1U48A

Extension of a cytosine-8-oxoguanine base pair
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
580
structure length
580
Chain Sequence
b'AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 215
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u48A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u48A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u48A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u48A01
3QEVA 4N56A 4FM2A 3C5GA 4K4IA 2E6LA 9ICQA 1YT3A 4MF2A 1C6VA 1X2IA 5L1LA 1HMVA 5T7BA 4RQ7A 4C8OA 3ISCA 3QEBZ 2FPKA 4Z6DA 5KFRA 4FLZA 4QWAA 3PV8A 2AJQA 4PHDA 3AVIA 2JEFA 3KK2A 2IAJA 3A2FA 5IIOA 2V4RA 3VQ9A 4FM1A 4DFJA 4KB1A 4ED8A 3C94A 1MSWD 2IDOA 5J2PA 4M3WA 1LAVA 3H40A 5EOZA 3CFOA 1ZQLA 5DB8A 4NLKA 2A1JA 4GXJA 5C25A 4KLOA 3AA4A 1JLAA 2Q0ZX 3QEWA 4Z4EA 2P66A 4F4ZA 5DDMA 1WSJA 3IAYA 4KHNA 3AU6A 4YFKA 3Q8KA 2EX3A 8ICPA 3AO3A 4RW7A 1EP4A 4I9QA 4XQ8A 3QIPA 1J9AA 3CM6A 3UXOA 3HVTA 1ZBHA 5KI6A 3RAXA 1XO1A 3SQ0A 4RNMA 4ED6A 2BCUA 1RDBA 2LSNA 4F5OA 4DTOA 2HHSA 1TKZA 4M9HA 1CZ9A 3DM2A 5HMMA 2YKNA 4YQWA 5KFJA 3DRSA 5EWFA 4Z4FA 1SUQA 8ICGA 4JK1A 4KO0A 5DBBA 1SV5A 1RTJA 3TAPA 2XGPA 1D9FA 2E4LA 3UQ0A 3LAKA 3HYFA 4N47A 8ICZA 3HPOA 2P6UA 3HW8A 1IKWA 1S6QA 4AHVA 1FKPA 3RAQA 3VQQA 3L3UA 2ZJ5A 3OYKA 1FK9A 3ZSOA 3NH1A 3VN5A 4QZAA 5DG7A 2AGQA 4JRPA 5FROA 5L1IA 3RB3A 3LPTA 4CJSA 4OKJA 4KFBA 3DOLA 4IG3A 1VRTA 2OA8A 4CIFA 4KMUA 4J9RA 3AA2A 2BGGA 3BQ0A 3EW9A 1TGOA 5J0YA 1S0OA 4L8RB 3G6XA 4HUGA 4FBUA 3S3OA 2ASJA 5DGAA 4B9TA 4OVLA 1ZQWA 3G6VA 3V9UA 4IR1A 4DQRA 1WN7A 4NLZA 3C6TA 4FCYA 4I2GA 4Z4GA 3OYGA 2W9AA 3PO4A 1SL1A 2DFFA 3DMJA 4FZYA 4E1MA 1ASVA 3T5KA 1SKSA 4MEXA 3VQ6A 2VA3A 1L3UA 2ZTCA 1S1WA 3M8QA 4OJRA 2QXFA 3L2QA 4J2DA 3C5FA 2A1SA 7ICFA 3RJEA 3S9HA 5KTQA 4CK2A 4F8RA 4F5QA 4DL5A 2NRZA 3MFHA 3HWTA 1VSHA 2C22A 4UAYA 4LH4A 3KTQA 1ZQMA 1J5OA 3OYEA 1A76A 5HHHA 2NRWA 3RJHA 1LWFA 3DLEA 4CGGA 3O3FA 4QZCA 1L3TA 4Q5VA 4JRQA 3SI6A 1WSEA 4RW8A 1S0VA 5J2BA 2OWOA 4DOCA 3PW4A 5CWRA 1ZJMA 3U3GA 1KVCA 2XHBA 1EXNA 8ICJA 1RDAA 1ASUA 1HUZA 5J0UA 2W8LA 1KCFA 2GUIA 3MEDA 3ZT3A 4KTZA 3AA5X 3AVMA 4QZBA 3ZSRA 4CGDA 4RUAA 3UIQA 4O5EA 1Z25A 2C2DA 1TAUA 4CE9A 1KDHA 4IRKA 3V9WA 2KN7A 3S3NA 3RJJA 4UB2A 3THVA 4JWNA 3KHRA 2D0AA 9ICCA 4XA5A 3NGZA 2BANA 4DU4A 3C1ZA 3SQ2A 2FPMA 4E3SA 2BHNA 1K1QA 3QNNA 1MU2A 4O3RA 4M47A 4GC7A 2HMIA 4HCBA 4R8UA 5DQIA 4TUQA 2IHMA 1X1PA 5KT3A 1NJWA 4DL6A 1JXLA 3SQ1A 1ZQGA 2DPJA 4FLXA 2XC9A 4B9NA 3NCIA 1ZQYA 1Z26A 1TK5A 5CP2A 2ZUBA 4UBBA 4KTQA 3NF7A 1JKHA 1RXVA 4TSXA 5KT6A 5C24A 3C2KA 4QZ8A 4F2SA 1A77A 2PI4A 3HPGA 3RMDA 4FK0A 5IIIA 3O4NA 2WONA 3CQ8A 3K5LA 2ASLA 2ZJ8A 5HNKA 3ITHA 5J2AA 8ICLA 1L5UA 5KFDA 2PFNA 3B6PA 4Q8EA 5J0PA 3ZSQA 2HW3A 2AQ4A 5IIJA 4IRCA 1JMSA 5CYQA 3HX0A 2XGQA 8ICWA 4FJ8A 5CYMA 3RMBA 4Q8FA 3M8RA 4XIUA 3RMCA 3JPTA 1BPBA 5KFGA 2Z1HA 1F21A 3QEAZ 4KHYA 4OLBA 5FDLA 1ITGA 8ICOA 3RJIA 4PA1A 2IC3A 4CJQA 1BI4B 5BPCA 2W9BA 1HYSA 4ZTJA 1HJRA 2KZ3A 3KD1E 1RILA 4O44A 8ICEA 4E7LA 3PO5A 3GDXA 3E01A 4H8KA 4CGIA 4LZGA 2HHWA 3AV9A 1D8YA 4F50A 2ZQBA 2B5JA 3EYZA 3DLBA 4IQWA 4W5TA 4YP3A 5KT5A 3MGHA 3L3VA 4Z4IA 4PHEA 4YNQA 5I3UA 3PMLA 4G1QA 3P83D 3RJKA 4RT3A 4KLLA 1U49A 1VSMA 3AVHA 2OZMA 1T7PA 4BDPA 2XRIA 4F2RA 5CJ7A 1IG9A 4E0DA 1RT3A 5D46A 4QW9A 1C1BA 4RQ0A 1T3NA 1ZQTA 4CF9A 2RDIA 1KFSA 1LAWA 3OYBA 5J0QA 2AGPA 1U45A 4FJMA 3VQ5A 3MR6A 2AQ0A 4IQUA 1KFDA 8ICQA 4F4WA 2BCSA 2UVRA 3TFSA 4O0IA 4CJ3A 8ICCA 4J2AA 3CYMA 4GVMA 3B6OA 1VSFA 4MF8A 3ZDAA 1ZQIA 4C8NA 2HNDA 9ICLA 4ELTA 2XY6A 4FK2A 3V1RA 4IRDA 2ETJA 1S9EA 3NGIA 1ZBIA 3RTVA 3JPNA 2D0CA 4RG8A 4N76A 3IS9A 1R0AA 5KFIA 3MABA 1JXEA 2G8HA 1IKYA 1BVSA 9ICVA 8ICYA 4AHRA 1DTTA 3PX6A 4B9UA 4I9LA 4O4GA 3T5JA 2BCVA 3LK9A 2ZE2A 2IHNA 4CHYA 3T1AA 4DLGA 1RT4A 3QE9Y 3TABA 5DLGA 9ICFA 3GIJA 3P5JA 5KFYA 4BWJA 2KTQA 2H5XA 9ICOA 4ED3A 4CCHA 4FJJA 4KLEA 2HB5A 3H8SA 3OSNA 4O5KA 3OYNA 4R64A 4O55A 4YXJA 3ZSYA 4DTJA 1BGXT 1S77D 3OHAA 4M41A 1T4GA 3ZDCA 4CHPA 1DTQA 3K5NA 4YMOA 3HM9A 3AO5A 3RH4A 1KLNA 4YXMA 2W9MA 4NM1A 5HRRA 3DOKA 3V6JA 4Q45A 3Q8LA 2Q3SA 4AHCA 1X9SA 5HRNA 2BGWA 3S3MA 3ISDA 2FLNA 3QLHA 3NAEA 1U9LA 1TKXA 3ZDEA 4Z0UA 4OPKA 1Q9XA 1S9GA 4KKOA 4ID5A 2F8SA 5BOMA 5DLFA 4DWIA 1BCMA 1J53A 4RQ3A 1BL3A 2QKBA 3AVNA 2BCQA 5J2GA 5KG7A 2PXIA 3GIKA 3V6DA 3SUNA 4UAZA 3UPQA 3RH5A 2HNZA 4HTUA 3ZSVA 2UVVA 4PGYA 4BXOA 4MEYA 3VQCA 3TANA 4PUOA 3MXJA 1UOCA 3MEGA 2G8KA 4FS1A 4R66A 4YVZA 3K59A 7ICIA 4ECRA 1BQMA 3KK1A 3HP6A 1FKOA 3MR3A 4KHUA 4QZDA 1I39A 3KIOA 3E2EA 4KLIA 2BPFA 4NCGA 5KFHA 5J2NA 1WSGA 2XCAA 3OYFA 3ALYA 9ICNA 3JPRA 4DSEA 1ZQBA 4CFDA 8ICSA 4R65A 3ZSZA 5KFKA 5KFVA 3SV3A 3PR5B 5KFCA 5IIMA 3GIIA 5CHGA 4EZ6A 3G0ZA 4CEBA 1RPLA 8ICRA 5J29A 1RBSA 4DEZA 2BPCA 3H8JA 4FLWA 3V9ZA 4KLHA 4M6WA 1XS9D 3ETLA 1JLGA 4UB3A 4BWMA 2PY5A 2HHUA 2KQ2A 3QEXA 2MAXA 1XSNA 1BPDA 9ICIA 4DFPA 3HO1A 2HHVA 8ICIA 4F4XA 4KB0A 4RQ2A 4RW6A 4NLNA 4RW9A 1X9WA 7ICNA 4DSLA 1RT2A 3D0PA 4KRFA 1XHXA 2W42A 3V7LA 9ICGA 3MFIA 3TQ1A 5DB7A 9ICTA 4JS5A 4RQ4A 3LWLA 1Q8IA 4Z6EA 4M04A 1ZQFA 1RBVA 4HCCA 3DLKA 2XO7A 2DPIA 2ATQA 2FBYA 