1U48A

Extension of a cytosine-8-oxoguanine base pair
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 215
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u48A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u48A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u48A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u48A01
1RDBA 3N97B 4DS5A 4FJXA 3SI8A 5KTQA 4J9QA 2QKBA 3UQ2A 2V9WA 4FLYA 3RMCA 1JLGA 5DGAA 3C23A 4ID1A 5CJ7A 1CUKA 4O3QA 1A5VA 4I2PA 3C21A 3CQ8A 5HHIA 2DPIA 2P5GA 3VN5A 3HPOA 2HNZA 1S6PA 5J2BA 1HMVA 4O55A 4DEZA 2PYJA 3B0XA 1ZYQA 2J6SA 1A5XA 2RDIA 4IQUA 4OVLA 3HL8A 3QNOA 2RDJA 2UVUA 1LWCA 8ICTA 4QWEA 3PMLA 3TR8A 1W9HA 7ICMA 4FM0A 1RBSA 2XO7A 2ISOA 3ZDAA 3OYIA 4EBCA 4YR3A 4RW9A 1B9FA 3ULDA 2ZUDA 2IHNA 7ICJA 5F9LA 3K2PA 4I29A 1TV6A 4NLNA 3SJJA 3OGUA 3EY1A 2MUTA 4YFUA 1Y97A 3T5JA 4XRHA 1C1BA 2ZE2A 1A5WA 1CXQA 3LANA 5HRPA 4KLEA 2JZBB 4RQ0A 4CEDA 2VG5A 3ZDCA 2OPQA 3QIOA 3NDKA 4DFPA 1IKYA 4MFCA 2IC3A 4KN7A 4K4GA 2LYHA 2ASLA 5C25A 1WAJA 3AA4A 3AVLA 4UAYA 1JLBA 4UBCA 4KLSA 4GXIA 4RW7A 5KFHA 8ICJA 8ICVA 3VQ5A 3V7LA 1RXVA 1ITGA 3ISNC 7ICNA 1G15A 3AO5A 5L1KA 4YMNA 4AHTA 4FVMA 4DQQA 3BQTA 1S1WA 4LH4A 5IIKA 4HYKA 4RQ7A 4IDKA 3BDPA 1S77D 4JLHA 4KI6A 3NAEA 1B9DA 1JMSA 5DDYA 2ZTCA 1GOBA 3ZSZA 2ZUBA 1Z26A 5KFKA 3V6HA 2R8GA 3L3VA 2KZ3A 3RJFA 4UAZA 8ICQA 3DMJA 1O1WA 2HVIA 1UA0A 5EU7A 3JPPA 2HHUA 9ICXA 4I2EA 5J0WA 4OLBA 1ZQWA 1X2IA 1R0AA 2FPLA 3OYJA 2KZMA 3QEWA 1TK0A 9ICEA 3L3UA 1RTDA 4ECQA 1VRTA 4PPXA 1WSHA 5D3GA 5KFMA 4CJQA 3V9WA 4O5BA 1BISA 3PV8A 4TQRA 4EBEA 8ICWA 2XCPA 4CJRA 5DLFA 2YV0X 4YNQA 1RILA 4GLXA 3V7JA 1ZQCA 3K5MA 1B22A 5D46A 4QZIA 1TVAA 3CM6A 2JGUA 3H4BA 4CGFA 8ICHA 1ZQTA 1BL3A 4I27A 5KRSA 3H8WA 1LAVA 5KG0A 4CJFA 4YMOA 1MQ3A 1IO2A 4BGDA 4M04A 3N4MB 5KFJA 1ZQRA 4QW9A 2P51A 4ED2A 4R66A 3Q8MA 4Q0BA 4DSIA 4ECUA 1BIZA 3SCXA 2BQUA 4LD0A 7ICEA 1ZQUA 3JPTA 3QNNA 4DFJA 2BGWA 1ZJNA 2IDOA 4Q43A 5KFPA 4DS4A 3AO3A 1NK6A 5J2PA 4YN4A 1NKEA 4ED0A 4G1QA 4KTQA 4QZGA 2LSNA 3ZSOA 3KLFA 3BGRA 2OPRA 2PFPA 3ZD8A 1Z00B 4J9SA 4QOZB 4RQ1A 3SNNA 3Q8PB 7ICTA 2HHVA 8ICUA 3UPQA 4M9HA 4DTRA 2R8HA 4FM2A 3WNHA 3LP2A 4F5QA 3C6UA 4P4MA 1N5YA 1VSKA 9ICUA 3HSTB 2BE2A 5CA7A 2KTQA 4TQSA 4YD1A 4FLTA 1IXRA 4EZ9A 1RT2A 3AVFA 4E1MA 3OSNA 2NRWA 1RBUA 4FJGA 4CEAA 5J0PA 3O3GA 2C2DA 4O44A 3KK3A 4KTZA 4QWAA 3MFIA 3HM9A 1NK8A 3OYFA 4O9MA 5L1LA 3VQEA 4PGXA 4DL6A 4RQ2A 3ZDBA 2W8LA 1ZBUA 1BHLA 4QZEA 5D49A 1C6VA 4JRQA 3DOKA 4DG1A 5CWRA 1NK5A 5CY4A 1BCOA 3MDCA 4CERA 5KFTA 5KFVA 2F1HA 4R5PA 8ICYA 4DTNA 3PO4A 2DFLA 1UT8A 8ICOA 2P6RA 4LVSA 4IQTA 2PI4A 5KG1A 5J2CA 3S3NA 4KRFA 3L2UA 4X5VA 4I2IA 3C5FA 1VRUA 1ZQXA 5KG3A 4ID5A 3KLIA 4F2SA 4EYIB 3RJJA 4C8LA 5KG5A 5DG7A 2HHXA 3VQ6A 4F4WA 3WNEA 1XC9A 9ICKA 1NOZA 5IIIA 3VQ8A 3RB6A 2D0BA 3UXPA 2MAXA 4RQ5A 4KHSA 4FO6A 4NLZA 4E19A 3QEVA 4I2GA 4KKOA 3QINA 3IG1A 2GWSA 3SQ0A 1ZQDA 4Y1DA 5HP1A 4CIEA 1VSLA 2UVVA 5KI6A 1HYSA 4B9VA 4EP4A 1Z3EB 4CF0A 2HHTA 1BPXA 3TARA 4UBBA 3C5GA 1J9AA 4DQSA 4CF9A 4NM2A 1IKXA 4K4IA 2VA2A 1LWEA 1JN3A 4FJ8A 4RQ6A 1ASVA 3OYCA 4Z6EA 4M3ZA 1YVUA 4R64A 4CJ4A 3ZSRA 4Z4IA 2R8IA 4DTOA 4KLFA 2BPFA 4K8ZA 3ALYA 1XU4A 4FLUA 3Q8RB 2PFNA 1S1VA 4RNOA 1D8YA 3K5NA 4JS4A 4XIUA 1JL2A 3H7IA 5KFYA 3BQ0A 2EX3A 4CEEA 3RR7A 2ZUCA 4LY7A 4IRCA 2G8WA 3P1GA 3ZDEA 2YNGA 3MXMA 4F92B 3KD5E 4YQWA 4M9JA 2ATQA 2HMIA 7ICUA 3DRPA 3FDSA 2IS3A 1TAUA 1Q8IA 4YP3A 2OZMA 5J1EA 8ICXA 4NM1A 1HNIA 2RKIA 3O3HA 2D0CA 1CEZA 1NK4A 4Q5VA 3LK9A 3RB0A 1SL0A 5DQIA 1QS4A 4RW6A 3MBYA 3U6FA 1WAFA 5CYMA 2X6SA 3SZ2A 4CFBA 1SZPA 1RYSA 4IRDA 5BOMA 3H8JA 4R65A 1S1UA 3D45A 1J53A 3MGIA 2G8FA 4MEYA 1ZQJA 3RH5A 4QWDA 1ZQOA 1L3SA 5J0YA 3B6OA 5KFZA 5J0RA 4ICLA 2PYLA 4I2AA 2E6MA 4RNMA 4KHYA 3GV7B 4B9LA 5DK5A 3HO1A 3OJSA 1BI4B 1SKRA 3KK2A 2ZQBA 1ZQQA 5J2QA 3KK1A 1S0VA 5FRNA 2FBTA 4KLDA 4Z6CA 3HPGA 3UXNA 2QK9A 4FM1A 9ICRA 3ZT0A 3LAKA 3IAYA 1V9PA 4UB3A 4PGYA 1J54A 4JV0A 4NYFA 2H5XA 3IHQB 1VSDA 7ICLA 3OYEA 5DG8A 2VA3A 4OLAA 4ED3A 4FW2A 4OGEA 3MECA 5K14A 4OJRA 2AQ0A 2FMQA 4FBTA 3NTUA 5KT2A 3S3OA 4F4ZA 8ICNA 1IKVA 1UT5A 2YNHA 5L1JA 3RJKA 4I7FA 4RT3A 3JYTA 4NXZA 1ZQYA 1RBTA 3JPQA 4M6WA 4LZGA 4F4YA 3ZSXA 1N6QA 4KLJA 4B9NA 3VQPA 3NE6A 5DMRA 4F50A 3NFAA 4PY5A 8ICBA 4FK2A 1HUOA 3PW4A 2KZZA 3OHBA 1TKDA 1RT4A 4Z4GA 2ISPA 5KFNA 1S10A 3AVMA 4NCBA 1ZQIA 2BHNA 4IBNA 4Z6FA 3AVIA 2W9BA 4M47A 2BCSA 4F4XA 4KLOA 2KQ2A 4CGJA 1VSIA 4QWBA 3TAMA 3HP9A 5DQHA 5J2GA 3HXMA 5J2MA 4I9QA 5D4BA 3THVA 1EETA 2HHWA 2NRTA 4XA5A 1ZQFA 2C22A 4QWCA 9ICOA 4M3WA 5KFRA 1QE1A 4CJKA 3VQBA 3TAQA 2XGPA 1BCMA 1JXEA 2O4IA 1JLFA 3M8QA 3WNFA 1KVAA 4NY8A 4Q8FA 5J2AA 4Z4CA 3RRGA 4CJVA 4Z0UA 4Z4FA 3RAXA 3K57A 2F8SA 4KHNA 2X78A 4OGCA 2YKMA 3H40A 4ED7A 2XGQA 5C42A 4UQGA 4NLKA 1RT5A 1VSHA 4PH5A 3SV3A 8ICZA 4FJJA 4KAZA 2F1IA 4M41A 4FW1A 1U9LA 4JRPA 1TKXA 1QHTA 4PA1A 5KT3A 4O5EA 2YKNA 4DLEA 1S9EA 4MFBA 5EWFA 5DBAA 4BE1A 5L1IA 1MQ2A 4B8AB 3AA5X 1ASUA 4CK1A 3QETA 4CJ3A 3MAQA 4BE2A 4DF4A 4OKEA 3RBDA 3KLGA 2R8JA 4NYNA 4AHVA 2W9MA 4Z4HA 5EWEA 4F5RA 1L3TA 3QESA 4EEYA 4P2HA 3LP0A 3V72A 2PFQA 1QSSA 