1NK9A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after two rounds of primer extension, following incorporation of dctp and dgtp.
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk9A01
1ZQWA 4F91B 4G3IA 3K5OA 2JLEA 3AVCA 4F4WA 2HVHA 3C2LA 3PNCA 3CFRA 4TQRA 4KHWA 4MFBA 3OYIA 4NCAA 1Z3EB 4P2HA 1RILA 2FPLA 1RYRA 3RH6A 4MF2A 3UQ0A 5D3GA 2FMPA 3V72A 3AVBA 4O5BA 3AA4A 1RNHA 2B4JA 2ZQBA 4FJGA 2GV9A 3SQ4A 5D4BA 2RF2A 4J2DA 2VWJA 2PY5A 2PI5A 4FXDA 5DBAA 4J9OA 1JLGA 4LSNA 3TAPA 7ICEA 5IIIA 1XU4A 3NFAA 5L1JA 1RCHA 4Z6DA 1LW2A 1U9LA 4RU9A 2Z1IA 1CUKA 2ATQA 2BPGA 4CEZA 4CJRA 3AVIA 2IHMA 1VSLA 5CA7A 1X9SA 4CEAA 4E89A 3SQ1A 4I29A 4CK2A 4FJ8A 2OPPA 2Z1GA 1HYSA 4KREA 1ZBUA 2HB5A 2QKKA 1KCFA 4RW4A 1BIUA 4F5QA 3QO9A 3O3FA 4CHPA 4DSEA 1J53A 8ICBA 4K8ZA 4E1NA 3RB6A 2BGGA 1WSJA 3DOKA 4PGQA 1XI1A 4M3WA 4QZCA 3MXMA 4M9NA 4YD1A 4CEEA 4DF8A 2XY7A 4CGIA 2V4RA 3VQQA 3KLIA 1HYZA 2XCAA 3ZDDA 9ICSA 3H08A 7ICOA 2I5JA 4I2IA 1TV6A 1WCNA 4DLEA 4IKFA 1EXNA 3HPHA 3K59A 3RJKA 1Y97A 4QZBA 3IRXA 5J2EA 9ICVA 1T7PA 1NKBA 4FM1A 4QZIA 1RBVA 3PR5B 4IQTA 5HRPA 3ZT2A 3SUOA 2DPIA 2DFHA 4CJVA 4RUAA 2OA8A 3TI0A 3K5NA 3LZJA 3NAEA 8ICYA 3JPSA 4ED8A 3OYBA 5DG8A 3ITHA 3MAQA 1CEZA 4BXOA 4KLSA 5IIKA 2A1SA 2PI4A 1ZQKA 4J2EA 2OZSA 3UXPA 4F2SA 2Q0ZX 1N5YA 1ZETA 4KMUA 5KG1A 8ICIA 4CIEA 3OYEA 8ICMA 3CG7A 3P5JA 5HBMA 3RMBA 3V1QA 3SPZA 3NTUA 3RJGA 3M8PA 2AGQA 1BISA 2BCUA 1C1CA 3V6KA 4F8RA 3Q8LA 1ASVA 4FLUA 3JPRA 4B8CA 4RG8A 2ZJ8A 5KFIA 4F2RA 4HTUA 3G6VA 4UB2A 5TZVA 2VA3A 2HHTA 1TAUA 3MECA 4CGDA 7ICHA 4Q45A 5EOZA 1XWLA 4NLGA 2AGOA 4I2JA 2QK9A 4IFVA 1NKEA 3SUQA 3SI6A 4I27A 2UVRA 1VSFA 3NH2A 9ICEA 1ZQDA 2PXIA 3HWTA 3KK2A 4CEOA 1S5JA 1KVBA 2J6UA 4KLEA 3U3GA 4F92B 1BQMA 5J2KA 1WAFA 4EEYA 4IR9A 4Q0BA 2OPQA 2KFNA 4PA1A 1BL3A 2ASJA 4CEDA 1RXWA 3AUOA 1NOZA 2ZJ5A 1LAWA 1VRUA 3PMLA 3ZT0A 2RKIA 2W8LA 4BE0A 5J2FA 3L2QA 3GIMA 4DU1A 4HCCA 3OJSA 3PUFA 4KLHA 3ZD8A 1Q9XA 4CEQA 4EBDA 1HNIA 1KEJA 1TGOA 2VA8A 3K75D 2PFQA 1T8EA 4CK1A 4Q43A 4QAGA 3TWHA 4JWMA 1HQEA 2YNIA 3ZSOA 3QERA 4CJTA 2BR0A 4DO9A 2P51A 2P66A 1RPLA 3SV4A 1TKXA 3IAYA 8ICJA 2NRTA 4FS2A 3N97B 3L3VA 4FJXA 2ZJAA 4IG0A 4BACA 5DDYA 3BQ1A 3SYZA 1XO1A 1RYSA 1ZQMA 2D0BA 5DG9A 1RTIA 4AHTA 4Z6FA 2Z1JA 2XGPA 3I0SA 4QZ9A 4DQRA 5L1IA 2R8HA 5J0UA 4BWMA 3DRSA 4NYNA 2DTUA 4FK2A 4CIGA 1ZQRA 4I2GA 1LB2B 4K4HA 2XRIA 4BDYA 1MC8A 4RQ8A 5DGAA 2UVUA 4LY7A 1YTAA 1Z25A 4M3XA 4DS4A 2OYQA 1H38A 3O4QA 4CF0A 5J0SA 4J9MA 2C28A 4CF1A 5FROA 4J9RA 1C0UA 5JS1A 5D49A 1Z00B 3KK1A 1QLNA 2X6SA 3VA3A 4E3SA 1ZBIA 1WAJA 1SKSA 1ZQQA 5HNKA 4RNNA 5L1KA 3V7JA 3QZ8A 3M9NB 4JUZA 1BCOA 3RB0A 1ZQTA 1L3VA 2F96A 3ZD9A 4I2AA 4QW8A 3GIJA 3SZ2A 1HJRA 4ZH4A 1TFRA 5EU7A 4RQ5A 5EWGA 8ICPA 8ICCA 9ICAA 3GIKA 4YD2A 3MDCA 3PX6A 3ZSWA 4C8OA 3C2MA 4RQ6A 4JK1A 3TAQA 4I2CA 3LANA 3T1AA 4B8AB 4DU4A 3TAEA 1T4GA 4KV8A 4KLLA 4UB5A 8ICQA 2PFOA 2HHWA 3B6PA 4HVJA 5J0RA 5KFYA 8ICOA 4IBNA 1R0AA 3V1RA 3WNFA 3JPOA 1S0VA 4CJPA 2F1HA 1HMVA 5KRTA 4KHYA 3RBDA 4YMNA 7ICNA 2BGWA 1WCLA 4YMOA 4XUSA 5C24A 5HHIA 2D0AA 5DKWA 5J2JA 3H8SA 4RUCA 2G8HA 5KFGA 4Z4FA 1IO2A 3HJFA 5D46A 3KK3A 8ICHA 4FLVA 1ZJMA 5CR0A 3KKRA 4PWDA 4CJUA 2FC0A 4KLJA 2IAJA 4JV0A 4F4ZA 3FFIA 4KFBA 3OYJA 2YKMA 3T5HA 4YR0A 4GLXA 1HPZA 3S3NA 1C0MA 2NUBA 2ISPA 4ID1A 4KKOA 1HYVA 4FJIA 2GUIA 2HHVA 2OPSA 4DTXA 4J9SA 3QEAZ 2KN7A 3VN5A 2G8FA 3JPNA 1RT6A 5KI6A 1RDDA 5CHGA 1C7YA 3P1GA 3C21A 2AJQA 4O5EA 3U6FA 2O4GA 2R8IA 3Q8KA 4I7FA 1RT3A 2AU0A 4KHSA 4CJLA 4PUOA 4DG1A 4M6WB 3C1YA 3G0ZA 2VWKA 9ICQA 4G1QA 5F9LA 2Y1JA 2V4QA 3CFOA 2M9NA 1L3TA 4ED6A 4OKJA 2JGUA 3QEPA 4CE9A 3MGIA 3LP1A 8ICSA 1ZQNA 3NCIA 4QWDA 4CGJA 1RBUA 3SV3A 2J6TA 2KZMA 1X2IA 3RMDA 1TK8A 4N47A 1ZBHA 4C8NA 4F5OA 3EPGA 1L5UA 3OYDA 3KHLA 2XGQA 5KFBA 1IKYA 5KFXA 3I0RA 5J2BA 1TKDA 2HHUA 3RJHA 3VQEA 4ZTFA 3GDXA 7ICRA 3NGIA 4CFDA 4I28A 4NM2A 3V7KA 4DEZA 3MFIA 2DFFA 3V9SA 3QE9Y 2O4IA 2JEFA 4M3YA 1IH7A 2E6MA 3PY8A 2FBXA 4M9JA 3ULDA 3LP2A 3AO3A 3NF8A 4YR2A 4GVMA 4B9NA 9ICPA 1G15A 4EBCA 4FLYA 2G8VA 4R66A 4GXJA 2E6LA 1QHTA 1ZQXA 2G8IA 4ECVA 2P5OA 3JPPA 3ZSVA 3TARA 8ICKA 1XSPA 2EX3A 3QESA 5KTQA 4B9TA 4KLTA 2MUTA 3UXOA 3QEBZ 4GC7A 1ZQHA 2BCQA 4TSXA 1UA0A 3QETA 4I2EA 4Q8FA 3VQDA 3T5LA 3OYNA 4QZEA 3LALA 1TVRA 1JLFA 4WE1A 3QEVA 2A1JA 5KFFA 1IM4A 2RN2A 3GIIA 3RB4A 1ZQCA 1JMSA 9ICUA 1IKVA 5J2NA 3AVFA 4R63A 4Y1DA 2XC9A 1MQ2A 3UPQA 1EP4A 2KTQA 4FBUA 4LZDA 3LP0A 3TQ1A 4DSLA 4FBTA 1D9FA 9ICXA 1S1TA 4BDZA 4KLIA 4I2FA 3L2WA 1JL2A 3KLHA 3MXIA 7ICUA 4CGFA 4N76A 4PH5A 3HVRA 4KN4A 3EYZA 2ZUCA 4ZHRA 4YXJA 3GILA 3V6HA 4O0IA 4CHNA 4DTNA 2HW3A 4BWJA 2R8JA 4QZAA 4FJ7A 2PYLA 3JPQA 4ED1A 3AU2A 2ASLA 2YHBA 5J2MA 2ATLA 4YFUA 2F1JA 4DU3A 1RT7A 4ICLA 1TL1A 2Y1IA 4MEYA 2R8KA 2FLLA 1LWFA 2XCPA 4JRPA 5KG2A 3ZSYA 4E19A 4M3ZA 1D9DA 4Z6CA 2G8WA 5CYMA 3PX0A 4H4MA 9ICBA 2A1JB 3KLFA 3AVAA 4ID5A 2Q3SA 1QQCA 4IRKA 1TVAA 5IIJA 3Q8PB 3VA0A 3RH5A 7ICSA 2ITGA 4AH9A 4R64A 1BPZA 1B92A 2B6AA 2NRVA 5CJ7A 4H4OA 4ECSA 1RT5A 4PY5A 4RT2A 4ED0A 4PPXA 1VSHA 3HT3A 2R7YA 4DQIA 3KTQA 4FM2A 4E7IA 1LV5A 1C1BA 1HJPA 1U49A 