1NK9A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after two rounds of primer extension, following incorporation of dctp and dgtp.
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk9A01
4RUCA 2X78A 3GV5B 5DG7A 3ZT0A 3AVJA 5J2KA 1LB2B 4DSIA 4M2YA 4O5EA 4FK4A 9ICPA 3DRSA 4RPYA 3M9NB 2BDPA 5DQGA 1QSSA 2A1SA 4MFAA 3Q8PB 3NF8A 2PFNA 3RH6A 1SKRA 2BANA 4Q44A 3Q8KA 4OPJA 4DU1A 2FMQA 1T3NA 3M8RA 4FZYA 4IQVA 5DK5A 7ICRA 2I1QA 1KDHA 3ZD8A 5CYQA 3ZCMA 2D0AA 7ICSA 2ZUDA 1WSGA 1ZQKA 5F9LA 1RT7A 5DB7A 5SZTA 5I42A 4JRQA 4DU4A 1UA1A 3UQ2A 5C25A 2P51A 4ID1A 2C22A 1S0VA 1C1AA 3HT3A 1L3VA 1C0MA 2BKEA 1DLOA 5KFFA 3H4DA 3SI6A 1HNVA 4EYHB 1NOZA 2ZTCA 8ICAA 4YD2A 4ELVA 4PHDA 4B9UA 5CZ1A 4DFMA 1Z26A 5FRMA 4CF2A 9ICQA 2NRTA 4O9MA 5HP1A 3QE9Y 2Q0ZX 2BCSA 5CYMA 2JLEA 3MDCA 5KG4A 5CR0A 2R8JA 4EBDA 1ZQGA 3JSMA 3CQ8A 3K2PA 4PA1A 4ZHRA 1RT3A 5CA7A 2YNFA 3ZT4A 5J2FA 3HK2A 1ZQUA 2E6MA 4CF9A 4M3TA 3BQ2A 4C8MA 1FK9A 2PXIA 4RPXA 4E89A 4IQUA 3V4IA 4DSLA 4EZ6A 3HVRA 1T8EA 1FKPA 4AHSA 1NKBA 1VSKA 4EP4A 3THVA 3RH5A 3MR2A 4DTPA 2P66A 1S76D 4R63A 3PO4A 4RG8A 2XY8A 7ICTA 1HRHA 3VQ9A 4DU3A 3KHRA 3RR7A 4CJRA 4O3PA 4ECVA 3LAMA 3OYBA 2OZSA 3B0YA 2PY5A 1ZQQA 2I9GA 1BISA 1HUZA 4K8XA 3MR3A 2C2EA 4PY5A 3H40A 1S1UA 3AVKA 3NDKA 2ZJAA 3BQ0A 8ICHA 4JLHA 4Z6FA 4DTJA 2BQRA 4AHVA 2OYQA 4E7LA 2LYHA 9ICVA 1LW0A 4R8UB 4IG3A 4C8KA 8ICZA 4CF0A 4RQ6A 4KHUA 4RQ4A 4M6WB 1RT2A 4DTRA 3DMJA 1B9FA 2BPFA 5DBBA 3OY9A 3QZ8A 3ISNC 4AH9A 2ASLA 2HNZA 5KFHA 4BXOA 3NH2A 3AVMA 1ZQHA 1N6QA 4TQRA 5J0TA 2GUIA 5C5JA 4O5KA 1RYSA 2IHMA 3NFAA 3HO1A 3EW9A 5IIOA 4NY8A 1GOAA 2AQ4A 3SZ2A 1D9DA 1ZQPA 3FFIA 5DDMA 3WNEA 2OZMA 1U4BA 3LPTA 5KG0A 4CJ5A 4J9MA 4HHTA 2XRIA 1JLEA 5KFDA 3FDSA 4GXKA 4I2GA 4KMUA 1KFSA 3I8DA 1VSLA 4ED1A 1NJYA 1CXQA 5KFKA 4O0JA 3RRHA 3TFSA 3RB0A 2XY7A 2P5GA 4IQWA 7ICPA 4MF8A 1A5XA 1RDCA 1MQ2A 1BPYA 3ZSXA 2DTUA 1FXXA 3T5LA 3U3GA 4J9QA 2PI4A 4O3NA 3OYHA 1KFTA 4I2JA 1J5OA 3ZSRA 4FJGA 3OSNA 3JPQA 5J2QA 4CGHA 1A76A 8ICJA 5EWGA 1TKDA 1CXUA 3LWLA 2VA2A 5BOLA 4ID5A 1T4GA 4CEAA 4FS1A 3UIQA 5CB1A 3PW2A 2IAJA 2FLNA 3PMLA 4DSEA 4DFKA 2W9AA 3AVIA 1QSYA 4GXIA 1N48A 4KI4A 3RJHA 4CGFA 1WAFA 2JEJA 4KN4A 5HHIA 4M9NA 3ISBA 4N56A 2F8SA 2DPIA 4JS4A 3RMDA 5DG8A 1VSFA 2W9BB 4XUSA 3L2QA 4IQTA 5HHHA 4F2RA 4OJRA 1S0OA 1ITGA 3OGUA 4O3OA 4F92B 3TARA 9ICOA 1K6YA 3VQAA 1EXNA 5KT5A 4FBTA 5KFXA 4CFBA 4AHUA 5KGXA 2P6UA 2BR0A 3JPRA 3KD5E 4CJPA 2XCAA 9ICHA 1WAJA 4CJ3A 3MR6A 2ZUBA 5KGWA 3LZJA 3LALA 5L1JA 3DLHA 2QXFA 3MFHA 4Z6CA 2Y1IA 4KLDA 3O3FA 1BPXA 3AVNA 3RJIA 5IILA 4RW6A 4JWMA 3NBPA 5KFJA 4PUOA 8ICGA 3TQ1A 3C94A 4JWNA 3M8PA 4DL5A 3C23A 1ASVA 4FJ8A 5KTQA 4DL4A 2V4RA 3RH4A 2F96A 4CJUA 3K5MA 3SQ1A 3C21A 4ECUA 2A1JB 2G8WA 1L3TA 5HRPA 2KZ3A 4CFCA 4LVSA 2E6LA 1IG9A 1S1XA 2FLPA 1KLNA 4CGDA 3NTUA 1SV5A 3LAKA 1KLMA 4RQ2A 4PHAA 3GFKB 3AU2A 4O0IA 2VWJA 2H5XA 4FK2A 2VWKA 3RAXA 1LAWA 3PW7A 5CP2A 3ISDA 4QOZB 3HP9A 4Z6DA 1S1WA 4G1QA 4M47A 5J0WA 5J2DA 4ED8A 4ECTA 1C6VA 1ZBIA 2BQUA 2C28A 1MU2A 1JMSA 3MFIA 4W5RA 3HPHA 3VN5A 3HYFA 1PZNA 4DLEA 4QWAA 1LWCA 2B4JA 4B8AB 1XU4A 4DQIA 3RTVA 8ICQA 1A5VA 3SV3A 3RB3A 1HYSA 4YP3A 4UB1A 3RAQA 4YMOA 8ICCA 8ICKA 4CF1A 1D8YA 4B9TA 1LWFA 4CFAA 3TABA 3BDPA 4JV1A 4QZCA 5KFSA 5HRRA 1JXEA 4YR2A 4KLLA 3L8BA 4FJLA 1I39A 4FJMA 3AV9A 5KFYA 4FLTA 3SUNA 2YKMA 4CECA 2ZQBA 4UBBA 1IM4A 4QAGA 3VQBA 3QEBZ 1TV6A 3AA2A 2UVRA 1RBSA 3WNGA 3LP3A 2JZBA 1IKWA 2X6NA 4CF8A 3RJFA 3P83D 8ICPA 3VA0A 7ICJA 4OPKA 4RZRA 5DBAA 3PMNA 2FPKA 4YFKA 2O4IA 5D46A 4C8OA 3Q8LA 4R66A 3C6UA 3Q8RB 3ZDDA 2XHBA 2XC9A 4CK3A 2IHNA 2XY6A 1NOYA 4FJ9A 1S6PA 5CJ7A 2QKBA 4Z4FA 4CEOA 9ICTA 4J9KA 3H08A 2MUTA 4LSLA 4LSNA 3AO5A 3DOLA 4FLVA 1NKCA 4I2HA 3KK1A 1MSWD 3PX6A 5KFTA 2E4LA 4FXDA 2V9WA 3TI0A 2JEGA 2C2RA 4AHRA 3GILA 4F4XA 3K5OA 3DLRA 8ICOA 2AGPA 3MEEA 3MXJA 3HL8A 1XSNA 1WSJA 3PNCA 4RT2A 1RBTA 2M9NA 4QWEA 4ECYA 2YKNA 2G8HA 2XO7A 4R5PA 2ETJA 3IHQB 4MFCA 3KLIA 2PYJA 1JLCA 4DF8A 4F4KA 4I9LA 3QZ7A 3TAMA 3QETA 4MEXA 1CEZA 4NM2A 4W5OA 4AHTA 5DBCA 3KHHA 1DGSA 9ICXA 3TR8A 4LZDA 1EKEA 1VSEA 3EY1A 3L2WA 1S6QA 8ICLA 3HWTA 4J9PA 3OJSA 1SL1A 2YHAA 4YR3A 1RTJA 1N56A 9ICBA 4ECSA 3MXMA 4FJNA 1X9WA 4TURA 4GMJB 3SPZA 4NLNA 8ICNA 5KT2A 1QQCA 1X9SA 5J29A 3HJFA 1U04A 3OYGA 1KFDA 4KHYA 3K58A 4F5RA 3OS2A 4F3TA 3M9MB 4FZXC 3PX4A 1YTUA 3NGZA 4DS5A 3NH1A 1A5WA 4J9OA 4FBUA 8ICWA 3V1RA 2J6SA 3ASMA 1ZQDA 3HW8A 4TQSA 3KTQA 2ITGA 3RWUA 4MF2A 3VQQA 5KFAA 1X2IA 1RT4A 4RUAA 4ECXA 4CESA 4M9HA 1RTIA 4IDKA 3C2LA 2WOMA 1HJPA 4F5PA 3RMBA 3O4NA 1SUQA 2FPLA 1ZJMA 4F91B 4FVMA 4FZZA 4Z4EA 2ATQA 5HMLA 9ICEA 4CEBA 1K1SA 5KFUA 3DI6A 4Z4HA 3NF7A 3K4GA 4RPZA 4K8ZA 1XWLA 1L5UA 2PFOA 5DGAA 2JGUA 3AA5X 3QEXA 2HVIA 5KG2A 3C5FA 2JEIA 1D5AA 4J2EA 1COOA 4TUPA 4LH5A 2XGPA 1VSHA 2HHXA 2KQ2A 1UOCA 3UXNA 3V9XA 1RZTA 4DL6A 1VSJA 2YHBA 1S0MA 2F1HA 3TANA 3GV7B 3C6TA 1QSLA 4E1MA 2O4GA 1WNSA 1K1QA 1KEJA 4W5NA 2PYLA 4BDPA 1UA0A 4ED2A 3AA4A 2HNYA 3T5HA 4JS5A 4B3OA 3OYEA 8ICFA 4FLYA 2FBTA 5IIKA 4HCBA 1ZQXA 4FM1A 1BI4A 2IDOA 2KZZA 3JPSA 4KAZA 2W9CB 2AQ0A 3OHBA 2BCQA 2D0BA 