4DSKA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, ppi and calcium
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
579
structure length
575
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*GP*CP*TP*AP*CP*AP*GP*GP*AP*CP*TP*CP*G)-3')
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 205
structure length 575
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dskA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dskA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dskA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dskA01
9ICFA 3NDKA 3OYIA 3ZSOA 3TR8A 3H8JA 4YNQA 1S0VA 2Q0ZX 4K8XA 2J6UA 3MDCA 4CF9A 2FPKA 4KTQA 4I27A 5DDMA 3NF8A 2HHWA 2XCPA 1C0UA 9ICMA 2DPIA 3UQ0A 3MXIA 1KVAA 3RJIA 4J9SA 3AA5X 3HVRA 3AUOA 1LAWA 1HPZA 2QXFA 5HHHA 1LB2B 3JPOA 4DQIA 5CWRA 4OKKA 5IINA 4CF0A 1EXNA 3QLHA 5KG1A 3OGUA 3H4DA 4IQWA 2ATLA 2F8TA 5CZ1A 3F73A 3ZT1A 4FYDA 5IIMA 3V9SA 5KFWA 3SUNA 5KFIA 4UB5A 7ICMA 5KT5A 3EW9A 2BDPA 4Q43A 4GXIA 2PYJA 5KFRA 2PFOA 4M3WA 2HHQA 5DG9A 3QEVA 2EHGA 3UIQA 5C42A 4I2HA 5DB8A 1TKZA 3OYJA 4RZRA 3Q8QB 4E0DA 2HW3A 2VG5A 4B3OA 1ZQPA 4YR3A 3KK2A 2KZ3A 4JRQA 4DTJA 1JMSA 5D4BA 4AILC 1S1WA 3ZT3A 3V6JA 1HJRA 4KN4A 1HNIA 3K5OA 3M8RA 4F5QA 3Q8LA 5CB1A 1QHTA 4CJWA 4ED6A 1KLMA 5KI6A 4I2JA 4I2GA 1R0AA 1YTUA 3DOLA 1DTTA 3TAMA 1FKOA 1HMVA 1NOYA 2XY5A 3N97B 4FLZA 5KRTA 4DOBA 1J53A 4KO0A 5L9XA 4OKEA 3HVTA 4M3ZA 4UQGA 9ICJA 8ICSA 3C23A 2G8FA 4DL7A 4J9QA 3VQPA 4IQUA 3U3YA 1S9GA 2ZJ5A 4RQ8A 5DB6A 3BQTA 4Q45A 4CJTA 3V81A 1FXXA 1IKWA 2QK9A 4DSEA 1TFRA 5DLGA 4JV0A 2LSNA 3M9NB 1ZBLA 4O3RA 4FBTA 3T1AA 5BPCA 1SL2A 4O4GA 3QE9Y 4DOAA 2IAJA 4O44A 4DOCA 3PUFA 3OYLA 1HJPA 3K75D 3T3FA 2IOCA 8ICHA 4I2EA 5KFDA 4QZIA 1IKXA 3V9ZA 5J2PA 2D0AA 2F1IA 1S0OA 2AQ4A 2ZUDA 1WLJA 4DTNA 1D8YA 5CY4A 5JUMA 2A1JA 1X9SA 4CEEA 4FCYA 2HHSA 5L1JA 4TQSA 1LW2A 4CEBA 4PGQA 4FM1A 1TL3A 1S0MA 4HCCA 3OVNA 3NH2A 3D0PA 1B9DA 1IH7A 4YXJA 3THVA 1KVBA 1RT4A 4KB0A 3C1YA 3L2RA 2AU0A 2PI5A 1Q9YA 1RXWA 1ZQIA 2FBVA 4GXKA 3GV7B 7ICIA 2X74A 4E7HA 2IDOA 3OS1A 3Q8MA 4YFKA 1L3UA 4DSFA 4O0JA 1ZJNA 4KTWA 4H4MA 4WE1A 4ZTFA 4CJ5A 4F4YA 5CR0A 4DS5A 1B22A 2H5XA 4F50A 4C8LA 1BI4B 2XCAA 3DLGA 2ATQA 4W5TA 1N56A 4CGIA 5EOZA 3P1GA 4E7KA 5KFEA 2JEGA 7ICLA 2FPMA 3AV9A 1CXUA 2JLEA 1WCLA 4DQQA 1TL1A 1VRTA 2YKMA 4W5NA 2YNFA 3V4IA 4K4HA 3RRHA 4NM1A 3TI0A 4KLEA 3I8DA 5I42A 1KTQA 4KAZA 5DG7A 2XC9A 4KHUA 2JGUA 3AU6A 3OYCA 3M8QA 3JSMA 4C8OA 3SQ0A 4EYHB 4YG2A 2OPSA 4RUAA 3PX0A 1KFTA 5KFUA 2GV9A 4M3RA 3L2UA 4Z4FA 4OGCA 4KHQA 3KK3A 2W8LA 5K14A 1V9PA 3C95A 2OPRA 2P5OA 1SL1A 4CEOA 4CJ3A 4F4WA 3NE6A 3QEWA 3RMBA 1ZQYA 5KT7A 7ICUA 2WTFA 7ICHA 3LALA 3MEDA 2G8VA 3SUOA 1UAXA 2IGIA 1EETA 4UAWA 2BPCA 5KT3A 1BPXA 5IIIA 2Z1JA 4BE1A 1WSEA 4NCGA 2FBXA 2EX3A 8ICOA 2W42A 4DG1A 4F4KA 3OYGA 8ICMA 5KFJA 3G10A 4CHPA 4DTMA 1XU4A 9ICKA 4ZH4A 3KLIA 4O3SA 4PGXA 4F3OA 3JPQA 4CEAA 1BGXT 1PZNA 4DSLA 5J0TA 4KLHA 1ITGA 4IFYA 3HP9A 2UVWA 5L1LA 1BQMA 8ICLA 3KLGA 3HJFA 3MXJA 4DFPA 2HHTA 1LWEA 3DMJA 7ICGA 4ECQA 1SKRA 3T5LA 1RBSA 4KI4A 4I2DA 4RW6A 3ZSQA 4F92B 3KJVA 2OYQA 4BXOA 4B08A 4FZXC 1BPEA 9ICRA 3EY1A 4P4OA 3IS9A 4RW8A 3CG7A 1ZYQA 3KTQA 3TAFA 3LWLA 4DL2A 2BE2A 3QEBZ 7ICQA 4KTZA 1TV6A 1HQUA 3CM6A 3MR3A 1VSMA 4CERA 4J9LA 1Z25A 3JPTA 1TAQA 2XO7A 1VSEA 4NYNA 1MC8A 2BCQA 4KLQA 1QSYA 4RW4A 2VWKA 2P66A 7ICFA 1JX4A 3K59A 1LWCA 3V1QA 5DKWA 3VQ7A 4CFCA 5DQIA 4RQ5A 4ELVA 2BQUA 5KFCA 3KKRA 1GOBA 4IR9A 3ZDCA 3H4BA 4QWDA 2W9BB 2DFFA 3H7IA 2IHNA 3DRSA 2W9CA 1IM4A 2G8HA 2FLPA 4M3YA 4TURA 4LZDA 4HUFA 4M2YA 1D9FA 5DB7A 1X1PA 8ICBA 4E3SA 5EWFA 9ICIA 3AVGA 1HNVA 1SUQA 1ASWA 3RWUA 1ZQTA 4FLTA 2BCRA 3OJUA 3K2PA 4DL4A 3OYBA 3MR5A 3KD5E 3RAXA 3AO4A 1XSPA 2DY4A 4K4GA 4KLFA 5HRNA 3C94A 4M6WB 5KG0A 3LDSA 3DRPA 4DU4A 4O3PA 4CFAA 1HUOA 4MF8A 3EYZA 1O1WA 3LP3A 3DLHA 3SCXA 1LWFA 1RCHA 3LK9A 4RW7A 5CZ2A 3LWMA 3WNEA 3NF6A 1NK4A 1WAJA 4R8UA 1ZQCA 3ZDAA 5KFMA 1NK6A 3MECA 4DTOA 5IILA 3RJJA 2UVUA 4CCHA 4RW9A 4F5OA 8ICQA 1ZQMA 4O3OA 2ETJA 1XI1A 1K1SA 2ASDA 4X5VA 4UB3A 4FS1A 1QE1A 1BIZA 2HHXA 3VQ8A 2KZZA 1RYRA 3DOKA 3NH0A 1D5AA 5KRSA 3KLFA 4BDPA 4LD0A 3V9XA 3G6XA 3V1RA 5J2GA 2NUBA 2FMSA 3QNNA 3DYAA 9ICXA 4BE0A 3S3MA 1ZQSA 5KFOA 3RTVA 1ZQWA 4ID1A 3OS0A 4DU1A 1ASVA 2DTUA 4DEZA 5J2JA 5IIKA 4ECVA 4B9MA 3LAKA 2ALZA 8ICKA 3GQCA 4Q8FA 4IR1A 4M45A 2JZBA 4CJUA 2X6NA 4XUSA 2OPQA 3LAMA 4Z6DA 4ECXA 4IG0A 1I3AA 1T4GA 5J2FA 1GOCA 1ZBIA 4M9HA 3UPQA 8ICPA 3SI8A 4E89A 1VSJA 3NAEA 2V4RA 2BGWA 4JK1A 5D46A 2YV0X 3HPOA 1C6VA 3TARA 3TAQA 4E7LA 3DM2A 3IM1A 2OWOA 1JXLA 4GXJA 2NRWA 4HVJA 1MSWD 1KLNA 3KHHA 2GWSA 1T05A 1S97A 4I2IA 3GILA 4NLKA 5J2DA 4R65A 1RT1A 4RG8A 5I3UA 4M9JA 3NFAA 1TK5A 1TVAA 2Z1GA 4ECUA 3K57A 2VWJA 3M8PA 1VK0A 4C8KA 3L2VA 4FZYA 5KTQA 5J0OA 3FDSA 2PFQA 4LY7A 3SYZA 4CHOA 1ZQLA 3C6UA 1RDCA 9ICEA 3KHRA 5J0PA 3HM9A 4NY8A 2C2EA 1SV5A 1UT8A 3AA4A 4DMNA 3SQ1A 5F9NA 5IIJA 2J6TA 1ZQBA 5BOLA 1ZQDA 4KHWA 3O4NA 4IRDA 2KFZA 1YT3A 1S0NA 4KLMA 4YFUA 3GDXA 3TAEA 4CJRA 4FJ7A 4YMOA 3B0YA 5KFAA 4F8RA 2ISPA 2P1JA 4PHDA 3RR7A 2KW4A 4KMUA 4HUEA 1GOAA 5KT4A 3NBPA 2RDIA 2BQRA 1XC9A 