1NK9A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after two rounds of primer extension, following incorporation of dctp and dgtp.
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk9A01
2P6RA 2FLLA 3ZDBA 8ICZA 4I27A 4MFCA 4ELUA 4KN4A 9ICLA 4RPZA 4OGEA 3OYDA 9ICBA 1RYSA 3QEWA 2XGQA 5KFMA 3ZSZA 4KLSA 8ICKA 5CR0A 2FLPA 7ICOA 4CIEA 4IFYA 3KTQA 1TGOA 4FBTA 3VQ9A 1KTQA 2GUIA 5J2BA 1S9EA 2M9NA 3TFSA 4CHPA 4O5KA 1IO2A 8ICVA 1ZQXA 3RWUA 3RJKA 4O3OA 4CK3A 3E01A 5DKWA 1NJWA 4M3YA 1L5UA 4FCYA 4LH4A 3H40A 4CF0A 7ICUA 3HVTA 5J2KA 4FJLA 4PHAA 2WTFA 3OYIA 1CXQA 5DQIA 4Y1CA 5KG3A 3JPPA 1NOYA 3B0YA 1RDDA 1S76D 2ZTDA 3PW4A 1ZQFA 3KHLA 3K59A 4CK1A 3B6OA 8ICUA 2HHXA 1D9DA 5DBCA 2W9AA 4RQ1A 2PFPA 2WONA 3D0PA 4KLIA 4CK2A 2VANA 2ASJA 4H8KA 1Z26A 1ZQGA 5C24A 4NLKA 4DTUA 2ZUCA 3AUOA 3OS0A 2DFFA 1TL1A 3OYHA 3DI6A 1YVUA 1KLMA 1QE1A 4FJIA 2BQUA 4CJ5A 3QEPA 2XCAA 2IMWP 3VQ6A 4I2JA 4JV0A 4O5CA 3WNEA 3MFIA 2UVVA 1MC8A 2B5JA 2UVWA 4DS4A 3DYAA 4UAYA 4KTQA 3OSNA 1JN3A 3U3GA 4UB1A 1CXUA 4Z6CA 5SZTA 4F5OA 3LALA 4FLTA 1VK0A 3NBPA 2A1SA 5CA7A 3NDKA 3TR8A 4ECUA 8ICLA 2IGIA 3LP3A 1FKPA 1B9DA 3QERA 1NK7A 4KLQA 8ICAA 3HWTA 1JLFA 3NH0A 1SL0A 3JSMA 4YNQA 1S97A 3DRSA 1SV5A 3SJJA 3F73A 4P4PA 5J0TA 3IM1A 5KG1A 2C2DA 3AA2A 3IHQB 2YNFA 4CJSA 1EP4A 3QEIA 4Z0UA 3AA5X 2W9BB 5KFAA 8ICGA 1JKHA 3KHRA 4LY7A 1S10A 5BOLA 5HRRA 3JYTA 3FFIA 3O4NA 4GLXA 1ZQZA 3ZT1A 3H8SA 4DFJA 4PA1A 4RW9A 2JZBB 4KHWA 1Q9XA 7ICPA 3T3FA 3OVNA 1ZJNA 2BQ3A 1L3SA 1JIHA 3V7JA 3RJHA 1I39A 1Y88A 1TK0A 4NLNA 3U6FA 1ZQJA 4M6WA 4HHTA 1NJZA 3MABA 3TAFA 5KG5A 3KK1A 4KI6A 2MUTA 4O3QA 1ZQNA 2KTQA 4EBCA 4C8LA 2PI5A 3V81A 3JPOA 4CJRA 3SI8A 3O3FA 4NCAA 4KLDA 8ICJA 1LAWA 2BPFA 5DG9A 4Z4HA 3TQ1A 2HNZA 4DEZA 4CFCA 2R8JA 1IKXA 2HW3A 4O0IA 3T5LA 3V6JA 3L3VA 4J2AA 2HHWA 4KLOA 3M9MB 1LW0A 1T7PA 1J9AA 4TUPA 4GXJA 1RT1A 5KGXA 4F4YA 7ICHA 8ICSA 4IBNA 1RXWA 4DTJA 5KT6A 3RMCA 4ZHRA 2W8LA 4IQTA 2PFQA 5J0SA 3AO1A 4IRCA 5L1KA 4EEYA 1LB2B 2FMPA 3TI0A 4Z4IA 2BCQA 3PNCA 4G3IA 1S0MA 4Q43A 4PHDA 9ICMA 2BDPA 2W42A 4M2YA 4O3RA 3AA3A 1BQMA 2PYJA 3DRRA 8ICBA 4RT2A 3BQ1A 2BCSA 2I9GA 2PZSA 3C2KA 2EHGA 3HJFA 3OYEA 4JRPA 4CHOA 1O1WA 1TKDA 4FJ9A 4YMNA 5J1EA 4B9NA 2ITGA 4O44A 5D4BA 1U45A 4RQ6A 3UXPA 2OPSA 5DG8A 4E1MA 2FBTA 4CFDA 9ICAA 9ICTA 4OJRA 4CJKA 3RRHA 1RDAA 3ISCA 5CZ2A 4BDZA 3RJEA 1ZQYA 3OYKA 4YMOA 4FLYA 4DFPA 2G8VA 1PZNA 1ZQLA 3ZCMA 2R8KA 3M8RA 3SQ2A 4FM0A 3MR5A 2RDJA 3LP1A 4KTZA 9ICUA 1RT6A 3DMJA 1K1QA 2GBZA 2F1JA 2RF2A 4DSIA 1HRHA 4J9PA 5J2FA 4FK2A 3MAQA 1NOZA 3OJUA 5HNKA 4QWBA 4FJHA 7ICVA 2V4QA 2G8WA 1J54A 4I2CA 1RT7A 3PW7A 4GVMA 2X6NA 9ICCA 4PY5A 2J6UA 3PW5A 5DLGA 4IR9A 1S6PA 2A1JA 1JLAA 5J0UA 3UPQA 2W9MA 2ISPA 4N5SA 5J2QA 4OGCA 4K8ZA 2BPCA 4FJGA 8ICEA 3WNHA 3PX0A 4FZYA 2C22A 1HNIA 1WSIA 3LZIA 3SUNA 3ULDA 3OYJA 4J9RA 4JWMA 5FRNA 4CF9A 1JL2A 4CJ4A 4K4GA 4FZXC 5KFLA 3L2RA 4ZTFA 7ICGA 4ED8A 5F9LA 1ZQOA 3SUQA 3HW8A 3C23A 4NLZA 4M3UA 1S1VA 3LK9A 2FPMA 4E19A 3RMDA 2QK9A 2DFHA 4O4GA 4FS1A 1ZQUA 2KW4A 4CGDA 5KFPA 1WSEA 1K6YA 4K4IA 4JS5A 3V9SA 3MR2A 9ICSA 4JRQA 4RZRA 1A5VA 4O3NA 4AHTA 1BPEA 3HPOA 2C2RA 4CHNA 4BE0A 2HHVA 4ED3A 3OYAA 2BE2A 4YR3A 1RT5A 3H8WA 1VRUA 3RH6A 4ED7A 4UBBA 3BQ2A 4O5EA 4YD2A 1TV6A 4O0JA 4AHSA 3SPZA 4M04A 4M47A 2KFNA 3H4DA 1ASUA 4CECA 3H4BA 1GOAA 2LSNA 4QZBA 2P5OA 4Z4CA 4Z4FA 5J0YA 9ICGA 5DB7A 2ETJA 1IM4A 3THVA 4Z4EA 5DLFA 1GOBA 4DQQA 1X9WA 4JUZA 5D49A 8ICYA 2UVUA 1KVCA 2X78A 2V4RA 4M45A 3WNGA 4Q0BA 4BE1A 2VA3A 4R66A 4CF1A 4F4WA 3H7IA 1S9FA 1XO1A 3HVRA 1FKOA 4QCLA 4K8XA 4NM1A 1TKXA 3HL8A 1WCLA 3K57A 1BPDA 3V7KA 1BISA 5DGAA 4XUSA 4F2RA 2YHBA 4E7HA 8ICQA 2VWKA 2AQ0A 4DSKA 5EU7A 4MFAA 3AVAA 1ZQVA 4EZ6A 1VSHA 4JWNA 2JGUA 4DFKA 4YN4A 3SQ4A 3OY9A 4F2SA 4IQWA 3VQ7A 3LWMA 3AVJA 4XQ8A 5D46A 4NCBA 4F4KA 1U9LA 4DTPA 4W5TA 2RDIA 1X1PA 4YD1A 3PY8A 3KLEA 4UB2A 3MEEA 2KZ3A 1H38A 3KHGA 4NM2A 3UXNA 4YR0A 3V9ZA 5JS1A 4KMUA 4DTOA 9ICWA 3ZT2A 1RCHA 3RBEA 3OYFA 3LWLA 3V6HA 4UBCA 5HRSA 3QEAZ 4DF4A 3OJSA 4OKEA 4KHNA 5KTQA 3M8QA 4J9QA 4OPJA 5KFCA 4M9HA 2QKKA 2P5GA 4H4MA 3SI6A 3QETA 1NK6A 3K4GA 3G10A 5KFSA 1C1BA 2JEFA 4NYNA 5KG0A 3ZSQA 1GOCA 4YXJA 1NK8A 5EWEA 4I2FA 4J2EA 3OYCA 4CEBA 1C0TA 4QZFA 4LH5A 2O4IA 4RPXA 1S0NA 1VSIA 1A5XA 4TUSA 4Z6EA 1MQ3A 2PY5A 1C1CA 3MXIA 4CJFA 4IRKA 1TV9A 2F8TA 4R5PA 2XY7A 2OYQA 5DB8A 4DTMA 4ELVA 3VQAA 3QIOA 3QEBZ 4N47A 1HYVA 4QOZB 5HRNA 3DLEA 3PUFA 4Q8FA 4IG3A 1ZQWA 5KRSA 4CE9A 1BIUA 4Q5VA 2PFOA 1ZJMA 1B43A 4RQ4A 4KB0A 1SKSA 1T03A 2BHNA 1RYRA 3PV8A 4B9UA 4HUFA 4QWEA 8ICWA 1WCNA 4EYIB 3MGHA 3GIMA 1N48A 4I2AA 4DG1A 5KFIA 3ZDEA 1ZQCA 1U4BA 1REVA 5KFYA 5E41A 2V9WA 5J29A 2IS3A 4B9VA 4ED6A 5KGWA 2IHMA 3NHGA 4FJ5A 5DQHA 4DFMA 1ZBIA 3ETLA 2W9CA 4QZHA 1A5WA 4J9OA 3TAMA 3OSPA 2R8HA 1UA0A 5L1JA 9ICHA 4I2BA 5J0XA 1D8LA 5KFGA 3OHAA 1LAVA 3QLHA 3QZ8A 3VN5A 3Q8QB 3MDAA 3TAPA 3HX0A 1S0OA 4BE2A 3Q8LA 4KN7A 3GQCA 5KT2A 3LAMA 3ZT4A 2NRVA 2P51A 4DTNA 4F8RA 4B9MA 4KLEA 4ID1A 1C7YA 4M9LA 2X74A 1ZETA 5IINA 3RJGA 8ICXA 3OYLA 2QKBA 4AHVA 2PXIA 5J0OA 3LZJA 4EBDA 3AVHA 1QS4A 2Y1JA 3K2PA 2BGGA 