1U48A

Extension of a cytosine-8-oxoguanine base pair
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 215
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u48A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u48A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u48A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u48A01
3M9OB 4DQRA 4J9RA 4IRCA 2VG6A 5KFXA 1ZQYA 4M0AA 3HP9A 3V9WA 4B9VA 4CECA 4M3UA 4BACA 2XY5A 3HPGA 4F4KA 4OPJA 2F1JA 4I2HA 4C8NA 1EP4A 3DLKA 4CJSA 4FM0A 4PHPA 4DOCA 5HHHA 1MSWD 2BPFA 4Z4FA 4UAYA 3SUQA 1TKXA 4ZTJA 1WN7A 5KFPA 2XY7A 1JLQA 5K14A 4I2IA 1U04A 1BIUA 3TABA 1UT5A 3HSTB 3I0SA 3H8JA 2A1SA 4ED6A 2YV0X 3HWTA 4Z4GA 3ZSRA 1TL1A 4FM1A 3ZDDA 4GXKA 1ZBLA 2P6UA 3RMDA 5D49A 1EX4A 4FLTA 9ICEA 1ZBUA 2X6NA 4KHSA 1RDAA 5FDLA 3H8SA 2IMWP 2JEGA 3QZ8A 4GVMA 5DB6A 4F5NA 4CHOA 4CJEA 4YMOA 3OYKA 4CHQA 4TURA 4FJGA 1LV5A 4M9GA 1RT7A 3QEIA 1WSFA 2W9CA 1VRUA 1Z25A 3TFRA 5DMRA 5CA7A 3PO4A 2W8LA 3OYDA 2H5XA 4CK1A 1TKZA 4CIEA 1ZQLA 9ICLA 4F5QA 4CHZA 3TFSA 1QE1A 4B9SA 1YVUA 1ZJNA 1QLNA 1ZQKA 2YKNA 3Q8SB 2AQ4A 7ICSA 1G15A 4O0IA 3MECA 1JKHA 5DLGA 5KG2A 3ZD8A 4NLNA 3L3UA 2V9WA 1LWFA 3TANA 4PHEA 2DPJA 1U9LA 1MU2A 2B5JA 1XI1A 1IXRA 3V6HA 4KLUA 2ALZA 4YP3A 3JPTA 1RDCA 1LAVA 1T05A 3TWHA 1XHXA 1ZQHA 1AROP 4CJVA 5DQIA 4ED0A 3DRSA 3ZT0A 2QK9A 4QW8A 2Z1GA 2ZUCA 3OYAA 4W5QA 4M9LA 2HHTA 1D9FA 5D4BA 4QZIA 4OPKA 1TK0A 3AVKA 4KTWA 2ZQBA 4YFUA 4CEZA 8ICVA 2P5GA 3KLHA 1REVA 1QHTA 3O3HA 1FKPA 1TVAA 3VA3A 1IKVA 1NK5A 1VSIA 3RAQA 3H40A 2VA3A 4BE2A 1B9DA 3OYJA 4QWBA 1CZBA 7ICNA 3OYHA 1NK0A 4XIUA 4LH4A 5SZTA 2XGPA 3PO5A 3V1QA 2BCRA 1S0MA 1L3SA 4AHUA 4CJ5A 3NH2A 2JEIA 4O3QA 4ECVA 7ICIA 1U4BA 5DB9A 4HUEA 4KMUA 5SWMA 5D46A 4B08A 2PYJA 1SV5A 1SUQA 3HPOA 1BI4A 2ZUDA 3SUNA 1NJWA 3NH1A 1BVSA 4I2PA 4ZH4A 2XC9A 4DFKA 9ICMA 4LY7A 3SI8A 3PW2A 2G8IA 1LB2B 4J2DA 2OPSA 1DTQA 4DSEA 3QEAZ 5J2KA 2BQRA 2FMSA 3T5LA 4YR2A 1HYZA 4GC6A 4CEDA 4N41A 2XGQA 1ZQVA 1ZQXA 3GIJA 4NCAA 3SQ4A 1NOMA 4FK4A 5L1IA 2OZSA 3IM1A 5J0PA 3UIQA 3ASMA 3L2WA 9ICNA 3QEBZ 2BR0A 2Z1JA 2P5OA 1Y97A 4UBCA 3LWMA 4K4IA 4YXJA 1K1QA 2FBYA 3QIOA 4KN7A 5J1EA 3NCIA 1WCLA 3FFIA 1S1XA 3VQ6A 5CY4A 8ICXA 1RT2A 4HVJA 4DLGA 3AVBA 2Z1IA 3B0XA 4M45A 7ICHA 9ICSA 2Q3SA 1B22A 3BQ2A 2UVUA 1VSEA 5KFRA 4XRHA 3KD1E 2FPKA 3K5NA 1HQUA 4QZBA 4KHQA 3AU2A 4CF8A 3O3GA 3V7KA 1C0UA 1TKTA 5KG6A 3RMAA 3AA5X 1PZNA 3VQPA 3TAFA 1S0VA 4JUZA 3ZDEA 4PA1A 4J2EA 1NOZA 3QEVA 1RBUA 4BWMA 1WSGA 2AGPA 2D0CA 3U3YA 4RT2A 3AV9A 2ZTDA 4FJNA 5CR0A 2VA8A 4C8MA 3QEPA 5HRRA 5FROA 2NRWA 3RAXA 1QS4A 1VK0A 8ICQA 4EZ9A 3WNFA 1RPLA 1TFRA 2PI5A 2D0AA 3AVMA 3ZDCA 3QNOA 1XSLA 5L1LA 2KN7A 4QZCA 3QZ7A 1RBTA 1RILA 2HMIA 3QO9A 3QESA 4CJ4A 8ICGA 3AA2A 1S76D 3G6VA 1HQEA 1ZQUA 4Z4CA 2ZJAA 4P4OA 4CF0A 4K8ZA 4M04A 3AVHA 4MFCA 2V4RA 3CM6A 5IILA 3NAEA 5J2HA 5CHGA 3OYBA 1LWCA 3EZ5A 2KTQA 4RUAA 2ITGA 4IFYA 2NRZA 1JXEA 4F2SA 4ECYA 2FPLA 9ICKA 1MC8A 1TV6A 3ZD9A 1NOYA 1LAWA 3PMLA 3PW5A 3ZSWA 4XA5A 4UBBA 3LK9A 3RH5A 3QIPA 4DF4A 2JLEA 3PW4A 1RTDA 4CJWA 1QTMA 4IBNA 4WE1A 5TZVA 9ICJA 1ZQWA 2VWJA 1XO1A 2ATLA 4E7JA 3H8WA 4LZGA 1TAQA 4ID1A 1JMSA 1Z00B 5KFVA 3TAEA 3EYZA 3NF7A 1Z00A 1S5JA 1C1BA 3LPUA 2E6MA 2E6LA 4Z6EA 4ECUA 3EW9A 1ZQSA 4JLHA 3I0RA 5JS1A 1BQNA 1H38A 1C0MA 5IIKA 1NK7A 1C1AA 4DTRA 4KLHA 5DGAA 3M9NB 4QW9A 4RT3A 2FPMA 3LAMA 1XSNA 1N6QA 1J53A 2F1IA 2P6RA 9ICOA 1HUOA 4DSJA 4IR9A 3CFOA 4FBTA 3LZIA 3BDPA 3DI6A 4RQ6A 1DTTA 4BWJA 2FBXA 3AVFA 4GLXA 1XS9D 1ZQMA 4I9LA 4KN4A 3GV5B 4FLZA 5KFNA 3K59A 4AHCA 5BPCA 3PY8A 4DS4A 4M3WA 1X9SA 1VSMA 3KK2A 1HPZA 1VRTA 5KG4A 2GUIA 4KI4A 4B9NA 4NXZA 5IINA 4RPZA 2YHBA 4CESA 1ZQAA 4E19A 4JV2A 3IAYA 3DYAA 5J2FA 3RB4A 3BGRA 4M2YA 2VANA 4M42A 3KKRA 5DGBA 3UQ2A 4CFCA 2PFQA 8ICMA 4IG3A 2G8FA 4IQVA 5J0QA 4I2FA 1COOA 2WOMA 4DMNA 5KFAA 3VQ9A 1WSJA 3RH4A 1LW0A 3UPQA 2KZ3A 5J2IA 4YD2A 5J2CA 4JV1A 4QZEA 5KTQA 8ICFA 4KKOA 2C28A 4JRPA 3OYMA 3KLIA 2VWKA 4FJ5A 4IQUA 3KHLA 3PX0A 4PGYA 1JXBA 3ISNC 1HYSA 1FKOA 5KG0A 4R65A 5EOZA 1RZTA 1BPBA 3AO2A 4QZ9A 4RW8A 2PFOA 1F21A 3KHGA 3U3GA 4RQ3A 3V81A 1S1UA 4BDZA 2AGOA 4NCBA 3AUOA 3SYZA 3OY9A 1JIHA 3C95A 4K4HA 7ICEA 4X5VA 3C1ZA 5KG1A 4CEBA 1RYSA 5KFDA 4FZXC 7ICTA 4P4MA 8ICKA 3T5JA 3H7IA 4TUPA 7ICQA 3K58A 4F93B 4KAZA 5HP4A 2I9GA 5EWEA 4N5SA 4DSFA 1ZQEA 3DLGA 3SQ2A 3RJHA 3C2LA 3TQ1A 4QWCA 5KFBA 2R8JA 4M3YA 3OS1A 3PUFA 2P1JA 4BE0A 2HHQA 3GV8B 3AVAA 4B8AB 4QZAA 5DG7A 1ASVA 1NK9A 5D3GA 3H4BA 2FBVA 4DG1A 4YXMA 1WCNA 3S3NA 3LANA 2BCSA 1S1VA 2B21A 4H4OA 4O5CA 4RW9A 3OYEA 3P5JA 3ZSVA 3SCXA 1L3VA 2FLPA 1BCOA 3KTQA 4E7LA 2KW4A 1ZQFA 4K8XA 2UVRA 1SKSA 2HNZA 1A5VA 1WAJA 2F8SA 3AO1A 2RF2A 4F50A 5L1KA 4ELTA 3KIOA 4RW7A 5KG3A 1BISA 3M8QA 3LP0A 1ZQBA 1J5OA 2W9MA 4HUFA 4JS5A 2C2EA 4HHTA 4F3OA 3MDAA 1ZYQA 4OKKA 3L2RA 3MDCA 7ICRA 3RTVA 4FJKA 4FJXA 3C21A 1UT8A 2J6UA 3OGUA 1D5AA 5J0UA 5KFWA 2ZJ8A 4CK3A 1X9MA 4R5PA 4FXDA 5KT2A 1ZQQA 1KLNA 3LWLA 2X78A 3RJJA 9ICFA 1S1WA 2VA2A 4CHNA 3ULDA 4ELUA 4JWMA 3ZT4A 2G8UA 3OSPA 3ZT2A 4CF1A 1J54A 2BCQA 3RJEA 3JPOA 4J9PA 5KRTA 2AGQA 2FLLA 1MQ2A 3JSMA 3G10A 3M9MB 