2VA8A 4YXMA 3HPGA 1L3SA 3PY8A 3IHQB 4EEYA 4CF2A 3DLKA 4R5PA 2PI4A 5EU7A 2BHNA 1VRUA 4I28A 1SKSA 2MUTB 3RJGA 1BL3A 3S9HA 2FLNA 4I29A 4B9LA 4ED2A 4TUQA 1UA1A 4ED0A 3PO5A 4FJ9A 1NK5A 4AHVA 2OZSA 1ZQUA 3QEPA 3PX4A 4O5EA 1DLOA 4DTXA 4YVZA 5DBCA 2C22A 2YNHA 4R64A 4B9UA 5HRPA 2XY6A 1CLQA 2YHAA 4AHUA 3AU2A 4Z4EA 4J9NA 4Q5VA 2ZUBA 1W0HA 2HHUA 1JIHA 3V7LA 3LPUA 2G8IA 1NKEA 3N4MB 4KRFA 2JEJA 3AVBA 1VSFA 1EX4A 4CJLA 4DLEA 4DQPA 1JLGA 4QZBA 2DPJA 3TFRA 4E7JA 4O55A 3LDAA 2BGGA 4N5SA 5D49A 3SPYA 4CJQA 4R63A 3VQCA 4Q0BA 5CHGA 3GIMA 3O4QA 4KLJA 2A1JB 8ICEA 2RDJA 7ICNA 4MEYA 4Z6EA 4QW9A 3C2LA 5HBMA 1S9FA 3CQ8A 4I2PA 4O5BA 3ISBA 1XHXA 3ORYA 4MFCA 3T19A 4I2AA 4RQ0A 4P2HA 1X2IA 1ZBUA 1KSPA 2ZJ8A 3VQ4A 4FXDA 1RDDA 3BJYA 1ZQVA 3GFKB 3OYKA 1UWBA 4FJ5A 1LW0A 5DQHA 2BCVA 9ICLA 8ICIA 3KLEA 5J2MA 3PV8A 5KG6A 3V1OA 4I9QA 2C2RA 1HRHA 4M3TA 4J9PA 2Z1HA 1JL1A 3AO3A 4W5RA 3RH6A 4CF8A 5KFZA 3PW5A 3NGDA 2B5JA 4FW2A 4J9OA 1VSHA 3E01A 5KG3A 9ICWA 1CUKA 3B0XA 4RQ2A 5C25A 4F5PA 1ZQEA 8ICGA 2ZJAA 4M0AA 4KHNA 1HYSA 2BCSA 4B8CA 3MABA 2I9GA 4DTSA 4FM2A 3BQ1A 5J2BA 3LPTA 3B6OA 3KLHA 2F1JA 4UB1A 1RBTA 4ECRA 2ZD1A 3K5LA 1S76D 4J9RA 2JEIA 4CHNA 8ICXA 4F5RA 4AH9A 1TK8A 5HRSA 3ULDA 4BE2A 1S10A 4UBCA 5IIOA 2E6MA 2IMWP 4IBNA 3SQ4A 5C5JA 3DRRA 2ISOA 4KV8A 4M42A 4O5KA 2OPPA 3OYAA 1JN3A 3GIIA 9ICVA 4CGGA 1YTAA 1D9DA 4LH4A 4I2BA 4FZZA 3OSNA 1ZQZA 4HYKA 1RDBA 2W9MA 4PA1A 1T8EA 3C2KA 1MQ2A 4QWAA 1BI4A 4KI6A 4DU3A 2F1HA 4BGDA 2E4LA 1QLNA 3EWAA 3RMCA 1XWLA 3MFIA 4UAYA 2F96A 4EBEA 8ICZA 4F4XA 4O5CA 1WCNA 2RPIA 5KFVA 4DSKA 5J2AA 3AVFA 4PWDA 3ZSZA 1N6QA 5J2IA 1U49A 8ICWA 2VA2A 4F4ZA 1UA0A 2FMPA 4Z6CA 3BDPA 2HVIA 1W9HA 3RMDA 4QW8A 3GV5B 3PW2A 3HXMA 4H8KA 2P6RA 4CJVA 5J0XA 2UVRA 3PVXA 5KFGA 3ZDBA 5KFNA 1C1AA 3DLRA 4RQ6A 1XSLA 1RTHA 2BANA 4CEZA 3PR5B 1KEJA 3UXPA 1Z00B 3HL8A 4PY5A 5DB9A 4Z0UA 1COOA 2XY7A 4CK1A 3SQ2A 2ZUCA 4AHTA 1BISA 4M47A 4NCBA 3PW4A 3MGHA 5J0UA 4NXZA 3QEIA 1KFDA 3V6KA 3JPPA 3C21A 3TWHA 4RPYA 3OYMA 1K1QA 4AHCA 5DLFA 4M04A 1TKXA 1BCMA 4EZ9A 2G8KA 5HLFA 2IS3A 4JS5A 3VQEA 4Q8EA 3M8SA 2V4QA 4CJEA 3ZDEA 4E19A 5J0RA 4FLYA 1J5OA 9ICUA 1J54A 3AVIA 4DQSA 1Y97A 4F3TA 3V9UA 1A76A 1A5WA 3V9WA 2YHBA 4JV2A 4UAZA 3KD1E 3JPRA 3GV8B 2Q3SA 4B9TA 1T03A 2BPFA 4W5QA 4YR2A 3HP6A 2QKKA 4YMMA 2KQ2A 5SZTA 3A2FA 3P5JA 2IHMA 9ICBA 3ZSVA 3L2WA 1ZQQA 4KLOA 3MR2A 4OPKA 4FJLA 1SL0A 7ICJA 3TQ1A 3K4GA 4O3NA 4HCBA 1NJYA 4ELTA 3QEXA 3LP2A 2X78A 4YD2A 1S6QA 5SWMA 2HMIA 3CYMA 3ZT0A 4FJHA 5FRNA 4PHAA 2KN7A 2B21A 9ICOA 7ICRA 5F9LA 2X6SA 2I1QA 3PMLA 4UB4A 3OJSA 4PGYA 2FC0A 1ZQFA 4CEQA 1K6YA 4XA5A 2VA3A 3CFOA 4I7FA 2KZMA 3SZ2A 7ICEA 5T7BA 4QZCA 4N76A 4ED3A 1Z3EB 5KFHA 3EPIA 3G6YA 5CP2A 1IXRA 3AO5A 4FLWA 4C8MA 3BQ2A 3FFIA 4FK4A 1T7PA 4JRPA 2YKNA 5HP4A 2D0CA 4N56A 3VQDA 4Y1DA 3RB6A 3VQBA 2F8SA 2R8KA 3HK2A 3QEAZ 4HTUA 1JLBA 4QOZB 4PUOA 4Z4IA 4ID5A 3MR6A 4DTRA 3BGRA 3P83D 1WAFA 4FJGA 2AGOA 4QZHA 2W9BA 4E1NA 4DLGA 1NK9A 4EBDA 3ZD8A 3OS2A 1ZQAA 4PHPA 3MXMA 3QINA 4ECYA 4B9NA 4TUPA 2C2DA 7ICTA 7ICVA 1D8LA 3AO1A 4FJXA 3AVJA 4Y1CA 4KN7A 5CJ7A 5KG4A 4NYFA 4QWCA 3NF9A 5DGBA 5HHIA 1Q9XA 2P6UA 1TV9A 8ICJA 4EZ6A 3H40A 4KLSA 3LZIA 4F91B 5KFYA 4JV1A 1U47A 3LP1A 3OHBA 2C28A 4MF2A 4RQ4A 7ICKA 4F93B 1NOMA 1BPDA 3RJKA 3AVAA 3RBEA 3UXOA 4K8ZA 1ZQJA 3KIOA 1JLEA 1HQEA 2WOMA 4F5NA 3ZD9A 4LVSA 3U6FA 4CIFA 3SV4A 5KFBA 1DTQA 4B9VA 4FVMA 4G3IA 4DL5A 2NRZA 4QZ8A 2PY5A 5E41A 3VQQA 3OYHA 2VANA 4OGEA 3NGZA 4YMNA 3KKSA 2I5JA 2O4IA 4IRCA 1Q8IA 3QNOA 1HUZA 2DFHA 3MDAA 4CESA 4FK0A 3L3UA 3TAPA 1NKBA 3NH1A 5DQGA 3RB4A 4RPZA 1EP4A 1WSHA 3QETA 7ICOA 1RT3A 3SPZA 3HW8A 1WSIA 2XGPA 2E6LA 4PQUA 4FO6A 3MGIA 3T5KA 4RNMA 4PPXA 3BQ0A 3AA3A 3V7JA 1ZQHA 3C6TA 1A5VA 1A77A 1NK0A 4NCAA 1NJXA 1S77D 3RR8A 4OVLA 4NLGA 3C2MA 4OLAA 3IAYA 4MFBA 3VQ9A 1IG9A 4IDKA 5KG5A 2HB5A 1S9EA 3PO4A 3RRGA 2RN2A 2FBYA 4FBUA 1SZPA 2A1SA 3H08A 3AVMA 4O3QA 4CEFA 1AROP 4DF4A 4CF1A 4N47A 2XGQA 4FS2A 3ZDDA 2ASLA 1TKTA 4RNOA 4QWEA 1RILA 1C0TA 5J0WA 4YR0A 3WNFA 5KFSA 5HROA 4DFJA 2AQ0A 4JLHA 4EP4A 4DO9A 3K5NA 4CK2A 3LP0A 1N48A 9ICTA 3VQ6A 3VA3A 4LZGA 1KDHA 3ASMA 4FW1A 4RT2A 3ALYA 3ZSXA 1L3VA 4XIUA 1TK0A 3RB3A 1UOCA 1WSFA 2IA6A 4B9SA 4KFBA 1X9MA 4CE9A 4JWNA 5C24A 3VN5A 4AHRA 3O3GA 4UBBA 3ZSWA 5JS2A 2R8HA 1H38A 3B6PA 3GIJA 3KK1A 1U9LA 3ZSYA 1L3TA 1NJZA 5L1KA 1JXEA 4TQRA 1CZ9A 1C7YA 3RH4A 1RT2A 9ICNA 2R7YA 2W8KA 4J9KA 3U3GA 1CZBA 4P4PA 3SUPA 1Y88A 3H8WA 5BOMA 1QS4A 1JXBA 3HX0A 1NJWA 1RZTA 3DI6A 2MUTA 2XRIA 5HNKA 2D5RA 3NCIA 3L3VA 1BVSA 1QSSA 4BACA 1KVCA 5KT6A 2PFPA 4KLLA 3C1ZA 3V6DA 4IRKA 4K4IA 3OYFA 1TAUA 5KFFA 3C5FA 4CHQA 4MFAA 1RTJA 9ICSA 1SKWA 2PXIA 1LV5A 3RJFA 4CJSA 5CYMA 1REVA 3TAGA 4EBCA 4M3UA 4CFBA 1BIUA 3L8BA 1LAVA 4QZGA 4ICLA 8ICNA 1NK8A 4J2AA 3IRXA 2PYLA 3KHGA 3JPSA 4KHYA 8ICTA 1ZJMA 3NGYA 4FJ8A 2ZTEA 4GC7A 5KGXA 4FJIA 4HHTA 3RJEA 3OSPA 4MEXA 1U4BA 2V9WA 5FROA 2M9NA 4PH5A 4BDZA 4CJPA 5J29A 3CFRA 2BCUA 3QERA 2W9AA 3LANA 3VA0A 4ED7A 5J0SA 1JL2A 3PR4A 4CHYA 1BCOA 4QZAA 1ZQOA 4E7IA 9ICAA 4CK3A 4DFMA 2BKEA 1WNSA 1CEZA 1EKEA 3I0RA 3WNGA 2RF2A 4KPYA 1EXQA 1ZBFA 4CJKA 3HO1A 3F9KA 4EYIB 2UVVA 