3EYZA 2ASDA 3CM5A 4FS2A 2Z1JA 2R8IA 4CJEA 1ZBFA 5J2MA 1X9SA 4CEQA 5HROA 3LP2A 4LVSA 4KLMA 4MF8A 1EKEA 3SPYA 1S6QA 1N5YA 1F21A 3I8DA 2FPLA 4YFKA 3K5OA 1NK5A 4BXOA 3RB0A 1BPBA 2ATQA 2XGPA 4DWIA 3PW2A 2F96A 4W5QA 2P66A 3ZDCA 4ELTA 3ZDAA 5KFKA 5JUMA 3JPNA 1ZQIA 2OPQA 4OPKA 1WSHA 1TKZA 3KK2A 4KAZA 4KFBA 4GC6A 1EX4A 2HHQA 3MDCA 4J9MA 3QE9Y 2BGWA 3KLGA 3B0XA 1LWEA 3TANA 4AHUA 7ICNA 2HVHA 3SZ2A 4F3TA 2D0BA 5KRTA 2XY5A 7ICJA 5J0QA 4M41A 3GV8B 3CG7A 3MR6A 1EXQA 1LWCA 1BPXA 4BDPA 2F1HA 1CZBA 2XC9A 4CEZA 5FRMA 4R8UB 1HNVA 4C8OA 3GIJA 1QLNA 3OYMA 1W0HA 1ZQPA 4ECTA 1K1SA 9ICXA 1TAQA 3HSTB 4J9SA 5EOZA 3ISBA 1MU2A 1CEZA 1ZQBA 2J6SA 3V1OA 5J0PA 1C1AA 8ICNA 4ED0A 3P5JA 2I5JA 2YNIA 4TURA 1WSJA 4DQSA 1KVBA 2NRXA 3N97B 4BWMA 5KFXA 4QWAA 7ICEA 3AVMA 3ZSWA 4FYDA 5DQGA 3MFHA 3EW9A 4CGGA 4LSNA 2UVRA 1NKEA 8ICTA 5IIOA 2XRIA 3NCIA 1UT5A 2J6TA 2ZUBA 3RAQA 5HBMA 3ITHA 1BCMA 4F5QA 4XRHA 3V9WA 2X6SA 5HMMA 1W9HA 1Z00B 5J2IA 5D3GA 4FBUA 1Q8IA 2B21A 3T5JA 1XWLA 2A1RA 5KG7A 2HNDA 1BI4B 4CJVA 2XO7A 3B6PA 1WNSA 2AJQA 3C5FA 1RBVA 5DB9A 1HYZA 2HHSA 5KFFA 5KT5A 1RT4A 1S1WA 3ZSXA 5KFDA 3VQEA 3RR7A 4FLXA 8ICFA 4KTWA 2G8FA 2YKMA 3OS2A 2OPPA 5C5JA 9ICQA 3MR3A 3C5GA 5KT7A 4E1NA 4PUOA 4E7JA 1D5AA 4PGXA 2G8HA 4I2DA 1QSSA 4QZEA 1NK9A 4KLJA 2GV9A 3KKRA 3V1RA 2F8SA 4HYKA 3Q8PB 4E7IA 1NJYA 4DQRA 4RW4A 2DY4A 4FJJA 4YFUA 4C8KA 1B22A 3IS9A 4O55A 4DOAA 5KG4A 3ORYA 2KZMA 1BVSA 3IRXA 3AVNA 4FLWA 2VWJA 4YQWA 3I0RA 3QNOA 1C0UA 1ZYQA 4FZZA 2ZJ8A 4UQGA 4RQ8A 2HHUA 1TKTA 3TAEA 1JL1A 4DTXA 4KV8A 3L2QA 4CJTA 3BJYA 1G15A 2H5XA 4B3OA 3JPQA 4PPXA 4N56A 3MECA 4I2GA 4IG0A 2W9BA 3PR5B 3DLKA 4HVJA 4CFAA 4RNMA 3M9NB 1ZQTA 3MXJA 3K75D 4I9QA 4KHYA 1XU4A 1VSJA 5DDYA 4JK1A 4ECXA 1DGSA 2JZBA 4LZDA 4YVZA 2HB5A 4RW6A 4P4OA 4CHYA 4RT3A 3Q8MA 3EPGA 1BL3A 3GILA 4I9LA 4BACA 2Q0ZX 3VQ8A 4HUEA 3VA3A 1NKBA 3VQCA 2D0CA 1XS9D 3DOLA 5I42A 1DLOA 2BANA 1QQCA 2G8IA 4QW9A 3GIIA 3E2EA 1XHXA 3T5HA 4B08A 4FXDA 1S5JA 1JXBA 2AGPA 4CJUA 3SQ1A 3SV3A 2Z1IA 4DQPA 9ICKA 8ICPA 2JEJA 4FW2A 4LZGA 3ZSVA 5KFJA 2PYLA 4YP3A 3P83D 4E7LA 3O4QA 4FJMA 4E89A 3UXOA 5KFVA 4QZ8A 1BGXT 4YXMA 4MFFA 1RZTA 1NK0A 9ICJA 3MGIA 4CJWA 1ZQRA 4F3OA 3QEXA 4K4HA 5IILA 1HQUA 1HJPA 5KFRA 3SV4A 4KLGA 4NXZA 3ZT3A 1ZBUA 1Z25A 3QZ7A 1RT3A 3DLHA 5T7BA 4JV2A 1VSFA 1BPZA 3HPGA 4DOCA 3NF6A 5KT4A 4FLUA 3H8JA 4DO9A 4AILC 2Z1HA 4KO0A 4GC7A 3N4MB 3HPHA 3V6KA 2ZJ5A 1X9MA 4F4XA 4KHSA 1XSNA 2E6LA 5J2CA 2I1QA 3JPTA 3RH4A 1XSPA 4GXKA 5HRPA 4N41A 4DSEA 4L8RB 3ZSYA 4ECWA 4RW7A 2BCVA 1KFSA 2ZTEA 1RTDA 4WE1A 4X5VA 4RG8A 1ZQEA 3QO9A 2HHTA 1TK5A 1ASVA 2YNHA 4RNOA 4R64A 3L2UA 3ALYA 1WN7A 4DL4A 3QINA 1JX4A 4TUQA 1YT3A 5IIJA 1TVAA 4FJ7A 2FBYA 1JLGA 3V7LA 1L3VA 2HMIA 4KI4A 3CQ8A 4GMJB 1C6VA 1KFTA 4UAWA 1WLJA 4CEAA 4ECQA 1DTQA 4DU4A 9ICNA 3NAEA 2E6MA 3M8PA 3K5LA 7ICQA 3AO5A 1HUZA 4IRDA 4CJPA 3RB6A 4P4MA 1ZQHA 1XC9A 4PGYA 1VSKA 4F91B 4QZGA 4F93B 2ZUDA 2AGOA 1BIZA 4KHUA 4ECZA 3LDAA 2ASLA 3KHHA 4KLLA 5KFHA 3LPUA 5KFZA 1JMSA 9ICRA 3C94A 4TQRA 1N6QA 3K5MA 2D0AA 3H08A 1EETA 2E4LA 4EP5A 3PR4A 3OHBA 4CCHA 1JLCA 4HCCA 3EPIA 3DRPA 3AO3A 4OKJA 4J9NA 1RBSA 2DTUA 1VSLA 4QZCA 1WAFA 1ZQKA 5SWMA 5CWRA 4UB5A 3EZ5A 1RPLA 4FJ8A 1TVRA 3OGUA 1KEJA 4DL6A 5HP1A 5FROA 3L2VA 1S1TA 4RQ3A 4E3SA 2FMQA 2OZMA 4FM2A 5DB6A 2D5RA 2AGQA 2DPJA 3HP9A 4Y1DA 2NRTA 3U3YA 2OPRA 2R8GA 1BPYA 5DK5A 1CUKA 2VG6A 4M3RA 3MBYA 3C95A 1ASWA 1U04A 3NGIA 4DU3A 3ZDDA 1T05A 1BQNA 1VRTA 4DS5A 5CYQA 4CERA 1UOCA 1R0AA 1LW2A 9ICVA 4CIFA 2NRZA 1BCOA 4TQSA 1DOQA 5J2NA 1N56A 3V1QA 3KD1E 3PMNA 3AVKA 4Q44A 1IKYA 2KQ2A 4DL3A 1S1XA 1KSPA 3C6TA 3CFOA 1RTHA 4KITB 3F9KA 2G8KA 3QNNA 3KLHA 4KRFA 2YKNA 1B92A 2G8UA 4I29A 1Y97A 4O9MA 4F5NA 2FLNA 4M6WB 2FPKA 1KDHA 2MUTB 7ICIA 4ECYA 4TSXA 4Q8EA 3RMAA 4GW6A 1S77D 4CGFA 1RDBA 1UWBA 2DFLA 4MEYA 4J2DA 4OKKA 3GIKA 4I2EA 4M9GA 5DBAA 3L3UA 4DMNA 4DTSA 3ZSOA 3CFRA 3P1GA 4PWDA 4GXIA 4O5BA 5FDLA 1V9PA 4F50A 4ECSA 5L1IA 3AVBA 1S1UA 3IG1A 4RQ2A 3SYZA 3QIPA 4B9LA 2MAXA 4AHCA 3IAYA 2LYHA 3KIOA 4ED1A 3V4IA 3LANA 3S3MA 3NH2A 1IXRA 2HVIA 4F92B 3BQ0A 3HXMA 3TABA 1VSDA 7ICMA 1COOA 2ZTCA 3GV5B 3RJIA 2ZE2A 4CEOA 1T4GA 4DSJA 4XA5A 1LV5A 7ICRA 3V6DA 1ITGA 4B8AB 4YG2A 5EWFA 3G6XA 4KLFA 3V72A 1HQEA 5DDMA 4CEDA 5JS2A 4QZIA 5DG7A 3S3OA 4N76A 5HHIA 3RAXA 1HYSA 4RUCA 3PX4A 1DTTA 4PQUA 3NGDA 4CESA 3DLRA 4YMMA 9ICFA 7ICLA 4RQ5A 4UAZA 1Q9YA 4IQUA 2P6UA 1NOMA 2BPGA 3MEGA 4I2PA 5J2DA 1U49A 2IOCA 3S9HA 9ICPA 3G0ZA 4I28A 4DF8A 3ZT0A 3BQTA 3CFPA 1A77A 1SZPA 2F1IA 5J2JA 4DSLA 4DU1A 2RN2A 1SKRA 3M8SA 2ISOA 3AU2A 3K5NA 2YNGA 5J2EA 4DOBA 2GWSA 4FJNA 1UT8A 4NLGA 4KLUA 1VSEA 5DBBA 5KFQA 4M9NA 5KFEA 4RQ0A 1RXVA 4BWJA 1XHZA 5CJ7A 1ZQQA 2IDOA 5KFBA 3CYMA 5C42A 4CEEA 3VQPA 3UQ2A 3RRGA 2HNYA 4JLHA 3ZD9A 4LD0A 4PGQA 1NKCA 3NE6A 4CHQA 4M3WA 1YTUA 4W5RA 1QSLA 4FJXA 3LDSA 3M9OB 2EX3A 4B9SA 1TAUA 4F4ZA 4RQ7A 3L2WA 3SNNA 3L8BA 3Q8KA 1ZQDA 2JLEA 2A1JB 3RJJA 9ICEA 2YV0X 1WSGA 4QWCA 4EYHB 5I3UA 3V9XA 2VA2A 3KJVA 1QHTA 1IKVA 2IBKA 3VQQA 4Z6DA 2XY6A 4CIGA 2BR0A 1JXEA 1RBRA 1D8YA 3MXMA 3AVLA 3EY1A 2NUBA 1JLQA 3DM2A 