2XY6A

Crystal structure of a salicylic aldehyde basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
581
structure length
581
Chain Sequence
TAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 199
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy6A01
2YNFA 3RRGA 3G10A 4O9MA 4YR0A 5J2PA 3LPUA 4KLIA 1KFTA 3AVAA 4DL5A 3OYGA 1Z26A 4YMMA 3ISDA 2PY5A 3ZDEA 2IAJA 4YMNA 1FKOA 2PYLA 3PR5B 3QNOA 1L3TA 4RNNA 1L5UA 3B0XA 5HP4A 4F3OA 3OYDA 5CJ7A 4EZ9A 4HTUA 2PFNA 3E2EA 1U45A 2BCSA 4B9UA 4R8UB 3PW4A 1SUQA 1ZBUA 3DRRA 4QZBA 1FXXA 4O3PA 3LP3A 3T5HA 2I9GA 5J2AA 4M45A 1RTHA 1BI4A 4LH5A 4F5PA 4NM1A 3VN5A 4QWCA 1ZBIA 1ZJMA 2IC3A 3C23A 1TVAA 3UXPA 2ZJ8A 5K14A 5FRMA 5DG9A 4J9KA 3ULDA 3TAQA 3NF9A 1JLQA 2ZUBA 4FS1A 4BGDA 4IFYA 1JN3A 2OPRA 2VG7A 2A1JA 1B9DA 3RJJA 4CEDA 4QZGA 4FZZA 3RH5A 3QLHA 3F9KA 4CGFA 3AO5A 5CYQA 3M9OB 2NRXA 4Z6DA 4MFAA 4IFVA 4J2EA 5KT7A 4FO6A 4OLBA 5DBCA 2HW3A 4RU9A 4IRDA 4LY7A 2BPGA 3OYAA 4EZ6A 5T7BA 4M6WB 4GLXA 3MDAA 1BPYA 3KLFA 4OGEA 5DMRA 4FM1A 9ICLA 2BGGA 1EKEA 4DTJA 2G8KA 3GIJA 1HNIA 3DLRA 3OS2A 3VQCA 4CF0A 5KRTA 3KLIA 4Z4CA 4I2QA 5DQHA 5DDMA 2IA6A 4F5NA 2HNDA 5HNKA 2WONA 1C7YA 5DLGA 1IKXA 1MQ2A 3FDSA 5CHGA 2FPLA 3O3FA 4B08A 2EX3A 2WOMA 1RT3A 4GXKA 1ASVA 4DTXA 1YVUA 1BQNA 3L3VA 4RQ4A 2FBTA 4O55A 2XGQA 9ICWA 4Q45A 3V9UA 2LSNA 4RW9A 2F1HA 3NE6A 1NK5A 3KK3A 2D5RA 3V6HA 3NGDA 2JGUA 3HP9A 4IR9A 1HQUA 4UAZA 5IINA 1WN7A 5HRSA 3KK1A 5HP1A 3ZDBA 3B6OA 3L2VA 3F73A 4ZTFA 5KFRA 1S1VA 3CFOA 1ZQFA 1ZQVA 2YNHA 3RB4A 3IS9A 1U9LA 1WSEA 1ZQRA 2BCUA 4PGQA 4Q8FA 2VG5A 2QXFA 4HVJA 4EBDA 2G8IA 3O4NA 4KLGA 4AHSA 5CR0A 3AVGA 2PI5A 3HSTB 1UOCA 4RQ6A 1YTUA 1VSEA 4OPKA 1S9EA 4M3ZA 4CJRA 4CJSA 4DWIA 3BQ2A 3QESA 3RMDA 4O0IA 3C6UA 4QWAA 1ZQTA 1BQMA 5DB6A 2OYQA 4M9NA 5FDLA 7ICRA 1EETA 3KD5E 4EBEA 1BIZA 4IG0A 3MEGA 4IKFA 4I2IA 4DF8A 5HRNA 1L3SA 2FPKA 1X2IA 3TAPA 1ZQDA 1RDDA 1RDBA 2ZTEA 3HK2A 4CJUA 4OKKA 3L2UA 1J54A 1COOA 1QE1A 4O5EA 1LW2A 5D3GA 9ICIA 3O3HA 3OJUA 1NK8A 4N41A 3JPRA 3UXNA 1UAXA 3HL8A 3BQ0A 3RMBA 1TFRA 2ZD1A 7ICLA 4W5OA 3OJSA 4ELUA 1RBVA 1QSYA 2R8HA 4F5QA 3RH4A 4J2DA 4IQWA 3I8DA 3AO4A 5J2NA 3CYMA 1BGXT 2WTFA 3K4GA 4O3SA 4Z6EA 2XY5A 2YHAA 3G6VA 4FK2A 3PO5A 3QZ7A 3JPSA 4FYDA 4BDYA 1ZQKA 2Y1JA 4M3TA 3V6KA 1KEJA 5TZVA 1ZQPA 3AO3A 2PXIA 1J5OA 3E01A 2XY7A 4CCHA 3RMAA 1ZQYA 3SQ1A 4Z4IA 4RW6A 5KFWA 1XSNA 3M8QA 2UVWA 3T5JA 1HQEA 3SI8A 2I1QA 3SNNA 1EXNA 1XI1A 1SZPA 1KTQA 2B21A 2HVHA 2KZZA 2IDOA 4BXOA 2FMSA 5KG6A 4KHYA 5KT5A 3LALA 3TABA 3BQTA 3KHLA 3H4DA 4R5PA 3TWHA 2HMIA 4DLGA 1FK9A 3DRPA 4Z4FA 3TAFA 4DS5A 1K6YA 4F93B 3UIQA 1S9FA 2BHNA 1ZQOA 3FFIA 5KT6A 4TSXA 5CA7A 1IG9A 1S76D 3K58A 2J6TA 4PHDA 4DTPA 1NK7A 4ECVA 2YNIA 2W9CA 1LW0A 3QZ8A 2AGOA 3Q8QB 3OVNA 3RMCA 4CGHA 1S1WA 4ELTA 5KFVA 1WNSA 3C1ZA 1RNHA 2JEIA 4R64A 2BR0A 2BCRA 4B9MA 3PV8A 3C2MA 1KDHA 4YR2A 4UB1A 5EU7A 1REVA 4DL4A 1JKHA 4M2YA 2OPSA 3VQBA 1IXRA 3IM1A 3ORYA 2O4GA 9ICAA 3RAQA 1SL0A 3V9WA 5J0PA 4FLUA 5J2FA 2V4RA 1ZETA 3P5JA 3GIKA 9ICMA 1T8EA 1KCFA 3DLBA 5DLFA 2UVUA 2ITGA 2IOCA 1ZBLA 3S3NA 2P6RA 4OJRA 2X6SA 3MDCA 2IHMA 1S6PA 2Z1JA 3CFPA 4QZ9A 5KFUA 1UA1A 1DLOA 4NYFA 3ZSQA 3C94A 1U04A 2E4LA 4RNMA 4ED0A 3OS1A 1ZQZA 4DSJA 1T05A 1JLAA 4CESA 1Z00B 2JZBA 2W9BB 4IRKA 3MEDA 5HHIA 3LAKA 2AJQA 4W5QA 5IIOA 1TAUA 9ICRA 3C95A 4KB1A 3MFIA 3KHHA 3NFAA 4YD2A 5J0XA 1Y97A 4JWNA 3OYNA 3MXIA 1ZBFA 4IQTA 5DB8A 4DL6A 1S97A 2OWOA 5J2KA 4AHTA 4Q5VA 1C6VA 5HROA 4CEOA 4RG8A 1A76A 4EBCA 3NAEA 8ICTA 1LWEA 2MUTA 3C6TA 4DFMA 3GFKB 1WSFA 3OS0A 2BANA 1JLEA 4M9HA 3AVFA 2R8KA 2XY8A 4KLUA 2BQUA 2KFZA 1YT3A 4IQVA 5IIJA 3OYHA 4AHVA 1NJYA 1LB2B 3K57A 4E1NA 4LH4A 4LSNA 2IGIA 2VA2A 4FJMA 3LDAA 4YD1A 1S9GA 3Q8KA 4O5KA 5J0UA 1RXVA 4KV8A 8ICGA 5J29A 3VQ5A 5L1KA 3OYFA 3SUNA 8ICOA 2VG6A 4B9LA 4X5VA 4CJQA 3H8JA 4YQWA 2RDJA 4DLEA 1EP4A 4JV2A 1S0OA 4QZCA 4J9QA 3C1YA 1TL3A 4CJTA 4QZFA 3SCXA 3VQDA 4M41A 2Q3SA 1RTDA 4QZEA 2DTUA 4NM2A 2JLEA 8ICQA 1KVCA 1S5JA 2G8UA 1U4BA 1SV5A 2HHWA 4PY5A 4RQ1A 4FJ5A 2P66A 1CZBA 1NOYA 4IBNA 5KG0A 4B8AB 3QIOA 2A1RA 3CM6A 4R65A 3QO9A 4KN7A 2FBYA 3SPYA 4K8ZA 4E1MA 5J0OA 3TFSA 1RBUA 4HCCA 2C22A 5J0SA 4DO9A 1S1TA 5KFQA 3N4MB 4O5BA 3NH1A 1S10A 2C2EA 3ZT4A 2BDPA 4PPXA 3T5LA 3GDXA 1JXLA 1HJRA 3AU2A 5KT4A 2ATQA 4RW4A 3M8SA 4Q43A 1S0MA 3EPIA 4FJJA 2HHSA 4HHTA 4KHUA 4ECZA 3K5MA 3HXMA 4CF8A 1D9DA 4FK0A 2NRTA 4WE1A 1ASUA 1JL1A 4JV0A 3SPZA 4JWMA 1X9SA 4ECQA 4MFFA 3H8WA 3KIOA 1HPZA 3WNFA 2AQ4A 1ZQUA 4C8OA 5EWGA 4ED6A 3PR4A 1KVBA 3MGIA 3HPOA 3VQ6A 1S77D 5DB7A 4BE0A 1K1QA 3ZSOA 1LV5A 3KJVA 1ZQWA 2GV9A 3V1OA 4GVMA 3MFHA 2ZJAA 1T03A 1QSSA 1J9AA 1JMSA 4W5RA 3H08A 3C21A 3HX0A 1GOCA 4FBUA 3ZDDA 8ICCA 4O0JA 2YKMA 2BQRA 1NK0A 3ZSVA 1HYZA 4LZDA 4F91B 1BPXA 3AVIA 3LPTA 8ICVA 4RQ7A 3C2LA 2P1JA 3VA3A 1HUZA 3QNNA 4KMUA 1S1UA 3OHBA 4I2BA 5CZ2A 4CFDA 4YMOA 1N6QA 3TANA 1TAQA 1BL3A 5J0TA 4AILC 1A5WA 1U49A 4RNOA 4RT3A 5FRNA 1D5AA 4KITB 1WSGA 4DQIA 4N5SA 3L2WA 4CEEA 5J1EA 4PHAA 2P51A 4BDZA 4CK1A 2R8JA 4FJXA 2X6NA 3PO4A 5HHHA 3AVBA 5J2HA 4GXJA 1R0AA 4FLVA 3ASMA 3JSMA 4IR1A 4DSLA 1Y88A 4ECRA 