4DSKA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, ppi and calcium
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
579
structure length
575
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*GP*GP*CP*TP*AP*CP*AP*GP*GP*AP*CP*TP*CP*G)-3')
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
total genus 205
structure length 575
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dskA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dskA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dskA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dskA01
2ZUDA 4ED1A 3HJFA 1WLJA 4CF9A 4JV1A 4CJLA 2VANA 4RPXA 5HROA 4J9KA 3BDPA 4KI4A 3AVAA 3H8SA 4Z4FA 3AVJA 2A1JA 4M9NA 1RXWA 3H4BA 3Q8PB 3ZDAA 2YNGA 5KFFA 4CJFA 1CXQA 3NTUA 1ZQWA 9ICFA 4LH4A 5J2QA 2PFNA 3QEBZ 2F1IA 4QZDA 9ICLA 1RT6A 8ICGA 3CYMA 3OYCA 4BDZA 3CM5A 3RMCA 1WAFA 4CECA 3KLHA 1W9HA 4CJ4A 1NOMA 3KHLA 4M9HA 1RXVA 4DSIA 2YKNA 3DM2A 1S0NA 5DB7A 3PUFA 5KI6A 7ICKA 2KZMA 5CZ2A 2HHTA 4UB3A 3ZSQA 4DFKA 3KKSA 3PO4A 3QNOA 3Q8SB 4NXZA 5KFNA 1ZQSA 4Z4IA 3C6TA 1RBVA 2X6SA 4ZH4A 5BOLA 4C8LA 3SPZA 1ZQHA 4PA1A 1LW0A 4DTXA 3Q8MA 4CGDA 3AVMA 4BXOB 1ZQJA 3NF6A 8ICCA 3VQ6A 7ICOA 3E01A 3RB4A 1U4BA 3GFKB 2DFEA 1U48A 4FVMA 9ICWA 3PW7A 2FBXA 3V1OA 3IHQB 2BCQA 3M8QA 4B9UA 3K5MA 3OS2A 1J9AA 4IFYA 4YD2A 4J9NA 1QSYA 4FK2A 1C6VA 3Q8KA 4JS5A 1J54A 1ASUA 1S0OA 2J6TA 2OA8A 2PI4A 3PMNA 4ECSA 1XU4A 1N56A 5DBCA 1NJYA 4LY7A 3JPTA 2BPGA 4RG8A 4F50A 5DMRA 1A5VA 3LWMA 1ZQOA 2ETJA 3SI8A 3IS9A 1S1XA 3ISNC 3KKRA 3OYFA 4FLXA 4TUQA 5J0QA 1X9SA 2ISPA 2AQ4A 2D0AA 4EBEA 4QZFA 3V6HA 2UVRA 4J2AA 5SZTA 1HRHA 1S97A 3NDKA 3CQ8A 2FMQA 8ICRA 1ZQGA 4J9PA 1B9FA 4OVLA 2AGPA 1CZ9A 3V9UA 3O4NA 3OYBA 4KKOA 4ECTA 1J53A 5KFZA 2QKBA 4DQSA 4NLKA 2MUTA 4IRDA 3LWLA 1J5OA 2FMSA 1C0TA 5J2BA 3RH4A 3S3NA 3LANA 2FPLA 1Z3EB 4CFAA 2VG7A 2HMIA 5EOZA 3VA0A 4DL3A 4FJ7A 3DOKA 2RDJA 1A5XA 4C8MA 3OS1A 1H38A 2R8JA 5IIMA 4HCCA 1UA0A 1EETA 2Z1GA 9ICIA 3HP6A 2FC0A 4RUAA 4R65A 3RR7A 4RNOA 2VG5A 1DTTA 1CUKA 4P4OA 5KFIA 3ZDBA 4CGGA 5J2HA 2W9MA 3NFAA 2PI5A 1EXQA 7ICNA 1VSDA 2XC9A 4AHTA 3HT3A 4ECUA 2JZBA 1BCMA 3LZJA 1TFRA 3ZDEA 1IM4A 1CXUA 3GILA 5EWEA 4RW4A 5KG0A 4F4ZA 4DTMA 2I5JA 3TFSA 4Z4HA 4K8XA 1ZJNA 1NJXA 5DQIA 4EYHB 4W5OA 4NLZA 1FK9A 4UB4A 3NH1A 4CIGA 1IH7A 4KLFA 4CGJA 5C24A 4HHTA 4RQ7A 4HCBA 5KG7A 4RQ3A 5KFBA 4RW7A 1LW2A 3MXMA 1JLQA 3AA2A 1WSEA 1RTHA 4M0AA 3QEWA 5DB9A 1S6QA 3RAQA 1XS9D 1MQ2A 2B4JA 1ZQPA 5KFVA 4QW8A 4KITB 3Q8QB 5KG2A 5KFUA 4RQ8A 1VSIA 4ID5A 2VG6A 3NHGA 3AVIA 2NRTA 4OGCA 2XO7A 5DQHA 4C8NA 4F4XA 5KFPA 1NKBA 2ZJ5A 4UAYA 3U3YA 4R66A 1S10A 4ELUA 4JS4A 1UAXA 1RPLA 4KLGA 7ICGA 3MAQA 4NM2A 8ICUA 2BCRA 3PR5B 5HNKA 4FW2A 3SI6A 2X74A 4CEQA 4O5BA 3VN5A 1B9DA 4CK3A 1SKWA 5HHIA 4AHVA 1KLNA 4L8RB 3QZ8A 8ICFA 4FJJA 4GC7A 1BPZA 1SV5A 5J29A 3QIPA 2BCSA 4GLXA 4O5CA 4QZAA 2VWJA 5CY4A 1HYSA 7ICJA 2OZSA 4IDKA 4YN4A 4G1QA 1L3UA 5KFLA 3D0PA 2Z1IA 1NK8A 4QWBA 1L3TA 3NAEA 4RT2A 4CIEA 4KLUA 1MU2A 1S0VA 5CP2A 7ICPA 2G8IA 4N76A 1ASVA 4ZTJA 4KLMA 4UBBA 1ZQZA 1KFDA 2NRVA 2G8WA 3PW0A 4CJQA 1HMVA 3VQ4A 3L2VA 3V9SA 1KDHA 4O44A 5FROA 2ITGA 1KVCA 4F5QA 3N4MB 3S9HA 2OPPA 3ORYA 4CEBA 1RTDA 2PFOA 2F1HA 4YCXA 3ISCA 1DLOA 4QWAA 1Q8IA 1JLAA 3K4GA 4BWMA 4ED2A 3DLBA 3HPGA 1NJWA 3JPPA 3EPGA 2YNHA 3PMLA 3BQ0A 1W0HA 4YG2A 4MFBA 2G8KA 5IIKA 3QIOA 4YD1A 2IMWP 1C1BA 3AVGA 3NBPA 1GOBA 1WSFA 3S3OA 5KFEA 2W9BB 4O3OA 3GV7B 4M6WB 1BI4A 4B9TA 2PZSA 1B22A 4UAZA 8ICYA 3NE6A 3UXNA 3RMDA 3DLGA 1MQ3A 5L1JA 1IXRA 1ZQQA 1KVBA 2NRWA 8ICMA 4CHPA 4HTUA 4EZ6A 2UVUA 5K14A 5HBMA 1FKOA 4RQ4A 5IIOA 2JEGA 1XWLA 1KLMA 2BGWA 3RB0A 9ICMA 3KLEA 1ZQDA 2Q0ZX 4P4MA 1ZQCA 3SQ1A 2F8TA 3V9WA 8ICQA 4KTZA 2B6AA 1TV9A 9ICNA 5KFYA 1ZQNA 1TKZA 3LP2A 3OYMA 1UT8A 3MXJA 4CEDA 4NLGA 2D5RA 4QZBA 2Y1IA 4W5RA 3LPUA 9ICOA 1S5JA 4KB0A 3ZT1A 3LZIA 3ZDDA 4I2CA 3K5NA 4CF2A 3DLKA 1BISA 2PFPA 4PH5A 3T5HA 2YNFA 4RNMA 2NUBA 2W9CB 4J9LA 3T5KA 2IA6A 2YKMA 1JLFA 4FJNA 2HVHA 3PX0A 4RW8A 2KZ3A 3C1ZA 5FRNA 4BDYA 4R8UA 3RJFA 4QZEA 3ISBA 3OSPA 3IM1A 3EZ5A 3RRGA 1SUQA 4ICLA 2LSNA 1S1TA 2XHBA 3K57A 4IFVA 3AO2A 4E0DA 3M8SA 3F73A 3L3VA 3LP0A 8ICIA 5KFXA 1KFSA 2HNZA 4DTOA 3HSTB 3E2EA 1ZQEA 3AUOA 3HXMA 4Z6EA 1F21A 3V9ZA 2KFZA 1PZNA 5DGBA 4RQ0A 3Q8RB 4M9JA 4M3YA 2XCPA 3QLHA 2YV0X 3AVCA 4O5EA 4DTPA 5DQGA 2Y1JA 2BCVA 2W8LA 3DI6A 3KLFA 4DL2A 1XSNA 5KFCA 1VSJA 1XHXA 3FDSA 2FBYA 2X6NA 4FXDA 3KD1E 1LB2B 3NCIA 4X5VA 1UT5A 1NOZA 5DDYA 2HVIA 4KB1A 4UB5A 4JLHA 1T8EA 5J0RA 3VA3A 4CJKA 4FJ8A 1NK0A 9ICKA 2OYQA 2C22A 3OS0A 4DL4A 1RDCA 3C94A 4DL6A 4DSLA 4DQPA 1S0MA 4YVZA 1RT2A 5KFMA 3OYIA 3MFHA 9ICPA 4FK4A 1YTUA 1ZQYA 4FS2A 1C1AA 5T7BA 5KT5A 2O4IA 1BGXT 1JLCA 4RW6A 3KLGA 1RT5A 4LSNA 1ZQRA 1BQNA 1QSSA 5FRMA 5DKWA 3MBYA 5I42A 1EXNA 4J2DA 2P51A 4DTNA 5HRRA 2IOCA 1Q9YA 2OWOA 3V6JA 4Q0BA 1LV5A 4KLDA 1NKCA 4IQVA 2LYHA 7ICSA 5J2NA 1B92A 1FXXA 1MC8A 3L2RA 1X9WA 3KK3A 4B08A 3AVNA 1ZQLA 3AA3A 4HVJA 3TAGA 4YXJA 4NCAA 3VQBA 1SL2A 3B6OA 3NF7A 4QZCA 3OYLA 4EYIB 8ICWA 9ICRA 4P4PA 3CFPA 1NJZA 1G15A 3KJVA 1K1QA 4N56A 2ZUBA 1Z26A 3PV8A 4O3SA 1HJPA 4CE9A 3MECA 4Q45A 