3GV8B 1BCOA 3MAQA 5J2HA 7ICKA 9ICFA 1Z00A 2Z1GA 4CJSA 3ZT1A 4IG0A 3CM5A 5J0SA 1T7PA 4F4YA 5CZ2A 3MABA 4FLZA 4PH5A 1XHXA 5HRSA 2F1IA 3KKRA 2NRZA 4CJ4A 1TGOA 2VG5A 3AO4A 2ISPA 4UAZA 4BWJA 4M0AA 2BE2A 4WE1A 2UVVA 1SKWA 4MFFA 3QNOA 1ZQMA 2ZD1A 3PW4A 5L1IA 2ALZA 4LD0A 3BQ1A 2PFPA 1SKSA 4ED3A 1TVAA 4Z4GA 4XA5A 4KLSA 5HNKA 5IIIA 4QWDA 4FLXA 1LWEA 5J2GA 5L1LA 5FRNA 1DTTA 2RF2A 5DQHA 2X6SA 3HX0A 3K59A 3QIPA 2NRWA 3TAQA 4J2BA 4KKOA 1HUOA 1BHLA 9ICUA 5DB9A 4BE0A 1TAQA 4M04A 4DL2A 4K4GA 2NUBA 4MEYA 2VG7A 4W5TA 3QEPA 4I29A 3OYJA 3KD1E 1HYZA 3OYAA 5HLFA 3KJVA 3V9ZA 4R64A 3PY8A 3HPGA 4RQ5A 4ELTA 1S1TA 2ISOA 1ZBLA 5IIJA 8ICEA 8ICYA 4ICLA 4KB0A 3WNHA 3NH0A 5J2CA 4CGGA 9ICJA 2IMWP 4HYKA 2MAXA 1WN7A 3T5KA 4J2DA 2R8HA 7ICLA 3BJYA 4M42A 1VRUA 4OVLA 3RB6A 4DG1A 1ZBHA 1HYVA 2AGQA 4CIFA 4IR9A 2VA3A 1WSIA 5KRSA 1HJRA 3CFPA 4DTSA 1AROP 1B92A 4CHNA 4ECZA 1RCHA 2BPCA 2BCRA 3S9HA 3KIOA 1ZQOA 3GQCA 4M3XA 5J2PA 3TAGA 2IBKA 1EP4A 5BPCA 4R65A 3MECA 3JPOA 4IRKA 2KZMA 3VQPA 3VQEA 5BOMA 3LP0A 3S3NA 1Z25A 4QZAA 1S0NA 4B9SA 1G15A 4CEFA 3DM2A 2FMSA 3K5NA 4GW6A 9ICAA 4DSFA 4CCHA 3C1YA 1EX4A 3AVCA 3L3UA 4I9QA 4FO6A 4P4PA 4DWIA 4N5SA 4FYDA 4UAWA 4QZHA 3ZDAA 5J0XA 7ICMA 1TK5A 5D3GA 3Q8SB 2X74A 4J2AA 3KHLA 3CFOA 1VSIA 4GVMA 4CHZA 5KFEA 2IC3A 3MEGA 4KI6A 3QEAZ 4GC6A 4IFYA 1TKXA 5KFIA 4KLTA 2VANA 2PZSA 3N97B 5HBMA 4M41A 3O4QA 3GIJA 1NJWA 4FCYA 1B9DA 5IINA 3MXIA 3ZDBA 1L3UA 3CG7A 5KG3A 4DQPA 5J0PA 4CIGA 2HMIA 3TAPA 3AA3A 4DO9A 4PHPA 1S97A 3LDSA 4F93B 3U6FA 2RPIA 3OYIA 1W9HA 5DB6A 2HHUA 1ZQBA 1RDBA 4Y1CA 3SPYA 4KPYA 4I2FA 5JUMA 2GBZA 2I5JA 3QO9A 4ECWA 2XY5A 4GLXA 3V7KA 1VK0A 1CLQA 4YMMA 4Q45A 4Q43A 4PHEA 4C8NA 1WCLA 3AVFA 1HPZA 4YQWA 4I2CA 4RNMA 3OYDA 4KHQA 4NLKA 3HVTA 3NGDA 1R0AA 2QKKA 3WNFA 3D45A 4KO0A 2ATLA 4G3IA 4HVJA 4RW8A 4FJIA 5F9NA 4I2IA 5SWMA 3LZIA 4DSKA 1RDDA 4EP5A 1UT5A 4YCXA 5J0RA 4CJLA 3G0ZA 4O5CA 4CGIA 3RB4A 4BACA 3PW0A 7ICHA 1JXBA 3PUFA 3VQ6A 4QZDA 4KV8A 2WONA 3D0PA 5J2JA 4CIEA 3KK3A 4NLZA 7ICEA 4I28A 5HROA 5KFQA 4CEEA 4I2BA 2KN7A 9ICMA 4CJVA 4JK1A 1Y88A 4H4MA 4PGYA 3ORYA 4KLQA 4UB2A 1J9AA 4O3SA 1C0UA 3OYKA 1BGXT 4HCCA 3NGIA 4CHQA 1HMVA 3HXMA 5DKWA 1ZQTA 5J0QA 1RNHA 1EETA 2A1RA 5KT6A 1GOCA 1HQUA 2P6RA 3H7IA 8ICVA 4BE1A 3V6DA 3LK9A 4BXOB 3V6HA 1S9FA 3L3VA 4Z4IA 1ZQYA 3IM1A 5EOZA 2HHTA 3QEVA 5DQIA 3QINA 2G8IA 3B0XA 3AVBA 3V72A 2Q3SA 4UB5A 1RXWA 3ALYA 1QS4A 4DLGA 1VSDA 3ZSVA 4W5QA 4YN4A 1YT3A 2G8FA 3B6OA 3VQ4A 9ICSA 4QCLA 2BCUA 4YG2A 2FC0A 5KFPA 5HRNA 3VQ5A 1QE1A 3MBYA 3ZT3A 1C7YA 1ZBUA 3LP2A 4KFBA 3EPGA 7ICIA 4O3RA 9ICNA 3M9OB 4QWCA 4CJTA 4H4OA 1DTQA 4J9RA 3DYAA 3RJKA 3E01A 4QZFA 4E7JA 4FJKA 3DLEA 4CE9A 1CUKA 3KHGA 4JV2A 2B6AA 1SZPA 5I3UA 3M8QA 3NGYA 4F5QA 1C1CA 1Q9XA 1F21A 1JXLA 1JLBA 3PV8A 2ZJ8A 4E3SA 4CJWA 1ZETA 3V81A 3H8SA 1SL0A 4F3OA 5J2BA 2HB5A 3H8WA 3ITHA 3S3MA 4CHPA 5KFCA 4DTUA 4JRPA 4UAYA 2XCPA 9ICCA 4KLGA 3ETLA 1SL2A 1JLQA 3DLKA 1J54A 2Z1JA 4YXMA 1D9FA 2P1JA 4CGJA 2R7YA 4E1NA 1RTHA 3V9WA 4F8RA 4Q8FA 1BPDA 4Q5VA 2IGIA 4CJQA 3ZD9A 4ZTFA 3A2FA 4R8UA 3V7LA 3L2RA 3LPUA 4DOAA 5HMMA 3ZT2A 3PVXA 4JUZA 4YR0A 4M6WA 4GC7A 3V6JA 4PWDA 4PPXA 4CK2A 4B9MA 4K4HA 3RJEA 3SQ4A 2YV0X 1T05A 3KLGA 3C2MA 1NKEA 4UB4A 4M9LA 3GIKA 4RQ8A 2W8LA 4F2SA 4RNNA 3ZSZA 3EWAA 3C5GA 3KLHA 1IH7A 3L2VA 1UWBA 5KFWA 2JEFA 1HQEA 1S1VA 1MC8A 2HNDA 1BPBA 1BIUA 4M3RA 3DLGA 1RBVA 3SQ0A 3LP1A 3KK2A 3MDAA 4EYIB 1LAVA 1RT5A 2GV9A 3B6PA 5E41A 5JS1A 1TKZA 5CWRA 5J2EA 1S77D 8ICTA 4QW8A 1BPZA 1JLAA 2PI5A 3PR4A 2R8GA 3M8SA 1C1BA 3MGIA 1ZQRA 3P5JA 3IAYA 1ZQEA 3SI8A 1BL3A 3RR8A 4YNQA 4LY7A 5IIMA 3S3OA 1TKTA 2KTQA 1RYRA 2DFFA 1N5YA 1JLFA 2IOCA 4FLUA 3RRGA 4FW2A 3T19A 4OKEA 4MQ3A 4FLWA 2ZTDA 3OYNA 1A77A 3QEWA 3V1QA 3SQ2A 5L1KA 4NYNA 1H38A 2XGQA 8ICUA 3HPOA 1O1WA 3LDAA 1ASUA 4OKKA 4FJ7A 3G6XA 3C2KA 4KN7A 2DFHA 1U47A 4Z6EA 4EZ9A 4OKJA 2FLLA 4RT3A 5T7BA 3AU6A 4ECRA 3F9KA 4OGCA 2OPPA 1HNIA 2W9BA 3KKSA 1KCFA 1GOBA 3PR5B 1BQMA 4BDYA 3I0SA 3UQ0A 4HTUA 5J2MA 4DOBA 5L9XA 4Q0BA 3TAFA 1TK8A 1RPLA 1KTQA 2JZBB 4J9SA 1J53A 3SCXA 4RW9A 3KLEA 5TZVA 4XQ8A 4QZGA 1ZYQA 3K57A 4KHWA 3AUOA 4N47A 4OLBA 5DLFA 3DRPA 4DTOA 1U9LA 2EHGA 4M45A 2NRVA 3SNNA 2UVWA 5KFBA 1XHZA 2OPSA 2G8VA 3OHAA 4ZH4A 3MGHA 2P5OA 1KSPA 3OJUA 2MUTB 2D0CA 1REVA 3T1AA 2DY4A 3TFRA 8ICBA 3LWMA 4OLAA 1NK8A 4IRDA 1U48A 3TAEA 4KREA 4I27A 4M3UA 3CFRA 4BDZA 3ZSOA 3DOKA 3GDXA 3VQ7A 1IKYA 1B22A 2RKIA 4Z4CA 2BHNA 2FMPA 2UVUA 4KLUA 1XS9D 2A1JA 2ZE2A 4Q8EA 4YXJA 2VG6A 5DB8A 8ICSA 1BPEA 4DTMA 1LV5A 1S9EA 3QEIA 7ICNA 4TSXA 3PW5A 5KT4A 3F73A 4HUGA 1I3AA 4E7IA 4IRCA 4P2HA 4DQRA 4DL3A 4M9GA 1TFRA 5D49A 4KRFA 4DMNA 1ZQWA 4KITB 2ASJA 4KLFA 1YTAA 2B5JA 2HHQA 2Z1IA 7ICUA 2BGWA 3OS0A 3VQ8A 1XO1A 3MEDA 4CEZA 4M3ZA 4XRHA 3UXOA 1NK9A 3DRRA 1LW2A 3U3YA 4I2DA 4ELUA 2NRXA 9ICIA 4DOCA 4DFPA 4DQQA 4FJJA 4FJ5A 4UB3A 5K14A 3OYLA 4QZIA 5EU7A 4CEQA 2F8TA 4O4GA 1RT1A 4P4OA 3ZSYA 4J9LA 3V9SA 5CHGA 1QTMA 4DTNA 2BQ3A 4DSJA 3VQCA 1ASWA 1IO2A 3JPNA 5KT7A 4F4ZA 8ICMA 3EYZA 2BGGA 3ZSWA 5CY4A 2FBXA 5DG9A 5KFMA 1TV9A 8ICXA 1WSFA 2PFQA 4N41A 3GIMA 4EEYA 