4DSKA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, ppi and calcium
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
579
structure length
575
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*GP*CP*TP*AP*CP*AP*GP*GP*AP*CP*TP*CP*G)-3')
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 205
structure length 575
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dskA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dskA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dskA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dskA01
5JUMA 3QIPA 1RYSA 4B9MA 3PW5A 1X2IA 3QE9Y 4FW1A 4F5RA 5DBAA 4NXZA 4RPYA 3UXOA 3ISBA 4C8NA 4F4WA 3BQ2A 2IOCA 2W8KA 2XY5A 3T5JA 1XHZA 3TAEA 4DSIA 4QAGA 4J2DA 4J9RA 2F1JA 3P5JA 3KK2A 3RB4A 2AJQA 1U48A 4YFKA 2BCVA 4ID1A 1L3TA 1DGSA 1KVBA 5JS1A 5KFOA 4O55A 2OYQA 3IRXA 1TVAA 3B6PA 2FPKA 1YT3A 5EOZA 3I8DA 4QOZB 3TABA 5KFRA 3CM5A 3SQ1A 3K57A 4DTPA 4PH5A 1JMSA 3WNHA 4ED1A 5J2CA 2XY7A 4N47A 1KVAA 2BQ3A 1RBVA 5C25A 3NDKA 4F2RA 4W5RA 1ZQOA 3AVFA 7ICFA 1BHLA 4JV0A 1HUZA 3MXMA 4ECZA 4DL4A 4DSKA 3PX0A 1WAFA 3VQBA 4ED2A 3ZSZA 4I2DA 1C1AA 4CFDA 4Z4CA 2RDIA 4I2AA 2HNYA 4MQ3A 1RXWA 4EZ9A 3OYLA 1EETA 4R63A 4KITB 3TI0A 2DFEA 4CK3A 4EEYA 4RQ6A 3MXJA 5L9XA 4IG3A 4HCBA 4P4PA 1T4GA 1HYZA 4FVMA 4O5KA 3F73A 7ICNA 4F5QA 4ECUA 3Q8RB 4B9VA 4KHSA 3K75D 3KK3A 3F9KA 5JS2A 3ISDA 1ZQIA 3RJKA 3PMLA 2R8KA 3UPQA 4RQ7A 4CK1A 1S0NA 3M9NB 4E7IA 3M8RA 3V1OA 1ZETA 1BIZA 3KHLA 2NRZA 1LWEA 3H4BA 3OS0A 3RWUA 4PHAA 3M8QA 4CHQA 4B9LA 4KB1A 2A1SA 4F3OA 5C5JA 5J2HA 4IR9A 2ZUDA 3SZ2A 4M47A 1YTAA 2GUIA 2JZBB 1LB2B 4QWAA 1Z25A 4CHNA 5HHHA 2YNIA 4WE1A 3ZSWA 4O5EA 4KLSA 1IKWA 4FJKA 4B9SA 3PR4A 5I3UA 7ICSA 4CJTA 8ICMA 3OJUA 3LZJA 4JUZA 4QZIA 4FK0A 4Z4GA 4Z6EA 4CJFA 4DL7A 4E19A 2MAXA 3ZSVA 4YD2A 1NK5A 2R8IA 3CQ8A 2DY4A 4RNMA 5KGWA 1RTDA 2ZUCA 2OPPA 4MEYA 3OYDA 4R64A 5J2KA 4I2FA 4CGIA 3MBYA 1L5UA 3HW8A 3NF7A 3T5HA 1C1BA 2BCSA 1TKXA 5HRRA 2G8KA 1HMVA 4CEEA 4AHRA 4F4YA 1XO1A 3OYFA 4NCAA 8ICBA 1TKTA 2W9MA 4QZCA 3H4DA 3PVXA 3MXIA 4K8ZA 4KO0A 2C22A 4RQ5A 1RT1A 3NF6A 1QSSA 4FM1A 4FM0A 4O0IA 4W5QA 1RT2A 8ICYA 7ICUA 4TURA 1K1QA 3RAQA 3AVKA 2LSNA 5I42A 9ICSA 4H8KA 3KLIA 3C5GA 4KLHA 5BOLA 3ORYA 1CZ9A 3DRRA 4KLIA 2V4QA 3V72A 3JPRA 3JPSA 4KAZA 4KHWA 2FLLA 3LALA 1RDAA 5KG2A 8ICQA 3NF9A 4AHCA 2XO7A 5KFLA 1UA0A 4DQQA 4HUFA 4E7LA 1BI4B 3S3NA 3E01A 3V6HA 4O3RA 3VQDA 4DQSA 3RJEA 4I9QA 2BPFA 2ALZA 4UB4A 1S5JA 2G8UA 2RN2A 4ED8A 3DMJA 3Q8PB 1IG9A 2ZJ5A 4PHPA 3AO4A 5J2JA 8ICAA 3OYKA 2R8GA 1ZBUA 4Y1DA 3VQPA 4M3RA 1D5AA 3NGZA 1Q9XA 3GIKA 1ASVA 4J9SA 1NOMA 4DSLA 4O3NA 4FLXA 2D0BA 2NUBA 3D45A 7ICEA 4MFFA 9ICXA 1QQCA 2DTUA 2VA3A 2R8JA 1XSLA 4M6WB 4KLTA 3Q8QB 1HYSA 3DYAA 3ISNC 2ZTDA 5J2DA 4CF1A 4QW9A 4O5BA 3V1QA 1T03A 1F21A 4I29A 1A5XA 2RDJA 1SKSA 4JS4A 1LW2A 3HPOA 8ICFA 5J2FA 2VWKA 1TVRA 2HNDA 3SV3A 1C0TA 1JL2A 1J5OA 5DG8A 4DTSA 1ZQUA 1U45A 4C8MA 5KFUA 3KHRA 3ZDEA 3K5NA 1RNHA 7ICPA 4DF4A 1TL1A 4DTOA 4KFBA 2C2RA 4RUAA 4JV2A 1HJRA 1HPZA 4R8UA 4F4KA 1NK6A 3MAQA 1ZQGA 1C0UA 1HQEA 3NF8A 2IGIA 5FROA 2C2EA 5KFAA 1QE1A 4IRCA 4AHSA 1S76D 1EP4A 4J9MA 2BPCA 3B0XA 1U49A 3QEVA 2B6AA 3SYZA 4FCYA 4FJLA 3DLBA 3ZSYA 3TR8A 4CCHA 1Y97A 4IQWA 5J2GA 3GV5B 1RBTA 4BE1A 2HVHA 2HHTA 2VG6A 5DQIA 1Q8IA 3HPHA 4FJ8A 7ICGA 3NGIA 3EW9A 4MEXA 1ZQVA 4RQ4A 3T19A 1NOZA 4PHDA 1Y88A 1NJYA 3OYAA 4TQSA 3MR6A 2ZTCA 3V9WA 5D49A 1BQMA 3HL8A 4I2QA 3MDAA 5J1EA 3M8PA 5IIKA 3ETLA 4JWNA 3OYHA 1JIHA 5KFWA 3EY1A 4W5TA 1ASWA 1TK5A 4BE0A 4ELTA 5KFCA 5HLFA 4M9LA 1SZPA 1S9EA 5L1LA 2F8SA 7ICKA 2PXIA 3FDSA 5CA7A 2VG5A 2HHSA 3RH5A 4PWDA 5HMMA 2FMQA 4MF2A 4M9HA 1RDCA 2ASDA 1T3NA 2VG7A 3PR5B 1WAJA 4IRDA 2RF2A 5BOMA 1TV9A 3HWTA 1BPBA 4M3ZA 2PI4A 4KLFA 3AV9A 2V9WA 1SV5A 4XA5A 3I0RA 4AHVA 4Z4HA 4IBNA 4CEAA 3V4IA 4B9TA 8ICXA 4PPXA 9ICRA 4DTUA 1L3VA 3BQ0A 4BXOA 4QZBA 5J29A 4N76A 4ED7A 5DBCA 1S10A 3HJFA 2BCUA 4F2SA 3HXMA 1Z26A 1ASUA 2W9BB 3TAMA 2F8TA 8ICCA 1DTTA 4P2HA 4KRFA 2IHNA 3LPUA 4F50A 4AH9A 2YNGA 1L3UA 1KFDA 5KFIA 2EX3A 4CFCA 4YR0A 2BQUA 1REVA 3PW0A 2VANA 5SZTA 4L8RB 3ZDCA 2YHBA 1SKRA 2J6SA 4EP4A 2VA2A 8ICEA 3SUNA 1JLFA 3SPZA 2XRIA 3N4MB 2OPSA 1U4BA 3EYZA 3AVJA 4E1MA 1KLMA 2DPJA 4EBCA 4CJPA 2HVIA 4KLUA 1QSYA 3E2EA 1VRUA 3PY8A 4CEZA 1TKZA 4G3IA 2F1IA 1MQ2A 4RQ1A 4DS5A 4FBUA 2XC9A 1RTIA 3QEIA 5KG7A 4JWMA 4R5PA 2KW4A 4O3SA 4M42A 2GBZA 4IQVA 3ZSOA 3QERA 1VRTA 3TQ1A 3NH0A 5KG4A 4R65A 1BCMA 4J9LA 1ZQPA 3OS2A 3SUOA 1HNIA 4LY7A 4JK1A 3ISCA 3NBPA 4ZH4A 3RRHA 4CGJA 2X6SA 1VSFA 1ZQZA 5E41A 3ZT3A 2X6NA 4JRPA 5HP1A 4CJLA 3RRGA 7ICMA 4CEDA 3EZ5A 3OY9A 1ZQQA 4JV1A 1LAWA 1I3AA 4IFVA 1BCOA 1KFSA 3PNCA 1J54A 4AILC 3OSNA 1B22A 1T05A 3QESA 3TFRA 3LK9A 4OGCA 5KFFA 1S1WA 3GIIA 4ZHRA 1LWCA 5TZVA 3C21A 8ICHA 3T5LA 4CFAA 1Z00A 1A5WA 3PW4A 5KGXA 4KMUA 3AVMA 1TK8A 4GMJB 1FK9A 2PFOA 3I0SA 3K59A 1VSJA 2DPIA 3G6XA 2QK9A 9ICVA 1BPZA 4RG8A 2P6RA 1Q9YA 4DSEA 2R7YA 2DFLA 5DQHA 3TAGA 1JXEA 5F9LA 4TUPA 3HSTB 5BPCA 4RQ0A 1DTQA 8ICJA 4F91B 4NYFA 4KN7A 3MR3A 1S0MA 4YMNA 2HW3A 5KT5A 4R66A 1TL3A 4M3XA 1S1XA 2NRXA 3RJFA 1UT8A 4K4HA 1HRHA 3A2FA 4YNQA 2XCAA 