1U48A

Extension of a cytosine-8-oxoguanine base pair
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 215
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u48A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u48A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u48A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u48A01
1Z00A 4YVZA 3IG1A 4M3YA 3NH2A 3Q8PB 3HP6A 5IINA 4I7FA 2RF2A 3V9ZA 3PY8A 2PXIA 4E3SA 5KFEA 4RQ6A 2OPPA 1RDDA 1JIHA 1RBUA 3ZT0A 1KVBA 1S10A 3U3YA 4FCYA 3ZSRA 3AVBA 4CGGA 3UQ0A 4H4OA 4OVLA 1U48A 1ZQJA 2HHSA 4B08A 4DOCA 2X6NA 1HRHA 1IKWA 1N56A 3T1AA 4M47A 1Q9XA 3AO4A 1SL0A 4NYFA 3M8RA 3D45A 3OS0A 4RW6A 5DQHA 4PHPA 1AROP 3Q8MA 3PR5B 4KLJA 1NKBA 1RBRA 2FMQA 3I0RA 4JV2A 1WAFA 4YD2A 4B8CA 1UA0A 8ICOA 1JXEA 4UQGA 1ZQEA 8ICWA 1WSJA 5HRNA 3V81A 1D8YA 2I5JA 3AVNA 4ED1A 1JLBA 3C94A 3TI0A 1IXRA 3PW4A 3B6PA 2R8HA 2LYHA 2DFFA 2J6TA 1T4GA 4F5RA 3RJJA 3OVNA 4YMOA 4O3NA 3EZ5A 1L5UA 4Q43A 2P66A 1ASUA 4DTXA 4ID5A 3GIMA 2ETJA 3SV4A 4Y1DA 4IBNA 5SWMA 4FJMA 1DGSA 2Z1IA 4J9KA 3HSTB 4MF8A 4YR3A 5DG9A 4CGHA 4GC7A 4OLBA 4DSIA 2OPRA 2FLNA 5J2BA 4OKKA 4DFKA 2JZBB 5DK5A 4TURA 3ZSYA 1ZQPA 2E6LA 4K8XA 5EOZA 4FZXC 4MFBA 4O0JA 3QIOA 8ICQA 1ZQVA 4CJVA 3GIKA 1N48A 1GOCA 3ZT2A 4BXOB 1RBVA 4FJ7A 2ZTDA 1ZBLA 4B9NA 3AUOA 4QWCA 4LY7A 2PFPA 3LP0A 9ICEA 4BACA 2FPKA 1S1UA 4UB4A 4YXJA 3M9NB 1CUKA 2VA8A 5KT2A 2MUTA 1MSWD 2PYJA 8ICLA 5J0UA 7ICHA 3NAEA 3GFKB 4R63A 1RNHA 2M9NA 5J2JA 2W9AA 4HTUA 1T05A 4EEYA 4M04A 1KDHA 1BPXA 9ICQA 4Z4FA 4EBDA 1C0UA 3PX6A 1VSKA 1HUOA 4KLOA 2P51A 4P2HA 4ELVA 3SI8A 1TKTA 5HHIA 4R8UA 3OYBA 3K58A 1SKWA 1T3NA 3MXJA 3LP3A 2YNFA 3UPQA 3LZIA 3K57A 1Q8IA 4CJ5A 2IAJA 2R7YA 9ICKA 3QERA 5KFWA 2DFLA 4FJLA 2Y1JA 7ICFA 4FS2A 5DBCA 2KW4A 3KIOA 4KPYA 4LD0A 3C2LA 1S1TA 3PX4A 4QCLA 1SV5A 8ICVA 2JEIA 3SI6A 1GOBA 9ICSA 3MGIA 4JK1A 4J9OA 4DL3A 4OJRA 3EYZA 5DGAA 2F1IA 3KK1A 5KFQA 3H8WA 4KB1A 1TK8A 3AVJA 5L1LA 3OYFA 3PUFA 4Z4IA 3B0XA 4DTPA 3CFPA 3RRGA 1C1AA 4O3QA 1ZQQA 4BGDA 1VSLA 8ICEA 3GIJA 5BPCA 4KTZA 1S97A 4IRDA 4CECA 4I2JA 3BJYA 5IIIA 2V4RA 3OYKA 3MEEA 3DRRA 3TAQA 1FK9A 1VSIA 1JLAA 4FW1A 4E7LA 4RT3A 3LPTA 1B43A 4EBEA 1ZQUA 4QWDA 3EWAA 1NOMA 2NRZA 3OGUA 1JLQA 4MFAA 4F8RA 3DLKA 1RXVA 2HVIA 3JSMA 1WNSA 4M3UA 3FDSA 3T5LA 1SUQA 4CEDA 2GBZA 3V6DA 3KKRA 3BQTA 4I2GA 1L3TA 2OZMA 4RQ5A 4CIEA 4FK4A 1XHXA 4QZBA 8ICKA 5J2FA 4DSEA 2IMWP 1BPYA 1VSEA 4OKEA 4QZCA 5J2DA 4ED6A 2JEJA 2W9BB 4ED0A 3ZSZA 2R8JA 4Q44A 1SKSA 5E41A 1EX4A 4DFPA 1A5XA 5KT7A 2BQRA 4E7KA 1RT5A 5KFFA 2BCRA 4DF8A 5T7BA 4F3OA 3OSNA 4FM2A 4W5NA 4RPZA 3OYHA 4M9HA 4E7IA 1IKYA 4AHRA 2H5XA 4QZGA 4JRQA 5J2HA 4J2EA 7ICVA 1PZNA 3S3MA 4ECTA 1NKCA 3HVTA 5KT4A 3PNCA 3OHBA 5DMRA 5CR0A 2Z1GA 4CJLA 4NYNA 4CK3A 4AH9A 2MAXA 5HRRA 4DQSA 4CJSA 5DG7A 3N4MB 4O5KA 3THVA 2PFNA 2ZUCA 3LDAA 3VQ4A 4M41A 2AGPA 4DL5A 5DG8A 4YFKA 4BWJA 3KK3A 3JPOA 2IHNA 2V4QA 4KFBA 1D8LA 3C6UA 1ASWA 3HVRA 4KI4A 3O3HA 3G6VA 1L3SA 4QW8A 3AVKA 2G8VA 1RXWA 4H8KA 1NJXA 4I9QA 9ICRA 4IFVA 3OYCA 1D9DA 2ASDA 4DU1A 5J2MA 4MEXA 1QSLA 4DSLA 4DL4A 3RRHA 1WCLA 1JXBA 3TANA 4F3TA 1RBSA 1RT3A 1RTIA 4CF9A 1XHZA 4EP5A 4O5BA 1HYSA 3RB6A 4M3TA 4I29A 2G8WA 3MDCA 4QWAA 5KT6A 4KRFA 4GLXA 2EHGA 4I2FA 4R66A 2WTFA 2AJQA 4JWNA 4KLQA 3KHHA 1RTJA 4YN4A 3RH5A 4HUGA 2HHXA 1B9FA 1NK7A 1JLCA 4FJKA 3GILA 4WE1A 2HHQA 4B9VA 2ISPA 4I27A 2QKKA 2Q0ZX 2KFZA 1XSPA 1YVUA 3CFRA 3NDKA 3NFAA 5KFOA 2A1JA 8ICBA 5KGWA 1SZPA 4CEQA 1S9GA 3HJFA 2BCQA 1YT3A 4J9MA 3QEVA 3H8SA 5KFGA 3PW7A 1RPLA 1CXQA 2XHBA 3L3VA 2VWKA 3T5JA 1UT5A 4RW8A 3GV8B 4I2DA 3KHLA 1TAQA 3ZDCA 2AGQA 1D5AA 1LB2B 4O5CA 3NH0A 1RDCA 1ZQYA 3HX0A 1ZQKA 1BCOA 2LSNA 3KHGA 3QZ7A 5D46A 2NUBA 9ICBA 4KB0A 2HHWA 8ICUA 4KAZA 4UB2A 4EZ9A 3NE6A 3SUPA 1XC9A 2W9MA 1JX4A 1TV9A 4YXMA 4IR1A 1VSHA 4HUFA 3KD5E 3V7KA 2XY5A 5EU7A 2XCAA 4CJTA 5KG3A 4FXDA 5KFZA 5IIMA 3MDAA 5J2KA 1I39A 3KLHA 1A5WA 1QLNA 3ITHA 3ZSVA 4F50A 4FBTA 2YNIA 4CGIA 3L2RA 1QE1A 4JV0A 4FZZA 1EP4A 1XS9D 3K59A 2JZBA 3M9OB 4DL6A 1KLMA 2QKBA 4RT2A 1QSSA 3V1RA 4HCCA 4KLMA 2YV0X 4C8KA 3OS1A 5J0WA 4Z6CA 4BXOA 1S76D 3LANA 2RKIA 4FS1A 3BDPA 3KK2A 2QXFA 4KREA 4ECYA 1UAXA 8ICJA 2ATLA 3ZD9A 3BGRA 3O3FA 3LALA 1KFSA 1TVRA 5C42A 1XU4A 1KFTA 1LWCA 2PZSA 8ICPA 4DLEA 1K6YA 3OJUA 1JL1A 5HP4A 1K1SA 2HB5A 3CFOA 2B21A 4NCAA 2Z1HA 3KLFA 4B3OA 7ICSA 2KZZA 1ZQSA 5FRMA 1VRUA 1JLFA 4ECRA 4DTSA 4O3RA 4C8LA 1KSPA 3M8SA 4QWEA 3MFHA 3L2WA 4DWIA 5DBAA 3M8QA 5J0OA 1S6QA 2IC3A 4KN4A 4KLIA 2PY5A 4K4IA 4QZAA 4FLYA 1MC8A 1S0OA 5BOLA 3RJGA 4L8RB 4M3RA 3Q8SB 5J2QA 4B9TA 5F9LA 3TFSA 1QTMA 3MXMA 3OYAA 5KT5A 4DQRA 3KLIA 4W5RA 4R64A 2DFEA 5DKWA 1RBTA 3BQ2A 4IQUA 3ZDBA 3S3OA 3AVFA 1O1WA 8ICMA 4YP3A 1ITGA 3RH6A 9ICJA 2VG7A 2FLPA 2BPGA 1TKZA 2G8FA 3QLHA 1TK0A 3LK9A 1Z26A 2HMIA 3LWLA 5J0PA 3T5KA 4DFJA 2GV9A 4DTUA 3RR7A 4CGFA 4K8ZA 4PWDA 2DPJA 3M9MB 5C24A 2VG6A 1RCHA 2KZ3A 2XY6A 4KTQA 4DSJA 4FJJA 5KGXA 4KLFA 4RQ0A 3V9SA 4J9LA 4N76A 5DQIA 2D0BA 1ZQIA 3OYEA 1N6QA 1VK0A 4M42A 3CM5A 1VSDA 4UB1A 3ZSOA 1DOQA 1BQMA 4RUCA 4FYDA 2PI4A 9ICTA 5CHGA 3GV5B 2ALZA 3OSPA 2UVUA 4RW9A 3DOKA 