2XY6A

Crystal structure of a salicylic aldehyde basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
581
structure length
581
Chain Sequence
b'TAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 199
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy6A01
1WSEA 4RQ6A 3PUFA 5KFNA 1S5JA 3C21A 4CEEA 3K75D 4KI4A 1HUZA 3OSNA 2FBYA 1RYRA 2ZTEA 2B4JA 4P4MA 4IR9A 4NCAA 5KFMA 1S97A 1T4GA 2P66A 1WCNA 9ICCA 2BHNA 3DI6A 2JEGA 1BI4A 2J6TA 2HNYA 5F9NA 5I3UA 1S1TA 4DOCA 4KV8A 3HWTA 1WSFA 1XU4A 4KLHA 1Y97A 4UB5A 2Q3SA 3RBDA 3ZDBA 4Q45A 1JLCA 4L8RB 4QOZB 5J2KA 4I2QA 2YKMA 2BDPA 4RT2A 1QLNA 4Z4HA 4LZDA 2Y1IA 4JK1A 1VRUA 1NKEA 4NYNA 4JRQA 3HO1A 2P6RA 4O3RA 4B9LA 1ZBHA 5IIKA 3PVXA 2I1QA 3SQ1A 4CJKA 2BCRA 3MFHA 3H8SA 4BXOB 4TURA 5T7BA 2PYLA 1CXQA 1C6VA 4E3SA 3JPQA 1O1WA 4DG1A 4AILC 3H4BA 3VQ6A 2NRXA 3OS2A 4CFCA 3MABA 3VQ7A 3JPRA 5KFRA 4FZZA 3GDXA 4MEYA 1LB2B 1JKHA 4KLLA 3OYJA 1IH7A 1VK0A 3DM2A 4F5QA 3F73A 2DPJA 2IHMA 3CFPA 3SNNA 1RXVA 1RXWA 3CQ8A 1J5OA 3SQ2A 2HNZA 3ZD8A 1B92A 2JGUA 4Z4GA 4UAZA 3AVMA 1SL0A 3NAEA 2UVWA 3NF6A 3HVRA 2C28A 3QEPA 9ICSA 4NYFA 2IGIA 2ATQA 3KHHA 4QZ9A 1S9EA 5KFBA 4PHAA 4JS4A 3K2PA 3O4QA 3OYEA 1RBTA 4ECWA 1IM4A 4KHUA 1WSHA 1KEJA 4H8KA 3H4DA 3AA4A 3U3GA 4EBEA 1U04A 4IQWA 3NGDA 2A1JA 3AVKA 5SZTA 2I9GA 7ICSA 3V1QA 1CEZA 4ED2A 5DGBA 4NLGA 4Q8EA 4CJVA 3MFIA 2VA2A 4FJ8A 4DOAA 1TFRA 4FLVA 4EYIB 1VSKA 1U48A 4DQRA 4ED1A 3AA5X 2BKEA 1MSWD 1J53A 4BGDA 2WOMA 1KLMA 4QAGA 4KN7A 5J0QA 2FMPA 1LV5A 3SCXA 5CZ1A 2F1HA 9ICWA 2VG7A 3E01A 8ICBA 1JX4A 8ICLA 3DRRA 3KHRA 4M04A 4PA1A 3DLRA 4M3TA 3O4NA 1JXLA 4E0DA 1RT5A 3Q8SB 4KLQA 5D49A 9ICAA 5KFVA 1ZQMA 1ASVA 1ZQJA 1DGSA 2NRZA 5L1KA 4JRPA 4FXDA 3ZCMA 3NGZA 2NRTA 1ASUA 3EPIA 4ED0A 3QINA 1B9DA 4QCLA 3HSTB 2RF2A 1ZQNA 4B9VA 4FW1A 2PI5A 1ZJMA 3NTUA 1RBVA 4FK4A 3T5LA 3V9XA 3QEIA 4UB2A 4CJLA 3V72A 1ZQAA 4YMNA 4RW4A 3QEAZ 4YXJA 2BQ3A 4CEOA 4FJHA 3GQCA 5DGAA 1BQMA 1HJPA 3CM5A 2AGQA 9ICFA 3ISNC 1VSDA 2C2DA 2R8JA 2ZJAA 1IG9A 4FJIA 3MXJA 4UB1A 3IG1A 4KLGA 3LDSA 1U4BA 3MEGA 4YR2A 4RZRA 2X74A 3M9NB 3SQ0A 3PV8A 2HHWA 4AHSA 4R8UA 2ITGA 9ICLA 5HRRA 2HB5A 4F3OA 2XRIA 4OJRA 1K1SA 5IIOA 4GXJA 4ED8A 4DU3A 1KVBA 1FKOA 4OKKA 3OHBA 9ICBA 4KB0A 9ICGA 8ICSA 2RDIA 5L9XA 2BE2A 4TUPA 9ICMA 1IO2A 4KHNA 3AVJA 4PGXA 4HTUA 1NK6A 3RAQA 1T3NA 4BE0A 3RMDA 1BVSA 2VA3A 8ICWA 1EXQA 2XC9A 2ASDA 4PGQA 3MEDA 3K5MA 4RNNA 5J2EA 1LWEA 4FLWA 4Z6EA 1RT3A 1N48A 1NJXA 3JPOA 8ICYA 4HUGA 3PW4A 3VQPA 2FC0A 4MQ3A 4KTQA 2C22A 4IRDA 2KZZA 2XHBA 1NK4A 2ISOA 2HHQA 1ZETA 2G8VA 4YNQA 3KLGA 4WE1A 4J9QA 4EBCA 3AUOA 2J6SA 4ECSA 2G8IA 1VSJA 5DK5A 3K59A 4RQ0A 4CJTA 3DLBA 1ZQVA 3HPGA 3OVNA 5CB1A 1N6QA 4E7LA 4XRHA 4FZXC 4CK1A 4UQGA 1ASWA 4ECUA 5HLFA 2G8KA 2OPQA 2BR0A 1Q9YA 4HUFA 4O0IA 4DL7A 3HPHA 3M8QA 5HRNA 2DFHA 5J0OA 4ZH4A 8ICEA 3NGYA 1ZQXA 3O3FA 2W9CB 2IS3A 2D5RA 4KLOA 3Q8PB 2R8KA 2AQ0A 2C2RA 4J2BA 4KAZA 2HNDA 4HVJA 3AVLA 3NH1A 4DFKA 3RB3A 1ZQYA 2V9WA 2E6MA 2G8WA 4FLTA 2ZTDA 3SPYA 3EPGA 4I2GA 4I2EA 1RTDA 9ICIA 5KG7A 4RPZA 1Z26A 4BXOA 5C42A 4HYKA 2HHVA 2UVUA 5KFOA 3VQAA 1K6YA 4IQUA 3BQ0A 4DO9A 4F2SA 4KHQA 3TFRA 1RPLA 3AVAA 4QWCA 5KT3A 3ISBA 2ZQBA 4E7JA 4J2EA 1YTUA 2HHSA 2J6UA 5KFWA 1RDDA 1BPBA 1ZQPA 3RJEA 3NF8A 3V6DA 3UIQA 3Q8MA 2GWSA 4Z6DA 1F21A 5L1LA 3NH2A 9ICTA 3AVHA 4TSXA 7ICIA 1CZ9A 5KFZA 2OZMA 2HVHA 4O3QA 3QIOA 2R7YA 4FS1A 4ECXA 1JIHA 1KDHA 4FZYA 5CP2A 3BQ2A 4H4OA 2VA8A 3QIPA 9ICPA 1JL2A 4FO6A 5DB8A 2OWOA 1TGOA 4B8AB 1TKZA 3RRHA 4RQ4A 3NDKA 2FBVA 4IFVA 2H5XA 4J9OA 1TK0A 8ICAA 3VQ8A 4F8RA 2DFFA 3Q8KA 3PX6A 5DB6A 3OYIA 4YD2A 3RJIA 1JMSA 1IKYA 1C1CA 3TAMA 3K57A 1SZPA 1DOQA 2R8GA 2NUBA 2FLPA 2ZTCA 5KFYA 4Y1DA 3LWMA 3DOLA 3S3OA 1BIZA 3HX0A 3I0RA 1XO1A 4MF8A 4DTUA 3OYAA 5KFFA 1SL2A 4I2FA 4ED7A 3RTVA 2X6SA 9ICXA 3IHQB 4QZBA 4DL6A 5DQHA 3JYTA 4YCXA 4W5RA 3GV8B 4DOBA 1W9HA 3GFKB 2IDOA 3EY1A 3HYFA 3QE9Y 5J2PA 1QS4A 7ICKA 5KFTA 2AGPA 1EXNA 4KMUA 1A5XA 3MDCA 3KD1E 2W9BB 2ALZA 3WNEA 3AU6A 4FJ9A 4FBUA 4DEZA 4IG3A 4C8OA 2XY8A 3FFIA 2HHTA 1QQCA 4DTXA 4FJKA 3PR4A 1MQ2A 9ICOA 3RJFA 3TQ1A 4KLMA 1NK5A 4OGCA 3LP1A 3QERA 4LD0A 4JV2A 3ZSVA 4CFDA 4M47A 3ORYA 4I28A 4B8CA 1BL3A 4LSNA 3TWHA 3TABA 4QZHA 4MFAA 9ICRA 1NKCA 4DSLA 3AVNA 4R65A 3OYLA 5KT6A 5HHIA 8ICCA 7ICOA 8ICNA 5DQIA 5J0SA 1QSSA 3P83D 4W5NA 1LW0A 3ZSRA 1UOCA 3C5GA 4CF9A 4IRKA 3C5FA 3RAXA 4DSJA 1A76A 1ZQBA 3OSPA 1S0VA 2PZSA 3NE6A 3RR7A 3NCIA 2G8HA 3LZIA 4O44A 3GV5B 4M3YA 4AHCA 5CYQA 4QZEA 4DSEA 4F4ZA 2FBTA 4FW2A 2IBKA 4YR0A 4LVSA 1RT6A 1CUKA 3V6JA 4DL2A 1DLOA 3S3MA 2PFPA 2XCPA 4KLEA 4PQUA 4UAYA 3Q8RB 1ZQKA 4J9KA 4CHPA 4I29A 2HHXA 4M3RA 1RTJA 3C6UA 2ZJ5A 2D0BA 4GVMA 2ZUDA 1PZNA 4KLFA 2YNIA 4O0JA 2Q0ZX 7ICGA 5CWRA 4NXZA 7ICHA 1VSHA 3KLIA 3GIIA 3VQBA 7ICLA 2KZMA 8ICUA 4NCBA 4RW7A 3THVA 3BQTA 4Z6FA 7ICEA 4ZTJA 3KLEA 3DRPA 1RNHA 4CJUA 3ZD9A 4ELVA 1DTTA 1C1BA 3K5NA 4B9TA 2YNHA 5F9LA 2KQ2A 3PW2A 3P5JA 2VG6A 3KK2A 4KHYA 4M9JA 3I8DA 4E7IA 4GXIA 4JWNA 4YN4A 3JPTA 3RJGA 3GILA 4BDZA 1RBRA 3TAPA 2MAXA 2FMQA 3KD5E 1L3SA 2DY4A 3OGUA 2I5JA 5KG1A 1D5AA 4FJXA 1ZYQA 1REVA 2DFEA 1N5YA 