1U48A

Extension of a cytosine-8-oxoguanine base pair
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 215
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u48A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u48A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u48A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u48A01
4RW8A 4Z4FA 1JLAA 3DLEA 8ICCA 4F2SA 2OPRA 1NOYA 1A77A 4IRKA 2FPLA 4OGEA 2LSNA 5CP2A 3B6OA 4M9JA 4BE0A 3RAQA 3ZT0A 3GV8B 1WSEA 2VANA 4G3IA 1WNSA 3K5LA 4DSEA 1XO1A 3NF9A 3MEEA 9ICIA 1RBTA 3M9NB 3AV9A 3JPPA 4B8CA 5EU7A 1CXQA 4IG3A 3LZJA 1ZQKA 3OGUA 1ZQGA 3VQPA 2A1SA 4DO9A 5CZ2A 5HBMA 2WOMA 4O3QA 3V1QA 3H7IA 3ZSOA 3QEPA 1D8LA 3FDSA 4CEDA 1S10A 2B21A 5J0XA 4R63A 4CK1A 2J6TA 1ZJNA 4CIGA 4FS1A 3ETLA 5KT5A 1WAJA 3MR6A 2HHXA 5SWMA 3G6XA 1ZQNA 4F4XA 4CJUA 4LD0A 3L2QA 4J9LA 5HP1A 4DMNA 5FROA 4UB2A 1TV9A 4YVZA 4DL7A 4IRDA 4RQ3A 2YKMA 1ZQXA 2IAJA 4W5QA 3ZSQA 2AJQA 4I2FA 5HLFA 2XRIA 4R65A 4ED6A 2DFEA 5KRTA 4O3NA 4YXMA 4JLHA 4JK1A 1QTMA 4CHYA 3AO2A 3IS9A 4FJ9A 5C5JA 1ZQQA 5SZTA 4B9TA 1ZQVA 4Z6DA 1RTJA 2D0BA 2ATLA 1KCFA 1JLEA 3PO5A 4M9NA 3S3NA 3O3HA 3SV4A 1WCNA 2BCRA 1X1PA 3AA2A 2PYJA 2F1IA 1U45A 3O3FA 2RN2A 3OYCA 4OJRA 4KHSA 3I0SA 1HJRA 3AVLA 2ZD1A 3ZDAA 4F4WA 4CEBA 3ALYA 9ICBA 4Q0BA 8ICBA 5D4BA 4C8KA 3SUNA 3DOLA 3AA4A 1RBVA 2XGQA 2Z1JA 5J2JA 7ICRA 3F9KA 4MF8A 4OVLA 3U3GA 3IAYA 5HP4A 3OYLA 4I28A 2W42A 5L1JA 1C7YA 2ATQA 2D5RA 3VQ7A 4KB1A 5HMMA 2FBXA 1WLJA 1D9FA 4HCCA 3ZDCA 3JYTA 9ICWA 3EW9A 4MFAA 4BDZA 2FLPA 1Q8IA 4NM2A 3BJYA 1FK9A 3MEGA 1WSHA 2IDOA 3IM1A 1DLOA 3LWMA 4M3TA 3NFAA 3OYFA 3KJVA 3DM2A 4E7JA 1NOMA 3M9OB 3QEWA 3AVCA 3M8SA 1S9EA 3LALA 2NRVA 4J9MA 4KFBA 2IGIA 3C2MA 4FZZA 2PZSA 3KK3A 3L2RA 4ECTA 3NE6A 3RR7A 4MFBA 1MQ2A 4M6WA 5KFWA 1BIUA 3V9WA 2G8IA 4FLVA 3TWHA 2OPPA 4I2QA 4P4PA 4RPXA 4QW8A 3RRHA 5JS2A 4I2AA 5KRSA 2HVIA 4R8UB 4PHPA 1ZQHA 1RT2A 3ZDDA 4DSKA 4FK4A 3V6HA 2I5JA 1QS4A 1K1SA 1CZ9A 1LWFA 2ZJ5A 3GQCA 4LSLA 2XY8A 3K57A 4CJQA 4CJSA 4F5NA 2JEIA 3L8BA 4DTXA 5J2GA 1RYSA 3PUFA 4CGFA 4LVSA 5HHHA 3TANA 4FXDA 7ICKA 2OPSA 2OWOA 3QEXA 2MUTB 4F4KA 1J9AA 4F3OA 9ICGA 3Q8LA 3QNNA 2H5XA 3K2PA 3K4GA 1ZJMA 3TR8A 2BKEA 4FJXA 4IDKA 4CHNA 4H4MA 4HUFA 2AQ0A 4I2HA 4C8LA 4N47A 3OYIA 1K1QA 1TKXA 8ICKA 3QETA 5KFTA 4DOAA 2GV9A 1HYVA 3Q8KA 1GOCA 4CFCA 1ZQOA 3KK1A 4E89A 3LP1A 4AHVA 1VRUA 7ICTA 1VSKA 1WSFA 5TZVA 4KLIA 3N4MB 3N97B 4FW1A 3C23A 1RTIA 3AU2A 7ICSA 2HHTA 9ICXA 4RW7A 2WTFA 3T19A 1JKHA 3NH2A 2W9CB 4MEXA 2NRZA 3ZSYA 5HHIA 5J0UA 5KG7A 1C0TA 4CJ4A 1SKWA 1T4GA 2BQ3A 3UXOA 3CM5A 4IQUA 4FLUA 5FRNA 1NK9A 4KLQA 1IKWA 3TARA 4CJTA 3IG1A 4KLSA 7ICQA 1XC9A 1RBRA 3GILA 3MGIA 1TGOA 5DLGA 4MQ3A 2PI4A 4FJNA 1LW2A 4RQ6A 3V9ZA 1JL2A 4O9MA 4CFAA 1T05A 1ZQBA 1GOBA 4E19A 2RDIA 3HPHA 3NBPA 3B0YA 5CB1A 4QZIA 4O3PA 4KI6A 4QAGA 3F73A 4QW9A 4C8MA 2DY4A 2OPQA 4F4YA 2JEJA 4IRCA 2G8KA 4PWDA 5KFRA 4HCBA 1ZQUA 3MR5A 1BVSA 8ICEA 9ICUA 2MUTA 1HQEA 3PY8A 4BWJA 1TK0A 4OPJA 1ASUA 5KG4A 1XHZA 3KKRA 3KD5E 4AHUA 4YXJA 4CEEA 4PHDA 2FBVA 3ITHA 3A2FA 2D0AA 4DU1A 4DFMA 1JLGA 1Z25A 1B9DA 4KLJA 1KVAA 5KFAA 4KV8A 2KZMA 1MC8A 5IIJA 5DBCA 4Y1CA 4I2EA 2ZQBA 4CECA 4DS4A 1UOCA 5KG0A 4GXKA 2W9BA 4PHEA 3VQDA 3OHBA 1GOAA 3V9XA 4QZ9A 3RMAA 2FMPA 4F5PA 1L3SA 4O5KA 3NH1A 4OLBA 1KFTA 4CIEA 3DOKA 3OJUA 4CFDA 2GUIA 4KLOA 3KHLA 3H4DA 3MAQA 4JV1A 4EBEA 1MSWD 5KFYA 2AGOA 5KT3A 4DL5A 4BACA 3NF7A 4RQ7A 4EBCA 5C25A 4JRQA 1QE1A 4LSNA 2FMSA 1RZTA 1BPXA 2GWSA 1U9LA 8ICVA 4CEQA 2BQUA 2UVVA 1EKEA 3SV3A 1S0VA 1U48A 3T3FA 4J2DA 1RNHA 3LAMA 5KFKA 4CEFA 3AVKA 3V72A 1J5OA 3SYZA 1N48A 3DLRA 4M0AA 2G8FA 1HUZA 1H38A 4IR1A 1F21A 3MXJA 1EXQA 1L5UA 4EYHB 2G8HA 1ZBHA 1TL1A 4DSJA 5J2EA 3GIMA 1R0AA 4N56A 3VQ4A 4J2EA 3PX0A 3VQ5A 2ASLA 5F9NA 8ICIA 8ICUA 1XSNA 4J9RA 4CHOA 1YTUA 4F5OA 4X5VA 1XHXA 1J54A 2BPGA 4DF8A 3E01A 5DBBA 3NGIA 4UBCA 4IQTA 4CIFA 4KHYA 4ECUA 3V9SA 4Z4HA 4B8AB 5DB7A 3QINA 1CUKA 1C0UA 1AROP 5KFZA 2IC3A 2YNFA 5DK5A 2OZMA 3QE9Y 5DDYA 2Z1HA 4YNQA 1U47A 4QZ8A 4UAWA 7ICEA 1RT6A 3O3GA 5CJ7A 3V7LA 1CLQA 3SQ1A 4FZYA 4GVMA 3ORYA 1NJZA 3WNEA 2KZ3A 1S9FA 4I2GA 3HP9A 4CF2A 3VQQA 1BQMA 2FLNA 2ZTDA 4ECWA 3LPUA 1RYRA 4NXZA 5CY4A 3H8JA 3ZDBA 5HRPA 1ZQMA 3WNFA 4HHTA 5CWRA 3TAMA 3ZT4A 2AGQA 3AVHA 3AO5A 3OSNA 5J2HA 2IOCA 3TI0A 3VQBA 2KN7A 5L1LA 1SUQA 4YMNA 2BE2A 3JPRA 3Q8QB 5C24A 4NLKA 1LAWA 1Z26A 1S6PA 4KLTA 2XHBA 3KLGA 3RAXA 4EZ9A 4ECVA 1ZQFA 1ZYQA 1W0HA 3EZ5A 1ZBUA 3AVFA 4O44A 1HYZA 3PW0A 3FFIA 1SL0A 4K4IA 1JL1A 3QIPA 4DQIA 3UIQA 1KDHA 4O5EA 3GV5B 3LP3A 4J9PA 2JGUA 3OS2A 4Z4EA 1S5JA 2F8TA 9ICTA 3QZ8A 3G6VA 3OSPA 1UA0A 4CHZA 4E7IA 9ICLA 1CEZA 2FC0A 3NCIA 4LY7A 5D3GA 5J0OA 2NRTA 4GLXA 4ECYA 4MF2A 2YNHA 2ZE2A 2XY5A 2HHQA 3MECA 4E1NA 4E3SA 3SZ2A 3Q8SB 1NK0A 1ZQZA 4J2AA 2BANA 2J6UA 2VA3A 1TV6A 4JS4A 5J2NA 1J53A 1U04A 4XRHA 4FJLA 3OYMA 4BDPA 1LWCA 3HW8A 2IHMA 5HRNA 3MFHA 3RB0A 2IHNA 5KTQA 1NKEA 3RH5A 2YNGA 3EWAA 4XA5A 5J0TA 4N5SA 4H8KA 4TURA 4Q5VA 1TL3A 1QLNA 2R7YA 4FLZA 1WAFA 1U4BA 3QIOA 1UT8A 2MAXA 4P4MA 4F8RA 3KHHA 3V1RA 4O0IA 1VSJA 2PY5A 3QNOA 4CGIA 1NJWA 2C2DA 4AHTA 