2KE7A

Nmr structure of the first sam domain from aida1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
QTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of the first SAM domain from AIDA1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ankyrin repeat and sterile alpha motif domain-containing pro
total genus 20
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ke7A00
2E8MA 2QB0A 4NJ8A 1X40A 2FE9A 1X66A 2D3DA 1PK1B 5JU5A 2QARA 4NL9C 4PZOA 1PK3A 2YTUA 2EAOA 1DXSA 3SEIA 1COKA 3BS7A 2DKZA 2ES6A 2L5YA 3TACB 3BS5A 2DL0A 2E8PA 2D8CA 2E8NA 2LPEA 2Y9TA 3SENA 1B4FA 2K4PA 2KSOB 1JI7A 1V38A 2F8KA 1V85A 2KG5A 1SGGA 4RQMA 1PK1A 3KKAA 4MHVA 1SXEA 2E8OA 2EAPA 1X9XA 1SXDA 1SV4A 2KMDA 2ESEA 2B6GA 5KNIA 3H8MA 3BS5B 2DKXA 4NL9A 5L1MA 2EAMA 4RQNA 3HILA 1B0XA 5F3XB 1WWUA 3BQ7A 4PZNA 1UCVA 2KSOA 5J8YC 2LMRA 3K1RB 2F44A 2F3NA 1SV0C 1UQVA 2QB1A 2Y9UA 5JTIA 1KW4A 1RG6A 2K60A 2QB0B 2KIVA 2QKQA 1F0MA 3TADA 2JV3A 1OXJA 5JRTA 1SV0A 1LKYA 3KKAC 4IS7A 5J8YA 3IDWA 2EANA 2KE7A 1WWVA 2QARB 3TADC 1LKYB 2GLEA 1Z1VA 1OW5A
chains in the Genus database with same CATH superfamily
2KJ9A 3NRZA 5ALHA 3V6HA 4KLHA 9ICKA 2BZFA 2JR5A 1ZQEA 4I2GA 5HP4A 4DSLA 5KFOA 5ALXA 1XU4A 3UPQA 1KRPA 5KFHA 4GIBA 5AI5A 2A1JB 5AI8A 4UQGA 1YZ7A 4QWAA 2A1AA 3FYHA 4YMOA 4YP3A 4J9SA 4ED8A 3ZDAA 2AGQA 3PR5B 1B22A 2HCFA 4O3RA 5IIIA 5AIBA 3JPNA 2L5YA 5ALEA 3EZ5A 4O3NA 5KG2A 5KG4A 8ICRA 2W3SA 4BX9C 2C2RA 1NJZA 4EZ6A 4K4GA 1NK0A 4UB6U 9ICGA 2GO7A 2F8KA 1NZBA 4OCZA 2XICA 2BPCA 1DGSA 1X2IA 1BNOA 2W54A 5IIJA 4Y2UA 3AU2A 4NLKA 1L7OA 2R18A 2B6GA 3B9JA 3N7RC 3SZ2A 4RU9A 2ZIUA 4Z6CA 2AJQA 2CXYA 3AQEA 3G6YA 1JX4A 2UVWA 3BQ7A 4KLFA 3GIMA 2LMRA 4DFMA 2JZBB 3M8RA 3PMNA 4ED7A 4P2HA 1UQVA 3C23A 4J9PA 3PO4A 4PL1A 3E58A 3BDPA 5H2FU 2H3FA 1TKDA 4YVZA 2JHDA 2ATLA 2R8HA 2W8LA 4FBTA 5J0PA 2WF7A 2KIWA 3EWAA 2ZUBA 4M0AA 2I6XA 2JZBA 2YMQA 2ZTDA 2BGWA 2KJ5A 3FAHA 1LKYB 2GLEA 1DK2A 5KFPA 2ZIXB 7ICGA 1ZD5A 5KG0A 4F93B 1MA7A 5FP0A 2R8KA 2NV3A 4FZLA 2GWSA 1S8OA 5CA7A 3LWMA 5AHXA 7ICFA 3WK7A 5J2BA 7ICNA 3H8WA 5ALRA 2F8LA 4MF2A 3IG8A 4QWEA 3R9KA 2NO4A 4DSEA 5KFGA 4KLSA 2ES6A 5ALPA 2KOBA 3N97B 4CDGA 1N56A 1F44A 2JH7A 3QU2A 5DBCA 4RNOA 4FS1A 1TK0A 5DG7A 2J6SA 4J9MA 5KL8B 1PVQA 9ICIA 4C7ZA 4DL3A 1V9PA 1NJWA 1RZTA 2HVHA 1ZQRA 5BPCA 3HW8A 2ASLA 2WTFA 4DLEA 3V7KA 1N60A 4RQNA 4Q44A 3UXOA 2MRLA 3RR8A 4C8KA 1UCVA 3RR7A 8ICBA 3ETLA 2F3NA 3M6ZA 9ICJA 1KLNA 3KZIU 2Y9UA 2RRDA 2EZYA 2B0CA 5J0XA 1NI3A 2CPRA 4UAUA 2KTQA 1F0MA 5DQHA 4QZDA 4I27A 2BCUA 4UARA 2KVSA 5AKZA 2DPIA 2NRWA 5KT6A 5KL1B 1KDHA 1PUZA 8ICCA 2HOFA 4JWNA 4O3OA 2LBOA 1HIWA 3EPGA 4U7CA 4DFPA 2ZIVA 4LJXA 3D2NA 4NM2A 4Y2QA 4QZAA 4CCHA 3UXNA 8ICOA 4IRDA 2MAXA 1KBUA 2WB1F 4RUCA 3ZDDA 4P0QA 4RZRA 3RFAA 5AKKA 4C4SA 4RQ8A 3T79A 1ZETA 2Y0SC 2XY6A 2JEIA 4QZIA 4Y2TA 2HHWA 4KLUA 4KLGA 2P6RA 1DXSA 4DOBA 2O6KA 2E8PA 1A6SA 1QQ6A 3A0HU 1T7PA 4RQ1A 5DB9A 2UVRA 3F2DA 8ICLA 9ICOA 4I2FA 4KTQA 4UB3A 1KEJA 2KG5A 3MABA 8ICAA 8ICZA 5B5EU 3WU2U 3LVWA 4DQRA 4IR9A 2E8OA 2H3IA 3SV4A 1ZQGA 1S5LU 1CUKA 2PFOA 8ICHA 4F8RA 2BHNA 4K4HA 2LI6A 1L7NA 2NYVA 2ALZA 1ZJMA 4M6WB 3K75D 2XIDA 3AQFA 4YMNA 5KT2A 2WHEA 1URJA 3JPOA 2JGAA 7ICVA 3NVWA 3V72A 1AQ6A 1CRXA 4F92B 1RG6A 1VLBA 4IL6U 1NK5A 4FZNA 3TADA 4UAWA 3SI8A 1Z00A 4NXZA 3T5HA 3UMCA 4F91B 3MDAA 1LKYA 1U4BA 2KN7A 1K1SA 2PMZF 3BJYA 4KX5A 4CF3A 4KLJA 1JXLA 2WF5A 4B9LA 2PFNA 2P35A 2ZJAA 3THVA 2RQ5A 5KTQA 4OJ5A 3C28A 4DSIA 2E5SA 2NRZA 5AK4A 3GV8B 1UA0A 5AK5A 4O5CA 2K8AA 2C2DA 1HUOA 4P4PA 2QARA 5KT5A 4U6PA 9ICTA 4F4ZA 4F4YA 1Q3UA 5AKYA 3QEBZ 1L3UA 2WAQC 1C20A 2HSZA 4CF4A 2BCVA 4DWIA 4Y2VA 2I5HA 3V7LA 3T3FA 4I2CA 1JI7A 9ICFA 4RQMA 2KZ3A 3MR5A 4ECTA 4UB2A 1FO4A 4OJ6A 2DUYA 1ZQUA 4EEYA 5KFEA 2ZUCA 5CHGA 3OPXA 3CP8A 3OGUA 3HILA 1DOQA 3IN5A 2G5HB 4R8UA 3M1YA 4F4XA 3RB0A 2I9GA 5AICA 1IG6A 1AROP 2Z7JA 3ZD9A 4P4OA 2ZIVB 4UBBA 2KIVA 4C8NA 4RPYA 3TQ1A 5EE9A 4DL2A 4NLBA 4RPXA 2ZIWB 8ICPA 2MA1A 1ZQNA 5ALIA 1SWVA 5J0TA 2BQRA 2C22A 4J9LA 2E1EA 5KFRA 3RBDA 3D2QA 4Y2XA 4R66A 4QZ9A 2FMSA 4PHPA 5CB1A 2AGPA 5DQIA 2W9CA 