5KFVA 5HHHA 4FLZA 3MR2A 7ICJA 1ZQJA 4QCLA 2B21A 2BDPA 1KFSA 2IS3A 3T3FA 2ZUDA 1CZ9A 1SUQA 4DS5A 3KLEA 4DL4A 1JLCA 2IC3A 1SZPA 1QS4A 5KFRA 4I2BA 5IILA 4YFKA 4B9SA 3G6XA 1A5VA 4M9GA 1JXLA 5KGWA 3KJVA 4DL6A 2BQ3A 5DBBA 1C0TA 4K4GA 2BCSA 3HP9A 3B0YA 4M3TA 2OZMA 8ICFA 1WSHA 1EXQA 1SL0A 4CJ4A 1Q9YA 3V6JA 5J0YA 3K58A 4O0JA 3OSNA 3HP6A 2P1JA 3VQ7A 2D5RA 2C22A 3ZSZA 3S3MA 4O3QA 4OVLA 4RW8A 1ZBFA 4IR1A 4XA5A 3H40A 2RPIA 4BE1A 9ICOA 1JLBA 2DY4A 1JLQA 1UWBA 3UIQA 3AV9A 5KFMA 5FRMA 3ASMA 1VSMA 1ZQUA 4ECQA 4KTZA 2KZZA 3AVNA 1N48A 4DOBA 4HUFA 4OPJA 1WSGA 3DI6A 3L2UA 2BQRA 3H4BA 2LSNA 3P83D 1RT2A 3SQ2A 4B08A 1JL1A 4CCHA 1EETA 1B22A 5KFCA 1N6QA 4GXKA 5SWMA 8ICAA 4TUQA 4JRQA 1ZQAA 1NK6A 2BQUA 2DFLA 1S1WA 2IHNA 3VQ5A 3OY9A 5KFKA 3DYAA 1C1AA 1LWEA 3QLHA 4PHEA 4F3TA 4K4IA 3TAMA 2ISOA 3ALYA 3A2FA 4QZDA 3AA5X 1ZQLA 2I9GA 4M04A 5DMRA 2OPRA 4BXOB 1HUZA 4KLFA 3AO5A 4L8RB 1K1SA 1J9AA 4TUPA 5DDMA 1ZBLA 3MEDA 4F5RA 4BDPA 4CJKA 4FJKA 3WNHA 1KVCA 2AQ0A 4EZ9A 1JXEA 4FJ9A 1RBRA 4ECTA 3RR7A 9ICLA 3OHAA 2BPFA 4PHDA 1U04A 1SV5A 3ZDAA 2HVIA 7ICGA 4JV1A 4I2PA 3RTVA 9ICHA 4CF2A 3GQCA 4KITB 3BQ2A 3OYLA 2ASDA 1AROP 1BCMA 3NF7A 5FRNA 4RNOA 3PO5A 1EKEA 4CECA 3KIOA 2YNGA 1KDHA 3KHGA 4QOZB 1XSNA 4XRHA 4KO0A 3VQAA 1CLQA 3D45A 5J0PA 1F21A 3V81A 3L2RA 4M6WA 5JUMA 4R8UB 1TAQA 1T3NA 4NYFA 4C8MA 8ICRA 7ICPA 4KPYA 4FYDA 1JN3A 2FLPA 2HHSA 1U4BA 4FM0A 1IG9A 3LDSA 2KFZA 3B6OA 4OLBA 1NKCA 1I3AA 2BE2A 3B0XA 4CF8A 5F9NA 3HXMA 4ECRA 4F3OA 5J2DA 4MEXA 9ICIA 4AHRA 8ICLA 2JEIA 3BQTA 5EWEA 1TKTA 5J1EA 4PQUA 9ICTA 4QWEA 1JXBA 3LAMA 5KT7A 4GC6A 3UXNA 4EZ6A 4KTWA 1CXUA 1RT4A 4J2BA 4RNMA 4RQ7A 3GV7B 4F4KA 5KT4A 3AA2A 4Z4IA 4KLDA 2VA2A 2FPMA 1BHLA 5KG6A 1NOMA 4B3OA 1ZQEA 1XHXA 3AA3A 4FCYA 3NF9A 2VANA 5HMMA 4J9KA 1U47A 1NK5A 1T05A 1DTTA 4JS5A 1SKWA 2RDJA 1DOQA 1NJZA 2IMWP 3MGHA 3TFSA 4DQPA 4Z0UA 1B9DA 4PGXA 3T5JA 4RZRA 4DTMA 3O3GA 5SZTA 4RW9A 4O5CA 3DMJA 4R8UA 3H4DA 4KLQA 4YR3A 4GMJB 3RJJA 4EP4A 5KFHA 1X9MA 3C23A 4KLOA 1S0OA 5KT6A 4OKKA 4DWIA 2XY6A 4LZGA 1JIHA 3NGDA 3PVXA 2RDIA 4JLHA 4QZGA 1S1VA 4FK4A 5K14A 4YVZA 4Q8EA 3M8QA 3HM9A 4Q5VA 2HHQA 4LSLA 1W0HA 4E1MA 1S0MA 5KFLA 4HUGA 5E41A 4Q44A 4CHYA 5JS2A 1U48A 1WNSA 1BVSA 3SPYA 1VSIA 4M0AA 1ZQYA 2OWOA 4J2AA 4O5KA 1ZQOA 4DLGA 3ZSQA 4ECYA 4RQ4A 4UAYA 4DFMA 2C2RA 1KLNA 7ICFA 4KLUA 4TUSA 1A5XA 2VG6A 3DLEA 3HX0A 3EWAA 4M9LA 4NLNA 4O3RA 4RQ2A 2ALZA 3RAQA 4J9NA 2FMQA 4YP3A 4KB1A 2AGPA 3MEGA 5KFUA 3MABA 4ED7A 9ICGA 1TKZA 3ISDA 8ICTA 2GWSA 4XQ8A 3DLRA 4KN7A 3QEXA 2WONA 7ICLA 3ETLA 4YQWA 3HW8A 3M9OB 1S10A 3PO4A 3TAGA 3EY1A 4QWAA 3NGYA 1B9FA 5DB6A 1HNVA 5KG0A 5CY4A 3TFRA 3SJJA 1ASUA 4CGGA 2B5JA 3JYTA 2HNZA 3NBPA 2W42A 3RB3A 3M9MB 5J0TA 1TL3A 3H8JA 3ISNC 4FJNA 5HRSA 4KHNA 4DOAA 4RPXA 3I8DA 2WTFA 3AVGA 2W9CB 3TABA 3OS2A 4RQ0A 3PR4A 4YNQA 4O4GA 1D5AA 2BCVA 4RQ3A 4DFPA 4YMMA 3TANA 4DFKA 3MEEA 3NE6A 4IFYA 4Z4HA 4TURA 9ICJA 4IG3A 5KG3A 1EX4A 2IGIA 1FK9A 1S6PA 1Z26A 1VSDA 3HPGA 5HMLA 4XIUA 3N4MB 4C8LA 3OYAA 4KLMA 4W5OA 2FBVA 1ZJNA 5KT2A 5J2PA 4JV2A 1IXRA 4AHUA 3LK9A 2PYJA 1DTQA 1BIZA 3ZSXA 3C94A 3WNEA 4ELTA 1V9PA 3PW0A 2IA6A 3RRGA 5I3UA 4W5RA 2F8TA 1CZBA 5J0WA 5DBCA 1SL1A 1UT5A 4KHQA 4FW2A 3V4IA 2C2EA 5DLGA 2C2DA 1BI4A 1HRHA 1DGSA 4BGDA 4I9LA 1N56A 1S0NA 8ICXA 4YCXA 2NRWA 4O3SA 5J2AA 5J0QA 4CJ5A 4W5TA 3OS1A 1S9GA 2PFNA 3JSMA 4O44A 1ZQZA 1NK0A 3RJFA 3RWUA 4M45A 3AVHA 2P6RA 3QINA 4CEFA 4X5VA 2JZBB 4M3UA 1X1PA 1QSLA 3PW2A 4P4OA 1WSIA 3T5KA 4CHOA 1K1QA 2QKBA 2GBZA 3MXJA 2E4LA 1L3SA 3H8WA 4AHSA 4M41A 1JKHA 3E01A 7ICTA 4CERA 3ISCA 2HNDA 2IOCA 3OSPA 4QWCA 1XS9D 4ECUA 3RMCA 5J0OA 4DL2A 3AVMA 5CZ2A 4DSJA 5KFAA 1K6YA 1QE1A 4IDKA 5IIMA 3PW7A 4FLXA 3OS0A 3F9KA 3DLHA 3NH0A 3AVKA 3K2PA 4LH5A 3RAXA 4JWNA 1X9WA 5KFZA 5KFNA 1GOCA 3VQ4A 3QIOA 1B43A 4Y1CA 3CFPA 4EYHB 5DGBA 3LPTA 1BPBA 5J29A 2BCRA 3NF6A 5CP2A 2ETJA 3OYMA 3LDAA 5DB7A 3KHRA 4EP5A 5DQIA 5KG4A 3OYHA 1IKXA 1TK0A 4GXIA 3C2KA 4J9LA 4QZFA 4CJ3A 4TQSA 4CFBA 2HMIA 1Y88A 4O3PA 4CF9A 1D8LA 4OLAA 1RZTA 3QIPA 4I9QA 3LAKA 4FVMA 5J2HA 1LW0A 4DTSA 4ELVA 4DQQA 2FBTA 3C6UA 4FO6A 5KFDA 5KFWA 4KAZA 8ICEA 3NHGA 5BOMA 4M47A 4DF4A 4HHTA 3ZCMA 4QZHA 9ICNA 3LWLA 4ELUA 3RH4A 4UB4A 3SI8A 7ICMA 4IRCA 1QTMA 4M42A 8ICNA 2KQ2A 1KSPA 3SUNA 4DL5A 1U45A 5J0XA 1KLMA 4FZYA 3MR6A 4KHUA 2ZTCA 1QSSA 1D8YA 3BJYA 1ASWA 4RQ1A 4CJSA 1ZQIA 2DFEA 4JS4A 1UA1A 4CFCA 9ICCA 1S76D 3OYGA 4FLWA 3L2VA 4FJLA 2H5XA 3TAFA 3L3UA 4ED2A 1ZQVA 4DSIA 4FJMA 4QW9A 3HVTA 4IQVA 4CESA 4FZZA 1UOCA 3V9XA 4LD0A 3GV8B 5IIOA 3U3YA 4YXMA 2ZTEA 4O55A 3HO1A 1YVUA 2DPJA 4NLKA 4KI6A 3C5FA 4AHCA 3VQ9A 4KI4A 3H7IA 1NK4A 5HRRA 5I42A 3C5GA 3K4GA 4O3OA 1A77A 2BANA 4I2HA 5L1LA 4NLZA 3V6DA 1XHZA 1J54A 5DK5A 1WN7A 5C5JA 4UB1A 1NJXA 2YKNA 3RMAA 4RW6A 2BHNA 2FPKA 2YNHA 1VRTA 1S97A 3PMNA 3IG1A 1FKPA 5J2QA 1NK9A 4DOCA 4MFCA 5CWRA 3AO4A 2X78A 2HHXA 2R8GA 2F1IA 5HP1A 4ZTJA 4UB3A 4MFFA 1JLAA 4DTJA 1RDAA 3VQ6A 3AO1A 5HP4A 3C6TA 1BQNA 3Q8RB 1KFDA 4OKEA 2FMSA 4C8KA 4AHVA 3NDKA 4F50A 2NRXA 1T03A 4O9MA 3OYKA 3OGUA 3L8BA 3OHBA 3DOLA 4F4XA 2D0CA 1FKOA 9ICWA 3V7LA 