1IXRA 4RZRA 2P6RA 4I2CA 3MR2A 3IRXA 2DY4A 2GWSA 3RBEA 4F4YA 3K57A 3AVJA 1GOBA 3DRPA 1D8LA 9ICEA 4I2QA 3K75D 2VG6A 4CJKA 8ICHA 1N6QA 2F1IA 2PZSA 5J0WA 4Z6FA 2X74A 4W5RA 4FJGA 4CJFA 1QLNA 3O3HA 2XCPA 1VSJA 4DTSA 4O9MA 3D45A 3PVXA 4TQRA 1KEJA 2NUBA 1QQCA 4B8CA 2FMQA 3BGRA 2F1HA 4QZEA 1ZQUA 4MFBA 4HUFA 3ZT4A 3AU2A 4QWDA 3BQ2A 1RT6A 2JZBB 3PX4A 9ICKA 4J9NA 4YD2A 1S76D 4UBCA 5JS2A 4B9LA 3LAMA 3EWAA 3DLGA 1A5XA 3Q8SB 4QAGA 2UVWA 5E41A 8ICTA 3OHBA 4I7FA 2O4IA 1VSIA 4QWEA 4KN7A 1TL1A 3HPHA 4IR9A 3M8PA 5J2DA 3T5HA 4N5SA 3RH6A 3KLIA 1HPZA 2JEJA 2RN2A 1XU4A 4CEEA 5DDYA 4NCAA 2RPIA 4CJVA 2ITGA 1G15A 5DG9A 7ICEA 2R8JA 3V72A 3QEPA 4I2JA 4CERA 4F5PA 2M9NA 1GOAA 4BDZA 4LH5A 2P51A 4Z4CA 4DL2A 2DTUA 4CEDA 1HUOA 4JWMA 1K1SA 3SV4A 1RBTA 1QSYA 1AROP 4EBEA 1C1CA 3I0SA 5K14A 3SUQA 1IKVA 2F1JA 5J0XA 1Q9YA 2OPQA 4DQSA 4KLMA 3TR8A 1JN3A 3QO9A 1WSHA 3AVBA 1QTMA 3LDAA 3GILA 5HBMA 1L3VA 1BHLA 4I29A 4JUZA 1NK4A 1X9MA 4MFAA 3M9NB 2J6UA 4KN4A 4B08A 4BE1A 4QWBA 3CFRA 1HYZA 3H08A 1UAXA 1ZBUA 5DKWA 2YNHA 1RZTA 4R8UB 8ICBA 5J2EA 3ORYA 3V1QA 2YHAA 2ZJAA 1EETA 3CM5A 4M9LA 4CEAA 3MAQA 4CIGA 4AHSA 5DBAA 3TAGA 2HHTA 2D5RA 2I5JA 1T03A 1KVBA 1NK9A 2F8TA 4TUPA 3QESA 5J0TA 4NYFA 2FBTA 4RQ5A 4CJWA 1NOZA 7ICJA 1EXQA 4KLJA 3M9MB 2MUTB 1HRHA 4KREA 3UQ2A 3U6FA 9ICJA 1K6YA 3OYDA 3TAEA 4UAWA 5TZVA 4FZZA 7ICSA 2NRXA 2YNIA 3QIOA 1XC9A 3K5OA 4PQUA 3ZDDA 3SCXA 4CGFA 1LWEA 2R8IA 1RTIA 4CJPA 4M9GA 4ZTFA 3LZIA 4CEQA 3TAMA 4BDYA 1N5YA 4F3TA 1XSPA 3L2RA 4R63A 4DQPA 5J2IA 5BOLA 1VSDA 3AA3A 2PFPA 2W9BB 2KW4A 7ICRA 5CZ1A 3ZD8A 2FLLA 3TI0A 3WNHA 3ZDBA 1VSKA 1SKRA 3RJGA 4OPJA 3MR5A 1JL1A 3HT3A 5HLFA 1TK8A 7ICPA 4RUCA 1S1XA 3OYIA 5EWEA 1NK8A 3SYZA 3RB0A 4EYIB 1QSSA 1FXXA 2LYHA 3MDCA 3K58A 1C0UA 3LPUA 3C6UA 1U48A 5L1JA 3AVLA 1RYRA 3OY9A 4G3IA 3K5MA 4KITB 4OGEA 2JGUA 3SQ4A 3JPPA 3Q8QB 4YR0A 4ELUA 2PYLA 4FJHA 5KFOA 2OYQA 4M0AA 4DS4A 2J6TA 4RNOA 1HQUA 3FDSA 5CZ2A 4M42A 4FJNA 3KLFA 4O3PA 3SPYA 2ZTEA 2Z1GA 3MECA 4O5CA 4Q44A 3DLRA 3VQAA 2ISPA 4MFFA 4H4MA 4DTNA 2ZTDA 5FRMA 3B0YA 4DL4A 4CF0A 4CEZA 4E19A 2R8GA 5J2KA 1JIHA 2I9GA 2W9CB 2G8WA 4KLGA 4RQ1A 5KGWA 4DG1A 5DGBA 3PR4A 3O3GA 1JL2A 5KT4A 4YG2A 1EX4A 1QHTA 1U04A 4CJ5A 3ISNC 3IG1A 5KFUA 2DFHA 1D5AA 3V1OA 2HHXA 3L2VA 4JV2A 1Z00B 1JLQA 1NJZA 1BI4A 4DSFA 1S10A 1HJPA 3F9KA 3QETA 4M3XA 4XRHA 2HVIA 4HVJA 4DF8A 1N48A 1KVAA 3TFRA 1RCHA 2F96A 4N41A 1XWLA 4E7KA 3F73A 5J2CA 1NKBA 3HL8A 3MXIA 1DGSA 5L9XA 5CA7A 4DS5A 4I2DA 4QCLA 5HMLA 4YD1A 2YHBA 2G8IA 4QWCA 4MQ3A 4CJ4A 3LDSA 3V9SA 4QZ9A 5J0RA 3PW5A 1S0MA 4ECUA 3AVFA 4RQ8A 3EPIA 3LZJA 2QK9A 4AHTA 1XHZA 4Z4HA 4IBNA 1B92A 4O5BA 3FYHA 3MEEA 3HXMA 4KLUA 3LP2A 7ICUA 1RBRA 3C2MA 3RRGA 1ZETA 2ZD1A 4Y1DA 3NBPA 4WE1A 4DSKA 4F5NA 3VQ8A 1WNSA 4J2EA 2YV0X 3I8DA 4DFKA 3ZT1A 5KFSA 8ICKA 3SNNA 1BPEA 4AHUA 4KPYA 4EP4A 1TL3A 1KRPA 1JLFA 5KFFA 2DFEA 5J1EA 4PHAA 1NOMA 5DQGA 7ICGA 3V6KA 4DSIA 2OPSA 4M45A 4DOBA 4GXKA 2VA2A 3SUOA 3KLHA 2PYJA 2JEGA 4DL7A 3OYLA 7ICVA 3UXPA 2BQRA 3DRRA 2WTFA 4BXOB 3JSMA 5IIKA 3SJJA 4ID1A 2G8UA 4IFYA 2OPRA 4J9MA 3AVAA 4YR3A 3C2LA 4ED1A 2KFZA 4FW1A 3AO1A 2YNGA 3KHLA 2Y1JA 1LWCA 5KFBA 1NJYA 1ZQOA 4CF1A 1MQ2A 4J9QA 1D9DA 4LY7A 3OGUA 1WAFA 4ECYA 2A1RA 3I0RA 3BQTA 5KFQA 2WOMA 2C2EA 1WLJA 1BPZA 3FFIA 1TKTA 4TURA 4J9SA 3RJFA 5KG3A 2XY8A 4FJKA 5KFZA 3V7JA 3T3FA 4GMJB 4P4OA 4Q43A 3PW0A 9ICWA 1JX4A 2IGIA 3AVCA 3EZ5A 1HNIA 5JUMA 3U3YA 3L8BA 2Z1IA 3RB4A 1WSIA 4DTXA 9ICMA 4CF2A 4DMNA 2VG7A 3ZD9A 4H4OA 3C21A 2A1JB 3G6YA 3PX0A 4F3OA 4PPXA 3DI6A 3AO2A 2BDPA 4DTMA 3DYAA 1ZQAA 4IKFA 4J9KA 4FW2A 5IILA 4K8XA 4RPXA 4KTWA 4FLYA 1CUKA 4ED0A 4BE2A 1COOA 2HHQA 2BPGA 4W5NA 3QNOA 4KHWA 1ZQNA 5KFEA 4E7JA 4ECTA 3H7IA 3NHGA 4GXIA 3ASMA 5D4BA 3H4BA 3RMAA 3ZSXA 4J9OA 4UB4A 2DFLA 2ALZA 3NE6A 3TWHA 4LSNA 1C1AA 2NRTA 4MFCA 1ZQDA 4M3ZA 3OYJA 1QS4A 4Q0BA 9ICXA 5KT2A 5KG0A 3RRHA 1VK0A 3VQEA 4R5PA 4FVMA 1RDCA 5J0SA 2VWJA 3V7KA 1HNVA 2O4GA 9ICBA 3KLEA 2GV9A 4IQTA 5J2QA 4NLGA 4RW4A 4DSJA 3KJVA 4DU3A 4M3YA 4F4KA 3NDKA 2BKEA 4KI6A 5D3GA 4ECVA 4YCXA 4EZ9A 1RXWA 3VQDA 2FMPA 4EYHB 3HJFA 4CGJA 3T5LA 1NJXA 1YVUA 4KLDA 5F9NA 1RNHA 7ICOA 3BQ1A 4BE0A 4FJ7A 5J0OA 4KI4A 3PNCA 4OKKA 4KLSA 1C7YA 4E7IA 3QINA 1HYVA 3QERA 4CGHA 1H38A 7ICLA 4UB5A 4GW6A 2C2RA 1RT7A 1CXUA 3MBYA 4YMNA 3JYTA 3ZSWA 5SZTA 4K4HA 3H8WA 2FBXA 4J9LA 4QZGA 3LANA 1ZQXA 2FMSA 4ZH4A 4E89A 3VA0A 4DO9A 1YTUA 3RBDA 1TAQA 3RB6A 1S1TA 2BQUA 4CJLA 2ASDA 4P2HA 2J6SA 3KHHA 2PI5A 3LP0A 4IDKA 3GIMA 9ICRA 4M2YA 3KKRA 2OPPA 5J2HA 4YMMA 4FJ5A 4KV8A 1SKWA 4EBDA 1W0HA 1Z3EB 1ZQCA 2VG5A 5KFPA 4LVSA 1TV6A 3HP9A 4B8AB 2I1QA 3QEIA 3MGIA 3EY1A 9ICUA 2W8KA 1RYSA 4YFUA 4DL3A 3ULDA 5EU7A 3VQ7A 5J2MA 1ZQHA 2E6MA 5DB9A 4QZFA 4F92B 4E1NA 1TVRA 3VQBA 5KRTA 3GV7B 4EBCA 1TVAA 1JLEA 7ICQA 4PH5A 3Q8RB 1ZQEA 4FBTA 1J54A 1RT1A 4GLXA 1TKDA 1U47A 1S97A 1WCLA 4M3UA 4ED2A 1IO2A 4CFCA 4ECXA 8ICXA 1NKCA 1S5JA 5DB6A 4O0JA 3L2WA 5KFMA 4I2HA 4E7HA 1MQ3A 4LSLA 4ECZA 2BQ3A 3SZ2A 3BJYA 2UVUA 1BISA 5J2FA 2B4JA 4ICLA 1ZYQA 1XI1A 5HHIA 5HRPA 2JZBA 2OZSA 4DU1A 2R8HA 1KTQA 3VQPA 2P5OA 1BQNA 1RBUA 4HHTA 4CESA 1Y88A 3OSPA 3UXNA 