1NK9A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after two rounds of primer extension, following incorporation of dctp and dgtp.
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk9A01
2IHNA 3MAQA 2VA3A 4JV2A 3RJHA 5HRSA 4Y1DA 4F3OA 3AU6A 4M47A 4CIFA 2FPKA 4O3RA 4DWIA 5SWMA 2P51A 4J2DA 1ZETA 3U3GA 2IA6A 3V7JA 4Y1CA 1WSEA 2A1JA 4I28A 4K4HA 5KFDA 4B9TA 2A1JB 4PHDA 4AHCA 3DLGA 1ZQKA 1ZQCA 4LH4A 3KJVA 4IFYA 5J0RA 4UB2A 4EBCA 5HP4A 1ZQAA 3Q8MA 1TAQA 2BPFA 4IR9A 1FK9A 1HYZA 1HYSA 2BPGA 1C7YA 2BCVA 3BQ2A 4DEZA 3M8PA 4PUOA 5CZ1A 1ZBUA 1Z00A 3MDAA 1IKWA 2G8UA 3OVNA 4DFMA 3QETA 3O3FA 4I7FA 5IIIA 3L2RA 4Z4IA 1C6VA 2B21A 3QNNA 3EY1A 4GXKA 4J9KA 2PYJA 3H8JA 4FW1A 3MFHA 3PW2A 4CK2A 1S6PA 4BXOA 4DTMA 1TV6A 7ICRA 5TZVA 4FM0A 3N97B 3NCIA 3CFRA 5HHHA 2BKEA 2HHTA 1YT3A 3P83D 5KFVA 4O3SA 3ZT3A 4ECZA 4DF8A 5DG9A 2UVVA 5FRNA 3GV5B 3T5KA 1LWEA 3K5LA 4HUFA 1N6QA 1JN3A 4ZTFA 1CZBA 1S1UA 1L3SA 4XRHA 1ZQQA 1ZQLA 1KEJA 4DS5A 7ICEA 3NH1A 1TKDA 2W8LA 1RBUA 3ZSZA 4FJ9A 1TK0A 3AVMA 3SI6A 3RAQA 2J6SA 4CGFA 3V6KA 4QWDA 1T8EA 3O4QA 4FBTA 1XI1A 3L2WA 4KLGA 1WAJA 8ICGA 1JLAA 3OYCA 3DLKA 3MEGA 4KHWA 5J2MA 1VSDA 3ZT2A 4ID5A 1G15A 1NK0A 1LWFA 3ISCA 2LYHA 3DRSA 4CERA 1VSHA 4OGCA 3RB3A 3HPHA 2KZZA 1D5AA 1U9LA 9ICWA 4W5TA 4B9VA 4G1QA 5KFEA 5FDLA 4CF1A 2XO7A 3MDCA 4HUEA 5KGXA 3JPRA 4CK3A 1RBRA 2Y1IA 1ZQDA 2BE2A 3Q8QB 3DI6A 1VSIA 5KFXA 3HWTA 2IC3A 1Z3EB 1VSKA 8ICYA 4DL5A 3JPNA 4JV0A 1EETA 1WSHA 4J9LA 2GUIA 4W5QA 1I3AA 9ICKA 4FJNA 4CHYA 1KVAA 4CE9A 1JLBA 1BPBA 5FRMA 2KTQA 4J9SA 4I2GA 4KHUA 3IG1A 4JUZA 4LVSA 4ID1A 4JS5A 2Q3SA 8ICMA 4CEFA 1JLCA 4J9QA 1TK8A 2RDIA 4N47A 3QEPA 1RT2A 3VQ8A 1NK8A 2ZJAA 5J2FA 3ZSXA 4GC7A 5DBCA 4DL7A 2BCUA 2FMQA 2ITGA 4UBCA 1MQ2A 4R8UA 5KFYA 4RZRA 4CF8A 2DFFA 3L8BA 4IKFA 4CK1A 4ECYA 4PHPA 3AA3A 2F8SA 4I2FA 4XUSA 4CEAA 1VSLA 3SZ2A 5KFFA 4W5OA 4F4ZA 4NCBA 4DTPA 2WTFA 2HVIA 4FLVA 3ZT4A 1N5YA 5JUMA 4CIEA 8ICVA 2IGIA 3LP0A 3RMDA 3H08A 4Z6CA 4E0DA 4LD0A 1NK7A 4KHNA 5DK5A 4CHOA 3UXOA 1IG9A 4DTUA 4ED1A 3MXIA 2O4GA 1T05A 1JLEA 7ICHA 4Z6EA 5J0QA 1UOCA 3RH4A 5DLGA 2VG5A 2BQUA 4QAGA 3KHHA 2E6LA 4FJ8A 1U47A 4MFAA 1BIZA 2VG7A 3C5GA 4RT2A 2ZD1A 3LWMA 3CG7A 4B9NA 1BPDA 4I2CA 4B9SA 3F73A 1RTJA 2Z1IA 3TAEA 4I2IA 3LANA 2QK9A 4QZ9A 4KPYA 1GOBA 5HMLA 1HNIA 4YN4A 4F5PA 1TK5A 1ZQRA 3SUPA 4CJKA 3SCXA 3V9XA 3EZ5A 2JEJA 3G0ZA 1RXWA 7ICKA 4PGXA 3IRXA 3ZCMA 4YMNA 1XSNA 2M9NA 3T3FA 4LSLA 3QZ8A 3K5OA 4O9MA 4E7IA 1REVA 1CXQA 4CIGA 4Z4GA 3KLHA 4C8LA 1ZBLA 1ZQYA 5DG7A 1N56A 2DPIA 4I9QA 1TGOA 3ZSOA 2C28A 1WCNA 3HP6A 4QZHA 4HTUA 4IG0A 3GDXA 5HROA 1ZQIA 2H5XA 3I0SA 4O5CA 1CUKA 1XS9D 3HO1A 1ZJNA 3S3OA 2LSNA 4FO6A 2W8KA 4FZXC 4UB4A 3KKSA 2Z1GA 3TABA 3OYGA 4M3ZA 5J2NA 3ISDA 5IIKA 9ICNA 1BPYA 4P4PA 1HPZA 3AVCA 2WONA 4JV1A 4YP3A 4CJ5A 4DTOA 3TQ1A 4F5NA 7ICGA 2R8IA 3Q8RB 4N5SA 2ZUCA 4M45A 1XO1A 5HLFA 2FC0A 3PMLA 4KHQA 4CJVA 1BCMA 4H4OA 2R8JA 4CJEA 3KLFA 1KVBA 5KFCA 5L1JA 3B0YA 3JSMA 5DBBA 2W9MA 4JK1A 2YNIA 3KHRA 5J2GA 4YFKA 1S1XA 2W9BB 3QZ7A 4GC6A 1S0OA 4GMJB 4FS1A 1MQ3A 1HJPA 1RT6A 1I39A 5J2CA 4EYIB 4TUPA 1A77A 1HMVA 4Z6DA 1FKOA 4CJPA 4RW7A 2HNZA 2PXIA 2E4LA 3ZSVA 1Q9YA 1LAVA 3NGYA 2PYLA 1VSJA 4XQ8A 1Y97A 4KKOA 2OPSA 4NCAA 4N41A 4DTNA 1S1TA 4HHTA 3HX0A 4NCGA 2AGOA 2YNHA 2E6MA 9ICXA 9ICHA 4I27A 3LPTA 4F8RA 4RG8A 3C1ZA 3JPTA 2C2EA 4FLUA 1QS4A 1ZQWA 3T19A 1HNVA 4ED7A 4I2BA 3ZSYA 4DTJA 4Z4EA 1VSMA 4M04A 1IXRA 3VA0A 5KG2A 3LDSA 4I2EA 3AVBA 1WSIA 1RTHA 1EXNA 5KFBA 1SL2A 3V9SA 1B43A 5KFGA 3TI0A 3AVHA 5HRRA 4CJ4A 3HYFA 1KLNA 4M9NA 3RRGA 4Q43A 2ASLA 2RF2A 5KFPA 4Q44A 3PY8A 1QQCA 4G3IA 4FJJA 3V4IA 3HW8A 9ICOA 4KI6A 4Z4CA 3PV8A 5KRTA 3WNEA 1C0TA 4DQSA 3RJFA 3V9UA 3UQ2A 1LW0A 3AVIA 1WLJA 7ICSA 3CFPA 3RJIA 4UB1A 1KVCA 1EXQA 3DLEA 4E19A 3EYZA 5C42A 3AA5X 5HNKA 1NJYA 2OA8A 4NLZA 5KFSA 2PZSA 4JS4A 3LAKA 4BE0A 3IM1A 3OSPA 4FLWA 5DGAA 4YFUA 7ICLA 5J2AA 2BANA 3PO5A 4M42A 2MAXA 2FBXA 1QSYA 4RQ7A 5J1EA 2DTUA 3UIQA 4HUGA 3H40A 4KLDA 5FROA 4CGJA 4KTWA 2AGPA 4H4MA 3Q8KA 1MSWD 2DPJA 1LAWA 2F1IA 2JEFA 2BGGA 4C8OA 9ICFA 1S1VA 1A5VA 1Y88A 1S97A 4GW6A 4M9GA 1BI4A 4KLSA 4JRPA 4GXJA 4ED6A 4W5NA 1T4GA 1VRTA 3AO5A 1RT3A 3NGZA 5KFTA 4MFBA 2ZUBA 1ZBFA 3AO2A 4ED8A 9ICPA 3SV4A 3E01A 2IDOA 4LSNA 1SKRA 2YHBA 3V72A 8ICOA 2IBKA 4FLZA 4LH5A 3PVXA 4B9UA 4CGIA 3NF8A 4KLJA 4B3OA 2YKMA 3OS0A 5HP1A 3LP1A 4UAWA 2J6TA 1RTIA 4IQTA 3ZD8A 4RNMA 5J2IA 5JS1A 1DGSA 3RH5A 5KT3A 2PFNA 4CFBA 3RJEA 1NK4A 4RPZA 2RPIA 3LZIA 3JYTA 1D8YA 3OS2A 4MFCA 3EWAA 4TSXA 1XC9A 4RQ1A 3AA4A 3RR8A 1N48A 1COOA 1ZQZA 4KHSA 3NFAA 4M3UA 4DFJA 4ECXA 3THVA 1S9EA 4BDZA 3KK3A 2D0BA 3GIIA 4PA1A 1NJWA 3LDAA 2PI5A 4KLIA 4OKEA 4FJ7A 3K5MA 3ZSQA 3PX6A 4CFAA 2G8WA 1ZQEA 5CYQA 4RQ2A 3JPPA 3NHGA 4CF2A 5KFHA 1RNHA 2B5JA 4PHEA 4FVMA 4CEZA 5KG5A 4MEXA 5CYMA 3RTVA 3QEVA 1X9WA 1NOYA 3SYZA 3PMNA 4CECA 4O5KA 4NYFA 4CEQA 3NBPA 1LW2A 3MEDA 5KGWA 5J2EA 4IG3A 3GFKB 5F9LA 5KT4A 2B6AA 9ICEA 7ICFA 3C1YA 1ZQVA 1U45A 4F4XA 3GIJA 2OPRA 2ASDA 1JIHA 3C5FA 3V9WA 4CF0A 4NLGA 5KTQA 3SPYA 4QZDA 2J6UA 3TFSA 1RILA 1ITGA 4KLEA 2V4QA 7ICOA 4DOAA 