1FKPA 2ZJAA 1ZJMA 2YHAA 4E7JA 4RG8A 1U49A 4EYHB 2JZBA 4QAGA 3SUNA 2FC0A 4YCXA 1RT1A 4M45A 2VWJA 1S76D 3E01A 3T1AA 4H4MA 2HNYA 3NHGA 3RB4A 2HB5A 4KPYA 3LPTA 4CK2A 4F5PA 3H08A 2GUIA 3HWTA 1L3UA 5HP4A 3ZCMA 1EXQA 3PX4A 1ZETA 1ZQGA 3L2WA 4CJLA 2DFEA 1FK9A 2P1JA 2DFFA 3TAEA 3PO5A 2J6UA 3V1RA 3OS1A 5CB1A 5KFWA 4O5KA 5DQGA 3EPIA 1S5JA 2C28A 2D0AA 1RDCA 1U04A 4E89A 5FROA 4W5RA 4DU3A 4Q44A 2C2EA 5FRMA 2OZSA 4IQVA 5KFIA 1ZQAA 2VANA 1NKBA 2BPCA 4JV2A 3OYKA 3VQDA 1K6YA 4Q8EA 7ICKA 3MR3A 1UOCA 3AU6A 4C8MA 2XRIA 3G10A 5J29A 4CIGA 1VK0A 1YT3A 7ICSA 3RRHA 1S6QA 3NGZA 1IM4A 3P83D 3AVGA 2AGQA 3LALA 5DB7A 3AU2A 4RNNA 3JPSA 4YMMA 1EP4A 3EWAA 1SV5A 4J9PA 4J9LA 2IBKA 1B43A 3AV9A 2HNDA 4MF8A 4KHQA 1T3NA 2VA8A 4LSLA 2Q0ZX 4AILC 2DFHA 4TURA 3HVRA 3AVKA 3M9NB 3RBEA 1JLAA 4B3OA 4GMJB 5HBMA 3V9ZA 3AO2A 4BXOB 3GIMA 1NJYA 3V4IA 2IMWP 1MC8A 4DSLA 5IINA 2QXFA 2W8KA 1HYZA 2I5JA 5HLFA 2FMSA 2IHMA 4I9LA 4J9MA 3RJEA 2X6NA 2XY6A 3NF9A 3TANA 1TL1A 3NGDA 4HTUA 3ZT2A 1JIHA 3HW8A 5IILA 1RDAA 4DL5A 4DL3A 1KVCA 2Z1GA 1H38A 3NH2A 9ICGA 3DLGA 2ITGA 3DYAA 1Z00A 1T05A 4I2FA 5J2JA 3TI0A 9ICHA 1X9MA 2IOCA 1TV9A 1BQMA 4KMUA 2OWOA 3QE9Y 1KLNA 3P5JA 4B8CA 5KFFA 3DLEA 3RMDA 5CR0A 1LB2B 3OS2A 4FLZA 3RMBA 4FJ5A 4F5OA 1RZTA 3AA3A 3SUQA 1ZBHA 3RR8A 2YHBA 4DMNA 3ZSVA 4RZRA 2OPPA 4NCGA 4FS2A 3NF7A 3V6KA 3SYZA 4IFYA 3PUFA 1BPYA 4DOBA 2RN2A 2BPGA 3AVBA 4UAWA 5KG2A 1XSPA 1KFTA 5J2DA 3QEAZ 4FJ9A 4ECTA 4CGGA 3C95A 4IG0A 4ZH4A 4LH5A 1Y88A 2P6UA 3OSPA 1JXBA 4M9NA 2AGPA 1HUZA 1ZBIA 1NJWA 4J9OA 3M8SA 1N56A 1J5OA 9ICNA 1T7PA 4DU4A 1D8LA 4M3UA 1Q9XA 4UB5A 4F93B 3AVNA 3OHAA 1XI1A 1NK9A 3DOLA 4MFAA 4KB1A 7ICOA 4N56A 1RT7A 4QCLA 1KEJA 3KLHA 1NK0A 3EZ5A 1T8EA 5TZVA 1WSJA 1KFDA 1ZBFA 5I3UA 5DBCA 5DBBA 1Z25A 4M2YA 3NGYA 3NF8A 3OYMA 1XHXA 1GOCA 2G8KA 3PR4A 2GV9A 4N47A 1UWBA 3UXOA 8ICCA 1L5UA 1XHZA 1ZQLA 1DOQA 4KN4A 3SUPA 4DO9A 1MU2A 2Z1HA 1BQNA 2KW4A 3L2RA 3CFRA 3CG7A 2BR0A 4RPZA 1KSPA 4ECZA 2W9CB 4KO0A 2G8IA 5DLGA 3EW9A 2FBVA 5J0XA 2ALZA 1NOMA 4QW8A 4CHZA 1RBVA 3NBPA 3MEGA 3T5KA 2UVRA 3K5LA 2JLEA 5DG9A 4F4KA 4RQ4A 3M9OB 1SL2A 4DSKA 3LAMA 3Q8SB 4RU9A 3DLBA 4YR0A 5KGXA 4QZFA 1WN7A 2F8TA 3SQ4A 1K1QA 4IRKA 3TFRA 4OKKA 9ICIA 8ICKA 2B5JA 5KFEA 5KFUA 1S97A 3ZDDA 3RB3A 1U48A 3V9SA 1ZQPA 4O4GA 5HRNA 1ZQVA 3H8SA 3C94A 2BQRA 2WOMA 5HHHA 3BQ2A 2Q3SA 5J2KA 4AHUA 1KLMA 4DTSA 5EOZA 2AJQA 1EX4A 3C1ZA 1S1TA 4AH9A 1QQCA 3Q8KA 3G6XA 4KLUA 5C24A 2W9AA 3TFSA 4DF8A 5FDLA 4PHEA 4CIFA 4E7IA 4ED8A 3FYHA 4I2DA 9ICQA 5JS1A 3TABA 2PZSA 3ZSQA 3I0RA 2JEGA 5IIMA 3LP1A 1BI4A 4HUGA 2AU0A 4E7KA 2IAJA 4JUZA 2Y1JA 3ISCA 4MF2A 1AROP 1FXXA 3ZD9A 2M9NA 1TKZA 4FK0A 4O0IA 2BKEA 4QZAA 4FYDA 5J0TA 4CF8A 2ZJ8A 1RPLA 5F9NA 3DLKA 4E3SA 1U4BA 5KFQA 5KT5A 1DTQA 1U45A 2NUBA 7ICGA 4NLGA 4M42A 9ICLA 4F3OA 3PW2A 3O3FA 1C0MA 2KN7A 4FLVA 4IQWA 1SUQA 2WONA 5J2IA 8ICMA 1QSYA 1VSMA 1ZQKA 4DTUA 2G8VA 3HT3A 1Q9YA 2J6TA 1T4GA 8ICSA 2FLNA 4J9NA 4LZDA 4LSNA 1CXUA 1YTUA 3UQ0A 3HP6A 3RJGA 1WSIA 4KV8A 4R8UB 2B4JA 2F96A 3QEPA 1C0TA 3KHRA 4WE1A 2IA6A 1JLEA 3CM5A 2V4QA 4CECA 4O3SA 2IGIA 1RNHA 4C8NA 4YXMA 4FJLA 5C5JA 5HRSA 4E7LA 4M3TA 8ICPA 4MEXA 2Z1IA 4DFKA 4GVMA 1LW0A 5KFAA 4CGDA 3SQ2A 4J9RA 4CFAA 4J2AA 2A1JB 4L8RB 1RDDA 2B21A 3C2KA 7ICVA 3ASMA 3RTVA 2R8KA 1X9WA 5KFGA 3MXJA 4IG3A 2BGGA 2NRVA 5J0SA 3PW5A 1QTMA 2BDPA 3DRRA 1A77A 3KKSA 2RPIA 3LP3A 3AVHA 2ZTDA 4DQPA 3M8PA 1C7YA 5HNKA 3PVXA 2QKKA 3ETLA 1SKSA 5JS2A 3HJFA 1W0HA 4ECXA 4UB2A 2XY7A 4N5SA 4OPKA 4P4OA 4KLQA 1HQUA 2JEFA 3HX0A 2RF2A 3OYAA 4HHTA 3SPYA 3MR5A 4CCHA 3H4DA 4CK3A 3AO4A 3V6DA 9ICPA 1C1CA 3PR5B 3K58A 5KFBA 4M3RA 3MFHA 2HW3A 5DB9A 7ICRA 2P5OA 5CHGA 1WCLA 2WTFA 1HJPA 3B6PA 3QZ7A 4QZDA 4FXDA 4P4PA 1QLNA 3V7KA 2V4RA 4H8KA 1NJXA 3M9MB 4AHCA 5DKWA 4B9UA 2JEIA 4RW4A 2BCRA 7ICPA 3QZ8A 5CZ2A 1ZQHA 4F91B 3SPZA 3VA3A 3KIOA 1EXNA 1S0OA 1TL3A 4FLWA 4TSXA 1X1PA 1QSLA 2A1SA 2FPKA 3D0PA 4CHYA 2W42A 5KFDA 4YR2A 1TAQA 3LWMA 3KHLA 4XUSA 1DTTA 3V9UA 3C2LA 1JKHA 1F21A 1HJRA 1VSEA 2JEJA 1D9DA 4DTMA 4PHPA 3T5LA 3JSMA 4HCBA 3OYNA 3UIQA 3ISBA 2I1QA 1NK7A 3KHHA 3L2QA 1ZQNA 3V6JA 4JV1A 8ICIA 4BWMA 3DM2A 3JPOA 4RW8A 5JUMA 1K1SA 4W5OA 3LZJA 4ECVA 4PWDA 4DOAA 4DL7A 3MEEA 3AVAA 2GBZA 1BVSA 3ZSYA 2OA8A 1RT3A 5KRTA 3PMNA 4QZ9A 3PNCA 2HHQA 4CJWA 4KLLA 1WSGA 4AHRA 3MR2A 9ICCA 3OYHA 1GOAA 4BWJA 5KFOA 4HUEA 5CYQA 1DLOA 3E2EA 1LV5A 4ELUA 2XC9A 5KT6A 4ECSA 4HVJA 4FK4A 4PGQA 2F1JA 2PY5A 3RWUA 3T3FA 7ICHA 5CP2A 4O0JA 4FBUA 3K59A 2KFZA 3ZT1A 5SWMA 2BQ3A 5KFCA 1RYRA 2EHGA 9ICBA 8ICEA 1UAXA 3GIKA 4PQUA 4ZHRA 4CE9A 4GXJA 3OYDA 3V1OA 3V9XA 1BPDA 4W5NA 4F3TA 4BXOA 4B9MA 2YNFA 3JPRA 3GIIA 4PHDA 2MUTB 5KG7A 5KG4A 2G8UA 4JK1A 4CHQA 4CESA 3NH1A 3IRXA 5DDMA 3PX6A 1JXLA 3SQ1A 1LWFA 3RJIA 2DPJA 4DOCA 4GC6A 4B9TA 1RCHA 2O4GA 1REVA 1HRHA 4ED6A 3A2FA 1SKWA 4I2HA 5J2NA 2XY8A 4M9LA 4TUQA 3G0ZA 1ZQSA 4TUPA 1HNVA 1YTAA 1HYVA 1NKCA 2XHBA 4KFBA 2ZD1A 4W5TA 3V81A 3GQCA 4ECRA 2ASDA 2HHSA 5KFXA 1S1XA 3AA2A 5EWGA 1LAWA 2NRZA 2HVHA 8ICFA 3B0YA 4ED1A 5J2FA 4DSFA 5BOLA 4RPXA 3ITHA 1BGXT 4J9KA 3BJYA 1FKOA 1TKTA 3OYBA 4DU1A 4CEFA 1WNSA 4GW6A 4CJUA 