4CJFA 3OVNA 4BE2A 1KFTA 1VSEA 3VQCA 3K57A 4DTUA 2YHAA 1DLOA 1C6VA 3RBEA 3MR5A 4FJJA 1A76A 5DG7A 1WSEA 1JLEA 4H8KA 3ZT1A 5C25A 2P5GA 1VK0A 8ICUA 4RW7A 4E7KA 3S9HA 3HPOA 1S9FA 3KD5E 1SKRA 9ICKA 3AO2A 4LVSA 3HSTB 3QEIA 3SQ0A 3MBYA 3AVLA 4OGCA 3AU6A 5HLFA 1UT8A 2IBKA 2MAXA 3M8SA 4UBCA 3QNNA 5KFOA 1KRPA 5KFEA 2G8UA 1ZQSA 3K5LA 3FYHA 1S77D 3ZT4A 3CM6A 2Z1HA 4K8XA 5HRNA 1S1UA 2EHGA 4R5PA 3T19A 4CJWA 5KFSA 4OPKA 2ZTDA 3HL8A 7ICKA 3IM1A 1IKWA 3C1ZA 3SNNA 3DLGA 1RTHA 1KVAA 3BDPA 5KRSA 4ECXA 3EW9A 9ICMA 4CIFA 1XSLA 4B9LA 5DLFA 4CK3A 3MDAA 4UBBA 1CXQA 2G8KA 2UVWA 4E7JA 1A5WA 5L9XA 1Z00A 3M8RA 4MFAA 3CM5A 1BGXT 3JPTA 4FLTA 4IQUA 4FZXC 2YNFA 4CFAA 4DTRA 3K5MA 1GOAA 4UAWA 2IDOA 4I2QA 3V1OA 4J9QA 3RR8A 2FBYA 4M2YA 4RPYA 3S3OA 2W9BA 8ICVA 4RPZA 1NJWA 1HUOA 4FJHA 5BPCA 4ECZA 2V9WA 3EZ5A 5J2IA 5J2CA 4MF8A 4ED3A 1S1XA 3D0PA 3HK2A 4QZ8A 4B9VA 5T7BA 4FK0A 2KZ3A 3QNOA 2A1RA 1SL2A 4UAZA 3BGRA 4PGYA 3ZDEA 3UQ2A 5KFQA 4FJ5A 3MR3A 4NCBA 4CEBA 2P6UA 4EBEA 4DQSA 5EWFA 5KFTA 3GFKB 1RBSA 4CJQA 5KG5A 4DFJA 4Z6EA 4DL7A 5KT5A 4UQGA 1ZQGA 4O3NA 4DTOA 2ZD1A 4YG2A 2AQ4A 4Z4EA 5DQHA 1BI4B 3WNGA 3C95A 1ZQFA 3HYFA 3OJUA 3PW4A 9ICFA 3IHQB 5KFJA 3QZ7A 2XY5A 2LYHA 4QWBA 3RJEA 1COOA 2KW4A 1J5OA 1S6QA 5FDLA 4FW1A 4E7LA 3AVJA 4EYIB 2XY8A 1TK5A 2NRZA 1I39A 5CYQA 4YN4A 2W9MA 3E2EA 1RT1A 3G6YA 5KGXA 1NK8A 2UVVA 3PV8A 3PW5A 3SUPA 3DRRA 1UAXA 4CGHA 3Q8QB 1RDCA 2X6NA 3IS9A 8ICGA 3O3HA 3ZT3A 4NXZA 4KRFA 4PHAA 4I2DA 2JZBA 1S9EA 4HUEA 4P4PA 4DMNA 1VSKA 2W9BB 1NOYA 1FXXA 3G10A 1NK7A 2XHBA 3CYMA 1YTUA 3KHHA 2PFPA 1LWCA 1NJYA 3NGZA 1ITGA 4CJEA 2J6SA 3RRHA 4W5NA 2JEGA 3Q8MA 3DM2A 1WSFA 3ORYA 5BOLA 4KLGA 3LPUA 1MU2A 1BPEA 2XO7A 1ZQBA 3BQ0A 3SCXA 4Z4CA 3KKSA 4E0DA 7ICQA 9ICRA 4AILC 2W8KA 4B9UA 1YT3A 4RT3A 2YV0X 4PHPA 2WOMA 1XC9A 4N5SA 4LH4A 2MUTB 1RDBA 4GW6A 1RTDA 2ZUBA 4HYKA 5IINA 5KFPA 5J2GA 3QEWA 3FDSA 4DTPA 7ICVA 1MSWD 3LWMA 3OYFA 3Q8SB 3EPIA 4IQWA 3DLBA 1TV9A 4F5NA 4CHZA 2VG5A 3VQ8A 2BPCA 3VQBA 3ISBA 5CB1A 3ZSRA 8ICZA 1L3UA 1HQUA 3LZIA 3V9WA 4KB0A 4FS1A 1BPYA 2JEJA 3NH1A 1REVA 5DQGA 3LP3A 3DLKA 3V9UA 3VQPA 4M9HA 2X74A 3V9ZA 3ZDCA 4DSKA 2ZE2A 4F93B 4W5QA 1PZNA 3TR8A 4CHQA 4NCGA 3OYCA 7ICIA 4F5PA 1QSYA 4OJRA 1KTQA 3GV5B 1BPDA 4N41A 2BKEA 1Q8IA 1WLJA 1RTJA 2I1QA 2PZSA 3KD1E 4M3RA 1MQ3A 1W9HA 3DRPA 5C42A 3RJIA 3THVA 5HROA 4ECWA 4DL3A 3F73A 4KTQA 4NY8A 4J9PA 4E7HA 3PX4A 4P4MA 2FLNA 2HNYA 1GOBA 4IRDA 2VG7A 5CZ1A 4NM1A 1RBTA 2QXFA 1ZYQA 1BPXA 5KT3A 3MFHA 1ZQPA 3ZDBA 2W9CA 1O1WA 1JX4A 5DB8A 4B9MA 4MQ3A 4N56A 4OGEA 3O4NA 4DSFA 1LAVA 1RXVA 5DB9A 4Z4GA 1VSJA 4F4YA 3KLGA 5KG7A 4R65A 2W9AA 3CQ8A 4HCBA 2F8SA 8ICWA
chains in the Genus database with same CATH superfamily
1QQ6A 2HMPA 2DHHA 3O1BA 2JLEA 3AVCA 4F4WA 4BRLA 4X66F 3PNCA 1KWMA 2V63A 5KPTA 3VGLA 3F5EA 4NCAA 5F0XA 3N28A 4NXNF 4P2HA 2B43A 2WC9A 4ES1A 4MF2A 2K3IA 3GONA 1VRTB 3JAMY 4CZGA 1ATSA 2Q6BA 1NGCA 2OXOA 2FMPA 2GO9A 3ETOA 1RNHA 3KLEB 2ZQBA 2F4VJ 2E2PA 4FJGA 2E8MA 1Q5VA 3MM8A 5D4BA 2VWJA 2QN6B 2MKYA 4KBOA 5C42B 5DBAA 1JLGA 2W4PA 3NASA 2P9EA 4LT6A 3W0LA 4NPOA 1U9LA 5AQXA 4L76A 2Z1IA 5IWAJ 5GMEA 1UKUA 4UUWA 2KM8B 1NO8A 1I94K 1VSLA 3F56A 2KICA 5CA7A 1X9SA 4H54A 4MDBA 2A6OA 4I29A 4CK2A 2OPPA 5ALIA 4CNZA 2QA4N 1KCFA 4RW4A 4BGAA 2F5GA 1VK8A 3TTFA 1OVYA 4CHPA 4DSEA 2JZ5A 2N82B 1S22A 1J53A 1XMOJ 4K8ZA 3QU9A 4WFXA 3RB6A 4ZPWR 4LF9J 5D0EA 2BGGA 3DOKA 3MOZA 3AT1B 3D9BA 1VBYA 3UKRB 2L41A 3WKEA 2QRRA 2VPXB 3ZZTA 1HI8A 2FUG9 1JKHB 1EIYB 2HNDB 2XCAA 4LF5J 3VAHA 9ICSA 5HLFB 2NXUA 4DLEA 4IKFA 5EX3A 1EXNA 3C15A 4WTOB 5GAGU 2RAQA 4QZBA 2GVZA 3IRXA 2EZZA 3KJQB 1H7XA 4I68A 2AKWB 4P7TA 2DKZA 4LVOP 2U1AA 3PR5B 2HF3A 3SQGB 2H3VA 3FKBA 2ADCA 4M94A 4BC4A 5AE3A 4CJVA 4BRAA 8ICYA 1X4HA 5FLXY 3NAIA 1DARA 1UVJA 1TUUA 3MAQA 4BXOA 4IS7A 4KLSA 2HMIB 2A1SA 1O03A 4J2EA 3UXPA 4BROA 2Q0ZX 1RBLA 2VFUA 4KMUA 5KG1A 8ICIA 2YKOA 4D3HA 4FYXB 4LF7F 3FZLA 3P5JA 1I51B 1U2RA 3CQYA 1HBMA 1UVIA 4WK1A 1PAEX 3T6BA 1QAJA 4PG5A 1HWLA 1RWVB 2B4PA 1C1CA 1CJTA 1HNZK 2VCPA 5CQGA 1A7GE 1WBBA 1Y10A 4ISFA 4B8CA 4KY3A 2ZJ8A 5KFIA 4F2RA 3R7SB 2GJIA 2YX1A 3LH2S 3G6VA 4UB2A 5TZVA 3CF5L 3U26A 4CGDA 2XZTB 1BWFO 3CC7S 4NLGA 1S1WB 3DFEA 2E7VA 1FKPB 1VQ4N 2R2RA 3SUQA 5M1QA 3MMBB 2EC0A 1HD0A 3TAMB 1VSFA 4X65F 1I94J 4CEOA 4OQJA 3QU4A 4KR0B 2JWLA 5J2KA 1BDGA 4FZVA 1H98A 1BOTO 1PBUA 3H25A 3UN5A 1BL3A 2ZBIA 3AUOA 3D66A 3M32B 3PSIA 1SXEA 3SBTA 1YQHA 1KDNA 5LMNJ 3L2QA 3GIMA 1FRIA 5ADXA 3OTOK 2COLA 5JU5A 1LKYA 3OJSA 4DR7J 3TTCA 5AK4A 2MY8A 4ZLPA 4CEQA 1UVNA 5H2FU 5KAIU 4EBDA 2KVQE 4RWXA 3MEKA 1TGOA 1D1UA 4KGVB 2VA8A 3DRRB 2YX6A 3P5BP 1VQOS 2YNIA 3VOVA 4OJ5A 2P66A 2R7UA 2DGXA 3SV4A 3Q2SC 4BC3A 2H1YA 4BVOA 4GKJK 2IC3B 2OKQA 1ED1A 3J8AA 3N97B 4GMKA 4IG0A 4BACA 5DDYA 3S6EA 3SYZA 1RYSA 4CBWA 2HURA 5AKLA 2EI5A 2F7VA 5DG9A 1RTIA 4AHTA 3B54A 4O4RA 1IBLJ 1C0TB 4ERDA 5L1IA 1QUPA 1GXTA 4ZVHA 2P9IA 2OYYA 4C9DA 3OTCA 3DRSA 1SZHA 2WAQC 4LF1A 3M7VA 5GMKa 1GLDG 1MC8A 1X3NA 5DGAA 2WSEC 2AJ1A 3M32A 2DNHA 2CPXA 1SXLA 3VVUA 5C2FA 1T9UA 1H38A 3HSZA 5BR8K 5ALOA 3GR0A 4CF1A 4J9RA 5D49A 