1NK9A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after two rounds of primer extension, following incorporation of dctp and dgtp.
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk9A01
3KHHA 4KHUA 3OYCA 4ZTJA 3ZD9A 4F2RA 1JLCA 1CZ9A 2VG6A 3KLIA 1BIUA 4BGDA 2C22A 4LSLA 3HPOA 5CB1A 4O5CA 4R8UB 2PI4A 5KFHA 4MEYA 3LP0A 3ZSVA 4FM1A 1ZQIA 4BACA 1BISA 2HB5A 2ZD1A 2PFNA 3RB3A 2DPIA 1IH7A 4F5PA 2F8TA 3AVLA 3TABA 4FLWA 3O4QA 4W5RA 1I39A 1QLNA 4QOZB 3NF9A 4E7IA 3L2VA 2HVIA 4DWIA 3KK3A 5F9NA 1S6QA 4I2PA 1TKTA 4DL7A 4DLGA 4FJ7A 1RT5A 8ICLA 3OYGA 1C1BA 3KK1A 1Y88A 2R8HA 1S1UA 1NK0A 4ECZA 3C5FA 1IM4A 1JN3A 4UQGA 4BXOB 3QEVA 5D3GA 1S1WA 8ICWA 4CIGA 3SV3A 3QEXA 3ZSRA 3JYTA 4YVZA 4RW4A 4FBUA 1QSYA 3L8BA 2XGQA 4ICLA 1BPYA 4DU3A 4FXDA 4IQVA 4KV8A 4B8AB 2BGWA 3C1ZA 2PFQA 9ICMA 1S1TA 2X6NA 5J2QA 1ZQUA 4YXMA 5EWEA 3T5KA 3VQ5A 4W5TA 1RT4A 1LB2B 5KG7A 3KTQA 1LAVA 2I5JA 1Q8IA 1NK4A 5J0UA 3Q8QB 2XRIA 3T19A 4M45A 1YTAA 4R66A 2IHNA 2OWOA 3EWAA 5DDMA 4DFMA 4M42A 4M6WB 1IG9A 4ECVA 4CJPA 3T5LA 5J2FA 5TZVA 1JLEA 4F5RA 3RH5A 2YNHA 4LZGA 2P5OA 2ISPA 2JEIA 1QTMA 3V1OA 4R64A 3MR6A 1RT2A 4OLBA 1KCFA 1VSJA 3DLBA 1ZQMA 1ZJMA 4ECXA 9ICUA 4RUAA 4NCBA 1MSWD 1PZNA 3V9UA 3PMLA 2J6TA 4KN7A 4YQWA 1RYSA 2VWKA 3Q8RB 7ICPA 3A2FA 4IRCA 3V6KA 1RT7A 3GV7B 4YMOA 4GVMA 1REVA 4AH9A 4DOBA 2R8IA 4ECUA 9ICPA 4YR3A 1LAWA 2ZTCA 4DS5A 2OA8A 1S9GA 5J2KA 1B43A 4KO0A 4RNNA 2E6LA 4TQRA 4J9SA 1S97A 4O3NA 1KVCA 3DRSA 4DQSA 3MEGA 3V9XA 4G1QA 8ICZA 4IG0A 3OY9A 3PR4A 2OPSA 2XO7A 4EBEA 4KTZA 2GUIA 2HMIA 4FJKA 4YMNA 2RDIA 4DL5A 4KTQA 3VN5A 4Z4CA 4Z0UA 1X9WA 4I27A 4MEXA 4C8LA 4NLZA 1SUQA 4GC6A 1YVUA 1NK8A 4CJUA 3KLHA 3ULDA 4PGXA 5SZTA 2B6AA 3WNFA 1RBSA 3I0RA 5CR0A 5KT6A 1EX4A 8ICVA 2G8IA 2A1JA 7ICNA 2PFOA 1WN7A 1NOMA 3AVMA 3VA3A 5C25A 3L2RA 2BE2A 3QERA 3L2WA 2YHAA 7ICHA 5J2NA 2G8UA 4O3QA 4Z6EA 3NGYA 4DOAA 4B9MA 1IKXA 3GQCA 1MU2A 7ICUA 5J0SA 5J2IA 3LANA 3L3UA 4O4GA 4JWNA 1SL1A 2BHNA 4RQ2A 3K59A 1VRUA 2ETJA 3SYZA 2PFPA 4FJMA 4RUCA 4RPXA 3S3OA 1IKVA 3AO5A 4QWAA 2ZQBA 1JLQA 5J2BA 4B9NA 4KHSA 3AVBA 2X78A 2RKIA 4CECA 3CFPA 3AUOA 1WSHA 1UWBA 3TQ1A 4DTPA 1QSLA 4CJTA 4KB1A 4AHRA 3PX4A 4KI4A 1TKXA 1U4BA 3TARA 2DFEA 5EWFA 2F96A 3H7IA 4JV1A 5CA7A 4KHWA 3KK2A 2DPJA 2Z1IA 4OKEA 3HP9A 4N5SA 4RQ5A 4O9MA 3P83D 1A77A 4CK3A 2R8KA 1NK7A 4DU4A 1TAQA 4BWJA 3OSPA 4QZ9A 1EP4A 1U04A 3OYBA 4P2HA 1SKSA 1RNHA 2I9GA 2G8KA 8ICRA 1TVRA 4RW8A 3MGIA 3P5JA 4KB0A 4FJJA 1NJYA 3V7JA 4HCCA 1LWCA 5KFBA 3OSNA 4Z4FA 1C0MA 3BQ1A 3HVTA 5DMRA 4I2CA 4F50A 1K1SA 4W5NA 2ASLA 3EW9A 4KLOA 2XGPA 1YTUA 3NH1A 1WLJA 4IBNA 3PW2A 3ZT3A 4XRHA 3OHBA 4DTXA 1ZQNA 3ZSYA 3QIPA 1C7YA 2P6RA 9ICQA 3HYFA 4UB1A 4E1NA 3ZSZA 1NOZA 5J0YA 3JSMA 2AGOA 1BI4A 1WSGA 1CXQA 3V6JA 1A76A 5F9LA 3SUNA 4O5BA 3VA0A 3RBDA 5KT7A 3LPUA 3OVNA 5KFNA 3C2MA 2HHWA 5J1EA 4DSFA 2XHBA 3QLHA 3V6HA 3PV8A 4CEBA 2FBVA 3PUFA 2QKKA 4RQ4A 4PHAA 3AV9A 4UB2A 4CFDA 3K5NA 1XHZA 2QK9A 1N48A 2HHVA 3QEWA 3H8WA 2IHMA 1CXUA 3B6OA 1W9HA 4OJRA 4NYFA 4FJ8A 8ICKA 2X6SA 7ICJA 4F93B 3ZT2A 4KLEA 1GOBA 3N97B 5J2JA 9ICGA 1XO1A 1RTJA 4FVMA 4B3OA 4PHDA 4CHYA 1Z00A 4LZDA 1NJXA 2C2EA 1LW2A 4HHTA 3ZDEA 4ED6A 4I2GA 4HVJA 3LAKA 4KLSA 2AQ0A 1TV6A 4DQRA 1XU4A 4BDPA 4E3SA 5KT5A 1XSNA 4DTMA 4YP3A 3H4BA 1A5XA 3QEPA 4QZBA 1RT6A 4HYKA 3LK9A 1NJZA 4DS4A 1TVAA 1K1QA 4M3RA 1LWFA 4F4ZA 1FKOA 4M47A 1FKPA 5KG3A 4I2EA 1RBTA 4J9MA 1ASVA 4B9VA 1RT3A 4EYHB 3BJYA 1T3NA 4Z6FA 3DLRA 2W9BA 2HHSA 3G6VA 2W42A 4HTUA 3M8SA 3LZJA 2HNZA 4DEZA 5KFPA 4QZHA 2AGPA 1KVBA 4YR2A 2IDOA 3OS2A 5J0XA 1QHTA 4M9GA 5KG1A 7ICSA 4QZIA 1RBVA 2UVVA 1COOA 2AQ4A 4I2BA 3SNNA 3NAEA 1S9FA 4KLTA 9ICHA 1ZJNA 5KFCA 3Q8PB 8ICJA 1CUKA 1LWEA 4CESA 3HVRA 4CK1A 3TANA 3SQ1A 3ISDA 1TV9A 2J6UA 3PVXA 4ELUA 2P1JA 3K75D 3MGHA 5EOZA 2BCSA 2HW3A 3AO1A 2Z1HA 5DG8A 2KTQA 3MAQA 5L1LA 4QZFA 4CHOA 4RQ6A 3LWMA 4AHVA 5BPCA 4DSJA 3GIJA 4CCHA 1KFTA 3RR8A 5D49A 4ED1A 3SUPA 4F4XA 4JRPA 4IRDA 5CJ7A 4DSLA 3RH6A 2B21A 1B9DA 4K8ZA 4FLTA 2A1SA 4GXJA 1WSEA 1C0TA 4M41A 4CHNA 2V4RA 4EYIB 3H8JA 4H4OA 5DGAA 3AU2A 4O55A 4CGGA 2FBYA 4FJNA 2XCPA 4FM2A 2M9NA 4X5VA 1T03A 3KJVA 4I2FA 4RT3A 4RQ8A 1SKRA 2RDJA 2ZUBA 3V9ZA 1IKWA 4O3RA 4O44A 2LYHA 4EZ9A 4KFBA 2BPCA 4JV0A 9ICIA 3EPIA 1ZYQA 1WNSA 3RMBA 5KT3A 1VRTA 4K4GA 1BCOA 3UPQA 4DMNA 2OZMA 5KG6A 3C1YA 1I3AA 4RNOA 3RJKA 4YR0A 4EBDA 4P4PA 3PO4A 3EZ5A 4FK2A 3K57A 1ZQEA 2ZJAA 1VSFA 4RW6A 3WNEA 3JPPA 3MFIA 2X74A 4NM2A 1VSLA 4DQPA 3HM9A 5L1KA 3K58A 4Z4HA 5KFOA 4O5EA 4RT2A 4CJRA 4FLXA 3OJSA 3DRPA 2ITGA 1U49A 4CEAA 5DQGA 1KSPA 3ALYA 1ZQDA 5CYMA 3U3GA 3VQ8A 4E89A 4KPYA 5J2HA 3O3FA 4KLMA 1J54A 1HMVA 5FRNA 3RJIA 4QZGA 1BIZA 1DTTA 3C6TA 4RPZA 1HYVA 3M8RA 5KG2A 3RTVA 3T3FA 9ICBA 1RDCA 4N41A 3EYZA 4ED7A 4IR1A 1X9SA 8ICFA 2YNIA 2PI5A 1ZETA 3OHAA 2EX3A 3RB6A 3ZD8A 1ZQWA 4KITB 3RH4A 1RTHA 1MC8A 1JLAA 5FDLA 4CIFA 2YKMA 3HX0A 4M3UA 4Z6CA 2BR0A 3OGUA 4Z4IA 5HMMA 1S1VA 2NUBA 1Z3EB 4JUZA 2IS3A 4DU1A 4Q0BA 3U3YA 1SV5A 2B5JA 1KDHA 5HRSA 4M2YA 2ZUDA 3MXIA 2P6UA 2MUTA 4EP5A 3NH0A 3V7KA 3DI6A 3MEDA 1U45A 3BQ0A 1KTQA 9ICCA 3QNNA 4K8XA 