2KE7A

Nmr structure of the first sam domain from aida1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
QTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of the first SAM domain from AIDA1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ankyrin repeat and sterile alpha motif domain-containing pro
total genus 20
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ke7A00
1X66A 1WWVA 3TADA 2QKQA 1B4FA 1OW5A 1X9XA 1UCVA 2QB1A 4NJ8A 1DXSA 2F8KA 2K60A 2EANA 4IS7A 1WWUA 5J8YC 1SV0A 2Y9UA 1OXJA 2D8CA 2KG5A 2DKZA 1F0MA 1PK3A 2EAMA 3H8MA 2E8NA 2KIVA 1LKYA 1SGGA 5L1MA 1KW4A 2QB0A 1PK1B 5F3XB 2E8PA 2F44A 2Y9TA 2L5YA 2QARB 2LMRA 3TADC 1COKA 4NL9A 3HILA 2YTUA 1V38A 1Z1VA 4PZOA 1PK1A 2QARA 2JV3A 2B6GA 1B0XA 2EAPA 2K4PA 2KSOB 3IDWA 3BQ7A 1SV0C 2KMDA 3SEIA 1LKYB 2LPEA 5JU5A 5JRTA 2QB0B 2E8OA 1JI7A 2FE9A 3TACB 2F3NA 1UQVA 3BS5A 3SENA 2DL0A 1RG6A 2E8MA 2GLEA 4RQMA 3BS7A 3KKAC 2D3DA 1V85A 3KKAA 2ESEA 4NL9C 1SXDA 1SV4A 4MHVA 2ES6A 2KSOA 2KE7A 3BS5B 2DKXA 3K1RB 4PZNA 1X40A 1SXEA 5J8YA 5JTIA 5KNIA 4RQNA 2EAOA
chains in the Genus database with same CATH superfamily
1K1QA 4O3NA 3ZI4A 4RZRA 2W3SA 2OHFA 2QLTA 4BGDA 1ZQKA 1JUDA 2A1AA 3DV9A 2PFNA 3IP4B 1BPYA 3KHRA 5H2FU 5ALVA 3HKZC 1ECWA 3UPQA 3MGHA 2FMSA 4ED6A 5EE9A 1F0MA 4QWAA 3ZDDA 4PHPA 3ALRA 5KFJA 4DFPA 4I29A 5IIIA 3MR6A 3GIKA 1FFUA 1NK0A 2W11A 2W55A 3QU9A 4DL7A 4EBCA 3V6JA 3M8RA 3HILA 2AH5A 9ICMA 4US9A 4O5KA 2QARA 2WAQF 1VDVA 4LJXA 4UQGA 3IDWA 1Z4NA 4DFKA 1TAQA 2ZG6A 7ICTA 1KL9A 3V6HA 2F1IA 4YXMA 1RYUA 4R64A 4UATA 1ZETA 2FPKA 3JPSA 4ECQA 4RT3A 1WYGA 1ZQ1C 1NZBA 4G9BA 1RQNA 4DWIA 3SENA 4RQ6A 4DSJA 2IHNA 4RQ2A 4IRKA 3KKAC 4UASA 1JRPA 4Q44A 1SXDA 1VJ5A 2WB1F 5DQIA 4QZIA 4JV1A 4C4RA 4QWDA 2XIDA 3OHAA 4UAZA 2RDIA 1LVHA 3FYHA 3NRWA 3KOOA 1HUZA 1QQ7A 4RNMA 4QWBA 2UVUA 2ZIUB 3KZXA 2R8GA 4DFJA 8ICBA 3M6KA 4IRCA 2ZIUA 3RB3A 5HR6A 4I2CA 1WUDA 1LV5A 4C8KA 5KFQA 3M8SA 5KFOA 1X9SA 2WTFA 5D46A 2ZXIA 4ECWA 2MUTA 4BJQA 4ZOHC 4K4HA 4Q8EA 5J0YA 1BPEA 3HT3A 4QZCA 4NLZA 5AIBA 1S9FA 3TI0A 3H0MB 2C2DA 9ICNA 3V6KA 1SKRA 3O0FA 3KD3A 5DQHA 5KFPA 5F3XB 4DF4A 3QYPA 1ZQOA 5ALKA 4TQRA 3MR5A 3RB4A 1X6JA 4HYKA 4FS1A 3G6YA 5EE0A 2J6SA 4PZOA 4ACOA 2I6XA 1ZQFA 2K4PA 4RPYA 4C80A 5AI6A 2BR0A 2KK0A 4CF5A 2H3FA 1ZQWA 7ICIA 1LKYB 3NTUA 4DQQA 4CF3A 1L3VA 4QJFB 2BPGA 2KVSA 5DB6A 3E58A 1UQVA 4KLQA 7ICHA 2RHFA 4DSIA 5ALYA 3SQIA 4YXJA 2KIWA 4B9UA 9ICQA 3ICXA 1T3NA 4EBDA 8ICEA 5DG8A 4TUPA 1SKWA 2HHUA 1TAUA 2ESEA 3L4PA 2KFZA 2ZJ8A 1ZQYA 5KFVA 2JEGA 2RLTA 3N28A 4DOAA 4F8RA 4C4TA 3BS5B 4DSFA 1U48A 4Z6FA 5ALOA 4RT2A 2Q0ZX 3PNCA 2RDJA 4KITB 3AEVA 4QWCA 3ZDEA 4C8OA 4K4GA 3QNMA 3Q8SB 4RNOA 4UARA 3OJSA 3TADA 4ED8A 1QSLA 2WHEA 3SI8A 3TAPA 1L6NA 4GXKA 2Y1IA 1B43A 1JIHA 2VJ4A 4F5NA 3QX7A 4QZGA 5KAIU 5J0WA 3ED5A 3M9OB 2KEYA 3T3FA 4OJ5A 4J9SA 4Y2UA 1B22A 2JEIA 5AM0A 3SAHA 1RYRA 1NK9A 3PV8A 3UMCA 5J2FA 1N48A 5ALHA 4YMNA 1K5OA 2DPIA 5J0RA 2GWSA 5ALZA 4NLNA 2AU0A 2XGQA 2IOFK 3TANA 5A0LA 4F91B 3G6XA 1S97A 2JGAA 2G5IB 3T5JA 3KFUF 4ELTA 4M9JA 1Z00B 2ZJAA 2MSNA 4YR0A 1JROA 5GTIU 2QB0B 2CN1A 3LVVA 1IXRA 1JI7A 2FE9A 3TACB 3RR8A 3N7RC 4BWJA 4EBEA 4Y2VA 2NRTA 5ALWA 3S6JA 7ICLA 1KEJA 2W9MA 3HP6A 5IIMA 2VANA 4DSKA 2HBLA 4BUGA 3KZIU 1ZQIA 4F72A 8ICIA 4UAUA 3NUQA 4IQVA 2XY6A 5J0XA 4B9SA 1JALA 2W43A 8ICVA 1PVPA 3V7LA 8ICSA 1N63A 2KFNA 3D6JA 5KFGA 5KL1B 3K1RB 4KLDA 4TUSA 4DL4A 3N7SC 9ICTA 4RPXA 3CRXA 5GTHU 2W54A 5DDMA 3A0BU 1SL0A 2OEHA 3JPQA 5AM2A 1TV9A 2LBOA 1T4GA 2ZIVA 2IMWP 4CF4A 2F8KA 4OCZA 2H3ZA 2I5HA 1WWUA 2F8LA 2C2RA 1WCLA 4PHEA 3SZ2A 8ICYA 2W9AA 5J2BA 2P35A 1QCKA 1PZNA 4M6WB 1SGGA 4HAIA 1S0VA 3QU4A 1D9DA 2J6TA 2V9WA 5KG0A 4AYBC 2XCPA 3DEEA 2KKVA 3C2KA 4XUSA 5ALDA 4BDPA 2ZUDA 5KT6A 2EAPA 2ZTCA 4UAWA 4ECVA 5L1LA 2EZXA 2PI4A 1ZQBA 2HOIA 4B9TA 4ECSA 2JMGA 2PFPA 1KTQA 3THVA 1ZJMA 4DL2A 3GIJA 4DL5A 1U49A 3I28A 4JMUA 5CEHA 5KFMA 2HHQA 3QEAZ 3D2QA 4NV0A 2EZYA 4KTQA 9ICFA 2XY5A 9ICIA 1ZQSA 3LYSA 4KLTA 4US8A 1SZHA 4C4SA 5KFTA 4YMMA 4R63A 1ZQCA 5KFKA 3NVWA 1SL2A 3L3FX 5HR7A 4YD2A 4QZEA 2LM4A 3WK5A 4F5RA 2GOLA 