2XY6A

Crystal structure of a salicylic aldehyde basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
581
structure length
581
Chain Sequence
TAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 199
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy6A01
2KFNA 2UVVA 3RR7A 3VQQA 4FJMA 1BCMA 2P5GA 3V6DA 4RT2A 3Q8SB 1U45A 1JIHA 1HJRA 4CCHA 1HUOA 4DL5A 3AA4A 4DOBA 1SKRA 4F2SA 1NKBA 3NF8A 3L3VA 2ATQA 3NBPA 2PFNA 4QWEA 3QINA 3JYTA 2XCAA 4RNNA 2FPMA 3AO3A 2PYLA 4UB1A 4DTRA 4DS5A 2X6NA 3DMJA 2R7YA 5HHHA 4FS2A 2IGIA 4CEBA 5L1IA 4DG1A 1NK8A 4B08A 1W9HA 3MXIA 5DB7A 1NKCA 4DQPA 3HYFA 3E2EA 2HB5A 2RDIA 1S6PA 3ASMA 3ZD8A 2RPIA 4RQ3A 4JS4A 4CGFA 2ITGA 8ICYA 1HYZA 3LDAA 3LPUA 3C2MA 3G6XA 4M47A 8ICBA 3DRRA 4EEYA 4J9KA 2FPKA 5KRSA 4O3OA 3LALA 4BDZA 5FRNA 4CF8A 4JRPA 3PV8A 4UB4A 3OYGA 1S9FA 1U9LA 5SZTA 3JSMA 4CF1A 4KLSA 1B92A 1BI4B 4RW8A 1N5YA 1Z26A 4PHDA 4M9JA 4C8MA 1HQUA 4AHCA 3RJJA 5F9LA 3UXOA 4J9PA 4FXDA 1L3VA 2BCSA 3SQ4A 2J6TA 1KVAA 3NF7A 4J9LA 5DBBA 1EX4A 1WAJA 4BXOB 4B8AB 8ICQA 4CGIA 3AVJA 4BACA 4Q0BA 2UVWA 4DL2A 5J2PA 3PW5A 4LZDA 5KG0A 2UVRA 1XS9D 3VQCA 4RW9A 1S0VA 3EY1A 1ZJNA 2YV0X 1RDCA 4KAZA 2BPGA 4J9SA 4HCBA 3MXMA 3RB4A 4F50A 3G10A 2W9BA 4EZ6A 1MQ2A 4RNOA 1DGSA 3VQ6A 3RMDA 2HHSA 2GUIA 3K5MA 3A2FA 1TK8A 4Q8FA 1F21A 2J6SA 2BQRA 2VWKA 2FMPA 4LH4A 4QZGA 1U47A 1KFSA 1C1BA 4CIFA 7ICNA 3DLEA 4OVLA 3EW9A 4B9UA 1FKOA 3V1OA 7ICRA 1YTAA 1EP4A 4M9HA 5HMMA 4GC6A 5CA7A 2C22A 4RQ4A 3S9HA 4ED7A 1MQ3A 3HM9A 4DTXA 4PY5A 3MEEA 1RXWA 4M6WA 4EYHB 1J53A 3MAQA 4CECA 4ZHRA 1RT4A 1W0HA 4PUOA 1ZQUA 5DBAA 1ZQLA 4O3NA 3OHBA 4CJLA 4ECXA 1QSSA 1KSPA 4K8XA 1XSNA 4IQUA 4Z6DA 4I2FA 3LPTA 4NLNA 5DDMA 2EX3A 3HVRA 2BCUA 1HUZA 4FW1A 2LYHA 2ZJ5A 3VQPA 3KHRA 1ZQEA 4E7IA 1R0AA 1KCFA 5HRPA 4E7JA 4YG2A 3K5OA 5KG2A 3H4BA 1H38A 1EXNA 4NM2A 3ISBA 2HHVA 3VQDA 2VWJA 3ZT1A 1RBUA 3CYMA 3U3YA 4KTQA 4NLKA 2EHGA 2UVUA 4J2BA 4KLJA 3GFKB 1RT1A 1BGXT 1BHLA 3AA3A 1XHZA 1I39A 1EKEA 3LAKA 2PYJA 3SV4A 3C21A 1RBRA 4FO6A 5BOMA 9ICVA 4RG8A 3AVHA 5KFLA 3V9ZA 3NCIA 4MEXA 1S1XA 3JPPA 4KREA 1ZBHA 3O4NA 4DQIA 1JKHA 4FYDA 2LSNA 3B0YA 3MR6A 3ZDAA 3KK1A 5HP1A 3CFPA 3OS0A 3NGZA 4RU9A 3CM6A 5DG8A 5L9XA 4TUQA 2G8VA 9ICRA 1XHXA 3AVAA 4RQ8A 3PO5A 4R8UA 4QZ8A 3PNCA 4UQGA 2ZD1A 3MFIA 2Q3SA 4W5TA 2PI5A 4RW4A 3PY8A 3AVBA 3TAEA 4IR1A 2HNYA 4CJUA 4I2CA 3HP9A 3M8QA 2BQUA 4TQSA 4CEEA 4M3RA 2ISOA 1ASVA 4AHRA 1ZQOA 4H8KA 4DWIA 1RTIA 1C0TA 1C1CA 5KFEA 1JN3A 8ICWA 3ZDEA 3IM1A 3T1AA 2PZSA 8ICOA 3IS9A 4KMUA 3LP2A 3L2QA 3AV9A 1Z3EB 3GV7B 1VSLA 1LAWA 4FZYA 1XI1A 4RPYA 4KHNA 1HJPA 2JZBB 9ICHA 2OPRA 4PHAA 4O4GA 4FLTA 1IM4A 5J2NA 1YVUA 2IC3A 5J2QA 7ICFA 3T5HA 3GDXA 3ZSOA 5EWEA 3L8BA 3V4IA 3C95A 5DB9A 4QZBA 4K8ZA 2YNHA 2XC9A 1VSHA 4R65A 4KN7A 3PW7A 1HNVA 4UAWA 2W42A 2D5RA 3P83D 4IQVA 3H8WA 5KT3A 4B9TA 4O3QA 2AJQA 5J0QA 4CERA 3K58A 1L3UA 4W5RA 2P6UA 4YR0A 1LV5A 2R8KA 3QEXA 1NK4A 2FBTA 1CEZA 3ZDDA 4CIGA 4PGXA 4QWAA 2Z1HA 5DKWA 4G1QA 2BHNA 8ICLA 4F5OA 4DOCA 2DFEA 1X9SA 3QEAZ 4ECSA 2Z1IA 4FJ9A 1GOBA 4J9MA 1D8LA 4P4MA 7ICEA 4O0IA 4F4ZA 3H7IA 2OZSA 4DLGA 4E0DA 1X2IA 5BPCA 4KLTA 1AROP 4J2AA 2W9CB 1ASWA 3M9MB 1RYSA 5CZ1A 1IKXA 1IXRA 2BCRA 3QLHA 4XIUA 4Z4GA 2H5XA 4FM0A 3PR4A 5KFMA 4CHYA 4IR9A 4Q45A 2HHUA 1CLQA 4IRDA 4CJVA 3RMBA 5J29A 1S1UA 3BDPA 3UPQA 1Y97A 4RQ5A 4DQSA 3MR3A 4PQUA 4KN4A 4EYIB 3EPGA 4DL3A 3PW2A 4FJGA 2BCVA 3DLRA 2R8JA 1S9EA 3QIPA 4F3TA 1BL3A 4FK0A 1LWEA 4IG3A 5KFOA 4KLDA 1QLNA 2M9NA 3OYCA 5I3UA 4KLUA 3NGDA 4XA5A 3UQ2A 1T3NA 3L2RA 4XQ8A 5FRMA 4KLQA 3VQ7A 7ICMA 2W9MA 4DL4A 3AO1A 2AGPA 2IAJA 3MGIA 5KG4A 4FJIA 2IHNA 2HHWA 8ICHA 2AGQA 4CEDA 1WSGA 4GC7A 4DSEA 2KZZA 4CF9A 4KLMA 2B6AA 3ZSYA 1QQCA 4DQRA 5K14A 3OYFA 3K2PA 9ICWA 3TWHA 4RW7A 4YD2A 4QWCA 1KLNA 1LW2A 2DFHA 2B5JA 4R5PA 1RYRA 5KT6A 4J9NA 3ZDCA 4NYNA 3ZT3A 1CZBA 4FJ8A 1ZYQA 4MFAA 4I7FA 1UAXA 1ZQCA 5J0PA 4DO9A 5C24A 3RBEA 9ICJA 5HROA 4OLBA 3V1RA 5C25A 3MBYA 1VSMA 3C5FA 2IOCA 4DSLA 1ZQMA 4HTUA 7ICJA 1JXBA 4NLZA 4YCXA 3PX6A 5KG7A 2AGOA 1QSYA 2Z1JA 1S0NA 2BDPA 5KFAA 2YNIA 2PFOA 1ZQWA 2PY5A 3L2UA 4DTMA 3MGHA 4ID1A 3M9OB 1ZQYA 2OYQA 2BANA 2OPQA 1ZQRA 4GXJA 3S3OA 3AVFA 3AUOA 1CXUA 3V7JA 3G6YA 3RB3A 4Z4FA 1QE1A 5KGWA 4J2EA 3SI6A 1Y88A 4BGDA 4E89A 8ICPA 4QWDA 4E3SA 7ICSA 1XWLA 4OKEA 1MSWD 9ICSA 5KRTA 2BPCA 3PO4A 1YTUA 1JMSA 1N48A 4EBCA 1JLCA 1FKPA 1U04A 3EPIA 8ICJA 4CJFA 4LSNA 4CF2A 1LWCA 1RTJA 2JEJA 5J0WA 2DFFA 5HNKA 5J2CA 3QEVA 3PX0A 3HX0A 4DU3A 2KFZA 4MF2A 2HHXA 1Z25A 2R8HA 5CJ7A 5J2KA 2ASDA 2E4LA 3OYIA 3O3HA 4F4YA 4RPXA 2FMQA 4DFPA 4TURA 1BPDA 5IIIA 4CEFA 1RBSA 2BGWA 2V9WA 4CGDA 4DU4A 2G8FA 9ICQA 4DF8A 3KHHA 1EETA 1UA0A 4CJEA 5CR0A 4UAYA 3F9KA 3M8SA 2E6LA 3HPHA 4ED2A 4M04A 1HYSA 1RDAA 3HJFA 1S1VA 3O3FA 2KTQA 4JK1A 1TAQA 4BDYA 3ETLA 4OPKA 1S1TA 3OYEA 3C2KA 5CY4A 3WNEA 3RRHA 3M8RA 3C94A 5IIOA 3M8PA 4UB3A 3RJHA 4E19A 9ICOA 3ZSRA 1HRHA 3V6HA 3K5LA 5L1JA 3GILA 3VQ4A 3TARA 4PHPA 3DLGA 4CHNA 1ZQZA 4ECVA 3GIMA 4B9MA 3JPQA 1O1WA 4FJ5A 1KVBA 4YNQA 5HHIA 5IINA 4NXZA 4KI4A 1HPZA 4QOZB 4DTOA 3ZT2A 4KRFA 2VA8A 3ZDBA 2FLNA 3PW4A 1TV6A 