2XY6A

Crystal structure of a salicylic aldehyde basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
581
structure length
581
Chain Sequence
TAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 199
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy6A01
4N47A 5CZ2A 3ZSWA 3PMLA 4CEEA 1C6VA 2DFHA 4IQUA 1JLFA 2XGQA 4FVMA 2IOCA 3VQ6A 1BI4A 4J2BA 4I28A 4BXOA 8ICNA 1K6YA 5KFRA 3ZT4A 4NLKA 4CK2A 1WSHA 2G8UA 4CE9A 3OYGA 2EHGA 4FS2A 4CJ5A 3KTQA 2HHWA 4L8RB 2W8LA 1BPEA 1D8YA 4JWMA 4O9MA 2YV0X 3HVRA 1JKHA 2ZUDA 3EPIA 1S1XA 5JUMA 5CYQA 3V9UA 4UB3A 1L3SA 4CERA 3ZT1A 4O0JA 4DTJA 3MR2A 3DLEA 5KFPA 4YD2A 2UVVA 4JV1A 2G8IA 1VSHA 3QEIA 1JL1A 7ICPA 4YXJA 4Z0UA 4UBCA 5HRNA 4BGDA 1UA0A 1ZQIA 1V9PA 1J53A 4IR9A 8ICRA 4R8UA 2PI5A 2BDPA 1RT5A 4HTUA 5KG3A 4GXJA 2OPRA 5J2HA 3K4GA 1TVRA 3HJFA 3MDAA 3BQTA 4XRHA 1S1UA 2D5RA 4ECTA 4Y1DA 2Q0ZX 4RZRA 3RTVA 4B3OA 4KLQA 3B0YA 5KT7A 1W9HA 3TABA 4BXOB 3MFIA 3FFIA 4IQWA 3DLBA 4CK1A 9ICWA 2IGIA 1HUZA 3O3FA 3QNNA 4M3YA 2W8KA 4P2HA 1NOYA 3AO4A 3DI6A 3PO5A 7ICNA 4Z6FA 4F4ZA 2O4IA 4J2AA 4DFJA 1R0AA 2KN7A 4RQ5A 4KLFA 1ZJNA 1CZ9A 1KFSA 4KLEA 2HNZA 3JYTA 4DS4A 1QLNA 4DO9A 4ECSA 4MFAA 2BCQA 5J2AA 4HCBA 3KLEA 4F4YA 3P5JA 3SUOA 1B92A 3OHAA 4CGHA 2BPFA 4R8UB 4RG8A 3NTUA 3RH6A 4CGIA 3G6XA 7ICTA 1JX4A 9ICTA 4M9GA 4FLUA 1S76D 2X78A 5DBBA 3EPGA 4NY8A 1D8LA 4CF8A 3M8SA 5DG9A 4FS1A 2R8GA 1HJPA 1TAQA 5KFEA 3RB0A 7ICHA 4FJKA 4XA5A 3QLHA 1RBRA 3TI0A 2F8TA 2B21A 4Z6EA 3KLHA 4I27A 4KFBA 1BPBA 2PI4A 4DSLA 1GOAA 4K4GA 2HHQA 4Z6CA 2R8KA 3L3VA 3ZSZA 3H40A 1HRHA 4K8ZA 1BCMA 4DLEA 1IKYA 2ZJ5A 5KFAA 4I29A 4W5TA 3A2FA 1JN3A 1U48A 1RTJA 4KLDA 1ZQEA 4XQ8A 4KLOA 5KG0A 3OYNA 8ICXA 3EYZA 2FMQA 4YR3A 3PW0A 2BCUA 5IIKA 3K5MA 3QIPA 4I2QA 4JK1A 2Y1JA 1CXUA 1ITGA 3OYLA 4QZCA 4O0IA 2GWSA 2PFOA 4YXMA 3CM5A 1ZQAA 3OYJA 3ZSVA 1WCLA 4ED8A 1WN7A 4DTOA 3HSTB 2LYHA 5F9NA 4YFUA 4W5QA 1LV5A 5HNKA 3NF8A 5J2MA 2VWKA 3S9HA 1C1BA 2D0BA 2XO7A 1RDAA 5J0WA 1DTQA 4RQ7A 4RW6A 4Q0BA 5CY4A 2BKEA 1B43A 4UB4A 2P6RA 1IKVA 3RBDA 4LY7A 3OS2A 3C94A 4EZ9A 4QZEA 4EYHB 4QZFA 1Q9YA 1WLJA 1WAFA 1KRPA 3C6UA 4FJ9A 3NCIA 3O3HA 7ICJA 2ZTDA 2C2RA 1QTMA 1S0VA 3WNGA 2Q3SA 2HHUA 3DMJA 1VRUA 4ECZA 4J9PA 3RMBA 4DL4A 3AVKA 4LSNA 1ZQTA 4O5BA 1RBSA 2F1HA 2B5JA 4FJMA 3RJKA 3PX4A 1EX4A 1QSLA 4IFVA 1SL1A 3C2LA 3QO9A 4NXZA 3PR4A 4CJKA 3ZD8A 4FJJA 4KREA 3V9WA 1Q8IA 1BPDA 5EWEA 4ECRA 5KFWA 4QZBA 3T3FA 3AVCA 4KLHA 4KTZA 5KGWA 4CFDA 1ZBUA 4YP3A 8ICSA 9ICAA 2R7YA 7ICVA 4CHZA 2W9MA 1NJZA 4FK2A 4CGJA 4BDYA 1K1QA 5L1JA 1MQ2A 3HP6A 3AA2A 3HPHA 2IMWP 1JXLA 3MXIA 4B9UA 3VQAA 4B08A 1ZBLA 4EZ6A 3U3GA 3HP9A 4Z6DA 3VQPA 4FJ8A 2F96A 5HBMA 3RJEA 4I2HA 4JRPA 4O5CA 1LWFA 1VSIA 3V1OA 3Q8KA 5E41A 2XC9A 4Q45A 1SKSA 4O4GA 2JEFA 1WNSA 3LPTA 4CJSA 3P1GA 3OSPA 4HHTA 4DF8A 4OKEA 1TFRA 4M45A 4ECQA 4F91B 4UAYA 3V4IA 2JEIA 4C8MA 3HW8A 5KI6A 1BI4B 4J9SA 3CFPA 9ICXA 4QAGA 8ICWA 2FPLA 4JLHA 2BQUA 3OYIA 3DM2A 4R63A 3TANA 2Y1IA 3AVLA 3UQ0A 2YKMA 3Q8SB 4DS5A 5KFJA 8ICKA 4I2GA 4DU1A 4ZH4A 3NAEA 5IINA 1S1WA 1BL3A 4BWMA 2AGPA 4FK4A 4B9VA 1C1CA 2AGOA 4PGXA 3MEEA 1BVSA 2KZMA 3QNOA 1SUQA 4AHRA 5J0RA 5K14A 3AVBA 9ICCA 1S9FA 3IAYA 1YT3A 3QINA 3OYAA 3MBYA 4M6WB 1KEJA 4PGYA 2AQ4A 4QWAA 3LAMA 4TURA 1VSEA 2E4LA 4KITB 3PW7A 1BQMA 4I2AA 2W42A 4KLJA 5KFOA 4CJ4A 1SL2A 3PV8A 2XY8A 8ICEA 3ZSXA 5DBAA 1WCNA 3TAEA 2YKNA 1BGXT 5I42A 2ZQBA 5IIJA 2IHNA 3TAFA 4KTWA 1H38A 4GXKA 1Z25A 3PUFA 8ICAA 3AA4A 4NM2A 1IM4A 4CFAA 3V7JA 4B9LA 3ZSOA 4ID5A 3ETLA 4P4MA 2OPQA 2NRWA 4QZHA 2RDIA 3RB6A 2D0AA 1YTUA 4JV0A 5J2DA 3Q8LA 4UQGA 3JPQA 5EU7A 5FRMA 1AROP 8ICFA 3RMCA 2W9CA 1YTAA 3VQQA 3DRRA 1ZQFA 4IRKA 4M3WA 2FLPA 4C8LA 1ZQLA 2RPIA 3NGYA 1EXQA 2ASJA 4Z4CA 3PW2A 4I2JA 3ZSYA 4HYKA 1VSDA 4KLSA 3SQ0A 4M47A 4CCHA 4MEXA 4DEZA 1VSLA 3UPQA 3BDPA 5HP1A 2A1JB 2ZD1A 4R65A 3TQ1A 3BQ2A 5J2JA 3MAQA 1S9GA 4P4PA 2XY6A 4JRQA 3HX0A 3VQDA 2PZSA 3ZDCA 1HQEA 2PYJA 3LDAA 1VSKA 3I0SA 4DSIA 5J0XA 2BGGA 1B9FA 3CFRA 4I2DA 5DLFA 1BIUA 4DF4A 1NKEA 3TWHA 4FJ7A 3AVAA 9ICVA 3SUQA 4I2CA 1DLOA 5J2BA 4B8CA 1NOZA 1VSJA 1T03A 3RH4A 1CLQA 4ELVA 4ED0A 4P4OA 1DTTA 3UXNA 1KSPA 4ED6A 3ZDBA 4KHWA 2KFZA 1RT7A 3GV8B 4YD1A 3SCXA 1W0HA 4KLLA 3DRPA 4KLMA 4CJQA 3T1AA 1JLAA 3LAKA 4BACA 1RBUA 3V9SA 5J2NA 4C8KA 3VQ8A 1ZQDA 3SI6A 3SI8A 2M9NA 4DTPA 1RDDA 4DU3A 4JV2A 1KDHA 4E1NA 4DL7A 7ICOA 2LSNA 1A76A 4NLNA 1XSLA 4CGFA 4CHQA 5BPCA 3CFOA 2HHXA 4RU9A 1JLCA 3O4NA 4M3UA 9ICNA 2KQ2A 4I9LA 1T8EA 4RQ0A 5HP4A 4M2YA 1A5XA 1REVA 2BPCA 3IM1A 4J9MA 3C6TA 3MEDA 3V7LA 1RTDA 3MXJA 4M9NA 4IR1A 3Q8PB 1JLGA 4BE0A 1F21A 3MGIA 4EBEA 8ICZA 4RW8A 2AU0A 3AVFA 3M8RA 5KFXA 1S77D 2P1JA 1RT4A 5CJ7A 4FLXA 4AHUA 1UT5A 4KB1A 2I9GA 3ISCA 3AVHA 1BQNA 3K5NA 3LK9A 1T7PA 1C0UA 4ECUA 4HUEA 2P66A 4ED7A 5DQIA 3C2MA 4PQUA 3SPYA 3L2RA 3PY8A 1JLQA 5DDMA 3K57A 4RW4A 3K5LA 2HVIA 3TFRA 4O3PA 3QZ7A 4UB5A 3IRXA 4RQ3A 3OJUA 3GIKA 1TKXA 4H8KA 4DSFA 4ECXA 4FXDA 1LAVA 4DL2A 1ZQUA 3LP2A 5KG2A 4FJLA 1JMSA 2HW3A 2BCVA 4PHAA 1KFTA 4I2EA 5J0YA 3L2VA 4LD0A 5J0SA 2HNYA 4KKOA 5KT4A 1C1AA 3OJSA 2R8JA 4RW7A 4CFBA 2XY5A 5KFLA 5KGXA 