2KE7A

Nmr structure of the first sam domain from aida1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
b'QTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ankyrin repeat and sterile alpha motif domain-containing pro
publication title NMR structure of the first SAM domain from AIDA1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ke7A00
1F0MA 3TADA 2L5YA 2ESEA 2DKXA 2KIVA 2QKQA 1LKYA 1V38A 1OW5A 1COKA 3IDWA 2GLEA 1SV0C 2EAPA 2DKZA 2EAOA 1UQVA 2E8OA 4PZOA 4RQNA 1JI7A 1LKYB 1SV4A 1V85A 1Z1VA 1SV0A 5L1MA 2KSOA 5KNIA 2LPEA 2KG5A 4NJ8A 2QB0A 1X9XA 4MHVA 2K60A 2KSOB 2JV3A 3K1RB 2EAMA 2QB0B 3BS5A 1X40A 1X66A 2F44A 3SEIA 3TACB 3BS5B 1OXJA 3BS7A 4NL9C 2KE7A 1KW4A 1WWUA 1SGGA 1UCVA 3HILA 1PK1A 4NL9A 2DL0A 1DXSA 1SXEA 1PK1B 3BQ7A 2E8MA 2K4PA 5JU5A 5F3XB 2ES6A 2B6GA 5JRTA 1PK3A 2QARA 2KMDA 4RQMA 5JTIA 2Y9UA 2QARB 1B4FA 2YTUA 2E8NA 2EANA 3KKAC 2QB1A 3H8MA 2F3NA 1RG6A 2F8KA 2E8PA 2LMRA 3KKAA 3SENA 4IS7A 2D3DA 1SXDA 4PZNA 2FE9A 5J8YC 3TADC 1B0XA 2D8CA 2Y9TA 1WWVA 5J8YA
chains in the Genus database with same CATH superfamily
4UAZA 3TADA 4ELUA 5EE1A 5J2CA 2O6KA 5CHGA 2KJ8A 1FO4A 4QWDA 4C8LA 1SV0C 3J81j 3QU4A 1JRPA 4NLZA 3PSPA 4ECTA 4Z6CA 1DGSA 3RAQA 1Z1VA 3CYMA 4RPZA 4OJOA 1N2XA 5J0YA 4DSIA 3E2EA 4YMMA 4RQ8A 1ZQIA 3AU2A 9ICMA 5AKLA 4HAIA 3OJUA 1CRXA 4KN4A 5AM0A 5DB9A 2Q0ZX 1L6NA 4QZHA 3PSIA 2LKYA 3TACB 2ZIVA 1X9MA 5J0RA 2QLTA 2AGPA 3RH4A 1S0VA 4B9TA 2BCRA 5ALZA 2WAQC 5ALYA 5KFVA 2KP7A 9ICQA 2ISPA 9ICRA 2WF5A 5F3XB 2B6GA 2BPFA 3C29A 1SWVA 2KMDA 8ICMA 2W3SA 4C80A 5JTIA 1C20A 8ICTA 2E8NA 5KFPA 2KHQA 2W11A 3EPGA 4DOCA 3TARA 5J0WA 1JMSA 1N5WA 2PXIA 3GFKB 1ZQVA 3Q8PB 3D2QA 4E0DA 2V4RA 1ECWA 5KFLA 4GLXA 3WK8A 2W9CA 1ZQJA 3MDCA 3UXNA 1JUDA 2HW3A 5CB1A 2KFZA 1ZQMA 9ICVA 4FS2A 2QKQA 5CWRA 4KMOB 3UMGA 3MR3A 5ALNA 2IHNA 4KX3A 4ELVA 4UAVA 2EAPA 3KZXA 1KL9A 4RT2A 4NLNA 4DSKA 2G5IB 4J9LA 3I28A 4XRHA 3RRHA 4HYKA 4NJ8A 3RH5A 3M8RA 4ED0A 4QZIA 7ICUA 3RBDA 1WCLA 2KSOB 3FC4A 3JPOA 8ICQA 1RXWA 4DCCA 2BKEA 1QH9A 4XA5A 5E79U 4DWIA 1MA7A 4KMUA 5KFQA 1K1SA 2I6XA 2W54A 3KZIU 3PMNA 3BS7A 5HHHA 2ASLA 2YY6A 1HEKA 2MRLA 3HILA 9ICBA 3GU3A 1HJPA 2UVWA 3WU2U 5AKEA 3C23A 4KTQA 3WKBA 2RDJA 4C0ZA 3S6JA 3H0MB 2RDIA 1L8LA 4MFCA 2H3IA 3RR8A 3L5KA 2F77X 4G9BA 9ICOA 3LYSA 4O3MA 9ICTA 2EZXA 1T94A 3TAPA 2HDOA 3PX4A 1ZQOA 3THVA 3QU5A 9ICNA 2C22A 2A1JB 2ZJ5A 2DBYA 1S9FA 4KLEA 2J6UA 2KNJA 5ALGA 3N97B 3PR5B 3F5AA 5KFZA 2BZFA 3TKAA 2H3ZA 5KFEA 4KLHA 4QWBA 5DG9A 3JPPA 1FFUA 2WF9A 3G6YA 5KFJA 1MN8A 3V7LA 4I2CA 1Z3EB 1WG8A 7ICQA 3HJEA 1U45A 2DKZA 2Y0SC 4PZOA 4F72A 4RQNA 5L1LA 2KD1A 4F8RA 3PW5A 1A77A 3MGHA 2OHFA 3TI0A 3ETRA 5KNIA 4CE6A 4DSLA 3UQ2A 3ALRA 4ECSA 2IOHA 4RU9A 1QLNA 4DL2A 5KAIU 2KVSA 1KQQA 4BGDA 4JV2A 3PW7A 2EAMA 4DSJA 2QB0B 3RJFA 1KRPA 3DEEA 2PI5A 4ED2A 2F44A 3SAFA 4OJPA 4MF2A 5KFRA 2RLTA 3VCBA 4YD2A 3MR2A 3IN5A 1SGGA 2VA2A 3SV4A 4RUAA 4GIBA 1PUZA 4M9JA 3VC8A 4LZGA 3TQ1A 4M2YA 4UARA 5IIKA 2A19A 4PHDA 2ES6A 5BOMA 4RNNA 5JRTA 5KG5A 2KJ9A 2NRXA 4DEZA 3V72A 3UMCA 1ZQAA 1A0PA 5KT4A 1S5LU 3HRDD 1B4FA 5DQIA 4Y2VA 1FFVA 5A0LA 4DSFA 9ICGA 2KTQA 3N7PD 3H8MA 1D9FA 4QZEA 2YX8A 2ZUCA 1O03A 3BQ1A 4KLSA 5KFXA 4NXZA 2FE9A 2YQEA 2CN1A 3MR5A 3UQ0A 5AKZA 3SR6A 3KHGA 2FI1A 3LWLA 1TK8A 2L5YA 2G0AA 3UMBA 2F76X 2FLLA 3EW9A 3RJIA 5J0QA 4F5OA 1URJA 4ECQA 4MEXA 1RXVA 5C0YA 5AI9A 1SKRA 3HX0A 2W9BB 8ICUA 2KIWA 1KEJA 5ALIA 3Q8RB 5ALSA 4GC6A 1ZQLA 4ECRA 5ALRA 1L3SA 4I27A 1B22A 1S8OA 1BPZA 1XC9A 4FZNA 4P0QB 4RPYA 3BQ0A 1ZYQA 2HI0A 4K4HA 3KFUF 1X66A 1CUKA 4EYIB 2OM6A 5KT7A 4PL2A 4I2BA 4O3SA 2NYVA 3BS5B 2XICA 4YR2A 2K8AA 2R18A 3QUQA 3MR6A 1TAMA 2YMQA 2DPIA 2ISOA 2XVTA 9ICFA 3SI8A 2AXTU 3SAHA 8ICPA 3NRZA 5D46A 4IQTA 4J9SA 2ASDA 2K4PA 1A6SA 4B9NA 4CRXA 3QUTA 4F4KA 2WFAA 2IOFA 4P0PB 5J2KA 2YTUA 1N48A 5J2AA 1RM6C 1TAQA 1S77D 4F5NA 4QZCA 5IIOA 4QZ9A 1ZQCA 5AKXA 3PSTA 4ED6A 3T5JA 2D3DA 4CNQA 1RYUA 1KLNA 4JWMA 4R8UB 3KHLA 3TADC 1HUZA 4KLTA 2AJQA 2F1IA 1SKWA 4ECXA 5AIBA 2E1EA 4O0IA 4LZDA 1U47A 1SL0A 1U48A 1SKSA 4I2IA 3HP6A 4RQ7A 3ISCA 1K1QA 3HW8A 3IDWA 