1GO3F

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
MIGKKILGERYVTVSEAAEIMYNRAQIGELSYEQGCALDYLQKFAKLDKEEAKKLVEELISLGIDEKTAVKIADILPEDLDDLRAIYYKRELPENAEEILEIVRKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
total genus 33
structure length 107
sequence length 107
chains with identical sequence N
ec nomenclature
pdb deposition date 2001-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1go3F01
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1go3F02
1WUDA 2HBJA 2HBLA 4QJFB 1D8BA 1GO3F 4OO1J 2E1EA 2HBMA 4QIWF 2DGZA 2HBKA 2CPRA 4NLBA 4CDGA 2KV2A 1YT3A 4NLCA 2RRDA 3SAHA 4O3MA 3SAGA 2MA1A 3CYMA 2E1FA 3SAFA 2RHFA 4CGZA 5C0YA
chains in the Genus database with same CATH superfamily
1KBHA 4UAWA 2NRXA 1S0MA 5KX5A 3UMBA 1VEWA 2ES6A 4HYKA 2WLIB 4R63A 4IQTA 4P2HA 4DR3O 3PV8A 2ZJ8A 2XO7A 3G6BA 4LCUC 3WK7A 4UV9A 4YD2A 2WB1F 3SJCC 1D5NA 2WLNA 4FVMA 2W7PA 3UMGA 2BCVA 1ZAUA 1JFFB 1ORQC 1R6KA 2W3RA 1CRXA 3RT3C 4F50A 4TUSA 2YS8A 5LYJA 2WF8A 2UXCO 2ZIWB 4LF7B 3KHLA 4UQGA 5DGBA 1SZHA 2JK5C 5AK3A 4FBUA 4ED8A 1M56B 4O4HB 1AR5A 3E8GA 4O3QA 4IYHA 3BFRA 2WWWA 2KEYA 1OCZB 3PX0A 1DF5A 5BZBA 5ALTA 1OXJA 1EXNA 4OO1J 5IIMA 3D2NA 1UA0A 4YD1A 2ATKC 1R3KC 3ASNB 1RXVA 4RQ6A 4O4JA 1Z19A 3RRGA 2F1MA 1QH9A 1FFXB 1QVGU 5EE9A 2EIJB 2UXDB 2UXBO 3CCJV 1ZQWA 2OIGA 1HDJA 2BZFA 2KV2A 5DG7A 5AKLA 3RAQA 1NK9A 1MSDA 1S5LZ 3HPLC 5J2TB 2F1JA 5KG6A 2C2AA 2XIDA 5KUMA 2MK3A 4UVAA 5DECA 4DV3O 4LFAB 4JYAO 4JTAB 1WB7A 2KVCA 1OW5A 5AKKA 1M90W 5L3CA 5BOMA 2HJFC 1FJGB 2PFOA 4EBCA 4ZOLB 2QB1A 4CF3A 1DTOA 4NLGA 3T1YB 3V7JA 3BQTA 2BSKA 2DYSB 5CMUA 1OCRB 5K1PA 1RSOB 4PHDA 2CPRA 4Y2VA 2K60A 4CS3A 3I76A 4RU9A 2Y0PA 4Y2UA 2D6FC 5B1OA 3UKMA 4P2ZA 1XNRB 1PNLA 4Q20A 5A2QN 1SQPH 8ICEA 5KG5A 1BPEA 1JROA 1RYUA 3SR2C 4UB1A 4O3MA 3UO3A 1B06A 2WLKA 7ICJA 7ICIA 4QWAA 2ASJA 3QEAZ 3WK8A 5JRTA 3Q8QB 5C8YB 1TUBB 3SPCA 1JFFA 1SS3A 2PI4A 2Q67A 2IJHA 1VQNV 1NK6A 2DOSA 5J9PC 4D6TH 1FXHA 4MTOA 1A76A 4DW1A 7ICMA 2ZIWA 4XRHA 4DFDA 3KKAA 2ZUBA 5LXTB 2PI5A 4CZZA 5EE1A 1YTFB 1GTOA 3PW2A 2ITDC 4US8A 1R73A 2QJ1A 3H1LH 1M9NA 2EILC 1ZQPA 5ALHA 2BCQA 3L70H 1JCHA 3RYCA 5LHGA 1KUQA 3K75D 4IQUA 4F4YA 1US6A 4GYCB 1IBMO 5KG3A 2ISPA 8ICMA 4IL6U 3RAXA 2BDPA 1FFXA 2R9RB 4DV5O 3K9SA 1JQ0A 5D5QA 1LNQA 4TUYB 2Y1JA 2PYLA 2LYAA 1MN8A 5J2TA 4BWAA 5ALSA 4YXJA 4RWUA 1AR1B 4LZGA 1BHAA 2YMQA 3NRZA 1AQ6A 1Y67A 4I9WA 4JI5B 5JVDA 3SGIA 2E8PA 2PYJA 4RPYA 2XCPA 3V6KA 1U49A 2BCCH 4GXIA 3BEHA 4PHAA 4ZOLA 1J97A 1XEQA 1KRPA 4ZBMA 1N33O 3CYMA 5B3SB 3U10A 1CP9A 3KG2A 5B1AC 2IJIA 3IP4B 4ZHQB 4C7YA 4J9PA 4UVBA 2BQUA 2KFNA 1S9FA 4J9NA 3ETLA 4PDRA 1F7YA 4KLJA 2D3DA 4DLGA 1ZSPA 3JSLA 4YMNA 5G5HA 1ZQMA 5C8YA 3ISCA 4KLFA 1TUBA 1HNWO 5AICA 1SXDA 5KHIA 3RTVA 2G38A 3DC6A 2BPGA 3K5LA 1E1RG 4X65O 3F7YC 5CBHA 5CA7A 3PW5A 1NH2B 1I94O 1AP5A 5J2BA 1Q82W 5LXTA 2AU0A 3IV6A 2XGPA 3H4BA 1SRYA 1YEWA 4BX9C 3F2DA 2Q6AA 4JWMA 4JTCB 3THVA 9ICXA 2ZJAA 1SL2A 5KT6A 3WKEA 2HDOA 1ZQHA 2IBKA 1SC5B 5BPCA 1X6JA 2WAMA 1KC8W 2ZKOA 2Q0OC 1WCLA 3PR4A 2FPKA 5J0XA 5IILA 2HVKC 2IBZH 3K0GA 3UQ0A 3CMEV 3MD0A 5JCOA 3HKBA 1WLEA 2PFNA 4TUYA 1XL4A 2F4VB 1JVMA 1TK0A 4MEXA 3CJHB 4RUCA 4EBDA 2LP7A 5BR8B 2E3TA 1VQPV 2AGQA 1S97A 1JIHA 3TANA 1DOQA 1IBLO 5CJ7A 2KZMA 1X9XA 4CBCA 4R8UB 1ZUQA 1A0PA 3ZDEA 3B77A 2W0FC 1X6IA 4DF4A 3CEIA 1I0HA 4GCZA 2FDRA 4JF3A 4NB5A 1XC9A 3SV4A 3D3QA 4B3SO 3SYPA 4RUFA 1ZQKA 1CPYA 3H8JA 1HW7A 1QU7A 4P9PA 1D9FA 5IJ9B 1VQKV 4NWIA 2OCEA 1V55B 4NL9A 3MGVA 3VC8A 3RBZA 3ZHTA 1SETA 5AIBA 2HR3A 4ZHQA 2ZNJA 1KKCA 2Y0SF 3ASOC 4B3MB 4GKJB 1DGJA 4UCVA 3MR3A 5LGUA 2AGPA 2GTSA 1RP3B 1IM4A 3K03A 1N62A 1SV0A 4DLEA 2ZINA 5JU5A 1JN3A 1NJXA 2KVSA 4LFCB 1K8AW 2F43G 1QLNA 8ICIA 2AHZA 4J42A 3H8SA 5HR6A 3SR6A 5DQGA 2JJ2G 5CBGA 5LOVB 4IRCA 3OTQA 3S3XA 4I2JA 5KUKA 4DOBA 3HJEA 4H37A 5EC1C 1U48A 2CUGA 1SQXH 4UB8U 4LC1A 3CCRV 4RQ8A 2JMGA 2QR4A 1T94A 3ORYA 3ZRVA 3F53A 2L35A 3JALB 2NR5A 1Y6XA 4P0QB 1OV9A 4OX9O 4YR3A 2W7OA 3SENA 2KJ5A 4QWDA 1MC8A 2DKZA 2YIBA 1ZQGA 4NTYA 4M9JA 2UUBO 1N32B 1BPYA 4DR5B 3JSNA 4F93B 3ISDA 1KQQA 2UUCO 1M4UA 2OTJV 1ZXIA 4J9QA 3OAAG 1Z3EB 4G3IA 1QSLA 1T5EA 3CJHA 4TUPA 2V4QA 4UB8Z 3H4DA 9ICMA 4CE6A 2H3IA 2C2DA 2NV3A 3X2QB 4G9BA 3ETQA 2HBMA 9ICEA 4EZ6A 3JAMN 2Q4TA 2FLPA 2N04A 3LDEA 3DDHA 1PUZA 1ZWIC 4R8UA 1S0OA 3W7TA 5ALWA 3QU4A 2W8LA 4UCOA 4ED1A 2QE7G 4FFBB 4DQSA 3DGEA 2XVTA 1YT3A 4F2SA 1Z00B 3HW8A 1FXKA 4X62O 3FC4A 2O57A 1F5SA 5AKJA 5KFKA 5KT5A 3JPTA 4FBTA 1MABG 5JQGA 2IH3C 4DR2O 4K0KB 1QSYA 4PZNA 1WYGA 4F2RA 2AZ0A 1X9WA 5K4LA 5IYBO 1XHZA 2AQ0A 1JX9A 2RHFA 4GC7A 2QM7A 3G6XA 3OTOB 1X40A 2VQEO 3APOA 4GXJA 2NRVA 3GIKA 5LHHA 3JD2A 7ICKA 3HKZC 2JRZA 1YF2A 3T1CA 1R1BA 4UB4A 3IGAC 4U7OA 4R64A 3QYPA 4JV2A 2F66C 3ZCCA 3OGUA 4RO2A 1Q90D 5B66U 3SYAA 1VQOV 1BNOA 5LOVA 1ZRNA 3KOOA 1NZBA 1NJYA 3AL0B 2JS5A 1JRPA 1Q8IA 3AG1B 1N36O 4CNQA 1NTZH 3UM7A 2BQ3A 1R3JC 5H5NA 3QU7A 1WNSA 2ZUDA 4P0QA 1NU1H 3EZ5A 3TQ1A 2G08A 1VDVA 4EYHB 3SV3A 4UCRA 1L3SA 3FKSG 1WUDA 4QZFA 4I50B 4GC6A 4AHCA 5DN6G 4DUYB 2Q0ZX 2JEGA 4KUMA 3M8SA 5B1NA 3EFFK 4ZH4A 3OGCC 3M9MB 1VF6A 5DLFA 1Z1VA 3OPXA 4KLIA 3E35A 2G06A 4C80A 3SDLA 1NK5A 4YHHB 2XAHA 3S3WA 3J80N 1F51A 4O9MA 3LUTB 1L8OA 4D7TA 3CRQA 5KFYA 2I6XA 4FFKA 2CDYA 3F7VC 1RPOA 2DBYA 4DWIA 3JATB 3F2BA 3B2EE 4FFBA 1Z00A 5AI5A 4PDMA 1HNXB 2OH2A 4LF7O 4CRXA 3CCEV 2YB1A 3QZ8A 3BS5B 3WKCA 4FLWA 1VLBA 5EC2C 5KL1B 4C7ZA 3C2KA 9ICLA 4ZKIA 4IR9A 3ABMB 4RNOA 1LR1A 3J81N 1Z4OA 1PK1B 2F93B 2BE3A 2DYRB 3K1RB 4P4MA 3OE7G 4O4LB 4PJ0Z 5J2JA 2ZXWC 3VQWA 2M9NA 4K4HA 3JAKB 1AP6A 3RH6A 1ZJNA 5J2IA 5BMVB 4EX7A 8ICFA 2IW5A 3FB8C 4PGYA 3RB4A 4PV1B 1L6NA 3ABLC 5K1XA 1WPBA 1RPLA 1NZ6A 2PMZC 4ECXA 3M6ZA 3N7SC 4O3NA 3OW2U 5HMLA 4ZIBA 2UU9O 1Q3UA 1PNKA 2VIXA 2P6JA 5LMNO 2OM6A 4M6WB 4ECYA 2EINC 4JV0A 4I4TA 1M93A 4I50A 5KHHA 3H8MA 4DR4B 2H3VA 3TAPA 3KKYA 2LHTA 3PMNA 2XGQA 2EULA 3QO8A 4KLGA 3OEEG 3T1YO 4TQSA 3QE9Y 3JPQA 3FX7A 4JI2B 4FMTA 3PO4A 9ICIA 3K57A 3WKDA 5ALPA 1SKSA 2FYUH 2LW1A 3W7WA 1U47A 4DV0O 1B43A 4NKGB 4J9OA 1B0XA 5J8YC 3D36A 3RYFB 5EWGA 4CH6A 3G6VA 5DLGA 2OWOA 1U9LA 4QZIA 3AG3C 1BQ0A 4JV5O 2JH1A 3L9DA 2ZR3A 4Z6FA 3V6HA 3EXAA 1EM1A 3QXGA 1IXMA 3CCVV 3D6JA 9ICGA 4J9SA 2NNUA 4JI0B 5IWAO 1YITV 5KG0A 4X1YB 1WWUA 4UB3A 3Q8RB 4TWKA 4B3TB 1JXEA 4JI7O 4FJCC 4GIBA 1NS1A 2Z0AA 5DM6V 2R8KA 3VQYA 4KTQA 2XASA 3E22B 3F2CA 1JPXA 1S3JA 4PA6A 4I2AA 4M9HA 1JX4A 1PK1A 2BR0A 2QWPB 2KG5A 4CCHA 2LFRA 3ABKC 3JPNA 4DS4A 4KLOA 1DLBA 3JAKA 2RNBA 4UXNA 5BMVA 3GV7B 5LMUO 3FFQA 1ZQRA 3MR2A 2YI9A 3K4GA 1YZ6A 3JASB 2OXOA 2YEVA 2RLTA 4ECZA 2X6BA 4PPXA 1T4GA 4JI5O 2GBOA 2N1RA 4MHVA 4O3SA 4MW8A 1MQ2A 1ZQQA 1E1QG 4M6WA 3H1HH 4J7ZA 1GAXA 3HKEB 2PFQA 4CF4A 1K4DC 9ICAA 4YJ2B 4RUAA 3N27A 4JI3B 3LVWA 1D8BA 2K9PA 2BHNA 2LQTA 4BWJA 2OIEA 4LF8B 2G5IB 5L3EA 3ZD9A 4DV6B 8ICRA 1K97A 4B9TA 2F23A 2W3SA 3OMAB 3IDWA 1TAQA 2P7TC 5H2FU 1RM1C 1IZ3A 1TK5A 4O4IB 5IT9N 1QQ7A 2CTQA 3ZD8A 3JAWB 3RGBA 2JVDA 3C28A 1COOA 2VJ4A 4DXWA 4O3OA 1XQ8A 4NXNO 2OCCC 4GX2A 3CMAV 4F72A 1QSSA 4X1YA 4C4RA 1D8YA 7ICPA 3H9VA 3ZMZA 3E8FA 4OJLA 3ZDDA 3BQ0A 2WLLB 4C8MA 3E22A 4PI0A 5ITZB 5H2FZ 4ECWA 1XU4A 1TAEA 4XUSA 5AI4A 3A0RA 5KFLA 4Q44A 2JEJA 2Q0AA 4I2DA 4E4EA 3AG4B 1F0MA 4ASUG 3GILA 3CRAA 1NJZA 2GSMB 4C8KA 4DO9A 4J9KA 1L0NH 4RQ2A 2BGWA 1AJQA 1SQGA 3Q8PB 5L1IA 4KLMA 2F4VO 4PDLA 3ZN0A 5ALZA 3BDPA 5KAIU 5BR8O 3JASA 2YB4A 5KFIA 4U3JA 3NS1A 4HAIA 2ZE6A 5AKXA 4YMOA 3AM9A 2P6UA 1FS0G 1UPGA 3KKAC 3T79A 2P67A 2VQFB 2XT9A 5KL8B 4RQ0A 1OCCB 5KFBA 3SPIA 1M56C 1YHQV 3MBYA 3HKEA 1Y88A 1KYOF 1OCZC 