1ZXIA

Reconstituted co dehydrogenase from oligotropha carboxidovorans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
161
Chain Sequence
b'KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Structural and functional reconstruction in situ of the [CuSMoO(2)] active site of carbon monoxide dehydrogenase from the carbon monoxide oxidizing eubacterium Oligotropha carboxidovorans
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1zxiA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zxiA01
5EE9A 3VR8B 1NEKB 2MJEA 4WQMA 4C7YA 5EE0A 2B76B 1N60A 4JWUC 3NRZA 1SF0A 2QIEB 3AE2B 1WWTA 4YXDB 1FFUA 1FRDA 2W3SA 5AUKA 1QF6A 1B9RA 3AMZA 1KFYB 1TYGB 1UWMA 4ZHPA 1JW9D 4P6VF 4YTPB 1QOGA 3AEFB 1FFVA 1FRRA 1JRPA 2G1EA 2LEKA 3AE9B 4YSYB 5AUIA 3AH7A 3AE5B 3NVZA 4ZOHC 1IUEA 1DOIA 2JQRB 4JWSC 4N58A 1XLQA 4KX6B 3AEGB 2CJNA 2MJDA 1JWAD 3RPFC 3WCQA 1J7CA 1A70A 3P4QB 1CZPA 2DBYA 1L6VA 3B2FA 1FXIA 3AV8A 1NYQA 2L52A 1QLBB 5C3JB 3HUIA 1NENB 3VRBB 4USAA 1VDVA 2EKIA 1ROEA 4US8A 3AE8B 2BS4B 4YSZB 1JROA 3W9CB 2H88B 4YSXB 3SFDB 1QOBA 1WXQA 1RFKA 3VRAB 1NI3A 3AE4B 5MPOA 3KWLA 1PDXA 1RM6C 3NVWA 2L83A 3PO0A 1AYFA 4LTUA 1FMAD 2K5PA 2BS2B 1KRHA 2PKOA 3SR6A 2OHFA 4ITKA 1TKYA 2DWQA 2WDVB 5G5GA 1AWDA 2QJLA 1KF6B 2WLBA 4WWMA 1JALA 3EUB2 3LXFA 2WQYB 1YJIA 2JX5A 3ABVB 1QOAA 1J7AA 2PIAA 3AB5A 5H92C 1E7PB 1VJKA 3LB8C 4N59A 1N62A 1OQRA 2N0SB 1JWBD 1ZP0B 2CJOA 1FO4A 1WRIA 4C80A 3AEBB 1CJEA 3CIRB 1WYGA 3BIID 1QT9A 1DOYA 4ZHOA 3B2GA 1GAQB 1ZOYB 3P1MA 4HRSA 1SB3C 1DOXA 3AEEB 3AECB 3AE1B 2BT6A 1NVID 2K22A 4JX1C 1F0ZA 1OQQA 1TKGA 4IDIA 1XO3A 1ZUD2 5C2TB 2WDRB 3FAHA 2PVGC 3L4PA 1YQ4B 2HTME 3HVZA 1L6UA 1R7SA 4US9A 2K9XA 3DWMA 1XLPA 2H89B 2PVOD 2Q5WD 3P4SB 1VLBA 2AX5A 2KMMA 3AEAB 1SIJA 3AN1A 2KAJA 3NVYA 2MH7A 1TJEA 1E6EB 4HROA 3W5VB 5EE1A 4YT0B 2M19A 1I7HA 1FM0D 2WU2B 2WDQB 3NS1A 5H8YE 3AE6B 1N5WA 1V8CA 2MJ3A 1FXAA 1DGJA 3SFEB 4C7ZA 1L0VB 3B9JA 2W55A 1WGKA 1PUTA 2W3RA 1RWSA 3AM9A 4N6EB 3AE3B 3ZYYX 1N63A 1ZXIA 1J7BA 3NVVA 1RYJA 2WU5B 4YTNB 1N61A 1PFDA 3CWIA 5GXGB 3HRDD 2Y5CA 3W5UB 2E3TA 1E9MA 1QOFA 2ACZB 2WS3B 3AE7B 3FC4A 4A9AA 5G5HA 1EWYC 2WP9B 3ETRA 1GPXA 4FXCA 1YJJA 2W54A 2BS3B 2FBWB 2M56B 1V97A 3AEDB 3P4RB 1YQ3B 3VR9B 2CU3A 1E10A 1NYRA 1OFFA 1L5PA 3DWGC 5EE3A 1T3QA 1XLNA 1JQ4A 1FIQA 1E0ZA 1TKEA 3P4PB 1N5XA 4YTMB 3P63A 1XLOA
chains in the Genus database with same CATH superfamily
1ET9A 3F2CA 5L1MA 1JIHA 2J42A 1FCLA 3ZRCA 4DSLA 2PE6B 2BCSA 2MUTA 4YXDB 2XIDA 1L7PA 4LCDE 4RM8A 4I28A 5IOIA 2GI9A 3S2AA 4DL3A 1EM7A 3QU2A 2LXCA 2L32A 4O5KA 2Y3AA 1G6JA 2ZPNA 3RTVA 1PVQA 3THVA 3Q69A 2RD0A 1TAUA 2H3QA 4O3OA 1X9SA 5KFQA 2SEBD 3LYSA 4ICUA 4UAZA 1U47A 2IGDA 1IP9A 1KFTA 1FXIA 5AICA 4FJZA 2JZ3B 4Q2JA 8ICQA 9ICVA 3H9DA 2I38A 3B1LX 5LNK1 2BYFA 4NLBA 4GXJA 3DQVA 1ZJNA 2XY7A 2KJ8A 2FUG1 2NBUA 2H88B 2N7EA 1WXQA 1E7UA 1I4XA 2BPFA 3PO0A 2EAOA 1R4MI 1SGGA 1D5ZC 2JF5A 5T8IA 4NM1A 1QSSA 1U4AA 3ED5A 2FIFA 2QJLA 3ABVB 2PJHA 1ZETA 2DLBA 4TSSA 1ZD4A 9ICUA 2K8HA 4TQ0A 2KANA 1ZOLA 4PZNA 9ICBA 4G0NB 3C28A 4IQWA 1N56A 4HKZE 1AROP 2IHMA 2R2OA 3H1UA 4BXOA 2V3PA 4DOBA 1S5LU 2K22A 3FILA 1C4AA 1WF9A 2QILA 4E71A 3AI5A 1YN5A 4O3PA 2NVUI 5D6JB 4KKIA 4F4KA 1WZ0A 5D3IB 3ZDDA 3A4RA 1UD7A 1SV0C 1E8XA 2LGIA 4BKSD 1DOQA 3QZ7A 2EELA 1RYUA 2AX5A 2UU7A 2O2VA 3KFUF 3HVDA 3MGHA 1T0QC 3PSTA 2L0FA 4PHPA 2KKPA 2PEAA 4ELTA 2OXOA 5B66U 1C4CA 1WE7A 4AQ7A 2QCZA 3B9JA 1NK9A 4DL2A 5AIBA 4EZ6A 3VH3B 1JXEA 2KWUB 1N63A 5KFJA 5DKWA 2JZZA 1SE4A 3DBHI 3HRDD 4JMUA 4TQRA 2RDJA 2WS3B 2DZJA 3T5HA 4RGTA 4PS7A 5J2GA 5BYQA 1ENFA 3C2MA 1ZQGA 1P7EA 3QK0A 3J9CA 4P1CC 4J9QA 4KDLB 4AWJA 3SU8X 5ALFA 3KHRA 4PT5A 5J2EA 1RAXA 1GJZA 4MEXA 3SV4A 1V80A 2C7MB 4YTMB 3H4BA 4O3QA 4XA5A 5B5EU 1D5XC 3RH4A 2WYQA 4IM3A 1URJA 3MBYA 3K9PB 4L23A 4ARIA 2ON8A 1F2RC 1XS9D 1T0YA 3AULA 4QZDA 2YB1A 4I2HA 1C79A 3H7PA 4JB3A 2FLPA 2HDEA 2FMPA 3IT4B 2O6KA 5ALMA 4W9DA 3QWZB 4B6WA 3RNGC 2K4PA 3T3OA 3D2QA 2ZJDA 3UQ2A 3DOWA 1OGWA 3RPFC 3WCQA 4NLKA 3VUYA 2LMRA 3ZO5B 2WXMA 4ASWC 4OJOA 2XGPA 2L5YA 1KQQA 3ZDEA 4I2CA 2BKEA 2UWQA 1YNTE 3LYYA 5C3JB 5L95C 4ZRJA 1ZD3A 1R4NB 2Y0SF 2BF8B 1QILA 3C2LA 1ZQLA 5DGAA 3ZDTA 3WKAA 2PE9A 4MT5A 5AZGA 2ZXHA 4LTUA 3T5JA 2HVHA 1GC6A 1YJ1A 3IG5A 1AWDA 3Q8KA 3GFKB 2KD0A 2MA1A 5C0YA 2KWDA 3BVGA 4OVZA 2R2QA 3UPQA 4MF2A 4J9OA 2ASQA 4U7CA 2IO0B 5G55A 1K1QA 2JVCA 4YN4A 3IFWB 3T5KA 3UMBA 2ZUDA 2MLBA 4DQPA 3C1YA 4AJWA 3PSFA 2LJ5A 3NUQA 4ECXA 3ZLZA 3R66C 2WXFA 2QB0A 4FHKA 1NJWA 4ANUA 2AQ3B 3PX6A 2K1FA 1B43A 4HPPA 2P6RA 3U52E 1E6EB 1U4BA 4BKTA 2GBJA 4M9LA 2FUHB 2WU2B 2IZVB 2K8BA 3RYTA 2N1WA 2B21A 4UAVA 1HEKA 2WXKA 2UVVA 1Z4OA 4M01A 1DOXA 5AM4A 2MA9B 4QIWC 4F5RA 4JQWC 3SAHA 4GIBA 9ICGA 1K51A 3Q3NC 2JGAA 1K5OA 2OJWA 5AZHA 1EWYC 2WP9B 8ICOA 2BS3B 5DBAA 3RBEA 1MVKA 3TKAA 4QZFA 4B9VA 3KHGA 3N1ZC 3C5GA 3RAQA 1CMXB 4IG7B 1I4GA 4CCHA 5KNIA 1OQYA 3PRZA 4PGQA 1L2NA 4AOFA 2JWZA 5JH5C 5ALXA 9ICNA 1N60A 3V62A 4FE3A 5ALJA 2D6FC 2KTRA 4UW9A 2LZ6A 2DQNB 1QF6A 2W9BA 4OO1J 4PZOA 5JZEB 2LGYA 5AK6A 2L3ZA 2PMVA 1IBXB 2C9WB 1T8EA 1GOZA 2LRWA 4GDKB 1P3QU 4W9FA 2DFLA 4YCXA 3M9NB 1E5WA 2NRXA 3QU4A 3TFSA 3TI0A 3HPOA 1TE2A 5EDSA 2G06A 1ET6A 3AL0B 3I57A 5IIIA 2DBYA 4RQ3A 2BPSA 1MFWA 7ICOA 4UB6U 1ZQYA 2KJ9A 3QUCA 3ZD9A 4RGOS 1J2NA 3RZWC 1Z00B 4QNLA 5L1LA 1KJTA 4R65A 2BQQA 2JSVX 4DXAB 2NTSA 5AI0A 2E5SA 1XXGA 4KTQA 1ZQQA 1YT3A 4F5OA 3Q8SB 2YX8A 1NK8A 2WFAA 3EA6A 1RFAA 2M8SA 2Y9TA 2K5PA 1BVSA 2OH2A 2JEFA 2PKOA 2KZZA 4UAYA 4K3CA 1MJDA 1RZTA 2BPCA 2LM1A 2VA2A 4A8XC 4DLEA 2J0MA 4ED1A 4OHJA 2JRIB 2AU0A 2WAQC 5T14A 2NCNA 2ZJ8A 3L10B 1N62A 2KHVA 2W11A 1DYQA 1FCCC 2YQEA 5KG4A 4M00A 2QC8A 3PZ8A 2XGQA 3QEBZ 4IRCA 1CI4A 4P0QB 1COOA 2NRVA 3RH5A 2HHUA 2KMCA 2KNBA 3OG5A 2R8HA 1HE8A 2WXJA 4Q45A 7ICFA 2V3NA 4J9RA 4ICAA 2KZ3A 3DDCB 4M6WB 3PX4A 3I1YA 1ZDVA 2JEIA 2LVPA 5C2TB 4FBJB 3FAHA 5C5JA 3UIPB 4BDPA 4LK0M 3BZKA 2KQ7A 2F1JA 1JN3A 4DWFA 2W9AA 2NMQA 3A9JA 2ZIXA 3Q6BA 3ZRFA 2Q5WD 3DHIC 3W1SC 4QWAA 2R8IA 3PVXA 3AEAB 4IWPA 5D94A 3AN1A 1GB4A 4XGAB 1E90A 1RYRA 4A6QA 5J0XA 4IQVA 3AE6B 1ZQ1C 2INPE 4BVUC 3M3JA 3TANA 1NK7A 2FDRA 2W3RA 4RNOA 1BPZA 4G3IA 3RNFC 5CEHA 5AK4A 3NVVA 1J7BA 4DQIA 1CQVA 2ZIUB 2DUYA 4RUCA 3FC4A 5G5HA 3H8WA 2LGXA 2F77X 1U9LA 2GWSA 1MPEA 4YR0A 4BOZB 2FMSA 4R8UB 4FZMA 2HE7A 3KVFB 1WCLA 4Y2RA 4ELUA 9ICKA 4FBUA 2JT4B 3GZNI 2GBNA 4XE0A 3M63B 4JLCA 2GO7A 2N9EB 5JU5A 4DFDA 2HBMA 4O3NA 3M95A 2ZIVA 1BPYA 2MBBB 3GP7A 3DCGA 5HG2A 2PFPA 2XEWA 2W9CB 1AARA 1NJZA 1UCVA 4CGZA 2PI5A 5HR7A 3UGBB 3M7DA 3EYZA 4EX6A 3SENA 2ISPA 2D3AA 4DF8A 2AL6A 2W82A 3JYUA 4KLLA 2EAPA 5CTRC 5DG9A 4F92B 4M04A 4M0WA 1XCQL 1Z2MA 2GBMA 5J8YC 1LFDA 1N6ZA 1JWAD 2KQSA 2J6UA 2D07B 1KRPA 4NL9C 1TAMA 3PMLA 2Y5BB 2I1QA 1TKDA 2MRLA 1TFRA 2UYZB 5HI1A 2OYYA 4HJKA 1V5TA 1WM3A 3ENEA 3PZ7A 7ICRA 4NXZA 1L7MA 1L3VA 1YMHE 3UXNA 3H0MB 1U45A 3CSTA 4C0ZA 4FS1A 4NPNA 1Z5SB 2KT7A 4DL4A 3ETLA 3NVWA 3ICXA 1YQBA 2F8KA 2HHQA 2LYBA 4CRXA 4M9JA 3NUHB 1C78A 1RRBA 4Y2PA 2KHQA 1ZQMA 2IMWP 3HK0A 1MG4A 2LXAA 4GMVA 2F2AB 2CJOA 5DQHA 5JHAA 1HTQA 1CJEA 5KT3A 5CRXA 5IAAC 8ICZA 1DOYA 1GO3F 1UGMA 4JK1A 4E0DA 3LVWA 3RI7C 2N9PC 1NK5A 5TSSA 1KLGD 5TZVA 4B6JA 4EYHB 2WDRB 5G2NA 2ASJA 2QKQA 1CK1A 1WFYA 5KT7A 5AKEA 4KLJA 1XEEA 3AU2A 4RNNA 1OUQA 1NK4A 4MH0E 5AI8A 4TUPA 3PW0A 2RRDA 4TV3A 5AK3A 3W2DA 1V9JA 4K4IA 3P4SB 5DB6A 4TMAB 3IXSA 2J6SA 2WDQB 5H8YE 4GDLB 1P7DA 3ONSA 3U30A 2V3SA 4ANWA 2MRPA 2GH1A 3PSPA 2XVTA 1PUTA 2D3BA 1EUVB 3MC9A 2BGFA 3VUXA 5AZFA 2Z59B 3ZYYX 2P35A 2INCC 3I5JC 2HD5B 2WNMA 1E9MA 2F3NA 3GIIA 1ZQKA 1WXMA 2I2YA 2V4IB 3OSNA 1M4VA 2UVUA 4FXCA 2W54A 3TADA 2IJ0A 1FNWA 1Z4NA 4RQNA 1K52A 2AXTU 2KWCA 3PPAA 4ZRIA 2BCUA 5HMLA 8ICYA 3IP4B 4K7UA 1L4DB 1KM7A 3QU7A 2BW2A 3Q8CA 2MJEA 5IIMA 2E1EA 8ICGA 4B9NA 5JTIA 2KJHB 1WWTA 4NAWA 1T7PA 5E6PA 1X6IA 4FZLA 2IO3B 4Y2UA 3AEFB 4C8KA 2E8PA 5J2IA 4ED0A 1TK0A 4ED2A 3ZDMC 1V2YA 1RLFA 4GB9A 3IAS1 1ZYQA 1L6NA 1HXYD 3ZXRA 1S0NA 3OSPA 4Q8EA 4BJQA 2PMZC 5I4DA 2GLSA 3RJEA 3DV9A 3DHGC 4QZCA 4FJYA 3BYYB 4I6PA 5KL1B 3Q8AA 1ROEA 3SQIA 2WB1C 1Y56A 3VXWA 1BPXA 3W9CB 4MEMA 1WY8A 3LWLA 3EC8A 2HVIA 4F93B 3RFZB 4GC7A 4NJCA 2LKYA 1QQ7A 3H0LB 3N7PD 4DO9A 5HHDG 7ICNA 4CQNA 2BS2B 5EWFA 2LUMA 3NG0A 4P1BC 4R3DA 2L00B 2KVSA 4B9SA 3VTUA 4O1NA 5J2AA 1XSPA 5JHBA 9ICQA 3LXFA 1Q46A 1QOAA 4OJ6A 2CS4A 3P42A 2PFOA 3K4GA 3RJFA 5E6JA 1EWCA 5ALUA 3ZQ4A 3ZW3A 4DSKA 3EGRA 4B0MA 1HUOA 5J0WA 3QC8B 1X9WA 3ZDAA 1SZPA 3C23A 4IWQA 2RDBC 1DK3A 3VUWA 5GTHU 1ZUD2 2JRZA 3N7SC 1ZQBA 2PVGC 4KLGA 3Q3MC 4MM3A 3MP9A 4DFKA 2AGQA 4P0PB 2YVCA 2AHOB 3ALRA 1WMHA 2VKQA 2KZMA 4QZIA 1V9PA 4F5QA 3JSVB 3PSEB 1LGRA 4UQGA 1ED1A 2QDFA 2W7OA 4ECVA 1TJEA 2KDFB 4HROA 7ICGA 2M19A 4XDDA 4UB4A 1N5WA 1F0MA 1R4MB 3VQIA 2XY5A 3SFEB 2YLMA 3AM9A 2LYAA 7ICSA 4BWMA 4HYKA 2CHWA 3PLUA 3PW5A 1Q1OA 4MJSA 1QOFA 4KIKA 4XDCA 2JHDA 2V4LA 1PGAA 3SAFA 2N9LA 3T9LA 2ZIWA 4IQTA 3VR9B 5KFOA 3AEDB 3OJSA 2JH7A 1TT5B 2GLEA 2OM6A 5IILA 3H8JA 4W9HA 2YMPA 1T3QA 3A1QA 3DPDA 1C3TA 3WK4A 2N1RA 2K60A 2KDMA 4DSFA 4IRDA 3RNCC 1RYSA 4FBTA 3CNHA 3AE2B 1XSNA 3JPNA 4ICVA 2K89A 5BPCA 4NY0A 1AW7A 2HHWA 1FFVA 3I76A 