5G5HA 2CRXA 3ZDAA 2ZUBA 4CF4A 2OYYA 4RPXA 5KG0A 4UB6U 2KZMA 7ICJA 4YR3A 5K4LA 4PHPA 7ICSA 4TUQA 2KG5A 1YZ7A 2XY6A 3RAXA 4O3RA 4UB5A 4TQRA 3KOOA 5CR0A 4DS5A 2JV3A 3QZ7A 4GXJA 2C2RA 3AEVA 1ZJNA 1XU4A 2HHUA 1ED1A 3DDHA 2JXJA 2W43A 2V4QA 7ICEA 3SD7A 3QX7A 1QQ5A 1X2IA 2KE7A 1KW4A 1TAUA 9ICEA 1JALA 3LK9A 3RJGA 1VJ5A 3PR4A 3RB4A 2R8KA 3MABA 2G07A 2JH1A 2GH1A 2IBKA 3G6XA 3PV8A 2UVRA 1NJWA 1PK1B 5L9XA 2DF4B 2F1JA 4C8OA 3UPQA 1L3TA 2I1QA 1ZQGA 5DGAA 2XCPA 1SZHA 3Q8LA 3Q8MA 4ZH4A 5KG3A 4YN4A 5DB6A 1ZQUA 2AU0A 3KHRA 3AQFA 2W7PA 4EYHB 3GV8B 7ICLA 4DL3A 2WB1F 2HBJA 4QZFA 1XO1A 2UVVA 1KTQA 4DL7A 4FE3A 4KLFA 1L7MA 4QWCA 4Z6DA 3E0FA 4M47A 3U26A 4BWMA 3BQ2A 1F0MA 1TK0A 3GQCA 1JN3A 5AK5A 4Y2JA 2ATLA 3V6JA 5BOLA 1PVRA 9ICHA 3T3FA 3H40A 4KLJA 2W7OA 4DLEA 1ZD3A 3JPTA 3ZD8A 1QSLA 3QNMA 2KICA 2ZG6A 1V85A 4IRCA 4EEYA 2ZTDA 2KSOA 1Z1BA 2E1FA 5H2FU 2VJ5A 1Z4NA 4F5RA 7ICIA 4KLIA 1NOMA 1QTMA 2BQRA 1IM4A 4F92B 3H4BA 4O5KA 3R9KA 5J0UA 4UB2A 5AM5A 2HBMA 1HUOA 9ICJA 1NNLA 4EX7A 4O9MA 2HBLA 4U7CA 1DGJA 1WWUA 4DF4A 1TFRA 5B5EU 5AKHA 4RQ5A 4J9RA 3LVWA 3I76A 8ICCA 2H3QA 4M0AA 2P6UA 2YB4A 4RQMA 1NK6A 4NLBA 1Q8KA 4Q8EA 4ICAA 3NRWA 2QARB 1ZQFA 5AM4A 2A1JA 5T14A 4RQ3A 1CEZA 2NV3A 2W03A 2R8HA 5KFBA 2XGQA 2K89A 3HWTA 2E8PA 5IIMA 3KKAA 4RQ1A 4J9NA 4RQ0A 1PZNA 4PZNA 4J9PA 1J97A 1Q46A 1X42A 5KFHA 3PNCA 2KV2A 2ZJ8A 1NKCA 3CRXA 3BZCA 2E5SA 3UM9A 1ZQZA 2LI6A 2YMMA 2LBOA 3EZ5A 5KFMA 3QU2A 2AGQA 7ICPA 9ICXA 2HVIA 3OSPA 2M0NA 1LKYB 1SIJA 1Z4OA 8ICGA 2RP5A 5KG1A 4ECUA 2FPLA 4M6WB 5KFSA 2QB0A 1BGXT 1NZPA 2JHDA 1XSLA 3V6HA 8ICJA 2JEGA 2FPMA 2FMPA 3A0HU 9ICSA 3WK4A 3T5LA 4F71A 3D2SA 4Y2PA 2BDPA 4ED7A 1WYGA 1X9SA 4DOBA 3OHAA 4JWNA 4UQGA 2Q4TA 3AMZA 4BJQA 5J2JA 4NLGA 3PW4A 5DBAA 4BDPA 7ICKA 3C1ZA 3D2NA 4IC9A 1L3UA 4UB8U 2JMGA 1AROP 5J2BA 1XSNA 1ZQYA 4DF8A 2ZIUB 2JEIA 4QZ8A 2E3TA 3OTQA 3JPNA 4EBDA 4B9MA 3M9NB 1KN5A 4Y2SA 4P4PA 3QU7A 2QB1A 2W3RA 4CCHA 5HHIA 3H0LB 2WF6A 4TUPA 4IS7A 3MC1A 5D49A 2IA6A 3EPIA 2FLNA 5DDMA 4DFDA 2PMZF 2KOBA 5EWFA 2P6RA 3TFSA 5KFGA 1O08A 4RT3A 3RFAA 8ICVA 8ICAA 4JV0A 2B21A 2BQUA 7ICVA 4DFJA 1BNOA 2GLEA 2HHXA 9ICUA 8ICZA 3ONNA 2W9BA 4C8KA 1SV4A 2VIXA 5EWEA 1U9LA 5ALJA 2K8CB 2DQNB 4Y2QA 1F5SA 4P0QA 2LPEA 2K4IA 3LWMA 2ODGA 5KG6A 4DQPA 3BS5A 4C7YA 1X40A 1ZD2P 4M9LA 3E58A 1RDFA 5KG7A 4RUCA 3FAHA 1S97A 4QIWF 1NJZA 2PFNA 1Y88A 4FBTA 2G5HB 2RQ5A 2JZBB 1DK3A 4UB4A 1K5OA 4OD0A 4NL9A 3FDSA 4C8MA 4M9NA 4YMNA 1Z19A 2DFLA 2KFNA 1M6YA 3PVXA 2HHSA 5JU5A 4NV0A 4QWAA 4NM1A 4YXJA 4P0PA 8ICFA 2H5XA 2HOQA 2KK0A 5KFIA 3QXGA 4KX5A 5ALTA 5KG4A 4F91B 3RH6A 4MFFA 3C28A 3QUCA 3PO4A 7ICGA 2H3FA 1ZRMA 1JXLA 1XWLA 5EE3A 4ED8A 1ZQNA 4DOAA 1MQ3A 2FMQA 2IOFK 4P2HA 4X5VA 4YXMA 1ZQQA 1Z00B 5KT5A 4R8UA 2BCQA 1UA1A 2MSNA 4M9GA 2WHEA 2EDUA 1IIPA 5D4BA 8ICRA 3H8WA 1T8EA 2WF7A 5DKWA 4RZRA 4UAYA 4AYBF 5EOZA 1S76D 3F2CA 7ICMA 2BHNA 4QNLA 5HNKA 1F44A 2Y0SF 2KVCA 4F4YA 4DFKA 4C4RA 3HKZF 2ALZA 4UATA 5HMLA 4NM2A 8ICKA 1PVPA 4NWIA 3ETLA 4OO1J 3IG8A 1S0OA 2ZXIA 2DPJA 2MU2A 8ICXA 4R63A 3EYZA 3BQTA 1P7DA 3KBBA 3GILA 5EE0A 4CF5A 1L7NA 3PW0A 2NRWA 4UAUA 4PHAA 1NZBA 1ZQTA 3M7DA 2JEJA 3M6KA 1KBUA 4KLOA 5ALMA 4F4ZA 2CPRA 1PK1A 4QJFB 2XGPA 4UBBA 4XQ8A 5AI8A 5AK6A 2P66A 3WKAA 4I28A 1WUDA 3M1YA 3UXOA 5KFDA 3OSNA 4QZAA 4YD1A 3NVWA 4C4TA 3H8JA 1ZQBA 4YMOA 4F4XA 1BPYA 2HOIA 2PFQA 2BCVA 5KT2A 5ALLA 1L8OA 3NVVA 1JX4A 4I29A 1NK8A 2IMWP 3PW2A 5ALQA 4U6PA 4KLQA 3A0BU 2PFPA 2G08A 4GXIA 1MSWD 9ICCA 5HMMA 2JRZA 4IQVA 3SENA 4J03A 3T5KA 3QEBZ 5AKJA 3M9MB 4Q45A 3K75D 1RPLA 5AKYA 2VJ4A 4QW9A 4EELA 3HPOA 4O5CA 4KLLA 4G3IA 2FMSA 2WF8A 2HVHA 4C4SA 5AK4A 1KDHA 2DUYA 3T79A 2BPGA 1D9DA 1NK7A 5AKIA 1UQVA 2E8OA 5FP0A 3NASA 1JIHA 5B66U 2R8JA 3LVVA 4O3NA 2D6FC 1SL2A 3IHQB 5L1KA 8ICBA 4DQIA 7ICNA 2N1RA 4BUGA 2FLPA 3I1YA 1IG6A 5J29A 4PGQA 3B0XA 3RB3A 4KN7A 3RR7A 3C5FA 1QCKA 3CP8A 4Q8FA 4M04A 4RNOA 3GDXA 2HOFA 2K4EA 5AM1A 1DOQA 4NLCA 1N56A 1QQ7A 3O0FA 1RQLA 2HBKA 2LM1A 5CA7A 3C2KA 5GTIU 1IV8A 3IM1A 2K8BB 2KEYA 3RJHA 1U4BA 5DLGA 3ED5A 1WCNA 1KSPA 3RTVA 3PY8A 3WK7A 3UXPA 3GIKA 4K4GA 4IQUA 2HCFA 