2W9CA 8ICYA 3DI6A 1KEJA 2BKEA 4RQ8A 4KO0A 3F73A 1NK8A 1S77D 3V6JA 4PPXA 3C23A 3NF7A 3KJVA 4I2BA 3PV8A 1CZ9A 4DG1A 1TKDA 4FBUA 1DTTA 4I28A 3MFIA 3RB0A 4PUOA 2NRTA 3HYFA 4M45A 4DU4A 2YKNA 1TL3A 5HMMA 1MQ3A 4NLZA 3MR2A 3RJHA 3JYTA 2HVHA 4M2YA 3GIIA 8ICFA 4NY8A 1IO2A 4PH5A 4Z6EA 2IHMA 4J9NA 4QZ8A 2ZUBA 3MXIA 4RQ2A 3RJFA 2W42A 4NLGA 5KG1A 1LAWA 2ZJ8A 2OYQA 2PYLA 3EPGA 2ASJA 1CXUA 2BE2A 4KHNA 3SUNA 1COOA 3ISBA 3IHQB 3V4IA 4RG8A 2R8GA 7ICEA 4QZIA 3NF8A 4Q45A 2FMPA 3RJEA 1U45A 4CJQA 5DGBA 9ICPA 5CY4A 4HYKA 1U49A 3ZT1A 4FW2A 3QESA 2B4JA 1S0NA 4YFUA 3O4QA 2X78A 4RQ3A 4FJXA 4CIGA 2Y1IA 4GC6A 9ICNA 4Z6FA 3Q8LA 4PY5A 2BCUA 3TARA 9ICOA 1YTAA 4I9LA 1ZQOA 4J9SA 2O4IA 3QINA 3O4NA 4NM2A 5IIOA 2OA8A 4RQ1A 4OGCA 2QK9A 4YD1A 2D5RA 1TV6A 3AVHA 2BGGA 3RWUA 4IR9A 3ZCMA 2Q3SA 1WSFA 2C28A 4CJFA 3VA3A 5DDYA 1WAJA 2VWJA 2MUTB 2GWSA 4CJWA 5FDLA 8ICZA 4DTOA 4KI6A 4CK1A 1L3UA 3LAMA 2HHUA 4UAYA 4E19A 1WSHA 3ZSXA 3PW0A 3JPTA 1RDBA 4EZ6A 3AVAA 3HWTA 4CJUA 4E0DA 3VQPA 5CB1A 3LAKA 4JS4A 3SNNA 5KFHA 3N97B 4KLEA 4DQPA 3MR5A 1W9HA 3V6KA 4BE1A 4PHEA 3L2UA 2A1SA 4YR0A 4FLZA 1J54A 7ICLA 2ZTCA 4YCXA 4CJ4A 3HK2A 3CG7A 2RPIA 4M3WA 5DBBA 3F9KA 3RMCA 3IS9A 3OYNA 2P1JA 4FJGA 3QEPA 1WN7A 3EY1A 1Q9YA 5EWEA 5CP2A 5KFJA 4UAZA 3G6XA 4ZTJA 5KFPA 4DSFA 4F4KA 4CJKA 4CEEA 4ECQA 4FK2A 4QZEA 3UXPA 4CE9A 1S0VA 1HQEA 2BQ3A 4CESA 2J6UA 3IRXA 3KD1E 4M9JA 4YMMA 4DMNA 1SKRA 3C5FA 1HQUA 1TKXA 3TAGA 4DTNA 4ED8A 4QZ9A 5JUMA 2JEGA 3B0YA 2ISOA 3T19A 4IRKA 3SPYA 3NHGA 4KMUA 4ECVA 1LW0A 1NOYA 3AA2A 3T5HA 4OKJA 3OYMA 4ICLA 1A76A 4E1NA 4EYIB 8ICRA 4Z4CA 4NLNA 2C2DA 1ZETA 5DDMA 1R0AA 8ICSA 4Q5VA 4HHTA 4MF2A 1DTQA 2F96A 2W8KA 1GOAA 3ISCA 3RB4A 5CYQA 2YHAA 1X1PA 1LAVA 5HROA 5KG0A 1WSGA 3L3UA 3KLEA 4PGQA 4O3PA 3VA0A 1RT6A 2VA3A 1G15A 1NJWA 1BPDA 4O0IA 1A5VA 2E6MA 4TQSA 2OWOA 5J1EA 3GQCA 1WSEA 1HJRA 3SYZA 4FJ8A 2NRXA 4C8OA 7ICNA 1A77A 4F4ZA 3MAQA 1BIUA 3V9XA 1RT4A 1KTQA 4IRCA 4F5PA 2ZD1A 5DLGA 5KT3A 1CEZA 3RJIA 3CQ8A 1IH7A 4ED3A 4ECZA 4O5EA 5L9XA 5L1KA 2C2RA 5D3GA 3H7IA 3TQ1A 3SUOA 4JLHA 3SQ0A 1HUZA 1FKOA 4DSKA 1BGXT 4QAGA 4KHWA 3OYGA 3SCXA 3QEBZ 2BGWA 1ASVA 1VRTA 7ICRA 4JUZA 2F8TA 4IG0A 4DF4A 4BE2A 1QHTA 4CK2A 4TUQA 5KFDA 4KLTA 3K5OA 3S3NA 1XI1A 1U4BA 2F8SA 5KFBA 4CEBA 3PVXA 3LPUA 4FZYA 2UVVA 7ICGA 1RZTA 3QE9Y 7ICUA 4KLSA 4YNQA 3QEXA 2BCVA 5J2AA 3VQDA 3AO3A 2DPIA 1NK4A 1B22A 4KTWA 1KLNA 7ICOA 2AU0A 3C2MA 4JS5A 1Z25A 5DB8A 4MQ3A 2YNGA 5J2NA 4CF8A 2BR0A 2DTUA 3RBEA 4B8AB 4B9LA 5KFXA 3HXMA 2PFQA 3BQ1A 3EPIA 1VSMA 8ICNA 3RAQA 4P4MA 3C1ZA 1NK6A 4CFBA 1EXNA 5FRNA 2YHBA 3AA3A 3V1QA 2WONA 3ZT4A 2FC0A 3KHRA 4RZRA 1HNVA 4XUSA 2Z1JA 4NCGA 1RYSA 5KTQA 2P6RA 4XQ8A 4W5OA 3C2KA 2VA2A 4BDPA 5KFNA 4CJ3A 2JLEA 4Q0BA 2ATQA 4E7HA 4RNOA 2ZJAA 3HT3A 4RW4A 1RDAA 5DB7A 1HJPA 3V6HA 1SL2A 3OYIA 3MECA 1YTUA 1KVCA 3QNOA 5HRSA 2HNZA 3OYDA 4RQ4A 1C6VA 3K75D 4OLAA 4CFDA 5J0RA 4LVSA 5KRTA 2VG5A 4ECUA 5L1IA 3ULDA 3C21A 3TAMA 3E2EA 3PW2A 2O4GA 5SZTA 1KVAA 3TAEA 2BDPA 1MQ2A 1IG9A 1BIZA 2E4LA 3DRPA 4YG2A 5J29A 4PHAA 2ZQBA 3PMNA 2J6SA 2F1HA 5JS1A 4I2PA 4KHQA 4BWMA 3IM1A 2IS3A 4ED2A 4EP4A 5I42A 3DYAA 5IIJA 1X9WA 5J2PA 4Z4EA 4N47A 3DMJA 1WLJA 4TSXA 2XY7A 5J2IA 3VQCA 4CEAA 4CF2A 4OPJA 4KLUA 3HP9A 2ITGA 4RW7A 3VQQA 2AQ0A 8ICAA 4CERA 1DLOA 4PGXA 3ZDEA 3DLRA 1X9MA 2JEFA 9ICMA 4ZH4A 2D0AA 1J53A 2RDIA 1MU2A 3ZT3A 3DM2A 1BHLA 4O44A 1C0TA 4FJ5A 1BL3A 3V7LA 3H08A 2HNDA 2AQ4A 5KG2A 3QEWA 4GMJB 4CEFA 1VSJA 9ICUA 4OPKA 4RPXA 4DOAA 1TK5A 4DU3A 4EBCA 5HRPA 4DTMA 1X2IA 1EKEA 4RPYA 4F4XA 4UBCA 3JPQA 7ICQA 3WNEA 3WNHA 2BPFA 4M3XA 4ZHRA 1S9EA 5L1JA 5KG7A 2KTQA 2OPQA 2I9GA 3MGHA 4KKOA 5J0SA 2AGOA 3Q8KA 1NKEA 3M8PA 4J9QA 3SZ2A 3TR8A 4DLGA 2IGIA 1BCMA 1NJYA 1FKPA 3G0ZA 5HP1A 1HYVA 4ZTFA 4H4MA 5FROA 4OGEA 4E7JA 3HL8A 5KG6A 3VQ6A 4FLTA 4I2QA 5HNKA 5KG4A 3V1OA 4QWBA 1RILA 1Y88A 4FVMA 3NF9A 3HW8A 2RN2A 3QZ8A 3HM9A 3EW9A 3MBYA 1ZQDA 3ETLA 1U9LA 1T8EA 3DRSA 1KRPA 4KLHA 1LV5A 4FJ9A 3QIPA 3QNNA 4P4OA 3OYJA 3PW5A 3SPZA 4NM1A 3B6OA 3OYLA 4F4YA 4KITB 5KG5A 5KRSA 7ICIA 3HPGA 2DFHA 4F5NA 1NK9A 3K4GA 1ZQWA 1EETA 3MEGA 3SQ2A 3JPSA 3DOLA 3UXNA 2P5OA 4CGDA 4P4PA 2B5JA 2IOCA 4LSLA 4HCBA 1HNIA 1TGOA 3NGYA 3PO5A 4Z0UA 2ZE2A 3FFIA 1WSIA 2C22A 4M3ZA 4FLWA 4DL7A 4FLUA 3L2QA 1NK5A 3LZJA 3AA5X 5EWFA 3VN5A 1VSFA 3H40A 1ZQNA 5J2EA 1ZQCA 3NF6A 1ZBIA 3NGDA 3C1YA 1BI4B 3WNGA 4IG3A 3SQ1A 5CJ7A 1U47A 4RNMA 2ZTEA 5CZ1A 1JKHA 9ICCA 4YQWA 2BPCA 4O3OA 1S9FA 5K14A 2NRVA 2HHTA 1QQCA 4O3SA 9ICVA 3V9UA 7ICTA 4CF1A 2EX3A 2OZSA 3Q8QB 3BQ0A 4FO6A 4CFAA 2ZUDA 4F93B 4AHUA 4R65A 1C7YA 4IQVA 3P5JA 2FBVA 4M9NA 4E1MA 3DLBA 5J0QA 4TUSA 1UA1A 1NJZA 3RMDA 4O55A 3GV7B 2JGUA 2XGQA 3PR4A 2W9CB 3OJSA 4G3IA 3DLHA 4FLXA 4AHCA 3ORYA 2XY8A 3VQEA 3JPRA 2G8IA 5KFRA 1ZJNA 4XIUA 1JLEA 2UVRA 1XWLA 4J2BA 4I2IA 3SJJA 1NK0A 3ZDAA 5J0XA 3AU6A 9ICAA 1N5YA 3PX0A 1BVSA 4HVJA 1ZQZA 1ZBUA 2NRWA 1IM4A 1LWFA 2YNHA 8ICIA 4N56A 4EYHB 3OS2A 3UIQA 1RT2A 2FPMA 1B92A 1UWBA 3ASMA 4F91B 4G1QA 3ZSQA 5EWGA 2P6UA 4O4GA 3KKSA 3VQAA 1S6PA 3CM6A 5DQGA 9ICGA 4KLDA 4K4GA 4LZDA 4DS4A 1JL2A 4JRPA 3NGIA 4CHZA 4DL2A 4J2DA 4KLGA 