4DSKA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, ppi and calcium
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
579
structure length
575
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*GP*GP*CP*TP*AP*CP*AP*GP*GP*AP*CP*TP*CP*G)-3')
total genus 205
structure length 575
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dskA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dskA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dskA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dskA01
3RAQA 5KG5A 7ICKA 2HW3A 5J0SA 2Q0ZX 5SWMA 4JUZA 1ZQEA 5KG0A 4RNNA 1SZPA 3GIKA 1ZQRA 3KJVA 1S77D 3GV5B 4N56A 4RQ0A 3MECA 2P5OA 4KLFA 5F9LA 1RYSA 1EXNA 3Q8PB 3SI8A 4ED3A 3UIQA 1HQEA 5J2CA 4EP5A 4HTUA 2MAXA 5KFYA 3A2FA 1ZQGA 2O4IA 1J5OA 3AO2A 1S1TA 2HNDA 4M9HA 4CJ4A 4I2HA 3GILA 4W5QA 2Z1HA 3H40A 5KFAA 7ICMA 9ICRA 1D9DA 1DLOA 2JEIA 4DL2A 4DOCA 4NM1A 4ECSA 4ELVA 4C8OA 4RQ8A 1C0MA 3V9ZA 4KN4A 4MFBA 3OYBA 4J2EA 8ICPA 4XUSA 1F21A 2F1IA 1ASVA 1S1XA 1U4BA 3AU2A 3VQBA 3I0RA 2HMIA 5KFNA 4DL6A 1HYVA 2ETJA 4RQ5A 4KTQA 4DLGA 2F8TA 4KMUA 4E89A 4QWDA 1D9FA 5HLFA 3MAQA 3QO9A 2NRTA 1NK9A 2XRIA 5KG4A 3BGRA 4CGGA 4WE1A 3PW4A 3PR5B 4QW9A 3RMAA 3RJKA 3V9SA 3MR6A 4Z0UA 2JZBA 1JL2A 1S97A 1TGOA 1L3UA 1A5VA 3SUPA 5FRMA 4DTRA 4CIEA 4B9VA 2OPQA 5HMLA 2NRXA 9ICHA 3HYFA 2G8FA 2WOMA 1WCLA 1ZQXA 4DFMA 4FJGA 1IKXA 2W8LA 3TABA 1RT3A 3EZ5A 1I3AA 4JV0A 1ZBUA 4YVZA 3L2WA 1ZQKA 4C8MA 9ICSA 5J2EA 4BXOB 5DBAA 4DWIA 1ZQUA 3RB6A 2DFLA 8ICEA 3OYAA 3H7IA 4R8UB 5KFPA 5L1LA 3V7KA 3S9HA 4E7HA 4YFKA 2X78A 2IOCA 4UB1A 2V9WA 3ALYA 2G8IA 5EWGA 1NOMA 3UPQA 3TANA 1RBRA 5KG6A 4DSIA 1RDAA 4CJPA 1JX4A 4KLEA 4GC6A 3PMLA 4FLVA 5CY4A 2FBYA 1JLBA 3V1RA 5KGXA 3K57A 3L8BA 2DFEA 4CJ3A 5J0OA 5HNKA 4BDYA 4HVJA 3CM5A 4CF0A 1RTDA 3MGHA 3WNHA 5HP4A 4G3IA 3MGIA 5C25A 9ICWA 3PMNA 1Z3EB 3ZT4A 2BR0A 4UB4A 4YD1A 3LZJA 2F96A 4CGHA 1ZJNA 3QEAZ 3SUOA 1U47A 4QZCA 1SV5A 4KO0A 4I9QA 3C2LA 2FLNA 3K5NA 1K6YA 2IA6A 3U6FA 4CEDA 3VQDA 2VG6A 1NJXA 3HO1A 3E2EA 1XSNA 5J0XA 3AO1A 3G6VA 1S0OA 1EKEA 3K2PA 2ZUBA 4DTOA 2BQRA 3HPHA 5KG2A 1NK4A 4YXJA 2E6LA 4CHOA 3QNNA 2RKIA 1N48A 5KFEA 4RQ7A 1HQUA 1JMSA 3CG7A 3PX4A 3U3YA 9ICKA 4YNQA 4KHSA 1LB2B 4ED0A 3BDPA 4CGJA 2RF2A 1KTQA 3ITHA 4KLTA 1BGXT 2HHWA 2LSNA 1Z26A 5DMRA 5KFOA 4CJFA 4M3YA 4Q43A 3ZD8A 1BQNA 3VQAA 2BDPA 2W42A 3N97B 3VA3A 4DQIA 1Z25A 8ICTA 1IXRA 2YKNA 3ORYA 3DLKA 2XGQA 1BI4B 9ICVA 2HVIA 4M04A 4I2BA 4W5TA 4IR9A 3SJJA 2BCVA 1W9HA 1QHTA 3ZSRA 2VWJA 3CFRA 4F5NA 4HHTA 2X74A 4NY8A 8ICOA 4CK3A 1N5YA 5C24A 3PW5A 3WNGA 1U49A 4JS4A 3RTVA 1XS9D 1RDCA 2IHMA 2AQ4A 3C5FA 5KT7A 3VQ4A 3PO4A 3OS0A 1VSHA 1S9GA 3ZDBA 4M47A 1ZQSA 2AGPA 1TK5A 4KRFA 2UVWA 8ICNA 1VSIA 2GV9A 4FLYA 1JLFA 4DS4A 2OA8A 1QSLA 2XC9A 3AVJA 2P66A 4CEFA 2R8JA 4XA5A 1TL3A 3AO3A 4O0JA 1D8YA 4F4ZA 4IKFA 3H8SA 2BCQA 3OVNA 1HYZA 5CYMA 4DLEA 4FJ5A 1A77A 2HHVA 3DLEA 2NRWA 4RQ2A 3IG1A 4CEBA 2J6SA 1ZBFA 4I2FA 4OVLA 4FLUA 1XHZA 4CHNA 4M3XA 1CUKA 2A1SA 3THVA 1TVRA 2KW4A 2BPCA 1BCOA 5CB1A 4KLUA 4Z6CA 4NCGA 2JEJA 4PQUA 3IAYA 4FJJA 4F5OA 2J6TA 3KD5E 1X9WA 4RQ6A 4KITB 2R8HA 1UA1A 4YG2A 4DSEA 5L1JA 4KLHA 1EETA 4PA1A 1EX4A 2D0AA 3L2QA 4OKEA 4CECA 3IM1A 1T03A 9ICPA 2Y1IA 4HCBA 1CXQA 9ICFA 3LP0A 2J6UA 3SV3A 1IO2A 2YNIA 4E7KA 2A1RA 4CE9A 5EOZA 4O3QA 3T5HA 1HUZA 3C2KA 3S3NA 5IIKA 2ISOA 3OYMA 4PH5A 3AO5A 5J2GA 8ICZA 4K8ZA 4CJRA 4FJMA 3RB3A 1HRHA 3NH2A 1ZQPA 3RJFA 1VSEA 9ICTA 3OYDA 4ECUA 4O5CA 1HJPA 3EPIA 2HHUA 3RWUA 3NE6A 2BCRA 3MEEA 4B9TA 1Q8IA 1S9FA 1HNVA 3QERA 4HCCA 2BKEA 3ZSOA 4RUCA 3JPNA 7ICFA 2ASLA 2ZTDA 3JYTA 1JLAA 1D5AA 4KLMA 3V1QA 3OYJA 5J0PA 4M0AA 1RT2A 4KN7A 5KFDA 4PHPA 4QCLA 2AU0A 3ZT1A 4CEEA 3QINA 4E7IA 3OYKA 4UB3A 5DQIA 1TK0A 4TQRA 4QWBA 5J0TA 1HUOA 2KTQA 1GOAA 3KLHA 4M3TA 2ZD1A 4KLDA 4NYFA 3RBEA 4M42A 3K59A 3QEWA 4K4HA 1ZQBA 4DFKA 1IM4A 4Y1CA 3O3FA 3V9UA 2IDOA 4KLOA 5D3GA 1UT5A 4GC7A 3H4BA 5JS1A 3NH1A 3AVNA 9ICMA 3Q8QB 2Z1IA 4F4KA 4F92B 3ISDA 4OKJA 5D46A 5DDMA 1ZQIA 3VQQA 3AVKA 4DOBA 4UAYA 5KFXA 1MQ3A 4IG0A 4M9JA 4Q45A 1RBUA 4CEZA 1UAXA 2OYQA 4BE1A 3MFHA 3HVTA 4I29A 4RQ3A 2HVHA 3JPPA 4J9SA 3SYZA 3ETLA 1ZQLA 3KLIA 4I2DA 4DEZA 8ICQA 4JRPA 4O44A 4NLGA 4ZH4A 4ID5A 4KFBA 4QW8A 2MUTA 3HW8A 4ECQA 2BQUA 7ICUA 3V72A 4MFFA 2BANA 1YT3A 3QLHA 3HM9A 5DB9A 3ZCMA 4F3OA 4RQ4A 2YNGA 5DK5A 4RUAA 5J2FA 1GOBA 3JSMA 3HX0A 4FK2A 1WNSA 3PW7A 4RPYA 3Q8RB 2O4GA 1ZQZA 7ICOA 4JRQA 1QQCA 4PPXA 3P1GA 8ICJA 3T5JA 4RU9A 1MQ2A 7ICSA 1QE1A 3JPTA 1B43A 3PY8A 5KFHA 4FM2A 1NOZA 2KN7A 2G8VA 4FJLA 2RDIA 3ZSXA 3IHQB 4GXJA 1MC8A 2ZTEA 4FBUA 5FDLA 4IRCA 5KFFA 1BVSA 2AJQA 2GWSA 1EP4A 5KFRA 1NK0A 1VRUA 4OPJA 3UXNA 2PFOA 3JPSA 3FYHA 1ZQQA 4E1NA 5KRTA 3Q8LA 1S0NA 4TUQA 4CJSA 5KFIA 3VQ8A 4TUSA 3QEXA 3NDKA 3WNEA 5KI6A 4KLGA 1LWCA 5KFTA 1Y88A 3K5MA 3UXOA 4DTUA 4KB0A 3VQ9A 4FCYA 1SUQA 3V1OA 1XHXA 1LAWA 2IBKA 5KT2A 1XSPA 3OJUA 3TI0A 4DF4A 2R7YA 3P83D 3OYIA 3RJIA 8ICUA 1FK9A 3GIMA 2AQ0A 4F4XA 2BGGA 1HPZA 2V4RA 4M6WA 2QXFA 3AVIA 1KVCA 4KLQA 1BHLA 1BISA 4OJRA 1SL1A 3EY1A 4QZFA 4JLHA 4RNMA 4FJ7A 4TUPA 3RRGA 5KFQA 3TWHA 3O4NA 3SUNA 1S9EA 1RTHA 4I27A 