2KE7A

Nmr structure of the first sam domain from aida1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
QTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ankyrin repeat and sterile alpha motif domain-containing pro
publication title NMR structure of the first SAM domain from AIDA1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ke7A00
2ES6A 1OW5A 2KSOA 2L5YA 2GLEA 2EAPA 2K60A 2QKQA 3KKAA 3SENA 1X66A 2DKXA 3TACB 1PK1B 2KMDA 2LPEA 2KSOB 2B6GA 1B4FA 5JU5A 2E8NA 1SXEA 3TADA 3IDWA 2D8CA 2KE7A 1WWUA 1OXJA 2Y9TA 2KG5A 1SV0A 2K4PA 1V85A 2LMRA 3HILA 2F8KA 3H8MA 2E8MA 2EAMA 3BS5A 2DKZA 3K1RB 1PK3A 1RG6A 5F3XB 4NL9C 1X9XA 3BS7A 1UQVA 5JTIA 3BS5B 2Y9UA 2QARA 1UCVA 3KKAC 1COKA 2E8OA 2QB0A 4PZNA 5J8YC 5L1MA 2DL0A 2QARB 1KW4A 2JV3A 2FE9A 2QB1A 2QB0B 1V38A 1DXSA 1SGGA 1WWVA 1Z1VA 4NJ8A 2D3DA 1PK1A 1LKYA 1SV4A 1F0MA 1SV0C 4PZOA 4MHVA 2E8PA 4RQNA 2KIVA 2ESEA 4IS7A 1B0XA 5J8YA 1LKYB 2EANA 2YTUA 4RQMA 3BQ7A 5KNIA 5JRTA 3SEIA 3TADC 1JI7A 2F44A 1X40A 1SXDA 2EAOA 4NL9A 2F3NA
chains in the Genus database with same CATH superfamily
2ES6A 1NK8A 1S10A 4M6WA 1MC8A 1U9LA 5DBAA 3BQ0A 5KFIA 4RQ6A 3RJEA 4ECWA 5TISU 1L7MA 3MGVA 3MDCA 2WF5A 3PX4A 3WU2U 2JXJA 2KE7A 5KFQA 2FLNA 1WWUA 9ICHA 7ICIA 1ZQWA 2B21A 3NVYA 8ICLA 4HYKA 1S97A 3M8RA 5DG7A 5AM2A 3PO4A 2BGWA 2E8MA 5CA7A 3BS5A 3TI0A 4P0PA 4RQ8A 1L7PA 3PW4A 3C23A 3Q8MA 1QQ6A 3H7IA 5J2FA 4DL5A 2WAQF 2DWQA 2C28A 3KBBA 1HUOA 1QQ5A 2VANA 5HNKA 3T3FA 4DL4A 4J9MA 9ICSA 4F5OA 1JALA 3LWMA 2QB1A 3RAXA 4PHEA 4EX6A 3MFIA 3RJHA 2FPLA 5AI0A 7ICGA 5KG1A 5HP4A 5L9XA 4O5EA 2ZIWB 4ECSA 2RRDA 3QU2A 4O3QA 3MR6A 4IR9A 4YR0A 2E8PA 5GTIU 2XY6A 4RQNA 4P0PB 8ICQA 4K4HA 1ZQYA 1ZQCA 2OWOA 3BQ7A 8ICJA 3IN5A 1NKEA 2HDOA 3O0FA 3E2EA 5KT4A 1PUZA 5HHHA 1TAMA 5KFTA 3WK5A 1SZPA 5DG9A 3H8JA 2EAOA 3UPQA 4EELA 2K8BB 1JIHA 4DSJA 5J2EA 1N2XA 8ICKA 3D2NA 4J9RA 5HR7A 5AM1A 4UQGA 1S0MA 5IIKA 1ZQOA 2P35A 3OSNA 4LVSA 2BPFA 3EPIA 2AH5A 2KOBA 2IHMA 1VLBA 3HKZC 2ATLA 2R8IA 4OJOA 2K4PA 3SAHA 4FO6A 5DGAA 1Z00A 1F5SA 5D46A 4WJ3B 1B22A 1X6IA 1RPLA 3ORYA 3ZDEA 3JPPA 2KP7A 2HOQA 1ZQEA 4USAA 4ELTA 1RXVA 2ZJ5A 4XUSA 1ZQSA 1NK7A 3M6KA 2YMLA 3AL0B 3QZ7A 1ZQPA 5AKIA 2JEFA 4ECXA 1UT5A 3WKAA 3T5LA 3RH5A 2BCVA 4DWIA 1X9SA 2D6FC 2AQ0A 2XY7A 4YR3A 1Z1VA 4ED1A 5J2CA 3A0BU 7ICNA 3RJKA 5J0XA 8ICSA 3LYSA 4O5CA 4BDPA 1X6JA 5AM5A 2KZZA 2ESEA 5AM0A 1J97A 4I2EA 1KDHA 4CCHA 2FPMA 1ZQZA 2K4IA 4GFJA 1U49A 3QEBZ 1SXDA 3QUQA 5IIJA 1SKRA 2K60A 3SENA 3RR8A 1X66A 1NK9A 4K4GA 5AIAA 2DQNB 2VA3A 2IMWP 3PX6A 2PFNA 3H4BA 4ECQA 4M9NA 4F5RA 3Q8RB 3ZDBA 4KLEA 4PL1A 1ZD5A 3H8WA 4RQ3A 4Q44A 1K5OA 3K75D 3MFHA 2KV2A 1S0VA 3Q8PB 2Z7JA 5KFBA 1Q46A 1BPZA 3D6JA 3HX0A 2KHVA 3PSFA 3PW7A 1U45A 4I2GA 2P66A 4DEZA 2Y9TA 5ALFA 9ICGA 2YB1A 2RLTA 4RPXA 2HBKA 7ICSA 2EAMA 4ECRA 4F3OA 3Q8LA 1BVSA 1CI4A 3VC8A 1PK3A 2DUYA 3H0RB 4KITB 3GV7B 9ICBA 1KTQA 1D9FA 3BJYA 4PHAA 4F71A 3KKAC 3AN1A 4MEYA 3C2LA 3C28A 2DL0A 2FI1A 4RQ7A 3RFAA 2JRZA 4KLGA 2QARB 1L3SA 4UB6U 3QYPA 4Z6DA 4EX7A 3N7RC 2MA1A 2IOHA 3UMBA 5KL1B 8ICRA 2F1JA 2CN1A 3B0XA 3DEEA 1A0PA 2WHEA 1NJWA 3QXGA 1SV0C 4MHVA 3A0HU 4OJ5A 4PL2A 5J8YA 2G5IB 2YMQA 4RNOA 2V4QA 4ED6A 4F5NA 5CR0A 4O3OA 1MSWD 3FDSA 2N1RA 3UM9A 5KAFU 3AEVA 3S6JA 1X40A 2BCQA 4F50A 3BZCA 3NGDA 1AROP 2KSOA 1YT3A 1N5XA 4QZIA 4DQQA 3PW5A 3WKDA 4ED0A 3RB6A 1ZQIA 2VA2A 3BDPA 4KLUA 5DBCA 3BZKA 4ACOA 5AICA 1SXEA 3NRWA 9ICTA 1XSNA 3RB4A 5CWRA 5EWEA 3TQ1A 3F5AA 2H5XA 1U4BA 2C2DA 1RQNA 4JWNA 4UAZA 4IC9A 2LYBA 3OHAA 3EYZA 3RBEA 3ISDA 2HHTA 5J0SA 4Q8FA 5J0TA 4FZMA 2DKZA 1L8LA 4PHDA 4ECYA 2A1JB 2HVHA 1DGSA 1OUQA 5KFFA 8ICVA 4KLLA 2IHNA 3AM9A 3IRUA 2QB0A 4DFPA 3RB0A 1D8YA 1ZQHA 2XY5A 8ICWA 2KNJA 3LVVA 5J29A 1D9DA 3PO5A 3KFUF 3V7LA 4DF4A 2VJ4A 3PVXA 2JGAA 3EWAA 3Q8QB 5J0WA 4QWEA 2W3SA 2W04A 1S76D 4I28A 3ZI4A 1NJZA 4QWBA 2LM4A 1ZQXA 2CPRA 4O3NA 1SKWA 1SV4A 1F0MA 4B9TA 2BQ3A 3H0LB 4M2YA 4P2HA 2R8JA 2G08A 4ZOHC 1Z19A 1URJA 2FPKA 5KFMA 4ED2A 4UB8U 5AI4A 3PW0A 3WKCA 9ICAA 2A3VA 1O03A 5DDMA 2BCSA 5AKYA 2JMGA 4OJ6A 5KT5A 2LHTA 2W55A 4B9VA 2KMDA 4KLIA 8ICGA 