4ELUA 1X1PA 4CF0A 3SUPA 1EXQA 3NE6A 1DOQA 4F4XA 4O5EA 1JLBA 1VSIA 1D5AA 1TKTA 4I9QA 4X5VA 1NK6A 2J6UA 4H4OA 5KFGA 1G15A 3MXJA 4I29A 3AVKA 2IMWP 2A1JB 1ZQNA 4XUSA 3F73A 4FLUA 4HUEA 3MDAA 3NF6A 4QZIA 3LANA 3RRGA 4CGGA 9ICMA 1ZQHA 5KFWA 2FLPA 1RCHA 1BI4A 1TL1A 4F91B 3SQ0A 3KLFA 3HPGA 1S6QA 5DG9A 5CHGA 4O5KA 2V4QA 2B4JA 4ZH4A 4JUZA 3NGYA 1T05A 3QNOA 8ICRA 4QZEA 1S76D 4HYKA 4F4WA 4BXOA 2P5OA 5DB6A 5KFTA 3SCXA 3H8JA 3PX4A 1RPLA 4I2JA 1SZPA 3HO1A 4DTUA 2JEIA 1RXVA 5KFNA 4DMNA 1T03A 4J9RA 1ZQJA 4ECZA 3KD5E 4LSLA 4TUSA 2Y1IA 3AVLA 2C2RA 3OVNA 3RJKA 5DLGA 2X6SA 4ED0A 2JEFA 2BCQA 3VQ9A 4KO0A 1SUQA 4CEOA 3ZSWA 1C1AA 8ICSA 1ZETA 4YMOA 4NLGA 2X74A 2BE2A 5J0OA 2RDJA 3OS1A 4AHSA 2XO7A 1ZQXA 3RAQA 1ZQBA 4O44A 3ORYA 7ICPA 4N56A 1C0MA 5KFHA 4DQQA 2ISPA 4Z4CA 1VSKA 2Z1GA 4CJPA 3L2VA 1VRUA 4FJKA 5DK5A 1L5UA 5IIKA 5DLFA 3K75D 1HYVA 4I28A 2MUTB 3GQCA 4YP3A 2XY8A 1TVAA 1S5JA 4KHSA 3HSTB 4UBBA 5KFDA 4EP4A 1TKZA 4ECUA 1TGOA 3GIIA 4CJ4A 4NCGA 4CJSA 3DRPA 4ELTA 1N56A 3GIJA 9ICLA 2FBYA 2ZTCA 1IO2A 2ZQBA 5J2DA 3ZCMA 5EU7A 5J0RA 2E6MA 2PI4A 3C23A 3RBDA 4YFUA 3ISNC 4CJWA 3V7KA 2VG5A 5KFZA 4AHUA 3TAQA 8ICVA 3OYBA 1K1SA 4M3UA 3E01A 3KTQA 3FDSA 2G8WA 4TQRA 3U6FA 5F9NA 3RB6A 3ISDA 3NGIA 3TQ1A 2ZUDA 4DTPA 4CJ5A 2NRZA 4Q43A 4UB2A 3CQ8A 3AVNA 3DI6A 2ZJAA 4MF8A 2G8UA 3ULDA 2Y1JA 4CEQA 1GOCA 2DTUA 1TV9A 4CK1A 4NYFA 5L1LA 4F3OA 4YD1A 4FLVA 3M9NB 3OYMA 4YXJA 1J9AA 2DFLA 8ICXA 3FFIA 1X9WA 3DOKA 2NRVA 1RTHA 5D4BA 3HK2A 4I2BA 5J0TA 1FXXA 4IG0A 4R63A 1TFRA 4I2DA 4YN4A 4HUGA 4FVMA 1RBTA 3Q8QB 1JX4A 1KFTA 3H08A 3DRSA 3TABA 1ZQVA 4PGQA 4PA1A 8ICKA 2D0CA 4O5BA 4CGHA 9ICIA 3MR2A 5IILA 5EOZA 3Q8KA 2AU0A 4ICLA 2IA6A 2F8TA 1NOYA 4F5RA 1ZQQA 1NJXA 1IH7A 4F92B 4B8CA 3SZ2A 3RJIA 3ZSVA 3QESA 8ICUA 3RJFA 5J0XA 1B22A 5FROA 4AHTA 3SYZA 4I2HA 2ASJA 9ICGA 2FPLA 3VA0A 4E1MA 2XY7A 1K6YA 1V9PA 2KN7A 1LW0A 4MEYA 1BPBA 2JEGA 9ICCA 5KFIA 4KB0A 5HRNA 4KI6A 4AILC 2JZBA 1TAUA 3KKSA 1MU2A 3C6UA 2F1JA 5CWRA 1SKSA 8ICGA 3TANA 4RT3A 1I3AA 4Q8EA 1NKEA 3QEBZ 3AU2A 3O4QA 4DOAA 4Z6CA 4FK4A 2RF2A 1K1QA 5J2GA 2DY4A 4KTWA 2O4IA 5I42A 1BQMA 5KFPA 1U49A 3D45A 7ICHA 3AVGA 4M3ZA 1A77A 3CFOA 4IFYA 3HW8A 2BR0A 4EP5A 1BVSA 5KFSA 4FZXC 1Z00B 3QEWA 3OGUA 2MAXA 3K4GA 4N5SA 1ZQGA 5DQHA 2OWOA 4YR2A 5J2EA 5E41A 3QZ8A 4JRQA 4G3IA 2ATLA 3DM2A 3TFSA 4YMMA 3Q8RB 1BISA 3TAMA 3KLGA 4F5NA 8ICTA 4CHZA 4CJ3A 5CYQA 8ICIA 3OY9A 1TKDA 2WONA 4FJHA 1B43A 1NOZA 4O0JA 1RNHA 4I2IA 5J0YA 2ETJA 2V4RA 1RT2A 4LZGA 3OHAA 1BPZA 1FK9A 3QEIA 3JPSA 1LAVA 4LH5A 3RH6A 3GIKA 1SL2A 8ICZA 2W9CA 3C5GA 4QWBA 5KG3A 2FBXA 2XY6A 2RKIA 2GWSA 8ICCA 4DFJA 3NH1A 4P2HA 1ZBLA 4FLYA 5J2HA 5DMRA 8ICFA 1XO1A 4FLXA 1JLFA 2KW4A 1Q9YA 5KFUA 1D8YA 3LP0A 4HUFA 4MQ3A 1B9DA 3V9WA 4I2QA 4K4HA 4GVMA 1KFDA 1S10A 5CB1A 3V7LA 3KKRA 3C1YA 1RT6A 4GXIA 4M3WA 4B9VA 4RQ2A 2XGPA 1JL2A 3JPOA 3KK3A 3Q8MA 9ICTA 1BCOA 2YNGA 4DSFA 3HT3A 2ZTEA 3V9SA 4OKJA 2HVIA 1PZNA 5JS2A 4QW8A 4DU1A 4CESA 4UBCA 1CXQA 1RILA 1S1WA 4HHTA 5JUMA 1L3TA 2X78A 4EBEA 3IG1A 3RR8A 1WLJA 1QS4A 3JPNA 5KFFA 4UB5A 3S3MA 5HP4A 9ICAA 4M41A 1TKXA 4E1NA 8ICNA 4NY8A 3ALYA 4KLFA 3FYHA 4F8RA 1NK0A 3L3UA 4CHOA 2KZ3A 3AO2A 5D49A 4YMNA 4JV1A 4B9NA 4EBDA 2YNFA 3SPZA 3IRXA 3ZSXA 4FJLA 1UT8A 2F96A 3V81A 4QCLA 3VA3A 3KHGA 4RPZA 3UXPA 2F8SA 4DSKA 1XC9A 4E7LA 4I2EA 3UIQA 4DSIA 1ZQPA 1KEJA 4IBNA 4FZZA 3G0ZA 3H8SA 3RH4A 3OYJA 3OYHA 1TK5A 2BGGA 5JS1A 2HVHA 3UQ0A 7ICLA 2ALZA 3OSPA 1SV5A 3QEPA 4GW6A 1NOMA 5J1EA 4DL7A 2GV9A 3OJSA 4ECTA 5DGAA 4M3YA 2NUBA 3VQ5A 5J0SA 3DLHA 4M45A 3SJJA 3NHGA 2VG7A 4DFKA 3I0SA 3RJGA 1Q8IA 1ZBIA 4ELVA 2FMSA 2PFPA 1D9DA 2NRXA 1RBVA 4J2DA 3PMLA 2C28A 4CJRA 3AO4A 2GBZA 2PFQA 4FBUA 4I2PA 4I27A 4CK2A 4KPYA 3DYAA 2W8LA 3TAGA 5D3GA 3PMNA 4IRCA 3BQ2A 2D0BA 1WSHA 1DTTA 4DTJA 5KFQA 2HW3A 1REVA 4QAGA 1LWFA 2IBKA 3T5LA 3MEGA 4ECRA 3L2WA 4CJTA 1TVRA 1WSJA 9ICBA 1JLQA 4OGCA 4QZ9A 4KLGA 4K4IA 3CM5A 1RT5A 2VA3A 3KD1E 3RWUA 4QZCA 3WNGA 2OZMA 5KFKA 1RT7A 4QZAA 1ZQKA 3C1ZA 4R66A 3OSNA 4ECYA 3HL8A 4FK2A 3NAEA 1WSFA 5IIMA 1KVCA 1NJYA 4OLAA 2AQ0A 4CK3A 3LZJA 3OS2A 3QZ7A 1JXEA 2NRTA 1S9GA 7ICGA 1VSDA 3BQ0A 3AA2A 4M3TA 4PGYA 3RH5A 4KLHA 4B9SA 4IQWA 4CFCA 2ZUBA 1RZTA 1ZBFA 3TI0A 2JGUA 3BJYA 2I5JA 8ICMA 1VSFA 3CG7A 3T5JA 1WSEA 1ITGA 3IAYA 3C2LA 1QHTA 5KFRA 4QW9A 2XY5A 3OJUA 3HPOA 2VA2A 7ICVA 3T19A 1KTQA 4I9LA 3OYAA 3VQEA 3TAFA 3K59A 3SV3A 4M2YA 4KITB 5J2IA 1ZBUA 2W9BB 1NJZA 4ZTJA 4O3RA 2QK9A 4FLZA 9ICXA 4K4GA 1X9MA 5SWMA 4KLOA 8ICAA 4JWNA 2NRWA 5T7BA 3K57A 4R64A 4P4PA 4QZDA 1ZQTA 2PXIA 4WE1A 3ISCA 3PUFA 4E7KA 5EWGA 3ZSZA 2C2EA 4TSXA 5D46A 2A1RA 2BPFA 2C2DA 4JV2A 2D0AA 4M6WB 3THVA 3ZT0A 4J9OA 5L1KA 4MFBA 3G6VA 4RQ0A 2A1JA 3PR5B 4O3SA 5CYMA 5TZVA 2ASLA 2XHBA 7ICKA 1HNIA 3SUOA 2IDOA 1T7PA 3MABA 1IG9A 1J54A 4DSJA 4CJQA 5J2MA 4FBTA 3KIOA 1TK0A 3AU6A 3MEDA 3QE9Y 3AVIA 3GV8B 5KG6A 2VANA 1CZ9A 1JLGA 3QERA 3ITHA 3O3GA 4W5NA 4FJNA 1T8EA 3D0PA 1A5WA 2ZTDA 5DG7A 4NCBA 4FJJA 9ICFA 2F1HA 5KT2A 4YQWA 9ICUA 3JPTA 4DF4A 1U4BA 4MFCA 3V1QA 2R8IA 4IDKA 3HWTA 4BE0A 2YKMA 4LD0A 1IKVA 3LP3A 1ZJMA 5KFBA 2YHBA 4DFMA 2XRIA 