2X74A 4DU4A 5DKWA 2PFNA 8ICKA 3PO5A 3HP6A 5DGAA 4O3PA 3KLFA 3MGIA 4RNNA 5D3GA 3BQ1A 1JKHA 7ICLA 5IIOA 3PW7A 4KHQA 2OPRA 4J2EA 4XIUA 4CESA 1CEZA 1RPLA 9ICJA 3RJHA 4M3UA 4QWEA 4KHUA 4Q44A 3HT3A 5KFKA 2KZMA 4CERA 4DSJA 1VSMA 3VQ4A 2I9GA 4YMMA 4IQUA 3OHAA 1FKPA 1RBRA 1W0HA 5CYQA 3NCIA 4ZTJA 4KB0A 4FJHA 3L3VA 1GOBA 4M45A 4E7JA 3N97B 4KKOA 1T8EA 3OS1A 3NAEA 4KLMA 2JGUA 2ZE2A 2BQRA 3BQTA 5DG7A 4J2BA 4UAWA 3OJSA 4DL2A 3L3UA 4KTWA 1S9GA 3V9XA 4RW8A 3HVRA 4IDKA 4HCCA 4H4MA 1ZQSA 4OPJA 3IM1A 2D5RA 4O9MA 3L2QA 3P83D 4I28A 4DOAA 4MFCA 3V9SA 1SL1A 4DOCA 4I2EA 1FKOA 1JL1A 1TK0A 2BANA 4I2BA 1RZTA 3L8BA 4FJNA 5J0WA 3O4QA 4OGEA 5J2NA 2WONA 4ZTFA 4PY5A 4M04A 4CEFA 5D4BA 4NYNA 1RBSA 2IMWP 8ICIA 4CHYA 4HUEA 4BACA 3QEBZ 2OZSA 3B0YA 1GOCA 4TUQA 3RMBA 5KFYA 1ZQXA 5IIJA 3ZSRA 3QIOA 3TFSA 4CGDA 4DL6A 3MDCA 3DRSA 2LYHA 3V1RA 3OYMA 2RKIA 3AA4A 9ICGA 3EPGA 4ELUA 3VA3A 1RTJA 4KHYA 4CJWA 3RR7A 3LAMA 3ALYA 2V4RA 2B21A 4X5VA 4CJ3A 5KG3A 1UWBA 1X1PA 5CZ1A 1KEJA 8ICGA 1WSFA 3TAQA 4O44A 2G8VA 3LP1A 3SI8A 1CXUA 1D8YA 2FC0A 4I9LA 4DLEA 1RXVA 3S9HA 2Q3SA 1Z3EB 8ICRA 4DFKA 3DLRA 4UB3A 4O4GA 5EWGA 3KHHA 2AQ4A 1QLNA 1H38A 4KPYA 3SUQA 4TSXA 1WNSA 4Q0BA 5KFJA 2BR0A 4RT2A 3AU2A 3KK1A 1LAVA 3H8SA 4OKEA 4ECWA 3KD1E 1NJXA 4DTNA 1ZQDA 4F8RA 4B8CA 3PW2A 3OVNA 5KFZA 1IM4A 4DQRA 5IIIA 7ICIA 3PUFA 3K5MA 5J2BA 2HHVA 3C23A 4CIEA 1N48A 3KHGA 4KLEA 1VK0A 3JPOA 3B6OA 4W5OA 4K4GA 4QWDA 9ICMA 5HRPA 3KLGA 4M9NA 3C1YA 5KG0A 3ZSXA 4NLGA 3K2PA 4Q45A 7ICVA 4E7KA 4IG0A 5J0QA 2A1JA 2O4IA 3S3MA 1TAQA 4GC6A 7ICHA 4M9GA 3ZDBA 3IHQB 1S6PA 3GFKB 2F1HA 3MECA 4UBBA 9ICKA 4DTMA 1KSPA 4CF8A 4B9UA 3WNFA 3THVA 3SCXA 3TARA 4YFUA 5KT7A 2AGPA 3AA5X 3V6KA 2B4JA 4I2GA 1U04A 4AHTA 3HVTA 3HM9A 4HVJA 4FLZA 5D46A 5J0YA 1ZBHA 3PO4A 5DQGA 1ZQEA 1QS4A 4EBDA 3BJYA 3TAPA 4E0DA 3UXNA 3DLEA 3VN5A 2J6UA 4YD1A 3DOKA 4PUOA 4J9OA 2Z1IA 4YN4A 4FLVA 1S1VA 2W9CA 3ZD8A 1S9FA 1JN3A 8ICWA 2WOMA 8ICZA 5J2MA 5KFBA 2W9AA 1EXQA 1XU4A 4CJVA 1EKEA 4R8UB 3V9ZA 2ZUBA 1VSDA 4CEBA 4QZHA 3K5OA 9ICIA 1IKYA 4OLAA 1UAXA 2AGOA 3DLHA 4CJKA 4E89A 4LVSA 3VQ6A 4DTXA 5KFQA 5HBMA 1KVCA 3AVGA 3MEEA 3ZT4A 1J53A 5L1KA 2ITGA 4HTUA 1JLAA 2UVRA 3Q8KA 3CFRA 4CEQA 3PX4A 4OPKA 1ZQRA 4ECVA 1D8LA 3RJIA 2IDOA 4AHUA 2ZJAA 4FJ9A 5IINA 4NLNA 1NKCA 4KLJA 4B08A 2Q0ZX 8ICSA 3IAYA 4DG1A 2W42A 4OJRA 3V7KA 5T7BA 5SWMA 4F93B 4M41A 5CY4A 4CF0A 3VQQA 1BIUA 4YQWA 3D0PA 4K8XA 4E1NA 2E6LA 3ZDAA 5J2QA 3NE6A 3TAFA 3Q8LA 3VQ7A 1BVSA 3V7LA 2IA6A 2G8HA 2JLEA 2D0AA 1ITGA 2YNHA 5DB8A 3O3FA 3GV8B 2AU0A 1JLBA 3AVNA 4FBTA 2BGGA 1G15A 1KDHA 3HO1A 4Y1CA 3H7IA 4ELVA 4YXMA 1CXQA 4MFAA 4CK2A 1KTQA 2J6TA 7ICQA 1JLEA 4CHOA 4F4ZA 1BPYA 1HQUA 1JX4A 4CJ4A 4C8OA 1ZQHA 3FFIA 4HUGA 3QNNA 4KLGA 3AO5A 1I39A 2NRWA 3LANA 3NFAA 1PZNA 1VSKA 4F4XA 3V6DA 1XSPA 4RNOA 4QW8A 1NK7A 4ECTA 2XY6A 4BXOB 4FXDA 2IAJA 4KTQA 1N56A 3QEXA 4W5NA 4JLHA 1TKDA 3UIQA 3UQ2A 4EYHB 1EXNA 3OYIA 1NJWA 1B92A 3H8JA 4J9QA 3MR5A 2MUTA 4CFBA 4K4IA 1ZQLA 4RT3A 1HNVA 5DLGA 3MR2A 5KFHA 8ICTA 4YR2A 5CR0A 2RPIA 4FZZA 1BGXT 5HMLA 2PY5A 4I2PA 4PA1A 1NK9A 3V81A 3SQ0A 4RU9A 3G10A 4YCXA 4QWBA 4YVZA 7ICTA 3QETA 4FJ7A 5HRNA 4NCBA 5KI6A 4DWIA 3NH2A 4GXJA 5J0PA 1YVUA 2DFHA 1NK0A 3SPYA 5DG9A 3LWLA 1ZBLA 2B5JA 9ICTA 5KG1A 4QZFA 2G8FA 2VWJA 1ZQFA 3RB3A 4ECRA 8ICUA 9ICFA 3PV8A 2BE2A 4Z6FA 1C7YA 5J2AA 3AVLA 1D9DA 4CEOA 1ZJNA 3H8WA 4GLXA 1ZJMA 3DLKA 5KG5A 5J2PA 4ECXA 4CGGA 1ZQJA 1VSEA 4PGXA 3RBEA 5KFDA 3IG1A 4E7HA 4O3OA 4J9PA 1JLGA 5EWFA 3AO3A 4RPZA 1NK4A 4FJJA 1JLCA 4CF2A 2X78A 3H40A 2ISOA 1BISA 1C1CA 2FLPA 2BKEA 3OYCA 3QZ8A 3G0ZA 3CYMA 4P4MA 3NGYA 1N6QA 3AO2A 1XSNA 5DB6A 4B9NA 4DFPA 3LAKA 5KRSA 1UT5A 4FJXA 4M2YA 4FLWA 4RQ8A 3OYGA 3TANA 4DO9A 3NH1A 2ETJA 1Z00B 2XGQA 1SL2A 2JEJA 4M3TA 4DLGA 2Z1HA 1JLQA 4KI4A 4FK4A 3SQ2A 3RR8A 1WN7A 5HHIA 3T1AA 4KLQA 4FJIA 1RT3A 4Z4IA 1UA1A 3NGDA 4QZAA 2W8LA 4ID5A 3MGHA 4UB2A 2KQ2A 4QZ8A 2FBXA 5EWEA 4PHEA 2E4LA 5J2IA 4ED0A 3C2MA 3OYEA 5DBBA 3OYBA 4UB1A 3C6UA 1ZBIA 1A76A 5HP4A 2YV0X 4I2JA 4CJUA 2OA8A 8ICLA 1TGOA 1HUOA 3JPTA 3L2VA 4YMOA 1JXLA 8ICNA 2BDPA 4M3YA 4I2CA 2ASJA 1RYRA 2D0CA 4LSLA 1S77D 2FMSA 3U3GA 2PZSA 2UVUA 3OYNA 1A77A 3S3OA 1MSWD 4CJEA 2IC3A 1HJPA 5CP2A 2HMIA 5KFTA 4DL3A 2P6UA 3WNGA 4Z6DA 3UXPA 4PQUA 5K14A 3ZSQA 1CLQA 3QLHA 3T5KA 3KKRA 1J9AA 3BGRA 9ICBA 3MEGA 4HHTA 3LP0A 3CFPA 4FJMA 9ICPA 3QINA 1VSLA 4KHNA 1MC8A 5IIMA 1NKEA 4B8AB 1RCHA 4KREA 1UOCA 4DEZA 3RMAA 1S97A 5KFPA 3U6FA 5J0UA 4NLKA 4Z4FA 5CYMA 2P66A 5KFMA 1KLNA 3O3GA 4DS4A 4DSFA 4FJGA 4IFYA 5DB9A 1ZQAA 1WSEA 4BDYA 4RW9A 4TQRA 5FDLA 4FZXC 4CJ5A 1U47A 1T7PA 3GIMA 2P5OA 1QTMA 4CIFA 3HP9A 4H4OA 4N5SA 3H08A 3GIJA 2ZJ8A 3ZDDA 4E3SA 2HNZA 4TUSA 3RJJA 3AVAA 1ZQYA 3EPIA 2C2DA 1S6QA 3GQCA 4ECQA 3M9OB 4FZYA 3JPPA 4EYIB 3ZT0A 1XC9A 3OHBA 4O0JA 3QO9A 3VQ8A 1RILA 3JPQA 4M0AA 5KFXA 5KRTA 4B3OA 5J0OA 3V7JA 2P51A 9ICNA 1IKXA 2G8WA 5J0XA 3V6JA 1NJZA 4YG2A 3AA3A 3DOLA 4GC7A 1S0OA 1A5VA 4XUSA 4QWCA 3KIOA 3OSPA 2BGWA 1XHXA 5KT6A 2JEFA 1S1TA 2IS3A 3VQ5A 4QCLA 1ZQKA 4RQ3A 3LP3A 1VSHA 3TWHA 2QXFA 9ICAA 2KZZA 3L2WA 4CJSA 4YR3A 4UAYA 1JXBA 1O1WA 1SL0A 5DMRA 2G8IA 1SUQA 2ZD1A 