3RJHA 2B6AA 5IIMA 3RMCA 4OKKA 1VSHA 8ICQA 4QZGA 3HSTB 2VA2A 8ICMA 1WSGA 1KLMA 4F5RA 4F92B 3BDPA 1SL1A 4R64A 2JEFA 5HRRA 3MXIA 1EETA 3K59A 3ISDA 2PFNA 2NRWA 5KFSA 3OVNA 3LK9A 1RBSA 4E7HA 1T03A 5KFGA 3UPQA 5KFIA 5J2BA 4NLGA 2HB5A 5L1KA 4PA1A 8ICGA 4UAYA 2BQRA 5CYMA 5KFVA 3DLBA 1ZQEA 1NOZA 1QSLA 4ECQA 4BE2A 4FJ7A 1V9PA 3CM6A 3T5LA 2KW4A 4NM1A 1ZQPA 3SPZA 3G6YA 1LB2B 1D9DA 4C8NA 2ASDA 3V4IA 5DLFA 3RJKA 1JLCA 5J29A 1EX4A 4E7LA 3PVXA 4R8UA 2WONA 3B6PA 7ICIA 2YNIA 3I0RA 4TUSA 1HNVA 5J2QA 1K6YA 3RR8A 4N41A 3NGYA 3OYAA 4CK2A 4IFVA 4M3XA 4LZDA 4RW4A 5KT6A 3AA3A 4M47A 3RWUA 2O4GA 4DL6A 3C1ZA 3G10A 5KFXA 4O3OA 5KGXA 4DG1A 3ZSWA 3C2KA 3TFSA 1EXNA 4F91B 4GC7A 4YP3A 4ID5A 3H40A 4UB1A 3TABA 4KO0A 4J9OA 5KI6A 1NK6A 5D46A 2LYHA 2ZUCA 3P1GA 4CGGA 1VSIA 3HVTA 3SQ2A 4FO6A 2FBYA 5HRSA 5L9XA 3ZT2A 3T5HA 3AO3A 3TQ1A 1RDAA 4FBTA 5DDMA 1JXEA 1ASWA 4Z6CA 3SUOA 3S3MA 1VK0A 1KVCA 3TAGA 2BCVA 5DGAA 2EX3A 4I9LA 3L2UA 4B9NA 3VQEA 1RT7A 2B5JA 5HNKA 1A5VA 2J6SA 1VSMA 2V4RA 1UAXA 1TKDA 3RBDA 4M9HA 4RNOA 5J2DA 4B3OA 1KFDA 3NH0A 1JLQA 5KFHA 5KFBA 4I9QA 1RPLA 8ICHA 5CHGA 1XU4A 1BI4A 3PR4A 4HTUA 4P4OA 1BIZA 5CA7A 4GC6A 2F96A 2E6LA 3BQ0A 2G8UA 4UAZA 1NJXA 4DTRA 3MGHA 3JPTA 4DTJA 3MDCA 2BPCA 9ICNA 5KFCA 3PO4A 4YR2A 4IFYA 4KKOA 3AVGA 1RXVA 3UXPA 1S0MA 3QESA 4RUCA 3DMJA 1VSDA 4CJEA 3SCXA 2FPMA 4CGJA 4DL4A 4CE9A 4QOZB 2KQ2A 9ICRA 2V4QA 3Q8MA 1KEJA 1I39A 3HPGA 1CXUA 3VQ9A 4KLHA 4R5PA 1XSPA 1SL2A 1RT4A 1TK5A 4G1QA 5KG6A 2OZSA 4FLXA 1ZBIA 4KLFA 1TAUA 3AVNA 2UVWA 4W5TA 4QWCA 2HNZA 3PR5B 2OYQA 4DTOA 4J9NA 3CG7A 1ITGA 3IHQB 3QERA 1IG9A 2QKBA 4KB0A 2DFLA 2Q3SA 3PW2A 1NK8A 7ICOA 2E4LA 2C28A 2ZTEA 1DTQA 4E0DA 4CERA 1BI4B 3PMLA 4CJLA 3D0PA 4ICLA 5DGBA 4DL2A 1O1WA 4FM0A 1RTHA 1HQUA 2P1JA 4YN4A 4ELUA 5KG1A 3EYZA 3QEVA 4PY5A 5KFEA 4DLGA 4FK2A 4QCLA 3VA3A 5IIOA 1ZBFA 2Q0ZX 2NUBA 4KTZA 5EOZA 1RDDA 3AVMA 9ICVA 3P83D 2F1HA 5KFOA 2ALZA 3OYGA 4DTMA 4DEZA 5KT2A 3ZT3A 7ICHA 7ICVA 1JLBA 4YR0A 4EBDA 2C2EA 1S9GA 3FYHA 2X6NA 1D5AA 4DLEA 4FJ5A 5F9LA 5DQGA 2GBZA 4M42A 9ICKA 4J2BA 4QZCA 3QZ7A 4F2RA 1KSPA 7ICPA 4I2DA 4W5RA 4O0JA 1JX4A 3SJJA 3GIJA 2NRXA 4I27A 2DPJA 3RJJA 8ICXA 1BHLA 4RG8A 2ZJAA 4NLNA 1YT3A 2YHBA 4QWAA 4ED0A 3C2LA 4NCBA 1T8EA 1Z00A 3HP6A 3C6TA 4CHPA 2IBKA 1S76D 2ZJ8A 2PXIA 1X9MA 4Q8EA 1QQCA 1ASVA 2XCPA 4BGDA 4I2PA 3AU6A 3C5FA 4ED8A 1ZQRA 1Z3EB 4DU3A 3K58A 4DF4A 4Z4IA 4RW9A 5L1IA 4B9UA 1TKTA 4AHRA 3NGDA 1Z00B 3OYDA 3DRPA 4R66A 4EZ6A 1VRTA 3SUQA 1ZQYA 1ZQTA 2W9MA 5D49A 1A5WA 1RT3A 4OPKA 3KTQA 1HNIA 3B0XA 4KN4A 3EY1A 4PHAA 5IIKA 1JIHA 2AGPA 1REVA 2AQ4A 5DBAA 4RQ5A 1BQNA 4FJHA 5KFQA 4DS5A 5T7BA 4FCYA 4CESA 2HHSA 3KLEA 3JPQA 4W5OA 1X2IA 3T5JA 2W9AA 5IIIA 4XIUA 3MABA 4M9LA 3HJFA 2QK9A 4DFJA 5J2IA 4ZHRA 2Z1GA 5IILA 5J1EA 1G15A 3C95A 4PGQA 4CJWA 1N6QA 8ICPA 2R8GA 5J0QA 3SI8A 4KITB 3OJSA 1L3VA 2RF2A 2P5GA 4DWIA 4K4HA 2FPKA 5KFFA 4JV2A 4I2JA 1Y97A 1KVBA 4YMOA 4ED7A 9ICPA 4IBNA 3RJFA 2P66A 1Y88A 4FM1A 4JUZA 4L8RB 5KFUA 1TKZA 1HUOA 4YD1A 3TAFA 4ZH4A 5KG5A 4EP5A 4OKJA 5BPCA 5J0PA 2VWKA 5IINA 4J9SA 3P5JA 4Z0UA 5J0WA 1RBUA 2ZTCA 5KG2A 5J2KA 3H8WA 4O55A 4KPYA 1UWBA 4IG0A 3SQ4A 3OYNA 4DQRA 3AO4A 2VG5A 4RU9A 3RMBA 9ICSA 4NCGA 3THVA 3PW7A 1JLFA 4UB4A 4MFCA 3GV7B 1MU2A 4KMUA 4B9SA 3RJIA 4K8XA 4CF0A 4GXIA 2Y1IA 1T7PA 3DLGA 4FM2A 3CFRA 4RQ4A 4BDYA 2BDPA 3G0ZA 1ZQCA 3ZD8A 2VWJA 3MEDA 2F1JA 4I2BA 4CEZA 4YD2A 3PV8A 2QXFA 1COOA 4M9GA 2DFHA 3VQAA 3HM9A 3S9HA 4M3RA 4DQSA 3PW5A 3QEBZ 4WE1A 4PGXA 3U3YA 4DFPA 2DPIA 4DOBA 3LPTA 1RTDA 2YHAA 2HNYA 4I2IA 4P2HA 1BPYA 5CZ1A 1S1VA 7ICJA 9ICQA 4FLTA 4DTSA 3SNNA 3VA0A 3AVBA 3HXMA 9ICCA 5EWGA 4M3WA 1PZNA 3KLIA 4FBUA 4O3SA 4PPXA 1HPZA 1BPZA 1S77D 2C22A 1N5YA 2DTUA 3TAQA 5C42A 1FKPA 4KREA 2IMWP 3KLHA 3JPOA 3PNCA 4H4OA 3K75D 5DQIA 4YFUA 3MXMA 5DG7A 4J9KA 5DB6A 5JUMA 3M8RA 1WSIA 4HVJA 2BCSA 3RBEA 2BGGA 3AVIA 5FDLA 4MFFA 3T1AA 3LANA 5I3UA 9ICEA 3V6JA 2RKIA 4KHUA 1SKRA 5KT4A 5I42A 1X9SA 4AILC 1JXLA 4CEAA 4KAZA 9ICJA 1IKVA 3SUPA 5FRMA 8ICAA 3BQ2A 4FJ8A 1ZQWA 3U6FA 1BPDA 3QEIA 3OY9A 1YTAA 9ICHA 1MQ3A 3RH6A 1B43A 5DB8A 4CJFA 4ED2A 3OYJA 2HHWA 4M3UA 1Q9YA 4M45A 4GXJA 2KZZA 4DFKA 3ZSVA 4CF8A 4N76A 3NTUA 5J0RA 3V7JA 4ECRA 1XWLA 1TAQA 3BQ1A 1JMSA 5JS1A 4B08A 4TQSA 1XSLA 4PUOA 1A76A 4FJMA 5DG8A 4RQ1A 4FW2A 4QZDA 3LZIA 3BQTA 3OYKA 4NLZA 4BXOB 1NK7A 3HL8A 2IS3A 1CZBA 3M8PA 1JXBA 4O4GA 5DKWA 3C94A 1HYSA 9ICMA 4I7FA 2PFOA 3JPNA 1HJPA 5DMRA 3ZT1A 3K5NA 4CHQA 4ELVA 2XY7A 3AO1A 3NGZA 1C1BA 4M41A 1KLNA 1ZQJA 4Q44A 2PI5A 4Y1DA 2VG7A 4IR9A 3AA5X 4IKFA 2BCUA 1B92A 3H08A 2PYLA 1S0OA 3LP2A 4FK0A 3GIIA 1LAVA 2HMIA 3V6KA 4OKEA 2R8IA 1BGXT 1QHTA 4Q43A 1KFSA 4QWDA 4BE1A 1RT5A 7ICUA 1EP4A 5EWFA 3PMNA 2KTQA 3MDAA 3GFKB 4B9LA 3PW4A 2X74A 4RPYA 3EPGA 3SI6A 2KFNA 4ELTA 4ECZA 2R8JA 2BR0A 8ICYA 9ICAA 8ICNA 1NJYA 3AUOA 4JWNA 5DB9A 3HX0A 2UVRA 3MFIA 1VSEA 2XO7A 3KLFA 1NKCA 3ZD9A 8ICJA 3OHAA 4HUEA 4JRPA 3KIOA 3DLHA 4BWMA 2IA6A 1HRHA 3OS0A 2HHUA 1S1WA 4QZBA 9ICOA 5J2FA 3VN5A 3LWLA 3MR2A 3HWTA 4EYIB 3V6DA 4F50A 1UT5A 4RNMA 3WNHA 4KN7A 1L3UA 4KRFA 2HHVA 1LWEA 4QZEA 1IKXA 4ZTJA 5DQHA 4KLGA 