2DPJA 5J2JA 3H4DA 3AVCA 4RUCA 4HVJA 4N76A 4CGJA 4W5QA 2QKBA 4O3PA 4ED3A 1WN7A 3NH2A 3Q8LA 1C0UA 3RB0A 4R8UB 3VQBA 4KTZA 4N47A 4O5CA 2WOMA 1ZQDA 3NTUA 2BQ3A 2JLEA 1RTDA 4AH9A 3RMAA 1BPEA 1WCLA 4GXKA 2VG6A 4M0AA 4KHQA 3HVTA 4XRHA 5J2BA 4F4KA 2B21A 4Z4HA 4KHYA 2YHAA 3HXMA 2MUTA 4RW6A 4L8RB 3SUQA 4JS5A 4ZTFA 5KFJA 2P51A 4JWMA 1QTMA 2Q0ZX 4ECWA 3LZIA 4FJXA 3TAPA 9ICPA 2IHMA 1J5OA 1WCNA 5J0UA 9ICEA 3RJEA 4CFBA 4FCYA 1RT3A 1D9FA 3EZ5A 4O55A 5KFYA 3MFHA 1GOAA 3SNNA 2G8IA 3VQ8A 1N6QA 1RDDA 3I0RA 3VQAA 2FC0A 3LWMA 2QKKA 5BOLA 1A5VA 4ID5A 4RQ6A 4M3XA 4W5OA 2YKNA 4YXMA 2QXFA 1ZQFA 4CE9A 1LB2B 1NJWA 3HP6A 4DLEA 4IQTA 2I9GA 2OA8A 3MR5A 3BQ1A 3KLEA 4DTNA 1JL1A 1QSLA 1UT5A 4IRKA 4FW2A 4N41A 3PW0A 1WNSA 3B6PA 3V72A 5DDYA 3DOLA 4YFKA 1C6VA 2ZUCA 4Q5VA 4Z6EA 4RNMA 4F5PA 3AO5A 3NDKA 4CHPA 2AQ4A 1S97A 3P1GA 3NF9A 4KV8A 4HCCA 7ICQA 1CUKA 5FDLA 3SUNA 3CFRA 4ED1A 3KHLA 4I2AA 4GLXA 3WNFA 5C5JA 3LAMA 3IHQB 4P4OA 4O9MA 1VK0A 3OYLA 3C6TA 5DQIA 4KFBA 1NK9A 4LVSA 1UOCA 3GV5B 4C8KA 3DLBA 4ECQA 4J9QA 2HHQA 5KFVA 4BE2A 3SI8A 4C8NA 1DLOA 4OGEA 4RUAA 2HMIA 4M42A 9ICNA 1XU4A 1UWBA 3OYDA 4QZFA 4JV0A 3P5JA 3SPYA 4M9NA 1VSJA 4RZRA 4Q44A 1T4GA 1DTQA 3V9UA 3LWLA 7ICIA 4FM2A 3V6JA 1RDBA 4BWJA 3NFAA 2OPPA 2WTFA 4PHEA 4E7HA 1HMVA 4KLLA 3WNHA 4DL6A 2DPIA 5KG1A 3RAXA 5CZ2A 2ZE2A 4F2RA 4OPJA 4BDPA 1S77D 3LDSA 3Q8PB 5IIJA 3MECA 3KK2A 2I1QA 1ZQSA 4Z4IA 4DTSA 1XSLA 5KGXA 2ZJ8A 4KKOA 3TR8A 2HNZA 3AVMA 5KT7A 4KLIA 5KI6A 5KT4A 4FM1A 4EZ9A 1JLAA 5EWFA 1YT3A 2W8KA 4YR3A 1IKWA 5CP2A 4CFAA 1UA1A 4JLHA 1SL1A 1Z00A 2R8GA 4C8OA 3BGRA 3ZT4A 3S3NA 2G8HA 5DQGA 2P6RA 1S0MA 3TFRA 4CEAA 1BQNA 1SKWA 2OPSA 4AHVA 2KQ2A 5HRRA 2XGQA 4H4MA 4B3OA 4MFFA 3KLIA 4Y1DA 4I2GA 3V9XA 4BWMA 2FBVA 3ZSQA 5KFXA 8ICEA 5KT5A 3T3FA 1VRTA 3JPRA 1BPXA 1VSEA 4IKFA 4KHUA 7ICOA 1KLMA 3UXNA 5DB8A 2P66A 3SQ1A 1L3SA 4DEZA 1XSPA 4M9LA 4ED8A 5HBMA 3RMCA 3PVXA 1IKYA 3QNNA 1WAFA 2G8KA 4Z0UA 1U48A 4KLEA 4PH5A 4C8LA 5J2AA 3MDCA 1ZQAA 3OYKA 4NCAA 1JXLA 3B6OA 2O4GA 3K5NA 1NK5A 3QO9A 4B9LA 5DBCA 3QETA 4LY7A 4CHQA 5KG5A 5DGBA 3U3GA 4OJRA 4CEZA 4Z6FA 3ZD9A 1HQEA 2HNDA 1B9FA 4GMJB 4PWDA 3QIOA 1COOA 4Z4EA 4CFDA 4M9GA 1BIUA 4QZHA 3AA5X 2RN2A 4CJKA 3LP1A 3DLKA 1SL0A 1JLEA 1BIZA 1KRPA 1A76A 3EWAA 1ASUA 4FLWA 4DS4A 1NK7A 4IFVA 5J2FA 5KTQA 4F93B 3SQ2A 2A1SA 2BKEA 3T5KA 3EYZA 2IS3A 1TL3A 4OKKA 5HRSA 3OYNA 2FLLA 5C42A 5HLFA 2W9AA 4RQ1A 2XCPA 3NH0A 1S0OA 4NM1A 4KB1A 3BQTA 2P1JA 1ZQIA 2KZMA 3N4MB 2F1IA 4KHWA 4FS1A 4TUPA 7ICUA 3N97B 4PPXA 4ED6A 5KFCA 3KJVA 3RTVA 3I8DA 4Y1CA 1WSIA 4F5QA 3H40A 4FJ7A 3KLHA 1C7YA 1Q9XA 2HHTA 4RQ7A 3VN5A 4CIEA 1A5XA 4UAZA 9ICKA 1KDHA 3LK9A 3V6KA 7ICTA 5HMLA 1MC8A 4BE1A 4YVZA 1BPYA 3B0XA
chains in the Genus database with same CATH superfamily
2KFNA 1SV0A 2E88A 2IRUA 3VQQA 2GQCA 5F41A 4WU3A 3Q8SB 1GMVA 2F1FA 3OXLA 1T3OA 5J8YC 3QT8A 4DL5A 2DRDA 1NKBA 3NBPA 1M5OC 2XCAA 2J9CA 3ET6A 4DTRA 2EEYA 1S48A 2R7XA 5HHHA 4FS2A 2IGIA 4CEBA 1G99A 2DRBA 4L3KA 4ZVGA 1NDKA 1NKCA 1VQLS 1XNQK 5LXYA 2MTLA 4HHUA 4DQPA 4BR0A 5HVHA 3FZMA 2RDIA 5KQDA 2W2PP 3NP5A 1JI7A 4RUHA 1UVKA 5LXRA 8ICYA 1P6TA 1RU1A 1HYZA 5HVGA 1Q3UA 5IWAJ 3LDAA 4BRMA 3G6XA 4EEYA 4J9KA 3C14A 3VV2B 4O3OA 1WHWA 4JN4A 3LALA 3CD0A 2PSZA 4BDZA 5EX5A 1YXQA 4UB4A 5SZTA 1UWAA 3ENVA 2F8EX 4DV3F 2ZIVB 2MKCA 4CE6A 1Z26A 4YB5A 1HIWA 1PK1B 3CCMN 4KX3A 1D4XA 3QUCA 3OUYA 4WCEL 4M9JA 1IUJA 2A1BA 3CCJS 4AHCA 5F9LA 3UXOA 2YMLA 2WSCC 5F8MA 3UE2A 2XYHB 4RX6A 4HACB 4ILRA 3VGMA 4BC3A 8ICQA 2FVQA 5KPTA 1X4AA 2CPEA 5K20B 1IBMJ 1Z19A 1JCEA 1J2NA 1C4CA 3NVMA 1UFKA 1N36K 2UVRA 2R3VA 3C2PA 3FGUA 1VC5A 1F5CA 1U09A 4RW9A 2MHEA 5LY3A 3WK6A 1ZJNA 2YV0X 4PKDB 1UJ6A 3DXSX 1MWZA 3IBWA 4GY2B 3RB4A 2W9BA 1MQ2A 4DV4K 4RNOA 1DGSA 1VIOA 2DCUB 3QICA 3VEZA 3ULEB 3NVYA 4UB8U 2A6OA 2GUIA 3IG8A 2GJ2A 2PGCA 2IIHA 2HRUA 1FTRA 3GG4A 1SQFA 5AM0A 2BUNA 4G6VB 3OR1B 4DPYA 4BRGA 2VWKA 3SMZA 4CH1A 3ENBA 2KE7A 2EBEA 4B9UA 1FKOA 3TADA 1YTAA 5HR6A 4M9HA 4DV6F 2E5LF 1N5WA 1SV0C 3S9HA 1FCAA 3TA2A 4NLPA 4DTXA 1JB0C 2DTJA 1RT1B 1K0VA 3D0GE 3T1YJ 4M6WA 1YITS 1VS3A 2J0SD 1W0HA 1PVRA 3SDEB 5FJ4A 3NXZA 4CI0B 1Q1KA 2C2ZB 1RWXB 4DB3A 3OHBA 3MPDA 4ECXA 1VQ9S 2IM2A 4FO0A 1XSNA 4A4JA 4IQUA 2HSTA 4NLNA 2WCXA 2EX3A 1D9AA 1HUZA 2B0GA 2LYHA 4FW1A 1OO0B 2ZJ5A 1YVNA 1W2BR 1R0AA 3PIOL 2F77X 5ALYA 4CZLA 1DKGD 4EEKA 1KVKA 3ISBA 4B3RK 3E01B 2OEKA 3ZT1A 3CJ9A 3X3UA 4KTQA 2F8MA 4C6AA 3TACB 6FD1A 2EHGA 3FQKA 5B0FA 4KLJA 3DI6B 4DR6F 2GH1A 1NSQA 2PYJA 3E3XA 3ZZTA 3C21A 4JKEA 3AT1B 2HDOA 4JKBA 1RBRA 2XM3A 4UATA 2B8PA 1XK8A 3FFIB 1YRTA 3UNYA 3DXKA 3NCIA 3PKMA 5KAKA 4ZK7M 4IG0B 4DCJB 2QMUB 1RTIB 2B9YA 2UU9F 3KK1A 3CFPA 3DRSB 2R2RA 3NOCA 4RU9A 4AT1B 1U6BA 3ZTRA 2E2QA 2Q97A 2M4MA 9ICRA 2FHJA 2ZH8A 3PO5A 3PNCA 2CJBA 4UQGA 3WQTA 2OANA 2Q3SA 3K0SA 5E7OB 1UHUA 1P8GA 5L9NA 4I2CA 3KWGA 3JAMO 1WWVA 2HZAA 4TQSA 2W41A 3EVMA 2M88A 4ZDNA 2ISOA 1ASVA 2EFNA 2QA4G 1ZQOA 4ZVTB 4H5WA 4AL7A 1FWKA 2WF5A 2IM1A 2GC8A 4CNQA 3X1LB 5KFEA 4EFAC 1LW0B 1VDHA 2BH1A 3IS9A 1QUVA 1U7LA 1I5OB 2FSJA 3SQGB 1VSLA 3TSUA 3IBFB 9ICHA 2OPRA 4PHAA 3IM9A 