1TK5A 4KRFA 4JWNA 8ICJA 2BDPA 3EY1A 3SCXA 4DSKA 3PW2A 3T5JA 2R8IA 4ELTA 4J2EA 1NK6A 2ASJA 4E7KA 3SUPA 2NRXA 4IRCA 1JN3A 3PNCA 4DEZA 1GOCA 3OJUA 3ZSWA 8ICNA 4H4OA 4YMMA 4CHZA 3OY9A 2G8FA 1SL1A 3KHHA 4J9RA 3G6YA 4FK0A 4AHSA 2ZJAA 9ICUA 1C0UA 4F3TA 1XI1A 5D49A 4H4MA 3KHGA 3V9XA 4FJKA 2XY8A 4XUSA 2C2RA 8ICLA 4RZRA 5TZVA 1YTAA 4F93B 3RJIA 2ZTEA 2HHSA 1LWFA 2PYLA 4F5RA 1ZQFA 1VSMA 4KV8A 4YNQA 2IHNA 3MDAA 9ICJA 2JEIA 5JS2A 4CF8A 1VK0A 4DU1A 3KIOA 3QESA 3MGHA 1RYSA 4J9MA 4O0JA 2ZE2A 1BIZA 2PYJA 4YR2A 3TAEA 4ELVA 4CK2A 1L5UA 1U04A 3VQCA 2Z1JA 3PY8A 3MGIA 5DG7A 4PY5A 5KGWA 1S1UA 3QO9A 1Z25A 4MFCA 1XC9A 1TL3A 4M2YA 4BE1A 4F5OA 4CEZA 4QOZB 8ICSA 1HPZA 3RB6A 3RJKA 3KK1A 5J0OA 1S1VA 3RH6A 2HHWA 4FW1A 5KFSA 5HLFA 2AGQA 1SKRA 1R0AA 3TAQA 5J2GA 9ICBA 1LAVA 4MF8A 1T03A 1WCLA 2GWSA 3UIQA 1REVA 4CHNA 4EBCA 1HQUA 3JPQA 3UQ2A 1ZQXA 2E4LA 3OHAA 1BCOA 1RNHA 3QERA 2B5JA 4KLEA 3DLRA 3MEEA 4UQGA 7ICFA 1EP4A 4DQRA 1IKYA 4BDPA 4OLBA 4NY8A 4Q43A 4K4IA 2VA8A 8ICPA 1RT4A 2WOMA 4FJHA 3M9OB 4MFFA 4F4YA 4JWMA 9ICEA 4ED6A 1VRUA 3F9KA 5KFKA 4CJTA 4XQ8A 4N5SA 4CF0A 4DOCA 4F5NA 3L3UA 3VQQA 2DPIA 5KT7A 2MUTB 3AV9A 3RRHA 4DTJA 1D8LA 4QZIA 4KPYA 4N41A 2DFHA 4HYKA 3V6KA 1B43A 1ASWA 4RT3A 1WNSA 5I3UA 1D5AA 3U3GA 3GV8B 1JX4A 3K58A 4RQ1A 1L3SA 4DLGA 3G6XA 2P1JA 4KAZA 5J0TA 2D0BA 2HHQA 3SYZA 3WNFA 9ICHA 1RILA 4IQWA 3KD5E 1KSPA 5D4BA 3HVTA 4DLEA 4I2FA 5CYMA 3OJSA 4EP5A 3AVHA 3ULDA 5J2KA 3L2QA 4E7JA 2JZBB 3GIMA 1RDBA 2OZMA 4BWJA 2R8GA 5IILA 1RT3A 4FM2A 4KHNA 4QZHA 3PR4A 3IAYA 3NH2A 3UQ0A 2D0CA 1S9FA 1ZYQA 4CFBA 4J9QA 4DG1A 3U6FA 3TI0A 1TAUA 3V1QA 1KRPA 3LDAA 4FJMA 2KZZA 2HNYA 2UVVA 4O3QA 3AO1A 2J6UA 5BOMA 5J1EA 3OYDA 4PQUA 4CHYA 3LP1A 5EU7A 3NGIA 4Y1CA 4DFPA 3LAMA 3G6VA 1DOQA 4CCHA 4YR0A 3O3FA 2ALZA 2IS3A 4E7LA 4PGYA 1IO2A 3N97B 1JKHA 4CEFA 2HHXA 3AO4A 3PX6A 3AO5A 3P5JA 3AVBA 4DTUA 4KHYA 4FYDA 1BPYA 3SQ4A 4FM1A 2BQUA 3QEXA 4RQ6A 3OYJA 4GXJA 4QWEA 3QNNA 4Z6DA 3L2UA 4UBCA 1AROP 1CZBA 4I29A 4KTQA 1TV6A 4PWDA 4YXMA 2RKIA 4QWCA 3CM6A 3UXOA 1NK7A 3OVNA 3QEAZ 3NGYA 2XCAA 2IGIA 5J2MA 4QZ9A 4RPZA 4ED0A 3DMJA 2WTFA 3RAXA 3JPRA 3C23A 3H7IA 3V72A 1JLGA 2MAXA 4MF2A 5KTQA 5C5JA 1BL3A 3M9NB 1XHZA 4DS5A 2C2DA 4Z6CA 3ZD8A 2DTUA 3AVFA 3T1AA 2JEJA 4QZGA 2Q3SA 4DS4A 2YHBA 4O55A 5KGXA 1Q9XA 1Z00A 3TFRA 4E7HA 4NYNA 4O0IA 2FMPA 3HYFA 4KN7A 4ECYA 3ZSXA 2W42A 2PY5A 3V1RA 1S9EA 5DG8A 3RH5A 4FJ9A 4FBTA 2W9AA 1IKWA 4Z4EA 2G8VA 1YT3A 3VQEA 2FBVA 1FKPA 4K8ZA 1D9DA 3JYTA 1JIHA 3EWAA 4TURA 4OPJA 1I39A 1BI4B 5KFGA 4BE0A 4TSXA 4M42A 4CGFA 4IBNA 4IG0A 2RDIA 3CFRA 2VWKA 4O4GA 3Q8LA 1RZTA 4ECQA 4JRPA 4IR9A 4MEXA 1XO1A 7ICQA 4M3UA 3C2KA 4LSLA 8ICAA 4FZYA 3VQ8A 3BQ1A 4UAWA 4M3WA 4OLAA 3SUQA 3B0YA 5DLGA 3OHBA 4B9LA 4ED3A 1I3AA 3V7KA 4DF8A 2IAJA 4QCLA 4NYFA 2FLPA 4QAGA 5HRNA 5KG6A 2Z1HA 4M41A 4JK1A 3RJHA 1UOCA 7ICLA 5KRSA 3LPTA 4I2PA 2AU0A 1IKVA 5EWGA 3LALA 1U49A 2VA3A 3NH0A 4TQRA 5J2IA 4O9MA 1XSPA 4YFKA 3QZ7A 3L8BA 8ICTA 4F2RA 1S77D 4OPKA 5KFTA 3NGDA 5CYQA 4DQIA 4E7IA 2F96A 3HX0A 4M9LA 2YHAA 3SQ0A 3QEPA 1ZBUA 3T3FA 4FLTA 4KREA 4CJPA 4AHUA 4I2QA 4PHDA 4KLOA 1RT1A 4IG3A 5KT2A 1RYRA 1HYZA 3HM9A 8ICBA 2R7YA 4ED8A 3MFIA 4EP4A 2QK9A 5DDMA 5CR0A 5BPCA 4DU3A 4HUEA 1NKEA 4FM0A 4M45A 4I2DA 4DO9A 1V9PA 2O4GA 4FZXC 4CEEA 3LK9A 1WAJA 1BHLA 3H40A 4R8UB 4HUFA 5J0SA 7ICUA 4EEYA 4MEYA 4RQ5A 7ICHA 5J2JA 5IIJA 4E19A 4FLYA 2E6LA 4DOBA 3MEDA 1KTQA 4LZDA 4XIUA 5IIIA 4IKFA 3SV3A 1HQEA 1KCFA 2GV9A 1U45A 4DQQA 1NK9A 3MDCA 2P66A 3VQAA 1A5WA 4YP3A 4Z6FA 4ZHRA 3GIKA 4JV0A 1TL1A 4M3ZA 4ECVA 1A76A 1GOAA 5J2CA 2IHMA 4UB2A 2X78A 8ICHA 3MR3A 8ICZA 4QWDA 3RMAA 3P1GA 3ISDA 4GMJB 1RBSA 4CJSA 4DWIA 2DY4A 2BPFA 1QTMA 3K2PA 4B8CA 3SPYA 4F91B 3V4IA 1T05A 2EX3A 1BQMA 3DYAA 4KLIA 4F4WA 4M47A 3MEGA 4BXOA 3ZT0A 4GXIA 1EX4A 3OSNA 3IRXA 4FJ5A 3RBEA 2HB5A 4E1NA 4M3RA 3FYHA 3DRSA 3GDXA 1C7YA 2IBKA 4FCYA 1T7PA 1ZQKA 4AHCA 3PW5A 4I9LA 4CGIA 4KTWA 4R64A 4F5PA 4KI6A 3TAFA 4CJ3A 3ZT3A 1X1PA 3GIJA 3LP3A 4M3TA 3QINA 4CK1A 1LWCA 3MABA 5KG5A 4IQUA 4FJIA 4KHWA 4RNNA 1WN7A 1N48A 2B21A 4NM1A 4Z4CA 1JL1A 4FJLA 5CJ7A 3NF9A 4C8KA 4H8KA 2A1JB 2R8HA 1SZPA 3V6DA 3VQDA 4CJEA 5KT4A 4I9QA 2ZQBA 3PX4A 1TK0A 4W5NA 4DTRA 4NCGA 3HO1A 3ZCMA 1HYVA 3QE9Y 4O5KA 4WE1A 3SQ2A 3V7JA 3VQPA 4LZGA 1ZBLA 1BPEA 4CHOA 1T4GA 4HUGA 2IC3A 4CHQA 4I2BA 3DRRA 2P5OA 4DL5A 4Q5VA 3BQ2A 1Y97A 4AH9A 4KMUA 5HMMA 3TAPA 2PXIA 3PW4A 1QLNA 2ZTCA 1S76D 3SNNA 1LAWA 3RJJA 3AA4A 4B8AB 3KHRA 2R8KA 3T5LA 3DLEA 3DRPA 4MQ3A 1ZQVA 2A1RA 2XY7A 1QQCA 4OGEA 4CEAA 2P6RA 3MR2A 9ICGA 4IQTA 4CESA 1RBRA 4W5QA 3B6PA 3V7LA 4PHEA 2XY5A 3H8WA 1ZQBA 4CJRA 4QZ8A 1DGSA 5J0YA 2XRIA 2ZTDA 1VSLA 5KFHA 5HMLA 4KN4A 4I2AA 2G8HA 2QXFA 3SUNA 4R63A 3ASMA 4KLSA 4P2HA 4DSEA 5DK5A 1IG9A 4KO0A 1NOYA 9ICSA 1S9GA 2UVWA 4B9SA 2PFQA 1JMSA 4M9GA 1QSLA 4KFBA 2BPCA 2BE2A 1ZQIA 9ICAA 3AVLA 3K5OA 5D46A 5DBBA 4NCBA 3O3GA 3SV4A 7ICIA 4B9VA 2A1SA 4DOAA 2FBTA 3UPQA 4DFJA 3TAMA 1TKTA 4JUZA 9ICTA 5J2EA 5DGAA 2BHNA 4PPXA 1RDDA 4AHRA 4XA5A 3RJGA 2M9NA 4CJWA 4Q8EA 5KFWA 4RQ2A 1S6PA 1N5YA 1L3VA 5L1IA 1D9FA 4F3OA 1IKXA 3I0RA 1NK5A 1HUZA 2BGGA 5IINA 5KT6A 1T3NA 4O3PA 4J2BA 