2XY6A

Crystal structure of a salicylic aldehyde basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
581
structure length
581
Chain Sequence
TAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 199
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy6A01
2AGPA 7ICOA 2BCUA 3AO5A 1BPDA 2W9CB 4YFKA 1BIZA 3K75D 3RJFA 2ISPA 2VANA 2HNZA 3RRGA 4XIUA 3NH1A 4B9TA 2X74A 3ZSOA 4KMUA 5E41A 2FBVA 3RBEA 2P51A 9ICSA 4G3IA 3K58A 2YKMA 2OA8A 5KFQA 2XO7A 2X6SA 3HP9A 4Z0UA 4Z6DA 3KK2A 4YR0A 4BDYA 1NJYA 3HPOA 4FJ9A 4BWMA 4CJWA 4DL3A 1KTQA 4JV1A 1FK9A 5J2QA 4LH5A 1KVCA 5DBCA 5J29A 1TVAA 3V9XA 4NYNA 3TFRA 4ECXA 3OJUA 4OPKA 3Q8RB 1SUQA 4PQUA 3NH2A 4ECRA 1RBTA 4W5TA 1WSEA 4ID5A 4CJ4A 3C2KA 1IM4A 3LDAA 4QWBA 8ICYA 4DOCA 3TARA 1BPZA 3OYEA 1VSMA 4M04A 1IKVA 3AV9A 4DU4A 4DTPA 1W9HA 2R8GA 3GV7B 1JLGA 3AVBA 3ZCMA 1DTTA 3NF9A 3KLIA 5CY4A 1JLCA 3RH6A 1YT3A 4CJEA 1B43A 3C1YA 4M9JA 2RN2A 1UT5A 1VSKA 3HJFA 4E7IA 2YNGA 1KEJA 5KFBA 5KG7A 2JEJA 4P2HA 5KG6A 4RW8A 3DRSA 4FK2A 4FM2A 2NRVA 3C21A 1CXQA 4YCXA 4DL7A 4NXZA 4B9NA 1WCLA 2VWJA 4TSXA 4XQ8A 3Q8MA 4J9MA 7ICGA 2I9GA 5D46A 3NGZA 3RB4A 4QCLA 4KITB 1RBVA 1T8EA 4Z4CA 7ICPA 4E7JA 3AVAA 1QS4A 4UB3A 4QZGA 2IMWP 5HMLA 3HPHA 3ZT0A 5KT7A 4KV8A 4O5KA 2HVIA 1S6PA 3E2EA 3V9WA 3H08A 3TAEA 1ZQAA 4DTNA 3RB0A 7ICIA 3EY1A 4OKKA 5DG7A 4CF8A 1LAVA 2W9MA 3QO9A 4CF2A 1C1CA 3L2WA 4F4ZA 3PW4A 4N56A 5EWFA 3OHBA 4E19A 2QKKA 1ZQZA 4CHYA 4NLKA 2F1JA 4DO9A 1ZQBA 4FM1A 3KK1A 4F5OA 3PW7A 5DLGA 4KAZA 1KVAA 3RJJA 4CEBA 1ZQGA 3L2RA 3NBPA 4RU9A 3HK2A 3VA0A 3V6JA 3OYDA 4I2AA 1NKCA 4RQ6A 4FVMA 4QWCA 3LPTA 4W5RA 5T7BA 3P83D 1O1WA 5J0TA 3OVNA 1Y97A 5KFPA 3AVCA 2HHXA 1ZQUA 4O0IA 1ZQIA 4KLSA 3TFSA 1TK8A 4KLEA 4XRHA 2IAJA 1ZJMA 3M8RA 2M9NA 2OPRA 3QETA 3ULDA 4FJJA 5DKWA 1LW0A 4GXIA 4M47A 3LDSA 4QZDA 3RMAA 9ICJA 1BVSA 1VSHA 2G8FA 1ZQVA 4F4WA 4MFFA 3M9NB 1S10A 1FKOA 2VA3A 4QZAA 1NOMA 4RNMA 4ICLA 2DPJA 1XHZA 1MQ3A 4Q44A 4KLDA 1Z3EB 2AQ0A 1HYSA 3K5NA 3DM2A 3N4MB 1U49A 8ICQA 4JRQA 4DSEA 5J0YA 4WE1A 4N76A 5I42A 4RW4A 4UB2A 2R8HA 4DTOA 5CJ7A 3I0RA 2OPPA 5L1LA 5J0SA 4DSLA 4I2HA 2JGUA 3P1GA 4PA1A 3ASMA 5KFEA 1K6YA 5KFDA 7ICFA 2Z1GA 4C8KA 1ZQHA 2RPIA 3H8WA 5EU7A 4J9QA 2XCPA 2W8LA 4L8RB 4FLWA 3C2MA 2PI5A 3RWUA 3TANA 2W9BA 5JS2A 4RQ8A 1CUKA 4FBUA 4M42A 1XHXA 2D0AA 4GC6A 1COOA 4CEFA 1A77A 3RAXA 4DL6A 3AVFA 4CJKA 2AGOA 4F4XA 1RNHA 8ICSA 4XA5A 4ZTJA 3EYZA 4ED2A 1HUOA 3KK3A 2FPMA 3DRPA 9ICAA 2P1JA 2UVVA 1QE1A 4OPJA 4CFBA 3EPIA 1VRUA 4HUFA 1SV5A 4I2QA 4NCBA 3V7JA 3LANA 2P6RA 3NTUA 1IKWA 4KN4A 4ZH4A 1CLQA 3KHHA 3LP0A 3LWLA 4DSJA 3MDCA 8ICZA 4M3WA 1NK9A 2EHGA 4O3QA 2O4GA 5KFLA 1S77D 4JRPA 3Q8SB 3MBYA 3RJIA 4KLUA 2JEGA 4J9PA 2VG7A 3V1RA 2KZ3A 3MDAA 5HNKA 4CJFA 3V6HA 4IG3A 1SL2A 5CZ1A 2HHTA 3DLGA 4Y1DA 5KT5A 3ZD9A 4J9SA 2YHBA 3PO5A 3K5MA 1B92A 8ICPA 3OS2A 4EP4A 3NGDA 3DOKA 4IRDA 3SQ4A 5CYQA 2IOCA 5KG0A 3GIMA 3SUOA 4E89A 1T05A 5L9XA 2W9BB 4YR3A 3AA2A 4FLVA 5SWMA 4TQRA 1TGOA 3B0XA 1WSJA 4NLNA 1RT6A 5EOZA 4P4PA 1ZQEA 1U45A 4F2SA 5J2AA 5C24A 9ICWA 3ZT3A 4MFCA 5CP2A 3U6FA 3RB3A 1TKDA 4CJLA 3GIJA 4HHTA 2R8JA 1XWLA 4AILC 2BQRA 1X9SA 3HX0A 2ZD1A 3VQ5A 9ICBA 3QNOA 3SNNA 2BGGA 4M3XA 4OLAA 2JZBA 3KD5E 2X78A 5KG1A 4FYDA 1ZQRA 5KFCA 8ICGA 4CGDA 1ZQPA 3DI6A 3UIQA 2FLPA 1S1UA 4GXJA 3N97B 2BPGA 2QKBA 1C0UA 2ZTDA 1MU2A 3AA3A 1SKRA 1KFSA 3HW8A 7ICQA 1WCNA 3TWHA 3O3HA 3ZSYA 2ASDA 4DOAA 1L3VA 1UWBA 4KKOA 4PGQA 1UAXA 4FM0A 5IIIA 3OSNA 8ICMA 1RDCA 1H38A 3QE9Y 1CZ9A 4KHNA 1EXNA 3RMDA 2F8TA 3DLEA 4NLZA 3DLBA 4ECUA 1ZQOA 4JK1A 1ZETA 4K4IA 1S76D 2NRXA 3RAQA 3CFOA 3M9MB 5HROA 3C6TA 1VSFA 1NK6A 2BGWA 4F3TA 1HNIA 4EZ9A 2B5JA 5KFZA 4GLXA 2C28A 1VSDA 5J2NA 3SCXA 7ICLA 4EZ6A 4RQ5A 4CJSA 4DTJA 2PYJA 4UB5A 3DOLA 3QZ7A 3SQ1A 4OJRA 2DTUA 5J2IA 4AHVA 3SQ0A 2R8KA 4IQWA 5DK5A 4F5RA 3VQEA 4CEDA 3T5LA 9ICGA 3OYNA 4B9VA 3TAPA 2VG6A 1C6VA 3OS0A 4CGIA 1NKEA 4RW7A 3BDPA 3JPTA 3KD1E 2KQ2A 3MEDA 3ZDDA 3QIOA 3GIKA 4CEZA 4K4HA 1Q9XA 1MC8A 2BKEA 3VQPA 3PR5B 5F9NA 2R8IA 4Q45A 3AVHA 4IR1A 2V9WA 1QQCA 4YD1A 5HHHA 4GW6A 4BXOA 1ZBHA 4F4KA 8ICAA 3ZDCA 1SKWA 4Q8EA 1TV9A 3SZ2A 3T5JA 1WSHA 4O55A 3UPQA 3RH5A 2ISOA 4RQ2A 4B9UA 2JLEA 4ED1A 4FJ8A 3M8SA 1SL1A 4KLGA 1RCHA 4KHQA 3PW2A 1C1AA 5EWEA 9ICIA 4LZDA 3IS9A 2OYQA 4IG0A 3BQ1A 1EKEA 4FJ5A 4DFMA 1NJWA 3H4DA 3MXMA 3ALYA 4JLHA 3AO3A 3QEWA 7ICMA 4K8XA 3C6UA 3UXOA 3SUNA 4FLZA 4FLXA 5J2BA 4JV2A 1RYSA 2IBKA 8ICNA 4YR2A 7ICHA 2O4IA 4RW6A 4IDKA 3Q8KA 5J2HA 1S1VA 4ECYA 1UA0A 3PX0A 4CCHA 1BI4A 3HM9A 3TABA 4H4MA 4I2IA 1XSNA 2VG5A 3PMLA 2ZE2A 1JXBA 4EBDA 4CFDA 1HYVA 4KLQA 4CHNA 3UXNA 1HNVA 2YNFA 4AHUA 4JS5A 4J2DA 4PGYA 3KTQA 2FBYA 1IO2A 4Z4FA 1XSLA 7ICTA 3AVJA 4M0AA 3MXIA 4QWAA 4DL4A 1J9AA 3PUFA 3AVIA 4Y1CA 4CK1A 3PR4A 9ICNA 2B21A 4M6WA 2YKNA 4GMJB 4Q0BA 1VSJA 3LAKA 1U04A 4YMMA 1BI4B 3ZSWA 4C8LA 1NK4A 4J9NA 2PYLA 1D8LA 4QZIA 2B4JA 4O5CA 4R63A 2XGPA 3Q8QB 4FW1A 4DSFA 4BDPA 2P5GA 4YVZA 1XSPA 1U47A 2YNHA 5KG4A 3WNGA 5HRPA 1TK5A 5D49A 3AVMA 4DG1A 2E4LA 4ELVA 1LV5A 4FXDA 1T03A 3IRXA 1WSFA 3WNEA 3RTVA 2RKIA 3C5FA 4FLUA 4KLTA 5DGBA 1DLOA 3V9ZA 2OPSA 