1ZXIA

Reconstituted co dehydrogenase from oligotropha carboxidovorans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Structural and functional reconstruction in situ of the [CuSMoO(2)] active site of carbon monoxide dehydrogenase from the carbon monoxide oxidizing eubacterium Oligotropha carboxidovorans
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1zxiA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zxiA01
5H92C 3HUIA 1E9MA 3LB8C 3P63A 1L6VA 2Q5WD 2PVOD 1TKEA 1R7SA 4YTMB 1V97A 1CZPA 2WLBA 3KWLA 2MJDA 3NVYA 3AH7A 3SFEB 3NS1A 1GAQB 2WDVB 3HVZA 4LTUA 1OQRA 1N5XA 1VLBA 4YSZB 1E10A 1JQ4A 1WWTA 4ITKA 1SIJA 1RWSA 2K22A 4WWMA 1XO3A 3AE3B 3B2FA 3AEBB 1DOXA 1FM0D 3PO0A 3L4PA 1JWBD 1ZUD2 3AE2B 2N0SB 1AYFA 1DOIA 3DWGC 3LXFA 3P4RB 1N5WA 3P4PB 2H89B 2E3TA 1B9RA 3AE4B 1TJEA 4N59A 4YXDB 1NI3A 2L52A 2K9XA 3B9JA 2PKOA 5AUKA 3CIRB 3DWMA 2WU2B 5EE0A 1FXAA 1ZOYB 3NVZA 2CU3A 1QOAA 2HTME 2W54A 5AUIA 2L83A 4YTPB 3AE5B 4USAA 2WP9B 1E0ZA 2PIAA 1WYGA 1EWYC 3AM9A 1KRHA 4N6EB 1PDXA 5H8YE 3RPFC 2WDQB 3AEGB 1QOBA 2W3RA 1WGKA 1T3QA 2BS4B 1KFYB 4JWUC 2ACZB 1J7AA 2BS2B 5C3JB 1RFKA 1TKGA 2QIEB 1GPXA 1L5PA 1J7CA 1ROEA 3W9CB 3AE7B 4KX6B 2KMMA 1N60A 4JX1C 1N62A 2PVGC 2BT6A 3AE8B 4US8A 2M19A 3AEDB 2M56B 2EKIA 1ZP0B 1N61A 2BS3B 4FXCA 4HRSA 1F0ZA 2LEKA 4ZHOA 2G1EA 4C80A 4IDIA 1N63A 3NVVA 1JROA 1RM6C 4C7YA 1E6EB 1FIQA 3ETRA 1QLBB 1J7BA 3AEEB 3AV8A 1QF6A 1TKYA 1A70A 3CWIA 4WQMA 1XLPA 1XLQA 1QOGA 1L0VB 3NVWA 1YQ4B 2W3SA 1NENB 1PFDA 1FO4A 5EE3A 1JRPA 1ZXIA 3EUB2 1L6UA 1OFFA 1SB3C 1YQ3B 1KF6B 1QOFA 5EE1A 5GXGB 3ZYYX 3AEAB 1FRRA 5G5GA 2DBYA 3AE1B 3SR6A 3AEFB 2W55A 1JALA 4YSYB 3W5VB 4US9A 3NRZA 1FFUA 4JWSC 3W5UB 1PUTA 2H88B 2WQYB 4ZOHC 4A9AA 4YSXB 3AN1A 3B2GA 2MJ3A 1I7HA 1NVID 3BIID 3P4SB 1TYGB 1WXQA 1XLOA 1RYJA 1IUEA 1UWMA 2KAJA 3AB5A 1AWDA 3P1MA 3ABVB 4N58A 1NYQA 3AE9B 3VR8B 3WCQA 1VJKA 2FBWB 1FMAD 2MJEA 1FXIA 1JWAD 2K5PA 4HROA 4YT0B 4P6VF 2JX5A 5EE9A 4YTNB 3P4QB 3VRAB 2B76B 1JW9D 2QJLA 1CJEA 1NYRA 3AECB 2CJOA 3AE6B 1FFVA 3FC4A 1FRDA 2DWQA 1E7PB 2MH7A 2OHFA 1SF0A 2Y5CA 3VRBB 5MPOA 1DOYA 2CJNA 1XLNA 1WRIA 3AMZA 4C7ZA 2JQRB 2WDRB 1YJJA 3HRDD 1YJIA 2WS3B 2WU5B 4ZHPA 1OQQA 3SFDB 1DGJA 5C2TB 3VR9B 1QT9A 1V8CA 3FAHA 2AX5A 1VDVA 1NEKB 5G5HA
chains in the Genus database with same CATH superfamily
2KMDA 2KICA 2LUMA 3SEBA 1FPYA 2B6GA 2UVVA 1EF5A 2N7JA 1P0RA 1X9XA 3N1ZC 3GOEA 2D3BA 2LI5A 4KLSA 2MJDA 4UBBA 5GTIU 3Q8EA 4GFJA 4F5NA 4XDCA 4QZHA 3SFEB 4ICUA 3NS1A 2JXJA 4I2CA 2J52A 2JVCA 1V38A 2P6UA 1Q46A 4RNOA 3GQCA 2KEYA 3MABA 2IMWP 2VA3A 1NK4A 4O3SA 1IIPA 3O65B 3MDCA 2FMPA 1F2RI 2ZIVA 1FM0D 1WX8A 5CHWA 5KFCA 3LXFA 3ZUNA 2JH7A 5AI9A 5KG3A 1JCKB 1WM3A 3E56A 4WAAA 3AU5A 1XT9B 1TY2A 4BBNC 2NRTA 1PGAA 2GOLA 5DCNA 8ICOA 2N9PC 2I1JA 2CU3A 2ZIUA 2BHNA 2KACA 4RZRA 1L7OA 2XN9C 3HPOA 1JX4A 1WIAA 3X0WA 1ZQLA 2KZZA 3Q8BA 4QZDA 4F72A 1EWYC 4IRDA 3N9YC 2PKEA 3P42A 2KTQA 5D2MB 1ZQGA 5J8YC 1ZQRA 4RF0A 3IP4B 3GV8B 3M1YA 4UDUC 4TQSA 4OVUA 4Y2JA 5AM3A 4HK2A 3PSTA 1L3UA 1QKZA 4KLLA 1P7EA 4B9TA 2IA6A 3AE7B 1Q8KA 1E7UA 4ZH4A 3N32A 2WAQF 3AEDB 1ZQIA 3AEVA 2FUHB 4NPNA 5IIIA 3KHGA 2HE7A 1WR1A 4L2YA 3U26A 5E6PA 5J2AA 5IILA 1TKYA 4NZLB 3R2TA 5ALGA 1ISNA 5CP2A 4LNOA 5E6NA 3ZTDA 1QQ5A 4YD2A 2OJWA 4IC9A 3PX6A 5DQHA 1NK5A 2I2YA 1L0VB 4ECQA 2KTRA 2W3SA 5EE3A 2JH1A 2IGHA 3A4RA 3VRAB 3DBLI 3EUB2 4I2FA 4EUTA 5KHQA 2NR2A 3EZ5A 4HJKA 4I28A 2EMTA 3E2EA 1LV5A 2C2EA 3WKDA 4C00A 2PFPA 2RDBC 2LGIA 2E1FA 2AGOA 1L7NA 4GMVA 1NVID 3V7KA 3TIXA 3P4SB 2G09A 2BCVA 3RH5A 4M9NA 1ZDXA 2RMMA 4TUUA 3VQIA 1LO5D 3I76A 4RQNA 2PE6B 3WCQA 2D3AA 2FBWB 5KFXA 4EFOA 1SXDA 2NCNA 1UD7A 4JV2A 4OW0A 3DOWA 2D3GA 1ZD5A 3W2DA 5EWFA 1GC6A 2JPHA 2NTTA 4BKTA 2L32A 2KJ9A 1L7YA 2VA8A 2Z0DB 4BXOA 4KLEA 4B95A 1TY0A 5HMMA 4XQ8A 3PSEB 4AQ7A 5DB8A 5J0TA 5CX3A 5C2TB 1K5OA 2PFOA 4ARCA 2W9CA 1GB4A 1LFDA 5TR5A 4J9PA 1HQRD 2OWOA 2R18A 4FULA 4FA6A 4QW9A 2AL6A 1V85A 1F52A 2YEPF 3PHXB 3BQ0A 1E8ZA 2PPHA 4DWFA 5D3DA 5ALHA 2EZZA 4G3IA 4OZBA 1N5XA 2KDFB 3QCAA 5KG7A 1KRPA 4KDLB 1Z4OA 2JV3A 1R4NI 4MH8A 1D5MC 3SAGA 2OOBB 4Q44A 3V72A 4EZ9A 4O3PA 2M4NA 1D3ZA 4PHPA 1FXAA 3LYYA 1E7VA 1UGJA 4DK5A 1NKEA 2KWCA 2KHVA 1QOAA 2BGWA 4PS7A 4S0RA 2HMXA 3RRGA 4BX9C 4R65A 3L5KA 4E0DA 4AWJA 2ISPA 3ZDDA 3WKCA 3F5AA 4ED0A 1CQVA 4WJQA 5C23A 2AJQA 4F1SA 3D2QA 5F9NA 2ZVOA 1QOBA 2H3FA 4GGQA 3VHTC 5ALFA 4GXIA 2K4IA 2X8XX 2PMZF 1ZJNA 3RNAC 1ROEA 4KX6B 4NLCA 1SE9A 4J9RA 4CF4A 5FP0A 2KDIA 4Z6DA 2CRXA 4JE3B 2EKIA 1F1HA 1WCNA 2RGFA 1N63A 4TQ1A 5KFJA 4J9KA 3CF6E 4KGRA 1QF6A 9ICRA 1GUAB 4OJOA 1NK6A 1DGSA 2N7DA 4WQMA 4PZOA 4ED3A 2IHMA 4P16A 2MUTB 4ARIA 4K81A 3N3KB 1SXEA 3Q8FA 2DZIA 3E58A 4ZRPA 5FR3A 9ICGA 1L8OA 4MM3B 5GXGB 3UXNA 3V62A 2YQEA 3OLMD 2KFNA 4LZGA 2ZTCA 3RFAA 2GI9A 1QQ7A 4RGOS 2H5XA 5C0YA 2INCC 3PMLA 3PZ8A 4YR0A 3MR5A 4LNIA 3H8JA 4IL6U 4RUCA 3NZUA 4I2HA 2V9WA 3HW8A 4DS5A 1S0MA 2N9EB 3SAHA 1TIFA 2ZEQA 2EZYA 4QZ9A 3IHPC 4YMOA 1BPEA 4QZIA 3V6EB 4KV2A 1ZQYA 2KV2A 5L1KA 1GO3F 1E8YA 1NYRA 1L0YB 2JWUA 3Q69A 4XX5A 5IA7A 2MH7A 3PX4A 1B0XA 4DFPA 1D8BA 1IG6A 2WS3B 2BWFA 2ONQA 5KL1B 1DGJA 1C77A 1AW7A 3V3XA 2NRXA 5D4BA 5JTIA 4HPPA 1ZE3D 3ZD9A 3V6JA 4QWDA 1A6SA 3ISCA 3LB8C 2W82A 1L6VA 3P63A 2Q5WD 4P1CC 1TVAA 3DBRI 4G50A 2HHUA 4PL1A 2WWZA 5TSSA 2JYEA 1GAQB 2ODGA 1K52A 3PZPA 2MBEA 3B08A 2JZBB 1Z1BA 2ZUDA 4DL3A 3Q3OC 1J0GA 3R2IA 4Z6FA 2J7QB 1WMHB 3JW0X 3NZSA 2FIDA 4FJVB 2D2QA 2YEPB 1FNWA 3H1UA 5LXIB 3H8WA 3GIJA 1O03A 3Q8QB 2C2RA 1TJEA 4DXAB 2LRWA 1P9DU 2Z0EB 2O6VB 1Q1OA 3AI5A 2EAPA 2ZIWB 1KDHA 3BVGA 2AXTU 4TKNA 2L83A 4F92B 4WURA 4ANUA 2M8SA 3IVFA 3F2BA 5JHBA 2ZTDA 1VZ7A 3CP8A 9ICQA 2K4EA 2AQ1B 2G5IB 2XCPA 1NKCA 1QLNA 2CKHB 3TMPB 4FE3A 4FHKA 5D94A 4NAWB 4YMMA 2BQRA 2KK0A 2ASQA 2P66A 4O5KA 2RLTA 8ICFA 3K9OB 7ICNA 2Q4TA 2HOFA 3ENEA 2EAMA 1XQQA 1TS2A 3IAS1 3KD3A 2WXNA 2DQNB 2WXMA 2LRUA 4W9DA 4UAWA 2BT6A 3KVFB 4MGKE 2M56B 3AL0B 3SMVA 3RJIA 4G0NB 4HDOA 2QHOA 4P7IA 1A5RA 3C19A 2Z7JA 2N9KA 2GBKA 4NJ7A 1HXYD 2LM4A 1WR6E 2WYQA 3F2CA 3DBSA 5AKJA 3EA6A 4JLCA 5JZEB 2HBJA 1NJWA 2XCAA 1ZD4A 1UA0A 1JRUA 1SJED 3GFKB 1YQ3B 3S6JA 4PZNA 3VTWA 3AEAB 5AHXA 1V5TA 2BCQA 7ICPA 3BINA 4YSXB 5CHGA 4MELA 5KT4A 2E6XA 3ZNGC 2AH5A 1I7HA 5DBCA 2ZW1A 1NI2A 5AIAA 1PK1B 2ZXIA 1ZD3A 2KZ3A 3H9DA 3P1MA 9ICKA 2RDIA 5DB7A 2L0FA 2MCNB 3A0HU 1EU4A 4JGHB 4OCZA 4W9IA 1WGGA 2K8HA 2EKEC 4P6VF 5L83A 3OJSA 1Z2MA 3TADC 4NQLB 1CJEA 9ICJA 4C8MA 2N9LA 4DOBA 2YMMA 4KDIC 4F91B 2WHEA 2XGQA 2AU0A 2C7HA 4ZRKA 3D2NA 4IM0A 3QNMA 4F5RA 2V3SA 3V6HA 3RD2A 1F0MA 2L0TA 2H3IA 2HSZA 1V8CA 2MBQA 4EBCA 1M4VA 5AZGA 3UINB 1SV0A 5B5EU 4UAVA 5TZVA 3M9OB 3MTNB 4MM3A 1V1PB 3JYUA 2V4IB 1S97A 5CJ7A 1R7SA 3Q3JA 5LLIA 3FDSA 4ECRA 1MVKA 2RDGA 2E8MA 3W1YA 2DFLA 1ACCA 2ASDA 9ICSA 3H7SA 3OHBA 1WWTA 4DOCA 4C4TA 2DAFA 5KFMA 2QCZA 1RYUA 2BKEA 1LGRA 3TBLD 2NV3A 3AEBB 3PZ7A 2FIFA 1STEA 3KWVA 3PO0A 3ONSA 4Y2QA 3TUOA 1NKBA 3NOBA 5KFYA 3ZDEA 2L52A 1AARA 2KVRA 4QIWC 1B4FA 3G6VA 3TAPA 3L0WB 3K75D 2K60A 3IRUA 1H38A 4WWPA 1DXSA 3HVDA 4Q45A 2C22A 2QMTA 3MDAA 3MC0B 4W9FA 4CYEA 2WP9B 2MP2B 3QU5A 2N1RA 1SKWA 4UB6U 1WZ0A 2WXLA 4H2AA 1E0ZA 3SYZA 2I1KA 1SE2A 4IUMB 1TS4A 3N20C 4F2SA 2W3RA 2OEHA 2GB1A 3HK0A 3PW7A 4O5EA 3DCGA 1KFTA 1EWCA 4QAYA 2KWVB 3C21A 3VAWA 5ALUA 2KT7A 4F4YA 4AP4C 2IZVB 4KGSA 1SWVA 8ICIA 2WB1F 1EUVB 2JZBA 5KFGA 4RUAA 4DL5A 2M19A 4GSWA 4JPSA 2QB0B 1YT3A 3U8ZA 1F0ZA 3NG0A 4YR3A 5AI0A 3S2AA 1QLBB 5CHVC 3ETRA 9ICNA 1J7BA 2ZPNA 1S0OA 3PGEA 4KN7A 2GMIC 4J9QA 5ALRA 1E8WA 1P7DA 2G0AA 4I2IA 5B66U 2KLCA 2O6VA 3W1SA 3SDLC 4P0PA 2IJ0A 4XWTA 2WXPA 2KFKA 1ZXIA 2MRLA 2ZIWA 1DYQA 4HXDA 3RJKA 2F2AB 2W03A 5KHOA 2JY6A 1UGMA 5ALXA 2H88B 4RQ3A 2PI5A 1Y8RC 4JMUA 4Z6CA 1XSPA 2A5UA 2BWES 2LZ6A 8ICMA 2NYVA 2YMQA 3BK2A 5L1MA 3IXSA 4UAZA 4CQNA 3KKAA 1Q0WB 1WXQA 4NAWA 1BVSA 4I2AA 2WF5A 1ET6A 4Y2RA 2E8NA 4BFRA 4K3BA 2IGDA 4OVVA 1FXIA 2K5PA 2BCSA 8ICLA 2XC9A 2EZXA 5J2GA 3F53A 3OGUA 2KQ4X 1IPGA 1ZQQA 1IGDA 4EKUA 1C7YA 5ALYA 5MPOA 3THVA 2CJNA 2SEBD 4HYKA 8ICEA 5T8IA 3NZ3A 3C5FA 3EW9A 4DCCA 1TS5A 4UQGA 3RNGC 4AOFA 8ICAA 3Q8MA 2GBRA 4LDTB 4ED2A 2HD5B 3RN9C 5KG5A 8ICJA 3VXWA 8ICHA 4JUZA 4PL2A 1GC7A 3WA0A 3JPOA 3ZDCA 4BKSA 4FFDA 1K1QA 1MPEA 1R4MB 2NRZA 2DGZA 1N6ZA 2ZIVB 5ALQA 4F4ZA 1ZQFA 5CTRC 3UQ0A 2AL3A 4IC7B 4FBTA 3OJ3A 9ICWA 1VR9A 1BPBA 2HDEA 4M00A 1C4CA 4LZDA 4UAUA 2OJRA 3PTFC 1ZRNA 2LGSA 3GE8C 4KX3A 1MA7A 5EWGA 3RNCC 1TGZB 1NNLA 3DDHA 2ZUBA 1BMLC 2AQ0A 5ALVA 4PHDA 1X66A 1Q3UA 2Y1JA 5AUIA 3RAXA 2CXYA 3QHTA 3E0FA 1C3TA 2EAOA 1AROP 2NBVB 2BDUA 1V1PA 1QSYA 4DSLA 3QUCA 1WGKA 3M95A 3RT3B 3ZDMC 3ZKJC 2PMVA 2MWSB 3DHIC 5C3JB 1I4PA 2B0CA 3GE3C 4ED8A 2ATLA 4O3OA 2KMMA 4KLFA 2NVUI 2Y1IA 3M3JA 4US8A 1CI4A 3SAFA 1X2IA 5KG0A 3WKAA 5EDSA 3C29A 1SGGA 3DDCB 3C1ZA 1WE6A 3AEEB 4WH4A 1KW4A 3H40A 5E6JA 4CF3A 5ALZA 1XLPA 3FM9A 3JPQA 4DHZE 2BB6A 1UQVA 2RDHA 4YXMA 4XRHA 1PFDA 4KX5A 4F50A 5HFYA 3VH3B 3M6ZA 3PNCA 2WTFA 3RB4A 3H0RB 2W55A 3TARA 4K4IA 1ZQOA 1PGXA 4MSQB 2JRZA 1MC8A 2WF9A 5DPRA 4BOZB 1LVHA 3GB1A 2JMGA 2KAJA 3ZDBA 4BXOB 2KN7A 5EE9A 1WGHA 5AK5A 3OTQA 4UASA 3LDZE 3M6KA 3V7JA 2LVPA 2NPTB 