4FJMA 4UB1A 4E7HA 4XQ8A 3OS0A 4KI4A 2BCVA 1JL1A 4JWMA 5KGWA 3SV4A 2KFNA 3VQQA 4CFCA 4CEQA 4J2EA 1COOA 4K8XA 4O3NA 2AQ4A 5J0UA 2P66A 5J0QA 1CZBA 4BACA 1VSJA 3S3MA 3CFPA 2FPMA 2G8HA 1TGOA 3F9KA 4YXJA 4I28A 3GFKB 3KJVA 1XSLA 2A1RA 4QZ8A 3G6YA 1RTIA 4O5CA 4R63A 9ICTA 3VQ7A 3OYGA 1S9FA 3L2VA 4O3PA 3MEDA 4DLGA 4YD2A 4KLTA 3VQ4A 4F8RA 4KLMA 2X74A 3LZIA 4CJTA 3LWLA 2OPSA 4C8OA 1I39A 3OYLA 1TVRA 3T19A 3AO1A 3DI6A 4GC7A 1S9GA 3VQ9A 4I2BA 3HYFA 2VG6A 7ICIA 9ICVA 2PI5A 4G3IA 4BDPA 4CJPA 5HRRA 5BPCA 4Z6DA 4FJNA 4BE0A 4CHPA 3GV8B 4Q45A 4E0DA 4NCAA 3C2MA 1RTHA 5HMLA 3SUOA 4DQRA 4I2CA 4RUAA 4KTWA 1RBRA 4E1NA 4M3YA 4OPJA 3Q8LA 2W9CA 4ELVA 4YVZA 4CGHA 1IG9A 4KLGA 4Z4EA 1SL1A 4QZBA 3HPHA 1U47A 5SZTA 3TQ1A 1B92A 4CEZA 3CYMA 2E6LA 2PXIA 2D5RA 3O4NA 3K4GA 3C1YA 3ZT3A 1ZQZA 9ICFA 9ICWA 1WSFA 3KKRA 1BPEA 4FZZA 1RT6A 4RT2A 3OVNA 2ZJ5A 4CF2A 4ZTJA 4KB0A 5KFLA 4IFVA 1ZQBA 5J2EA 3PW7A 3PW0A 4Y1CA 4C8KA 5T7BA 5DB8A 3JPNA 4CEOA 1JLCA 9ICJA 4I2JA 3QERA 3NH0A 2AGOA 2NRXA 3DRSA 2ASJA 3O4QA 3MDAA 4CHNA 2DTUA 5I42A 9ICAA 4YFKA 1JX4A 4CGIA 3MGHA 2BCQA 1C1AA 2ZTEA 3NGIA 4FJIA 5CZ1A 2I9GA 4UB4A 2XCAA 7ICQA 3QEIA 2PFOA 3U3YA 1N48A 1HQEA 2DY4A 1JLQA 3LPUA 4FLXA 4DTXA 3F73A 3TWHA 3LDAA 3MXIA 4M9GA 4FJKA 4F2RA 3V1QA 5E41A 3U3GA 3VQCA 4JWNA 4IKFA 3I8DA 3GIJA 1RTJA 3KLEA 5HROA 1CZ9A 2ATLA 1ASWA 3NCIA 8ICLA 5DB6A 3FFIA 4MQ3A 4PHAA 1CLQA 3OY9A 4CJSA 2ETJA 1NJZA 1TK8A 3QEBZ 1ZBLA 3TAFA 5KT4A 3T5HA 1BPZA 1WLJA 3I0SA 2B6AA 1BPBA 4K4HA 4CJEA 1S0MA 1TK5A 5DGBA 3K75D 9ICMA 2Y1IA 4IR9A 3KD1E 4RUCA 1A76A 3AUOA 5IIJA 1PZNA 4O3OA 1D5AA 4ECWA 5J0OA 1KVBA 1WSEA 3MR6A 4FZXC 2YNIA 4N41A 2R7YA 4KREA 3SI6A 4KHUA 4R8UA 2VG7A 3QLHA 2FBXA 3VA0A 5KFSA 1KDHA 5J2HA 4DL2A 4DTJA 3IM1A 3GILA 1UA1A 1LW2A 4F5NA 1S0NA 4M0AA 3WNGA 4J2DA 4J2BA 4QZHA 8ICGA 4FCYA 4DFMA 1IKWA 2OYQA 4DL4A 3NF6A 1BIUA 4CEBA 1NOYA 1C0UA 2VWKA 3GV5B 1XO1A 2A1JA 3ORYA 4B08A 9ICSA 5L9XA 3IS9A 4M3XA 4KLIA 4KITB 1XSNA 2FLPA 4ZTFA 4BDZA 2Z1JA 4AHSA 3ISDA 3CFOA 3QIPA 4DQIA 1KRPA 4GXKA 3RJHA 1XS9D 4PUOA 8ICRA 4KHWA 1TFRA 3LDSA 5HMMA 1I3AA 4CJ5A 4OKJA 4KLHA 4RQ3A 4FS1A 4HUFA 4ECYA 4CFDA 4HCCA 3BQ1A 3HK2A 1D9FA 4BDYA 4FJHA 3QEXA 3MABA 3K5OA 2BANA 4FZYA 1KTQA 3S9HA 1KFSA 3C6TA 3TAPA 2FLLA 3OJUA 3ZT4A 1EKEA 4MFFA 3KHGA 3QO9A 5KT7A 4DSJA 3RH6A 4YG2A 1ZQMA 4DWIA 4QZCA 3RH4A 1VSFA 1RXWA 1MSWD 4RQ8A 2C2RA 1HPZA 4DTPA 4CF1A 4RPYA 2E4LA 3ZSWA 1DGSA 3GDXA 3KTQA 1IH7A 4M6WB 4H4OA 4ELTA 4DSEA 3G6VA 3M8RA 4B9SA 2BCUA 2XY5A 4EBDA 3RAQA 1KCFA 1WCNA 3EPGA 3EYZA 1X9SA 3VQAA 2FBYA 4CHOA 3PY8A 4N76A 2FMPA 1T03A 3TAGA 1L3VA 3AVCA 3DLHA 3DLRA 5IIOA 1XWLA 4EP5A 4JS5A 3RMAA 4IR1A 5KG6A 4TUSA 7ICFA 2W9BB 3Q8QB 8ICAA 3HVTA 3PX0A 2UVWA 3AVJA 4FJ7A 3L8BA 4O3RA 4I2QA 4W5QA 1ZQEA 4EZ6A
chains in the Genus database with same CATH superfamily
2DGTA 1RDBA 2FTRA 3QMQA 3SI8A 1T9UA 2QKBA 4USMA 1AW0A 3UQ2A 4OZ2A 2HWIA 1RSCA 4FLYA 4YEAA 3UI3A 4TNOA 4BR7A 1JLGA 4ENOA 5ALFA 1QE1B 3C23A 4ID1A 5B66U 4LFBF 5FPMA 4PHTX 4FF2A 4DR2K 2D7SA 3M8QB 1W7WA 5EX3A 3WX4A 4ZN3A 5FJ4A 2W2OP 2AEJA 3EZWA 5LJ3Y 3C21A 1FRKA 2F8MA 5AXKA 1HBUA 2V34A 3TTCA 3LGNA 2YKMB 1S6PA 4E2FB 1SJFA 1R8BA 4FPIA 3P5TL 4O55A 2XB2D 3LDOA 1ZYQA 2BM1A 3IA0A 4IQUA 3QB0A 1VQ8N 5JJBA 4DX7A 4DR2F 2QYCA 1TKXB 4QPXA 1CJUA 5HQ8A 2FJWA 3HL8A 3QNOA 4YORA 2YKNB 4I2PB 1YRUA 2R3VA 2IIRA 4WFBQ 1TL5A 3OYIA 1KVJA 4ER8A 1WI8A 2FVSA 2BJ7A 3CCSN 1EQ0A 1GXUA 2YX8A 1J2VA 3ULDA 2ZUDA 2IHNA 3J7Z5 1RHKB 1TV6A 2EI5A 4ZVHA 3P31A 2MUTA 2IIHA 2GJ2A 4MTPA 1M5SA 1P27B 4KLEA 3HDSA 2JZBB 1FFSB 4FWNA 4NLDA 3R8EA 3ZZPA 2E5LF 1I1GA 3AJ2A 3EO3A 3CUNA 2ITMA 4A8SA 2Q66A 2DGXA 1IKYA 3UE2A 3QWUA 3TJ9A 3AA4A 1VQ8S 3AVLA 1FVSA 1Y5IB 2CG8A 3NLCA 4WF9Q 1JLBA 4KLSA 1CJKA 4GXIA 4RW7A 2A3VA 2CJBA 3ZETB 2ZE2B 1FK9B 7ICNA 1T02A 5AQTA 1TQLA 4AHTA 4FVMA 2DL0A 4CD1A 4ZCLA 2O8DA 3P45B 1S1WA 2J9EA 5G0RA 3SK3A 3GSIA 4RQ7A 1N33J 2GS8A 2KKVA 2MGZB 3MMAA 2L3MA 1GOBA 3ZSZA 2W24A 2PA3A 4P10A 2R8GA 3DMJA 3UKUB 2Q3PA 3JPPA 4WCEL 2BABA 1ZQWA 2BKPA 4WJBA 1R0AA 5AK5A 3QEWA 4L74A 1S6QB 2ZUGA 1WEYA 3E58A 3VCBA 3L3UA 1J27A 4PJ0U 2VZ9A 5T7LB 2ZIUB 8ICWA 4YHHF 2IRUA 3CERA 1UTAA 4LT6A 1RILA 1YIJN 1ZQCA 4OJ3A 3TKAA 1OJ4A 2RHKA 3EJMA 1CULA 2HBRB 3HHDA 2QE5A 4QZIA 4MLEA 1PJ7A 2ZGYA 4IH7A 2JGUA 3VGLA 1TUGB 1RTDB 4I6WA 3H8WA 4B3RK 5I3PA 2VV5A 3G82A 3N4MB 3B78A 4NZ0A 4JI4K 1WDDA 3NS6A 5HLFB 3B6BA 3QU2A 3C65A 3O9QA 4A8WA 3SSQA 4JMUA 2JL9A 4B1XB 4FOIA 3SCXA 2BQUA 2CFXA 3Q89A 1MN9A 1PG5B 1X4HA 4CW7B 2IDOA 2E1FA 5THWA 5KFPA 2EKNA 3AO3A 4YN4A 4ES1A 1NKEA 4DV7F 2DRDA 4G1QA 3HJEA 4QZGA 4AD6A 3KLFA 4B3RF 1AFJA 4UATA 1NUEA 3FZBA 2PFPA 3DC2A 4J9SA 2O1PA 3Q8PB 2HHVA 3GPAA 1YIJS 4PPDA 3LP2A 2E8AA 5C2FA 2CJAA 5AZIB 3HSTB 3HF5A 2Y9TA 4TQSA 1LXJA 3HKZC 2HKEA 1YVFA 3QMLA 5KQDA 4BC5A 4CEAA 3O3GA 4UTGA 4O44A 1RK8A 4OZ0A 3VQEA 4NCGB 1QQ7A 2DH7A 4JYAJ 3ZDBA 3O9UA 5JTIA 3B8HA 2QMXA 1U6BA 3BKTA 4QZEA 1W26A 4JRQA 2EANA 3K0JA 2JVRA 5CWRA 2F8KA 2FLOA 3FSIA 1BCOA 1SC3B 1L7MA 2ZHOA 3CDWA 5KFVA 4R5PA 4BRLA 2VU5A 2H48B 3PO4A 2P6RA 4LVSA 5GADU 4IQTA 5KG1A 3E3XA 2VONA 2EEYA 2XULA 2ADBA 