4F92B 3V7JA 1HYZA 4QZ8A 4RW9A 4NLNA 3PW7A 4CIFA 5DBBA 4J2DA 4R63A 1LW2A 1TVRA 3VA3A 3SV4A 4I9QA 4M42A 7ICJA 1ZBIA 4RUAA 2FLLA 4Q8FA 3PR5B 1RDBA 4XQ8A 1BPZA 1U49A 3RMBA 4JUZA 3KK3A 3ZT1A 5KFPA 1NK9A 1ZJNA 4J9LA 2XGPA 3GIJA 4E7HA 2JZBB 1KTQA 3T1AA 3GIMA 1A77A 1WNSA 5HHHA 5DDMA 3TAGA 3M8PA 3ZDDA 3VQ9A 2O4IA 4CJEA 1ITGA 5J0PA 4DF4A 4F4YA 2GUIA 5DG7A 2QXFA 4J2AA 5KG5A 3VA0A 2JEIA 1A5WA 2B5JA 1UA1A 4YQWA 1FXXA 4RQ3A 4RUCA 3SI8A 5J0TA 3B0XA 3NGIA 2NRVA 8ICTA 2PY5A 2B6AA 1WSIA 4N47A 2MUTB 3MR3A 5J2NA 1VSLA 3TI0A 5J2JA 5D4BA 3RJKA 4RG8A 3MXIA 4I2JA 1SV5A 1HYSA 4KLIA 3L3UA 4O3OA 3DRSA 4RU9A 1KFDA 4RT3A 4CFAA 2BPGA 1HMVA 4ECTA 3PX4A 4IR1A 4RPYA 4CJ3A 2QKKA 4QW9A 1SKSA 2GV9A 2YHBA 3H8WA 1T8EA 4IRCA 4O5EA 5J2DA 2NRWA 3ZSZA 5BOMA 2EHGA 3TANA 1KLNA 9ICHA 4Z0UA 4PUOA 3B0YA 2V4QA 4DSFA 3OY9A 2BPFA 4DMNA 4PHEA 1JLQA 3V6KA 4EZ6A 3RH5A 3DYAA 4EP5A 3AA3A 1NOYA 3KHGA 2AGOA 3UPQA 4CGGA 3LP2A 3KHLA 3AO5A 5EWGA 1KFTA 3ZT4A 2W9MA 1LWCA 1KSPA 3VQDA 4TUSA 3WNFA 4CFBA 4CF1A 2YHAA 2RPIA 1IKWA 3DLEA 4NM2A 3ZDEA 2HW3A 3O3HA 4F2RA 3B6OA 2ZUBA 5J2IA 3V9UA 2A1SA 2BGGA 2B21A 8ICPA 3CFOA 3RR8A 1RT7A 1D8LA 4K4HA 5L1JA 9ICNA 3V7KA 3P1GA 3OHAA 1WSGA 4Z4FA 1S1WA 3ZSQA 4F3TA 4F4XA 5E41A 3HPOA 2X78A 4DSKA 3QESA 3LP3A 1S1VA 1RDAA 3WNGA 3V9SA 3ZSYA 3KIOA 3M8SA 3DOKA 4DTRA 3IM1A 4TQRA 5HBMA 1S1XA 3UXPA 1RBSA 4M6WB 1QSYA 1XHZA 5KFXA 3G0ZA 2XGQA 1UA0A 4KLUA 4QWAA 8ICQA 4FJ7A 1VSEA 1LAWA 4GC6A 4DLEA 2ZUCA 2FMSA 1ZQEA 1MQ3A 4ECZA 1WAFA 2IA6A 1BPDA 3OYGA 4R66A 4JWMA 3GIKA 3LZJA 1IXRA 3OYDA 1MC8A 2UVVA 3SUPA 1WN7A 2AQ4A 5JS1A 3PX0A 1HNVA 3V1OA 3A2FA 4QZFA 4W5QA 5J2GA 3C23A 4YMMA 3SJJA 1UAXA 4CHQA 3HK2A 2PFQA 1QE1A 4YR3A 4F50A 3RB4A 9ICJA 3K58A 4DTNA 8ICOA 4RQ8A 4FK2A 4O3PA 5C24A 5J29A 4CEBA 2FBXA 3TAFA 3FYHA 5DG9A 4UBBA 3T5KA 5KFKA 2E4LA 4CHOA 3IAYA 3Q8QB 3RB6A 3NF9A 1U9LA 3SYZA 5FROA 3JSMA 2OYQA 4C8NA 3EWAA 4P4PA 2JEJA 1BCOA 3OYKA 3QZ8A 4E1MA 5KFSA 1T05A 1C0UA 3RH6A 4K4GA 1X9WA 3T5HA 1GOAA 4X5VA 4RW6A 4YXMA 3VQ4A 1TK5A 2YNFA 3C95A 3L2QA 3AVFA 4BDYA 5KFGA 3QEXA 4UB3A 3PO5A 3DLHA 1Z00B 4DFMA 4DL3A 5HROA 2AJQA 2OA8A 2VG5A 3FDSA 1I3AA 3RB0A 9ICVA 3UQ2A 3O3GA 1ZQWA 4YG2A 5KG0A 1GOCA 1HJRA 4DTOA 1BPEA 1L3UA 4C8MA 2XO7A 9ICUA 3MBYA 3OYMA 4NLZA 1NK0A 5J2CA 4F4WA 4FLUA 1RT1A 1ZBLA 3MGHA 1ZQCA 4PHPA 5KFCA 1RZTA 1HQUA 5KFLA 5L1IA 1TAUA 3IRXA 4KREA 5DBAA 2VWJA 4ECRA 4AHUA 1ZQZA 1JLEA 1ZQIA 4EZ9A 1EX4A 3VQQA 7ICPA 4IQTA 4W5OA 4O3NA 5J2AA 3PY8A 3ZT2A 2JZBA 1B22A 1N56A 2Z1JA 1XI1A 3KLFA 1YTAA 4I2BA 4R5PA 4AHRA 4IFYA 3QNOA 1JLAA 1ZQSA 4K4IA 4K8ZA 1T03A 7ICRA 4DWIA 2P5GA 5FDLA 1RT2A 4AH9A 2Z1GA 4P2HA 4MEXA 1I39A 1Q8IA 4O4GA 2KFZA 3LP0A 2A1JB 1SL1A 2DPIA 1C0TA 7ICQA 3QZ7A 3V7LA 1U47A 4NLKA 2WTFA 1KVCA 4F5RA 1YT3A 2MUTA 3OS0A 1WLJA 3QNNA 4I27A 5CHGA 3T5JA 4CF2A 3BQ1A 2XY6A 4N56A 3ULDA 3ZDCA 4M9HA 3ZT3A 3U6FA 4EP4A 1G15A 3QLHA 4MFCA 8ICVA 4P4OA 4J9NA 4QWBA 4J9SA 2PXIA 4DS4A 4LSLA 4J9RA 4O5CA 2KZ3A 2F8SA 4GLXA 4XA5A 3RJJA 4N76A 2P5OA 1WAJA 4YP3A 4M3WA 3QEBZ 4CEQA 5DB9A 1RTIA 3L2RA 3VQ5A 1BPYA 3H8JA 5DB7A 2WONA 3K4GA 4RNOA 1UT8A 3LANA 5CY4A 5DKWA 4MFBA 2R8IA 4JS5A 1JL1A 3ZT0A 1SKWA 3CG7A 1FKPA 4QWEA 4R64A 2IHNA 2OZSA 3PNCA 5CZ2A 4CEFA 3PMLA 1NOMA 4CJ5A 4CJSA 3S9HA 4H4MA 1H38A 3AO2A 3OS1A 5FRMA 1LAVA 1ZQLA 4XUSA 1W0HA 4OPJA 1L5UA 1B43A 4F91B 4FYDA 2KW4A 4M3XA 4KHWA 4UBCA 4PGYA 1TKDA 1S0OA 4CF8A 4YFKA 4KLTA 4CHNA 5EOZA 7ICVA 2YNGA 2Z1IA 3AVGA 4KPYA 3MR6A 2HMIA 3JPNA 3OYHA 4J9PA 3SQ4A 3RMCA 4EYHB 2W42A 2W8LA 2IOCA 1ZQQA 4CE9A 2UVRA 4Z4EA 4O3SA 2A1RA 4KLDA 4KB1A 3WNHA 4M6WA 5KI6A 4KO0A 2Z1HA 3G6XA 3MXMA 3KKSA 4DLGA 5J2MA 2BQRA 4FBTA 3OYFA 4QZDA 1VSIA 5KRTA 1HNIA 4MF2A 1C7YA 4RNMA 1KRPA 2C2EA 4ICLA 2W8KA 5FRNA 2XY7A 4QZGA 5KG3A 1RTHA 4M9LA 3I0SA 5J0XA 2F96A 1SKRA 3ETLA 1TK8A 4RQ1A 5C5JA 1XSPA 5KG6A 3K5OA 3NHGA 3V9WA 4AHTA 2VWKA 4BWMA 3CM6A 4FLXA 5KT4A 2BCVA 1TL1A 4PPXA 1RT4A 3BJYA 2D0AA 4M2YA 1S1UA 4ZTFA 1Z3EB 4CEAA 3SPZA 4M9GA 3RH4A 8ICJA 4F5NA 1HYVA 4CGJA 2ETJA 4Z4CA 4EBDA 2LSNA 1Q9XA 4FJLA 4CJWA 4OPKA 8ICZA 2FPKA 4I2HA 3AO4A 2ISPA 3DMJA 4Q0BA 5KGWA 4CGHA 3OJSA 4HCCA 4CF0A 5D46A 5IILA 4DF8A 4RQ7A 1FK9A 1YVUA 5KFQA 3PO4A 1NJZA 2D0CA 2DFLA 2ZE2A 1NK8A 3QO9A 3V4IA 3RJHA 2R8HA 4Q43A 3JPSA 5J2BA 1BQNA 4ZHRA 2OPPA 1Z00A 2YKNA 4QZIA 4CJ4A 2W9CA 3EW9A 4KRFA 1UWBA 3SZ2A 3T3FA 5KRSA 3SUNA 4PY5A 4K8XA 3AO1A 4CERA 4CJRA 5IINA 1ZQTA 1XC9A 1BIUA 2LYHA 1BCMA 3QEWA 4E19A 9ICEA 4O55A 1X9SA 4I2IA 1NK7A 3L2UA 1NOZA 2KN7A 2PFOA 5KTQA 5DQGA 3VQCA 5IIJA 3RRGA 1ZQUA 5KFAA 3HW8A 3ZSOA 4M0AA 7ICNA 2F8TA 3MR2A 4E89A 3M9OB 3LAKA 4CJFA 4OLBA 4BWJA 1WCLA 4G3IA 5JUMA 4ED6A 3MECA 1X9MA 3LWLA 3C6TA 1RDCA 3G6YA 2IAJA 3SUOA 5HMLA 3LK9A 3OYBA 2YV0X 4FJJA 4LH5A 2BCUA 3S3NA 2KFNA 2FPMA 5SWMA 4C8LA 5J2QA 3HM9A 4QWDA 4EEYA 4IKFA 3SI6A 4NCGA 3V1RA 3H08A 1C1AA 5IIIA 4YD1A 3SUQA 1B9FA 3OYNA 4DFPA 3OYCA 1A5VA 5CA7A 2ATLA 1BHLA 4Q44A 4GW6A 4Z6CA 4FJNA 5DLGA 4DL5A 7ICMA 4J9MA 2F1IA 4RPXA 4I2AA 5J0YA 3PW5A 2X6NA 2P6UA 1V9PA 3ZSWA 5KT5A 2P51A 5D3GA 3HJFA 2ZJ8A 3C2KA 1S0MA 3JPPA 3UQ0A 1K1QA 3QEVA 1L3VA 1JLFA 