1MJDA 3P4QB 3Q8AA 4DSJA 1BNPA 3M8RA 4DQIA 1FFVA 2DAJA 3B1LX 1WWUA 4QNLA 7ICGA 2QB0A 2G4DB 3NTUA 1XNSA 2DZMA 4AJWA 3BZCA 3V60A 1YJJA 2GWSA 3DV9A 1KKXA 2RQ5A 2VJ4A 3M8SA 3VFKA 2CU1A 4PS8A 5E79U 4M04A 3HX0A 1IBXB 3QIJA 4JV0A 3GIMA 2PVOD 2ALZA 3A9JA 2MLBA 3U2SC 4CE6A 3IG3A 2C7NB 2BYFA 1VZ8A 2GH1A 1ZQXA 1U45A 2A4ZA 1E10A 1WX7A 4HPMB 3V61A 1RDFA 2FAZA 3DBHI 1SSNA 2LGXA 5D46A 4IKGA 2JEJA 5AM2A 2VH2A 5L1IA 1I35A 4XWWA 1YN3A 3ZJUA 3RJGA 3HJEA 2KMCA 2YLMA 3UQAA 2N7EA 2G07A 7ICQA 5JH5C 3C2MA 1ZOYB 1P98A 3MFGA 2R61A 2BCUA 3FILB 7ICVA 4TSSA 4B0EA 2G06A 1YJ1A 4FS1A 7ICJA 4MEMA 3TEWA 3U30A 4USAA 4RQ1A 4YFKA 4YL8A 2NO5A 4MHVA 1VZ6A 2CR5A 5H8YE 5JHAA 2R8JA 2VIXA 2MBHA 1PQSA 4ICAA 3G6YA 2L3ZA 3R66C 5IN7A 3O13A 3ZDAA 4DQPA 4M01A 3JPNA 3Q14C 2ES6A 4LLGM 4EZ6A 5AI6A 3HKZF 1J7CA 3W9CB 5AKGA 3OJ4B 3T3NA 1SKSA 4IWQA 2CHZA 2LEKA 3H8MA 4RT3A 3IFWB 3J9CA 5KAIU 3A4SC 3IAM1 4UB5A 2MEKA 3GS2A 1BT0A 3EPGA 2V3PA 3UMGA 2HHTA 4RGMA 5DGAA 2W04A 4DQSA 1XSLA 1C4PA 4KLTA 5KFSA 1XS9D 1Q3VA 1OFFA 3D6JA 1WXSA 2ON8A 2YMLA 1X9MA 1ZQEA 2LPEA 4C4VB 4K3CA 2IO1B 3B2GA 4ASWC 4PGXA 3V7LA 5DQGA 1IUEA 4EOYA 3ED5A 4XGAB 2R8IA 1NYQA 2RHFA 1WZ3A 1XCTL 4YT0B 1N56A 1KJTA 4ZRQA 3DVNU 5ALOA 4P0QA 4BDPA 2AQ2B 4OJPA 3AE6B 4DFMA 2KJ5A 2Y0SF 3UMBA 1ZGUB 1BPDA 3LK9A 1KFSA 1MFWA 5HI1A 4YMNA 2REXA 2KDMA 3RI7C 1X40A 4Y2TA 4O3QA 5J2BA 4UB2A 3JSVB 5KFBA 1VDVA 4YQWA 3JPTA 3QK0A 2RPVA 3I3TB 1ZQVA 4G9BA 5J2JA 4P4MA 4GLXA 1KEJA 4RNNA 4YTMB 2NBUA 3ICXA 1WJ6A 4YWGG 3TCAA 3CSFA 2CPRA 2QC8A 5KFVA 1MN8A 1WUDA 4ANWA 1V86A 5HR6A 5IIOA 3ZRCA 3SZ2A 1HA5A 4WWMA 2J0KA 5HKHA 2D3CA 4K7UA 4RPZA 2JF5A 2V4LA 5KT5A 2N0SB 3RH4A 1TKDA 2NPTA 1YNTE 2MSED 2K9XA 3CIRB 3DWMA 1N2XA 2J0JA 1ZQHA 4R8UB 3KHHA 2AEHA 9ICHA 2LYBA 2IPKD 1D9DA 2W54A 3O0FA 2YTUA 3OSPA 1DRGA 4OJLA 5DG7A 1XO0A 2HHSA 2GOWA 4KVGB 5I4DA 3AM9A 1PDXA 4DL2A 3DBLB 4RH6A 3ZNHB 2KVZA 3C23A 3OAWA 5KFQA 3SHQA 4NNJB 2IGGA 3KW5B 1IBXA 2PLPA 3KLSX 5J8YA 2EQYA 3GDXA 3RRHA 1J7AA 2FE8A 2QARB 1F44A 2KDEB 1BPYA 2QIEB 2KWDA 2WXQA 2JEIA 1UH6A 3MJWA 2KYWA 1UBQA 2YY6A 4WQOB 3MBYA 3ISDA 3OJUA 4ECWA 8ICTA 2FCSA 3WK7A 1N61A 4FXCA 2ZVNA 9ICMA 4RMAA 7ICFA 9ICLA 4PGQA 1FIQA 2HVIA 3URYA 4ED6A 8ICZA 1OTRB 2HHXA 4C8OA 2IDYA 3PMNA 3QU2A 3IG8A 1CRXA 2K1FA 2KIVA 4BWJA 3MR3A 4BKGA 1S77D 2KX3A 3FILA 5KFDA 1X6IA 2H3ZA 3T5LA 3RR8A 1ZKHA 1ZXHA 4B9VA 4KKIA 3VVWB 4RGNA 8ICRA 2DZJA 3VH4B 2JZ3B 4NV0A 3UIOB 5HP4A 2FMSA 2W11A 3RZFA 3HT3A 2ESEA 3PR4A 3KTQA 3ZXRA 4LNFA 4Y2PA 9ICPA 1MI0A 4JB3A 5F9LA 4F8CB 2FLLA 4REZA 4Y2YA 3PV8A 4NL9C 5C1ZA 3KBBA 2PW9A 1IXRA 4EENA 4K4HA 4HCNB 2L1AA 2Y5PA 1OQYA 1WJNA 4M02A 3L16A 3L10B 2KE7A 3PY8A 4O5CA 1XF5L 4AYBC 2XY6A 5IINA 1KN5A 2HI0A 3ZI4A 3TKAA 4W9KA 3C28A 1P7FA 3CW2C 1R4NB 3BYTB 3M9NB 1YJIA 4FZLA 1OQQA 1RG6A 3RTVA 3BQ2A 2RSUA 1HJPA 2VJ5A 4HKZE 4I2DA 4HJGE 4QWAA 1X9WA 4TV3A 2OM6A 4P1BC 4IQTA 4ANXA 2W8LA 4DWIA 3H0MB 3K1RB 1FCCC 1NK7A 1TKEA 1QCKA 2PJHA 2WLBA 5DDMA 5AICA 4EYIB 4C4VA 1EF1A 4KTQA 2K4PA 3RR7A 1P1AA 2KWUB 4TMAB 5J17A 1I42A 1VLBA 4YSZB 3N1XC 1C1YB 5BMGA 1U48A 4K1RB 3WKBA 4DLGA 1WFYA 1ZQUA 3PO5A 2A19A 3GILA 1JMSA 3BQ1A 1ZQBA 3APCA 2J6SA 2KKVA 2W7OA 5LXHA 3QJZA 1L7PA 2DF4B 2VRRB 5EE0A 1ZQNA 4F4WA 2G3QB 4DSKA 1ZPSA 2FLPA 5AKLA 5JRTA 2LVOA 3WANA 3QZ8A 4B0MA 1BXTA 1COOA 1ET9A 3JSVA 1ZRMA 4QZBA 1HZ6A 3RNFC 3EHVA 2VZKD 4HDQA 1U9LA 2AYOB 4PYZA 3N7PD 4MFCA 3RNBC 2G45B 2AHOB 3RJEA 5AM0A 3RH6A 4ECVA 1V80A 1KFYB 5AM5A 2IOFA 3RB3A 2BKFA 1RPLA 4A8XC 2LI6A 2UVWA 1A77A 2DPJA 2J42A 4CNQA 2MBOA 1SJHD 1N62A 1HZ5A 2PFNA 2K4HA 5KT7A 4WIPA 5BOMA 4QJFB 1D5ZC 1PYWD 4P0PB 2V3NA 4O9MA 3ZJVA 2WX0A 3GZNI 2KFKB 1JROA 1FD6A 3AV8A 4YG2A 4NLNA 4M9HA 3LJ3A 2KXJA 4KZ0A 3U7ZA 1A70A 1WGYA 5D49A 1YN4A 2KP7A 4GIVA 5BMHA 5L95C 3PV1A 4LJXA 4R66A 1S10A 3BZDB 5AKZA 4R8UA 1OGWA 3ZDTA 1UT5A 1TAQA 2F76X 3Q8LA 1ZQTA 1QOFA 4KLHA 5AKKA 1XD3B 2FUG1 1XCQL 2HTHA 3T8MA 4EELA 2PI4A 2KKCA 4OZCA 2C7MB 2WAQC 1Z19A 9ICOA 4W9GA 3BQ7A 4EEKA 1FEHA 3BVMA 3CYMA 1NK9A 5IIJA 3V05A 2K8CB 2G5HB 2ZPYA 1EXNA 2AGPA 1URJA 5DB9A 4KLOA 2LXCA 5KFHA 3ABVB 3B0AA 3T5JA 1ZQSA 3DBRB 4IM2A 5AK6A 2BPSA 3QUBA 5JUMA 3AUOA 2QARA 2IY1B 4PK1A 3TACB 2CN1A 2YVCA 4DSFA 3QU4A 2KHQA 3T3OA 2ZCCA 1RYSA 1E5WA 3PZDA 3KFUF 5HNKA 3A0BU 5ALDA 2DWQA 2IO3B 4IS7A 3MHZA 1BGXT 4WJNA 4C7ZA 3K4GA 4XUSA 5ALIA 2LM1A 3SFDB 2R8HA 5G2NA 1ZDVA 1X9SA 3SD5A 1Z3EB 4IQWA 2FCMA 2WQYB 4ECTA 4NLKA 1SGHA 5BYRA 3U7DA 1KL9A 2JGAA 3Q8SB 1C79A 5DG9A 2QILA 1XC9A 1D6EC 4UB1A 3AU4A 1BPZA 1H8CA 1CZPA 3QC8B 2JXTA 2CHWA 4J03A 3HWTA 3AH7A 3B0XA 1OUQA 5DPWA 4KITB 5ALWA 1N48A 3QE9Y 2WXIA 3GP7A 3CRXA 5ALNA 3AE3B 4HWIB 2V4RA 5HHHA 4RQ6A 4QWCA 1JWBD 3PSIA 1JN3A 2K0PA 1L0XB 3VTUA 5KAFU 1HIWA 4N59A 2W7PA 2WGSA 2KNJA 4DFKA 4Y2SA 1TK0A 2L00B 2ASJA 1YZ6A 4DO9A 4UW9A 2XY7A 4EBEA 4E71A 1AQ6A 4LK0M 2V9HA 2BPCA 1U47A 5KFUA 1RLFA 4N6EB 1KRHA 1BUIC 4NWIA 4MF8A 4TUPA 4J9OA 3T3FA 2KTFA 2NRWA 4ICVA 2ACZB 3NS8A 5ALSA 2OH2A 2MSNA 2WXGA 2RR9A 2Z8LA 2A3VA 2NBWB 2HHWA 2GBMA 2XK5B 4MGYE 1SKRA 2INDC 5BYSA 2BCRA 4A8EA 4YXJA 1NJYA 2DX5B 3KZXA 3Q3FA 2NMQA 4DSEA 3KYCD 1V5OA 4RF1A 2JEGA 1QILA 2R2QA 3ZTCA 2BR0A 1TE2A 4DQRA 1KSPA 4EZJA 3N30A 1TS3A 2JU6X 4TUSA 1WGDA 1FXTB 1ZQDA 2E8PA 4RQ2A 3A33B 1FO4A 1JRPA 2PMZC 4M8NA 1YN5A 4UARA 2MA1A 4FBUA 2XI9A 1V6EA 3A1QB 3QAQA 3QZ7A 4JWSC 2HHQA 3ZJTA 1P3QU 2KJHB 3WU2U 3B0YA 2GO7A 1K50A 1UUPA 5BYQA 2DLBA 3AB5A 3ZLZA 4J3OD 5IOIA 1SE4A 4PT5A 2KOBA 4EEYA 4KLIA 3ML9A 4YD1A 4I6LB 5DPTA 2V4QA 1LQBA 2PEAA 4ECUA 4DQOC 5KFRA 3UXOA 4KLQA 9ICEA 3QWZB 2XVTA 3NASA 3ML8A 1Y56A 2G9HD 2MQJA 2Y5CA 4NXZA 3TADA 1E7PB 5IIMA 4ZYSA 1RQLA 1DOYA 5KL8B 4EBDA 1UELA 1J2NA 2JQRB 2ZCBA 4PHAA 3A9JB 4HEA1 3L13A 9ICBA 4XDDA 2BPFA 1QH9A 5J0QA 4IG7B 2DUYA 1WYWB 4XA5A 4BBNF 2N4FA 3DPDA 4NJCA 3RZWC 1YZ7A 4I2JA 1J2MA 1BNOA 3IBEA 3KWLA 3RB0A 5TISU 1KFDA 2HOIA 2L8JA 4CDGA 3HM3A 1KM7A 2NTSA 4LTUA 4DF8A 2K8CA 1WF9A 2DYMA 4RCOA 4ITKA 2V0GA 2I1QA 1T0YA 2KC1A 1TZ1A 2D07B 2J4XA 4D2KA 4NM2A 3AE2B 1SZPA 3ZIMA 1JUDA 2H89B 1B22A 1I4GA 4GXJA 2K39A 4C8NA 4NY8A 1KLUD 4HPLB 3BK1A 4DHZB 1C78A 2VH1A 3L17A 4RQ8A 1GOZA 2M0NA 1I4HA 2WDTB 4GLSC 5ALJA 1RQNA 3BQTA 4FZMA 3PREA 4YTPB 2IHNA 3NUQA 5CA7A 2G4SA 3ZXVA 1JWSD 2M0XA 4KGTA 3I57A 4KMOB 4OZAA 4GN1A 8ICSA 4NJ6A 1SV4A 4LNKA 2OXOA 2BS4B 2RPQA 5J2KA 2BS2B 2LJ5A 1Z1VA 3H8HA 2P6RA 4NAMA 2WF7A 5H2FU 3AQFA 1I4RA 1L5PA 1Z4NA 2Y9UA 2YB4A 4JWNA 2F1HA 1XXGA 1N60A 4HRSA 2BS3B 3WK5A 2BW2A 8ICPA 2G1EA 3N1YC 5J0YA 4C7YA 4F5PA 4IW0A 2KOXA 4EEWA 2LYHA 3R8BA 1MHXA 2A1AA 1ED1A 1B1ZA 1ZQWA 1SE3A 2C5LC 3WAPA 5EE1A 4DHJD 3VCBA 2BVCA 3PHWB 3ZYYX 5G5GA 3Q3NC 4O3NA 1SEBD 2BQUA 2F77X 2DNFA 2KQSA 3PS6A 5LNK1 2VKQA 4OHJA 3PVLA 4UAYA 4J6IA 3RB6A 5J18A 3TL5A 4U7CA 4P0QB 4AP9A 3BY4B 3Q6BA 1SL2A 3HILA 2PFQA 3PRPB 1RYJA 3JVZX 2DL0A 4WAFA 3TJPA 4KSLC 4NLGA 4XZ4A 1RAXA 3GIKA 2KC2A 2MJEA 2ZNVC 3UGBB 2JZPA 2LD9A 3LDAA 4DOAA 3PVXA 4F2RA 2RD0A 2XK5A 2O6KA 1VJ5A 4NQKE 2LBOA 5KFPA 5J29A 4J9MA 3NHEB 2MAXA 3FC4A 4IR9A 2ZJ5A 3VRBB 1IYFA 2KVSA 2RRDA 5AKEA 3PRZA 8ICCA 3GZFA 4MEYA 3Q8KA 1ZYQA 1VRAB 4GDKA 1HTOA 3UI3A 3JPPA 3RNEC 2L05A 2QDFA 1XO1A 4GOCA 2Y9TA 1KTQA 2DYOA 4QZGA 1V9JA 3R3MA 1S5LU 4AUQC 2KIWA 5H92C 4LCDE 4EX6A 1YIWA 5BO4B 1Q10A 2KANA 3APFA 4TURA 4RPYA 3A1QA 3QX7A 3E9SA 4NY0A 3TQ1A 2WDVB 5KFOA 1C20A 4K4GA 1UPHA 3SV3A 5AKHA 5J2HA 3B2FA 4MJSA 3IG5A 4P4PA 3R9KA 1ZUD2 2BYTA 1JIHA 3LVVA 5BPCA 3P4RB 1MG4A 1QSLA 3Q8CA 4S17A 1XU4A 4F93B 1PVPA 2KJ6A 1T6BX 4MGIE 5KFLA 3NVZA 7ICLA 3MR2A 3APDA 2RP5A 4P4OA 1FNVA 4F5OA 2H3VA 4CGZA 5KT2A 3M7DA 4FHJA 5AI8A 2CHXA 1D9FA 2FE9A 4Q2JA 5D7GA 1V81A 3X23A 2KHWB 4UBCA 4HLEA 2M17A 4F3OA 4IWOA 4F4KA 4IR1A 1WE7A 4UB8U 2WDQB 4C4RA 4NLBA 5KFTA 3IT4B 3M9MB 4RQ4A 5KG6A 5A0LA 2HHVA 3WIMA 4BGDA 2JR5A 2IO2B 3WAOA 2F44A 4JK1A 7ICSA 2WXHA 5KG2A 1KH0A 1MHHE 4N9F4 1ZQCA 2PVGC 5AM1A 4ECSA 2KZMA 4A3OA 4DDGD 3N7RC 4KIKB 1K51A 2DZKA 3BWUD 4ZHOA 2FDRA 1WI0A 1QOGA 3NVVA 1XEEA 1X42A 4P2HA 1SBBB 3A9KA 3KHRA 4LJOB 1QQ6A 2W9MA 3QU7A 4ECZA 4KLUA 1UNSA 5DG8A 3PW4A 4W9EA 3V6CB 1C9FA 2X38A 2JRIB 3GV7B 7ICTA 5IKCM 4FLHA 2A1JA 4B6JA 2QLTA 4C4SA 1RFAA 3F2DA 1H4RA 1SB3C 3ALRA 5J0PA 4G11A 3AE1B 5AK3A 3W5VB 5KT3A 1JALA 4BWMA 1FFUA 2WB1C 3T79A 4RM9A 4RGTA 1NZBA 1JMLA 2AQ4A 3KZIU 3TANA 2MJ3A 3PPAA 1NJXA 4YN4A 4RNAA 4DL6A 4II3B 1WM2A 4WWNA 1WWVA 3AE9B 4N58A 1L3SA 3QARA 1WY8A 4HROA 3U52E 2O2VB 3IHQB 1NBFC 4M8MA 3MGHA 1TK5A 5EOZA 1TZOA 5J0WA 1RZTA 4X5VA 3KYDD 2ZJ8A 2DHZA 3JPRA 2QB1A 3DBHB 4GDLB 4FADA 1VCBA 2OHFA 4Y2XA 5DBBA 2FLNA 4OD0A 4CF5A 2FPLA 4E3CA 2KJ8A 3HM6X 3IT6B 2J0MA 4C8KA 5DKWA 4Y2VA 4QZFA 3GIIA 2JT4B 2LHEA 2N9XA 5DQIA 7ICIA 4I2GA 4BOSC 4HVBA 3SI8A 4ZRIA 3QQ8B 5AZFA 5FKAC 4IRKA 5KFKA 4ECXA 4WJOA 1FCLA 2MW5A 1RYRA 4DL7A 3D2SA 4CHKA 4FZNA 5CRXA 1COKA 2BB5A 4E74A 1CEZA 1PK3A 3N4MB 4OJ5A 1WXAA 1L2NA 3ZW3A 4C8LA 1PZNA 3H7IA 1XO3A 2K6DB 2PE9A 1V1OA 4LJPB 4RNMA 4GB9A 2AGQA 2B3AA 3DVGY 3TEZA 3P4PB 5KFNA 2E3TA 1TK8A 5GMVA 4YXDB 3B9JA 4DF4A 4A3PA 4GXBA 1HE8A 1D4BA 2M9NA 2WXOA 4RU9A 2DKZA 3DHHC 4X57B 4J9NA 5IIKA 4IWPA 1WCLA 1L5UA 3M62B 5ALLA 4CO7A 4I27A 2LKYA 3AE5B 2HJ8A 5K4LA 3LWMA 2UYZB 1Z00B 