4F4WA 3C2KA 1LWCA 2ASJA 1ZQPA 4DO9A 2XCAA 2C22A 1XHXA 3C6TA 3TAPA 1NK5A 2NUBA 1ZQSA 2AJQA 2XY7A 1RT4A 3U6FA 1C1AA 1YTAA 3KLGA 3KD5E 4QZEA 5I3UA 9ICJA 5KFQA 1ZBIA 1K6YA 5J2DA 4IBNA 4I2AA 2Q0ZX 2ZUDA 1ZQTA 4NLKA 9ICRA 4EBDA 4CFDA 3GIMA 4KREA 4KB1A 2UVRA 3OY9A 4F91B 3NDKA 3L2UA 1Z26A 5C25A 4ED2A 4IQWA 3OYHA 2ZE2A 4KLHA 4DU1A 4F3TA 3SQ1A 3QNOA 1DTTA 1UA0A 1WAFA 4O3NA 3M8SA 4B08A 1X9SA 3I8DA 4DU4A 3PUFA 1WCLA 1ZQHA 4R66A 4CHNA 2WOMA 9ICMA 3K5NA 1SL1A 4E7HA 4KB0A 5HMMA 3PO4A 2PFQA 1HJRA 3SV3A 2FPMA 3OYFA 9ICIA 3DLRA 3B6OA 2BQ3A 3QE9Y 5BOLA 4PGQA 1DTQA 2XC9A 9ICAA 5EWGA 3U3YA 3VQ5A 2BCRA 4M0AA 4XA5A 4UQGA 1GOAA 2JLEA 4MF2A 3H7IA 4YMMA 4QWBA 4FS2A 5J2JA 4Q8FA 3FYHA 3EW9A 4M9LA 8ICKA 3ZSWA 1QTMA 3PW7A 3E2EA 3ISBA 4M2YA 3H4BA 4FK2A 1JL1A 3LP3A 2BPCA 1B9FA 1J54A 4RNNA 4UAZA 5DB9A 1RCHA 3WNGA 3RJKA 5C24A 1MC8A 2W9CB 4AH9A 4ZH4A 1KCFA 3L3UA 2G8FA 3MGHA 4CEDA 3C94A 1BHLA 3ZDBA 4BE2A 4AHRA 3PW0A 4IFVA 1BVSA 3KD1E 2X6SA 4J9RA 3L2QA 9ICQA 1SKSA 1BIUA 8ICCA 2XRIA 4RUCA 2YHAA 4DSFA 4YMOA 4J2EA 4RQ3A 3CYMA 4Q8EA 3CFOA 3VQ6A 2BQRA 1KFDA 4DOBA 1EKEA 5KFNA 1ZQOA 4YR0A 3AVFA 3VQEA 5EWFA 1C1BA 5IIJA 4EBEA 5EU7A 4IRDA 2G8KA 1IO2A 3GILA 3QEBZ 5K14A 4ECSA 3JPSA 4QZCA 3AO4A 3KKRA 4NY8A 3V6HA 2FMPA 4KLMA 4JLHA 3SUNA 1CXUA 2D5RA 5T7BA 5DB7A 4UAYA 3DM2A 4F5QA 4QWEA 2C2DA 4DSJA 4PHAA 4GXIA 1LB2B 4KO0A 4NM2A 1NJXA 3T5LA 4AHTA 2F1HA 2O4IA 4FYDA 1S9GA 4DTXA 3VQCA 1TFRA 2I5JA 1ZBHA 1JL2A 3FDSA 4ECVA 1TV9A 3V6DA 4TUQA 2PY5A 4J9OA 5CJ7A 4TURA 8ICJA 5CWRA 4K8ZA 4YD1A 2Z1JA 4RT3A 1UWBA 1JXEA 5J2KA 1ZQFA 3G6YA 2DFEA 2ZTEA 4RW4A 2V4RA 7ICUA 3DOKA 2HVHA 4YR3A 3Q8SB 4CJTA 1RBVA 5KT2A 3AVAA 3AO3A 1S6QA 3SPZA 2OYQA 3RRHA 1RTDA 2MUTA 2MUTB 5KG4A 5KT6A 5D49A 4Z4HA 3RB0A 1VSFA 5J0PA 4FK0A 3HPGA 1IKVA 2RDJA 3H8WA 3OJUA 5D46A 1S76D 2W9BA 4TQRA 4IQVA 3LK9A 3ORYA 1NJZA 4KLFA 3WNHA 2DFHA 1KFSA 2QKKA 3ZDAA 4DL3A 1L5UA 1RPLA 4K4GA 3LZJA 4JWNA 2XHBA 3NGDA 1RZTA 2FBTA 8ICSA 4FJ5A 2BR0A 2GV9A 4JRQA 5DQGA 4DSIA 4E1MA 4YR2A 1X2IA 2IS3A 5DMRA 4DL2A 9ICGA 2V9WA 2Z1HA 8ICBA 2QXFA 1TKXA 1TL3A 3MEEA 4FM1A 1EX4A 3V1QA 4Z6FA 1CEZA 4EZ9A 3H8SA 8ICZA 4KTQA 3G10A 8ICPA 1SL0A 4I2QA 5KG6A 4B8AB 3QO9A 1A76A 3V9ZA 5I42A 4B9LA 4YVZA 5J0SA 4CGHA 2JZBB 3IS9A 5KG1A 4YD2A 2W9AA 1WNSA 3KHGA 3MR3A 1JX4A 2XY5A 1T3NA 4HYKA 2HHUA 1FXXA 3OYDA 3EPGA 1L3VA 4YXMA 2DY4A 4PQUA 5L9XA 4R64A 4TQSA 5J0UA 2ZJ8A 1NK6A 4RQ8A 5DLFA 2GWSA 3HK2A 3K2PA 3MABA 5BOMA 7ICVA 3ZD9A 3RH6A 4RU9A 4BE1A 2A1RA 4CF9A 1JKHA 4F92B 1U04A 3OSNA 2FBYA 2VWJA 3C23A 4M3WA 4FJMA 4F2RA 4YQWA 3T1AA 9ICLA 2AQ0A 3LP2A 2PFOA 3DLHA 4Z0UA 5E41A 5J0YA 3D0PA 3PR4A 8ICXA 3MGIA 4CFCA 1L3UA 7ICPA 4DTSA 5DBAA 4CJLA 4J2BA 3AO1A 1ZQJA 1RYSA 4N76A 5DQIA 1D9DA 1B9DA 4O0JA 4E7JA 9ICBA 3HJFA 3T5JA 1UA1A 1WSGA 3AU2A 2FBVA 1RT1A 5J2QA 2NRXA 1RDCA 5CY4A 1C0UA 4CEBA 5HHIA 3EPIA 3KLIA 4O44A 4PWDA 2ZTCA 3OJSA 2HHWA 2QKBA 1HQUA 1QE1A 4DU3A 4IRKA 2FLPA 2FPLA 1RBSA 3OYIA 3H4DA 4CJFA 1WSJA 3BJYA 4E7LA 4ZHRA 3Q8PB 5C5JA 8ICLA 3NH0A 4QZ8A 5DDMA 1UAXA 4F4YA 4IQUA 4UBBA 3B6PA 3SUQA 3NF9A 4R63A 1AROP 3TAGA 1TAUA 3SUOA 8ICWA 3M8QA 2UVUA 5KFUA 4DLGA 3SQ0A 1WSFA 4OLBA 2YV0X 3DOLA 2UVWA 3F9KA 1BPEA 4BGDA 3NAEA 1NKCA 3RMCA 4KLLA 4CEOA 4I2DA 4CEEA 2XGQA 4M9HA 2YNGA 4LY7A 5KRSA 1RYRA 3GV8B 1BCOA 4J9NA 3V1OA 1FKPA 1JLGA 1J53A 2KW4A 4CJWA 5J0TA 2OZSA 7ICIA 4OKKA 5BPCA 2OPPA 2KFNA 4P4MA 5DB6A 3NGIA 3BDPA 4ELUA 3BQTA 5F9NA 4C8NA 3N4MB 2HHSA 5DDYA 3VQ4A 1A5WA 5J2PA 4OVLA 4QW9A 4KHYA 4DF4A 3HVTA 4UB5A 4ED3A 1TL1A 3NF7A 5KI6A 1ZYQA 1TKTA 3SQ2A 1BQNA 3VN5A 5DB8A 4E1NA 3QEIA 5CA7A 3MBYA 5EWEA 4Q0BA 3KK1A 1JLFA 3VQAA 4FJKA 3MR2A 4DFKA 3V81A 2PFPA 5CHGA 4RPXA 5KFRA 3MXMA 1QHTA 4KLUA 3S3NA 2P66A 4IR1A 4KITB 4B8CA 5D3GA 3ISNC 2P5GA 3AVKA 2OWOA 1QLNA 3C21A 4RW6A 5L1LA 1NOMA 4ECUA 1D8LA 3ZSRA 1XWLA 5J0WA 8ICQA 2XY8A 2OZMA 3RMBA 2R8GA 3GIKA 3VQQA 3K58A 1S77D 4M6WA 3QEAZ 1TVRA 1JLQA 1SZPA 3RR7A 2NRWA 3AV9A 8ICTA 4M6WB 1XSPA 8ICNA 4X5VA 4CGDA 1Z00B 2HHQA 3HL8A 3DLBA 3ZT0A 5J0XA 4CHZA 1ASWA 5JS2A 1RXVA 2KFZA 1B92A 3LPUA 3BQ1A 4IRCA 5HRPA 4EP4A 1RDAA 1MU2A 2KN7A 1VK0A 2X78A 4I2JA 1KLMA 3QEXA 2P1JA 3RWUA 4NM1A 3CM6A 4BXOB 5KG7A 1YVUA 3RMAA 1S1WA 2OPQA 1ZQXA 4YXJA 4DQQA 5KT7A 5SZTA 1BPXA 4I2PA 4KRFA 3PX4A 4RUAA 3DRPA 2FMSA 4C8MA 2HNYA 3OHBA 3Q8LA 2HW3A 4DSEA 1H38A 4DQPA 4RQ5A 4RNOA 4R65A 1XSLA 3VQ7A 3HXMA 3RB4A 1SV5A 3HT3A 2Y1JA 4MEYA 2X6NA 1V9PA 1IKXA 3TAFA 4QZIA 4GLXA 1C0MA 4Q5VA 1JXBA 1S5JA 3OYNA 3V1RA 4O5BA 2ZTDA 4RQ6A 8ICAA 3C6UA 3TAMA 1CZ9A 2R8HA 3TANA 1WN7A 5DKWA 3QINA 4M3XA 4N56A 2VA2A 4FJXA 1QSSA 4UB3A 3K4GA 4KN7A 4FLXA 1SKWA 4NYNA 3UXPA 2HHXA 3P5JA 4OJRA 1S0NA 3SNNA 2A1SA 4K4IA 4BWMA 2XCPA 3KK2A 3S3MA 1BQMA 5KFMA 3QLHA 1RT5A 4E89A 2ISOA 5EOZA 4PH5A 5KFAA 3HP9A 4PY5A 2HMIA 3AUOA 5DG8A 5J2BA 3VQ9A 5KFOA 2NRTA 3O3HA 1W9HA 1RDDA 3LALA 3TAQA 3VQPA 3AVGA 4FZZA 3LWLA 1KFTA 4WE1A 4CJUA 2XY6A 4DSLA 4XIUA 2KQ2A 3VA3A 1ZQGA 2ETJA 1RT7A 8ICUA 3QIPA 1PZNA 2AU0A 5J29A 1KTQA 5DQHA 4J9MA 4M41A 4O3PA 4P2HA 5D4BA 4YCXA 4I9LA 1X9MA 3GQCA 5HRNA 3HM9A 5DGBA 4DG1A 4Z4FA 