4EBDA 3C23A 3ZDDA 4NCGA 1CZBA 2ISPA 9ICUA 3Q8QB 3PMNA 3DLRA 1XI1A 3VQBA 2KW4A 3OVNA 2F1JA 2ASLA 3VA3A 3U6FA 1Y97A 3QEAZ 5EWGA 8ICOA 4FJXA 2HMIA 4FZZA 3SQ2A 1EP4A 1TK5A 2YNGA 3MR6A 2G8FA 3C5FA 4BE2A 2JGUA 2NRXA 3SYZA 4GC6A 1XC9A 1T4GA 3O3GA 8ICTA 4I2IA 4RPXA 4QWCA 1FXXA 2XGPA 1RT2A 3IS9A 3KHRA 5EOZA 3AO2A 4X5VA 3V81A 1G15A 4DSEA 1QHTA 3V7KA 5FRNA 4IDKA 3G10A 2VWJA 5FDLA 5DG7A 4PHEA 8ICJA 9ICQA 1J5OA 1A5VA 5JS2A 1EKEA 3RJHA 3NFAA 4N41A 3HPOA 4DTMA 5CP2A 3NGDA 4IG0A 4CJVA 5DKWA 3VQEA 3RBEA 2ZJAA 2FLNA 1NK8A 4OGEA 2HHVA 4O5EA 2VG5A 5DQGA 1S1VA 3E01A 2DFEA 4CJEA 3N4MB 5KFZA 5J29A 3K2PA 1SZPA 5KT3A 2X6NA 3RR8A 4FJIA 4QZDA 1QSSA 3B6OA 3S3OA 1ZQOA 2J6SA 3PO4A 4RT3A 5KRSA 4CF2A 4NCBA 8ICQA 4CIEA 3RRGA 4BDPA 7ICRA 3G6YA 3PX6A 1KCFA 3VQ9A 2MAXA 3OYDA 1L3UA 4IQTA 5DB7A 1Z26A 2PY5A 3HO1A 2ISOA 5KFUA 4LVSA 2IAJA 1N48A 2DPIA 3DYAA 1TKDA 4DWIA 4LH4A 2ALZA 1ZQCA 4CEZA 1ZQMA 3ZT3A 1NK7A 4KV8A 4F93B 4M3RA 2PYLA 1ASUA 3AV9A 1BPZA 4E3SA 4FBUA 4PPXA 4FW2A 2A1JA 4KLIA 5KFQA 3TFSA 4RT2A 4DQIA 4E89A 2JZBB 4CEBA 1MSWD 3RAXA 4LSLA 3JPSA 3T5LA 3HYFA 4QZAA 1U4BA 1RNHA 4JWNA 4J9QA 5KRTA 5KG4A 4M9LA 2DFLA 4M6WA 4OLAA 3NHGA 4RUCA 1WAJA 1TL1A 1RTHA 4PWDA 1UOCA 5KFBA 4QW9A 4E7LA 7ICUA 1HQUA 2B4JA 3V6DA 5IIOA 4F5OA 4O44A 4OGCA 4GVMA 5IIMA 1RYSA 4CJWA 1IH7A 3GDXA 7ICFA 1JLBA 2DY4A 4QZIA 3AUOA 2ZJ8A 3LPUA 1IO2A 4OLBA 3MDCA 8ICMA 1TKZA 5KG7A 1RT3A 3NGIA 1BPXA 2Z1GA 4DQQA 2XCPA 3KJVA 4FO6A 5KT6A 3L2UA 4M3TA 2HHSA 4Q44A 4FK0A 3G0ZA 5HHHA 2ZE2A 1LAWA 1NK4A 1T05A 1D9FA 3HVTA 1FKPA 5L9XA 3ZDEA 3LDSA 2XY7A 3HWTA 1RT6A 4YMMA 2RF2A 4J9LA 2XCAA 4KAZA 4E7JA 3K5OA 3P83D 4KO0A 8ICUA 2WTFA 1TVAA 5D3GA 3KHGA 4M41A 1HYSA 4Y1CA 4I9QA 1NKCA 1SL0A 4CJPA 3HK2A 3TAMA 2VG6A 3TARA 4HUFA 4C8OA 5DB8A 3OSNA 4QW8A 4YN4A 4DTNA 3OS0A 1IXRA 4F2RA 4DL5A 1XS9D 4PA1A 3NH2A 3TAPA 4GMJB 2Z1JA 1X1PA 3JPOA 1L5UA 2XRIA 2ASDA 1XU4A 4KHUA 4M0AA 4KHYA 3UQ2A 3AU2A 1WSJA 4F5NA 2ETJA 3AVJA 3K75D 4CHOA 4UAWA 2I1QA 1S0NA 4Z4GA 3G6VA 1X2IA 3AVGA 4EP5A 5BOLA 2IC3A 1NK5A 4DQPA 2Z1IA 4CGDA 4E7HA 1CUKA 5D46A 1ZQPA 3ITHA 2MUTB 4LZGA 3C95A 1ZJMA 5DBCA 5IILA 9ICMA 2HB5A 4J2DA 2BCRA 2GV9A 3V1QA 2G8HA 3EZ5A 3UXPA 2P6UA 1RYRA 1HJRA 3L2WA 5F9LA 1LW2A 1S5JA 4IG3A 1HNIA 2D0CA 1N5YA 5DGBA 4QCLA 1EXNA 1DGSA 3JPNA 3RAQA 4KHNA 3OHBA 1BIZA 4OJRA 4DSKA 5KG1A 5J0UA 1JXEA 1KLNA 4RQ2A 1XSNA 4OPJA 4ZTJA 5SZTA 3QEWA 3QEVA 1DOQA 4R66A 3EW9A 4W5RA 2E6MA 2EX3A 3BQ0A 4FJ5A 5TZVA 1NJWA 1C7YA 2OWOA 1RT1A 4F5PA 4O3NA 5L1IA 3TAQA 7ICMA 4E7IA 2BGWA 3SNNA 2IBKA 3QE9Y 1Q9XA 3M8QA 4DTSA 2IHMA 1RBVA 1K1SA 1RBTA 4PY5A 1XSPA 3QIOA 3EY1A 3KK1A 3N97B 4FLVA 4RNNA 3RH5A 4YG2A 3PNCA 4F50A 4FLZA 4ELTA 3VQCA 1ZBFA 5C5JA 1VRTA 4GW6A 4TUPA 5L1KA 2NRZA 4N76A 1ZYQA 4DU4A 5C42A 4Q8FA 4PGQA 1LWCA 3MABA 1ZQNA 4TSXA 3KD5E 1NK0A 1L3VA 4J9NA 5J2CA 3RJGA 5HRRA 1ZQZA 5DQHA 4Q8EA 4JS5A 4FLTA 1C0TA 9ICKA 2C22A 4AHCA 4IRCA 2P5OA 4CGGA 2R8IA 1RCHA 3ZSRA 1XO1A 4JUZA 2V4QA 3GIIA 3NF6A 4F3OA 4B9TA 2P5GA 1ZBIA 3H8WA 4M3XA 4O5KA 2OYQA 5KFIA 3VA0A 2QKKA 3DLHA 4IBNA 4FLYA 9ICGA 4DFPA 4YMOA 3LZIA 4TQRA 5CHGA 4CEFA 2V9WA 5J0PA 1HYVA 3KLIA 9ICIA 4CHPA 4RNOA 3V9ZA 2W9BA 4CJFA 1ZETA 8ICBA 1X9WA 3AVMA 3E2EA 3ZT0A 4ZHRA 8ICLA 3KK2A 4EBCA 2KZ3A 1ASWA 3M8PA 1XHZA 1HYZA 4NYNA 3OY9A 2VANA 5CA7A 4RPYA 3KHLA 4R5PA 1UT8A 1SV5A 2YHAA 1T3NA 3H7IA 1RDBA 3LANA 1VSFA 4M9HA 2FPKA 3DOLA 2OPPA 1S6PA 4EYIB 4ICLA 1RXVA 4Q43A 3ASMA 4PH5A 3JPPA 1U49A 4I2BA 4E19A 2FLLA 3H08A 3SZ2A 3I8DA 1IG9A 1RZTA 2YNIA 4LH5A 3KHHA 5KFFA 4IKFA 5HRPA 5KFYA 3L3UA 4ECWA 4N56A 1RTIA 4KLTA 4O55A 4FJNA 4DTXA 3ISBA 2IA6A 8ICVA 3ZSQA 9ICOA 4KI6A 1S9EA 3NE6A 1GOBA 4J9OA 4FJGA 1ZQSA 4DMNA 4KRFA 5KFSA 4FZXC 3LALA 1O1WA 4LZDA 4E0DA 3ZCMA 4DTRA 4YR0A 4KPYA 7ICKA 3NF7A 3QERA 4CJRA 3BJYA 3L2QA 4FM0A 2XHBA 3AO3A 2VA2A 3OYBA 3OS1A 4DLGA 2G8VA 4F4XA 4B9MA 3PVXA 9ICBA 3KKSA 4CHYA 3SV4A 2W9AA 1RPLA 9ICFA 1LB2B 3F73A 1JXBA 3T5HA 2NUBA 1RILA 4ZTFA 4KLGA 4AILC 4K8XA 1B9DA 1EETA 3AU6A 1QS4A 5KFVA 1ZQWA 4M42A 3M9MB 3GIMA 2DTUA 5KT5A 3ZD9A 3Q8RB 1ZQKA 1Z3EB 2F8SA 3MR3A 4DQSA 3KLGA 3SJJA 3C2KA 1ZQGA 4PHDA 4AH9A 3CM6A 8ICYA 3KLFA 4C8NA 5KFMA 1HMVA 1WSFA 1TK0A 2O4GA 5HMLA 3LP0A 1ZQXA 3MECA 5CR0A 1D5AA 5T7BA 2AGQA 9ICPA 4CK3A 4JS4A 3KKRA 2NRVA 4F92B 3WNEA 2UVRA 4AHTA 3CQ8A 1FK9A 4RW9A 4CJLA 4DOBA 4UAZA 5L1LA 2PFQA 3O4QA 1S97A 4DOCA 3C21A 2AJQA 5HRSA 2A1SA 3MGHA 3UXOA 4NM1A 4G1QA 1TV6A 1PZNA 7ICEA 1COOA 4TUSA 2OZMA 1ZQVA 4EEYA 2J6UA 4NLGA 2FMSA 9ICJA 4O3QA 2B6AA 1BCOA 4XIUA 4CFCA 5HROA 3WNFA 3FYHA 2J6TA 3LP1A 3D45A 4GLXA 5D4BA 3AVIA 4YQWA 3AA3A 3LP3A 4KB0A 3HPGA 3RRHA 1VSMA 3RB3A 1UAXA 1RXWA 3EWAA 4QWEA 3NH1A 4KHSA 3HM9A 5DG8A 3VQ7A 7ICLA 5KTQA 4RQ4A 1ZQYA 1J9AA 1LW0A 4YNQA 4K4HA 1TKTA 2YNHA 3MR5A 2RN2A 3IHQB 3U3YA 1ZQQA 4YMNA 2QK9A 4W5OA 4F2SA 1ZQBA 5J2PA 5EWFA 1Z00A 3HT3A 3NH0A 5FROA 3THVA 4J9RA 2OPSA 3QETA 1J54A 1TV9A 1QSYA 1D9DA 4AHVA 4RPZA 4KMUA 2OZSA 1CEZA 3JPTA 4CHNA 4DFKA 2ZTEA 1UWBA 3FDSA 5HMMA 3S3NA 2PFNA 3T5JA 3ISNC 3M9NB 1U9LA 3QEBZ 4B9SA 3RWUA 5CWRA 4DL3A 3DRSA 2JZBA 4RQ6A 3GV5B 3GILA 3RR7A 2NRTA 