2XY6A

Crystal structure of a salicylic aldehyde basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
581
structure length
581
Chain Sequence
TAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 199
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy6A01
2BGWA 2NRTA 3TARA 2ATLA 3ZT0A 1KVBA 3ETLA 4CJQA 5CZ2A 3DRSA 4RT2A 3AO5A 1TAUA 5KG6A 2HVHA 2AQ0A 4ECRA 2R8JA 5C24A 2VG7A 4JRQA 3QLHA 2JGUA 1VRTA 4NLKA 5DKWA 5HHIA 3VQBA 1VSMA 2G8UA 4P4MA 2HNZA 2IAJA 4CK2A 4OKKA 3OYLA 2KZZA 3B0YA 3K75D 3AVLA 2BGGA 5J2KA 4I29A 3VQ7A 3BQ0A 1RILA 4DSLA 3MXMA 5JUMA 4QZHA 3L2QA 1W9HA 4LSLA 4PHPA 4I2GA 4CK3A 3VQ6A 3L2RA 3I8DA 4B9UA 1B9DA 3RR7A 1S77D 3T5JA 4CEEA 5I3UA 3LK9A 4OGEA 1RDAA 4B9SA 4CE9A 4KAZA 1HQEA 4YMMA 4J9LA 3EZ5A 2PYLA 1AROP 4EYIB 2PXIA 4CGDA 1RXWA 1WNSA 5F9NA 1RNHA 1U45A 4CF9A 3UIQA 2JZBB 3ORYA 3QZ7A 3MGHA 1JXEA 3F73A 5J2FA 1HQUA 2NRXA 4YFUA 3HXMA 3TAPA 4I2BA 5HRSA 3M9OB 4CGFA 3UXOA 2G8KA 4RG8A 1COOA 1NK5A 1KSPA 5IIOA 5J0WA 2D0AA 9ICCA 4ECXA 2D0BA 3SPYA 4KLDA 3P1GA 1XU4A 3RMDA 4FM2A 4GXJA 4K4GA 3SV4A 4HUGA 4EP5A 3NAEA 4ECZA 4GXIA 3HVRA 4CJ5A 4ECYA 3Q8PB 3AV9A 1S5JA 4DSEA 5FROA 3ZSQA 4CEZA 5C25A 5JS1A 5FDLA 3Q8MA 4DQPA 2FPMA 1RT5A 3O4NA 3SI8A 1LV5A 1RBSA 4CJSA 1J53A 1RTHA 3OYIA 5KG4A 4R8UB 1KVAA 4CHPA 3KLFA 4DSFA 4M9JA 4UAWA 1V9PA 4DL4A 8ICGA 4UQGA 4FLUA 3AO1A 1U48A 4DTOA 4KHSA 4NLNA 4DQQA 1KDHA 3SNNA 1ZQBA 1ZBHA 3Q8QB 3U3YA 3PUFA 8ICRA 3ISNC 9ICGA 1Q9YA 8ICKA 4O55A 3ZSOA 4G3IA 5D46A 5KT6A 4K4IA 1BPXA 4KLGA 3S3NA 3C6TA 5KG3A 5DK5A 4FJMA 4EBCA 4OPJA 4Q5VA 4B9LA 4IQWA 4YP3A 2VWJA 3RB0A 3OY9A 1HNIA 1KRPA 8ICEA 3JPQA 1EKEA 3MEDA 4UAZA 3RJIA 3T1AA 4DOAA 1KFSA 1WCLA 4QZ8A 4YR2A 7ICTA 3E01A 1S6PA 2IGIA 2Z1JA 4JWNA 4ELUA 3CM6A 4CIEA 4ED0A 2DFLA 1S1XA 1CEZA 3OYHA 3ZSWA 5KG2A 8ICIA 8ICYA 4B8CA 3DLKA 4IQUA 3MXIA 4KLLA 3VA3A 4FBUA 3WNFA 3BQ1A 4YFKA 3SV3A 4DWIA 7ICUA 2Q0ZX 5D49A 4DU3A 4M3UA 5IIIA 2DFFA 2ZJAA 4H4MA 4AHRA 4NM2A 4J9QA 5CA7A 3D0PA 8ICHA 5EWGA 1QSSA 3TAQA 4RW9A 3NGZA 2GWSA 2JLEA 3D45A 3LAKA 4B9MA 5JS2A 1N48A 3C94A 3QEBZ 4M3RA 8ICQA 4M3ZA 3SUQA 5DQGA 3LP3A 4CGHA 3NF7A 4J2BA 3EPGA 3SYZA 5J2CA 3KKSA 1A5VA 2G8IA 2ZUBA 3IHQB 4P4PA 3QINA 2BQ3A 3AUOA 3RMBA 4KKOA 4CJEA 1SZPA 4FYDA 2PYJA 2HNDA 4BE0A 1ZQIA 1ZQDA 1DTQA 1BCMA 2DPIA 3AA2A 5HRPA 4K8ZA 2P5OA 5KG0A 3RJHA 4LZGA 3VA0A 3NGIA 4J2EA 5K14A 2BANA 7ICEA 9ICQA 1HRHA 3C5GA 1RT2A 3ISCA 5KT3A 4ED6A 3ZT4A 1S9EA 4C8NA 4JUZA 4DFPA 3CQ8A 4CGIA 3BJYA 5HROA 3DYAA 1WSIA 1RDBA 1T03A 3IRXA 9ICUA 4F93B 4CEQA 7ICQA 5DB6A 4Y1DA 1N6QA 4HCCA 4UAYA 1TL1A 2O4IA 4NLGA 4KO0A 2ZE2A 2IOCA 4W5NA 3OHBA 1KCFA 1SKSA 4M42A 5J2QA 4QOZB 5CYQA 4XQ8A 4NCBA 2FLPA 2DY4A 3KHLA 4M9GA 5KFBA 3NH2A 1IG9A 9ICBA 4DL7A 1WSGA 4O5CA 1ASWA 3RAXA 4LZDA 1REVA 3H8JA 1TK5A 2FMQA 3TFRA 4HVJA 4Q8EA 2W8LA 4DF8A 2RDIA 4NXZA 3HK2A 4Z6CA 1RYRA 4MEXA 2YV0X 4Z4EA 4RQ7A 5DQIA 1K6YA 2YNGA 2VG6A 4FM0A 3HX0A 4O5EA 4C8LA 1U9LA 5J0TA 3V81A 1UAXA 1ZQZA 5CB1A 3QO9A 4DQIA 4FK4A 4J9OA 3E2EA 3VQPA 3JPTA 4RQ2A 1NKBA 1ZQFA 3AA4A 1JL2A 1ZQAA 1TKZA 3JSMA 3HPOA 4R5PA 3B6PA 4IQTA 4M3WA 1IKWA 4F91B 2V4RA 4LH5A 3S3OA 1TVRA 3VQ9A 1U04A 3AVGA 3G6VA 2NRZA 4KTWA 4F3TA 1BI4B 4BGDA 3JYTA 7ICFA 1Z26A 4FXDA 4M45A 2OZSA 1LB2B 1WN7A 3C2KA 3DI6A 4OJRA 4ID1A 3BGRA 2IHMA 3L2VA 5J2PA 1RPLA 3PW0A 1D8LA 4JV2A 3RBEA 1TK8A 2FLLA 3NFAA 3KK2A 2A1JA 4C8OA 4FK0A 4MF8A 2I9GA 2VA8A 4QAGA 1ASVA 4CHYA 5EWFA 3C95A 4I2JA 3KD5E 3PO5A 1ZQUA 1JXBA 1QE1A 1RBTA 1KEJA 2R8HA 4EYHB 3ZSXA 4DU4A 3GIIA 9ICVA 1ZQSA 3NCIA 1XI1A 2KZ3A 3EYZA 3K58A 4UBCA 3DRRA 2AQ4A 3LZJA 3CFPA 4MFAA 2WTFA 1BPEA 3DLGA 3DRPA 3LP1A 4IFVA 3OJUA 1BISA 4M47A 3JPNA 3G6YA 1BHLA 3OGUA 3QEVA 3LANA 8ICXA 4IKFA 1WSJA 2IS3A 4DTRA 5KFGA 3NDKA 4ED2A 3M9NB 2W9CA 3GDXA 3B0XA 3TQ1A 2UVVA 3K5OA 4R63A 1QSYA 3RH4A 4G1QA 5HMLA 3OS1A 1XWLA 3JPRA 3OSNA 1SKRA 2C2EA 1U47A 4CF0A 4GMJB 2W8KA 2P6UA 3RJEA 2KQ2A 4RW8A 4QZDA 4Q44A 4TQSA 4HUFA 4Z4IA 2ZJ5A 2VA2A 3ZSVA 5IIKA 5I42A 4JS5A 1S97A 7ICSA 4TSXA 8ICAA 2YKMA 4FJNA 2EHGA 4CERA 2FPKA 3V7LA 4CJFA 1YTUA 4YCXA 3G10A 1ZQQA 4KB1A 4AH9A 2XY8A 3OJSA 4DOCA 4JWMA 9ICRA 4RNMA 3ISBA 1TAQA 5J2AA 5DDYA 4KLMA 1ZQMA 3O4QA 3T19A 3OYJA 2OZMA 3G6XA 1S1TA 1YTAA 2G8WA 4FJ8A 1QTMA 1B22A 3IS9A 4TUSA 5J0PA 4F8RA 1HJRA 3K2PA 4DF4A 1NK0A 4RQ1A 3QESA 3Q8LA 4BWMA 4OKEA 1XHZA 3TAMA 3IAYA 1ZJNA 5EU7A 2QK9A 3M8PA 5KFXA 1JLBA 4N76A 1D5AA 5HRRA 2XC9A 2RDJA 3RJFA 2X74A 1T05A 1C7YA 4FJXA 2V9WA 2NRVA 3AO4A 5J0UA 1VRUA 3DLEA 4KN7A 4X5VA 4E7LA 4YXJA 1NJZA 5KFOA 2P1JA 3AVNA 4OVLA 3C1ZA 4I2AA 3SUPA 1VSIA 4KTQA 2PI4A 5L1IA 1MU2A 4ZTFA 1D9FA 2HHWA 4KLSA 1VSFA 4CJLA 4KREA 2DTUA 4DO9A 3MAQA 5KFZA 4ECTA 4J2DA 4BDPA 2AGPA 4E19A 2A1RA 3EW9A 4CF1A 1L5UA 4Z6FA 4RQ0A 3KIOA 4M6WB 2RF2A 3K59A 7ICGA 3VQEA 3MR6A 5J29A 4ZTJA 3C21A 1O1WA 3LWMA 2UVRA 3FFIA 1C0MA 4M6WA 2PFNA 3HL8A 4FS2A 3NE6A 2Z1GA 4FJHA 7ICJA 2IC3A 8ICVA 4NLZA 4DL6A 2WONA 3V6KA 1T4GA 3TWHA 1TVAA 4CEOA 1IKYA 3QETA 1NJWA 4ED8A 3MFIA 4NM1A 4O44A 1Y88A 5HMMA 1RDCA 4F4YA 3RJKA 3K5NA 3RRGA 3PY8A 4Q0BA 1UA0A 2J6SA 4FW1A 5DDMA 3VQAA 3OVNA 3FDSA 5TZVA 