1Z00B 1DXSA 4KFBB 1GLLO 4E3SA 3ENHA 2JXJA 5HNKA 4NI2B 3HI0A 1HNXF 5L1KA 5AIAA 1VI7A 2ZFHA 5JICA 4JUZA 1SVDA 3VEYA 1CBKA 1L3VA 3LQVA 2YVSA 2N3OA 2ZIWB 3FMBA 4ES2A 1HUXA 5EU7A 1UPHA 1FRXA 1HQ2A 2L3MA 3MAHA 2IJRA 8ICCA 3HSDA 3H3OB 4GY2B 2N7YA 9ICAA 3R8YA 3MK6A 4PUOB 4YD2A 3MDCA 1IR0A 2M0NA 2B7BB 3T1AA 3BO4A 4KV8A 8ICQA 1OH7A 3AXMA 2HVDA 2MQMA 2XI9A 1R0AA 3PYEA 2QI2A 1T9VA 3GZ7A 4CJPA 2F1HA 2IM2A 4YB5A 3NVWA 4KHYA 1YRTA 2QA4S 4GIBA 1LWXA 3CCVN 5AI5A 1FJGK 3M8QB 3BO3A 4LR7A 5HHIA 4CIOA 5DKWA 3CXCR 1J5OB 4F72A 5J2JA 3H8SA 2G8HA 3LGMA 1UZDA 5KFGA 4A4JA 1IO2A 3DKDA 4R79A 4FLVA 1SKUB 1CULB 2LKZA 1NNEA 3FQLA 4F4ZA 4KFBA 3S3NA 1C0MA 2XSJB 1RACB 3H1VX 4KKOA 4JI4J 2GAGC 1H1VA 2AEFA 4FJIA 1U24A 2GFFA 2NS1B 2ZZMA 1U0HA 2P9NA 4IFYB 3WK6A 1MLAA 5DZ6A 2VQFK 4DV6F 1KC8T 1DK3A 4ANDA 2AU0A 4DUYF 2YBVA 1Y9OA 4IKAA 2DT9A 3D6MB 4CJLA 4JMUA 2DHAA 4WQ4C 2W01A 3G0ZA 3MM8B 1ZA2B 4CDGA 2Y1JA 3MMCB 3CFOA 3I9ZA 3ZTQA 2HQCA 2J0XA 4GV3A 4CZHA 4ED6A 2JGUA 2EANA 2B9WA 4CE9A 8ICSA 2P35A 1ZQNA 3P5TL 3D6HB 3DN9A 5J2NB 4DHYA 4Y2MA 3SDEA 1F1BB 2KZMA 3RMDA 1TK8A 1XK8A 4N47A 3RU0A 1S1TB 2YWKA 3O1LA 4NLXA 2JNJA 4ZVGA 1T95A 3I0RA 1VQMN 3RJHA 3ILOA 3U02A 5ALVA 3OXLA 2YTUA 4DEZA 3MFIA 4NA1A 3V9SA 3O9SA 2JEFA 3MN6A 2JVOA 3D2WA 1VS3A 1N36J 1YLXA 2KHDA 4IO1A 4K43A 3KLIB 4IL6U 4FYVB 3A8YA 4A57A 2KH9A 3NVMA 5D15A 5FIIA 3RW7A 2E6LA 4P71A 3HDSA 1ZQXA 3JPPA 4I7FB 3G86A 8ICKA 3Q24A 4M8LA 2Q6CA 2R7RA 3HZGA 3QESA 1TL1B 2ZC3A 1VBXA 1F0MA 3TVYA 4G1QB 5E79U 1UA0A 3OW2M 2ABYA 4Q8FA 3VQDA 4QZEA 4CLLA 4WE1A 2UUAK 2EEYA 2RN2A 1CQMA 1BWEA 4ID5B 2W2NP 2A6MA 4MT1A 5J2NA 2XC9A 4PR6A 5D78A 2HBMA 5A0LA 3AODA 3GCXP 3TQ1A 4H03B 3O5BA 2JRZA 4FBTA 1D9FA 9ICXA 1S1TA 3ZTRA 4BDZA 1PC5A 3SCIE 2ZE2B 4GVBB 3DXMA 5DRKA 2E9RX 4ILMA 3D2NA 4B3MJ 3EYZA 3BSAA 2ZUCA 1HW9A 4PHTX 2FZGB 3V6HA 4O0IA 3E51A 4QPTA 3Q83A 4CHNA 3T7ZA 2JRSA 3RAMA 4MAKA 4BWJA 2IY5B 2HF4A 2V2ZA 4MK7A 4QZAA 3K0JA 3F2CA 3FRZA 4CD1A 4P2SA 4IDKB 2XNRA 3D2SA 3OFGA 2D8CA 1FX4A 3CERA 2IIRA 4JV5K 2CA9A 3GYGA 3MPWA 4EENA 5J2MA 2KHCA 3O9RA 3AA8A 4ICLA 1ULRA 3MMBA 4H0TB 3NVZA 1B70B 3CTRA 4R0EA 2HLUA 4A48A 4E19A 1D9DA 3BGLA 1KLMB 4K59A 5IQ6A 2MU2A 3AVAA 2HQ3A 1QQCA 2RT3A 4IRKA 3PDNA 4IO9L 3PIPQ 5IIJA 2LXUA 3VA0A 3RH5A 3OR2B 3HVWA 4X4RA 2V34A 3KD3A 1YI2N 2O8FB 3KJNB 1Q8KA 1RT5A 3HHLB 4ED0A 4PPXA 4LF7J 2R7YA 2NYHA 1R59O 4FM2A 3Q89A 3ZFVA 3VAGA 3MI7X 4Y2JA 5HHHA 1YGYA 4FLZA 3MR2A 4H0PA 1CPZA 3NAHA 2BDPA 1A9NB 4NO7A 1KFSA 2IS3A 3JXUA 3T3FA 4DS5A 1WOPA 1OH8A 1WD6A 2IC3A 1GLCG 3C8YA 4I2BA 4B3SK 4YFKA 2BX6A 2CVIA 2ZGYA 5I3UB 2XYPB 2EFOA 2GGPB 3THXB 3N4WA 5DDRC 1VQ9N 3ZTSA 4DL6A 2BQ3A 4X4TA 5DBBA 3HP9A 2BCSA 3B0YA 4M3TA 2CQ3A 2MTLA 5AQPA 2OZMA 4X66J 1MG7A 1QAIA 2QYGA 4WQ4A 1SL0A 1AUDA 5J0YA 2BEFA 2U2FA 3K58A 4RO0A 1FNXH 2HBRB 1G2EA 4FWOA 5E2QA 2KD1A 2UXDJ 2RHFA 4O3QA 4OVLA 4RW8A 1ZBFA 3MEDB 4DMZA 4BE1A 1XMOK 3BKTA 4XDCA 4QJVA 1WI8A 4FXVA 2P9KA 1X4CA 4OL8A 5B0GA 2A3ZA 4JI1K 1GX5A 2EAPA 3HD1A 3W8GA 5FRMA 4AYBF 2ZH7A 1VSMA 2QA1A 1ZQUA 2O8FA 4ECQA 3OFFA 4KTZA 3POTB 2MA1A 1UFKA 2UUWA 3DDNA 3L2UA 2BQRA 4CO0A 2MQOA 3BM7A 5E3CA 1N33J 3SQ2A 2KL8A 4B08A 3P39A 1HLUA 4PKDB 4CT9A 3NCPA 5KFCA 4GXKA 8ICAA 3K8WA 2QL7B 4QJFB 5ALUA 5CCMA 3CCLN 2DCUB 2DY9A 2W7PA 4DJBA 1CI4A 1QTNB 2AYEA 5KFKA 2O8DA 2AEJA 1ZA1B 1C1AA 4Y2VA 1TUWA 4BC7A 2CQIA 4TN2A 1JJ2R 4F3TA 4K4IA 5ALNA 4WP8A 3TAMA 2E5LJ 2ISOA 3M2RA 3ALYA 3WKDA 4QZDA 1ZQLA 1R0AB 5DMRA 1X4EA 3ITHB 2Q3PA 1T02A 4BXOB 3QRQA 2I6XA 4OZ3A 4TUPA 5DDMA 4YB7A 6AT1B 4MIAA 1ZBLA 3MEDA 1ZM4A 1M5KC 4FJKA 1RTHB 2ZG6A 3KZBA 3HLUA 2EBEA 1FFVA 4HACB 2YJEA 3W3DA 7ICGA 4CF2A 9ICHA 2NCKL 4CZMA 5ALXA 2HQGA 3TUPA 3POTA 4KKOB 4ZA1A 1NGIA 5FRNA 1Q3UA 1NSQA 3PO5A 2RQ5A 1N88A 1U1KA 2YNGA 2W24A 2P9UA 2IOHA 4NXNK 1X0FA 1X42A 2KJVA 4O0NA 3VQAA 1U7LA 4Y34A 5J0PA 4I64A 4ILHA 2DXFA 1T3NA 1QAYA 4C8MA 1NMNA 2HHSA 1KVKA 1LWEB 1IG9A 4MDAA 3QPIA 3N6NA 3QWUA 5J2DA 4EX7A 1ESVA 1RAHB 1X5OA 5A6WA 5EWEA 3SMPA 2X7IA 5KT7A 3L4PA 1FE4A 4ZJQA 1S4FA 2F1FA 4ITSA 4DV4K 1VQMS 4PG7A 3TWZA 2WSFC 3EDQB 4DCOB 4F4KA 5KT4A 1BD6A 5ALEA 2YNIB 3J80Y 3IP0A 2VA2A 1FERA 5ALMA 5IT9U 4OYIA 3CQXA 3KK1B 4US9A 3PTWA 2QXLA 4WYWA 4WZMA 3NF9A 2CXYA 3NUQA 4NI2A 2VODA 1H7WA 4PKIA 1U47A 2N1RA 4JS5A 1NG9A 1SKWA 2YNGB 5CEHA 3I82A 2UUCK 5CHCB 4R25A 3P49B 3CCWA 3SEIA 5EE0A 4DQPA 1P1TA 1B9DA 1AW0A 2WONB 4PGXA 4DR6J 2W54A 2O8BA 3PEHA 2H4WB 3O3GA 5SZTA 4YR3A 2OP5A 2MZ1A 3MTJA 4YB6A 3PSPA 1S0OA 5ETTA 4OKKA 4DWIA 2XY6A 4E98A 2LLZA 3NVKA 5LOQA 4FDFA 2QC3A 4JLHA 4DV4F 3NKYA 4NL9A 3EVMA 2E2QA 4IO8A 4M5IA 3M8QA 2HHQA 4E1MA 5J8YC 3LOUA 4CHYA 2VG5B 3GU0A 1VQON 2H54B 1HX1A 2UUCF 1BVSA 2MZSA 1ZQYA 3VCDA 4O5KA 3ZO7A 1F0XA 1ZQOA 3T9NA 4UAYA 1VRQC 7ICFA 2EPIA 4KLUA 4TUSA 2A3VA 3P31A 4TY9A 4RQ2A 2ALZA 3RAQA 4J9NA 2AGPA 3MEGA 3BEXA 5KFUA 3MABA 1DT9A 3ISDA 5IM0A 1X5PA 2W3RA 2X1FA 3EVOA 2GWSA 1YJWN 3QT6A 3DLRA 3BY5A 7ICLA 3ETLA 3M9OB 5HR7A 1F3FA 1HHSA 3GU3A 5KG0A 3WEEB 3JYTA 5C24B 1WOSA 1V6HA 5DDOC 3W2VA 3RB3A 1HIWA 3M9MB 5J0TA 4F36A 5HRSA 2E9ZA 3R1LA 4OD0A 1HW8A 4RPXA 1GXLA 