4MF2A 8ICIA 4OKJA 4CEOA 3HXMA 5KFDA 2KFNA 4CESA 1MC8A 1CXQA 2BPGA 7ICIA 5DGAA 4UBBA 4MQ3A 4AHSA 5KG6A 5KFHA 3MXMA 4MFBA 2BCSA 4CEQA 2UVUA 4Z4IA 1N56A 2BR0A 1Z00B 4J2EA 4M3ZA 4ECYA 4H4MA 4CJ3A 1A77A 4EP4A 2QKBA 2FPMA 3AO1A 2BANA 1A5WA 3NGZA 4TUQA 2WONA 4UB1A 4RQ1A 3ISDA 1S10A 5DK5A 4DL6A 1KFDA 2W9BB 1WSGA 2ZTCA 3SPZA 3B0XA 5J2IA 4RQ8A 1S1TA 1U04A 2P51A 5J2KA 2FBVA 3QEXA 4CIFA 4ED2A 3PW5A 1BPYA 3L8BA 4I2FA 4M04A 2FBTA 5J2QA 2WOMA 9ICRA 3LWLA 1U45A 1B22A 4N5SA 2GBZA 1XWLA 4F8RA 1U47A 3TR8A 4IQVA 5KFTA 5BOMA 1KVBA 1YVUA 4CECA 5SWMA 3WNHA 3NBPA 4FZYA 1HNVA 8ICCA 2FBYA 2YNFA 3KD1E 4HUGA 4KN7A 5IIIA 4Q5VA 4YFKA 3H4DA 2RDJA 4DSJA 4FCYA 4BE1A 2X74A 2UVWA 1TAUA 8ICHA 3RMAA 1Y88A 3GFKB 2IDOA 4BDZA 4NLZA 4GXIA 1MU2A 3VQ5A 1XHXA 2DFFA 2MUTA 4M9JA 4DQRA 4CIGA 3GQCA 2I5JA 2JLEA 3K58A 2GUIA 5KG5A 3SV3A 3ZDAA 4CEAA 2C2DA 4J9KA 4DFMA 1C0MA 3RJJA 4XUSA 4ED3A 4DG1A 1TL3A 3H8SA 2RKIA 7ICGA 3KK3A 3C5GA 1ASVA 2OA8A 3V9XA 5J1EA 1QE1A 2E6LA 5JS1A 3C1YA 1X9SA 3RB4A 2Z1HA 5HLFA 1KTQA 4DOAA 4Z4HA 1VK0A 3ORYA 4OVLA 1S6QA 4MF8A 4FLWA 5J0TA 2BHNA 2C28A 3H4BA 1FKOA 1WSIA 9ICLA 1JLEA 3QZ8A 2ZUBA 4H4OA 4HCCA 1ZQJA 2FMPA 3OYEA 1NK6A 3OYFA 5DLGA 3DOKA 3V1RA 2X6SA 3T5KA 4O3SA 7ICQA 3SUNA 4FYDA 1HPZA 4ED1A 4NYFA 4F3TA 5CB1A 4QWBA 4TQSA 3F9KA 4DTUA 4RUAA 2R8HA 5KFGA 5J2FA 1ZQRA 4YVZA 5KFCA 9ICHA 2HNDA 4Z4FA 4QZ9A 2JEJA 3IG1A 1ZQHA 5DB9A 5DDYA 4ECVA 3M9OB 5DMRA 3D0PA 1LWEA 3V6HA 5J2EA 2V4RA 2ATQA 3PR5B 3RJFA 3K59A 3SUPA 4E1MA 3ALYA 2HVHA 7ICSA 2G8WA 8ICGA 4OKKA 4CJTA 4F5QA 4WE1A 4FM1A 4O3OA 1S0OA 4I2PA 3VN5A 3ZT2A 2FBXA 5DB6A 1IKXA 1X9MA 5KT2A 4K4IA 3SQ1A 4CJUA 1I39A 5HHIA 4O3RA 4YR2A 1BHLA 1QQCA 3AVNA 2BQ3A 4RNMA 8ICPA 2QXFA 1L3TA 5C25A 3AO5A 3GIJA 4FJHA 3JPRA 1NOMA 4MEYA 3C1ZA 3AA5X 4F4WA 1ZBHA 1KLMA 5KFKA 2FC0A 5C24A 1WSEA 2BE2A 3LWMA 2PXIA 1N6QA 4FM2A 3MEGA 4PUOA 4FW1A 5CYMA 3BQ1A 4GC7A 4F5RA 2DPJA 4KTQA 3OYCA 4Z4EA 3Q8MA 5CZ1A 3OYMA 4MFCA 2YHBA 2C2EA 1NK9A 4UB2A 1SKWA 3OYHA 4E7KA 4YCXA 3DLGA 3DLKA 2ZUCA 1I3AA 1JIHA 4MFFA 3UIQA 3QEPA 4NCAA 2A1RA 2IS3A 4B8AB 3VQ4A 1NJYA 3RJIA 3S3MA 5D49A 4FBTA 3H8JA 3GV7B 1IKWA 4CF0A 1UA1A 4KLUA 2G8KA 4R64A 1TGOA 3NDKA 1TK8A 3PW4A 3B6PA 4ID1A 3BGRA 5J0QA 4BWJA 2KZZA 1GOCA 2VG7A 4CF9A 4F4KA 1MQ3A 4HVJA 1HUOA 3HL8A 2W9CB 1RDCA 5J2GA 5J0OA 4W5NA 3MFHA 4G3IA 3KIOA 3I0RA 4I7FA 2AQ0A 4PHPA 4CF1A 2JEGA 3CYMA 2H5XA 2ATLA 4KN4A 1NJXA 1BISA 3RMDA 3SQ4A 3OYKA 5I3UA 1NKBA 1S0MA 1KVAA 9ICSA 3OGUA 3NF9A 3V72A 2PFPA 3V6JA 4IRDA 2HHTA 3JSMA 5KFNA 2F1IA 2KTQA 4QWDA 3ULDA 4QZ8A 1KVCA 2VA8A 1JL2A 4KHQA 9ICEA 4OPKA 4B9NA 2ITGA 3QESA 2BQRA 3PX0A 2VA3A 3V6KA 3LZJA 3TAGA 4QZGA 4ELUA 4IFYA 4CEDA 3CG7A 1SKRA 4KI4A 4QOZB 3T19A
chains in the Genus database with same CATH superfamily
2CJKA 1VQKS 2C3MA 4CEEA 1XR7A 2EXUA 2XGQA 5DM6L 4FVMA 1NPKA 2DHHA 2OHFA 4I28A 2XS2A 3TJAA 2AP6A 4IWVA 4Q2MA 5KFRA 3R5BA 2E3TA 1HWIA 2I5JB 3C3LA 2BH1A 2CVEA 5ALVA 2WUSA 1ZXIA 2KK0A 4CJ5A 2HHWA 3O08A 4O9MA 2YV0X 1FK9B 3HVRA 2ZUDA 3ZZYA 4FWPA 3EPIA 2M9KA 5CYQA 3V9UA 2XI9A 4CERA 4DTJA 3H2UB 3DLEA 4YD2A 3UKRB 2G8IA 1N63A 1VSHA 3QEIA 5L46A 3RF9A 2VBXA 4Z0UA 3E1YA 1IV8A 4IR9A 4OZNA 2DISA 2BDPA 4HTUA 4CO1A 3FRZA 3HJFA 3AQFA 1N88A 4XRHA 3NUQA 1S1UA 2HLUA 2D0OA 4HHHA 3RVCA 2D5RA 1U1OA 1T3OA 1FVQA 2Q0ZX 4RZRA 4C9DA 4B3OA 4KLQA 2RRDA 1VAZA 3ILLA 1W9HA 4GMKA 2FE9A 5A76A 5ADXH 4AQYJ 1S6QB 2MLXA 3CDWA 2VQFK 5ALUA 1LWFB 3GFXA 3QNNA 1C1CB 4OYZA 2RE1A 2W8KA 4P2HA 4OI6A 3ZTPA 4NYPA 3EL2A 3AO4A 3DI6A 5AKGA 5IWAK 3PO5A 1SAZA 3AXMA 1IN0A 3AOCA 4IOXA 3C2PA 1JJ2M 3BGFA 5J1NA 1B99A 4A62A 4RQ5A 1QDUB 4KLFA 1ZJNA 1CZ9A 1LKYB 3JYTA 3IAM9 3DRRB 3QGPA 2W55A 3AARA 1TQLA 5H9EK 2XI3A 2R7VA 3V81B 3O1BA 4MK9A 4IC9A 4LFBJ 4R8UB 3CJTA 4OJLA 5BJRA 3RZAA 7ICTA 2R2TA 3TYTA 2AMCB 1JALA 1WWVA 2RP5A 2P8IA 4JB8B 4MIAA 4CF8A 5DG9A 1MLAA 1WBBA 1TFYA 5KFEA 5C2FA 2HHHJ 2V34A 3KHYA 4FJKA 4WE1B 3J7Z5 2F8TA 5IT9O 2B21A 2LM4A 4Z6EA 1IR1A 4I27A 3N9UC 1N33J 5A0YB 4RWTA 3PFEA 1WYGA 4QNLA 1UEUA 1FTCA 4L6V3 2PFDA 5HQMA 4Z6CA 2BTFA 3FLCO 5J1EB 2GVZB 1HRHA 4ZCLA 1RAEB 3TEGA 2ZJ5A 5A8RA 1RWMB 1IJJA 4W5TA 4BY9C 2J4RA 1HKCA 2EAOA 1MN7A 3JAMY 3NCPA 3VF6A 3QFHA 3W2VB 4BBYA 3OBWA 3LGHA 3QU2A 4NEZA 2FF3B 1UZHA 5M1NA 2GWKA 1Q8BA 3OYNA 3EYZA 4YR3A 5A8WB 3RW6A 4CIOA 3QIPA 1GEHA 3CNQP 1SXLA 3JTOA 1HW9A 4X4QA 1WDTA 2BOPA 4OMFG 4MKYA 3TX0A 4CTAA 1SIJA 1YJTA 3OXGA 4ED8A 1IBCB 2XMKA 2N7YA 3HSTB 4XPCA 4B1YB 3P5BP 2W2NP 4M5MA 3I5AA 1PKUA 4ZA1A 4JEPA 5C25B 2WOMB 2C2NA 2WF7A 1OY6A 1C1BA 3CCVS 3PM9A 3SEIA 1RDAA 4RW6A 4LFAK 3MURP 1B43A 4UB4A 4MIWA 4DR3J 2VPYB 5ALEA 4LY7A 1TL3B 3CCEN 2VH7A 5HOOA 3GU0A 4EZ9A 3MM9B 5K8NA 1JMTA 1FT8A 1M1KO 4OYIA 1T9VA 2MZSA 1WAFA 2Y8YA 1NDCA 2YMLA 2ZM6K 4OYMA 3WNGA 1CG2A 1VQ5S 3Q2TC 5CEHA 4DL4A 4LSNA 3QU4A 3AVKA 1Z4NA 4XH5A 4O5BA 1RBSA 3C14A 4FJMA 1O51A 3PX4A 4PXBA 4IFVA 1DHMA 1S49A 4CF5A 3V9WA 1BPDA 3AVCA 2QRRA 2CGJA 3WUHA 3CGIA 3TX8A 3CXCR 4KTZA 4CFDA 1ZBUA 3TUPA 2DRAA 3T41A 3G4SN 3H2VE 2H5EA 3G8SA 1NJZA 1H2TZ 4CM2A 5LT5A 4CGJA 1K1QA 2Q0RA 1MQ2A 2A5XA 3GZFA 1X4EA 2XNQA 2QT7A 3MMVA 