2KE7A

Nmr structure of the first sam domain from aida1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
QTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ankyrin repeat and sterile alpha motif domain-containing pro
publication title NMR structure of the first SAM domain from AIDA1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ke7A00
1SV4A 1Z1VA 2QB0B 2FE9A 4IS7A 4PZNA 2E8OA 3KKAC 2DKZA 1KW4A 4RQMA 2EANA 5J8YC 2D8CA 2YTUA 1OXJA 3IDWA 4MHVA 2E8MA 2ESEA 2QB1A 1UQVA 3K1RB 5JRTA 5J8YA 1COKA 5L1MA 2KSOB 1RG6A 2EAMA 4PZOA 3SEIA 5F3XB 2JV3A 3BS7A 2QB0A 2Y9UA 2KG5A 2DKXA 1PK3A 2K60A 3TADC 5JTIA 3BS5B 2LMRA 2EAOA 1SV0C 3TADA 2KSOA 2QARB 2B6GA 2LPEA 1V38A 1OW5A 1SV0A 2DL0A 1B4FA 1B0XA 3H8MA 2GLEA 2KMDA 2L5YA 1PK1B 2ES6A 3BS5A 1JI7A 1WWVA 2EAPA 1DXSA 4NL9C 1F0MA 3BQ7A 2QARA 1WWUA 2KE7A 1SGGA 3TACB 1LKYB 2KIVA 2E8PA 4NL9A 1SXDA 4NJ8A 1X66A 3SENA 2F8KA 3HILA 4RQNA 2D3DA 2QKQA 1V85A 2F44A 2K4PA 1PK1A 5KNIA 3KKAA 2E8NA 2F3NA 1SXEA 1X40A 2Y9TA 5JU5A 1UCVA 1LKYA 1X9XA
chains in the Genus database with same CATH superfamily
2E5SA 2RHFA 4QZEA 1L3VA 3IV6A 3RR7A 2ASLA 3C2KA 4C8LA 2Y1IA 4MHVA 5DKWA 1D8LA 2R8KA 5ALEA 2R18A 5DLFA 9ICQA 2KSOB 4P2HA 3E2EA 3TFRA 4ZOHC 3M9NB 5IIMA 1DK2A 3L3FX 4MF2A 1NK9A 1NI3A 4F5PA 1DRGA 1Q46A 4UAVA 3Q8PB 1QLNA 2KD1A 3TADC 4FZNA 5JTIA 2ZXHA 2KZMA 1BGXT 3OJUA 4JUZA 4IQTA 1ZXIA 2VJ4A 2ZXIA 5J29A 4LZGA 1T94A 3T5JA 1HUZA 4O5EA 1N5XA 4DEZA 3SMVA 1LV5A 1JN3A 3UXPA 3PSPA 5CP2A 2KEYA 4R8UB 2FI1A 1S97A 2E3TA 3A0HU 4FE3A 2FMSA 1ZQIA 9ICXA 1RYRA 3UPQA 1Z1BA 2NRVA 3THVA 2XGPA 2E1FA 3IG8A 1S5LU 4RT2A 4DSEA 5B5EU 5J0WA 2HW3A 2E8PA 4NL9A 1ZRMA 3D6JA 3M8SA 1KDHA 9ICFA 2F8KA 5KG0A 4RNOA 3KZXA 1ZQTA 5F9NA 5J2HA 1T8EA 4EYIB 2V9WA 2F1IA 4UARA 2IBKA 2I5HA 4IC9A 1ZQAA 1U48A 4J9OA 3H0RB 5ALVA 3RJIA 4ELTA 7ICFA 3LDAA 4AP9A 1ZQBA 1S77D 1OXJA 1ZQNA 4RQ2A 8ICYA 4NLZA 4QWBA 1TKDA 5AM5A 2NRXA 5AKGA 4NWIA 2BCUA 7ICVA 5DB6A 2MA1A 3C5GA 3DV9A 4OJ5A 1XSLA 3WK7A 3PX6A 4UAWA 2HDOA 3EW9A 3S6JA 4FO6A 1A77A 3H0LB 2NV3A 4OJPA 2LMRA 4BGDA 3ED5A 1RDFA 5J0XA 4RQ0A 1SZPA 7ICJA 8ICMA 2IOFK 3V7LA 8ICTA 2KJ8A 4TUQA 5G5GA 2B6GA 4C80A 4JMUA 5IIOA 4RQ6A 2HHUA 2PMZC 3NVYA 4UB3A 4C4RA 5J0SA 4HYKA 1L3TA 2KZZA 1N63A 3RJJA 2ZTEA 5KG3A 2LBOA 2W55A 1QQ5A 3T79A 5IILA 2QARA 3GZFA 4R65A 2PFOA 3WK6A 1L7MA 4PHDA 3TANA 3OPXA 4YXJA 1SXDA 4KMUA 3MGIA 4NV0A 1KLNA 4U7CA 1HUOA 4TUPA 1L3UA 2A19A 4QZHA 1SWVA 3TFSA 3Q8MA 1C7YA 3N7PD 5T14A 2F3NA 5C5JA 2AQ0A 4UB6U 5DB8A 5KFJA 2EZYA 3QEAZ 5BPCA 1X6IA 3AL0B 1TK5A 4QZBA 3HKZF 4RQMA 1ZQKA 3LYSA 2FLLA 3OJSA 4O3PA 4P0PB 2JHDA 3JPRA 4TUSA 1Q8KA 3NVZA 4DSLA 5ALTA 5J2FA 1RG6A 1DGSA 3NRZA 5HHIA 3QU7A 4XQ8A 2W9BB 4F2RA 4WJ3B 1RPLA 3SD7A 1T3QA 2WF6A 5HMMA 4C4SA 3RAQA 4JK1A 4PGQA 3N7SC 5EE9A 4EEKA 5AKKA 2ZIXA 1SV0C 5AKLA 3VCBA 2YB4A 4FZLA 5AI5A 3M9MB 1UHUA 5ALIA 4Z6FA 2PXIA 4P4PA 1ECWA 4NM1A 4O3MA 4IQUA 5ALYA 4B9NA 3QXGA 1S0MA 3PVXA 4A8EA 4R66A 3EWAA 5ALNA 5GTHU 4FS1A 8ICEA 1JI7A 3RJEA 4J9SA 3V6JA 4NLNA 3LWMA 2LYBA 2OYYA 4US8A 1X9WA 1SGGA 4KLEA 2ZIUA 5HHHA 3RJKA 4YMOA 4ZH4A 5KFSA 3LVVA 4BX9C 2HHXA 4P4OA 1FIQA 1RYUA 3HILA 1DOQA 3PSIA 4F93B 4DQIA 2JEGA 1ZQRA 3KOOA 3H0MB 2GWSA 2CRXA 5AKXA 3MGVA 3T3FA 4M9NA 5CRXA 3L5KA 3UXNA 4PJ0U 5J0QA 5ALHA 2K8CB 2VKQA 3C2LA 3H8JA 2DKZA 3TARA 1N5WA 2G09A 4J9RA 2OM6A 4PHEA 3GIIA 4RT3A 4EX7A 3MGHA 1KFDA 1C20A 2HBLA 3FM9A 3CP8A 3V6KA 3SEIA 3BS7A 5AM2A 2DFLA 1NZBA 3V72A 2BHNA 4QZIA 3F2BA 1Z00A 4F4XA 3TAPA 4BWMA 3Q8RB 4DFPA 4YD2A 5KFOA 4LJXA 2KFZA 2HBMA 3FC4A 5IIJA 4KLDA 1L3SA 8ICLA 4ECVA 3AQEA 9ICPA 5J2AA 8ICWA 2MU2A 4EZ9A 4TQSA 1B4FA 4YXMA 4UAZA 4Q8FA 1D8BA 2GLEA 4ICAA 2FLPA 1BPYA 2JZBA 2W54A 4KLQA 2HBKA 5DGBA 1UT5A 5KT4A 1S76D 4KLHA 5AKZA 2K89A 1TE2A 4NL9C 2K4HA 1O08A 3KHGA 5KFBA 8ICFA 2HBJA 4DL4A 3V6HA 4PGYA 5KAFU 4QJFB 1X66A 5DBBA 3CRXA 4RNNA 2KZ3A 3AN1A 4MEXA 1RZTA 2DGZA 2ZJAA 1KL9A 5J0UA 5ALQA 1ZJNA 2HVIA 1EXNA 2YN4A 1SIJA 2C2RA 3GILA 1VJ5A 4FBUA 1ZQSA 3K4GA 5J2EA 2XCPA 1L8OA 5IIIA 1BPEA 4P0QA 4DOAA 3KHRA 5HMLA 1QSSA 4JV2A 1ZQVA 2ESEA 9ICIA 5AI8A 2PFPA 