4DSKA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, ppi and calcium
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
579
structure length
575
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*GP*CP*TP*AP*CP*AP*GP*GP*AP*CP*TP*CP*G)-3')
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 205
structure length 575
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dskA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dskA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dskA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dskA01
2ZJ5A 4DTUA 3AVNA 5F9NA 3PW4A 3MR3A 4O3QA 4QZEA 2VWKA 8ICZA 3PW2A 3HVTA 4M3TA 5DG9A 2XO7A 1JL2A 2BQRA 1VSFA 3CFOA 5DMRA 4AILC 4CJSA 3V4IA 3C94A 1S1WA 1IO2A 1GOAA 4CJUA 5KFMA 4Q5VA 4CGGA 3QLHA 5KFKA 1TV6A 2ETJA 4LY7A 1T3NA 1XWLA 4I29A 4PGYA 1L3TA 4FJ9A 3LP0A 4ZHRA 3C5FA 3HM9A 3LZJA 3SUNA 2KZ3A 3OYIA 4CEAA 7ICJA 4CHQA 8ICKA 1JKHA 5KG3A 1QSSA 1JLAA 5DQGA 3RMAA 1BI4B 4CGJA 1BPBA 1ZQTA 3HSTB 4DO9A 3IM1A 1VSHA 4HHTA 4IDKA 4CK2A 4CCHA 3I8DA 1BIUA 3AVBA 1ZQFA 1U9LA 3G6YA 1VK0A 1S0NA 2ATLA 2PFOA 1VRTA 3PV8A 1V9PA 3MDCA 4RQ0A 4RNNA 9ICWA 2Z1HA 2J6TA 4ED7A 4PPXA 5DLFA 4RNOA 2ZQBA 2W9BB 2P6RA 3UQ0A 3ZT1A 5C5JA 4M9GA 2IC3A 4W5TA 2R7YA 1L5UA 2JGUA 5DQIA 4KTWA 3V9SA 1CZBA 3CFPA 2RDIA 5KGWA 4NM1A 3AUOA 3SJJA 1Z25A 1WCNA 3U3GA 3HPHA 4EBEA 2VG6A 7ICIA 5J2KA 5I42A 3LK9A 2PI5A 3F9KA 3SPZA 5JUMA 2ZUDA 1NJWA 4DSKA 4KI4A 1ZQSA 2IBKA 4FJNA 1F21A 4DFMA 5DDYA 3KHRA 3RH4A 4CFCA 3RJJA 1HPZA 4YR0A 8ICIA 4Z6EA 2W8LA 4IR1A 5IINA 3KJVA 4RQ5A 4PUOA 1B43A 5KG2A 3AA4A 3JPOA 2XY7A 3RJEA 1ZQCA 9ICIA 3MEDA 4CJKA 4KFBA 2KTQA 5T7BA 3MXIA 4MFBA 4J9QA 3IG1A 4AHTA 2ZJAA 4GLXA 2C22A 3ZSZA 3FYHA 5HHHA 1JLCA 3S3OA 4KAZA 5DBBA 4FJKA 3ZSXA 1YVUA 2NUBA 3M8SA 4LVSA 3LDSA 3QERA 1NK5A 1HUZA 1AROP 2OPQA 2UVRA 2HNZA 4TQRA 4LH4A 2Z1JA 1K6YA 4KLSA 3MXMA 3ORYA 4MFCA 3EY1A 4M41A 1N56A 4ED1A 1QE1A 2C28A 2DFEA 3PX4A 3PMNA 2NRTA 4O5BA 1JMSA 3AU2A 4KLEA 5J1EA 1EP4A 1T4GA 3QETA 9ICQA 3C21A 3NAEA 8ICAA 4E3SA 3AA2A 1ZQEA 1COOA 4DF8A 2W9AA 4KTZA 4EBCA 8ICNA 5FDLA 3ZT3A 4ECQA 1C7YA 4O0IA 4KHUA 3EPGA 4FM2A 4KB1A 2IMWP 3MR6A 4JUZA 4M04A 4O3NA 4O5KA 3ULDA 1UT8A 4FLUA 4F5NA 4K4GA 1HJPA 2OPRA 2BCVA 3OY9A 2A1JB 1IG9A 2JEIA 1DLOA 4FYDA 4F2SA 1C0MA 4M3RA 2BE2A 3SUQA 4JV1A 1VSMA 3MR2A 1U48A 2BGGA 3NFAA 2FBVA 4ELVA 5J2PA 1BPYA 3Q8MA 4YD2A 1U49A 3T1AA 3OSPA 3V1QA 1T03A 5DG8A 3QEWA 4XQ8A 1NKBA 4I2JA 3VQ9A 3S9HA 3ZSYA 1HJRA 4M42A 2WONA 4KLJA 3NTUA 2F1HA 1K1QA 3AA3A 7ICMA 4W5RA 2IHNA 5KFNA 3PNCA 1S76D 1ZQMA 1LV5A 4NCAA 4PGQA 4CERA 1B9DA 3MECA 4CF2A 1DOQA 4P4MA 1NJYA 2OPPA 2FLLA 4DF4A 3Q8PB 3EWAA 4FJLA 1IKVA 3VQ6A 4EZ9A 3AU6A 3S3MA 4FZZA 4KMUA 3FFIA 4F5RA 4MFFA 3LANA 3Q8RB 4CEDA 1RTJA 5KFZA 4DTPA 4CE9A 5C24A 1SKWA 4J9KA 1CUKA 3SV4A 4XA5A 4NLNA 4O3SA 3IS9A 2HHSA 7ICGA 3VQ8A 2ZUBA 4I2BA 5J2EA 2FPKA 4LSNA 4DLEA 5KFOA 7ICHA 3RMCA 5IIJA 3NF9A 8ICBA 2I1QA 9ICPA 1RT4A 2ZJ8A 5CB1A 3OYBA 4YN4A 4EZ6A 3TFSA 3K75D 4NXZA 7ICVA 3GIIA 1TKDA 3K5NA 5D46A 4J9OA 4NY8A 2RPIA 4RPZA 3LP1A 2QK9A 4CJQA 3KLFA 1X9SA 4J2DA 4FLYA 1IKYA 4IQTA 8ICUA 1X9MA 1TV9A 1Z26A 4CGDA 4KLMA 1NK0A 2HHUA 1RPLA 1XSNA 1NOZA 3RJFA 2V4QA 2AQ4A 1UAXA 7ICFA 4IBNA 3ISNC 5KG6A 3A2FA 4B08A 4KV8A 4QZ8A 4F4WA 4DL6A 8ICMA 1ZQYA 4RU9A 1KRPA 5DLGA 2WOMA 3QNOA 5KFWA 1O1WA 3OVNA 3ZD8A 4RQ8A 4QWCA 3BQ2A 3S3NA 1RCHA 4YXMA 1FKOA 1WLJA 4I2AA 1BQMA 3PVXA 4Z4FA 2J6UA 1BIZA 2R8HA 4CK1A 5DB7A 3OYNA 3DMJA 3K5MA 1RZTA 2IOCA 2FC0A 5CHGA 4NCGA 8ICJA 3JPNA 1REVA 2G8FA 5KFDA 4ELTA 4QZIA 5KRTA 4O3OA 4I28A 5J0UA 9ICHA 3QZ8A 3AVGA 3C5GA 2E4LA 3ZSWA 3AVAA 2NRVA 3DI6A 1LAVA 2FLNA 4JRPA 4BE1A 3RR7A 4ZH4A 4CESA 4N5SA 4DSJA 2KZMA 4B9MA 4M47A 2QXFA 1WCLA 1HYSA 1L3UA 2EHGA 2O4IA 1KLMA 4F4KA 2PYLA 2ASJA 2PI4A 3C6UA 4GC7A 3V72A 4PWDA 3ISBA 3DLKA 1ZQUA 4E7JA 3OYCA 8ICXA 4GXIA 4OLAA 3SQ0A 2DFLA 5L1LA 1KTQA 3OYJA 5JS1A 5HMMA 3KKSA 5KFIA 5DBAA 1ZQRA 5J0PA 2R8JA 5J0SA 3OHBA 2P66A 3RB3A 1L3SA 4CIEA 3TWHA 4M3WA 1RXWA 4I27A 2F96A 4DQIA 2JEFA 4AHRA 4UAWA 4UAYA 3UXOA 1IH7A 3RMDA 3LDAA 2AGPA 5HMLA 5KFVA 4YVZA 4QW9A 3OJUA 2O4GA 1SV5A 1S1VA 4W5NA 3DOLA 5KT5A 4IG0A 3V6DA 4ECSA 3ZSRA 3KHLA 2BCRA 2YKMA 4PHAA 4KLFA 4CJPA 2B4JA 1XHZA 1YT3A 4M9NA 1Z00B 2A1SA 4TUPA 2P5GA 3QNNA 4PH5A 4DFPA 1RT1A 5J0WA 1NKEA 2XY6A 3OYFA 3K58A 2XY5A 1UWBA 3HP6A 4KI6A 2XGQA 1X9WA 3ITHA 4EYIB 2IHMA 5KFAA 4B9TA 4CEOA 3EPIA 4Z4HA 3QEAZ 8ICGA 3AVIA 3THVA 3BQ1A 4AHVA 3LAKA 1RT6A 3KK1A 3U6FA 3K4GA 5D4BA 1HMVA 2IDOA 2G8VA 4R8UA 2BGWA 4QZAA 5KGXA 4R8UB 4B9LA 1ASWA 1HNVA 4AHUA 4CJFA 1T8EA 2YNIA 4RNMA 1GOCA 8ICTA 1S1TA 3HX0A 4OPJA 4OKJA 3ASMA 4FBTA 3AVMA 4LD0A 1ZBLA 2IGIA 2FBXA 4FM0A 4F4YA 3P83D 2X6NA 1D8LA 3L2RA 5CZ1A 1VSEA 3VQAA 4DTJA 1MC8A 3N97B 5HHIA 4E7IA 5SZTA 7ICUA 4JS5A 4CJ5A 1HYZA 3IAYA 1ZQGA 1BI4A 1DGSA 3DOKA 4DWIA 3WNFA 2VA3A 4LH5A 4EP4A 3HK2A 1JN3A 3M9MB 4DMNA 3HT3A 1NJZA 4YD1A 2BR0A 5J0RA 1C1AA 4B9VA 3GILA 4YFKA 1JIHA 5EWFA 3AVFA 3RAXA 4FJIA 1KVCA 5EWEA 1PZNA 1ZQWA 3HYFA 1BPXA 4CGFA 3K59A 1NK4A 4FS1A 5FRNA 3TABA 1UOCA 2AU0A 1JX4A 1NK8A 3DYAA 2GWSA 3OHAA 3B0XA 2W9BA 1TK5A 4B9SA 