2KE7A

Nmr structure of the first sam domain from aida1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
QTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Ankyrin repeat and sterile alpha motif domain-containing pro
publication title NMR structure of the first SAM domain from AIDA1
rcsb
source organism Homo sapiens
total genus 20
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ke7A00
2JV3A 1X9XA 2E8MA 2QARB 1Z1VA 1V38A 3TADA 2Y9TA 4RQMA 2ESEA 3TACB 2Y9UA 2FE9A 3BQ7A 2QKQA 2EANA 1UCVA 2K60A 2KSOB 2DKZA 1B4FA 1B0XA 4NL9C 2QB0B 1PK3A 2ES6A 5L1MA 2E8NA 2KE7A 1COKA 2K4PA 2DKXA 4RQNA 3H8MA 5KNIA 2B6GA 2KG5A 3BS5B 1PK1A 4NJ8A 2F8KA 1DXSA 1X40A 4IS7A 2QARA 1LKYB 1UQVA 3TADC 3KKAA 2GLEA 1JI7A 5F3XB 4NL9A 2LPEA 2D8CA 1SV0A 2EAMA 2KIVA 2L5YA 3IDWA 5J8YC 2KSOA 2QB1A 1OW5A 2F44A 3BS7A 1KW4A 2KMDA 5JU5A 2EAOA 4MHVA 2QB0A 4PZNA 2F3NA 2D3DA 1SGGA 4PZOA 3K1RB 1RG6A 5JRTA 1WWVA 2DL0A 5JTIA 3BS5A 3SENA 2YTUA 1X66A 2E8PA 1WWUA 1F0MA 2EAPA 3SEIA 1OXJA 1LKYA 2LMRA 3KKAC 5J8YA 1PK1B 1SV4A 1SV0C 2E8OA 1SXDA 1SXEA 1V85A 3HILA
chains in the Genus database with same CATH superfamily
7ICFA 1BPXA 1T7PA 3RAQA 1QCKA 1SL2A 1V38A 2C2EA 5DB9A 5KL1B 1NJZA 3Q8PB 7ICRA 4C8MA 1JX4A 2FMPA 2K60A 1WCLA 5AI6A 4DEZA 3QUTA 4GIBA 5KFXA 4Z6FA 2GOLA 5J2IA 3H8MA 3T5JA 4KLUA 9ICJA 9ICNA 2BQUA 1QTMA 2K4HA 4ZOHC 4QWCA 4UB2A 1TK5A 2KD1A 8ICKA 4M9GA 1NKBA 2W7OA 4UAZA 2YN4A 4M2YA 4C0ZA 1KL9A 4DL2A 2C2RA 4EYHB 1TK8A 3F5EA 2BCQA 1ED1A 3QU4A 2P35A 3N7SC 3TKAA 1ZQPA 5DLFA 2KHVA 2ODGA 4CRXA 3QX7A 2MU2A 1TVAA 3QEAZ 2I1QA 2UVVA 2QB0A 2RHFA 3F5AA 3PW2A 4YXMA 1SGGA 8ICFA 5KFIA 2KK0A 3IV6A 4J9QA 3QEBZ 3JPPA 2DL0A 3PW4A 4UB5A 3KFUF 3SENA 1ZQCA 3WKDA 1NKEA 3V72A 1Q3VA 2XO7A 3ZDEA 3L5KA 5B66U 4PL1A 1D9FA 2AH5A 3Q8LA 2HHXA 3JPRA 1XO1A 2UVWA 5J0PA 1M6YA 4F5QA 5KT5A 4RQMA 3QU7A 1RXVA 3UMCA 4CE6A 3N4MB 2IOHA 2LM4A 1KKXA 4DQQA 2P66A 3QU5A 4C8KA 4NLKA 9ICFA 3GDXA 4IRKA 2BCSA 4PHPA 3KTQA 2KSOB 4CCHA 2KKPA 5J0UA 3KHLA 2LKYA 5AIAA 1NJYA 2W04A 5HR7A 5H2FU 1XWLA 4ED8A 2W03A 1NZPA 1COKA 3RJFA 4KN7A 1X6IA 4F72A 5KTQA 2I5HA 4RQ3A 9ICVA 2OH2A 2B6GA 3BS5B 1NJXA 4C4SA 2WF7A 3ICXA 9ICLA 2ZTEA 2FMQA 1X9SA 1AROP 4FBTA 1XS9D 2BKEA 3ETRA 1KSPA 3B0XA 9ICUA 2K89A 2OEHA 5J0TA 3UMGA 1ZQLA 2D8CA 1JRPA 2G08A 4F4YA 3C2MA 4QZ9A 4IQWA 1ZQAA 4I2GA 2VANA 4CGZA 3E2EA 1ZETA 3BS7A 1L8OA 8ICVA 4Y2VA 3QXGA 4NY8A 2BPFA 4PZOA 4JMUA 3AEVA 1QSSA 5ALLA 3T5HA 4NLZA 3GILA 5ALFA 1L7OA 2QLTA 4QWEA 2G07A 2JZBB 2EH9A 1MQ2A 3AMZA 4YN4A 4I28A 4Q43A 2MUTB 7ICKA 1X2IA 1F0MA 5KFGA 5DBAA 4M9HA 4YCXA 3CNHA 5C0YA 3ISCA 3M7DA 4M6WB 1SXDA 4DL7A 5AKGA 2AU0A 2W3RA 4C8NA 2NV3A 4PH5A 4ED2A 3AU2A 2JHDA 2LM1A 8ICRA 4DLEA 3QU2A 1Z4OA 4RNNA 3MDAA 3NGDA 3F2CA 3ZDBA 5KT3A 1UCVA 3UXNA 4YVZA 4GXJA 1B0XA 2XY7A 5ALQA 4KLDA 5ALKA 4RQ4A 2KOBA 5DB8A 1C20A 2HHWA 4RU9A 5AICA 2HOFA 1ZQRA 4DQPA 2FDRA 9ICPA 2OCEA 4KITB 4QWDA 3IN5A 1S77D 4AP9A 5A0LA 2DPJA 2Z7JA 4RQ2A 3SD7A 2GLEA 1KFDA 3GIMA 1RYRA 2BQRA 5HNKA 2A3VA 4O5EA 5KG2A 3IDWA 5TZVA 4DWIA 2QB1A 1L3UA 2F44A 4I2HA 3FDSA 3ZDDA 1FEZA 1RPLA 4NM1A 1YZ7A 4CF5A 3PW0A 5DQIA 4DFKA 4UBCA 2D3DA 4GXKA 2W8KA 5JUMA 3C2KA 4DQSA 2KVCA 2AQ0A 4QW8A 4DQRA 2OYYA 2EQYA 5AM1A 1KFTA 2LHTA 7ICNA 1CRXA 4QZEA 5KAFU 4O3OA 2PMZF 2PFNA 4KLFA 4F5RA 2JV3A 1KEJA 4IRCA 3D6JA 4O3RA 3PZPA 4EZ9A 4FO6A 3RJJA 3H0LB 4F91B 3RFAA 4RNOA 3AN1A 3LK9A 2BZFA 2BPGA 2OM6A 4KLSA 3UPQA 5HP4A 4U7CA 3N97B 4F4KA 5ALEA 2ZIUA 4EZ6A 1Q8KA 5AK5A 4F5NA 1ZQBA 1WCNA 4NM2A 4EELA 1K1QA 2CRXA 2ZIXA 3EYZA 2DPIA 3FYHA 5EE3A 2GO7A 5J2KA 3C5GA 5L1KA 4PGXA 2IOFK 4PGQA 1KDHA 4US9A 4NXZA 1RYSA 3IG8A 3WKAA 1ZQJA 4B9NA 3WKBA 2C2DA 1U45A 1WG8A 2EAMA 1A76A 4MEYA 4JV1A 3R9KA 1NJWA 5ALTA 3E58A 1OW5A 4UAWA 3CP8A 3MR3A 2RLTA 1NI3A 4ED7A 1UT8A 2EZZA 4E0DA 4UARA 1SWVA 2R18A 3V6KA 1C7YA 5DGAA 4GC6A 1IM4A 5KFNA 1RG6A 3D2SA 4I2DA 1T3NA 2DQNB 4MF2A 1V97A 1YZ6A 5KAIU 1LVHA 4M47A 8ICBA 4KX5A 1CUKA 1JMSA 3KOOA 4YR0A 4BDPA 1OXJA 1N48A 4RQ0A 4KMOB 5HR6A 2E8OA 5D49A 4JWMA 2G06A 4DSJA 5ALWA 4QW9A 3QUBA 2WAQF 5ALMA 5HHIA 2W55A 4UBBA 3TADA 1BVSA 