2JEIA 5ALUA 2EQYA 3A0BU 3R9KA 4DOBA 4O3OA 2BPCA 1T4GA 1IM4A 3SV3A 2YB1A 9ICNA 5BOMA 4G3IA 3AM9A 2Y9UA 4YR2A 4J9NA 1NNLA 3ETLA 3H7IA 8ICNA 1Z00B 1URJA 9ICTA 5J2BA 4I2EA 3TI0A 2KSOA 1F44A 3WK5A 2BCQA 3F5AA 2DQNB 1OW5A 5D4BA 2Z7JA 3PW0A 1DGJA 3RJFA 2H3QA 5KTQA 2XY7A 5CA7A 1PK1B 1SZHA 5AM3A 2YMPA 2JZBB 3F5EA 1U9LA 2GO7A 3WKBA 5DB9A 1WCNA 5CR0A 5KFQA 3KHHA 1NOMA 2VA8A 4CF4A 3IM1A 1S0NA 9ICWA 2M9NA 4B9UA 1TAQA 2D3DA 3JPPA 4QZ8A 4KTQA 5KFKA 3AMZA 2CXYA 4I2GA 5KL1B 4R8UA 1ZYQA 2F1JA 3PSTA 1BPDA 3ICXA 2YX8A 2RDJA 9ICEA 4I2HA 1JXLA 4NLGA 3IP4B 5ALKA 5AK4A 2MUTB 4C4TA 3PX4A 3IG5A 3QUQA 5AK5A 1JXEA 4YCXA 1Q3UA 1NK0A 1ZQFA 3UQ0A 4F4WA 4G9BA 4DFDA 2DF4B 2QB1A 1YT3A 5KFWA 4GC7A 2Y1JA 2DWQA 1OUQA 4QWAA 4OJ6A 4MFFA 2KJ9A 4EELA 5KFZA 2ASDA 2A1AA 4O9MA 9ICMA 2V4RA 9ICSA 4B6JA 3HKZC 4Y2TA 7ICKA 4DCCA 4OJOA 5B66U 3JPSA 1P7DA 4DL6A 2OWOA 2HCFA 5KFEA 1UPHA 4KLGA 1L6NA 4FS2A 1JROA 1AQ6A 2KFNA 4K4HA 9ICHA 3PO4A 4UB4A 4M9HA 2ZJ5A 1D9FA 4Y2QA 2WAQC 1L7OA 1ZETA 3E58A 2XICA 3EPIA 4K4IA 1NKBA 3NUQA 4UQGA 2BQRA 1BNPA 4Y2RA 1RQLA 3QNMA 1KRPA 2UVVA 1A6SA 2KTQA 5KFNA 4KLMA 1F0MA 2H3FA 2ALZA 4F5RA 1FFUA 4F5OA 3NVVA 2EDUA 5DQIA 5TZVA 2C22A 4NJ8A 2Q0ZX 4KN7A 1NZPA 1CI4A 1TAUA 5KNIA 3EPGA 3RBEA 1X2IA 1QCKA 2Y9TA 3E0FA 5DG8A 1JX4A 5L1LA 3BQTA 4CGZA 3OHAA 2W9AA 4B9SA 3GIMA 2I9GA 2XI9A 2G5IB 2YY6A 1L8LA 2E1EA 1TFRA 2FJ6A 4Z6EA 4ED3A 3SYZA 4YFKA 2AGQA 2BZFA 3BJYA 2DPJA 3MR3A 5DG7A 4DQSA 2XY5A 1B22A 1RM6C 5J2IA 5AI4A 4P0PA 1K1SA 4X5VA 3WKAA 1J97A 2AXTU 2WF5A 2JGAA 4Y2SA 3T5LA 5TISU 3I76A 5F9LA 1KFSA 4F72A 4ED1A 3OSNA 5KFUA 2W9BA 4UBBA 3GV8B 1MC8A 4NM2A 3M1YA 4QZFA 2UVWA 2PI5A 3RJHA 1D8YA 5DQHA 9ICCA 2LYAA 1LKYB 2W7OA 4YN4A 1ZQDA 2C28A 2H3ZA 4ECTA 2JRZA 1V85A 3I1YA 4B9VA 5ALXA 4MF8A 4YP3A 8ICIA 4DL3A 3KKAA 4QWEA 4GXJA 1S8OA 3RTVA 5E79U 2DPIA 4ECZA 2R8HA 2FMPA 3NASA 4GXIA 2VIXA 2YMLA 1FO4A 3AU2A 1JIHA 4LVSA 2B21A 1IIPA 1XS9D 5HP4A 4J9KA 5EWFA 5KL8B 5EOZA 4F2SA 5AI9A 5KFPA 3CYMA 2XY6A 1Z4OA 5ALZA 9ICVA 5CB1A 2D6FC 3KBBA 2RQ5A 3ISCA 2R8GA 3ISBA 1MQ3A 2GOLA 4QZGA 3C2MA 1XWLA 4UB2A 8ICVA 3F53A 1SWWA 3NVWA 8ICSA 3ORYA 4CF3A 4HAIA 9ICLA 2KOBA 8ICOA 2MSNA 3ZI4A 4I2AA 5KFHA 4B9TA 4OD0A 3ZDCA 1WUDA 5J0RA 3M9OB 2L5YA 5ALDA 4I2BA 2K8BB 2WAQF 3MBYA 2H3IA 2VANA 2BGWA 1NKEA 1WWVA 2EAPA 2ZUBA 2JEJA 4UW9A 3GFKB 2W03A 3ETRA 4NXZA 1Z4NA 5KG6A 3QE9Y 1JMSA 2LHTA 3B0YA 3QUBA 4M9JA 2ASJA 1XSNA 4YR0A 2OH2A 2F76X 1PZNA 1XSPA 1U4BA 4RUAA 4DWIA 4J9MA 1BPXA 1UCVA 5KFTA 4M9LA 1MSWD 4PHAA 5AIAA 4QW8A 5L1IA 3ZDDA 2AHOB 2BCSA 1NJZA 5KFIA 2K4EA 3GDXA 2YTUA 3M8RA 2KHVA 3H40A 3M6KA 4IQVA 4UB5A 2F2AB 3JPQA 7ICEA 4ELVA 1ZJMA 2NO5A 5ALGA 3BQ1A 4DSFA 2FLNA 3K1ZA 4DQQA 3RB6A 4GLXA 1RQNA 2W3SA 1QTMA 4USAA 2CPRA 3B0XA 3D2QA 3C5FA 3RJGA 2WF9A 2CN1A 1N48A 4B9LA 1X42A 5KFGA 9ICUA 3PW2A 5DDMA 4C0ZA 1RYSA 2WHEA 1U45A 4OO1J 3L4PA 5ALPA 2XIDA 8ICJA 5L1JA 7ICLA 1L7PA 4IQWA 2AQ4A 3ONNA 5AKYA 2A1JB 4KITB 5J2GA 4NLBA 3PX0A 1TAMA 2W04A 2NYVA 4EBCA 3PY8A 5DBAA 4CDGA 5JUMA 2HHVA 2NO4A 1KSPA 5DB7A 2JH7A 4ECQA 3C1YA 1QH9A 2MRLA 1A76A 1DK3A 2W8LA 4EEYA 7ICIA 4UATA 4O0IA 2C2DA 4BWJA 3FYHA 3QU2A 3PZPA 4F3OA 1ZQHA 1ZQEA 4DSIA 1SKSA 3MR5A 5KFLA 2P6UA 3NRWA 2IHNA 4DLGA 3SV4A 4JV1A 1KBUA 2FDRA 4YMNA 2XGQA 4KLTA 1U49A 2G06A 2KIVA 4KX3A 2AH5A 5CEHA 1NKCA 1SKWA 3QUCA 1S10A 5KFMA 2QKQA 2HOFA 4IRDA 2I1QA 2F44A 5AKIA 3Q8KA 3BQ2A 5KFFA 1PK1A 1WYGA 5KFXA 1SL1A 2HSZA 5ALLA 2NRTA 5DLGA 4RQ8A 1QSYA 3QX7A 4I28A 5J2DA 2J6TA 4IS7A 2NRZA 5ALFA 3N97B 2JMGA 4U6PA 3GIKA 4Y2YA 2ZIVB 3D2NA 4F92B 1K1QA 1UQVA 4UAYA 1KFTA 4YD1A 2KNJA 2J6UA 4DFKA 2IMWP 1KKXA 5CWRA 1JALA 3ZD9A 4CE6A 4YR3A 3H8SA 4QZAA 3RAXA 3BDPA 4FBTA 2MUTA 4RPZA 5AK6A 3PR5B 2KG5A 4LZDA 1KQQA 2KJ5A 4ELUA 8ICAA 3JPNA 3BS5B 4F91B 4RNMA 1XU4A 2EAOA 4RU9A 4DQRA 5EE1A 2OEHA 3PO5A 2F77X 5KG2A 4F4ZA 3V7KA 3KFUF 1VDVA 9ICOA 3K75D 3G6YA 4F71A 1FFVA 4QIWF 3TAQA 1B0XA 2RLTA 1ZQGA 1ZQXA 4J9QA 4KLIA 3BZCA 1CRXA 3UXOA 3C21A 2W9CB 1ZQZA 2KICA 4O3RA 2KIWA 4I2JA 8ICCA 4I2DA 1ZQWA 4PL1A 1X9MA 4RQ3A 3UMGA 4EBEA 3GV7B 5DG9A 4Q45A 4US9A 4RQ5A 5CJ7A 1WG8A 