4O4GA 5G0RA 5AZJB 2DCLA 1OY8A 3C6UB 1IQTA 2W4DA 2IC3A 5J2QA 3DLJA 2E8OA 2DVIA 5HK4A 2V9KA 3FCWA 2N7YA 2ZJRQ 3ICLA 3V4IA 3NMRA 2IVOA 5DB9A 1N0UA 4UUXA 3KK7A 5AI0A 1VSHA 3PW7A 1PC5A 2EI5A 2PT0A 1TQLA 4NYPA 4IQVA 5B7WA 3MCNA 4B9TA 4O3QA 2PMZC 2AJQA 1MN8A 1BQMB 4LREA 2K4EA 1L3UA 2P6UA 1LV5A 3QGHA 1IWGA 3O1LA 3M7DA 3ZDDA 5TKYA 4DU8A 4CIGA 4P0QB 1K5OA 2I2YA 5AQMA 5DKWA 4QR0A 3IV6A 8ICLA 3P96A 4DOCA 2DFEA 3KLGB 1QQOA 4FJ9A 2RNEA 4J9MA 2V68A 1N52B 1NGGA 1NJIO 4X4OA 5AQFA 4QIVA 1UVJA 2H3IA 5K8PA 2CXYA 4E0DA 1X2IA 1SQEA 1QJHA 4X64K 2JX2A 3M9MB 3MN5A 2V34A 3QLHA 3RBZA 5GAHI 2B4UA 2JHDA 1RQ0A 4Z4GA 2BEFA 4I6MB 4NOHA 4Z2XA 3AXMA 5KFMA 2V8PA 2MSNA 3MM6B 2G06A 2GELA 1CLQA 1F2HA 2OFHX 4X62F 1DK2A 4BG8A 2R7TA 4EENA 1ZPWX 3BDPA 1Y97A 1RT6B 3N6MA 2F8HA 4EYIB 2ZHBA 2ESEA 4EFHA 3ZZUA 3H5SA 1GLBG 4LFCJ 2QLXA 2YNGB 4X4UA 4CLFA 2VKZG 5EOYA 1S9EA 1KN6A 3W65A 4X66J 1BL3A 4IG3A 5KFOA 4RL1A 3UE5A 2M9NA 3NGDA 2YH1A 4X65J 3WXKA 1F3FA 2I6XA 2Q2RA 2O8FB 3VQ7A 3BV8A 4DL4A 5CE3A 5KG4A 1FDDA 2ODGA 1GH8A 1UCNA 1E6VB 1FRKA 4WFBL 1WOPA 3UDVA 3P4UB 3WHIA 3C7NA 2VJ4A 4DSEA 2KZZA 4CF9A 2DHXA 1FVSA 5JVGL 4G1PA 2OYYA 2NZ4A 3CCTA 3ISND 1ZRMA 3WEEB 4AM6A 4JKAA 4YD2A 1KLNA 1P27B 2DFHA 2APOA 2DNNA 2B5JA 4R5PA 3UR3C 1RYRA 5CAAA 4C0ZA 5L38A 5KT6A 4J9NA 4URSA 1I6JA 4NYNA 1CZBA 5KPRA 2EC2A 1VJWA 3HCXA 4I7FA 1MWKA 5CA5A 4ZJLA 2UUCF 1YIJN 1FJGJ 3TTFA 3A12A 4UAUA 1X4HA 3UCGA 3MBYA 2UXCF 2IOCA 2LKYA 3O0FA 1K8KB 5KG7A 5AR0A 2XZWA 3LA0A 1QSYA 1OWXA 5LMUF 2N1RA 4K2JA 5AK5A 3WKDA 2PFOA 1TZ0A 3L2UA 4DTMA 4ID1A 4LT6A 3M9OB 5CRXA 4DV7K 1ZQYA 3A1YG 4CLZA 4KYZA 2BANA 2OPQA 3SSSA 3CMQA 1I94F 2WHEA 3OTOF 4GXJA 3I0SB 5MLCV 3NCRA 2GVDB 4QR2A 4H0YB 3RB3A 2J7KA 5AQWA 2CZ9A 2XMWA 4CLUA 2FHMA 1GAOA 1NU0A 4CBUA 1Y88A 3D4JA 4E89A 8ICPA 3GZFA 3S7RA 1TUVA 4Q2MA 2W4CA 1ZH5A 1S3XA 3PFOA 1T3QA 2CQGA 5IQ6A 2I5HA 4CT9A 1XWLA 4U95A 3AD7C 1QM9A 5AI4A 2DXFA 3ID8A 1H7XA 1ZTTA 4BVOA 1FKPA 5E3PA 3KBBA 4JI6J 1DTTB 1LWCA 3F5EA 1T9UA 2JEJA 5J0WA 2DFFA 5HNKA 3R6LB 3HX0A 1LWFB 1XEZA 2UXDJ 3K8WA 1Z25A 3A0BU 1HWKA 1TL7B 4OJ5A 4ITSA 1YQHA 2E4LA 4U6PA 3FMBA 4MMOA 5AQSA 1RT7B 2KP7A 4TURA 1BPDA 3M2RA 1OH8A 3ZO7A 2V9WA 4QBUA 1JNRB 2H4YB 3GONA 4DU4A 2G8FA 2E7VA 2K8GA 3KHHA 1EETA 1N34J 2LQBA 2C3MA 5AI6A 2ZBRA 2ASYA 1FRHA 2NXEA 1X60A 2C2NA 2HBMA 4NLBA 1YDLA 3I33A 1KWMA 2XI3A 3F9KA 1WOSA 3UD3P 4ED2A 3R7BB 4M04A 4OHZA 2X1BA 2DKZA 4MDAA 1HNZK 3OTBA 3HJFA 4FWKA 5AKJA 3O3FA 4BDYA 3ETLA 4OPKA 1D09B 1S1TA 4OI2A 3W2WB 3OXFA 3J80O 2IYIA 1CC8A 3C94A 5IIOA 2PA3A 3RJHA 1URNA 4LVOP 5L1JA 1X3MA 4PHPA 2DHGA 1BNPA 3CULA 4OYXA 2F76X 2GO9A 3IP0A 2P9UB 2VGMA 3GIMA 4FWLA 2YCHA 5CQGA 2YY3A 2KVCA 3QSYB 4P2SA 3N0VA 4NXZA 3UMGA 4DV3K 4KRFA 4BROA 3ZDBA 4A8OA 2CYYA 2VOPA 2G0IA 1X1PA 4D3HA 3NE6A 2AYMA 2V8VA 1VSIA 1KD1O 3IAS9 4MK8A 4JAXA 5B0GA 3HSGA 4I9QA 1XMQJ 3MAAB 4X5VA 3SCJE 2YX8A 4H54A 3JXOA 1ZQNA 1NGCA 3KUHA 4XUSA 1R89A 1HNIB 4QZIA 3LANA 2CNNB 9ICMA 1RWKB 1YI2N 2ZIVA 4GNIA 2FLPA 3FZ2A 1GLDG 1SIWB 1EHWA 3QX7A 1PK1A 5BR9A 4NL9C 3GR1A 5AICA 4BG9A 4FP9A 3SQ0A 3HPGA 3CD6N 4LFBJ 3ENHA 4ZH4A 4JUZA 3UWTA 1V4TA 3KKFA 4YY3K 3SENA 8ICRA 4QZEA 2MZSA 4HACA 5B08A 5DB6A 2FY8A 4WXWA 2UXBJ 2GJFA 3CNHA 1F5AA 4ZCIA 3C0BA 3SCXA 4LF7J 3PX4A 4I2JA 2H9ZA 5JU5A 1YJRA 1JJHA 5EX0A 3QBCA 4DV6K 2E5LK 2DRAA 3H7HB 3L7UA 4IDKB 4KX5A 1RSCA 4NB4A 4TUSA 5EE0A 2Y1IA 4ZP6A 3OVNA 3RJKA 2NYHA 1V3RA 4HH0A 2DGQA 2JEFA 3D6RA 3UB5A 3VQ9A 1D3WA 4NL5A 2ACYA 4OJPA 3M8YA 1FJCA 3SK3A 1WBDA 5CCMA 8ICSA 2CGKA 1RDRA 3ULEA 3FLCO 4NLGA 2AV5A 4DR2F 3DGPB 4K59A 3CC2S 3B4MA 4EHUA 5J0OA 4M1KA 4QR1A 1ZQXA 3OR1A 3PSPA 2BJ1A 3J7A1 4K4SA 2WOMB 4NLDA 2OAUA 1RTDB 4LC9B 4FJKA 1FFGB 5DK5A 5IIKA 3OXGA 3K75D 3OL7A 3VAHA 3A5OC 3GQCA 5A6PA 4RW6B 2Z57B 3BH7B 2C3UA 3MMCA 2Y8WA 4DR6K 2HHHF 2FDRA 3AA8A 1H2TZ 3GMGA 2Z2YB 4Z7CA 4NO7A 4EP4A 3SDEA 4RBTA 1TGOA 3M6VA 4EMDA 3GIIA 4F4AA 1UETA 5HSPA 1VBZA 5D8HB 3FSXA 2VASA 3ILJA 1T94A 2DGUA 4CLTA 3GIJA 2I7PA 5EU7A 2ZOFA 2DHAA 4F3MA 3FQLA 3UCZP 4K41A 1N54B 2DK2A 3RU0A 2W25A 3BREA 2UU9K 3TWZA 1ZXOA 1MROB 3V7KA 2YWGA 3ZZPA 3IMQJ 2KEYA 5C2FA 1CJKB 3E01A 3KTQA 2W6LA 2HSEB 5F9NA 3KFUF 4Y0FA 3ISDA 2WUSA 5AQNA 3NGIA 2ZUDA 4WBFA 3AGKA 2B9XA 3HDSA 3KLEB 3DI6A 2NO4A 2G8UA 4OV6A 3D5MA 3O9QA 2Y1JA 2YKQA 2XMTA 4CEQA 2DTUA 1TV9A 4NYFA 5L1LA 4FLVA 4MIBA 3OYMA 1FESA 4YXJA 3FFIA 1J9AA 8ICXA 3O8MA 4OFZA 4KSEB 1OPIA 4M5KA 4IQXA 3IRWP 3D66A 1WI8A 4IG0A 4R63A 1TFRA 4AYBD 4I2DA 4YN4A 1FVQA 3Q8QB 5AHXA 3HOSA 1JJCB 2ES6A 3DRSA 2KFYA 1ZQVA 4PGQA 3IR6B 4H03B 4PA1A 9ICIA 2M52A 2AIRB 4U67L 2EK1A 3NVWA 1UMJA 1VHIA 3DDNA 3HFZB 5JXSA 1FXDA 5AQOA 4M5DB 4CIOA 2YN4A 1U2CA 1ZOLA 2FY1A 4F5RA 2ASOA 2ZWOA 2YKPA 3B78A 2ZM6F 8ICUA 4WQ4C 2CAJA 2ZH1A 4WIIA 3HRDD 3ENAA 1B22A 2RAQA 3PYFA 1X0FA 1Y9OA 2ASJA 9ICGA 2Q43A 1NDLA 3VA0A 4PAAA 4AQYK 2NPIA 4F3QA 1B4FA 1M0SA 4M5GA 3OFEA 1LW0A 4DPXA 2YWHA 1ZRNA 3TSPA 4IC9A 3OTCA 1BPBA 4FPBA 1T3VA 4BREA 4JD2B 3SQGA 5KFIA 2MSTA 4OI4A 4AILC 2VWBA 5AZJA 3CT9A 3C6UA 2KOBA 1N4LA 2HOQA 2ZE2B 3TANA 3ZX3A 1XNRF 4RT3A 4K0KF 4E1JA 4H0VB 3CCZA 4NPOA 1WB9A 