1BL3A 3HYFA 2ISPA 3L2UA 4JS5A 7ICOA 1X9WA 2ATQA 4I7FA 4ED3A 4XRHA 2F96A 5J2EA 3C2KA 4Z0UA 1D9FA 5DLFA 8ICPA 1RT7A 2HHXA 4BDZA 3NTUA 2P1JA 3MEDA 4EZ6A 3AVCA 2I5JA 4CECA 2FBYA 4Z4EA 3RH6A 3ASMA 3KLHA 1LW0A 1WSIA 3DM2A 3BDPA 3C1ZA 2HHQA 2JZBA 4KN4A 5FRMA 1IKVA 1XI1A 1B9FA 4BWJA 4F5OA 3RAXA 2A1JB 3SI6A 4OKKA 2VA8A 4F92B 1BPDA 4F5NA 3VQAA 2FBVA 5J0SA 4QZDA 2A1RA 4BGDA 4MFBA 3JYTA 3JSMA 2HHWA 2QKKA 3AVHA 4FLUA 4KLLA 4CJRA 4FJ5A 3SUPA 1ZQBA 3NHGA 1RT6A 4QZGA 3LZIA 4UAZA 4F3TA 1XWLA 5EU7A 3ZCMA 1NK8A 1ZQCA 4M3WA 3HPGA 4UB5A 4O5CA 1RT5A 3VQCA 1LV5A 3IS9A 2FMPA 3O3HA 5HROA 1S0VA 4Q43A 4EBEA 2YNFA 3UQ0A 4ICLA 2HB5A 8ICOA 4CHZA 3MFIA 5KG6A 2W9CB 3V9UA 3K4GA 3FYHA 4DFJA 4ED6A 3KD5E 4QZEA 3SQ4A 2NRVA 3G6YA 5KTQA 3PX6A 4LH5A 1VSIA 1FXXA 1ZQTA 1WCLA 4F5PA 2KN7A 4DF8A 5KFNA 1KRPA 4G1QA 1BQNA 2IBKA 1ZQMA 2ZTEA 1KCFA 1XS9D 1MQ3A 4O3QA 1YTUA 1RTHA 3ULDA 4J9NA 2YHAA 1SKWA 2AGQA 1ZYQA 3L2RA 2XHBA 2Y1IA 4IQTA 1BI4A 2KZ3A 2JEIA 2WTFA 1WSHA 4I27A 2FBTA 5DDMA 3KLEA 4N56A 1DOQA 1K6YA 1HYVA 2JEGA 4NY8A 5C42A 3VQEA 4Q5VA 2E6MA 2M9NA 9ICEA 3VQ9A 3KTQA 3T3FA 4DOBA 1NKBA 2FLNA 3HK2A 4DQPA 5KT3A 4RW4A 4DFMA 2EHGA 7ICJA 2ASLA 4I2HA 1R0AA 4EP5A 2XY8A 2I1QA 4DU3A 5CWRA 3JPNA 2ZQBA 2BPGA 4RW6A 4RW7A 1COOA 4MF8A 4DQIA 3EWAA 4KLOA 1IXRA 2AQ0A 4C8KA 1AROP 4LD0A 3M9MB 4HYKA 4GVMA 4CF9A 2Y1JA 4M6WA 4J2AA 4I2IA 4YXJA 3AVIA 1GOAA 4FS2A 1EX4A 4YP3A 4NCGA 3AVBA 2PFQA 2BCQA 5F9NA 4LH4A 4RPXA 4FW2A 1RDBA 4PGYA 1V9PA 3Q8MA 3CM6A 1QSLA 4OKJA 3U3YA 2KTQA 2GV9A 4IR1A 4FS1A 1ZBFA 4GW6A 1WCNA 8ICVA 3QEAZ 4Z6CA 3CG7A 5KFEA 3QNOA 1C6VA 4P4OA 3RMDA 3RB0A 5CJ7A 1RDDA 4CGFA 3C95A 3GILA 9ICOA 4FO6A 2DFFA 5KFVA 9ICCA 2UVWA 1RT4A 3CFOA 4BE2A 4NM2A 4DTJA 3QZ7A 4FYDA 2MUTB 3RJGA 9ICWA 4KLDA 2HHUA 4CIGA 1IH7A 1KFTA 3ITHA 1ZQWA 4ECYA 4LZDA 3RH4A 1BPXA 2OWOA 3ZT2A 3DLGA 3LP2A 3QEWA 2BCRA 1QHTA 4RQ2A 5DB7A 2KFNA 5HRSA 1LWFA 1TFRA 2FPMA 3K5LA 4J9KA 2IHMA 3KKSA 4FLTA 4RUCA 3GV7B 4XQ8A 4UQGA 3DRPA 2Z1JA 1RBUA 3VA0A 3Q8SB 2YKMA 1TV6A 3M8SA 4UBCA 5FRNA 2OZMA 5CB1A 3SV4A 5CZ2A 5HNKA 3LDSA 2FPLA 1WSGA 1N5YA 1X9SA 4IRKA 4ECSA 1WLJA 5KFGA 5IILA 5DGBA 2GWSA 5L1JA 3OYJA 5CHGA 4IKFA 4KTZA 4N41A 4RZRA 1WSJA 3SNNA 1C0MA 2Z1GA 4CJQA 4FLYA 3C6TA 3ZT1A 4DTRA 1S1UA 1CZBA 5C24A 3DI6A 2XCPA 5KT4A 3RB6A 4Q8EA 3AO1A 9ICLA 5J0TA 3C5FA 1W9HA 3AA2A 4CE9A 9ICQA 2PI5A 2UVVA 4OVLA 4NLZA 4LSNA 3WNEA 5L1IA 4KV8A 4M9JA 4DMNA 3RBDA 3AUOA 2YKNA 3RMCA 4FK2A 4JRQA 1TAUA 1L3SA 3LDAA 2QKBA 1CUKA 3SJJA 4CHPA 9ICUA 5KFSA 4DL5A 4BDPA 3G6VA 1ZQNA 3GDXA 4FM2A 2R8HA 4PGQA 4KI6A 5J0RA 4BWMA 4CGHA 2PYJA 2P5GA 1NOYA 9ICHA 1BPEA 3P1GA 2NRTA 1U9LA 1K1SA 3OGUA 1MU2A 2XGPA 2KFZA 4DU1A 2H5XA 1X9MA 1IO2A 4QZ9A 1B9DA 3ZD9A 4C8LA 2OPQA 3QEPA 3C2LA 4NM1A 2PFPA 3AU6A 2W9BA 2ATLA 2C28A 4OLBA 3RTVA 3LWMA 4GXIA 3LPTA 2PYLA 3HX0A 5DDYA 4LZGA 3K58A 5DK5A 3C94A 4GXKA 3O4NA 2O4GA 3MFHA 1B43A 3PMNA 4Q8FA 1DLOA 2BHNA 5KT2A 3KJVA 3MABA 7ICRA
chains in the Genus database with same CATH superfamily
1T0TV 1NGJA 3LH2S 4Y2RA 2CPIA 4B9MA 5ALVA 1X2IA 3QX7A 4F0KA 4NXZA 2HRUA 3Q7BA 1P90A 3GTYX 4UB8U 3ISBA 4L74A 4F4WA 2AEJA 3C16B 2IOCA 4W92B 3NS1A 2DY1A 4FP9A 4PWUA 2MHNA 5K14B 4J2DA 2F1JA 4OJOA 4Y2UA 4EO6A 2ZZNA 4DPOA 3Q86A 4WKRA 2CQBA 1U48A 3VAGA 2BCVA 1DK2A 2DT9A 3MM7B 1KVBA 5GTHU 1KN5A 4Q2MA 2OYQA 2E1AA 4CF4A 5G0RB 4IOAL 3L4PA 4R0JA 5CYMB 2ZH4A 3I8DA 1VQ8N 4WZQA 1CJKB 2WB4A 1RWMB 3HSGA 3KJNB 3FEZA 3MX2A 4A8EA 4NMXA 1S57A 3BH7B 4FOEA 4BX9C 5D6GA 3HVAA 4ZP8A 4ILMA 5J2CA 2ZH6A 3G9CA 2BQ3A 2V2ZA 2EG1A 4I64A 4NV0A 4UW9A 4BQZA 3O3LA 5IV3A 2HNZB 1ZQOA 1LNQA 5GAHP 7ICFA 3HX9A 4ECZA 4DL4A 5FLXO 3ENQA 1CJKA 4BROA 4GKKK 3QO9B 2RS2A 3UKRA 3ZSZA 3RYLA 4I2DA 3TJ9A 3MURP 5C12A 4C7YA 1IKXB 4C11A 5BR8J 1DQ8A 4EZ9A 2F2AB 4BQLA 4R63A 4RWXA 2DFEA 4EEYA 3MXJA 3JTNA 1UCNA 1B4SA 2EVZA 4P4PA 5AKJA 3QT7A 2WUSA 3NAIA 4ZPWR 4JI3K 4HVZA 4O5KA 4CM0A 4C8ZA 3F73A 3NGTA 3J7Z5 1BWEA 2OTJN 2DO0A 3KK3A 1IVZA 3F9KA 5JS2A 3VGMA 4AE5A 2B8PA 4A47A 2R8KA 4RQ7A 4EWTA 3V2UC 4WFXA 1J97A 3KHLA 2VJVA 2NRZA 3VF0B 2QL9B 1RT7B 3RWUA 4CLYA 2I5JB 4NPOA 2C3YA 2DNYA 5J2HA 6AT1B 3EE8A 3GE9A 5KAKA 3M6KA 3SZ2A 2HZCA 4FWLA 2V6AA 3AGRA 1IKVB 2CRXA 2YPZA 2K4EA 2YWGA 1IIPA 4Y2TA 3ZSWA 3IAS9 5F8HA 3IBCB 1IKWA 1FWKA 3WXIA 1D09B 5I3UA 2POKA 4CJTA 3S01A 3D28A 3LZJA 2F65A 2VCPA 1U2VB 2OLWA 3JYTB 2V8DA 2FVSA 3W2VB 3NAHA 1RBAA 4A2AA 5FD1A 4OJLA 2M4MA 3PRBA 4OJPA 2IM3A 5GINA 3BBFA 2ERRA 4R64A 5J2KA 3MBYA 3EKSA 2I7PA 3HM8A 1MG7A 4WJBA 2Y9UA 3ZTQA 5AE1A 4BGBA 4DR5K 1KW4A 3IS9B 4LBHA 5HROB 4DHYA 1F2GA 4BRQA 2ZBPA 4AHRA 3R7NB 4NCAA 2GQCA 8ICBA 1QVGM 1PCAA 1TKTA 3QWPA 2K2PA 3MXIA 3I5BA 1Q78A 3W2VA 3N4PA 1VQ5S 3KKAC 4M95A 3KZBA 2A40A 1RT1A 3THXA 3M6UA 4V1Ak 3GB0A 3RAQA 3AVKA 4H8KA 4OHWA 3KYLA 4G1QB 3NCQA 3ORYA 2AYGA 2CUYA 3BREA 3N4WA 3JPSA 5CABA 4KAZA 4HT5A 1RTHB 4X64J 2AIRB 1O8BA 1NMDA 4X4PA 1R8PA 3CO9A 2VIXA 2QA1A 3IFRA 3C65A 1UW4A 1IQZA 5KG2A 8ICQA 4Y00A 1N32F 2GH1A 3DOMB 5KFLA 1URJA 5IXUA 4I6MB 3HKZC 3H8MA 3BBBA 4E7LA 4HUFA 3CCQN 3JAMY 4I9QA 1CS4B 3WDOA 3VAMA 4UB4A 1S5JA 1V85A 4CT8A 2G8UA 2ZVIA 3DFEA 3DYAB 3WQPA 1BU6O 3H0MB 3Q8PB 