5KFLA 4RQ2A 2HOFA 2IOFA 1TK0A 5ALSA 4BGDA 5AKXA 1FEZA 3GIJA 2ZTDA 2OH2A 1ZQGA 2CRXA 1Z3EB 1L7OA 1ZRNA 2GWSA 2KJ5A 3TANA 3QX7A 2YX8A 2ZIUB 2J6TA 2AHOB 1ZQMA 1FO4A 3E58A 3F2DA 1YZ6A 2ZIVA 2G0AA 3QU5A 4YMOA 4NLNA 4F4WA 1WG8A 2ZUCA 5KG2A 4PGQA 3QEAZ 1KQQA 1NOMA 2JZBA 3KTQA 1UQVA 2ZUBA 1XNSA 3WKEA 4DFDA 4QZFA 4I2DA 1ZJMA 5ALXA 2MU2A 3MABA 3IG8A 5BOLA 3K1ZA 1KBUA 4EZ6A 1KL9A 4KTQA 1TAQA 4UB2A 1FFUA 2NRVA 3THVA 8ICPA 3V6KA 3GQCA 2ZIVB 1SL1A 1BNPA 4RQ1A 3K4GA 3C1YA 2WF8A 4RUAA 2ZG6A 4QW9A 3PR4A 7ICHA 3TKAA 1TVAA 2I6XA 3CP8A 4C4SA 1L8OA 2WB1C 1XU4A 1Q3VA 4I2AA 4CE6A 3SV4A 4Y2QA 3N97B 5CHGA 2I5HA 1ZQ1C 2W8LA 4JV1A 1ZD3A 4J9OA 4Z6FA 8ICAA 1N5WA 5KFAA 3KKAA 4YXJA 3QZ8A 3LWLA 1QQ7A 4JK1A 5FP0A 5KFUA 1NI3A 1UT8A 3KHGA 3FC4A 3M8SA 1NKCA 4ED7A 1SKSA 3H8SA 1YZ7A 4IL6U 3SD7A 3WK4A 2XVTA 4G9BA 4QZCA 3TADA 4CGZA 3JPSA 3EPGA 4JWMA 2PI5A 3E0FA 4J9QA 2XIDA 1LVHA 1SV0A 3HJEA 2W8KA 4UBCA 4ECTA 1Z4OA 1ZJNA 4KN4A 5KFHA 4OJPA 2XICA 3JPNA 2I9GA 3QNMA 2R8HA 1D8BA 5ALGA 3QU9A 4M9LA 3QUBA 9ICOA 2K4EA 5CEHA 4PZNA 5J8YC 5L1LA 3ZD9A 2R18A 5KT6A 5BPCA 4M47A 3TAQA 5ALWA 2ZIWA 4Y2VA 2HBMA 4Y2YA 4KN7A 1KKXA 1VJ5A 1WWVA 3BQ1A 3G6VA 4PGXA 1PVQA 2RQ5A 4ZH4A 2KK0A 1NK0A 2M9NA 4P4MA 5L1JA 8ICYA 4LZDA 5JUMA 4KLHA 3AQFA 1S9FA 4FS1A 1T3NA 4NM2A 4KLMA 5E79U 4YR2A 4F4YA 1Z4NA 4MEXA 1XWLA 3F53A 3SMVA 4CDGA 1CUKA 2Y0SF 1AQ6A 1JXLA 3AU6A 5ALNA 1NJYA 1TV9A 2QKQA 4F4XA 8ICNA 2GO7A 5J2IA 1WCNA 1MA7A 2H3QA 2JH1A 4DSEA 2G06A 2RP5A 3IP4B 5ALVA 1DK3A 4NXZA 5JU5A 5KFNA 3M9MB 3GV5B 2HHQA 3KHLA 3G6YA 3ETLA 2HHVA 2V4RA 2IBKA 2OEHA 5DLGA 1JRPA 3KHHA 2XGQA 2KJ9A 2WTFA 1BGXT 2LMRA 1ZQAA 2YQEA 4QIWC 4B6JA 2F8KA 7ICOA 1HJPA 3RJJA 1N62A 3WK7A 3PSIA 3V72A 9ICNA 4J9PA 4TQRA 3ZDCA 2FLLA 4UB1A 2BPCA 1V9PA 5L1MA 4Z6CA 3QE9Y 2KJ8A 5AKGA 3SAGA 3M9OB 5ALYA 1ZOLA 2E5SA 5KTQA 2MAXA 5AK3A 5ALUA 5KFSA 5DB9A 2G07A 4O0IA 5KFRA 4Y2TA 3GDXA 3DDHA 4MF2A 4F93B 2ZXHA 4O3MA 2KIVA 4RQ5A 1XO0A 1UA0A 2AGPA 4UB4A 2HCFA 5J0RA 5DG8A 3MR3A 3B9JA 1NKBA 2DBYA 5AK6A 1NZBA 3T5KA 2AJQA 1ZRMA 1S0OA 1WYGA 3VCBA 4ICAA 5KFDA 1KFDA 1QSYA 1DXSA 4EZ9A 2F3NA 2WAQC 2F76X 2EAPA 4O9MA 3PNCA 1QLNA 2UVWA 4BWMA 3ONNA 4UBBA 2JR5A 5ALJA 9ICQA 7ICMA 2V9WA 5CP2A 1TAUA 4KMOB 3NTUA 1ZQQA 8ICBA 3IDWA 1KRPA 1WCLA 2BQRA 1U47A 1H38A 5L1IA 1RYSA 2HOIA 4YP3A 2P6UA 4DQSA 3T5JA 4AP9A 4MFCA 5IIIA 5KFWA 3EZ5A 1XC9A 7ICTA 4YCXA 3TFRA 1X9WA 4NL9C 2HHWA 1HEKA 4US8A 5DDYA 2LM1A 1BPDA 2Y9UA 3IHQB 3NVWA 5K4LA 2QARA 2C22A 4FZNA 2E8OA 2WFAA 3QUTA 1T94A 2XGPA 2NRTA 4DSKA 3D2SA 5AKLA 1BNOA 4IRCA 3ZDDA 2JV3A 3RF9A 3LVWA 9ICWA 4LJXA 1XSPA 1PK1A 4DQPA 1XSLA 4DOCA 5D4BA 2H3VA 8ICHA 4C4TA 3GILA 4GC7A 7ICUA 5T14A 4JV2A 4FS2A 4NLGA 1J2MA 3GU3A 5KG6A 5KFJA 3SAFA 3UQ0A 3TADC 2DF4B 5J2AA 4U7CA 4NWIA 2KKPA 3PX0A 2KIWA 4OD0A 3C21A 1NZPA 2GLEA 3GZFA 3HP6A 3UQ2A 1PK1B 4F92B 3RBDA 5H2FU 4QJFB 1RXWA 3IV6A 4RU9A 4FE3A 3FAHA 5KG0A 4PH5A 5C5JA 5J2BA 1P7DA 2EZZA 5AK4A 2F1IA 1RYUA 1ZQVA 1QSLA 3UXPA 2YMMA 1BPXA 3ZDAA 4O3RA 4OCZA 2O6KA 3AMZA 5GTHU 3OSPA 5DBBA 3KD3A 1PVRA 2A1JA 5KFCA 4UAWA 2XCAA 3H8MA 5J2KA 1QCKA 1SL0A 4M0AA 3PSTA 1S0NA 3K1RB 2KD1A 4RPYA 5TZVA 4MFFA 3V6HA 5ALMA 4BWJA 2XO7A 7ICQA 3QUCA 2I1QA 3R9KA 1QTMA 1Q3UA 4J9KA 1UCVA 5KFVA 2EZXA 1XS9D 8ICZA 5KT7A 4P4OA 4ELUA 4A8EA 2W03A 1L3VA 4ECZA 1L3TA 5DB7A 3I1YA 1LB2B 2KN7A 4LZGA 5J0YA 2FLPA 2ZJ8A 4QZBA 4B9NA 3WK6A 2KVCA 3PW2A 3U26A 1SIJA 1RYRA 3N7SC 4O3SA 3KZIU 2ZUDA 2RHFA 4DL6A 2K89A 1QH9A 1B0XA 2NO4A 1IG6A 5KFXA 5AKHA 4U6PA 2VA8A 5AIBA 5G5GA 4C7YA 5AI6A 1ED1A 3I28A 2KHQA 3QU7A 4NLCA 5ALRA 4DSLA 5HR6A 2BPGA 3ZD8A 4DO9A 4CNQA 9ICKA 2AQ4A 2RDJA 3EUB2 3FM9A 4QZ8A 4I2FA 2NV3A 4TQSA 2ZIUA 3HW8A 4GXIA 3TAPA 2PFOA 7ICPA 5A0LA 3H0MB 2HHUA 3IG5A 4YXMA 4NY8A 4DS5A 4PPXA 4BX9C 4J9NA 4IQVA 2YMPA 1L7NA 2DFLA 5KG4A 2NYVA 4DFMA 4DQRA 2W7OA 4J03A 1HIWA 3L5KA 8ICIA 3T5HA 5ALTA 1DOQA 1X9XA 2YB4A 3TARA 4F5PA 4YVZA 3C1ZA 4YQWA 3MDAA 1S5LU 4O3PA 2MSNA 3F5EA 1SZHA 1NK5A 1C20A 3GFKB 5AI9A 5KG3A 5CJ7A 4P0QA 5DLFA 2HW3A 4F91B 3GIIA 2PXIA 2BHNA 8ICEA 4I27A 2H3IA 3PMNA 3OGUA 4YG2A 3OJSA 4F4KA 1NK6A 