2O6VD 4AJYB 1WRDB 2H3QA 3K1ZA 7ICEA 4QWEA 3H6NA 1LM8B 2I38A 3L08A 1UCVA 3H4BA 1C76A 2FJ6A 1SL1A 1MSWD 3PSPA 1OEYJ 3H7PB 2D11A 2TSSA 3OG5A 4M47A 2J53A 4RFBA 1L3TA 3ZRFA 2INPE 4JX1C 5AKIA 1FEZA 1MG8A 2JEFA 1ZQKA 3HP6A 4PS3A 3MGIA 2JSVX 5KFZA 3H4DA 4IM3A 3IV6A 4Y2UA 3WALA 2K22A 1E6EB 2WXRA 1TAUA 1IP9A 2W9NA 2LGYA 2WHIA 1WJ4A 1M6YA 4DLEA 1YQBA 5ALEA 5BMIA 1YX6B 1MQ3A 1RXWA 2XNAC 1NJZA 5KFFA 2K6QA 2LMCA 2ASLA 1Q5WB 1X6JA 3N7SC 3RBDA 2HVHA 1B9RA 2E8OA 1ZD2P 1KF6B 2XEWA 5AZHA 4EE2A 3PW5A 2JRHA 1XWLA 5DLGA 2V1YA 4J9LA 1T5XD 3NRZA 3V6KA 4MFFA 5DB6A 1T0SC 4BAXA 3UMCA 8ICGA 1PVQA 3ZD8A 4JWMA 4BKSD 4DQQA 4MEXA 3MFIA 2FNJB 2D3DA 3P2BA 2LYAA 1VJKA 5GTHU 1CMXB 4JL9A 3UPQA 3AQEA 3TI0A 3JPSA 1AN8A 4M6WB 1WXVA 3CSTA 3DEEA 5JU5A 1IV8A 4NM1A 2B76B 4L1BA 3AECB 3OPXA 1S9FA 3NGDA 2CJOA 1SXTA 2D5GA 4KIKA 1JI7A 3CMMB 3EFCA 1HUOA 2YB1A 4EX7A 1UA1A 3DQVA 4FN2A 2UVRA 3AE8B 7ICHA 2WDRB 3KH0A 4BZAA 2KJRA 1S3SG 2LJIA 4FJYA 2IOHA 1UT8A 5KFWA 3DVNV 2KNBA 1F2RC 2WF8A 4WWOA 4A6QA 2OYYA 2QEJC 1M94A 3AULA 1TT5B 3WKEA 3HUIA 4ELVA 3SEIA 1WG8A 5AM4A 5J2RA 3D32A 3QYPA 3H8SA 4QIWF 1E8XA 4C56C 5J2FA 3LWLA 5KNIA 4ECYA 2JHDA 3PW2A 4Q8EA 2Y5BB 1L8LA 4MT5A 3RAQA 2IY0B 2BKRB 2WNMA 3OWEB 8ICKA 4DBGA 3Q8PB 1T0QC 1SIJA 1S0NA 4Q43A 1QTMA 1HUZA 2PXIA 1J19A 2O2VA 3PLVA 5DLFA 5J0SA 4DDID 3BS7A 1EO6A 4GDLA 2K3UA 2PKOA 5AUKA 2LHDA 2ZJDA 4DS4A 2JYTA 4J9SA 5G55A 1FNUA 4LVSA 1HEKA 3N28A 3PO4A 3UF8A 4M9GA 2EANA 3ISBA 4KLDA 1SZHA 2PIAA 3WAMA 5DBAA 2NRVA 3RUIB 2KKPA 1LB2B 2K8BB 4YCXA 2UU7A 4BUGA 2BPGA 1G6JA 3MR6A 5L9XA 2GBJA 5J0UA 1NK8A 4WJ3B 1T3QA 2IO0B 1U4BA 4CCHA 8ICNA 4B9SA 1RFKA 2MX2A 2EELA 2ZIXB 2LMRA 4UB4A 3SU8X 4I29A 1KLVA 5ALMA 1S76D 3BVZA 3KUZA 3DVGX 1TTNA 2Y3AA 2HDOA 2F1JA 1XSNA 1S8OA 3L3FX 4B9LA 2HW3A 3ORYA 4JQWC 1GB1A 1XLQA 3QUQA 3OHAA 5ALPA 4MDKE 1ZW7A 4GU2A 2W43A 4F4XA 4U6PA 1NENB 1K8RB 2M1MA 3HKZC 4NLZA 3VUXA 1FRRA 1K1SA 2LGDA 3AEFB 2L7RA 1X1MA 2R2OA 3NY5A 2BYVE 3NUHB 1Z00A 2KVCA 2MRPA 2KQ7A 4JIOU 2XICA 4A90A 1UWMA 4W9LA 3SD7A 7ICMA 3H7PA 2R8KA 4R63A 2YMPA 2L5YA 1FMAD 4NL9A 4B9UA 4PGYA 1OEYA 3EPIA 2HJ1A 2MHJA 5HG2A 1ZQPA 1WJUA 1QQRA 2QJLA 3ECIA 1WXMA 4DXFA 2IYDB 4M0AA 4FJZA 1WGRA 1OW5A 1JXEA 4I2EA 4O3MA 1WRIA 3AMZA 2INNE 2JZZA 4M0WB 5DGBA 2R8GA 4M2YA 5D6JB 4ED7A 3TEXA 1SV0C 1YMHE 3ZNID 2ZTEA 3FYHA 4A55A 5ALKA 4HKQA 3KHLA 3UIPB 3MC1A 3UQ2A 1NEKB 3FKYA 3RJHA 2OEDA 1F5SA 3VTVA 1JWMD 3RMKC 4A20A 1WSPA 5CHFA 1V97A 7ICRA 3PRMB 2KZRA 1B43A 2Y0SC 3T5KA 1I4XA 4LDTD 3ZGZA 5J2DA 3HVZA 1OQRA 4LNNA 5AI5A 9ICCA 3I28A 3QA8A 4IQVA 1EU3A 4URKA 4GC7A 4FO6A 1LKYB 2KN4A 1DOXA 3WK8A 1BPXA 3L4PA 1UF0A 4M6WA 1AYFA 1DOIA 5KFEA 2LHTA 4RQ0A 2F8KA 7ICUA 2C28A 3GZNB 2Z59B 1ZQAA 2HTME 3TFSA 1ECWA 1RXVA 1D8LA 1HTQA 1J8CA 2W9BB 3GU3A 4I2BA 3VC8A 8ICYA 4AS1A 5CEHA 1ZQJA 3QU9A 1V2YA 1V9PA 4FS2A 4MF2A 3BDPA 4O3RA 5HR7A 4XE0A 3RFZB 9ICIA 5DPSA 4ZDVA 2LVQA 3ETLA 9ICTA 3CNHA 1GJZA 3F5EA 1F77A 3AU6A 3R7RA 2E1EA 5DDYA 4PPXA 3I9V1 1UHUA 1Z5SB 5AEKB 4KLMA 4B6WA 2DKXA 4DL4A 3W1SC 1KTKA 2HBMA 3Q3MC 1CUKA 2I5HA 4XC2A 4QZAA 3BJYA 4KMUA 2MA9B 3PR5B 3NVWA 4YVZA 3WK4A 5BOLA 2VA2A 2KLGA 4F71A 5C5JA 4RQMA 2VANA 3WK6A 2DBYA 4YSYB 4IRCA 3QEBZ 3L54A 4US9A 4YR2A 5J2IA 2NO4A 1KLNA 2WXKA 2MUTA 3WK9A 1SIFA 3AN1A 3KKAC 2W8KA 9ICFA 2XY5A 1LXDA 2BGFA 2K8BA 2WXJA 3VDZA 3I1YA 5J2EA 1TYGB 4DFJA 5AKXA 4MSMB 2ZUCA 4OO1J 3PSFA 1T4GA 2F8LA 1QSSA 3T5HA 1T0RC 4GDKB 4R64A 3N97B 2RDJA 2KSOB 2JUOA 4YTNB 2BF8B 3GV5B 3DHGC 2ZIXA 3ONNA 4II2B 1D8YA 3IN5A 3BYYB 2BBCA 5FK9C 1KOTA 1XLNA 1EM7A 1T3NA 3Q2AC 1C4AA 3TFRA 3HRDD 1KQQA 2J6UA 3I5JC 4R3DA 3HIZA 3TSSA 2ZZPB 4XYCA 3VR9B 3FAHA 2AX5A 1WX9A 5G5HA 2IBIB 7ICOA 4BJQA 1DK3A 2EDUA 4K7WA 5KG1A 4RM8A 3ZNZB 1NOMA 3RJJA 4DSIA 2LFIA 4B9MA 4UATA 2ZW0A 3ZQ4A 5J2CA 4QWBA 4MJSB 4PHEA 3TEYA 4ELTA 2KFJA 3NVYA 4QW8A 4MGZE 4GC6A 9ICVA 7ICKA 1IGCA 2BDPA 3SV4A 2E5SA 2NS5A 4BVUC 2XIDA 2MBBB 2BQQA 1VD2A 1ZQZA 5KT6A 2BQ3A 1K53A 2G08A 4GXKA 1L4ZB 1N5WA 2IBKA 4QZEA 4OVZA 4B9NA 2GBNA 1PGBA 4I6NB 2KO3A 1I4QA 2KMAA 3IDWA 2VZKB 4W9HA 4ACOA 3TAQA 1WMHA 4CRXA 2SAKA 4M0WA 1J97A 2YX8A 3SENA 2KD1A 5HHIA 1R4MI 2PTLA 3EC8A 3C8YA 1O08A 5F3XB 2HOQA 4RQ5A 3J81j 1WYGA 3BS5B 3PW0A 2DYBA 3ALBA 3LVWA 3RPFC 1YOVB 5JXVA 3AEGB 4F8RA 4KLJA 1UWXA 2EH9A 4M9JA 3AU2A 5T14A 2K89A 5L1JA 1NZPA 2HBKA 4Q8FA 3KQ4A 2N1WA 5IAAC 3A9KB 2DENB 4KLGA 2ZNVB 2FCNA 3C0RB 2I6XA 1ZP0B 3EECA 2A1JB 1LKYA 1RM6C 2GRIA 5IO9A 2YN4A 3SQIA 1L7MA 2IOFK 3G6XA 2AQ3B 2WX1A 1DK2A 3MP9A 4B9KA 2D10A 5AIBA 1L6NA 4ACFA 4JV1A 4TUQA 3VUWA 1CK1A 3KUDB 2HBLA 8ICWA 1V49A 2AWTA 4DXGA 1Y88A 2GLSA 2P35A 2Q0ZX 1L6UA 3EYZA 3RYTA 4DFDA 3UXPA 1ZETA 3NRWA 3SR6A 1ESFA 2W9BA 4KSKC 1L3VA 1PUTA 4EZKA 4ZOHC 4RQ7A 5CWRA 5AK4A 5HMLA 3QX1A 5KFIA 4GIBA 5FR6A 3BIID 4EZLA 1TBEA 4QZ8A 2FPMA 3UM9A 4PH5A 1AWDA 3I63C 3LYSA 1L4DB 4RPXA 2FPKA 4Z6EA 1QZEA 2QKQA 3K9PB 1JWAD 1ZOLA 4ZYNA 2ZJAA 4EYHB 1UZXB 2LWPA 1PUZA 2HCFA 2ICIA 1PK1A 3QXGA 5KG4A 1FRDA 3MJ5A 1T8EA 1KLGD 1SF0A 2FMQA 2ZIUB 2MU2A 2BZFA 4QZCA 1T7PA 8ICBA 2WU5B 3AXCA 4I6PA 4MH0E 9ICAA 3ZVVA 3RULA 4ELUA 4IOIE 5ALTA 1E90A 4PYUA 1E9MA 4O0IA 8ICVA 2UWQA 3MFHA 1ZQ1C 2FI1A 4KKJA 2KFZA 5J0RA 2KDBA 2JWZA 1JWUD 3EFUA 2C60A 2WF6A 1JQ4A 1WH3A 2KN5A 1MQ2A 1GNUA 3PX0A 1RWSA 1TAMA 4YP3A 2N1VA 3HHMA 3EGRA 1A0PA 3MGVA 2D8CA 2ZXHA 2QSDA 3DWGC 2C9WB 2KSOA 3AE4B 1NI3A 4L23A 3MC9A 4WJPA 2C2DA 2ZG6A 2WU2B 3KOOA 3U4EG 2J6TA 2LXAA 2KTRB 1ZQMA 2XGPA 2LUEA 4W9CA 4IQUA 4O1NA 4RT2A 2D6FC 1ENFA 3C2KA 4HCPB 4MACA 1RRBA 2XBBC 4FBJB 2B21A 2K8AA 1TV9A 4DEZA 5J0OA 4TQRA 4HAIA 3OSNA 1SL0A 4M9LA 1YX5B 5CB1A 1JXLA 5EWEA 3MC8A 4JWUC 3PLUA 3QEAZ 2EMSA 1ZJMA 3RJFA 2MP2A 1TKGA 1GPXA 1S0VA 2LASA 4ANVA 2XO7A 1D5XC 4C0ZA 3R7QA 2F3NA 1F9JA 1U4AA 2CS4A 3H0LB 4C80A 1DOQA 3M63B 4IDIA 9ICUA 4K7SA 2KG5A 5AI4A 1NK0A 1IM4A 5IP4D 1HEZE 2GLEA 4KZCA 3CWIA 4TQ0A 5E6OA 3EWAA 2KX0A 2JXXA 5J0XA 1OXJA 3RF9A 4MFAA 2W9CB 2I9GA 2L76A 1GG3A 3RCZA 2ISOA 3Q8RB 2WXFA 4AYBF 1YQ4B 4F5QA 4NJ8A 4ZRJA 3C1YA 5CR0A 2WFAA 5L1LA 2BTEA 4G3XB 1TFRA 1NDDA 1YD8U 1A76A 3W5UB 4A9AA 3BS5A 2DPIA 5KTQA 3T9LA 3MHSD 4PJ0U 4W9JA 3RBEA 8ICQA 1XLOA 4OJ6A 1KBUA 3UQBA 1SWWA 3IM1A 4UB3A 2FCQA 5KFAA 3NJTA 3VR8B 1U49A 3QUTA 8ICXA 2JX5A 1T94A 2KK8A 3KUCB 3VUYA 5D3IB 1JW9D 8ICUA 1S1QB 2BYEA 4ED1A 9ICXA 3ZO5B 5HHDG 2UVUA 2K25A 2M0AA 2W9AA 4F7ZA 2F1IA 3BZKA 2KD0A 4KN4A 4ZHPA 3C2LA 4DHJB 1PVRA 2OCEA 3C5GA 1QT9A 1UBIA 3PT2B 5AKYA
chains in the Genus database with same CATH topology
3HUIA 1C79A 2LUMA 3SEBA 2QILA 2N7JA 1D6EC 4C56C 1MPEA 1CZPA 2MJDA 2JXTA 3Q8EA 3AH7A 4XDCA 3SFEB 4MT5A 3NS1A 2J52A 2WNMA 3OWEB 2WXIA 3GP7A 1SIJA 1VR9A 2HDEA 3AE3B 1F2RI 1C4CA 1FM0D 1JWBD 2K0PA 3LXFA 1L0XB 1JCKB 3E56A 4N59A 2K3UA 1TY2A 1BMLC 2PKOA 5AUKA 2LHDA 1PGAA 2JYTA 2CU3A 2KACA 1FNUA 5AUIA 2XN9C 4LK0M 2PIAA 1EWYC 3Q8BA 4N6EB 1KRHA 3N9YC 3P42A 1BUIC 4UDUC 4RF0A 1V1PA 1WGKA 1T3QA 1QKZA 2ACZB 2PMVA 1P7EA 5C3JB 1I4PA 1RFKA 2WXGA 2Z8LA 2EELA 3AE7B 2KMMA 5BYSA 4US8A 3AEDB 2NMQA 3BVZA 2Y3AA 4RF1A 4L2YA 1QILA 3AEEB 1TKYA 4NZLB 3R2TA 4WH4A 5E6JA 1XLPA 1TS3A 1GB1A 1XLQA 2JU6X 2BB6A 2RDHA 2I2YA 1L0VB 2W3SA 1NENB 1PFDA 1FO4A 2IGHA 5EE3A 1JRPA 3VRAB 3EUB2 5HFYA 1YN5A 1FRRA 3AEFB 2W55A 4JWSC 3NUHB 3ZJTA 2LGIA 1PGXA 1NVID 1K50A 3P4SB 1UUPA 5BYQA 4A90A 3GB1A 1UWMA 2DLBA 1ZDXA 2KAJA 2RMMA 3AB5A 4J3OD 1SE4A 4PT5A 1LO5D 3VQIA 3WCQA 2FBWB 1FMAD 5EE9A 4DQOC 4OW0A 3Q8AA 3P4QB 5HG2A 3W2DA 2QJLA 1QQRA 4DXFA 1Y56A 2G9HD 1FFVA 2Y5CA 4ZYSA 1E7PB 2NTTA 1DOYA 2L32A 1WRIA 3AMZA 2JQRB 1YJJA 2INNE 1TY0A 4HEA1 3TEXA 1YMHE 4AQ7A 4A55A 4HKQA 5C2TB 1NEKB 4XDDA 4ARCA 2OEDA 1GB4A 1JWMD 1HQRD 1WSPA 1IBXB 4NJCA 2PVOD 3U2SC 2YEPF 1V97A 3KWLA 1VZ8A 1I4XA 5D3DA 3ZGZA 4OZBA 2NTSA 3HVZA 1OQRA 1N5XA 4LTUA 1E10A 2DYMA 4RCOA 4ITKA 2V0GA 1SSNA 4IKGA 1EU3A 2KN4A 1DOXA 4MH8A 2J4XA 4D2KA 4XWWA 3L4PA 3AE2B 1AYFA 1DOIA 1D5MC 1YN3A 3ZJUA 2H89B 1I4GA 1KLUD 1FXAA 1ZOYB 3BK1A 3LYYA 1UGJA 3MFGA 1C78A 2R61A 3FILB 4TSSA 1QOAA 1GOZA 2HTME 1I4HA 4B0EA 4GLSC 4YTPB 3TEWA 4USAA 1CQVA 1JWSD 1VZ6A 4AS1A 5H8YE 4KGTA 3I57A 4OZAA 1QOBA 2BS4B 3O13A 2BS2B 4XE0A 3H8HA 4LLGM 3RFZB 4NAMA 1XXGA 1I4RA 1L5PA 1J7CA 1ROEA 3W9CB 4KX6B 1N60A 3T3NA 4JE3B 1F77A 2EKIA 4HRSA 2BS3B 2BW2A 2LEKA 3J9CA 2G1EA 3I9V1 1N63A 4TQ1A 4C7YA 4KGRA 1QF6A 3IAM1 2MEKA 3GS2A 4WQMA 2V3PA 4RGMA 1KTKA 3R8BA 1MHXA 4P16A 4ARIA 1B1ZA 3NVWA 3Q8FA 1C4PA 1SE3A 4ZRPA 5FR3A 1OFFA 2ON8A 4MM3B 5GXGB 5EE1A 3ZYYX 2DBYA 5G5GA 4YSYB 2GI9A 4RGOS 1SEBD 5LNK1 4US9A 4OHJA 3PZ8A 2WXKA 3AN1A 3B2GA 2WXJA 1TYGB 4WAFA 1RYJA 1IUEA 1NYQA 1XCTL 2MJEA 4YT0B 4GDKB 2JZPA 4ZRQA 4YTNB 1NYRA 2JWUA 1L0YB 3Q69A 2AQ2B 3AE6B 3FC4A 2MH7A 3VRBB 3BYYB 2BBCA 5FK9C 1XLNA 1EM7A 1C4AA 2WS3B 3HRDD 1VRAB 4R3DA 5HI1A 3UI3A 2KDMA 3TSSA 2ONQA 1DGJA 1C77A 3VR9B 1AW7A 3V3XA 2DYOA 2AX5A 3FAHA 1VDVA 5G5HA 5H92C 2RPVA 1ZE3D 3LB8C 3P63A 2LFIA 1L6VA 1Q10A 2Q5WD 2W82A 2ZW0A 3ZQ4A 3TEYA 4YTMB 4YWGG 3NVYA 3E9SA 5TSSA 2JYEA 1GAQB 2WDVB 1K52A 1HA5A 1IGCA 4WWMA 3B2FA 3R2IA 1K53A 2YEPB 1ZUD2 1FNWA 2N0SB 2BYTA 1L4ZB 3P4RB 1N5WA 4OVZA 1YNTE 1TJEA 3Q8CA 2K9XA 3CIRB 3DWMA 1PGBA 1T6BX 3NVZA 1I4QA 2VZKB 