5T41A 1K8AT 1IG9A 4UZCA 1NSAA 5J2JA 2LECA 4LJMA 3OYKA 3MPDA 2R8GA 2PMHA 2DYAA 2VGMA 3A5LC 3VQPA 2HGLA 4M3RA 2ZH9A 3NGZA 3MCPA 1Q9XA 2R7UA 4J9SA 1PO6A 1K5OA 1RWXB 2FZKB 1C0TB 4X62K 3AD8C 3I9V9 1KQGB 2QGFB 2NUBA 2DXEA 4FZMA 1WF1A 4NL9A 1XR7A 1QQCA 3T41A 2UUBJ 2GFFA 4R79A 5M1NA 4F02A 2JC0A 3DYAA 1F1BB 4CF1A 1TELA 2W2NP 2A6MA 3V1QA 1L7MA 2RDJA 3UPFA 3BKTA 5JMVA 2ZDPA 2YX6A 4BR5A 1JCEA 1F9EB 1KHVA 2HI0A 2IVPA 2VWKA 8ICFA 4O8UA 4LF7K 1TVRA 2HNDA 1X4EA 3WEEB 1ZM2A 1C0TA 2G06A 3HI0A 3U02A 2NLWA 3AAWB 2X1GA 1EO1A 2VDIA 2BKPA 4C8MA 3FQKA 1NB2A 4OPAA 1Z4NA 2XWYA 2YQ3A 3QU7A 1U1PA 4KH6A 2C42A 2KXNB 2ZC3A 1QCKA 4YDDB 4WK1A 1YQHA 3RRKA 5KFAA 2BXJA 2K89A 4IRCA 3OBIA 4B9QA 3POTB 1FF2A 1U49A 2HQCA 2B6AA 4WQ4A 3NWGA 3ID6A 3W9JA 5A76A 4CZKA 3ZSYA 3TR8A 4CCHA 2YWKA 3I56S 3GV5B 2I2YA 2FIUA 1RBTA 1X0PA 3N6LA 4QPXA 7ICGA 1S5ZA 1Q53A 1ZQVA 4B3SJ 2Q0RA 1Q18A 5F41A 2J9DA 1BG3A 3HI9A 3DRYA 5HQLA 4WP9A 3VEVA 2ZTCA 3V9WA 2F9TA 5D49A 3HL8A 4JK7A 1VQMN 2EBGA 3ETLA 2FY8A 3POTA 3OYHA 4ZITA 3CJQA 1GMWD 3CCWA 5KFCA 5HLFA 5ALHA 5C24B 1S9EA 2Q0UA 3P49B 1X66A 3ETMA 4J9VA 3FDSA 2HSTA 5CA7A 1NXIA 1BWFO 2HHSA 4WFBL 5HMMA 5TISU 4MF2A 3OTDA 4O8KA 5ALWA 4TVAB 4XTTA 1S59A 4M3ZA 2YKNB 1R7IA 5H1SV 1IJFB 4CLFA 2V9WA 3G8QA 2RHFA 2CQCA 4XA5A 3I0RA 4QQBA 4B9TA 4OX9J 3QUCA 1PAUB 2H3VA 1VQ4S 4BUGA 5F1XA 9ICRA 4DTUA 3I87A 3BQ0A 4F0MA 3TSUA 5J29A 4DV2K 1IJEB 3OUYA 5C15A 4EELA 4NEYA 4HTLA 3CB4A 2J9EA 1HNXF 5DBCA 4MHVA 2BMBA 1LKZA 5GADU 4GFJA 1Z4UA 5H9EJ 2O6KA 2MB0B 1Z26A 2B8QA 4EENA 3TAMA 2R7SA 2XYHB 1VQOS 1YI2S 1IWAA 1BXNA 2DHXA 3LPUA 4AM6A 1KFDA 1KVKA 3VQSA 3ZTPA 5SZTA 1LXNA 2JMGA 1XNSA 1ZM4A 1DLOB 3KG4A 2VA2A 8ICEA 3H90A 2O8BA 4DV4K 3D2WA 1U4BA 3AVJA 3E9PA 3EVOA 4CJPA 4KLUA 1VRUA 3SJHA 1N34F 4CLZA 5E3RA 5BJRA 2ZH1A 5BPNA 2V2QA 3B8AX 3NVZA 4DS5A 4FBUA 4F25A 2MQQA 3ENOA 4JWMA 4R5PA 2UU9K 3OL6A 2KW4A 3ZSOA 3IWLA 5AQHA 1R59O 3FGVA 4R65A 3D2FA 1BCMA 4J9LA 2CAJA 3IRXB 2QYCA 2XTJP 3VGTA 1SXLA 2HOFA 1HNIA 4GKKJ 4NOHA 4CM2A 1UVLA 3TUIC 2F8KA 2CGKA 1LFPA 2H3EB 1SJFA 1Y5IB 3DLLL 4JRPA 3W9HA 7ICMA 2YXLA 3CCRN 1NGAA 4PRFA 5C2FA 5G5GA 1JCFA 2WVEA 1NRKA 3O8MA 3R5CA 3IN5A 4NMLA 1KFSA 1NMNA 1FVSA 1J54A 3OSNA 1WC1A 4Y2CA 2I0XA 1V4SA 4JKAA 4NYOA 5THWA 5KFFA 3GIIA 4NI2A 2PC6A 5TZVA 1MNEA 5GAEU 1O0PA 4CFAA 5E3CA 3F9MA 4XPEA 2OI2A 3NGKA 2W40A 2VICA 2PFOA 4BR0A 4EAHD 3FZMA 2GQQA 5ALKA 4LF5F 1M6YA 2HNYB 1Q9YA 5AQPA 2G0IA 2GWJA 5A8RA 4OYMA 1GMUA 1XMOK 2QB0B 8ICJA 4F0HA 1NAQA 1S0MA 4YMNA 1K9MT 4DR7F 4X4UA 2HW3A 5KT5A 4M3XA 2M8DB 3IR5B 3T9ZA 5KAFU 3IG8A 4OI0A 1UT8A 1MWMA 2XCAA 2X74A 2KXFA 4DU4A 5BR9A 2RQKA 3N0VA 3W3DA 2BJ8A 3P31A 5GVQA 5D3GA 3HBTA 1WBDA 5IIOA 3PW7A 3PJ9A 4KHQA 2OPRA 1S8OA 2J9CA 3MDFA 1FX4A 1NZBA 4MIAA 4UOGA 3QU2A 4DN9A 4OYPA 1NU4A 4KHUA 3TX0A 3O2IA 2KZMA 3D67A 2WSCC 3SQOP 4YMMA 3OHAA 3M6GA 1GXTA 1V3RA 1RBRA 4KB0A 3IKMA 3B82A 2HAFA 3L3VA 1J5EF 4M45A 2RE1A 1YITN 1KDNA 5J2NB 2ZBCA 5AQJA 1T8EA 3OS1A 1L8LA 4WFZA 4USIA 4AD6A 3NAEA 4KLMA 2JGUA 1NI3A 4X65K 3BQTA 2YNIB 2CH5A 3OJSA 3L3UA 1Y11A 4HCCA 3HHNB 2C2OB 3P83D 2J7WA 1SJ4P 4JI0F 3ZZUA 1Z19A 4HLBA 1SL1A 4DOCA 3ZX2A 1PG5B 3D4JA 3DXBA 3MPWA 3G4SN 3MMCB 3CCZA 5JJBA 5J0WA 4OGEA 3EE3A 5J2NA 4ENOA 5AKLA 4ZPCA 4BACA 1T9TA 3UKUB 2Z58B 4H0VB 2GVZA 2GCFA 1GOCA 3WXKA 4U67Q 1ZQXA 1KQKA 3FCVA 1C1BB 4CGDA 4DL6A 1N5SA 3AODA 4GVBB 4WCEL 4LR9A 3V1RA 3OYMA 2DH9A 2PMWA 5E26A 4KHYA 4CO1A 2K7KA 3RR7A 3C8YA 4KO0B 3ALYA 2V4RA 2B21A 2R7OA 4LMZA 2E5SA 2F3JA 2E1FA 5CZ1A 4DHVA 3UQSA 5JRTA 4JI6K 1CXUA 3KLIB 3PKYA 2DCLA 1QAIA 2FC0A 4DLEA 2FJXA 3A0IX 4OHXA 4IJAA 4WFYA 1XTZA 4MN4C 1T6DA 2J0SD 3C19A 2UXBK 3SIPB 4GVBA 2AQ4A 4OZ3A 2H4YB 4I4BA 4KPYA 1HUXA 5ALQA 4X62J 1RABB 1WOPA 4JHDB 2M8HA 1C20A 4OKEA 3KD1E 5LL6Z 1NJXA 3ZZYA 4DTNA 3R5BA 1CJVB 4LJXA 4DR2F 3DXMB 1H1VA 2AX0A 5KFZA 1IM4A 3BZKA 5IIIA 2XMUA 2IVNA 4MIBA 3FZHA 1FFUA 2OCEA 3H59A 3GWCA 8RUCA 3OW2R 1RA6A 2WAQD 3D3BJ 2IBOA 3KLGA 1AYEA 2LPEA 2ES6A 7ICVA 2V50A 1P9YA 4IG0A 3KFWX 2M70A 2GX9A 4NZ6A 5I3PA 5IC4B 2KFYA 4GC6A 3B6BA 2QFJA 1YVFA 1CJVA 3ADAC 3MPYA 2MKJA 4L73A 3MECA 4UBBA 5CR4A 2LEAA 2LLZA 1HYSB 2W2PP 2RIJA 1N4LA 5KT7A 1T03B 4KX3A 4PXBA 3V6KA 1QUVA 2W4CA 2WOMB 1PJ7A 2B4JA 3W3SA 3MM9A 1X4DA 1FO4A 1WF2A 3QAUA 2KHVA 4IDHA 2O8FB 1U04A 1J5EK 2B7BB 3RFAA 1M0SA 3WXJA 1AB8A 5D46A 4OIXA 2W3SA 5J0YA 4OX7A 4NA1A 4DV5F 3K0JA 2H5JB 1BWVA 3ZLJA 4BRKA 1SB6A 1AUDA 2NUUG 1VQLN 4CI6A 2MQPA 4JK9A 1LK5A 2W9CA 1TL1B 4LQ9A 2WOMA 5H9FK 4Y2KA 4X4VA 4QYZJ 1HPZB 1XU4A 5KL8B 3HJVA 4R8UB 3G71S 4ER8A 4DG1B 1EKEA 1HHTP 3V9ZA 1VSDA 1B70B 2M7SA 4LF1A 3A5NC 4KGKA 1HQEB 2ZFHA 2CJAA 2DNNA 3I6PA 4OLAA 1UAXA 2EANA 4CJKA 5JVGL 3D1QA 3BUZB 3AD7C 2W1BA 5KFQA 2MEWA 2ITGA 2AYMA 4LRBA 4PKGA 4HTUA 4ECVA 4FYVB 4FWMA 2YI1A 1N32J 2H5EA 2VG6B 1OYDA 2ZJAA 4AHUA 1NDCA 2FJ6A 2JVRA 3D7EO 1U1KA 2Q0ZX 3MF5A 3J7AP 4DG1A 1WORA 2W42A 2U1AA 4OJRA 3KD3A 5T7BA 1XR6A 4CF0A 2DEJA 1XIQA 4HI2A 3BPSP 3M8PB 4NXNK 4FO0A 1D8BA 3VQ7A 4PL1A 4TY9A 4QPTA 2D0AA 2YNHA 3KHYA 2DGVA 3AVNA 4XAKA 1FWPA 2HK2A 5LMUF 2H65B 1GK8A 4EX7A 5D4OA 3HO1A 5FJ4A 4OI3A 4ELVA 1PVRA 4EO8A 3VGKA 1KTQA 2VF3A 