2XVTA 7ICTA 1XNSA 4E0DA 3SR6A 1K5OA 2PFQA 2H3VA 4PPXA 5J2CA 1ZQJA 2A3VA 4C8MA 5KT6A 2AGPA 3ZDAA 4M47A 4DLEA 1WCLA 4EX6A 5AKJA 1IXRA 4M2YA 8ICBA 2RRDA 2QB0B 4ED0A 4MFCA 4BUGA 4DF8A 5AHXA 3KZIU 5ALOA 3SAGA 3QU9A 3HJEA 1CUKA 1ZQUA 4C7ZA 4QZDA 3ZDBA 4DSKA 1Y88A 5J8YA 3LK9A 2JEFA 5KG4A 4CF5A 2LM1A 4B9MA 4M6WB 5D46A 3Q8LA 2BCRA 3MR6A 3EZ5A 8ICUA 2K60A 2KV2A 1N56A 2BKEA 5ALJA 3QU5A 1T3NA 4KMOB 5KT7A 2RDIA 1S0VA 3MFIA 2Q4TA 3RH5A 2YQEA 4ECXA 1TK8A 2DL0A 2P6RA 3AEVA 3Q8SB 2P66A 3RRGA 2JR5A 7ICPA 2G08A 5EE3A 2OXOA 8ICGA 4JV0A 1BPZA 2HOIA 2YMMA 1HIWA 1U47A 1TK0A 4YQWA 1COOA 1NJXA 5D49A 4KLOA 2ZJ8A 2XC9A 3QUTA 2W8KA 5HR7A 9ICRA 5J0OA 1NK8A 5AM4A 4YMMA 2PI4A 5DGAA 4KLJA 3OHBA 3G6XA 3IHQB 2HOQA 2ISOA 3N7RC 3RB0A 1Z3EB 2K4PA 4C8OA 1XO1A 3SI8A 1ZQLA 2R8JA 4QZCA 1LKYA 4DL2A 4EENA 1M6YA 3WKCA 4QW9A 5CHGA 3QZ8A 4DL7A 1KW4A 3B9JA 4IRKA 2JH1A 1L5UA 3D2SA 3PNCA 2OHFA 3JPTA 2LI6A 4KN4A 4AYBC 4PH5A 1SL0A 3Q8QB 3HRDD 4ED8A 2IHMA 3RH6A 5F3XB 2JV3A 3OTQA 3O0FA 4BXOB 4Y2UA 1H38A 1KEJA 5EWGA 3V7JA 1A0PA 4OCZA 4ECWA 1JUDA 4UASA 5IINA 2FPLA 4M04A 3RBDA 3WK4A 2LM4A 3T5KA 1LVHA 3GQCA 2PFNA 3C23A 1IG6A 3WK8A 4Q8EA 2W9MA 3HWTA 5J2JA 7ICRA 2FPKA 2ZIWB 1ZD2P 1NJWA 2XO7A 2HVHA 1HJPA 4FZMA 3N28A 5AKEA 3QU4A 5HNKA 1J2NA 9ICAA 4Y2JA 1MN8A 4I27A 4R63A 2IOFA 4RZRA 3BQ7A 4KLFA 1WWUA 2W43A 2KE7A 4DQPA 4J03A 3TACB 4KLUA 3NTUA 1LB2B 4GXKA 2Y0SF 3F2DA 2WB1F 1F5SA 1ZQYA 5H2FU 5J0PA 3WK9A 2HHQA 3WKDA 3HW8A 2ATLA 3QZ7A 4IL6U 4J9PA 1TV9A 1N60A 2G07A 2UVUA 5KFDA 1BVSA 3LWLA 2BQUA 5DQGA 7ICQA 4TURA 2O6KA 3AQFA 1X6JA 3RR8A 4O3NA 3OSPA 1YZ7A 2WFAA 3H4BA 1UA0A 4DS4A 2E8MA 3IRUA 2RP5A 5KFRA 4BDPA 2LKYA 1ZQQA 4UBCA 5L1MA 2EAMA 2YMQA 2ZG6A 4DL5A 1ZD4A 4GFJA 2BPFA 3FDSA 2V4QA 1NK7A 5G5HA 3RB3A 1XC9A 3M6ZA 7ICSA 7ICMA 1N61A 3M7DA 4F4KA 2FPMA 1X9SA 4CRXA 5AK3A 2C2EA 4P4MA 5FP0A 1AROP 2B0CA 3PR4A 2VA3A 2ISPA 2WF8A 4UAUA 2LPEA 4ED2A 5J0TA 3C1ZA 1MA7A 1V38A 5AKHA 1YZ6A 3UM9A 3EUB2 3KHLA 1QQ6A 5KT2A 4DSJA 2HMXA 4RQ1A 2W11A 3NGDA 9ICJA 4DF4A 7ICHA 5AM1A 3PW5A 2A1JA 2BDPA 1ZQ1C 3RH4A 1GO3F 4QIWC 1N2XA 7ICGA 5GTIU 1NK6A 1VLBA 4NLKA 5KG1A 7ICUA 1PUZA 1PVQA 4I29A 5KT3A 2BDUA 4XUSA 8ICPA 4F5QA 3KTQA 2BR0A 1S9FA 1XO0A 1ZQCA 1SXEA 1PVPA 1ZQOA 3GV5B 2VA2A 5C0YA 5J0YA 4ECYA 1Z1VA 4RQ7A 1NK5A 5DDYA 4C8KA 4IR9A 3PMNA 3NS1A 4EYHB 5J8YC 1PVRA 1MQ2A 2KN7A 4CCHA 3SAHA 3K1RB 2FMQA 4RPXA 8ICKA 1ZQMA 5DBCA 9ICGA 2G0AA 4ECUA 1QQ7A 2ZUCA 4NLCA 4ACOA 2MAXA 1S0OA 5AM0A 5BOLA 4DFMA 3HT3A 1SL2A 2BPGA 3DEEA 4AYBF 9ICBA 3GU3A 2JXJA 2WF7A 2DKXA 2ZIVA 2H5XA 4JB3A 2DUYA 4XRHA 2AJQA 2ZTCA 5AI0A 1V9PA 3WKEA 2ODGA 1D9DA 4IR1A 2IOHA 2W7PA 3TADA 2QARB 3SAFA 4Z6DA 2QLTA 4F4YA 3H8MA 4Y2PA 1BNOA 5IIKA 5KAIU 3QYPA 2WTFA 4DFJA 1KN5A 2ES6A 3BS5A 4ECRA 5KFYA 2KKPA 3HP6A 2HI0A 4Y2VA 1N62A 3EYZA 4C8NA 1ZRNA 3WU2U 4FFDA 3SENA 4O3SA 3C28A 4RQNA 8ICRA 5AI6A 2M0NA 2N1RA 1CEZA 4F8RA 2W9CA 1ZD5A 2I6XA 1SKRA 4QZ9A 3CNHA 5A0LA 2DBYA 1X9XA 4ED7A 3RB4A 4M9GA 1SV4A 3PW4A 4O5CA 1V97A 3ZD8A 3PMLA 2E8OA 4K4GA 8ICHA 3BQ0A 3BZKA 2EANA 4I2CA 2HHWA 2P35A 1Z19A 3IDWA 3HPOA 1ZQPA 4JWNA 2KVCA 4F5NA 1ED1A 2VJ5A 3CW2C 2PKEA 2HHSA 2ZIXB 4I2IA 4PGXA 2KVSA 5KT5A 4UB8U 4EBDA 2QB0A 2AU0A 2KP7A 1ZD3A 5ALSA 4Z6CA 2PMZF 2KHQA 1HEKA 5L9XA 3F2CA 3HX0A 4UB1A 4I2FA 4OJLA 2ZUDA 3J81j 4M0AA 1BPBA 1QSLA 3QEBZ 3I28A 2F8LA 2ZIUB 3N4MB 4R64A 4QWCA 3SZ2A 4M6WA 4Q44A 3UQ2A 1RXVA 5ALWA 5KG5A 4DOCA 3MR2A 4QNLA 3JPOA 2J6SA 1L7NA 4MEYA 4F50A 4Q43A 5J2KA 2NRWA 3ISDA 2KK0A 2IA6A 2W3RA 2AGOA 2G5HB 1FEZA 5KFAA 4O5KA 2HHTA 3MC1A 3PSFA 2ZTDA 4QWDA 7ICOA 1UA1A 3MABA 3PW7A 4CNQA 1X40A 3RRHA 2Y0SC 4J9LA 7ICNA 2WB1C 2KKVA 3MFHA 5K4LA 1ZOLA 1KTQA 4BJQA 4Y2XA 4MFAA 4DO9A 4C7YA 2FE9A 2LYHA 4PZNA 3KKAC 3VC8A 5AIBA 4RPYA 4YG2A 2D8CA 3U26A 4YVZA 5JRTA 2BQ3A 8ICXA 3TQ1A 3H8WA 3OGUA 1COKA 2K4IA 3LVWA 4O3QA 3C29A 5ALMA 4PZOA 3T5HA 4GC6A 1O03A 4ED6A 2K8AA 3UMCA 2R8IA 1J2MA 4IRCA 9ICKA 1PK3A 4RQ4A 2XCAA 1IV8A 2OCEA 3IN5A 5KFCA 1RXWA 3TKAA 3UMBA 3G6VA 3MDCA 1NJYA 3GIJA 1T7PA 2BCVA 5KFVA 1SV0A 2EZZA 4BXOA 4JWMA 1SB3C 5L1KA 3SQIA 8ICQA 5HR6A 2EZXA 2KMDA 3AUOA 4ECSA 2GH1A 3MDAA 4NY8A 8ICZA 4GIBA 4EZ6A 1JRPA 1DXSA 3RFAA 3KD3A 4RUCA 4KX5A 1NK4A 5EWEA 5AICA 5ALRA 4DS5A 4P0QB 2ZIWA 3FAHA 2EH9A 3RF9A 2F1HA 4TQRA 3PV8A 1UT8A 3ZDEA 4KLLA 1Q3VA 2E8NA 4XA5A 4PHPA 1TVAA 4KLSA 4PL2A 3H4DA 3ALRA 2UVRA 5JU5A 3AU6A 5KG7A 1B43A 5EE0A 3DDHA