5I3UA 2HHVA 2P5GA 4FLVA 4Y1CA 2X74A 4CEZA 3MABA 4TUPA 3SQ4A 4IDKA 4TQRA 4CHNA 1I3AA 5TZVA 4M9LA 5KFCA 4UBBA 3V72A 3GDXA 1RT7A 2FBTA 4LH5A 4DTJA 4IKFA 5IIKA 3V7JA 2C2EA 4JV1A 4LZGA 1H38A 1ZQMA 3QEIA 4AILC 4B9UA 3IAYA 1Z3EB 4F5QA 9ICWA 4CGJA 9ICIA 7ICMA 4M6WB 1ZQHA 3Q8RB 4ELTA 5BOMA 4NLKA 4KHSA 5F9NA 3G6YA 3VQ8A 3VQBA 1IKVA 2BQUA 4GVMA 1SL1A 2I1QA 4GXJA 4Q8FA 1J9AA 1TL1A 5C25A 3K5LA 2IBKA 1JMSA 5HLFA 4BDZA 3HO1A 4KHUA 1UOCA 1S1XA 1ZBFA 3AO2A 4ECWA 4X5VA 1ZQRA 4CHQA 1C1CA 4PA1A 4CJEA 4KLLA 4CCHA 3UXOA 3RTVA 4YMNA 4DOBA 3TABA 3A2FA 1FXXA 3ISDA 4GXIA 1S0MA 4IQWA 4LSNA 3V9WA 4PGYA 4FK0A 4Z4HA 3SV3A 3K2PA 4RNNA 2KN7A 1ZBHA 4CEOA 4DFMA 1RTDA 3L8BA 1BQNA 2W9BA 1KFDA 2B6AA 5DLFA 5IILA 3RAXA 2W8LA 3JPPA 1QSYA 4I2AA 1F21A 3RJKA 4FJNA 2V9WA 5CYMA 3NBPA 1D9FA 1XO1A 2BHNA 4CF0A 1U04A 4NCBA 4CJPA 8ICTA 3S9HA 3NTUA 2HW3A 5KFLA 1RTHA 3NCIA 1ZQBA 2XGPA 2A1RA 3DLGA 4E89A 2PFOA 4F2RA 1BI4A 4IFYA 2BCSA 4W5TA 2VANA 4F92B 3ZSWA 8ICCA 3E01A 1TFRA 3CYMA 4JWMA 9ICXA 3K5MA 5KFIA 5J2GA 1B9DA 4J9PA 1ZQLA 4M0AA 3H4DA 1S5JA 1ZQAA 3O3GA 1T7PA 4B9MA 7ICKA 5KI6A 4K4HA 3KLGA 4J2AA 4FM0A 1K1QA 4ELUA 3QO9A 2FBYA 2UVWA 2R8KA 3L2VA 3UQ2A 3RMBA 4M6WA 4AHVA 3AO1A 2FLLA 1RT1A 3U6FA 5HHHA 3LWMA 3SUQA 3AVMA 4ECSA 3NH1A 4UAWA 4YR2A 5KFMA 3FYHA 4Z4GA 5KFYA 4QZDA 3LDSA 7ICJA 2X6SA 4I2CA 2OPSA 3HPOA 4PHDA 4C8MA 1ZQGA 3ISNC 1T03A 1WCNA 4B9SA 3C95A 1UT8A 4FJHA 4CJRA 5J0YA 1LW2A 2XO7A 4ECXA 2FMSA 7ICPA 1TAUA 5HMLA 5D49A 1KCFA 1W0HA 9ICLA 2ZJ5A 3AVIA 1HMVA 3U3GA 3OY9A 4MFCA 3AA4A 1ZQTA 4XRHA 4M9GA 4GW6A 3I8DA 1L3VA 2YKMA 3QETA 2BANA 4QZHA 4KN7A 4I2EA 4C8NA 3RMAA 4QZFA 5KFVA 1HYZA 5DB9A 3LP1A 5KFAA 5DB6A 4KHYA 1CZBA 1C0MA 1ZQXA 1Y97A 4RUAA 3DLEA 4F4WA 4BDYA 1JN3A 5C5JA 1IKXA 4DEZA 4R8UB 4RU9A 1CLQA 5KFSA 5D4BA 3AO5A 5CA7A 4QOZB 4XA5A 3PMLA 3JPNA 5KFKA 1RYRA 3ALYA 4Q8EA 5HBMA 1Z00B 2FPLA 3KTQA 3PO4A 1LWEA 2PI5A 2KFNA 2XCPA 1ZQFA 4ED7A 4HUEA 3C5GA 3TAFA 3RBDA 4UB5A 3TWHA 4NXZA 4BE0A 4FJIA 3P1GA 1NOZA 8ICGA 3ZDDA 2KQ2A 1JLGA 3RH4A 1BPBA 4J9RA 4ID1A 3K5NA 1XSNA 3G10A 3MR3A 4UB3A 4GXKA 1QS4A 3LP2A 2IDOA 3C6TA 4N41A 4N5SA 9ICHA 4AHTA 1BPZA 5CWRA 4MEYA 3D0PA 5KFUA 8ICXA 3AV9A 1EXQA 2WOMA 3MR6A 2IA6A 4DS5A 4FM1A 5CZ2A 3AVLA 1JXLA 1HPZA 4CFCA 4CHPA 1BPEA 4LH4A 2XC9A 1S1WA 1S1VA 9ICFA 4PQUA 1TVAA 4KV8A 3TFRA 8ICHA 2D0CA 5J2CA 3WNFA 5KFTA 2GUIA 5J0TA 1V9PA 1REVA 4MFFA 3VQ5A 3QEAZ 2G8UA 4R5PA 4RQ7A 4QW9A 3AVGA 2FBXA 3ZD8A 2ASLA 3OHAA 3I0SA 2DY4A 2HNYA 3VQ7A 4I2HA 2F1JA 1X9SA 4AHSA 4CHOA 3H4BA 4DQQA 2XRIA 4DO9A 3MEDA 1ZYQA 4F5OA 1ZJMA 5JS2A 1XSLA 4CIFA 3NGZA 2R8IA 3TAPA 4F2SA 2RDJA 4O9MA 1C1BA 3HPHA 4Z6DA 4DTRA 3P83D 1BISA 4DQIA 2KZMA 3VQ9A 4CHYA 3AVCA 3RR8A 3H8JA 2G8KA 3AU2A 2G8HA 3T3FA 4W5QA 3RB3A 1J5OA 2A1JB 4IQTA
chains in the Genus database with same CATH superfamily
4WU2A 1Z00A 3IG1A 2RJZA 2MQ8A 2MU2A 4HACB 4LFBK 3HP6A 2LA4A 2QN6B 5IINA 4I7FA 4KIAA 4YOUA 5GAGP 2Z57B 3GDQA 5E79U 3DYAB 3H98A 4NLXA 1P8ZA 4OJHA 2N4CA 3R1HA 4K25A 1QAJA 2VJ5A 1HUXA 4AQYK 3HFVA 4FCYA 3ZSRA 2YJFA 3AVBA 4HTLA 1OY9A 4H4OA 4OVLA 3F53A 1ZQJA 2HHSA 3BSAA 4B08A 4OD0A 3GYXB 1FA0A 3VESA 1Y64A 1IKWA 1N56A 1Q9XA 3FCVA 1FXLA 2UUBK 3M8RA 4LMZA 1VQPN 4XDCA 1JRPA 3FMWA 4DV6K 3PR5B 4KLJA 1NKBA 2DNOA 4EK2A 3FSIA 1F6TA 5FLXY 2OLWA 3MM5B 3BR8A 1WAFA 1WSJA 1ZQEA 1FRHA 2HQCA 4QQBA 3LF0A 4ED1A 1JLBA 3PW4A 2R8HA 3PIOQ 3W3SA 2D41A 2LYHA 2UU9K 3D2NA 1K0VA 3BYPA 3DKDA 3EZ5A 3AJ1A 3TW0A 1QJHA 1L5UA 4Q43A 4DTXA 5JMVA 3SV4A 1UPMB 5SWMA 2B7BB 1YJRA 1BNOA 3HSTB 5DG9A 4BRHA 2YKMB 3JTNA 4NEYA 2OPRA 3M6ZA 1UFWA 5DK5A 5ETNA 2E2QA 2E6LA 1RABB 3WEEA 8ICQA 4LY7A 2PFPA 9ICEA 2ZXHA 3M2UA 4DR6J 2E3TA 4CZJA 4EEKA 2VA8A 2B9YA 3BF1A 5J0UA 3R7NB 2DCUB 2IA0A 3GFKB 2IOFA 5BYRA 1N5TA 2AJ0A 5KL8B 1HMVB 1EJ7L 2CVIA 4QYRA 2G5IB 5J2JA 1VQ4S 4HTUA 4IG0B 1BPXA 1N0UA 5K8NA 1Z4NA 4Z4FA 4LF6K 3WKBA 3PX6A 2EZZA 4OCZA 1VSKA 1XK8A 4H5TA 1PAEX 3CDWA 1HUOA 1IBKJ 2P51A 4P2HA 1RBOB 5BRDA 2ESEA 3NBPB 2BEFA 3R6GB 5HHIA 3CD0A 4CNQA 4H0TB 2UUTA 3KDNA 2FSKA 3LP3A 1X5TA 4X4TA 2W04A 1PYSB 4AYBD 4CJ5A 2GAGC 5HMYA 2CKWA 4AUKA 9ICKA 3QERA 2QLXA 4DV2J 3MUVP 4FJLA 7ICFA 4U8YA 5DBCA 1NO8A 3IG5A 3Q7BA 4ILLA 1SV5A 4ZPCA 9ICSA 5EOYA 3EGNA 3AY0A 1PUZA 2FHJA 2NQPA 3EYZA 1S59A 4HAIA 4F7VA 5KFQA 3H8WA 3D28A 4PG4A 3QFWA 3AVJA 2VG7B 4H0VB 3PUFA 4Z4IA 4YORA 3BO3A 3B0XA 2LQ5A 1TTHB 2XMVA 3AAPA 4OZ3A 1WSVA 3CHWA 5ALPA 5LSRA 4O3QA 4ZVGA 3PRVA 2CGKA 5BPCA 4AQYF 4NMLA 1TL1B 4C4RA 3OYKA 2D74B 5D4LA 2VPWB 2EEYA 2ASPA 1XUPO 4BG9A 4ZVEA 2LLZA 1JLAA 5DJBA 2ZH6A 4FW1A 3RBXA 4DV4J 4CBXA 4QWDA 4CLSA 1GLBG 3DRXA 5ETTA 4MIWA 3CP8A 2VBWA 1N5QA 3TYTA 4M3UA 1SXEA 3FDSA 4Y2SA 5H9FK 3LW5C 2FSJA 2NXNA 3V6DA 2VCPA 2OZMA 4RQ5A 1GLCG 4NRUA 1XNRJ 4CIEA 4OX9F 4C7QA 3ID8A 1QVFM 3TZZA 3ETRA 1P27B 4FF4A 4QZBA 2F44A 3C15A 4KO0B 4OKEA 4R0EA 4QZCA 5J2DA 4ED6A 3ZSZA 4Q44A 5LOQA 4HHUA 2V7ZA 3Q7CA 2MYFA 4GKKK 1H2UX 4PKGA 4OLOA 4G9ZA 4NXNJ 1YVFA 2DGSA 3GSDA 4E7KA 4A8SA 1RT5A 4C2MA 2BCRA 3A3NB 2WB1C 4ZLNA 1IR2A 2V2QA 2GIFA 4QIWC 2MHNA 5FPMA 2JFDA 5LJWA 4W5NA 4M9HA 4FKYA 1LKZA 2QWMA 4E7IA 4ZS6A 1BHNA 