5CB1A 1ZQMA 3PMLA 3NF7A 4ECRA 7ICFA 7ICSA 5J2PA 2RKIA 3PX6A 4F5PA 8ICRA 4CF8A 4NY8A 2YHAA 4O3SA 3UIQA 2BKEA 3Q8SB 3AVIA 4FLVA 4QZDA 2JEGA 5CP2A 4XIUA 3KK3A 3SUOA 1J53A 3NFAA 3TAQA 4ICLA 2ZD1A 3O3HA 3KKSA 4IFVA 8ICIA 3LAKA 5KT3A 9ICOA 3VQ4A 1A76A 5KG6A 4CJ3A 3AA4A 4M9JA 4KLTA 3Q8RB 4FLZA 4B9TA 3AU6A 1KVAA 3OYBA 2ZJAA 3TWHA 2XCPA 4FVMA 7ICTA 2O4GA 4KKOA 2KZZA 4ECVA 4CJLA 1MSWD 1QSYA 4P2HA 3NGYA 3OS1A 4J9LA 1QTMA 3TAGA 1D9FA 5KFTA 3AO4A 4I7FA 2FC0A 3HO1A 4CJQA 3NF9A 8ICOA 1RTIA 1JXLA 4PH5A 4RW8A 4RU9A 4KREA 3RB4A 2BCRA 1YTAA 4I2HA 2PFNA 4AHRA 3A2FA 1ZBHA 2P1JA 3ZD8A 4JV1A 1HMVA 4G1QA 1HPZA 4MF2A 3NTUA 1WAJA 1KLNA 5BOMA 5L1LA 3JPRA 5IIKA 2FBVA 5CYMA 2ALZA 3VQBA 2C28A 2KN7A 3C2LA 4RNNA 4CHZA 2RPIA 2Q3SA 4HTUA 1IH7A 3PW0A 4MQ3A 2IHNA 4EZ9A 3BDPA 1UA1A 1MQ2A 3AVCA 5KG2A 1S0VA 4EP4A 1NK4A 2VG5A 3AV9A 1U48A 2AQ4A 3KLIA 3AVGA 1RBTA 3RMBA 1LWFA 3UQ0A 1NJXA 2DPIA 4KHQA 3SUPA 4CEFA 2B4JA 4M3ZA 4DL7A 3AO2A 4DLGA 1JLEA 4C8MA 1RT2A 2Z1GA 4DTRA 2FBXA 1C0MA 3HK2A 4R63A 1TL3A 4DSFA 5L9XA 4IDKA 4FJKA 2ATLA 4R8UA 5KFNA 3MEDA 2OA8A 3C1YA 4OLBA 4PHPA 4ED2A 4Z4GA 1AROP 3G6VA 5IIIA 1EXNA 4CGHA 1B9FA 1FK9A 3ASMA 4C8NA 1L3UA 3DOKA 4H4OA 1SL1A 3AVFA 3EWAA 4ID5A 5J2AA 3VQDA 1TK8A 4CGIA 8ICMA 1RILA 4RUAA 3DLBA 4E7KA 2AU0A 4LSLA 1SKWA 5HHHA 1J5OA 1X2IA 5KFOA 1RDCA 4FW1A 5HMLA 1CLQA 2W8KA 3KLFA 2IA6A 2BCUA 3VA0A 1Z00A 2FMSA 4MFBA 4QWDA 4W5NA 3KD5E 1SL2A 1BI4A 2B6AA 2NRWA 4KLHA 4I2IA 4QZAA 3T5KA 3RB3A 3GDXA 3CM6A 4JS4A 1IKWA 3OYGA 4UB4A 4OLAA 3T19A 5C25A 4QAGA 4BDYA 3RH5A 2KFZA 4OVLA 3HM9A 4DL2A 4O3PA 1HJRA 4J2BA 4YCXA 3NH1A 5IIMA 4DQIA 3RTVA 1FXXA 5DMRA 3O3GA 4IQVA 8ICHA 2WOMA 4IR1A 4CF2A 3C1ZA 1RNHA 1HUOA 3QEVA 4ZTJA 4R65A 3T1AA 4E0DA 1ZBLA 1Z3EB 3RJFA 1JLBA 1RBUA 4FK4A 3FYHA 3HT3A 4B8CA 5HLFA 4IKFA 1L3TA 3HP6A 5J0RA 5J0WA 2IAJA 5KFWA 2W9CB 4KPYA 3ISDA 1KRPA 2DFEA 1IG9A 5EWGA 3GFKB 4UB3A 1BHLA 2XHBA 5CY4A 2BQRA 3LP0A 3WNFA 4QZ9A 2R7YA 4PHEA 4QW8A 5HP4A 1ZQSA 5TZVA 1T8EA 9ICIA 3RBDA 4M0AA 5KI6A 2Y1IA 3TARA 4AH9A 3LPTA 1WSFA 2XY8A 3V9UA 4FO6A 1XSLA 4NYFA 4FM1A 5J2GA 3JPSA 4J9KA 3G6YA 3SQ0A 4HUGA 1T3NA 3D45A 5DGBA 4BGDA 1U47A 3RR8A 3OYNA 4M42A 1KCFA 3VQ5A 4NCGA 3S3NA 1UAXA 1I3AA 3C21A 2VG7A 4RPYA 2OWOA 1SUQA 4M3TA 3FDSA 4CGJA 3K58A 5F9NA 4M3XA 1CZ9A 8ICCA 4Q45A 3C2MA 2ZQBA 3ZSRA 4BXOB 4FK0A 3C6UA 1XI1A 5BPCA 3DLGA 3QESA 1S9GA 3GV7B 5KFUA 1ZQAA 4KB1A 3HYFA 4CFBA 2QXFA 4F5RA 2PI4A 2IC3A 1KFDA 4DLEA 1VSMA 5CHGA 7ICKA 4Z6FA 2VA8A 3PO5A 2JEIA 3TFRA 2C2EA 4MEXA 4DL5A 5K14A 3SCXA 3I0SA 1RTJA 5CZ1A 4HCBA 4W5OA 1TFRA 3PO4A 5J2HA 2OZSA 3ISNC 4I2QA 4ZH4A 3BGRA 3NF8A 3NGZA 4YR2A 4EBEA 3PVXA
chains in the Genus database with same CATH superfamily
4PZNA 4FVCA 3NXZA 2B51A 4CYUA 4MFCA 4KH6A 1Y00A 2V6AA 3UWTA 2XGQA 2CUYA 1XMOJ 3T69A 4KLSA 2KL8A 4JD2A 5CR0A 2MQMA 3A3PB 1TGOA 3ATVA 1KTQA 2GUIA 2B0GA 4CF3A 5U47A 4FPBA 2RRNA 4ZPAA 1URNA 2I5JB 5AE1A 4DV2J 3M7VA 1ZQXA 2R7XA 3RWUA 3RJKA 2HFNA 4CK3A 1ZH5A 2VZ9A 1L5UA 4KYZA 4HT5A 3EZUA 5GIPA 5C0YA 2XZTB 5DQIA 5HBMB 4JI3F 1RHMB 4GNIA 3TSPA 2KVCA 5D3GB 1D8ZA 1BNOA 3GZFA 2ZTDA 3PW4A 2HNDB 4N77A 3Q83A 4NXNJ 2O6KA 8ICUA 2HHXA 1QUPA 5DBCA 2BW7A 3QT8A 4JI8K 4KLIA 1RT4B 2ASJA 1UWAA 5LJ3Y 3TPQA 2CKWA 5C24A 4DTUA 1ED1A 4CZFA 2FSKA 2VPWB 3OPXA 4BX9C 2GO9A 2IMWP 5FD1A 4JV0A 3H1VX 3WNEA 3L3CA 2UVVA 3OR2A 4KTQA 3OSNA 1JN3A 2YVSA 1MWZA 3LALA 3UCUP 2A1SA 2VBYA 3R97A 2OCEA 3D68A 1YAGA 3SJHA 4M7XA 2IGIA 3HSGA 2E1ZA 2VASA 2HS3A 5A8RB 4KLQA 3KUEA 1JLFA 3NH0A 3JSMA 3G87A 4EENA 3DRSA 2P9SA 4HAIA 2C2DA 2B56A 1VQ7N 1SZ2A 4HTJA 2QB0B 5AKZA 2YNFA 1UJ5A 3AA5X 1HKBA 1VK8A 5LY3A 3HDSA 1Q5YA 4LY7A 1A9NB 1X4HA 2QA2A 1HBNB 1KQQA 5HVGA 3JYTA 1TQLA 1L8OA 2I9SA 2ERRA 4FYVB 3CUNA 2Y0BB 1ZQZA 1NDKA 3ZT1A 4DFJA 1RHKB 2PFUA 2JZBB 2Y9TA 4DPOA 1BO5O 1DK3A 7ICPA 4RW6B 3T3FA 1ZTTA 2E1PA 2BQ3A 2E88A 4NXMJ 3V7JA 1TK0A 1ZQJA 4M6WA 3DOLB 5DETA 3W5ZA 3MABA 5IQQA 3KK1A 4KI6A 2ROEA 4A5BA 1UVNA 4C8LA 4CJRA 5KOWA 3O3FA 2QT7A 1OXJA 1GLBG 2BPFA 5DG9A 4Z4HA 5M2UA 5J8YA 5KPRA 3HI0A 5E3RA 3QYYA 4KH0B 2P9KB 4IZ9A 2R8JA 2HW3A 1ZXIA 4BC7A 1IQZA 1U2FA 3HZ6A 4J2AA 2HHWA 1N36K 1T9UA 1T7PA 4RO0A 4TUPA 1X42A 5KGXA 3VR1A 2Y1RI 4EUVA 4AXIA 2DIUA 2POKA 5KT6A 1W7WA 1LOTB 3T6JA 1VMBA 3SEIA 3UI3A 2R7VA 4DX8H 1RT3B 3T1YK 4YOUA 3H0MB 1ZA2B 2GAHC 4EEYA 3GR1A 3HSCA 4M7YA 1L6NA 4MO4A 2BCQA 3PNCA 1QZ6A 3GJQB 1S0MA 4DV4F 5F8GA 3M6WA 9ICMA 3J7YI 3PYDA 2F3JA 4RWXA 2HVDA 4V19S 3AA3A 3LPYA 1YJNN 1WB9A 8ICBA 2PEHA 3FQKA 3H45C 5D4LA 3C6HA 2PZSA 2KM8B 3EDRB 4DPUA 2FZCB 4CHOA 5DDRC 3D6FB 2YKPA 4KBIA 3QO9B 2V51B 3PFOA 1TKDA 5AI0A 3QIDA 5J1EA 4B9NA 2ITGA 4O44A 5D4BA 5A8KB 3UXPA 4E8UA 4BJQA 1Q0NA 1CC7A 5AI9A 3OLAA 4CZMA 2QL9B 1ATNA 4E1MA 5F8LA 9ICAA 3B6BA 4OYXA 3BO4A 3MHYA 3VAMA 1YHQS 4AM7A 2WF7A 1QVGM 4A48A 4YB7A 4B6JA 1RDAA 2EAMA 1S4EA 3KZBA 2HBLA 2E1EA 4DFPA 4CP5A 1QVFM 1PZNA 1ZQLA 3ZCMA 2W11A 4FNHA 4FM0A 4KTZA 3ZYYX 1K1QA 4DUYJ 3ENQA 2DBYA 2RF2A 3W8PA 5J2FA 1ZRNA 3MAQA 3ZFVA 5HNKA 4DJBA 4YOXA 2FPHX 4GMKA 4FJHA 2RP5A 2V4QA 2JWNA 3SSSA 3PW7A 5IV4A 1N6QB 9ICCA 3NGKA 3ID8A 