1JALA 1RYUA 2WFAA 2ESEA 1PVPA 4PGYA 1CEZA 4O3SA 2ZJ8A 4Q44A 4UQGA 4G9BA 3H0MB 4UB4A 1UPHA 4NL9C 4TUPA 2W9MA 4DF4A 2OHFA 2W9AA 4I27A 2E3TA 2FLLA 9ICBA 5ALHA 2WF9A 1ZD3A 3QZ8A 1DK3A 1Z4NA 4Y2XA 3C5FA 1OUQA 1PZNA 5J2FA 3TARA 3EZ5A 5J2BA 4DFJA 3MR6A 1U47A 2YMMA 2YX8A 4YP3A 2W7PA 2A1AA 2LPEA 5DG8A 3RH5A 3BQ2A 3GV7B 4Y2TA 2XVTA 2FLPA 3NASA 5IILA 2JXJA 1BNPA 8ICCA 1Z19A 4O3NA 3GIKA 3MDCA 4BXOA 2HHSA 8ICWA 4R8UB 4EEKA 4ECYA 2J6SA 4ELTA 1S9FA 3Q8RB 3A0HU 4ED1A 3C29A 4QZ8A 3PVXA 2FPKA 1ZQYA 2NYVA 3WKCA 2YTUA 2IMWP 3ORYA 4F2RA 5AKJA 2G0AA 3PSIA 1WWUA 1ZQEA 2KEYA 3PSTA 1ZQDA 1ZJMA 3S6JA 7ICPA 2F1JA 3RR8A 1N60A 5FP0A 1S76D 7ICSA 2NRZA 1QSLA 4J9KA 2R8JA 4R63A 1UT5A 5J0OA 4O5CA 3NVWA 3RJEA 1ZD4A 2WF6A 3NS1A 4DQIA 2Y9UA 5L1LA 2F2AB 1FFVA 5CEHA 2Q4TA 1N2XA 1S5LU 4ECVA 5KFAA 2A1JB 5AI0A 3LYSA 2RP5A 3C1YA 3GIJA 4YD1A 8ICEA 4P0QB 2DGZA 4ECSA 4PPXA 4GLXA 2DKXA 4ECXA 8ICAA 1QSYA 4UAUA 4JK1A 1KLNA 1ZRMA 2IBKA 3WKEA 2HSZA 2JMGA 1JXEA 2G09A 5AKKA 2YQEA 3QU9A 5KG6A 3OSPA 2H3ZA 4Z6EA 5KG1A 4F8RA 2QARA 1KRPA 3GV5B 5KFVA 4YXJA 3V6JA 1QQ6A 2PFPA 4EX7A 4NL9A 2ASDA 4EBCA 1UA0A 4LVSA 5GTHU 3PW5A 5DQHA 1LV5A 1MQ3A 3K1ZA 5KG5A 2E1FA 2W54A 3IG5A 5KFJA 1VDVA 5CA7A 1WUDA 4FBUA 4YMMA 1ZQOA 4R65A 1D8LA 1Z1BA 4B9VA 5ALXA 5J0XA 1RQNA 4M9LA 1ECWA 3SI8A 5J0RA 3AM9A 4C7YA 1PVQA 3C2LA 1X66A 3PR5B 4F4WA 4Y2UA 2ZG6A 3LVWA 3Q8MA 5CRXA 3EPGA 3ISDA 1TFRA 3UMBA 1SV0C 2E1EA 4DL6A 4ED6A 1JN3A 1ZQUA 3MGVA 5KT6A 3THVA 4I2BA 5AI9A 1F44A 4KTQA 4EX6A 5KFHA 1WYGA 2ZXHA 3OJSA 4UASA 1RQLA 2VA2A 5J2EA 4EEYA 2DFLA 4OO1J 3OSNA 5KFQA 5DDMA 4YR2A 4DOCA 3KHGA 4B9UA 3QUQA 2KV2A 2ISPA 2NRVA 5EWFA 3RF9A 1X6JA 2RQ5A 3TANA 3GU3A 3QYPA 4PHDA 3MFHA 5J2JA 4J9MA 3E0FA 2XY6A 2FI1A 4J9OA 1H38A 2DBYA 1SZPA 4DFPA 3QUCA 4XUSA 1ZQIA 2FPMA 5AM5A 5AM0A 3RJKA 4RQ5A 1RDFA 8ICHA 9ICMA 2KIWA 1UQVA 5ALGA 1LB2B 4DL5A 7ICUA 3KKAA 3IHQB 1L6NA 4QZGA 1K5OA 2WF5A 3HX0A 5CR0A 5ALSA 4B9MA 4I2IA 5K4LA 2L5YA 1L7NA 3C23A 2NO4A 1SL0A 1CI4A 2CN1A 3SAHA 4RT2A 4UB6U 4NLNA 1Z00B 4QJFB 8ICUA 1ZXIA 4BX9C 4MFCA 2AGQA 3TAPA 3PX4A 3SAGA 2EDUA 1ZQGA 1N5XA 2AHOB 1QQ7A 4JWNA 1AQ6A 4YR3A 1T3QA 5IIJA 1ZQWA 2E8PA 3MGIA 2W9BB 5ALIA 5DBBA 2D6FC 1B22A 4US8A 1ZYQA 2ZXIA 4RNMA 1U48A 1SKWA 4M9JA 3GZFA 3HILA 3RRGA 2LYHA 8ICTA 3OHBA 5HHHA 2VJ4A 4ACOA 2R8HA 5EWGA 4ECZA 5DGBA 5KFUA 2IOFA 3GFKB 3RB3A 5T14A 5D4BA 3PO5A 3PW7A 4K4IA 1VLBA 5CWRA 3TFRA 1NK8A 1HEKA 3V6HA 4O0IA 4AYBF 4YMNA 3CRXA 1PK3A 2XICA 4CNQA 3F2DA 1PVRA 1PUZA 4O5KA 4UAVA 3KD3A 8ICZA 4ED0A 1J97A 2ATLA 4I2AA 4RPZA 4IQTA 5AKYA 1IXRA 1SKSA 2PXIA 4JV0A 3Q8QB 3EW9A 1KTQA 3WK9A 2HCFA 1NK0A 1SWWA 4C80A 4ICAA 2KKVA 2H3QA 3MR2A 4R66A 4DFMA 2KFNA 2XCAA 2V4RA 5ALOA 2KIVA 4IQUA 2HBJA 2KSOA 2ZIWB 3WK7A 1U49A 4P0PB 1X9MA 1HJPA 2KN7A 4MF8A 3WK4A 4QZCA 4KX3A 4R64A 1Q46A 2EAOA 4F93B 4EBDA 3BZKA 2F3NA 3L3FX 4DLGA 5EE0A 5CB1A 3F2BA 3IM1A 3K1RB 4C8LA 1XC9A 2LYBA 3BS5A 4USAA 4IR9A 3KZIU 4OCZA 3RBEA 1MSWD 4AYBC 5AKHA 5KG4A 2MSNA 1PK1B 3M9OB 1SV4A 4F5PA 3AU6A 1HUOA 2JGAA 2NO5A 5CP2A 3NRZA 2E8MA 3F53A 1XU4A 2KJ5A 4Q8EA 1ZQTA 3RTVA 2ZUBA 1JIHA 3FM9A 4YD2A 1SL1A 3H8SA 3SR6A 3MABA 3DDHA 3LWLA 2R8KA 2PKEA 4O3QA 3JPNA 2FMSA 1JROA 4QZFA 1L3TA 2JZBA 4F4XA 4Y2RA 2LBOA 5KL8B 2MUTA 2WB1F 1J2MA 3RH6A 1FFUA 5KNIA 9ICEA 1QH9A 4RQ1A 4IL6U 4K4HA 3VCBA 3ZI4A 4QWAA 3VC8A 2W9CB 1NKCA 1ZQNA 2F8KA 4RT3A 3WK5A 3FAHA 1A77A 2ZIVB 2AGPA 5EE9A 4TUSA 3MC1A 4IRDA 2KP7A 4C7ZA 4BWJA 2BQ3A 2P6UA 4B9TA 2KZMA 5KT2A 2JH7A 4KLMA 1L8LA 3OGUA 1IIPA 4MHVA 4B6JA 1S8OA 5IIOA 1SB3C 2A19A 3PR4A 2NRTA 4FZMA 3HT3A 3RB6A 4KLIA 3RRHA 2M9NA 3PMNA 3IP4B 2W3SA 3PV8A 5KFCA 3C1ZA 2RDJA 3KBBA 9ICHA 3ETLA 5KT4A 2W11A 5KFZA 4DSIA 4RZRA 4Y2QA 2PMZC 2YB1A 5EOZA 4WJ3B 5J0YA 1HUZA 2J6UA 3PX6A 3RH4A 2WB1C 2O6KA 2BCUA 2IHNA 2NRWA 2ZTCA 4JV2A 4ECUA 2VA8A 3H8WA 4OJLA 4ECWA 4NLBA 1KFSA 1T94A 8ICOA 5KFLA 3SV3A 3UQ0A 3ZDAA 3TACB 3GV8B 1GO3F 2QKQA 3WU2U 5AIBA 2JR5A 4RUAA 5KG0A 2JEIA 4X5VA 4YG2A 4BJQA 3BQTA 3UM9A 5AI4A 1Y88A 3M1YA 3K75D 2K8CB 1D8YA 1NNLA 2KE7A 2K4PA 5J0SA 1BGXT 2Y0SF 5KG7A 2H3FA 2PI5A 3PMLA 4OJ5A 2ASLA 2JRZA 4Q45A 