2D3DA 2F8LA 3PSPA 4BUGA 2LYAA 3C2MA 2R8KA 5J2HA 3QU4A 4PGYA 3SI8A 3M9NB 4QZAA 2ZXIA 3NRZA 4IS7A 3CRXA 2YTUA 4CF3A 4R63A 2M0NA 2IA6A 1LV5A 4DSFA 9ICMA 4KLQA 4YMNA 4QZDA 1X42A 1TKDA 4P0QB 4CRXA 3KOOA 4NL9A 3H4DA 4Q8EA 4XA5A 2OM6A 3D2QA 4JB3A 2HBLA 5ALQA 4KLSA 3BQTA 3SV3A 4IQTA 3RR7A 5ALKA 4UAUA 4QZHA 2W9BA 5HHIA 4YN4A 3MGHA 1A76A 2YN4A 7ICVA 1KSPA 3CYMA 5AI8A 5AK5A 5ALZA 4KX5A 2OXOA 4DL3A 5ALPA 1PVPA 2W9AA 8ICFA 1X2IA 1TK5A 3I76A 1S77D 2CXYA 5KFZA 1ZQRA 5B5EU 2WF6A 5IIOA 3PY8A 4DL2A 1UA1A 4GXKA 3JPTA 4ED8A 1RG6A 2PKEA 3KZXA 2W9BB 4DSIA 2PMZF 4B9SA 4NM1A 1N56A 3SYZA 1MN8A 1T7PA 4F72A 4I2JA 4HAIA 3DV9A 1TK8A 4M04A 5KAIU 1MQ2A 3UXOA 2Y1IA 3L4PA 4DL7A 4I29A 1Z1BA 4DFKA 4QWAA 2LBOA 4RQ0A 5EOZA 4KMUA 4R65A 1NK4A 4FBTA 2C2EA 2PFPA 2C2RA 2WF9A 3HKZF 5J2GA 4R8UB 2FMPA 5J0UA 3NVZA 1LKYB 1JN3A 3RB3A 3RAQA 3OTQA 4QZEA 4X5VA 3GV8B 4Q43A 1SWVA 1IIPA 2A1AA 4GIBA 7ICFA 4FZLA 4UB5A 3HT3A 3WK8A 3OPXA 4UAVA 4Y2SA 5DQIA 2HMXA 5G5HA 4J9SA 4M6WB 5IILA 4M9GA 3MR2A 3GIKA 2E8NA 3L3FX 2MUTA 4QNLA 3V7JA 1ZQTA 4XQ8A 3RJFA 4CF5A 2KG5A 7ICRA 1RQLA 4F5QA 4M9JA 2KEYA 5HMMA 1V85A 1U48A 3C29A 3SQIA 5C0YA 2LKYA 1SL2A 1M6YA 4RT3A 3V7KA 3MBYA 5JTIA 3BS5B 2JEJA 3FYHA 4RQ4A 2JEIA 1IM4A 5ALDA 2ZTCA 2MUTB 2UVVA 2FDRA 3WK9A 4KX3A 4R64A 2HHXA 4UB3A 8ICOA 1V38A 3ALRA 3F2BA 9ICCA 7ICLA 2K4HA 2UVRA 2HI0A 4NJ8A 2PMZC 2KTQA 4F2RA 3EW9A 1A77A 2W3RA 2ZJAA 2HVIA 2NRWA 4PZOA 4ED3A 2NRZA 3ED5A 5AHXA 8ICMA 5CRXA 2KZ3A 4RNNA 1B43A 1JI7A 3HRDD 3F2CA 4ECVA 3HPOA 4UARA 4B9MA 3TACB 3UMGA 1V97A 4C0ZA 8ICXA 5EE0A 1B4FA 7ICKA 1FFVA 5KG7A 1DGJA 5EE9A 3V6JA 3IM1A 2NRXA 9ICVA 4DQIA 2EH9A 4EBEA 4KLFA 1OXJA 4QWCA 5AKZA 5ALHA 4GC6A 4GXJA 2F1HA 5ALEA 1ZQKA 2VIXA 5ALOA 4UW9A 8ICTA 1CRXA 3PR5B 2W43A 4IRDA 3AUOA 2K8AA 2VKQA 2AGOA 9ICIA 2MRLA 5F3XB 2Y0SC 1Z00B 1ECWA 2XC9A 1UHUA 2GH1A 1JX4A 4C8LA 1COKA 4AYBF 5F9NA 1X9MA 1K1QA 1NNLA 2W9CA 4Z6EA 1QSSA 4RZRA 4IQWA 2JH7A 4EEYA 2R8GA 4B9LA 1RZTA 5EWGA 3Q8KA 1C7YA 4I2CA 3PZPA 4EYIB 4MFAA 3BQ2A 3MC1A 3N28A 5IINA 4BJQA 4Y2PA 1T4GA 4QZGA 2KZMA 2EANA 7ICJA 1IXRA 5JRTA 4OJLA 3OHBA 5AKJA 5KFPA 3UMCA 5BOMA 4C8KA 2FMSA 2ALZA 3ISCA 2W9CB 3LDAA 3N4MB 1RDFA 4DS4A 2B0CA 4RUCA 2HBJA 4DF8A 2KVSA 1BPEA 4RNMA 2L5YA 1JMSA 9ICFA 1IV8A 4QWDA 8ICUA 4F8RA 3ISBA 1ZQFA 5AKKA 2AU0A 2Q0ZX 1N48A 1ZD4A 4TUQA 4EEKA 4F4ZA 2P6RA 4Y2XA 2YY6A 5KFYA 1KFTA 2BCUA 3RH4A 3C5FA 4QZ9A 1ZQDA 4J9LA 4US9A 1O08A 2ASJA 4C8NA 5KFOA 2AGQA 3PMLA 3SR6A 4R66A 5DQGA 5DB6A 4DLGA 5CB1A 2Y1JA 4YMMA 4IRKA 5J2DA 4PHPA 3HILA 4EYHB 4XRHA 2HSZA 2BR0A 1Q8KA 7ICEA 3KHRA 3ETRA 2BZFA 4MF8A 3RTVA 5L1KA 2W7PA 4O5KA 3CNHA 1GO3F 4KLOA 4IR1A 3UXNA 4JV0A 2LI6A 2PFQA 1N63A 2FE9A 3RJGA 2BDUA 1SGGA 4QW8A 5DKWA 3NUQA 4EBCA 2FMQA 2E1EA 4AYBC 5AKEA 4I2HA 3CW2C 2VJ5A 1VDVA 1WUDA 4NLZA 5KFEA 1MQ3A 4RQMA 5KNIA 4NLBA 9ICXA 1EXNA 3MR5A 2ODGA 3OJUA 5J0QA 3MGIA 1ZD2P 2A19A 1ZQUA 4NLKA 2WF7A 1CEZA 1OW5A 3NS1A 2EDUA 4G3IA 2J6UA 5EE1A 4GLXA 1TE2A 4DCCA 2G5HB 8ICCA 2KICA 4I2IA 2ZTEA 1N61A 4DLEA 5ALLA 2LPEA 2KSOB 5KT3A 2OHFA 4EENA 1SWWA 2JHDA 2W9MA 1F44A 2JEGA 2GOLA 1S8OA 2F2AB 2ASDA 4YD2A 3Q8SB 2H3ZA 2BCRA 3T79A 2Q4TA 3RJIA 4KLJA 4Y2UA 4UASA 4YFKA 2H3FA 4DOBA 2WB1F 2EZYA 1JROA 2UVUA 4I2BA 3M6ZA 1ZQNA 1BPBA 5HMLA 4EBDA 2QLTA 5F9LA 5KFGA 1BPYA 3LK9A 4JUZA 4B9UA 4UATA 1ZETA 1N60A 3M7DA 1D8LA 5EWFA 1RM6C 1COOA 3C2KA 4C8MA 4CF4A 4DFJA 3C5GA 5J2JA 2ISOA 3AU2A 3B0YA 2BKEA 2QB0B 9ICEA 1ZQJA 2XCPA 4Q45A 4DOAA 4C4RA 1A6SA 2AXTU 4BXOA 3PV8A 5KL8B 4TUPA 1ZYQA 5D49A 2KKVA 2XI9A 4ELVA 4FBUA 1L3UA 3J81j 1ZQBA 5DGBA 4C7ZA 1T3QA 2E3TA 3RH6A 2KFNA 3RRGA 2G09A 4P4PA 9ICLA 2IOFK 2LYHA 1XO1A 1NJXA 4RPZA 2ISPA 5DB8A 2DKXA 4ECUA 3AQEA 3NVVA 2OYYA 1KFSA 1FIQA 5AM3A 1KLNA 2B6GA 4BXOB 9ICJA 2NO5A 5B66U 1L5UA 1PZNA 3ICXA 2OCEA 2BQUA 4IQUA 2D8CA 3M1YA 2FJ6A 3G6XA 3H40A 9ICPA 2DPJA 5AM4A 4K4IA 3TFSA 4C8OA 3NASA 4E0DA 4TUSA 4F2SA 1J2NA 2BDPA 5J0PA 2RDIA 3JPOA 2EQYA 3RRHA 2W54A 2J6SA 5EE3A 2DGZA 9ICUA 1Y88A 1ZQLA 5J0OA 2ZIXA 3BS7A 5ALIA 1SB3C 2DPIA 1L6NA 3N7PD 3JPQA 4UAYA 1ZXIA 2W11A 5KFKA 4M9HA 2ASLA 9ICRA 2HHSA 2JZBB 2F77X 4RT2A 4TURA 1KW4A 1DRGA 2K8CB 4YD1A 4C80A 4KLDA 4Y2JA 4FFDA 1DK2A 1K1SA 3SZ2A 2KFZA 4JMUA 1KEJA 4NV0A 1KN5A 4R8UA 1LKYA 5DQHA 1T8EA 1UPHA 3WKBA 3GIMA 4OO1J 4PJ0U 2PI4A 2ZIXB 5KG5A 4KLTA 5IIMA 5KT2A 1JUDA 3HWTA 3SEIA 1TFRA 4QIWF 1HUZA 4Y2RA 5AI5A 1JXEA 2E1FA 2F44A 3JPRA