5CP2A 4FJGA 2DFLA 2HNDA 2RKIA 4KFBA 2EHGA 5KG0A 2G8HA 3ZDCA 9ICUA 3ETLA 4O55A 4ICLA 1BPZA 3LAMA 5IIOA 4OLAA 4NXZA 4QWCA 4CJQA 4PGYA 2GBZA 2W9CA 3RJJA 3KLEA 2P6RA 3ULDA 4EEYA 4R8UB 4M3TA 4O3QA 4FXDA 4CHPA 1NK9A 7ICMA 3NE6A 2ATQA 2VANA 4ECWA 3O3GA 4ELVA 3UXNA 4EP5A 2F96A 2G8VA 4LZDA 2IAJA 3OYAA 4MF8A 3UQ0A 1B22A 3NTUA 4R5PA 3AVNA 1EP4A 2ZJ5A 8ICRA 4OGEA 3MR5A 3GV7B 5L1KA 3HPOA 2JEGA 1GOCA 4JWMA 1DOQA 4DTRA 4M3YA 1ZQBA 1O1WA 2AQ4A 2NRVA 3G6XA 1U49A 1UT8A 4HCCA 1K1SA 3QERA 3V7KA 4KTZA 4AHSA 2IHMA 8ICEA 1HQEA 7ICNA 4KV8A 2BCSA 3WNFA 3AVJA 4QZBA 3G6VA 2ALZA 4C8KA 1ASUA 4KI4A 3PNCA 2ISPA 4O5EA 3ALYA 3NF6A 3RAXA 4KLTA 3HVRA 3DMJA 4B9MA 3NH2A 4I29A 4EYHB 3M9OB 4QW8A 4CHQA 2AGQA 1TVAA 4QZGA 4F93B 2I1QA 5IINA 4FLTA 1JXLA 4FJHA 3TR8A 3KHLA 3SJJA 1U4BA 2R8KA 4QZFA 1T03A 2KZ3A 4O0IA 4QOZB 3M9NB 1UT5A 1KRPA 4HVJA 4M3RA 3AVLA 3P1GA 4BDYA 3MFIA 3SI8A 1HYVA 2ZQBA 3ZT1A 3MR6A 3OYKA 2VG6A 3T5HA 4E3SA 4H8KA 3K57A 5IILA 3DRRA 4FW2A 3B0XA 1YTUA 2ATLA 3OYMA 4KLQA 1HRHA 3VQBA 4Q45A 4J9PA 3MXJA 4CCHA 4DFPA 1ASVA 4OPJA 4RPYA 1XHZA 2IMWP 3ASMA 3A2FA 2VA8A 3ZDEA 4RQ0A 2R7YA 4O4GA 3PX0A 3PW4A 1K1QA 5CB1A 3L2VA 3JPQA 2BCQA 4LZGA 4MQ3A 3KIOA 4I2HA 4F50A 2F8TA 1S0VA 1IM4A 4PPXA 4FZYA 1HUZA 2F1JA 4OPKA 1S10A 1SUQA 3RJGA 2HHVA 3V7LA 3I0RA 4OKJA 4P4OA 1ZJMA 4CESA 2G8IA 1F21A 4ELTA 4ECRA 5IIMA 4F2SA 3KTQA 8ICFA 3TWHA 4FLYA 4KAZA 3RBDA 4AHVA 2D0AA 3OYEA 3SQ4A 3IHQB 1D9FA 3C2MA 2JZBA 4KN4A 1KDHA 1IKYA 4DMNA 4J2AA 2EX3A 3OYBA 3OHAA 1RDBA 5J2HA 4DL6A 4RW9A 4HCBA 3UPQA 4MFFA 4FK4A 1A5XA 1S9FA 4YG2A 2P5OA 3ITHA 1J5OA 1RBTA 3L3VA 1C1CA 3O4NA 2P6UA 1NOZA 7ICJA 4M9JA 3ZDDA 1XU4A 4DQIA 4ECTA 1ZQMA 5CR0A 4FCYA 4O3OA 1TKZA 3K59A 4KMUA 4TUSA 3TARA 3MECA 1VSEA 5KFZA 5KFLA 5L1IA 1HUOA 3S9HA 3BQ0A 3CM5A 1IH7A 4KLOA 4AILC 4GVMA 4CJRA 9ICVA 4F5OA 2VWKA 1S0MA 1ZQUA 1R0AA 4IDKA 4CJSA 4QCLA 4QWAA 5KFJA 3V6JA 4DS4A 5KFIA 5KT5A 1CLQA 2IOCA 2JGUA 1X1PA 2YNFA 4DLEA 4BWJA 1ZQNA 4F5RA 4W5RA 4ED0A 3TFRA 9ICTA 1NKEA 4F4KA 4FBUA 4FJIA 4RQ4A 3K75D 5KFKA 3AA2A 3QIOA 4DQRA 1T7PA 3OS1A 3OYLA 3M8RA 4EZ6A 1VRUA 4DSKA 2YKNA 3PR5B 4RW8A 3BGRA 2NRZA 8ICHA 2I9GA 5HBMA 2PI4A 2JEIA 1Q9XA 4FJLA 1BGXT 1KSPA 2BDPA 3M9MB 4NLNA 2BHNA 1U48A 1QSLA 2XGPA 4YNQA 3RB6A 4ECQA 1BISA 2W42A 4ZTJA 3RBEA 5KFWA 4DOCA 3FFIA 4FM2A 2C2RA 1L3TA 3OYJA 4CJ3A 3HSTB 1J9AA 9ICSA 2HB5A 2D0CA 3CQ8A 1JMSA 2BGWA 1Z25A 2RN2A 2KZMA 3OGUA 8ICIA 3JPOA 2FLNA 1DLOA 2B4JA 1Q8IA 4AHUA 1W0HA 1NKBA 7ICTA 3PW5A 4CGGA 4DL4A 4BACA 2X74A 3C95A 2FLLA 3QESA 3QEWA 3C2LA 3IAYA 3VQDA 1BI4B 4BDPA 1BL3A 3D45A 5J0OA 9ICCA 4QZAA 5KG3A 3DYAA 5CZ2A 4L8RB 4K8XA 7ICQA 4E7KA 1LV5A
chains in the Genus database with same CATH superfamily
1NEEA 3DJCA 1T3VA 1ZS6A 1K8AO 2WFAA 2KL8A 4M7YA 1SH3A 2JSXA 4F3OA 4AD6A 2DNHA 1VDVA 3UR0A 2V8DA 5AQNA 4CIFA 1YLXA 4MYTA 5LSLA 1WSEA 4K4HA 5AXKA 3TOQA 2CPJA 2A6OA 4AHCA 1ZBTA 1ZD2P 4IFYA 2XMUA 2C2OB 2HBMA 3E9PA 1IWAA 1TAQA 2BPFA 4NMLA 1PYSB 2RMLA 4KHMA 5ALYA 1C7YA 3E51A 4DEZA 4AQYF 4PUOA 2AX1A 2CNKB 2NV3A 2E2QA 2IJFA 1IKWB 4P6QA 4O0NA 4I7FA 4JAXA 3OD2A 4BRGA 5CRXA 4GXKA 3R7BB 4B1UB 5LT5A 4J9KA 2EH9A 4LFCF 1N0VC 2B5JB 5KL1B 4ACOA 1TV6A 2FHJD 3ZTQA 4RR5A 3NCIA 5B0DA 3SQOP 5HHHA 2BKEA 2HHTA 2A42A 1T9XA 3TACB 3ZT3A 4ECZA 3QT5A 3GV5B 4X4NA 3EGNA 2B0GA 4CLZA 4IG3B 1N6QA 1CJVA 2YHXA 1JN3A 1M5OC 2WVBA 3BGOP 2NXJA 4BS2A 4OJ1A 2OPRB 2Z2YB 1TKDA 2W8LA 3ZSZA 4TU8A 1WC1A 3SI6A 4CGFA 2MZRA 3NNHA 3J81O 3O4QA 3O9QA 1FDAA 5EXWA 4LBHA 3THTA 3ETOA 3QX7A 1CLFA 4KLGA 3S8SA 2DK2A 4OYWA 4BBYA 2KHCA 3MEGA 3DLKB 3ZT2A 2CADA 1RDFA 1I94J 2V52B 1LWFA 3ISCA 3RB3A 2NO4A 2KZZA 1P9QC 3H5UA 2M7SA 2GW8A 1WKKA 3TJ9A 3CNHA 5KFEA 2VQFJ 2PAVA 3TO8A 1IG6A 2KJVA 5B0BA 2KXFA 4HUEA 3MAAB 4X4TA 3NP5A 3JPRA 2WZ1A 5ETOA 1RBRA 5AIAA 2GC8A 2F40A 3EE3A 4DCHA 1ZQDA 2BE2A 2ZE2B 4W90B 3DI6A 2WAQD 5GMKa 2IC3B 1FHTA 4JV0A 1WSHA 1RISA 4J9LA 5AXMA 3HRDD 3KZXA 1Q18A 1MMLA 1QQ5A 3MM9B 4OLPA 2PFDA 1KVAA 1JLBA 5FRMA 2KTQA 2IM1A 4ZJOA 5FLXY 3ZTPA 4JS5A 4CEFA 3HHDA 1JLCA 1TK8A 1DTQB 4ZVUB 4DR2J 5IS2A 1GMWA 2ITMA 4TLRA 3P39A 2UXBF 1R6VA 2G0CA 2RP5A 3KK7A 4NWIA 5HJXA 4Y2YA 4RZRA 4CF8A 1I1GA 2DFFA 3TJAA 3L8BA 2DR5A 3QIDA 1FRXA 2HHPA 3UDLA 4I2FA 4XUSA 1U24A 2BJ7A 4KH0B 3BGLA 2P9EA 4F4ZA 4OZLA 4BC7A 3JTNA 4DTPA 4OPAA 2F77X 2WTFA 4OJHA 4BRLA 1FERA 4FLVA 1M5KC 3F41A 1S3XA 4M5IA 8ICVA 3LP0A 3RMDA 2U1AA 2RHKA 4LD0A 3T9ZA 3TU5A 4JI2F 4NYPA 1PC5A 2LDYA 1HX1A 1T05A 3MXIA 1JLEB 2W40A 5EN1A 4U7UK 2HIQA 2VICA 3FSXA 4A46A 2CGLA 4LF4J 1TL7B 2CPHA 4CZIA 1U47A 3SCKE 2WSCC 4ZOHC 1MWYA 2PA8D 4B9NA 3TPQA 4B9SA 3F73A 2KU7A 3P6YC 1YJTA 4I2IA 4KPYA 3O80A 1NLKL 1X5TA 2ZH8A 1B99A 3IXQA 3F2KA 4DX6A 7ICKA 3IRXA 1XSNA 3T3FA 4LSLA 1REVA 4OZ3A 3R8YA 2FVRA 4OJ6A 4A4JA 4N77A 2WB4A 4DR4J 3F5TA 1X4BA 2DNOA 3EEQA 4I9QA 2YWWA 2HGMA 3MR7A 3HP6A 3UVJB 2XBPA 3CJ3A 2V69A 2W2QP 3I0SA 4NE9C 3K17A 3HO1A 2I5JB 2W8KA 4RBUA 2BZ2A 3AMZA 5LMUJ 5HOOA 3D9BA 3KNGA 4Y2AA 2XULA 1UWBB 3QYYA 1UFKA 3H20A 3UO0A 1O51A 2C3PA 5E33A 3OYGA 9ICNA 2XIDA 2OJ3A 3AVCA 2CQ0A 4ILMA 4DTOA 2YBVA 2VONA 3BPDA 4KSEB 