1FKPA 4O3RA 1K1SA 2E6LA 2P6UA 4E7LA 3MR5A 1BGXT 2PZSA 1ZQXA 1RTHA 2UVVA 4K4HA 2D0AA 4Q45A 5DB9A 4NYNA 4NM2A 4YG2A 3HW8A 4IFVA 3HL8A 4KLOA 3RH5A 2VA2A 3L2VA 3TAFA 1S6QA 5BPCA 2OWOA 3LALA 4IQVA 9ICAA 3OYAA 5J2MA 2YHBA 3O3FA 2G8KA 4MFAA 1YTAA 4E0DA 5EU7A 7ICLA 4QZFA 3ZDDA 4WE1A 3L2WA 2PXIA 1QSLA 4KHQA 1S5JA 2F1JA 4FLWA 3NCIA 5D49A 1H38A 3PW5A 1KFTA 4FM1A 3DLHA 5L1KA 4CFAA 4UB2A 4RUAA 4O3PA 2X6SA 4FLVA 4C8LA 1XSPA 3PO4A 3SYZA 5DK5A 3KD1E 3KK3A 1S1XA 3GFKB 3VA0A 4FXDA 4O9MA 5FRMA 1XSLA 3C2KA 2DFHA 1LW0A 4QOZB 7ICRA 3VN5A 1WNSA 2D0BA 4DTRA 1ZBHA 1JLGA 9ICFA 4FK2A 3T5HA 4M3YA 2ATQA 2E6MA 1RBSA 5C42A 2BPFA 2F8TA 2D5RA 4F5PA 4ECWA 3MEEA 1VSDA 2MUTB 9ICNA 4R65A 3K57A 2P5OA 1GOBA 5J2DA 3ZSOA 3ZT0A 4CJVA 2JEGA 4M0AA 3DRRA 4DTNA 3NGZA 4XUSA 1HQUA 4CJRA 1MQ2A 3EZ5A 4G3IA 4Z4IA 4RQ4A 4R63A 4R5PA 3GIMA 3V81A 1KSPA 1A77A 5J2AA 4QZDA 2DPJA 7ICQA 3KLIA 4YMOA 5KT7A 1LWCA 2AQ0A 3RJIA 3DRPA 4ECYA 2G8WA 3M9NB 3TAGA 4MEYA 4YMMA 3AVLA 1HNIA 4I2EA 4IRCA 4CEQA 5KG7A 5KFFA 2KFZA 1BISA 4CF1A 3SNNA 4KREA 4RQ1A 3NGDA 4E19A 4F5QA 4Y1DA 4HUFA 1CEZA 2IA6A 4IG3A 2A1JA 2W9CA 3MGIA 3LPTA 4RT2A 9ICCA 4M2YA 2GBZA 4CIGA 2W9CB 4FS2A 2OZMA 3MAQA 2XHBA 2J6SA 3JSMA 3DLEA 4CHYA 2NRWA 3V7KA 4FO6A 1TKTA 2KFNA 2H5XA 1KLNA 5IIKA 2HHVA 3KLEA 4GC6A 5J29A 1QQCA 2VG5A 3N4MB 3MXJA 4CHNA 1ZQOA 4YR2A 4F4XA 4P4OA 1ASUA 2RN2A 4CGIA 4ZTFA 3CYMA 9ICEA 2VANA 4ECTA 5HLFA 4QZ9A 3HP9A 3QESA 5I3UA 4BWMA 4JWMA 4E89A 4OKKA 3CG7A 4JRQA 3CM5A 2LSNA 1QS4A 4R64A 4CJ3A 5CYMA 2XGPA 2HNDA 5DBCA 3V1OA 4BE2A 2DPIA 4RPXA 1ZQBA 1FXXA 1RILA 1S6PA 3ZDBA 1HRHA 2YNGA 4Q8FA 4QWBA 3T3FA 4FBUA 4YXJA 1KVBA 4G1QA 2Z1GA 1C0TA 4PY5A 1D5AA 4DOAA 2BPGA 4H8KA 2R8IA 3I0SA 3QE9Y 8ICHA 3OS1A 4FLZA 4I2DA 4CECA 3MABA 2BANA 4M6WB 5DDMA 2KZZA 3L2UA 9ICBA 1W0HA 1HUOA 5KFYA 1ZQPA 5HBMA 3NE6A 1RDDA 4O0JA 1UT5A 2NRZA 5HNKA 2X78A 3RB4A 4JWNA 4ED6A 5J2QA 4DL3A 4UBBA 2RKIA 4DFJA 1VSKA 3SQ4A 5IILA 1FK9A 3WNHA 3TAPA 2I9GA 9ICKA 3H40A 2I5JA 1RYRA 4OVLA 3V9UA 4PA1A 3PW7A 9ICRA 3RJKA 3AVKA 4ED3A 5HRNA 3H08A 3PO5A 2XRIA 2OA8A 4ED0A 1C6VA 5L9XA 3RB6A 3WNGA 5KG5A 4ID1A 3M9OB 2RF2A 4CEFA 5KFSA 2AJQA 8ICYA 1RT7A 3D45A 3H8JA 1CXQA 1J5OA 4J9MA 8ICEA 5KFPA 3M8RA 1WAJA 3L8BA 3SV3A 4KHSA 1I39A 5J2FA 4B3OA 3OYHA 3LP2A 4MQ3A 4AH9A 1RTDA 3V9ZA 2YNHA 2HHWA 5CR0A 1RDBA 3F73A 1JXLA 1W9HA 4KB0A 3BQ0A 4OGEA 4KO0A 1ZQIA 3E01A 5KFQA 2BDPA 5KFTA 2HVHA 4J2BA 3RRGA 3NGIA 2ASLA 1S0OA 3TFRA 3O3GA 2R8GA 1KFDA 1XC9A 4DQQA 2G8IA 3KLHA 7ICSA 1WSHA 9ICSA 2KN7A 1UA1A 4E7HA 4DQRA 4I9QA 3GV5B 4RW4A 3SUOA 1IM4A 1ZQLA 4KITB 1IKWA 2HHQA 2JZBA 2Y1JA 8ICLA 4IQWA 3RTVA 3PY8A 2EX3A 3TAQA 4TSXA 4F2RA 2JZBB 4C8NA 3LP3A 1C1BA 3UXNA 4YCXA 3O4NA 2HHXA 1A5XA 4DOCA 3NF8A 4M9HA 4K8ZA 3NGYA 2LYHA 3IHQB 3QEBZ 1S0VA 1Q9YA 4YP3A 3RRHA 2KQ2A 3OYEA 3PW0A 3VA3A 1SKRA 3QEXA 2B21A 4J9SA 1SUQA 3AO3A 5DQHA 1C0UA 3UQ2A 1Z3EB 4RW9A 5KFUA 3KLGA 1RTIA 4XIUA 1KCFA 4TQSA 5KG4A 1XS9D 4CJLA 1SL2A 4JK1A 3RH6A 3ISCA 3I0RA 2B5JA 2PFNA 3Q8QB 3TQ1A 3O3HA 4FJJA 1SL0A 4Z4EA 4J9NA 1YTUA 2ALZA 4F91B 9ICMA 4J9LA 5KFHA 1NKCA 4ED2A 3RR8A 4BXOA 1BQNA 1ZQVA 8ICQA 4BDZA 3UIQA 4BXOB 4OPKA 8ICOA 5KFEA 3V6JA 4BGDA 5KTQA 4OLBA 4K4IA 3PUFA 1Z00A 3O4QA 3MEGA 4PQUA 1ZQDA 5L1IA 1BCOA 4RW8A 3VQDA 3V9WA 1RBVA 4Q44A 2AGOA 4HYKA 2JLEA 3GV8B 9ICJA 4JV2A 1VRUA 1NOMA 3B6OA 2BQUA 4O4GA 2FPLA 3AA5X 4HCCA 3SQ1A 9ICTA 3CQ8A 1S9FA 4RW7A 4RW6A 3NDKA 1DTTA 2QKKA 1N6QA 5HRSA 5BOMA 1QLNA 3QINA 1VSLA 4CIFA 3NH1A 3VQQA 3PX6A 3ZSQA 5F9LA 4RZRA 4YFUA 3AVJA 5J0OA 4MEXA 3HPOA 2C2RA 4DFKA 4GMJB 4FK0A 3B6PA 4FJ8A 4M3XA 8ICCA 2IS3A 1EKEA 4FJMA 4UB1A 2FMPA 3G0ZA 4N56A 1SKSA 1S0MA 4FJGA 4IQUA 4F4ZA 3JYTA 2ZE2A 1BL3A 4CJ4A 1I3AA 3AO1A 5HRRA 5J2CA 2A1RA 3G6XA 1S77D 1ZJMA 4FZXC 2BPCA 5KFJA 5IIIA 1D9FA 4I2CA 3LAMA 2MAXA 4I2IA 4E1MA 3KKRA 4FLTA 4NCBA 4FW1A 4F5OA 3H8SA 3BJYA 3C2LA 2JEJA 4DOBA 4M9JA 1D9DA 3HXMA 3NF6A 3MDAA 2HMIA 3KHHA 5KI6A 3E2EA 4YR3A 4CFBA 4X5VA 1KEJA 4DS4A 3DLBA 1T7PA 3GDXA 1Q8IA 1WN7A 4DEZA 4BDPA 4HUGA 2V4RA 5DKWA 1RYSA 5K14A 4UAZA 2FBTA 7ICEA 1UA0A 3HWTA 4B8AB 4BDYA 4FJXA 2ITGA 8ICFA 3C1YA 5J0TA 5J2HA 5KRSA 5BOLA 4EBDA 1Y97A 1U4BA 1TAQA 3T5LA 5C25A 2YKNA 3QEPA 1TKXA 3PX0A 2VWJA 3TAEA 3C95A 3JPTA 4LZDA 1BPZA 4UB5A 1TL3A 4OJRA 3DLRA 3L2QA 1ZQHA 4F50A 1MSWD 3OYMA 4F92B 3K2PA 1N5YA 4FLXA 4IKFA 1EXNA 9ICXA 4W5QA 1RNHA 1BCMA 2BKEA 4EEYA 3KTQA 4H4OA 4PHEA 4H4MA 1WSGA 3HO1A 7ICPA 4NYFA 5KG1A 4IRKA 4KLLA 1QSYA 2ZTDA 5J2IA 5KT6A 4GXJA 3V6KA 4QZGA 3U3YA 4KN4A 4W5OA 1ZQZA 5KFRA 3SQ2A 3Q8LA 4J2EA 4CJEA 3ZDCA 1BPDA 1WSEA 1U47A 4F8RA 3MGHA 3K5OA 4CK3A 3VQEA 7ICKA 2KW4A 4F3TA 1JXEA 1TKZA 3V7JA 5KT2A 1ZETA 1XHXA 5HROA 5KFLA 2PFQA 1XU4A 2OPSA 1J54A 5IIMA 2FPMA 2HB5A 3SCXA 3UXPA 1ZQNA 3GV7B 1B9FA 4NLGA 1VSJA 1L3VA 3JPSA 4Q0BA 1CLQA 4Z6CA 1ZQJA 2G8UA 1EXQA 1TAUA 4FJ5A 1MU2A 4DL4A 5CA7A 4CHZA 2HVIA 2FBYA 5DGBA 2W8KA 4CEBA 2WTFA 5KFGA 4IRDA 5KFCA 4NLKA 2F1IA 2MUTA 3AO5A 3C6TA 4B9NA 4I2QA 2VA8A 2HNYA 4C8OA 3VQCA 3TI0A 5KT3A 3AV9A 3V7LA 1NK6A 1WSJA 4Z0UA 4N41A 1NJXA 4DSEA 3GIKA 1S9GA 2D0CA 4KKOA 8ICVA 4ICLA 3QO9A 3NHGA 4FK4A 3Q8SB 3TR8A 3C1ZA 3AO4A 3ZDAA 