4EX6A 3X3UA 3AB4B 2EG1A 3C29A 3VQAA 3D2EA 4B08A 4EZ6A 3I6PA 3K1ZA 2HIQA 5EE0A 2A1BA 3R97A 4WU2A 4O5CA 4DR5K 1LWFA 3EGVA 1VSIA 3PRBA 3CB4A 3V1OA 1FJ7A 4NL9C 2BDUA 4K4YA 2KYZA 1HBUB 4DCOB 1WNSA 3O0FA 3IRWP 1OJ4A 4WPAA 3L9ZA 2YBVA 1B70B 2RMLA 1Q81O 1TFRA 4F91B 3MR7A 2WFAA 3N7PD 5KI6A 5KNIA 4J9SA 1B0VA 4QAGA 2QGFB 4RR5A 2E2OA 5M1OA 3LH2S 1RFQA 8ICWA 3U7JA 5FPEA 2R2SA 2BQUA 3OYIA 2MKIA 2F4VK 2OEMA 2ZBCA 3Q8SB 1F3FA 4LVNP 1A6SA 4M5DB 3DOKB 4I2GA 1FFGB 2G9OA 4DU1A 3H7HB 3POTB 1F5AA 1AZSA 1Z05A 1TMJA 1BL3A 2DXEA 2ZJQQ 1OH5A 1SUQA 4WYBA 1V5VA 3OUYA 4BGAA 1VIXA 2E5LK 5C42B 2VUGA 3DC2A 3TACB 4YOVA 4CLFA 1KQSR 4PGYA 5E0OA 1VC5A 3PHEA 4LF5F 4JI0F 3PW7A 1LOUA 5GAEU 5C7PA 1BQMA 2PFFB 1HNIB 1T9UA 4MO4A 3FEZA 3PV8A 5MLCV 3ZSXA 2ZH6A 5ADZA 3VAJA 2BRLA 3CJ5A 3K7RA 4LT6A 1QHAA 1BGXT 4WP8A 7FDRA 1X5SA 2YHYA 4CGZA 3AA4A 4MT1A 3A8EA 3IBPA 4ID5A 3ZSOA 3ETLA 3B9JA 4AXJA 3OTOJ 3RB6A 3J7ZT 2PIIA 2VBWA 2VDHA 1NNLA 4ZLLA 5J2DA 3HHLD 3WEEB 1HARA 5AHXA 1IG6A 2UUTA 3WQUA 3Q8UA 3W63A 2WBNA 4USVA 5F2RA 4B3OB 3FZ2A 1ZQFA 4IRKA 1GO3F 4M3WA 1CJKB 1S1XB 4ENOA 3QRRA 2HMPA 2RPIA 5RUBA 4P2XA 4UY8T 5AE3A 4ACOA 1VSDA 1A6LA 4KLSA 3IA0A 4M47A 1ZM4A 4OO1J 2VBYA 3DXBA 1Q81T 3IG8A 2MTLA 4R65A 5J2JA 4KRWA 2MZQA 3R5AA 2XY6A 2HBZB 2PZSA 2D3DA 4GV9A 1W2BR 2ZE2B 3LDAA 4URGA 1B7YB 2Q6CA 5ALSA 3D6FB 4DF4A 1ZPWX 2RDDA 9ICVA 3VC8A 5J2BA 2KSOB 3VAGA 4ELVA 4F7VA 2WVDA 5DS7A 5G4DA 5AQIA 1R0CB 3WXJA 4Y2SA 1KSPA 2KFZA 1RT7A 4YD1A 3M32A 3HHDA 3KDNA 2Y9HA 4WKYA 3DRPA 4CJQA 3T1AA 4BACA 2F4VF 3I9V9 5J2NA 4OZ1A 2YY3A 3VQ8A 2WBRA 1ZQDA 5K20B 5D77A 2IVYA 1XO0A 4DU3A 4JV2A 1IXKA 7ICOA 4AD6A 2N7CA 5A2QY 2D1KA 1JLBB 3KWGA 3O4NA 2KQ2A 3UR0A 4RQ0A 4NI2B 1ZH5A 1U0SA 1IG8A 2B5JB 2I7PA 3IM1A 4OX7A 4J9MA 3C6TA 1JKHB 3V7LA 3EVMA 1QJHA 4LF5K 1JLGA 4EBEA 5KPZA 3GR0A 4NLQA 1HNXK 3CPWM 2HYIB 3NNCA 2ZJRL 4C0HA 2P1JA 2IIRA 4J8FA 5JXSA 1HMVB 4DPOA 2LCWA 3ZYYX 4DMZA 1UT5A 2I9GA 3K0SA 2CQDA 3AVHA 3K5NA 1T7PA 1C0UA 4HUEA 1FEEA 2P66A 1D09B 4ED7A 1R8AA 1WG5A 3UQSA 4AYBF 1UTAA 2DXFA 3HX9A 5JICA 4FF2A 2QLXA 3GG0A 4RW4A 4X65K 2R3VA 2KN4A 3IR6B 3TFRA 3GJSB 2VONA 4EFHA 2Q4TA 3MC1A 3F56A 3GIKA 1RAFB 2LECA 4H8KA 2IVPA 3J7A1 4UY8O 2NV3A 4DL2A 5KG2A 2VQEJ 4FJLA 1U2FA 1RKJA 4A47A 2HW3A 1GLLO 4PHAA 3DHXA 3K8VA 1NSAA 3J80O 4KQZA 1R8CA 1I94J 4O3MA 4DKWA 5LXRA 2GQ2A 5KT4A 1FO4A 3UNYA 5DO2A 3OJSA 2R8JA 2DR7A 4CFBA 4PZNA 3QYPA 2YY6A 3IXQA 3ZDDA 2ZFHA 3OVAA 2DRDA 4A2AA 3JAMU 1CZBA 4CLUA 9ICUA 4LRAA 4MH8A 1BE4A 1LFPA 4ISGA 3BZQA 3DLRA 3OVNA 2VDIA 3R5CA 3TJ9A 4AUKA 2ACYA 1Y97A 2OD4A 2MZRA 4FJXA 2HQDA 2HMIA 3IUCA 2H3QA 2ROEA 2WONB 2YNGA 3MR6A 1TKXB 3SYZA 1T4GA 3O3GA 2O8CA 2MQ8A 4LR7A 4GKJJ 1HR0K 3DU6A 4Y2YA 1S22A 4DSEA 1Y9OA 1R31A 5FDLA 4FZLA 5KAFU 4LUBA 5DG7A 4CH1A 1P1LA 5JLHA 2EH9A 4J90A 1TV6B 4DBQA 3BM7A 1RTJB 2ILYA 5JS2A 1REGX 1ZD2P 3NFAA 4DTMA 1GLDG 2HVDA 4IG0A 1IBLF 2DNLA 3VQEA 2ZJAA 2HHVA 4O5EA 2VG5A 3I1YA 1BO5O 4HT7A 1VQ4N 2AEJA 1Y00A 1QSSA 5EXWA 3S3OA 4NLDA 1URRA 1ZD4A 2ZHOA 3OPXA 2I7NA 3PO4A 5KRSA 3M6VA 4NCBA 2CQBA 2UV8G 1N5TA 4O44B 2BZFA 3HHLB 3VQ9A 1U8SA 2GUPA 3H45C 2BBEA 4KX5A 3ED5A 1UEKA 4AE5A 3HO1A 4M8LA 5C2GA 2QFJA 2GJFA 4LVSA 2FVRA 1N48A 2DPIA 3GYGA 3DYAA 5T7LA 5D0RA 4IOAL 2LHTA 4JI1K 5HI7A 1ZQCA 1ZQMA 1LKZA 1NK7A 1SJFA 5HQ8A 3NVVA 3AEVA 3CEDA 5AKKA 4FBUA 4FW2A 4F9OA 5CD4H 5I4MA 4AT1B 3KLVA 2W2PP 4E89A 3V2UC 1MSWD 1CJTA 2DCLA 1B4SA 4BR7A 1FWKA 4DFDA 3FM9A 4ETXA 3T5LA 1NU0A 4QZAA 1N5VA 4PR6A 1ZS6A 3IR5B 3D6HB 4DHYA 4OLAA 1ITPA 3NHGA 4TLQA 2H3FA 2V8VA 2C2OB 2ZH1A 1TL1A 3ELHA 4X66F 2K1RA 1O8BA 1RU1A 1N6QB 4X4UA 3HFZB 5AXKA 3E58A 5F0XA 3HJEA 3H5XA 3U9DA 4E7LA 1G99A 2B4JA 1F0XA 2LXFA 3V6DA 3PRVA 2KRBA 4CLWA 4JB3A 4WWSA 4GVMA 2BW7A 4ZCKA 3SCKE 7ICFA 4MKAA 4K4WA 4QZIA 5AI9A 4C0OC 3LPUA 1OY9A 1YLXA 2AX1A 8ICMA 4ZN3A 5AI6A 5KG7A 4DR4J 4DQQA 2XCPA 4FO6A 4GIBA 2DITA 4Y2RA 2FGOA 5AQHA 1ZD3A 1Q78A 1LAWA 1FKPA 3CULA 1H98A 3LL3A 3ZDEA 4DR7K 4L3QA 3LDSA 1YF5L 1VQ7S 5CH7B 3W8PA 3HI9A 4J9LA 1RWUA 5L9NA 3NL0A 2APOA 5BPLA 5LMNK 1F1BB 2J7KA 2EFNA 4M41A 1RWKB 4X66J 5ETRA 1FFVA 3NGRA 4I9QA 4KR0B 1SL0A 2JHEA 5DM6Q 1RE1B 4NLYA 4CJPA 4LRFA 2VG6A 2P9IB 2XWYA 4YN4A 4DTNA 3OS0A 2IBOA 4PA1A 3GDQA 4FXVA 4OFZA 3JPOA 1NZAA 3FGVA 4YEAA 2XRIA 2OPSB 1UETA 4KHUA 1BLUA 1R6YA 4KHYA 1WOQA 1WSJA 4F5NA 3VGTA 5KL1B 4Z94A 1R43A 1RT4B 5C0YA 5BPMA 2C3PA 1S0NA 1N2XA 3G6VA 2M88A 3R9LA 4YDUC 2ZNZA 1NU4A 3G4SS 4EP5A 1S1WB 1MWMA 4LFBK 2IM1A 1CUKA 5D46A 1X5TA 4IJAA 2LXUA 4I1TA 1HNZJ 4GVBA 5DBCA 2GMJA 9ICMA 4C1NK 5EGYA 3A12A 5LY3A 3ZZOA 3NVZA 2BOAA 4U7UK 2H3IA 1XN9A 3CETA 1RU2A 1RYRA 4ISEA 4ZCIA 5F9LA 3T6JA 1N34F 2A18A 1QZ5A 4UF4A 1NPPA 4IG3A 2ZKUA 2K4EA 4QCLA 3TVKA 1SCJB 3H0MB 4U67L 3JPNA 4IG0B 1NGIA 2F65A 1BIZA 4DSKA 1KLNA 3OFEA 4WYLA 5AQWA 2E7WA 1HFEL 3QIDA 2HVZA 1X3NA 2DKXA 1EKSA 1FXRA 3OL8A 1WHVA 3I32A 1U2VB 4JBCA 5CQGA 1CRXA 3O6WA 1DOQA 3D68A 5HQLA 3TP2A 5M1QA 1ESVA 4DCCA 3BQ0A 3DDKA 3NBPB 4H4OB 2J5AA 2KT3A 2BGWA 2ZIUB 2B7CB 1Q9XA 1YTYA 2IHMA 2YKNB 3W66A 1S48A 3O1WA 4OPAA 3LPEA 4AYBC 4NO7A 2EAPA 1CJKA 4KGMA 4DR5J 4A8OA 2OI2A 