3BVGA 2IPKD 1FNVA 2W54A 2SAKA 2L83A 4M0WA 4WURA 4Q2JA 1VZ7A 2PTLA 3C8YA 5D7GA 1WYGA 5I4DA 3AM9A 2AQ1B 1PDXA 4RH6A 3RPFC 5JXVA 2WDQB 3AEGB 2IGGA 4NAWB 1IBXA 2PLPA 1UWXA 3KLSX 3IT4B 1J7AA 2FE8A 3IAS1 1TS2A 2WXHA 3KQ4A 2QIEB 2WXQA 1KH0A 1MHHE 2KWDA 2WXNA 2WXMA 2PVGC 2BT6A 2M56B 1K51A 1N61A 1ZP0B 4FXCA 3BWUD 4ZHOA 1QOGA 3NVVA 1RM6C 2GRIA 1XEEA 2N9KA 1FIQA 1SBBB 3URYA 1HXYD 2AQ3B 3MP9A 1UNSA 3EA6A 2IDYA 1C9FA 2X38A 1CK1A 4DXGA 1SJED 3FILA 1L6UA 1YQ3B 1SB3C 4KKIA 1ZXHA 3AEAB 4RGNA 3AE1B 3SR6A 3W5VB 1JALA 1ESFA 1FFUA 1PUTA 4YSXB 4ZOHC 4RGTA 1JMLA 2E6XA 1MI0A 1I7HA 2MJ3A 3BIID 2ZW1A 4REZA 4RNAA 1AWDA 3P1MA 4N58A 3AE9B 2PW9A 1L4DB 1EU4A 2L1AA 1JWAD 2Y5PA 4HROA 4P6VF 3U52E 1XF5L 1TZOA 4GDLB 1CJEA 2ICIA 2N9LA 1FRDA 2OHFA 3MJ5A 1KLGD 1SF0A 1P7FA 2WU5B 3BYTB 1YJIA 3IT6B 1OQQA 4HKZE 1V8CA 2LHEA 4HJGE 1M4VA 4IOIE 5FKAC 1E9MA 1FCLA 1V1PB 1FCCC 2V4IB 4KKJA 1TKEA 1R7SA 2WLBA 2BB5A 1MVKA 2RDGA 1JWUD 4TMAB 1ACCA 1JQ4A 1VLBA 4YSZB 1WWTA 5BMGA 1RWSA 1XO3A 3EGRA 1V1OA 3AEBB 3PZ7A 1STEA 3KWVA 3PO0A 2QSDA 3DWGC 3TUOA 3TEZA 3P4PB 2E3TA 3AE4B 4YXDB 1NI3A 2L52A 4L23A 3B9JA 1D4BA 2WXOA 2WU2B 5EE0A 3U4EG 1ZPSA 4O1NA 3HVDA 1ENFA 4B0MA 2QMTA 3MC0B 4MACA 1BXTA 3AE5B 1ET9A 2WP9B 1HZ6A 2WXLA 1E0ZA 4H2AA 2VZKD 2I38A 1SE2A 1C76A 1TS4A 2W3RA 2GB1A 4JWUC 1KFYB 2TSSA 1EWCA 4A8XC 1TKGA 2J42A 1GPXA 2J53A 4RFBA 1SJHD 2INPE 4JX1C 1N62A 4KGSA 1HZ5A 1D5XC 4JPSA 2M19A 4WIPA 1D5ZC 2JSVX 1PYWD 2V3NA 1F0ZA 3ZJVA 4C80A 4IDIA 2K22A 1JROA 1E6EB 1QLBB 2WXRA 3AV8A 3ETRA 1FD6A 1J7BA 1HEZE 3U7ZA 1A70A 1YN4A 3CWIA 4TQ0A 5BMIA 5BMHA 2XNAC 3W1SA 2WXFA 2IJ0A 1YQ4B 3BZDB 4XWTA 2LMCA 2WXPA 1ZXIA 1DYQA 1B9RA 2FUG1 1KF6B 1QOFA 4EE2A 1XCQL 2BTEA 4OZCA 1T5XD 3NRZA 3W5UB 2H88B 4A9AA 1FEHA 3BVMA 3IXSA 3V05A 3BK2A 4CQNA 1WXQA 1XLOA 1ET6A 3ABVB 3VR8B 1VJKA 2IGDA 1FXIA 2K5PA 1AN8A 2JX5A 5D3IB 3T3OA 2KQ4X 2B76B 1JW9D 4L1BA 1IGDA 3AECB 2D5GA 2CJOA 1SXTA 2DWQA 5MPOA 3MHZA 5HHDG 2CJNA 2M0AA 2SEBD 3AE8B 4C7ZA 2WDRB 5T8IA 4ZHPA 3NZ3A 2LJIA 3SFDB 1ZDVA 1QT9A 4A6QA 1F2RC 1TS5A 5BYRA 2QEJC 2WQYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H92 C;  3HUI A;  1E9M A;  3LB8 C;  3P63 A;  1L6V A;  2Q5W D;  2PVO D;  1TKE A;  1R7S A;  4YTM B;  1V97 A;  1CZP A;  2WLB A;  3KWL A;  2MJD A;  3NVY A;  3AH7 A;  3SFE B;  3NS1 A;  1GAQ B;  2WDV B;  3HVZ A;  4LTU A;  1OQR A;  1N5X A;  1VLB A;  4YSZ B;  1E10 A;  1JQ4 A;  1WWT A;  4ITK A;  1SIJ A;  1RWS A;  2K22 A;  4WWM A;  1XO3 A;  3AE3 B;  3B2F A;  3AEB B;  1DOX A;  1FM0 D;  3PO0 A;  3L4P A;  1JWB D;  1ZUD 2;  3AE2 B;  2N0S B;  1AYF A;  1DOI A;  3DWG C;  3LXF A;  3P4R B;  1N5W A;  3P4P B;  2H89 B;  2E3T A;  1B9R A;  3AE4 B;  1TJE A;  4N59 A;  4YXD B;  1NI3 A;  2L52 A;  2K9X A;  3B9J A;  2PKO A;  5AUK A;  3CIR B;  3DWM A;  2WU2 B;  5EE0 A;  1FXA A;  1ZOY B;  3NVZ A;  2CU3 A;  1QOA A;  2HTM E;  2W54 A;  5AUI A;  2L83 A;  4YTP B;  3AE5 B;  4USA A;  2WP9 B;  1E0Z A;  2PIA A;  1WYG A;  1EWY C;  3AM9 A;  1KRH A;  4N6E B;  1PDX A;  5H8Y E;  3RPF C;  2WDQ B;  3AEG B;  1QOB A;  2W3R A;  1WGK A;  1T3Q A;  2BS4 B;  1KFY B;  4JWU C;  2ACZ B;  1J7A A;  2BS2 B;  5C3J B;  1RFK A;  1TKG A;  2QIE B;  1GPX A;  1L5P A;  1J7C A;  1ROE A;  3W9C B;  3AE7 B;  4KX6 B;  2KMM A;  1N60 A;  4JX1 C;  1N62 A;  2PVG C;  2BT6 A;  3AE8 B;  4US8 A;  2M19 A;  3AED B;  2M56 B;  2EKI A;  1ZP0 B;  1N61 A;  2BS3 B;  4FXC A;  4HRS A;  1F0Z A;  2LEK A;  4ZHO A;  2G1E A;  4C80 A;  4IDI A;  1N63 A;  3NVV A;  1JRO A;  1RM6 C;  4C7Y A;  1E6E B;  1FIQ A;  3ETR A;  1QLB B;  1J7B A;  3AEE B;  3AV8 A;  1QF6 A;  1TKY A;  1A70 A;  3CWI A;  4WQM A;  1XLP A;  1XLQ A;  1QOG A;  1L0V B;  3NVW A;  1YQ4 B;  2W3S A;  1NEN B;  1PFD A;  1FO4 A;  5EE3 A;  1JRP A;  1ZXI A;  3EUB 2;  1L6U A;  1OFF A;  1SB3 C;  1YQ3 B;  1KF6 B;  1QOF A;  5EE1 A;  5GXG B;  3ZYY X;  3AEA B;  1FRR A;  5G5G A;  2DBY A;  3AE1 B;  3SR6 A;  3AEF B;  2W55 A;  1JAL A;  4YSY B;  3W5V B;  4US9 A;  3NRZ A;  1FFU A;  4JWS C;  3W5U B;  1PUT A;  2H88 B;  2WQY B;  4ZOH C;  4A9A A;  4YSX B;  3AN1 A;  3B2G A;  2MJ3 A;  1I7H A;  1NVI D;  3BII D;  3P4S B;  1TYG B;  1WXQ A;  1XLO A;  1RYJ A;  1IUE A;  1UWM A;  2KAJ A;  3AB5 A;  1AWD A;  3P1M A;  3ABV B;  4N58 A;  1NYQ A;  3AE9 B;  3VR8 B;  3WCQ A;  1VJK A;  2FBW B;  1FMA D;  2MJE A;  1FXI A;  1JWA D;  2K5P A;  4HRO A;  4YT0 B;  4P6V F;  2JX5 A;  5EE9 A;  4YTN B;  3P4Q B;  3VRA B;  2B76 B;  1JW9 D;  2QJL A;  1CJE A;  1NYR A;  3AEC B;  2CJO A;  3AE6 B;  1FFV A;  3FC4 A;  1FRD A;  2DWQ A;  1E7P B;  2MH7 A;  2OHF A;  1SF0 A;  2Y5C A;  3VRB B;  5MPO A;  1DOY A;  2CJN A;  1XLN A;  1WRI A;  3AMZ A;  4C7Z A;  2JQR B;  2WDR B;  1YJJ A;  3HRD D;  1YJI A;  2WS3 B;  2WU5 B;  4ZHP A;  1OQQ A;  3SFD B;  1DGJ A;  5C2T B;  3VR9 B;  1QT9 A;  1V8C A;  3FAH A;  2AX5 A;  1VDV A;  1NEK B;  5G5H A; 
#chains in the Genus database with same CATH topology
 2KMD A;  2KIC A;  2LUM A;  3SEB A;  1FPY A;  2B6G A;  2UVV A;  1EF5 A;  2N7J A;  1P0R A;  1X9X A;  3N1Z C;  3GOE A;  2D3B A;  2LI5 A;  4KLS A;  2MJD A;  4UBB A;  5GTI U;  3Q8E A;  4GFJ A;  4F5N A;  4XDC A;  4QZH A;  3SFE B;  4ICU A;  3NS1 A;  2JXJ A;  4I2C A;  2J52 A;  2JVC A;  1V38 A;  2P6U A;  1Q46 A;  4RNO A;  3GQC A;  2KEY A;  3MAB A;  2IMW P;  2VA3 A;  1NK4 A;  4O3S A;  1IIP A;  3O65 B;  3MDC A;  2FMP A;  1F2R I;  2ZIV A;  1FM0 D;  1WX8 A;  5CHW A;  5KFC A;  3LXF A;  3ZUN A;  2JH7 A;  5AI9 A;  5KG3 A;  1JCK B;  1WM3 A;  3E56 A;  4WAA A;  3AU5 A;  1XT9 B;  1TY2 A;  4BBN C;  2NRT A;  1PGA A;  2GOL A;  5DCN A;  8ICO A;  2N9P C;  2I1J A;  2CU3 A;  2ZIU A;  2BHN A;  2KAC A;  4RZR A;  1L7O A;  2XN9 C;  3HPO A;  1JX4 A;  1WIA A;  3X0W A;  1ZQL A;  2KZZ A;  3Q8B A;  4QZD A;  4F72 A;  1EWY C;  4IRD A;  3N9Y C;  2PKE A;  3P42 A;  2KTQ A;  5D2M B;  1ZQG A;  5J8Y C;  1ZQR A;  4RF0 A;  3IP4 B;  3GV8 B;  3M1Y A;  4UDU C;  4TQS A;  4OVU A;  4Y2J A;  5AM3 A;  4HK2 A;  3PST A;  1L3U A;  1QKZ A;  4KLL A;  1P7E A;  4B9T A;  2IA6 A;  3AE7 B;  1Q8K A;  1E7U A;  4ZH4 A;  3N32 A;  2WAQ F;  3AED B;  1ZQI A;  3AEV A;  2FUH B;  4NPN A;  5III A;  3KHG A;  2HE7 A;  1WR1 A;  4L2Y A;  3U26 A;  5E6P A;  5J2A A;  5IIL A;  1TKY A;  4NZL B;  3R2T A;  5ALG A;  1ISN A;  5CP2 A;  4LNO A;  5E6N A;  3ZTD A;  1QQ5 A;  4YD2 A;  2OJW A;  4IC9 A;  3PX6 A;  5DQH A;  1NK5 A;  2I2Y A;  1L0V B;  4ECQ A;  2KTR A;  2W3S A;  5EE3 A;  2JH1 A;  2IGH A;  3A4R A;  3VRA B;  3DBL I;  3EUB 2;  4I2F A;  4EUT A;  5KHQ A;  2NR2 A;  3EZ5 A;  4HJK A;  4I28 A;  2EMT A;  3E2E A;  1LV5 A;  2C2E A;  3WKD A;  4C00 A;  2PFP A;  2RDB C;  2LGI A;  2E1F A;  2AGO A;  1L7N A;  4GMV A;  1NVI D;  3V7K A;  3TIX A;  3P4S B;  2G09 A;  2BCV A;  3RH5 A;  4M9N A;  1ZDX A;  2RMM A;  4TUU A;  3VQI A;  1LO5 D;  3I76 A;  4RQN A;  2PE6 B;  3WCQ A;  2D3A A;  2FBW B;  5KFX A;  4EFO A;  1SXD A;  2NCN A;  1UD7 A;  4JV2 A;  4OW0 A;  3DOW A;  2D3G A;  1ZD5 A;  3W2D A;  5EWF A;  1GC6 A;  2JPH A;  2NTT A;  4BKT A;  2L32 A;  2KJ9 A;  1L7Y A;  2VA8 A;  2Z0D B;  4BXO A;  4KLE A;  4B95 A;  1TY0 A;  5HMM A;  4XQ8 A;  3PSE B;  4AQ7 A;  5DB8 A;  5J0T A;  5CX3 A;  5C2T B;  1K5O A;  2PFO A;  4ARC A;  2W9C A;  1GB4 A;  1LFD A;  5TR5 A;  4J9P A;  1HQR D;  2OWO A;  2R18 A;  4FUL A;  4FA6 A;  4QW9 A;  2AL6 A;  1V85 A;  1F52 A;  2YEP F;  3PHX B;  3BQ0 A;  1E8Z A;  2PPH A;  4DWF A;  5D3D A;  5ALH A;  2EZZ A;  4G3I A;  4OZB A;  1N5X A;  2KDF B;  3QCA A;  5KG7 A;  1KRP A;  4KDL B;  1Z4O A;  2JV3 A;  1R4N I;  4MH8 A;  1D5M C;  3SAG A;  2OOB B;  4Q44 A;  3V72 A;  4EZ9 A;  4O3P A;  2M4N A;  1D3Z A;  4PHP A;  1FXA A;  3LYY A;  1E7V A;  1UGJ A;  4DK5 A;  1NKE A;  2KWC A;  2KHV A;  1QOA A;  2BGW A;  4PS7 A;  4S0R A;  2HMX A;  3RRG A;  4BX9 C;  4R65 A;  3L5K A;  4E0D A;  4AWJ A;  2ISP A;  3ZDD A;  3WKC A;  3F5A A;  4ED0 A;  1CQV A;  4WJQ A;  5C23 A;  2AJQ A;  4F1S A;  3D2Q A;  5F9N A;  2ZVO A;  1QOB A;  2H3F A;  4GGQ A;  3VHT C;  5ALF A;  4GXI A;  2K4I A;  2X8X X;  2PMZ F;  1ZJN A;  3RNA C;  1ROE A;  4KX6 B;  4NLC A;  1SE9 A;  4J9R A;  4CF4 A;  5FP0 A;  2KDI A;  4Z6D A;  2CRX A;  4JE3 B;  2EKI A;  1F1H A;  1WCN A;  2RGF A;  1N63 A;  4TQ1 A;  5KFJ A;  4J9K A;  3CF6 E;  4KGR A;  1QF6 A;  9ICR A;  1GUA B;  4OJO A;  1NK6 A;  1DGS A;  2N7D A;  4WQM A;  4PZO A;  4ED3 A;  2IHM A;  4P16 A;  2MUT B;  4ARI A;  4K81 A;  3N3K B;  1SXE A;  3Q8F A;  2DZI A;  3E58 A;  4ZRP A;  5FR3 A;  9ICG A;  1L8O A;  4MM3 B;  5GXG B;  3UXN A;  3V62 A;  2YQE A;  3OLM D;  2KFN A;  4LZG A;  2ZTC A;  3RFA A;  2GI9 A;  1QQ7 A;  4RGO S;  2H5X A;  5C0Y A;  2INC C;  3PML A;  3PZ8 A;  4YR0 A;  3MR5 A;  4LNI A;  3H8J A;  4IL6 U;  4RUC A;  3NZU A;  4I2H A;  2V9W A;  3HW8 A;  4DS5 A;  1S0M A;  2N9E B;  3SAH A;  1TIF A;  2ZEQ A;  2EZY A;  4QZ9 A;  3IHP C;  4YMO A;  1BPE A;  4QZI A;  3V6E B;  4KV2 A;  1ZQY A;  2KV2 A;  5L1K A;  1GO3 F;  1E8Y A;  1NYR A;  1L0Y B;  2JWU A;  3Q69 A;  4XX5 A;  5IA7 A;  2MH7 A;  3PX4 A;  1B0X A;  4DFP A;  1D8B A;  1IG6 A;  2WS3 B;  2BWF A;  2ONQ A;  5KL1 B;  1DGJ A;  1C77 A;  