4AILC 4CHZA 5KG4A 5KGXA 4FLTA 3SPZA 5JS1A 4UQGA 4IG0A 3OYCA 1JXBA 4I2AA 3O4QA 3OJUA 1S9FA 3GFKB 4CJRA 4NCBA 4BGDA 5KG5A 4KLTA 1UA1A 1T05A 4I2EA 4M9NA 4W5QA 3OYMA 2PFQA 5C42A 1CEZA 5C5JA 4O3SA 3WNGA 4PHPA 2B6AA 3C23A 4NM2A 3AO4A 4FM0A 4DTUA 3ZT2A 1BIZA 3T19A 4PY5A 2YKMA 4FJIA 2JLEA 5KT7A 4ZHRA 4CFBA 1SL2A 9ICPA 1REVA 4EEYA 3OYHA 1ZJNA 1W9HA 4TUSA 3SI8A 8ICVA 3CG7A 4I2IA 4F93B 2AGOA 2BR0A 2VA8A 1VSLA 5I42A 1QE1A 4M3RA 4TQSA 4DF4A 4I27A 2NRVA 5HP4A 4F5RA 1LW2A 4Y1CA 1JLBA 4QW8A 3DLHA 4Z6CA 2IS3A 4B9VA 5DK5A 1O1WA 3V4IA 3Q8MA 4CEOA 4NYNA 5HRSA 2PFOA 4RT2A 4CJUA 2FPLA 1T8EA 1L3SA 3PUFA 4KHSA 2ATLA 1IKXA 2D0BA 2R7YA 3WNEA 1HQEA 5DG8A 2BE2A 3ZT0A 1ASWA 4FLVA 2VWKA 4NXZA 2R8KA 3QZ7A 4ED7A 4IQVA 4RNNA 3Q8PB 4OLAA 4K4GA 9ICAA 4FLUA 3SUPA 1ZQSA 3AVGA 3G10A 2RDJA 3EPGA 1Y97A 4YN4A 4O3QA 1TV9A 2FC0A 5KFWA 4CFAA 5EWGA 2MUTA 4RPYA 1TK0A 1S1UA 5KFTA 2QKKA 5FRNA 1S0NA 3HVRA 3N97B 1S1VA 8ICFA 4C8MA 3NFAA 4K8ZA 3PW7A 1UT8A 4DFMA 5SWMA 4FZXC 1SZPA 1DOQA 3LWMA 1KSPA 1CLQA 4DTPA 2V4QA 4HUEA 4P4PA 1UA0A 4PGXA 1IM4A 2GBZA 1I3AA 4IFVA 1CXQA 2IOCA 3OYAA 3NF9A 5KG2A 3NF8A 4C8KA 1LW0A 4CECA 1PZNA 4OKEA 1LB2B 3KHGA 2RF2A 2XY7A 3AVKA 1A5WA 4DQIA 3GQCA 1C0MA 2P5GA 4CK3A 4ECSA 3IM1A 1BPXA 1MC8A 4I2FA 4CJEA 3V81A 1V9PA 3AUOA 4M3TA 4FS2A 4O3NA 4DOAA 2ZUDA 5HROA 1SL0A 3OJSA 3OVNA 2V9WA 3L2UA 4CIEA 8ICNA 2HNYA 2BCRA 1YTAA 3C1YA 4CK1A 3N4MB 9ICSA 4ELVA 7ICMA 1RTDA 4QZIA 4DLEA 4LD0A 2G8VA 4FJLA 2VANA 1RT5A 4EP5A 3KD5E 3TARA 4CHNA 3LP3A 2C28A 4UB1A 3PY8A 5KRSA 3K2PA 3BDPA 4KHQA 1RDDA 4RU9A 4RQ6A 3M9OB 3NH0A 8ICAA 4M9JA 1ZQVA 2ISOA 3P1GA 1BCOA 1UT5A 4CEFA 8ICMA 1VSEA 1NK5A 5KFAA 1ZQJA 1N56A 5KG1A 5KFNA 3C95A 4FK4A 1WSFA 3MXMA 3PW2A 1ZQKA 2JEIA 4FXDA 5CB1A 1QSLA 3LALA 4AH9A 4C8LA 4PGQA 1ZQRA 3LP1A 4X5VA 2Y1IA 3OS1A 4QZHA 3MDAA 1WAJA 5J2JA 8ICUA 4CJTA 3VA3A 2ZUCA 5KG6A 4F91B 4O3OA 2W9CA 4HYKA 4J2BA 3IHQB 5CR0A 4XUSA 3NF6A 2FLPA 3OS0A 5HP1A 1LV5A 5D49A 4ECQA 3JPQA 5DQHA 2P1JA 4DQQA 1CZBA 1B43A 3ZCMA 4DTRA 4KLQA 4J9PA 5KFLA 2Z1JA 4CF8A 4I2BA 3NGDA 1Z00A 2AU0A 2IA6A 3V6HA 4QOZB 1NK6A 4B9MA 1KLMA 3NTUA 4FO6A 4OGCA 5IINA 3NH2A 7ICKA 4JLHA 5L1KA 4CHOA 5DMRA 2RKIA 1NKEA 4KAZA 3M8SA 3KK3A 4FJXA 3B0XA 3JPOA 2X78A 1S6PA 4FYDA 5DBCA 7ICHA 2HVHA 3TAQA 1TFRA 1U4BA 2EHGA 2G8FA 3JPSA 3TAFA 2X6SA 4NY8A 4B9SA 1VRUA 4FJ9A 4JV1A 3K4GA 4YR2A 5CY4A 1DLOA 2B21A 3WNFA 1C0TA 2IMWP 3KKSA 1UWBA 1IH7A 4RPZA 2FBVA 4W5OA 1ZBFA 1B22A 1EKEA 3OS2A 3HSTB 1BPYA 4I28A 1NK7A 1GOCA 4KLFA 2KFNA 3NGYA 1B9DA 1ZBLA 4LZDA 1NOYA 4ECWA 2IBKA 3CFPA 3H4DA 4BACA 2KZMA 1XSLA 2KZZA 3RR7A 3RR8A 1ZQQA 1KFTA 5F9LA 5KFXA 9ICHA 1ZQZA 4PWDA 1A5VA 4JS4A 3V9XA 1ZQPA 1BIUA 4CHQA 3QZ8A 3GV8B 4P4MA 3VQ4A 4M6WB 2XY5A 3GV5B 2X6NA 3ISBA 1NK0A 3RWUA 1WCNA 3KLGA 4JV0A 7ICTA 1JLCA 1RTHA 4GC6A 4B3OA 3PMNA 4I2PA 3HK2A 1B9FA 2YNFA
chains in the Genus database with same CATH superfamily
4N56A 1RLDA 5RUBA 4QYRA 1WBDA 3CDBA 3DC2A 2WVBA 1C6VA 2MZSA 4RQ7A 3H3OB 3ISCA 4YN3B 2F9TA 1IV8A 3QEBZ 2E5LJ 2KMDA 3GCWP 5KFRA 1R43A 2QLFB 4QWAA 3PV8A 1U24A 4PHDA 3D7SB 4QPTA 2F40A 1RKJA 4JI4K 5EVZA 4Z2XA 2E2QA 4YB5A 4KB1A 3C94A 3FGUA 1HEKA 4LF7F 3CJTA 5J2PA 1LAVA 2PMZC 3A4TA 3DRPB 3WX4A 3V5RA 4GV3A 2VG6B 2M4MA 2G4BA 1S1TB 3QFUA 3CCMS 2ZBQA 3MN7A 1FO4A 2XS5A 2Q0ZX 3CDUA 1S6OA 5D0RA 3X3UA 3KKAC 2LI6A 1GXTA 5EE9A 1HI0P 4KHNA 2OPPB 1HR0F 1N36F 1PK1A 1EP4A 3VF4A 4I9QA 4XQ8A 3ZEUB 5GADP 1ZBHA 4R0EA 3MTJA 2HZCA 1XO1A 2RIJA 1JCGA 4A5BA 4RNMA 3M5RA 4CTAA 1RDBA 2BZFA 2HHSA 4WF9L 4WJ3B 2IJFA 3DM2A 4MLHA 3MDQA 3SEOA 2YKNA 5KFJA 3M8PB 3CCLS 1DKGD 2LEBA 4L74A 1LK5A 1RTJA 3TAPA 2ZDPA 2E4LA 2CQIA 3UQ0A 3LAKA 5U47A 4DR7J 4YDDB 3HW8A 1IKWA 4JB3A 3GZ7A 1CZAN 1VQ6N 1Q82O 4PPZA 2ZJ5A 3OYKA 1FK9A 1YBAA 4QZAA 3SAFA 1HL6A 3P31A 1XMQK 2JH7A 1JI7A 1M5SA 4ZVEA 3LGMA 5AQTA 4X4QA 2F4FA 4IG3A 1P9YA 3Q2SC 3QBWA 4I68A 5AKHA 3EW9A 2WFBA 3MMBA 3BBBA 3VQTA 1JB0C 2APOA 2I7PA 4F36A 5DGAA 4NE9C 2VPYB 1CG2A 2J8SA 1ZQWA 4FPRA 4DQRA 4NLZA 2YNHB 3C6TA 4M5MA 2ZKTA 4NO7A 1URNA 4I67A 4IG0B 1SL1A 2RQCA 2DFFA 3CCTA 5LSOA 3VGVA 3IBFB 1KNZA 1T05B 1ASVA 2ZWPA 2HBMA 4MEXA 1T03B 4JI8K 2B6AB 1RTZA 3HHKA 3ZTRA 4J2DA 5JICA 2A1SA 7ICFA 5KTQA 4NLOA 3TA0A 4G65A 2ZKUA 1HD1A 2PD1A 3QMQA 3A8KA 1QQ5A 3MFHA 2MJUA 1W26A 2ALYB 4CO5A 3IN5A 3QSIA 4JI2F 1VSHA 4UAYA 2QL5B 5KNIA 3KTQA 1ZQMA 3OYEA 1G6BA 5F0WA 4QPXA 3RJHA 1LWFA 4LFAF 3O3FA 2EH9A 4Q5VA 1NDPA 3SI6A 5AM3A 1WSEA 2OWOA 5CH7B 3PW4A 5CWRA 1KVCA 1EXNA 8ICJA 4ZJQA 2JH1A 2GEMA 5J0UA 3TJAA 3CCES 2EI5A 2FVRA 1H7XA 1LOTB 4GNIA 1FTCA 3FBEA 2EWHA 1SIZA 2VPXB 4CGDA 2RILA 1FWPA 3RAMA 1RGIA 3UIQA 2ADBA 2E8NA 1TAUA 2BVZA 1VQKN 3N6NA 1QVFM 1UZHA 2K8BB 4KX5A 2XNRA 4BUGA 1X7VA 9ICCA 3D9BA 2O8EA 3WDOA 3PKYA 1SJQA 2DJWA 2R2SA 3G71S 3CC7N 2IIRA 2FY1A 1ATSA 5D0HA 5E3CA 3QT7A 1MU2A 3WKBA 4GC7A 4M47A 3MHYA 1WF0A 3WQPA 4R8UA 4BREA 5IWAJ 5DQIA 2IHMA 3ID6A 1K8KB 4B3RJ 1L7OA 2DPJA 4LSZB 2JH3A 3TUIC 2MGZA 3S7RA 1V5IB 2E9RX 5BN8A 3IAM9 3NF7A 2W01A 2NPFA 3QFPA 3ZTSA 2F77X 2W41A 3IFEA 2PDAA 4FK0A 3RMDA 3O4NA 2WONA 1Z2LA 2ABYA 2ZJ8A 5HNKA 3ITHA 3MECB 3NS7B 4J7CA 4LF6K 1GNKA 