chains in the Genus database with same CATH topology
2ES6A 1OW5A 2KSOA 2L5YA 2GLEA 2EAPA 2K60A 2QKQA 3KKAA 3SENA 1X66A 2DKXA 3TACB 1PK1B 2KMDA 2LPEA 2KSOB 2B6GA 1B4FA 5JU5A 2E8NA 1SXEA 3TADA 3IDWA 2D8CA 2KE7A 1WWUA 1OXJA 2Y9TA 2KG5A 1SV0A 2K4PA 1V85A 2LMRA 3HILA 2F8KA 3H8MA 2E8MA 2EAMA 3BS5A 2DKZA 3K1RB 1PK3A 1RG6A 5F3XB 4NL9C 1X9XA 3BS7A 1UQVA 5JTIA 3BS5B 2Y9UA 2QARA 1UCVA 3KKAC 1COKA 2E8OA 2QB0A 4PZNA 5J8YC 5L1MA 2DL0A 2QARB 1KW4A 2JV3A 2FE9A 2QB1A 2QB0B 1V38A 1DXSA 1SGGA 1WWVA 1Z1VA 4NJ8A 2D3DA 1PK1A 1LKYA 1SV4A 1F0MA 1SV0C 4PZOA 4MHVA 2E8PA 4RQNA 2KIVA 2ESEA 4IS7A 1B0XA 5J8YA 1LKYB 2EANA 2YTUA 4RQMA 3BQ7A 5KNIA 5JRTA 3SEIA 3TADC 1JI7A 2F44A 1X40A 1SXDA 2EAOA 4NL9A 2F3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ES6 A;  1OW5 A;  2KSO A;  2L5Y A;  2GLE A;  2EAP A;  2K60 A;  2QKQ A;  3KKA A;  3SEN A;  1X66 A;  2DKX A;  3TAC B;  1PK1 B;  2KMD A;  2LPE A;  2KSO B;  2B6G A;  1B4F A;  5JU5 A;  2E8N A;  1SXE A;  3TAD A;  3IDW A;  2D8C A;  2KE7 A;  1WWU A;  1OXJ A;  2Y9T A;  2KG5 A;  1SV0 A;  2K4P A;  1V85 A;  2LMR A;  3HIL A;  2F8K A;  3H8M A;  2E8M A;  2EAM A;  3BS5 A;  2DKZ A;  3K1R B;  1PK3 A;  1RG6 A;  5F3X B;  4NL9 C;  1X9X A;  3BS7 A;  1UQV A;  5JTI A;  3BS5 B;  2Y9U A;  2QAR A;  1UCV A;  3KKA C;  1COK A;  2E8O A;  2QB0 A;  4PZN A;  5J8Y C;  5L1M A;  2DL0 A;  2QAR B;  1KW4 A;  2JV3 A;  2FE9 A;  2QB1 A;  2QB0 B;  1V38 A;  1DXS A;  1SGG A;  1WWV A;  1Z1V A;  4NJ8 A;  2D3D A;  1PK1 A;  1LKY A;  1SV4 A;  1F0M A;  1SV0 C;  4PZO A;  4MHV A;  2E8P A;  4RQN A;  2KIV A;  2ESE A;  4IS7 A;  1B0X A;  5J8Y A;  1LKY B;  2EAN A;  2YTU A;  4RQM A;  3BQ7 A;  5KNI A;  5JRT A;  3SEI A;  3TAD C;  1JI7 A;  2F44 A;  1X40 A;  1SXD A;  2EAO A;  4NL9 A;  2F3N A; 
#chains in the Genus database with same CATH topology
 2ES6 A;  1NK8 A;  1S10 A;  4M6W A;  1MC8 A;  1U9L A;  5DBA A;  3BQ0 A;  5KFI A;  4RQ6 A;  3RJE A;  4ECW A;  5TIS U;  1L7M A;  3MGV A;  3MDC A;  2WF5 A;  3PX4 A;  3WU2 U;  2JXJ A;  2KE7 A;  5KFQ A;  2FLN A;  1WWU A;  9ICH A;  7ICI A;  1ZQW A;  2B21 A;  3NVY A;  8ICL A;  4HYK A;  1S97 A;  3M8R A;  5DG7 A;  5AM2 A;  3PO4 A;  2BGW A;  2E8M A;  5CA7 A;  3BS5 A;  3TI0 A;  4P0P A;  4RQ8 A;  1L7P A;  3PW4 A;  3C23 A;  3Q8M A;  1QQ6 A;  3H7I A;  5J2F A;  4DL5 A;  2WAQ F;  2DWQ A;  2C28 A;  3KBB A;  1HUO A;  1QQ5 A;  2VAN A;  5HNK A;  3T3F A;  4DL4 A;  4J9M A;  9ICS A;  4F5O A;  1JAL A;  3LWM A;  2QB1 A;  3RAX A;  4PHE A;  4EX6 A;  3MFI A;  3RJH A;  2FPL A;  5AI0 A;  7ICG A;  5KG1 A;  5HP4 A;  5L9X A;  4O5E A;  2ZIW B;  4ECS A;  2RRD A;  3QU2 A;  4O3Q A;  3MR6 A;  4IR9 A;  4YR0 A;  2E8P A;  5GTI U;  2XY6 A;  4RQN A;  4P0P B;  8ICQ A;  4K4H A;  1ZQY A;  1ZQC A;  2OWO A;  3BQ7 A;  8ICJ A;  3IN5 A;  1NKE A;  2HDO A;  3O0F A;  3E2E A;  5KT4 A;  1PUZ A;  5HHH A;  1TAM A;  5KFT A;  3WK5 A;  1SZP A;  5DG9 A;  3H8J A;  2EAO A;  3UPQ A;  4EEL A;  2K8B B;  1JIH A;  4DSJ A;  5J2E A;  1N2X A;  8ICK A;  3D2N A;  4J9R A;  5HR7 A;  5AM1 A;  4UQG A;  1S0M A;  5IIK A;  1ZQO A;  2P35 A;  3OSN A;  4LVS A;  2BPF A;  3EPI A;  2AH5 A;  2KOB A;  2IHM A;  1VLB A;  3HKZ C;  2ATL A;  2R8I A;  4OJO A;  2K4P A;  3SAH A;  4FO6 A;  5DGA A;  1Z00 A;  1F5S A;  5D46 A;  4WJ3 B;  1B22 A;  1X6I A;  1RPL A;  3ORY A;  3ZDE A;  3JPP A;  2KP7 A;  2HOQ A;  1ZQE A;  4USA A;  4ELT A;  1RXV A;  2ZJ5 A;  4XUS A;  1ZQS A;  1NK7 A;  3M6K A;  2YML A;  3AL0 B;  3QZ7 A;  1ZQP A;  5AKI A;  2JEF A;  4ECX A;  1UT5 A;  3WKA A;  3T5L A;  3RH5 A;  2BCV A;  4DWI A;  1X9S A;  2D6F C;  2AQ0 A;  2XY7 A;  4YR3 A;  1Z1V A;  4ED1 A;  5J2C A;  3A0B U;  7ICN A;  3RJK A;  5J0X A;  8ICS A;  3LYS A;  4O5C A;  4BDP A;  1X6J A;  5AM5 A;  2KZZ A;  2ESE A;  5AM0 A;  1J97 A;  4I2E