3JTPA 3M1VB 3IDWA 1IR0A 2UUTA 3TRGA 1RHMB 3O4QA 4ETXA 1QCKA 1H2UX 3GWCA 3KK2B 4BRNA 1Q79A 4Z6CA 4KB7A 1K44A 2XS2A 4XH4A 5J2GA 4KKOB 3D3BJ 4ANCA 2FGOA 2HNZB 5IV4A 3F2CA 1BQMA 5ALQA 3AVGA 3MWPA 4RR5A 4M3ZA 3ZXWA 4GKJK 4LBHA 1BVSA 3ELHA 2QN6B 5C15A 2PN6A 3OGUA 2MAXA 4N5SA 1ZQGA 2X3GA 4C0OC 4P0QA 3MMJA 4ETZA 5J2EA 2MY8A 3FC9A 3VVTA 5BR8F 3HKZC 4I2QB 3WT0A 4G3IA 4MKBA 4AE5A 3TFSA 3Q8RB 3KLGA 3TAMA 2F9WA 3EEQA 4CHZA 4CO2A 2ABYA 4B3OB 1NOZA 3KG1A 4IEIA 1RNHA 3KK3B 2V4RA 3OHAA 3QNMA 2NR0A 4B3SJ 1LAVA 1FEZA 3GIKA 2CPHA 4QWBA 4ZOSA 2XY6A 1U2RA 2GWSA 8ICCA 4DV5J 4DFJA 5J2HA 1KNZA 1NGEA 3GB0A 4GV3A 1UEUA 3HSCA 1D8YA 2E1MC 2HOIA 4A5AA 1SC1B 3HI9A 2DGTA 3MM6A 4EUVA 1CVJA 2WSEC 1KOHA 2FYXA 4USAA 3JAMU 3PLAA 3NRZA 1RT6A 1PUZA 2EVZA 4GXIA 2NYVA 2BJ7A 4GO5X 4RQ2A 2PEHA 1JL2A 3JPOA 3BPDA 3M8WA 3W9HA 1BCOA 2YNGA 1WC5A 3HT3A 2ZTEA 1TELA 4QPTA 4FNIA 2E1CA 3OBWA 1PZNA 5JS2A 4DU1A 3NAIA 1GLLO 4CESA 4UBCA 4ZCLA 3MMVA 3AAPA 2JFDA 1CXQA 1RWWB 1V6HA 4CBXA 2HFNA 2HVDA 4NLTA 4HHTA 2X78A 1KC8O 1D8BA 4PZNA 1WLJA 1QS4A 2UUCK 3DLKB 3S3MA 2MEWA 2UXCK 1GFWB 4C4WA 2KHOA 4WFNL 1E6VA 1KBUA 2ZJPQ 4KRWA 4NY8A 3ALYA 4ALZA 3O08A 5LMUK 3WEEA 3G4SN 2ILZA 3G2XA 5J1EB 4JV1A 4B9NA 3JSRA 4Y2YA 4OLOA 1R6YA 2ACMA 4K4VA 4B3TF 2MKKA 3V81A 4QCLA 4LF4F 5F8HA 4UB6U 3KJFB 2F8SA 3CIPA 4I2EA 1U24A 2J9EA 5BPNA 5CYJA 3FM9A 4ZVOB 2MGZB 3K9JA 1K8KA 4JV5F 1TK5A 3AQFA 2YQ1A 4CYUB 5DM6Q 2QKQA 5JS1A 5T7LB 3J81Y 3UQ0A 2KDOA 3CI5A 4C3KA 2M2BA 4IH7A 3W3SA 3MUTP 2QA1A 1G6BA 4GW6A 4QYZJ 3ETMA 5DGAA 3WK8A 2NUBA 5IFMA 1SI9A 1FE0A 2Z56B 4JI8F 4NXNF 1ZA1B 1NGIA 1YSJA 1NNDA 1TMMA 3V6DB 2PKEA 2YQEA 1TVRB 3NHGA 4DFKA 3I0SA 4MLHA 1HD1A 2LP4A 1NGHA 2GVDA 3AJ2A 1AFJA 1N33J 1YHQS 3GJQB 4ZVQB 4FPIA 2LKZA 3PMLA 3DMJB 3AO4A 1VI7A 3BGOP 4KHPJ 4FBUA 3T1HK 4CK2A 4F36A 3D2EB 2JC0A 2PFFB 4HDGA 2DITA 2P9GA 3TUZC 4IRCA 1NZ8A 4K4WA 2FXUA 3BQ2A 4C9DA 2DNZA 3GSDA 1DTTA 2NRRA 1S6PB 3PRBA 3WX4A 4WFAL 2F9DA 4QAGA 1LWFA 2GX9A 3T5LA 1WSJA 1WWUA 4MO5A 1TL7A 4OI1A 1HKCA 3WX8A 4FXWA 2IM0A 4OGCA 2BM0A 4QZ9A 2LMRA 3TZZA 4JK8A 2IYGA 2VA3A 3RWUA 3GE9A 5KFKA 1RT7A 4Y28C 2OIHA 3GZ7A 3NAEA 3D9BA 4OYPA 4ZPCA 1U1NA 2OM6A 4FYWB 4Z94A 1HQUB 1TL4A 4CK3A 3LZJA 3OS2A 4RWXA 3PJ9A 2O3DA 1QQ5A 3VF4A 2KM8B 1GQEA 4OMFG 1G2EA 2Q3PA 3AA2A 2MQMA 3RH5A 3FMWA 5E3AA 6FDRA 1J5EF 2KNJA 3W2WA 2CNKB 1DRZA 3BJYA 3LPYA 4K4UA 2X51A 1VSFA 3CG7A 8AT1B 1FJEB 1QHTA 3MXHP 4WIQA 4B1YB 2VA2A 3FCVA 4OX6A 3SV3A 4KITB 5J2IA 4FKYA 2P9UA 4RO0A 4LF5K 4CP5A 4P10A 4BRCA 2AT1B 2R7SA 3KZXA 5SWMA 3I5BA 4JWNA 2LDYA 1MDUB 1N88A 4FWRA 2MKHA 4BRIA 2BZFA 2KH9A 5T7BA 1AQ6A 1B0TA 4R64A 2MXYA 2WFAA 4P4PA 1M5SA 4CZJA 4QZDA 4WE1A 3ISCA 4WKRA 4E7KA 2KD1A 4PABA 3ZSZA 4LFAJ 4PXBA 4TSXA 1YJ9N 2A1RA 1OSDA 3MEEB 2C2DA 1U8WA 5AZIB 2HFUA 4ZHRB 1RT4B 2MQQA 1N60A 4RQ0A 4DR4K 1G3OA 4MKYA 4DPTA 1R8CA 7ICKA 4YDXA 1HNIA 4CLKA 1PG5B 3SCKE 3MABA 2K60A 1J54A 2NXJA 4CJQA 2E9ZA 2QEXN 4USHA 1CJTB 3AVIA 3GV8B 5GAHU 4QIWF 1CZ9A 1AW0A 3QERA 1S7HA 4W5NA 3BKTA 1T8EA 4K5RA 3OFFA 1A5WA 3GCXP 4NCBA 9ICFA 2HZCA 3PACA 4YQWA 2HFVA 3JPTA 3SQOP 2XHCA 4DF4A 2VPZB 1M5PC 1PYOB 3F0NA 3KDOA 1VLBA 5ALGA 4F71A 1XBWA 3NASA 4IDKA 3GJTB 2D9OA 4AL6A 1S1XB 2HHHK 1W2IA 2GTDA 3VAGA 4NXMF 1KAZA 2M0GB 3I9V9 3CNQP 3AVCA 5BN8A 2LYBA 4HVJA 4A47A 2DR9A 2E1ZA 3J80U 4ED3A 1X6IA 3NH2A 3DGPA 3Q8LA 1P7DA 5ALLA 2FQQB 4R8UB 2RQKA 4PEOA 2ZD1B 1JCGA 2WOMA 1ZQDA 2JLEA 1XMOF 3FZLA 2DR8A 1RQNA 1RLDA 4NLYA 1RTDA 2IDEA 1G4CA 4GXKA 4YN3B 4MKVA 3M8QB 4JMUA 2QT7A 5CHCB 3DV9A 5B0AA 1VQ7S 4QOTA 4KHYA 3JSBA 1JROA 1SH3A 4RW6A 1V9OA 3UN5A 4OJ6A 4JWMA 3W8GA 5C12A 2J4RA 3LZIA 1C0TB 3TAPA 9ICPA 4DBQA 2IHMA 2DH8A 2RLTA 4JOUA 2QO3A 1KAXA 4MK9A 3BGLA 2P9SB 4FCYA 1NU4A 2NREA 1K8AT 2LQ5A 4C7ZA 1WJ9A 3N6NA 3LP2B 2FJWA 4O55A 1T9XA 1ZD2P 3WKEA 4MHVA 1FD8A 2G8IA 3ED5A 4ILGB 1RDDA 3VQAA 1HNWK 2QKKA 1A5VA 1MROA 2V8GA 5J2NB 4HR2A 4AYBF 3UPFA 2H48B 5GMDA 1ZQFA 4CE9A 2G0AA 5IT9Y 1Y00A 4IQTA 2OA8A 3MR5A 1QVFR 4LF9J 3KUEA 3KLEA 4DTNA 2DUYA 2HEKA 5GMKa 4H4KA 4FW2A 1HL6A 2VJVA 3NCQA 2P6TA 4YMEA 5DDYA 4ZJOA 1AT1B 2BV3A 2HBZB 3QGIA 4NZ0A 1C6VA 3AO5A 5EE1A 1DLOB 3NDKA 4PWWA 1QD1A 1S97A 2GZOA 2OCEA 3W3DA 3P1GA 5AKKA 4ZIWA 1N32J 4LQ9A 3CCRS 2XSJB 3LOUA 2XI2A 2YMPA 1CUKA 3J81O 4PG4A 5ALIA 3SEOA 1BA1A 1BY9A 4NRTA 4I2AA 3LAMA 3TJ8A 1GNKA 2DNOA 2CQ4A 4M5DA 3RGIA 5AJ3J 3T79A 1Y64A 1HW9A 1XNRK 4FWPA 2BOPA 3DLBA 4K0KK 4WYWA 4Y2JA 1IKXB 4C8NA 4OGEA 4XK8C 3OTQA 2FD2A 2MDAA 4GVLA 4RUAA 2ZKUA 9ICNA 3UCUP 1Y0HA 5G5HA 4QZFA 1ZBSA 3P5JA 4CI6A 3N01A 4M9NA 1ZAVA 5JRTA 3N4QA 3MX5A 3LWLA 4KQZA 1RDBA 3NFAA 3UD5A 4E7HA 2PDAA 3VQSA 2DT9A 4LF8J 1KEKA 1MMDA 4DCHA 3ZYYX 1NMDA 2DPIA 5KG1A 4Y2KA 1DXSA 3L95X 1M1HA 5GMEA 2P9IB 2BKNA 2QL5B 2ZE2A 4I56A 4OPJA 3QIPB 3IGNA 3GFXA 2MZTA 3M1VA 2HWTA 3DHXA 5AIAA 3DWLA 2J8AA 1KN5A 2HK3A 3KK2A 1N8RT 2ZC3A 5ADZA 2F5GA 5KGXA 4YOXA 2ZJ8A 4KKOA 2HNZA 4A8KA 5KT4A 2IAJB 4EZ9A 3WK9A 2P9LB 1SIJA 5CP2A 2PEBA 3ZT4A 5E3RA 2B6AB 5I3PA 2ZOGA 3LW5C 3HX9A 3FRYA 4GV9A 4AHVA 1LW2B 3ATVA 2NXCA 3PEJA 2KQ2A 4QS9A 5IT0A 4B9QA 1WC3A 3DEEA 4IL6U 4B3OA 