2JEGA 4CCHA 2FBTA 2JZBA 3VQCA 4J9QA 8ICTA 1C0MA 3RJGA 1S0NA 3M8QA 3UXNA 2P6UA 5KFMA 2G8VA 3TAEA 4DQQA 3KD1E 2VA8A 4RT3A 3SPYA 4MEYA 4PGYA 3JPSA 3DRRA 4AHCA 4F93B 5KFDA 1D8YA 4KLEA 1B22A 3C5GA 3V7KA 4GW6A 4DOCA 8ICRA 1BCMA 1WN7A 3DYAA 1B9FA 3RB3A 4BXOA 3VQ6A 3RMDA 1ZQDA 4K4GA 2R8HA 2ASJA 2YV0X 2FMQA 3KK2A 3MBYA 5DG9A 1SZPA 2QKKA 3ISNC 4XQ8A 4KI4A 1ZQSA 2Z1IA 4AH9A 1BPEA 3O4QA 3EPIA 3CFPA 2BHNA 4YCXA 8ICOA 1I3AA 3JSMA 3LDAA 5K14A 4CJVA 4NYNA 4M04A 4F4ZA 2BPFA 4RW6A 9ICFA 4IQWA 1TFRA 3ASMA 1QSYA 4EP4A 4ECSA 2F8SA 5KFLA 3L3VA 4Z6EA 1DOQA 4YMMA 1QSSA 4KTQA 3LAKA 1KRPA 4E1MA 4QZFA 4JS5A 3ULDA 1HMVA 3RTVA 1WCLA 2B4JA 5J0YA 4YG2A 2KFZA 5CYQA 3CFOA 1C6VA 4JWMA 4O5BA 3NAEA 4NCAA 4UB5A 3RB4A 4XUSA 3K5OA 2DFFA 4RQ0A 2OA8A 3MR3A 2RDJA 4LH5A 2XGPA 1ZBLA 5KFNA 3IRXA 4RNNA 7ICNA 2ETJA 1W9HA 1RDBA 3V81A 4PH5A 4LH4A 2A1JA 2ZUBA 2JZBB 4Q45A 3K5MA 3V9UA 2UVUA 1RT1A 4RZRA 4KLDA 3BGRA 4OLAA 4K8ZA 3WNGA 8ICFA 2X78A 2O4IA 5KFPA 2A1RA 4ED3A 4DQPA 3PX4A 4CGDA 2AU0A 1RILA 4FLWA 1FXXA 3E2EA 1U49A 7ICFA 3RJEA 1DGSA 4Z4CA 5EWEA 4DTNA 8ICZA 3ZSXA 1S6QA 4I2CA 4CFBA 2M9NA 1DTTA 3O4NA 2JLEA 1IO2A 5KG3A 5J2AA 4DSFA 7ICLA 1FKOA 3T5KA 2R8KA 4DU4A 1IKYA 5KGWA 1LV5A 2RPIA 1ZETA 7ICGA 3NHGA 3UQ2A 4JV0A 4QWEA 1ZQIA 3NF8A 4NY8A 2Y1JA 2HVHA 4HUGA 1N56A 1NKBA 5E41A 3HO1A 5J2PA 4KLLA 3HVRA 4CEOA 3L2VA 1XS9D 4FS2A 2I1QA 2P5OA 1BISA 4M6WB 4GMJB 3S3OA 4FYDA 1BL3A 4KHNA 1SV5A 4M2YA 3HYFA 3CQ8A 3LDSA 4CJRA 1TVAA 4PQUA 4LZGA 4ID1A 3C21A 1IXRA 2P51A 4QWBA 2PFPA 3TAPA 1UA1A 4ED1A 3DLKA 5BOMA 4UQGA 1S1UA 1TK8A 4DTPA 1RCHA 8ICSA 8ICWA 8ICLA 4YR3A 4Z4GA 1JN3A 2VG6A 2V9WA 4C8OA 2FLLA 4TUQA 4B9VA 5J2CA 3DRSA 3L2WA 3HK2A 4M3YA 1LW0A 4DSLA 3RB6A 1YVUA 4FLYA 4CJPA 4W5NA 3OS1A 5HROA 4B9MA 3UQ0A 1KTQA 3TFRA 4RQ8A 3LP0A 4FJGA 4CF9A 2HNDA 4RQ2A 2W9BB 4DL3A 2BGWA 4CJ3A 4M3ZA 3H8SA 5KFJA 1X9WA 4AHSA 4O5CA 1RDCA 3L3UA 4FZXC 3GIKA 3V1OA 1NK5A 4FJJA 1IM4A 3HPOA 3OYBA 5CR0A 4ECXA 1A5XA 3KKSA 2P6RA 2BCQA 3CYMA 4FVMA 4TSXA 4EEYA 5J0SA 3OYHA 2EHGA 4KLMA 3SQ0A 3OYEA 4TUPA 3ZDEA 2YKNA 3GDXA 2ZUDA 4FJIA 3ZCMA 4YQWA 2G8WA 4UBBA 1SKSA 1VSLA 3VQ8A 4E7KA 1Q9XA 4KHQA 4F3TA 5KT7A 2D0CA 2XCAA 4Z6FA 4CGHA 2W8LA 3ZSZA 2W9CA 5HMLA 1VSFA 3NDKA 1RXWA 3PX6A 3KHGA 3Q8PB 1S1TA 2XY6A 2PFQA 3RRGA 3C6UA 7ICMA 1NK4A 1IH7A 2ITGA 2W8KA 4DSIA 5BOLA 5J2MA 1T3NA 4RUAA 1TVRA 4YFKA 4Q8FA 1ZQAA 3D45A 4OGCA 4TQRA 3RH4A 1WSJA 4FJKA 3Q8RB 2X6SA 4ZTFA 1C1CA 2I9GA 4KHWA 1XI1A 4CF1A 4KLUA 1S97A 4NYFA 2C2RA 1BPBA 4RPZA 1BCOA 1C1AA 3QLHA 2XC9A 3ZSRA 4DTUA 4O3RA 3C1YA 3M9MB 2ISOA 1ZQLA 4CK3A 3AVAA 4RT2A 4KTWA 1S1XA 2A1JB 3AVJA 3ISBA 3I8DA 4QZHA 4IQVA 3DI6A 1L3TA 4CJ5A 2ISPA 3H4BA 3NF6A 3QO9A 2E6MA 3QEAZ 4QZAA 4I29A 3ISCA 4F5QA 3KHRA 4CJKA 3HT3A 2HW3A 4UB3A 4HYKA
chains in the Genus database with same CATH superfamily
4F25A 3W2VA 4E1JA 4C3LA 4OJLA 4A61A 1A77A 3CJ8A 2LSNA 4M9JA 1KQKA 2MZ1A 2FSJA 1LQ9A 3ZT0A 4G3IA 5IQQA 4MK8A 3K5LA 2MY8A 2CDRB 4DV3J 1W2BR 4AM6A 3EE3A 4GV6A 1N32K 3T1HF 5IT9Y 2WOMB 3M9NB 2EAOA 4JB8B 1RAIB 2LMRA 5AXKA 4IG3A 3AOAA 3LZJA 4I6YA 3HD1A 1ZQKA 1NHKL 2A40A 4DO9A 3I5CA 2HHHK 4U6PA 5CZ2A 4IYQA 4B3SK 5HBMA 3CO9A 4J90A 4DPXA 4O3QA 3V1QA 3ZSOA 1D8LA 2EFNA 1X3NA 2O8DB 4C9DA 4NA3A 4O4GB 1WC6A 1RUSA 4FS1A 3UMBA 2DGTA 2CWXA 3MR6A 2EQYA 4QPTA 2ZC3A 1NGAA 2K7KA 3QUTA 1ZQNA 3ZTRA 1T95A 4F4XA 2UUTA 3KYLA 4LD0A 3L2QA 4J9LA 1DGJA 3W5ZA 5HP1A 3NS6A 4LVNP 1FRJA 1WB9A 2EZXA 2YBVA 2LKZA 1FE0A 2IHR1 2O5DA 5E3AA 2UXBK 3FMBA 3DFEA 4QIEA 3WKCA 3AT1B 2XRIA 5KRTA 2W7PA 3IP4B 4JK1A 2Z2MA 4O3MA 3GZFA 4KJIA 2LDYA 4P2XA 2IOFK 1KCFA 3NS5A 2NXUA 3PO5A 4UOGA 2H4WB 2WBRA 3WK7A 5FIIA 1Q82T 4UTGA 4JHDA 3SMSA 1S79A 4ZJOA 2CPHA 3HULA 3AA2A 2HIYA 4M5KA 3S01A 1RACB 3OYCA 4OJRA 4M95A 2EAPA 2DIUA 2K8GA 9ICBA 4Q0BA 8ICBA 1A7GE 3DOLA 3AA4A 3H7HB 3AGRA 1Q8LA 4H5TA 3ENBA 1VJQA 2GIQA 2UUWA 2Z1JA 5L1MA 1QHAA 2ZH7A 3SEIA 2EAMA 1Q18A 4B3MK 7ICRA 3VQSA 1FTCA 3CCUN 1S5ZA 3DDNA 3GFYA 2O66A 4PG6A 4QIWF 4I28A 4ZPWR 4KB1A 5AK3A 4FZLA 1IWAA 1FJGF 2DRAA 3P6YC 2QWLA 4JKAA 1KTVA 3NGRA 3IFRA 4WFZA 2C3UA 2HI0A 1XTZA 5E3PA 3EW9A 3FQKA 4BDZA 4WU2A 4PKHA 3BJYA 3VGTA 5AQJA 3IM8A 1WSHA 1DHMA 3IM1A 1FNOA 3AB4B 1DLOA 3WK4A 4QBUA 5HQLA 1PYOB 2FVCA 3KJVA 4XH5A 1U1NA 1BUPA 2P9PB 4E7JA 2YX8A 1YSJA 2M0NA 2E2OA 2FSNA 5M2PA 3H2UB 3M2RA 3KK3A 2PKEA 3NE6A 1FDNA 2QA4S 1MQ2A 2YXLA 4M6WA 4MIWA 4M94A 2IMOA 1I94J 4KX5A 4RPXA 4QW8A 3NVZA 4I2AA 3EVWA 2ZITA 2CA9A 1V4TA 3IFEA 3US5A 3J8AA 2LM4A 1ZQHA 1T05B 3OUYA 4BRFA 3V4IB 4FK4A 4IFYB 3V6HA 4K7QA 4FWMA 1LWFA 2ZHOA 3OTQA 2WHEA 2RB7A 4ZVHA 2XMAA 5GMKa 3K57A 4F5NA 2JWKA 4NA2A 2F1FA 4IG0B 1RYSA 4LVSA 5HHHA 2FTRA 2O1PA 2KO1A 4F4KA 2YH1A 1RP5A 1J9AA 3OBWA 2RHFA 1KL9A 2W7AA 1GT8A 3CWJA 3QNNA 3CCSS 1X8DA 3K2PA 2WBMA 4ZK7M 1ZJMA 3T9ZA 3TR8A 1K0TA 3QJJA 2HQFA 2A0FB 2CQIA 3N6LA 4N47A 2L9DA 2QI2A 2CYYA 5ALRA 2V2QA 2XS7A 5KFTA 1E6YA 1HNZJ 2R9LA 2M9KA 3RYLA 3KK1A 3MDQA 3KOOA 4JB3A 7ICTA 3BM7A 3UVJB 1Z19A 2K4IA 5FPEA 3C23A 1FKAF 4DHVA 2M4MA 4ERDA 7ICSA 4PG5A 5A6PA 3BO4A 4UAUA 2WTFA 3T19A 4MO4A 5CYJA 3NH2A 1DLOB 2XNRA 2UU9F 5HHIA 3CW2C 