2HRTA 4CM2A 4I2IA 3C5FA 1VRUA 1ZQXA 4ID5A 4DZDA 2LDYA 1RZMA 3KLIA 4DI6A 3T1HF 3ATVA 2AYMA 3RJJA 4C8LA 4ZPVR 5KG5A 3DOLB 3NKYA 2KRBA 1RT7B 2D0BA 4FKYA 4KH0B 4Y2XA 5H1SQ 1Z1ZA 4WWSA 1IIPA 2MAXA 4G9ZA 5I3UB 1N2XA 1VQ6S 1V5IB 5ALEA 5E79U 2ODGA 3NGSA 1ITPA 1N0UA 1UVLA 3F56A 2KVQE 4Y1DA 2BE7D 3UD3P 2UVVA 2BRKA 1M90O 4B9VA 4IOCQ 3SFGA 1Z3EB 2HHTA 2MZJA 9ATCB 4S0MA 4NM2A 4JEPA 3ETOA 2HVDA 4OFZA 1M90T 1IM6A 4H54A 1SXLA 2DNOA 4RQ6A 4Z6EA 2XZDB 4M3ZA 1N62A 4AUKA 3F0NA 4DTOA 4KLFA 2BPFA 3ALYA 3LM2A 4FLUA 1XNQK 2G13A 2PFNA 1S1VA 4C7YA 4OHWA 3AGRA 1D8YA 1JL2A 4TYBA 3H7IA 4FWQA 4H4KA 4CEEA 1FRIA 3RR7A 4IRCA 2G8WA 2UXDK 2GQQA 3MXMA 5LL6Z 1HNZJ 4Y2CA 2O8EA 3UMGA 4M63A 3KD5E 1BWVA 3AXKA 2LU1A 1TAUA 1ZA2B 1Q8IA 2OZMA 5H9EK 1XNQF 3QNWB 8ICXA 2M2BA 2ZNZA 2QG9B 2RKIA 2F1FA 4PCQA 4FO0A 4FWRA 3RB0A 3I87A 3BO4A 2R7OA 2UXDF 5DQIA 3B54A 4RW6A 1QS4A 2GAGC 3DXSX 3PHEA 2CJXB 5CYMA 1WAFA 4OYAA 1IXKA 2XHCA 2P9NB 3SZ2A 1RYSA 4PZOA 4P9SA 4IRDA 2G1DA 5A0LA 1YTYA 3OBIA 1ATSA 4LF9K 5J1EB 3PACA 1VHIA 3MGIA 3MUVP 4MEYA 2R7XA 4W98A 3JS9A 4C0ZA 2OELA 2D6FC 5KFZA 3DJCA 5J0RA 3F5TA 3LTOA 4I2AA 2ZH6A 2MKIA 3AY9A 5EE3A 4CLUA 3MOZA 3G6EN 1L8OA 3AB4B 3OJSA 4LF9F 4HTIA 1BI4B 1SKRA 2P9UB 3RRKA 3KK2A 2N4CA 4N7TA 4FVCA 2HSEB 3TX0A 4Z6CA 5KPRA 1D8BA 2QK9A 4UY8O 1N5QA 3CT9A 1FNOA 4PGYA 3PSTA 4ES3A 1SBRA 2LU2A 4UY8T 1FCAA 1QD1A 1KXPA 2Q2RA 2DNQA 5D4LA 1P9QC 1MMDA 4OGEA 2ASPA 3MECA 2RU9A 4UOHA 4FBTA 4DUYJ 5KT2A 3VV2B 2HOFA 1EZZB 8ICNA 4BRPA 5L1JA 3IG8A 3BB5A 3CD7A 4LUBA 3HHLC 1E4FT 4I7FA 4RT3A 4N77A 4USVA 1JRPA 1S79A 3HFKA 3JPQA 4LZGA 1V85A 5ETPA 4F4YA 3ZSXA 4ATNA 4KLJA 3VMFB 1WEZA 3CW2C 2DEIA 3A8JA 1U25A 3G6ES 3EZOA 3VQPA 2YJEA 4KV8B 4UUXA 4P74A 5E0OA 1E4GT 4FK2A 4CP5A 1G3OA 3PW4A 1KDNA 3ENVA 2PFUA 5AM4A 1KQFB 3D6FB 2ISPA 5KFNA 5KL8B 1SB6A 2HYIB 1TAMA 2D41A 5EN1A 3OL7A 4JD2A 4KLOA 3AQOA 4CGJA 4QWBA 3TAMA 2ZXHA 4TLRA 4I9QA 1N32J 2CQIA 1OH8A 3THVA 1EETA 2EFQA 2NRTA 3THWA 3ALRA 1ZQFA 2G2YA 4M7XA 3MUMP 4M3WA 1WB9A 5KFRA 4RJVA 1T94A 1N5VA 1VHXA 3TAQA 1RP5A 5T14A 2XGPA 3N0VA 3DRRB 3WNFA 2ROGA 1V9OA 2O8BB 4Z4CA 2HHHJ 3RRGA 2OMLA 5EGYA 3KZIU 2KG1A 2J9DA 4C98A 1R31A 4RX6A 4CF5A 3H40A 2DNNA 2AJ1A 5ALJA 4ED7A 3QSIA 5E84A 1J97A 1U2FA 5D0EA 1N33K 2ES6A 3SV3A 8ICZA 4Y00A 4KAZA 4M41A 4GMKA 4JRPA 2MPUA 4LMZA 2HK2A 4DLEA 5DBAA 1T3QA 4B8AB 2W55A 5F8GA 4IOBA 1K73O 4MK8A 4CK1A 3H5XA 2KV2A 4RBTA 3MAQA 1K73T 1RHRB 2BJ9A 4CLFA 4KH6A 3U02A 4YB5A 2QFIA 1N33F 1NGIA 4PAAA 2AX0A 5EWEA 4F5RA 3D2QA 4EEYA 3LP0A 4CIOA 2UXBJ 2PFQA 1QSSA 2F44A 2HZCA 1ZJMA 1NZPA 1FRXA 1U49A 1RWPB 3WHIA 5AKIA 2C2MB 1TL3B 2W54A 1RT1A 3QSYB 1QZ6A 4M45A 2VWJA 4USTA 3E01A 5D77A 2QA2A 1UAWA 4NEYA 4CO4A 4DR4K 2OJ3A 5ETMA 4KPYA 4C3KA 1OYDA 3LPTA 2O8CA 4F5PA 1Y11A 3H08A 3G8TA 5IXUA 2XZTB 1ZETA 1PILA 4V19J 3GOIA 1T3VA 2CA9A 2P1JA 3PO5A 3ZZTA 2J6UA 4OYIA 4LREA 4A5BA 4PXBA 2VFRA 3BS5B 3EICA 5KFWA 3DWLA 2HNYB 4X84A 3DM2B 4OYZA 4E89A 5FROA 5GAEP 4DU3A 3FM9A 3M6VA 2C2EA 2FZCB 4EENA 1VOMA 5KFIA 1ZQAA 5AHXA 3KKFA 4CDGA 3TUPA 1Y10A 4CIGA 2MDAA 3RSEB 1U8SA 5IQ6A 3NGZA 3TO8A 1IM4A 3GYXB 4NLUA 4C8ZA 3P83D 4C7QA 3TUZC 4OLPA 1B7YB 1JJHA 3UFCX 4K43A 1F5BA 3IRUA 2Z30B 4YDDB 4CQ1A 3TU5A 1HWIA 3AV9A 5FLXU 3NY0A 1PC5A 3AHPA 5LJWA 3J7YI 3HVRA 4JYAK 2KXFA 4FKXA 2HQCA 1IN0A 4ZHRB 1A7GE 3SCLE 2K8CB 3BH6B 4NASA 3V9ZA 5GAEU 2YNFB 1M1GA 2W2MP 2FSKA 4RQNA 5AK6A 1ILYA 4I64A 2J9DE 1RLDA 1JQGA 1LWFB 4AYBD 3BH7B 4JYAF 4J9MA 3RJEA 3NF9A 3FZ2A 3PIOL 2YHXA 4DL3A 4X4QA 4BGBA 2FDRA 2ITGA 1T05A 3AOBA 3QGHA 1MWZA 2VC1A 4CZLA 9ICHA 1X9MA 1BOTO 2MLYA 3A5OC 1TV9A 4W90B 3TADA 4LRDA 4Y3CA 1KQQA 5KFFA 3RMDA 4PYDA 4JI3J 1TKTB 4FLZA 4QIWD 3RMBA 1VQ7N 2RMLA 3I28A 2CNLB 4FWOA 4I6MA 2YHBA 1MWYA 2M70A 2OSRA 4XAKA 2HFUA 4X4NA 2ZOFA 4DMNA 4M5NA 3ZSVA 1H3DA 3SYZA 4IFYA 4WP9A 4DOBA 3M4XA 3DLEB 2KNJA 8ATCB 4CNQA 2E1MC 5D15A 4B3TK 5GIOA 2J0QD 2PMHA 3C95A 3JS6A 4ZH4A 4LH5A 1TR0A 4K5SA 3OSPA 2Q43A 3M8SA 1M5KC 5J1PA 1T7PA 4C23A 4DU4A 4M3UA 1Q9XA 1VQ7S 4MO5A 3VZHA 1XI1A 2PD1A 1YF5L 1CJVA 1A0OB 4AP9A 4MFAA 4N56A 1S9GB 4D3HA 2NLXA 3C0BA 4QCLA 3A3NB 4XEIA 4BBYA 3KLHA 1HNZF 2DWQA 1VQ9N 5TZVA 2RHFA 1KFDA 1UJ5A 1ZBFA 2AH5A 4J37A 4TY8B 1T95A 1RAGB 1OIAA 1Z25A 3D6RA 3OYMA 3DGPA 3OQ2A 2G8KA 4ACOA 4JHDA 1SC1B 2GV9A 4FWMA 3F5EA 5ALIA 1L5UA 1XHZA 4DPXA 2LP4A 1NSKL 1F44A 1NGEA 1DOQA 4DO9A 2ACMA 1TYQB 3M30A 3M1VB 3WXKA 2HOQA 3SBTA 2XSJA 2KJ9A 5GINA 5D4PA 2OAUA 4RPZA 3CJSA 4CI6A 4KO0A 4CTAB 1S4EA 5DLGA 4WZMA 4DDFA 2FBVA 5J0XA 2QMUB 3M32A 1YI2N 2K4HA 2ALZA 1XTZA 4DOZA 4BRFA 2D3OR 1NHUA 2RD5C 1VQ9S 1RBVA 1S7HA 4KGMA 2RS8A 3MEGA 3SBGA 2RP5A 4WYWA 5DG9A 4F4KA 1YSJA 3R1LA 3VGVA 5AXMA 3GTYX 4DSKA 2KVCA 1YX2A 1QAJA 2YQ1A 3TUJC 1ZD3A 2I2YA 2J0XA 3DLBA 4BVOA 4OD0A 4DUYK 1YGYA 2CQCA 5ETNA 2DRAA 1RWVB 4OLOA 2LFVA 2HWTA 4WQ5C 4OKKA 1JLCB 1VQYA 1QUVA 4WXOA 2B5JA 2LEAA 5KFEA 5A8RB 1S97A 3ZDDA 5I42B 2MKHA 2EFVA 4MT1A 4KMOB 4IWVA 1VR6A 4A4JA 4BR5A 2EK1A 4J8FA 3MMJA 2YX7A 2C2OB 4OX7A 4DUYF 4AL6A 1SJRA 4NLPA 5EOZA 2AJQA 2E88A 2E7VA 2NPIA 2EFNA 1Z1BA 1HQEB 2A3JA 5FDLA 2W9AA 4PHEA 4CIFA 3FYHA 1WG1A 