1AW7 A;  3V3X A;  2NRX A;  5D4B A;  5JTI A;  4HPP A;  1ZE3 D;  3ZD9 A;  3V6J A;  4QWD A;  1A6S A;  3ISC A;  3LB8 C;  2W82 A;  1L6V A;  3P63 A;  2Q5W D;  4P1C C;  1TVA A;  3DBR I;  4G50 A;  2HHU A;  4PL1 A;  2WWZ A;  5TSS A;  2JYE A;  1GAQ B;  2ODG A;  1K52 A;  3PZP A;  2MBE A;  3B08 A;  2JZB B;  1Z1B A;  2ZUD A;  4DL3 A;  3Q3O C;  1J0G A;  3R2I A;  4Z6F A;  2J7Q B;  1WMH B;  3JW0 X;  3NZS A;  2FID A;  4FJV B;  2D2Q A;  2YEP B;  1FNW A;  3H1U A;  5LXI B;  3H8W A;  3GIJ A;  1O03 A;  3Q8Q B;  2C2R A;  1TJE A;  4DXA B;  2LRW A;  1P9D U;  2Z0E B;  2O6V B;  1Q1O A;  3AI5 A;  2EAP A;  2ZIW B;  1KDH A;  3BVG A;  2AXT U;  4TKN A;  2L83 A;  4F92 B;  4WUR A;  4ANU A;  2M8S A;  3IVF A;  3F2B A;  5JHB A;  2ZTD A;  1VZ7 A;  3CP8 A;  9ICQ A;  2K4E A;  2AQ1 B;  2G5I B;  2XCP A;  1NKC A;  1QLN A;  2CKH B;  3TMP B;  4FE3 A;  4FHK A;  5D94 A;  4NAW B;  4YMM A;  2BQR A;  2KK0 A;  2ASQ A;  2P66 A;  4O5K A;  2RLT A;  8ICF A;  3K9O B;  7ICN A;  2Q4T A;  2HOF A;  3ENE A;  2EAM A;  1XQQ A;  1TS2 A;  3IAS 1;  3KD3 A;  2WXN A;  2DQN B;  2WXM A;  2LRU A;  4W9D A;  4UAW A;  2BT6 A;  3KVF B;  4MGK E;  2M56 B;  3AL0 B;  3SMV A;  3RJI A;  4G0N B;  4HDO A;  2QHO A;  4P7I A;  1A5R A;  3C19 A;  2Z7J A;  2N9K A;  2GBK A;  4NJ7 A;  1HXY D;  2LM4 A;  1WR6 E;  2WYQ A;  3F2C A;  3DBS A;  5AKJ A;  3EA6 A;  4JLC A;  5JZE B;  2HBJ A;  1NJW A;  2XCA A;  1ZD4 A;  1UA0 A;  1JRU A;  1SJE D;  3GFK B;  1YQ3 B;  3S6J A;  4PZN A;  3VTW A;  3AEA B;  5AHX A;  1V5T A;  2BCQ A;  7ICP A;  3BIN A;  4YSX B;  5CHG A;  4MEL A;  5KT4 A;  2E6X A;  3ZNG C;  2AH5 A;  1I7H A;  5DBC A;  2ZW1 A;  1NI2 A;  5AIA A;  1PK1 B;  2ZXI A;  1ZD3 A;  2KZ3 A;  3H9D A;  3P1M A;  9ICK A;  2RDI A;  5DB7 A;  2L0F A;  2MCN B;  3A0H U;  1EU4 A;  4JGH B;  4OCZ A;  4W9I A;  1WGG A;  2K8H A;  2EKE C;  4P6V F;  5L83 A;  3OJS A;  1Z2M A;  3TAD C;  4NQL B;  1CJE A;  9ICJ A;  4C8M A;  2N9L A;  4DOB A;  2YMM A;  4KDI C;  4F91 B;  2WHE A;  2XGQ A;  2AU0 A;  2C7H A;  4ZRK A;  3D2N A;  4IM0 A;  3QNM A;  4F5R A;  2V3S A;  3V6H A;  3RD2 A;  1F0M A;  2L0T A;  2H3I A;  2HSZ A;  1V8C A;  2MBQ A;  4EBC A;  1M4V A;  5AZG A;  3UIN B;  1SV0 A;  5B5E U;  4UAV A;  5TZV A;  3M9O B;  3MTN B;  4MM3 A;  1V1P B;  3JYU A;  2V4I B;  1S97 A;  5CJ7 A;  1R7S A;  3Q3J A;  5LLI A;  3FDS A;  4ECR A;  1MVK A;  2RDG A;  2E8M A;  3W1Y A;  2DFL A;  1ACC A;  2ASD A;  9ICS A;  3H7S A;  3OHB A;  1WWT A;  4DOC A;  4C4T A;  2DAF A;  5KFM A;  2QCZ A;  1RYU A;  2BKE A;  1LGR A;  3TBL D;  2NV3 A;  3AEB B;  3PZ7 A;  2FIF A;  1STE A;  3KWV A;  3PO0 A;  3ONS A;  4Y2Q A;  3TUO A;  1NKB A;  3NOB A;  5KFY A;  3ZDE A;  2L52 A;  1AAR A;  2KVR A;  4QIW C;  1B4F A;  3G6V A;  3TAP A;  3L0W B;  3K75 D;  2K60 A;  3IRU A;  1H38 A;  4WWP A;  1DXS A;  3HVD A;  4Q45 A;  2C22 A;  2QMT A;  3MDA A;  3MC0 B;  4W9F A;  4CYE A;  2WP9 B;  2MP2 B;  3QU5 A;  2N1R A;  1SKW A;  4UB6 U;  1WZ0 A;  2WXL A;  4H2A A;  1E0Z A;  3SYZ A;  2I1K A;  1SE2 A;  4IUM B;  1TS4 A;  3N20 C;  4F2S A;  2W3R A;  2OEH A;  2GB1 A;  3HK0 A;  3PW7 A;  4O5E A;  3DCG A;  1KFT A;  1EWC A;  4QAY A;  2KWV B;  3C21 A;  3VAW A;  5ALU A;  2KT7 A;  4F4Y A;  4AP4 C;  2IZV B;  4KGS A;  1SWV A;  8ICI A;  2WB1 F;  1EUV B;  2JZB A;  5KFG A;  4RUA A;  4DL5 A;  2M19 A;  4GSW A;  4JPS A;  2QB0 B;  1YT3 A;  3U8Z A;  1F0Z A;  3NG0 A;  4YR3 A;  5AI0 A;  3S2A A;  1QLB B;  5CHV C;  3ETR A;  9ICN A;  1J7B A;  2ZPN A;  1S0O A;  3PGE A;  4KN7 A;  2GMI C;  4J9Q A;  5ALR A;  1E8W A;  1P7D A;  2G0A A;  4I2I A;  5B66 U;  2KLC A;  2O6V A;  3W1S A;  3SDL C;  4P0P A;  2IJ0 A;  4XWT A;  2WXP A;  2KFK A;  1ZXI A;  2MRL A;  2ZIW A;  1DYQ A;  4HXD A;  3RJK A;  2F2A B;  2W03 A;  5KHO A;  2JY6 A;  1UGM A;  5ALX A;  2H88 B;  4RQ3 A;  2PI5 A;  1Y8R C;  4JMU A;  4Z6C A;  1XSP A;  2A5U A;  2BWE S;  2LZ6 A;  8ICM A;  2NYV A;  2YMQ A;  3BK2 A;  5L1M A;  3IXS A;  4UAZ A;  4CQN A;  3KKA A;  1Q0W B;  1WXQ A;  4NAW A;  1BVS A;  4I2A A;  2WF5 A;  1ET6 A;  4Y2R A;  2E8N A;  4BFR A;  4K3B A;  2IGD A;  4OVV A;  1FXI A;  2K5P A;  2BCS A;  8ICL A;  2XC9 A;  2EZX A;  5J2G A;  3F53 A;  3OGU A;  2KQ4 X;  1IPG A;  1ZQQ A;  1IGD A;  4EKU A;  1C7Y A;  5ALY A;  5MPO A;  3THV A;  2CJN A;  2SEB D;  4HYK A;  8ICE A;  5T8I A;  3NZ3 A;  3C5F A;  3EW9 A;  4DCC A;  1TS5 A;  4UQG A;  3RNG C;  4AOF A;  8ICA A;  3Q8M A;  2GBR A;  4LDT B;  4ED2 A;  2HD5 B;  3RN9 C;  5KG5 A;  8ICJ A;  3VXW A;  8ICH A;  4JUZ A;  4PL2 A;  1GC7 A;  3WA0 A;  3JPO A;  3ZDC A;  4BKS A;  4FFD A;  1K1Q A;  1MPE A;  1R4M B;  2NRZ A;  2DGZ A;  1N6Z A;  2ZIV B;  5ALQ A;  4F4Z A;  1ZQF A;  5CTR C;  3UQ0 A;  2AL3 A;  4IC7 B;  4FBT A;  3OJ3 A;  9ICW A;  1VR9 A;  1BPB A;  2HDE A;  4M00 A;  1C4C A;  4LZD A;  4UAU A;  2OJR A;  3PTF C;  1ZRN A;  2LGS A;  3GE8 C;  4KX3 A;  1MA7 A;  5EWG A;  3RNC C;  1TGZ B;  1NNL A;  3DDH A;  2ZUB A;  1BML C;  2AQ0 A;  5ALV A;  4PHD A;  1X66 A;  1Q3U A;  2Y1J A;  5AUI A;  3RAX A;  2CXY A;  3QHT A;  3E0F A;  1C3T A;  2EAO A;  1ARO P;  2NBV B;  2BDU A;  1V1P A;  1QSY A;  4DSL A;  3QUC A;  1WGK A;  3M95 A;  3RT3 B;  3ZDM C;  3ZKJ C;  2PMV A;  2MWS B;  3DHI C;  5C3J B;  1I4P A;  2B0C A;  3GE3 C;  4ED8 A;  2ATL A;  4O3O A;  2KMM A;  4KLF A;  2NVU I;  2Y1I A;  3M3J A;  4US8 A;  1CI4 A;  3SAF A;  1X2I A;  5KG0 A;  3WKA A;  5EDS A;  3C29 A;  1SGG A;  3DDC B;  3C1Z A;  1WE6 A;  3AEE B;  4WH4 A;  1KW4 A;  3H40 A;  5E6J A;  4CF3 A;  5ALZ A;  1XLP A;  3FM9 A;  3JPQ A;  4DHZ E;  2BB6 A;  1UQV A;  2RDH A;  4YXM A;  4XRH A;  1PFD A;  4KX5 A;  4F50 A;  5HFY A;  3VH3 B;  3M6Z A;  3PNC A;  2WTF A;  3RB4 A;  3H0R B;  2W55 A;  3TAR A;  4K4I A;  1ZQO A;  1PGX A;  4MSQ B;  2JRZ A;  1MC8 A;  2WF9 A;  5DPR A;  4BOZ B;  1LVH A;  3GB1 A;  2JMG A;  2KAJ A;  3ZDB A;  4BXO B;  2KN7 A;  5EE9 A;  1WGH A;  5AK5 A;  3OTQ A;  4UAS A;  3LDZ E;  3M6K A;  3V7J A;  2LVP A;  2NPT B;  1MJD A;  3P4Q B;  3Q8A A;  4DSJ A;  1BNP A;  3M8R A;  4DQI A;  1FFV A;  2DAJ A;  3B1L X;  1WWU A;  4QNL A;  7ICG A;  2QB0 A;  2G4D B;  3NTU A;  1XNS A;  2DZM A;  4AJW A;  3BZC A;  3V60 A;  1YJJ A;  2GWS A;  3DV9 A;  1KKX A;  2RQ5 A;  2VJ4 A;  3M8S A;  3VFK A;  2CU1 A;  4PS8 A;  5E79 U;  4M04 A;  3HX0 A;  1IBX B;  3QIJ A;  4JV0 A;  3GIM A;  2PVO D;  2ALZ A;  3A9J A;  2MLB A;  3U2S C;  4CE6 A;  3IG3 A;  2C7N B;  2BYF A;  1VZ8 A;  2GH1 A;  1ZQX A;  1U45 A;  2A4Z A;  1E10 A;  1WX7 A;  4HPM B;  3V61 A;  1RDF A;  2FAZ A;  3DBH I;  1SSN A;  2LGX A;  5D46 A;  4IKG A;  2JEJ A;  5AM2 A;  2VH2 A;  5L1I A;  1I35 A;  4XWW A;  1YN3 A;  3ZJU A;  3RJG A;  3HJE A;  2KMC A;  2YLM A;  3UQA A;  2N7E A;  2G07 A;  7ICQ A;  5JH5 C;  3C2M A;  1ZOY B;  1P98 A;  3MFG A;  2R61 A;  2BCU A;  3FIL B;  7ICV A;  4TSS A;  4B0E A;  2G06 A;  1YJ1 A;  4FS1 A;  7ICJ A;  4MEM A;  3TEW A;  3U30 A;  4USA A;  4RQ1 A;  4YFK A;  4YL8 A;  2NO5 A;  4MHV A;  1VZ6 A;  2CR5 A;  5H8Y E;  5JHA A;  2R8J A;  2VIX A;  2MBH A;  1PQS A;  4ICA A;  3G6Y A;  2L3Z A;  3R66 C;  5IN7 A;  3O13 A;  3ZDA A;  4DQP A;  4M01 A;  3JPN A;  3Q14 C;  2ES6 A;  4LLG M;  4EZ6 A;  5AI6 A;  3HKZ F;  1J7C A;  3W9C B;  5AKG A;  3OJ4 B;  3T3N A;  1SKS A;  4IWQ A;  2CHZ A;  2LEK A;  3H8M A;  4RT3 A;  3IFW B;  3J9C A;  5KAI U;  3A4S C;  3IAM 1;  4UB5 A;  2MEK A;  3GS2 A;  1BT0 A;  3EPG A;  2V3P A;  3UMG A;  2HHT A;  4RGM A;  5DGA A;  2W04 A;  4DQS A;  1XSL A;  1C4P A;  4KLT A;  5KFS A;  1XS9 D;  1Q3V A;  1OFF A;  3D6J A;  1WXS A;  2ON8 A;  2YML A;  1X9M A;  1ZQE A;  2LPE A;  4C4V B;  4K3C A;  2IO1 B;  3B2G A;  4ASW C;  4PGX A;  3V7L A;  5DQG A;  1IUE A;  4EOY A;  3ED5 A;  4XGA B;  2R8I A;  1NYQ A;  2RHF A;  1WZ3 A;  1XCT L;  4YT0 B;  1N56 A;  1KJT A;  4ZRQ A;  3DVN U;  5ALO A;  4P0Q A;  4BDP A;  2AQ2 B;  4OJP A;  3AE6 B;  4DFM A;  2KJ5 A;  2Y0S F;  3UMB A;  1ZGU B;  1BPD A;  3LK9 A;  1KFS A;  1MFW A;  5HI1 A;  4YMN A;  2REX A;  2KDM A;  3RI7 C;  1X40 A;  4Y2T A;  4O3Q A;  5J2B A;  4UB2 A;  3JSV B;  5KFB A;  1VDV A;  4YQW A;  3JPT A;  3QK0 A;  2RPV A;  3I3T B;  1ZQV A;  4G9B A;  5J2J A;  4P4M A;  4GLX A;  1KEJ A;  4RNN A;  4YTM B;  2NBU A;  3ICX A;  1WJ6 A;  4YWG G;  3TCA A;  3CSF A;  2CPR A;  2QC8 A;  5KFV A;  1MN8 A;  1WUD A;  4ANW A;  1V86 A;  5HR6 A;  5IIO A;  3ZRC A;  3SZ2 A;  1HA5 A;  4WWM A;  2J0K A;  5HKH A;  2D3C A;  4K7U A;  4RPZ A;  2JF5 A;  2V4L A;  5KT5 A;  2N0S B;  3RH4 A;  1TKD A;  2NPT A;  1YNT E;  2MSE D;  2K9X A;  3CIR B;  3DWM A;  1N2X A;  2J0J A;  1ZQH A;  4R8U B;  3KHH A;  2AEH A;  9ICH A;  2LYB A;  2IPK D;  1D9D A;  2W54 A;  3O0F A;  2YTU A;  3OSP A;  1DRG A;  4OJL A;  5DG7 A;  1XO0 A;  2HHS A;  2GOW A;  4KVG B;  5I4D A;  3AM9 A;  1PDX A;  4DL2 A;  3DBL B;  4RH6 A;  3ZNH B;  2KVZ A;  3C23 A;  3OAW A;  5KFQ A;  3SHQ A;  4NNJ B;  2IGG A;  3KW5 B;  1IBX A;  2PLP A;  3KLS X;  5J8Y A;  2EQY A;  3GDX A;  3RRH A;  1J7A A;  2FE8 A;  2QAR B;  1F44 A;  2KDE B;  1BPY A;  2QIE B;  2KWD A;  2WXQ A;  2JEI A;  1UH6 A;  3MJW A;  2KYW A;  1UBQ A;  2YY6 A;  4WQO B;  3MBY A;  