX5 B;  4GDL A;  2NO5 A;  4NL9 C;  2UVW A;  1WXV A;  4RQ0 A;  2ZJD A;  1NK9 A;  4B0E A;  1FFV A;  4RZR A;  5HFY A;  1BPB A;  5IOI A;  2A5U A;  1S76 D;  1B22 A;  1BPD A;  2BQQ A;  4DFP A;  1TKE A;  4R64 A;  1IGC A;  2FID A;  2N7J A;  4CNQ A;  3U8Z A;  3ZNG C;  4ECW A;  3HIL A;  2YY6 A;  3C23 A;  5KFP A;  4M0W A;  4MM3 A;  4NL9 A;  1ZD2 P;  5DG8 A;  2D3A A;  4ZRQ A;  2FPM A;  3N3K B;  2FCQ A;  3PW7 A;  2ASQ A;  1ET9 A;  2PI5 A;  2XCA A;  3OHA A;  2BCV A;  3RRG A;  2IO1 B;  1UUP A;  3RJF A;  3H9D A;  1HZ5 A;  2KVZ A;  3A9K A;  3DBS A;  2RMM A;  8ICU A;  4J9M A;  2HCF A;  3PW0 A;  3CIR B;  3M9N B;  2D6F C;  4I28 A;  2LGD A;  3NZ3 A;  2BHN A;  4GC6 A;  5AKI A;  1ZDX A;  3FKY A;  3RH6 A;  3H8W A;  4TUR A;  5T14 A;  4YR2 A;  5AM4 A;  3RB0 A;  4Y2T A;  1KEJ A;  5IIJ A;  5DQG A;  1RFK A;  3VTW A;  4DL5 A;  3DVN V;  3GIJ A;  1M4V A;  3VH3 B;  3BII D;  4O3S A;  3GB1 A;  4K3C A;  5JH5 C;  5HMM A;  4S0R A;  2CJN A;  4F3O A;  3NZU A;  3DEE A;  4NJ8 A;  4PJ0 U;  4RQN A;  5J2B A;  5D46 A;  3PPA A;  4K3B A;  2MSE D;  4DQI A;  2JZ3 B;  2HVI A;  9ICE A;  5EWE A;  1JWU D;  2JXJ A;  4OZA A;  1ROE A;  1C7Y A;  4F5N A;  5BMI A;  9ICF A;  2AQ2 B;  5DQI A;  3TAD C;  5KFO A;  3WK8 A;  2MCN B;  5AKG A;  3DVG Y;  5E79 U;  1ZKH A;  1WWU A;  1SIF A;  2JZP A;  4MHV A;  3SMV A;  4UAU A;  2KXJ A;  5G5G A;  1JI7 A;  3EZ5 A;  3DBH B;  1H4R A;  2WXN A;  5B66 U;  4MGY E;  2NO4 A;  3IVF A;  2J6T A;  3ZLZ A;  7ICP A;  5IN7 A;  4KLS A;  1IPG A;  3TJP A;  1K52 A;  4YSX B;  2FLP A;  5ALG A;  1UA0 A;  1KLU D;  3DBH I;  3IDW A;  3D2S A;  4W9K A;  2K22 A;  4Z6D A;  1M94 A;  4I2C A;  3SD5 A;  1F52 A;  3L08 A;  3O13 A;  2DWQ A;  4TQ0 A;  1TZ1 A;  5AIB A;  4JL9 A;  3CWI A;  4G0N B;  3BK2 A;  5J29 A;  3U30 A;  1SXE A;  2R8G A;  3IAS 1;  2KAN A;  1GG3 A;  1Z5S B;  2KZ3 A;  4DOC A;  2ZTC A;  2K60 A;  4BKT A;  3SAF A;  1MSW D;  3FC4 A;  3P4S B;  4W9E A;  2NS5 A;  1HUZ A;  2ZJ8 A;  2MU2 A;  4ICU A;  1E7P B;  2KTQ A;  2X38 A;  2KMC A;  5D4B A;  4C0Z A;  2KJ8 A;  4II2 B;  1I35 A;  5AM3 A;  1OW5 A;  3WKA A;  1UGJ A;  1EUV B;  2RHF A;  2M0A