3MR5A 1U47A 2V4RA 4OJRA 4LD0A 5SWMA 1VSKA 5CA7A 2DFLA 4CEOA 2ASLA 3ZSOA 1NK4A 1TGOA 3S3MA 4FBUA 3ZDCA 1O1WA 1C0MA 2GUIA 4UB1A 3H08A 4CIFA 4B9MA 4O3NA 4Z0UA 1BPDA 2OPSA 3ETLA 4F4KA 1WSGA 1TVRA 1X2IA 1S1WA 5DB8A 3CG7A 4DSFA 5C25A 1X9MA 3AVKA 3QEIA 1YVUA 2I1QA 5HRSA 4GVMA 3TABA 3H4DA 3TR8A 3L2WA 4RU9A 3EYZA 3UXPA 1JXLA 5L1LA 2FLNA 2RN2A 3WNHA 4GC6A 8ICEA 4LH5A 3JPOA 3G0ZA 3V81A 5KG1A 3WNEA 2JEFA 4I28A 1UWBA 4YQWA 4W5TA 3C1YA 2ISOA 2ZD1A 3ZSVA 4CJ5A 2YNIA 3JPNA 4FO6A 4C8OA 1RBTA 4N47A 1ZBHA 1RT7A 1C1CA 1QS4A 2ATQA 5L1KA 5JUMA 2H5XA 3DOLA 1RDAA 1K1SA 1Y88A 2AQ0A 1RTJA 4E3SA 3HPHA 3C2LA 5J2FA 4DF4A 4PHPA 4M3XA 2XY6A 4KLLA 5J2AA 5J0WA 3KLIA 5DB6A 4Z4GA 3TARA 2HW3A 4BACA 1CLQA 4ECRA 3GV5B 4ED7A 2BQ3A 2J6SA 5KG3A 4DMNA 3EPIA 2KW4A 4PGXA 8ICXA 4J9OA 4DU4A 2RF2A 1TKDA 2HNDA 2C2EA 5DG9A 4FZZA 1A77A 4DFMA 3AA5X 2F1JA 1N6QA 1SL0A 1U9LA 2W9BA 2ASDA 5C42A 5CB1A 4BE2A 2ZUCA 4M6WA 1VSEA 2V9WA 4FJGA 2AJQA 2P5GA 1XSLA 4E1MA 3PVXA 3M9MB 4I2HA 4K4HA 2XGPA 7ICEA 3OYNA 5F9NA 4GW6A 1TK8A 1JXEA 1HUOA 2WONA 5KFJA 4KLTA 4XRHA 4R5PA 3C21A 3HW8A 3BQTA 2VA2A 3HP9A 1BVSA 4G3IA 4KHUA 5KFQA 1BIUA 2G8UA 3T19A 3VQ5A 5KFDA 4CJUA 4YFUA 3AO3A 1TKXA 4QW9A 4J9SA 4I2JA 3QETA 2NRZA 4OKJA 2P6UA 8ICKA 5CZ1A 1KEJA 3ZSRA 3C6UA 5KT3A 4RUCA 1TAQA 5HHHA 4JRQA 5KG4A 3GIIA 4E89A 2KQ2A 3C2MA 3KTQA 1JXBA 1VSHA 1MSWD 3I0SA 1KFTA 1QE1A 4IRKA 3RR8A 5D3GA 9ICCA 1ITGA 3OYEA 1D8YA 2QKKA 3JPSA 4K4GA 1K6YA 3C5FA 4NLNA 3H8JA 2OPQA 3ZSYA 9ICVA 2BR0A 5L9XA 1WSJA 1WSHA 4B3OA 1ZQUA 3SZ2A 3PO5A 2W9CA 7ICRA 3TQ1A 3ZD9A 4IR1A 7ICVA 3JSMA 1JLBA 3RTVA 4JV2A 2E6MA 5J2PA 7ICMA 3THVA 4ECZA 4CERA 4AILC 1JL2A 4GXKA 3K75D 3MXIA 2V4QA 5HP4A 2ZJ8A 2GBZA 5J0PA 2DFFA 3D45A 3HK2A 3K59A 4I2GA 5E41A 5J2DA 2W8KA 2BANA 3LDSA 2RPIA 5J0UA 4FLUA 1ZJMA 4MFAA 2BCUA 3NGZA 1ZBIA 3IG1A 4O3RA 4EBDA 4RW9A 4ZTFA 1WCNA 4F2SA 4F8RA 3ZT2A 3B0XA 2FPMA 2KTQA 7ICTA 2KFNA 8ICVA 2I9GA 1ZQMA 3HPOA 1Z00B 4Q44A 4DSJA 1ZETA 1HNVA 3QEVA 4CFDA 4CJVA 1RTIA 4RPYA 4B9NA 4TUPA 4FLVA 1JLEA 1RCHA 3KK2A 2JGUA 1DTQA 4CF1A 1TVAA 3RB3A 3OYKA 4FLZA 5F9LA 4YMNA 4FLWA 1VRTA 9ICXA 4KLQA 1HJRA 3M8RA 3RMBA 2HHUA 3MR6A 1RBUA 5CHGA 1BPXA 2KN7A 4PHAA 5JS1A 1ZBFA 3CFOA 2XGQA 5KRTA 4OKKA 4FS1A 2BQRA 4I27A 2C28A 5DBAA 3HL8A 3ZT4A 4DL7A 4KHSA 3EW9A 4PGQA 3SUOA 3BJYA 5HP1A 4ECXA 2HHVA 2OPRA 4LVSA 5DLFA 5KFAA 3HVRA 1ZQTA 5J0XA 1CEZA 3ITHA 1BPBA 3G10A 4YR3A 3OYHA 3ZSZA 1QHTA 4CFCA 3GQCA 3DLHA 4I7FA 1EKEA 3TWHA 4EZ9A 3A2FA 2JLEA 3ALYA 2BKEA 8ICOA 2AGOA 3RWUA 3NF8A 3BGRA 3HWTA 4Q8FA 5HRPA 4Y1DA 3OYAA 3K5LA 4I2EA 3AU2A 4M04A 1KVAA 2FLLA 2ATLA 3O4QA 3P83D 1UA1A 9ICQA 4FJXA 3LAKA 3SJJA 3AU6A 4OKEA 4YMOA 1LWEA 3WNGA 2FPKA 4TUSA 5CWRA 3VQ9A 1ZQAA 4KHQA 3TANA 1VSFA 1WSIA 3OYGA 4BGDA 4ID1A 3OGUA 3O3HA 5EWFA 5KFOA 4DTSA 3I8DA 4TQSA 3RJEA 3M8PA 2DPJA 2EHGA 3VQ7A 4ECWA 3C5GA 4CGHA 4I2IA 5FDLA 4KLHA 1SKSA 3RBDA 4KLJA 2IDOA 1COOA 3C95A 3FFIA 4F92B 1HNIA 4PUOA 5KFRA 2F8SA
chains in the Genus database with same CATH superfamily
4ED1A 5BR9A 2PDAA 1GLFO 3GR0A 1WLJA 3KFWX 5DS7A 5L46A 4RPXA 1FNXH 3UPFA 3A8YA 3H8SA 2PC6A 4M9NA 3Q8PB 5IXUA 2KM8B 2YNGA 5B5EU 4K43A 2GNKA 4LF8K 4CJFA 3AA9A 1CXQA 4JKBA 4LH4A 4DV4F 3WXJA 4DQ8A 3K8WA 5D0EA 1OPZA 2MXYA 2AYBA 4BVOA 3OYCA 1GTHA 4TVAB 5F0UA 2GC8A 5FLXU 2WFAA 2UUAF 3KLHA 3Q7CA 3KHLA 2NZTA 1BQNB 2CXYA 5AICA 3B82A 4FKYA 3DM2A 4JD2A 4BLGA 1Z1VA 4LF4F 2VGMA 2VKRA 3BP8A 7ICKA 1N34J 2P9IA 2GFFA 3OTOJ 3PO4A 4OHWA 4B1VA 3Q8SB 4Z4IA 3ETRA 2FF6A 3C6TA 1RBVA 3ELHA 5CZXA 5LM7E 3SPZA 5K8OA 1BQMB 2DIUA 4DPXA 1LW0A 1HIYA 2AW0A 3EUNA 3Q8MA 2W40A 5A2QO 3AVMA 4BXOB 1ZQJA 2D74B 3IRXB 4BRKA 3DRSB 4F7VA 2DFEA 9ICWA 5AI4A 4BRPA 5ALXA 3PW7A 4X62F 4PG6A 4CZIA 5LXYA 3M8QA 3TYTA 4DUTA 2KL8A 4IFYA 4IDHA 4WFAQ 4JB8B 4OYXA 4MLEA 5BREA 3R9KA 1EWQA 4IOCL 2ZWPA 2J6TA 4EO8A 3CMES 5C2FA 1YJNS 2PI4A 3FEXB 5EX5A 2X3GA 1XU4A 1T94A 1YTYA 3C16B 2DR8A 3N6MA 1NGAA 1MWQA 5DMRA 1ZQOA 3R5AA 4CNZA 4BHQA 3I28A 3TA2A 3SI8A 4DUZF 3DKDA 3ISNC 2V2ZA 3KKRA 4US8A 5AKHA 2ZIVB 2NXNA 4FLXA 1YJ9S 2FXUA 3CJAA 1X9SA 4MK8A 2MZSA 2DXEA 1NU0A 1UVJA 3NOCA 1WOSA 4C2MA 1VQPS 5SZTA 3SMPA 4JI2J 3T41A 2FMQA 1OH7A 1ZQGA 4X66K 2WF9A 2ZC4A 1CZ9A 3V9UA 1VQ7N 4KKOA 3A8JA 3WQTA 1J53A 1WHVA 1WB9A 3NASA 4JI8J 1WBBA 3RBXA 1O08A 2YY3A 1ZOLA 5HOOA 2M0NA 1Q82T 2OTLS 3OHRA 3DAWA 2CPHA 3A5NC 4Y2VA 4FN5A 1C0TA 3CNQP 3BF1A 3RH4A 2GAGC 5HMWA 1T3OA 2FPLA 1K0VA 3K8VA 1Z3EB 2HMIA 2CYYA 4KBOA 4ANDA 4DL3A 3DDIA 4GIBA 1A5XA 1KD1O 4QIVA 3OS1A 4WFXA 2LQJA 1EETA 9ICIA 3BGOP 4X4VA 5D0HA 1UJ4A 4R65A 4RNOA 5KFIA 5J2HA 2Z4PA 3IBFB 3TW0A 2VPWB 3N7RC 3UN5A 4LF5F 3HT3A 2MZJA 5ALUA 2J76E 2GJ2A 3LZJA 3D6HB 1IM4A 1S9GB 3MCAB 5EWEA 3Q0AA 2V4JA 4RW4A 1OW5A 5K20B 5KG0A 4F4ZA 1WG8A 1HBOB 2YWWA 2I5JA 2YPYA 4F26A 2C42A 4K8XA 2G4BA 4LREA 5E3CA 5H1SV 2FF3B 3QT7A 1URNA 3EGZA 4W5OA 4ES2A 4CIGA 1IH7A 1EQMA 4KLFA 2F8MA 4RQ7A 2RP5A 3TZXA 1R0CB 4GVBA 4NXNK 5KG7A 3VF2A 3BO3A 2A2CA 4ZN3A 5IS2A 5BPNA 2G13A 3AA2A 3IR7B 4CD3A 1RTHA 1S6PB 3QEWA 1CJTA 1N0VC 3Q83A 2KKZA 1NNEA 4LJMA 1S6QA 1XS9D 3WXLA 2B4JA 1ZQPA 4QW8A 4WP9A 3Q8QB 3FEYB 3POTA 1M5OC 4EUVA 1Q79A 5KFUA 