3ISD A;  3OJU A;  4ECW A;  8ICT A;  2FCS A;  3WK7 A;  1N61 A;  4FXC A;  2ZVN A;  9ICM A;  4RMA A;  7ICF A;  9ICL A;  4PGQ A;  1FIQ A;  2HVI A;  3URY A;  4ED6 A;  8ICZ A;  1OTR B;  2HHX A;  4C8O A;  2IDY A;  3PMN A;  3QU2 A;  3IG8 A;  1CRX A;  2K1F A;  2KIV A;  4BWJ A;  3MR3 A;  4BKG A;  1S77 D;  2KX3 A;  3FIL A;  5KFD A;  1X6I A;  2H3Z A;  3T5L A;  3RR8 A;  1ZKH A;  1ZXH A;  4B9V A;  4KKI A;  3VVW B;  4RGN A;  8ICR A;  2DZJ A;  3VH4 B;  2JZ3 B;  4NV0 A;  3UIO B;  5HP4 A;  2FMS A;  2W11 A;  3RZF A;  3HT3 A;  2ESE A;  3PR4 A;  3KTQ A;  3ZXR A;  4LNF A;  4Y2P A;  9ICP A;  1MI0 A;  4JB3 A;  5F9L A;  4F8C B;  2FLL A;  4REZ A;  4Y2Y A;  3PV8 A;  4NL9 C;  5C1Z A;  3KBB A;  2PW9 A;  1IXR A;  4EEN A;  4K4H A;  4HCN B;  2L1A A;  2Y5P A;  1OQY A;  1WJN A;  4M02 A;  3L16 A;  3L10 B;  2KE7 A;  3PY8 A;  4O5C A;  1XF5 L;  4AYB C;  2XY6 A;  5IIN A;  1KN5 A;  2HI0 A;  3ZI4 A;  3TKA A;  4W9K A;  3C28 A;  1P7F A;  3CW2 C;  1R4N B;  3BYT B;  3M9N B;  1YJI A;  4FZL A;  1OQQ A;  1RG6 A;  3RTV A;  3BQ2 A;  2RSU A;  1HJP A;  2VJ5 A;  4HKZ E;  4I2D A;  4HJG E;  4QWA A;  1X9W A;  4TV3 A;  2OM6 A;  4P1B C;  4IQT A;  4ANX A;  2W8L A;  4DWI A;  3H0M B;  3K1R B;  1FCC C;  1NK7 A;  1TKE A;  1QCK A;  2PJH A;  2WLB A;  5DDM A;  5AIC A;  4EYI B;  4C4V A;  1EF1 A;  4KTQ A;  2K4P A;  3RR7 A;  1P1A A;  2KWU B;  4TMA B;  5J17 A;  1I42 A;  1VLB A;  4YSZ B;  3N1X C;  1C1Y B;  5BMG A;  1U48 A;  4K1R B;  3WKB A;  4DLG A;  1WFY A;  1ZQU A;  3PO5 A;  2A19 A;  3GIL A;  1JMS A;  3BQ1 A;  1ZQB A;  3APC A;  2J6S A;  2KKV A;  2W7O A;  5LXH A;  3QJZ A;  1L7P A;  2DF4 B;  2VRR B;  5EE0 A;  1ZQN A;  4F4W A;  2G3Q B;  4DSK A;  1ZPS A;  2FLP A;  5AKL A;  5JRT A;  2LVO A;  3WAN A;  3QZ8 A;  4B0M A;  1BXT A;  1COO A;  1ET9 A;  3JSV A;  1ZRM A;  4QZB A;  1HZ6 A;  3RNF C;  3EHV A;  2VZK D;  4HDQ A;  1U9L A;  2AYO B;  4PYZ A;  3N7P D;  4MFC A;  3RNB C;  2G45 B;  2AHO B;  3RJE A;  5AM0 A;  3RH6 A;  4ECV A;  1V80 A;  1KFY B;  5AM5 A;  2IOF A;  3RB3 A;  2BKF A;  1RPL A;  4A8X C;  2LI6 A;  2UVW A;  1A77 A;  2DPJ A;  2J42 A;  4CNQ A;  2MBO A;  1SJH D;  1N62 A;  1HZ5 A;  2PFN A;  2K4H A;  5KT7 A;  4WIP A;  5BOM A;  4QJF B;  1D5Z C;  1PYW D;  4P0P B;  2V3N A;  4O9M A;  3ZJV A;  2WX0 A;  3GZN I;  2KFK B;  1JRO A;  1FD6 A;  3AV8 A;  4YG2 A;  4NLN A;  4M9H A;  3LJ3 A;  2KXJ A;  4KZ0 A;  3U7Z A;  1A70 A;  1WGY A;  5D49 A;  1YN4 A;  2KP7 A;  4GIV A;  5BMH A;  5L95 C;  3PV1 A;  4LJX A;  4R66 A;  1S10 A;  3BZD B;  5AKZ A;  4R8U A;  1OGW A;  3ZDT A;  1UT5 A;  1TAQ A;  2F76 X;  3Q8L A;  1ZQT A;  1QOF A;  4KLH A;  5AKK A;  1XD3 B;  2FUG 1;  1XCQ L;  2HTH A;  3T8M A;  4EEL A;  2PI4 A;  2KKC A;  4OZC A;  2C7M B;  2WAQ C;  1Z19 A;  9ICO A;  4W9G A;  3BQ7 A;  4EEK A;  1FEH A;  3BVM A;  3CYM A;  1NK9 A;  5IIJ A;  3V05 A;  2K8C B;  2G5H B;  2ZPY A;  1EXN A;  2AGP A;  1URJ A;  5DB9 A;  4KLO A;  2LXC A;  5KFH A;  3ABV B;  3B0A A;  3T5J A;  1ZQS A;  3DBR B;  4IM2 A;  5AK6 A;  2BPS A;  3QUB A;  5JUM A;  3AUO A;  2QAR A;  2IY1 B;  4PK1 A;  3TAC B;  2CN1 A;  2YVC A;  4DSF A;  3QU4 A;  2KHQ A;  3T3O A;  2ZCC A;  1RYS A;  1E5W A;  3PZD A;  3KFU F;  5HNK A;  3A0B U;  5ALD A;  2DWQ A;  2IO3 B;  4IS7 A;  3MHZ A;  1BGX T;  4WJN A;  4C7Z A;  3K4G A;  4XUS A;  5ALI A;  2LM1 A;  3SFD B;  2R8H A;  5G2N A;  1ZDV A;  1X9S A;  3SD5 A;  1Z3E B;  4IQW A;  2FCM A;  2WQY B;  4ECT A;  4NLK A;  1SGH A;  5BYR A;  3U7D A;  1KL9 A;  2JGA A;  3Q8S B;  1C79 A;  5DG9 A;  2QIL A;  1XC9 A;  1D6E C;  4UB1 A;  3AU4 A;  1BPZ A;  1H8C A;  1CZP A;  3QC8 B;  2JXT A;  2CHW A;  4J03 A;  3HWT A;  3AH7 A;  3B0X A;  1OUQ A;  5DPW A;  4KIT B;  5ALW A;  1N48 A;  3QE9 Y;  2WXI A;  3GP7 A;  3CRX A;  5ALN A;  3AE3 B;  4HWI B;  2V4R A;  5HHH A;  4RQ6 A;  4QWC A;  1JWB D;  3PSI A;  1JN3 A;  2K0P A;  1L0X B;  3VTU A;  5KAF U;  1HIW A;  4N59 A;  2W7P A;  2WGS A;  2KNJ A;  4DFK A;  4Y2S A;  1TK0 A;  2L00 B;  2ASJ A;  1YZ6 A;  4DO9 A;  4UW9 A;  2XY7 A;  4EBE A;  4E71 A;  1AQ6 A;  4LK0 M;  2V9H A;  2BPC A;  1U47 A;  5KFU A;  1RLF A;  4N6E B;  1KRH A;  1BUI C;  4NWI A;  4MF8 A;  4TUP A;  4J9O A;  3T3F A;  2KTF A;  2NRW A;  4ICV A;  2ACZ B;  3NS8 A;  5ALS A;  2OH2 A;  2MSN A;  2WXG A;  2RR9 A;  2Z8L A;  2A3V A;  2NBW B;  2HHW A;  2GBM A;  2XK5 B;  4MGY E;  1SKR A;  2IND C;  5BYS A;  2BCR A;  4A8E A;  4YXJ A;  1NJY A;  2DX5 B;  3KZX A;  3Q3F A;  2NMQ A;  4DSE A;  3KYC D;  1V5O A;  4RF1 A;  2JEG A;  1QIL A;  2R2Q A;  3ZTC A;  2BR0 A;  1TE2 A;  4DQR A;  1KSP A;  4EZJ A;  3N30 A;  1TS3 A;  2JU6 X;  4TUS A;  1WGD A;  1FXT B;  1ZQD A;  2E8P A;  4RQ2 A;  3A33 B;  1FO4 A;  1JRP A;  2PMZ C;  4M8N A;  1YN5 A;  4UAR A;  2MA1 A;  4FBU A;  2XI9 A;  1V6E A;  3A1Q B;  3QAQ A;  3QZ7 A;  4JWS C;  2HHQ A;  3ZJT A;  1P3Q U;  2KJH B;  3WU2 U;  3B0Y A;  2GO7 A;  1K50 A;  1UUP A;  5BYQ A;  2DLB A;  3AB5 A;  3ZLZ A;  4J3O D;  5IOI A;  1SE4 A;  4PT5 A;  2KOB A;  4EEY A;  4KLI A;  3ML9 A;  4YD1 A;  4I6L B;  5DPT A;  2V4Q A;  1LQB A;  2PEA A;  4ECU A;  4DQO C;  5KFR A;  3UXO A;  4KLQ A;  9ICE A;  3QWZ B;  2XVT A;  3NAS A;  3ML8 A;  1Y56 A;  2G9H D;  2MQJ A;  2Y5C A;  4NXZ A;  3TAD A;  1E7P B;  5IIM A;  4ZYS A;  1RQL A;  1DOY A;  5KL8 B;  4EBD A;  1UEL A;  1J2N A;  2JQR B;  2ZCB A;  4PHA A;  3A9J B;  4HEA 1;  3L13 A;  9ICB A;  4XDD A;  2BPF A;  1QH9 A;  5J0Q A;  4IG7 B;  2DUY A;  1WYW B;  4XA5 A;  4BBN F;  2N4F A;  3DPD A;  4NJC A;  3RZW C;  1YZ7 A;  4I2J A;  1J2M A;  1BNO A;  3IBE A;  3KWL A;  3RB0 A;  5TIS U;  1KFD A;  2HOI A;  2L8J A;  4CDG A;  3HM3 A;  1KM7 A;  2NTS A;  4LTU A;  4DF8 A;  2K8C A;  1WF9 A;  2DYM A;  4RCO A;  4ITK A;  2V0G A;  2I1Q A;  1T0Y A;  2KC1 A;  1TZ1 A;  2D07 B;  2J4X A;  4D2K A;  4NM2 A;  3AE2 B;  1SZP A;  3ZIM A;  1JUD A;  2H89 B;  1B22 A;  1I4G A;  4GXJ A;  2K39 A;  4C8N A;  4NY8 A;  1KLU D;  4HPL B;  3BK1 A;  4DHZ B;  1C78 A;  2VH1 A;  3L17 A;  4RQ8 A;  1GOZ A;  2M0N A;  1I4H A;  2WDT B;  4GLS C;  5ALJ A;  1RQN A;  3BQT A;  4FZM A;  3PRE A;  4YTP B;  2IHN A;  3NUQ A;  5CA7 A;  2G4S A;  3ZXV A;  1JWS D;  2M0X A;  4KGT A;  3I57 A;  4KMO B;  4OZA A;  4GN1 A;  8ICS A;  4NJ6 A;  1SV4 A;  4LNK A;  2OXO A;  2BS4 B;  2RPQ A;  5J2K A;  2BS2 B;  2LJ5 A;  1Z1V A;  3H8H A;  2P6R A;  4NAM A;  2WF7 A;  5H2F U;  3AQF A;  1I4R A;  1L5P A;  1Z4N A;  2Y9U A;  2YB4 A;  4JWN A;  2F1H A;  1XXG A;  1N60 A;  4HRS A;  2BS3 B;  3WK5 A;  2BW2 A;  8ICP A;  2G1E A;  3N1Y C;  5J0Y A;  4C7Y A;  4F5P A;  4IW0 A;  2KOX A;  4EEW A;  2LYH A;  3R8B A;  1MHX A;  2A1A A;  1ED1 A;  1B1Z A;  1ZQW A;  1SE3 A;  2C5L C;  3WAP A;  5EE1 A;  4DHJ D;  3VCB A;  2BVC A;  3PHW B;  3ZYY X;  5G5G A;  3Q3N C;  4O3N A;  1SEB D;  2BQU A;  2F77 X;  2DNF A;  2KQS A;  3PS6 A;  5LNK 1;  2VKQ A;  4OHJ A;  3PVL A;  4UAY A;  4J6I A;  3RB6 A;  5J18 A;  3TL5 A;  4U7C A;  4P0Q B;  4AP9 A;  3BY4 B;  3Q6B A;  1SL2 A;  3HIL A;  2PFQ A;  3PRP B;  1RYJ A;  3JVZ X;  2DL0 A;  4WAF A;  3TJP A;  4KSL C;  4NLG A;  4XZ4 A;  1RAX A;  3GIK A;  2KC2 A;  2MJE A;  2ZNV C;  3UGB B;  2JZP A;  2LD9 A;  3LDA A;  4DOA A;  3PVX A;  4F2R A;  2RD0 A;  2XK5 A;  2O6K A;  1VJ5 A;  4NQK E;  2LBO A;  5KFP A;  5J29 A;  4J9M A;  3NHE B;  2MAX A;  3FC4 A;  4IR9 A;  2ZJ5 A;  3VRB B;  1IYF A;  2KVS A;  2RRD A;  5AKE A;  3PRZ A;  8ICC A;  3GZF A;  4MEY A;  3Q8K A;  1ZYQ A;  1VRA B;  4GDK A;  1HTO A;  3UI3 A;  3JPP A;  3RNE C;  2L05 A;  2QDF A;  1XO1 A;  4GOC A;  2Y9T A;  1KTQ A;  2DYO A;  4QZG A;  1V9J A;  3R3M A;  1S5L U;  4AUQ C;  2KIW A;  5H92 C;  4LCD E;  4EX6 A;  1YIW A;  5BO4 B;  1Q10 A;  2KAN A;  3APF A;  4TUR A;  4RPY A;  3A1Q A;  3QX7 A;  3E9S A;  4NY0 A;  3TQ1 A;  2WDV B;  5KFO A;  1C20 A;  4K4G A;  1UPH A;  3SV3 A;  5AKH A;  5J2H A;  3B2F A;  4MJS A;  3IG5 A;  4P4P A;  3R9K A;  1ZUD 2;  2BYT A;  1JIH A;  3LVV A;  5BPC A;  3P4R B;  1MG4 A;  1QSL A;  3Q8C A;  4S17 A;  1XU4 A;  4F93 B;  1PVP A;  2KJ6 A;  1T6B X;  4MGI E;  5KFL A;  3NVZ A;  7ICL A;  3MR2 A;  3APD A;  2RP5 A;  4P4O A;  1FNV A;  4F5O A;  2H3V A;  4CGZ A;  5KT2 A;  3M7D A;  4FHJ A;  5AI8 A;  2CHX A;  1D9F A;  2FE9 A;  4Q2J A;  5D7G A;  1V81 A;  3X23 A;  2KHW B;  4UBC A;  4HLE A;  2M17 A;  4F3O A;  4IWO A;  4F4K A;  4IR1 A;  1WE7 A;  4UB8 U;  2WDQ B;  4C4R A;  4NLB A;  5KFT A;  3IT4 B;  3M9M B;  4RQ4 A;  5KG6 A;  5A0L A;  2HHV A;  3WIM A;  4BGD A;  2JR5 A;  2IO2 B;  3WAO A;  2F44 A;  4JK1 A;  7ICS A;  2WXH A;  5KG2 A;  1KH0 A;  1MHH E;  4N9F 4;  1ZQC A;  2PVG C;  5AM1 A;  4ECS A;  2KZM A;  4A3O A;  4DDG D;  3N7R C;  4KIK B;  1K51 A;  2DZK A;  3BWU D;  4ZHO A;  2FDR A;  1WI0 A;  1QOG A;  3NVV A;  1XEE A;  1X42 A;  4P2H A;  1SBB B;  3A9K A;  3KHR A;  4LJO B;  1QQ6 A;  2W9M A;  3QU7 A;  4ECZ A;  4KLU A;  1UNS A;  5DG8 A;  3PW4 A;  4W9E A;  3V6C B;  1C9F A;  2X38 A;  2JRI B;  3GV7 B;  7ICT A;  5IKC M;  4FLH A;  2A1J A;  4B6J A;  2QLT A;  4C4S A;  1RFA A;  3F2D A;  1H4R A;  1SB3 C;  3ALR A;  5J0P A;  4G11 A;  3AE1 B;  5AK3 A;  3W5V B;  5KT3 A;  1JAL A;  4BWM