1HBMB 3ZZRA 2HKEA 1X4CA 2AQ4A 4IRCA 5CYQA 3HX0A 2XGQA 3QAUA 2VCPA 2OEMA 2UU9K 4PXEA 5GADI 3NNCA 4A48A 1NBEB 2C2ZB 3M8RA 3A0IX 1AA1B 4BR5A 1KKXA 1X6IA 2E1AA 2VBWA 5KFGA 5LMNK 5AQVA 4KHYA 1RTDB 2KYXA 2BTFA 4MKBA 8ATCB 3OL9A 1ITGA 2LQJA 4RCHA 4B9QA 1RHMB 4HI2A 4CJQA 5EX5A 4FDFA 3CCVS 4DV3F 1OWXA 2YB4A 4ZP9A 2KZ3A 4P73A 5HQLA 4E7LA 3PO5A 2W2PP 3E01A 4CGIA 1HKBA 3AV9A 1AXQA 2FF3B 2OJ3A 3OD2A 4F50A 1N62A 3EYZA 1N4LA 4WQ5A 2CPHA 5KT5A 3MWTA 3MGHA 3W66A 4PHEA 4YNQA 1QUPA 3CI5A 1BD6A 3C15A 1WOOA 4NRTA 4KLLA 2GC8A 4A8KA 4LF8F 4W92B 3A5MC 2NLXA 1T7PA 3E66A 4BDPA 2BMBA 1FRMA 4F2RA 4CGZA 4Y2AA 5CJ7A 3OFEA 4DX7A 3BZQA 1RT3A 2KJ5A 4QW9A 2EC0A 1B7FA 2ZDOA 2AGPA 1GX5A 3NMUA 4L6V3 5AKLA 2CADA 2O5DA 3MR6A 4A8QA 3ICLA 2MB0B 3I31A 5A8RB 4LIWA 2OGUA 3UB5A 3QU4A 1AUDA 1NGCA 1RAAB 2K60A 2KJVA 4CJ3A 3JAMY 4W98A 4J2AA 4P52A 4GVMA 1NMNA 2YMMA 4DKWA 3FZBA 2ROEA 3B6OA 4CF5A 2N4DA 3L0QA 3DCAA 1FFSB 1U25A 2F3JA 1BU6O 3G8SA 2HNDA 3BGFA 3OBWA 1H74A 3V1RA 2IM1A 1SBRA 2VV5A 1S9EA 1T3OA 3NLCA 4C9DA 3PSFA 3DRRB 2ILZA 2Q6CA 3RTVA 1SXDA 3QIDA 3GJTB 3I4PA 3IS9A 2JXJA 1VRUB 2VASA 2ZWHA 1IJFB 9ICVA 4URQU 3JB9k 1DTTA 3I32A 4DR3K 3EJMA 4I9LA 2JWKA 2M88A 2CPIA 4QS8A 2D1CA 2ZE2A 3FRZA 3N4WA 4CHYA 3T1AA 4H4KC 1H1VA 1ELOA 4DV7F 3GYNA 1NM2A 2WOMB 2FHJA 2BOPA 1R59O 5DLGA 5AKJA 1XNQJ 2NRRA 2N4CA 2E3TA 5KFYA 5M2UA 4CJ7A 2EC2A 3TQEA 1QDUB 1C20A 4CCHA 3CRXA 4FJJA 3GMGA 2HB5A 1HBOA 3OSNA 4O5KA 2BXJA 2Y8WA 4R64A 4AT1B 4DTJA 3AOAA 1YJVA 5AI8A 4MDAA 4YUDA 4WFXA 2MA1A 4YMOA 1VQKS 3DI6B 2E20A 1RUSA 4JKDA 3IR6B 1KS2A 3LUYA 1H7WA 3KLGB 2JFDA 5HRRA 2I2YA 5AR0A 2UXBJ 3CJ5A 3QU5A 3Q8LA 1ZM2A 2Q3SA 4KBOA 4HACB 4DR6F 4AHCA 1XR6A 3BZCA 5HRNA 3G6EN 4LQ9A 1NMEB 3UWTA 3CC7S 4UUWA 3TSUA 5L9NA 2XMKA 2G0AA 2FLNA 4IJAA 3QLHA 1SQKA 2P9GA 3PYEA 5F8IA 3NAEA 1RKIA 3LYSA 1HWUA 2WTUA 4KKOA 2F5GA 3TZYA 4ZVTB 4MK8A 3KG4A 4BR0A 3N6MA 2OP5A 5J2GA 1JJHA 2J9EA 5KG7A 2UUAJ 1ZTWA 3W0LA 2IAJB 3N0VA 1RYUA 4HTUA 1U02A 1IBKF 4X65J 4PGYA 2BUPA 2XZDB 3CD6N 1YJWN 1VIOA 4FS1A 1HWLA 7ICIA 1JLAB 1BQMA 3KK1A 4KHUA 3I8BA 5AIBA 1GK8A 3ENHA 1NNEA 3KIOA 3VCDA 1X31C 3MN9A 3SAHA 1CC8A 2UV8A 3N79A 1ZD3A 2HBLA 5F8HA 4NCGA 5IM0B 5I3QA 4IOXA 4ENOA 8ICSA 3CP8A 3ZSZA 2LQ8A 5KFKA 2BZ2A 3PR5B 3EWGA 4XH1A 3GIIA 1UEVA 4EZ6A 2OI2A 2K4EA 4CEBA 1RACB 3L4PA 4QJFB 4X66F 2GW8A 3ETRA 4OX9K 4DEZA 1UVIA 2IM0A 2OHDA 2P9UA 1RSCA 4M6WA 1XS9D 1SUQB 2FLOA 2E9TA 4BWMA 2PY5A 3LP0B 2QV6A 4UARA 1IN0A 4FWRA 4K43A 1VRQC 2MAXA 3IBCB 1NJIT 2UXCF 1P1LA 9ICIA 3ULEA 2GJIA 2BE7D 2QL7B 4FSVA 1VQLS 3C2PA 4KB0A 4RQ2A 2LHTA 5IC6B 4RW9A 1TV6B 5J1NA 2AJ1A 2VYPA 1XHXA 3Q7BA 1E6YA 3MFIA 3TQ1A 1M5KC 5DB7A 1OH8A 1WF1A 3THYB 1RBVA 4KFBB 2IVOA 3H7HB 3VF0B 4ED4A 2RD5C 3QATA 3IRXA 4FOIA 1WG8A 1GXLA 1ZRMA 2BUNA 3RBEA 3AM9A 4C97A 3N28A 1GOBA 3MMCA 2MU2A 5IS2A 3K75D 4A57A 8ICHA 1N6QA 2HWTA 2F2AB 4LSLB 4W5RA 4CM2A 2GMLA 4CJFA 3DXMA 1QLNA 1N33K 4ZOHC 3B82A 3ZC4A 4LREA 1JJ2M 3BGRA 4ZDNA 4US8A 3DMJB 3H59A 4M1KA 4EFHA 4MFBA 4BRHA 1DQ8A 2AKWB 5E0OA 3BQ2A 2E5LF 2DNZA 4I6MB 3M8QB 5AQZA 4YD2A 3CERA 4BJQA 2KIWA 3UI3A 5JS2A 3VGSA 1BQNB 3EWAA 4GMKA 4QAGA 1QM9A 2UVWA 5F8JA 3ZZYA 8ICTA 3OHBA 1N32K 2O4IA 2HYIB 3JTNA 4N8OA 4DOZA 1HFEL 5J2DA 3T5HA 4N5SA 3KLIA 2LKYA 3VCBA 4ISEA 5AQSA 3DLLL 2JEJA 2RN2A 1XU4A 3U1NA 5DDYA 4K0KK 1GFWB 1WWUA 1ZD4A 1NHUA 3W9HA 1AZSA 2IMOA 5C42B 2ATCB 1YRUA 3MEDB 1N63A 1WOQA 4P2MA 3OFGA 5ETMA 5DM6L 4F0HA 3ET6A 2KDOA 4ZHRB 3KWIA 1QZ5A 4JI6K 1REVB 1S6UA 3I0SA 3TVKA 2F1JA 3G6ES 1Q9YA 4DQSA 4KLMA 3QGPA 2XQCA 1JN3A 2EK1A 3QO9A 3BF4A 1HNXJ 1UVJA 1QE1B 1WSHA 1UW9A 3FEZA 1Q5VA 3TEHB 3LDAA 3ZTPA 3KBBA 4JUZA 3LL3A 2Y9TA 2DHGA 1X9MA 2GELA 1N8RT 2MQOA 4DR7F 2I6WA 4KN4A 2XZWA 4B08A 1HBNA 3NAIA 3ILOA 3WX8A 4OZ3A 2HMIB 1J97A 3AJ1A 4JEPA 1IKXB 2DBYA 8ICBA 3SMZA 1R3NA 4M9LA 4CO2A 3Q83A 1J6ZA 3CJ8A 4OZ2A 2D5RA 1SC4B 4U96A 2I5JA 3IV6A 5HAOA 4DB3A 4HLBA 3T9NA 3OVAA 3FQKA 1W2IA 5CRXA 2A6AA 1YJWS 1E6VA 4RQ5A 2Q6BA 3CCUN 2IVPA 2GZOA 1PYTA 1U2VA 2UV8G 4JKGA 1A9NB 3OW2M 2MUTB 2YX7A 4USVA 3UQ2A 9ICJA 4ZVQB 1FJGJ 3OYDA 1RA7A 1O6XA 3W5ZA 1RAIB 4CO3A 4FF4A 4JI1J 1NZPA 2X1GA 5ETLA 5I9EB 3I6PA 1UJ6A 3MK6A 4M9GA 4DUYK 1VJQA 4BC9A 1N5YA 1P90A 1FX4A 3TSQA 4YDUC 1Y4ZB 4WIQA 2IC3B 2DUYA 2QSFA 5BOLA 5AHXA 3R9LA 2PFPA 4DV6J 4OJLA 5CZ1A 1HNWK 2Z2MA 3LVVA 2FLLA 3BH6B 3DLLQ 3UD4P 1NI3A 2JC0A 1MWQA 3RJGA 4NLUA 3C7NA 3HFVA 1S7HA 1ZXIA 3HT3A 5HLFA 4RUCA 3E9LA 3NMAA 2PMWA 5AZJB 1TP7A 4AM6A 3O8WA 1N0VC 2HNYB 2HWIA 4RBUA 3K58A 3LPUA 5IT4A 1LKYA 1SH3A 3AVLA 4OGEA 3UVJB 2DGQA 3SBGA 3D6JA 1GXUA 4DCOB 5DZ6A 4KYZA 2FVQA 2FZCB 4FPIA 1R8PA 3EM1A 3U02A 3NEKA 1JJ4A 5CZ2A 3OTEA 2LDIA 3G86A 3KLFA 4O3PA 1VFJA 5LMUK 4JB8B 4Q44A 1N5XA 3VQAA 2CIMA 2ISPA 4H4MA 3AT1B 2ACMA 4CF0A 3TA1A 3WXIA 4K4WA 1PVRA 2DKOB 2MQQA 2VC0A 5DGBA 5IWAF 3U1LA 1NPPA 2NNWA 1U1RA 3KOOA 2FVPA 4B3RF 1JL2A 3DXKA 4Y2VA 2VQFK 1N8RO 1U04A 4CJ5A 3ISNC 2DFHA 1CBKA 1D5AA 2HHXA 3L2VA 4JV2A 3EKSA 1Z00B 5M1OA 1JWWA 1BI4A 4O4GB 1SJ4P 4YOYA 1M5PC 2J0QD 2HVIA 1KVAA 3TFRA 4K4VA 1RCHA 2QARB 3MUMP 2F96A 4XH5A 3TZWA 1JALA 2DO4A 2CNNB 3L3FX 5A8KA 1ECWA 5HMXA 