2R8IA 2AD9A 2M3DA 2Y0SF 4U8VA 4X4QA 2VJUA 4M45A 5IT9O 4FP9A 4UT4A 2FC0A 2KFYA 4LJMA 1XIQA 4H4OA 5HLFB 5AZJB 1RI7A 2ZFHA 2DQNB 3CPWM 1OY8A 2X1FA 5DBBA 2W9MA 2QWQA 2V94A 2W9BB 2ZBRA 4AT1B 1X6IA 4GMJB 5L39A 1MQ3A 4OV1A 4YB6A 4IDHA 3TYTA 3C0BA 3PYFA 4USAA 4NV0A 4TUPA 1NGDA 2QT7A 1A77A 1HMVA 4CJPA 4UARA 2HNZA 4FPBA 2D3DA 2VPXB 3ZSVA 1Q9YA 1JWWA 5EOYA 5FP0A 4EU0A 1Y97A 4H5VA 4NCAA 3F44A 4N41A 2ESEA 4JKEA 3HX0A 4I2QB 3GDQA 4DV3J 1KD1O 3FBBA 3A4TA 3N4PA 3IS9B 2JC1A 1RWOB 3LPTA 4F8RA 1BLUA 2CQPA 1LEOA 5AE2A 4IEIA 4FWMA 4FLUA 3NRBA 2P6TA 3T19A 2PMWA 4DTJA 1IXRA 1VQSA 4OI6A 1UZHA 3LDSA 3T1HK 2VDIA 3AVBA 2IVYA 4FF3A 1WSIA 5IT4A 1ZM2A 3A13A 1KS2A 3SDEA 2Q2RA 1B43A 3LYSA 1HWKA 4CJ4A 3HYFA 1RA6A 3C16B 2UV8G 1KD1T 5IWAJ 5AIBA 3B8HA 1YJVA 3I6PA 2RF2A 3I56N 5KFPA 2V2QA 4QJVA 2VBWA 1OVYA 2QWLA 3PV8A 2DO4A 1VFJA 4DQSA 3RJFA 3CRXA 4QU7A 2Z8QA 3BZCA 2E7VA 3AVIA 7ICSA 3RJIA 1FX4A 1KVCA 1EO1A 1C0UB 4O44B 1Q5YA 1WHVA 3AA5X 5L9NA 4ZVEA 3TQEA 1HQUB 3F2BA 2VDHA 1VBYA 3OXFA 5E5NA 2PZSA 1QUPA 4LJXA 3FC9A 2RLTA 3D2SA 4F36A 2BE9B 3T6BA 3DXBA 2NPIA 1ZXIA 2CZ9A 2P9PB 3T1YF 1NSAA 4M42A 5KQ8A 2MAXA 2CNOB 2XZWA 1QSYA 2QL9B 4H5TA 4RQ7A 4YHHK 3VF6A 3K0SA 3D6MB 1T94A 2KKZA 4JHDB 1GXTA 2AGPA 4H4MA 3Q8KA 2GMHA 1MSWD 3U26A 2DPJA 1P27B 2F1IA 3AJ2A 2JXJA 1WOSA 1S1VA 2B8PA 5AI6A 1W97L 1S97A 2M2BA 2HFOA 2PT0A 1E6VB 2K4IA 4U7CA 2EFGA 1VRTB 1NNLA 4MFBB 3AO2A 4DV5F 4KHPK 4AQYJ 2IDOA 1IXKA 4CO4A 1BOTO 2IBKA 3PVXA 2KYXA 4B9UA 3NGRA 2ZZNA 4CGIA 1B0TA 4KLJA 4J9UE 2DGQA 3EZWA 3LP1B 2DR6A 3DOMB 4LFCJ 3US5A 4UAWA 2FJAB 5J2IA 4WU3A 1HWJA 3CW2C 4ZP6A 4B3TJ 5KT3A 4NWBA 2RPIA 1D8YA 3G71N 2XHWA 3OS2A 3JYTB 2K1RB 3UMBA 4RQ1A 3KK1B 5EUHA 3JB9k 4NI2B 1COOA 4M8LA 4BDZA 4C11B 2QARA 2QWPA 1BE4A 2D0BA 4PA1A 1VQPN 2NXCA 1CC7A 3LDAA 4KLIA 3H5YA 4ILGB 3DDIA 3K5MA 3ZSQA 3PX6A 2HAIA 3DXKB 3Q83A 4RQ2A 2B5JA 4DMZA 4PHEA 1VQ4S 4JV5K 2JH1A 1G4CA 5CYMB 3JAMY 1X9WA 2G5IB 1WG4A 3PMNA 4KGMA 4EWTA 3AN1A 3TADA 3MEDB 1HW8A 2ZWOA 4IG3A 4AM6A 1KLMB 5F9LA 2FHJA 1TMJA 2XMTA 4YDDB 5BR8J 9ICEA 2E1PA 2B6AB 2MSSA 2L48A 2OPRA 1S1WB 3DLJA 3TADC 4M7XA 4I2PB 4CF0A 4QZDA 4AXJA 2Z4PA 4M1KA 3MM8B 1JROA 2HNYB 1NDCA 4C3LA 3PTWA 4DO9A 2QFJA 1Z19A 1ZQSA 3VGKA 1ZZNA 2WB1F 1RT4A 3KUGA 3VAHA 2UXDK 1FDNA 3QGHA 4B17A 4PHTX 3KDOA 3KLGB 1V9OA 3CMAS 4QZEA 1RHJB 2VKRA 2KKPA 5KFQA 2LI6A 2YX7A 2JZ5A 4W98A 5L38A 3JSBA 1UJ4A 2ZUDA 1ZQTA 9ICRA 3MD1A 4EBDA 2QWMA 5HJYA 2UVRA 3OY9A 4F91B 3MAAA 1UVIA 1J97A 4URGA 3FCWA 2QA4S 2ZE2A 1ESVA 3KK2B 1DQAA 2BTFA 3FBEA 3NS1A 4O3NA 1RT5B 2QM1A 4JKHA 3MMAA 4DU4A 3G25A 1ZQHA 2Z7JA 5A6PA 4AL5A 2E5LK 1H72C 9ICMA 4WXWA 1SL1A 3MM9A 2GJIA 5HMMA 2F8EX 3PO4A 2PFQA 3NAHA 1HJRA 2FZGB 5ITHA 2FPMA 3OYFA 4TU9A 3HZGA 4OZ0A 2BQ3A 3FEYB 1YTYA 1UP1A 4ZN1A 4DR1F 1RHMB 3L5KA 1DTQA 1CSJA 1FNMA 2Q0RA 3U3YA 3B78A 4ZCKA 3D6RA 2WAQC 1RDWX 4XA5A 3VETA 1GOAA 2ROEA 1KVKA 1OVQA 4RL1A 3N79A 2EKYA 2VJ4A 8ICKA 4JOUA 2KVSA 4IOCQ 3ISBA 4OYOA 1T6CA 1K73O 4M2YA 3H4BA 1JL1A 2RKIB 1KEKA 2AEJA 4CZHA 4ED4A 2XMMA 3BM7A 3W2VA 4D3GA 2O8DB 4KB7A 4RNNA 5DB9A 2MSTA 2V67A 3IGVA 5C24B 4P9SA 2DXEA 1DGKN 4AH9A 2Q4TA 3KWIA 3DXMB 2GHPA 2P9GA 3NS5A 1UCVA 4WP3A 1BHLA 1Y00A 3PW0A 3CP8A 5E0OA 1HI8A 1Q8LA 2O8CB 2N3LA 4JK8A 3KDNA 2QI2A 5M1QA 5K5MA 1XNRF 5AKZA 1K73T 1SJFA 2ZH9A 2PBDA 3PKMA 5HO4A 9ICQA 4OYZA 4XK8C 2L08A 3DGPB 4YMOA 4CF4A 4ZLPA 1TL7A 5JXSA 3AQFA 5F41A 1KN5A 4NLXA 2E5HA 3CFOA 3P45B 4QQBA 3M3ZA 4XH5A 1ZQOA 1X5OA 2RHSB 3HT0A 3AVFA 2MJNA 1PKUA 2R7QA 3O44A 1SJQA 4P0QB 1W2IA 5EU7A 3HHLD 4IRDA 2I9SA 2L9WA 1IO2A 4BUGA 5AQQA 4ECSA 3O9SA 4I67A 1HKBA 4IL6U 3AO4A 5I4MA 3H0MB 4RCHA 2VFRA 2OMOA 2RRDA 3MPWA 2VQEK 3V6HA 3W2WB 4JLHA 1CXUA 3ZTOA 2D5RA 3JQKA 4DR7K 5DB7A 2W2PP 2DISA 3AQOA 3DM2A 4DSJA 1YRUA 2CPFA 1O5JA 3ONQA 4OI1A 3IDHA 4CDGA 4DTXA 2D3O1 4Y2JA 2MKKA 3LW5C 2I5JA 2LQ8A 1ZBHA 2A6AA 4QPXA 3FMBA 1TV9A 2IIRA 8ICJA 4YD1A 3W5XA 1UWBA 1CC8A 4XH1A 5IZHA 3G6YA 2DFEA 3VERA 2PFUA 2KK0A 4PZVA 2WMMA 2V4RA 2K2PA 1NWKA 4YR3A 1ED1A 3U1MA 1R8AA 3Q8SB 5GTHU 2RS8A 4IOCL 2Z2LA 2KT2A 2FHKA 1RTDA 1VC0A 2MUTB 5ALOA 5KG4A 3E3XA 4USWA 4P52A 1FVQA 3GSIA 3HPGA 3GMGA 3OJUA 2BRKA 2G09A 2CKWA 2W9BA 4TQRA 3FEXB 2QWNA 4OV6A 3M8WA 3WNHA 2FXUA 2QKKA 4UQTA 1FXLA 4DL3A 1L5UA 3LZJA 2HMPA 2Z0GA 1SJ3P 3LM9A 4FJ5A 2BR0A 2GV9A 3ZTRA 1D4XA 4E1MA 1X2IA 2IS3A 3AARA 4UOCA 2V9WA 2Z1HA 7AT1B 1PVRA 5FLXO 1TKXA 3UQSA 2ZH1A 3R5DA 1CEZA 2RJZA 3ETMA 1TFYA 2B4VA 3SAHA 4Y2IA 8ICZA 2WBRA 2LU2A 4I2QA 4PZOA 1A76A 1RWWB 4URQU 5BJRA 2PC6A 4YVZA 5J0SA 3GL1A 2JZBB 3IS9A 1WNSA 5B0GA 1IBCB 3U02A 4HYKA 3OYDA 4FYWB 4BX9C 3LDLA 3CDWA 5GADP 4P2SA 5A2QU 2DY4A 2A0FB 3HI9A 1YXQA 4I6WA 4RTFD 2MZTA 3CJ7A 3W60A 2HGLA 1J5OB 2E2OA 1NK6A 1RACB 1XBWA 3K2PA 2O6KA 2H3IA 4K5SA 2UP1A 3MABA 2J0XA 3ZD9A 1WG5A 2XNQA 4K4TA 3AD8C 4CLUA 4I4BA 3GG4A 4CF9A 3D6TB 2HYIB 1JKHA 2QMWA 3KKAC 2FVPA 2HRUA 1VHFA 5A0YB 5HN0A 2BMBA 1BY9A 4ZPCA 1K0VA 2IBOA 3CXCM 4FJMA 9ICLA 2B4OA 3WQUA 5M1OA 2XNRA 1X4FA 3LP2B 5CYJA 1EIYB 4JI8K 4YUDA 2W6LA 3LDNA 3MGIA 3B6BA 1L3UA 4NXNK 3EZUA 2H5IB 4IDKB 1D9DA 2VOPA 1S22A 