4NLNA 9ICQA 4CGJA 1S1XA 4GVMA 4E1MA 4ECSA 4C8NA 4RUCA 4CJFA 1ZQRA 3OYEA 1I39A 4KLUA 2FLLA 1RT5A 3H8SA 4L8RB 2AGPA 4I2QA 4IKFA 3UQ2A 9ICCA 5KG7A 5KFKA 4NLZA 4CIGA 3KHLA 1RNHA 8ICAA 1FK9A 4KLDA 4KHSA 5J2QA 1NOZA 4FK2A 4DQRA 4GC6A 2IBKA 1IO2A 4QZ9A 3JYTA 3G0ZA 7ICPA 1RBVA 5TZVA 3NF7A 5EWEA 3AVLA 4IG3A 1ZQKA 1CXQA 3G6VA 5KGWA 2NRTA 2ZE2A 5J2EA 1C1CA 4I2FA 3QESA 4FJNA 2R8JA 3K5MA 4GW6A 3O3FA 2P5GA 4BDYA 4JS4A 4M3XA 3DLEA 1N5YA 4QWBA 3K58A 4CECA 4FJJA 8ICRA 1JLAA 5KFPA 2MAXA 1JLQA 4J9MA 5EWGA 4ELUA 1MU2A 3RJHA 2KTQA 2VG6A 4DTUA 5KT2A 2BR0A 5CYQA 4MFFA 1X9WA 5DG8A 2OZMA 4XRHA 1B9FA 1QQCA 2ASJA 2PFNA 2AJQA 1QTMA 4JUZA 3S3NA 2R8IA 2J6SA 5J2KA 5DDYA 1XS9D 2DFLA 1TKDA 3MFHA 3ZT4A 2XHBA 1ASUA 1DOQA 1J9AA 1F21A 5KG2A 4MQ3A 1RTDA 1ZQXA 4KKOA 2FMQA 3AO2A 1JLFA 3AVCA 2WONA 1VSDA 4RT3A 1NK7A 4IQTA 3C5GA 3M9OB 1DGSA 4O9MA 3V6HA 3ZT2A 2HNDA 4CJ4A 4DSIA 3I0SA 3SNNA 4KREA 4DTPA 1XHZA 3ISNC 4RQ3A 2YNIA 4F2RA 1XO1A 1VSLA 1ZETA 4KLIA 3SI6A 1C1BA 4RU9A 3UXNA 1U45A 4CEDA 3TANA 2DFEA 3WNHA 5J0YA 1FKPA 5KFLA 4CGDA 1Z00A 4ECTA 3V7KA 1XSNA 2IC3A 4QZFA 4BXOB 4JWMA 1S6PA 4ED8A 4LH5A 1U48A 1IKYA 4ECZA 3AVKA 2BQ3A 4GMJB 3EZ5A 1RXVA 1ZBHA 3CM5A 2NRVA 4RQ7A 1S5JA 2YNGA 3AVNA 8ICUA 4CGFA 1B92A 5FDLA 3FYHA 3TABA 2Y1JA 1RYSA 3PW0A 1BPBA 5DGAA 1Z26A 2HNZA 2ZQBA 1YVUA 3E2EA 4DL6A 2Y1IA 2ITGA 1C0MA 3S3OA 5JS1A 4QZDA 1A5XA 5D3GA 5KFTA 4QAGA 4FLVA 3ISDA 4Q44A 1BQNA 4IQVA 4TUSA 1VSIA 4AHSA 4M9LA 1KCFA 2ZTCA 2OA8A 4YN4A 4B8AB 5HP1A 4M9NA 3OHAA 5DK5A 1BPZA 2G8WA 3GIKA 3OYNA 2NRXA 4ZTJA 3TFSA 4ECWA 8ICFA 3LZJA 3NHGA 1WSJA 2HVHA 4RNNA 1QSLA 4DL3A 2W9CB 1T3NA 1KRPA 3DLBA 5HRRA 2ZTDA 7ICSA 1RPLA 4BWMA 1HYVA 5J2CA 4FJKA 4OKJA 1L5UA 3ISCA 3MAQA 4DFKA 3Q8RB 3MEEA 4RQ1A 2B6AA 3ETLA 4FLUA 4I2CA 2KFNA 4J2DA 1WSGA 9ICPA 2PZSA 5FRMA 3HWTA 1TVRA 3JPNA 1RTIA 3MEGA 1B43A 4FM0A 5J0QA 3PW7A 4FLXA 1BHLA 3T5HA 3HSTB 4W5OA 1TGOA 3HT3A 8ICYA 3PX6A 4Z6FA 4J2EA 4DSJA 4R8UB 3M9MB 3HPHA 4KLGA 1ZQNA 4CFDA 3NGIA 4LSLA 4OLBA 4FJMA 2VG7A 4YCXA 4P4MA 4Z4HA 1BPYA 1KFSA 5CA7A 5L1IA 4YD1A 5J2NA 3CFPA 3HYFA 2FPLA 4KB1A 4TSXA 3QZ8A 4O0IA 3VQAA 4J2BA 3NTUA 1HYZA 2XY8A 3AA2A 3SJJA 4HUGA 2JEFA 3ITHA 2O4GA 4RPXA 2HHVA 2BPGA 1S1UA 3ZSRA 1RDAA 4Z4CA 1IKVA 4M6WA 3QZ7A 4DF8A 9ICHA 5DMRA 2A1RA 3RMAA 4KLTA 1RBUA 4N41A 1U04A 3Q8KA 3PNCA 4CGHA 2P51A 3T5JA 4QZEA 4XQ8A 3RB0A 3V72A 4M41A 4UB2A 3QIOA 4DWIA 2JZBB 4OJRA 3Q8SB 3VQ5A 4CHZA 4Z4GA 1RT6A 8ICCA 1JKHA 2D0BA 2GUIA 5KFQA 4NM2A 3QO9A 3L2QA 3EPGA 3RH5A 4ZHRA 4EP5A 2AGQA 2QKBA 5HMLA 4YQWA 1ZQGA 2LYHA 2B4JA 3SV3A 1NKCA 3QIPA 4H4OA 2Z1IA 4G1QA 4M9GA 3AVHA 5J1EA 3OYDA 1S1TA 4QCLA 4YP3A 4KITB 2FBTA 3SUQA 1RBRA 2RKIA 1JLCA 1G15A 1S1VA 3MBYA 4BWJA 4PHEA 1VSKA 1RT7A 4CIEA 3PMNA 3D45A 4DS4A 3IG1A 5KFXA 4F2SA 3O3HA 1WN7A 4LSNA 3RAQA 4I9LA 2R8GA 5J2HA 2G8UA 3OY9A 4GLXA 2HNYA 3Q8PB 3ZCMA 5DBAA 9ICGA 4ED1A 4R66A 4OPJA 1UT5A 5HMMA 1MQ3A 3RBDA 8ICVA 5DBBA 2GBZA 4IFVA
chains in the Genus database with same CATH superfamily
9ICFA 3NDKA 4MFBB 3OYIA 3ZSOA 3VALA 2EG1A 4FZLA 1M1GA 4MLHA 3FZ2A 1A0OB 2KG5A 4UB6U 4CF9A 2H3GX 4I27A 2YWWA 3EL2A 1QQMA 4ZLJA 4H0XB 2GS8A 2HAIA 2HHWA 1F1BB 4FPAA 3ZYYX 1NPKA 2N82B 4AYBC 3HKZC 2NS1B 3AUOA 1OYEA 2QXFA 3SMVA 3UD4P 4TYBA 2YCHA 4OKKA 5IINA 3ENQA 4N8NA 3VEWA 2Q2RA 4CF0A 4KH0B 4USTA 2JH1A 2MKYA 2V68A 5CZ1A 3CJ1A 3O08A 1F5SA 3V9SA 4FNIA 2M8HA 1O5JA 3CE8A 2YN4A 3W2VA 1WHYA 3EW9A 2BDPA 2QMWA 4Q43A 2HBLA 2ZF5O 2PFOA 4O8UA 2HHQA 2ZKUA 4NV0A 3QEVA 1C4AA 4P52A 5A2QU 4O23A 3WK4A 2QWLA 2UUBF 3VEOA 2W4CA 1VJ5A 3OR1B 1N34J 1TKZA 4ISFA 4RZRA 3Q8QB 5GMKa 3PRBA 4B3OA 4XDCA 1JMSA 1Z1BA 2HOEA 2KMDA 4AILC 2MHNA 1WKJA 2Q36A 3GG4A 3GFZA 3K5OA 5D78A 3OLAA 3Q8LA 1KN6A 4ZPDA 1YTUA 3DOLA 1DTTA 4BHQA 5ETNA 1OQ6A 3N97B 4Q0BB 3EWGA 4M5MA 2QC3A 3GTYX 4GO7X 1RQLA 2DGSA 1XR6A 4H5TA 3J7YU 3OUYB 1FRHA 1S9GA 1JRPA 5DB6A 1GTEA 2BTFA 4Q45A 3UMCA 3WZ0A 3CCVS 1FXXA 1IKWA 3E66A 2CPFA 3L7UA 1NHVA 5DLGA 2LSNA 1DJ0A 1YJ9N 3M9NB 4QQBA 2J4RA 4FBTA 5BPCA 1PK3A 2LA6A 1GTHA 3BDEA 4DOAA 4O44A 2LYAA 1B4FA 1B7YB 2DY1A 1YSJA 3PUFA 1LW0B 1GMVA 4NA3A 1N5SA 2BKOA 3T3FA 2WSEC 5KFDA 2P9NB 1IKXA 3V9ZA 3MPDA 1B64A 4B1UB 3QJLA 5LT5A 1PJ5A 4LF5J 2VH7A 2JHEA 3M2UA 1WLJA 4DTNA 4R79A 1IR2A 4PPZA 1D8YA 3HDSA 4YHHK 3H6EA 1XK8A 3OL7A 1U1NA 2WB1C 1F9EB 5AZJB 1R0BG 4JKAA 5L1JA 2H48B 2Z58B 4CEBA 3UDVA 2HFOA 2QWQA 1MROB 2JRSA 4FL9A 3OVNA 1YGYA 2JGAA 1AT1B 3DEEA 2ZJQQ 1IH7A 3AT1B 4F71A 1ZM3A 3GYGA 1MA7A 1Q9YA 1CJTB 4GXKA 1FWKA 2B9WA 4E7HA 2ZDOA 2OFHX 3WXLA 3TEGA 5MAOA 2DBYA 4ZOSA 5LMUJ 4PG8A 4B1ZA 5H9EJ 1PC5A 2ZE2B 4H4MA 4ZN3A 1VIOA 4WE1A 3KXDA 2YHXA 4F4YA 5CR0A 1B22A 2H5XA 4FWQA 3B8AX 4B3MJ 3EMTA 4CGIA 2CRXA 1ED1A 2HQGA 1MW7A 7ICLA 3CNHA 3PRVA 3AV9A 1CXUA 2A1BA 1LOUA 4A62A 2ATCB 3CJTA 1DT9A 3CQYA 2VG6B 1VRTA 2FVRA 2O8DB 1WTBA 4Z7YA 3QT8A 2LQBA 1RG6A 3UWTA 1PCAA 3NVMA 3I8DA 2H1YA 1V4TA 3IMXA 4KAZA 1WTFA 3BZCA 5DG7A 2XC9A 5F8LA 3KLVA 4X4OA 4WP3A 3HHLB 4K41A 4OX9J 2RRBA 1IBKK 4MK8A 4RCHA 3M8QA 4OO1J 2QW9A 1NB7A 4XEIA 2GWJA 3PX0A 5KFUA 1M1KO 5C7PA 4DPWA 1QUVA 3TJ9A 3EEQA 4Z4FA 2KVSA 3BM7A 2W8LA 1FX4A 3C6AA 2V5HG 1RQNA 3FZMA 