3IDWA 2OEHA 2LEKA 3HM6X 3AE9B 4M8MA 7ICKA 4TQ1A 2DPJA 4EOYA 1WUDA 4KDIC 1SWVA 3X0WA 3A9KB 2IOFA 5AM3A 2KJ5A 3ZNZB 2VRRB 5BOMA 5AM1A 4DXGA 2WF9A 2K4IA 2NPTB 1WX8A 2W04A 5JXVA 3MR6A 2YTUA 1ZQXA 2KVRA 3MGIA 2WXOA 4RQ6A 1ZQPA 3ZUNA 1NZBA 1VRAB 2N4FA 5L1JA 4ECYA 2ZVNA 5AKKA 3VRAB 5K4LA 2IO2B 1J8CA 2FPMA 4NAMA 3SAGA 3V7JA 4I27A 1ZQJA 1TK5A 4YTPB 1QQ6A 3WALA 3SMVA 2Z0EB 1C20A 3RRGA 1XSLA 3ZDBA 1C77A 2RHFA 3BS5A 4RU9A 2I5HA 4ECUA 8ICLA 3V61A 1JWBD 3NJTA 4WAAA 4DQSA 4QZ9A 2QLTA 4KMUA 3RZFA 3IV6A 4MFAA 1BPEA 3D6JA 1XC9A 2JEJA 3C5FA 2KD1A 2ODGA 2K3UA 4Y2QA 5AKXA 2HCFA 2JPHA 4A3PA 2PTLA 3SD5A 1NK6A 3C0RB 2ZTCA 1BMLC 2CPRA 2JXJA 4I2IA 1S76D 2O6VA 4LLGM 1ZPSA 4ELVA 2KVCA 4HK2A 4KZ0A 4FADA 4BUGA 5DBBA 2MH7A 1WH3A 4NJ6A 4M47A 2J0JA 5J0TA 2BVCA 3X23A 2MP2B 2OWOA 4KLQA 5ALYA 4EBEA 4JWMA 1OEYA 9ICTA 4PHEA 4YVZA 4PHDA 8ICKA 4RNMA 3NASA 3ALBA 1NJXA 2DZMA 1JWMD 3ZIMA 1IG6A 5HFYA 5AKZA 2ACZB 3AE7B 3GE8C 3RNEC 3V6HA 4DCCA 1T3NA 2TSSA 4GOCA 1L7NA 4IWOA 3OPXA 5HNKA 5DB9A 2H3FA 1E8YA 3KKAA 2KTQA 2HJ8A 3NY5A 4K7SA 3WKDA 5BMIA 4R64A 4XX5A 2L1AA 2ZW1A 4R66A 2LRUA 1K1SA 2NRTA 7ICTA 3PV1A 2LASA 1XLOA 1F44A 1P98A 1NEKB 2JZBA 1MQ3A 2F8LA 2BYVE 5BMGA 4DHZE 2LHDA 2QIEB 5AKYA 1FFUA 1FRDA 1C9FA 3K9OB 1KFYB 7ICUA 2Q4TA 3SHQA 1DGSA 4JGHB 4P6VF 4AJYB 1V6EA 2LJIA 3Q8QB 1S8OA 2B6GA 1C1YB 3MTNB 4DLGA 4TKNA 4YSYB 5CJ7A 2QMTA 1EU3A 8ICCA 1JMSA 2YEPF 1V86A 3APDA 3KYCD 2KN4A 4LNFA 1QQ5A 3GIMA 3M9OB 2GBRA 2XCAA 3L13A 1CZPA 1WYWB 2EKEC 4BGDA 3WK8A 2KG5A 2CRXA 2PFQA 4MSQB 4BBNC 1VDVA 1HZ6A 4ZRPA 3ZGZA 2XNAC 2IOFK 4I6NB 3V72A 3RH6A 1T5XD 4KSKC 4ED3A 1L7YA 3G6XA 2M9NA 1XWLA 4HLEA 5ALIA 2MBEA 4BFRA 1YIWA 4G9BA 3KH0A 2ES6A 1S3SG 1A77A 1WJUA 8ICJA 4CNQA 1X9MA 1UZXB 3DHHC 3P2BA 4ITKA 1TS4A 5ALZA 3MR5A 1LM8B 4OCZA 5AK5A 4KLSA 2RSUA 4ZH4A 9ICLA 4HCNB 3APFA 3ZNHB 1UQVA 2N0SB 4W9JA 4ANVA 4O0IA 2RDIA 5J2JA 4DDGD 2QB1A 2UVRA 3GIJA 2BT6A 5KHOA 4HKQA 2LPEA 1TKGA 5KL8B 1H38A 3N1YC 3CSFA 4OVUA 2BCQA 4B9LA 2XCPA 4A20A 3N9YC 3PO4A 1ZD2P 3VFKA 3TEZA 5DDMA 4WQOB 3N4MB 4K4HA 2KIWA 1STEA 5KFXA 1ZRNA 2PVOD 3IM1A 1OW5A 3SEIA 2HHXA 1TBEA 1VCBA 4RH6A 3TJPA 1ZXHA 1ZQCA 2LI5A 4WJ3B 2ZUCA 3SV3A 3IN5A 1F9JA 2KLGA 1Z3EB 2HDOA 1PK1A 3NS1A 1D8LA 1FXTB 3WA0A 1ZQVA 3HP6A 4PPXA 4AUQC 1RXWA 1RWSA 1KFDA 1BPDA 3JPTA 1TV9A 1PVRA 4UARA 3AU6A 4NLZA 2KFKB 1BGXT 2WU5B 3AUOA 3HIZA 1IYFA 1SE3A 3RAXA 2HOFA 2HBKA 2Y5CA 4I2DA 2E3TA 5DQIA 1LKYA 3HT3A 5KFNA 4Y2VA 3GE3C 4KVGB 3IRUA 1TS5A 1YJJA 2L05A 3ZJVA 2BWFA 3GZFA 2M56B 2BKFA 3HKZF 4RQ7A 4BZAA 2BZFA 4EZJA 1E0ZA 1XO0A 2RP5A 1V81A 2BYTA 2KV2A 3ORYA 4B9KA 4QWDA 1PQSA 1WR6E 2N7DA 1XU4A 4HVBA 2H3IA 1TVAA 4YL8A 1KBUA 1KW4A 2HTHA 4EUTA 2W3SA 2PI4A 3V7KA 1QSYA 3V7LA 5IN7A 4ZHPA 5L1IA 5AKLA 1JW9D 4AYBF 2PPHA 3RULA 3R9KA 2BB5A 2L8JA 3QJZA 4ED8A 3BQ0A 1ZDXA 1ZQZA 3R7QA 2KSOA 2WX1A 3MFGA 4RF1A 1KSPA 4GXKA 3BQ1A 4KX6B 4MEYA 2Y0SC 2CJNA 4CDGA 1FPYA 1L7OA 3WAMA 4IM2A 2QARA 2LD9A 1BUIC 1F5SA 1D9DA 3VVWB 3AQEA 4B95A 5AIAA 4CE6A 2ATLA 1MG8A 1SSNA 8ICBA 3H8HA 1NENB 4W9LA 3H6NA 5AKHA 2WAQF 1JROA 4W9IA 2E6XA 4YXJA 1UA1A 4QAYA 1SJED 1SXEA 1QOBA 2INDC 1T0SC 5MPOA 1NI3A 5DG8A 3QEAZ 1Y8RC 3MDAA 3KQ4A 2M0NA 3L16A 4XC2A 3FYHA 5J18A 4ED6A 1ZQUA 4NLGA 4J9PA 1P1AA 3DVGX 1NZPA 4REZA 3SR6A 2K8CA 1HZ5A 2WDVB 8ICXA 1KF6B 4H2AA 2FJ6A 3NTUA 5KFWA 4RFBA 4TURA 5AKGA 4IL6U 4IR1A 3LB8C 1V1PA 3LDAA 2KJRA 1HUZA 1WRIA 4WJQA 4DSEA 1D9FA 5ALOA 1UWXA 2KHWB 4ZHOA 5ALNA 3AECB 5KFGA 1F0ZA 2A1JB 1K8RB 4U6PA 3NGDA 5CA7A 2KEYA 2XN9C 3C8YA 4CYEA 3DVNU 1YZ7A 4DQQA 5HMMA 1X40A 2GOLA 1SKWA 3RJHA 2Z0DB 1KLNA 3HILA 2VA3A 1V5OA 1RQLA 2K9XA 3UMGA 1NDDA 2ZEQA 3EFUA 3EZ5A 1SE9A 4MGKE 3DWMA 3ZVVA 2JXXA 1I35A 5CHVC 4K4GA 1HIWA 3RB6A 1X66A 4KLMA 5DB7A 4A90A 3NVYA 4C00A 1V49A 3DBRB 5AM5A 3PT2B 2XK5A 3V6CB 1I4HA 4S17A 1V8CA 4UBBA 2GBKA 2WXLA 1UELA 4C7ZA 1QKZA 3EFCA 2KOBA 3IHPC 1L8LA 4Y2TA 3RFAA 5J2FA 2WXIA 2V9WA 2FI1A 4N6EB 4RT3A 2NRWA 2GB1A 4F5NA 1N61A 2JY6A 5AM0A 2KNJA 9ICCA 3JVZX 4A9AA 4PS8A 4P4OA 9ICJA 4OJLA 1EXNA 1WGGA 4F4WA 2VANA 2E8MA 2W9MA 2N1VA 1KKXA 1HJPA 2NYVA 4C4VB 3HX0A 3T8MA 1X2IA 2KP7A 3GILA 1L5PA 3CMMB 4KN4A 3DWGC 2AGOA 1JXLA 4YD1A 1I4RA 1IM4A 1VZ8A 3MDCA 1JQ4A 2VJ5A 2ASLA 1TKEA 2FCNA 2JYEA 2KTFA 5A0LA 1X1MA 3UMCA 1UHUA 5LXHA 1D8BA 1NK0A 4WWPA 2MUTB 1PUZA 4NLNA 4YMMA 2LYHA 2ZCBA 3KUCB 1T4GA 2ONQA 1C76A 2F76X 3GV8B 2WDTB 4GLSC 5KFFA 3KOOA 2BDUA 3JPQA 1F52A 1SGHA 2FCMA 3AE5B 4ZOHC 5TR5A 2VA8A 5KAFU 3UXPA 4RQ8A 3MHSD 3M1YA 4KITB 2WX0A 2ZZPB 1YX6B 3NZUA 1A70A 3GOEA 1SL1A 2V9HA 1L6VA 5IIKA 2BKRB 2DYBA 1NYQA 1L8OA 5DBCA 2ICIA 3HUIA 1XF5L 3VRBB 4US8A 3JPPA 4ECWA 2IY0B 2WXGA 1B4FA 2FE9A 1ESFA 3H40A 2HBLA 2ZXIA 3B0YA 3TBLD 1UF0A 4E3CA 3IG8A 4RPYA 2MSNA 4YR3A 2ESEA 4FA6A 3AQFA 1KRHA 1EU4A 1CUKA 1TKYA 4LNIA 2WLBA 3ECIA 4WWMA 3H8SA 3EUB2 4Z6FA 4PGYA 4KGTA 4F71A 3JPSA 2C7HA 4CF5A 1J2MA 2KX0A 2EZZA 2DNFA 3MC8A 3Q3OC 5KFEA 3WKBA 4DEZA 4DWIA 2DHZA 4FS2A 5DPTA 4XWTA 3KBBA 1WYGA 1QT9A 8ICHA 2EMTA 4PS3A 3ZXVA 3P1MA 4BXOB 2L76A 2FCQA 3FILB 4JUZA 5IO9A 4JX1C 4JE3B 3RR8A 1J0GA 3LDZE 3HHMA 4MGYE 4TUQA 5KHQA 4DK5A 3ZNID 3QX1A 2GMIC 1TZ1A 4K7WA 3PTFC 2HI0A 4MACA 2G45B 1SZHA 2NO5A 5KFRA 1L3TA 4LJOB 1D4BA 5J8YA 1X9XA 5F9LA 2C28A 1YN3A 1NKBA 2O2VB 4NL9A 2KMMA 2KX3A 4DSJA 3PZPA 2VH1A 3AU4A 2KAJA 1QH9A 5FKAC 3KZIU 4GSWA 2K4EA 2BTEA 5J0YA 1O03A 4G11A 4ECQA 3M62B 1UBIA 3VR8B 3NZSA 5KFCA 3U7ZA 3WIMA 5D49A 3RR7A 1MHHE 5J29A 3RJIA 3VTVA 2RQ5A 3LK9A 3UQAA 3PY8A 3GQCA 5L9XA 1WI0A 4EYIB 4YTNB 4I2BA 2CU1A 4N9F4 2INNE 1IXRA 1YZ6A 4RQ4A 3ETRA 3L3FX 2D3CA 3MHZA 2KOXA 5JUMA 2J52A 5FR3A 3ZD8A 3IVFA 2K8AA 3Q8RB 2W7PA 3PRPB 3TMPB 3KHHA 4OJ5A 2BR0A 3VAWA 1SXTA 1SXDA 5EE9A 4KX3A 1JCKB 4WAFA 4C8MA 4WQMA 2DYOA 4HJGE 3A4SC 5EE0A 4QWBA 4KLOA 2KACA 3VTWA 2ZUBA 3IHQB 5ALGA 1Q3UA 2KZRA 3C19A 3SZ2A 1TYGB 3H7PB 1CEZA 3VHTC 1U49A 2QEJC 1RQNA 1V85A 5AUIA 4WJOA 1ZQAA 3NS8A 3AH7A 2BYEA 3KYDD 1IUEA 3L54A 2H3VA 2IDYA 5JRTA 2JQRB 3TADC 3V60A 1XLQA 2G0AA 1K50A 4EELA 3ZJUA 1VJ5A 4QZBA 3SI8A 4RQ1A 4J9KA 2KN7A 7ICVA 3ML8A 3UI3A 4A8EA 1RG6A 4I2GA 4ECTA 2M0XA 1WWUA 3BK2A 1FNVA 4KZCA 3OHBA 5KT6A 7ICMA 2YB4A 4YMNA 2EAMA 3PS6A 2KFJA 3AE4B 3QUBA 3OLMD 3KWLA 2RLTA 2IOHA 1A6SA 3EPGA 1AYFA 5F9NA 5AKJA 3WK9A 2BB6A 4ECZA 1LB2B 2DWQA 8ICRA 4UAUA 2Y1JA 1C4PA 1J7AA 5AM2A 2ZVOA 1Q3VA 1VJKA 4M9HA 1B1ZA 4F8CB 1S77D 3D2NA 5IINA 4UDUC 3CIRB 1Q8KA 3H7IA 5HHHA 3VDZA 4GFJA 4M9NA 3HJEA 3WU2U 5DG7A 3DBLB 3RJGA 3WANA 3U2SC 4IDIA 5ALRA 3UINB 3IG3A 2H3ZA 8ICSA 2XC9A 2A3VA 2HSZA 2EDUA 2QB0B 3UM9A 5J0SA 2G09A 2V1YA 4ECSA 2IHNA 4Z6DA 4DOCA 3OJ4B 4J03A 4XQ8A 4WWNA 2XI9A 2IGHA 3V6KA 3TACB 4M0AA 2K8BB 4ZYSA 1Y88A 2CXYA 4IS7A 5KFZA 5BMHA 1KN5A 3QNMA 1SKSA 1A0PA 2MJ3A 4QZGA 3QU5A 1M94A 2I9GA 4FHJA 4L2YA 4C8OA 1O08A 1L3UA 4IR9A 5HR6A 2JZPA 4NV0A 4HDOA 2ZJ5A 2K25A 2Q0ZX 3E2EA 2LVOA 4WJNA 3T3FA 3RNBC 2L7RA 2R61A 5J2KA 4XUSA 1V97A 1YQ3B 5KT5A 3M6ZA 1E7VA 3I63C 2KFNA 2DKXA 3O13A 3UIOB 5KFBA 1UT5A 3MR3A 4FULA 3RB0A 2RPQA 3BJYA 3TSSA 7ICPA 1EF5A 4JIOU 3C21A 5EOZA 4YWGG 5KFHA 4HPLB 2KTRB 2MEKA 9ICSA 1ZJMA 3GIKA 4W9EA 2W9BB 3BZDB 1B9RA 1YN4A 3URYA 1L0XB 5J0PA 1F2RI 2G1EA 2DKZA 4BKGA 3FM9A 1IBXA 5CHFA 2AJQA 4JWSC 3TQ1A 4TQSA 4BKSA 4I2FA 4W9CA 3AEGB 2YMQA 4GDKA 2EZYA 2MHJA 3PW2A 1D3ZA 3QE9Y 3F53A 2Y9UA 2DF4B 3P4QB 3GV7B 3MFHA 4A3OA 1AN8A 1EO6A 1E8ZA 5DCNA 3D2SA 5IKCM 2H5XA 1TIFA 3BY4B 3MJWA 5DPRA 2B0CA 4USAA 1Z00A 2D8CA 3RCZA 2DL0A 2BQRA 2NS5A 5AHXA 4J9SA 4EBDA 1E8WA 2OOBB 4KGSA 4KKJA 2WWZA 1P0RA 3A33B 2WF6A 3NOBA 5BO4B 3A0BU 1JWSD 4O5CA 3PNCA 4DF4A 4RGNA 5TISU 1ZW7A 2KXJA 1MC8A 3QUTA 1OQRA 3Q8FA 3LWMA 1OXJA 4Y2JA 4C80A 4PH5A 4KLEA 1P9DU 3DBHB 3BIID 3KUZA 3N30A 4EZKA 3PR5B 3JPRA 1VD2A 4P0QA 1SB3C 3G6VA 2AEHA 3H4DA 3OJ3A 3C1ZA 2KFZA 4F5PA 2FAZA 3TUOA 4GXBA 2YY6A 1IPGA 4M6WA 5KT4A 2J4XA 4LDTD 4CO7A 3PZDA 3ML9A 4JV0A 4DS4A 1FEHA 2KKVA 1R7SA 3A9JB 2ZIXB 4GU2A 3F5AA 3PREA 5KFTA 3U26A 3UQ0A 3H8MA 1SIFA 2KMDA 3RMKC 3QAQA 1SIJA 2F1HA 1UNSA 2JR5A 1S1QB 2K6QA 1KTQA 4RQ0A 2BQ3A 4RPZA 4UB5A 3N1XC 4G50A 1NKCA 4FN2A 4W9KA 3E0FA 1WGKA 3V3XA 2DPIA 3UQBA 4B9UA 2W9NA 4F4ZA 1WXAA 3RN9C 3F2DA 2HHSA 4Q43A 1VZ7A 2LWPA 4KGRA 1N2XA 2ZIUA 2VIXA 1N48A 1JRUA 1Q0WB 1WXVA 2KE7A 2ZJAA 2C22A 1A76A 2AWTA 1L4ZB 1H8CA 1RXVA 2M1MA 3BINA 1ZQSA 4C4RA 4NNJB 4KN7A 5F3XB 3ZKJC 4R8UA 1RDFA 4LJPB 7ICEA 1DXSA 4QWCA 3RBDA 9ICXA 4YD2A 1BNPA 2WTFA 4MFCA 2KKCA 1GUAB 1KFSA 3L08A 4ZYNA 4MF8A 3Q8PB 1MA7A 4OZBA 2CKHB 4O9MA 1ZQFA 3QHTA 2N9KA 2ZIVB 3EECA 1XNSA 1LO5D 3NRZA 4HCPB 3WKCA 3Q3JA 2XO7A 5DLFA 1FEZA 2BHNA 5AUKA 3AMZA 2W9CA 2FIDA 3PMNA 1ISNA 2NRZA 1QOGA 2G4DB 5J2RA 4BBNF 2KVZA 3Q14C 3QU9A 3JW0X 4IOIE 4M0WB 2KK0A 5ALEA 5L1KA 2IBKA 2EQYA 4F2RA 2B3AA 4YG2A 2JYTA 5CX3A 1ZRMA 5J0OA 3KKAC 3QYPA 2HOIA 2IPKD 2MQJA 2MJDA 2LFIA 4IKGA 5KFUA 1ZE3D 1T0RC 4OW0A 4MDKE 4EX7A 4KLTA 1V38A 4OJPA 4Q44A 3B2FA 3B0XA 4I6LB 4UB1A 5DPWA 1L3SA 1QLBB 5IA7A 3BWUD 4X57B 1KEJA 2BS4B 3T5LA 2HBJA 1FD6A 1YD8U 2K0PA 2PLPA 3MJ5A 4NJ8A 3GV5B 1D6EC 1WZ3A 1RFKA 2MBQA 1COKA 1PDXA 5AEKB 4C56C 1T6BX 5DB8A 1SV0A 4JWNA 3HW8A 4F8RA 1L5UA 4YSZB 4UATA 4FLHA 3ZI4A 4S0RA 1YJIA 3QIJA 3Q8EA 4N59A 2JMGA 