3FAHA 2MRLA 1UA1A 4C6AA 3IMXA 2AYEA 4LBPA 2NRXA 1C0UA 3EPIA 3KLIA 4O44A 2ZIXB 3OJSA 2HHWA 1HQUA 3FGUA 4DU3A 2A10A 4CIOA 3PSIA 4CJFA 5AKXA 4C4TA 2DJWA 4OHXA 2F4VK 4CNQA 3SFUA 3SUQA 3VV2B 2V2VA 1DEJA 4DV5J 2Y1RI 4R63A 1KKXA 3TAGA 3G6EN 4EO6A 3M8QA 4JHDA 5KFUA 4DLGA 1T3OA 2DRDA 3D1OA 3SQ0A 3A0HU 3KHYA 5HBMB 2CPYA 2XS5A 1Y0HA 4EK2A 1S6UA 4IO9Q 2D41A 1ZXOA 1U0HB 3I4PA 4I6MB 2G06A 4CEOA 1WJ9A 3KG1A 4I2DA 1PK1B 1QQ7A 2RNEA 3BBCA 4CVNE 2YNGB 1RYRA 2BV3A 2NNWA 1FKPA 2AJ2A 1GX6A 4TKTA 1UVLA 1TYQB 2MXYA 3QNMA 5ALZA 4WKYA 1BNPA 4BGAA 1WACA 2OZSA 1X8DA 2QFIA 2QSWA 4A5AA 3HHEA 4HDHA 1XTZA 3NGIA 1GO3F 4MH8A 3WXJA 4EIAA 5F9NA 2DF4B 1Z2LA 3DYAB 3CCRN 2H48B 1BG3A 5J2PA 4DF4A 1BUXA 2Z57B 3HVTA 2N82B 1ZZFA 1MA9B 3CC4N 2E5IA 3JQJA 2GVDB 2XSJB 1XNQJ 1Z4NA 3SQ2A 5F0WA 4LFAF 4FPAA 4YOUA 5IV3A 5DB8A 1J27A 3R3TA 3QEIA 1X0FA 3KK1A 1JLFA 4NLTA 1BA0A 1N54B 2RHQB 3MR2A 2GJ2A 4I69A 4LFBJ 1QHTA 2H3GX 3CJ9A 4K2XA 3D2EB 5ALDA 3S3NA 1Y5IB 2O67A 3Q89A 5JMVA 3C21A 1VQ6N 3ILJA 5L1LA 2R4FA 1NI3A 4HEA9 4JNEA 4ECUA 1FRKA 1DQ8A 3ZSRA 1FK9B 2OZMA 1TP7A 3CETA 4M6WA 3QEAZ 4EGLA 4FKXA 3AV9A 5GAEI 8ICNA 1I51B 3UMGA 3NWGA 3R7SB 1EX8A 2MKJA 1IJJA 3Q8YA 5J0XA 4NLDA 8AT1B 1FE0A 1CVJA 1KQSM 4TN2A 3LPUA 5HRPA 4EP4A 4OJ5A 1RDAA 4OJOA 3IV6A 2X78A 1KLMA 3QEXA 2QC3A 3KKFA 4BXOB 3LQVA 2CNLB 4KBIA 4B3MK 2HHHK 4C0BA 2Q66A 1S7HA 3L3FX 1S1WA 2RVJA 2XMAA 3FRYA 9ATCB 2ZM6K 4FXWA 1ELOA 3ZI4A 2BA9A 4I2PA 3CIPA 3L4IA 3PX4A 2FMSA 4HHHA 2A18A 3HZ6A 3G82B 3DRPB 4CQ1A 4IO9L 2HNYA 4C97A 4DX7A 2HW3A 4DSEA 1FE4A 2M9KA 1HWLA 4RQ5A 3QUTA 2Y3YA 5D0HA 3VQ7A 2H4YB 4PYDA 2QTDA 3K8WA 2Y1JA 1WI6A 1Y7PA 3T1HJ 4DJBA 3EE8A 2WK4A 4GVBB 2DY9A 2FF6A 3VVUA 2DHHA 1S5JA 1HWIA 4CLPA 3OYNA 5J1PA 3GOIA 3V1RA 1K8KA 3CD6N 4BR2A 5DM7Q 2JMGA 1S72S 1WN7A 4H54A 2LYAA 2VA2A 4RX6A 4WCEQ 4JMUA 4FWNA 4ID5B 1UEKA 4OI4A 3NNAA 5J1NA 2HHXA 4H4KA 4YOTA 1ZPVA 3SNNA 4AXIA 2LHTA 3CJKB 2A1SA 2AMCB 1IWGA 5ETTA 4K0KK 3KK2A 1RAIB 1RKJA 4V1Ak 3QU7A 3TSPA 2KNJA 1RT5A 3AT1B 4ISGA 4X64F 4G1QB 3HP9A 4BHQA 4LSZB 1BHNA 2ASOA 4PY5A 5DG8A 5J2BA 5CQGA 5AQYA 4UB6U 3OBWA 2D3OR 3B9JA 3LALA 4RWXA 4JYAF 2BOAA 3OW2M 2HBKA 1KFTA 4HTIA 4CO3A 3W3DA 2FB0A 1ILYA 2LECA 4GKJF 4C2MA 5D0GA 1ZQGA 3A8KA 2RU9A 5K8NA 4JI5F 3TEHB 2EPIA 2O8FB 1KTQA 2HLUA 4M41A 5D4BA 1FNXH 3VTIA 1XNRJ 3VC8A 4Z4FA 3I9V9 3J80U 4B3SF 5CP2A 1N5QA 4TYBA 4DG1B 4FJGA 4DCOB 2HNDA 2RKIA 4KFBB 3FM9A 4KQZA 2EHGA 4OD0A 4MIBA 4CWBA 9ICUA 4HL9A 3N7PD 3I5CA 2AZ1A 4V19J 2WVDA 1FESA 4ICLB 5ALRA 1KC8T 2GBZA 3AAPA 3RJJA 2OEKA 2YQ0A 3TX8A 3VAIA 3DXMA 2OEMA 2YXLA 2M5YA 4M3TA 4YORA 4O3QA 2YKAA 2O8CA 7ICMA 3IAM9 2ATQA 3QU5A 3BV8A 3I56S 3O3GA 3D6HB 5EX5A 2IAJA 3OYAA 3UQ0A 2GHVC 1HWUA 1JJ2M 4MO5A 1R31A 4R5PA 4IO1A 1NU0A 3J7A1 3QAUA 4GO7X 4CT9A 3N4QA 2Q3PA 4M5LA 4OGEA 3HPOA 2EBGA 1CI4A 3AQEA 5LMNK 4LT6A 1N63A 2J8SA 1ZQBA 1O1WA 5ALSA 1DARA 5DM7L 5EHHA 4P0QA 4A8SA 1U49A 2J5AA 4TLQA 2FY8A 2FY1A 4HCCA 4WCEL 4K4UA 3JAMO 2BXJA 2POKA 4L75A 2OD4A 2Y9UA 8ICEA 2HKEA 1GLBG 1HQEB 4QZBA 4YDXA 3W2WA 3C46A 5F0UA 3RF9A 3HHLA 2ZD1B 1X3NA 4TVAB 1YI2N 2G4BA 3NH2A 2DNMA 3M6VA 4M5DA 3O0FA 5F3TA 4QW8A 2AGQA 1HNIB 2QSFA 4JV5J 2MA1A 1JXLA 3HHLC 3SJJA 3H98A 2R8KA 2KXNB 4O0IA 1X31C 3EVMA 3M9NB 3UMCA 4S0MA 3OW2R 3FCHA 2OUGA 4M3RA 2XVTA 2KT5A 3AVLA 3I96A 3MFIA 1NB2A 5I3QA 1HYVA 4LRDA 2CG4A 4CO5A 4E3SA 1FEEA 2B43A 3QATA 3OPKA 1BWFO 2KH9A 1HRHA 4MKAA 4J9PA 1KKHA 3VF0B 3CERA 3SXLA 4CCHA 3ETRA 5EE3A 2Z2MA 3CCUN 4QYZJ 4OPJA 1QAXA 4KH4A 2IMWP 5ETPA 2VA8A 4RQ0A 2WFBA 2B4UA 3G71S 2QXLA 3UD5A 4JI3F 4MQ3A 1XMQK 1TELA 4JBCA 4FZYA 4ZPTR 1S10A 2PKEA 1ZD5A 2VWBA 3JSMB 5FD1A 1D8ZA 3V7LA 2YNIB 3WIVA 2ADCA 3I0RA 4P4OA 1ZJMA 1VQPS 1S1XB 4XO0A 4OX7A 4ECRA 2YB4A 3EICA 1VQMN 3KTQA 2KI2A 1IBKF 3IFRA 4F04B 2F8LA 5BN9A 4EHTA 2B9XA 3OYEA 4DV0F 2W1BA 3IHQB 3CUNA 2P9UA 1HEKA 2RE1A 2JZBA 4KN4A 1IKYA 2E5LJ 2ALYB 2BJEA 2EX3A 4PABA 1Q0NA 2J0SD 5C2CA 4KYZA 4RW9B 4PPDA 2BBEA 5DO2A 4YN3B 1J5OA 1N8RO 1RBTA 2P6UA 1C1CB 3RBXA 1NOZA 3D54A 4DQIA 2YNHB 5KNIA 1ZQMA 1M6YA 4BG8A 4A2BA 3OT9A 3MCOA 1WELA 3K59A 4KMUA 4TUSA 1HNVB 1YGYA 3R1XA 1WC4A 1HKAA 3MECA 2MKSA 1IBLF 5KFLA 4TU7A 1HUOA 4MK8A 3D1HA 2KO1A 3CM5A 2OCEA 1VR6A 3T9NA 4GVMA 1FT8A 4CJRA 1DXSA 1PCAA 9ICVA 2DKXA 4F5OA 5GAHU 3CCTA 2CH5A 3CI5A 4LF7K 4IDKA 3VALA 4CJSA 3ED5A 1OPZA 1Y64A 4ZVTB 2E7XA 1Q82O 4QCLA 4QWAA 3A8IA 3V6JA 1SC6A 2LEPA 4LF2A 1N4LA 5F8JA 3NMRA 2ZIXA 1GT8A 1KOOA 3ULEB 3N7SC 1J6ZA 5DM6Q 2KKVA 4BWJA 4F0HA 1ZQNA 5C2GA 4ED0A 1H7WA 1NKEA 1RWKB 1UJ6A 4F4KA 1SPBP 4FJIA 1DFDA 4RQ4A 2YWKA 3L3CA 3HX9A 3SMPA 3OS1A 3VAMA 4UW9A 4ANEA 1VRUA 3K7RA 3DLEB 2NRZA 8ICHA 1U2CA 3BGRB 2I9GA 5HBMA 4PG8A 1AFJA 1Q82T 2PI4A 2DGZA 3M9MB 2ADBA 2BJ8A 1U0HA 2CJKA 4I6MA 1KBRA 4I6YA 3T69A 2W42A 4ZTJA 2YY3A 4DOCA 4RUBA 2P9IB 5J1EB 2VQEJ 1L3TA 4LFAJ 3IA0A 4CJ3A 2OHFA 1I5OB 4IQXA 3HSTB 1SQFA 4E98A 3W8PA 4PKIA 3IG5A 1TYQA 2HB5A 2MZ1A 2NPFA 1Z25A 3A0IX 3QMLA 2KZMA 2KHVA 3JPOA 1S5ZA 1YJWN 1DLOB 5AQFA 3PCOB 1NKBA 4ZP8A 4NXMK 4DL4A 2AHOB 3VQDA 4H0TB 3CCJS 3J7YP 2JH7A 3MX2A 5D6GA 3DYAA 4L8RB 2UXCF 4K8XA 2MGZB 