4KI4A 3GV8B 1VSIA 1ZQMA 1T3NA 1ZQNA 4P2HA 4J2AA 1ZQCA 4CIGA 4F4KA 7ICEA 4KB0A 4CHNA 4CEFA 8ICLA 2V4QA 4I2HA 4MQ3A 4FW1A 3RJHA 2KZMA 1WAJA 2C2RA 1BPZA 3SI6A 3NF8A 4KTZA 8ICHA 5HBMA 3L8BA 1N56A 4XUSA 2FPMA 4GC7A 8ICUA 2RN2A 1ZQHA 3ZSXA 2PZSA 1YTAA 4CHPA 2HVIA 1AROP 1KFSA 2R8GA 3C2KA 1TGOA 4DL7A 2B5JA 1ZQLA 3V7LA 3CG7A 4J9NA 4FJHA 3ZSYA 1VSHA 3JYTA 4CJ4A 1TKDA 3RRHA 1S1XA 4H4OA 2BPCA 3K5NA 3V9XA 2ISPA 3HP6A 1C1CA 3JPOA 1TV9A 1J53A 4DL3A 5DK5A 2PYJA 5J2JA 4F4WA 8ICXA 5KFGA 3ALYA 1RCHA 3T1AA 1Q8IA 3NDKA 3H40A 1WCNA 4B8CA 4HUFA 1JIHA 1TL1A 5HRRA 4BACA 4PGYA 4P4PA 1BPBA 5KRSA 5L1IA 4CECA 4F50A 1ZQQA 4ED3A 3B6PA 2B4JA 1RYRA 4RQ5A 4TUPA 3VQ9A 4KHSA 2R8IA 4YXJA 5J0QA 2X74A 5EWEA 1A77A 4XIUA 4ECWA 3S9HA 4RQ0A 5KFTA 4HCBA 4HYKA 2X78A 5KFDA 2DFFA 4DS4A 1I39A 3NTUA 3L3UA 4DL2A 5HRPA 4RQ8A 5JUMA 5EWFA 2XCPA 4J9MA 2RF2A 4CGGA 5KG4A 4YR3A 2E6MA 4BXOB 4UBBA 3QEIA 3NGIA 4NCBA 5F9NA 3L2QA 4CF9A 3LP1A 4CIFA 4AHCA 2ISOA 2BKEA 3U6FA 4ZTJA 3I0SA 5DBAA 1CZ9A 1ZQBA 2IS3A 4KLMA 4I2EA 3AVCA 3LP0A 2BCQA 5JS2A 1TV6A 3DI6A 2XHBA 2Z1HA 4I2JA 3KKRA 3WNHA 5D46A 4ID1A 4Q8EA 4CJVA 2W9CB 3MGHA 1VSJA 3SUOA 2VA8A 4CJEA 4DU3A 1HJPA 4CF1A 4NLGA 3SQ4A 4XQ8A 4PHEA 1HNVA 1TKZA 2YNGA 3HVTA 4MEYA 5BOMA 5DKWA 2XY6A 2XCAA 3SZ2A 3JPTA 2F96A 2GWSA 4NLZA 5IIIA 3V4IA 2VWKA 1TK8A 1DTQA 9ICXA 2ATLA 7ICOA 2D0BA 4PQUA 3RH6A 4JK1A 1RDCA 2J6UA 4I9LA 3MABA 4KI6A 9ICTA 4QWDA 1U47A 1QLNA 1D9FA 3ZDCA 3QEBZ 4HUGA 2OZSA 4RUAA 4M9JA 3GV7B 1ASWA 4M3XA 3GIIA 3BGRA 1ZQGA 2NUBA 2KQ2A 5IIKA 1BCOA 3HPHA 1HYSA 7ICMA 2XO7A 5BOLA 3PW0A 3MR5A 4GC6A 3D0PA 3AU6A 3LK9A 5KG7A 3TAEA 4QZDA 2ZTCA 1ZQXA 1L3UA 3A2FA 7ICUA 3OSNA 3M9MB 2HHQA 3EWAA 5SWMA 4ZH4A 1LAVA 5SZTA 1NKBA 5J2DA 7ICJA 5CP2A 2G8VA 4PHPA 4JLHA 4ED2A 3HJFA 9ICSA 3P83D 4E7IA 1XHXA 3I0RA 4DF4A 4RW7A 4I28A 3PX6A 4N56A 4B9SA 3ZSRA 5J2QA 1FKPA 4M9LA 4OGCA 2MUTB 2R7YA 3P1GA 1N5YA 3V9ZA 5KFXA 1SKWA 1LAWA 1RYSA 2FLLA 4GW6A 4BE1A 4FZYA 4ECSA 1WSJA 3SV3A 4M04A 1GOAA 9ICVA 4CFBA 3OSPA 3NH2A 1IM4A 3OHAA 3EZ5A 3VA0A 4K8XA 5KFHA 4UAYA 4E7KA 1B92A 4RT2A 4C8NA 2GUIA 5KFPA 1B22A 1D8LA 1F21A 5C5JA 2IBKA 5KFAA 3MR3A 3QEXA 4J9PA 3UPQA 2P6UA 4L8RB 4MFCA 4LZGA 4FVMA 4DQRA 3WNEA 5BPCA 4B9VA 3RTVA 1XSPA 3KLHA 3AVJA 2A1SA 3SQ0A 4TQSA 1QHTA 4B3OA 3G6YA 4FBTA 9ICCA 4DSKA 4PH5A 4E89A 4TQRA 1TK5A 2KN7A 1RBTA 5DG8A 3VQQA 1I3AA 4F4YA 4I27A 4KLOA 2W9MA 3AV9A 1W0HA 3HM9A 3M8RA 5HMMA 3AVHA 2FC0A 2HB5A 3HWTA 4JS4A 8ICWA 4I7FA 7ICHA 3D45A 3PUFA 1WCLA 1VK0A 4C8MA 4XRHA 4F3TA 1RBRA 1VRTA 3HT3A 1ZJNA 3AA2A 1VSFA 4JRPA 3MEEA 4K4GA 3BJYA 4RW8A 3KLGA 1XU4A 4J9RA 1NK9A 3K59A 5HMLA 4C8KA 4KTQA 1KVAA 4UAWA 3LDSA 4P4MA 4FLWA 4P4OA 1T4GA 4B9NA 3CM5A 3M8PA 1KRPA 2KFNA 4FJGA 4F5RA 5KFYA 1DGSA 1S0NA 4ELVA 5DQIA 4DTUA 2PFQA 4O5CA 2HNYA 3U3GA 4M3UA 4Q0BA 3MXMA 3DOKA 3DLEA 1C0TA 1C1AA 3AVLA 3ZD9A 2HHUA 4FJ7A 4RQ3A 4CGDA 3H7IA 5J2MA 3S3MA 4DU1A 3TAMA 1BPEA 5KFZA 3KHGA 4F2SA 1JLFA 3RB0A 4YG2A 1K1SA 1Z00A 3ZT0A 2W9BA 4FJIA 1VSMA 4RPZA 3ZCMA 2UVVA 4IRCA 3OYBA 8ICPA 2ZE2A 1MSWD 1CLQA 2DY4A 3EPGA 4QW9A 4FLZA 4I2CA 4CIEA 1HUOA 5CY4A 5J2BA 3T19A 1VSLA 4CE9A 4R66A 1IKWA 4KLEA 1BI4B 3O4QA 3DLHA 3TARA 1BIUA 1RXWA 2D0CA 3LZJA 3QERA 3MBYA 4H8KA 4N47A 4RUCA 3V7KA 1MQ3A 9ICEA 5KI6A 1RTJA 4G1QA 3V1RA 2KW4A 5J0RA 9ICPA 2A1JB 2W8KA 1C0UA 2VA3A 2XC9A 2NRWA 3THVA 3MXJA 5KGWA 3C5GA 2PFOA 4NCGA 1IH7A 2NRVA 4M47A 1HYVA 4ZHRA 3RBDA 3DLGA 2HHVA 3NBPA 4QCLA 2C28A 3SUPA 5FROA 4OKJA 3KHRA 3PW2A 4J2BA 5DGAA 4CK3A 1BPDA 4CJ3A 4DSEA 4HUEA 3PNCA 3JPQA 4Y1DA 3GILA 4I2AA 2H5XA 1NOMA 2LYHA 1V9PA 1QQCA 2FMPA 8ICIA 1BCMA 4O44A 4KN4A 4CEZA 5KFEA 1U48A 1CXQA 1SL1A 8ICFA 3GV5B 4IG3A 4CEQA 4LSLA 9ICJA 3OYEA 3PW7A 5KGXA 3MAQA 4F2RA 3PVXA 4CJFA 2EHGA 8ICRA 1C1BA 1NJZA 4UB2A 4YFKA 4M0AA 1CEZA 3QEPA 4N76A 4FJ9A 2D0AA 3M9NB 4FZXC 2BE2A 3PW5A 4O3NA 4MF8A 4CEAA 3TAGA 3ISNC 4KLDA 1ZQAA 3WNGA 2W42A 3TR8A 3RWUA 4NLNA 3V9SA 3UXOA 1EX4A 4FXDA 2RKIA 4QZ8A 4DMNA 4H4MA 2C2DA 1A5XA 4DQSA 4EYHB 3Q8MA 4KO0A 1BVSA 1XS9D 2QK9A 4KHWA 3HPGA 4E7LA 4KLJA 3RAXA 4TURA 1DOQA 5D49A 4FS2A 2OZMA 2Q0ZX 1X9MA 8ICNA 3S3OA 3QINA 1C0MA 2O4IA 2E6LA 2ETJA 5I3UA 1NOZA 3IHQB 3VQ8A 1IO2A 4CHOA 1ZQJA 5L1JA 1VSKA 2ALZA 2OA8A 5L1LA 1UT5A 5KFBA 2YKNA 2Y1IA 4NCAA 3H4BA 3OY9A 1RT4A 4I2FA 1RDAA 3NGZA 4KTWA 4E3SA 3DM2A 4FLXA 7ICIA 2XGPA 5C42A 5C25A 2GBZA 3AVKA 4YVZA 4FLYA 1Q9XA 2W8LA 5DB9A 1XSLA 4DU4A 2KTQA 4F8RA 4MF2A 4QWBA 4KFBA 3K75D 4PGXA 1RBSA 4R8UA 8ICMA 3OYJA 4FJ8A 2BCVA 2AGPA 4DFJA 3OYMA 3PMNA 1D8YA 4DEZA 1MC8A 4JV1A 1KLNA 4YXMA 4BWMA 1ITGA 3V81A 4F92B 5DQGA 1W9HA 4F5OA 2F8TA 1BISA 3V1QA 3IAYA 5KFIA 4NXZA 2M9NA 3SV4A 1UWBA 4G3IA 4R63A 3JPNA 1GOBA 1S6QA 3KTQA 1JXBA 1T7PA 4Z4EA 3HW8A 4FJNA 3EW9A 3KK2A 2ASLA 4KLTA 2NRZA 7ICNA 2Z1IA 4Y1CA 2ASJA 1KFDA 3T5KA 5KFLA 4O3RA 4M6WA 1Z3EB 3K5LA 3OYLA 2XRIA 3AA3A 3RB6A 5J2IA 1RT6A 4DG1A 3SYZA 4KKOA 1G15A 3RR7A 7ICVA 4DQQA 1CXUA 3RJFA 1JLBA 2VWJA 4DOAA 4EP4A 4KLQA 5KFOA 2ASDA 4JUZA 2KZ3A 3ZDAA 1SKRA 4CJ5A 1VSDA 3ZT3A 4KLFA 2ZUCA 2F1JA 4Z4HA 3IRXA 2UVRA 4FM0A 4F4ZA 9ICBA 3BDPA 2OPQA 3ZT1A 4DFKA 3Q8PB 