2YHAA 4N5SA 4C8MA 2JZBA 1DOQA 2AGOA 4R64A 3PW4A 4O4GA 3TFSA 1NOYA 1MC8A 4IG3A 4PPXA 3K5LA 3AA3A 4DS5A 1TKXA 4O3PA 4QZFA 2HHVA 5DQHA 2XY6A 4GW6A 4J9MA 5DB7A 1ZBFA 2C28A 4UB1A 4F50A 3B6OA 3NGYA 3TAEA 3ITHA 3BQ2A 3KLGA 3V9SA 4ZHRA 3CFRA 3LP0A 4DTPA 4IBNA 2HHQA 2P6RA 3AA5X 4DQRA 5SWMA 3KHHA 5T7BA 3GILA 1KLNA 4CJWA 5J2GA 3V72A 5J1EA 4YR3A 1WSFA 3K57A 3MECA 2D5RA 1NJXA 3H4BA 2KFZA 4PGQA 4CFCA 3OYMA 4YD1A 5J0SA 5KG1A 1Z25A 2VA3A 3V1OA 5KFYA 1K1QA 9ICKA 4R8UA 2YHBA 5J2NA 4HHTA 4PHAA 4M3XA 1ITGA 3GIMA 1FKPA 2Z1HA 4KI4A 4KMUA 3QNOA 4O3QA 1X9SA 4RQ4A 2VWKA 4ID5A 4E7HA 3RMCA 4FO6A 4RQ5A 7ICHA 4IR1A 1ZYQA 3TR8A 2BCQA 4JV1A 3RRHA 2AGQA 1RT7A 3OYNA 3H8WA 2JEJA 9ICIA 5KFVA 4M9LA 1ZQLA 3WNGA 4ZH4A 4IQVA 4JS4A 2FBYA 3HSTB 2MUTB 7ICLA 2W9MA 4PGYA 1U4BA 3CM5A 3ZSYA 1S6QA 3C2MA 4F92B 1QHTA 4JLHA 1EX4A 2FBXA 2A1SA 3ZDBA 4F5NA 4YD2A 4MQ3A 5DG8A 4DG1A 4FM1A 2OPPA 1C6VA 3PR4A 1LW0A 4H4OA 1HJPA 4EBDA 4O0IA 4PHDA 5FRMA 2W9BB 3BQTA 5KG7A 4ED3A 4FJIA 2BCUA 4UB5A 1CXUA 5IILA 4CIGA 3SCXA 2G8VA 4N47A 3RMAA 4JV0A 4BWJA 3KLHA 4B3OA 2Z1IA 2X6NA 1C1BA 1BCOA 3GV5B 2NRWA 4P4OA 4CJPA 4MFFA 4QZIA 2J6TA 3ASMA 4NYNA 3PMNA 2ITGA 3IG1A 2OPRA 3SUNA 2ZTCA 1B9FA 2FBTA 4FLZA 3VQQA 3MABA 5J2DA 3JPPA 2I5JA 4IFYA 5L1KA 1RCHA 4DTMA 1IXRA 2HVIA 5CWRA 4Q43A 5KFQA 4M3YA 3TANA 1UOCA 3KLIA 5KFEA 1KTQA 3HW8A 1T8EA 1ASUA 1RT4A 2F96A 2QKBA 4PY5A 4J9SA 1KFTA 3PW5A 3P83D 1JLGA 2FMSA 3QEIA 4DL3A 3H4DA 4J9NA 2JEGA 7ICNA 3A2FA 1A5WA 4M04A 1S1VA 5J2MA 4HTUA 4J9RA 5KRSA 1X1PA 1ZQOA 3V7JA 1SUQA 3QIOA 3QZ8A 3QEXA 1ZQTA 5J2IA 4IRCA 4L8RB 3V1RA 3VQ5A 3ZDAA 4YMOA 2FBVA 3HPGA 4FVMA 3NHGA 4LH4A 3K5MA 1CZBA 1MQ2A 4I2DA 5KFUA 3ZD8A 4KHYA 5IIMA 4KLTA 2DFHA 5KFLA 4FCYA 2ZQBA 3AVBA 1BPBA 2LSNA 1CUKA 3MGIA 2HHSA 4CGGA 8ICOA 1IM4A 4FJ9A 4LVSA 1S1UA 4CJ3A 4B9VA 2XRIA 3FYHA 1C1AA 2PFQA 1FXXA 4DTNA 4I7FA 1Q9XA 3UQ2A 2LYHA 1L3VA 4I2FA 1JLCA 3PR5B 4AHVA 5KFAA 4YN4A 4DL2A 2B6AA 4O5BA 2FMPA 1RTJA 2EX3A 4CF8A 4RQ8A 4CEBA 5DBBA 4Z4HA 4E7KA 1QQCA 3ZDEA 2BCVA 4I2HA 3V9XA 4WE1A 1WLJA 3RAQA 4LD0A 4E89A 4CHNA 2R8IA 5CP2A 3C2LA 4EBEA 5DGAA 3OYKA 2YNFA 4RW7A 1IKVA 4E3SA 3RB4A 3O3HA 4FLXA 4FLWA 4CECA 2ASLA 1BIUA 3LALA 2KTQA 2JEIA 4B8AB 5DG7A 4BACA 3SQ0A 4QCLA 1SV5A 2UVUA 4K8XA 1S1WA 5J0YA 1EXNA 1S10A 2IHNA 5HP1A 1WAFA 3HP9A 3EY1A 3PMLA 1Z00B 3PNCA 4E7IA 2X78A 2WOMA 8ICWA 4RPYA 1BI4A 4F3OA 1BPDA 3OHAA 1RZTA 4UBBA 4CIFA 1RT6A 4KHWA 1B43A 1UT8A 4F2SA 3OYBA 2B4JA 4KTZA 4DFMA 2XHBA 4PWDA 4FJ5A 4KHUA 5KFPA 4DU1A 3ISDA 3HPHA 1S0OA 5DB9A 5KFSA 5BOLA 3ZD9A 4Q8FA 9ICPA 1HMVA 4AHCA 4NCGA 3QNNA 4F5PA 1XHXA 2QXFA 1WCNA 4H8KA 1JIHA 5KGWA 3S9HA 4W5OA 3P5JA 3QEAZ 1Q8IA 2FPLA 5J2JA 1R0AA 1C1CA 8ICJA 3L3UA 1S9GA 4I2CA 1CLQA 4PHEA 3LDSA 1SL2A 1VK0A 1JXLA 4PA1A 5L9XA 4ECVA 3KLEA 3MR2A 5DGBA 2P66A 3HJFA 2E6LA 3MFHA 1A76A 2BPFA 4DLEA 5IINA 4CESA 4CJTA 3M8QA 3CFOA 5KFJA 3I0RA 3V1QA 4KFBA 1A5XA 4IRKA 3PX4A 2IA6A 1CZ9A 1BL3A 4KLUA 4Z6DA 4QZCA 4QWDA 4ED1A 3ZT2A 2ZTDA 1S0VA 4NCAA 5D3GA 5J2BA 5CYMA 4JRPA 2FC0A 3OS2A 2C22A 4J9KA 1J5OA 2OA8A 1YVUA 4Q45A 2MAXA 4OPKA 4O3NA 5L1LA 1C0TA 2BQRA 2GUIA 2D0CA 3T5HA 3VQ4A 4GLXA 2R8KA 1B92A 4F4ZA 5C42A 3ULDA 4GXKA 3AVCA 3HVTA 4DTXA 4N41A 4E7JA 9ICWA 4ELTA 2KW4A 2G8FA 3MDCA 3V6JA 4FS1A 1EXQA 4EZ6A 4DOBA 5L1JA 1TK0A 2ZJ8A 4E0DA 2XCPA 4DFKA 5HHHA 1C0UA 3MDAA 5D4BA 2BE2A 5FRNA 1L3UA 3PVXA 4CHZA 3V4IA 4MEYA 1NK4A 4QZAA 2P51A 1CXQA 1N56A 8ICBA 2PFPA 2R7YA 4DEZA 4OKJA 5KFRA 3VQCA 2XY7A 4TUPA 3ZDCA 5DLGA 3QEPA 3GIKA 2BKEA 1JN3A 5J2HA 3RTVA 7ICKA 1RBRA 4Z4GA 8ICSA 5KTQA 1HYZA 2O4GA 2H5XA 5CHGA 4LY7A 4YMNA 4O5KA 5EWEA 9ICXA 5KT4A 3OYAA 3JPOA 4KLFA 4KI6A 4PUOA 2ZTEA 4I9LA 2AJQA 5C5JA 4RNOA 3V7KA 4DQSA 1S0MA 2XGPA 2KZMA 4TURA 4YXMA 4ELVA 3DM2A 4CCHA 4ED7A 4FZZA 2PZSA 4DTUA 1MSWD 4ECWA 4AILC 1HYSA 2ISPA 4QZGA 9ICEA 1T3NA 3SQ1A 3MR3A 4O3SA 3M9MB 2HMIA 4I27A 1DLOA 1PZNA 7ICMA 4FLYA 5BOMA 4CHQA 2JEFA 2VG5A 4YNQA 1A77A 1WAJA 3HP6A 3OSPA 1X9WA 4FLVA 4M0AA 1NOMA 1VSKA 3OYCA 9ICFA 1XSLA 3CYMA 4RPXA 3LDAA 1S76D 4CF2A 3U6FA 4C8KA 4FZYA 1UA1A 5KFHA 3ZT1A 4KHNA 4KLOA 3O3FA 3GV8B 3OYGA 3KHGA 4FW2A 1SL0A 4KRFA 4GC7A 3UXPA 5KG5A 3QERA 2XY5A 4GVMA 1JLFA 4QWEA 4CEDA 5HBMA 4KN4A 3KK1A 7ICRA 2ZD1A 4W5TA 2HHTA 4TUQA 1JKHA 2KN7A 3SQ4A 4CEAA 8ICLA 4QW9A 4F5RA 2NUBA 4RZRA 3RR8A 3NH0A 3V6DA 4IRDA 2ZUDA 4BE2A 2BPGA 4RW4A 4J9PA 5DLFA 1JLQA 3LPTA 2M9NA 3SQ2A 4KV8A 3RJGA 4YQWA 1TL3A 4CGJA 3OYFA 4O9MA 3K4GA 3AO3A 3U3GA 4XRHA 3Q8RB 4P2HA 8ICUA 1XS9D 4F4WA 4CEFA 1NKEA 3EPIA 1VSEA 3OS0A 4QWCA 3H7IA 2OPSA 3C5FA 2BPCA 1RT1A 4EP4A 1NK8A 4CJKA 4NYFA 4XUSA 2Y1IA 4XIUA 4RW6A 2XO7A 3NF6A 3O3GA 1X9MA 4BE1A 1VSJA 4YR0A 1X2IA 2FLNA 3HYFA 1ZQGA 1HUZA 2HW3A 1ZQEA 9ICHA 4F5QA 2F1JA 3AU2A 4MFCA 3KKRA 2X6SA 4XA5A 5DMRA 4HCBA 1BQMA 2W42A 4I2QA 4M41A 1D9DA 3QEWA 3V9WA 2HB5A 4OGCA 4UB4A 3PO4A 3JPSA 2XCAA 3M8SA 5J0OA 9ICNA 1EP4A 1ZBIA 3HO1A 4QW8A 3HT3A 2BHNA 1ZQHA 3T5KA 2IDOA 2PY5A 2MUTA 4KHQA 3HWTA 1N5YA 1JLAA 4O3OA 1ZQCA 1BGXT 4EZ9A 1I39A 9ICMA 3AVMA 2J6UA 3AO2A 4MFBA 2RPIA 1UT5A 2ASDA 5KFMA 1BVSA 4CFBA 7ICIA 2B5JA 5J0RA 3SUOA 3TI0A 