5AI4A 3CB4A 1IKYA 3ZLJA 1RLDA 1AUSL 1HQEB 3FLCO 7ICVA 1YJVA 3PKMA 4DV7F 1NKCA 3HVTA 5DZ7A 3D6RA 2KSOA 3OHBA 4LSLB 3KJNB 1CC8A 1HNIB 1O6XA 2B9WA 4JI1F 1SH2A 5A0LA 1HBNA 2Z0GA 5AE2A 2PFNA 2ZUCA 4MIBA 3LDAA 1B99A 3VQ4A 4G9BA 1H73A 4YFKA 3QRQA 4BWJA 2ZIUA 2KV2A 1X4GA 2V4QA 2EKYA 1T3QA 4QS8A 3O3HA 4WYWA 3G6VA 1L3SA 2G8VA 2FVQA 1J27A 4H8KA 4I9QA 3DDKA 3WZ0A 4PXCA 2DO4A 1D9DA 1CJVB 2X1FA 4DU1A 1S1VB 4OHWA 3U9ZA 4DSLA 4DL4A 3QFUA 1MG7A 3FE1A 1JXBA 4OYWA 5FPDA 2XLIA 5AQWA 3OL8A 4UZBA 4JI0F 1A0PA 3LA0A 3R5CA 4ETXA 3CEDA 2E8NA 2GW8A 1F44A 5M1OA 3RB6A 2CPHA 2GHWA 4RW4B 4M3TA 3OTBA 4JI7J 4JHDA 3GG1A 2WVFA 3LDOA 4U6PA 4BRAA 1WHXA 4NA1A 2APOA 3CWJA 4QWAA 5LL6d 2KHVA 4GLXA 2EHGA 2GCFA 4BC9A 4I2FA 5CHIA 2CQ4A 3KHHA 4YN4A 3CCZA 1TKTB 2GH1A 2YB1A 5FDLB 3ULEA 2DHAA 2ISPA 4B9VA 2HHQA 2QKKA 4K59A 1N2XA 1XSPA 4RW9B 5GAHI 1YVUA 4WP3A 4DCOB 2ZJRQ 1FJGJ 2NR0A 3TAMB 2LDYA 5BR8J 3MM9B 3KJVB 3B8AX 2BCQA 2DRBA 4J9MA 3H8SA 1HARA 1RPLA 4F36A 5EY4A 1MMNA 3VENA 4DB3A 4GO7X 2VWKA 1F5CA 3BR9A 4FOEA 5HBMB 4I2DA 3RYLA 3GMGA 3PJXA 5D46A 3L7OA 2NUBA 1J97A 2HAFA 3GYNA 2YTUA 4ERDA 2ACMA 2JRZA 1MN8A 3D1QA 5IWAJ 5BR9A 1T6CA 5C10A 2R2TA 3MN9A 5LXRA 1EZZB 5J2NB 4P6QA 1JX4A 4YXMA 4OZ5A 1QAYA 4RW7B 2MZTA 5EU7A 3EJMA 1TL7B 5KG3A 5KFZA 2Q36A 4HT7A 5AQOA 3QLHB 1DZ5A 1BMQB 2MA1A 2HWHA 3UVJB 4FBTA 2VKZG 2YNIA 2QKBA 3VTIA 1QSSA 5JJBA 4JK8A 5AQQA 3S1TA 1Y3KA 1YWXA 4MDAA 4C8KA 5AQXA 1M5VC 1S72N 1WDTA 4BXOA 1S76D 3GCWP 2RKIA 1RJJA 2AX1A 1SIJA 1UMJA 2QXFA 4KREA 4CZEA 2JV3A 1DBDA 1HNWK 2KKPA 2HVEA 3WIUA 1KFTA 3QPIA 6FDRA 2PZSA 1K9MO 8ICPA 2YWFA 4OJOA 3N4PA 3KWIA 4O8UA 4DV5K 3CFOA 7ICSA 4TYBA 3EVWA 5JU5A 2F8EX 3JXUA 5B09A 1WC1A 1SVDA 4P2FA 2KHQA 3Q83A 3M8SA 3OFFA 3GBTA 1DTTB 1D3WA 3TVZA 4WQ5C 4YB5A 2DH8A 4KN4A 4QZAA 4LQ9A 2ZD1B 3J7Z5 1ZD5A 4M3RA 4HR2A 4DPUA 5KT5A 5BN9A 2ZBQA 4CLFA 4W5RA 1SKUB 4RUBA 2DFEA 2Q1LA 2YX7A 4CLYA 4A2AA 4IQUA 3ZDBA 4I56A 1N8RO 1Y00A 3SCLE 8ICMA 4Y2IA 3G87A 3D66A 1VHFA 9ICJA 1S4FA 4CZKA 2BPGA 1TKZA 2EANA 2RRBA 1TK0A 1Z26A 3ZZRA 1NM2A 2HMIA 1PO6A 4W90B 2GVZA 2GV9A 1QE1B 3BUZB 1DRZA 4U7UD 2DD8S 4URSA 4L75A 2W41A 2RRNA 4P7VA 1N32F 2PBDA 3KVGA 4DUZJ 2OPQB 4BR5A 4DSJA 3GB0A 2QLFB 2ZVIA 3QYPA 4WTYA 4PYAA 4KH6A 4OJ5A 2YX1A 3UKRA 1TUUA 4OYZA 4CO2A 2MMYA 2FVPA 1S3XA 2RHKA 3EGZA 3UO0A 4DCCA 1ZQIA 2GUPA 1N6QA 3FQLA 1VK0A 4M42A 2LHTA 3AA8A 2HBLA 1VSDA 3LTOA 4UB1A 2DRDA 1RCXB 1DOQA 5L1MA 4U67L 4B3TF 1HQ2A 3B8HA 3I55S 2PI4A 4KQZA 3FAHA 2GQQA 2PSZA 2ZXIA 5CHGA 3GV5B 2UVUA 3OSPA 2HNZB 3I32A 4ANDA 3Q0AA 3PIPL 2LXUA 5TISU 4RQ8A 3EE3A 1Q5VA 2R3VA 1S77D 4PPXA 2A6AA 2W7AA 5T7LA 4G1IA 1YQHA 4LJXA 2N7CA 3N6MA 2E1FA 3DGVA 1XIQA 4CTAB 5AXNA 4PXDA 1TELA 3MFIA 4BVOA 4MYTA 1JCEA 3F2CA 4M45A 3C15B 1TL3A 5HMMA 4NRTA 1VDVA 4QR1A 1GNKA 2HFUA 8ICFA 3EE9A 3MWTA 5CR4A 4PH5A 4J9NA 2H3ZA 2ZUBA 2W42A 1LAWA 2JWNA 1Y0HA 4BRNA 3EPGA 1VJ5A 1HR0K 5CD4A 2BE2A 3H0RB 1N4LA 1SWVA 3ISBA 2HGMA 5EN1A 1U1KA 1OMSA 3J81O 2J8SA 5E3QA 3KKFA 4YY3F 3D0GE 4OJ1A 1U45A 4CJQA 5DGBA 9ICPA 4M5LA 2AYBA 3HSJA 3VCDA 2B4JA 3J7ZO 2IDLA 3KZIU 1U1MA 2RLTA 1NSAA 1IBKF 2X78A 1LOUA 3CCQS 2YKPA 3AL0B 4BC5A 3SD7A 3CXCR 1NH8A 4AE5A 5ELZA 2QMWA 2ZOMA 3JB9k 1ZQOA 4J9SA 3K2YA 2O4IA 4E2FB 5IC6B 2C2KB 3ID6A 2FUG9 4RL1A 3KLVA 1YRTA 2JLGA 3I76A 3FUYA 3TQEA 2BGGA 3RWUA 2Q3SA 2C28A 1FDAA 2OYYA 4ZJOA 2MZ1A 3H45C 1J6ZA 2NYIA 4PABA 1RTZA 1VISA 4DTOA 5L9NA 2ILYA 4JHDB 4CK1A 1OY8A 5ALGA 1Y5NB 2HHUA 1WSHA 2SXLA 3HILA 2LKZA 4PL2A 1LWFB 2OEKA 4EZ6A 1HPMA 3AVAA 4C4WA 3FEZA 3PACA 3ULEB 3DLLQ 1S99A 3JYTB 3V6KA 1QQ6A 2VICA 1PK1B 4FF3A 3CERA 2HFVA 3MM9A 2BXJA 2D3ZA 3BBFA 7ICLA 4CZGA 3HK2A 3W62A 2ERRA 4B3SJ 3IS9A 3AOAA 2K4EA 1TR0A 2HS0A 2BKPA 2ZE2B 3SCKE 3TJ8A 4FJGA 5ETLA 3MM6A 1Q9YA 5EWEA 3G6XA 4C98A 1TYQB 4BRQA 3I9V9 2K4IA 2FJEB 2K60A 1KONA 4ES3A 1KOOA 1NU4A 2J6UA 2CPJA 4IG3B 4YMMA 4O23A 3O08A 4JKDA 4FNIA 1NWKA 3R3TA 4ED8A 1FE4A 4KSEB 2H48B 3VF4A 3L4QA 2ISOA 3CE8A 3T19A 2E1YA 2KN4A 4MLEA 1NOYA 3W5YA 4A8YA 3KZBA 4US9A 2MKHA 4DX6A 1UVMA 3OL9A 2A5XA 1RA7A 2M2BA 4CF4A 4DR7K 1VIOA 4FN5A 1DEJA 2F4VK 3I56N 2HNYB 4MKVA 4HI1A 4WPAA 4A4JA 4USKA 4DV5J 4DV3F 1NSQA 2BJ3A 4QBUA 2W43A 2MGZB 3HSZA 5HROA 2DR6A 5KG0A 2PMZC 3DU6A 1CZAN 3KLEA 4PGQA 1KKXA 3CJ7A 3J80O 1HNWJ 4KH5A 4O3PA 3VA0A 1M90T 1G15A 2E5LK 4OMFG 2GO7A 2NZCA 5J1EA 2OWOA 4E8UA 1WSEA 4CQ1A 2WC9A 2NRXA 4C8OA 3ZEUB 7ICNA 2MSNA 3IG1B 4P74A 1RT4A 1KTQA 4IRCA 1SJRA 3AOBA 2EFGA 1M1GA 5KT3A 3RJIA 5AZIA 3KUEA 4IJNA 2YQ3A 3CQ8A 2ZDOA 1RTJB 2BRKA 4ECZA 5L9XA 4Q2LA 1ED1A 2KIVA 3H7IA 3NY0A 1IKXB 2H4WB 2VFVA 4ENOA 4OHYA 1QHAA 4H4OB 3CJAA 4DSKA 4MK8A 2IVFB 2DY9A 2DY1A 2ZJPQ 1U1PA 1VRTA 3QATA 7ICRA 1J5EF 1T05B 4GVBA 4DR1J 4PUOB 4CK2A 4KLTA 3K5OA 4DR3J 5HATA 1Q53A 1HIWA 5HANA 1XMOJ 1NGEA 1U4BA 3C16A 1XI1A 2F8SA 2RE1A 4FZYA 2UVVA 2K06A 1RZTA 2L9NA 4PQAA 2DPIA 4KTWA 2UXBF 2AU0A 1Z25A 5DB8A 4UUWA 4EIAA 3THPA 4MQ3A 3GG4A 2LP4A 3MK6A 3MN6A 1KAXA 4JD2B 2DTUA 4BC2A 1OIAA 4LBPA 5HR6A 2ZIUB 4B9LA 3QU9A 3BQ1A 1WD6A 2OPRB 8ICNA 3T1YF 3OXFA 2PO4A 5C25B 2WONA 1IBMJ 3ZT4A 3C65A 1W25A 1ZRNA 2BKOA 1OSCA 3GPAA 1RQLA 