4KLLA 1RT5A 3NF6A 2OZMA 3DMJA 3RB6A 4DL7A 4B9UA 3PVXA 4FLWA 3QINA 3VQBA 5JUMA 1Z3EB 5J2EA 1QSLA 2FMQA 5BOLA 3MR2A 2UVVA 3B6OA 2R8HA 4IQTA 3C5FA 1RT4A 1CLQA 4CGIA 3H4DA 3MABA 1XC9A 3DRRA 4M9HA 4NLKA 5KGWA 5C24A 3K5MA 3HVRA 4QAGA 3MXIA 3T3FA 1L3UA 4BGDA 3KKSA 5DQHA 3BJYA 4RPYA 3T1AA 4JV0A 3SQ1A 4Y1CA 1S9GA 3SUPA 1B9FA 4E7HA 4J9NA 3QEXA 4FW1A 2IOCA 1C0TA 4FS1A 4RQ7A 1ZBIA 5JS2A 1RXWA 4I2BA 3V6JA 1X9WA 8ICTA 4BXOB 4IR1A 4RW4A 3AVIA 4BXOA 1EKEA 3GIMA 1RDDA 1UAXA 4DEZA 3NF8A 2R8KA 4RU9A 1B43A 1KVAA 5IIMA 2IHNA 5FRNA 9ICTA 3AO5A 5BOMA 4CEAA 5CJ7A 4FCYA 1S6QA 4AHSA 4KLQA 3K2PA 5DBBA 8ICWA 4FJMA 4ED8A 4LZDA 4G3IA 4GXIA 3KK1A 1KSPA 1WAFA 2D5RA 5J0YA 1CEZA 1NKEA 4DSLA 4YMMA 2C2RA 3DLRA 1ZQPA 4IG0A 3MEDA 4OJRA 2R8IA 3MXJA 1ZQNA 3OS2A 4YNQA 3V9XA 4L8RB 1RCHA 4RQ5A 4FJJA 1JLBA 4YVZA 4FYDA 2I1QA 1BPXA 4CGJA 3HL8A 2EX3A 1LWEA 7ICJA 3RMBA 3T19A 2ZE2A 2BQUA 4W5TA 1HNIA 3L3VA 3ZDAA 4DQPA 4TUSA 3TARA 4DL2A 5J2NA 4DFJA 4P4PA 4B9MA 1T8EA 1SZPA 4BE1A 1VSKA 2GBZA 3HJFA 3IRXA 4AHTA 1TGOA 4M6WB 1U48A 2KFZA 2AQ0A 4M6WA 4QZDA 4W5OA 1A76A 4EP4A 4KLGA 4E3SA 3PW7A 3CG7A 3CM5A 2W42A 4MFBA 4Q0BA 1N56A 3TR8A 3OSNA 2DTUA 4KRFA 5KFYA 3ZSYA 3Q8LA 3JPNA 1B92A 4UB3A 4B9TA 3LP3A 2IC3A 4KLTA 3BQ0A 4KPYA 4M47A 3H08A 4KB0A 4PQUA 2OPQA 2GWSA 3SJJA 2HVIA 4FLXA 4CF2A 4M9JA 4EBCA 4DL6A 3L2QA 2O4GA 2IAJA 4I28A 3VQDA 2LYHA 4F8RA 1ZBFA 4CJUA 1XSPA 4N47A 1RNHA 1HUZA 4J2BA 2ASLA 4F4XA 3CFPA 1WNSA 3Q8PB 2P51A 7ICFA 3WNEA 2DFEA 1HJPA 3SQ0A 3C2KA 4DO9A 3PW0A 1N5YA 1NJYA 3V72A 3UXOA 4I9QA 9ICXA 4I2GA 3RBEA 1S9EA 4ECWA 4EYHB 4B8CA 4PUOA 7ICOA 1TK8A 2PFNA 4RZRA 4CF9A 1IKYA 3LDAA 4H8KA 4DQSA 4DU3A 3VQEA 4YR3A 4CK2A 3GQCA 3MGIA 3EWAA 4M3ZA 1ZQGA 3RJIA 2GV9A 1ZJMA 1UWBA 4RQ1A 3AVGA 3OS0A 2JZBB 4FO6A 2JZBA 2PI4A 5KFCA 5CB1A 4FJIA 1VSJA 1RDBA 4XQ8A 7ICGA 5KFEA 4DU4A 1QQCA 4E7IA 3WNHA 4CJLA 3KJVA 1Q8IA 1JN3A 3SI6A 3K5OA 3DLBA 7ICMA 1JLAA 5I42A 1CZ9A 2BGWA 2X6SA 2ATQA 7ICVA 4EEYA 3GILA 3EY1A 5CZ2A 1ZQRA 5KFIA 4Z4IA 1IM4A 5KT7A 2BHNA 4OGCA 3HVTA 4O5EA 4HYKA 2KZZA 2ZTEA 1ZQIA 4KI6A 4NLGA 2ISOA 5L1JA 1QSYA 4DS5A 1S6PA 2NRTA 3LALA 4EBEA 2HHSA 3C1YA 3TAMA 3ISDA 2C2DA 4J2AA 1RTJA 5J0TA 1O1WA 3ZT1A 1X2IA 3T5KA 3OJUA 4FJHA 4LVSA 4CJQA 1DLOA 3SUOA 4UB4A 3C94A 5KFGA 1A77A 5HHIA 2UVWA 4E89A 3S9HA 4CJ3A 5KFTA 1KFDA 5E41A 4AILC 1IKXA 1S1TA 1XU4A 3NGZA 3Q8RB 4KFBA 8ICJA 3ZSQA 1RBSA 4YCXA 2HW3A 1XHZA 3VQ7A 1L5UA 4I2QA 5IIIA 3HXMA 1SKRA 1ZQTA 5DDYA 2IDOA 2G8KA 5J2GA 4CEFA 3MBYA 4IDKA 4DL5A 1BPDA 3V6DA 3ZSXA 2BPGA 4DTOA 4PH5A 3BQTA 1R0AA 4KLIA 2DY4A 2IHMA 4KHYA 5CYMA 2W9AA 1ZQZA 1SKWA 5KFSA 1VSFA 3JPPA 3MAQA 8ICUA 1CUKA 4TQRA 4BDYA 1J9AA 4CIFA 4O9MA 1V9PA 1MQ3A 1JX4A 2FBTA 4GW6A 2XCPA 4CEEA 3U6FA 4Q44A 1JL2A 4RNOA 4ED7A 3ZT3A 3JPRA 3V4IA 1NKCA 1IG9A 5EWFA 2HHWA 1DOQA 4O3NA 4FS2A 5C42A 3VQCA 5KI6A 2YNHA 4CEOA 3LDSA 4AH9A 2ETJA 4GMJB 1NJXA 4FM2A 3MEEA 3RBDA 3ITHA 4K4GA 4O5KA 5DB7A 1CXQA 3NTUA 3RJFA 5J0SA 4Z4EA 4ECZA 3NFAA 8ICBA 3KHHA 1KCFA 4KLFA 4N56A 1BHLA 5DB8A 5DDMA 3SPZA 4PHAA 4FW2A 4G1QA 5KFMA 2O4IA 4KHUA 3UXNA 4EYIB 2B4JA 1UOCA 1JLCA 4EBDA 3MR6A 4F5OA 2PY5A 3PX4A 1UA1A 5KG5A 1L3TA 4PY5A 4LSLA 5KFOA 2BKEA 4IRDA 3V1RA 5KGXA 4I2DA 5KFHA 2Y1JA 1TL3A 1JLFA 4PPXA 4Q8FA 3CQ8A 1KLMA 1D8YA 3BQ1A 3HX0A 4UAWA 1BPYA 4CFDA 5J2MA 5HLFA 2Q0ZX 3IS9A 3I8DA 3JYTA 2OWOA 4YN4A 4YG2A 1XWLA 3SPYA 1RT6A 4OVLA 2OPPA 3K75D 3PX6A 3AVJA 4R63A 4I7FA 3HT3A 2P66A 5DQGA 7ICKA 3KLFA 4YD1A 1S0OA 5L9XA 5IIJA 3V9ZA 4DLEA 1WSHA 2AJQA 4F2RA 2M9NA 4F5RA 3RJKA 5KT6A 4RQ8A 3QERA 4FJ9A 4CEQA 1RXVA 3DLHA 1BGXT 3GIKA 3VA0A 1C6VA 3L2UA 3AO4A 1TKDA 3P83D 3RB3A 4Z4HA 3TAPA 2J6TA 4RNMA 1CXUA 5J2QA 3FDSA 3ZDBA 3V7LA 1QSSA 3Q8MA 4IQWA 3AVLA 1NKBA 2MAXA 2W8KA 1BIZA 2F96A 4DFMA 4ID5A 1IH7A 2PZSA 1WLJA 1S10A 4JWNA 4CGHA 1U47A 2LSNA 1N48A 4HTUA 4FJLA 1T03A 5KFFA 4ECQA 4C8KA 4JK1A 2DPIA 2ZJ5A 3NGYA 1EETA 2QKKA 4OKEA 3OVNA 5HNKA 4YQWA 4J9KA 4O44A 4CE9A 4H4MA 2G8VA 1KTQA 4KLMA 3CFRA 1U45A 1IO2A 7ICLA 3VQ4A 2PYLA 4QZFA 3G6XA 2NUBA 4F4YA 3SZ2A 3DRPA 1NK8A 4CJKA 4Y1DA 3PMNA 4FK2A 3RB0A 4QWDA 8ICNA 4F4WA 2V4QA 9ICGA 4KLEA 2W9CB 4XUSA 5HBMA 8ICEA 3QEWA 4DSKA 4MQ3A 4E0DA 5DBAA 1RTIA 5DG9A 4OLAA 4O3SA 4BDPA 2HHUA 3NDKA 5F9NA 3PNCA 3E2EA 3DM2A 4DTMA 4CIGA 4YMNA 5C25A 5KFQA 3OYNA 2AU0A 4Z0UA 1EXNA 4W5RA 1HJRA 5HRSA 2NRVA 4ECTA 4KTZA 3OJSA 4J9LA 4ZTFA 2OPRA 7ICUA 1ZETA 5HRPA 4CFBA 2RKIA 4KHWA 1BQMA 3EPGA 3QETA 1SL2A 1FK9A 1WSEA 4ED2A 3ORYA 1RBVA 2HNYA 3KD5E 4RQ4A 1Q9YA 5KFLA 3OYCA 2BPCA 4HCCA 1K1SA 4PGQA 4R64A 1WSIA 3DOLA 3OYIA 3ZSZA 1X1PA 3CYMA 4DL4A 3VQ5A 2KFNA 1ZQOA 3QLHA 5J0WA 2I5JA 3G0ZA 4KLSA 4HCBA 1I3AA 2QXFA 3RH6A 3ZCMA 3M8RA 8ICZA 3HP6A 4M9NA 2JGUA 4NCGA 4KB1A 5F9LA 4DSIA 4R66A 4M3RA 3L2VA 8ICAA 2XO7A 3L8BA 8ICSA 1TAUA 4RG8A 9ICQA 5J2DA 5I3UA 3V9UA 3C6UA 4GXJA 3TI0A 4CHPA 4ZHRA 1GOBA 1ZQCA 3OYLA 4DTSA 4PHDA 5J2AA 4ECSA 3HM9A 2R8GA 1RT3A 2VG7A 3SV4A 3B0YA 9ICBA 4J9OA 4FZYA 3IG1A 4TSXA 3RMCA 2IBKA 3P1GA 3C23A 1IKWA 4JRQA 1GOCA 9ICUA 4QOZB 5J0RA 1HRHA 2W9BB 3V1OA 4FLVA 4CERA 2W9BA 5KFZA 4J9QA 1BL3A 4CJRA 2VG5A 4PWDA 2PXIA 3Q8KA 5EWGA 