2G08A 3MABA 3QA8A 7ICLA 2WXPA 3N3KB 1ZP0B 4MSMB 1BPBA 3RT3B 4QZHA 1XO1A 1WG8A 4NY8A 3B2GA 1WR1A 3B0AA 2X38A 1ZQHA 1SE2A 2CR5A 9ICPA 1XO3A 3SEBA 2RMMA 3E58A 5ALVA 2ZW0A 3L4PA 1UT8A 4K81A 3WK5A 2C60A 4DOAA 5HHIA 4ECRA 2R8JA 1ACCA 2MU2A 3M8SA 3KZXA 5KFDA 2ISOA 1VLBA 1JX4A 3JPOA 3PVLA 1J97A 3N28A 3TAQA 2JEGA 1WJ4A 3KUDB 4YT0B 3FDSA 1MQ2A 4C8NA 4NWIA 5J2CA 1B22A 3K1RB 5KG7A 1UGJA 4PYZA 3L5KA 4GDLA 4Z6EA 4MHVA 8ICNA 4OVVA 5J0UA 4P4MA 2YMLA 1QLNA 1RYJA 4MGZE 4RMAA 1T94A 2J7QB 5KT2A 5FK9C 2I1KA 2ZCCA 3W5UB 4GGQA 1MI0A 4IM0A 4I29A 4EBCA 3Q8BA 2XICA 3BYTB 3PHWB 3PSIA 3V6JA 4TUUA 3S6JA 1OFFA 4QIWF 1BT0A 3OJUA 2VZKD 2OJRA 5CWRA 1XLNA 2V4QA 5ALHA 4ARCA 2KLCA 2NTTA 3KHLA 1XT9B 4JV1A 8ICUA 2LHTA 4YR2A 5H2FU 1Z19A 1FNUA 3TEYA 4NAWB 2R8KA 4MH8A 2KICA 4A55A 2C2EA 1VR9A 3PGEA 2O6VD 4LDTB 1WWVA 4ACOA 5KG3A 3ISDA 2A1AA 3AEVA 2BWES 4KLFA 4PK1A 3PLVA 4K1RB 3CP8A 4N58A 4F3OA 1U48A 2LMCA 4OZCA 2GOWA 4IC9A 3TARA 1J7CA 1KH0A 9ICWA 3A0HU 3MC0B 3PHXB 3WK7A 4FO6A 1NBFC 4P2HA 5CR0A 5J2HA 4DL6A 2L52A 4GN1A 3R7RA 5LXIB 7ICJA 5IP4D 5DGBA 3QQ8B 4YSXB 1NKEA 4DDID 8ICIA 3I3TB 2DAFA 1QCKA 8ICMA 1FMAD 2WGSA 2OHFA 5KFPA 9ICRA 5L83A 1AQ6A 2DZKA 5BYSA 3I28A 2SAKA 3ZJTA 2IA6A 2EMSA 1TS3A 2JX5A 2C5LC 3K1ZA 1PZNA 3APCA 3CYMA 3U8ZA 3QZ8A 5CB1A 2CN1A 2LI6A 5KFLA 5J2DA 3O65B 2DENB 5D3DA 3VH4B 1A5RA 3GU3A 4UB2A 7ICQA 2ASDA 3LJ3A 1L0YB 4P4PA 1MN8A 4XZ4A 2REXA 3TEXA 1BXTA 3BQTA 5DQGA 1Z1VA 3ISBA 3ISCA 2BQUA 4MM3B 3N97B 3QCAA 4RQ2A 2MAXA 1WMHB 3HVZA 4YFKA 4P0PA 4Q8FA 2HHTA 3GZNB 1ZQNA 2D3DA 1TS2A 5D4BA 3JSVA 1GC7A 5KTQA 4EZ9A 4O3RA 2MW5A 4EFOA 4C8LA 4F2SA 3BK1A 1KTKA 2G9HD 2DYMA 3QXGA 4YMOA 3H0RB 2DGZA 2PFNA 4K3BA 1L0VB 2FMQA 3PO5A 1WGHA 2J53A 2FLLA 4EENA 2E8OA 3AE3B 5CHGA 3LVVA 3HKZC 4MJSB 4J9LA 2JUOA 4KIKB 4EE2A 2HW3A 8ICFA 2KMAA 4DHZB 1R4NI 2QSDA 1GPXA 4NM2A 2ZIWB 4ED7A 4DL5A 2AQ4A 2BCRA 4LNNA 3P4RB 4QW9A 3AU5A 3HM3A 1ECWA 1XD3B 1Z1BA 2KDIA 1NYRA 4KX5A 3A1QB 5FR6A 2AGPA 1WGYA 2EZXA 2EANA 1UA0A 4KLHA 2I1JA 5KFKA 4AYBC 5DDYA 1PVPA 1WSPA 5KFYA 2WXQA 1J19A 4RZRA 2RGFA 3FKYA 5CHWA 4EEYA 4XYCA 4EEWA 4KSLC 7ICIA 1WGRA 4P16A 1JUDA 8ICEA 2B76B 2E1FA 9ICMA 2Y5PA 3TIXA 4PL1A 1SBBB 4C4TA 2BGWA 2ZNVB 5KFIA 1LV5A 3C29A 2FCSA 2QHOA 2HHVA 9ICEA 3KW5B 1KDHA 1VZ6A 5C1ZA 2YMMA 7ICHA 2V4RA 1JRPA 1LVHA 2IYDB 4J9NA 2G07A 3N7RC 2KO3A 5AI6A 2A4ZA 4HXDA 3ZTDA 1TK8A 3U4EG 1WE6A 4Y2SA 1CRXA 2D3GA 3A9KA 2LBOA 2V0GA 1QZEA 3MGVA 3AV8A 4I2JA 3E9SA 2F44A 5D46A 1TY0A 1MSWD 2KIVA 2NPTA 4MGIE 4UB8U 4DL7A 4E74A 1I42A 3RUIB 2K39A 3SDLC 3U7DA 2KDBA 4HDQA 2I6XA 5ALPA 2M4NA 1Q5WB 2W8LA 1RM6C 4R63A 4CF3A 4RQMA 1ZQOA 5AI5A 4RPXA 1KOTA 4M9GA 1S0MA 5G5GA 4YXMA 2X8XX 2R8GA 1JALA 3W1SA 2JXTA 1GB1A 1WX7A 2WQYB 3PRMB 4ANXA 3TEWA 3OTQA 3BS5B 2AQ2B 5GMVA 2IO1B 2WF8A 3D32A 4RM9A 2VZKB 3PV8A 4MFFA 1ZQEA 3BDPA 1HTOA 2RPVA 3V6EB 3ONNA 4ACFA 5KG2A 1ZOYB 4F1SA 4JL9A 4RCOA 3AE1B 3QARA 4PYUA 2JV3A 3CF6E 4QZEA 4Y2YA 1OQQA 3ZNGC 1ZGUB 4URKA 5EWGA 5CP2A 4C4SA 1WRDB 5E6NA 1PGBA 3WK6A 1SKRA 5KFMA 1UBQA 5IIJA 4EEKA 3DVNV 2O6VB 4II2B 3M8RA 4EKUA 4US9A 2F1IA 4RF0A 2NBVB 2HOQA 3OGUA 3ZDCA 4UASA 1XLPA 5J17A 4XWWA 2KQ4X 5ALTA 1WX9A 1P7FA 1NJYA 4M8NA 3RF9A 4AP9A 4L1BA 2Z7JA 3W5VB 2W43A 1S0OA 2KC1A 2K4HA 3KWVA 1OTRB 5ALWA 1DRGA 5BOLA 2WHIA 4BWJA 1WJ6A 1KLVA 3L0WB 2MP2A 2W55A 5KAIU 4UB3A 1PGXA 1TZOA 4J3OD 3PR4A 4PL2A 2Z8LA 3BQ2A 3PW4A 1ZXIA 3F2BA 4I2AA 3IAM1 4DQRA 1WXSA 1QSLA 3O0FA 2LGDA 3NRWA 2GRIA 4OD0A 1YOVB 2IY1B 1OEYJ 3KLSX 2FBWB 2LUEA 4JPSA 2E8NA 5EWEA 2W8KA 1E10A 4II3B 4DS5A 4WH4A 3Q8MA 3GB1A 2JH1A 2N7JA 4DHJD 3TL5A 3P4PB 2G4SA 1N5XA 1HEZE 2PW9A 2JZBB 5BYRA 4PHAA 3PX0A 4C7YA 4M02A 5HP4A 3V05A 1X42A 4KMOB 2PXIA 1SF0A 4RT2A 2NBWB 3DBRI 2BDPA 1Q10A 4CF4A 5KG0A 4DSIA 4D2KA 5ALSA 3SYZA 2L0TA 4J6IA 3RD2A 1FRRA 4FFDA 1D5MC 1ZQTA 2N9XA 2W03A 1DOIA 1F77A 4IUMB 4DQOC 3PW7A 4QWEA 2VH2A 1D8YA 4J9MA 4O3MA 1ZQRA 3T79A 3MR2A 5KG1A 5C23A 2ZPYA 5ALDA 4ZDVA 3KTQA 2NR2A 4IW0A 4WJPA 4PJ0U 4NQLB 2LHEA 2WXRA 4F50A 4ZRQA 4NQKE 4AP4C 2WXNA 8ICPA 4NJ7A 2PMZF 4B0EA 5KG6A 2M17A 4RGMA 1M6YA 4LZDA 9ICOA 2CHZA 4CHKA 8ICTA 5LLIA 2WB1F 2OCEA 1WM2A 3QUQA 2KC2A 4UAWA 1IGDA 5H92C 5FP0A 2G3QB 3AB5A 3GDXA 3QX7A 4WURA 3F5EA 4DFJA 2JRHA 1FO4A 1NI2A 4Z6CA 3CRXA 4LVSA 4O5EA 2CHXA 4KLUA 1GAQB 1QTMA 2C2DA 3L17A 2BPGA 3WAOA 1LQBA 2D2QA 2XBBC 4GLXA 4F91B 1YX5B 5E79U 2MX2A 1DK2A 1YQ4B 4OZAA 2P66A 4DFPA 2MCNB 3R3MA 5IIOA 2MSED 4F4XA 2AL3A 3UF8A 3EPIA 3OHAA 3DEEA 4XRHA 2C7NB 4BOSC 8ICWA 5HKHA 4RNAA 5EE1A 3EWAA 1PK1B 1FM0D 2ZTEA 4M2YA 2G5IB 4BAXA 2KWVB 1S97A 1DGJA 4IRKA 1FXAA 2RR9A 2ZTDA 2YEPB 4Y2XA 1S9FA 3BVZA 4F7ZA 3VC8A 3IT6B 5AKIA 5J0QA 4KLDA 2KFKA 3T3NA 3VCBA 3MFIA 2D5GA 2UVWA 1PK3A 2WHEA 4UBCA 2D11A 4IC7B 1LKYB 5E6OA 3BZCA 1SL0A 2WXHA 4AS1A 1UH6A 2JU6X 2FPLA 2G5HB 5KG5A 4F4YA 2P6UA 1TGZB 2A5UA 1S0VA 3GS2A 3RJJA 5EE3A 9ICIA 2AYOB 5D7GA 2HMXA 2HJ1A 4LNKA 1I4QA 2BBCA 3CW2C 2MBHA 2MWSB 3IBEA 3ZTCA 2WF5A 5AI4A 4MELA 1HQRD 4HPMB 4PGXA 2C2RA 4JWUC 2IGGA 5DPSA 3M6KA 3E56A 3R8BA 4YP3A 2A19A 4FJVB 3Q2AC 1UWMA 2FPKA 1WIAA 4F72A 2KSOB 3DDHA 3NVZA 3RB4A 3NHEB 4QZ8A 4HEA1 3H7SA 5KFVA 2WF7A 3WKEA 1ZQIA 2QARB 3WAPA 1LXDA 2J0KA 3W1YA 1WGDA 1V1OA 3AXCA 3DBSA 1ZKHA 4G3XB 1SV4A 4GIVA 4HWIB 4WIPA 4FZNA 4X5VA 3R2TA 1NOMA 4BX9C 1WJNA 1IGCA 2EKIA 3G6YA 3AE8B 1XQQA 2NO4A 1QQRA 2IBIB 4O3SA 1ZD5A 1ZQDA 9ICAA 4LJXA 1HA5A 4GC6A 1B0XA 4TUSA 4QW8A 2Y1IA 2XY6A 1WCNA 4B9MA 1ZQWA 9ICFA 2NV3A 4YQWA 8ICAA 3BVMA 3NZ3A 3SFDB 2L83A 1JWUD 4WWOA 1NNLA 3HWTA 2FE8A 1EF1A 1SJHD 1RPLA 2K8CB 9ICHA 1KLUD 4IQUA 4RQ5A 2EH9A 2AQ1B 1TAQA 3Q8LA 2KDEB 2KJ6A 1UUPA 1V1PB 2PIAA 3Q3FA 1E7PB 2DAJA 2PKEA 3N32A 1F1HA 1XCTL 1MHXA 3TCAA 2D10A 4RUAA 2AH5A 3AEBB 4DHJB 2DZIA 5ALKA 3KD3A 2KYWA 4HRSA 1UPHA 3AEEB 3OAWA 3RJKA 4QZAA 4DXFA 5GTIU 4HAIA 1NVID 2ZG6A 4GXIA 4NZLB 2R18A 3J81j 2A1JA 1SWWA 2FLNA 1C7YA 4LZGA 1K53A 1TY2A 3OWEB 5AI9A 3BQ7A 3C2KA 2HTME 1L6UA 2RDGA 2ZNVC 3BS7A 3EHVA 2K6DB 3R2IA 8ICVA 5ALQA 3B08A 2LM4A 2H89B 1JI7A 4DFMA 2YN4A 4JV2A 2MBOA 2OEDA 2DX5B 2XK5B 2KK8A 2ALZA 1H4RA 3RNAC 1I7HA 1GG3A 3RB3A 4W9GA 4I2EA 4DBGA 5J0RA 3M9MB 2VJ4A 2FNJB 1IIPA 5KFAA 3SD7A 2BCVA 1JMLA 2LGSA 5J2BA 5KFSA 3N20C 1I4PA 3RRHA 4KLIA 1PYWD 5ALLA 1PFDA 3CWIA 5GXGB 1BNOA 1SL2A 4NLCA 5D2MB 1IV8A 2J6TA 3DBLI 4EZLA 1SEBD 1GNUA 1TTNA 3I9V1 2KN5A 3TFRA 4P7IA 4B9TA 2CU3A 2LVQA 3DVGY 2M0AA 3K75D 4LNOA 4C4VA 2JWUA 2AQ0A 5DLGA 1FIQA 1X6JA 3MC1A 1KL9A 3EW9A 3UXOA 3TAPA 2RDHA 4ZRKA 4KV2A 1S10A 4QJFB 3P63A
chains in the Genus database with same CATH topology
1ET9A 2BW2A 3Q8CA 2MJEA 1FNUA 2J42A 3TEYA 1FCLA 4NAWB 4MH8A 1WWTA 4YXDB 4A55A 1VR9A 2GI9A 2ONQA 1C76A 1EM7A 2L32A 3AEFB 2Y3AA 4GLSC 3AE5B 4ZOHC 3Q69A 3IAS1 4N58A 2LMCA 4OZCA 1HXYD 2SEBD 1J7CA 1A70A 1KH0A 3MC0B 1L6VA 5I4DA 2IGDA 1FXIA 1NYQA 2L52A 4Q2JA 2ICIA 3BYYB 3HUIA 1XF5L 3Q8AA 3VRBB 1ROEA 4US8A 2I38A 5LNK1 1Y56A 3W9CB 2WXGA 1ESFA 2FUG1 2H88B 4YSXB 1WXQA 3RFZB 1I4XA 3PO0A 4NJCA 4CQNA 5HHDG 1FMAD 1D5ZC 5T8IA 2BS2B 2LUMA 1KRHA 1EU4A 4R3DA 2OHFA 1TKYA 5BYSA 2QJLA 4O1NA 2WLBA 4WWMA 2SAKA 3EUB2 4KGTA 3LXFA 1TS3A 3ABVB 2JX5A 1QOAA 3P42A 2DLBA 4TSSA 5E6JA 5D3DA 4TQ0A 1EWCA 3ZQ4A 4B0MA 3EGRA 4XWTA 1WYGA 1L0YB 1QT9A 4HKZE 3P1MA 3FILB 2V3PA 2K22A 3FILA 4JE3B 4JX1C 1C4AA 1BXTA 3TEXA 2QILA 1ZUD2 1YN5A 4MM3B 2PVGC 4KKIA 3MP9A 5D3IB 3HVZA 4MACA 2LGIA 1D4BA 1TS2A 1YN3A 2EELA 2AX5A 2KMMA 5FKAC 2KAJA 3HVDA 1TJEA 4HROA 3BK1A 2M19A 4XDDA 1KTKA 2G9HD 2DYMA 2BTEA 1N5WA 3VQIA 3VR8B 1C4CA 3SFEB 1L0VB 2J53A 3B9JA 1MHHE 3U7ZA 4AQ7A 3AM9A 3AE3B 1N63A 1SE4A 4YTNB 4EE2A 3HRDD 2INNE 1QOFA 4XDCA 2WS3B 4RGTA 5BYQA 2QSDA 1ENFA 3ETRA 1P7EA 1PGAA 1GPXA 2N9LA 3MHZA 3P4RB 3VR9B 3AEDB 3J9CA 2J52A 5FR3A 1NYRA 4PT5A 1T3QA 2KDMA 1WSPA 4YTMB 2WXQA 1SXTA 4WAFA 1JCKB 5EE9A 1D5XC 4WQMA 2DYOA 4HJGE 4P16A 4ARIA 4L23A 5EE0A 2B76B 3AE2B 2ON8A 1F2RC 2KACA 2Y5PA 1SBBB 1TYGB 1C79A 1AW7A 1VZ6A 2HDEA 1FFVA 2QEJC 1JRPA 2LEKA 3AE9B 5AUIA 3IT4B 3AH7A 1IUEA 2IDYA 2JQRB 4TQ1A 3T3OA 1XLQA 1K50A 3U4EG 3ZJUA 3RPFC 3WCQA 4DXGA 2V0GA 2WXMA 3AV8A 3E9SA 1TY0A 3LYYA 3UI3A 5C3JB 1YNTE 5JXVA 3BK2A 1FNVA 2WXOA 1QILA 1VRAB 4MT5A 3VRAB 3AE4B 3KWLA 4LTUA 1RM6C 1AYFA 4NAMA 2BB6A 4YTPB 2DWQA 5G5GA 1AWDA 1JALA 3W1SA 2JXTA 1GB1A 3TEWA 2WQYB 1C4PA 2KWDA 3BVGA 1J7AA 2AQ2B 1C77A 4OVZA 1VJKA 1B1ZA 2VZKB 1JWBD 4UDUC 2RPVA 3CIRB 1ZOYB 4RCOA 3AE1B 3U2SC 1OQQA 4IDIA 2K3UA 2PTLA 1PGBA 1BMLC 4US9A 2WXFA 4RF0A 4LLGM 1XLPA 1ZPSA 4XWWA 2KQ4X 1P7FA 2AQ3B 4L1BA 2IGHA 2MH7A 1E6EB 3U52E 3W5VB 3KWVA 4ZYSA 2WU2B 5BMHA 2MJ3A 4L2YA 2W55A 1PGXA 2WXKA 1TZOA 4J3OD 1DOXA 2Z8LA 2JZPA 1ZXIA 3IAM1 1JWMD 5HFYA 1K51A 2ACZB 3AE7B 2GRIA 2TSSA 1EWYC 2R61A 2WP9B 2BS3B 2FBWB 3KLSX 1V97A 1MVKA 1YQ3B 3O13A 4JPSA 1E10A 4WH4A 3GB1A 5BMIA 3TSSA 2L1AA 2N7JA 2ZW1A 3P4PB 1N5XA 1I4GA 1HEZE 2PW9A 1XLOA 5BYRA 4YWGG 1NEKB 5BMGA 4C7YA 1N60A 2LHDA 3V05A 2MEKA 1SF0A 2QIEB 1Q10A 1FFUA 1FRDA 1C9FA 3BZDB 1QF6A 1B9RA 1KFYB 1YN4A 1L0XB 3URYA 4D2KA 4P6VF 1FRRA 1F2RI 2LJIA 2G1EA 4YSYB 1D5MC 2PMVA 1IBXB 1DOIA 1GOZA 1EU3A 2QMTA 1F77A 1IBXA 2YEPF 4GDKB 4JWSC 4DQOC 3AEGB 2KN4A 3I57A 1ET6A 3P4QB 1CZPA 1AN8A 2DBYA 4RGOS 