8ICIA 1IKVA 5J0WA 3TR8A 5J0UA 2KTQA 4KHSA 1RCHA 3D0PA 7ICTA 1D8YA 1S9GA 4B9MA 2HHUA 4E7KA 8ICMA 4F5OA 5EU7A 4CJQA 5HP4A 4B9SA 1TKTA 3ALYA 3C1ZA 4BE1A 4QW8A 4CK3A 3LAMA 2G8FA 4ID1A 3UXOA 5KG2A 5CYMA 1JXEA 1HUOA 2BPCA 1S76D 5DDYA 4KTWA 5KFJA 4LY7A 4DTSA 2BGWA 4YMOA 5DG8A 4LZGA 1CZBA 4JV1A 2W9BA 7ICFA 1COOA 4XIUA 4B08A 5KGXA 2G8UA 3EZ5A 1QTMA 4B9UA 3TAQA 8ICGA 4QZAA 2OPSA 4FS2A 3M8RA 1S77D 3HP6A 1X1PA 4I2DA 1X2IA 3N4MB 4MFFA 4CGIA 1KCFA 3BDPA 4B3OA 1EETA 1R0AA 5IIMA 2JEFA 5KFEA 5KFUA 3HT3A 4DSIA 4DU4A 3H7IA 1S10A 3VN5A 4HUEA 3AVCA 4ECVA 4IG0A 4C8KA 4O5KA 2BCQA 3CYMA 2BQUA 4FM1A 4G1QA 3KKRA 4CHZA 3CFRA 1Y88A 3EYZA 1AROP 1ZQOA 4Q5VA 3L8BA 4KITB 1ZBUA 3KJVA 3V6HA 1KFSA 1ZQGA 4I7FA 3HXMA 4OLAA 4KI6A 5I42A 4HHTA 3L2WA 3KK1A 4JLHA 4CIEA 1ZQHA 5CR0A 3ZDAA 1Z25A 3NH0A 1HPZA 1L3TA 3V9ZA 1WSJA 1QSLA 4ED3A 1HQEA 1C0MA 4CEDA 1XSLA 2VANA 3AVBA 5TZVA 1JLGA 1BI4B 1QHTA 1XHXA 3T19A 2FPLA 1TAQA 4I2CA 4ECQA 4KTZA 4OKEA 3HVTA 5HMMA 4FK0A 5KFHA 3HP9A 9ICQA 1XSNA 4M41A 5C25A 1VRTA 3BGRA 3LPTA 1S9FA 1TV6A 3ASMA 3DLGA 4IQVA 3ZSXA 3LALA 8ICRA 4F5PA 5EWEA 2XCAA 4PHDA 1J9AA 5BPCA 4M45A 3D45A 8ICHA 2BANA 3LDAA 3MEEA 5J1EA 3TARA 4Z4IA 4DFJA 2M9NA 1BGXT 3TFSA 3G6VA 4UB4A 5DMRA 2ASLA 2EX3A 4DQSA 1SUQA 4DTPA 1CLQA 4CJPA 1ZQFA 1LWFA 4BDPA 5J2FA 4ELTA 4DTMA 2XY5A 3U3YA 5DLFA 1BISA 3QETA 3C2LA 5KFDA 1RYSA 1MU2A 3G10A 3UXNA 1EP4A 2GBZA 2E6LA 3HL8A 1J54A 3AO3A 4I9LA 5JS2A 1XS9D 4GMJB 1TV9A 1T7PA 4UAWA 4CCHA 3C1YA 4DQIA 4IDKA 4FM0A 4KLSA 1UT5A 4IBNA 2OPRA 1CXUA 4I2PA 3AVIA 5EWFA 2RDJA 1JLBA 4YVZA 2Y1JA 5HRPA 2HVIA 3RWUA 5DBCA 5BOLA 4KLJA 5J2HA 3AV9A 3NBPA 8ICKA 4LH4A 3C2MA 2O4GA 4CHYA 4FJGA 3DLKA 2JLEA 4AHVA 4Y1CA 3LPUA 2P1JA 1NKBA 4FJ5A 2BCSA 5HRSA 4HCBA 1S6PA 1D9DA 4KN4A 3MGIA 2V4RA 1RILA 4PWDA 4DS5A 1JN3A 2QK9A 5HP1A 4CEZA 3ITHA 3NFAA 2ASJA 4CIGA 1U45A 4N5SA 2ZD1A 3AA2A 4RQ2A 4KKOA 3H40A 1NJYA 4OVLA 3RMAA 1D9FA 1TL3A 5KT7A 4FVMA 4CGFA 3F9KA 4DQQA 1ZQDA 3E2EA 4CGDA 1TVAA 1S0NA 3ISDA 1HRHA 3MR5A 4OKJA 4KFBA 3N97B 3OJUA 4RW8A 4CECA 4RQ5A 4CESA 3IS9A 2FLNA 4YFUA 1S6QA 5KFIA 4FLZA 2RN2A 4M3UA 4ECYA 4BACA 2RKIA 3AU2A 3PMNA 4PH5A 1EKEA 3K5LA 4ELUA 3RBEA 3Q8LA 4FLYA 9ICKA 3C94A 4NY8A 2AU0A 3V81A 4GXKA 8ICFA 4F4KA 1ZBFA 2W9AA 4W5TA 1VSFA 3MAQA 5KG4A 3M9MB 4FCYA 4DU1A 3MDAA 3KLHA 3ISCA 4FJMA 4DTJA 2DTUA 2PI4A 4JV0A 3GV7B 3L2VA 4TUQA 4ID5A 3VQEA 1TKXA 1VSMA 3TAEA 5J0RA 1DTQA 4O9MA 4R8UB 1ZQRA 2PYJA 2QKBA 3KTQA 4GC7A 4M9NA 5HNKA 2F1JA 4M3ZA 3NF7A 1GOBA 1KVAA 4DQPA 4CK2A 3SV3A 1NJWA 8ICXA 4N41A 5K14A 2IMWP 4DL4A 4O5BA 2PFNA 3PW0A 1JXBA 1RBUA 4NM1A 7ICUA 4FM2A 1IKXA 1XWLA 5KT2A 4E1NA 4QZCA 2IC3A 3B6PA 4OGEA 4B9NA 4TQSA 3L3VA 4BE2A 1BPXA 5CJ7A 4F93B
chains in the Genus database with same CATH superfamily
2RT3A 1WSEA 3PUFA 1WB9A 2CQBA 4OYPA 1SC6A 3H0MB 3S6JA 1S5JA 3C21A 3KDOA 4JYAJ 3EE3A 3H3NO 3ZX3A 4YOVA 2BOAA 4BRMA 1K5OA 2M8DB 1S8OA 4NLWA 1YIJN 2P9UA 2ROGA 4BCAA 2B9WA 1QM9A 4UY85 3H90A 1LOUA 5EHHA 3JXUA 2P66A 1K9MT 2BHNA 3NS7B 3MMJA 3P5TL 1TUUA 3SSQA 2B4PA 2PFFB 2HNYA 2BJ8A 2W3SA 1WSFA 1C4CA 3HSDA 1XU4A 5HLFB 2ZOGA 2F44A 4CT9A 3Q24A 3UKRB 3SQIA 3RBDA 2GGPB 3M8QB 3ZDBA 5F8HA 1HNXK 1JLCA 3C7NB 2VBXA 4C23A 3AL0B 4JOUA 2BDPA 5GTHU 6FDRA 3IWXA 1CULA 3GJSB 1VRUA 2PAVA 2QWNA 1OYDA 4DV7K 3HO1A 2P6RA 1T3OA 5ALNA 2VJUA 4QR2A 1VFJA 2J8AA 3PIOQ 2I1QA 1OW5A 5AXNA 2D4WA 1VQ7N 3KUGA 5B5EU 3MFHA 5HVHA 1C0GA 2PYLA 2KOBA 1KD1T 4AILC 2NRXA 4CFCA 5KPTA 2GWJA 3PTWA 3VQ7A 3JPRA 1QCKA 4QOTA 1FRIA 1OVYA 2Y0SF 2ZITA 3F73A 1P6TA 1YRXA 4YY3K 2NLWA 1J5EJ 1YBUA 3BUZB 3V6DB 1NGAA 3ZD8A 1IBLK 4ZPDA 2JGUA 3CCJS 2XSJB 2JRSA 2IVPA 2EZXA 2C28A 3EXYA 4M94A 5LT5A 1XMBA 4C0OC 3GR0A 2ATQA 2HFVA 4H4OB 3ZO7A 4NRTA 4CM0A 4QZ9A 3IM9A 5LMNF 1S9EA 2N1RA 1HJOA 3K2PA 3O4QA 4WQ5C 4DR4K 1LFWA 1KEJA 3CJ1A 3QJJA 3AA4A 3U3GA 3VF6A 4DUYK 4AYBF 1UVKA 4GKKF 4DHYA 3HVAA 4WYBA 2FZCB 4JI4F 2UXCK 5DGBA 4NLGA 4DOAA 3O5TB 1EQMA 1VSKA 1U48A 3F2KA 4DQRA 2HEKA 3T6JA 1MMNA 4G65A 1LV5A 2V2ZA 3QT6A 2V4JB 3NASA 1Q95G 1DQAA 2F1HA 8ICLA 1ZS6A 3DHWC 3H5XA 3QMLA 3J7ZT 3I1YA 4M3TA 2VKQA 1RT5A 2WONB 3Q8SB 4KLQA 5ETNA 5KFVA 2DB1A 1ZQJA 4Y2RA 1DGSA 1XMOF 3QU4A 5ALFA 1VQ8N 4LSZB 4US9A 3OQ2A 4IG3B 4L3NA 1FWLA 2CQ3A 1RI7A 1FEEA 1EO1A 4NASA 4ISEA 3EPIA 2CAJA 4C6AA 2P9EA 3ZI4A 2P9LA 3QINA 3DDHA 1WKLA 3IKMA 1ZJMA 4HL9A 4R0EA 4K0KF 3SENA 4WFZA 1JJ2R 5IWAJ 3BSNA 1VQ8S 2J8SA 4CJLA 2FVPA 2BABA 4RW4A 3O1BA 2IRUA 3GQCA 1N5VA 2GW8A 4M7XA 2FUG9 2WAQC 4OCZA 1HJPA 1EB0A 4ZVEA 1VQ5N 2YWHA 3ET6B 3FBBA 4W90B 2AGQA 1F5AA 3HHKA 1UFLA 4CH1A 3GG4A 4FJIA 2VV5A 3IG1A 2E9TA 3MEGA 1WDDA 3QYPA 1HWJA 2J76E 1KQQA 2HHWA 4R8UA 3BKTA 2ITGA 1BE4A 1DURA 5TKWA 1HNIB 3CD7A 3I0SB 4ED8A 4DU3A 5EE0A 4CM2A 5ALTA 5AK3A 1IWAA 2A41A 1LEOA 3QATA 3OHBA 2R2TA 4WTOB 2HGMA 3D3BJ 3N7PD 1ZBSA 9ICGA 8ICSA 5AR0A 2CRXA 1MWQA 2BE2A 1NGCA 3IDHA 4KHNA 2E5JA 4YS2A 1NK6A 3RAQA 2HBZB 1M1KO 3KLIB 1U7LA 2XC9A 4PGQA 3THXB 1T3VA 1S79A 3D5MA 4CWBA 3MN7A 1S57A 4FLWA 4Z6EA 2ODGA 4PEOA 5J8YC 3U1LA 3DRPB 3W8GA 4BC4A 4TU7A 1CRXA 1ESVA 5D4LA 1MDUB 3OXLA 1NK4A 4JKCA 2V69A 3VC8A 