A;  1KDH A;  4CCH A;  2FPM A;  1ZQZ A;  2K4I A;  4GFJ A;  1U49 A;  3QEB Z;  1SXD A;  3QUQ A;  5IIJ A;  1SKR A;  2K60 A;  3SEN A;  3RR8 A;  1X66 A;  1NK9 A;  4K4G A;  5AIA A;  2DQN B;  2VA3 A;  2IMW P;  3PX6 A;  2PFN A;  3H4B A;  4ECQ A;  4M9N A;  4F5R A;  3Q8R B;  3ZDB A;  4KLE A;  4PL1 A;  1ZD5 A;  3H8W A;  4RQ3 A;  4Q44 A;  1K5O A;  3K75 D;  3MFH A;  2KV2 A;  1S0V A;  3Q8P B;  2Z7J A;  5KFB A;  1Q46 A;  1BPZ A;  3D6J A;  3HX0 A;  2KHV A;  3PSF A;  3PW7 A;  1U45 A;  4I2G A;  2P66 A;  4DEZ A;  2Y9T A;  5ALF A;  9ICG A;  2YB1 A;  2RLT A;  4RPX A;  2HBK A;  7ICS A;  2EAM A;  4ECR A;  4F3O A;  3Q8L A;  1BVS A;  1CI4 A;  3VC8 A;  1PK3 A;  2DUY A;  3H0R B;  4KIT B;  3GV7 B;  9ICB A;  1KTQ A;  1D9F A;  3BJY A;  4PHA A;  4F71 A;  3KKA C;  3AN1 A;  4MEY A;  3C2L A;  3C28 A;  2DL0 A;  2FI1 A;  4RQ7 A;  3RFA A;  2JRZ A;  4KLG A;  2QAR B;  1L3S A;  4UB6 U;  3QYP A;  4Z6D A;  4EX7 A;  3N7R C;  2MA1 A;  2IOH A;  3UMB A;  5KL1 B;  8ICR A;  2F1J A;  2CN1 A;  3B0X A;  3DEE A;  1A0P A;  2WHE A;  1NJW A;  3QXG A;  1SV0 C;  4MHV A;  3A0H U;  4OJ5 A;  4PL2 A;  5J8Y A;  2G5I B;  2YMQ A;  4RNO A;  2V4Q A;  4ED6 A;  4F5N A;  5CR0 A;  4O3O A;  1MSW D;  3FDS A;  2N1R A;  3UM9 A;  5KAF U;  3AEV A;  3S6J A;  1X40 A;  2BCQ A;  4F50 A;  3BZC A;  3NGD A;  1ARO P;  2KSO A;  1YT3 A;  1N5X A;  4QZI A;  4DQQ A;  3PW5 A;  3WKD A;  4ED0 A;  3RB6 A;  1ZQI A;  2VA2 A;  3BDP A;  4KLU A;  5DBC A;  3BZK A;  4ACO A;  5AIC A;  1SXE A;  3NRW A;  9ICT A;  1XSN A;  3RB4 A;  5CWR A;  5EWE A;  3TQ1 A;  3F5A A;  2H5X A;  1U4B A;  2C2D A;  1RQN A;  4JWN A;  4UAZ A;  4IC9 A;  2LYB A;  3OHA A;  3EYZ A;  3RBE A;  3ISD A;  2HHT A;  5J0S A;  4Q8F A;  5J0T A;  4FZM A;  2DKZ A;  1L8L A;  4PHD A;  4ECY A;  2A1J B;  2HVH A;  1DGS A;  1OUQ A;  5KFF A;  8ICV A;  4KLL A;  2IHN A;  3AM9 A;  3IRU A;  2QB0 A;  4DFP A;  3RB0 A;  1D8Y A;  1ZQH A;  2XY5 A;  8ICW A;  2KNJ A;  3LVV A;  5J29 A;  1D9D A;  3PO5 A;  3KFU F;  3V7L A;  4DF4 A;  2VJ4 A;  3PVX A;  2JGA A;  3EWA A;  3Q8Q B;  5J0W A;  4QWE A;  2W3S A;  2W04 A;  1S76 D;  4I28 A;  3ZI4 A;  1NJZ A;  4QWB A;  2LM4 A;  1ZQX A;  2CPR A;  4O3N A;  1SKW A;  1SV4 A;  1F0M A;  4B9T A;  2BQ3 A;  3H0L B;  4M2Y A;  4P2H A;  2R8J A;  2G08 A;  4ZOH C;  1Z19 A;  1URJ A;  2FPK A;  5KFM A;  4ED2 A;  4UB8 U;  5AI4 A;  3PW0 A;  3WKC A;  9ICA A;  2A3V A;  1O03 A;  5DDM A;  2BCS A;  5AKY A;  2JMG A;  4OJ6 A;  5KT5 A;  2LHT A;  2W55 A;  4B9V A;  2KMD A;  4KLI A;  8ICG A;  5KFL A;  4RQ2 A;  2HOF A;  2IOF A;  1TK0 A;  5ALS A;  4BGD A;  5AKX A;  1FEZ A;  3GIJ A;  2ZTD A;  2OH2 A;  1ZQG A;  2CRX A;  1Z3E B;  1L7O A;  1ZRN A;  2GWS A;  2KJ5 A;  3TAN A;  3QX7 A;  2YX8 A;  2ZIU B;  2J6T A;  2AHO B;  1ZQM A;  1FO4 A;  3E58 A;  3F2D A;  1YZ6 A;  2ZIV A;  2G0A A;  3QU5 A;  4YMO A;  4NLN A;  4F4W A;  1WG8 A;  2ZUC A;  5KG2 A;  4PGQ A;  3QEA Z;  1KQQ A;  1NOM A;  2JZB A;  3KTQ A;  1UQV A;  2ZUB A;  1XNS A;  3WKE A;  4DFD A;  4QZF A;  4I2D A;  1ZJM A;  5ALX A;  2MU2 A;  3MAB A;  3IG8 A;  5BOL A;  3K1Z A;  1KBU A;  4EZ6 A;  1KL9 A;  4KTQ A;  1TAQ A;  4UB2 A;  1FFU A;  2NRV A;  3THV A;  8ICP A;  3V6K A;  3GQC A;  2ZIV B;  1SL1 A;  1BNP A;  4RQ1 A;  3K4G A;  3C1Y A;  2WF8 A;  4RUA A;  2ZG6 A;  4QW9 A;  3PR4 A;  7ICH A;  3TKA A;  1TVA A;  2I6X A;  3CP8 A;  4C4S A;  1L8O A;  2WB1 C;  1XU4 A;  1Q3V A;  4I2A A;  4CE6 A;  3SV4 A;  4Y2Q A;  3N97 B;  5CHG A;  2I5H A;  1ZQ1 C;  2W8L A;  4JV1 A;  1ZD3 A;  4J9O A;  4Z6F A;  8ICA A;  1N5W A;  5KFA A;  3KKA A;  4YXJ A;  3QZ8 A;  3LWL A;  1QQ7 A;  4JK1 A;  5FP0 A;  5KFU A;  1NI3 A;  1UT8 A;  3KHG A;  3FC4 A;  3M8S A;  1NKC A;  4ED7 A;  1SKS A;  3H8S A;  1YZ7 A;  4IL6 U;  3SD7 A;  3WK4 A;  2XVT A;  4G9B A;  4QZC A;  3TAD A;  4CGZ A;  3JPS A;  3EPG A;  4JWM A;  2PI5 A;  3E0F A;  4J9Q A;  2XID A;  1LVH A;  1SV0 A;  3HJE A;  2W8K A;  4UBC A;  4ECT A;  1Z4O A;  1ZJN A;  4KN4 A;  5KFH A;  4OJP A;  2XIC A;  3JPN A;  2I9G A;  3QNM A;  2R8H A;  1D8B A;  5ALG A;  3QU9 A;  4M9L A;  3QUB A;  9ICO