4USAA 1VDVA 1HZ6A 2LHEA 2JSVX 4ZRPA 3ZGZA 2XNAC 2WXRA 1T5XD 2NTSA 4ZRQA 1XXGA 2WXNA 4KGSA 4KKJA 3EA6A 4B0EA 2K5PA 4RGMA 2PKOA 4ITKA 1JWSD 1TS4A 4A8XC 4OHJA 1IGDA 5H92C 3AB5A 4RGNA 4WURA 1N62A 1OQRA 2N0SB 1DYQA 3Q8FA 1FCCC 1FO4A 4C80A 3PZ8A 3BIID 1GAQB 1SB3C 3TUOA 2WXJA 2BT6A 2V3NA 4HKQA 1TKGA 1ZDVA 5C2TB 2J4XA 3FAHA 1YQ4B 3N9YC 4LK0M 4OZAA 1FEHA 1R7SA 3TEZA 2NMQA 1STEA 2PVOD 2Q5WD 3AEAB 4RH6A 1SIJA 3AN1A 1GB4A 1ZXHA 1UNSA 4RNAA 5EE1A 4A6QA 1FM0D 3NS1A 3AE6B 2INPE 1FXAA 1DGJA 1WGKA 3V3XA 2YEPB 2W3RA 1RWSA 3BVZA 3IT6B 1J7BA 3NVVA 2WU5B 3T3NA 1CQVA 1VZ7A 2D5GA 4KGRA 1SE3A 2Y5CA 2E3TA 3FC4A 5G5HA 4AS1A 1L4ZB 2WXHA 2JU6X 1TS5A 1YJJA 1MPEA 3ZJVA 2M56B 3GS2A 5EE3A 5D7GA 1I4QA 2BBCA 2BYTA 1E0ZA 4XE0A 4OZBA 1HQRD 2N9KA 1LO5D 2IGGA 3NRZA 3GP7A 4JWUC 5HG2A 3E56A 3R8BA 2W3SA 5AUKA 3AMZA 1UWMA 4ZHPA 1JW9D 1QOGA 2BB5A 1ZDXA 2W82A 4IOIE 3MFGA 3NVZA 4RF1A 2JYTA 4M0WA 1XCQL 4HEA1 4KX6B 2IPKD 2CJNA 2MJDA 1JWAD 2LFIA 4IKGA 1ZE3D 4OW0A 1BUIC 3B2FA 1V1OA 4WIPA 5HI1A 1QLBB 1SSNA 3R2TA 3BWUD 1NENB 3H8HA 1IGCA 2EKIA 3PZ7A 3AE8B 2BS4B 1YMHE 1QQRA 1JROA 1FD6A 2K0PA 1HA5A 2E6XA 2PLPA 3MJ5A 1SJED 1D6EC 1QOBA 3SFDB 1RFKA 3BVMA 1NI3A 3NZ3A 5MPOA 1PDXA 3NVWA 1JWUD 1T6BX 2L83A 4C56C 3KQ4A 2FE8A 1SJHD 1KLUD 4REZA 3SR6A 4YSZB 1HZ5A 2WDVB 4H2AA 1KF6B 3NUHB 1C78A 2AQ1B 1YJIA 4RFBA 1UUPA 1V1PB 2PIAA 1E7PB 3LB8C 3Q8EA 1V1PA 4N59A 1XCTL 2WXPA 1MHXA 2CJOA 1ZP0B 1WRIA 3AEBB 1CJEA 1UWXA 1DOYA 4ZHOA 3B2GA 4HRSA 3AEEB 3AECB 2X38A 4DXFA 1NVID 1F0ZA 4NZLB 5TSSA 1KLGD 1SE2A 3C8YA 1XO3A 2XN9C 3SEBA 2RMMA 1TY2A 1K53A 2WDRB 3OWEB 2ZW0A 1CK1A 3L4PA 2HTME 1L6UA 1XEEA 2RDGA 2K9XA 3R2IA 1ACCA 3DWMA 3W2DA 2H89B 3P4SB 1VLBA 4TMAB 3IXSA 4A90A 2OEDA 3NVYA 3ZJTA 4YT0B 1I7HA 2WDQB 5H8YE 1I4HA 1UGJA 1V8CA 4GDLB 2WXLA 4C7ZA 1QKZA 1PUTA 1JMLA 2WXIA 4N6EB 3ZYYX 1RYJA 2GB1A 1I4PA 1N61A 1PYWD 1PFDA 3CWIA 5FK9C 5GXGB 2WNMA 3W5UB 1E9MA 4A9AA 2I2YA 1MI0A 2V4IB 1M4VA 3Q8BA 3BYTB 1SEBD 3I9V1 4FXCA 2W54A 2IJ0A 1FNWA 1K52A 2CU3A 1OFFA 2M0AA 1L5PA 3DWGC 2VZKD 2JWUA 1I4RA 1VZ8A 1XLNA 1JQ4A 1FIQA 4ARCA 1TKEA 2NTTA 2JYEA 1L4DB 2RDHA 3P63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE9 A;  3VR8 B;  1NEK B;  2MJE A;  4WQM A;  4C7Y A;  5EE0 A;  2B76 B;  1N60 A;  4JWU C;  3NRZ A;  1SF0 A;  2QIE B;  3AE2 B;  1WWT A;  4YXD B;  1FFU A;  1FRD A;  2W3S A;  5AUK A;  1QF6 A;  1B9R A;  3AMZ A;  1KFY B;  1TYG B;  1UWM A;  4ZHP A;  1JW9 D;  4P6V F;  4YTP B;  1QOG A;  3AEF B;  1FFV A;  1FRR A;  1JRP A;  2G1E A;  2LEK A;  3AE9 B;  4YSY B;  5AUI A;  3AH7 A;  3AE5 B;  3NVZ A;  4ZOH C;  1IUE A;  1DOI A;  2JQR B;  4JWS C;  4N58 A;  1XLQ A;  4KX6 B;  3AEG B;  2CJN A;  2MJD A;  1JWA D;  3RPF C;  3WCQ A;  1J7C A;  1A70 A;  3P4Q B;  1CZP A;  2DBY A;  1L6V A;  3B2F A;  1FXI A;  3AV8 A;  1NYQ A;  2L52 A;  1QLB B;  5C3J B;  3HUI A;  1NEN B;  3VRB B;  4USA A;  1VDV A;  2EKI A;  1ROE A;  4US8 A;  3AE8 B;  2BS4 B;  4YSZ B;  1JRO A;  3W9C B;  2H88 B;  4YSX B;  3SFD B;  1QOB A;  1WXQ A;  1RFK A;  3VRA B;  1NI3 A;  3AE4 B;  5MPO A;  3KWL A;  1PDX A;  1RM6 C;  3NVW A;  2L83 A;  3PO0 A;  1AYF A;  4LTU A;  1FMA D;  2K5P A;  2BS2 B;  1KRH A;  2PKO A;  3SR6 A;  2OHF A;  4ITK A;  1TKY A;  2DWQ A;  2WDV B;  5G5G A;  1AWD A;  2QJL A;  1KF6 B;  2WLB A;  4WWM A;  1JAL A;  3EUB 2;  3LXF A;  2WQY B;  1YJI A;  2JX5 A;  3ABV B;  1QOA A;  1J7A A;  2PIA A;  3AB5 A;  5H92 C;  1E7P B;  1VJK A;  3LB8 C;  4N59 A;  1N62 A;  1OQR A;  2N0S B;  1JWB D;  1ZP0 B;  2CJO A;  1FO4 A;  1WRI A;  4C80 A;  3AEB B;  1CJE A;  3CIR B;  1WYG A;  3BII D;  1QT9 A;  1DOY A;  4ZHO A;  3B2G A;  1GAQ B;  1ZOY B;  3P1M A;  4HRS A;  1SB3 C;  1DOX A;  3AEE B;  3AEC B;  3AE1 B;  2BT6 A;  1NVI D;  2K22 A;  4JX1 C;  1F0Z A;  1OQQ A;  1TKG A;  4IDI A;  1XO3 A;  1ZUD 2;  5C2T B;  2WDR B;  3FAH A;  2PVG C;  3L4P A;  1YQ4 B;  2HTM E;  3HVZ A;  1L6U A;  1R7S A;  4US9 A;  2K9X A;  3DWM A;  1XLP A;  2H89 B;  2PVO D;  2Q5W D;  3P4S B;  1VLB A;  2AX5 A;  2KMM A;  3AEA B;  1SIJ A;  3AN1 A;  2KAJ A;  3NVY A;  2MH7 A;  1TJE A;  1E6E B;  4HRO A;  3W5V B;  5EE1 A;  4YT0 B;  2M19 A;  1I7H A;  1FM0 D;  2WU2 B;  2WDQ B;  3NS1 A;  5H8Y E;  3AE6 B;  1N5W A;  1V8C A;  2MJ3 A;  1FXA A;  1DGJ A;  3SFE B;  4C7Z A;  1L0V B;  3B9J A;  2W55 A;  1WGK A;  1PUT A;  2W3R A;  1RWS A;  3AM9 A;  4N6E B;  3AE3 B;  3ZYY X;  1N63 A;  1ZXI A;  1J7B A;  3NVV A;  1RYJ A;  2WU5 B;  4YTN B;  1N61 A;  1PFD A;  3CWI A;  5GXG B;  3HRD D;  2Y5C A;  3W5U B;  2E3T A;  1E9M A;  1QOF A;  2ACZ B;  2WS3 B;  3AE7 B;  3FC4 A;  4A9A A;  5G5H A;  1EWY C;  2WP9 B;  3ETR A;  1GPX A;  4FXC A;  1YJJ A;  2W54 A;  2BS3 B;  2FBW B;  2M56 B;  1V97 A;  3AED B;  3P4R B;  1YQ3 B;  3VR9 B;  2CU3 A;  1E10 A;  1NYR A;  1OFF A;  1L5P A;  3DWG C;  5EE3 A;  1T3Q A;  1XLN A;  1JQ4 A;  1FIQ A;  1E0Z A;  1TKE A;  3P4P B;  1N5X A;  4YTM B;  3P63 A;  1XLO A; 
#chains in the Genus database with same CATH topology
 1ET9 A;  3F2C A;  5L1M A;  1JIH A;  2J42 A;  1FCL A;  3ZRC A;  4DSL A;  2PE6 B;  2BCS A;  2MUT A;  4YXD B;  2XID A;  1L7P A;  4LCD E;  4RM8 A;  4I28 A;  5IOI A;  2GI9 A;  3S2A A;  4DL3 A;  1EM7 A;  3QU2 A;  2LXC A;  2L32 A;  4O5K A;  2Y3A A;  1G6J A;  2ZPN A;  3RTV A;  1PVQ A;  3THV A;  3Q69 A;  2RD0 A;  1TAU A;  2H3Q A;  4O3O A;  1X9S A;  5KFQ A;  2SEB D;  3LYS A;  4ICU A;  4UAZ A;  1U47 A;  2IGD A;  1IP9 A;  1KFT A;  1FXI A;  5AIC A;  4FJZ A;  2JZ3 B;  4Q2J A;  8ICQ A;  9ICV A;  3H9D A;  2I38 A;  3B1L X;  5LNK 1;  2BYF A;  4NLB A;  4GXJ A;  3DQV A;  1ZJN A;  2XY7 A;  2KJ8 A;  2FUG 1;  2NBU A;  2H88 B;  2N7E A;  1WXQ A;  1E7U A;  1I4X A;  2BPF A;  3PO0 A;  2EAO A;  1R4M I;  1SGG A;  1D5Z C;  2JF5 A;  5T8I A;  4NM1 A;  1QSS A;  1U4A A;  3ED5 A;  2FIF A;  2QJL A;  3ABV B;  2PJH A;  1ZET A;  2DLB A;  4TSS A;  1ZD4 A;  9ICU A;  2K8H A;  4TQ0 A;  2KAN A;  1ZOL A;  4PZN A;  9ICB A;  4G0N B;  3C28 A;  4IQW A;  1N56 A;  4HKZ E;  1ARO P;  2IHM A;  2R2O A;  3H1U A;  4BXO A;  2V3P A;  4DOB A;  1S5L U;  2K22 A;  3FIL A;  1C4A A;  1WF9 A;  2QIL A;  4E71 A;  3AI5 A;  1YN5 A;  4O3P A;  2NVU I;  5D6J B;  4KKI A;  4F4K A;  1WZ0 A;  5D3I B;  3ZDD A;  3A4R A;  1UD7 A;  1SV0 C;  1E8X A;  2LGI A;  4BKS D;  1DOQ A;  3QZ7 A;  2EEL A;  1RYU A;  2AX5 A;  2UU7 A;  2O2V A;  3KFU F;  3HVD A;  3MGH A;  1T0Q C;  3PST A;  2L0F A;  4PHP A;  2KKP A;  2PEA A;  4ELT A;  2OXO A;  5B66 U;  1C4C A;  1WE7 A;  4AQ7 A;  2QCZ A;  3B9J A;  1NK9 A;  4DL2 A;  5AIB A;  4EZ6 A;  3VH3 B;  1JXE A;  2KWU B;  1N63 A;  5KFJ A;  5DKW A;  2JZZ A;  1SE4 A;  3DBH I;  3HRD D;  4JMU A;  4TQR A;  2RDJ A;  2WS3 B;  2DZJ A;  3T5H A;  4RGT A;  4PS7 A;  5J2G A;  5BYQ A;  1ENF A;  3C2M A;  1ZQG A;  1P7E A;  3QK0 A;  3J9C A;  4P1C C;  4J9Q A;  4KDL B;  4AWJ A;  3SU8 X;  5ALF A;  3KHR A;  4PT5 A;  5J2E A;  1RAX A;  1GJZ A;  4MEX A;  3SV4 A;  1V80 A;  2C7M B;  4YTM B;  3H4B A;  4O3Q A;  4XA5 A;  5B5E U;  1D5X C;  3RH4 A;  2WYQ A;  4IM3 A;  1URJ A;  3MBY A;  3K9P B;  4L23 A;  4ARI A;  2ON8 A;  1F2R C;  1XS9 D;  1T0Y A;  3AUL A;  4QZD A;  2YB1 A;  4I2H A;  1C79 A;  3H7P A;  4JB3 A;  2FLP A;  2HDE A;  2FMP A;  3IT4 B;  2O6K A;  5ALM A;  4W9D A;  3QWZ B;  4B6W A;  3RNG C;  2K4P A;  3T3O A;  3D2Q A;  2ZJD A;  3UQ2 A;  3DOW A;  1OGW A;  3RPF C;  3WCQ A;  4NLK A;  3VUY A;  2LMR A;  3ZO5 B;  2WXM A;  4ASW C;  4OJO A;  2XGP A;  2L5Y A;  1KQQ A;  3ZDE A;  4I2C A;  2BKE A;  2UWQ A;  1YNT E;  3LYY A;  5C3J B;  5L95 C;  4ZRJ A;  1ZD3 A;  1R4N B;  2Y0S F;  2BF8 B;  1QIL A;  3C2L A;  1ZQL A;  5DGA A;  3ZDT A;  3WKA A;  2PE9 A;  4MT5 A;  5AZG A;  2ZXH A;  4LTU A;  3T5J A;  2HVH A;  1GC6 A;  1YJ1 A;  3IG5 A;  1AWD A;  3Q8K A;  3GFK B;  2KD0 A;  2MA1 A;  5C0Y A;  2KWD A;  3BVG A;  4OVZ A;  2R2Q A;  3UPQ A;  4MF2 A;  4J9O A;  2ASQ A;  4U7C A;  2IO0 B;  5G55 A;  1K1Q A;  2JVC A;  4YN4 A;  3IFW B;  3T5K A;  3UMB A;  2ZUD A;  2MLB A;  4DQP A;  3C1Y A;  4AJW A;  3PSF A;  2LJ5 A;  3NUQ A;  4ECX A;  3ZLZ A;  3R66 C;  2WXF A;  2QB0 A;  4FHK A;  1NJW A;  4ANU A;  2AQ3 B;  3PX6 A;  2K1F A;  1B43 A;  4HPP A;  2P6R A;  3U52 E;  1E6E B;  1U4B A;  4BKT A;  2GBJ A;  4M9L A;  2FUH B;  2WU2 B;  2IZV B;  2K8B A;  3RYT A;  2N1W A;  2B21 A;  4UAV A;  1HEK A;  2WXK A;  2UVV A;  1Z4O A;  4M01 A;  1DOX A;  5AM4 A;  2MA9 B;  4QIW C;  4F5R A;  4JQW C;  3SAH A;  4GIB A;  9ICG A;  1K51 A;  3Q3N C;  2JGA A;  1K5O A;  2OJW A;  5AZH A;  1EWY C;  2WP9 B;  8ICO A;  2BS3 B;  5DBA A;  3RBE A;  1MVK A;  3TKA A;  4QZF A;  4B9V A;  3KHG A;  3N1Z C;  3C5G A;  3RAQ A;  1CMX B;  4IG7 B;  1I4G A;  4CCH A;  5KNI A;  1OQY A;  3PRZ A;  4PGQ A;  1L2N A;  4AOF A;  2JWZ A;  5JH5 C;  5ALX A;  9ICN A;  1N60 A;  3V62 A;  4FE3 A;  5ALJ A;  2D6F C;  2KTR A;  4UW9 A;  2LZ6 A;  2DQN B;  1QF6 A;  2W9B A;  4OO1 J;  4PZO A;  5JZE B;  2LGY A;  5AK6 A;  2L3Z A;  2PMV A;  1IBX B;  2C9W B;  1T8E A;  1GOZ A;  2LRW A;  4GDK B;  1P3Q U;  4W9F A;  2DFL A;  4YCX A;  3M9N B;  1E5W A;  2NRX A;  3QU4 A;  3TFS A;  3TI0 A;  3HPO A;  1TE2 A;  5EDS A;  2G06 A;  1ET6 A;  