1N0UA 1ZETA 4YNQA 3O80A 4WE1A 2VU5A 4EBCA 3AUOA 2XQCA 3GCWP 3AB2B 4UW2A 3T79A 1NGIA 3ED5A 4BVOA 4RQ0A 1MWZA 5HQLA 1AQ6A 2WSFC 3HPGA 4FN5A 5CB1A 1H73A 1EIYB 4XTTA 2WFAA 4ECUA 3QWUA 5HLFA 2WK4A 1G99A 3UKRA 1BQNB 2GGPA 3M8QA 5HRNA 5J0OA 2LMIA 5A2QU 1ZQXA 3C7NA 4C4SA 1BNOA 2IS3A 2Q0UA 2LCWA 3VEOA 2R8KA 3VR1A 3D1HA 2C2RA 5CE3A 3S8SA 4KAZA 3AVLA 3RUBL 4LFBJ 1IJFB 2POKA 3VVUA 1YVFA 2ZBIA 5FJ4A 1YWXA 2LXUA 4I2EA 9ICIA 2O8FB 4HTLA 2WVEA 5L39A 4IQUA 1G7CB 3UNGC 4KHQA 4CP5A 3TKAA 1SJFA 2BM1A 3AVAA 2OEJA 3V2UC 4YUDA 3ISBA 4OX9K 1Q46A 4E7JA 3H1VX 3K0JA 1YTUA 3RJEA 1ZQPA 3V6DA 4KH1B 5AI9A 2FZKB 3QUTA 2HVHA 4O3QA 1UFWA 2CA9A 3MAHA 5H9FK 2BBEA 3PEJA 4ECXA 1KOOA 2LM4A 3J7YU 1VISA 4H4OA 2DNQA 1T9XA 5DB8A 3VEZA 3KVGA 4A61A 2XS2A 3DU5A 3R8YA 4B8AB 4P10A 1KQSM 1VMBA 1YTYA 2GOLA 4JI2F 5D15A 3I5CA 1GX6A 1TK0A 4J9OA 4CZIA 3Q8KA 3PX6A 3A5NC 4ZJLA 5DB6A 2IIRA 2DISA 2PEHA 1JMSA 3TAMA 1SZPA 1KN5A 3PIPL 3UCGA 5AQGA 5KFYA 4HACB 3LWMA 2E88A 1L3KA 3HX0A 5KFFA 4Y2CA 1QZ6A 2V4JA 4DV7J 4X66F 3RTVA 5DDRC 2G0JA 2X6SA 4QZBA 2E5LK 4YCXA 2DGTA 5GAHI 3KWGA 1W9HA 3AH6A 2D7SA 3HYFA 4UZCA 1YJ7A 4C4TA 7ICKA 2YWFA 3ADAC 3PSTA 2HGLA 2JHEA 5AKKA 1IBKK 2ALZA 4RNFA 3KLVA 2PD1A 1CLFA 4IG3A 4LIRA 2MA1A 2HF4A 4QIFA 1ATRA 1RAHB 2W01A 3PR4A 4FPRA 1MQ2A 4YY3J 1S1VB 2OPSB 1SH2A 4KHPK 1UQVA 1IBLJ 4BR7A 4JV2A 2MQQA 4ZCKA 1S99A 4B8CA 4LSNA 1Q79A 3TABA 1SAZA 1W2BR 1YI2N 3UDVA 3M6VA 3NGRA 2ZNYA 3C65A 4F26A 2G13A 1VBKA 2HRTA 3CJBA 4IJAA 1ZQBA 2XULA 3DDKA 5AK5A 1PJ7A 4IG0B 2PZSA 1VQSA 3QAEA 3ICXA 4G1QB 4PCQA 3NCIA 3NNAA 2GJIA 1XNRK 1FJ7A 4DUYJ 5K8MA 4QZEA 4DSEA 3DDIA 4LMZA 2JZ5A 2B8PA 3GBTA 4BR5A 2HHHK 4LVSA 1HBUB 3FZ2A 4JKBA 5H1SV 1CUKA 3Q8UA 2KKPA 3I6PA 3S3MA 3T1YK 4KLEA 3BREA 2UU9F 3SEOA 1BD6A 4M3RA 2ZJ5A 2E5HA 1DGKN 4KBIA 2ZUDA 1PZNA 4KLFA 3FJ2A 4LJMA 2O8CA 2E5IA 3JSMB 5CWRA 2J0WA 3MM7B 2E5GA 3E3XA 1RDFA 2Q6CA 2Z58B 1SQEA 2HSEB 1JB0C 3KLIA 4ZVQB 4YOYA 1T05B 3THXA 4RW7A 3THVA 3BQTA 7ICEA 5K5MA 3DRPA 3ID6A 4YORA 2GIQA 3K5NA 1SJRA 5F9LA 2FGCA 2KQ2A 2E1FA 2ESEA 4URGA 4OHYA 3KXDA 3VENA 4B1XB 1GT8A 2Y0BB 4JWNA 3HSJA 5JMVA 5IC4B 3GILA 2HMXA 4CLTA 3TAPA 4DX6A 2ACMA 1DGJA 3FEYB 4DV5F 2DVIA 1L3SA 2GHVC 4ZIWA 3OGUA 4LFCK 4MK9A 2KHOA 5KG1A 4FJXA 2DFEA 2P9IB 4CDGA 2O8EB 1RHMB 4QZ8A 1S4EA 2G5IB 4CIFA 5DBBA 4J2DA 1HQUB 2H9ZA 3HSZA 1LW2A 4BRHA 2CKWA 2PFDA 5LJVA 1TVRA 3C14B 1PVPA 2UUAF 1PVRA 1F44A 1ZBIA 2G1DA 1RDBA 4OX8A 5AQFA 4PYDA 1NK9A 3OFHA 4E7HA 2JZBB 2MMYA 1V6HA 3U9ZA 2O8FA 2VFSA 4RUBA 5HHHA 1WNSA 3M8PA 1TUWA 3HHLB 1JLAB 1KAXA 5AQNA 1JLBB 5FDLB 4U95A 2CPDA 1KBUA 3OHRA 2GUIA 3I4HX 2QXFA 3LPEA 3B4MA 4CBWA 1LVHA 2RQCA 5B0EA 2NREA 4B6JA 3G96A 1NUEA 3JQMA 1FW6A 2OAUA 1FXXA 3ZNJ1 2R7VA 1UCNA 3SI8A 4J8FA 2NRVA 4JKDA 1F5SA 3CCRN 1WSIA 2B0CA 2MUTB 3MR3A 5J2JA 4F72A 1VLBA 3DRSA 5M1PA 4RT3A 2ZC3A 4CFAA 2BPGA 2QG9B 2HYIB 5EX0A 3BSAA 1DQ9A 2EG1A 4CJ3A 5J1NA 2OUGA 2GHPA 4H5TA 2A1AA 1X42A 1REGX 2WUSA 2M0NA 3MMVA 1EWRA 2W1BA 3DGPB 1TL3B 1VDVA 3GSDA 2XSFA 2KVSA 3UVJA 5FPDA 2QA4N 3KZIU 3OY9A 4BC5A 1WF2A 1E3MA 4PHEA 3RH5A 3ILOA 2P8IA 1GO3F 3KHGA 1KOHA 3UPQA 1A6SA 4DDFA 3KWMA 3ZZPA 5A76A 3ZT4A 1VK3A 2RKIB 1FKPB 1VQ6N 1HARA 2BTFA 3ZX2A 4BC7A 1KSPA 4TUSA 4DR6K 4BROA 4DV2J 3WNFA 5EOYA 2C3MA 2YHAA 2RPIA 3ZTPA 4NM2A 3SCIE 3ZDEA 2D74B 1VR6A 1WF1A 3B6OA 2E29A 3I28A 3MPDA 3UR3C 4JAXA 2PFUA 2A1SA 2BGGA 5AM1A 2B21A 3WKBA 3MOJB 8ICPA 3RR8A 1OPIA 4IC9A 2X1BA 1UZHA 4PHTX 4WKYA 3GE1A 2VFVA 1U09A 1ZM2A 2H3QA 4IOXA 4F0KA 2PE8A 4WFBQ 3TOQA 4OX9J 3HBTA 4FPAA 1N62A 2OTLS 2IPOB 1QQNA 3LP3A 1S1VA 1RDAA 3ZSYA 3KIOA 5A8KB 3VF4A 2VZ9A 3A8IA 4TLRA 4DTRA 3IM1A 4TQRA 5G5GA 3UXPA 4NZ0A 2VHGA 2OTJN 2HBRB 1XHZA 2OH2A 1RAFB 3CCTA 5H9FJ 4K4XA 5K14B 3U1MA 1Z05A 1UA0A 4USTA 4QU6A 1LCUA 1YJTA 1VSEA 4DLEA 1RG6A 2NQPA 4ECZA 3VEVA 3S7RA 4JWMA 1HNZF 2ROPA 5GAGP 1IXRA 3O2IA 2OTJS 3MX2A 1D8ZA 1Z4UA 1HNVA 4IJNA 4YMMA 3CJ0A 3AARA 4BRNA 4MIBA 1F1BB 1S1UB 3NVKA 5A8RB 4NL5A 1HLUA 4IFEA 2PFQA 3RB4A 3CC4S 1M90O 2YHWA 1NCLA 4DTNA 2VQEF 2DUYA 2ZWOA 2FPHX 2QGFB 3TAFA 2GFFA 1FTRA 3KYLA 5M1KA 4DUZF 1RP5A 2E5LJ 5JJBA 5KFKA 3DDNA 4V1Ak 3BN4A 4Q0BB 1VQPS 3Q8QB 3NF9A 3SYZA 5I3UB 3JSMA 1SC4B 2IM3A 3EWAA 4P4PA 3MM7A 5B0AA 2GC8A 3FC4A 2RS8A 4DCJB 2LEBA 4E1MA 2K2PA 2IBOA 1D1UA 5KFSA 1T05A 4OHZA 1IBKJ 3RH6A 1X9WA 2O3DA 2YMPA 3T5HA 1GOAA 3QNMA 2YB4A 4KIAA 2K3KA 1HNWF 5HK4A 2K4IA 1DT9A 1PK1B 4CJ7A 2GVDB 4KHPJ 4RQMA 2JH3A 2DWQA 3PO5A 3DLHA 3RW6A 2CQDA 4X64F 3ZX0A 1I3AA 9ICVA 3L0QA 4WYWA 3EN9A 1ZQWA 4B3RK 3I4PA 4KHMA 2QMXA 2G0AA 2MLXA 2IVYA 3EL2A 3W2VB 1L3UA 4IL6U 5D0GA 9ICUA 2XS5A 3DRYA 1NK0A 2GELA 2ZJQQ 1OSDA 3BV8A 3HT0A 2P9IA 1JKHB 3L95X 3D28A 1FEZA 1C0FA 3FR0A 3MGHA 3O4WA 2MU2A 3SK3A 5DO2A 1UL3A 4PHPA 1RZTA 5LSRA 2Y1RI 1HQUA 1XNRJ 1PVQA 2AEMA 3BY5A 1TAUA 4KREA 1D0EA 3GMGA 1R89A 2VWJA 3RU0A 2HHHJ 2P9GA 2FI1A 2IAJB 3VQQA 2FHMA 4JI5K 1N60A 4OJGA 4H5NA 5J2AA 3T1YJ 2E9RX 2JZBA 2BKOA 1MWYA 2Z1JA 2H4YB 5J2QB 4R5PA 4LF8K 2G1HA 4ZP8A 2OEHA 3HHLA 1QY7A 1JLAA 4LRBA 5CXTA 2VCPA 5BPNA 4UAUA 2P5GA 5AE3A 5FDLA 5LXYA 3D2EB 2Q36A 3ATVA 4AH9A 2Z1GA 