3MR6A 5IINA 3V6KA 2XGQA 2PFQA 4FLTA 4FJIA 4OLBA 4MEXA 3EW9A 4OGCA 3MFIA 3D45A 4E7HA 2NRTA 1WNSA 3PY8A 4MF2A 4E0DA 2BR0A 3IG1A 1ZBUA 4YQWA 4QZCA 1D9FA 4J2EA 2R7YA 2V4QA 5DGAA 3MAQA 4O5BA 9ICFA 5IIMA 4MEYA 4JS4A 4QZHA 3QZ8A 1TFRA 4FJLA 3RR7A 1N56A 1KRPA 4KI4A 3C95A 3NAEA 1U48A 4PPXA 4BACA 3GFKB 1RDAA 4KREA 4ED6A 1U4BA 3NFAA 4DS5A 2GV9A 1ZQQA 4R8UA 4F91B 4DQPA 2DY4A 3TAGA 5KT3A 5KRSA 3OYBA 2D5RA 4E7KA 4W5NA 4F3OA 1S6QA 3K57A 1J54A 9ICLA 1X9WA 9ICRA 3CM6A 3QNNA 5DG9A 4TUSA 4Z4EA 2W42A 3MFHA 1JIHA 5KFNA 4M45A 4I2FA 4KO0A 4OGEA 2HW3A 3C2LA 1JXEA 5KFWA 4PHEA 2IHNA 5D3GA 3OYHA 3SUPA 4CJTA 1GOCA 3B0YA 1Z00A 5HMMA 3HYFA 3FYHA 2HMIA 4E3SA 5DB9A 4UAYA 5CB1A 3OYAA 3QEAZ 3OY9A 4FJXA 1JLBA 1ZBIA 4IRKA 4Z4HA 3ETLA 2NRWA 5KT4A 5J0UA 4UB1A 3AU6A 1WN7A 5JS1A 4O9MA 5J2EA 2UVUA 5SZTA 5BPCA 5D4BA 4Q5VA 3RJGA 3RJEA 1K1QA 3ZSQA 4DF8A 4UAZA 5KG5A 4FZYA 2PFPA 5DDMA 7ICJA 4KHSA 3AVGA 2ZJ5A 3LP2A 4FCYA 3OHAA 3H40A 3HXMA 1NK7A 1GOBA 5JUMA 5J2CA 3VQ9A 4IFYA 4IQVA 2UVRA 3TQ1A 2BE2A 3SPZA 1TVRA 5DQHA 9ICTA 3KLGA 4RQ3A 5DG8A 1S0VA 5J2MA 4ED0A 4CJVA 3VQ6A 1RBRA 4DTRA 4DQQA 4CIFA 4FK4A 7ICUA 1ZBLA 1VSIA 5HRRA 1NOYA 4LZGA 2BCVA 3MEEA 4RG8A 3VQAA 4LD0A 4DTSA 5FDLA 4CFCA 3QEVA 5KFRA 2ATQA 5BOLA 2J6SA 1C0MA 4DFKA 3UXPA 1QSSA 2ETJA 2AJQA 1JXLA 1B9DA 2F1IA 3ZT2A 3PO4A 1RBUA 2BHNA 4KHWA 4KTWA 2DPIA 1QTMA 3I8DA 1UT8A 1JL2A 2VA2A 2FC0A 4FS2A 8ICKA 3K2PA 3L3VA 4HYKA 3WNFA 2XC9A 1BQMA 5L1KA 7ICKA 4IBNA 1UA1A 2IHMA 5EWGA 1BIUA 1D5AA 4CJRA 1RILA 9ICQA 3V1QA 1HQEA 3PX4A 3ZDBA 3TAQA 2A1RA 3Q8LA 3QEBZ 3V9UA 4TUPA 5DBBA 2ZJ8A 1S9EA 5HRNA 2DFLA 4O3OA 1F21A 1ZQMA 4KI6A 4FS1A 4CF0A 5HBMA 1LWFA 2HHWA 9ICEA 3C5GA 3NF8A 1DTQA 2ATLA 3SQ2A 2I5JA 1LWEA 4I2BA 2QXFA 8ICOA 4J9KA 3O3GA 1BGXT 1S1TA 2IGIA 2A1JB 3BJYA 1RTDA 4QZBA 4AHSA 1ZBFA 5CA7A 8ICIA 5DBAA 2C22A 4GVMA 3V4IA 2G8VA 1C1BA 2Q0ZX 4CERA 3ITHA 3KJVA 1K1SA 1S0OA 4B9LA 4DOBA 4FJKA 4YFUA 3D0PA 3IHQB 2LSNA 3ZSRA 3L3UA 1NJXA 4RQ7A 2G8KA 3T1AA 4EBEA 1XC9A 3VQ8A 1XO1A 4FW2A 2C2RA 5I3UA 2A1SA 5KFGA 1TL3A 3JPSA 1KDHA 3T19A 4I2JA 1V9PA 4LY7A 2DFHA 4DWIA 3GQCA 4ED7A 4KFBA 2G8UA 3VQ7A 3KKRA 1N48A 4DFJA 2PI4A 4FK0A 4F92B 4HTUA 1C7YA 3L8BA 1ZQNA 2KN7A 3THVA 5DLFA 3NF6A 3PX6A 2BQ3A 3AVKA 1CXUA 4CHPA 8ICUA 3SI6A 2VWKA 1QSLA 4KHUA 1HMVA 2W9AA 4B9SA 5L1JA 4UAWA 4F4YA 3JSMA 4DTUA 1IKYA 1ZQXA 5KT6A 4I2GA 4M6WB 3PW5A 1S1WA 3V72A 3IAYA 3HWTA 2WTFA 7ICEA 4CIEA 3KLHA 3AUOA 5CWRA 2ASLA 4M9NA 4NLGA 2OZSA 3OS1A 2PFNA 5HHIA 4XUSA 4RPXA 1BPEA 4B9MA 1Z26A 1MQ2A 2IA6A 3K5OA 3G0ZA 4FJGA 4CK3A 3OYCA 1KLMA 3O4QA 3H8JA 5IIJA 1Y88A 4BDZA 4J2AA 1ZQWA 5KFUA 5J0QA 2HHQA 2KFZA 3QESA 1PZNA 5KFKA 4KTZA 4PHPA 3GDXA 3HVTA 3T5KA 3TR8A 4H4OA 4GC7A 3TAFA 3MECA 4ECQA 1S0MA 8ICTA 4HCBA 3L2UA 2DFFA 4BXOB 3RMCA 1Q9YA 4PHDA 3OJSA 3OYJA 3CM5A 3FFIA 4DTXA 2XY5A 3KIOA 4MFAA 4QZ8A 3V81A 4CEQA 1S1XA 3CFRA 4MF8A 4FJ7A 4K4GA 1QLNA 5TZVA 3GIIA 4TURA 3RJHA 3NCIA 4O5EA 2P5OA 1RYRA 1KLNA 1RBSA 3BQTA 2OWOA 3I0SA 3LPUA 1RT5A 2BQUA 1EETA 1KFTA 7ICRA 1WLJA 4CF9A 1CEZA 3T3FA 4RQ0A 4W5QA 3VN5A 4R66A 1HJPA 4CGGA 4PHAA 1S0NA 4KPYA 4IFVA 1TL1A 4M9HA 3QINA 1JMSA 4C8OA 4KLMA 4DU3A 2KFNA 4CEEA 2J6TA 8ICEA 1RZTA 4B08A 4ZHRA 3Q8PB 4CGHA 1LWCA 2HB5A 3JYTA 1D8YA 1A5WA 4QW8A 1JL1A 1RT3A 9ICPA 2Y1JA 8ICVA 4LVSA 4I27A 1ZQTA 3LK9A 4Z6CA 8ICRA 4QZFA 4GXKA 5KFOA 1T4GA 1VK0A 3ZDEA 1ZQJA 4O44A 1X9MA 4MFBA 3EPGA 1HUZA 2Q3SA 3HPGA 2ALZA 2E6MA 2BPFA 3KHLA 3ZSZA 2HHSA 3UQ2A 1X1PA 4J2BA 5KT2A 1JLQA 2IC3A 2X6NA 4ELTA 9ICMA 1QHTA 1RXVA 3HVRA 4CJ5A 4N47A 3MR5A 2HVHA 1D9DA 1ITGA 2WOMA 1RT2A 4RQ4A 4C8MA 3NF7A 3HO1A 4HVJA 4RPZA 2PXIA 4H8KA 4I2DA 1DGSA 3LAMA 1TKTA 2F96A 1NKBA 3MGHA 4ECZA 2B6AA 5KG3A 1T7PA 1TKZA 3SV3A 1JX4A 5J2KA 4FLYA 5KFFA 4C8NA 3LZIA 4Z4IA 4CECA 4OKJA 1QSYA 3DLRA 3GILA 3OYFA 7ICSA 4KB0A 1JLFA 1RDDA 5CZ2A 4M3UA 1I39A 4ECWA 4DS4A 3CQ8A 2BPCA 4AHTA 5J2DA 1BHLA 3FDSA 3DMJA 2BCSA 1DOQA 3C1ZA 3G6YA 3LZJA 4E1MA 3JPPA 3B6OA 5DQGA 1IG9A 1C0TA 3QEPA 3G6XA 5DB8A 1KCFA 4QWEA 4UQGA 3UQ0A 5IILA 3M8QA 3V6DA 3ZT1A 4IQUA 4ZTFA 2Z1IA 4CFAA 1G15A 3P5JA 4O3RA 3LP3A 3G6VA 3QIPA 1L3UA 3DRRA 3U3YA 3WNHA 4DTMA 3SI8A 4F5PA 4YN4A 5CYMA 4O0JA 1LW2A 1KSPA 5DB6A 2YHAA 3OYLA 5K14A 4QW9A 3H4BA 4KLIA 9ICKA 1A5XA 5KG2A 1BCMA 2Z1HA 4QZEA 1RTJA 4B3OA 4DSIA 2MAXA 1W0HA 4CE9A 4KRFA 1B9FA 3S3MA 4QWDA 8ICHA 4P4OA 2OPQA 5HP4A 3OYGA 4AHRA 5C25A 3QLHA 3ZT4A 4ECSA 4CEOA 1ZJNA 3AU2A 2ASJA 4F50A 3IM1A 3TI0A 4OVLA 3ZDAA 4Z6EA 1NK8A 2HHVA 4UB4A 1HRHA 1S5JA 3ISBA 4DL2A 5DDYA 4RNOA 3TAMA 4R64A 1SZPA 2ITGA 2KW4A 1KVBA 3V9SA 4YXMA 1SL0A 2DFEA 5IIKA 1LAWA 1RT7A 8ICLA 3F9KA 1B22A 2A1JA 1YVUA 4YD2A 1UOCA 4RZRA 2JEIA 5J2FA 4YG2A 2PY5A 4Z6FA 8ICJA 2D0CA 1JN3A 4YMOA 3HSTB 1XU4A 1ZQCA 2YV0X 4E1NA 4F5QA 3ORYA 4EEYA 5F9LA 1VSEA 3A2FA 3RH4A 4DLEA 4M3RA 4KLHA 1RDBA 2XCAA 2ZQBA 4M41A 4HUEA 1WSIA 1YTAA 3QEXA 3VQQA 3HT3A 1HYZA 9ICVA 1JLEA 2J6UA 3H8SA 2BANA 3MR2A 5KGWA 4ELUA 4KLLA 2ZUDA 4CF1A 1L5UA 2KZZA 5KFIA 2FLNA 2P66A 3QEIA 4I9QA 3RBDA 3RJKA 3NGIA 4M2YA 1BPYA 3S3OA 2YNIA 4DMNA 4JV0A 4PUOA 4M3TA 4Q8FA 2GUIA 1RXWA 8ICBA 3SYZA 3AVLA 