2ISOA 3OSPA 4M9NA 1COOA 5KFDA 3F53A 3GQCA 1T8EA 2HBMA 7ICEA 5IIMA 3AN1A 5HHIA 4GFJA 2BPFA 2HBJA 3C5FA 2C28A 4KLMA 2G07A 4KLEA 1J97A 1V97A 5KT3A 1ZQBA 2Y9TA 5ALTA 3SENA 2FI1A 2OXOA 3M9OB 3AEVA 2F76X 2DF4B 3RF9A 1QTMA 3ICXA 4JK1A 4F5OA 3DDHA 1TVAA 1PZNA 3GILA 5ALKA 1TV9A 1SXEA 8ICVA 1ZXIA 3ONNA 5DLFA 4C8OA 1IIPA 3GIIA 1ZYQA 4ECQA 3HKZC 2DKXA 4NV0A 2BDUA 5KFXA 4F5PA 3K1RB 1L7PA 1MQ2A 3ED5A 1VDVA 4M9JA 8ICJA 3JPSA 1ZQZA 8ICWA 2VJ5A 5JRTA 4YXMA 5ALUA 3RJIA 3QZ8A 4QIWC 8ICGA 4CE6A 2YMMA 2R8IA 2EANA 4O3PA 3AL0B 3KFUF 3DV9A 5KFZA 5DGBA 2K4HA 2KKPA 1XSLA 9ICVA 2IHNA 4YR3A 4F71A 3N7PD 1ZD3A 3NS1A 2QB0A 3RJGA 4DCCA 2WFAA 3MGHA 8ICXA 4Y2YA 4NLGA 4UW9A 5AM2A 4DLGA 4JB3A 3RBEA 3B0YA 1RXWA 4C80A 9ICRA 1X9SA 3O0FA 2KICA 2VJ4A 3BS7A 5J2DA 2XCAA 2DL0A 7ICSA 1QQ7A 4OD0A 1B4FA 4GXKA 4M47A 1KL9A 4RPZA 2KSOB 4O3QA 5D4BA 3G6XA 3C2MA 3KBBA 4Y2SA 3J81j 3GV7B 5KFMA 1SGGA 1PK1A 5AKHA 4ED6A 2JEFA 2EAPA 1Q46A 4FFDA 1RQLA 3CRXA 3BS5B 4FS2A 3MGVA 5AM4A 1B43A 3MFHA 1Z1BA 1ZQJA 4PZNA 5J8YC 1XNSA 1ZQLA 5B66U 1RYRA 5J2HA 5JTIA 4M9GA 4KLOA 2V9WA 4GC6A 4NLZA 1KW4A 4JUZA 3PW5A 2MUTB 2VIXA 1X42A 3KHRA 1ZQKA 2DPJA 3SMVA 3UMBA 4ECRA 2V4QA 5TISU 5KFAA 3M9NB 8ICMA 2P6UA 3ZDEA 2G09A 4X5VA 1ZQQA 3NVYA 1S0VA 2IOFA 3C1ZA 2XCPA 5J0YA 2YX8A 3MR6A 4DOCA 3MDCA 3EW9A 5A0LA 2KFZA 2FPLA 2MSNA 4J03A 1N48A 2KHVA 2AHOB 2XI9A 4AYBF 2YB4A 5AM1A 3PSPA 4I2DA 4GLXA 4ECSA 3KTQA 7ICHA 5DB7A 5ALWA 4A8EA 1RQNA 5AM5A 1ZD4A 4F5RA 4EX7A 4J9QA 2DWQA 5EE1A 3GIKA 4FE3A 4KLQA 1TAQA 3AMZA 2E1FA 3D2SA 1QQ5A 3QX7A 5KFNA 4O5EA 3NRWA 8ICUA 1OUQA 5J0RA 4DSFA 3PY8A 3TAQA 5DB6A 1ZQSA 3ISBA 4ICAA 4KLIA 1QCKA 1H38A 4PGQA 5AK3A 2FDRA 1BPXA 3WK8A 4FBUA 3QUTA 2HMXA 4B9TA 3GV5B 5ALFA 4I2IA 1ZD2P 3RH5A 4BXOB 3H0RB 1TK8A 2G06A 4OJPA 4EYHB 4MFFA 5L1IA 5HR6A 3ZD8A 2LYAA 2HBKA 1QH9A 3C1YA 2KV2A 1Z4NA 3NVZA 4IQWA 5KFKA 1RM6C 4RUAA 2W9BA 2C2EA 2QB0B 4IQUA 4O3MA 1JMSA 1Q8KA 1D8YA 4KLLA 4R63A 3LVVA 4IC9A 7ICLA 2A3VA 4Z6EA 1ZQYA 2BQ3A 1ZQVA 4DS5A 4BDPA 4TUQA 5IIOA 9ICSA 2F1IA 3BQ0A 1U49A 2A19A 9ICCA 4JV0A 2AH5A 4M9HA 1FEZA 5KT7A 2W11A 2VA2A 1ZQOA 4DL7A 4UB4A 5HNKA 5KFSA 2W3RA 3QYPA 3H4DA 1D8LA 2HVIA 3I76A 4IQTA 5KG5A 1KN5A 2RP5A 9ICAA 2JRZA 3LDAA 1SKWA 3ISDA 1CEZA 1XS9D 9ICHA 3FM9A 3WK4A 2YMLA 4F3OA 2EZXA 2G5IB 8ICYA 5ALJA 2M9NA 4EBDA 2Q4TA 9ICUA 3NVVA 3H8MA 4R64A 3M6KA 5L1MA 3ZDCA 3PNCA 2LM1A 4LZDA 1FFUA 1HEKA 3PX4A 5ALDA 4DQIA 3QE9Y 2DQNB 3NASA 2EQYA 3RTVA 1YZ6A 3OHAA 2NRVA 3UQ0A 3SAHA 5KFTA 3JPRA 1N61A 5EOZA 1YT3A 1ZQAA 1XWLA 4OJLA 2JXJA 2P66A 2DGZA 5J2EA 4PHAA 1S0NA 1WCNA 3EUB2 3N7SC 4IS7A 2HDOA 5J8YA 4M6WA 5DG8A 2ZTEA 3GU3A 1SL2A 1UT5A 9ICMA 3OJUA 2KVCA 3QU9A 2K8CB 5T14A 3VC8A 1N63A 1X40A 5J2KA 1SWWA 3ORYA 4UB1A 4PHDA 1X6IA 1BNPA 3LWLA 2F1JA 5AKEA 3HP6A 4PL2A 2G0AA 4CF5A 1XO0A 4NL9C 5J2FA 2IBKA 4DFKA 2PI4A 5HR7A 4UB5A 2IHMA 2LM4A 2VANA 4UAVA 1COKA 3KHLA 4LZGA 3Q8KA 3BS5A 9ICLA 3A0BU 1MQ3A 2WB1C 5KFWA 2E8NA 4EBEA 1T3NA 4J9OA 4Q8EA 5J29A 4E0DA 4RQ6A 8ICKA 2A1JA 3HRDD 2W03A 2KZZA 5ALNA 4XQ8A 4YR0A 3FDSA 2NRTA 4ECWA 5AI0A 4I2JA 2K4IA 2BQUA 1XO1A 3ZDBA 1DRGA 5AI6A 4IQVA 2W7PA 1S9FA 1TK5A 7ICMA 5ALVA 4ZH4A 1SKRA 4O9MA 5CR0A 2F44A 2XY5A 4KX3A 3UM9A 3RAQA 2PI5A 5KAIU 3QEAZ 4DQSA 1IXRA 4J9RA 1XSPA 2BDPA 2HOIA 1T94A 5KFVA 4P0PA 1ZQ1C 3SR6A 3L4PA 1TFRA 3HPOA 1C7YA 3WKBA 1XSNA 4FZMA 4RQ7A 2KNJA 2WF6A 3OJSA 3NTUA 4JMUA 5ALGA 4TQSA 1OW5A 4NJ8A 1SKSA 5J2IA 2PMZC 1KFDA 5G5GA 4PGYA 1RDFA 5KFUA 4F50A 3V7JA 3RRGA 3E0FA 5AKJA 5K4LA 4IRKA 5AKXA 4B9SA 3PW4A 1BPYA 5HMLA 5AK6A 1UHUA 1JUDA 3I28A 1QSLA 2AQ4A 2ZIUB 2ZXIA 5KFQA 2QLTA 4KITB 3WKDA 1ZQTA 4GXJA 5CRXA 2FLPA 4PGXA 4DSKA 4DF4A 1V38A 1BPDA 3GDXA 4F2RA 1L6NA 2W04A 1A0PA 4OO1J 4DEZA 2XGQA 8ICNA 1O08A 2OHFA 2IOHA 2KK0A 4R65A 4MEYA 1JROA 4UB8U 4NL9A 4ED0A 3RH6A 2BCSA 2JEJA 4ED1A 1NKBA 4YR2A 3MC1A 1B0XA 5J2AA 5J2CA 3WKAA 2I1QA 5KG7A 3S6JA 2YMPA 7ICPA 8ICIA 5D46A 4PJ0U 1D9FA 3HX0A 3QUQA 1L3SA 4Y2PA 5AI4A 4TURA 2RHFA 2W9MA 2BPGA 1SV0A 1VJ5A 1KFSA 3MR3A 4P0QB 4J9NA 5DQGA 3SV3A 1SIJA 2VA8A 1LV5A 4KN7A 4DS4A 2KD1A 5C0YA 5AKGA 1Q3VA 3E2EA 9ICXA 5KG3A 