3AL0 B;  3I57 A;  5III A;  2DBY A;  4RQ3 A;  2BPS A;  1MFW A;  7ICO A;  4UB6 U;  1ZQY A;  2KJ9 A;  3QUC A;  3ZD9 A;  4RGO S;  1J2N A;  3RZW C;  1Z00 B;  4QNL A;  5L1L A;  1KJT A;  4R65 A;  2BQQ A;  2JSV X;  4DXA B;  2NTS A;  5AI0 A;  2E5S A;  1XXG A;  4KTQ A;  1ZQQ A;  1YT3 A;  4F5O A;  3Q8S B;  2YX8 A;  1NK8 A;  2WFA A;  3EA6 A;  1RFA A;  2M8S A;  2Y9T A;  2K5P A;  1BVS A;  2OH2 A;  2JEF A;  2PKO A;  2KZZ A;  4UAY A;  4K3C A;  1MJD A;  1RZT A;  2BPC A;  2LM1 A;  2VA2 A;  4A8X C;  4DLE A;  2J0M A;  4ED1 A;  4OHJ A;  2JRI B;  2AU0 A;  2WAQ C;  5T14 A;  2NCN A;  2ZJ8 A;  3L10 B;  1N62 A;  2KHV A;  2W11 A;  1DYQ A;  1FCC C;  2YQE A;  5KG4 A;  4M00 A;  2QC8 A;  3PZ8 A;  2XGQ A;  3QEB Z;  4IRC A;  1CI4 A;  4P0Q B;  1COO A;  2NRV A;  3RH5 A;  2HHU A;  2KMC A;  2KNB A;  3OG5 A;  2R8H A;  1HE8 A;  2WXJ A;  4Q45 A;  7ICF A;  2V3N A;  4J9R A;  4ICA A;  2KZ3 A;  3DDC B;  4M6W B;  3PX4 A;  3I1Y A;  1ZDV A;  2JEI A;  2LVP A;  5C2T B;  4FBJ B;  3FAH A;  5C5J A;  3UIP B;  4BDP A;  4LK0 M;  3BZK A;  2KQ7 A;  2F1J A;  1JN3 A;  4DWF A;  2W9A A;  2NMQ A;  3A9J A;  2ZIX A;  3Q6B A;  3ZRF A;  2Q5W D;  3DHI C;  3W1S C;  4QWA A;  2R8I A;  3PVX A;  3AEA B;  4IWP A;  5D94 A;  3AN1 A;  1GB4 A;  4XGA B;  1E90 A;  1RYR A;  4A6Q A;  5J0X A;  4IQV A;  3AE6 B;  1ZQ1 C;  2INP E;  4BVU C;  3M3J A;  3TAN A;  1NK7 A;  2FDR A;  2W3R A;  4RNO A;  1BPZ A;  4G3I A;  3RNF C;  5CEH A;  5AK4 A;  3NVV A;  1J7B A;  4DQI A;  1CQV A;  2ZIU B;  2DUY A;  4RUC A;  3FC4 A;  5G5H A;  3H8W A;  2LGX A;  2F77 X;  1U9L A;  2GWS A;  1MPE A;  4YR0 A;  4BOZ B;  2FMS A;  4R8U B;  4FZM A;  2HE7 A;  3KVF B;  1WCL A;  4Y2R A;  4ELU A;  9ICK A;  4FBU A;  2JT4 B;  3GZN I;  2GBN A;  4XE0 A;  3M63 B;  4JLC A;  2GO7 A;  2N9E B;  5JU5 A;  4DFD A;  2HBM A;  4O3N A;  3M95 A;  2ZIV A;  1BPY A;  2MBB B;  3GP7 A;  3DCG A;  5HG2 A;  2PFP A;  2XEW A;  2W9C B;  1AAR A;  1NJZ A;  1UCV A;  4CGZ A;  2PI5 A;  5HR7 A;  3UGB B;  3M7D A;  3EYZ A;  4EX6 A;  3SEN A;  2ISP A;  2D3A A;  4DF8 A;  2AL6 A;  2W82 A;  3JYU A;  4KLL A;  2EAP A;  5CTR C;  5DG9 A;  4F92 B;  4M04 A;  4M0W A;  1XCQ L;  1Z2M A;  2GBM A;  5J8Y C;  1LFD A;  1N6Z A;  1JWA D;  2KQS A;  2J6U A;  2D07 B;  1KRP A;  4NL9 C;  1TAM A;  3PML A;  2Y5B B;  2I1Q A;  1TKD A;  2MRL A;  1TFR A;  2UYZ B;  5HI1 A;  2OYY A;  4HJK A;  1V5T A;  1WM3 A;  3ENE A;  3PZ7 A;  7ICR A;  4NXZ A;  1L7M A;  1L3V A;  1YMH E;  3UXN A;  3H0M B;  1U45 A;  3CST A;  4C0Z A;  4FS1 A;  4NPN A;  1Z5S B;  2KT7 A;  4DL4 A;  3ETL A;  3NVW A;  3ICX A;  1YQB A;  2F8K A;  2HHQ A;  2LYB A;  4CRX A;  4M9J A;  3NUH B;  1C78 A;  1RRB A;  4Y2P A;  2KHQ A;  1ZQM A;  2IMW P;  3HK0 A;  1MG4 A;  2LXA A;  4GMV A;  2F2A B;  2CJO A;  5DQH A;  5JHA A;  1HTQ A;  1CJE A;  5KT3 A;  5CRX A;  5IAA C;  8ICZ A;  1DOY A;  1GO3 F;  1UGM A;  4JK1 A;  4E0D A;  3LVW A;  3RI7 C;  2N9P C;  1NK5 A;  5TSS A;  1KLG D;  5TZV A;  4B6J A;  4EYH B;  2WDR B;  5G2N A;  2ASJ A;  2QKQ A;  1CK1 A;  1WFY A;  5KT7 A;  5AKE A;  4KLJ A;  1XEE A;  3AU2 A;  4RNN A;  1OUQ A;  1NK4 A;  4MH0 E;  5AI8 A;  4TUP A;  3PW0 A;  2RRD A;  4TV3 A;  5AK3 A;  3W2D A;  1V9J A;  4K4I A;  3P4S B;  5DB6 A;  4TMA B;  3IXS A;  2J6S A;  2WDQ B;  5H8Y E;  4GDL B;  1P7D A;  3ONS A;  3U30 A;  2V3S A;  4ANW A;  2MRP A;  2GH1 A;  3PSP A;  2XVT A;  1PUT A;  2D3B A;  1EUV B;  3MC9 A;  2BGF A;  3VUX A;  5AZF A;  2Z59 B;  3ZYY X;  2P35 A;  2INC C;  3I5J C;  2HD5 B;  2WNM A;  1E9M A;  2F3N A;  3GII A;  1ZQK A;  1WXM A;  2I2Y A;  2V4I B;  3OSN A;  1M4V A;  2UVU A;  4FXC A;  2W54 A;  3TAD A;  2IJ0 A;  1FNW A;  1Z4N A;  4RQN A;  1K52 A;  2AXT U;  2KWC A;  3PPA A;  4ZRI A;  2BCU A;  5HML A;  8ICY A;  3IP4 B;  4K7U A;  1L4D B;  1KM7 A;  3QU7 A;  2BW2 A;  3Q8C A;  2MJE A;  5IIM A;  2E1E A;  8ICG A;  4B9N A;  5JTI A;  2KJH B;  1WWT A;  4NAW A;  1T7P A;  5E6P A;  1X6I A;  4FZL A;  2IO3 B;  4Y2U A;  3AEF B;  4C8K A;  2E8P A;  5J2I A;  4ED0 A;  1TK0 A;  4ED2 A;  3ZDM C;  1V2Y A;  1RLF A;  4GB9 A;  3IAS 1;  1ZYQ A;  1L6N A;  1HXY D;  3ZXR A;  1S0N A;  3OSP A;  4Q8E A;  4BJQ A;  2PMZ C;  5I4D A;  2GLS A;  3RJE A;  3DV9 A;  3DHG C;  4QZC A;  4FJY A;  3BYY B;  4I6P A;  5KL1 B;  3Q8A A;  1ROE A;  3SQI A;  2WB1 C;  1Y56 A;  3VXW A;  1BPX A;  3W9C B;  4MEM A;  1WY8 A;  3LWL A;  3EC8 A;  2HVI A;  4F93 B;  3RFZ B;  4GC7 A;  4NJC A;  2LKY A;  1QQ7 A;  3H0L B;  3N7P D;  4DO9 A;  5HHD G;  7ICN A;  4CQN A;  2BS2 B;  5EWF A;  2LUM A;  3NG0 A;  4P1B C;  4R3D A;  2L00 B;  2KVS A;  4B9S A;  3VTU A;  4O1N A;  5J2A A;  1XSP A;  5JHB A;  9ICQ A;  3LXF A;  1Q46 A;  1QOA A;  4OJ6 A;  2CS4 A;  3P42 A;  2PFO A;  3K4G A;  3RJF A;  5E6J A;  1EWC A;  5ALU A;  3ZQ4 A;  3ZW3 A;  4DSK A;  3EGR A;  4B0M A;  1HUO A;  5J0W A;  3QC8 B;  1X9W A;  3ZDA A;  1SZP A;  3C23 A;  4IWQ A;  2RDB C;  1DK3 A;  3VUW A;  5GTH U;  1ZUD 2;  2JRZ A;  3N7S C;  1ZQB A;  2PVG C;  4KLG A;  3Q3M C;  4MM3 A;  3MP9 A;  4DFK A;  2AGQ A;  4P0P B;  2YVC A;  2AHO B;  3ALR A;  1WMH A;  2VKQ A;  2KZM A;  4QZI A;  1V9P A;  4F5Q A;  3JSV B;  3PSE B;  1LGR A;  4UQG A;  1ED1 A;  2QDF A;  2W7O A;  4ECV A;  1TJE A;  2KDF B;  4HRO A;  7ICG A;  2M19 A;  4XDD A;  4UB4 A;  1N5W A;  1F0M A;  1R4M B;  3VQI A;  2XY5 A;  3SFE B;  2YLM A;  3AM9 A;  2LYA A;  7ICS A;  4BWM A;  4HYK A;  2CHW A;  3PLU A;  3PW5 A;  1Q1O A;  4MJS A;  1QOF A;  4KIK A;  4XDC A;  2JHD A;  2V4L A;  1PGA A;  3SAF A;  2N9L A;  3T9L A;  2ZIW A;  4IQT A;  3VR9 B;  5KFO A;  3AED B;  3OJS A;  2JH7 A;  1TT5 B;  2GLE A;  2OM6 A;  5IIL A;  3H8J A;  4W9H A;  2YMP A;  1T3Q A;  3A1Q A;  3DPD A;  1C3T A;  3WK4 A;  2N1R A;  2K60 A;  2KDM A;  4DSF A;  4IRD A;  3RNC C;  1RYS A;  4FBT A;  3CNH A;  3AE2 B;  1XSN A;  3JPN A;  4ICV A;  2K89 A;  5BPC A;  4NY0 A;  1AW7 A;  2HHW A;  1FFV A;  3I76 A;  3IDW A;  2OEH A;  2LEK A;  3HM6 X;  3AE9 B;  4M8M A;  7ICK A;  4TQ1 A;  2DPJ A;  4EOY A;  1WUD A;  4KDI C;  1SWV A;  3X0W A;  3A9K B;  2IOF A;  5AM3 A;  2KJ5 A;  3ZNZ B;  2VRR B;  5BOM A;  5AM1 A;  4DXG A;  2WF9 A;  2K4I A;  2NPT B;  1WX8 A;  2W04 A;  5JXV A;  3MR6 A;  2YTU A;  1ZQX A;  2KVR A;  3MGI A;  2WXO A;  4RQ6 A;  1ZQP A;  3ZUN A;  1NZB A;  1VRA B;  2N4F A;  5L1J A;  4ECY A;  2ZVN A;  5AKK A;  3VRA B;  5K4L A;  2IO2 B;  1J8C A;  2FPM A;  4NAM A;  3SAG A;  3V7J A;  4I27 A;  1ZQJ A;  1TK5 A;  4YTP B;  1QQ6 A;  3WAL A;  3SMV A;  2Z0E B;  1C20 A;  3RRG A;  1XSL A;  3ZDB A;  1C77 A;  2RHF A;  3BS5 A;  4RU9 A;  2I5H A;  4ECU A;  8ICL A;  3V61 A;  1JWB D;  3NJT A;  4WAA A;  4DQS A;  4QZ9 A;  2QLT A;  4KMU A;  3RZF A;  3IV6 A;  4MFA A;  1BPE A;  3D6J A;  1XC9 A;  2JEJ A;  3C5F A;  2KD1 A;  2ODG A;  2K3U A;  4Y2Q A;  5AKX A;  2HCF A;  2JPH A;  4A3P A;  2PTL A;  3SD5 A;  1NK6 A;  3C0R B;  2ZTC A;  1BML C;  2CPR A;  2JXJ A;  4I2I A;  1S76 D;  2O6V A;  4LLG M;  1ZPS A;  4ELV A;  2KVC A;  4HK2 A;  4KZ0 A;  4FAD A;  4BUG A;  5DBB A;  2MH7 A;  1WH3 A;  4NJ6 A;  4M47 A;  2J0J A;  5J0T A;  2BVC A;  3X23 A;  2MP2 B;  2OWO A;  4KLQ A;  5ALY A;  4EBE A;  4JWM A;  1OEY A;  9ICT A;  4PHE A;  4YVZ A;  4PHD A;  8ICK A;  4RNM A;  3NAS A;  3ALB A;  1NJX A;  2DZM A;  1JWM D;  3ZIM A;  1IG6 A;  5HFY A;  5AKZ A;  2ACZ B;  3AE7 B;  3GE8 C;  3RNE C;  3V6H A;  4DCC A;  1T3N A;  2TSS A;  4GOC A;  1L7N A;  4IWO A;  3OPX A;  5HNK A;  5DB9 A;  2H3F A;  1E8Y A;  3KKA A;  2KTQ A;  2HJ8 A;  3NY5 A;  4K7S A;  3WKD A;  5BMI A;  4R64 A;  4XX5 A;  2L1A A;  2ZW1 A;  4R66 A;  2LRU A;  1K1S A;  2NRT A;  7ICT A;  3PV1 A;  2LAS A;  1XLO A;  1F44 A;  1P98 A;  1NEK B;  2JZB A;  1MQ3 A;  2F8L A;  2BYV E;  5BMG A;  4DHZ E;  2LHD A;  2QIE B;  5AKY A;  1FFU A;  1FRD A;  1C9F A;  3K9O B;  1KFY B;  7ICU A;  2Q4T A;  3SHQ A;  1DGS A;  4JGH B;  4P6V F;  4AJY B;  1V6E A;  2LJI A;  3Q8Q B;  1S8O A;  2B6G A;  1C1Y B;  3MTN B;  4DLG A;  4TKN A;  4YSY B;  5CJ7 A;  2QMT A;  1EU3 A;  8ICC A;  1JMS A;  2YEP F;  1V86 A;  3APD A;  3KYC D;  2KN4 A;  4LNF A;  1QQ5 A;  3GIM A;  3M9O B;  2GBR A;  2XCA A;  3L13 A;  1CZP A;  1WYW B;  2EKE C;  4BGD A;  3WK8 A;  2KG5 A;  2CRX A;  2PFQ A;  4MSQ B;  4BBN C;  1VDV A;  1HZ6 A;  4ZRP A;  3ZGZ A;  2XNA C;  2IOF K;  4I6N B;  3V72 A;  3RH6 A;  1T5X D;  4KSK C;  4ED3 A;  1L7Y A;  3G6X A;  2M9N A;  1XWL A;  4HLE A;  5ALI A;  2MBE A;  4BFR A;  1YIW A;  4G9B A;  3KH0 A;  2ES6 A;  1S3S G;  1A77 A;  1WJU A;  8ICJ A;  4CNQ A;  1X9M A;  1UZX B;  3DHH C;  3P2B A;  4ITK A;  1TS4 A;  5ALZ A;  3MR5 A;  1LM8 B;  4OCZ A;  5AK5 A;  4KLS A;  2RSU A;  4ZH4 A;  9ICL A;  4HCN B;  3APF A;  3ZNH B;  1UQV A;  2N0S B;  4W9J A;  4ANV A;  4O0I A;  2RDI A;  5J2J A;  4DDG D;  2QB1 A;  2UVR A;  3GIJ A;  2BT6 A;  5KHO A;  4HKQ A;  2LPE A;  1TKG A;  5KL8 B;  1H38 A;  3N1Y C;  3CSF A;  4OVU A;  2BCQ A;  4B9L A;  2XCP A;  4A20 A;  3N9Y C;  3PO4 A;  1ZD2 P;  3VFK A;  3TEZ A;  5DDM A;  4WQO B;  3N4M B;  4K4H A;  2KIW A;  1STE A;  5KFX A;  1ZRN A;  2PVO D;  3IM1 A;  1OW5 A;  3SEI A;  2HHX A;  1TBE A;  1VCB A;  4RH6 A;  3TJP A;  