1IIPA 1UCVA 4NJ8A 3RJKA 3AQFA 2W7OA 5G5GA 2M9NA 1YZ6A 2G07A 3PO4A 1NOMA 4EEYA 1OXJA 4J03A 5AKHA 4RQ1A 2ZIWB 3T5LA 1X42A 4B6JA 4F50A 2BCSA 2E8NA 9ICOA 5F9NA 4ELUA 4JV2A 5HHHA 5L1MA 4DS5A 1A77A 9ICLA 4Y2QA 2E8PA 4CE6A 2BCQA 3F53A 3GIIA 1QQ5A 3ISBA 3HPOA 2E5SA 1NZPA 2YTUA 4RQ7A 1GO3F 2KNJA 1S77D 5J2DA 1MA7A 2VKQA 2LYBA 5BOMA 1ZYQA 5DG9A 3OHBA 3AM9A 2OM6A 4UB2A 4RPZA 2JH7A 2KSOB 1KRPA 2CPRA 4P4OA 3WKBA 3QZ8A 3J81j 4F2SA 1CEZA 1T7PA 2E8OA 3ISDA 4PHAA 5ALUA 3HKZF 2YQEA 2HHVA 5AI9A 3FC4A 5AI4A 2ISOA 3RTVA 2BKEA 1WG8A 1ZD4A 5L1KA 4KLGA 1H38A 4NL9C 4C0ZA 4DF8A 3FAHA 3RF9A 2KE7A 5J2AA 4R8UA 3F2BA 2ODGA 4OJPA 3Q8KA 3E2EA 1UHUA 3TARA 5KT5A 4JV0A 2W03A 1SKSA 1URJA 5AKJA 2KZ3A 2MU2A 2FPMA 2JRZA 1X66A 1WWVA 1U9LA 3G6VA 8ICXA 1DGJA 1KFDA 5KFNA 4UAVA 3QUQA 1L8LA 2BDPA 4XA5A 3BDPA 4Y2TA 2HVIA 1F5SA 2F76X 4Y2XA 4PPXA 4KMUA 8ICGA 2KVCA 1NJWA 2PFOA 8ICFA 2ASJA 3UXNA 9ICRA 2ASLA 3EYZA 4QZ9A 4XQ8A 3QUCA 4Y2YA 4KLOA 3M7DA 2F44A 2DQNB 5J2IA 2FLLA 2Y9TA 4RNNA 5AK6A 3ZDBA 3TADC 1Z3EB 4NL9A 2RP5A 2BGWA 3C5FA 5K4LA 5AK3A 3UXPA 3PW0A 1ZD5A 4DFDA 3SV3A 1T8EA 4KLMA 1ZQDA 2ATLA 4QIWF 2NRXA 4DQRA 2FMPA 4OD0A 8ICQA 3SV4A 5HMLA 3NVVA 4FZLA 4C8LA 4F4YA 4LVSA 3OTQA 1MSWD 3GDXA 4YMOA 2LHTA 3HX0A 4U7CA 5J2KA 4ICAA 3D2NA 1IG6A 5ALTA 2D6FC 3WK9A 4P0PB 2E8MA 3KBBA 5DKWA 4EEKA 3GZFA 2R8HA 2R18A 1S76D 3JPOA 1S8OA 4M9NA 5J2CA 2XI9A 3BQ2A 1ZRMA 1ZQGA 4TURA 2G08A 2V4RA 3PY8A 2KHQA 4CGZA 2YMLA 3UXOA 2LYHA 3IN5A 5CR0A 7ICGA 4M04A 1NKBA 2HBMA 1ED1A 5KNIA 5C5JA 3MGIA 3GQCA 1AQ6A 3V7KA 2HI0A 1KBUA 1D8BA 3H40A 4IRDA 2NRVA 1FO4A 4Y2RA 1XO1A 4F93B 4YN4A 3UM9A 2PFQA 7ICKA 3LK9A 3GV8B 4RUAA 3FM9A 3QU7A 4M9HA 1PK3A 1ZQAA 5C0YA 5AKLA 1UPHA 4F5QA 1HIWA 1KKXA 2OH2A 5J0TA 3PSTA 3GIMA 2YB1A 5AKKA 4M2YA 3EPGA 3NASA 3EPIA 1NK4A 1TK0A 4ECYA 7ICRA 2HOFA 5CHGA 3MBYA 4K4IA 4J9PA 3BQTA 2JZBB 4P2HA 3C29A 5B5EU 3I76A 1ZQLA 5KG1A 1Z1BA 4ED0A 1IM4A 1LB2B 3ZD9A 5DB8A 1XSNA 4YR3A 1RZTA 3RJHA 2UVRA 4ECUA 3BZCA 5KG7A 5KTQA 4CDGA 2BCVA 3B0YA 2Y0SF 5L1JA 2KZZA 2A1JA 2AGOA 1YT3A 4FE3A 1RQLA 2DPJA 5DBBA 7ICJA 3PX0A 2W9CB 3IG8A 4M0AA 1V9PA 3PMLA 1SXEA 3H7IA 1MQ3A 1QH9A 1CI4A 1KDHA 2O6KA 4P0QB 5D49A 2XO7A 3JPPA 5KT7A 1BPBA 3ZDCA 8ICKA 4R8UB 1V97A 2E1EA 2QKQA 4C7YA 4P4PA 4BXOA 3HW8A 4F2RA 2RRDA 3CNHA 5KFWA 5KT4A 1TKDA 4O5CA 1F44A 4J9LA 1D8LA 1C20A 4ELVA 7ICMA 5HHIA 3OSNA 5AK4A 3U26A 4PGXA 4U6PA 4ED3A 2HCFA 2DUYA 2KIVA 2CXYA 3B0XA 1BNPA 5DBAA 1HUOA 2FLNA 4I2DA 5J2JA 3PZPA 4I2GA 1TAMA 1J2MA 3JPTA 3PX4A 2XC9A 2DWQA 5AM5A 4FZNA 2G0AA 1ZQQA 3RJIA 4F92B 4R65A 3TFRA 4B9LA 1N61A 3TFSA 2XVTA 2JV3A 3T79A 5KG3A 3H4BA 5KFXA 1ZQZA 3LDAA 1T94A 5FP0A 5KT3A 3Q8PB 5HP4A 3ZD8A 2ASDA 3UMGA 4TQSA 9ICSA 5KFSA 2IOFA 3WK6A 1M6YA 2K89A 1JX4A 2PMZF 4PGQA 1RG6A 3F5AA 2Q4TA 4IR9A 5ALGA 3H4DA 4IQWA 4RU9A 5KFDA 1A76A 4YP3A 9ICWA 4EZ9A 1NJZA 2EZZA 2OYYA 3IM1A 4R66A 3RFAA 2IOHA 1XWLA 1ZRNA 3C5GA 4MF8A 1DOQA 3NS1A 9ICEA 3MDAA 2W8KA 2DFLA 1SL1A 2XCAA 5CP2A 3OGUA 4IR1A 5DQGA 2A3VA 2K60A 3WKDA 4EELA 1T3QA 4KN4A 2XY7A 3H8JA 3WKEA 7ICFA 2Y0SC 4C7ZA 4JWMA 2G09A 4ED2A 9ICVA 4YD1A 1N62A 4I2AA 3H8MA 5EE1A 2IA6A 1L7OA 2KZMA 3RRGA 3NRZA 4F5OA 1BNOA 1Q3VA 3QEBZ 1NK5A 3OSPA 4KLEA 2WF5A 2L5YA 3RJJA 3V7JA 1FIQA 1NJYA 2M0NA 4TUQA 3OPXA 8ICMA 5EWFA 4NXZA 1U45A 1K1SA 2F1HA 3BQ0A 5AI8A 1S10A 1FEZA 4QW9A 3Q8QB 1FFVA 2KMDA 5J0QA 2KTQA 2WF9A 2LPEA 4NLBA 2KV2A 3C2LA 2W8LA 3PX6A 5G5HA 4P0PA 2DBYA 5AM4A 2JHDA 3Q8LA 2AJQA 2NRZA 1U4BA 9ICBA 4F5PA 3K1ZA 2JXJA 2GLEA 4DEZA 2J6UA 2MA1A 3KKAA 2H5XA 4MHVA 1NNLA 3KHGA 1SWVA 1A0PA 4NM1A 4J9QA 4YFKA 1X2IA 1ZOLA 4QIWC 4DCCA 8ICAA 1ZD2P 3K4GA 4I2FA 4MEXA 4E0DA 2AXTU 3DDHA 5AKZA 4QNLA 2GO7A 3JPRA 2BCRA 3UQ2A 2K4EA 3AQEA 2A1JB 2P66A 4FO6A 1HEKA 1L8OA 4EYHB 1QQ6A 5KFZA 1DXSA 3QXGA 3MABA 4DFMA 2YX8A 2VIXA 3AL0B 5IIOA 3SMVA 4O0IA 4FZMA 1KSPA 9ICUA 2EAMA 4Z6DA 1BPXA 4DL6A 2KN7A 4A8EA 3T5KA 4YG2A 2QB0A 1QSYA 5KFYA 2MRLA 5T14A 5ALSA 1D9FA 3QUTA 1ZQRA 5J2EA 5HMMA 8ICJA 4DOBA 5TISU 2KJ5A 2ALZA 3RR7A 3WKAA 8ICTA 3KHHA 1QLNA 5DBCA 7ICQA 3PW2A 5KAFU 1XC9A 3T5HA 2XGPA 2HHXA 4UB1A 1L7MA 3RAXA 8ICCA 