2JR5A 2KHCA 4ID5A 2BJEA 2JWNA 5ALPA 2XO7A 1NBEB 3BR8A 3CJCA 4TY9A 1NKBA 5IWAJ 3U3YA 4ELUA 4US9A 4ERDA 2HOFA 4KLGA 7ICGA 1FVQA 3NMRA 2GQQA 2O1PA 3H46O 2HFVA 2PFFB 3VN5A 5E3AA 5EDWA 1SKWA 1S1WB 1F5SA 5A8RB 4L8RB 1KLNA 2G2YA 2K8GA 3AGKA 1IBMF 1QUPA 3QZ8A 3MM6B 5ALZA 1WSRA 2RAQA 3W8PA 5A0YB 1SV5A 4NA2A 2VWJA 3BSCA 4ED4A 2OZSA 4YN4A 1L3TA 1WKLA 2LXIA 1WWUA 2D1KA 1HI0P 3R1LA 7ICPA 2CUYA 2IDLA 2G8IA 1X0FA 4NLXA 4O23A 4N76A 1RT7B 2QB0B 2W2MP 1IBLF 1FW6A 3CT9A 2VQFJ 1RTJB 1W25A 2B4UA 1N52B 4F5QA 2OPPA 3H90A 1SJ1A 1RTDA 4CEBA 3QU5A 4LFCK 4UOFA 5CCLA 4LR7A 5AI9A 2BRLA 3FC4A 4F02A 3R3LA 3K4GA 4C1NK 2CZ9A 2BJ9A 2AJ0A 1W0HA 5CZVA 2HNDB 3QAEA 4MFBA 4YD1A 2H3EB 4ZCMA 1RXOB 2J7UA 3O5BA 1VOMA 5KFEA 2M88A 2W9BB 2ATCB 1UJ6A 4G65A 5C42B 4O3OA 4LF7J 1FVSA 4Y28C 3GV7B 3CJQA 1N5QA 3NVZA 1RGVA 1NHKL 5CXTA 1HA1A 4CZEA 3KG4A 3NE6A 2Z56B 1ZQQA 3VGSA 3L0QA 3RU0A 4U7UK 1VHIA 2JEGA 4IXCA 1W2IA 4KMOB 1RGIA 2NREA 4DCJB 1KLMA 1X31C 2F8EX 4BY9C 1EHWA 1BOTO 4J8FA 1YK9A 3SQ1A 5AI0A 4Y2XA 1C2PA 5EN1A 3HT0A 1TV9A 4CDIA 5B0CA 1ZQNA 3H7HB 5FIIA 1H7XA 1WWVA 5ALEA 4JI0J 2W7AA 2LKZA 2XYPB 3IWXA 3DGPB 2VF3A 1WTBA 2QKQA 3QXGA 2Y1IA 3I0SB 5D15A 1RM6C 9ICOA 1NJIT 3FQKA 5BXIA 3LZIA 4J7CA 4FVCA 2J0XA 1N63A 4ZVPB 2HS3A 3CCJS 3DLKA 2ALYB 4C0HA 2IYGA 2PFPA 4B3OB 5KL1B 3AB4B 4RNMA 3NNCA 3CQYA 4OMFG 3SDEB 3US5A 2M5YA 3R5JB 1URRA 4DN0A 1OH6A 2QL7B 2YKMA 5KAIU 1NWKA 1JLFA 4FJNA 1Z2LA 3FE1A 3CXCM 2HOIA 4FWRA 2DCUB 3OSPA 4NA3A 2IJFA 3TZYA 2H9ZA 1CQNA 4ICLA 2BW7A 4B1XB 2WZ1A 2R7OA 1Q1KA 3K57A 1SS6A 4YOTA 4IOXA 3SEIA 1WHWA 2HQIA 3GU3A 2ZWOA 2J0QD 1QDUB 4E0DA 5KOXA 3F73A 3OBWA 8ICIA 2EG2A 3TEHB 1RHUB 3THXB 2OHDA 1R8BA 4USUA 3GBTA 3BZQA 3HXMA 1S59A 4LRCA 3V9ZA 3Q8RB 5GINA 1ZTWA 3QLHA 4DTPA 4H0VB 2Y1JA 3H8YA 1SWWA 1F5BA 4CO5A 2HAIA 1VSJA 3GFXA 2XNRA 4FXDA 1LB2B 1DRZA 2W54A 2OEJA 1NOZA 2DEIA 1SCJB 2Q3PA 4KB1A 4NYPA 1JLEB 1PJ7A 2FJ6A 3OVSA 5EX3A 4IO8A 3FEZA 1ZA2B 1NK0A 9ICKA 1TP7A 2V2KA 3EX7B 2C22A 2CZVC 5EE0A 1RDCA 5EXWA 1NDLA 3T1YK 4DX5A 3GLJA 5TKWA 4KSEB 3TUJC 1RT2A 1FE0A 1U24A 4ZVGA 2EFGA 2H5IB 4EAHD 5CD4H 2XZWA 3GZFA 2EVZA 1YTUA 1ZQYA 2FHJD 5T7BA 1Q5VA 1LQ9A 4IG3B 3CJKA 5IT9Y 5ALTA 5BYRA 3VVTA 1RE1B 2E8PA 2E1CA 1QSSA 3PTWA 2O01C 4OPHA 3D68A 2JRSA 5E2QA 3R2CJ 2QARA 2HZVA 3V6JA 4ZMMA 1FFWB 1U2RA 4Q0BA 1LV5A 1NKCA 4PL2A 4IQVA 1FRIA 4NYOA 3KMQA 3BGRB 5ALSA 1JROA 5M1OA 1QVFM 2KG0A 3L2RA 2UUCJ 2K4HA 2XMAA 3FZKA 5BR8J 2XHWA 3KK3A 4B08A 3AVNA 4GVEA 3HULA 3TAGA 2V67A 3AJ2A 1LFWA 3M3ZA 2DKXA 1WF0A 3VQBA 1SL2A 3ENWA 1WHYA 1V3RA 3B6OA 4EYIB 5GADP 4Z7YA 9ICRA 4ZP8A 2WAQD 4A8MP 1HNZK 2X1GA 3CFPA 1NJZA 1UHUA 4DV2K 2PEHA 2B0CA 4A8EA 1S6UA 3UI3A 3NVMA 4N56A 4A5BA 4NEYA 4CE9A 1HJPA 5FDLB 1KN5A 2P35A 3MMJA 4C7YA 1TK5A 4CI6A 1FJGF 4DR6J 1QZ6A 3M1VB 1CC8A 3FFIB 2ZE2B 1X42A 2M3DA 1CJVB 3U9DA 1NK6A 3WQPA 3PG9A 3SUPA 3VOVA 1B0TA 1UMJA 2KKHA 3FQLA 1Q8BA 4DEZA 2Q6BA 3OJUA 4ZK7M 4YMMA 4X4UA 3MOZA 3MXHP 1SL1A 3PJXA 2E8NA 4J9RA 3QJPA 1K8AO 4FK0A 2AWZA 1YX2A 4GNIA 1C0UA 1RT6B 1RWUA 2V7YA 1S8OA 3V9XA 2Y3YA 4DCHA 3B8HA 3A1YG 4XUSA 2AYMA 2YKNB 1LWFA 1VSMA 1N5SA 2IHNA 3AA8A 3MDAA 3W9IA 5L1MA 3QT5A 4RWTA 2P9NB 1COKA 5GMDA 3QESA 1FRMA 4O0JA 4DV7F 2MZ1A 3IG8A 3SAGA 3CE8A 4YR2A 4ELVA 4CK2A 1L5UA 3VQCA 4MDBA 2Z1JA 3NGKA 3GDQA 3OD2A 3BS9A 4PY5A 4WXOA 1S1UA 1XR5A 1Z25A 3IBPA 3CJTA 1XC9A 5L39A 1S7IA 5ETSA 5B09A 1VQ6N 3DC2A 4BE1A 4F5OA 4CEZA 3V2UC 4KY3A 1GNKA 1HPZA 4I69A 4P10A 2QG9B 2WB4A 2FQQB 4QS9A 3K5PA 1S1VA 2Z2ZA 3NAIA 3AJDA 1R0AA 2V8GA 1T03A 3EE9A 1I51B 2DVIA 2O8FA 1IXKA 3ILJA 3KUEA 4CHNA 4OIXA 4N77A 3OHAA 1RNHA 2B5JA 3TACB 1HBMA 1KR4A 4C6AA 3AD9C 4UQGA 1EP4A 3W61A 1NH7A 4JMUA 3DEEA 2GMLA 4OLBA 2D3DA 4BDPA 3IS9B 2B56A 1S1XB 3D7EO 4NY8A 2HGMA 2VA8A 4GV3A 1RT4A 4YDXA 3FMWA 2DHXA 1UAWA 4CZCA 4JI6F 4FJHA 3RGIA 2UXCK 3U4LA 4JWMA 3MAAB 9RUBA 4DR2K 3F9KA 4RBTA 3J81j 5D0GA 5IZHA 2QC3A 3AQFA 2W4DA 4CF0A 2E5IA 3OPKA 3F0NA 2YX4A 3IM9A 4F5NA 2ZJRQ 2JRZA 5E0OA 3KWMA 2GMJA 2VD3A 3AV9A 3VVUA 4DTJA 4LFAK 3IA0A 3S1TA 3C7NB 2DFHA 4PYDA 4ZVEA 4ED5A 4JHDB 2LM1A 3L7OA 3WHIA 4RT3A 2VG7B 1ASWA 4HL9A 2MY7A 4EU0A 1D5AA 1EQ0A 4C3LA 3K58A 4RQ1A 2DGUA 3SBGA 1U25A 3AH6A 3NEKA 4AYBD 2D0BA 1T9VA 5IFMA 2X51A 2ZXHA 1FDNA 3NWGA 2F5GA 3D4JA 2KB2A 4Y6IA 4EP5A 2JZBB 3ZTPA 1RDBA 4UY8T 1M0SA 2Z8QA 2DGXA 5E7OB 5HATA 3VQTA 2MZQA 3KG1A 2XG8A 2HQDA 4FF4A 2OANA 1YITS 2VFUA 3TI0A 5FD1A 2KRBA 4OHZA 1TAUA 2ZH5A 3V1QA 1U8SA 1NGDA 2KZZA 3ZETB 2HNYA 4O3QA 2ZVIA 5C24B 5BRHA 3MCNA 4BUGA 2J9EA 2R7VA 5ALJA 2GA7A 1N32J 1ZTTA 1KVJA 2XB2D 2V6AA 3KJQB 2WVDA 4ID8A 1RWNB 2MJUA 2QIFA 1S22A 4Y1CA 3ADAC 4KGKA 2WF7A 3MN9A 1DOQA 4C4SA 3O3FA 1S5ZA 4I68A 1MW7A 2IS3A 4PGYA 1HD0A 2O8EB 3C28A 3N97B 3OL9A 2ZEJA 2HHXA 2FZCB 3AO4A 2QSFA 2O5DA 3AO5A 2L08A 2ESEA 3P5JA 3P39A 4UOGA 1U0SA 2BQUA 2GGPB 3NCRA 4QWEA 3PEJA 3QNNA 3ILLA 5EE3A 1EAYC 4UW2A 4BC9A 2D0PA 3J7Z5 2RMLA 2ZH2A 2B43A 4IO9Q 5ETLA 3QEAZ 3QIPB 3NGYA 1HYSB 4QPTA 3SMSA 3CJ7A 1SPBP 4QYZJ 2EFVA 4RPZA 3ULEB 2DXFA 1KS2A 1WSVA 2P9SA 2WTFA 3CD7A 2XMTA 1ECWA 4CNYA 3R6LB 4FOEA 2IMOA 3MMAB 2CQGA 2XMUA 4W4MA 1QTNB 3P4UB 4Z6CA 2JH7A 3AVFA 3TO8A 2L3MA 