A;  3ZJT A;  4R8U B;  2LYH A;  3TAQ A;  3I5J C;  1L6N A;  2LMC A;  2EZX A;  4GXJ A;  3QEB Z;  2WWZ A;  1VCB A;  1KFS A;  3RR8 A;  2J6S A;  4KLI A;  2ZJA A;  2GBK A;  4GFJ A;  3H8H A;  3N28 A;  2W7P A;  4Z6C A;  1I4R A;  1H38 A;  2V3P A;  2K8B A;  3FIL B;  2C2D A;  2L83 A;  1WE6 A;  2MP2 B;  4DSE A;  4ED1 A;  3Q8K A;  5JHA A;  3QUQ A;  3Q14 C;  3C0R B;  1L7P A;  1VZ8 A;  5HI1 A;  3JYU A;  2JSV X;  1SV0 A;  1SE2 A;  3Q3M C;  2MRL A;  5IIK A;  5L1K A;  3DBR I;  1F2R I;  4B0M A;  1I7H A;  5EOZ A;  2OJW A;  2AQ3 B;  3M6Z A;  5ALJ A;  1Z19 A;  4EKU A;  5DG9 A;  5ALM A;  2O6V A;  4QZC A;  2QIE B;  1V1P A;  2XNA C;  4B9K A;  1XQQ A;  4LZD A;  1WGD A;  3C2L A;  3MGH A;  2BPF A;  5D2M B;  3T5J A;  5GTI U;  4WJN A;  2K6Q A;  5J2C A;  1SE3 A;  2AL3 A;  2KZM A;  3RI7 C;  2F8L A;  1WCN A;  5DGA A;  2FE8 A;  4MSQ B;  3VRB B;  4FJZ A;  4GIB A;  1N60 A;  2N9E B;  1UWM A;  2M19 A;  3V61 A;  2D8C A;  4DHJ B;  4RNM A;  2NRT A;  5KFN A;  2E5S A;  1HZ6 A;  1X40 A;  1E6E B;  2WTF A;  4I29 A;  3B0A A;  1L3T A;  2HDE A;  3JSV A;  1WUD A;  1XC9 A;  1GNU A;  4BZA A;  5KFW A;  4J9R A;  1QQ6 A;  3RH4 A;  3VUW A;  2OEH A;  1Q3V A;  2ZW0 A;  4GMV A;  4CCH A;  8ICO A;  1OGW A;  2KFK A;  1XU4 A;  2MAX A;  4IQW A;  1ENF A;  1XT9 B;  1ZP0 B;  1URJ A;  3C29 A;  1S3S G;  2FIF A;  5KFG A;  2KD0 A;  2V3S A;  1EF5 A;  1F44 A;  5G2N A;  4ZHO A;  3AE6 B;  5T8I A;  3RZW C;  3AEE B;  5HNK A;  2LRU A;  4KKI A;  3ZTC A;  2G9H D;  2BB6 A;  3AE4 B;  1TVA A;  1L7Y A;  4C4R A;  1IP9 A;  3Q8B A;  2KFN A;  4UW9 A;  3AN1 A;  1XLQ A;  4M6W A;  4BVU C;  3ZTD A;  2W9N A;  4GGQ A;  3WKC A;  3RTV A;  5J0Q A;  3LJ3 A;  3F2D A;  3ENE A;  3Q6B A;  1UT8 A;  2OOB B;  1DOQ A;  3KHH A;  9ICO A;  2L0T A;  1KOT A;  2N4F A;  4MEM A;  3PW5 A;  3DOW A;  3H40 A;  1RM6 C;  2H3Z A;  2OHF A;  3M9O B;  3V72 A;  1ZQM A;  1WM2 A;  5JUM A;  2QB0 B;  4UQG A;  5KTQ A;  3A9K B;  5D3I B;  3QZ7 A;  3N7S C;  5TR5 A;  2ZUD A;  3ICX A;  1JQ4 A;  5III A;  2ESE A;  2VZK B;  2DQN B;  1SL0 A;  4F5O A;  4C4T A;  3KZI U;  1E10 A;  1S8O A;  2KO3 A;  1WM3 A;  5AM0 A;  4YSZ B;  4PT5 A;  3ZNZ B;  1YIW A;  3QX1 A;  4MGI E;  1ZDV A;  3ZIM A;  4C8N A;  2IHN A;  3WAP A;  1OEY J;  1CI4 A;  4YL8 A;  2WXO A;  3RD2 A;  3F5A A;  3V7L A;  2V4R A;  1TS3 A;  3AU6 A;  4EZK A;  4RGM A;  4KSK C;  3LVV A;  1YX6 B;  1WR6 E;  2WX1 A;  3ETL A;  3T79 A;  3IM1 A;  2ZNV C;  1TS5 A;  1SL2 A;  3A1Q A;  3QU4 A;  2KHW B;  1TIF A;  3PZP A;  4C4S A;  1N6Z A;  2RR9 A;  4UB1 A;  2MW5 A;  2BVC A;  3WKB A;  3U7Z A;  3TFS A;  3DPD A;  1NJY A;  3NAS A;  1TS2 A;  1V6E A;  1MN8 A;  4TQS A;  4XDD A;  1LVH A;  2MUT B;  2CXY A;  2ZIW B;  2UWQ A;  2VH2 A;  2LM4 A;  2XBB C;  3UQ0 A;  2WF9 A;  1P7D A;  1JML A;  2C7M B;  2EMT A;  4MFC A;  1ZRN A;  4M9H A;  3DWM A;  5IO9 A;  2Y3A A;  2MLB A;  1N63 A;  4EZL A;  1T8E A;  1JUD A;  3Q8Q B;  1NKC A;  1LM8 B;  3PS6 A;  5KFM A;  4PHP A;  2K0P A;  2W8L A;  2CU3 A;  3GV5 B;  2IDY A;  1ZPS A;  3C19 A;  4DBG A;  5AZH A;  5KNI A;  1SWV A;  2QKQ A;  4P16 A;  4PS8 A;  2F44 A;  2LBO A;  1X9S A;  4MEX A;  4MJS B;  2ZUB A;  2A4Z A;  3VHT C;  4P4P A;  3UMB A;  3ZYY X;  1NK6 A;  2PTL A;  4C56 C;  2JHD A;  3IHQ B;  4RF1 A;  4WQO B;  4YTP B;  2E8M A;  2KD1 A;  1UEL A;  2LVP A;  4W9C A;  3EUB 2;  1B43 A;  5L1I A;  4GN1 A;  5KT7 A;  2FUG 1;  2KVS A;  1DOY A;  4QZB A;  4CGZ A;  2FCS A;  2KWD A;  3DBR B;  1WXM A;  1J7A A;  4IWP A;  2N9K A;  3RB3 A;  3Q8R B;  2R8H A;  5J0S A;  2IGD A;  4KX5 A; 
#chains in the Genus database with same CATH homology
 4KX6 B;  1FNV A;  3P42 A;  1K50 A;  2NTS A;  1JAL A;  4MH8 A;  4A6Q A;  2BBC A;  1ZE3 D;  2DYO A;  5C2T B;  3NVV A;  1EU3 A;  4RGT A;  4HKQ A;  4WIP A;  1L5P A;  1EWC A;  3MFG A;  4N59 A;  1FO4 A;  3ZGZ A;  4KGR A;  2GRI A;  1D6E C;  1IGD A;  2J53 A;  3BVZ A;  3VQI A;  1FD6 A;  3UI3 A;  2JU6 X;  4RH6 A;  1TS4 A;  1HXY D;  1YN3 A;  2LGI A;  3BYY B;  3NRZ A;  2Y5C A;  1QIL A;  1SSN A;  2GI9 A;  2W82 A;  2BW2 A;  1GOZ A;  1SF0 A;  3W5V B;  1WYG A;  3V05 A;  2WDV B;  3ETR A;  2INP E;  4IDI A;  4OZC A;  1B1Z A;  1HA5 A;  4ZYS A;  3RPF C;  3AE2 B;  2WQY B;  4XWW A;  3RFZ B;  3P4R B;  1D5X C;  3BWU D;  1DGJ A;  3W2D A;  3U2S C;  5C3J B;  1D5M C;  1YJJ A;  1QF6 A;  1BXT A;  2PVO D;  2WXL A;  1I4Q A;  3AE5 B;  2BTE A;  3PZ7 A;  1V97 A;  4L1B A;  2H89 B;  2BS2 B;  4MT5 A;  2NTT A;  4ARC A;  3U7Z A;  2ON8 A;  2PKO A;  3R2I A;  2BYT A;  1RWS A;  4MM3 B;  2WNM A;  2W55 A;  1PFD A;  4R3D A;  2DBY A;  4L2Y A;  3NVY A;  1JCK B;  1N5X A;  2SAK A;  5TSS A;  2ZW1 A;  2H88 B;  5AUK A;  2PLP A;  3Q8A A;  2D5G A;  1UWX A;  1XXG A;  3URY A;  1TY0 A;  1PUT A;  2YEP B;  4YT0 B;  2BT6 A;  2WXH A;  4C80 A;  1YNT E;  2J52 A;  2WXP A;  3EA6 A;  4IKG A;  5MPO A;  3TEW A;  5D3D A;  1OQQ A;  3VR8 B;  2INN E;  1TKY A;  1C9F A;  4A8X C;  1NYQ A;  1KH0 A;  2PVG C;  1J7C A;  4CQN A;  1YN5 A;  3P63 A;  2WXR A;  2JQR B;  4L23 A;  1XLN A;  2PIA A;  4HKZ E;  2IPK D;  1JWA D;  1T5X D;  4USA A;  4NAM A;  1D5Z C;  1SJH D;  4RGN A;  2GB1 A;  1FXI A;  4YTM B;  4HRS A;  2TSS A;  1WRI A;  1NEN B;  1XCQ L;  1XO3 A;  4P6V F;  4YXD B;  2AX5 A;  2M56 B;  1SIJ A;  3P4P B;  1PYW D;  2WXM A;  4US9 A;  1VRA B;  1QOA A;  2QSD A;  3EGR A;  3GS2 A;  5BYQ A;  4RFB A;  4OHJ A;  5FR3 A;  3SFD B;  3V3X A;  1KRH A;  2I2Y A;  1SEB D;  2JYT A;  4OW0 A;  1NVI D;  2RDH A;  3AM9 A;  1Q10 A;  3IT4 B;  2OED A;  3AH7 A;  3IXS A;  2JX5 A;  1SXT A;  4GDL B;  1OQR A;  4WQM A;  2WXI A;  1YJI A;  2LEK A;  5EE1 A;  1I4X A;  2FBW B;  3T3N A;  5BYS A;  2Z8L A;  1D4B A;  1L0V B;  2EEL A;  2WXQ A;  1XEE A;  1AN8 A;  4HRO A;  1QKZ A;  3NVZ A;  1AWD A;  2BS4 B;  2KAJ A;  5BMH A;  2W3R A;  1F2R C;  1C4A A;  2BS3 B;  1DOI A;  3NUH B;  1YQ4 B;  4B0E A;  1FCC C;  2Q5W D;  3WCQ A;  1A70 A;  1FFV A;  1JRO A;  1CJE A;  5HFY A;  2KDM A;  1JWM D;  3NS1 A;  5LNK 1;  2PMV A;  1I4G A;  2MH7 A;  3AEF B;  1TKE A;  5HHD G;  1I4P A;  1IGC A;  2N7J A;  1GAQ B;  4WAF A;  4YSY B;  5FKA C;  1TJE A;  4M0W A;  1VDV A;  3MC0 B;  4ZRQ A;  1ET6 A;  3BVM A;  5H92 C;  4N6E B;  1YN4 A;  1XLO A;  2WXK A;  4NZL B;  3AEG B;  1ET9 A;  3OWE B;  1K51 A;  2DLB A;  3Q69 A;  3E9S A;  5BMG A;  1UUP A;  3LB8 C;  3J9C A;  4JWU C;  1HZ5 A;  2R61 A;  5EE0 A;  2RMM A;  3HRD D;  4TMA B;  2G1E A;  4WUR A;  3CIR B;  3NZ3 A;  2B76 B;  