1RT6A 4HUEA 2V4QA 3G10A 3SUPA 3AVAA 2IA6A 2BPGA 2YNIA 4FS2A 3N4MB 3V7JA 4QZEA 3HSTB 5JS2A 3AVLA 1RILA 1S9GA 7ICFA 3G6VA 4L8RB 2VA8A 1ZQSA 1ZQAA 5DLGA 4DQSA 3SJJA 4LH4A 1BCMA 5C24A 3NCIA 4KLEA 1U49A 4YFUA 3L2UA 1U45A 3CYMA 2R8KA 2RDJA 5KG5A 5KFLA 5J0UA 2HVHA 5DGBA 5KT3A 4RQ1A 3Q8MA 4DL7A 5J0YA 4EBEA 1S10A 4NCGA 5J2AA 3RMAA 4CK1A 2W9MA 2ZUCA 9ICGA 3V6KA 3OVNA 3QESA 4ZTJA 3DLBA 4TUQA 1TVRA 1WSEA 3Q8QB 4F5NA 3EZ5A 3P1GA 2WTFA 2QK9A 1IKXA 4NCBA 4YD1A 8ICIA 4F50A 2IS3A 2D5RA 3O3GA 4FJHA 1JN3A 1QHTA 5KG1A 3O3HA 1TAUA 3G6YA 1ZQNA 1QLNA 4P4MA 2RDIA 4M3YA 4Y1DA 4QZ8A 3OYCA 4B9VA 4F4WA 4XIUA 4CHYA 4QW9A 4AILC 4O3QA 1TL1A 2C2DA 1BI4B 5KFNA 3JPTA 3TWHA 4F5OA 3I0RA 1S5JA 3ZDEA 2AJQA 1JLGA 1NK7A 4GXJA 3AO1A 3OSPA 1Z3EB 4I2EA 3T5JA 1JL1A 1Y97A 4KHSA 4IKFA 3VQDA 4FW1A 4BE2A 4B9LA 3NF9A 3E2EA 1KRPA 1XI1A 5KG7A 4TUSA 4J9NA 2ZJ5A 5KFZA 1UT8A 4CEDA 2DFEA 1V9PA 1Z00B 3QIOA 3QNNA 5KFGA 4DF4A 3HM9A 4UBCA 2J6TA 5J1EA 3IG1A 3IRXA 5KFRA 1JX4A 3QLHA 4FJXA 3SUOA 2G8UA 1JL2A 9ICRA 4DTXA 2GWSA 3ZSQA 4FM0A 4CJEA 4KTWA 1L3SA 3RJGA 1C0TA 2AU0A 4CJFA 1VSMA 4O44A 1XSPA 1Q8IA 4AHCA 4BWMA 1NK4A 1IXRA 4KLHA 4MFBA 4QZBA 4IBNA 1RXVA 4PQUA 3EPIA 1W0HA 2OPRA 4KTZA 4KHNA 1ZQIA 1RDAA 5J0OA 4NXZA 4B08A 4FK0A 4LZGA 1VRTA 4NCAA 5DDYA 1MQ3A 1BIZA 4CERA 5KFOA 4I2AA 4NYFA 1DOQA 4I7FA 3BGRA 2EX3A 2OWOA 3ISCA 4K4IA 4ED7A 1NK0A 5C42A 4KTQA 3NE6A 4RQ7A 4Z0UA 3H4BA 1RTDA 4NLGA 4CJKA 4ECQA 4ED0A 1JKHA 3GIIA 4M3WA 1NJXA 4OGEA 4JV0A 3OYFA 4E0DA 3ULDA 1RBRA 1ZQZA 1ZQCA 1ZQFA 3NF6A 4M9JA 3V9UA 5KI6A 1NK6A 7ICGA 9ICLA 3PX0A 3QERA 3JPPA 5FROA 2KFZA 1ZQLA 3K5LA 1TL3A 4RQ0A 2Y1JA 5FDLA 2HHVA 3SUQA 3LANA 4RW4A 4PGXA 3RBDA 1ZJNA 2KW4A 7ICVA 4X5VA 3ZDCA 4IFVA 3V1OA 4CHOA 4ED6A 4CFDA 1FKOA 4QZ9A 2FBYA 4RU9A 3RBEA 3AVHA 5KG6A 4DS4A 1BQNA 3OS1A 3NHGA 4I2PA 2LSNA 2W9CA 7ICOA 3JYTA 1WLJA 4C8LA 4KLJA 3OYMA 2OA8A 1KVAA 3UXPA 2RN2A 1X9MA 2OPQA 1YVUA 4QWBA 3SV4A 1NJZA 4I2QA 3IS9A 1D8LA 4KLOA 1ZQVA 3NAEA 3AO3A 3T3FA 4H8KA 5KFVA 3AVGA 1ZQJA 3AO2A 1JIHA 2KFNA 2YNHA 4BGDA 1CZBA 1UAXA 1XSLA 2DPJA 2ZTEA 1B43A 4N76A 3C1ZA 4YVZA 1Q9YA 2J6UA 2HHWA 4EBCA 2Z1HA 4IR1A 4RW7A 1X1PA 4RQ3A 1NK5A 3K75D 4B8CA 1WCNA 4KLMA 1XC9A 3UPQA 3FYHA 1WSHA 4YMNA 4O5BA 4RNOA 2HHSA 4O55A 4FM2A 3HP6A 1NOMA 5J2IA 4HUFA 3CM6A 3PO5A 3BQTA 2FBVA 2R8IA 3VA3A 1BVSA 1EXQA 4NM1A 1T03A 5D4BA 2B21A 1TK0A 8ICRA 3C95A 2DFLA 4E7HA 5HP4A 1KVBA 1RBUA 5EWEA 1CZ9A 1IKVA 4B9NA 5DMRA 4E19A 5KRTA 3RMCA 9ICWA 1KVCA 2HW3A 2F1JA 7ICQA 2W42A 4DFJA 3KLFA 4UQGA 1ZBFA 4PGQA 4DEZA 2G8KA 3H8JA 3RJJA 4KLIA 9ICKA 2AGOA 3SYZA 2BCVA 2ASDA 2YNGA 3MR5A 4E7KA 4KB1A 2FPMA 5EWFA 5J2NA 2W8KA
chains in the Genus database with same CATH superfamily
4JI6F 3Q7BA 2FHMA 2AYMA 2H51B 5DG7A 2IRYA 1ZM2A 4CLWA 2DXDA 4O5EA 9ICPA 2BDPA 3VF6A 5JVGQ 2A10A 1PK3A 4MFAA 3Q8PB 2PFNA 3BM7A 1FEEA 3Q8KA 4YHHJ 4FWLA 2CPFA 3IUCA 2Q4TA 3LVVA 3M8RA 4IQVA 4X62J 7ICRA 2HK2A 2K8AA 5CYQA 5E3RA 4YS2A 4FKXA 1WSGA 1ZQKA 5F9LA 1RT7A 5DB7A 2VPZB 5SZTA 4B3SF 3V6DB 4I6AA 4JRQA 1XQIA 1UA1A 4PL2A 3EE9A 3H0LB 3IBPA 3HKWA 4CBXA 2P51A 2C22A 1S0VA 3CC4N 3J80Y 5L39A 2BKEA 1DLOA 4FWSA 3H4DA 5H1SQ 1E4GT 2W4PA 3K1ZA 4YD2A 3PIPL 1KW4A 3NVKA 1XNQF 2ZH9A 2VJ4A 5K8MA 2NRTA 3PSTA 5HP1A 5F8JA 3QE9Y 2BCSA 2YX1A 1S72S 1QE1B 2VPXB 3BKUA 1VLBA 4UB8U 2PSZA 1ZQGA 3JSMA 2VFTA 2F3JA 4K4ZA 4LFAK 1NEEA 3W9JA 5AKXA 3N7SC 3N7PD 3QICA 1H73A 3HK2A 2CGJA 5ALHA 4TKTA 2RRAA 3OVBA 5AR0A 1WHXA 4CF9A 4FPIA 3M30B 2XHWA 4TY8A 1FESA 2PXIA 1AUSL 4RPXA 1IR2A 3M8QB 1FIQA 3DU6A 4IQUA 1F6TA 2IHR1 4WYLA 3A13A 2QWRA 1U1RA 3R1XA 3RH5A 2ZZMA 3MR2A 3MCNA 2H1YA 3N5BA 4R63A 3PO4A 1NH8A 5F0UA 3O80A 2R18A 3KJFB 1HRHA 1R59O 5AQSA 2UYTA 3OTQA 3B0YA 1Q1KA 4M5LA 5BREA 2M0GB 4PY5A 4LFAF 2DGUA 2QMXA 1JLQB 5ETRA 4Y2TA 2GEMA 3IR7B 2VH7A 3CCUS 3NDKA 4K43A 4MDBA 4LT6A 1QZ5A 1RTHB 4LRFA 8ICHA 1JNRB 3BEGB 1NGFA 4DTJA 1RDUA 5EXWA 4E7LA 2JR5A 4DCHA 5ETPA 1U0HA 4CF0A 4RQ6A 4M6WB 4PWDB 2HRTA 3DMJA 1RAEB 3MMJA 3VAKA 5DBBA 2KRRA 3QZ8A 3H98A 1T05B 4AH9A 4FVUA 2HNZA 3MM7B 3ZX3A 3NH2A 1Q8KA 1ZQHA 1N6QA 1ZM9A 1NJIT 5K5MA 5K20B 4P2MA 3GZ7A 2GUIA 2XICA 4EFHA 4K41A 5IIOA 1UWBB 3SZ2A 1WUAA 4JKEA 1S1VB 3QAEA 3FFIA 2HNDB 5AQZA 2E66A 2A18A 1XK8A 3F0NA 3FDSA 4KMUA 4QYZK 2DNMA 1CXQA 5DM6L 4O0JA 3HMJG 1ZXOA 3BQ7A 3BV8A 2CFXA 1RDCA 4NX9A 3WHIA 2MU2A 2V2VA 1CC8A 2DTUA 2Z56B 5AQYA 2Q31A 2F76X 4UF4A 2V6AA 3U3GA 4KC5A 2KU7A 3OYHA 4NXNJ 3EVMA 5HAOA 1JLFB 1YKWA 5AZIB 2XSFA 4FJGA 3JPQA 4CGHA 1A76A 2P9UB 1TKDA 5BN9A 2O66A 4FO0A 4DHYA 2DNHA 2F9DA 1H0HB 4B3TJ 4H5WA 3WXKA 2AIRB 1IG8A 2MKIA 4JNEA 2E5LJ 1QSYA 3OLBA 1N48A 4CGFA 1WAFA 2JEJA 2OTJS 5CAAA 4KN4A 5KPTA 1AT1B 1DRZA 4GVBA 2IBOA 1C0GA 3NGTA 1OSDA 5KOWA 4IH7A 4OPAA 5DG8A 2GMHA 3U02A 4ZP7A 4I6YA 2PGCA 3L2QA 4IQTA 5EX3A 3I0SB 1Q16B 5J2MB 1RWUA 4BRIA 2UXDJ 2QYCA 3VQAA 2R7RA 4JN4A 3PLAA 4GNIA 3US5A 3ZEUB 2F9WA 1YVNA 4RW9B 1PC5A 3UN3A 1PYSB 3GFZA 2Y1LB 3DNCA 4CJPA 3FCHA 5HI7A 2XCAA 4IC9A 3DRPB 3K0SA 9ICHA 2VKRA 3PFOA 4UB6U 5IS2A 3DEEA 5LJ3Y 5B5EU 3B6BA 3IWXA 3DLHA 1UKUA 1REVB 1TL7B 1O08A 3OPKA 1BNOA 4Z6CA 