1I39A 2EXUA 4QIVA 2AT1B 4O4GA 3WKCA 3PZPA 2BV3A 5D4NA 3H2LA 2VQFK 2JLGA 2YPZA 2DPIA 1U47A 2WTFA 2EKNA 1OY9A 1V4TA 2MUTA 3QNNA 3T5JA 2WOMB 5G4DA 1Z6RA 1JLFB 1KLMB 3SDEB 4YOXA 2JV3A 4EP4A 1IKVB 4MFCA 3CCLS 1HHSA 3P38A 2MKHA 3H0LB 2QN6B 5A6WA 3AGRA 4QWBA 3H25A 2L9WA 3FZBA 4J9SA 3DRRB 3DGPA 5ADZA 3DKDA 1TKTB 4O5CA 5BRFA 4MKVA 3O3LA 4LFCJ 2BACA 2P5OA 1WAJA 4M3WA 3R3TA 1G1XA 4XEIA 2A0FB 3MZIA 5DB9A 4G1PA 2VFTA 1UVIA 1NGBA 2QWOA 1M0SA 1Q86T 5CY4A 3L4PA 1F5CA 2QWPA 3PRDA 4JS5A 4O4RA 1FKPA 1AW0A 1R31A 1X4GA 3UKUB 5LJWA 3CCSS 2DNHA 1ZQLA 3EDQB 3U1NA 1BUPA 4CH0S 3BBFA 2PGCA 4JI3K 2OM6A 2HFOA 1RA7A 2EK1A 1Q16B 4KHWA 2KV2A 4UAVA 2N82B 4FWMA 3DC2A 4LRCA 4KLTA 7ICVA 4OHWA 4B3OB 1EETB 3NMUA 3LM9A 2PSZA 4TKTA 3IBWA 1FA0A 4PL7A 2FJDB 2Q43A 2U1AA 1KP6A 3MR6A 3SQ4A 2FHJA 2KJ5A 4EYHB 2IOCA 3LO3A 5A8KA 2KU7A 1NM2A 1TELA 2BX6A 5EN1A 3ZZYA 4O3SA 2JH7A 4M5GA 3K0SA 1JMTA 2N4CA 2Z1HA 2IOFA 2VPWB 1ZRNA 3FQKA 4DLGA 2BQRA 4MN4C 1VSIA 1F9HA 3D6JA 5FRNA 1CQMA 2XY7A 3C16B 3Q86A 1U1KA 3CIMA 2B7CB 4M5DA 1KC8T 1NMEB 2K60A 3CC7S 1SKRA 3ETLA 4CT8A 5KG6A 3NHGA 2RQ4A 4FLXA 2BCVA 2C2MB 2ZBQA 4UQTA 1QD1A 2ZH1A 3BJYA 1AYEA 4U8YA 1T94A 1S1UA 1WWUA 2GV1A 1Z3EB 4CEAA 3RH4A 1A7GE 5AXMA 4F5NA 1KQKA 4DR6J 4EBDA 1YGYA 1N36J 4JKGB 2GWKA 2H5JB 4ZS6A 3E9LA 4CJWA 1YJWN 2FJBB 2FPKA 4I2HA 4DV4F 4Q0BA 4MO5A 4CGHA 2BANB 3EE8A 2LM1A 2FDRA 5D46A 2JDJA 1RU2A 1WC0A 5GINA 1W2IA 2OPQB 2RUGA 2GAHC 1NU4A 1AFIA 2DFLA 1RFQA 3RVCA 2UUCF 1K9MO 1U1LA 4OYMA 4JI1F 1UPMB 1PK1A 2BW7A 5HATA 5ALZA 2LDYA 5J2BA 4TY8B 5AQJA 1S12A 2G2ZA 2Q79A 4Y65A 4CJ4A 4ZVGA 1WI6A 1JJ4A 1N33F 3T3FA 3QJLA 5H9EK 1EP4B 2WSEC 3OBYA 2YY6A 1X3NA 1HL6A 3QEWA 3C8YA 4CO4A 3AN1A 5F3ZA 4GVLA 4ZN3A 5ETRA 2OYYA 4ZVRB 1NOZA 5KTQA 3M6UA 5IIJA 1RISA 3LL3A 2F8TA 4BC2A 4E89A 2OPRB 4ES2A 5H1SQ 4CJFA 3G25A 4BWJA 2V67A 4C0ZA 2ZBRA 2ZIUB 3EUNA 1UVNA 2AEJA 5ELZA 2CYYA 3T69A 1NH8A 4JI0J 1K0TA 3NBPB 4OX7A 3PM9A 1RDCA 3D2WA 3AMZA 2IAJA 3SXLA 1KD1O 3OYBA 4B3MF 3DLKB 2CGKA 2BCUA 4A8SA 2KFNA 1VCTA 3ILIA 4FWLA 5SWMA 5J2QA 2P9PB 2W2PP 4EEYA 2MZ1A 3SI6A 3JS9A 5AXKA 1MG7A 3QIPB 5IIIA 4YD1A 2KVQE 4WYLA 3MDQA 5GMKa 3OYCA 2DH7A 4JV5K 3D2EA 4Q44A 3H42A 4GW6A 2GH1A 2DNPA 4WXOA 5ETLA 1S7IA 4J9MA 2F1IA 2ZXIA 5LMUK 3QFPA 2XLKA 5BPLA 5F3XB 1FJGJ 3ZSWA 3DLJA 2EFGA 5D3GA 3HJFA 3GFZA 5E3PA 3THPA 3WHIA 3QEVA 2BYCA 1JLFA 2EFPA 3DLLL 3IS9B 3SDEA 8ICIA 1IKVA 3PYFA 3CO0P 3TR8A 5J0UA 4PG4A 4I6YA 4KGXB 4OIXA 1D8YA 4B3RJ 4UB6U 3OL7A 5AQRA 3IR6B 3CIPA 5BN9A 1TKTA 4BE1A 5C2GA 2DGZA 1P8ZA 5HN0A 4QIEA 1F5BA 3LAMA 2G8FA 4FXVA 4OJPA 3GYNA 1JXEA 1HUOA 2GO8A 4RUHA 4I64A 3TVYA 3W8PA 1P9QC 5KFJA 2DXDA 4LY7A 2Q66A 4DTSA 4YMOA 4Y2VA 3WK9A 5C10A 3CB4A 4CTAA 2W9BA 1KAZA 4FYXB 3R1XA 1ZH5A 3UKUA 5KGXA 3CO9A 2D3UA 2AH5A 3J7ZO 5AQKA 2XMWA 5F8LA 3UDCA 3TAQA 2MDAA 5GAHU 4QZAA 4JI5J 1GLFO 2MQ8A 5ALVA 1J27A 4NXNJ 4BGAA 4I2DA 4LF8J 4Q2LA 4A46A 1T95A 3N4MB 5CCLA 4MFFA 2CNOB 4DPTA 4B3OA 1EETA 1UVLA 1TUYA 4CQ1A 3TSUA 1R0AA 3Q22A 5G0RA 3DEEA 1LNQA 1IKXB 5A8WB 2ZKTA 3BQ7A 1H7XA 2VQFJ 4LF6F 3HT3A 4DU4A 2DNYA 4DR7F 4C8KA 2BQUA 2E2PA 4CZKA 4FM1A 3KKRA 4TU9A 4L3QA 3E9PA 4H0VB 3EYZA 4H5WA 1AROP 1ZQOA 3KJVA 1KFSA 1ZQGA 3G8QA 3G86A 1VQLS 5AQZA 4YHHF 3J81j 4NLUA 3C16A 1FVSA 4CIEA 4DX7A 1Z25A 3V9ZA 1WSJA 1B7YB 2GQQA 5C0YA 2VKZG 4IOBA 3AVBA 1UKUA 5TZVA 2RS2A 1OH7A 1WHXA 4JKFA 3T19A 2FPLA 3TA0A 2HZCA 2NLXA 4I2CA 1S1TB 2M0GB 3S6EA 5EY4A 5LXRA 2I5HA 4OKEA 4M5IA 1YQHA 3AAQA 9ICQA 2W3RA 1XSNA 3F53A 5IT9O 2RQKA 3LPTA 4AQYJ 5A0YB 4FPBA 2YKMB 3G4SS 2OHFA 4JKGA 3H5SA 4F5PA 4GY2B 5EWEA 1SIJA 2XCAA 3NP5A 4RBVA 4PHDA 3AOCA 2AYBA 1J9AA 5AK4A 4JI3J 2HMPA 2BANA 5AM5A 3MEEA 4FYVB 2KJ8A 5FLXO 5GAGI 2H3FA 1UP1A 2KHQA 5J1EA 4OJ1A 1FVQA 1BGXT 3FSYA 3TFSA 3AFGA 3UCUP 5CQGA 4FVUA 4UB4A 4ZPBA 4DQSA 1SUQA 2K8CB 1EWQA 3BPDA 1ZQFA 1SC1B 1RM6C 2LQ8A 1HWLA 3W65A 2XY5A 4JHDB 3U3YA 5DLFA 4Y2YA 4HI1A 3NWGA 3C2LA 2CZVC 3TR5A 4ZMMA 2HBLA 2VPXB 5KFDA 4LR9A 2HQIA 2O8DA 3UXNA 1I51B 1EP4A 4PKGA 2E6LA 3LM2A 5FPMA 2MJUA 4I9LA 1FERA 1N5TA 2YWEA 1S48A 4DV3F 5B0DA 1N4LA 4DV6F 2HKEA 4OYAA 4K4UA 2HLUA 2MEWA 2K1RB 5EXWA 4WZQA 2OPRA 2WMMA 4GRSA 1R43A 2RDJA 3EGWB 2AP1A 4YVZA 3L7PA 2GMJA 1M5KC 5HRPA 2ZIUA 4H0XB 1RWVB 3GDQA 3RWUA 5DBCA 5BOLA 1T3QA 4KLJA 2Z2YB 3AV9A 4BRGA 1MN9A 3NBPA 1SH0A 3PRVA 3LVWA 3ULHA 4LH4A 3JB9k 3UW1A 2O4GA 3DLKA 5C12A 2JLEA 6FD1A 2AF6A 3L5KA 5IQQA 3KDNA 2PT0A 5D78A 5J1PA 2V50A 2DXEA 3RG6A 4KN4A 1JN3A 2VUGA 3OW2R 3WEEB 3EVOA 1SZ2A 5LL6Z 1ACMB 5LMNK 3H40A 1NJYA 2EWHA 4OVLA 4RO0A 2G4BA 5KT7A 2GMLA 4EFAC 3F9KA 4IH7A 2WF9A 3E2EA 3P3DA 1HRHA 2B43A 3DV9A 3N97B 2AJ2A 4GKKK 4CECA 1DK3A 4JI4K 1WKJA 4RQ5A 4CESA 3IS9A 2FLNA 4YFUA 5KFIA 2RN2A 4ANCA 3ZNUA 2UUBF 3F56A 3UNYA 3AY9A 2X1FA 5A2QO 2RF2B 5H9EJ 3AB4B 2H3GX 4FLYA 1ZPWX 2ZC4A 2NUUG 1NLVA 2AU0A 3GZ7A 8ICFA 1TL7B 4F4KA 2VJVA 2W9AA 1HIWA 4P2FA 4LF2A 1XNQF 1RBAA 1Y9OA 1M5OC 3ISCA 5AKIA 1XMOK 4DTJA 2NZ4A 4OHVA 3FMWA 1TFWA 4BG8A 3CCQN 3C46A 3SCLE 3L2VA 1DARA 3AEVA 2L08A 1EKSA 5IFMA 4O9MA 3HHLC 2QKBA 2KB2A 3KTQA 4GC7A 3HD2A 4K0KK 1KVAA 2M70A 8ICXA 4X65F 5FP0A 