5J2JA 4MEYA 4KHNA 4O55A 4NM1A 4UQGA 3RRGA 4DTUA 2XHBA 3HPHA 3C2MA 2XRIA 4Q43A 3UXPA 3QE9Y 5J0OA 3PR5B 1BI4B 3AO3A 4ECXA 5J0XA 4J9MA 8ICYA 4ELVA 4F92B 3FYHA 3KK3A 3OHAA 3MR5A 4UB5A 3TAQA 2ASDA 4QWAA 2HHXA 3DOKA 4F91B 3AVNA 2RDJA 4KV8A 4DTJA 5T7BA 2ZUBA 2RDIA 4MFFA 4F3TA 8ICCA 1K6YA 1ASWA 1ITGA 4KO0A 4LH5A 1A5WA 1C1CA 2YHAA 2A1RA 4QZ8A 4CJPA 1JLGA 4IFVA 3JPSA 3SNNA 1VSHA 4Q45A 5FRMA 2BGGA 2ZTCA 4CCHA 3AU6A 2IS3A 3S3OA 1C7YA 1UA0A 4KTQA 1S77D 5CZ1A 2WTFA 4ED1A 3K5LA 9ICCA 4DU1A 2MUTB 1BPZA 3MGHA 1NJZA 2MUTA 3NE6A 1NK6A 9ICVA 3VQ8A 1VSDA 2HHVA 8ICRA 5KFKA 3THVA 4KLDA 1W0HA 5HMMA 4I2CA 4C8LA 3GV7B 3V7JA 3VN5A 4DOAA 3EPIA 4HUGA 1BPEA 3NBPA 8ICIA 1RYRA 3M8PA 3NF9A 4E1MA 1HNVA 4RPXA 3D0PA 4TQSA 4E7KA 1RBRA 2FLNA 3G6YA 1BCMA 4IRKA 9ICWA 4UB2A 4Z6DA 2FMPA 2BDPA 5HRNA 3C5GA 4F5PA 9ICAA 2B6AA 2DFHA 8ICOA 5KT4A 2YNFA 3IHQB 4MF8A 2G8WA 2IGIA 9ICPA 4EP5A 2Z1HA 1Q9XA 4RUCA 2YNGA 4QWEA 1KEJA 2ZD1A 3GDXA 5HMLA 4I29A 4CJTA 2XY8A 1YTUA 3UQ0A 4Z6FA 2X74A 1T4GA 4F4ZA 2RPIA 4QCLA 5DLFA 5KRSA 2Y1IA 4DF8A 1FXXA 2XY6A 4AHVA 4DWIA 3ISCA 5J29A 4UB1A 8ICLA 4KREA 1U49A 3N4MB 8ICPA 3M8SA 3MEGA 3ALYA 4QZGA 4RW6A 3NH0A 4YFKA 3V9SA 4B3OA 3HO1A 2NRXA 3LP1A 4MEXA 3QNNA 2A1JB 1YTAA 5J2BA 5HROA 4RQ2A 4KLJA 2A1JA 2C22A 1S9FA 4TUQA 3OYFA 2HVHA 1KFTA 2OYQA 5KT3A 3OYGA 2ISPA 3F73A 1EXQA 2G8HA 1D8LA 2IA6A 2BCUA 1S97A 1JL1A 4B9LA 3KHRA 3F9KA 3VQAA 4NM2A 2JEFA 1ASUA 2OA8A 4M3XA 4FLYA 4I2EA 4O3RA 3HK2A 2KZMA 3KLGA 3PR4A 3HYFA 3T5HA 5IIOA 3B6PA 4JS4A 2PFPA 3ETLA 3RRHA 4LD0A 4Z6CA 2BANA 3LPTA 5HP1A 3N97B 4M41A 3OHBA 2JEJA 3S3MA 4ICLA 7ICPA 1RT1A 4NLZA 2RN2A 4NYFA 4MF2A 3WNGA 4I2JA 1RTHA 5KFJA 1TK5A 3RR8A 2D0BA 3RWUA 1KDHA 4RNNA 3AVCA 3NGIA 4RQ0A 1SL1A 3ZSOA 1ZQDA 1Z26A 5DKWA 4OGEA 2BQ3A 2WONA 3LZJA 2BCVA 3MFHA 4NYNA 2XCAA 3JPQA 4I27A 3NHGA 4OLBA 2YKMA 3RR7A 1HMVA 4ECRA 4E1NA 4DOBA 5CYQA 3DLEA 3PV8A 4N76A 1S0NA 9ICRA 1NK4A 1LW2A 4FVMA 4PGXA 3AA3A 4DL3A 1KRPA 1DGSA 4ED3A 4O3OA 4Q8EA 1TVRA 4CFAA 2HB5A 2FC0A 4O5BA 4DQIA 3E01A 3HW8A 2F1HA 5EU7A 3KLEA 4OKJA 4QZHA 4W5NA 9ICHA 4O4GA 5J2PA 9ICIA 4UAZA 4NY8A 3C6TA 4O3PA 2KQ2A 4R8UB 2ASJA 3O4NA 2DFFA 4R8UA 5KT5A 4LSNA 2HNDA 3MFIA 2BE2A 2YNIA 4P2HA 2R7YA 4FJ8A 3MR3A 3ISBA 1VSLA 1T7PA 5KG7A 5CP2A 2EHGA 4FBUA 3MXMA 1SL0A 2J6SA 3D45A 4DTNA 1ZQJA 4IKFA 3O4QA 1T3NA 3V6KA 4FJ7A 4O0JA 4DTXA 3LAKA 2E4LA 2F8TA 1GOAA 3AA4A 3SV3A 1JLEA 3VQQA 2QKBA 4KITB 4CHYA 3Q8QB 4KLOA 4I2AA 1YT3A 4M3TA 1KVBA 3RJGA 4CGDA 4AHRA 1JXLA 5DBCA 8ICHA 3LP2A 1KFSA 5KFUA 5DG8A 4YR0A 4MFAA 3O3FA 4C8OA 3GFKB 1Y88A 4GC7A 1TV9A 3GIIA 5C5JA 4CGFA 4EZ6A 3K4GA 4CGGA 1ZBHA 4FZZA 4Q5VA 1A5XA 3TAGA 4J9SA 3A2FA 1D9DA 1HYVA 4DTPA 2DFLA 1W9HA 5CWRA 4DFPA 4CJFA 1KVCA 4FLUA 4FK0A 3K57A 3NGDA 4DQQA 1I39A 5DK5A
chains in the Genus database with same CATH superfamily
3M9OB 2EKYA 4MLEA 1K5OA 4PG5A 1ECWA 3N4PA 3M7DA 2VIHA 3HP9A 3V9WA 4B9VA 3M7VA 4M3UA 3QNMA 3KD3A 5BYQA 2F1JA 4AE5A 2R7QA 4A8MP 3DLKB 1VQ7N 1GMVA 2KJVA 1P27B 4UAUA 2EI5A 2OEHA 3CIZA 1PVQA 4ZTJA 3I5BA 5KFPA 1WDTA 2DGZA 4PR6A 3AA8A 3J8AA 3I0SB 3R6GB 4JI2J 4USMA 5JMNA 2CUYA 5HR7A 1RM6C 1TL1B 3HWTA 3M6GA 3ZDDA 4GXKA 1BDGA 1ZBLA 1FESA 3MX5A 2MY7A 5D49A 2DJWA 4CLYA 2BJEA 1U1MA 4LBHA 3L0QA 5DRKA 1ZBUA 2X6NA 5FDLA 1URRA 2ZDPA 3D2FA 3T1YK 2JEGA 4K4WA 4BLGA 3MMBA 4CHOA 2JV3A 2ASYA 4KX5A 4FPRA 2LFVA 5A2QO 5EE1A 3CCQN 4QJFB 2LKZA 2BVZA 4FJGA 1CJUB 1KTVA 1N36F 3AY0A 2QLBB 4PPDA 4PAAA 1VRUB 1WHVA 4DPOA 1X3MA 2O01C 3JTOA 5DMRA 1NNDA 2H5XA 3RG6A 4CK1A 1RU1A 1TKZB 4FWRA 4LFBJ 4X4SA 4CIEA 2E5HA 1QZ5A 3NUQA 1KVIA 3VAMA 3OTCA 3TFSA 4B9SA 2VONA 1EARA 3HJEA 7ICSA 4YEAA 5AZJB 1Q82T 2V34A 5KG2A 3UNYA 1ZZFA 3I87A 4EHUA 2OTLS 3CJ7A 3LH2S 3TANA 1MU2B 4PHEA 4WKRA 2P2CB 1XI1A 2E1MC 4MKBA 1U1LA 2ALZA 1RDRA 3O2IA 3KKAA 2DGTA 2DHXA 2DR6A 1T05A 3TWHA 1PBUA 2GMLA 1C0TB 3TADC 4CJVA 1QQOA 3DRSB 3V2UC 3IO1A 4B1UB 1WC0A 4ZOHC 2QK9A 1OSCA 3OYAA 4LR9A 4W5QA 2RHQB 3IR5B 4TNOA 1ICEB 3CI5A 1U0HB 1FTCA 1J2VA 1TK0A 5D0HA 2HGMA 2IVNA 3KLHB 4KTWA 4YFUA 1ED1A 4UZBA 5HAOA 2IM0A 4LQ9A 1U1QA 1RQNA 2BJ1A 3H42A 3O80A 4M5LA 3IA0A 4JI1F 3L4BC 2L41A 3Q8YA 1JNZB 2G2OA 4DPWA 4MJKA 4JK7A 1QUVA 4UZCA 1MA9B 2MKHA 2DTJA 3HSJA 2FQQB 4LH4A 2ZIWB 5SZTA 4NEZA 1WUAA 1XNSA 5AKXA 2PFDA 2XGPA 3D0HE 2OELA 2H48B 3TVKA 3NWRA 3Q2TC 2P9IB 4ANDA 2F8MA 3MCMA 1CPZA 4O3QA 3FEXB 1U4BA 5DB9A 4HUEA 5SWMA 2XNQA 5LL6d 4OJ5A 5GADU 1VHIA 4PKGA 2ZUDA 3SUNA 1NJWA 5KNIA 1BVSA 4I2PA 3W3DA 4YORA 3CCLS 4FKYA 3CJ1A 2WUSA 1VJQA 1DTQB 3PW2A 3MM7A 1HD1A 2G8IA 1LB2B 1OQ6A 2OPSA 1W2BR 3OL9A 3O9TA 3CVKA 2I9SA 2WVCA 3VALA 3MM6B 5LMUF 2FMSA 4GC6A 2L9WA 2ZH3A 2F77X 2EZXA 1TMMA 4CEDA 4CNZA 2E29A 4F3MA 2RLTA 2EFOA 3CDEA 4JI6J 4ZLPA 3G8SA 4QJVA 3SSRA 3UIQA 3U9DA 1S7HA 4LF6F 2P5OA 2LQJA 2XLIA 1A9NB 3N7SC 3BSNA 3WQTA 2GJ2A 5J1EB 4NLRA 4L73A 4FSVA 3M6XA 3FFIA 3OFFA 3VQ6A 4JKAA 8ICXA 1F3VA 3AVBA 4M45A 2RB7A 2V4JB 2VGNA 2CYYA 1B22A 2ZG6A 4QIWF 2DD8S 4X64K 3KD1E 1WDDA 2FPKA 4BS2A 5ALJA 1GLLO 4AFFA 1C0UA 5KG6A 3VGLA 4BC5A 2GIRA 3ZDEA 4P0QA 4LR7A 2NV3A 1S4EA 4PL7A 3QEVA 1HLWA 1WSGA 3U3YA 4IEEA 4QIWC 1RBOB 