chains in the Genus database with same CATH topology
1SV4A 1Z1VA 2QB0B 2FE9A 4IS7A 4PZNA 2E8OA 3KKAC 2DKZA 1KW4A 4RQMA 2EANA 5J8YC 2D8CA 2YTUA 1OXJA 3IDWA 4MHVA 2E8MA 2ESEA 2QB1A 1UQVA 3K1RB 5JRTA 5J8YA 1COKA 5L1MA 2KSOB 1RG6A 2EAMA 4PZOA 3SEIA 5F3XB 2JV3A 3BS7A 2QB0A 2Y9UA 2KG5A 2DKXA 1PK3A 2K60A 3TADC 5JTIA 3BS5B 2LMRA 2EAOA 1SV0C 3TADA 2KSOA 2QARB 2B6GA 2LPEA 1V38A 1OW5A 1SV0A 2DL0A 1B4FA 1B0XA 3H8MA 2GLEA 2KMDA 2L5YA 1PK1B 2ES6A 3BS5A 1JI7A 1WWVA 2EAPA 1DXSA 4NL9C 1F0MA 3BQ7A 2QARA 1WWUA 2KE7A 1SGGA 3TACB 1LKYB 2KIVA 2E8PA 4NL9A 1SXDA 4NJ8A 1X66A 3SENA 2F8KA 3HILA 4RQNA 2D3DA 2QKQA 1V85A 2F44A 2K4PA 1PK1A 5KNIA 3KKAA 2E8NA 2F3NA 1SXEA 1X40A 2Y9TA 5JU5A 1UCVA 1LKYA 1X9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV4 A;  1Z1V A;  2QB0 B;  2FE9 A;  4IS7 A;  4PZN A;  2E8O A;  3KKA C;  2DKZ A;  1KW4 A;  4RQM A;  2EAN A;  5J8Y C;  2D8C A;  2YTU A;  1OXJ A;  3IDW A;  4MHV A;  2E8M A;  2ESE A;  2QB1 A;  1UQV A;  3K1R B;  5JRT A;  5J8Y A;  1COK A;  5L1M A;  2KSO B;  1RG6 A;  2EAM A;  4PZO A;  3SEI A;  5F3X B;  2JV3 A;  3BS7 A;  2QB0 A;  2Y9U A;  2KG5 A;  2DKX A;  1PK3 A;  2K60 A;  3TAD C;  5JTI A;  3BS5 B;  2LMR A;  2EAO A;  1SV0 C;  3TAD A;  2KSO A;  2QAR B;  2B6G A;  2LPE A;  1V38 A;  1OW5 A;  1SV0 A;  2DL0 A;  1B4F A;  1B0X A;  3H8M A;  2GLE A;  2KMD A;  2L5Y A;  1PK1 B;  2ES6 A;  3BS5 A;  1JI7 A;  1WWV A;  2EAP A;  1DXS A;  4NL9 C;  1F0M A;  3BQ7 A;  2QAR A;  1WWU A;  2KE7 A;  1SGG A;  3TAC B;  1LKY B;  2KIV A;  2E8P A;  4NL9 A;  1SXD A;  4NJ8 A;  1X66 A;  3SEN A;  2F8K A;  3HIL A;  4RQN A;  2D3D A;  2QKQ A;  1V85 A;  2F44 A;  2K4P A;  1PK1 A;  5KNI A;  3KKA A;  2E8N A;  2F3N A;  1SXE A;  1X40 A;  2Y9T A;  5JU5 A;  1UCV A;  1LKY A;  1X9X A; 
#chains in the Genus database with same CATH topology
 2E5S A;  2RHF A;  4QZE A;  1L3V A;  3IV6 A;  3RR7 A;  2ASL A;  3C2K A;  4C8L A;  2Y1I A;  4MHV A;  5DKW A;  1D8L A;  2R8K A;  5ALE A;  2R18 A;  5DLF A;  9ICQ A;  2KSO B;  4P2H A;  3E2E A;  3TFR A;  4ZOH C;  3M9N B;  5IIM A;  1DK2 A;  3L3F X;  4MF2 A;  1NK9 A;  1NI3 A;  4F5P A;  1DRG A;  1Q46 A;  4UAV A;  3Q8P B;  1QLN A;  2KD1 A;  3TAD C;  4FZN A;  5JTI A;  2ZXH A;  2KZM A;  1BGX T;  3OJU A;  4JUZ A;  4IQT A;  1ZXI A;  2VJ4 A;  2ZXI A;  5J29 A;  4LZG A;  1T94 A;  3T5J A;  1HUZ A;  4O5E A;  1N5X A;  4DEZ A;  3SMV A;  1LV5 A;  1JN3 A;  3UXP A;  3PSP A;  5CP2 A;  2KEY A;  4R8U B;  2FI1 A;  1S97 A;  2E3T A;  3A0H U;  4FE3 A;  2FMS A;  1ZQI A;  9ICX A;  1RYR A;  3UPQ A;  1Z1B A;  2NRV A;  3THV A;  2XGP A;  2E1F A;  3IG8 A;  1S5L U;  4RT2 A;  4DSE A;  5B5E U;  5J0W A;  2HW3 A;  2E8P A;  4NL9 A;  1ZRM A;  3D6J A;  3M8S A;  1KDH A;  9ICF A;  2F8K A;  5KG0 A;  4RNO A;  3KZX A;  1ZQT A;  5F9N A;  5J2H A;  1T8E A;  4EYI B;  2V9W A;  2F1I A;  4UAR A;  2IBK A;  2I5H A;  4IC9 A;  1ZQA A;  1U48 A;  4J9O A;  3H0R B;  5ALV A;  3RJI A;  4ELT A;  7ICF A;  3LDA A;  4AP9 A;  1ZQB A;  1S77 D;  1OXJ A;  1ZQN A;  4RQ2 A;  8ICY A;  4NLZ A;  4QWB A;  1TKD A;  5AM5 A;  2NRX A;  5AKG A;  4NWI A;  2BCU A;  7ICV A;  5DB6 A;  2MA1 A;  3C5G A;  3DV9 A;  4OJ5 A;  1XSL A;  3WK7 A;  3PX6 A;  4UAW A;  2HDO A;  3EW9 A;  3S6J A;  4FO6 A;  1A77 A;  3H0L B;  2NV3 A;  4OJP A;  2LMR A;  4BGD A;  3ED5 A;  1RDF A;  5J0X A;  4RQ0 A;  1SZP A;  7ICJ A;  8ICM A;  2IOF K;  3V7L A;  8ICT A;  2KJ8 A;  4TUQ A;  5G5G A;  2B6G A;  4C80 A;  4JMU A;  5IIO A;  4RQ6 A;  2HHU A;  2PMZ C;  3NVY A;  4UB3 A;  4C4R A;  5J0S A;  4HYK A;  1L3T A;  2KZZ A;  1N63 A;  3RJJ A;  2ZTE A;  5KG3 A;  2LBO A;  2W55 A;  1QQ5 A;  3T79 A;  5IIL A;  2QAR A;  3GZF A;  4R65 A;  2PFO A;  3WK6 A;  1L7M A;  4PHD A;  3TAN A;  3OPX A;  4YXJ A;  1SXD A;  4KMU A;  3MGI A;  4NV0 A;  1KLN