1NHVA 4NCGA 1RUSA 3MXHP 5J8YC 2VA2A 2P9PA 3U27A 3B78A 1KKHA 3CETA 2VPZB 4Q0BA 2ATQA 2ZJAA 5CD4H 4RW4A 5JVGL 1RDAA 1XEZA 3AGKA 3UNGC 1SV0C 3EX7B 4A8XA 4YOTA 1UKUA 2NLXA 1FXDA 1LNQA 2HNZA 3OR1B 4RQ4A 2BW7A 2N3OA 4NI2B 3HOSA 3H6EA 3TJAA 1KD1T 4ECUA 5LJVA 2ASOA 1QQ7A 4BBYA 3TAMA 2FZGB 3PW2A 4Y2AA 3TAEA 2BDPA 3UCZP 1BIZA 1W7WA 4MKBA 3VGTA 3W2WB 1TUVA 1BQNB 4C7ZA 5JS1A 1RHQB 3O8MA 4I2PA 1FE0A 4LIRA 4OI4A 4X62K 4ED2A 4OLPA 3H1VX 2AKWB 3E66A 1X40A 2HOEA 1X9WA 4Z4EA 5M1PA 2C2OB 4TSXA 1W97L 4DQ8A 4KLUA 4RW7A 1VQ6S 2AQ0A 3IBWA 8ICAA 3SBTA 3N9UC 3ZDEA 3JTOA 2O8DA 4TNOA 2KDOA 1RWWB 1RACB 1S57A 4JI0J 4X4OA 1BHLA 1C0TA 3H42A 1BL3A 2ZGZA 4FJ5A 1RAOA 3H08A 3QGGA 1HLWA 5A0YA 3UI3A 3QU2A 2DGXA 1RXOB 5JMNA 4RPXA 5GMEA 2BBEA 1N5VA 2Q31A 1VBXA 1X2IA 2Z2MA 1EKEA 4RPYA 2Z2LA 2QLTA 1XNRK 3FBFA 3QO9B 1WKKA 3D0HE 2WF6A 2BPFA 3IBFB 4M3XA 2KJ5A 2ZC4A 2I9GA 2QE5A 1K0TA 4DUYF 3CMAS 2HOFA 2GGPB 4A8WA 2BUPA 3K1ZA 3TR8A 1GK8A 4F02A 3ZZTA 3BEXA 3CC4N 2LI6A 2OFGX 3SDEB 5E7OB 2CG8A 4ZTFA 3QJLA 3HL8A 5KG6A 1W2IA 4ZOHC 3SAFA 5HNKA 1UPHA 2DH7A 1MWMA 4LR9A 1M90O 3NAHA 4LVOP 3CMQA 1KQSM 3HM9A 3EW9A 2O1PA 4FZNA 3SXLA 4FPRA 4WJ3B 1L7OA 4OX9K 3UPFA 3T1HJ 2E8PA 2IYIA 4TYAA 1ZZFA 2E2NA 1PGZA 5AM4A 2ZGYA 3PW5A 3OYLA 1YLXA 4KITB 3E01B 4HLBA 1IUJA 3HPGA 2QB0A 3HHEA 3K4GA 3MWPA 4RQNA 4HKQA 3JPSA 2VPYB 2P5OA 4P4PA 2B5JA 4L6V3 2IOCA 4LSLA 1HNIA 2YNGB 3NGYA 3SMSA 2M0NA 3PO5A 4Z0UA 1YJ9N 3QU5A 2ZE2A 1WSIA 5AM5A 2XTJP 2PA3A 4ACOA 2QC3A 4FLWA 3MD1A 4FLUA 3FBEA 4FXVA 3K8WA 2J9DA 3Q2SC 3UDLA 4ZMMA 4PZOA 4JI6F 1FT8A 1RAJA 2JXJA 1BO5O 3VN5A 3U8XA 3H40A 5J2EA 1ZQCA 1FFUA 5GMKa 3QNMA 4IG3A 2AIRB 3UMCA 3OL6A 1CC7A 3AMZA 2IVMA 2UUCF 2NZTA 2QA2A 2HHHF 3M1VA 1JCGA 3NP5A 2W4DA 2BPCA 3HZEA 4O3OA 2HSEB 2DKZA 2ASMA 3V9UA 4L72B 4PRFA 5FD1A 4IOCQ 2HBYB 3T1YK 2AEJA 2KXHA 3BH7B 2OZSA 4FDFA 3QSYB 4FO6A 4BCAA 3VAKA 4BGBA 2XULA 1S12A 4AHUA 2JVOA 3HHNB 2Y0SD 3P5JA 2FBVA 2VDHA 3DGPA 4O55A 4I6MA 2DT9A 3THYA 3W0LA 2JGUA 4NLBA 2XGQA 4K2JA 1PK3A 2N7YA 3OJSA 3Q89A 1ZM9A 3NEKA 2XY8A 4OJLA 3JPRA 2F4VF 2G8IA 5KFRA 1ZJNA 2A3ZA 1JLEA 3CXCM 4J2BA 4PKHA 4I2IA 5J1EB 5D3GB 3VGLA 3SJJA 4JP8A 4HTJA 4NLRA 1C4CA 3CJ0A 3OW2M 2E7XA 3G71S 4A5BA 1N5YA 4C0BA 4DUYK 1BVSA 4NLUA 4D3HA 1Q82O 5T41A 4F91B 3P45B 4Y34A 3GFYA 4NLCA 1GMVA 3S7RA 3N7PD 3PSFA 4U8VA 3VQAA 5DQGA 4UQTA 4LZDA 4DS4A 3U4LA 1FRJA 3NGIA 1HNZF 3LVWA 2HHVA 4FLVA 2DNGA 3ZO7A 2X74A 4N77A 3LH2S 3ZZPA 2OMOA 3UVJA 4GNIA 4QS7A 3I0RB 1ZPWX 1E6VB 5DS7A 4CZCA 4DTJA 4IKFA 5IIKA 2C2EA 4YY3K 1MROA 2K1RA 1WACA 4JD2A 4J5OA 4B9UA 4R0JA 1Z3EB 1O0PA 5CHCB 4CGJA 2CQDA 5AE3A 4FFDA 3MAAA 1UP1A 7ICMA 4M6WB 4WZMA 1NZPA 3C14B 5BOMA 1REVB 3VQ8A 3VQBA 1IKVA 2RVJA 2BQUA 3WIVA 2K8BB 4K0KJ 2B4OA 2OM6A 4U96A 5C25A 3K5LA 1H1VA 2YH1A 5HLFA 4LFAF 5ETPA 3RAMA 3F5AA 4EWTA 4CH1A 4EHUA 2R7WA 2Q97A 2XMWA 4ER8A 4EFHA 3TX8A 1ZBFA 3M32B 3ZC4A 8RUCA 3TNVA 2GC8A 2KRRA 4ZIWA 1U1RA 1LW2B 5I3PA 2DHXA 4W98A 4JI1J 2HHHJ 5ALFA 2ROGA 1NGJA 3GCXP 1Q8BA 3GJQB 2Y0BB 4OHZA 1S0MA 3V9WA 3M8PB 3PRDA 3M6GA 4EFAC 1NB2A 3K2PA 4WTOB 4CRJA 4NI2A 2YJEA 2NSCA 1KBRA 5ALJA 2ZZMA 2GQ2A 3MX5A 3RJKA 3AB2B 1FVSA 4FJNA 4OYXA 3MOZA 3UMBA 3I5BA 2OD4A 2GOLA 3JXOA 1U04A 3JSYA 1MW7A 4NCBA 3SBGA 2YWKA 5LMUJ 4H0YB 3G4SN 2ZWOA 3R8YA 2V8DA 2DIVA 3DU5A 3MM7B 3G9CA 2HW3A 5KFLA 2ACYA 2A1RA 4LIWA 2PFOA 1J5OB 3ELHA 4W5TA 4YDDB 3ZSWA 1AZSA 2E29A 1V6HA 4JWMA 5ITHA 1H2TZ 3OPXA 2AWZA 1K73T 5J2GA 2GFFA 2P9NB 2AT1B 4K7QA 2PKEA 3H4DA 1S5JA 1RA6A 1GEHA 3O3GA 7ICKA 4UOCA 2O8CA 4OYOA 3K17A 3W5ZA 2L48A 1XR5A 4B6JA 2YHYA 4FM0A 3KK1B 2VDIA 3L2VA 4DR6F 5F0WA 1EQYA 2YI1A 4AHVA 3AO1A 3VGMA 2FLLA 2DNPA 3BGFA 2CDRB 4ZJQA 3NNAA 3U6FA 3K8VA 5HHHA 4XEIA 2V67A 1N6QB 4OYAA 4HI2A 3QWUA 3NH1A 1SV4A 3HULA 4UAWA 2IMOA 1FCAA 1Q8LA 3F41A 2N82B 5KFYA 3LDSA 1JKHB 2WVDA 4XH4A 2X6SA 5HVHA 4PHDA 4C8MA 2HBQB 4ILJA 2QMUB 3C95A 4NEZA 1UT8A 3IC1A 3X1LB 2CQPA 3FC9A 2RMLA 2FMSA 1DAXA 4CO3A 3O44A 1TAUA 2A18A 1KCFA 1ZAVA 3IXQA 2PMZF 3SDEA 2V2VA 3HHLC 2V8GA 2ZH3A 4YDUA 2UUAJ 5ALTA 5AK3A 5MLCV 4CTAA 4GW6A 4WF9L 3W9IA 3QETA 2BANA 1TL3B 4USVA 3RMAA 1HYZA 4DR7J 2P9UA 1CULB 5DB6A 4KHYA 4Y2VA 2VKRA 4B3OB 4AYBC 3LVVA 1YHQN 1JN3A 5C5JA 1IKXA 2OTJN 3AAQA 2YKAA 3QAEA 3PMLA 1ZM4A 4OZNA 3IBPA 5KFKA 1RYRA 2R7UA 2FJAB 2WSFC 2RSQA 5AKHA 2AW0A 3P4UB 4X64J 1NUEA 4Q8EA 4OX6A 5GAGU 2IYGA 3G96A 2R9LA 5DO2A 3PO4A 1F2GA 2Y0SC 4ED7A 3HKZC 4UB5A 4XAKA 2QEXN 1B3TA 1DFDA 3KWGA 2XO6A 3TZYA 3KG0A 1ZZNA 3I82A 2KQ2A 3NVYA 1GLEG 1FDBA 4ICAA 1BPBA 2W54A 3W5XA 1XSNA 3D3CJ 3ENOA 2KI2A 3FBCA 1CQNA 3VAHA 3A8IA 4JV5F 1OXJA 2PT0A 4QIVA 1IBKK 3D0PA 4O3MA 4OZLA 3D6HB 4KHMA 1X5SA 2WOMA 3MR6A 1MDUB 1XNQK 3P6YC 3BN4A 1Q16B 4KMOB 2O8EB 4BRPA 5GMDA 4OX9J 2MKIA 1BPEA 4KGXB 4Y28C 4K0KF 2VBXA 1TMJA 4IZ9A 2D0CA 1VQKN 5J2CA 1HNXK 2I6WA 3GTYX 3GJSB 4MFFA 1QUPA 1RTIB 1NGDA 4QW9A 4BQZA 2FBXA 1HWLA 2FVSA 4WBFA 2DY4A 4C3LA 3CCRN 3VQ7A 4H0PA 5AQJA 1WTFA 1X9SA 5J2MB 2FHJD 4DQQA 1JLFB 4NLSA 2OTLS 4F5OA 2DEIA 5CA5A 1XSLA 1FRKA 4NZ0A 4HEA9 3NGZA 2WAQC 1C1BA 3HPHA 4Z6DA 5AKEA 4DTRA 3VQ9A 2J0XA 1OPZA 1X4DA 2CN1A 2LU1A 