4CJQA 5HRSA 4CGJA 5KGXA 4DQIA 2IDOA 3KHRA 4KHYA 2RF2A 4O3SA 2NRZA 2AU0A 4KLJA 5HLFA 4CEAA 4J9OA 4QAGA 5KRTA 2WONA 4N5SA 1HJRA 3DLHA 1RT4A 1TAQA 3BGRA 3C94A 1BL3A 3SUQA 1BPBA 4K8ZA 1L3SA 1EXQA 3MEGA 4P4MA 1RTHA 4N41A 4E7LA 2XY8A 3MABA 1ZQKA 1ZQYA 4M3YA 4PY5A 1TV6A 4I9LA 5DMRA 4CIGA 1VRTA 3K4GA 4DQSA 5J0WA 3PMNA 5J0OA 1MSWD 3RRHA 2HHUA 4G1QA 4BE0A 2PFOA 3ZSVA 1S9FA 2FMQA 1X2IA 3AVNA 1L3TA 3AO2A 3SV4A 3V7KA 4RUAA 3E01A 3MR3A 3B6PA 4KB1A 4FJMA 4B8AB 4QOZB 3MGIA 4DU1A 3SJJA 1XS9D 4CHOA 5CHGA 1RTIA 2XY7A 4KLFA 1GOAA 4UBBA 3JPRA 4NY8A 3AA5X 2Y1IA 4O3NA 3RMBA 3NH0A 4DEZA 3BQ0A 1WSGA 2FLLA 4F8RA 4J9LA 3VA3A 5KFAA 3CFPA 4RUCA 2LYHA 2RDJA 4DF4A 1BISA 3V1OA 5J2PA 1KFDA 4B8CA 4NYFA 4ECTA 4NCAA 3OYMA 3C23A 3U3GA 4NM1A 1ASVA 4R8UB 2VA8A 9ICCA 1ASUA 4IR9A 2XHBA 3S3NA 8ICFA 1FXXA 1IH7A 4TQSA 1Z00B 5KFXA 2ZTEA 3ISNC 4YMNA 3RR8A 4FJHA 4KTQA 3KHGA 4R65A 3JPNA 1TK0A 2D0BA 5J1EA 1Q8IA 4HUGA 4FJNA 2NUBA 1AROP 2FPLA 2MUTB 5HP1A 7ICNA 4M9LA 4CJUA 2XY6A 3NHGA 1T3NA 3QERA 3OGUA 4IKFA 3AO4A 3O3FA 1NJZA 1I3AA 4CGFA 1S9GA 4JWMA 3L2QA 9ICHA 1S97A 7ICVA 2KTQA 2MUTA 3DLKA 3ISDA 4I2CA 3O4NA 4YP3A 4CHQA 1R0AA 2Z1JA 4JUZA 5IIOA 3VQDA 1J53A 5KI6A 4X5VA 1U9LA 5DQIA 2EX3A 5KFVA 4CJ3A 3BQ2A 3MXJA 4I7FA 4I2PA 4YNQA 1TKXA 5BOMA 4EYHB 3HP6A 4CK2A 4IQTA 4TUQA 4FZXC 1VSLA 2BCRA 3KKSA 4O4GA 2I1QA 5J2GA 2ZTCA 2FPKA 3PW0A 3L2VA 9ICUA 5FRNA 9ICOA 1IXRA 2JEFA 2FMPA 4EP5A 3K59A 8ICWA 3ISCA 3HL8A 4AHCA 1NK5A 4RT3A 2FMSA 3KLEA 3VQ4A 3PV8A 5J2JA 4UBCA 1TAUA 1IKXA 3NDKA 5KFHA 4RT2A 1ZYQA 4DFPA 1WAFA 1ZQSA 2C2DA 4ECVA 2C2EA 2HNYA 4JWNA 4O3PA 3JPOA 4PGXA 4FBTA 3SPYA 4Z4GA 4ED8A 4R5PA 1N6QA 2ZUBA 4I29A 4DL5A 2F8SA 4LH4A 3JPQA 4EBCA 4W5OA 3VQBA 3ZSXA 3NGYA 2G8IA 3VQCA 5C42A 2F1HA 2AGQA 1ZQFA 5KFYA 4ID1A 4NCGA 5KFMA 5KFTA 3M9OB 4DSKA 9ICXA 1CZBA 4I28A 1WAJA 4BWJA 5KTQA 4KN7A 4BE1A 5J0PA 4F5NA 4DLGA 3PVXA 4QZ9A 3K5LA 3PNCA 3GV5B 8ICXA 5DB7A 5L1IA 1XI1A 5CR0A 4RNNA 2BDPA 2XRIA 2ZJAA 4EYIB 3LWMA 2BCQA 2IS3A 2QK9A 4PWDA 4IRCA 5J0XA 1HQUA 4YXJA 1NK0A 3EZ5A 2E6LA 3KLFA 2H5XA 4DQRA 1EP4A 1ZQLA 2GBZA 1BCOA 3NE6A 4KLOA 4RPYA 4I2EA 2RDIA 3F73A 4LSNA 1A5VA 2V4RA 2W9CA 3S9HA 4OKEA 3V7LA 4J9RA 3OSPA 3GV8B 4F2RA 5KFSA 3EWAA 2UVWA 1J5OA 4Q43A 2GWSA 4F93B 2JZBB 3LP1A 3G10A 4M3ZA 4HCCA 2HNDA 1REVA 5J0RA 1JLAA 1JKHA 4CJPA 3H7IA 2PZSA 1Z25A 2P6UA 4CHZA 2W8KA 4NM2A 4AH9A 1HPZA 3OYKA 4CESA 1RPLA 4RQ1A 2G8HA 1YTUA 4M9GA 2G8WA 4MQ3A 3CG7A 1LB2B 1FKPA 1BQNA 2FBXA 3M8PA 3RB6A 1A76A 5KFJA 3T5HA 4BGDA 1SKSA 1ASWA 3DYAA 1EX4A 5FROA 4LSLA 4ED3A 4PH5A 2AQ4A 1BPXA 2OZMA 4FZZA 5FRMA 1RT1A 3OYIA 1NOZA 3CYMA 3AA4A 3ZD8A 2KZMA 5C5JA 4RW9A 1N5YA 1ZQDA 4BE2A 4FO6A 3AO1A 2FBTA 8ICCA 3LALA 2ZUCA
chains in the Genus database with same CATH superfamily
5H1SV 2OPQB 4JD2B 4M1KA 2QMXA 3MEDB 2BCUA 2NRRA 3FZ2A 4X4UA 2G13A 4DCOB 2CQ4A 2Y1RI 4ZPVR 1EAYC 3VEZA 1FJGF 5HJXA 1SB6A 1VLYA 1IBKJ 1KNZA 3VAFA 1JCFA 3LP2B 2YKMA 5J2QB 5AQMA 3T9ZA 4Z6DA 1NH8A 4BDYA 1TMMA 3MM8A 3HPOA 1NGBA 4NXMK 4PXDA 2UUBK 1KQSM 3HDSA 4IFYB 5AQJA 1SUQB 1FK9A 2PDAA 3LO3A 4YUDA 4KBIA 4NYOA 4YDDB 5H2FU 5J29A 1WC4A 5LY3A 2DGWA 1HNZJ 3CCVN 5AK4A 1UVNA 3TSPA 2KOBA 3HHDA 3NH2A 4W5TA 3BGRB 1UVIA 4ID5A 1IM4A 1HR0K 1Z2ZA 1PSDA 4KC5A 4ETZA 1KC8T 4N77A 1TYQA 1O0PA 5LJWA 2YKQA 2JX2A 4AP9A 4MMOA 1N33K 3THYB 1U6ZA 3OTOK 2DBYA 5G0RB 3ZCMA 4USWA 4LFCK 1DTTA 1B0TA 3OD2A 3TZWA 5CRXA 3M7DA 4DR6F 2M3DA 3R27A 4E7IA 2BJ1A 4CE6A 2OANA 3N5BA 2I6WA 1HNXF 1Y11A 2ZOFA 4RW8A 1HNIB 3ULEB 1IVZA 3TPQA 3M2VA 3PG9A 4DL7A 4BG8A 2KXFA 3W2WA 5GMKa 2HKEA 1WCLA 3P5BP 1N32J 5LJ5Y 2VWJA 4KT0C 2FJ6A 1ED1A 2IRYA 3G8TA 3I96A 4J9MA 5D46A 4A46A 4QCLA 4UARA 4KITB 2ZF5O 5ALIA 1AA1B 4E7JA 4LRBA 4QZGA 3HKZC 1CS4A 3ZLJA 3HPHA 4DV4F 4ISEA 2HAFA 3DOMA 1WEYA 2PT0A 2WCXA 3TAEA 4DXLA 4OKKA 1R0CB 1U1OA 2QA4N 4CF2A 5EXWA 3OHBA 4E19A 2E1PA 2QKKA 2IRUA 4DX5A 1ZQZA 1S1XB 3TZXA 2B4OA 4K0KJ 4S0MA 4CHYA 2LMIA 2QWMA 3ZZPA 3FVYA 2Z4PA 4PL2A 2CGLA 1RBOB 2ILYA 3GLJA 3K2YA 3PW7A 4P6QA 3A0BU 5DLGA 3W5ZA 4PG4A 1S79A 2KV2A 1H72C 3WKCA 1J2NA 1VRTB 4YHHK 2WTUA 5EE3A 3OYDA 4I2AA 4ISGA 4CH7A 4FVMA 3LPTA 3LP0B 1YJUA 4O8UA 2DKOB 2ZITA 2HHXA 2H3GX 3NKYA 5IC4B 1IKYB 4O0IA 2N4CA 4K25A 5F8MA 2KYZA 3MX5A 4ISFA 5AIAA 1ZJMA 2JFDA 3RRKA 5AJ3J 4OI3A 1KHVA 4J9VA 4FJJA 2QX0A 2FZGB 5F8JA 1MN8A 3LDSA 4QZDA 3OBIA 3CO0P 2IVYA 9ICJA 3ET6A 4PABA 1WORA 3DLGB 4E2FB 2ITMA 4ICLA 4CBWA 4WK3A 1MQ3A 3ETMA 4HI1A 4OX9K 3K5NA 3N4MB 4Q2LA 5J0YA 4WE1A 3CERA 4LF8J 4FYWB 1QZ6A 1FDAA 3I0RA 4DV1F 4DSLA 4I2HA 1GLLO 2F5GA 5AT1B 1VHFA 4BRQA 3HRDD 3ASMA 2KHOA 1K6YA 2N4DA 2Z1GA 1DEJA 3GSDA 1ZQHA 2Q4TA 1YG0A 3WK5A 2A2CA 4FLWA 5F41A 2HMIB 3V4MA 4DV5F 2XEXA 4QR1A 1TFWA 4RCHA 2W9BA 4N8OA 4DR4K 2YXLA 2BUPA 3FRZA 4M42A 2P9UB 2D0AA 4QIFA 2A3VA 3IRWP 4KHPF 2B4VA 4CEFA 1A77A 4RKUC 1YKWA 1UEVA 3AVFA 3ENVA 2QSFA 4F4XA 4YB6A 8ICSA 4XA5A 2UYTA 3HI9A 3KK3A 1WI8A 9ICAA 3OBWA 3W3DA 1QE1A 4OPJA 2XO6A 4CFBA 2N3LA 4ZOHC 4JKFA 1SV5A 2YKPA 2NR0A 2RRBA 1IKWA 4KN4A 3PIPL 3LP0A 2FQQB 2Q1LA 8ICZA 3IG1B 2MQLA 3VETA 4D3HA 1S77D 2JL9A 2NLXA 4CZEA 2AYBA 3ZZUA 