1SH0A 2ZH5A 2W9CB 3UW1A 2AEMA 1YI2S 1FFUA 1WUDA 1PILA 2DRAA 4AQYF 4RQ0A 3PR4A 3CPWM 3ZEUA 2CXEA 2W6KA 1HBUA 4DFPA 2DRDA 4YMMA 3TANA 1SJ3P 1VQKS 1U0HB 2IVPA 4IFYA 5K8MA 4BRGA 5AFUA 1FK9A 1Z26A 4IYQA 2MZQA 3OL8A 5IV3A 5J2PA 2FBVA 5KT2A 1SUQB 4JV2A 4HHJA 4AHUA 4DG1B 1S7IA 2WBMA 1KBRA 4B1ZA 3GLJA 1DTQA 3C94A 2QLWA 1L7PA 5HROB 1QQNA 3MEGB 3RRGA 5I3UA 1WOQA 2GGPA 3KFWX 3GZFA 1URJA 1U1PA 4KE5A 2F76X 3K0SA 2Z2MA 1SL1A 5U47A 1ZAWA 4FW2A 4OJ3A 2RF2B 2C2EA 1VQ6S 5ADXH 2C2DA 4L6V3 4WYBA 1DGSA 1I5OB 1MN9A 1SC1B 4PXDA 2XEXA 5J2AA 4I4BA 1CG2A 3P8BB 4N7TA 1CQNA 2APOA 2P9KB 4XEIA 4CJ5A 4JK9A 4B3SJ 1WEXA 4M7YA 4HTIA 3IBPA 3CIMA 2FF3B 1NK0A 2XMUA 4I67A 4RW4B 2ZDOA 2P6RA 2YHWA 1MMDA 4CEFA 4X5VA 3CJCA 2XVTA 4WP3A 5B0CA 2WTUA 4OX8A 3NG8A 1OJ4A 4P4OA 2AF6A 2PKEA 1XQSC 4DX7A 4OZLA 1VQ4S 2W2OP 1MN7A 5FPNA 2E4LA 1L3SA 5L39A 2M8DB 2VDHA 3I6PA 4AHSA 4V19J 1JKHA 1B7FA 2FJEB 7ICTA 3ISCA 2HNDA 4OYXA 1PVRA 4FPBA 1RAJA 2KJ8A 4OJOA 7FD1A 5CZ2A 4DSJA 4IDKA 3OTBA 2W2MP 4FLXA 5ETRA 3NNAA 3AAPA 3NH0A 4JI1F 2ZNYA 4JD2B 3L4IA 1ELOA 4LF5K 1X9WA 3O4WA 2F2AB 5HVFA 1XMOF 3VQ4A 1S48A 2E2OA 3QIOA 2HBJA 1B43A 2GAHC 2ZH3A 2CH6A 5D0HA 2D1CA 3LPTA 2H3IA 1NZAA 4LF8K 4K42A 4QIVA 3NF6A 4UAUA 2OTJS 2DGZA 4DV5F 3CP8A 2P9LB 2XI2A 3OYHA 3OQ2A 4DV0F 4FWPA 4DR4F 3C2KA 1ATRA 4CFBA 1RWWB 4HACA 1DRZA 1RZTA 3ZX0A 1HLWA 1CLFA 4I9QA 5J2HA 3EZUA 2J7WA 1I6JA 5ALYA 2LBOA 1O13A 4OHVA 3FCWA 2Z8QA 2V50A 4ILLA 1C2PA 4JV5F 2XLKA 5BOMA 1NGBA 4DF4A 9ICNA 4H4KC 3E8OA 4RQMA 2PO4A 4C2MA 2VWBA 1RHKB 3VTIA 3GSDA 1Z1ZA 1QTMA 4K50A 3M6KA 4F0HA 4WCEL 1PVQA 4FF2A 5J0XA 1KLMA 3SQGA 5DM6Q 4QZVB 4KHUA 2ZTCA 1QSSA 4CJSA 4CFCA 9ICCA 3A4TA 3OYGA 2FYXA 1PKUA 3TAFA 5IT9O 2F9TA 4JYAK 4FJMA 4QW9A 1LNQA 2C2OB 4FZZA 3I1YA 1N54B 1FKOB 2HG4A 3CJKA 4LD0A 2MKCA 4O55A 1X9JA 3C5FA 5JMNA 4AHCA 3VQ9A 5T7LB 3CJ2A 4UF4A 4G1PA 1S49A 1NK4A 1WI6A 5JVGQ 5I42A 2CQGA 5GADP 3G82A 1SJ1A 1QVFM 2QGFB 1CVJA 1C1CB 3LDLA 1N61A 4C0ZA 5DM7Q 1XHZA 1J54A 4G9ZA 5C5JA 2IM0A 3ENQA 3THYA 4NL5A 3OL9A 3I55S 3RMAA 2FPKA 1S97A 3IXQA 2UUAJ 1FKPA 3FZHA 2BZFA 5E3QA 2BKNA 3M1VA 2WAQF 2RHKA 4A61A 2PA8D 2R8GA 5LJVA 2IOFA 2LYBA 5HP1A 4UB3A 4DV0J 4GO5X 1RDAA 2WHEA 5LMUJ 4X84A 1T3QA 2EKNA 4WFBQ 4BRKA 2JX2A 3FAHA 1TL7A 3LYSA 5CRXA 1KONA 6FDRA 1AFJA 4QYZJ 2DUYA 4X64J 2BJ9A 4AHVA 2G4BA 4F50A 3OBYA 1T03A 3WXLA 4IZ9A 2GELA 4KT0C 1RAIB 2G5HB 3BSCA 3L8BA 2GMLA 3OHBA 2EFVA 1RAAB 1VQ8S 2HZAA 3WKAA 4BY9C 3V7LA 2DNMA 1FD2A 1KFTA 2YKAA 5AI6A 5I3PA 1VSEA 3VEWA 3FZKA 4DTUA 4OLPA 1DLOA 5LXRA 4KGZB 4DBQA 3MR5A 1A76A 1RB0A 2CPEA 4ZLLA 5AM0A 5BYRA 4K4ZA 3G82B 5IC4B 8ICUA 2GWKA 2EK6A 4PZNA 1Q82O 4JI6F 3CCZA 3HPOA 4BRQA 1S9FA 3AO2A 3QEIA 3D3BJ 3J81O 5KFOA 3I33A 2G8UA 3K5LA 2Q1NA 2P9UB 3CM6A 2Z1HA 1IJEB 5HRNA 2HRUA 3CVKA 1XMQF 4CJWA 2PMZD 5KOXA 2DKOB 1IBKJ 2AIRB 2HWIA 3DRSB 4DR5F 3QGHA 2CPIA 3VGVA 3LPYA 2EK1A 2B4UA 1YJNN 7ICKA 4CP5A 1BY9A 3IM1A 2GVDB 2R7OA 4DFDA 1Q46A 1AT1B 4LSZB 4NB4A 4ECXA 3EW9A 2B51A 5AQMA 1U25A 4KAIA 4B9LA 5THWA 5DLFA 4CK3A 3MDAA 4NYZA 1KAYA 2G8KA 4E7JA 4C1NK 3NWRA 3M8RA 3I56S 4FLTA 2DHGA 1WKJA 4CFAA 5MLCQ 3K5MA 1Q78A 2GMHA 3O1WA 2HCFA 4J9QA 3RR8A 6FD1A 4DV6K 4DPUA 1V3RA 3KK3B 4M2YA 2AW0A 2E1FA 3QGGA 1LOTB 1NJWA 3HSJA 4QIWD 4FJHA 3A8JA 1NM1A 5AKGA 1JK9B 3P45B 2V9WA 5J2CA 2HQIA 4ED3A 1QAXA 2IVOA 3HK2A 3HHEA 3KZIU 4B9VA 5T7BA 3GE1A 3H8MA 3QNOA 3MECB 2LYVA 3ZDEA 4DI6A 1Y4ZB 2VHGA 2G0IA 2P6UA 2G2ZA 3ZZZA 3IR6B 4KV8B 3G9CA 5KG5A 4Z6EA 1FDDA 2CFXA 2VD3A 4UQGA 1ZQGA 1EHWA 4O3NA 2MKIA 1M1KO 2G0CA 1K9MT 3KG1A 2ZD1A 3DDHA 2M3DA 2O67A 3BGFA 5AKEA 4YG2A 3D0GE 1ZQFA 3HYFA 3PW4A 3MM5A 2F44A 2MJNA 4QWBA 3R27A 1COOA 3Q8YA 2KW4A 1J5OA 4Y2AA 3AOAA 3L7PA 4FW1A 4E7LA 4EYIB 1TK5A 2NRZA 1KL9A 4ZCKA 2K8GA 4U95A 4YN4A 3BYPA 3E2EA 3IR5B 1XR6A 1UVKA 2IAJB 2V94A 2R9LA 4O8KA 2UVVA 1JNRB 2FDNA 3PW5A 1UAXA 2QJ3A 4JYAF 3Q8QB 1KR4A 2E8NA 1T94A 2RQCA 1S6UA 2RJZA 3N6MA 3KHHA 3UE2A 1HNXK 3HRDD 1MNEA 2VIHA 3NGZA 1WF0A 4CJEA 3RRHA 4W5NA 4OJPA 4ZVOB 5BN9A 2JEGA 3RGIA 2YH1A 5LMNK 2XHCA 5BOLA 1HBOA 2XO7A 3BQ0A 5IM0B 2GNKA 2ASMA 4CRXA 3PIOQ 4HI1A 4LIRA 2GC8A 1YT3A 1RHQB 4Y2KA 4RT3A 1TFWA 3CHWA 2PFUA 5ALKA 2WOMA 2HZCA 2QG9B 4N5SA 1VIOA 3CCQS 1FXDA 1SB6A 4QIFA 2YI1A 1CJUB 5L8RC 3RYLA 3C46A 3OFHA 3J7AN 3CCTA 1MSWD 4LBPA 1LEOA 4YORA 3DLBA 2PE8A 3TA0A 2C1EB 2VG5A 3SCJE 2DNLA 3ISBA 3QXGA 1G4CA 3CW2C 3W2WB 2E88A 1SCJB 2XYHB 5DO2A 4WU2A 4ZP6A 3W5ZA 1YRUA 3V9ZA 3DLEB 3ZDCA 3KVGA 2ZE2A 4W5QA 4WPAA 2UZAA 5D4NA 3OYCA 2LI6A 4F5PA 3O44A 1QSYA 1O51A 2ROEA 3FC4A 4DUZF 4LF6K 3MN9A 4N41A 2BKEA 4DR3K 5ALFA 1WLJA 4WK3A 2BVZA 4DUYJ 1N32F 2CNNB 4IOCQ 2C42A 3KD1E 2ES6A 1MQ3A 3E1YA 2Q0UA 4PPDA 5C42A 2I9SA 3H5SA 4DL3A 3F73A 4NY8A 3M6VA 2DD8S 1VQYA 4J9PA 2BJDA 2LEPA 5JTIA 2ROPA 4DR4K 3KZXA 2B7CB 2KRBA 1KOOA 5C2GA 5AQOA 1MWMA 3QU7A 1U6ZA 3UD5A 4JKGA 5CZ1A 1UP1A 4LF7K 4IQXA 2DL0A 3PCOB 1ZQPA 2W9CA 1JX4A 4B9MA 1YVNA 4HVZA 1JWWA 2R2SA 1UAWA 1U6FA 3W9JA 1NDCA 2G09A 4LF4F 4DU8A 4LF5F 5HR6A 3ICXA 5K5MA 2GEMA 1NAQA 4QQBA 2VH7A 3CQ8A 2F8SA 8ICWA 4CZCA 1ZQWA 4F91B 4G3IA 5D0GA 2GV1A 4FP9A 4B3RF 