4B3RK 2JH3A 4O55A 5KGXA 2FVQA 2O8BB 2D3UA 3EICA 3TFRA 2YQ1A 1XNRJ 3O9QA 4NYNA 1PK1A 4I6MA 2DR6A 4OCZA 2CXEA 4QIWC 3R5GA 3ZSXA 3MPUB 1FERA 4YB6A 3RW6A 3ENHA 5HANA 2GOLA 2WHOA 4FJ9A 4FBTA 2H1YA 2W9AA 2AF6A 2BJ8A 2JV3A 2JDJA 1U1RA 1TTHB 1IKWA 2G8VA 3JTNA 5CCMA 2BZFA 3VQEA 4K8ZA 2CN1A 3DOMB 2E1ZA 1VQOS 2EANA 3O8WA 5C2GA 2XM3A 3CETA 3MMBA 2AKWB 4CGFA 4LF8J 2ZOMA 2KG1A 5AQWA 2ADCA 3SQIA 3DLGB 1RZTA 4H5WA 4ECQA 1X6IA 5DO2A 3NCQA 5K14B 3RUBL 4MEXA 2MA1A 4FZYA 3VQ8A 2HOEA 3BO4A 5KNIA 2P9UB 2JGAA 3HFKA 3D2FB 4W98A 3V7KA 4G1PA 2DNYA 4JBCA 2OAUA 4H4KA 4JK1A 5F8MA 1UOCA 3ZX0A 3LPTA 5ALHA 1H6KX 1M1GA 1I1GA 5ALQA 4CLTA 3HI0A 2AU0A 1MROA 2KT3A 1YJWS 1U49A 2VA3A 4DZDA 1Q86O 4MIBA 3SSRA 1D4XA 3WK8A 2YBVA 1KOOA 3D66A 1K9MT 3I76A 1XSPA 2BTFA 2KP7A 3L8BA 4CO0A 4DUYK 4F2RA 4OPKA 1UJ5A 2E88A 4ETZA 3LM9A 4M9LA 1X0PA 4FLTA 2OEMA 3L5KA 4HACA 2KDOA 4CJPA 1Y9OA 2IRUA 3DXSX 1XEZA 4LR9A 5KT2A 1Q8KA 5DJBA 3EWGA 3A3NB 5BPCA 1OVQA 1NKEA 5HI7A 5HQLA 4I2DA 2UXDF 5AJ3K 4FZXC 6AT1B 1WAJA 1PC4A 1SQGA 4FO0A 3H40A 4R8UB 5JRTA 1KP6A 3N4WA 5C2DA 4YOXA 2EFPA 2R7UA 5J2JA 1SUQB 2LXFA 4FLYA 1S1TB 4BCAA 3A5LC 1IWGA 4XIUA 3C15B 3CJ3A 1U45A 1NK9A 2PMHA 3VQAA 3N0VA 2IIRA 1Q7YT 2FSJA 4ENOA 5ETOA 3PNIA 2RNEA 1GOAA 5J2CA 2V0NA 4NO7A 3R8YA 4X66J 2X78A 2I2YA 5DM7L 4FWNA 5FPNA 3ISDA 1TQLA 4CT8A 2QFIA 4M5DB 3SPYA 5ALFA 1DARA 4AXJA 1Q18A 3CQXA 1X6JA 2FIUA 2EX3A 5CR4A 1BQMA 4KLIA 2ASOA 3VAIA 2CQBA 1F9HA 4WCEQ 2WAQF 4M47A 1WEXA 5LMUK 4BXOA 3ZT0A 1OJ4A 4GXIA 3IRXA 2EAPA 3RBEA 3CDEA 3L3FX 2HB5A 2BH1A 1MN9A 2MLXA 3DRSA 3HHLB 3GJTB 1C7YA 4OZ1A 1IBKF 1KHWA 4I9LA 1I3OB 4CGIA 4R64A 4F5PA 4IKAA 3BREA 2Q31A 1JLCB 4CM0A 4YS2A 3ZT3A 4Y2TA 2J0SD 2VHGA 4M3TA 4PUOB 3MABA 5AKYA 4OX7A 4KHWA 3K9KA 1YJNN 3PKMA 1UEKA 1N48A 2P6TA 3C16A 5B0GA 2VONA 1H2UX 4KX5A 2A3VA 2GV1A 2MHNA 2EFQA 5CJ7A 4C8KA 4H8KA 3H42A 2W41A 1ZD5A 2ZIVA 2I7PA 1NDKA 2CQ2A 4I9QA 1YJ9N 2G1DA 4LF9F 1VRQC 3GJQB 4BBYA 5GAHP 1HI1A 5E79U 4NXNJ 1G6BA 1VQ4N 1D3WA 3VQPA 4LZGA 1VQPN 2JSXA 4F0KA 3KWGA 4IJAA 2VIXA 4CHQA 1VC6A 4ZP6A 2P5OA 4JKHA 3CERA 2KNJA 1KVKA 2DNMA 3KJVB 3BQ2A 3B8AX 2Z2YB 4AH9A 3MWPA 3TAPA 2PXIA 1QLNA 3W66A 3QBWA 3UO0A 4MKAA 4Y0FA 4YHHF 1DY3A 3EZOA 1LAWA 2RQ4A 4MDAA 2OTLN 1FJ7A 2ZJPL 3ZFVA 4YOVA 3KHRA 2R8KA 3SBTA 5HN0A 4C9DA 4MQ3A 1ZQVA 2XY7A 1QQCA 5D4LA 2ZJRL 1TL7B 1N8RT 4C11B 2AJFE 4F3QA 3B6PA 4PQAA 3H8WA 3JQKA 4PCQA 1E6VB 1FF2A 2XRIA 1HNWF 5M1QA 3S6EA 2P9KB 4PG8A 2G8HA 2J0WA 4WQ5C 4R63A 5IC6B 4K41A 4C1NI 1IG9A 2L9WA 1S9GA 4W92B 4DR5J 2HRYA 1ZD2P 5ETPA 3CPEA 1VJWA 3JS9A 1VQ8S 2BPCA 2CG8A 1VISA 4KH5A 4Q2MA 1HBOA 1JJ4A 5CHIA 3HF5A 2EKYA 1GMWA 2W03A 4NCBA 2DXDA 3O3GA 3JSYA 1NXIA 4JYAF 2WBRA 3MMCB 3TA1A 4X4TA 1DFDA 1H7WA 3UPQA 2B4OA 3QJLA 3ZC4A 5J2EA 2JWKA 4Y2QA 3L6QA 4JI4F 5EE9A 1RDDA 4LFCJ 4FOIA 4KGZB 4GKKF 3MCPA 4Q8EA 4ILHA 3EJMA 1S6PA 3QO9B 1N5YA 5L1IA 4BRFA 3JAMU 5IINA 2DCLA 3VGKA 2AEJA 1TL3B 2F63A 4O3PA 4OJGA 1QD1A 2W7PA 3VEZA 4OJRA 3E9PA 2DFLA 2MKHA 2F9WA 4OJ5A 3O1BA 2ZH6A 5J8YC 4AD6A 4NLQA 2GUIA 4UB1A 1EX8A 4B9MA 4O4RA 4DJBA 3A12A 3H98A 1REVB 1S1WA 5DB8A 3DOKB 5A8RA 1NGCA 3TA0A 2KD1A 3QEIA 3MM6A 4NX9A 1Y00A 4XAKA 3DU5A 5A0YA 1BC6A 3WK9A 1IKYB 1RAEB 5HL7Q 3IP0A 4RU9A 3UXPA 2CQCA 5L1LA 1FD8A 1R7IA 2IOHA 4GC6A 1X4FA 2E9TA 2HBZB 2HFNA 3TUIC 5LL6d 4AL6A 2CAJA 2I38A 4FYWB 4WXWA 2ZM6K 4YQWA 4W5TA 4IO9L 3C1YA 2ISOA 4OYOA 3NS5A 3HKWA 1VRUB 2IVFB 1ZAXA 4CJ5A 1J5EK 3JPNA 1QAXA 4FO6A 2FHOB 1RT7A 2YH1A 2QB0A 2H5XA 3GYGA 1WG5A 1SC3B 3W1YC 1RDAA 2BACA 2Q0UA 1Y88A 4M95A 1RTJA 4R0JA 3C2LA 1FA0A 1P6TA 4KLLA 5J2AA 5JMVA 2HW3A 2A10A 3GV5B 2KT2A 5KG3A 3EPIA 3HHDA 1IUJA 2RUSA 4J9OA 2HNDA 1T11A 2LCWA 2WVFA 2D0OA 1TUWA 4L73A 2RS2A 4CDGA 1FNOA 3OVAA 4WFNQ 4KHRA 2W9BA 5C42A 1Y11A 2AV5A 5CB1A 3BB5A 1SQKA 3BY5A 4BE2A 3HVTB 2AJQA 5AI8A 3A8IA 5CYMB 3DXMB 3CMAN 1RHRB 4ZIVA 4I2HA 3SQGB 2XGPA 7ICEA 1PGZA 1NGHA 4YOUA 1JXEA 4RNFA 5KFJA 4R5PA 3HW8A 3FSXA 3BQTA 2B4PA 4IH6A 4DG1B 3HP9A 4L3NA 3U9ZA 1RCOB 4EEKA 1O0PA 3AAPA 2VFVA 4KHUA 2G8UA 4OZ0A 1WI8A 1WEYA 3IGNA 2F7TA 2QT7A 3QETA 3LA0A 1LCUA 4OKJA 2P6UA 8ICKA 2KVSA 1A7GE 4PQUB 2NRHA 2H3FA 4NI2B 2KMDA 3SCLE 1FESA 2EZYA 4BR5A 4UF4A 3C2MA 3KTQA 4CBUA 1ULRA 3I0SA 2F4VF 2KVQE 1KFTA 3T1YJ 1IBCB 4IRKA 2CVEA 1MA9B 9ICCA 1D8YA 2QKKA 3JPSA 2I8EA 4K4GA 1JKHB 2EBEA 2LMRA 3ZSYA 9ICVA 2FJEB 2ASPA 3CCJN 1WSJA 1WSHA 4B3OA 2PT0A 1ZQUA 3TVZA 3O9UA 7ICRA 4IR1A 7ICVA 4ZVFA 1ZPVA 2J8AA 2NO5A 4Y2JA 1Q16B 3N4PA 4DPYA 5J2PA 2ZHOA 1N4LA 2BUPA 4YDUC 1ZAWA 4ECZA 3ISND 1ATNA 1RLCL 2JVRA 5HP4A 2ZJ8A 2GVZB 1TV6B 4Y3CA 1Z1BA 2GBZA 5J0PA 2RKIB 1FO4A 3BEXA 2QWMA 4JN4A 4I2GA 1PAEX 3ETMA 2W8KA 4KRWA 4IQMA 4CLFA 2DNOA 5ELZA 5J0UA 4FLUA 1ZJMA 4EI2A 3E9LA 4DR4K 4OHXA 2BCUA 1RQLA 4WQ4A 2VPZB 3THXA 3UMBA 5HVHA 2L9DA 2DD8S 1IG8A 4DX7A 3B0XA 1HNZJ 1MLAA 2KTQA 2BJDA 1NDCA 1WC1A 3GFHA 2MSSA 4DV2J 3HPOA 3PRBA 1Z00B 1YJTA 4LVNP 4CFDA 3H3NO 4RPYA 4B9NA 3TVYA 2QLXA 1TE2A 3SEOA 1JLEA 4WIIA 3QU9A 1YLXA 1S9EB 1HX1A 4OJOA 1TVAA 2UU9K 5F9LA 3WT0A 1ATRA 1HJRA 4DR3F 4A8KA 1FKPB 2VIHA 4PHAA 4J91A 1JWWA 3MR7A 1WWHA 4WCEL 4GKJF 3CO9A 3HL8A 1R8HA 4FF2A 1TMMA 4KHSA 