3VQPA 2R8GA 3K5OA 2HHTA 1RT5A 4NCAA 4EBCA 5BPCA 1RZTA 1Z00B 4QWCA 4DTMA 2EHGA 4UAWA 2XHBA 2ISPA 3ULDA 2PY5A 1KEJA 2KFZA 3KLGA 4KLLA 4DTSA 8ICBA 3BQ1A 4M45A 1CEZA 3IRXA 4QZIA 4ICLA 4Z4EA 2DFFA 5JS2A 3AA5X 4J9PA 4YMMA 1NJZA 4LZGA 4BGDA 2EX3A 4M9NA 4W5RA 4RT3A 3RB4A 3ISCA 5CJ7A 5IIMA 4OGCA 4R5PA 4NLZA 4Z6DA 2UVRA 4FK0A 3C5GA 3ZT2A 3SI6A 2ZUDA 4LSNA 1IH7A 4E7JA 3MEGA 3OYGA 4KTZA 4CFAA 4DL3A 3LDSA 4ED8A 3TAQA 7ICLA 1JLCA 4PUOA 9ICOA 3AVHA 4N76A 2AGOA 2IHNA 1BPBA 8ICXA 2BPFA 1CZ9A 1ZQDA 2NRZA 1CXUA 4KHWA 3L3UA 5DLGA 4I2IA 1B22A 1YTUA 4FLWA 7ICPA 1ZQTA 4NXZA 1BPXA 3HP6A 4BE0A 4YP3A 3M9MB 9ICGA 4F91B 4UQGA 1KVBA 5IIOA 4ECZA 4FZYA 4CJQA 1ZQHA 4FJKA 4RG8A 2RDJA 4C8LA 4IR1A 4O5BA 3OYNA 1CZBA 3DOLA 4M9GA 4CK2A 2P5GA 4I9LA 5KT4A 2A1JA 4FK4A 4CJVA 3CFOA 3ZSVA 4DU3A 2VA2A 1SKRA 3DRSA 2JGUA 1GOCA 4OLBA 1RCHA 4FJIA 4DSKA 3Q8MA 3KIOA 3FFIA 4FVMA 3M8QA 2YV0X 2D5RA 3LWLA 1TKXA 8ICHA 2VWKA 5FROA 2Q3SA 2F8SA 3LAKA 4K4IA 4R64A 4R8UA 2ASDA 2X6NA 1HYSA 4J2BA 4YR2A 8ICAA 3Q8KA 3RR7A 3IS9A 3RR8A 8ICVA 1U9LA 4FLXA 3EPGA 3ISNC 4DL7A 4RT2A 3OGUA 2E4LA 3LWMA 8ICWA 3UXPA 3JPRA 4KHYA 4BACA 3F73A 3O4QA 1BPEA 2WTFA 2ZJ5A 4EEYA 2YNFA 4O3PA 1TAUA 3TAFA 4EZ9A 1YVUA 4W5OA 2B4JA 5KTQA 4W5NA 4E7LA 4RW4A 5HRRA 2ZUCA 2IGIA 3RMCA 1T3NA 5L1KA 3RJEA 5J2BA 1W0HA 3H8WA 4B9UA 2DPJA 2PZSA 1XWLA 4O9MA 2BCSA 4AHUA 3AA4A 5KG3A 4YMOA 4R65A 3V9XA 1DGSA 5L9XA 4YQWA 4XQ8A 8ICRA 1ZQJA 1KCFA 1VSMA 1RXVA 4J9LA 4NLNA 5J2QA 3SCXA 4FXDA 4CK1A 2HNZA 3CM6A 3HPGA 3QEIA 3O3HA 8ICCA 3SQ0A 1NK7A 3C94A 3OJSA 2OZSA 1A5WA 2OPRA 1EXQA 1SL2A 4CHQA 5KG1A 1X2IA 1MU2A 3V6KA 4QZDA 1NK6A 1DTQA 4M3RA 3RMBA 3KHLA 8ICFA 3HVRA 1ZQMA 3M8RA 1YTAA 2HNYA 2D0CA 3TQ1A 2PFQA 4J9QA 4IDKA 2XGPA 4JK1A 3ASMA 4F4YA 1B92A 4DSFA 3RJGA 4GW6A 4H4OA 4AILC 4FLTA 1RBTA 4DU4A 1BQMA 3C6TA 4M2YA 2W9AA 1JXEA 4IRDA 2QK9A 4LD0A 9ICEA 5TZVA 1XU4A 1ZBIA 1WSHA 4F2RA 1COOA 3OHAA 2IAJA 4DG1A 3RBDA 3QEBZ 1XC9A 1VSDA 4MEXA 3NGIA 3LP2A 3VQCA 5CWRA 4QZBA 3C23A 5CZ2A 2W9BA 3GIIA 4O4GA 3V6JA 1T8EA 1JKHA 3CYMA 5J0YA 3JPOA 1JN3A 5D4BA 1FKOA 2HHQA 4Z4HA 3VQ6A 1QS4A 7ICHA 2UVUA 2FMQA 3C21A 4K4GA 4MQ3A 3NF8A 4ZTJA 1VRTA 4CIFA 4I2AA 4CCHA 1KLMA 1S5JA 3GDXA 2KFNA 4FM1A 1PZNA 4FW1A 1G15A 2MUTB 3QETA 2FLLA 5J0WA 4I2CA 4IQWA 4EBDA 1ZQOA 1WCNA 3KHGA 5KFSA 1BIUA 4MEYA 5KFWA 3ZSWA 5KRSA 4M3WA 4BWJA 5KFVA 4CJTA 3PO5A 2ASJA 5J2IA 1C0UA 4KHUA 2C22A 2R8IA 3MBYA 2GBZA 3FDSA 1CLQA 2KQ2A 4FLZA 3TARA 1H38A 4EBEA 4Z4IA 4IRKA 1NKEA 3MDCA 3L2UA 4KLJA 4PWDA 4IQVA 4M6WB 4DTPA 4X5VA 9ICIA 5JUMA 1QSSA 3P5JA 4LH4A 3AVMA 7ICQA 2V4QA 4FS1A 5DKWA 4B9MA 1LV5A 4NCBA 4L8RB 4KHNA 3B6OA 4BDPA 4CHZA 2BE2A 2A1JB 3ZDEA 4KTWA 2ZQBA 4DTNA 1SKSA 4C8KA 4DTXA 2ZJ8A 4G1QA 5K14A 3TAMA 1ZBHA 3E01A 5J2PA 1ITGA 3SQ4A 1ZQCA 2HB5A 2PYLA 3AVAA 8ICKA 2P51A 3ZSZA 3L2RA 9ICCA 3LPTA 5CZ1A 1KFSA 1KFDA 3MDAA 1NJWA 5SZTA 1AROP 4MFAA 2ZE2A 4UB2A 5IILA 3F9KA 4CGIA 2BQ3A 1ZETA 4CESA 2WONA 1KLNA 1C1CA 1WSIA 4AHTA 4AHSA 4QZGA 3NCIA 4Z4CA 3MXJA 4ECRA 3NF7A 3TAEA 1RT1A 4KPYA 4J2DA 3C6UA 4OKKA 1NKCA 1N6QA 3HK2A 3GQCA 3LZIA 1C7YA 3CFPA 3NGYA 5KFJA 4KHQA 3DM2A 4Q8EA 1T05A 3K5LA 2AGQA 3OSNA 2C2EA 1RBVA 4DQPA 1S6PA 3SQ2A 1NK5A 5J0RA 3V81A 4BDZA 4FYDA 2ITGA 1S1UA 5DG9A 1VSKA 2VANA 2M9NA 5DB7A 4M3UA 3OS2A 4H8KA 3KK2A 4F50A 8ICSA 2JEFA 5HRNA 3EYZA 1DOQA 3VQ7A 2P6RA 4I2EA 4NYNA 4AH9A 3HJFA 1RDDA 1J54A 1REVA 2BGWA 7ICEA 5F9NA 4KLSA 4CGDA 1RBSA 2RN2A 3OYLA 3DI6A 4I28A 3QEPA 3AVCA 2FBVA 3K58A 1KFTA 3TAPA 1WSGA 4N5SA 3VA0A 4GLXA 5KT5A 1IKWA 1X1PA 3OYCA 9ICJA 1V9PA 3RJHA 4O0IA 1ZYQA 4CJLA 4AHCA 4DQSA 4DSJA 4E3SA 1ASWA 1JXBA 4DS5A 2Y1JA 8ICGA 1FXXA 3G10A 3KHRA 4UB5A 2FBTA 4CF8A 3S3MA 3C2MA 5IINA 3T5KA 4CF2A 7ICGA 4F5QA 1C1AA 5DGBA 4CHYA 4YMNA 2C28A 3BJYA 3EW9A 5CYQA 1WAJA 2ATLA 1RT7A 4R63A 4DF8A 3ZD9A 2UVVA 4GVMA 1RILA 3VQ5A 1S10A 5J2AA 4E0DA 3EWAA 5KT3A 4O3OA 3V7LA 2D0BA 4CJWA 4FJNA 1BCMA 4DL4A 4DOAA 4Y1DA 7ICRA 1KDHA 4QWEA 4BWMA 2H5XA 4ZTFA 2G8WA 2IC3A 1RNHA 4JWNA 2YNHA 4FBTA 4F93B 2KZZA 5HHIA 3HL8A 4Z6EA 3MR2A 5DQHA 2FC0A 2ZTCA 3LP3A 3B0XA 3QNOA 4F4WA 3MXMA 1VSLA 3PX6A 1HNIA 1VK0A 4KI4A 2JZBB 3AU6A 3NH0A 4B3OA 3T1AA 3PR4A 1UT8A 3I0SA 4RW7A 3SUQA 1VSFA 4QZ9A 5CA7A 3CQ8A 2R8KA 1RT6A 4RZRA 1LWEA 5HMMA 4FJ9A 3AVLA 4P4PA 3NFAA 3KTQA 1J53A 5EWFA 3HT3A 4J9KA 4E1MA 4AHRA 4J9NA 2W9CA 4HYKA 4KI6A 5CHGA 5KFBA 3RRHA 2B21A 2P1JA 5FRNA 2HHXA 4O5KA 4EZ6A 7ICVA 4BXOA 1JLEA 3KK1A 3C1YA 4P4OA 4RPXA 4CFBA 3RJJA 4ID1A 1Q9XA 3L3VA 3SPZA 2DFHA 3TR8A 1UWBA 2ZJAA 4JS5A 4AHVA 3OHBA 3NBPA 3B6PA 1TKDA 4MF8A 4XIUA 1MSWD 4RNOA 3SNNA 2C2DA 4I2GA 1Y97A 3SQ1A 2FMPA 1WN7A 2ALZA 3MR3A 2W9BB 2G8HA 4UBCA 4XRHA 4IQTA 1B9DA 4KLIA 3VQEA 5J2NA 3RMDA 3PV8A 4YFUA 5D49A 3M8PA 1XO1A 4CFCA 1S0VA 4PHEA 5C5JA 5HRSA 4J2AA 2DTUA 4QOZB 2OWOA 4BE2A 4KAZA 1WSEA 4CHPA 4Q0BA 4OPKA 2XCAA 4KB1A 3QZ8A 2F1JA 4F3TA 5J2KA 5KGWA 4Z6FA 4O3NA 1L3VA 1I39A 4UAZA 4DQRA 1FKPA 3LALA 4ECWA 2FMSA 1S76D 3JPQA 4Q8FA 5DBCA 5EWEA 3NHGA 2PI5A 3C95A 3DOKA 1ZJMA 3QZ7A 3ZDCA 5KFKA 3WNFA 8ICIA 1L5UA 5L1IA 5KFMA 5T7BA 2VG7A 3AVBA 1WLJA 1TV6A 4I2JA 3V6DA 1UA0A 4RW9A 4YD2A 1KVAA 3HSTB 3KKSA 1LW0A 3D0PA 3AO4A 4R66A 4ELUA 5J29A 3NAEA 4F5RA 3V7JA 3ZSQA 2FLPA 7ICTA 1ZQYA 1ZQWA 5I42A 1QLNA 2HHSA 3H08A 4DMNA 5KFUA 3MABA 8ICMA 4QZAA 8ICLA 3G6XA 4Z4FA 3DLGA 4JV1A 4EYHB 3PNCA 1NJYA 3RB0A 2PFNA 2X6SA 3RH5A 4NM2A 4PGXA 4DL5A 1TL1A 3B0YA 5KFLA 2FPLA 3NGZA 3PX0A 2XY6A 3KLFA 4K8XA 4FZZA 4EP4A 5DB8A 4CJKA 4DFJA 7ICJA 3OY9A 3DLRA 1S6QA 3LAMA 3MEDA 5IIIA 4N47A 4CJ5A 3ZDDA 5J2DA 3Q8SB 4YCXA 3DLBA 3RAXA 4EYIB 2LYHA 1R0AA 5BOMA 3M8SA 2KZ3A 2XY7A 2W8KA 4B9LA 1LW2A 3KK3A 4O3SA 2F1HA 5HP1A 3KKRA 2Z1JA 4Z4GA 4YR0A 3QE9Y 3H4DA 4JV2A 4J9RA 4H4MA 2BHNA 2FPKA 1T7PA 4FZXC 2E6MA 3V9WA 4NLKA 1TV9A 4RQ1A 2JEGA 1L3SA 1BPYA 1KSPA 5DG7A 2OPSA 3AA3A 3BQ2A 2IMWP 1JL1A 4HUGA 3KLEA 3QIPA 4CF1A 4YR3A 5KT6A 1U04A 2OPPA 5HRPA 1TVAA 4CFDA 5CR0A 1LWFA 9ICQA 2B6AA 2B5JA 4B8AB 4TQSA 1X9SA 5IIJA 2XCPA 4J9MA 1TAQA 4OLAA 5J0QA 3AVFA 4HUFA 3NF6A 1JIHA 2XY5A 3ZT3A 2PI4A 3GV8B 4CEQA 1U48A 1A76A 4IG3A 3SV4A 4ECXA 4B8CA 5HHHA 1VSJA 4YXMA 5HROA 3S3OA 1TKTA 4QZEA 3PW2A 4FM0A 2IS3A 4IQUA 2KZMA 1K1QA 2BCUA 2FPMA 4C8NA 1KRPA 4TURA 3PW0A 3QESA 2RPIA 4IFVA 4LSLA 4DO9A 3O3GA 2QKKA 2DY4A 4DFPA 3OSPA 3SPYA 5C42A 2JLEA 3V6HA 1ZBLA 1BL3A 3OS1A 1ZQFA 3GIJA 3ZT0A 5DG8A 3HWTA 1NOYA 9ICAA 5E41A 4LZDA 1QTMA 4YN4A 1IKYA 1J9AA 4CJEA 3HXMA 4HUEA 3SZ2A 5J2HA 4B08A 3N4MB 2YHAA 3L2VA 1BIZA 5BOLA 3AVGA 3QEVA 5DB6A 3LANA 2GUIA 4LY7A 1UOCA 3H8JA 2DPIA 1RTJA 2W9CB 1A5XA 4ECVA 3ISBA 1IKVA 3NF9A 1ZQAA 2QKBA 4ED6A 4MFCA 3OYFA 4DSLA 3V4IA 2YHBA 3BQTA 3PVXA 1RT4A 5KFCA 1IG9A 5J0UA 3GV7B 1C0TA 2W9MA 1BPZA 1TFRA 1ZQNA 2XO7A 4IBNA 1U45A 4KV8A 1QSYA 5J2JA 9ICLA 4PGYA 3MFIA 1XSLA 4Q5VA 4N41A 4ED2A 1RDBA 1NKBA 1BI4A 5HBMA 4CGFA 1SKWA 3G0ZA 3GFKB 3LDAA 5DGAA 2VG5A 2NUBA 3OYEA 3BQ0A 1Q9YA 3TFSA 2ATQA 1WSFA 3D45A 3C1ZA 4I2PA 4PHAA 4P2HA 5DQGA 4QWAA 1HMVA 3ZSYA 1S0MA 1S1WA 1K1SA 5I3UA 2NRVA 2YKMA 3KD1E 2OZMA 4ECTA 9ICBA 4RW6A 1D8LA 4QZ8A 2VA3A 1XI1A 4M9LA 3NTUA 5KG7A 4I7FA 4J9OA 1T4GA 1ZQVA 3HPOA 2PYJA 3LK9A 3TAGA 3NGDA 3UQ2A 4GXKA 5DDYA 4F8RA 4ELTA 4CIGA 3UQ0A 2P6UA 4GMJB 4DQQA 3VN5A 1C6VA 2I9GA 5J1EA 4FW2A 1L3TA 4QAGA 2Z1GA 1RXWA 4I2QA 4O55A 7ICNA 2I5JA 4IFYA 1RYRA 4P4MA 3I8DA 5J2MA 4CF9A 4QZHA 2XY8A 1HJRA 1B9FA 1RPLA 1DTTA 2PXIA 3T3FA 4E19A 3T19A 1JLGA 4PY5A 3DMJA 4MF2A 2G8KA 1TKZA 1Z00A 3OYHA 2FBXA 4O3RA 4DTJA 2G8UA 3MR5A 9ICXA 4DU1A 4FJXA 1WSJA 4OGEA 3RH4A 4ED7A 4CERA 5KFGA 3K75D 5DLFA 9ICUA 3AUOA 1ASUA 4LVSA 4PGQA 3QIOA 1X9MA 4ED1A 3PUFA 4FO6A 4F5PA 5CP2A 3HP9A 5EU7A 3KHHA 5DBBA 3M9OB 3U3GA 3ZDAA 4RW8A 4FS2A 4CEAA 3RH6A 3DYAA 2VA8A 3LPUA 4ZHRA 2C2RA 4PHDA 4Q44A 3DRRA 3T5LA 3DRPA 4TSXA 1TK8A 1N56A 2BPGA 3AV9A 5KFZA 1LAVA 1BPDA 9ICNA 4B9SA 4LH5A 1WAFA 4RPZA 2PFPA 4M3ZA 4CEOA 3MXIA 4M41A 3M9NB 1NK8A 3LP1A 4KKOA 3TFRA 4ECYA 4O5EA 7ICIA 4CJUA 1RTIA 4FJ8A 1O1WA 4B9NA 1SL0A 3AA2A 3G6YA 4KREA 1JLQA 4UBBA 4F2SA 3K4GA 1S1VA 4FJHA 2I1QA 1C1BA 4JWMA 4GXIA 3DLHA 8ICYA 1JXLA
chains in the Genus database with same CATH superfamily
2P9GA 4CLYA 2JH1A 2PAVA 1U1KA 3ZX3A 5J0SA 1I94K 2O8CA 4JUZA 1ZQEA 3BUZB 4OV1A 4O0NA 2EC2A 1WEXA 1ZQRA 2QV6A 1ATSA 3HMJG 3CF5L 3H25A 1N61A 2P5OA 3MTJA 3AJ2A 1ITPA 1EXNA 2DF4B 4LVOP 4MMOA 4EP5A 2JC0A 2J4RA 3E58A 3GU0A 3AO2A 1EP4B 3VERA 4CJ4A 1YI2N 4DFDA 2WSEC 3OR2A 3GILA 2ZH5A 4W5QA 4DV5K 4URSA 5KFAA 4GVBB 4OX9F 7ICMA 4YOUA 4BVPA 4OJHA 2RUSA 2V0NA 4BR2A 4JV5K 1FRKA 3W7BA 1U1RA 4JI6F 2HBMA 3MMCA 1RZMA 4JN4A 4AQYF 5AKZA 1RT2B 4NJ8A 3JAMY 2MKJA 2W43A 3KG4A 8ICPA 4MH8A 3IP4B 4F36A 4PQUB 1F21A 5AQQA 1NB7A 2KB2A 2IRYA 2HMIA 1KEKA 1SH0A 3SK3A 1NJIO 3Q86A 4NZ7A 1J2NA 5LJ5Y 1FF2A 4DLGA 3NGKA 1UMJA 2F8TA 4QS7A 1IBLK 1D9FA 2NRTA 3M2VA 2QO3A 2B8QA 4WE1A 3H5YA 2DNZA 4JKBA 3UD3P 3RMAA 2FHJD 1T3VA 4F72A 4Z2XA 1BOTO 2CZVC 2JZBA 2HAFA 5BRDA 2V50A 3N7PD 2BTFA 1A5VA 4OZLA 3SUPA 4DTRA 4PR6A 2HOIA 1PK3A 1Z4NA 4Y2UA 4CLZA 2YHWA 4B9VA 3E8OA 4XTTA 3U4LA 4XH1A 1U8WA 2F44A 2OPQA 2RUGA 2NRXA 1RT6B 2EKNA 1ZQXA 2GELA 4EELA 2QMUB 4RUHA 4DFMA 2AEFA 2KOBA 3SDEB 1V4SA 1ZBUA 2HEKA 4ZLNA 2LEAA 1ZQUA 3U02A 2DFLA 2CPEA 3S9HA 2WUSA 3QQCD 2X78A 1LEOA 4ZPVR 4EMDA 2EFPA 3H7HB 4NPOA 2V9WA 1WC5A 3LW5C 2Q6CA 3FZMA 2LXFA 6FD1A 4DHVA 1FJEB 1RDAA 2HBJA 1WG8A 3DYAB 4CNQA 3QXGA 4GC6A 4UF4A 2J0WA 2EBGA 2XNRA 2I8EA 2ZD1B 2G07A 3L8BA 4K41A 3L9ZA 5J2NB 4DR1K 4CLWA 4CF0A 2VQFK 2MKSA 3MGHA 1I3OB 2ZIXB 1F5SA 3KOAA 3PHTA 3WNHA 2QZ8A 5C25A 2MZJA 3E51A 1TKZB 4QYRA 4ES3A 2Y8WA 4O5FA 2V8PA 3ZLJA 3H2VE 3ZT4A 5E5NA 3DRSB 4DCJB 4IS7A 1VJWA 2ILZA 3LZJA 4P2FA 4OLOA 3TTDA 3ZTOA 1VQNN 4V19J 2AYGA 1U47A 3H42A 4ID8A 4BC3A 4IKAA 3RAMA 4Y2IA 1K6YA 3NNAA 3I9ZA 3VQDA 4A8OA 3CDBA 3HO1A 4LREA 4LQ3A 5J0XA 4RW6B 4Y2SA 4U9RA 3R2DJ 2BQRA 2IVMA 4YXJA 3QNNA 2XS5A 4RUBA 2YX7A 2XULA 1SJQA 3PX4A 9ICKA 4YNQA 1VQYA 1PILA 1IBLJ 2DRBA 4CGJA 3MEGB 2QW9A 1XMBA 3ITHA 2A2DA 3K8VA 1URNA 2ACMA 2HHWA 2K06A 1Z26A 5KFOA 2BKNA 3QLHB 1OXJA 1S48A 2AYMA 1T9UA 2F9WA 2HQ3A 3DLJA 4LF6F 3Q0AA 2M8HA 3DLKA 1BI4B 1N8RO 1ZOTA 1L7NA 3ULHA 1UVJA 4JV5J 3ZC4A 4UY85 2W7PA 1SKUB 2KXHA 5D4OA 3KK7A 3QGIA 3UVJA 3L3FX 2CFXA 4HH1A 2VWJA 3CFRA 4F5NA 1JLQB 8ICOA 2IVFB 4K42A 2XWXA 5C24A 3WNGA 3CMEN 4UASA 1XS9D 