4OHZA 2HNYB 2VG7A 4PEOA 3MDAA 3CC2N 5HNKA 5J2PB 1WC5A 5CZ1A 1SL2A 4Y1DA 3DLGA 3ZD9A 1D0EA 1RWPB 3SSQA 3PO5A 1WSVA 3SQ4A 3EGWB 4X65J 3A5MC 2IOCA 3F9MA 2ZJQL 3THPA 5L9XA 1YWXA 1HBNB 3EJMA 4FLVA 5SWMA 4JI0K 3B0XA 3M2RA 4CF5A 3OPXA 1C0TB 2PEBA 4NLNA 5AE3A 1JNZB 4F2SA 2CPRA 1Y5IB 1FTCA 2DNHA 5C24A 9ICWA 3SMSA 5AQXA 2E9TA 2OXOA 3U6FA 5F8LA 3IRUA 3R5CA 4MTPA 3N6LA 1XWLA 1YF5L 2OH2A 2BQRA 1I51B 2W01A 4OLAA 2ZJRL 1RHKB 2XS2A 5GAHP 4GIBA 5EE9A 4HACB 2F8KA 1VLBA 1R8HA 1YK9A 4LFBJ 3CCQN 3DI6A 2AW0A 1ZAWA 1WUUA 2NLWA 3GR1A 4L76A 1MU2A 2I2YA 3HW8A 3I9ZA 3TADC 5C15A 4KKOA 1UWBA 2CH6A 5AXNA 4PGQA 2BXJA 2AEJA 5L46A 4FM0A 5IIIA 3FCWA 8ICMA 3HSGA 4WWSA 3W5YA 3A5NC 1RDCA 3MEEB 2UXDF 1BDGA 1H38A 3UR3C 4BC3A 3SLCA 5ALNA 3DLEA 4NLZA 4JK1A 4K4IA 1S76D 3RAQA 5HROA 2R2TA 1VSFA 3B8HA 1CG2A 4YOVA 4J90A 3O3LA 3W1YC 3BR9A 1VSDA 3OTDA 4FWQA 1FEEA 3RU0A 2EG1A 4DV0F 3OTQA 3BF1A 3SCJE 3QZ7A 3U7JA 2R8KA 4IQWA 4V1Ak 4CEDA 2ZJQQ 1F0XA 3M2RB 5AKYA 9ICGA 4B9VA 2J7WA 3CCJN 3OS0A 4BBYA 3L7PA 2KH9A 3ILOA 5EGYA 5B09A 1YIJN 4AYBC 5DO2A 2NZTA 3OXLA 4NMXA 4CIOA 2KQ2A 3GIKA 3BH7B 4K4HA 4J37A 2XMUA 4OJ6A 2Z0GA 2IYGA 2GWJA 4AQYF 3AVHA 4OZNA 4OCZA 5AI6A 5B0GA 3NRWA 2Z56B 4XDCA 5HHHA 2PMHA 1N34F 2VD3A 4L3KA 2O5DA 1AB8A 4F4KA 5ETNA 4CT9A 1NZAA 5AI4A 1TV9A 3T5JA 3UPQA 4M7YA 4KIAA 3RH5A 3IM9A 4AL6A 2C2OB 4B9UA 1PBUA 2JLEA 4FJ8A 3KJVB 4NWBA 2MKSA 1Y00A 5KAIU 3MCNA 3HVTB 1IM6A 1D8ZA 1Y9OA 1EKEA 1VQKS 3CPWR 6AT1B 2ASYA 3E01B 3ALYA 5AZJB 1TL3B 7ICMA 2FZCB 3P8BB 2MJUA 1JROA 4CLWA 3SUNA 2KHCA 1LFWA 3E66A 8ICNA 3AARA 3VEOA 4H4OB 2WF7A 2OPRB 2O4IA 3GYGA 1S1VA 3D67A 4H0TB 2FDNA 1NB2A 1BI4A 2OD6A 3TABA 4I2IA 1F2HA 3PMLA 3HLUA 2M0NA 3KLIB 2GX8A 1JXBA 4B1YB 4CFDA 4KLQA 2YNFA 4MKVA 3KTQA 4FWLA 3WC0A 2F44A 4ZDNA 2PSZA 4K2XA 3G25A 4U95A 7ICTA 5I42B 2V4JB 3KHYA 3BP8A 2OHDA 9ICNA 4EO6A 2B21A 2DHGA 2YKNA 5EOYA 4Q0BA 4JHDB 4PZVA 3ZSWA 4NYPA 2XMVA 4C2MA 4C8LA 3JB9k 4FSVA 2HBYB 1F9EB 5MAOA 4P2XA 1JALA 1KQKA 4OJOA 4O5CA 4FW1A 4DSFA 2KJVA 2LDYA 5HVGA 5T7LB 2IFXA 1U47A 1GQEA 2IC3B 4NRTA 3MPVA 4KH5A 3ENQA 1PC5A 4IG0B 4DR1F 3WNGA 4EFHA 2WF9A 1U26A 3B4MA 1BC6A 3CP8A 1LV5A 3H2UB 4FXDA 1SGGA 3PHTA 4KLTA 2QMWA 3HSCA 3L0QA 3AJDA 2OPSA 2MKKA 5IINA 3V6KA 2XGQA 4OHXA 4CO1A 4OLBA 1N5VA 1A9NB 4EGLA 4W90B 4UAUA 4M5KA 2P9KB 4H4MB 2HG4A 4CI6A 4E7HA 3KZIU 3L9ZA 3MWPA 4MF2A 5ETTA 3IG1A 3L5KA 1URRA 2HFNA 2DL0A 3CCRS 4FOEA 3H3OB 1M1HA 5GTIU 1LQ9A 4O5BA 4FE3A 1J2VA 3BYPA 4MHVA 1H7WA 1TFRA 5F8GA 4YB1P 1KRPA 2U1AA 4CM0A 4P71A 2QI2A 3DMJB 2EFNA 1VQ7N 3AJ1A 4YORA 3LVWA 4RQNA 1KVKA 1RDAA 1K73T 2K7JA 1U4BA 1ZQQA 1UTAA 3UCUP 1F2GA 4F91B 4DQPA 2DY4A 2W2PP 4CO5A 3MCMA 1QCKA 1S6QA 5F3XB 1JKHB 1NGDA 1I1GA 9ICRA 3ICXA 1XMQJ 4M5DA 4E1JA 2G1DA 4TUSA 1IG6A 4QIWD 5HQMA 2CG4A 3ID6A 4HVZA 1JQGA 2UXBF 3C2LA 4NXMJ 5KFWA 4PHEA 4NLBA 3B0YA 1Z00A 4X4RA 4JI4K 4E3SA 5DB9A 1UEUA 4AYBD 1JLBA 4LF7K 3IN5A 3ETLA 4DR2K 2DRBA 2QA4G 3BKFA 3FGUA 4IOCL 1WN7A 1RKIA 5I3QA 3D66A 1U1LA 4YEAA 5BPCA 4BVPA 4Q5VA 2D3UA 3DNCA 5ETSA 2Q43A 4CW7B 1DGJA 4O4GB 4UAZA 2FLOA 4KHSA 3AVGA 2ZJ5A 1EX8A 3TADA 4NXNF 1XN9A 3H40A 1GOBA 4DPXA 2P8IA 5J2CA 2ZUAA 5E26A 1F6TA 4NMLA 2P6SA 4F25A 2BE2A 2AEFA 4IO9Q 1M1KT 5DG8A 4C4TA 3ALRA 3PYFA 2LLZA 4WJ3B 4DQQA 4OZ2A 2Q36A 3UWTA 4FK4A 3I31A 1ZBLA 1FE0A 2EBEA 3VGUA 5HMWA 5ALKA 3WX4A 4M63C 1U2CA 1WBDA 2GC8A 5HRRA 3KMSA 4G9ZA 3FSXA 4KHPJ 1P90A 4DR2F 1VQ5N 4OZ3A 1CSJA 2B5JB 2BCVA 2DGQA 4RG8A 3ZTSA 2HHHJ 2LU1A 5KNIA 4PWWA 3QRRA 3W2VA 5EE1A 4Y00A 2ETJA 2AJQA 2KL8A 4ILGB 1B9DA 2F1IA 4WP8A 3ZT2A 3ICLA 4ILLA 2LXUA 5FLXY 2ILZA 1ZRMA 4KTWA 1JL2A 3FEXB 2VQFJ 1N33F 2FJBB 4ZVOB 1TR0A 8ICKA 1KKHA 3IFEA 2O67A 4KE5A 3WIUA 1N52B 3H25A 1Z6RA 4IJAA 3A4TA 4CZLA 1UA1A 2G2ZA 1BIUA 3EZOA 2I6XA 4R0EA 2MYFA 1VHIA 2MZRA 3N7PD 2DKZA 1G7CB 5THWA 3PX4A 2A1RA 3Q8LA 3GPAA 3N9UC 3V9UA 3H8MA 3ED5A 4TUPA 4YDUA 3FRYA 2HNZB 1HPMA 4O3OA 3T1YJ 4RWXA 5DM6L 4DBQA 2ZH6A 3QNWB 1LWFA 4I69A 9ICEA 4Z2XA 1VBXA 3MPUB 3NGSA 1RT7B 1OO0B 2IBOA 4I2BA 4J9KA 1BGXT 4WPAA 2A1JB 2CPEA 2DNRA 4AUKA 3HOTA 8ICIA 2C22A 4XPEA 3C29A 2EDUA 3IBPA 1RWNB 3MN6A 1SZ2A 4CERA 5CZXA 1NCLA 2XG8A 4B9LA 1Q5YA 4DV7K 4YFUA 3L3UA 3G6EN 1YJWN 1GMUA 2L48A 3MURP 5MLCV 4LF4J 5G5GA 2ASOA 3FR0A 1DQAA 1TL3A 4DUTA 3IUCA 1FVQA 2E2NA 1VGYA 4LY7A 2DFHA 4DWIA 2JWNA 1VQON 5D0RA 2HSTA 3JAMO 4ED7A 4B1WB 2IVFB 1RT1B 3WEEA 4DFJA 4NLRA 1S5LU 4FK0A 3DHXA 4F92B 1Z19A 4OJPA 1H6KX 2YB1A 2X1FA 2RU9A 1TAMA 1CS4B 1U8SA 3PX6A 3AVKA 3NGKA 2DIVA 2W9AA 4B9SA 5L1JA 5KQ8A 5M1QA 3NUQA 1P6TA 4L74A 1IKYA 1ZQXA 1EJ7L 3NWRA 1V4SA 5KT6A 3MUTP 2VGMA 1FWKA 1WDDA 5DM7Q 3HMJG 1FXLA 3JQJA 2DB1A 2J7UA 3OS1A 2PFNA 5HHIA 4XUSA 4WYWA 2R7UA 1A6SA 4USJC 2MLYA 2K89A 3QT5A 2EC0A 3G0ZA 3IBWA 2N3OA 4G1IA 4BY9C 1KLMA 1T9WA 5IIJA 4BDZA 4IJNA 3SDEB 5D0HA 4I6MB 3P3DA 4PHPA 1KTVA 3I55N 2ZIVA 1W7WA 4PZOA 4GC7A 3SEIA 3DLLQ 2C2ZB 3U1NA 1UCVA 1NSQA 1Q9YA 3UNGC 1KXPA 4CZKA 2D6FC 2NRHA 4MFAA 3MN5A 4OX6A 3V81A 1L3KA 3G2XA 3VAIA 5TZVA 3BUZB 3GSIA 2QARA 1OVQA 3CMAN 1CI4A 1FRMA 1RT5A 2AJ0A 1RA6A 2NXNA 2JGAA 2QA1A 1YJ9S 5IZHA 2NYVA 4OV1A 4O0NA 