3RR8A 2ZOFA 3OR2A 3E58A 1VHXA 1N5YB 3UR3C 3MMCB 4ZCIA 4KGKA 1Z1VA 2IM0A 2A1AA 1E3MA 1NMDA 4AL5A 5DM7L 2QW9A 1UZDA 2BYCA 1TYQA 1S49A 3V9ZA 4WE1B 4E3SA 3OXLA 2OPPA 4RQ6A 3BGOP 4J8FA 4MK7A 4K5RA 4BRKA 1NNLA 2R7RA 2F1FA 5ALDA 2HDOA 2UZAA 1TMMA 3AQFA 3GWCA 1VQOS 1GX5A 1HR0J 1HRHA 5I3QA 5DDQC 4HH0A 1R43A 2BJEA 1SL0A 1M0SA 3OS0A 1BOTO 4OIXA 1RBRA 2GJ2A 3I0RA 4JV2A 1UJ4A 4YD2A 1VS3A 1UA0A 3L3FX 8ICOA 1JXEA 2GHPA 2VL1A 1AXQA 3NGTA 3TI0A 3KMQA 3C94A 1QCKA 1IXRA 4LFAK 2L9DA 2J6TA 4RPFA 2LYVA 1KD1O 3RJJA 4YMOA 4KX5A 4ZP9A 5ALYA 2P66A 3NOGA 3GIMA 3UMGA 3QT5A 4PR6A 4JMUA 4MMOA 4UW2A 2ETJA 2HSTA 4IBNA 2P9LA 4S0MA 4J9KA 2DKXA 4DV6F 1C1CB 4JNEA 4KPCA 2A40A 4DFKA 3DXMB 2DRAA 1T44A 1U6ZA 2W25A 1ZQPA 4MFBA 2DHHA 4WF9Q 1P6TA 2UYTA 2LQJA 2FC9A 1GOCA 2Z7JA 4OI0A 1U0HB 2J4RA 2ZTDA 1RTDB 3AUOA 1HHTP 4MN4C 3LP0A 4YXJA 1L7NA 1JNZB 1WORA 1Y4ZB 3M9NB 1FERA 2VODA 1JJ2M 2DEJA 2IM3A 4Y2KA 1MSWD 2PYJA 2UUCJ 7ICHA 3A5LC 4DUZK 2O8FA 5BYQA 2KP7A 5CYMB 2XWXA 3ET6B 4OZ1A 1PBAA 3MECB 4NYZA 1RNHA 1P1TA 4G6VB 1T05A 4GVLA 2RT3A 2A1BA 5HR7A 4A8KA 4EBDA 3CJKB 4DXLA 4FWMA 1C0UA 4TKTA 2AYGA 3J7AP 4ED5A 1E4GT 1YG0A 1A6SA 4OI6A 4ELVA 2Q0RA 1R0CB 2FHKA 2CA9A 3AT1B 4R8UA 3BBCA 3LDQA 3C29A 3IG8A 1T3NA 3I5CA 2CPYA 3KOAA 4IO9Q 3V4IB 2CNOB 1KQQA 1Q8IA 4TY9A 1LOTB 2R7YA 2HI0A 1SJ4P 4N8OA 2DFLA 3R9PA 2E1EA 4FS2A 4KPYA 2BOAA 1NGGA 2LQ9A 4X64K 8ICVA 2JEIA 1T9TA 3MGIA 4DR1K 3U02A 3CD7A 2F1IA 3KK1A 4KB1A 2MQQA 2KVCA 4BHQA 5L1LA 4JI5J 3C19A 3DDIA 4BR2A 3BN7A 5AJ3K 1VSLA 4U67Q 8ICEA 3VCBA 3GIJA 1WG1A 4KTZA 5B8HA 1CLFA 5K8PA 2V4RA 3D4JA 3IR6B 1G6BA 2VJUA 4I6MB 3TAQA 1FK9A 2F9DA 5DETA 1VSIA 1WF2A 1NOMA 4FWLA 4C4TA 1JLQA 2DGOA 4MFAA 4F8RA 1NHKL 2DXFA 2YWEA 2I7PA 2AH5A 3JSMA 2BM1A 1FRMA 5TKWA 4B1UB 3K0SA 4BC3A 1OQ6A 1OVYA 2K3KA 1TVRB 3HD1A 1CULA 4FK4A 2X1BA 8ICKA 3F56A 5AZJB 5J2FA 4RWXA 1VSEA 3QT8A 3G6EN 4Y2JA 4P73A 4ED0A 3HT0A 4LF2A 3OBWA 3ICLA 1SKSA 3PLAA 2HFZA 2HGNA 5E41A 1EX4A 1GMWD 1QY7A 3W1YC 3H90A 3CJ5A 2AMCB 2HF3A 2NYVA 5T7BA 2XZDB 3DOMB 1UW4A 4DHYA 4F3OA 4P2XA 3VGVA 2DNKA 3OYHA 3R6LB 2H3GX 3BSOA 4WFBQ 1SXLA 2P9IA 2RRDA 2H5XA 3SSRA 1DKGD 2ZOGA 1D0EA 2HOIA 1VQMS 4HWIA 2U1AA 1DT9A 5AQRA 1PZNA 4B3TJ 5JLFA 5KT4A 1U09A 5DMRA 4BRIA 2Z1GA 4CJLA 4I0WA 2H3FA 2E5GA 2MAXA 3H0LB 4B3SK 4DQSA 2Q6CA 3LGHA 4Y2YA 1QM9A 1IKWB 2F4VJ 2DBBA 1P8GA 1S1WB 1SIZA 4PQUB 1IKVB 4WP8A 3BYRA 2V50A 1VGYA 3KK3A 3R27A 3JPOA 1ZS6A 3E9LA 5HLFB 1D8LA 4NMXA 5ALKA 4ETZA 4KI4A 2E5IA 1RDWX 3R5JB 4IOCL 5B0CA 1RXWA 4USHA 3OFHA 9ICRA 4XH5A 3TEGA 3AXKA 2DR5A 1F60B 2AP1A 3OYCA 4JI7K 2JDJA 1C2PA 3RRHA 1SS6A 2V94A 3CCEN 4NWBA 4BRLA 3QJJA 3TANA 4K42A 2EKNA 1RBSA 1RT3A 1G2EA 3GE9A 1RTIA 1SQEA 4CF9A 2E1CA 2L08A 5E3PA 2RRAA 4I29A 3O0FA 4Z7CA 3NGRA 2G8WA 2OI2A 1JK9B 4RU2A 2CUYA 4XH1A 3OBYA 4JWNA 1K8AO 4KLQA 1BQMB 2EFOA 3RH5A 3N6NA 4HUGA 1WC6A 2HHXA 1URNA 1NK7A 2AJ4A 2RU9A 1YIJS 2XI2A 2W01A 2MQMA 3OR2B 2LYBA 3J81j 1YF5L 5GINA 3ZNJ1 4Y2UA 2HBMA 2EDUA 3EMTA 3NDKA 2EFQA 3NFAA 2CRLA 2K4HA 4F26A 5G0RA 1H7WA 3BSCA 4USUA 1ZBTA 3UN2A 1YITS 4NL9A 3VAGA 3EE8A 3T5JA 1CJKA 4FWRA 3AD7C 2LEBA 4JYAK 3TU5A 1TAQA 1D5AA 4O5CA 3HX0A 2K4PA 3QZ7A 1WBBA 4LRFA 3FQKA 4WFZA 4DUTA 2XWYA 3SUPA 2W2OP 2VQEK 4CO4A 4M7YA 3QRPA 4OYMA 2ZBCA 2ZBRA 2XY5A 4GKKJ 4JKAA 1X4BA 4CJTA 3TZXA 4K2XA 4FXDA 2IM1A 1X9JA 4BRGA 1A5WA 1Q79A 3KNAA 1QLNA 3ITHA 4ZVQB 4H5WA 1Z4OA 2N3LA 5C2CA 1KVIA 5B0EA 4JV0A 2HFSA 2HS3A 5F3TA 2JZBA 1KEKA 3FNNA 2F2AB 3V1RA 4IFVB 2YV0X 3OS1A 2ZKTA 4N8NA 3D0IE 3ETMA 3QMQA 1UAXA 3JQJA 2ATLA 3TKAA 1KFSA 1XN9A 2HWIA 4UW9A 3WC0A 5BJRA 1YHQS 3KZXA 2CDQA 4NLTA 3ADAC 4YB6A 4DV6J 2HBZB 1LKYB 2YMQA 3VF2A 3OJUA 5HP4A 1K1SA 4QU6A 1H2VZ 4RNFA 1WC5A 4B3OA 4O0NA 3AA9A 2KZZA 1ZQSA 3T1YJ 2BJ8A 2HGLA 2E8AA 1VRUA 2F8LA 4IL6U 3DDHA 4G1PA 1EKSA 2KKZA 4C8LA 4HHHA 4JKHA 4QYZK 1FJ7A 5DBAA 3A3PB 3M8QA 4ZPBA 2K7KA 5J0OA 1S6QA 3PTWA 1DARA 2BUNA 2MDAA 4KLIA 3JSBA 4K4IA 2H1YA 3SQGB 3NGKA 3BF3A 3SR6A 4BJQA 2KT5A 1Q7YO 1T3OA 5IWAF 2KSOB 1N88A 4HACA 4DV0K 5DDOC 3K5PA 1RKIA 5B08A 1VBYA 1N5WA 4B9TA 2HYIB 5F9LA 5CCMA 1QTMA 3MXMA 1W2BM 1X3NA 5DKWA 3LM2A 4FSVA 3EVMA 3HCXA 4X4NA 4FWSA 3DXKB 1VQ5S 1RE1B 1O1WA 4UB8U 3FZKA 3GJRB 3BPDA 2KYZA 4JN4A 2Y8YA 3MAAB 3RH6A 3G2XA 7FD1A 2FLPA 3E3XA 3M8ZA 2G8FA 2Z56B 2RHQB 4CT8A 3UKUB 5J0PA 3CJSA 1BXNA 2M7SA 2J8AA 4DFJA 3JAMY 3MM5A 4Y3CA 4A46A 3VAFA 2B4PA 3QT7A 2E1PA 1N5XA 4ZP6A 1EKRA 2CQ3A 3NS5A 5EX0A 3RRKA 2DPJA 4PWDA 1VLYA 4WU3A 2VG6A 4GRSA 3W9JA 1CBKA 1P9QC 3O80A 4FJJA 5E0OA 4KLFA 5IM0A 3WBZA 5HJYA 1G7CB 3MGVA 3G82A 1FJGF 3OFGA 1X4CA 3D2QA 4ID8A 3OYEA 3MTKA 3I87A 3A1YG 3L7PA 2DNZA 4RUCA 1LFWA 4DR2K 1S8OA 2IFXA 3Q8VA 3LDPA 4RW9A 4RWTA 1KEJA 2BKEA 3HLUA 4X65J 2DGZA 3C23A 3QRRA 3KJVA 2HZVA 3NF7A 4U7BA 2QJ3A 3DHWC 3PV8A 1CZ9A 4DG1A 1FF2A 2AZ1A 4FBUA 4PG6A 2CZVC 4I28A 5C2GA 1QTNB 3PIOL 1RBAA 2RILA 1UJ6A 4QNLA 2I9SA 4W4MA 1U2VB 2H9ZA 2YKNA 2E7WA 4M95A 1UZHA 2EQYA 3NASA 3MR2A 2CJXB 3JQMA 4KJIA 2W7OA 2VG5B 3ZYYX 4JK9A 4FWKA 5CRXA 1UWBB 3E8OA 3D2EA 3VF0B 4M5IA 4QZ8A 5ALUA 3RJFA 4Y2QA 4NLGA 5ETQA 3BGLA 3DOMA 3AOCA 2O5DA 1KNZA 4OPAA 2K7JA 