2WONA 5KFZA 1BL3A 4FM0A 3JPTA 4E7LA 2BQUA 2DFHA 3KIOA 5KFDA 5C5JA 1RDAA 1WAJA 3PW7A 1S0VA 1ZQLA 4N47A 4B9UA 1ZQJA 2FLNA 4AILC 3QZ8A 4BE1A 4JWMA 3CG7A 5KGXA 1K6YA 3UXNA 3NGZA 5HMLA 8ICXA 2DFLA 3ZDDA 4F5QA 1L3UA 3ZSOA 4J2EA 4FZYA 3GDXA 2ZTDA 3RJHA 4JV2A 3ZSWA 3ISCA 2PXIA 1BPZA 3B0YA 2BCRA 4DLEA 5DK5A 4FS2A 2ASDA 1L3TA 2G8HA 2WTFA 1RZTA 2KN7A 4KMUA 4C8KA 5J2PA 4B9SA 3HWTA 8ICQA 1S0NA 3Q8KA 3BDPA 3KKSA 4IDKA 5K14A 4ELVA 4OKJA 3WNHA 1TL1A 2OZSA 4RNMA 3TWHA 2KFNA 4CHPA 3RMCA 4Y1CA 4DTRA 2GV9A 2W9CB 3DLGA 1JMSA 4DQIA 3CFRA 1C1CA 1A5VA 1DTQA 1HNVA 1WSFA 1KRPA 5HRPA 4M9LA 4PWDA 4LVSA 4QZCA 2IA6A 2PZSA 5HHIA 1TKZA 9ICNA 3RAXA 1KVAA 3O4NA 2MAXA 2PYJA 3C5GA 1TK5A 4R8UA 5KFFA 1J5OA 1G15A 3LWLA 1QSSA 4FZXC 3BGRA 1TL3A 9ICLA 5DB6A 4I28A 4GXIA 4RW9A 4ED8A 1W0HA 3E01A 3MABA 1CZBA 3ASMA 1CLQA 4ECWA 1HJRA 8ICUA 3OYJA 2JEJA 3ITHA 4QCLA 2JEGA 3LZIA 5J29A 4CHZA 3MDCA 3LALA 8ICPA 4DL4A 4I2QA 1LV5A 5SWMA 4AHSA 4AHTA 4WE1A 4CJSA 4BXOA 2HVHA 3NHGA 1NK6A 4PUOA 1SZPA 4XA5A 2ATLA 4DOCA 1BI4B 3V9SA 3PNCA 1XS9D 2E4LA 1HRHA 3PW0A 1RILA 1D8YA 8ICMA 3L2QA 5E41A 2J6SA 1WSIA 3SQ4A 4FZZA 4IQWA 2R8JA 1VSEA 3Q8MA 1S76D 4M3ZA 4C8MA 1Q9YA 5J0QA 4ECRA 1WCLA 3DMJA 4DTOA 4FK0A 2YHBA 1L3SA 3SZ2A 4Y1DA 1KEJA 3SV4A 1ITGA 1U48A 2HHTA 4M3WA 2E6MA 3KHGA 5IILA 5CZ2A 3RR7A 3KLGA 4IRKA 2UVRA 4F2SA 1Z26A 3OYKA 3FFIA 8ICGA 5J0OA 2EHGA 2O4GA 5L1IA 2ALZA 4NLKA 3C94A 2UVWA 4CJLA 4NCAA 3DLEA 1ASUA 3B6PA 2R7YA 3KLFA 3ZDBA 1IKYA 4DTNA 4MFCA 3KLEA 3K5LA 3ZSXA 4OGCA 1ZBUA 4PPXA 4E19A 2LSNA 3AA3A 3IHQB 4CJVA 1ZQTA 2R8GA 4CEZA 4J9LA 5KT2A 4YG2A 8ICHA 4QWEA 2JZBA 3VQQA 2BKEA 4OPKA 3L3VA 4W5QA 4O3SA 1A5WA 3GFKB 4H4MA 2HHQA 3NE6A 4OGEA 3DLHA 4ECYA 4FK4A 5KFUA 3HXMA 9ICSA 4FJ9A 1J53A 1WCNA 1FK9A 1JKHA 5KI6A 3GIMA 4KTWA 4FBTA 4I2JA 3ISBA 3OYNA 3O3GA 4QZ8A 4YNQA 4DTJA 3HL8A 4PGQA 2W9BB 4IFYA 4PGYA 1JL2A 4IR9A 4NCGA 4CJ3A 2XY8A 1IXRA 4TUQA 1ZQZA 1D8LA 7ICGA 4CEQA 4OVLA 3IS9A 4NLGA 3OYAA 3H40A 3AVFA 4L8RB 2XY7A 4GC7A 3AA2A 1HPZA 3M8QA 1NK9A 3VQBA 1NKBA 1B9FA 1LW0A 3MXMA 4P4MA 3DOLA 3HW8A 4XUSA 4MF8A 3K2PA 4I2HA 4M9NA 4B08A 4CK2A 4E7JA 1U9LA 1ZQAA 5HRNA 4ED2A 1XSPA 4UAWA 5J2AA 2BCQA 1UA1A 2XC9A 1X9MA 2Z1GA 4CFBA 4CJWA 5KRTA 2W9AA 9ICKA 3S3MA 5IIOA 1Z25A 2XCAA 1RPLA 3LP1A 5KFGA 5J0PA 4I7FA 1T4GA 3C21A 4E7HA 1JIHA 2QXFA 5BOMA 2IOCA 5DBAA 5HRRA 4XQ8A 4CJ4A 2VA2A 4KLDA 1ZQHA 4TSXA 5CZ1A 4MF2A 1D9FA 4FS1A 4I2DA 3RMDA 4TURA 4F4KA 4Q44A 3C6UA 5DQHA 4CERA 4OKKA 4B9TA 5KFVA 4KI6A 3OS1A 3PX0A 2BPFA 1HUOA 4M9JA 2Y1JA 5KT4A 1BHLA 1J9AA 4LH5A 5I42A 2NRXA 3QZ7A 3RJEA 5JS2A 3OYEA 4PA1A 3Q8LA 4O3OA 5KFKA 3V4IA 5J2EA 3QINA 4JRQA 5KFWA 3AVJA 1Q9XA 2YV0X 3AA4A 4AHCA 4KLGA 1BVSA 8ICSA 4F5OA 5CY4A 4E1MA 2AJQA 5CHGA 5KFTA 4UAZA 3SQ2A 4DTSA 4CGIA 5DB7A 1NOYA 5HNKA 1VSMA 2Q3SA 3RRGA 4CHQA 3AA5X 1KLMA 3G10A 2V9WA 3RJFA 2YNGA 4B9LA 2ZJ8A 3S9HA 4MQ3A 3CQ8A 4UBBA 1L5UA 3C2LA 1TAUA 4Z4EA 4F92B 4FLUA 1XHXA 4KLLA 3AVAA 7ICIA 2I1QA 2H5XA 1SL0A 2VANA 4Q8EA 2HNYA 4NM1A 1BPDA 2MUTB 1UT5A 4FJIA 1MQ3A 4QWBA 5KG4A 5CWRA 5DKWA 3NF6A 3NTUA 1NKEA 4FW2A 2W8LA 1BQNA 3SI6A 1JXLA 3QO9A 1JLFA 2KZ3A 3WNGA 5J2GA 3TAGA 3F9KA 1RCHA 2KZMA 3IAYA 4GLXA 4F8RA 4BE2A 2G8WA 1ZQPA 3ETLA 3FYHA 4IQUA 4F4WA 2YNFA 4ECQA 4EEYA 4LY7A 3V6DA 3ISNC 4ID1A 1O1WA 2DFFA 4PHPA 3V1QA 4F91B 3LDSA 9ICEA 4LD0A 5EWGA 5KRSA 1VSIA 5KFRA 3T5JA 4CJEA 4RQ7A 2P66A 1EXQA 4J9QA 1VK0A 4CJ5A 4BDZA 1EETA 4Q5VA 2AU0A 2OPRA 4RU9A 3TAPA 1RDBA 3ZCMA 4FCYA 3I0SA 2Q0ZX 4Q8FA 4QWDA 3KKRA 1GOAA 4R65A 3V72A 4K4HA 3NBPA 4FJGA 4FW1A 3SQ0A 4KHQA 4FLVA 3KD5E 3HPHA 1SL2A 8ICCA 3NH2A 1RTIA 4FO6A 1RT1A 1F21A 3M9NB 4UAYA 1VSHA 4J9RA 3LP2A 2BDPA 4CFCA 8ICYA 2D0CA 4R5PA 4CFAA 1JXBA 1S77D 1QE1A 4DQQA 1N6QA 1S0MA 4ED0A 3PW4A 9ICXA 3JPNA 5J2MA 3QNOA 4CJFA 4I29A 3VQ9A 1HYZA 2VWJA 2ZJ5A 3PR5B 4M3YA 1HJPA 1BQMA 3LDAA 3S3NA 2FBXA 5DGBA 3DLKA 3RWUA 3H08A 4P4OA 2KQ2A 2HHXA 4N76A 4DSKA 3VQ7A 4UBCA 7ICTA 1R0AA 9ICWA 3OJUA 4W5OA 3C2KA 5HP4A 3N4MB 5IIKA 4M0AA 3NDKA 5KFAA 4EBCA 2RPIA 3OYMA 2WOMA 2ASJA 2ATQA 5L1JA 4KHNA 2A1JB 1WSJA 4FJ5A 1QS4A 1XC9A 3OYFA 4TUPA 3UIQA 2G8FA 3SUQA 3CYMA 1IO2A 5EU7A 3LAMA 4G3IA 3PW5A 2ISOA 3H8SA 4CJQA 4EZ6A 3JPOA 1XSLA 4RQ3A 4DL2A 4MFBA 1KLNA 3ZT0A 4IFVA 2F1JA 4Z6DA 3G6YA 1C0UA 3JPSA 1VSDA 4KLUA 4C8OA 8ICAA 5DG7A 4KLHA 3VQEA 1XI1A 4I2AA 4DO9A 2D0AA 5KFYA 4JS5A 8ICIA 2FMSA 2G8VA 3CM6A 2C28A 3SCXA 3GIIA 4CIEA 2YKNA 1JXEA 1RDDA 4DG1A 2FPMA 1BGXT 3T1AA 1C6VA 2C2RA 1ZQQA 4DF4A 3SI8A 1DGSA 4EP4A 2FPKA 3MECA 3SJJA 1B22A 1NJWA 3QESA 5DQIA 4I9QA 5KFMA 4IG3A 5JS1A 9ICVA 1JLBA 2VA8A 3D0PA 4J9KA 9ICOA 1RTDA 1UAXA 3NGIA 3K5MA 3TAEA 2NRTA 1UA0A 5DLGA 3KHRA 2OYQA 2ZTEA 4UB5A 1S1XA 1ZQBA 4PY5A 1ZQSA 7ICFA 4KREA 2JZBB 3AU6A 4NXZA 4PHEA 2PYLA 4CGHA 5KFSA 2FMPA 9ICJA 1B92A 4DF8A 4DFPA 4QZDA 3V81A 4YD1A 4YCXA 1D9DA 4MFAA 1HNIA 3MXJA 3V9WA 4ZHRA 4GW6A 4RW7A 3JPRA 4PH5A 4C8NA 4TUSA 3EY1A 5J0TA 3RAQA 1KFSA 8ICOA 4XIUA 4RG8A 4CGDA 1BPXA 3NF7A 4KHYA 3B0XA 4UB4A 7ICRA 4KKOA 4LH4A 3V1RA 2F1HA 3TAQA 4O5KA 5J0RA 5KFIA 3NGDA 2NRVA 2IAJA 4N56A 3AVGA 1TKDA 2V4QA 2VG7A 