A;  2K4E A;  5CEH A;  4PZN A;  5J8Y C;  5L1L A;  3ZD9 A;  2R18 A;  5KT6 A;  5BPC A;  4M47 A;  3TAQ A;  5ALW A;  2ZIW A;  4Y2V A;  2HBM A;  4Y2Y A;  4KN7 A;  1KKX A;  1VJ5 A;  1WWV A;  3BQ1 A;  3G6V A;  4PGX A;  1PVQ A;  2RQ5 A;  4ZH4 A;  2KK0 A;  1NK0 A;  2M9N A;  4P4M A;  5L1J A;  8ICY A;  4LZD A;  5JUM A;  4KLH A;  3AQF A;  1S9F A;  4FS1 A;  1T3N A;  4NM2 A;  4KLM A;  5E79 U;  4YR2 A;  4F4Y A;  1Z4N A;  4MEX A;  1XWL A;  3F53 A;  3SMV A;  4CDG A;  1CUK A;  2Y0S F;  1AQ6 A;  1JXL A;  3AU6 A;  5ALN A;  1NJY A;  1TV9 A;  2QKQ A;  4F4X A;  8ICN A;  2GO7 A;  5J2I A;  1WCN A;  1MA7 A;  2H3Q A;  2JH1 A;  4DSE A;  2G06 A;  2RP5 A;  3IP4 B;  5ALV A;  1DK3 A;  4NXZ A;  5JU5 A;  5KFN A;  3M9M B;  3GV5 B;  2HHQ A;  3KHL A;  3G6Y A;  3ETL A;  2HHV A;  2V4R A;  2IBK A;  2OEH A;  5DLG A;  1JRP A;  3KHH A;  2XGQ A;  2KJ9 A;  2WTF A;  1BGX T;  2LMR A;  1ZQA A;  2YQE A;  4QIW C;  4B6J A;  2F8K A;  7ICO A;  1HJP A;  3RJJ A;  1N62 A;  3WK7 A;  3PSI A;  3V72 A;  9ICN A;  4J9P A;  4TQR A;  3ZDC A;  2FLL A;  4UB1 A;  2BPC A;  1V9P A;  5L1M A;  4Z6C A;  3QE9 Y;  2KJ8 A;  5AKG A;  3SAG A;  3M9O B;  5ALY A;  1ZOL A;  2E5S A;  5KTQ A;  2MAX A;  5AK3 A;  5ALU A;  5KFS A;  5DB9 A;  2G07 A;  4O0I A;  5KFR A;  4Y2T A;  3GDX A;  3DDH A;  4MF2 A;  4F93 B;  2ZXH A;  4O3M A;  2KIV A;  4RQ5 A;  1XO0 A;  1UA0 A;  2AGP A;  4UB4 A;  2HCF A;  5J0R A;  5DG8 A;  3MR3 A;  3B9J A;  1NKB A;  2DBY A;  5AK6 A;  1NZB A;  3T5K A;  2AJQ A;  1ZRM A;  1S0O A;  1WYG A;  3VCB A;  4ICA A;  5KFD A;  1KFD A;  1QSY A;  1DXS A;  4EZ9 A;  2F3N A;  2WAQ C;  2F76 X;  2EAP A;  4O9M A;  3PNC A;  1QLN A;  2UVW A;  4BWM A;  3ONN A;  4UBB A;  2JR5 A;  5ALJ A;  9ICQ A;  7ICM A;  2V9W A;  5CP2 A;  1TAU A;  4KMO B;  3NTU A;  1ZQQ A;  8ICB A;  3IDW A;  1KRP A;  1WCL A;  2BQR A;  1U47 A;  1H38 A;  5L1I A;  1RYS A;  2HOI A;  4YP3 A;  2P6U A;  4DQS A;  3T5J A;  4AP9 A;  4MFC A;  5III A;  5KFW A;  3EZ5 A;  1XC9 A;  7ICT A;  4YCX A;  3TFR A;  1X9W A;  4NL9 C;  2HHW A;  1HEK A;  4US8 A;  5DDY A;  2LM1 A;  1BPD A;  2Y9U A;  3IHQ B;  3NVW A;  5K4L A;  2QAR A;  2C22 A;  4FZN A;  2E8O A;  2WFA A;  3QUT A;  1T94 A;  2XGP A;  2NRT A;  4DSK A;  3D2S A;  5AKL A;  1BNO A;  4IRC A;  3ZDD A;  2JV3 A;  3RF9 A;  3LVW A;  9ICW A;  4LJX A;  1XSP A;  1PK1 A;  4DQP A;  1XSL A;  4DOC A;  5D4B A;  2H3V A;  8ICH A;  4C4T A;  3GIL A;  4GC7 A;  7ICU A;  5T14 A;  4JV2 A;  4FS2 A;  4NLG A;  1J2M A;  3GU3 A;  5KG6 A;  5KFJ A;  3SAF A;  3UQ0 A;  3TAD C;  2DF4 B;  5J2A A;  4U7C A;  4NWI A;  2KKP A;  3PX0 A;  2KIW A;  4OD0 A;  3C21 A;  1NZP A;  2GLE A;  3GZF A;  3HP6 A;  3UQ2 A;  1PK1 B;  4F92 B;  3RBD A;  5H2F U;  4QJF B;  1RXW A;  3IV6 A;  4RU9 A;  4FE3 A;  3FAH A;  5KG0 A;  4PH5 A;  5C5J A;  5J2B A;  1P7D A;  2EZZ A;  5AK4 A;  2F1I A;  1RYU A;  1ZQV A;  1QSL A;  3UXP A;  2YMM A;  1BPX A;  3ZDA A;  4O3R A;  4OCZ A;  2O6K A;  3AMZ A;  5GTH U;  3OSP A;  5DBB A;  3KD3 A;  1PVR A;  2A1J A;  5KFC A;  4UAW A;  2XCA A;  3H8M A;  5J2K A;  1QCK A;  1SL0 A;  4M0A A;  3PST A;  1S0N A;  3K1R B;  2KD1 A;  4RPY A;  5TZV A;  4MFF A;  3V6H A;  5ALM A;  4BWJ A;  2XO7 A;  7ICQ A;  3QUC A;  2I1Q A;  3R9K A;  1QTM A;  1Q3U A;  4J9K A;  1UCV A;  5KFV A;  2EZX A;  1XS9 D;  8ICZ A;  5KT7 A;  4P4O A;  4ELU A;  4A8E A;  2W03 A;  1L3V A;  4ECZ A;  1L3T A;  5DB7 A;  3I1Y A;  1LB2 B;  2KN7 A;  4LZG A;  5J0Y A;  2FLP A;  2ZJ8 A;  4QZB A;  4B9N A;  3WK6 A;  2KVC A;  3PW2 A;  3U26 A;  1SIJ A;  1RYR A;  3N7S C;  4O3S A;  3KZI U;  2ZUD A;  2RHF A;  4DL6 A;  2K89 A;  1QH9 A;  1B0X A;  2NO4 A;  1IG6 A;  5KFX A;  5AKH A;  4U6P A;  2VA8 A;  5AIB A;  5G5G A;  4C7Y A;  5AI6 A;  1ED1 A;  3I28 A;  2KHQ A;  3QU7 A;  4NLC A;  5ALR A;  4DSL A;  5HR6 A;  2BPG A;  3ZD8 A;  4DO9 A;  4CNQ A;  9ICK A;  2AQ4 A;  2RDJ A;  3EUB 2;  3FM9 A;  4QZ8 A;  4I2F A;  2NV3 A;  4TQS A;  2ZIU A;  3HW8 A;  4GXI A;  3TAP A;  2PFO A;  7ICP A;  5A0L A;  3H0M B;  2HHU A;  3IG5 A;  4YXM A;  4NY8 A;  4DS5 A;  4PPX A;  4BX9 C;  4J9N A;  4IQV