3HD1A 3PW5A 5EGYA 3UNGC 2Z57B 3SEOA 2A1JA 5J0UA 3UPQA 2AV5A 2W9MA 4JKBA 1H7WA 5J2QA 1SS6A 2VG7B 4IQXA 1J2MA 1EJ7L 2E5JA 5BRHA 1N61A 2V4JA 4BLGA 1M5HA 3NRZA 4BBYA 4CZKA 5CA5A 2QSFA 3BEXA 3OYJA 2OPRB 3CD6N 2EZXA 5GADU 2VG6B 4P72A 1JL2A 3CD5A 1ELOA 4K4GA 1P90A 4ZTFA 3MM7A 2CVIA 3OR1B 1T05B 2ZIUB 1BQNB 1H98A 3PDNA 3SUQA 2BH1A 1CJUB 5CYQB 4NPOA 1KC8O 1BD6A 3RMDA 2QL7B 1CJKA 1YVNA 4WK1A 5J1PA 4FS1A 1RAFB 3GIRA 4K4IA 2VPYB 4GRSA 3G6EN 3V9SA 9ICSA 2PMZC 4LF8K 3ET6A 3HFVA 4AHTA 4DQ8A 2C2RA 1LEOA 4BE0A 2DHSA 1V3RA 3OYAA 2BE2A 2Q4TA 1VRUA 3RH6A 4ED7A 2DYAA 4XH5A 5HAOA 1TV6A 4FZVA 4O0JA 3NCPA 3SPZA 2IRYA 4WK3A 1Y5NB 4M04A 4M47A 1WF1A 3TA0A 3WXIA 5JRTA 2E3TA 2LSNA 1E6YB 4BC3A 4QZBA 2LYAA 4Z4FA 9ICGA 3QICA 4WFBQ 2QZ8A 1WORA 4RBTA 2XSJB 4JUZA 4TLQA 1NJIT 8ICYA 2UVUA 1KVCA 2KXFA 4AP9A 2WAQF 1VIXA 2V4RA 4M45A 1T3OA 3FGUA 5CCLA 2KHOA 4JI4K 5JTIA 4D3HA 1RGIA 2JWLA 3H7IA 4LT6A 2ZE2B 1BXNA 3HVRA 2NR0A 1FKOA 1KP6A 4NI2B 2XS7A 3R6LB 3HL8A 3HFZB 3V6DB 3V7KA 3GU0A 3MMVA 3MUVP 1SH3A 8ICQA 3IGVA 2AQ0A 1JJ2M 4QNLA 1VLBA 4EU0A 1DTTB 1ZQVA 5E79U 1PBAA 3VWSA 1YBTA 3BSCA 3AARA 2WW4A 4LBHA 4QIWC 3QGGA 3AY9A 4C23A 4W5TA 4RJVA 2D3DA 4J03A 2O8EA 3CJ8A 3QMQA 3SSQA 1GX5A 2O8DB 3DN9A 4KE5A 4U7UD 4UARA 5ALPA 5AQKA 1JJ4A 3P4UB 3MEEA 4LF7F 3EJMA 2XTJP 3C28A 4YR0A 3V9ZA 5JS1A 3J7AP 2DL0A 2YNGB 1JCGA 4DTOA 9ICWA 4ZMMA 4DV5F 1WJ9A 4YDUC 4DF4A 4CNYA 3OJSA 5HK4A 4U67L 2D9OA 3FZBA 4BVPA 1EB0A 2XSFA 2XMAA 3N7RC 3FRZA 1K44A 4HTLA 4CLPA 1VQ8N 5C42B 1HD1A 1NHUA 2WRMA 4ZS6A 1Z1VA 4MTPA 2PKEA 3ZSQA 8RUCA 1NK8A 1C0TA 1DKGD 2O4IA 4OO1J 1RLDA 2CIMA 2VJUA 4P0PA 2HGNA 4MYUA 5M1OA 4P6QA 3MXIA 2HQDA 1FJGF 3EMTA 2EK6A 2XY7A 2CJQA 2AF6A 1B0TA 4DTMA 4Z37A 4HHJA 1FT8A 3CJ0A 1ZRMA 3QUCA 3QIOA 1Q7YO 4HI1A 3R7NB 3QFHA 2ZH7A 3FSYA 1ZAWA 2R3VA 4F3MA 3KJVB 4FWKA 4FPAA 4OD0A 1U09A 3AOCA 4IG3A 3R3LA 4C9DA 3UKRB 1RHRB 2CPHA 1HBUA 4Q5VA 1U1QA 4LF9J 2PFOA 1B43A 4OI3A 5IWAF 2PBDA 1F9EB 2BHNA 1VYAA 1RYRA 2Y1LB 4CZGA 3PV8A 4HUFA 1RP5A 4QWEA 8ICWA 3MTKA 4GKJJ 2RKIB 3OTOF 2WZ1A 4EGLA 1WWUA 1KR4A 4I2AA 3JTPA 1KS2A 4DG1A 5KFIA 1IBKJ 5AQYA 2V9WA 4CBXA 4B9VA 5IT9Y 3CQXA 1S79A 2IHMA 2I6XA 5KGWA 1NGHA 4ICLB 2ZD1B 3M05A 3UQSA 1N5XA 4B1XB 5F0WA 4LRBA 2F8KA 1A5WA 3AB2B 3OSPA 2R8HA 1V38A 3LL3A 3N9UC 1YRXA 1CLFA 3PIPQ 4IEEA 2H9ZA 2KVQE 2EFQA 2QGFB 3FEZA 5HOOA 3QX7A 3VN5A 3MDAA 2C42A 1IWAA 5L38A 3TAPA 1JROA 2V8PA 3D28A 4RL1A 2FJEB 2XIDA 1NNDA 2ZITA 1R3NA 4I7FB 1XMOK 4C11A 2JC0A 3KJNB 5KT2A 3LAMA 3ZT4A 4F8RA 4B9MA 3EE9A 1SC4B 1C7YA 4M9LA 2QA1A 3RJGA 1R43A 2DKOB 2WB1D 3LZJA 2G0CA 4DV2K 3AVHA 3K2PA 4H5RA 2BGGA 4CEQA 3BSAA 4OIXA 4XPCA 4BR4A 3TJ8A 1S3XA 3O9TA 2KG5A 3MUTP 4GV6A 5C10A 3CCVN 3IGNA 3SPYA 3A5OC 4ZLLA 1S6QA 3DU6A 5CYMB 1URJA 3ZEUA 3I8DA 3RB0A 1D9AA 2ROGA 2E7XA 1BPBA 4AD6A 4JI5J 2K89A 2XGPA 4DWIA 4IKAA 3CCMS 5AQQA 4DV6F 4QR2A 5ALSA 3ZDAA 5KFKA 4A8QA 4Z2XA 1Z2LA 2W4DA 4IO1A 3H42A 2OKQA 1LWFB 1X5OA 2I8EA 1Y4ZB 3Q0AA 2A3JA 3QU9A 5FPEA 1NG9A 3NVYA 2A3ZA 3KLGA 4BG9A 7ICNA 3SZ2A 4PABA 4F3TA 2DUYA 2D0BA 3O0FA 4K59A 1VQMS 7ICJA 3GV8B 3IWXA 3MUMP 1EXQA 4KMOB 2BKPA 1BUPA 2F7VA 1B0VA 2XC9A 4XTTA 2F77X 1EKRA 2HHHJ 2V8VA 1U02A 3OYMA 2EWHA 4OYBA 3HSTB 1FK9B 5EOZA 3OQ2A 4BQLA 2DGOA 1B0XA 4LBPA 2DHHA 1VHFA 3QRRA 2R2SA 1HWIA 2I5JA 4OI0A 1HNWJ 2CZ9A 3MX2A 4ZN3A 3EWGA 3N97B 2UYTA 4QWAA 2YX1A 1IJFB 7ICEA 3ZSWA 5DQGA 2FVQA 2DNLA 8ICTA 1H2TZ 1UT5A 5MLCQ 3KLFB 2ZUBA 2AWZA 3RAQA 5HBMA 2HSEB 4F5QA 3ENVA 4MK8A 4OZLA 5HMMA 1Z4OA 4WFBL 1S6OA 5J2IA 5D3GA 3T5JA 1Q8IA 2B21A 2A1RA 2ZVIA 3JQJA 5AE3A 3BN7A 1VQ5N 2HNDA 2B6AB 2LYVA 2XO7A 3L4BC 5AJ3J 3VTIA 1WNSA 3QQCD 3C5FA 3CO9A 2WMMA 4NXMK 1QTNB 1AXQA 3NUQA 5KT5A 1RT4A 3ZSXA 2YTCA 3I55S 1N4LA 1FRJA 4HH1A 3VQEA 8ICFA 1RKJA 1RE1B 3GOIA 3SQGB 3CC2S 3JAMO 5GTHU 2DH9A 4JEPA 3GWCA 4AQYJ 4ZVEA 5DJBA 2HVZA 4ZPCA 4PGXA 4H5NA 4J5OA 3HSDA 1QSSA 1GK8A 3KKRA 4E7IA 5HLFB 1YZ6A 3U1NA 2ROPA 5LJ5Y 1NMDA 2F65A 3J81Y 2UUAJ 3THXB 3Q22A 4DOAA 2D9PA 2R4FA 3U26A 2E9TA 2A10A 3AVNA 4FO0A 1S12A 1ZA1B 2VWJA 2CPFA 4DL0C 1KD1T 4OQJA 3D2QA 5AK5A 1F0MA 1EWQA 3OL8A 4BR0A 5A8RA 4H03B 5I3QA 2ZJ8A 2BE7D 2M0NA 4IH6A 1F0XA 1PJ7A 1O5JA 2P9LB 4O5FA 4JK9A 2GJIA 2NLXA 2H5XA 2R7QA 2QB0A 2C2NA 3PZPA 2Z58B 4JI7F 4HVJA 2HOIA 1XR6A 2DY9A 1HBNA 4DI6A 4I9QA 1QD1A 3FNNA 4YDUA 2W3RA 3CJ1A 3LA0A 4NCGB 4I68A 4DR1F 4KSEB 2JZBA 1YJUA 4NWIA 4G6VB 4RW6A 4DU7A 1SUQB 1WHVA 4P4OA 2DR6A 2PN6A 3UKUB 3EPGA 3AJDA 2IOFK 2Q0ZX 3KUHA 3ZI4A 2E1AA 2DB1A 1AFIA 3LW5C 3SR6A 1XS9D 3DOLA 1TUVA 4QW9A 2CNOB 1FEEA 3VHQA 1F5AA 1S9GB 1S7HA 1P9YA 2FTRA 2AKWB 3QWUA 2UUCJ 2KT3A 4UAUA 4URGA 2WF6A 2IC3B 2LU2A 2Z1IA 4CH0S 3P8BB 1UHUA 2D1KA 2P9KA 2CDQA 4PKHA 2PYLA 3RF9A 2N3LA 4G1IA 3BS9A 4QZ8A 1F3FA 3ADAC 2CQPA 3DXKB 4DUYK 4BR7A 4YXMA 4MFFA 2ZZMA 2FQQB 4C7ZA 3QEXA 3MTJA 5IILA 2FHJD 2QTDA 1HJPA 5KFRA 1CPZA 2J9EA 3Q23A 2N4CA 2QFIA 1WUDA 1NGBA 3RG6A 1RT3A 5T7BA 2E2QA 1PYSB 2WSEC 2FXUA 1T3QA 4LR9A 3VEOA 3H8JA 2WHOA 2ZEJA 2Z1HA 4GC7A 3N4MB 2ZJ5A 1UPMB 1X9MA 2F8LA 3ZO7A 2AX0A 2E6LA 3AXKA 1T95A 4YOEA 2FLOA 5J2CA 1XSPA 4EFAC 5HRPA 4DSEA 