4J9KA 3AN1A 1ZXIA 1U47A 4UB8U 3PW7A 4BXOB 5J0OA 2CRXA 4GFJA 5D4BA 4F71A 1NK7A 5ALFA 4GXJA 4KN7A 4PL1A 3CYMA 4AP9A 7ICNA 4ECTA 4Z6EA 4OO1J 2BQRA 2FDRA 5KFIA 1KFTA 5ALMA 1DGSA 2JH1A 1JMSA 2WFAA 1BVSA 5BOLA 5DLFA 3MGVA 2WB1C 2BDUA 2KJ8A 3SD7A 1KN5A 1CUKA 2VJ5A 2KG5A 8ICLA 2VA8A 3C2MA 3RB0A 4PHDA 3MC1A 4O3QA 1PK1B 4YVZA 2H3QA 2ZIWA 1SIJA 2IBKA 1EXNA 4PH5A 3SR6A 3HJEA 2HOQA 4QZFA 4CNQA 4ECXA 2H3VA 3KHLA 4USAA 2I9GA 9ICCA 3C23A 3IRUA 3BQ7A 4OJLA 3OJUA 5JU5A 2KJ9A 1RPLA 4Z6CA 2EQYA 5F9LA 2BPFA 1ZQJA 5E79U 1Y88A 2DL0A 5AIAA 1ZQPA 2W9BB 4UB4A 4ZH4A 2OXOA 4UB5A 1NK8A 1XO0A 7ICVA 1TE2A 2ES6A 3D2SA 4DQPA 8ICZA 1BPZA 1CRXA 4KLLA 1PUZA 4PZNA 2P6UA 4IQTA 4JK1A 4DLEA 5AM1A 5KL8B 1ZQEA 3QU5A 5AKGA 2MAXA 7ICSA 1KFSA 3AU6A 4GXIA 7ICEA 4P4MA 1L3TA 2LM1A 4LZDA 5ALRA 4FFDA 4NLGA 1NKEA 3LWMA 1XU4A 4GIBA 4ECRA 3NGDA 3BQ1A 4RUCA 2BHNA 4KLUA 1O03A 4IS7A 2IHMA 4Y2JA 4RQ3A 3EWAA 2KOBA 4DQSA 4UB3A 3CW2C 9ICHA 5AKYA 2YN4A 1L7NA 3C21A 2R8KA 4G3IA 2VA3A 4MEYA 5AKEA 4PL2A 3GV7B 1PVRA 4I28A 4F4ZA 2NV3A 3M1YA 3LWLA 3N97B 9ICAA 2LMRA 3ONNA 2F2AB 2DF4B 2AQ4A 5KG2A 3K75D 2PKEA 1ZQHA 1J2NA 3QE9Y 5BPCA 1QSSA 9ICKA 4EENA 4ED7A 3H0RB 3R9KA 3RB6A 3F2DA 4DSLA 4M9GA 5JRTA 5ALNA 2WF6A 2F77X 3VC8A 3IG5A 1ZQNA 1QTMA 2PMZC 8ICUA 3AUOA 1DK2A 3RAQA 5AICA 4O3MA 5L1IA 4PGYA 3BS7A 8ICNA 4KLSA 3MR2A 5HNKA 2EH9A 1V85A 2HSZA 5AKXA 4DQIA 1YZ7A 2ZUBA 5J0UA 3TQ1A 1MC8A 4FBUA 1X6IA 4LZGA 9ICPA 2NRWA 3FDSA 1TVAA 2KP7A 2W7PA 8ICRA 2C2EA 4XRHA 2P6RA 4J9NA 4AYBF 1XSLA 4CCHA 4NLKA 1N60A 2WAQC 2YMMA 2ZJ5A 1OW5A 5B66U 2ZIXB 3RH5A 1ZJNA 5J29A 1TFRA 5CB1A 4UAYA 7ICUA 1ZQVA 1SV0A 1JN3A 4QZBA 4YCXA 4DSEA 4RQ4A 2D8CA 5KFHA 4J9OA 1SWWA 3PMNA 1UA1A 2DKZA 3V72A 3GU3A 2HBJA 3NVZA 1D8YA 3AU2A 2G06A 5AK5A 4JUZA 4ECZA 2ZIVB 1KQQA 3M6ZA 4PJ0U 1Q46A 3H0LB 2YY6A 1L7PA 2NO4A 1X9MA 1MN8A 4KLJA 8ICOA 2HBKA 4P0QA 1PK1A 2BZFA 5DB7A 4Q45A 2B6GA 3EZ5A 1B0XA 2K8AA 2BCUA 3Q8MA 2BQ3A 2I1QA 3SEIA 5ALXA 5J2GA 3PW4A 1N5WA 5ALIA 3M9NB 4O3SA 1L3SA 1TK5A 3PSPA 2H3IA 2FPLA 4GC7A 5KFAA 2F3NA 2JEJA 2A19A 4DOCA 4QWEA 1N5XA 4O5EA 2ZTDA 3BS5A 4QW8A 5KG6A 2C28A 2G5HB 3BJYA 5KT2A 2FJ6A 5TZVA 3MR3A 2HW3A 1SV4A 2LYAA 4EX7A 5CWRA 1TK8A 4KLHA 4O3PA 3WKCA 4FS2A 4M9LA 3C1ZA 3EW9A 1Q3UA 2LI6A 4BX9C 2ZUCA 5J8YA 1MQ2A 3H8SA 4OJOA 3MFIA 4KLFA 3L5KA 2PXIA 3RRHA 3PO5A 2HVHA 4GC6A 1S5LU 3F5EA 2BPCA 3IHQB 1X9XA 3SYZA 3UMBA 5IIJA 2EANA 3TKAA 1RDFA 4JWNA 1BPDA 3SAGA 2Y9UA 2ZXHA 1Z19A 1UT8A 1C7YA 5KFRA 4O3OA 5JUMA 3WK7A 1P7DA 1Z00A 4Y2PA 3VCBA 3I1YA 4NLCA 3TAQA 1KW4A 3SAFA 2PI5A 4J9RA 4C8MA 4UBCA 7ICOA 2ZIXA 2AHOB 4IL6U 2EDUA 4Q43A 1HJPA 1COOA 5AHXA 5KG5A 4MFFA 4Q8FA 1DRGA 2UVVA 1RXWA 1S0OA 1NKCA 1RYSA 5KFUA 4I2EA 4KX5A 2AGPA 1ZQXA 3BZKA 5L9XA 1OUQA 2AQ0A 4BWMA 2FI1A 3E0FA 1RM6C 2UVWA 2W9CA 8ICWA 4JB3A 4DS4A 2KD1A 2NYVA 5AI5A 2D3DA 2B21A 3RJEA 5DGAA 3ORYA 4FBTA 2NO5A 2JZBA 1Z4OA 1XSPA 1X9WA 2HHWA 3QU2A 4M47A 4YR2A 5AKIA 5J0SA 5KFEA 4WJ3B 5KFCA 1VLBA 2E3TA 2Y1JA 1BGXT 2HMXA 3RBDA 4NM2A 1N2XA 2ISPA 2OCEA 4UB6U 3H8WA 4YQWA 5IIKA 5ALPA 1NI3A 1B4FA 2QB1A 5CJ7A 4IC9A 5J0PA 2FMQA 3PR4A 4QZAA 3GILA 5J8YC 2E1FA 4DLGA 3RJGA 3PVXA 3N4MB 3C1YA 2N1RA 1LKYA 3M9MB 2BQUA 4MF2A 1IV8A 2RQ5A 2MUTB 2JEFA 1AROP 4EX6A 2ZTEA 1NK6A 2KHVA 1Q8KA 4KX3A 1COKA 3PR5B 2R8IA 2AGQA 4I2BA 1ZD3A 9ICJA 1O08A 2YB4A 4I2IA 3EUB2 3Q8RB 2FLPA 2YMQA 1N56A 4NY8A 4QZ8A 3A0HU 4EZ6A 2HHSA 3NVYA 3B9JA 4CRXA 4QZDA 5AM3A 5EWGA 4NWIA 4ED1A 4DL3A 2W9BA 3RH4A 5ALLA 3GV5B 2KKPA 2XICA 1NJXA 1WCNA 3C28A 3RH6A 5EE3A 1UT5A 4B9MA 1SB3C 2DKXA 1XS9D 1S0NA 3WU2U 1X40A 5ALEA 2VA2A 4EYIB 4B9NA 9ICXA 5ALJA 2F1JA 9ICGA 3RJFA 4RQNA 4GLXA 1XNSA 4MFAA 4IQUA 3ISCA 2W04A 5DLGA 1ZQTA 5AI0A 2W3RA 3WK4A 5IINA 1SZPA 5ALQA 2HDOA 7ICPA 3ETRA 4KMOB 1J97A 3N7PD 4KLIA 4DO9A 5KFFA 3ZDAA 2OWOA 2R8JA 3PSIA 1UA0A 2V4QA 1DK3A 1ZQMA 3KTQA 4J9MA 4O9MA 2K4HA 3MDCA 4I2HA 5IILA 4O3RA 8ICHA 8ICPA 5DB9A 2B0CA 3MFHA 2QARB 5EOZA 3F2CA 4RQ0A 5DDYA 5DG7A 2K8CB 1V38A 5KFBA 1Z1VA 2LKYA 4F4KA 5DGBA 5CRXA 4Y2SA 1L3UA 1KLNA 1L5UA 2HHTA 3QZ7A 3QUBA 4UBBA 2C22A 1SV0C 4F4WA 2Z7JA 4C8NA 1PVQA 3IV6A 1JXEA 3HRDD 3GFKB 4F4XA 3JPNA 4MFCA 3WK8A 5KG4A 2WF8A 1ZQUA 3CP8A 4OJ6A 3LVWA 4B9VA 4UW9A 4RQMA 1S0MA 5EWEA 4RQ8A 3PW5A 1JXLA 2K4IA 4M6WA 1RXVA 2GH1A 1A6SA 3PSFA 2KSOA 3RBEA 3AMZA 4RQ5A 4F3OA 5J2HA 2DGZA 2JR5A 2K8BB 3UQ0A 5KFLA 5JTIA 4X5VA 2KICA 3ETLA 4I27A 2YMPA 4QZHA 2EAOA 2WF7A 4I2JA 3HWTA 5CA7A