3VQ4A 2C2MB 2CPHA 1S9GA 3ZDBA 4M47A 2GW8A 1HR0J 2UVWA 1VSIA 1L3KA 3KJQB 2HBQB 1XR5A 3M05A 4FLYA 1F0XA 2OA8A 4WIIA 1QSLA 3VGUA 4JOUA 4AYBC 3H0MB 3RZAA 1R6VA 1TYQA 2IM3A 3KYLA 2RILA 2YCHA 4IKFA 5ADZA 3MMVA 1ECWA 3OVSA 3H8SA 3D7EO 4GO5X 4CLSA 4DLEA 1LOUA 2BA9A 1A77A 4KGXB 3DLEA 3CJQA 4RQ2A 3IG1A 1P9QC 1ZBFA 2YBVA 2Q36A 1NCLA 3ZXWA 2K3KA 4JI2F 4M3XA 4A8WA 1TVRA 4BRCA 2BPCA 5CB1A 5CHIA 4NCGA 5ALMA 4PQUA 4LF5J 1LFWA 2W01A 3NKYA 3AAWB 5ETTA 4YOTA 4F5OA 2GJ2A 3G96A 3W5YA 4RPFA 1WWVA 3QT6A 3JXOA 2R8HA 2BVZA 2AHOB 1S4EA 2FYXA 3MMCB 4BRHA 4YG2A 4DSEA 5L1JA 3KKFA 2D0AA 1NAQA 3DDNA 3PYGA 2I2YA 2ACYA 2F8MA 2Y1IA 1CXQA 2RHQB 3BN7A 9ICFA 3LP0A 3SV3A 3J81Y 1OUQA 4E7KA 2NSBA 4CE9A 3SIPB 1KKXA 2V6AA 5IIKA 3PEJA 1QCKA 5J2GA 4K8ZA 2GHVC 1QAXA 1UEKA 5GAGI 4USKA 3RJFA 4ZCLA 4DV0F 1NGIA 3IBFB 4CBWA 2YX6A 1FWLA 3D67A 2ZJPL 2HHUA 3EUNA 5I9EB 3DC2A 4UTGA 4B9TA 1Q8IA 1UZHA 1FFGB 2RDDA 1BD6A 1Q86T 3ZSOA 1YHQN 1CC7A 2ASLA 2QSFA 2K89A 1WKLA 2YHYA 1X6JA 4MK8A 1PVQA 2K4PA 4KLMA 2BANB 3AEVA 3RGIA 3OYJA 1VQ6N 3TSPA 4LF9J 5J0PA 3K0SA 2CNOB 4A8YA 4KN7A 1DARA 2EI5A 3C29A 3KZBA 1EZZB 4QCLA 4OZ3A 1HKBA 1KN5A 1X6IA 1E3MA 3ED5A 2CXEA 1HL6A 4E7IA 1XR6A 4IOAL 4A8FA 4TQRA 4QWBA 3U27A 4ZPBA 2Z56B 3LP2B 1WOOA 2CWXA 3KLHA 3N4QA 3GJQB 1XNQF 2CDRB 4PPZA 3TZZA 3K59A 3WQUA 3QEWA 4NYOA 3IAM9 2D3DA 4DFKA 4YOEA 4Y1CA 4D3HA 1ELOA 1HIWA 2IDOA 1GAOA 2HWIA 4GC7A 3I96A 2KJ8A 3NH1A 2OD4A 3ILLA 5GAEI 3PM9A 3E66A 3MM5B 4CBXA 4CH0S 4B3SK 5HMXA 5AQPA 3EZUA 1HBNB 3GG4A 3L4IA 2YQ0A 1ZQIA 2H5EA 5FPDA 2E7WA 4WPAA 4WYBA 4I6AA 2D9PA 5IT9O 4WIQA 4IG0A 3A0BU 4M9JA 2Q97A 3CJAA 4CEZA 3ZZZA 2OYQA 3Q8UA 1VBZA 4BE1A 3HVTA 1R0BG 3NASA 1S1TB 4ZHRB 4I29A 3E3XA 3KLIA 2NYIA 3UPFA 3LM2A 1HNIB 3GCWP 4RQMA 1HW8A 2WB1D 3C15B 2LXUA 2CAJA 3L7PA 1VQNS 5IWAF 4JYAK 1VS3A 3VAMA 2P9SA 2DXDA 1GMUA 2BQUA 2OYYA 2XB2D 1WYGA 3BS5A 1KBUA 4FYYB 3QLHA 1LXJA 1BWEA 5DK5A 3UCUP 1GOBA 3THYA 2X1GA 5JMNA 3ZTSA 4EHUA 5AKIA 2LM4A 1O0PA 3PW7A 5BREA 3PSPA 1Q5YA 2XMWA 4FVUA 2V4JB 1F2GA 4PPXA 2AA4A 1JKHB 3P1GA 1MWMA 1Q86O 1F0MA 2EZZA 3QT5A 4RU9A 4DX8H 5J2QB 3PZPA 3JPTA 3MHYA 2ROEA 4A47A 1PIEA 2BJEA 2J0XA 5HQ8A 1KWMA 4FWOA 1T9WA 3ZSXA 2CXYA 4BHQA 4ACOA 1UJ5A 4IRCA 4OL8A 1S7HA 1BVSA 3LGMA 1XN9A 3C7NA 4NB4A 1VRUA 4OPJA 2PFOA 1U2CA 3G86A 2JVOA 1YTYA 1ZQQA 4WF9L 4NXMJ 4TUQA 4P7TA 4CJSA 4DB3A 3VQ8A 2E5LK 3QEXA 3NDKA 4OHYA 1HR0F 1X0PA 1U1PA 4EAHD 3CCSS 4X4SA 5AKEA 4DTUA 2CRXA 3B8AX 3PSTA 1W7AA 1G7CB 3QNMA 1A6LA 2Z0GA 4F4XA 4P6QA 3BSNA 4OMFG 4FN5A 2NXJA 4AL6A 2O8BB 3M6KA 3AARA 2QXFA 2E8OA 4KT0C 1BHLA 2ZEJA 1SL1A 4X64J 4QZFA 4JLHA 4RNMA 2KVSA 2YKNB 4FJ7A 4TUPA 3RRGA 2OFGX 3FBEA 3SUNA 2R8GA 4UB8U 2KT5A 4NCAA 1QUPA 2CQ1A 2BRLA 3LYSA 1S57A 2NO5A 2B4PA 4ERDA 3T6BA 2J9DA 1KEJA 4DR3F 2A6OA 5AI0A 2F8LA 1MROB 2GZOA 3H3NO 3I82A 1AUDA 3M8QB 1KOHA 3E9PA 3G4SN 4P9SA 3IRXA 4DUYK 1NI3A 4YMMA 2J76E 3A13A 5CHCB 4LZGA 2QWLA 1NGAA 1N32K 2DVIA 2HF4A 4FOEA 2FGOA 1CLFA 4Z6DA 2UVRA 2VQEF 3SCKE 3ZT2A 3SI6A 2UUCJ 4FK0A 5JXSA 3QIPB 4LSNA 2ITMA 3W60A 3THTA 2LQJA 1M5PC 2H4WB 1YRXA 4OYMA 4CFAA 3CJ5A 2E9RX 4PHTX 3ENHA 3J7AP 5D6GA 2XMTA 3H0LB 5E3CA 3C7NB 4AFFA 4CO0A 1MN8A 1ZQDA 2G1HA 1KNZA 2CVIA 1FRHA 1WD6A 4PCQA 1N34F 1FFWB 3ZEUB 2V8HA 4Z7CA 3HP6A 4JK8A 3RVCA 1SCJB 1NLVA 1F1BB 4NEYA 5IIOA 4NYZA 4CJQA 4FJKA 2RDJA 1Q0NA 1S72N 4NLVA 5JU5A 3M2RB 1UW9A 1TUWA 4O5BA 4WFAQ 5AZJB 1IJFB 1D1UA 3CJTA 5LSOA 2P5GA 3R5GA 1R89A 4F4AA 4GNIA 3QB0A 2W11A 4CJVA 4AF1A 3DI6B 3EMTA 4JK7A 1F3FA 2J5AA 3R2CJ 1TU0B 3AN1A 3ZZYA 1YIJS 1CJUB 2ZC4A 1QHAA 2JV3A 1HBUB 2F8EX 4Q7AA 2YV0X 2RS8A 3UNYA 4ZLPA 1RA7A 2ASDA 2X6NA 2ZOGA 4J2BA 8ICAA 3OW2R 3Q8KA 1F6TA 3S01A 3RR7A 3RR8A 3R7NB 1U9LA 4GIBA 2PO4A 5AQTA 2E4LA 2E29A 4RWXA 1LCUA 4AQYK 4FXVA 2RMLA 4KHYA 2VZ9A 2AJ4A 3PXGa 1BDGA 3QIDA 3T1YK 3PYFA 4KH4A 3L7OA 4ZPTR 1HI8A 2B4JA 2CH6A 4W5NA 1FJ7A 4RW4A 5HRRA 3RMCA 3EWGA 2E1CA 4FPAA 1REVB 3BPDA 5ETQA 2DPJA 2PZSA 1XWLA 4IEIA 5KG3A 1F2HA 1GLJO 2D6FC 5L9XA 8ICRA 3VR1A 1ZPWX 1ZQJA 3QJJA 2AX0A 2FUG9 1FDBA 2LP4A 4J9LA 3CERA 4KGVB 1IQTA 4FXDA 1IBKJ 3CC4N 4CK1A 1V38A 2XWYA 3HI9A 3QEIA 2U1AA 1NU4A 3O3HA 2GOLA 3P49B 1NK7A 3OTOJ 1SL2A 1OO0B 4CHQA 2LXIA 5LMNK 4QIFA 1SB6A 1WHVA 3HVTB 4M3RA 1ZQMA 4QIWF 4RW7B 1I1GA 4P73A 2UUBK 2C42A 5F41A 1X0FA 1FHTA 3ASMA 2O67A 1OJ4A 1FNOA 2GAGC 1B92A 4DSFA 1FJGF 3DWLA 1S6QB 3QBXA 3M7DA 1RQ0A 2FSNA 2HMPA 2VBXA 4FWKA 2DKOB 3NGUA 2ZIWA 4ISEA 2PEBA 1SXDA 2DKZA 2W9AA 1JXEA 2XI2A 4C8YA 4LD0A 1CQMA 3QRPA 3M1FA 2NZTA 1XU4A 3Q8VA 2UUCK 1WSHA 1HPZB 2BABA 4F2RA 4ZKAA 3C66A 3MPWA 2KH9A 3QT8A 4K5SA 4C0ZA 2G5HB 4AP9A 1JXVA 5J1PA 3KXDA 2CVEA 3NGIA 4CLPA 1FVQA 2NXUA 5CWRA 4QZBA 2HBKA 2W9BA 3V6JA 2GMJA 2F9DA 2MQMA 3ENVA 4C0BA 5EVZA 1U2RA 4LR8A 5MLCV 3WK6A 2YJFA 3V6DB 1ZXOA 1NDLA 4LFBK 4CI6A 1NG9A 3VQTA 2DEJA 3CE8A 3F53A 2UXBJ 4HACA 3C21A 2KEYA 2RH3A 4DR4K 5HQMA 3NF8A 4ZTJA 4PAAA 2DISA 9ATCB 1HWJA 4DMZA 1GLAG 2KFNA 3RU0A 1HKGA 4FM1A 1RCOB 2JC1A 4RX6A 2QA4G 4KFBB 2MUTB 5F1XA 3QETA 3ATUA 2F9JA 4MEYA 3R1XA 1SV4A 2UZAA 3J81U 4M3WA 3BS5B 4BWJA 2KKPA 4CJTA 5H1SQ 3PO5A 4KHUA 1NXIA 1HI0P 2W24A 1WOSA 3MM7B 2R8IA 