2EZYA 5J2AA 4LJXA 1NOMA 2KVSA 1LKYB 3PNCA 1QQ5A 4BGDA 4GFJA 3H4DA 9ICGA 2JH1A 3WK8A 3C28A 1JI7A 3T5LA 5J2GA 1JXLA 3ED5A 5AK6A 3K4GA 3HKZF 9ICCA 2KZ3A 1Q3UA 2KMDA 3B0YA 2NRXA 8ICSA 3LVVA 3ISBA 5DB6A 1ZQHA 5JRTA 9ICSA 4I2JA 5KFBA 1S0NA 2ZJ5A 2WHEA 3SMVA 3TQ1A 5DLGA 3SAFA 4CF4A 4UB1A 1B43A 3SEIA 5J29A 3NUQA 4JUZA 2WAQC 3NVZA 4TQRA 7ICTA 2Y0SC 3N7RC 2AXTU 1L3VA 4DSLA 1UA1A 2BDUA 3RB0A 1QLNA 1Z1VA 4Y2PA 2H5XA 4Y2SA 2HHTA 5J2CA 3SYZA 1N62A 1ZQZA 5F9LA 4RPYA 4P4OA 7ICGA 4YQWA 2HVIA 8ICMA 1D9DA 2QB0B 2LYAA 5AK3A 1BNOA 3QE9Y 3I28A 5KFDA 2E8NA 8ICXA 4IQVA 1JUDA 4OJ6A 4NJ8A 4Y2YA 2B21A 3H8JA 4RQ8A 4IR1A 4BUGA 1X40A 4XA5A 1TAQA 2UVUA 3HP6A 3ZDCA 4J9NA 1S0VA 4KLLA 4QZIA 3G6XA 4C8OA 4UB3A 2J6TA 2KHQA 5AHXA 2K8AA 1X9WA 2FLNA 5AM2A 4CDGA 2YMQA 1NK4A 1HIWA 5DDYA 3EPIA 3JPSA 3HWTA 1ZRNA 2HMXA 3KZXA 3DV9A 4FZNA 5AM4A 3NRWA 1XSLA 5G5HA 1RM6C 3DEEA 2I9GA 9ICTA 3UQ2A 2AGOA 3H0RB 4JB3A 4DL4A 1ZQFA 1O03A 2K4IA 3TAQA 3QZ7A 4DSEA 2EAPA 5DG9A 3MBYA 1VJ5A 2MA1A 1V85A 4LZGA 4J9SA 1DGJA 2R8GA 2Y9TA 2KNJA 1RZTA 5KFEA 4PHAA 4ECQA 1A6SA 3D2QA 4NV0A 5IIIA 2OWOA 3HJEA 4R8UA 1S10A 5ALUA 3ONNA 3OTQA 5CJ7A 2KJ8A 2DKZA 2WTFA 1TKDA 5AKXA 2C22A 4XQ8A 4HYKA 7ICIA 2E5SA 3N28A 3RB4A 2BR0A 4XRHA 1TV9A 2KFZA 4UATA 3H7IA 5HMMA 2HVHA 1L3SA 1IV8A 4IC9A 3PY8A 5J0WA 2F1HA 3QNMA 4J9LA 2N1RA 1U4BA 5J2HA 3M9NB 2HHVA 2RRDA 1KN5A 4KLOA 5KFOA 2YMPA 3JPOA 1L7MA 4FFDA 1TAMA 3RJHA 2IHMA 2A1JA 1ZQSA 7ICJA 3JPTA 2V9WA 4P0QA 2HHUA 2ZTDA 7ICOA 8ICNA 5DB7A 2K8BB 4KN4A 1J2NA 4EENA 9ICRA 2AQ4A 2KJ9A 1EXNA 2MAXA 1ZD5A 1N61A 2R8IA 1YT3A 4F5OA 2ISOA 3M8RA 4EBEA 3BZCA 1XSPA 1UHUA 1V9PA 2GH1A 3ZD8A 2H3IA 5CHGA 1DRGA 5E79U 4KLJA 4UB8U 3IRUA 4EYIB 8ICPA 3V7LA 3EWAA 3T5KA 2HBKA 2YB4A 7ICEA 3SZ2A 2KICA 3BDPA 3HPOA 3RBDA 2XGPA 9ICKA 3PX0A 2JEJA 1DOQA 1S0MA 2F77X 4DSKA 2JEGA 4PHEA 4P4MA 2K4EA 4PJ0U 4QIWF 4Z6CA 3WK6A 2HHQA 5KT7A 5KFSA 1T4GA 3ALRA 1DXSA 3G6YA 4DL3A 3V7JA 4F92B 2HBLA 1URJA 8ICYA 3A0BU 4DF8A 5AKIA 3UXOA 2HOQA 1SV0A 2F8LA 4RUCA 4FS1A 2G5IB 3T3FA 4C4RA 2XY5A 2Q0ZX 4M04A 5KG3A 2HI0A 1SZHA 5IIKA 2HOIA 1MC8A 3L4PA 3JPQA 3TFSA 4CF3A 1N56A 2ZIUB 1IG6A 2YY6A 4HAIA 2G5HB 5JTIA 4QZDA 4OJPA 4I2FA 2F76X 4BWMA 4DFDA 3RJIA 2FPLA 4KLQA 3BQ0A 2ZIXB 4P4PA 1S0OA 9ICXA 5G5GA 4I2CA 2KZZA 9ICIA 3I1YA 5AI8A 1SXEA 2V4QA 4DOAA 8ICQA 4QIWC 9ICQA 1NK9A 3H40A 4G3IA 4UW9A 4DS4A 3OHAA 4M9NA 4OJOA 4MEXA 2XI9A 5ALJA 2IA6A 4QZHA 3MFIA 8ICLA 4C4TA 5KFYA 4F4ZA 3PSFA 3AL0B 1Z00A 3BQ7A 4RPXA 4QWBA 5B5EU 5L9XA 3O0FA 2FJ6A 1B4FA 5AKZA 5ALZA 4B9LA 4ECRA 1TAUA 5L1MA 4DSFA 5BOLA 5TISU 2DF4B 4RQNA 5BPCA 3G6VA 4NWIA 2JEFA 2W9BA 2H3VA 5KFMA 3N7PD 1ZQQA 3M6ZA 5AKEA 1XNSA 3BQ1A 2KG5A 2UVRA 3AQFA 2HW3A 1L5UA 4RQ7A 2I6XA 2CPRA 4TQSA 4IS7A 4F50A 4I29A 3TADC 1SIJA 4DS5A 1RXWA 3CW2C 4ZH4A 4NLCA 5EE1A 3GQCA 4M0AA 1BPYA 3CYMA 5IIMA 1NZBA 2PFQA 1KBUA 1D8BA 3MGHA 1KW4A 3RAXA 2GWSA 4M6WA 5L1IA 4DO9A 2BPCA 4PZNA 7ICLA 3V7KA 4FE3A 2XCPA 2Y1IA 1WWVA 4RQ6A 3LDAA 3MR5A 4DCCA 1ZD2P 2RDIA 2M0NA 1BPDA 1ZQ1C 5KFRA 1NK6A 1ZJNA 5AM3A 4FS2A 3GIIA 4QZAA 1DK2A 1X9XA 8ICIA 1L7PA 2VKQA 2ZIWA 4P0PA 3PSPA 1MN8A 3NVYA 4K4GA 4O3MA 2AJQA 5AK4A 4TUQA 2YMLA 5DG7A 1N5WA 1N63A 4BXOB 8ICGA 5L1JA 1XSNA 2ES6A 4A8EA 5C5JA 5J0QA 5BOMA 4Z6DA 9ICAA 5AI5A 1ZQMA 1PK1A 5F9NA 5ALYA 3AUOA 2WF8A 2HBMA 5AKLA 1MA7A 2OXOA 4O3PA 3HRDD 2PI4A 5GTIU 5IINA 1DGSA 4YFKA 5EWEA 8ICJA 4J03A 2PFOA 1F5SA 2EZXA 5J8YC 4KLEA 4ELVA 4Y2JA 2C28A 1ZOLA 4ELUA 7ICMA 7ICVA 4MFFA 1Z3EB 3KHRA 9ICWA 4YMOA 4I2EA 1ZQKA 4NLGA 1XO0A 4OD0A 5DKWA 2MRLA 4PL2A 2XC9A 2BCRA 1FIQA 5KFWA 4UAYA 4TURA 2HDOA 2W9CA 4KLTA 4KLHA 5D46A 4B9SA 2BDPA 2ZIVA 4LZDA 2BHNA 3C21A 1ZQVA 4ECTA 2ZUCA 5KFTA 2DUYA 2ZJAA 2QARB 1A0PA 2DWQA 1TK0A 2XGQA 1NK7A 2F1IA 2FE9A 5ALPA 1SKRA 2VIXA 2EANA 1K1SA 1O08A 3I76A 4O9MA 4U6PA 2W43A 3KHHA 2W8LA 3PO4A 3Q8KA 4F3OA 3AQEA 3ZD9A 5KFPA 3RR7A 5KFKA 5HMLA 5DQGA 5ALVA 2CXYA 5J2DA 4GXIA 3FC4A 2LI6A 1BPZA 4KMUA 3H4BA 3M9MB 4KLGA 3OPXA 4P2HA 2ALZA 3B9JA 3D2NA 3J81j 3BJYA 1TE2A 2BCVA 3EUB2 3HKZC 3Q8SB 9ICOA 5ALRA 1COOA 2ASJA 3M8SA 3SQIA 2P6RA 5DBCA 1KQQA 1BPEA 5ALDA 5F3XB 1FO4A 3LWMA 2BGWA 5KFFA 2ZUDA 3SV4A 1U9LA 1NK5A 2Y1JA 3NTUA 3U26A 4MFAA 4J9RA 4QNLA 5JU5A 4QZBA 1BPBA 4J9PA 3OJUA 2VA3A 7ICQA 2B0CA 3RJGA 3UXPA 3TI0A 2KTQA 1X42A 7ICHA 4FZLA 5ALNA 4Q8FA 1P7DA 1S97A 4F2SA 1T8EA 3M6KA 3NVVA 2VJ5A 4F71A 4ED3A 1ZQXA 3HW8A 1LKYA 4GC7A 2LMRA 3KKAC 5J8YA 4DOBA 3T79A 2XIDA