A;  2YMP A;  1L7N A;  2DFL A;  5KG4 A;  2NYV A;  4DFM A;  4DQR A;  2W7O A;  4J03 A;  1HIW A;  3L5K A;  8ICI A;  3T5H A;  5ALT A;  1DOQ A;  1X9X A;  2YB4 A;  3TAR A;  4F5P A;  4YVZ A;  3C1Z A;  4YQW A;  3MDA A;  1S5L U;  4O3P A;  2MSN A;  3F5E A;  1SZH A;  1NK5 A;  1C20 A;  3GFK B;  5AI9 A;  5KG3 A;  5CJ7 A;  4P0Q A;  5DLF A;  2HW3 A;  4F91 B;  3GII A;  2PXI A;  2BHN A;  8ICE A;  4I27 A;  2H3I A;  3PMN A;  3OGU A;  4YG2 A;  3OJS A;  4F4K A;  1NK6 A;  2D3D A;  2F8L A;  3PSP A;  4BUG A;  2LYA A;  3C2M A;  2R8K A;  5J2H A;  3QU4 A;  4PGY A;  3SI8 A;  3M9N B;  4QZA A;  2ZXI A;  3NRZ A;  4IS7 A;  3CRX A;  2YTU A;  4CF3 A;  4R63 A;  2M0N A;  2IA6 A;  1LV5 A;  4DSF A;  9ICM A;  4KLQ A;  4YMN A;  4QZD A;  1X42 A;  1TKD A;  4P0Q B;  4CRX A;  3KOO A;  4NL9 A;  3H4D A;  4Q8E A;  4XA5 A;  2OM6 A;  3D2Q A;  4JB3 A;  2HBL A;  5ALQ A;  4KLS A;  3BQT A;  3SV3 A;  4IQT A;  3RR7 A;  5ALK A;  4UAU A;  4QZH A;  2W9B A;  5HHI A;  4YN4 A;  3MGH A;  1A76 A;  2YN4 A;  7ICV A;  1KSP A;  3CYM A;  5AI8 A;  5AK5 A;  5ALZ A;  4KX5 A;  2OXO A;  4DL3 A;  5ALP A;  1PVP A;  2W9A A;  8ICF A;  1X2I A;  1TK5 A;  3I76 A;  1S77 D;  2CXY A;  5KFZ A;  1ZQR A;  5B5E U;  2WF6 A;  5IIO A;  3PY8 A;  4DL2 A;  1UA1 A;  4GXK A;  3JPT A;  4ED8 A;  1RG6 A;  2PKE A;  3KZX A;  2W9B B;  4DSI A;  2PMZ F;  4B9S A;  4NM1 A;  1N56 A;  3SYZ A;  1MN8 A;  1T7P A;  4F72 A;  4I2J A;  4HAI A;  3DV9 A;  1TK8 A;  4M04 A;  5KAI U;  1MQ2 A;  3UXO A;  2Y1I A;  3L4P A;  4DL7 A;  4I29 A;  1Z1B A;  4DFK A;  4QWA A;  2LBO A;  4RQ0 A;  5EOZ A;  4KMU A;  4R65 A;  1NK4 A;  4FBT A;  2C2E A;  2PFP A;  2C2R A;  2WF9 A;  3HKZ F;  5J2G A;  4R8U B;  2FMP A;  5J0U A;  3NVZ A;  1LKY B;  1JN3 A;  3RB3 A;  3RAQ A;  3OTQ A;  4QZE A;  4X5V A;  3GV8 B;  4Q43 A;  1SWV A;  1IIP A;  2A1A A;  4GIB A;  7ICF A;  4FZL A;  4UB5 A;  3HT3 A;  3WK8 A;  3OPX A;  4UAV A;  4Y2S A;  5DQI A;  2HMX A;  5G5H A;  4J9S A;  4M6W B;  5IIL A;  4M9G A;  3MR2 A;  3GIK A;  2E8N A;  3L3F X;  2MUT A;  4QNL A;  3V7J A;  1ZQT A;  4XQ8 A;  3RJF A;  4CF5 A;  2KG5 A;  7ICR A;  1RQL A;  4F5Q A;  4M9J A;  2KEY A;  5HMM A;  1V85 A;  1U48 A;  3C29 A;  3SQI A;  5C0Y A;  2LKY A;  1SL2 A;  1M6Y A;  4RT3 A;  3V7K A;  3MBY A;  5JTI A;  3BS5 B;  2JEJ A;  3FYH A;  4RQ4 A;  2JEI A;  1IM4 A;  5ALD A;  2ZTC A;  2MUT B;  2UVV A;  2FDR A;  3WK9 A;  4KX3 A;  4R64 A;  2HHX A;  4UB3 A;  8ICO A;  1V38 A;  3ALR A;  3F2B A;  9ICC A;  7ICL A;  2K4H A;  2UVR A;  2HI0 A;  4NJ8 A;  2PMZ C;  2KTQ A;  4F2R A;  3EW9 A;  1A77 A;  2W3R A;  2ZJA A;  2HVI A;  2NRW A;  4PZO A;  4ED3 A;  2NRZ A;  3ED5 A;  5AHX A;  8ICM A;  5CRX A;  2KZ3 A;  4RNN A;  1B43 A;  1JI7 A;  3HRD D;  3F2C A;  4ECV A;  3HPO A;  4UAR A;  4B9M A;  3TAC B;  3UMG A;  1V97 A;  4C0Z A;  8ICX A;  5EE0 A;  1B4F A;  7ICK A;  1FFV A;  5KG7 A;  1DGJ A;  5EE9 A;  3V6J A;  3IM1 A;  2NRX A;  9ICV A;  4DQI A;  2EH9 A;  4EBE A;  4KLF A;  1OXJ A;  4QWC A;  5AKZ A;  5ALH A;  4GC6 A;  4GXJ A;  2F1H A;  5ALE A;  1ZQK A;  2VIX A;  5ALO A;  4UW9 A;  8ICT A;  1CRX A;  3PR5 B;  2W43 A;  4IRD A;  3AUO A;  2K8A A;  2VKQ A;  2AGO A;  9ICI A;  2MRL A;  5F3X B;  2Y0S C;  1Z00 B;  1ECW A;  2XC9 A;  1UHU A;  2GH1 A;  1JX4 A;  4C8L A;  1COK A;  4AYB F;  5F9N A;  1X9M A;  1K1Q A;  1NNL A;  2W9C A;  4Z6E A;  1QSS A;  4RZR A;  4IQW A;  2JH7 A;  4EEY A;  2R8G A;  4B9L A;  1RZT A;  5EWG A;  3Q8K A;  1C7Y A;  4I2C A;  3PZP A;  4EYI B;  4MFA A;  3BQ2 A;  3MC1 A;  3N28 A;  5IIN A;  4BJQ A;  4Y2P A;  1T4G A;  4QZG A;  2KZM A;  2EAN A;  7ICJ A;  1IXR A;  5JRT A;  4OJL A;  3OHB A;  5AKJ A;  5KFP A;  3UMC A;  5BOM A;  4C8K A;  2FMS A;  2ALZ A;  3ISC A;  2W9C B;  3LDA A;  3N4M B;  1RDF A;  4DS4 A;  2B0C A;  4RUC A;  2HBJ A;  4DF8 A;  2KVS A;  1BPE A;  4RNM A;  2L5Y A;  1JMS A;  9ICF A;  1IV8 A;  4QWD A;  8ICU A;  4F8R A;  3ISB A;  1ZQF A;  5AKK A;  2AU0 A;  2Q0Z X;  1N48 A;  1ZD4 A;  4TUQ A;  4EEK A;  4F4Z A;  2P6R A;  4Y2X A;  2YY6 A;  5KFY A;  1KFT A;  2BCU A;  3RH4 A;  3C5F A;  4QZ9 A;  1ZQD