chains in the Genus database with same CATH topology
1X66A 1WWVA 3TADA 2QKQA 1B4FA 1OW5A 1X9XA 1UCVA 2QB1A 4NJ8A 1DXSA 2F8KA 2K60A 2EANA 4IS7A 1WWUA 5J8YC 1SV0A 2Y9UA 1OXJA 2D8CA 2KG5A 2DKZA 1F0MA 1PK3A 2EAMA 3H8MA 2E8NA 2KIVA 1LKYA 1SGGA 5L1MA 1KW4A 2QB0A 1PK1B 5F3XB 2E8PA 2F44A 2Y9TA 2L5YA 2QARB 2LMRA 3TADC 1COKA 4NL9A 3HILA 2YTUA 1V38A 1Z1VA 4PZOA 1PK1A 2QARA 2JV3A 2B6GA 1B0XA 2EAPA 2K4PA 2KSOB 3IDWA 3BQ7A 1SV0C 2KMDA 3SEIA 1LKYB 2LPEA 5JU5A 5JRTA 2QB0B 2E8OA 1JI7A 2FE9A 3TACB 2F3NA 1UQVA 3BS5A 3SENA 2DL0A 1RG6A 2E8MA 2GLEA 4RQMA 3BS7A 3KKAC 2D3DA 1V85A 3KKAA 2ESEA 4NL9C 1SXDA 1SV4A 4MHVA 2ES6A 2KSOA 2KE7A 3BS5B 2DKXA 3K1RB 4PZNA 1X40A 1SXEA 5J8YA 5JTIA 5KNIA 4RQNA 2EAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X66 A;  1WWV A;  3TAD A;  2QKQ A;  1B4F A;  1OW5 A;  1X9X A;  1UCV A;  2QB1 A;  4NJ8 A;  1DXS A;  2F8K A;  2K60 A;  2EAN A;  4IS7 A;  1WWU A;  5J8Y C;  1SV0 A;  2Y9U A;  1OXJ A;  2D8C A;  2KG5 A;  2DKZ A;  1F0M A;  1PK3 A;  2EAM A;  3H8M A;  2E8N A;  2KIV A;  1LKY A;  1SGG A;  5L1M A;  1KW4 A;  2QB0 A;  1PK1 B;  5F3X B;  2E8P A;  2F44 A;  2Y9T A;  2L5Y A;  2QAR B;  2LMR A;  3TAD C;  1COK A;  4NL9 A;  3HIL A;  2YTU A;  1V38 A;  1Z1V A;  4PZO A;  1PK1 A;  2QAR A;  2JV3 A;  2B6G A;  1B0X A;  2EAP A;  2K4P A;  2KSO B;  3IDW A;  3BQ7 A;  1SV0 C;  2KMD A;  3SEI A;  1LKY B;  2LPE A;  5JU5 A;  5JRT A;  2QB0 B;  2E8O A;  1JI7 A;  2FE9 A;  3TAC B;  2F3N A;  1UQV A;  3BS5 A;  3SEN A;  2DL0 A;  1RG6 A;  2E8M A;  2GLE A;  4RQM A;  3BS7 A;  3KKA C;  2D3D A;  1V85 A;  3KKA A;  2ESE A;  4NL9 C;  1SXD A;  1SV4 A;  4MHV A;  2ES6 A;  2KSO A;  2KE7 A;  3BS5 B;  2DKX A;  3K1R B;  4PZN A;  1X40 A;  1SXE A;  5J8Y A;  5JTI A;  5KNI A;  4RQN A;  2EAO A; 
#chains in the Genus database with same CATH topology
 1K1Q A;  4O3N A;  3ZI4 A;  4RZR A;  2W3S A;  2OHF A;  2QLT A;  4BGD A;  1ZQK A;  1JUD A;  2A1A A;  3DV9 A;  2PFN A;  3IP4 B;  1BPY A;  3KHR A;  5H2F U;  5ALV A;  3HKZ C;  1ECW A;  3UPQ A;  3MGH A;  2FMS A;  4ED6 A;  5EE9 A;  1F0M A;  4QWA A;  3ZDD A;  4PHP A;  3ALR A;  5KFJ A;  4DFP A;  4I29 A;  5III A;  3MR6 A;  3GIK A;  1FFU A;  1NK0 A;  2W11 A;  2W55 A;  3QU9 A;  4DL7 A;  4EBC A;  3V6J A;  3M8R A;  3HIL A;  2AH5 A;  9ICM A;  4US9 A;  4O5K A;  2QAR A;  2WAQ F;  1VDV A;  4LJX A;  4UQG A;  3IDW A;  1Z4N A;  4DFK A;  1TAQ A;  2ZG6 A;  7ICT A;  1KL9 A;  3V6H A;  2F1I A;  4YXM A;  1RYU A;  4R64 A;  4UAT A;  1ZET A;  2FPK A;  3JPS A;  4ECQ A;  4RT3 A;  1WYG A;  1ZQ1 C;  1NZB A;  4G9B A;  1RQN A;  4DWI A;  3SEN A;  4RQ6 A;  4DSJ A;  2IHN A;  4RQ2 A;  4IRK A;  3KKA C;  4UAS A;  1JRP A;  4Q44 A;  1SXD A;  1VJ5 A;  2WB1 F;  5DQI A;  4QZI A;  4JV1 A;  4C4R A;  4QWD A;  2XID A;  3OHA A;  4UAZ A;  2RDI A;  1LVH A;  3FYH A;  3NRW A;  3KOO A;  1HUZ A;  1QQ7 A;  4RNM A;  4QWB A;  2UVU A;  2ZIU B;  3KZX A;  2R8G A;  4DFJ A;  8ICB A;  3M6K A;  4IRC A;  2ZIU A;  3RB3 A;  5HR6 A;  4I2C A;  1WUD A;  1LV5 A;  4C8K A;  5KFQ A;  3M8S A;  5KFO A;  1X9S A;  2WTF A;  5D46 A;  2ZXI A;  4ECW A;  2MUT A;  4BJQ A;  4ZOH C;  4K4H A;  4Q8E A;  5J0Y A;  1BPE A;  3HT3 A;  4QZC A;  4NLZ A;  5AIB A;  1S9F A;  3TI0 A;  3H0M B;  2C2D A;  9ICN A;  3V6K A;  1SKR A;  3O0F A;  3KD3 A;  5DQH A;  5KFP A;  5F3X B;  4DF4 A;  3QYP A;  1ZQO A;  5ALK A;  4TQR A;  3MR5 A;  3RB4 A;  1X6J A;  4HYK A;  4FS1 A;  3G6Y A;  5EE0 A;  2J6S A;  4PZO A;  4ACO A;  2I6X A;  1ZQF A;  2K4P A;  4RPY A;  4C80 A;  5AI6 A;  2BR0 A;  2KK0 A;  4CF5 A;  2H3F A;  1ZQW A;  7ICI A;  1LKY B;  3NTU A;  4DQQ A;  4CF3 A;  1L3V A;  4QJF B;  2BPG A;  2KVS A;  5DB6 A;  3E58 A;  1UQV A;  4KLQ A;  7ICH A;  2RHF A;  4DSI A;  5ALY A;  3SQI A;  4YXJ A;  2KIW A;  4B9U