chains in the Genus database with same CATH topology
2JV3A 1X9XA 2E8MA 2QARB 1Z1VA 1V38A 3TADA 2Y9TA 4RQMA 2ESEA 3TACB 2Y9UA 2FE9A 3BQ7A 2QKQA 2EANA 1UCVA 2K60A 2KSOB 2DKZA 1B4FA 1B0XA 4NL9C 2QB0B 1PK3A 2ES6A 5L1MA 2E8NA 2KE7A 1COKA 2K4PA 2DKXA 4RQNA 3H8MA 5KNIA 2B6GA 2KG5A 3BS5B 1PK1A 4NJ8A 2F8KA 1DXSA 1X40A 4IS7A 2QARA 1LKYB 1UQVA 3TADC 3KKAA 2GLEA 1JI7A 5F3XB 4NL9A 2LPEA 2D8CA 1SV0A 2EAMA 2KIVA 2L5YA 3IDWA 5J8YC 2KSOA 2QB1A 1OW5A 2F44A 3BS7A 1KW4A 2KMDA 5JU5A 2EAOA 4MHVA 2QB0A 4PZNA 2F3NA 2D3DA 1SGGA 4PZOA 3K1RB 1RG6A 5JRTA 1WWVA 2DL0A 5JTIA 3BS5A 3SENA 2YTUA 1X66A 2E8PA 1WWUA 1F0MA 2EAPA 3SEIA 1OXJA 1LKYA 2LMRA 3KKAC 5J8YA 1PK1B 1SV4A 1SV0C 2E8OA 1SXDA 1SXEA 1V85A 3HILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JV3 A;  1X9X A;  2E8M A;  2QAR B;  1Z1V A;  1V38 A;  3TAD A;  2Y9T A;  4RQM A;  2ESE A;  3TAC B;  2Y9U A;  2FE9 A;  3BQ7 A;  2QKQ A;  2EAN A;  1UCV A;  2K60 A;  2KSO B;  2DKZ A;  1B4F A;  1B0X A;  4NL9 C;  2QB0 B;  1PK3 A;  2ES6 A;  5L1M A;  2E8N A;  2KE7 A;  1COK A;  2K4P A;  2DKX A;  4RQN A;  3H8M A;  5KNI A;  2B6G A;  2KG5 A;  3BS5 B;  1PK1 A;  4NJ8 A;  2F8K A;  1DXS A;  1X40 A;  4IS7 A;  2QAR A;  1LKY B;  1UQV A;  3TAD C;  3KKA A;  2GLE A;  1JI7 A;  5F3X B;  4NL9 A;  2LPE A;  2D8C A;  1SV0 A;  2EAM A;  2KIV A;  2L5Y A;  3IDW A;  5J8Y C;  2KSO A;  2QB1 A;  1OW5 A;  2F44 A;  3BS7 A;  1KW4 A;  2KMD A;  5JU5 A;  2EAO A;  4MHV A;  2QB0 A;  4PZN A;  2F3N A;  2D3D A;  1SGG A;  4PZO A;  3K1R B;  1RG6 A;  5JRT A;  1WWV A;  2DL0 A;  5JTI A;  3BS5 A;  3SEN A;  2YTU A;  1X66 A;  2E8P A;  1WWU A;  1F0M A;  2EAP A;  3SEI A;  1OXJ A;  1LKY A;  2LMR A;  3KKA C;  5J8Y A;  1PK1 B;  1SV4 A;  1SV0 C;  2E8O A;  1SXD A;  1SXE A;  1V85 A;  3HIL A; 
#chains in the Genus database with same CATH topology
 7ICF A;  1BPX A;  1T7P A;  3RAQ A;  1QCK A;  1SL2 A;  1V38 A;  2C2E A;  5DB9 A;  5KL1 B;  1NJZ A;  3Q8P B;  7ICR A;  4C8M A;  1JX4 A;  2FMP A;  2K60 A;  1WCL A;  5AI6 A;  4DEZ A;  3QUT A;  4GIB A;  5KFX A;  4Z6F A;  2GOL A;  5J2I A;  3H8M A;  3T5J A;  4KLU A;  9ICJ A;  9ICN A;  2BQU A;  1QTM A;  2K4H A;  4ZOH C;  4QWC A;  4UB2 A;  1TK5 A;  2KD1 A;  8ICK A;  4M9G A;  1NKB A;  2W7O A;  4UAZ A;  2YN4 A;  4M2Y A;  4C0Z A;  1KL9 A;  4DL2 A;  2C2R A;  4EYH B;  1TK8 A;  3F5E A;  2BCQ A;  1ED1 A;  3QU4 A;  2P35 A;  3N7S C;  3TKA A;  1ZQP A;  5DLF A;  2KHV A;  2ODG A;  4CRX A;  3QX7 A;  2MU2 A;  1TVA A;  3QEA Z;  2I1Q A;  2UVV A;  2QB0 A;  2RHF A;  3F5A A;  3PW2 A;  4YXM A;  1SGG A;  8ICF A;  5KFI A;  2KK0 A;  3IV6 A;  4J9Q A;  3QEB Z;  3JPP A;  2DL0 A;  3PW4 A;  4UB5 A;  3KFU F;  3SEN A;  1ZQC A;  3WKD A;  1NKE A;  3V72 A;  1Q3V A;  2XO7 A;  3ZDE A;  3L5K A;  5B66 U;  4PL1 A;  1D9F A;  2AH5 A;  3Q8L A;  2HHX A;  3JPR A;  1XO1 A;  2UVW A;  5J0P A;  1M6Y A;  4F5Q A;  5KT5 A;  4RQM A;  3QU7 A;  1RXV A;  3UMC A;  4CE6 A;  3N4M B;  2IOH A;  2LM4 A;  1KKX A;  4DQQ A;  2P66 A;  3QU5 A;  4C8K A;  4NLK A;  9ICF A;  3GDX A;  4IRK A;  2BCS A;  4PHP A;  3KTQ A;  2KSO B;  4CCH A;  2KKP A;  5J0U A;  3KHL A;  2LKY A;  5AIA A;  1NJY A;  2W04 A;  5HR7 A;  5H2F U;  1XWL A;  4ED8 A;  2W03 A;  1NZP A;  1COK A;  3RJF A;  4KN7 A;  1X6I A;  4F72 A;  5KTQ A;  2I5H A;  4RQ3 A;  9ICV A;  2OH2 A;  2B6G A;  3BS5 B;  1NJX A;  4C4S A;  2WF7 A;  3ICX A;  9ICL A;  2ZTE A;  2FMQ A;  1X9S A;  1ARO P;  4FBT A;  1XS9 D;  2BKE A;  3ETR A;  1KSP A;  3B0X A;  9ICU A;  2K89 A;  2OEH A;  5J0T A;  3UMG A;  1ZQL A;  2D8C A;  1JRP A;  2G08 A;  4F4Y A;  3C2M A;  4QZ9 A;  4IQW A;  1ZQA A;  4I2G A;  2VAN A;  4CGZ A;  3E2E A;  1ZET A;  3BS7 A;  1L8O A;  8ICV A;  4Y2V A;  3QXG A;  4NY8 A;  2BPF A;  4PZO A;  4JMU A;  3AEV A;  1QSS A;  