3P31A 2I8EA 1RZMA 4F72A 3MN7A 1COOA 2YWWA 1U6FA 2I6XA 1R7IA 2ZZNA 3E1YA 2R8GA 4QZIA 3NF8A 2MKKA 3SBMA 2FMPA 4KC5A 1YVNA 2ROPA 1DK3A 5CY4A 4HYKA 4FWQA 2P6SA 1RDRA 4Y0WA 3PYGA 3D9BA 2B3TB 3O4QA 5GAHP 1WTBA 4GC6A 1NI3A 2CPXA 2DCLA 4MO5A 5IZHA 1TL7A 2LKYA 4FWPA 1P9YA 4I9LA 2ZBPA 3GR1A 2Z30B 5B5EU 4IEIA 2WRMA 4UASA 4LF1A 1NB7A 2DK2A 3QINA 4NM2A 2EAPA 2MLZA 5IIOA 2OA8A 4RQ1A 4CBUA 2XSJB 5BPNA 2WBMA 2QK9A 1U0HA 1TV6A 2VWBA 3ZCMA 1FNXH 4BROA 2FJBB 4PL8A 3THXA 3QSIA 3TO8A 2GWSA 5LJ5Y 2CFXA 1DGJA 1SQKA 1L3UA 4HVZA 5EE3A 4UAYA 4E19A 1RBLA 3KKAC 3IUCA 3AARA 3TZWA 2DWQA 2WSCC 1UHUA 2UXDJ 3T69A 1FFVA 3BPSP 5CB1A 1FJGK 1T11A 4K4YA 3MM8B 5KFHA 1SPBP 2RHSB 2QWRA 1W9HA 4YOVA 4PYDA 4I68A 1CRXA 2DITA 4BE1A 2NUUG 3CSKA 1O08A 1XTZA 3L2UA 3WK8A 1MWKA 2A1SA 1U25A 2DVIA 4LRAA 2CAJA 3GSIA 1X5OA 4C1NI 1N8RT 4ZVRB 3RMCA 4HDGA 4V1Ak 4JI3J 1NJIO 5IQQA 3FFIB 5A2QY 1YAGA 2AYMA 2ZVSA 1CS4A 4PPDA 2RF2B 5AQVA 4FPAA 2GVZB 4U9RA 4ILMA 4DSFA 3R9KA 4CZIA 3VPZA 4QZEA 3P39A 4CE9A 3C46A 1S0VA 1HQEA 2BQ3A 4JKEA 4CESA 1HWUA 2OHDA 1MN9A 3FKBA 3IRXA 2HG4A 4M9JA 1MA9B 2B51A 3KD1E 4IO8A 4DMNA 3C5FA 1HQUA 4GY2B 1G1XA 4Q7AA 4KRWA 4MHVA 4K0KK 4QZ9A 4KHPK 3WQUA 3QUTA 2X7IA 2ZBIA 1S72S 4KMUA 1BDGA 3CPWM 1LW0A 3AA2A 3T5HA 1K44A 2ZHOA 5JICA 3R2DJ 1A76A 4E1NA 5DZ6A 1RDUA 4DCJB 4W92B 8ICRA 3DC2A 4LR8A 4YY3J 4NLNA 1TU0B 2C2DA 3RGIA 1ZETA 1B0TA 3BGRB 1MU2B 3CCVN 2F96A 2AEMA 3BS7A 2KVQE 5L39A 2GV1A 2E5LJ 2F5GA 3I5AA 3ISCA 4EX7A 3PDNA 5D8HB 3KG4A 5AI6A 1B7YB 3NCQA 2I1RA 3FZLA 3CCES 4LQ3A 2VA3A 5A8RB 3KWMA 5B0BA 4O0IA 3PKYA 1A5VA 2HEKA 4CLLA 3HD2A 1OYDA 4H5NA 2V8HA 1BWVA 3V5RA 3SYZA 3AQPA 4PXBA 4M5JA 5EHHA 1VJWA 2LDIA 4DUZF 5GAEI 2RQCA 1WF1A 5AZJA 3U1NA 1CEZA 4NO7A 1IH7A 4DUYJ 3VEXA 2JOQA 3CMEN 3TQ1A 3SUOA 1HUZA 2M9KA 3SQIA 2P9GA 4ZN3A 1TUWA 1IV8A 3D2SA 1A9NB 2L3MA 1WHYA 3SCXA 4JUZA 2F8TA 5IFMA 1HLUA 3VR1A 3FGUA 2PN6A 3S3NA 2KJWA 5KFBA 2UUAF 3LPUA 1X31C 2C3OA 3LUYA 2XMAA 3QEXA 4JKFA 2BCVA 1NK4A 3J7YP 7ICOA 3KJQB 3C2MA 4JS5A 2NO5A 3J81U 5J2NA 3UDCA 4WFBL 4DR2F 1WWVA 3R5GA 1RWVB 1HNXJ 3O9RA 3AD9C 4AM7A 5BRFA 4ZCMA 4DMZA 1S4EA 1NK6A 4CFBA 1EXNA 1HL6A 1XNQJ 3AM9A 1ZXOA 1CPZA 2VFUA 4FE3A 4RZRA 1SGGA 2JWKA 1RAGB 5CYQB 3MI7X 2P6RA 4KH0B 5IC4B 3C2KA 2CZ4A 2KRBA 3R7SB 2G2YA 1DQAA 1KS2A 3ZTPA 4X84A 3DLJA 5ETVA 3I56S 1SJ1A 3HT3A 2G0CA 5DB7A 3BH6B 2QWPA 3V6HA 4B3RK 2J9DE 2XHWA 2FGCA 3MECA 2HVDA 4LSNB 1YTUA 1VQNN 3D6JA 3QNOA 5HRSA 2UXCF 3CJCA 1FWLA 1C6VA 3K75D 1UW9A 3JQKA 3WHIA 3DWLA 2B43A 3O6WA 3HZGA 3CUNA 2FJXA 5BR8F 4JK7A 8AT1B 2C2NA 3ULDA 2GO8A 2GELA 5DM6Q 3E2EA 1A6LA 2W4PA 2Z58B 4EO8A 2J7WA 3P3DA 4PHAA 3SSQA 2AZ3A 3SEIA 4L3NA 2J6SA 2F1HA 2O01C 2UU9J 4JI6J 3EM1A 3DCAA 3Q86A 1APSA 2PFUA 5AKJA 2V2ZA 2K2PA 2IS3A 5IIJA 1VC5A 3BM7A 4DR6K 4DPTA 1SV0A 1OWXA 3FJ2A 1EAYC 2XY7A 2AP6A 2F9WA 1KAZA 2ITGA 4LF8J 2HWTA 3AB4B 2B4UA 3DLGB 3OA9A 3ZT3A 3WC2A 2ZWHA 5I3UB 4YS2A 2JGAA 1N36F 3V7LA 1JMTA 2EC0A 2AQ4A 3QEWA 2AEFA 2I38A 9ICUA 2KKVA 1TK5A 2ILZA 2FJWA 3WU2U 5HRPA 2JNJA 4UTGA 3KDOA 3WT0A 3JPQA 7ICQA 2CQHA 3WNHA 5ALQA 3HOTA 4ZHRA 1S9EA 2LVWA 4ID5B 2OPQA 1JLQB 1NZBA 2VQEJ 2XZWA 5AXKA 3Q22A 3SZ2A 2IGIA 4IOXA 2X1AA 1BCMA 3G0ZA 4ZLJA 5HP1A 1TV6B 5F3XB 1HYVA 2GAHC 2ZJQL 4H4MA 3J80U 2OAUA 3G71N 3VQ6A 3THXB 1VRUB 2ZKUA 5KOWA 5KG4A 1R8HA 3CD6N 3R97A 1I1GA 3NNCA 4JI3K 3JS9A 1Y88A 4N7TA 3NF9A 3HW8A 2RN2A 5AI5A 5U47A 1HNWF 4WFNL 1ZQDA 3B4MA 3HMJG 1T8EA 1BWFO 3Q24A 1KRPA 4NLOA 3MGJA 4KLHA 2X3DA 2FZCB 4PL1A 4ZVHA 3QIPA 4KE5A 2AF6A 3EZOA 5AKKA 3SPZA 3TA0A 1B0PA 4G65A 3K1RB 1Z1BA 2OH2A 3M2RA 5AZIB 4F0KA 3MEGA 1ZQWA 5AKLA 4ANEA 3SQ2A 5ALNA 3L7UA 3WXJA 2BVZA 4CGDA 3SCJE 4P0PA 1HD0A 3MMVA 1Z19A 1U0SA 2PEBA 3MDFA 4HT5A 3FFIA 2LBOA 4LSZB 1CS4B 4EO6A 3O9TA 2JMGA 4AD6A 5A76A 4A8MP 3E0FA 4JI2F 4I6AA 4OV6A 3AA5X 2QV6A 2EWSA 2VIHA 1H6KX 4CZMA 3FM9A 1WHWA 2BE2B 4O4RA 3RUBL 5GTIU 3KD3A 1ZQNA 1F5AA 3KK3B 2V52B 3N6LA 1ZBIA 3NGDA 4IXCA 4YN3B 2HNDB 2IIHA 5AXMA 3BKTA 1U47A 3OTOF 4F3MA 2FVCA 3N28A 5CZ1A 1C0FA 1BD6A 3A5OC 2LU2A 4YQWA 4ZK7M 1S9FA 1QQCA 3LGNA 9ICVA 5HSPA 3SAHA 7ICTA 2ADBA 5GIPA 3OUYB 1T02A 3KLHB 4C8ZA 3AQEA 4F93B 3CJTA 2VH7A 2W7PA 5EE9A 3OR1A 1FKPB 1PIEA 2VC1A 2R7TA 4E1MA 3A0BU 5AM0A 3QGHA 1BQXA 3GV7B 3DRRB 2HOQA 2DNHA 1X66A 3CDBA 4BC7A 3G8TA 1NLKL 1NZ8A 5C15A 3J7YI 2QRRA 4E98A 1KN6A 2ZIXA 2AV5A 3OT9A 1YK9A 4XIUA 2UVRA 2EAOA 5KNIA 2QWNA 5J0XA 1U1LA 9ICAA 3CQYA 4I2PB 2OMLA 3MPWA 4CLUA 1LWFA 8ICIA 4N56A 3UIQA 4RO0A 1UWBA 1B92A 1YZ6A 5M1QA 3NS6A 4O4GA 1KDNA 3CM6A 1RWNB 4P52A 9ICGA 2FVRA 3KNGA 2W55A 1PJ7A 2NRHA 4LUBA 2QLWA 4OPHA 4X65K 4DL2A 3M2VA 3IS9B 1NNDA 1OH7A 3OTDA 3DN9A 4ZPDA 5ALLA 5GAEU 3E9PA 5F0XA 3SQ4A 3H5UA 2Y9HA 4JOUA 3HDSA 3PXGa 4CHNA 4OZ2A 6AT1B 1QZ6A 3QAUA 1L8LA 4MKAA 4CRXA 3KLIB 3V72A 2YQ1A 1RT7A 4IH5A 3M6WA 1YSJA 2OCEA 1EX8A 4JV1A 4LZGA 1HW9A 1H38A 1R3NA 4LR7A 3QEIA 1O8BA 5F0UA 4KV8B 3EVOA 1CQMA 9ICIA 1AYEA 2MSSA 1ZQHA 1NNEA 5JVHL 3G6YA 2O8DB 1DXSA 4GVMA 3MCMA 2PGCA 1NHUA 2I1QA 1R89A 4Q8FA 1J9AA 4QJFB 2EWHA 4IFEA 5IT0A 1C0TB 4F04B 2IBKA 4PG8A 4KFBB 2Z2ZA 5ETMA 3NKYA 2W3RA 1LKYA 4FNHA 