4U7BA 3C95A 3DGPB 2P5OA 2QL9B 3KDNA 1HWJA 3RMBA 3W63A 3K8WA 5HLFB 2ZIUB 2K8BB 4OJPA 1Q5YA 2FVPA 5DZ6A 2F4VF 4PCQA 3SQOP 2LDYA 4QYRA 3FKBA 7ICUA 1UHUA 2MKHA 4K5RA 4HT7A 1M5HA 3FSYA 4UAWA 3IR7B 3UKRA 1TR0A 4NCGA 2FBXA 2EX3A 3CMAS 5AK3A 2OIHA 3CC4N 3THWB 8ICMA 3I1YA 1SVDA 5DS7A 4ZH4A 1JCGA 3D66A 3H2VE 1U6ZA 1WOQA 2AP1A 4PGXA 3D28A 4M5IA 1BGXT 2RMLA 1ITGA 5E33A 4PWUA 1SXLA 1YI2S 3TYTA 1BQMA 4JI7K 8ICLA 2F7TA 4AQYF 1LWEA 2HHTA 2FHJD 3G25A 4C4SA 4WU2A 1LNQA 1OW5A 4ETZA 4KI4A 2E5IA 5IS2A 3FAHA 4F92B 2KG1A 4BXOA 3TVZA 3A4TA 4B08A 4FZXC 2BOPA 4ZPVR 9ICRA 1WC0A 3AY9A 2A2CA 1ITPA 2CPRA 4RW8A 5M1FA 1SH3A 1ZYQA 2P9UB 4DL2A 2BE2A 3QEBZ 3ZETB 1CC7A 7ICQA 3AB2B 4JV5F 3CM6A 4NX9A 4XK8C 4P0QA 2DR5A 3G8QA 3QT5A 4UOHA 4CERA 4J9LA 5ETLA 1FNXH 2WZ1A 1JI7A 1HNZK 1Z25A 1VSEA 2RP5A 2X1BA 5BREA 2F9TA 1LWCA 2CNNB 1VK3A 3OPKA 4OZ0A 2J7WA 4CFCA 3CNQP 4ILRA 3BGRB 3I56N 5AI8A 1KD1O 1SH0A 1R8AA 2VG7B 3H42A 4A8XA 3KMQA 2HBMA 2FLPA 4W90B 1S3XA 4LZDA 2Q66A 1SV0C 2FZKB 4ID8A 3F56A 2V34A 3WKEA 3VAJA 3G6EN 1HNVA 1ASWA 2Y0SC 4FLTA 3OV7A 1AUDA 4BUGA 3OJUA 3K2PA 3AO4A 1XSPA 3UE2A 2HBJA 2GJ2A 1NPPA 1M5VC 5HRNA 2HURA 3RAMA 1MWZA 5KG0A 3LDSA 3DRPA 3SAGA 1HUOA 1RAHB 3UR3C 2PA8D 1YJWN 2P35A 2BJ1A 3DLHA 4L74A 1Q86O 5CZ2A 3GFXA 2W7OA 2FVQA 2V9KA 1NK4A 3ZDAA 5KFMA 1TYQB 2XB2D 2RRDA 3MX5A 1NK6A 3MECA 5IILA 4K59A 5GAHI 4P0PA 2HPUA 5H1SV 3IWLA 2RQ4A 3G82A 3AMZA 2KO1A 4M63A 2ASDA 4X5VA 4FS1A 1EAYC 1JLEB 5F1XA 5D4LA 1M1KT 4ILGB 3VENA 1VQYA 1X4CA 3VQ8A 2FE9A 1RYRA 1DY3A 4PYDA 2XMKA 1CJVB 2FB0A 3BY5A 4BDPA 3WK9A 2L41A 4OJHA 1VDHA 1RGVA 2GGPB 2I5JB 1QQNA 4WP9A 9ICXA 2K60A 1F0MA 1RAJA 1ZQWA 5BXIA 1JJ4A 3O6WA 1D3WA 3QGGA 2GMHA 3SSRA 1BG3A 4GNIA 1EP4B 2M52A 3LAKA 2ZG6A 8ICKA 3GQCA 1RT3B 3OL9A 4DUZJ 4ZK7M 1PVQA 4WF9L 3CJ8A 2FQQB 5GTHU 2PSZA 3AAWB 3AM9A 4JI3K 1NU0A 2VBWA 4X4QA 4B1VA 8ICPA 2AP6A 2BGWA 2R2RA 1RUSA 4AFFA 3SMSA 3HI0A 2JH3A 1C6VA 3TARA 1ZXOA 3TAQA 2LQ5A 3MN7A 2OWOA 1HFEL 1ZPWX 2JFKA 1CI4A 1MSWD 2GWSA 4PL7A 1EKSA 2GMLA 2W04A 5JXSA 4DR5F 2V4JB 4NLKA 5E2QA 3Q86A 4RG8A 4M9JA 4OYWA 3K1RB 1QJHA 4Y2XA 1JNRB 4RBUA 3IP4B 4C11B 1YJUA 2EANA 2IDLA 4J7CA 2AYMA 4PZNA 4C8KA 2V2QA 1NGEA 1G4CA 2PFQA 1F44A 2VJVA 4QS7A 4C3KA 4CHOA 1ZQLA 1X0PA 3DXSX 3THYB 2CN1A 3MOZA 1KL9A 3OL6A 3KHRA 4O0NA 5J8YA 3OFGA 4F0HA 2C2EA 2JSXA 3EE3A 4X4TA 2J6TA 2EK6A 1FE0A 3D5MA 3OXLA 2CPDA 4M5HA 2MSNA 4FYXB 4DQ8A 1SC3B 3PIPQ 4IRDA 3CERA 1S0NA 1BUPA 2W1BA 4CNYA 1SJQA 3UNGC 4R0EA 4FJ7A 1HL6A 1Y5NB 2KRRA 4FF1A 1GLBG 3Q7CA 4NXMJ 2HVEA 2P1JA 1N36J 4DN9A 4RJVA 2FSKA 2CNLB 3N5BA 2XO6A 3HBTA 2BQRA 1XC9A 3PY8A 1KD1T 3ALRA 5AM3A 1U2FA 2HQFA 4ZCKA 3NS6A 4DV7F 1GLDG 2XIDA 2H65B 2G1HA 1DRZA 2BHNA 2AJ4A 2HWIA 1VRUA 1BL3A 2MUTB 1FFWB 1I1GA 4B6JA 3LQVA 4YB7A 4HAIA 4B9LA 2HIQA 4ED0A 4FJ9A 1WEYA 1XR5A 4NZ0A 2DRAA 1HD1A 3TAMB 2O8CB 4DTXA 3TU5A 4CQ1A 2VOOA 1ACMB 3NCQA 3I82A 4YDUC 4DR2K 2W40A 4IEEA 1T11A 5DBCA 2IM3A 4KO0B 1HLUA 5GMEA 1XERA 2CGJA 2XY6A 3ZX2A 2B3TB 2YHAA 4Z4EA 4Q5VA 5DJBA 4DR3K 4MH8A 5A6WA 4CH1A 1Q86T 3NGKA 4BCAA 3OR1A 2DQNB 2GW8A 5ALYA 3VGVA 4B3RK 3O1LA 5BYSA 4DV6F 4H0PA 3G8SA 2MZSA 3TFRA 4E7JA 2AYEA 2JLGA 1FJGF 3CD6S 4O55A 2CDQA 2BGGA 3M8ZA 4Q0BA 5CHGA 4CGZA 1B99A 2XI2A 4KGMA 1U1OA 2YY6A 1GQEA 8ICEA 3I0RB 2X7IA 1QQ6A 5DRKA 3GE1A 1HW8A 5HR7A 3AQFA 4MFCA 1OMSA 3PSTA 4Z37A 1HX1A 4QPXA 1IJJA 4P2HA 1SH2A 1W2IA 1KVKA 2KL8A 4U8YA 3UR0A 2VQEK 4I2QB 3D6MB 3VQ4A 3QYPA 3BJYA 1N33J 1ZQVA 3OYKA 1F9HA 2L9DA 1WBBA 1GMWA 1LW0A 2J9DE 3OQ2A 9ICLA 5HOOA 5KG6A 3L7OA 1FK9B 2FLOA 2G0JA 4Q7AA 4A8EA 2QRRA 4QIGA 2Z57B 1NWKA 5J2QB 4LRAA 2HF3A 2D3DA 2PMZF 5C2GA 4AM6A 1CUKA 3B0XA 3L09A 5IOLA 2W2MP 5AZJA 5C25A 2VD3A 2RAQA 4BR5A 1ZQEA 2HWTA 5HVHA 3M2VA 1MROA 2VZ9A 2ESEA 2J9EA 2MQPA 2I9GA 4FKYA 4DTSA 1WWVA 4J03A 2YKMB 4CLYA 2KKHA 4MAKA 4NZ6A 3T1YJ 1K0VA 1S76D 1JLAB 5M2UA 3LVWA 1CJTA 4AT1B 1UAWA 4JHDB 4AH9A 2EK1A 3ULDA 2CVEA 1S10A 2MGZB 2NPIA 3ZZTA 1HKAA 1H6KX 3FSIA 3GB0A 2UXDF 9ICVA 1D9DA 4LH4A 4FZZA 2NYIA 4XDDA 2W9MA 4PA1A 1IBCB 2IM2A 2D41A 2OAUA 3AFGA 4X64J 2X1FA 1PYSB 2F1HA 2E4LA 3I31A 3EWAA 1XBWA 3CDUA 4B1YB 4UAYA 4EBEA 3IAS9 4BRGA 1RWWB 2RRNA 3TRGA 1OPZA 4P6QA 3OTOF 4WYLA 1Z4OA 2RPIA 5J2AA 2O8DA 3M1FA 3ET6A 5J2IA 4PKHA 2RD5C 2VA2A 3NKYA 4F4ZA 5CRXA 2VJUA 2PFUA 1HUXA 2FMPA 2HVIA 4C23A 3RMDA 1XJWB 2GIRA 3CCLN 1DFDA 3I0SB 4PG6A 2OELA 4H8KA 5AI4A 1GK8A 2W4DA 2HQCA 1PJ6A 3FEXB 4CJVA 3ZDBA 1AYEA 1C1BB 4YOXA 2MQMA 5JVGQ 3HL8A 3GR0A 4PY5A 4K4ZA 2LDIA 1S6OA 1SWWA 5A6PA 3PEJA 3OL8A 1UJ6A 4UOCA 3MN6A 3D54A 3MGHA 4NXZA 2E9RX 4X4RA 2F7VA 3A3PB 3DGPA 3JPPA 5K8NA 4UASA 1Q0NA 1K1QA 3W9IA 3Q8YA 4F02A 2FJAB 5HLFA 2ZIUA 2IS3A 3M6WA 2CPEA 2A2DA 4Q8EA 3M8SA 1N2XA 2MPUA 4E19A 1JNZB 3E9PA 3KD3A 2ZC4A 1J54A 2P8IA 1CPZA 4IJAA 3QU5A 3V9UA 1A76A 3KOOA 3N9UC 1BQNB 4NOHA 1A5WA 3V9WA 4JV2A 3JPRA 2OH2A 3THWA 4F3QA 3HFVA 2EBEA 1RHRB 5AZIB 3P5JA 3HZEA 3W1YC 5FPNA 5FIIA 3OTQA 1CQMA 3MR2A 2CAJA 5JRTA 4DI6A 3DLJA 1SL0A 2KSOB 3K4GA 3MEEB 2DKXA 4DOZA 4HCBA 4DR4K 5IFMA 3QEXA 2DGQA 3VGMA 4HH1A 5SWMA 5GAHU 2NYHA 2PE8A 1RTIB 2ZOFA 9ICOA 2QL5B 2I1QA 3TUPA 3PMLA 1ZD3A 1NBEB 4MDAA 2VKZG 