1M57B 1XNSA 1VMGA 2LW7A 3TCUA 4ICAA 1O08A 5CHGA 3I28A 3ASNC 4XDKA 4CC5A 2JEUA 5ALLA 1TKDA 3MFIA 5HMMA 5L3FA 1L3TA 3CCUV 1ZQJA 1X42A 5EZYB 5IYCO 4MTFA 1TAUA 1AVMA 1YDXA 1ROPA 4DCCA 3JAWA 4O4IA 2OYQA 8ICGA 3HP6A 1H2LA 1XMQB 3OMIB 2E76B 4JASA 4C0ZA 2F1HA 3MR5A 4JI1B 4FZNA 1XHXA 4LFCO 5AHXA 3EPGA 2ZE5A 3JPOA 3BQ1A 2B1IA 1EN4A 4OJOA 2CRXA 3WB0A 2Q7GA 2KICA 3APQA 3ZX6A 2LBOA 2ZDIC 1BPBA 4OXSA 3LSSA 2Q9LA 4PHEA 3B4SA 4KITB 5J0TA 1RZTA 2EIKC 2DYSC 2WLLA 5DEDA 1V54B 3TJTA 5ITZA 1JA8A 1GN2A 3ETDA 4O5EA 5KFOA 3CP8A 4A8EA 1N63A 1HEKA 2EAMA 1S5JA 1NH2D 2R9IA 1I5XA 3PX6A 2DJVA 1HIWA 4X1KB 5LP6C 4DR5O 3E8BA 3ZMSA 1NKBA 1FXVA 1ZL8A 2K4HA 1O9GA 1AI5A 3B0YA 4EX6A 1COKA 3GB7C 1RXWA 1XSLA 4DRXB 3E2EA 2ADPA 1N56A 3CPWU 4BWMA 4IYIA 4C8OA 1UQVA 4KP4A 2ZTDA 1LUVA 4EB6B 3DC5A 1P7DA 5KA6A 3T5LA 4DV2O 4GXKA 3AK3A 3SJBC 2V1DA 3MAQA 2QB0A 4DR7B 4DQPA 1PL4A 3C3SA 5FP0A 5KTQA 4MVOA 3PW0A 4ELUA 2XAFA 1ZQNA 1VARA 1JUDA 2CGOA 4EYIB 5J2DA 1GKFA 3LK9A 1ZQAA 5EWEA 1QNMA 3GDXA 3OM3B 3LVVA 5DQIA 4K0KO 4B3RB 4CC6A 1SQBH 3OHBA 1UFIA 4KXRA 3HWTA 5EZYA 5JCOC 4LH6A 3K5MA 1ZQUA 3OTOO 1K1SA 2VA8A 2Y9TA 2HHUA 2N74A 3RF9A 5EBLC 1PM9A 2W54A 4OJ6A 1MG1A 1MOFA 3MDCA 2VA3A 4J9LA 2Z5UA 3IFXA 4EBEA 1Q6UA 1SKVA 1SGGA 4KLDA 4O3PA 3MGIA 1GO3F 2KB1A 1IV8A 2CXYA 4FIPC 1OHHG 3RYCB 2JGAA 4XQ8A 5B3SC 1TVAA 3SPGA 4NYKA 3IRUA 1WP8A 1ZTEA 3O0FA 1XMOO 3OUSA 4O0IA 4M04A 5D5PA 4FLUA 3T5JA 2VKQA 4J7JA 2A1JB 1G1XB 1S0VA 4BR6A 4DR6B 2O6KA 2KZZA 1RYSA 2KSDA 3K06A 2K4PA 3GFKB 1NK7A 3K59A 2PMZF 2ILMA 3RFRA 4X1KA 3HR0A 2RRDA 4UAYA 2R8GA 2GUZB 1W0JG 1Z1BA 4GT1A 1T3QA 1K4CC 4AI8A 4XA5A 3FAVA 2QARB 3QO7A 5JVDB 4FLXA 4RT2A 2IJKA 4Z2WA 4DRXA 2XY5A 1TGOA 3WK6A 1Z4NA 3R9KA 4EB6A 4YHHO 1M5IA 4JTDB 1YJWV 4Y2XA 4FS2A 5E79U 2F77X 4R65A 4Q6GA 4MSWC 4KX3A 4LNUA 8ICHA 4CDGA 4DQRA 5J0YA 9ICUA 4DV1O 9ICNA 3MHHC 1SL1A 4C4TA 3BZKA 9ICTA 1WWVA 3IM1A 3T5KA 1FFTB 4JPRA 4QIWC 5F9LA 4Z6EA 1C20A 2FL4A 2WFAA 1JALA 5AM4A 3C23A 4ED3A 1SQVH 3RR8A 3T4DA 3ALRA 2V9WA 1A6SA 2DN9A 1PZNA 2DE0X 1Y76B 1HR0B 4LF9B 5E79Z 3JCZA 5J2UB 4DSKA 4RQ4A 4F4XA 2YXHA 2XTAA 3FB7C 3D8CA 2KP7A 4O2BB 4X64B 3F5WC 2X0LA 4OD0A 2XAGA 4KL1A 3WFVA 1Q8KA 3QZ7A 4JGSA 3CCLV 3W7SA 1BZKA 4CF5A 4MF8A 1K7DA 2BPFA 1KU9A 3VOUA 2JEXA 2XAQA 2QKAA 3HT3A 4DV4B 4JZ2A 4FM2A 5KG7A 4JZGA 4Y2TA 4FLZA 2A1JA 4I7ZB 1NVPD 2DMXA 3HKBB 4DR4O 9ICCA 1K33A 3UPQA 3AMZA 2P6RA 4YMMA 1VJ5A 3W7UA 2NRTA 3I5DA 3V7KA 2C28A 3K5NA 2GUZA 3O9OA 2KSOB 5KFTA 3SJQC 2KHQA 4JI2O 3Q8MA 2W55A 2KFZA 2QARA 3CSXA 2FMPA 1W2BU 4NLKA 5AKEA 1AILA 3R66A 4F8RA 2YN4A 4UATA 2YI8A 5LHIA 4EENA 4IL6Z 4X8AA 4F91B 2KKWA 2EX3A 5JWPA 5AKZA 2KNJA 1ZQXA 1KMIZ 2W03A 4LF6B 2Y4TA 1AI6A 2F3NA 4GUNA 4AILC 1SIJA 2K1EA 1ZQCA 4X88A 5HFLA 2HLDG 2EZYA 3KZIU 8ICBA 4B3TO 1PD3A 4YFKA 2KIVA 5J0WA 4YR0A 1MMMA 1S77D 5KT2A 1X59A 1KL9A 2E8OA 2R70A 3K79A 5AKIA 1VP7A 1NZPA 5KHJA 1PKXA 8ICJA 2EJ7A 1FIQA 3ZEDA 3OFNG 4DR1B 1FAFA 3TAQA 1Y76A 2EAOA 5DQHA 2Q4PA 3X2QC 1YZ7A 1ZJMA 4DQIA 5J2UA 4CS4A 1L3UA 3ZMTA 2HG5C 4O2BA 7ICSA 3KZIZ 4PELA 7ICTA 2XICA 3IAYA 3U0ZA 4ELVA 2BOCC 4F6RB 3GIIA 4XBFA 2PKEA 3TXQA 3KBBA 4CH3A 2WF5A 4IQWA 4TOIA 1U45A 2F76X 1L3VA 5HHHA 3Q8SB 4RQ7A 1SB3C 1RQNA 2OYYA 2XY6A 8ICQA 1H2MA 3LNNA 4JI3O 4LF8O 4UBCA 1T3NA 5DKWA 7ICGA 2E8NA 3T1HB 2C2EA 1H2SB 4RUEA 1BPXA 2W9BB 2KSOA 3P3NA 1NBMG 2VJ5A 3PW4A 1SA0A 5LA6B 3ISBA 3C3TA 2BKEA 4JYYA 4DL7A 1QCEA 3ABTA 4M9LA 1RG6A 2HBJA 2Q68A 5IIIA 2H3OA 1IURA 3RJHA 1EFRG 5EIBD 1VQMV 3QEBZ 1ZD2P 4JAVA 4WF9V 4XDJA 3V6JA 4KLTA 1FXKB 3K58A 5JQGB 5H9CA 5AI9A 3M6KA 4IHJA 3UM9A 4QWCA 2FMSA 1D5AA 3RB0A 1XWLA 2BOBC 3HX0A 2DKXA 4I2CA 8ICOA 4NLZA 5ALVA 1YSCA 1SERA 4GFJA 2DFLA 1PL0A 1CI4A 5A0LA 3M9NB 2GTAA 3M99B 1S72V 1UJWB 2P66A 3CRMA 1VQLV 3ICXA 2HKOA 2M6YA 3L72H 2EIMB 3ZDCA 2AH5A 3ZS8C 2H3ZA 4KLSA 2FMLA 4JB3A 2LGQA 1EN5A 1HJPA 1KB9F 4TV8B 4GKJO 1K9MW 3B8MA 2WA3A 1U96A 3RJKA 3N4MB 4Y2JA 3V72A 4F6RA 5ALNA 5LBQA 4MF2A 1LUWA 5CA1B 3MHSC 2QA4V 4EEYA 4FE3A 5HFMA 2VQFO 2FJ6A 4QZCA 3WU2U 3OTFA 3SYZA 8ICCA 4MVMA 3VQVA 3ZN1A 4E2LA 1Q7YW 4LFBB 1ZQIA 2KKPA 4UARA 2LKYA 4PA9A 4WFHA 2DL0A 4I28A 2K8BB 2W9BA 3OMNB 1XNQB 3L74H 3JPSA 5LA6A 4X89A 4DFJA 2IMWP 5KAFU 3RJIA 4DV7O 3K04A 4LF4B 3GV8B 4UUJC 2ZTEA 3C2MA 3TI0A 4YJ3B 4X66O 4TURA 4JI1O 3JD0A 1IXBA 2KQXA 4B9UA 4OJ5A 1VF5B 4UW9A 1X9SA 4NXMO 1WA8B 4QNLA 4I2GA 2B9ZA 2AQ4A 3AEVA 1SESA 3BAAA 4PHZA 3NTUA 4I9QA 2FLLA 1RQLA 2OEHA 5CR0A 5KAFZ 1BGYH 3ZIAG 2Q7EA 3LDDA 2ZG6A 2F8LA 3A8TA 5IDJA 2IHMA 2ZE8A 3TADA 4YY3B 1IVSA 2WHEA 4F4ZA 3RN4A 1KN5A 1Q6HA 3CP1A 1AR4A 2ZJ5A 3A0HU 1NI3A 4DR3B 2ASLA 2I1QA 4J9ZB 1NVPB 2CE4A 2IJJA 4BW9A 3GZFA 4JYBA 3ML0A 4QZAA 4TV8A 3QUQA 3AEIA 3ETGA 5J0OA 1IX9A 2JR5A 1J2MA 2BPCA 3QO5A 1VQ4V 3JARB 1DRGA 2J6TA 4B6JA 4O3RA 4I4TB 1H8HG 4QWEA 1T7PA 1QQCA 4YIOA 4DUZO 1H8EG 1RFYA 1S76D 1GH6A 5CA1A 1SQQH 1SWVA 5B66Z 1KP3A 4DR7O 2N05A 4I0XA 2QWOB 3A0HZ 5AKHA 2A3QA 3MABA 2YC0A 4MVRA 4U7CA 2H3FA 2WF7A 3OR6C 4JI4B 4U3FH 3TARA 1OZ0A 3FDSA 2CTWA 4DS5A 1O9HA 4XDLA 4GLXA 3UXPA 2ZR2A 4NLCA 5J0RA 8ICPA 4DYLA 1XUQA 2UVUA 4Z1VA 1Q81W 4P9OA 3CS5A 2JS3A 5EWFA 2MU2A 2BQRA 2WAQC 1YJ9V 2RDCA 2EANA 4QPKA 2GWSA 4EZ9A 7ICLA 3TETA 2IU3A 2JJ1G 3K1ZA 1P4RA 4Q8FA 1U97A 5GTHU 3K08A 4YJ3A 4YN4A 2QKCA 4JYAB 5HP4A 3CCSV 4FM1A 4QIWF 2E74B 5ALGA 4C4SA 2KG7B 3RR7A 1WA8A 1GRJA 2AGOA 1NQTA 4DL5A 4G28B 1B3QA 2PZSA 3FB6C 3CC2V 5DB8A 1HUZA 2F95B 5IINA 2NN4A 3GIMA 2ZT9B 3T4ZA 2P5OA 2UXNA 2UXDO 4RNNA 1H2GA 1WPXA 4W4KA 2X7RB 4K8ZA 4DR6O 4I2IA 5GTHZ 3ZHQA 1QQ6A 3H0LB 4FZLA 4O5CA 4B08A 2GDSA 2ZIVB 1F4NA 5AM2A 3NR7A 2YEVB 1V85A 3C2LA 1B4FA 4WFEA 4LFAO 1NK8A 3GQCA 2FPLA 4H0LB 4U7NA 2XC9A 5BY1A 3UMCA 3L71H 2OTLV 5DGAA 4F4LA 3ZJZA 3STLC 4P0PA 1QTMA 4M2YA 4O5KA 3MFHA 3JARA 3M8AA 5CB4B 5KLVH 4ECUA 1FJGO 5KG1A 3AK1A 4J9MA 1FPOA 3H1KH 3QF7A 5IIKA 4L8JA 3HPOA 1AROP 4RQFA 4DQQA 1N48A 3A2FA 2YDEA 1K92A 1XNRO 4DEZA 3D3IA 4YXMA 4B7KA 5TZVA 2HOQA 3L5KA 4GX0A 1AJNA 1XBLA 1N61A 2HVJC 1L8LA 4DO2A 4I29A 1ZYQA 4QE9A 2QTSA 1HR0O 4LF9O 4F5QA 3RBDA 4JI8B 3LDCA 4MFAA 9ICKA 2QDOA 2XNDG 3KHRA 2CAZC 2EBOA 1OCCC 4B9LA 2Y4UA 4FO6A 1VQ6V 3C5FA 2K89A 3CC7V 2KG7A 5B1BB 3FYEB 2JGUA 3AG2B 5KT7A 3Q4HB 2P4VA 3RFAA 5KFFA 4F71A 3CW2C 4TQRA 2ZXHA 3MGHA 2DGZA 2H5XA 2HBKA 3BY6A 2VS0A 4P4OA 5HR7A 3CRCA 1CUKA 4B9MA 1S10A 4UAZA 4UCUA 2ATLA 4LZDA 1F44A 1JR9A 2VWKA 3N97B 1DGSA 2A9HA 2KJ8A 3TFSA 2ZIVA 2DW4A 4U3JB 2Y9UA 1JOYA 2IU0A 1N8RW 5JH7B 4PHPA 1KECA 2Z7JA 1P7BA 4QWBA 4EELA 2EDUA 4Y2RA 1GM7A 4RT3A 4RNMA 7ICQA 5CB4A 1FO4A 1XO0A 1PVRA 2HBLA 4AP9A 3KFUF 9ICQA 2YIAA 2P35A 2YQEA 2XCAA 4DFMA 2A06H 2MRLA 2J6UA 4LF6O 4NLNA 4TUQA 3ZHVA 5CWRA 4UB2A 2ZIOA 4PL1A 4KLQA 4I2BA 2HVHA 2WLMA 3OUFA 4I2FA 1QQ5A 1XI1A 2B0CA 5KFJA 2EZPA 4PI2A 2NRWA 3NVVA 1QLEB 4IIJA 2Y69B 2D8CA 3SI8A 5IY5B 3SAFA 3AU2A 3OHAA 3CC4V 4ECTA 1GK9A 1NKDA 4DR1O 2GH1A 3WK9A 2ARHA 1J5EB 3AUOA 4N23A 4YG2A 1WN7A 2C22A 4J7KA 4I2EA 1IBLB 2ZXWB 4WFFA 3VCBA 4YXWG 3E83A 2W9AA 3AU6A 2W11A 2GV9A 5T14A 3OGIB 4G2KA 4NVPA 2E8MA 3SJAC 1YIJV 5D49A 8ICWA 3EHBB 5KFAA 1VIBA 3Q4HA 1Y4MA 1BL8A 1ZQTA 8ICXA 1S8OA 4B3SB 1D9DA 2JEFA 9ICBA 5BXZA 7ICHA 2HP8A 4YVZA 1CXZB 2LO1A 4MEYA 4B9SA 4X1IA 1N60A 2K8AA 4OJPA 1KFDA 2QM4A 4Y2QA 2VRZA 1ZL8B 1VQ9V 1PVPA 4HAMA 2YSUB 3K9AA 4NR1A 5KFQA 4B9NA 4C7UA 3D2SA 4P30A 1BCCH 9ICVA 5KHKA 3T1HO 1G8MA 2QWQB 2FKXA 5JH7A 4U6PA 5A9GA 5DG9A 5J0SA 2IM9A 2Q73A 2PFPA 5HNKA 2QB0B 5FPRA 4RZRA 2YIDA 7ICNA 1THZA 2HHHB 4F5RA 2ZXIA 1KDHA 3LYSA 1ZQEA 1ZETA 1BVSA 3KHHA 2NRZA 1ZQLA 3IJ4A 3AG3B 2YMPA 4PGXA 1Q5OA 1GN4A 1Q6IA 1R6TA 