3DYAA 5KFQA 5J0WA 1DLOA 4DL3A 5D46A 3NCIA 1RBUA 3QEAZ 3MBYA 3GV8B 3DRRA 4E0DA 4CEEA 1AROP 1HQUA 7ICOA 4NY8A 1ZQKA 3UQ0A 4IKFA 4QW8A 5C42A 2IBKA 2BCUA 4YD2A 1X1PA 4RQ0A 3F73A 3LPTA 4YFKA 3K5OA 5IIMA 3P1GA 4QZEA 1C1AA 3HO1A 1BPBA 4GMJB 2VG5A 3VQPA 3ORYA 2BCVA 3HK2A 4ECSA 1Z00B 3ZT4A 3SPYA 4YXJA 1ZQCA 4M6WA 3MEEA 4CGJA 1S0OA 3RJGA 4HCBA 1S10A 1EXNA 4F4YA 4CF1A 2BPGA 1T05A 3VQDA 5D4BA 5KFLA 3AVNA 5IINA 5DDYA 5CP2A 2W8KA 3HSTB 3VQCA 2FMQA 5L9XA 3TI0A 7ICEA 3PX6A 4KN4A 4QAGA 3TAMA 4HUEA 3QETA 3ZSQA 2W9CA 1TGOA 7ICKA 2JEFA 3M8PA 3AO4A 2P5GA 4YMMA 2F1IA 5J2DA 4HUGA 3TAFA 4DTUA 5KG0A 3KHLA 3TFRA 1DOQA 5DB8A 1S9EA 4K4IA 1RYRA 4KRFA 4QZAA 5KGWA 3VQ4A 3FDSA 2BANA 1CEZA 3H4DA 1X2IA 4OPJA 4CEDA 2FPLA 4J2AA 4AHUA 4R63A 2BGGA 4Q43A 4F3TA 1ZBLA 3BQ2A 1VSKA 3KD1E 3QEIA 3K4GA 4ECTA 5FROA 3LP3A 5C24A 4FLZA 2Y1IA 5HROA 4FYDA 1ZQGA 9ICFA 3BQTA 3OYLA 3Q8SB 1EKEA 1RXVA 2HHUA 3HJFA 4J2BA 2RN2A 5IIIA 3EPGA 5KTQA 1QQCA 3ZT1A 3OYIA 1ZBFA 4KLIA 1HUZA 2JLEA 3UQ2A 2ZE2A 1MQ2A 2IGIA 4IQTA 4H8KA 2KZZA 3C23A 3PO5A 4QWCA 3GILA 5HHHA 9ICRA 4I9LA 3TR8A 1YT3A 2PY5A 1ZQRA 3G6XA 3D45A 2QKBA 3C95A 5KFXA 3M9OB 3PMNA 3IM1A 2ZUCA 4JK1A 3QE9Y 1HQEA 4M3XA 3MR2A 4MFFA 3OS0A 2FLLA 2BQ3A 4DFKA 4ID5A 1ZQOA 4UB3A 4LSNA 4M3TA 3IRXA 3MR5A 3VQAA 4Q45A 1N5YA 2C2DA 4FJXA 3MFHA 4F3OA 1TK8A 2AGQA 9ICAA 2OPQA 3L2UA 1TFRA 3U6FA 1ASWA 3UXOA 1UT8A 8ICTA 3G0ZA 4KLQA 2GBZA 3QIOA 3AVCA 4RQ1A 3HP6A 4DL6A 4O0JA 7ICLA 1NKCA 4OLAA 4JLHA 2KFZA 3ZDCA 2UVUA 2FBTA 8ICNA 3MR3A 4ZTFA 1KFDA 4J9PA 3AO3A 5KFJA 4HUFA 5J2CA 5FRMA 4I2IA 1JL1A 1V9PA 4KAZA 4NYNA 4JS4A 5I3UA 1N56A 1T8EA 4FLYA 3I8DA 3PY8A 5JUMA 3AVIA 3AO2A 3OYDA 5DBCA 3MDAA 3HT3A 3UXPA 2KW4A 1JLGA 1T7PA 3V7LA 4BE0A 4FJLA 3JPQA 4CF8A 2A1RA 3ZDAA 1SKWA 2FLPA 1UOCA 3VQ6A 1XWLA 2HNDA 4M04A 3DM2A 1ZBHA 1L3VA 1D5AA 1ZBIA 4ELTA 4DFJA 3QEBZ 4KLFA 1S6PA 3GV5B 1H38A 3SUOA 3SPZA 1HYSA 3RJJA 5HLFA 3DOKA 1RXWA 2OPPA 3OYHA 4CEFA 2Z1JA 4NLNA 5IIJA 2FC0A 4J9NA 5BOLA 7ICQA 4FJHA 4O0IA 3O3HA 8ICBA 1ZQFA 4CJKA 5DLFA 3RMAA 3E2EA 2F8SA 4YFUA 4J9OA 2NRZA 1GOCA 3GIKA 4CE9A 3AVHA 4TQSA 4ED3A 3CFOA 3M9MB 4BDYA 3THVA 3TFSA 3IG1A 1ZQYA 3RRHA 5KFEA 4J2DA 2P51A 4RPYA 3HPGA 4KLJA 5CYQA 4M9HA 3NF8A 4O3PA 3RB0A 3AVKA 1WAFA 1U47A 4GXKA 2GWSA 4YN4A 4Z4GA 2O4IA 2W9MA 5HP1A 2XY5A 9ICTA 2D0BA 3CM5A 2IC3A 1BCMA 1S5JA 4DSEA 1BPEA 3NFAA 5DG9A 5T7BA 2BQRA 4DSIA 2NRWA 4CEOA 2IMWP 5KG5A 3RB4A 4ZH4A 1JX4A 2DTUA 4BWMA 5HBMA 3T5HA 1NK5A 1TK0A 2B4JA 4CGFA 2VA3A 5DB9A 2DY4A 4CF0A 1ZQXA 4RZRA 4CF2A 4CF9A 1FXXA 7ICMA 2JGUA 2RF2A 4QW9A 4B8CA 1RBRA 4E7KA 4PQUA 8ICEA 5DBBA 1Y97A 1ZQVA 4F5NA 2D5RA 2XY6A 3RBEA 7ICVA
chains in the Genus database with same CATH superfamily
1RACB 3CIZA 3OYCA 1CVJA 4F2RA 3KLVA 4YOXA 4UW2A 4EK2A 3HPOA 4FWRA 4O5CA 4R8UB 3FZMA 5KFHA 3OFHA 3TJAA 1J5OB 4FM1A 4BACA 3MOZA 1RU1A 2R42A 2ZD1A 2PFNA 4B3TJ 2HBQB 2E20A 3OR1B 1T02A 2F65A 3BPDA 3TABA 3O4QA 3L2VA 1XMQF 4KX5A 5F9NA 1S6QA 2LKZA 2MZTA 2VGMA 4I2PA 1TKTA 4DLGA 1F44A 1UZDA 3R7BB 1B3TA 1MA7A 3PJ9A 5DM6L 3AOBA 4FVCA 4UATA 2EZXA 4LRAA 4M5HA 2XWXA 4ES1A 4ECZA 3C5FA 1WF1A 2HCFA 3NY0A 4PUOB 1V85A 8ICWA 3D2EB 1RQNA 1K44A 5AQYA 1QSYA 2AEMA 3PSTA 2VPZB 4ICLA 3M1FA 1BPYA 3PSFA 2GIRA 1VHFA 4OZNA 4KV8A 3D2FA 2X6NA 1ZD3A 4JI2K 3NASA 3HX9A 2G13A 2GWKA 2VKQA 1RT4A 2LHTA 4AL7A 3GYNA 5A2QY 2VODA 2IHNA 3EE8A 2LXFA 1P6TA 4YB1P 3M2UB 1OVYA 4L3QA 2HWTA 4M42A 4M6WB 1I51B 1ZH5A 1F9EB 4ECVA 3FZ2A 2FQQB 2YNHA 4LZGA 2ISPA 3MR6A 3NNHA 1YAGA 5LMNJ 3KKAA 3I33A 4F9OA 1ZJMA 2D74B 4DV3J 4UUWA 4RUAA 1M1KT 2AHOB 2J6TA 1RYSA 1OY9A 2VWKA 2Y0SF 3Q8RB 2K3IA 1W7WA 4IRCA 2X1GA 1RT7A 2DHSA 1PC5A 1XERA 3KDOA 1DZ5A 4NXNF 4GVMA 4AH9A 4GKJK 3BZCA 5AZIA 1U1LA 1X0PA 3ALRA 4ECUA 3T1YJ 3NNCA 4YR3A 1LAWA 2ZTCA 4GFJA 1S9GA 1O13A 1PC4A 4KO0A 4ZVEA 3C3LA 2E6LA 3QUCA 1S97A 3DRSA 4DQSA 4I4BA 1ZS6A 1U1OA 5B7WA 4BRCA 4K4ZA 3EMTA 3OXLA 4G1QA 2N1RA 4Z94A 1T3QA 4JNEA 3PR4A 4KGKA 3EM1A 4OJPA 2HMIA 4KTQA 4Z4CA 4DMZA 2Q1NA 2AEJA 1HKCA 1O8BA 4MEXA 2A40A 3M8QB 4IOAQ 4GNIA 1OPIA 1WSVA 3MXHP 3ULDA 5M1KA 3WNFA 3DOLB 1RBSA 5A8RA 5CR0A 5KT6A 4IJNA 1EX4A 2G8IA 2A1JA 2DBYA 4WFBQ 2PFOA 2E5LF 1NOMA 3VA3A 3ENVA 2YHAA 1SC3B 3NXZA 4I69A 5LMNF 5D78A 1FJGF 1Q95G 4O3QA 3UB5A 4Z6EA 4DV3F 4DOAA 4USHA 2Z57B 5T7LB 3U02A 4I7FB 1R89A 4NMXA 7ICUA 5J0SA 3O80A 4RL1A 5J2IA 4K41A 3L3UA 3KWGA 4KYZA 2F4VJ 4JWNA 3W9HA 2I5HA 4ZMMA 2DD8S 2BHNA 3K59A 1VRUA 1V3RA 2FDRA 4JI4K 1U0HA 3GONA 1SPBP 4FJMA 1N5YB 3AO5A 2CPIA 2ZQBA 1F60B 4MAKA 1RYUA 4OCZA 1RWOB 4CLTA 4PKIA 4KHSA 5E3PA 4CECA 1VQSA 4DTPA 3GCWP 3SCIE 1FWPA 4LSZB 2HF3A 4AHRA 4KI4A 2PFDA 2ROGA 2DFEA 5F8LA 4CBWA 3X3UA 5BREA 4E2FB 3AB2B 2DPJA 2XYPB 1AZSA 3KJQB 3WK7A 1HWIA 4C11B 4N5SA 1J6ZA 2O8FA 3WT0A 2DO0A 4OPHA 1SJFA 2E1CA 4IH7A 4CZCA 1GX6A 8ICRA 1TVRA 3MGIA 4YHHK 3P5JA 2C3OA 5FLXY 2J5AA 2YWKA 2JOQA 1UZHA 3FBEA 1URJA 3OSNA 3E58A 4Z4FA 1FJEB 4DR7F 3R5DA 2E5SA 1C0MA 2EQYA 2ZVSA 4HDHA 1KR4A 2DR6A 4I2CA 1N32K 4P2SA 2XGPA 2BM1A 3MF5A 3EJMA 3NH1A 4W92B 2DJWA 5AQKA 1HNWF 1JJ4A 5K4LA 1WUDA 4ILGB 4QIFA 1SI9A 3ZYYX 4P0PA 4CW7B 