4PGYA 1ZQFA 2HI0A 1F3VA 2YBVA 2UUCF 3SCLE 3IP0A 4JI2K 2WBNA 3CFOA 1RFQA 1IBMK 1V97A 3SZ2A 2LLZA 2P9UA 3ZETA 3UPFA 4QZCA 4W98A 3J81O 4N76A 1Z3EB 2KG0A 4K2JA 1X66A 1SUQB 1YJTA 1QQ5A 1VQ9N 3HF5A 2V67A 2RH3A 4FK4A 4NZ7A 5JVHL 1T7PA 1HWLA 1T9VA 3RB6A 3VQBA 2R8KA 3HK2A 4HTUA 4L3NA 5H1SQ 3ITHB 2NXEA 4QOZB 3QFWA 3LH2S 3NWGA 5BN9A 3FNNA 3BGRA 1OSDA 1DQ9A 2YMPA 3J81U 5IWAF 4IH6A 1RKIA 1CBKA 4JP8A 5TISU 2W3RA 1ZQAA 2UXBK 3QINA 2YWKA 4BRKA 2HBZB 2AJ0A 3PFOA 4P2MA 2FHMA 4Y0FA 2Z4PA 1HBOB 5AQWA 3PYDA 3G8TA 1CZAN 1Z1VA 1KS2A 1NDPA 4DV5J 5B5EU 4ZHRB 4NYFA 1XMQK 4QWCA 4FWSA 1Q9XA 1VQ4S 4EZ6A 3H40A 4KLSA 5DDQC 3RZAA 1M6YA 4WYBA 2KJVA 3O5BA 3LP1A 1WUDA 5ITHA 4RQ4A 2YJEA 1TYQA 5DDPC 5BR8F 3K89A 3AVAA 4NI2B 3UXOA 4LFAK 1ZQJA 1RT7B 3SAHA 1JLEA 4LBIA 5LJ5Y 2UYTA 4V19S 3SV4A 3EGWB 1UEKA 3Q7BA 4C0OC 3F41A 2V6AA 5D6GA 1CJVA 4JI4K 4F9OA 2GGPA 3KKSA 2I5JA 2O4IA 4PXEA 2HOQA 1URNA 4IRCA 1HUZA 1VFJA 4P73A 1I51B 4A8WA 2ERRA 3MDAA 3G9CA 4CESA 3WK5A 3I6PA 3L3UA 4U7CA 3TAPA 1NKBA 2V51B 2OKQA 5LXRA 1EP4A 1WSHA 1P90A 1FO4A 2YKOA 2DISA 7ICOA 1RT3A 2G13A 3CCMS 3HW8A 1UW4A 3HSJA 3WC2A 2EZXA 4U6PA 2ADBA 1KBRA 4RNMA 4PPXA 1MN9A 2IM0A 3AA3A 4K0KJ 1ZQHA 3IWXA 4QYZJ 4CLKA 1NJXA 2CPHA 4DR1F 2A18A 4USAA 1U1RA 4DV1F 3HJVA 4PWWA 4ZIVA 1UJ5A 4NLDA 1RABB 5KG5A 4CLUA 3MAAB 2V4JA 1X42A 2QGFB 3P8BB 4DU7A 1P6TA 2RN2A 1NGBA 1SZPA 2PT0A 3FBEA 2I2YA 3AVMA 3I55N 2V2VA 3IMQJ 1AROP 3LYSA 4C11A 2RS8A 2AYGA 2E2QA 4LF6F 3A0IX 4CF1A 4Y2MA 4F0KA 2WF8A 4QWEA 2O8EB 1R8CA 3WNFA 1FVQA 2MZJA 3IGNA 4C4WA 4C0BA 3THYA 2AQ0A 5KL1B 5GADI 4EP4A 2A0FB 4KT0C 4DO9A 3K5NA 3TX8A 3FMWA 1N48A 3VQ6A 2VQEF 4LZGA 1B70B 5EVZA 3BQ7A 1YX2A 1VHFA 2RQMA 1RA7A 3UVJB 2HBQB 2KB2A 2XG8A 3HHKA 3VF0B 2G09A 5IC6B 4B9SA 3HT0A 4P71A 3A1YG 4BC2A 7FDRA 4JWNA 1KEKA 4X4VA 2DUYA 4PJ0U 4UBBA 4BLGA 1L8OA 1T6DA 4A8OA 2Z56B 2KLAA 1OXJA 4LFCF 3HTVA 1C7YA 3EVMA 4RPFA 3RH4A 1RT2A 3V81B 3U1NA 4J9KA 4I6AA 1D9AA 1VQOS 3W9JA 1QS4A 6FD1A 1JXBA 1NJWA 1RZTA 2MUTA 3WKAA 9RUBA 3CCTA 1X5TA 4DZ6A 3S8SA 2X1AA 2O8CA 1UP1A 4PR6A 1TAUA 1NLVA 3GBTA 4B3SK 5M2PA 4MFAA 5J2PB 3WBZA 4BC5A 3H59A 1IV0A 3BGLA 4USJC 2E2OA 5M1OA 1SIJA 2OO4A 1NK8A 4ETXA 3M6VA 1X9JA 4NLXA 3CCJN 3KHGA 3JPSA 1QQOA 4KHYA 1ZJMA 5AI6A 4OMFG 3ZEUA 3GDQA 1NU4A 4FJIA 5AKZA 1Q81O 1RT4B 4MKAA 3SCKE 2M9NA 3CO9A 4CJPA 1R43A 2W9AA 1ZBTA 4CHYA 4QZAA 1ZQOA 2Y9HA 2XQCA 3IM9A 3VQSA 3I0RA 4KPYA 1ZBFA 2W6KA 4N7TA 3F9KA 2VQFK 1R0CB 1TMMA 2WSCC 3JXOA 4RUCA 3SAFA 1X4HA 2E9ZA 2K2PA 3PACA 5CHIA 4HH0A 1I39A 4XH1A 4I2QA 4IKFA 2OMOA 1RHUB 4NLZA 1TL1B 3KHLA 1N0UA 1FK9A 1UFWA 1U2VB 1IWGA 5JLHA 3DRRB 4KHSA 2XNQA 2LEPA 3ZTRA 5J2QA 4OLOA 1NHUA 4K43A 1IO2A 4QZ9A 2QIFA 2OEJA 3JYTA 7ICPA 5EWEA 3AVLA 1WEZA 3G6VA 2H5IB 5T7LB 2FDRA 4EMDA 3P96A 4LF1A 4I2FA 4FJNA 2VIXA 1KQFB 5J1PA 2E8NA 2ZHOA 4BDYA 2GUPA 2ZBPA 4CECA 3C3LA 1NAQA 1YVNA 1JLAA 1XTZA 3LM9A 2LMIA 1ZM2A 3A8YA 1YXQA 3DV9A 4JHDA 2NQPA 2G07A 1TTHB 2UU9F 5B0FA 4DTUA 2MGZA 2BR0A 1A6LA 1IG8A 3VZIA 1X9WA 4M5JA 3D4JA 2OPRB 2V69A 4YHHJ 3BYPA 1K8AT 1MMDA 3BPSP 2PFNA 1JUDA 3E8OA 2KXNB 4JUZA 1RI7A 2DFLA 3HMJG 1RTHB 3N4PA 3N5FA 1UVJA 5F3XB 4C3MA 2XHBA 1RWKB 2CPJA 1Z6RA 4FWRA 4WK3A 1F21A 4LRFA 3W64A 1HWKA 3AVCA 2VIHA 4DG1B 1VSDA 3S6EA 4Y65A 4H5NA 3M9OB 1DGSA 1G7CB 2QA4N 3S1TA 4EK2A 1H73A 5HJXA 1U0HB 1K9MO 4ZVQB 3I0SA 4IFYB 4X4PA 3DNCA 4KREA 3GONA 4LMZA 1KQSR 1OH8A 1VC0A 5AK5A 1RHMB 3IXQA 3KLGB 3C65A 1C1BA 4CEDA 2QMXA 4OI0A 4CT8A 5J0YA 5KFLA 3OFEA 3J7AN 1PIEA 2LXFA 2ZBIA 4DV3F 4JWMA 3TNVA 3DDNA 2K7KA 3QSIA 2GMJA 1ZBHA 4CZHA 3AVNA 5L1MA 2WK4A 1NZAA 1D4XA 2E20A 4K4TA 2MQOA 5GAGI 2B6GA 1IBKJ 2PMZD 3PW0A 1HQUB 2LVWA 3L4QA 1JCFA 3LW5C 2BJEA 2DGZA 2RB7A 3MTJA 1V4SA 1Q81T 3S3OA 4RW4B 1BQNA 4IQVA 1VSIA 1FRKA 4M9LA 2IYIA 1KCFA 3CI5A 1KONA 1KQSM 4B8AB 1KQKA 1S12A 3OHAA 1G2EA 4OV1A 4WTYA 2IVOA 2G8WA 3GIKA 3OYNA 3NXZA 8ICFA 3LZJA 4USVA 2HVHA 1QSLA 5AZIA 4CH7A 2W9CB 4IFEA 5HRRA 4YY3F 4ED5A 3KG1A 4QIVA 4JI8K 2GVDA 3KZBA 1L5UA 2XI3A 2KSOA 3MEEA 3Q8RB 1XN9A 1FJCA 3ETLA 1BA1A 4J2DA 1WSGA 1Z2ZA 1ZOTA 9ICPA 3PKMA 1ZOLA 2PZSA 5FRMA 3WK6A 1HIYA 3U27A 1RTIA 3D6TB 1FTRA 1B43A 4WFXA 3LDLA 3AOCA 3PW7A 3T7ZA 4DR7K 4CJ7A 4UW2A 4M5DB 3T5HA 4ZITA 1TGOA 1W7AA 3I33A 2Y8WA 4C4RA 4Z6FA 4J2EA 4DSJA 1VQNN 4CF4A 1WG5A 4JI7J 4K42A 3HPHA 1L7NA 3VVUA 4KLGA 1ZQNA 4ENOA 4CFDA 1OH7A 4FJMA 4YCXA 4K2XA 3BR8A 2DRBA 2H3VA 1BPYA 3PG9A 3H8YA 2ROEA 4CYUB 2ZXIA 3H1VX 1F3FA 3PJXA 3PIOL 5AR0A 2HFNA 2W3SA 3NLCA 4LIRA 3ITHA 4RPXA 3A5MC 1F9FA 3HD1A 2E1PA 2HHHK 3DYAB 4Z94A 3L4IA 3O9QA 2EC2A 4CNZA 1U04A 1ZD4A 2IOFK 4DPTA 2W03A 4H5WA 4BR2A 1VQ8N 1QZ6A 2UZAA 4FZVA 3F53A 1RJJA 1HNZJ 3C0BA 1ZS6A 1BQXA 1AFJA 3H7HB 2JZBB 2QWRA 1HBOA 3PZPA 2FGOA 4ZIWA 3VQ5A 1QTNB 1HNXF 1JKHA 2D0BA 2GUIA 5KFQA 1V3ZA 3WIVA 4ZHRA 4EP5A 1DXSA 3WKDA 1G6BA 3FFKB 3CDWA 2OD4A 3O1WA 3SV3A 1NKCA 2IVYA 4M9GA 1K9MT 4QCLA 4YP3A 2FBTA 3SUQA 2CQDA 3MBYA 4NI2A 4BWJA 2J7KA 1EB0A 3U4LA 4U95A 5GIPA 1RT7A 2OD6A 1J2MA 5DO2A 4CIEA 2U2FA 2ZVIA 1RT1B 3CCQS 3GYNA 2E44A 2ZH5A 3NNHA 4JD2A 3O3HA 3TTCA 2BA9A 2PO4A 4GLXA 2ZNYA 4X65K 2HNYA 3Q8PB 4B1WB 4ACOA 2ADCA 3TTFA 4NPOA 3B9JA 