2Z30B 3N6NA 1VQKS 1HNXJ 1KFSA 3PJ9A 2QIFA 4X5VA 1TMJA 3E01B 1ZQEA 3QO9A 4K5SA 1TK5A 4M63C 2HMXA 2ZNZA 4AL7A 2A18A 4I6YA 2DK2A 3HVTB 2PT0A 4RNOA 4R64A 5A8KA 3QU7A 4DL4A 2XMMA 2ILYA 1YT3A 2CPIA 5IIJA 4CDGA 1N52B 3OVBA 4DHVA 1L3VA 3FCHA 1RXOB 1PAEX 3QUQA 1RWXB 2AEMA 1FNOA 3M1VB 1WLJA 5AM5A 9ICNA 2E6MA 5I9EB 2DXDA 1GO3F 1XNSA 1HUZA 2R2RA 2RSQA 2G06A 3RB6A 2QLTA 5IM0B 1ZQHA 2BKNA 4QZGA 3SBGA 3ZX0A 2E7VA 1QE1B 2E44A 5D4NA 1Z2ZA 3TZZA 1VHXA 3QPIA 1JMSA 2LKZA 3DYAB 1N6QA 3K5MA 3H08A 3GCXP 4CCHA 3W5YA 3WIVA 1LFPA 4HCCA 1N32K 4IOAQ 2AMCB 4DHYA 4J9NA 2V2KA 2AZ3A 1RBSA 2M0GB 3VEXA 1XUPO 4DU8A 2V7ZA 3TA2A 1RWMB 1UEUA 4JI6F 5F8MA 4JI3J 4FJ8A 1TVRA 1VDHA 1XK8A 3OGUA 1VR6A 2P8IA 3MCPA 4E3SA 4WIQA 2RDDA 4CD1A 2W2MP 1BWEA 2HQFA 2OZMA 2Z7JA 5DB6A 5ALYA 2AGQA 2DPJA 3HP9A 3WXKA 2OPRA 2RLTA 1SV5B 4P71A 5DK5A 1CUKA 2VG6A 4M3RA 3KUGA 2OSRA 3MI7X 3UMCA 2DEJA 4DU3A 3ZDDA 1HHQA 3OR1A 1T05A 2ZIUA 1BQNA 4ISGA 1CJUA 5CYQA 3SCJE 2BJDA 3ETRA 2CQ2A 1RBAA 5TKYA 2NO5A 3SMPA 3J7YP 3AVKA 3H7HB 3BPDA 1BUXA 4JOUA 3RW6A 4BRNA 3A0HU 2GFFA 2B9EA 2EH9A 1L7OA 1KSPA 1NM1A 3R3TA 4EMDA 4P2FA 4KITB 4P73A 2G8KA 3KLHA 1VISA 4I0WA 5KL1B 2G8UA 4I29A 4O9MA 4F5NA 3R5DA 4ZN1A 2YMLA 3HM8A 3IDWA 2MUTB 4Q8EA 2KT5A 3V81B 5DO2A 4ZVFA 2KYZA 3THYB 2RQCA 4C8YA 2DFLA 4MEYA 3MN5A 5DDPC 4J2DA 2P9NB 2CNLB 4OKKA 2NYVA 3GIKA 4I2EA 2DITA 1E6YA 2MJUA 2E1MC 3MPUB 2HKEA 4GXIA 1V9PA 4F50A 3TJ9A 4ECSA 1LW0B 2XSJA 3SYZA 1RT1B 3BS7A 3LANA 3TTFA 4YOTA 1MA9B 2QJ3A 5CEHA 3NH2A 3T79A 3TABA 7ICMA 2YX7A 3R6MA 2ZTCA 1R89A 5TISU 2ZE2A 4CEOA 4K4TA 3OXGA 4NI2A 2AT1B 1LV5A 1MROB 3V6DA 4MKYA 4YG2A 3G6XA 2RNEA 3V72A 2V2VA 1S6UA 3HZEA 5JS2A 1HQ2A 1RWOB 1DTTA 4BC4A 2GH1A 3NGDA 1BQMB 3DRRB 9ICFA 4PL7A 4LF4F 1N8RO 3IWLA 3M6XA 4NLDA 4LF9K 1WYGA 4PL1A 5CYJA 3TA1A 2IOCA 4B3MF 4GKJK 2UZAA 2O8DA 3ZXWA 5F2RA 3ZT0A 3PYEA 1FWLA 3BQTA 5HO4A 1VC5A 2OPSB 3CFPA 1IBKK 3NVVA 3NGTA 2ISOA 3M8SA 4DCOB 2PFDA 2YNGA 4DOBA 2GWSA 2JLGA 5KFQA 2Q66A 1IV0A 4M9NA 1TUUA 4L6V3 2JH1A 1RXVA 3H3OB 3R8EA 1XHZA 1UFKA 1WBDA 2LDIA 1XO0A 4DV4J 3CYMA 4I6AA 5C42A 2W2NP 5E33A 3GDQA 3UQ2A 3FE1A 2LM1A 2IA0A 3ZD9A 2JFKA 1KXPA 3HKZC 2B4PA 4LD0A 1HD0A 1BHNA 4EFHA 4CHQA 1K47A 1HKAA 3MPVA 1YTUA 4PG5A 4FJXA 2VIXA 3PM9A 4CLKA 1UZDA 2PMZF 3B9JA 3L2WA 3N01A 4RR5A 2H4WB 3Q8KA 2CNKB 1S6PB 2JLEA 1JLAB 3RJJA 2VFUA 9ICEA 2YV0X 3MD1A 2V8GA 3GE9A 4ILRA 9RUBA 3D1OA 4PWWA 4WZMA 3KJVA 1QHTA 2YWEA 5K8OA 1I94J 1DZ5A 3UKRA 4PG8A 1JXEA 3OT9A 1HNIB 4F02A 3MXMA 5M1FA 1YITN 3EY1A 2ZC4A 1GLCG 3ONNA 2LA6A 3E0FA 4U7UK 4JI5K 3NRBA 1ZQMA 4DZ6A 4DR5F 1FJCA 7ICSA 2RKIA 3U27A 1SWWA 3PX6A 1SXLA 4QZVB 2YHAA 2GMHA 2JXJA 1X4CA 2K7KA 4WQ5A 5IQ6A 4NA3A 4FYYB 4PKIA 3U8XA 1J53A 3SBMA 4RQNA 4NLUA 2MY8A 4O4GB 3D6JA 4ICLA 2I0XA 2ZD1A 3O3HA 1B4SA 1LVHA 3RGIA 3LAKA 9ICOA 3CCTA 3CNHA 5D0HA 2V94A 3NAIA 4CJ3A 4IH5A 3AJ2A 4B9TA 3FMWA 5ALIA 1KDNA 1KWMA 5E2QA 3TWHA 7ICTA 2P9CA 2KZZA 3WK8A 4ECVA 4MJKA 3R8YA 4M63A 3M8WA 1QSYA 2KICA 2CQGA 4CTAB 2VJ4A 3NGYA 2HHHK 5KNIA 2VONA 1UCVA 2A6MA 4J9LA 1FVSA 3EZWA 4ZVQB 3H0RB 3TAGA 1D9FA 4Y2KA 4OPAA 4I7FA 3O80A 1WF2A 4UTGA 1WOQA 4QIWF 5JVGQ 3POTB 2X1AA 1TL5A 8ICOA 2E8AA 1PJ6A 2YQ0A 5ALZA 4RU9A 4JP8A 3RB4A 2V50A 2DQNB 1KN5A 4TU9A 4TVAB 2A3VA 1YTAA 2W55A 4ES1A 2HRUA 1HNWK 3EL2A 1RAIB 2I6WA 3D2FB 4A8MP 3JPRA 4CE6A 1COKA 4KHPF 5CYMA 2KG0A 1LXNA 3UM9A 1RAOA 1TKXB 3Q8UA 4CHZA 4IUFA 1WSVA 5GADI 3A5MC 4C2MA 3RW7A 3SCLE 1HIYA 2NNWA 4ISFA 1MQ2A 5AM0A 5AJ3K 2R7RA 2HGMA 3NOGA 4IH7A 4JB3A 3M6UA 2KNJA 4Y34A 4GVLA 1RBTA 1LWFA 2IMOA 4LF5F 4L74A 3Q7CA 4H0XB 2DPIA 1R8CA 2HYIB 1S59A 1IBLK 2E5GA 3AO2A 4UY85 4DLGA 2BOAA 5D0EA 4HHUA 1ZBTA 3KLEB 1YI2S 1OVQA 2FE9A 2QFJA 2FBXA 2E2PA 1C0MA 3HK2A 1NZPA 3A12A 1IR1A 3ZC4A 2YH0A 2ATLA 3G82B 3TRGA 2UUAK 5KFNA 1CC8A 2FJ6A 4PHPA 2ZZNA 3DHWC 1XQSC 4DDFA 2PDAA 3VF0B 2NCKL 1FK9A 4PG4A 3ASMA 2GW8A 3D2EB 3A5LC 2V69A 2ZIWB 3BS5B 1L3UA 4H4MB 3DCAA 3EWAA 4OJGA 2QMXA 1RHUB 3CJAA 1A0PA 1C1BB 1FRLA 1LQ9A 4C3MA 1F9FA 1J27A 1U24A 4RUAA 1V85A 5EHHA 3MWPA 3DLBA 1SKWA 4PL2A 2IVFB 4HVZA 3GYXB 4OFZA 2DWQA 1FNXH 4LFCF 5HMLA 1XNQF 2E1RA 3R27A 4C0HA 1C1CB 4LC9B 3KLFA 4NX9A 2IA6A 2BCUA 2HBZB 4OLOA 4I69A 4LF7J 5DZ7A 4OYOA 6AT1B 1FHTA 2HDOA 3H59A 5H1SV 2B6AA 2MDAA 5EE1A 1U6FA 2FUG9 2HK3A 4DV5J 2QLFB 1Z1BA 4OLAA 3T19A 1Z19A 4KIAA 3KLVA 3HM9A 3WQPA 3E66A 2NS1B 1HJRA 1T03B 3RRKA 1T9YA 3CCQS 4EHTA 5F3XB 5IIMA 3O8MA 4DQIA 3SQGA 4OI6A 2WC9A 1E6VB 1ZQ1C 1KC8T 2GO8A 4DV3K 4IR1A 4CF2A 6FD1A 2HVEA 8ATCB 3IP4B 2IM1A 4YHHF 4R65A 3QEVA 2YKOA 4E0DA 1Z3EB 4A4JA 3EGVA 4RWWA 1RWWB 2OTJS 1WC4A 5HLFA 4IKFA 2K3KA 1L3TA 3THXA 5KFWA 4KPYA 2K06A 1IG9A 2HWIA 1FJGJ 1NU0A 1S5ZA 3TAMB 2WFBA 5ETTA 1BHLA 1QH9A 1RWKB 5HMYA 4UAVA 3VESA 1ZQSA 2P9LA 4Y2TA 2KU7A 5AKKA 9ICIA 1TP7A 1XNRF 2VD3A 1C0GA 5IWAJ 1WSFA 5JVHQ 1LKYB 3SBTA 2IDLA 4WPAA 5F1XA 2BJ8A 3SQ0A 2OMOA 3D45A 3OTOJ 4PXBA 1U47A 4M42A 4M5MA 4NCGA 1TMMA 3MAAB 3S3NA 2H5IB 2QC3A 1Y3KA 4IOXA 1KQKA 3C21A 5J2MB 1K8AO 4DV1F 5AQJA 1YIJS 1SUQA 4F0HA 4M3TA 2DEIA 4Y2YA 4H0TB 3AAPA 3UKUA 1NNLA 1RZMA 1N5YB 4M3XA 1FRIA 2Y9UA 