A;  1FFU A;  2WB1 C;  3T79 A;  4RM9 A;  4RGT A;  1NZB A;  1JML A;  2AQ4 A;  3KZI U;  3TAN A;  2MJ3 A;  3PPA A;  1NJX A;  4YN4 A;  4RNA A;  4DL6 A;  4II3 B;  1WM2 A;  4WWN A;  1WWV A;  3AE9 B;  4N58 A;  1L3S A;  3QAR A;  1WY8 A;  4HRO A;  3U52 E;  2O2V B;  3IHQ B;  1NBF C;  4M8M A;  3MGH A;  1TK5 A;  5EOZ A;  1TZO A;  5J0W A;  1RZT A;  4X5V A;  3KYD D;  2ZJ8 A;  2DHZ A;  3JPR A;  2QB1 A;  3DBH B;  4GDL B;  4FAD A;  1VCB A;  2OHF A;  4Y2X A;  5DBB A;  2FLN A;  4OD0 A;  4CF5 A;  2FPL A;  4E3C A;  2KJ8 A;  3HM6 X;  3IT6 B;  2J0M A;  4C8K A;  5DKW A;  4Y2V A;  4QZF A;  3GII A;  2JT4 B;  2LHE A;  2N9X A;  5DQI A;  7ICI A;  4I2G A;  4BOS C;  4HVB A;  3SI8 A;  4ZRI A;  3QQ8 B;  5AZF A;  5FKA C;  4IRK A;  5KFK A;  4ECX A;  4WJO A;  1FCL A;  2MW5 A;  1RYR A;  4DL7 A;  3D2S A;  4CHK A;  4FZN A;  5CRX A;  1COK A;  2BB5 A;  4E74 A;  1CEZ A;  1PK3 A;  3N4M B;  4OJ5 A;  1WXA A;  1L2N A;  3ZW3 A;  4C8L A;  1PZN A;  3H7I A;  1XO3 A;  2K6D B;  2PE9 A;  1V1O A;  4LJP B;  4RNM A;  4GB9 A;  2AGQ A;  2B3A A;  3DVG Y;  3TEZ A;  3P4P B;  5KFN A;  2E3T A;  1TK8 A;  5GMV A;  4YXD B;  3B9J A;  4DF4 A;  4A3P A;  4GXB A;  1HE8 A;  1D4B A;  2M9N A;  2WXO A;  4RU9 A;  2DKZ A;  3DHH C;  4X57 B;  4J9N A;  5IIK A;  4IWP A;  1WCL A;  1L5U A;  3M62 B;  5ALL A;  4CO7 A;  4I27 A;  2LKY A;  3AE5 B;  2HJ8 A;  5K4L A;  3LWM A;  2UYZ B;  1Z00 B;  2O6V D;  4AJY B;  1WRD B;  2H3Q A;  3K1Z A;  7ICE A;  4QWE A;  3H6N A;  1LM8 B;  2I38 A;  3L08 A;  1UCV A;  3H4B A;  1C76 A;  2FJ6 A;  1SL1 A;  1MSW D;  3PSP A;  1OEY J;  3H7P B;  2D11 A;  2TSS A;  3OG5 A;  4M47 A;  2J53 A;  4RFB A;  1L3T A;  3ZRF A;  2INP E;  4JX1 C;  5AKI A;  1FEZ A;  1MG8 A;  2JEF A;  1ZQK A;  3HP6 A;  4PS3 A;  3MGI A;  2JSV X;  5KFZ A;  3H4D A;  4IM3 A;  3IV6 A;  4Y2U A;  3WAL A;  2K22 A;  1E6E B;  2WXR A;  1TAU A;  1IP9 A;  2W9N A;  2LGY A;  2WHI A;  1WJ4 A;  1M6Y A;  4DLE A;  1YQB A;  5ALE A;  5BMI A;  1YX6 B;  1MQ3 A;  1RXW A;  2XNA C;  1NJZ A;  5KFF A;  2K6Q A;  2LMC A;  2ASL A;  1Q5W B;  1X6J A;  3N7S C;  3RBD A;  2HVH A;  1B9R A;  2E8O A;  1ZD2 P;  1KF6 B;  2XEW A;  5AZH A;  4EE2 A;  3PW5 A;  2JRH A;  1XWL A;  5DLG A;  2V1Y A;  4J9L A;  1T5X D;  3NRZ A;  3V6K A;  4MFF A;  5DB6 A;  1T0S C;  4BAX A;  3UMC A;  8ICG A;  1PVQ A;  3ZD8 A;  4JWM A;  4BKS D;  4DQQ A;  4MEX A;  3MFI A;  2FNJ B;  2D3D A;  3P2B A;  2LYA A;  1VJK A;  5GTH U;  1CMX B;  4JL9 A;  3UPQ A;  3AQE A;  3TI0 A;  3JPS A;  1AN8 A;  4M6W B;  1WXV A;  3CST A;  3DEE A;  5JU5 A;  1IV8 A;  4NM1 A;  2B76 B;  4L1B A;  3AEC B;  3OPX A;  1S9F A;  3NGD A;  2CJO A;  1SXT A;  2D5G A;  4KIK A;  1JI7 A;  3CMM B;  3EFC A;  1HUO A;  2YB1 A;  4EX7 A;  1UA1 A;  3DQV A;  4FN2 A;  2UVR A;  3AE8 B;  7ICH A;  2WDR B;  3KH0 A;  4BZA A;  2KJR A;  1S3S G;  2LJI A;  4FJY A;  2IOH A;  1UT8 A;  5KFW A;  3DVN V;  2KNB A;  1F2R C;  2WF8 A;  4WWO A;  4A6Q A;  2OYY A;  2QEJ C;  1M94 A;  3AUL A;  1TT5 B;  3WKE A;  3HUI A;  4ELV A;  3SEI A;  1WG8 A;  5AM4 A;  5J2R A;  3D32 A;  3QYP A;  3H8S A;  4QIW F;  1E8X A;  4C56 C;  5J2F A;  3LWL A;  5KNI A;  4ECY A;  2JHD A;  3PW2 A;  4Q8E A;  2Y5B B;  1L8L A;  4MT5 A;  3RAQ A;  2IY0 B;  2BKR B;  2WNM A;  3OWE B;  8ICK A;  4DBG A;  3Q8P B;  1T0Q C;  1SIJ A;  1S0N A;  4Q43 A;  1QTM A;  1HUZ A;  2PXI A;  1J19 A;  2O2V A;  3PLV A;  5DLF A;  5J0S A;  4DDI D;  3BS7 A;  1EO6 A;  4GDL A;  2K3U A;  2PKO A;  5AUK A;  2LHD A;  2ZJD A;  4DS4 A;  2JYT A;  4J9S A;  5G55 A;  1FNU A;  4LVS A;  1HEK A;  3N28 A;  3PO4 A;  3UF8 A;  4M9G A;  2EAN A;  3ISB A;  4KLD A;  1SZH A;  2PIA A;  3WAM A;  5DBA A;  2NRV A;  3RUI B;  2KKP A;  1LB2 B;  2K8B B;  4YCX A;  2UU7 A;  4BUG A;  2BPG A;  1G6J A;  3MR6 A;  5L9X A;  2GBJ A;  5J0U A;  1NK8 A;  4WJ3 B;  1T3Q A;  2IO0 B;  1U4B A;  4CCH A;  8ICN A;  4B9S A;  1RFK A;  2MX2 A;  2EEL A;  2ZIX B;  2LMR A;  4UB4 A;  3SU8 X;  4I29 A;  1KLV A;  5ALM A;  1S76 D;  3BVZ A;  3KUZ A;  3DVG X;  1TTN A;  2Y3A A;  2HDO A;  2F1J A;  1XSN A;  1S8O A;  3L3F X;  4B9L A;  2HW3 A;  3ORY A;  4JQW C;  1GB1 A;  1XLQ A;  3QUQ A;  3OHA A;  5ALP A;  4MDK E;  1ZW7 A;  4GU2 A;  2W43 A;  4F4X A;  4U6P A;  1NEN B;  1K8R B;  2M1M A;  3HKZ C;  4NLZ A;  3VUX A;  1FRR A;  1K1S A;  2LGD A;  3AEF B;  2L7R A;  1X1M A;  2R2O A;  3NY5 A;  2BYV E;  3NUH B;  1Z00 A;  2KVC A;  2MRP A;  2KQ7 A;  4JIO U;  2XIC A;  4A90 A;  1UWM A;  4W9L A;  3SD7 A;  7ICM A;  3H7P A;  2R8K A;  4R63 A;  2YMP A;  2L5Y A;  1FMA D;  4NL9 A;  4B9U A;  4PGY A;  1OEY A;  3EPI A;  2HJ1 A;  2MHJ A;  5HG2 A;  1ZQP A;  1WJU A;  1QQR A;  2QJL A;  3ECI A;  1WXM A;  4DXF A;  2IYD B;  4M0A A;  4FJZ A;  1WGR A;  1OW5 A;  1JXE A;  4I2E A;  4O3M A;  1WRI A;  3AMZ A;  2INN E;  2JZZ A;  4M0W B;  5DGB A;  2R8G A;  4M2Y A;  5D6J B;  4ED7 A;  3TEX A;  1SV0 C;  1YMH E;  3ZNI D;  2ZTE A;  3FYH A;  4A55 A;  5ALK A;  4HKQ A;  3KHL A;  3UIP B;  3MC1 A;  3UQ2 A;  1NEK B;  3FKY A;  3RJH A;  2OED A;  1F5S A;  3VTV A;  1JWM D;  3RMK C;  4A20 A;  1WSP A;  5CHF A;  1V97 A;  7ICR A;  3PRM B;  2KZR A;  1B43 A;  2Y0S C;  3T5K A;  1I4X A;  4LDT D;  3ZGZ A;  5J2D A;  3HVZ A;  1OQR A;  4LNN A;  5AI5 A;  9ICC A;  3I28 A;  3QA8 A;  4IQV A;  1EU3 A;  4URK A;  4GC7 A;  4FO6 A;  1LKY B;  2KN4 A;  1DOX A;  3WK8 A;  1BPX A;  3L4P A;  1UF0 A;  4M6W A;  1AYF A;  1DOI A;  5KFE A;  2LHT A;  4RQ0 A;  2F8K A;  7ICU A;  2C28 A;  3GZN B;  2Z59 B;  1ZQA A;  2HTM E;  3TFS A;  1ECW A;  1RXV A;  1D8L A;  1HTQ A;  1J8C A;  2W9B B;  3GU3 A;  4I2B A;  3VC8 A;  8ICY A;  4AS1 A;  5CEH A;  1ZQJ A;  3QU9 A;  1V2Y A;  1V9P A;  4FS2 A;  4MF2 A;  3BDP A;  4O3R A;  5HR7 A;  4XE0 A;  3RFZ B;  9ICI A;  5DPS A;  4ZDV A;  2LVQ A;  3ETL A;  9ICT A;  3CNH A;  1GJZ A;  3F5E A;  1F77 A;  3AU6 A;  3R7R A;  2E1E A;  5DDY A;  4PPX A;  3I9V 1;  1UHU A;  1Z5S B;  5AEK B;  4KLM A;  4B6W A;  2DKX A;  4DL4 A;  3W1S C;  1KTK A;  2HBM A;  3Q3M C;  1CUK A;  2I5H A;  4XC2 A;  4QZA A;  3BJY A;  4KMU A;  2MA9 B;  3PR5 B;  3NVW A;  4YVZ A;  3WK4 A;  5BOL A;  2VA2 A;  2KLG A;  4F71 A;  5C5J A;  4RQM A;  2VAN A;  3WK6 A;  2DBY A;  4YSY B;  4IRC A;  3QEB Z;  3L54 A;  4US9 A;  4YR2 A;  5J2I A;  2NO4 A;  1KLN A;  2WXK A;  2MUT A;  3WK9 A;  1SIF A;  3AN1 A;  3KKA C;  2W8K A;  9ICF A;  2XY5 A;  1LXD A;  2BGF A;  2K8B A;  2WXJ A;  3VDZ A;  3I1Y A;  5J2E A;  1TYG B;  4DFJ A;  5AKX A;  4MSM B;  2ZUC A;  4OO1 J;  3PSF A;  1T4G A;  2F8L A;  1QSS A;  3T5H A;  1T0R C;  4GDK B;  4R64 A;  3N97 B;  2RDJ A;  2KSO B;  2JUO A;  4YTN B;  2BF8 B;  3GV5 B;  3DHG C;  2ZIX A;  3ONN A;  4II2 B;  1D8Y A;  3IN5 A;  3BYY B;  2BBC A;  5FK9 C;  1KOT A;  1XLN A;  1EM7 A;  1T3N A;  3Q2A C;  1C4A A;  3TFR A;  3HRD D;  1KQQ A;  2J6U A;  3I5J C;  4R3D A;  3HIZ A;  3TSS A;  2ZZP B;  4XYC A;  3VR9 B;  3FAH A;  2AX5 A;  1WX9 A;  5G5H A;  2IBI B;  7ICO A;  4BJQ A;  1DK3 A;  2EDU A;  4K7W A;  5KG1 A;  4RM8 A;  3ZNZ B;  1NOM A;  3RJJ A;  4DSI A;  2LFI A;  4B9M A;  4UAT A;  2ZW0 A;  3ZQ4 A;  5J2C A;  4QWB A;  4MJS B;  4PHE A;  3TEY A;  4ELT A;  2KFJ A;  3NVY A;  4QW8 A;  4MGZ E;  4GC6 A;  9ICV A;  7ICK A;  1IGC A;  2BDP A;  3SV4 A;  2E5S A;  2NS5 A;  4BVU C;  2XID A;  2MBB B;  2BQQ A;  1VD2 A;  1ZQZ A;  5KT6 A;  2BQ3 A;  1K53 A;  2G08 A;  4GXK A;  1L4Z B;  1N5W A;  2IBK A;  4QZE A;  4OVZ A;  4B9N A;  2GBN A;  1PGB A;  4I6N B;  2KO3 A;  1I4Q A;  2KMA A;  3IDW A;  2VZK B;  4W9H A;  4ACO A;  3TAQ A;  1WMH A;  4CRX A;  2SAK A;  4M0W A;  1J97 A;  2YX8 A;  3SEN A;  2KD1 A;  5HHI A;  1R4M I;  2PTL A;  3EC8 A;  3C8Y A;  1O08 A;  5F3X B;  2HOQ A;  4RQ5 A;  3J81 j;  1WYG A;  3BS5 B;  3PW0 A;  2DYB A;  3ALB A;  3LVW A;  3RPF C;  1YOV B;  5JXV A;  3AEG B;  4F8R A;  4KLJ A;  1UWX A;  2EH9 A;  4M9J A;  3AU2 A;  5T14 A;  2K89 A;  5L1J A;  1NZP A;  2HBK A;  4Q8F A;  3KQ4 A;  2N1W A;  5IAA C;  3A9K B;  2DEN B;  4KLG A;  2ZNV B;  2FCN A;  3C0R B;  2I6X A;  1ZP0 B;  3EEC A;  2A1J B;  1LKY A;  1RM6 C;  2GRI A;  5IO9 A;  2YN4 A;  3SQI A;  1L7M A;  2IOF K;  3G6X A;  2AQ3 B;  2WX1 A;  1DK2 A;  3MP9 A;  4B9K A;  2D10 A;  5AIB A;  1L6N A;  4ACF A;  4JV1 A;  4TUQ A;  3VUW A;  1CK1 A;  3KUD B;  2HBL A;  8ICW A;  1V49 A;  2AWT A;  4DXG A;  1Y88 A;  2GLS A;  2P35 A;  2Q0Z X;  1L6U A;  3EYZ A;  3RYT A;  4DFD A;  3UXP A;  1ZET A;  3NRW A;  3SR6 A;  1ESF A;  2W9B A;  4KSK C;  1L3V A;  1PUT A;  4EZK A;  4ZOH C;  4RQ7 A;  5CWR A;  5AK4 A;  5HML A;  3QX1 A;  5KFI A;  4GIB A;  5FR6 A;  3BII D;  4EZL A;  1TBE A;  4QZ8 A;  2FPM A;  3UM9 A;  4PH5 A;  1AWD A;  3I63 C;  3LYS A;  1L4D B;  4RPX A;  2FPK A;  4Z6E A;  1QZE A;  2QKQ A;  3K9P B;  1JWA D;  1ZOL A;  4ZYN A;  2ZJA A;  4EYH B;  1UZX B;  2LWP A;  1PUZ A;  2HCF A;  2ICI A;  1PK1 A;  3QXG A;  5KG4 A;  1FRD A;  3MJ5 A;  1T8E A;  1KLG D;  1SF0 A;  2FMQ A;  2ZIU B;  2MU2 A;  2BZF A;  4QZC A;  1T7P A;  8ICB A;  2WU5 B;  3AXC A;  4I6P A;  4MH0 E;  9ICA A;  3ZVV A;  3RUL A;  4ELU A;  4IOI E;  5ALT A;  1E90 A;  4PYU A;  1E9M A;  4O0I A;  8ICV A;  2UWQ A;  3MFH