5AQKA 4PWUA 3C65A 5M2PA 1LV5A 1ZBUA 3MAQA 2VA3A 1XMOF 2XSJA 4LC9B 3WQPA 3RJHA 3J7YU 2CPEA 3MMJA 5HRSA 4Y1DA 2VU5A 1TL5A 3CJ2A 3AU6A 2J9DA 2FPKA 4DWIA 4B3OB 4DUYF 3U3GA 4I28A 3D2EA 5ALGA 5KFDA 2A1JB 2V7ZA 1H6KX 1MWQA 3CEDA 1VLBA 2X51A 3DLGB 4L6V3 4ZLLA 3SMSA 1WG1A 3IR5B 4EBCA 3THWA 5H1SV 1FK9A 1HYZA 4WK1A 3WEEB 4A8MP 2BCVA 3BQ2A 1DK3A 1M5PC 2XS7A 3M5RA 5CZ1A 1W2BM 2LU1A 2RRAA 1VBXA 2G8UA 5DM6L 4I68A 4A8YA 2PN6A 4KX3A 2CJAA 3L2RA 3MUVP 3CDEA 2XZTB 2B21A 3MGJA 2ZNYA 1WB9A 1J5EF 2J7WA 5CYQB 4WTOB 4ZCLA 2A6MA 4X4PA 3GONA 4BXOA 4CDIA 3QRRA 4WJBA 3PLAA 4FM0A 2E2PA 2B8QA 1QAIA 1U2FA 4OJGA 3HSCA 1VQON 3P83D 5KFVA 5CZXA 4O3SA 4WP9A 4PXCA 4DF8A 5DG9A 3G82A 2GV1A 3FZFA 1BQXA 4DR6F 3K5LA 4HUFA 2MKCA 2YY6A 2CAJA 5HK4A 1S1UA 2IA0A 2RUSA 1ZQQA 1ZQLA 1KEJA 4DS5A 2GO7A 7ICEA 3OFHA 2QYCA 4X64J 3NVZA 1B4SA 3AVMA 1KP6A 3V6KA 2V8HA 2CPDA 3KVGA 1LKYB 4FBTA 3L2WA 2GVZA 4LF6K 1SAZA 4HHJA 2HS4A 3G9CA 4JYAJ 3FZMA 4MAKA 2OIHA 1JLAA 4NA2A 4CO1A 5H9EK 2DTJA 4X4OA 1GLCG 4G6VB 4ID5A 4PG4A 3S6JA 3TSUA 1G15A 3D28A 4GKJJ 4BRIA 1NK0A 4RNHA 4JI1F 4LREA 4CERA 4EENA 3DRSB 4OGCA 4CH0S 4IH6A 3TA2A 4JI5J 4NXNJ 4H0VB 4DN9A 5I3UB 2LM1A 1U9LA 4W5TA 1JXVA 3NVWA 4B9VA 4G1QA 5AQUA 4B9QA 5FDLA 3TP2A 3CNQP 4JKBA 4B3SJ 3KBBA 2Y1IA 4NA1A 3NG8A 4LF8F 3ZX3A 3S01A 3K1RB 2YPYA 3OR2A 1VHIA 1VSIA 4YOVA 3HWTA 5T7LA 1Z3EB 2CDRB 4DL5A 4CLKA 2FE9A 1EETB 3VF2A 2GUIA 4CHYA 1N33F 4CE9A 1F60B 1JNZB 4I2GA 2VCPA 1RE1B 4KHUA 1K47A 3IG1A 2RUGA 3NMAA 4PG7A 3QJLA 3F5EA 5B66U 2RDIA 3CQXA 2ZH4A 5J2FA 1ROFA 3ZX2A 3W5YA 4ATNA 1P8ZA 2QWRA 3M2UB 5KOXA 5AQOA 4JI7K 2B7CB 2GAGC 3SK3A 4NRUA 1NJIT 2N1RA 3W62A 2YTUA 3WK9A 1T02A 2F9WA 3A5NC 4CK1A 4PHPA 2F8SA 3ET6A 1Y3KA 1QQ6A 4F3MA 1IR1A 4K4ZA 1O6XA 1VSLA 1AZSA 3SZ2A 4LIRA 4PL7A 5KFFA 4W5OA 1WEYA 4OX9K 3ZNJ1 2DNRA 4A8QA 2JHEA 2HVIA 2CN1A 2HQFA 3F53A 4IJNA 1ULRA 4E0DA 3EX7B 1NK7A 3GPAA 4IS7A 4CHOA 4DTUA 3VEWA 4GY2B 4ED1A 3J81U 3MHYA 1WYGA 2O4GA 2WC9A 4DU7A 4IZ9A 4ZVFA 5J0QA 4KHPF 4OYAA 2PMZF 3WDOA 4HH0A 1XC3A 2BQUA 5BR9A 2E6LA 3ALRA 4FJ8A 2ZC4A 4JKGB 3GYGA 3JS9A 4LR8A 1F6TA 1RU1A 2ZD1A 2D0PA 1FRHA 3G6ES 2AEFA 2J9EA 1NCLA 1RTJA 2WVCA 2W01A 2A41A 2B56A 3LANA 1PBUA 2AT1B 1HNIA 4EO8A 3WK7A 4YN4A 2OSQA 1TK5A 4ES1A 2E5JA 2KRRA 2JEJA 1NM1A 3G0ZA 1RXWA 5AQRA 4PGXA 3H5XA 1MWMA 2IFXA 3QZ8A 3VVTA 5AM4A 1CXQA 4CIGA 3F2CA 3W65A 2J76E 2ZH6A 1ZQYA 4JI3J 3CCMS 2HFZA 2DPIA 1BDGA 2FSNA 1TGOA 2C28A 4KO0B 4PAAA 5HROA 3DHXA 1ZQIA 3OTCA 4OIXA 1WD6A 4LF5K 3U1NA 3QRQA 1NH7A 3L6QA 3DFEA 2O5DA 2LSNA 3BDEA 3NNCA 5HQLA 5H1SQ 4GRSA 4C4RA 3SBMA 4A2AA 1KOHA 4XDCA 1IBKJ 3CCRS 1F5SA 1SXEA 2W04A 5IIKA 3ISDA 2DITA 4P4PA 5J2NB 1HPZA 3CC4S 4OPHA 4BR7A 1SH2A 4H0XB 4DV0J 4CJ5A 2N4DA 2ERRA 4Z7CA 1WHWA 2XG8A 4AFFA 5K4LA 1B70B 3W0LA 4KHQA 1BCMA 5AI4A 1Q1KA 1JK9B 4HACA 3KLFB 4BROA 4US9A 3JSMA 1IKVB 4JK1A 2YNIA 5F1XA 1S1XA 4FF1A 1YZ7A 3LPEA 2HBQB 1VQ6S 3CJ0A 4Y2MA 1HR0F 4BVPA 4GC6A 1S0OA 4K43A 4FWLA 3I32A 1HJPA 1T11A 2BE7D 1TFWA 4EYIB 2UXDF 2XMJA 1IBLJ 4Z6DA 4BRMA 2UUAF 5AQPA 1YF5L 2PXIA 2WVEA 1LK5A 3F0NA 2C3OA 4WWSA 2PYLA 1VSJA 4OL8A 1X42A 3HBTA 3O9TA 4IWVA 3CJQA 2ZDPA 1S48A 4HHTA 3ENWA 4NCGA 2AGOA 3PYEA 2YNHA 3MMBB 3QO9B 1UVJA 3BYRA 4ZIVA 1CBKA 1SQEA 2F76X 2XI2A 4RG8A 4ZIWA 3HFVA 2GGPB 2OAUA 1QS4A 2BJ3A 1HNVA 3U1LA 3P5TL 3EWGA 4CF3A 5AKHA 2BUPA 2QIFA 3BF4A 4Q7AA 3HRGA 4TYAA 3CB4A 4I2EA 3GE9A 3O9UA 1Q8BA 2NCKL 4EAHD 1RTHB 2YB1A 1WKJA 2VOOA 4GNIA 3TI0A 4FPRA 3WK4A 3FUYA 4Q43A 2ASLA 3GFZA 2QLWA 1Q3VA 1RM6C 1I94K 1R6YA 3VZHA 1WI8A 2MU2A 3HW8A 3N6MA 5IT0A 4WF9Q 5CAAA 2JHDA 3WNEA 5C15A 4WZQA 3QB0A 3V9UA 1C0TB 2VBYA 5EGYA 4KT0C 2BDUA 3BF1A 3FFKB 2VQFK 1RT1B 2DGWA 2CQDA 4RWTA 3DLEA 4NYOA 5HNKA 2GNKA 5C42B 2VHGA 3O1LA 2ILZA 1ZM4A 2AKWB 4ZVQB 2RRBA 3DCAA 2F7TA 1X4HA 3OSPA 5IT9U 3WBZA 2UXCJ 5DGAA 4MLHA 7ICLA 5J2AA 3PO5A 2XLKA 1XMOJ 2HSTA 1SB3C 2P9IA 1VQNN 5J1EA 3MCNA 4A48A 2DTUA 3UIQA 1D09B 2I7PA 4NA3A 4HUGA 3CCLN 5FROA 3AA8A 3AGKA 5DDQC 5B0CA 5E3RA 4H5RA 4L3QA 4X62F 5AXLA 2JEFA 1Q95G 2BGGA 4C8OA 4PL8A 2C3MA 1U1NA 4DR2K 3C28A 2O01C 4F7VA 1A5VA 1OH7A 2C42A 1Y88A 2DIVA 3CDAA 4KGZB 4GW6A 4JRPA 1WUUA 3GFHA 8RUCA 4JN4A 2VFUA 3NGZA 5KFTA 1J2NA 3OL6A 2H65B 4Y2UA 4GIBA 3OTBA 4MJKA 1QCKA 1A7GE 4QNLA 4DFDA 1SKRA 3OR1B 2YHBA 3V72A 8ICOA 1Y11A 1WORA 4B3OA 3AY9A 3OS0A 2GUPA 2YKMB 2VPZB 1J5EJ 1RTIA 4KRWA 4RNMA 5IC4B 3PM9A 1PUZA 1R8HA 3FVYA 1N5SA 4CFBA 3RJEA 2XO6A 1NK4A 4RPZA 1TKTB 4Y0FA 3LZIA 4NJ8A 4GV9A 4NL5A 4C0HA 1UW9A 1XC9A 2GCFA 3AA4A 4FNIA 1LK7A 2CWXA 1QD1A 3E8OA 2E7WA 1QY7A 3NGKA 3W61A 4DR6J 4M3UA 4HKQA 2JV3A 2BEFA 1B0VA 5IV4A 3FSIA 4LF4K 1NGBA 2WRMA 1NJWA 4YOYA 4WF9L 2HVDA 4L3KA 3EDQB 4HTJA 4FJ7A 1S49A 3PSTA 1ZQEA 1RWUA 3TW0A 5CYQA 1W7WA 3JPPA 1M1HA 4CF2A 1V5IB 5HR7A 1YI2S 4CEZA 3VR1A 2MQMA 2CFXA 4PXEA 2ZOMA 2A3JA 3SYZA 1DURA 4O5KA 1QQNA 3AAQA 5J8YA 3NOGA 4JI1J 3H45C 4WP8A 5KT4A 5AT1B 1UFLA 4DR4K 1EJ7L 3C1YA 4UY8O 3GG0A 1U45A 3Q23A 4F4XA 3I55N 4DU8A 2ASDA 2C2KB 4ZCIA 4OCZA 3IG8A 1JIHA 3C5FA 3TNVA 5J8YC 4Y65A 3CWJA 1LKYA 1RILA 2QGFB 2RIJA 3LF0A 7ICOA 5LMUK 3VGLA 4F4WA 