2BX6A 3SUOA 4EO6A 3BJYA 4OPAA 3FJ2A 1YG0A 4NV0A 4LVSA 2MKIA 4X65K 2E8OA 3TSPA 3HVRA 2YWFA 2VDIA 2I6XA 4HVZA 4K5RA 2J9CA 3OYHA 2OMLA 1RFQA 1QHTA 3QYYA 1NJIO 4UW9A 2YJFA 4AUKA 3ALYA 8ICOA 3BGRA 3HWTA 4J37A 1NU4A 3OYAA 4I2EA 1X3MA 2HHPA 3O4QA 4HH1A 9ICQA 4I2PB 5CD4A 5JVGQ 4HH0A 1VQ9S 3ONNA 2DEJA 4FE3A 3CI5A 3ID8A 4CIOA 1Y3JA 4IH5A 3O08A 4IL6U 2B9EA 4P0QB 1VSFA 3WXKA 2YX7A 4OZ3A 5AQTA 1KW4A 4BGDA 1Q95G 1YGYA 2A3JA 5CYQB 4DL0C 4DTSA 3I8DA 3D1QA 2G5HB 3RJEA 2HWIA 2EHGA 1S3XA 4NE9C 5LJ5Y 4CGHA 4I2IA 3LPEA 5FDLA 1RT1B 1HNXK 1JMTA 3RBDA 2B3TB 5F8NA 4LBIA 3M1VA 3C95A 3TQEA 3FFIA 2Q97A 2ZE2A 4UT4A 1N33F 3QWPA 2ZUDA 1CJVA 1SKUB 4CF9A 4PPZA 2QV6A 4CJLA 4X4OA 1YHQN 1KOHA 1UQVA 3IP4B 4Z4FA 4JI7F 3BBCA 4PABA 1RSCA 3ID6A 2ABYA 1ZM3A 1BY9A 5KFFA 4NMLA 3OR2B 5CRXA 4IYQA 2CDQA 3NTUA 1T3QA 9ICFA 2FUG9 3G4SN 2AX1A 4PHTX 1RT6A 4FF3A 1FJCA 3VGUA 4WJ3B 4ILJA 5CYJA 4F72A 4ZHRB 2UXCJ 1IWAA 2YKNA 4DR2J 3FC9A 2QEXN 5KI6A 3KWIA 2Z58B 2P9NA 2DGWA 3D0IE 2HHTA 5BPMA 4DFKA 3KKSA 5KFNA 2WVBA 2X6SA 4ZH4A 1PYTA 1U2CA 4C8LA 3IC1A 4LFAJ 4DZ6A 1T05B 3OR1B 3JXUA 1Z6RA 3NGTA 1SXLA 1ILYA 2A3ZA 4CGDA 5AI6A 3MEGB 3J7YI 3EXYA 5F3ZA 2G1HA 3VQ6A 1KXPA 2ADBA 3UKRB 1NI3A 3RB4A 5BRFA 4FVMA 1U48A 1PAUB 2VC0A 2CRLA 2M8HA 1T95A 3RVCA 2B4VA 5AM2A 3CDAA 3IHQB 5DDRC 3PIOQ 1QAYA 4C7ZA 1J9AA 2ZIXB 1OSDA 3UVJB 1DRGA 3CCLN 1OY6A 1C6VA 5F8IA 3Q8KA 2OI2A 5IT9O 4JS5A 4WZQA 4OI3A 1FKAF 4DHYA 3BBBA 3GYXB 3QPIA 3VENA 5DBCA 3GB0A 4LY7A 4TYAA 4URQU 3JPTA 1U1MA 2BPGA 2HI0A 1LOTB 1PYSB 5A8KB 2DHAA 1A5VA 3LWMA 1SGGA 2VBYA 4USIA 1WBDA 3IS9A 1S1XA 3OYFA 4CLWA 1RKJA 2XHCA 1UVLA 2IVNA 4YMEA 4YY3K 2CQ0A 4OLOA 2HFZA 2IBOA 1OKJA 2KT5A 4EBEA 1Q81T 3V6HA 4J2AA 2NUUG 3MAAA 5HL7L 3NDKA 3CQ8A 4WBFA 2IC3B 4P7TA 4BJQA 1KL9A 3RSEB 3NVKA 4OVLA 3O4NA 4DR7K 2CQHA 3F2DA 5GAGP 4ECTA 2GHVC 2E7XA 1UVMA 5KFZA 4IRDA 2E1FA 3MCOA 3LWLA 2ZDOA 1J5OA 5J2BA 2YX1A 3TUZC 1HUXA 3S3NA 3C7NA 4JHDA 2QLWA 2VG7A 3ZTRA 1NM1A 3HSGA 1V5VA 4ZVSB 3VA0A 4LRDA 4FJ7A 4WP8A 1BWVA 3WQUA 2R8JA 5IIMA 3O9TA 4MHVA 2HSTA 3HP6A 4RUAA 3BV8A 4DV3J 3D2QA 3GIRA 2RS8A 1CUKA 4P4OA 4CGGA 3ZDBA 1BWEA 3CWJA 2OP5A 1BNOA 2W2QP 1ZC6A 3NFAA 4KH6A 3FCVA 4F0HA 2CPEA 1EJ7L 3TKAA 4ECUA 2DH8A 4KO0B 3PJWA 2JZBA 5JLFA 3NRZA 4RWWA 2DNPA 3EEQA 2GIRA 4WFNL 1L7PA 4KFBB 2H3QA 2EKNA 4ZCIA 1VQ7S 2W24A 1VBZA 2D69A 1VI7A 2E1PA 4UTGA 1YITN 1HR0K 3T1HF 1ZJNA 2RJZA 5T41A 1UPMB 3EVOA 3H2VE 4ZJQA 3ZETA 4B3RJ 1FK9A 1K8KB 2QWRA 1TKTB 4G9ZA 1E4GT 5C24A 4HHTA 3H59A 5GADU 1V9OA 4A8XA 4RQ3A 3I31A 4KE5A 2JJ4D 3NNAA 3HFVA 1WSEA 2VQEF 5JJBA 1IKXB 4MJKA 1QVGR 4BR0A 2RD5C 2W4CA 1CZAN 1ZRMA 3ILOA 2O8EA 3J80U 4C8NA 4F4XA 5KFPA 2DNZA 2RQKA 3FBEA 2QMXA 4JS4A 1UAXA 3VAGA 5IQQA 8ICUA 5AQPA 5HNKA 3OLAA 2OIHA 3D5MA 2PMZF 1VQ5N 2GGPA 2OFGX 1TVRB 3RAMA 4CEQA 1B9DA 4CK3A 4WFZA 5HHIA 1K0TA 4GY2B 4AHVA 5JMNA 2W7OA 5HQ8A 2IVMA 8ICFA 1J5EF 4FJJA 4JKAA 2RILA 3L7UA 2OLWA 1BPZA 5A6PA 3MN5A 2FC9A 5J29A 3QIPA 2BCSA 4O5CA 1HYSA 4QZAA 5CY4A 2V8PA 1QAIA 1E4FT 2KHDA 3ULEA 3D0PA 1NK8A 3FGUA 1LNQA 2N3OA 3NAEA 3N7PD 1A0OB 4PWWA 4EMDA 5AHXA 3CCMS 3V81B 5G5GA 2NYHA 1RP5A 4CYUB 5CP2A 2ZD1B 4B6JA 1Q3VA 3I87A 1SXEA 2C2KB 3MMAA 1F5CA 4CGZA 4ZTJA 2A6OA 4UBBA 1XN9A 3EM1A 4DUYJ 1KDHA 5FROA 1HKAA 2ITGA 2O8BA 3N4MB 2IA0A 4NLCA 3KLIB 2IVPA 3RFAA 4YCXA 4EGLA 3ISCA 4UY8O 1Q8IA 4UZBA 1VQSA 4WU3A 4LRBA 2WHEA 3EPGA 2XMVA 1YZ6A 2DGTA 2Y8WA 4YG2A 2JOQA 2G8KA 2PEBA 5IIKA 4I6WA 3LP1B 1TYQB 5AJ3J 1WSFA 3S3OA 2XQCA 3DOMA 4DV0J 1VQON 5EE1A 2COLA 2LDYA 4B9TA 2PZSA 3KKAA 3U1LA 4UQTA 3OA9A 3UXNA 3DLGA 3ENVA 1IXRA 4K5SA 1KVBA 8ICMA 4U95A 2DH7A 2UVUA 1ATSA 3D0GE 5K14A 4H03B 3MCMA 2WONB 4RQ4A 4CTAB 2ZZTA 3ENQA 4DPOA 4EHTA 1S79A 4OX9K 4CF3A 2CVIA 4JI3K 1XNSA 3RB0A 3D2FA 3JTOA 1HEKA 1D09B 1TKXB 4P4MA 2EZZA 4MIAA 1WTFA 2F8TA 3V9WA 1NSQA 1KQSM 4KTZA 5I4MA 3TADC 9ICNA 2XWYA 4CLKA 4OI0A 3TJAA 1CLFA 1YJWN 3OYMA 2B7CB 1HKCA 5LMUJ 3LDLA 2D5RA 3RF9A 1HWUA 3LPUA 4ILLA 1QE1B 4G6VB 5D3GB 1S5JA 3LDPA 3ZDDA 4I2CA 3K9JA 3OFEA 3EZWA 4CF2A 2A40A 3MTJA 1BISA 5JVGL 4M5LA 5D4OA 4U8YA 2PSZA 5DDPC 3W7BA 1J2NA 2W9CB 3ZEUB 3P5BP 3JSMB 1KQKA 1JLBB 4A46A 1HKGA 3PX0A 4I6YA 5FRNA 4BDYA 2ZIWB 4R8UA 4QZEA 3ISBA 3IM1A 3EZ5A 1SUQA 3I1YA 3BSAA 1S1TA 3UD4P 2VODA 2XHBA 5DETA 3EE3A 1LFPA 3C15A 3Q7BA 3L3VA 3EXCX 1KFSA 4OQJA 3E2EA 4IOBA 4USHA 2VBWA 3KUHA 3ZLJA 4RW9B 1PCAA 2OYYA 3VQSA 3WKDA 2MSNA 4FYXB 2CWXA 4M3YA 5AQUA 2XCPA 3GZ7A 2YV0X 4RTFD 4ZP7A 2R2UA 4DL2A 2MJNA 1WC3A 1HARA 2WW8A 2X6NA 3QNMA 5EUHA 3KD1E 2FE9A 3NCIA 4ATNA 4X5VA 2E1RA 2KFYA 1HNVB 4M5DA 2EQYA 1N0UA 1OVYA 4OYIA 4JLHA 1T8EA 3DDNA 3F2BA 3HJEA 1XO0A 5J0RA 3KK2B 3VA3A 4CJKA 1H3DA 5F2RA 4FJ8A 3R1HA 1TU0B 1NCLA 4X65F 3C94A 1CVJA 3HHLA 1OQ6A 1LWXA 1S0MA 2WTUA 1FE4A 3VZHA 2H3GX 5KFMA 3P45B 1S72N 3DHWC 1R89A 9ICPA 3QWUA 3GR1A 1BHNA 1ZD4A 2QL9B 4FS2A 1C1AA 3JAMY 1XMQK 3R8EA 2O4IA 1JLCA 4KHPK 2A6AA 3T7ZA 2CPDA 2OPRB 1P27B 3QFHA 2W2OP 1JNZB 3LUYA 3PIOL 3ITHB 1IM6A 1GH8A 2P51A 2IOCA 3UNGC 1Q9YA 2OWOA 4UZCA 1NGFA 3CJSA 1Q53A 3O80A 2MEWA 2A18A 3O1WA 4RQMA 4CD1A 2ZHAA 2HLUA 2YI1A 2H5EA 3PXGa 2Y0SF 3R5CA 5MLCV 4YXJA 2EG1A 4NA1A 3N5FA 4HTLA 