4ZPTR 2FJVA 2ZTDA 2E5JA 2Q36A 4WZMA 1F9EB 1SXEA 5ETSA 4DV3K 1UPMB 1VK0A 8ICQA 3DC2A 1KD1O 1WYGA 2MZQA 2GGPB 2PI5A 3AVMA 1Y3KA 3P31A 1J2NA 4F36A 3RF9A 1XSLA 2RJZA 1FJGK 2W2OP 3KZXA 1F1BB 1DFDA 2OP5A 3TTDA 3SQOP 5KPRA 4BRPA 1RKJA 3HX9A 3NKYA 1S76D 1RYUA 4PG6A 4PXCA 4CZJA 4M5IA 1RHKB 2ZJAA 1XR7A 1ESVA 3UR0A 1VJWA 2HLTA 5D0RA 4IH7A 4K8ZA 4YY3K 4DPTA 3FBCA 2RQCA 4MFCA 3AVHA 2M0NA 3O6QA 3CM6A 3NAEA 4OI6A 3OYBA 1LWCA 4UAVA 4BREA 1JJ2M 4RUAA 2E1YA 4JNEA 3DDKA 1JXEA 4ECYA 1RWMB 4XDCA 4XAKA 2QLJB 5B0EA 4XA5A 1X4HA 1GH8A 1VLYA 3JTNA 2JLEA 2B4PA 3MAAA 1UAWA 3MDQA 1DK2A 3OR1B 4WE1B 5T7LA 4FYXB 4N77A 1VBYA 1RTDA 5TZVA 2IMOA 3VCDA 1ZQWA 4PYDA 2ODGA 1JMSA 5KFVA 3N5FA 4WP3A 4F4AA 1S5JA 3I0RB 4ECUA 2V8DA 1ZQSA 1BQNA 2QC3A 1H38A 1ZXIA 3AQFA 2VFSA 3AQOA 3NVVA 2E2NA 2FPMA 3N28A 2LU1A 4L76A 2F1IA 2P6RA 3V6DB 1K44A 5GAGI 4IR9A 2RE1A 3ETOA 2UU9K 4P75A 4RQ6A 1OIAA 1DTTA 3AVFA 2ZIXB 2LQ5A 3GV5B 5L8RC 2R42A 3KK2B 1RHMB 1NZPA 3NS6A 1HPZA 2DNNA 1QZ6A 3H1VX 2LXFA 3WXLA 2Y0BB 4RPZA 5AE1A 2Q0UA 1MMDA 3CQXA 3DYAB 2DNQA 3IAYA 5HOOA 3ZZOA 5IT4A 2W6LA 5A8WB 5DGBA 5CXTA 4IFEA 2NNWA 1K8KB 2PFQA 4AQYK 2VFTA 2WOMB 1QAYA 2G8FA 4BRCA 5KFAA 1FRLA 3VQ9A 1YJ7A 4KKOB 3FM9A 3MN9A 2KZ3A 4USUA 3FE1A 3MMJA 2WB1D 5J2CA 4KSEB 8ICFA 1Q86O 4JRPA 2BYCA 1FKOB 1KNZA 2QL9B 5KAKA 5KG0A 2K2PA 4R65A 3C7NA 5EOZA 3H90A 3ATUA 1WKLA 3I4PA 3L7PA 1RZTA 5AJ3F 3DXBA 4UW2A 2RQ4A 3JAMO 4B3SK 3G86A 1L7OA 1NCLA 2ZITA 3ZNUA 1GLEG 3W0LA 4ISEA 2AGOA 3AUOA 1JIHA 3C95A 4X65J 2FJWA 5FPEA 5KG1A 1HD0A 4M5MA 1XUPO 5KFDA 5EVZA 2H3IA 4PG8A 3BR9A 4WTYA 3AJDA 3K58A 2CQ3A 2HRYA 1IVZA 4F93B 2A41A 3A5NC 3CMAS 4IO9Q 5J8YC 4LBIA 3RJHA 2IVMA 3TQ1A 4QWCA 4GO7X 2XS7A 2R8JA 4U67Q 4B02A 3CETA 2I5HA 2IM3A 3L9ZA 4JI0J 5BPMA 1DEJA 5IOLA 3D5MA 1V3ZA 3Q89A 3PJXA 4B8AB 1UPPA 2BKNA 2HCFA 3IM8A 1S1VB 4DG1A 5EUHA 2BCSA 3P49B 4DV6J 5H2FU 3OPXA 4BHQA 3OTBA 4H4OA 2YQEA 4O5CA 4ZJOA 3G9CA 3E66A 4CD3A 1KQGB 3A3NB 4XH1A 2G5HB 3DLLL 2Y0SD 3NEKA 4C97A 2H5EA 3CJRA 1XIQA 1X6IA 2QFIA 4P9SA 1GMUA 1PIEA 1M5HA 1HKBA 3H25A 3OR2B 4K2JA 1A5VA 1CI4A 4EU0A 4EELA 2YWGA 4JHDB 3L7UA 2G2YA 3LP0A 3VHQA 3CC7S 3EWGA 4R0JA 1BWEA 2ZZTA 2C2EA 5FD1A 4F3OA 3PIPL 3T9NA 2JWNA 2KOBA 2OTJS 4BROA 1TMJA 3MMVA 4FJKA 4I69A 2VJ5A 5ETLA 2GELA 4IL6U 5LY3A 1VS3A 1UT8A 4NLVA 2J6UA 3OGUA 4V19S 1Q3UA 3M4XA 1WC4A 4LF1A 4R5PA 4OHZA 5KT2A 2Q31A 2I6WA 1LOTB 5GIPA 1EETB 2LKYA 3BSAA 1NGAA 5TISU 3QAEA 4EMDA 4ELUA 4MK7A 4AL5A 3ZT4A 2OH2A 4CF1A 1J54A 3T41A 4F72A 2AA4A 3PNIA 2DF4B 2FLLA 3MMAB 5IV4A 4GKKK 5JRTA 3JSMA 4H5VA 3KDNA 4NPOA 5ALMA 2F44A 4KLLA 1RT5A 5ETQA 3DMJA 4DL7A 2J5AA 3PVXA 3NCQA 4HL9A 2P9UA 4K4TA 3QINA 1Z3EB 1S8OA 1U1NA 3CO9A 5J2EA 1QSLA 2UVVA 2H5JB 2R8HA 2EAMA 4P10A 3C5FA 2Z56B 1G3OA 1HA1A 3H0PA 1RT4A 1CLQA 2Z4PA 3IBPA 3DRRB 4WU3A 2RQKA 4OZJA 3K17A 3MABA 1Q8KA 5KGWA 4EX6A 3MXIA 2V0NA 4X64F 3KKSA 4YHHK 1P8GA 3B54A 3ONQA 3T1AA 2KIWA 1S9GA 2XTJP 4YDDB 4FW1A 2IOCA 1VQON 1XERA 3UE2A 1ZBIA 2DH8A 1VQLN 5JS2A 3R5CA 2MZ1A 2ZBPA 1RXWA 2QSFA 1P9QC 8ICTA 4BXOB 4IR1A 2NRRA 2HGLA 3AVIA 1HQ2A 4BR2A 4KH6A 4DV3F 5F3ZA 2ZIVA 2EKNA 4RNHA 1NJIT 2ZNYA 4IOXA 3PHEA 2IHNA 3HTVA 5FRNA 2A6OA 1FD8A 4Q2MA 3SDEA 4EFHA 5BOMA 1M0SA 3L09A 1FJGF 5CJ7A 1S6QA 4AHSA 4KLQA 5DBBA 4ZHRB 4GXIA 3LUYA 1OQ3A 3H8YA 3VCBA 1UW4A 3D67A 4IG0B 3MEDB 2E9TA 2C2RA 3DLRA 2R8IA 5HR6A 3ZX2A 3OS2A 2VG7B 2QM1A 3IG1B 2IOFA 4YVZA 4FYDA 3I56N 1LWEB 2MJNA 4DHVA 1BPXA 4YY3F 2FSNA 4FZMA 3HL8A 1FFSB 1WF0A 3DDHA 2ZE2A 3KBBA 4W5TA 3MZIA 5J2NB 2VJVA 5AKKA 3ZDAA 1R0CB 4TUSA 1FFUA 1EIYB 4P4PA 4H0VB 1SZPA 3Q8UA 2GBZA 3MCPA 5B7WA 5ALXA 3I82A 2ZM6F 4DV2J 4AHTA 5M1PA 2OTLN 2KFZA 2VZ9A 2AQ0A 5KAIU 4M6WA 1NG9A 4EENA 2EEYA 4WTOB 4NB4A 3FCHA 1A76A 3PFOA 3SLCA 3LOUA 3D28A 2OFGX 2E2QA 1KBUA 4WXOA 3TR8A 3OSNA 2DTUA 2UV8G 2QARB 3KYLA 3ZSYA 4AF1A 4UB3A 2NLWA 5CHIA 2OPQB 4NMLA 3BQ0A 3M2UA 3W7BA 3A0BU 4K4ZA 3SJJA 4DCOB 2LDYA 4QU7A 3FRZA 2O4GA 2IAJA 2DBYA 4FZNA 4NLSA 4CZIA 3EO3A 1ZBFA 2UU9F 1NZAA 4CP5A 1HJPA 3RUBL 4QYZJ 5D4LA 1X4EA 4FNIA 1DXSA 2EAOA 2VUGA 2WBNA 1N5YA 1KKHA 3UXOA 1S9EB 5LMNJ 2P6TA 2YHXA 2GHWA 4M5KA 5F8MA 4PUOA 3WKDA 7ICOA 1IJFB 1IKYB 1XNQK 3UD4P 2PFNA 4RZRA 3LDAA 3CRXA 1WEZA 5GADI 4CK2A 4FWOA 2A3VA 1ZQGA 4BR0A 3M05A 4AQYF 1UWBA 4RQ1A 3AVGA 2JZBB 5FLXU 1H2TZ 2QWLA 3VC8A 1NZBA 1IR0A 2D1KA 5ALUA 5C2DA 5KFCA 2CDQA 4KRWA 2WVEA 1NGIA 4IDHA 3NNAA 4FVUA 1N5VA 4BC3A 1JN3A 3CD5A 2UZAA 3PHTA 4DB3A 3BBFA 1Q0NA 3K5OA 2W1BA 3I1YA 3MGJA 3U1MA 3MN7A 3M6WA 2WB1F 5CYJA 4EFAC 2FD2A 2ZKTA 3VPZA 2VFUA 1Q18A 3HVTB 9ATCB 4QR1A 4Z4IA 4OGCA 3TZYA 4HYKA 2KZZA 2ZTEA 1ZQIA 2HG4A 4NLGA 4KI6A 1SIZA 4M63A 3WKCA 3OFHA 4RW6B 1F5CA 3Q22A 2LMRA 2WB1C 3NASA 1MROB 3C1YA 4C4TA 3MPYA 3TAMA 4J2AA 4L74A 2ZUAA 1GLDG 3CXCM 1X4GA 3ZT1A 3T5KA 4FJHA 4CJQA 1DLOA 3SUOA 2JFKA 2WAQD 2ZH4A 2CKWA 1GLFO 1GX6A 2UVWA 4NWBA 4CD1A 4TKTA 1IKXB 2QB0A 1DARA 4MIAA 5E41A 2CPFA 4KFBB 1S1TA 4M5NA 2MQLA 3NGZA 3ZSQA 2AYMA 4Z94A 1PC5A 4YCXA 1IBLJ 3BREA 2KVCA 2UUTA 5IIIA 3V5RA 5GMEA 5DDYA 2W43A 2G8KA 3I5AA 3NMUA 3QICA 4IDKB 3WQUA 2FJBB 1BUXA 5E79U 3H0LB 1W7AA 2BPGA 3VAJA 