3KIOA 2FLPA 2HW3A 4TUQA 3VQ5A 2F8SA 2M9NA 4CEEA 4QAGA 4CGHA 4DSLA 3ZDEA 4Z6FA 2Q0ZX 4UQGA 4OGCA 5HP4A 4DU4A 4UB3A 1TK8A 3SPYA 3NF7A 3BQTA 3FDSA 9ICGA 3WNEA 4DLGA 4ZTJA 3H4BA 4P2HA 4LSLA 3P5JA 4I2FA 1ZJNA 4O55A 3B0YA 1WSIA 3KHGA 4DU3A 4KLQA 2PFPA 5J2JA 1ZQAA 1ZQKA 1CZ9A 1EETA 1NK7A 3H7IA 4BWJA 3TANA 2BQ3A 4DU1A 4HUEA 4XRHA 4MF8A 4O44A 1MQ3A 3LWMA 4RQ3A 1WSFA 4GVMA 4FVMA 2Z1IA 3VQ4A 2XCAA 3HPGA 2NRXA 4YMNA 1D8YA 1BPEA 2B6AA 4FCYA 4GXKA 1KDHA 3BDPA 4QW8A 1ZBFA 4J2AA 3NH2A 3BGRA 4RT3A 3NH0A 4TURA 1RXVA 3ETLA 4RQ2A 4EYHB 2PY5A 3HVRA 4F3OA 1JLEA 2ISOA 1X2IA 4RQ6A 5CWRA 2V9WA 3AO2A 1Y88A 4OKEA 4F93B 4DTXA 4I2GA 5J0XA 1BVSA 4CHPA 2HHTA 4DSFA 1A5VA 5TZVA 1LW2A 4QZHA 1RBRA 3RJHA 1XO1A 4IR9A 4EP5A 3V9XA 3RWUA 3ZD9A 2C2EA 5HP1A 1Q9XA 2BHNA 3IRXA 4FZYA 5DB6A 3SI6A 3JPQA 2BCSA 5J2NA 3ZSVA 7ICTA 2IAJA 4M6WA 3SUPA 2YV0X 1HQEA 4DQPA 2C2DA 1LWEA 1TFRA 2P51A 1KVAA 3AVHA 3JPPA 4O5EA 1BHLA 4DG1A 1IXRA 9ICVA 4KLTA 2ZTCA 4Q43A 4DTOA 3H8WA 4DL2A 3H4DA 4KTQA 4Y1CA 3QEIA 4I2HA 4KHYA 1G15A 4DTSA 2ZTEA 1S1UA 4CF0A 4DQSA 1C1CA 4HTUA 1RBUA 2UVWA 5JS2A 3CFRA 4PHPA 2ISPA 4Z4CA 1J9AA 3RJGA 3C2MA 1XI1A 4RPYA 4PHDA 8ICWA 3OS2A 3SZ2A 3LPUA 1LAWA 1QHTA 4KLDA 5KFBA 5EOZA 5CP2A 8ICPA 1U04A 7ICOA 4NLZA 1WAFA 5DB8A 4KLIA 9ICLA 9ICUA 4RG8A 3LZIA 2RDJA 3DLGA 1S9EA 2UVUA 1X1PA 1T05A 4Q8EA 4FJHA 4M3ZA 5D3GA 2AGQA 3PR4A 3EW9A 1NOYA 4KHNA 3Q8KA 1CXUA 3G10A 3DRSA 3ZCMA 5J2GA 2X74A 3ISDA 1ZBUA 2P1JA 4ECXA 7ICNA 3NBPA 4B8CA 1RT2A 3GQCA 5E41A 3V1RA 5SWMA 3ZT2A 4KN7A 2FMQA 1TVAA 1JLBA 3SI8A 2Y1IA 3HJFA 4JS4A 4ED8A 4DL7A 2YNFA 2YHAA 4PGXA 2BCUA 4JLHA 4CF8A 4L8RB 1A5WA 1RT5A 5CJ7A 4E7KA 1RT3A 4I2PA 3UPQA 4R66A 3MFIA 3QEVA 4FJ7A 4KLHA 8ICRA 2GV9A 2G8HA 3KD5E 4FW2A 4HCBA 3KK2A 3ALYA 1RBTA 4M9LA 1RDCA 1KFSA 4ECUA 3DM2A 3RAQA 3OSNA 3OYKA 4RUCA 1TL1A 2DFFA 3V6HA 3OGUA 1B92A 5DGAA 4E1NA 2FMSA 4DSIA 4HVJA 1S10A 1A76A 4B9UA 4JV0A 1ASVA 4KRFA 3PMLA 4ECRA 5J2BA 5L1JA 1SL1A 2W42A 4TUSA 1U45A 3GIJA 3T5KA 1R0AA 2GUIA 4M3UA 2BCQA 3QZ7A 3L3UA 3QIOA 1TGOA 5EWGA 1JLFA 2ZD1A 2QKBA 2DY4A 2OZSA 1SZPA 5KT4A 4IFYA 3EYZA 5CZ2A 2Q3SA 4CF9A 3AVCA 2ZUCA 3T5JA 4N47A 4UB4A 3TARA 1ITGA 3RBDA 4KHWA 4K8XA 3OJSA 4QWDA 4J9PA 3MBYA 1TVRA 5KG0A 2XC9A 4YQWA 4YNQA 3M8PA 4I7FA 1N48A 2DTUA 4RQ7A 2ASDA 3G6VA 4CJTA 4C8KA 1EX4A 1LWFA 1ZQQA 3L3VA 4ECZA 4AHCA 1DTQA 5CYQA 1J53A 5J0QA 3OYDA 3MFHA 2W9MA 5IIOA 1JL1A 3VQPA 1ZYQA 4CFDA 1JLQA 2OYQA 4Z6DA 4CHOA 4DTMA 1B22A 1VSIA 1LB2B 5KFXA 4QZCA 4QZBA 4MF2A 4QCLA 1NK9A 5DG7A 2R8KA 3OYGA 3VQ7A 1S97A 4KLUA 3OS0A 4I9LA 4M45A 3P1GA 4GW6A 4BACA 3RMBA 3RBEA 3CM6A 4BE0A 4J9RA 4DS5A 8ICSA 2VG7A 3VQBA 4KPYA 4DL5A 4Z4GA 3D0PA 3T19A 1TK0A 4QWEA 5FROA 1HYVA 4N76A 3LWLA 4CEZA 4O5CA 1RDAA 9ICOA 5HRPA 5CY4A 4QWAA 4KLGA 3TAMA 3M8QA 1QTMA 2PYJA 4C8MA 1ZBIA 3ZT4A 1IKXA 3OYLA 3PR5B 4UBCA 2XY8A 4AHSA 2XCPA 4ECVA 4CJWA 4ID5A 3JPRA 1JXBA 4LZGA 3QIPA 3RB0A 5J0YA 3C23A 4ELUA 3K5LA 4P4PA
chains in the Genus database with same CATH superfamily
1PSDA 3KK1B 2OH2A 4DTUA 4LRDA 3PW4A 5LMUF 2B3TB 3BPDA 1JL2A 2EANA 5DMRA 4F0KA 4AILC 4W4MA 4CJSA 3GJRB 1WBDA 2DGUA 3C94A 2D3O1 4C7YA 4HI1A 2X1AA 4Y00A 4OHXA 2MKYA 1FD2A 3B4MA 5KNIA 2EFNA 2MZJA 5KFKA 2JC1A 1JK9B 2O8BB 4JP8A 2ETJA 3GONA 4PGYA 3BBCA 4WP8A 2ZIWA 4ZP6A 3QJPA 3C5FA 3HM9A 4RU2A 2KDOA 4WFYA 4B1WB 1U2VA 5CXTA 3AM9A 4GNIA 7ICJA 4CHQA 5AQYA 1JKHA 1R0CB 1R43A 4FKYA 5KG3A 3KUHA 2VFTA 3UDLA 3PKYA 1JCEA 4EO6A 3V4MA 3RMAA 1BI4B 3CCEN 4ANDA 1Z1BA 4C97A 3TJ8A 1T9YA 2Y1RI 1SV4A 2GW8A 2Y3YA 3PJWA 2IM3A 3IM1A 3BEXA 4IDKA 1YK9A 2ZJQL 4DBQA 1BIUA 5AI5A 2L41A 3ZTOA 5E33A 2NREA 4EX6A 5HK4A 4V19X 3S01A 2M70A 1J5EF 1RTZA 1V9PA 4XH4A 4FVUA 4RNNA 3M2UA 2KEYA 1XJWB 4RNOA 1YBAA 2B4OA 3WQUA 2VF3A 4PL1A 2IC3A 1VIOA 4EU0A 3SMPA 2IOFA 3MWBA 4IUFA 1WCNA 3J81j 3HPHA 2VG6A 4UY85 3LPEA 5J2KA 3LK9A 5AM3A 1QQ6A 2PI5A 3KXDA 3F9KA 3SK3A 1NJWA 4KI4A 1ZQSA 4FJNA 4LT6A 1F21A 4DFMA 2DNPA 4KH0B 5DDYA 5J2MB 3RH4A 2A40A 1HPZA 1U8WA 4JI1K 4YR0A 1NGIA 4P9SA 1EZZB 1ZXIA 3OL7A 2W54A 2W8LA 3JSYA 5KG2A 1NPPA 1N5WA 4Q7AA 1K73T 3EZUA 3RJEA 3M32B 4PL2A 3P4IA 5T7BA 4ZLNA 3MXIA 1SV0C 3VVTA 3OUYA 4ZDNA 1CC7A 1Z05A 1Y5IB 1EWRA 2C22A 1EQ0A 3I9V9 4K42A 3ZSZA 3FYHA 5HHHA 2CWKA 4EFHA 2XSFA 3IR6B 5DBBA 1CS4A 3M8SA 4F71A 4RWXA 4DOZA 4Y2YA 3FGUA 5F2RA 1C4AA 2V7YA 1HUZA 8ATCB 1AROP 2OPQA 5DO2A 5LL6d 4K4YA 4TQRA 4FDFA 1WHYA 2YVSA 1UZHA 1YF5L 2Z1JA 1K6YA 4AM7A 4EHTA 4M41A 3M2RA 1QZ5A 1LVHA 3DXMA 1WG5A 3BH7B 4IOAL 2NRTA 2F9JA 1IXKA 2J7KA 2A6OA 2WTUA 2ZH3A 3I28A 5J1EA 3WKBA 9ICQA 3C21A 3QYPA 1GMVA 8ICAA 1RAFB 3PNIA 4R5PB 1Q81T 4E3SA 1LCUA 5M1FA 3X3UA 1COOA 4OX9J 4WFZA 3KJQB 2HHHJ 2GJ2A 3C46A 2OELA 3VAKA 1W97L 3ATUA 5FPEA 2MB0B 3DRPB 4ZVEA 5GMEA 2UXDK 5HN0A 1VQ8S 3AD7C 2FVPA 3F2CA 3I32A 3EPGA 3ULHA 3HX9A 4OX9F 4IO9Q 2HHHF 4KB1A 2IMWP 4JUZA 1ZM4A 1AB8A 4NX9A 1UPHA 1SXLA 2OPRA 4OZ2A 2BCVA 2E5LK 2Y0BB 3OY9A 4IG3B 4DV3K 2A1JB 5JVHL 4OZ3A 3ENHA 4F2SA 9ATCB 2W3RA 1MDUB 3R8EA 2BGGA 3NFAA 2FBVA 1H6KX 4B1VA 1TE2A 3J8AA 3Q8MA 4WP9A 3GWCA 1P8ZA 5D78A 4I6WA 4IKAA 3JAMY 4XQ8A 3M8ZA 5AI8A 2WHEA 4I2JA 3CJCA 1X0PA 2ZC3A 3S9HA 3SQOP 4GVBA 