4BHQA 5KG7A 2V2KA 4U7CA 1L6NA 1VQKS 1EIYB 2DNLA 1SKWA 1T4GA 1K8KA 5AQFA 4FLUA 1IBMJ 2GHVC 5FRNA 4KLQA 4BRPA 1ULRA 2GNKA 1QD1A 4NXNF 3KKAA 3EXYA 2AYEA 3H1QA 2FJAB 4IH5A 4KLSA 3DDIA 4JN4A 4Y65A 2HBYB 7ICQA 3L4QA 1BDGA 3QSYB 1NAQA 3BP8A 1LW2A 2ACYA 4JI3F 2BW7A 4WF9L 4BLGA 3UR0A 1WHYA 2H3FA 2A3VA 1T05A 4CFAA 1QAXA 5ALGA 1UFLA 3QATA 4HDHA 3EUNA 1X7VA 2AWZA 2EBGA 4CLWA 4NLOA 4NLSA 3FMWA 3NMRA 4RTFD 3S6JA 4WXWA 5DZ7A 4A4JA 4KI6A 1URJA 3W1YC 2DY4A 1L3KA 2WVEA 4F4YA 8ATCB 4KH5A 5KFRA 1HR0J 3DXKB 3CCWA 2ZGYA 4X4QA 3P31A 3I31A 1AW0A 1KC8O 1HQEA 3LA0A 1TK0A 1UCVA 2D9PA 3C16B 5BJRA 4E98A 2O8BB 3BF4A 4AHUA 2FBVA 1C0TB 3ITHA 4EIAA 4AXJA 2D0AA 1XMBA 2RE1A 4WKRA 1B9DA 2LEAA 4KB7A 2VPZB 4LF5F 1RT2B 5KFAA 4KV8A 2KZMA 1MC8A 1R8PA 4CI6A 5DBCA 3DGPA 4Y1CA 3V6DB 1ICEB 4I2EA 1KVJA 4DR6J 1UOCA 4GXKA 2J5AA 4DV5J 3TA2A 2RHKA 3KNGA 1Q3VA 4Z37A 2BJ3A 3TOQA 2DHHA 2MSSA 3VQDA 2VIHA 1GOAA 3V9XA 3BS9A 3PTWA 4D3GA 2ZM6K 3NH1A 1RWNB 3D6JA 1KFTA 3R1HA 4YORA 2AH5A 5JMNA 3Q24A 1VQMN 5A76A 2GX9A 1OYDA 4DR4F 4KLOA 2QN6B 3VVTA 4X65F 3KHLA 3H4DA 2WFAA 2JHDA 2PC6A 2HRYA 3A0BU 4ES1A 2G0AA 5CCLA 4EBCA 4EX6A 1RDWX 2FMSA 3H0MB 1Z2ZA 2GWSA 2OI2A 4W90B 1VQ9S 3SV3A 1WC0A 3PIPQ 1S0VA 3N0VA 3MMCA 1SJFA 1QJHA 2YKMB 1XK8A 3BEXA 4CGZA 2QRRA 4BRHA 4OYMA 3UDEA 2DWQA 2VJVA 5FLXY 3SYZA 2A18A 1OQ6A 3T6BA 1N48A 3NNCA 3LO3A 1VLYA 1HUZA 1H38A 6FD1A 3MXJA 2QG9B 4C11A 3MEDB 2VGNA 4OZ0A 3G87A 4J2EA 3D66A 3VQ5A 8ICIA 3U1LA 1XSNA 2KJ8A 2OTLS 2QYGA 2DNOA 1NGFA 4KR0B 1YJVA 1JJCB 2K60A 5DB7A 5CYMB 1C0UA 2YNFA 2HVDA 5DK5A 3UN5A 4K0KF 2R18A 5HLFB 3A5MC 2FUG9 2YX4A 2AT1B 2Z4PA 1CS4A 2I38A 2ZBPA 5ETPA 5E3CA 4IEIA 1HQEB 2BUNA 2IAJB 3O3GA 5CJ7A 3BSCA 3V7LA 1CLQA 1S9FA 2JZ5A 2PO4A 3OV7A 3QBCA 4PYAA 1YXQA 1BQMA 5CYQB 3D28A 3RBZA 3NOCA 1WTBA 2ZBCA 2C2MB 3L9ZA 1DJ0A 4DR5F 1QQNA 4DV0K 1LW2B 1RTHB 4ZP6A 5CY4A 3HHDA 4Z94A 5HRPA 4MO5A 3M2RB 1K73O 3CD6N 2WB1F 1UVMA 2VC0A 3P8BB 4AFFA 3VAFA 5F8MA 2IOCA 3TI0A 4LR7A 4YN3B 3VQBA 4JI1K 4HTJA 3FC9A 1P6TA 4QU7A 5GAGI 3WC0A 3FSXA 4MJKA 4DUTA 5C7PA 5C24A 1Z26A 1YIJN 2RP5A 4C1NK 3O0FA 3KLGA 3JYTB 3RAXA 2MEWA 4US9A 1NGIA 2I6WA 1W0HA 4JI7J 2W2QP 4LSLB 1SL0A 2DD8S 3J7YP 4CIOA 2KM8B 4DZDA 3NBPB 3UIQA 3I0RB 3F5TA 1KLMB 3G8SA 3C8YA 3OSPA 3IWNC 9ICLA 2V5HG 1CEZA 5ALXA 3D6FB 2GAGC 1QVGR 4LY7A 5J0OA 3WX8A 5AJ3J 5G5GA 2ZE2A 1CQNA 2HHQA 3MECA 1N2XA 3DLLL 2HZVA 3SZ2A 4KIAA 4FWPA 2J6UA 2VA3A 2B9WA 2IHMA 2J9DA 4CDIA 3TADC 3CIPA 1FJCA 2Z0GA 3RB0A 2IHNA 1VIXA 3U9DA 5J8YA 1FK9B 1I94K 4A8MP 2YNGA 2KRRA 3VALA 3OVAA 2ZH6A 4JI8F 1TL3A 3UMCA 5CCMA 3E1YA 1L8LA 2QYCA 3QNOA 2KB2A 2NQPA 1NJWA 2B6AA 4ZOHC 2DB1A 5ALNA 2BE9B 1PIEA 5ALPA 1F0XA 4JI5J 4HT5A 1NB2A 3BDPA 2JEFA 3PLAA 2GMJA 3IR7B 2BRKA 4UAVA 3HMJG 1EETA 3TW0A 3U02A 2R4FA 2PFNA 2NRWA 1JNRB 1T03A 2Y1RI 2EDUA 4C4WA 5FP0A 3UPQA 1F6TA 1R6YA 4AL7A 1WEXA 3NRZA 4LFBF 1VYAA 2WVDA 3C19A 5L1KA 4H0VB 3OL7A 4B17A 3QUQA 3TJ8A 2FVQA 3VF0B 3DLBA 3I4HX 3IWLA 5K8NA 2LECA 1HBUB 4RX6A 1NOZA 3DXMA 4ECQA 1SIZA 4PXBA 2Y9UA 2KW4A 1TAMA 3UR3C 5CD4H 1PJ7A 4AQYF 3VGKA 1PGZA 1K8AO 2Q0RA 4Z2XA 4KE5A 1PILA 1EWRA 4DPYA 5J29A 3ZX3A 2I5HA 1EX4A 3VF6A 2HOIA 3UE5A 2QJ3A 5AKKA 4TUSA 1SC3B 1S12A 4PABA 3MM6B 3NL0A 2NPIA 3NGYA 3CXCR 3OYAA 4IFVA 4JI0K 4M3XA 5KT6A 3EKSA 2KDOA 3O9SA 3RWUA 3N4QA 3FGUA 3G10A 3DOMB 5KGXA 2FY8A 1SXDA 4LSZB 4ED5A 4YP3A 4NZ7A 1A6SA 1D1UA 1UFKA 3TABA 3CDWA 1Q95G 2R7OA 2WSCC 2ZH4A 3P1GA 1GFWB 4HI1A 4EFAC 1R3NA 4FO6A 4OLPA 5BYQA 3M7VA 3R6GB 1NU4A 5DDMA 4OX9K 4WK1A 3SUOA 1QAYA 1VK0A 4OYWA 3TAGA 2EX3A 3CCMN 1IVZA 4USKA 1Z2LA 1Z4UA 1WWVA 4L6V3 2R7XA 1A5VA 4OI1A 4C7YA 1UAXA 5EX3A 1A0OB 5AKXA 5C42B 3AODA 5J2DA 2IY5B 2GIRA 3NH0A 1RQLA 4XH1A 3CDAA 2ASYA 5KFHA 4ANEA 4CZLA 3KVGA 1RWPB 4TN2A 1UZDA 2VASA 8ICHA 5CHGA 1TL7A 2IIHA 1XU4A 1BI4A 1WKKA 2W24A 3PR4A 3I9ZA 4J5OA 3D2WA 2YB1A 4DUYF 4EI2A 4OQJA 2D1KA 3U1MA 1KR4A 1ZRNA 4DTRA 1WOSA 1XIQA 1I6JA 4YR2A 4CLYA 1GLCG 1W25A 1S0MA 3QESA 1VLOA 5LJ3Y 3P4UB 1WBDA 1WD6A 2AX0A 5AI0A 2V4QA 5ALLA 2ZEJA 4Z7CA 2J0XA 2JHEA 3FSYA 3UN3A 1CI4A 4KHRA 1MN7A 3R6MA 3T79A 4KLHA 2J7KA 4DI6A 2I0XA 3DRRB 1OY6A 1AFIA 1TK5A 3Q2TC 4LFAK 5KG6A 3H98A 2KHCA 1NGGA 2K3IA 3DI6B 3D4JA 4IL6U 2Q0UA 4YB1P 1ATRA 3FC4A 3WK9A 1OSCA 3TZXA 1X9XA 2ERRA 2H9ZA 1VQLS 5B7WA 2BKPA 3DLKB 4C7QA 2Q3SA 5CA5A 2RMLA 2OPSB 3PW2A 3IS9B 5LOQA 2E4LA 2K7JA 3W9HA 4DCHA 3R5JB 4E0DA 3BEGB 3PMLA 2LQ5A 4ANDA 3D0PA 1T9YA 5DGBA 4DL2A 1YJUA 1O1WA 3QU5A 2MTLA 4FM0A 5D0HA 1RTHA 1HQUA 2P1JA 4YN4A 4IFEA 1GAOA 3E3XA 3QEVA 2ZJRL 2B56A 1S57A 2ZOFA 4CZIA 2OANA 1ZBFA 3LDNA 4DX5A 3ZETA 1RDDA 2MGZB 3P83D 3OYGA 2D0PA 5KT2A 2OEJA 4USUA 4DR3K 4X62K 7ICHA 1JLBA 3L7PA 4YR0A 3CSKA 1S9GA 4ZOSA 1D5AA 3C29A 3MURP 2XS5A 4WFXA 3HKZF 4CYUB 4FJ5A 2JJ4D 4OZ2A 2UXBF 3I4PA 2ZM6J 2DCUB 1SWWA 4K25A 2ZIWA 3NGKA 9ICKA 2W54A 4DV4K 2PE8A 2BE2B 7ICPA 4I2DA 2OEKA 1JX4A 3ULHA 3RJJA 2BOPA 4GMKA 3AOCA 4ED0A 3C2LA 1U2RA 3UVJA 1T8EA 5IXUA 1Z00A 3CNHA 3C6TA 2F65A 3OR1A 2B4VA 2PXIA 4LR9A 4BC2A 2YVSA 3C5FA 1JALA 2DR7A 3CMQA 2GVDA 1UCNA 4RW9A 3BGLA 5IC4B 1VRQC 2W55A 4JI1J 4AHRA 5KPRA 2DCLA 1Z00B 3OYDA 