2DO0A 1KN5A 4PH5A 4KX3A 2ZVIA 2HQCA 4NXMK 2D4WA 1KC8O 3HDSA 1EWRA 4KHYA 3BEXA 5JICA 1W25A 4MT1A 2Y0SF 5AXKA 1JJ4A 2CQ0A 5D6GA 1H72C 1MLAA 1VSFA 3JPPA 3ZEUA 2W3RA 1HHTP 3TSUA 3T1HK 1NSPA 4GVEA 1V9PA 1MQ3A 1JX4A 3FVYA 2C3MA 3RU0A 4HDHA 1IWGA 1E4FT 3CJBA 1UCVA 3A1YG 2Y0SC 4RO0A 3ZT3A 3JPRA 1IG9A 4MKYA 5EWFA 2HHWA 1DOQA 4UTGA 3ID8A 4O3NA 3I31A 2HLUA 2K89A 2YNHB 1PUZA 2W4PA 3EMTA 2R7OA 4GMJB 5ALWA 3THWA 4CO4A 4FM2A 5EE9A 2OD4A 4WU2A 4ACOA 3RBDA 4ILJA 3ITHA 4K4GA 3EZUA 4O5KA 2KEYA 3F56A 4G1IA 3DXMA 2KRBA 1CS4B 2CRLA 3NTUA 5J0SA 7AT1B 5IM0A 4Z4EA 4H4KC 2CN1A 3SFGA 8ICBA 3W5XA 3WK8A 3NS1A 3KHHA 1KCFA 1HIYA 2I1RA 2ROPA 3BS9A 3QFHA 5DDMA 4PHAA 3WU2U 2BKPA 4WFYA 5KFMA 3MK6A 2B4JA 5K8MA 5M1OA 2P9GA 4PXEA 1UOCA 3M5RA 4ZVRB 3MR6A 3W1YC 1ZS6A 4AXJA 4YHHF 2HK2A 3VAFA 4M1KA 5AICA 4IRDA 4I2DA 2Y1JA 1KLMB 1TL7A 2HZCA 4C6AA 4FF3A 1X6JA 4UB6U 2D9OA 4V19X 1YIJN 2H51B 2DT9A 2P9SB 2D3DA 5FJ4A 1AA1B 3JYTA 2OWOA 2DHAA 1Z19A 5IT9Y 3ATVA 3LM2A 4OPHA 4YG2A 2KJ9A 3K75D 3ZX0A 1UZDA 2NSCA 4I7FB 4AL7A 3VGTA 4R63A 2WW4A 2K7JA 3HT3A 2P66A 7ICKA 3KLFA 3A8IA 4YD1A 5IIJA 2H65B 3V9ZA 1WSHA 1GO3F 2ZZMA 4WCEQ 2JWKA 2M9NA 4F5RA 1S79A 3QSIA 3ENOA 2C2MB 2E2PA 1RXVA 4L6V3 1HWKA 3BR8A 1TKDA 3RB3A 4Z4HA 2K4EA 4AL6A 3TAPA 4RNMA 1CXUA 3FDSA 5CD4A 4RWTA 4HVZA 1EJ7L 1CZAN 4IQWA 3AVLA 2W8KA 1T03B 3CCSN 2LSNA 1N48A 2AHOB 1YGYA 4J9UE 2JZ5A 2Z7JA 5KFFA 4JKEA 2QI2A 3DWLA 4NXNK 4YQWA 4O44A 4C80A 3QU5A 2G8VA 3ULEB 3HOSA 3EZWA 3DRPB 2NUBA 2FJDB 2KN4A 1T02A 1WG1A 1J6ZA 2QTWA 4Y2PA 2M3DA 2V4QA 3G6EN 5LXYA 4KLEA 2GEMA 5B0FA 1FFWB 5JVGL 5DG9A 2Z2ZA 4HACA 4OLAA 4UUWA 3NDKA 2HQ3A 1UJ6A 3PSPA 3UPFA 2ZOGA 5C25B 4Y2MA 2DGOA 4YMNA 4JI4J 1EB0A 1CJKB 3KWMA 2W7PA 1BA0A 2NRVA 4ECTA 2GWKA 3UKUA 3OJSA 3KK7A 2OPRA 4JB8B 5HRPA 1Q4RA 1BQMB 3M6ZA 1P1TA 3EPGA 2HNYB 5AI0A 4X65K 2ZWPA 3QT6A 5H9EJ 1XNQF 1TQLA 4CO1A 2UXDK 3OD2A 4I56A 5HQMA 4PGQA 2PBDA 4R64A 3DOLA 3JQJA 3G25A 3FC9A 3JS6A 4ES1A 1M5PC 3RW7A 5J0WA 2BM0A 4R0EA 2QL7B 1WEYA 4TY8B 2QXFA 1SVDA 3D0IE 3ZCMA 2QN6B 1TYQA 2XMVA 3M8RA 1ZOLA 2XSJB 4LF4K 3HVAA 2QLFB 4NCGA 4KB1A 2YMPA 2XO7A 2Y1LB 4BG9A 1UVNA 3UI3A 4RG8A 5J2DA 2CZVC 2XM3A 3FEZA 2K8CB 2WVDA 4GXJA 1VISA 2H4YB 4G9ZA 1RB0A 5E3PA 1FNOA 4CHPA 1F0MA 4ENOA 3M1VB 2IHR1 1RA6A 2E3TA 4ECSA 5ETKA 4JEPA 2RRBA 2R8GA 4IOAL 1FT8A 1RT3A 4J03A 1JJ2R 3SV4A 9ICBA 1KHWA 4KR0B 5IQ6A 2KJ5A 1IKWA 1GOCA 9ICUA 4LF7K 1IQTA 4PWDB 1ZXOA 5KFZA 1BL3A 4CJRA 2HWTA 3THTA 2RT3A 1MWKA 5C7PA 3M6VA 1RAIB 2XLJA 2FVCA 2DRDA 1WC5A 3HHLD 1IIPA 2GX8A 1HLUA 4DBQA 4DTUA 2G5IB 3C2MA 3QE9Y 4NI2A 1AYEA 5AI5A 1YUWA 1YJNS 4I2PB 2NXNA 3KK3B 4ELVA 3VVTA 2E88A 4UOCA 1FX4A 2MQOA 2OPSB 3DOKA 2VICA 3A8EA 2FF3B 4CZFA 4JD2B 4H0TB 4MH8A 1E6VA 1UFWA 4ZVPB 4BR7A 4GKJJ 4DTJA 1I94K 2XMTA 1VQ6N 1QHAA 1DK3A 3PRDA 2WAQF 4CLPA 4KH4A 3W2VA 4DUYK 4F3TA 2XICA 5LJ3Y 4A2BA 2WFAA 1ASWA 1ZZNA 4KO0A 1ITGA 3FJ2A 2HAIA 1KVKA 1R8HA 3CJKA 5C12A 3AM9A 3QGIA 1C1CA 5AQWA 2MZTA 3QU9A 4IFVA 4NXMF 1J2MA 3JPSA 1SC4B 5D4PA 2YX7A 1SS6A 4NRUA 3JXUA 3AU6A 2HFZA 2WAQC 1N32J 3FFIB 1UJ5A 3D0GE 3IFRA 3T1HF 5BRFA 1FRXA 4DU1A 3EDQB 3MGHA 1NK6A 4RJVA 3ZTQA 1KQSM 2DNKA 1Y5LB 2JLGA 2D3OR 5DDOC 4CNQA 3SAGA 2YMMA 1HEKA 4ZPBA 1MMNA 1Q8LA 2QA4S 3VR1A 3VAKA 4PL1A 3NF9A 5KOWA 2DWQA 3D2WA 4E1MA 4F02A 1HNVA 2V69A 1U8WA 1RBRA 3UD5A 3G6YA 2HIYA 1BCMA 3CPEA 5KOXA 4Z6DA 2OO4A 2BDPA 2IA0A 4OIXA 4F5PA 2B6AB 1BA1A 2F3NA 4L72B 2YNFA 3IHQB 5AKJA 4TU7A 4X4QA 4EHTA 1FDAA 4P7VA 2W24A 2DY1A 2O6KA 1CC7A 5BYRA 1Q9XA 2HHPA 4USAA 3BUZB 3POTB 5B0DA 2MPUA 4EX7A 2ZD1A 5ALVA 3GDXA 4CJTA 1YTUA 1NNLA 3OW2M 3UQ0A 2YH0A 2X74A 4NASA 4K42A 2HEKA 4JI8J 1FXXA 2BH1A 3MMCB 4U8YA 4AHVA 3CJ4A 4KREA 2MU2A 1DQ9A 3N4MB 2ZBQA 4OX9J 3M8SA 3WKBA 2L48A 3NH0A 4QZGA 4DR2K 3LP1B 3M2VA 2B9XA 2WC9A 4L3KA 2MDAA 3X3UA 2NRXA 3L5KA 3HO1A 3QNNA 3W2WA 4HH0A 2CPRA 4FP9A 3I55S 5HI7A 3ICXA 2Q3PA 3HHLB 1U6BA 2HVHA 2OYQA 5KT3A 2CNNB 3D1QA 4NLDA 1EXQA 2G8HA 1D8LA 4WFNL 1RKIA 1Z1VA 2N1RA 3VQAA 2RE2A 4NM2A 2A2CA 2FTRA 1ASUA 2KKPA 2AIRB 1VQ4S 3GJSB 1SXLA 2OKQA 3BYRA 4U7UK 1FRHA 4I2EA 2XIDA 4IS7A 5T7LB 3CD6S 3HK2A 1RTDB 3T5HA 5IIOA 3B6PA 5HP1B 2PFPA 4M7YA 4LD0A 2BANA 5F0UA 4BRMA 1RT1B 2O8CA 4M41A 2JEJA 3KZBA 4NLZA 2RN2A 1B0XA 3WNGA 1KAYA 1IBCB 5ADZA 4JOUA 4I2JA 1RTHA 2DXDA 4YB1P 2D0BA 2UUBK 4RNNA 3NGIA 1T3VA 2PSZA 4B17A 1LXJA 4RQ0A 1OO0B 3VEYA 1RE1B 2WF5A 2WONA 3FAHA 2D41A 3HVWA 2BCVA 4NYNA 2NXEA 1YXQA 3S8SA 5AQSA 4J91A 3JPQA 3AJ2A 3IP4B 2YKMA 2J7WA 3RR7A 3H98A 4A48A 2VQEJ 1HMVA 4ECRA 1DTTB 4GY2B 4JB3A 1LW2B 2DKOB 4N76A 1JUDA 5F8LA 1S0NA 9ICRA 2WRMA 2W54A 4BGBA 1VCTA 4OJ3A 5IT9O 5LMNK 1TVRA 4YOYA 4YOXA 4NXNF 1L6NA 4KPCA 2JNJA 3E01A 2HVZA 4QZHA 2KRRA 2RUGA 4NY8A 4S0MA 1M5VC 4A8SA 3L3CA 2G08A 1NDLA 4HDGA 2HNDA 2YNIA 1IR1A 1F44A 3J7Z5 3MR3A 3IXQA 1XQSC 3M6KA 5CP2A 2EHGA 4DPXA 4OZ5A 2PIIA 4DTNA 2GVDB 1CBKA 3O4QA 2YWWA 5LJVA 3WQPA 3KKFA 2VB6A 2Z0GA 4U96A 2X3GA 2ILZA 1QY7A 1LK5A 1RWPB 1TUVA 3O3LA 4OHVA 5HMZA 1JLEA 3VQQA 1YZ7A 1UZHA 4PHTX 4CHYA 3Q8QB 1YT3A 4DV7K 2DNMA 1F5BA 1OY8A 2VGMA 3EGNA 4AHRA 4AT1B 3LP2B 2ZNZA 5F8GA 1C0FA 2UXDF 1LKYA 