1ZXH A;  1ZQC A;  2LI5 A;  4WJ3 B;  2ZUC A;  3SV3 A;  3IN5 A;  1F9J A;  2KLG A;  1Z3E B;  2HDO A;  1PK1 A;  3NS1 A;  1D8L A;  1FXT B;  3WA0 A;  1ZQV A;  3HP6 A;  4PPX A;  4AUQ C;  1RXW A;  1RWS A;  1KFD A;  1BPD A;  3JPT A;  1TV9 A;  1PVR A;  4UAR A;  3AU6 A;  4NLZ A;  2KFK B;  1BGX T;  2WU5 B;  3AUO A;  3HIZ A;  1IYF A;  1SE3 A;  3RAX A;  2HOF A;  2HBK A;  2Y5C A;  4I2D A;  2E3T A;  5DQI A;  1LKY A;  3HT3 A;  5KFN A;  4Y2V A;  3GE3 C;  4KVG B;  3IRU A;  1TS5 A;  1YJJ A;  2L05 A;  3ZJV A;  2BWF A;  3GZF A;  2M56 B;  2BKF A;  3HKZ F;  4RQ7 A;  4BZA A;  2BZF A;  4EZJ A;  1E0Z A;  1XO0 A;  2RP5 A;  1V81 A;  2BYT A;  2KV2 A;  3ORY A;  4B9K A;  4QWD A;  1PQS A;  1WR6 E;  2N7D A;  1XU4 A;  4HVB A;  2H3I A;  1TVA A;  4YL8 A;  1KBU A;  1KW4 A;  2HTH A;  4EUT A;  2W3S A;  2PI4 A;  3V7K A;  1QSY A;  3V7L A;  5IN7 A;  4ZHP A;  5L1I A;  5AKL A;  1JW9 D;  4AYB F;  2PPH A;  3RUL A;  3R9K A;  2BB5 A;  2L8J A;  3QJZ A;  4ED8 A;  3BQ0 A;  1ZDX A;  1ZQZ A;  3R7Q A;  2KSO A;  2WX1 A;  3MFG A;  4RF1 A;  1KSP A;  4GXK A;  3BQ1 A;  4KX6 B;  4MEY A;  2Y0S C;  2CJN A;  4CDG A;  1FPY A;  1L7O A;  3WAM A;  4IM2 A;  2QAR A;  2LD9 A;  1BUI C;  1F5S A;  1D9D A;  3VVW B;  3AQE A;  4B95 A;  5AIA A;  4CE6 A;  2ATL A;  1MG8 A;  1SSN A;  8ICB A;  3H8H A;  1NEN B;  4W9L A;  3H6N A;  5AKH A;  2WAQ F;  1JRO A;  4W9I A;  2E6X A;  4YXJ A;  1UA1 A;  4QAY A;  1SJE D;  1SXE A;  1QOB A;  2IND C;  1T0S C;  5MPO A;  1NI3 A;  5DG8 A;  3QEA Z;  1Y8R C;  3MDA A;  3KQ4 A;  2M0N A;  3L16 A;  4XC2 A;  3FYH A;  5J18 A;  4ED6 A;  1ZQU A;  4NLG A;  4J9P A;  1P1A A;  3DVG X;  1NZP A;  4REZ A;  3SR6 A;  2K8C A;  1HZ5 A;  2WDV B;  8ICX A;  1KF6 B;  4H2A A;  2FJ6 A;  3NTU A;  5KFW A;  4RFB A;  4TUR A;  5AKG A;  4IL6 U;  4IR1 A;  3LB8 C;  1V1P A;  3LDA A;  2KJR A;  1HUZ A;  1WRI A;  4WJQ A;  4DSE A;  1D9F A;  5ALO A;  1UWX A;  2KHW B;  4ZHO A;  5ALN A;  3AEC B;  5KFG A;  1F0Z A;  2A1J B;  1K8R B;  4U6P A;  3NGD A;  5CA7 A;  2KEY A;  2XN9 C;  3C8Y A;  4CYE A;  3DVN U;  1YZ7 A;  4DQQ A;  5HMM A;  1X40 A;  2GOL A;  1SKW A;  3RJH A;  2Z0D B;  1KLN A;  3HIL A;  2VA3 A;  1V5O A;  1RQL A;  2K9X A;  3UMG A;  1NDD A;  2ZEQ A;  3EFU A;  3EZ5 A;  1SE9 A;  4MGK E;  3DWM A;  3ZVV A;  2JXX A;  1I35 A;  5CHV C;  4K4G A;  1HIW A;  3RB6 A;  1X66 A;  4KLM A;  5DB7 A;  4A90 A;  3NVY A;  4C00 A;  1V49 A;  3DBR B;  5AM5 A;  3PT2 B;  2XK5 A;  3V6C B;  1I4H A;  4S17 A;  1V8C A;  4UBB A;  2GBK A;  2WXL A;  1UEL A;  4C7Z A;  1QKZ A;  3EFC A;  2KOB A;  3IHP C;  1L8L A;  4Y2T A;  3RFA A;  5J2F A;  2WXI A;  2V9W A;  2FI1 A;  4N6E B;  4RT3 A;  2NRW A;  2GB1 A;  4F5N A;  1N61 A;  2JY6 A;  5AM0 A;  2KNJ A;  9ICC A;  3JVZ X;  4A9A A;  4PS8 A;  4P4O A;  9ICJ A;  4OJL A;  1EXN A;  1WGG A;  4F4W A;  2VAN A;  2E8M A;  2W9M A;  2N1V A;  1KKX A;  1HJP A;  2NYV A;  4C4V B;  3HX0 A;  3T8M A;  1X2I A;  2KP7 A;  3GIL A;  1L5P A;  3CMM B;  4KN4 A;  3DWG C;  2AGO A;  1JXL A;  4YD1 A;  1I4R A;  1IM4 A;  1VZ8 A;  3MDC A;  1JQ4 A;  2VJ5 A;  2ASL A;  1TKE A;  2FCN A;  2JYE A;  2KTF A;  5A0L A;  1X1M A;  3UMC A;  1UHU A;  5LXH A;  1D8B A;  1NK0 A;  4WWP A;  2MUT B;  1PUZ A;  4NLN A;  4YMM A;  2LYH A;  2ZCB A;  3KUC B;  1T4G A;  2ONQ A;  1C76 A;  2F76 X;  3GV8 B;  2WDT B;  4GLS C;  5KFF A;  3KOO A;  2BDU A;  3JPQ A;  1F52 A;  1SGH A;  2FCM A;  3AE5 B;  4ZOH C;  5TR5 A;  2VA8 A;  5KAF U;  3UXP A;  4RQ8 A;  3MHS D;  3M1Y A;  4KIT B;  2WX0 A;  2ZZP B;  1YX6 B;  3NZU A;  1A70 A;  3GOE A;  1SL1 A;  2V9H A;  1L6V A;  5IIK A;  2BKR B;  2DYB A;  1NYQ A;  1L8O A;  5DBC A;  2ICI A;  3HUI A;  1XF5 L;  3VRB B;  4US8 A;  3JPP A;  4ECW A;  2IY0 B;  2WXG A;  1B4F A;  2FE9 A;  1ESF A;  3H40 A;  2HBL A;  2ZXI A;  3B0Y A;  3TBL D;  1UF0 A;  4E3C A;  3IG8 A;  4RPY A;  2MSN A;  4YR3 A;  2ESE A;  4FA6 A;  3AQF A;  1KRH A;  1EU4 A;  1CUK A;  1TKY A;  4LNI A;  2WLB A;  3ECI A;  4WWM A;  3H8S A;  3EUB 2;  4Z6F A;  4PGY A;  4KGT A;  4F71 A;  3JPS A;  2C7H A;  4CF5 A;  1J2M A;  2KX0 A;  2EZZ A;  2DNF A;  3MC8 A;  3Q3O C;  5KFE A;  3WKB A;  4DEZ A;  4DWI A;  2DHZ A;  4FS2 A;  5DPT A;  4XWT A;  3KBB A;  1WYG A;  1QT9 A;  8ICH A;  2EMT A;  4PS3 A;  3ZXV A;  3P1M A;  4BXO B;  2L76 A;  2FCQ A;  3FIL B;  4JUZ A;  5IO9 A;  4JX1 C;  4JE3 B;  3RR8 A;  1J0G A;  3LDZ E;  3HHM A;  4MGY E;  4TUQ A;  5KHQ A;  4DK5 A;  3ZNI D;  3QX1 A;  2GMI C;  1TZ1 A;  4K7W A;  3PTF C;  2HI0 A;  4MAC A;  2G45 B;  1SZH A;  2NO5 A;  5KFR A;  1L3T A;  4LJO B;  1D4B A;  5J8Y A;  1X9X A;  5F9L A;  2C28 A;  1YN3 A;  1NKB A;  2O2V B;  4NL9 A;  2KMM A;  2KX3 A;  4DSJ A;  3PZP A;  2VH1 A;  3AU4 A;  2KAJ A;  1QH9 A;  5FKA C;  3KZI U;  4GSW A;  2K4E A;  2BTE A;  5J0Y A;  1O03 A;  4G11 A;  4ECQ A;  3M62 B;  1UBI A;  3VR8 B;  3NZS A;  5KFC A;  3U7Z A;  3WIM A;  5D49 A;  3RR7 A;  1MHH E;  5J29 A;  3RJI A;  3VTV A;  2RQ5 A;  3LK9 A;  3UQA A;  3PY8 A;  3GQC A;  5L9X A;  1WI0 A;  4EYI B;  4YTN B;  4I2B A;  2CU1 A;  4N9F 4;  2INN E;  1IXR A;  1YZ6 A;  4RQ4 A;  3ETR A;  3L3F X;  2D3C A;  3MHZ A;  2KOX A;  5JUM A;  2J52 A;  5FR3 A;  3ZD8 A;  3IVF A;  2K8A A;  3Q8R B;  2W7P A;  3PRP B;  3TMP B;  3KHH A;  4OJ5 A;  2BR0 A;  3VAW A;  1SXT A;  1SXD A;  5EE9 A;  4KX3 A;  1JCK B;  4WAF A;  4C8M A;  4WQM A;  2DYO A;  4HJG E;  3A4S C;  5EE0 A;  4QWB A;  4KLO A;  2KAC A;  3VTW A;  2ZUB A;  3IHQ B;  5ALG A;  1Q3U A;  2KZR A;  3C19 A;  3SZ2 A;  1TYG B;  3H7P B;  1CEZ A;  3VHT C;  1U49 A;  2QEJ C;  1RQN A;  1V85 A;  5AUI A;  4WJO A;  1ZQA A;  3NS8 A;  3AH7 A;  2BYE A;  3KYD D;  1IUE A;  3L54 A;  2H3V A;  2IDY A;  5JRT A;  2JQR B;  3TAD C;  3V60 A;  1XLQ A;  2G0A A;  1K50 A;  4EEL A;  3ZJU A;  1VJ5 A;  4QZB A;  3SI8 A;  4RQ1 A;  4J9K A;  2KN7 A;  7ICV A;  3ML8 A;  3UI3 A;  4A8E A;  1RG6 A;  4I2G A;  4ECT A;  2M0X A;  1WWU A;  3BK2 A;  1FNV A;  4KZC A;  3OHB A;  5KT6 A;  7ICM A;  2YB4 A;  4YMN A;  2EAM A;  3PS6 A;  2KFJ A;  3AE4 B;  3QUB A;  3OLM D;  3KWL A;  2RLT A;  2IOH A;  1A6S A;  3EPG A;  1AYF A;  5F9N A;  5AKJ A;  3WK9 A;  2BB6 A;  4ECZ A;  1LB2 B;  2DWQ A;  8ICR A;  4UAU A;  2Y1J A;  1C4P A;  1J7A A;  5AM2 A;  2ZVO A;  1Q3V A;  1VJK A;  4M9H A;  1B1Z A;  4F8C B;  1S77 D;  3D2N A;  5IIN A;  4UDU C;  3CIR B;  1Q8K A;  3H7I A;  5HHH A;  3VDZ A;  4GFJ A;  4M9N A;  3HJE A;  3WU2 U;  5DG7 A;  3DBL B;  3RJG A;  3WAN A;  3U2S C;  4IDI A;  5ALR A;  3UIN B;  3IG3 A;  2H3Z A;  8ICS A;  2XC9 A;  2A3V A;  2HSZ A;  2EDU A;  2QB0 B;  3UM9 A;  5J0S A;  2G09 A;  2V1Y A;  4ECS A;  2IHN A;  4Z6D A;  4DOC A;  3OJ4 B;  4J03 A;  4XQ8 A;  4WWN A;  2XI9 A;  2IGH A;  3V6K A;  3TAC B;  4M0A A;  2K8B B;  4ZYS A;  1Y88 A;  2CXY A;  4IS7 A;  5KFZ A;  5BMH A;  1KN5 A;  3QNM A;  1SKS A;  1A0P A;  2MJ3 A;  4QZG A;  3QU5 A;  1M94 A;  2I9G A;  4FHJ A;  4L2Y A;  4C8O A;  1O08 A;  1L3U A;  4IR9 A;  5HR6 A;  2JZP A;  4NV0 A;  4HDO A;  2ZJ5 A;  2K25 A;  2Q0Z X;  3E2E A;  2LVO A;  4WJN A;  3T3F A;  3RNB C;  2L7R A;  2R61 A;  5J2K A;  4XUS A;  1V97 A;  1YQ3 B;  5KT5 A;  3M6Z A;  1E7V A;  3I63 C;  2KFN A;  2DKX A;  3O13 A;  3UIO B;  5KFB A;  1UT5 A;  3MR3 A;  4FUL A;  3RB0 A;  2RPQ A;  3BJY A;  3TSS A;  7ICP A;  1EF5 A;  4JIO U;  3C21 A;  5EOZ A;  4YWG G;  5KFH A;  4HPL B;  2KTR B;  2MEK A;  9ICS A;  1ZJM A;  3GIK A;  4W9E A;  2W9B B;  3BZD B;  1B9R A;  1YN4 A;  3URY A;  1L0X B;  5J0P A;  1F2R I;  2G1E A;  2DKZ A;  4BKG A;  3FM9 A;  1IBX A;  5CHF A;  2AJQ A;  4JWS C;  3TQ1 A;  4TQS A;  4BKS A;  4I2F A;  4W9C A;  3AEG B;  2YMQ A;  4GDK A;  2EZY A;  2MHJ A;  3PW2 A;  1D3Z A;  3QE9 Y;  3F53 A;  2Y9U A;  2DF4 B;  3P4Q B;  3GV7 B;  3MFH A;  4A3O A;  1AN8 A;  1EO6 A;  1E8Z A;  5DCN A;  3D2S A;  5IKC M;  2H5X A;  1TIF A;  3BY4 B;  3MJW A;  5DPR A;  2B0C A;  4USA A;  1Z00 A;  2D8C A;  3RCZ A;  2DL0 A;  2BQR A;  2NS5 A;  5AHX A;  4J9S A;  4EBD A;  1E8W A;  2OOB B;  4KGS A;  4KKJ A;  2WWZ A;  1P0R A;  3A33 B;  2WF6 A;  3NOB A;  5BO4 B;  3A0B U;  1JWS D;  4O5C A;  3PNC A;  4DF4 A;  4RGN A;  5TIS U;  1ZW7 A;  2KXJ A;  1MC8 A;  3QUT A;  1OQR A;  3Q8F A;  3LWM A;  1OXJ A;  4Y2J A;  4C80 A;  4PH5 A;  4KLE A;  1P9D U;  3DBH B;  3BII D;  3KUZ A;  3N30 A;  4EZK A;  3PR5 B;  3JPR A;  1VD2 A;  4P0Q A;  1SB3 C;  3G6V A;  2AEH A;  3H4D A;  3OJ3 A;  3C1Z A;  2KFZ A;  4F5P A;  2FAZ A;  3TUO A;  4GXB A;  2YY6 A;  1IPG A;  4M6W A;  5KT4 A;  2J4X A;  4LDT D;  4CO7 A;  3PZD A;  3ML9 A;  4JV0 A;  4DS4 A;  1FEH A;  2KKV A;  1R7S A;  3A9J B;  2ZIX B;  4GU2 A;  3F5A A;  3PRE A;  5KFT A;  3U26 A;  3UQ0 A;  3H8M A;  1SIF A;  2KMD A;  3RMK C;  3QAQ A;  1SIJ A;  2F1H A;  1UNS A;  2JR5 A;  1S1Q B;  2K6Q A;  1KTQ A;  4RQ0 A;  2BQ3 A;  4RPZ A;  4UB5 A;  3N1X C;  4G50 A;  1NKC A;  4FN2 A;  4W9K A;  3E0F A;  1WGK A;  3V3X A;  2DPI A;  3UQB A;  4B9U A;  2W9N A;  4F4Z A;  1WXA A;  3RN9 C;  3F2D A;  2HHS A;  4Q43 A;  1VZ7 A;  2LWP A;  4KGR A;  1N2X A;  2ZIU A;  2VIX A;  1N48 A;  1JRU A;  1Q0W B;  1WXV A;  2KE7 A;  2ZJA A;  2C22 A;  1A76 A;  2AWT A;  1L4Z B;  1H8C A;  1RXV