4MAKA 2PZSA 1N32K 2AP6A 2ZJRQ 2DXDA 3MURP 3LP1A 4CNZA 2Y0SF 2AU0A 2H51B 4E7KA 5M2UA 3N4PA 1RQLA 3BQ7A 2Y1JA 4MF2A 3AGKA 2V4JA 5JVGQ 5AI8A 2BYCA 4IUFA 2ZJ8A 2EW9A 1O8BA 5F9NA 5KFQA 1DTQA 1R89A 1WF0A 2POKA 1N32F 1CQNA 4BRMA 2HHHK 3CJRA 2FGOA 3PW2A 3O3FA 3TOQA 3I0SB 3D2FB 3UNGC 4KBIA 4RL1A 1U1OA 3QICA 5C10A 4C97A 3D2EA 1SUQA 1UETA 5J2IA 2ERRA 3JSBA 4E1JA 2GGPB 2EH9A 5A2QO 4TU9A 5LMUK 1Q9YA 2VBWA 2FLNA 1WOQA 2CXEA 3IP4B 4LZDA 1CXUA 2HHHF 3FBBA 3RJGA 1QM9A 2KDOA 2RSQA 1HEKA 4FFDA 3CWJA 4CLZA 4R8UB 3VWSA 2F96A 1WUUA 1S5LU 4FWSA 4UZCA 3QEPA 1LKYA 1C0TA 4PG4A 1TUUA 4PL1A 1JLEA 2GO7A 1LFWA 2WZ1A 4Z7CA 1QVFR 2LQ5A 4KPCA 2UXBK 4C8NA 4YXMA 4E7LA 4M3TA 8ICPA 2J9CA 4MEXA 2Z1IA 1JJ2R 1LW0A 4QOTA 3OTCA 4DR6F 4CO3A 3WIUA 4BR0A 3HSCA 4BCAA 3AN1A 2D8CA 3DU5A 2HMXA 2ZIXA 3NNAA 4YDUA 3RTVA 3VQTA 2R8KA 4EMDA 5E2QA 4IG3A 3MXJA 2K4IA 2BGGA 5AKEA 2NRVA 4I6YA 2R18A 3PW5A 3BZQA 2UXBF 2A18A 4MK7A 4RNHA 5I9EB 3BZKA 3OW2M 2CQDA 2E1YA 2IVYA 2K06A 1S22A 2RPIA 4BJQA 2ZTDA 3E8OA 4A8KA 3M8PA 2Z0GA 3AD9C 2WW4A 4CF4A 2KT3A 2EVZA 3GP9A 3QJLA 5AQZA 2XY7A 5ETLA 2Z57B 3CIMA 2AYBA 2V94A 4O23A 3E1YA 2CQ2A 2P9SB 2M52A 3IM8A 2ZUAA 1WC3A 2JEFA 3SPYA 4K0KJ 3H4DA 2CGLA 1YJNN 2FGCA 1PGZA 1WG8A 9ICPA 3SMZA 1RAIB 1GK8A 1C1CA 4AQYJ 1H73A 3K58A 5DB9A 3BGLA 1HUXA 2UYTA 4IFEA 2VICA 1HPZB 2FHJA 3B6PA 3QZ7A 1VQNN 1NSPA 1RM6C 1QLNA 3V7KA 4DBQA 4EAHD 2V4RA 1RTZA 4IXCA 4H8KA 3PZPA 2FJDB 4AHCA 5DKWA 2ZH3A 4JKHA 4B9UA 1VLYA 5FPEA 5CZ2A 1FDNA 4O3MA 3M2RB 3KIOA 4EHTA 1PIEA 1S0OA 3CJ1A 1NMEB 2VFTA 4FLWA 2HF4A 3HULA 1FVQA 2GLEA 2H5IB 4IJNA 2W42A 4CD3A 4DFDA 2ZXIA 1RADB 5GAHI 2MZTA 4YR2A 3MM9B 3V9UA 2QTWA 1YHQN 2R7SA 3C2LA 1FERA 4DUTA 4NEZA 1BNOA 3H25A 5F3XB 1F21A 5TKYA 3HHLA 4A8MP 2I1QA 3L2QA 1ZQNA 3R6LB 4A57A 5BRHA 1JLGB 8ICIA 2XMUA 2KJ5A 4LC9B 4USJC 3C6AA 4RW8A 3F53A 3H0MB 3O9RA 1MDUB 1K1SA 3LZJA 4PWDA 5ALTA 1KN6A 4DL7A 1ZM9A 3MEEA 3PRBA 3AVAA 2PA8D 5BRFA 1HBUB 1YJ7A 1BVSA 1HFEL 1N54B 1S6PB 5KRTA 3ZC4A 1Z4OA 1O08A 5KL1B 4GV3A 3UNYA 4JI3K 1FRMA 4ZPDA 1JK9B 3WXJA 3E51A 1GOAA 2IY5B 1YHQS 4HUEA 1CJUB 3GSDA 4XDCA 5KT6A 1C20A 2WB4A 2KIVA 4FK4A 2J8AA 2Q0UA 3ISND 4K41A 2L08A 7ICHA 1HKBA 5CP2A 1U1LA 3RWUA 4FBUA 2KFZA 4NLBA 3BPSP 1X66A 3H2LA 5KFCA 1RYRA 2EHGA 9ICBA 8ICEA 1QTNB 3GIKA 2APOA 2VODA 3OYDA 4GXJA 4JI3F 3HRDD 2MB0B 4ZVUB 2DCUB 1TV6B 4BXOA 3W8GA 4Z2XA 4B9MA 3RVCA 2D74B 3EEQA 2MUTB 4USKA 5E5NA 2QA4G 1KD1T 4OJ1A 3CRXA 1O5JA 1TMJA 4GC6A 4B9TA 1IKYB 1RCHA 4O8KA 3A2FA 5A6PA 1CJKB 2K3KA 3BDEA 4RW7B 3OR2A 1RDUA 4ZP8A 4PRFA 1NKCA 2ZD1A 3GQCA 2ASDA 4BX9C 3OLAA 1PAEX 3BSAA 3AA2A 2BKOA 3KG0A 2NRZA 5AM0A 1S1WB 3GU3A 2HVHA 5G0RB 3W61A 3CXCM 3TR5A 2MLZA 5A2QY 4DSFA 2XSFA 3MOJB 4C8YA 5BOLA 1MN8A 4RPXA 3MMAB 2UUAJ 1BGXT 1N5WA 1FKOA 1E3MA 3OYBA 2VKZG 5MLCV 3KOOA 5J2NB 4C1NI 3W1YC 3W7BA 1Z6RA 2CRXA 4MHVA 2MQOA 2QWOA 4FJMA 4XQ8A 3WZ0A 5KGWA 5FP0A 4P0PB 2KFNA 3DMJB 2V7ZA 2AYGA 2WC9A 5AJ3J 3AD8C 2V8VA 4K8XA 4BACA 2GJIA 5J0UA 3P6YC 4PL7A 3VEWA 3O5BA 4ED5A 4OX9J 3QJPA 3CFPA 2DGVA 1NMDA 1KAXA 1DT9A 4U8YA 3R7NB 5E3QA 3KG1A 3QYYA 4QZ8A 3IR5B 5KPTA 2NS1B 9ICTA 3VQ7A 2GA7A 2CJYB 4YD2A 1EHWA 4LBHA 1FI4A 2LI6A 3HX9A 4FF3A 1CULB 2DNPA 1DGJA 4FPRA 3OYLA 1WC5A 3AO1A 3DI6A 4UW2A 3CCUN 1EAYC 4GC7A 4C4WA 3CD5A 3G82B 3VQ9A 2JH7A 4CDIA 2VG6A 3O0FA 9ICVA 2CJQA 4NXNJ 1K0VA 1SIWB 4FOEA 3LA0A 2C2KB 2DR6A 3HI9A 4EHUA 1N8RO 4XK8C 4RKUC 4G1QB 1WI6A 4NCAA 4L76A 1N8RT 1RTHA 1SIJA 3CMEN 4WFNL 2WHOA 1Z4NA 3QBWA 2IM3A 5K8MA 3LP2B 1XN9A 3BGFA 1U7LA 2LXFA 1OW5A 1RBRA 4E1NA 3PFOA 2E2PA 4OPJA 2MEWA 2UUCJ 2W9CA 4FWLA 1RDRA 4GV9A 1ZXOA 2GVDB 4M5KA 2OEJA 3CCUS 4Z4EA 2XYHB 4F67A 2MSSA 1U47A 5CE3A 3ID6A 4O44B 1UJ6A 4CEZA 3CYMA 1JUDA 2VKQA 1HNXJ 2D5RA 2OEKA 3R1XA 2P6SA 2M8HA 1WSVA 4LR7A 3KKRA 3FSYA 2Y8WA 4U67Q 2EXUA 2GHPA 1RT6A 4LSZB 1NHKL 3OVNA 2AT1B 3KFWX 5F41A 4ZTJA 4KB0A 1OKJA 4ZP7A 1ZQBA 3PW7A 2OP5A 2QWPA 3AT1B 1U1NA 3CMES 4M5HA 3ETRA 5F3ZA 5F8JA 4CEOA 2BW7A 1NDLA 1XNRJ 4CI0B 3NH0A 4R5PB 3BBFA 3DRSA 3M6ZA 1U02A 4NLYA 4HH1A 4NE9C 4YB6A 2L9DA 4YFKA 1S8OA 1PKUA 3DOMA 1VRUB 3F2DA 4ID5B 2G2OA 3KLIB 1RYUA 3SSSA 7ICQA 2PFOA 1TE2A 2DY4A 4DTXA 3AOAA 2VDIA 3FRZA 3LDAA 3NS5A 4QR0A 2MKSA 3SMPA 3CVKA 5K4LA 4F2RA 5E41A 3ZTPA 3VQCA 3MN7A 3GIJA 3KLEA 1FE4A 3MMCA 2QARA 5BJRA 3FFIA 3V5RA 4PHAA 1CLQA 1VQSA 1SZ2A 2DKXA 4FN5A 4ANEA 3M6WA 1NJZA 1TK8A 2C3YA 5BR8K 3DDKA 2DY1A 3NGKA 4F0HA 3MMBA 1RAAB 1X4FA 1S1VB 4DCPB 4Z37A 3NEKA 4K4HA 4CJEA 1S0MA 3HVAA 4JKFA 5DGBA 2AJFE 3OFHA 1IQTA 3GZ7A 3K75D 1FJGJ 2AV5A 2O8EB 3MX5A 5IIJA 3CDBA 4P2MA 4M95A 1SB3C 4OV6A 1N88A 1WKKA 1HKGA 2XM3A 1KVBA 3O2IA 4FZXC 2YNIA 2R7YA 4AQYK 4Y0FA 2O8FA 1KN5A 2JWNA 1MROA 1NPRA 2RKIB 2X51A 1J5EJ 5J2HA 4DL2A 1M5VC 4DTJA 1NNDA 3R6GB 4TU8A 4RW6B 5IM0A 3JSYA 2Q1LA 2DIUA 1CBKA 3A5NC 3WNGA 4J2BA 2QW9A 5CYMB 4K0KF 8ICGA 3IKMA 4FCYA 4M94A 2N82B 2HQ3A 4CEBA 4AQYF 2L5YA 1C0UA 2VWKA 4PG8A 2A1JA 3K8WA 1VJQA 3W64A 4AFFA 3IS9A 2NYIA 3EE3A 4KITB 1KTVA 4H5RA 3L95X 5BPLA 2XLKA 3KDOA 3R6MA 4AHSA 3MPVA 3CETA 1LW2B 3CFOA 2B6GA 2Q6BA 1XK8A 1XS9D 1V5VA 1PYTA 3W8PA 1U2CA 4JV5J 1LKZA 2F5GA 4BLGA 