4HVZA 3PNCA 4GKJK 4FLZA 3VQCA 4M7XA 3OTQA 2KLAA 3A0BU 2NRZA 4N76A 2F9TA 1N34J 4Q8FA 4KB7A 3MABA 2DJWA 5U47A 3NGTA 5D4NA 2XMVA 4IOBA 2J9DE 5HP1B 2LLZA 3MGJA 5DQHA 4Q8EA 4HTJA 4IRCA 1PK1B 5HANA 2R7TA 2X1FA 2MQNA 3M8ZA 3BSAA 4JUZA 3GIIA 1R8HA 3CNHA 1UJ6A 1HLWA 2W54A 4B9TA 1T02A 2HVEA 2F3NA 2A2DA 4M3XA 4H0YB 1D8ZA 2JRSA 3A8KA 5K8OA 4HKQA 2ASMA 3VA0A 4GV3A 4CZHA 3ID8A 2R7WA 4DFPA 3C8YA 4TQRA 4IDHA 5LMUK 5J0PA 1HYVA 4C7ZA 3I4HX 2P9KA 4RNOA 3CP8A 5LJ3Y 2RHQB 3D54A 8ICBA 2EDUA 1X9WA 1XEZA 3AVMA 2QB1A 3ZT0A 2D9PA 2E66A 3GPAA 1O13A 3HJVA 4DPYA 1IUJA 3QYYA 4I2PB 3JSMB 4BCAA 3OTCA 1LNQA 1A7GE 3KBBA 1U6FA 3M2VA 3KHLA 1BNPA 2HGNA 1RBOB 3CWJA 4X2BA 2WB1C 3VGLA 3H7IA 5AK5A 3IDWA 3BDEA 3QRQA 2GVDB 2I5HA 1H0HB 3NRWA 4ICLA 1RXVA 3QT8A 4PH5A 1RDFA 5BYSA 4LIRA 4E19A 3AMZA 3SZ2A 1YRTA 3I8DA 2YKQA 3EGZA 1RZTA 5AQZA 2CNOB 4OV1A 1TYQB 5HRPA 2BE7D 5KFYA 1WNEA 3GWCA 4KLTA 2RRNA 5B08A 1X0PA 4O55A 4YOYA 2ZBPA 4FJNA 1FX2A 3OPKA 4DTXA 5CA5A 2QLFB 5AZIA 2E88A 2L5YA 2KNJA 2IA6A 3ZSQA 4C4RA 2WC9A 1JJ4A 1Y64A 3NE6A 3EKSA 4BC9A 2KE7A 3SSSA 3SENA 2FDRA 1T6DA 1YJ9N 1XMOJ 4KPYA 3NMUA 7ICKA 2UU9F 3NRBA 3NF7A 2J9CA 3QUTA 2KXNB 1CJUB 1AFJA 4FM0A 5HMXA 3OS1A 1FJEB 4F4XA 5AQLA 4B9MA 3KKSA 4CHYA 1V97A 4CBUA 1SB6A 3UN5A 2ZJRQ 4B3TK 2W9AA 3MM6B 1JXBA 1T9XA 3O44A 4LJXA 4GKKK 1MW7A 4ZTFA 2DPNA 3A5NC 4K8XA 3GE1A 1SWWA 3MDFA 3Q89A 1DJ0A 1RDWX 3AU6A 4M42A 3M9MB 4H0VB 1RQLA 4NYZA 2YB1A 3WKDA 4BVPA 3R6LB 2DTUA 2GO9A 3MCOA 3Q8RB 2MKSA 2Z56B 1UVJA 1B7FA 2ZXIA 4FSVA 2M52A 3MR3A 3KLGA 1Q7LB 1ZQGA 2WW8A 1EWQA 8ICYA 3KLFA 4C8NA 4LF7K 5AKXA 3NOGA 3VAIA 4KHRA 5HMLA 3AGRA 4CO3A 2EG2A 3KNAA 4A57A 4RTFD 3MECA 4FYYB 5CR0A 5T7BA 4F36A 2Z57B 3C66A 2DR9A 2C2ZB 2HMIB 3G25A 3KKRA 4F92B 4PZVA 3QNWB 1UPPA 1FK9A 2UXBF 1E4FT 2E5IA 2B0GA 4U96A 5AQYA 1ZPVA 2R7XA 2Q31A 4F0KA 5HVGA 1VK8A 4B3RF 4MKVA 3UXOA 3N5FA 1COOA 4O23A 1SB3C 1WEZA 2POKA 5M2PA 2VKQA 2NPFA 4FYWB 1FRJA 1NSQA 2YB4A 1BCOA 2LEPA 3JB9k 1LFWA 1J6ZA 2O8EA 4CFCA 3FVYA 5HROA 1U6ZA 3WNFA 4PG6A 5B66U 4FZMA 2K06A 5D4BA 2G5HB 4UZBA 2JVOA 3AA3A 5ETOA 4K0KF 1FIQA 2HZAA 5GTIU 3VF2A 3NS7B 3RRHA 2WF9A 3RB3A 3D0HE 4OZ3A 3NH1A 1VIOA 1WKLA 5CHIA 3HM9A 5HSPA 5A8KA 1HI1A 3NWRA 4FOIA 2HRTA 5KTQA 2QA4N 1K8AO 4XDCA 4JN4A 2KT5A 2P35A 3JTPA 1CPZA 2RS2A 3LM9A 1FESA 3U3YA 4YMNA 3AD8C 4EU0A 4W5OA 2QK9A 4ZLPA 2K4IA 3O1LA 5J2PA 5EWFA 5D4LA 3NH0A 2G4BA 5FROA 3ZXWA 2YQ1A 2FSNA 4P2MA 2EEYA 5E84A 2GMLA 3AY9A 4OHVA 5T14A 2MY7A 3S3NA 1CS4B 1BOTO 3ISNC 3QSIA 3M9NB 4JI4J 4X64F 2VG6B 2VQEF 4DL3A 3DRSA 1VQYA 3GV5B 1MWYA 4UQTA 4RNFA 1GLCG 2MMYA 2EI5A 4CDIA 4MF2A 2AEMA 5EE3A 5AR0A 8ICIA 3SLCA 5FD1A 3HXMA 2V68A 1RADB 2KFNA 4LF2A 4DR2K 2DNHA 2BPGA 2MYFA 4WF9Q 3SAFA 4AHSA 3O8MA 3MXMA 2GX9A 8RUCA 2RHSB 4WFYA 4CEQA 1N5QA 5D3GB 2W4PA 2MZ1A 2B4UA 2MEWA 1N56A 4H03B 2BR0A 3SDEB 1SQFA 1H7WA 3V5RA 2RT3A 3AO1A 3QICA 2QA1A 4UB1A 1VYAA 4CLLA 2LI6A 4KFBB 1XMBA 2B3TB 3I76A 1KFDA 1VDVA 3SPZA 2FHJA 1U1KA 2PEBA 1IVZA 3VAHA 4KV8B 5HBMB 1MA7A 5ALTA 9ICRA 2QO3A 2G1HA 2QL7B 2CQIA 3C14B 1OH6A 4CRXA 3HVAA 4CZIA 5KFTA 1HBUA 4C1NI 1JROA 2P9KB 1HA1A 4QR1A 1ZAVA 1HNVA 8ICCA 4F02A 4DI6A 2HIYA 4YN3B 5IIIA 3D6TB 3BSNA 4B3TJ 2ZIXA 4HL9A 4DSJA 4B17A 4FCYA 1J27A 3IFRA 3ISZA 5AQJA 2RQKA 2X74A 1RWWB 3G71S 5ALPA 3E01B 3GJQB 5ALJA 1GNKA 2DGWA 3RMAA 3I56S 4C11A 3MZIA 2IDOA 2PMZF 2QYGA 2IOFA 1MU2A 1Y5LB 3HDSA 4CIGA 3UI3A 3NS1A 2JLEA 3G86A 4MHVA 2WB1F 1X42A 4DV5F 4ILHA 4UW2A 1AZSB 3G6ES 3ZDAA 4K2XA 2LU1A 3CMEN 2AHOB 4DG1A 4L74A 2N82B 2VHGA 3P31A 1IKVB 2XS5A 1WEXA 2VPXB 1TL3A 1UJ4A 3KK3A 4DR7J 5I3PA 4H0OA 1JWWA 4Y0WA 1C2PA 2E6LA 3C1YA 4MIBA 1KXPA 3CJKA 4JD2A 3SSRA 4UAVA 2RQMA 5KOWA 5HR6A 4MF8A 5J0TA 1T11A 2NSBA 4LF8J 2JJ4D 2GIQA 3ZNUA 3FZMA 4HCCA 1ZQJA 1J5EK 4P73A 3HCXA 3DOKA 3ZZZA 3AA8A 1VK3A 1WORA 3T5KA 2CNLB 2Z2LA 1UHUA 1H73A 1YJNN 3SUNA 2FHKA 4FYDA 3RBZA 1HPZA 4ED1A 1U1PA 2QLTA 4QIWF 3EMTA 4DV6F 1HI8A 4F3TA 3F9KA 1KS2A 3KLEB 1HQUB 3K1RB 1FI4A 3I33A 3DEEA 1RTIB 2A3ZA 5JJBA 4Z4FA 2EWSA 3MPYA 4CO4A 1O0PA 3M2UA 2YMQA 1KKHA 1VQLS 3H1QA 5EE1A 3AAWB 1DTQB 3E9PA 3AL0B 2VKZG 2ATQA 4B1VA 4E1MA 1VJWA 7ICSA 1Q16B 1NGHA 2G8WA 4OKKA 1VQMS 4LFBF 3MAAA 4JI0J 2NXNA 5D0GA 2IRYA 1FRMA 2B4OA 2MQOA 4DV6K 5DB6A 1IKXA 3KLFB 3WKCA 2HK3A 3E9LA 1LW0B 3TEHB 1K9MT 4CJUA 3WEEA 4TXSA 4YR2A 2FTRA 4QIWC 3CCMS 1LWCB 1AB8A 3VAMA 1U09A 1L3TA 2QXFA 4EMDA 3SQIA 4KGVB 1Y5NB 2NR0A 1SXEA 4F4WA 5KFKA 3GIRA 2FC0A 3AQOA 3IMQJ 4BRQA 3SCIE 2UXCK 2K7JA 2Z2ZA 3PACA 1ULRA 4BR9A 1UW4A 3J7ZO 3HHKA 1HHQA 1HHTP 3OFGA 5HJYA 4ZKAA 2MQLA 1JIHA 3KZXA 2QLWA 1RT5B 2IS3A 2K8AA 3RAMA 4DX6A 3CC4N 2MZTA 3AQEA 1JI7A 2LQBA 3RJIA 4ZN1A 3TWZA 1U1RA 3OL9A 1ATSA 1IKWA 2Q36A 1JUDA 2G8KA 2Z8QA 3NDKA 1TGOA 1TK8A 1VISA 3WT0A 1KAYA 5D15A 2O8BB 2BV3A 3B6PA 1DQAA 1UKUA 4M5IA 4YY3K 5J0QA 2KZZA 4FWOA 1RT7B 2QWRA 3F2DA 2GC8A 2E8AA 4CF9A 1MQ3A 1C4CA 2ZD1B 4BG8A 3UN3A 1RDCA 4FWNA 5IQQA 1YAGA 3DLLQ 5MLCQ 1RB0A 2OPPB 3KIOA 2HFOA 1NDLA 2YHXA 3D1OA 1HJOA 3D1HA 2ATLA 2I1RA 4A48A 2KP7A 4LFCJ 2IY5B 3CD0A 9ICSA 1JJCB 2RJZA 5BXIA 2FVCA 4X4PA 1KKXA 1J5EJ 1VBXA 