1HPMA 2GBZA 1VMBA 4M95A 3TARA 2CNNB 5ELZA 1WKJA 1H38A 3W9JA 1X3MA 4BRGA 2KKVA 3W5ZA 2BJ9A 4K2XA 5ETVA 5AKYA 4IRKA 2ZHBA 4BC4A 4KLJA 3TADC 3VZHA 3V2UC 2P35A 4DTPA 4K4TA 1E4GT 4OYZA 3P5BP 3P5JA 7ICQA 2V4QA 3O80A 1U6FA 1LV5A 1ATNA 4CO1A 4C4TA 2GVDA 1AZSB 3GE1A 3FBFA 4FNHA 3UN2A 1HKAA 2ZZMA 2GLEA 3MM5A 3ZDEA 3UKRB 1DKGD 3Q89A 1UFLA 3SBGA 3D2WA 3ZTRA 2ZITA 3O1LA 3GCXP 4IOCL 4G1QA 5K14A 3TAMA 1ZBHA 2PYLA 1RDFA 1P90A 3EM1A 1KC8T 4LF6K 2ZDOA 3LPTA 1IUJA 5GTHU 1KFDA 3EE3A 1AROP 3HD2A 3W9HA 1JLAB 2W55A 3JAMU 4CGIA 5AICA 3SAHA 1Y7PA 1YQHA 5D4NA 1C1CA 4B3RF 4AHTA 1OY6A 2NV3A 4B3SF 3IRUA 4ECRA 3VEVA 4J2DA 3C6UA 3Q22A 5TKWA 1N6QA 3HK2A 3FGUA 1XEZA 3QFPA 4WFNL 1G99A 5KFJA 2OMOA 4IC9A 1RT5B 1P8GA 3OFHA 2CJAA 3AB2B 2V51B 3OSNA 1OKJA 2EANA 5CE3A 1Q8BA 2DBYA 1YKWA 4DPXA 4JKFA 2QKQA 3BGOP 5J1EB 3BN4A 3EGWB 1NK5A 2DT9A 5J0RA 2A19A 3NRWA 1VQ7S 3CCQS 4BDZA 4G1IA 2ITGA 3HCXA 1B99A 1VSKA 1C2PA 2QFIA 5ETLA 4H8KA 4F50A 8ICSA 5HRNA 1NDPA 1DHMA 4OIXA 2P6RA 3HJFA 7ICEA 5F9NA 1IXKA 5BYSA 5F0XA 4I2PB 2B51A 3K89A 2ZNZA 4I28A 1TUUA 5LOQA 1KFTA 3TAPA 1WSGA 3VA0A 3HSCA 3IBCB 2KV2A 2FDRA 1SZHA 5ALPA 1X1PA 4O0IA 1NZ8A 3Q23A 4DS5A 1FXXA 8ICGA 5M1KA 3G10A 1U2VB 1OSDA 1H7XA 2G5IB 2I1RA 3T5KA 2DNOA 3HOTA 7ICGA 3U9ZA 4CD1A 1KHWA 4ZJQA 1H2VZ 1C1AA 4CHYA 3GWCA 4IXCA 3EW9A 1P9YA 5CYQA 1NZBA 4MT1A 2C1EB 3HFVA 1D8BA 2GQ2A 4GVMA 2OPSB 5LY3A 4G6VB 5J2AA 5DZ7A 1T94A 2EC0A 4CM0A 2ZJQQ 1WJ9A 3ULEA 3DJCA 3GJSB 2D0BA 4UATA 2KRBA 2MPUA 4Y2JA 3IGNA 3KLEB 3GOIA 1RHKB 1WDDA 3FCHA 1DQ9A 4WFXA 5IS2A 4FF1A 1GH8A 2XQCA 1LWFB 2YNHA 3TP2A 2YMMA 2W2QP 5HHIA 1GLEG 2FC0A 3LP3A 3KUEA 3P3DA 2IA0A 1VSLA 4DZDA 3PX6A 1M90O 1JJ2M 3CJ2A 1WKKA 2GUPA 4KI4A 2NXCA 2Z2ZA 4NXNJ 4B3OA 1B0TA 4RW7A 1KDNA 1Z4OA 2H3EB 5H9FJ 2R8KA 4RZRA 2DNQA 5HMMA 4F3MA 2ZM6J 3D2EA 1SH2A 3KTQA 2HFUA 5AK5A 5CH7B 2W9CA 2H1YA 2NREA 4KI6A 5CHGA 5KFBA 3N6NA 1PC4A 4KMOB 4EZ6A 3C1YA 4QIVA 1KQSR 4RPXA 1AUSL 3RJJA 4ID1A 3L3VA 2J7KA 2ZGZA 2MQQA 2ZJAA 4DL0C 3QYPA 1MSWD 4XK8C 1DLOB 3SNNA 4EK2A 3CD6N 3HSZA 4B3MJ 1FRLA 2VU5A 2XLKA 5CR4A 4IG3B 1WN7A 2MKKA 4LFCJ 1IBKK 3CNQP 4Y3CA 4DR2K 1Q78A 2DH9A 1JWWA 4A2AA 1B9DA 3VQEA 5J2NA 4DV1J 5AK6A 3M8PA 1DRZA 4CFCA 2A42A 2NUUG 4GMKA 5HRSA 4YY3J 3IO1A 2DTUA 2O8EB 4BE2A 4Q0BA 4LF7J 2XCAA 1N5VA 1CC8A 3N4PA 3T79A 5J2KA 3NS6A 5KGWA 4Z6FA 2Z4PA 4CZLA 2BM0A 4UAZA 2BX6A 3KG0A 3M30B 3VC8A 4C7QA 3J7AN 3O5TB 3DXMA 4ZVOB 2VGMA 1XNRJ 5DBCA 5HK4A 4GKJJ 3NHGA 4WKYA 4C0HA 3D6RA 3F9MA 2PMHA 2PI5A 3EN9A 3WK9A 3HJVA 4DPYA 1L5UA 4C23A 3KVGA 1FEEA 5U47A 3QUQA 3AMZA 2E9ZA 3NLCA 2VG7A 1TV6A 3P8BB 4RW9A 1B0XA 1HEKA 4ES1A 1KVAA 1OH6A 4URGA 3HSTB 4NMXA 3AO4A 3SSRA 4FZMA 3MAHA 2YJEA 2ESEA 3UCGA 4IDHA 2HWTA 4B1WB 1ZQYA 3CMAN 4DMNA 5KFUA 8ICMA 2LU2A 4QZAA 4ES2A 2BUNA 3G82A 4FYXB 2HLUA 5BRFA 5C25B 2FJ6A 1X4CA 3PNCA 3H5UA 2ZJRQ 5ALIA 3RB0A 4ZPAA 1NGHA 3PACA 2CDQA 4I7FB 2CQGA 4NM2A 7FD1A 4LBHA 3B0YA 1NGFA 2CQ2A 2RHSB 3NGZA 3PX0A 2UU9F 3KLFA 1RACB 3HVWA 4Y2MA 4EP4A 3DU6A 2WF9A 4LFBJ 2DGZA 4CJKA 4DFJA 7ICJA 2QA1A 3MCOA 3B6BA 3DLRA 3OR1B 2IM0A 4JI1J 2HBLA 5ALLA 5J2DA 3D1OA 1TL5A 3DLBA 3EO3A 5BOMA 3ZZRA 4YOYA 1U0HA 4DV6J 3B9JA 2F7TA 5G5GA 1LW2A 4B9LA 3TUPA 4P0PA 2QTDA 1RWVB 3KMQA 2Y0SC 4JYAJ 1RADB 1Z05A 2B4VA 2Z1JA 4EENA 1S6PB 2W7AA 3O8WA 2VFUA 5A2QO 2LHTA 2E2NA 4HR2A 3H4DA 4JV2A 4P0QB 3GFHA 1U1QA 4J9RA 4FZXC 2VV5A 3V9WA 3ENBA 4DR5F 4ZVFA 3ULEB 4KBIA 4RQ1A 4NCGB 2VKQA 1L3SA 2OPSA 3AA3A 5FLXO 3BQ2A 5KPTA 2KG5A 3AM9A 3LVVA 2OD6A 4TNOA 5KT6A 4K50A 2A2CA 3TKAA 3C14B 2JH7A 4KH6A 2OPPA 1WF2A 3H20A 3GFYA 2C3UA 9ICQA 2B6AA 4B8AB 3R6LB 3O08A 2E1PA 4L73A 4IWVA 1TAQA 1U0HB 4KO0B 3R9LA 2MJUA 2M5YA 1CZAN 3AVFA 5DRKA 3NF6A 3QDKA 3GV8B 2CPYA 3POTA 4CEQA 1U48A 2B4OA 4FO0A 1VSJA 5HROA 3WBZA 1K1QA 4PYDA 4B3TJ 4ZOSA 2RPIA 3I28A 2QKKA 5C42A 3F2DA 4RW4B 4OZ5A 4Y0FA 1XK8A 4HT5A 4XPCA 3BH7B 4JI3J 2YMLA 1ZQFA 5DG8A 5E41A 5EE9A 1QTMA 3JS6A 4YN4A 5G5HA 3HXMA 5M2PA 1J9AA 4CJEA 4HUEA 3SZ2A 4PZOA 3N4MB 3L2VA 2VQEJ 5L9NA 5EUHA 1UOCA 2HMIB 5F8MA 1A5XA 4ECVA 2HPUA 3NMAA 3WXJA 5A8KA 2QKBA 1X9XA 4ED6A 1QAJA 2B9XA 3P6YC 3IUCA 3OBWA 5LL6Z 3O6WA 5KFCA 4OX7A 3NMRA 3GV7B 2RHKA 2A3VA 4CF5A 4OCZA 1VQKS 4MTPA 4KV8A 2DB1A 2C3YA 5KPZA 4OYPA 2QG9B 3DCAA 4U96A 1NKBA 3ETOA 1BI4A 3H2UB 1EKRA 1Q79A 3G0ZA 3LDAA 4BQZA 3CQXA 2NUBA 3Q7CA 2L08A 2ATQA 4ED4A 4ZPCA 3C1ZA 3UMCA 4PHAA 1T0TV 2YI1A 4MKYA 4QWAA 3ZSYA 4DV6K 5ETSA 3O3LA 2BYCA 5I3UA 2P9NA 1TL3B 2YKMA 3KMSA 5K8OA 1CS4B 5AT1B 4DR5J 1TUGB 2X7IA 2OM6A 2I0XA 1XI1A 3UN3A 4I7FA 1ZQVA 2LA4A 2FSJA 3LK9A 3QUBA 2O8FB 3OL8A 1ZM2A 3UQ2A 4GXKA 5DDYA 3M2UA 2HGMA 3KFUF 1VBKA 5IC6B 4JI8F 4QIGA 4CTAA 1R8BA 1U8SA 2FLOA 3PHEA 1RXWA 7ICNA 5J8YC 3MXHP 1YK9A 4IFYA 8RUCA 2MYFA 2PFDA 3BKUA 1U1NA 2AYBA 2GIQA 2XY8A 4I67A 3BO3A 1VJQA 4TLQA 1JLGA 2E8AA 4AXJA 1KXPA 1XIQA 2IRXA 3HM8A 2J9CA 4DTJA 3KWGA 9ICXA 2XMMA 4DU1A 2GVZA 3IDWA 1WWUA 5BPLA 3K75D 3GYNA 2OTLN 3CIZA 3QIOA 1QQ5A 1ZBTA 4FO6A 2HKEA 4I68A 1M5SA 4F5PA 1NNLA 4PPDA 1IKWB 2A3ZA 5CP2A 2F4FA 3CXCR 4KQZA 4FWPA 1N0VC 3CVKA 1OQ6A 4LSZB 3MWTA 2F40A 2QLJB 5T14A 4DV5F 1FD8A 2ZJRL 2K8GA 3MN5A 1HNXF 3RH6A 5K8NA 