4A8EA 2GWJA 2K7KA 5I3UB 5F0UA 1K1QA 3AA3A 2IIRA 1YUWA 2GFFA 4NYZA 1S76D 4JHDB 2LEBA 3WK5A 1QAJA 2XMMA 2MXYA 4YDUC 2J5AA 1RWKB 2CQGA 4CTAB 2FVSA 1DOQA 2YMQA 2OPPA 4ITSA 2FLLA 3Q8PB 3EWAA 4FJLA 3VQ6A 5J8YA 4FZZA 2YNGB 2NYVA 3FFIA 1IBMF 1F60B 4MFFA 4ZPVR 4RCHA 1RTJA 3VGMA 3QQCD 1FIQA 1TUVA 3M1YA 1IBCB 2DNYA 3BEGB 2ZNYA 3H46O 4JKGA 2B8PA 2YHYA 3VQ8A 2ZUBA 5MAOA 4I2BA 3D0HE 5J2EA 4LSNA 4DLEA 2WAQC 3HKWA 5IIJA 4IZ9A 5J2QB 2WSCC 3ONQA 4ZLJA 3EGVA 4V19J 4DV2F 4OHVA 1BHNA 3U9ZA 2YQ3A 4AYBC 4JI3K 3K5NA 4NY8A 5HSPA 1UMJA 1V9OA 1HBUB 4CJQA 1A0PA 2PO4A 3RAMA 4BRAA 4J2DA 5AE3A 4LRFA 1X9MA 2I6WA 1Z26A 4TY9A 1GTEA 2FD2A 2ZFHA 4C3MA 2A5XA 3JQKA 1NOZA 3RJFA 1U02A 2V4QA 2ZIUB 1UAXA 1X60A 2PAVA 2O8FB 3IBWA 3VGKA 1SJQA 5KG6A 3A2FA 4P7VA 2JRSA 4KV8A 1SZHA 2KJVA 1E6VB 1P8GA 4DL6A 8ICMA 1SCJB 4PR6A 3KMQA 1ZQYA 4JI7K 4D3HA 2EEYA 2B8QA 4ICAA 2CDRB 1M90O 2HSTA 2WOMB 3NNHA 1VQMS 4MKAA 3WQPA 3BGUA 1BQMA 3PVXA 3TACB 4E8UA 1BIZA 3HCXA 3DMJA 2UUCK 2IOCA 4Y2IA 1YLXA 4MHVA 5CHGA 3MK6A 5BRDA 2KXHA 3DOMA 1X4CA 1REVA 2FJVA 4O3OA 5ITHA 2DXFA 3QZ8A 5K8MA 3AVGA 4LBPA 3C5GA 2E4LA 2UYTA 2GLEA 2BM1A 4ZPWR 3KZXA 1CQNA 3DI6A 4OD0A 5GAGI 4F26A 2FLNA 4JRPA 2W2NP 4BE1A 3HT0A 1YQHA 1RCOB 3I4HX 2D3ZA 3D1OA 4NLXA 1UWAA 2FTRA 1L3UA 2GVDB 2EHGA 2IM1A 4UW2A 2KJ8A 2CPYA 5AT1B 3C6UA 2AYMA 3V72A 5I9EB 4PWDA 4E7JA 3G82A 4UF4A 1DK3A 1KVJA 2O5DA 3ZC4A 8ICXA 5GADU 3CCQN 3T1HJ 5L1LA 4YB7A 5HMMA 1Q82O 3HZEA 4DV1J 5KFIA 2DKOB 5EUHA 1ZQRA 2WVCA 3K17A 2RS8A 1XR7A 1Z4UA 3NOCA 4I68A 2P66A 2WFAA 1TMMA 2VQEF 3RBXA 3O9UA 2RE2A 1VQ5S 4DQIA 4BCAA 3T1HF 4EX7A 1IH7A 4Y3CA 3RMDA 2ZGYA 4DV1F 3LDAA 2AGPA 4BRKA 3OJUA 1S1VA 4LREA 3DOLA 3SMVA 1RYUA 4KHPF 3C29A 4JI8K 5M2UA 2VJUA 2BOAA 3HMJG 2GAGC 2RE1A 3O44A 1VQKN 1YT3A 4WTYA 2QA2A 1Z00B 4TUPA 4NXNJ 2P5GA 1RM6C 3KK7A 4PQUB 4YOEA 2LU2A 3OD2A 1V38A 5J0WA 4ZPBA 2XY6A 3CJBA 6FDRA 2KP7A 3K58A 2LQ9A 2D8CA 4CH1A 3HP6A 3FC9A 4FF4A 4KI6A 4A48A 2XGQA 4LFBK 4ZPCA 1V3SA 4NXNF 3WK4A 2LVWA 1N6QB 2WF8A 4CEOA 1XBWA 1ILYA 3O1LA 5GINA 4H0VB 4OI4A 4ZJLA 4KAIA 3TWZA 5KQDA 3PIPQ 3U6FA 4CH7A 3AA8A 3ZTRA 2BGWA 4QJVA 2FZGB 2E5GA 5KGXA 1NZ8A 4AHUA 4CJFA 2UUAK 2YNIA 2FY1A 1GOCA 8ICTA 2EZYA 2NUHA 3I31A 2DYAA 3ASMA 4FBTA 3P45B 2UUBF 3AVMA 2YBVA 3H25A 2WC9A 3VETA 2VBYA 4P71A 5CZ1A 1GQEA 5HVHA 4US9A 4E7IA 5SZTA 7ICUA 4CJ5A 1Q3VA 4I6AA 1MN7A 4NLVA 3M05A 4XPCA 4C9DA 4QS7A 3J7Z5 4LH5A 3A3PB 3HK2A 4LVOP 2KLAA 1B7FA 4YD1A 3GILA 3J7A1 4RUBA 1VQPS 2H5EA 1PZNA 1BWVA 3K59A 1NK4A 2FUG9 3IGVA 4GV3A 3TABA 4CD1A 2AU0A 1DBDA 1OH5A 3ETMA 3GFYA 3Q8VA 4CZHA 3N01A 3V5RA 2W9BA 1QQOA 4HHHA 4B9SA 5AM4A 4O3RA 4BVPA 3ZZTA 4JKEA 1YIJS 4E7LA 1BGXT 2HBJA 3WXMB 3BH6B 2IJFA 1MWQA 3AGKA 3OFGA 1XQIA 4L6V3 3DU5A 4TU9A 4DKWA 4FXWA 4NM2A 3W5XA 2RNEA 2RP5A 4H4OB 2DNOA 4FWNA 4M7YA 2D41A 1VK8A 5BPCA 2YMLA 3OYAA 1YTAA 3FZLA 1JJ4A 1YI2N 3L2WA 3BZQA 2JHEA 3ENBA 3NEKA 4WE1B 5D49A 1H38A 3AA9A 4RUAA 2XZWA 4O3PA 1SC6A 3EGNA 4WFXA 3PO4A 3ZZPA 4LF5F 2APOA 1TKZB 1NU4A 3VENA 3W9HA 4OX6A 4LSZB 3D2NA 2MU2A 3N7PD 4CNYA 3M2VA 2DFHA 4QOZB 1YVFA 4QJFB 5D6GA 3VN5A 2RQCA 2PGCA 4CBUA 4M3YA 4FWLA 4JKAA 1MU2B 4K5RA 5IT0A 1WEYA 3RSEA 2WCXA 4ECWA 2HZAA 5C42B 3EM1A 4JI2K 3K57A 4RWTA 3ZT0A 2VKQA 4DCHA 2N3LA 4M0AA 3DRRA 3VMFB 1HR0J 3FBEA 3NGZA 3CCSN 1GLFO 2DD8S 2PN6A 2D3DA 3KFWX 2A18A 4RQ4A 3CVKA 3GP9A 3GIMA 3V81A 3MN6A 2HMXA 3O80A 2PSZA 4QZDA 2DPJA 1RA7A 4YMOA 5ALPA 2VFUA 5AXKA 3FRYA 1HR0F 2DT9A 4CLKA 2FC8A 1E3MA 3M9NB 1IG8A 1Q7YO 3TAGA 2XMUA 4NI2A 2K8AA 4MEYA 3QGPA 3R2CJ 3TYTA 1G1XA 4CEQA 5KG7A 1VQ9N 2FJBB 4RQ1A 4E19A 4LSLB 4Y1DA 2NR0A 4GVLA 4LF6J 3D2WA 2CAJA 5ALEA 4RLEA 3MGIA 4D3GA 3LPTA 9ICCA 1ATSA 2GBZA 4RNHA 2OZMA 3MAQA 4TLRA 3JSMA 1EHWA 4P52A 4WKRA 1KR4A 3DLEA 2NRWA 3V7KA 5F41A 1CULA 1AXQA 1XQSC 5KL1B 5IIKA 5D0EA 3KLEA 4LF6F 1N33J 1TKTB 2F4FA 2VG5A 2IIHA 1HNWF 4O0NA 2Q97A 1YZ6A 4DPWA 4ZIWA 3K9KA 4UAVA 2J8SA 1AW0A 4HLBA 4F4XA 1ASUA 4CGIA 4B3RJ 3P5TL 2M7SA 4DPOA 4IJNA 2GJFA 4J03A 2J4RA 3N7RC 1N33F 4E89A 2GX9A 3BF3A 2DKZA 4A61A 4YHHK 1OS5A 4NL9A 2DEIA 3SSRA 3CM5A 2E9RX 4R64A 3PSTA 2HNDB 5T41A 1ZQBA 1FXXA 2HBZB 5GIOA 1RILA 4DI6A 1TYQB 1S6PA 4Q8FA 4QWBA 1XMBA 4YXJA 3ILIA 1ZPWX 2XLJA 3MPDA 1LXNA 2Z1GA 2W41A 1C0TA 5BN9A 3PG9A 4DOAA 2BPGA 3I0SA 2YMPA 4B1UB 2O67A 5ETMA 3QE9Y 3OL6A 4I2DA 5A0YA 2CG8A 2GX8A 5DDMA 3L2UA 9ICBA 1HQEB 3FZ2A 5EX3A 1XNRJ 5LL6Z 2NYIA 3IWXA 3NE6A 1F2GA 1WOOA 1UT5A 3VCDA 5JMNA 2VJ5A 1SQFA 4X4RA 5HNKA 4BR9A 2KIVA 3H2UB 4FF2A 4X66K 3FZKA 4B1YB 1OJ4A 2RKIA 4DFJA 1VSKA 3SQ4A 2GELA 2BJ7A 3CC7S 1XNRF 4OVLA 3G6EN 3R5CA 1GLBG 2GZOA 3RJKA 3JB9k 3AVKA 2KKHA 3WC2A 2BMBA 4HACA 3PO5A 2XRIA 5L9XA 1NZBA 4LMZA 1D8BA 2R7QA 2RF2A 3BREA 3H8JA 1RHUB 2OLWA 3W9IA 4A62A 1FERA 4UOGA 5AKGA 4WZQA 3WXKA 3SV3A 1EJ7L 4B3OA 3OYHA 1S9EB 4MQ3A 2P9KB 2X7IA 2YNHA 1RDBA 3F73A 1JXLA 1W9HA 1RTDB 4KB0A 3FBCA 3BQ0A 2I7PA 4OGEA 3O1WA 3DRSB 1B0XA 1SH2A 5KFQA 2YQ0A 1LK5A 2ASLA 2IHR1 3GSDA 2X51A 1JLBB 1KFDA 3A5MC 2AYEA 3UCZP 5HQMA 3WEEA 1HNZK 3H8MA 3BZKA 2I38A 2WHOA 4WP3A 4CNZA 1U25A 3SUOA 1RT3B 1IM4A 4I2PB 1E6YA 2ZM6F 4WQ5C 2I9SA 3KK2B 4IQWA 3RTVA 2DO0A 3PY8A 2EX3A 