3SAHA 2WFBA 2RH3A 3V9XA 4CLYA 4H4KC 1TFWA 3PYEA 1T44A 2L9NA 1SVDA 4L75A 2A2CA 3R8YA 3T3FA 3LPEA 3BO3A 3M6KA 1VQKS 2NXNA 5C25B 3K7RA 1GXUA 1HQEB 7ICOA 4KGVB 2Q6BA 4NZ6A 2AJFE 4US8A 4DEZA 3CF5L 1XSPA 1NLVA 4JI4K 7AT1B 1R27B 2Z7JA 3H8YA 3RMCA 2YNIB 2VICA 3QNNA 1Y11A 2BZ2A 3G8TA 3OW2M 1MN9A 5AXNA 3W1YC 4PH5A 3TX0A 3IFRA 3OYKA 1IJFB 2FF6A 3KWIA 3K5NA 4CF4A 5DBCA 3QETA 1VQ8S 2DXEA 4CHQA 5KG5A 2FJEB 3U3GA 2RUSA 5HMZA 4OJRA 2J7UA 1LCUA 3PIOQ 4CEZA 1UJ4A 2D1CA 2QLWA 3MOJB 4Z6FA 2BKOA 5F0WA 2CZ4A 1TL5A 1WELA 2VKQA 1FFVA 2YWWA 3KJVB 1COOA 4ISEA 4O5FA 4PKGA 2IVPA 4M9GA 3UDEA 4X62J 4QZHA 3DLKA 1JLEA 1BIZA 1R8BA 3FUYA 5KTQA 3DGVA 2A1SA 2BKEA 1FFUA 4JV5K 4OKKA 1VQMN 3ALRA 2G2ZA 2I1RA 2EAOA 5IWAF 1DEJA 5B5EU 2B9WA 3BQTA 2P1JA 2J0WA 4TUPA 4NRUA 3O9TA 4ED6A 2NLXA 2WTUA 7FDRA 2HOFA 1TUGB 3VC8A 2QG9B 5ALTA 1HYSB 2PMZD 2XYPB 4DMZA 4CIEA 3RFAA 2MGZA 1S1VB 9ICKA 2CPYA 1KDHA 2XB2D 3LK9A 2B9EA 2O8CB 5HMLA 4CYUA 2RQ5A 2Z2ZA 4ILLA 3MCMA 1IBMF 4CLPA 2F4VJ 3M7VA 1WHYA 1HQ2A 4U7UD 2CUYA 1RBAA 1BCMA 4C23A 3FKBA 3R27A 3VHQA 3KHYA 1RAEB 4FPRA 3V6DA 3AOCA 3HSZA 5LL6Z 4ZCKA 3DLGB 4M5JA 3VWSA 1JIHA 1HJRA 4JB8B 4GIBA 4CCHA 4MKAA 1UAWA 1VDVA 4DOBA 1SKRA 4CD1A 3NF8A 1HNXK 2ATQA 2PFNA 3J7AP 4B1XB 4RNNA 2FPMA 2WVDA 1QZ6A 4IJAA 2PYLA 3HFKA 4UB1A 4DS5A 1ZXIA 2CJAA 3CCUN 3DMJA 2R7YA 1RU2A 3O9RA 4JI0F 2YH0A 4CO0A 1PIEA 1WUDA 3D2EA 2DQNB 4B08A 3MXIA 5DDPC 1JLBB 3QU5A 4OYIA 4LF2A 4CO4A 4LSZB 2J5AA 5KAIU 3E2EA 1RZMA 1FHTA 5LT5A 1NH7A 1I94J 1S6PA 1WKJA 4F0HA 3CDWA 4RQ3A 1U2FA 2WAQD 5K8NA 4CGFA 4L73A 2ITGA 4EIAA 1J5EK 2FHJD 1EWQA 3PKYA 3LPUA 3KG4A 4M47A 8ICBA 3DRRA 2Y8YA 2FPKA 3T1YF 4NLXA 2ZBCA 4ATNA 3PSFA 4I67A 4C7YA 3MMAB 1S72S 1HI0P 3OYGA 3TZYA 1OVYA 2C2OB 3CC4N 3KLFB 2ZJQL 4ZIVA 4YS2A 1S6QB 1HQUA 1YJWS 3RAMA 4J9PA 3IBPA 4FXDA 2EFOA 1KKXA 3H90A 4QIFA 1PO6A 2J6TA 1QVGM 3CIMA 4J9LA 1EX4A 1WAJA 4B8AB 2XNRA 4PG8A 3CJ3A 2PMWA 3LDOA 4DL2A 3PW5A 4K8RA 2O67A 4OYZA 3CSKA 3ZC4A 4PJ0U 3GG1A 1HR0K 3J7ZO 2W2QP 2P35A 1T03B 2RS2A 1JWWA 2L41A 2AJ2A 2CRLA 3FCHA 2AYBA 4RU2A 1Z4OA 2O01C 4KAZA 4AP9A 5HQ8A 4YOYA 2DHSA 4HCBA 1WTFA 2EG2A 3LYSA 3FK4A 3D6HB 1HUXA 2VF3A 3WBZA 1ZM9A 2CQ0A 1ZPVA 2V5HG 3A3OB 3ILOA 3ZZRA 2B6GA 4L6V3 5F0UA 4ZLLA 2QB0B 2BE2B 3K5MA 4Q8FA 2J6SA 4G9BA 4O44B 3CCWA 3MCAB 1Q82O 5ADXH 1F9FA 5FIIA 1VRUB 7ICRA 4ED7A 2P9PB 3THYB 5F8LA 4WWSA 3CCQS 3G8SA 1LKYB 3HM9A 4PY5A 3MEEA 5AZIA 2KJ9A 2EWHA 4ZHRA 1RT4A 1I3OB 3PRDA 5CD4A 4ZPAA 3HT0A 4WFBQ 2WF8A 1ZQLA 3SMSA 2VBZA 4NCGB 5JVGQ 1QSSA 2QWLA 3WK7A 4DV2K 5HL7Q 4K8XA 5ALVA 4Z6DA 4P2MA 5DZ7A 3VQPA 4E7IA 1X40A 5AQXA 5HRPA 4E7JA 1Q46A 2PFDA 1SXEA 5KG2A 1EXNA 1CJTA 4RBVA 5ELZA 4AL5A 2QLJB 4CBWA 3VQDA 2VWJA 3HLUA 3CXCR 3U3YA 4NLKA 2CQCA 2AJ0A 3SFUA 4M94A 1BHLA 1YZ7A 3P45B 2DISA 1I39A 1ROFA 1J6ZA 3SV4A 1LKZA 3ULHA 9ICVA 3VERA 4X84A 3JTNA 3VVUA 2ZUAA 3ZZZA 4RG8A 4JK9A 4A8WA 2F3JA 1S1XA 3JPPA 1KDNA 2XLIA 2W03A 4DQIA 2LSNA 4URGA 3C6AA 3SSRA 4GKKK 4BQLA 2MQ8A 5I9EB 5C0YA 4I64A 1HPMA 3R97A 1MNEA 3MR7A 2RILA 4OYAA 2CPRA 4RQ8A 4R8UA 4QZ8A 1NNLA 2ZD1A 3PY8A 3PEHA 3AVBA 4DQ8A 3TAEA 2RQCA 2UYTA 5CHIA 3HP9A 1VQ6N 2ZKTA 2EZXA 3M8QA 3O9SA 2IOFA 4L72B 4M3RA 1TR0A 2WVCA 1P1LA 2HBYB 4H8KA 4FWNA 1M1GA 4DWIA 4FOEA 2Y9TA 3L09A 3TX8A 3QYYA 1C0TA 2EC0A 2P9SA 1YJNN 4PZOA 8ICOA 3RBXA 3LP2A 1M5HA 4OHYA 1U1RA 1NZPA 4LBPA 5A2QY 1SJFA 1QAJA 1UCVA 1XI1A 3ZI4A 4J8FA 2G2YA 3A0HU 1HJPA 1JJ2R 1BU6O 1MU2B 1QH9A 3MMBB 3HULA 4JYAJ 5J2NA 2JL9A 4OYWA 3T5HA 3G71S 4LFCF 5EWEA 1AB8A 5DZ6A 2JFKA 3C95A 2FZKB 4RQNA 3M4XA 3IBCB 2XC9A 2AMCB 4R65A 4ZPDA 2Y0SD 3QU4A 3Q7BA 3IRUA 4X65F 5J0QA 3K58A 4CERA 4W5RA 2KHVA 2V7YA 4LQ3A 5IT4A 2C2MB 3MN9A 4ZVFA 2JC1A 2IVNA 4BUGA 2XSJA 4DCOB 4PGXA 2DPNA 1FDAA 4C0BA 2OELA 1N5QA 3MD3A 1ATRA 3QEAZ 4YOUA 4ECSA 1VGYA 5CYQB 4BRQA 1S6UA 2WONB 3I55S 3H5YA 2RRBA 3BZKA 1OUQA 2GO7A 5AFUH 4P4MA 2KI2A 3CJKB 2VQFJ 1FK9B 2DXDA 2YTUA 2V0NA 1DBDA 4KLTA 4WJ3B 3U02A 1AROP 4J2AA 2OSQA 1X3NA 5AKGA 1IKXA 2E8MA 3TJAA 2BCRA 4PHTX 3H5UA 1FJGF 2LI6A 2LLZA 3JB9k 4BVPA 3GL1A 4QPXA 2DEIA 2QJ3A 3R9KA 5GAEP 2NSBA 4Q45A 4PRFA 2HHUA 2CN1A 4CJVA 3RMBA 1VC6A 2HIYA 2YHWA 3K5PA 4BX9C 3I28A 4PYDA 1M5KC 5AQPA 3MR3A 4KN4A 1XJWB 5AI8A 4BR7A 1CJVB 3CJ0A 3BKUA 4OD0A 5JMNA 3FBBA 1ILYA 2YWFA 3E9PA 2P9IA 3DLRA 1Y5LB 3O1WA 3NGUA 3QIPA 2HGMA 3GR0A 3ZFVA 4M7XA 1NB7A 1UL3A 3KJQB 5KOXA 1YWXA 2EBGA 3IG1B 4XQ8A 2R9LA 4KLQA 1Q18A 4NMLA 2XWXA 2IAJA 2ZITA 2P9LA 2QWPA 2WVEA 1HBOB 4YDUA 4RKUC 4JI6F 3HILA 3IWLA 4CEDA 2U2FA 3B8AX 4QU7A 4MLEA 1QAXA 1VOMA 2B6AA 4Y34A 2HRYA 4DQRA 5LJ5Y 4U9RA 2UXDF 2AJ4A 1WF2A 3K2PA 4BRAA 4CZFA 3BQ7A 2IHR1 2V8HA 1LW2A 2HCFA 3IGVA 1TUUA 2YNFB 3IRXB 5K8OA 4WU2A 3U1LA 3ZDCA 1AYEA 4FJ8A 3MTJA 3BF1A 1UAXA 4X64J 4DO9A 1DRGA 2XYGB 2J8SA 2G08A 1N34F 3R7SB 1U1OA 3J81U 4X4NA 5C25A 2ZC4A 1VSMA 1EX8A 3C5FA 1ZQMA 3RYLA 1JXBA 4YCXA 1QZ5A 3EN9A 1S0NA 3NGTA 4ID8A 2YNIA 5F2RA 1RTJB 3DHWC 9ATCB 1BUXA 3TUJC 1DQAA 2OYQA 3NRWA 3FC4A 4LF1A 2MZJA 4MN4C 3TZXA 1XERA 2B4VA 4WF9Q 2BW7A 3V7JA 1CXUA 5IWAK 4U7BA 1SJRA 5KGWA 4TLQA 2Q1LA 1X5OA 3CCEN 4IO9Q 3EVWA 5CR4A 5EX3A 