2EIJC 4QZDA 4ABMA 1I5YA 1DK3A 2HCFA 1Q3EA 4DSJA 2LFSA 3PMLA 1VF7A 2IOFA 3T3FA 1MSWD 5KAIZ 1ED1A 1TUEB 4BW5A 4B3MO 4OX9B 3M7MX 3GWKC 8ICUA 2AXTU 4BIUA 2V4DA 3FAHA 4FLTA 1KLNA 5KFNA 5DB9A 2W6IG 4QZHA 3BA9A 3UCSC 5C93A 2YICA 1V9PA 3SD7A 4JI6B 2Q69A 9ICWA 1YXBA 3H40A 4ELTA 1QR8A 5H6QA 1TVKB 5DB7A 5EK0A 5L3GA 3HKZF 3ABKB 5JJJB 3H1IH 1N5WA 2MA1A 3QU5A 1OCRC 2Q7HA 2AXTZ 4BUGA 4KFMA 1N34B 3F5EA 5C0YA 2E75B 4DSLA 5AM5A 3BZCA 5FL7G 5LL6Y 5KT3A 5GONB 5EOZA 4X62B 2RN9A 3J81j 2I9GA 4DR2B 3I1YA 4PGQA 4YIPA 2BTQA 1N32O 4R7CA 1O03A 2F2AB 1YJNV 4K35A 4UAVA 1FEZA 4CH4A 4ED7A 2C2RA 4DL4A 2RDJA 2KJ9A 3FAVB 3PSTA 4ECRA 2Y0IA 4Z6DA 5KFEA 5JUMA 4LFBO 1YZBA 2FMQA 3RJEA 1XNQO 3SAHA 1TV9A 1NKEA 1N0JA 1S0NA 1PPJH 4QE7A 5L3BA 1MA7A 4KLEA 4KLUA 2HHXA 2DPIA 9ICRA 1RM1B 3P30A 3M9OB 2B1GA 5EBMC 4F4WA 2HJDA 4WBNB 5J8YA 4LNUB 1LKYB 5L1JA 3ZDAA 1JXLA 1AI4A 1MA1A 4WJ3B 2OCCB 4MS2A 3WK4A 1J95A 4K8XA 2BCSA 2WAQF 4ZI7B 1B04A 4LR3A 1H2KA 3THOA 1NK0A 3H0MB 5AM3A 2QSAA 1OJHA 2ZM6B 3CRRA 1IIPA 3BHPA 4H13B 4CS2A 2W04A 4FS1A 3MR6A 3GWOA 5F3XB 5ALFA 3N7RC 2DWEC 4F6EA 3B40A 1K5QA 1NT2B 4HNAA 2W9MA 2ODMA 5ALMA 4QZGA 3QU2A 1GN3A 4UFZA 3RW0A 3M7DA 1TVKA 1RDFA 3KZXA 2UVRA 4J41A 1C7YA 3WG7B 1IXRA 3F5TA 5B5EU 3IC9A 3GIJA 5CA0B 5ALDA 1PK3A 3PZPA 1NI8A 3NVZA 3DEEA 1WG8A 2BTOA 2E5SA 1XO1A 1JI7A 3G6EV 4NL9C 2HVIA 3SPJA 3OSPA 5L1KA 2G07A 3G71V 5ALXA 3SPHA 1BSMA 5J2KA 5GONA 3PSIA 2WLHA 4FZ1A 1S5LU 3LSQA 3BABA 1ZQSA 4DUYO 1J2NA 1YCIA 5LGNA 1SV0C 5ALOA 2G0AA 3ONNA 9ICJA 1NJWA 4K4GA 4RQ1A 1L0LH 1PVQA 4RQEA 4UB6U 1ZX3A 5B5EZ 2X6CA 3CRXA 1BE3H 1SKRA 2MAXA 5KFRA 5J2EA 4RAIA 4JI4O 4LBEC 2CTRA 2A1AA 5AK6A 2JRIA 5J2CA 4Z6CA 2AJQA 1MZEA 1KEJA 4GX1A 1D8LA 4R8CA 4MTXA 3CXCU 4L87A 2ZE7A 1BPDA 1L5UA 4KHPB 1QBZA 5KFUA 2JGDB 4KLLA 4WBNA 3G6YA 5IYDO 1LKYA 1IG6A 2M7WA 2G5HB 1H38A 3G80A 2D2CB 5L3DA 2DUYA 2UXXA 2LYHA 4UB6Z 1HNXO 2XAJA 1P84F 4PA4A 3QNEA 2UU9B 4OCZA 2E1FA 4ZI7A 5LMNB 1SL0A 4BIZA 4OPHA 1D2DA 1QVFU 3ZHSA 4QPJA 2JZBA 1A77A 1M6YA 3D2QA 4C8LA 4KLHA 4MFFA 7ICUA 2IH1C 3WK5A 2EIKB 4F5PA 3PX4A 5TISU 1OCOB 2DF4B 2FTKA 1X66A 2MSNA 1I08A 1JJOA 2LJ2A 2EJRA 4DV0B 5JJEB 2WLIA 4D7SA 5CA0A 1KW4A 2JEIA 5LGTA 1KD1W 4R50A 4R66A 5KFHA 5LP6B 1FXKC 4JV5B 5IIOA 4I27A 1IDSA 3NVYA 1ZOLA 2ZIXB 4QZ9A 1V55C 8ICAA 5KFZA 1XL6A 2HHSA 4UB5A 1ZD3A 5IWAB 3AQFA 2Z3YA 3A0BU 4BIOA 1V97A 2WTFA 2FE9A 5AI6A 1TA8A 4QJFB 2CTPA 5TISZ 4JI7B 3P3PA 3R65A 5F2VO 3C29A 2OCHA 1JMSA 4Q43A 4ED0A 3RH5A 4NXZA 2W9CB 2ZTCA 4O4HA 3TADC 4UBBA 3NVWA 1EZVH 4DL3A 1SA0B 3H1JH 4ACOA 3T2MA 2LM4A 2EIMC 2QTOA 2W0XA 4Y2YA 4KN4A 1EZJA 1JMKC 4JK1A 8ICNA 2UVVA 4BXOB 5J2GA 5KFWA 4GZRB 2ZIUB 3EW9A 4BAYA 1UA1A 5L1MA 2FB5A 1IBKB 1DK1A 1ZD5A 1QCKA 3A0BZ 4AYBC 3S6JA 3BJYA 4IRKA 4JWNA 4JMUA 4EEKA 4IHJB 4UCTA 5LMUB 4JI0O 2JGDA 4Y2SA 1BHBA 4M9GA 3RYHB 2MUTB 1NKCA 3B0XA 1TAMA 4J03A 4JI8O 2XUMA 3CCQV 4ED2A 2KMDA 2NLJC 4ECVA 3TACB 2WA4A 3OD4A 2PTMA 1VF6C 1HNZB 2ZDIA 3RB3A 2VA2A 4IT5A 1DK2A 2UUAB 4EEQA 1GMGA 2IOHA 2RJZA 3CE2A 4PDVA 1BMFG 3KTQA 2QLTA 4IQVA 5L9XA 2FI1A 1X9MA 5L1LA 1RSOA 5EE0A 2JIZG 3ZRXA 3GV5B 3BS7A 1EBOA 3RVZA 2Q8VA 4DL2A 2P06A 3BQ2A 5LP6A 1YI2V 4NXNB 2WLJA 4DSFA 2ZIXA 1LB2B 4FK5C 1B6QA 3QUTA 2ESEA 2JV3A 3AK2A 3N2KB 3H7IA 4HZ3A 2ODGA 4NLBA 4O2AB 1Q43A 3I55V 3B09A 4DW0A 1DXSA 2P22C 2L6LA 3QUCA 2LM1A 5CP2A 1KQSU 2ADQB 2RQ6A 3EUB2 2R18A 4IGGA 2EH9A 1JJ2U 2GO7A 2HW3A 5J0UA 3ABUA 4BGDA 2VWJA 2W9CA 4DV6O 4I2HA 2A19A 1BQZA 1SV4A 2BDUA 3C21A 3Q8LA 2E5LB 4BXOA 3RVYA 1Z5VA 9ICHA 3AG1C 5DG8A 2HEPA 2ZIUA 1SZTA 1NTMH 1VQ7V 5AK4A 2XY7A 5J2AA 5KFPA 4LF5B 2UVWA 3ZDBA 5BOLA 4QZEA 2ZUCA 1TE2A 2R8HA 3JCUZ 4LP8A 2V7QG 4JYCA 4TT3G 5GTIU 3I56V 3RJFA 1J5EO 1FKAO 2GOLA 3UXNA 4H44B 3RYHA 2MUTA 3PNCA 1VQ8V 2YTUA 7ICEA 1N4CA 3KD3A 1KBUA 2QKSA 5CB1A 2QM8A 1WB8A 2ZQMA 5AG2A 5AIAA 2EILB 3D36C 2IHNA 3ZRWB 3CX5F 5GTIZ 2KIWA 4ECQA 2RP5A 5KFVA 1KP2A 3EVKA 3FD9A 3LSUA 4MW3A 4KN7A 5AK5A 3FM9A 4YQWA 8ICSA 1K34A 2YUAA 2FLNA 4IC9A 4DL6A 1KFSA 1COWG 2H8PC 5D4BA 3MDSA 3RB6A 2W6JG 4X20B 4GKKB 4RPXA 4E0DA 1RM6C 5EE3A 4YCXA 2L5YA 1P7GA 4J80A 5KFCA 3LNMB 4I5SA 3DSQA 1ZQZA 3N2KA 4G27B 3LWMA 1F4MA 4I0XB 4O2AA 2HHHO 2NO5A 1ZQDA 3ABMC 3N2GB 1Y66A 2Y1IA 2H94A 4QZ8A 1URFA 1WP7A 4JAUA 4AQYB 2DYRC 3K5OA 2LPEA 2R9AA 2NO4A 2QKQA 4YR2A 1P49A 4FM0A 4X5VA 2CK3G 5KFXA 1TK8A 5B1AB 3NRWA 5AKGA 5KFMA 2V4RA 2EZOA 4IS7A 4PL2A 1SZPA 5AM1A 2LGWA 1XMQO 2OHFA 3C90A 2YX8A 3WU2Z 4JI6O 2JXJA 3CYOA 5AKYA 2F44A 4MFCA 1G4YB 3PJSK 4JAAA 2GHYA 2KOBA 4A5UB 3FYIB 4DV2B 1H2NA 4Z1MG 4KMUA 4X9QA 4UASA 2YY6A 2K4IA 3FB5C 4RQ5A 2KKVA 5EIBC 9ICOA 3M1YA 3K3WA 3F5AA 4UVCA 2PGGA 1N34O 1PV0A 2YMLA 3ZRSA 3TXSA 1AJPA 2JDIG 3O65A 2A3VA 1KKDA 5IJ9A 4WCEV 1ENVA 3ZRWA 1N5XA 2WF6A 4EKWA 2H3QA 4RQ3A 4QZBA 5J2HA 2HHWA 1UHUA 1GN6A 3U26A 8ICZA 2HSZA 1NR1A 1V38A 4OGQB 3C1YA 2BCUA 3AQEA 3NUQA 4B9VA 2DQ3A 3UQ2A 4M0AA 1NK4A 4P0PB 2AGAA 3SYOA 3ZMUA 4X20A 5AI8A 2A79B 2KZ3A 2UXCB 3BA8A 3GU3A 4ICGA 3BCCH 1ZQFA 4MVQA 1AB3A 5ALJA 3HB3B 5CN0A 4FFDA 1BNPA 5B1BC 1Q86W 3AG2C 3KCXA 1L7PA 3RBEA 3DXRB 3E0FA 3N2GA 5KT4A 4DOCA 5J29A 3LWLA 3ZHUA 4RQNA 2YXLA 1U4BA 1K5SA 3TKAA 1AI7A 3STZC 7ICRA 3JALA 3WB1A 2WF9A 1XMOB 3SYQA 4B3RO 4F92B 2UXBB 4Y2PA 2ASDA 2Y48A 3TK1A 1N0NA 3KCYA 3ASOB 5AM0A 2EQYA 1NR7A 1SQFA 3ZHRA 2ZM6O 2PY5A 5EBWC 5ALEA 3HRDD 2HFEC 5FNVB 3UXOA 4J11A 4EFBA 4DV3B 4USAA 4NTWA 1R6NA 3JYCA 2EZZA 4NTXA 4DFKA 5D46A 2CH7B 4WFGA 3PSFA 2AZ2A 2DPJA 4PD4F 4HBNA 1QHTA 1F23A 4TQFA 1QR9A 1G6UA 5AI0A 2B21A 1ZQ1C 2KK0A 2RDIA 2RMKB 4PJ0U 4WFBV 2WB1C 3FYHA 3HKCB 1CEZA 1RPRA 1A32A 1L7NA 3CHXA 3TGUH 5KHGA 2R72A 4DV1B 2E1EA 1QLEC 3HILA 3JD4A 5CRXA 1X2IA 1I7FA 2ETNA 2Y69C 5F9NA 5IY5C 8ICKA 2JHDA 3ZI4A 3JPRA 3EYZA 3SQIA 2HOFA 4BDPA 1MNGA 4JUZA 1ECWA 2AHYA 2P90A 2F1IA 2KD1A 2A7WA 1FFUA 3EWAA 2LI6A 7ICVA 1K3EA 1UT5A 3RWRD 2K8CB 3B9JA 3BPZA 3UQ8A 1FYJA 2HHQA 3RJJA 3DXRA 3QG5A 4KHPO 3SZ2A 3RRHA 2ZCEA 3OJSA 3WKAA 5FPOA 3L3FX 2ISOA 1WAZA 3RYIB 1NTKH 3AG4C 3IG5A 3C5GA 4B7EA 3VQXA 4LJXA 4P4PA 1IBMB 2DQ0A 3H8WA 4AYBF 3PSPA 4FZMA 5IJ0B 4IIJB 5KNIA 2KHVA 4UAUA 2QWRB 4DV5B 1L8DA 2VANA 1MZFA 1PP9H 2EZXA 1Z2GA 2WSSG 1NOMA 4NJ8A 2YMMA 4US9A 4TQDA 4CH5A 3WKBA 4KMOB 3MDAA 5FNVA 3T5HA 5KG4A 4J9RA 3IC7A 3VBBA 1UPHA 3NASA 2CH7A 2R8IA 4X64O 3JPPA 3OSNA 1X4TA 4CGZA 4UCSA 5CA3A 1Q3VA 5J0PA 1M57C 3U11A 1FD9A 1Q46A 2PXIA 2XOKG 5DDMA 4HYOA 5CBFA 1GM8A 4F3OA 1N33B 2PF4E 5DB6A 4X1IB 1K5OA 3OJUA 3L73H 2QGNA 4DV4O 3HKCA 3ETRA 4YP3A 3CNHA 1YVWA 3JATA 4Q45A 4M9NA 2RQ5A 4DOAA 1XILA 3BVOA 3BS5A 8ICVA 5J0QA 2DWDC 3V7LA 1ZRMA 3QVNA 1W0KG 3WB2A 1HNWB 2HOIA 4WFAV 5ALRA 4J10A 3CD6V 5JTIA 1BS3A 4MT8A 1ZQOA 4FPPA 1XSPA 4I55B 1UT8A 3NGDA 4O4LA 2MW2B 4X65B 5KG2A 4NV0A 1I94B 3QNMA 1V54C 5GW7A 1IBKO 3ZBHA 5IIJA 5ALQA 1HUOA 3PO5A 5DBBA 2P4KA 3RYIA 2A0LA 3GVMA 1S5HC 3SMVA 2NYVA 3MC1A 4DF8A 1Y74B 3M8RA 3QX7A 2LYBA 4F5NA 3IHQB 1HWYA 4F5OA 4FLYA 3NXSA 5IJ0A 3SAGA 3G4SV 4TV9B 2W8KA 3QTCA 4KX5A 4BJQA 3SYCA 2GLEA 2IA6A 4DSIA 1HNZO 3N7PD 2X6AA 4QW8A 4OPAA 2UUAO 4NM1A 1DF4A 1URJA 1MQ3A 4C8NA 2KE7A 4NY8A 4EFEA 5KFGA 9ICSA 1N2XA 3JD1A 3QU9A 1R3LC 2M0NA 4PH5A 4ED6A 4F4KA 3OR7C 5ALKA 2CGNA 3RYFA 2RCVA 4LWSB 2LMRA 7ICOA 1L1FA 1NJIW 1LV5A 2D3OW 1T8EA 3ABLB 4FZ0A 3RJGA 5KFSA 4MTGA 4MVZA 7ICFA 1KTQA 4LVSA 3CXHF 2BTQB 1L7MA 1KSPA 4PZOA 4GX5A 3OEHG 2BCRA 2G09A 5IE9A 1SZXA 5KMGB 4K3AA 2EINB 3LDAA 3SEIA 4Q8EA 2PUSA 3G67A 5G5GA 1ZQVA 4PA7A 3H0RB 3P32A 4IRDA 3DTUB 5FLXN 3HKDB 2FPMA 2KTQA 1K1QA 2WPDG 4DFPA 5C5JA 2J6SA 8ICLA 2E5LO 2AHOB 3WG7C 3J7AU 2EAPA 4I55A 3DV9A 9ICPA 2HHTA 3RH4A 