5AJ3J 4ILRA 2WVCA 3EWGA 3HTVA 5A8WA 4JI7F 3NRWA 3AVNA 2O8CB 4RW6A 4OI2A 4JK9A 4P2SA 2HSTA 2DR9A 1IKYB 3VTIA 4G6VB 4WIIA 1BO5O 3CPWM 4JWNA 2RKIB 3UN5A 2QFJA 5KTQA 4DL4A 3C21A 1YX2A 2HLTA 3TJAA 1L3TA 1RLDA 3OL7A 4CFCA 1IG9A 1YIJN 1RAHB 2ALYB 1KLMA 5GAGI 5ALPA 3GFKB 3AU2A 3KFUF 1TP7A 2B5JB 3HSCA 1Z19A 4Z6DA 1X0FA 3CCVN 2VBYA 3A8YA 4G1PA 4ED8A 4ECTA 1Q79A 2A1BA 1MU2A 4KQZA 3PYFA 3C6AA 2H3IA 2EFVA 2MKSA 2ZDOA 4DQIA 3RTVA 3SV3A 4WP3A 5ALNA 2B6GA 3BREA 2LQ5A 4J90A 2OGUA 3RAQA 3JS6A 4CFAA 4BR0A 4DV4J 3CO0P 2KKZA 1FX4A 1JXEA 4P7VA 3MM8B 4PG7A 5CH7B 4RUHA 3OTOJ 1NGDA 3UE2A 5KFYA 2P9IA 3R8YA 2YKMA 2JOQA 3HHNB 1RT6B 2G0JA 2Y0SD 3GFXA 4CECA 4XH1A 5AQQA 4EHTA 4QAGA 3I76A 4F7VA 2B0GA 5M1KA 5JXSA 2AX0A 1N62A 1Y10A 3QEBZ 4JB3A 4H0PA 2H9ZA 1YBTA 1N52B 3WNGA 1YBUA 3LM2A 4CO1A 3C14B 2X6NA 4LBHA 3UR3C 4B1YB 1VQMN 3VA0A 3DGPB 4OPKA 4RZRA 5DBAA 2FPKA 5D46A 1H6KX 3AOAA 3MHYA 1NM1A 3HZ6A 9ICTA 3I6PA 4J9KA 4UY8O 1COKA 3LUYA 1PKUA 2BOPA 4FLVA 4OYAA 3CMQA 2V9WA 3WBZA 3KBBA 3K2YA 3J80U 1QQOA 1GTEA 1DRGA 3MEEA 4M5HA 4I4BA 1XSNA 3IGVA 3PNCA 4Y2RA 4ECYA 5D4LA 2ETJA 3IHQB 1DJ0A 2VZ9A 3KLIA 2DQNB 1LOTB 2JHEA 2GTDA 8ATCB 3ILJA 2E2OA 4WFBL 4MJKA 1YITS 3QETA 3CJQA 2ZJPL 2QL5B 2FXUA 9ICXA 1DGSA 4XEIA 2OHDA 1RACB 4ZJOA 3W8GA 1VSEA 1D9AA 1VQOS 2JDJA 4IZ9A 4J9PA 2QX0A 2PO4A 1KWMA 2RUGA 4JHDB 3EGZA 2GX8A 2G4BA 9ICBA 1NU4A 4FJNA 1VHXA 2OD6A 4DN0A 5ALRA 3RF9A 1DURA 3OYGA 2KB2A 1KFDA 3PJ9A 3IRXB 2YHWA 2WB1F 1YTUA 4E98A 2DKOB 4FBUA 3R9PA 2J6SA 3PKYA 4DV2K 3A5LC 3FEYB 3THTA 3HW8A 4TQSA 2M3DA 3KJNB 3RWUA 4H4KA 3NGUA 4K42A 1X2IA 4NLOA 1HARA 4WTYA 3W5ZA 4EELA 1Y7PA 1YXQA 1GQEA 3C2LA 4EHUA 4OJHA 3VF0B 3QT7A 1VGYA 2HGLA 1KHVA 5HN0A 2GLEA 2BRLA 4FVMA 2VOPA 4Z4EA 1Q86O 2NZ4A 2HAIA 1YLXA 4DCOB 4CH1A 4I7FB 3BGRB 5KFUA 3DI6A 5KPZA 1VQ5N 3EJMA 1AZSA 4Z7CA 2FJAB 3EX7B 1RTDB 4K8ZA 1EQMA 2UV8A 2OXOA 2HVIA 2JEIA 2W7PA 1COOA 3EMTA 3PHEA 4B3MJ 4LH5A 1VSHA 3VGVA 2IYIA 3UXNA 3V9XA 3AQFA 1RZTA 2KSOA 2F1HA 2XEXA 4I6WA 2NREA 1HI1A 2VFRA 1QSLA 2Q1NA 4K0KJ 4E1MA 3NVMA 3TUIC 2W03A 1LWXA 2AZ1A 2O4GA 1KEJA 5FJ4A 3QJLA 4P75A 2PEBA 4RW4B 3L5KA 2OSRA 1JCGA 2HNYA 5IM0A 1QQNA 2ZZNA 2GX9A 1X40A 3ZTSA 4HCBA 1ZQXA 1IWGA 4DHVA 1VS3A 2JJ4D 4I2PB 1L7PA 2LDIA 2WF7A 1U1OA 3JPSA 2W9CB 2AQ0A 3A3NB 4GKJK 1TE2A 3JYTB 3AOBA 1BCOA 3NG8A 3MAAB 4LR9A 4IUFA 9ICFA 2OPQB 4CJSA 1XMQK 3QUQA 3ZT1A 2WHOA 4FXWA 5L38A 4X4TA 3HD2A 3DXMA 3IS9B 1T7PA 2RS2A 4CM0A 3LGHA 1EWQA 3A0HU 1LXNA 5AKGA 4CWBA 5ALQA 1V38A 3M1YA 2EAPA 4CJ4A 4YB1P 4LF6K 2ZWHA 4UAZA 3CJKA 2YNHB 1BNPA 2LYBA 4DB3A 2ZHOA 1ZRNA 3QNOA 2M5YA 4BR2A 4A8QA 2SXLA 5LSOA 3DWLA 4IJNA 1B0XA 2MSSA 3VEXA 4OZNA 3NUQA 1FRHA 3IG8A 2J0QD 1QAJA 3FCWA 3BGUA 1YAGA 1RWXB 1VQ9N 3Q8YA 5KL1B 4FLXA 4HT7A 1G3OA 5J2GA 4FF2A 1LQ9A 1A6SA 4IH5A 4Y28C 4NYPA 3G82A 2HWIA 1RWPB 4Y34A 4ZLNA 4ZIVA 3K59A 3FZMA 5A8KA 4JYAJ 2KVQE 2B51A 2VPWB 4BS2A 2DCLA 4O23A 5DB9A 4KH5A 1TAQA 4W5TA 3QEPA 2VG7A 2WW4A 2PA3A 3QX7A 1JJ2R 4IWVA 5A2QU 3SAHA 3IP4B 1VIOA 3SQIA 1EARA 3PY8A 4A2BA 4RQ5A 5A8RB 1ZBLA 2ISOA 4JI1J 8ICYA 2MDAA 4CZCA 1RWWB 4ES2A 1XR6A 4P6QA 5TKWA 4A59A 4LBPA 1WN7A 2KMDA 2R8HA 3BJYA 3W62A 1VRUA 5GAGP 2FJVA 3OQ2A 4UTGA 1RJJA 5ALEA 2E1EA 3ELHA 1NBEB 5J2NB 1KONA 5KRSA 3WKEA 4J37A 5HOOA 1N36K 3FZKA 1B92A 2OEHA 4CHNA 4ECZA 3HM8A 2P5VA 4A46A 3VGUA 4P2XA 2AEMA 4I56A 1ZQOA 2F8KA 4M3XA 3EVWA 3F56A 5K4LA 1Q46A 2ZIUA 4QJFB 5BPCA 3MECA 3IO1A 2IVPA 5CA5A 3GSDA 4EMDA 1ESVA 2QMUB 3R8EA 1V97A 1U8WA 2HQ3A 5I42B 3K5NA 4GW6A 9ICAA 3C7NB 3C1YA 3HHLC 4OJ5A 1NRKA 4LR7A 2VBZA 4I9QA 4FO6A 4OPHA 2UUCK 3VGLA 3TKAA 7ICMA 3O8WA 3QXGA 3MX2A 3Q8SB 1HNVB 4USWA 1M5PC 2YJFA 1SWWA 3A1YG 3KDOA 1N36F 4CHZA 4FWQA 5KFEA 1IIPA 4PG6A 2HQDA 1YJNN 5AQPA 1NGJA 4OFZA 3AEVA 1K5OA 2M9KA 3JQJA 5HBMA 4DUZK 2BM1A 2E1ZA 3GIJA 1NJWA 3ENWA 4DPXA 1RM6C 2Z0GA 1DKGD 1PILA 1S97A 2DNOA 4AUKA 5DB6A 1ZQBA 1RDBA 4Y1CA 2FUG9 3TZXA 2H65B 3QO9A 2D8CA 4ECWA 2KXNB 3MGJA 5AE1A 4F3MA 4Q45A 2D3UA 2HBZB 4RWTA 5AQNA 4Y2XA 4C8NA 2UUCF 1P1TA 4I2CA 3V4IB 3NEKA 3M7DA 3HVTA 1RDRA 2FJEB 4FOEA 3KUEA 4RW8A 5LSRA 4FJIA 4YB7A 4IOAL 3MCPA 1XTZA 5SWMA 3LZIA 4EP5A 2A6AA 4JKFA 3CDEA 1WKLA 1NB7A 4N8OA 2DF4B 2V4JA 3RB4A 2J8AA 4JI2F 4DUZF 4NLUA 3PRBA 3VQ6A 4QR2A 5CYJA 3KK3A 4CIEA 2HK3A 3J81O 2XYPB 5B08A 1ZBSA 1S1UB 3GE1A 2KN7A 5ALXA 3GU0A 4JK1A 1Y88A 4PGYA 4PG8A 4BRNA 3EE3A 4O3SA 1C0UA 1PK1A 1UW9A 1LW0B 2RLTA 1ZZFA 3ILLA 2P9PA 1BWFO 3ET6B 1GOCA 1Z4OA 4MIBA 1HBUB 2K4PA 5ALSA 4BE1A 3IDWA 1WWHA 4BX9C 3MEKA 3V6HA 5F8IA 5ETNA 5EY4A 2CAJA 1S9FA 1LKYB 3IM1A 3MM9A 1UMJA 2KG5A 2HHTA 1FNOA 1UJ5A 2G8IA 3DXKB 2KN4A 3DKDA 1VFJA 1RXWA 2COLA 1QS4A 3UMGA 3OTBA 4DLGA 4IXCA 3TZYA 3HJEA 2DBYA 3AXMA 3O6WA 1YT3A 1JLEB 3S6JA 4ETXA 1PO6A 3VQ4A 4QCLA 4QU7A 2A40A 4C0OC 4YG2A 2FC0A 1I1GA 3CJSA 3LGNA 5ETQA 3ILOA 4DR6K 2HFNA 1M5KC 1HWUA 1IG6A 1X4EA 3GFHA 3P6YC 2FF6A 1NLKL 4KFBA 4JD2B 4RQNA 3C16B 4JKDA 5DM7L 3UKRA 5H9FK 7ICIA 5LOQA 3DFEA 3M9OB 2CRLA 4URSA 1MWQA 4H4OA 4JMUA 5B0FA 4HHJA 4FSVA 3E01A 1D09B 3DLEA 1BQXA 3HF5A 4CE9A 4WYWA 4ID5B 4CLLA 4CW7B 4JV2A 5I3UA 2CGLA 