3TSPA 1XMQK 3V6JA 2FUG9 4H5VA 4DU8A 5ALKA 5KFNA 1LVHA 4QWDA 1AXQA 4KHQA 2GOLA 4OPKA 5AXNA 4B9NA 1U0HB 4I64A 3QESA 1Q79A 3PSIA 2GQQA 3LZJA 3TAGA 1M1HA 4QZGA 2BANB 5H1SQ 2E20A 4ELUA 2IIHA 1DGJA 3I0SB 3QUCA 5GAHP 4K2JA 2L41A 5AQOA 5B0EA 3T19A 3D2WA 4N47A 4V19J 1C6VA 4IQUA 3S1TA 2QI2A 1BI4A 3AJDA 4BC7A 2K60A 3MUVP 2IDEA 4CI6A 1SPBP 1LK7A 2D1CA 1XNRJ 3EGNA 4IG3B 3ZC4A 3G9CA 1K6YA 1S79A 2M3DA 2M8HA 4NLKA 1D3WA 4OX8A 4FZNA 3T79A 3EUB2 2W8LA 4L8RB 1BPEA 1D8YA 3H6EA 3TRGA 2M70A 1SJRA 1XNQF 2AJ1A 4RCHA 4G9BA 5JUMA 1L3SA 4QZVB 3SEOA 4CP5A 4O0JA 1KHWA 3MR2A 4C2MA 4JV1A 2UVVA 3MECB 3QSYB 2B9WA 3AQPA 4ISFA 5C10A 4LF9K 3BGOP 1V9PA 4MLHA 8ICRA 1QH9A 1R89A 2BKPA 2V2QA 2GMHA 2P6SA 4GXJA 2HWHA 2VZ9A 4UB6U 3F5EA 2OPQB 3D2FB 1WF1A 4BRMA 3MDAA 4AP9A 3BQTA 3MN5A 3RFAA 2UU9K 1CC7A 2LDIA 4DV1J 3KJQB 2F3JA 2ZIWA 3OD2A 2Q1NA 1N33K 5CCLA 3RTVA 3CJ1A 3RYLA 3MFIA 4IQWA 1NHKL 4CZKA 3PEHA 9ICWA 3CJ0A 2F8HA 4C0ZA 2IGIA 1HUZA 2JX2A 3O3FA 4JI3K 3WQPA 4B3TF 4GKJF 3MMCB 2RILA 3KWMA 1YJWN 2O4IA 3LGMA 4DFJA 4BUGA 3CCLS 1RAAB 2DXDA 2OGUA 1KFSA 2HNZA 2K7KA 3HF5A 5A8RB 2G2YA 1V85A 4DS4A 4ECSA 2K8GA 5LJWA 3KLEA 5G0RA 3SUOA 3OT9A 4M95A 3VEVA 1B92A 1R3NA 4JHDA 2IM3A 3RH6A 4N8OA 3H59A 4CGIA 4WKRA 9ICTA 2B4VA 4NASA 4QS8A 3JSBA 3QAEA 3VEWA 5GADI 1URNA 1ILYA 3M8SA 2UXBK 3FZHA 4FS1A 4KAIA 1TAQA 2CDRB 1IBMK 3MM8B 1UMJA 4XA5A 1NHUA 5IT4A 2ZBIA 1RBRA 2RH3A 5AFUH 2B51A 2DNPA 3KLHA 5TKWA 4DSLA 4YUDA 4WIIA 2Z2YB 4JI8J 4K4GA 2HHQA 4PG7A 3UDLA 4AM7A 1GXLA 4KHMA 1ROFA 2NUUG 1FXLA 2FI1A 3EJMA 1FWLA 1PJ5A 2PC6A 1CJVB 4G6VB 2HAIA 4ILMA 4OHZA 1CLFA 1UPHA 4AL6A 1CI4A 1EWRA 1WSVA 1N54B 1RT1B 5AI8A 1RTJA 4KLDA 4FOEA 1ZQEA 2O8FA 4DR1K 4H54A 1DKGD 2DEIA 4WBFA 8ICXA 1Y0HA 2FMQA 3PW0A 3OVSA 3FUYA 2B43A 1RHJB 3AFGA 4TLRA 4ANEA 4BG9A 1E6VA 1N36J 1ITGA 3R7BB 4NV0A 3L6QA 1RT3B 3U02A 4OHWA 3P38A 1IKXB 2XMUA 1AUSL 5THWA 1EARA 3S8SA 4GVBB 2RHFA 3ZSVA 2DHGA 1UQVA 4ZVUB 4I4BA 2JGAA 2NO4A 2N3LA 4DTOA 1N60A 2LYHA 4YFUA 1MWZA 1RHMB 2RAQA 5HNKA 5AM4A 4H4MB 1GLEG 1JLQB 5J2MA 2VWKA 2X51A 4ZP7A 1DTQA 2GV1A 5CY4A 2P6RA 4IO9L 2ATCB 3RBDA 3OS2A 3HSZA 3LVVA 3MWPA 1KRPA 3C6UA 4Y2MA 4FJ9A 2ZHBA 3O3HA 7ICJA 4NLWA 2JVRA 3THXA 2HHUA 1TZ0A 1VRUA 2MQMA 3KUHA 4ED4A 2XS7A 3HKWA 4J9PA 3RMBA 3TADA 3TUZC 1YVNA 2HNYB 4FE3A 3ZX3A 1ZQTA 3UCGA 1VC6A 3RJKA 2CRXA 1QSLA 1UEVA 3WIVA 2HCFA 3DNCA 5CXTA 2QARA 3C2LA 4JYAK 4B3SJ 3ZD8A 1WUAA 4FJJA 4KREA 1NJIT 2UUCF 5EWEA 3CMAN 4YDDB 3PIOL 2DUYA 5KGWA 1IBLK 4YOWA 4YP3A 3CCSN 1O03A 3LF0A 2R7YA 7ICVA 5AE1A 2VFSA 4WQ5C 1RHQB 2QWMA 5L1JA 4BDYA 4LF7F 3R3TA 3AA2A 3BZKA 4C6AA 4DUTA 1NPRA 3MMBB 2GGPA 4IO9Q 2FVPA 1RWPB 1RTHB 5H9FJ 3RJEA 3I55S 4I2HA 1RAIB 4EX7A 4JRPA 2NS1B 3C15B 3Q8KA 5E41A 1X5OA 3ETOA 2NSCA 2QG9B 3IRXB 1T95A 3M6ZA 3V6DB 4Q45A 2GH1A 1SKSA 3SCJE 3DMJB 1XJWB 3LPTA 4WYWA 1HEKA 3P1GA 3TTDA 4NCGB 2ZKTA 4JI7J 3CJ7A 3OBYA 3ILIA 4OKEA 1FX4A 4OYOA 3N4QA 1PSDA 3HW8A 1K47A 1ZOLA 1BI4B 2AJ4A 3CCQS 9ICXA 3BSOA 2M7SA 3DLLL 1WTFA 3DM2A 4R63A 1Q3VA 3OTOF 3TANA 3UKUA 2ZOMA 3CJ9A 3BO4A 4PKHA 2V2KA 4NXMJ 1M5OC 2YKMA 2V50A 5KFJA 1X60A 4EFAC 3W64A 4DUZF 5B8HA 1Z1BA 3O2IA 4BRKA 1U1NA 3IWLA 5FPMA 1C1CA 1VQ7N 1LWEB 4JI2J 4AHRA 3CDBA 2YWFA 2MJUA 2N3OA 3IAYA 4X66K 3QINA 3OYAA 5J1PA 1X9XA 1KL9A 2GHVC 1HNWK 5LM7E 4J03A 4M6WB 2NXEA 3M6GA 2KJ8A 3LAMA 4LFCF 3WDOA 4Q0BB 3H46O 2E4LA 3J80Y 3N01A 5FLXU 1NCLA 3A5LC 3ZTSA 3OTOK 4I2AA 1N5YB 1NZPA 2W42A 4KLJA 5KFOA 1VR6A 2IMOA 5DBAA 3TAEA 2YKNA 2IJRA 2ZQBA 2B4PA 2HBKA 2JWNA 2SXLA 4EGLA 3I8BA 4KTWA 5AM5A 1ZA1B 1N36F 3PUFA 3LP0B 2Y9TA 3GONA 4BLGA 5F3ZA 4CFAA 3V7JA 5FPDA 2R7SA 2OPQA 3D2FA 4QQBA 3MWTA 1HL6A 2RDIA 1JNZB 1YTUA 4JV0A 3IC1A 3JPQA 5EU7A 1UVNA 1M5PC 2ZWPA 8ICFA 4PL7A 1T9WA 5KAKA 2F4FA 4C8LA 1ZQLA 4ZJOA 2QSWA 1G1XA 1EXQA 3NGYA 1GXUA 4JI8F 3I4PA 4Z4CA 3PW2A 4PG5A 3CIMA 1XIQA 4OJ6A 2ZJPQ 5CZVA 1UVLA 3SQ0A 2F77X 2HBJA 4MEXA 1X3MA 4RBUA 4RWXA 3BDPA 1TUYA 5LOQA 1QUPA 3TQ1A 3BQ2A 3PKMA 1FDAA 3MAQA 1RSCA 3DLKB 3HX0A 1HIYA 2KKVA 2CPYA 2NZTA 3VQDA 1Z1ZA 5LSLA 3VCDA 3ZDCA 3DFEA 2YWWA 3M8QB 4U6PA 1JCEA 1VSKA 1HNVB 2FZGB 3FCWA 1NKEA 3TWHA 4FJ7A 4I2CA 2DNKA 1DLOA 4NPOA 1NOZA 2P9SB 1WKKA 1VSJA 3H3OB 1T03A 2KYXA 3SBMA 5C24B 3FFKB 4ED0A 4FP9A 2VQFF 3PSPA 2XZDB 4HWIA 4YY3J 2FGCA 3ZDBA 2XNRA 4ZHRB 1VQNS 1N34K 4KHWA 4HH0A 1OMSA 3MPWA 2V5HG 3C16A 1W0HA 4KLLA 3SMVA 4GVLA 2HNDB 1JLAA 3LAKA 5A2QU 4DX8H 4V1Ak 4BX9C 4M1KA 4U7BA 2DNNA 2M9NA 1SQKA 1S8OA 2LSNA 1VQKN 5F0UA 1A76A 2FHMA 2PA3A 2RRBA 2GGPB 3H5UA 4R25A 3QT7A 3KK3B 2MSTA 2QEXS 2KVSA 1YITN 1JLCA 1NZBA 2QW9A 9ICNA 3C15A 4M3UA 1V3RA 4I9LA 1HNZK 1ELOA 4JAXA 1TKZB 4M2YA 1A5XA 5LSOA 4ZOHC 3H2LA 2HS0A 4IR1A 5L8RC 1VQ5N 1UCVA 4X4TA 3MGIA 4PYDA 4RW8A 2AU0A 4C4WA 3CCVN 3FBBA 3M8RA 2GX8A 1WB9A 3EWGA 4L76A 4JI3J 2P6TA 2DY1A 4KB1A 3CCRS 4PWWA 4U8VA 1ZRNA 3DU5A 1JK9B 3CCMN 4ECUA 2LFVA 1XNQJ 5DQIA 2KXHA 3C2MA 3WKBA 4PQUA 2B9EA 3SPYA 3DGPA 1FTRA 3PY8A 3MM5B 2E5LF 4HDGA 3DN9A 3RU0A 3K89A 3MOZA 2HVIA 2JLGA 1UFLA 1TKXA 2RE2A 3AD9C 2FY1A 1QAYA 1K5OA 4DV5J 3LP2A 1JMSA 3W2WA 4LF4F 3H25A 2FJDB 1KFTA 3W8GA 1Q7YO 4I2EA 