4BWJA 5J0PA 2PFOA 4PH5A 2WB1C 3QUBA 3T5HA 2F2AB 2OCEA 4MF8A 5CJ7A 4DQSA 1DK2A 2QARA 3ZDBA 1NK0A 3SZ2A 1ZQRA 4NY8A 2HSZA 5DGBA 4BXOB 3KKAC 4F4WA 5KFOA 2PKEA 2F3NA 3C5GA 3QZ8A 4P4OA 2W9MA 1YT3A 4FFDA 9ICKA 1ZQEA 4YG2A 5EWGA 3NVZA 3FM9A 3KHHA 4B6JA 8ICEA 2XC9A 5KL1B 4EBCA 1A76A 1SL1A 4CF3A 1RYSA 1T4GA 5J8YA 2R8GA 2AGOA 3ORYA 3PX6A 2KIVA 3CNHA 2J6SA 1LKYA 1UPHA 1V38A 3K4GA 4K4IA 2NRZA 5J0SA 2HHQA 3H7IA 3L3FX 2MA1A 4R65A 9ICAA 3WKEA 4M6WA 3M8SA 2ZIWB 4JMUA 4B9LA 3B9JA 5DB7A 1ZQPA 3OGUA 9ICWA 2RHFA 4JK1A 5AI4A 5KT3A 2Y1JA 4B9VA 2G06A 3OPXA 2BGWA 2HHTA 2OWOA 2NRVA 5AI6A 3Q8KA 3BZKA 4GFJA 4F2RA 4PJ0U 2W9AA 3V6KA 3F2DA 5KFYA 4DL5A 2LYHA 3WK9A 3MBYA 5KFUA 4ECWA 7ICTA 3FYHA 3DV9A 4DFPA 8ICOA 2ZIXB 2XCAA 2MAXA 3N28A 7ICHA 5AK3A 4EZ9A 4I2FA 3WK6A 2ZIUA 4B9UA 4DL6A 5J2IA 1BPBA 5ALOA 2ZTEA 4I2JA 3QE9Y 1PK3A 4GXKA 2EZYA 5L1JA 1D8LA 2JGAA 3F53A 2KZ3A 1S0MA 4IRDA 4UAWA 1RG6A 4KLDA 2ZJAA 3SQIA 2KKVA 2FJ6A 5KL8B 5HR7A 5JUMA 5J2GA 4R64A 2WTFA 2YMPA 5IIIA 3NS1A 1SZPA 2LYAA 1FIQA 4US8A 5KFKA 1WWVA 4PL1A 4JV1A 3ICXA 2GWSA 4UB3A 2KN7A 2V9WA 2W8LA 2KZZA 1RQNA 2LM4A 3BDPA 8ICYA 4EBEA 4I2GA 1X9WA 4UW9A 3N7RC 2JR5A 2UVUA 3WKCA 3WK5A 1KFDA 1ZRNA 3SV3A 3GZFA 5DBBA 2YN4A 2VA3A 2AQ0A 3PSFA 5J2EA 1L7PA 4YCXA 3AL0B 3SEIA 1ZQHA 5KFTA 2JZBA 4JB3A 5AI0A 1TE2A 1T3NA 1ZQKA 4NL9C 1N61A 3QEAZ 3ZDCA 2XY5A 1UA0A 2EZZA 3NGDA 8ICNA 4QZDA 2BQ3A 4I2EA 3SAGA 4F5QA 1MQ2A 1NKBA 4CGZA 2E8MA 5HP4A 4EZ6A 4RNMA 5ALXA 2P35A 2IHMA 2JEFA 1XO0A 4MEYA 5KTQA 2WAQF 5AKGA 5GTHU 3H8SA 2PMZC 5KFAA 2CXYA 4YVZA 1L7OA 1QSYA 1Z00A 3IRUA 5J0TA 2EANA 4OJ5A 2F1HA 2Y1IA 4RQ4A 5DDYA 2W55A 2XY7A 3NUQA 2LMRA 5F9NA 5DLFA 5KFCA 5J2HA 3GIJA 4C7ZA 4FZMA 4KLGA 5ALKA 1RZTA 5KFNA 2D8CA 3AN1A 3ISDA 4ACOA 4F93B 4O3OA 3KD3A 4DLGA 2F8LA 3Q8QB 3ZDEA 1RYRA 4FBUA 1SWWA 3N7SC 4ED1A 1COKA 3N4MB 1J2NA 1BPXA 3MGVA 2EAOA 2AHOB 2VKQA 2ZXHA 3ZI4A 2A1AA 7ICRA 1SV0A 4QIWC 3RB0A 3CW2C 5AICA 4AP9A 1ZXIA 2ZUDA 2VANA 5DG8A 1H38A 1J2MA 2G09A 4RQ2A 2NO4A 5IILA 1U49A 3M6ZA 5AHXA 1SB3C 3D6JA 5TZVA 2I9GA 2AH5A 8ICHA 4F5PA 4DFMA 4USAA 1ZQDA 4US9A 5ALFA 2ZIVB 1X6JA 4OJLA 5KAFU 5AIAA 3PZPA 4ECVA 1FEZA 3WKDA 3EWAA 1B43A 4J9OA 3RBEA 4QWEA 1ZD5A 5KT6A 5AM2A 1KKXA 3K1ZA 9ICIA 3F5EA 3GV5B 5DBCA 4F50A 2B0CA 4PGYA 1TVAA 2Y9UA 1EXNA 4I2DA 1UT8A 3F2BA 4AYBC 4Y2YA 3PO5A 1XS9D 3C2MA 5G5GA 3GV7B 3IV6A 1BNPA 4TUSA 5J0OA 2VA8A 3BJYA 1SXDA 3V7JA 3HKZC 4J9KA 1ZQSA 8ICLA 1LVHA 3JPQA 1KFSA 4I2HA 4OJ6A 2C2DA 4O3PA 1Q3VA 5DB8A 2DKXA 2W9CB 1NK5A 1CI4A 5DQHA 1PVQA 1OW5A 1AQ6A 4IR1A 2YMLA 4F2SA 4PHEA 4DQRA 4OCZA 3AQEA 5CEHA 4ECYA 3AUOA 5ALVA 4Y2TA 3KTQA 4KITB 4Y2XA 4CDGA 1NKEA 1UHUA 5J2DA 3JPRA 3C1YA 4R66A 2K60A 3M9OB 3IP4B 3OJSA 1NK9A 4ECZA 2MUTA 2FDRA 3JPSA 5ALEA 1ZQ1C 3SMVA 3RRGA 1NJXA 2ASJA 4EENA 2BDUA 5C5JA 2W04A 1UCVA 3C21A 4QW8A 1NI3A 4YP3A 3GIMA 1S10A 3MGIA 1DXSA 3G6VA 1NK4A 8ICSA 2BCUA 2HHVA 1LB2B 2OEHA 1QQ6A 1KFTA 3NTUA 5AM3A 2R8IA 2LYBA 1T7PA 4BXOA 1JXEA 1XNSA 5KG2A 1X6IA 3PX0A 2RRDA 4C8NA 4NLKA 2AQ4A 1TV9A 5DG7A 1BPDA 5CP2A 5AI5A 9ICLA 5F9LA 4YFKA 1BPEA 1ZQXA 3QYPA 5ALWA 5J8YC 5BPCA 4JUZA 4A8EA 4PGXA 2Y9TA 3TAQA 3MFHA 5KFWA 2ESEA 2OH2A 4IL6U 4QZBA 1N63A 5ALDA 2GOLA 4PPXA 5ALUA 2XIDA 1BVSA 4UB1A 2ZIWA 2XI9A 1JI7A 3GIIA 2H3VA 2KJ5A 3RJKA 2HMXA 4M9HA 4DL4A 1JROA 4QZGA 5IINA 4Q44A 4I2AA 5ALPA 1X9XA 2NRTA 4MHVA 3Q8SB 3ZD9A 4IRKA 2EQYA 4FS1A 2NO5A 4ELTA 2GO7A 4DQQA 3NVYA 5DQGA 3ZDDA 2HHWA 2EH9A 1T3QA 5L1IA 4YR0A 1V9PA 1N5XA 4DSEA 1VDVA 4TURA 4KLMA 5AKKA 2KKPA 2ZIXA 2A3VA 4ZOHC 3TFRA 2C28A 3RJEA 4Z6FA 4Z6EA 2OXOA 3RF9A 4IR9A 1V97A 4RQ6A 4EEKA 4XUSA 1SXEA 5IIJA 3QU9A 1Q3UA 2K4HA 2ZTCA 4MFAA 4WJ3B 1HIWA 1N62A 2MUTB 1D8BA 5KFFA 4KLUA 5J2FA 2DWQA 4YQWA 3HT3A 4B9SA 7ICOA 1ZD4A 7ICFA 1N60A 3V7KA 2W8KA 2F8KA 4J9MA 2XO7A 1TK5A 5J0XA 1XSPA 3H4DA 1NJYA 3H0RB 2I5HA 3LDAA 4EX6A 1YZ6A 8ICIA 1QSSA 2YB1A 3TANA 2M9NA 2BR0A 1B0XA 3RJJA 4O5EA 3PMLA 4TQSA 1L5UA 3ISBA 5CRXA 4FZLA 4Y2RA 2LHTA 2KHVA 4F3OA 1D8YA 1MC8A 2J6TA 4LVSA 2BPCA 1DRGA 5L1MA 1VLBA 2C2EA 3K1RB 3SYZA 3L4PA 4P4MA 5ALHA 2Z7JA 1L3VA 3MFIA 4DO9A 1IXRA 2JH7A 8ICWA 1UT5A 3RB6A 1ZOLA 1ZETA 1OXJA 4Q43A 3AM9A 3C2LA 4J9QA 5TISU 1COOA 2DL0A 4BX9C 1ZQWA 4UBCA 3MDAA 3BQ7A 3IG5A 2BCSA 1ZJMA 2PI4A 3AU6A 1OUQA 2FPKA 1GO3F 4DS4A 4O3QA 3OHBA 3B0YA 2DGZA 3EUB2 5EE9A 1LV5A 9ICPA 4FO6A 4UASA 1TKDA 1S0NA 5HR6A 1C7YA 4Y2UA 4LJXA 4GC7A 4IQWA 4ED3A