3MCNA 3UN5A 3MM8B 3ZSRA 4BXOB 3CPWR 2LP4A 1S9GA 3NGSA 4KB1A 3CC4N 3J80Y 5CHIA 5LMUF 2HBQB 2IC3A 4GO5X 1KFDA 4IYQA 3VQTA 2P6SA 2OPQB 4GV9A 2P35A 2Q0RA 7ICKA 1YBAA 4KFBB 5DM6Q 5G5GA 2ZNYA 4DPYA 2O8FB 4MEXA 3DXKA 1NLVA 1U25A 3O5BA 1GMUA 1LWEB 4ETXA 1GX6A 2KK0A 1YZ7A 2HFZA 2OZSA 1SVDA 3ISNC 4ZH4A 2J7WA 3WC0A 3NGZA 3VF4A 2EQYA 1B4FA 2NRWA 2P6RA 3VAHA 1G7CB 1PJ5A 4RBVA 3ZDBA 1PIEA 3AODA 4RPZA 1RWVB 5HJXA 1KAZA 3NL0A 4JI3K 3ZSZA 2J0WA 1X31C 2J8AA 2FLPA 4WYWA 1KW4A 1MU2B 1NPKA 2FY1A 3KTQA 2EAOA 4FBTA 5G4DA 4DV6J 2ZXHA 2M3DA 3CSKA 4CZEA 2H3FA 2H51B 3TFSA 2MZTA 3WKBA 1DXSA 3ELHA 1Q18A 4C4RA 1WKLA 3E01A 5DKWA 4YS2A 5IT9U 1NJWA 2QLWA 4M3YA 4CF0A 7ICUA 2W7AA 3HVTA 3MMAB 2E1YA 3I31A 4X66F 4PHAA 4K2XA 4RKUC 1CXQA 1AA1B 2Q1NA 2LEPA 4Y1CA 3JPPA 1NOYA 3OVSA 3I96A 1ACMB 1NWKA 2DGTA 1S76D 1X66A 3R5AA 1ZQFA 4WF9Q 2VQEF 2O8BB 3M1VA 1X0PA 2WONA 2ZH3A 2EVZA 2VANA 2P2CB 4I64A 1Z26A 3EVMA 4NLKA 3AUOA 5IM0A 2YKMB 2AXTU 4GKKF 1QE1A 1QZ5A 2ACMA 1YRUA 2MQ8A 3MFIA 1U1LA 2BJEA 3DYAA 3DV9A 1UMJA 1RTIB 2KHCA 3PHEA 2AP6A 4EX7A 4RW4B 5SZTA 2X3GA 4FLTA 1VK0A 3IS9B 1FRXA 4N8NA 3CC7N 2V8DA 2YPZA 1IBCB 4A57A 2ZG6A 1XIQA 1X4BA 4MAKA 2F1FA 3LP3A 4X4QA 4DR4F 4A61A 4CZIA 1GXTA 3QERA 4UB8U 1NK7A 8ICAA 3HWTA 1N0UA 2EKYA 1TKTB 3BQ7A 1R6VA 1S97A 1RK8A 2D8CA 5ALXA 1SV5A 3SJJA 3F73A 2F4FA 2OJ3A 5J0TA 5KG1A 4F0KA 3PCOB 2W2OP 2E8PA 1GMWD 1TYQB 3QEIA 5KFAA 3DLKB 3KHRA 4MK9A 4NEZA 1S10A 1B3TA 3D1QA 3PYGA 2Q1LA 1O6XA 1GLFO 2V68A 1FXRA 5BN9A 2F44A 4Y6IA 3VGLA 4C97A 4JKFA 3D0IE 4FKXA 2Y8YA 1U1MA 4KHWA 1HUXA 1AT1B 3CB4A 3OVNA 1L3SA 4TU7A 3TTDA 2M9KA 4ZPWR 5F8IA 2FY8A 4NXNF 1ITPA 4X4NA 2MUTA 1Q7LB 3CCEN 1ZQNA 3OW2R 3V81A 4CRJA 3CDUA 2Z56B 3Q8VA 4MO5A 3THYA 4KLDA 8ICJA 4B02A 3IUCA 2P9NA 1EKSA 1Y9OA 3BZQA 4DR2F 3BPSP 2YKAA 3V6JA 2M88A 4M5GA 4DV4K 3OL7A 1LW0A 4JI7J 2FJWA 3FQLA 1J9AA 2D0OA 2VICA 1S72N 1RT1A 2OYYA 2E5IA 3HHNB 4JK8A 1U0HB 3O9RA 4DR1J 2B7CB 4IFEA 2NPIA 1Y5IB 4IQTA 4KGMA 1RWPB 2PFQA 2MQOA 3G4SS 1MROA 3VGMA 4ILHA 2FMPA 4CLSA 4WFZA 1I1GA 4F25A 4KO0B 3ENHA 1BA1A 3KOAA 1JI7A 4CLZA 4Q43A 2J0SD 3WZ0A 2BDPA 4JMUA 3AB4B 3FGVA 4O3RA 1BQMA 3DRRA 2WVCA 3RSEB 4RT2A 3EICA 2DNHA 1YVFA 3C2KA 3H5YA 3CJRA 4JRPA 5LM7E 5AKJA 4ZVRB 3CMAS 2N7YA 1O1WA 2H4YB 2HFVA 1N5TA 4FWLA 1F5CA 5EE9A 5GAGU 1HHTP 1UL3A 4RQ6A 1OY8A 1VIOA 2ADCA 4BRDA 2CAJA 4WYLA 1EO1A 2AJ0A 2OPSA 5DG8A 2JNJA 5FIIA 4F36A 3ONQA 3PFEA 1JLGB 3I4HX 4BQZA 3OUYB 2E1CA 1EARA 4ES3A 1YJ9N 1H2VZ 1F44A 4JKEA 2XULA 2CQBA 1DTQB 2V52B 2NRHA 4BRCA 2KHDA 2R8KA 3M8RA 1Q86T 2KD1A 2GBZA 1RDRA 4RNFA 3CCES 3ILIA 4XAKA 3T6BA 4NO7A 3OJUA 2C1EB 4QWBA 4A59A 3M1FA 1FX4A 3QSYB 2G8WA 3CE8A 4I2CA 4ZIVA 4GVMA 3BGOP 3NVMA 4O3MA 3CT9A 4HDHA 3BYRA 4DCPB 1R31A 2J6UA 2G2YA 4JKHA 5DLGA 4DR7F 2HF3A 4RX6A 1S6PA 2W3SA 3LGMA 1JLAA 3GLJA 2RE2A 2QXLA 2F4VF 1B64A 4N5SA 1B7YB 3PG9A 1DFDA 4OGCA 4WKYA 5HP1B 3IKMA 4CO2A 3QB0A 3K0SA 1S1TB 8ICEA 4CO5A 4J9VA 4FZYA 3R2DJ 1HNIA 4C3LA 1WSIA 3LZIA 3SUNA 3BB5A 2I7NA 5B0DA 3CF5Q 1DEJA 3CDEA 3TYTA 4FZXC 3KFWX 3G71N 7ICGA 3PRDA 4ZJLA 4ED8A 2MKSA 5F9LA 3MAHA 3C23A 2HQ3A 3H90A 4ZLNA 2BABA 2VFTA 1SGGA 3L95X 1RADB 2X1BA 3CCLN 5GAEI 4O4GA 2KIWA 5ETOA 4UT4A 1RABB 1ZQUA 5LSOA 5KFPA 1K6YA 4JS5A 4JRQA 4RZRA 1BPEA 3BBCA 3GMGA 1NJIO 2B7BB 4FWPA 3KFUF 3P4IA 4YR3A 2ACYA 4JI6J 2HSZA 3DEEA 2HBYB 3BQ2A 5B5EU 3CNQP 5AQNA 2LECA 1Z05A 1WSRA 4CTAA 2MY7A 2KFNA 3H4DA 2A40A 3UMGA 4CECA 2CFXA 1G6BA 3H4BA 4IJNA 5EE3A 4QR1A 1HWJA 3FRYA 4OJ1A 2PMZD 5BPNA 5DDOC 5FDLB 4OZ1A 1NB7A 1GOBA 3HX9A 1GT8A 1S1UB 3IG1B 4QIGA 5LJVA 4P52A 2W40A 3TJAA 2DH8A 3D2FA 2DD8S 2X78A 2BUPA 4Y28C 3ZZUA 3T7ZA 4CF1A 4FE3A 5K5MA 1V4SA 3NS5A 4BC9A 4QCLA 3MX5A 4NM1A 3ENOA 4DR3K 1TKXA 5E0OA 1S7IA 2WF5A 1HWKA 2P9PB 4LF7K 2HBRB 1N33F 2W24A 4C1NI 1I3OB 4URQU 5EU7A 3O1BA 1HYSB 3IAM9 2W7OA 5D78A 3HKZF 4Y2RA 4DV5K 4EZ6A 4JWNA 1PVPA 2B8QA 5GMDA 3SQ4A 3OY9A 4IQWA 3LWMA 4X4OA 1CRXA 3A8KA 2J9DE 4DTPA 4YD1A 3QGIA 3KLEA 1LK7A 4PZVA 1H38A 3KHGA 4EWTA 3VGTA 2EBGA 4OL8A 3G82A 1RCHA 1P6TA 1T3VA 3RBEA 1UJ4A 1MG7A 1FJGK 3MCMA 3VGVA 4JV5F 5KTQA 1NGIA 4J9QA 5CQGA 3VVUA 3D2EA 4M9HA 2ZIWA 3BS5A 2VJVA 1VQON 4H4MA 2P5GA 3SI6A 3J81O 3QETA 4F3QA 3CPEA 3K4GA 2LBOA 3FAHA 2R42A 2YMMA 2HEKA 5AK4A 5KFSA 4UASA 1C1BA 1W2BR 3B4MA 1VFJA 1Q8BA 4C7YA 2G13A 4CO4A 3R5BA 2V34A 3A0BU 1WUAA 4I2FA 4LF4J 4DKWA 3DDKA 4H4KA 4CEBA 3UD3P 4JI2F 1MMLA 5IWAK 1S0NA 4OJPA 4TUSA 5AICA 4ICAA 4Z6EA 2GIFA 1C1CA 4QYZJ 4IRKA 2WSCC 1HBOB 2ZDPA 3KG0A 2GMJA 2F8TA 4ZCIA 1KVIA 2L9NA 5AIAA 4UQTA 4PG7A 2LMRA 1HYVA 1NBEB 2GV1A 5HRNA 1IKVB 3EE8A 5KRSA 3EUNA 2VGMA 1BIUA 3EE3A 3W3SA 5ALHA 1SKSA 3WIUA 2BUNA 1T03A 2RMLA 3DM2B 3T9NA 3H6EA 4DPTA 1WCNA 1E6VA 1KBRA 1C4CA 3HHLD 1N48A 2BX6A 3R5CA 3S6EA 2DHXA 1QAXA 3ETOA 5GADP 2RQ4A 1ZQCA 5IT4A 5KFYA 3KK3B 2C3PA 3DLLQ 4FJ5A 5EUHA 5DQHA 4DFMA 3ETLA 3IMXA 4QZHA 4IFVB 3EKSA 1SV4A 1U0SA 3SCKE 3H2LA 2XHCA 2FC9A 2B0CA 3TAMA 4X62F 2GLEA 1NUEA 1WUUA 2DGUA 4KRWA 1UA0A 5L1JA 9ICHA 1D8LA 2JX2A 5KFGA 1XEZA 1LAVA 1BY9A 1OO0B 3PKYA 3HX0A 2A5XA 1S0OA 1SWVA 4KN7A 2UUTA 1LKYA 2NRVA 4DR5J 