3RJIA 1NJWA 4JS5A 5F9LA 4KHNA 3V7JA 3AVMA 3RJEA 4CERA 2W9AA 4YN4A 4DTOA 3ZD8A 4AHUA 4CJLA 2DPIA 8ICAA 1RZTA 1EXQA 3NF6A 1SL2A 5KFCA 3LP2A 4CJKA 3KLEA 3K2PA 1QTMA 4K4HA 1HRHA 3LWLA 3CQ8A 4DQPA 4Q44A 2V9WA 3DRSA 4CHZA 2BQ3A 1ZQIA 1QSLA 5DGBA 3OGUA 4QAGA 4CGJA 4DTMA 3G6XA 4BE2A 2HHTA 8ICSA 4O4GA 2DPJA 4XA5A 1X1PA 1VRUA 4OLAA 4Z6FA 3OYIA 2YV0X 8ICKA 3O3GA 3JPPA 2AU0A 4AH9A 4QZHA 2FBVA 4KREA 1LWCA 4CK2A 2G8FA 5KT2A 9ICGA 4UB5A 4O3OA 4EEYA 8ICYA 5C24A 3NGYA 2PI4A 1ZQSA 3PMLA 2RPIA 3V72A 4DSIA 9ICFA 3IG1A 3AA4A 3QIPA 9ICQA 5KT3A 4ED7A 2YHBA 1UT8A 2Z1GA 4EP5A 3MR6A 3T3FA 1WSHA 3AO1A 3KKSA 3DMJA 2B6AA 1NK6A 4UB3A 5KFFA 1JLCA 3SUQA 3VQEA 3Q8SB 2JEJA 3DYAA 4FM2A 3EY1A 3ISBA 4ICLA 2HNZA 1A5VA 3RR8A 2ZQBA 3K5OA 4RZRA 3ISCA 3GIMA 2PFPA 2JZBB 1B9FA 1JX4A 1RPLA 7ICTA 3ETLA 5EOZA 2OPPA 3AO2A 1JL2A 7ICSA 4LD0A 3KD1E 5E41A 1ZBHA 3FYHA 3UQ2A 1TKXA 2VANA 3VQPA 4W5TA 2ZTDA 4I2DA 4GMJB 1IKVA 1S0VA 4TUQA 3TFRA 2F1IA 4C8LA 3OYKA 1L3VA 4M3YA 4MFBA 4OPJA 5L9XA 4FJLA 2IHNA 2RDIA 1TK0A 2MAXA 1KSPA 4CHQA 4KLLA 3U3YA 2P5OA 5KG5A 9ICUA 1ZQEA 3PY8A 3C5FA 7ICPA 1QS4A 1IKYA 4YP3A 4NYNA 3ZSWA 1RT5A 1XO1A 3MECA 4E19A 4QZIA 7ICFA 2BGWA 4CHYA 5HLFA 2QKKA 1N48A 4E0DA 3V6JA 2ZJ5A 5J0WA 4CJWA 3LWMA 1XWLA 4E7HA 4M3WA 3TQ1A 3GQCA 9ICKA 4NY8A 3VQ7A 5J2EA 4AHRA 4DFPA 4M3RA 3QEVA 1TKTA 5IILA 2FMQA 4EYIB 1H38A 3UQ0A 4JRQA 7ICKA 3H8SA 4MEXA 3DOLA 4ECYA 1WAFA 4I29A 2IMWP 1RT2A 1JXEA 5CB1A 4DOCA 5DDYA 1ZYQA 3LANA 1CUKA 2G8HA 4TUSA 1NKCA 5DG7A 4DOBA 2DFEA 2FLNA 1KLMA 8ICEA 3NH0A 1NK4A 4YCXA 4ECXA 3QEAZ 4BWJA 2AGQA 4PWDA 4E7JA 4RPYA 3EYZA 1DTTA 3AUOA 1BHLA 4CF2A 3PX0A 3NCIA 5KFNA 5KFJA 4OKEA 8ICJA 4ED8A 2JEFA 5DBBA 4NLKA 9ICHA 5CZ1A 3ITHA 3MR2A 3L2RA 4GXIA 3CFRA 4O3QA 5J2CA 8ICZA 3QEWA 3HYFA 4RPXA 4J9SA 4ED1A 1B43A 3TI0A 5KFMA 1XHZA 3RJKA 2JEGA 5CYMA 7ICQA 3G0ZA 5J0YA 4DTNA 4RQ2A 4K4IA 1Z25A 4KLHA 4FK4A 2AQ0A 3ZSZA 2QKBA 4CFCA 2FLPA 1RILA 3SJJA 1RT7A 4F4XA 5CWRA 3V6DA 2F8SA 5KG2A 4I2GA 3HO1A 7ICGA 5KG1A 3PX4A 4OVLA 4PA1A 3ZT2A 2FBXA 1Q9YA 2ZUDA 3AA5X 4CEBA 4FCYA 4Z4GA 4UBCA 1RT1A 1XC9A 3NHGA 1PZNA 1O1WA 4KAZA 9ICNA 3OYCA 4QW8A 4KRFA 4ECTA 4ECUA 5IIMA 4I2PA 3B0YA 3RBEA 2DFHA 5KG3A 4DSFA 1MU2A 1WSIA 3HVRA 1JLGA 3QE9Y 4LVSA 1HMVA 4Z0UA 3LZIA 2J6SA 4UB4A 4ID5A 3SQ2A 4KPYA 5I42A 3RB3A 2P5GA 2G8WA 5JS1A 2I5JA 1TVRA 1X9WA 3AVNA 3VQ4A 4KLSA 3BQ1A 4PUOA 4I9QA 4Z6CA 4FLTA 4IQUA 4CGIA 4CFAA 5D4BA 4FJKA 3RJGA 4YFUA 3VQAA 4FW2A 4QZAA 1WLJA 4QWEA 3N97B 4DTRA 4KHQA 1NKEA 4YNQA 4UQGA 4BDPA 3LAMA 3Q8RB 3NF7A 2BPFA 1SKSA 4W5NA 4B9TA 3Q8LA 4IDKA 4DTSA 4J9LA 9ICOA 4M9GA 3DLKA 5J2GA 1RTIA 1UA0A 8ICBA 4CJPA 4QOZB 4M42A 1NJXA 2HHXA 3QETA 5KFSA 2DFLA 5KTQA 5KFKA 1LWFA 4J9OA
chains in the Genus database with same CATH superfamily
4Y00A 2G0AA 3NCQA 2YNFA 3QBCA 2E5IA 4O9MA 5J2PA 1KFTA 3N6NA 2UUCK 4YMMA 4DV5J 3ISDA 2DT9A 3ZDEA 4YMNA 5C25B 4ZIVA 2VZ9A 2VICA 2ITMA 4BRQA 4KHPF 2NXCA 4X4VA 5K9FA 3FEZA 3PJ9A 3B0XA 5HP4A 4QU6A 3R3TA 4KFBB 4MYTA 1HKAA 3G9CA 3CMEN 3O9UA 1S1XB 5IT9O 3PW4A 1SUQA 1Y00A 3K89A 1ZBUA 2Q6CA 1Q79A 4QZBA 2HWIA 2JV3A 5D0RA 3UDVA 3T5HA 1EO1A 2CQBA 1VAZA 3JS6A 2K4IA 2HSTA 2JNJA 4C7ZA 1FNXH 5IT9U 3VN5A 1U24A 2DO4A 4DR3J 4LFCF 4DX8H 4QWCA 4CLTA 4PG7A 2KJ5A 3VAHA 4MKAA 3UXPA 2ZJ8A 4J9KA 1YJ9N 2P9UA 3TAQA 1GMVA 3ENQA 1JLQA 2ZUBA 4CDGA 3EZOA 5CYJA 5L46A 4BGDA 3BS5A 1NNLA 2M52A 3RJJA 5B0CA 2RHQB 3M9OB 4YS2A 3BV8A 4WU3A 3MUTP 5AQWA 4OLBA 3VGKA 4YOYA 2YVSA 5T7BA 3O8WA 3SJHA 2VFSA 3HHLA 3CEDA 1J5EK 4KKOB 1FX2A 2OP5A 3UNYA 2KHOA 3KNAA 1BPYA 3KLFA 9ICLA 4X2BA 2BGGA 4DTJA 5JVGQ 2HPUA 2EBEA 3P5TL 3DLRA 3OS2A 3ZZ0A 3MX5A 3WKEA 3KLIA 3EGVA 5B09A 1IXKA 2HNDA 4HHHA 3S7RA 4ACOA 2RQ5A 1C7YA 2ZXIA 4NLCA 2YWKA 3HOSA 4MT1A 4C48A 3IRXB 2LKZA 1FTCA 3VGTA 4B08A 1AUDA 1VC0A 5ALPA 1ASVA 2E1ZA 1Q5YA 4RQ4A 4O55A 3QFPA 9ICWA 1WWVA 1V3RA 2LSNA 2P9PA 2EK1A 2F1HA 2O8EA 1VOMA 2VF3A 1ZRNA 1W2BR 2FF3B 1VQLN 2MSSA 3V6HA 1N52B 4L6V3 1GMWA 4WBFA 3UCGA 2VASA 3DRSB 2FJDB 4UAZA 2WVEA 3ZDBA 4BHQA 1PGZA 5IM0B 3B6OA 3F73A 5KFRA 1VRUB 2MTLA 4BRCA 1ZQVA 3RB4A 1U9LA 1WSEA 4ZVRB 2BCUA 2OEHA 4IXCA 4Q8FA 2VG5A 1RWXB 2H51B 2QXFA 5A8KB 1IR0A 4DBQA 2ZUGA 5LXYA 2C2OB 4EX7A 2J7KA 1FFUA 2IVOA 3VGUA 1UOCA 4GV6A 3VAKA 3ENAA 1CC8A 1EB0A 4DU7A 2YMQA 1O08A 2CQ4A 4FKYA 3UVJA 2J76E 1T94A 1ZQTA 1GLLO 2UU9J 2OYQA 5FDLA 2FSKA 4LFBF 4EBEA 4C8YA 4IKFA 4JKCA 2EFNA 3GFXA 4DF8A 4HH0A 4C11B 1PAEX 4NLVA 1YZ6A 3K0JA 1S57A 3TKAA 2OPPB 1J54A 1COOA 1QE1A 2YKOA 3H25A 4M95A 4A48A 9ICIA 1YJTA 4WFNL 4OX8A 2OH2A 2QEXS 1SC1B 3BQ0A 3NASA 1IKVB 5D78A 1X60A 2UUTA 2APOA 5IS2A 1OY6A 3GJTB 1KHVA 1IBCB 2ZZTA 3VAIA 3RH4A 2CG4A 4IQWA 2BJ8A 5J2NA 2FHKA 2HFSA 2WTFA 3K4GA 4O3SA 2HLUA 2KJWA 2KO1A 3CJ4A 4AM7A 1H7WA 3QZ7A 4LRBA 3S6EA 1T0TV 2QLJB 2AV5A 1KEJA 1ZRMA 3NCRA 5TZVA 4CNYA 1Q1KA 1YTYA 1JJHA 3QMLA 2RMLA 4BROA 1FEEA 2LQ8A 1ZQYA 1DQ8A 1N61A 3SQ1A 5IV3A 3VZHA 4F36A 2GHPA 5HJYA 1TKTB 1HQEA 2DH9A 5BRDA 3W9IA 3SK3A 1LXNA 2KE7A 2W2OP 1XMQK 5KG6A 2FE9A 2NYHA 2DKOB 1RKJA 4QS8A 2LMIA 1SPBP 2F7TA 2VDIA 2HMIA 4UB6U 4B3TJ 2OAUA 1OSCA 3E8OA 4DS5A 2DD8S 