A;  2M1M A;  3BIN A;  1ZQS A;  4C4R A;  4NNJ B;  4KN7 A;  5F3X B;  3ZKJ C;  4R8U A;  1RDF A;  4LJP B;  7ICE A;  1DXS A;  4QWC A;  3RBD A;  9ICX A;  4YD2 A;  1BNP A;  2WTF A;  4MFC A;  2KKC A;  1GUA B;  1KFS A;  3L08 A;  4ZYN A;  4MF8 A;  3Q8P B;  1MA7 A;  4OZB A;  2CKH B;  4O9M A;  1ZQF A;  3QHT A;  2N9K A;  2ZIV B;  3EEC A;  1XNS A;  1LO5 D;  3NRZ A;  4HCP B;  3WKC A;  3Q3J A;  2XO7 A;  5DLF A;  1FEZ A;  2BHN A;  5AUK A;  3AMZ A;  2W9C A;  2FID A;  3PMN A;  1ISN A;  2NRZ A;  1QOG A;  2G4D B;  5J2R A;  4BBN F;  2KVZ A;  3Q14 C;  3QU9 A;  3JW0 X;  4IOI E;  4M0W B;  2KK0 A;  5ALE A;  5L1K A;  2IBK A;  2EQY A;  4F2R A;  2B3A A;  4YG2 A;  2JYT A;  5CX3 A;  1ZRM A;  5J0O A;  3KKA C;  3QYP A;  2HOI A;  2IPK D;  2MQJ A;  2MJD A;  2LFI A;  4IKG A;  5KFU A;  1ZE3 D;  1T0R C;  4OW0 A;  4MDK E;  4EX7 A;  4KLT A;  1V38 A;  4OJP A;  4Q44 A;  3B2F A;  3B0X A;  4I6L B;  4UB1 A;  5DPW A;  1L3S A;  1QLB B;  5IA7 A;  3BWU D;  4X57 B;  1KEJ A;  2BS4 B;  3T5L A;  2HBJ A;  1FD6 A;  1YD8 U;  2K0P A;  2PLP A;  3MJ5 A;  4NJ8 A;  3GV5 B;  1D6E C;  1WZ3 A;  1RFK A;  2MBQ A;  1COK A;  1PDX A;  5AEK B;  4C56 C;  1T6B X;  5DB8 A;  1SV0 A;  4JWN A;  3HW8 A;  4F8R A;  1L5U A;  4YSZ B;  4UAT A;  4FLH A;  3ZI4 A;  4S0R A;  1YJI A;  3QIJ A;  3Q8E A;  4N59 A;  2JMG A;  2G08 A;  3MAB A;  3QA8 A;  7ICL A;  2WXP A;  3N3K B;  1ZP0 B;  4MSM B;  1BPB A;  3RT3 B;  4QZH A;  1XO1 A;  1WG8 A;  4NY8 A;  3B2G A;  1WR1 A;  3B0A A;  2X38 A;  1ZQH A;  1SE2 A;  2CR5 A;  9ICP A;  1XO3 A;  3SEB A;  2RMM A;  3E58 A;  5ALV A;  2ZW0 A;  3L4P A;  1UT8 A;  4K81 A;  3WK5 A;  2C60 A;  4DOA A;  5HHI A;  4ECR A;  2R8J A;  1ACC A;  2MU2 A;  3M8S A;  3KZX A;  5KFD A;  2ISO A;  1VLB A;  1JX4 A;  3JPO A;  3PVL A;  1J97 A;  3N28 A;  3TAQ A;  2JEG A;  1WJ4 A;  3KUD B;  4YT0 B;  3FDS A;  1MQ2 A;  4C8N A;  4NWI A;  5J2C A;  1B22 A;  3K1R B;  5KG7 A;  1UGJ A;  4PYZ A;  3L5K A;  4GDL A;  4Z6E A;  4MHV A;  8ICN A;  4OVV A;  5J0U A;  4P4M A;  2YML A;  1QLN A;  1RYJ A;  4MGZ E;  4RMA A;  1T94 A;  2J7Q B;  5KT2 A;  5FK9 C;  2I1K A;  2ZCC A;  3W5U B;  4GGQ A;  1MI0 A;  4IM0 A;  4I29 A;  4EBC A;  3Q8B A;  2XIC A;  3BYT B;  3PHW B;  3PSI A;  3V6J A;  4TUU A;  3S6J A;  1OFF A;  4QIW F;  1BT0 A;  3OJU A;  2VZK D;  2OJR A;  5CWR A;  1XLN A;  2V4Q A;  5ALH A;  4ARC A;  2KLC A;  2NTT A;  3KHL A;  1XT9 B;  4JV1 A;  8ICU A;  2LHT A;  4YR2 A;  5H2F U;  1Z19 A;  1FNU A;  3TEY A;  4NAW B;  2R8K A;  4MH8 A;  2KIC A;  4A55 A;  2C2E A;  1VR9 A;  3PGE A;  2O6V D;  4LDT B;  1WWV A;  4ACO A;  5KG3 A;  3ISD A;  2A1A A;  3AEV A;  2BWE S;  4KLF A;  4PK1 A;  3PLV A;  4K1R B;  3CP8 A;  4N58 A;  4F3O A;  1U48 A;  2LMC A;  4OZC A;  2GOW A;  4IC9 A;  3TAR A;  1J7C A;  1KH0 A;  9ICW A;  3A0H U;  3MC0 B;  3PHX B;  3WK7 A;  4FO6 A;  1NBF C;  4P2H A;  5CR0 A;  5J2H A;  4DL6 A;  2L52 A;  4GN1 A;  3R7R A;  5LXI B;  7ICJ A;  5IP4 D;  5DGB A;  3QQ8 B;  4YSX B;  1NKE A;  4DDI D;  8ICI A;  3I3T B;  2DAF A;  1QCK A;  8ICM A;  1FMA D;  2WGS A;  2OHF A;  5KFP A;  9ICR A;  5L83 A;  1AQ6 A;  2DZK A;  5BYS A;  3I28 A;  2SAK A;  3ZJT A;  2IA6 A;  2EMS A;  1TS3 A;  2JX5 A;  2C5L C;  3K1Z A;  1PZN A;  3APC A;  3CYM A;  3U8Z A;  3QZ8 A;  5CB1 A;  2CN1 A;  2LI6 A;  5KFL A;  5J2D A;  3O65 B;  2DEN B;  5D3D A;  3VH4 B;  1A5R A;  3GU3 A;  4UB2 A;  7ICQ A;  2ASD A;  3LJ3 A;  1L0Y B;  4P4P A;  1MN8 A;  4XZ4 A;  2REX A;  3TEX A;  1BXT A;  3BQT A;  5DQG A;  1Z1V A;  3ISB A;  3ISC A;  2BQU A;  4MM3 B;  3N97 B;  3QCA A;  4RQ2 A;  2MAX A;  1WMH B;  3HVZ A;  4YFK A;  4P0P A;  4Q8F A;  2HHT A;  3GZN B;  1ZQN A;  2D3D A;  1TS2 A;  5D4B A;  3JSV A;  1GC7 A;  5KTQ A;  4EZ9 A;  4O3R A;  2MW5 A;  4EFO A;  4C8L A;  4F2S A;  3BK1 A;  1KTK A;  2G9H D;  2DYM A;  3QXG A;  4YMO A;  3H0R B;  2DGZ A;  2PFN A;  4K3B A;  1L0V B;  2FMQ A;  3PO5 A;  1WGH A;  2J53 A;  2FLL A;  4EEN A;  2E8O A;  3AE3 B;  5CHG A;  3LVV A;  3HKZ C;  4MJS B;  4J9L A;  2JUO A;  4KIK B;  4EE2 A;  2HW3 A;  8ICF A;  2KMA A;  4DHZ B;  1R4N I;  2QSD A;  1GPX A;  4NM2 A;  2ZIW B;  4ED7 A;  4DL5 A;  2AQ4 A;  2BCR A;  4LNN A;  3P4R B;  4QW9 A;  3AU5 A;  3HM3 A;  1ECW A;  1XD3 B;  1Z1B A;  2KDI A;  1NYR A;  4KX5 A;  3A1Q B;  5FR6 A;  2AGP A;  1WGY A;  2EZX A;  2EAN A;  1UA0 A;  4KLH A;  2I1J A;  5KFK A;  4AYB C;  5DDY A;  1PVP A;  1WSP A;  5KFY A;  2WXQ A;  1J19 A;  4RZR A;  2RGF A;  3FKY A;  5CHW A;  4EEY A;  4XYC A;  4EEW A;  4KSL C;  7ICI A;  1WGR A;  4P16 A;  1JUD A;  8ICE A;  2B76 B;  2E1F A;  9ICM A;  2Y5P A;  3TIX A;  4PL1 A;  1SBB B;  4C4T A;  2BGW A;  2ZNV B;  5KFI A;  1LV5 A;  3C29 A;  2FCS A;  2QHO A;  2HHV A;  9ICE A;  3KW5 B;  1KDH A;  1VZ6 A;  5C1Z A;  2YMM A;  7ICH A;  2V4R A;  1JRP A;  1LVH A;  2IYD B;  4J9N A;  2G07 A;  3N7R C;  2KO3 A;  5AI6 A;  2A4Z A;  4HXD A;  3ZTD A;  1TK8 A;  3U4E G;  1WE6 A;  4Y2S A;  1CRX A;  2D3G A;  3A9K A;  2LBO A;  2V0G A;  1QZE A;  3MGV A;  3AV8 A;  4I2J A;  3E9S A;  2F44 A;  5D46 A;  1TY0 A;  1MSW D;  2KIV A;  2NPT A;  4MGI E;  4UB8 U;  4DL7 A;  4E74 A;  1I42 A;  3RUI B;  2K39 A;  3SDL C;  3U7D A;  2KDB A;  4HDQ A;  2I6X A;  5ALP A;  2M4N A;  1Q5W B;  2W8L A;  1RM6 C;  4R63 A;  4CF3 A;  4RQM A;  1ZQO A;  5AI5 A;  4RPX A;  1KOT A;  4M9G A;  1S0M A;  5G5G A;  4YXM A;  2X8X X;  2R8G A;  1JAL A;  3W1S A;  2JXT A;  1GB1 A;  1WX7 A;  2WQY B;  3PRM B;  4ANX A;  3TEW A;  3OTQ A;  3BS5 B;  2AQ2 B;  5GMV A;  2IO1 B;  2WF8 A;  3D32 A;  4RM9 A;  2VZK B;  3PV8 A;  4MFF A;  1ZQE A;  3BDP A;  1HTO A;  2RPV A;  3V6E B;  3ONN A;  4ACF A;  5KG2 A;  1ZOY B;  4F1S A;  4JL9 A;  4RCO A;  3AE1 B;  3QAR A;  4PYU A;  2JV3 A;  3CF6 E;  4QZE A;  4Y2Y A;  1OQQ A;  3ZNG C;  1ZGU B;  4URK A;  5EWG A;  5CP2 A;  4C4S A;  1WRD B;  5E6N A;  1PGB A;  3WK6 A;  1SKR A;  5KFM A;  1UBQ A;  5IIJ A;  4EEK A;  3DVN V;  2O6V B;  4II2 B;  3M8R A;  4EKU A;  4US9 A;  2F1I A;  4RF0 A;  2NBV B;  2HOQ A;  3OGU A;  3ZDC A;  4UAS A;  1XLP A;  5J17 A;  4XWW A;  2KQ4 X;  5ALT A;  1WX9 A;  1P7F A;  1NJY A;  4M8N A;  3RF9 A;  4AP9 A;  4L1B A;  2Z7J A;  3W5V B;  2W43 A;  1S0O A;  2KC1 A;  2K4H A;  3KWV A;  1OTR B;  5ALW A;  1DRG A;  5BOL A;  2WHI A;  4BWJ A;  1WJ6 A;  1KLV A;  3L0W B;  2MP2 A;  2W55 A;  5KAI U;  4UB3 A;  1PGX A;  1TZO A;  4J3O D;  3PR4 A;  4PL2 A;  2Z8L A;  3BQ2 A;  3PW4 A;  1ZXI A;  3F2B A;  4I2A A;  3IAM 1;  4DQR A;  1WXS A;  1QSL A;  3O0F A;  2LGD A;  3NRW A;  2GRI A;  4OD0 A;  1YOV B;  2IY1 B;  1OEY J;  3KLS X;  2FBW B;  2LUE A;  4JPS A;  2E8N A;  5EWE A;  2W8K A;  1E10 A;  4II3 B;  4DS5 A;  4WH4 A;  3Q8M A;  3GB1 A;  2JH1 A;  2N7J A;  4DHJ D;  3TL5 A;  3P4P B;  2G4S A;  1N5X A;  1HEZ E;  2PW9 A;  2JZB B;  5BYR A;  4PHA A;  3PX0 A;  4C7Y A;  4M02 A;  5HP4 A;  3V05 A;  1X42 A;  4KMO B;  2PXI A;  1SF0 A;  4RT2 A;  2NBW B;  3DBR I;  2BDP A;  1Q10 A;  4CF4 A;  5KG0 A;  4DSI A;  4D2K A;  5ALS A;  3SYZ A;  2L0T A;  4J6I A;  3RD2 A;  1FRR A;  4FFD A;  1D5M C;  1ZQT A;  2N9X A;  2W03 A;  1DOI A;  1F77 A;  4IUM B;  4DQO C;  3PW7 A;  4QWE A;  2VH2 A;  1D8Y A;  4J9M A;  4O3M A;  1ZQR A;  3T79 A;  3MR2 A;  5KG1 A;  5C23 A;  2ZPY A;  5ALD A;  4ZDV A;  3KTQ A;  2NR2 A;  4IW0 A;  4WJP A;  4PJ0 U;  4NQL B;  2LHE A;  2WXR A;  4F50 A;  4ZRQ A;  4NQK E;  4AP4 C;  2WXN A;  8ICP A;  4NJ7 A;  2PMZ F;  4B0E A;  5KG6 A;  2M17 A;  4RGM A;  1M6Y A;  4LZD A;  9ICO A;  2CHZ A;  4CHK A;  8ICT A;  5LLI A;  2WB1 F;  2OCE A;  1WM2 A;  3QUQ A;  2KC2 A;  4UAW A;  1IGD A;  5H92 C;  5FP0 A;  2G3Q B;  3AB5 A;  3GDX A;  3QX7 A;  4WUR A;  3F5E A;  4DFJ A;  2JRH A;  1FO4 A;  1NI2 A;  4Z6C A;  3CRX A;  4LVS A;  4O5E A;  2CHX A;  4KLU A;  1GAQ B;  1QTM A;  2C2D A;  3L17 A;  2BPG A;  3WAO A;  1LQB A;  2D2Q A;  2XBB C;  4GLX A;  4F91 B;  1YX5 B;  5E79 U;  2MX2 A;  1DK2 A;  1YQ4 B;  4OZA A;  2P66 A;  4DFP A;  2MCN B;  3R3M A;  5IIO A;  2MSE D;  4F4X A;  2AL3 A;  3UF8 A;  3EPI A;  3OHA A;  3DEE A;  4XRH A;  2C7N B;  4BOS C;  8ICW A;  5HKH A;  4RNA A;  5EE1 A;  3EWA A;  1PK1 B;  1FM0 D;  2ZTE A;  4M2Y A;  2G5I B;  4BAX A;  2KWV B;  1S97 A;  1DGJ A;  4IRK A;  1FXA A;  2RR9 A;  2ZTD A;  2YEP B;  4Y2X A;  1S9F A;  3BVZ A;  4F7Z A;  3VC8 A;  3IT6 B;  5AKI A;  5J0Q A;  4KLD A;  2KFK A;  3T3N A;  3VCB A;  3MFI A;  2D5G A;  2UVW A;  1PK3 A;  2WHE A;  4UBC A;  2D11 A;  4IC7 B;  1LKY B;  5E6O A;  3BZC A;  1SL0 A;  2WXH A;  4AS1 A;  1UH6 A;  2JU6 X;  2FPL A;  2G5H B;  5KG5 A;  4F4Y A;  2P6U A;  1TGZ B;  2A5U A;  1S0V A;  3GS2 A;  3RJJ A;  5EE3 A;  9ICI A;  2AYO B;  5D7G A;  2HMX A;  2HJ1 A;  4LNK A;  1I4Q A;  2BBC A;  3CW2 C;  2MBH A;  2MWS B;  3IBE A;  3ZTC A;  2WF5 A;  5AI4 A;  4MEL A;  1HQR D;  4HPM B;  4PGX A;  2C2R A;  4JWU C;  2IGG A;  5DPS A;  3M6K A;  3E56 A;  3R8B A;  4YP3 A;  2A19 A;  4FJV B;  3Q2A C;  1UWM A;  2FPK A;  1WIA A;  4F72 A;  2KSO B;  3DDH A;  3NVZ A;  3RB4 A;  3NHE B;  4QZ8 A;  4HEA 1;  3H7S A;  5KFV A;  2WF7 A;  3WKE A;  1ZQI A;  2QAR B;  3WAP A;  1LXD A;  2J0K A;  3W1Y A;  1WGD A;  1V1O A;  3AXC