3SLCA 4R66A 4TLRA 2KG0A 2YX7A 4OPKA 3FSIA 1SC6A 2QLJB 1HHQA 2F2AB 1U1OA 2G08A 1Q1KA 4CRXA 3NG8A 1WC4A 4OJPA 2HWIA 2RQKA 2HHHJ 4Y2UA 2K8CB 4DV0J 1U0HA 3QWUA 3I8BA 2HHSA 4IOXA 2CPRA 2ZOGA 1HNWJ 4W5OA 3U9ZA 2W9AA 1GMWA 2NUUG 4LQ3A 3MCOA 5ALSA 3MABA 4X62J 4USMA 4NB4A 4DFJA 3R9LA 2UUBJ 4NYOA 4RWWA 1MA7A 2GO8A 5HN0A 3AD9C 3C95A 4PGQA 4BR9A 1MWMA 4CZFA 4ZVSB 3SI8A 3ETMA 1YBTA 2FE9A 2CIMA 2P5GA 4DWIA 1NM2A 2OTJS 3BQ7A 4JYAJ 1N6QB 4ED7A 2P66A 4OFZA 2MA1A 3AAPA 1Y88A 1TL3B 3NXZA 1TUUA 4L8RB 5KFUA 4YD1A 3U26A 1CJKB 5BPCA 4J9SA 3QGIA 1GLBG 1RBUA 4O55A 4IG0A 2D6FC 4KFBB 1N5QA 3SQ4A 4DQRA 4H5NA 4P0QB 3AO4A 4F0KA 2VG5A 4RU9A 3MCNA 3RMBA 3W9JA 4JKGB 1HIYA 4ES2A 1HNIB 5AKZA 4FN5A 1H72C 1DKGD 2F5GA 4KMUA 1SVDA 4CF0A 5FD1A 3CIZA 4FM2A 2QMUB 3CF5L 2F8MA 4OMFG 4RQ4A 1YI2S 2CUYA 1ZRMA 2P9UA 4CM0A 5H9FJ 1UVLA 2VWJA 2F1JA 5A8KB 5IWAK 4LQ9A 3A8EA 4I4BA 4I2BA 4CEZA 3JQMA 5J1EB 2WONB 2G06A 4JV5F 4H0TB 3LYSA 1VJ5A 4JI0J 3HM9A 4NEYA 3F9MA 4DQSA 4WE1A 1H73A 1JLGB 1WWHA 1P27B 3U3YA 4AP9A 2OP5A 4DOBA 1N33K 4NLQA 4CLSA 3GG1A 4WKYA 1O03A 4RUBA 5CZ1A 3C2PA 3ONQA 9ICQA 1H6KX 7FDRA 3PIOQ 4W4MA 3VA0A 2RQCA 1RDFA 4JI6F 5M1NA 2B9XA 3HXMA 9ICCA 5K8PA 1VQNN 1PZNA 3ISND 3MK6A 1S77D 2G1DA 2ZIUB 4CD1A 2DTUA 2FHJD 3QJPA 1SV5B 3TAQA 1MWKA 3IKMA 5C42A 3SENA 2ZH5A 2MMYA 3PNCA 2KN4A 4H4OA 3K75D 4GKJK 3MXMA 5AQGA 4JI7K 4YHHJ 5DB6A 4DHYA 4HVJA 5FDLA 2J4RA 4MFFA 3HHLD 2B7CB 3G8TA 9ICEA 4U8YA 4LT6A 1F60B 2JOQA 3DGPB 1Y5NB 3N7RC 2VV5A 9ICJA 5GIPA 1IKVA 3R3LA 3I76A 4FJ8A 1ILYA 3UNYA 4DKWA 3HZEA 3U6FA 4IOAQ 3QEIA 2B8QA 1YTAA 5KPZA 1KS2A 3RH6A 2BA9A 2ZOMA 1CJKA 1JLQB 1ATNA 4ED2A 2HFNA 2HOFA 2BUPA 2QXLA 3CC2S 3C14A 3QJLA 2KZZA 4M45A 4WFYA 3UKUB 4I64A 3FLCO 2HGLA 5LMNF 4N76A 4CO0A 2ZGZA 1C4CA 2GO7A 3G86A 3IM9A 4IOCL 1JMSA 3B4MA 4TQSA 2QB0B 2DRDA 1KQQA 4FW2A 4QR1A 1ZZNA 5C2FA 1SV4A 1NK7A 3HL8A 5AFUH 1ZD3A 3CC7S 4GO5X 1OW5A 2IYIA 3R8EA 5DKWA 4I7FA 5BN8A 1HJPA 3OVBA 5DMRA 2CWKA 3T1YF 5DRKA 4X4UA 1K5OA 4X4RA 2V8DA 2QA2A 4Y1DA 2K4EA 2VG7A 5BRFA 2BCUA 1B92A 4QYZK 4OPHA 3SCLE 2ZNZA 4UUWA 3VGUA 3I1YA 3UD4P 2MKSA 2XO6A 1LAVA 5EE0A 3V6KA 2CQPA 4OKEA 1YRXA 2R8IA 3E9LA 3U4LA 3AMZA 3PEHA 3CB4A 3ENVA 3DU5A 2ZF5O 1EP4A 1ZAXA 1SC4B 3PMNA 4OZ3A 3MDAA 1UP1A 3GFKB 4B9LA 2HBQB 4NLBA 3PW4A 2L48A 1HBNA 2R8JA 2ES6A 8ICNA 4M5MA 3MWPA 3MM9B 2P9KA 3AUOA 2VBYA 5DB9A 4KHPJ 4OYXA 1WC3A 3VC8A 2JC1A 3DU6A 3KLFA 3ZEUB 4A8SA 1QH9A 2NYIA 2E2NA 1OMSA 2DT9A 3DLHA 2F8LA 4BWMA 3KLHB 1GLFO 2HHUA 3BPDA 2AW0A 4V19J 1OVYA 4BG8A 5J2FA 3K9JA 1RJJA 5DM6Q 3V2UC 3HWTA 4EYIB 3CTRA 4F50A 1UT5A 4USIA 2NRHA 4KN7A 1BNPA 3F2DA 2VQFF 2KJVA 1L3UA 1VQPS 4M8LA 4ZIVA 4NLYA 5HI7A 2GAHC 2K3KA 4ZITA 4WQ5A 3W64A 4CCHA 3MZIA 2JZBA 1RADB 8ICTA 1VC5A 4BR7A 3UXNA 1GMVA 2YB4A 4MEYA 1K9MT 1UL3A 4CNQA 4NYZA 2C2NA 5GAEU 5KFDA 4KLEA 1B22A 5J2MB 4GW6A 1AZSB 2BM1A 3AOBA 1WN7A 3M30B 1B9FA 1TUVA 2A42A 2Z7JA 1YJ9S 3Q7CA 1SI9A 1T9XA 5DETA 3MMAB 3OVSA 3WQTA 2DGXA 2R7QA 3MPUB 1L8OA 1Q53A 2W25A 3IC1A 2FJEB 1G6BA 3KK2A 5MLCQ 2QKKA 1WKJA 4XQ8A 4ZP7A 2Z1IA 2KVQE 1PK3A 4DV6K 2XLIA 3KLIB 1UW4A 3BSOA 2BHNA 3DLLQ 1UVIA 4OZNA 3CC4N 2EPIA 1RCXB 2PT0A 1REVB 1VQPN 3JQJA 2GC8A 4CBXA 2BPFA 1VFJA 9ICFA 3JSMB 1TFRA 5ALZA 4F26A 4EP4A 5KFLA 4CVNE 2O67A 3KK7A 4YMMA 5E33A 4DPOA 2W4DA 1JKHB 4QIWC 2CVIA 4IWVA 1KRPA 2X1FA 2KHQA 3GWCA 3FVYA 4JS5A 1HMVA 1WCLA 4ZJLA 2AZ1A 2IM1A 1TYQA 5LL6Z 1C6VA 2VOPA 4DV4J 2VICA 1YRUA 3O9RA 1VK8A 4YB5A 3A8YA 2OGUA 2QE5A 3LP0B 2P9LA 3O8MA 2GLEA 2BM0A 3RB4A 3TRGA 3DN9A 2OA8A 2RDJA 1VQ4N 5E79U 3KNAA 4LH5A 1NZAA 5KFNA 3IRXA 7ICNA 1KHVA 4E2FB 3FCHA 5F0XA 3TTDA 5BRHA 4LH4A 2ZUBA 2JZBB 4TU8A 2Z56B 3L7OA 1RT1A 2LBOA 3RGIA 4K8ZA 3WNGA 4PG8A 2HBJA 4DV5K 4DQPA 2ASPA 2VG7B 2CJBA 2GMHA 2AU0A 1RM6C 1RAFB 3NCPA 1U49A 2F9WA 3C7NB 2SXLA 1X4CA 4Z4CA 5EWEA 4DTNA 8ICZA 4LBPA 3BS7A 4CE6A 4I2CA 3O1WA 4CFBA 1PVRA 3O4NA 2JLEA 5AQXA 2GEMA 2YKAA 3A3OB 3GFHA 1Q16B 3T5KA 4DU4A 1IKYA 2QTWA 4ISFA 3MR7A 4QWEA 3CCQS 1RCOB 2Y1JA 4XPCA 4HUGA 3PHEA 1H74A 1URNA 2KI2A 2DKOB 3VAMA 2DNKA 1QCKA 2IRXA 4CEOA 3J7YI 1IR2A 4ZN3A 1EX8A 2P5OA 3OXFA 4M6WB 4A2BA 4V19X 1TFYA 1SV5A 4CNZA 2AD9A 2XHWA 1Q4RA 1TVAA 1VC0A 1H3DA 3H42A 4ID1A 2P51A 2BABA 2PFPA 3OXLA 1UA1A 3TKAA 1S7HA 1BQNB 4Y34A 4UQGA 1NDKA 2W6LA 1IWGA 1VQKN 2KVSA 1HHSA 2IDEA 1RLDA 3DRSA 1IBKK 1FESA 1V85A 2GMLA 2Q97A 3OS1A 4CLZA 4B9MA 3UQ0A 3TFRA 4QOTA 3LP0A 2ZBRA 2IIRA 2XMTA 4FJGA 4ILJA 3EWGA 2RNEA 2RF2B 4DL3A 2E5LF 3H8SA 2DH8A 3D2EB 1X9WA 5F8GA 1RDCA 4Y3CA 1YI2N 4MTPA 4FJJA 1HMVB 1UJ5A 2BJ1A 3HPOA 3O9QA 5CR0A 3M1VA 3KKSA 2ZIUA 1RU1A 3CYMA 3GBTA 4FVMA 1CQMA 4EK2A 5BREA 5ETNA 4TSXA 4KLMA 3SQOP 3SQ0A 4LVOP 2YKNA 2B4PA 4JI2K 4MAKA 2ZDPA 5GAGP 3CCJN 2G8WA 1JROA 1Y4ZB 5LMUJ 1VSLA 2A3JA 3UKRB 4LF2A 1E6VA 4G65A 4GKJJ 4CGHA 4LF8K 5HMLA 2LHTA 3GCXP 2C42A 3JAMU 2WVFA 4MT1A 3KHGA 3Q8PB 1S1TA 4GV3A 1G1XA 4O23A 1HPMA 3EN9A 2CJAA 4X4SA 3VZIA 1NK4A 3AY0A 2VJUA 1J2MA 1KQFB 2W8KA 2AYBA 1NJIT 3AM9A 3H3NO 1T3NA 4Y2VA 3CPWR 5LM7E 4RUAA 2DKXA 3D6HB 3ENWA 3T1HK 3WDOA 4FKXA 5FDLB 1XNRF 2IVFB 2H4YB 1LK5A 1S1TB 2X6SA 1ZM3A 1C1CA 2F4VF 