5ALL A;  3T5H A;  4NLZ A;  3GIL A;  5ALF A;  1L7O A;  2QLT A;  4QWE A;  2G07 A;  2JZB B;  2EH9 A;  1MQ2 A;  3AMZ A;  4YN4 A;  4I28 A;  4Q43 A;  2MUT B;  7ICK A;  1X2I A;  1F0M A;  5KFG A;  5DBA A;  4M9H A;  4YCX A;  3CNH A;  5C0Y A;  3ISC A;  3M7D A;  4M6W B;  1SXD A;  4DL7 A;  5AKG A;  2AU0 A;  2W3R A;  4C8N A;  2NV3 A;  4PH5 A;  4ED2 A;  3AU2 A;  2JHD A;  2LM1 A;  8ICR A;  4DLE A;  3QU2 A;  1Z4O A;  4RNN A;  3MDA A;  3NGD A;  3F2C A;  3ZDB A;  5KT3 A;  1UCV A;  3UXN A;  4YVZ A;  4GXJ A;  1B0X A;  2XY7 A;  5ALQ A;  4KLD A;  5ALK A;  4RQ4 A;  2KOB A;  5DB8 A;  1C20 A;  2HHW A;  4RU9 A;  5AIC A;  2HOF A;  1ZQR A;  4DQP A;  2FDR A;  9ICP A;  2OCE A;  4KIT B;  4QWD A;  3IN5 A;  1S77 D;  4AP9 A;  5A0L A;  2DPJ A;  2Z7J A;  4RQ2 A;  3SD7 A;  2GLE A;  1KFD A;  3GIM A;  1RYR A;  2BQR A;  5HNK A;  2A3V A;  4O5E A;  5KG2 A;  3IDW A;  5TZV A;  4DWI A;  2QB1 A;  1L3U A;  2F44 A;  4I2H A;  3FDS A;  3ZDD A;  1FEZ A;  1RPL A;  4NM1 A;  1YZ7 A;  4CF5 A;  3PW0 A;  5DQI A;  4DFK A;  4UBC A;  2D3D A;  4GXK A;  2W8K A;  5JUM A;  3C2K A;  4DQS A;  2KVC A;  2AQ0 A;  4QW8 A;  4DQR A;  2OYY A;  2EQY A;  5AM1 A;  1KFT A;  2LHT A;  7ICN A;  1CRX A;  4QZE A;  5KAF U;  4O3O A;  2PMZ F;  2PFN A;  4KLF A;  4F5R A;  2JV3 A;  1KEJ A;  4IRC A;  3D6J A;  4O3R A;  3PZP A;  4EZ9 A;  4FO6 A;  3RJJ A;  3H0L B;  4F91 B;  3RFA A;  4RNO A;  3AN1 A;  3LK9 A;  2BZF A;  2BPG A;  2OM6 A;  4KLS A;  3UPQ A;  5HP4 A;  4U7C A;  3N97 B;  4F4K A;  5ALE A;  2ZIU A;  4EZ6 A;  1Q8K A;  5AK5 A;  4F5N A;  1ZQB A;  1WCN A;  4NM2 A;  4EEL A;  1K1Q A;  2CRX A;  2ZIX A;  3EYZ A;  2DPI A;  3FYH A;  5EE3 A;  2GO7 A;  5J2K A;  3C5G A;  5L1K A;  4PGX A;  2IOF K;  4PGQ A;  1KDH A;  4US9 A;  4NXZ A;  1RYS A;  3IG8 A;  3WKA A;  1ZQJ A;  4B9N A;  3WKB A;  2C2D A;  1U45 A;  1WG8 A;  2EAM A;  1A76 A;  4MEY A;  4JV1 A;  3R9K A;  1NJW A;  5ALT A;  3E58 A;  1OW5 A;  4UAW A;  3CP8 A;  3MR3 A;  2RLT A;  1NI3 A;  4ED7 A;  1UT8 A;  2EZZ A;  4E0D A;  4UAR A;  1SWV A;  2R18 A;  3V6K A;  1C7Y A;  5DGA A;  4GC6 A;  1IM4 A;  5KFN A;  1RG6 A;  3D2S A;  4I2D A;  1T3N A;  2DQN B;  4MF2 A;  1V97 A;  1YZ6 A;  5KAI U;  1LVH A;  4M47 A;  8ICB A;  4KX5 A;  1CUK A;  1JMS A;  3KOO A;  4YR0 A;  4BDP A;  1OXJ A;  1N48 A;  4RQ0 A;  4KMO B;  5HR6 A;  2E8O A;  5D49 A;  4JWM A;  2G06 A;  4DSJ A;  5ALW A;  4QW9 A;  3QUB A;  2WAQ F;  5ALM A;  5HHI A;  2W55 A;  4UBB A;  3TAD A;  1BVS A;  1JAL A;  1RYU A;  2WFA A;  2ESE A;  1PVP A;  4PGY A;  1CEZ A;  4O3S A;  2ZJ8 A;  4Q44 A;  4UQG A;  4G9B A;  3H0M B;  4UB4 A;  1UPH A;  4NL9 C;  4TUP A;  2W9M A;  4DF4 A;  2OHF A;  2W9A A;  4I27 A;  2E3T A;  2FLL A;  9ICB A;  5ALH A;  2WF9 A;  1ZD3 A;  3QZ8 A;  1DK3 A;  1Z4N A;  4Y2X A;  3C5F A;  1OUQ A;  1PZN A;  5J2F A;  3TAR A;  3EZ5 A;  5J2B A;  4DFJ A;  3MR6 A;  1U47 A;  2YMM A;  2YX8 A;  4YP3 A;  2W7P A;  2A1A A;  2LPE A;  5DG8 A;  3RH5 A;  3BQ2 A;  3GV7 B;  4Y2T A;  2XVT A;  2FLP A;  3NAS A;  5IIL A;  2JXJ A;  1BNP A;  8ICC A;  1Z19 A;  4O3N A;  3GIK A;  3MDC A;  4BXO A;  2HHS A;  8ICW A;  4R8U B;  4EEK A;  4ECY A;  2J6S A;  4ELT A;  1S9F A;  3Q8R B;  3A0H U;  4ED1 A;  3C29 A;  4QZ8 A;  3PVX A;  2FPK A;  1ZQY A;  2NYV A;  3WKC A;  2YTU A;  2IMW P;  3ORY A;  4F2R A;  5AKJ A;  2G0A A;  3PSI A;  1WWU A;  1ZQE A;  2KEY A;  3PST A;  1ZQD A;  1ZJM A;  3S6J A;  7ICP A;  2F1J A;  3RR8 A;  1N60 A;  5FP0 A;  1S76 D;  7ICS A;  2NRZ A;  1QSL A;  4J9K A;  2R8J A;  4R63 A;  1UT5 A;  5J0O A;  4O5C A;  3NVW A;  3RJE A;  1ZD4 A;  2WF6 A;  3NS1 A;  4DQI A;  2Y9U A;  5L1L A;  2F2A B;  1FFV A;  5CEH A;  2Q4T A;  1N2X A;  1S5L U;  4ECV A;  5KFA A;  2A1J B;  5AI0 A;  3LYS A;  2RP5 A;  3C1Y A;  3GIJ A;  4YD1 A;  8ICE A;  4P0Q B;  2DGZ A;  4ECS A;  4PPX A;  4GLX A;  2DKX A;  4ECX A;  8ICA A;  1QSY A;  4UAU A;  4JK1 A;  1KLN A;  1ZRM A;  2IBK A;  3WKE A;  2HSZ A;  2JMG A;  1JXE A;  2G09 A;  5AKK A;  2YQE A;  3QU9 A;  5KG6 A;  3OSP A;  2H3Z A;  4Z6E A;  5KG1 A;  4F8R A;  2QAR A;  1KRP A;  3GV5 B;  5KFV A;  4YXJ A;  3V6J A;  1QQ6 A;  2PFP A;  4EX7 A;  4NL9 A;  2ASD A;  4EBC A;  1UA0 A;  4LVS A;  5GTH U;  3PW5 A;  5DQH A;  1LV5 A;  1MQ3 A;  3K1Z A;  5KG5 A;  2E1F A;  2W54 A;  3IG5 A;  5KFJ A;  1VDV A;  5CA7 A;  1WUD A;  4FBU A;  4YMM A;  1ZQO A;  4R65 A;  1D8L A;  1Z1B A;  4B9V A;  5ALX A;  5J0X A;  1RQN A;  4M9L A;  1ECW A;  3SI8 A;  5J0R A;  3AM9 A;  4C7Y A;  1PVQ A;  3C2L A;  1X66 A;  3PR5 B;  4F4W A;  4Y2U A;  2ZG6 A;  3LVW A;  3Q8M A;  5CRX A;  3EPG A;  3ISD A;  1TFR A;  3UMB A;  1SV0 C;  2E1E A;  4DL6 A;  4ED6 A;  1JN3 A;  1ZQU A;  3MGV A;  5KT6 A;  3THV A;  4I2B A;  5AI9 A;  1F44 A;  4KTQ A;  4EX6 A;  5KFH A;  1WYG A;  2ZXH A;  3OJS A;  4UAS A;  1RQL A;  2VA2 A;  5J2E A;  4EEY A;  2DFL A;  4OO1 J;  3OSN A;  5KFQ A;  5DDM A;  4YR2 A;  4DOC A;  3KHG A;  4B9U A;  3QUQ A;  2KV2 A;  2ISP A;  2NRV A;  5EWF A;  3RF9 A;  1X6J A;  2RQ5 A;  3TAN A;  3GU3 A;  3QYP A;  4PHD A;  3MFH A;  5J2J A;  4J9M A;  3E0F A;  2XY6 A;  2FI1 A;  4J9O A;  1H38 A;  2DBY A;  1SZP A;  4DFP A;  3QUC A;  4XUS A;  1ZQI A;  2FPM A;  5AM5 A;  5AM0 A;  3RJK A;  4RQ5 A;  1RDF A;  8ICH A;  9ICM A;  2KIW A;  1UQV A;  5ALG A;  1LB2 B;  4DL5 A;  7ICU A;  3KKA A;  3IHQ B;  1L6N A;  4QZG A;  1K5O A;  2WF5 A;  3HX0 A;  5CR0 A;  5ALS A;  4B9M A;  4I2I A;  5K4L A;  2L5Y A;  1L7N A;  3C23 A;  2NO4 A;  1SL0 A;  1CI4 A;  2CN1 A;  3SAH A;  4RT2 A;  4UB6 U;  4NLN A;  1Z00 B;  4QJF B;  8ICU A;  1ZXI A;  4BX9 C;  4MFC A;  2AGQ A;  3TAP A;  3PX4 A;  3SAG A;  2EDU A;  1ZQG A;  1N5X A;  2AHO B;  1QQ7 A;  4JWN A;  1AQ6 A;  4YR3 A;  1T3Q A;  5IIJ A;  1ZQW A;  2E8P A;  3MGI A;  2W9B B;  5ALI A;  5DBB A;  2D6F C;  1B22 A;  4US8 A;  1ZYQ A;  2ZXI A;  4RNM A;  1U48 A;  1SKW A;  4M9J A;  3GZF A;  3HIL A;  3RRG A;  2LYH A;  8ICT A;  3OHB A;  5HHH A;  2VJ4 A;  4ACO A;  2R8H A;  5EWG A;  4ECZ A;  5DGB A;  5KFU A;  2IOF A;  3GFK B;  3RB3 A;  5T14 A;  5D4B A;  3PO5 A;  3PW7 A;  4K4I A;  1VLB A;  5CWR A;  3TFR A;  1NK8 A;  1HEK A;  3V6H A;  4O0I A;  4AYB F;  4YMN A;  3CRX A;  1PK3 A;  2XIC A;  4CNQ A;  3F2D A;  1PVR A;  1PUZ A;  4O5K A;  4UAV A;  3KD3 A;  8ICZ A;  4ED0 A;  1J97 A;  2ATL A;  4I2A A;  4RPZ A;  4IQT A;  5AKY A;  1IXR A;  1SKS A;  2PXI A;  4JV0 A;  3Q8Q B;  3EW9 A;  1KTQ A;  3WK9 A;  2HCF A;  1NK0 A;  1SWW A;  4C80 A;  4ICA A;  2KKV A;  2H3Q A;  3MR2 A;  4R66 A;  4DFM A;  2KFN A;  2XCA A;  2V4R A;  5ALO A;  2KIV A;  4IQU A;  2HBJ A;  2KSO A;  2ZIW B;  3WK7 A;  1U49 A;  4P0P B;  1X9M A;  1HJP A;  2KN7 A;  4MF8 A;  3WK4 A;  4QZC A;  4KX3 A;  4R64 A;  1Q46 A;  2EAO A;  4F93 B;  4EBD A;  3BZK A;  2F3N A;  3L3F X;  4DLG A;  5EE0 A;  5CB1 A;  3F2B A;  3IM1 A;  3K1R B;  4C8L A;  1XC9 A;  2LYB A;  3BS5 A;  4USA A;  4IR9 A;  3KZI U;  4OCZ A;  3RBE A;  1MSW D;  4AYB C;  5AKH A;  5KG4 A;  2MSN A;  1PK1 B;  3M9O B;  1SV4 A;  4F5P A;  3AU6 A;  1HUO A;  2JGA A;  2NO5 A;  5CP2 A;  3NRZ A;  2E8M A;  3F53 A;  1XU4 A;  2KJ5 A;  4Q8E A;  1ZQT A;  3RTV A;  2ZUB A;  1JIH A;  3FM9 A;  4YD2 A;  1SL1 A;  3H8S A;  3SR6 A;  3MAB A;  3DDH A;  3LWL A;  2R8K A;  2PKE A;  4O3Q A;  3JPN A;  2FMS A;  1JRO A;  4QZF A;  1L3T A;  2JZB A;  4F4X A;  4Y2R A;  2LBO A;  5KL8 B;  2MUT A;  2WB1 F;  1J2M A;  3RH6 A;  1FFU A;  5KNI A;  9ICE A;  1QH9 A;  4RQ1 A;  4IL6 U;  4K4H A;  3VCB A;  3ZI4 A;  4QWA A;  3VC8 A;  2W9C B;  1NKC A;  1ZQN A;  2F8K A;  4RT3 A;  3WK5 A;  3FAH A;  1A77 A;  2ZIV B;  2AGP A;  5EE9 A;  4TUS A;  3MC1 A;  4IRD A;  2KP7 A;  4C7Z A;  4BWJ A;  2BQ3 A;  2P6U A;  4B9T A;  2KZM A;  5KT2 A;  2JH7 A;  4KLM A;  1L8L A;  3OGU A;  1IIP A;  4MHV A;  4B6J A;  1S8O A;  5IIO A;  1SB3 C;  2A19 A;  3PR4 A;  2NRT A;  4FZM A;  3HT3 A;  3RB6 A;  4KLI A;  3RRH A;  2M9N A;  3PMN A;  3IP4 B;  2W3S A;  3PV8 A;  5KFC A;  3C1Z A;  2RDJ A;  3KBB A;  9ICH A;  3ETL A;  5KT4 A;  2W11 A;  5KFZ A;  4DSI A;  4RZR A;  4Y2Q A;  2PMZ C;  2YB1 A;  5EOZ A;  4WJ3 B;  5J0Y A;  1HUZ A;  2J6U A;  3PX6 A;  3RH4 A;  2WB1 C;  2O6K A;  2BCU A;  2IHN A;  2NRW A;  2ZTC A;  4JV2 A;  4ECU A;  2VA8 A;  