4JV5J 4DL4A 1FKOB 1MROB 4NM1A 4Y2XA 7ICUA 2FIUA 4FM2A 1IKXA 3IN5A 1NGHA 2A3ZA 3Q8VA 2D9PA 2PKEA 1TL5A 7FD1A 4NLVA 2NPFA 2KJWA 3TX8A 3IUCA 5BRHA 4TQSA 2D8CA 1X9XA 3OBWA 3T9NA 2XTJP 4RQ6A 4EI2A 3CDWA 1GQEA 5IS2A 1HUZA 1C20A 3D66A 3R2DJ 3R27A 2QWLA 1VHIA 4MDAA 4K43A 2ZTEA 1CG2A 2B4JA 4P4MA 1NHKL 4IR9A 3E8OA 3GIRA 4D3GA 2N4DA 5KFMA 1T4GA 3OR2B 3KOAA 1KHVA 3JQJA 3KFUF 4BRFA 2BE9B 1S1TA 4LF1A 1U1NA 3MX5A 4DOCA 2F8KA 3HWTA 4URSA 3TWZA 2FVCA 1Y97A 4UB5A 2F77X 4YDDB 2Z4PA 3RW7A 4Q45A 4L8RB 1NHVA 4ZOSA 5AQVA 4FWPA 2YKMA 2HRUA 4RT2A 2DR7A 4GV9A 3QU5A 4LZDA 1VQMN 2QEXN 4JK1A 2ES6A 4ZJOA 4CIOA 3H7HB 2KKZA 4O3RA 1RQNA 2WBRA 1ZBHA 3PVXA 4OLOA 4CBUA 3SQ1A 4CJKA 2BCRA 2NO5A 1BG3A 2JWNA 5C42B 4TURA 5T7BA 2ZJPL 3KD3A 1CXQA 3CDUA 4F04B 1VQ4N 3JPQA 1UJ5A 1LWXA 1KTVA 2H1YA 3MABA 3ILLA 4XK8C 2HG4A 4QR1A 3MM6B 3VAJA 3D2FB 5KFRA 4FZZA 4LFAJ 1LB2B 4KLLA 3POTB 4EMDA 1OUQA 4JHDA 3FGUA 2DNKA 1VK0A 1K8KB 2KJVA 2ZWPA 2E2QA 2YTCA 1IBMF 1RXWA 2FJEB 2B9EA 3M1YA 1WSRA 3WU2U 1NDPA 4Z4GA 3GE9A 2FLOA 1HEKA 1T9VA 3GJQB 3RFAA 2VIXA 2KEYA 4EENA 3QEPA 4MLEA 2W04A 2QSWA 3HVWA 2UV8G 4HTJA 4NMLA 3HFZB 3Q7BA 3KHHA 3PYDA 4JB8B 4NA1A 3NVYA 4JS4A 4PHAA 1Q1KA 1OVQA 2DNOA 4OJLA 4Y2PA 4NLDA 4IOAL 3IRUA 5CEHA 2HGNA 4IQXA 1WEXA 4N8NA 1HBOB 2ZKUA 3D0HE 2YXLA 3R1LA 2BEFA 3PKYA 4GV3A 3MMAB 3E51A 4IQWA 1VQKS 2A1JA 3AVKA 2I9GA 1GLDG 4ED2A 4CJVA 3VAKA 4FJ8A 3MCOA 1NU0A 4FLVA 2MQPA 2X3GA 3DOLB 3N4WA 4L76A 1QHAA 1J53A 4BGDA 2P9SB 5AKYA 2XWYA 5J0QA 2CGJA 1WYGA 2QT7A 9ICWA 3WEEA 2VG7A 4JI6J 1JX4A 1VQ9S 3KHRA 2AJ0A 3W64A 4PA1A 1XNSA 3M1VB 5ALUA 5ALOA 5J2PB 4JI2K 2PO4A 5D6GA 1ZQMA 1ASVA 1SC3B 1W7WA 4JRPA 1YZ6A 3TQEA 2DRBA 2BH1A 2E44A 4J90A 4DI6A 3BR9A 3FFIB 5AQLA 1WWVA 1NPRA 4QJFB 4QCLA 3HSTB 2RF2A 2PC6A 3N4QA 1ZQNA 1YJVA 4FW1A 3NS6A 1SB3C 2ZFHA 2YHXA 4X66K 1RBVA 4FK4A 1YUWA 4KGZB 4JI7J 4USAA 1TL7A 4NEZA 4USHA 3MCNA 3AJ2A 4BJQA 3HI9A 4K4WA 1U26A 1ZQAA 1RWXB 4YMNA 2HQDA 2QJ3A 3LW5C 3W9JA 4IO9L 2R2SA 4MAKA 1X0FA 1OQ6A 1X4HA 3CM5A 4DR5F 3MM5B 1FJCA 1Z19A 3UMBA 2YX6A 2HBKA 4KLGA 3NMRA 4KO0B 2RHFA 2X74A 3NXZA 1F9FA 4CGZA 4USKA 3SCKE 3M3ZA 1XMQJ 4TVAB 2ZHBA 4AHSA 2H3VA 1RT6B 4ICLB 2JXJA 2XNRA 1RTHB 5CR4A 3CJ2A 3DOMB 2AV5A 3M4XA 4YOEA 1KVBA 1FKOA 1MROA 1RTJB 3C6UB 2ZM6F 2OHDA 5LMNJ 2YNIB 2E1PA 5LJ3Y 4AP9A 1SKUB 1FD8A 1ZC6A 2E1YA 1T3NA 1BDGA 2K8GA 1U1QA 2VA3A 3MAAB 2WFBA 3QRRA 2ASDA 4RNHA 3D67A 4DPOA 3CT9A 1IBCB 4GKKJ 2OGUA 4RNNA 3C19A 5ALDA 4IDHA 3D4JA 5I3QA 4HUGA 2NSCA 1ECWA 1DTTB 1FHTA 2D0PA 3PLAA 5HR6A 5I9EB 2FY8A 5HSPA 2D41A 3DMJB 2ISOA 2UU9K 2FZGB 2HRYA 2WSCC 3IP0A 3T6BA 3EXCX 1L8LA 3CERA 3VEXA 4G9ZA 4CLUA 5B8HA 4OYWA 1T9WA 1NHUA 4ECSA 2G8IA 5KQ8A 1FD2A 5AJ3F 3VTHA 1O08A 1S5LU 3PIPQ 2E8MA 1N6QA 2Z7JA 2I5JB 3V4IB 3F9MA 1I94F 1W97L 4O0IA 4M7YA 2ZH3A 1RAEB 3HPHA 4NLQA 4AL5A 2H51B 1Y7PA 3O9SA 2W9CB 2R42A 3KBBA 4LVNP 3BS5B 4J9UE 3TZYA 2HNDA 4DFKA 1QUPA 2IJRA 1ZQYA 3R5CA 5HVFA 5F8MA 3J80O 2E6MA 1G2EA 4CLLA 4K0KJ 2ZTDA 4I2GA 2AKWB 1RTDA 2P5VA 4B1VA 5C42A 3TSQA 4DV5K 1UETA 3TACB 1XR5A 1FFVA 5KFOA 3QBWA 1K6YA 3CC2S 3R1HA 2QWQA 3QU9A 1QQ7A 3MOZA 4YB5A 3MN6A 1RWWB 1RPLA 5T14A 4LF9F 3POTA 4N8OA 2ZQBA 1PBUA 1K8KA 4J2EA 2MHNA 1RDDA 3GYGA 2UUAK 5E5NA 1W7AA 1BPBA 2B6AB 3QDKA 3NF8A 1X4AA 2HOQA 3Q8MA 1ZA1B 2HIYA 1F21A 5L1LA 3ZZ0A 2ZBPA 1TUVA 7ICIA 5KFZA 4KHRA 2E2OA 2OZMA 2LEPA 2N3LA 1MLAA 1JIHA 3U26A 1ICEB 4LR7A 5CP2A 2KIVA 2VA8A 3EO3A 1JL2A 4FO6A 3MMCB 2B56A 2OWOA 3QQCD 1KBRA 2HWTA 3P4IA 1TKZA 1KKXA 4CI6A 4RQ4A 2LI6A 3F2DA 1U24A 1K0VA 2FBVA 1JLQB 1UW9A 3MMAA 2H5XA 8ICAA 3SMVA 2ROEA 3TPQA 3OYIA 4YD2A 2FF3B 2DHSA 5CH7B 4Y1DA 3DOLA 3VTIA 3DFEA 1XO1A 4MF8A 2W4CA 4BGBA 4DTUA 2V0NA 4O8UA 2LLZA 1Q5YA 1SIZA 1XO0A 4ZJQA 3O9TA 1QAYA 3UE2A 1Q7YT 2R7QA 3ENQA 4RQNA 4KH4A 5CYMB 3M1VA 3EY1A 1CJVB 4LBHA 3QE9Y 5J2PA 3CD6S 4WJ3B 2AGPA 4XDCA 4KMUA 3MDCA 4BR4A 1J2VA 3KD1E 1VI7A 5ETPA 2D3OR 3BF3A 3QFHA 4FJ9A 2D1CA 4FF4A 3O44A 3H6EA 1V85A 4C8OA 3FFIA 1QQCA 2QA4G 9ICOA 5BREA 2CJKA 3NVMA 2ZIXA 2DGWA 1WOPA 3DXMB 4LD0A 4CFDA 1S1XB 1J5EF 4M47A 1YKWA 1BL3A 4OQJA 2ITMA 1Q86O 2Z2LA 2K7JA 4MFAA 4PPZA 4NYPA 3OYLA 5AKJA 5HHIA 7ICOA 5DQIA 2CG8A 3ZSRA 3AJDA 3HM8A 2KICA 4OJHA 4IRKA 1NXIA 5JMNA 2C42A 3RR7A 1FKAF 3BZQA 3MM5A 4O44A 4EK2A 2DQNB 4M3YA 2HVEA 3L7OA 4I67A 2W7PA 1U2CA 4L6V3 2AXTU 2RD5C 2HAFA 1QE1B 1RT6A 1XQSC 2AA4A 2XCPA 3BEGB 2NXJA 3IAM9 4CHPA 4FYWB 4I29A 2HHXA 1RTJA 1NNDA 3C6UA 2B4UA 1KXPA 1JLGB 4PZVA 4GVMA 5JVHL 5FLXY 1LFPA 3MM8B 2YNIA 4X4PA 2WB1D 3IMQJ 4O0JA 3EGVA 3MURP 4WFNL 1HNZK 3PSIA 4F0HA 1XTZA 2M52A 4JI2J 4Z37A 7ICHA 3R97A 1VSHA 4C48A 3GIIA 2KZMA 1PIEA 1YITS 3HILA 2KYXA 3KMQA 4ZTJA 1KC8O 1X66A 4A57A 3MMBB 2FVSA 1RNHA 4JI8F 3ZD9A 1X9JA 1DTTA 3ETOA 3O8WA 2JWLA 2YNFB 1V3ZA 3WXIA 2XMVA 2RE2A 2VQEK 3PW2A 3A8YA 4PKDB 1XBWA 3KK2A 3I8DA 4E7IA 3I56N 4X66J 2ZZMA 4YN4A 3RJGA 4DUZK 3LOUA 3R6GB 4BDZA 1RAJA 5AE2A 4CF3A 2KN4A 2FMQA 4IO1A 3UPFA 2HS4A 1BA0A 1ZTWA 2AEFA 2I5JA 2J7UA 3H3OB 1D3WA 4OX6A 2E7XA 1ZYQA 3ZEUB 2GHWA 4F92B 4URQU 2AJ4A 3DRXA 4NMXA 3V7JA 2PMZF 1FWKA 2ATCB 4RW9A 4NLNA 5K9FA 1HNWK 3I56S 