3LM2A 4F93B 2AEFA 4CF3A 5AICA 3FFIA 1NBEB 1HNXJ 4OYZA 4TSXA 5AXLA 4UW9A 4KHRA 1R8BA 1SWWA 4PHDA 4DTPA 3D68A 1A7GE 4ALZA 1K8KA 3RMCA 1WI8A 2ZHOA 1J5EF 4ELTA 5B0FA 3C1ZA 2DR7A 2JEIA 2MKYA 3ELHA 2BR0A 5F0XA 4X64K 4PL7A 2GX8A 1VRTB 5I9EB 4NL9A 4B9MA 1KQKA 4YOVA 1FJ7A 4YR2A 4UB1A 4DL4A 3MEEB 2N82B 2EFPA 3IM1A 3ORYA 3NS7B 9ICAA 3MURP 1SL0A 1WG1A 4FLUA 3CCLS 4DV7F 2MMYA 1DGJA 2G0JA 9ICMA 1MN8A 3DLBA 5DLFA 2E9ZA 3N4PA 3U7JA 1CJKA 2KLAA 3FMBA 1LVHA 2X6SA 2ASPA 2Z1JA 2KSOB 3IBFB 2ZNZA 2CJ9A 1DLOA 1U04A 4RNMA 3GB0A 5AI8A 2MEWA 3J7YP 3OFFA 3ATUA 3IXQA 2GH1A 4CESA 2JZBA 2P5VA 3MEDA 3Q23A 1B0PA 3EGWB 3PJWA 2CRXA 2I5JB 4YD2A 1HWLA 4TNOA 4DCPB 2W1BA 1Y97A 2J4RA 4JK9A 2B4VA 2OWOA 1S97A 5J2KA 3JSYA 2G06A 4CEOA 3MM6B 4RG8A 3UO0A 1IR2A 5HMXA 3THYB 3C6TA 4DFMA 2BANA 1FVQA 1VLYA 2R8KA 2JWLA 4KLUA 5GMEA 4F25A 4OYOA 1UEVA 1RTJB 1K47A 1VRQC 3FZHA 2IM0A 1HQ2A 2LI6A 3H5UA 4IDKB 2E8OA 2WHEA 3MN7A 4E1NA 4U7UK 4C1NK 2EVZA 2P9GA 4DR1J 1JNRB 5EGYA 3M2VA 2IGIA 3MCPA 3W63A 4J9VA 4O5KA 5J0UA 1CBKA 1DURA 3SSQA 1HBNA 1HWIA 2DRAA 4GMKA 2DCUB 5F8GA 3IR6B 3FGUA 3AJDA 2F9WA 4N8NA 5B0BA 3F53A 2HDOA 4CJTA 3VALA 2FSJA 4KX3A 2V6AA 4DR5F 4EUVA 4M41A 4BVPA 3AOBA 4QZEA 2KNJA 3CB4A 4EAHD 1YVNA 1KVCA 1S5JA 2EAMA 5GMDA 4FWMA 2HSZA 3BKUA 1U4BA 4PY5A 4NYZA 4FJ5A 4UZBA 5AKLA 5KG0A 4DPXA 4CLSA 2W41A 2PEBA 1E3MA 4R65A 3QO9A 4U6PA 2CPYA 3KKAA 2BE2B 2NCKL 3LL3A 1JQGA 1Q86T 3GMGA 4A8MP 3K9JA 4E1MA 1R0CB 4KAIA 3TFSA 2V4JB 4BGAA 4HCCA 4A8WA 5J0SA 4DO9A 1U6BA 1MWZA 1RAIB 4GVBB 1WG5A 3T5LA 2DWQA 1JMTA 5C2GA 3ALRA 5DDRC 5KT4A 3G71N 3E51A 2VKQA 1XMQF 4FJJA 2HHSA 2IC3B 4ECZA 3K5MA 3HXMA 5ETRA 1CZAN 1D9DA 2VJUA 4JI8J 3GLJA 2E5HA 4OZLA 5GAEU 1FRMA 4WE1A 2CAJA 2AJ4A 2OPRB 5HATA 1JL1A 4PZVA 3SPZA 2LBOA 3UCZP 4ECQA 4MFFA 1V4TA 2YKNB 1HPZA 4CD1A 3VETA 5CYQB 3WNFA 2BRLA 2AQ4A 4JI5K 4JKDA 2HBLA 5IQQA 1IBLF 1FJCA 1WOQA 4OYMA 1YRTA 3MGIA 1X9JA 1HPMA 2YHWA 1S77D 2O8DB 2CRLA 3G8TA 1N60A 1FD8A 5EE3A 2VQFJ 4KB7A 2FDNA 4BR7A 4HDHA 3NWRA 4X64F 1OPIA 3V1OA 3QU4A 3AGKA 1QSSA 1JMSA 4P0PA 3MCOA 3G6ES 1HNIB 3H08A 3HX0A 1EQYA 1BU6O 2IM2A 2YKMA 2BQRA 3AVIA 2JC0A 3OVBA 4DN9A 1IBMF 2HHHK 2P1JA 2YWFA 4WXWA 4KMUA 2Q79A 3AN1A 1RT3B 4I2BA 2KV2A 4CFDA 2HF4A 3TANA 1RWKB 2GV1A 1Q7LB 1BL3A 3N5FA 5J0TA 1U49A 5FRNA 5L1MA 4KITB 3EKSA 3WK4A 3RF9A 4N5SA 2DHXA 3KK3B 1X5SA 4NLSA 3NVYA 3PO4A 3RBXA 1S6QB 4XH1A 1YJWN 3JSMA 3EMTA 5GAHI 2R2SA 1LCUA 2ZJPL 2VBXA 1HR0K 1I51B 1WF2A 1ZQNA 2FJXA 4P2HA 5LMUK 1EWQA 1ZQCA 1PIEA 2XLKA 1L7MA 1F0MA 3K0SA 5LXRA 1HNZJ 4CWBA 2V4QA 3GCWP 1V5VA 3D1HA 2KZMA 3TZYA 4A2AA 2IVMA 1WAJA 2C2RA 1BPZA 1A6SA 4ZPTR 1T9TA 2O8FB 4B1YB 4L76A 3RSEA 5M1OA 2FPMA 3WKCA 2PMZF 4GC7A 5AM2A 2PZSA 2JHEA 3QJPA 4IOAQ 1AROP 2R8GA 1TELA 3CTRA 3F56A 2Q36A 4FKXA 2P6TA 4IG0B 4J9NA 2QI2A 1Q86O 4FJHA 3ZSYA 2BUNA 4CTAA 2MSNA 1D09B 4H4OA 4O3MA 4OLOA 2QG9B 3WBZA 2FJ6A 3HP6A 5LSOA 1WEZA 5SUHA 3MMAA 1TV9A 2EDUA 2BKPA 3L7UA 2PYJA 2Q2RA 4RQMA 3CJ3A 3I4HX 3CJ9A 1UETA 2NQPA 1RCHA 4NJ8A 2ZD1B 1JCFA 4C4TA 1HX1A 2LKYA 4O4GB 4X84A 3MM8A 1BLUA 4DR4F 4PPZA 3M2RA 4NOHA 1F1BB 2P9CA 3B6PA 3OBIA 4TLRA 5DZ6A 4C4SA 2B4JA 3CDBA 4RQ5A 1Q95G 1W7WA 3PIPL 2KT2A 2KK0A 5HR6A 4ZP7A 4KHSA 2R8IA 4ED4A 2HIYA 5J0QA 1KVKA 3H0PA 5CD4H 4DI6A 3D7SB 2MKSA 3JAMY 4NV0A 1X4GA 3QICA 4DL2A 1H2UX 4J9MA 4CGGA 2ZH3A 5KG4A 4RUHA 2E6MA 1YITN 4BXOB 2EKYA 3U8XA 4UAUA 2Y0SC 3PRDA 1SQEA 2I8EA 5F8HA 3L2QA 4DUYK 4CF9A 1ZAWA 3LP1A 4K4SA 2E29A 3DRPB 4QYZJ 3QGHA 1P6TA 1TKXB 4ZTJA 3I0SA 4DV1K 4ZKAA 5JS2A 3LP0A 1TV6A 1N36F 5B0EA 3EWGA 4I2JA 4MFBB 3R1LA 2E2OA 1IBLJ 1FFSB 2GX9A 4Q8EA 1FDDA 2JLFA 3CCUN 3A4TA 2GGPB 3LQVA 4CJVA 1HLWA 3G87A 3SUOA 4CJEA 4OJPA 2OTJS 3P3DA 1HJPA 1SI9A 1MDUB 4XQ8A 2YNGA 2QA4N 1HKGA 3D4JA 4MEYA 5BOMA 2D3ZA 1JKHB 2WBMA 4ES2A 5DKWA 5M2UA 4NE9C 2OPSB 4NLZA 1MWKA 5AQNA 4JYAJ 3V4IA 1QTNB 2HS3A 7ICOA 2ZH6A 5GINA 3RH6A 3RFAA 1HKBA 3ONNA 4NLXA 4QWDA 2LA6A 2V8DA 3ZDCA 3VF6A 4DCHA 1CJTA 3D3BJ 3MCNA 3AM9A 2OD6A 4YY3J 1ZQGA 2O8BA 2V7YA 1SZHA 1BNOA 1M0SA 2GELA 2BKOA 4BR4A 3J81O 3TWZA 4FE3A 3D0PA 3LK9A 4QZDA 2C2MB 5I3PA 3IKMA 1ZQXA 1L3UA 4JD2A 1F44A 5SZTA 2JRSA 2MY7A 1RBOB 3DC2A 7ICJA 5LMUF 3J81U 1VQPN 1YSJA 1U1MA 4ZLLA 9ICSA 4AL7A 2Y8WA 4E7IA 2MLXA 4FWRA 2R9LA 4NEYA 1J6ZA 4A8FA 1Y11A 3PX6A 4JI7K 1UFKA 4DR7K 4YUDA 5LOQA 3M1FA 3DRXA 1T9UA 1K9MT 4UZCA 3IMQJ 5B66U 1FKPA 1MROB 2MUTB 3P1GA 5C2DA 5K8OA 1N5YA 1BWEA 5KFXA 1XNQF 5J8YA 1SKWA 4WCEQ 4IOBA 4FZYA 2C3MA 4CGZA 4OX9J 4M04A 1GOAA 1RHJB 1KBRA 1J2VA 3D2FB 1IM4A 3EZ5A 3VA0A 3GYGA 1DBDA 3O9SA 5T41A 2YQ0A 4E7KA 1S9GB 1RK8A 2HAFA 1DXSA 4MK7A 4Z7YA 2XO6A 2HBQB 1C2PA 1D8LA 1SXLA 2NS1B 2CDQA 2CQPA 2P6UA 2G08A 1RKIA 2ZEJA 2FI1A 2YB1A 1EP4B 2NO4A 2L48A 1TYQA 2LDIA 2L08A 4FVMA 3VV2B 4F3QA 4CZFA 4DQRA 2EFGA 2ZIUA 2ZHBA 3KG4A 3KLHA 4JV5J 2HLTA 3C16B 3UN2A 4DR4J 4TQSA 3SQ0A 4B3RF 1HD0A 1NMNA 4URQU 4B3OA 3CJKB 4FBTA 3M8WA 4E89A 4TQRA 1SV5B 2KN7A 5E7OB 1QQ7A 1W97L 4I27A 1RJJA 3GE1A 3QXGA 1UWAA 4ES3A 2C42A 4C0HA 3TJ8A 4G6VB 1CI4A 3DDHA 4BS2A 4GKJK 2HB5A 2JLGA 1QAXA 3MUVP 4OV6A 5KPRA 3PEJA 3CERA 4M8LA 4C8MA 1S1TB 