4I2PB 3SAFA 4UTGA 3CRXA 5JICA 3DYAB 4OKEA 1MSWD 4BRDA 3H0LB 2BPCA 3VTIA 4RJVA 1GTEA 1JMSA 1N48A 5AQYA 3C6HA 3EPIA 2Z4PA 5AQTA 2F8LA 8ICJA 1IBKJ 4ZLJA 4CJFA 4CF2A 2OGUA 1LOTB 2VIXA 4USVA 4DU3A 1VR6A 1FRXA 3BF4A 4P2XA 4MF2A 1C2PA 2EFPA 3BM7A 1XMQF 2PMZF 2HHXA 5IQQA 2KU7A 3Q0AA 4OJOA 1JUDA 1IBMK 1JLQB 2BJEA 3BR9A 4RPXA 1VISA 4J9VA 3EZUA 2E44A 3EMTA 1S79A 3THPA 5IIIA 4CEFA 1TP7A 5JTIA 4U67Q 9ICQA 4DF8A 1Z05A 4ZN3A 2H5JB 3D2WA 4LFBF 1X42A 1S9GB 2E6LA 3HPHA 2UV8A 5C10A 4YDUC 4DR3J 1HYSA 3BP8A 2CJ9A 4YHHF 4K42A 1WG5A 1S1VA 3NAHA 2KTQA 1B0PA 1Y4ZB 3C16B 2O8CA 1OYDA 3D6JA 4ENOA 3ZEUB 4K7QA 2UXBF 3C2KA 3WNEA 3RRHA 4CGZA 3OT9A 3EDRB 3HKZD 1BA0A 1YZ6A 3FAHA 4LF4J 1FEEA 3K5LA 3DLGA 3T1YK 3US5A 1KQSR 1SJ3P 4B9MA 1HLWA 2E1YA 5AXLA 4FJ5A 2B4OA 1KVBA 4YNQA 5HHIA 2DNYA 2ZIXB 3DNCA 4KI4A 1IR1A 4TU8A 3ZT2A 2V51B 1ZAWA 4A57A 2FLNA 3PW4A 1RA6A 4J9UE 4CF0A 3SUPA 3GG0A 1SGGA 1JLBA 4YOVA 2RMLA 3HKWA 5E26A 3RG6A 2XMJA 2CGJA 1UEKA 2J9DE 3WQPA 3NS6A 2J6UA 2MKJA 3CJ1A 3BH6B 1BO5O 1G15A 3MXJA 4I29A 4C0HA 5GINA 2HVZA 3AVKA 2EXUA 5CYMB 2FHKA 3IWNC 1HJOA 4FLUA 1N2XA 2IMOA 1W97L 3I56N 3MMAA 4H5NA 4P72A 2ZIWB 1ZQHA 2GMJA 1RCHA 2V6AA 1TFYA 1T9YA 4NLRA 3KLFA 1RUSA 1S6QA 5CZXA 5ALJA 3FZBA 2V4QA 3GP9A 2K8BB 2WB1C 3PIPL 3PDNA 2N82B 4PYAA 1D8ZA 3E0FA 5ALKA 1HNZJ 3QNOA 1GXTA 1RDUA 4IOCL 4F4WA 1MA7A 4DPWA 2P5OA 5KFTA 8RUCA 1OY6A 4UY8O 4V1Ak 4LRDA 3Q2SC 3D54A 4DMNA 1T03A 2CQIA 3CP8A 4J9RA 2YKMB 4ECZA 2CH5A 1IKVB 4M63A 1CQMA 4DJBA 1L3KA 2HFZA 2QLTA 2C2RA 1IR2A 3A8JA 2JGAA 2PBDA 5HR7A 1R8AA 2WF9A 1RACB 1N61A 2W1BA 2X1AA 5IOLA 3U9DA 2QB0A 2X74A 2BE2A 1Y3JA 4LRBA 2XEXA 2XO7A 4O44A 1Y3KA 3ORYA 4N56A 2N4DA 1C0MA 3TYTA 4HT7A 4Z4CA 1Y5IB 3WIUA 4CJPA 1VRUA 1L5UA 5DLFA 4EGLA 2ZNZA 2I38A 2P9PA 3THYA 4DFDA 2MUTB 2QTWA 1LKYA 5K4LA 4FWQA 2XY8A 1TVAA 5ETPA 3NUQA 1HW8A 4C11B 1ZD5A 3HSTB 4A8EA 2L5YA 4JI5K 1J5OB 1FDBA 4ECUA 1FWLA 1Z6RA 3PFEA 4V19J 3BGFA 4NCGA 4CJSA 5GAEU 2QA4N 2EDUA 1N56A 9ICLA 2ZQBA 2ZTCA 1OH5A 5HJYA 3KLVA 5AQUA 5J0RA 1EQYA 2E6MA 1NPRA 4I1TA 3NNAA 4NMXA 4USIA 3M2VB 4ID5B 4I4BA 4U8VA 1I1GA 3E8OA 1GMUA 3GFZA 1WNEA 3TAQA 4YY3J 1RQLA 3B9JA 1PSDA 3AJDA 1K1SA 2OHDA 3N7SC 3FDSA 3TQ1A 4DTPA 4CJ5A 3M1YA 3CD5A 1S72N 4CNZA 2NRZA 2W4PA 3GPAA 3AAWB 2KLAA 4FL9A 3ULDA 4F3OA 2MQOA 3DOLB 1SJ4P 1OQ6A 2JSXA 3M9NB 4K4TA 1YJWN 4IQMA 1NCLA 1T0TV 1HA1A 4FF4A 3HK2A 1BXNA 4X4RA 3HZ6A 4NJ8A 2MLXA 4HUGA 4FVMA 1RBTA 1NLKL 1JX4A 3A8YA 4GO7X 4UW9A 1KFTA 4KV8B 3AJ1A 3AMZA 4P7TA 3S41A 2D0CA 4O5BA 4CGHA 4Y2CA 1HWUA 3CJQA 3Q8KA 5ETMA 5M2PA 4CZKA 3C6TB 2UUWA 3VAKA 1FXRA 2QB1A 3SZ2A 3D6TB 3ZSVA 1NSAA 3QESA 2DYAA 4M63C 2B43A 4USKA 1FWPA 3D0HE 1FX4A 4X66K 2RRDA 2HMIB 4DV5F 3SYZA 3ZZYA 2CQPA 4E1MA 1MMLA 1KQQA 2GQQA 4WFAQ 1NRKA 2HBKA 1K6YA 1EQMA 1V9PA 1FFWB 4F9OA 3ID6A 4CLWA 1DTQB 2JEGA 4P52A 2AWZA 1TAUA 2CNOB 1MU2A 3MMBA 3CCVN 2FJBB 3K17A 2PE8A 5CWRA 1Q78A 2G9OA 3OL9A 2KJ5A 4E8UA 5B09A 2QFJA 1NKEA 3AU2A 4XAKA 3E9LA 4BC5A 2JLGA 3MEKA 3MECB 5DO2A 3R1LA 3MC1A 2O4IA 2RHSB 2E5JA 4PR6A 4LVNP 3NEKA 1U49A 7ICHA 3IDHA 4H0TB 2E20A 1WEZA 1IKWB 3CQYA 4DR5K 3QMQA 2RRAA 3BGRB 1Q86T 2HQ3A 2Z30B 4YR2A 2YVSA 1PILA 2X7IA 4W4MA 3QFUA 4JRQA 1N5VA 2XSFA 5M1NA 2OPSB 1BISA 4F5NA 8ICTA 4CJ3A 3OY9A 5CYQA 4ZPVR 4OPAA 2WONA 4FJHA 1PAUB 1B43A 3EE3A 1WHXA 3CJKA 2ETJA 1FK9A 2KJ8A 3QEIA 4LH5A 4OZ3A 4H5VA 4PPZA 2OO4A 3AN1A 2WK4A 2FGCA 2VHGA 4P2HA 2WSFC 5SUHA 4FLYA 4AQYJ 1HX1A 4FLXA 4HUFA 4MQ3A 2E2OA 3WKBA 4MO4A 2CWKA 5ETLA 5KOWA 1IKYB 1KFDA 2VH7A 4JI6K 2M8HA 4N8OA 5CB1A 3F53A 2BX6A 3KKRA 1SJ1A 4TKTA 1NMEB 4MH8A 4M3WA 2XGPA 1CLFA 1CJVA 5IV3A 2UXDK 5J8YA 5T41A 1HD0A 2P2CB 3GYGA 5ALFA 1BUPA 2BMBA 4OKJA 3EGZA 2HVIA 1N33F 3AY9A 4EX6A 2QTDA 2HNDB 5AE2A 3QMLA 4O0NA 4KHPF 5JUMA 4EBEA 3IG1A 1G1XA 2XS5A 1O08A 2ZG6A 3IR7B 4GKJJ 4HI1A 3PNIA 2OSRA 1XR5A 4M41A 1HBOA 1BWFO 3W5ZA 2NO5A 5CXTA 1H73A 3ONNA 3BBFA 4CNYA 3CO9A 3J7Z5 4JP8A 3VQTA 4EBDA 2YNFA 3IRXA 3QT5A 3D2NA 3OR2B 3BEXA 4ED5A 3ZSXA 3MURP 1UT8A 3LUYA 2VG7B 1JALA 4WPAA 3KHGA 1NPPA 3UXPA 1PJ6A 3QQCD 4JHDA 4EK2A 3W64A 4CWBA 4K4XA 2X1FA 5AKHA 1CC7A 3RH4A 3OYJA 5IC4B 1HBNA 2BGGA 1R31A 3IN5A 2W01A 1FDNA 5IM0B 2FIUA 3OSPA 1RG6A 2RHQB 5C2CA 5F8NA 3QEPA 5C7PA 1RISA 1NOMA 3LM9A 3NVKA 3FJ2A 4ECTA 2IY5B 3CPWR 2DB1A 5E3QA 3VQ5A 1PC4A 2G5IB 2DGOA 4M45A 2MQLA 3SJJA 3S1TA 3EO3A 1ZOTA 3RJGA 1WSRA 1Q8IA 3DDIA 2CQ2A 4WQ5C 2PFPA 1D9DA 2FLOA 2ZH4A 4J2DA 3DAWA 3J81j 3BZQA 2PFQA 4U7UK 4I2PA 4I27A 4DG1B 3DYAA 3PXGa 2HQDA 4C4TA 1W2BM 4Y0WA 1OPZA 2D0BA 2KL8A 2MU2A 3ZZOA 1MWMA 4DTJA 2CZVC 2IBKA 1MN7A 1R0CB 1K0TA 2E2NA 4FYYB 4LFAF 1QDUB 2F63A 2QI2A 4CVNE 4N8NA 1JLQA 2A3JA 4LF7K 4K4IA 4QZCA 1X9JA 1X5SA 1IG6A 2NXUA 2G07A 4Q7AA 3OSNA 3HKZF 4ECYA 4RW8B 1N5YB 3HL8A 3L3FX 1U6FA 1RWPB 2PAVA 4K50A 1PYSB 1S9GA 4NA3A 3BQ0A 3S8SA 4M3TA 3KZIU 2OEHA 3UM9A 3HTVA 3SEIA 1NDCA 1UPPA 1VBYA 2O8BA 3C16A 5J2PB 4PKHA 3ZEUA 3QRPA 1OYEA 2JGUA 1FT8A 3V5RA 2V52B 3BSCA 4HH1A 5K8MA 5AQQA 5JLHA 2V94A 4QZVB 3C2LA 2G13A 2XY5A 1IJEB 3OJUA 2FJXA 1FX2A 7ICVA 2ZXHA 3VQEA 2FC8A 1SH2A 2MKSA 4R79A 3VOVA 3O1BA 2R7RA 