3CO9A 2RU3A 4WQ5A 3VTHA 4HCCA 4CO1A 3FJ2A 1GH8A 1D9FA 2QKQA 1NHVA 3K5OA 4BQZA 2E8MA 3ETMA 4OQJA 3FLCO 3QRRA 4OCZA 1Q53A 2E1PA 1KFSA 3G71S 3QDKA 4K59A 5CQGA 3MZIA 2FLLA 3KBBA 1EKEA 1F3VA 1NGFA 5KT7A 3L3CA 4DWIA 2AMCB 3MECB 1RXWA 1YJUA 2ZBRA 1NGAA 4CF1A 4I7FB 1XR5A 3HLUA 1GNKA 1HWJA 4H4OA 1AB8A 3EGNA 3H3OB 4MYUA 3TQEA 5F1XA 2F8HA 4BY9C 4LF7J 2W25A 1M5HA 1KCFA 1NPPA 2FBYA 1Z1VA 4CHOA 3LVVA 1H1VA 4QJFB 2FMPA 1T03A 2KXHA 4FP9A 3DLHA 1VI7A 3SEIA 4EP5A 4LF5J 2E1RA 5AXNA 2Q97A 2YHYA 3IBPA 4JD2B 3VF6A 3PX0A 2NYHA 4BR4A 2MZQA 1RWMB 3O8WA 4YN3B 3TAMB 2CGKA 4GRSA 3UDLA 2F65A 4W5QA 1EETB 4EZ6A 3N97B 3THWB 4FJXA 5KTQA 2H9ZA 3R5DA 1RWNB 4M5DA 4DPOA 3FQLA 1X40A 2W2NP 3RMCA 1UVJA 2E1EA 4B9QA 1MA7A 1YBAA 4BC2A 3FEYB 1FT8A 4I2PA 3H2UB 1QH9A 1NZ8A 3CQ8A 2P5GA 3VN5A 2GW8A 3LVWA 1ZA1B 1QVFM 1X42A 4LRAA 3GE1A 1HMVA 4LF4J 3ILJA 2YMLA 4DEZA 4JKBA 2C1EB 4J7CA 2UUAK 2RDIA 1T6DA 2E9RX 3H98A 4OVLA 1YZ7A 2Z4PA 3SIPB 1WC0A 3BF4A 3SD7A 2UVUA 1L7NA 8ICTA 2R2RA 4K2XA 4KIAA 3TR8A 1W9HA 1G6BA 1VQ4S 5ETSA 5D8HB 4IKAA 1RBSA 1QVGM 3C15A 3I56S 5AJ3K 2ISOA 1RXOB 4EBCA 3B4MA 4HT5A 4Y2QA 1QAYA 4OX9K 4HKQA 4V1Ak 2UUAF 1B9FA 7ICJA 3QT5A 3K2PA 3QPIA 4K7QA 4I29A 3LP0B 1OVQA 2PMZD 4NLNA 3GJSB 1QJHA 2CIMA 3SJJA 1FD8A 3OGUA 4YFUA 2L41A 1F9EB 2ZE2A 5HRPA 3LANA 4NYPA 2RT3A 4DX6A 1CPZA 3HTVA 2XICA 1RT1B 4OZJA 3E01B 4MFCA 5HJXA 5HVHA 2IC3A 4KN7A 4OX9F 3VF4A 1WAJA 2H3ZA 2KFYA 2YB1A 2CQPA 4UAYA 2MSTA 2O8CB 4UBCA 4ZIVA 1K9MO 4F71A 3FCWA 5KFHA 2YWGA 8ICJA 1K9MT 2XS5A 2DHGA 4C48A 3Q2TC 2HQGA 1G15A 1X6IA 4LH4A 5IIKA 3M5RA 4JLHA 1R59O 1JMSA 4BC7A 5DDYA 3WKAA 1F0XA 2YQ3A 1F2GA 2H3GX 1Z26A 3W65A 3D0GE 1Z05A 1PO6A 8ICQA 1O1WA 2HVIA 1UA0A 4NXNF 4JK9A 2D3ZA 9ICXA 3LOUA 1BD6A 4KB7A 3V2UC 2FPLA 4KRWA 2DJWA 1TK0A 9ICEA 5IQQA 1YUWA 2XO6A 4GV6A 1RTDA 4ECQA 1UPHA 4PPXA 1WSHA 4X66F 1WORA 5KFMA 4M5GA 4CJQA 3TA1A 4CZCA 3J7YP 2ROEA 1HNXK 1VBZA 4CJRA 1KAZA 2OH2A 3MGJA 2YV0X 4DPTA 2JGAA 4H0PA 4NYZA 3QFPA 2UUCF 1NO8A 4K4YA 1VQPN 3CM6A 8ICHA 1TZ0A 1U1MA 2MZ1A 3MN5A 2LQBA 4DX5A 3QIDA 4CJFA 4YMOA 1MQ3A 3NXZA 5KFJA 1HNXF 1ZQRA 1FFWB 1WG5A 4USAA 4R66A 4ED2A 1BU6O 4BRHA 3Q8MA 1X5PA 4DSIA 1BIZA 7ICEA 4DV1J 3QNNA 3CDUA 3ONQA 4DFJA 1F3FA 5AZIA 1P6TA 3SAHA 2YY6A 4OYWA 4ED0A 2KMDA 3A0HU 5DRKA 1UVMA 3HKZD 5DM7Q 3ZSOA 2A2DA 2UUBJ 3UN5A 5BYSA 4CRXA 1XNRF 3ZD8A 4IO9L 1T05B 1K8AO 3T7ZA 4QOZB 3SNNA 1WWHA 3AH6A 3UPQA 4M9HA 4DTRA 2R8HA 4YB7A 3L0QA 3SCKE 1SXDA 1VBXA 1WKJA 3NGUA 4F5QA 1X5OA 2E44A 3C6UA 4OZLA 4P4MA 5GAGI 3MWTA 1VSKA 9ICUA 5DM6Q 1B3TA 1YLXA 3DCAA 2RLTA 1IXRA 4EZ9A 3M6KA 5HATA 5KOXA 3AVFA 1GTHA 4I6MB 1GFWB 3CJ7A 4FJGA 1ZRNA 4RTFD 4KTZA 1KBRA 3N5FA 2PAVA 1GXLA 4IFYB 2ASYA 1O51A 3IRWP 4ZS6A 3UMBA 1HKCA 2GIFA 3VGTA 1ZBUA 5ALYA 6FDRA 4PWWA 1NZBA 2HFOA 4K4SA 2N7YA 3U1NA 3VVUA 2YBVA 5C2DA 3G8SA 1NK5A 5CY4A 3MDCA 3HSDA 5AQIA 1FJGK 1G4CA 3I32A 2DGSA 4CZMA 1UT8A 8ICOA 3TWZA 3S3NA 2JSXA 4KRFA 4JI1J 2MQ8A 3L2UA 2A10A 1URJA 4QU6A 3D6TB 2MMYA 2W04A 3Q83A 3ZI4A 3A0IX 1J5EK 4F2SA 4EYIB 1CJVB 3PYFA 3VQ6A 5IIIA 1FJGF 3KLHB 2VBYA 4OX8A 4H0XB 4GVLA 3IG5A 4UAVA 3H1QA 4ITSA 4RQ5A 1YITN 2RQMA 2WVDA 4CWBA 1B0TA 3QINA 2KD1A 2GWSA 3DGPB 5HMWA 3EDQB 2ZVIA 1ZQDA 4F7VA 4JHDB 2ESEA 3NCPA 1VSLA 2YI1A 5KI6A 2E8PA 2SXLA 2QM1A 3C5GA 4UBBA 1JCGA 4CF9A 1IKXA 2VA2A 1LWEA 2F63A 1JN3A 3O80A 1S3XA 1UL3A 2H3FA 3JQKA 3M30B 3HILA 3D67A 3WQPA 1YVUA 4R64A 2XSJB 4LFAK 4JV5K 3K9JA 4Z4IA 1QDUB 4KKOB 1NDPA 4KO0B 4RNOA 3K5NA 4JS4A 3MR7A 3M32B 1F5AA 2ZUCA 4LY7A 3MEGB 1WC4A 2OO4A 4YQWA 4M9JA 2QLTA 3ZNUA 1YITS 2VL1A 2HMIA 2BZ2A 2ATQA 1WHVA 4JV5F 5EE1A 2IS3A 4M1KA 2W01A 3CJQA 3AJDA 2BJ3A 1DEJA 4I69A 5J1EA 4JK8A 2V8PA 2DF4B 1HNIA 2D0CA 1NAQA 1W97L 1NK4A 3M2UA 4Q5VA 3ENQA 3LK9A 1C4AA 3OFGA 2EK6A 4R25A 2BJDA 3UB5A 4RNFA 1Q7YO 3MBYA 2B5JB 3O3LA 4AM7A 1Q82O 2X6SA 1Q16B 3J81j 1Z2ZA 2BE9B 4CFBA 4P7VA 4LF7K 3TVYA 1Q82T 5BOMA 3H8JA 4R65A 1O03A 1RAOA 4JI0K 4NA3A 4B3SF 2P9LA 4ZIWA 3CD0A 2G8FA 3AAQA 4OPHA 5C15A 1BA0A 2QWLA 4RBUA 3RH5A 4QWDA 1ZQOA 4LF5K 1L3SA 1R8PA 2ZVSA 4IEIA 5ETKA 5ALVA 4ZVEA 3GONA 5FDLB 2E6MA 2HOEA 1FW6A 3D54A 4LF7F 3ILOA 2VPYB 5DK5A 3LP1B 1FESA 3VGKA 1RWWB 1TL7A 2VC0A 1Q46A 3WT0A 1ZQQA 2IOFK 5J2QA 2P9GA 1S0VA 4A46A 4QNLA 4OJGA 4ZVPB 4LF5F 4NB4A 5JLHA 2ZH1A 4B02A 4EO8A 2F2AB 2FUG9 3FBFA 3NGRA 1V9PA 1DTQB 4UB3A 4FWPA 3IHQB 7ICLA 5DG8A 4OLAA 4UW9A 3EVOA 4KSEB 2IJFA 5K8OA 3D2EB 1SUQB 3NTUA 3S3OA 4F4ZA 4LF4K 1M5OC 4J9VA 4P6QA 4DV6J 2OKQA 3HBTA 3JYTA 3HKWA 4NXZA 1RBTA 2QIFA 2H65B 1SVDA 1IR2A 1PUZA 2G2ZA 3NFAA 4MKYA 3LGHA 1HUOA 4JI6K 1C0TB 4Z4GA 4A8XA 3AVMA 4LF4F 1JLEB 1ZQIA 3FR0A 2MKKA 2A19A 1ECWA 3F5AA 4IBNA 3AVIA 2BCSA 2OUGA 2CXYA 3BN4A 2M7SA 1R8HA 3NP5A 1VSIA 2BKNA 2FZGB 2IVPA 1BG3A 1LW0B 2RJZA 4XA5A 2H4WB 3QT8A 5GMEA 2ZIXB 2NV3A 9ICOA 3I9ZA 4OJHA 1KEKA 3OL6A 4OZ1A 3FZFA 5B0GA 2ZZTA 2LQJA 3DAWA 4IG3B 4CJKA 4ZPWR 2DKZA 1JXEA 1ATNA 4NY8A 4PKGA 4ZCMA 4CJVA 1XEZA 3M8PB 3K57A 2J4RA 5BYRA 1VC6A 2XYPB 1S5ZA 2X78A 4OGCA 3SEOA 1D9AA 1SC4B 3FMBA 4UQGA 5MLCQ 4XH1A 3BF1A 1XIQA 4FW1A 2ZBQA 2ZBCA 4PA1A 2HURA 2UUWA 4MFBA 4ZVGA 3BO3A 4MKVA 