4XRHA 3Q86A 4BQZA 3R9KA 1RHRB 5A0LA 1NNEA 3L0QA 5ADZA 3KDNA 5IWAK 3BJYA 4RW4B 2MKCA 6AT1B 3KLGA 1NK9A 1L7OA 5IV4A 4UAWA 4P4MA 1AT1B 3C2PA 4XK8C 4P4OA 4C3LA 3BR8A 1KRPA 5KFYA 2ZIVB 1S0NA 4YB1P 1ZBTA 4LF9F 5KNIA 2YTCA 2YMPA 5DQIA 1BC6A 2HRYA 3M6ZA 4M3UA 4Q0BA 1ATSA 1Q8BA 4QIWD 4YDXA 1LNQA 2HQGA 3OUYB 4CGDA 1VISA 1YBTA 1G2EA 3S3MA 2VCPA 2F63A 4DU1A 3KJVB 4A5BA 5KFZA 2B9WA 2F5GA 4USHA 1FHTA 4YG2A 3GFHA 3J7YI 4FJIA 4LF8F 4DR6J 3SLCA 8ICPA 3R5CA 1RADB 3PACA 4FLZA 4CIEA 2F3NA 1K9MO 1EKRA 1HUOA 5ALMA 1S1UB 1V5IB 4CE9A 4R66A 5RUBA 3CT9A 4KLEA 4UARA 2ZH9A 5JVGL 2H3VA 4TU9A 2XMAA 4PKHA 1RAGB 4HR2A 2D8CA 1BIUA 2W2MP 2D0CA 3F2CA 1C4CA 1X5TA 4JAXA 4DV0K 5J1EB 2CPXA 2P9UB 3VEXA 2XQCA 5ETNA 2CG8A 4USVA 3N7PD 3UMGA 3BS5B 1C0UA 2VA3A 2ZC3A 4GFJA 3CI5A 5AKKA 4KPCA 1HL6A 1HBUB 3FQKA 2VBYA 3FGVA 4ZHRA 4TU7A 4PL1A 2DGQA 3HVAA 3EGZA 4QCLA 2C28A 2JHDA 5M1KA 3SQGA 4J2BA 3MMBB 2HBRB 3SSRA 3CO0P 5J1NA 4IS7A 1H3DA 2KKVA 3HHLB 1XUPO 2ILZA 1HUXA 4I2AA 1L8OA 1NOMA 2LYHA 2MHEA 4H54A 4Q2MA 3L3CA 2P9NA 1SQGA 3BYRA 4DR7F 4EK2A 1QQOA 2C2ZB 3KLFB 1CXQA 1SL1A 5AM1A 1REGX 5JXSA 1ULRA 5HBMB 4IG3A 3THXA 2M2BA 2DY1A 2K8BB 1TUVA 2UUWA 3PW7A 2HNDB 3R7NB 2R3VA 4YOTA 3PVXA 2W6LA 1PC5A 1NJZA 3ILOA 4UB2A 4YFKA 4M0AA 2GA7A 3QEPA 3H1VX 4I68A 4Q2LA 2XYPB 4RL1A 3ZNJ1 1OKJA 3JYTB 2P35A 3M9NB 2IDEA 2P9PB 4FVUA 1HEKA 1SC4B 3ISNC 4KLDA 2W42A 3V9SA 1PVQA 5F8JA 1EX4A 3QFHA 1L8LA 4LC9B 4PWUA 2DR9A 4AQYF 5AQYA 4QZ8A 4H4MA 2X51A 2HBJA 4DQSA 1ZD5A 1AYEA 2KM8C 4FWSA 4KO0A 2ZH7A 3QWUA 2E5GA 3J7A1 3WX8A 3RAXA 4KLJA 4TURA 4Y2IA 1DOQA 4E2FB 3IWXA 1MA9B 3QUBA 8ICNA 3S3OA 1F9FA 1ZM3A 1C0MA 5I3UA 2FQQB 2ETJA 1NOZA 3BS9A 2WAQD 1Y64A 4QIFA 2OANA 4RPFA 3AODA 2VG5B 4Z7CA 4CHOA 1G99A 5L1JA 2ALZA 3C8YA 5E5NA 3EDQB 3HI0A 3I6PA 4PL2A 1FI4A 3KWIA 3OY9A 5E3AA 3IM8A 4RTFD 2HBKA 4KTWA 2EWHA 3AJ2A 3DM2A 3O4WA 1OUQA 4IH7A 2V94A 2HVDA 3MDQA 2VPZB 2W2NP 2W8LA 3UVJB 2AEJA 3BGLA 1DARA 4F8RA 2VJ5A 3PZPA 1DHMA 4NL5A 5FDLB 5DETA 1YGYA 3B6BA 1RWPB 2RF2B 3K75D 4JI3K 1RBSA 2DNLA 1VS3A 3EX7B 2X1BA 5A2QO 4IFEA 2ZDOA 2JH7A 1QE1B 4FJ8A 4DV4K 2BCVA 5CH7B 3QIDA 2G2OA 4FXWA 3HSJA 4H0XB 1MC8A 2EAOA 1IQZA 4OJ3A 2B8QA 4YXMA 2NLXA 4CF5A 5A2QU 1H7XA 1SIZA 3MZIA 3V81A 4F92B 4HEA9 4M63C 2F2AB 3OL7A 1BISA 3CJ7A 2ASYA 2N4CA 4OMFG 2FC8A 2BJDA 5F1XA 1M5KC 3R1HA 2LVWA 4EMDA 2BRKA 4PZOA 5HVHA 1SCJB 3CCQS 3JPNA 4QIEA 5DM6Q 2E2NA 3T69A 1TKZB 3W1YC 3HW8A 3ZX0A 3TO8A 3ZX3A 4LREA 3M2UA 1P7DA 1U1RA 5KFLA 4ZOSA 2F8LA 1GLAG 3RB6A 1RT6A 2B0GA 4DG1A 1QHAA 5ALNA 3NRBA 1T6DA 3GG4A 5M1PA 1HQEB 2M4MA 4LBHA 4KLQA 3BEGB 2ASDA 2KZ3A 2VIHA 2BKNA 4CJ5A 2KJ8A 4DV0F 2Q3PA 4KLFA 2ZUCA 3KJQB 4A62A 3N7SC 4Z4HA 1QM9A 2UVRA 2EW9A 3FBBA 2HMIB 4F4ZA 4H5NA 4NRUA 2HCFA 3ZT1A 2E1RA 2QKQA 5GADI 3RJIA 1GXLA 1NJWA 2YX7A 3DDNA 2VOOA 2AYEA 2F4VJ 3AVMA 1WI6A 1U8SA 2CH6A 4QR1A 3ZD8A 4CJLA 5AKIA 4LFAK 8ICAA 3LW5C 3UE2A 1K8KB 3K2PA 4K4HA 3I0RB 4RW7B 3VESA 2V9WA 3GOIA 4TY8A 2IFXA 1QSLA 4BRIA 4CGJA 4DL0C 4NLTA 2HHTA 4OLAA 2GFFA 1O8BA 4Z6FA 3VWSA 3ZZOA 3O3GA 3JPPA 1WORA 4CK2A 4ZIWA 1YJNS 9ICGA 4O3OA 3TVZA 8ICYA 5C24A 2IYGA 4BRPA 1UW4A 3NGYA 2PI4A 1SIJA 2ZOFA 1ZQSA 3SMVA 3PMLA 3GSDA 2HS4A 3OPXA 2KYXA 4M5DB 1ZZFA 1Q4RA 4JI2J 1ZM4A 3O6WA 1U2FA 4ED7A 2Z1GA 3CCRN 3AO1A 2B6AA 2HHPA 5BJRA 3SUQA 2Z30B 2HOQA 3M6XA 2JEJA 2FGOA 3DYAA 4FM2A 4BC7A 1DLOB 2VBZA 4NLWA 2A2DA 3VERA 2C3YA 4RZRA 3ISCA 3SCKE 1F2GA 2JZBB 3I87A 1JX4A 2E66A 7ICTA 3NGSA 3OTOF 3ETLA 2MGZA 2MZSA 4LD0A 1BO5O 4BC9A 3KD1E 4L3QA 4JI6J 5GAEP 4JKHA 2CQ0A 5HMZA 3CCMN 2VKZG 4I2DA 4ZPCA 4CBWA 2NPIA 1UFLA 3TFRA 2F1IA 4C8LA 2GOLA 3R5JB 4H5TA 4OPJA 4FJLA 2BJ3A 2IHNA 3WC0A 2MAXA 3C6TB 5KL1B 2BANB 4JI0F 5KG5A 2R7QA 9ICUA 3W65A 1ZQEA 4B02A 3TRGA 2W03A 4GY2B 2PEHA 3CRXA 4E19A 7ICFA 2HSEB 2H4WB 3BREA 2QWRA 2WAQC 3PYDA 3NS6A 2QA4G 1P9YA 4RW8B 4JI3F 2EG1A 4CDIA 3M2VB 5J0WA 4KGZB 8RUCA 2B9EA 2YQEA 1BA0A 3O8MA 3GYXB 5E2QA 2CPZA 1R7IA 1UVLA 1X4FA 4IZ9A 5AKJA 1NDPA 1UFWA 3KFWX 4AHRA 3MAAA 3UR3C 2RLTA 2UXCK 4EYIB 4LRFA 4JRQA 7ICKA 3ULHA 1RBLA 4X62J 4DOCA 5DDYA 4D3HA 4XH4A 4FF2A 2G8HA 1NKCA 2VV5A 1WDDA 2DTJA 2E8MA 4LVNP 4DOBA 1QVGR 4JI4K 4MLHA 1KLMA 2D6FC 2P9KB 3THWB 3NH0A 4DX7A 1GMWD 4YCXA 3W3DA 1JLFB 2AGQA 1YLXA 4E7JA 4A8KA 3QO9B 4X65J 4OKEA 8ICJA 1DT9A 3OHRA 1BA1A 2JEFA 3KMQA 1MNEA 4NLKA 3G6EN 2LU2A 2XHWA 1N4LA 3ITHA 1VGYA 3MR2A 3WXIA 3DXSX 2BA9A 3DHWC 2DPNA 2GJIA 4WP8A 2YHXA 2LDYA 3HYFA 3TTFA 3ENBA 1Q3VA 1LEOA 4OFZA 2J9EA 1H73A 2MZQA 2C3OA 3GZ7A 4NX9A 3RJKA 2JEGA 7ICQA 5J0YA 4N7TA 2ZKUA 4X4UA 1M5SA 3T1YJ 3ZZUA 1XO0A 1SC3B 4WE1B 4CFCA 3WXMB 5K8NA 2Q31A 2KVSA 2GJ2A 3V6DA 3TX0A 1X42A 5KG2A 2IIHA 4NCGB 1HPZB 4PYDA 4PYAA 1MWMA 1NSQA 1TUYA 4DX5A 2UUCJ 3D6HB 5KG1A 3ZT2A 3Q8VA 1SVDA 3DLGB 2FBXA 2QL5B 2ZUDA 4LFAF 5G4DA 3D6JA 2H3GX 1FFVA 2HYIB 2QWOA 1RT1A 3P38A 2OLWA 5AXNA 4KAZA 3NAHA 4KRFA 4ECTA 1M1KT 4O44B 1Q0NA 3ZNUA 3B0YA 3POTA 4P0PB 2CH5A 3HVRA 1WSIA 1JLGA 2Z0GA 4KYZA 4Z0UA 1PC4A 4BRFA 2YKMB 3RG6A 3LZIA 4LF6K 5IFMA 1JI7A 4FNHA 4PZNA 1SV4A 3KXDA 3FCWA 1C1BB 1NGBA 1WACA 3NMUA 2CQ3A 3EKUA 3VQ4A 1AXQA 2X1FA 