1YTFD 4MVUA 1BGXT 4R6ZA 4TSFG 4M47A 4LF5O 5DBCA 4LH7A 1BPZA 3UT5B 1WCNA 1OUQA 4ZOHC 3Q8KA 1Y74A 3PY8A 4FLVA 3TFRA 1SF9A 4QW9A 4UV8A 5IYZB 1TFRA 2CN1A 2UUBB 2DWQA 4TV9A 2UUCB 1GM9A 3H01A 4HNAB 3BQ7A 3E89A 1XREA 4YJ2A 2I5HA 5DDYA 3OT7A 5EYPB 4RPZA 1ZQBA 1UCVA 3E8HA 5KX5B 3QUBA 3UO2A 8ICTA 1BT8A 4DK0A 2ZIMA 3PW7A 3L4PA 4JV1A 1XSNA 3CWBH 3N28A 1XOUA 3CCMV 3ED5A 2F8KA 3AG7A 4DK1A 1K73W 1RYRA 1L7OA 1KFTA 4DV7B 3PVXA 4LWSA 1E79G 3ETEA 2JH7A 2KN7A 8ICYA 2Y0SC 5H6RA 3PN1A 2R8JA 4K4IA 4GKKO 5LYJB 4X66B 1FFVA 5ALIA 2Q5ZA 1EN6A 4NM2A 3JD3A 4NXMB 1ZD4A 5KMGA 5ALUA 4MVSA 3C1ZA 4ECSA 2YXYA 3L75H 2VQEB 3KHGA 1M1KW 2ALZA 4IR1A 3EPIA 1R3IC 4AQYO 5CEHA 1OCOC 2IOFK 3W7XA 1B22A 4O4JB 9ICFA 4DSEA 3HKDA 4H33A 5KA5A 1ZLZA 2XI9A 1SKWA 1LVHA 1HP8A 2E3CA 2K4EA 1VQ5V 2HMXA 3IG8A 4W4LA 2QEXV 1W59A 4LF4O 2B6GA 1XS9D 1WJZA 5E1AC 1SWWA 4J9YB 3ZMVA 1N36B 2W43A 3E86A 2DQNB 2ZD9A 4RQMA 2XHBA 2QWNB 4QGPA 3UT5A 1NNLA 2HHVA 2YIBD 5ALYA 5DBAA 1SXEA 5HHIA 4N21A 3B8NA 4DUZB 1XDCA 4QNHB 4PA3A 2JZBB 3IN5A 1ZQYA 2AW9A 5IYZA 2ZNIA 3K0DA 2B5UA 3PR5B 2ITCC 2OT5A 5JJNB 3BRCA 1Z5WA 2BSKB 2HI0A 5KFDA 3CB2A 1KKXA 1PNMA 4YY3O 3AN1A 5EYPA 3E58A 5J2FA
chains in the Genus database with same CATH topology
3QO5A 1VQ4V 1EBOA 3RVZA 1DRGA 3LVWA 1D8BA 1H8HG 2WLIB 1H8EG 2G5IB 1YI2V 4LCUC 1S76D 5L3EA 2WLJA 4UV9A 2ZIXA 1K97A 2WB1F 1KP3A 4FK5C 2WLNA 1B6QA 2W7PA 3OMAB 1ORQC 4HZ3A 2P7TC 1R6KA 4NLBA 4MVRA 3I55V 4U7CA 2H3FA 1RM1C 3OR6C 1CRXA 1KQSU 1OZ0A 4XDLA 3C28A 2VJ4A 2R18A 2ZR2A 4DXWA 4NLCA 2ZIWB 1JJ2U 2OCCC 3ABUA 1Q81W 4GX2A 3CMAV 1SZHA 2JK5C 4P9OA 1M56B 2BDUA 2WAQC 3E8GA 1YJ9V 4QPKA 2WWWA 2KEYA 1OCZB 1DF5A 3RVYA 5BZBA 3TETA 2IU3A 4OO1J 3K1ZA 1P4RA 2JJ1G 3D2NA 2ATKC 3AG1C 1R3KC 2ZIUA 1SZTA 3ASNB 3K08A 3ZMZA 3E8FA 4OJLA 1Z19A 2WLLB 3CCSV 1VQ7V 4QIWF 1QVGU 2EIJB 4LP8A 2V7QG 4JYCA 4TT3G 3CCJV 3I56V 3A0RA 2GOLA 2KV2A 3AG4B 3HPLC 4ASUG 1NQTA 1VQ8V 4G28B 2C2AA 3FB6C 3CC2V 2XIDA 5KUMA 2MK3A 4UVAA 2GSMB 4JTAB 2KVCA 1KBUA 3T4ZA 2QKSA 1AJQA 2QM8A 2UXNA 2ZQMA 1H2GA 1WPXA 2X7RB 4PDLA 3ZN0A 1M90W 5L3CA 3H0LB 4FZLA 2YB4A 2HJFC 2EILB 2ZIVB 1F4NA 3ZRWB 1DTOA 2YEVB 4WFEA 1FS0G 2KIWA 3T79A 2RP5A 1KP2A 2DYSB 2P67A 4U7NA 1OCRB 5CMUA 5KL8B 1OCCB 4MW3A 1K34A 3SPIA 1M56C 1YHQV 2CPRA 2OTLV 4F4LA 3ZJZA 1OCZC 5B1OA 2D6FC 3STLC 4P0PA 1M57B 3UKMA 1XNSA 3TCUA 4P2ZA 4IC9A 1PNLA 4Q20A 4ICAA 1COWG 2H8PC 4XDKA 3ASNC 2W6JG 2JEUA 4O3MA 2WLKA 5L3FA 3CCUV 3LNMB 4I5SA 1AROP 4G27B 3SPCA 4MTFA 5IYCO 2Q67A 4RQFA 1F4MA 2IJHA 2PI4A 1VQNV 1ROPA 3ABMC 5J9PC 1Y66A 1K92A 1FXHA 2H94A 4MTOA 3D3IA 3OMIB 4JAUA 2DYRC 4JASA 2ZIWA 4C0ZA 4FZNA 2HOQA 4GX0A 2B1IA 1AJNA 2PI5A 4CZZA 4OJOA 2HVJC 1GTOA 2ITDC 1YTFB 2CK3G 2CRXA 5B1AB 3NRWA 2KICA 4DO2A 2EZOA 1R73A 2LBOA 2ZDIC 4QE9A 4OXSA 1M9NA 4PL2A 2EILC 3LSSA 1JCHA 5LHGA 3LDCA 2EIKC 2XNDG 2DYSC 2WLLA 1V54B 2EBOA 1OCCC 2YX8A 1VQ6V 2K89A 3ETDA 3CC7V 2R9RB 3CYOA 5B1BB 3CP8A 4A8EA 3FYEB 1JQ0A 1LNQA 3AG2B 1G4YB 3PJSK 2LYAA 1HEKA 2GHYA 2KOBA 3FYIB 3RFAA 1NH2D 2R9IA 4Z1MG 1I5XA 1AR1B 1BHAA 1HIWA 2K4IA 3FB5C 3E8BA 3ZMSA 2ZXHA 2KKVA 2DGZA 2HBKA 1FXVA 3BY6A 2K4HA 4I9WA 1AI5A 3K3WA 3F5AA 5HR7A 4UVCA 3GB7C 3ZRSA 3E2EA 3CPWU 1F44A 1AJPA 2JDIG 3BEHA 2A3VA 2DW4A 2A9HA 4KP4A 2KJ8A 5KA6A 2ZIVA 1P7DA 4WCEV 1ENVA 3ZRWA 1JOYA 4EKWA 4ZBMA 2IU0A 2V1DA 1N8RW 2H3QA 1KECA 3CYMA 5B3SB 2Z7JA 1P7BA 1CP9A 3KG2A 1NR1A 1GM7A 2IJIA 5B1AC 4MVOA 3IP4B 2XAFA 4UVBA 1XO0A 3AQEA 3NUQA 1PVRA 2HBLA 2DQ3A 3KFUF 4P0PB 1GKFA 3SYOA 3ZMUA 4PDRA 2A79B 3OM3B 3GU3A 3LVVA 4MVQA 2MRLA 3HB3B 5CN0A 5B1BC 1Q86W 4PL1A 3AG2C 3E0FA 2WLMA 3OUFA 3RF9A 5EBLC 1E1RG 1K5SA 4OJ6A 2EZPA 3F7YC 1MG1A 1AI7A 1MOFA 1QLEB 3STZC 5CBHA 1NH2B 3SYQA 1Q82W 2Z5UA 1SRYA 3IFXA 2Y69B 5IY5B 4BX9C 3SAFA 3F2DA 2Q6AA 3CC4V 4JTCB 2Y48A 1GK9A 1NKDA 3TK1A 2GH1A 3ASOB 1NR7A 2KB1A 5EBWC 1GO3F 4N23A 1KC8W 2WAMA 2HFEC 4FIPC 1OHHG 2JGAA 2ZXWB 3VCBA 3K0GA 4WFFA 2HVKC 4YXWG 3SPGA 5B3SC 3E83A 3O0FA 1R6NA 3JYCA 3OUSA 3CMEV 4G2KA 3MD0A 5T14A 4WFGA 2VKQA 3PSFA 1WLEA 1YIJV 1XL4A 3EHBB 1JVMA 1S0VA 1Y4MA 1BL8A 1F23A 2LP7A 3K06A 1QR9A 2PMZF 1VQPV 2RRDA 1ZQ1C 2K8AA 1Z1BA 4OJPA 1W0JG 4GT1A 4CBCA 1K4CC 4WFBV 2WB1C 1VQ9V 3QO7A 1PVPA 4HAMA 1CEZA 1A0PA 1RPRA 2IJKA 2W0FC 2YSUB 3B77A 3K9AA 4JF3A 4GCZA 3D2SA 4P30A 3SYPA 2E1EA 1G8MA 1QLEC 1CPYA 4RUFA 4JTDB 1YJWV 4P9PA 1VQKV 4U6PA 5CRXA 4NWIA 3JD4A 1V55B 2F77X 2Y69C 3MGVA 5IY5C 3VC8A 3RBZA 1SETA 2JHDA 3SQIA 2HOFA 4KX3A 2HR3A 4MSWC 3ASOC 2Y0SF 1THZA 1ECWA 2AHYA 4CDGA 2P90A 2ZXIA 5LGUA 2KD1A 3LYSA 3K03A 1K3EA 3AG3B 3MHHC 1K8AW 2K8CB 4JPRA 1FFTB 2F43G 1QLNA 2EIJC 2AHZA 4QIWC 5HR6A 1I5YA 2LFSA 2JJ2G 5CBGA 1MSWD 1ED1A 1TUEB 4BW5A 3L3FX 3T4DA 3ALRA 1A6SA 3AG4C 3IG5A 4H37A 5KUKA 5EC1C 4BIUA 3JCZA 4LC1A 3CCRV 2JMGA 2DQ0A 4AYBF 1T94A 3PSPA 2W6IG 3F53A 4FZMA 3FB7C 3ZRVA 5C93A 2Q69A 2KHVA 4P0QB 3F5WC 1QR8A 2X0LA 5H6QA 2W7OA 2WSSG 2KJ5A 2XAGA 5EK0A 3WFVA 3CCLV 4JGSA 5L3GA 3HKZF 3W7SA 4KMOB 3ABKB 1K7DA 3VOUA 2JEXA 2XAQA 3IC7A 3VBBA 2MA1A 1UPHA 2OTJV 1OCRC 3OAAG 4BUGA 4KFMA 1NVPD 3F5EA 4CGZA 5CA3A 5C0YA 1Q3VA 1M57C 1K33A 5FL7G 2XOKG 3W7UA 2H3IA 2NV3A 4HYOA 3X2QB 2HBMA 5CBFA 1GM8A 4R7CA 2F2AB 2Q4TA 1YJNV 3SJQC 2KHQA 3LDEA 1ZWIC 3W7TA 1W2BU 2KJ9A 3PSTA 2QE7G 5LHIA 3DGEA 2XVTA 1YT3A 4X8AA 1FXKA 3SAHA 4QE7A 1MABG 2KNJA 2DWDC 2IH3C 5L3BA 2W03A 1MA7A 1AI6A 1W0KG 2HOIA 5IYBO 4WFAV 1JX9A 3CD6V 2RHFA 2QM7A 1RM1B 2K1EA 3P30A 4MT8A 4X88A 5HFLA 2HLDG 2B1GA 4FPPA 5EBMC 5LHHA 3JD2A 3HKZC 1PD3A 3T1CA 1AI4A 3IGAC 4U7OA 4NV0A 4WJ3B 1V54C 2OCCB 5GW7A 3ZCCA 4RO2A 1S77D 3K79A 4MS2A 1J95A 3SYAA 2WAQF 1VQOV 1PKXA 1NZBA 3H0MB 2A0LA 1S5HC 3OFNG 3SMVA 3AL0B 1IIPA 3X2QC 2LYBA 2W04A 3GWOA 3AG1B 3UM7A 1HWYA 3N7RC 1R3JC 2DWEC 3ZMTA 3NXSA 2HG5C 3SAGA 1K5QA 3G4SV 4P0QA 4KX5A 4BJQA 2G08A 4PELA 3SYCA 3RW0A 3FKSG 3M7DA 1WUDA 3N7PD 3KZXA 2X6AA 2XICA 3WG7B 1DF4A 1URJA 2BOCC 4XBFA 3PZPA 5DN6G 4KUMA 3DEEA 2E5SA 3JD1A 5B1NA 1R3LC 3EFFK 3G6EV 2M0NA 3SPJA 3OGCC 2F76X 3OR7C 2G07A 3G71V 3SPHA 3OPXA 2OYYA 3E35A 1L1FA 2G06A 3PSIA 1NJIW 2WLHA 2D3OW 3ABLB 2XAHA 3LSQA 4RUEA 4MTGA 5LGNA 1F51A 2G0AA 3LUTB 3ONNA 4MVZA 1NBMG 2VJ5A 1PVQA 4GX5A 4RQEA 3F7VC 3OEHG 2G09A 1RPOA 1QCEA 3ABTA 2X6CA 3CRXA 2EINB 2HBJA 2Q68A 4RAIA 3F2BA 4LBEC 1EFRG 1VQMV 4PA7A 3H0RB 4JAVA 2OH2A 4PDMA 4WF9V 4CRXA 3P32A 1FXKB 4XDJA 3CCEV 3DTUB 2YB1A 5H9CA 3M6KA 4R8CA 2WPDG 4GX1A 4MTXA 5EC2C 3CXCU 4L87A 5KL1B 2BOBC 4ZKIA 1QBZA 3ABMB 3WG7C 5IYDO 1YSCA 2M7WA 2G5HB 1H38A 1SERA 4GFJA 5L3DA 1PL0A 2DYRB 3OE7G 1YTFD 4MVUA 2UXXA 2ZXWC 5A0LA 2XAJA 4R6ZA 4TSFG 4PA4A 3QNEA 3M99B 1S72V 1UJWB 1VQLV 2E1FA 3ICXA 1OUQA 4BIZA 2HKOA 1QVFU 2IW5A 3FB8C 4QPJA 2EIMB 3D2QA 1L6NA 3ABLC 4UV8A 2IH1C 2CN1A 2EIKB 2PMZC 2H3ZA 1OCOB 3M6ZA 2DF4B 3N7SC 2FTKA 3OW2U 1GM9A 3H01A 1Q3UA 1PNKA 2VIXA 2P6JA 3E89A 2OM6A 1K9MW 2EINC 3B8MA 2EJRA 2WLIA 2H3VA 3E8HA 1KKDA 5LGTA 5LBQA 1KD1W 4R50A 2LHTA 3QO8A 1FXKC 3OEEG 3CCMV 3MHSC 2ZIXB 2QA4V 1V55C 4FE3A 5HFMA 1K73W 1XL6A 4FMTA 3AQFA 3W7WA 2Z3YA 1Q7YW 1E79G 3ETEA 2JH7A 4MVMA 3ZN1A 4E2LA 5H6RA 2Y0SC 4QJFB 3D36A 2KKPA 4PA9A 2LKYA 3R65A 3C29A 4WFHA 2K8BB 3OMNB 3AG3C 2JH1A 2ZR3A 4X89A 1IXMA 3JD3A 3CCVV 2NNUA 3T2MA 4ACOA 4MVSA 3K04A 1YITV 2EIMC 2QTOA 1EZJA 4TWKA 1M1KW 4UUJC 1R3IC 4FJCC 1OCOC 2ZIUB 5DM6V 3W7XA 3JD0A 4BAYA 2XASA 4H33A 3F2CA 4AYBC 1JPXA 5KA5A 2XI9A 1S3JA 4OJ5A 4PA6A 1VQ5V 2K4EA 4JMUA 2HMXA 3IG8A 4QNLA 2QEXV 1BHBA 1SESA 5E1AC 4J9YB 3ZMVA 1TAMA 2LFRA 3ABKC 3CCQV 3E86A 1DLBA 3ZIAG 2DQNB 3LDDA 2ZG6A 2F8LA 2NLJC 2ZD9A 5IDJA 4UXNA 2ZDIA 4N21A 3B8NA 3CP1A 4QNHB 1GMGA 4PA3A 2OXOA 3IN5A 4J9ZB 1NVPB 2YEVA 4PDVA 1BMFG 2B5UA 2OT5A 2IJJA 2ITCC 3K0DA 3GZFA 2X6BA 4JYBA 3ML0A 2N1RA 2JIZG 4MW8A 3AEIA 3ETGA 1PNMA 1E1QG 3ZRXA 1K4DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUD A;  2HBJ A;  2HBL A;  4QJF B;  1D8B A;  1GO3 F;  4OO1 J;  2E1E A;  2HBM A;  4QIW F;  2DGZ A;  2HBK A;  2CPR A;  4NLB A;  4CDG A;  2KV2 A;  1YT3 A;  4NLC A;  2RRD A;  3SAH A;  4O3M A;  3SAG A;  2MA1 A;  3CYM A;  2E1F A;  3SAF A;  2RHF A;  4CGZ A;  5C0Y A; 