2J9DE 3C2KA 1LWCA 1UVMA 1HKGA 1G1XA 4LF8J 1XHXA 2HOEA 3TAPA 1NK5A 2AJQA 4L3NA 4ENOA 3DRXA 3CCUS 4NL9A 1KXPA 2W03A 3H59A 3BN7A 3U6FA 4A47A 4C7QA 5I3UA 2AIRB 4UY8T 2OTJN 5KPZA 1K6YA 5J2DA 1N33J 1IV0A 4I2AA 4NL9C 3V5RA 1UPMB 4OZ5A 2L9DA 4CYUB 3L2UA 1Z26A 2NLWA 3Q2TC 2AP1A 2E1CA 4KLHA 4DU1A 4F3TA 3DV9A 1DTTA 1BQMB 2DUYA 1GLLO 1WAFA 3QLHB 1VQMS 1X9SA 4F02A 3A0BU 3I8DA 2KSOA 4LQ3A 3PUFA 1WCLA 3FQKA 4R66A 1UJ5A 3WKAA 4ANDA 3K5NA 1HD1A 3Q86A 4E7HA 4BRCA 2I2YA 5A8KB 3UM9A 3SV3A 2B4PA 2G07A 3DLRA 2ZBQA 3RGIA 1DHMA 2YPZA 1QAJA 2BABA 5EWGA 4DV3K 3IO1A 5AI8A 2UU9F 3MN6A 3R9KA 3BSCA 4Y2VA 3H1QA 4UQGA 3VEZA 4FZVA 3M2UA 4LRBA 3AODA 4FS2A 5J2JA 3J7ZO 4M9LA 1HQ2A 4AE5A 4JK7A 3ZSWA 1QTMA 5ETQA 2C3YA 2BVZA 4NLSA 4FK2A 4BC4A 3GZFA 4C7ZA 4OJLA 4NXMJ 3LP3A 3QRPA 1U25A 2DNZA 4UAZA 1RCHA 4Q2MA 4MHVA 3WNGA 4Q2LA 1MC8A 1GLFO 3UB5A 2ZG6A 2WTUA 3L3UA 2G8FA 5IWAK 1JJHA 1JJCB 1NGHA 4CEDA 4FZLA 3C94A 1FJGK 2XWYA 3HKZF 3GFYA 2V4JB 2U2FA 4MYUA 1BVSA 2NLXA 3J7ZT 1HLUA 4IFVB 1OIAA 2OMLA 1KHVA 5A8WB 3HOTA 4AL7A 4QIVA 1J2MA 2OXOA 3VPZA 1NGJA 3W9JA 3EDRB 3L2QA 3O5TB 1BIUA 8ICCA 2ZVSA 4DSFA 3C2PA 2W2OP 2YX6A 2JNJA 4J2EA 3WUHA 3MN5A 3CYMA 5IM0A 2ASMA 5EVZA 1WC0A 3L0QA 3FKBA 4P72A 4YR0A 3ENHA 4QOTA 1D3WA 1KVIA 4EBEA 3RAMA 1C1BB 1QQMA 1ZTWA 4BC3A 3EL2A 3QEBZ 3CCZA 3IRWP 5K14B 3AOCA 3HHKA 5HQMA 4QZCA 3KKRA 1VQ7N 4OO1J 4NY8A 4KLMA 3QXGA 2DCLA 2EI5A 2OTLN 4OYPA 5BRHA 3Q2SC 4QWEA 2FSJA 1HNXF 4PHAA 4GXIA 4YOEA 2GOLA 4KO0A 2OYYA 2H3FA 2O4IA 2OM6A 4Y34A 3DRYA 2PMHA 3M1FA 5ETMA 5AR0A 4IKAA 3OBYA 2GQQA 4DUZF 4TUQA 1NAQA 2JOQA 4K8ZA 2Z1JA 4G1PA 1HJOA 2E1FA 3UKUA 3QT7A 4AQYK 5CZVA 3MCAB 3S7RA 3NAIA 3THYB 2VGMA 2MQQA 1CJKB 2CGKA 3DOKA 2HVHA 2IM3A 3QWUA 2UUAJ 4CJTA 1RBVA 2CVIA 3AO3A 1S6QA 2ZIWA 1F9HA 4ZS6A 3N6LA 4LFCK 3WK5A 2UZAA 4Z4HA 1L7MA 4B3TK 5J0PA 2FGOA 2ZHBA 4I56A 3KNAA 1IKVA 3SBGA 2E8AA 2ZNZA 3PYGA 3MEKA 3UN5A 2I7NA 5D46A 4O4GB 4CE6A 2P9SB 3NVMA 3C14B 3GG1A 1DZ5A 4IQVA 3NS6A 4CRXA 2MY7A 1NJZA 1YSJA 4KLFA 5LJWA 1N2XA 4IJAA 1KFSA 2K4PA 4K4GA 2QYGA 4JWNA 4ZVSB 3UD3P 4FO0A 2K60A 3BBBA 5D78A 2FSKA 2RB7A 1SUQB 2FBTA 4JRQA 5DQGA 2FZCB 3CJ4A 1XEZA 5AQGA 1JUDA 2DCUB 8ICBA 2QB0B 4Y0WA 4FZMA 3THPA 1CJUB 1EX4A 3V1QA 4PG6A 2DKZA 2ZH3A 3G10A 8ICPA 1SL0A 2QLJB 5KG6A 4B8AB 3QO9A 3V9ZA 3GCXP 5KG1A 3QPIA 3ISZA 3OVBA 3C15B 2KIWA 1VQOS 1ZA1B 3I33A 4ZMMA 3Q0AA 2Q43A 1UWAA 2PA3A 1BWVA 1SKUB 2YHYA 1M5VC 4PQUB 5J0UA 2DH7A 2PFFB 2ZJ8A 5DZ7A 4BY9C 3BEXA 1NZPA 1NHVA 3AD7C 4RQ8A 4QBUA 1MG7A 2GELA 1T9VA 1V85A 4NZ7A 2MMYA 2FUG9 4RU9A 4BE1A 5JMNA 4J03A 1Q46A 2FBYA 2VWJA 3C23A 4M3WA 2H3VA 4F2RA 1SIZA 2DWQA 2AQ0A 3IDWA 3KZIU 3DLHA 1NGEA 5J0YA 3IR7B 1SCJB 2APOA 3PR4A 8ICXA 4CFCA 4WFXA 1Y9OA 1RB0A 2XYHB 4QIFA 3F9MA 1RYSA 4O0JA 3IP4B 1YJ7A 4E7JA 5CABA 1WSGA 1BWEA 3BR8A 1RT1A 5F8LA 5CY4A 1U8WA 5IFMA 4CEBA 2ZTCA 4PWDB 3HSZA 3HZEA 1QE1A 4IRKA 2FLPA 2QTWA 2FPLA 1IBMF 1HARA 3OYIA 1EARA 1IR0A 3BJYA 2I5HA 3MCSA 4P73A 2UXBK 5C5JA 2LKYA 5DDMA 1UAXA 4CNYA 3B6PA 2J9CA 3DKDA 1AROP 2MHNA 3D3BJ 3PKYA 2UVUA 1EQMA 4RW8B 3HILA 2E8PA 3RW7A 1O0PA 4NLOA 4A8EA 4OLBA 2FDNA 2H1YA 2UVWA 4K4VA 2QLTA 1BPEA 3RMCA 1NKCA 3S1TA 1NSQA 5KQDA 5BYQA 4JD2B 2E8NA 2XGQA 3M05A 2AX0A 3WC2A 3M30B 1QH9A 2UYTA 1BCOA 1ZAVA 4J9NA 2OELA 1FDBA 1JLGA 1GXUA 1NGCA 3U7JA 2KW4A 4JI2K 2CG8A 1S8OA 3HDSA 3GSDA 4PL2A 5J0TA 5FLXU 3QSYB 1V4TA 3O08A 2KB2A 1WSVA 2OPPA 4P4MA 2ZXHA 2X3GA 3OR1A 4WIIA 3D67A 1Q81T 1DJ0A 1TUGB 2MKYA 4C3MA 4DZDA 3MM7A 4ELUA 3A8EA 3HULA 2LM4A 3U9ZA 3HI0A 3ID8A 4B3RJ 3M6WA 4Y2TA 5DDYA 2ZJQQ 3W9IA 4OVLA 3ZZPA 5DJBA 2D1CA 1TL1A 2K4HA 2C1EB 2LQJA 1ZYQA 2WBMA 1FXDA 1TKTA 1Q3UA 1BQNA 4E1NA 4ZK7M 5CA7A 4AL6A 4WJ3B 5ALJA 2GQCA 4DQ8A 3O2IA 1HNZF 1G99A 1RQNA 1HL6A 4Q0BB 3VQAA 3R1HA 3EUB2 4DFKA 5G0RB 4ZJQA 2GFFA 3TWZA 4LF9F 3SD7A 5F3XB 4KITB 2P5GA 1TAMA 5E7OB 4RNFA 1QVGR 1NOMA 3N0VA 4B1ZA 1URRA 1WC5A 1D8LA 1XWLA 2XY8A 3PJWA 1K8AT 3GIKA 1HYSB 3CJ5A 4CF5A 2CQ3A 3VGTA 5FPMA 1JLQA 4CD1A 2VV5A 2NRWA 8ICTA 4NB4A 1WOPA 2J4RA 2CZ4A 2BACA 5H2FU 2B9WA 3TZWA 5KOWA 4CHZA 2CQ2A 1ZM3A 2EG1A 3M6XA 4HI2A 3BQ1A 3N01A 3KWMA 3TR5A 1VK0A 4MKBA 5A0LA 2P1JA 3RWUA 2DEJA 1F0XA 3H8YA 3ENOA 3IBWA 4DCCA 3BREA 3LGNA 4PEOA 4DQQA 2NQPA 1VMBA 1F5BA 1N36F 4KRFA 5GVQA 2SXLA 4RUAA 4C8MA 4GVLA 3NRZA 3G2XA 1ATRA 5GIOA 1FRLA 2ZIVA 1LWEB 1WF0A 4OZ1A 4OQJA 1H38A 2CQGA 2UUBJ 4BJQA 4RNOA 3CJCA 2D3ZA 1SV5A 2Y1LB 3HT3A 1TR0A 4MEYA 1HD0A 4NOHA 2X6NA 1YZ6A 1IKXA 4QZIA 2ATCB 4Q5VA 2ZC3A 3VCDA 3KLVA 4Y2KA 2ZTDA 3TAMA 1FFUA 1CZ9A 2R8HA 3C6UB 3FQLA 5DKWA 2KG0A 3EZOA 3QINA 1RWVB 4FJXA 5J2MB 3K4GA 4KN7A 1SKWA 4NYNA 3UXPA 2JWNA 2QZ8A 2UU9J 3P5JA 2JVOA 4FZNA 2ZJQL 5JJBA 1ZRMA 2DGUA 3ZETB 2D74B 4WBFA 2CXEA 1BQMA 2LFVA 3QLHA 4H03B 2HBJA 2MEWA 3JS6A 1YG0A 3W8GA 2IM0A 2ZZMA 1ZH5A 2HMIB 2XTJP 4AUKA 3QJPA 4ZPAA 2NRTA 2KVQE 1RCXB 4C80A 1T9TA 2R7UA 4QR2A 5HMYA 1JCEA 3SFGA 3M6UA 1X4GA 3H42A 3C8YA 2IDLA 4CJUA 1GXLA 2AW0A 3GU0A 3F56A 2XMVA 1VJ5A 3KG4A 4NLVA 2KQ2A 2ETJA 1W26A 1RT7A 8ICUA 1PZNA 2AU0A 4J9MA 4O3PA 3GE1A 3MMCB 1NGAA 5HRNA 3CO9A 2CUYA 3TZXA 2DR7A 5GTIU 