5GAEI 8ICWA 4P4PA 1RWPB 4HAIA 1JCGA 1PSDA 4JKDA 3KJVA 3PIPQ 3NRWA 5GAGI 3D2NA 3M8PB 4PL1A 2ZUBA 1Z26A 4CF4A 3PV8A 4TN2A 4X4RA 3HVAA 3LF0A 2GH1A 5CHCB 3KLVA 4FZLA 2BDPA 1R31A 4CLLA 4QS7A 3SCXA 4K0KK 1WOOA 1TL7A 3UDCA 3VEXA 3N01A 2F7VA 4KB7A 4C11A 4B3MK 1V5IB 4XO0A 2HF4A 2NRXA 1L8LA 3ZTQA 1E6VA 1JN3A 3PNCA 2DKOB 3PFOA 1GOCA 2P9KA 3ZSWA 1GX6A 2JMGA 4MKVA 2QW9A 2YWEA 2RLTA 2CPRA 4W90B 3E66A 1R59O 3KHHA 2W01A 5J2QB 3G6YA 4KHMA 2CADA 3W9HA 2YXLA 4BRCA 2IM3A 4FJKA 3LPYA 1IV8A 3K89A 4PXEA 2ZM6J 2C2RA 1I94F 5TZVA 1J5EJ 3CUNA 4F93B 2PYLA 4F5RA 1VDHA 4OI1A 3MMCA 9ICJA 5BYQA 2JEIA 5JS2A 3SFGA 2E1YA 2DBBA 4CF8A 3EUB2 2YHXA 2OCEA 3H20A 2VJVA 3MGHA 4J9MA 4IEEA 2W11A 3TAEA 3PY8A 4C0BA 4U7CA 5DG7A 4C4TA 4U8VA 3QO9A 2EXUA 4MT1A 4L75A 1N36K 1MWZA 3FRZA 1TL3A 2N1RA 3C8YA 2EAMA 2FLOA 5K8NA 4O8KA 1QQMA 3CSKA 3LGHA 3MMVA 1AXQA 5EVZA 5KQ8A 1XMOJ 4YUDA 3OXFA 2HHWA 2CNLB 4FW1A 5KFSA 3TX0A 3T6BA 3C6AA 4QJVA 1TZ0A 3CIZA 5E33A 4MN4C 5J2GA 1WF2A 3N4QA 9ICBA 5LSLA 4MF8A 3AQOA 3VF6A 3W0LA 1VK8A 1REVA 4NLYA 2XNQA 2L9NA 3JPQA 1FI4A 2Y9HA 2E4LA 3WU2U 2LXUA 1U8WA 3M5RA 2HDOA 3KXDA 2C2OB 1WOPA 3M6UA 4GO7X 4JEPA 2CG4A 3L4QA 5HMZA 1CG2A 2E66A 4DQRA 1OYDA 4C80A 1IKYA 2B9WA 4Q43A 4HI2A 2VV5A 8ICPA 4CLZA 2H3IA 4ACOA 2OTJS 3HRDD 1UP1A 2WC9A 1N8RO 5H2FU 4MFFA 1GAOA 1VQ6S 9ICEA 2ZJQQ 1APSA 1J6ZA 1VRUA 2W04A 4EX7A 5IT9U 3VAHA 2FHKA 2C3PA 1U1PA 3TTCA 3TEGA 3E8OA 4DKWA 2CJKA 4N5SA 3NNHA 4DOCA 1S49A 3C6HA 2A0FB 4Z2XA 2LP4A 4YDUA 1KC8T 3VQQA 2DPIA 4M5NA 5JVHQ 3WK6A 5U47A 4DV1K 2UUBJ 2UUTA 1B43A 5H9EK 4K2XA 2YHYA 4DLGA 2ZIUA 1SH3A 4C8ZA 3G6XA 1QQNA 4ZN1A 3UDVA 4P6QA 2VG5B 1DTTB 1NPPA 2XBPA 1HHTP 3CTRA 4XPCA 3Q86A 4Y2KA 2F44A 5D4BA 1KSPA 1GTEA 3HVTA 1N34F 3W9JA 1HR0F 4QOTA 3L3CA 3OTOF 5CYMA 3DXMA 2GW8A 3L2QA 4E7JA 2G0JA 2B0GA 3SQGA 3AGRA 4BWJA 2R8GA 2M52A 1HHQA 4DR4J 4KHNA 1CULB 2D0CA 1S9FA 4O0NA 4D3GA 4CFBA 3U6FA 4DG1A 3IFEA 5GAHU 2YTUA 4USAA 1T0TV 3IR6B 2RU9A 5ETMA 2J6UA 3M7DA 1OYEA 3GYNA 2BV3A 1H73A 1LW2B 4CH0S 4PQUA 2SXLA 4ZS6A 3CCTA 4NI2A 3VALA 5M1NA 4DFPA 2UU9J 5E26A 3EKUA 2YNIB 2ALZA 4I64A 4F67A 3OXGA 4E7LA 2K8BB 1WG1A 2YCHA 3I5BA 1JKHA 2K4PA 3KYLA 1W26A 5ADXH 3PX6A 2WSEC 4IQXA 2AEMA 3A0BU 4EWTA 5AQJA 3CEDA 4BRLA 2QI2A 1TUVA 4OFZA 3QFWA 3SQ4A 4X64K 3OYJA 4X65J 3L2UA 3NUQA 3BM7A 1AROP 4A2AA 2VASA 4QIGA 1VLOA 1RQNA 2GVZA 1TV6A 3WK4A 4JI8F 2RKIA 2O8DB 3U27A 3GG4A 3OVNA 4WJBA 2WUSA 3LOUA 1R6VA 4RX6A 2XCAA 2OHFA 2G2OA 4ZITA 2ZBCA 4A8QA 2BUNA 5ADZA 1UW4A 2QM1A 4ED0A 1VQYA 2HGLA 1NPKA 2R4FA 3P96A 3C23A 4FNIA 2E1EA 2MAXA 1VJ5A 5KTQA 5C5JA 1BO5O 1BL3A 4DS5A 4K4XA 4RNHA 1IQZA 8ATCB 3ZYYX 2QWLA 5DZ7A 1Z00A 1R43A 3QATA 3HYFA 2FMPA 3S7RA 2LA6A 3L7PA 2CPFA 2FJDB 1JLAB 1HNXJ 2W42A 3CCWA 2J9DA 3V1RA 4KBIA 3MHYA 1S9EA 2YNHB 4Y0WA 2FVRA 4E98A 2YN4A 3MUTP 1BNPA 1T02A 4Z4EA 3HCXA 3EO3A 2V2VA 3Q8UA 1GQEA 1FKPA 3Q89A 2IY5B 1GEHA 1U6ZA 1SH2A 1NM2A 2VU5A 2NXUA 1I39A 4DR1K 1OH8A 2LHTA 1KHVA 4BE0A 4P0PB 4TSXA 3HX9A 2VGNA 4IBNA 2RDIA 3CFRA 4O4GA 1FRXA 3DGVA 3HTVA 4NLRA 5F8HA 2XICA 3GSDA 2UYTA 4NWBA 3N9UC 5IM0B 1FKOB 1D8BA 4MKBA 4YB5A 3UE5A 4QZVB 4M3WA 1XQSC 3DU6A 3GSIA 3ZO7A 3OHBA 4B9LA 3K7RA 4AXIA 2QLTA 4ED3A 1I3AA 4QCLA 3CJ0A 4CT9A 2FLPA 5IWAF 1VGYA 2E3TA 5AQRA 1N32K 2Z1HA 1JCFA 2WRMA 7ICLA 1G7CB 1L7NA 1MN7A 1OQ3A 1UZDA 2HQGA 4I2PA 3NVVA 5EWGA 3ZZZA 3ZNUA 2NSBA 4NL9A 4ZA1A 1RWKB 4O9MA 1VQ9N 1DJ0A 3B4DA 3VHQA 2OELA 4P0QA 4AL5A 8ICTA 2H65B 3BEGB 4G1IA 5KFTA 4ZP9A 3NGDA 2MQ8A 5CYQA 4GVLA 2GJFA 3QEPA 3T3FA 3IM8A 4KREA 2MQMA 1RT1A 2YNFB 4OYWA 1KWMA 2V8DA 2Z30B 2LVWA 1X60A 3IGVA 3PIPL 3ZZPA 3UN3A 3W2WB 4FM0A 3J81Y 2WVCA 5ETNA 4LFBK 2HBKA 4CEEA 3LK9A 4RW8B 2VBXA 3MUVP 2WFBA 1BHLA 5J0SA 2VQFF 4WK1A 2BJ7A 4MEYA 1ZBSA 2YPZA 1HD1A 1N5TA 3OR2A 2H4YB 2LQBA 4IKFA 2W2PP 2ZH9A 1KCFA 1HLWA 4WU2A 3LP0B 4YY3J 2HNZB 2FTRA 1EZZB 1IR1A 5CE3A 4ZHRA 3N7SC 3E1YA 4A59A 1SJ3P 4M3ZA 2HK3A 2IHMA 1NDPA 3FSYA 3DI6B 8ICHA 5I3PA 8ICZA 3RMAA 2UXBK 3H5XA 4DR7J 3P1GA 4H0OA 5AK4A 1RBSA 4JAXA 2ACYA 2DY4A 2MZRA 1A6LA 4CBWA 4F91B 1VS3A 2DB1A 4M1KA 1T05A 3OR1A 4U6PA 2A41A 1BG3A 2LBOA 1BU6O 2HFUA 4AQYK 3MEGA 3VESA 3D6MB 4O3MA 3GPAA 3UKRA 2IBKA 1I6JA 4YOYA 4USJC 2NQPA 2FI1A 4AHCA 2H3VA 1F2HA 1C0GA 2FPHX 4OJPA 4KTWA 4YOEA 1N2XA 3LYSA 3ZI4A 3SR6A 3TAFA 4CJ3A 4UATA 3I82A 3UVJA 4BVPA 2B8PA 3DFEA 4RW6B 3PSFA 1VQMS 3BPDA 3X3UA 1RT5B 2G0IA 4JI0F 1DHMA 1Y3KA 4CK1A 3AOBA 4C0ZA 4A48A 4CZMA 4IQUA 4IOAQ 4IC9A 4RNNA 3J80Y 2DKZA 2CJ9A 4NM1A 4FWOA 3BDEA 5A8KA 1HR0J 4FYYB 1U1NA 4XH1A 1Y64A 2ZUGA 3HVWA 4HHJA 3VR1A 2KJ5A 4HHHA 5J2NB 4B1YB 1EKSA 2LQ5A 1Y5IB 5M1PA 4RO0A 3VQDA 3NKYA 4DTRA 1OSCA 1T9XA 3ZCMA 1HYVA 1Z2ZA 3SQ2A 3V7JA 4DPUA 2IC3A 2AMCB 4I2BA 3RSEA 1X4AA 2BKOA 4Q5VA 4J9UE 4DX6A 2FHJA 2KI2A 4NL5A 3K0SA 4PZOA 3M1YA 4KMUA 3PW4A 2N4DA 3CJ8A 1FDAA 5DM6Q 4J90A 3RJJA 4CZKA 3O0FA 5AQFA 3T5LA 3C14B 1MA7A 4C48A 1TUUA 2P6RA 3MR2A 9ICGA 4KGVB 2GVDB 4Y65A 1ZXOA 2E8AA 5AQNA 5JVHL 4NZ6A 2ZTDA 1VSLA 2HMPA 1EARA 5DZ6A 2F65A 4KN4A 1U1KA 3WBZA 4DSEA 4TU7A 1PKUA 4H0YB 4KO0A 3CULA 3W3DA 1NOYA 1RWWB 2E5LK 1VQ4S 1XMBA 2DQNB 2GO8A 2YMQA 2ROGA 4NLWA 4B9SA 2DH9A 1QSLA 