2IIRA 1WC0A 2ZIXA 9ICXA 4K4GA 4Z7YA 2DY1A 4DZ6A 3T1HJ 3VENA 3ZX2A 1W26A 3CJ4A 2GWJA 1O6XA 1F6TA 1RXOB 4FFDA 2JVOA 2LQ8A 3DLEB 4KE5A 1EP4B 3PUFA 1KHWA 1JCFA 5EWGA 2C2EA 3KXDA 2UUBF 3I4HX 4JV2A 2D0AA 5GTHU 2A19A 2QWOA 3IKMA 3ZT0A 5H9EJ 5CYMA 5TZVA 1VJ5A 5FD1A 4JI0J 1O51A 4EAHD 3SUOA 2R42A 2E9RX 3VEOA 2ZIWA 2GIFA 2IDOA 2M0NA 1IG9A 1RTZA 4DSJA 1WDDA 3IG5A 2ZVSA 4JEPA 3MD1A 3AU6A 3BN7A 1KHVA 3OLAA 4EX7A 5MAOA 4B3MK 1JLGA 5AM3A 4DR7K 4IYQA 2E66A 3FFKB 4FJNA 5B0BA 3NS1A 3D0PA 3TNVA 1R6VA 1ZAXA 1XQSC 4LF9F 4IFEA 4LJXA 2QRRA 1U4BA 4PWUA 2G4BA 1SZHA 4BRLA 3HWTA 2YKMA 4OO1J 3A3NB 2DR5A 3S01A 1IKVA 3C15B 3HHKA 1H74A 2QXLA 3B54A 4P74A 2A42A 1ZJMA 4OPHA 4DR1F 2YXLA 1AZSB 3UD4P 5A8KB 4LF5J 3TOQA 2XRIA 4YOEA 1FI4A 5J2JA 2BRKA 4UF4A 1N32F 1S6OA 2KMDA 4RUCA 4N76A 1JRPA 6AT1B 4PKIA 3U9ZA 3ZNUA 2JZ5A 1FNOA 2H65B 3VGSA 3EICA 2GVZB 4FWOA 5ETOA 4N47A 2HBQB 2YX7A 5HQLA 2HNYB 1WCLA 4M0AA 2IDLA 5AJ3F 3EGNA 1YF5L 4Z4HA 2YHAA 1XO0A 2UV8G 2MUTA 2AEFA 4L8RB 4L3NA 4WZMA 4C11A 4JS5A 5D4LA 4DR4J 1QTMA 4ECWA 3M2UB 4FJXA 1C1CB 2KT5A 1J5OA 2RJZA 1WACA 4PL7A 3P49B 4DPOA 4TY8B 1WUUA 1E4FT 4ZPBA 3EZ5A 3W8PA 5KFYA 2Q66A 3LDNA 4LF6F 4ZVSB 3B82A 3FGVA 3VQ8A 3ETRA 1YG0A 3MPVA 2IVFB 3LWMA 3M2VA 3U7JA 4ID5A 3QWPA 4W5OA 4LF8F 2QXFA 3ZTQA 1RHKB 2EQYA 4Y2SA 4IO1A 2CNLB 2D3UA 2I9GA 3AQEA 2YNHB 1K9MT 4OZJA 1VQ4N 4UOHA 2KIVA 3KKAA 1UT5A 4DV1K 1HNVB 2OTJN 1U0SA 4IS7A 3DOLA 2EZYA 2KXNB 4B3SK 5LJWA 4Q5VA 3MM7B 1UPMB 2XICA 4Z6EA 4RNMA 4LBIA 4UOGA 1NGFA 2AQ4A 2P8IA 2CG8A 2R7OA 1KQFB 2EH9A 3BSOA 2ALYB 1DHMA 4KV8A 4HCCA 3I1YA 3VEYA 4JI3K 3CMAN 1CSJA 1UVMA 5D15A 1O13A 3KHLA 1NSKL 4GLXA 5C5JA 4Q2LA 1Y10A 4P4OA 2OJ3A 3WU2U 3MGJA 1VK0A 3C6TA 5DQIA 3PSIA 1GO3F 4ILMA 2HKEA 3QYPA 1YVFA 2WHOA 1UOCA 3H0MB 3TR5A 4J9QA 4LRFA 2WW4A 3SI8A 1VQPS 3EXCX 1R8PA 2M9KA 4OYBA 3W2VA 5JVHQ 1RAAB 2HMIA 2HYIB 4M42A 2W2MP 1KKHA 2HWHA 3R5GA 4P75A 1ICEB 4W90B 1QQNA 4EU0A 2HSZA 1XU4A 3BBBA 2AKWB 4L3QA 3SQIA 3QWUA 1DTQA 1UP1A 3THWB 7ICIA 3A8KA 2VJUA 4IOAQ 3V6JA 1NBWA 4FM2A 1S1UB 4BWJA 1ATNA 3E1YA 4PHEA 1M1KO 1YTYA 2Y0BB 3TW0A 4DL6A 5IS2A 4DUYJ 1WF1A 5ALEA 4ES1A 1T9VA 2VU5A 5AK4A 1KVIA 4F2RA 5J1PA 1UVNA 5CH7B 5E5NA 4OJLA 4BDPA 2WMMA 2HQFA 1QAIA 4CM2A 5IIJA 3MECA 3V2UC 5ETVA 2HMXA 5E79U 4DTSA 1XSLA 3SBMA 4BHQA 2MKIA 4WFXA 3R9LA 4YOWA 4YR3A 1IKWA 2K7KA 1P9YA 4JLHA 3UDCA 2R8GA 3BGRA 1BMQB 3S3NA 4BRPA 4Y6IA 5DQGA 3O3LA 5ETQA 3FEXB 3TFRA 4CEAA 3TKAA 1SKWA 1ZZNA 3THXB 5FLXU 2OPSA 1NSPA 1PBAA 3G6EN 1NH8A 2Q79A 4KGKA 2K1RB 5LMNF 4F67A 3KKAC 4I2GA 1UQVA 4J7CA 2FBVA 3UVJB 1IM6A 4DV0J 5ALPA 3L3CA 3CMEN 3ZLJA 3L6QA 3Q8VA 3NY0A 2VIHA 2VV5A 5C24B 1N33K 4CZCA 4XH5A 2ZHOA 4URQU 5HROB 3A0IX 4XH1A 3LVWA 3CB4A 4KHUA 3K2YA 3HVWA 1KLMA 3UXNA 1OH7A 2P66A 4KHPK 1JMTA 2RVJA 4M9LA 4RBUA 1RKJA 4ED8A 4B6JA 5BYSA 3ILLA 4N7TA 1IKYA 2IVMA 2LM1A 5T14A 1JXVA 5EE9A 1A0OB 4Z0UA 2O6KA 4K2XA 4KLEA 3CCMS 4TU7A 2F4VF 1SC3B 1SBRA 2UZAA 2YJEA 3B6OA 5F8GA 4PG5A 2FVCA 4S0MA 3OL8A 4KR0B 5ALSA 2A40A 2HNDA 5KPZA 5KNIA 2LXIA 3I87A 5GAGP 1PGZA 3QIOA 2Q0UA 3KOAA 5EXWA 3CCLN 1JLCB 2VKRA 2CQBA 3AA5X 2RN2A 1R0BG 3AD9C 3IUCA 3I4PA 3NWGA 3DLLQ 4FLWA 1NK7A 5J2FA 3T5KA 2YPYA 2C42A 3OYNA 2FLLA 2DO0A 2JNJA 3BR8A 4UY85 3KFWX 5FPNA 2QYGA 3CUNA 5AQIA 5BREA 2XCPA 3NH0A 3D68A 3DDKA 1Q7LB 4NM1A 1W25A 1ZQIA 4DDFA 2QE5A 2DBYA 1YK9A 4FS1A 3OR2A 7ICUA 3HHLB 2RHFA 1R8HA 1CI4A 3EGVA 4NL9A 2F44A 2XVTA 4JI1J 5HMWA 3VAJA 4IH5A 2LA6A 5DRKA 4FJ7A 1Q9XA 3ETOA 2DGZA 4F72A 2LXFA 4JI7K 1F5BA 2GA7A 3K89A 4UAZA 1VBXA 4JI4J 2XG8A 4UAVA 5KL1B 1MC8A 5GTIU 5IM0A 4YVZA 5HI7A 2NYIA 2HK2A 3B0XA 4ZOHC 2UVVA 3M8PB 2YKOA 2JOQA 3AGRA 1H6KX 2P5GA 4RT2A 1U45A 3CJ5A 4F2SA 3KUGA 2N3OA 3L3VA 2K7JA 3QINA 4QWEA 2WF6A 3AO3A 2ADBA 2OTLN 3VGVA 3EUB2 3CHWA 3EX7B 5L1IA 4DG1A 3DJCA 1TV6B 4ZLPA 3BS5B 1W9HA 4FYXB 2XQCA 3OUYB 5DB7A 1KAYA 3R8EA 1TKTB 2KHDA 2SXLA 1DQ8A 3HYFA 2K3IA 5AM1A 1Q7YT 2HB5A 3L4BC 3UN3A 1RFQA 1WUAA 2R7WA 2D69A 4WFYA 4TYBA 2RPIA 4JS4A 2XMUA 1HBMB 2HLUA 4C8YA 2H4WB 4KGZB 2AZ3A 1HKGA 2HBJA 4CF8A 2HQIA 2ZZMA 3PV8A 4JRPA 1U9LA 4CF1A 4KLSA 1B92A 2VBYA 4RW8A 1N5YA 3D0IE 4X4VA 3ZTPA 1ACMB 4PHDA 3POTB 4BC9A 3RJJA 3C46A 4IJNA 1L3VA 1CG2A 4I6YA 2E1FA 4ILHA 5DBBA 3QU9A 3SMPA 4CGIA 3G87A 4BACA 3OQ2A 2UVWA 3BS9A 3LGNA 5J2PA 4LZDA 2LHTA 5KG0A 4AUKA 4BBYA 2RB7A 2AHOB 2ZXIA 3VQCA 3MWBA 3I6PA 3O2IA 3NMUA 2OXOA 3QBXA 2DY9A 2BPGA 4J9SA 1HNXJ 2H1YA 4HAIA 2B0CA 1MWYA 4KO0B 1SUQB 3G10A 4EZ6A 1VQNN 4FE3A 1DK3A 2Y1LB 1VQ5N 2DNGA 1V3SA 4YHHJ 4DV4F 2ZOMA 2HHSA 3A2FA 3Q23A 2CQ3A 1F21A 3TA1A 2BQRA 2LEPA 1U6ZA 1U47A 2AA4A 1KFSA 1HHTP 2IBOA 3DLEA 4X4QA 2ZGYA 1EP4A 2EW9A 2C22A 4QQBA 1F9HA 2YKAA 2KO1A 1YUWA 2D3DA 3GOIA 4ERDA 4WQ4A 2OLWA 2HS4A 1H98A 4EYHB 3MAQA 2E5HA 4CECA 1FD2A 2YHYA 2N4CA 4QIWD 1TKZB 1VQON 5DBAA 5IXUA 5AK3A 1SPBP 4ZLNA 4O3NA 2W11A 1KSPA 3DRPB 4C1NK 4I2FA 2CDRB 3NWRA 2BCUA 1RJJA 3KHRA 1NBEB 2ROPA 3PYDA 2HFSA 3MOZA 4YG2A 2LBOA 1HARA 3K5OA 1N32K 1H38A 3BDEA 1VQSA 4NM2A 3KNGA 4JYAF 2HHVA 1NHKL 3CYMA 4J2BA 3GFKB 1RT1A 1XR7A 3AA3A 1XHZA 2DH9A 1EKEA 3LAKA 2MY7A 5AJ3K 4FO6A 4KH0B