2J0QD 4E8UA 5AQTA 3R6LB 4DV1J 3WT0A 1XI1A 3ZTOA 4JYAK 4LFAF 3HVWA 3CI5A 2HZAA 3ZSRA 3C1YA 4U7BA 4YOVA 5AQKA 4BGBA 2OYYA 4FF2A 4DR2F 1VAZA 1KEKA 4KTWA 4FKYA 3AVJA 4PPDA 2CNNB 2GWKA 3MN6A 2J76E 2XSFA 2IOFA 4FWLA 4UUXA 4QZAA 1VRTB 1HKBA 4EFHA 1TMJA 1VHFA 2BZFA 3KHRA 1NPPA 5ETTA 2CZ9A 4DR7K 1IBLJ 1ZTTA 2WTUA 4UB3A 3LP1B 5AI5A 2N82B 4GIBA 3H2VE 4Z4FA 3ONNA 3JAMO 2CQCA 3S6EA 1HW9A 3EZOA 3DLEA 2P9IB 1VQON 5AXLA 5IWAJ 1P9YA 2FJXA 4A8YA 3QGGA 3QUCA 4OGEA 1I51B 1Q7LB 4ZN1A 2JC0A 2XYPB 4QIWD 3GV8B 1WSEA 2VANA 3AD7C 2GQ2A 1RBOB 2QSWA 4CO3A 2HGNA 1RZMA 9ICIA 4OYOA 1DK2A 2DR9A 3H5XA 2J7WA 4DN0A 1APSA 3VQPA 2A1SA 2LPEA 4DV3F 4DX7A 4URSA 3H7IA 5AE3A 1SQKA 3PSIA 1JQGA 4NI2B 3T1HJ 4CM2A 2GOLA 1S10A 4B3OB 4CK1A 2J6TA 4CIGA 4RPFA 3ETLA 3OTOF 3NP5A 5KT5A 2DNPA 2NPFA 1SB6A 2G07A 3VEZA 1D8ZA 2FVSA 2JFKA 2MKHA 2RU3A 1RHRB 4CJUA 2WAQF 2VQEK 2XSJA 2RHQB 3DYAB 2XLKA 3M8YA 1NBEB 2P9UB 1G99A 3AQPA 5B0CA 4DMNA 2VD3A 4UB2A 3CMAS 1TV9A 4YVZA 2WRMA 4DL7A 4DR3F 2DUYA 4IRDA 4RQ3A 2E8PA 2IAJA 4QIGA 4NLUA 1NNDA 3WK5A 3CDUA 4R65A 2VWBA 4ZMMA 4YXMA 1QTMA 4FJ9A 3IS9A 4J9VA 1XUPO 4B9TA 4HACB 4ZPTR 1RTJA 1RQ0A 3VEOA 1IQTA 2KG5A 1GK8A 5BR8K 2LYVA 3BPSP 3MM5B 1P9QC 1HBMB 3M1YA 2FQQB 4B3TF 1X1PA 2F1IA 1U45A 1T3OA 4MYTA 3PG9A 2ATCB 1HJRA 4IXCA 2XB2D 4ZVOB 1B7FA 4CW7B 4GVEA 5I3UB 2ZD1A 4ZPAA 4PPZA 3ZDAA 2RVJA 4F4WA 2MGZA 4OI0A 3IN5A 3M05A 5D4BA 4C80A 4DR1J 3SUNA 3BSAA 1RBVA 3RZAA 1AT1B 5LJ5Y 2ZJQQ 1K9MO 2XGQA 1RABB 2FXUA 5J2JA 4CNYA 4KPCA 4OVLA 3U3GA 4RUHA 3LM9A 4BRLA 2MXYA 2DBYA 3CUNA 4KHPK 1PAEX 1GLDG 1C7YA 2FBXA 1WLJA 3NRBA 1BWVA 4U9RA 1HL6A 2YWWA 4HCCA 1OXJA 9ICWA 4B3MF 1WELA 3CDBA 1S9EB 2IYGA 4MFAA 1Q8IA 2ZIWB 1FK9A 2D9OA 4DJBA 2IDOA 2W40A 3LWMA 3BGUA 5ITHA 1FJGJ 3QLHB 3M9OB 3QEWA 3AVCA 4LFCJ 3VPZA 3MEEB 4BQZA 3C2MA 2Z8QA 3HHEA 3CP8A 1U8SA 2M2BA 4CI0B 2DGWA 4NE9C 2E44A 4KGKA 4MFBA 5KFWA 3DRPB 3TWHA 2D74B 2HRUA 1NDCA 5HQ8A 2QM1A 2V8GA 2HVIA 3P38A 4PHPA 2LU1A 2A41A 3CD5A 3ZDDA 3R7SB 3M2UA 2YJEA 1QS4A 1I94F 1K1SA 3GR0A 2JV3A 1PG5B 2GWJA 1HNZK 3GQCA 3CHWA 3BGOP 4UY8O 3M6XA 3KKAC 1MROB 3AHPA 2JEIA 3MM5A 1U6FA 3AB2B 1TUYA 1IV8A 2HMIB 4LF4J 3IBWA 1S6OA 3PUFA 4CGFA 3W7BA 1JLEB 2EXUA 1FRLA 3OTDA 1C0UB 4C97A 5M2RA 2MDAA 1D3WA 1KONA 3Q8LA 3GFXA 3K4GA 4JD2B 4RQNA 2BKEA 4FJXA 4H4MA 4HUFA 2AQ0A 2V8VA 1S1WB 2DR8A 3H46O 1NBWA 5ALQA 4DOAA 1AB8A 1HBOA 1JLAB 4CZMA 2FJDB 1DQ8A 4EWTA 1ZQOA 2A10A 1JRPA 2ZC4A 1VRUA 3F41A 1HKAA 3CCRN 1S4EA 2Y8YA 2KSOB 3CEDA 2DRBA 4FW1A 1RTIA 2V63A 3C6TB 2HHTA 5D4NA 3THXA 1MDUB 4RW7A 4WFAL 4UZCA 2V34A 1HNZF 4MEXA 2NRZA 3ZSYA 5BR9A 3VR1A 1C0TA 3ITHB 5AQPA 4OZLA 4WFNL 4Q7AA 2Y9TA 1NMDA 3M6VA 3BDEA 3GU3A 1XO0A 2HFVA 3CM5A 1MMLA 2VDHA 4A8QA 4RR5A 2LKYA 1NK9A 4USHA 2WBNA 1FWLA 4ENOA 1A9NB 3CF5Q 2VB6A 2YQ0A 3IG1A 1C1CB 4NLWA 3MN7A 3O3LA 3R7NB 2PMHA 1XC9A 4ILLA 4F0MA 2RRDA 2XHCA 3O5BA 2AX1A 4FJNA 1NZPA 2V2ZA 3KXDA 4RQ6A 1JL2A 1ZQBA 2RDIA 5DZ6A 1J6ZA 3B0YA 5AK6A 3HPHA 2AA4A 4UQTA 3I55N 2AJ0A 3I9V9 3C6UB 2C3YA 3PZPA 1R8AA 3B4DA 5A6WA 4C8MA 4IRCA 2JEJA 1Q7YO 2G8KA 3ZFVA 2Q1LA 4FYVB 2CQBA 4QJVA 3J81U 3T1YK 2QKQA 8ICEA 3BO3A 1CS4B 9ICUA 1ZXIA 3CJTA 3ENOA 1F44A 4BWJA 2ZWOA 4DCOB 1ZPVA 3CVKA 2DITA 4RLEA 4FVUA 5H1SV 3VGVA 1ASUA 4P2FA 2DR6A 3R97A 3L3FX 3KD5E 3UE2A 4YXJA 3CDEA 4CEEA 1BY9A 3KJNB 4DBQA 3A2FA 4DU1A 3MOJB 2J8SA 4KLJA 3NMAA 4BR5A 1Q82O 1MNEA 2PFDA 3UD5A 2ZQBA 1AXQA 2XI3A 3JXUA 2C2KB 4DS4A 4OJ6A 2QV6A 1QDUB 2GJFA 4IEEA 4WQ5C 3ZYYX 3J7A1 4P6QA 2VFVA 3ZO7A 3RMAA 2FMPA 1DT9A 2H3GX 4K0KK 3ALRA 2NXCA 2ZVIA 4NI2A 4DV5F 3OJUA 4CFDA 4JNEA 4DV7J 1WHVA 1WUAA 3MAQA 4JV1A 5BRDA 2QLBB 2DGSA 3U7JA 5KT3A 3A0IX 3DM2B 4FFDA 1IKXB 1S8OA 3NAIA 5C25A 4LSNA 3CJKB 4HDGA 4P7VA 1BPXA 2ZKTA 1X40A 1BLUA 2E5LK 3ISZA 3FNNA 3MOZA 1U2VB 2BACA 3F0NA 3A5OC 1VS3A 1TV6B 5E26A 1GTEA 4AYBC 5F0WA 5KFKA 3W9IA 1DY3A 2RD5C 4H5VA 1LWFB 4QPXA 1SJQA 3DLRA 2N7CA 1Z4OA 3DAWA 4JKHA 2D3UA 1F21A 5MAOA 5HSPA 2DISA 2P6TA 4PAAA 4EYHB 2G8HA 2FYXA 4DSJA 1WACA 5J2EA 2E88A 1X0PA 2UXDK 3PX0A 4J37A 3ZZOA 5F9NA 1QZ5A 4CHOA 2FF3B 4K4XA 4F5OA 3UQSA 4NA1A 4C23A 3FR0A 1J54A 3E01A 4KQZA 2NNWA 1TFWA 2FHKA 3NGIA 3J7AP 4UBCA 4IQTA 2PFFB 1SV0C 3ZZZA 4IS7A 2KLAA 2R42A 5C24B 1HIWA 3V9SA 1VLBA 1SH0A 5GMEA 3FUYA 3BF3A 4B8AB 2VG6B 3MMVA 3HOTA 5CXTA 1AROP 5KFZA 2IC3A 3KDOA 3I33A 2RHSB 2HK2A 2Z1HA 4YNQA 2WW4A 1U47A 5GTIU 3A8JA 4CLKA 3AQOA 4FYYB 4NLTA 3W0LA 2M8HA 4NMLA 4UW2A 3NS7B 4ISEA 1KN6A 3HZ6A 3RFAA 4K0KJ 4GVMA 5DJBA 2KZ3A 3F2KA 5BPMA 3FGVA 2JMGA 2MHEA 2FLNA 2Q3PA 2XYGB 2ZTDA 2WB4A 2NYHA 1FWPA 3GJQB 3A8IA 4JK8A 4H4MB 3LPUA 4OYPA 4B3SJ 3QU4A 2B9YA 2ZH2A 4NLCA 3WNFA 4HHTA 4KGZB 1KVKA 2JWLA 1DFDA 4YDUA 5HBMB 3AVHA 2GGPA 3OSNA 3OD2A 2ZBIA 4DR5J 3HRDD 1XEZA 2LXIA 2KN7A 1FRKA 5ALVA 4B02A 4BG9A 1W7AA 1ZH5A 1FWKA 3D0IE 5AQMA 4CH0S 4WXOA 5EE3A 4DV1K 2XHBA 1X31C 1G3OA 5LSOA 4ECVA 2EKYA 1ZYQA 2EWHA 1ZBUA 1GQEA 4K4IA 2ZHBA 1UMJA 1JL1A 3H1VX 1IM6A 5EE9A 2VU5A 4RKUC 5D0RA 4DQIA 1KDHA 2F40A 3LP3A 4J9PA 2JGUA 1X0FA 2DR5A 4LF5K 3OS2A 1PK1B 2UV8A 4HEA9 2V52B 4A8OA 3VAHA 1UA0A 2J9CA 3SBTA 4E7IA 2FC0A 2VYPA 3DMJB 2D7SA 2AV5A 