3VN5A 1G1XA 2V34A 3AQEA 1X66A 4CGGA 4PHAA 1S0NA 4NZ7A 2CJBA 5LMNF 4IFVA 3ZETA 2V8VA 4C8OA 1RDRA 3WXJA 3WQUA 3TKAA 4JEPA 2J6TA 1RZTA 3Q8PB 3IDWA 4IDKB 4C98A 3M7VA 1SVDA 2V8DA 1E4FT 2G09A 2K60A 5AXMA 1RT3A 1S48A 2NXJA 2QWRA 2W2MP 4CZIA 4JMUA 2Y1JA 8ICVA 4LVSA 2M8HA 2YWGA 3J80O 1ZQTA 4Z6CA 4DPOA 4GXKA 4RU2A 4X2BA 2DPNA 3ZDEA 1ZQJA 2IJFA 4O44A 4QYZK 1X9MA 1YJ9N 3MC1A 3F41A 2P9SA 3HPGA 4A8XA 2BPFA 5EDWA 3O5TB 3OR2A 4OZ1A 5IS2A 3LF0A 3IG5A 4BR7A 5H9EJ 5KT2A 2OKQA 2JHDA 1OIAA 1DQ8A 2X6NA 3B9JA 5LSOA 3BPSP 9ICMA 2DNLA 5ALTA 4Y28C 2C3OA 2KMDA 1MN7A 2JH3A 1D9DA 1ZS6A 4I2PB 1AT1B 2WOMA 3DGVA 1RT2A 4RQ4A 3J81Y 1LXJA 2CQ1A 3DRYA 3CJSA 4HVJA 1K0TA 1MNEA 3NBPB 5FIIA 1DGSA 2F96A 4O3MA 4ECZA 1IQZA 3VHQA 2A1BA 1LWFB 1S7IA 2HMPA 1NNDA 1T7PA 3C15A 1TKZA 1IXKA 2GHWA 5J2KA 2RT3A 4MKAA 4FLYA 4M5JA 2V7YA 4CECA 3F0NA 3E9LA 3EKUA 4C8ZA 4OPAA 3OYFA 5M2PA 4JI8F 4KKOB 4M3UA 2PA3A 1XNRK 2HURA 3PIPQ 2VWBA 4KX3A 2D41A 1V85A 4AHTA 4WFAL 1QUPA 3N6NA 4TVAB 2BCSA 3P4UB 1BG3A 3S8SA 3UE5A 3D1OA 2H3FA 4QJFB 3MM9B 5GVQA 3KZXA 4ZK7M 3G6XA 2D9OA 3RSEA 2R7RA 1K5OA 3UQ0A 4TYBA 3PEJA 3ZT1A 4IQUA 5GAHU 2VBYA 2UUBF 3VEXA 2UXCF 2PC6A 3RW6A 4KH6A 1LKYB 1F0MA 2ZBCA 4LVNP 1N34K 1R8CA 1QAYA 1F60B 2CXYA 3U3YA 3IR6B 3SQGA 1UW9A 3UD4P 3OR2B 4CO3A 4C8YA 2GQQA 2YHAA 2KHDA 4QW9A 4KLIA 4UUXA 4DR5K 3KKFA 1FFGB 4QZEA 1HBNA 2RS8A 4CO2A 1RTJA 4GO7X 2JRZA 4DSIA 2MAXA 2XSJB 1KHWA 1J97A 4KRFA 3KG0A 1B9FA 2QLTA 2DY9A 1YJNN 1K9MO 4WFBL 1WF2A 2NZCA 3QLHA 4ECSA 1RG6A 2YWFA 1ZJNA 4QNLA 3N4WA 3NMRA 1FI4A 5B08A 3IM1A 3M1VB 4CLLA 1OH8A 1UPPA 4P75A 4UY8O 5K14B 3DLEB 4BX9C 4JKBA 3ZO7A 2XS5A 5DDYA 4R64A 4A8YA 5J2MB 2ITGA 2HFVA 3OW2M 1W97L 2DFEA 4CVNE 1E6VB 3AAPA 3MUMP 3CJ9A 8ICLA 3VVUA 4DR6J 3OTCA 2K8BB 3POTB 4FZVA 1YVUA 4DV6K 3I87A 4W98A 5J2FA 4PYDA 2CQPA 4WYLA 1HNXK 1P9QC 4Z6FA 8ICJA 2D0CA 2O8EA 1JN3A 4PJ0U 1RP5A 2B3TB 1VQ7S 2E2PA 3HSTB 4CQ1A 1ZQCA 4CP5A 3E51A 5AQYA 4CLTA 4PUOB 1VQ4N 3A2FA 1V3ZA 2F8EX 4GKJK 1RDBA 5HL7Q 4HUEA 3THXB 2AIRB 5AQNA 3VQQA 4IO1A 2W43A 1NH7A 1WG4A 9ICVA 1T11A 4ES1A 3H8SA 3Q8YA 3ZZZA 5JVHQ 5BRHA 4JD2A 1EKRA 3N7SC 1U2VA 3C0BA 2DHHA 3L4QA 4QIWC 1ZAXA 3DOKB 4CF1A 5KFIA 2FLNA 4NLVA 3AOAA 1J6ZA 3VENA 1EHWA 1ZA2B 1X9JA 1Z4NA 1LWEB 4M2YA 2FJEB 5A8KB 1S22A 4BRDA 2YNIA 2F77X 1JB0C 4HTIA 2DIUA 3VF2A 4Q8FA 1RXWA 2RUGA 3CHWA 1WG1A 3MD3A 2IDOA 4WTOB 2IOHA 2EFPA 2GHPA 1YI2N 4AL5A 3VQTA 2XSJA 2KYXA 4H0OA 2AU0A 3HFKA 1R0BG 1GMWA 3DU5A 2WB4A 5HLFA 2HOIA 2M7SA 4JI5F 4QAGA 4B3TF 1T3VA 3NOCA 3THWB 2HWHA 4OI4A 1YLXA 5AQKA 5IOLA 1RT4A 4ZLLA 3BS5A 2KG0A 4BRFA 3BGRA 1FX4A 2OMOA 2OM6A 2F8LA 1BPBA 2DGOA 1ITPA 4K8ZA 1DT9A 4EX6A 3L09A 2ZH9A 4DHVA 5HMZA 2M88A 4PG8A 2XY8A 4C11B 4BC4A 4PY5A 2FY1A 2LEPA 4I9LA 3MGVA 3K4GA 2BM0A 3PMNA 3H42A 4OZJA 5J0OA 1MSWD 4C7YA 3D2WA 3IP4B 4AXJA 2XICA 1T9UA 1KOOA 3CI5A 4M7XA 3CSKA 4NLOA 3D6TB 4RW6B 1X2IA 4LRAA 2FXUA 1HBMA 3SV4A 3HJEA 1GAOA 3BS9A 2QWPA 5HMYA 1E6YA 2DNOA 3E01A 5ALVA 2CDQA 3EM1A 2CUYA 2GJFA 4ZPAA 3OFHA 4FJMA 2J4RA 1L7MA 2YMMA 3SJJA 3O6QA 4WP9A 4OYIA 1WOOA 5AKHA 4GVBB 4CHOA 1SKUB 1URNA 3EN9A 5HSPA 2XY7A 5FLXO 4G65A 4DFDA 4UBBA 4NY8A 3AA5X 4O3NA 5ALFA 5KAFU 3PNIA 2RD5C 1JLGB 1WSGA 4WXWA 5HVFA 4J9LA 4R5PB 3VA3A 1R7IA 2WONB 3VAHA 4M5DB 3CD0A 2RDJA 5TKYA 4DF4A 5HI7A 2XQCA 1KFDA 3BREA 2HYIB 2QB1A 3DM2B 1B4FA 2JHEA 3QAEA 1RI7A 2WUSA 4JK7A 4IR9A 3S3NA 2KB2A 1JJHA 5ALWA 2GZOA 3R8YA 3FE1A 3TSUA 2MTLA 4WF9Q 4R65A 3NP5A 3JPNA 1NSPA 3M6XA 5A2QY 4K5SA 1FNOA 1CQNA 3G71N 4U96A 4M9LA 2XY6A 2VHGA 4A2AA 2E8AA 4JWMA 3KMQA 7ICVA 3VMFB 4OX7A 4JV5K 3ISDA 4I2CA 1XMBA 2G4BA 4YP3A 3DOMB 1VQ6S 4K2JA 2XZWA 3TTCA 1OY6A 1J53A 5KI6A 4LR8A 4X5VA 4MN4C 5KFVA 4CJ3A 3MXJA 1TKXA 5BOMA 4EYHB 2VGNA 4C97A 2SXLA 1ZBTA 4DG1B 4FZXC 4O4GA 2BCRA 2J9EA 3KOOA 3PSTA 2FGCA 2YQ1A 2FPKA 3PW0A 2AMCB 2J0SD 5CZVA 4KY3A 4EP5A 1JCGA 4FWRA 3DCAA 8ICWA 3JSYA 3UN5A 3HL8A 1OXJA 4DCCA 2WSFC 3WT0A 1LKYA 4RT3A 3PRVA 3SAHA 4RTFD 5J2JA 4UBCA 1DQ9A 2R18A 4FZNA 1TAUA 2FHJA 4DV4J 2AJ4A 4BRMA 4RT2A 4W4MA 1GK8A 2HNYA 2UU9F 2HK3A 4DV7F 2P2CB 4EEKA 4Z4GA 3I82A 4ED8A 2HSEB 4L3NA 4R5PA 1N6QA 4MH8A 5KOWA 2BJ3A 4JI6J 2XBPA 3JPQA 4EBCA 3VQBA 2YMPA 3GU0A 2F1HA 2G0IA 2E66A 1KN6A 2FVPA 2FSKA 3CNHA 4DSKA 2A2DA 2ATCB 2YY3A 3O9TA 2O1PA 5ALXA 1WAJA 1IJEB 4BE1A 5J0PA 3MCAB 2M5YA 3I5AA 3TA0A 2XMKA 2DVIA 4NXNJ 1XI1A 4L75A 2WF5A 2ZJAA 2XTJP 2E5LF 4FF1A 3LWMA 3MTJA 4CTAB 1HIYA 4CRJA 1S1UB 2IS3A 5AQPA 1FRIA 3I32A 5HQLA 5J0XA 4DR3F 1HQUA 3D68A 2HRYA 2OHFA 1VQPS 2H5XA 3N4QA 4DQRA 1ZQLA 4NLUA 4JKAA 1BCOA 3TEGA 4RPYA 3N01A 5AQFA 2R42A 2D3OR 5K20B 2V4RA 3OTOF 3POTA 2W9CA 1UVMA 3KK7A 2VOOA 5B0AA 2KI2A 4OKEA 3V7LA 2BV3A 4J9RA 1X4CA 3M05A 3MWTA 2GS8A 3NNAA 1NXIA 1J5EK 3GV8B 4F2RA 2N82B 4HHJA 3O9SA 3FMBA 3VGSA 1V9OA 3A3PB 4ANEA 5LL6Z 4B3TJ 2CDRB 3TJAA 4U67Q 3OVAA 3D2FB 2IA0A 3LP1A 4HCCA 3HTVA 2HAIA 3H7IA 5JU5A 3MF5A 2P6UA 1V97A 4M5HA 2F8HA 3OVBA 1RPLA 6FDRA 5D4PA 4RQ1A 4CRXA 3PJXA 1RA7A 4RR5A 3T9NA 2FBXA 3M8PA 5A8KA 5KFJA 1SKSA 5HJYA 2BE9B 3A3OB 1GMWD 2YMQA 2ZIXA 4ED3A 2ZHBA 1BPXA 3RVCA 2FHMA 4YMEA 2OZMA 2K4PA 