4TSXA 3PZPA 1LKYA 2UV8A 2DEJA 5A8KB 1V4TA 2A42A 5AI6A 4C8NA 2CVEA 3GE9A 2HGMA 4OO1J 3JTOA 3THYA 2DH8A 3MUTP 2JLGA 3O4NA 1A5XA 1C1BB 4M9HA 4K8ZA 2IVOA 3QEBZ 1S0VA 4DR4J 4NA2A 4KQZA 1X9JA 3OYEA 5T7LB 4NZ0A 4PPZA 3VA3A 4FWSA 1SKRA 1X4DA 3KDNA 4J9SA 2YKPA 4RW9A 2M0GB 3KLGA 3BR8A 4OYMA 4IO9L 2OSQA 4DR4F 5B0AA 3UKUB 2HRYA 4JK1A 4C3LA 3AL0B 2WF9A 2FY8A 1VQNN 2WVFA 1ZBSA 3KLVA 2JV3A 3V2UC 4J9NA 1KQGB 3G9CA 1I6JA 3L7OA 2KE7A 5DETA 9ICMA 4F3QA 2F76X 2OIHA 1NKCA 1LOUA 3OTCA 4JI4J 3AOBA 4BDZA 4BXOB 5AJ3K 5ETKA 3P5BP 4H5WA 5E3AA 3T41A 5DM7Q 1HBOA 4BGDA 2CDQA 4X62J 2K3IA 2E5IA 4EEKA 1JI7A 4C80A 3PUFA 4P2MA 2KO1A 2JH3A 3AGRA 5L1IA 1BCOA 3MEGB 4K7QA 2G06A 2OEHA 4RW8B 4X64J 3GV8B 9ICJA 4JV2A 1R0BG 4ES1A 3B6OA 2BQUA 4OL8A 2FPLA 3F44A 1VRUB 2V2KA 4NYOA 3SQ1A 2WB1D 4KBOA 4RW6A 4X4QA 3NDKA 4UTGA 5HRSA 4HKQA 4RW7B 4M5LA 3FZBA 1VC5A 3PX6A 1A0OB 5F9LA 4X64F 3ZSQA 4DUZK 2OHDA 2P9UA 5E3RA 2C2RA 1U1OA 2RU9A 4BC9A 2W4CA 4FK0A 2C2MB 3B6PA 1NH7A 4X65K 3A4TA 3K8VA 1K8KA 1EKEA 4DV6K 3FEYB 4UB1A 3G0ZA 1S0MA 1HA1A 4ALZA 2XM3A 4F4ZA 2KVQE 5D77A 3VALA 5AQVA 2Y1LB 1I3AA 2CQHA 2RT3A 4FZNA 2ZE2B 1S77D 3A3NB 3HBTA 1FJGJ 1VRQC 4F0HA 4EGLA 5IQQA 1XNQJ 4B1ZA 1D9FA 3TEGA 4JAXA 2AP1A 4I2IA 2AZ1A 4FLTA 2X3GA 3A8EA 1FJGF 4ED5A 3C3LA 4NXMK 1D9DA 5E3QA 1XNQF 3HXMA 1S79A 3K0SA 3NF6A 4CI6A 3CDBA 4GKJJ 5AQFA 3H0LB 5KI6A 4CLYA 3DC2A 3L4IA 4X5VA 1N5XA 1T44A 1D0EA 3DLBA 1UEUA 3JXUA 3PYEA 4BC5A 4K4ZA 1KXPA 2HRTA 4GKJF 2FBTA 7ICEA 5LSLA 4PXEA 2ITGA 1FHTA 8ICFA 5IC4B 4DZDA 3MM9B 5KRSA 2MY8A 3J81U 5BOLA 4C1NK 1I94J 1U4BA 1TAQA 3A13A 2ILYA 2YKNA 3AARA 3EO3A 3O4WA 3A8YA 1FFUA 5H2FU 3TAEA 4LZDA 1BPZA 1V4SA 1PO6A 1TL3B 2V8GA 3CJ8A 2R2TA 1I94F 3M1VA 3K2PA 3M5RA 1VRTB 1EXNA 1X9XA 5MLCQ 2BKEA 3KTQA 1GX5A 4CO2A 7ICPA 1S7IA 2P9PB 3I8BA 3D6RA 4H4MB 4KLLA 2E3TA 1G6BA 1U1RA 3GTYX 5A8RA 4KGZB 4GXJA 3V6KA 4QZGA 3MEKA 3U3YA 3TSPA 3CE8A 5KFRA 3SQ2A 1WYGA 1DHMA 1YHQS 5CCMA 3W8GA 4CJEA 1BPDA 4KH4A 4U95A 4FE3A 4E98A 2OEMA 4ZMMA 2KW4A 3V7JA 1PVQA 5ETTA 5KFLA 4FWOA 3DXKA 2OPSA 3UXPA 1B9FA 4NLGA 1OY9A 2HFZA 3JPSA 4Q0BA 2EG2A 2B7CB 4DR1J 2VPWB 2ZIXA 2NXEA 1ZQJA 1BXNA 4BR5A 2G8UA 2DGZA 3PEJA 3MM6A 4PUOB 4QYZJ 4CHZA 2HKEA 5JLFA 4O5FA 2W8KA 4FF1A 2MUTA 2CJ9A 4DR1F 4BJQA 4ZVGA 4KFBB 2VODA 5KPZA 4CO3A 2LQ8A 3C6TA 4B9NA 5SUHA 1RA6A 4H4KC 3CJ1A 2BJEA 3DAWA 4YORA 4EENA 2FHKA 4DR6J 1DARA 1ZOLA 4OZ1A 4N41A 2XHCA 1NJXA 4BGBA 2J0WA 3GIKA 4ICLA 3IG5A 2L08A 2CH6A 4FK4A 4NLWA 2IVFB 2HNZB 5AZIB 4NYPA 2CZ9A 2DR6A 4TUQA 3MI7X 2F8SA 4DR6F 4DSLA 2FDRA 2RU3A 2Q0ZX 1PG5B 5ETOA 2CRLA 4PZNA 5HP4A 4DU4A 1QE1B 3T1YK 3SSSA 2L9NA 4YUDA 4NEYA 3BQTA 2UU9J 3FDSA 2LHTA 1GNKA 4BROA 1HKCA 3P5JA 1UCVA 3AXKA 4O55A 1ULRA 2BE7D 2HLUA 3KHGA 4DU3A 4KLQA 1PAUB 4ZLLA 3PIPL 4PG7A 1CZ9A 1JJHA 3H7IA 3R6GB 3R7SB 1CJTA 1FTRA 4DU1A 4HUEA 3N79A 4LFAJ 4U7BA 2M0NA 3LWMA 1WSFA 1LXJA 3IR7B 2NRXA 1KN5A 2QLTA 2B6AA 2W03A 2MKHA 4FCYA 4WIQA 2DQNB 3BDPA 4QW8A 1ZXOA 1RUSA 3MM8B 4KGKA 3LDNA 1GFWB 4LFAF 4TURA 1RXVA 3ETLA 4RQ2A 2EFQA 2XI9A 2WSFC 3Q22A 2PY5A 4F3OA 5HJXA 1JLEA 4Y28C 4NRUA 3P38A 2UUWA 1FFGB 2ISOA 2V9WA 3AO2A 4DN0A 5H9EJ 4OX8A 4F93B 3OR2A 4QS8A 3CC4N 1SQKA 3ICXA 4ZCMA 4CHPA 2HHTA 4DSFA 4C6AA 3CGIA 4QZHA 3FBBA 3GCWP 1T03B 5E79U 2DPNA 1RBRA 2BKOA 3D0IE 1J6ZA 4KHRA 1FVSA 4WYLA 4FVCA 3GB0A 3IRXA 4WFAQ 1NGDA 5DB6A 3SI6A 3OT9A 5HP1B 3QUTA 2CJAA 3ZSVA 5D4PA 2CPJA 5K8PA 4CZFA 2QC3A 2L48A 3WIVA 4HH1A 4JV5K 1LWEA 2PIIA 2IM0A 3D6JA 1PAEX 3ZFVA 5ALKA 4MT1A 3S7RA 4LF4J 2UXCK 2HHPA 2KV2A 4O5EA 3OVAA 4U8VA 9ICVA 1K9MO 4Q43A 2Q6BA 4DG1B 2H3EB 4B3TK 3CC2N 3W2WA 4CF0A 5B0EA 3W5ZA 1S22A 1T3OA 1WSRA 4HTUA 2ASOA 3EZWA 1TL7A 5C7PA 1X42A 4IC9A 1F5AA 3RJGA 2FLOA 3OS2A 4BREA 2DRDA 4DR7F 5EOZA 5AQLA 1K44A 3F2KA 8ICPA 4NLZA 4CLSA 3MCMA 2J76E 4GMKA 4KLIA 1UAWA 2RDJA 5AQTA 3CCES 4NPOA 6FD1A 1KW4A 2W7OA 2X1FA 2JOQA 4FJHA 5A0LA 5D3GA 4M3ZA 4HEA9 3HHNB 3FJ2A 1WF0A 2ZDOA 4HWIA 1WTFA 1K8AT 3EUB2 5EXWA 3QYYA 1RT2A 3AAPA 4P0PB 2DBYA 1K0VA 2ZHOA 3HD1A 3TNVA 2NUUG 2A3JA 4JS4A 1U6ZA 3RG6A 4IH5A 3ISND 2EH9A 4X4SA 1UPMB 3LUYA 3GL1A 1VQ6S 2F9WA 4WQ4A 3MFIA 3QEVA 1VBKA 3C8YA 3NVZA 5THWA 1RBTA 2R7OA 1TL1A 2DFFA 3SDEA 2YY6A 2FMSA 2MHEA 4DSIA 3AODA 1ESVA 1A76A 3R5DA 1B4FA 4J90A 1RWNB 4FWPA 3R6LB 1IN0A 1R0AA 5GAEI 1UVJA 2XMKA 3HZ6A 2ZWPA 2ZH7A 1JQGA 1U6FA 1XR5A 2AD9A 4QIVA 4AD6A 3RJMB 2XB2D 3D2FA 4ZP7A 1MROA 4DR2J 1NGHA 3QIOA 3L9ZA 1NNLA 2ZD1A 1MA9B 3AXMA 5AI9A 3PYGA 1GH8A 2Q3SA 4CF9A 2ZUCA 3T5JA 3O3LA 1HYSB 4JB8B 1JRPA 3MBYA 2XTJP 2OEJA 5KG0A 3QU4A 4YQWA 4YNQA 3M8PA 1N48A 4JKFA 5CQGA 3PIOQ 3PRDA 3TUJC 1VQ8N 5EN1A 1LFPA 3WK6A 2FZKB 4Z7YA 2AYBA 1EX4A 2FHMA 3FK4A 3L3VA 1DTQA 1OMSA 3J81Y 3WKEA 3MFHA 3ENAA 1T02A 4KY3A 1OSDA 4KIAA 2MZ1A 3VQPA 4FP9A 3D2SA 2P9NB 4Z6DA 2P6TA 1HL6A 1WHWA 3LH2S 4PL8A 4DTMA 4JKDA 3P8BB 1VSIA 1YGYA 3FKBA 2F8LA 1LB2B 5KFXA 3IV6A 4QZBA 2F3NA 1NK9A 4DV0J 5DG7A 3ALRA 1SV5B 4KLUA 3H0PA 4I9LA 4M45A 5BR8J 4IG0B 1T9TA 1MMDA 5CZVA 3CJ5A 3WX4A 3RMBA 2V68A 2AJ1A 5DDRC 4BE0A 4J9RA 3VQBA 4KPYA 3THPA 3HHLA 2E1YA 1F9HA 5JU5A 4O5CA 2DGXA 9ICOA 5BR8F 5LSOA 4CGZA 1UWBB 3M8QA 4H5RA 3PDNA 4MDBA 