3VGSA 3ZX2A 2KJ9A 1HQUB 3LPUA 2WMMA 5B0GA 3T5LA 3D4JA 3DRPA 4TSXA 2WF7A 1OY8A 3DHXA 2LI6A 1QVFM 3AV9A 2RIJA 1LAVA 1JK9B 4B9SA 2ZUGA 2KHOA 2V9KA 5DM6L 4LJXA 3PYDA 1NK8A 2OTJN 3LP1A 4KKOA 4O5EA 1O1WA 3MEDB 4ZVEA 4Y28C 2GMHA 1PAEX 2VYPA 3DXSX 3AA2A 3G6YA 4KREA 1QTNB 2XHCA 2WF6A 4F2SA 2NO4A 2VD3A 1FWKA 1YBTA 3R5DA 4P0PB 4Y2QA 1R8AA 3DLHA 1QJHA 4JI5J 3PSIA 5KG5A 1FD2A 2HW3A 4FWMA 1YSJA 2Q0ZX 1XC3A 4HLBA 5SWMA 5ALTA 1U1LA 5KG0A 4MKBA 1XNQJ 1XQSC 1SZPA 5ETOA 3S7RA 2ZOFA 2ZH3A 1S77D 2AMCB 1NZPA 3R6GB 2HBYB 1TZ0A 1B70B 3BYRA 2MEWA 3GPAA 1TMJA 2XEXA 3Q8PB 4FWNA 3HHKA 3UIQA 5J2CA 4OHXA 2MAXA 4HTUA 3TUZC 1X5SA 1ZQGA 2O4IA 2O66A 4XAKA 3JYTB 1PG5B 4I2HA 1TKXB 2CA9A 3IKMA 4A2BA 3H40A 3S1TA 3EZOA 1KTVA 4LF7K 2YMQA 3P38A 1SV0A 4YY3K 2G0IA 2JEIA 4NM1A 4K7QA 3FFIB 4C8OA 3GJRB 4BR5A 3V9ZA 5IT4A 2GGPA 4J2EA 4I4BA 2GX9A 4A8MP 1U4BA 2FSKA 1RYUA 4ER8A 1EARA 4DL6A 3F2BA 3OA9A 1HWUA 3FAHA 2JR5A 3W2WA 4KMUA 1Y5LB 2BMBA 1VQLN 1T03B 3MM9A 3MAQA 4Y2RA 5AKHA 1S8OA 5KG4A 2GJIA 1ZAWA 2ZBQA 4NLBA 2CRLA 2HHPA 3PR5B 4WFZA 4QW9A 3MUTP 4OZ1A 1S22A 3F5TA 3V9SA 4DG1B 2DGWA 4Z0UA 1S97A 3MN9A 1SV0C 1L3UA 2AX1A 3R8YA 4F3QA 2DNLA 2EBEA 2F8HA 4NI2B 4CIEA 4U6PA 5AZIA 5B08A 3J7YP 2CGKA 1WCLA 2L41A 1FKOB 4L3QA 1RQNA 1MMDA 3TABA 3EZ5A 5CZVA 1I3AA 4JV0A 1XMQF 1FCAA 1ZQKA 1WG1A 3J81O 2MDAA 2OEMA 1BUPA 3CCUN 1AT1B 3OTOF 5D77A 4QQBA 8ICEA 3OYAA 2KSOA 4LSLB 3H7IA 4R8UB 5L1LA 3V7KA 3UE2A 3QJPA 3ONQA 4E7HA 4JBCA 4I6MA 1ZRNA 2IOCA 4C4RA 3CCTA 3LO3A 1VQ9S 4MYUA 3ALYA 5EWGA 3RSEB 1NOMA 3UPQA 3RUBL 3TJAA 5M1QA 1OYEA 4DSIA 3JSYA 1IM6A 4QPXA 3KJFB 2ZBRA 4LIRA 4DV5J 4KLEA 3PMLA 4NA1A 3NWRA 5A8RB 4FLVA 4AUKA 2FY1A 2FBYA 5KGXA 4X64K 1RHJB 4JI8K 2P9KB 1UJ6A 4CJ3A 1S4FA 5HNKA 2ZH2A 4BDYA 1IKXB 2KP7A 1Q4RA 4QIWD 4HVJA 2KJ5A 3CM5A 1RTDA 3BF4A 4DDFA 2N1RA 2Z7JA 3S6EA 5HP4A 4G3IA 5C7PA 2F4VK 4OJ6A 9ICWA 4L75A 1U7LA 2WHOA 5HMWA 1HNWF 1U6BA 2H51B 5JVHL 3BS7A 3SBMA 4QS9A 2HIYA 3M8ZA 1DGKN 4KHPK 3G6ES 2WSCC 4QZCA 4WQ4C 2CPJA 2XS2A 3T41A 5JRTA 5CABA 4I9QA 3C2LA 2FLNA 3K5NA 2IA6A 4CVNE 3LGNA 1BLUA 1NJXA 1SIJA 4B6JA 2XZDB 3BBBA 3UM9A 1O08A 3AO1A 4DV3F 2RJZA 1S0OA 1EKEA 2HG4A 2E6LA 1WC3A 5AQOA 1N48A 5KFEA 1R8PA 4I6YA 5AXLA 3LQVA 2BEFA 3ZZTA 1BHNA 3U3YA 3CC2S 1RKJA 3H3OB 4I56A 5EHHA 1YJ9S 4ED0A 3PDNA 3ONNA 5D0HA 3X3UA 2CGLA 4JI0K 1KTQA 2LSNA 3N6LA 2CQPA 4CJFA 3ZD8A 2BDPA 3QRRA 3CJ4A 3CCLS 3VA3A 4J5OA 8ICTA 1FX4A 3QFWA 1IXRA 4CTAB 2H48B 3MAAA 3FBCA 2XGQA 4DR6J 4NWIA 9ICVA 1FVSA 1ED1A 5JICA 1K73T 4M04A 2LU1A 2MKHA 1J5EK 4FNIA 4RTFD 4PRFA 3K1ZA 1IN0A 1C0TB 4W5TA 2QWOA 2BCVA 2HVEA 3NP5A 4RLEA 3ZSRA 4DUYJ 4HHTA 4NY8A 3I4PA 3CJKB 5F8LA 3CI5A 3RTVA 2K8BB 3C5FA 2AQ4A 3HKZD 4KHRA 1VSHA 4M8LA 1TK5A 2KI2A 8ICNA 4BR4A 4Y2XA 5FDLB 3QGHA 1JLFA 4DPUA 4JD2B 3HILA 3T1YJ 3OQ2A 5D0RA 5ALYA 2H3QA 2P66A 5CCMA 4GKKJ 4CEFA 3A8JA 4XA5A 1DGJA 1NJIT 3AO3A 2PMWA 4O0JA 3IS9B 4JKGA 2JL9A 3IG5A 2BCQA 3HOSA 5DM7Q 5ALZA 4FJ5A 1X4FA 2IOFK 2KN4A 2NRWA 2HYIB 4DR1F 1UWAA 1XHZA 1E6YA 4CHNA 2RVJA 1CUKA 5AQGA 2A1SA 4KSEB 2P8IA 3NVZA 2H65B 1VDHA 2DIVA 2C3PA 3IAYA 4FJJA 1WHYA 2EG1A 3V4MA 5L46A 1UA1A 1W97L 3ZX0A 2DYAA 4PKHA 2E44A 3NGSA 3CJCA 1ZQ1C 2YWHA 3WK8A 4CECA 1KQSM 3IM1A 2K1RB 1T03A 3FZHA 3PIOQ 9ICPA 1SC4B 3PTWA 4PJ0U 1IO2A 2BM1A 2A1RA 4QIEA 4TYBA 1EWRA 1HUZA 2GO7A 3PEHA 1X8DA 1YITS 3AO5A 5HQLA 1K8KB 3MX5A 1FO4A 1VHIA 4OYAA 1UETA 2YH0A 1HRHA 3NH2A 1ZQPA 3KJVB 2M0NA 2YKOA 3OYDA 3CULA 4O5CA 2JRSA 2UXDF 1HJPA 3EPIA 2ZIVB 3OBIA 2BCRA 4HWIA 5LXRA 3MEEA 1Z4UA 5ALXA 1D8ZA 1QAIA 2V2VA 1JJ2R 3ILOA 2A1BA 2UXCF 4JHDA 2J0QD 1N54B 7ICFA 4PXDA 3GSIA 1XMQJ 1CJKB 3TO8A 3BGLA 2QN6B 1HR0K 2OIHA 4XDDA 4M0AA 1QVGM 4UAVA 1V5VA 1RFQA 2QEXN 4ZDNA 2UUBF 2OLWA 2X1FA 3ZT1A 1LKZA 1TL7B 4X4RA 1S99A 1CG2A 4UB3A 3FZFA 3O9SA 2KTQA 4OZ0A 4B1YB 4M3TA 1VK3A 1JLBB 4KLDA 3I0RB 3VVUA 3MM7A 2IY5B 1ZAVA 4CT8A 2C3OA 4O44B 4CRJA 4H5TA 4JI2J 3O3FA 3V9UA 3HHDA 4JI7J 4H54A 4KE5A 4KLOA 2B6AB 4ILRA 1ZM9A 5JS1A 1VQOS 3B8HA 1YJ9N 4CNYA 3AVNA 5I4MA 3OW2M 4ZIWA 2FE9A 2HOQA 3L4PA 4PZNA 4AYBF 3ISDA 4OX6A 4OKJA 1RLDA 3TVZA 4F25A 4UAYA 5KFXA 3CJRA 4Q45A 2FHOB 1UAXA 3I56S 4DPTA 4BGBA 2KU7A 2YQ1A 1FKAF 2ZUAA 2W1BA 4RQ3A 4ZVUB 4J9SA 5E3AA 4YB5A 7FDRA 5HL7L 4MAKA 4JRPA 4ZH4A 2LDIA 3H6EA 5IV3A 2MUTA 3QYYA 2YKPA 2RHFA 1X5TA 4I2QB 3LPYA 3LVWA 1HW9A 4GY2B 1T3OA 2YNGA 3TOQA 4BBYA 3A5LC 5J2FA 2MLXA 1FKPB 3BQ7A 3JSMA 4J9UE 4V19S 3LDLA 3T9NA 3PKYA 2DHGA 3NGTA 2MKYA 2ZWHA 3Q8RB 3SQGA 4AXIA 3CT9A 4DR7K 3D2FA 1NLKL 3UR3C 2C2ZB 4EFHA 3RJMB 1JI7A 4CDGA 2E8MA 4UQTA 8ICJA 1IWGA 3F56A 2PEHA 2OP5A 7ICSA 2V2QA 3OLBA 2KG0A 4C7YA 3HHLB 1R43A 3NGRA 3UKUA 4FM2A 3NS7B 4WK1A 3W2VB 3M8PB 2V34A 3IHQB 4ZCIA 5EX5A 2QB0B 4USUA 3VOVA 5IQ6A 4FBUA 4PG4A 2CPZA 5KFFA 4K4SA 1RUSA 2AJQA 2ZIWB 1XO0A 2CJKA 3Q8LA 1O5JA 4FF4A 5BPMA 2IMOA 2F3JA 3IRWP 4DV7K 3WNEA 4ETZA 4KLGA 2J7UA 3V4IB 1KAYA 1Y88A 4CE6A 3K5PA 1XHXA 1EHWA 3OJUA 3TI0A 5ALDA 4N8NA 3RJIA 8ICUA 3OYIA 2AQ0A 4X66J 1NDCA 1J97A 2C2KB 5FLXU 2O3DA 2MTLA 4OJRA 4HAIA 3VAKA 3EY1A 2MSTA 1UEVA 3SSQA 4BRDA 3CMAS 1YVFA 3OXFA 5GMKa 3O4NA 4OI0A 3DXBA 4EBCA 1UWBB 5BPCA 3KUHA 3FVYA 