2XQCA 4P73A 3HFKA 2HIYA 2BKNA 4CJ4A 2RD5C 3CJ8A 2YH0A 3AO5A 4ZPTR 2NRWA 4I2PB 1HBUA 1WACA 3H1VX 1JNZB 2NNWA 4QW8A 4DKWA 2PA3A 2HPUA 1IR0A 3VWSA 1WHVA 4BXOB 5E3PA 1T9YA 1MN8A 4DV4J 2DGTA 2L9NA 2K60A 1NDPA 2PBDA 2VFRA 4B6JA 3I55N 1TKDA 3UQ2A 4LF6F 1TTHB 1B92A 3H8JA 2IVYA 2V8VA 2JFKA 1WC3A 3IFEA 3RVCA 5KFHA 8ICTA 2CQDA 2HBLA 2BKOA 4KMOB 4I2PA 4H03B 5BYRA 4DL0C 4PA1A 3HHEA 2G5HB 3QUBA 2GIQA 2R2TA 2GVDB 1SIZA 5EN1A 1DZ5A 2HIQA 2HBKA 4BC9A 3SBTA 2W54A 2JHDA 1VLOA 4DWIA 2BM1A 3SAHA 3R7BB 1YVUA 4DV1F 2ASOA 1NK0A 2P9NB 3A4TA 1ZBLA 3CDEA 2K8CB 4BRIA 1CBKA 5KG1A 4QZFA 1C1CB 2G8FA 4QZVB 4CLWA 1RTIB 3OR2B 3QNWB 1S4FA 2BE2A 2LKZA 4NL9C 4ZPAA 4TLQA 4GIBA 4J37A 1NO8A 1VRTB 1YJVA 1B3TA 4NLDA 2RJZA 3C15B 3QUQA 2RB7A 4GKJK 3TVYA 4LF8F 2C3UA 1APSA 3VC8A 2MQ8A 3H6EA 1SWVA 4FPRA 1JJ4A 1IXKA 3SFGA 4RPZA 4FJJA 4CF2A 3QRRA 2X78A 1W97L 4KH5A 2Z2LA 4WYLA 2QWLA 1C1CA 2GIRA 4Y3CA 3OR2A 3VERA 3WIUA 4MT1A 2IHR1 4AXJA 4JI5F 2KT3A 2Y0SF 5AJ3F 1XMOJ 4RKUC 3AO2A 5BRHA 1OYEA 5GADI 2VYPA 3DGPA 3OYGA 3NWRA 2IPOB 1RGIA 4JKGA 5B8HA 1Z00B 1SL2A 3GR1A 2QA4G 2Q36A 4AQYK 2JEJA 1HPMA 1JLQA 1FK9B 3I0SB 4FWRA 3BGOP 2B3TB 3R2DJ 3KJQB 1GLBG 4ID5A 3MGHA 1NGHA 2FBXA 5EWEA 4PHEA 1XMBA 1QDUB 3NOGA 5ETRA 1HNXJ 2E4LA 4ED0A 3C2MA 4WQ4C 4C3MA 2YWEA 3FR0A 3H0PA 4PQUB 2CPZA 1BA0A 4TXSA 1RHMB 2DNOA 3T7ZA 2A1BA 3JPTA 1JXLA 1RDUA 5KPZA 4JD2A 4I2CA 1JKHB 2MZRA 4Q7AA 2H51B 3GIRA 4LSLA 3AA8A 4TKTA 2XVTA 2PZSA 3PSPA 3TA1A 2WC9A 4ZS6A 1NH7A 1JJCB 5CP2A 2IC3A 5KFTA 2CFXA 2PSZA 3IMQJ 1FNMA 1BNOA 5ALGA 1N34J 1RLCL 5CYQB 4PQUA 5ADZA 1Z6RA 3J81U 1HL6A 4RW9B 3A8EA 2HMXA 3J7AN 5FPDA 4BGAA 1J9AA 5AT1B 4HHTA 2ZE2B 2PEBA 3QINA 3O9QA 2DVIA 2VPZB 4KREA 1RCHA 2ZM6F 2E8PA 3J7YU 3KMSA 4ED5A 3GCWP 3ZNUA 1S97A 5KFPA 3U6FA 4NLKA 2ZBQA 3HHLB 2P66A 5KFMA 3PYDA 4LT6A 5GAEI 2JGAA 1FXRA 1LKYB 2EAPA 3IAM9 4RW9A 5E5NA 3NVWA 2JNJA 2WONB 4H54A 1V6HA 4UUXA 5AICA 5HR6A 5I9EB 1VQPN 1YSJA 1X5TA 3AD9C 4N5SA 4N8NA 5E3QA 4ZPBA 3H08A 3S6JA 4LBPA 1NBEB 5BPLA 4MK7A 4QJFB 3EPIA 2E29A 3TZXA 1S49A 4ZVUB 3M9OB 3DRSB 4X4QA 2X3GA 1KAZA 3ZT0A 2RKIB 5ETPA 3VQ8A 2YX1A 2QWNA 2PMZD 3JPQA 4A8YA 3H20A 4KY3A 4K50A 1PKUA 3QATA 3CDBA 2CPFA 4CLSA 3MWTA 1OH6A 1Q95G 2XS5A 3V6JA 3DOLA 3PEJA 1XHXA 5D77A 3CI5A 1H2VZ 2OHDA 1X4CA 2AX1A 2DIUA 2EFVA 4LFCF 3K9KA 3LP3A 4WFNQ 4DR7J 2VFVA 2EC0A 3LGMA 1IWGA 2UUCF 3PZPA 2Z8QA 1SUQA 2ZD1A 2K1RA 3HYFA 2ISPA 1CQMA 3L2UA 1YX2A 4PXEA 3VAJA 3ZYYX 5B0GA 4XRHA 1TL5A 2F96A 3RW6A 3C2KA 4Z0UA 3L0QA 4Y2VA 4BDZA 5AE2A 5B08A 1U1OA 2ZGYA 4OZLA 4P0QB 5J8YA 3RH6A 2NUHA 2VC1A 2HHQA 1QQNA 2JZBA 4KN4A 1J5EJ 5GIPA 1YJ9S 4DR6K 1B9FA 3QUTA 4U95A 4DR1K 1RT5B 3N5BA 4F5OA 3RAXA 2A1JB 5JICA 1RAHB 2VA8A 5CEHA 1S99A 4F92B 3GDQA 3E0FA 3KLVA 2A1RA 1YRXA 3UN3A 1P6TA 3UVJB 2QEXS 2FVCA 4JI0J 2QKKA 2JJ4D 2GJIA 2IRYA 3R27A 2K4HA 1NZ8A 5IWAF 2A6OA 2MZTA 1Y64A 5AQSA 1Y5LB 4P0QA 2VV5A 3ZO7A 3A3PB 5H9FJ 3ICXA 2CJQA 1YTYA 2MPUA 4BRDA 3LZIA 4C6AA 4UAZA 3CJKA 2LHTA 1XWLA 1N5WA 1X5SA 3ZCMA 4M3WA 1ZQCA 1HIYA 2A6AA 3W62A 3E3XA 3MHYA 3OR1B 1RT5A 2VBWA 3D9BA 2F8EX 4DXLA 2XO6A 2LMRA 5AIBA 2EDUA 1LV5A 5M1OA 1HKBA 1W2IA 2FMPA 2ZM6K 5K9FA 4EBEA 2YNFA 1SCJB 5HATA 4PUOB 1FI4A 4YUDA 3MAHA 1VCTA 1UPHA 4A8SA 4OX6A 4QIEA 3KZXA 3V9UA 3BEGB 1QVFM 3FYHA 3OBWA 1HBNA 1FFWB 3WKCA 2DNKA 2LCWA 3CQYA 3SQ4A 1FXXA 4USHA 2XHCA 1WCLA 3DC2A 4F5PA 4CO3A 4DF8A 2MQMA 1V4TA 2CDRB 1DT9A 1KRPA 1AFJA 1JJHA 1KCFA 1MQ3A 2C3MA 3HOSA 5ALUA 3DHWC 3ULDA 2YB4A 3MEEB 1YAGA 3A13A 4Y0WA 1JLAB 1KHWA 3D6FB 1ZYQA 3O9UA 4ANEA 2Q66A 2CN1A 1OY8A 1BI4A 2JEIA 2HGNA 1AW0A 4RNHA 4Y0FA 3RUBL 1VR6A 3CJ0A 4ZVRB 1SQEA 2JEGA 4DR2J 2HCFA 5C42A 3UMCA 4Q5VA 5ETNA 2M9NA 3VQ9A 4ISFA 2G2ZA 1Q79A 1JK9B 5IM0A 3PIOQ 1VFJA 3TEHB 1BA1A 4B1ZA 1YHQN 4IUFA 2FJVA 3HK2A 4QIGA 4BJQA 4WFBQ 4DQPA 1C2PA 2ASLA 4PCQA 1D3WA 3IGNA 2F76X 5CZVA 2ZQBA 1COOA 1EAYC 4Y2AA 4DQIA 1NEEA 1NH8A 4ES1A 1IXRA 4ZIWA 4LD0A 5M1QA 2O1PA 3D0HE 4RLEA 3CC7S 4M6WA 1JLEB 4UOCA 4J2AA 4QR1A 5GIOA 1HQUB 2APOA 4FPIA 3AVIA 1GOAA 1EX4A 1HNWF 4YP3A 3AVBA 4RCHA 5F9NA 4RPXA 4FW2A 2IDEA 2XI3A 8AT1B 4PGYA 3FFIB 2HHHF 1RDBA 1V9PA 3ZEUA 3H5XA 5CH7B 3FZ2A 4IYQA 5KFEA 3QNOA 1C6VA 4P4OA 1SGGA 1RDDA 3GL1A 4URGA 3C95A 2DHSA 2WF7A 9ICOA 5A8KA 2IAJB 2ADCA 4YDXA 3KFUF 1HW8A 1T11A 2FHJD 2ZXHA 3CFOA 4BE2A 4YOEA 4DV6F 2G0AA 2HBJA 3MWBA 3VZIA 1NG9A 9ICWA 4KLDA 3DRPB 1VJ5A 4CIGA 4NLSA 4ZVTB 1NPPA 3IR6B 5B0CA 1MDUB 3PYFA 3LF0A 3P5BP 2QWRA 2D9OA 3QEWA 2VBXA 2ZIXA 2GELA 3V81B 4X66K 1N5YB 5DB7A 3R6MA 1VBKA 3Q2TC 3FKBA 2CNKB 2CQ2A 4J9KA 3GFHA 4BBYA 1PK1B 2E1YA 1TE2A 5FLXY 2VJ4A 4PG7A 3CQXA 4FLTA 1UEVA 4RUCA 4M8LA 1ATSA 1F2HA 3GV7B 3DRPA 3OTOF 2Z1JA 3US5A 2B5JB 1TV6A 2E1RA 1OH8A 3ISND 1U02A 2V5HG 4QU6A 3M8SA 4UBCA 4OYOA 1GLDG 5CB1A 4FF2A 1N5YA 4P6QA 1VQ7S 4CO5A 3R3TA 1RHUB 3DLLQ 5IILA 1KKHA 4HAIA 3W5YA 6FD1A 1WSJA 4YEAA 3HMJG 2E8OA 2AF6A 4P75A 3ZT1A 4DTRA 2HF3A 4CD3A 3ALRA 3AO1A 4KJIA 3C5FA 9ICQA 4NA2A 5F8LA 1QTNB 3LPEA 4NLZA 5CAAA 4LSNA 1VBYA 4KV8A 4M9JA 5I4MA 1M90T 2CGLA 1NGBA 1PYOB 1IR2A 2OXOA 4B3RF 3SSQA 3TQEA 4C0OC 3UDVA 3FRYA 3TACB 4DL5A 4BDPA 4QS9A 1ZQNA 2XG8A 4GV3A 2P9KA 3H42A 