3HZGA 4BC4A 1W26A 2RAQA 2D1CA 2XZTB 4C8OA 4P0PB 5IWAF 2MLYA 1EAYC 4EZ6A 4CGGA 2FSJA 4FZZA 5ADXA 4L3NA 3UVJA 3TAGA 4XPEA 1NGBA 1O13A 4LF4F 1N33J 1D9DA 1IJJA 4CJFA 4DFPA 2CJQA 1CULA 1YITS 4FLUA 2VBZA 4DQQA 1HFEL 4J9OA 1I39A 5A76A 4IRCA 4QOTA 3P8BB 2DL0A 4M0AA 4H4OB 2HHHK 5DJBA 5K8PA 3HPGA 3GP9A 4OPJA 4K4YA 3DLKA 3HSGA 2DRAA 4DOCA 1KQFB 1TKXB 2PA3A 3IDHA 4CZGA 1XO0A 2MY8A 1JLQA 4LF7F 3PYFA 3QT8A 4I2IA 2CQ1A 3GTYX 3LP0B 3C46A 3HSTB 3I0SA 3H8JA 3C6AA 2A1SA 4U6PA 2YV0X 4Z4GA 4WP8A 3SQGB 3M1YA 3ZSRA 1TL1A 2K7KA 3WXMB 4FM1A 3K5PA 1EX4A 2YWEA 1WC1A 4WP9A 2CH6A 4FLTA 2BV3A 9ICEA 2P9PA 4ZVQB 6FD1A 2IOFK 3H8SA 2IMWP 4JMUA 1IN0A 1B0VA 4GFJA 1RDWX 3PYGA 4ANEA 3KVGA 4C3LA 3DDNA 4YMOA 1SKUB 1DRGA 4CHQA 4TURA 1RT7B 4M9GA 3SFUA 3E8OA 1N36J 4X4PA 1CJUA 4NA2A 1F2GA 1VRUA 3KJNB 3FBFA 2GQQA 1K73T 1I94F 3I28A 4DUYF 1TKZA 3E51A 2R2UA 5E26A 1ZQLA 4F5QA 4CHZA 3D1HA 1IXKA 3HHLC 1YVUA 1ZQKA 3Q8SB 2AQ4A 2XSFA 2J9EA 3MECB 3UWTA 3L4IA 1RT4B 3K1RB 1U09A 4NLNA 2YPYA 1IR2A 4C7YA 1TZ0A 1SC1B 3ET6B 3BEGB 1U9LA 2UXCF 1MU2A 1T9UA 3SQIA 2D8CA 3BV8A 3L95X 2ZH9A 4KLUA 2Y1RI 3VEXA 1YDLA 2GC8A 4YP3A 3JPTA 2CJYB 4DXLA 1QVGR 1S9GB 4MK8A 3ZTPA 4GV6A 4HT7A 3M3ZA 1X5SA 4UARA 4ZVTB 1AROP 5AM4A 4I1TA 5DQIA 1NAQA 2D6FC 2J0WA 2VFVA 5AZIB 2C3YA 3H1QA 2KG5A 2DR5A 3DRSA 4BC9A 3GONA 4AYBD 2BE9B 4HTIA 2Z1GA 4IO1A 2HBZB 1D9FA 1Y00A 1P90A 2GO8A 2VKZG 5D4BA 5ETRA 3K7RA 4WK1A 1U0HA 3PTWA 4CEZA 4F04B 2WK4A 3KLHA 2X1GA 3O3HA 3MN6A 4JN4A 1FKPA 3VA3A 2QL5B 3EX7B 4JI1J 4LC9B 3J81j 2VA3A 3VEWA 4BE2A 1S6QB 2QWOA 1N2XA 3PIPQ 2K4HA 2FGCA 3OYHA 1NK0A 1K8AO 4XIUA 2KG0A 2ZIWA 4C0HA 3ZETB 3NGKA 2NPIA 3CCTA 3T79A 3A4TA 2FXUA 3V1QA 5HVFA 5LOQA 4DR2F 5HK4A 2M8HA 5F8HA 4AHUA 2VF3A 3NH2A 2FC8A 2JEIA 1NNEA 3I4HX 4KMUA 1BG3A 4B08A 2OEMA 1SUQA 2PC6A 3CCRS 2XC9A 4C4WA 4DFKA 1WORA 4ZP7A 4ED4A 4F67A 2KLAA 1TFWA 4PL2A 4LUBA 4A8WA 4J2DA 3HKZD 1DTQA 1D3WA 2E7VA 1FTRA 4Q2LA 2BQRA 1ZPWX 4PWWA 5LMUJ 2KI2A 3DKDA 2YQ1A 3MM6A 2E8NA 1NO8A 3KNGA 4P74A 3CDAA 2WB4A 4IOBA 2DHSA 4X62K 5C2CA 1NOMA 4FK4A 2OZSA 1WBBA 4KHPF 5J0PA 4IC9A 3ASMA 3L2WA 5GAGP 4LF6J 1Y97A 2OIHA 2UUBF 3CCJN 4K4IA 2HWIA 3QT7A 4JK9A 2CPEA 4P6QA 2KO1A 3D6MB 5ALKA 3QIOA 3W5YA 1S1XB 4KN7A 5J1EA 3NCIA 1WCLA 5CY4A 1RT2A 3R5DA 1AB8A 1XJWB 1N5QA 3EL2A 3W66A 7ICHA 2BMBA 1PYOB 2UVUA 1VSEA 2Z8QA 4EIAA 5KFRA 1HQUB 2AKWB 2YTCA 3CMEN 2V94A 4ZVHA 1TKTB 1RABB 2MTLA 2DXFA 3QRRA 4CF8A 3O3GA 4US8A 3RMAA 3FCWA 1X9JA 4QR2A 1PZNA 2C3PA 3TUIC 3AD8C 3TAFA 3J80Y 4JUZA 4Y2AA 3O5TB 2ZVSA 1NOZA 3CC4N 2HMXA 2BRKA 1S59A 2D0CA 2HBQB 4GRSA 4URQU 1PGZA 4LF5K 3EVWA 2XMKA 1UWBB 2QW9A 4H5RA 4FJNA 4OZ0A 5CR0A 3OL8A 4C8MA 5HRRA 2OSRA 5ETTA 3RAXA 1SPBP 4UY85 3KUGA 2BZ2A 3NY0A 4DZ6A 3WNFA 1RPLA 2W40A 1D8BA 3CQYA 4HTLA 2GGPA 4IQXA 1SV0A 5L1LA 2KN7A 3I33A 1YRTA 3DU5A 4DV0F 5M1FA 3THYB 3D9BA 3QZ7A 2B6GA 2V2ZA 2WFBA 2HMIA 4PEOA 3QESA 5K4LA 1YJTA 1HQEB 2NUUG 4DV7F 2H3GX 3HHDA 3FSIA 4U7CA 4DR3K 3QUTA 3CWJA 4Y0FA 4BX9C 4CF0A 1DKGD 1S12A 4H0XB 4Z2XA 5IILA 5J2HA 5CHGA 3W65A 2N4CA 2ZJPQ 3AEVA 1WOOA 3CJAA 3CTRA 1HNWK 2RP5A 1WSRA 4ZVOB 2QE5A 4F2SA 2KB2A 4UOGA 2UUAF 1TV6B 1MC8A 4ERDA 2WF6A 3ZD9A 3H8MA 1NOYA 3GL1A 3NNCA 1R6YA 4LQ3A 3ZSWA 1DLOB 4UY8T 4BQLA 4UBBA 5ALRA 1H7XA 3NNHA 2AP6A 4MDAA 4DF4A 4ZP6A 5FP0A 4CJWA 3OR1A 1T3OA 4WE1A 4IBNA 3DN9A 1X3NA 4HWIA 1XO1A 2ATLA 3D66A 2F3JA 2KHCA 4E7JA 3H0MB 1Z00B 3SJHA 3TAEA 3EYZA 2HHHF 2Q4TA 1NXIA 3UFCX 2E6MA 2FUG9 4Z6EA 2ZH5A 3LO3A 4RWWA 4GKJK 4JLHA 3I0RA 4NLUA 2B3TB 3F53A 5IIKA 1NK7A 4M5GA 4KLHA 3SD7A 5DGAA 3GJTB 2DY9A 1OW5A 3M8YA 4UF4A 1XSNA 2E20A 2VPWB 3F0NA 9ICOA 1KAXA 3N6LA 3QIDA 1T94A 4BWJA 5D78A 3GSDA 2AF6A 3NVWA 1XS9D 1ZTWA 2O8DA 4I9LA 1X0PA 4KN4A 4NO7A 4P7TA 2KICA 2ZIXA 5KFNA 2JH3A 1PYTA 4RBVA 1VRTB 4DS4A 4M3WA 4DUZF 3KK2A 1RK8A 2KFYA 4B9NA 1ZBTA 3QMLA 2JVRA 4X66K 4E19A 1LQ9A 4JV2A 1FNXH 3OVBA 3DYAA 4LRAA 3RB4A 9RUBA 4MLHA 2VANA 3EE3A 3UQ2A 4IG3B 2ZH7A 2YB4A 1K8KA 1Z6RA 4IQVA 5J0QA 1VQ7S 1COOA 2WOMA 1VDHA 2UP1A 4FN5A 1LW0B 3SMPA 1C4AA 3OXGA 2LXUA 2P9CA 2L08A 5CCMA 3ZXWA 4JV1A 1F3FA 4KKOA 3D6RA 3I55N 4X2BA 2Z2YB 1HI8A 3KWGA 4IQUA 4OD0A 3A3PB 4CYUA 2ES6A 3PX0A 1FKOA 4Z37A 2F8KA 4IOCQ 2G0JA 4Y2TA 5ALDA 1BPBA 5DETA 4RW8B 5AJ3J 1WNEA 3SSQA 1UFLA 2PFOA 3N7PD 1SB3C 1F21A 2VL1A 3KHGA 3IBWA 3SIPB 3U3GA 4RQ3A 3F2CA 3R2DJ 4F7VA 7ICEA 4MN4C 3O6WA 1HKCA 1U0SA 1N34K 3CMQA 2VBXA 1RYSA 3SENA 4NEYA 8ICKA 5T14A 3CCQS 3H7IA 4TUPA 7ICQA 2DNLA 2RILA 3GLJA 3HRGA 2E5GA 3THXA 4DN0A 5B09A 4OX9K 4OYPA 4KBIA 5HP4A 2LVWA 3OVSA 4N5SA 4DSFA 1ZD3A 3SQ2A 5AE2A 1G4CA 1NHUA 2I38A 1H2UX 2ZBRA 1FRJA 3CT9A 5ETNA 1ZRNA 3TEHB 2VBYA 4BE0A 3GV8B 4CM2A 3AVAA 3FR0A 4F9OA 1U02A 4ZN1A 5D3GB 5DG7A 1NK9A 1S99A 3R6MA 4KGMA 5F3XB 4UASA 3H4BA 2FBVA 3S3NA 3IV6A 1S1VA 2ZC3A 2H54B 1SBRA 2VKRA 3ILIA 4PKDB 1VQNN 4CVNE 3P5JA 3SCXA 2E9RX 2CH5A 2QWNA 1L3VA 2FLPA 4AYBF 2IDEA 2I0XA 3U1LA 1YJ9N 3UCZP 2A40A 3TZXA 3GBTA 4E7LA 1ZQFA 2UVRA 1SKSA 3TX8A 1WAJA 4MKVA 1Q46A 4JI7F 1FIQA 1XMQK 1NGJA 3M8QB 3FCVA 4JHDA 1RQ0A 3QGPA 5D8HB 1OH5A 3QJPA 1ZQBA 5EOYA 4AYBC 3N4WA 3O4WA 3O9SA 4M5DB 2KG1A 