3BS5A 1X3MA 1DGSA 1IXKA 5LJWA 4C4SA 1CJKB 3IM8A 4QCLA 2KO1A 4YD1A 4QWCA 4MQ3A 4QZ9A 4L72B 4GKJJ 2OD4A 5K8PA 4PYDA 3SBMA 4K50A 2ASPA 2QK9A 3IFRA 4EUVA 1XHZA 3TACB 4CNZA 1B92A 2RHSB 3FYHA 2HIYA 2QA4N 2GAHC 1RBRA 4BGBA 1NG9A 4D3GA 3CHWA 1ZETA 3THXA 3HHLA 4DSKA 4F5NA 2CPEA 4WE1A 3VQ8A 1FHTA 1S99A 2WRMA 3WKDA 2HVDA 3Q2TC 1RU1A 3ZT1A 2A6OA 8ICKA 3HDSA 4DCCA 3NVWA 4EP4A 3NOCA 3FZ2A 1UKUA 1KRPA 4CD1A 1JLFA 2JRZA 2AMCB 5J1EA 4PHAA 2OPSA 3KLHA 3W60A 2P9KA 4CF3A 3UXPA 2E5SA 4NYPA 4LT6A 3CCUS 2MQNA 4BXOB 3SJJA 4ID1A 2V68A 1JLCB 1V6HA 4CT8A 4ZA1A 4X4PA 4PUOB 2Y0SC 2HHPA 3MEGB 3VAFA 4YR3A 2KFZA 1FEZA 4FWLA 2MQLA 5JVGQ 3POTA 1U6FA 2ZVSA 3OGUA 1WAFA 2KV2A 4BGAA 4ECYA 2WBMA 3I0RA 2A1RA 1H2TZ 4TURA 4TU7A 3RYLA 2DGVA 3T6JA 3ZTQA 1ICEB 1O08A 4J8FA 2D41A 3PW0A 1JX4A 2IGIA 3MN6A 1BWEA 1TUVA 2QN6B 1KP6A 3W9IA 2Z1IA 3P5TL 1PJ5A 3F9MA 2MSNA 3T1HJ 2VG7A 2H3GX 3ZD9A 4ANEA 2A40A 1OPIA 3G6YA 1JLGB 2LEAA 4GV6A 2BDPA 4DTMA 1ZQAA 4BR9A 3TA2A 5IILA 3GG0A 1CUKA 1ZRNA 1PK1B 1EP4B 2AW0A 2J8AA 4ZN3A 2HHQA 2GGPB 1XNQF 1IQTA 4B3SK 3QNOA 1VQ5N 4KHWA 1PK3A 4LJXA 4J9UE 1CJUA 3VEVA 1Q0NA 4GXIA 2QW9A 2V5HG 3ASMA 4CTAB 5D4BA 1XUPO 2FYXA 3H4BA 2IJRA 2PSZA 2QYGA 3DM2B 1KAYA 3NE6A 1FXRA 4WFBL 3UN2A 1FVSA 2YKNB 3CTRA 1RAOA 3DLKB 3QDKA 2DRBA 3VGMA 3VTHA 3M30A 3RRHA 1RTJB 1FE4A 4R5PA 3VQEA 3WT0A 3GDQA 1T9TA 2OIHA 3V7KA 1IKWB 2UXBF 5AK3A 4WCEL 4NLGA 3KJVA 4DSJA 4IDHA 1IM6A 1FK9B 2BKEA 5D3GA 4KI6A 2JLGA 4ECVA 2CQ0A 4EZ9A 1RXWA 5BPLA 1VDHA 3FR0A 4KLDA 4DR4K 4HHJA 3BQ1A 4BE0A 5J0OA 4OX6A 2P9IB 3PNCA 3A3OB 2FDRA 2G5IB 3QINA 3SCLE 2UUAF 3P38A 1YZ7A 3BEGB 3MMBB 3D54A 1TL7B 2D0PA 3DLGB 3MBYA 1PJ7A 3ZSWA 4X65F 1KQGB 5SZTA 4OHZA 1QQNA 1X0FA 1TL1B 3RBDA 2BX6A 4CJLA 3VQSA 4DPUA 1HHQA 5H1SQ 3MPVA 3UFCX 5EN1A 3PYGA 2P9NA 1G2EA 2J6SA 1DFDA 2PI5A 2RRDA 2CA9A 4IDKA 3GIMA 3JTOA 4ZVHA 4M2YA 3DNCA 5EUHA 3CJKA 3QJJA 2GHPA 4YMMA 4FJ5A 2VFVA 1U0SA 1WEXA 1SKWA 2HRTA 4I64A 1W0HA 2CH6A 2IM2A 3CDAA 1Z3EB 1ZQCA 2DEIA 2KT2A 4B8AB 4LFBJ 1ACMB 1W25A 3MGIA 1RWUA 4ALZA 3VEYA 1HD0A 3UQSA 2KT3A 2RQMA 3CQXA 2UXDJ 3ENBA 3ONNA 2W8KA 4UF4A 3WEEA 1B0XA 3UR0A 2QA4S 4BRMA 3EDQB 3ZETB 4F92B 4BC2A 4QYZK 3VQBA 4B1VA 4BC7A 1Q8KA 2F8LA 4PQAA 1JLEA 4U95A 4DCHA 2JC1A 2DHXA 3M2VA 2DH8A 1O0PA 3CIZA 1WCLA 3PEJA 2BRLA 3HM8A 4GVBA 4X62J 4O0JA 3L2WA 4WFBQ 1Y5IB 5JMNA 1MQ3A 3IMQJ 3WQTA 2JRSA 3H0LB 4K7QA 4K4ZA 2BQ3A 1EETB 2FPHX 1APSA 3GB0A 1TUUA 1K47A 1Z05A 1RAGB 2UVUA 5DDOC 5C0YA 2WF8A 1ZZFA 2GO7A 5HHIA 2JZBA 1M1GA 2M70A 1KTQA 3JSYA 3ID8A 1T3QA 3VQPA 2P5OA 4O23A 4F26A 1RBUA 5F0UA 3CJ7A 4X4VA 1RG6A 3OSPA 4OYZA 2L9DA 4WKRA 1MU2B 2AP1A 4LR8A 2CGJA 4F02A 4FLTA 1UVMA 2YY6A 2DNNA 3O3LA 2J0XA 4UQGA 1X8DA 1WC5A 1JXBA 3TVZA 3EE9A 3O4QA 2MGZB 1S9FA 4CJRA 1NUEA 4KLTA 3TAMB 1RWXB 4I2EA 2DKZA 2HWHA 1QQOA 1ZA2B 3LDQA 4MHVA 5E3QA 3OYMA 2JWNA 4ZVGA 4O3SA 5JXSA 4PHPA 3O0FA 1FTRA 1MNEA 3AO4A 3ITHB 4DTUA 1FA0A 2W1BA 1T11A 2YKMA 1ATRA 1S12A 3L4BC 4NEZA 5KT7A 1WSRA 4B17A 5BJRA 4UAVA 4EEYA 5JU5A 2HHHJ 1ZJNA 1DRGA 1SIJA 1W9HA 5KAKA 4Q2LA 4I2IA 2BR0A 4BRAA 1GLCG 4O8KA 1FEEA 1X4BA 4IOAL 4TQSA 3G4SN 2CQ3A 5HP4A 1MWZA 3QT8A 1GMUA 1Z2ZA 3CCQS 3BKUA 4PHTX 4Z6CA 4QR2A 1ZQ1C 3V4IA 1BC6A 4QR1A 2PFOA 5CR4A 4JK9A 3QGIA 3PRVA 3QUCA 1L3SA 2DGUA 1C0GA 3K8VA 1T3VA 1HQEA 3ZT0A 3IUCA 3J81Y 3E01B 3QZ7A 1IV0A 4PCQA 1EZZB 2XIDA 4ED7A 2QO3A 4XAKA 4K4GA 1C4AA 1WKJA 4FLUA 1ZQSA 3MM8A 3N5BA 4NOHA 3EO3A 4DHYA 2H3IA 3EXYA 1P8GA 1HNXF 3D0IE 3I5BA 4C23A 4O3QA 1Y5LB 3QMLA 4CFAA 5EWGA 1UZDA 1TK0A 2GWJA 4LFCK 2CVEA 5LSRA 1S1UA 2JX2A 5FRNA 3UMCA 1S0NA 1S1VA 8ICFA 2Q1NA 4C8MA 3NFAA 1TAMA 1RT3B 2YWGA 3PSPA 4DFMA 4AXIA 2XG8A 2FQQB 4FZXC 4JI4J 4AL7A 3HRGA 3IO1A 3IG1B 1P7DA 4USJC 1VLYA 5FLXY 1RQLA 4PGXA 2CZVC 1CXQA 3O44A 2RU9A 2M5YA 2IRYA 5AT1B 1NGDA 3HBTA 4CECA 4CZJA 1LB2B 1NU0A 3KHGA 4V19J 4ZLPA 2XY7A 2MEWA 4I6AA 3L7PA 3ZZUA 1WNEA 3G2XA 2HNDB 4NLPA 2JFKA 2P5GA 1NB2A 4ECSA 1BPXA 3V81A 1IBMJ 1FJGF 5HROA 1SL0A 1WC6A 3OVNA 1HW8A 4JI1F 3BSAA 1N52B 1PC4A 2LQBA 1MG7A 3IS9B 4M5IA 4ZPWR 2BCRA 3C1YA 4C11B 3WU2U 5CD4H 3IWNC 1NGJA 7ICMA 6FD1A 1OVYA 3RSEA 1CJVA 4P2FA 2G8VA 4EP5A 3VZHA 2KHCA 4O8UA 2YXLA 2C28A 2Q66A 2K2PA 4OJHA 4DV6F 2YWEA 3BDPA 2ZE2B 1KVKA 4CBXA 4IOAQ 4RU9A 4K4YA 5AE2A 3TWZA 4MO5A 8ICAA 5GMKa 2GTDA 4WXWA 1Y64A 3R6GB 1BCOA 3X1LB 1UT5A 3AL0B 4CEFA 1VQ9S 1RXOB 1VSEA 1W7AA 5HMWA 2LM1A 3CJ1A 4DUZJ 3LGNA 3DDKA 4FXDA 5A6PA 5CB1A 1QSLA 1RE1B 4K2XA 5ADXH 1HBOB 3PACA 1ZQRA 1U0HA 3PCOB 2V2KA 3IRWP 2FIUA 5GTIU 3VENA 5AKIA 2CRXA 4CJTA 5AM0A 2ZIUA 3TUPA 2DXDA 1XMQJ 1S49A 2GIQA 2VJVA 3IHQB 2GJFA 3NF6A 5HP1A 2EZXA 1D8ZA 3JPQA 3OVBA 2CQGA 2KLAA 2V67A 3MZIA 2X3GA 3UN5A 4BC4A 3A8IA 3L3CA 2Z1JA 2XMMA 2ZM6K 3QLHB 2B4OA 3V6HA 2H54B 1KLMA 3NTUA 4WQ5C 3MM6A 2YMQA 1VAZA 3WXJA 1VC6A 2H3VA 4JLHA 1WUDA 2YJFA 3ZX3A 5DMRA 3Q89A 3AQEA 3HHDA 4CZEA 1NGEA 1U1QA 3QGHA 1JJ2R 4JI8J 1Q16B 7ICHA 3SLCA 2HVHA 3TAQA 1U4BA 2PKEA 3BQ7A 2NR0A 5ALTA 3H45C 3TAFA 2B43A 2X6SA 1HWJA 4OLPA 2A3ZA 2W2NP 3CCSN 2RS2A 5JVHL 4H4OB 1OH7A 4GFJA 3R5DA 3VETA 3TEGA 1BQMB 3WNFA 4KH0B 1C0TA 3BDEA 3K5PA 4NYOA 3ENVA 3AB2B 3WK8A 4W5OA 