3H8W A;  4OJL A;  4ECW A;  4NLB A;  1KFS A;  1T94 A;  8ICO A;  5KFL A;  3SV3 A;  3UQ0 A;  3ZDA A;  3TAC B;  3GV8 B;  1GO3 F;  2QKQ A;  3WU2 U;  5AIB A;  2JR5 A;  4RUA A;  5KG0 A;  2JEI A;  4X5V A;  4YG2 A;  4BJQ A;  3BQT A;  3UM9 A;  5AI4 A;  1Y88 A;  3M1Y A;  3K75 D;  2K8C B;  1D8Y A;  1NNL A;  2KE7 A;  2K4P A;  5J0S A;  1BGX T;  2Y0S F;  5KG7 A;  2H3F A;  2PI5 A;  3PML A;  4OJ5 A;  2ASL A;  2JRZ A;  4Q45 A;  2EZY A;  5J2A A;  4LJX A;  1NOM A;  2KVS A;  1LKY B;  3PNC A;  1QQ5 A;  4BGD A;  4GFJ A;  3H4D A;  9ICG A;  2JH1 A;  3WK8 A;  3C28 A;  1JI7 A;  3T5L A;  5J2G A;  1JXL A;  3ED5 A;  5AK6 A;  3K4G A;  3HKZ F;  9ICC A;  2KZ3 A;  1Q3U A;  2KMD A;  3B0Y A;  2NRX A;  8ICS A;  3LVV A;  3ISB A;  5DB6 A;  1ZQH A;  5JRT A;  9ICS A;  4I2J A;  5KFB A;  1S0N A;  2ZJ5 A;  2WHE A;  3SMV A;  3TQ1 A;  5DLG A;  3SAF A;  4CF4 A;  4UB1 A;  1B43 A;  3SEI A;  5J29 A;  3NUQ A;  4JUZ A;  2WAQ C;  3NVZ A;  4TQR A;  7ICT A;  2Y0S C;  3N7R C;  2AXT U;  1L3V A;  4DSL A;  1UA1 A;  2BDU A;  3RB0 A;  1QLN A;  1Z1V A;  4Y2P A;  2H5X A;  4Y2S A;  2HHT A;  5J2C A;  3SYZ A;  1N62 A;  1ZQZ A;  5F9L A;  4RPY A;  4P4O A;  7ICG A;  4YQW A;  2HVI A;  8ICM A;  1D9D A;  2QB0 B;  2LYA A;  5AK3 A;  1BNO A;  3QE9 Y;  3I28 A;  5KFD A;  2E8N A;  8ICX A;  4IQV A;  1JUD A;  4OJ6 A;  4NJ8 A;  4Y2Y A;  2B21 A;  3H8J A;  4RQ8 A;  4IR1 A;  4BUG A;  1X40 A;  4XA5 A;  1TAQ A;  2UVU A;  3HP6 A;  3ZDC A;  4J9N A;  1S0V A;  4KLL A;  4QZI A;  3G6X A;  4C8O A;  4UB3 A;  2J6T A;  2KHQ A;  5AHX A;  2K8A A;  1X9W A;  2FLN A;  5AM2 A;  4CDG A;  2YMQ A;  1NK4 A;  1HIW A;  5DDY A;  3EPI A;  3JPS A;  3HWT A;  1ZRN A;  2HMX A;  3KZX A;  3DV9 A;  4FZN A;  5AM4 A;  3NRW A;  1XSL A;  5G5H A;  1RM6 C;  3DEE A;  2I9G A;  9ICT A;  3UQ2 A;  2AGO A;  3H0R B;  4JB3 A;  4DL4 A;  1ZQF A;  1O03 A;  2K4I A;  3TAQ A;  3QZ7 A;  4DSE A;  2EAP A;  5DG9 A;  3MBY A;  1VJ5 A;  2MA1 A;  1V85 A;  4LZG A;  4J9S A;  1DGJ A;  2R8G A;  2Y9T A;  2KNJ A;  1RZT A;  5KFE A;  4PHA A;  4ECQ A;  1A6S A;  3D2Q A;  4NV0 A;  5III A;  2OWO A;  3HJE A;  4R8U A;  1S10 A;  5ALU A;  3ONN A;  3OTQ A;  5CJ7 A;  2KJ8 A;  2DKZ A;  2WTF A;  1TKD A;  5AKX A;  2C22 A;  4XQ8 A;  4HYK A;  7ICI A;  2E5S A;  3N28 A;  3RB4 A;  2BR0 A;  4XRH A;  1TV9 A;  2KFZ A;  4UAT A;  3H7I A;  5HMM A;  2HVH A;  1L3S A;  1IV8 A;  4IC9 A;  3PY8 A;  5J0W A;  2F1H A;  3QNM A;  4J9L A;  2N1R A;  1U4B A;  5J2H A;  3M9N B;  2HHV A;  2RRD A;  1KN5 A;  4KLO A;  5KFO A;  2YMP A;  3JPO A;  1L7M A;  4FFD A;  1TAM A;  3RJH A;  2IHM A;  2A1J A;  1ZQS A;  7ICJ A;  3JPT A;  2V9W A;  4P0Q A;  2HHU A;  2ZTD A;  7ICO A;  8ICN A;  5DB7 A;  2K8B B;  4KN4 A;  1J2N A;  4EEN A;  9ICR A;  2AQ4 A;  2KJ9 A;  1EXN A;  2MAX A;  1ZD5 A;  1N61 A;  2R8I A;  1YT3 A;  4F5O A;  2ISO A;  3M8R A;  4EBE A;  3BZC A;  1XSP A;  1UHU A;  1V9P A;  2GH1 A;  3ZD8 A;  2H3I A;  5CHG A;  1DRG A;  5E79 U;  4KLJ A;  4UB8 U;  3IRU A;  4EYI B;  8ICP A;  3V7L A;  3EWA A;  3T5K A;  2HBK A;  2YB4 A;  7ICE A;  3SZ2 A;  2KIC A;  3BDP A;  3HPO A;  3RBD A;  2XGP A;  9ICK A;  3PX0 A;  2JEJ A;  1DOQ A;  1S0M A;  2F77 X;  4DSK A;  2JEG A;  4PHE A;  4P4M A;  2K4E A;  4PJ0 U;  4QIW F;  4Z6C A;  3WK6 A;  2HHQ A;  5KT7 A;  5KFS A;  1T4G A;  3ALR A;  1DXS A;  3G6Y A;  4DL3 A;  3V7J A;  4F92 B;  2HBL A;  1URJ A;  8ICY A;  3A0B U;  4DF8 A;  5AKI A;  3UXO A;  2HOQ A;  1SV0 A;  2F8L A;  4RUC A;  4FS1 A;  2G5I B;  3T3F A;  4C4R A;  2XY5 A;  2Q0Z X;  4M04 A;  5KG3 A;  2HI0 A;  1SZH A;  5IIK A;  2HOI A;  1MC8 A;  3L4P A;  3JPQ A;  3TFS A;  4CF3 A;  1N56 A;  2ZIU B;  1IG6 A;  2YY6 A;  4HAI A;  2G5H B;  5JTI A;  4QZD A;  4OJP A;  4I2F A;  2F76 X;  4BWM A;  4DFD A;  3RJI A;  2FPL A;  4KLQ A;  3BQ0 A;  2ZIX B;  4P4P A;  1S0O A;  9ICX A;  5G5G A;  4I2C A;  2KZZ A;  9ICI A;  3I1Y A;  5AI8 A;  1SXE A;  2V4Q A;  4DOA A;  8ICQ A;  4QIW C;  9ICQ A;  1NK9 A;  3H40 A;  4G3I A;  4UW9 A;  4DS4 A;  3OHA A;  4M9N A;  4OJO A;  4MEX A;  2XI9 A;  5ALJ A;  2IA6 A;  4QZH A;  3MFI A;  8ICL A;  4C4T A;  