1RU2A 2CYYA 3L7PA 2DHAA 5D4BA 3O1LA 3RJGA 3VQAA 2I38A 5HMYA 2KU7A 4IOAL 4JNEA 1QH9A 1Q7YT 3QGGA 1NKEA 3IFRA 4YNQA 2ZDPA 3NF7A 4YOWA 5I4MA 4W5NA 5H9FK 5BR9A 4QPXA 3Q8LA 1YKWA 3MPUB 4DTSA 3JSMB 3VMFB 4KH6A 2BBEA 1LKYA 4HT5A 3SDEB 1M5OC 1IBKK 2BJ7A 3G8QA 4QOZB 1FE0A 4NXMK 2H3IA 3EXCX 2DFLA 1SXDA 5KTQA 5HQLA 3UN5A 1LWFA 5GIOA 4OZ1A 1VJQA 2WSFC 3UFCX 3G10A 3SFGA 1QVFR 3VCBA 2V2VA 3AVAA 1DY3A 3CCVS 2Y9TA 4JI0J 3QNOA 3FRZA 4ZCMA 2VQEK 4F04B 4F3OA 3OYDA 5CJ7A 4EZ9A 1N0UA 3C66A 3W2WA 2PFNA 3HFVA 1BUXA 5TKYA 4H4OB 2AT1B 3DRRA 1NGEA 4ETZA 4FWKA 3F41A 2CQ2A 4YDUC 3MMCA 2I9GA 2K1RB 5J2AA 3M4XA 4EELA 4Y2KA 1SJFA 2KG0A 3SR6A 4AUKA 4G9ZA 1RTHA 2UXCF 1X0FA 4NA1A 4ZPWR 5ALUA 2UYTA 2A1BA 4QS7A 2DGUA 2ERRA 3C23A 2ZIWB 2F7VA 3CJ2A 4EO8A 4MKYA 3NF9A 5U47A 3AHPA 2VG7A 4IFYA 4DJBA 3BH6B 2OYYA 3H6EA 2RJZA 4OYXA 4CEDA 3RH5A 3NNAA 1NDCA 3QLHA 1U1QA 3DXMA 2ILYA 3F9KA 3UKUA 5E3QA 5IZHA 1VFJA 3KWGA 2DGOA 4J2EA 4FP9A 5KT7A 1YJUA 3GDQA 2IRUA 4FO6A 4RU9A 4LY7A 3OYAA 1SV0C 1M1KO 5LJ3Y 5BPLA 3GL1A 1U1NA 2LMRA 3PFEA 1FJGF 3A3OB 4K5SA 2FJVA 4OGEA 5L38A 3TUPA 4K0KK 1T3QA 3VQCA 4CF0A 5AIAA 2VYPA 1FIQA 4CF4A 3I28A 1PO6A 5KRTA 2BUPA 4F5NA 4U96A 1X4CA 4EIAA 4Z2XA 1MQ2A 4DPYA 5CHGA 1X5OA 3O3FA 1I94F 2QYGA 3L3VA 2FBTA 1TV6B 2HGLA 4Q45A 4OI1A 3V9UA 1N33K 1Q7YO 4CJ7A 2XMUA 2F76X 2X1AA 4RW9A 3E9LA 3DDKA 3W2VA 1E4GT 3PHTA 3A3NB 3NGDA 2JGUA 1KWMA 5M1FA 4IR9A 4HWIA 5IINA 1XR5A 5HRSA 5JU5A 3IAM9 1T3VA 2NXNA 5HP1A 4C23A 2IDLA 2P9IA 5EOYA 1VQMS 4MLEA 1ZQFA 5KAFU 1ZXOA 1EWRA 1OYDA 3EN9A 5H2FU 2FVCA 4PGQA 3RGIA 3V4IB 2QMWA 3BKTA 1FO1A 3U4LA 4KLGA 1OO0B 2W54A 3QIPB 2BM0A 3HSTB 2BE9B 5AE1A 2BOPA 1VSEA 3QMQA 4TN2A 3KLVA 1OH8A 3VVUA 3C0BA 3QESA 3DMJB 1RQNA 2SXLA 1U6ZA 4WCEL 2OJ3A 3MCSA 2O8BB 5IT4A 4FWLA 1BQMA 2YKQA 4IH6A 4B17A 4M9NA 4P75A 1KKHA 5D4LA 3IDWA 1EETA 1P8GA 2EC0A 3KD5E 4CNQA 1KONA 2CPFA 2G2YA 4BQLA 4I2IA 3N01A 1L3SA 2E44A 3B8HA 4NYPA 3B4DA 4JD2B 4CJUA 2C3UA 3QFWA 4YB6A 2WB1D 5AKYA 3SAGA 3CCJS 3UD3P 1PJ5A 3FR0A 5ETPA 1LW2A 1U2VA 5D3GA 3O3HA 4NXMF 2W2PP 4N41A 2ZM6K 3JPRA 3UXNA 3SCIE 2Q1LA 1G3OA 3HL8A 2A0FB 3RMBA 3CC7S 7ICLA 1ZZNA 4J03A 2DH8A 4W5OA 4C2MA 1RBVA 5D4PA 2R8HA 3MMJA 5AJ3J 4J2DA 2V0NA 4FYVB 1VI7A 3CNQP 2A19A 2QWQA 2YB4A 5B0GA 4GVEA 3MR7A 4Y2MA 2ZF5O 1B64A 2VQEF 2VC0A 3D6RA 4IO9Q 1IKYB 5A0YA 2ZWHA 4KHMA 3G6VA 4RJVA 3PO5A 4FYDA 1L7NA 2XS2A 2Y1JA 4M3TA 4DV3K 5HLFB 3QB0A 5TKWA 3AFGA 1J5OA 2J9CA 4UY8T 5K8PA 3E01A 3KMSA 5ALDA 4CCHA 3ET6B 3T1HK 3MX2A 5AQQA 1WDTA 4Z4IA 2B3TB 5KFWA 4LF7K 2BV3A 2UVWA 3OTBA 2R18A 4H4KC 3SNNA 1XI1A 2B21A 1KTQA 4BG8A 2R7UA 2IDOA 3ZETA 2FMSA 3DOLB 3BSCA 4CBXA 5KT5A 3TABA 3I9V9 2W24A 1URNA 1RT2B 3TJ9A 1F5CA 1VQ6S 3H4DA 3CD6S 1JCEA 4DLGA 4USTA 2IPOB 1ZM2A 2N1RA 3HHDA 4ANCA 4JKAA 4BR5A 2O67A 3A8IA 5FPMA 3F2KA 4FYWB 3WX4A 5THWA 1AW0A 2CVIA 2J6TA 4A4JA 3P39A 1NK7A 2YNIA 3H42A 1CRXA 4HDGA 1R6VA 2RDDA 2GCFA 4R64A 1NDLA 2KFYA 1FJGJ 2BCRA 2PE8A 3PV8A 1KDHA 3PTWA 2UXBF 5EU7A 4YHHK 3KOAA 2X7IA 1GFWB 3KLGB 4M2YA 3ILIA 1IXRA 1RA6A 1GTEA 3U1MA 5CYMB 2V4RA 1ZETA 3P5JA 3CJRA 2YY3A 3CIZA 3M05A 4WFAQ 3GIKA 4Y2SA 2OMOA 1VBKA 3CCTA 4Q0BB 1N33F 3TUZC 1S12A 4WZQA 3MTKA 1N32K 4HLBA 1ZBLA 1T3OA 3S3NA 4OJRA 1S6PA 3CFPA 1UA1A 1NWKA 3OT9A 4JI1K 4LF4K 1RCOB 1GLFO 1IV8A 4DSJA 3UQSA 2WBNA 2UUBK 2H9ZA 3NP5A 3M32A 4K50A 2IJFA 3QAEA 3TVYA 2GQ2A 1FKAF 1YAGA 5IIOA 1N34F 9ICRA 5GAEI 3C95A 3VZIA 3NFAA 2FVSA 3FUYA 4NI2B 1VQ9S 1TVRB 4ZVHA 1V6HA 5DB8A 2RHFA 4DL6A 2KYZA 4Q5VA 1WBDA 4RBTA 5HROA 2M5YA 1IWAA 5K4LA 1U25A 5F8NA 2DUYA 1GEHA 4PKGA 5H9EJ 1WTBA 1M5VC 1JLEA 2L3MA 1I5OB 2WUSA 5GTHU 2KFZA 4UY8O 3CQXA 4IQVA 1SH0A 3OYHA 1U1PA 4AHVA 1NJYA 1LB2B 3ZZRA 4ES1A 4ZHRB 4JI5J 5AK4A 1ELOA 3BN7A 3TZWA 2LM1A 1NSKL 3SUNA 3QUQA 2YJFA 3WK8A 4X5VA 1SZ2A 3OW2M 5CEHA 5L8RC 4CJQA 4E1JA 5ALLA 2RDJA 1UVNA 4JV2A 3WT0A 2P9NB 2BTFA 1ILYA 5ALEA 4UOCA 2QSFA 4XDDA 1YI2N 3WU2U 3SCXA 1ZOLA 1FKOB 1YRUA 1ZS6A 3VEZA 3BB5A 2DTUA 2WHOA 3CHWA 2IRXA 4CI0B 3GE9A 1N5TA 4BRNA 2P66A 1CZBA 1NOYA 4IBNA 1WEYA 4DV2K 4DV3F 4DMZA 5G5HA 3QIOA 2A1RA 3UKRB 2FBYA 4BRAA 3BN4A 5F0WA 5J0OA 4J91A 2WBRA 1RBUA 3P4UB 4CZCA 4ZPVR 3W5XA 5E26A 2C22A 4ISEA 2FGCA 1NMDA 5FPDA 2YWGA 4O5BA 3NH1A 4H4MB 2DNMA 3ZT4A 2GMLA 1ZA1B 2BDPA 5A8RB 4PPXA 1HJRA 1B99A 3AU2A 1HLUA 2E1PA 1NZAA 2PBDA 4Q43A 1HR0J 4CYUA 3J7Z5 4HT7A 3O0FA 4CF8A 4XO0A 5K14B 3VF0B 4YOUA 1E6VA 2HQDA 4GKKK 2XICA 4LBPA 4JV0A 1X9SA 5LJ5Y 2ODGA 2XULA 3S01A 2QYCA 4IFVB 1ZQUA 4C8OA 3MOJB 1M5HA 3HX9A 4ED6A 3ILJA 3WIVA 1KVBA 3IG8A 3A8YA 3VQ6A 4C4WA 3CULA 3ZSOA 1LV5A 3OVSA 4USKA 5DM6L 1CSJA 4WXOA 2E5LF 4GVMA 3MFHA 4C98A 2ZJAA 2UXBJ 2ZIXB 3WQUA 3EL2A 4YHHF 2IM3A 4OI2A 3UB5A 5CE3A 1F5BA 2F44A 3ZDDA 2EQYA 3A12A 8ICCA 2WONB 4C3KA 3ZSVA 1W2IA 1HYZA 1LOUA 3MCMA 1IKXB 3LPTA 3BBFA 3QRQA 3VA3A 3CCSS 4BRLA 5B8HA 3RYLA 2WOMB 4YOXA 3FSYA 4BC3A 4K25A 4GV9A 4AILC 2GAHC 4RNOA 4RT3A 1PBAA 2HVZA 2NSCA 4CO4A 1D5AA 1HI0P 4DQIA 2UUAK 1NHKL 4PHAA 1RQ0A 2P51A 3WQPA 3AOAA 3OFHA 3L5KA 2I7NA 2X6NA 3EE8A 2AMCB 3O1WA 1FEHA 2QRRA 4X4PA 1H72C 5HN0A 2I2YA 2QX0A 1Y88A 3ISZA 2UUBF 4BR0A 