4KX5A 2R7VA 4M95A 1RT2B 3ETLA 2NRRA 4DR3F 4FVUA 1VCTA 3HVAA 3HKWA 4DCPB 3GJQB 2G0IA 3T6JA 2M8DB 3E9LA 3OTQA 4EEYA 4R8UB 2V8VA 1IR2A 2RQMA 2E1RA 1NGFA 1VBZA 1YITS 2HBYB 1SQGA 5GAEP 2O8EB 2VANA 3AXMA 4EP5A 1L6NA 2KKHA 1Z1VA 1B22A 2CDQA 3NTUA 2HF4A 3QBWA 2FHMA 5GAEU 1N5YB 4HVZA 4IOXA 8ICRA 2QO3A 3K9KA 2Q31A 1HNXJ 4LRCA 1SZHA 4M3YA 4JI4F 4UAUA 3D7EO 3CCQN 1T44A 1PIEA 3O6QA 3LVVA 5AI9A 3MURP 1AA1B 4DUZJ 1K1SA 3QERA 3V7KA 2B9YA 4AHSA 2VG5B 1H74A 1CZAN 4ISEA 4DV5K 7ICNA 4CZGA 2EQYA 3EXYA 3G6VA 2ALZA 4B02A 3AHPA 4C8KA 2VG7B 4X65F 1RAAB 1M1GA 2MZQA 1VQNS 3ALYA 1C2PA 3RAXA 3QYPA 3DMJB 4I29A 3NCRA 3M9OB 1TVAA 4FDFA 4QZGA 5DDRC 2WF9A 4F93B 2I1QA 6FDRA 1Z05A 4FJHA 3KHLA 2NXEA 1U4BA 1M1KO 5AQHA 4QOZB 2CJ9A 1T03B 1PYOB 4C9DA 2IDEA 1IIPA 4IYQA 4BDYA 4DR5F 1FXRA 3AJDA 4FXVA 2ZQBA 5E26A 3IRUA 2K7JA 2GMJA 3MR6A 3GB0A 3WU2U 3CC2N 2G0AA 1T9WA 1UEVA 3K57A 5C2DA 5IILA 3OFGA 4NASA 1CJKA 4NMXA 4FW2A 1X4AA 4NLYA 4U6PA 2ATLA 3OYMA 1FO4A 1U1RA 3VQBA 3LM2A 1Z2ZA 3NVKA 1SJRA 5AE1A 3BO2A 3MAHA 4DFPA 2WW8A 1ASVA 3MM5B 1X9XA 4RPYA 3AOBA 1XNQK 2LXUA 3RJMB 2ABYA 3ENQA 3H0LB 1FVSA 3ZDEA 2HQ3A 4O4GA 2P9SA 2AP6A 2WONB 3C14A 1RGVA 1OKJA 4Z37A 2GH1A 5CB1A 3L2VA 3JPQA 5FPNA 4LFBK 1N62A 2G08A 2PGCA 1L8LA 2DD8S 5HANA 3P4IA 4CBXA 3B4DA 1WG8A 2M8HA 3ZXWA 5LXRA 2Y0SD 3K8VA 4GVEA 1HUZA 2F1JA 1SUQA 2X7IA 2EFQA 1ATSA 4CLWA 3D2WA 2HHVA 1RDUA 4PRFA 4FYYB 3ZC4A 4OKJA 1WWVA 2G8IA 1F21A 1DRGA 3SLCA 1FO1A 2K3KA 2QB0A 4DL0C 5LOQA 1MDUB 2KP7A 1CJUA 4DV4F 3FZ2A 1VQ8S 3KXDA 4FKYA 4KAZA 1B7FA 4DHYA 3OVSA 2YMPA 4ICAA 4OJPA 5ALIA 3LOUA 5AZIB 2D0AA 3SQ4A 4CZCA 1N5VA 3C2MA 5HI7A 4XPCA 2KJ5A 2QA2A 4FSVA 4ERDA 4RW7B 1ZM9A 3SAFA 4OFZA 3OYBA 4DV1J 2N3OA 5J2HA 4DL6A 4HCBA 4OHZA 4MFFA 1MMDA 1S9FA 1R8BA 2OPSB 1GLJO 3L3VA 3DDNA 7ICJA 5KAKA 1AUSL 4ECTA 5CR0A 3NASA 3I55S 2BZFA 1P6TA 2E1YA 1IBMJ 4OI2A 3MOJB 3SQGB 4QIWF 2DT9A 4CO0A 3S9HA 2O1PA 2H9ZA 1OQ3A 3M8ZA 1JNRB 1QZ6A 2I8EA 4PXDA 1PBAA 4K42A 2QKQA 1EHWA 3RG6A 2JWKA 1S0MA 2UUCF 1ZQUA 1R0AA 5DDOC 1AFIA 3PHTA 5E3CA 3OLBA 5EY4A 2OTJS 4ZVOB 1MLAA 3GLJA 1FJGJ 1F3FA 3LGHA 2YNFA 4UB8U 4P0PB 2WVFA 1NBEB 4DLEA 5IQQA 4U9RA 5LSRA 4FWRA 1RAFB 4JI0F 3TFRA 3NGSA 4FBUA 1LW0B 3H7HB 3K75D 2E20A 1OJ4A 3BZQA 5KFKA 2VB6A 4CM2A 1UTAA 3R6MA 4HH1A 1XK8A 2DBYA 4EZ6A 4RW8A 4ETXA 4OX9F 1VQLN 3ADAC 4DDFA 4DV2J 2G5HB 2W4CA 2BDPA 3CPWR 1QSLA 4X2BA 3M32B 2ZOGA 4ZPVR 4JD2A 5LY3A 1EZZB 3RB6A 1KNZA 4FM2A 3M30A 4JI6F 5ETLA 3OYJA 1J9AA 2F5GA 9ICSA 3CQ8A 1JMSA 2RN2A 1XNRK 8ICIA 4UUWA 2VKQA 2RT3A 2Y9HA 2V0NA 2KEYA 1HBMA 4LF9J 4BR5A 2W3RA 2Z30B 3PW5A 1D1UA 2FLLA 2HVZA 4M5MA 1D8BA 1BI4B 2F9TA 4BDPA 1BL3A 9ICCA 2MB0B 4MDBA 5KG3A 2VF3A 4L74A 1RT3B 5TKYA 2ZH2A 1SV4A 1XR5A 1Q86O 2DR8A 2EXUA 3D0IE 2GLEA 2IHNA 4BR9A 3CCWA 4K8RA 1FRJA 4JV2A 3BUZB 2GIQA 1TUYA 3OPXA 3E01B 4YY3F 2GJFA 3S6EA 4LSNB 4MK7A 4K4WA 1SVDA 4GKKF 1NDPA 4M47A 1URNA 4O3RA 4JB3A 4CW7B 4J2DA 3ID6A 1LXJA 4V19X 2CJYB 3Q22A 5CD4A 4ER8A 4Y1CA 3OFEA 5E3QA 2V9KA 4EFAC 2P9LB 2IVMA 4PHDA 5AKLA 2CQHA 2OLWA 4U8YA 2WHOA 4ZPWR 3MUTP 1DT9A 1ZQKA 2RD5C 4LH4A 4FWOA 3Q8MA 2XM3A 3G4SN 1N36J 1HYSA 2BPGA 3J80O 3BPSP 1OUQA 3QQCD 1S9EB 1IKWA 4EMDA 5IIIA 4Z4IA 2EWSA 4I6AA 2JFDA 3G86A 3CIMA 3WIUA 1VQ7S 1QJHA 1OY6A 2PYJA 4FW1A 1SC1B 3PW2A 3E9OA 3C19A 4CK2A 1XO0A 3WKBA 4PR6A 2DNNA 3TVYA 3W5ZA 2RU3A 1TV6B 3N97B 7FDRA 4X66F 1YT3A 1PILA 3SEIA 2UVVA 3OUYB 2AYMA 1K9MO 3NBPB 3T5KA 1LWEA 2K3IA 1N6QB 1QAYA 3BS7A 1L3SA 4BRAA 3QAEA 4XRHA 3F2DA 2YQ1A 3R5BA 2F8HA 1HHTP 4EX6A 5BRFA 4FJ9A 5HL7Q 2D8CA 1KQGB 2J6SA 4QWDA 2IRXA 1XI1A 3PSFA 1AB8A 4USMA 4A61A 3NL0A 8ICGA 5ALNA 3VOVA 3R1LA 4QYZK 3DLKA 2DGSA 1SXDA 4KHWA 3VGUA 3FZBA 5J2MA 3L4PA 2QN6B 2CQBA 2Q79A 3QMQA 2WB1D 5ALUA 3HPHA 1D5AA 1EWRA 9ICWA 2GX9A 2BJ9A 4IC9A 2HFSA 2AA4A 4CF1A 2MY8A 1NPPA 1RQ0A 2YVSA 4Y2QA 3QWPA 3DAWA 5KGXA 4A59A 4CK3A 2JFKA 4DR3J 5D4NA 3R5CA 2UXBJ 3S41A 3Q8QB 4ES3A 5KFXA 2IC3A 3DI6B 1XQIA 1VSKA 5U47A 1XQSC 3JPNA 3ZO7A 1A0OB 1VQ9S 1S6OA 3N9UC 2DGVA 2QLBB 1BPBA 4J9SA 1JLBB 4W92B 4JUZA 4WIQA 2VQFF 2Q3SA 8ICMA 4OYIA 4J9QA 1VHXA 3CC7N 4UZCA 1JLCB 4MO4A 2F63A 3QEPA 2K7KA 1RT2A 5A6WA 2J0QD 1NK8A 3VQ8A 2FJBB 1B0XA 3FBCA 3ZSXA 1H73A 5DBCA 4DV7F 4JKCA 2BCUA 1EQ0A 1PSDA 4JI2J 4JI4J 2FMQA 2RSQA 5L1MA 3KMSA 1MQ2A 3MF5A 4R8UA 2G2YA 3CMQA 2R2SA 5KAIU 1OMSA 4RO0A 4IKFA 2YWFA 2O8EA 2EANA 4ECYA 5LSOA 1VK3A 4AP9A 3TA0A 1NHKL 4CEAA 1KN6A 5GIPA 4X65J 4NCBA 4ANCA 2NYHA 2NUUG 2COLA 3NKYA 2BRLA 3ZT4A 1N5YA 5JUMA 1Q7LB 4CIEA 2OEHA 5HL7L 2IGIA 1IVZA 3H08A 4Z6CA 1YJ9N 1RJJA 3MWBA 4KHNA 3IFEA 4MKVA 5JVGQ 2C2ZB 5GAHI 1JLEA 7ICHA 2GZOA 4Z6EA 2HWIA 3RH4A 1SC3B 4DR5J 1N60A 3D1QA 2VG5A 2HFNA 4HHUA 3KHHA 2MLYA 4DCJB 1RLDA 3IBPA 2DVIA 1GEHA 3H0RB 2VG7A 3IWXA 1T0TV 4CLLA 1M5HA 3LWMA 3B54A 1HNWF 3CG7A 2HLTA 2RRNA 4I2CA 4RLEA 2RHFA 1S4FA 1FD2A 1NH8A 4QZ9A 4A8KA 5HMLA 2NO5A 4KPCA 2VGNA 1R27B 1E6YB 1FW6A 1ZQRA 3SUPA 2KMDA 3G8TA 3RW6A 1UVNA 4YMNA 1B4FA 3ZZ0A 1GLEG 3WXKA 4LFAK 2M9NA 4RBTA 3A5MC 4DXLA 3K5OA 4LSLB 4E7IA 1T3QA 4Z4GA 5AFUA 1CPZA 3GIRA 5DG7A 2HVEA 3OBIA 1QVFM 4CGZA 3UVJA 1V97A