1ROFA 3UN5A 3CJ7A 4TNOA 1Y64A 2MU2A 4UQTA 2CH6A 4F0MA 2C2OB 1MQ3A 3I9V9 2F2AB 4M95A 3TR8A 3H8JA 1SV5B 1S0VA 2GQ2A 3FZHA 2R7RA 5CA5A 4FF4A 1NM2A 5AQUA 3MZIA 2DD8S 5DZ7A 1N8RT 2J8SA 3VV2B 3R5DA 3TX0A 2BW2A 3MN5A 3PXGa 2XCPA 1TKTB 3PSIA 4ZVPB 4DJBA 3AA5X 1QD1A 1TU0B 2WHEA 3NBPB 2RJZA 1LB2B 3JPOA 1WKLA 2GJFA 3DRXA 5CWRA 2KHDA 4CZGA 5AIBA 1N60A 4WQ5C 3DLKB 4R5PB 1WWUA 2D9PA 2UUTA 3GJRB 3MDQA 1O6XA 3FBBA 3H4DA 4DUYK 2AV5A 1E6VB 4IQWA 4DHVA 2F8TA 1EX8A 3MAAA 4MK7A 2XMMA 4V19X 5IQ6A 5IIMA 3SUNA 5KFIA 5BJRA 1SIWB 2WB4A 2I1RA 2YB4A 4NLUA 4GXIA 2YNHB 4JI3J 5KFRA 4M3WA 3MUVP 4K4YA 2ABYA 1OKJA 1RDFA 3EE8A 4NLWA 3PKYA 2DPNA 3I5CA 2OFGX 4HTJA 4WU3A 2IVPA 3UIQA 2FZCB 3PRDA 2Q0UA 3DU5A 5AQJA 1O51A 3PJ9A 2OP5A 2VFTA 2ZM6K 3CDAA 3M6UA 4NLCA 4I2HA 2HW3A 3K5PA 3CF5L 4L3QA 2R7XA 2KZ3A 2AH5A 3EGZA 1MWKA 3ZT3A 3GPAA 2XVTA 1B0PA 1NGGA 4KN4A 4CI0B 3M8RA 4F5QA 4P75A 3UVJA 3HLUA 1QHTA 1H7WA 5C12A 2ZNZA 2RS2A 4I2JA 3A5NC 4I2GA 3RGIA 1DBDA 3R6LB 1DHMA 4FLZA 1KKHA 1J53A 2YMQA 4M3ZA 3A5LC 2J5AA 4UQGA 2F9DA 2V63A 4EO8A 3C23A 2ZIXB 4OX8A 5ALTA 4IOBA 5KQ8A 4HL9A 4A46A 4AM7A 3U3YA 2ZJ5A 5AFUH 1Q3UA 3HHNB 4CJTA 4OJOA 3V81A 1WDDA 1TFRA 5E3AA 4Y2TA 2FY8A 2M3DA 1ZBLA 1FCAA 1SL2A 6AT1B 4BY9C 3RBZA 2CJBA 4JBCA 5HO4A 4HVZA 1GLAG 3OYLA 1SQEA 4USKA 5J2MB 2FTRA 2IIHA 1AB8A 5IM0B 4QZIA 5HSPA 4LRDA 2RF2B 2B9EA 5J2PA 2Y9TA 2B5JB 3WUHA 3TJAA 1B4SA 5CY4A 5JUMA 4IC9A 2PC6A 4H03B 1UEVA 2H5EA 2DL0A 1Y5IB 4WYWA 4FM1A 1HYSB 1FDBA 4ITSA 3BSCA 4WBFA 2KV2A 2ZZMA 5KQDA 3KLHB 4DR2J 1RT4A 5KAKA 3AODA 3C1YA 3L2RA 1ZRNA 2PI5A 1ZQIA 5EUHA 3GV7B 1PJ7A 2HSZA 2X74A 4DR3J 2E5LJ 1SB3C 5ALVA 1P27B 2CXEA 4KV8B 5CHCB 3FK4A 1DAXA 3FZBA 2M0NA 2E5HA 3MD3A 3AA9A 1ZJNA 4B3RJ 1YAGA 3D6HB 4ZTFA 2H3QA 3KUHA 4PL8A 2KHOA 1OH5A 4C8LA 2OCEA 3JAMY 2XCAA 3DLGA 2AA4A 1BOTO 1N56A 1VQSA 4DKWA 5KFEA 2JEGA 1S59A 1S5LU 4F36A 1RZMA 3ONNA 1VJWA 1TL1A 2UUAF 3NL0A 5CYQB 1U2VA 2RU9A 1FJEB 2C2MB 3V4IA 4KX5A 1NUEA 2GLEA 2NXJA 3J80O 2DNKA 1KXPA 4X62K 3KOAA 1KTQA 3M8WA 1GAOA 1U1KA 2RHQB 1GLFO 5T7LA 5LM7E 4B02A 3BO2A 2VQEJ 1HKGA 2DNGA 3ILIA 2JGUA 2FHOB 2BEFA 1FI4A 1RHKB 2B8PA 2YQEA 1WB9A 4Q2LA 4C8OA 5ALIA 4KE5A 3CCUS 4RUAA 3MM6B 2GV9A 2X51A 1IJFB 4BQLA 3CSKA 1RDRA 3L2UA 1J5EF 4BQZA 1NH8A 2ILYA 4ZCMA 4JI1F 3ZZUA 1YIJN 1V9PA 2OPRA 1SL1A 4CJ3A 3D2EB 4F4WA 2W2PP 3QEWA 1TKXB 2I6WA 3BB5A 3SXLA 4JB3A 3O3LA 1UVIA 4JI6F 3QSYB 3FCVA 4USMA 4QU7A 3H0LB 1NRKA 2BPCA 5B08A 5KT3A 1BPXA 1XNQK 1WSEA 5AQYA 8ICOA 4DG1A 4ER8A 2L9NA 1T03B 3G10A 4JKGB 4CHPA 1XU4A 1XNRF 3AXKA 1UMJA 2B4OA 4OZ3A 5AKKA 2R4FA 3LF0A 2XS2A 3KWGA 2WTUA 3JPQA 4CEAA 1BA0A 1U0HA 2GQCA 3TEHB 2EAMA 2YB1A 4IFYA 4FWKA 3HP9A 5AQRA 5L1LA 2HFZA 3KLGA 3TPQA 2Q6BA 1Z2LA 3QWUA 4DFPA 4DV0F 2FY1A 2MLYA 1S6QB 5GADP 5C0YA 2Q6CA 5CCLA 3T5LA 2QI2A 1RBSA 4XO0A 3QUQA 2G2ZA 3KJVA 3ZC4A 3R5GA 3UQSA 3O4WA 1BPEA 4FWOA 1TELA 3EY1A 3C28A 2KJ9A 4FP9A 1KHVA 4I7FB 3B82A 3LWLA 3IA0A 1WC5A 4A57A 4UT4A 2LFVA 1RDUA 1GT8A 1R7IA 2DNLA 1HQUA 4CH0S 2CJQA 4IZ9A 2EH9A 5AQXA 1SCJB 1VSMA 3EUNA 4F04B 4DX6A 1AQ6A 5AKEA 3C19A 3CCWA 4LVNP 4NYNA 3CJ9A 1XNSA 1MC8A 5AIAA 4KLQA 4A8KA 1QSYA 3G2XA 1Z4NA 4RW4A 3GG1A 2P66A 3PEHA 7ICFA 1YBAA 3FSXA 5DKWA 2H3EB 3OLBA 2CPYA 4PUOB 2KJWA 2A1AA 2YX1A 3G87A 1LEOA 2XHCA 1RADB 3KKRA 1GOBA 3CJCA 2DFFA 3H7IA 2IHNA 2W9CA 1IM4A 2G8HA 4M3YA 3ENHA 4WWSA 4HUFA 4M2YA 5DB7A 3CJ3A 1X1PA 1RKJA 3VGKA 5EWFA 3AVGA 1PC4A 2ZFHA 2YHYA 5HL7L 4IOCL 3WC0A 4CZKA 4NXNK 2FVCA 1VBYA 4DL4A 3D9BA 4LF8K 4RWTA 2EPIA 3M1VB 2KEYA 4M6WB 1C0GA 3TZXA 4DU4A 4O3PA 3GLJA 3AHPA 4CFAA 4MF8A 3EYZA 2V8HA 4M5DA 4ZPAA 1C20A 3MUTP 1N34F 1X5PA 3LWMA 3A3NB 3WNEA 1ZQCA 2MMYA 1YHQS 3PSPA 4DTOA 1MWYA 3KJQB 5AK4A 4IUFA 2C2KB 3Q2SC 3CJRA 2LPEA 4DR4J 5AQMA 2K8AA 1K1SA 1LFWA 1QE1A 2DKZA 4CYUA 3QO9B 1RK8A 2L48A 2QM1A 2RSQA 3NH0A 4C80A 3CJ2A 1QAIA 4ZVSB 3TZYA 2E5GA 3G71S 4JI2J 3V9XA 2NUBA 3ZZYA 2FMSA 2VV5A 3GZ7A 2RQ5A 1IBMJ 2ZKTA 3UI3A 4OJ5A 1DARA 3DYAA 2B56A 4BE0A 3T1HK 5EX0A 2J0XA 5KFOA 1D1UA 4DU1A 3CJ5A 4RWWA 2EFVA 5HMXA 1TL7B 4DEZA 3R97A 4FNHA 4WFAL 3LO3A 2BH1A 2P9PB 1FWLA 2GC8A 2JVRA 4ECVA 1U1MA 4OZ2A 4DPOA 3QT6A 3CC7S 4Q8FA 4IR1A 4M45A 2JZBA 4PQUB 2FPHX 3PSFA 3WDOA 1RACB 2QWMA 1KOHA 4ECXA 1I3AA 4UOGA 1YITN 1VQ7N 5J2FA 2HVZA 1ZBIA 1U25A 3C6TB 4M9HA 1MDUB 4LF5F 1NBWA 1FFUA 3FGVA 1DEJA 1VSJA 2NNWA 4E89A 2LQ8A 2V4RA 3KKAC 4IS7A 2DK2A 4JK1A 5D46A 3KBBA 2VBZA 1LKYB 2RILA 4G1IA 2MLXA 3HKWA 5EE1A 2UXBJ 4A2AA 5KAFU 2YI1A 1LKZA 4NLRA 1M90O 3PNIA 4HVJA 3BS5B 3KHHA 1S97A 4FF2A 3I5BA 2QSWA 3TA2A 1D09B 4I2IA 1Q1KA 8RUCA 4F26A 3VAGA 4P2FA 4R65A 1RT1A 1VQPN 3NFAA 2YJFA 1UVKA 3W61A 1XMQJ 4TY9A 3MURP 3K57A 2DXFA 2F76X 1XQSC 4M94A 2WRMA 3IR6B 3VHQA 2K4EA 3BGUA 5E0OA 3FDSA 3BSNA 1APSA 1WD6A 5LMUF 4A5BA 1RDCA 9ICEA 5IV4A 2RHFA 5J0PA 5ALRA 4B3MF 4LF4K 1SV5A 4LFAJ 1FTCA 2HQIA 2OEMA 4A47A 1ZQBA 3CCSS 3NOGA 4ZP6A 2Z2ZA 4QPTA 1YT3A 1LWXA 3CMEN 3WU2U 1YRTA 1SXEA 3F2KA 3TAEA 3ETOA 4LF2A 2AX0A 4ERDA 2JZ5A 2XYHB 3B0YA 4F4AA 2G0CA 4JI4J 4PHDA 4D3HA 4OYPA 4O4RA 2KW4A 4KMUA 5KT4A 3NBPA 3KK1B 2CQ0A 4B3OB 2VA8A 3I5AA 1L3SA 4ZP9A 1FRLA 2DGTA 3DLKA 4R5PA 4ZCLA 2PI4A 