3VQDA 4DSKA 2W9BA 4LSNA 1D8YA 5BPCA 2KFNA 3AVAA 5IIJA 4ECQA 1HNVA 2BCRA 3N4MB 3Q8SB 4IR9A 3I0SA 3GQCA 5HRNA 3L3VA 1BPYA 1QSLA 1NK9A 1JMSA 4RUAA 4CJRA 1GOAA 2F8TA 4KLIA 2UVWA 4M2YA 3DLRA 2ETJA 2BCSA 4JK1A 1RBVA 3H08A 8ICMA 4UB3A 3NH1A 1F21A 4F4XA 3TABA 1LWCA 4RQ6A 3ALYA 4BDZA 2C2RA 1LW2A 3RH6A 3T3FA 1LAVA 3SZ2A 3UXNA 4FK2A 4ICLA 7ICPA 1LWEA 4RU9A 4ECSA 4FLTA 1QS4A 1XC9A 2R8GA 4CFDA 1HUOA 3DOKA 4Z4CA 4F2RA 1JX4A 1I3AA 8ICNA 4FBTA 3NF9A 3KK3A 4B08A 1IH7A 4DS4A 1EETA 2RKIA 4PQUA 4QZEA 1T7PA 4CHOA 3C1YA 8ICFA 9ICJA 3H40A 2Q3SA 3AVIA 4RT3A 3RB6A 4BDYA 4FJGA 1TV6A 3TAGA 1NK7A 5E41A 4KITB 3DLBA 1XSPA 9ICOA 4Y1CA 3MBYA 1UWBA 3AVJA 4DTJA 5F9LA 1ZQKA 4N56A 1GOCA 4CFAA 3C23A 3VQ8A 2F8SA 3PX6A 4E1NA 4O0JA 5KFNA 3LP2A 4CJUA 3LWLA 4J2AA 8ICCA 1NOZA 5KGXA 5J0QA 3NTUA 5KFKA 3KTQA 4M3TA 3ZSZA 5J2EA 3NGDA 3BDPA 2XGQA 1XO1A 1ZQJA 3MEEA 1SKWA 5CZ1A 5DB8A 5KI6A 3V6HA 4KPYA 4RPZA 4ECUA 3ZCMA 4GC6A 2IMWP 5KFDA 4I2EA 2BQUA 1JLEA 4M9NA 1TV9A 3WNEA 3OYDA 9ICAA 3KHRA 5KFIA 4KLEA 3VN5A 1NK6A 1FKOA 2Y1JA 2F1HA 2YNHA 4E1MA 2ATQA 3GV7B 4K4HA 3AVFA 1ZQWA 4Z4FA 4CK1A 1L3TA 1VSLA 5KT5A 1RTDA 1ZQVA 4AHSA 3LPUA 4QWBA 2F1IA 4DTSA 2ZUCA 3MR5A 2VANA 2ALZA 3SI6A 4BXOB 2P5GA 1RYSA 4W5RA 2HHXA 3AVHA 2ISOA 2HHUA 1KLMA 3ZSRA 4FJJA 5SZTA 3RJJA 2V4QA 4QZ9A 3RWUA 4FJLA 3V9ZA 4BXOA 5KRTA 5KFTA 3AU6A 4Z6EA 5KFCA 3AVKA 3CG7A 5CY4A 4QZBA 3RH5A 1FK9A 4FZXC 3T5LA 3LAMA 3WNHA 1ZQPA 4Z0UA 1ZQYA 1Z00A 3PW7A 4I28A 3F9KA 2PI5A 3DLHA 1RTIA 1RXVA 1LAWA 1Z3EB 1YT3A 5HNKA 2E4LA 2A1JB 4EEYA 2E6MA 4AHTA 3HM9A 1QLNA 2DFEA 3NBPA 1U49A 4UB2A 3OYEA 3TAFA 1K1SA 3S3MA 3UQ0A 4IDKA 3DMJA 1VSDA 4CJ4A 3KJVA 4DFJA 3KD1E 3MEGA 5KT2A 1W0HA 4DMNA 2G8HA 3IM1A 2PFOA 4HYKA 3SJJA 2RN2A 5HLFA 2QKKA 3THVA 2OWOA 4AHUA 2DPJA 4OLBA 5KT7A 4F5OA 3RB3A 5KFWA 8ICTA 9ICLA 2OYQA 4YVZA 3ZDDA 2W9CB 1IKXA 3GIJA 1LWFA 3UPQA 1XSNA 4QWAA 4KLJA 3RBDA 3L2UA 1TFRA 1ZQRA 4F4KA 9ICTA 4I2IA 4I9QA 4B9TA 3QIPA 1G15A 4DSIA 1RT3A 3H8SA 1S0NA 1WSHA 4MF2A 3MXJA 5CR0A 4RUCA 4RQ3A 4M9HA 1KFDA 1RDDA 4FJKA 7ICOA 1HPZA 1H38A 1ZETA 3N97B 1ZQXA 2B21A 8ICZA 3QE9Y 3DOLA 4NY8A 1ZBUA 1Y97A 1WSEA 1DTTA 2OPQA 3GFKB 1MQ3A 3L8BA 1IO2A 2ASJA 1ZJMA 1L3SA 3ZT3A 5DBCA 4IG0A 5DG9A 2GBZA 3V9UA 7ICVA 4KLQA 4YG2A 4KB0A 1TGOA 1NJYA 2HNYA 3C6UA 1GOBA 1BPZA 3EWAA 3G0ZA 8ICPA 1TKTA 4HUEA 4PH5A 5EOZA 1J9AA 3SPZA 3L2WA 4W5QA 4R66A 3M8RA 1VSHA 3NF8A 2YKNA 1ZBLA 3Q8KA 5HP4A 5KFFA 1ZQNA 1S9FA 4FJ7A 3PW2A 2BR0A 4KLHA 1HYVA 1DGSA 5DBAA 4RNNA 1NKCA 1BIZA 4DL5A 2AU0A 4TQRA 1TKDA 4DSJA 4R65A 5J0XA 1BQNA 3PV8A 2BDPA 4I2PA 4PGXA 2C2DA 2I1QA 9ICSA 2YNIA 1J54A 1KVCA 1JL1A 4OLAA 5CJ7A 3LZIA 1RBUA 2GV9A 4B9NA 4O3RA 4CJVA 2IBKA 1SL1A 4DLGA 3PX0A 2W9AA
chains in the Genus database with same CATH superfamily
1YVNA 3TARA 1VRTB 4WQ4C 1DY3A 4J37A 4URGA 3R2DJ 4C1NI 4NOHA 2YWWA 3P39A 2CRXA 2ZKUA 2VG7A 4JRQA 3NRBA 4DCPB 1VRTA 1F9FA 4NLKA 2A2DA 3VQBA 2N4CA 1S57A 2GGPA 4CK2A 2ROPA 3C46A 1RWOB 4L3KA 4DU8A 3U9ZA 2W3SA 2CPJA 3VQ7A 2QGFB 5GADU 1NSPA 2D9PA 5AI9A 3VGTA 2LI6A 2XHWA 3L2RA 3FCHA 3RR7A 4IKAA 1IKYB 2ZH9A 1F0XA 3I6PA 2NXEA 3LK9A 1HI0P 4O44B 4OGEA 2J8AA 2RQ5A 4YMMA 1AROP 1HD1A 1H2UX 1N62A 4OYXA 2DNKA 4CGDA 3TEGA 5EX3A 1U6FA 4PXEA 3W66A 1RNHA 3M4XA 4UUXA 2F7TA 3MGHA 5C15A 2ZWPA 5J2FA 2F8HA 4IG3B 2P9IB 4I2BA 1U7LA 2C42A 2BBEA 3CMQA 4W98A 1NK5A 4Y28C 1VISA 5J0WA 4C8YA 1VQON 1VI7A 2HBMA 1IWAA 1WOPA 4ECXA 2KN4A 3NVYA 3QJLA 3P1GA 2OMOA 2CZVC 3KLGB 3ULHA 4P10A 4M95A 5AT1B 4OV1A 3IDWA 3OR1A 2EAPA 1FO4A 4CJ5A 3O9TA 1S5JA 3M1VB 2ZHBA 3CCUN 5C25A 5JS1A 1BXNA 2FPMA 1RT5A 2GEMA 4CJSA 1RBSA 2ZIUB 3IWLA 2QIFA 1X4DA 1XR7A 3CMAN 2FI1A 2WSEC 1NGGA 4GIBA 3LGHA 1CSJA 4TLQA 2QEXS 4FLUA 5ALZA 1FRMA 1U48A 2BJEA 2O1PA 4NLNA 4DR3J 1RE1B 2FHOB 3E51A 3SNNA 3TADA 2MKYA 1ZBHA 3BS5B 3WEEB 1M5KC 3MN5A 1Q9YA 2CQHA 4ANEA 4DR3K 1ATSA 3ZSOA 3C65A 3W62A 5KT6A 4K4IA 1BC6A 5KG3A 2B9YA 4FJMA 4EBCA 3BBBA 3DXKA 4YP3A 2OPPB 2VWJA 4H4OB 3MMJA 1HNIA 1KRPA 2KRRA 1D4XA 2PN6A 1WG8A 2XWXA 5L46A 3Q22A 4YHHF 2GX8A 2JR5A 3QYYA 3DAWA 1K0TA 2QTWA 3ZX3A 4ED4A 3J7Z5 4CIEA 2L48A 2QWPA 3SSSA 2OPRB 2AP6A 4B8CA 4PWUA 1JNRB 5ALSA 1Z4NA 3G82B 3JAMU 5IFMA 4HLBA 4AUKA 3PNIA 4YFKA 1ZRMA 1Y00A 4RW9B 7ICUA 4P2SA 5D49A 5HJYA 4M3UA 5IIIA 3Q24A 2ZJAA 4N8NA 2ILZA 1FRLA 4WYWA 2BXJA 3G82A 5RUBA 1ZTWA 3PXGa 4OYOA 8ICHA 3VERA 4DV6J 4RW9A 3NGZA 2FJBB 5DZ6A 3VALA 3HZGA 3QEBZ 1KP6A 2DNNA 1JLGB 4FL9A 3DJCA 2IOHA 2V51B 2VC1A 4DV6K 3NF7A 1X4HA 3NCRA 3EPGA 5ALDA 3KKSA 4H54A 3IHQB 2BQ3A 5J2MB 4KKOA 3TU5A 1WOSA 1YITS 4FYDA 1S7HA 4NA3A 4CO2A 2ZOMA 1SUQB 3O1WA 4P7TA 2P5OA 2G06A 5KG0A 3RJHA 2R2TA 2J76E 2BANA 1HRHA 3FZ2A 3ISCA 4PL2A 2J0WA 3GFHA 4MK8A 2IMOA 3BJYA 2P6TA 2XS7A 1FRXA 3EE9A 4CLZA 3US5A 4JI6F 4PZNA 3EWGA 7ICQA 1EQMA 4P0PB 4DB3A 6FD1A 4HCCA 3NS6A 3S8SA 1V4TA 1N5QA 3TO8A 2IVMA 2O4IA 1T9XA 1RWPB 4W5NA 1Z1ZA 1KCFA 1SKSA 5CZVA 2EEYA 4QOZB 4I7FB 4NCBA 3A5MC 5KFBA 4DR7F 4WU3A 3PACA 4CLTA 7FD1A 4UZBA 4DL7A 1WSGA 3JQJA 3CJQA 4FYXB 1ASWA 2HGMA 4AXIA 1KWMA 3PYFA 1LK5A 2UUCF 3I32A 2CQ1A 1RTJB 4GKKF 1I94J 3IR7B 5EE9A 2PSZA 1DRZA 