A;  4U7C A;  1HUO A;  4TUP A;  1L3U A;  2A19 A;  4QZH A;  1SWV A;  3TFS A;  3Q8M A;  1C7Y A;  3N7P D;  5T14 A;  2F3N A;  5C5J A;  2AQ0 A;  4UB6 U;  5DB8 A;  5KFJ A;  2EZY A;  3QEA Z;  5BPC A;  1X6I A;  3AL0 B;  1TK5 A;  4QZB A;  3HKZ F;  4RQM A;  1ZQK A;  3LYS A;  2FLL A;  3OJS A;  4O3P A;  4P0P B;  2JHD A;  3JPR A;  4TUS A;  1Q8K A;  3NVZ A;  4DSL A;  5ALT A;  5J2F A;  1RG6 A;  1DGS A;  3NRZ A;  5HHI A;  3QU7 A;  4XQ8 A;  2W9B B;  4F2R A;  4WJ3 B;  1RPL A;  3SD7 A;  1T3Q A;  2WF6 A;  5HMM A;  4C4S A;  3RAQ A;  4JK1 A;  4PGQ A;  3N7S C;  5EE9 A;  4EEK A;  5AKK A;  2ZIX A;  1SV0 C;  5AKL A;  3VCB A;  2YB4 A;  4FZL A;  5AI5 A;  3M9M B;  1UHU A;  5ALI A;  4Z6F A;  2PXI A;  4P4P A;  1ECW A;  4NM1 A;  4O3M A;  4IQU A;  5ALY A;  4B9N A;  3QXG A;  1S0M A;  3PVX A;  4A8E A;  4R66 A;  3EWA A;  5ALN A;  5GTH U;  4FS1 A;  8ICE A;  1JI7 A;  3RJE A;  4J9S A;  3V6J A;  4NLN A;  3LWM A;  2LYB A;  2OYY A;  4US8 A;  1X9W A;  1SGG A;  4KLE A;  2ZIU A;  5HHH A;  3RJK A;  4YMO A;  4ZH4 A;  5KFS A;  3LVV A;  4BX9 C;  2HHX A;  4P4O A;  1FIQ A;  1RYU A;  3HIL A;  1DOQ A;  3PSI A;  4F93 B;  4DQI A;  2JEG A;  1ZQR A;  3KOO A;  3H0M B;  2GWS A;  2CRX A;  5AKX A;  3MGV A;  3T3F A;  4M9N A;  5CRX A;  3L5K A;  3UXN A;  4PJ0 U;  5J0Q A;  5ALH A;  2K8C B;  2VKQ A;  3C2L A;  3H8J A;  2DKZ A;  3TAR A;  1N5W A;  2G09 A;  4J9R A;  2OM6 A;  4PHE A;  3GII A;  4RT3 A;  4EX7 A;  3MGH A;  1KFD A;  1C20 A;  2HBL A;  3FM9 A;  3CP8 A;  3V6K A;  3SEI A;  3BS7 A;  5AM2 A;  2DFL A;  1NZB A;  3V72 A;  2BHN A;  4QZI A;  3F2B A;  1Z00 A;  4F4X A;  3TAP A;  4BWM A;  3Q8R B;  4DFP A;  4YD2 A;  5KFO A;  4LJX A;  2KFZ A;  2HBM A;  3FC4 A;  5IIJ A;  4KLD A;  1L3S A;  8ICL A;  4ECV A;  3AQE A;  9ICP A;  5J2A A;  8ICW A;  2MU2 A;  4EZ9 A;  4TQS A;  1B4F A;  4YXM A;  4UAZ A;  4Q8F A;  1D8B A;  2GLE A;  4ICA A;  2FLP A;  1BPY A;  2JZB A;  2W54 A;  4KLQ A;  2HBK A;  5DGB A;  1UT5 A;  5KT4 A;  1S76 D;  4KLH A;  5AKZ A;  2K89 A;  1TE2 A;  4NL9 C;  2K4H A;  1O08 A;  3KHG A;  5KFB A;  8ICF A;  2HBJ A;  4DL4 A;  3V6H A;  4PGY A;  5KAF U;  4QJF B;  1X66 A;  5DBB A;  3CRX A;  4RNN A;  2KZ3 A;  3AN1 A;  4MEX A;  1RZT A;  2DGZ A;  2ZJA A;  1KL9 A;  5J0U A;  5ALQ A;  1ZJN A;  2HVI A;  1EXN A;  2YN4 A;  1SIJ A;  2C2R A;  3GIL A;  1VJ5 A;  4FBU A;  1ZQS A;  3K4G A;  5J2E A;  2XCP A;  1L8O A;  5III A;  1BPE A;  4P0Q A;  4DOA A;  3KHR A;  5HML A;  1QSS A;  4JV2 A;  1ZQV A;  2ESE A;  9ICI A;  5AI8 A;  2PFP A;  2JEI A;  5ALU A;  2EQY A;  3A0B U;  3R9K A;  4DOB A;  4O3O A;  2BPC A;  1T4G A;  1IM4 A;  3SV3 A;  2YB1 A;  9ICN A;  5BOM A;  4G3I A;  3AM9 A;  2Y9U A;  4YR2 A;  4J9N A;  1NNL A;  3ETL A;  3H7I A;  8ICN A;  1Z00 B;  1URJ A;  9ICT A;  5J2B A;  4I2E A;  3TI0 A;  2KSO A;  1F44 A;  3WK5 A;  2BCQ A;  3F5A A;  2DQN B;  1OW5 A;  5D4B A;  2Z7J A;  3PW0 A;  1DGJ A;  3RJF A;  2H3Q A;  5KTQ A;  2XY7 A;  5CA7 A;  1PK1 B;  1SZH A;  5AM3 A;  2YMP A;  2JZB B;  3F5E A;  1U9L A;  2GO7 A;  3WKB A;  5DB9 A;  1WCN A;  5CR0 A;  5KFQ A;  3KHH A;  1NOM A;  2VA8 A;  4CF4 A;  3IM1 A;  1S0N A;  9ICW A;  2M9N A;  4B9U A;  1TAQ A;  2D3D A;  3JPP A;  4QZ8 A;  4KTQ A;  5KFK A;  3AMZ A;  2CXY A;  4I2G A;  5KL1 B;  4R8U A;  1ZYQ A;  2F1J A;  3PST A;  1BPD A;  3ICX A;  2YX8 A;  2RDJ A;  9ICE A;  4I2H A;  1JXL A;  4NLG A;  3IP4 B;  5ALK A;  5AK4 A;  2MUT B;  4C4T A;  3PX4 A;  3IG5 A;  3QUQ A;  5AK5 A;  1JXE A;  4YCX A;  1Q3U A;  1NK0 A;  1ZQF A;  3UQ0 A;  4F4W A;  4G9B A;  4DFD A;  2DF4 B;  2QB1 A;  1YT3 A;  5KFW A;  4GC7 A;  2Y1J A;  2DWQ A;  1OUQ A;  4QWA A;  4OJ6 A;  4MFF A;  2KJ9 A;  4EEL A;  5KFZ A;  2ASD A;  2A1A A;  4O9M A;  9ICM A;  2V4R A;  9ICS A;  4B6J A;  3HKZ C;  4Y2T A;  7ICK A;  4DCC A;  4OJO A;  5B66 U;  3JPS A;  1P7D A;  4DL6 A;  2OWO A;  2HCF A;  5KFE A;  1UPH A;  4KLG A;  1L6N A;  4FS2 A;  1JRO A;  1AQ6 A;  2KFN A;  4K4H A;  9ICH A;  3PO4 A;  4UB4 A;  4M9H A;  2ZJ5 A;  1D9F A;  4Y2Q A;  2WAQ C;  1L7O A;  1ZET A;  3E58 A;  2XIC A;  3EPI A;  4K4I A;  1NKB