4BR9A 4KHUA 1UOCA 1S1XA 2BJ7A 1Z05A 4ECWA 3IWXA 4OYBA 3WX4A 3D6MB 3OFEA 3VVTA 1ZQRA 2MXYA 3GR0A 4CJEA 2XMUA 4KLLA 2KOBA 3RTVA 3SMZA 6FD1A 5B7WA 4B3MJ 2I7NA 1ZC6A 4DOBA 1R6YA 2R42A 3M8QB 4LSNA 2GGPA 4IQWA 4NX9A 2M70A 1FXXA 4RKUC 4FK0A 4Z4HA 2DL0A 4X4QA 5AQHA 4NLPA 2KYXA 3MCOA 2G2OA 1PC5A 3OTQA 5I4MA 4CNZA 4UUXA 1U1NA 2PE8A 4NZ7A 4CH0S 2W9BA 1Q86O 1QAIA 5HI7A 2FLOA 1GMWA 1KFDA 4DN9A 4FZVA 2G07A 2B9EA 1VIXA 3W8GA 5DLFA 2HBRB 5GADP 3HHLB 2W8LA 1QSYA 4M5NA 4QYZJ 4Y2CA 3C7NB 1GQEA 3FMBA 3MPVA 3T1HK 5KOXA 4X66K 4CJPA 3P5BP 1N34J 3DXKA 5AFUH 8ICTA 1VQ8S 3K89A 1RTHA 3BDEA 4F2RA 4IFYA 2W2MP 2IAJB 4ZVFA 4F92B 3A8EA 1XERA 2VFTA 4NJ8A 8ICCA 4GVBB 1AFIA 3E01A 5D0GA 5KFIA 5AK6A 2JFKA 3GL1A 2ASYA 1B9DA 1ZQLA 1XMQF 2G06A 2RDDA 3HKWA 3RSEA 2W2QP 4J90A 3F5EA 5TKYA 1ZQAA 4F25A 4B9MA 2E1ZA 2YN4A 2DR7A 4ELUA 4K4XA 3KJFB 2ZFHA 5HOOA 3RMBA 1Q82T 4LF5F 5AE1A 3H5SA 3THWB 3RF9A 4I6WA 1T0TV 3LWMA 3AVMA 4ECSA 1R31A 3FYHA 3MURP 2GMLA 4WZQA 4Z4GA 1J5EK 3ATUA 4C9DA 2HQGA 2QTWA 2WONB 1YJWN 2V6AA 3HPOA 5H9EK 1ZQGA 2A41A 4B9SA 1X4EA 1KQKA 2YQ0A 1K8KB 5J0YA 3AD8C 2XO7A 4ECXA 7ICPA 3O9QA 3CCMN 4C0HA 1YBAA 3MAHA 5D49A 4AFFA 1W0HA 9ICLA 3U3GA 4ZPVR 4MFCA 4ZP7A 1ZQTA 2GHVC 3AA4A 4XRHA 2FHOB 2WAQD 1S6OA 3CJ1A 2FIUA 4JKGA 1CJUB 3N4QA 4URQU 2YXLA 4I2EA 3DGPB 4DJBA 4C23A 2LFVA 1GXTA 1CZBA 3CPWR 1MWQA 2LXIA 1ZQXA 2Y8WA 2LM1A 4B9QA 5B0AA 4WQ5A 3D2EB 5H9EJ 4F4WA 4BDYA 5D4BA 2CIMA 2ZH4A 1S1UB 5CA7A 1J5EJ 1Q81T 4XA5A 3WK4A 2J0SD 3CJ3A 5J1PA 1QAXA 3K9JA 4US8A 4RW8B 3CULA 1Z00B 4DX8H 1BE4A 1NM1A 2FPLA 1H3DA 4DV2K 5HJXA 2V51B 3CC7S 2PI5A 2VBZA 3M2RB 4IS7A 2XCPA 1ZQFA 2F8KA 1YGYA 3TAFA 1XNSA 3TWHA 2Z4PA 4GIBA 1FI4A 1I94K 2E66A 4BE0A 3P1GA 8ICGA 4CLTA 2YBVA 1E6YB 3UE5A 3MWBA 3VZIA 2Y1RI 4K4ZA 1HWKA 3MR3A 1O51A 2WF9A 4DU8A 3CW2C 3LP2A 2HQDA 4N5SA 2CPDA 9ICHA 1JNRB 1BPZA 4DV7J 3WQPA 3QDKA 4MEYA 3AV9A 5E5NA 3MEEB 5DDPC 5LM7E 4TU7A 2DHSA 1EXQA 2MRLA 5F8GA 1HWIA 2IA6A 4KY3A 4FM1A 2JHDA 3AVLA 1Q18A 4CHPA 3TTCA 2ZG6A 2FGOA 9ICFA 4DR4K 4LF7F 3UB5A 1TVAA 3TFRA 1TQLA 5KFTA 2CPZA 3ZETB 1B7FA 5J0TA 5K4LA 5KPTA 1REVA 4M5MA 3VQ5A 2EZYA 4ES1A 2G8UA 4R5PA 1ZD4A 3ZD8A 1T9YA 2ZIWB 2MZSA 5LL6Z 2DNRA 4B3TK 3MTJA 4OZ0A 4DV5F 2F1JA 4LF9F 3O9UA 4AHSA 3WKAA 4GKJF 2V69A 3H4BA 2XRIA 3R5AA 3TOQA 5AKGA 1ZYQA 1K73O 3RW7A 1ZJMA 5JS2A 4CIFA 2VQFF 3UD4P 3M7DA 2RDJA 3LQVA 1FKAF 2F63A 2J76E 3IM9A 1MLAA 2UXCK 3I6PA 1SAZA 3NMAA 1VAZA 4DQIA 2KZMA 2OSRA 1WHVA 4FPBA 3AVCA 4NLYA 4ZPAA 2OEJA 5BN8A 4OQJA 4YHHK 2MEWA 2G8HA 3RB3A 4UARA 1J5OA 2A1JB 2A10A 4IQTA 4YVZA 4M3YA 4K4WA 3NH2A 2RF2A 2Q66A 3BZKA 4Y6IA 4DV1K 1HW8A 4Q2MA 3LYSA 1VYAA 4WQ4A 5ALEA 1KL9A 2UUBJ 2WVBA 5KFEA 1JIHA 1LXNA 4QOTA 1KVBA 1RBUA 5MLCQ 1VK3A 3HKZD 1S10A 3U3YA 4ZVUB 2O8CB 1M6YA 3UQ0A 1IQTA 1YBUA 3IRUA 1U48A 3ENWA 1XNQF 1XJWB 4DOCA 3FEYB 1VK8A 2WUSA 3AJDA 3H3NO 3T1AA 5B0FA 3AO4A 3D45A 5AI0A 4RW6A 4PHPA 2YWHA 3U9DA 3Q8MA 4AXIA 2ZJRL 3KFWX 4LFBJ 4USWA 3KUHA 3TUZC 2D9PA 8ICWA 4UQGA 3V81A 1KVJA 3PM9A 4DV4F 3AVNA 4AT1B 2EZXA 1PBUA 3B6PA 1BWEA 2MLXA 5A2QU 4O3NA 3HTVA 4K4TA 1ASUA 4ID5A 4ES2A 4USJC 1ZOTA 2FYXA 2RUSA 4WFXA 4Y1DA 2WB1F 4IYQA 1Y11A 1DGSA 1HYSB 2H54B 4O5FA 3OXGA 4YR3A 4GC7A 3WXIA 4OLBA 4DSIA 1IJJA 4OI2A 1JB0C 3IA0A 4OKKA 1I94F 2WF8A 2PC6A 4TURA 1N52B 4P9SA 1HEKA 3IR7B 3G6ES 5JVHQ 3ZSYA 4K8XA 3PYDA 1Q86T 5EOZA 4O0JA 3QIOA 3PFOA 3ZT2A 1N48A 4MIAA 4BXOB 1RBVA 4B9NA 5HQLA 1N62A 4UB4A 1HNZJ 2GS8A 3IAS9 5KT2A 2MUTA 3H3OB 3FZMA 1N32K 4ZA1A 2F8MA 1W26A 3NAEA 4WWSA 2NLWA 4JV5K 3TVKA 3HM8A 1HBMA 2N4DA 2UXDK 5AQSA 2M9NA 2W9AA 4PWUA 5AI9A 4M04A 1MMDA 3V4MA 2BANB 3H0PA 2CVEA 5EX3A 5GADU 4NYPA 4P2SA 4P10A 2DNLA 3UNYA 3MEGB 4NLVA 5CCLA 4KLOA 1R8PA 2F3NA 1RLCL 2DISA 2NXCA 3OYBA 4EENA 2IRXA 2H3IA 3K58A 1SKWA 2YNFA 1SB3C 3UPQA 3LZIA 1JQGA 4ED4A 4ISEA 2IAJA 4TLRA 5KFWA 2VFSA 3D2FA 3HFKA 2EFNA 2B4VA 4ZCLA 4CWBA 3R5BA 4F67A 4LF6F 2KW4A 3KIOA 2R7QA 1UJ5A 1GOBA 3POTA 4NA3A 2VIXA 4JK1A 1FFSB 3IP4B 4J9OA 4FYVB 2DH9A 5DGAA 2D4WA 2YHWA 3NLCA 4X64F 1JALA 1AUDA 2QL7B 1HKAA 2P2CB 1JI7A 3QB0A 3OUYA 5CABA 3A0IX 1ZPVA 3D1OA 5F8MA 3L95X 3CFPA 3RRGA 1C1AA 5DM6L 1XMQK 1GTHA 4I2JA 1UVLA 2GO9A 3J80Y 4Y2MA 2YQEA 1IN0A 4D3GA 1SH0A 3DRRA 5F41A 3M30B 2LA6A 2ODGA 1KBUA 4Z94A 3CJ9A 1MA7A 4E7LA 4RT3A 3C6AA 3HZ6A 1HFEL 3LPTA 1ZQUA 3EWAA 4GKKF 2NRZA 3OGUA 1YUWA 1S7IA 3M32A 3QU7A 3DLKA 1RXVA 2HVIA 1WNSA 5D0HA 1X0PA 2KHDA 1ZM3A 2ZITA 3HRGA 1F0MA 1SUQA 1NGCA 1X42A 5GTHU 4NXNK 2VGMA 4OYPA 3KKRA 4I2GA 1L3TA 3VWSA 5C42B 1N5SA 2P8IA 1TL4A 1IG8A 5AT1B 1XHXA 3PEJA 3VEYA 1NBEB 1FX4A 2QGFB 4M63A 3IGVA 2W40A 2JEJA 2ZNYA 4RJVA 1VC0A 3VF6A 3N5FA 4UF4A 3Q8YA 3OQ2A 4X4UA 3H59A 5AR0A 1BLUA 4DFPA 4ZOSA 2X1GA 2FF6A 5KFFA 1DY3A 4DF8A 3UDEA 1IBLJ 3M2VB 4FM2A 1KN5A 2DNNA 1A0OB 3T79A 2HKEA 3ISZA 5ALIA 4WK3A 3KYLA 5AK4A 3H8MA 3I33A 4AHRA 4JRQA 5J2HA 3FVYA 1RQ0A 5FLXO 2RS8A 2ATCB 4ECTA 2NPFA 3WKEA 3PNCA 3C0BA 3TWZA 2XS5A 1C20A 4NYNA 2GX8A 4CK3A 2CGJA 2XEXA 5HRRA 3JTPA 1QVFR 4CJSA 5DG7A 4O5KA 1NSKL 3LP2B 3NGSA 4MJKA 4LFCJ 3THVA 4A61A 2C42A 5JVGQ 3VEWA 4RCHA 4M41A 2AGPA 4DL5A 5ALWA 5DG8A 2GNKA