2YV0X 5DQIA 4P0QB 2KO1A 5GAHI 3ZI4A 4M7YA 2YNGA 2VG6A 3AARA 4O5EA 2MXYA 3M6KA 4JKAA 2NZTA 1ZQZA 3W63A 3QO9A 1XNRJ 2QMUB 4FF2A 1IKWB 5TKYA 2JVOA 1U24A 3N7PD 2JWNA 3CSKA 5ETKA 4WTYA 5IOLA 4ZCIA 3CE8A 3AA4A 1XNRK 4RUBA 3GONA 3B6PA 1VDVA 4F91B 1IKWA 2RQ4A 3S3OA 2QLWA 5IM0B 1U04A 2JMGA 3AVGA 1M1GA 2DT9A 1FFGB 5J1NA 1BI4B 5H9EJ 3QSIA 3H25A 1K9MT 1TP7A 3JYTA 2P9NB 7ICFA 4FXDA 4TU8A 3QB0A 1WUAA 2YH0A 5H9EK 4PWDB 4X84A 2HBQB 2XLJA 3BGRA 2IHMA 2KEYA 2CZ9A 2W25A 4DV1F 5DS7A 1D8LA 2N1RA 3M2VA 3A0IX 4BRKA 1ZS6A 3NFAA 5H1SQ 3AGKA 4MK7A 3N0VA 2VA8A 4NWIA 1YIJS 1FFWB 2FF6A 3HRDD 4QIVA 1XK8A 5BPNA 3ZZYA 5KOWA 1RBTA 1KEJA 4JI7F 4EYHB 2MZ1A 1YKWA 2H9ZA 3QGPA 2E1ZA 1Q53A 1C1CB 3O4WA 3ILLA 3GIIA 1ZQSA 1Y64A 3MDQA 3BSCA 3NCIA 3EYZA 3D28A 3K58A 1Y11A 1A0OB 4Z7YA 4OZ2A 3BSOA 3KDOA 4X4QA 3OJUA 3WX4A 1KD1O 3J80U 3T1YJ 1BHLA 2DWQA 4WXOA 1VFJA 4IKFA 1WSJA 3UD5A 1A6LA 5AQPA 2HSTA 3NDKA 3J81j 3D68A 4FWOA 3TSPA 3T1YK 1V9OA 2W9CA 3GDXA 3TQ1A 2GQCA 3ILOA 3RH4A 5HMLA 3OS1A 1XWLA 2F44A 5D4LA 2HMXA 4H5RA 2EZXA 2C2EA 1U47A 4CLFA 4RW8A 4QIGA 4QZDA 2L5YA 5AI4A 3R8YA 2OHDA 3OTDA 1C0TB 3ZSVA 5IIKA 3G8QA 3QGGA 3ZTQA 1S97A 2LBOA 4MIWA 1L7NA 2V69A 2WB1D 4A8KA 1DKGD 1YJ9N 2ASPA 2CPHA 1VYAA 2BMBA 2UXCJ 3MM8A 2AW0A 2FPKA 2XNRA 3DWLA 1XR5A 3G10A 3C15A 2Z56B 5IT4A 5D4PA 2XY8A 2DY9A 3DOMB 5E5NA 4NZ6A 3IRWP 3T19A 2OZMA 3IO1A 4XK8C 4C7QA 1NGAA 2WAQD 5KPZA 1YTAA 3M7DA 1N34J 2G8WA 1RK8A 2UUAF 3SAFA 1QTMA 2FJAB 1B22A 1IR2A 3IS9A 3CP8A 4XDDA 5J0PA 2KXNB 4F8RA 3QFWA 3QGHA 3NMAA 1N34K 2OEKA 3Q8LA 4ANCA 1XHZA 2DXDA 1NUEA 2LM1A 5AZJB 3WXMB 1VQNS 3UDCA 3H3OB 1NWKA 1FXDA 3T1HJ 1JLBA 2LCWA 4F3QA 4CJ7A 3TR5A 2XC9A 5JJBA 5C2GA 1M6YA 2RDJA 1FX4A 5HI7A 1T05A 4LQ3A 3T1HK 1M1KO 3NKYA 1W2BM 1ROFA 5K9FA 3W0LA 1QDUB 4ZITA 4E7LA 1R43A 4YXJA 2RLTA 5KFOA 5JXSA 1UAWA 4OYZA 3CCTA 4KJIA 4U7UD 1APSA 1X66A 4DPXA 5L1IA 1MU2A 5HN0A 1D9FA 1I1GA 4KLSA 3R5AA 4CJLA 4MO5A 5KFZA 4ECTA 3EGVA 3SCJE 2XYGB 4OLOA 4Y2MA 4BDPA 1RUSA 4AF1A 4CZCA 4Z6FA 4RNFA 5JMNA 3M6WA 1BNOA 3IBWA 4JOUA 1UCVA 4M6WB 2IVFB 1HX1A 7ICGA 1BWVA 2F8LA 3W9JA 3C21A 3LWMA 4PCQA 3PEJA 2UVRA 2BJ7A 3EUB2 3FFIA 3P5TL 2LYAA 4M6WA 2PFNA 1WTBA 2FHJA 4P74A 3CI5A 4DL6A 2WONA 1LWXA 4ED8A 3ULEB 4NEYA 3QUCA 3KWIA 4P75A 5HBMB 4JI0J 3P49B 3PY8A 3LF0A 1JKHB 4Q0BA 1UA0A 2Q0RA 2UXDJ 5DDMA 3VQAA 3CJAA 2FYXA 2J0XA 4RO0A 4JI0K 3FDSA 4Y2VA 2YHAA 2FVSA 2E5JA 2JZBA 5EHHA 2OM6A 4WCEQ 3PW4A 4O4GA 3TFSA 2UXDK 1HNXJ 5AFUH 4BRQA 4PPXA 1LNQA 2W54A 3AA3A 1TL3B 2M2BA 4DS5A 4QZFA 2HQCA 5DQHA 1C4CA 4ES2A 2X3GA 1CC7A 1K47A 3B6OA 3NGYA 3JAMY 4DV7J 3CFRA 3LP0A 5CHCB 2LQ8A 5AQXA 4M5NA 3TZZA 2P6RA 4K0KJ 2XZWA 2VFUA 4ILGB 4TYAA 1RGVA 2WTUA 4B1ZA 4L72B 3GILA 1NGHA 4L74A 1KLNA 4RW6B 5ETSA 5J1EA 3DU6A 3L7PA 4YR3A 4K0KK 1WJ9A 2CPXA 1S72S 1VBKA 1FKPB 2WVEA 1V85A 3H4BA 3JB9k 4K4XA 2JC1A 2WVDA 4YD1A 1K8KA 1ZM9A 3V1OA 2Q66A 5KFYA 5ETNA 4R8UA 2YHBA 3KNGA 4PHAA 2KVIA 3R5GA 2IOFA 2DRAA 1FKPA 2OFGX 4KI4A 4I2QB 3QNOA 1NB2A 1CLFA 4E7HA 2E8MA 2MQPA 5AQUA 7ICHA 4IR1A 4PXDA 3TR8A 2O67A 5KFVA 4M9LA 5ADZA 4JS4A 2OAUA 5DDPC 1HIYA 2FBYA 4GY2B 1FXLA 7ICLA 2CNLB 1CJUB 4DR3F 2W9MA 2JH1A 3CM5A 3NGSA 5AIAA 4F92B 1TYQA 1EX4A 2V4JB 2A1SA 1X4BA 4GO5X 3ZDBA 5L9NA 4F5NA 4YD2A 3D0HE 4MQ3A 1UZHA 5AQNA 3N4PA 3N7RC 1C6VA 1Q95G 1CS4B 2LXUA 4LSNB 5KG7A 4ED3A 3K8WA 2HK3A 2BCUA 2P9LB 4V19S 4UB5A 2G8VA 4N47A 4X64J 3RMAA 4K2XA 3KLHA 3IG1B 4B3OA 2Z1IA 3I0SB 4Y2SA 2XI3A 2P5VA 4DU7A 2ZWOA 2V2KA 4P4OA 1RDRA 2J6TA 2ITGA 2IJFA 3IG1A 4NRUA 1KXPA 1KS2A 3CJ5A 1OH8A 3W65A 2GJ2A 2ZBCA 5L1KA 4TN2A 1E6VB 1LWEB 4JAXA 3KBBA 1V3RA 2B56A 1VAZA 1RFQA 2QL5B 3J81U 5AQMA 2GW8A 5AK5A 1T8EA 2GIFA 1RT4A 2F96A 2CNKB 2P9KA 1MA9B 1EWQA 1D09B 2VF3A 2JHEA 1KN6A 5M1NA 2MZRA 5GADP 3KK3B 1Q18A 1KAYA 3L7OA 2W7PA 1O6XA 3AY0A 4DV6F 2RKIB 3QEIA 3HHKA 4MK9A 4U7BA 2D3DA 1E6YA 3D2WA 4Y2UA 4JN4A 3H4DA 1AUSL 4J9NA 2P9GA 5KAIU 1S1VA 4HTUA 4DI6A 3AT1B 3V7JA 1C0GA 2M88A 3L3CA 4ED5A 5AQZA 5AQIA 5A0YB 2VFRA 3VESA 4DX8H 3ZDAA 3MI7X 1U2RA 1JXVA 2JVRA 4I2DA 4J8FA 3BYRA 4LF4J 2B0GA 4WJBA 4KHYA 4L75A 2R3VA 2DFHA 4KAIA 4CYUA 4WFBQ 2ZQBA 5FJ4A 1BPBA 4EI2A 3HHNB 4EENA 3PIPL 3AQOA 3MMCB 2FJDB 2FZGB 3MGIA 1RG6A 3IG8A 2LQBA 4LF4K 2FHJD 1IM4A 5IT0A 1S1UA 2XEXA 1K44A 4Y6IA 2K2PA 4ZK7M 2BE9B 2DH8A 1NZ8A 1F44A 2PFQA 4DL0C 2B6AB 2WFAA 1KC8T 2LYHA 2JHDA 3MDFA 2DUYA 2IRXA 3CJCA 1IM6A 3H8MA 3GSIA 4U96A 4RX6A 2YQ3A 5E26A 4YN4A 3VEVA 1UVMA 4KIAA 3KJQB 2B6AA 2EFPA 3J80Y 1RTDB 1JCEA 4RQ8A 4I6AA 4TU9A 3V9XA 1GQEA 4QR1A 5I3QA 4K2JA 4P73A 5E3CA 4CHNA 4CO3A 5CP2A 3VC8A 5B0FA 2LEAA 4Q7AA 1Y5IB 1YJUA 2ILYA 4LT6A 2HKEA 1GX6A 5DM6Q 4FLXA 1XNRF 2ASLA 4XAKA 2JEIA 4HI2A 3M2RB 3WK4A 2M0GB 3A4TA 2E5LJ 5AM2A 3UCGA 2QKQA 4ATNA 1Z00B 2YPYA 2NSCA 4F02A 1RTIB 1RABB 4CTAA 2YWHA 3OHAA 1RZTA 3M32A 5HQLA 4KHWA 1UT8A 4USMA 1BHNA 2EZZA 2HLTA 1BG3A 4DFMA 4KTZA 2XHBA 3ISZA 1LKZA 4FJ5A 4KHUA 2DITA 3PJ9A 4DU1A 2HURA 3L6QA 4A46A 2UP1A 3ZD9A 2GO7A 3CW2C 3KJVB 3QNNA 2J4RA 2LU2A 2HWIA 1WCNA 4TKTA 3E58A 4US9A 5LJVA 2QJ3A 4W5OA 4MTPA 2FGOA 1NNDA 1S9GA 5E33A 4IO9Q 2B9XA 1HNWK 3EVMA 1FESA 