A;  3NUQ A;  4UQG A;  2BQR A;  1BNP A;  4Y2R A;  1RQL A;  3QNM A;  1KRP A;  2UVV A;  1A6S A;  2KTQ A;  5KFN A;  4KLM A;  1F0M A;  2H3F A;  2ALZ A;  4F5R A;  1FFU A;  4F5O A;  3NVV A;  2EDU A;  5DQI A;  5TZV A;  2C22 A;  4NJ8 A;  2Q0Z X;  4KN7 A;  1NZP A;  1CI4 A;  1TAU A;  5KNI A;  3EPG A;  3RBE A;  1X2I A;  1QCK A;  2Y9T A;  3E0F A;  5DG8 A;  1JX4 A;  5L1L A;  3BQT A;  4CGZ A;  3OHA A;  2W9A A;  4B9S A;  3GIM A;  2I9G A;  2XI9 A;  2G5I B;  2YY6 A;  1L8L A;  2E1E A;  1TFR A;  2FJ6 A;  4Z6E A;  4ED3 A;  3SYZ A;  4YFK A;  2AGQ A;  2BZF A;  3BJY A;  2DPJ A;  3MR3 A;  5DG7 A;  4DQS A;  2XY5 A;  1B22 A;  1RM6 C;  5J2I A;  5AI4 A;  4P0P A;  1K1S A;  4X5V A;  3WKA A;  1J97 A;  2AXT U;  2WF5 A;  2JGA A;  4Y2S A;  3T5L A;  5TIS U;  3I76 A;  5F9L A;  1KFS A;  4F72 A;  4ED1 A;  3OSN A;  5KFU A;  2W9B A;  4UBB A;  3GV8 B;  1MC8 A;  4NM2 A;  3M1Y A;  4QZF A;  2UVW A;  2PI5 A;  3RJH A;  1D8Y A;  5DQH A;  9ICC A;  2LYA A;  1LKY B;  2W7O A;  4YN4 A;  1ZQD A;  2C28 A;  2H3Z A;  4ECT A;  2JRZ A;  1V85 A;  3I1Y A;  4B9V A;  5ALX A;  4MF8 A;  4YP3 A;  8ICI A;  4DL3 A;  3KKA A;  4QWE A;  4GXJ A;  1S8O A;  3RTV A;  5E79 U;  2DPI A;  4ECZ A;  2R8H A;  2FMP A;  3NAS A;  4GXI A;  2VIX A;  2YML A;  1FO4 A;  3AU2 A;  1JIH A;  4LVS A;  2B21 A;  1IIP A;  1XS9 D;  5HP4 A;  4J9K A;  5EWF A;  5KL8 B;  5EOZ A;  4F2S A;  5AI9 A;  5KFP A;  3CYM A;  2XY6 A;  1Z4O A;  5ALZ A;  9ICV A;  5CB1 A;  2D6F C;  3KBB A;  2RQ5 A;  3ISC A;  2R8G A;  3ISB A;  1MQ3 A;  2GOL A;  4QZG A;  3C2M A;  1XWL A;  4UB2 A;  8ICV A;  3F53 A;  1SWW A;  3NVW A;  8ICS A;  3ORY A;  4CF3 A;  4HAI A;  9ICL A;  2KOB A;  8ICO A;  2MSN A;  3ZI4 A;  4I2A A;  5KFH A;  4B9T A;  4OD0 A;  3ZDC A;  1WUD A;  5J0R A;  3M9O B;  2L5Y A;  5ALD A;  4I2B A;  2K8B B;  2WAQ F;  3MBY A;  2H3I A;  2VAN A;  2BGW A;  1NKE A;  1WWV A;  2EAP A;  2ZUB A;  2JEJ A;  4UW9 A;  3GFK B;  2W03 A;  3ETR A;  4NXZ A;  1Z4N A;  5KG6 A;  3QE9 Y;  1JMS A;  2LHT A;  3B0Y A;  3QUB A;  4M9J A;  2ASJ A;  1XSN A;  4YR0 A;  2OH2 A;  2F76 X;  1PZN A;  1XSP A;  1U4B A;  4RUA A;  4DWI A;  4J9M A;  1BPX A;  1UCV A;  5KFT A;  4M9L A;  1MSW D;  4PHA A;  5AIA A;  4QW8 A;  5L1I A;  3ZDD A;  2AHO B;  2BCS A;  1NJZ A;  5KFI A;  2K4E A;  3GDX A;  2YTU A;  3M8R A;  2KHV A;  3H40 A;  3M6K A;  4IQV A;  4UB5 A;  2F2A B;  3JPQ A;  7ICE A;  4ELV A;  1ZJM A;  2NO5 A;  5ALG A;  3BQ1 A;  4DSF A;  2FLN A;  3K1Z A;  4DQQ A;  3RB6 A;  4GLX A;  1RQN A;  2W3S A;  1QTM A;  4USA A;  2CPR A;  3B0X A;  3D2Q A;  3C5F A;  3RJG A;  2WF9 A;  2CN1 A;  1N48 A;  4B9L A;  1X42 A;  5KFG A;  9ICU A;  3PW2 A;  5DDM A;  4C0Z A;  1RYS A;  2WHE A;  1U45 A;  4OO1 J;  3L4P A;  5ALP A;  2XID A;  8ICJ A;  5L1J A;  7ICL A;  1L7P A;  4IQW A;  2AQ4 A;  3ONN A;  5AKY A;  2A1J B;  4KIT B;  5J2G A;  4NLB A;  3PX0 A;  1TAM A;  2W04 A;  2NYV A;  4EBC A;  3PY8 A;  5DBA A;  4CDG A;  5JUM A;  2HHV A;  2NO4 A;  1KSP A;  5DB7 A;  2JH7 A;  4ECQ A;  3C1Y A;  1QH9 A;  2MRL A;  1A76 A;  1DK3 A;  2W8L A;  4EEY A;  7ICI A;  4UAT A;  4O0I A;  2C2D A;  4BWJ A;  3FYH A;  3QU2 A;  3PZP A;  4F3O A;  1ZQH A;  1ZQE A;  4DSI A;  1SKS A;  3MR5 A;  5KFL A;  2P6U A;  3NRW A;  2IHN A;  4DLG A;  3SV4 A;  4JV1 A;  1KBU A;  2FDR A;  4YMN A;  2XGQ A;  4KLT A;  1U49 A;  2G06 A;  2KIV A;  4KX3 A;  2AH5 A;  5CEH A;  1NKC A;  1SKW A;  3QUC A;  1S10 A;  5KFM A;  2QKQ A;  2HOF A;  4IRD A;  2I1Q A;  2F44 A;  5AKI A;  3Q8K A;  3BQ2 A;  5KFF A;  1PK1 A;  1WYG A;  5KFX A;  1SL1 A;  2HSZ A;  5ALL A;  2NRT A;  5DLG A;  4RQ8 A;  1QSY A;  3QX7 A;  4I28 A;  5J2D A;  2J6T A;  4IS7 A;  2NRZ A;  5ALF A;  3N97 B;  2JMG A;  4U6P A;  3GIK A;  4Y2Y A;  2ZIV B;  3D2N A;  4F92 B;  1K1Q A;  1UQV A;  4UAY A;  1KFT A;  4YD1 A;  2KNJ A;  2J6U A;  4DFK A;  2IMW P;  1KKX A;  5CWR A;  1JAL A;  3ZD9 A;  4CE6 A;  4YR3 A;  3H8S A;  4QZA A;  3RAX A;  3BDP A;  4FBT A;  2MUT A;  4RPZ A;  5AK6 A;  3PR5 B;  2KG5 A;  4LZD A;  1KQQ A;  2KJ5 A;  4ELU A;  8ICA A;  3JPN A;  3BS5 B;  4F91 B;  4RNM A;  1XU4 