4KFBA 1FT8A 3K5OA 5DBBA 2AA4A 1N36F 1ZXIA 3S6JA 2C1EB 7ICIA 4MK9A 5LMNJ 5M2RA 2FBTA 1K8KA 1TKTA 9ICTA 4PPXA 2HGNA 2EWSA 2CA9A 3MPWA 4USMA 3LVWA 4BC2A 4I1TA 3R7NB 2PN6A 2CJAA 1L3VA 1IKXA 4HKQA 1HUZA 2QGFB 2BGGA 2L48A 1H0HB 4LD0A 5CA7A 3E58A 3EVMA 2ASLA 1NK4A 3S3MA 1XJWB 5D4PA 4BRIA 2UUCF 5BR8F 2VZ9A 1IV0A 1JALA 4O3NA 1BPDA 2WB1F 2OPSA 4F4KA 2QFJA 2P8IA 1RDRA 5K5MA 4P71A 1TVRA 1X2IA 1UPHA 1HQUB 4NEZA 5EX0A 3IFRA 4DSFA 4GRSA 4OX9J 3AVKA 4JI3J 1YVUA 3KJNB 4JI5K 4R79A 4PKHA 4B1WB 4GVMA 2JC0A 2OSQA 4HTIA 3R27A 1TUYA 3H4DA 3OL8A 5GIOA 4M7YA 3UM9A 3EYZA 2GEMA 1JXLA 3WNHA 1UTAA 4TY8B 4LH5A 1AW0A 1RAFB 4ANCA 2WOMB 4DR6F 1IN0A 2VWBA 2D1CA 3VAMA 3ZZUA 3G0ZA 3D6RA 3V81A 5KG1A 3WNEA 2JEFA 4IEIA 3CCMN 4CYUA 3D2SA 1KAYA 2ZD1A 2GELA 2KJWA 2NSCA 3MCSA 5JUMA 2CFXA 1NGGA 3NS7B 2OH2A 1B7YB 2ROEA 3WEEB 1KTVA 4DF4A 4PXBA 3CNHA 1B64A 4DV5K 5J0WA 3KLIA 3PYFA 5ALMA 3TARA 1CLQA 2BQ3A 2J6SA 5HJXA 4A4JA 3P6YC 2KW4A 4PGXA 1B4SA 8ICXA 3CO0P 2ZH1A 4DU4A 4H5VA 1TKDA 2G0AA 2PKEA 4FZZA 5C12A 3BH7B 4NLBA 1TYQA 2GHWA 2VPXB 2FJXA 5M1FA 1U9LA 2F8HA 5AM5A 4CJ7A 5AM3A 1UPPA 1URJA 2EZXA 3NS1A 4QNLA 2HYIB 2P5GA 4E1MA 3IDHA 2OKQA 3PVXA 3P3DA 3RBZA 4DR5K 3M9MB 2DHGA 2ZBQA 3KHYA 4WYBA 3OYNA 4K7QA 4PXDA 2CPYA 5HVGA 1NGIA 3QQCD 2WONA 3MN6A 3B9JA 4CTAA 4XRHA 4NLOA 3VF4A 3UQSA 3UD3P 2VA2A 3MM7B 3THTA 3VAFA 3FZLA 2LU2A 1BIUA 3T19A 3VQ5A 5KFDA 1W7WA 4YFUA 1TKXA 1SV5B 1RJJA 4I2JA 1KEJA 3WKAA 4Y2YA 2PA3A 5AQIA 2F77X 3LGMA 5GAGU 3GJRB 1TAQA 5HHHA 1FEZA 1H2VZ 5KG4A 3GIIA 4P2MA 4E89A 1MN8A 2XYGB 4NZ0A 1VSHA 1MSWD 1QE1A 1X3NA 5D3GA 1ITGA 3OYEA 1DEJA 3C5FA 2W1BA 3CMAS 3H8JA 2RUGA 5L9XA 1VHFA 2XS7A 4OX6A 5AR0A 2Y1LB 3UCGA 5F3XB 2DF4B 2W9CA 3HD1A 3ZEUA 5E3RA 2AYEA 3ZD9A 1XMQJ 1F44A 4KHPJ 3JSMA 2V50A 1JLBA 3RTVA 2QLBB 3S8SA 4JV2A 4CZHA 2E6MA 3I4PA 2YKOA 1HBUB 4MFBB 2ZIWA 4KH4A 5BJRA 3FCHA 4PWDB 4DV6K 3G2XA 3D45A 1VBKA 3K59A 2GZOA 3BGLA 4WKYA 1NMNA 1S6OA 5J2MB 1XERA 1UCVA 2FDRA 2BANA 3DMJB 3W3SA 2K06A 2B9YA 2BEFA 4OZLA 2QZ8A 2BJ3A 3H5UA 1ED1A 4RW9A 3WIUA 5FP0A 1AYEA 1RB0A 1H74A 1NLVA 2AP6A 4OZNA 4F8RA 4USKA 2HK2A 3B4MA 2OD4A 4PKGA 7ICTA 1RAGB 2KXHA 1EO1A 3W2VB 5CH7B 5M1KA 1ZQMA 4U7UD 5K8MA 2N4CA 4DSJA 1HNVA 4CJVA 3A0HU 2OD6A 2KHQA 3IRWP 4TUPA 4KR0B 3JSBA 1RCHA 4B3TK 3KK2A 3VCDA 2JGUA 3OTDA 3IKMA 4K0KJ 4FLWA 1V85A 4KLQA 9ICXA 4B3MJ 2W43A 2DO4A 3H2UB 1ESVA 2HHUA 1F3FA 5CHGA 2KN7A 1RCXB 1T9UA 3ONQA 3UKUB 3JYTB 1WKJA 2DRDA 3ZT4A 4DL7A 3ILIA 1PILA 4IG0B 4M7XA 5GMEA 2R7RA 4ECXA 4MYTA 1XUPO 1N32F 2OPRA 3VF0B 3DDHA 3G82B 2C2NA 2N7YA 1ZQTA 2MKJA 3ITHA 2CQIA 3ZSZA 4K4ZA 3GQCA 2V2QA 3TWHA 3R5DA 4EZ9A 1SC1B 1Q5YA 2YMMA 3IR5B 2JLEA 2BKEA 2VKZG 5B0EA 5CABA 2IAJB 2AGOA 1QQ6A 1NPRA 5AK3A 5AXLA 1ZAVA 2YKQA 2MKYA 2KH9A 2IOFK 3B54A 4LSZB 1IKVB 2D3ZA 2Y8YA 3AU6A 4OKEA 4YMOA 3WNGA 4ZDNA 4IH7A 2RB7A 3VQ9A 1N36J 4KHQA 3HJVA 3KJFB 4HR2A 3CC7N 1UL3A 4OLPA 3QLHB 2F9JA 3KNAA 2QWNA 4BC4A 4TQSA 3M8PA 2DHSA 3C5GA 3BGUA 2HEKA 4DV4K 4PWUA 4KLHA 2VBZA 4I0WA 3UMCA 4DU8A 1X66A 4F92B 2MKCA 2XMMA 5KFRA 1MWYA 2UUAK 1VJQA 3TTDA 3FBFA 2GCFA 2YTCA 3FZBA 4CO2A 2CPXA 2QWPA 4WFAL 2VANA 4LF4K 4J9KA 5I3QA 3BDPA 4KI4A 5F8JA 3AVAA 2A1JA 2KEYA 3H4BA 3ZDAA 1FX4A 4OZ2A 3MEDB 3VGMA 4M5GA 1RAJA 1XNRF 3D6FB 5ALKA 1HQEB 3D67A 3O3LA 5J2QA 2PFNA 2A6MA 3DDKA 2F1IA 2Q2RA 2XI2A 2Y9UA 4CECA 1W9HA 4M9HA 3DXBA 4DSIA 1JJ2R 4X62K 1S0NA 3ZZ0A 4DPWA 1BDGA 1V97A 3PUFA 2KZMA 5CZ2A 2R3VA 2YX6A 3ZSQA 4UB3A 2H51B 2K7KA 2ZGZA 1UEUA 1ZQSA 3RW7A 4LF8F 4FXVA 4FDFA 1ZQHA 4DV1J 2K4IA 4DTXA 3LDNA 5H9EJ 4QU7A 3MOJB 2HBJA 4XPEA 3NMAA 3VEVA 2VPYB 1YHQS 2GX8A 3K0JA 3GFKB 4OYAA 2FBXA 3V1OA 4DUZK 3R6GB 4B9UA 4LRFA 3OS2A 3G4SS 4Y2CA 2KXFA 8RUCA 3JAMO 3W65A 2EC0A 4YD2A 4J9NA 4FK2A 2F3JA 4M63A 1ASUA 3ICLA 1UEVA 1LWCB 2QEXS 3LH2S 4ECSA 4AT1B 1BD6A 4L3KA 2FSNA 4RG8A 2GIQA 1SV0A 4P74A 1HIWA 4CRXA 3WC0A 1ZRNA 3V6DB 1RADB 5HR7A 5J0QA 4YDDB 2Y9TA 2AQ4A 2DJWA 1ZM9A 2OTJN 4NCGB 3V4MA 3CCUS 1H2TZ 4WE1B 1L7OA 4X4QA 4B02A 1KDNA 1HRHA 1S97A 2PE8A 1P1TA 3OT9A 3MM8B 2AGPA 1C20A 1GXUA 1YVFA 2NS1B 4KYZA 3BH6B 4JK7A 2Y1RI 3CJ1A 3CVKA 3CCLS 4KPCA 1NSAA 2QA2A 5ALVA 4AF1A 5F1XA 2NR0A 5B08A 3LANA 3DRPB 4CFAA 2OFHX 1OXJA 1UZHA 5ALWA 1L8OA 2MKKA 4X64J 3R2DJ 1AUSL 3CCEN 4C8MA 4ZVHA 1U0HB 1ZZNA 5ALNA 1DQ9A 3F9MA 2XI9A 4X66F 4U67Q 3D2EB 3H0MB 2VG5A 2CIMA 5BRDA 1OUQA 1DTTA 2IRYA 4M5KA 4IOCQ 4GMKA 2FGCA 2PI5A 4Z7CA 4BRGA 4ZOSA 1EXQA 1EB0A 1NH8A 2XC9A 3VPZA 1WC5A 1RHQB 2XZTB 4A8OA 1BCMA 1H1VA 1H72C 1TFRA 2E7VA 1ZM2A 1CXUA 3GILA 3CD0A 1HQ2A 2BE2B 1HBNB 1YWXA 4JKCA 4MKYA 1R3NA 2RRNA 3HKZC 2CNNB 2GWJA 1GLEG 1YAGA 1D8ZA 5AKIA 3BKTA 3TAMB 3NH1A 4NLUA 5LSOA 4HCBA 1GLDG 1NSKL 5KFBA 1LW2A 3SCKE 3MXMA 1JLQA 4ILRA 1WACA 1QQ5A 1B3TA 3I0RB 3RAQA 3ICXA 4PAAA 2UP1A 1IBMK 1FWLA 1ACMB 2KU7A 1REGX 4HI1A 5FPMA 4RQ8A 3M4XA 3AVIA 1TUGB 2ZJ5A 4UAYA 2O6KA 4DR1J 4R66A 3THYB 4DCCA 3EVWA 1RPLA 3MAQA 1LVHA 3MURP 4NXNF 3R6MA 2XS2A 3PR5B 3SI6A 5C10A 3P49B 2X74A 2YKPA 2YWKA 2QMUB 4KJIA 3JQJA 4O5BA 3KMSA 1G2EA 1XIQA 3FFKB 1NLKL 1IBLK 2NLXA 1KC8O 4B1ZA 4M5JA 3G86A 4V19S 2O8DA 3C3LA 3QNWB 1GMUA 3MD1A 2ZUAA 2LM4A 3F5EA 3Q8YA 1SIJA 3K1ZA