1YJWS 1NGFA 1ZYQA 3IMXA 1AUDA 3MDCA 7ICRA 3FQKA 5DZ7A 3RBZA 2GQ2A 3JSYA 1D5AA 2LQ9A 2ZJ8A 3VETA 3NGSA 1D4XA 1X9MA 2VPZB 4CK3A 4FXDA 4CLSA 1ZQQA 3QWPA 4K4VA 2B4OA 1FJ7A 1S1WB 4LF8K 4C0BA 4O44B 3VGVA 2VA2A 2LYBA 5J1NA 4KT0C 4JWMA 5IC4B 2G8UA 2W4DA 2P9LA 3OSPA 2QYCA 2CGJA 2BCQA 5A8RB 4A57A 4J9PA 1MQ2A 3MMAA 4X62F 4DU8A 3GFYA 4BRIA 4WIQA 1L7MA 2OZMA 2SXLA 3HKZF 1UPHA 1SXDA 1IM6A 4K0KK 2GUPA 1M1HA 4JI3F 3KG1A 4NLPA 1FA0A 3MR2A 3B6OA 2XWXA 5D77A 4IQTA 2P9KB 4CGIA 3IRWP 5ALSA 1KQSR 3H4DA 2A0FB 5GAEI 1XC9A 3DRRA 2QMXA 4P2XA 4QAGA 5CH7B 3HKZC 5GADP 4X64J 3V4MA 2HOFA 3CJQA 3BZQA 2YBVA 1QDUB 1FXRA 5LSOA 3OBWA 4JV0A 1RCOB 4Y1CA 1B9FA 3QEXA 4DR5K 2W25A 3CEDA 1SJ4P 3P4IA 1WG8A 2HOQA 4Y28C 2QMWA 4TU9A 3C16B 1WKKA 4JAXA 3G8TA 1X9WA 4RW4B 3CNQP 3ENQA 4LF5F 3N9UC 2E66A 5C2FA 4BXOA 1K9MT 3GIMA 2GAHC 3SAFA 1UCNA 2ROEA 5A6PA 5EE0A 4C98A 4DV3J 2Z2LA 1KVAA 5CR4A 9ICTA 3AO5A 1LKZA 1H1VA 4CEAA 1FJGJ 4FCYA 3K2PA 1NH7A 2RSQA 1OY6A 4LZDA 3TOQA 4WFXA 4CI0B 4DV1F 5DM7L 1DAXA 1NWKA 4FKXA 3H5YA 4YMMA 4IG0A 2O8BB 3MEDA 4OJRA 1RT3B 2RS2A 1JLBB 1RCHA 4DR3F 5ALYA 3EN9A 1SWWA 5HANA 4YY3J 5AXMA 4DHYA 1LWEA 5AQYA 1W97L 3J80O 2BQUA 1HNWF 4UB8U 1YBTA 1ZAVA 4P71A 4DL2A 2HQDA 2MKJA 5J2NA 4AUKA 4OPAA 2NUHA 3N79A 5GAHI 1VQ9S 2LYAA 1JMTA 3QQCD 1RSCA 3GJRB 4H4KA 2ZM6J 4BRFA 3PKMA 4OZNA 3WIVA 4WF9Q 5JVGQ 3BKFA 5LT5A 2HGNA 1KDNA 1XNRK 3IAM9 1BLUA 4E3SA 2OHFA 2XI2A 4NLCA 3W64A 2UV8A 3CG7A 2GX9A 3CM5A 3U4LA 3HOTA 1RHRB 1E6VB 3JQMA 4KRFA 2IC3B 5KFYA 1B92A 3JPNA 2XQCA 1BMQB 2QARA 4CLKA 4KPYA 4PQUA 2CGKA 2OPQA 3IN5A 3ETMA 1V4SA 2N3OA 4KO0B 1MN9A 4M9JA 2J9CA 3CD0A 4DL6A 1WTBA 3L2QA 4I28A 4U95A 1CJTB 2LYHA 1XSPA 1RNHA 2OUGA 4J2BA 3UN5A 1X60A 2UU9J 2G0IA 4FDFA 2RU3A 2P51A 3Q8PB 7ICFA 3WNEA 2KHOA 3O9UA 3SQ0A 4ER8A 4CLWA 3C2KA 3KOOA 4FZLA 3RRKA 1LOUA 2ASPA 3V72A 2B4VA 4I9QA 4US9A 9ICXA 2ZOMA 1S9EA 3MD3A 4B8CA 4EYHB 3EJMA 1G6BA 5DDRC 3OTEA 5KAFU 2O1PA 1HI0P 4X66F 1IKYA 4H8KA 4DQSA 4DU3A 3VQEA 4DCPB 1B4SA 3CJTA 2R7TA 1ZJMA 3IWLA 4AQYJ 1BWFO 4FO6A 2JZBA 2PI4A 4K41A 4DX8H 1RDBA 3HKWA 3ZZPA 5KFEA 3CDWA 4UOHA 2KP7A 2DNHA 4D3HA 1QQCA 5IS2A 2DKXA 4IOAQ 2CZ9A 4ZJLA 2KHQA 3WNHA 1VLBA 1RU2A 3O44A 2RRAA 5G0RB 1RAFB 3TU5A 3R9KA 1S7IA 5FLXO 2CPDA 3ZZRA 3DLBA 7ICMA 3CJ3A 5BR8K 4DPYA 1IBKK 3UW1A 3C2PA 1JQGA 1KEKA 1U1PA 4HHUA 4B1WB 1AT1B 2EQYA 3HHEA 3IGNA 1N34F 3EXCX 3DOMA 3HVTA 4O5EA 3LDPA 3RFAA 4C1NI 1JCFA 1QSYA 4DS5A 1RZMA 4OX9F 4JKCA 3LALA 2P6SA 1IWAA 4USKA 3LPEA 3M2VB 3MWBA 4JKDA 3W2WB 2C2DA 1MROA 2XS5A 2R7VA 3SMZA 1O1WA 3CJCA 2PMZF 3ZTOA 3OJUA 2CXEA 1T9VA 2M5YA 4IXCA 5G5GA 3QMQA 4F3QA 1C0GA 3S9HA 1G2EA 1IKXA 3HI9A 1XU4A 4XDDA 3KWIA 2YKAA 3WBZA 4Y2SA 4KFBA 2XMAA 2XB2D 1RBSA 3VVUA 3GFZA 1X8DA 2PMZC 4I2QB 1XHZA 3VQ7A 1O5JA 5AXNA 2BANB 3HXMA 1SKRA 3MPWA 2IDOA 1LFPA 2CG8A 2E8AA 5K9FA 1DY3A 3MBYA 4IDKA 3OBIA 4ZN3A 2YXLA 3NOGA 5IC6B 6FDRA 5ETVA 2LEAA 1XMQF 3AT1B 3BQTA 4KLIA 1TR0A 2CNLB 2WONB 5CYMB 3QAUA 1SKWA 5IT9U 1HWJA 5KFSA 1MWYA 2EZZA 1JNRB 2P8IA 1KL9A 1HMVB 3MAQA 1VR6A 2EVZA 5G5HA 2VOPA 1JRPA 4CIFA 4CIOA 5CABA 4CZHA 1DHMA 1GX5A 4FXVA 1B64A 4LF8F 3E01B 4ED7A 3V4IA 2PMWA 4OI1A 4FYWB 5C42B 2NS1B 1KQKA 4FS2A 1XEZA 2KKHA 1G1XA 3TA2A 2YX4A 1SAZA 5KI6A 2YNHA 3ZTRA 4CEOA 4AH9A 3PYDA 4C8ZA 3AOCA 1R43A 5HMYA 1KAZA 4LRBA 5EGYA 2U1AA 1O51A 1UJ4A 4NLWA 2ILYA 2IRXA 5DB7A 4YOUA 3KMQA 4CF5A 2GO9A 1CXQA 4K0KF 4FWNA 1CS4A 3QWUA 1N88A 3RJFA 4ZCLA 4ECZA 3NFAA 4LT6A 5CAAA 2XWYA 2F65A 2PO4A 2MA1A 4MAKA 4G1QB 4Y2CA 5KL8B 1C4CA 4OYXA 1T6CA 4FO0A 3SPZA 2OMLA 2F8HA 4KHUA 3LVVA 2HKEA 3TZWA 1AFJA 4J90A 3BKTA 4J8FA 3H2VE 4EBDA 2YH1A 2J0QD 3FSXA 3PX4A 1UA1A 5KG5A 4ZJQA 4PY5A 4YHHJ 1HWIA 2WF7A 3V1RA 4PG7A 5KFHA 4KC5A 4GO5X 2AXTU 3N0VA 2Y9UA 1LKYB 3CQ8A 1KLMA 2JH7A 3BQ1A 3BDEA 2IYGA 2VDHA 7FD1A 1FCAA 4DR5F 3WX8A 5J2MB 1HR0K 1VYAA 1YRUA 2GHPA 2P9SA 3AARA 4CE6A 4LVOP 1XR5A 3SMSA 1RCXB 2V67A 1RT6B 1VQSA 4BRLA 4OVLA 3AD7C 1NSAA 2Q1NA 1U1OA 3AVJA 3AAQA 1U6ZA 2VWBA 4I7FA 4KGKA 4NL5A 3R9LA 4IH6A 1X4AA 2YKQA 5CE3A 2LBOA 2EBGA 3WXJA 4F2RA 2V2KA 1GXTA 3RJKA 2CWKA 4LFAK 4RQ8A 3QERA 3BS5B 4CEQA 5CD4H 3OV7A 1BGXT 3GIKA 4N8OA 1ITPA 4CBUA 3VA0A 3ZNJ1 3ZZTA 4ATNA 5AKIA 2B4UA 1F9HA 2LECA 1T95A 2HBRB 1RWOB 2PFFB 5J2QA 1VQOS 1JLQB 5K5MA 2OEKA 1VQLS 1NKBA 4ID5B 2GFFA 1T9WA 2F96A 3AJ1A 3SEIA 3IFEA 1TAMA 4P73A 1WLJA 2QWMA 1T03A 4DR6K 4CDIA 1N5XA 2DPIA 1Q5VA 2QKKA 4OKEA 5I4MA 2P9PB 3C66A 3C28A 2D69A 3NGUA 2B8PA 1IV0A 2FVRA 1S5LU 1XNRF 3CFRA 1U45A 4B6JA 1WKJA 3ULEA 4BQZA 3G6XA 3SZ2A 3DRPA 2FPHX 4B3RK 2V2VA 2IRYA 4OZ3A 3AAWB 3RB0A 2PDAA 3J81Y 3EE9A 4ZCMA 4F4WA 5HBMB 3FBBA 2RQMA 8ICEA 2XHWA 4E0DA 5DBAA 3R5BA 4PZOA 1VQ8S 2MKSA 5FPDA 3DM2B 3CCMN 3E2EA 3I56S 1K47A 1W2IA 5C25A 2EFVA 5KFQA 4H03B 3VESA 2QEXN 4H5NA 1PILA 1HJRA 1HWUA 3J7YI 2YVSA 2E44A 3VENA 1CJKA 2RS8A 4B3MF 3VV2B 2F9DA 5AJ3K 4ZTFA 3D6FB 3PG9A 4ZDNA 2UUCF 3G96A 1BQMA 3QETA 5F2RA 2HNYA 1RBVA 3OLBA 3R2CJ 5AQQA 1Q9YA 2AWZA 3OYCA 2BTFA 2BPCA 1XNQJ 2JXJA 1K1SA 2E1RA 1MMLA 3CYMA 3NVZA 3U9ZA 3QLHB 4WJBA 3VQ5A 2KFNA 2I5JB 5HL7Q 1TELA 2IVYA 4NZ6A 4HEA9 2JSXA 3GYNA 3G0ZA 