3BYPA 4FDFA 2XMKA 1YHQS 4I9QA 2X1AA 4BR9A 5HOOA 4RUAA 4X64K 3HF5A 2HS3A 5GAGU 2FHOB 3PYEA 1BPZA 4GKJF 1U49A 3RMBA 5ALGA 4JUZA 4CZEA 3KG4A 1JJHA 5KFPA 4Y2JA 3ZYYX 2XGPA 2QLTA 5HMZA 4GNIA 1X6IA 1A77A 3WK4A 2BVZA 3QT8A 3TAGA 2RHQB 1ITGA 4DF4A 2FC9A 3MPUB 3P5BP 1UZDA 1YJ9S 4QIWF 1KN6A 4J2AA 2LYBA 2YBVA 1YLXA 2W4PA 2BXJA 4YQWA 4YB1P 3CPWR 3LP0B 4EHTA 5GADP 3KMSA 3THTA 2DBBA 2B6AA 3WXKA 2HK2A 2ILYA 3BPSP 1H0HB 3TI0A 2KFYA 3RJKA 5A2QY 3QLHB 4IR1A 2UU9J 4RPYA 3R5GA 5ADXA 2GV9A 4FNIA 3R9LA 3H8WA 3ZXWA 4M63A 3LDPA 5J2DA 2NRWA 2CRLA 2EHGA 1KLNA 3US5A 3G8SA 4PUOA 3B0YA 2RMLA 2V4QA 2CQ1A 3CMEN 2LHTA 1HFEL 3UN5A 2BPFA 1JLQA 4EZ6A 4JP8A 4EP5A 3AA3A 1RTIB 3ATUA 2HDOA 5E33A 2AGOA 3KHLA 4PPDA 3AO5A 4PXCA 2HSZA 2K06A 5LJ5Y 2KSOB 3GL1A 2W9MA 3HHEA 1VBXA 2W54A 3HKWA 3P39A 1QAIA 2KVIA 2VWBA 2J7KA 4CFBA 4CF1A 1S72N 1D4XA 4CYUB 3LUYA 2HW3A 3O3HA 1JALA 2EFOA 1SZHA 4CLYA 2DO0A 4LFBF 1H1VA 3CFOA 3J81O 4K4HA 1D8LA 4DV5J 3FSXA 1RQLA 3V7KA 3BM7A 1CJVA 3W63A 3OHAA 3KLHB 2QB1A 3JAMO 2N3OA 2C2NA 3ZSQA 1UAWA 2YNGB 5E41A 1WC4A 2JVOA 1VYAA 2NPIA 5ALKA 5IT4A 1HLWA 4LREA 1S72S 2B3TB 3I55S 5BYSA 3QB0A 3QESA 1EQYA 3HZ6A 5L1MA 3E1YA 4A48A 2UUAJ 3WNGA 1DTQB 2NZCA 4A8KA 3DXMA 1S1XA 4KE5A 4FWRA 2P9CA 5J2MB 5C2FA 1H7WA 3O8MA 4KLUA 4QWAA 3D54A 3JS6A 2I9SA 4GC6A 1HW8A 1OH5A 4ES1A 1ZQEA 4A8XA 3ENHA 3NY0A 2J9DE 1WAFA 2IA6A 2EAOA 3OYGA 3EWGA 5E3AA 2LU1A 2A6AA 2GNKA 1IIPA 3GIKA 5HL7L 3LZJA 2WF8A 3OYDA 2K8BB 2Q1NA 1TL1B 1WN7A 3V1OA 1XERA 2B6GA 3UN2A 3G6ES 4I6MA 4DB3A 3AM9A 2QTDA 2GX9A 3HK2A 2FE9A 2KG0A 2P9UB 1QE1A 9ICJA 3K58A 2KT3A 3CCUN 4O3PA 5C24A 1GMVA 3AAPA 2FBXA 3JTOA 2FYXA 4ZPCA 4CHOA 4O8KA 1U9LA 3AQFA 2V7YA 5FROA 1UVMA 2MKJA 1FK9B 1R27B 1O13A 1VIOA 4A59A 2D69A 3IWLA 1C0UA 3KK7A 2I8EA 1JLCB 3CJ5A 4Y3CA 1AZSA 4X5VA 4YXMA 2ZH8A 3S01A 3IBCB 2YNFA 3AVFA 5KFGA 2MQNA 4UB3A 1FEHA 1OJ4A 3NNCA 2OA8A 4YN3B 2DXFA 4ZLNA 1JXVA 1UWBB 2MLYA 3UQ2A 1H74A 3GCXP 4HT5A 3KG0A 4DV4K 1HJRA 3D3CJ 1BWFO 5D0RA 2YY3A 4FOEA 3NVZA 3AD7C 4NE9C 1OWXA 2VGNA 3OYMA 4NLZA 2NCKL 2D1KA 2Q0RA 3ZEUA 2Y9UA 2EI5A 3M7DA 2UUCK 4U7BA 4JI1K 5KFCA 5KFLA 1TZ0A 5L1IA 2NYIA 2XNQA 4CI0B 5DBAA 2JC0A 3C6TB 2FC8A 4EZ9A 1EX4A 1N33K 4DUYF 7ICPA 3A3OB 1S7HA 1WG4A 3CJTA 3PY8A 3N28A 3MTKA 2R2RA 1N56A 3KLFA 3OL9A 4I2BA 4IFYA 5IXUA 3Q2TC 4NCGB 4P6QA 1ZQSA 3IBPA 5DM6L 1S9EB 7ICRA 1RT2A 1HKGA 4BREA 1HNZJ 2DEIA 4UB8U 3OBIA 4DR2F 1RXOB 3WK7A 4DUTA 3HKZF 3D9BA 1Q82T 3LP0A 2W25A 1JWWA 1RUSA 1C0TA 4ED4A 7ICQA 5F0XA 3V7LA 2WB1C 1BNPA 3QBXA 1KVCA 3OS0A 1WLJA 4I27A 1VRQC 4CNZA 1VQON 4B3MK 2OXOA 3LTOA 4M9HA 3AD8C 4C11B 1IUJA 2VQEJ 4A8QA 3QLHA 4PG5A 4I1TA 4P4OA 4DUZJ 1OKJA 4IYQA 1E6YB 3TA2A 4ACOA 4C3KA 1RT5B 2V5HG 3ULEA 2KZ3A 3QX7A 4ZLLA 4QR0A 1VHFA 1RTIA 2MRLA 3L2RA 3H8JA 2ADBA 5AQSA 4OV6A 4ILHA 4DMZA 5DKWA 4F3QA 4MFBA 2R8IA 2CPYA 1HNWJ 1JL1A 3ZT0A 2XICA 2IVNA 3D68A 2AZ1A 2QLWA 4X4RA 4M5NA 4V19J 2IHNA 3CDBA 3UDEA 4CEFA 5KOWA 4CJSA 4X64J 3H8MA 3C6HA 1LOTB 2NRHA 4CYUA 3OLAA 2ZNZA 1KVKA 3AO2A 1UTAA 3O1LA 2PMZC 2RHKA 3ZETA 4XUSA 1W0HA 4Y2UA 1DAXA 4OPJA 2CNKB 2KIWA 2V7ZA 4WXWA 4F91B 2DNZA 4CF8A 4YFKA 2JLFA 4TLQA 5BXIA 2YNGA 1N5XA 2Z1IA 2VJ5A 5AQTA 3WK5A 3QFUA 3JPNA 2M3DA 1ZD4A 3TUPA 2F1FA 3MEGB 2KRBA 2K7KA 1ZQQA 4BR0A 1FO4A 4ZVUB 2HVDA 2UVRA 4Z4EA 1NSPA 4AFFA 3WNHA 5F3TA 4K8RA 3VGMA 5KI6A 5ITHA 2MHEA 2P9NA 3G6XA 5J2MA 3WXJA 5AZIB 4FBTA 1B64A 4MF2A 1TUGB 2RLTA 3FRZA 2IDEA 4QZGA 1IR0A 5KG3A 1QTNB 2KT2A 2F9TA 3TADA 2F96A 4NLYA 2BE2B 1SB6A 2IOFK 5C5JA 4WFXA 2RU9A 3V9WA 4AHTA 2VWKA 4LF6K 4DR7K 1TL1A 2JOQA 3HULA 3TJAA 1Q5VA 4HVZA 3L4IA 3A4TA 3IMXA 5U47A 1GX5A 2WVBA 1X4DA 4H4KA 3SPZA 1E6VA 4PL2A 5AM3A 5HJXA 4CGJA 1N88A 3DLGB 4J5OA 2NUHA 3J80Y 2GO9A 3MEKA 4FJLA 4YHHK 1M6YA 2QKQA 2PEBA 4WE1B 3N79A 5AQWA 4WP8A 4DV2F 2JFKA 2QI2A 1RE1B 3OXFA 2J0SD 2RJZA 4Y2SA 4RQ7A 1FK9A 4YDUA 5KFQA 3DLLQ 3PO4A 4DV0F 2OJ3A 1NJZA 1U0SA 3W9HA 3VGUA 2ASOA 2A6OA 4NZ6A 3QO9A 3RJHA 2DNMA 4QS7A 2RP5A 3ISZA 4ZHRA 3IXQA 4KRFA 1UWBA 3D6HB 2MKKA 3SUNA 3OW2M 4K8XA 1NAQA 4ZVFA 1VQNS 3AGKA 4CERA 2EFVA 1N61A 4CJRA 4F36A 3CXCM 5IINA 2HFSA 2LYHA 3UMCA 1BCMA 4E19A 1SQFA 1NK7A 3CCJN 3HFVA 2DKOB 2MKCA 2PFOA 2FJAB 1ZQUA 5KFAA 3IC1A 3MR2A 3WK8A 1U2FA 3NKYA 1H6KX 2Y0SD 1CBKA 1N34J 1X9MA 1S3XA 5AQOA 2O1PA 3TEGA 1PUZA 4Y2KA 3LWLA 1WDTA 3C6TA 2V63A 3WK6A 3K1ZA 5HMLA 1XQIA 3O08A 4R0JA 5GIOA 5BR8J 4JKAA 4FJJA 4CLPA 3MCMA 4C8LA 1F0XA 2Y1LB 4DV3K 3KOOA 4QWDA 4NCGA 4DCOB 4DV6K 4LIWA 3WX8A 3L4BC 1DY3A 2V8HA 4PWDB 2VASA 2ACYA 4A8FA 2ATLA 4GFJA 4ETZA 5HP1B 4FJNA 2F2AB 5DLGA 5DJBA 2CGLA 4DL5A 2WF5A 1HKCA 4I2AA 2K3IA 4AYBD 2MB0B 3MCPA 3J7AN 3TAMB 3QU2A 4P75A 5D8HB 2D3DA 3VAFA 3WBZA 3IAS9 4CO1A 4A5BA 1OQ3A 3JPPA 3UQ0A 1K1QA 4C11A 1S6QB 3OPKA 1B3TA 1SQKA 3WKAA 1VK8A 3PCOB 2KTQA 3C2PA 3HDSA 4B17A 3CD0A 2KJ9A 3D0PA 4K59A 1E6YA 1NI3A 4B3TJ 3H2VE 5AIAA 4B9MA 4DV4J 4F5OA 4B9SA 1AXQA 3ALYA 1ZQ1C 5IT9U 1Z1ZA 1ITPA 4PXEA 4ID1A 4DCPB 2BPCA 4MTPA 1DRZA 1S76D 3TZWA 4KTWA 1X0PA 3W61A 2UUCJ 2DKZA 4JI1J 2IYGA 4YMEA 7ICFA 2G8UA 5FLXU 3CCVS 4G6VB 2NO4A 3A0HU 2UUBK 3NS1A 1KNZA 8ICGA 