A;  9ICQ A;  3ICX A;  1T3N A;  4EBD A;  8ICE A;  5DG8 A;  4TUP A;  1SKW A;  2HHU A;  1TAU A;  2ESE A;  3L4P A;  2KFZ A;  2ZJ8 A;  1ZQY A;  5KFV A;  2JEG A;  2RLT A;  3N28 A;  4DOA A;  4F8R A;  4C4T A;  3BS5 B;  4DSF A;  1U48 A;  4Z6F A;  5ALO A;  4RT2 A;  2Q0Z X;  3PNC A;  2RDJ A;  4KIT B;  3AEV A;  4QWC A;  3ZDE A;  4C8O A;  4K4G A;  3QNM A;  3Q8S B;  4RNO A;  4UAR A;  3OJS A;  3TAD A;  4ED8 A;  1QSL A;  2WHE A;  3SI8 A;  3TAP A;  1L6N A;  4GXK A;  2Y1I A;  1B43 A;  1JIH A;  2VJ4 A;  4F5N A;  3QX7 A;  4QZG A;  5KAI U;  5J0W A;  3ED5 A;  3M9O B;  2KEY A;  3T3F A;  4OJ5 A;  4J9S A;  4Y2U A;  1B22 A;  2JEI A;  5AM0 A;  3SAH A;  1RYR A;  1NK9 A;  3PV8 A;  3UMC A;  5J2F A;  1N48 A;  5ALH A;  4YMN A;  1K5O A;  2DPI A;  5J0R A;  2GWS A;  5ALZ A;  4NLN A;  2AU0 A;  2XGQ A;  2IOF K;  3TAN A;  5A0L A;  4F91 B;  3G6X A;  1S97 A;  2JGA A;  2G5I B;  3T5J A;  3KFU F;  4ELT A;  4M9J A;  1Z00 B;  2ZJA A;  2MSN A;  4YR0 A;  1JRO A;  5GTI U;  2QB0 B;  2CN1 A;  3LVV A;  1IXR A;  1JI7 A;  2FE9 A;  3TAC B;  3RR8 A;  3N7R C;  4BWJ A;  4EBE A;  4Y2V A;  2NRT A;  5ALW A;  3S6J A;  7ICL A;  1KEJ A;  2W9M A;  3HP6 A;  5IIM A;  2VAN A;  4DSK A;  2HBL A;  4BUG A;  3KZI U;  1ZQI A;  4F72 A;  8ICI A;  4UAU A;  3NUQ A;  4IQV A;  2XY6 A;  5J0X A;  4B9S A;  1JAL A;  2W43 A;  8ICV A;  1PVP A;  3V7L A;  8ICS A;  1N63 A;  2KFN A;  3D6J A;  5KFG A;  5KL1 B;  3K1R B;  4KLD A;  4TUS A;  4DL4 A;  3N7S C;  9ICT A;  4RPX A;  3CRX A;  5GTH U;  2W54 A;  5DDM A;  3A0B U;  1SL0 A;  2OEH A;  3JPQ A;  5AM2 A;  1TV9 A;  2LBO A;  1T4G A;  2ZIV A;  2IMW P;  4CF4 A;  2F8K A;  4OCZ A;  2H3Z A;  2I5H A;  1WWU A;  2F8L A;  2C2R A;  1WCL A;  4PHE A;  3SZ2 A;  8ICY A;  2W9A A;  5J2B A;  2P35 A;  1QCK A;  1PZN A;  4M6W B;  1SGG A;  4HAI A;  1S0V A;  3QU4 A;  1D9D A;  2J6T A;  2V9W A;  5KG0 A;  4AYB C;  2XCP A;  3DEE A;  2KKV A;  3C2K A;  4XUS A;  5ALD A;  4BDP A;  2ZUD A;  5KT6 A;  2EAP A;  2ZTC A;  4UAW A;  4ECV A;  5L1L A;  2EZX A;  2PI4 A;  1ZQB A;  2HOI A;  4B9T A;  4ECS A;  2JMG A;  2PFP A;  1KTQ A;  3THV A;  1ZJM A;  4DL2 A;  3GIJ A;  4DL5 A;  1U49 A;  3I28 A;  4JMU A;  5CEH A;  5KFM A;  2HHQ A;  3QEA Z;  3D2Q A;  4NV0 A;  2EZY A;  4KTQ A;  9ICF A;  2XY5 A;  9ICI A;  1ZQS A;  3LYS A;  4KLT A;  4US8 A;  1SZH A;  4C4S A;  5KFT A;  4YMM A;  4R63 A;  1ZQC A;  5KFK A;  3NVW A;  1SL2 A;  3L3F X;  5HR7 A;  4YD2 A;  4QZE A;  2LM4 A;  3WK5 A;  4F5R A;  2GOL A;  1IIP A;  1UCV A;  4NJ8 A;  3RJK A;  3AQF A;  2W7O A;  5G5G A;  2M9N A;  1YZ6 A;  2G07 A;  3PO4 A;  1NOM A;  4EEY A;  1OXJ A;  4J03 A;  5AKH A;  4RQ1 A;  2ZIW B;  3T5L A;  1X42 A;  4B6J A;  4F50 A;  2BCS A;  2E8N A;  9ICO A;  5F9N A;  4ELU A;  4JV2 A;  5HHH A;  5L1M A;  4DS5 A;  1A77 A;  9ICL A;  4Y2Q A;  2E8P A;  4CE6 A;  2BCQ A;  3F53 A;  3GII A;  1QQ5 A;  3ISB A;  3HPO A;  2E5S A;  1NZP A;  2YTU A;  4RQ7 A;  1GO3 F;  2KNJ A;  1S77 D;  5J2D A;  1MA7 A;  2VKQ A;  2LYB A;  5BOM A;  1ZYQ A;  5DG9 A;  3OHB A;  3AM9 A;  2OM6 A;  4UB2 A;  4RPZ A;  2JH7 A;  2KSO B;  1KRP A;  2CPR A;  4P4O A;  3WKB A;  3QZ8 A;  3J81 j;  4F2S A;  1CEZ A;  1T7P A;  2E8O A;  3ISD A;  4PHA A;  5ALU A;  3HKZ F;  2YQE A;  2HHV A;  5AI9 A;  3FC4 A;  5AI4 A;  2ISO A;  3RTV A;  2BKE A;  1WG8 A;  1ZD4 A;  5L1K A;  4KLG A;  1H38 A;  4NL9 C;  4C0Z A;  4DF8 A;  3FAH A;  3RF9 A;  2KE7 A;  5J2A A;  4R8U A;  3F2B A;  2ODG A;  4OJP A;  3Q8K A;  3E2E A;  1UHU A;  3TAR A;  5KT5 A;  4JV0 A;  2W03 A;  1SKS A;  1URJ A;  5AKJ A;  2KZ3 A;  2MU2 A;  2FPM A;  2JRZ A;  1X66 A;  1WWV A;  1U9L A;  3G6V A;  8ICX A;  1DGJ A;  1KFD A;  5KFN A;  4UAV A;  3QUQ A;  1L8L A;  2BDP A;  4XA5 A;  3BDP A;  4Y2T A;  2HVI A;  1F5S A;  2F76 X;  4Y2X A;  4PPX A;  4KMU A;  8ICG A;  2KVC A;  1NJW A;  2PFO A;  8ICF A;  2ASJ A;  3UXN A;  9ICR A;  2ASL A;  3EYZ A;  4QZ9 A;  4XQ8 A;  3QUC A;  4Y2Y A;  4KLO A;  3M7D A;  2F44 A;  2DQN B;  5J2I A;  2FLL A;  2Y9T A;  4RNN A;  5AK6 A;  3ZDB A;  3TAD C;  1Z3E B;  4NL9 A;  2RP5 A;  2BGW A;  3C5F A;  5K4L A;  