5KFY A;  4F4Z A;  3PSF A;  3AL0 B;  1Z00 A;  3BQ7 A;  4RPX A;  4QWB A;  5B5E U;  5L9X A;  3O0F A;  2FJ6 A;  1B4F A;  5AKZ A;  5ALZ A;  4B9L A;  4ECR A;  1TAU A;  5L1M A;  4DSF A;  5BOL A;  5TIS U;  2DF4 B;  4RQN A;  5BPC A;  3G6V A;  4NWI A;  2JEF A;  2W9B A;  2H3V A;  5KFM A;  3N7P D;  1ZQQ A;  3M6Z A;  5AKE A;  1XNS A;  3BQ1 A;  2KG5 A;  2UVR A;  3AQF A;  2HW3 A;  1L5U A;  4RQ7 A;  2I6X A;  2CPR A;  4TQS A;  4IS7 A;  4F50 A;  4I29 A;  3TAD C;  1SIJ A;  4DS5 A;  1RXW A;  3CW2 C;  4ZH4 A;  4NLC A;  5EE1 A;  3GQC A;  4M0A A;  1BPY A;  3CYM A;  5IIM A;  1NZB A;  2PFQ A;  1KBU A;  1D8B A;  3MGH A;  1KW4 A;  3RAX A;  2GWS A;  4M6W A;  5L1I A;  4DO9 A;  2BPC A;  4PZN A;  7ICL A;  3V7K A;  4FE3 A;  2XCP A;  2Y1I A;  1WWV A;  4RQ6 A;  3LDA A;  3MR5 A;  4DCC A;  1ZD2 P;  2RDI A;  2M0N A;  1BPD A;  1ZQ1 C;  5KFR A;  1NK6 A;  1ZJN A;  5AM3 A;  4FS2 A;  3GII A;  4QZA A;  1DK2 A;  1X9X A;  8ICI A;  1L7P A;  2VKQ A;  2ZIW A;  4P0P A;  3PSP A;  1MN8 A;  3NVY A;  4K4G A;  4O3M A;  2AJQ A;  5AK4 A;  4TUQ A;  2YML A;  5DG7 A;  1N5W A;  1N63 A;  4BXO B;  8ICG A;  5L1J A;  1XSN A;  2ES6 A;  4A8E A;  5C5J A;  5J0Q A;  5BOM A;  4Z6D A;  9ICA A;  5AI5 A;  1ZQM A;  1PK1 A;  5F9N A;  5ALY A;  3AUO A;  2WF8 A;  2HBM A;  5AKL A;  1MA7 A;  2OXO A;  4O3P A;  3HRD D;  2PI4 A;  5GTI U;  5IIN A;  1DGS A;  4YFK A;  5EWE A;  8ICJ A;  4J03 A;  2PFO A;  1F5S A;  2EZX A;  5J8Y C;  4KLE A;  4ELV A;  4Y2J A;  2C28 A;  1ZOL A;  4ELU A;  7ICM A;  7ICV A;  4MFF A;  1Z3E B;  3KHR A;  9ICW A;  4YMO A;  4I2E A;  1ZQK A;  4NLG A;  1XO0 A;  4OD0 A;  5DKW A;  2MRL A;  4PL2 A;  2XC9 A;  2BCR A;  1FIQ A;  5KFW A;  4UAY A;  4TUR A;  2HDO A;  2W9C A;  4KLT A;  4KLH A;  5D46 A;  4B9S A;  2BDP A;  2ZIV A;  4LZD A;  2BHN A;  3C21 A;  1ZQV A;  4ECT A;  2ZUC A;  5KFT A;  2DUY A;  2ZJA A;  2QAR B;  1A0P A;  2DWQ A;  1TK0 A;  2XGQ A;  1NK7 A;  2F1I A;  2FE9 A;  5ALP A;  1SKR A;  2VIX A;  2EAN A;  1K1S A;  1O08 A;  3I76 A;  4O9M A;  4U6P A;  2W43 A;  3KHH A;  2W8L A;  3PO4 A;  3Q8K A;  4F3O A;  3AQE A;  3ZD9 A;  5KFP A;  3RR7 A;  5KFK A;  5HML A;  5DQG A;  5ALV A;  2CXY A;  5J2D A;  4GXI A;  3FC4 A;  2LI6 A;  1BPZ A;  4KMU A;  3H4B A;  3M9M B;  4KLG A;  3OPX A;  4P2H A;  2ALZ A;  3B9J A;  3D2N A;  3J81 j;  3BJY A;  1TE2 A;  2BCV A;  3EUB 2;  3HKZ C;  3Q8S B;  9ICO A;  5ALR A;  1COO A;  2ASJ A;  3M8S A;  3SQI A;  2P6R A;  5DBC A;  1KQQ A;  1BPE A;  5ALD A;  5F3X B;  1FO4 A;  3LWM A;  2BGW A;  5KFF A;  2ZUD A;  3SV4 A;  1U9L A;  1NK5 A;  2Y1J A;  3NTU A;  3U26 A;  4MFA A;  4J9R A;  4QNL A;  5JU5 A;  4QZB A;  1BPB A;  4J9P A;  3OJU A;  2VA3 A;  7ICQ A;  2B0C A;  3RJG A;  3UXP A;  3TI0 A;  2KTQ A;  1X42 A;  7ICH A;  4FZL A;  5ALN A;  4Q8F A;  1P7D A;  1S97 A;  4F2S A;  1T8E A;  3M6K A;  3NVV A;  2VJ5 A;  4F71 A;  4ED3 A;  1ZQX A;  3HW8 A;  1LKY A;  4GC7 A;  2LMR A;  3KKA C;  5J8Y A;  4DOB A;  3T79 A;  2XID A; 
#chains in the Genus database with same CATH homology
 2JV3 A;  1X9X A;  2E8M A;  2QAR B;  1Z1V A;  1V38 A;  3TAD A;  2Y9T A;  4RQM A;  2ESE A;  3TAC B;  2Y9U A;  2FE9 A;  3BQ7 A;  2QKQ A;  2EAN A;  1UCV A;  2K60 A;  2KSO B;  2DKZ A;  1B4F A;  1B0X A;  4NL9 C;  2QB0 B;  1PK3 A;  2ES6 A;  5L1M A;  2E8N A;  2KE7 A;  1COK A;  2K4P A;  2DKX A;  4RQN A;  3H8M A;  5KNI A;  2B6G A;  2KG5 A;  3BS5 B;  1PK1 A;  4NJ8 A;  2F8K A;  1DXS A;  1X40 A;  4IS7 A;  2QAR A;  1LKY B;  1UQV A;  3TAD C;  3KKA A;  2GLE A;  1JI7 A;  5F3X B;  4NL9 A;  2LPE A;  2D8C A;  1SV0 A;  2EAM A;  2KIV A;  2L5Y A;  3IDW A;  5J8Y C;  2KSO A;  2QB1 A;  1OW5 A;  2F44 A;  3BS7 A;  1KW4 A;  2KMD A;  5JU5 A;  2EAO A;  4MHV A;  2QB0 A;  4PZN A;  2F3N A;  2D3D A;  1SGG A;  4PZO A;  3K1R B;  1RG6 A;  5JRT A;  1WWV A;  2DL0 A;  5JTI A;  3BS5 A;  3SEN A;  2YTU A;  1X66 A;  2E8P A;  1WWU A;  1F0M A;  2EAP A;  3SEI A;  1OXJ A;  1LKY A;  2LMR A;  3KKA C;  5J8Y A;  1PK1 B;  1SV4 A;  1SV0 C;  2E8O A;  1SXD A;  1SXE A;  1V85 A;  3HIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...