A;  3DBS A;  1ZKH A;  4G3X B;  1SV4 A;  4GIV A;  4HWI B;  4WIP A;  4FZN A;  4X5V A;  3R2T A;  1NOM A;  4BX9 C;  1WJN A;  1IGC A;  2EKI A;  3G6Y A;  3AE8 B;  1XQQ A;  2NO4 A;  1QQR A;  2IBI B;  4O3S A;  1ZD5 A;  1ZQD A;  9ICA A;  4LJX A;  1HA5 A;  4GC6 A;  1B0X A;  4TUS A;  4QW8 A;  2Y1I A;  2XY6 A;  1WCN A;  4B9M A;  1ZQW A;  9ICF A;  2NV3 A;  4YQW A;  8ICA A;  3BVM A;  3NZ3 A;  3SFD B;  2L83 A;  1JWU D;  4WWO A;  1NNL A;  3HWT A;  2FE8 A;  1EF1 A;  1SJH D;  1RPL A;  2K8C B;  9ICH A;  1KLU D;  4IQU A;  4RQ5 A;  2EH9 A;  2AQ1 B;  1TAQ A;  3Q8L A;  2KDE B;  2KJ6 A;  1UUP A;  1V1P B;  2PIA A;  3Q3F A;  1E7P B;  2DAJ A;  2PKE A;  3N32 A;  1F1H A;  1XCT L;  1MHX A;  3TCA A;  2D10 A;  4RUA A;  2AH5 A;  3AEB B;  4DHJ B;  2DZI A;  5ALK A;  3KD3 A;  2KYW A;  4HRS A;  1UPH A;  3AEE B;  3OAW A;  3RJK A;  4QZA A;  4DXF A;  5GTI U;  4HAI A;  1NVI D;  2ZG6 A;  4GXI A;  4NZL B;  2R18 A;  3J81 j;  2A1J A;  1SWW A;  2FLN A;  1C7Y A;  4LZG A;  1K53 A;  1TY2 A;  3OWE B;  5AI9 A;  3BQ7 A;  3C2K A;  2HTM E;  1L6U A;  2RDG A;  2ZNV C;  3BS7 A;  3EHV A;  2K6D B;  3R2I A;  8ICV A;  5ALQ A;  3B08 A;  2LM4 A;  2H89 B;  1JI7 A;  4DFM A;  2YN4 A;  4JV2 A;  2MBO A;  2OED A;  2DX5 B;  2XK5 B;  2KK8 A;  2ALZ A;  1H4R A;  3RNA C;  1I7H A;  1GG3 A;  3RB3 A;  4W9G A;  4I2E A;  4DBG A;  5J0R A;  3M9M B;  2VJ4 A;  2FNJ B;  1IIP A;  5KFA A;  3SD7 A;  2BCV A;  1JML A;  2LGS A;  5J2B A;  5KFS A;  3N20 C;  1I4P A;  3RRH A;  4KLI A;  1PYW D;  5ALL A;  1PFD A;  3CWI A;  5GXG B;  1BNO A;  1SL2 A;  4NLC A;  5D2M B;  1IV8 A;  2J6T A;  3DBL I;  4EZL A;  1SEB D;  1GNU A;  1TTN A;  3I9V 1;  2KN5 A;  3TFR A;  4P7I A;  4B9T A;  2CU3 A;  2LVQ A;  3DVG Y;  2M0A A;  3K75 D;  4LNO A;  4C4V A;  2JWU A;  2AQ0 A;  5DLG A;  1FIQ A;  1X6J A;  3MC1 A;  1KL9 A;  3EW9 A;  3UXO A;  3TAP A;  2RDH A;  4ZRK A;  4KV2 A;  1S10 A;  4QJF B;  3P63 A; 
#chains in the Genus database with same CATH homology
 1ET9 A;  2BW2 A;  3Q8C A;  2MJE A;  1FNU A;  2J42 A;  3TEY A;  1FCL A;  4NAW B;  4MH8 A;  1WWT A;  4YXD B;  4A55 A;  1VR9 A;  2GI9 A;  2ONQ A;  1C76 A;  1EM7 A;  2L32 A;  3AEF B;  2Y3A A;  4GLS C;  3AE5 B;  4ZOH C;  3Q69 A;  3IAS 1;  4N58 A;  2LMC A;  4OZC A;  1HXY D;  2SEB D;  1J7C A;  1A70 A;  1KH0 A;  3MC0 B;  1L6V A;  5I4D A;  2IGD A;  1FXI A;  1NYQ A;  2L52 A;  4Q2J A;  2ICI A;  3BYY B;  3HUI A;  1XF5 L;  3Q8A A;  3VRB B;  1ROE A;  4US8 A;  2I38 A;  5LNK 1;  1Y56 A;  3W9C B;  2WXG A;  1ESF A;  2FUG 1;  2H88 B;  4YSX B;  1WXQ A;  3RFZ B;  1I4X A;  3PO0 A;  4NJC A;  4CQN A;  5HHD G;  1FMA D;  1D5Z C;  5T8I A;  2BS2 B;  2LUM A;  1KRH A;  1EU4 A;  4R3D A;  2OHF A;  1TKY A;  5BYS A;  2QJL A;  4O1N A;  2WLB A;  4WWM A;  2SAK A;  3EUB 2;  4KGT A;  3LXF A;  1TS3 A;  3ABV B;  2JX5 A;  1QOA A;  3P42 A;  2DLB A;  4TSS A;  5E6J A;  5D3D A;  4TQ0 A;  1EWC A;  3ZQ4 A;  4B0M A;  3EGR A;  4XWT A;  1WYG A;  1L0Y B;  1QT9 A;  4HKZ E;  3P1M A;  3FIL B;  2V3P A;  2K22 A;  3FIL A;  4JE3 B;  4JX1 C;  1C4A A;  1BXT A;  3TEX A;  2QIL A;  1ZUD 2;  1YN5 A;  4MM3 B;  2PVG C;  4KKI A;  3MP9 A;  5D3I B;  3HVZ A;  4MAC A;  2LGI A;  1D4B A;  1TS2 A;  1YN3 A;  2EEL A;  2AX5 A;  2KMM A;  5FKA C;  2KAJ A;  3HVD A;  1TJE A;  4HRO A;  3BK1 A;  2M19 A;  4XDD A;  1KTK A;  2G9H D;  2DYM A;  2BTE A;  1N5W A;  3VQI A;  3VR8 B;  1C4C A;  3SFE B;  1L0V B;  2J53 A;  3B9J A;  1MHH E;  3U7Z A;  4AQ7 A;  3AM9 A;  3AE3 B;  1N63 A;  1SE4 A;  4YTN B;  4EE2 A;  3HRD D;  2INN E;  1QOF A;  4XDC A;  2WS3 B;  4RGT A;  5BYQ A;  2QSD A;  1ENF A;  3ETR A;  1P7E A;  1PGA A;  1GPX A;  2N9L A;  3MHZ A;  3P4R B;  3VR9 B;  3AED B;  3J9C A;  2J52 A;  5FR3 A;  1NYR A;  4PT5 A;  1T3Q A;  2KDM A;  1WSP A;  4YTM B;  2WXQ A;  1SXT A;  4WAF A;  1JCK B;  5EE9 A;  1D5X C;  4WQM A;  2DYO A;  4HJG E;  4P16 A;  4ARI A;  4L23 A;  5EE0 A;  2B76 B;  3AE2 B;  2ON8 A;  1F2R C;  2KAC A;  2Y5P A;  1SBB B;  1TYG B;  1C79 A;  1AW7 A;  1VZ6 A;  2HDE A;  1FFV A;  2QEJ C;  1JRP A;  2LEK A;  3AE9 B;  5AUI A;  3IT4 B;  3AH7 A;  1IUE A;  2IDY A;  2JQR B;  4TQ1 A;  3T3O A;  1XLQ A;  1K50 A;  3U4E G;  3ZJU A;  3RPF C;  3WCQ A;  4DXG A;  2V0G A;  2WXM A;  3AV8 A;  3E9S A;  1TY0 A;  3LYY A;  3UI3 A;  5C3J B;  1YNT E;  5JXV A;  3BK2 A;  1FNV A;  2WXO A;  1QIL A;  1VRA B;  4MT5 A;  3VRA B;  3AE4 B;  3KWL A;  4LTU A;  1RM6 C;  1AYF A;  4NAM A;  2BB6 A;  4YTP B;  2DWQ A;  5G5G A;  1AWD A;  1JAL A;  3W1S A;  2JXT A;  1GB1 A;  3TEW A;  2WQY B;  1C4P A;  2KWD A;  3BVG A;  1J7A A;  2AQ2 B;  1C77 A;  4OVZ A;  1VJK A;  1B1Z A;  2VZK B;  1JWB D;  4UDU C;  2RPV A;  3CIR B;  1ZOY B;  4RCO A;  3AE1 B;  3U2S C;  1OQQ A;  4IDI A;  2K3U A;  2PTL A;  1PGB A;  1BML C;  4US9 A;  2WXF A;  4RF0 A;  4LLG M;  1XLP A;  1ZPS A;  4XWW A;  2KQ4 X;  1P7F A;  2AQ3 B;  4L1B A;  2IGH A;  2MH7 A;  1E6E B;  3U52 E;  3W5V B;  3KWV A;  4ZYS A;  2WU2 B;  5BMH A;  2MJ3 A;  4L2Y A;  2W55 A;  1PGX A;  2WXK A;  1TZO A;  4J3O D;  1DOX A;  2Z8L A;  2JZP A;  1ZXI A;  3IAM 1;  1JWM D;  5HFY A;  1K51 A;  2ACZ B;  3AE7 B;  2GRI A;  2TSS A;  1EWY C;  2R61 A;  2WP9 B;  2BS3 B;  2FBW B;  3KLS X;  1V97 A;  1MVK A;  1YQ3 B;  3O13 A;  4JPS A;  1E10 A;  4WH4 A;  3GB1 A;  5BMI A;  3TSS A;  2L1A A;  2N7J A;  2ZW1 A;  3P4P B;  1N5X A;  1I4G A;  1HEZ E;  2PW9 A;  1XLO A;  5BYR A;  4YWG G;  1NEK B;  5BMG A;  4C7Y A;  1N60 A;  2LHD A;  3V05 A;  2MEK A;  1SF0 A;  2QIE B;  1Q10 A;  1FFU A;  1FRD A;  1C9F A;  3BZD B;  1QF6 A;  1B9R A;  1KFY B;  1YN4 A;  1L0X B;  3URY A;  4D2K A;  4P6V F;  1FRR A;  1F2R I;  2LJI A;  2G1E A;  4YSY B;  1D5M C;  2PMV A;  1IBX B;  1DOI A;  1GOZ A;  1EU3 A;  2QMT A;  1F77 A;  1IBX A;  2YEP F;  4GDK B;  4JWS C;  4DQO C;  3AEG B;  2KN4 A;  3I57 A;  1ET6 A;  3P4Q B;  1CZP A;  1AN8 A;  2DBY A;  4RGO S;  4USA A;  1VDV A;  1HZ6 A;  2LHE A;  2JSV X;  4ZRP A;  3ZGZ A;  2XNA C;  2WXR A;  1T5X D;  2NTS A;  4ZRQ A;  1XXG A;  2WXN A;  4KGS A;  4KKJ A;  3EA6 A;  4B0E A;  2K5P A;  4RGM A;  2PKO A;  4ITK A;  1JWS D;  1TS4 A;  4A8X C;  4OHJ A;  1IGD A;  5H92 C;  3AB5 A;  4RGN A;  4WUR A;  1N62 A;  1OQR A;  2N0S B;  1DYQ A;  3Q8F A;  1FCC C;  1FO4 A;  4C80 A;  3PZ8 A;  3BII D;  1GAQ B;  1SB3 C;  3TUO A;  2WXJ A;  2BT6 A;  2V3N A;  4HKQ A;  1TKG A;  1ZDV A;  5C2T B;  2J4X A;  3FAH A;  1YQ4 B;  3N9Y C;  4LK0 M;  4OZA A;  1FEH A;  1R7S A;  3TEZ A;  2NMQ A;  1STE A;  2PVO D;  2Q5W D;  3AEA B;  4RH6 A;  1SIJ A;  3AN1 A;  1GB4 A;  1ZXH A;  1UNS A;  4RNA A;  5EE1 A;  4A6Q A;  1FM0 D;  3NS1 A;  3AE6 B;  2INP E;  1FXA A;  1DGJ A;  1WGK A;  3V3X A;  2YEP B;  2W3R A;  1RWS A;  3BVZ A;  3IT6 B;  1J7B A;  3NVV A;  2WU5 B;  3T3N A;  1CQV A;  1VZ7 A;  2D5G A;  4KGR A;  1SE3 A;  2Y5C A;  2E3T A;  3FC4 A;  5G5H A;  4AS1 A;  1L4Z B;  2WXH A;  2JU6 X;  1TS5 A;  1YJJ A;  1MPE A;  3ZJV A;  2M56 B;  3GS2 A;  5EE3 A;  5D7G A;  1I4Q A;  2BBC A;  2BYT A;  1E0Z A;  4XE0 A;  4OZB A;  1HQR D;  2N9K A;  1LO5 D;  2IGG A;  3NRZ A;  3GP7 A;  4JWU C;  5HG2 A;  3E56 A;  3R8B A;  2W3S A;  5AUK A;  3AMZ A;  1UWM A;  4ZHP A;  1JW9 D;  1QOG A;  2BB5 A;  1ZDX A;  2W82 A;  4IOI E;  3MFG A;  3NVZ A;  4RF1 A;  2JYT A;  4M0W A;  1XCQ L;  4HEA 1;  4KX6 B;  2IPK D;  2CJN A;  2MJD A;  1JWA D;  2LFI A;  4IKG A;  1ZE3 D;  4OW0 A;  1BUI C;  3B2F A;  1V1O A;  4WIP A;  5HI1 A;  1QLB B;  1SSN A;  3R2T A;  3BWU D;  1NEN B;  3H8H A;  1IGC A;  2EKI A;  3PZ7 A;  3AE8 B;  2BS4 B;  1YMH E;  1QQR A;  1JRO A;  1FD6 A;  2K0P A;  1HA5 A;  2E6X A;  2PLP A;  3MJ5 A;  1SJE D;  1D6E C;  1QOB A;  3SFD B;  1RFK A;  3BVM A;  1NI3 A;  3NZ3 A;  5MPO A;  1PDX A;  3NVW A;  1JWU D;  1T6B X;  2L83 A;  4C56 C;  3KQ4 A;  2FE8 A;  1SJH D;  1KLU D;  4REZ A;  3SR6 A;  4YSZ B;  1HZ5 A;  2WDV B;  4H2A A;  1KF6 B;  3NUH B;  1C78 A;  2AQ1 B;  1YJI A;  4RFB A;  1UUP A;  1V1P B;  2PIA A;  1E7P B;  3LB8 C;  3Q8E A;  1V1P A;  4N59 A;  1XCT L;  2WXP A;  1MHX A;  2CJO A;  1ZP0 B;  1WRI A;  3AEB B;  1CJE A;  1UWX A;  1DOY A;  4ZHO A;  3B2G A;  4HRS A;  3AEE B;  3AEC B;  2X38 A;  4DXF A;  1NVI D;  1F0Z A;  4NZL B;  5TSS A;  1KLG D;  1SE2 A;  3C8Y A;  1XO3 A;  2XN9 C;  3SEB A;  2RMM A;  1TY2 A;  1K53 A;  2WDR B;  3OWE B;  2ZW0 A;  1CK1 A;  3L4P A;  2HTM E;  1L6U A;  1XEE A;  2RDG A;  2K9X A;  3R2I A;  1ACC A;  3DWM A;  3W2D A;  2H89 B;  3P4S B;  1VLB A;  4TMA B;  3IXS A;  4A90 A;  2OED A;  3NVY A;  3ZJT A;  4YT0 B;  1I7H A;  2WDQ B;  5H8Y E;  1I4H A;  1UGJ A;  1V8C A;  4GDL B;  2WXL A;  4C7Z A;  1QKZ A;  1PUT A;  1JML A;  2WXI A;  4N6E B;  3ZYY X;  1RYJ A;  2GB1 A;  1I4P A;  1N61 A;  1PYW D;  1PFD A;  3CWI A;  5FK9 C;  5GXG B;  2WNM A;  3W5U B;  1E9M A;  4A9A A;  2I2Y A;  1MI0 A;  2V4I B;  1M4V A;  3Q8B A;  3BYT B;  1SEB D;  3I9V 1;  4FXC A;  2W54 A;  2IJ0 A;  1FNW A;  1K52 A;  2CU3 A;  1OFF A;  2M0A A;  1L5P A;  3DWG C;  2VZK D;  2JWU A;  1I4R A;  1VZ8 A;  1XLN A;  1JQ4 A;  1FIQ A;  4ARC A;  1TKE A;  2NTT A;  2JYE A;  1L4D B;  2RDH A;  3P63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...