chains in the Genus database with same CATH topology
1F0MA 3TADA 2L5YA 2ESEA 2DKXA 2KIVA 2QKQA 1LKYA 1V38A 1OW5A 1COKA 3IDWA 2GLEA 1SV0C 2EAPA 2DKZA 2EAOA 1UQVA 2E8OA 4PZOA 4RQNA 1JI7A 1LKYB 1SV4A 1V85A 1Z1VA 1SV0A 5L1MA 2KSOA 5KNIA 2LPEA 2KG5A 4NJ8A 2QB0A 1X9XA 4MHVA 2K60A 2KSOB 2JV3A 3K1RB 2EAMA 2QB0B 3BS5A 1X40A 1X66A 2F44A 3SEIA 3TACB 3BS5B 1OXJA 3BS7A 4NL9C 2KE7A 1KW4A 1WWUA 1SGGA 1UCVA 3HILA 1PK1A 4NL9A 2DL0A 1DXSA 1SXEA 1PK1B 3BQ7A 2E8MA 2K4PA 5JU5A 5F3XB 2ES6A 2B6GA 5JRTA 1PK3A 2QARA 2KMDA 4RQMA 5JTIA 2Y9UA 2QARB 1B4FA 2YTUA 2E8NA 2EANA 3KKAC 2QB1A 3H8MA 2F3NA 1RG6A 2F8KA 2E8PA 2LMRA 3KKAA 3SENA 4IS7A 2D3DA 1SXDA 4PZNA 2FE9A 5J8YC 3TADC 1B0XA 2D8CA 2Y9TA 1WWVA 5J8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F0M A;  3TAD A;  2L5Y A;  2ESE A;  2DKX A;  2KIV A;  2QKQ A;  1LKY A;  1V38 A;  1OW5 A;  1COK A;  3IDW A;  2GLE A;  1SV0 C;  2EAP A;  2DKZ A;  2EAO A;  1UQV A;  2E8O A;  4PZO A;  4RQN A;  1JI7 A;  1LKY B;  1SV4 A;  1V85 A;  1Z1V A;  1SV0 A;  5L1M A;  2KSO A;  5KNI A;  2LPE A;  2KG5 A;  4NJ8 A;  2QB0 A;  1X9X A;  4MHV A;  2K60 A;  2KSO B;  2JV3 A;  3K1R B;  2EAM A;  2QB0 B;  3BS5 A;  1X40 A;  1X66 A;  2F44 A;  3SEI A;  3TAC B;  3BS5 B;  1OXJ A;  3BS7 A;  4NL9 C;  2KE7 A;  1KW4 A;  1WWU A;  1SGG A;  1UCV A;  3HIL A;  1PK1 A;  4NL9 A;  2DL0 A;  1DXS A;  1SXE A;  1PK1 B;  3BQ7 A;  2E8M A;  2K4P A;  5JU5 A;  5F3X B;  2ES6 A;  2B6G A;  5JRT A;  1PK3 A;  2QAR A;  2KMD A;  4RQM A;  5JTI A;  2Y9U A;  2QAR B;  1B4F A;  2YTU A;  2E8N A;  2EAN A;  3KKA C;  2QB1 A;  3H8M A;  2F3N A;  1RG6 A;  2F8K A;  2E8P A;  2LMR A;  3KKA A;  3SEN A;  4IS7 A;  2D3D A;  1SXD A;  4PZN A;  2FE9 A;  5J8Y C;  3TAD C;  1B0X A;  2D8C A;  2Y9T A;  1WWV A;  5J8Y A; 
#chains in the Genus database with same CATH topology
 4UAZ A;  3TAD A;  4ELU A;  5EE1 A;  5J2C A;  2O6K A;  5CHG A;  2KJ8 A;  1FO4 A;  4QWD A;  4C8L A;  1SV0 C;  3J81 j;  3QU4 A;  1JRP A;  4NLZ A;  3PSP A;  4ECT A;  4Z6C A;  1DGS A;  3RAQ A;  1Z1V A;  3CYM A;  4RPZ A;  4OJO A;  1N2X A;  5J0Y A;  4DSI A;  3E2E A;  4YMM A;  4RQ8 A;  1ZQI A;  3AU2 A;  9ICM A;  5AKL A;  4HAI A;  3OJU A;  1CRX A;  4KN4 A;  5AM0 A;  5DB9 A;  2Q0Z X;  1L6N A;  4QZH A;  3PSI A;  2LKY A;  3TAC B;  2ZIV A;  1X9M A;  5J0R A;  2QLT A;  2AGP A;  3RH4 A;  1S0V A;  4B9T A;  2BCR A;  5ALZ A;  2WAQ C;  5ALY A;  5KFV A;  2KP7 A;  9ICQ A;  2ISP A;  9ICR A;  2WF5 A;  5F3X B;  2B6G A;  2BPF A;  3C29 A;  1SWV A;  2KMD A;  8ICM A;  2W3S A;  4C80 A;  5JTI A;  1C20 A;  8ICT A;  2E8N A;  5KFP A;  2KHQ A;  2W11 A;  3EPG A;  4DOC A;  3TAR A;  5J0W A;  1JMS A;  1N5W A;  2PXI A;  3GFK B;  1ZQV A;  3Q8P B;  3D2Q A;  4E0D A;  2V4R A;  1ECW A;  5KFL A;  4GLX A;  3WK8 A;  2W9C A;  1ZQJ A;  3MDC A;  3UXN A;  1JUD A;  2HW3 A;  5CB1 A;  2KFZ A;  1ZQM A;  9ICV A;  4FS2 A;  2QKQ A;  5CWR A;  4KMO B;  3UMG A;  3MR3 A;  5ALN A;  2IHN A;  4KX3 A;  4ELV A;  4UAV A;  2EAP A;  3KZX A;  1KL9 A;  4RT2 A;  4NLN A;  4DSK A;  2G5I B;  4J9L A;  3I28 A;  4XRH A;  3RRH A;  4HYK A;  4NJ8 A;  3RH5 A;  3M8R A;  4ED0 A;  4QZI A;  7ICU A;  3RBD A;  1WCL A;  2KSO B;  3FC4 A;  3JPO A;  8ICQ A;  1RXW A;  4DCC A;  2BKE A;  1QH9 A;  4XA5 A;  5E79 U;  4DWI A;  1MA7 A;  4KMU A;  5KFQ A;  1K1S A;  2I6X A;  2W54 A;  3KZI U;  3PMN A;  3BS7 A;  5HHH A;  2ASL A;  2YY6 A;  1HEK A;  2MRL A;  3HIL A;  9ICB A;  3GU3 A;  1HJP A;  2UVW A;  3WU2 U;  5AKE A;  3C23 A;  4KTQ A;  3WKB A;  2RDJ A;  4C0Z A;  3S6J A;  3H0M B;  2RDI A;  1L8L A;  4MFC A;  2H3I A;  3RR8 A;  3L5K A;  2F77 X;  4G9B A;  9ICO A;  3LYS A;  4O3M A;  9ICT A;  2EZX A;  1T94 A;  3TAP A;  2HDO A;  3PX4 A;  1ZQO A;  3THV A;  3QU5 A;  9ICN A;  2C22 A;  2A1J B;  2ZJ5 A;  2DBY A;  1S9F