3HKZD 1VQON 5J0SA 3C46A 1C1AA 3CJCA 5F8NA 4IXCA 3DKDA 3QAUA 1X6IA 4DV4K 2QARB 2IM0A 2MLZA 4FWMA 5KGXA 1OPZA 5B7WA 5ALFA 4NCGA 4C8YA 3ETRA 4L75A 1S6PB 2ISPA 2R7QA 1NJIO 1WI8A 3MN7A 1FVSA 2KW4A 4ZVFA 1FA0A 3UCZP 5E5NA 2BKNA 1TL7A 8ICOA 2P9PA 2VC0A 2OMLA 3B8AX 1XNQK 2CQCA 1EP4A 4USJC 5E26A 3C5FA 1YBAA 2CQHA 4GC6A 1XC9A 4PL1A 1LKYA 4H4KC 1F2GA 4I2IA 4NLBA 4WZMA 4YOEA 1QTNB 1YJUA 2ZM6F 1PK3A 5EOZA 1FNOA 2QLBB 5HVHA 2IA0A 1QUVA 1QHTA 4NOHA 3F41A 3G10A 1VQMN 3VGUA 4PHEA 2L9DA 1S9GB 1JLEB 4QBUA 4DPWA 5DETA 1J5OA 1M5SA 1EKEA 3WK7A 2LYAA 3RJHA 1RZMA 4N41A 1VDHA 4JKCA 4B3SK 4CRJA 2RS8A 3D0IE 3TKAA 4CJVA 5DKWA 1K8AT 2O8BA 2FLNA 2AJ2A 4L72B 3DOLB 4CJEA 3E3XA 5J29A 1N52B 5EY4A 5KT3A 2X6NA 4P52A 1YSJA 2CQGA 4FJIA 5BRDA 4QZDA 3NS5A 1Q53A 2BABA 4CNZA 1VQ8N 4JI4F 3L7OA 3RSEB 2EFVA 8ICQA 1OIAA 4B1XB 3RRGA 7ICRA 2BKOA 3TR5A 3PX6A 1SQEA 2MAXA 1M5VC 5LSRA 1F60B 2R4FA 1PVQA 1Z26A 1NLKL 4NLSA 1HI0P 4A2BA 4CZMA 5KFUA 2VWBA 1DAXA 2W2OP 1K8KB 4J37A 3ZETA 1N0VC 2OPRB 1NG9A 4LH4A 1SJQA 1UVMA 3C65A 4M3RA 1SV4A 1K73O 3AV9A 1BPZA 4E3SA 4PPXA 4DCPB 1OUQA 4NL5A 2W4DA 3TFSA 4RT2A 1FE4A 4CEBA 4BS2A 3TA1A 3JQKA 3RAXA 1HKBA 4LSLA 3LYSA 3HYFA 3SBTA 1RDRA 4JWNA 3CD5A 4V19S 3OXFA 2RQ5A 2DFLA 4UOGA 2Y0SC 3DI6B 3ONNA 4FPBA 2LU2A 5JVGL 4YHHK 2CZ4A 2V52B 1QZ6A 5KFBA 5AZJB 4QW9A 1EJ7L 2WAQC 2HZCA 3GLJA 3M2RB 1HQUA 4NWBA 4DV6J 4DOZA 2K8CB 4F5OA 3M7VA 4AL5A 2F2AB 4O44A 4OGCA 1RUSA 4CJWA 3A3PB 3HZEA 5IFMA 4O4RA 3QRPA 1VQ9S 3DXSX 2ZJ8A 2HQ3A 3SXLA 1YRUA 1REVB 2XMTA 1PBUA 1BPXA 2Z1GA 4LF8F 4JV5K 3L2UA 1I94K 2HHSA 4NMXA 5IXUA 4K41A 4Q44A 3G0ZA 5HHHA 2CJAA 3R8EA 1SJ1A 4WFBL 1T05A 1D9FA 5L9XA 1Y7PA 3HWTA 5K8MA 1JCFA 4YMMA 1FJGJ 4A8KA 4KAZA 1CJUA 3IN5A 1YBUA 2EVZA 3HHEA 3K5OA 4KO0A 4X65J 2OSRA 2XM3A 1ZAWA 1SH2A 3D28A 4Y1CA 2EFQA 1VQ6S 5AIAA 1X4HA 4C7YA 2KT2A 2W4CA 5D0HA 2O5DA 4HUFA 2LDYA 4QW8A 4BRNA 2ZBRA 2V6AA 1IXRA 4DL5A 4X4SA 3NH2A 3SQOP 4GMJB 1YWXA 3HULA 4C3KA 3WC0A 3W3SA 5I3UB 2WHEA 1R6VA 3ENQA 3UKUB 2IPOB 3EVWA 3GB0A 3LDOA 1C4AA 1VBZA 4A4JA 1X5PA 3BF4A 3M2UB 4I2QB 3V4IB 1L7NA 3QT6A 3BKTA 3TNVA 1NK5A 2IOHA 3N0VA 1MMNA 4E7HA 1EKRA 2Z0GA 2IM2A 3ITHA 2PN6A 3A1YG 1FWPA 3PHTA 5EE9A 2G1DA 4LSZB 2HRYA 1XMOF 4RUHA 3G6EN 3BSCA 3WQTA 2DWQA 4JK7A 1LW2A 5AQGA 1HBMB 1Y5IB 1N5YA 3NVWA 5HL7Q 2GJIA 4OYXA 1DGSA 3EICA 3G71N 3X1LB 2JWKA 2YJEA 2YQEA 4RQ2A 2QTWA 4OPJA 2KHVA 4ZTJA 3UD3P 3QEWA 5AK4A 3QEVA 1CJVA 5GMKa 4W5RA 2E8OA 2KHQA 2Y0SF 1WUDA 5TZVA 2I6XA 1PC5A 1YHQN 2ITMA 4LR8A 4O3NA 5L1IA 3M6UA 2D4WA 4E7IA 3SNNA 1N8RT 3BS9A 4DTSA 1HKGA 2Q3PA 4CH0S 4BQZA 1RBTA 1XSPA 1OQ3A 1F2HA 2AKWB 3QIOA 2ZITA 1GX5A 3EY1A 1YI2N 1RLDA 1MROA 3N97B 3FCVA 3UFCX 4FLVA 4F50A 3PG9A 1F3VA 3HD1A 3MI7X 3D2NA 1VRTA 4GW6A 2UUWA 5ALDA 3PIPL 3UR3C 4X64J 2K8BB 1VQLN 4EI2A 3LA0A 3KD5E 4DV2F 1L3VA 1ZA2B 4MAKA 2RQCA 5AKIA 5J2CA 1WG4A 3MHYA 1IM6A 2XHCA 3N4WA 4JS5A 3ENHA 9ICKA 1UAWA 2YTCA 2I38A 5ALZA 1PVPA 1WELA 2HFSA 4WIQA 1RCHA 1S99A 2JH3A 1XO1A 3F5AA 2V4QA 2PMWA 2YH1A 3NF6A 2P9GA 4K4VA 2G06A 2BUNA 3J7YP 3VGKA 3JYTB 2ACMA 2ODGA 2KHOA 5BPNA 3ILJA 2M4MA 1N0UA 4YMOA 2WAQF 4PPDA 3LZIA 2HDOA 3K2YA 5CHGA 4UARA 3KNGA 3H5SA 3MXHP 3V9ZA 1U2RA 2W9BA 5ADXA 5CCMA 2YPYA 4OX9K 1ZETA 4NXNF 4KGKA 2YJFA 4CF3A 4ZHRA 4EBCA 2KZ3A 4CZEA 1ASWA 4LVOP 1HWJA 2A40A 3UE5A 1HYZA 4ILGB 1E3MA 1I51B 2D6FC 3W5YA 4CBXA 2NZ4A 5M2UA 4R5PA 2PFUA 1TL7B 1VQPS 3A8JA 4RBTA 1I6JA 1OQ6A 3N6NA 3IFEA 1ATRA 2CGKA 4EHUA 4USKA 2OPPA 5AM0A 4ZVRB 1LCUA 1V9OA 5G5HA 4Q43A 5C12A 4WFZA 3ZEUB 3LDQA 3RJMB 2ZZMA 4ES2A 2LYBA 2HHHK 2R18A 3N4PA 1VLOA 3U1NA 1IG9A 3ONQA 3KHHA 4V19X 2VB6A 2YQ0A 1Q4RA 5CE3A 4CT9A 2P9PB 3L3UA 4ECWA 1K9MO 2MSNA 1J2VA 2UXBJ 4DR1J 3H0RB 1B0PA 2KJ5A 2ZZNA 3M1VB 4EEKA 4ZVEA 2NZCA 1FKAF 3L7UA 5CYJA 4BHQA 2IVFB 1DZ5A 4UT4A 4DMNA 4KRFA 2OM6A 2LP4A 3LALA 2AP1A 3M5RA 4ZPCA 4KC5A 2E9ZA 2DHXA 3QERA 4HACA 4K25A 1JLFB 2IRUA 1E4GT 2BE9B 4DLGA 2G8VA 4LSLB 2X1GA 2DF4B 1S12A 3PVXA 3CERA 2PDAA 2PD1A 4AF1A 4OYPA 3K5PA 1WWHA 5AQQA 3SV4A 4KH4A 2UXCF 2PT0A 4FN5A 5MAOA 9ICFA 3CF5L 3F73A 4FWQA 4TY8A 3FBEA 2KFYA 4E8UA 3N6MA 2QWQA 4DUZK 3BP8A 1ZQWA 3UMGA 1WG1A 2AYBA 4KT0C 1RAGB 3TADC 4Y2QA 4AFFA 2DD8S 1XNRK 2F7TA 4DQSA 3C19A 1QD1A 4Z37A 3C2KA 6FDRA 1TE2A 3CTRA 4PHDA 5F8HA 5KPTA 2NNWA 5KFMA 1HMVA 3T1YK 2O4GA 2I0XA 2W7AA 3C0BA 1D5AA 4MLEA 4UTGA 1RTZA 3TZWA 3WKAA 2FJVA 4MTPA 4KGZB 4NZ6A 2Y1RI 3F44A 3GFHA 2ZM6J 3UCUP 3W60A 2VG5B 2M2BA 4J9UE 2G0CA 5J8YC 1S97A 2PSZA 1OS5A 2MKJA 2AJQA 1PCAA 5HRSA 3MGHA 3A0IX 4G1QA 1TV6A 4TUSA 5EUHA 3FCHA 4NLGA 4XH4A 1OO0B 2ZDOA 4O3QA 2B6AA 4A59A 2CNNB 5B5EU 4DV3F 4P0QB 1FXDA 4S0MA 2FD2A 2J6TA 3LP1A 1V6HA 1EZZB 5ITHA 4OLPA 1F0MA 1JRPA 2H48B 2WTUA 4NLVA 3LP3A 2KM8C 2CPXA 4IQMA 3HPGA 4KB0A 4CYUA 2HI0A 1VSMA 4FF4A 2KHDA 4LIWA 3CUNA 4QWEA 1V38A 3CD7A 1H2VZ 2HBQB 5DG8A 2QA4S 3HSGA 3J7YI 3VQ7A 7ICLA 4LF4J 8AT1B 3D6JA 2AD9A 4K5SA 3NAIA 1LW0A 4FO0A 3M1YA 1NAQA 2YNHA 3HZ6A 3MR5A 4XAKA 5ETMA 1ZQBA 4I6WA 2ESEA 4E1JA 1Z00A 3HT3A 4NLPA 4NRTA 3THVA 5CYQB 3HSDA 1AFIA 1KLMB 1LK5A 4JI2K 2E5LJ 3QETA 5GIOA 4G65A 1D9DA 4AHVA 4GO5X 