A;  1ZQ1 C;  2FI1 A;  4KKJ A;  2KFZ A;  5J0R A;  2KDB A;  2JWZ A;  1JWU D;  3EFU A;  2C60 A;  2WF6 A;  1JQ4 A;  1WH3 A;  2KN5 A;  1MQ2 A;  1GNU A;  3PX0 A;  1RWS A;  1TAM A;  4YP3 A;  2N1V A;  3HHM A;  3EGR A;  1A0P A;  3MGV A;  2D8C A;  2ZXH A;  2QSD A;  3DWG C;  2C9W B;  2KSO A;  3AE4 B;  1NI3 A;  4L23 A;  3MC9 A;  4WJP A;  2C2D A;  2ZG6 A;  2WU2 B;  3KOO A;  3U4E G;  2J6T A;  2LXA A;  2KTR B;  1ZQM A;  2XGP A;  2LUE A;  4W9C A;  4IQU A;  4O1N A;  4RT2 A;  2D6F C;  1ENF A;  3C2K A;  4HCP B;  4MAC A;  1RRB A;  2XBB C;  4FBJ B;  2B21 A;  2K8A A;  1TV9 A;  4DEZ A;  5J0O A;  4TQR A;  4HAI A;  3OSN A;  1SL0 A;  4M9L A;  1YX5 B;  5CB1 A;  1JXL A;  5EWE A;  3MC8 A;  4JWU C;  3PLU A;  3QEA Z;  2EMS A;  1ZJM A;  3RJF A;  2MP2 A;  1TKG A;  1GPX A;  1S0V A;  2LAS A;  4ANV A;  2XO7 A;  1D5X C;  4C0Z A;  3R7Q A;  2F3N A;  1F9J A;  1U4A A;  2CS4 A;  3H0L B;  4C80 A;  1DOQ A;  3M63 B;  4IDI A;  9ICU A;  4K7S A;  2KG5 A;  5AI4 A;  1NK0 A;  1IM4 A;  5IP4 D;  1HEZ E;  2GLE A;  4KZC A;  3CWI A;  4TQ0 A;  5E6O A;  3EWA A;  2KX0 A;  2JXX A;  5J0X A;  1OXJ A;  3RF9 A;  4MFA A;  2W9C B;  2I9G A;  2L76 A;  1GG3 A;  3RCZ A;  2ISO A;  3Q8R B;  2WXF A;  4AYB F;  1YQ4 B;  4F5Q A;  4NJ8 A;  4ZRJ A;  3C1Y A;  5CR0 A;  2WFA A;  5L1L A;  2BTE A;  4G3X B;  1TFR A;  1NDD A;  1YD8 U;  1A76 A;  3W5U B;  4A9A A;  3BS5 A;  2DPI A;  5KTQ A;  3T9L A;  3MHS D;  4PJ0 U;  4W9J A;  3RBE A;  8ICQ A;  1XLO A;  4OJ6 A;  1KBU A;  3UQB A;  1SWW A;  3IM1 A;  4UB3 A;  2FCQ A;  5KFA A;  3NJT A;  3VR8 B;  1U49 A;  3QUT A;  8ICX A;  2JX5 A;  1T94 A;  2KK8 A;  3KUC B;  3VUY A;  5D3I B;  1JW9 D;  8ICU A;  1S1Q B;  2BYE A;  4ED1 A;  9ICX A;  3ZO5 B;  5HHD G;  2UVU A;  2K25 A;  2M0A A;  2W9A A;  4F7Z A;  2F1I A;  3BZK A;  2KD0 A;  4KN4 A;  4ZHP A;  3C2L A;  4DHJ B;  1PVR A;  2OCE A;  3C5G A;  1QT9 A;  1UBI A;  3PT2 B;  5AKY A; 
#chains in the Genus database with same CATH homology
 3HUI A;  1C79 A;  2LUM A;  3SEB A;  2QIL A;  2N7J A;  1D6E C;  4C56 C;  1MPE A;  1CZP A;  2MJD A;  2JXT A;  3Q8E A;  3AH7 A;  4XDC A;  3SFE B;  4MT5 A;  3NS1 A;  2J52 A;  2WNM A;  3OWE B;  2WXI A;  3GP7 A;  1SIJ A;  1VR9 A;  2HDE A;  3AE3 B;  1F2R I;  1C4C A;  1FM0 D;  1JWB D;  2K0P A;  3LXF A;  1L0X B;  1JCK B;  3E56 A;  4N59 A;  2K3U A;  1TY2 A;  1BML C;  2PKO A;  5AUK A;  2LHD A;  1PGA A;  2JYT A;  2CU3 A;  2KAC A;  1FNU A;  5AUI A;  2XN9 C;  4LK0 M;  2PIA A;  1EWY C;  3Q8B A;  4N6E B;  1KRH A;  3N9Y C;  3P42 A;  1BUI C;  4UDU C;  4RF0 A;  1V1P A;  1WGK A;  1T3Q A;  1QKZ A;  2ACZ B;  2PMV A;  1P7E A;  5C3J B;  1I4P A;  1RFK A;  2WXG A;  2Z8L A;  2EEL A;  3AE7 B;  2KMM A;  5BYS A;  4US8 A;  3AED B;  2NMQ A;  3BVZ A;  2Y3A A;  4RF1 A;  4L2Y A;  1QIL A;  3AEE B;  1TKY A;  4NZL B;  3R2T A;  4WH4 A;  5E6J A;  1XLP A;  1TS3 A;  1GB1 A;  1XLQ A;  2JU6 X;  2BB6 A;  2RDH A;  2I2Y A;  1L0V B;  2W3S A;  1NEN B;  1PFD A;  1FO4 A;  2IGH A;  5EE3 A;  1JRP A;  3VRA B;  3EUB 2;  5HFY A;  1YN5 A;  1FRR A;  3AEF B;  2W55 A;  4JWS C;  3NUH B;  3ZJT A;  2LGI A;  1PGX A;  1NVI D;  1K50 A;  3P4S B;  1UUP A;  5BYQ A;  4A90 A;  3GB1 A;  1UWM A;  2DLB A;  1ZDX A;  2KAJ A;  2RMM A;  3AB5 A;  4J3O D;  1SE4 A;  4PT5 A;  1LO5 D;  3VQI A;  3WCQ A;  2FBW B;  1FMA D;  5EE9 A;  4DQO C;  4OW0 A;  3Q8A A;  3P4Q B;  5HG2 A;  3W2D A;  2QJL A;  1QQR A;  4DXF A;  1Y56 A;  2G9H D;  1FFV A;  2Y5C A;  4ZYS A;  1E7P B;  2NTT A;  1DOY A;  2L32 A;  1WRI A;  3AMZ A;  2JQR B;  1YJJ A;  2INN E;  1TY0 A;  4HEA 1;  3TEX A;  1YMH E;  4AQ7 A;  4A55 A;  4HKQ A;  5C2T B;  1NEK B;  4XDD A;  4ARC A;  2OED A;  1GB4 A;  1JWM D;  1HQR D;  1WSP A;  1IBX B;  4NJC A;  2PVO D;  3U2S C;  2YEP F;  1V97 A;  3KWL A;  1VZ8 A;  1I4X A;  5D3D A;  3ZGZ A;  4OZB A;  2NTS A;  3HVZ A;  1OQR A;  1N5X A;  4LTU A;  1E10 A;  2DYM A;  4RCO A;  4ITK A;  2V0G A;  1SSN A;  4IKG A;  1EU3 A;  2KN4 A;  1DOX A;  4MH8 A;  2J4X A;  4D2K A;  4XWW A;  3L4P A;  3AE2 B;  1AYF A;  1DOI A;  1D5M C;  1YN3 A;  3ZJU A;  2H89 B;  1I4G A;  1KLU D;  1FXA A;  1ZOY B;  3BK1 A;  3LYY A;  1UGJ A;  3MFG A;  1C78 A;  2R61 A;  3FIL B;  4TSS A;  1QOA A;  1GOZ A;  2HTM E;  1I4H A;  4B0E A;  4GLS C;  4YTP B;  3TEW A;  4USA A;  1CQV A;  1JWS D;  1VZ6 A;  4AS1 A;  5H8Y E;  4KGT A;  3I57 A;  4OZA A;  1QOB A;  2BS4 B;  3O13 A;  2BS2 B;  4XE0 A;  3H8H A;  4LLG M;  3RFZ B;  4NAM A;  1XXG A;  1I4R A;  1L5P A;  1J7C A;  1ROE A;  3W9C B;  4KX6 B;  1N60 A;  3T3N A;  4JE3 B;  1F77 A;  2EKI A;  4HRS A;  2BS3 B;  2BW2 A;  2LEK A;  3J9C A;  2G1E A;  3I9V 1;  1N63 A;  4TQ1 A;  4C7Y A;  4KGR A;  1QF6 A;  3IAM 1;  2MEK A;  3GS2 A;  4WQM A;  2V3P A;  4RGM A;  1KTK A;  3R8B A;  1MHX A;  4P16 A;  4ARI A;  1B1Z A;  3NVW A;  3Q8F A;  1C4P A;  1SE3 A;  4ZRP A;  5FR3 A;  1OFF A;  2ON8 A;  4MM3 B;  5GXG B;  5EE1 A;  3ZYY X;  2DBY A;  5G5G A;  4YSY B;  2GI9 A;  4RGO S;  1SEB D;  5LNK 1;  4US9 A;  4OHJ A;  3PZ8 A;  2WXK A;  3AN1 A;  3B2G A;  2WXJ A;  1TYG B;  4WAF A;  1RYJ A;  1IUE A;  1NYQ A;  1XCT L;  2MJE A;  4YT0 B;  4GDK B;  2JZP A;  4ZRQ A;  4YTN B;  1NYR A;  2JWU A;  1L0Y B;  3Q69 A;  2AQ2 B;  3AE6 B;  3FC4 A;  2MH7 A;  3VRB B;  3BYY B;  2BBC A;  5FK9 C;  1XLN A;  1EM7 A;  1C4A A;  2WS3 B;  3HRD D;  1VRA B;  4R3D A;  5HI1 A;  3UI3 A;  2KDM A;  3TSS A;  2ONQ A;  1DGJ A;  1C77 A;  3VR9 B;  1AW7 A;  3V3X A;  2DYO A;  2AX5 A;  3FAH A;  1VDV A;  5G5H A;  5H92 C;  2RPV A;  1ZE3 D;  3LB8 C;  3P63 A;  2LFI A;  1L6V A;  1Q10 A;  2Q5W D;  2W82 A;  2ZW0 A;  3ZQ4 A;  3TEY A;  4YTM B;  4YWG G;  3NVY A;  3E9S A;  5TSS A;  2JYE A;  1GAQ B;  2WDV B;  1K52 A;  1HA5 A;  1IGC A;  4WWM A;  3B2F A;  3R2I A;  1K53 A;  2YEP B;  1ZUD 2;  1FNW A;  2N0S B;  2BYT A;  1L4Z B;  3P4R B;  1N5W A;  4OVZ A;  1YNT E;  1TJE A;  3Q8C A;  2K9X A;  3CIR B;  3DWM A;  1PGB A;  1T6B X;  3NVZ A;  1I4Q A;  2VZK B;  3BVG A;  2IPK D;  1FNV A;  2W54 A;  2SAK A;  2L83 A;  4M0W A;  4WUR A;  4Q2J A;  1VZ7 A;  2PTL A;  3C8Y A;  5D7G A;  1WYG A;  5I4D A;  3AM9 A;  2AQ1 B;  1PDX A;  4RH6 A;  3RPF C;  5JXV A;  2WDQ B;  3AEG B;  2IGG A;  4NAW B;  1IBX A;  2PLP A;  1UWX A;  3KLS X;  3IT4 B;  1J7A A;  2FE8 A;  3IAS 1;  1TS2 A;  2WXH A;  3KQ4 A;  2QIE B;  2WXQ A;  1KH0 A;  1MHH E;  2KWD A;  2WXN A;  2WXM A;  2PVG C;  2BT6 A;  2M56 B;  1K51 A;  1N61 A;  1ZP0 B;  4FXC A;  3BWU D;  4ZHO A;  1QOG A;  3NVV A;  1RM6 C;  2GRI A;  1XEE A;  2N9K A;  1FIQ A;  1SBB B;  3URY A;  1HXY D;  2AQ3 B;  3MP9 A;  1UNS A;  3EA6 A;  2IDY A;  1C9F A;  2X38 A;  1CK1 A;  4DXG A;  1SJE D;  3FIL A;  1L6U A;  1YQ3 B;  1SB3 C;  4KKI A;  1ZXH A;  3AEA B;  4RGN A;  3AE1 B;  3SR6 A;  3W5V B;  1JAL A;  1ESF A;  1FFU A;  1PUT A;  4YSX B;  4ZOH C;  4RGT A;  1JML A;  2E6X A;  1MI0 A;  1I7H A;  2MJ3 A;  3BII D;  2ZW1 A;  4REZ A;  4RNA A;  1AWD A;  3P1M A;  4N58 A;  3AE9 B;  2PW9 A;  1L4D B;  1EU4 A;  2L1A A;  1JWA D;  2Y5P A;  4HRO A;  4P6V F;  3U52 E;  1XF5 L;  1TZO A;  4GDL B;  1CJE A;  2ICI A;  2N9L A;  1FRD A;  2OHF A;  3MJ5 A;  1KLG D;  1SF0 A;  1P7F A;  2WU5 B;  3BYT B;  1YJI A;  3IT6 B;  1OQQ A;  4HKZ E;  1V8C A;  2LHE A;  4HJG E;  1M4V A;  4IOI E;  5FKA C;  1E9M A;  1FCL A;  1V1P B;  1FCC C;  2V4I B;  4KKJ A;  1TKE A;  1R7S A;  2WLB A;  2BB5 A;  1MVK A;  2RDG A;  1JWU D;  4TMA B;  1ACC A;  1JQ4 A;  1VLB A;  4YSZ B;  1WWT A;  5BMG A;  1RWS A;  1XO3 A;  3EGR A;  1V1O A;  3AEB B;  3PZ7 A;  1STE A;  3KWV A;  3PO0 A;  2QSD A;  3DWG C;  3TUO A;  3TEZ A;  3P4P B;  2E3T A;  3AE4 B;  4YXD B;  1NI3 A;  2L52 A;  4L23 A;  3B9J A;  1D4B A;  2WXO A;  2WU2 B;  5EE0 A;  3U4E G;  1ZPS A;  4O1N A;  3HVD A;  1ENF A;  4B0M A;  2QMT A;  3MC0 B;  4MAC A;  1BXT A;  3AE5 B;  1ET9 A;  2WP9 B;  1HZ6 A;  2WXL A;  1E0Z A;  4H2A A;  2VZK D;  2I38 A;  1SE2 A;  1C76 A;  1TS4 A;  2W3R A;  2GB1 A;  4JWU C;  1KFY B;  2TSS A;  1EWC A;  4A8X C;  1TKG A;  2J42 A;  1GPX A;  2J53 A;  4RFB A;  1SJH D;  2INP E;  4JX1 C;  1N62 A;  4KGS A;  1HZ5 A;  1D5X C;  4JPS A;  2M19 A;  4WIP A;  1D5Z C;  2JSV X;  1PYW D;  2V3N A;  1F0Z A;  3ZJV A;  4C80 A;  4IDI A;  2K22 A;  1JRO A;  1E6E B;  1QLB B;  2WXR A;  3AV8 A;  3ETR A;  1FD6 A;  1J7B A;  1HEZ E;  3U7Z A;  1A70 A;  1YN4 A;  3CWI A;  4TQ0 A;  5BMI A;  5BMH A;  2XNA C;  3W1S A;  2WXF A;  2IJ0 A;  1YQ4 B;  3BZD B;  4XWT A;  2LMC A;  2WXP A;  1ZXI A;  1DYQ A;  1B9R A;  2FUG 1;  1KF6 B;  1QOF A;  4EE2 A;  1XCQ L;  2BTE A;  4OZC A;  1T5X D;  3NRZ A;  3W5U B;  2H88 B;  4A9A A;  1FEH A;  3BVM A;  3IXS A;  3V05 A;  3BK2 A;  4CQN A;  1WXQ A;  1XLO A;  1ET6 A;  3ABV B;  3VR8 B;  1VJK A;  2IGD A;  1FXI A;  2K5P A;  1AN8 A;  2JX5 A;  5D3I B;  3T3O A;  2KQ4 X;  2B76 B;  1JW9 D;  4L1B A;  1IGD A;  3AEC B;  2D5G A;  2CJO A;  1SXT A;  2DWQ A;  5MPO A;  3MHZ A;  5HHD G;  2CJN A;  2M0A A;  2SEB D;  3AE8 B;  4C7Z A;  2WDR B;  5T8I A;  4ZHP A;  3NZ3 A;  2LJI A;  3SFD B;  1ZDV A;  1QT9 A;  4A6Q A;  1F2R C;  1TS5 A;  5BYR A;  2QEJ C;  2WQY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...