4EX6A 3NGYA 2J0SD 4F04B 2ROPA 3GWCA 2GHVC 3UDEA 1KAXA 4CNQA 4DR4J 3KUGA 1Q9XA 3ISND 1X4HA 1F21A 3VR1A 3MMBA 2ZH7A 3EE8A 4DN9A 3J7A1 4OYBA 2CXEA 2DISA 2ZKUA 1ZETA 5AM5A 4JI5J 3ZZUA 3H3OB 4CF5A 3BS5A 3H8WA 3KKFA 1SXLA 4KHPF 4CHPA 5AI0A 2FQQB 2CPEA 4JRPA 4UAYA 4WF9Q 1SC4B 4KLGA 3ETLA 1U6FA 3DLKA 2NSBA 4NI2B 4Y2PA 2CNOB 3OR1A 4CO5A 3BBBA 3K5PA 3V9WA 3V4MA 1N33J 4BHQA 1WUDA 2BJ9A 4DV5K 1X0PA 3TUZC 4ZPWR 1IBKJ 3GJQB 2YCHA 1WWUA 3H8YA 3H1VX 3ZD9A 1AA1B 3ZT2A 1RFQA 3LW5C 4A62A 5CR4A 4PXEA 6FD1A 3MK6A 1U2CA 1Y11A 3VGMA 3FMWA 4K4HA 1E6YA 3MN7A 3H5XA 3KLGA 1NKEA 1XR7A 5E84A 5G5HA 3W3SA 4RQ8A 4F2SA 5CXTA 4RNNA 2DJWA 2NSCA 5ALJA 4OI6A 2DR6A 4NL9A 1PBAA 3KLHA 4PKGA 3L2VA 1TUVA 2AEJA 3L4PA 3ZETA 4C11A 2HMPA 3SQ0A 5AQTA 3KK2A 3MDAA 3B6PA 2GV9A 3NAIA 3NNHA 5E41A 3LDPA 3O8MA 1S77D 1BPZA 1JLAA 5D0HA 2BZ2A 2RP5A 2OP5A 1N32F 2PI5A 1PC4A 4CTAB 3LDNA 2LMRA 1NLVA 1FFGB 2QGFB 3MGIA 1ZQRA 1XO0A 4DV5F 3IAYA 3HZGA 3HDSA 1GT8A 4RUBA 1UFKA 1CULB 1NU0A 4ACOA 4LY7A 4A8WA 3SDEA 2IY5B 4IJAA 1ZOTA 1TKTA 2XS2A 3QFPA 2DFFA 2GNKA 3CHWA 4U7BA 2H3EB 4FYXB 4CD3A 3K8WA 3QEWA 1TL4A 3L6QA 2MXYA 1LWCB 2HCFA 3AARA 3UM9A 3OFEA 4IYQA 3PFEA 1NBWA 4OIXA 2XGQA 1TR0A 4UASA 1LWFB 4JV5J 1RA6A 1RAAB 3TTCA 2Y0BB 2EQYA 2YY6A 4NLVA 1K73T 2DFHA 1U47A 1X8DA 5CZXA 5KQ8A 3L4IA 1LFPA 4URQU 3ZZZA 5M1NA 1NM2A 5T7BA 3AU6A 1QUPA 2CNLB 4P9SA 1WG1A 1HNIA 3KKSA 3KZIU 2CQ4A 3N6MA 3R9LA 2A5XA 3O08A 1GOBA 1LNQA 4W4MA 3UQ0A 4RWXA 2YWKA 4Q0BA 2W2PP 4X4VA 3ED5A 1TK8A 1KTQA 1KDNA 4K50A 4LJMA 3CJ5A 2E88A 3FGUA 2FVRA 3PIPQ 3A8KA 2A19A 2WW8A 2O8EB 3M4XA 1ZYQA 1J2VA 3K57A 2OANA 1NNLA 2WSEC 1YRUA 2BRKA 5A76A 5DLFA 3MM6A 2WF9A 2KT3A 1ZA1B 1N60A 3SNNA 4WU3A 2OPSA 1HKAA 3MGHA 3ZZPA 2D0CA 3TTFA 2PEHA 3T1AA 3TFRA 4UATA 4OLAA 5E7OB 4IRDA 2BJ8A 1U48A 2YX7A 2WFBA 3CFRA 4LF4K 1YQHA 2Y0SC 3DOKA 3ZSOA 2MKJA 3CCRS 3FNNA 4C0BA 2YH1A 3M6XA 1HNZJ 4Z4CA 2BHNA 2UVUA 2ZE2A 2J9DE 4YXJA 4R5PB 2OSQA 4TSXA 1I3AA 5G4DA 5DDOC 1KKXA 1V85A 1RWKB 4P10A 4KLFA 4KITB 4ZP9A 2Z1IA 5MLCV 2X51A 4DV1J 1V5IB 3WKCA 4K4VA 2BGWA 3VQ8A 3N28A 4OL8A 2QC3A 3DRRA 1IXKA 1LW2A 4I2DA 2Q36A 4ELUA 4UAVA 5K14A 1UQVA 4QS9A 4USMA 1WF2A 4NZ0A 1X60A 5BYQA 4O4GA 4LF4F 1VQ6S 4J9LA 1UW4A 4BC5A 1QTMA 4X65K 1TU0B 4NA1A 3PG9A 1YRXA 2V8GA 1IO2A 2GOLA 5HMWA 1O03A 5KT7A 4F4ZA 3F2CA 1LFWA 2XBPA 4DV2J 3CJCA 2YQ0A 3ZSWA 4LBIA 3QJPA 5CY4A 2FBXA 1TV9A 2UUBK 3DU5A 2RMLA 2PFQA 1KQSM 3CE8A 1RT4B 3SUPA 5G0RA 1D1UA 3N4MB 3VQTA 3HSTB 3AD7C 2FB0A 3R7SB 3M6WA 2Z4PA 3AVLA 1S9GA 7ICFA 2YPZA 2XMAA 3KUHA 1ZQAA 2GQ2A 4DV7K 1SC1B 3K0JA 5C24A 3NCIA 4FWMA 1RG6A 4KLEA 1RAGB 1SJRA 4NLWA 2QLFB 1U49A 4YFUA 2I0XA 4N7TA 3NOGA 5DM6Q 4M94A 3EZOA 2RDJA 1Y3KA 2Q6BA 5KG5A 2ZBIA 1P8ZA 5C15A 1XNRK 4X65F 4Y2IA 1CJUA 4G9ZA 2NZCA 2HVHA 5DGBA 5KT3A 3Q8MA 4NLYA 5EE1A 1FRLA 3JSYA 4CK1A 3RMAA 1YG0A 4ZN3A 2ZUCA 2XSJA 2UUBF 4CF4A 3FMBA 2QB1A 7FD1A 1R6VA 5IQ6A 3CPEA 1ZD5A 3Q8QB 3W64A 1F5CA 1GLJO 4AQYK 2B4PA 8ICIA 2D5RA 1B4FA 2E9TA 1FKAF 1EAYC 1QHTA 4C4RA 4PQAA 2ZUGA 4XDCA 2XMWA 5EX5A 2PFUA 4X4UA 4IEIA 2FHJD 4DV7F 4TY9A 4B9VA 1VQKN 2C2DA 3OBWA 4ZIWA 4CLTA 3I0RA 1XNRF 3AMZA 5AKLA 1NK7A 1JLGA 4GXJA 4GKJJ 1Z3EB 4I2EA 2NYVA 2Q1LA 4DCPB 1F60B 3VQDA 5AKJA 3NVVA 4BE2A 1XI1A 5KG7A 1YGYA 4ZVQB 3NVWA 2XZDB 5KFZA 1UT8A 2E29A 4C4SA 2DFEA 5ALLA 1Z00B 3BPSP 1XMQJ 5KFGA 4IG0B 1T6CA 4IO8A 3TSQA 5KFRA 1JX4A 3THWA 2G8UA 1XERA 2DNKA 9ICRA 5HQMA 2RQKA 2Q66A 1CZAN 4YY3K 3NMUA 5AXKA 2EFNA 1H1VA 2BJEA 4LF6J 2CQCA 1WSRA 4CJEA 4HDGA 1L3SA 3D1QA 2D0PA 4NLTA 2AU0A 4CJFA 1VSMA 4WE1B 1SIZA 4FZVA 3X3UA 1XSPA 3CJ0A 4WCEL 3UDLA 3PYGA 4AHCA 1O51A 2ZD1B 1AFIA 4IKAA 4KLHA 1MN7A 4PG5A 4BC4A 3K17A 4MFBA 4OD0A 1RXVA 3CJBA 1W0HA 2OPRA 4NXZA 1WNEA 1T9XA 1LWEB 1B99A 3TPQA 5DDYA 4CYUA 1MQ3A 1BIZA 1DTTB 5KFOA 2QE5A 2RF2B 2EX3A 2FDRA 2OWOA 3ISCA 4K4IA 2NXEA 4NO7A 4KKOB 5LJVA 4M5DA 4ED0A 2EANA 3B4MA 5IC4B 1NJXA 1TYQB 3UKUB 3AJ2A 4BUGA 3OYFA 4B3RK 3HHKA 2DGTA 4YY3F 3CCLS 4NLXA 3D3CJ 4OYWA 1KD1T 3D3BJ 1JQGA 5AQXA 4WBFA 3KJVB 1ZQCA 2XVTA 1ZQFA 4JI0J 4UY8T 1F5AA 3CIPA 1IJJA 4OJOA 4ICLB 1I51B 1MDUB 2GWKA 3I4PA 1NK6A 4Q2LA 3JPPA 3C29A 3TWZA 4FF1A 4RQ0A 2Y1JA 3DDNA 3Q23A 4C0HA 3IN5A 2EDUA 2RQCA 5AQHA 2Q43A 2GGPB 2HHPA 2KW4A 4PABA 1FHTA 4X5VA 3ZDCA 2AWZA 4IFVA 2CGKA 4RU9A 3RBEA 4ZVHA 4DS4A 3PRDA 5E3QA 1GMVA 1FJ7A 1HW8A 3THYA 2KP7A 3BF1A 1DZ5A 5LMUF 2OA8A 2Y8WA 2DYAA 1KVAA 2YX8A 4A8KA 1VQPS 4H03B 5FPMA 2Z30B 4GV6A 4NZ6A 4HI2A 1YVUA 3MCAB 3OL9A 4FVCA 4ZLPA 3FSXA 2KH9A 3WKDA 3LP0B 1QZ6A 2F44A 4PYDA 5B8HA 4I2QA 2ACYA 3C65A 3TYTA 3QWUA 3JAMU 1K8KA 5CRXA 5LMNK 2O1PA 3OUYB 3AVGA 2ZIXA 1OY6A 3HLUA 1ZQJA 4FXVA 4C4WA 3QT8A 2KFNA 1X5PA 5D3GB 1PAEX 2D3ZA 3NMRA 2YWHA 3FZFA 2W2QP 1B43A 4OI0A 2YKOA 3O1LA 2KK0A 5EDWA 3MEGB 1KQGB 4IFYB 3MMAA 2K1RA 1Q53A 1X1PA 1WCNA 1Q18A 5KQDA 2DHAA 4RTFD 2A3JA 1VI7A 1W97L 4DV0F 1JRPA 3VEZA 1XC9A 3MPWA 3FE1A 1VLOA 1WSHA 1EO1A 2RU9A 4RNOA 4C9DA 4IS7A 5DDQC 2ESEA 2ZHAA 1OVQA 1NOMA 2ZJPQ 3BQTA 2I5JB 2CQ0A 3HULA 2WK4A 3VZIA 1BVSA 3IG5A 1JCFA 1GEHA 5LMNF 8ICRA 5AXNA 1KBUA 5D4NA 4E8UA 1IKVA 4B9NA 1N5SA 4E19A 