1XLP A;  2LUM A;  1FXA A;  1ZDX A;  1WSP A;  2J4X A;  4JX1 C;  1QT9 A;  1GB1 A;  2YEP F;  1KF6 B;  3HUI A;  3U52 E;  2SEB D;  3AE1 B;  1FEH A;  4OZB A;  1FRD A;  1RFK A;  1K53 A;  1M4V A;  2K3U A;  1VZ7 A;  1V1O A;  4NJC A;  3BII D;  3HVD A;  3GB1 A;  3L4P A;  1IUE A;  4H2A A;  2CJN A;  3VRA B;  1MHX A;  1STE A;  4JE3 B;  4IOI E;  3SR6 A;  1HEZ E;  3T3O A;  1P7F A;  1JWU D;  2WXF A;  1WWT A;  4J3O D;  4OZA A;  1T3Q A;  3VR9 B;  1ROE A;  4MAC A;  3W9C B;  3AV8 A;  4Q2J A;  5BMI A;  2NMQ A;  1MVK A;  5H8Y E;  4AQ7 A;  2AQ2 B;  3ABV B;  1CZP A;  3AB5 A;  4OVZ A;  2JZP A;  1C4C A;  3IAM 1;  3NVW A;  1KFY B;  3PO0 A;  5G5G A;  3KLS X;  1ACC A;  2BB5 A;  2WXN A;  5G5H A;  1ZXI A;  2WDR B;  2LHE A;  1SJE D;  4D2K A;  3BK1 A;  4US8 A;  1K52 A;  4YSX B;  1PDX A;  1KLU D;  2HTM E;  3LXF A;  3ZJU A;  1YMH E;  3AE9 B;  2K22 A;  1ESF A;  4A9A A;  2AQ1 B;  2LJI A;  3O13 A;  3DWG C;  2DWQ A;  4TQ0 A;  1FNU A;  2KQ4 X;  1ZXH A;  3CWI A;  1DYQ A;  1AYF A;  3AE8 B;  2RDG A;  3BK2 A;  3IT6 B;  3MHZ A;  1V8C A;  3IAS 1;  2ONQ A;  1IBX A;  1JRP A;  1CK1 A;  2WDQ B;  4YTN B;  4A90 A;  3KWL A;  3FC4 A;  3GP7 A;  3I57 A;  2Y5P A;  2WS3 B;  3P4S B;  4EE2 A;  1E7P B;  2X38 A;  3FIL A;  4ITK A;  1VZ6 A;  1L6V A;  1UGJ A;  1JWB D;  1SB3 C;  1VJK A;  2IGH A;  2M0A A;  4A55 A;  3ZJT A;  4RF0 A;  1TZO A;  4RNA A;  5D7G A;  1FCL A;  1EU4 A;  2LMC A;  1FM0 D;  1DOX A;  3C8Y A;  2MJD A;  2W54 A;  2MEK A;  1L4Z B;  3TEY A;  2I38 A;  3Q8E A;  3W1S A;  4REZ A;  3MP9 A;  2E3T A;  3R8B A;  3H8H A;  1I4R A;  3HVZ A;  2V3P A;  3B2G A;  2LFI A;  3FIL B;  2L83 A;  3TEZ A;  3SFE B;  1Y56 A;  1VZ8 A;  5HI1 A;  4DQO C;  2JSV X;  1MHH E;  1SE2 A;  3AEA B;  1F2R I;  4B0M A;  3AMZ A;  1I7H A;  4AS1 A;  1R7S A;  1WXQ A;  2WXG A;  1SE4 A;  2AQ3 B;  2WXJ A;  1EM7 A;  2L1A A;  2QIE B;  2W3S A;  1V1P A;  2XNA C;  4GDK B;  3LYY A;  3AE3 B;  4ZOH C;  1L0X B;  1SE3 A;  3W5U B;  1LO5 D;  1JW9 D;  1TY2 A;  2E6X A;  2FE8 A;  3VRB B;  1N60 A;  1L0Y B;  1NI3 A;  1UWM A;  2M19 A;  2QMT A;  1HZ6 A;  2QEJ C;  1FFU A;  1E6E B;  1MI0 A;  2V0G A;  3Q8F