3A5NC 3LDSA 1LWFB 9ATCB 1M0SA 4ECVA 3MR2A 3M1FA 2CZ4A 2JGAA 3MFHA 5H2FU 4DDFA 4CESA 5IINA 5KFJA 1H2VZ 1A5XA 1HJOA 2KOBA 3T1YF 5M2PA 2KRBA 3MMAA 4EIAA 3GB0A 4Z6DA 2R2RA 4QWDA 3M05A 2NZCA 4ED1A 1X7VA 3MAHA 6AT1B 1EKSA 1S0VA 4NCAA 3IM8A 3NGUA 1DTTB 1PSDA 2C22A 4J9KA 4HWIA 1N0UA 3OHRA 5C2CA 5L1LA 2KP7A 2UYTA 1B0XA 3THWB 2OSQA 3VQ4A 2DGXA 3U1NA 4AL7A 1B92A 3ULDA 2CJYB 2PEHA 5BRDA 1VBZA 3CCJN 2VD3A 3HVTA 4DTXA 2HK2A 1HBMB 9ICWA 2XSJB 4TY9A 4EZ6A 2PA3A 2YKOA 1S7IA 5L1JA 5AXNA 2ZJ8A 4E0DA 5AZIA 1RBLA 4C9DA 4DFKA 3MDAA 1CQNA 1VOMA 4CLWA 2OTJS 3O08A 4BREA 4FZVA 2E5GA 2FC9A 1ZXIA 2PFPA 5KFRA 5K8OA 2RS8A 1HD0A 2ZC4A 5DM7L 5ALHA 4GV9A 2MSTA 2YNIB 3DGVA 3QEPA 5DLGA 3WC0A 3S41A 3M2UB 1JN3A 3DDIA 4PR6A 1HNZJ 2JXJA 4PQAA 2DTJA 2VJVA 4OX8A 1C0FA 1T9VA 4JYAK 1HNZK 1C4AA 1CVJA 2HVZA 2OEMA 3OBWA 1EQYA 5EWEA 2ZH6A 9ICXA 4MH8A 5KT4A 3OYAA 1Y5NB 1Q5VA 2ZTEA 1HUXA 2JL9A 3V7KA 1S0MA 4TURA 1SBRA 1F2GA 3LGNA 4ELVA 4CCHA 2ZITA 2HZAA 3KJFB 4PPZA 2VGMA 4C1NK 4ECWA 4AILC 2KD1A 2BX6A 3D0GE 3MR3A 4O3SA 3M9MB 5ETRA 5FP0A 8AT1B 2GHPA 3W5ZA 2NREA 2JEFA 5IV4A 1A77A 4B17A 5AICA 4LSLB 2QYCA 1WAJA 3MGVA 3ZNUA 4IOCQ 4F04B 4RQMA 3OYCA 9ICFA 3D2FB 3K0JA 2EWHA 4C8KA 1LQ9A 2IDEA 5KFHA 3A5LC 2GOLA 4X4VA 1SL0A 1RDUA 4KRFA 1Q8KA 5A2QO 3UXPA 1Q86T 2XY5A 4LUBA 4GVMA 4CRXA 2DEIA 4OIXA 2BJ1A 5BRFA 4B3RK 1UFLA 5F8IA 2ZD1A 2ZIVA 8ATCB 4CEAA 4KV8B 4LFCJ 1R27B 4MDBA 1TAMA 3RR8A 3N5FA 4YB6A 1U2CA 4IRDA 4OLPA 2H5IB 1FXRA 4LFCK 2M9NA 4ZVOB 4KV8A 2YMPA 4ZMMA 1D8ZA 1ZH5A 1WORA 2BW7A 2ZHOA 3VVUA 4CGJA 3FE1A 3K4GA 3H46O 3AO3A 2MZTA 3VQSA 4X66J 1XS9D 4OI1A 2HHHJ 4F4WA 1NKEA 3EPIA 5LMNJ 3CCQN 4ACOA 4QWCA 4BG8A 1RAIB 3H0MB 4K4YA 2BPCA 1RT1A 4NLQA 4X66K 2HHHK 3B8AX 5AK6A 2A42A 5LY3A 5LMNK 4PYDA 1YBTA 2HBZB 3J81Y 2XWYA 4XIUA 3O3GA 3CDWA 4BE1A 1VSJA 4YR0A 2FLNA 2CH6A 2ZIWB 2O01C 2O8FB 2JFKA 4O23A 3ZC4A 1M5VC 1ZBSA 2CN1A 1NSKL 3DDKA 2F1JA 2AIRB 1QQ7A 1OY6A 3AU2A 5BYQA 2WF6A 4FZMA 5D78A 2UUBJ 2DHAA 2ZKTA 4ZVEA 3ID8A 2FHKA 2ZIWA 1BQMA 2O8CA 2WBMA 3QEWA 3C6TB 2HB5A 1WWHA 2SXLA 3SBMA 1GLDG 4UB4A 2HF4A 3JPSA 2XCAA 2UUBK 1H6KX 1EP4A 1T3VA 3HO1A 1I6JA 4QW8A 4ZDNA 5AM5A 4KHQA 4USJC 2HGLA 2JC0A 2HRYA 4FF3A 1I39A 3TUJC 2VPXB 3WXJA 3AO2A 2JWKA 2RPIA 1UT5A 2WF8A 1BVSA 2MHNA 2R7UA 7ICIA 1XMOF 4UB6U 4LRBA 5B0AA 5AM1A 3FC4A 3ZTOA 4FWKA 2MQNA 1YSJA 1YJNS 2XICA 3MTKA 2W9BA 1S1XB 3SBTA 2MYFA 1RHUB 2BE7D 2KFNA 5EN1A 5LM7E 3AVAA 5IIJA 1HNVA 3C19A 4QS9A 3WKEA 4WXWA 2QYGA 4RUAA 4CJRA 3JSBA 4HHJA 2F8TA 4JI3F 2F7VA 2N4DA 2GWJA 1M90T 4JK1A 4J9VA 4C2MA 1U2VB 4F4XA 4BLGA 1LWCA 4RQ6A 2XMUA 4IH7A 5IV3A 3ALYA 4BDZA 3RH6A 2C2NA 2E88A 1X3MA 3BH6B 1G7CB 2ZOGA 2DF4B 1QS4A 2H1YA 2R8GA 5LOQA 2R7OA 1HUOA 2GMHA 2MU2A 2X1FA 4PQUB 2FTRA 3F5AA 1ATNA 4QYRA 1P1TA 8ICNA 4FBTA 1GT8A 1DTQB 4DS4A 1RAJA 4PQUA 2LYVA 1K0VA 4P6QA 1I5OB 2JLGA 3GSDA 2ZM6J 1GLAG 4CHOA 1EAYC 3C0BA 1IQTA 2HBJA 2QLTA 8ICFA 2GHWA 3NEKA 3SEIA 2AYGA 2CWXA 4LF9F 3VAIA 2Q3SA 4OI4A 3AVIA 4RT3A 3NNHA 2ZM6K 1HHSA 1WWUA 5HROB 3DYAB 2YH1A 1RHKB 4M5GA 3DLBA 9ICOA 2QL7B 1T03B 4Y1CA 3R6MA 2NUHA 3A12A 1UWBA 1P1LA 2BJ9A 4DTJA 5F9LA 5JVHQ 2IRYA 4DV5J 5U47A 1GOCA 4CFAA 3C23A 3CCWA 3VQ8A 3PX6A 4JK7A 2Q6CA 1TL1B 3J7A1 3LP2A 1Y4ZB 3ENWA 3Q23A 4EAHD 4DV5K 4PWWA 4JKBA 3ISND 3LWLA 4KO0B 2FDRA 2UUWA 8ICCA 1OPZA 1RZMA 1O03A 4LF4F 2PA8D 5J0QA 4N7TA 2G4BA 3KTQA 4M3TA 2QZ8A 1LXJA 1AZSA 2W04A 5J2EA 2K06A 2MZQA 1XO1A 1RHQB 3MEEA 2YJEA 5CZ1A 3V6HA 2AYBA 3QDKA 3CJ7A 4UATA 4FKXA 4BC9A 3D6JA 4GC6A 2D6FC 2IMWP 1TV9A 3T41A 2C1EB 1CZAN 2MY8A 2YWGA 2LFVA 9ICAA 2A18A 1RWMB 3TSUA 3J8AA 2F1HA 4B02A 2A3ZA 4E1MA 4K4HA 3CC4N 4USUA 2LQ9A 3BR8A 2WB1C 3CPWR 1HBNB 2EKNA 3NASA 5ITHA 1R6YA 2RE1A 2CGLA 2R42A 1QVFM 2HFVA 2ZUCA 1TKZB 4QS7A 2ALZA 4U95A 3K1ZA 1TL7B 3O5BA 5D4OA 4W5RA 4JKHA 4BRMA 3H20A 4A8EA 3TTDA 2ISOA 3GG4A 3ZSRA 5SZTA 1ILYA 2WAQC 3RJJA 2V4QA 2DGTA 4OJHA 4QZ9A 3J7YI 4JV5F 4FJLA 3CJRA 3K8VA 2GIRA 3NMRA 1X31C 2GJFA 3O2IA 1NGJA 3UO0A 4QIWC 3KWMA 2QWNA 1FK9A 3T5LA 3MUMP 1ZQPA 3MPVA 2D0PA 2VFVA 2CXEA 3F9KA 2GAGC 1U6ZA 2W2QP 2E4LA 1FD8A 4IDKB 3THPA 4FF1A 4YY3J 2E6MA 3HM9A 2DFEA 2I7NA 3N4QA 2K4PA 2HDOA 4UB2A 3OYEA 5B7WA 2ZJRL 1QE1B 1JCGA 4YY3K 3D2EA 4IDKA 1R8CA 3DMJA 1VSDA 3OVBA 4CJ4A 5ALIA 3LDOA 1WC5A 3P4IA 1W0HA 2QFIA 2QLFB 3IM1A 2PFOA 4HYKA 3DLGB 3DGPB 2W1BA 3I5CA 1HR0F 1Q79A 4IC9A 1R89A 3WQUA 2OWOA 5E3RA 4AHUA 4OJ6A 1XERA 4OFZA 3BEXA 1G6BA 3MM7B 1HNWF 5KFWA 4ZVTB 1RT3B 2HZVA 3WXKA 5JVGQ 3AQFA 3ZTSA 5IC4B 3H5XA 1IKXA 2CQ0A 3GIJA 2RHKA 3QU4A 2V52B 4QWAA 3H98A 4KLJA 3W9HA 3RBDA 2FB0A 4G1QB 1TFRA 4F4KA 4Z37A 2BZFA 1JNZB 3QIPA 4DSIA 4NXMJ 1RT3A 4HL9A 4GMKA 3H7HB 2EG2A 4MF2A 3SMVA 1QZ6A 3UKRB 5GMKa 3MMBA 4P9SA 4NXMK 4FOIA 1REGX 2Y0SC 1NLVA 1J5EJ 2OTLS 1ZETA 1H38A 3N97B 5G0RB 3U4LA 1ZQXA 4A61A 2B21A 1SCJB 2YX8A 2HIQA 2KHQA 2DKZA 3EXCX 4QR2A 2EK6A 5LL6d 4KH6A 3UMBA 1LK7A 2YKMB 1J5EK 2WRMA 1CRXA 1SH3A 3AHPA 2K7KA 4UOFA 1IG6A 1WB9A 1IO2A 1BA1A 4LRCA 1ZJMA 1K9MO 3ZT3A 2IM0A 3WK5A 7ICVA 1PJ7A 3ET6A 3RYLA 5ADXA 2MMYA 2YQEA 1NJYA 2GVDB 3I5AA 2YX6A 3EO3A 3C28A 1GXUA 3SEOA 2DNYA 