3GG0A 5L1IA 2CVIA 3VF2A 4F25A 3AA5X 1ASUA 1C1CB 3QETA 2W03A 5K5MA 4BE2A 1WTBA 3IGNA 2R8JA 3BBCA 1DRZA 5ALUA 1XMQK 2GVZA 1AYEA 4DCOB 2A40A 1L3TA 1L7PA 4P2HA 1FKPA 2LYBA 4C9DA 2ZJAA 2K3IA 2E2OA 3IV6A 1OQ3A 1PK1A 1XR7A 4RG8A 1WOPA 3CMQA 2FC0A 4L73A 3B8AX 4IL6U 4KHMA 4I67A 1L7OA 2JH1A 1HR0J 3RFAA 1S76D 5GAHP 4JKGB 2E9TA 3VAHA 3KLGB 2HNYA 5CH7B 1V4TA 1X60A 3BSNA 2MZRA 3IN5A 2GUIA 4HH0A 3MK6A 4ZPAA 3MCAB 3O6WA 4LRCA 3NVVA 1EXQA 4KAIA 3L2WA 2DFEA 2CUYA 2ZJQL 2DFFA 3V1RA 5A8KA 2PSZA 4C80A 3OS1A 4K2JA 1SJ1A 1CJTA 4DV1K 5CB1A 1JJ4A 4H4MB 2V8DA 1UVNA 4OYBA 2C28A 4RW8B 5AM1A 4KBOA 3AL0B 2OTJN 4W5RA 5AQUA 3H59A 3L7OA 4PWDB 5FRMA 2E7XA 1VQ5S 2C3MA 3MEEB 3S8SA 4IQVA 2MY7A 2FHMA 4JV2A 1AZSA 3C19A 1UOCA 2KJWA 2XRIA 3QBCA 4DR3J 3TSQA 1U09A 3THXA 2LCWA 5JVHL 3RRHA 2IVMA 3EM1A 3OT9A 3BREA 4YMMA 2JRSA 2UUBF 3EWAA 4PL8A 3UPFA 3GFZA 4KHQA 4AILC 2PE8A 2GX9A 3KNAA 2WF9A 5ALPA 3RBEA 1JLAA 2E66A 3H0PA 4B3OA 2OTJS 1XBWA 3TX8A 2HBMA 3AO2A 4BXOB 3V4IA 3P5BP 2IMWP 4X4OA 2KHVA 3D6MB 3GJRB 4MIWA 1EP4B 3O08A 5IINA 1D8ZA 2OI2A 1C0FA 2Z58B 1LCUA 3FC9A 1P90A 1WEXA 4I9LA 4JI1K 2X6NA 3FCVA 3TANA 1RBOB 1SV0A 3HW8A 1RDAA 1IWAA 3PTWA 3EMTA 4OYXA 2JHEA 3N79A 2HLUA 1KVCA 2IRXA 3OR2B 2HFNA 1D1UA 5AM3A 4ZLPA 9ICGA 1IVZA 1Z00A 1FF2A 3QRPA 3UD4P 4JI1F 2ZC4A 1KLNA 3P5JA 5H9FJ 4OZ5A 1FX2A 4DV5J 3DLEA 1NGJA 5AFUH 4B8CA 2YWWA 4CH7A 5CR0A 1FKOB 3R97A 3RUBL 2W7PA 4IS7A 3SUQA 1ZBHA 3RR8A 2VF3A 3IDWA 3IUCA 4UOCA 4Y2SA 1FWLA 3DYAB 2LVWA 4ANCA 2GHWA 3V6KA 3W3SA 1BA1A 1ZD4A 4Y65A 4PXCA 3C8YA 2MYFA 3QFHA 2WFAA 2K8BB 5EXWA 2KYXA 2HBZB 2KVSA 3MAHA 2OXOA 1UPMB 1RCXB 2B9XA 5K9FA 2G09A 4IG0A 5ETTA 2P6UA 4A8QA 1LOTB 1JXBA 1Y5LB 1X31C 3QUTA 2DYAA 4YOVA 3TUIC 1X9JA 1ZBIA 2AJ4A 1N56A 1J5OA 3T1YK 1V97A 2E3TA 2PN6A 1OH5A 5CEHA 2GMHA 3R5JB 4F93B 3AVNA 3D6HB 5LXYA 3W9HA 3DI6B 5EY4A 7ICOA 5GMDA 3CJTA 3TRGA 3G25A 2VG6B 3MHYA 1TYQA 5DBCA 1QQ5A 1TUYA 5DBBA 5B08A 4UAUA 3NF8A 4HWIA 2Y3YA 1GOCA 1NSAA 5ITHA 3K0SA 5J1NA 3HOTA 2DH9A 3WC2A 4CM0A 3JXOA 2AJ0A 2OFHX 5AE3A 3UXOA 2YTUA 1F0MA 3PNIA 1RTHB 3ZTRA 2P2CB 5D4OA 1ZQLA 2ZOMA 2PC6A 3T41A 2H3VA 3Q22A 1ZPWX 1MU2A 2KVIA 4WXWA 4NPOA 2KW4A 4FF1A 1FDBA 1KSPA 2G0JA 4ECZA 2W9CB 4CYUB 3C14A 3QGPA 2FD2A 2NZCA 1OXJA 2J7KA 1HPMA 2HRYA 4JI4J 4URGA 3WU2U 3J7AP 1FJ7A 3VAJA 3A1YG 2B51A 3K5LA 3HFZB 1VQLN 1X6JA 3HHEA 3QFUA 2LECA 1MWMA 1SL2A 5KGXA 4QZFA 1WN7A 1K1QA 3IXQA 3IGVA 2XNRA 4IRKA 5JU5A 5DJBA 1DGKN 1Q3UA 2YPYA 4DV6K 1FJCA 1VIOA 2BV3A 9ICIA 3DRSB 4HTLA 2ZKUA 2OSQA 5KFUA 1T9YA 4OPAA 4FZNA 3CCQN 2KL8A 3DXBA 2M3DA 4RQMA 4O4GA 3PIPL 4CT8A 4DHYA 3TA0A 1EKRA 3H8SA 4GO5X 3DOMB 2C2ZB 4GNIA 5HHHA 2Q3SA 2PMWA 4K4UA 1IR0A 5JICA 5DDQC 1P8GA 1KLMA 1NLKL 3L4BC 2W4DA 4DV6F 2IM1A 1EX4A 1T11A 1XMBA 2KT2A 1QQCA 3N28A 1VQLS 4C0HA 3OXLA 2OFGX 1X0PA 3CPEA 4ZKAA 4EIAA 4DF8A 4LIWA 4E7IA 2W41A 4ED8A 2FPHX 9ICQA 3BUZB 2A42A 3GLJA 1IWGA 4OV1A 4Q2LA 3I0RA 2JEGA 3D2FA 3CD6N 3NMUA 3PYDA 2IAJA 4JUZA 3ISCA 3HFVA 1AROP 2N3OA 4QYZJ 1TKZA 4FK0A 2O67A 2DY9A 1REGX 4QZAA 1R43A 4CF8A 3KLEB 3MMCB 1RPLA 4DV2J 2QARB 2ABYA 1U4BA 3FFIB 3UMCA 2GOLA 5KT5A 2RQCA 2E8OA 1RU2A 3ZNJ1 7ICGA 3VR1A 2EAOA 1ZH5A 2M5YA 4F3OA 3MMBB 2YY3A 2GEMA 3BF3A 3H5UA 4CGZA 4IQWA 3S1TA 3KD3A 4BROA 1F9HA 1XC3A 1XO0A 5AQYA 3LDPA 3IAM9 4DTUA 2G8VA 3HT3A 5L9NA 2J6TA 4OO1J 8ICSA 2NUHA 3G4SN 1VJ5A 4BS2A 4F3MA 3UQSA 4LSNA 3UQ0A 3D4JA 4TXSA 3KOAA 3FZLA 4DHVA 2YNIB 1F2HA 4C3MA 2B4JA 3P39A 2O8FB 1MROB 5ALDA 4ZITA 2EWSA 1WC1A 5M2PA 1FIQA 3SLCA 3AD7C 2NXCA 5ALNA 1RNHA 5IM0B 2LYVA 2ALYB 1H98A 3MTJA 1Y0HA 1X4EA 4K4WA 4GVMA 3Q8YA 4DR5K 3W9JA 4A47A 4EGLA 5AK4A 1C0UB 4IOXA 4J9RA 1I94F 1SGGA 4J2AA 2A1JB 3ZZOA 2O5DA 2DR9A 1RDDA 1PVRA 1HR0K 3IS9B 4LQ3A 3B4DA 7ICVA 3H6EA 3CO0P 3A13A 5J0SA 3ATUA 1EARA 2FJVA 2RB7A 2JHDA 4Y2UA 2XEXA 2H4YB 4J91A 4O0NA 3KZBA 3AVHA 2MU2A 4Y2KA 4KC5A 2K89A 2KYZA 5JS2A 4CZGA 1W0HA 3GE9A 4BQLA 1N36K 4OJ6A 3UR3C 1X4DA 4OPKA 3M1FA 4KLQA 2D0PA 4LF2A 3HX0A 2B0CA 1X0FA 2C3UA 5FIIA 3VENA 4CCHA 2GC8A 2A6AA 3BSOA 3EL2A 3ZZYA 5D0HA 3VOVA 1KQSM 1W25A 5KFBA 2WVFA 4M3RA 3MFHA 4CBXA 2HW3A 5CHGA 1VYAA 2P9KA 1WCLA 4DR3K 1HJPA 4P4PA 3CCJN 2I0XA 1R6YA 2D4WA 3UO0A 2JEIA 4RW4A 3H7HB 3US5A 2W3RA 3SPZA 1HHTP 1CI4A 3KHYA 2JLFA 3SDEA 5BN9A 4RWWA 1Q18A 1T03B 3WK5A 4DR3F 1YZ6A 3D0PA 3EE9A 1B4SA 1NGGA 5KFDA 1VLBA 2VYPA 4WFYA 2CPXA 4TLQA 3LWMA 1R8CA 5IV4A 2CGJA 2XMWA 2CDRB 4BUGA 2G07A 2HG4A 2FE9A 1D9DA 5E3CA 4CLSA 3T5LA 1UFLA 2VIXA 3JSMA 4HCBA 1CRXA 2AEFA 3ISBA 4M5DB 2DB1A 1NK7A 4DN9A 1SWWA 3CCJS 1WWUA 3D68A 3PIPQ 2DRBA 4BWMA 2OGUA 4QR1A 2G1HA 2AX1A 5JUMA 2NREA 3SAFA 4W5OA 2EAPA 4US9A 4DOAA 1KC8O 1FWPA 3WBZA 2GBZA 3KK7A 2I1RA 2P6TA 3Q2SC 1KC8T 1N60A 3OL8A 3FNNA 2XLIA 4NRUA 2F8EX 2JR5A 4C0BA 3CC4N 4CJWA 1HMVB 5H9FK 2QGFB 4DV5K 5ETVA 4UB8U 3TTDA 3MR2A 9ICCA 3OYHA 3TADC 3RW7A 2W43A 5KFOA 1Q1KA 1OPZA 3TW0A 1P1LA 1HX1A 4Y2VA 4HVJA 4PGQA 3T3FA 3C15B 3BO2A 2BQ3A 2P9CA 4N8NA 2Q0RA 4CZJA 1UAXA 3D0IE 4DV5F 2ACYA 1YRXA 4CE9A 2HBQB 3V9XA 2R7QA 4W5NA 1Q79A 4IOAQ 1UPPA 4LRFA 3CIZA 2K1RA 4RUBA 4JK1A 4CHQA 3CC4S 4LR8A 1T9XA 4JK7A 2DPJA 4DOCA 