4KI6A 5J0RA 4BWMA 4JKDA 2QSWA 4C97A 4CGHA 9ICHA 1BPEA 2DNQA 1MU2A 2XGPA 1YBAA 4UW2A 2P9IA 4URQU 3RZAA 2VBYA 5F0UA 5L8RC 4CH0S 4NLQA 3QEPA 4LF6J 3C6UB 3S8SA 3F44A 2CPRA 4OLBA 1HNWK 3LWMA 1HKGA 3QJJA 2MU2A 4GXIA 2DJWA 4MKYA 4X4NA 3GLJA 3SDEB 4A8WA 1SI9A 3C94A 1NHUA 1WI8A 9RUBA 4NRTA 1NLVA 2DHHA 4Q8FA 2ZJQL 3FJ2A 2BHNA 4DUZK 3MABA 4GO7X 3Q7CA 3CCVS 4BC3A 4CH7A 2IRXA 4ZVPB 3ZTOA 4FW1A 3WK8A 4JKBA 2P5VA 4BRGA 2B9XA 2CJ9A 1KVJA 4TNOA 5AZJB 3OHRA 2IJFA 4DV1J 2VJ5A 4ETZA 4L76A 5GMEA 3QLHB 5EVZA 2F9DA 5D0GA 2AP1A 2RE2A 2KH9A 2RDDA 3BGRB 3KUEA 4ID1A 4UY8T 1Z1ZA 4JI2F 1U09A 2NRRA 3MAAA 2MZ1A 1A7GE 4NRUA 5KFOA 4KR0B 3B6PA 1U0SA 2FPKA 3D3CJ 4OI4A 4Y2MA 5DM6L 5C0YA 1YT3A 4PKHA 4LF8J 4QOZB 5KFRA 2B51A 4K4ZA 5AZJA 4OJ3A 3SQ1A 4LF4F 3K17A 3K57A 2KG1A 4DTPA 2KO1A 4J91A 4OLOA 2FJAB 2ZHAA 4ZP9A 4ED1A 4MKBA 4N47A 2ILYA 2WB1F 1KVAA 4WCEQ 2OSRA 4JI5J 5AJ3J 2CQIA 5C25A 3NDKA 4F2RA 1U1MA 2HEKA 4PJ0U 1QD1A 2F44A 4IWVA 2DR6A 4OYWA 3MXMA 3FBEA 2CJKA 4ED2A 1YBUA 3TUZC 2FSNA 2W41A 4AYBC 2RDIA 4B3OB 3O44A 3DDNA 3OFGA 1NGCA 5J1PA 4Y2XA 4MQ3A 1HWUA 1RXWA 4Y2QA 1B0PA 4G1IA 1E4FT 1X3NA 1EETA 3OTQA 2W4DA 4P71A 1CC8A 1GMWA 4HR2A 1M1KT 5L9XA 4ATNA 2A3JA 4HCBA 3CPEA 3CVKA 3DJCA 3L3FX 3HHDA 3CJ7A 1U0HB 1ZQ1C 5ADXA 4B9VA 2IOFA 1SZ2A 1Y10A 3CCLS 3E8OA 4PPZA 4WE1B 3U1NA 1XNRF 2B4PA 3M9NB 3GG4A 4E7IA 3V1OA 1BIZA 1V97A 2V8HA 1LWEA 3OS0A 2XULA 4ZCKA 3M8QA 3W63A 3CO0P 3KLHB 3O08A 4DDFA 4PZVA 4KYZA 5CCLA 1Q86O 2CPEA 3MMBA 4F26A 4IR9A 5EX0A 4M47A 3BV8A 1LB2B 2NXJA 4PEOA 2HYIB 2E8MA 4LSZB 3HT0A 5D4LA 4WE1A 4O5EA 4KLSA 1QAYA 4OMFG 3SLCA 4FKYA 4B9SA 3PR4A 2GMHA 3ENAA 7ICSA 2ZM6J 3VF6A 2NR0A 4YOTA 1OQ6A 4RPFA 4Z4GA 4Z6EA 5AQXA 4DR3F 4OYZA 3FFKB 4E19A 1Q8BA 1C0GA 1LOUA 3CQ8A 3QYYA 2DY4A 4JYAK 2VONA 1XNQF 5KGWA 3FC9A 2UUAK 2E20A 2E66A 3MN7A 2UZAA 1L5UA 2W7PA 3NF7A 3CXCM 3TUJC 3C2PA 2YWHA 3TP2A 2ALYB 2BCSA 1K44A 1UAWA 5HRRA 3ZETB 2RUGA 4F4YA 4OV1A 2OJ3A 1KAYA 1QH9A 3QBCA 4PG4A 4XH5A 3G8SA 5LJ5Y 4QIWF 3BZCA 3NF6A 1UVKA 1SC1B 2X1FA 2FZGB 1GEHA 1YJNN 1N2XA 8ICYA 5JVGQ 3K1ZA 1JI7A 1P8ZA 2LSNA 5I42A 2AHOB 3L4IA 3RW7A 1LCUA 1YIJN 3FRZA 1UMJA 2FJWA 1CZ9A 4KLIA 2Y9TA 1MLAA 2Z2ZA 3M30B 3B9JA 2Y3YA 3GG0A 3W65A 2V67A 1UZHA 2UUCJ 2IRUA 3NF9A 3I31A 1BO5O 4QBUA 5HVFA 3ET6B 1N0VC 2EFPA 1VMBA 2E5LK 3S3NA 3V6HA 1SJRA 2PIIA 4WP3A 2WW8A 2BPFA 2KEYA 1VGYA 2ALZA 4LF9K 3D66A 3PG9A 2RN2A 4NYZA 2YX8A 4PHPA 2HBZB 3M30A 3AO4A 8ICAA 3ISZA 3OPKA 5LSRA 3TO8A 1ZBUA 2VKZG 4DPYA 2IYIA 3GIKA 1M1KO 5B0EA 1B0XA 1H2TZ 4WP8A 2VDHA 4MKVA 2W6KA 2NZ4A 4PQAA 7ICEA 2AYEA 2DKZA 3Q83A 1XNRK 3VEYA 4MFFA 2Q6CA 1FRLA 1YF5L 2R8JA 2OEKA 1XSLA 2H3GX 3M7VA 3MPVA 1A9NB 3Q8QB 2ZEJA 5J2DA 5EE3A 1SWWA 2FE9A 5LXYA 2JH1A 4TYAA 4P9SA 1O5JA 5KL1B 1RDRA 1LW2A 5HMZA 1H7XA 2HFSA 3LL3A 1FRJA 5F3TA 4QNLA 1JL2A 4FWOA 2V94A 2BYCA 1J5OA 1CRXA 5DG8A 4DTSA 2GGPA 2YY6A 5AI4A 3ZTRA 1EKSA 4IH6A 3VEOA 1WEYA 1ZQUA 4K2XA 5KFUA 1RWUA 4USVA 1I5OB 2V9KA 3UE2A 1Z1VA 1NPKA 3CCVN 1XNQK 1GLAG 4F4KA 2ZOMA 1NK6A 1OJ4A 3JB9k 3NF8A 1N33F 4LIRA 2MJNA 4YB7A 2GAHC 1WI6A 1LWFB 1N52B 2PN6A 2D3DA 5J8YC 5HJYA 2VIHA 5ETQA 3SYZA 4ZCIA 1ZD3A 4DZDA 5AE3A 5AKIA 5AI6A 3DLBA 4BRHA 2R7TA 1Y97A 3IXQA 3M32A 2OEHA 5EGYA 2HHTA 2ZNYA 3M5RA 3OL8A 1VDVA 2LBOA 2BZFA 2Q6BA 4RQ4A 3LVVA 2FI1A 1NOZA 3V5RA 3PACA 1HBOB 4TQSA 3MR6A 1IBMF 3MDAA 1SKUB 4J9UE 5J1EA 1GLEG 3R8EA 3AXKA 3F2CA 5HSPA 5KFWA 4W5TA 4USJC 2E8AA 1ASWA 1TK5A 4BE0A 2MGZB 1DGKN 1SZPA 3DI6B 2F8SA 4M63A 7ICKA 4V19J 3BEXA 3CT9A 2GAGC 1SQFA 4F71A 3BN7A 2FMQA 4JMUA 3I32A 2HBMA 1RDCA 2ASDA 2B4OA 4DUYK 5HAOA 1HBOA 3PR5B 3GZ7A 4ILHA 3DXKA 4IRDA 1WG8A 4C98A 2JRZA 3HWTA 3TWZA 2D1KA 1ZBSA 1HNWJ 3AV9A 5BRDA 1SV5A 3TEGA 2HHHJ 4FNIA 4IBNA 3QGHA 4CEAA 3P38A 2QARA 8ICXA 3NRWA 1X4HA 2XLIA 3CETA 1TZ0A 1OWXA 4QZBA 2YMPA 3RJMB 3C7NB 3NMAA 2K3IA 3HJFA 2OPQB 3HXMA 3AJDA 4DV6J 3FZBA 4IO1A 2IHNA 3IRUA 3IO1A 4PAAA 3W8GA 4CDGA 2OTLN 4KAIA 5D4NA 4AH9A 1L3UA 5KFIA 2EX3A 4CFCA 2RHQB 3TOQA 1X5PA 4OZ5A 3M6VA 4UOHA 2NYIA 1IM6A 1FE0A 2DITA 1SKRA 2J6SA 1W26A 4EHTA 1PYSB 3IDWA 2XRIA 4LRCA 2BABA 1F44A 3QIPB 4A57A 4WFAL 2ZIVA 3EYZA 1RAGB 1GLLO 4B1VA 1KLMA 4EBCA 3MM6B 1QSYA 2F40A 2NSCA 4CEZA 1TKZA 4G3IA 2A42A 3UCGA 4IFEA 3OTOJ 2R42A 3DDKA 1F6TA 5KG7A 2HAIA 4DBQA 4NB4A 2D1CA 1H3DA 3VV2B 3TQ1A 1T05B 1N33K 1MW7A 5I3QA 1HX1A 1ZQPA 3SUOA 3A12A 1IV8A 4ZH4A 3MM6A 4CGJA 1YJ7A 2P9SA 3BF1A 1YKWA 3FMWA 3R9LA 1ZQQA 1XK8A 4JV1A 1NDLA 3T9NA 4FYYB 2O01C 4C48A 4H5NA 4IO9Q 3EKUA 1T05A 3LOUA 2UXCF 3TFRA 2P9PA 3LK9A 3I82A 3BY5A 3DU5A 1LWCA 3HHKA 2EZXA 2J7KA 1A5WA 3EEQA 5KGXA 3I8BA 3UFCX 3AVMA 1TK8A 4ITSA 4GMJB 3K59A 4DCJB 3KLFB 3G6XA 4X2BA 2QK9A 1ULRA 1X5OA 1BPZA 2XHWA 4RG8A 2P6RA 3C6AA 3BF3A 4DSEA 1HR0K 2Z2MA 3BO3A 3EE9A 4H0XB 3O1LA 2Q31A 4TUPA 3HDSA 3J80O 4ILRA 3EGNA 2YHXA 1DTQA 2E7VA 4BY9C 4IG3B 3A8KA 4R66A 1S1XA 2NRXA 1Q7YT 1Q5VA 2O3DA 3FSIA 2E3TA 1KONA 4YNQA 2JH7A 1UFLA 2PFNA 1CC7A 4XPCA 3PO5A 3HP6A 3L95X 3KLFA 3MGIA 4RNNA 2VOPA 3FEYB 3BQ1A 1SJ3P 7ICLA 1ZTTA 3VESA 4IDKB 4J2EA 4XIUA 3D2EB 4CESA 1CEZA 5ALEA 1XJWB 3KBBA 3SAFA 9ICJA 3RJHA 2BE9B 4M3UA 5U47A 2LXUA 4Q44A 3HT3A 3VQTA 