1S1VB 4AXJA 4BRKA 3UD4P 2YNHB 2XBPA 3X3UA 1VSIA 3OTEA 3H45C 4F4KA 3OXGA 2HRUA 2HQCA 4LF5K 2QTDA 2RB7A 4KB0A 3GR0A 1RT6B 1RZMA 4DG1B 8ICLA 4I2HA 4MQ3A 4X4OA 1N88A 5AK5A 1QAJA 4KTZA 4DV5K 4K4TA 4C4RA 1S9EB 5D15A 3GIRA 3J80O 3QT5A 8ICUA 3HKZD 2RN2A 3C6UB 1YTAA 4DUYJ 4LF1A 2J5AA 4ILHA 2KP7A 5KL8B 4OI0A 5AI0A 2V68A 4LT6A 4IJAA 1SBRA 3MEGB 4DDFA 3NVMA 2JZ5A 3J80U 1TKDA 4CH0S 3NLCA 1W2BM 2BW2A 1HNWF 5B0AA 2QO3A 3K5NA 2ISPA 3VPZA 4FDFA 4NZ6A 2QMUB 3JPOA 5C7PA 1HBMA 5DK5A 2QWMA 4F4WA 1Z1ZA 2KHQA 4KJIA 2OTLS 2HFOA 2NO5A 2R7XA 2KRBA 2IVYA 3HRGA 4TY9A 1WCNA 1RDRA 4HUFA 2QB1A 5JMNA 1RAEB 4BACA 2HK3A 1BPBA 3TUIC 1B4FA 4CRXA 2A3JA 3OA9A 3BDEA 1RYRA 4DXLA 4ISFA 5AQSA 1U2RA 3LTOA 4YXJA 5FLXU 2C1EB 3GONA 4DV2F 1GXTA 4JKBA 4XIUA 3IN5A 1TUGB 2O01C 1WOPA 2P9SB 4M63A 3KWMA 2BMBA 5KFTA 4KMOB 2CPDA 4HYKA 2X78A 5KFDA 1WELA 1KN5A 4DS4A 3DYAB 3M8QB 3SCLE 4OI4A 3NTUA 1GLJO 3DXKB 5EHHA 4FPBA 5JUMA 3T6JA 2ADBA 4G1PA 2HF3A 1SJQA 3QEIA 5F9NA 4I6YA 2R42A 2MGZB 5HSPA 4R5PB 1K5OA 2CNOB 5AKXA 2BKEA 2XSJA 3U6FA 3GU0A 4KLMA 4I2EA 1CS4A 2BCQA 4WFZA 3DI6A 4NMLA 3E3XA 4USAA 2W25A 1X6IA 2IM1A 3H8YA 3H0LB 2I1RA 4KE5A 3WIUA 4I6MB 1KTVA 2W9CB 1LW0B 2OEKA 4F67A 3MAHA 2VA8A 2MQOA 1S1WB 2AX1A 3DLJA 4NLGA 2ZGYA 2E2PA 1HNVA 5AQOA 5AQUA 4AM6A 1E4FT 2XY6A 3UMBA 1VJWA 2QN6B 3D2QA 5K8MA 3BSOA 5ALVA 4I69A 4PXBA 3FMWA 1COKA 4OV1A 1NMEB 4DR2F 5F8IA 4MTPA 3MAAB 1RDCA 4J7CA 4IEIA 4OHYA 4JKGB 3MABA 9ICTA 4OX6A 1D9FA 4URSA 4HUGA 1LFWA 4RUAA 4M9JA 3GV7B 4NRTA 1ASWA 4M3XA 1L6NA 3GIIA 3BGRA 4ZVPB 2NUBA 3HPHA 3EUNA 1NCLA 1HYSA 2UU9K 5BOLA 5AQRA 2I6XA 3V2UC 1KLMB 2AF6A 3AU6A 4FSVA 1VQ7N 3C6AA 1B70B 3TAEA 4GV3A 1RE1B 3OTQA 1RABB 1PK3A 7ICUA 1T05B 3M9MB 1JLAB 2ASOA 5SWMA 3EWAA 3SCJE 3OR2B 2ACMA 4NLDA 4B1UB 3B8AX 3RBZA 5AQKA 2WMMA 2G8VA 4I64A 4PHPA 4JLHA 3HJFA 2FF6A 4Y2VA 3P83D 1YDLA 3C15A 3U1LA 2A40A 3ITHB 4I28A 2BZ2A 2J0XA 2D7SA 4OD0A 1RAJA 5B0DA 5IWAJ 4ID8A 3NNHA 5K20B 4OGCA 3ZX2A 5ETQA 5BREA 3EE3A 3V9ZA 1RLCL 1WTFA 4KHPK 3VGVA 2ZUAA 1HD1A 1GO3F 1RUSA 1K0VA 5C12A 1W7AA 3B82A 4XH5A 3VF2A 3DJCA 4IH5A 4UAYA 3VTIA 3EVWA 4C8NA 2GUIA 1RQLA 4KH0B 4KV8B 1B22A 5FP0A 2IBKA 5KFAA 3L7OA 3KZBA 3MR3A 3NUQA 4J9PA 3UPQA 1F9EB 2MZJA 1RDUA 4L8RB 4MFCA 1S99A 2FTRA 1O13A 3W9JA 3CVKA 3CXCR 4LFCK 3NMRA 3QX7A 3WNEA 4DR3F 1TL3B 2AXTU 3RTVA 1EKSA 1NSPA 1XSPA 3A13A 3POTB 3AB4B 4RBUA 4FL9A 5AZJB 1JLGB 3ZEUB 3VOVA 3HHEA 1RTDB 2CDRB 4ANEA 1KQSR 5HJXA 1X4BA 4Y3CA 5DJBA 4B3TK 1KP6A 2DCLA 2HZCA 3VQQA 4F4YA 2NZ4A 3AV9A 3SQOP 5F8LA 1W0HA 2XWXA 3M8RA 3CIPA 1HNXK 3CJTA 3K8VA 3OLAA 3AVHA 1CULA 8AT1B 4JS4A 8ICWA 4I7FA 2PFUA 4K8RA 4RNFA 2WC9A 5E3RA 3X1LB 3QNMA 2RS2A 4W4MA 1ZJNA 1CJVA 2V2QA 2NR0A 3AA2A 4EFHA 4JRPA 2EAPA 1RWWB 4K4GA 3CSKA 3ULEA 5EE1A 1XU4A 1VHFA 1WWHA 3K59A 4C8KA 1LKYB 4KTQA 1KVAA 3H59A 4RQNA 2ZBIA 4BRMA 2FJAB 2CJXB 3SENA 1AUSL 1F5AA 4PEOA 1ESVA 2KFNA 4FJGA 4F5RA 5FJ4A 4WQ5C 1LWFB 3BPSP 2KD1A 3U9ZA 2KI2A 1KVIA 4P2XA 2XMWA 4DPUA 3DLEA 1C0TA 1C1AA 3AVLA 4FJ7A 4ZN1A 5J2MA 1RDWX 2RP5A 1Z6RA 1BPEA 1F60B 2QA2A 3RZAA 4F2SA 4C0OC 3RB0A 4PPDA 3R8EA 4FZNA 3CCZA 3AXKA 1Z00A 3ZT0A 1PSDA 4OI6A 3TZZA 3MWBA 4OZNA 1R3NA 3OYBA 3K7RA 1S6UA 2J8AA 4PQAA 2DY4A 1MLAA 2QIFA 4UOGA 2E1YA 1CJUA 1NLVA 5C0YA 2AHOB 4PG6A 4WFBQ 4USMA 4ZN3A 1RTHB 1IKWA 2IMOA 3TA2A 3O4QA 4CM2A 2MDAA 3TARA 3BBCA 1RAOA 3IV6A 2KXHA 3CD0A 3LZJA 4QJVA 4H8KA 4RUCA 2GNKA 5DRKA 9ICEA 5KI6A 4NYOA 3MPVA 2UU9F 5J0RA 1FDNA 4IFYB 2VG7B 1R0AB 4HACA 3VTHA 5KGWA 4QPTA 3C5GA 3QLHB 4CLYA 3EO3A 1UJ6A 3E1YA 5DDOC 3AA8A 2M70A 4B3MJ 5AQJA 4G65A 3NBPA 1UP1A 5AQLA 5FROA 4OKJA 2X3DA 2J9DE 3PW2A 1R89A 3FRYA 4ZCLA 4CK3A 1D9AA 4WKYA 5IT0A 3GILA 2H5XA 1PILA 4X4QA 3H20A 1IM6A 1FFGB 3M1VB 1BCMA 4KN4A 4WF9L 1I1GA 4AE5A 2A6AA 4LSLA 2P9LB 5AZIB 9ICJA 2MY8A 3MAQA 2AH5A 2RHSB 4NXNF 3DDIA 4K2XA 4CJFA 2B5JB 1CEZA 4DCOB 3QFUA 3HILA 1ED1A 2ZZNA 3MM5B 3PSFA 4C1NI 4AT1B 3SAHA 2WZ1A 2K8CB 4MF8A 4V19S 5EXWA 3WNGA 1C1CB 4NLNA 5G5GA 3W2VB 3HHLC 2XM3A 4FXDA 4A46A 3FM9A 4QR0A 5KQDA 2RKIA 1SJ3P 1A5XA 4EYHB 3Q8MA 3CCJN 5IOLA 3BGUA 1XS9D 1TMJA 4KHWA 1TL1B 5ALSA 4JN4A 3HPGA 3TR5A 2P9IB 5ETTA 4FS2A 3QINA 5CHCB 3H2LA 2DGWA 1RXOB 5M2PA 3IHQB 3FC4A 3K1RB 1NGDA 4YDUA 2QL7B 2KIWA 1ZQJA 2A5XA 2OA8A 4B3TF 4UUWA 2BZFA 3PXGa 4NZ0A 3CQYA 2LYAA 4NCAA 3H4BA 4DFDA 4LRAA 4O23A 2LXFA 1HNXF 4WP9A 4UUXA 5C25A 2QZ8A 2GBZA 2J9DA 4YVZA 4CT9A 2VDHA 3P5BP 1Q9XA 1X4HA 2CPJA 4IO9L 2CADA 2VQFK 1XSLA 4DU4A 2WF9A 4HI1A 4OQJA 1EETB 3UN3A 4MF2A 4KFBA 2KIVA 5ETLA 2V2KA 4F0KA 1T11A 1N63A 2RQ4A 2QA1A 2B7BB 1VQON 4Y0WA 1UQVA 2XLJA 4DV7K 3G4SS 2H5IB 1LW2B 3RRKA 2DBYA 3OYMA 4DEZA 1Q16B 3CD6N 3O9TA 2WF5A 2XMJA 1W9HA 3T7ZA 3H2VE 3ZC4A 3V1QA 3ILLA 4KC5A 1N8RT 5KFIA 2M9NA 3NCPA 3SV4A 1UWBA 1Z05A 4R63A 4TLQA 2W7OA 2PSZA 3KTQA 1JXBA 3HVTB 2E1AA 4CH7A 4FJNA 3EW9A 4B3SJ 3NMAA 3DXBA 3I4PA 1UHUA 1EJ7L 1VQ8S 1J5OB 2NRZA 3H46O 3M5RA 1BXNA 2E7VA 2PMWA 4MK9A 4I56A 2ASJA 1KFDA 5AIBA 3QQCD 1Z3EB 3K5LA 2YPZA 3OYLA 2XRIA 3AA3A 1DTQB 1VQ4N 4KKOA 2FB0A 4PQUB 4PXCA 1CXUA 2QLXA 2V5HG 4W98A 3F5TA 4UY85 4EP4A 3J7AN 5EE0A 4WTYA 