3QRRA 2LM1A 4OX9F 1SKSA 3DOMA 1E6VA 1VQ6S 3PO5A 3DC2A 5M2RA 4H4KC 1VQ5S 1GLLO 3DOLB 3Q0AA 4ANEA 3QBCA 1Q16B 3IUCA 1RBLA 5GAGP 4YVZA 1U2CA 2YNHA 5TKWA 2H3IA 1S9GB 4CW7B 4D3GA 4J9NA 2DY9A 1RISA 1FVSA 4JK7A 5EHHA 2HHUA 1JIHA 4JI5K 2DR6A 2CJAA 2YX8A 1YBUA 4ICLB 4MT1A 3KHYA 2HS3A 3WHIA 3R5AA 4O44B 2FJBB 3ICXA 3RF9A 3AVBA 3VAIA 1VSFA 4MYTA 4DQPA 1JLGA 1B0VA 4QZBA 1Q79A 3W5XA 1C4CA 3A8KA 5H9FK 4DU8A 1N32K 5GAEU 1WF2A 4AL5A 5K4LA 1HBUB 3K9JA 5D49A 3IR5B 1AXQA 3VQCA 2FJXA 3GIMA 3GIRA 4OZ5A 4DCOB 2PFFB 2ODGA 4MEYA 3C2LA 4QW9A 4LF9K 4WZQA 2ZIXA 2D1CA 2IFXA 2YKAA 2E29A 1S1XB 3NGUA 2KYXA 4QIFA 2EKNA 2LKYA 2IBOA 1X2IA 5L9NA 4JKFA 5K8PA 3H20A 4FXDA 1RDDA 4P7TA 2BXJA 3DGVA 4FJ5A 2FC9A 2B7BB 1IWAA 8ICIA 3HZGA 5J2MA 4FYVB 2HWHA 3V1OA 2D7SA 5IM0A 2LU1A 2Z1HA 1VGYA 1JL1A 2VHGA 4UB8U 4K25A 4FZNA 4DDFA 2B5JA 4TVAB 2D6FC 3CCEN 4J9OA 3CTRA 5KG3A 9ICWA 3UFCX 3POTA 4XH4A 3MN9A 2DVIA 5FLXO 4RQ2A 2VF3A 3F9MA 4IOAL 3HRGA 4JYAK 1FF2A 1M90T 2ZJRL 3AH6A 1HYSA 2N3OA 4USHA 3SQGB 3MABA 2HHPA 5AI5A 1MMLA 5HI7A 3J7YI 4FM2A 3BQ1A 3LPTA 3KLHA 1RBTA 3K5LA 1WOOA 4B3SJ 4CHNA 4KSEB 1MU2B 3MI7X 5HRSA 3M1YA 4C98A 2R7WA 2QSFA 3FJ2A 5IIOA 2E6MA 3D0IE 4IBNA 1RA6A 4KV8A 1WNEA 2DNZA 4F25A 4M42A 4O5KA 1GLCG 4RNHA 4CGGA 4I2BA 1M5PC 4J5OA 1ZQZA 5BPLA 5IT4A 4AF1A 1T8EA 2WW4A 3OW2R 4IO8A 3C2KA 3CJ0A 1QHAA 1MQ2A 2CIMA 1NMDA 3FCHA 4XPCA 2ZH8A 2E1EA 3IG8A 3ETRA 4WIQA 4KKOB 4V19J 1D0EA 2ROPA 3PM9A 3MMJA 1WCNA 2B0CA 5KFVA 2WONB 1P9QC 4QS9A 3AVFA 3WXIA 1DK2A 2OYYA 2VQFJ 4Z6CA 3BDPA 1W9HA 3GV5B 2P6RA 3SMPA 2UVRA 3FZFA 1GXLA 4ZA1A 5KFNA 1KR4A 1CJKB 5AM4A 4NLYA 4RQ6A 1XSLA 4NE9C 3BKUA 5ETSA 2BANA 2Y1LB 3PR5B 1FKPB 3UXPA 3DDKA 3MWPA 2PAVA 1S6UA 3MM6A 1Z00B 4ZVEA 2VDIA 3R2CJ 1X31C 4Z0UA 1NG9A 2XY7A 4CK1A 1S6PB 5ALPA 3SQ2A 4AHTA 3N28A 1BISA 3OW2M 1NSQA 2J0QD 3PW4A 2MKCA 2HMXA 3W8PA 5J0UA 5A0YB 2GCFA 2F44A 1SV0A 2YNGB 4BRNA 3F44A 3C21A 3TWHA 5KL8B 1TKXA 1BCMA 5AQNA 2F77X 3T41A 4RR5A 3VQEA 3L4PA 1ZD5A 3IN5A 1W25A 3BBFA 2EWSA 4CJEA 4FLYA 2HNZB 1Z19A 1I5OB 2FUG9 1DKGD 1J5OA 4DUZF 9ICUA 2FJ6A 1ZTWA 4F3TA 3ZFVA 4Y2SA 2KE7A 4LT6A 5FPMA 1RAEB 4UAZA 3EJMA 4RW8B 1T03A 5KPRA 4W5QA 4JKGA 5AQSA 1SS6A 3HP6A 2W55A 4JMUA 2BE2B 4XAKA 4YMMA 5SZTA 5CXTA 4MN4C 4GV6A 2YQ1A 1ZQQA 2W2NP 1WF0A 4YOTA 2YMLA 4FJLA 1FRMA 4OJ3A 3VVTA 8ATCB 1FESA 2F8KA 4O3NA 2FJWA 2VYPA 2B6AB 3HFZB 3QWPA 1NJYA 1ATNA 3B78A 3CO0P 2BE7D 4I6WA 1S6QA 2HMIA 2BVZA 1LWCB 3ZT0A 2V8PA 1CJUB 1RLCL 5FRNA 5E3RA 4OHXA 4RQNA 4PHAA 3BR9A 2NXCA 1QDUB 5B0AA 3NCRA 2YQ0A 3ZZ0A 4RUHA 5A8WB 2X6SA 3GU0A 3LDPA 2RDDA 3E51A 2D9OA 3EZOA 4XA5A 4I7FA 5A2QY 2R7QA 4X84A 4OI3A 5AJ3K 1I94K 4G6VB 4ZLNA 2OTJN 4OZJA 7ICEA 4FKXA 4NLTA 2MSTA 3QU7A 4LSLB 1OH6A 1T3QA 1NLKL 5DETA 3AO5A 4OZ1A 3EZWA 5DM6L 2QLXA 1UEUA 4NXMF 3VQDA 4Y6IA 3Q23A 4PXBA 3MHYA 1KDNA 3R5CA 4DCHA 2YTUA 2VGMA 4XH5A 4PUOA 4Z4IA 3L0QA 5D15A 2HGMA 1T9TA 2AGOA 2CQPA 4P0PB 2C3UA 1JROA 1SJ4P 4E1NA 3JSRA 3G82B 4DLGA 1TUYA 4EBDA 3EKSA 3OS2A 4FOEA 2BUPA 4PHPA 3JQKA 3SLCA 3OTDA 3A13A 3SQIA 1A0PA 3O8MA 4USIA 4TUPA 2SXLA 4P2SA 1U6FA 3M6ZA 4FJXA 5F8HA 1RT6B 4Y1CA 3AJ2A 3M1VA 1O8BA 4OCZA 4AD6A 3L5KA 3EXCX 3NF9A 2PDAA 5HHIA 4GVBA 2KDOA 1TV9A 3DJCA 3N6NA 1Q18A 1BU6O 3QIPB 4H4OB 3GE9A 4JV1A 2K8CB 5J1EB 1S1TB 4IKAA 4JI8J 3O80A 1FE4A 2RUSA 2LM4A 3C8YA 4LQ3A 1O03A 2WAQC 1PVPA 1S1VB 4IEIA 4K8ZA 4BC7A 4WFBL 3ZD9A 5I3PA 3WIUA 3CPWR 3RJMB 3AAQA 1RBOB 5KFBA 4DR7J 4A59A 4G3IA 1HARA 4J37A 1UKUA 3IM8A 2OXOA 2WFBA 2Z7JA 4YMNA 4OI4A 4IFVB 3R27A 3U1LA 2RUGA 4LFBJ 4A4JA 4YDUA 1T94A 4NLBA 4EI2A 4X66K 4FPRA 3NH1A 2ZIVB 1TL7A 1N33F 4OYMA 3CCVN 4AUKA 2P9PA 2XWYA 4RPZA 3NVYA 3LDQA 4QOTA 1WSIA 4PQUA 4FO6A 5F8NA 3T5KA 5IT0A 1PBUA 4PXDA 3C6TA 5HJYA 4US8A 1A5VA 1WBDA 1A77A 1NK0A 2HHHJ 4CLTA 4JI5F 4RUBA 1Q8BA 3RR8A 3ZTOA 1LKYA 2GAHC 2AF6A 5LSOA 3C2MA 3CPWM 2UXCK 2QFIA 1V9OA 1QVGR 1CRXA 5AFUA 3BS5A 1NMEB 1HI0P 1FJ7A 2ASMA 3ATUA 2HQ3A 2HB5A 3D6RA 3DWLA 3T1YF 3NMUA 3PO4A 3ADAC 1U2RA 3RRGA 3CRXA 4AE5A 4FBUA 5D0RA 1GH8A 1X0FA 3FVYA 4CEFA 3H08A 3TUIC 4O3QA 3NVKA 3MPUB 3N6MA 5C42B 3CXCR 4C8YA 2XGQA 3LVVA 5AQKA 5IT9Y 2MZQA 3AB4B 5KFSA 3DHWC 2DNPA 1KP6A 1CQNA 1VRUB 1CS4B 4BRPA 3AGRA 1R59O 3KK2B 3M8YA 4X64F 3CJQA 3CF5Q 4CK2A 1JB0C 9ICTA 1S1WB 1FWPA 1KDHA 5C10A 3MPVA 1KLMB 2IA6A 3BKTA 1SKUB 1R0AB 4X65J 2MY8A 1HMVB 2IJFA 4KHRA 4CE9A 1BDGA 4AHRA 3O3GA 4C7YA 1QVGM 3AD7C 3FRZA 3KK1A 1U9LA 1ILYA 4OJGA 4TQRA 4FWMA 9ICNA 2R7YA 2W8KA 2G4BA 1Y88A 2W41A 3H8WA 2CRLA 2XRIA 5HNKA 3CMQA 1VDVA 3CXCM 1XUPO 1X60A 4DB3A 3W3DA 2O3DA 4BACA 4K5SA 4KYZA 2HFVA 3PYEA 3K17A 4K4IA 5KFFA 1Q4RA 4CHQA 4YB1P 4F7VA 1KAZA 4FYYB 2DRDA 3ID6A 3MM9B 4I56A 1D8BA 1LV5A 3RJFA 2O1PA 2QT7A 4M3UA 3R9KA 3L8BA 4QZGA 2EDUA 4DUYJ 3N4QA 1LW2B 4ICLA 4KHPK 4J2AA 3WX4A 1UPMB 2KKZA 8ICTA 4OI6A 4FJ8A 1X4BA 4ZP7A 4KB7A 3L4BC 3TJ8A 5KGXA 4HHTA 4MEXA 2V9WA 4NRTA 2FD2A 3PYGA 2W01A 1HBUA 4BDZA 3NVVA 1VQLS 3OVBA 3QERA 3H5SA 5BN8A 3LANA 1RQ0A 4DX5A 4EX6A 1GXUA 3W8GA 3WXKA 3PR4A 2K3KA 4DMZA 4USWA 4PG4A 1UCNA 3N7SC 2ZM6J 3IRUA 4NO7A 1CEZA 3OFHA 1OY6A 2ROGA 3WNGA 2CUYA 5C25B 3R7BB 3CMAN 1EXQA 4PHTX 5BRFA 1X4FA 3C6HA 4PL1A 