4XRHA 5BR8K 2HNYB 7FD1A 3AMZA 1CI4A 4UB1A 2L48A 2P9GA 2UUTA 3CHWA 1NOZA 3MWPA 3HKZC 1X40A 5LL6Z 2AGOA 1YWXA 1O5JA 3UO0A 1A76A 4M5MA 3M3ZA 3OVNA 2HHWA 1VAZA 3CT9A 1UFLA 3FSIA 1KD1T 2J8AA 2ZJPQ 3NUQA 3PUFA 1P90A 2CJ9A 1NH8A 2DGSA 3H0LB 4OI1A 3QGIA 3ET6A 3OXFA 4K42A 2W2QP 2QB0B 1W2BM 2VYPA 3K1RB 3EE3A 2IHMA 3B6OA 1W9HA 4OJRA 1PK3A 2FI1A 4NYFA 3AD7C 4IO9Q 2HVEA 3KUEA 4KLEA 1N2XA 1NGBA 1GOBA 5J2JA 3NCPA 2Q1LA 1RTJA 1FF2A 1XMQK 4CHYA 2CDRB 3HVAA 2DB1A 2O8BA 2YWEA 3FKBA 2ZH1A 4Y0FA 1CQMA 1RAEB 4HHTA 3I0SB 1CPZA 3LAKA 1B7YB 1TV6A 4CLKA 4DQRA 1XU4A 4KC5A 2H3QA 2F8EX 2ZEJA 3MMAB 5AE1A 3I5BA 2MZQA 2MPUA 2CQGA 3OXGA 3KOOA 1NJZA 2G4BA 1K1QA 4ZVOB 1HHQA 1LWFA 2W7OA 2JFKA 2J7UA 3FCHA 2HRYA 2VG6B 3SAFA 1RBTA 1PYTA 2QFIA 1T95A 4EYHB 2YTUA 2PGCA 5LSOA 1RHKB 5AKEA 2W9BA 2HHSA 1V4SA 3CI5A 3LZJA 3MM8A 4B3MJ 3F2BA 1NLVA 1KVBA 4JKAA 3ETOA 4B3TK 4YR2A 2WK4A 3F0NA 1YF5L 1EWRA 2W4CA 4LJMA 5HJXA 1SV4A 4CYUB 4MYUA 5KPZA 7ICSA 2H4WB 4QZIA 3A8KA 1K8AT 4PRFA 2AQ4A 3SMZA 2CQPA 1LNQA 3Q8PB 4PAAA 1CUKA 1LWEA 5M1NA 4CESA 4FF3A 2MKYA 3MN7A 3VESA 4ER8A 4IH5A 3NLCA 4ELUA 3K75D 2BCSA 4A47A 3JYTB 3WXMB 5L1LA 1FCAA 2D7SA 2XEXA 3H2UB 2M2BA 5B0AA 4AHVA 3ILIA 5J1PA 3FGVA 5IT9Y 3GIJA 5ALTA 1NPKA 5D49A 4AFFA 3VGMA 3N6LA 4IRDA 1NMDA 3CJ8A 4LMZA 1H2UX 2B21A 2DGVA 1B9DA 4K8ZA 1CJKA 1VQMS 3NVWA 2BRKA 4M41A 2V4RA 2R7RA 3H8JA 4H03B 3TADA 4LF7J 4OJ3A 4O23A 4CGGA 5IM0B 4BR9A 4RT3A 3HVWA 3Q2SC 3BGFA 4DV6F 1IKWA 2LYHA 3K0JA 5THWA 3D66A 3RUBL 4A61A 5KT3A 1VRTA 4K4GA 2OZMA 3WK5A 3C1YA 1I3AA 4JV5J 2PFFB 4CNZA 5ALSA 4EBDA 3QU5A 3PO4A 1RT2B 3W63A 4FK2A 1ZQEA 2ZJAA 1VSFA 3OPKA 4Z7YA 3MK6A 3JPPA 3FBBA 3SEIA 2R4FA 2X74A 1YVNA 5ALKA 3VGUA 4I0WA 3KFWX 5LMNK 4DQPA 3HM9A 1VHIA 3K58A 1FKAF 4DV3K 2VPWB 3A13A 4CJRA 3ISZA 3OJSA 3DRPA 5DQGA 4KQZA 5GAEP 3VQ8A 4E89A 1T9UA 4N77A 4CIOA 1YJ9S 2R3VA 2WAQD 2QKQA 4FPIA 1DTTA 2EAPA 4RPZA 2V2QA 5CE3A 5KG2A 3JTOA 3CCVN 4NLQA 1RDCA 3T1YK 4N41A 1X9SA 1S4EA 2OTLS 3C6AA 2VH7A 3Q7CA 4IG0B 2K4PA 3RH4A 3O9RA 1MC8A 4CIFA 3CMQA 2OPSB 2BR0A 2NPFA 1SH0A 4LF7F 4ZVQB 2XVTA 1OSCA 5HMMA 1NH7A 3CF5Q 5D6GA 4Q0BA 4DU1A 3U3YA 1SUQB 3SBMA 2WRMA 3ICLA 8RUCA 2RU3A 4L73A 1DQAA 2ZUDA 3CJ5A 1SGGA 3MXIA 2B6AB 3OVAA 4K4TA 2W4PA 3NH0A 3HLUA 1SQKA 1U45A 1KTQA 2BKOA 4DR4J 1HQUB 4IO1A 5CCLA 5C25B 2WONA 4G65A 5ALXA 4RUBA 3JPTA 3J7YP 2JLGA 5AK6A 5KFDA 1RDAA 2OH2A 1HNZJ 4N47A 2HGNA 2P9NB 3TSUA 2NXJA 4DPXA 4G9ZA 2A10A 4PPZA 5KGXA 4WFZA 1K6YA 3UXNA 4DV2K 3NGZA 5HMLA 2DFLA 3ETRA 4FZYA 3QXGA 2CH6A 5FPNA 2F4VK 4FL9A 4WXOA 1NDKA 5DK5A 4DLEA 3PG9A 4BR0A 1L3TA 4J9VA 2YQ3A 4RU2A 3OL8A 4C8KA 5EE0A 5J2PA 3CPWM 3BGLA 3MDFA 3W60A 3Q8KA 4YDDB 4OYBA 2HSZA 1VQ6S 2QWOA 2MKIA 4IYQA 3D6RA 3KKSA 1QAYA 3N79A 2YH1A 3L9ZA 4CVNE 5K14A 3J7A1 2DGWA 3LGHA 3WKDA 2PMHA 3F2CA 1TL1A 2OZSA 4PJ0U 4H5RA 3RMCA 4I6AA 3UN3A 3CNHA 1UFWA 3TAMB 4DTRA 3I76A 4UF4A 5DZ7A 3CJSA 2B4PA 2VU5A 3DLGA 1JMSA 1XO0A 3CJRA 4C1NI 1DQ9A 4E98A 4DR4F 5GIOA 1DTQA 2M0NA 3ILJA 3M6GA 1FDBA 4X64J 1U26A 2GVZB 3U1LA 5CA5A 3BDEA 3DNCA 2P9UB 1TKZA 3M05A 2CUYA 1E4FT 1Y64A 1Z19A 3ENHA 2PYJA 3AQOA 5KFFA 1S7HA 5EUHA 1EB0A 5HN0A 1G15A 3LWLA 5E26A 1QSSA 3Q7BA 1CC8A 2ZF5O 4A4JA 4UB6U 2LXUA 4YY3J 4GXIA 4FWOA 3KZIU 1NGDA 2FZGB 3ZETB 3MABA 3EUNA 1CLQA 4OX6A 4LFCJ 4EFAC 3GFYA 4KH4A 8ICUA 3H42A 3QT5A 3J80U 1WD6A 2MKHA 2Q66A 2JEGA 3OUYA 5AQVA 3LZIA 1BA1A 3QRPA 4CHZA 2DNNA 1N5VA 4ZJLA 4NXMJ 4I2QA 3OTQA 1LV5A 3OR2B 4X4SA 4BR2A 2BJ3A 4JHDA 2K7KA 4K4WA 2PKEA 3T1HJ 3BSCA 2HVHA 1QQMA 4OZLA 5AR0A 4BG8A 5GIPA 4XA5A 1SIJA 5AI8A 1Q7LB 1HRHA 3CC7S 2ZWOA 4PXDA 2P9LA 4UOHA 3QLHB 4KGZB 3HF5A 3LH2S 4IQWA 2FTRA 2R8JA 2V68A 3Q8MA 3MM6B 4C8MA 3DRYA 4ECRA 4EEKA 1L3SA 2V7YA 2RRBA 1KEJA 4KT0C 5CD4H 2QWNA 4Y1DA 5HQMA 5AFUA 1AT1B 3D6FB 5IILA 3M6ZA 2XQCA 3AM9A 4IRKA 2ADCA 1PVPA 2H51B 2KT2A 9RUBA 2CJKA 3OYKA 2Q0UA 5E3RA 2ZIXA 2CAJA 2CQ4A 2JX2A 3PYDA 3LDNA 4K8RA 4NLKA 3GYGA 3C94A 4B3OB 2XSJB 2NXUA 3IO1A 3UPFA 3G8SA 3ZDBA 3AAPA 1IKYA 2V8GA 2H5EA 4WF9Q 4HTLA 4JI7J 2RE2A 3KLEA 1RA6A 2HMPA 4YY3F 1XIQA 2GMJA 3CCSN 4PPXA 3EL2A 4J91A 4CJVA 2RJZA 3MCNA 1ILYA 3SCLE 4RNHA 3DHXA 2G9OA 2D41A 2QTDA 5AKGA 4HH0A 4NXMF 4OPKA 2YMQA 4O3SA 4PEOA 2CYYA 3GFKB 2L3MA 2W3SA 4OGEA 3I4PA 3T1HF 3QBXA 5KFUA 4YS2A 1EQYA 4FJ9A 1FK9A 2MDAA 2HNDB 1JKHA 4BCAA 1XQSC 3ISBA 2A1AA 1RT3B 3CMAS 2HFVA 4QZ8A 3O3GA 4YNQA 3M4XA 5B0CA 1A7GE 4DQ8A 5B08A 2CJQA 4KJIA 3EEQA 4PGYA 5A6WA 5A2QU 4NCGA 1Q3VA 1KN6A 1APSA 3OYAA 1ELOA 3H40A 4B3MK 2V4JB 2W2OP 2AKWB 2PBDA 4CE6A 4L8RB 3MCAB 1FFUA 2HGLA 2KXFA 3AD8C 1G3OA 3D7EO 5D0HA 4NLUA 1WSRA 3NRZA 2XMMA 2KRBA 4JI7F 4XUSA 4MF8A 4U7UD 1KC8T 1EKRA 5HRNA 4ED2A 2GNKA 2KP7A 3CD6N 1AB8A 4CJWA 5KRTA 3IDWA 1PJ5A 3AQPA 5KAKA 2OEJA 1RPLA 5J0PA 5HP1B 1NGAA 2QLWA 3C21A 2JHEA 3LDPA 1NHVA 4USJC 2M7SA 5DS7A 5HRRA 4CZHA 3FZKA 3DJCA 4H4OB 1D9FA 2HQ3A 1N36J 1P8GA 2YMMA 1SWWA 2JH3A 4MN4C 5AZJA 3RMDA 3CTRA 2UUBF 1T03B 5ALLA 2H5IB 1RB0A 4LF7K 4TURA 3THXA 3EDQB 2MQPA 4OKKA 4B9TA 5KFVA 1U1KA 3BS9A 4HACA 1J9AA 5J1NA 3CNQP 5I42A 3QZ7A 3ZZUA 2WVCA 5JS2A 3OYEA 2B4OA 5I3PA 4BREA 