4ID5B 1TKXB 4LSNB 1K8AT 1FNXH 3NWRA 2CPJA 2IM1A 1V5VA 1X2IA 2J0QD 3OVAA 1Y4ZB 3BDPA 5ALWA 2LKZA 4WJBA 3CP8A 1HI0P 1XNQK 2HFZA 5B7WA 2HURA 3EZWA 5KFUA 2EZZA 2HOEA 2HPUA 3VN5A 2NSBA 2H3IA 2FB0A 1RHJB 4ECVA 3CYMA 3MUMP 2DRAA 4KGMA 1SGGA 3CDEA 1I1GA 1EJ7L 1N32J 1Y88A 1HWIA 4K50A 4LVOP 4Q5VA 1WG5A 4KITB 3V6HA 1U2VA 3HKZC 5AZIA 4M63C 4OLAA 4KI6A 3HFKA 4HHTA 4Y2IA 2DO4A 1ZQHA 4X65K 2Q3PA 2O8CB 1HPZA 2DCUB 3FCVA 3WDOA 4ED3A 1SCJB 2XMJA 3DI6B 3KNAA 1HQEA 4LRFA 1IJJA 4QBUA 4QPXA 3ZZUA 1BI4B 1N5WA 3MR7A 3TNVA 1QHTA 1XHXA 4HAIA 4RW7B 3NNHA 1V97A 1DQ8A 4KV8B 4KTZA 5HMMA 5KFHA 1IG6A 5F1XA 4M41A 2JRZA 2GVZB 4J03A 2WW8A 3NRBA 1O6XA 5C25A 2ZGYA 2WCXA 3DLGA 3BR8A 4IQVA 2DIUA 2K8AA 5E84A 3ZSXA 2QTWA 1VJ5A 3D6TB 5DDPC 4YOUA 1VC0A 3D45A 2EBEA 1MWMA 2BRKA 2YX1A 4DPXA 3KNGA 2B4OA 4DG1B 5HJYA 3WC2A 3G6VA 4Y0FA 1M5HA 3JXOA 1KAYA 2ASLA 2EX3A 5DMRA 2J9EA 1CLQA 2DBYA 1QJHA 1LW2B 3LDNA 4HHJA 1TVRB 4UOCA 5E79U 3BP8A 4HR2A 3QETA 2DIVA 2GZOA 5AKXA 5EE1A 4BLGA 1U1RA 5E0OA 1J5OB 4EGLA 4ILLA 2RRAA 4KRWA 2DKXA 2GBZA 3HL8A 2HNZB 3AO3A 2I1RA 2IM0A 3ZTRA 1RACB 4GMJB 1TV9A 1T7PA 3M8PB 2DPNA 4JKHA 4QS8A 4IDKA 2W03A 1CPZA 5F8NA 4KY3A 2QA1A 4FM0A 1UT5A 2VDIA 4P2SA 4P72A 2IVOA 4IBNA 3MCAB 4LF6J 1ULRA 4UARA 4DR7J 2Y1JA 4PABA 1OY8A 1RCXB 4C3MA 5J2HA 5CRXA 4P0QB 1ZTTA 1IBMK 4CHYA 3DRSB 4AHVA 4Y1CA 2E3TA 1F0MA 3VV2B 3W5ZA 1QVFM 2KXHA 1TAMA 4FJ5A 5HRSA 3A5LC 4PQAA 2FSNA 1S6PA 2V68A 3HHDA 1FESA 4YHHJ 4FWKA 4OJ6A 2G5HB 3MGIA 2V4RA 1ZZNA 3PNIA 2OMLA 2X51A 3UVJB 4PWDA 1N36F 5HP1A 4CEZA 3C6AA 4OZJA 2A3VA 4AF1A 1U45A 2JHDA 4RQ2A 3HHNB 1HKAA 2YMLA 3JAMY 2KT5A 2QLXA 2OKQA 4OJ3A 1HNXJ 5JRTA 1ZQDA 1KW4A 1S0NA 3L4QA 3ISDA 4GVEA 2Z56B 3MR5A 4C7ZA 3KZBA 2VGMA 3OJUA 2VFRA 4K5SA 4RW8A 1B99A 5AIBA 2MZQA 3MN5A 1S6QA 3PJ9A 4M3UA 3BF1A 2DEJA 4OI4A 1MW7A 1RHRB 3EKSA 1EKEA 3LH2S 3RBEA 3Q8LA 9ICKA 3QICA 3C94A 1FF2A 1XJWB 4ZKAA 1NO8A 4GXKA 3MI7X 3WQUA 3NOCA 1ZBFA 3R8EA 3DU6A 2QWMA 5KG4A 3M9MB 3SAGA 1V38A 4DU1A 4UY8T 1UJ4A 4DL0C 2ZJRL 4KR0B 1X5SA 2PI4A 1IVZA 5F0WA 1QH9A 5CAAA 2KXFA 1RADB 4FKYA 1Q7YO 3D0IE 4JV0A 4M5HA 3BSOA 1R8AA 2MTLA 4TUQA 2ZJPQ 4ID5A 1TKXA 4NEYA 2CADA 4JI0F 3TAEA 2Y0SC 1ZQRA 1MMLA 3N9UC 4DV3J 3PFEA 3A8EA 4M3ZA 1GOBA 3PJXA 4DV6J 4CK2A 3SV3A 1J2MA 2IMWP 3NOGA 5K20B 3GU3A 1ATSA 4A5AA 4XH4A 2FVQA 2PFNA 3W5YA 2VBZA 5RUBA 4DR4J 1SV0A 2JFDA 4CH7A 4YB7A 4E1NA 3QXGA 2EZYA 2CDRB 3L3VA 1HNVB 4KQZA 2H5EA 4E2FB 2R7TA 3RBXA 1BA1A 2UXCJ 5BYRA 3MM9A 5CJ7A 4DR5K 2YQ3A 3PYGA 2HBJA 2G9OA 4NLTA 2LFVA 4KI4A 3AA8A 3IP4B 2V8PA 1FJGF 4CNYA 1BLUA 4NV0A 4AYBC 1TL4A 5M2RA 3BKFA 2FBYA 4FF2A 3M32A 1RWPB 4FYYB 1WELA 1S97A 2NZTA 3LVVA 2ZM6K 2MJNA 3DI6A 2E8OA 2JEGA 1BI4A 1QQ6A 2DCLA 2ZIVA 4KV8A 4KLHA 4O23A 2Q3SA 2GVZA 1HI8A 2E1AA 3FBEA 5J2KA 4I2QA 4XDDA 3L9ZA 2GIRA 3QSYB 3HX9A 5A0LA 3B4DA 2WC9A 3VGSA 2Y1IA 3CSKA 1WC6A 1PJ5A 4B9LA 5KOXA 3G8TA 1CZAN 3PG9A 1L8OA 3H8SA 4NXNF 2HFNA 2HF3A 5AJ3K 5F8IA 4E3SA 2M7SA 4DG1A 1O1WA 2CQ2A 1XNQJ 3I87A 3H4BA 5AKLA 3MXHP 2H3ZA 1GFWB 5M2PA 3IA0A 4QYZK 1I94K 3TJ9A 3TZZA 3GDXA 2JNJA 3OYJA 5JVGL 2UXDF 2DH8A 2V8VA 4FL9A 3CW2C 1B0TA 4F5QA 1S6UA 5IV4A 3FVYA 2IHMA 2QMUB 3TU5A 3CFPA 1RXVA 1J5OA 3CQ8A 2JSXA 1YBAA 3VF0B 4CZCA 2N7YA 3SQ2A 2HNZA 2ZH2A 1WG1A 1ILYA 4R5PB 4X4SA 3VAHA 1Q18A 2M5YA 3TADC 4C1NK 4UAZA 4IO9Q 4PWUA 3DCAA 2DD8S 2Z57B 3HVRA 3G71S 4MMOA 4OI1A 9ICSA 4OZ3A 4NYFA 1WUUA 4O4GB 2E2NA 3JTPA 2SXLA 1ZRMA 5KFBA 4PXBA 2ZG6A 4FZNA 3KUHA 1RBTA 4HHUA 1IM4A 1LKYB 4LF9K 2DHAA 3EVMA 4H4KC 2R9LA 3AXMA 4H8KA 2F8LA 4IFVB 2HOIA 4EBEA 2RQMA 4P0QA 2RVJA 3NGDA 3JQKA 4OPAA 1U2RA 5DM7L 1C1CB 4C4RA 3MFIA 2VA2A 2E5SA 2FGOA 1TFRA 3I9ZA 3PKMA 4ED1A 3CQYA 3AA5X 2B0GA 3I0RB 1Q3VA 2MKSA 4AQYF 2FMPA 3SCXA 3E01A 4YDUC 2EAMA 3O0FA 3MWBA 3JYTB 4DOZA 1RA6A 2W2MP 4RX6A 2LECA 3DLRA 4FF3A 3O4NA 1P9YA 2MPUA 1JJCB 1DKGD 3DN9A 1X7VA 3F41A 2HI0A 2WBNA 4CO3A 2XMAA 3JSYA 4FXDA 2V94A 3TA1A 2I7PA 4U9RA 4PKIA 2NRTA 2CQCA 2XZTB 2EW9A 3C66A 4ED0A 2OTLN 5C2CA 3HSCA 3LP1B 4B9VA 1MMDA 2PI5A 1NG9A 4IKAA 3A13A 3T5LA 1FXDA 2CWXA 3AXKA 2VJ4A 4C80A 2O8BB 3V72A 2ZDOA 3CHWA 1OPZA 2PA8D 3QEAZ 4YXJA 1UEKA 1LW0B 2LXIA 4FJHA 5ALHA 1DJ0A 4E8UA 4KX5A 3J80U 1UMJA 4H0YB 2CPEA 4HT7A 3ISNC 1VSDA 3TVKA 3LDSA 1JCEA 1U4BA 2B7BB 4YR2A 2R7RA 3M9NB 3J7Z5 2EK6A 4KMOB 2KO1A 3DAWA 3SQ0A 3FAHA 5HRRA 4ZVTB 2GCFA 3W60A 1DLOB 3D2NA 3BBBA 2HB5A 3CC4N 3QWPA 4F3OA 2XRIA 4M5DB 2CWKA 1JCFA 1K1SA 4OJRA 4A62A 4PQUB 5AICA 4GXJA 5CA5A 2EFQA 2OD6A 4CF5A 3UD5A 2AYGA 3B8HA 3NEKA 1RWUA 4OKKA 4G9BA 4NRUA 4NXMF 2UP1A 5L9XA 1VQPN 4TUPA 3ZFVA 2XLIA 2F3NA 1IO2A 3JSRA 2ZVIA 4BE0A 3RMDA 1BVSA 1EXQA 4GO7X 4BUGA 2J4RA 3MEDA 3K5MA 2L48A 5J2EA 5ALYA 4MT1A 3KLEB 4K4VA 1RT3A 3EDRB 1N48A 1NJXA 3JPOA 5E3QA 8ICYA 1HR0F 3PW4A 1NEEA 4MQ3A 4KTQA 3K7RA 2C22A 5B0BA 5C2DA 3FLCO 4IRDA 2KZZA 2HHQA 1HBMB 3WT0A 2VONA 2F8EX 3M2RB 1NBEB 3NGKA 3THWB 4ZVPB 3H20A 4NZ7A 2Q2RA 2IOHA 4J9QA 2J6SA 3VQSA 4WPAA 3K59A 3CPWM 1VBYA 4CJTA 4U67Q 4OI2A 4K4ZA 4E7LA 4XRHA 4F9OA 2EEYA 4UQGA 1ASWA 3ELHA 1OYEA 1HPMA 2G8KA 2BR0A 3H59A 1Y64A 1N5YB 3NG8A 3HOSA 1GXTA 2V2VA 1AUDA