#chains in the Genus database with same CATH topology
 1KBH A;  4UAW A;  2NRX A;  1S0M A;  5KX5 A;  3UMB A;  1VEW A;  2ES6 A;  4HYK A;  2WLI B;  4R63 A;  4IQT A;  4P2H A;  4DR3 O;  3PV8 A;  2ZJ8 A;  2XO7 A;  3G6B A;  4LCU C;  3WK7 A;  4UV9 A;  4YD2 A;  2WB1 F;  3SJC C;  1D5N A;  2WLN A;  4FVM A;  2W7P A;  3UMG A;  2BCV A;  1ZAU A;  1JFF B;  1ORQ C;  1R6K A;  2W3R A;  1CRX A;  3RT3 C;  4F50 A;  4TUS A;  2YS8 A;  5LYJ A;  2WF8 A;  2UXC O;  2ZIW B;  4LF7 B;  3KHL A;  4UQG A;  5DGB A;  1SZH A;  2JK5 C;  5AK3 A;  4FBU A;  4ED8 A;  1M56 B;  4O4H B;  1AR5 A;  3E8G A;  4O3Q A;  4IYH A;  3BFR A;  2WWW A;  2KEY A;  1OCZ B;  3PX0 A;  1DF5 A;  5BZB A;  5ALT A;  1OXJ A;  1EXN A;  4OO1 J;  5IIM A;  3D2N A;  1UA0 A;  4YD1 A;  2ATK C;  1R3K C;  3ASN B;  1RXV A;  4RQ6 A;  4O4J A;  1Z19 A;  3RRG A;  2F1M A;  1QH9 A;  1FFX B;  1QVG U;  5EE9 A;  2EIJ B;  2UXD B;  2UXB O;  3CCJ V;  1ZQW A;  2OIG A;  1HDJ A;  2BZF A;  2KV2 A;  5DG7 A;  5AKL A;  3RAQ A;  1NK9 A;  1MSD A;  1S5L Z;  3HPL C;  5J2T B;  2F1J A;  5KG6 A;  2C2A A;  2XID A;  5KUM A;  2MK3 A;  4UVA A;  5DEC A;  4DV3 O;  4LFA B;  4JYA O;  4JTA B;  1WB7 A;  2KVC A;  1OW5 A;  5AKK A;  1M90 W;  5L3C A;  5BOM A;  2HJF C;  1FJG B;  2PFO A;  4EBC A;  4ZOL B;  2QB1 A;  4CF3 A;  1DTO A;  4NLG A;  3T1Y B;  3V7J A;  3BQT A;  2BSK A;  2DYS B;  5CMU A;  1OCR B;  5K1P A;  1RSO B;  4PHD A;  2CPR A;  4Y2V A;  2K60 A;  4CS3 A;  3I76 A;  4RU9 A;  2Y0P A;  4Y2U A;  2D6F C;  5B1O A;  3UKM A;  4P2Z A;  1XNR B;  1PNL A;  4Q20 A;  5A2Q N;  1SQP H;  8ICE A;  5KG5 A;  1BPE A;  1JRO A;  1RYU A;  3SR2 C;  4UB1 A;  4O3M A;  3UO3 A;  1B06 A;  2WLK A;  7ICJ A;  7ICI A;  4QWA A;  2ASJ A;  3QEA Z;  3WK8 A;  5JRT A;  3Q8Q B;  5C8Y B;  1TUB B;  3SPC A;  1JFF A;  1SS3 A;  2PI4 A;  2Q67 A;  2IJH A;  1VQN V;  1NK6 A;  2DOS A;  5J9P C;  4D6T H;  1FXH A;  4MTO A;  1A76 A;  4DW1 A;  7ICM A;  2ZIW A;  4XRH A;  4DFD A;  3KKA A;  2ZUB A;  5LXT B;  2PI5 A;  4CZZ A;  5EE1 A;  1YTF B;  1GTO A;  3PW2 A;  2ITD C;  4US8 A;  1R73 A;  2QJ1 A;  3H1L H;  1M9N A;  2EIL C;  1ZQP A;  5ALH A;  2BCQ A;  3L70 H;  1JCH A;  3RYC A;  5LHG A;  1KUQ A;  3K75 D;  4IQU A;  4F4Y A;  1US6 A;  4GYC B;  1IBM O;  5KG3 A;  2ISP A;  8ICM A;  4IL6 U;  3RAX A;  2BDP A;  1FFX A;  2R9R B;  4DV5 O;  3K9S A;  1JQ0 A;  5D5Q A;  1LNQ A;  4TUY B;  2Y1J A;  2PYL A;  2LYA A;  1MN8 A;  5J2T A;  4BWA A;  5ALS A;  4YXJ A;  4RWU A;  1AR1 B;  4LZG A;  1BHA A;  2YMQ A;  3NRZ A;  1AQ6 A;  1Y67 A;  4I9W A;  4JI5 B;  5JVD A;  3SGI A;  2E8P A;  2PYJ A;  4RPY A;  2XCP A;  3V6K A;  1U49 A;  2BCC H;  4GXI A;  3BEH A;  4PHA A;  4ZOL A;  1J97 A;  1XEQ A;  1KRP A;  4ZBM A;  1N33 O;  3CYM A;  5B3S B;  3U10 A;  1CP9 A;  3KG2 A;  5B1A C;  2IJI A;  3IP4 B;  4ZHQ B;  4C7Y A;  4J9P A;  4UVB A;  2BQU A;  2KFN A;  1S9F A;  4J9N A;  3ETL A;  4PDR A;  1F7Y A;  4KLJ A;  2D3D A;  4DLG A;  1ZSP A;  3JSL A;  4YMN A;  5G5H A;  1ZQM A;  5C8Y A;  3ISC A;  4KLF A;  1TUB A;  1HNW O;  5AIC A;  1SXD A;  5KHI A;  3RTV A;  2G38 A;  3DC6 A;  2BPG A;  3K5L A;  1E1R G;  4X65 O;  3F7Y C;  5CBH A;  5CA7 A;  3PW5 A;  1NH2 B;  1I94 O;  1AP5 A;  5J2B A;  1Q82 W;  5LXT A;  2AU0 A;  3IV6 A;  2XGP A;  3H4B A;  1SRY A;  1YEW A;  4BX9 C;  3F2D A;  2Q6A A;  4JWM A;  4JTC B;  3THV A;  9ICX A;  2ZJA A;  1SL2 A;  5KT6 A;  3WKE A;  2HDO A;  1ZQH A;  2IBK A;  1SC5 B;  5BPC A;  1X6J A;  2WAM A;  1KC8 W;  2ZKO A;  2Q0O C;  1WCL A;  3PR4 A;  2FPK A;  5J0X A;  5IIL A;  2HVK C;  2IBZ H;  3K0G A;  3UQ0 A;  3CME V;  3MD0 A;  5JCO A;  3HKB A;  1WLE A;  2PFN A;  4TUY A;  1XL4 A;  2F4V B;  1JVM A;  1TK0 A;  4MEX A;  3CJH B;  4RUC A;  4EBD A;  2LP7 A;  5BR8 B;  2E3T A;  1VQP V;  2AGQ A;  1S97 A;  1JIH A;  3TAN A;  1DOQ A;  1IBL O;  5CJ7 A;  2KZM A;  1X9X A;  4CBC A;  4R8U B;  1ZUQ A;  1A0P A;  3ZDE A;  3B77 A;  2W0F C;  1X6I A;  4DF4 A;  3CEI A;  1I0H A;  4GCZ A;  2FDR A;  4JF3 A;  4NB5 A;  1XC9 A;  3SV4 A;  3D3Q A;  4B3S O;  3SYP A;  4RUF A;  1ZQK A;  1CPY A;  3H8J A;  1HW7 A;  1QU7 A;  4P9P A;  1D9F A;  5IJ9 B;  1VQK V;  4NWI A;  2OCE A;  1V55 B;  4NL9 A;  3MGV A;  3VC8 A;  3RBZ A;  3ZHT A;  1SET A;  5AIB A;  2HR3 A;  4ZHQ A;  2ZNJ A;  1KKC A;  2Y0S F;  3ASO C;  4B3M B;  4GKJ B;  1DGJ A;  4UCV A;  3MR3 A;  5LGU A;  2AGP A;  2GTS A;  1RP3 B;  1IM4 A;  3K03 A;  1N62 A;  1SV0 A;  4DLE A;  2ZIN A;  5JU5 A;  1JN3 A;  1NJX A;  2KVS A;  4LFC B;  1K8A W;  2F43 G;  1QLN A;  8ICI A;  2AHZ A;  4J42 A;  3H8S A;  5HR6 A;  3SR6 A;  5DQG A;  2JJ2 G;  5CBG A;  5LOV B;  4IRC A;  3OTQ A;  3S3X A;  4I2J A;  5KUK A;  4DOB A;  3HJE A;  4H37 A;  5EC1 C;  1U48 A;  2CUG A;  1SQX H;  4UB8 U;  4LC1 A;  3CCR V;  4RQ8 A;  2JMG A;  2QR4 A;  1T94 A;  3ORY A;  3ZRV A;  3F53 A;  2L35 A;  3JAL B;  2NR5 A;  1Y6X A;  4P0Q B;  1OV9 A;  4OX9 O;  4YR3 A;  2W7O A;  3SEN A;  2KJ5 A;  4QWD A;  1MC8 A;  2DKZ A;  2YIB A;  1ZQG A;  4NTY A;  4M9J A;  2UUB O;  1N32 B;  1BPY A;  4DR5 B;  3JSN A;  4F93 B;  3ISD A;  1KQQ A;  2UUC O;  1M4U A;  2OTJ V;  1ZXI A;  4J9Q A;  3OAA G;  1Z3E B;  4G3I A;  1QSL A;  1T5E A;  3CJH A;  4TUP A;  2V4Q A;  4UB8 Z;  3H4D A;  9ICM A;  4CE6 A;  2H3I A;  2C2D A;  2NV3 A;  3X2Q B;  4G9B A;  3ETQ A;  2HBM A;  9ICE A;  4EZ6 A;  3JAM N;  2Q4T A;  2FLP A;  2N04 A;  3LDE A;  3DDH A;  1PUZ A;  1ZWI C;  4R8U A;  1S0O A;  3W7T A;  5ALW A;  3QU4 A;  2W8L A;  4UCO A;  4ED1 A;  2QE7 G;  4FFB B;  4DQS A;  3DGE A;  2XVT A;  1YT3 A;  4F2S A;  1Z00 B;  3HW8 A;  1FXK A;  4X62 O;  3FC4 A;  2O57 A;  1F5S A;  5AKJ A;  5KFK A;  5KT5 A;  3JPT A;  4FBT A;  1MAB G;  5JQG A;  2IH3 C;  4DR2 O;  4K0K B;  1QSY A;  4PZN A;  1WYG A;  4F2R A;  2AZ0 A;  1X9W A;  5K4L A;  5IYB O;  1XHZ A;  2AQ0 A;  1JX9 A;  2RHF A;  4GC7 A;  2QM7 A;  3G6X A;  3OTO B;  1X40 A;  2VQE O;  3APO A;  4GXJ A;  2NRV A;  3GIK A;  5LHH A;  3JD2 A;  7ICK A;  3HKZ C;  2JRZ A;  1YF2 A;  3T1C A;  1R1B A;  4UB4 A;  3IGA C;  4U7O A;  4R64 A;  3QYP A;  4JV2 A;  2F66 C;  3ZCC A;  3OGU A;  4RO2 A;  1Q90 D;  5B66 U;  3SYA A;  1VQO V;  1BNO A;  5LOV A;  1ZRN A;  3KOO A;  1NZB A;  1NJY A;  3AL0 B;  2JS5 A;  1JRP A;  1Q8I A;  3AG1 B;  1N36 O;  4CNQ A;  1NTZ H;  3UM7 A;  2BQ3 A;  1R3J C;  5H5N A;  3QU7 A;  1WNS A;  2ZUD A;  4P0Q A;  1NU1 H;  3EZ5 A;  3TQ1 A;  2G08 A;  1VDV A;  4EYH B;  3SV3 A;  4UCR A;  1L3S A;  3FKS G;  1WUD A;  4QZF A;  4I50 B;  4GC6 A;  4AHC A;  5DN6 G;  4DUY B;  2Q0Z X;  2JEG A;  4KUM A;  3M8S A;  5B1N A;  3EFF K;  4ZH4 A;  3OGC C;  3M9M B;  1VF6 A;  5DLF A;  1Z1V A;  3OPX A;  4KLI A;  3E35 A;  2G06 A;  4C80 A;  3SDL A;  1NK5 A;  4YHH B;  2XAH A;  3S3W A;  3J80 N;  1F51 A;  4O9M A;  3LUT B;  1L8O A;  4D7T A;  3CRQ A;  5KFY A;  2I6X A;  4FFK A;  2CDY A;  3F7V C;  1RPO A;  2DBY A;  4DWI A;  3JAT B;  3F2B A;  3B2E E;  4FFB A;  1Z00 A;  5AI5 A;  4PDM A;  1HNX B;  2OH2 A;  4LF7 O;  4CRX A;  3CCE V;  2YB1 A;  3QZ8 A;  3BS5 B;  3WKC A;  4FLW A;  1VLB A;  5EC2 C;  5KL1 B;  4C7Z A;  3C2K A;  9ICL