1NK4A 2FE9A 3CW2C 1SB3C 1X66A 1NNLA 4Q45A 2N1RA 3QNMA 8ICFA 4PZOA 2G08A 2BCQA 2BR0A 4QZEA 3BQ1A 3LYSA 4BXOA 4US8A 4BWJA 4QZGA 1ECWA 2IA6A 2HHTA 4QJFB 2Y1IA 4UASA 4MFAA 2H3ZA 3V6KA 2K4PA 4ECUA 5J2GA 4IR1A 4C8MA 5IILA 3NGDA 3JPQA 1KSPA 1S76D 3QU5A 4P0PB 1RYUA 1FFVA 1HJPA 3TKAA 2HI0A 4DFDA 1NJXA 3HJEA 4LVSA 2GOLA 2FJ6A 2XVTA 4EYIB 4ELTA 3L5KA 4YCXA 2XY7A 4DOAA 2YY6A 2JEGA 4K4IA 3RJKA 3HT3A 8ICEA 3TARA 3PR4A 3H8SA 1D9DA 3HKZF 4RQ0A 3BZKA 4XUSA 2QKQA 4M04A 1QLNA 3BZCA 1L3VA 1OXJA 3RJJA 4KN4A 4ACOA 1IV8A 5ALZA 4YXJA 4F5NA 5HMMA 2KP7A 1NZPA 1BPBA 3WK9A 5AI9A 2V4RA 2WF9A 2B21A 4QZFA 3N28A 5DBAA 1LVHA 4QIWF 5KG1A 2F77X 5KFIA 1WUDA 5J0OA 1ZQDA 1BVSA 1F5SA 1Z00B 1ZQPA 2W43A 3WKEA 4C7YA 1ZQMA 3F2CA 4B9VA 1LB2B 1ZRNA 3WK5A 2CN1A 3UXPA 4JV1A 2PFPA 2W8KA 1KFTA 3RB3A 4DL6A 4RNNA 4UBCA 4F4KA 9ICQA 4CGZA 7ICIA 5J0SA 7ICTA 3IRUA 4QWBA 3WK6A 1Y88A 1Z4OA 1V85A 4KLTA 4PHEA 3RJHA 3H7IA 3ALRA 3C2LA 1U48A 4MHVA 1NK7A 2FLNA 3RJEA 2HHQA 7ICKA 1SV4A 1N5WA 4XA5A 4YG2A 1K1QA 5KNIA 1U45A 1ZQFA 2KKVA 3IM1A 3QU7A 5ALQA 5F3XB 4DO9A 3UMGA 4B6JA 1BGXT 5L1LA 1TAMA 1KTQA 4RQ2A 4US9A 1TE2A 2F1HA 4UATA 3PO5A 7ICJA 3I1YA 4NWIA 3M9MB 4JV2A 1N2XA 3ISCA 9ICEA 5G5HA 2FMQA 4WJ3B 3C2KA 2F2AB 1GO3F 2Q0ZX 4QZCA 2PKEA 4MF8A 4TUSA 2VA3A 1S77D 2HW3A 4RQ3A 2VKQA 5J2JA 4DQQA 3Q8LA 2KE7A 5EWFA 1ZQHA 4HYKA 4R8UB 3F5AA 4CRXA 3EPIA 5DBBA 3PW7A 2JH1A 2MUTA 2Y0SF 4DF8A 1JRPA 1L7MA 4F4WA 2HBLA 4QWCA 3H40A 4KMUA 2YB1A 2ASJA 3JPTA 4Z6FA 4OJOA 5KFJA 1WYGA 4YFKA 2ZIWA 4J9KA 5D49A 2HHUA 3CYMA 4JWMA 3H8JA 2LKYA 3IV6A 3PMLA 4AYBC 2J6TA 2YTUA 2FLLA 1SL1A 3SYZA 3OSNA 1U9LA 2DKZA 4RQ4A 3TACB 1P7DA 2EZZA 3RB4A 5EWEA 1JIHA 4DL5A 5DKWA 3QZ7A 4B9UA 2YQEA 2KEYA 4NM1A 4PPXA 3PV8A 1IM4A 4NY8A 3EYZA 4M9LA 3Q8QB 4ECVA 1X9XA 4I2EA 4M2YA 4BGDA 5KFFA 2XC9A 2KMDA 3SAFA 2ESEA 3AM9A 4DQPA 1J2MA 3V6JA 1NK8A 3PW0A 5BOLA 4XRHA 5DGAA 5KFLA 2K4EA 4MEXA 4IRCA 3TAPA 9ICBA 1MC8A 4BWMA 1SL0A 4EZ9A 2IMWP 2AU0A 4GC7A 3QXGA 4UAZA 4O5KA 5EE3A 2W9CB 2AQ0A 2IOFK 8ICTA 3HWTA 4BUGA 2ODGA 4F72A 3MR2A 4UAYA 2NRXA 5GTIU 1T3QA 1X9WA 1BPZA 4YN4A 2ZIXA 1L3TA 3IHQB 2QARB 3SAGA 2BCRA 2JMGA 3TADC 8ICQA 2H3QA 3QUCA 1X9MA 4I2BA 4AP9A 3UQ2A 4O0IA 4F5QA 1Z1VA 4RT3A 2E8MA 3U26A 1QSYA 5KG6A 3OTQA 2WAQF 5AKLA 2W9BB 1Z19A 4ED3A 3KHHA 1S0OA 5TZVA 2Y1JA 3SQIA 1S10A 3M7DA 3PZPA 2FMPA 1PK1B 5JU5A 3T5LA 2UVUA 3G6VA 1WG8A 1J2NA 1BPEA 4Q43A 4ECYA 1ZQIA 4DL4A 2M0NA 5ALSA 5BOMA 1T4GA 1ZQCA 2ZG6A 4P4MA 5KFYA 2D8CA 5E79U 4QW8A 2EDUA 2LPEA 7ICUA 2PXIA 2FPKA 3PSIA 3PW2A 2HOQA 3AUOA 3RB6A 3N4MB 5DG9A 4GXIA 2LYHA 2OWOA 3MFIA 4QWDA 3KKAA 3TANA 4C0ZA 4O3SA 1S0MA 5AIAA 2XO7A 1ZRMA 2YN4A 1PVPA 2KHQA 2ZJ5A 2OEHA 4YMMA 3OHBA 3GFKB 2K89A 1X6JA 5JUMA 3AU6A 4TQRA 4F2SA 2KSOA 4EX6A 9ICNA 2OCEA 5C5JA 2H5XA 1A77A 4YD1A 1L8LA 4I2AA 5F9NA 2PFQA 3PX6A 5IIKA 4G9BA 2LYBA 5KFBA 4Q8FA 3PVXA 4RNMA 5J0UA 2D6FC 3KOOA 3RAXA 4NLCA 2HHXA 3PX0A 5HHHA 3BQ2A 1O03A 1SZHA 4Y2RA 5ALOA 3TFSA 4DFJA 5CP2A 2W9AA 3RH4A 5L1JA 3Q8SB 1NOMA 5GTHU 4C4TA 3F2BA 1TAUA 1NK9A 1WWVA 3GIJA 3VCBA 2WF8A 5KT4A 2D3DA 3Q8MA 5DDYA 4ECXA 8ICSA 5AM0A 4EELA 1PVRA 1NKCA 2NO5A 5IINA 3PSTA 5ALMA 3JPPA 3LK9A 2OM6A 1K5OA 3SEIA 1KQQA 4DSJA 1MSWD 1XC9A 1JN3A 3RJFA 4ED2A 3F5EA 1ZOLA 4QZHA 3D6JA 3KZXA 4EENA 3TI0A 4EBCA 2E3TA 3KD3A 3NUQA 2ZTCA 4USAA 2OYYA 1WCLA 4TUPA 2XGPA 2R8JA 5KAFU 3CNHA 2EAMA 1RXVA 4YD2A 3QU4A 5L1KA 2ZUDA 1WWUA 2HHVA 1D8BA 3ZI4A 1ZQXA 5CEHA 5DLGA 5J0WA 1JXEA 3MGIA 3KHGA 4NLNA 2K60A 3C5GA 4I28A 2AGOA 2LHTA 4CNQA 1NK6A 2JV3A 7ICRA 3K1ZA 4RQ5A 2W7OA 1FIQA 3B0XA 3KKAC 1EXNA 3IDWA 3SD7A 3BQTA 5L9XA 1L5UA 3QUBA 4C4RA 3TFRA 1UA1A 1KKXA 2RDJA 4ECZA 2ZJ8A 5CJ7A 3H4BA 3H0LB 1ZJNA 4B9NA 7ICOA 3Q8PB 1A76A 2RDIA 5ALYA 5AKIA 1L8OA 4QNLA 4MFCA 2GH1A 3GZFA 1PK3A 2ISPA 1UPHA 2EAOA 1QSSA 5EE0A 3K4GA 5F9LA 3IG5A 5KFCA 2W55A 4KMOB 5EWGA 2R8GA 1ZQWA 5J0QA 2KZMA 2KFNA 1RPLA 5ALLA 4KLDA 4G3IA 2HHSA 1NKEA 1N5XA 1U47A 5CWRA 3C29A 4ELUA 2ASDA 3DEEA 4EEKA 1RYSA 1JALA 2J6UA 4FO6A 2DBYA 5DB8A 4I2HA 1SXDA 1M6YA 3C21A 4PH5A 4Z6DA 3WKCA 3IP4B 2ZXHA 4Y2JA 3FC4A 4ELVA 4BJQA 1HUZA 2AXTU 2MU2A 1DGJA 2UVVA 3Q8RB 1SV0C 2QB1A 1S97A 3L3FX 5DDMA 4RT2A 2K8BB 2RLTA 9ICPA 2OH2A 3H0MB 3M8SA 4ZOHC 1SZPA 3ETRA 2DFLA 3RRHA 4C8LA 4YQWA 4I29A 1N62A 3PSFA 4QZBA 7ICQA 1DK3A 1UT8A 4QW9A 3T5JA 1NJYA 2EH9A 3T5KA 4QZ8A 2BKEA 4HAIA 2H3VA 9ICWA 1CI4A 3MBYA 1ED1A 1Z3EB 2KJ8A 5AM3A 2FPMA 4B9MA 1MN8A 2CRXA