A;  4KLE A;  2J6U A;  2KNJ A;  5ALG A;  3N97 B;  3PR5 B;  3F5A A;  5KFZ A;  2BZF A;  3TKA A;  2H3Z A;  5KFE A;  4KLH A;  4QWB A;  5DG9 A;  3JPP A;  1FFU A;  2WF9 A;  3G6Y A;  5KFJ A;  1MN8 A;  3V7L A;  4I2C A;  1Z3E B;  1WG8 A;  7ICQ A;  3HJE A;  1U45 A;  2DKZ A;  2Y0S C;  4PZO A;  4F72 A;  4RQN A;  5L1L A;  2KD1 A;  4F8R A;  3PW5 A;  1A77 A;  3MGH A;  2OHF A;  3TI0 A;  3ETR A;  5KNI A;  4CE6 A;  4DSL A;  3UQ2 A;  3ALR A;  4ECS A;  2IOH A;  4RU9 A;  1QLN A;  4DL2 A;  5KAI U;  2KVS A;  1KQQ A;  4BGD A;  4JV2 A;  3PW7 A;  2EAM A;  4DSJ A;  2QB0 B;  3RJF A;  1KRP A;  3DEE A;  2PI5 A;  4ED2 A;  2F44 A;  3SAF A;  4OJP A;  4MF2 A;  5KFR A;  2RLT A;  3VCB A;  4YD2 A;  3MR2 A;  3IN5 A;  1SGG A;  2VA2 A;  3SV4 A;  4RUA A;  4GIB A;  1PUZ A;  4M9J A;  3VC8 A;  4LZG A;  3TQ1 A;  4M2Y A;  4UAR A;  5IIK A;  2A19 A;  4PHD A;  2ES6 A;  5BOM A;  4RNN A;  5JRT A;  5KG5 A;  2KJ9 A;  2NRX A;  4DEZ A;  3V72 A;  3UMC A;  1ZQA A;  1A0P A;  5KT4 A;  1S5L U;  3HRD D;  1B4F A;  5DQI A;  4Y2V A;  1FFV A;  5A0L A;  4DSF A;  9ICG A;  2KTQ A;  3N7P D;  3H8M A;  1D9F A;  4QZE A;  2YX8 A;  2ZUC A;  1O03 A;  3BQ1 A;  4KLS A;  5KFX A;  4NXZ A;  2FE9 A;  2YQE A;  2CN1 A;  3MR5 A;  3UQ0 A;  5AKZ A;  3SR6 A;  3KHG A;  2FI1 A;  3LWL A;  1TK8 A;  2L5Y A;  2G0A A;  3UMB A;  2F76 X;  2FLL A;  3EW9 A;  3RJI A;  5J0Q A;  4F5O A;  1URJ A;  4ECQ A;  4MEX A;  1RXV A;  5C0Y A;  5AI9 A;  1SKR A;  3HX0 A;  2W9B B;  8ICU A;  2KIW A;  1KEJ A;  5ALI A;  3Q8R B;  5ALS A;  4GC6 A;  1ZQL A;  4ECR A;  5ALR A;  1L3S A;  4I27 A;  1B22 A;  1S8O A;  1BPZ A;  1XC9 A;  4FZN A;  4P0Q B;  4RPY A;  3BQ0 A;  1ZYQ A;  2HI0 A;  4K4H A;  3KFU F;  1X66 A;  1CUK A;  4EYI B;  2OM6 A;  5KT7 A;  4PL2 A;  4I2B A;  4O3S A;  2NYV A;  3BS5 B;  2XIC A;  4YR2 A;  2K8A A;  2R18 A;  3QUQ A;  3MR6 A;  1TAM A;  2YMQ A;  2DPI A;  2ISO A;  2XVT A;  9ICF A;  3SI8 A;  2AXT U;  3SAH A;  8ICP A;  3NRZ A;  5D46 A;  4IQT A;  4J9S A;  2ASD A;  2K4P A;  1A6S A;  4B9N A;  4CRX A;  3QUT A;  4F4K A;  2WFA A;  2IOF A;  4P0P B;  5J2K A;  2YTU A;  1N48 A;  5J2A A;  1RM6 C;  1TAQ A;  1S77 D;  4F5N A;  4QZC A;  5IIO A;  4QZ9 A;  1ZQC A;  5AKX A;  3PST A;  4ED6 A;  3T5J A;  2D3D A;  4CNQ A;  1RYU A;  1KLN A;  4JWM A;  4R8U B;  3KHL A;  3TAD C;  1HUZ A;  4KLT A;  2AJQ A;  2F1I A;  1SKW A;  4ECX A;  5AIB A;  2E1E A;  4O0I A;  4LZD A;  1U47 A;  1SL0 A;  1U48 A;  1SKS A;  4I2I A;  3HP6 A;  4RQ7 A;  3ISC A;  1K1Q A;  3HW8 A;  3IDW A;  5G5H A;  2CRX A;  3ZDA A;  2ZUB A;  4CF4 A;  2OYY A;  4RPX A;  5KG0 A;  4UB6 U;  2KZM A;  7ICJ A;  4YR3 A;  5K4L A;  4PHP A;  7ICS A;  4TUQ A;  2KG5 A;  1YZ7 A;  2XY6 A;  3RAX A;  4O3R A;  4UB5 A;  4TQR A;  3KOO A;  5CR0 A;  4DS5 A;  2JV3 A;  3QZ7 A;  4GXJ A;  2C2R A;  3AEV A;  1ZJN A;  1XU4 A;  2HHU A;  1ED1 A;  3DDH A;  2JXJ A;  2W43 A;  2V4Q A;  7ICE A;  3SD7 A;  3QX7 A;  1QQ5 A;  1X2I A;  2KE7 A;  1KW4 A;  1TAU A;  9ICE A;  1JAL A;  3LK9 A;  3RJG A;  1VJ5 A;  3PR4 A;  3RB4 A;  2R8K A;  3MAB A;  2G07 A;  2JH1 A;  2GH1 A;  2IBK A;  3G6X A;  3PV8 A;  2UVR A;  1NJW A;  1PK1 B;  5L9X A;  2DF4 B;  2F1J A;  4C8O A;  3UPQ A;  1L3T A;  2I1Q A;  1ZQG A;  5DGA A;  2XCP A;  1SZH A;  3Q8L A;  3Q8M A;  4ZH4 A;  5KG3 A;  4YN4 A;  5DB6 A;  1ZQU A;  2AU0 A;  3KHR A;  3AQF A;  2W7P A;  4EYH B;  3GV8 B;  7ICL A;  4DL3 A;  2WB1 F;  2HBJ A;  4QZF A;  1XO1 A;  2UVV A;  1KTQ A;  4DL7 A;  4FE3 A;  4KLF A;  1L7M A;  4QWC A;  4Z6D A;  3E0F A;  4M47 A;  3U26 A;  4BWM A;  3BQ2 A;  1F0M A;  1TK0 A;  3GQC A;  1JN3 A;  5AK5 A;  4Y2J A;  2ATL A;  3V6J A;  5BOL A;  1PVR A;  9ICH A;  3T3F A;  3H40 A;  4KLJ A;  2W7O A;  4DLE A;  1ZD3 A;  3JPT A;  3ZD8 A;  1QSL A;  3QNM A;  2KIC A;  2ZG6 A;  1V85 A;  4IRC A;  4EEY A;  2ZTD A;  2KSO A;  1Z1B A;  2E1F A;  5H2F U;  2VJ5 A;  1Z4N A;  4F5R A;  7ICI A;  4KLI A;  1NOM A;  1QTM A;  2BQR A;  1IM4 A;  4F92 B;  3H4B A;  4O5K A;  3R9K A;  5J0U A;  4UB2 A;  5AM5 A;  2HBM A;  1HUO A;  9ICJ A;  1NNL A;  4EX7 A;  4O9M A;  2HBL A;  4U7C A;  1DGJ A;  1WWU A;  4DF4 A;  1TFR A;  5B5E U;  5AKH A;  4RQ5 A;  4J9R A;  3LVW A;  3I76 A;  8ICC A;  2H3Q A;  4M0A A;  2P6U A;  2YB4 A;  4RQM A;  1NK6 A;  4NLB A;  1Q8K A;  4Q8E A;  4ICA A;  3NRW A;  2QAR B;  1ZQF A;  5AM4 A;  2A1J A;  5T14 A;  4RQ3 A;  1CEZ A;  2NV3 A;  2W03 A;  2R8H A;  5KFB A;  2XGQ A;  2K89 A;  3HWT A;  2E8P A;  5IIM A;  3KKA A;  4RQ1 A;  4J9N A;  4RQ0 A;  1PZN A;  4PZN A;  4J9P A;  1J97 A;  1Q46 A;  1X42 A;  5KFH A;  3PNC A;  2KV2 A;  2ZJ8 A;  1NKC A;  3CRX A;  3BZC A;  2E5S A;  3UM9 A;  1ZQZ A;  2LI6 A;  2YMM A;  2LBO A;  3EZ5 A;  5KFM A;  3QU2 A;  2AGQ A;  7ICP A;  9ICX A;  2HVI A;  3OSP A;  2M0N A;  1LKY B;  1SIJ A;  1Z4O A;  8ICG A;  2RP5 A;  5KG1 A;  4ECU A;  2FPL A;  4M6W B;  5KFS A;  2QB0 A;  1BGX T;  1NZP A;  2JHD A;  1XSL A;  3V6H A;  8ICJ A;  2JEG A;  2FPM A;  2FMP A;  3A0H U;  9ICS A;  3WK4 A;  3T5L A;  4F71 A;  3D2S A;  4Y2P A;  2BDP A;  4ED7 A;  1WYG A;  1X9S A;  4DOB A;  3OHA A;  4JWN A;  4UQG A;  2Q4T A;  3AMZ A;  4BJQ A;  5J2J A;  4NLG A;  3PW4 A;  5DBA A;  4BDP A;  7ICK A;  3C1Z A;  3D2N A;  4IC9 A;  1L3U A;  4UB8 U;  2JMG A;  1ARO P;  5J2B A;  1XSN A;  1ZQY A;  4DF8 A;  2ZIU B;  2JEI A;  4QZ8 A;  2E3T A;  3OTQ A;  3JPN A;  4EBD A;  4B9M A;  3M9N B;  1KN5 A;  4Y2S A;  4P4P A;  3QU7 A;  2QB1 A;  2W3R A;  4CCH A;  5HHI A;  3H0L B;  2WF6 A;  4TUP A;  4IS7 A;  3MC1 A;  5D49 A;  2IA6 A;  3EPI A;  2FLN A;  5DDM A;  4DFD A;  2PMZ F;  2KOB A;  5EWF A;  2P6R A;  3TFS A;  5KFG A;  1O08 A;  4RT3 A;  3RFA A;  8ICV A;  8ICA A;  4JV0 A;  2B21 A;  2BQU A;  7ICV A;  4DFJ A;  1BNO A;  2GLE A;  2HHX A;  9ICU A;  8ICZ A;  3ONN A;  2W9B A;  4C8K A;  1SV4 A;  2VIX A;  5EWE A;  1U9L A;  5ALJ A;  2K8C B;  2DQN B;  4Y2Q A;  1F5S A;  4P0Q A;  2LPE A;  2K4I A;  3LWM A;  2ODG A;  5KG6 A;  4DQP A;  3BS5 A;  4C7Y A;  1X40 A;  1ZD2 P;  4M9L A;  3E58 A;  1RDF A;  5KG7 A;  4RUC A;  3FAH A;  1S97 A;  4QIW F;  1NJZ A;  2PFN A;  1Y88 A;  4FBT A;  2G5H B;  2RQ5 A;  2JZB B;  1DK3 A;  4UB4 A;  1K5O A;  4OD0 A;  4NL9 A;  3FDS A;  4C8M A;  4M9N A;  4YMN A;  1Z19 A;  2DFL A;  2KFN A;  1M6Y A;  3PVX A;  2HHS A;  5JU5 A;  4NV0 A;  4QWA A;  4NM1 A;  4YXJ A;  4P0P A;  8ICF A;  2H5X A;  2HOQ A;  2KK0 A;  5KFI A;  3QXG A;  4KX5 A;  5ALT A;  5KG4 A;  4F91 B;  3RH6 A;  4MFF A;  3C28 A;  3QUC A;  3PO4 A;  7ICG A;  2H3F A;  1ZRM A;  1JXL A;  1XWL A;  5EE3 A;  4ED8 A;  1ZQN A;  4DOA A;  1MQ3 A;  2FMQ A;  2IOF K;  4P2H A;  4X5V A;  4YXM A;  1ZQQ A;  1Z00 B;  5KT5 A;  4R8U A;  2BCQ A;  1UA1 A;  2MSN A;  4M9G A;  2WHE A;  2EDU A;  1IIP A;  5D4B A;  8ICR A;  3H8W A;  1T8E A;  2WF7 A;  5DKW A;  4RZR A;  4UAY A;  4AYB F;  5EOZ A;  1S76 D;  3F2C A;  7ICM A;  2BHN A;  4QNL A;  5HNK A;  1F44 A;  2Y0S F;  2KVC A;  4F4Y A;  4DFK A;  4C4R A;  3HKZ F;  2ALZ A;  4UAT A;  5HML A;  4NM2 A;  8ICK A;  1PVP A;  4NWI A;  3ETL A;  4OO1 J;  3IG8 A;  1S0O A;  2ZXI A;  2DPJ A;  2MU2 A;  8ICX A;  4R63 A;  3EYZ A;  3BQT A;  1P7D A;  3KBB A;  3GIL A;  5EE0 A;  4CF5 A;  1L7N A;  3PW0 A;  2NRW A;  4UAU A;  4PHA A;  1NZB A;  1ZQT A;  3M7D A;  2JEJ A;  3M6K A;  1KBU A;  4KLO A;  5ALM A;  4F4Z A;  2CPR A;  1PK1 A;  4QJF B;  2XGP A;  4UBB A;  4XQ8 A;  5AI8 A;  5AK6 A;  2P66 A;  3WKA A;  4I28 A;  1WUD A;  3M1Y A;  3UXO A;  5KFD A;  3OSN A;  4QZA A;  4YD1 A;  3NVW A;  4C4T A;  3H8J A;  1ZQB A;  4YMO A;  4F4X A;  1BPY A;  2HOI A;  2PFQ A;  2BCV A;  5KT2 A;  5ALL A;  1L8O A;  3NVV A;  1JX4 A;  4I29 A;  1NK8 A;  2IMW P;  3PW2 A;  5ALQ A;  4U6P A;  4KLQ A;  3A0B U;  2PFP A;  2G08 A;  4GXI A;  1MSW D;  9ICC A;  5HMM A;  2JRZ A;  4IQV A;  3SEN A;  4J03 A;  3T5K A;  3QEB Z;  5AKJ A;  3M9M B;  4Q45 A;  3K75 D;  1RPL A;  5AKY A;  2VJ4 A;  4QW9 A;  4EEL A;  3HPO A;  4O5C A;  4KLL A;  4G3I A;  2FMS A;  2WF8 A;  2HVH A;  4C4S A;  5AK4 A;  1KDH A;  2DUY A;  3T79 A;  2BPG A;  1D9D A;  1NK7 A;  5AKI A;  1UQV A;  2E8O A;  5FP0 A;  3NAS A;  1JIH A;  5B66 U;  2R8J A;  3LVV A;  4O3N A;  2D6F C;  1SL2 A;  3IHQ B;  5L1K A;  8ICB A;  4DQI A;  7ICN