5D3GA 4GLXA 4ILMA 2YMLA 4E1NA 4DV6F 3Q8SB 4P9SA 1Q8BA 1ZQZA 3A1YG 1TV6A 2E8MA 5J2NA 2G13A 6FDRA 1FTRA 1LWCA 4LRAA 4FNHA 3HW8A 2XZTB 2XQCA 3LVVA 3EDRB 2X1GA 3HHKA 2UXCJ 3QGPA 1GXTA 2YTCA 2FDRA 3MFHA 3S1TA 2XZWA 5B08A 1PCAA 1NKEA 5AM2A 3RH5A 3M8ZA 1OWXA 3QRQA 3R1LA 2R7YA 1QLNA 1WAFA 3R2DJ 3PSFA 1LEOA 2OIHA 4JI4J 1U4BA 1K47A 3QIOA 1UT8A 2AP6A 2QA4N 3JQKA 4AUKA 3KHHA 3R2CJ 1WI6A 4M5GA 1BU6O 4CGIA 1U09A 2C2DA 2C2ZB 2VIXA 1YJNN 3K89A 1YF5L 4C7ZA 3RMCA 4JI8J 3THWA 8ICQA 2VA2A 1DQAA 5DDPC 3B8AX 4A8XA 1WSGA 4WFNQ 4JI5K 4F5RA 1SL1A 1OIAA 1CRXA 4X4VA 4UB8U 2RILA 1U1KA 2XZDB 4FOIA 5KFSA 3OVNA 4E7HA 2VQEJ 2QWQA 1RT1B 1LWEB 4DN9A 2WF6A 4YY3F 4GKKJ 2GGPB 4UAYA 4ZLLA 3CC4S 5CYMA 4CDGA 2BEFA 2ROPA 4NLDA 4BE2A 3THYA 3IMQJ 2DNNA 4BJQA 3T5LA 4A8EA 4RW7B 4BS2A 3G6YA 3EDQB 4MIBA 4LFBJ 4C8NA 1BA1A 1N5VA 1YAGA 5BR8J 3RJKA 1JLCA 3PKMA 4K4ZA 2B0CA 2QMWA 2HNDB 3PVXA 3B6PA 4X4PA 5AZJA 4I1TA 3U27A 3PYDA 5F8NA 3J80O 3THYB 2MKCA 4L74A 4PCQA 5J2QA 2YQEA 1VGYA 1FXRA 3CCZA 3IV6A 3WK6A 4RBTA 3GDQA 4DR1K 4RW4A 3O9TA 1HBMA 3TUZC 3TZWA 4M47A 3F5AA 3F44A 3H0PA 4JI4K 4DL6A 5KFXA 2H51B 4O3OA 5K14B 4ZVQB 3ZSWA 3C2KA 3TFSA 1XMOJ 1F5SA 1EXNA 4F91B 2G2ZA 1DQ9A 3OTEA 4A2AA 1YVFA 5K8OA 4KH1B 4LFCK 4K4VA 1Z1VA 2LYHA 1SJRA 2PIIA 3C66A 1IJJA 1HKCA 3THWB 2I2YA 4CWBA 3HVTA 2IFXA 1GTHA 2B5JB 2FBYA 3MXHP 1HWIA 5AT1B 2QFJA 2ZFHA 4Z6CA 1X4HA 4I9LA 2QLXA 1RT7A 4AM7A 3P39A 1IJEB 4RNOA 4CZKA 2W4CA 1KKHA 3NLCA 1RAGB 3PIPL 1YRTA 3T69A 2CQ0A 2RDDA 5F8HA 3PDNA 2QGFB 1LOUA 4CT9A 3CMES 1BIZA 1A6LA 2CKWA 2F96A 2CQHA 2YPYA 4FPAA 2G8UA 1X3MA 4UAZA 3B9JA 1LXJA 3JPTA 5AM3A 3MDCA 2BPCA 9ICNA 5KFCA 3PO4A 4W92B 3Q23A 3AVGA 3FEYB 4ATNA 3UXPA 3HSDA 1VSDA 4CJEA 4O8KA 4LF4K 2YQ3A 2WSEC 4DUYJ 3Q8MA 2B6GA 1KEJA 2DTJA 1JCEA 1N5TA 3HPGA 4BR0A 2FB0A 3OHRA 5AQOA 3D6MB 4YOWA 5A8WB 1ZBSA 4V19S 4FLXA 3SSQA 2KKZA 1ZBIA 3AVNA 1LKYA 2M0GB 2IJRA 1IR0A 5CZXA 3RF9A 4J9NA 1JJ2M 3NCQA 2ZZTA 1FI4A 1S1XB 3D68A 1IG9A 2BKOA 3TQEA 1NK8A 4DV2F 7ICOA 1J5EK 3NY0A 2C28A 1DTQA 2Q1NA 1NZBA 2PEHA 3HHLB 5E5NA 5HANA 2E3TA 4ZPBA 4CJLA 2IA0A 2GQQA 4ILRA 3VCDA 4DV3K 1KP6A 2KIVA 4JOUA 5F3TA 1F5BA 2OFGX 4ELUA 2BJ8A 5KG1A 4PZVA 3OBIA 4PY5A 4FK2A 3VA3A 2DGQA 1VR6A 4C48A 4A8WA 4ZKAA 3AVMA 5GMDA 9ICVA 2KT3A 4DEZA 5KQ8A 2MRLA 4KH4A 3MI7X 4GNIA 7ICVA 2V51B 3UN2A 3CPWM 2C2EA 2ZD1B 4DX6A 2CPDA 2NRRA 3MPWA 3SEOA 5HO4A 2IRYA 2UYTA 2JVRA 1JMTA 2QFIA 2GBZA 1VQ6S 1CJVA 5AFUA 1B7YB 3SSRA 3W63A 3CJKA 4LR8A 2NYVA 2X51A 5CH7B 1PYSB 4GY2B 4F2RA 2O8EB 1N36K 5EY4A 2QW9A 1N36J 3SJJA 1VQLN 4NXMF 2DPJA 1UPPA 2HBMA 2W03A 2ZM6F 1UZHA 4RG8A 4QWAA 2QO3A 1BC6A 1S59A 2K1RB 1NPKA 3HP6A 4U67L 1PC4A 1XN9A 1VQ5S 2VODA 4EGLA 1X9MA 5ALDA 3NUQA 1NH7A 1RLCL 1QQCA 2XCPA 4LF9J 1ROFA 4I2PA 3AU6A 4Z4IA 3K9KA 4UATA 1ATSA 5IC6B 5AQSA 3JXOA 3BS5A 3DDHA 5L1IA 1TKTA 4IJAA 2HKEA 4EZ6A 1VRTA 1TR0A 3J7Z5 1ZQTA 1V3SA 3DLJA 2W9MA 2DNGA 4W98A 1RT3A 3KTQA 1HNIA 3B0XA 4KN4A 3EY1A 4PHAA 2CXYA 3L09A 3C15B 3R5CA 5IIKA 2NXNA 1JIHA 1REVA 4HH1A 1VQ8S 2JR5A 1BQNA 1KDNA 3PRVA 3S8SA 4DS5A 4OYIA 3OFFA 4Y2TA 4Y2XA 1KAYA 3D1HA 4DZ6A 1D09B 2KRBA 3BSNA 2VH7A 2ASOA 1ZAVA 2DGUA 1X2IA 4GVBA 3CQYA 4NXMK 2EG2A 2FI1A 4XIUA 9ATCB 3O80A 2KSOA 3HJFA 3CCJS 4CLLA 1NNEA 5ALKA 2Z1GA 1GNKA 2HHHF 3IAS9 2IPOB 3D67A 5GIOA 4CJWA 2CRLA 1VDHA 2BTFA 3VTHA 3JTOA 4UY85 4KITB 3MEKA 1L3VA 2RF2A 4K4HA 4RU2A 4YY3K 3NKYA 4YMOA 2KICA 2UUBF 4OJGA 2XMUA 4HHJA 3QAEA 3FBFA 1TKZA 4EENA 4YHHK 3QWPA 1MU2B 4ZCKA 3TAFA 3ZI4A 4OKJA 4HLBA 2VWKA 3P5JA 4Z0UA 3HFVA 5J0WA 1FA0A 3CCEN 4CO1A 5JU5A 5MLCV 5KG2A 3H8WA 2ZWPA 4JYAF 1N60A 2UXDJ 3VGLA 3OYNA 2WFBA 3FZLA 5EE1A 2QWNA 4NCGA 1RWXB 1QQMA 1VQ8N 5C25B 2NZTA 3A0HU 4UB4A 1CJVB 1BHNA 1MU2A 4BRIA 1M1GA 1FEHA 2A2CA 2UUAF 4DR2K 4K8XA 3AJ1A 2I5JB 3HKWA 4X66J 5G5HA 3BV8A 2NUHA 5IQ6A 4QS8A 1B64A 1V5VA 2BDPA 1YKWA 4FL9A 3ZD8A 1HBOB 3BN4A 2OO4A 2K8AA 3IAM9 2NXEA 3C28A 1LFPA 4PZNA 4YD2A 3EVMA 3PV8A 3D2FA 1N0UA 5ETKA 2V4JA 4M9GA 4C4TA 2AEFA 2DFHA 1IKYB 4M5LA 1VC6A 3FEXB 3MM7A 4GKKK 4F04B 1RTDA 4OJ5A 2YHAA 2K8BB 4P2HA 2HVEA 4C0HA 1AFJA 4UARA 4F4AA 4JV5J 3MC1A 4EO8A 4FLTA 4JI0F 3UCZP 4LF1A 2V67A 3UWTA 3BYRA 1QQOA 1H2TZ 1IV0A 3KLIA 4FBUA 4O3SA 1HPZA 4Y2SA 3M7DA 2FY1A 4B1WB 1N5YA 5ALHA 3ET6A 3CCRS 1MMNA 3HI9A 4OHVA 1FFWB 3EE8A 3FK4A 1HNXF 1FKPA 1OVQA 3A5LC 2IMWP 4JI6J 3GSDA 2E8NA 3KLHA 1P1LA 3O8WA 1CLFA 3I87A 3KK1B 4LF7F 1N63A 4J9KA 4H0YB 5JUMA 3M8RA 1WG1A 3I96A 3WHIA 5AHXA 3LANA 2IVOA 1R89A 5JVGQ 5I3UA 3IA0A 2I7NA 1TYQB 2CQDA 5T7LB 1KXPA 3I55S 1SKRA 1V3ZA 2DNYA 3JSRA 4AILC 1JXLA 3OR2B 3C6HA 3MMCB 4KAZA 2YWKA 2EI5A 1FDDA 3WK8A 3TVYA 3AA9A 5EUHA 3SUPA 5FRMA 2B8PA 2XMKA 4ICLB 1YJRA 3SDEB 1BPDA 4L75A 5CHCB 3DDKA 2OEHA 4JKEA 4QQBA 1MW7A 9ICHA 4BRMA 1VQSA 2O3DA 5C2CA 2HHWA 4KBIA 4XEIA 1VI7A 4GXJA 2NS1B 4DFKA 3V7JA 4ECRA 1SQFA 1L7PA 4IQXA 4B3TK 1TAQA 3GJRB 3B6BA 3J7YU 4B08A 1XSLA 4O8UA 2FZCB 1A76A 3CCLN 2QWRA 5DG8A 3IBPA 2L41A 3CO0P 5AZJB 4QZDA 3BQTA 1HEKA 4BVPA 2QX0A 1SIWB 1VQ9N 3RU0A 4IH7A 3SCJE 4DXLA 9ICMA 2RQMA 1YLXA 3JPNA 3MTJA 3ZX0A 1OPZA 3K5NA 4ELVA 3AO1A 3NGZA 2G0JA 3DXMB 4MFBB 