chains in the Genus database with same CATH topology
2E8MA 2QB0A 4NJ8A 1X40A 2FE9A 1X66A 2D3DA 1PK1B 5JU5A 2QARA 4NL9C 4PZOA 1PK3A 2YTUA 2EAOA 1DXSA 3SEIA 1COKA 3BS7A 2DKZA 2ES6A 2L5YA 3TACB 3BS5A 2DL0A 2E8PA 2D8CA 2E8NA 2LPEA 2Y9TA 3SENA 1B4FA 2K4PA 2KSOB 1JI7A 1V38A 2F8KA 1V85A 2KG5A 1SGGA 4RQMA 1PK1A 3KKAA 4MHVA 1SXEA 2E8OA 2EAPA 1X9XA 1SXDA 1SV4A 2KMDA 2ESEA 2B6GA 5KNIA 3H8MA 3BS5B 2DKXA 4NL9A 5L1MA 2EAMA 4RQNA 3HILA 1B0XA 5F3XB 1WWUA 3BQ7A 4PZNA 1UCVA 2KSOA 5J8YC 2LMRA 3K1RB 2F44A 2F3NA 1SV0C 1UQVA 2QB1A 2Y9UA 5JTIA 1KW4A 1RG6A 2K60A 2QB0B 2KIVA 2QKQA 1F0MA 3TADA 2JV3A 1OXJA 5JRTA 1SV0A 1LKYA 3KKAC 4IS7A 5J8YA 3IDWA 2EANA 2KE7A 1WWVA 2QARB 3TADC 1LKYB 2GLEA 1Z1VA 1OW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8M A;  2QB0 A;  4NJ8 A;  1X40 A;  2FE9 A;  1X66 A;  2D3D A;  1PK1 B;  5JU5 A;  2QAR A;  4NL9 C;  4PZO A;  1PK3 A;  2YTU A;  2EAO A;  1DXS A;  3SEI A;  1COK A;  3BS7 A;  2DKZ A;  2ES6 A;  2L5Y A;  3TAC B;  3BS5 A;  2DL0 A;  2E8P A;  2D8C A;  2E8N A;  2LPE A;  2Y9T A;  3SEN A;  1B4F A;  2K4P A;  2KSO B;  1JI7 A;  1V38 A;  2F8K A;  1V85 A;  2KG5 A;  1SGG A;  4RQM A;  1PK1 A;  3KKA A;  4MHV A;  1SXE A;  2E8O A;  2EAP A;  1X9X A;  1SXD A;  1SV4 A;  2KMD A;  2ESE A;  2B6G A;  5KNI A;  3H8M A;  3BS5 B;  2DKX A;  4NL9 A;  5L1M A;  2EAM A;  4RQN A;  3HIL A;  1B0X A;  5F3X B;  1WWU A;  3BQ7 A;  4PZN A;  1UCV A;  2KSO A;  5J8Y C;  2LMR A;  3K1R B;  2F44 A;  2F3N A;  1SV0 C;  1UQV A;  2QB1 A;  2Y9U A;  5JTI A;  1KW4 A;  1RG6 A;  2K60 A;  2QB0 B;  2KIV A;  2QKQ A;  1F0M A;  3TAD A;  2JV3 A;  1OXJ A;  5JRT A;  1SV0 A;  1LKY A;  3KKA C;  4IS7 A;  5J8Y A;  3IDW A;  2EAN A;  2KE7 A;  1WWV A;  2QAR B;  3TAD C;  1LKY B;  2GLE A;  1Z1V A;  1OW5 A; 
#chains in the Genus database with same CATH topology
 2KJ9 A;  3NRZ A;  5ALH A;  3V6H A;  4KLH A;  9ICK A;  2BZF A;  2JR5 A;  1ZQE A;  4I2G A;  5HP4 A;  4DSL A;  5KFO A;  5ALX A;  1XU4 A;  3UPQ A;  1KRP A;  5KFH A;  4GIB A;  5AI5 A;  2A1J B;  5AI8 A;  4UQG A;  1YZ7 A;  4QWA A;  2A1A A;  3FYH A;  4YMO A;  4YP3 A;  4J9S A;  4ED8 A;  3ZDA A;  2AGQ A;  3PR5 B;  1B22 A;  2HCF A;  4O3R A;  5III A;  5AIB A;  3JPN A;  2L5Y A;  5ALE A;  3EZ5 A;  4O3N A;  5KG2 A;  5KG4 A;  8ICR A;  2W3S A;  4BX9 C;  2C2R A;  1NJZ A;  4EZ6 A;  4K4G A;  1NK0 A;  4UB6 U;  9ICG A;  2GO7 A;  2F8K A;  1NZB A;  4OCZ A;  2XIC A;  2BPC A;  1DGS A;  1X2I A;  1BNO A;  2W54 A;  5IIJ A;  4Y2U A;  3AU2 A;  4NLK A;  1L7O A;  2R18 A;  2B6G A;  3B9J A;  3N7R C;  3SZ2 A;  4RU9 A;  2ZIU A;  4Z6C A;  2AJQ A;  2CXY A;  3AQE A;  3G6Y A;  1JX4 A;  2UVW A;  3BQ7 A;  4KLF A;  3GIM A;  2LMR A;  4DFM A;  2JZB B;  3M8R A;  3PMN A;  4ED7 A;  4P2H A;  1UQV A;  3C23 A;  4J9P A;  3PO4 A;  4PL1 A;  3E58 A;  3BDP A;  5H2F U;  2H3F A;  1TKD A;  4YVZ A;  2JHD A;  2ATL A;  2R8H A;  2W8L A;  4FBT A;  5J0P A;  2WF7 A;  2KIW A;  3EWA A;  2ZUB A;  4M0A A;  2I6X A;  2JZB A;  2YMQ A;  2ZTD A;  2BGW A;  2KJ5 A;  3FAH A;  1LKY B;  2GLE A;  1DK2 A;  5KFP A;  2ZIX B;  7ICG A;  1ZD5 A;  5KG0 A;  4F93 B;  1MA7 A;  5FP0 A;  2R8K A;  2NV3 A;  4FZL A;  2GWS A;  1S8O A;  5CA7 A;  3LWM A;  5AHX A;  7ICF A;  3WK7 A;  5J2B A;  7ICN A;  3H8W A;  5ALR A;  2F8L A;  4MF2 A;  3IG8 A;  4QWE A;  3R9K A;  2NO4 A;  4DSE A;  5KFG A;  4KLS A;  2ES6 A;  5ALP A;  2KOB A;  3N97 B;  4CDG A;  1N56 A;  1F44 A;  2JH7 A;  3QU2 A;  5DBC A;  4RNO A;  4FS1 A;  1TK0 A;  5DG7 A;  2J6S A;  4J9M A;  5KL8 B;  1PVQ A;  9ICI A;  4C7Z A;  4DL3 A;  1V9P A;  1NJW A;  1RZT A;  2HVH A;  1ZQR A;  5BPC A;  3HW8 A;  2ASL A;  2WTF A;  4DLE A;  3V7K A;  1N60 A;  4RQN A;  4Q44 A;  3UXO A;  2MRL A;  3RR8 A;  4C8K A;  1UCV A;  3RR7 A;  8ICB A;  3ETL A;  2F3N