1AQ6A 3VZIA 2HVHA 3C2LA 2AYGA 4DCCA 1GMWD 2ZHBA 1RILA 1DGKN 2FF6A 2GIRA 2V8VA 2O01C 2CJAA 3PRVA 3UR0A 5GINA 4KHPK 3QSYB 2Z0GA 2W4DA 2MZJA 2VKRA 3AVBA 5J2MB 4O5BA 2DF4B 4PXEA 2B4JA 1RGVA 2RF2A 2DB1A 2KN4A 4C3LA 4O23A 4FE3A 3HT0A 3TAPA 4OX6A 1XU4A 3CGIA 3C6AA 4Z6DA 4NLSA 1TL7B 1LW2A 2YX4A 3AFGA 4OZ0A 3VEXA 2ATQA 2BPGA 3MD3A 2ZHAA 2HK2A 3AVIA 2OFHX 4NMLA 4TYAA 2ZOGA 4LC9B 2OGUA 4CYUB 4CEAA 4E89A 1LOUA 4FJ8A 2Z1GA 2KJ5A 2PC6A 1JCEA 3M6GA 4DV7F 4RW8B 2N4DA 1ZM9A 1BIUA 2F7TA 1ZTWA 1IIPA 5KPZA 2HHHK 1WSJA 1GXUA 3PRBA 1CRXA 1XI1A 2HGLA 3IV6A 1SC6A 4M3WA 2FPHX 4M9NA 4YD1A 4CEEA 5BPMA 4KRWA 5E3RA 2XY7A 1S5LU 4ER8A 4FPRA 5LSLA 2V4RA 5IT9Y 3VQQA 1N33K 2WVDA 1HFEL 3NGTA 3CPWR 7ICOA 2I5JA 1QE1B 3N7PD 3NMRA 1ZBSA 5B0BA 1RFQA 3QT7A 3HPHA 4DDFA 5A76A 2QWNA 3KWGA 4IFVB 2BZ2A 2E29A 1U1QA 5HQ8A 4X66K 4UW2A 1NKBA 4IDHA 3VF4A 4C8ZA 1JLFB 5AQRA 4BX9C 5B08A 4QIGA 2DPIA 2GVDA 2F9WA 2O8DB 3TSUA 2HS0A 2OA8A 2ZWOA 4AXIA 3LZJA 1SWWA 3NAEA 5FPMA 1HR0J 3CC4S 3ZZ0A 5EN1A 4ED8A 3ITHA 3D68A 3J7YP 3CJKB 5IIKA 2OZSA 4F2SA 2WUSA 1ZETA 3LTOA 2M7SA 4CIEA 3OYEA 3W5XA 2J76E 3TSQA 4K4WA 2OIHA 3CG7A 3AOCA 3RMBA 3V1QA 3IWXA 3J80O 3VAMA 4P0PB 4J5OA 3SPZA 1Z4UA 3NTUA 3RJGA 1VQLS 1NUEA 2BCUA 3IMXA 5M2RA 2QWOA 1N62A 5D0RA 3Q8LA 5AKYA 2Y9HA 2ZBQA 3OPKA 4FZMA 1W7WA 1YZ6A 5HANA 1TL4A 5KNIA 4HTUA 4NYOA 4IG0B 2VA3A 4BLGA 3BGRB 7ICHA 4AL5A 4K5SA 1LK5A 4Q45A 3B82A 3MOJB 2AGOA 2EAOA 2QK9A 4IFVA 1NKEA 5KOWA 1V97A 3CNHA 1F2GA 3SI6A 3TYTA 5KAFU 1YJWS 4HHHA 5BREA 3M2RB 1QZ6A 3ULHA 2PXIA 2WBNA 1KVBA 2J6UA 2ZD1B 4TY8B 2H48B 1ACMB 1PK3A 4KIAA 4CEDA 1RXWA 2A10A 2HGNA 2PMWA 5T7LA 3O3LA 2NYIA 2NSCA 2RKIA 4BE0A 5J2FA 3CF5Q 3VGUA 5G0RA 4KLHA 3ZD8A 5KQDA 4KYZA 1UEKA 4FWQA 4PXBA 3DJCA 1HNIA 3IFRA 2VC0A 2FQQB 5ADZA 3K75D 1RP5A 1T8EA 4XK8C 4Q43A 3THYB 4Y6IA 2ZWPA 4JNEA 3TWHA 3WIUA 2E1AA 1FJ7A 3EKSA 2GX9A 2YNHB 3CCMN 4CJTA 4B3TK 2C2ZB 2KB2A 5EVZA 4KJIA 1PYSB 1NM2A 8ICJA 2NRTA 2ZNZA 1ZZNA 2WCXA 3L3VA 2ZJAA 2V67A 3EGVA 1XO1A 1FD8A 3H5XA 4OYMA 4LF8J 1BXNA 1N2XA 1KQQA 2V68A 5E33A 1HBOB 2YXLA 4DPYA 4DQRA 3D7EO 2V8DA 2DGUA 5J1PA 3H0PA 2PMZC 2E1EA 3BKFA 3D1HA 4NYNA 4FK2A 3TP2A 1ZQRA 2QE5A 4WIQA 2XRIA 5G4DA 4LY7A 1YTAA 1RI7A 2ZUAA 2GHPA 1JLQB 4DS4A 2D41A 4J7CA 3WK9A 4OX7A 4CZEA 3DXKA 4J9MA 4IC9A 3PLAA 5FROA 3BBFA 1X5TA 1F5BA 1SV4A 4X64K 3O08A 5JS1A 1C20A 1Y5LB 3KK1A 2X6SA 3FFIB 1SV0A 3R5JB 1N5XA 1ZBIA 1WAJA 1ZQQA 1FI4A 4RNNA 3H2VE 2G2YA 1GNKA 3V7JA 1F5SA 1DTTB 2HBLA 2D0OA 1N5VA 4KH6A 4I2AA 1UW9A 3H90A 3CDAA 1S4EA 3AB2B 4ZH4A 2E20A 3NY0A 3BBBA 1J2NA 4A5AA 4RQ5A 8ICPA 2B0CA 3ZX2A 3GIKA 3MAAA 2V52B 1ZD2P 4C8OA 2IJNA 3C2MA 1NXIA 4JK1A 4WFNQ 4DU4A 1LVHA 4I2CA 1N34F 4KLLA 5MLCV 1AB8A 4WXWA 2PFOA 2HBZB 2A40A 5KFYA 4AP9A 5B7WA 3WNFA 1S0VA 5L38A 1LCUA 3I5CA 5KRTA 2NLXA 4HDGA 3RBDA 3B78A 2YMMA 4ED4A 1E4GT 4YMNA 7ICNA 4B3RK 2BGWA 1H0HB 1FHTA 4YMOA 5H9EJ 3SMVA 5C24A 4TXSA 3DWLA 4DOZA 4PL1A 4PKHA 4JI7J 5D46A 3KK3A 4JI4K 3CCSN 1ZJMA 2ZITA 4H5RA 2FC0A 1EWQA 2IAJA 2ZIUA 3FFIA 2YKMA 1S7HA 4YR0A 4Y00A 3MCPA 2NUBA 5ELZA 1HYVA 3LPEA 1HKAA 4M5GA 2OMLA 4IOCL 4J9SA 4DN0A 1XNRJ 1RT6A 2R7TA 5KI6A 3GFYA 1J2VA 1VQLN 2C3UA 3C21A 2AJQA 1L8LA 4O5EA 1IQZA 3ICLA 1KQFB 2O4GA 3U6FA 2R8IA 4LFBJ 4I7FA 4KHPJ 1VLBA 2YX7A 5J2PB 1RLCL 3IKMA 3THWA 3V81B 4DG1A 1OXJA 3C1YA 4M6WB 2Q43A 1T9TA 2VWKA 1PCAA 3DM2B 2XWXA 4G1QA 2V4QA 4ZPDA 2WRMA 2AP1A 2M9NA 2FSJA 3D1OA 2ZH1A 4LF6F 2B9XA 1NWKA 1UEUA 1L7NA 3W2VB 2B3TB 4C7ZA 4USMA 4LRDA 4CH0S 4DPXA 4LF4K 4CGJA 3I87A 4CYUA 4PQUB 1X2IA 4EX6A 1ZBHA 4EWTA 4P2FA 4F5OA 3NS7B 3H0LB 3CCVS 1YTYA 5KFBA 1IKYA 5KFXA 1HBUB 1X60A 1KD1O 2HHUA 3X3UA 4X4PA 3VPZA 3CDBA 4I28A 5BPNA 3ENVA 3ED5A 2DFFA 1JNZB 1JRPA 3QE9Y 3SXLA 4C4RA 4DXLA 1IH7A 3PJ9A 4CLSA 4B1WB 1CZAN 3CDUA 1C0GA 2A2DA 3L5KA 1UCNA 3NF8A 5E84A 1PAUB 1N32K 5GAHP 4A8XA 4FLYA 2CJQA 3CIZA 2ASOA 4ILJA 4GXJA 4JI6J 2E1RA 4P9SA 2GOLA 4DUZK 3C15B 2G8IA 4MKVA 3TARA 5EY4A 1D9AA 2EX3A 5KTQA 4ILGB 4JI2J 1T9XA 2WOMB 1NLVA 1FNOA 4FWLA 2BCQA 4TSXA 3T5LA 1RKJA 3OYNA 2LCWA 3LALA 1J6ZA 1JLFA 3QEVA 4C7QA 4DR3J 1W26A 1M90O 2YTCA 1IKVA 4DN9A 4USAA 2OH2A 5GTIU 1MQ2A 2MHEA 1X4AA 4K7QA 3OR2A 4LZDA 1HWJA 4HT7A 4O44B 5C2DA 2HFSA 3GMGA 1IKYB 4OJ6A 4KLIA 3I9V9 3L2WA 3FEYB 1RT5B 4Y2IA 4ZN3A 3J7A1 1RADB 1JL2A 4JI3K 3MXIA 4CGFA 4B6JA 2PSZA 1U1LA 1XMBA 4KN4A 1Y3KA 2VL1A 2YQEA 3AD8C 4YXJA 2YQ3A 2CJXB 5AQGA 4UARA 2WVEA 4DTNA 5LMNF 3OPXA 2FVRA 3SCLE 4QU6A 2PYLA 3G96A 3JQJA 2KIVA 1IV8A 4Y2RA 2RQKA 5D4LA 5JVHL 4IJNA 5E3AA 4ZN1A 3AU2A 2ZBRA 3R9LA 2ATLA 1YIJN 4YFUA 2F1JA 2YHXA 1BA1A 2JH7A 3ZNUA 3U1NA 1T3OA 4JRPA 3LVWA 1HNVB 3ZSYA 4DKWA 4BRNA 2G8WA 3J81U 3PX0A 2A1JB 5ALQA 1LW2B 1Q7YO 1LK7A 4PL8A 4QNLA 1Z1BA 4CJ7A 1T9WA 1QDUB 1FX2A 3FQKA 7ICSA 3ISND 2R7WA 4R64A 1K9MO 3HD2A 5F3TA 1ZD5A 1B92A 4L74A 1HPMA 1X7VA 1PIEA 5C0YA 1R3NA 2W7AA 1GFWB 1XO0A 2KJWA 1HNIB 4RT2A 4J37A 3K89A 1VSHA 3JSRA 4DQIA 1N8RT 2CGKA 4FNHA 1C1BA 2ZM6F 4WFBL 2HLTA 5KFVA 2ASYA 3BUZB 3SQIA 3T6JA 2XICA 1VC6A 7ICJA 2B21A 2QV6A 2CDRB 2ZUDA 3V6DB 4OX9J 3RBZA 3E66A 3QBWA 3RJMB 2CJ9A 5IILA 3B4DA 