A;  2EAO A;  4RU9 A;  4DQR A;  5EE1 A;  2OEH A;  3PO5 A;  2F77 X;  5KG2 A;  4F4Z A;  3V7K A;  3KFU F;  1VDV A;  9ICO A;  3K75 D;  3G6Y A;  4F71 A;  1FFV A;  4QIW F;  3TAQ A;  1B0X A;  2RLT A;  1ZQG A;  1ZQX A;  4J9Q A;  4KLI A;  3BZC A;  1CRX A;  3UXO A;  3C21 A;  2W9C B;  1ZQZ A;  2KIC A;  4O3R A;  2KIW A;  4I2J A;  8ICC A;  4I2D A;  1ZQW A;  4PL1 A;  1X9M A;  4RQ3 A;  3UMG A;  4EBE A;  3GV7 B;  5DG9 A;  4Q45 A;  4US9 A;  4RQ5 A;  5CJ7 A;  1WG8 A;  2XVT A;  7ICT A;  1XNS A;  4E0D A;  3SR6 A;  1K5O A;  2PFQ A;  2H3V A;  4PPX A;  5J2C A;  1ZQJ A;  2A3V A;  4C8M A;  5KT6 A;  2AGP A;  3ZDA A;  4M47 A;  4DLE A;  1WCL A;  4EX6 A;  5AKJ A;  1IXR A;  4M2Y A;  8ICB A;  2RRD A;  2QB0 B;  4ED0 A;  4MFC A;  4BUG A;  4DF8 A;  5AHX A;  3KZI U;  5ALO A;  3SAG A;  3QU9 A;  3HJE A;  1CUK A;  1ZQU A;  4C7Z A;  4QZD A;  3ZDB A;  4DSK A;  1Y88 A;  5J8Y A;  3LK9 A;  2JEF A;  5KG4 A;  4CF5 A;  2LM1 A;  4B9M A;  4M6W B;  5D46 A;  3Q8L A;  2BCR A;  3MR6 A;  3EZ5 A;  8ICU A;  2K60 A;  2KV2 A;  1N56 A;  2BKE A;  5ALJ A;  3QU5 A;  1T3N A;  4KMO B;  5KT7 A;  2RDI A;  1S0V A;  3MFI A;  2Q4T A;  3RH5 A;  2YQE A;  4ECX A;  1TK8 A;  2DL0 A;  2P6R A;  3AEV A;  3Q8S B;  2P66 A;  3RRG A;  2JR5 A;  7ICP A;  2G08 A;  5EE3 A;  2OXO A;  8ICG A;  4JV0 A;  1BPZ A;  2HOI A;  2YMM A;  1HIW A;  1U47 A;  1TK0 A;  4YQW A;  1COO A;  1NJX A;  5D49 A;  4KLO A;  2ZJ8 A;  2XC9 A;  3QUT A;  2W8K A;  5HR7 A;  9ICR A;  5J0O A;  1NK8 A;  5AM4 A;  4YMM A;  2PI4 A;  5DGA A;  4KLJ A;  3OHB A;  3G6X A;  3IHQ B;  2HOQ A;  2ISO A;  3N7R C;  3RB0 A;  1Z3E B;  2K4P A;  4C8O A;  1XO1 A;  3SI8 A;  1ZQL A;  2R8J A;  4QZC A;  1LKY A;  4DL2 A;  4EEN A;  1M6Y A;  3WKC A;  4QW9 A;  5CHG A;  3QZ8 A;  4DL7 A;  1KW4 A;  3B9J A;  4IRK A;  2JH1 A;  1L5U A;  3D2S A;  3PNC A;  2OHF A;  3JPT A;  2LI6 A;  4KN4 A;  4AYB C;  4PH5 A;  1SL0 A;  3Q8Q B;  3HRD D;  4ED8 A;  2IHM A;  3RH6 A;  5F3X B;  2JV3 A;  3OTQ A;  3O0F A;  4BXO B;  4Y2U A;  1H38 A;  1KEJ A;  5EWG A;  3V7J A;  1A0P A;  4OCZ A;  4ECW A;  1JUD A;  4UAS A;  5IIN A;  2FPL A;  4M04 A;  3RBD A;  3WK4 A;  2LM4 A;  3T5K A;  1LVH A;  3GQC A;  2PFN A;  3C23 A;  1IG6 A;  3WK8 A;  4Q8E A;  2W9M A;  3HWT A;  5J2J A;  7ICR A;  2FPK A;  2ZIW B;  1ZD2 P;  1NJW A;  2XO7 A;  2HVH A;  1HJP A;  4FZM A;  3N28 A;  5AKE A;  3QU4 A;  5HNK A;  1J2N A;  9ICA A;  4Y2J A;  1MN8 A;  4I27 A;  4R63 A;  2IOF A;  4RZR A;  3BQ7 A;  4KLF A;  1WWU A;  2W43 A;  2KE7 A;  4DQP A;  4J03 A;  3TAC B;  4KLU A;  3NTU A;  1LB2 B;  4GXK A;  2Y0S F;  3F2D A;  2WB1 F;  1F5S A;  1ZQY A;  5H2F U;  5J0P A;  3WK9 A;  2HHQ A;  3WKD A;  3HW8 A;  2ATL A;  3QZ7 A;  4IL6 U;  4J9P A;  1TV9 A;  1N60 A;  2G07 A;  2UVU A;  5KFD A;  1BVS A;  3LWL A;  2BQU A;  5DQG A;  7ICQ A;  4TUR A;  2O6K A;  3AQF A;  1X6J A;  3RR8 A;  4O3N A;  3OSP A;  1YZ7 A;  2WFA A;  3H4B A;  1UA0 A;  4DS4 A;  2E8M A;  3IRU A;  2RP5 A;  5KFR A;  4BDP A;  2LKY A;  1ZQQ A;  4UBC A;  5L1M A;  2EAM A;  2YMQ A;  2ZG6 A;  4DL5 A;  1ZD4 A;  4GFJ A;  2BPF A;  3FDS A;  2V4Q A;  1NK7 A;  5G5H A;  3RB3 A;  1XC9 A;  3M6Z A;  7ICS A;  7ICM A;  1N61 A;  3M7D A;  4F4K A;  2FPM A;  1X9S A;  4CRX A;  5AK3 A;  2C2E A;  4P4M A;  5FP0 A;  1ARO P;  2B0C A;  3PR4 A;  2VA3 A;  2ISP A;  2WF8 A;  4UAU A;  2LPE A;  4ED2 A;  5J0T A;  3C1Z A;  1MA7 A;  1V38 A;  5AKH A;  1YZ6 A;  3UM9 A;  3EUB 2;  3KHL A;  1QQ6 A;  5KT2 A;  4DSJ A;  2HMX A;  4RQ1 A;  2W11 A;  3NGD A;  9ICJ A;  4DF4 A;  7ICH A;  5AM1 A;  3PW5 A;  2A1J A;  2BDP A;  1ZQ1 C;  3RH4 A;  1GO3 F;  4QIW C;  1N2X A;  7ICG A;  5GTI U;  1NK6 A;  1VLB A;  4NLK A;  5KG1 A;  7ICU A;  1PUZ A;  1PVQ A;  4I29 A;  5KT3 A;  2BDU A;  4XUS A;  8ICP A;  4F5Q A;  3KTQ A;  2BR0 A;  1S9F A;  1XO0 A;  1ZQC A;  1SXE A;  1PVP A;  1ZQO A;  3GV5 B;  2VA2 A;  5C0Y A;  5J0Y A;  4ECY A;  1Z1V A;  4RQ7 A;  1NK5 A;  5DDY A;  4C8K A;  4IR9 A;  3PMN A;  3NS1 A;  4EYH B;  5J8Y C;  1PVR A;  1MQ2 A;  2KN7 A;  4CCH A;  3SAH A;  3K1R B;  2FMQ A;  4RPX A;  8ICK A;  1ZQM A;  5DBC