8ICPA 2XMVA 1VQYA 3VR1A 3M30B 4PH5A 3FQLA 3SPZA 1DQ9A 4ERDA 2NO5A 4R66A 3VEYA 3R1XA 2YKNA 2MB0B 3BF1A 4NLRA 1IR1A 4Y00A 1Z4UA 4DPUA 3TTCA 4DCHA 4A2BA 1ZQNA 2MSSA 1EWRA 1T02A 2AJ2A 1PBAA 1HYVA 2VHGA 1BIZA 1EARA 4R65A 2CPIA 2ZC3A 4PGXA 2DGOA 1LVHA 5ALKA 1J54A 1JL1A 3CB4A 1VRUB 2GV9A 4BR5A 4O3RA 1RAGB 2Q31A 4JYAF 2MQLA 3ENOA 3AH6A 2E8PA 4FNHA 1DARA 1X3NA 4NXNJ 1W7AA 5CZ2A 3BYPA 2KXFA 3AO5A 4ECRA 2R8JA 5C24A 4NXNK 2JGUA 1SXEA 3DEEA 2IRUA 5DKWA 3KUGA 5CCLA 2WB1F 1QJHA 2RF2B 1KQSM 1R0CB 2AZ3A 1VSMA 3UI3A 2G8UA 4DHVA 2HNZA 2NSBA 3HSZA 4CZLA 3OYLA 3LPYA 2KZZA 2AKWB 2W41A 2BGGA 5KL8B 3CCSN 3I5BA 1W26A 5J2KA 2VASA 4I29A 3T7ZA 5I3UB 2OMLA 5EGYA 2H5JB 4QZHA 1HQEB 3ENBA 4CK3A 2WAQF 3VQ6A 8RUCA 3I8DA 1Z05A 2N7YA 3T5JA 5I3UA 1CJVA 3AGRA 3EZOA 2ALYB 1HQEA 3CC7S 3MWTA 4ZPBA 1ZQ1C 4J9LA 3EZ5A 1HQUB 4AL6A 4EYIB 3OFEA 2PXIA 1X9JA 1RXWA 3TNVA 2EW9A 4CF9A 3ORYA 3ENHA 4HH0A 5BRHA 2LDYA 1HQUA 2HSZA 3PZPA 4B3RF 3TAPA 5HRSA 1MWZA 3UXOA 1FI4A 1F2HA 2G8KA 1S48A 4RG8A 1FCAA 2DR6A 5HL7Q 2O66A 9ICCA 3HFKA 3UDEA 3WKAA 3KZIU 4TNOA 2DL0A 3SPYA 4LFCF 2G0AA 4FM2A 3ZETB 1CPZA 4Z94A 1OY9A 1YF5L 3NAEA 4ECYA 3BS7A 3Q8PB 4DSEA 4JI5J 3ZSQA 4AYBC 3F2DA 4JHDB 5FDLA 3Q8MA 4QIEA 3MECB 4M5DB 4DQPA 1MWYA 3Q0AA 4DPTA 4JI5K 3O4NA 4X66F 3OLAA 2HHHF 3SI8A 5KPRA 2OCEA 2MKJA 5LMNF 1RTHA 4MIAA 1KVAA 4I6WA 4A47A 2QT7A 4CHPA 3GE1A 4IFEA 3KLFA 1VQKN 4M9JA 1WEXA 3L9ZA 2QA1A 5C7PA 1DEJA 4ZIWA 2DIVA 4KHSA 2HBRB 5FLXU 3D54A 2VH7A 2DNZA 3HI9A 1KDHA 2VZ9A 3W2VB 2DO4A 1ZQBA 1S5ZA 3Q8QB 4ZA1A 3U3YA 4R0JA 3QT5A 4NLDA 5AM4A 8ICKA 1S6QB 3R7SB 4O55A 3IKMA 2MPUA 4G3IA 1YK9A 3O9SA 2ZXHA 2UUBF 1E4GT 5DK5A 2K8AA 4DG1B 4OPJA 4B9LA 4IQWA 4X65J 1LW0B 1T95A 3SMSA 2CJAA 5KOXA 1S6PB 4LQ9A 3OY9A 8ICEA 2B43A 1EKEA 3MEDA 2XMMA 3LDLA 3I55S 4ISGA 3GMGA 4M63A 4DOAA 4X65K 3NAIA 4QZ8A 4YR2A 3FKBA 1X0PA 3E01A 1ECWA 1S6PA 2IGIA 2QSFA 4ZJQA 3CM6A 3MN6A 4ED0A 3LUYA 1OVYA 1RAHB 1CEZA 3U8XA 3OYHA 3ZSWA 5KG2A 2A3VA 1TFWA 5J8YA 4KLLA 5F41A 4FBUA 2I5JB 3G25A 3D1OA 1B7FA 3PLAA 5MLCV 4FZLA 1UJ6A 5IWAJ 2MHEA 4AHRA 4NM2A 4J9QA 1WC0A 3D0PA 1QSSA 2YJFA 3TAQA 5HO4A 5IWAK 1RP5A 3D45A 1IJJA 1N48A 3C94A 8ICQA 3PM9A 1WDTA 2PFDA 5DQGA 5J2CA 2FQQB 4Y2AA 1A5VA 2I7PA 2VV5A 1PK1B 3R8EA 3C3LA 3RMBA 1TUYA 3AN1A 1SZPA 2QM1A 1FJCA 2PYJA 4BE0A 1ZQDA 1S9EB 3NNAA 1RWNB 3AA2A 4O8KA 4UY8O 4ZCKA 1B7YB 1R3NA 1TU0B 3NWGA 4MKAA 3C5GA 2B4UA 4JB8B 2QTDA 4ED6A 5ALGA 1S9EA 4ZKAA 2FSKA 4DFPA 1VK3A 3HOTA 5ETVA 4DOZA 1N6QB 5ALXA 1JK9B 2XTJP 9ICUA 5IT9O 3QUBA 5AIBA 3N4WA 3NVKA 3G87A 3G71N 5AKGA 1NZAA 1ZM3A 5DB6A 3ZZUA 1MN8A 5F0XA 1CQMA 2XULA 1N6QA 4UAYA 2ZUAA 3F56A 4H0TB 4WJ3B 4B1VA 4RKUC 4NLGA 3MURP 3AAQA 1PYOB 2EANA 5AJ3F 5J2QA 1KL9A 5CYQA 2DY4A 2FVRA 1SJ4P 1PBUA 1IG9A 3AXMA 2QB0B 2H51B 5AKHA 4LZDA 1TK5A 1JJ4A 3TFRA 3R6LB 5B0EA 2W8LA 4NXZA 1RYRA 4WE1B 1YITN 3QBXA 3UVJA 4LMZA 4P72A 3QU2A 4HVZA 3HX0A 2PMZC 1JJ2R 4G9ZA 1U9LA 5AKZA 2YNFB 3V81A 4PKHA 1RHJB 5CB1A 2J0SD 4UW9A 4FK4A 4J9OA 3VQPA 3JPTA 1TVRB 5D0HA 1UVJA 2F40A 1NKBA 1RJJA 4C98A 5CABA 1JL2A 3K89A 1MMDA 1N36J 3JSMA 3HPOA 1SV5B 2DCLA 4BR0A 1N5WA 4R5PA 4IQTA 1BMQB 4XPEA 5KAFU 2MQ8A 3H59A 1GLJO 1TVRA 3HFZB 3DHXA 3VQ9A 4M5JA 5ETQA 4CBUA 2W4CA 2WSFC 2WOMB 3MZIA 3CJ8A 4IQXA 4JI1J 2OEHA 4F3TA 4B1YB 4BGDA 4CIOA 4NWBA 1RT6B 1NJIT 2RD5C 2OZSA 1LB2B 3TZYA 3C2KA 4JI1K 1NGBA 5F1XA 1VC0A 4KX5A 5LT5A 4OJRA 3QWUA 1MG7A 2H3GX 2F4VF 3LGMA 1RADB 2DNOA 4K5SA 5J2PA 3PW0A 1HMVB 1RHRB 3GFYA 9RUBA 4NCGB 4IWVA 4JV2A 3RBEA 2HS4A 3KK2A 4TY8B 4FK0A 4WKYA 4CHYA 2ZBRA 4I2JA 3KD5E 1B64A 3H3NO 2L9DA 1YZ6A 1JMTA 2DR9A 4PJ0U 4CNYA 5T14A 2R8HA 2YB4A 4DU4A 1R0AB 2CAJA 1MWKA 1KC8O 9ICVA 2O8EA 2KZ3A 4IO1A 3DRRA 3CFPA 1N33J 2WTFA 2VONA 3DRPA 1LOUA 3LP1A 1Q7LB 2QA4S 1BISA 3KZBA 2AT1B 2KJVA 3QEVA 3M8QB 1N33K 3OL9A 8ICXA 3I0RB 1F3VA 1HBOA 4NZ7A 3WKDA 1UJ5A 4UOGA 4NYOA 4DTRA 5KFGA 1L3KA 4ED2A 3WUHA 3P5BP 4IZ9A 1WHXA 3MM5B 3GP9A 1NGDA 2LKZA 3K5OA 4R63A 1V38A 3HKZD 1ULRA 1U0SA 3GE9A 3C14A 1Z1VA 1J5OB 1NZBA 3D6RA 2HQFA 4RBUA 4CF0A 3MM5A 2W8KA 2CUYA 3RJEA 1KDNA 2Y9UA 4NXMF 4Q44A 1RI7A 3AOAA 4TQSA 4YOEA 1IXKA 4X62J 2ZJ5A 3Q83A 1QZ5A 2VA2A 1NMEB 3S6EA 3U9DA 3NAHA 4LIRA 4OHXA 5F3TA 7ICSA 4X62K 1KVIA 3NRWA 1LKYA 2P9SA 2NS1B 2EHGA 1YIJN 4CERA 1TFYA 1FF2A 4CJFA 2JRZA 3VQTA 4YCXA 1YTUA 3O80A 3QMQA 3IBFB 1NHVA 2LQJA 4IOXA 2V8DA 2CH5A 3Q8VA 2B7BB 5HVGA 4OJLA 4KLMA 1ZQMA 3B9JA 4BRLA 3V4IB 3O4QA 3BO4A 2YQ0A 1BD6A 3TAMB 3R5BA 4FJ8A 3ZNJ1 6FDRA 4UQTA 4OHYA 4KGXB 3TVYA 4Y34A 3KUEA 4DF4A 4RQ1A 4KGMA 2YHWA 4CD1A 4BWMA 5ALOA 4DPYA 2R4FA 3TAMA 5A8KA 4CD3A 2W24A 1ZJNA 2DNGA 2OELA 5EU7A 3M8PA 3FZHA 5KFXA 3KFWX 5AQQA 5F8MA 3SQGA 4N76A 2GWKA 1D5AA 5AQHA 5HRRA 2HBYB 2K89A 2RT3A 4L6V3 2UXBJ 3CXCR 3RJFA 4Y2JA 2X74A 1C7YA 3UCZP 1Y7PA 2V9WA 2E1FA 2E7WA 5J0UA 1X0FA 3AO4A 2UXBK 4C48A 3DM2B 2XIDA 2P1JA 3HSJA 1VQOS 3AVNA 4OVLA 3C1ZA 3WHIA 2JZ5A 3SUPA 2DD8S 2I38A 4KTQA 3R7NB 3IWNC 1HYSB 3LTOA 4DO9A 3MAQA 2N3OA 2HMIB 4WFAL 1SZHA 2CNOB 3QBWA 2Y1RI 3PSPA 1SC1B 2DGSA 4RQ0A 1NGFA 3CCUS 5CZXA 4C23A 1AA1B 3MM9B 1HEKA 1HL6A 4UASA 5J29A 2R2UA 2VYPA 2MJNA 1WC1A 1RQLA 1C0MA 3EUNA 2HBLA 1V97A 1N5SA 3CMAS 4BGBA 4CO5A 4FJHA 7ICJA 2IC3A 2A3JA 4IOAL 4CZEA 2HWTA 3OFGA 3KMSA 3TWHA 2PGCA 1JLFB 2ZFHA 4D3GA 4RLEA 1K8AT 4LF2A 3H5YA 3CIPA 1NJWA 2KT2A 1FERA 3DCAA 3MFIA 4NM1A 2X1AA 3ENAA 1Y88A 5HMMA 3TZWA 1RDCA 4F4YA 3RJKA 5CD4A 2J7UA 1WDDA 3KK1B 3RRGA 3OL6A 3CJTA 2V34A 1F0MA 1WKKA 1TZ0A 4BC5A 2E2NA 3OVNA 2B8PA 3MEKA 4LRAA 3R1HA 5DDOC 4JEPA 1FWLA 1TKXB 3V6DB 4CP5A 2PEBA 3V4MA 3JTOA 3AAWB 1NOYA 1FDNA 3K5LA 1KW4A 3OTCA 2E1YA 4L76A 4ZHRB 1SH2A 3F2BA 3KG1A 1TKXA 2HHVA 2XY6A 4QPTA 3B8HA 5B0GA 2PMWA 3N6NA 3VF0B 3F5TA 2C28A 1ZXOA 2DRBA 3ITHA 3V9SA 4ZHRA 4P2MA 2OD4A 3WIVA 5HMXA 4BUGA 2EI5A 2BUPA 1PC4A 2R18A 3KHHA 2GMLA 3M3ZA 3V72A 5FPMA 3OUYB 4K41A 4HT7A 3K57A 4LF7J 3SSQA 3BP8A 3M5RA 2VQFF 4JD2B 1ELOA 4CFCA 2OSRA 1HFEL 5G5GA 2DGZA 4CI0B 4LF7K 1Z25A 5GAGI 5E84A 1K1QA 5J2NA 3TX8A 1ITGA 1KTVA 2ODGA 4OI2A 4O3QA 4ID5A 2VWKA 5HANA 4RQ5A 4DR1K 4C97A 1ZYQA 2G13A 4DUYJ 4LF5J 1DGJA 3H8WA 2JEJA 9ICIA 5F0UA 4LR9A 3MOJB 2L41A 4ZH4A 3WNGA 1WHVA 4ILLA 1R0BG 3HSTB 2MUTB 2R7RA 1JLAB 1XMBA 4LF5K 5BYRA 4O3MA 5HQMA 2A40A 1QHTA 4JLHA 4MFBB 2FBXA 3UKUB 2N7CA 2IYIA 2OANA 4A8OA 1NI3A 3CDEA 5DG8A 2NNWA 2B5JB 4O0IA 3C8YA 5B0DA 3QU9A 5IILA 3SCXA 2BW2A 2DISA 5AQKA 2GLEA 2B51A 4Y0FA 3VMFB 2I0XA 2VPWB 4DCCA 2KFYA 3I9V9 4HTIA 2XO6A 2RRAA 1N0VC 3GZFA 4IFYB 2VODA 1S72N 4QZIA 1FD2A 1YRUA 1TUUA 4KBOA 5BN8A 3KKFA 2MTLA 2KJ8A 1B9FA 5J2DA 1F9HA 1H7XA 1LW2B 3JPPA 4KR0B 3OV7A 4IFYA 4ICLB 2OP5A 1V6HA 5HMYA 2HVIA 2VBXA 3GYGA 4LF1A 5FIIA 4Q43A 4OHWA 3QRPA 3R2CJ 5IWAF 3B78A 1X4FA 2F76X 1ASUA 4JKEA 3DFEA 2QKBA 2J9DE 2Z2MA 3NNCA 4J9SA 4WFZA 3P83D 1EETB 4A57A 3P45B 3Q8YA 1IBMF 2GH1A 5AI5A 1DFDA 1VQSA 7ICNA 1XQIA 4C0BA 1A5WA 2F2AB 3O3LA 1QCKA 5AQWA 1B0VA 2BM0A 1X1PA 3TTFA 1ZQOA 1SWVA 2ZH4A 2WB4A 2LHTA 3MCAB 1UHUA 5J2IA 4F9OA 4IRCA 4L8RB 2E5IA 3HPGA 4K8RA 4FVMA 3CF5Q 3C7NB 3T6BA 2ROEA 3K5MA 4I6MA 3NOCA 2FSNA 4CM0A 3K9JA 3G86A 3DXMA 2FJXA 1R8BA 1FWPA 4KLTA 3I8BA 5KFLA 1U1MA 3AVBA 1U09A 2LSNA 4HT5A 5K8NA 3C7NA 1SI9A 4JI8J 3BB5A 3H0PA 2KH9A 2OFHX 2EFOA 4NI2B 8ICOA 4KHPJ 4JI8K 4FJ9A 1PYSB 4LVSA 2R7QA 3M8YA 4CJ3A 3JXUA 4B9VA 2QE5A 2EAOA 2BM1A 1HHQA 1FXXA 5HSPA 4KHPK 3UQ2A 2Z57B 3CGIA 1M90O 4H0YB 3CQXA 2ZHAA 2VOOA 2OJ3A 1JLCA 3PR5B 2YNHB 2C3OA 5KFAA 1J97A 4OV6A 4FPBA 3SD7A 4ZLJA 3VCBA 5ETOA 3U7JA 2CJKA 2EX3A 4CF8A 3CD6N 2ZIXB 4CEBA 4FE3A 1QQCA 3ZDEA 2BCVA 2F8MA 1GH8A 5AM0A 3RAQA 3EVOA 4LD0A 2HRTA 5EVZA 4EBEA 3OYKA 2CA9A 1UFWA 3O9UA 4RW7A 1HI8A 2ZIXA 2NXUA 1IKVA 2QMXA 4FLWA 2EFVA 4CECA 4HTJA 1BIUA 3LALA 3SR6A 3TW0A 5DG7A 3HHLD 3O1LA 1S1WA 5B0CA 1EXNA 3POTA 5HP1A 1WAFA 4DV0F 3HP9A 3CCZA 3GYNA 4A59A 2X78A 3LYSA 3PFEA 4LSZB 5BREA 5BXIA 1BPDA 2YKPA 1G1XA 2NV3A 3R5DA 4UBBA 3SQIA 3QPIA 4CIFA 3OYBA 2W03A 4JI1F 1Q3VA 2CQ3A 2D7SA 5IS2A 3OFFA 9ICPA 1WKJA 4NLUA 4AHCA 2KL8A 1PVPA 4MN4C 3RGIA 1U1LA 2KK0A 2RHSB 4H8KA 1CJKB 5EE1A 4UW2A 3S9HA 4ZCLA 3UE5A 2L9NA 1FDBA 8ICJA 3L3UA 4U67Q 3EE3A 2GO8A 3GR1A 3TVKA 4EFHA 1SL2A 3VOVA 2LEPA 2F8EX 3KLEA 2NLXA 4WQ4A 4C0HA 2E6LA 1N33F 4CJTA 3CFOA 4HACB 4KFBA 1TUGB 4WTOB 3G4SN 4OZ0A 4E8UA 5J1PA 2IA6A 1B99A 3R9KA 5H9FJ 1CZ9A 1HPZB 4KLUA 3BREA 4QZCA 1NZPA 3VETA 1MA7A 2VCPA 4HDGA 3BM7A 2ZTDA 5H9FK 3A3OB 1EIYB 5D3GA 2A41A 3OS2A 4LRDA 2MAXA 4IG0B 1ED1A 1RKIA 5CA5A 2BQRA 3QWPA 3X3UA 5HR6A 3T5HA 4X62F 3IR5B 5F8HA 4NPOA 3AVCA 2RMLA 4N41A 1YVFA 1C0UB 3R6GB 4ZN1A 1HBUA 3D67A 2KW4A 2G8FA 1NBWA 1EXQA 3ED5A 1VK8A 1GMVA 1TK0A 2DNHA 2J9DA 1C0UA 2B4VA 4WIIA 2BE2A 3B82A 2VQEJ 2Y8WA 2OHFA 4X4PA 4ICAA 2HF3A 4CHZA 1ZD3A 4MEYA 5AQGA 2R7WA 4NLSA 3MHYA 4QZAA 1E4FT 1VS3A 1CXQA 2VQEK 3BKTA 3VGSA 2YY3A 1BQNB 1WSVA 3VQCA 4I2PB 3OTQA 3TQEA 2XY7A 1RKJA 1WI6A 2YQ1A 2BKEA 3F44A 5J2HA 5D8HB 3SDEB 3GPAA 3UN5A 4BRGA 4Z4GA 5KTQA 2O4GA 3HVWA 2RSQA 3NS7B 5TISU 3MAAA 3G96A 5CHGA 2KV2A 3ETOA 4H5WA 3WXIA 2DJWA 2QV6A 4JI2J 1U1NA 3CCVN 4KI6A 4PUOA 3R3TA 4K42A 2AJQA 4RNOA 2VG7B 3VV2B 2XGPA 3C6AA 5EX5A 4YXMA 5D0GA 1DLOB 3G6EN 4ED7A 3VAMA 4JI2K 4C0OC 4DTUA 1MSWD 3QIDA 2GGPB 3UPFA 2HLUA 4QZGA 9ICEA 1T3NA 4OJ5A 4BR7A 3JTPA 2DR5A 3OR2A 1DLOA 4C8ZA 2F9TA 1PZNA 7ICMA 1T9YA 4FWSA 2CYYA 2WVFA 4CHQA 1OWXA 2AYEA 1F5AA 2E9TA 4ZPAA 1FHTA 3OXFA 1GEHA 3QT6A 3FBFA 2E2OA 4DR6J 4FLVA 2NQPA 2JX2A 2KHVA 4RPXA 4WKRA 4CF2A 4A5BA 4DR6K 4FZYA 3ZT1A 2P9UB 3CRXA 4KLOA 1SQEA 2AYMA 1RA6A 2ZVIA 5T7LB 5A8RB 3O3FA 4FW2A 4GC7A 3DDNA 3AXKA 1UP1A 1BQXA 4EHTA 4QWEA 2P9UA 5A8RA 5T7LA 2KVCA 1VQ7N 7ICRA 4W5TA 4TUQA 2FJ6A 2MKCA 2MGZB 2KN7A 8ICLA 3K17A 2V6AA 1OH6A 3FGUA 2CQDA 1S12A 3PRBA 2NUBA 3VENA 1QM9A 3NH0A 2P9PB 3AAPA 4RW4A 1KQFB 5DLFA 1HWLA 1JLQA 2ASOA 2MGZA 3LPTA 3OR1B 3ID6A 1SIZA 3EDQB 4H0VB 4CQ1A 1NHKL 1G4CA 3CDAA 3KKAC 2OPSB 2P9PA 3U3GA 3Q8RB 3QFPA 4P2HA 5C25B 4X4SA 8ICUA 3RF9A 4U7CA 4CEFA 1BLUA 2UU9F 3OVSA 2QWRA 3NP5A 3OS0A 5HMWA 1RT5B 1QD1A 2G1DA 3H7IA 2ZJQQ 2G9OA 2OPSA 3JS6A 1FNXH 4EP4A 1QVGR 5B8HA 3IGNA 2ACMA 4CJKA 3OW2R 1X6IA 2KVQE 3FEXB 4XUSA 2Y1IA 2CPZA 2W2NP 3IMXA 1X9MA 5AE1A 1FJEB 1B4FA 1X2IA 2XMKA 3JSYA 2HW3A 5THWA 2RS2A 4OPAA 4FO0A 2K4EA 1COKA 