3ZETB 2IOHA 2J7UA 4ZJQA 1ZQ1C 3ZDAA 1SKRA 3N9UC 1WKLA 3BH7B 2QE5A 4LJXA 1Q3UA 4WFAL 3IRXA 3UDEA 1TFWA 4O0NA 3US5A 9ICBA 3Q0AA 4L74A 3T9NA 2DHGA 1WD6A 2XYHB 4MO5A 3I55N 4JS5A 1NEEA 2DIVA 1OIAA 4DR1F 4USUA 3RJEA 5CCLA 4ZP6A 4YN4A 1EQMA 1TL5A 3R5BA 2OHFA 2EFQA 4B1VA 2W01A 1EXQA 1IV0A 4CJKA 5KFCA 2YNIB 2H3FA 3O1BA 1HRHA 3LWLA 3CQ8A 2QARB 3DRSA 4CHZA 3NWGA 1CQNA 4MH8A 1VQ5N 2QW9A 2GTDA 4R25A 4QAGA 4DTMA 2A6MA 5IM0A 2DPJA 1X1PA 1VRUA 1K73T 4FPRA 5J2QB 5JVHQ 3OYIA 1JALA 4DR5K 2QB0A 2H3EB 2H4YB 4AH9A 4QZHA 4NXNJ 4OYWA 4BRHA 1LWCA 5KT2A 1XR6A 2DGSA 2R7OA 2XLIA 1NGFA 3W0LA 4GO7X 5CXTA 2AJ2A 4EP5A 3MR6A 5LL6d 1UPHA 5AK3A 5MAOA 2RQKA 2YPYA 4XTTA 2D69A 3Q83A 4JI4J 4OPAA 3AT1B 3NOGA 2YWEA 2XHCA 3TYTA 3ID8A 3RR8A 3HFZB 1H1VA 2ZQBA 3CCWA 2AP1A 4A5AA 1JUDA 3GIMA 1VQLS 4WJBA 4ILRA 1B9FA 1RPLA 3VQTA 2OPPA 3ZZYA 1JL2A 3H1QA 4ZOHC 4KGVB 3R27A 5E41A 5AM4A 4JI8F 2N3LA 3CC4S 3UQ2A 4QYZK 2VANA 3G8SA 3VQPA 4W5TA 1NGCA 3R6MA 3D2NA 1IKVA 1N8RO 5C2FA 2DITA 1YWXA 4H4KA 3T41A 3V5RA 1QQMA 4WK3A 5L9XA 1IBLK 2ZZMA 2IY5B 1KSPA 7FDRA 4O4RA 4KLLA 3VENA 3D1QA 2H54B 2G9OA 3FBCA 3PY8A 2ZC4A 4ZPAA 2VQFF 3MM7B 1O6XA 1Y10A 1XO1A 2BGWA 3DGPB 4CHYA 3L4PA 3FZKA 1Q82T 2CIMA 2NYVA 4CJWA 2DNGA 1NU4A 4JYAK 3G2XA 1IBMK 5IC4B 4E7HA 1LFPA 3M8PB 4NY8A 3CJ0A 3VQ7A 1ATRA 5BYQA 3SBTA 1PG5B 3GFZA 4DFPA 4M3RA 2VJVA 1TKTA 3C7NB 1TL7B 5T7LB 2E3TA 4ZCIA 2HNYB 2MJUA 4H0YB 1XQSC 2ZBPA 3CCEN 1V85A 1LXJA 3HOTA 4ECYA 4I29A 2F9JA 2FHJD 2ROPA 2LQ9A 5CB1A 1B7FA 4LF6J 2AP6A 2RD5C 3R1XA 1CUKA 4UOFA 3EXYA 2LCWA 2DFEA 2FLNA 2FZKB 1VQNS 5D77A 1NK4A 3Q89A 1KAZA 4BWJA 2DKXA 2G2ZA 4RPYA 3QPIA 1BHLA 2E1FA 3JTOA 5H1SV 4CF2A 1RHKB 4JK7A 4UAVA 5ETSA 9ICHA 4BBYA 5CZ1A 1K73O 1HNZF 4LSZB 2Q97A 5FPEA 4JB8B 1YZ7A 4GXIA 2ZBQA 3J81j 1RWOB 4ZVOB 4RPXA 4J9SA 2B9XA 3T6BA 5KFMA 5D0HA 4K4IA 5T14A 2Z2ZA 1HHSA 2P6SA 3EM1A 4FK4A 2DYAA 2AQ0A 1E6VB 2M8DB 1NM2A 4RX6A 4G1QB 1RT7A 1YG0A 2VPXB 1KVJA 4I2GA 3HO1A 7ICGA 4OHVA 5LJVA 3IMXA 4AP9A 4Z37A 5E3PA 1F0XA 2WF8A 1Q9YA 4K4XA 4FCYA 3I9ZA 1NB7A 1GLEG 2MYFA 4NLQA 3F2BA 1X4DA 5JICA 1AA1B 2FHMA 2XS5A 1O1WA 9ICNA 3CO9A 4F3MA 2GO8A 5M1QA 2N7CA 3CUNA 4F4AA 1Y5LB 4X66J 2JWKA 2DFHA 2GIRA 2KHDA 4RCHA 4CZIA 3L3FX 2LM4A 1YBUA 2CJYB 1JXVA 4DR4K 5ALQA 2LP4A 4ZVGA 5BN9A 3K17A 1HMVA 1G7CB 4UB4A 3RB3A 4L72B 2P5GA 2G8WA 2CVEA 2IOFK 2I5JA 2RHKA 2Y0SD 4ILMA 4KLSA 3IRWP 2OSQA 4PUOA 4I9QA 4FLTA 1S3XA 3MM6A 4CFAA 5ALOA 3PYGA 2NUUG 4MAKA 1KKXA 4FW2A 4QZAA 1WLJA 3UCUP 3N97B 4UF4A 2M9KA 2NLWA 3D9BA 2FJBB 2XI3A 4UQGA 3LAMA 4TU8A 3Q8RB 3WC2A 2O8CB 1Q82O 1SKSA 4B9TA 4IDKA 1YIJN 3C14A 2G07A 4M9GA 2OTLN 3ZLJA 1UEUA 2YMLA 2VONA 2DEJA 4QIWF 8ICBA 4PL8A 1NJXA 2HHXA 2BJ9A 3RUBL 3QETA 1RWVB 4XEIA 4YOEA 2XMVA 4J9OA 2NZTA 5EN1A 2DR8A 1N36K 3JQMA 4YR0A 4KH5A 4KLIA 2DNRA 1QY7A 4DL5A 3OYGA 1UL3A 4K0KJ 3LGNA 3FSXA 3FEYB 3PR5B 1MMDA 4YB7A 1U09A 3TADC 1TU0B 2C3PA 1L3TA 3ZZZA 5ALRA 3GG0A 4Y2QA 1GXUA 5LMNJ 1S7IA 3HF5A 2CZ4A 3OFEA 3U27A 1L5UA 1NZ8A 4HTUA 3E2EA 2CPHA 3OD2A 3WKDA 2P9EA 2BCSA 4B9UA 3KUEA 4R8UB 3CE8A 4PWWA 1ZTWA 4LIWA 3NOCA 3IGVA 4JYAF 1FXXA 2V4JA 4A8SA 3SFUA 2CPEA 4KR0B 5HVGA 4GVBA 1R59O 3CIMA 1BI4A 4F5PA 4NM1A 2IA0A 5MLCV 4A8EA 5ALZA 3TQEA 1ZBIA 3CD7A 4CLWA 5AQMA 2VBWA 2IC3A 5AKGA 3O80A 4NASA 5DG9A 3Q8UA 4YY3F 3LYSA 1KAXA 2D4WA 4BX9C 3C29A 1JN3A 2OPRA 4JK8A 1B9DA 1RGIA 4FZVA 4QZGA 4FZZA 3CF5Q 3HHNB 2WTUA 3HZ6A 2H65B 3SIPB 1NRKA 3AO5A 5CYQA 3KK2B 4RKUC 4MFAA 4YDDB 3MMVA 1NHUA 2F9TA 5DBCA 1FRIA 1R8CA 4FPAA 4IRDA 3TSUA 2BPGA 2O8DA 3UR0A 3JTPA 4M6WB 1QZ6A 3T9ZA 4USIA 2OKQA 1S72N 4GLXA 3CPWR 2YWWA 1I3OB 1M6YA 5DMRA 1SH2A 5IQ6A 1HNIA 4P7VA 2DNKA 3A5MC 4Y2YA 1UZHA 5AE3A 1Z4NA 1TUUA 4I2QA 1RACB 5DDMA 3W5YA 2VUGA 3DV9A 3S1TA 1XNQK 3R7BB 5HNKA 3KOOA 1UPPA 2RNEA 1SB3C 2FPLA 3G71S 1HWKA 4OX9F 4MDBA 1RT3A 1RDFA 4GXKA 3AOCA 3KG1A 2XGQA 1B3TA 3DI6B 4BVOA 4ZS6A 5EX0A 1T6CA 5AKZA 5ITHA 3KK3A 2V8GA 3NRZA 2OM6A 3OPKA 5AHXA 3LP2B 1A0OB 2NSBA 3IAS9 2VWBA 2WAQF 4TYAA 2BDUA 2QM1A 1HQUA 3HP9A 3BR9A 2F8EX 3WUHA 3JAMO 1C4AA 5IC6B 4K4UA 2FJWA 3CFOA 3CDUA 2COLA 4B3RK 4JV5F 1FDAA 3IS9A 2GLEA 1ZQRA 2K7KA 4ATNA 4RLEA 2PFFB 3T1HJ 4LJMA 4US9A 1Y4ZB 2J7WA 1RAAB 2DGTA 1WUDA 3JAMU 4A8YA 3MWTA 3O4NA 1NLKL 4LF7J 5FLXY 4AHSA 5CR0A 1PAUB 3AVGA 3UPFA 2PI5A 4RQ6A 3BYPA 1YTUA 2O8FA 3ETOA 3HSDA 2RU3A 2PIIA 4M3ZA 4CJSA 3BQ2A 4O0IA 3LA0A 2WF6A 4IC9A 1Q8LA 4XPEA 3HT0A 3IRUA 3PRBA 3ZI4A 7ICRA 2MPUA 1BIZA 4IG0A 3A8EA 3AA9A 4ICLB 2M0NA 3WEEA 1WSVA 5HRNA 1G6BA 1X2IA 3TAPA 1RDDA 1RDBA 2ZTEA 5A6WA 5ADXA 3VEWA 4OKKA 4CZKA 1V4SA 2UXDJ 3BPDA 4K43A 3D0IE 5ALWA 1WC1A 1NGJA 3I96A 1GQEA 4LF9K 1D8BA 1HW9A 4OYIA 3SSSA 2E20A 1TFRA 2ZD1A 3HRDD 2QWNA 3OJSA 3E66A 2ZOMA 1WC0A 4F5QA 3D2EB 4PG8A 4CLUA 2B0CA 3I8DA 3AO4A 2DNHA 3CYMA 2ZHAA 1BGXT 1X4AA 1KOHA 2WVDA 1E6YB 5HL7L 4Z6EA 4ZLPA 2YHAA 1RP5A 2VPWB 3H7HB 3JPSA 3MECB 4BDYA 1ZQKA 3AARA 2AJ1A 3CETA 3VF4A 2FVRA 4P72A 1ZQPA 4LF8K 1H6KX 2W43A 2CA9A 4ZVSB 3EVOA 3WHIA 3I56N 2XY7A 3GCXP 3QT6A 2DRBA 4DR6F 3RMAA 2BM1A 3FNNA 5I3QA 4PXEA 2R7WA 1VQKN 1JJCB 4RW6A 3RU0A 4F02A 2FZGB 4JI1J 2I1QA 4LF4J