4X84A 3MN5A 4CO2A 1RLCL 3JQKA 1VQYA 2ZWOA 2PIIA 3H2LA 3BPDA 2HW3A 2CPZA 3DGVA 1X7VA 4B1UB 3SCKE 2F1JA 3GTYX 4UQGA 2N7CA 4PGQA 1ZBFA 2N3OA 3U27A 2G8KA 3RJJA 1KOHA 3KHYA 3CJ1A 3CD7A 2YNGA 3G87A 5ALGA 2ZM6J 3I9V9 3L7PA 5CCLA 5FIIA 5JVGL 3BUZB 4ZK7M 2X78A 3M1VB 3AVJA 1WOPA 1W25A 4M2YA 3R6MA 1PJ5A 3DRSA 5DQGA 1QSSA 2KHDA 1U6BA 3RH6A 4DZ6A 1T3NA 5K8OA 3IAM9 4RQMA 2H3FA 1KDHA 1EETB 2D0AA 4FL9A 2X1GA 1SV0A 1IR0A 2KDOA 4DU7A 4F0KA 3CPWR 1C1AA 4MT1A 2QIFA 3NS1A 1F3VA 5KFFA 5AXMA 2HYIB 3C6HA 2KO1A 3SI6A 1NZPA 3ZTPA 1NOZA 2ZTCA 8ICAA 3GJRB 4ZDNA 2JSXA 4ELVA 1M90O 4PHDA 4B9UA 4QR1A 5CZ1A 4DFMA 5CZVA 4XAKA 1JJHA 4O9MA 3EL2A 2Q0ZX 5CYMA 4DR6J 1VJWA 1G7CB 4WFXA 3M8WA 5KG4A 5CR0A 3LP2B 3I8BA 3QATA 3SQGB 1VC0A 1RHMB 2HVZA 1Z1BA 4ZHRA 1RT3A 3A5OC 2DNQA 5CA7A 2YNFA 3DYAB 1FXDA 5J2FA 3L7UA 3E0FA 2WVBA 1NGIA 2W7AA 1T9YA 2BYCA 4MKAA 3MPVA 2RHQB 4M3TA 1FK9A 1JK9B 3IWNC 3B4DA 4DSLA 3HVRA 4RCHA 2B4OA 2E2NA 4EP4A 3SCJE 2ZG6A 3H46O 4DTPA 3FRZA 3CUNA 1OS5A 3V81B 4F26A 1SIWB 2Z2LA 2RE1A 4RG8A 3UI3A 4LJXA 3AAQA 1KC8T 3ITHB 3AD9C 4DU3A 3KHRA 3CCEN 4O3PA 2HZVA 2K89A 1ZQQA 1BISA 1HUZA 3U9ZA 1AUDA 4K8XA 2C2EA 1YJWS 3QFUA 3DHXA 2A3VA 1K47A 3MCOA 3H40A 1R0BG 3RYLA 4CDGA 4FDFA 5AQUA 2JC1A 3HI9A 4WIQA 2QWOA 1EIYB 2OTLN 2XWXA 5E33A 2FVQA 2HHHK 2EPIA 4CD1A 1D4XA 3OTCA 2OYQA 1FRKA 2UXBK 5F8HA 4NWIA 3M05A 3CMAS 1KN5A 4UZBA 2IRXA 4RQ4A 4KHUA 1RT2A 2J7WA 2F4VJ 3ISNC 4ERDA 1RABB 5KFHA 2CPJA 2GH1A 2QWLA 3AVMA 5C2CA 1TUUA 2FTRA 4TQRA 5J0TA 4DUYJ 4O5KA 2QN6B 3HO1A 1GOAA 2MZ1A 1DFDA 2GHWA 1HQEB 1ZBTA 5GINA 1U4BA 2MQLA 2DT9A 3BEXA 1GO3F 4DR3K 4J9MA 1SZHA 2KXHA 2QLWA 3Q2TC 4BVPA 2IJNA 2G06A 4CI0B 1XMOK 3POTB 5A6PA 5LT5A 3RRHA 3TFSA 4MTPA 1C1BB 1YJRA 4DCCA 3K89A 3MGVA 3PSPA 2Z2ZA 3PYEA 4LF7K 1HKBA 7ICPA 1A5XA 4MF8A 2UXBF 3UMBA 4OCZA 2XMUA 3MN9A 1PJ6A 4B6JA 3NASA 2YWEA 3OHRA 1SH0A 4I2JA 1J5OA 1OWXA 1T44A 3ZSRA 5HL7L 5BN8A 4WQ4A 1FRMA 5J2QA 4BROA 4BC3A 3LWLA 2VA2A 4WP8A 3DV9A 3P31A 5H1SV 2V2ZA 1BDGA 3HRGA 1KBRA 1ZTTA 5CB1A 1NSPA 4LRAA 3H45C 2IJRA 2IAJA 4A8SA 4M5MA 2VIHA 4DFKA 4DR3F 2WF5A 3AVIA 5EX0A 2EC2A 2CPYA 1FERA 1XMOF 2CQ2A 2DGOA 4U6PA 2R7VA 2F8SA 1VQ4S 1ZM3A 3SIPB 3SMPA 2P9GA 1T9VA 2K4EA 2NUUG 4LF7F 2W9BB 1LEOA 1BQMB 1HBNA 3IRUA 3CF5Q 4F2RA 4OJRA 1ATNA 1ITGA 1K6YA 1P1LA 1I94K 2M52A 5KT5A 1NDCA 4CFBA 4AHUA 3KLEB 3CO9A 1T0TV 3JPRA 2E20A 3NS7B 3SSQA 4C97A 2FY1A 1N61A 2Y0SF 2ZUBA 4XK8C 3ZNUA 1V5VA 3LALA 5AI5A 2VBWA 2DHSA 2ZH2A 3HHDA 2ZVIA 4KLDA 4OLOA 3O3FA 4TYAA 2W11A 2U2FA 5IILA 1APSA 4JWMA 3QGIA 4LVNP 5JMVA 3NBPA 2W4CA 1G2EA 1R8HA 3VMFB 1MNEA 5AQKA 4ZPAA 1EWRA 4DPTA 1G99A 3C23A 2F96A 3RH4A 4CJUA 3SQ1A 1BMQB 1HI0P 2AT1B 3U1MA 4ECUA 2ILZA 2A1JB 1I94F 2G8WA 4DR7J 5D77A 1HR0K 2MZQA 3GDQA 1S1XA 4CGDA 3NTUA 2AH5A 1N0VC 2XB2D 4CIOA 3N4QA 3CQXA 4PHAA 5DETA 1FX2A 5J8YA 1ICEB 2H5XA 1LAWA 3ISDA 4M47A 3RRKA 2WTUA 2BQUA 2C28A 2O8DB 4I67A 3IDHA 3FBEA 2GMJA 3HPHA 3MUMP 2O5DA 4EIAA 5A6WA 2LXUA 2M8HA 4QWAA 4B8AB 3RB3A 3MR7A 4YP3A 1FNXH 4P73A 4UB1A 4YMOA 3TABA 3BDPA 2IM2A 2UP1A 3L8BA 2X1BA 1HR0F 3SFUA 1FCAA 2ZH4A 1TFWA 1Y9OA 2WFAA 3I55S 4DKWA 1WC3A 1EQYA 2LEPA 3CCTA 4I0WA 5CHCB 1TV6A 3P5BP 3WQTA 1U2VB 2IM3A 4IO1A 3LA0A 2IFXA 2KLAA 3CP8A 3SD7A 3PMNA 4YFKA 2O4IA 1VQLS 4L3NA 3C6UA 2OM6A 3Q8RB 4EK2A 4V1Ak 1ATRA 2C3OA 2I7NA 2XY6A 4FJ9A 2VQEJ 2QKBA 1PVQA 2VJVA 3VGTA 3CD0A 1B7FA 3G9CA 4NCGB 4LSNA 3AO5A 2CNNB 3DOLA 1N5TA 1O6XA 4ISGA 1A7GE 4I2HA 2CADA 4FPAA 2AA4A 5TKYA 4FXDA 3TI0A 2C2RA 3BN7A 1R8PA 4F4XA 3CJ8A 3DLRA 4AQYJ 4DL0C 1IKXB 3CTRA 1WSJA 1RBTA 3CXCM 5U47A 4X4SA 4U7CA 1H72C 3ZZOA 5AKKA 2PYJA 1U1KA 2CG4A 5GAEU 3TAMA 1CEZA 3MPUB 5DBCA 1WTFA 3BSCA 4LZDA 2E8AA 2MPUA 3EZUA 3L2WA 1S6QA 1S4EA 1UZDA 2LECA 2DGXA 3OJSA 1SL1A 3VGKA 4QIGA 4LF8J 2V2QA 3PKMA 3K9KA 1CJTB 1N56A 4ECSA 3A5NC 3TW0A 3MMCA 2ERRA 1X9WA 1QQMA 1MA9B 4NLNA 1MW7A 5KT2A 2V51B 2E5JA 2KJWA 1S7HA 5J29A 1UPMB 3HJFA 9ATCB 4NLCA 3J80O 5AICA 4KHYA 3K58A 3IG1B 4F5RA 3OS2A 3PX4A 2LQBA 3NGZA 3QLHB 2VC0A 1A5WA 5AK3A 4PAAA 3V1RA 2XLIA 1YJ7A 2GJFA 2DHGA 2V0NA 3KTQA 5F8MA 3QFHA 2ITGA 4M7XA 4MF2A 2VC1A 4RUAA 3I33A 5E2QA 2NXCA 5IWAJ 4CESA 4JI3J 4O44B 3IBCB 1BG3A 1PSDA 4TVAB 1WBBA 2WOMA 3CQYA 1OPIA 1U1NA 4F5PA 3IP0A 3RMBA 1N63A 4PQUB 4OHWA 4OX9J 3O4NA 1ZJMA 3QU7A 2ZIVA 4F91B 4HWIA 2ES6A 4MLEA 5EE3A 1ZH5A 5A0YA 1UCVA 9ICEA 3WC0A 2QZ8A 2I6XA 5IT9U 4RPZA 1VHIA 1PBUA 3OLAA 5DGAA 2JGUA 4P7TA 1NZ8A 1JKHB 3QEXA 1IJFB 1UETA 4B3RJ 4Y2CA 4DI6A 1JCEA 5M1OA 5GAGU 2QLXA 4ETZA 3QGPA 4DL6A 4ZVFA 5IOLA 2QO3A 1S0MA 3FZ2A 3DXBA 3HILA 1HD0A 3I4HX 1RUSA 1TL3B 4AXJA 5FDLB 3NNCA 4W5NA 5BR9A 4K4XA 3P4IA 2IM0A 1UA0A 4JS5A 4B3OA 1QVGM 3OYEA 8ICFA 2O8BA 1NNEA 1VQNS 3O4WA 4FLYA 2FBTA 5IIKA 1FKOB 1FRJA 1BI4A 1X3NA 4YDUA 1BQNB 3IFEA 3FEXB 3HFVA 5ETKA 2EC0A 1T94A 5D0GA 4DX5A 3R2DJ 5GADU 2BCQA 1OJ4A 3GV8B 4P0QB 3VV2B 3T1HK 1ZAWA 1HBOA 1T9TA 4ZCIA 5J2HA 3TQEA 2KD1A 1RHKB 2JZ5A 2PC6A 3GCWP 1CS4B 2Z1GA 2Q3PA 3CM5A 5J0SA 1WC4A 5CZ2A 4OJ3A 2DD8S 1X6JA 1Q81O 4PH5A 1XHXA 3O44A 2NO5A 2DGVA 3B9JA 2PBDA 2NRZA 1TGOA 1Q5VA 2VG5A 5HQLA 3OT9A 4DV3J 