3CIMA 3M2VB 2DHSA 5L39A 3BH6B 2QARA 1N5XA 1S1XA 4C8NA 3BZKA 1SZ2A 1F5CA 1X6JA 1ZQRA 3OYEA 4K8RA 3IBCB 1YI2N 4GO5X 3QUBA 5CQGA 3OBIA 4CIGA 3HSCA 3SBTA 1RNHA 4NL5A 8ICAA 4FWPA 2LEBA 5E5NA 2NZTA 4NYZA 1SWVA 2YNFB 5CAAA 1T9UA 2JVOA 4GC6A 1RBVA 1WHVA 3GP9A 3NF7A 3K7RA 1CXQA 4URQU 1OS5A 1Q8LA 4QIWF 2D3OR 2NRTA 1ULRA 4CLPA 2H5JB 2V8VA 1C1CA 1C2PA 3K9KA 4GW6A 3SQGA 2VODA 3O3FA 1WDTA 3JSMB 4HKQA 3IFRA 2I7PA 2OSQA 3UN2A 4G9ZA 4FJJA 3QQCD 5E3PA 8ICRA 3ET6B 1DZ5A 5KFPA 4GY2B 4J9MA 1MU2A 1K47A 4YS2A 4IXCA 1XO0A 3KK3B 2KTQA 5K14B 1IQZA 1HIWA 2CJYB 1KWMA 4MFFA 3NWRA 2OZMA 2IHR1 3I32A 2PEHA 4KJIA 1UCVA 2XLKA 1B9FA 2AJQA 3RSEA 1QTMA 2R8IA 2MA1A 2CQ4A 3PCOB 2XZDB 2M8DB 3QX7A 3MFHA 5AE1A 2OLWA 4LBHA 3ZT4A 2HKEA 3R1LA 1UPPA 3H0PA 3MEDB 3ZX3A 4ZLPA 1DOQA 2COLA 4DV5F 2W11A 2ILZA 2DO4A 4KKOA 2F9JA 3PFEA 4BBYA 3AO2A 2WONA 1NK7A 3DAWA 4CO1A 1QCKA 2OTLS 2ZBCA 3QRQA 4PKGA 3KLIB 4O9MA 3ZT2A 2HAFA 1PSDA 4PQAA 4ZPBA 4CJ4A 3M05A 2BOAA 4EO6A 3SNNA 3FQLA 3HJEA 2BJDA 4F2RA 2HZAA 1XO1A 1CJKA 3KK7A 2PMZC 4KLIA 4NYPA 3UXNA 2DKOB 2DFEA 4OYOA 4Y2JA 1FKPA 4U7UK 2R3VA 3HOSA 1Z00A 4ECTA 1XSNA 4KPCA 1S6PA 4FWLA 2JC0A 4LH5A 3M4XA 5BR9A 1U48A 5A0YA 1HNWK 3AVKA 3T6BA 4X62J 1RXVA 4ZPWR 3CM5A 2NRVA 3IS9B 4RQ7A 1RWVB 1S5JA 2YNGA 2HS4A 5C2DA 3D1HA 1R8HA 4CGFA 1DK3A 2LYVA 2YWEA 2QLWA 3ISND 1U8SA 3VF2A 5FDLA 1U7LA 1B3TA 2B51A 3D3CJ 2L08A 1BPBA 1Z26A 2MEWA 2HNZA 3GG0A 2LQJA 1ATRA 1BD6A 1C0MA 2ITMA 2PD1A 5KFTA 5F0UA 4QAGA 4FLVA 4K0KF 2VPWB 4NLOA 4TUSA 4AHSA 4YN4A 2EBGA 4TY8B 4HR2A 3HRDD 4GKKK 3TFSA 4ECWA 3VTIA 2IRUA 4WXWA 3NRZA 1WSJA 1F5AA 4B3TK 3DRSB 4L76A 4B17A 5AKGA 4BWMA 1MA9B 3MMBB 3MAHA 2QB0B 3R8EA 2DGVA 3JAMO 4OKJA 4KGZB 3VAFA 3MAQA 4DFKA 3VCDA 2B6AA 4UTGA 1RWMB 1RWUA 1TMJA 2GO7A 1R3NA 4I2CA 2KFNA 2HK2A 1FHTA 5HL7Q 1XNQJ 1LQ9A 1CJUA 4ZLLA 4JEPA 3CPEA 1B0XA 4Y2QA 3F5TA 4H5RA 5A8WA 5J0QA 4FLXA 1BHLA 3HSTB 3AN1A 4W5OA 5ALXA 4RW7B 5IQQA 1EQMA 4OYZA 2G08A 3GOIA 2QA1A 3OXFA 1F2GA 3BV8A 4FDFA 2KHVA 1N61A 2GH1A 3M9MB 3VGLA 1SI9A 2QTDA 3NGIA 4LSLA 4RW9B 4OLBA 2BRKA 3CIZA 4JK9A 1KFSA 4DX8H 4ED4A 5ALZA 2R7UA 3CFPA 4LIWA 3HYFA 5D0GA 4TSXA 1RP5A 2E1ZA 2G2OA 2JFDA 2RQKA 3M7VA 3AA2A 2LI6A 1EWQA 1YK9A 4HUGA 2JEFA 2KXFA 4ISGA 3LP1B 2HHVA 2BPGA 2CZ4A 1RDAA 3QZ7A 5ALFA 4DF8A 4I67A 2WC9A 4GFJA 2A1RA 3LPEA 3SSQA 4N41A 3PJWA 3Q8KA 4M7XA 3UCUP 2UXCF 3R6GB 3UB5A 3T5JA 1RAGB 3EGVA 2KD1A 3RB0A 5AQVA 2D3O1 3PTWA 3GMGA 4E8UA 1LXJA 4DWIA 2N4CA 2JWNA 3VF6A 2BJ7A 4YB6A 3DXMB 3Q8SB 2H54B 3VEXA 2OPQB 5CR4A 1RT6A 3RRKA 1HHSA 2YWHA 4NM2A 4J91A 3EPGA 2AGQA 3UKUB 1D8ZA 1H1VA 2QKBA 1Z4UA 5HMLA 4YQWA 3AAPA 3W9HA 3J7YP 2RQCA 3R2DJ 4KIAA 3QIPA 4H4OA 4P10A 2D0PA 1XMBA 1ATSA 3EKUA 2Z1IA 5TKYA 3CJSA 3DFEA 4Z7CA 5J1EA 1S1TA 4BRMA 5D0HA 3ENOA 1RBRA 1S5ZA 1S1VA 1T05B 1ZBSA 4HDHA 2G9OA 3TTDA 4NLSA 3J81j 1TUUA 4NXNJ 3FE1A 3KFUF 2NSCA 4LF8J 4F2SA 1TL5A 4UAVA 2K4PA 3QNMA 1Y3KA 3RAQA 2H4WB 2VCPA 3CD6N 2ZH4A 4MO5A 2YQ3A 3OY9A 3QDKA 2W4PA 2NSBA 1QM9A 2FJEB 4OPAA 2E8AA 2DHGA 1UT5A 3C6UB 1YJRA 4WFYA 4Y2UA 4IFVA 4KQZA 2A10A 3A0HU 4FZMA 4BRDA 1TL4A 2DB1A 2Q0ZX 4K8XA 2J6UA 4EELA 2BJ3A 4FVCA 5LMNK 3MDCA 2ZIVA 2E1AA 4KTQA 3IFEA 1RAIB 3THTA 3IWNC 2AJ1A 1C0UA 2RLTA 5AM5A 2KFYA 3TR5A 3MXIA 3D6JA 1KVAA 3RJIA 3DXKB 4J9SA 2HLTA 2A19A 1DRGA 2RNEA 2ZEJA 2EAOA 1HHQA 5L38A 3T1HJ 4M7YA 5LL6d 5BPMA 5ADZA 2V50A 1ZXIA 1HWUA 2QFJA 1HR0K 3F73A 2ZJPL 3D67A 3PIPL 1WUUA 5ALWA 5AKYA 3WKCA 4ILHA 7ICMA 2QLBB 5AKXA 1JALA 1SZHA 2EI5A 2GO9A 1P8ZA 3RVCA 4DR6K 3J80Y 5C42A 4YHHF 2E66A 1RT2B 1XMOK 2C3MA 5L8RC 2ZBQA 3LGMA 3AQOA 2BRLA 1CS4A 4RBVA 2VG5A 2WMMA 1OIAA 1WWHA 1ZQPA 4YR3A 2F3NA 3KK2A 3IBPA 4DTJA 5B8HA 4OJ6A 4M5GA 3CJAA 1S1WA 2ZVSA 3TWZA 1HJRA 4JN4A 5CB1A 4ED6A 1KLMA 2VFUA 4K7QA 1R0AA 2HGLA 1Z1ZA 5F8IA 1ZM9A 1NGFA 1HMVA 2XY5A 3QU4A 2BV3A 2E5LK 1WC4A 5KRTA 3S01A 4DOBA 5M1PA 4OKEA 1N63A 9ICJA 3BEGB 2E1FA 2GHWA 5IXUA 4LRBA 1Y3JA 1ZD2P 4DL7A 4J9QA 4I2PB 4LF4J 4RQ8A 3AD9C 3O6QA 3BQTA 4HTLA 1J6ZA 2V8DA 3NG8A 3ZEUB 4DSEA 4WK1A 3V4MA 4WJ3B 4YOUA 3ILJA 4O4GA 4BC9A 3DKDA 4DOCA 5LJVA 1ESVA 4BR9A 3DXBA 4ZP8A 2OSRA 3EVOA 3KLEB 3K75D 3HVWA 2V0NA 8ICHA 4HLBA 4UY85 2Q4TA 2E2PA 4BR0A 2QWPA 1EQYA 1WSVA 1NM1A 4JKEA 5AQPA 3NGSA 1WYGA 5AT1B 3U02A 3MM9A 3MMVA 4Y2VA 3H0MB 2A1JA 3MF5A 4TQSA 1IBKF 1LW2A 2UUBK 2W7AA 4HCCA 1S0MA 1XC3A 1RBAA 4RQMA 3NH2A 8AT1B 4PG7A 4IOXA 3THVA 1KVBA 1UFKA 2ZD1B 4KB0A 2AU0A 2JH7A 2MJUA 1RDWX 2WF5A 4CO3A 7ICIA 3ZZRA 3JYTB 2M4MA 2B0GA 2IDOA 4JI5J 1NGAA 5FD1A 2HZVA 1L3UA 3ELHA 1BC6A 4DSFA 2ASOA 3NRWA 1NGHA 4U67Q 1X4EA 1S72S 4CJ5A 1BWEA 3UM9A 2AMCB 4X2BA 4W5TA 1VQKS 5EOZA 2CQHA 5H9FJ 3P1GA 4E7KA 1N32J 4FE3A 2FJDB 1UVNA 2DEJA 2PGCA 2JLEA 1WCLA 3VAHA 4E2FB 2IIRA 4DQQA 2Z8QA 3JB9k 3ID8A 2ZWHA 1NO8A 2YNFA 4LF9J 4L73A 2P9IA 5AI0A 1S49A 4NM1A 2FVSA 3N6LA 3TI0A 3WK7A 2MKKA 3OBWA 2NZCA 4JKCA 4QR0A 4JI7F 5ALKA 3HCXA 3HSDA 3JTNA 4KHUA 1WORA 3VEVA 3AU6A 1IVZA 4CBXA 4AP9A 3JSMA 2VICA 4EYHB 3OR2B 4P2XA 4YG2A 1KFTA 3FC4A 4UUXA 2DNNA 3G4SN 1TZ0A 4CI6A 2L9WA 2YKQA 1S4EA 4KHQA 3KK3A 2EKYA 5K14A 4DN0A 4EHTA 4I4BA 2W54A 2K1RB 3BO3A 4CZLA 1F60B 4JYAJ 3S41A 2D3ZA 1PG5B