1LCUA 2OYYA 4JV5K 2LYAA 5B66U 4CLSA 2FJEB 1TMJA 3SDEA 3VAHA 5LSLA 4TNOA 4OO1J 2H3ZA 2K2PA 2YV0X 1BVSA 3CJ1A 1WOSA 1Z4NA 1KKXA 2NPIA 4F5OA 4NLYA 4TU9A 2VKRA 2VPYB 2GELA 3C14A 1NB7A 1UVNA 2HOIA 2AJQA 1UJ4A 3BS5B 3C6TB 4BRFA 2ZD1B 3ONQA 1TUGB 2Q3SA 5A0YA 2WW4A 4TU7A 1UVJA 3RRGA 1SQGA 2FJAB 2YNGA 4B9LA 3S9HA 4I2PB 1TKTB 5FDLB 3DOMA 4Q2LA 5KAIU 4MQ3A 5AICA 4Z4EA 2DR8A 2CQ0A 4F92B 3H0MB 3AVAA 4OYWA 1SV5B 4DCCA 4DUYJ 2E1RA 2GGPA 4NA2A 1BUPA 2XS2A 1SL0A 4Q8EA 4WU3A 1B99A 2JZ5A 1QAIA 3RG6A 2QGFB 3TVYA 1UT5A 3N6MA 4FJIA 5BPMA 3IP4B 5DKWA 4FYXB 4KGMA 4IWVA 4ICLB 4QJFB 3B82A 4DR4K 4KV8B 2W8LA 1GMUA 2OD6A 3QO9A 5J2GA 1HNZK 3RU0A 4OX8A 1U2RA 2PMZF 1RCHA 1IV8A 3CCMS 2C2MB 1ITPA 2NRRA 2G8WA 1ZQPA 2IPOB 4DBQA 1N88A 3ETLA 2HBMA 4LREA 5LOQA 3A8YA 4EEYA 4R0EA 1O1WA 3H3OB 2DFFA 4PHPA 3ZTSA 3ZZTA 2O8CB 4DXLA 5EWGA 2ZH6A 5B09A 2XB2D 1IBMK 4CJEA 1FX2A 4OV6A 3NVYA 4MO5A 2QSWA 1EXQA 4CJ5A 4J9QA 3JXUA 4BDZA 2I2YA 1I5OB 4FCYA 2DISA 3KNAA 5GADI 4QWDA 1XUPO 8ATCB 4EFHA 3DEEA 3NBPA 3GWCA 2KKHA 2VQFJ 3W66A 3IBWA 4FLVA 2X1AA 5ALUA 2PIIA 8ICCA 3QFPA 4P0QA 2I6XA 4FO6A 1RT7B 3UNYA 5A8KA 3C16A 2EBGA 2YX1A 4R5PA 1HNVB 1NMNA 4F02A 1EX8A 4PWDB 1RABB 3VZHA 3GFHA 5AM4A 3PW4A 4X64K 9ICXA 3QNOA 3DRSB 4I29A 2F9TA 4OPAA 4JAXA 4LF8J 4G1QB 1HIWA 1HYZA 4WKYA 4EU0A 1RADB 1NI3A 1R6YA 3LVWA 4RWXA 1BQMA 3LDAA 4CH7A 2FBXA 4ETXA 4OI3A 3MEKA 4WYLA 3H08A 2HIYA 1FDDA 4WK3A 4N76A 1SH2A 5AK5A 2VBYA 4DSKA 2W43A 1R0AA 2HZAA 1S4FA 4YY3K 3O9UA 3SJHA 1FWLA 5KFAA 5DM7L 2ZOMA 4EBCA 2WB1F 1UKUA 3OYMA 4LFCK 2ATQA 3C65A 4BC5A 3FQKA 2A1JB 3PFOA 2DTJA 1ZOLA 2LM1A 3RF9A 1F5AA 2VBWA 2RHKA 3LAMA 4NXMK 1PILA 2DEIA 4Y2XA 4ZJOA 4P75A 3WC0A 4RQ3A 4DL2A 4MFBA 3ZT0A 5EX5A 3MM7A 3G6YA 2VQFF 2V8VA 1Q86T 4H5NA 4BRHA 2ZDPA 3THYB 3M1VB 3JPSA 2AJ2A 2DCLA 1YLXA 4C8OA 8ICAA 2BW7A 4NEZA 3PKMA 2P9PB 4I2AA 2H5JB 1VQ5N 1NSKL 2FMSA 1U0HB 1FRLA 2MLXA 1CULA 3DMJB 2QI2A 3KWIA 3L6QA 3GIIA 4CIEA 4BGAA 1JXEA 2LXIA 1RDDA 2DGXA 3T1AA 2C2RA 1QZ5A 1FE4A 2AXTU 4CT9A 1TAMA 2CGJA 3K5PA 1HI1A 2DR9A 2V8DA 3LA0A 4LF8F 3A8IA 1L7OA 2FPKA 3MECA 2DNLA 2BX6A 4JI3J 1NJWA 5KFMA 3BSAA 2HS0A 1JLBA 3WKCA 2W04A 4WFXA 9ICOA 4LBPA 4GO7X 4GIBA 5IQ6A 5DLGA 3L7PA 4JI7K 4UB5A 1YG0A 1ZQBA 4ZK7M 4QU6A 4PL2A 2O8FB 1ZQSA 4ZS6A 4CP5A 2XBPA 4C4RA 4CNQA 4PHEA 5AQRA 3UI3A 4LFAF 1BQXA 3U9ZA 1TVRB 4YD1A 1QY7A 3BB5A 1S72S 3SMSA 4MFAA 5IT9U 1HNIA 2ZDOA 5D0GA 1VQKN 1R27B 2MQ8A 4ZN3A 3W5XA 2OEMA 4C8NA 4I6YA 1NG9A 4TUSA 5J0TA 2MGZA 5M2RA 3RAQA 4XIUA 1SH3A 4RG8A 3EE9A 4KHYA 3I28A 3F9MA 1IV0A 2Q4TA 4IFEA 3WQUA 3AA8A 4KKOA 3Q89A 1RAGB 3UNGC 5J0RA 3NGDA 1Q82T 2NRVA 1NRKA 2Y9UA 2PO4A 2IAJA 1TKDA 2V4QA 1HBUB 4FZLA 2UXDJ 3NGUA 3QEAZ 1KVKA 5AM2A 4L3KA 3UVJA 4X4PA 4PKDB 1YJRA 2KHDA 1WJ9A 3GJTB 4IKFA 5CRXA 3ET6B 4RQ0A 3EKSA 3W2WB 3NGTA 1X9XA 2FVSA 1VQ8S 4NRTA 2DO4A 3G82A 1LXJA 3H5YA 3G9CA 2F7TA 5IIMA 2WHOA 3HFKA 4GMJB 1BY9A 2YWFA 1RBAA 3VQPA 4LF4F 1HI8A 3HZGA 1JRPA 2ILYA 5KOXA 1V6HA 1N63A 3D9BA 5A0LA 3IV6A 2F2AB 4YXJA 4M5JA 1N36K 3G6ES 3HCXA 1S0OA 3E9LA 4RPFA 3DAWA 1TV6B 2E8PA 5ADXH 2BPGA 4WP9A 1UEUA 5D4BA 3ENQA 1NJIO 3DXKB 5BN9A 5KFLA 5IINA 2A3JA 1UVIA 5L9XA 2UXDF 4ZIWA 4K5RA 5ALEA 3PX6A 4KN4A 4QAGA 1GXTA 1RJJA 4HUEA 5L38A 4CZKA 2W9CA 3GU0A 1D09B 1TGOA 1QAJA 1UETA 3AO4A 5J2DA 1SC1B 1VDHA 5JMVA 2ZH8A 2WBNA 4AT1B 2LM4A 1WG1A 1S9EA 4EO6A 5M1QA 4WQ5A 4AUKA 1J5EF 5E3CA 1DY3A 1B0PA 4BQLA 3L09A 3MM8B 1AFJA 1X2IA 4BBYA 2FPLA 3T41A 4A48A 1X4FA 3T79A 3M6KA 3VF2A 4MKAA 2FB0A 2IOHA 3KOAA 3LP3A 5D4PA 2Y1IA 5HROA 5J8YA 3BQTA 1Q18A 1RXVA 4J2BA 5IIIA 4WJ3B 3OFFA 2E3TA 4WQ4C 4OLPA 2IOFK 1JMTA 2ZE2A 4DUYK 4F7VA 1WDTA 2F4FA 4H8KA 3VMFB 3PO5A 2ZWPA 3I5AA 2DNQA 3NGSA 4CTAB 5KQ8A 4UOGA 2V2VA 3BSOA 1HQEA 2YX6A 1SJ4P 3BH7B 4EX6A 3BGOP 3MR2A 1CJKB 2D3UA 2E29A 4ID5A 3SSQA 4LSNA 2HDOA 4NLBA 4AM7A 3MR5A 3THPA 4JEPA 3MFHA 2IRYA 4F3OA 3IGVA 2QO3A 4K43A 2OPQA 1U7LA 2KM8C 1TFRA 7AT1B 5AQJA 3LOUA 3P8BB 1Q81T 3MC1A 2HRTA 3QIOA 1YI2N 3TTDA 3AVCA 1FHTA 4O0JA 1LOUA 1VRTB 1NKCA 1PIEA 4OHYA 4TLRA 2HHHJ 3ZDCA 1EETB 2FBTA 3L95X 1QH9A 1KFDA 3DGPA 3OHRA 3AO3A 2FPHX 5J2CA 3G4SS 5AQPA 3QU9A 3SQOP 4QYZJ 1YQHA 2DK2A 2V94A 2MQNA 2ZNZA 1FEZA 1NSPA 3AVIA 3DRPB 2VQFK 2QWPA 3SBTA 2D1CA 2OLWA 2UP1A 5HVFA 3ZDAA 3VQ6A 3JB9k 1UOCA 1DTTB 2EI5A 3PYGA 1XWLA 4IQMA 4MH8A 1IR0A 1S6PA 4L75A 1HD0A 4C4WA 5H1SV 1ZPWX 4LF8K 1HYSA 3DLKB 3BBFA 5HLFA 1U6BA 3OYHA 2OPPA 1M1GA 5IIJA 4J9NA 1VC6A 4FJHA 1BLUA 4O0IA 5HL7Q 8ICBA 3LM2A 3J81U 3RMAA 2QZ8A 3MCSA 4LQ9A 2F8SA 4UY8T 3ONNA 2BW2A 4J9OA 1RDUA 4WFAL 1VQ7S 1GLDG 4CE9A 2CQ1A 2HHHF 2WONB 3IBCB 2H3GX 4ZIVA 2OUGA 3H2LA 5AQMA 2OTJS 3IG1A 2MQOA 1Q53A 3UKRA 4IKAA 3B4DA 1Y7PA 2P51A 4RPYA 3TZYA 2XNRA 4QR2A 3HPGA 3FM9A 4M9HA 2RRAA 5AQXA 2DKXA 1N5XA 1U47A 1XR6A 3A0BU 2GWSA 4YB5A 3SENA 4JB3A 3WKBA 2BA9A 4ILMA 4WXWA 4Z4GA 4FZVA 9ICTA 4C48A 4JKGA 2IC3A 2DKOB 2YKNB 4DG1B 2EFNA 4YOWA 3NFAA 5J2PB 3PIOQ 2BQRA 1ZOTA 1K9MO 2Y1LB 4P7TA 4JK7A 4E8UA 3IRWP 2QA4N 2KJ9A 5CCMA 4KIAA 4U8VA 5MLCV 1JX4A 4TY9A 4BWMA 2KT5A 4CJ7A 3FSYA 5G0RA 2VQEJ 4JI3K 3O08A 1TL1B 2VF3A 1WHWA 4A8XA 