A;  1QQR A;  2HDE A;  2KMM A;  2RPV A;  1P7E A;  4HEA 1;  1VR9 A;  4KKJ A;  4N58 A;  3FAH A;  1PGA A;  2ZW0 A;  3KQ4 A;  1FIQ A;  1SBB B;  1ENF A;  1ZP0 B;  1N61 A;  1F0Z A;  4ZHO A;  2KAC A;  1E0Z A;  3AE7 B;  1AW7 A;  5I4D A;  3AE6 B;  5T8I A;  1B9R A;  3AEE B;  4KKI A;  2G9H D;  2BB6 A;  3AE4 B;  5FK9 C;  3BYT B;  1L6U A;  3Q8B A;  1MPE A;  3ZQ4 A;  3AN1 A;  1F77 A;  1I4H A;  1XLQ A;  2J42 A;  4XWT A;  2XN9 C;  5HG2 A;  1GPX A;  1GB4 A;  4FXC A;  2PW9 A;  2DYM A;  3KWV A;  1RM6 C;  1FRR A;  2OHF A;  1C79 A;  4ARI A;  5D3I B;  4LTU A;  2EKI A;  1HQR D;  1OFF A;  1C4P A;  1FNW A;  2L52 A;  3I9V 1;  3N9Y C;  1QOG A;  1JQ4 A;  1FMA D;  2V3N A;  2VZK B;  1UNS A;  2ACZ B;  2CJO A;  5BYR A;  2IJ0 A;  1E10 A;  4LLG M;  2N0S B;  4YSZ B;  4PT5 A;  1QOB A;  2JWU A;  1ZDV A;  5EE9 A;  5AUI A;  2MJ3 A;  2QJL A;  4NAW B;  2WP9 B;  3SEB A;  2WXO A;  1E9M A;  2JYE A;  1TS3 A;  4RGM A;  4DXG A;  3ZJV A;  2LHD A;  1C77 A;  3BVG A;  1TS5 A;  4UDU C;  3TSS A;  4TQ1 A;  1VLB A;  3P1M A;  5EE3 A;  5GXG B;  2N9L A;  2WU2 B;  1J7B A;  3MJ5 A;  4XDC A;  1T6B X;  3B9J A;  1QLB B;  3AEB B;  4YWG G;  1JWS D;  1XF5 L;  3BZD B;  1NYR A;  1TS2 A;  4C7Y A;  1XCT L;  4XDD A;  4KGT A;  2JXT A;  3Q8C A;  4GLS C;  1JML A;  4DXF A;  2IGG A;  1QOF A;  2ICI A;  3R2T A;  3DWM A;  2MJE A;  2Y3A A;  1WGK A;  3TEX A;  1N63 A;  1BUI C;  1V1P B;  4XE0 A;  2VZK D;  5JXV A;  4JWS C;  4KGS A;  3TUO A;  1PGX A;  2WLB A;  2WU5 B;  2K0P A;  1EWY C;  2K5P A;  4ZHP A;  1BML C;  2CU3 A;  2IDY A;  1ZPS A;  2K9X A;  2QIL A;  1C76 A;  3PZ8 A;  4P16 A;  2L32 A;  4TSS A;  4LK0 M;  3P4Q B;  3AEC B;  1IBX B;  1ZOY B;  3U4E G;  1NEK B;  3ZYY X;  1YQ3 B;  2PTL A;  4C56 C;  4O1N A;  1CQV A;  4RF1 A;  4YTP B;  1TKG A;  4RGO S;  3EUB 2;  1N5W A;  2FUG 1;  1DOY A;  5E6J A;  3AED B;  1N62 A;  1KTK A;  2KWD A;  2V4I B;  3E56 A;  1J7A A;  1PGB A;  4RCO A;  4ZRP A;  2N9K A;  3B2F A;  1C78 A;  1RYJ A;  1TYG B;  4HJG E;  4JPS A;  2KN4 A;  4WWM A;  2IGD A;  1L4D B;  4C7Z A;  1KLG D;  4WH4 A;  1ZUD 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...