2ISPA 1E6VB 4BWJA 2W7OA 2DXEA 4KGXB 1DK2A 2FJDB 4L75A 4MFFA 2MQQA 3BZCA 1WOOA 2RQ4A 4ZS6A 2MLZA 2HS3A 2PFPA 1SKSA 2A1AA 3JB9k 2CPHA 2K8CB 1MN9A 1OH6A 3D2EB 3QJJA 4RW7B 2LEBA 5IIIA 1WI6A 3JQMA 2YWWA 4ER8A 4UQTA 5FRNA 1I5OB 1E3MA 3HX0A 5IZHA 2DHXA 4KJIA 1X31C 2NV3A 3SSRA 1ED1A 4O8UA 3TAQA 4A57A 4UOFA 3M32A 2YKPA 4NMXA 5C7PA 3VAHA 1FVQA 4P52A 2RRBA 2AYGA 3H90A 1Z1ZA 3ICLA 3KD1E 3HPGA 1OQ6A 4ELTA 4ZITA 3M2VA 5IIJA 2C3MA 2HGMA 4KB0A 3WNHA 3SJHA 3NH0A 4NEYA 5CABA 2IMWP 4BQLA 1WHYA 1H2VZ 2MGZA 4JI4K 3VC8A 2MAXA 3KLFB 5CQGA 2O8FA 4UUXA 4J2DA 2GVZB 1VAZA 1NCLA 4ZLLA 3DAWA 2D6FC 3T1YK 2KKVA 1DQ9A 3EDRB 2P9EA 3D4JA 1NH7A 1S72N 3C15A 1WSIA 2F7VA 2Q6CA 4NZ7A 3CFPA 1HLUA 1AROP 2EWHA 3ZC4A 2XM3A 3HKZC 1RCHA 4GKKK 4OZ0A 1S6UA 2H3ZA 3A0IX 3FBCA 5GTIU 3S7RA 1EP4A 3TAGA 3ULEA 5A2QO 3M1FA 4R65A 4IRKA 5DDRC 4UARA 2RE2A 2V52B 2VGMA 5CYQB 5BOMA 3S3NA 4JKBA 4QZAA 3S6EA 1RT7B 2BJ1A 1D8ZA 1D3WA 3DM2A 1RWNB 3L3UA 3MPYA 4JI4F 4P4PA 4C23A 4DWIA 2L48A 4N5SA 3RZAA 3CJRA 1Q82O 2UUAK 4UAWA 2LDYA 4NLRA 3ZDAA 1DLOB 5J0XA 2E5GA 1TK5A 4LF5F 2X74A 2W2NP 2VQFK 3IBWA 3T1YF 4J2AA 3KHLA 3MDQA 2Z2MA 1HNXK 4Y2QA 3DXSX 2YHYA 3R5BA 1N34K 4UOHA 2V7ZA 3TEHB 4KI6A 3QEAZ 2WVEA 4LVOP 4E1JA 3THPA 5HP1B 5KFIA 4KLTA 2PZSA 4OI3A 4FCYA 2I5HA 5IINA 3CCUN 3JSMB 2QSWA 4CIGA 3M3ZA 2N7YA 4PHPA 3M8ZA 4CQ1A 3U6FA 1SZ2A 4YOXA 1W9HA 3SPYA 4QPXA 1CRXA 4I2FA 3PIOQ 2DK2A 4IFEA 2QT7A 2XY5A 4BGBA 5AZJA 3V7KA 1VK0A 4U67Q 4C3LA 1CLQA 4Q43A 3EXYA 4DX8H 4BRDA 4C6AA 4TY8B 1D8BA 3LTOA 3AVFA 1WCLA 2UUAF 1HPZA 4EENA 1KKHA 1N54B 4DR2J 2EFQA 4D3GA 1R0AA 3WNFA 2VDIA 4RX6A 3H42A 1XMBA 4KO0A 4CE6A 2ATLA 4G3IA 5ALIA 4V19X 4KH6A 3VENA 1Q5YA 1Q8LA 3LO3A 3FZLA 1YUWA 5AQFA 1HNXF 4BBYA 2P9KA 4USKA 1N34F 1RDDA 1UT5A 4YCXA 4ZCLA 4OZ5A 4NXMJ 4CJLA 4HR2A 4QR0A 3ZI4A 3QUTA 3G0ZA 4O5CA 4BACA 1J5EF 1JXBA 1VQ7S 3DDKA 3ATUA 1Q0NA 4C8ZA 3PUFA 4J7CA 4QZDA 1R8BA 2HFOA 3D0PA 4QQBA 5HROA 2E1YA 4JI8K 2BABA 3AB2B 4WKRA 4H4MA 1OKJA 3PNIA 3HSJA 3ORYA 4WCEQ 2HHHJ 2G2ZA 1U1LA 3R5CA 2BVZA 3CCQS 1BGXT 4ITSA 4QIVA 1HMVA 4MIWA 1RNHA 1U0HB 1PG5B 5CEHA 3DMJB 3CCJS 1HQUA 1JWWA 2P6RA 2VFSA 1NGCA 3H7IA 2MY7A 1N88A 3LK9A 4G65A 2HNZB 1JNZB 5FP0A 4Z4IA 1N6QB 3WK6A 5EOZA 3GU3A 3QEVA 2RH3A 2QTDA 2Q3SA 2OTJN 2R4FA 3FFIB 4RJVA 2UU9K 3EGNA 1RISA 2I7PA 3KWMA 2XZTB 4JAXA 2G8FA 4KAIA 2P9SA 1BC6A 3BH7B 9ICSA 3UDCA 4CZGA 1WOQA 2HDOA 2V34A 1SQGA 1ZBUA 4PXDA 1U25A 2KVCA 3HSDA 1H3DA 1XN9A 2HQGA 4CJ7A 1WB9A 4QWCA 1MG7A 1DTQA 3RJKA 4QZFA 2CJBA 2ASMA 4M5IA 3AXKA 1Z2ZA 1RHRB 1CUKA 2NXJA 3ZO7A 1PYTA 5LY3A 3KHGA 4NWBA 2QA4S 2B6AA 1MWMA 1C1CA 3RJMB 4RU2A 2J9DA 2LLZA 2MLYA 4X64K 3Q0AA 2IIRA 3S01A 3VEOA 1KQSR 2ZDPA 2FIUA 4K59A 3WXJA 4ICAA 1JLBA 3OPXA 3BR9A 1VBZA 4E3SA 5HVFA 1RWMB 2R7WA 2GJ2A 4GVBB 3WZ0A 3PJWA 2EWSA 2LMIA 4X66K 3S3MA 2E5SA 2G1HA 5ADZA 3H3NO 1U0SA 2QKQA 3ZX0A 2FSKA 3QFWA 3HSZA 1QQ6A 1WF1A 1J54A 1WYGA 1OY9A 5F8GA 1KQKA 2P1JA 2R9LA 2P9LA 1R8CA 3I1YA 2GIRA 2DHHA 4Q8FA 1BPDA 2IGIA 1IN0A 3E9PA 1F3FA 1AYEA 4A4JA 1FJGK 3QWPA 4R8UA 3V7LA 2ZH3A 4FWPA 4ZCKA 3NVYA 4IOCQ 4JUZA 1IQTA 1M5OC 1JMTA 4X64F 1RAOA 1P9QC 1H2TZ 4UAUA 3RJEA 5ALMA 2JRSA 4L3QA 4DZDA 5A8WB 3HJVA 2JXJA 2XI2A 3EWAA 4RW6B 2VYPA 2MQMA 3J7ZO 5KFWA 1MC8A 3DLGA 1RBVA 3BS9A 3LP1A 1X9XA 2KJ5A 2IJFA 2ZXHA 4HDHA 1RT5A 2DUYA 2E2QA 1TKZA 5CWRA 5J2EA 8ICTA 4QW8A 4M63A 4DX6A 4LFBK 2GO7A 3GYNA 5L9NA 1GLFO 3P5JA 1KLMB 1BL3A 2Y8YA 1FJGF 4YNQA 2HIYA 3O6QA 1XNQK 1FDDA 2KTQA 4WFNQ 3AOCA 3AGRA 1N5YA 4CZMA 2IOCA 1MU2B 3R6LB 3RRGA 4EWTA 3T19A 3PACA 1EHWA 1A77A 5L1KA 1RYUA 4NLSA 2H3QA 1O1WA 3BF4A 4FJ7A 2ZFHA 3RG6A 3G6XA 5AKIA 4OYXA 3C2KA 2X1AA 4KN7A 2OFGX 3SCLE 2FLLA 3TJ9A 3GYGA 3DLLQ 4QIFA 2P9IB 3O5TB 2LCWA 2YKMB 4LFBF 3AQEA 2OPPA 2WB1D 1KCFA 3SBMA 3EUB2 2IMOA 2H4YB 2YH0A 4BDYA 1TFYA 4LREA 4DOBA 1IBMF 4DR5F 3QBXA 1YITN 1RPLA 4F25A 4J9SA 4EEKA 2APOA 2LVWA 4L72B 3UD5A 4C48A 4DV6K 5TZVA 2XMTA 3D9BA 3P38A 2YB1A 2JLFA 3UMCA 4B02A 4N47A 2P9NA 3D2FA 3IKMA 4DTOA 4M45A 3ZTQA 3CVKA 2YI1A 1XHZA 4PEOA 3PM9A 2MQOA 3EZWA 2OYYA 3P5TL 3ATVA 3OJUA 1Z4UA 1T95A 4WK3A 1K9MT 1U1MA 2WF8A 3G4SS 2W6LA 4AD6A 1NK8A 3MI7X 3U1NA 3CC2S 4M3UA 5AXLA 5HK4A 2KKHA 2ZIWA 4PL1A 6FDRA 3MEEB 1TMMA 1B22A 4F67A 2FMPA 4BR4A 4KLUA 4X4RA 2VG6A 4ZVSB 1BPEA 4DTMA 1LV5A 1KQFB 1S9EA 3KLIB 3PW5A 5KT4A 3F73A 1HBMA 2ZHBA 4DV6F 5AI9A 4P2HA 5AM3A 2D4WA 2ASJA 1R31A 1UEUA 7ICUA 4WU2A 1ZZNA 4UY85 3MEDA 2RD5C 4NLDA 3UXOA 3I56S 3W61A 1VBKA 2AHOB 4FJJA 2IA0A 1VQ8S 4CEQA 2F8TA 1RT1A 1U7LA 4FP9A 2JH7A 1OMSA 2MEWA 1V9OA 3CJ9A 3KG1A 4DSJA 3WIUA 4K7QA 1UTAA 3D7EO 1ASWA 1F5BA 2WRMA 3BZKA 4JP8A 2QWNA 1K0TA 8ICMA 4NA3A 3AB4B 3THXA 5DG9A 1JB0C 3SCIE 4N41A 1WSFA 2QB0A 1X42A 4EEYA 2VJUA 4ILHA 1KAYA 3MUVP 1G6BA 2IA6A 2B3TB 2YNIA 3BF3A 4FS2A 1WKJA 4NOHA 2B0CA 3KKAC 1QAIA 3QAUA 3D6TB 2WBRA 5AFUH 3FM9A 5EHHA 1OUQA 2G1DA 2P2CB 1RILA 1WUUA 2FJ6A 4MK9A 2NXUA 1FXRA 1URJA 1RB0A 3F53A 1KQQA 1VBXA 2ZH1A 2VGNA 2J5AA 3DI6B 1AZSB 1QY7A 1AQ6A 2Z58B 4RQ1A 4BRKA 5J0YA 1FT8A 1UVMA 4EBEA 2XNRA 3RU0A 3R5JB 5L8RC 5J2AA 1RU1A 2ZBRA 1SC3B 2QARA 2W9MA 3QESA 