2F3JA 3TRGA 2QB1A 2B4PA 4NLWA 4F5QA 3KK7A 4MFCA 3BGUA 1HARA 1ZAVA 2X6SA 1SVDA 4XA5A 5DMRA 3SAHA 1IBLF 1FNOA 3F0NA 4DR1F 1N5YB 3V9WA 2RRDA 5J0OA 4FWPA 3DXKB 1ZBIA 4B3MJ 4C4WA 1YAGA 2BHNA 1HNIB 4FPRA 4LF5F 2PY5A 3HWTA 3PIOQ 1N5YA 3KOOA 4YS2A 4O3OA 2HI0A 5EY4A 2C2MB 2LXIA 4B3MK 5AKJA 3QNWB 2QLBB 4WP8A 1QH9A 5H1SV 3VVTA 1MW7A 2GFFA 4NLOA 2ASDA 3D66A 2W7AA 3JAMO 4CFBA 4DN9A 3CJ0A 3SUOA 3V2UC 3VQDA 2FPHX 4WP3A 5E0OA 1CULA 3BGOP 4OL8A 4OJOA 3IP4B 2BRLA 3L3VA 1BPYA 1NK9A 5BN9A 1JMSA 1SZ2A 1UPPA 2ZVSA 2G0JA 2M70A 3R3LA 3UFCX 1RBVA 8ICMA 3EX7B 2BDUA 3SZ2A 2P6SA 3UXNA 2EC0A 4FK2A 2B9EA 1XC9A 5CYJA 3NCPA 1ZAWA 3EMTA 1IJEB 4CFDA 2DEJA 3DOKA 4FXVA 4Z4CA 4PRFA 3KHYA 4F2RA 2Q97A 4KKOB 2PC6A 4DBQA 1YI2S 4ALZA 2VBWA 3NF9A 4B08A 1IH7A 3KUHA 3BEGB 3SQOP 4QZEA 2BANB 4BRDA 2C3MA 1RAOA 1Y5LB 3H40A 1WOQA 4EFAC 2PMHA 1TV6A 4FYWB 4ZVGA 1YJNN 4KITB 2NYHA 2W55A 1J2VA 3AVJA 4WZMA 3GG1A 4B6JA 3CXCM 3Q7CA 1GMWA 2YWEA 1HKCA 2WVBA 2P9CA 3PYDA 2F8SA 4E1NA 1NM1A 2D3OR 4PKGA 4Y2QA 3P6YC 2E1AA 1FIQA 3P3DA 2ADCA 4J2AA 3UQSA 3J7AP 2DRDA 1TR0A 1NOZA 2YMQA 5KGXA 4USVA 3NTUA 5KFKA 2YX7A 3M8ZA 3NGDA 3BDPA 2XGQA 1ZQJA 1NXIA 4NX9A 4RPFA 4C7YA 4PXBA 5DB8A 3MXHP 2ZBPA 2VGNA 4RPZA 2MLXA 3THXA 3QU7A 4ECUA 3ZCMA 2HYIB 3F5EA 1SQGA 5KFDA 4YOXA 4I2EA 2BQUA 1JLEA 4A8MP 2YNGB 2ZDPA 3R5JB 3AM9A 3WNEA 3OYDA 2VG6B 2CPYA 3KHRA 3QRQA 4KLEA 1FKOA 4C11A 1JB0C 2X1GA 1IBKJ 3GV7B 1SXLA 2ATQA 1W97L 1ZQWA 3EM1A 3QO9B 1N88A 1T0TV 4OQJA 1VSLA 1FEEA 2XSFA 1BY9A 4MT1A 2OD6A 3FEZA 3M1YA 1IBKK 1I94K 2QWMA 4DTSA 2ZH8A 3MF5A 2RQCA 1M5PC 1RYSA 4OX7A 4OZNA 2E2PA 1KLMA 2JRSA 2GZOA 4LREA 4F3MA 2D1KA 1A0PA 3RWUA 4WP9A 5GINA 3JYTB 5B5EU 4CZKA 3AU6A 4Z6EA 2CIMA 3CG7A 2GMJA 4YOYA 3GBTA 4Z0UA 2HS0A 3BGRB 2CQGA 3W3DA 3PW7A 1O13A 4UAVA 3W7BA 2PI5A 3DKDA 3M2VB 3PHEA 1VLYA 1MROA 1LAWA 1SQFA 3UM9A 1YT3A 5HNKA 3KWGA 1PGZA 1QLNA 3IN5A 3CCJS 1Q8LA 3TAFA 2VFTA 3OBIA 3T9NA 1NEEA 3UQ0A 1ZZNA 3IC1A 4ZVFA 1EKRA 4BQZA 1KR4A 1SPBP 3J80O 4DFJA 4YORA 3KD1E 3MEGA 1HWJA 3FR0A 1RAEB 2K4HA 4DUZJ 1BWEA 4QZVB 3DRXA 1ZOLA 1H98A 3FBBA 5HLFA 2KJ5A 3THVA 4KT0C 2DPJA 4DUZK 1FFSB 4OLBA 3IAS9 1V3SA 5AE3A 4F5OA 3CJ2A 9ICLA 2HOQA 2YHYA 2OYQA 5AI8A 2W9CB 4G65A 4KGVB 1PAEX 1RWKB 1XSNA 4KSEB 3Q2SC 1GLBG 1ZQRA 1RCXB 4MYUA 1MWQA 3ZZTA 2RAQA 3IRUA 4CBXA 3L0QA 3QYPA 1WSHA 3WIUA 4RW8B 1K5OA 1DT9A 4RUCA 5CEHA 5JTIA 3AY9A 1KKXA 2W01A 4FJKA 7ICOA 2IVNA 1MN9A 2BZ2A 3DN9A 3QE9Y 3DOLA 2XS2A 5AHXA 1V4SA 2OPQA 3GFKB 1MQ3A 3L8BA 4JBCA 3HSDA 2F5GA 3HLUA 3MM8B 1U26A 5DBCA 4PKDB 2NCKL 2F8KA 1NJIO 5DG9A 3D0IE 3C15B 3THTA 2OH2A 2W2OP 3EKSA 3C6UA 1HKAA 2YB1A 1BPZA 2MLYA 1U0HA 2DXEA 4CZGA 1TKTA 4JKGB 4HUEA 4LF8J 4FN5A 5EOZA 3HZEA 4HI1A 2UXCK 4W5QA 3D5MA 3IS9B 2B7CB 4DR5J 1ZBLA 5LJ5Y 1OY8A 2OO4A 4LF8K 2NLWA 2KIVA 5HAOA 2A0FB 5KFFA 3AQPA 4JKGA 1RQ0A 3A8EA 4DR5K 3U27A 1S9FA 4WZQA 4FJ7A 2BR0A 1RWWB 1DGSA 5DBAA 4RNNA 1NKCA 4DL5A 1JLBB 1TKDA 2RHFA 1GMWD 4WFNQ 2C2DA 3BO3A 5ALNA 1T05B 3PSFA 4LFBJ 1GFWB 4PL8A 3U1MA 3ILIA 1KVCA 1PJ5A 3HILA 4OLAA 3IBCB 3HKZF 4C3KA 3HI0A 4LFBK 1F1BB 2IBKA 4GVBB 1SL1A 4DLGA 3OXLA 3CJKA 3HULA 1MU2B 3HMJG 3MOZA 2BGWA 4FWLA 3ZT0A 1KVBA 2W11A 4WIQA 2EKYA 3NRZA 3DRSA 4OZLA 4RT2A 1TAUA 1RXOB 2IAJB 2HVHA 4GVBA 3BPDA 4Y2YA 3QLHA 1C2PA 2YI1A 2HOIA 2XQCA 1WBDA 5HHIA 3ZFVA 4WFXA 3WK9A 2APOA 2GO9A 2IAJA 4NLTA 4NLVA 5CD4H 2Z2ZA 3AVLA 3FFIB 4Y2XA 3GJRB 3BQ0A 2E1EA 5DDRC 1YHQS 2HEKA 3MXMA 5JUMA 2RP5A 3SCIE 1VHXA 1KVKA 1OQ3A 4OI3A 2WONB 4PHPA 1WTFA 2QRRA 4B9UA 5A6WA 1B9DA 1ACMB 3LVVA 4OMFG 1OXJA 3VAKA 4CEEA 1RAAB 1RDAA 4B9SA 2BUNA 4Q0BB 2VIHA 4I0WA 4FYYB 2ZNYA 1Y9OA 4CF5A 1N8RO 1GXTA 3J7ZO 2BJ8A 1U45A 3EGWB 2JZBB 4RBVA 4IH6A 4URQU 1L8LA 4O4GB 1JXEA 2EWSA 3F73A 1Q81T 3HXMA 4YFUA 2KHDA 3M9OB 3AODA 4HEA9 4CGFA 1QTNB 1Q3UA 4CLPA 1JJHA 1Z1BA 2F9JA 1PC5A 5CAAA 3LM2A 4DCJB 3RAMA 1OO0B 1IBCB 4KLDA 4V19X 1XU4A 2DH9A 3RMDA 3KJNB 3LP0B 4GXJA 2F9WA 3FFKB 3SV4A 1VRQC 4HUGA 1HNXK 4ECZA 2IIRA 2O5DA 5EUHA 3HVRA 5I9EB 5GAEI 2KSOA 3L3FX 1HHTP 3A8JA 5AFUA 5J1EB 3RW6A 3VTIA 2CJQA 3C16B 2NYIA 3E1YA 4USHA 1LV5A 4DV7K 2OGUA 2AP1A 4M5MA 4CNZA 3KLVA 1GTEA 1K8KB 1P8GA 3OYIA 2HFOA 5KG4A 4R8UB 1YRTA 4K59A 3C16A 3D7SB 4CZMA 3H0LB 4DL4A 2E5SA 3WDOA 2KG5A 3AO1A 3E8OA 1NGIA 2Q36A 3LM9A 4BRCA 1P27B 4WFBL 4GFJA 3PUFA 8ICRA 4URSA 9ICGA 2MZJA 2KYXA 2LP4A 1S3XA 1GMUA 1M5SA 4KH0B 1TYQB 4UY8T 2O8DA 5D46A 2G0IA 1K8AO 4YHHJ 1BPXA 4KLGA 3FRZA 3S3NA 1Q82O 3FBEA 2XHCA 1N5VA 1V3ZA 4Q5VA 3OD2A 1O51A 4P71A 3RB0A 4YHHK 4D3HA 1KAXA 3GWCA 3DLLQ 3JPQA 4UAZA 4B3MF 3RJIA 2MQQA 4Z7CA 3T1AA 4CLSA 4J5OA 3KLHB 4B3OB 1AW0A 5KNIA 2Q2RA 2FIUA 4DMZA 2V68A 4JWNA 1GLEG 1SV0C 3EGZA 1OYEA 3MM6A 3NOGA 8ICIA 3QXGA 4OHZA 2FDNA 4QJVA 3DLKA 3J81O 3MXIA 3F2KA 2RH3A 4X64K 5CXTA 2M52A 4KH1B 2ZG6A 3WNFA 3SV3A 4IOBA 2PAVA 4DU3A 5DM6L 2DFFA 3BF4A 3DDHA 5M1QA 4OZ3A 1TE2A 1RT4B 2P9KB 3FBCA 3PYGA 2GWSA 5C12A 4B9MA 3BN4A 4ILHA 1SB3C 4M3RA 5D15A 4NA2A 5AR0A 4E1JA 2YWFA 3LOUA 3VGUA 2MRLA 4CGHA 4J2BA 2CPEA 1E6YB 3SYZA 1VBYA 4DXLA 2Q79A 2E8NA 2GS8A 2G8IA 4Y3CA 1VQLN 2CRLA 3QINA 3CC4S 1S1VB 1W2BR 2R7VA