4BR7A 4WK1A 4C8MA 2MKIA 1ZBIA 3ZT4A 3OYLA 7FD1A 3PR5B 3QU2A 1N32F 2Q4TA 2XCPA 1S72S 5JMVA 1EX8A 1JXBA 4OJPA 5J0YA 1ZD2P 2YHXA 4L8RB 4IL6U 1FRXA 4E2FB 5ALVA 4MJKA 3MR3A 3BB5A 5J8YC 2VWKA 1HMVB 4ILLA 5AQXA 3E0FA 5AZJA 3X1LB 2U2FA 2IRXA 3OFFA 1VSFA 4OJHA 3CFOA 3V4IA 1HNVB 5IWAK 1P9YA 1S1WA 1WC6A 2DR8A 1TUUA 3OQ2A 2M52A 2R7SA 2NSBA 2QL5B 4Y2QA 3QLHA 3VGUA 1FEHA 5C2DA 3C16A 1V97A 1XWLA 4I29A 5EDWA 1X5TA 5CEHA 1ITPA 4O8UA 3SUNA 4M63C 4JYAK 4UARA 3NMUA 4NLQA 3TKAA 4FPRA 4JMUA 5L1MA 3NLCA 1QSSA 2VICA 1JLAA 1CJKB 1JKHB 1VGYA 2KICA 3HSTB 2ADCA 5AE2A 2H4WB 1KOOA 4QIGA 2LLZA 5L38A 1BQXA 1RWMB 2XYPB 1SS6A 1U9LA 3D68A 1QQ7A 4K0KF 2NZTA 4HTLA 2CPXA 3C7NA 4OI1A 3EDRB 2ZNZA 1SJ1A 2RD5C 3KWIA 1BWFO 3MDCA 3D6FB 4USVA 2GUPA 5DLFA 3M4XA 3TO8A 3UQ0A 1MWYA 1DQ8A 5ALOA 4W5TA 3H7HB 1YITS 3MMAA 3TADA 4N8OA 5DQIA 4DV4J 2KHCA 1HBNB 2RDIA 1RTHB 2VPYB 3QAUA 3CF5L 4U96A 1R8HA 4CRJA 4KH6A 5I42A 4K4TA 5M1QA 5ETPA 5TKYA 3MMBA 5JUMA 3NCRA 4DV4F 2G2OA 2IBKA 4Y2AA 4CFCA 3GFXA 3AY9A 4YMEA 3OFEA 4CZLA 1G4CA 2N4DA 8ICIA 5JTIA 3IBCB 2C1EB 4Z6EA 2Q6CA 2XHWA 4LF8J 3KJVA 4RQ5A 5EE9A 2FSJA 1OXJA 5EHHA 5HR7A 4ZS6A 3GR0A 2RQ4A 4FWKA 3JPOA 1VBXA 3W63A 3MEDA 4CJKA 3UKRB 1W26A 4MFBA 1FRIA 3IG1A 3KK3B 2A1BA 1S1XB 3IWLA 3IDHA 4PHTX 2QXLA 4DUYK 2H3VA 3HKZD 3NS6A 1Z2LA 3VC8A 4KAZA 1JCGA 2Q3PA 2R7XA 4TYBA 1JLGB 1YVUA 4C8ZA 1ZA1B 2NUBA 4LVSA 2PD1A 2LI6A 1CS4B 1X4HA 4K4SA 2UVRA 2HEKA 4GY2B 3FFKB 4LH4A 1AZSB 2PEBA 4B3SK 1CJUB 4BRNA 3VV2B 1VQ5N 3VF0B 1DT9A 4MFCA 3PSIA 4FO0A 3EY1A 1KC8O 3L7UA 1F9FA 4ED1A 3DLLL 2C28A 3PX4A 3FCHA 3IG8A 3UMBA 4O5BA 4KH1B 3DXMB 3THWA 3IN5A 4K4VA 1I1GA 3QETA 1B4SA 2ZHAA 1SH0A 5G4DA 5G0RA 4DF8A 1BNOA 2W9AA 2B0CA 5HATA 2YX4A 4GKKJ 3ZT3A 3MPVA 1C7YA 3TJ9A 1TL4A 1FXLA 2V34A 4O0IA 3KUGA 5M2PA 4WYBA 2YTUA 2JFKA 2GAHC 4CP5A 3CCQS 4IXCA 2QG9B 2YX7A 4JKCA 4F67A 1HNIB 3KKAC 1S99A 5F0WA 1QH9A 2QN6B 4NOHA 4NV0A 2O8EA 2F4VF 1N36J 4NL5A 1CVJA 3HSCA 3HHLD 2KHDA 3Q86A 5ADXH 3M7DA 1IG9A 2JEIA 2K8BB 4FYDA 1UVMA 2CJXB 3NGUA 2N7CA 5AM5A 2BE2A 1FNXH 4BRMA 1VSMA 1U48A 4ELVA 2MRLA 1GLDG 2OFHX 3M30B 4YD2A 2V8HA 2D69A 1ZOTA 2YWGA 3U1LA 1VQKS 3V1QA 3CRXA 2HWHA 5DG8A 3O6QA 2OANA 3SIPB 1TP7A 2DXDA 2GHWA 1HJRA 1GMUA 3N4QA 4KLJA 3NTUA 5FLXU 3IFRA 7ICMA 4W5RA 3M8YA 3UO0A 5KFNA 3QFHA 3AD8C 1XMQJ 4GIBA 4B3MJ 4NCAA 1X40A 4HDHA 4PGQA 1WEXA 4CERA 1KNZA 3MECA 1W2IA 1F6TA 3E66A 3MMCA 1NJYA 4LF9F 1IBKF 1OYEA 3GG0A 1DURA 4EZ9A 4W98A 1XMQF 4KMUA 4B3MF 1A9NB 4DFDA 4F5RA 3CB4A 3LANA 1X6IA 4G1QB 2AEMA 4CEDA 4IYQA 4DTPA 3J81O 5H9FJ 3MGJA 3DKDA 5DRKA 1CUKA 1RWXB 4FWQA 3CCUS 1MLAA 2F40A 1PIEA 2J9CA 2RRNA 3IS9A 4PJ0U 2QSFA 3N9UC 2FPKA 3HVAA 3QBCA 3RMCA 2VIHA 2GOLA 2V67A 4LSNB 4LR9A 3WX8A 1HNXF 2HOEA 4GV9A 2KFYA 1YIJN 4OI3A 1NDCA 3SBTA 1RT4A 4WCEQ 5AQIA 1FJEB 2I5JB 4LRCA 4EZ6A 3NRWA 3TFSA 4NXZA 2QI2A 2XG8A 4WXWA 4Z94A 3IFEA 3LP1A 3HRGA 3DEEA 2JX2A 2OO4A 5ETQA 3GBTA 4FLYA 1IKYA 8ICUA 2W24A 4CGDA 2W7AA 2E20A 4M95A 4KE5A 5HANA 3ZETA 1UVKA 1RT7B 1RPLA 3BO2A 1J5OB 3UD4P 5IM0A 3OTQA 2AQ4A 2EK1A 2JC0A 1ICEB 1RBAA 2KRBA 3BF1A 4H03B 1VISA 4RU9A 4KV8B 1KRPA 5AQRA 4C4WA 1VQ4S 1NLVA 5KFWA 4KO0B 3R9PA 4PXDA 2DK2A 3E01B 2RSQA 2MMYA 3H1VX 4QWCA 1VQLN 4ZPAA 4GVEA 3S3NA 2GO8A 4NO7A 1FKOA 2MZSA 2R7WA 4IOCQ 4WF9L 2MQMA 3BPSP 4OX9K 2HHHK 3SXLA 2KL8A 2M9KA 2FSKA 1NG9A 2QZ8A 1RQ0A 5IT9U 1D8ZA 2G8FA 5KFDA 5HL7Q 1VIXA 4OLOA 1YI2S 3R8YA 3CNHA 3POTA 1P9QC 3AVAA 3C15B 3RR7A 4ZVSB 3DI6B 3LM9A 3GYNA 5HQLA 4N5SA 2KZMA 3E58A 1NJIT 3CETA 2QXFA 2YH0A 2KD1A 2LQ5A 2ZBPA 3BSAA 2J9DA 1DK2A 2GV1A 3BYRA 5ALTA 3VGTA 4BGAA 1FVQA 3VQTA 3TA1A 1C0UB 3AQOA 5D0RA 2PI4A 3B6BA 1RTIB 3ISBA 3BGLA 3C6UB 2ZITA 4DCOB 4GXIA 5DM6L 1HLUA 3G82B 2AXTU 3KKSA 2EC0A 2WAQF 3PRVA 2OSRA 2R8JA 4C98A 3OHBA 1W2BR 1KAYA 3EUNA 1L3SA 1UW4A 1NUEA 2V7ZA 2K3KA 4I27A 2K4IA 1UTAA 1KKXA 2F96A 2JEFA 4AHRA 4UAWA 3UXOA 4F04B 3I9ZA 3E1YA 4AYBF 1S6UA 3ZZYA 2BVZA 2Y9UA 5HMLA 5KFVA 2GH1A 4YVZA 2BJ1A 1BQNB 4R79A 2HS3A 3V6DA 3MPUB 2GQQA 2WB1C 3A5NC 4K41A 2WZ1A 4PYAA 4I4BA 1XHZA 3JSRA 3QT8A 4X4OA 2QLWA 1SVDA 3MUMP 2A1SA 2GGPA 3QBXA 4PH5A 1RT1A 3OYFA 2I7NA 2IYGA 2JSXA 4FOEA 3CMQA 2MA1A 2P2CB 2YQEA 4Y2JA 4RWWA 5GADP 1JALA 4Z2XA 4OYOA 4NL9C 5KFAA 1DTTB 2FI1A 3L5KA 5AM1A 4Y2MA 1QUVA 3EPIA 4A8WA 4Z4HA 2QB0A 3R5GA 4JN4A 3QEAZ 1O5JA 2BW7A 4MK7A 3O5TB 3THVA 2E1MC 2CJBA 3A8KA 4YB5A 1Q7YT 3KK1A 4ILMA 3NNCA 2XWYA 2G8VA 3K4GA 1NDPA 2L9DA 5EE3A 5GAHU 1J2NA 3CDAA 4B9LA 1QZ6A 1ASWA 4LJXA 1M0SA 1IR0A 2Z2LA 2W40A 3HX0A 4OKJA 1W2BM 4AQYJ 1YWXA 4WFBQ 3DNCA 1NSKL 1OQ6A 4A8MP 1V5VA 4LD0A 3MAAA 2CZ4A 4FM0A 4F4YA 2X6NA 1D8LA 5B0GA 1SC4B 1U7LA 4DTJA 2R9LA 1F9EB 3N97B 4AQYF 1WTBA 2OTLN 3CC7N 3PRBA 2GMJA 4JS5A 1FRMA 2G1HA 3IMQJ 3IAYA 4HI2A 1RAIB 5TKWA 2UXBJ 1M1KO 3W5YA 1VQ7N 1BI4A 1DGSA 4DWIA 3M6GA 3ID8A 4EP4A 1XN9A 2ZH2A 2LXFA 4DV3F 1NJZA 2NYHA 2DNKA 2JZ5A 5J0RA 4CWBA 2UXBF 1MG7A 1B99A 2HQGA 1KVCA 2C3YA 3NRZA 1KBUA 2ZBQA 1RG6A 1ZQWA 3HYFA 4CGFA 2K8CB 3LDPA 5ALQA 3IBPA 3F41A 1UOCA 3SFUA 3IR5B 1TTHB 4ZITA 4URSA 1FRKA 3HJVA 2EFVA 3B0XA 1D4XA 1MW7A 4A8QA 4H5NA 2ZJRQ 3CTRA 2E6LA 4KSEB 2MKCA 3MR5A 2IM2A 2PZSA 4RL1A 