A;  4ZKI A;  4IR9 A;  3ABM B;  4RNO A;  1LR1 A;  3J81 N;  1Z4O A;  1PK1 B;  2F93 B;  2BE3 A;  2DYR B;  3K1R B;  4P4M A;  3OE7 G;  4O4L B;  4PJ0 Z;  5J2J A;  2ZXW C;  3VQW A;  2M9N A;  4K4H A;  3JAK B;  1AP6 A;  3RH6 A;  1ZJN A;  5J2I A;  5BMV B;  4EX7 A;  8ICF A;  2IW5 A;  3FB8 C;  4PGY A;  3RB4 A;  4PV1 B;  1L6N A;  3ABL C;  5K1X A;  1WPB A;  1RPL A;  1NZ6 A;  2PMZ C;  4ECX A;  3M6Z A;  3N7S C;  4O3N A;  3OW2 U;  5HML A;  4ZIB A;  2UU9 O;  1Q3U A;  1PNK A;  2VIX A;  2P6J A;  5LMN O;  2OM6 A;  4M6W B;  4ECY A;  2EIN C;  4JV0 A;  4I4T A;  1M93 A;  4I50 A;  5KHH A;  3H8M A;  4DR4 B;  2H3V A;  3TAP A;  3KKY A;  2LHT A;  3PMN A;  2XGQ A;  2EUL A;  3QO8 A;  4KLG A;  3OEE G;  3T1Y O;  4TQS A;  3QE9 Y;  3JPQ A;  3FX7 A;  4JI2 B;  4FMT A;  3PO4 A;  9ICI A;  3K57 A;  3WKD A;  5ALP A;  1SKS A;  2FYU H;  2LW1 A;  3W7W A;  1U47 A;  4DV0 O;  1B43 A;  4NKG B;  4J9O A;  1B0X A;  5J8Y C;  3D36 A;  3RYF B;  5EWG A;  4CH6 A;  3G6V A;  5DLG A;  2OWO A;  1U9L A;  4QZI A;  3AG3 C;  1BQ0 A;  4JV5 O;  2JH1 A;  3L9D A;  2ZR3 A;  4Z6F A;  3V6H A;  3EXA A;  1EM1 A;  3QXG A;  1IXM A;  3CCV V;  3D6J A;  9ICG A;  4J9S A;  2NNU A;  4JI0 B;  5IWA O;  1YIT V;  5KG0 A;  4X1Y B;  1WWU A;  4UB3 A;  3Q8R B;  4TWK A;  4B3T B;  1JXE A;  4JI7 O;  4FJC C;  4GIB A;  1NS1 A;  2Z0A A;  5DM6 V;  2R8K A;  3VQY A;  4KTQ A;  2XAS A;  3E22 B;  3F2C A;  1JPX A;  1S3J A;  4PA6 A;  4I2A A;  4M9H A;  1JX4 A;  1PK1 A;  2BR0 A;  2QWP B;  2KG5 A;  4CCH A;  2LFR A;  3ABK C;  3JPN A;  4DS4 A;  4KLO A;  1DLB A;  3JAK A;  2RNB A;  4UXN A;  5BMV A;  3GV7 B;  5LMU O;  3FFQ A;  1ZQR A;  3MR2 A;  2YI9 A;  3K4G A;  1YZ6 A;  3JAS B;  2OXO A;  2YEV A;  2RLT A;  4ECZ A;  2X6B A;  4PPX A;  1T4G A;  4JI5 O;  2GBO A;  2N1R A;  4MHV A;  4O3S A;  4MW8 A;  1MQ2 A;  1ZQQ A;  1E1Q G;  4M6W A;  3H1H H;  4J7Z A;  1GAX A;  3HKE B;  2PFQ A;  4CF4 A;  1K4D C;  9ICA A;  4YJ2 B;  4RUA A;  3N27 A;  4JI3 B;  3LVW A;  1D8B A;  2K9P A;  2BHN A;  2LQT A;  4BWJ A;  2OIE A;  4LF8 B;  2G5I B;  5L3E A;  3ZD9 A;  4DV6 B;  8ICR A;  1K97 A;  4B9T A;  2F23 A;  2W3S A;  3OMA B;  3IDW A;  1TAQ A;  2P7T C;  5H2F U;  1RM1 C;  1IZ3 A;  1TK5 A;  4O4I B;  5IT9 N;  1QQ7 A;  2CTQ A;  3ZD8 A;  3JAW B;  3RGB A;  2JVD A;  3C28 A;  1COO A;  2VJ4 A;  4DXW A;  4O3O A;  1XQ8 A;  4NXN O;  2OCC C;  4GX2 A;  3CMA V;  4F72 A;  1QSS A;  4X1Y A;  4C4R A;  1D8Y A;  7ICP A;  3H9V A;  3ZMZ A;  3E8F A;  4OJL A;  3ZDD A;  3BQ0 A;  2WLL B;  4C8M A;  3E22 A;  4PI0 A;  5ITZ B;  5H2F Z;  4ECW A;  1XU4 A;  1TAE A;  4XUS A;  5AI4 A;  3A0R A;  5KFL A;  4Q44 A;  2JEJ A;  2Q0A A;  4I2D A;  4E4E A;  3AG4 B;  1F0M A;  4ASU G;  3GIL A;  3CRA A;  1NJZ A;  2GSM B;  4C8K A;  4DO9 A;  4J9K A;  1L0N H;  4RQ2 A;  2BGW A;  1AJQ A;  1SQG A;  3Q8P B;  5L1I A;  4KLM A;  2F4V O;  4PDL A;  3ZN0 A;  5ALZ A;  3BDP A;  5KAI U;  5BR8 O;  3JAS A;  2YB4 A;  5KFI A;  4U3J A;  3NS1 A;  4HAI A;  2ZE6 A;  5AKX A;  4YMO A;  3AM9 A;  2P6U A;  1FS0 G;  1UPG A;  3KKA C;  3T79 A;  2P67 A;  2VQF B;  2XT9 A;  5KL8 B;  4RQ0 A;  1OCC B;  5KFB A;  3SPI A;  1M56 C;  1YHQ V;  3MBY A;  3HKE A;  1Y88 A;  1KYO F;  1OCZ C;  1M57 B;  1XNS A;  1VMG A;  2LW7 A;  3TCU A;  4ICA A;  1O08 A;  5CHG A;  3I28 A;  3ASN C;  4XDK A;  4CC5 A;  2JEU A;  5ALL A;  1TKD A;  3MFI A;  5HMM A;  5L3F A;  1L3T A;  3CCU V;  1ZQJ A;  1X42 A;  5EZY B;  5IYC O;  4MTF A;  1TAU A;  1AVM A;  1YDX A;  1ROP A;  4DCC A;  3JAW A;  4O4I A;  2OYQ A;  8ICG A;  3HP6 A;  1H2L A;  1XMQ B;  3OMI B;  2E76 B;  4JAS A;  4C0Z A;  2F1H A;  3MR5 A;  4JI1 B;  4FZN A;  1XHX A;  4LFC O;  5AHX A;  3EPG A;  2ZE5 A;  3JPO A;  3BQ1 A;  2B1I A;  1EN4 A;  4OJO A;  2CRX A;  3WB0 A;  2Q7G A;  2KIC A;  3APQ A;  3ZX6 A;  2LBO A;  2ZDI C;  1BPB A;  4OXS A;  3LSS A;  2Q9L A;  4PHE A;  3B4S A;  4KIT B;  5J0T A;  1RZT A;  2EIK C;  2DYS C;  2WLL A;  5DED A;  1V54 B;  3TJT A;  5ITZ A;  1JA8 A;  1GN2 A;  3ETD A;  4O5E A;  5KFO A;  3CP8 A;  4A8E A;  1N63 A;  1HEK A;  2EAM A;  1S5J A;  1NH2 D;  2R9I A;  1I5X A;  3PX6 A;  2DJV A;  1HIW A;  4X1K B;  5LP6 C;  4DR5 O;  3E8B A;  3ZMS A;  1NKB A;  1FXV A;  1ZL8 A;  2K4H A;  1O9G A;  1AI5 A;  3B0Y A;  4EX6 A;  1COK A;  3GB7 C;  1RXW A;  1XSL A;  4DRX B;  3E2E A;  2ADP A;  1N56 A;  3CPW U;  4BWM A;  4IYI A;  4C8O A;  1UQV A;  4KP4 A;  2ZTD A;  1LUV A;  4EB6 B;  3DC5 A;  1P7D A;  5KA6 A;  3T5L A;  4DV2 O;  4GXK A;  3AK3 A;  3SJB C;  2V1D A;  3MAQ A;  2QB0 A;  4DR7 B;  4DQP A;  1PL4 A;  3C3S A;  5FP0 A;  5KTQ A;  4MVO A;  3PW0 A;  4ELU A;  2XAF A;  1ZQN A;  1VAR A;  1JUD A;  2CGO A;  4EYI B;  5J2D A;  1GKF A;  3LK9 A;  1ZQA A;  5EWE A;  1QNM A;  3GDX A;  3OM3 B;  3LVV A;  5DQI A;  4K0K O;  4B3R B;  4CC6 A;  1SQB H;  3OHB A;  1UFI A;  4KXR A;  3HWT A;  5EZY A;  5JCO C;  4LH6 A;  3K5M A;  1ZQU A;  3OTO O;  1K1S A;  2VA8 A;  2Y9T A;  2HHU A;  2N74 A;  3RF9 A;  5EBL C;  1PM9 A;  2W54 A;  4OJ6 A;  1MG1 A;  1MOF A;  3MDC A;  2VA3 A;  4J9L A;  2Z5U A;  3IFX A;  4EBE A;  1Q6U A;  1SKV A;  1SGG A;  4KLD A;  4O3P A;  3MGI A;  1GO3 F;  2KB1 A;  1IV8 A;  2CXY A;  4FIP C;  1OHH G;  3RYC B;  2JGA A;  4XQ8 A;  5B3S C;  1TVA A;  3SPG A;  4NYK A;  3IRU A;  1WP8 A;  1ZTE A;  3O0F A;  1XMO O;  3OUS A;  4O0I A;  4M04 A;  5D5P A;  4FLU A;  3T5J A;  2VKQ A;  4J7J A;  2A1J B;  1G1X B;  1S0V A;  4BR6 A;  4DR6 B;  2O6K A;  2KZZ A;  1RYS A;  2KSD A;  3K06 A;  2K4P A;  3GFK B;  1NK7 A;  3K59 A;  2PMZ F;  2ILM A;  3RFR A;  4X1K A;  3HR0 A;  2RRD A;  4UAY A;  2R8G A;  2GUZ B;  1W0J G;  1Z1B A;  4GT1 A;  1T3Q A;  1K4C C;  4AI8 A;  4XA5 A;  3FAV A;  2QAR B;  3QO7 A;  5JVD B;  4FLX A;  4RT2 A;  2IJK A;  4Z2W A;  4DRX A;  2XY5 A;  1TGO A;  3WK6 A;  1Z4N A;  3R9K A;  4EB6 A;  4YHH O;  1M5I A;  4JTD B;  1YJW V;  4Y2X A;  4FS2 A;  5E79 U;  2F77 X;  4R65 A;  4Q6G A;  4MSW C;  4KX3 A;  4LNU A;  8ICH A;  4CDG A;  4DQR A;  5J0Y A;  9ICU A;  4DV1 O;  9ICN A;  3MHH C;  1SL1 A;  4C4T A;  3BZK A;  9ICT A;  1WWV A;  3IM1 A;  3T5K A;  1FFT B;  4JPR A;  4QIW C;  5F9L A;  4Z6E A;  1C20 A;  2FL4 A;  2WFA A;  1JAL A;  5AM4 A;  3C23 A;  4ED3 A;  1SQV H;  3RR8 A;  3T4D A;  3ALR A;  2V9W A;  1A6S A;  2DN9 A;  1PZN A;  2DE0 X;  1Y76 B;  1HR0 B;  4LF9 B;  5E79 Z;  3JCZ A;  5J2U B;  4DSK A;  4RQ4 A;  4F4X A;  2YXH A;  2XTA A;  3FB7 C;  3D8C A;  2KP7 A;  4O2B B;  4X64 B;  3F5W C;  2X0L A;  4OD0 A;  2XAG A;  4KL1 A;  3WFV A;  1Q8K A;  3QZ7 A;  4JGS A;  3CCL V;  3W7S A;  1BZK A;  4CF5 A;  4MF8 A;  1K7D A;  2BPF A;  1KU9 A;  3VOU A;  2JEX A;  2XAQ A;  2QKA A;  3HT3 A;  4DV4 B;  4JZ2 A;  4FM2 A;  5KG7 A;  4JZG A;  4Y2T A;  4FLZ A;  2A1J A;  4I7Z B;  1NVP D;  2DMX A;  3HKB B;  4DR4 O;  9ICC A;  1K33 A;  3UPQ A;  3AMZ A;  2P6R A;  4YMM A;  1VJ5 A;  3W7U A;  2NRT A;  3I5D A;  3V7K A;  2C28 A;  3K5N A;  2GUZ A;  3O9O A;  2KSO B;  5KFT A;  3SJQ C;  2KHQ A;  4JI2 O;  3Q8M A;  2W55 A;  2KFZ A;  2QAR A;  3CSX A;  2FMP A;  1W2B U;  4NLK A;  5AKE A;  1AIL A;  3R66 A;  4F8R A;  2YN4 A;  4UAT A;  2YI8 A;  5LHI A;  4EEN A;  4IL6 Z;  4X8A A;  4F91 B;  2KKW A;  2EX3 A;  5JWP A;  5AKZ A;  2KNJ A;  1ZQX A;  1KMI Z;  2W03 A;  4LF6 B;  2Y4T A;  1AI6 A;  2F3N A;  4GUN A;  4AIL C;  1SIJ A;  2K1E A;  1ZQC A;  4X88 A;  5HFL A;  2HLD G;  2EZY A;  3KZI U;  8ICB A;  4B3T O;  1PD3 A;  4YFK A;  2KIV A;  5J0W A;  4YR0 A;  1MMM A;  1S77 D;  5KT2 A;  1X59 A;  1KL9 A;  2E8O A;  2R70 A;  3K79 A;  5AKI A;  1VP7 A;  1NZP A;  5KHJ A;  1PKX A;  8ICJ A;  2EJ7 A;  1FIQ A;  3ZED A;  3OFN G;  4DR1 B;  1FAF A;  3TAQ A;  1Y76 A;  2EAO A;  5DQH A;  2Q4P A;  3X2Q C;  1YZ7 A;  1ZJM A;  4DQI A;  5J2U A;  4CS4 A;  1L3U A;  3ZMT A;  2HG5 C;  4O2B A;  7ICS A;  3KZI Z;  4PEL A;  7ICT A;  2XIC A;  3IAY A;  3U0Z A;  4ELV A;  2BOC C;  4F6R B;  3GII A;  4XBF A;  2PKE A;  3TXQ A;  3KBB A;  4CH3 A;  2WF5 A;  4IQW A;  4TOI A;  1U45 A;  2F76 X;  1L3V A;  5HHH A;  3Q8S B;  4RQ7 A;  1SB3 C;  1RQN A;  2OYY A;  2XY6 A;  8ICQ A;  1H2M A;  3LNN A;  4JI3 O;  4LF8 O;  4UBC A;  1T3N A;  5DKW A;  7ICG A;  2E8N A;  3T1H B;  2C2E A;  1H2S B;  4RUE A;  1BPX A;  2W9B B;  2KSO A;  3P3N A;  1NBM G;  2VJ5 A;  3PW4 A;  1SA0 A;  5LA6 B;  3ISB A;  3C3T A;  2BKE A;  4JYY A;  4DL7 A;  1QCE A;  3ABT A;  4M9L A;  1RG6 A;  2HBJ A;  2Q68 A;  5III A;  2H3O A;  1IUR A;  3RJH A;  1EFR G;  5EIB D;  1VQM V;  3QEB Z;  1ZD2 P;  4JAV A;  4WF9 V;  4XDJ A;  3V6J A;  4KLT A;  1FXK B;  3K58 A;  5JQG B;  5H9C A;  5AI9 A;  3M6K A;  4IHJ A;  3UM9 A;  4QWC A;  2FMS A;  1D5A A;  3RB0 A;  1XWL A;  2BOB C;  3HX0 A;  2DKX A;  4I2C A;  8ICO A;  4NLZ A;  5ALV A;  1YSC A;  1SER A;  4GFJ A;  2DFL A;  1PL0 A;  1CI4 A;  5A0L A;  3M9N B;  2GTA A;  3M99 B;  1S72 V;  1UJW B;  2P66 A;  3CRM A;  1VQL V;  3ICX A;  2HKO A;  2M6Y A;  3L72 H;  2EIM B;  3ZDC A;  2AH5 A;  3ZS8 C;  2H3Z A;  4KLS A;  2FML A;  4JB3 A;  2LGQ A;  1EN5 A;  1HJP A;  1KB9 F;  4TV8 B;  4GKJ O;  1K9M W;  3B8M A;  2WA3 A;  1U96 A;  3RJK A;  3N4M B;  4Y2J A;  3V72 A;  4F6R A;  5ALN A;  5LBQ A;  4MF2 A;  1LUW A;  5CA1 B;  3MHS C;  2QA4 V;  4EEY A;  4FE3 A;  5HFM A;  2VQF O;  2FJ6 A;  4QZC A;  3WU2 U;  3OTF A;  3SYZ A;  8ICC A;  4MVM A;  3VQV A;  3ZN1 A;  4E2L A;  1Q7Y W;  4LFB B;  1ZQI A;  2KKP A;  4UAR A;  2LKY A;  4PA9 A;  4WFH A;  2DL0 A;  4I28 A;  2K8B B;  2W9B A;  3OMN B;  1XNQ B;  3L74 H;  3JPS A;  5LA6 A;  4X89 A;  4DFJ A;  2IMW P;  5KAF U;  3RJI A;  4DV7 O;  3K04 A;  4LF4 B;  3GV8 B;  4UUJ C;  2ZTE A;  3C2M A;  3TI0 A;  4YJ3 B;  4X66 O;  4TUR A;  4JI1 O;  3JD0 A;  1IXB A;  2KQX A;  4B9U A;  4OJ5 A;  1VF5 B;  4UW9 A;  1X9S A;  4NXM O;  1WA8 B;  4QNL A;  4I2G A;  2B9Z A;  2AQ4 A;  3AEV A;  1SES A;  3BAA A;  4PHZ A;  3NTU A;  4I9Q A;  2FLL A;  1RQL A;  2OEH A;  5CR0 A;  5KAF Z;  1BGY H;  3ZIA G;  2Q7E A;  3LDD A;  2ZG6 A;  2F8L A;  3A8T A;  5IDJ A;  2IHM A;  2ZE8 A;  3TAD A;  4YY3 B;  1IVS A;  2WHE A;  4F4Z A;  3RN4 A;  1KN5 A;  1Q6H A;  3CP1 A;  1AR4 A;  2ZJ5 A;  3A0H U;  1NI3 A;  4DR3 B;  2ASL A;  2I1Q A;  4J9Z B;  1NVP B;  2CE4 A;  2IJJ A;  4BW9 A;  3GZF A;  4JYB A;  3ML0 A;  4QZA A;  4TV8 A;  3QUQ A;  3AEI A;  3ETG A;  5J0O A;  1IX9 A;  2JR5 A;  1J2M A;  2BPC A;  3QO5 A;  1VQ4 V;  3JAR B;  1DRG A;  2J6T A;  4B6J A;  4O3R A;  4I4T B;  1H8H G;  4QWE A;  1T7P A;  1QQC A;  4YIO A;  4DUZ O;  1H8E G;  1RFY A;  1S76 D;  1GH6 A;  5CA1 A;  1SQQ H;  1SWV A;  5B66 Z;  1KP3 A;  4DR7 O;  2N05 A;  4I0X A;  2QWO B;  3A0H Z;  5AKH A;  2A3Q A;  3MAB A;  2YC0 A;  4MVR A;  4U7C A;  2H3F A;  2WF7 A;  3OR6 C;  4JI4 B;  4U3F H;  3TAR A;  1OZ0 A;  3FDS A;  2CTW A;  4DS5 A;  1O9H A;  4XDL A;  4GLX A;  3UXP A;  2ZR2 A;  4NLC A;  5J0R A;  8ICP A;  4DYL A;  1XUQ A;  2UVU A;  4Z1V A;  1Q81 W;  4P9O A;  3CS5 A;  2JS3 A;  5EWF A;  2MU2 A;  2BQR A;  2WAQ C;  1YJ9 V;  2RDC A;  2EAN A;  4QPK A;  2GWS A;  4EZ9 A;  7ICL A;  3TET A;  2IU3 A;  2JJ1 G;  3K1Z A;  1P4R A;  4Q8F A;  1U97 A;  5GTH U;  3K08 A;  4YJ3 A;  4YN4 A;  2QKC A;  4JYA B;  5HP4 A;  3CCS V;  4FM1 A;  4QIW F;  2E74 B;  5ALG A;  4C4S A;  2KG7 B;  3RR7 A;  1WA8 A;  1GRJ A;  2AGO A;  1NQT A;  4DL5 A;  4G28 B;  1B3Q A;  2PZS A;  3FB6 C;  3CC2 V;  5DB8 A;  1HUZ A;  2F95 B;  5IIN A;  2NN4 A;  3GIM A;  2ZT9 B;  3T4Z A;  2P5O A;  2UXN A;  2UXD O;  4RNN A;  1H2G A;  1WPX A;  4W4K A;  2X7R B;  4K8Z A;  4DR6 O;  4I2I A;  5GTH Z;  3ZHQ A;  1QQ6 A;  3H0L B;  4FZL A;  4O5C A;  4B08 A;  2GDS A;  2ZIV B;  1F4N A;  5AM2 A;  3NR7 A;  2YEV B;  1V85 A;  3C2L A;  1B4F A;  4WFE A;  4LFA O;  1NK8 A;  3GQC A;  2FPL A;  4H0L B;  4U7N A;  2XC9 A;  5BY1 A;  3UMC A;  3L71 H;  2OTL V;  5DGA A;  4F4L A;  3ZJZ A;  3STL C;  4P0P A;  1QTM A;  4M2Y A;  4O5K A;  3MFH A;  3JAR A;  3M8A A;  5CB4 B;  5KLV H;  4ECU A;  1FJG O;  5KG1 A;  3AK1 A;  4J9M A;  1FPO A;  3H1K H;  3QF7 A;  5IIK A;  4L8J A;  3HPO A;  1ARO P;  4RQF A;  4DQQ A;  1N48 A;  3A2F A;  2YDE A;  1K92 A;  1XNR O;  4DEZ A;  3D3I A;  4YXM A;  4B7K A;  5TZV A;  2HOQ A;  3L5K A;  4GX0 A;  1AJN A;  1XBL A;  1N61 A;  2HVJ C;  1L8L A;  4DO2 A;  4I29 A;  1ZYQ A;  4QE9 A;  2QTS A;  1HR0 O;  4LF9 O;  4F5Q A;  3RBD A;  4JI8 B;  3LDC A;  4MFA A;  9ICK A;  2QDO A;  2XND G;  3KHR A;  2CAZ C;  2EBO A;  1OCC C;  4B9L A;  2Y4U A;  4FO6 A;  1VQ6 V;  3C5F A;  2K89 A;  3CC7 V;  2KG7 A;  5B1B B;  3FYE B;  2JGU A;  3AG2 B;  5KT7 A;  3Q4H B;  2P4V A;  3RFA A;  5KFF A;  4F71 A;  3CW2 C;  4TQR A;  2ZXH A;  3MGH A;  2DGZ A;  2H5X A;  2HBK A;  3BY6 A;  2VS0 A;  4P4O A;  5HR7 A;  3CRC A;  1CUK A;  4B9M A;  1S10 A;  4UAZ A;  4UCU A;  2ATL A;  4LZD A;  1F44 A;  1JR9 A;  2VWK A;  3N97 B;  1DGS A;  2A9H A;  2KJ8 A;  3TFS A;  2ZIV A;  2DW4 A;  4U3J B;  2Y9U A;  1JOY A;  2IU0 A;  1N8R W;  5JH7 B;  4PHP A;  1KEC A;  2Z7J A;  1P7B A;  4QWB A;  4EEL A;  2EDU A;  4Y2R A;  1GM7 A;  4RT3 A;  4RNM A;  7ICQ A;  5CB4 A;  1FO4 A;  1XO0 A;  1PVR A;  2HBL A;  4AP9 A;  3KFU F;  9ICQ A;  2YIA A;  2P35 A;  2YQE A;  2XCA A;  4DFM A;  2A06 H;  2MRL A;  2J6U A;  4LF6 O;  4NLN A;  4TUQ A;  3ZHV A;  5CWR A;  4UB2 A;  2ZIO A;  4PL1 A;  4KLQ A;  4I2B A;  2HVH A;  2WLM A;  3OUF A;  4I2F A;  1QQ5 A;  1XI1 A;  2B0C A;  5KFJ A;  2EZP A;  4PI2 A;  2NRW A;  3NVV A;  1QLE B;  4IIJ A;  2Y69 B;  2D8C A;  3SI8 A;  5IY5 B;  3SAF A;  3AU2 A;  3OHA A;  3CC4 V;  4ECT A;  1GK9 A;  1NKD A;  4DR1 O;  2GH1 A;  3WK9 A;  2ARH A;  1J5E B;  3AUO A;  4N23 A;  4YG2 A;  1WN7 A;  2C22 A;  4J7K A;  4I2E A;  1IBL B;  2ZXW B;  4WFF A;  3VCB A;  4YXW G;  3E83 A;  2W9A A;  3AU6 A;  2W11 A;  2GV9 A;  5T14 A;  3OGI B;  4G2K A;  4NVP A;  2E8M A;  3SJA C;  1YIJ V;  5D49 A;  8ICW A;  3EHB B;  5KFA A;  1VIB A;  3Q4H A;  1Y4M A;  1BL8 A;  1ZQT A;  8ICX A;  1S8O A;  4B3S B;  1D9D A;  2JEF A;  9ICB A;  5BXZ A;  7ICH A;  2HP8 A;  4YVZ A;  1CXZ B;  2LO1 A;  4MEY A;  4B9S A;  4X1I A;  1N60 A;  2K8A A;  4OJP A;  1KFD A;  2QM4 A;  4Y2Q A;  2VRZ A;  1ZL8 B;  1VQ9 V;  1PVP A;  4HAM A;  2YSU B;  3K9A A;  4NR1 A;  5KFQ A;  4B9N A;  4C7U A;  3D2S A;  4P30 A;  1BCC H;  9ICV A;  5KHK A;  3T1H O;  1G8M A;  2QWQ B;  2FKX A;  5JH7 A;  4U6P A;  5A9G A;  5DG9 A;  5J0S A;  2IM9 A;  2Q73 A;  2PFP A;  5HNK A;  2QB0 B;  5FPR A;  4RZR A;  2YID A;  7ICN A;  1THZ A;  2HHH B;  4F5R A;  2ZXI A;  1KDH A;  3LYS A;  1ZQE A;  1ZET A;  1BVS A;  3KHH A;  2NRZ A;  1ZQL A;  3IJ4 A;  3AG3 B;  2YMP A;  4PGX A;  1Q5O A;  1GN4 A;  1Q6I A;  1R6T A;  2EIJ C;  4QZD A;  4ABM A;  1I5Y A;  1DK3 A;  2HCF A;  1Q3E A;  4DSJ A;  2LFS A;  3PML A;  1VF7 A;  2IOF A;  3T3F A;  1MSW D;  5KAI Z;  1ED1 A;  1TUE B;  4BW5 A;  4B3M O;  4OX9 B;  3M7M X;  3GWK C;  8ICU A;  2AXT U;  4BIU A;  2V4D A;  3FAH A;  4FLT A;  1KLN A;  5KFN A;  5DB9 A;  2W6I G;  4QZH A;  3BA9 A;  3UCS C;  5C93 A;  2YIC A;  1V9P A;  3SD7 A;  4JI6 B;  2Q69 A;  9ICW A;  1YXB A;  3H40 A;  4ELT A;  1QR8 A;  5H6Q A;  1TVK B;  5DB7 A;  5EK0 A;  5L3G A;  3HKZ F;  3ABK B;  5JJJ B;  3H1I H;  1N5W A;  2MA1 A;  3QU5 A;  1OCR C;  2Q7H A;  