2M70A 2DVIA 3KOAA 2IDEA 5GAEI 1I3OB 2NRHA 3UNYA 3ZZ0A 5HL7Q 4TUQA 1TVRA 3D0GE 5BPLA 1KN6A 4U96A 2KSOB 3P1GA 1YK9A 3BP8A 2QK9A 4EO8A 4FJHA 1N2XA 4IEEA 3M6ZA 3KYLA 4DR1K 2L9DA 5DZ7A 4JI7K 4JKGA 1WHWA 1NHUA 4P4MA 2RDIA 2E1RA 2HNYB 5IM0B 2I2YA 2B8QA 4HT5A 4F4WA 2GS8A 4Y0WA 1SJQA 3QNWB 4QW9A 3JTOA 4AILC 1TL1A 2BW7A 4BRAA 1WKKA 3WK8A 3TWHA 1QCKA 4TLQA 3OTEA 1OVYA 4F0HA 3AO1A 1Q3UA 3T1HJ 4FYVB 4KHSA 4IKFA 1SGGA 5AQWA 5AE3A 4B9LA 2YWFA 2VD3A 2V50A 2ZJ5A 3CERA 4CEDA 1V9PA 1GMWA 1RE1B 1FF2A 2ODGA 1KL9A 2H5IB 2BM0A 4DF4A 4PCQA 2LXFA 5J1EA 3B8HA 3DXMB 1GAOA 4FJXA 3SUOA 2MSTA 2PFDA 4LRCA 4DR1F 1IBLK 2POKA 3VEYA 3WKAA 1HA1A 3ZSQA 5HATA 4GV9A 4Y2UA 2DNLA 3RJGA 1C0TA 3CJKB 2G0AA 3W8PA 2W2MP 4MKVA 3CT9A 4GV3A 5HQ8A 2JLGA 4BWMA 1NK4A 1IXRA 5ETTA 3FCVA 2HOEA 4IBNA 4KTZA 4KHNA 5J0OA 5FLXU 4DQ8A 2QXLA 4OHZA 4EO6A 1FWPA 5ADXH 4LZGA 1VRTA 3CDAA 3CJ3A 1TQLA 4I2AA 4YHHK 1MMNA 3QQCD 4NYFA 3G82B 4X62K 3OL6A 4ED7A 5C42A 4KTQA 3JSRA 5A8KB 1TTHB 4P72A 4NLGA 1A0PA 4ZP6A 1U8SA 4HEA9 4OGEA 1NDLA 2LA6A 2VG7B 1IBLF 3MM5A 2QLBB 2E1PA 1JJ4A 2YKAA 1SJFA 4U8YA 3NF6A 3ENOA 4M9JA 1CJVA 3V9UA 2EH9A 3UCGA 4WJ3B 5FROA 1SIJA 2KFZA 1FEHA 5GADI 3ILIA 3L95X 3MWPA 4PGXA 4FKYA 1EB0A 2DL0A 4YOUA 1VRUB 4YHHF 5B66U 2FBYA 4X62F 3AVHA 4YDXA 3OS1A 3QRPA 4FOIA 4HHHA 1VK3A 4GKKJ 2L5YA 7ICOA 4C8LA 3R5GA 3A5MC 1SQKA 3RSEA 4KLJA 2IYGA 1SBRA 4TYBA 2L41A 1HFEL 3UXPA 2ZIUB 4YUDA 3MECB 3BSAA 2WVFA 2J9EA 2ZF5O 4AE5A 2ASYA 4DBQA 4QWBA 3RW6A 1NJZA 4M8LA 2WB4A 1J2MA 3TADC 5AI8A 4ZOSA 4AP9A 1REGX 3NAEA 1R8AA 4W98A 3ISZA 3G25A 4P0PA 1RADB 4HACA 5T7LA 4MO4A 4RNHA 1XR5A 3TA2A 2DTJA 2GAGC 2NNWA 5LL6Z 3DDHA 1UEVA 4PYAA 3UCZP 1BWVA 3OXGA 1P27B 1D0EA 5D15A 5LXRA 1JIHA 2VQFJ 4BGDA 3BR8A 3FZBA 2EK1A 1UAXA 2UXCJ 1XSLA 3C1ZA 4YVZA 2RRDA 2J6UA 1MWYA 4TXSA 3AJDA 3I31A 1RWOB 2Z1HA 3OFFA 1QQ5A 5HBMB 3K75D 3ETRA 2CYYA 1SS6A 3O9UA 2YX4A 2RT3A 5AQVA 5HVHA 4YDUC 4AL5A 4LC9B 1HNWJ 1FA0A 3CJ2A 2AX1A 2HIQA 4KLMA 4NEZA 5MLCQ 4O5BA 3G6ES 4LFCJ 3CM6A 3QO9B 2FBVA 3JAMO 1HI8A 3D1HA 1QHAA 4J03A 4NM1A 1FI4A 5D4BA 2VL1A 1T03A 4KGKA 4OJGA 4FYWB 3HVTB 5KAKA 1RBUA 5BRFA 4RW8B 3IMXA 1RCXB 2V2KA 2DKXA 3W2WA 4DFJA 1P6TA 1EQ0A 2W6KA 3SAGA 4DEZA 1W7WA 2XMMA 1VYAA 4KLIA 1S48A 2V4JB 3CDWA 3SYZA 1XIQA 4AF1A 3AQOA 2ROEA 5AK4A 3MR5A 1GTHA 1S59A 3MOZA 4E7KA 2HMXA 3KK3B 2FPMA 5EWFA 3QT6A 2W8KA 4XH5A 8AT1B 1YTYA 3N7RC 2UV8G 4JI8J 4NXNK 2A2CA 3TVYA 1LB2B 4DSIA 4CBUA 4NA2A 2A1SA 1C0UB 1PK1B 2BANA 5M1PA 2GMLA 4OPJA 2FMQA 3UFCX 2V63A 5DK5A 1UEKA 2I1QA 5M2RA 2P9PB 2D3OR 4B3TK 4ZN1A 1M1KT 3VGSA 2E5LK 2HVEA 2ZBCA 3ZZRA 2A41A 4DU4A 4OYPA 3UQSA 3UQ2A 3MWBA 5C25A 3QDKA 3HX9A 4ID1A 3MM9B 4KHMA 3HT3A 4OI1A 3T6JA 2GQCA 2WSFC 4Y0FA 5AKYA 3PSIA 2UU9J 4Z37A 1WC0A 3NGSA 5HVGA 5FRMA 4NXNF 2UXDK 9ICQA 1F1BB 2CQ3A 4MN4C 4A8EA 2JLEA 5BR8J 2YMPA 5BPMA 2XLKA 4WZMA 3MF5A 4KFBB 1X3MA 3VAIA 3UKRB 4B3TF 3FJ2A 5AK6A 3GR1A 4H4OB 1Y5NB 3E01B 2E5LF 4ZJQA 2E6MA 3DLEB 2XNQA 5CE3A 4IO9Q 2E3TA 3H0MB 4C8MA 2KHQA 3BQ2A 3QIDA 4N8NA 2BUNA 1VRQC 3H20A 5I3UB 4E89A 5GAEP 5LSLA 3WT0A 4EZ6A 4PRFA 1FKPA 4AHSA 4DPYA 1NKBA 3EEQA 4ZCMA 4PKHA 3MMBB 1URRA 2WF6A 4A48A 4Z2XA 3THVA 3KMSA 2W40A 2W41A 1S76D 2UXDF 2XY8A 3BS5B 7ICTA 2DNNA 3CD6S 1WG8A 4X66J 4M5KA 3OR2A 1LXJA 1OXJA 2CH6A 5IQQA 5ALYA 4ECVA 3QGHA 2KFYA 2I9GA 3QB0A 2PY5A 3ADAC 3DLKB 5AQMA 5B0AA 3W5XA 3OR1B 5JU5A 5HJXA 4YORA 2KJ8A 2ZJAA 3R3LA 4KPCA 1YF5L 1U24A 4Y2JA 4JLHA 2BQRA 3A8EA 2LYHA 1M1HA 2FJXA 9ICVA 3NL0A 1GLCG 2H3VA 2BMBA 4YEAA 2V8DA 1DK3A 4H0XB 4JI6J 4IG3A 5JMNA 1CC7A 1WDDA 2FVSA 3K9JA 5JLHA 4DV4K 2LQ9A 1RSCA 2BPFA 3IMQJ 4GO7X 1GFWB 3OY9A 2G5IB 4RBTA 1E6YB 3AM9A 2ASLA 1AXQA 2R42A 3KLGB 4BXOA 4USAA 3OTOK 2R7TA 3Q8VA 3CXCR 5C5JA 4P74A 1V3SA 3KLHB 2IHMA 3EW9A 4NY8A 2BKNA 1ZQPA 3ZETB 4B3SJ 4C11B 3E66A 3LPTA 5KG0A 3DOMA 1T3VA 4CJ5A 3MAHA 3KK2B 3D0IE 4HHTA 1C0FA 1NMDA 5KFDA 1H7XA 2GIFA 4GXKA 1JLAB 1NPPA 3I8DA 4ED1A 3SXLA 5KFKA 5HMYA 4GO5X 5AQLA 4LFBJ 2M4MA 1A6LA 3QU9A 1IM6A 1HWJA 2QLJB 3KLVA 3TSUA 1GNKA 3T6BA 2BOAA 2XY7A 1X4BA 2FZCB 4PKDB 5JVHL 3SDEB 3ZSXA 1FXXA 3T5LA 4J9QA 1XNQJ 2PI4A 1TKTB 1J2NA 1ZOLA 1PUZA 3ID6A 3WK4A 4DV4F 1KFTA 4KB7A 2GUPA 2ABYA 3CJ4A 1X5SA 3NY0A 3EN9A 1S3XA 4TU7A 4TU9A 4F3QA 3OTOF 4BLGA 1CXUA 5BOLA 1NGAA 3H0PA 1T4GA 3HHEA 4EU0A 1CLFA 4CEAA 4R25A 3MX5A 1WACA 3UIQA 2O6KA 2BW2A 4RWWA 3PW2A 2FLNA 1SJ4P 2D74B 2KXFA 1H7WA 4DSEA 4H5TA 5ALWA 1FDAA 4GXIA 3M2RA 3RJHA 4KI4A 5GADP 5BPNA 4BCAA 3WIVA 3UR0A 2HLUA 3Q7CA 4US9A 5HHIA 2BE9B 4M9NA 3ISBA 3CF5L 4N56A 3CCRN 4HI1A 2DPIA 3RMDA 1HNIB 3WQPA 2EZYA 1Q4RA 1DQ8A 1VC5A 3GYXB 2C42A 4Q0BB 4OZ2A 3TARA 1H2UX 5B7WA 1OY8A 2M88A 5ITHA 3O5BA 4K2XA 3LF0A 4JI2K 2D41A 1ZAVA 3I5CA 5EGYA 2KKPA 2AEFA 1YI2N 3D28A 3PSFA 2XMKA 3DHWC 3AJ1A 4LFAJ 2P8IA 4W92B 3MM6B 1YRTA 2B7BB 2VFVA 4CJ3A 1RBLA 4JK7A 3VPZA 2OPSB 5KGWA 4UW2A 3LZJA 4HL9A 5L1JA 1OPZA 2QXFA 1ZTWA 1VQ6N 4CRXA 2CJKA 4C7YA 3OXLA 4ISFA 3RJIA 4PUOA 2MJUA 3DOKB 2OUGA 1Y3JA 2GAHC 1QVGR 2WB1C 3QMLA 3EUNA 3C94A 3M8PA 4K5RA 3UE5A 2ZE2B 2XIDA 4KT0C 2KZ3A 4LVSA 4B1WB 1P9YA 2FLPA 1FFSB 3SAFA 1SV5A