2I5JB 1A5VA 4LUBA 3S6JA 3ZETA 2MPUA 4DPWA 3DHWC 3CJQA 1C0TA 1OSCA 4UZBA 2VC1A 8ICFA 2CRXA 3QFWA 1DQ8A 2P9GA 3MCSA 3MCNA 4O0JA 4H4MB 2LDYA 3QQCD 2C22A 3G6ES 2E8PA 2ILZA 1CJVB 3OXGA 2KXFA 4IR1A 2CQ2A 3EXCX 2P9SB 4A2AA 1JLBA 1JLQA 2BKOA 3IWLA 3AN1A 1YSJA 4MLEA 1P8GA 3DOLB 1M90T 3K9JA 4YOEA 2D6FC 2ZJRL 3KG4A 1K0TA 5LXYA 4OV1A 1N5YB 1PC4A 1M5OC 2KZZA 3CJ0A 1X66A 4RR5A 2ZZTA 3FZMA 1SH2A 4HUFA 4OPJA 2VF3A 3GG0A 1IXKA 5CAAA 5C25B 2DIVA 2PBDA 3H4BA 3A3PB 5J2QB 1RT2A 2LSNA 3P83D 3M1VB 3VESA 1ZH5A 1VC5A 4A8QA 2DXDA 3E01B 5FLXU 1N6QA 5SWMA 3VMFB 3J81Y 2KG1A 4TUQA 5M1KA 2O8EB 1C4CA 1NK6A 2LQBA 1EQYA 5ALPA 1NSPA 4JI6K 1KKHA 3VQ5A 1UFLA 2NXCA 4C0HA 4UUXA 1LWEA 3QX7A 3AXKA 3W3SA 3A2FA 1IR2A 4EAHD 2XBPA 3RVCA 2ZM6K 4M04A 4KLFA 1HBNA 2FVQA 2RQ4A 4L8RB 1FIQA 1K1SA 1J9AA 4DR7F 1ZQ1C 3KNGA 4WBFA 4CJKA 4EZ9A 1DLOB 1JXEA 1UWBB 5HSPA 3CJBA 1RXOB 2PEHA 2RKIB 2A5XA 3OHAA 3A8EA 4P0PA 2BPFA 4QU7A 4AT1B 2HOEA 1U04A 1X6JA 3ZDAA 4ZVQB 2E5IA 4IWVA 3MURP 1Q8LA 1KD1T 2C3YA 1RQ0A 2HGMA 3UQSA 1UVMA 1NNLA 5H9FK 1AYEA 1XN9A 1AROP 2H5JB 1SQEA 4KPCA 4RNOA 2ZH2A 1HQEB 4UW9A 2QWRA 1EKEA 1IBCB 2HZVA 5D4OA 1X40A 1KDHA 3QBCA 3P38A 1O6XA 2CVEA 3D28A 1EO1A 5GADU 2BJ3A 5FLXO 2GMJA 3G4SN 5K8NA 2KRRA 4OYBA 1FRMA 3R1HA 1Q95G 1Q82T 3SAGA 3MGVA 5F8MA 4LF4J 1F21A 3OBWA 1VQ6N 3L2RA 4M6WA 4NYFA 4LRCA 4KPYA 3HHLD 2CPYA 3SSRA 4M5MA 1RA6A 2R7XA 3A13A 2ZWHA 2NRHA 5JLHA 3DLGB 3W8PA 1U4BA 4EI2A 3IBWA 2ZVSA 1VRUB 4OLBA 1NKCA 3N6LA 3B0XA 3F2DA 5LSRA 2OEHA 5F9NA 3HXMA 4ECRA 4MEXA 4AHRA 2ERRA 5ETLA 3LAMA 1B0XA 4J2BA 1SI9A 3GV7B 3AA2A 3RZAA 2HFZA 4DV5K 4WQ5A 3GYNA 4IOAL 5KG6A 1YWXA 2HWHA 1G1XA 1PJ5A 4B3OA 3T1HJ 1ZQEA 4LFAK 2FB0A 2I1RA 3R2CJ 2HSTA 5LSOA 3H3NO 4J9KA 1IUJA 4USVA 4EK2A 2CIMA 4GKJF 4NLCA 1T05A 1DTTA 2E2NA 1Z4OA 2RDJA 1BNPA 3Q23A 2D3O1 4NLOA 1VQ9S 3BZQA 1N63A 5C15A 3BZCA 1EAYC 1AA1B 2OTLS 4Z0UA 2JVRA 3T5JA 4RZRA 4CLWA 4O5CA 3DMJA 2YMQA 4AD6A 4RU2A 4FNIA 3H4DA 4KLQA 2LU1A 3RJJA 1U1OA 2DNKA 3MM5B 3WEEA 2HFUA 2FHJD 3ADAC 2BE2B 2Y9TA 3DXKB 3PVXA 2RDIA 1J5EK 5L1MA 1GLJO 2NR0A 3GJRB 4FK4A 4WU3A 5K14A 1P9YA 4O4GB 1UEVA 1LQ9A 4BRHA 3M8YA 4EO6A 2E1ZA 4GVBA 3DXMB 5E41A 3D6TB 3ZC4A 4WKYA 5JS2A 1RABB 2JFKA 4C4SA 1YBTA 2GO8A 3EO3A 2G9OA 4J2AA 1D3WA 3DXBA 3PRDA 4RW7B 5A8RA 4J90A 1VHIA 4ACOA 2GHWA 3DLEA 2VG6A 4EFAC 2YQ0A 3MAAB 5A6PA 4M9LA 3QMQA 2ZGZA 2V8PA 2FMQA 4KB1A 2FHJA 3CB4A 9ICGA 4FF3A 4Z37A 1R89A 5LM7E 3TVKA 4ICLB 3TAGA 3R7BB 3NGYA 1B9FA 3MM6A 3GCWP 5DB6A 1DGJA 1HNVA 3BB5A 3I5BA 1ZAVA 3TNVA 1VQ8N 3GDQA 3HBTA 3MMAB 3LDPA 1ASUA 2OEMA 4CGGA 1MROA 1QVGM 2PD1A 4OV6A 2NREA 4JI4F 1TL3A 3ELHA 3ISNC 3FSIA 4FJNA 5HN0A 2ESEA 4KHNA 4BC9A 2RUSA 2LEAA 4PABA 3W2WA 1C4AA 3HX9A 4FVUA 2WTFA 4F67A 1BLUA 2EXUA 2YNFB 3RF9A 3MPVA 4DB3A 4O4GA 3GSIA 2IRUA 2OHDA 1WF1A 1D5AA 2BCVA 3FUYA 3N7RC 3SK3A 1JMTA 1I94F 5LL6Z 3MEEA 1KS2A 1S72N 1FEZA 3NRZA 4TURA 4H0XB 5KG3A 1A6LA 2IGIA 1TE2A 5A8RB 1GT8A 3DGPA 2PGCA 4DV3F 2XSFA 4GV9A 2V0NA 4ZVEA 1VMBA 1ZJNA 5KL8B 2BH1A 3LK9A 3KBBA 5EX0A 1RWPB 1V9PA 2WAQD 1OH6A 4K5RA 3BH7B 4NEZA 2ZJQQ 3HHDA 2D0PA 1H2UX 4FWKA 4BRFA 4C0OC 4NLRA 1CZBA 5ALLA 5DBCA 1SJFA 3DOMB 3UM9A 2UXCK 1TAMA 1RJJA 5HJYA 3V4IA 5DLGA 2HK3A 3SAHA 3GWCA 1BI4A 4G1IA 4BGDA 1N56A 2WF9A 3MMAA 2RU3A 1S0NA 8ICXA 4YCXA 1B0PA 3JXOA 4GV6A 1CJVA 1HNXJ 2B8PA 2B56A 5J0QA 1VLYA 2P9LA 4MN4C 2W43A 5IZHA 2BOPA 4W5TA 2KJ9A 4GVLA 2BRKA 3C66A 2PFNA 1Z2ZA 4QR2A 2HIYA 4O44A 2M9KA 3RWUA 2NXJA 1S9EB 3K1ZA 1VAZA 1KAXA 4MFBB 1QUVA 3JSBA 1QSLA 2HOQA 5FD1A 4AM6A 4AQYJ 1WSIA 3SMZA 4H5WA 3F2KA 4CHOA 1DZ5A 2MKSA 1H72C 1K1QA 2QKBA 3L4BC 2HVZA 4M5DB 3K5PA 4M41A 2BA9A 3E01A 3TJ8A 4JAXA 3OSPA 1NGFA 1XS9D 3JQMA 3WQTA 5J0OA 4NMXA 1MU2B 2ZH9A 3F0NA 1ZXIA 1KHWA 1QE1A 1FRLA 3QYPA 3PW7A 1L7MA 3F9KA 3DLHA 3OS0A 1RAOA 4L3KA 4DR2J 3AVKA 1S5ZA 3BGUA 3EE3A 3OLAA 1B99A 3PSFA 1FTCA 2K06A 3VALA 5KFZA 5F0UA 1GOCA 3CCJN 2E5LK 1IWAA 4NZ0A 2EQYA 3GP9A 2H3EB 3CFPA 3QBXA 3KXDA 3IGNA 5AFUH 2ETJA 3CCUS 2LKYA 2KG5A 2BXJA 5DQIA 3FEZA 5KG4A 5IV4A 1KXPA 1TK0A 4GXIA 2UP1A 4J9LA 2CUYA 4QZFA 1F2HA 4CJ3A 2CJBA 3W9IA 4TQSA 3VQTA 5HJXA 1REGX 4CF9A 1D8LA 3HHKA 2DEJA 3LAKA 2NNWA 1LW0A 1ZTTA 4DX8H 4C3MA 4KH1B 3AMZA 3SFGA 4NA3A 4KAZA 3FBEA 4OPAA 5BYSA 2RH3A 2ZOMA 3ZCMA 4QZHA 2DNYA 4M5DA 3CMQA 3ZTPA 3RH4A 1GEHA 4HR2A 2XQCA 3QFPA 1JLCB 3ZLJA 1LWFB 3I4HX 3NMUA 1XUPO 4M42A 2KQ2A 4US8A 5CXTA 3T1YF 5C10A 4A47A 3KLFB 2CN1A 2BMBA 3KNAA 2DFEA 4JS4A 1H2VZ 5HATA 2CAJA 2K4HA 3WQUA 2LP4A 1RHMB 3AJ2A 1ZQVA 4DSIA 3FSXA 1HD1A 1UOCA 3KWIA 1K0VA 3PZPA 3V9XA 2XS2A 3GV8B 5IIOA 4QIWC 3AD7C 1TMJA 4H4OB 2CPJA 2Y0SD 2JV3A 2DPJA 4KI6A 2P9SA 4KI4A 2YWWA 1SB3C 2N4CA 2EFGA 5HRRA 2JL9A 3VF2A 3K4GA 5AJ3K 1XNSA 3R9PA 3WXMB 4WF9L 4BC2A 4NLZA 2WB1C 3V6DA 1MA9B 3H0RB 3IBCB 3OHRA 5DK5A 5ETVA 1RWXB 1WC4A 2JDJA 3QGPA 3F5TA 1NJXA 2MKHA 3M05A 1NDLA 3DI6B 1YJNS 4GVEA 2YNHA 5D3GB 3PMNA 2Q31A 3IG1A 5J2QA 3ZETB 4DOCA 4MFCA 1LXNA 3AO4A 2F3NA 5A8WA 1Y11A 4MFFA 4DTJA 2PAVA 4I6AA 3J7YI 3K17A 3VQ6A 3AO1A 4CW7B 3Q8RB 4XO0A 1N33F 2KI2A 1OS5A 2ACYA 3A5NC 2F9JA 4PL2A 3CJTA 2LU2A 4O9MA 