4ENOA 4DV6K 1V9OA 3IM8A 4JI1K 5IINA 4I1TA 3TR5A 3OYLA 2QKBA 1PK1B 4X4RA 2PXIA 1X9JA 2XYPB 3EYZA 3MAAA 3MCAB 4JI8F 1DT9A 2Z1JA 1HMVB 2COLA 1ZD4A 1HPZB 5J2MA 4JHDB 4PQAA 4G9ZA 3THPA 4MF8A 1EKEA 2IRXA 3PHTA 1AFJA 4PWUA 1VCTA 2GHPA 1N5YA 7FDRA 4YFKA 3MM8A 4BXOA 2A2CA 2H3IA 4BC2A 2KRRA 2ZZTA 3W61A 2G2ZA 3D2WA 1N8RT 2CGLA 5A2QU 4BRQA 1W2BM 2OPQA 2QYCA 4KFBA 3U1MA 3GG0A 3NKYA 3HHEA 4I6WA 3VV2B 1WNEA 4J9MA 2O8FA 2CPZA 4PXDA 2M5YA 2IVNA 3EKUA 2QARB 1LWEA 2GA7A 2C2MB 2ZBQA 4AHUA 2HVHA 5K4LA 3K5PA 3CHWA 4U7CA 3UW1A 2CQIA 3H5UA 2H3GX 2YCHA 4BROA 4M41A 3CG7A 5MAOA 3MR6A 5B0BA 1UP1A 1UW9A 1TL3B 3OXFA 4M5HA 1FFWB 4JB8B 4CEZA 2YQEA 5FRMA 5D0GA 3I4PA 3MEDB 4C8OA 2CQ0A 1HR0J 2NO4A 1QLNA 1RWUA 3TADC 1ZQPA 1YJWN 4ECTA 2ZVSA 5AXNA 1RYUA 3ISBA 4HHHA 1VJQA 5ALFA 1C2PA 1MU2A 4H4OB 1ZQBA 5E3QA 1XMQF 3V1OA 4ED5A 1MN7A 2PMWA 1C1AA 3UMBA 8ICNA 2GOLA 3P5JA 4B1ZA 3NMRA 3Q24A 4K4YA 2ODGA 3VQSA 1XTZA 4LF5J 3AVMA 4FYDA 3EXCX 2JHEA 3MMAA 2G0IA 3MM6A 4CNQA 2OTLN 3KJQB 1BCMA 2YX8A 2GX9A 2KOBA 1Z00B 3NLCA 4FBUA 2DR7A 1XWLA 5IOLA 1D3WA 4CJVA 2Q2RA 4CJ7A 2AJQA 1N5QA 1RBVA 5CE3A 2O8BA 1X9XA 1SJRA 3TUIC 3QU4A 1N36F 1Q81T 5C25B 1OH8A 3ETMA 1KD1O 4FLXA 3RR7A 1F9HA 2HBKA 1X6IA 2G8FA 5FPDA 2YKMA 3KVGA 8AT1B 4DUZF 9ICQA 3JS9A 4LIWA 1JXVA 2HBJA 3C5GA 1ZPVA 4E7JA 4ILJA 3VAIA 1K0TA 3T41A 4WKRA 1WOPA 2W41A 1SC6A 4PG6A 1NHVA 5ALRA 3NY0A 1JLBB 1RAGB 4JK7A 2F8SA 4HYKA 2JMGA 1NJYA 4LUBA 4RW4A 2DY4A 3O9UA 3PIOQ 4OV1A 2KSOB 3FR0A 3IS9A 4LFCJ 4WFYA 4O55A 5KG4A 3ORYA 5EVZA 1XNQJ 4JI7K 1VQ6S 3OLBA 1BVSA 4C98A 3RJMB 3QNOA 3T1HK 1NBWA 2E8NA 4DR1K 1IV8A 3LP0B 1M90T 4OZJA 4UQGA 3UFCX 1N5WA 5FLXO 1TKTA 4AM6A 2PA3A 3TAEA 5L46A 1OPZA 1JL1A 1S49A 4H5WA 3ULEB 2DJWA 3L2QA 3PNIA 3H5SA 1G15A 2PE8A 1E4GT 1TYQA 3US5A 3CMES 1HI0P 2AP1A 2FYXA 5ADXH 3PR5B 3DLKA 5L8RC 2CRLA 3G86A 2AEFA 4RNMA 1SI9A 4YUDA 3VGUA 2EK1A 4YHHJ 1VSJA 4JK1A 3EXYA 4YVZA 1TUWA 5HMZA 4CHYA 3D0GE 3Q8MA 3I5CA 2W7PA 4XDDA 4XO0A 2MHEA 2E66A 2FJXA 1YWXA 4LFAF 3C6UB 4B17A 1S22A 3GIIA 3E2EA 1XHXA 1ZAXA 5E3CA 3L0QA 3F2DA 3S6JA 1IG6A 5B7WA 2LCWA 1JXBA 2OXOA 2AGPA 3M7DA 5B0GA 2NXCA 1WACA 3QGPA 2YQ1A 2ZJQL 4DQPA 4N8OA 9ICKA 2JEJA 4FW2A 3ZSVA 1XNRJ 1ZD2P 4E7LA 2ZJRQ 1M1GA 3NS1A 3OXLA 4E89A 4QS7A 4B3RK 4OYZA 4BRMA 1BGXT 3CCRN 2CG8A 2ASMA 2J0XA 4WTYA 1E3MA 4F3OA 4OJ3A 2F8MA 2VF3A 4K4HA 4QBUA 1SJFA 3MDFA 1U0HA 3SV4A 4KLGA 5GTIU 3QZ7A 5J8YC 3VERA 4JV2A 4DV1J 1VSFA 2VWBA 1QQ7A 1PYOB 3NF6A 4ZP7A 2D3O1 4OYIA 3N7PD 2V0NA 4ZVTB 2CJYB 2IJFA 4KO0A 1U8SA 3GE1A 1Y5LB 2ZJPQ 3DLLL 3V6KA 3DKDA 4QS8A 4PYAA 2YWKA 2IOFA 2XI3A 4CO3A 2HQGA 5GINA 3OTCA 4IFYB 2WTUA 3RH4A 4IOCL 5LMUJ 1SIJA 1Y0HA 4UY8T 2BCVA 1S9EB 3CDWA 1KBUA 2J9DA 1KQSM 2ZWHA 3F5TA 2FB0A 4ANEA 1Q5VA 3LM9A 1YKWA 3N79A 5GAHP 1VLYA 3NG8A 1WN7A 4K8RA 1T6DA 1JX4A 2A42A 3UDVA 4TUQA 3NCRA 4FJ7A 3CTRA 1JLGA 5I3PA 4KI4A 2AJ1A 3C65A 3OUYA 1PGZA 1C6VA 4U7BA 2RU3A 3J7Z5 4ECQA 2DRDA 1DTQA 3DFEA 3AO5A 2XG8A 2UUCF 5A8WB 4F26A 1QUVA 1VSKA 1TL1B 4F91B 1BIZA 4FXWA 1SV0A 4FZNA 1FE0A 3DI6B 4KHUA 4ECZA 1RFQA 2WK4A 1X60A 3KHHA 1ZOLA 5KFHA 3LPUA 5KFZA 4ZP8A 2OI2A 2B5JB 3TEHB 3LDNA 9ICRA 2V2ZA 2DGQA 5H1SQ 1HI8A 4ZLJA 2E4LA 3QATA 5M2PA 3PR4A 3NWGA 3OHBA 4H54A 3TTCA 2GS8A 5CZVA 1P8GA 5ALOA 2DTUA 4X66J 3RYLA 4FP9A 1VSLA 1WAFA 4UB5A 3EZ5A 4QPXA 1KEJA 5HP1A 3NNHA 3ATUA 3PJWA 1S1TA 5ELZA 1FKPB 2X3DA 3HOTA 3BH7B 3ZEUB 1Y64A 2D5RA 2VQEJ 3RAMA 2XVTA 2GX8A 2ABYA 2R2TA 4GV3A 1TL7B 1ASWA 3WK9A 2E5LF 3HMJG 2PMHA 3ZETB 2AJFE 4DS5A 3BKTA 3I9ZA 4GKKJ 2LXFA 3KBBA 1ZM4A 4CERA 1JKHB 4CIFA 2NRZA 3QMLA 1HW8A 4C6AA 2D41A 3FFIB 3V1QA 2XMTA 1U1RA 4Q44A 4L73A 2IJRA 2RS2A 2PAVA 1SBRA 1GTEA 2XEXA 1WELA 1DBDA 3N28A 3CJ2A 2OMLA 3W9JA 1VJ5A 4E1JA 4DR4J 4GW6A 1SXEA 3OFHA 2HRYA 4AYBC 2PSZA 2Q0UA 2ZH2A 1RDBA 4DZDA 2VL1A 2HNZB 1P1LA 3VALA 4M9GA 5ITHA 3N6MA 4DMNA 4DTSA 3ZSOA 5FDLA 4O5BA 1JNRB 1FFUA 5L1IA 2M4MA 1S1UA 3IG1A 3JQMA 1VBKA 2ZM6F 2LYHA 4WZQA 2XQCA 4DR6F 1RB0A 4TN2A 4HACB 1IXRA 2HVIA 3QYPA 3W65A 4ZHRB 3HXMA 1VSDA 5G5HA 3DAWA 1COOA 2MQNA 3RJIA 2EBEA 1T4GA 4B3MK 4QYZK 3HVWA 5EWFA 1VS3A 4KB7A 4BRGA 2P9PA 3PIOL 3K8VA 4ZA1A 2QX0A 3VVTA 4QZIA 2AEJA 5DG7A 4H5TA 3KKAA 3EGNA 4N76A 1HYSA 3FEXB 2P9UB 3EGZA 4ZK7M 4YMMA 4WFAQ 7ICLA 3GU3A 1Q9YA 4KX3A 3HVAA 3LDPA 4DR2J 4ACOA 1UVJA 5ALNA 1D1UA 4IC9A 9ICPA 1H73A 3QU2A 1PYTA 4Y2PA 3R2CJ 2DGWA 4I28A 3JSYA 3MM9B 4OJOA 2PO4A 5J2JA 4DSLA 2A6AA 1SKRA 2WBMA 5AQZA 1UT8A 4MIBA 4NLGA 5G0RB 5DBBA 5GAEP 4MKAA 4CT9A 4BWJA 2AD9A 4Q2MA 4NLBA 1X3MA 5IS2A 1IQTA 4B3TK 1WD6A 3JTOA 4KT0C 3RRGA 1GLJO 4PGQA 4YY3F 3NE6A 3LQVA 2VU5A 2VUGA 1RAHB 4M3WA 4W5RA 3AJ1A 3LDSA 3M9OB 3CCJS 1TAUA 5HQ8A 4FNIA 3CVKA 4DR5K 3DOMB 4F4ZA 4DV7F 3M6ZA 1HBOA 3BP8A 1YHQN 3H98A 4U67Q 3DGPB 3UE2A 2ZJRL 3IA0A 3ICLA 1HFEL 4I67A 2K4EA 2PGCA 4DCHA 2VA2A 2HFOA 3FLCO 1IKVA 2IBKA 3HKZD 2KJWA 3VQQA 2YHWA 1MA7A 2DKZA 2BR0A 2DISA 1X7VA 1VBYA 2NLWA 2FJVA 4D3GA 3DM2A 4H0VB 4JKGB 4CD3A 3N0VA 3GB0A 2Y0SC 8ICRA 3BKFA 3SK3A 1SQKA 4CF8A 2KKVA 4O3SA 1U2RA 3W63A 5GAGI 2ZJPL 2HFSA 3UIQA 4F04B 2KJ5A 3QRPA 2D4WA 3KK3A 4NWBA 3J80O 