2R7WA 1K73O 4HI1A 4CGFA 4JKHA 1Q7YO 2KKPA 1U8SA 4I67A 1FXXA 3B8AX 4JI0F 3BR8A 2JGUA 3Q22A 4OJ6A 4B8CA 4PQUA 1FO4A 2CFXA 5DBBA 1ZQVA 1WKKA 3ZO7A 3BQ7A 4GVLA 5C15A 3KHHA 4KHUA 2ROEA 3ZD9A 3V81B 1JLCA 1CZ9A 3I5CA 4URQU 2CNLB 2CVIA 3TZWA 2YY6A 1BIUA 2KJWA 4LSLA 3BGUA 2LQ9A 3MWTA 4RW7B 2MY8A 4ILHA 2PI4A 4MEYA 4X4RA 1BISA 2E5JA 4ZVTB 1N5TA 4OFZA 2DPIA 3Q0AA 3DXMB 1UP1A 4FLWA 1I39A 4QOZB 3NF9A 5E84A 4DWIA 3KK3A 4YOVA 2QEXN 4OX9K 3NL0A 2DH9A 3PSPA 2ZNYA 8ICLA 3OYGA 3WHIA 1N33J 4I2QB 3KK1A 1Y88A 3DYAB 3QJPA 1WHYA 2Q6BA 2CQHA 1JN3A 5AXMA 2CG8A 5D3GA 5LJVA 4PZOA 2VQEF 2H3EB 1LK5A 2E9RX 4CIGA 2BM0A 2QV6A 4KMOB 1L7PA 2MKKA 3VAGA 1FRMA 1PK1A 3DGVA 2LLZA 2XGQA 1VHXA 4FXDA 4DU3A 2DIVA 4B8AB 2BGWA 9ICMA 1S1TA 1YUWA 2NUHA 3BO4A 3QUBA 4L72B 3T5KA 3VQ5A 5FJ4A 2F3JA 3KTQA 2I5JA 5M1FA 1X9JA 1Q8IA 1X4HA 3DKDA 2Q2RA 3S7RA 5J0UA 5A8WA 2M5YA 5C7PA 3FSXA 2XRIA 2ZIXB 5LMUK 2HGMA 3S6JA 2B7BB 1HWKA 2A42A 3BV8A 3ELHA 5J2FA 1YBAA 5TZVA 3K9KA 3N5BA 1YJWN 2JEIA 1QTMA 1K47A 2DR7A 1T05B 3VAIA 1MMDA 3TW0A 4OLBA 1ZQMA 1N33F 1O6XA 4NCBA 1PZNA 3V9UA 3PMLA 4KN7A 4YQWA 3CDEA 5F0WA 3TOQA 2ZC4A 2OAUA 2A3ZA 4RNFA 4DCJB 3MOJB 2JRSA 5D0EA 2ESEA 3DDHA 3H5UA 4YOTA 2HVDA 4M8LA 5IT4A 4DOBA 2JWKA 2ASYA 9ICPA 2IDLA 5GAGU 3PSIA 1VCTA 2OA8A 5J2KA 1HBMA 2I9SA 4RNNA 4TQRA 4J9SA 4JB8B 4ZPBA 4O3NA 1KVCA 2Q97A 3EVMA 2DNOA 4J7CA 1JK9B 2KL8A 1LK7A 3AODA 1JWWA 4KTZA 3ILOA 3R1LA 3KNGA 4ENOA 4DL5A 1VIOA 1X9WA 3PIPL 4JI6F 2AD9A 2BXJA 1NK8A 4BGBA 3HJVA 3AQEA 3I0RA 4OMFG 1N54B 7ICNA 2FJ6A 2ABYA 5FIIA 4MLHA 2BE9B 2YWGA 3TVKA 1NLKL 1RG6A 2XLIA 3QERA 2DL0A 3AXMA 4H5TA 3NS7B 4FWQA 5J2NA 3U26A 2NS1B 5KNIA 2D6FC 3BKFA 4W4MA 3ILLA 3NGYA 2E66A 4QS7A 1IKXA 3GQCA 2BJDA 4ZA1A 4XPEA 1FDNA 3M32A 3LANA 1RDFA 1JI7A 2WTUA 1IJJA 4RQ2A 2VJVA 2ZH3A 4AQYF 4BRKA 1D0EA 3MAAB 4UARA 4ZP7A 1FRJA 3G87A 1S8OA 3P49B 5J2BA 2LMRA 2HAFA 5G5GA 2J9DE 2X78A 2OMOA 4CF5A 3AUOA 1UWBA 3QT7A 1F5CA 4GRSA 2H4YB 1Q5YA 4A8MP 2KEYA 4OYAA 3ENAA 1U4BA 2KICA 2DRBA 4MMOA 3WKAA 3HT0A 2E44A 3KK2A 2E2OA 2Z1IA 4OKEA 3HP9A 4RQ5A 3A5OC 3O5TB 4GV3A 3LDOA 3WEEB 3GJSB 3TP2A 2R8KA 3AY0A 3IKMA 4QYZK 2ZC3A 4IH6A 3BO2A 4DU4A 2FGCA 1WC3A 2N3LA 1VQLN 1EP4A 1WTFA 5AE2A 4DUZJ 2ZJQQ 4LFBK 2MY7A 4P2HA 2JC1A 4FYYB 1SKSA 1H3DA 1ZA2B 3C14B 2P5VA 4FOEA 3MX2A 2XMTA 2KVIA 4CM2A 4BRIA 4NLCA 3DM2B 1LFWA 4HCCA 3CCJN 1LWCA 5A0YB 4DV0J 3IWLA 2YNGB 2BMBA 2E1MC 4BLGA 1KAXA 3UKUB 1RISA 1HLWA 2BV3A 5ETVA 4W5NA 5ALIA 5HJYA 2LA4A 4Y2YA 1YTUA 2J0XA 2APOA 3DC2A 1TP7A 5IFMA 4DV7F 3RYLA 2GGPB 3R8EA 5CXTA 4DUTA 1VQ9N 3IGNA 1ZQNA 3ZSYA 3P96A 2D0PA 1MDUB 1R8CA 3DV9A 1HLUA 1TU0B 4ZPWR 1T9TA 1WSGA 2RQCA 2K4EA 5F9LA 3SUNA 4XO0A 5F3TA 3C2MA 2HOFA 4DSFA 3QO9B 3GP9A 3E9OA 2YCHA 1W7AA 1ZA1B 2FBVA 2O8EA 2QKKA 1U1MA 1R8AA 4CFDA 2M0GB 5JJBA 3K5NA 5ETOA 1T94A 1WG4A 2HHVA 1RA7A 3H8WA 4BC2A 1CXUA 4DB3A 3E3XA 1VK8A 3HD1A 2P9SA 8ICKA 4NLDA 1UPPA 2A3VA 3CCUN 3N97B 1VC5A 4EELA 3D1HA 1XO1A 4DV0F 3BO3A 1VRQC 3HM8A 4HHHA 3W62A 3VALA 1NJXA 2GX9A 3LPEA 2WVFA 2C2EA 3OBYA 3EDRB 3M6UA 4BRNA 4C3KA 1LW2A 5HBMB 1D4XA 4C4SA 4KLSA 2ZM6K 5I9EB 3H25A 4UAUA 1FRKA 3ZEUA 5KT5A 2VQEK 1KQQA 3PHTA 1VQPS 3H4BA 3O2IA 3QEPA 4AXJA 4QZBA 1CQNA 4HYKA 4P0QB 1FVQA 1KAZA 3GZ7A 2ES6A 1TVAA 4M3RA 5A8KB 1QUPA 3C16B 1X4GA 1FIQA 1CRXA 1FKPA 2MXYA 2D4WA 5KG3A 1FNMA 4I2EA 3L3CA 3UDLA 2KIVA 3IWXA 3VAMA 4O0NA 2MKSA 1T3NA 4PYDA 3DLRA 3SMPA 4OYIA 3Q86A 4YEAA 5BRFA 3NWRA 2W42A 2HNZA 3IA0A 4TY8B 1VLOA 3C8YA 3H8YA 3F56A 4DEZA 1ATNA 2RLTA 4CF4A 4QZHA 3GTYX 2AGPA 2ZWHA 4HT5A 1F1BB 3WU2U 1T11A 2DIUA 2RSQA 3OS2A 2NZ4A 1NB2A 4M9GA 1RBVA 1GMVA 3L7OA 4I2BA 3D67A 2ZIUA 3D3BJ 5TKWA 9ICHA 3K1ZA 1YSJA 5KFCA 8ICJA 3D6TB 4NB4A 1VLBA 1NNDA 2IJFA 1N33K 1IR2A 2V8HA 2OFGX 1S1WB 4FWSA 2QARB 2J6UA 2DGOA 3ENWA 4MFBB 2P1JA 3MGHA 1J2NA 4RW4B 4IUFA 2KTQA 1HD1A 2DBBA 4G1IA 4ANDA 1QM9A 3CC4S 4DSJA 5J2QB 4CCHA 3A1YG 2Z4PA 2V8PA 2VFTA 2ERRA 4DSLA 1BG3A 3RH6A 4FLTA 2QA1A 4CHNA 4EYIB 3MDQA 4CZJA 1N34J 1W2IA 3H5XA 1UVKA 1GLFO 5DGAA 4U67Q 4ZCIA 1TYQA 2FBYA 3OTBA 3MECB 3I8BA 2M9NA 2K4IA 3IR7B 2RDJA 3KUGA 4USMA 4KH0B 3MN9A 2VCPA 4DU7A 3EPIA 1ZYQA 1WNSA 1WOQA 5E0OA 4G1PA 2RS8A 4C4TA 2CJAA 2KXNB 1VQNN 2WAQF 2I1RA 3K57A 3CC2S 1HWUA 3WNEA 1K5OA 4P72A 4EMDA 4FF2A 1AYEA 4OJ5A 4C0BA 2QYGA 2VFVA 4EIAA 4O5EA 2VB6A 3BUZB 5GMDA 2Z58B 1DEJA 1COKA 4FLXA 4AXIA 4CEAA 1KSPA 1R31A 1XNRJ 2F9DA 2I38A 4KPYA 1DK2A 1QDUB 3O3FA 4KLMA 1J54A 3ZNUA 5FRNA 3RJIA 5B5EU 2MGZB 3MMBA 1HYVA 3W1YC 2AA4A 1YIJS 9ICBA 2Y9TA 1KW4A 1CG2A 2MHNA 2ROPA 4FWKA 4IR1A 2YNIA 8ICFA 2YX8A 2PI5A 2LFVA 3ZTOA 3UMGA 3CIMA 4CBUA 2EX3A 3RB6A 2ZUAA 1RBLA 3ZD8A 4PG8A 1QQNA 4CD1A 3J7AN 3HX0A 2ACMA 2DY1A 4FFDA 4U7CA 5LJ3Y 3UE2A 2G5HB 5E3AA 2NUBA 2B8QA 2FSNA 4JUZA 5LJ5Y 2IS3A 5EE9A 5HRSA 4M2YA 3QYPA 2P6UA 2MUTA 2XYGB 3UVJB 4Y2RA 3TEGA 3BQ0A 3PHEA 1Z4OA 2GHVC 4HVZA 3QNNA 2FC8A 4K8XA 3R1HA 4FM0A 4E7LA 2BQUA 5LJWA 1WAJA 3PW7A 1S0VA 1ZQLA 2YVSA 3HKZD 2FLNA 3OTCA 4BE1A 4JWMA 1WEXA 1X4DA 4KH1B 3J81j 3CG7A 1MU2B 1NAQA 3TEHB 4A8OA 3G82B 3IC1A 5DJBA 4OI2A 3WBZA 4NL9A 4O4GB 3GSIA 5F1XA 2WVBA 