1Z00B 3TWZA 4QWCA 4DTMA 5BYRA 3CPWM 2P2CB 3ZZOA 2RP5A 5KAKA 4WFBL 4DUZJ 3WQPA 4CH7A 1Z1BA 2E2OA 2KFZA 5IM0A 4DBQA 4DR6K 8ICBA 2GIRA 2XNQA 3BQ1A 3R97A 1CEZA 4JK9A 2KHVA 4ICLA 2DFFA 1WUDA 3C16A 3HHNB 3M6GA 4JI3F 3I33A 5JS2A 2HSTA 4LIWA 4J9PA 2IVNA 2EX3A 1YIJN 4JI8J 4RT3A 3RB4A 1WELA 3LA0A 4YMEA 3T7ZA 3HRDD 7AT1B 4NLZA 2VG6B 4YS2A 3C5GA 2RNEA 3L09A 2EFQA 3MEGA 2GCFA 1NGDA 1RG6A 1UVMA 3ITHB 3D2NA 1YDLA 1JJHA 4BQLA 1P6TA 2QYCA 2H54B 2YHXA 2JGAA 4I6MB 2IHNA 4JI0J 1BPBA 3GBTA 8ICXA 2BKOA 1BMQB 1HD0A 3MM8B 2NRZA 4BY9C 3E9LA 3PSFA 4NX9A 2Q4TA 4HTJA 1YBAA 7ICPA 3B82A 1J27A 5AI8A 1FIQA 3T9ZA 3QFUA 3V81B 1K0TA 5AK4A 3QSIA 1O51A 3M9MB 1TVRB 1YWXA 3JXUA 3SXLA 4O4RA 1WTFA 2Z30B 1RDRA 3CB4A 3C65A 5B09A 3A8IA 3CCEN 4IR1A 4AYBD 2V67A 1EQ0A 3CXCM 4ZIVA 3OYNA 5IT0A 3TAMB 1GLLO 2AIRB 4CK2A 3GU3A 5ALEA 3CJ8A 2HOEA 4FK4A 3CFOA 1JRPA 4E98A 5F3ZA 4X4QA 4WQ5C 1SKRA 2HAIA 3ELHA 3VPZA 3DRSA 2JGUA 1GOCA 1Y0HA 1RWPB 1NNEA 3NVMA 4FJIA 2A1AA 4GVEA 1TUVA 3KIOA 3FFIA 1CQNA 2CPFA 2GS8A 3M8QA 1IJEB 3M1YA 3FCVA 5H9EJ 4QS8A 5FROA 2Q3SA 3MMAB 4R64A 2MQNA 1SIZA 3K9JA 4EX7A 2G0AA 2V68A 2WONB 1NMEB 2WVEA 1HHTP 1S1XB 2OXOA 5H9FK 3FNNA 2PN6A 3LWMA 3UXPA 4AD6A 1IG6A 1Y4ZB 3F73A 3KHYA 4NL9A 3R27A 1D9AA 1NO8A 1I51B 3TAFA 4EZ9A 1YVUA 2CIMA 1HFEL 1O13A 5K9FA 3MM8A 5K20B 1T3NA 4P71A 2PFFB 1M90T 3QU2A 4U95A 1Q5VA 3G82B 1WC4A 3H8WA 4MO5A 2NCKL 3IM9A 2BCSA 3BGRB 2BOPA 1HNWK 1RT4B 2DJWA 2M4MA 3V9XA 1URJA 1DGSA 1VDVA 1SZ2A 3FEYB 3CCES 1SJRA 4L3KA 1RXVA 1FRXA 4NLNA 1YJWN 2Q0UA 4OHVA 2QX0A 4NLRA 3HPGA 1PJ7A 2DBBA 2VJUA 2E8PA 5EGYA 2W2NP 3OJSA 1W26A 2OPRA 4BRQA 4WWSA 1X2IA 2VFRA 3FK4A 4TY8A 4NLXA 3V6KA 1HBOB 1RGVA 4Z7YA 1NK6A 1KD1T 1UAWA 4LJMA 3TYTA 3M8RA 2HNYA 4USJC 1K0VA 4DV3J 1UEUA 4J9QA 4DV2J 2KICA 4F4YA 3MD3A 2QLXA 2UXCK 4H4OA 4LFBF 1WHXA 4LBPA 3MOJB 1UHUA 2R7SA 4GFJA 1UP1A 4M2YA 4IRDA 3MCNA 4H4MB 3DLLL 1W2BR 9ICEA 2FJBB 2Y3YA 1JLEB 3KK1B 3OHAA 4DXLA 2K7JA 3RBDA 4C3MA 3RF9A 3QEBZ 1XC9A 2RQ5A 5F3XB 2CPRA 3VGKA 1TE2A 4MEXA 2ZWPA 1PVRA 2MQOA 4C11B 3J7Z5 3A0HU 1HLWA 1T8EA 2FVSA 4NWBA 1JN3A 1FKOA 2MKCA 2HHQA 1FTRA 3SCIE 3TSQA 4Z4HA 3DRYA 4L6V3 4OYIA 3VQ6A 3M1VB 4PKIA 3WIVA 1BE4A 3CRXA 2OJ3A 4X84A 4MQ3A 1Y5IB 1VRTA 3VMFB 1KLMA 4ZVHA 2ZZTA 1P1LA 1U0SA 4Q0BB 1PZNA 5AK3A 1RBLA 2MXYA 2YWKA 1G15A 4ZMMA 2AWZA 1N36K 2XIDA 3NRBA 2AT1B 5KFSA 1BIUA 3JB9k 3WXKA 2JMGA 5KRSA 3GZ7A 3TEGA 4QIWC 2ASJA 3GONA 5C42B 1XNRF 2WSFC 6FDRA 4LF8K 3DGPB 4PABA 1G2EA 5AXNA 3MBYA 2KQ2A 1UVIA 3ID8A 4FLZA 1T9YA 2K8AA 4LRCA 1FNMA 3ADAC 2VHGA 4BX9C 1R59O 1NKEA 1HNZF 3MDCA 4PWDA 3WX8A 4IQVA 4M6WB 5JUMA 4DOZA 1RTZA 3AVMA 4KH5A 3RBZA 4FS1A 2PE8A 1WDTA 5DKWA 4ANCA 2DGTA 4KHNA 2B7CB 2Z57B 3B6OA 3OL6A 5LMUF 4DV7J 2Q1LA 3T69A 2QWQA 2BE2A 3GG1A 3RW7A 4CZIA 4DTNA 1HLUA 1SKSA 5D4PA 2ZXHA 2ZJ8A 4G1PA 5AZJA 1F9FA 3QGGA 3SQ4A 1ZQCA 2R2SA 3AVAA 8ICKA 2A5XA 3L2RA 3UWTA 2YTCA 3N7RC 2JWKA 1N5XA 3D2SA 2CNKB 4MFAA 1NEEA 1S72S 1KW4A 4UB2A 2VC1A 2B6GA 3MMAA 1RSCA 3F9KA 2W2MP 2YPZA 1Z6RA 1WSIA 2DL0A 3NCIA 3ZFVA 3MXJA 2OHDA 2X3GA 4ATNA 5F8IA 3TAEA 1RT1A 4USWA 1FXLA 3LH2S 1FEHA 2HQIA 3N0VA 3A8KA 1DY3A 4J03A 3PG9A 2MQPA 2E5SA 1C7YA 3CFPA 2JWNA 5L38A 4Y0WA 1JCEA 4PXBA 3NGYA 4DZ6A 3SCJE 5A8WA 3ET6A 4Q8EA 3K5LA 3W3DA 1C0UB 3MCMA 1RBVA 1A6SA 3IFEA 4HHJA 4DQPA 4KJIA 4KR0B 3VVTA 3V81A 1S1UA 4BRKA 2VANA 2M9NA 4M3UA 4ZVTB 2MZSA 3EYZA 3THXB 1DOQA 2F7VA 1EB0A 2JOQA 2E5GA 4I2EA 4NYNA 3G4SS 2QLWA 3C14A 4GKKF 3OD2A 1LXNA 3DOMB 4UOHA 2G08A 1J2MA 2RN2A 3L3CA 3DI6A 2E9TA 1MNEA 3D0IE 3ZZPA 2FBVA 3K58A 5AQHA 4N5SA 3WC0A 3BO4A 1MWZA 1RTDB 2PMZD 4IH6A 3N6MA 3OYCA 1ZYQA 4AHCA 4DQSA 4DSJA 4E3SA 4DUYF 2DGVA 1ASWA 3KD3A 3NY0A 4Z37A 2VQEK 3AL0B 3C2MA 1O6XA 2HHHF 2FY8A 2I6WA 4R0EA 1VC6A 3HHLD 2ATLA 1RT7A 4R63A 5AQIA 1UFWA 4DF8A 3AH6A 1L7OA 2UVVA 4WXWA 1RILA 2QA4S 2IHR1 3RSEA 1S10A 3IA0A 4J90A 3WQTA 1F60B 1Q82O 4YB1P 5KT3A 3I5CA 3H2LA 3V7LA 3D68A 4X2BA 1SPBP 1NUEA 2P9LB 1QZ5A 5HAOA 2DNRA 1X3NA 4QWEA 3CTRA 4R0JA 3NS5A 1J5EF 5ETPA 2FDNA 2H5XA 3DN9A 2IC3A 1RNHA 1WEYA 1ICEB 4PWUA 3JQJA 3SJHA 2ADBA 2HQCA 4F93B 1NMNA 3NNCA 4HI1A 5MLCQ 4X4VA 2JFKA 4Z6EA 1HWIA 5DQHA 2ZVSA 3WUHA 3K7RA 3IC1A 4LFAF 1GMWD 1HNZJ 2MQ8A 5RUBA 3GFXA 1UL3A 1VFJA 1VK0A 3D2QA 1UCNA 3IFRA 3AU6A 4ICAA 1UT8A 3I0SA 3SUQA 1PSDA 3AQFA 1TMMA 4HDHA 4IFVB 1L6NA 3ZNUA 3ZEUA 4WF9Q 4NA2A 2HNDB 3BREA 2DRDA 1I6JA 1J53A 5EWFA 4J9KA 2GQCA 3MURP 2VKRA 3HKZC 2HS0A 2Z8QA 5KQ8A 2Q43A 2B21A 2P1JA 2HHXA 1Y9OA 3T1HK 7ICVA 1JLEA 3KK1A 1ZTTA 5D3GB 3J7ZT 2ZHOA 4Y65A 2K60A 3SPZA 2ZWOA 2DFHA 2D0PA 3MPDA 1EIYB 5T41A 1TKDA 3B6PA 4B3RK 2VJ5A 4XIUA 1QE1B 4ANDA 2EVZA 3T1HF 1SQKA 2C2DA 4R25A 4ZVPB 3J7ZO 3HZ6A 1TR0A 1T02A 2R2RA 1Y97A 5AXKA 5A8RA 2FMPA 2XG8A 4DX6A 3MR3A 2W9BB 5AQKA 4FP9A 4UBCA 2V52B 1N88A 3CPWR 1UCVA 5KOXA 3RMDA 2B8PA 4DHYA 1HBOA 5AM3A 1F3VA 1KVJA 2FD2A 4OI1A 3EX7B 4GO7X 2IVYA 3FMBA 1LOTB 1LWCB 2OWOA 4KAZA 4CHPA 2OPRB 1Z2LA 1SJFA 2FPHX 5CD4H 2F1JA 4LFAK 3KFWX 3B78A 3QU7A 3EDQB 2XZTB 4O3NA 1J5OB 4I64A 1U1OA 5AI4A 4CDIA 3VETA 1I39A 1MA9B 1F44A 2D41A 4DQRA 2YPYA 1FKPA 2KMDA 2JH3A 2EFGA 1M1GA 2FMSA 4CI0B 4RCHA 2IDEA 