2RU9A 2JZ5A 1WTFA 3NFAA 3F44A 3P3DA 4IFVA 1FWKA 3JSRA 3M2RB 3W0LA 5B8HA 3ZZOA 4DR7J 2NSBA 3VQ4A 3HT0A 1A76A 2DVIA 2XLIA 3FBBA 3MN6A 2F4VJ 5ADXA 4KPCA 4FLZA 1WC3A 3UR0A 1NH7A 1KKHA 4HLBA 2ZJAA 2GIQA 4FVMA 2EPIA 2B9XA 4R0JA 4CJLA 1MSWD 3K2YA 1C0FA 1PCAA 4KHPK 2RUGA 4Y3CA 5A76A 1QTMA 5AI6A 5KFTA 1ZZFA 3MMBB 3AO4A 1G4CA 3HKWA 2FDRA 3U9DA 3AQEA 3NF9A 1WG5A 4PH5A 4BREA 1R27B 1WEXA 4KREA 1PK1A 2ATCB 2BCRA 1TFWA 1J5EF 2KJ9A 3G25A 4AHRA 4DMZA 2F9TA 1ROFA 1HMVA 3H46O 3UN2A 5C2DA 1HPZA 4JHDA 3NTUA 4ZP9A 4LF5K 2G07A 1KLNA 4Q0BB 5L1LA 3E9LA 4ZCKA 1NO8A 3GPAA 5IIKA 2DHGA 3J81j 3RUBL 3D67A 4LF6F 1EWRA 1WG4A 2MQQA 2C28A 4DV0K 1FRKA 1RAJA 1DARA 1I94F 1IH7A 2GWKA 2G08A 3PW0A 4K2JA 2F3NA 3BDPA 1T6CA 3D9BA 3KMQA 1EHWA 4LVOP 5KG2A 1S0VA 4EP4A 1K9MO 2HPUA 4LREA 3UDLA 1N88A 2AQ4A 3I6PA 3KLIA 3AM9A 3UQ0A 4CGZA 1EQYA 4KHQA 4CEFA 3QWPA 2QARA 1YBUA 4MHVA 3M6GA 1NCLA 3D7SB 1SC1B 1RU2A 2DNPA 4OCZA 3IR5B 2YTUA 3H5XA 4OZ5A 1TL3A 4DSFA 5D4OA 3CJTA 5L9XA 3N5FA 1W26A 2GUPA 4M94A 4LFCK 3MEDA 2OIHA 3VAKA 1U2VB 1XNQK 3O08A 1HNZK 2UU9F 1TVRB 3LUYA 4C4TA 3W2WB 5T7LB 4PXCA 1ZM2A 2V8HA 5HL7Q 3M8QB 1B9FA 3ILOA 1TELA 4MLEA 4H4OA 1N33J 2F8HA 2V2QA 4QS9A 5J2AA 1T9WA 1RILA 3NVWA 2EFOA 3A4TA 3ULHA 1D8BA 2AU0A 1UVLA 2KHQA 3BZKA 1SIZA 1X2IA 5KFOA 1X3NA 1VQ9S 3SAFA 2ZHAA 1CVJA 2OFHX 2PA8D 2Q6CA 2O1PA 4R5PB 3NMUA 3U02A 2UUBK 3VA0A 2OEHA 1Z00A 4QWDA 2DO4A 4W5NA 2NXNA 3KLHB 1RM6C 3X3UA 3DLEB 4DPWA 2NV3A 3OYGA 5C25A 1OW5A 3CWJA 3B54A 4QAGA 3RH5A 1Z4NA 4JV5J 2KFZA 4DL2A 4O3PA 2IHR1 4J2BA 3VCBA 3U7JA 3NH1A 1SH2A 5BYRA 3W7BA 5DMRA 4QU7A 4RU2A 3C1ZA 4R79A 2PC6A 1HUOA 4ZTJA 3N7SC 2CQ3A 2OHDA 3W9HA 4KY3A 3RJFA 1JLBA 3DHXA 4FWSA 1REVB 1XNRK 3FYHA 1GH8A 3PSTA 1I6JA 4JI2J 2KSOA 5LJWA 1DRZA 5ALMA 3EEQA 4G1PA 3TW0A 1SPBP 2QEXN 3HP6A 1OQ3A 5FP0A 4ETZA 1UAWA 5J0WA 4WFAL 2W9CB 1KRPA 1J97A 4X64F 5IC4B 3GFKB 4UB3A 3MOJB 4IS7A 3O8WA 2XHBA 2UXBF 2RHQB 5B0AA 1FD8A 1LKZA 3LP0A 3HULA 3NASA 4DV1K 1BG3A 1NDCA 3QLHB 3QT5A 3ULEA 3RBDA 3TARA 3F41A 1FFGB 2NUUG 1XSLA 3VZIA 3CJ3A 4GO7X 5J2GA 3JPSA 4J9KA 5BR9A 5LMUK 3R9LA 4BGDA 3CJQA 3OYNA 3M3ZA 1NSKL 3VQ5A 3W1YC 1Y7PA 2W01A 3VTHA 4K4XA 3SD7A 1UAXA 4CLLA 1VRQC 2VIHA 4RPYA 4AF1A 3LP2B 5EX0A 3K58A 3M8ZA 5F9NA 1O03A 3CCUS 1CZ9A 4Q45A 3C2MA 5LT5A 4FK0A 4X62J 4AL5A 3C6UA 1IG8A 5BPLA 4CZCA 2FZKB 5KFUA 3HYFA 2Q79A 4F5RA 3QUTA 2KJ8A 3DNCA 4C48A 2DRAA 2MSTA 1TKZB 3KK2B 1NGEA 3ENBA 5A0LA 1ICEB 2VA8A 1C4AA 1V97A 2VKQA 3TFRA 3FJ2A 4Z7YA 1Q53A 3OFGA 4DL5A 4EK2A 5H2FU 4C0BA 3AH6A 4YDXA 5CZ1A 5A6PA 1RA7A 1TFRA 4W5OA 5J2HA 2MMYA 3BGUA 5L39A 4JI8J 4EBEA 2VFSA 3V5RA 3QJJA 3JXOA 3PRBA 2FLLA 3TKAA 3JAMU 2WCXA 8ICZA 4I27A 4ELUA 4J9UE 3SFGA 2BA9A 3CI5A 9ICLA 2QEXS 4X66K 3CCMN 2MHNA 4OGEA 1RYSA 4KGVB 3QEWA 4UZCA 2KG1A 2GJ2A 7ICOA 4CIEA 4IFYA 2B43A 3TUPA 3MF5A 4LRFA 3VQ9A 3TZYA 5J2BA 2NQPA 3I33A 1HL6A 3ISND 2YKQA 1S9EA 2RQ5A 3N4PA 4CHPA 3WKCA 1IO2A 8ICVA 3MPDA 3BDEA 4ALZA 5ADZA 1VQMN 2QM1A 2UV8G 5ALTA 3H40A 4FJLA 4CLFA 2E8MA 5KQ8A 1QCKA 2WVEA 2WTFA 1FDNA 1ZTWA 3CDBA 2EZYA 3ITHB 5KG3A 2R7WA 3HZGA 4PPDA 4WXWA 3A5NC 4NZ0A 3B0YA 2VC0A 3CRXA 1RDDA 1FEHA 4NYOA 4K25A 5AT1B 4B1UB 3KHLA 2KM8C 3B6OA 2DGZA 5J1NA 4IO9Q 1REGX 3D0PA 4RQ1A 2PFPA 2MKJA 4CK2A 1DGKN 4M1KA 1ZQGA 3WKDA 2H65B 3CULA 5A8WA 3OS0A 1TL1A 2Z0GA 4DR4K 3IMQJ 3DI6A 3PJXA 1XMQJ 3JXUA 4PUOB 2BQUA 3QEPA 1QQMA 1L7PA 4O5CA 2BZFA 5AQVA 4AUKA 4NL9A 2B5JA 4PXEA 2R18A 4YN3B 3CD0A 4L75A 4DS4A 4C8ZA 4UAYA 3TX8A 3U3GA 4UB1A 4Z6CA 4A46A 1EX8A 2JL9A 5CA7A 3ZTQA 4PKGA 3IRXB 1P9QC 3TR8A 1NRKA 2GQ2A 4ECUA 1FA0A 4ATNA 3LH2S 1FKPA 2IM0A 1B9DA 3I55N 5ALJA 2KI2A 4O23A 4YNQA 5BRDA 3K9KA 1SH0A 1I5OB 4KV8B 3HSZA 3CC2N 1N36J 4P4PA 1TL7A 3QAEA 2W25A 4TY9A 2EC2A 2F63A 1V5VA 4DFDA 4B3OB 9ATCB 3AA2A 4NXNK 2ZFHA 3IHQB 3ZETA 3BZCA 3OTQA 1WHYA 4CJSA 3MECB 1EP4A 4DUZJ 4Z0UA 4NL5A 8ICGA 1JKHA 5HL7L 1TAMA 4P2XA 2E2OA 5BOLA 4AT1B 4C4SA 2FHJA 3TVYA 1YJ7A 2GVDB 3FFIA 3O4NA 2KKHA 4CLYA 4F67A 1UQVA 1VQPS 4GFJA 2C2OB 3H0PA 3K89A 1BE4A 5E5NA 3H8SA 4PA1A 1Q9XA 3GSDA 1ZJNA 4P0QB 3P49B 1WOOA 3A8YA 4WFNQ 1MDUB 3U6FA 4HHTA 1DLOB 1FXDA 1RQ0A 4QJVA 3TAFA 4USIA 5HANA 2AIRB 4KX5A 2XBPA 3JPOA 3SI8A 2KVIA 2ZUAA 4NCAA 4ZOSA 4FWQA 3WC2A 4WU3A 2HNZA 5EX5A 4CFCA 4USJC 4A8KA 2JHDA 3WX8A 3T5LA 5HN0A 1FVQA 1VQLS 1UZHA 3AN1A 2D3UA 2QRRA 3L3VA 1BOTO 1OPIA 4KLOA 2QN6B 4LRCA 1VQYA 1MLAA 2ZHOA 7ICHA 8ICSA 1RXWA 4DTJA 4OX8A 4YB1P 4ANDA 1LFWA 1SC3B 5F3ZA 4NEYA 3SXLA 4HACA 2XZWA 3RMCA 4ZHRA 3C6AA 2W8LA 3H8YA 4PYDA 4A47A 5J0SA 2O5DA 4OI4A 5L1KA 1V4TA 5ALDA 1UETA 2BJ3A 3TI0A 1N60A 4Z4IA 2XS5A 4LFAJ 1AUDA 3WT0A 5AQOA 2EFVA 4PHDA 2KN4A 2W42A 2P9UA 4M2YA 3NMAA 2GAGC 4I4BA 3S7RA 3GJSB 2XWYA 1W97L 3BQ1A 2BCSA 4FYWB 1H1VA 2EHGA 4OZNA 4KH5A 3RVCA 3A3OB 2DNGA 3R6GB 4ZVGA 1Q86O 4TLRA 2W6LA 3C16B 4FJ9A 1NMEB 1ZD5A 3MM9A 2VB6A 2M70A 2PFFB 2F9WA 3NCQA 3O9SA 1FJEB 4AXJA 2CJAA 4CF4A 9ICTA 4CJKA 1WI8A 2WSFC 3QFWA 2HMIB 5E3AA 3IDHA 4CLUA 4LSZB 5G0RA 5AQSA 4DR7K 5CZ2A 3H2UB 2B9WA 1WDDA 3BYPA 1ZQYA 3OYKA 2E9ZA 3WXJA 3BEGB 2GMLA 2F4VK 2G8VA 1Q95G 3DGVA 2EDUA 2RDJA 1RT6A