2W11A 3OYKA 3TVZA 4A8KA 3TUZC 1V4SA 3DOLA 3BQ7A 3CI5A 1HYSB 2D0CA 5G0RB 4IFEA 1HBNB 4QYZK 9ATCB 4BE2A 3ET6B 3R6LB 5ETQA 3VQCA 2KYXA 1UJ5A 2YHAA 2LQJA 1C6VA 1RDFA 1Y5NB 3W1YC 2B9YA 5DG7A 5D6GA 5C25A 3ISZA 1SXDA 3C14A 3FSYA 1VK0A 3JS6A 2H3ZA 4MO4A 1RWUA 3I5AA 4DUTA 4E7KA 3S9HA 1SAZA 3CMEN 2QTDA 3MWBA 1N6QB 4LVSA 4AYBC 2G1DA 4JKEA 3MGJA 4OGCA 2VG6B 4USHA 2LECA 4OYZA 1BQXA 2DGQA 4Y3CA 1JI7A 3SIPB 1UTAA 1S77D 2NV3A 1QJHA 3DCAA 4ETXA 4F02A 4K8XA 1Q81T 3PG9A 3WC2A 2EHGA 4R5PA 4B3SF 2AH5A 4RLEA 5GAGP 2ZTDA 2K3KA 3FK4A 3AEVA 4NXMK 1WWHA 3GFHA 3K9KA 3IM9A 2HOFA 3HHLC 3DLGA 4C4TA 3O9UA 1KVAA 2QO3A 5KRSA 3SMSA 2F4VK 9ICMA 2XMMA 5EE9A 4FYWB 2UVWA 1A5WA 3UCUP 2A42A 3ILIA 3CM5A 1OMSA 1HHTP 2X51A 4X4OA 4IQUA 2YNFA 5GIOA 3TZWA 3VAIA 3KJFB 3EL2A 3C6HA 4MTPA 3R6MA 2IDOA 1S57A 4RPYA 2AP6A 5HQMA 1URNA 1KAZA 5BPCA 2VFVA 4MF8A 2OAUA 3EJMA 4QZ8A 1WOOA 4FK0A 1Q81O 1SL2A 3AJ1A 3NGKA 2VB6A 1CC8A 5G5GA 3NGSA 3UQ2A 4FJ5A 3MR3A 4EBEA 1RT6B 3GFKB 5FPDA 3WX4A 1NGEA 3BF1A 1DAXA 4JKFA 5KT5A 4DTOA 1CC7A 3F9MA 2XMJA 2NZ4A 3THWB 3DMJB 1NZ8A 5DQHA 4DV7J 1BI4B 3C95A 2QMXA 1YX2A 2HFOA 5HQLA 1HJOA 1CS4A 2DNNA 3QZ7A 2XY5A 1FFWB 1EJ7L 2LYHA 3RJEA 2FVPA 3GE9A 4J8FA 2RIJA 1AXQA 3CC4N 2HBYB 2K7JA 2BBEA 3M6WA 3E9LA 1MWYA 4HDHA 3W7BA 2DH7A 3G6YA 2L9DA 2YKMB 5CH7B 4LFCK 2P9CA 1REVB 2QT7A 4CGHA 2HWTA 2LEBA 4I2DA 1B0VA 1S9EA 4M5HA 3ID6A 2HSZA 2DJWA 5EOYA 3KOAA 2D7SA 3UKUB 4ZOHC 1NK7A 1X4FA 2N7CA 1LWCA 4DV1F 2Q79A 3EICA 1NJYA 4OYWA 1YJ9S 1IBKK 2J6SA 4TLRA 2ZM6J 4CD3A 4C3KA 3BV8A 4HHUA 3DM2A 2MGZB 1LFWA 3R6GB 2CJKA 7AT1B 1BPEA 1FF2A 1TKZB 4EIAA 3UR3C 2D4WA 7ICQA 1GO3F 2WHOA 4JD2A 4B9UA 3FLCO 3VTHA 4PHPA 4ZOSA 1RDBA 4GW6A 1V38A 5EHHA 3WT0A 1F5AA 3CCUN 3LWMA 1GTEA 1FDBA 4K4YA 3SR6A 3OYFA 4IH7A 1M5SA 4WWSA 4F5NA 1GLBG 1IKVB 4EUVA 3VQ8A 4DR6F 1RAEB 2KP7A 4C8YA 2DISA 4B3MK 1HQUA 3JTPA 3V9WA 4CZFA 2FC8A 3DEEA 2JC0A 4U7CA 1REVA 5DQGA 3VENA 2HFNA 2Q36A 2A0FB 3LP3A 1QM9A 3DLKA 4JK8A 3VQPA 3V9UA 2X74A 3VQSA 4BQLA 2EWSA 2WK4A 3EVWA 1PG5B 4F93B 1PZNA 3G8QA 1ILYA 3TR8A 1UPMB 3B9JA 3HJVA 3FZFA 1SQKA 1U2VB 3BREA 3DGVA 4HTJA 5EX5A 4PG4A 1O5JA 2PZSA 3IO1A 4M3RA 1ICEB 2QYCA 2D3ZA 4DR1J 1PBAA 2NZTA 2ZXIA 3MM6B 1W9HA 1YJRA 4U6PA 4ECWA 3K1RB 4P7VA 5ALRA 4CM2A 3CXCM 4OI3A 2GQQA 1N5TA 2R7SA 2WF5A 3CJ1A 2J0QD 2YWEA 1GOBA 1F5CA 2VG7A 5JJBA 5H1SV 1ROFA 3DC2A 3V4IB 2LHTA 5I4MA 5KT3A 2BJ8A 2H3FA 2X3GA 1B7YB 3ZDBA 1O1WA 5DB8A 4N56A 4OGEA 4DU7A 2XZDB 3O4NA 4DSFA 4OI0A 4N77A 2K1RA 5AKIA 3IN5A 1PO6A 1VSJA 2BOAA 5FJ4A 3SSQA 4F4YA 2ROGA 4QS8A 1IR1A 2GX8A 3BO2A 5KG7A 2W9AA 3DGPB 4HCBA 2EC2A 2YCHA 3UFCX 4V19X 4KHWA 4MFBA 2UU9J 3OYIA 4DR5K 1Z3EB 2FPLA 3RH6A 3Q0AA 4IJAA 5I3QA 5D3GA 1TQLA 2JC1A 2JH3A 3AA4A 4LJXA 1BO5O 2FHMA 3TACB 2W2PP 1YJTA 4CBXA 1D09B 1RDRA 4CQ1A 3U9DA 4J2DA 1KQGB 3ILJA 4JYAJ 7ICEA 5IIIA 2UV8G 1RCHA 5LJ5Y 2KHVA 2XG8A 4ZDNA 2CPZA 4L72B 4RU9A 1KKXA 3QUBA 2UU9F 3NLCA 2MQPA 3QIDA 4CJRA 2IHMA 3GG1A 4J03A 5BJRA 3BPDA 2DNRA 1GMUA 1T11A 3I56N 1ZBUA 2QKKA 1UL3A 2HHHJ 4DV4J 2NUUG 2K1RB 4F5QA 1UZHA 3EZOA 1JLBB 3TUJC 4NEYA 8ICBA 4D3GA 3KLGB 3CCMS 4PGQA 5AXKA 8ATCB 2UYTA 5CD4H 4NLVA 1LW0B 1AZSA 1S8OA 4RBUA 3LO3A 4UT4A 2DO4A 3JSYA 1F6TA 3THPA 4XPCA 1BA0A 4BR7A 3ZDDA 2IRYA 3H08A 2K4IA 2M4MA 1WCNA 1DY3A 2OSQA 4KH4A 2IDLA 2WVFA 3K59A 3B8AX 1Y97A 4KC5A 3HILA 3R3LA 4MLHA 1N32J 1NEEA 2Z2YB 9ICVA 3OBIA 1ZM2A 2FGCA 4FM1A 4QZIA 1RBVA 2ACMA 3G25A 2MZRA 1WWVA 3ZT2A 2DBYA 4BRCA 4KH0B 1HL6A 3IBFB 2BV3A 2DFHA 4S0MA 4UB6U 1T3VA 3TI0A 3K5NA 3QT5A 4OHWA 4H5NA 2HYIB 4YY3K 3BYRA 2VYPA 5DG8A 2MHNA 2A41A 1BG3A 2ATCB 4AXJA 2GIQA 4C11B 2YMLA 3UCGA 2CQ0A 1N5YA 1NBEB 3G6EN 3QO9B 8ICMA 5AKHA 4K8RA 3L7OA 2OUGA 1U2FA 2NPFA 5AKJA 5K8OA 2VKZG 4RKUC 1RT2B 4F8RA 3THTA 2IRXA 1WORA 3HCXA 3JPRA 3J7ZO 4OZ1A 2QFJA 1TAUA 1YJUA 1TV6B 3MECA 3IG1B 3ATVA 1HKBA 4H0OA 4UASA 5ETSA 2Z7JA 5GAGI 4I27A 4LR8A 5AKZA 3IM8A 3NH2A 9ICEA 3G8TA 2GWJA 1DQ9A 1ZQDA 3CCRS 1VCTA 2MSSA 3QDKA 2MDAA 4KLEA 3U3GA 4X62F 1ZAXA 1WAFA 2E5HA 5DZ7A 4Q0BA 2OPQA 3QSIA 2ASJA 4GKJJ 2ZJ5A 4U96A 5AE2A 1VRUA 3OTOF 3BSNA 3EE9A 2VQEJ 2W8LA 4CTAA 3WK5A 4HCCA 2FY8A 3PUFA 1FTRA 4YDXA 4A62A 4USKA 2XMKA 4FO0A 2XLJA 1IM6A 3HKWA 4UATA 4LF8F 2DK2A 2WVCA 1X8DA 2PFQA 3DDKA 2UXBF 4CK1A 4QAGA 4K4TA 2BW2A 3HTVA 4X65K 4JWMA 3TPQA 1HQEA 1Z1VA 1WTBA 2BR0A 4RBTA 1GMVA 4DO9A 1Z6RA 2P51A 2HIQA 2VJ5A 4DHVA 5A8WB 4DV2F 1TKXA 4I1TA 2M2BA 2M8HA 1S99A 4FS2A 1QCKA 4CI6A 2DNZA 4FJXA 1R8CA 3MWPA 2FZCB 3BR8A 3C7NA 1T05B 1ATNA 4V19S 1ZQMA 2MGZA 4Z6FA 2Z1JA 2XGPA 3OTDA 4EU0A 2HI0A 3GIRA 2ZKUA 2NQPA 3NGRA 2WVBA 3KHYA 2QB0B 2DGWA 4Y65A 1AFIA 4CIGA 4K4HA 2CWKA 1MN8A 3C0BA 4Q0BB 1CJUA 1Z25A 4M3XA 3VEOA 2GO7A 3JAMU 1DFDA 4RBVA 3O4QA 4CF0A 4CTAB 3GJSB 2LQ8A 3VVTA 3C14B 1WSRA 4MMOA 1HQUB 4ED5A 1MWQA 4H4KA 5AQNA 2XIDA 1KQSR 1SKSA 2IA0A 3U1LA 1VDHA 3NRWA 1D8BA 3A0HU 3M9NB 3RB0A 1ZQTA 4FFDA 2F96A 2E1YA 2UXCJ 1N36F 4NLBA 1UJ6A 5HVGA 1HJRA 3SZ2A 2DRBA 2VPWB 1TFRA 1VDVA 4R5PB 5F8JA 5H9FJ 2LMIA 4A8EA 3AM9A 2R7QA 3PX6A 1B0TA 4UTGA 1SJ4P 3TAQA 3BS7A 3LANA 4B8AB 1WSVA 1T4GA 4LIWA 2E1CA 5B0FA