A;  3M6Z A;  9ICJ A;  1KLN A;  3KZI U;  2Y9U A;  2RRD A;  2EZY A;  2B0C A;  5J0X A;  1NI3 A;  2CPR A;  4UAU A;  2KTQ A;  1F0M A;  5DQH A;  4QZD A;  4I27 A;  2BCU A;  4UAR A;  2KVS A;  5AKZ A;  2DPI A;  2NRW A;  5KT6 A;  5KL1 B;  1KDH A;  1PUZ A;  8ICC A;  2HOF A;  4JWN A;  4O3O A;  2LBO A;  1HIW A;  3EPG A;  4U7C A;  4DFP A;  2ZIV A;  4LJX A;  3D2N A;  4NM2 A;  4Y2Q A;  4QZA A;  4CCH A;  3UXN A;  8ICO A;  4IRD A;  2MAX A;  1KBU A;  2WB1 F;  4RUC A;  3ZDD A;  4P0Q A;  4RZR A;  3RFA A;  5AKK A;  4C4S A;  4RQ8 A;  3T79 A;  1ZET A;  2Y0S C;  2XY6 A;  2JEI A;  4QZI A;  4Y2T A;  2HHW A;  4KLU A;  4KLG A;  2P6R A;  1DXS A;  4DOB A;  2O6K A;  2E8P A;  1A6S A;  1QQ6 A;  3A0H U;  1T7P A;  4RQ1 A;  5DB9 A;  2UVR A;  3F2D A;  8ICL A;  9ICO A;  4I2F A;  4KTQ A;  4UB3 A;  1KEJ A;  2KG5 A;  3MAB A;  8ICA A;  8ICZ A;  5B5E U;  3WU2 U;  3LVW A;  4DQR A;  4IR9 A;  2E8O A;  2H3I A;  3SV4 A;  1ZQG A;  1S5L U;  1CUK A;  2PFO A;  8ICH A;  4F8R A;  2BHN A;  4K4H A;  2LI6 A;  1L7N A;  2NYV A;  2ALZ A;  1ZJM A;  4M6W B;  3K75 D;  2XID A;  3AQF A;  4YMN A;  5KT2 A;  2WHE A;  1URJ A;  3JPO A;  2JGA A;  7ICV A;  3NVW A;  3V72 A;  1AQ6 A;  1CRX A;  4F92 B;  1RG6 A;  1VLB A;  4IL6 U;  1NK5 A;  4FZN A;  3TAD A;  4UAW A;  3SI8 A;  1Z00 A;  4NXZ A;  3T5H A;  3UMC A;  4F91 B;  3MDA A;  1LKY A;  1U4B A;  2KN7 A;  1K1S A;  2PMZ F;  3BJY A;  4KX5 A;  4CF3 A;  4KLJ A;  1JXL A;  2WF5 A;  4B9L A;  2PFN A;  2P35 A;  2ZJA A;  3THV A;  2RQ5 A;  5KTQ A;  4OJ5 A;  3C28 A;  4DSI A;  2E5S A;  2NRZ A;  5AK4 A;  3GV8 B;  1UA0 A;  5AK5 A;  4O5C A;  2K8A A;  2C2D A;  1HUO A;  4P4P A;  2QAR A;  5KT5 A;  4U6P A;  9ICT A;  4F4Z A;  4F4Y A;  1Q3U A;  5AKY A;  3QEB Z;  1L3U A;  2WAQ C;  1C20 A;  2HSZ A;  4CF4 A;  2BCV A;  4DWI A;  4Y2V A;  2I5H A;  3V7L A;  3T3F A;  4I2C A;  1JI7 A;  9ICF A;  4RQM A;  2KZ3 A;  3MR5 A;  4ECT A;  4UB2 A;  1FO4 A;  4OJ6 A;  2DUY A;  1ZQU A;  4EEY A;  5KFE A;  2ZUC A;  5CHG A;  3OPX A;  3CP8 A;  3OGU A;  3HIL A;  1DOQ A;  3IN5 A;  2G5H B;  4R8U A;  3M1Y A;  4F4X A;  3RB0 A;  2I9G A;  5AIC A;  1IG6 A;  1ARO P;  2Z7J A;  3ZD9 A;  4P4O A;  2ZIV B;  4UBB A;  2KIV A;  4C8N A;  4RPY A;  3TQ1 A;  5EE9 A;  4DL2 A;  4NLB A;  4RPX A;  2ZIW B;  8ICP A;  2MA1 A;  1ZQN A;  5ALI A;  1SWV A;  5J0T A;  2BQR A;  2C22 A;  4J9L A;  2E1E A;  5KFR A;  3RBD A;  3D2Q A;  4Y2X A;  4R66 A;  4QZ9 A;  2FMS A;  4PHP A;  5CB1 A;  2AGP A;  5DQI A;  2W9C A;  2ISO A;  3OSP A;  4M9N A;  1COO A;  5KFD A;  3F53 A;  3GQC A;  1T8E A;  2HBM A;  7ICE A;  5IIM A;  3AN1 A;  5HHI A;  4GFJ A;  2BPF A;  2HBJ A;  3C5F A;  2C28 A;  4KLM A;  2G07 A;  4KLE A;  1J97 A;  1V97 A;  5KT3 A;  1ZQB A;  2Y9T A;  5ALT A;  3SEN A;  2FI1 A;  2OXO A;  3M9O B;  3AEV A;  2F76 X;  2DF4 B;  3RF9 A;  1QTM A;  3ICX A;  4JK1 A;  4F5O A;  3DDH A;  1TVA A;  1PZN A;  3GIL A;  5ALK A;  1TV9 A;  1SXE A;  8ICV A;  1ZXI A;  3ONN A;  5DLF A;  4C8O A;  1IIP A;  3GII A;  1ZYQ A;  4ECQ A;  3HKZ C;  2DKX A;  4NV0 A;  2BDU A;  5KFX A;  4F5P A;  3K1R B;  1L7P A;  1MQ2 A;  3ED5 A;  1VDV A;  4M9J A;  8ICJ A;  3JPS A;  1ZQZ A;  8ICW A;  2VJ5 A;  5JRT A;  4YXM A;  5ALU A;  3RJI A;  3QZ8 A;  4QIW C;  8ICG A;  4CE6 A;  2YMM A;  2R8I A;  2EAN A;  4O3P A;  3AL0 B;  3KFU F;  3DV9 A;  5KFZ A;  5DGB A;  2K4H A;  2KKP A;  1XSL A;  9ICV A;  2IHN A;  4YR3 A;  4F71 A;  3N7P D;  1ZD3 A;  3NS1 A;  2QB0 A;  3RJG A;  4DCC A;  2WFA A;  3MGH A;  8ICX A;  4Y2Y A;  4NLG A;  4UW9 A;  5AM2 A;  4DLG A;  4JB3 A;  3RBE A;  3B0Y A;  1RXW A;  4C80 A;  9ICR A;  1X9S A;  3O0F A;  2KIC A;  2VJ4 A;  3BS7 A;  5J2D A;  2XCA A;  2DL0 A;  7ICS A;  1QQ7 A;  4OD0 A;  1B4F A;  4GXK A;  4M47 A;  1KL9 A;  4RPZ A;  2KSO B;  4O3Q A;  5D4B A;  3G6X A;  3C2M A;  3KBB A;  4Y2S A;  3J81 j;  3GV7 B;  5KFM A;  1SGG A;  1PK1 A;  5AKH A;  4ED6 A;  2JEF A;  2EAP A;  1Q46 A;  4FFD A;  1RQL A;  3CRX A;  3BS5 B;  4FS2 A;  3MGV A;  5AM4 A;  1B43 A;  3MFH A;  1Z1B A;  1ZQJ A;  4PZN A;  5J8Y C;  1XNS A;  1ZQL A;  5B66 U;  1RYR A;  5J2H A;  5JTI A;  4M9G A;  4KLO A;  2V9W A;  4GC6 A;  4NLZ A;  1KW4 A;  4JUZ A;  3PW5 A;  2MUT B;  2VIX A;  1X42 A;  3KHR A;  1ZQK A;  2DPJ A;  3SMV A;  3UMB A;  4ECR A;  2V4Q A;  5TIS U;  5KFA A;  3M9N B;  8ICM A;  2P6U A;  3ZDE A;  2G09 A;  4X5V A;  1ZQQ A;  3NVY A;  1S0V A;  2IOF A;  3C1Z A;  2XCP A;  5J0Y A;  2YX8 A;  3MR6 A;  4DOC A;  3MDC A;  3EW9 A;  5A0L A;  2KFZ A;  2FPL A;  2MSN A;  4J03 A;  1N48 A;  2KHV A;  2AHO B;  2XI9 A;  4AYB F;  2YB4 A;  5AM1 A;  3PSP A;  4I2D A;  4GLX A;  4ECS A;  3KTQ A;  7ICH A;  5DB7 A;  5ALW A;  4A8E A;  1RQN A;  5AM5 A;  1ZD4 A;  4F5R A;  4EX7 A;  4J9Q A;  2DWQ A;  5EE1 A;  3GIK A;  4FE3 A;  4KLQ A;  1TAQ A;  3AMZ A;  2E1F A;  3D2S A;  1QQ5 A;  3QX7 A;  5KFN A;  4O5E A;  3NRW A;  8ICU A;  1OUQ A;  5J0R A;  4DSF A;  3PY8 A;  3TAQ A;  5DB6 A;  1ZQS A;  3ISB A;  4ICA A;  4KLI A;  1QCK A;  1H38 A;  4PGQ A;  5AK3 A;  2FDR A;  1BPX A;  3WK8 A;  4FBU A;  3QUT A;  2HMX A;  4B9T A;  3GV5 B;  5ALF A;  4I2I A;  1ZD2 P;  3RH5 A;  4BXO B;  3H0R B;  1TK8 A;  2G06 A;  4OJP A;  4EYH B;  4MFF A;  5L1I A;  5HR6 A;  3ZD8 A;  2LYA A;  2HBK A;  1QH9 A;  3C1Y A;  2KV2 A;  1Z4N A;  3NVZ A;  4IQW A;  5KFK A;  1RM6 C;  4RUA A;  2W9B A;  2C2E A;  2QB0 B;  4IQU A;  4O3M A;  1JMS A;  1Q8K A;  1D8Y A;  4KLL A;  4R63 A;  3LVV A;  4IC9 A;  7ICL A;  2A3V A;  4Z6E A;  1ZQY A;  2BQ3 A;  1ZQV A;  4DS5 A;  4BDP A;  4TUQ A;  5IIO A;  9ICS A;  2F1I A;  3BQ0 A;  1U49 A;  2A19 A;  9ICC A;  4JV0 A;  2AH5 A;  4M9H A;  1FEZ A;  5KT7 A;  2W11 A;  2VA2 A;  1ZQO A;  4DL7 A;  4UB4 A;  5HNK A;  5KFS A;  2W3R A;  3QYP A;  3H4D A;  1D8L A;  2HVI A;  3I76 A;  4IQT A;  5KG5 A;  1KN5 A;  2RP5 A;  9ICA A;  2JRZ A;  3LDA A;  1SKW A;  3ISD A;  1CEZ A;  1XS9 D;  9ICH A;  3FM9 A;  3WK4 A;  2YML A;  4F3O A;  2EZX A;  2G5I B;  8ICY A;  5ALJ A;  2M9N A;  4EBD A;  2Q4T A;  9ICU A;  3NVV A;  3H8M A;  4R64 A;  3M6K A;  5L1M A;  3ZDC A;  3PNC A;  2LM1 A;  4LZD A;  1FFU A;  1HEK A;  3PX4 A;  5ALD A;  4DQI A;  3QE9 Y;  2DQN B;  3NAS A;  2EQY A;  3RTV A;  1YZ6 A;  3OHA A;  2NRV A;  3UQ0 A;  3SAH A;  5KFT A;  3JPR A;  1N61 A;  5EOZ A;  1YT3 A;  1ZQA A;  1XWL A;  4OJL A;  2JXJ A;  2P66 A;  2DGZ A;  5J2E A;  4PHA A;  1S0N A;  1WCN A;  3EUB 2;  3N7S C;  4IS7 A;  2HDO A;  5J8Y A;  4M6W A;  5DG8 A;  2ZTE A;  3GU3 A;  1SL2 A;  1UT5 A;  9ICM A;  3OJU A;  2KVC A;  3QU9 A;  2K8C B;  5T14 A;  3VC8 A;  1N63 A;  1X40 A;  5J2K A;  1SWW A;  3ORY A;  4UB1 A;  4PHD A;  1X6I A;  1BNP A;  3LWL A;  2F1J A;  5AKE A;  3HP6 A;  4PL2 A;  2G0A A;  4CF5 A;  1XO0 A;  4NL9 C;  5J2F A;  2IBK A;  4DFK A;  2PI4 A;  5HR7 A;  4UB5 A;  2IHM A;  2LM4 A;  2VAN A;  4UAV A;  1COK A;  3KHL A;  4LZG A;  3Q8K A;  3BS5 A;  9ICL A;  3A0B U;  1MQ3 A;  2WB1 C;  5KFW A;  2E8N A;  4EBE A;  1T3N A;  4J9O A;  4Q8E A;  5J29 A;  4E0D A;  4RQ6 A;  8ICK A;  2A1J A;  3HRD D;  2W03 A;  2KZZ A;  5ALN A;  4XQ8 A;  4YR0 A;  3FDS A;  2NRT A;  4ECW A;  5AI0 A;  4I2J A;  2K4I A;  2BQU A;  1XO1 A;  3ZDB A;  1DRG A;  5AI6 A;  4IQV A;  2W7P A;  1S9F A;  1TK5 A;  7ICM A;  5ALV A;  4ZH4 A;  1SKR A;  4O9M A;  5CR0 A;  2F44 A;  2XY5 A;  4KX3 A;  3UM9 A;  3RAQ A;  2PI5 A;  5KAI U;  3QEA Z;  4DQS A;  1IXR A;  4J9R A;  1XSP A;  2BDP A;  2HOI A;  1T94 A;  5KFV A;  4P0P A;  1ZQ1 C;  3SR6 A;  3L4P A;  1TFR A;  3HPO A;  1C7Y A;  3WKB A;  1XSN A;  4FZM A;  4RQ7 A;  2KNJ A;  2WF6 A;  3OJS A;  3NTU A;  4JMU A;  5ALG A;  4TQS A;  1OW5 A;  4NJ8 A;  1SKS A;  5J2I A;  2PMZ C;  1KFD A;  5G5G A;  4PGY A;  1RDF A;  5KFU A;  4F50 A;  3V7J A;  3RRG A;  3E0F A;  5AKJ A;  5K4L A;  4IRK A;  5AKX A;  4B9S A;  3PW4 A;  1BPY A;  5HML A;  5AK6 A;  1UHU A;  1JUD A;  3I28 A;  1QSL A;  2AQ4 A;  2ZIU B;  2ZXI A;  5KFQ A;  2QLT A;  4KIT B;  3WKD A;  1ZQT A;  4GXJ A;  5CRX A;  2FLP A;  4PGX A;  4DSK A;  4DF4 A;  1V38 A;  1BPD A;  3GDX A;  4F2R A;  1L6N A;  2W04 A;  1A0P A;  4OO1 J;  4DEZ A;  2XGQ A;  8ICN A;  1O08 A;  2OHF A;  2IOH A;  2KK0 A;  4R65 A;  4MEY A;  1JRO A;  4UB8 U;  4NL9 A;  4ED0 A;  3RH6 A;  2BCS