5AK3 A;  3UXP A;  3PW0 A;  1ZD5 A;  4DFD A;  3SV3 A;  1T8E A;  4KLM A;  1ZQD A;  2ATL A;  4QIW F;  2NRX A;  4DQR A;  2FMP A;  4OD0 A;  8ICQ A;  3SV4 A;  5HML A;  3NVV A;  4FZL A;  4C8L A;  4F4Y A;  4LVS A;  3OTQ A;  1MSW D;  3GDX A;  4YMO A;  2LHT A;  3HX0 A;  4U7C A;  5J2K A;  4ICA A;  3D2N A;  1IG6 A;  5ALT A;  2D6F C;  3WK9 A;  4P0P B;  2E8M A;  3KBB A;  5DKW A;  4EEK A;  3GZF A;  2R8H A;  2R18 A;  1S76 D;  3JPO A;  1S8O A;  4M9N A;  5J2C A;  2XI9 A;  3BQ2 A;  1ZRM A;  1ZQG A;  4TUR A;  2G08 A;  2V4R A;  3PY8 A;  2KHQ A;  4CGZ A;  2YML A;  3UXO A;  2LYH A;  3IN5 A;  5CR0 A;  7ICG A;  4M04 A;  1NKB A;  2HBM A;  1ED1 A;  5KNI A;  5C5J A;  3MGI A;  3GQC A;  1AQ6 A;  3V7K A;  2HI0 A;  1KBU A;  1D8B A;  3H40 A;  4IRD A;  2NRV A;  1FO4 A;  4Y2R A;  1XO1 A;  4F93 B;  4YN4 A;  3UM9 A;  2PFQ A;  7ICK A;  3LK9 A;  3GV8 B;  4RUA A;  3FM9 A;  3QU7 A;  4M9H A;  1PK3 A;  1ZQA A;  5C0Y A;  5AKL A;  1UPH A;  4F5Q A;  1HIW A;  1KKX A;  2OH2 A;  5J0T A;  3PST A;  3GIM A;  2YB1 A;  5AKK A;  4M2Y A;  3EPG A;  3NAS A;  3EPI A;  1NK4 A;  1TK0 A;  4ECY A;  7ICR A;  2HOF A;  5CHG A;  3MBY A;  4K4I A;  4J9P A;  3BQT A;  2JZB B;  4P2H A;  3C29 A;  5B5E U;  3I76 A;  1ZQL A;  5KG1 A;  1Z1B A;  4ED0 A;  1IM4 A;  1LB2 B;  3ZD9 A;  5DB8 A;  1XSN A;  4YR3 A;  1RZT A;  3RJH A;  2UVR A;  4ECU A;  3BZC A;  5KG7 A;  5KTQ A;  4CDG A;  2BCV A;  3B0Y A;  2Y0S F;  5L1J A;  2KZZ A;  2A1J A;  2AGO A;  1YT3 A;  4FE3 A;  1RQL A;  2DPJ A;  5DBB A;  7ICJ A;  3PX0 A;  2W9C B;  3IG8 A;  4M0A A;  1V9P A;  3PML A;  1SXE A;  3H7I A;  1MQ3 A;  1QH9 A;  1CI4 A;  1KDH A;  2O6K A;  4P0Q B;  5D49 A;  2XO7 A;  3JPP A;  5KT7 A;  1BPB A;  3ZDC A;  8ICK A;  4R8U B;  1V97 A;  2E1E A;  2QKQ A;  4C7Y A;  4P4P A;  4BXO A;  3HW8 A;  4F2R A;  2RRD A;  3CNH A;  5KFW A;  5KT4 A;  1TKD A;  4O5C A;  1F44 A;  4J9L A;  1D8L A;  1C20 A;  4ELV A;  7ICM A;  5HHI A;  3OSN A;  5AK4 A;  3U26 A;  4PGX A;  4U6P A;  4ED3 A;  2HCF A;  2DUY A;  2KIV A;  2CXY A;  3B0X A;  1BNP A;  5DBA A;  1HUO A;  2FLN A;  4I2D A;  5J2J A;  3PZP A;  4I2G A;  1TAM A;  1J2M A;  3JPT A;  3PX4 A;  2XC9 A;  2DWQ A;  5AM5 A;  4FZN A;  2G0A A;  1ZQQ A;  3RJI A;  4F92 B;  4R65 A;  3TFR A;  4B9L A;  1N61 A;  3TFS A;  2XVT A;  2JV3 A;  3T79 A;  5KG3 A;  3H4B A;  5KFX A;  1ZQZ A;  3LDA A;  1T94 A;  5FP0 A;  5KT3 A;  3Q8P B;  5HP4 A;  3ZD8 A;  2ASD A;  3UMG A;  4TQS A;  9ICS A;  5KFS A;  2IOF A;  3WK6 A;  1M6Y A;  2K89 A;  1JX4 A;  2PMZ F;  4PGQ A;  1RG6 A;  3F5A A;  2Q4T A;  4IR9 A;  5ALG A;  3H4D A;  4IQW A;  4RU9 A;  5KFD A;  1A76 A;  4YP3 A;  9ICW A;  4EZ9 A;  1NJZ A;  2EZZ A;  2OYY A;  3IM1 A;  4R66 A;  3RFA A;  2IOH A;  1XWL A;  1ZRN A;  3C5G A;  4MF8 A;  1DOQ A;  3NS1 A;  9ICE A;  3MDA A;  2W8K A;  2DFL A;  1SL1 A;  2XCA A;  5CP2 A;  3OGU A;  4IR1 A;  5DQG A;  2A3V A;  2K60 A;  3WKD A;  4EEL A;  1T3Q A;  4KN4 A;  2XY7 A;  3H8J A;  3WKE A;  7ICF A;  2Y0S C;  4C7Z A;  4JWM A;  2G09 A;  4ED2 A;  9ICV A;  4YD1 A;  1N62 A;  4I2A A;  3H8M A;  5EE1 A;  2IA6 A;  1L7O A;  2KZM A;  3RRG A;  3NRZ A;  4F5O A;  1BNO A;  1Q3V A;  3QEB Z;  1NK5 A;  3OSP A;  4KLE A;  2WF5 A;  2L5Y A;  3RJJ A;  3V7J A;  1FIQ A;  1NJY A;  2M0N A;  4TUQ A;  3OPX A;  8ICM A;  5EWF A;  4NXZ A;  1U45 A;  1K1S A;  2F1H A;  3BQ0 A;  5AI8 A;  1S10 A;  1FEZ A;  4QW9 A;  3Q8Q B;  1FFV A;  2KMD A;  5J0Q A;  2KTQ A;  2WF9 A;  2LPE A;  4NLB A;  2KV2 A;  3C2L A;  2W8L A;  3PX6 A;  5G5H A;  4P0P A;  2DBY A;  5AM4 A;  2JHD A;  3Q8L A;  2AJQ A;  2NRZ A;  1U4B A;  9ICB A;  4F5P A;  3K1Z A;  2JXJ A;  2GLE A;  4DEZ A;  2J6U A;  2MA1 A;  3KKA A;  2H5X A;  4MHV A;  1NNL A;  3KHG A;  1SWV A;  1A0P A;  4NM1 A;  4J9Q A;  4YFK A;  1X2I A;  1ZOL A;  4QIW C;  4DCC A;  8ICA A;  1ZD2 P;  3K4G A;  4I2F A;  4MEX A;  4E0D A;  2AXT U;  3DDH A;  5AKZ A;  4QNL A;  2GO7 A;  3JPR A;  2BCR A;  3UQ2 A;  2K4E A;  3AQE A;  2A1J B;  2P66 A;  4FO6 A;  1HEK A;  1L8O A;  4EYH B;  1QQ6 A;  5KFZ A;  1DXS A;  3QXG A;  3MAB A;  4DFM A;  2YX8 A;  2VIX A;  3AL0 