1RT1A 2C2NA 3OYIA 3ZD8A 2LECA 4B1UB 5CCMA 4OIXA 1FJ7A 2D1CA 1H7XA 4WFNQ 2KU7A 1NPPA 3C65A 1K8AT 4USAA 2NYIA 2FBTA 2EKNA 3LALA 2CPIA 3WBZA 2ZUCA 2DR8A 2AGPA 5C0YA 5FJ4A 2RE2A 1HHSA 3KVGA 2NUHA 4NRUA 2YJEA 2OTJS 4MYUA 4WIIA 4JI4F 4ZP8A 1NSKL 2ISPA 5FPEA 2HNZA 3THWA 4ZKAA 1QVGM 2LQ8A 4B9TA 1LWXA 2FSNA 3NH1A 3FZBA 2AEMA 1Q1KA 1H73A 6FD1A 2X74A 3ZSOA 4KMUA 5E41A 3CD6S 3ENBA 1D3WA 5KFQA 2ZNZA 4JB8B 1RBAA 1N5YB 2UXCK 1RAAB 4OHWA 4BWMA 4DL3A 2ZIUB 1ELOA 2V69A 5DDPC 5J2QA 3I55S 5BR9A 1GMVA 5DBCA 5JMVA 1TVAA 2W55A 3V9XA 4NYNA 3TFRA 1M90O 1QAIA 2KICA 4OPKA 5RUBA 3Q8RB 1DURA 1CLFA 1KQQA 1FDNA 5ALOA 3WK7A 3AQPA 3CO9A 4ECRA 1YGYA 3JTOA 2GWKA 1XUPO 3TJ8A 3LDAA 3UMGA 3B78A 3CC7S 2QYGA 4DOCA 3TARA 1BPZA 1SJRA 5B0BA 4QBUA 1VSMA 4M04A 3PXGa 5K8NA 1YVNA 3AV9A 1J5EF 4NB4A 4YB7A 4EI2A 3MUVP 1X4AA 3ITHB 1JLGA 2MSTA 2ZWPA 4IFVB 3AVBA 5BRDA 4MIWA 5CY4A 4WTYA 1JLCA 4C7QA 2HVDA 3VERA 2E20A 2GV1A 5BR8K 1B43A 1FF2A 2I7NA 2OUGA 4F02A 3QB0A 1DBDA 2F4FA 4MDBA 1GLCG 3HJFA 1RAFB 2B9EA 2YNGA 5KFBA 5KG7A 5AICA 4P2HA 3NLCA 3ZZRA 2CNKB 1TYQB 3ZETB 3C21A 1CXQA 4YCXA 2D74B 3J80Y 5CR4A 4NXZA 4K59A 1X9XA 3AAQA 4H5VA 4B9NA 1VFJA 5ETMA 3Q7CA 2HBJA 1BY9A 4JHDA 4JI7F 1J27A 2GVDB 4TSXA 5IT0A 2P9NA 3HHLA 7ICGA 2LDIA 5A2QO 2WRMA 3AQOA 4Z4CA 4A8FA 1UVKA 3GYXB 3N4PA 7ICPA 2BUNA 1V5IB 3RZAA 4UB3A 3M2UA 1BD6A 1HI8A 3CPEA 3ZT0A 4UOHA 5KT7A 2MQQA 4KV8A 4QU6A 2HVIA 4O8KA 3H08A 2RU3A 1XQIA 2GJ2A 7ICIA 3EY1A 1NM2A 4CF8A 1LAVA 4FPAA 1B0PA 1Y0HA 4GV3A 4WK1A 2F7TA 3PW4A 2Y3YA 3TSQA 4FXVA 3MK6A 3NG8A 1SS6A 2J5AA 5E7OB 4K4SA 4K4XA 4FM1A 4DO9A 2MSSA 3F2BA 2ZE2B 4F5OA 2ABYA 4XK8C 1D8BA 2CJ9A 1NRKA 3RJJA 2XI9A 2RJZA 5HQ8A 4CEBA 3IAS9 3NBPA 5ADXH 4A47A 3OXFA 3VA0A 3HZGA 1Q8LA 2G06A 2VQEF 4K0KF 1VQLN 3P83D 1O1WA 5KFPA 4Y2KA 2ZZTA 1X5SA 4TLRA 1ZQUA 1ZQIA 2V2KA 3TFSA 2IAJA 3M8RA 3G4SN 2OPRA 1BWVA 2V9KA 1JK9B 3W9HA 1K8KB 4BRKA 1EQYA 1LK5A 5M2UA 3UMBA 4F4WA 3M9NB 2AHOB 1QQ6A 1FKOA 4QZAA 4RNMA 3CCUS 4QR0A 5EUHA 2XIDA 3OL7A 4ES3A 2QLJB 1U49A 4DV3F 4RJVA 3CDAA 1U1MA 5I42A 4RW4A 3ISND 2CRLA 4DTOA 2LEAA 2R2RA 3QX7A 5L1LA 4LF1A 2W11A 7ICFA 3GJSB 3LDNA 5A0YA 1RTHB 4J9QA 2XCPA 2BJ8A 4UW2A 1PK3A 3RWUA 2FJVA 1L7NA 1HWUA 3ZZYA 3UQSA 2E8OA 1CUKA 4Y6IA 3LGHA 4HTJA 1WEXA 1XHXA 4C0OC 3O80A 5E3AA 3JS6A 1HD0A 4WFZA 1OY9A 3N6MA 3RAXA 2KD1A 4OI1A 4AFFA 1RQNA 3B82A 2H3EB 4ICAA 2Q0UA 4OZ5A 4I7FB 3EYZA 1HUOA 2KXHA 3EICA 3MWBA 2FPMA 3IBCB 4DB3A 5AXKA 3GFHA 3C15B 3VPZA 5I3PA 1QZ5A 4P2FA 4I2QA 3J7YI 1NLKL 2RILA 4BRAA 1TP7A 2P9UA 2P6RA 4ZH4A 4P0PA 3QYPA 2ZIUA 5I9EB 3LWLA 2APOA 3MDCA 1GEHA 2RQ5A 4NLSA 9RUBA 2EHGA 3UDLA 2J7KA 4JRPA 3DKDA 1WG5A 3Q8SB 3IKMA 3MBYA 3RJIA 1F5SA 1B99A 2OD4A 4CLKA 4LJMA 5L9NA 5IC6B 2JEGA 4LFAF 4ER8A 4IEIA 4ZPCA 2LM4A 3PRBA 3TA2A 3QT8A 1FKOB 5KT5A 5F8NA 4X4TA 4J9SA 2YHBA 2QWQA 3OFGA 1B92A 2ROGA 4EP4A 3X1LB 1TUGB 4IRDA 3HZ6A 3J8AA 1WKLA 3MDFA 4YR3A 3QU2A 4TQRA 1TGOA 2GMHA 3AQFA 1RT6A 2VDHA 4P4PA 4HTLA 1U45A 2DITA 4H0YB 5FLXU 1F5BA 2R7XA 5GADP 1UFWA 3RB3A 3IMQJ 2AX0A 1RABB 3CJ0A 2MDAA 3KFUF 3R1LA 4HHTA 4OJLA 4G6VB 4AILC 2YBVA 2Z2YB 3KLFB 3CTRA 4IS7A 1DK3A 3HX0A 2ZD1A 3K8WA 2QLWA 2BX6A 3ZEUB 1WYGA 2X78A 1XEZA 4FYDA 1G3OA 4Z94A 1ZQRA 3VC8A 4LF9F 1Y10A 1ACMB 2B8PA 3N97B 2BPGA 1YZ7A 4GKJF 2ZM6J 1C0UA 3AT1B 3LYSA 5AZIB 2Y9TA 1NHKL 2XWYA 4X64F 3BBFA 1SKRA 1W7AA 7ICQA 1WCNA 2AYMA 3O3HA 3ZSYA 4QIVA 1JCEA 1F3FA 1QVFR 3ENOA 2FC8A 2KJ8A 5BPNA 5ALLA 1GLJO 1E6YB 1NPKA 1CZ9A 4OJ5A 4IFEA 2RMLA 3MXHP 3F53A 3U9ZA 3R7BB 2VG6B 2ZBQA 1EB0A 1IJFB 3DDKA 4WKYA 4IUFA 3HCXA 2O8EB 4YDXA 1MU2B 1P9YA 2G5HB 1NK6A 3TW0A 2WMMA 4BVOA 1PILA 1VQ8N 2B5JA 1B0XA 4OMFG 4GLXA 4V19S 3LM9A 7ICLA 4RBVA 2YX4A 4RQ5A 1SJ1A 3OW2R 3SQ1A 3AEVA 2DTUA 4AHVA 2CWKA 3FK4A 3PHEA 3T5LA 3MI7X 5IWAJ 4CGIA 2YKAA 2DGTA 3MCPA 2A10A 2IDLA 1CJKA 3WHIA 2GO8A 4KH0B 3ZDDA 4CEZA 3NVYA 3LGMA 3IMXA 2RRNA 2ZDPA 2R8IA 1MWKA 3KFWX 1CJVB 2V9WA 3QBWA 1VQMS 4CLZA 1M5VC 4BRLA 4YD1A 2CG8A 2FB0A 2QL9B 2F4VK 2YMLA 1NGCA 3UB5A 1ZBHA 4Y2CA 4DV1K 3ETOA 1SKWA 1H1VA 5L8RC 1WSHA 4WCEQ 3FFIB 2ZC3A 2ISOA 2ZBRA 2E2QA 3M8SA 1RCHA 4KHQA 2CQGA 1HR0F 3H98A 4JI2F 4PL1A 4L73A 2OYQA 5EX3A 2F4VJ 1ZPWX 3BQ1A 2IJNA 3W9JA 1NJWA 4A8SA 4NLWA 3D3BJ 4JLHA 2YTUA 1Q8BA 3QEWA 1COKA 3EXYA 2MHNA 1RISA 3UXOA 4FLXA 5J2BA 4G9BA 2UUTA 3BGFA 1RYSA 2IBKA 2HBLA 5EX0A 1I94F 2B7BB 3TUPA 7ICHA 4Y2QA 2WBMA 4GNIA 4RW6A 1RFQA 1UA0A 1RTIB 2VQEK 3D7SB 3PX0A 1VQ8S 4H0PA 2V68A 1PVPA 1HD1A 2KKVA 5L1MA 1R27B 3DGPB 1HYVA 5CQGA 3UXNA 2UXDJ 4PGYA 3BB5A 4WU3A 4JI1K 1FT8A 2YWKA 2KIWA 2CQ2A 1XSLA 2CH5A 4LFAK 4GVBA 1SV0A 1LW0B 4M0AA 3AOCA 4FKYA 4QWAA 5U47A 3PUFA 4UB8U 5F2RA 2NREA 3KJQB 4CBXA 3PR4A 3QRQA 2X51A 3CPWM 4YB5A 1VSJA 1YQHA 2BW7A 1BI4B 2QLFB 5C2CA 1M5KC 4J9NA 2ZH7A 3U1LA 4QZIA 3D28A 4RW8B 2RHKA 2XGPA 3Q8QB 5ALYA 1XQSC 3J7A1 4YVZA 3R7NB 4UAVA 2BYCA 5KG4A 4IWVA 3T1HJ 1KAYA 3CJKA 3AVMA 4DG1A 3O9QA 2ZM6K 1ZA1B 4ELVA 4JI7K 2YQ0A 1WSFA 3RTVA 2CJQA 4C23A 3QDKA 4FLUA 3CEDA 1DLOA 3R5GA 1YIJS 4FLTA 2PFQA 4FYVB 4ZCMA 4FJIA 3CULA 3FGVA 2XULA 1YBTA 1RCOB 2V6AA 1KVJA 1LKZA 4RUBA 3D45A 2DNNA 3LOUA 