1E4FT 1L3KA 3G4SS 3BGLA 2OM6A 4UB6U 5AZIB 2DHAA 3OS2A 3HSTB 7FDRA 4X84A 3MUVP 2QI2A 3NGYA 4LZDA 2UYTA 4WP3A 1NOYA 2F8EX 1NU4A 5E33A 2ZH1A 1OKJA 2KZZA 3RR8A 3H1VX 9ICHA 3TUJC 4PWDA 2RAQA 4GKJF 2XSJB 3NGTA 3CCZA 3BB5A 2XLKA 5GVQA 4CIOA 2P9UB 1BQXA 3VQ4A 4M6WB 4B1UB 2XY5A 4FN5A 2GHWA 2QTWA 1PCAA 2CGKA 4K5RA 2PAVA 1NGHA 3GP9A 3L9ZA 3KFUF 3KLEB 4V19X 1RTHA 3MPDA 2BJDA 4B3OA 1O51A 3PMNA 3SFUA 3HK2A 2D1KA 4TVAB 1B9FA 2YNFA 2J9CA 4RW9B 4FM2A 3E1YA 1YT3A 1GT8A 1E6YB 1OXJA 1X2IA 5LM7E 1HMVA 2E8MA 2HSZA 4NLCA 2CWKA 2E1FA 2YKAA 4KHRA 4NLTA 1ZZNA 2A18A 4OI3A 1GLEG 3SMPA 4ZITA 2AJQA 1M5HA 1NPRA 1XEZA 3KK2A 3AVIA 1EB0A 1RHRB 3IRXB 3LO3A 3I55S 5IIOA 3ZNUA 3VQ9A 4ZPDA 1RT7B 3HMJG 3OR2A 1MN8A 3JYTB 3MMAA 4M3WA 3RFAA 3MMCB 2BJ1A 3M05A 3MOZA 5GIPA 3EVOA 1N6QB 4GXJA 3I82A 5C25A 2A1AA 3DXMB 4AL6A 4NL9A 3H8YA 3KHYA 2X51A 4OJPA 3BGRB 3F2BA 4F4ZA 5SUHA 3QSYB 1HPMA 2H3FA 3M6WA 5DDMA 3IAYA 1F2HA 2NSCA 4JKBA 3EUNA 1OW5A 5JVHQ 1GAOA 3LDOA 5LMNJ 4BRNA 1J9AA 2VJ5A 2XHCA 3MCOA 3HVTA 3H5XA 2YX8A 2DGZA 2AWZA 1MWMA 2LSNA 2P2CB 2QA4G 4M9HA 1X4HA 4KGKA 1Q7LB 2R7VA 5AI9A 2W24A 3T1HF 4YQWA 3DRSA 1QJHA 2VFRA 4KX3A 2NXNA 4JK1A 4M5GA 5L46A 1RDWX 1RT1B 1DAXA 4HHHA 5C2GA 8ICZA 3HPOA 1QAIA 3RBZA 1S6QA 4OHVA 2PA3A 2BKOA 3HD1A 1ED1A 1FKPA 1AZSB 5B66U 1Z1ZA 2GO9A 5CZXA 3RAQA 3C16A 1FXDA 2HOEA 2O8FA 2ROGA 4NI2A 3ET6B 3VN5A 2AYMA 3HSGA 3CC4N 5BR8K 3KG1A 4ICLB 3I0SB 4E98A 1VRTA 1B0PA 4CIFA 2ZOGA 2BGGA 2OKQA 3CSKA 5J0YA 3OXLA 2R2TA 1Q53A 4DR1F 3G6XA 1LXNA 3GE1A 3S3OA 2FUG9 2ASJA 4OJ6A 4OVLA 4Y2IA 3R5JB 2QA1A 2YN4A 1WN7A 4UW2A 4F25A 1NPKA 1ZC6A 5C2CA 4JP8A 2NXUA 2RB7A 3KDOA 2WF7A 3QU2A 4YEAA 2FJEB 4Y6IA 4E1MA 4C0OC 2I5JB 4CBUA 1PG5B 1T9YA 3GFXA 4CWBA 1RBLA 3CCSS 2HBJA 1L3UA 2ZTCA 1S1WA 1RBOB 1X9JA 4LF7K 1E6VB 2B7CB 4RU2A 2QXFA 4CLYA 4OJ3A 3IMXA 3NNHA 3C5FA 1SPBP 4DR3J 4YY3K 3S9HA 4JKGB 4CK2A 3D7EO 4Y2PA 4DPWA 2ZIVA 1LNQA 1Y00A 4DL5A 2NRZA 2RRBA 2VKZG 2P9SB 2YQEA 2O8CB 2YQ3A 4LBHA 1KVJA 2VU5A 1TZ0A 1YDLA 4EIAA 1J5OA 1QAJA 4DV2J 4BRKA 1N5TA 2NRWA 2CNKB 3DLEA 4JI5J 2QXLA 4CGGA 3TSPA 4F9OA 1N36K 2ZOMA 3WC2A 4JRQA 1SS6A 3MN5A 1JLBB 2NREA 4RW8A 5ALGA 1S0VA 5J2BA 3SD7A 4DOCA 4JKCA 1N5YB 3W62A 2XHBA 1AYEA 3Q8UA 3ETOA 1VQSA 1HUZA 4H03B 3JXUA 2LA4A 4KTZA 1OQ6A 3AA5X 3TVYA 4LFBF 4QZBA 2NUHA 2ZEJA 4KPCA 3ZSRA 2UXDF 3NUQA 1UCVA 3Q86A 4O5EA 2I0XA 2C2NA 2C2DA 1Z25A 4XK8C 3UE2A 3NVMA 4CE9A 1X9XA 1RHQB 4IRKA 3V9WA 4C4RA 3CDEA 2KN7A 2HQCA 4UB2A 3IGNA 2FSKA 3THVA 1QD1A 5GAHP 4LRFA 4XA5A 4C8ZA 5K8OA 1R8AA 3C1ZA 1DEJA 2KKVA 3MOJB 3AXMA 2YKPA 2XI9A 4LUBA 4X62F 3QNNA 3W5XA 2DNKA 3A1YG 4ILGB 3B54A 4HCBA 1WDDA 4TUQA 4OI6A 1JXLA 2XYHB 3R8YA 5D78A 4FLXA 2XC9A 4LRCA 1KW4A 5CP2A 2ZUBA 1JKHA 3C65A 2D9PA 5C24A 2P9PA 1TE2A 3C2KA 2YH1A 4QZ8A 3KXDA 2PI4A 2QMUB 3CJAA 2F9WA 1D09B 2CVIA 3CQ8A 3EE3A 3K5LA 2GCFA 1L5UA 2O6KA 5KFDA 4FNIA 4QNLA 4QS7A 4QIWC 2HW3A 3T7ZA 2OEJA 2E2PA 4H4MB 2KK0A 2EW9A 2W7PA 2NYHA 5T14A 1XIQA 5A2QY 5CYMA 1OY9A 4NEYA 1ZA1B 4XIUA 3RMCA 1F21A 2A19A 5FDLA 2N7YA 5T41A 2CQBA 1MN7A 5ALWA 1NDLA 2H5JB 2VOOA 2D3OR 1BI4B 1YK9A 4OX9J 5BPCA 4OZNA 1HYSA 1HJRA 5HL7L 4O44A 3ZI4A 4PWWA 8ICEA 5D8HB 2DITA 4JI2K 4WPAA 3VAIA 2OANA 4IL6U 4F3MA 2IRXA 4TYAA 2JVOA 3DOMB 4BCAA 2HHHF 1JUDA 4IQWA 5H9FJ 2F65A 1H3DA 5IV4A 2XB2D 4G6VB 1XNRK 4DV1J 4J37A 1GLFO 2E5GA 4NXMK 3LPYA 2VGNA 2K4HA 3BP8A 3QYPA 3CC4S 3P83D 1U49A 1VSMA 3AVHA 2OZMA 1IVZA 1XQIA 3HRDD 2P8IA 3CMEN 5M1QA 2QMXA 4E0DA 2DB1A 1D3WA 5D46A 4RQ0A 4IWVA 4X64K 5J0QA 3HHLB 4FJMA 1M90T 3VQ5A 1J2VA 2AQ0A 4UY8T 3BR8A 4IQUA 4USMA 4F4WA 3M2UB 1XJWB 2BCSA 3TFSA 1REGX 1ZBSA 2CQ2A 3CYMA 3PHTA 2HFUA 4MF8A 2KHOA 3CD7A 2OPSB 3UMGA 3EKUA 4C8NA 3SIPB 1GX6A 2IM3A 2RKIB 9ICLA 4ELTA 3S6EA 2PMZD 3KK3B 1SAZA 4IRDA 1NHKL 5KQDA 1WI6A 3MI7X 5AI0A 1KL9A 3NGIA 1S6PB 2QRRA 2QLJB 2AZ1A 2LQ5A 2LEPA 2VGMA 3FBFA 2QJ3A 1VQ8N 4N76A 1SH2A 1R0AA 5KFIA 3MABA 3A8YA 1CJTA 4JI4F 2EBGA 3F0NA 3FSYA 4J90A 3J7ZT 3MM9A 3BPDA 4AHRA 2QG9B 3D2FA 4OJOA 4OZJA 3T5JA 1N32J 3HZ6A 3LK9A 2CH5A 2IHNA 4DLGA 1RT4A 1S48A 2B8QA 1HKAA 3I0RB 2GVDA 3L6QA 4K0KJ 2KTQA 1MMDA 1IBMF 2YKQA 3TJ8A 3VWSA 5HL7Q 5ETOA 1T6CA 3H0RB 2XVTA 3ZSYA 4FNHA 1BGXT 1ZD5A 1S77D 3Q23A 2YKOA 5H9EK 4HT7A 3VALA 1K44A 4OMFG 2J9DE 1SC3B 1T4GA 3ZDCA 2V34A 4JI6J 2I7NA 3HM9A 5GAHI 3RH4A 1KLNA 4BY9C 2W9MA 2EAMA 5B0FA 4E2FB 3DOKA 3V6JA 2JDJA 4Q45A 1H6KX 3B8AX 2I5HA 3UW1A 4GKKK 1RGVA 2BGWA 3KDNA 5A0YA 3BPSP 3ISDA 3A0HU 4OPAA 4NZ7A 3F2CA 1H98A 2W3SA 1QCKA 2OAUA 4K4SA 1CJUB 4DUZF 1U9LA 4C0HA 4ID5A 5BOMA 4ES2A 4A2AA 1BCMA 1J53A 4RQ3A 2EAOA 2NYVA 2GNKA 2QKBA 4DV5K 4PG4A 1NNLA 1EX8A 1XMQF 1SC6A 1J2NA 3M30B 3UPQA 2HNZA 3VVUA 2C3PA 1ZM4A 4R5PB 2HGMA 5B0BA 1DARA 2UVVA 3NL0A 2D3DA 1MLAA 3VQCA 3TANA 3MXJA 5KL8B 1UOCA 5FLXU 3KJVB 3MGJA 2KFYA 4CI0B 4ECRA 4QZDA 4FXVA 2VIHA 4KLIA 1BLUA 3I76A 5BYSA 2BPFA 5KFHA 5J2NA 3EGZA 3M8WA 3GONA 2FVCA 4LF9K 9ICNA 5AQRA 1M90O 1Q1KA 4A8EA 4DUYJ 1BA1A 4UY8O 3CO0P 2OTJN 5IIMA 3J7Z5 2UUWA 4BVPA 3VAGA 3R6LB 4JI8F 4KC5A 1D1UA 1QQMA 1RBSA 3W63A 4FLWA 3WUHA 2WSEC 4KLHA 2CJQA 4DV7K 3TADA 5AQXA 4OZLA 3H5YA 1FDDA 2F3NA 2P9NB 