A;  2N1R A;  4BUG A;  2FLP A;  3I1Y A;  1IG6 A;  5J29 A;  4PGQ A;  3B0X A;  3RB3 A;  4KN7 A;  3RR7 A;  3C5F A;  1QCK A;  3CP8 A;  4Q8F A;  4M04 A;  4RNO A;  3GDX A;  2HOF A;  2K4E A;  5AM1 A;  1DOQ A;  4NLC A;  1N56 A;  1QQ7 A;  3O0F A;  1RQL A;  2HBK A;  2LM1 A;  5CA7 A;  3C2K A;  5GTI U;  1IV8 A;  3IM1 A;  2K8B B;  2KEY A;  3RJH A;  1U4B A;  5DLG A;  3ED5 A;  1WCN A;  1KSP A;  3RTV A;  3PY8 A;  3WK7 A;  3UXP A;  3GIK A;  4K4G A;  4IQU A;  2HCF A;  4BWJ A;  5J0P A;  2PFO A;  4PH5 A;  2WB1 C;  3QUB A;  3T5H A;  2F2A B;  2OCE A;  4MF8 A;  5CJ7 A;  4DQS A;  1DK2 A;  2QAR A;  3ZDB A;  1NK0 A;  3SZ2 A;  1ZQR A;  4NY8 A;  2HSZ A;  5DGB A;  4BXO B;  3KKA C;  4F4W A;  5KFO A;  2PKE A;  2F3N A;  3C5G A;  3QZ8 A;  4P4O A;  2W9M A;  1YT3 A;  4FFD A;  9ICK A;  1ZQE A;  4YG2 A;  5EWG A;  3NVZ A;  3FM9 A;  3KHH A;  4B6J A;  8ICE A;  2XC9 A;  5KL1 B;  4EBC A;  1A76 A;  1SL1 A;  4CF3 A;  1RYS A;  1T4G A;  5J8Y A;  2R8G A;  2AGO A;  3ORY A;  3PX6 A;  2KIV A;  3CNH A;  2J6S A;  1LKY A;  1UPH A;  1V38 A;  3K4G A;  4K4I A;  2NRZ A;  5J0S A;  2HHQ A;  3H7I A;  3L3F X;  2MA1 A;  4R65 A;  9ICA A;  3WKE A;  4M6W A;  3M8S A;  2ZIW B;  4JMU A;  4B9L A;  3B9J A;  5DB7 A;  1ZQP A;  3OGU A;  9ICW A;  2RHF A;  4JK1 A;  5AI4 A;  5KT3 A;  2Y1J A;  4B9V A;  2G06 A;  3OPX A;  2BGW A;  2HHT A;  2OWO A;  2NRV A;  5AI6 A;  3Q8K A;  3BZK A;  4GFJ A;  4F2R A;  4PJ0 U;  2W9A A;  3V6K A;  3F2D A;  5KFY A;  4DL5 A;  2LYH A;  3WK9 A;  3MBY A;  5KFU A;  4ECW A;  7ICT A;  3FYH A;  3DV9 A;  4DFP A;  8ICO A;  2ZIX B;  2XCA A;  2MAX A;  3N28 A;  7ICH A;  5AK3 A;  4EZ9 A;  4I2F A;  3WK6 A;  2ZIU A;  4B9U A;  4DL6 A;  5J2I A;  1BPB A;  5ALO A;  2ZTE A;  4I2J A;  3QE9 Y;  1PK3 A;  4GXK A;  2EZY A;  5L1J A;  1D8L A;  2JGA A;  3F53 A;  2KZ3 A;  1S0M A;  4IRD A;  4UAW A;  1RG6 A;  4KLD A;  2ZJA A;  3SQI A;  2KKV A;  2FJ6 A;  5KL8 B;  5HR7 A;  5JUM A;  5J2G A;  4R64 A;  2WTF A;  2YMP A;  5III A;  3NS1 A;  1SZP A;  2LYA A;  1FIQ A;  4US8 A;  5KFK A;  1WWV A;  4PL1 A;  4JV1 A;  3ICX A;  2GWS A;  4UB3 A;  2KN7 A;  2V9W A;  2W8L A;  2KZZ A;  1RQN A;  2LM4 A;  3BDP A;  8ICY A;  4EBE A;  4I2G A;  1X9W A;  4UW9 A;  3N7R C;  2JR5 A;  2UVU A;  3WKC A;  3WK5 A;  1KFD A;  1ZRN A;  3SV3 A;  3GZF A;  5DBB A;  2YN4 A;  2VA3 A;  2AQ0 A;  3PSF A;  5J2E A;  1L7P A;  4YCX A;  3AL0 B;  3SEI A;  1ZQH A;  5KFT A;  2JZB A;  4JB3 A;  5AI0 A;  1TE2 A;  1T3N A;  1ZQK A;  4NL9 C;  1N61 A;  3QEA Z;  3ZDC A;  2XY5 A;  1UA0 A;  2EZZ A;  3NGD A;  8ICN A;  4QZD A;  2BQ3 A;  4I2E A;  3SAG A;  4F5Q A;  1MQ2 A;  1NKB A;  4CGZ A;  2E8M A;  5HP4 A;  4EZ6 A;  4RNM A;  5ALX A;  2P35 A;  2IHM A;  2JEF A;  1XO0 A;  4MEY A;  5KTQ A;  2WAQ F;  5AKG A;  5GTH U;  3H8S A;  2PMZ C;  5KFA A;  2CXY A;  4YVZ A;  1L7O A;  1QSY A;  1Z00 A;  3IRU A;  5J0T A;  2EAN A;  4OJ5 A;  2F1H A;  2Y1I A;  4RQ4 A;  5DDY A;  2W55 A;  2XY7 A;  3NUQ A;  2LMR A;  5F9N A;  5DLF A;  5KFC A;  5J2H A;  3GIJ A;  4C7Z A;  4FZM A;  4KLG A;  5ALK A;  1RZT A;  5KFN A;  2D8C A;  3AN1 A;  3ISD A;  4ACO A;  4F93 B;  4O3O A;  3KD3 A;  4DLG A;  2F8L A;  3Q8Q B;  3ZDE A;  1RYR A;  4FBU A;  1SWW A;  3N7S C;  4ED1 A;  1COK A;  3N4M B;  1J2N A;  1BPX A;  3MGV A;  2EAO A;  2AHO B;  2VKQ A;  2ZXH A;  3ZI4 A;  2A1A A;  7ICR A;  1SV0 A;  4QIW C;  3RB0 A;  3CW2 C;  5AIC A;  4AP9 A;  1ZXI A;  2ZUD A;  2VAN A;  5DG8 A;  1H38 A;  1J2M A;  2G09 A;  4RQ2 A;  2NO4 A;  5IIL A;  1U49 A;  3M6Z A;  5AHX A;  1SB3 C;  3D6J A;  5TZV A;  2I9G A;  2AH5 A;  8ICH A;  4F5P A;  4DFM A;  4USA A;  1ZQD A;  4US9 A;  5ALF A;  2ZIV B;  1X6J A;  4OJL A;  5KAF U;  5AIA A;  3PZP A;  4ECV A;  1FEZ A;  3WKD A;  3EWA A;  1B43 A;  4J9O A;  3RBE A;  4QWE A;  1ZD5 A;  5KT6 A;  5AM2 A;  1KKX A;  3K1Z A;  9ICI A;  3F5E A;  3GV5 B;  5DBC A;  4F50 A;  2B0C A;  4PGY A;  1TVA A;  2Y9U A;  1EXN A;  4I2D A;  1UT8 A;  3F2B A;  4AYB C;  4Y2Y A;  3PO5 A;  1XS9 D;  3C2M A;  5G5G A;  3GV7 B;  3IV6 A;  1BNP A;  4TUS A;  5J0O A;  2VA8 A;  3BJY A;  1SXD A;  3V7J