4F5QA 1L3UA 2MHEA 2P9CA 1FVSA 3VC8A 3RJHA 1MMNA 2HG4A 4KBIA 3B9JA 2BCRA 3CCES 3J7Z5 2G8HA 2WTFA 4ETZA 2R2TA 2KN7A 2FF3B 4KMUA 1JLQB 3K7RA 3K9JA 3Q8VA 4CDGA 5AKXA 2COLA 2V2ZA 5E5NA 1XK8A 4AL5A 1VDVA 2PA3A 1XNQJ 2RKIB 2OCEA 3IFEA 3CCLS 1YDLA 3BDPA 3WX8A 1U02A 2AWZA 3MCMA 3W9JA 4OKJA 1B0VA 1WC0A 4OHXA 3TWHA 3S1TA 3H46O 3PACA 3ZZZA 2FHOB 2W9CB 1SV0A 2UUCJ 5B0DA 1ZAXA 2KJ5A 5ALMA 3M1YA 2F77X 2Y8WA 1A5VA 1H73A 1NGFA 2YXLA 1S9EB 2IM3A 1D1UA 4DUZK 2FIUA 3C0BA 2IA6A 1V5IB 3AARA 1R8PA 2K1RA 9ICNA 3RAXA 3BZKA 1WACA 2Y0SD 4CZIA 3O4NA 3LW5C 3WX4A 2NLWA 3C5GA 4DV5J 5AQFA 5H1SQ 3G8QA 2YX7A 2B9YA 1H7WA 3BGRA 3SR6A 3HVTB 5HROB 2K89A 3D2SA 1FXRA 2HK3A 4PCQA 5ADXA 2KVQE 3E01A 1EARA 2OIHA 4QCLA 2W7PA 2M70A 1M1KO 5J29A 3MDCA 1XNQF 1DGJA 2W03A 1CLFA 3LALA 8ICPA 4YN3B 4DL4A 3QIPB 1ZM3A 3NS5A 5SWMA 2BVZA 4AHTA 1FESA 3QDKA 1Q0NA 2GVDB 3E51A 4CI0B 2GA7A 1X42A 3RRKA 1NK6A 3D7SB 1BI4B 3PNCA 1XS9D 2E4LA 4YDUC 1RILA 3CP8A 8ICMA 2F7VA 1WSIA 4U7BA 1HEKA 3SQ4A 4JI2J 2DNKA 2FHKA 2UUCF 1S76D 3J7ZO 5J0QA 1H72C 2GJFA 3MD1A 4ID8A 4NI2A 2WC9A 1DQ8A 3SV4A 1ITGA 1Q4RA 5CZ2A 2EAOA 3RR7A 3KLGA 4NOHA 1ZTTA 2I7NA 3SD7A 3FFIA 3F5AA 1C0GA 3BKUA 3F5TA 5J0OA 4OJHA 5L1IA 2ALZA 4QPTA 4CJLA 5MLCQ 4LJXA 2MJUA 1ASUA 3B6PA 3KLFA 4FPBA 3OL6A 2IVNA 5KL8B 4MFCA 3QU2A 3V5RA 1JJ2M 3CDBA 1JJ2R 2YMPA 3ZSXA 2NV3A 4HR2A 1R0CB 2LSNA 3E8OA 3IHQB 1ZQTA 2R8GA 3ZLJA 4J9LA 4WBFA 4YG2A 4AYBF 1GT8A 3PM9A 4QWEA 1A0OB 1K0VA 1RT6B 1GTHA 3KZXA 4W5QA 3WXLA 4H4MA 4OLOA 2QFJA 2AYBA 4BR5A 3JTNA 4ECYA 3EGNA 2Z2ZA 2LYVA 3N0VA 3ENOA 4H0OA 5KI6A 4BJQA 3GIMA 3FE1A 4FBTA 4GKJJ 1C0FA 1WWUA 4I2JA 2BRLA 3W3DA 4JI2F 1EIYB 2XI3A 3EXCX 1J97A 2MQLA 3CQXA 2V2KA 1HYSB 5HLFB 3MMCB 5GAHP 4AM6A 3NEKA 4QU7A 4TUQA 7ICGA 3MURP 2M9KA 4S0MA 4USTA 1AQ6A 1Q79A 1X6JA 3SIPB 2KKZA 5F8IA 5C10A 2ZJRL 4GC7A 4USWA 1HPZA 4CO2A 1FRIA 3SAGA 1P9QC 2JSXA 2CQBA 3QNWB 1NKBA 1YKWA 3HULA 2EK1A 2VASA 2DKZA 3MPUB 4P4MA 2LU1A 3HW8A 3TVZA 5L39A 4HDGA 1F9FA 3QBWA 3IG1B 2GO8A 2QL9B 4B08A 4BVOA 4CK2A 4E7JA 1U9LA 3UKRB 1XSPA 5J2AA 2EFPA 1X9MA 1R7IA 2A18A 3MCPA 3N4PA 2CQ2A 2W9AA 2W24A 3BKTA 3PJXA 3S3MA 1Z25A 3H3NO 4ZLPA 4K7QA 2DITA 2JLFA 5KFGA 2QWQA 1X5SA 3UQSA 6FD1A 1RHJB 1MN8A 4JKGB 3POTA 1JIHA 2QXFA 3AJDA 2HSTA 5DBAA 1VISA 1LVHA 4JI4J 1OY8A 4XQ8A 1QAXA 4CJ4A 4ZKAA 4TSXA 4GKJF 3H1QA 3QFUA 2KLAA 4KH6A 2DWQA 2BZFA 3CCSS 2E5HA 5DDOC 1YJUA 1N34K 3OW2M 2EWSA 4F4KA 4Q44A 3C6UA 4BRGA 5GADP 2KYXA 4CERA 4O44B 4KFBB 4ACOA 3H2VE 4KI6A 3OS1A 3BEXA 1JUDA 3PX0A 3NRBA 4M9JA 1HUOA 2N7CA 2IVOA 2YTCA 2KVSA 1SBRA 1NGGA 3DCAA 1VR6A 1WHVA 3G71N 3Q8LA 2G2ZA 4RW6B 4O3OA 1RWKB 2QJ3A 4UY85 3V4IA 4KH5A 1RAOA 1JLCB 4JRQA 2E2PA 3AA4A 3KKAC 4M5DA 1SQEA 1RQ0A 4LIRA 4AHCA 8ICSA 1E6YA 2MA1A 4QOTA 5B0FA 3CJTA 3O9TA 1XNRK 1HMVB 2E2QA 1YJVA 1YJ9N 1LFPA 2IIRA 1UEKA 3FBFA 4DTSA 4V19X 1BUXA 1TL7A 4DX5A 2R7TA 1V4TA 5MAOA 4CHQA 1PJ7A 4JI4F 1IQZA 2PN6A 3QJLA 2ZJ8A 3N5FA 1RTHB 1N32J 4UAVA 3HILA 1OKJA 4J03A 1NBEB 3CQ8A 4CQ1A 2OTLN 4KHPJ 1GK8A 1L5UA 4FDFA 4MIWA 3QGGA 1S1VB 3AXKA 1WOOA 1RCOB 1RAAB 4MK7A 2KHVA 5AKHA 2AP6A 5D3GB 1XNSA 4GV6A 1Q8BA 3WK8A 3DI6B 3R7NB 5KG4A 5CWRA 3NF6A 2DXDA 1S1TB 5F0UA 3MMJA 2HQCA 1HKGA 4WU2A 3VAJA 3SI6A 1C20A 1JLFA 5CR4A 4I6MB 1DJ0A 4PL8A 1NU0A 1VBKA 2FSJA 2W01A 2I5JB 4Y2VA 2DH8A 3HRDD 2GS8A 3MPYA 3KMQA 1CC7A 3Q8UA 4X2BA 3IRUA 5A8WB 1MROB 2B4UA 4HI2A 4IQUA 3G86A 2RQ5A 4X66J 4PABA 4Y2AA 4LY7A 3V6DA 2B6GA 2YY3A 1K8AO 4ID1A 4H5WA 2AYMA 3V1QA 3G2XA 1A6LA 5EDWA 3LDSA 5CEHA 4LD0A 1RUSA 3T7ZA 5KFRA 3T5JA 1O0PA 2P66A 1U2FA 1N32F 1MWZA 2AU0A 2OPRA 4RU9A 4KHPF 1WC4A 2AP1A 2Q0ZX 3KKRA 1GOAA 3V72A 2GH1A 2OFHX 3PLAA 3ATVA 4KHQA 3N7RC 2QLXA 2CJBA 5K9FA 4KSEB 1T9WA 3IDHA 1MA9B 3U8XA 3KD5E 1TUUA 5JU5A 3NH2A 1RT1A 4UAYA 1PO6A 1VSHA 4J9RA 1GH8A 3L0QA 2BDPA 2UUCK 8ICYA 4CFAA 2N4DA 1ACMB 4NLVA 1S0MA 2JL9A 2K8CB 3RGIA 5GADU 1HBMB 4FOIA 2IFXA 4CJFA 1ZC6A 2GCFA 1VQOS 5KPRA 2XHCA 2VWJA 2ZJ5A 1ED1A 3QT8A 3S3NA 4DV5K 5DGBA 3RWUA 4P2XA 3FRYA 1URNA 4P4OA 2RHQB 4ATNA 4RW9B 5ITHA 2V34A 4LVOP 3VQ7A 7ICTA 3RSEB 2EW9A 1IN0A 3OJUA 3C2KA 3N4MB 3AGKA 2BZ2A 4OHVA 4NJ8A 5D15A 1X3NA 3KBBA 4KHNA 1WSJA 2RD5C 2KT3A 2POKA 4M63A 4TUPA 3UIQA 3SUQA 1QQ5A 2QL7B 1SC6A 3U7JA 4G3IA 4WE1B 2ISOA 1S49A 3JPOA 1XSLA 4EZ6A 1FTCA 4QPXA 3D68A 2NSCA 2F1JA 4KB7A 1TL5A 1GXUA 5AQNA 2HSEB 2VZ9A 3CC7N 4KX3A 2FYXA 4KLHA 4RBTA 2YQ0A 5EGYA 2D0AA 3UDVA 3CM6A 1ZBTA 5FPEA 2B9WA 2LMIA 2RNEA 2VOOA 2G09A 2CQDA 1K8KB 3O1LA 2B8PA 1HL6A 4BC4A 5AKZA 3HHLA 4PG4A 4H0TB 4U7UK 1UWBB 1SJ3P 1DGSA 3UR3C 4EP4A 1XTZA 3RFAA 3DLEB 3TRGA 2KRRA 5K8MA 2VBZA 5ETSA 4B3TF 3ZI4A 3KK2B 2FJVA 3D0PA 2FZCB 4J9KA 1NMEB 1UAXA 3NGIA 5ALJA 3K5MA 3TAEA 2RQKA 1OY6A 3KHRA 1M5HA 2DHGA 3HKWA 4FWMA 4CLFA 3PTWA 5GAGI 1XR5A 4Y0WA 1BOTO 4R79A 4KREA 2JZBB 2CQCA 4C6AA 4JKDA 2PYLA 1YX2A 2FMPA 9ICJA 1B92A 4DF8A 5CYJA 2UXBJ 1D9DA 3H1VX 2JR5A 2Y0BB 3OLAA 3QGHA 4A5BA 3MXJA 3VTHA 1LWCB 3CCTA 1E3MA 4EWTA 1WWVA 3N7SC 1ZAVA 4G9BA 8ICOA 1TUYA 5IC4B 1Y5LB 2HMXA 4NYZA 1F6TA 1Z05A 3NF7A 3B0XA 3ADAC 1UEVA 5K20B 3IS9B 4IOXA 4N8NA 4C7YA 2E88A 