2YHWA 2AHOB 3G6ES 2OMOA 4Q45A 4C0HA 3CCMN 3CJ3A 1N5YB 5DB9A 4NYNA 3OXGA 4UAUA 2ZZTA 3NMRA 2V9KA 2HWTA 4IFVA 7FDRA 4KLOA 3KKFA 3RH5A 2JR5A 2PEHA 5HMZA 5ETVA 3TAFA 3RVCA 2OWOA 2P5VA 1KKHA 3CERA 4IQVA 2IJRA 1NGJA 4YOYA 5J2MA 1BA1A 4NLYA 2AX0A 2EW9A 4MFAA 2YHBA 2Y9TA 4E0DA 5EU7A 7ICLA 1SB6A 1SJ3P 4RQNA 3ZDDA 1UETA 2VL1A 3T1HK 2ESEA 4DV1K 2RHSB 5AQKA 3OL9A 3BYPA 3C6HA 3DLHA 4FM1A 3NUQA 2MJUA 2KHOA 2XYGB 4FLVA 3CD5A 4K4UA 3FBFA 3M32A 2YJEA 3SYZA 5DK5A 4N7TA 4U67Q 5FLXY 1GTHA 4XEIA 4P2SA 3PIOL 3VA0A 1XSLA 1L3KA 2VJVA 2YKAA 4WPAA 5CABA 1CSJA 4PZVA 3JXOA 1WNSA 2QWMA 4AP9A 1VFJA 1ZBHA 4M5DA 4Y2TA 4FK2A 2GWKA 4JI3F 1OPIA 5AK3A 3AB4B 4QPTA 2V4JA 4ZCLA 4NXNK 1N63A 4CZKA 1WOPA 4F5PA 3DCAA 3MEEA 2D5RA 1KN6A 3SD7A 3EEQA 3LA0A 3FGVA 1WBBA 5J2DA 3OA9A 1RAHB 2JEGA 3OTEA 1Z6RA 3HULA 4GO5X 4DTNA 3CJKA 3O0FA 2KSOB 2D3UA 2BRKA 1RZMA 1MQ2A 3WBZA 4DL0C 4R63A 4R5PA 1KDNA 4KKOB 4AXIA 1A77A 3QO9B 3W64A 2G9OA 7ICQA 1N5SA 1RWUA 4K4XA 1VC0A 5KT7A 4OX7A 2ALYB 1BOTO 1AQ6A 3RJIA 2G13A 3DRPA 3OV7A 1PBUA 3MUVP 5AK6A 2HZCA 5C0YA 3AVLA 4IRCA 2CIMA 1VHIA 4OPHA 2IDEA 2UUCF 1VQNS 2KFZA 1F5CA 3NS5A 5KAIU 3ADAC 3U02A 3F5TA 1FCAA 4HUFA 1FE0A 4GFJA 1CEZA 2IA6A 1OPZA 4IG3A 2A1JA 3FZHA 2V6AA 3ICLA 5CYJA 2XHBA 2J6SA 1ZBTA 3CJSA 1L6NA 2W55A 2KFNA 2H5XA 3DLEB 2CQ4A 2MZRA 3MOZA 3B82A 2EAMA 5J29A 1RHKB 2LKZA 3KLEB 3D6MB 3W62A 3CSKA 1ZQOA 3D5MA 5L39A 1QM9A 4YR2A 2RN2A 1RABB 3CYMA 3QJLA 1Q3UA 3BKFA 4QZ9A 5I3UA 2GIQA 2DHAA 4JWMA 2POKA 3C14B 2WVEA 4JHDA 1FNMA 3GPAA 4EMDA 2KJWA 1OWXA 5CYMA 2XGPA 3WXLA 4YOXA 5DBCA 1C0GA 1T95A 2PFDA 4YB1P 3PHTA 1IM6A 4PKIA 2DPIA 4RPXA 5IT9Y 2FGOA 4XH1A 2LEAA 2DKXA 3SCKE 2YNGA 1S6PB 1H0HB 5CZXA 4NLDA 4A8KA 1D5AA 2Y0SD 1RHMB 2KKPA 5J2NB 2AYGA 1KBRA 1Y10A 2IAJB 4M8LA 4C11B 5ALFA 1MNEA 3H1QA 5F8NA 2E1ZA 4PG5A 3PHEA 5A0YB 2MGZB 4JNEA 5GAEP 3R5JB 5KFYA 1ZQPA 5M1KA 3MAHA 2K7JA 3FM9A 2C3PA 2X78A 4Y2PA 3RB4A 4JWNA 2BKNA 4ED6A 1U0HA 3HDSA 1BA0A 5J2QA 4DL3A 2FJDB 5AQQA 4LFBF 3HFVA 2QL9B 4MO4A 2I5HA 3WNHA 3DHXA 1RYRA 1BDGA 5AQUA 3PW7A 1ZZNA 3MM7B 1HBUA 4ED3A 5HRNA 3H08A 4K5SA 2XMJA 4JI6J 3PFOA 2HS4A 4G6VB 3RB6A 4TYAA 2AJQA 1AUSL 2YKQA 3KZIU 4O23A 1CXQA 2ZKTA 3VEZA 8ICEA 3M8RA 1WAJA 2UUAF 1HWIA 2A19A 5AK4A 2O8FA 3L8BA 4KGMA 5ALMA 4KHSA 5J2FA 3DLGB 3BV8A 4CYUB 1BU6O 4AH9A 4ZOSA 5CR0A 4USHA 2DIVA 4L76A 2YNHB 2MY7A 2ABYA 4HTIA 5KFTA 3D28A 3NBPB 3O1BA 2GMHA 2A2DA 1HR0K 3QGGA 4P2FA 4I69A 3O3GA 4DQQA 1WSHA 9ICSA 1RE1B 3PCOB 3J80U 2KN7A 4E7HA 2PT0A 3AHPA 4DQRA 1RT5B 2IY5B 3ZZ0A 4I9QA 3GV5B 4DU7A 2JHDA 3JAMU 1IKWA 2HHQA 3QMLA 2RILA 2JZBA 1T6CA 4BC2A 3IC1A 2H48B 5B66U 1S5ZA 3DM2B 3UXNA 3FRZA 2HHXA 1S49A 5BYSA 2MZQA 3RW7A 3NGYA 3IHQB 3TVKA 4LF6K 2G5IB 1Q9YA 3RRHA 3VAGA 1F0XA 1SV0A 3QRQA 3TZZA 3QEXA 3AO3A 4HR2A 2GCFA 3A5LC 5F8LA 1Z3EB 4MTPA 4CF3A 4CT9A 4XIUA 3H3OB 2XULA 4Y2RA 2WK4A 1VBYA 4BLGA 4RW9B 4CJLA 3KLGB 1N33K 1SL2A 4ETZA 1FO4A 2VBZA 5AQZA 3JTPA 3EX7B 2E2QA 4PZOA 4UB8U 2B5JA 2B6GA 2PFNA 3Q8QB 3FMWA 3TQ1A 5EVZA 1SI9A 3PEHA 3FLCO 3O3HA 4FJJA 4B3RK 1SL0A 3THTA 1Q78A 1W25A 2OTJN 5KAFU 4Z4EA 1YTUA 3NS7B 4CBWA 1PJ5A 5C2CA 5A8WA 4LFCJ 5BREA 4J9LA 4F7VA 1WUAA 1WUUA 3I87A 4NZ7A 1ZQVA 8ICQA 1TUGB 2ZUGA 4CO5A 5AQHA 4EWTA 2NO4A 3EGZA 3GE1A 4OPKA 2CVIA 1BUPA 5EGYA 4NZ6A 4P75A 3NGSA 3IKMA 1YJWN 2OFGX 1U1LA 5KL8B 1Z00A 2XLKA 4G9ZA 4PQUA 1ZQDA 1KHWA 5HO4A 1JLQB 3VQDA 3L4BC 4Q44A 2JLEA 4UZCA 3O9TA 2DH9A 3ETRA 2AMCB 2JVOA 3NAIA 1CJVA 1ZD3A 4TVAB 1OW5A 4O4GA 1IR2A 1RKIA 9ICTA 3CQ8A 1N6QA 2AF6A 1XNRK 4CIFA 4RW6B 3MX5A 5FLXO 1R8AA 3AN1A 3AVJA 2VG7B 4C8YA 3ILOA 1CLFA 5E3PA 3FZFA 2MDAA 3HRDD 1L7NA 1RBLA 1N34J 4M3XA 2IS3A 3SLCA 2VASA 4FJMA 1PVRA 4N56A 3G8SA 1N2XA 5LMUJ 4IQUA 3JYTA 2EBGA 2W25A 1IKXB 3RBZA 1URRA 3D0GE 1N34F 4CJ4A 5HRRA 4ID5B 2LM1A 2A1RA 1QAXA 1ROFA 1ZJMA 2QW9A 4PG4A 1V85A 4KR0B 3UN2A 2R7VA 2K8GA 3LAMA 1V3RA 1EIYB 3F9MA 4HVZA 3C0BA 3KKRA 3OBIA 4NCBA 4LBIA 4YDUA 2EPIA 5AQWA 4P73A 2JEJA 4DOBA 1X7VA 3CC4S 2PE8A 4FF3A 1WOSA 3QWPA 3O9RA 2JGAA 3KHHA 2HBYB 4AUKA 1VK3A 4MKVA 3UM9A 1DAXA 2CPFA 1TV6B 1T7PA 3GDXA 4ZHRB 1JNZB 4CIOA 2ACMA 3EL2A 1RYSA 5K14A 1PJ6A 5AICA 1QVGR 3HWTA 5A6PA 1NGCA 2VCPA 3NVKA 4FJXA 2VFRA 5AHXA 3W65A 4BUGA 5J0TA 5M1PA 1VHFA 3A1YG 2CJYB 2PMZF 4EBDA 2LEPA 2LBOA 3GOIA 3T5LA 2CPZA 4H0XB 4XPEA 1J5EJ 1TMJA 2VD3A 2YKNB 3C95A 3ZTQA 4YHHF 4RX6A 2NPFA 2XNQA 1ZQHA 4F50A 1MSWD 1F5SA 3CC2S 1RISA 3OYMA 5BYRA 9ICXA 2XSJB 1L7OA 3M1VB 1RNHA 4DR4K 4H4OA 2WF6A 1YG0A 1WHXA 2A6MA 4QIWC 4HT5A 1VQ6N 3PTWA 5HL7L 2YMMA 2O8DA 3GZ7A 5KPRA 3R3TA 2VKZG 4CDGA 4W5OA 5ALNA 1NPKA 2IOHA 3Q8LA 1CG2A 3TZXA 3ZDCA 5IT9O 3BM7A 1WSEA 3MGHA 3K5OA 3VQEA 4Y2SA 2BJDA 3AJDA 1TKZA 2XQCA 5AIAA 5HROA 1WEZA 2PFQA 4M5KA 3UWTA 3GV7B 4JI4K 1XMOJ 1WDTA 1HI8A 1XEZA 1VSJA 3LVVA 5CR4A 2B9EA 2HYIB 1QVGM 4XDCA 2DWQA 2X3DA 2YI1A 4X62K 3GMGA 2FE9A 4C1NI 1MU2A 2DGVA 2VHGA 2HVIA 4CEBA 2WTFA 1XMOF 3QX7A 1VBZA 1VQYA 2BUPA 4NLKA 2F1IA 1RAGB 4NE9C 3MCOA 4X64K 3AO5A 4MO5A 2BKPA 1Z1VA 4C8OA 3VQCA 3TI0A 4U6PA 3C6TB 3B78A 1F3VA 2CA9A 3R27A 1JLCB 2D74B 2HDOA 4HHJA 3VHQA 4DSEA 2QARB 8ICVA 5DS7A 2W43A 2VOPA 1JMTA 1B70B 4GO7X 3M7VA 3S1TA 