2J7UA 3WIVA 9RUBA 1F1BB 2IC3B 2O4GA 5G5GA 1REVA 1HRHA 4ED6A 2YB4A 4WK1A 2FXUA 4ZCIA 2DR7A 3CPWM 4ILHA 1SV4A 4USUA 2YH1A 5J2NA 3H8YA 3G0ZA 5M2RA 3GCWP 4ID8A 1JALA 5M1NA 2JFKA 3W2VA 4TUPA 5LM7E 1HNVA 3MCPA 4P0PA 3LF0A 2J8SA 3CJ3A 5KFXA 3IRXB 1LAWA 1UKUA 4JI7K 3L6QA 8ICFA 4F36A 2JVOA 3BKUA 2O3DA 4OHXA 2JX2A 4RUHA 1RBLA 2GMLA 1UWAA 2LYAA 3T69A 4DU1A 1WNSA 4GW6A 1HI8A 1TUVA 2AYEA 5M1KA 2FC8A 3OS0A 3OUYA 1JL1A 4JWMA 3GBTA 5ALSA 2XMTA 3SV4A 1RACB 3K9KA 4CFCA 3V81B 3C7NA 4DR4J 1COOA 3BY5A 2P66A 3N9UC 5J0QA 1CZBA 3UM9A 1VSJA 5GADI 5AI4A 3S3MA 4BVPA 5ALXA 3F9KA 3J80U 3AB2B 3J80O 1D3WA 5E26A 1XSLA 3VZIA 4QS8A 2LEBA 4A61A 3HOSA 2QC3A 2ZFHA 4QIFA 5LJ5Y 1DFDA 1DBDA 4EFAC 3WK4A 3L2VA 3FEXB 4O3PA 1NI3A 3QBXA 1GLFO 1KS2A 1QAXA 3LPEA 5ALKA 3NCRA 3NG8A 3VQ4A 2WAQF 3RF9A 4KLMA 1S49A 2X74A 2EBGA 2OPSA 1FKAF 1X4GA 4FWKA 3KJVB 4JI4F 1RHMB 2ZIWA 1T44A 1ZS6A 3THTA 7ICIA 2VOOA 4FL9A 2GJFA 1QQNA 4PZNA 1GX6A 4Z6DA 5AQXA 2ZJPL 4BE0A 2X1AA 1LFPA 2GVDA 3GJTB 3I55S 3OLBA 3LDNA 5BYQA 1CC7A 3BV8A 2EKYA 2LMRA 3NASA 3AQEA 5HOOA 5HMLA 2M9KA 3T9ZA 3HHNB 1V3ZA 3BR9A 2LM1A 4RUAA 4HTJA 3I76A 5GAGP 1JMTA 1OY6A 1VQ6N 4KTWA 2F9TA 1OWXA 3C6UB 2OD6A 5EX0A 2QLXA 1WF2A 4ZMMA 4PXEA 1UQVA 4YVZA 4CGHA 4QYZK 4QU7A 3CB4A 3MM8A 4O8UA 1EKSA 5SZTA 3TQ1A 4DV2K 3MDQA 4C7ZA 4EU0A 3O4NA 3K4GA 3C1YA 4DV3J 3J7ZO 4M7YA 2VJ4A 1ZQZA 9ICFA 9ICWA 1BPEA 3P8BB 3J7ZT 3UWTA 2UU9J 1HL6A 2QO3A 4CF2A 4A8EA 4IFVA 5J2EA 3FC4A 1RB0A 5DB8A 3JPNA 4LF8J 3F2CA 4DV2F 3L09A 1MMLA 9ICJA 1FE0A 2AGOA 1U8WA 2ROPA 2BUNA 2DTUA 9ICAA 3M6UA 1WD6A 1MWKA 1H7WA 3VVTA 2RE2A 2KSOA 2R7WA 5D0RA 1JX4A 2LKYA 4OYMA 1UZDA 5KAKA 4CLPA 3MGHA 1MW7A 1NZAA 3EGVA 3A3PB 2BCQA 4LR9A 2OHFA 4K4ZA 4CE6A 2I9GA 3I96A 2WF8A 2R7UA 1IJEB 4XH5A 2QWRA 1TP7A 3OVSA 3U3YA 4LRBA 1OH6A 3ZZZA 2C3OA 3PG9A 3TWHA 3ADAC 4EFHA 2Q36A 1I51B 3U3GA 4NJ8A 3C16B 4B3TJ 1RTJA 4O4RA 2XLJA 1IKXB 1LWEB 5DB6A 2LXIA 2PBDA 4YDUC 2DNHA 4JN4A 3VEOA 4CJSA 3CP8A 3NVZA 3JQMA 4QS9A 4WIIA 3DXKA 1ZBLA 1S57A 3WKDA 3OW2R 5AQPA 1WLJA 4RPFA 1SQEA 2B6AA 1BPBA 5C2GA 4WCEQ 1BWFO 1GLLO 4WPAA 3NRBA 4DPWA 2H5EA 2Y1IA 1KQGB 1WJ9A 3AMZA 3KD1E 3SSRA 3MTKA 1A76A 4KY3A 5LSRA 3G96A 2HMIB 3I5CA 2LDIA 4P72A 1D5AA 1MMNA 4IJAA 1WSEA 4DR1K 4AL5A 3VC8A 2QZ8A 4TYAA 3QLHA 2VG7A 3NRWA 2FBXA 2Y0SD 1HNIB 5B5EU 1KDHA 1JI7A 3M2UB 2Q1NA 1LW2A 4F5NA 4UUWA 1S0NA 5EX5A 2FVCA 2LKZA 4U8VA 1GMVA 2PIIA 3L4QA 4CLWA 3I4HX 4TY9A 2NR0A 3NF6A 4NL9C 3K89A 3IWLA 1H2TZ 1X4BA 4OJOA 4B08A 2P9LB 2NUUG 2XI3A 2K7JA 2B9EA 2CQGA 2IVFB 5L9XA 3I9V9 4KLIA 2B56A 2O66A 4BDZA 3MWBA 2VJUA 3OFEA 3ISDA 2YQ0A 3QIPA 3QAEA 4DQIA 4FXVA 4OHYA 4GXKA 4PUOA 2V2VA 1BY9A 3VESA 5AQFA 3G9CA 3NVYA 3UDVA 2E7WA 4NMXA 4OKJA 1ZAXA 1B70B 1QCKA 2HVEA 1XMOJ 5AI5A 4ECYA 1TL7B 3J80Y 1HNWK 2FYXA 3BQ1A 3EDRB 1H7XA 5J2QB 1YJVA 2B9WA 3QEXA 1R27B 2B43A 2OTLN 2DNKA 2H3EB 1T6CA 4FZYA 3ET6A 3S9HA 5LJVA 3TAPA 3D2SA 5HVGA 4NLVA 1DKGD 2JRZA 2JFDA 3ZT4A 3KHGA 2JDJA 1BXNA 4IYQA 1RWKB 2AZ3A 1ZQMA 1FXLA 3RH4A 3M8ZA 4ZJLA 2C2RA 1Q3VA 1T0TV 2KHDA 1BNPA 3DFEA 1DQ8A 3JYTB 4HHHA 2IDEA 3GDXA 2XVTA 1GXTA 4KHPK 1U2VA 1NBEB 4FNIA 4NWBA 3MD1A 3M8RA 2QL9B 2IM2A 2XY5A 1S12A 3RAQA 2VGMA 4ISGA 3PY8A 2V63A 1Q5YA 5M1OA 1L3VA 4CNYA 4E8UA 2OTLS 3AVCA 4JS5A 1FRJA 2G06A 2F76X 3OXGA 8ICAA 2OD4A 3HVTA 1N63A 2ZH2A 2JMGA 3I5BA 2BJEA 4FJ7A 1WOOA 3ZTOA 3LDQA 4B1VA 4BGAA 2NXUA 1ZQEA 1WBDA 2PKEA 2ZWOA 4J9QA 3R7SB 2MJNA 2NXEA 4WU2A 3GDQA 2BW2A 2GMJA 5LMUJ 2YH0A 1ICEB 2RRNA 2HIYA 5CJ7A 3NRZA 1WOSA 1CUKA 4PKHA 3ZTQA 4Y2MA 2G5IB 3H0LB 1XQIA 2OMOA 1A5VA 3KMQA 4HT7A 2XWYA 4MIBA 1B64A 1KVKA 1W2BM 2IOHA 1ZD5A 2A1AA 1BO5O 2R4FA 3WQUA 3NWRA 1KW4A 3B0XA 2PYJA 3IBCB 4WTYA 5DDRC 3ZZ0A 4PR6A 3CXCR 2RDJA 2IJNA 2PMZF 5C0YA 1S4FA 3MPWA 1PVPA 1LWCA 2VJVA 4QWEA 3MI7X 5AK3A 2E1AA 4MFBB 7ICMA 2F3JA 3MDFA 1YKWA 5GAEI 1FXDA 3RG6A 3W5ZA 5LSOA 2XO7A 4C6AA 4CF3A 3A8EA 3OTDA 3UCZP 4IO8A 4YR3A 5AQKA 3TVZA 5DS7A 4RW9A 3L7PA 2NO4A 2GVZB 5F9LA 2OM6A 1V3SA 3M8YA 3UVJB 1F60B 3CF5L 3MM5A 3O6QA 1FKPB 2XMKA 3QU5A 3OBYA 1PK1B 5IV3A 1C1BA 2IOFA 1A5WA 1KP6A 3A8IA 4DPYA 4RQ0A 2VG5A 3ZDCA 2ZDPA 3PDNA 3UW1A 3QIOA 4DR4F 2GNKA 4DFPA 3WK7A 4KYZA 2GH1A 2HSTA 2LYHA 3L5KA 1H2VZ 2ASLA 5C25A 3DRXA 2I6WA 3N6LA 2NO5A 2EWHA 2ZHAA 1WSRA 1KR4A 2HGNA 3O4WA 4HHUA 2P35A 2K2PA 3Q23A 2CPDA 4I56A 1ITGA 3ISNC 3AO5A 4M5MA 3HRGA 3HD1A 5L1KA 4YMNA 5A8KB 5TISU 4DQQA 5CHIA 3BQTA 1CJTB 2DNLA 3AA8A 4OHZA 4HYKA 4IDKA 2XI9A 1S77D 4KI6A 3SCIE 2RE1A 2ZZMA 2ZTCA 3I31A 4FZMA 2F4VK 1KQKA 2ZUBA 2KKHA 2I5HA 5KFKA 2PFDA 4PG7A 2YPZA 5FLXO 4UAZA 1AZSB 1H72C 5EU7A 4GO7X 3UN3A 1ZM3A 3VAIA 1N5SA 4OLBA 3THXB 3IBFB 1X2IA 1FHTA 3GL1A 5D3GA 1PBUA 5HI7A 4WYBA 4O5BA 2KU7A 1BISA 3PV8A 3ULHA 4TQRA 5LMNK 2XCPA 3ICLA 4DV3K 4WK3A 3MPYA 5DLFA 1H0HB 4GLXA 3IAS9 3V7JA 2UU9K 2ZZNA 3K5MA 4DR7K 1B22A 1JLAB 4BRIA 4B3OB 5D46A 5LY3A 2Q4TA 2PEHA 3H4BA 4YY3J 2HCFA 3V4IB 1BL3A 1A6LA 3PRVA 1VRTB 2QSWA 3VALA 4LF8K 5KG0A 2DXFA 2M88A 2L48A 1JXVA 3Q86A 4QW9A 2P51A 4ECUA 3W0LA 1VRQC 2UU9F 4LD0A 4QIEA 3VHQA 1ZJNA 2QA4N 4DS4A 1NK6A 5J2PA 2L9WA 5HL7L 4KTQA 2LSNA 1VQKS 2X1GA 2ZC3A 4LF8F