4EFHA 4YOWA 5KFKA 4JYAJ 2LEPA 1K8KA 3VQ4A 3ZZOA 2F4FA 4IQUA 2XS2A 3I4HX 1DARA 1S72N 4E7JA 3DEEA 3A8IA 1GTEA 4NLRA 3IRWP 1XC3A 2DBYA 2A2CA 3M2VA 1S9GA 4JI2J 3V9XA 4C4WA 2YVSA 3HVRA 4IDKA 2U2FA 4WK3A 4CTAB 3D2EA 4H4MA 1ZQSA 3IUCA 2PT0A 1OO0B 4OPJA 4O9MA 2KSOA 2G1DA 4I28A 4DOAA 4MKAA 3CD7A 4CLUA 3V9SA 3T69A 1F60B 2F8LA 3SQIA 1ZZNA 3BDEA 1N5XA 2BANA 4I2BA 1RZTA 2VASA 2OFHX 4IQMA 3EZOA 2NQPA 1OH5A 4LUBA 2OPPB 4M04A 4CEFA 1YRTA 4NYNA 8ICIA 1RBSA 4CHYA 3FCHA 4P2MA 3E58A 2QLXA 3ZZTA 5AQVA 5IIJA 2EKNA 4AL7A 3ZSRA 3OLBA 1CZAN 3QIOA 1TKXB 4CW7B 4CZGA 4CTAA 1HMVB 4O4GB 2F63A 3VA3A 3FSYA 2PGCA 1RTJA 5IV4A 4CJWA 1VC0A 4JK8A 4R0EA 2E5LJ 1UWBA 2FYXA 1TYQA 2QL7B 1X1PA 4CWBA 1KEJA 2HFNA 1WSFA 4UZBA 1RT2B 3TAQA 4N7TA 2E9RX 4LF9J 4O44A 3LP1A 2I1RA 5AQZA 1NHVA 1D8YA 1ECWA 2LDYA 2O67A 4I9LA 1RACB 1RWKB 3L6QA 1Z3EB 2IDLA 3LGNA 2UXCK 3CIPA 4O4GA 3U8XA 5EWGA 3A3OB 1QLNA 4DR4K 1H38A 1WNSA 3HF5A 2DNGA 5KFJA 2BR0A 2LKYA 4XO0A 5K4LA 2BJ3A 3BKFA 3TRGA 3KK1A 3J8AA 4ECWA 1XNRJ 3SK3A 2H3ZA 1ZQDA 5D0EA 4EHUA 4FVUA 3TJ8A 2FHMA 3GFZA 3PUFA 5J2BA 3C23A 5T14A 4NLYA 3KHGA 2XZTB 5HL7Q 1VK0A 4OZ1A 5EY4A 1GX5A 3B6OA 2K4PA 4CYUA 2E88A 4W5OA 1E6YB 4C7QA 3WBZA 3AOCA 2KVCA 3Q23A 4PKDB 3C1YA 2CPDA 4NLGA 4Q45A 3MMAA 4E7KA 4URSA 5J0QA 2O4IA 1ZS6A 1TAQA 1HNZF 3VHQA 1NZPA 4L75A 3IHQB 1S6PA 5CD4A 2JL9A 3VEXA 2GUPA 2F1HA 2FDNA 2Y1RI 9ICKA 3AN1A 4NJ8A 5IQ6A 2HLUA 1LVHA 3CCSS 4B9UA 2V8GA 2MSTA 3QU4A 3C0BA 3AA5X 5AM2A 1XNQJ 1Z4OA 2WF9A 1SXDA 3C28A 4OCZA 5K20B 3HVTA 3IA0A 5HVHA 4AT1B 2XMAA 3AQEA 4FLZA 5ALXA 4WWSA 3BZQA 1ATRA 1WUAA 1G1XA 2IM1A 3UXNA 4LFAK 3DLEA 1LWXA 4F3QA 4YD1A 3VF2A 1WC4A 4J9OA 4YN4A 4FLVA 1O13A 4BS2A 2DH8A 4JKHA 3GPAA 2OFGX 4KFBB 3VALA 2ZUGA 1Y3KA 8ICZA 1DQ9A 3R6GB 3S7RA 5KFBA 4FN5A 4B3SF 4UASA 1FCAA 1HBMB 4CJ7A 4CEBA 1XQIA 4NZ0A 1C0UB 1VQKS 2X51A 1J27A 9ICIA 2UXDK 1O03A 1QE1B 4ANDA 3ENVA 2NSBA 5AKHA 5AKZA 1HWKA 1EP4B 2DGQA 3M8ZA 4E89A 4DTXA 2XZDB 2OM6A 3ZT4A 5L1KA 3CC2N 3M2RA 3Q8KA 3CFRA 2R7XA 2AH5A 1D8LA 3RJIA 2WCXA 2LA6A 3W2WB 1RI7A 2YY3A 2IMOA 1NKCA 4KLJA 2RU9A 4AP9A 1L3KA 4M5KA 1UEKA 3ULHA 1N62A 5AIAA 3WX4A 4YQWA 3D0PA 1SV0A 4BRNA 3AARA 5J2QA 3AQOA 1RWVB 3Q8LA 3HRGA 4IH7A 1BVSA 3V7LA 4B1WB 4OX9F 3R9KA 4LFBF 5DB8A 3O3FA 3GV8B 1JLBA 1DHMA 2QV6A 4K4TA 1SC6A 1G15A 2OD4A 1KDHA 2ZDOA 2VG5B 1RFQA 2ASPA 3H7IA 4M5DA 4PWDB 3F53A 4YXMA 5G5HA 4MFAA 7ICQA 3GCXP 4CHOA 1P7DA 1RAOA 3CMAS 4ZK7M 2RF2B 3G82A 4PHTX 1NUEA 4HUGA 3KWIA 4ZLJA 3CUNA 1VC5A 3Q89A 1UVIA 3NFAA 1HD1A 2N3OA 1EKRA 4F4XA 3V4IB 1VHXA 2WW4A 1UJ4A 4ECTA 2FTRA 5DETA 4WIIA 3WKAA 3NASA 4JBCA 3A1YG 1N56A 1S7HA 1Z1BA 3NNHA 3L09A 1BQXA 1EXNA 1NJWA 2ZBRA 4C3KA 4UY85 4PYAA 3KJFB 2A3ZA 2D0OA 2JWKA 3ULEA 4CFBA 2RP5A 3CC4S 2IA0A 3R6LB 1U1QA 3HHLD 2ZJQQ 1IJJA 1BGXT 2G09A 5HMLA 4QU7A 4ZLNA 2VQEK 4M7XA 3VEZA 4MK8A 1N33J 3W66A 2YJEA 4QWBA 3ZXWA 5HRNA 2OPSB 1GH8A 2KKHA 4NCBA 4Z37A 1VAZA 1GX6A 5ETOA 4HH0A 5AR0A 5J0PA 4YMEA 2CPXA 5CCMA 9ICTA 1BE4A 1VJWA 3MC1A 1MA7A 4C9DA 4U8VA 9ICFA 2Z30B 4Z6FA 3AVLA 2RLTA 3RSEA 1D9DA 3H98A 2ZWPA 4CEOA 4DU8A 4DN0A 4GLXA 1IBMJ 4ECXA 4JI3F 4KH1B 1RE1B 2LQBA 3SMVA 4FXWA 2H48B 3RBEA 2GHPA 3H0RB 4J9PA 1JLGA 1T9VA 2ROPA 3M05A 3NBPB 2DR9A 3JTOA 3AO3A 5MLCV 4JI4K 4FFDA 1K73T 1JLCA 1E4GT 4CD1A 5LL6d 2ISOA 4RBTA 2KMDA 4B3MK 2P9GA 2FLPA 3OYCA 2IOFK 3G0ZA 4IFVB 1X6JA 3CYMA 1WOQA 4P4MA 4ZDNA 4J5OA 1SAZA 1ZM9A 1N6QA 3PNIA 3H3NO 1XSNA 5DB6A 4DUTA 2CZVC 2R7QA 5ETMA 1KVIA 1UT5A 2R9LA 5BN8A 1NNEA 4FLWA 2ZNZA 5ALNA 4L3KA 2BVZA 3TANA 1GXLA 5L9NA 4NX9A 2BRKA 2RQ4A 2QWOA 5DM7Q 2HF4A 2XGQA 1CULB 3TTFA 1W2BM 4DLGA 2Z1HA 2ABYA 4F36A 4FWSA 4YOVA 3SQ2A 4LFBK 3RR8A 4RR5A 5HHIA 4FJIA 1SB3C 4LBIA 5K8MA 1RISA 2CVIA 4Z7YA 5HI7A 2W8LA 3QXGA 1PAEX 3M7DA 5DBBA 4UB1A 3M1VB 3SFUA 1TL3B 4ZP6A 1VBZA 4CJUA 3EVWA 3P3DA 4MYTA 1JMTA 2P9UB 1SQKA 3ILIA 1CULA 1TGOA 1HUOA 3VPZA 4P0PA 2VZ9A 4WZMA 3L2VA 3GJRB 4YMOA 8ICNA 4M3YA 4DR5F 5IZHA 2KHQA 3RBXA 4I0WA 2D0CA 3CMQA 4CZLA 4FXVA 4CF3A 3OYNA 3ETRA 4USWA 2GQ2A 4CJEA 2JLGA 1HJPA 4EK2A 3C16A 2Y0SD 2J7UA 4IFYB 2HRYA 2V63A 3UXPA 2KL8A 1FKPB 2WVBA 5K14A 3K9JA 4M63C 3CDWA 4ILJA 1RCOB 2J4RA 2FLOA 2SXLA 1QQMA 4KKOB 3KKRA 3K0SA 1VQNS 3PDNA 2VODA 3CCSN 2FHJA 2IVFB 3N01A 1GXUA 3MM7A 1NKEA 4C4RA 4RW8B 1UOCA 3FNNA 5M1PA 5G0RA 4USAA 3CE8A 5J0UA 1R8CA 5AK3A 5CYMA 1KS2A 2DNZA 3WC0A 1KLNA 4DCCA 3O3GA 5KQ8A 4DS4A 4DSFA 4ZOSA 4IFYA 3UN5A 1ZQAA 2DR5A 4TQRA 1C0FA 4FZXC 3LDOA 3TUPA 2MA1A 2PD1A 4CRXA 1Q3VA 1RP5A 3CCJN 2N7CA 4TY8B 2WAQC 1EQ0A 4UUWA 2OYYA 2J0XA 2E7XA 2UXCJ 2HNZA 1YJTA 2GC8A 4OI1A 1Q8KA 3AVAA 4ECQA 4W90B 4DR4J 1KTVA 4KGZB 3R2CJ 4O0JA 3QO9A 4X62F 1H73A 1VQKN 2BBEA 2O8CB 2EZZA 5GAGU 5AQUA 3V7JA 2L48A 1IKXA 2L9DA 4S0MA 4YG2A 1A5VA 2W24A 4ZCLA 3BGLA 2K7JA 5KT6A 2ZC4A 5FP0A 4CO0A 4CGZA 4IOBA 5ALOA 4RQ3A 1N0UA 3MD3A 4UARA 2J9DE 4Y65A 2Z7JA 2QXFA 4LF7F 2K4IA 4YR3A 4KBIA 3NXZA 3OVAA 1JXBA 2QWQA 5K5MA 1O1WA 1SL0A 3CIZA 3HULA 2ZGZA 2O8CA 1BL3A 1YRUA 1SQGA 3A5MC 7ICOA 1WKLA 3NRZA 1YDLA 1JJ2R 5DLFA 1RT7A 4MFBB 2HHXA 4JB3A 3HFZB 1F0XA 1BNPA 1J6ZA 2I5JA 2HQDA 2PE8A 1T94A 3C1ZA 3WHIA 2E9TA 1IKVA 4XH1A 3KG0A 4H5WA 4I6YA 