A;  2JEJ A;  4ED1 A;  1NKB A;  4YR2 A;  3MC1 A;  1B0X A;  5J2A A;  5J2C A;  3WKA A;  2I1Q A;  5KG7 A;  3S6J A;  2YMP A;  7ICP A;  8ICI A;  5D46 A;  4PJ0 U;  1D9F A;  3HX0 A;  3QUQ A;  1L3S A;  4Y2P A;  5AI4 A;  4TUR A;  2RHF A;  2W9M A;  2BPG A;  1SV0 A;  1VJ5 A;  1KFS A;  3MR3 A;  4P0Q B;  4J9N A;  5DQG A;  3SV3 A;  1SIJ A;  2VA8 A;  1LV5 A;  4KN7 A;  4DS4 A;  2KD1 A;  5C0Y A;  5AKG A;  1Q3V A;  3E2E A;  9ICX A;  5KG3 A;  1NK4 A;  2FE9 A;  3CW2 C;  1SB3 C;  1X66 A;  1NNL A;  4Q45 A;  2N1R A;  3QNM A;  8ICF A;  4PZO A;  2G08 A;  2BCQ A;  2BR0 A;  4QZE A;  3BQ1 A;  3LYS A;  4BXO A;  4US8 A;  4BWJ A;  4QZG A;  1ECW A;  2IA6 A;  2HHT A;  4QJF B;  2Y1I A;  4UAS A;  4MFA A;  2H3Z A;  3V6K A;  2K4P A;  4ECU A;  5J2G A;  4IR1 A;  4C8M A;  5IIL A;  3NGD A;  3JPQ A;  1KSP A;  1S76 D;  3QU5 A;  4P0P B;  1RYU A;  1FFV A;  1HJP A;  3TKA A;  2HI0 A;  4DFD A;  1NJX A;  3HJE A;  4LVS A;  2GOL A;  2FJ6 A;  2XVT A;  4EYI B;  4ELT A;  3L5K A;  4YCX A;  2XY7 A;  4DOA A;  2YY6 A;  2JEG A;  4K4I A;  3RJK A;  3HT3 A;  8ICE A;  3TAR A;  3PR4 A;  3H8S A;  1D9D A;  3HKZ F;  4RQ0 A;  3BZK A;  4XUS A;  2QKQ A;  4M04 A;  1QLN A;  3BZC A;  1L3V A;  1OXJ A;  3RJJ A;  4KN4 A;  4ACO A;  1IV8 A;  5ALZ A;  4YXJ A;  4F5N A;  5HMM A;  2KP7 A;  1NZP A;  1BPB A;  3WK9 A;  5AI9 A;  2V4R A;  2WF9 A;  2B21 A;  4QZF A;  3N28 A;  5DBA A;  1LVH A;  4QIW F;  5KG1 A;  2F77 X;  5KFI A;  1WUD A;  5J0O A;  1ZQD A;  1BVS A;  1F5S A;  1Z00 B;  1ZQP A;  2W43 A;  3WKE A;  4C7Y A;  1ZQM A;  3F2C A;  4B9V A;  1LB2 B;  1ZRN A;  3WK5 A;  2CN1 A;  3UXP A;  4JV1 A;  2PFP A;  2W8K A;  1KFT A;  3RB3 A;  4DL6 A;  4RNN A;  4UBC A;  4F4K A;  9ICQ A;  4CGZ A;  7ICI A;  5J0S A;  7ICT A;  3IRU A;  4QWB A;  3WK6 A;  1Y88 A;  1Z4O A;  1V85 A;  4KLT A;  4PHE A;  3RJH A;  3H7I A;  3ALR A;  3C2L A;  1U48 A;  4MHV A;  1NK7 A;  2FLN A;  3RJE A;  2HHQ A;  7ICK A;  1SV4 A;  1N5W A;  4XA5 A;  4YG2 A;  1K1Q A;  5KNI A;  1U45 A;  1ZQF A;  2KKV A;  3IM1 A;  3QU7 A;  5ALQ A;  5F3X B;  4DO9 A;  3UMG A;  4B6J A;  1BGX T;  5L1L A;  1TAM A;  1KTQ A;  4RQ2 A;  4US9 A;  1TE2 A;  2F1H A;  4UAT A;  3PO5 A;  7ICJ A;  3I1Y A;  4NWI A;  3M9M B;  4JV2 A;  1N2X A;  3ISC A;  9ICE A;  5G5H A;  2FMQ A;  4WJ3 B;  3C2K A;  2F2A B;  1GO3 F;  2Q0Z X;  4QZC A;  2PKE A;  4MF8 A;  4TUS A;  2VA3 A;  1S77 D;  2HW3 A;  4RQ3 A;  2VKQ A;  5J2J A;  4DQQ A;  3Q8L A;  2KE7 A;  5EWF A;  1ZQH A;  4HYK A;  4R8U B;  3F5A A;  4CRX A;  3EPI A;  5DBB A;  3PW7 A;  2JH1 A;  2MUT A;  2Y0S F;  4DF8 A;  1JRP A;  1L7M A;  4F4W A;  2HBL A;  4QWC A;  3H40 A;  4KMU A;  2YB1 A;  2ASJ A;  3JPT A;  4Z6F A;  4OJO A;  5KFJ A;  1WYG A;  4YFK A;  2ZIW A;  4J9K A;  5D49 A;  2HHU A;  3CYM A;  4JWM A;  3H8J A;  2LKY A;  3IV6 A;  3PML A;  4AYB C;  2J6T A;  2YTU A;  2FLL A;  1SL1 A;  3SYZ A;  3OSN A;  1U9L A;  2DKZ A;  4RQ4 A;  3TAC B;  1P7D A;  2EZZ A;  3RB4 A;  5EWE A;  1JIH A;  4DL5 A;  5DKW A;  3QZ7 A;  4B9U A;  2YQE A;  2KEY A;  4NM1 A;  4PPX A;  3PV8 A;  1IM4 A;  4NY8 A;  3EYZ A;  4M9L A;  3Q8Q B;  4ECV A;  1X9X A;  4I2E A;  4M2Y A;  4BGD A;  5KFF A;  2XC9 A;  2KMD A;  3SAF A;  2ESE A;  3AM9 A;  4DQP A;  1J2M A;  3V6J A;  1NK8 A;  3PW0 A;  5BOL A;  4XRH A;  5DGA A;  5KFL A;  2K4E A;  4MEX A;  4IRC A;  3TAP A;  9ICB A;  1MC8 A;  4BWM A;  1SL0 A;  4EZ9 A;  2IMW P;  2AU0 A;  4GC7 A;  3QXG A;  4UAZ A;  4O5K A;  5EE3 A;  2W9C B;  2AQ0 A;  2IOF K;  8ICT A;  3HWT A;  4BUG A;  2ODG A;  4F72 A;  3MR2 A;  4UAY A;  2NRX A;  5GTI U;  1T3Q A;  1X9W A;  1BPZ A;  4YN4 A;  2ZIX A;  1L3T A;  3IHQ B;  2QAR B;  3SAG A;  2BCR A;  2JMG A;  3TAD C;  8ICQ A;  2H3Q A;  3QUC A;  1X9M A;  4I2B A;  4AP9 A;  3UQ2 A;  4O0I A;  4F5Q A;  1Z1V A;  4RT3 A;  2E8M A;  3U26 A;  1QSY A;  5KG6 A;  3OTQ A;  2WAQ F;  5AKL A;  2W9B B;  1Z19 A;  4ED3 A;  3KHH A;  1S0O A;  5TZV A;  2Y1J A;  3SQI A;  1S10 A;  3M7D A;  3PZP A;  2FMP A;  1PK1 B;  5JU5 A;  3T5L A;  2UVU A;  3G6V A;  1WG8 A;  1J2N A;  1BPE A;  4Q43 A;  4ECY A;  1ZQI A;  4DL4 A;  2M0N A;  