1PKUA 1SV5B 4ZCKA 2XYPB 4M94A 3J7YU 2KQ2A 3QEXA 1OH5A 1XSNA 4ZPTR 5AKZA 3UNGC 3J7ZO 1RISA 4F4XA 4UT4A 3FK4A 4Y2UA 2RRAA 4RW6A 7ICNA 1RT2A 4OYPA 2VBYA 3FM9A 2CFXA 9ICTA 2DPNA 3WEEB 3CJ3A 2EDUA 3HILA 1LQ9A 3M1YA 3O80A 1ZQFA 2HCFA 4DR2J 3DOLB 2FBYA 4P10A 2ATQA 2P6RA 3MR2A 1JLEB 3KD3A 1HJOA 3VGTA 3M2VB 5CCMA 3K57A 3QNMA 1R89A 3SQOP 2BYCA 5LMUJ 2KIVA 2EQYA 4HVZA 5ETKA 4I2QA 5E3RA 2G5HB 3HHNB 4CJKA 4Z6FA 1V5VA 5D0EA 2XEXA 1VSJA 1U1PA 1OS5A 4DTSA 4O9MA 2V2VA 2QGFB 4MIAA 3H5SA 3PVXA 3D45A 1KEJA 1SZ2A 1QQCA 3IBPA 3NP5A 5BRFA 2XMWA 5HN0A 1ZQUA 5DM7L 4B3TK 3RF9A 4QIGA 5LJVA 2DO0A 4FZMA 2PC6A 2JZBB 2VQFJ 4RX6A 1FJCA 4J9NA 1RQNA 1VK3A 1FNMA 4B9LA 1S72S 3IWLA 1X4FA 1FDNA 2EWSA 3SCIE 1A0OB 4KN7A 3HPHA 4UAUA 3I5CA 4M5DA 2RNEA 2FJDB 3KJFB 2HIQA 4CLPA 1RAEB 4EGLA 3GSIA 4CEEA 1PJ6A 4K41A 4RWXA 2K8AA 3GJQB 2D74B 2ZVIA 2DNQA 2R8JA 3CJSA 5LMNF 4CERA 4X66K 4LH5A 1R8BA 4RBTA 4CO0A 2HQIA 2YKMB 3VERA 2P51A 4Z4CA 4KIAA 2NO4A 3BSNA 4CEDA 3ILJA 3ONQA 3QAEA 4RWWA 1K1SA 1RBTA 2CXYA 2BJEA 3SUQA 2X1BA 1KKHA 5HMYA 5L1MA 2OPQA 4A4JA 2Q3PA 3M8YA 4JKFA 3VGKA 2YX6A 1H0HB 2E44A 5HBMA 1L3VA 2V7YA 3CCRS 1VHXA 4I29A 1NK4A 3I56S 5L8RC 3LGHA 1BHNA 2J6UA 2U2FA 3OL7A 5CABA 1VJ5A 3GWCA 2MKJA 4BE1A 4QWBA 1HYZA 3W3SA 4ACOA 4UZBA 5J2EA 3ORYA 3V1QA 2Z30B 4WXOA 2ZJAA 1HQEB 2YHAA 3I9V9 2POKA 3MAQA 2A41A 4CYUB 7AT1B 3GR0A 4LF5K 3AJ2A 4KE5A 1GO3F 3R1XA 4P72A 4AQYJ 5J8YA 4KH4A 3MM8B 1KVBA 4TUPA 2B6GA 1HI8A 5J0TA 3ISZA 2RHKA 4ZIWA 2OELA 2OMOA 3M9MB 4C3MA 1WTFA 8RUCA 4OJGA 2CYYA 1IG6A 2QWPA 5JJBA 5GAHU 1HI1A 3FKBA 4IFEA 1QAXA 1S1VB 3W2VA 3UE5A 5CA5A 4F3QA 2YNIA 1XC9A 2OTJS 1FNXH 1L7MA 1LWEA 2LXUA 3DXSX 2R8IA 4MH8A 1RTIA 5GTHU 2VKRA 4CJPA 3LZIA 4BDYA 5GIOA 2PE8A 3L2RA 2WK4A 1NDKA 4R63A 3I28A 4UZCA 1N5WA 3AA3A 2W9BB 2KW4A 7ICRA 5IQQA 1JROA 3TI0A 2C3MA 3D2EA 2AF6A 4DR3F 5AQUA 1YHQN 3NNAA 3TZZA 4P74A 3V81B 1TK8A 3PEHA 1S1XA 2IVYA 1G4CA 1T9XA 4DV2F 5HROB 5AXNA 5EWEA 2EFQA 3HKZC 3SYZA 3RB0A 4JI5F 5I3UB 3SR6A 4EYIB 1DY3A 4B3SJ 4BS2A 2FZKB 2V8VA 3H6EA 1I6JA 3NKYA 3CNQP 1C0UA 5FLXO 3C6UA 1WC1A 2ZJPL 5D77A 2QFJA 3OY9A 1WUAA 3K5MA 1G99A 4KITB 1GEHA 2JGUA 4YR0A 3QYYA 4ELUA 1NZBA 1IJJA 2OYQA 1ITPA 2HDOA 2DIUA 2JWLA 5AM4A 1XC3A 2LXIA 2OFHX 5I4MA 4M42A 5ALIA 2BOAA 3NCRA 4OJ1A 3SPYA 3SCJE 3DDNA 4LIRA 4DR7K 2QB0A 4O5CA 2J5AA 3UD5A 3EN9A 2RQ5A 3UKRB 1X60A 5E3AA 4DTNA 1QH9A 4EHUA 4DR5K 2CN1A 5K4LA 1PGZA 4DR4J 2XYGB 4LQ3A 2DNPA 3SDEA 3O3GA 3BS7A 4DUTA 3W65A 3BO2A 1EX4A 1OYEA 1SJRA 3PZPA 3VGUA 1QHTA 1KN5A 5KFUA 3OQ2A 3R7BB 3V1OA 1RLCL 2J9DA 1T02A 1HJPA 3QUBA 2RT3A 3C46A 3QETA 3MM7A 5B0AA 3CF5L 1KLMB 1S3XA 4XRHA 2AX0A 9RUBA 2EFPA 1NBWA 3DGPA 4Y0WA 4KJIA 3JXOA 4WKYA 4N41A 4IXCA 3QB0A 1YXQA 2XMTA 4QU6A 9ATCB 1XWLA 1ZAVA 4Y2RA 3MXIA 3DHXA 1D0EA 2G2ZA 2P6SA 1OYDA 1KQKA 4CLTA 2YHBA 4GO7X 2XBPA 3LDSA 3AVFA 3LZJA 4AHTA 4IBNA 4OX9F 3MTKA 3HXMA 3LP2A 2QEXN 2DH7A 1GQEA 3EMTA 7ICUA 3WBZA 3SQGA 3MX2A 4K25A 1TTHB 1VJWA 1DK2A 3C2MA 3RRGA 4Y1DA 2ZJPQ 4ZVPB 3NBPA 3M1FA 3BN4A 2YV0X 3HLUA 2U1AA 1VISA 1N61A 1FFUA 2ZG6A 3W9JA 1BPEA 4AHUA 1TKXB 4DV1F 1S9GB 1WBBA 3BH7B 2ZH9A 5KFFA 2IYIA 4MYUA 4PWDB 3V6KA 4DSIA 2HBYB 4LJMA 4M45A 2WUSA 4GXKA 3SUOA 2Q0RA 2Z2YB 1FRHA 4ZVSB 5HSPA 3V6DB 2PYJA 3KMSA 2JEGA 2JOQA 3UR3C 1D8BA 2WB1C 2R7XA 1YIJN 7ICVA 4JOUA 3AHPA 2BQRA 2UZAA 1EWQA 2LM4A 2V4JA 4FWOA 3JSMA 2Q97A 2FJBB 4BRFA 2G8UA 2W6KA 3F5TA 4B3OB 3PHEA 2H65B 3AVAA 2KOBA 4ED1A 3H0PA 2DH9A 4BRLA 3TPQA 2YNFB 2M8DB 3O08A 1XNSA 4JI7J 5KFBA 1NJYA 3PM9A 4CF1A 3AXKA 2KHQA 2K3IA 1HMVB 4NA2A 5KFQA 1BPZA 3FFIA 5HANA 2NS1B 5FP0A 1TKTA 1Q5YA 2M7SA 5A2QU 5GAGI 5IWAK 3EXCX 3RJFA 2GQCA 1YKWA 4Y65A 4W90B 4B3RK 4FJKA 4ES1A 2GA7A 2W7AA 3KK2B 2W43A 4PL1A 3T3FA 4GMJB 4P4OA 3CF5Q 1HIWA 2G2OA 3OR2B 2RVJA 3L8BA 1WSIA 3MMAB 2QWOA 4DTXA 5EE0A 3D6MB 1YHQS 4CF2A 2QKQA 2HRUA 4DMNA 1HA1A 4CZLA 3C21A 2GX8A 1UPHA 4USAA 4C7QA 4F3OA 4PPXA 1N32F 3TKAA 3DYAA 3M7DA 1F3FA 4J9KA 4FW2A 2MXYA 3HKZF 4RPXA 5B7WA 3K89A 1X3NA 4P7TA 1X5OA 4FLYA 1IBLJ 4TKTA 3G25A 4K0KF 2AT1B 3CC2N 5E5NA 3FCWA 2ZH6A 1QVGR 3VPZA 1C4CA 2MY7A 1ZQNA 5KFEA 3O9UA 3KZIU 1MA7A 1B4SA 1P1TA 2QWRA 5DJBA 2BKNA 4ATNA 3ZSXA 1ZM3A 1UVNA 2KM8C 2ALZA 5ADXA 3TWHA 1NEEA 4LSNA 5I3PA 4DPOA 1C1AA 4MFCA 4R25A 4M3ZA 2DNLA 3DRSB 4Z7YA 3M2RB 4Q0BA 4JI6F 1LEOA 4ER8A 9ICXA 1YSJA 4KBIA 3BF1A 4FVMA 1RDCA 5J0SA 1GLBG 4RPFA 2GV9A 2XICA 3S8SA 4DU3A 3DEEA 2MKHA 4M3YA 3IP4B 3H5UA 2ZBRA 2OTLN 3NDKA 4YCXA 3BBCA 4EYHB 4L3NA 1VBXA 1NJXA 3NRBA 1YUWA 2WFAA 7ICOA 2ASOA 4FJ7A 4YORA 4OKKA 3P4UB 4KLSA 1C7YA 4X4RA 3QX7A 3F2DA 2QT7A 3QERA 3H46O 4CGHA 7ICLA 1O13A 3EVMA 2C2RA 3QFHA 1CXUA 1SQEA 2XO6A 1VBZA 2FMSA 3VA0A 2HFOA 4DO9A 4QBUA 3EZUA 3RB6A 1S1TA 2Y8YA 2W4DA 4KMOB 4HHUA 4KY3A 2DK2A 2CRLA 2EANA 4Q7AA 5D4LA 1Y10A 2CNOB 4BR2A 2H9ZA 2W40A 3O5TB 9ICRA 3KKRA 2IY5B 2OPPA 1U7LA 2Z57B 4RQNA 3D2SA 2FXUA 4CLLA 3GCXP 2VG5A 3G9CA 4DUYF 3HP9A 3ZEUA 1JRPA 3BEXA 4ISFA 5AK4A 5IC4B 1RYSA 4DL3A 2MLXA 2QEXS 3ULDA 3ZNJ1 1K73T 2V50A 2CPRA 1ZQHA 4ZJOA 1IWAA 1Z1BA 4LR9A 1J5OB 2BEFA 3FUYA 4XDCA 1SQGA 1WKKA 2ES6A 1T44A 2KHVA 4DJBA 2IA0A 2Y1LB 1TKDA 