1RGVA 3NVVA 2RT3A 2WF8A 2FBVA 4HACB 2KP7A 3Q8UA 3BO2A 2MKIA 2IM2A 4MFBA 3JYTA 1U2VA 1FEZA 3QYPA 2MMYA 1U6BA 2FF3B 2KM8B 4J03A 2GIFA 2QMXA 4FJ5A 4IKAA 1PSDA 3SUPA 1ZQBA 2QWMA 3D6MB 5EU7A 1NK8A 2FJBB 4D3GA 3HPGA 2CYYA 2HQIA 2JWNA 5A8WB 3HRDD 3LM9A 2MSSA 4BRCA 3IS9A 3O3HA 5HROA 1S0VA 2UV8A 4Q43A 3PXGa 2YX4A 2I6XA 3DOKB 2V8PA 4LR8A 3MFIA 1S1VB 5KG6A 1GFWB 4WFNL 3KD5E 3UNGC 3WK9A 2W43A 2QMWA 1QAJA 5KTQA 2CRLA 5J2MB 2B0GA 3QSIA 2F9WA 5B0AA 5AFUA 1ZQTA 5B5EU 2KN7A 5AQRA 2C1EB 1VQ9N 2ZOGA 3TZWA 4G1QA 1KD1T 2BOAA 4MK9A 4H0OA 1IKYB 2VL1A 2IBKA 1RUSA 1ZQMA 3LM2A 4FVCA 2FD2A 4JI7K 2G2YA 4J8FA 4O3QA 1YTUA 1RTHA 3IWXA 5HBMB 2MLYA 4J9NA 2AEFA 2CA9A 2M0GB 4KC5A 2AGQA 1ZA2B 2W7AA 4IH5A 4F72A 5AK6A 3BGUA 1DRGA 3DOMA 4CE6A 2Y1IA 3Q2SC 4HTJA 4I6MA 4CNQA 4DV2F 3O0FA 3EM1A 2CWKA 4RW7B 2R2SA 3VCBA 3HKZF 5DDMA 1CS4A 2A3VA 4N56A 1HYVA 2QWPA 2J0WA 4NY8A 1XMQK 4YHHF 3BQ7A 3KTQA 4CH1A 3R97A 2G13A 4B1YB 2KVSA 5L38A 4TLRA 2FLNA 1WJ9A 2OP5A 4M94A 5F2RA 5KT3A 2CQGA 2DGSA 1N8RT 1M5PC 1BUXA 3SSSA 4JV5K 5H1SQ 2WBRA 3MPUB 4EP5A 1DXSA 4BR9A 2I1QA 4DU3A 2ZIWB 4FL9A 4DV4F 2BPGA 1ZAWA 4RW7A 1HNZJ 3QB0A 3EWAA 1Q82T 3M9MB 4HYKA 2NXCA 4IZ9A 4CF9A 2Y1JA 4I2IA 1QY7A 3QMLA 4OPHA 3SMZA 1N5TA 2UU9F 3UB5A 3Q8MA 4BLGA 1IBLK 2KTQA 4IR1A 4JOUA 4FS1A 3IC1A 4KBOA 3WEEA 2N3LA 2Q79A 3NOCA 4GW6A 1WCNA 4FF1A 4I69A 3RB0A 3GILA 4FO6A 2V0NA 4K0KK 1RAFB 3UD4P 2UVWA 2DXFA 5B0FA 1UP1A 4C3LA 3WK5A 3PCOB 4U6PA 3S1TA 1OW5A 2UUWA 1WWVA 3KUHA 1VIOA 4FYDA 4K42A 2MUTB 2CKWA 4EGLA 3CP8A 1HNVB 4A8QA 4NXMK 1JB0C 4LF2A 1KFTA 3AQPA 4ECYA 3RH4A 3L9ZA 3BH6B 3AJ2A 4WFAQ 5K8OA 2CXYA 4B3TK 2E5HA 3CCES 3VZHA 3MUVP 3JS6A 2KFNA 4M7YA 1WYGA 3RAMA 1TFRA 3K5LA 3SCLE 4HKQA 4FKXA 1GLCG 1WBBA 2IHMA 2DR8A 5TKWA 3P5TL 1VQNN 2BTFA 3PIOL 1RJJA 4XQ8A 4UQGA 4DI6A 3IBWA 1RBUA 3G2XA 3LDLA 1HQ2A 3HZEA 3OD2A 3U4LA 2DPNA 3MDQA 2B56A 1XMOF 2VGNA 3SV4A 5CZ2A 3TADA 5HNKA 1YJWS 3OXFA 4C0HA 2IM0A 1X6IA 4RNFA 4HEA9 3CPWR 4XH4A 1XN9A 1X9SA 4RX6A 3DLKB 3JSRA 4WF9L 1JROA 5FIIA 4XDDA 4H5VA 1KD1O 5CHGA 2AMCB 4IKFA 4N41A 1K8AO 3SNNA 1C0MA 2Z1GA 3VGSA 5E7OB 1CZBA 5C24A 3HZ6A 4LFBJ 2AJFE 1REGX 4KH4A 2GJ2A 1UCVA 1W9HA 4CE9A 4OL8A 4JAXA 1VHFA 5L1IA 1KXPA 1NBWA 1TAMA 2EK1A 5LXRA 4DMNA 3RBDA 3GOIA 1Q5YA 4C4SA 4ACOA 4YHHK 2YKNA 4H5RA 2N1RA 4JRQA 2XBPA 1TAUA 2QKBA 1S48A 1CUKA 4U7CA 2DHGA 5KFSA 2LMIA 4CHPA 3F0NA 3G6VA 2V2KA 4X65F 2GEMA 4FM2A 4IEIA 2FSJA 2L9WA 3JQJA 2D7SA 3CJSA 3Q22A 3P1GA 1AZSB 5HO4A 1RT3B 1N8RO 3RG6A 5AI8A 2H5XA 1IO2A 3SQGB 1B9DA 4FE3A 2KJ8A 3R1LA 4EEKA 4NM1A 1GLJO 2ZF5O 1T02A 2YHWA 5EDWA 3AB4B 4K4VA 1UJ6A 5T7LB 3RTVA 3DCAA 2F5GA 5DZ6A 3KK2B 4P2SA 2VKRA 3GSIA 4KE5A 4LZGA 2D74B 5DK5A 4UOFA 5AM5A 3O4NA 2O4GA 2IY5B 1DLOA 1DQAA 3U9DA 3MGJA 4QR2A 4P72A 2PMZC 5JUMA 1RYSA 4Z2XA 3SQGA 1AA1B 3PW5A 3QE9Y 1SV0C 5DBAA 4UTGA 3QU5A 3UXOA 1SV4A 4BR4A 1GQEA 3BQ2A 1ELOA 2F3NA 1R27B 2W8KA 4ZJQA 3NRBA 5AI0A 2GZOA 3TAEA 5B09A 3DXSX 4J9RA 3OTEA 4CNZA 3KK2A 4JI6F 5JLFA 3RB4A 2AJQA 3GJQB 2Q43A 2KYXA 1W25A 4YFKA 4A46A 1W7WA 1QUPA 1U1RA 3EXYA 2LXFA 3ZNJ1 1L3TA 2E2PA 5JS1A 1VQ5N 1WSRA 1RHKB 3HTVA 2UXBF 2VHGA 5ALDA 3IRXA 3WX8A 1TVAA 2KVQE 2DH7A 4JI3J 3IM9A 2KHCA 2EPIA 5EOZA 2V2VA 4CI0B 1Y3JA 4GMKA 2EG2A 2QTDA 2KE7A 2H1YA 3AY9A 5FDLB 1JMSA 3WNHA 2XY7A 2H54B 1PVQA 3F5EA 2BW7A 2D3O1 2CIMA 4H4OB 2H3QA 2WMMA 3MK6A 4IC9A 3D6JA 1D8ZA 1WNEA 1X0FA 2MQNA 3AVFA 1BHLA 1HUZA 1DAXA 3H5YA 2QJ3A 1SH3A 1FE4A 2X1BA 4C1NI 2CJBA 2LM1A 3OL7A 3C6HA 4P7VA 3AXMA 2HNYA 3O6WA 1FD2A 2X3DA 4TU8A 4KITB 3TI0A 3UO0A 3R3LA 4CK3A 4CBUA 4FZLA 2QB0A 2QLTA 2MQLA 2MKCA 1A0PA 2KLAA 1JJ2M 3IP4B 1F5CA 5HR7A 1EQYA 7ICNA 4F5QA 2JFDA 2QA4S 5ALMA 4ECUA 4KHSA 3HVWA 4NLXA 2AYBA 3R5DA 4K4UA 2K06A 3UPQA 4DR5J 2JC1A 3T6BA 2XWXA 3R9PA 4C0ZA 3QGPA 2Q97A 1ZETA 2EAMA 2FC9A 1A6SA 2COLA 2EEYA 3LVWA 2PA8D 3H4BA 4BR2A 4ZVSB 4PHAA 3MEDB 4OYBA 2WB1D 4CHQA 4KB1A 4F3OA 2VBZA 3BF4A 5C5JA 1LW0B 4JI8K 2FC8A 3DM2B 1RTDB 1KQQA 4FYXB 4L72B 1Z25A 1ZD2P 4CHNA 1HKCA 3SMSA 5HHHA 2KIWA 2YNIA 4D3HA 3GP9A 4K25A 4FJKA 1NU0A 4BC5A 5BR8K 3OJUA 4CZJA 3BSCA 1ED1A 2AJ1A 3VGLA 3JSMB 4E1JA 4DL7A 2MAXA 3ZSVA 2R8IA 5GAHU 4RNMA 4W4MA 3MMCA 1RTDA 5A0LA 2ZUCA 2V69A 3QFHA 6FDRA 4MEYA 5GAGI 3IBPA 3OYDA 3UKUA 3ED5A 1MN7A 3WK7A 3I5AA 3JSBA 3T5HA 2KICA 3RGIA 4JI7J 1C1BA 3I56N 5KNIA 1ZOLA 4NXNF 2G8KA 3UM9A 2KDOA 1XO1A 1ROFA 2GWKA 3VAKA 2W9MA 4QZCA 3H4DA 4DV7F 2NYVA 3EUNA 3CCEN 1HFEL 4KO0A 1IV0A 1QSSA 3E51A 4O0IA 1RU1A 3TZZA 4W5QA 2BW2A 1VQ8S 4CVNE 2E1EA 4KHMA 9ICSA 3KLIA 5L46A 2G0CA 1WKJA 3C5GA 3BP8A 5F8GA 3EL2A 2DTJA 3RF9A 3DMJB 3QRPA 3NG8A 3D6TB 4GVLA 2V4QA 3V72A 1FRHA 2KOBA 4FZNA 2E1CA 4KHWA 3H8YA 3D68A 3LALA 1NDKA 4LF7J 1RDAA 1K9MO 3N7RC 4MYUA 5C2GA 4JHDA 2KKZA 5AQQA 5D15A 3NCRA 2WFAA 2MQOA 4O3RA 4QR0A 4DQSA 3RJEA 3DXMA 1OXJA 3KLEB 5HMWA 2N4DA 3PJWA 1Q46A 3MWPA 2QXLA 4ED8A 3DMJA 5K8PA 1VQ4N 1KC8T 2ZJ5A 3PJXA 2K8AA 3EGZA 4I6AA 2ZJRQ 2QM1A 1WOSA 1KR4A 4RW4B 1HEKA 1NOMA 4DSLA 3OXLA 4C1NK 2AT1B 2D0BA 1WTFA 2ZUAA 4BCAA 5FPNA 3KWMA 1VQON 4QIWD 1YI2N 1R3NA 5ELZA 9ICXA 2UP1A 2OTJS 2P9LB 2VA3A 5A6PA 2LEBA 1VDHA 2DHAA 3HCXA 4CO2A 4KLTA 3HKWA 1HYSA