5ALS A;  5BOM A;  1T4G A;  1ZQC A;  2ZG6 A;  4P4M A;  5KFY A;  2D8C A;  5E79 U;  4QW8 A;  2EDU A;  2LPE A;  7ICU A;  2PXI A;  2FPK A;  3PSI A;  3PW2 A;  2HOQ A;  3AUO A;  3RB6 A;  3N4M B;  5DG9 A;  4GXI A;  2LYH A;  2OWO A;  3MFI A;  4QWD A;  3KKA A;  3TAN A;  4C0Z A;  4O3S A;  1S0M A;  5AIA A;  2XO7 A;  1ZRM A;  2YN4 A;  1PVP A;  2KHQ A;  2ZJ5 A;  2OEH A;  4YMM A;  3OHB A;  3GFK B;  2K89 A;  1X6J A;  5JUM A;  3AU6 A;  4TQR A;  4F2S A;  2KSO A;  4EX6 A;  9ICN A;  2OCE A;  5C5J A;  2H5X A;  1A77 A;  4YD1 A;  1L8L A;  4I2A A;  5F9N A;  2PFQ A;  3PX6 A;  5IIK A;  4G9B A;  2LYB A;  5KFB A;  4Q8F A;  3PVX A;  4RNM A;  5J0U A;  2D6F C;  3KOO A;  3RAX A;  4NLC A;  2HHX A;  3PX0 A;  5HHH A;  3BQ2 A;  1O03 A;  1SZH A;  4Y2R A;  5ALO A;  3TFS A;  4DFJ A;  5CP2 A;  2W9A A;  3RH4 A;  5L1J A;  3Q8S B;  1NOM A;  5GTH U;  4C4T A;  3F2B A;  1TAU A;  1NK9 A;  1WWV A;  3GIJ A;  3VCB A;  2WF8 A;  5KT4 A;  2D3D A;  3Q8M A;  5DDY A;  4ECX A;  8ICS A;  5AM0 A;  4EEL A;  1PVR A;  1NKC A;  2NO5 A;  5IIN A;  3PST A;  5ALM A;  3JPP A;  3LK9 A;  2OM6 A;  1K5O A;  3SEI A;  1KQQ A;  4DSJ A;  1MSW D;  1XC9 A;  1JN3 A;  3RJF A;  4ED2 A;  3F5E A;  1ZOL A;  4QZH A;  3D6J A;  3KZX A;  4EEN A;  3TI0 A;  4EBC A;  2E3T A;  3KD3 A;  3NUQ A;  2ZTC A;  4USA A;  2OYY A;  1WCL A;  4TUP A;  2XGP A;  2R8J A;  5KAF U;  3CNH A;  2EAM A;  1RXV A;  4YD2 A;  3QU4 A;  5L1K A;  2ZUD A;  1WWU A;  2HHV A;  1D8B A;  3ZI4 A;  1ZQX A;  5CEH A;  5DLG A;  5J0W A;  1JXE A;  3MGI A;  3KHG A;  4NLN A;  2K60 A;  3C5G A;  4I28 A;  2AGO A;  2LHT A;  4CNQ A;  1NK6 A;  2JV3 A;  7ICR A;  3K1Z A;  4RQ5 A;  2W7O A;  1FIQ A;  3B0X A;  3KKA C;  1EXN A;  3IDW A;  3SD7 A;  3BQT A;  5L9X A;  1L5U A;  3QUB A;  4C4R A;  3TFR A;  1UA1 A;  1KKX A;  2RDJ A;  4ECZ A;  2ZJ8 A;  5CJ7 A;  3H4B A;  3H0L B;  1ZJN A;  4B9N A;  7ICO A;  3Q8P B;  1A76 A;  2RDI A;  5ALY A;  5AKI A;  1L8O A;  4QNL A;  4MFC A;  2GH1 A;  3GZF A;  1PK3 A;  2ISP A;  1UPH A;  2EAO A;  1QSS A;  5EE0 A;  3K4G A;  5F9L A;  3IG5 A;  5KFC A;  2W55 A;  4KMO B;  5EWG A;  2R8G A;  1ZQW A;  5J0Q A;  2KZM A;  2KFN A;  1RPL A;  5ALL A;  4KLD A;  4G3I A;  2HHS A;  1NKE A;  1N5X A;  1U47 A;  5CWR A;  3C29 A;  4ELU A;  2ASD A;  3DEE A;  4EEK A;  1RYS A;  1JAL A;  2J6U A;  4FO6 A;  2DBY A;  5DB8 A;  4I2H A;  1SXD A;  1M6Y A;  3C21 A;  4PH5 A;  4Z6D A;  3WKC A;  3IP4 B;  2ZXH A;  4Y2J A;  3FC4 A;  4ELV A;  4BJQ A;  1HUZ A;  2AXT U;  2MU2 A;  1DGJ A;  2UVV A;  3Q8R B;  1SV0 C;  2QB1 A;  1S97 A;  3L3F X;  5DDM A;  4RT2 A;  2K8B B;  2RLT A;  9ICP A;  2OH2 A;  3H0M B;  3M8S A;  4ZOH C;  1SZP A;  3ETR A;  2DFL A;  3RRH A;  4C8L A;  4YQW A;  4I29 A;  1N62 A;  3PSF A;  4QZB A;  7ICQ A;  1DK3 A;  1UT8 A;  4QW9 A;  3T5J A;  1NJY A;  2EH9 A;  3T5K A;  4QZ8 A;  2BKE A;  4HAI A;  2H3V A;  9ICW A;  1CI4 A;  3MBY A;  1ED1 A;  1Z3E B;  2KJ8 A;  5AM3 A;  2FPM A;  4B9M A;  1MN8 A;  2CRX A; 
#chains in the Genus database with same CATH homology
 2E8M A;  2QB0 A;  4NJ8 A;  1X40 A;  2FE9 A;  1X66 A;  2D3D A;  1PK1 B;  5JU5 A;  2QAR A;  4NL9 C;  4PZO A;  1PK3 A;  2YTU A;  2EAO A;  1DXS A;  3SEI A;  1COK A;  3BS7 A;  2DKZ A;  2ES6 A;  2L5Y A;  3TAC B;  3BS5 A;  2DL0 A;  2E8P A;  2D8C A;  2E8N A;  2LPE A;  2Y9T A;  3SEN A;  1B4F A;  2K4P A;  2KSO B;  1JI7 A;  1V38 A;  2F8K A;  1V85 A;  2KG5 A;  1SGG A;  4RQM A;  1PK1 A;  3KKA A;  4MHV A;  1SXE A;  2E8O A;  2EAP A;  1X9X A;  1SXD A;  1SV4 A;  2KMD A;  2ESE A;  2B6G A;  5KNI A;  3H8M A;  3BS5 B;  2DKX A;  4NL9 A;  5L1M A;  2EAM A;  4RQN A;  3HIL A;  1B0X A;  5F3X B;  1WWU A;  3BQ7 A;  4PZN A;  1UCV A;  2KSO A;  5J8Y C;  2LMR A;  3K1R B;  2F44 A;  2F3N A;  1SV0 C;  1UQV A;  2QB1 A;  2Y9U A;  5JTI A;  1KW4 A;  1RG6 A;  2K60 A;  2QB0 B;  2KIV A;  2QKQ A;  1F0M A;  3TAD A;  2JV3 A;  1OXJ A;  5JRT A;  1SV0 A;  1LKY A;  3KKA C;  4IS7 A;  5J8Y A;  3IDW A;  2EAN A;  2KE7 A;  1WWV A;  2QAR B;  3TAD C;  1LKY B;  2GLE A;  1Z1V A;  1OW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...