4KLSA 4HCBA 3IM9A 1I3AA 2CNOB 4TY8A 1GEHA 1ZA2B 1YJWN 1UKUA 3H59A 3IRUA 4J7CA 2XSJA 3AL0B 1FNMA 1RLDA 2G06A 3L2VA 8ICAA 2BM1A 2YQ3A 3HM8A 3L8BA 3VGUA 2ZJQL 1TAUA 5I3UB 9ICQA 2EH9A 1UEUA 2HYIB 4C3KA 2Y9HA 3TI0A 2M8DB 1OWXA 2DEJA 3BO2A 1FKPB 1MA7A 2R7WA 2BJ3A 5BR8F 1GOBA 2V7YA 4WXWA 4DTSA 1IBKF 5J2AA 3M1VA 5HVHA 3WC2A 4LRDA 4NZ0A 1HI1A 4QIGA 5AKZA 4FZYA 3W3SA 1N54B 4E2FB 1NM2A 3C23A 4JRQA 1KQQA 2HRTA 5J0RA 2P9NA 2M0GB 4FLVA 4KJIA 4PWDA 1H2VZ 1OJ4A 2PXIA 1QUPA 4I4BA 4ILLA 3TTCA 4CZKA 2KYZA 4NA1A 4OJOA 1V9OA 1YF5L 4Y2XA 2CQGA 4NM1A 2BACA 4DCCA 2AD9A 3TJAA 2R18A 3E1YA 1U24A 1SUQB 3CCUS 3PR5B 3DHXA 2AYEA 4L3QA 2D0OA 3M32B 4J5OA 3GJQB 4ECXA 1SC6A 2ZJRL 3VF2A 3KK3A 3MR5A 4WQ5C 2ASDA 4QWAA 2DGQA 3S01A 4F91B 4KV8B 4JD2A 2XBPA 2ZWOA 2YB1A 4OQJA 4DJBA 3W9IA 1L7NA 1JCEA 3B4DA 8ICCA 2CXYA 3F5TA 1SQKA 4JKHA 1RISA 2L9NA 1JLGB 2A1RA 4CJPA 4NXMJ 3MD1A 4RBTA 4ILGB 3UN3A 1Q78A 1ACMB 4KTQA 1XR6A 1RT2B 5CZ1A 2EFPA 3W9JA 3UM9A 3OTDA 3K5LA 2ADBA 4BGAA 3T1HJ 2MUTB 3NS5A 2HURA 3TUZC 3QPIA 9ICVA 3WEEB 1OH6A 2HHVA 4HAIA 2LMIA 8AT1B 3THVA 4I2CA 1S3XA 2F4FA 2FYXA 2FJEB 1WG4A 4HKQA 4C8LA 1GTEA 3UDVA 2V8GA 3GV7B 3BKUA 3CJ9A 3VN5A 2QA2A 1BPEA 4G9BA 4JKFA 1U2FA 4RPXA 5JLFA 4TQSA 4E8UA 2ZFHA 4E7KA 1DGKN 2IYIA 5I3PA 2FMPA 5HRNA 3GZ7A 1HX1A 1TL5A 4CZLA 4OHWA 1VQ9N 2QB1A 9ICAA 1IG6A 2B6AA 2DFHA 4MF8A 2RRDA 3S41A 2QA1A 2GS8A 4J37A 2CJKA 5HSPA 1WOQA 2B9EA 1WBDA 5AKGA 3Q83A 1KEJA 2PKEA 5HMLA 3POTA 1GMWD 2F2AB 2ESEA 1X0FA 3ZO7A 3M2RA 1T4GA 4F4ZA 2HMIB 5KRSA 2Y1IA 2XY6A 4Y2KA 2ADCA 4DCHA 1ELOA 8ICLA 3MMCA 8ICPA 3QUCA 4YFKA 4B3OA 3AQEA 1VIXA 5E0OA 3LP1A 5K8OA 4MEXA 5HROB 3FGVA 4FL9A 2A1JB 1HR0F 4FWLA 3F2KA 3BZCA 4RQ2A 3T6BA 2ASMA 2C22A 2Q97A 5ITHA 3DV9A 3HHLA 2W6KA 2ISPA 2YX1A 1Q53A 3ENHA 1SH2A 2BCUA 4DV4K 1S97A 1U7LA 3TW0A 2VHGA 4IO9L 1HNZK 3KHRA 1NM1A 1O03A 3F9KA 3TSPA 5E84A 2ZM6K 2JEFA 1ZM3A 2VDIA 3F5AA 3ZZUA 5HQLA 3KLGB 4WFBL 2KZMA 2CQBA 2G0AA 4ISGA 2LM1A 5DM6L 3E0FA 1W2BM 3HHNB 5HP1A 3N97B 4C9DA 3HSCA 3A5OC 1X31C 4I6AA 4LFAF 1RT1A 3C15A 1TK5A 3RR8A 2KD1A 4DV5K 4OI0A 5F8JA 1SL1A 2CJAA 2YX8A 2E1CA 4OGEA 2BQ3A 5LJWA 1HW8A 2E5IA 2BOPA 5HVGA 1YIJS 2ZIUB 2DB1A 3TZZA 1Y7PA 5CYQB 4TYAA 3DLEB 1Q7YT 1ZQ1C 2XHCA 2O8DB 3C14B 3J7AP 1LW2A 4LF2A 3VQTA 3K9JA 4DR6F 4LJXA 2G09A 2COLA 4ED3A 1VBXA 5ALZA 3C3LA 4CFAA 4M5JA 4NXNJ 3HCXA 2F1HA 1GXLA 5U47A 4OKJA 2AJ4A 5J2PB 3NAHA 4ZKAA 3C6TB 4X4UA 4WFAL 4B3RF 4O3PA 4IKAA 4LSNB 2ASJA 3MPVA 2BE2B 5KT5A 2KK0A 1MWQA 2F7TA 4IZ9A 5M2PA 4P2HA 5DZ6A 2R7YA 5B0AA 3ISBA 1X4CA 3NG8A 3A3OB 1T7PA 3ENAA 1IBMK 3D45A 1Q86T 2ACMA 4CYUB 5AQRA 3V6KA 2GVDA 2QWQA 4DTXA 2HK3A 1N8RO 4YOEA 3VTHA 1WG5A 3LGHA 1E3MA 4A4JA 4P2SA 3ID6A 2DEIA 3CCSS 1ATRA 4CO0A 3D2EA 1H73A 4I2AA 4TN2A 5CZXA 4M3TA 1Q81T 3BF1A 4U9RA 2V52B 4CGDA 3VMFB 4YOTA 2OJ3A 4IH5A 1GFWB 8ICHA 3QB0A 4OHXA 3LP2A 2E8OA 2JGAA 2UXDJ 2ZH2A 4DCJB 5AQJA 4HHHA 4YR0A 4M5HA 4MFAA 3I96A 1R27B 3THXB 4YDXA 4GC7A 1Z05A 5IWAJ 3G6ES 1ZAXA 3LQVA 4P0PA 3GIIA 5C5JA 4CGFA 1RDUA 3K4GA 1YBAA 1LEOA 1ZBHA 2FVQA 4Y3CA 2O3DA 4CDGA 4Y0WA 1A5XA 1NGHA 4GV9A 4J9SA 4LF4J 1HYVA 4KYZA 4PWUA 1R8CA 5CWRA 2QRRA 4FK0A 2F63A 1UVKA 3K57A 2J8AA 2VG6B 3O1BA 2XYGB 4DQRA 5HO4A 2C2KB 2JWLA 3HT0A 1I51B 4H5TA 1TP7A 2A6MA 2Q6CA 4BACA 4F4KA 3F44A 3DHWC 3H3OB 3OTOK 4I2HA 4C8NA 2F7VA 3MM5B 4FM0A 3QGHA 1H74A 2NYIA 4BRNA 4PHPA 4IJNA 5HHHA 1MSWD 3C8YA 2I6XA 4UAYA 2Q43A 3MUMP 1TKXA 5F3TA 5K14B 3G2XA 4BRDA 1YX2A 1BY9A 4RQNA 2JVOA 4NLYA 4LF7J 2YY6A 1PJ6A 3S7RA 1U04A 5GTIU 3FFKB 4EUVA 1UT5A 2CA9A 4QBUA 4O23A 4WYBA 2ZH6A 3ISND 1FJCA 4FWQA 1XTZA 4WFZA 3HRDD 3F9MA 2P6UA 3SQGA 1NLVA 3RMDA 3K8WA 3U26A 2IIRA 5AQVA 1RDAA 4NMXA 2H4WB 3TVZA 1L3KA 4GVMA 5DB6A 4OJ1A 1SV0C 5AI9A 3OYKA 4UUXA 1LV5A 1RT7A 3MAHA 4M94A 1WSFA 4RNFA 3NRBA 3EVOA 2P9LB 2HQGA 2F4VK 1Z25A 3LW5C 2BUNA 3J7AN 2G1HA 3OYDA 1I94J 2Q79A 3MCNA 2V2QA 2KHVA 2F76X 4ILMA 4DUYJ 4EWTA 3OXLA 5HJYA 1QE1B 4OLPA 4MDBA 2QLTA 2DHGA 3CJ8A 5AI8A 1T0TV 1OYDA 2YKNA 3P4UB 1JKHB 1S57A 1TUUA 3MECA 1YJUA 5DLGA 3ZD8A 4TLRA 1AW0A 1JCGA 3OT9A 1LWFA 3VWSA 1S6UA 2UXCJ 5HMXA 2YCHA 4DU7A 3ET6A 2B5JB 5T41A 2ROGA 3V6HA 3O9RA 1S72N 5AM5A 1RHJB 2HZVA 3UKRA 4YUDA 3C65A 1VFJA 3SAHA 5JVHL 2F8LA 1K9MO 2JC1A 1RDCA 4JV5K 1J5EF 1LAVA 3ULHA 3TA1A 2A6AA 4GV3A 3GFHA 1XHXA 2Z30B 1ZQHA 1VQ6S 5M1KA 3HD1A 3HBTA 1PC4A 2AMCB 4ID8A 5AZIA 3ZT0A 4DR1K 5A2QY 2PMHA 2ZUCA 2X3DA 3VGSA 2HHTA 4LIWA 4OPKA 3B8AX 3AVKA 3ILLA 2ZQBA 1GK8A 2P5GA 1REVA 1QHTA 4FZVA 1IKVB 2QJ3A 5M2RA 1NK5A 1VSIA 3PJWA 4CM0A 2W11A 5CZVA 1B9DA 3LGMA 4QWBA 3QBXA 1DJ0A 3J80U 1V3RA 1Q79A 2K8AA 5EX3A 5KQ8A 4MYTA 3NRWA 2W7AA 2HSEB 4WBFA 3ZETA 3PO5A 1VQ8N 2EC0A 2BCRA 4I6YA 3ENVA 1WHYA 3G82B 3BH6B 4DR2J 1WWUA 4ALZA 4RU2A 4CJ5A 3QJJA 2B43A 3J7A1 1SV5B 5D46A 1NRKA 1OPIA 3A8YA 2PYJA 3KG0A 3HPOA 3L7OA 1ZOTA 1KN6A 4R25A 4GVLA 1D1UA 3NH1A 2MLZA 4ZH4A 4DV4F 4P2FA 1HNZF 2KSOA 9ICMA 3BGFA 3QU7A 4LY7A 3SI8A 2BJ9A 3MDFA 4DSEA 3WXKA 3QEAZ 3FZFA 4RBUA 5ALIA 4YR2A 1HYZA 1WELA 4I64A 5EE3A 2DXEA 1FO4A 4RUHA 1HW9A 2AEJA 1QAJA 2XGQA 1ZQVA 5C10A 2XNRA 2HWHA 3SQ4A 5L1IA 3VEZA 3IM1A 2XI3A