A;  3HKZ C;  4J9K A;  1ZQS A;  8ICL A;  1LVH A;  3JPQ A;  1KFS A;  4I2H A;  4OJ6 A;  2C2D A;  4O3P A;  1Q3V A;  5DB8 A;  2DKX A;  2W9C B;  1NK5 A;  1CI4 A;  5DQH A;  1PVQ A;  1OW5 A;  1AQ6 A;  4IR1 A;  2YML A;  4F2S A;  4PHE A;  4DQR A;  4OCZ A;  3AQE A;  5CEH A;  4ECY A;  3AUO A;  5ALV A;  4Y2T A;  3KTQ A;  4KIT B;  4Y2X A;  4CDG A;  1NKE A;  1UHU A;  5J2D A;  3JPR A;  3C1Y A;  4R66 A;  2K60 A;  3M9O B;  3IP4 B;  3OJS A;  1NK9 A;  4ECZ A;  2MUT A;  2FDR A;  3JPS A;  5ALE A;  1ZQ1 C;  3SMV A;  3RRG A;  1NJX A;  2ASJ A;  4EEN A;  2BDU A;  5C5J A;  2W04 A;  1UCV A;  3C21 A;  4QW8 A;  1NI3 A;  4YP3 A;  3GIM A;  1S10 A;  3MGI A;  1DXS A;  3G6V A;  1NK4 A;  8ICS A;  2BCU A;  2HHV A;  1LB2 B;  2OEH A;  1QQ6 A;  1KFT A;  3NTU A;  5AM3 A;  2R8I A;  2LYB A;  1T7P A;  4BXO A;  1JXE A;  1XNS A;  5KG2 A;  1X6I A;  3PX0 A;  2RRD A;  4C8N A;  4NLK A;  2AQ4 A;  1TV9 A;  5DG7 A;  1BPD A;  5CP2 A;  5AI5 A;  9ICL A;  5F9L A;  4YFK A;  1BPE A;  1ZQX A;  3QYP A;  5ALW A;  5J8Y C;  5BPC A;  4JUZ A;  4A8E A;  4PGX A;  2Y9T A;  3TAQ A;  3MFH A;  5KFW A;  2ESE A;  2OH2 A;  4IL6 U;  4QZB A;  1N63 A;  5ALD A;  2GOL A;  4PPX A;  5ALU A;  2XID A;  1BVS A;  4UB1 A;  2ZIW A;  2XI9 A;  1JI7 A;  3GII A;  2H3V A;  2KJ5 A;  3RJK A;  2HMX A;  4M9H A;  4DL4 A;  1JRO A;  4QZG A;  5IIN A;  4Q44 A;  4I2A A;  5ALP A;  1X9X A;  2NRT A;  4MHV A;  3Q8S B;  3ZD9 A;  4IRK A;  2EQY A;  4FS1 A;  2NO5 A;  4ELT A;  2GO7 A;  4DQQ A;  3NVY A;  5DQG A;  3ZDD A;  2HHW A;  2EH9 A;  1T3Q A;  5L1I A;  4YR0 A;  1V9P A;  1N5X A;  4DSE A;  1VDV A;  4TUR A;  4KLM A;  5AKK A;  2KKP A;  2ZIX A;  2A3V A;  4ZOH C;  3TFR A;  2C28 A;  3RJE A;  4Z6F A;  4Z6E A;  2OXO A;  3RF9 A;  4IR9 A;  1V97 A;  4RQ6 A;  4EEK A;  4XUS A;  1SXE A;  5IIJ A;  3QU9 A;  1Q3U A;  2K4H A;  2ZTC A;  4MFA A;  4WJ3 B;  1HIW A;  1N62 A;  2MUT B;  1D8B A;  5KFF A;  4KLU A;  5J2F A;  2DWQ A;  4YQW A;  3HT3 A;  4B9S A;  7ICO A;  1ZD4 A;  7ICF A;  1N60 A;  3V7K A;  2W8K A;  2F8K A;  4J9M A;  2XO7 A;  1TK5 A;  5J0X A;  1XSP A;  3H4D A;  1NJY A;  3H0R B;  2I5H A;  3LDA A;  4EX6 A;  1YZ6 A;  8ICI A;  1QSS A;  2YB1 A;  3TAN A;  2M9N A;  2BR0 A;  1B0X A;  3RJJ A;  4O5E A;  3PML A;  4TQS A;  1L5U A;  3ISB A;  5CRX A;  4FZL A;  4Y2R A;  2LHT A;  2KHV A;  4F3O A;  1D8Y A;  1MC8 A;  2J6T A;  4LVS A;  2BPC A;  1DRG A;  5L1M A;  1VLB A;  2C2E A;  3K1R B;  3SYZ A;  3L4P A;  4P4M A;  5ALH A;  2Z7J A;  1L3V A;  3MFI A;  4DO9 A;  1IXR A;  2JH7 A;  8ICW A;  1UT5 A;  3RB6 A;  1ZOL A;  1ZET A;  1OXJ A;  4Q43 A;  3AM9 A;  3C2L A;  4J9Q A;  5TIS U;  1COO A;  2DL0 A;  4BX9 C;  1ZQW A;  4UBC A;  3MDA A;  3BQ7 A;  3IG5 A;  2BCS A;  1ZJM A;  2PI4 A;  3AU6 A;  1OUQ A;  2FPK A;  1GO3 F;  4DS4 A;  4O3Q A;  3OHB A;  3B0Y A;  2DGZ A;  3EUB 2;  5EE9 A;  1LV5 A;  9ICP A;  4FO6 A;  4UAS A;  1TKD A;  1S0N A;  5HR6 A;  1C7Y A;  4Y2U A;  4LJX A;  4GC7 A;  4IQW A;  4ED3 A; 
#chains in the Genus database with same CATH homology
 1F0M A;  3TAD A;  2L5Y A;  2ESE A;  2DKX A;  2KIV A;  2QKQ A;  1LKY A;  1V38 A;  1OW5 A;  1COK A;  3IDW A;  2GLE A;  1SV0 C;  2EAP A;  2DKZ A;  2EAO A;  1UQV A;  2E8O A;  4PZO A;  4RQN A;  1JI7 A;  1LKY B;  1SV4 A;  1V85 A;  1Z1V A;  1SV0 A;  5L1M A;  2KSO A;  5KNI A;  2LPE A;  2KG5 A;  4NJ8 A;  2QB0 A;  1X9X A;  4MHV A;  2K60 A;  2KSO B;  2JV3 A;  3K1R B;  2EAM A;  2QB0 B;  3BS5 A;  1X40 A;  1X66 A;  2F44 A;  3SEI A;  3TAC B;  3BS5 B;  1OXJ A;  3BS7 A;  4NL9 C;  2KE7 A;  1KW4 A;  1WWU A;  1SGG A;  1UCV A;  3HIL A;  1PK1 A;  4NL9 A;  2DL0 A;  1DXS A;  1SXE A;  1PK1 B;  3BQ7 A;  2E8M A;  2K4P A;  5JU5 A;  5F3X B;  2ES6 A;  2B6G A;  5JRT A;  1PK3 A;  2QAR A;  2KMD A;  4RQM A;  5JTI A;  2Y9U A;  2QAR B;  1B4F A;  2YTU A;  2E8N A;  2EAN A;  3KKA C;  2QB1 A;  3H8M A;  2F3N A;  1RG6 A;  2F8K A;  2E8P A;  2LMR A;  3KKA A;  3SEN A;  4IS7 A;  2D3D A;  1SXD A;  4PZN A;  2FE9 A;  5J8Y C;  3TAD C;  1B0X A;  2D8C A;  2Y9T A;  1WWV A;  5J8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...