A;  9ICG A;  2G0A A;  4ECU A;  1QQ7 A;  2ZUC A;  4NLC A;  4ACO A;  2MAX A;  1S0O A;  5AM0 A;  5BOL A;  4DFM A;  3HT3 A;  1SL2 A;  2BPG A;  3DEE A;  4AYB F;  9ICB A;  3GU3 A;  2JXJ A;  2WF7 A;  2DKX A;  2ZIV A;  2H5X A;  4JB3 A;  2DUY A;  4XRH A;  2AJQ A;  2ZTC A;  5AI0 A;  1V9P A;  3WKE A;  2ODG A;  1D9D A;  4IR1 A;  2IOH A;  2W7P A;  3TAD A;  2QAR B;  3SAF A;  4Z6D A;  2QLT A;  4F4Y A;  3H8M A;  4Y2P A;  1BNO A;  5IIK A;  5KAI U;  3QYP A;  2WTF A;  4DFJ A;  1KN5 A;  2ES6 A;  3BS5 A;  4ECR A;  5KFY A;  2KKP A;  3HP6 A;  2HI0 A;  4Y2V A;  1N62 A;  3EYZ A;  4C8N A;  1ZRN A;  3WU2 U;  4FFD A;  3SEN A;  4O3S A;  3C28 A;  4RQN A;  8ICR A;  5AI6 A;  2M0N A;  2N1R A;  1CEZ A;  4F8R A;  2W9C A;  1ZD5 A;  2I6X A;  1SKR A;  4QZ9 A;  3CNH A;  5A0L A;  2DBY A;  1X9X A;  4ED7 A;  3RB4 A;  4M9G A;  1SV4 A;  3PW4 A;  4O5C A;  1V97 A;  3ZD8 A;  3PML A;  2E8O A;  4K4G A;  8ICH A;  3BQ0 A;  3BZK A;  2EAN A;  4I2C A;  2HHW A;  2P35 A;  1Z19 A;  3IDW A;  3HPO A;  1ZQP A;  4JWN A;  2KVC A;  4F5N A;  1ED1 A;  2VJ5 A;  3CW2 C;  2PKE A;  2HHS A;  2ZIX B;  4I2I A;  4PGX A;  2KVS A;  5KT5 A;  4UB8 U;  4EBD A;  2QB0 A;  2AU0 A;  2KP7 A;  1ZD3 A;  5ALS A;  4Z6C A;  2PMZ F;  2KHQ A;  1HEK A;  5L9X A;  3F2C A;  3HX0 A;  4UB1 A;  4I2F A;  4OJL A;  2ZUD A;  3J81 j;  4M0A A;  1BPB A;  1QSL A;  3QEB Z;  3I28 A;  2F8L A;  2ZIU B;  3N4M B;  4R64 A;  4QWC A;  3SZ2 A;  4M6W A;  4Q44 A;  3UQ2 A;  1RXV A;  5ALW A;  5KG5 A;  4DOC A;  3MR2 A;  4QNL A;  3JPO A;  2J6S A;  1L7N A;  4MEY A;  4F50 A;  4Q43 A;  5J2K A;  2NRW A;  3ISD A;  2KK0 A;  2IA6 A;  2W3R A;  2AGO A;  2G5H B;  1FEZ A;  5KFA A;  4O5K A;  2HHT A;  3MC1 A;  3PSF A;  2ZTD A;  4QWD A;  7ICO A;  1UA1 A;  3MAB A;  3PW7 A;  4CNQ A;  1X40 A;  3RRH A;  2Y0S C;  4J9L A;  7ICN A;  2WB1 C;  2KKV A;  3MFH A;  5K4L A;  1ZOL A;  1KTQ A;  4BJQ A;  4Y2X A;  4MFA A;  4DO9 A;  4C7Y A;  2FE9 A;  2LYH A;  4PZN A;  3KKA C;  3VC8 A;  5AIB A;  4RPY A;  4YG2 A;  2D8C A;  3U26 A;  4YVZ A;  5JRT A;  2BQ3 A;  8ICX A;  3TQ1 A;  3H8W A;  3OGU A;  1COK A;  2K4I A;  3LVW A;  4O3Q A;  3C29 A;  5ALM A;  4PZO A;  3T5H A;  4GC6 A;  1O03 A;  4ED6 A;  2K8A A;  3UMC A;  2R8I A;  1J2M A;  4IRC A;  9ICK A;  1PK3 A;  4RQ4 A;  2XCA A;  1IV8 A;  2OCE A;  3IN5 A;  5KFC A;  1RXW A;  3TKA A;  3UMB A;  3G6V A;  3MDC A;  1NJY A;  3GIJ A;  1T7P A;  2BCV A;  5KFV A;  1SV0 A;  2EZZ A;  4BXO A;  4JWM A;  1SB3 C;  5L1K A;  3SQI A;  8ICQ A;  5HR6 A;  2EZX A;  2KMD A;  3AUO A;  4ECS A;  2GH1 A;  3MDA A;  4NY8 A;  8ICZ A;  4GIB A;  4EZ6 A;  1JRP A;  1DXS A;  3RFA A;  3KD3 A;  4RUC A;  4KX5 A;  1NK4 A;  5EWE A;  5AIC A;  5ALR A;  4DS5 A;  4P0Q B;  2ZIW A;  3FAH A;  2EH9 A;  3RF9 A;  2F1H A;  4TQR A;  3PV8 A;  1UT8 A;  3ZDE A;  4KLL A;  1Q3V A;  2E8N A;  4XA5 A;  4PHP A;  1TVA A;  4KLS A;  4PL2 A;  3H4D A;  3ALR A;  2UVR A;  5JU5 A;  3AU6 A;  5KG7 A;  1B43 A;  5EE0 A;  3DDH A; 
#chains in the Genus database with same CATH homology
 1SV4 A;  1Z1V A;  2QB0 B;  2FE9 A;  4IS7 A;  4PZN A;  2E8O A;  3KKA C;  2DKZ A;  1KW4 A;  4RQM A;  2EAN A;  5J8Y C;  2D8C A;  2YTU A;  1OXJ A;  3IDW A;  4MHV A;  2E8M A;  2ESE A;  2QB1 A;  1UQV A;  3K1R B;  5JRT A;  5J8Y A;  1COK A;  5L1M A;  2KSO B;  1RG6 A;  2EAM A;  4PZO A;  3SEI A;  5F3X B;  2JV3 A;  3BS7 A;  2QB0 A;  2Y9U A;  2KG5 A;  2DKX A;  1PK3 A;  2K60 A;  3TAD C;  5JTI A;  3BS5 B;  2LMR A;  2EAO A;  1SV0 C;  3TAD A;  2KSO A;  2QAR B;  2B6G A;  2LPE A;  1V38 A;  1OW5 A;  1SV0 A;  2DL0 A;  1B4F A;  1B0X A;  3H8M A;  2GLE A;  2KMD A;  2L5Y A;  1PK1 B;  2ES6 A;  3BS5 A;  1JI7 A;  1WWV A;  2EAP A;  1DXS A;  4NL9 C;  1F0M A;  3BQ7 A;  2QAR A;  1WWU A;  2KE7 A;  1SGG A;  3TAC B;  1LKY B;  2KIV A;  2E8P A;  4NL9 A;  1SXD A;  4NJ8 A;  1X66 A;  3SEN A;  2F8K A;  3HIL A;  4RQN A;  2D3D A;  2QKQ A;  1V85 A;  2F44 A;  2K4P A;  1PK1 A;  5KNI A;  3KKA A;  2E8N A;  2F3N A;  1SXE A;  1X40 A;  2Y9T A;  5JU5 A;  1UCV A;  1LKY A;  1X9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...