B;  5IIO A;  3SMV A;  4O0I A;  4FZM A;  1KSP A;  9ICU A;  2EAM A;  4Z6D A;  1BPX A;  4DL6 A;  2KN7 A;  4A8E A;  3T5K A;  4YG2 A;  2QB0 A;  1QSY A;  5KFY A;  2MRL A;  5T14 A;  5ALS A;  1D9F A;  3QUT A;  1ZQR A;  5J2E A;  5HMM A;  8ICJ A;  4DOB A;  5TIS U;  2KJ5 A;  2ALZ A;  3RR7 A;  3WKA A;  8ICT A;  3KHH A;  1QLN A;  5DBC A;  7ICQ A;  3PW2 A;  5KAF U;  1XC9 A;  3T5H A;  2XGP A;  2HHX A;  4UB1 A;  1L7M A;  3RAX A;  8ICC A;  4J9K A;  3AN1 A;  1ZXI A;  1U47 A;  4UB8 U;  3PW7 A;  4BXO B;  5J0O A;  2CRX A;  4GFJ A;  5D4B A;  4F71 A;  1NK7 A;  5ALF A;  4GXJ A;  4KN7 A;  4PL1 A;  3CYM A;  4AP9 A;  7ICN A;  4ECT A;  4Z6E A;  4OO1 J;  2BQR A;  2FDR A;  5KFI A;  1KFT A;  5ALM A;  1DGS A;  2JH1 A;  1JMS A;  2WFA A;  1BVS A;  5BOL A;  5DLF A;  3MGV A;  2WB1 C;  2BDU A;  2KJ8 A;  3SD7 A;  1KN5 A;  1CUK A;  2VJ5 A;  2KG5 A;  8ICL A;  2VA8 A;  3C2M A;  3RB0 A;  4PHD A;  3MC1 A;  4O3Q A;  1PK1 B;  4YVZ A;  2H3Q A;  2ZIW A;  1SIJ A;  2IBK A;  1EXN A;  4PH5 A;  3SR6 A;  3HJE A;  2HOQ A;  4QZF A;  4CNQ A;  4ECX A;  2H3V A;  3KHL A;  4USA A;  2I9G A;  9ICC A;  3C23 A;  3IRU A;  3BQ7 A;  4OJL A;  3OJU A;  5JU5 A;  2KJ9 A;  1RPL A;  4Z6C A;  2EQY A;  5F9L A;  2BPF A;  1ZQJ A;  5E79 U;  1Y88 A;  2DL0 A;  5AIA A;  1ZQP A;  2W9B B;  4UB4 A;  4ZH4 A;  2OXO A;  4UB5 A;  1NK8 A;  1XO0 A;  7ICV A;  1TE2 A;  2ES6 A;  3D2S A;  4DQP A;  8ICZ A;  1BPZ A;  1CRX A;  4KLL A;  1PUZ A;  4PZN A;  2P6U A;  4IQT A;  4JK1 A;  4DLE A;  5AM1 A;  5KL8 B;  1ZQE A;  3QU5 A;  5AKG A;  2MAX A;  7ICS A;  1KFS A;  3AU6 A;  4GXI A;  7ICE A;  4P4M A;  1L3T A;  2LM1 A;  4LZD A;  5ALR A;  4FFD A;  4NLG A;  1NKE A;  3LWM A;  1XU4 A;  4GIB A;  4ECR A;  3NGD A;  3BQ1 A;  4RUC A;  2BHN A;  4KLU A;  1O03 A;  4IS7 A;  2IHM A;  4Y2J A;  4RQ3 A;  3EWA A;  2KOB A;  4DQS A;  4UB3 A;  3CW2 C;  9ICH A;  5AKY A;  2YN4 A;  1L7N A;  3C21 A;  2R8K A;  4G3I A;  2VA3 A;  4MEY A;  5AKE A;  4PL2 A;  3GV7 B;  1PVR A;  4I28 A;  4F4Z A;  2NV3 A;  3M1Y A;  3LWL A;  3N97 B;  9ICA A;  2LMR A;  3ONN A;  2F2A B;  2DF4 B;  2AQ4 A;  5KG2 A;  3K75 D;  2PKE A;  1ZQH A;  1J2N A;  3QE9 Y;  5BPC A;  1QSS A;  9ICK A;  4EEN A;  4ED7 A;  3H0R B;  3R9K A;  3RB6 A;  3F2D A;  4DSL A;  4M9G A;  5JRT A;  5ALN A;  2WF6 A;  2F77 X;  3VC8 A;  3IG5 A;  1ZQN A;  1QTM A;  2PMZ C;  8ICU A;  3AUO A;  1DK2 A;  3RAQ A;  5AIC A;  4O3M A;  5L1I A;  4PGY A;  3BS7 A;  8ICN A;  4KLS A;  3MR2 A;  5HNK A;  2EH9 A;  1V85 A;  2HSZ A;  5AKX A;  4DQI A;  1YZ7 A;  2ZUB A;  5J0U A;  3TQ1 A;  1MC8 A;  4FBU A;  1X6I A;  4LZG A;  9ICP A;  2NRW A;  3FDS A;  1TVA A;  2KP7 A;  2W7P A;  8ICR A;  2C2E A;  4XRH A;  2P6R A;  4J9N A;  4AYB F;  1XSL A;  4CCH A;  4NLK A;  1N60 A;  2WAQ C;  2YMM A;  2ZJ5 A;  1OW5 A;  5B66 U;  2ZIX B;  3RH5 A;  1ZJN A;  5J29 A;  1TFR A;  5CB1 A;  4UAY A;  7ICU A;  1ZQV A;  1SV0 A;  1JN3 A;  4QZB A;  4YCX A;  4DSE A;  4RQ4 A;  2D8C A;  5KFH A;  4J9O A;  1SWW A;  3PMN A;  1UA1 A;  2DKZ A;  3V72 A;  3GU3 A;  2HBJ A;  3NVZ A;  1D8Y A;  3AU2 A;  2G06 A;  5AK5 A;  4JUZ A;  4ECZ A;  2ZIV B;  1KQQ A;  3M6Z A;  4PJ0 U;  1Q46 A;  3H0L B;  2YY6 A;  1L7P A;  2NO4 A;  1X9M A;  1MN8 A;  4KLJ A;  8ICO A;  2HBK A;  4P0Q A;  1PK1 A;  2BZF A;  5DB7 A;  4Q45 A;  2B6G A;  3EZ5 A;  1B0X A;  2K8A A;  2BCU A;  3Q8M A;  2BQ3 A;  2I1Q A;  3SEI A;  5ALX A;  5J2G A;  3PW4 A;  1N5W A;  5ALI A;  3M9N B;  4O3S A;  1L3S A;  1TK5 A;  3PSP A;  2H3I A;  2FPL A;  4GC7 A;  5KFA A;  2F3N A;  2JEJ A;  2A19 A;  4DOC A;  4QWE A;  1N5X A;  4O5E A;  2ZTD A;  3BS5 A;  4QW8 A;  5KG6 A;  2C28 A;  2G5H B;  3BJY A;  5KT2 A;  2FJ6 A;  5TZV A;  3MR3 A;  2HW3 A;  1SV4 A;  2LYA A;  4EX7 A;  5CWR A;  1TK8 A;  4KLH A;  4O3P A;  3WKC A;  4FS2 A;  4M9L A;  3C1Z A;  3EW9 A;  1Q3U A;  2LI6 A;  4BX9 C;  2ZUC A;  5J8Y A;  1MQ2 A;  3H8S A;  4OJO A;  3MFI A;  4KLF A;  3L5K A;  2PXI A;  3RRH A;  3PO5 A;  2HVH A;  4GC6 A;  1S5L U;  3F5E A;  2BPC A;  3IHQ B;  1X9X A;  3SYZ A;  3UMB A;  5IIJ A;  2EAN A;  3TKA A;  1RDF A;  4JWN A;  1BPD A;  