3IXQA 2N3OA 4RW8B 4IO9Q 3BBFA 1S97A 4NL9C 4M3UA 5DB6A 1RABB 5KFMA 5EGYA 1KN6A 3LA0A 1RAFB 4A8YA 1YVFA 3ILLA 3ENAA 1HLWA 2B8PA 5A8WA 3SZ2A 5DO2A 3BJYA 2ZFHA 4X4NA 1MWKA 2WB1F 4CM0A 5HJXA 2LDYA 1BISA 4NV0A 4KGMA 3R97A 4WIIA 1ZYQA 4K4TA 5HRPA 4DR2F 1A7GE 3Q7CA 1OSDA 2ZM6J 4QQBA 5B0EA 5BXIA 3H98A 3E9OA 5LMUF 4EX7A 3K1RB 4TU8A 3H2UB 4H54A 3SK3A 3IGVA 5KG4A 4ZCLA 1IR2A 5KGXA 3ISND 5JS1A 1COKA 4IG0A 5K20B 2HLUA 3DAWA 2YY3A 2UUAK 1U2RA 1UA1A 1T05A 3N9UC 1VQON 4M9NA 1JKHB 1HX1A 2MHNA 1YWXA 4DU7A 3QT5A 1CEZA 4I56A 2VQFF 2B6AA 2VFSA 1Q95G 1G7CB 5HI7A 4IS7A 3T19A 1TUYA 3Q22A 3N5FA 5BR9A 1N34K 2JLEA 5D0GA 3EUB2 3OFHA 9ICPA 3OYHA 5AQQA 2DCUB 2Y3YA 3FC9A 3WXMB 5CYMB 4F93B 2AGOA 2ZH2A 2VA8A 1HHSA 4AP9A 5I42A 1YITN 5AIAA 4I27A 3R9KA 3DLHA 4QW8A 5DK5A 2HAFA 4CEOA 5FDLB 5HRSA 5E7OB 1VLOA 3OXFA 4RT2A 4U7CA 3CPEA 3GTYX 1RWMB 2W7OA 2ATLA 2V8HA 2D0BA 5DG8A 4RTFD 1ASWA 3ILIA 5HMZA 4M7XA 2R8KA 1IWGA 2GQ2A 2YPYA 2P9EA 5A2QO 5LL6Z 5GAGU 5ALRA 3DLJA 1TU0B 4DFDA 4OLAA 1HQUB 2O8DA 2BACA 4Y00A 3SUPA 3P8BB 3OLAA 4ZS6A 3TTFA 1Y97A 2KXFA 4NXNK 4N8NA 1F2GA 5KFWA 5ALVA 3RW7A 1ZD2P 1J2MA 2FHKA 1K73O 2MYFA 2CPYA 5L38A 1KXPA 2VQEK 3T6BA 3N7SC 2Y0SD 4K8ZA 1K8KA 3PW7A 1UT8A 3FBCA 5SWMA 1RHJB 2LQ9A 1SZPA 1DOQA 3J80Y 3EE8A 3K0SA 1SV0C 1KSPA 1WOSA 3QRQA 2YJEA 1N2XA 1AT1B 3G87A 4AQYF 4A47A 2V4QA 4CH0S 2KP7A 3WIUA 4FYYB 3NF9A 4AE5A 4QOTA 3WKCA 4C8KA 2MZRA 1Z4UA 1LW0A 2XI3A 4DV0K 2ADCA 1PZNA 4ZVRB 3L7UA 4M5JA 3NGKA 1NDCA 1VHFA 4DQIA 3GQCA 1NSPA 1PC5A 3FZLA 4MKYA 2ZC4A 2AJ4A 1PBUA 1MC8A 3JQMA 1V9PA 4M3TA 1VQ6S 1Q8LA 4LRAA 2K4IA 3BKFA 2QE5A 2ZJQL 1KQSM 2V9WA 4K42A 3ICXA 2VFTA 4CIEA 2FJXA 3MX5A 1R0AB 1YTAA 1CJTB 2I8EA 1RTDA 4OPHA 4DLEA 3THPA 3OBYA 4LD0A 4FJLA 3MM9B 4OZ0A 1RT5A 4YS2A 3KD5E 3D2FB 4YHHK 3TARA 2Z56B 4CHNA 5KRSA 3MEEB 2Q0UA 1VQMN 1RDDA 1RT4B 3AY0A 3OHRA 3M9OB 2G06A 2YWWA 3NH0A 2LYAA 1ZQVA 3AAQA 2AZ3A 3P1GA 2ZNYA 3KUHA 1XMOJ 2YCHA 8ICMA 4F0KA 4B1XB 1Z19A 2C1EB 1NK5A 5KFAA 1ZQJA 1N56A 4BC3A 5KG1A 4OHWA 2GV1A 2JR5A 3SSRA 1WSFA 3F53A 3MCMA 3QWUA 4V19S 4BQZA 3UNYA 2FF6A 4AH9A 2BJ9A 2E8PA 1TL3B 3LP1A 4B3SF 3OS1A 4KRWA 5ALEA 1OMSA 5H1SV 1NLVA 4QS9A 5BR8J 4XUSA 1NNDA 5TKWA 3OS0A 2UUCJ 4ECQA 3CDWA 2P1JA 3DN9A 2PN6A 1CZBA 1S79A 2HS0A 3AH6A 3AEVA 3T1YK 4YOXA 3F5AA 1OY6A 3RUBL 4D3HA 5A0YB 3M8ZA 2E8AA 1HBUB 4I2BA 3NGDA 2YNGB 5BYRA 4PG6A 3TO8A 1LWCB 4A8SA 4FWSA 4JI0K 4QOZB 4FO6A 1K0TA 5ADZA 4ID5B 1T94A 5E79U 4NPOA 5F3ZA 4PXBA 5AQNA 1NKEA 1VQOS 3D1HA 2C2KB 4FJXA 4URGA 2ZGZA 4DR4F 1VC5A 2X78A 5K8MA 1LXJA 3ZFVA 4FYDA 2IVFB 3NRZA 2UUBK 3VC8A 1J27A 4KGXB 4B9SA 1JK9B 1VRUA 4YY3J 3F41A 1RK8A 4JBCA 2P5VA 1X6JA 3KZXA 2LLZA 1N5VA 2PIIA 1RJJA 3FEYB 2FHMA 1UWBA 3L7OA 2JVRA 2ZJQQ 5B0DA 1IH7A 1YITS 1PVPA 2DGSA 2E5JA 3QPIA 4FF2A 4I28A 1FO1A 1GOCA 4EENA 1F60B 1TR0A 3E3XA 1SKUB 2W3RA 1B9DA 4PG8A 1ZBLA 2QIFA 2Z8QA 2CJ9A 3W2WA 4BACA 4MMOA 5AJ3K 2KZMA 4FYVB 1XSLA 2KKHA 3HHEA 4WFAL 4PG7A 1ZQQA 2XLIA 1KFTA 5KFXA 5ALXA 1A5VA 4HR2A 4JV5K 1ZQPA 1OY8A 2CAJA 3FQLA 4MKAA 1A6SA 2MKIA 1WCNA 3SCKE 5T7LA 3KLGA 1S5LU 3QRPA 1HNVB 2K8GA 4HACA 5J2QB 5E2QA 4RW4B 3QWPA 2BM1A 7FD1A 4RW6B 2FB0A 1N5SA 2MSTA 3H20A 2E5HA 4EO6A 1RT2B 4K4IA 2E6LA 3CMAN 1HKCA 2KB2A 2LFVA 4F0MA 2HMPA 1I51B 3ULHA 1DT9A 5T7BA 2YHWA 4Y34A 1PYOB 2G09A 5F8NA 4Z6DA 2JEFA 2IAJA 2QX0A 2DL0A 2V4RA 4HKQA 2ZBCA 4FM1A 4DFJA 3CUNA 3M6XA 1CSJA 1MSWD 4LC9B 2IDOA 5AQMA 2CUYA 3CFOA 5EOZA 4B6JA 4OZ1A 4ES3A 4JHDB 3D2WA 2ESEA 1FIQA 4GIBA 4NLKA 1CQMA 2A1JA 2KNJA 4ZVOB 4C0ZA 3AA4A 2WMMA 1JLAA 1PYSB 2PEHA 4JI7F 4A61A 3QEWA 4Z4EA 4A2BA 5K9FA 1Q46A 1K9MT 3GU3A 1A6LA 1WSJA 3KYLA 4B3MJ 3Q8KA 4YFKA 1HLUA 2EX3A 3NVZA 8ICPA 3AO3A 4RW7A 4KV8B 2AD9A 2MZ1A 3VEZA 1HUXA 2Z58B 2RS8A 2SXLA 4PL2A 2H3ZA 1I94K 2HSEB 3CM6A 2WAQC 2AYGA 3UDVA 1RU2A 2QLWA 3DDIA 2EFOA 2HURA 2M52A 3SQ0A 2BCUA 1OVQA 3HZGA 5HJYA 4DTOA 4F5OA 1CZ9A 3K8WA 3L95X 5GADU 5HMMA 1TVRB 4Z4FA 4UQTA 1SUQA 8ICGA 2H3QA 4ICAA 2FTRA 2EG2A 4WFAQ 1J5EK 4L75A 1XNRJ 4NXMJ 1IBLF 3EGWB 4HH0A 3BSOA 3L3UA 4NLYA 4OYAA 2KG0A 3ZSOA 1OO0B 1TUGB 2DBBA 4DCPB 2V2QA 2AGQA 1DHMA 3B9JA 2K8CB 5FPMA 3WQUA 2IVNA 5FROA 2K1RB 3RB3A 4A62A 3NY0A 4DV4K 5MLCQ 4P0QB 1YJ9N 1EHWA 5ETPA 2AIRB 4CJSA 4KFBA 4X64J 2OPQB 2OA8A 4ISGA 4KMUA 4MAKA 3BQ0A 1TGOA 2H51B 2PGCA 3O2IA 1Q86T 2WZ1A 1S0OA 4L8RB 3L5KA 3TADC 1UJ5A 1FF2A 4HUGA 3Q0AA 4DU8A 2GS8A 4XTTA 4ILHA 4B9TA 1F44A 3MD3A 4UOFA 2NZ4A 3G6VA 3EX7B 4MK9A 2B3TB 3V9UA 4IR1A 2E7WA 1K5OA 4I2GA 4Z4GA 3OYGA 2W9AA 5A76A 2PT0A 3SAGA 3IC1A 4CO1A 5EY4A 3DMJA 4FZYA 2MJNA 1X66A 1MA9B 5AQKA 3GIRA 2F7TA 3VQ6A 2VA3A 1M0SA 3Q8VA 3BM7A 4P7VA 3M8QA 1FDBA 3RJEA 4HWIA 3G82A 4F8RA 3IBWA 3OTBA 3HWTA 3DHWC 3P96A 5IT0A 2HVEA 2C22A 3NXZA 2IRUA 4OYXA 3W2VB 4DZ6A 2YNIB 3OA9A 2Z2LA 2E1CA 4HAIA 4QZCA 3PFEA 1L3TA 1LWEB 1LW2B 1U2FA 1U8SA 3AD7C 4FE3A 1RTIB 2OO4A 1YJNN 3TUZC 1ZJMA 3U3GA 1WC3A 2KH9A 4PJ0U 4BRDA 4NZ6A 2W8LA 4F4AA 5H9EJ 3MEDA 3ZT3A 5AM5A 2Q2RA 3CO9A 2HQ3A 3D2EB 1K9MO 3CCJN 2OXOA 5LOQA 2IDEA 1NJIO 2CNLB 2WSFC 4CW7B 1W2BR 1X42A 3MAAB 1KDHA 4RUBA 2HI0A 4WYLA 1S1XB 3CD6S 4GKKJ 3ZZOA 4JK8A 4GY2B 3S3NA 3HFZB 5AQYA