2HVZA 3IGVA 1RAGB 3DNCA 2B56A 3WXLA 1RT3B 4DV4J 3QZ7A 2XMUA 3KG1A 4AE5A 2KVQE 2HK2A 3ZDCA 1YI2S 2UU9K 2ZIUA 3BKFA 3LP1B 5T7BA 2UXCJ 3V6DA 4DV2K 1ZM3A 4YOVA 5GMEA 1WC6A 3EVWA 4PXCA 2ZJQL 3ISND 1GLBG 4R66A 5J29A 2A40A 4CF3A 3V7JA 1RHQB 3BGFA 1NGJA 2OH2A 4CLTA 2ZM6F 2L9NA 3CC7N 5IV4A 1NJYA 2PFNA 5A0YA 2QEXS 3MN6A 4PKGA 5K5MA 3RH5A 1K44A 2RRBA 1RHRB 1TL1A 5KFLA 4X4OA 4XO0A 2J8AA 2B43A 1KAZA 1YJNS 4FZZA 4KH1B 4TVAB 1TV6B 4YY3F 1VLYA 4FOIA 3VEZA 2VDHA 2PMZC 1CRXA 3VALA 3MEDA 4CH1A 2BV3A 4N47A 4O8UA 2GEMA 1BQMB 2L9DA 3BSCA 4CLLA 1K8AO 1R0AA 4C11A 4HTLA 2DR5A 4LFCF 3M8SA 2XY7A 2W8KA 2WRMA 2MU2A 5MAOA 1VQ4N 3J81j 5A2QU 4YR0A 3QE9Y 2AJFE 4DQ8A 3OL7A 3CCMS 2BHNA 1T7PA 3QAEA 2E6MA 3H98A 1TV9A 2HFVA 3KWIA 5E26A 3H1QA 4Q2LA 2JEGA 2KKHA 3G25A 4LF2A 2EZYA 1NSKL 1YXQA 1BPYA 4LR7A 2HQFA 3TEHB 5DG7A 3GTYX 1VQKN 1O8BA 3SMSA 4U8VA 3KBBA 1U04A 5DETA 2AW0A 4OX9J 5D4LA 2P9KA 4YORA 1YJUA 3H90A 4TQSA 1X9SA 2XCPA 4JI2K 4ZCMA 3PIPQ 1YRUA 2UUTA 2NLXA 3R8EA 4BRIA 5J0QA 1COKA 3W0LA 2VB6A 1JIHA 1B0PA 3KKAC 4U7UK 4IG3A 4ECXA 1NH7A 4JKGB 4M5MA 4ZLJA 3F41A 4A57A 1TKTA 3ZO7A 4C8NA 1WF1A 4TURA 3PW0A 2G0JA 3U1NA 4LF9K 4LSLA 2DY4A 4DFPA 3SPYA 4P74A 1T05B 2FHMA 4OYOA 1C0FA 4A8XA 2BKPA 2JLEA 1ZC6A 4BREA 3O6QA 3ZT0A 1GO3F 1SC1B 1NOYA 1SWWA 9ICAA 2DGOA 5A0LA 1IKYA 4BRNA 1TL4A 5J2HA 4CO2A 5TKYA 1EQMA 5BOLA 3LANA 4NV0A 1BNPA 1CVJA 4LY7A 2F63A 5ALVA 1RTJA 2W9CB 4RJVA 3FBBA 3A3PB 2VFTA 3FEZA 1CS4A 2WAQF 4TU9A 5K8MA 3TACB 4A48A 1KAXA 5E3QA 4EGLA 3V4IA 2XHWA 4RNHA 3OT9A 3BQTA 1IG9A 5K14B 4EX6A 1S1UB 2W9MA 1BPZA 1TFRA 2E3TA 2XO7A 3IMQJ 1U45A 1QSYA 3KK2B 1M5VC 5J2JA 3UKRA 3EZWA 2ZIXA 1FW6A 2AJ0A 1RDBA 3ATVA 1JB0C 1URRA 5F2RA 4M5JA 5B0AA 2OTLS 3BQ0A 4XH4A 3VESA 2CADA 4CZJA 5CRXA 1WSFA 3FGVA 4JP8A 2YWFA 3SQGB 4P2HA 4LR9A 4USVA 1SV5B 2HZCA 5E3RA 2ASMA 3NVYA 2AV5A 1JJ4A 1Y5NB 3CCVS 3KD1E 2WVDA 5A8WB 2HS4A 9ICBA 1FERA 2JRZA 4QZ8A 3RBXA 2G09A 4M9LA 5KG7A 4ILGB 2K4IA 2D0OA 1DK3A 4LF8F 4BRFA 1S6UA 2VQFF 4F8RA 3RW6A 1H73A 1DJ0A 4R5PB 4CIGA 2NXNA 2AH5A 3HDSA 2P6UA 1EWQA 1JROA 3C6UB 4LF4K 1MN9A 4FW2A 3DGVA 3WKCA 4BG9A 4CM2A 5HVGA 1S12A 4O4GB 3G2XA 4PL1A 4P4MA 3I8DA 4CF9A 4K5RA 1FT8A 2F76X 2DO0A 3PJXA 4B3TF 1M0SA 3T19A 3TUJC 3DLLQ 3DMJA 1Z19A 1VIOA 5GTIU 5A76A 3LTOA 4B3MK 5AQMA 1KONA 3NG8A 4C6AA 4FJXA 3VAIA 1WORA 1ZTWA 4ED7A 2NZCA 9ICUA 2HRUA 1ASUA 1J2VA 4PGQA 3PUFA 4A62A 3LDQA 2AEMA 3MTKA 3KHHA 2VBZA 1BWFO 5DBBA 2YY3A 1CULA 2F9TA 1MN7A 1OIAA 3LM9A 3QJLA 3ZDAA 4RW8A 2N7CA 3NWGA 4CEAA 2DD8S 1U24A 2GGPB 4PHDA 2D8CA 1NBWA 1TK8A 3O9RA 2HZVA 2GMLA 4FZLA 9ICNA 2PFPA 2DNNA 3UB5A 4CEOA 4FSVA 2OGUA 4YB7A 4DR2J 1U6ZA 1A0OB 3UN5A 7ICIA 4FJ8A 1YJRA 5FIIA 1SJ1A 4B9NA 4KHMA 4H03B 2FVCA 4WFNQ 3E9OA 2AP6A 5AKKA 4UBBA 2OSRA 2PA3A 2E5LF 3WK7A 3O9TA 3GIRA 4DU7A 4GXIA 2QL7B 3QBCA 3J7YU 1PK1A 8ICYA 3R5JB 3RAQA 3SAGA 3P39A 1D09B 2MHEA 4BS2A 2BJ7A 3BZCA 3DXKA 1K8KA 1BUXA 4ANEA 4RNNA 1RHMB 4ZP9A 2Q66A 3CCUS 3KJVA 3NCRA 3GV5B 2BJ8A 2QWNA 2ILYA 3AA8A 3ZNJ1 2IC3B 2XICA 1UVKA 4KLFA 1MA7A 5F9LA 1RYSA 2XMJA 5GAHU 3FJ2A 4ED3A 2MQLA 2FJWA 1HQEA 3W2WB 5CYJA 3R1LA 1MW7A 4C9DA 2E2PA 1IQZA 5KFYA 5HR6A 3P96A 4KB7A 2DUYA 2HGNA 2G2ZA 3EXCX 1S1TA 2BZFA 2LQ9A 4IO9L 2GAHC 5BXIA 1NSAA 3B4DA 3BB5A 2Z1HA 3SQOP 5BN8A 9ICRA 3KDNA 1HUXA 1XQIA 4HI2A 2BBEA 2VOPA 5BR8J 1DLOA 4DL2A 4DOCA 4GVLA 5IWAJ 1U26A 4ECSA 2H3VA 3AOAA 2DR6A 3DDKA 4KYZA 1C0MA 5A6WA 1VHXA 1T9XA 3HSGA 2HIQA 3BR8A 1ASVA 1S1XA 1B3TA 3I0RA 1V6HA 1T11A 5KFNA 1N33K 2P9EA 3MZIA 1HYVA 1KR4A 3BKTA 4RQ5A 2ZF5O 2O1PA 4OHZA 3EL2A 2R18A 1RTIB 5AR0A 4E89A 1WEZA 1U09A 3HD1A 4QWDA 3QO9A 3IMXA 3A4TA 3L7UA 4JKEA 3PW4A 5BPNA 1FJCA 4GVBA 4UT4A 3R5CA 4OYBA 4JI0F 3QGPA 1OY9A 2KM8B 4LF4F 3W62A 2FJAB 2FVPA 5D15A 3OTCA 3HTVA 4K4WA 3NMUA 1NPPA 2JSXA 3P5TL 4DV1F 1RE1B 3HYFA 9ICHA 4X65J 2K2PA 1X5OA 2ZIVA 2OMLA 5E79U 2NUHA 3EGNA 4WTYA 3DOKB 3C8YA 3ILJA 3L2WA 1IG8A 4C1NI 4C8MA 2Y1RI 5J2EA 5DBAA 4DWIA 3RB6A 3JS9A 2KE7A 5KFPA 1S1WB 1MU2B 1HYSB 1RGIA 4FL9A 1DT9A 1YAGA 2KJWA 4F04B 1EO1A 4FFDA 4CYUA 2LFVA 4L3NA 3QU5A 2APOA 3TANA 2JLGA 1IBCB 4Y00A 3GDQA 3I56N 4CJPA 2Q2RA 3C2PA 4OJ3A 1JX4A 1LQ9A 3KUGA 3DV9A 5ADXH 1JLBA 3K57A 3V1RA 4TN2A 1W2BM 2UP1A 1RWOB 2P5VA 2QTWA 5GADI 2UXDK 1Q81T 4EIAA 3CPEA 2POKA 3MGIA 3H8YA 2ZKUA 3DOLB 4MYTA 1Z3EB 4UB4A 1A7GE 4YD1A 2DNMA 3EVMA 3BSOA 2VJ4A 2F96A 2GVZB 2HFZA 1ATRA 3QWPA 3FZKA 2FB0A 4MK9A 1SV5A 3UE5A 1GTEA 1WOQA 4CEDA 2VG6A 1XSNA 2QLTA 1I94J 3G6VA 4BC9A 4LF5F 3L95X 4DTOA 3OTEA 1NK4A 4CHOA 2WZ1A 3G87A 4LF9F 2RKIA 4RQ7A 2LBOA 4EU0A 5AQUA 5AM1A 1SC3B 5AKJA 1KQFB 3B4MA 5B0BA 4HL9A 5BYQA 5C0YA 2W54A 1GQEA 4K4VA 4KLTA 5JTIA 2ZZNA 1NMDA 1MLAA 5DMRA 4USHA 1YGYA 4Q43A 1HX1A 4NRTA 5IXUA 5KL8B 2W42A 1N8RT 2W7OA 4DQIA 2VGNA 4AL5A 4MLEA 3C46A 5BN9A 1GFWB 1NPKA 4OFZA 2QLFB 5IWAK 1DURA 3AY9A 1BA0A 3IV6A 4UUXA 4M7YA 2QB0A 1HNXK 1LK7A 1QHTA 5JMVA 2O5DA 2X74A 2Q6BA 4CK3A 4IFEA 4JS4A 1V97A 1KQKA 5KT7A 1I5OB 3IM8A 3VAHA 2VBYA 4R79A 1OH8A 4ENOA 5ALRA 1QAYA 4TXSA 1ZQSA 2F4VJ 1WUAA 4YB6A 2DPNA 1OPZA 3D3BJ 4ZPWR 4A46A 5M1PA 2DGXA 2XC9A 1PGZA 4USMA 3HKWA 3A5NC 2R8JA 1RBAA 1FK9B 5HVHA 2FTRA