3SAG A;  2Y9U A;  2ZXH A;  1Z19 A;  1UT8 A;  1C7Y A;  5KFR A;  4O3O A;  5JUM A;  3WK7 A;  1P7D A;  1Z00 A;  4Y2P A;  3VCB A;  3I1Y A;  4NLC A;  3TAQ A;  1KW4 A;  3SAF A;  2PI5 A;  4J9R A;  4C8M A;  4UBC A;  7ICO A;  2ZIX A;  2AHO B;  4IL6 U;  2EDU A;  4Q43 A;  1HJP A;  1COO A;  5AHX A;  5KG5 A;  4MFF A;  4Q8F A;  1DRG A;  2UVV A;  1RXW A;  1S0O A;  1NKC A;  1RYS A;  5KFU A;  4I2E A;  4KX5 A;  2AGP A;  1ZQX A;  3BZK A;  5L9X A;  1OUQ A;  2AQ0 A;  4BWM A;  2FI1 A;  3E0F A;  1RM6 C;  2UVW A;  2W9C A;  8ICW A;  4JB3 A;  4DS4 A;  2KD1 A;  2NYV A;  5AI5 A;  2D3D A;  2B21 A;  3RJE A;  5DGA A;  3ORY A;  4FBT A;  2NO5 A;  2JZB A;  1Z4O A;  1XSP A;  1X9W A;  2HHW A;  3QU2 A;  4M47 A;  4YR2 A;  5AKI A;  5J0S A;  5KFE A;  4WJ3 B;  5KFC A;  1VLB A;  2E3T A;  2Y1J A;  1BGX T;  2HMX A;  3RBD A;  4NM2 A;  1N2X A;  2ISP A;  2OCE A;  4UB6 U;  3H8W A;  4YQW A;  5IIK A;  5ALP A;  1NI3 A;  1B4F A;  2QB1 A;  5CJ7 A;  4IC9 A;  5J0P A;  2FMQ A;  3PR4 A;  4QZA A;  3GIL A;  5J8Y C;  2E1F A;  4DLG A;  3RJG A;  3PVX A;  3N4M B;  3C1Y A;  2N1R A;  1LKY A;  3M9M B;  2BQU A;  4MF2 A;  1IV8 A;  2RQ5 A;  2MUT B;  2JEF A;  1ARO P;  4EX6 A;  2ZTE A;  1NK6 A;  2KHV A;  1Q8K A;  4KX3 A;  1COK A;  3PR5 B;  2R8I A;  2AGQ A;  4I2B A;  1ZD3 A;  9ICJ A;  1O08 A;  2YB4 A;  4I2I A;  3EUB 2;  3Q8R B;  2FLP A;  2YMQ A;  1N56 A;  4NY8 A;  4QZ8 A;  3A0H U;  4EZ6 A;  2HHS A;  3NVY A;  3B9J A;  4CRX A;  4QZD A;  5AM3 A;  5EWG A;  4NWI A;  4ED1 A;  4DL3 A;  2W9B A;  3RH4 A;  5ALL A;  3GV5 B;  2KKP A;  2XIC A;  1NJX A;  1WCN A;  3C28 A;  3RH6 A;  5EE3 A;  1UT5 A;  4B9M A;  1SB3 C;  2DKX A;  1XS9 D;  1S0N A;  3WU2 U;  1X40 A;  5ALE A;  2VA2 A;  4EYI B;  4B9N A;  9ICX A;  5ALJ A;  2F1J A;  9ICG A;  3RJF A;  4RQN A;  4GLX A;  1XNS A;  4MFA A;  4IQU A;  3ISC A;  2W04 A;  5DLG A;  1ZQT A;  5AI0 A;  2W3R A;  3WK4 A;  5IIN A;  1SZP A;  5ALQ A;  2HDO A;  7ICP A;  3ETR A;  4KMO B;  1J97 A;  3N7P D;  4KLI A;  4DO9 A;  5KFF A;  3ZDA A;  2OWO A;  2R8J A;  3PSI A;  1UA0 A;  2V4Q A;  1DK3 A;  1ZQM A;  3KTQ A;  4J9M A;  4O9M A;  2K4H A;  3MDC A;  4I2H A;  5IIL A;  4O3R A;  8ICH A;  8ICP A;  5DB9 A;  2B0C A;  3MFH A;  2QAR B;  5EOZ A;  3F2C A;  4RQ0 A;  5DDY A;  5DG7 A;  2K8C B;  1V38 A;  5KFB A;  1Z1V A;  2LKY A;  4F4K A;  5DGB A;  5CRX A;  4Y2S A;  1L3U A;  1KLN A;  1L5U A;  2HHT A;  3QZ7 A;  3QUB A;  4UBB A;  2C22 A;  1SV0 C;  4F4W A;  2Z7J A;  4C8N A;  1PVQ A;  3IV6 A;  1JXE A;  3HRD D;  3GFK B;  4F4X A;  3JPN A;  4MFC A;  3WK8 A;  5KG4 A;  2WF8 A;  1ZQU A;  3CP8 A;  4OJ6 A;  3LVW A;  4B9V A;  4UW9 A;  4RQM A;  1S0M A;  5EWE A;  4RQ8 A;  3PW5 A;  1JXL A;  2K4I A;  4M6W A;  1RXV A;  2GH1 A;  1A6S A;  3PSF A;  2KSO A;  3RBE A;  3AMZ A;  4RQ5 A;  4F3O A;  5J2H A;  2DGZ A;  2JR5 A;  2K8B B;  3UQ0 A;  5KFL A;  5JTI A;  4X5V A;  2KIC A;  3ETL A;  4I27 A;  2YMP A;  4QZH A;  2EAO A;  2WF7 A;  4I2J A;  3HWT A;  5CA7 A; 
#chains in the Genus database with same CATH homology
 1X66 A;  1WWV A;  3TAD A;  2QKQ A;  1B4F A;  1OW5 A;  1X9X A;  1UCV A;  2QB1 A;  4NJ8 A;  1DXS A;  2F8K A;  2K60 A;  2EAN A;  4IS7 A;  1WWU A;  5J8Y C;  1SV0 A;  2Y9U A;  1OXJ A;  2D8C A;  2KG5 A;  2DKZ A;  1F0M A;  1PK3 A;  2EAM A;  3H8M A;  2E8N A;  2KIV A;  1LKY A;  1SGG A;  5L1M A;  1KW4 A;  2QB0 A;  1PK1 B;  5F3X B;  2E8P A;  2F44 A;  2Y9T A;  2L5Y A;  2QAR B;  2LMR A;  3TAD C;  1COK A;  4NL9 A;  3HIL A;  2YTU A;  1V38 A;  1Z1V A;  4PZO A;  1PK1 A;  2QAR A;  2JV3 A;  2B6G A;  1B0X A;  2EAP A;  2K4P A;  2KSO B;  3IDW A;  3BQ7 A;  1SV0 C;  2KMD A;  3SEI A;  1LKY B;  2LPE A;  5JU5 A;  5JRT A;  2QB0 B;  2E8O A;  1JI7 A;  2FE9 A;  3TAC B;  2F3N A;  1UQV A;  3BS5 A;  3SEN A;  2DL0 A;  1RG6 A;  2E8M A;  2GLE A;  4RQM A;  3BS7 A;  3KKA C;  2D3D A;  1V85 A;  3KKA A;  2ESE A;  4NL9 C;  1SXD A;  1SV4 A;  4MHV A;  2ES6 A;  2KSO A;  2KE7 A;  3BS5 B;  2DKX A;  3K1R B;  4PZN A;  1X40 A;  1SXE A;  5J8Y A;  5JTI A;  5KNI A;  4RQN A;  2EAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...