1V3RA 2XVTA 2Z30B 1HJOA 3CMEN 4IKFA 2DHSA 5CEHA 5M2UA 3LP2A 1K73T 1RBLA 5DM6L 2QWPA 3GIIA 3M6ZA 2EFPA 4XH4A 2FHMA 5A0YB 3O1BA 3WEEB 3VWSA 7ICUA 1AYEA 1TL5A 2HRTA 3OBYA 3KUGA 1EJ7L 5FPDA 5F8JA 4HHUA 1U02A 4RPYA 5F0UA 2KFNA 4ECZA 9ICAA 2DGZA 4G1PA 3DOKB 4RW8B 4USWA 2CH5A 1NJYA 4JWNA 2B7BB 4C3MA 2RAQA 4G9BA 2UVRA 2F7VA 2G2OA 4CLTA 3TWZA 1Q7YT 5AKJA 1NKCA 1J5EF 1U8WA 1D8BA 4NPOA 8ICJA 2ESEA 2RRNA 2O6KA 3MM9A 2P9KB 4JRPA 2K4PA 4NO7A 3MX2A 2BOAA 3OS0A 2YKQA 2LQ8A 3AA8A 1S1WA 4ZS6A 1RWKB 3VN5A 3LWLA 5BXIA 3MR2A 1XR5A 3W60A 2N3OA 1V4SA 4RNMA 2KHDA 3WNHA 4BY9C 4GFJA 1UFWA 4KRFA 3NGSA 4QZEA 2JDJA 1IKXA 4ZTJA 5DQHA 2K06A 2JEGA 1X4DA 1WJ9A 2HS0A 3T9NA 1C0MA 1S0NA 1Q46A 3SR6A 2IM3A 3VESA 2P6UA 5KFMA 3G4SN 3TAEA 2VA8A 2OM6A 3KUEA 1D8YA 1U2CA 1T0TV 2QZ8A 3V7KA 8ICRA 1BCMA 3DYAA 3J80Y 1UVJA 3ZXWA 5ETQA 1BWEA 4BXOA 3Q89A 3VQ6A 3N7PD 1ZQDA 1NEEA 3LDQA 4PUOB 1PBUA 2QWOA 2YJFA 5CR4A 2PMWA 5GADU 2H3ZA 3R7BB 1FFVA 2ASJA 1FEEA 3V4MA 3MBYA 2K1RA 2Q6CA 4WPAA 1SPBP 2JH7A 1XNSA 3F5EA 2YWEA 1Y7PA 2OFHX 4ZP9A 2WCXA 4BRDA 2BVZA 4ZVTB 1I3AA 2IC3B 4DG1B 3G6EN 1BXNA 4NYNA 3E66A 5IFMA 4M04A 4F4ZA 5IZHA 1DARA 5AXMA 5LY3A 2V9KA 2DH9A 3AH6A 2ZE2B 3MECB 4NLVA 1QSYA 1S1VB 8AT1B 2F8SA 1IJFB 3L3VA 3LPYA 1DOQA 1QSSA 3TX8A 3LAKA 1GXUA 2CNOB 4E1MA 4QZFA 2E1CA 4YG2A 2KFZA 2OXOA 3O44A 2VKZG 4BC5A 2CJXB 4CH1A 3MMBA 2VKQA 3ZTPA 1NUEA 4LJMA 2AXTU 4XUSA 2BYCA 4P0PB 2ZUGA 2NLWA 4J03A 1SC1B 3N7SC 4KV8B 1ZBLA 4RNNA 1NGEA 3GCWP 2ZVSA 4A62A 3K5MA 1W26A 2Q4TA 2P9PA 3NVKA 5KFPA 2A1RA 2FGCA 2QSFA 4K4UA 2F76X 1RXOB 5HQMA 4NYPA 1RILA 1FXXA 1WSRA 3E2EA 3RJEA 1YK9A 3HKZD 4WFBQ 2W43A 2OPQB 5J2QB 4ER8A 2JH1A 4JI2J 3C65A 1IO2A 5JICA 5J2AA 4DSFA 1Y3KA 2GVZB 1FKOA 5AIAA 2HLTA 2E1FA 4DV7K 3I28A 2RPIA 2CPZA 3KG1A 4JV0A 1HYSB 2HVHA 2R3VA 1NKBA 2OSQA 4P72A 1U6ZA 5J2PA 1P8ZA 3BKTA 1FRXA 3L2VA 4K2JA 4FS2A 2U1AA 4TYBA 2E9ZA 3S3OA 4FYDA 3QYPA 4K8RA 1BL3A 4O44B 4KHNA 1HWLA 3HI0A 3HYFA 2HOQA 3CQ8A 3VGSA 2RH3A 2H3QA 3EGWB 5CABA 1IXRA 1IR1A 3HHLA 2XEXA 3TAPA 4QR2A 3DLKA 2DQNB 1KOHA 3QRPA 1TK8A 4YB7A 4Y2QA 8ICWA 1RSCA 3ZZ0A 4KHMA 1JN3A 1Q0NA 2VG6A 3IG5A 3MF5A 4M63A 4TUQA 4B9VA 3FE1A 3L2WA 2PD1A 2WF9A 1LW0A 1O8BA 3RB6A 5K8MA 1YVUA 4L73A 4W5NA 1ED1A 4IZ9A 5HROA 3VEXA 4UOFA 3DLEB 1NSQA 4G9ZA 3HSJA 1M0SA 3H5SA 4CF9A 1YZ6A 3QQCD 2BGWA 1SJ4P 4CJ3A 3GB0A 5GAHP 1Z6RA 3GIKA 5K4LA 2P35A 1P90A 2UU9J 1A5XA 2P6RA 2WZ1A 3ET6B 2KJWA 2YTUA 2E5LJ 4RBUA 3R5DA 1ZC6A 5J0SA 2V0NA 2EHGA 3CNQP 3OYEA 4DR4K 3ZDEA 3GDXA 2Y0SC 2ZUDA 4IG3B 3ZCMA 4FJIA 1SKSA 1R0BG 3LDPA 2XS2A 1N0VC 3E9PA 3KG0A 3TA1A 3FCVA 3WIVA 5AM5A 3VEWA 5KT7A 2DO0A 4OL8A 1YG0A 4BC9A 2LMIA 4EHTA 1FJ7A 3ATUA 4JI3J 4JI3K 2FHOB 1VSFA 3NDKA 4WQ4A 3BUZB 4OIXA 4BREA 5E0OA 1N33J 2GHPA 2NSBA 1V97A 3SMVA 3A5NC 2ITGA 2Z57B 5BOLA 1NLKL 5J2MA 2YY6A 1TVRA 2H5IB 4Q8FA 3N4PA 1ZQAA 3CJAA 5ALEA 1WSJA 4ZPDA 3EM1A 2ZH1A 4I0WA 1ZOTA 3C7NA 1PYTA 4CF1A 4KLUA 1S97A 1OH7A 1BPBA 1C1AA 3HRGA 2XC9A 3KLEB 5ADXH 5B66U 1XNRJ 3G25A 2ISOA 3OA9A 4I6AA 3QNWB 3BGFA 4Y2MA 3A4TA 4IQVA 3DI6A 1V38A 1J2VA 4CJ5A 1RAOA 5HJXA 2O8FA 2LXFA 2PN6A 2P9LB 4WE1B 3M6KA 1S6UA 3CE8A 4PWDB 3NF6A 3QICA 2E6MA 3QEAZ 4OZ1A 3ULEB 4BRKA 3ISCA 4ETZA 5EX5A 2D0OA 4F5QA 5AZIA 1MN8A 4Y2JA 4CJKA 4DR6K 2KK0A 2Z58B 1XNQK 4ZLPA 3WX4A 4DR4J 2EWSA 3DJCA 2CQ1A 1FKOB 5HROB 1JLAA 4CLPA 4MKYA 2OPRA 4F2SA 4IRKA 4ACOA 2EK6A 4OI4A 4HTIA 4BE0A 4ICAA 3RAQA 1GLEG 1WNSA 4OHXA 4DSEA 3TEGA 5K20B 1XO1A 3MEEA 3WC2A 1RBTA 4BC3A 2P9SA 2OLWA 3AV9A 4B8CA 3LGMA 5EU7A 2WVCA 4EMDA 1S4FA 2MB0B 1NHVA 2BKNA 2O8CB 2MKJA 2ZH9A 4X2BA 3AAQA 1EO1A 4R25A 2VCPA 3PJWA 1UAWA 1WG5A 2KYXA 1QAJA 1FT8A 2WOMA 4PKGA 1RAHB 3QEPA 4CEDA 2B21A 1VCTA 5J0XA 4LF8F 2DVIA 5LXYA 2Q43A 1WAJA 4C3KA 4KAIA 3E51A 2HHXA 1SJ3P 4F02A 3AGKA 1UPHA 5D77A 1OH5A 4BR2A 2OTJN 2N3LA 2E8AA 1X6IA 2UUCF 5AQQA 5FROA 1H2UX 2HBKA 4JI6K 5BPNA 4PL8A 2I8EA 1WG4A 4W5QA 4DUZK 3ZSQA 4I2FA 3PHTA 3NWGA 3ZTSA 4ED6A 4O3NA 4LRDA 3HHNB 1IKWB 4JLHA 2HEKA 2GJIA 2H3EB 5C5JA 1ZQVA 2QARB 3EKUA 2D0BA 2ATLA 3DOMA 4DR3J 1JLEA 4U7UK 1C0GA 3FAHA 4CZCA 3SV4A 2E1RA 1WCNA 2G1HA 2KD1A 2BCRA 3A13A 3K5PA 2HF3A 1YBAA 1Y5LB 4C0OC 3O3FA 4N77A 2UV8G 2A1AA 3NS1A 3BBCA 4OJHA 4FF1A 2RN2A 2E5SA 2OH2A 1CULB 4LF6F 3Q8VA 3I0SA 2R7VA 3AVLA 2D69A 4LRCA 1HR0K 2MYFA 4CEBA 3ALYA 4UASA 2MU2A 2JRSA 5K5MA 4X64F 2R2RA 3PRBA 3J7ZO 4HWIA 1VJWA 1EWQA 4PJ0U 2AIRB 3QSIA 4MF8A 2BBEA 3IAYA 3I0SB 4FWRA 5HP4A 3QMQA 4K4TA 2WK4A 5L1JA 2D5RA 2ATQA 3VQ7A 3RBXA 5HMMA 2MQOA 2ZIXA 5D0EA 1C2PA 3OFEA 4DUZF 4P73A 1Y5IB 1QE1B 1RHUB 4NM2A 3MEGA 1F1BB 4HH0A 2VUGA 2E9RX 3HCXA 3M6GA 3NFAA 4JI7F 4LRBA 3OYFA 4K43A 5I4MA 3BGRB 1NOMA 5H9EK 4LRFA 5M1FA 1S9EA 2NRVA 4J9MA 3QFWA 1JCGA 2IGIA 3HX9A 3MM6A 2RS8A 1T03B 2BJEA 1TU0B 3WXJA 4ECTA 1RKIA 3D9BA 4FVCA 4NZ6A 2MQQA 1BIUA 4FLVA 5AIBA 2V7YA 2C1EB 4LF6K 2OPPA 2A3ZA 3KWIA 4LFCF 3AAWB 2IM2A 4JAXA 3RRHA 4PXEA 5KRSA 1SZHA 1R0AB 5AJ3F 4WU3A 1B4FA 4I2PB 4H4KA 4CTAA 4X65K 5EN1A 4DSKA 5AI6A 1IQZA 1W7WA 4A57A 1YJWN 1W97L 4Y0FA 3FM9A 2FZGB 3GU0A 5JVHQ 3FFIB 1ESVA 2XY8A 2P9NA 3SBMA 4CJQA 4USTA 4CQ1A 1O5JA 3FBCA 2AJ2A