3GZFA 2HW3A 2M9NA 4CEEA 4USWA 3UPFA 3ZDEA 1ATRA 2UUTA 4F9OA 3QB0A 1RJJA 1X4FA 4UB3A 2Z57B 3ET6A 3TA2A 3SPYA 1KAZA 2BA9A 2RRBA 2VPZB 4I1TA 3WNEA 1EP4B 1UEVA 2RLTA 4ZTJA 2VBWA 4LSLA 3KG0A 1FJGK 2HURA 4I2FA 1ZJNA 2L9WA 2RUGA 1XNQK 4J37A 2E29A 2PFPA 5GIPA 1ZQAA 2YTCA 1Q95G 3OVSA 2QMXA 2W04A 3VAHA 5BR9A 1RAJA 4EIAA 1CBKA 3HHLC 1AUDA 4FFDA 1HKGA 2BQ3A 1CJTB 4QZVB 4XRHA 2HQFA 1U0SA 2JWLA 2DGTA 3NY0A 2OXOA 2Z1IA 3LDLA 5GVQA 3VQ4A 3MX2A 4GKJK 3HPGA 4WFBL 1D8YA 1S72N 4K4WA 1KDHA 2LP4A 4O8KA 2LYVA 3TVZA 1WG8A 2AEJA 4J2AA 4DCCA 3NH0A 1KVIA 4EYHB 3RZAA 2E7WA 1BY9A 3HVRA 1TFWA 1N54B 5JVGL 4B9QA 1X2IA 1DLOB 3QATA 4HTJA 3VZIA 3QJJA 4MIAA 2JMGA 3J80Y 1Y88A 4ZJOA 3MCSA 4I2GA 1Y64A 5J2PB 1I94K 1P90A 1LW2A 4LBHA 1N8RO 1Y7PA 3DXSX 3CPWR 2ITMA 1IJEB 3W1YC 3V9XA 3RWUA 1UPPA 5M2RA 3UFCX 1M1GA 2IFXA 3N28A 1OUQA 4WJ3B 3T6BA 1SWWA 4P10A 2ZVIA 1IBMJ 3HD2A 4K59A 1TUYA 7ICTA 3G4SS 2ZWHA 2YX1A 1HQEA 2OI2A 1FEEA 4DQPA 3N6LA 1FE4A 3P4UB 2G0AA 2G09A 2HGNA 1TFRA 1RDUA 1IKVB 5U47A 3J7YU 1GK8A 3EVWA 4KLTA 2OM6A 5ALUA 2ZTCA 3QU7A 2IPOB 4KTQA 4Y1CA 1IUJA 5B0FA 4FZMA 4DTSA 1HD0A 4MAKA 4OJGA 1C1CA 4OZ0A 3F53A 2RHKA 1YJUA 1N4LA 2LYAA 2FF6A 4DV2J 2ZOFA 3TSUA 4PHPA 3VGSA 4FYVB 2WAQD 1DZ5A 1Q86T 2BX6A 4RPYA 4PHDA 1COKA 4X65F 8ICWA 4DR1K 1YITN 4U7UD 4DV6F 3MN5A 4KJIA 2M3DA 3H20A 1FWKA 4LQ3A 3OPKA 7ICOA 1EO1A 2J7UA 1N62A 4QYZK 4IS7A 3KJFB 2H3ZA 1H74A 3SQIA 3LZIA 1S9EA 4A8OA 2P9KA 4OJ5A 4Q8EA 3D9BA 3E9PA 3QBWA 2AGQA 4U67L 3CPWM 2ZJPL 3PR4A 3JSBA 5M1OA 5D3GB 2OD6A 3DRSA 3M6XA 3ZCMA 5J2GA 3ISDA 3WHIA 2P1JA 4ECXA 7ICNA 4J5OA 1OQ3A 1PBAA 4B8CA 2ZJQQ 3V1RA 4M5JA 3UVJB 5SWMA 5IC6B 4DR6K 2FMQA 2V8PA 1JLBA 3SI8A 3U27A 1RT2B 1YJ7A 2WBRA 2YNFA 2NXUA 1G3OA 3VVUA 2BCUA 1Q18A 4JLHA 2B9WA 2YWEA 1RT3A 2NRHA 1ZC6A 4I2PA 3D2QA 2EZXA 3UPQA 2IVNA 1FNOA 3KK2A 1RDCA 4GRSA 3N6MA 2ZZNA 3OSNA 2E5SA 3OYKA 2UU9K 3EXYA 1KS2A 3OGUA 1B92A 1RXOB 1ZAWA 4QU6A 1LWXA 4LF7J 5J2BA 2GC8A 4BRIA 3JTNA 1SL1A 5T7LA 3UQSA 4DPYA 3GIJA 3T5KA 1GXTA 2BW2A 2CJKA 1NMNA 1KQQA 4LFAK 4LF7F 5M1NA 1C0FA 3UKUA 4C3KA 3QZ7A 4MK9A 3L3UA 4IOBA 2DHSA 4ZVHA 3Q2TC 3QSIA 2ZD1B 3W2VB 2OCEA 1KP6A 5F8IA 4UB4A 1P6TA 4KHWA 4K8XA 3IRUA 2K4EA 4JKBA 1JCFA 2XC9A 1KLMB 4I7FA 2DTUA 4RQ7A 3FMBA 5LY3A 5H9EK 3UNYA 4ZVQB 2VQEJ 4PXBA 2MTLA 1ZQQA 4AHCA 2E1AA 1RGIA 5J0QA 1KAXA 2F44A 2FIUA 5B8HA 1S5LU 2ROGA 4RO0A 4KHPJ 3HOSA 2DR9A 1LOTB 5ALIA 4C4TA 2DH7A 1HARA 2F2AB 3EKUA 2LFVA 4OPAA 3US5A 1PC4A 3K9JA 4QCLA 2KNJA 3L3CA 1S97A 4ISEA 2N7YA 3P1GA 4I64A 1BE4A 3OLAA 4GW6A 4PCQA 2YKMB 3PKMA 1KC8T 3IP4B 2VB6A 4DS5A 8ICSA 4LF4K 3WU2U 1URJA 4MN4C 2BEFA 4DJBA 4QWEA 4N76A 1RDAA 3MMVA 1CZAN 2AIRB 2PYJA 2G5HB 4YY3F 1YSJA 3I96A 5F8GA 3W61A 3KWMA 2N1RA 1G99A 2J7WA 3UE2A 2CWXA 2E8AA 2ZF5O 3HSZA 4KBIA 2LM4A 4NA3A 2HBLA 1NO8A 5LM7E 2UUBJ 4BRPA 2R7TA 4O3QA 4QZEA 2CNKB 3PW2A 3A3OB 4CT8A 3HVTA 5DG9A 5JVHQ 1UW9A 5AZJB 5EE1A 3CCUN 3ENQA 3OLBA 1S1TB 5AR0A 4CJUA 5KFMA 1FX2A 4BS2A 2JFDA 4L3KA 1S1WB 4Q5VA 2VQFJ 3EMTA 2NV3A 4LY7A 2XI2A 1ZPVA 3QLHB 2MQ8A 4FJ9A 1HHSA 3LP0A 4IEEA 1PK1A 3C16B 4Y2VA 2KZ3A 4P6QA 4HAIA 5HMXA 3OYIA 3QUCA 1I51B 3PLAA 2VQFF 2D3OR 3GJQB 3MM9A 1NDKA 2LYBA 2VOOA 3DOKB 4CGJA 4C23A 1ZQTA 5G5GA 4OJLA 2WB4A 1VSHA 4HHTA 1JWWA 4CCHA 1Z4NA 4ZN1A 2DGSA 1DJ0A 2R4FA 3D6HB 1QQMA 2F3JA 3G6YA 1VK0A 3FSIA 2C3MA 2PFOA 1VRTA 3G96A 1WG1A 4OYWA 4Z7CA 1HI0P 3F5EA 2P9PA 2O1PA 3PV8A 2K1RA 4CLFA 3M6VA 4RQ0A 2P9SB 3D4JA 3DYAB 3EVMA 2Z1HA 5IV3A 3L4QA 2ZQBA 1RAOA 1VQ4N 4PRFA 2P6RA 2N3OA 5C5JA 4M9GA 2R7YA 1L5UA 3MTJA 1FKPB 1TU0B 2JGUA 4I6MB 4DR2K 1N5VA 1YJVA 4KTWA 3U9DA 3CFPA 2CQ0A 1UJ6A 4OYZA 3AUOA 3JAMO 1Z25A 4MK8A 4EBEA 5GTIU 3C66A 3THXB 1T0TV 1V3ZA 3DJCA 4USTA 1KHVA 4XH5A 3CIZA 4TLQA 2M88A 1RAAB 2KYZA 2DCUB 2NNWA 3CCTA 2MQPA 4LF5J 2F9DA 2HSEB 2XMVA 4B3TF 1NCLA 1H72C 5EOYA 2MQLA 3R97A 4CO1A 4IR1A 4PUOA 3N4PA 1B43A 5E2QA 1HWUA 3J7AP 2X1BA 3GSIA 5EY4A 2Z2YB 1FDBA 4RQMA 4KFBA 2KTQA 4DR3J 4A5BA 4J9QA 2F8EX 3AEVA 4AHTA 4X4NA 3OR1B 1VQLS 4DV0K 3T6JA 3L4PA 1O03A 2MHNA 3VGLA 5BR8K 4FJKA 3ZSXA 6AT1B 2KXNB 4DR3F 4ZVUB 3LDSA 1MMLA 3QERA 1NK5A 4NEZA 2HNZA 3MMJA 1BG3A 2FF3B 3P3DA 1IJJA 3ORYA 2PMWA 5ALWA 2BOPA 2RH3A 1QE1A 2XVTA 2DFEA 3PMNA 2MSTA 3CP8A 1NGGA 4KLEA 3H2LA 1CPZA 2O8CB 2RRDA 1HQUB 3THWB 1T4GA 4EO8A 2HBMA 4CNQA 3AA2A 1ZQEA 1TQLA 5AXLA 3A0HU 5BJRA 1RSCA 4EBCA 2B4PA 3KLIB 1NAQA 2G2YA 5FDLA 1LWCB 2WMMA 1M5SA 2F8KA 2OHFA 2EFGA 4KHUA 3B54A 3Q7BA 3N0VA 1N52B 2KRRA 2WVDA 4A8FA 5ETLA 1GLAG 3MR6A 2KVIA 2HMPA 5D15A 4O5KA 2EFPA 3ULDA 1UT8A 4OYBA 1HUXA 2Z56B 4FZLA 2K2PA 4KRWA 4FLUA 3MM8A 1DXSA 4K4GA 2ZZMA 2C2ZB 4EUVA 4F3MA 2F9TA 4CDIA 2AP6A 4FXVA 1HNWJ 4EAHD 1DKGD 1VI7A 2DCLA 2MKJA 3JQMA 5GAGU 1C0MA 5H1SV 1JJ2R 2GJIA 4M3RA 3SUQA 4JV1A 3TTFA 1PYTA 1RHQB 5AI4A 2BE2B 2Z7JA 4FPBA 1MN8A 2JLFA 1ZM2A 1U49A 3T1AA 1T03A 3G25A 1KD1T 2FB0A 3QEWA 1K0TA 3GDQA 1VAZA 4MYUA 2D4WA 3VQ9A 1NBWA 2G0IA 3ILJA 3U7JA 2CPHA 5HLFB 5AKEA 2WONA 1FFSB 3UD5A 4CJ7A 4OYAA 1B9DA 4C7QA 4P4MA 4TY8B 4DF4A 3I76A 3WUHA 1RQLA 3ZZZA 3S6JA 4IDHA 4QS9A 4UZBA 2E9ZA 3AU6A 3S3MA 3MDQA 2OKQA 3CCJN 4ENOA 4DV4K 2W6LA 3NVVA 5JRTA 4DDFA 4CE9A