4RPZA 4KMUA 4QIVA 1CEZA 3JPTA 3UDCA 1GMWD 3IM9A 4DFKA 1LWXA 4ER8A 2BW2A 2P9EA 4CNYA 2PFNA 4TVAB 3BN7A 1O08A 5FIIA 4Q2LA 1NGFA 4NXMK 1U26A 4MDAA 3VTHA 2F5GA 2Z4PA 5CWRA 4QR2A 3FGUA 3OR1B 5DZ6A 4JI5J 2GTDA 1F9HA 4LF9F 5I42B 4ZITA 3FZBA 2HFUA 4OKJA 2A6AA 4DR5F 4GNIA 4UOFA 1K0VA 5ELZA 1CXQA 3I87A 3KFWX 4RW8B 3QPIA 5F8GA 3N7SC 1P27B 7ICIA 4UBBA 3TZZA 4DV0K 5KFHA 1N33F 3Q2SC 1WKJA 3CIZA 3DM2B 4MFBA 2BCSA 3BH6B 3LVWA 2W3RA 4USWA 2LQJA 2UVUA 1RCXB 1HYSB 3R9PA 2ADBA 4WK3A 5CRXA 4ECYA 3QMQA 1A77A 2CQ0A 2D8CA 2D69A 3NGZA 1RA7A 4TUQA 1AUDA 4JI4K 3CDAA 2J0QD 3DGPB 1WEYA 1TR0A 1MNEA 3B0XA 4AQYK 4RQ8A 4A8MP 3BS5A 3ATVA 1S1TA 3CCJN 3QEXA 3PW5A 1BPYA 2ROPA 4I2FA 3BYRA 5J2QA 3CJBA 2WOMA 1U45A 2WHOA 5SUHA 4N5SA 2A2CA 2IHR1 4CZCA 1XWLA 2DQNB 3EXYA 2CZ9A 2GJ2A 2ZH2A 1U47A 3D9BA 4IQVA 2AJ0A 1KVBA 1YVUA 2NUHA 5SWMA 1RDUA 1ACMB 3WNHA 4P2FA 4LBHA 4FZYA 2B0CA 2FBYA 3KD1E 3BGUA 2B6GA 2WK4A 4HUGA 2WMMA 4DV3K 3KKAA 3U26A 2VIXA 2RDJA 3Q8YA 2GIFA 4LMZA 1TAUA 3KJNB 2F1FA 1J2NA 1Y88A 3RGIA 3GFKB 4WQ4C 4BDZA 1EAYC 2CJBA 4NLZA 3F0NA 3VQ5A 1XHXA 1N5XA 2DFFA 2MUTA 4DN9A 3ZZRA 4DQRA 2GO8A 2KVIA 1VRUB 5F8MA 3K58A 2QM1A 1V3ZA 3QJJA 5GADU 1WI6A 3W2VA 1X4BA 2FSJA 4J9KA 4DFMA 2HBRB 3O9QA 2FJ6A 1C0MA 1VHFA 5DM7L 4ED3A 2L9WA 5GVQA 2NLXA 4DZ6A 4KH1B 3C5GA 1Q1KA 2AIRB 2IAJB 1UPMB 2C3OA 4HTLA 3V9XA 5J1EA 1QE1A 2HBYB 5TISU 4Z4HA 2CJ9A 2NXCA 3ORYA 1VMBA 1DT9A 4K0KK 1S6QA 2U2FA 3R8YA 2QJ3A 4DUYK 2BHNA 2VPWB 2C28A 3H4BA 1WSIA 1JLEA 3LUYA 3VGVA 4WFAQ 4OCZA 2G07A 2ZUBA 4M5LA 1ZM2A 1NK6A 3OYFA 5DLGA 3V1RA 2Y8WA 3J7AP 2E44A 4O3SA 7ICQA 5T41A 2E29A 2K3KA 2E2PA 1RI7A 2XICA 5CB1A 4QWBA 4TQSA 2WB1D 4DTUA 3D3BJ 2R9LA 1UL3A 1KC8O 4JK9A 2HNDA 4A8EA 5BN8A 4QZ9A 2Z30B 4OX6A 1XR5A 3POTA 2GLEA 4BJQA 2DH8A 3CE8A 4JKHA 1RWXB 3CJSA 3MN6A 3M9OB 2C3YA 2FSKA 2VIHA 5E7OB 5J2EA 2JZ5A 2VQEK 5H2FU 3HRDD 4HAIA 4X4NA 5ALQA 1S6OA 2D3UA 3ALYA 1JLCB 4H5TA 2ZNYA 3OFFA 4WE1A 2LA6A 4F71A 4FM1A 3HD2A 4I2PA 2KVCA 4P6QA 2Y3YA 3AA9A 3SFUA 8ATCB 3TZYA 2CQ3A 2PMHA 2NYVA 4JI7F 5KT2A 4IH6A 5DRKA 1TKTB 3SQ1A 4PG8A 2HEKA 3BS7A 1X4CA 4LRBA 1I39A 4U8YA 1BHLA 2J8SA 4OQJA 5AI4A 4PKGA 3M4XA 2BQ3A 5ETNA 3D1QA 1BC6A 3AO5A 1B0XA 4QIFA 3JPRA 3CJ4A 3NCRA 1TELA 4MEYA 3KG4A 1RQ0A 5C24A 5KAIU 4NA2A 2W7OA 3LWMA 3JSRA 1MWKA 3IP4B 3A13A 4FW1A 3QX7A 4WU3A 1NMDA 4GC7A 4UAUA 4F5RA 3GJTB 1X4FA 3A5MC 4LF7J 1JLAB 1FRLA 1W7AA 2F8KA 1T0TV 4JI7K 2YMPA 2YHBA 2C2EA 2DGQA 3EDRB 3DLKA 2ZUCA 1I3AA 2AXTU 2OFGX 4L3KA 4H5RA 3MUTP 3LP2B 2NQPA 2H54B 3BH7B 1DURA 3VQ4A 3SQGB 2XYPB 1N4LA 3S3MA 2G0IA 1X8DA 1DLOB 3ENAA 2LM1A 1YJ9S 4KLUA 2IYIA 4OJ3A 4C23A 5IC6B 1NGCA 3MX2A 1Q5VA 1TUWA 1GOCA 3HVWA 2VG7A 2B6AB 1XMQJ 2GHWA 4F4KA 1RHRB 4ILRA 4PG4A 1RBLA 2DNOA 3OR1A 5J2MB 2QIFA 1HNWF 2DR6A 4G3IA 3I0RA 4I7FA 4KIAA 4JI1F 4MYTA 4J9VA 2FJBB 4KN4A 2L3MA 3I5CA 1BISA 3SQ4A 4TU8A 2H5IB 2D74B 3EX7B 1NKBA 1S0MA 3OGUA 4A46A 2J0WA 3S7RA 4ZDNA 3M6KA 2GO7A 1VQ9N 3S6EA 2PFPA 1T03B 3JSMA 2ASYA 5FLXO 4QZ8A 4DV2K 1KVCA 2CGLA 1OVYA 5GAGU 1JL2A 1FW6A 9ICEA 4P10A 3LP1B 4LJMA 2VA3A 2BA9A 1N32K 1NNEA 1CJTB 4QOZB 3ZSWA 4YB7A 3PMLA 4F3QA 2DFHA 4IEEA 2VJ5A 3F5TA 2PEHA 4BXOA 1DRGA 3IWXA 3CCTA 3K9JA 1PYTA 8ICNA 1XC3A 1WSHA 1WC4A 2G8UA 4CE9A 2EHGA 4KYZA 3M8WA 3KTQA 2ZH9A 1BMQB 3LQVA 4RW9B 2HMXA 4OJPA 1BQMB 4Y6IA 2O8EB 1RTDB 1S1XA 4BR4A 4USIA 3BGLA 5KFPA 4OI0A 2OLWA 2XVTA 1NXIA 5ETSA 3C7NB 3HM8A 4NLUA 1JL1A 4YXJA 1UA0A 1ZQIA 3EEQA 1KONA 5TKYA 4DR2F 2PI5A 1H74A 1RT5A 5A8KB 5KG3A 2AZ3A 3CQYA 2OPRA 5J2HA 4HT5A 2JMGA 3UVJA 4FFDA 4IL6U 5CZXA 5AQSA 4JP8A 4Y1DA 1R8PA 1FFSB 2HHPA 3RBXA 3B0YA 2B8QA 3FFIA 2QXLA 5F3TA 4CK1A 2HGLA 3O9SA 2H3ZA 5ALHA 1YX2A 2WF8A 4M3YA 1IV0A 1S1TB 3VTIA 1NOYA 1QM9A 1SH0A 5D0EA 2O8DA 2F4VJ 7ICNA 4Z6FA 3M6XA 3QATA 3W7BA 4J2AA 1R0AA 5HL7L 4CT8A 1XQSC 3H5YA 4CLZA 1YI2S 7AT1B 2YX4A 4MFAA 2BCQA 3NLCA 5J2AA 1P8GA 4HCBA 3R5JB 3THYA 3KK7A 3OHAA 4FKYA 1S5ZA 4JYAJ 1TL5A 2LA4A 3CCZA 4RG8A 1BQXA 3HOSA 1JX4A 3RRKA 4FLUA 1S76D 2D3ZA 3U27A 5DBBA 5A6WA 2NRRA 3ICXA 2JV3A 2ROGA 4NY8A 1BQNB 3UWTA 5CHCB 1D8LA 1TTHB 3PRDA 3SQGA 5F0WA 3KD3A 3AAPA 3RB0A 2N4CA 5KQ8A 7ICHA 2QWPA 3R5DA 4C4SA 3MPVA 2RF2B 4NE9C 4K4TA 3WKEA 4KE5A 1UFKA 3IKMA 2VPZB 3ATUA 4KFBA 1XK8A 2MPUA 4QYZJ 2MY8A 3ZSZA 2ILZA 3H40A 4K8ZA 3SCLE 4XK8C 4USMA 1X4AA 1IKYA 1U24A 3MPDA 1MMLA 2JFKA 5KFAA 4I29A 4QYZK 3A2FA 2JHDA 1JN3A 2W6LA 1DEJA 4KLOA 4U95A 3GBTA 5GIPA 1F9FA 4KY3A 5AIBA 2LEBA 2H4YB 3IGVA 3K5MA 2HHHF 4KHPJ 4I2QA 2Y1JA 3M32B 1CXUA 3OYLA 4DR3K 4QZCA 3E8OA 2PFOA 3VVUA 2Q2RA 3T1YJ 5DDOC 3OYJA 1J5EF 3GL1A 4TY9A 1WN7A 4QOTA 5F9NA 1KQSM 1UVKA 2Q97A 1LV5A 1JLGB 4IQXA 3NF8A 3VPZA 2CPRA 3OFHA 1PAEX 4DPXA 3MOJB 2D0BA 4YS2A 3G2XA 3UMBA 2HK2A 3GG4A 3NS6A 5J0WA 1C0FA 4RQ7A 4ZPTR 4Q0BA 2BKEA 2GCFA 5FJ4A 3QMLA 1IKVA 5JVGQ 1X9JA 4CLKA 3WXIA 2KXFA 4QZEA 2QE5A 1Q9YA 1WLJA 4A8XA 2ZTDA 2JH1A 1M1GA 1S0VA 2Q3SA 3A3NB 3DMJA 1G2EA 3CJKB 4LF6F 4JD2B 3KFUF 1FJCA 2IRXA 4KKOB 4NRUA 3Q24A 3DDHA 1EX4A 1SL1A 4ZP8A 3R2DJ 3C7NA 3QO9A 3ZTOA 4NXZA 4ECRA 2BJ7A 5KFWA 4QZBA 1ZZNA 4KLHA 4NLTA 1SV0A 3T1HK 2RQ4A 9ICAA 5IT9Y 3VEZA