1CULA 4PPDA 2NRTA 1WNSA 3PY8A 3C3LA 2BR0A 5JICA 1ZBUA 2Q31A 2CQIA 5IQ6A 1D9FA 4CWBA 2J76E 4HEA9 3WKEA 2PD1A 1JWWA 2E9ZA 2R7YA 3W66A 3H5SA 4YDUC 2BKPA 1PKUA 5AE2A 3W64A 9ICFA 1I94K 3IAM9 2VFTA 1ROFA 3J7YP 1M6YA 2H5JB 3QSYB 2UU9J 4USTA 5F3ZA 1N8RO 3C95A 5CE3A 3WK9A 1H2UX 1U48A 4QPTA 4Z37A 4XH5A 5FDLB 4M8LA 3HVAA 4ED6A 1TUVA 2KSOB 1OSDA 2CZ9A 2GCFA 1WHYA 1WACA 2D5RA 4E7KA 4NZ0A 2HLTA 2HQDA 3Q2TC 3MX2A 4NPOA 3QFPA 5DRKA 1FEZA 3H0LB 3CM6A 3TEHB 5J8YA 1CRXA 2V8HA 2F7VA 1IBCB 2NXUA 2EAOA 3MFHA 3ENWA 4M45A 2IJRA 2JC0A 2MZTA 1P8ZA 1S99A 3C7NB 3R1XA 1VOMA 3HSZA 4LRCA 3TTDA 1T3QA 1FESA 5D3GA 1WTFA 2F8MA 5HMMA 2QJ3A 1ATSA 2B43A 3FYHA 2D9PA 3UW1A 5CA5A 1VQOS 4ZITA 1I6JA 1OS5A 3I4PA 4Z4HA 5AHXA 2HIYA 2NRWA 5KT4A 2GAHC 5AM0A 4MO4A 2B6AB 3SD7A 4KGKA 3H5XA 1W2BR 2OAUA 2N1RA 3R9LA 1TTHB 5GTHU 3RJEA 1K1QA 2O8BA 3LP2A 4CLYA 2ZD1B 3PCOB 2QV6A 5B0EA 1YVFA 1CJVA 3HKWA 5HAOA 3RAMA 3VEVA 2VKRA 4IFYA 2DHAA 4IQVA 3LA0A 4RPFA 3J7AN 1TVRA 5DQHA 3SPZA 2PFDA 9ICTA 1NNEA 1K73O 3CCTA 5ETKA 2BVZA 1TL4A 3M8PB 2EVZA 4USHA 2ZGZA 5ETRA 7ICUA 3M30B 3KLGB 1RU1A 4CM2A 2ALYB 2HMXA 1LFPA 3F2KA 2AXTU 4OFZA 3F56A 4DPYA 3VQAA 4LD0A 4DTSA 2LQJA 1GH8A 4MK9A 2ATQA 5BOLA 3THYA 4CDIA 2HBQB 4ID5B 1JXLA 1WD6A 3CXCR 5HK4A 2A41A 1Q81T 1MDUB 5LL6d 2GUPA 1UT8A 3KYLA 3SMVA 3UO0A 2CWXA 2B7CB 3W61A 4L72B 2YX1A 1VJ5A 4CI0B 4IBNA 5EX5A 3H1VX 1D5AA 4CJRA 1RILA 9ICQA 2AP1A 2LA4A 2WF6A 2YPZA 2RQKA 3ZDBA 3TAQA 2P9NB 1WWUA 2LP4A 3O1WA 4DUZK 1F1BB 4OO1J 2FIUA 5IQQA 1QQMA 3PDNA 2HHWA 4B1VA 1CJTA 2QZ8A 1DTQA 1X4BA 1L8LA 5E0OA 1Q46A 3BZQA 3SQ2A 2DEJA 2QXFA 3I28A 3O3GA 5F3TA 2ZH1A 2CJYB 1VBKA 4AHSA 3FBCA 2VCPA 4U67L 4HR2A 4JI5J 3QFUA 5JLFA 4YHHF 3V4IA 2O01C 4X4PA 3U8XA 4KFBB 2Q0ZX 5D4NA 1SWWA 2D8CA 4ITSA 2P9CA 3ITHA 3PYGA 4V19J 1QQ5A 1S0OA 1FXDA 3IHQB 5HN0A 2LSNA 3ZSRA 5A2QU 2BEFA 4HACA 2F76X 4LF5K 3H0PA 3MMCA 1W26A 3T1AA 2LXFA 3P4IA 1FCAA 2P9EA 3CD6N 3CMEN 2VG5B 1WWVA 4DV0K 4NLPA 4I2JA 3V2UC 1XMOK 3BO2A 2UXBJ 1V9PA 3M2VB 1O13A 2XLKA 3GQCA 2VB6A 3D9BA 4ZVGA 3QUBA 2FJAB 4OYWA 3QGIA 4MKYA 1C7YA 3L8BA 2NUUG 4R0JA 1ZQNA 2DGZA 1K8KA 2MZSA 4PQUB 2DHXA 5BR8J 1CXUA 1EQMA 2HWTA 2VWKA 4WCEL 1HMVA 4UAWA 2Z57B 3EUNA 2KXNB 2UXDK 2B9XA 2FVQA 2G0JA 2XM3A 4FWNA 3NMAA 3OT9A 1YRXA 5B7WA 3DDNA 2CQ0A 4M6WB 3G82A 3HWTA 2WTFA 1AW0A 1KAZA 3QBCA 3PEHA 4X64K 5CWRA 2ASLA 4GKKF 1AQ6A 2MA1A 4RPXA 1BPEA 2HSZA 3J7YU 1Z26A 2Y8YA 2IA6A 2K7KA 2J0XA 3OYCA 3H8JA 2MMYA 2VFVA 2JXJA 3IP0A 1Y88A 4DV3J 1B3TA 1BNPA 1ZQWA 2D69A 5KFUA 5J0QA 4HH1A 5IXUA 3UKRA 1D1UA 3O8WA 3MN9A 1SPBP 3D7EO 3NXZA 1T0TV 3GDXA 4FYYB 3R8EA 3KKAA 3TAFA 4UF4A 4ECQA 1U1KA 2DKXA 4HCBA 2DO4A 3L2UA 2DFFA 2DH9A 4BXOB 3CD5A 3H2LA 4DV1J 1HA1A 3ZXWA 1APSA 1YJRA 3CFRA 3ZNJ1 4MF8A 1XK8A 1WC3A 1IG8A 1WKKA 3GIIA 4TURA 5BYQA 2P5OA 3HHNB 1N36J 3BQTA 3D0GE 2L08A 3I0SA 4IH6A 1PYOB 4CF9A 4QIWF 2ZOMA 3X3UA 4RQ0A 2Z30B 3B8AX 2IDEA 1HJPA 4FZMA 2K4EA 3NS1A 3C16B 2AX1A 4EK2A 2EFOA 5F8IA 4M9HA 5GAGI 1XR6A 2D1KA 4CEEA 4WF9L 2EW9A 3BEXA 4ZHRA 5F0WA 1NU0A 3L7OA 3UCZP 3RGIA 1R43A 2XWXA 2VBWA 5JVGQ 5KOXA 1T6DA 4QW8A 4DUYK 3CIPA 4I27A 3LK9A 4DR7J 8ICRA 2W3RA 1T4GA 1ZH5A 1SQEA 4MFBA 2VG7B 2UUCK 2ALZA 3MPYA 2KRRA 2HHSA 1LOTB 3UQ2A 1X1PA 3CCES 2ZKTA 1SB3C 4BCAA 1R0AB 4M95A 4B3TK 1FNXH 4K42A 2A40A 1U02A 5DS7A 3OXGA 4EUVA 1MWYA 2WSEC 4CJ5A 3GZ7A 4N47A 1VQ4S 4LSZB 1U1PA 4I67A 5AK5A 5IFMA 1NHUA 3MR5A 3UD5A 3J7Z5 1ITGA 1MN9A 4JYAF 4C8MA 3CDUA 1HYSB 1T94A 2HZCA 4YY3K 1R31A 2PXIA 2E5GA 4CD3A 3D6FB 4P0QA 3LAMA 3EUB2 5M2RA 4HDHA 3WK6A 2MQOA 2B6AA 3DRPB 5KG3A 1SQKA 1B70B 2D7SA 3JTPA 4KAIA 3OFFA 3C14A 5D0EA 3WDOA 2ACYA 4ZVUB 2HBZB 4NZ6A 4BROA 3BZKA 1W2IA 2QA4S 1UP1A 3BGOP 2CADA 4DN0A 4B3SJ 1VQ9N 1D09B 1XNQK 4J7CA 4PZNA 5AZIA 1SC1B 2CYYA 3NEKA 1FO1A 1ICEB 1Q78A 2ZH5A 3QMQA 4B3RJ 1R59O 5CZ2A 1Q7YO 2XMTA 3BF4A 4ECWA 2BKOA 1VQSA 2Q6CA 1XMOJ 1GLFO 4DV0J 4A8KA 2W25A 4GKKJ 1BHLA 1HNWF 3IDHA 1DOQA 1WKJA 2CPDA 3ZTOA 3G6YA 3QJLA 3JPPA 3HT0A 5DQGA 3B6OA 1IG9A 1C0TA 5ALMA 4FDFA 1RT6B 3QEPA 3BN4A 2DK2A 4L6V3 4QWEA 1RWKB 2P9LB 4ZIVA 3M8QA 2LYAA 3EE9A 3FAHA 2Z1IA 3QAUA 1G15A 4USVA 1NNLA 4H5WA 3WQTA 2V2VA 1KEKA 2FJXA 3D4JA 4WQ5C 3L7UA 1X5OA 3WNHA 4DTMA 3SI8A 1CQMA 3KNGA 5B0FA 5AM4A 3WKBA 4KR0B 2LPEA 3H4BA 4FN5A 2Z1HA 3SQGB 3VZHA 4LMZA 1WC1A 1TUYA 4B3OA 1L8OA 3H5UA 1Z1BA 1S8OA 3S3MA 4EWTA 2OPQA 3G4SS 5HP4A 4AHRA 3U4LA 2VYPA 2XHWA 1NMDA 3ZT4A 4CEOA 2BE7D 3MOZA 2ASJA 1HWKA 2DGSA 4F50A 4NLDA 1NM1A 1REGX 1C0UB 5T41A 1YX2A 2HHVA 4UB4A 1HRHA 1SJQA 1WF1A 2O3DA 4RNOA 3NCRA 3SCLE 2MU2A 1FJCA 4YXMA 5KAKA 5IIKA 4C1NK 2W4CA 2E7WA 2VJ4A 1B22A 3LP1B 3Q89A 1UOCA 1M1KO 4US9A 4YG2A 4C1NI 2PY5A 3UN3A 2HFUA 2UV8A 4YMOA 3Q7BA 1XU4A 2E3TA 1RWMB 3ORYA 3M32B 4PR6A 2K3IA 3TR5A 4DLEA 4KLHA 4MT1A 2XCAA 1YRUA 1TU0B 3QEXA 3R3LA 2OEHA 4RLEA 3T6JA 1OH7A 3FQKA 4OPHA 1IV8A 3C8YA 5AFUA 2VJ5A 2ZG6A 3ONNA 1NBWA 3MR2A 4ELUA 2W4PA 1GTEA 2QM1A 2KZZA 3MTKA 3HHLC 2G0AA 4B17A 3OA9A 3I5BA 4B1XB 3TO8A 1X5PA 1ZD4A 3NVZA 2KG1A 3SQOP 3NGIA 2KE7A 4IDHA 5BXIA 4PCQA 3FEZA 3OR1A 4PPZA 4PUOA 1VQKN 5C10A 8ICBA 2B9WA 4OZ0A 3SYZA 