A;  4J9L A;  4US9 A;  1O08 A;  2ASJ A;  4C8N A;  5KFO A;  2AGQ A;  3PML A;  3SR6 A;  4R66 A;  5DQG A;  5DB6 A;  4DLG A;  5CB1 A;  2Y1J A;  4YMM A;  4IRK A;  5J2D A;  4PHP A;  3HIL A;  4EYH B;  4XRH A;  2HSZ A;  2BR0 A;  1Q8K A;  7ICE A;  3KHR A;  3ETR A;  2BZF A;  4MF8 A;  3RTV A;  5L1K A;  2W7P A;  4O5K A;  3CNH A;  1GO3 F;  4KLO A;  4IR1 A;  3UXN A;  4JV0 A;  2LI6 A;  2PFQ A;  1N63 A;  2FE9 A;  3RJG A;  2BDU A;  1SGG A;  4QW8 A;  5DKW A;  3NUQ A;  4EBC A;  2FMQ A;  2E1E A;  4AYB C;  5AKE A;  4I2H A;  3CW2 C;  2VJ5 A;  1VDV A;  1WUD A;  4NLZ A;  5KFE A;  1MQ3 A;  4RQM A;  5KNI A;  4NLB A;  9ICX A;  1EXN A;  3MR5 A;  2ODG A;  3OJU A;  5J0Q A;  3MGI A;  1ZD2 P;  2A19 A;  1ZQU A;  4NLK A;  2WF7 A;  1CEZ A;  1OW5 A;  3NS1 A;  2EDU A;  4G3I A;  2J6U A;  5EE1 A;  4GLX A;  1TE2 A;  4DCC A;  2G5H B;  8ICC A;  2KIC A;  4I2I A;  2ZTE A;  1N61 A;  4DLE A;  5ALL A;  2LPE A;  2KSO B;  5KT3 A;  2OHF A;  4EEN A;  1SWW A;  2JHD A;  2W9M A;  1F44 A;  2JEG A;  2GOL A;  1S8O A;  2F2A B;  2ASD A;  4YD2 A;  3Q8S B;  2H3Z A;  2BCR A;  3T79 A;  2Q4T A;  3RJI A;  4KLJ A;  4Y2U A;  4UAS A;  4YFK A;  2H3F A;  4DOB A;  2WB1 F;  2EZY A;  1JRO A;  2UVU A;  4I2B A;  3M6Z A;  1ZQN A;  1BPB A;  5HML A;  4EBD A;  2QLT A;  5F9L A;  5KFG A;  1BPY A;  3LK9 A;  4JUZ A;  4B9U A;  4UAT A;  1ZET A;  1N60 A;  3M7D A;  1D8L A;  5EWF A;  1RM6 C;  1COO A;  3C2K A;  4C8M A;  4CF4 A;  4DFJ A;  3C5G A;  5J2J A;  2ISO A;  3AU2 A;  3B0Y A;  2BKE A;  2QB0 B;  9ICE A;  1ZQJ A;  2XCP A;  4Q45 A;  4DOA A;  4C4R A;  1A6S A;  2AXT U;  4BXO A;  3PV8 A;  5KL8 B;  4TUP A;  1ZYQ A;  5D49 A;  2KKV A;  2XI9 A;  4ELV A;  4FBU A;  1L3U A;  3J81 j;  1ZQB A;  5DGB A;  4C7Z A;  1T3Q A;  2E3T A;  3RH6 A;  2KFN A;  3RRG A;  2G09 A;  4P4P A;  9ICL A;  2IOF K;  2LYH A;  1XO1 A;  1NJX A;  4RPZ A;  2ISP A;  5DB8 A;  2DKX A;  4ECU A;  3AQE A;  3NVV A;  2OYY A;  1KFS A;  1FIQ A;  5AM3 A;  1KLN A;  2B6G A;  4BXO B;  9ICJ A;  2NO5 A;  5B66 U;  1L5U A;  1PZN A;  3ICX A;  2OCE A;  2BQU A;  4IQU A;  2D8C A;  3M1Y A;  2FJ6 A;  3G6X A;  3H40 A;  9ICP A;  2DPJ A;  5AM4 A;  4K4I A;  3TFS A;  4C8O A;  3NAS A;  4E0D A;  4TUS A;  4F2S A;  1J2N A;  2BDP A;  5J0P A;  2RDI A;  3JPO A;  2EQY A;  3RRH A;  2W54 A;  2J6S A;  5EE3 A;  2DGZ A;  9ICU A;  1Y88 A;  1ZQL A;  5J0O A;  2ZIX A;  3BS7 A;  5ALI A;  1SB3 C;  2DPI A;  1L6N A;  3N7P D;  3JPQ A;  4UAY A;  1ZXI A;  2W11 A;  5KFK A;  4M9H A;  2ASL A;  9ICR A;  2HHS A;  2JZB B;  2F77 X;  4RT2 A;  4TUR A;  1KW4 A;  1DRG A;  2K8C B;  4YD1 A;  4C80 A;  4KLD A;  4Y2J A;  4FFD A;  1DK2 A;  1K1S A;  3SZ2 A;  2KFZ A;  4JMU A;  1KEJ A;  4NV0 A;  1KN5 A;  4R8U A;  1LKY A;  5DQH A;  1T8E A;  1UPH A;  3WKB A;  3GIM A;  4OO1 J;  4PJ0 U;  2PI4 A;  2ZIX B;  5KG5 A;  4KLT A;  5IIM A;  5KT2 A;  1JUD A;  3HWT A;  3SEI A;  1TFR A;  4QIW F;  1HUZ A;  4Y2R A;  5AI5 A;  1JXE A;  2E1F A;  2F44 A;  3JPR A; 
#chains in the Genus database with same CATH homology
 2ES6 A;  1OW5 A;  2KSO A;  2L5Y A;  2GLE A;  2EAP A;  2K60 A;  2QKQ A;  3KKA A;  3SEN A;  1X66 A;  2DKX A;  3TAC B;  1PK1 B;  2KMD A;  2LPE A;  2KSO B;  2B6G A;  1B4F A;  5JU5 A;  2E8N A;  1SXE A;  3TAD A;  3IDW A;  2D8C A;  2KE7 A;  1WWU A;  1OXJ A;  2Y9T A;  2KG5 A;  1SV0 A;  2K4P A;  1V85 A;  2LMR A;  3HIL A;  2F8K A;  3H8M A;  2E8M A;  2EAM A;  3BS5 A;  2DKZ A;  3K1R B;  1PK3 A;  1RG6 A;  5F3X B;  4NL9 C;  1X9X A;  3BS7 A;  1UQV A;  5JTI A;  3BS5 B;  2Y9U A;  2QAR A;  1UCV A;  3KKA C;  1COK A;  2E8O A;  2QB0 A;  4PZN A;  5J8Y C;  5L1M A;  2DL0 A;  2QAR B;  1KW4 A;  2JV3 A;  2FE9 A;  2QB1 A;  2QB0 B;  1V38 A;  1DXS A;  1SGG A;  1WWV A;  1Z1V A;  4NJ8 A;  2D3D A;  1PK1 A;  1LKY A;  1SV4 A;  1F0M A;  1SV0 C;  4PZO A;  4MHV A;  2E8P A;  4RQN A;  2KIV A;  2ESE A;  4IS7 A;  1B0X A;  5J8Y A;  1LKY B;  2EAN A;  2YTU A;  4RQM A;  3BQ7 A;  5KNI A;  5JRT A;  3SEI A;  3TAD C;  1JI7 A;  2F44 A;  1X40 A;  1SXD A;  2EAO A;  4NL9 A;  2F3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...