4LH4A 3TAQA 4AD6A 4F4AA 3AN1A 1G7CB 1MLAA 1REGX 4OL8A 2IMOA 3WKEA 4OZJA 5GTIU 1TUVA 1X8DA 5KFQA 3CO9A 3BS7A 1LW0B 1HR0K 5CQGA 1RBUA 2AIRB 4DR6K 1SZ2A 4TU8A 3D2EA 2IBOA 4A8FA 4E0DA 1BNOA 1RZMA 1VQ5S 1NJIT 4PXEA 1NM2A 4CEEA 1AROP 7ICOA 2O8EB 4RQMA 3SQGA 3VVTA 1ZQKA 1V3ZA 4QW8A 1NZPA 2F40A 2Z7JA 2WF8A 5ALNA 3FZLA 1HX1A 1VGYA 2YBVA 1S6UA 4DV2J 2XICA 1J27A 1WC1A 4WYWA 3I87A 3GDQA 3IMQJ 3K5OA 3P1GA 1OH8A 2P9SB 2UXBF 5LXRA 1BPBA 4WP3A 5IV4A 2GQQA 2VG5A 2XMVA 4GVBB 3VQTA 2GAGC 5AI9A 2BCVA 1Y9OA 3M2UA 3ZT4A 1ZQCA 3T1YF 2XMWA 3A0IX 4M6WA 5T14A 3MEEA 3CCWA 1R43A 3B8HA 2R2RA 3G96A 4IEEA 3AOAA 3TADC 3FEXB 2RUSA 3RJGA 2RB7A 4C0ZA 3OVSA 4F4YA 3DU5A 4FKYA 2AJ1A 3CULA 2WSEC 3AVNA 5DDYA 2LEAA 1FFSB 2Q6CA 2NLXA 3TYTA 3P4IA 1IBLJ 3PEHA 2FMQA 3J81O 3TI0A 1YITN 1N0UA 3LM9A 2AYEA 3ZSQA 1RAFB 3UDEA 2P5GA 2CIMA 4X62J 3HSZA 3G8TA 3TAFA 1VIXA 3UWTA 1DOQA 3GPAA 4K4IA 2LKYA 1RYRA 4MLEA 3VQ4A 4WP8A 1KEKA 3R9KA 3U27A 2HNZB 2EC2A 4DV2F 2AYGA 4UUXA 1GQEA 4XH5A 1Z1VA 4AHUA 4R63A 4Q43A 2F4VF 2K8BB 1KLMB 4DHYA 4K4UA 3DLLQ 2EFGA 3C7NA 2ZKUA 1UAWA 3QEIA 4C7QA 1Y4ZB 4RKUC 5FROA 5IOLA 4FSVA 4ZPCA 3Q8SB 2VDHA 1EKEA 4KHPK 1RK8A 5L9NA 3CDUA 2NYIA 4DHVA 3EPGA 3ZT1A 3E9PA 2D0OA 4KLIA 4HH1A 2JLEA 2GQCA 3UQ2A 1RTZA 4QR1A 2K7JA 1RWPB 2IGIA 4WCEQ 2KZZA 4QWCA 2GZOA 1HFEL 1T9VA 2NO4A 1RI7A 3TR8A 3UD4P 3TUJC 3SSSA 2XI2A 1ZQRA 5T7LA 3D45A 4OI4A 1L3KA 1BQNB 4FWNA 2QKBA 3M9OB 2EFQA 3PMNA 4JK1A 3QE9Y 4L74A 4M3XA 4B3RJ 4MFFA 2FJBB 2WFBA 1EAYC 4M3TA 3IRXA 3VQAA 4CH1A 3A8EA 5ALDA 1N5YA 1G4CA 2B0GA 1X4AA 2YNFB 5K8NA 3CCMN 2AJ4A 2AGQA 4LIWA 1FXLA 9ICAA 2GEMA 4H4KA 3SEOA 1N52B 3UXOA 4X66K 4BRLA 1VQ4S 4KLQA 1S6OA 2JNJA 3QRRA 3CVKA 2DGUA 1L8LA 2ALYB 1GMWA 7ICLA 2KB2A 3QUTA 3TWZA 5ALGA 1WKLA 1CBKA 2OD4A 2FZKB 8ICNA 1TTHB 4UASA 3M30A 2F63A 3JAMO 1Q78A 1JL1A 4C11A 3BN7A 2OHFA 3A4TA 4IDHA 1FERA 1KTVA 4IZ9A 2NXEA 5ETPA 4FLYA 2GAHC 5JUMA 3OYDA 5DBCA 3HT3A 3V7LA 3D3CJ 4ZVUB 4BE0A 4P74A 2MEWA 2DQNB 4CF8A 3SBGA 3FFKB 1LKYA 2IM1A 2K8AA 1QE1B 2UUAJ 1KQKA 2Y0SC 3MMBB 4DN9A 1N6QB 3FGUA 2FVPA 1HBNB 5BYRA 1ZBIA 5SUHA 5J2MB 5C2GA 2NYVA 4Z7CA 4ELTA 2DNRA 3QEBZ 1YJNN 2HBYB 4B3RF 3G25A 3FJ2A 1M5OC 1YRTA 2CWKA 3SUOA 2QWLA 1P8ZA 1LQ9A 1RWVB 3N4QA 3DWLA 2DUYA 2O6KA 2NZCA 7ICQA 1K9MT 4CRXA 3O3HA 4M7XA 3ZZOA 4YFUA 2WOMB 3N4WA 3CGIA 4X4TA 5F41A 4DPOA 4TQSA 1K73T 1Y0HA 5IZHA 3CFOA 3NWGA 3M9MB 5AQHA 4WTYA 4EHUA 4GVEA 5AKLA 2RRNA 1ZQYA 4IFVB 2A6MA 4KLJA 5CYQA 5AJ3J 2DXEA 5DZ6A 3D6JA 1WF0A 1PBAA 1C0UB 1WAFA 1Y5IB 3KJNB 4GXKA 2QB0A 1YXQA 2KV2A 1WBDA 2W9MA 3ZZPA 1X0FA 1VMBA 3CM5A 1YI2S 1BCMA 1RSCA 5HR7A 5IQQA 3DHWC 4ISEA 2EEYA 2ODGA 2NO5A 1OYDA 2ZJPL 2IMWP 2PMZD 3CJ7A 1P1TA 4ZOHC 2FHJD 3F5EA 3LF0A 1W25A 5EHHA 4B3MF 2UUWA 4QZVB 2DY4A 4CF0A 4IO9L 1AUDA 4BRQA 1SXEA 2FVQA 3MMAA 2E8AA 7ICMA 3AD9C 3UCZP 4DR3J 4ZCLA 1RBRA 8ICEA 1JJHA 1Y97A 2ILZA 1NSAA 2XY6A 3RW7A 2C3PA 7ICVA 3ZNJ1 1WKJA 3AHPA 3A5MC 4ZTJA 3ZFVA 1H6KX 3HTVA 3QU4A 3WZ0A 2VG6A 4RWWA 3KLIA 4FYVB 2C22A 2UXBK 4Y2QA 1KQFB 4A46A 2CPDA 2A2DA 4U95A 3SAHA 2YMLA 3LP0A 3ZSVA 3VZIA 3OVBA 1ZQIA 5JRTA 2AZ3A 3BGRB 1M6YA 2XTJP 1IH7A 2F8TA 1WI8A 2RHSB 4W5RA 5E7OB 4E7IA 2HVIA 3MMVA 4I6WA 3EZUA 4CYUA 4DL7A 3O0FA 4FJ7A 1RT5A 4JI8J 5JMNA 1YRXA 1NK0A 1DLOB 3HZ6A 1KN5A 1ZZFA 1F5BA 4FWPA 4M5IA 3H98A 4YVZA 2H48B 2O66A 2VD3A 4FBUA 4JBCA 3JYTA 2CPJA 4NE9C 2CQIA 2WB1D 3MR7A 3TA1A 2A6OA 1YJTA 4JV5F 1F0XA 2J7KA 1U2VB 4DR3F 2OP5A 3UN5A 3C1ZA 2PFQA 3AH6A 4CT8A 2N4CA 4YXMA 4NI2B 2M88A 3CJ0A 4GO5X 4W5TA 3FCVA 1LAVA 4PHTX 3M5RA 3R27A 1NK4A 5HVHA 1VQ8N 2JFDA 3Q8QB 3DXBA 2EFVA 2B9EA 4JKFA 3T19A 4M45A 2W55A 4R66A 4RJVA 5IM0A 4WFYA 3KLFB 2MSNA 5BXIA 3U1MA 2E8OA 3TSQA 1IBMJ 1IIPA 2GOLA 1ECWA 3VGTA 2MZRA 3KXDA 3NNAA 2KNJA 2HLTA 2BYCA 2HBKA 1JLEA 2P5OA 3G6EN 3BPSP 4MDAA 4R64A 3FMWA 4XK8C 1RT2A 1WORA 1KCFA 1VSJA 1Q86O 3DLBA 1Q46A 3M7VA 2OGUA 4ECXA 9ICUA 4F67A 4PL1A 4H4MB 1SAZA 3D4JA 4PG5A 2VDIA 3C2PA 1IBLK 2MQQA 5F8MA 2XS5A 4DR1J 1F2HA 1CSJA 3GV7B 2UYTA 2ZJRQ 2CRLA 2MZJA 4OJ1A 4X62K 5EX0A 2YKAA 2R8IA 1X4EA 5F8NA 3LL3A 1HNZF 4DS5A 4AP9A 2V9KA 3OT9A 4X4VA 2G08A 2HEKA 2QSFA 2K3KA 3MEGA 3V9XA 8ICZA 4IG0A 2HZVA 3O8MA 3OY9A 1Z6RA 2B56A 2OPSA 2XO7A 1XMOK 3NRWA 2DEJA 4FJKA 1QCKA 2RDIA 4YMNA 5C24B 1HNXJ 5ALYA 3CD7A 4I27A 1N4LA 2PDAA 4NLZA 1SUQA 2O8DA 4GC6A 3TNVA 3H7HB 4CJUA 2VHGA 3KLHA 4PGXA 1IBMF 2B6AA 2YB1A 1WN7A 4OZ0A 2OEKA 3R5GA 2G07A 1RAHB 5C25A 3L2RA 5AM3A 2KVCA 4ILRA 2GWJA 3HRGA 3L2WA 1M5KC 3B4MA 3CF5L 2Z30B 2KSOB 3EZWA 1UW9A 2P9NA 4B9MA 2Z0GA 4ANEA 1MN7A 3POTB 3GU3A 3N9UC 1TE2A 1BHNA 4BS2A 4DR1F 1EZZB 2ETJA 3SYZA 2PFPA 4B3RK 3EGWB 3ULHA 4X84A 4BY9C 1Q82O 4X64F 3MM9B 4B9NA 3ISND 1WB9A 3ZX2A 2P9IB 4CO0A 3CFPA 1QSLA 2ASOA 3ED5A 4DV4K 3VR1A 3CCQN 1TKXA 2DRDA 5EWFA 2F96A 3H7IA 3TUIC 5DDPC 3M2VB 1KOOA 1Q8KA 5CA7A 1HNXF 3AQFA 4E1JA 3TKAA 3FEYB 4I64A 1QJHA 4O9MA 3M6VA 3IUCA 2CQ3A 3P83D 4LFCF 2JH7A 2V5HG 2P9KB 1QVGM 1Z2ZA 1QVGR 1HIYA 1NO8A 1NK7A 3CCRN 4NZ6A 1TAQA 4BWJA 4M5DB 4QZ9A 3FLCO 1B0TA 2DR5A 2WMMA 5E33A 3PYEA 4C98A 3OBWA 2WF7A 2GVZA 2O3DA 3IG8A 1NGIA 4RW8A 2P9UA