2IVMA 2RS2A 2H3QA 1RTDB 1GLEG 5HRSA 4RX6A 4A62A 2RF2A 2NRZA 4USMA 2MQPA 3V5RA 3CJRA 1KW4A 4GVEA 2JSXA 2B51A 1RAIB 3VCDA 4AT1B 4PL8A 5EY4A 4ZVFA 4BC5A 5KRTA 2HVEA 2D3DA 2EH9A 4N5SA 1HJRA 3A8KA 3DLHA 2MKJA 3W0LA 5C7PA 1G99A 4ZOSA 3PSPA 4QIGA 2AYGA 2VL1A 1URJA 3WU2U 3MEGA 1RT4B 3QYYA 1NZ8A 2P6TA 1XMOF 1M1GA 1ZQKA 4DL0C 1X8DA 4M3YA 5ALDA 5DMRA 4CIGA 1VRTA 3QJPA 3NRZA 2XZDB 1VQ9S 3RRHA 3TQEA 1FEHA 2XMAA 3WK8A 2HHUA 4LF5F 4YOTA 4HI2A 1L3TA 2ZVIA 5JXSA 4U6PA 2YX7A 3QT6A 2DCLA 1Q7LB 2E8NA 1YXQA 2YWWA 1RAEB 3V7KA 2VDIA 2XZTB 3CNQP 4ZHRB 4Q0BB 1Q5VA 1VHXA 3B6PA 1RTZA 2V63A 4KB1A 4DOZA 4B8AB 2YI1A 3MGIA 2B4PA 4I6AA 3SAGA 2WVFA 1XS9D 1TZ0A 4B3RK 3TYTA 1SAZA 2YB4A 1RTIA 1FWPA 3D6RA 5F8HA 3JPRA 1SC3B 2NQPA 2MKYA 5TKWA 3RG6A 1U1NA 4H5RA 3CW2C 3O1BA 3R5BA 2FVSA 3LQVA 4ENOA 3TNVA 2YY6A 1NGEA 3W60A 1RCXB 4RUCA 1ZBSA 1MG7A 2LYHA 1NAQA 2QLBB 2ZJPQ 1KQFB 3V1OA 5J2PA 2CGKA 3PIOQ 4NCAA 1YHQS 2NPFA 3OYMA 3CCUN 3ETRA 2Z2ZA 4PHTX 2W54A 3U3GA 4UY85 1QVGR 3UPFA 2V2ZA 4FKXA 5EVZA 8ICFA 3R9KA 1Z00B 5KFXA 3ISNC 4WFNL 4YMNA 2FGOA 1TK0A 4FWPA 4WFYA 3ZZ0A 3AA8A 3R1HA 1AROP 2MUTB 4ZJOA 7ICNA 3AGKA 3OGUA 4IKFA 3AO4A 1S9GA 1X3NA 2E5IA 9ICHA 4PXBA 1X5TA 1V4TA 3DLKA 2ZXIA 2GVZB 4PG7A 4CHQA 4DR7K 1N36F 4K4VA 5IIOA 4U8VA 1O6XA 3ZX2A 4I0WA 5DQIA 2EX3A 3BQ2A 1IV0A 4I7FA 4N8NA 5SUHA 1X4DA 4CK2A 2K8CB 4IQTA 4TUQA 2OGUA 3G87A 1OKJA 3H0RB 2B9YA 2I1RA 5LM7E 3PACA 1WOPA 2OP5A 4CF4A 3L2VA 3PRDA 1N32F 1ZM9A 3Q2SC 5E79U 2FMPA 2HQ3A 3K59A 4J03A 1C20A 2W1BA 4ES2A 2K4HA 3C7NA 4AHCA 3P31A 4P7VA 5A8RA 1NK5A 1P1TA 4DV2J 5JLHA 1EETB 1W25A 3P96A 2PIIA 4K5RA 4NV0A 4IZ9A 4A2BA 3CF5L 4NA2A 1ZYQA 4F67A 1ZQSA 2C2EA 8ATCB 4JWNA 1FE4A 1QH9A 1N5TA 1Q86T 1N60A 2XYGB 5LMNJ 3CJ1A 5ETVA 4I29A 2L9WA 3FKBA 4EFAC 4DL5A 3K7RA 5DM7L 4PYAA 4ZP7A 3ILLA 5AKLA 1HPZB 3W9IA 4PWDB 1IIPA 1JJ2M 5D77A 2QWOA 2G8IA 3IWLA 5C42A 1ZQFA 2MHEA 1N4LA 1O5JA 2P35A 4M94A 1BWFO 1HWJA 2N7YA 9ICXA 2V0NA 4X65F 4KHRA 4BWJA 2FC9A 4KN7A 2ZHAA 4F5NA 3GV5B 8ICXA 2I9SA 3D2NA 5DB7A 5L1IA 1CJTB 2E7VA 2IM3A 4DKWA 2BDPA 3R5JB 3DXMB 2V50A 3QU9A 5CYMB 1B7FA 1C0FA 3OVSA 3CDEA 4YXJA 2V8GA 4D3GA 2YWEA 2FHJD 3CCLS 1HEKA 3MHYA 2GBZA 3PM9A 4KLOA 3L3FX 2C3UA 3NE6A 4CTAA 2Y0BB 1HHTP 1A5VA 1UWAA 3ZI4A 1HBOA 3UNYA 1NGJA 2OO4A 3DI6B 2HFOA 4OLPA 4LF6F 4TU9A 5KFSA 4B3MK 4JKHA 4FF4A 1SIZA 2DR6A 4ZLNA 4NL9C 1KN5A 3SENA 4RBUA 3ZEUA 1ZD3A 1D4XA 4ETXA 4U7UD 2EFQA 5HMXA 1REVA 4CJPA 2PZSA 4UQTA 5IWAF 1WELA 2F63A 4OYPA 4NM2A 1SH3A 2WW8A 3HKZD 4RWTA 2CN1A 4NI2B 4HWIA 3AB4B 2G8HA 2KKHA 2G8WA 5DM6Q 4UY8T 4MQ3A 3FFKB 4LR7A 1MMLA 1FKPA 1P1LA 4AF1A 5EE0A 3T5HA 2PGCA 3LTOA 1KQSR 3DYAA 1N6QB 2B6GA 1OY8A 2AQ4A 1M5SA 4FVCA 3KZBA 3CGIA 4FZZA 1GX5A 5FRMA 2EFGA 4YN3B 3FQLA 4LR9A 1ZQ1C 4BGBA 2E1RA 1DTTB 1ZQDA 1QM9A 1OPZA 4FO6A 3I1YA 1NDKA 2W03A 3GOIA 8ICCA 2R7TA 7ICOA 5A6PA 4WQ4C 2DY1A 1BPDA 1ZZFA 2WVCA 5LXRA 3MMCB 2W9CB 4YFKA 1BIZA 3RJFA 4LSLB 3UD3P 4CZCA 1S7HA 1RAGB 4PRFA 1TV6B 1O08A 3RRGA 2FE9A 4UZCA 4RWWA 1SIJA 1SJ4P 2MRLA 4FFDA 3GJTB 4CLSA 2P51A 2FBVA 3RBEA 4X4VA 3MMAB 5B66U 9ICSA 4ZPBA 3K58A 2UUAF 2M4MA 2DEIA 3R2CJ 2XO7A 2LBOA 4FVUA 4Z0UA 1Z4UA 2KK0A 4JV5J 5F1XA 3KK2A 1VQMN 3I56N 1GNKA 4AQYJ 2LKYA 1BU6O 1QTNB 2CNNB 1KTQA 2KNJA 3GIRA 4EHUA 4JV1A 1JLAB 4PWUA 3W7BA 1MLAA 2QYCA 1YITS 1KVCA 1WB9A 3TU5A 1SUQA 4J9UE 3I5CA 2UUAJ 1PJ7A 8ICYA 2UUWA 2H54B 3JXOA 3KDOA 4B02A 1IKVA 4DU4A 4DTPA 4LF6K 4NE9C 1WSRA 3HFVA 4DCJB 4H5TA 5AKGA 5E3PA 3FLCO 1IBMK 3FZKA 2EWSA 1SQGA 3US5A 2KVIA 4BRIA 3AXKA 2BANB 3NF9A 2V7ZA 4C4WA 3KLIA 4PL7A 1XBWA 1LW2B 2YQEA 3BKUA 1YT3A 3RH6A 2WFBA 3C1YA 1UT5A 1VSKA 4UOCA 3QUQA 4KSEB 4P72A 1C0GA 3DRSA 2DRDA 2NRVA 3CC2S 5AQTA 3OTBA 2OI2A 5BREA 2JWKA 3BO4A 3H8YA 3BSNA 1FDDA 2LVWA 5AQSA 3Q8MA 5LXYA 3NGZA 4TY9A 3RB4A 3HZEA 4OI2A 5JMNA 3TA1A 1U25A 4FYXB 3JSBA 3AVAA 4PXCA 4NLYA 3D6JA 3BF3A 3WUHA 3IG8A 3UCGA 4O5KA 2YNGB 5ALRA 3DLKB 4KO0B 1S6PA 4LF6J 3E2EA 3HVWA 3V9WA 1GXLA 4DTNA 1Y64A 3M2UB 1Y7PA 5DG7A 2FJWA 4GV9A 4B1ZA 2W9MA 3QO9A 3K1ZA 1RAHB 1C1CA 3BN7A 5ETQA 3L2WA 1NGAA 4N56A 5A8WB 4U8YA 5EWFA 4RNFA 3CQXA 3H0MB 2VODA 2L41A 3DFEA 1RGIA 2F1JA 1ZQBA 3E58A 3TWZA 3KK1A 5AKEA 3S6JA 3KLVA 1UL3A 4YOEA 1YJNS 4TXSA 2VPYB 4TNOA 1ZQGA 2WC9A 3BDEA 2K3KA 5B5EU 4RU9A 1RAJA 3CCZA 3PTWA 3C16A 4K4ZA 1NKCA 1Y3KA 1Q4RA 4QWCA 5T7BA 5IM0A 2QIFA 1Y97A 4CH0S 5AXLA 4BR0A 3AVCA 3MD1A 2EG2A 2V52B 4KLSA 1VQLS 4IKAA 1TK8A 4KLEA 2KDOA 4XRHA 2POKA 1H98A 5CAAA 5FD1A 3IV6A 4KRWA 2M9NA 2LHTA 3QETA 3ULDA 3TZZA 2KVSA 5J8YC 1LW0A 1E3MA 3WXIA 4M47A 3KXDA 4XH1A 2NCKL 4Q2MA 1BVSA 2R7QA 2JNJA 3MR7A 4MFFA 2VA3A 5K8OA 1XHZA 4PQAA 4Q44A 2EBGA 3Q8VA 4KLDA 1Z3EB 4ID8A 3VV2B 2CJKA 3GB0A 3UVJB 2HHHK 4DSEA 3M8YA 4CO0A 3GR0A 4X66J 3MDQA 4N76A 4ICLB 2OSQA 2R8HA 4UB2A 1XR5A 2P9LA 5CJ7A 1YZ6A 1HHQA 2OPPA 1F44A 3P1GA 4PA1A 3ZZTA 1XNQF 5KFEA 4BR2A 1VQ6N 5C42B 2HGNA 5AQOA 3T1HK 4OV6A 2BA9A 2RPIA 3AGRA 5EU7A 3OL9A 1Q3VA 5BN9A 4KV8B 2PI5A 1PVRA 1CULB 1VRUB 2CZ4A 5A0YB 4A8WA 5E2QA 3BBCA 3DWLA 2I8EA 4IOBA 4FBUA 3D0IE 3QFWA 3MN7A 4WE1B 2HRTA 1COOA 2MGZB 2Q2RA 4KBOA 2YJFA 3G71S 2I7PA