2AXT Z;  4BUG A;  4KFM A;  1N34 B;  3F5E A;  5C0Y A;  2E75 B;  4DSL A;  5AM5 A;  3BZC A;  5FL7 G;  5LL6 Y;  5KT3 A;  5GON B;  5EOZ A;  4X62 B;  2RN9 A;  3J81 j;  2I9G A;  4DR2 B;  3I1Y A;  4PGQ A;  4YIP A;  2BTQ A;  1N32 O;  4R7C A;  1O03 A;  2F2A B;  1YJN V;  4K35 A;  4UAV A;  1FEZ A;  4CH4 A;  4ED7 A;  2C2R A;  4DL4 A;  2RDJ A;  2KJ9 A;  3FAV B;  3PST A;  4ECR A;  2Y0I A;  4Z6D A;  5KFE A;  5JUM A;  4LFB O;  1YZB A;  2FMQ A;  3RJE A;  1XNQ O;  3SAH A;  1TV9 A;  1NKE A;  1N0J A;  1S0N A;  1PPJ H;  4QE7 A;  5L3B A;  1MA7 A;  4KLE A;  4KLU A;  2HHX A;  2DPI A;  9ICR A;  1RM1 B;  3P30 A;  3M9O B;  2B1G A;  5EBM C;  4F4W A;  2HJD A;  4WBN B;  5J8Y A;  4LNU B;  1LKY B;  5L1J A;  3ZDA A;  1JXL A;  1AI4 A;  1MA1 A;  4WJ3 B;  2OCC B;  4MS2 A;  3WK4 A;  1J95 A;  4K8X A;  2BCS A;  2WAQ F;  4ZI7 B;  1B04 A;  4LR3 A;  1H2K A;  3THO A;  1NK0 A;  3H0M B;  5AM3 A;  2QSA A;  1OJH A;  2ZM6 B;  3CRR A;  1IIP A;  3BHP A;  4H13 B;  4CS2 A;  2W04 A;  4FS1 A;  3MR6 A;  3GWO A;  5F3X B;  5ALF A;  3N7R C;  2DWE C;  4F6E A;  3B40 A;  1K5Q A;  1NT2 B;  4HNA A;  2W9M A;  2ODM A;  5ALM A;  4QZG A;  3QU2 A;  1GN3 A;  4UFZ A;  3RW0 A;  3M7D A;  1TVK A;  1RDF A;  3KZX A;  2UVR A;  4J41 A;  1C7Y A;  3WG7 B;  1IXR A;  3F5T A;  5B5E U;  3IC9 A;  3GIJ A;  5CA0 B;  5ALD A;  1PK3 A;  3PZP A;  1NI8 A;  3NVZ A;  3DEE A;  1WG8 A;  2BTO A;  2E5S A;  1XO1 A;  1JI7 A;  3G6E V;  4NL9 C;  2HVI A;  3SPJ A;  3OSP A;  5L1K A;  2G07 A;  3G71 V;  5ALX A;  3SPH A;  1BSM A;  5J2K A;  5GON A;  3PSI A;  2WLH A;  4FZ1 A;  1S5L U;  3LSQ A;  3BAB A;  1ZQS A;  4DUY O;  1J2N A;  1YCI A;  5LGN A;  1SV0 C;  5ALO A;  2G0A A;  3ONN A;  9ICJ A;  1NJW A;  4K4G A;  4RQ1 A;  1L0L H;  1PVQ A;  4RQE A;  4UB6 U;  1ZX3 A;  5B5E Z;  2X6C A;  3CRX A;  1BE3 H;  1SKR A;  2MAX A;  5KFR A;  5J2E A;  4RAI A;  4JI4 O;  4LBE C;  2CTR A;  2A1A A;  5AK6 A;  2JRI A;  5J2C A;  4Z6C A;  2AJQ A;  1MZE A;  1KEJ A;  4GX1 A;  1D8L A;  4R8C A;  4MTX A;  3CXC U;  4L87 A;  2ZE7 A;  1BPD A;  1L5U A;  4KHP B;  1QBZ A;  5KFU A;  2JGD B;  4KLL A;  4WBN A;  3G6Y A;  5IYD O;  1LKY A;  1IG6 A;  2M7W A;  2G5H B;  1H38 A;  3G80 A;  2D2C B;  5L3D A;  2DUY A;  2UXX A;  2LYH A;  4UB6 Z;  1HNX O;  2XAJ A;  1P84 F;  4PA4 A;  3QNE A;  2UU9 B;  4OCZ A;  2E1F A;  4ZI7 A;  5LMN B;  1SL0 A;  4BIZ A;  4OPH A;  1D2D A;  1QVF U;  3ZHS A;  4QPJ A;  2JZB A;  1A77 A;  1M6Y A;  3D2Q A;  4C8L A;  4KLH A;  4MFF A;  7ICU A;  2IH1 C;  3WK5 A;  2EIK B;  4F5P A;  3PX4 A;  5TIS U;  1OCO B;  2DF4 B;  2FTK A;  1X66 A;  2MSN A;  1I08 A;  1JJO A;  2LJ2 A;  2EJR A;  4DV0 B;  5JJE B;  2WLI A;  4D7S A;  5CA0 A;  1KW4 A;  2JEI A;  5LGT A;  1KD1 W;  4R50 A;  4R66 A;  5KFH A;  5LP6 B;  1FXK C;  4JV5 B;  5IIO A;  4I27 A;  1IDS A;  3NVY A;  1ZOL A;  2ZIX B;  4QZ9 A;  1V55 C;  8ICA A;  5KFZ A;  1XL6 A;  2HHS A;  4UB5 A;  1ZD3 A;  5IWA B;  3AQF A;  2Z3Y A;  3A0B U;  4BIO A;  1V97 A;  2WTF A;  2FE9 A;  5AI6 A;  1TA8 A;  4QJF B;  2CTP A;  5TIS Z;  4JI7 B;  3P3P A;  3R65 A;  5F2V O;  3C29 A;  2OCH A;  1JMS A;  4Q43 A;  4ED0 A;  3RH5 A;  4NXZ A;  2W9C B;  2ZTC A;  4O4H A;  3TAD C;  4UBB A;  3NVW A;  1EZV H;  4DL3 A;  1SA0 B;  3H1J H;  4ACO A;  3T2M A;  2LM4 A;  2EIM C;  2QTO A;  2W0X A;  4Y2Y A;  4KN4 A;  1EZJ A;  1JMK C;  4JK1 A;  8ICN A;  2UVV A;  4BXO B;  5J2G A;  5KFW A;  4GZR B;  2ZIU B;  3EW9 A;  4BAY A;  1UA1 A;  5L1M A;  2FB5 A;  1IBK B;  1DK1 A;  1ZD5 A;  1QCK A;  3A0B Z;  4AYB C;  3S6J A;  3BJY A;  4IRK A;  4JWN A;  4JMU A;  4EEK A;  4IHJ B;  4UCT A;  5LMU B;  4JI0 O;  2JGD A;  4Y2S A;  1BHB A;  4M9G A;  3RYH B;  2MUT B;  1NKC A;  3B0X A;  1TAM A;  4J03 A;  4JI8 O;  2XUM A;  3CCQ V;  4ED2 A;  2KMD A;  2NLJ C;  4ECV A;  3TAC B;  2WA4 A;  3OD4 A;  2PTM A;  1VF6 C;  1HNZ B;  2ZDI A;  3RB3 A;  2VA2 A;  4IT5 A;  1DK2 A;  2UUA B;  4EEQ A;  1GMG A;  2IOH A;  2RJZ A;  3CE2 A;  4PDV A;  1BMF G;  3KTQ A;  2QLT A;  4IQV A;  5L9X A;  2FI1 A;  1X9M A;  5L1L A;  1RSO A;  5EE0 A;  2JIZ G;  3ZRX A;  3GV5 B;  3BS7 A;  1EBO A;  3RVZ A;  2Q8V A;  4DL2 A;  2P06 A;  3BQ2 A;  5LP6 A;  1YI2 V;  4NXN B;  2WLJ A;  4DSF A;  2ZIX A;  1LB2 B;  4FK5 C;  1B6Q A;  3QUT A;  2ESE A;  2JV3 A;  3AK2 A;  3N2K B;  3H7I A;  4HZ3 A;  2ODG A;  4NLB A;  4O2A B;  1Q43 A;  3I55 V;  3B09 A;  4DW0 A;  1DXS A;  2P22 C;  2L6L A;  3QUC A;  2LM1 A;  5CP2 A;  1KQS U;  2ADQ B;  2RQ6 A;  3EUB 2;  2R18 A;  4IGG A;  2EH9 A;  1JJ2 U;  2GO7 A;  2HW3 A;  5J0U A;  3ABU A;  4BGD A;  2VWJ A;  2W9C A;  4DV6 O;  4I2H A;  2A19 A;  1BQZ A;  1SV4 A;  2BDU A;  3C21 A;  3Q8L A;  2E5L B;  4BXO A;  3RVY A;  1Z5V A;  9ICH A;  3AG1 C;  5DG8 A;  2HEP A;  2ZIU A;  1SZT A;  1NTM H;  1VQ7 V;  5AK4 A;  2XY7 A;  5J2A A;  5KFP A;  4LF5 B;  2UVW A;  3ZDB A;  5BOL A;  4QZE A;  2ZUC A;  1TE2 A;  2R8H A;  3JCU Z;  4LP8 A;  2V7Q G;  4JYC A;  4TT3 G;  5GTI U;  3I56 V;  3RJF A;  1J5E O;  1FKA O;  2GOL A;  3UXN A;  4H44 B;  3RYH A;  2MUT A;  3PNC A;  1VQ8 V;  2YTU A;  7ICE A;  1N4C A;  3KD3 A;  1KBU A;  2QKS A;  5CB1 A;  2QM8 A;  1WB8 A;  2ZQM A;  5AG2 A;  5AIA A;  2EIL B;  3D36 C;  2IHN A;  3ZRW B;  3CX5 F;  5GTI Z;  2KIW A;  4ECQ A;  2RP5 A;  5KFV A;  1KP2 A;  3EVK A;  3FD9 A;  3LSU A;  4MW3 A;  4KN7 A;  5AK5 A;  3FM9 A;  4YQW A;  8ICS A;  1K34 A;  2YUA A;  2FLN A;  4IC9 A;  4DL6 A;  1KFS A;  1COW G;  2H8P C;  5D4B A;  3MDS A;  3RB6 A;  2W6J G;  4X20 B;  4GKK B;  4RPX A;  4E0D A;  1RM6 C;  5EE3 A;  4YCX A;  2L5Y A;  1P7G A;  4J80 A;  5KFC A;  3LNM B;  4I5S A;  3DSQ A;  1ZQZ A;  3N2K A;  4G27 B;  3LWM A;  1F4M A;  4I0X B;  4O2A A;  2HHH O;  2NO5 A;  1ZQD A;  3ABM C;  3N2G B;  1Y66 A;  2Y1I A;  2H94 A;  4QZ8 A;  1URF A;  1WP7 A;  4JAU A;  4AQY B;  2DYR C;  3K5O A;  2LPE A;  2R9A A;  2NO4 A;  2QKQ A;  4YR2 A;  1P49 A;  4FM0 A;  4X5V A;  2CK3 G;  5KFX A;  1TK8 A;  5B1A B;  3NRW A;  5AKG A;  5KFM A;  2V4R A;  2EZO A;  4IS7 A;  4PL2 A;  1SZP A;  5AM1 A;  2LGW A;  1XMQ O;  2OHF A;  3C90 A;  2YX8 A;  3WU2 Z;  4JI6 O;  2JXJ A;  3CYO A;  5AKY A;  2F44 A;  4MFC A;  1G4Y B;  3PJS K;  4JAA A;  2GHY A;  2KOB A;  4A5U B;  3FYI B;  4DV2 B;  1H2N A;  4Z1M G;  4KMU A;  4X9Q A;  4UAS A;  2YY6 A;  2K4I A;  3FB5 C;  4RQ5 A;  2KKV A;  5EIB C;  9ICO A;  3M1Y A;  3K3W A;  3F5A A;  4UVC A;  2PGG A;  1N34 O;  1PV0 A;  2YML A;  3ZRS A;  3TXS A;  1AJP A;  2JDI G;  3O65 A;  2A3V A;  1KKD A;  5IJ9 A;  4WCE V;  1ENV A;  3ZRW A;  1N5X A;  2WF6 A;  4EKW A;  2H3Q A;  4RQ3 A;  4QZB A;  5J2H A;  2HHW A;  1UHU A;  1GN6 A;  3U26 A;  8ICZ A;  2HSZ A;  1NR1 A;  1V38 A;  4OGQ B;  3C1Y A;  2BCU A;  3AQE A;  3NUQ A;  4B9V A;  2DQ3 A;  3UQ2 A;  4M0A A;  1NK4 A;  4P0P B;  2AGA A;  3SYO A;  3ZMU A;  4X20 A;  5AI8 A;  2A79 B;  2KZ3 A;  2UXC B;  3BA8 A;  3GU3 A;  4ICG A;  3BCC H;  1ZQF A;  4MVQ A;  1AB3 A;  5ALJ A;  3HB3 B;  5CN0 A;  4FFD A;  1BNP A;  5B1B C;  1Q86 W;  3AG2 C;  3KCX A;  1L7P A;  3RBE A;  3DXR B;  3E0F A;  3N2G A;  5KT4 A;  4DOC A;  5J29 A;  3LWL A;  3ZHU A;  4RQN A;  2YXL A;  1U4B A;  1K5S A;  3TKA A;  1AI7 A;  3STZ C;  7ICR A;  3JAL A;  3WB1 A;  2WF9 A;  1XMO B;  3SYQ A;  4B3R O;  4F92 B;  2UXB B;  4Y2P A;  2ASD A;  2Y48 A;  3TK1 A;  1N0N A;  3KCY A;  3ASO B;  5AM0 A;  2EQY A;  1NR7 A;  1SQF A;  3ZHR A;  2ZM6 O;  2PY5 A;  5EBW C;  5ALE A;  3HRD D;  2HFE C;  5FNV B;  3UXO A;  4J11 A;  4EFB A;  4DV3 B;  4USA A;  4NTW A;  1R6N A;  3JYC A;  2EZZ A;  4NTX A;  4DFK A;  5D46 A;  2CH7 B;  4WFG A;  3PSF A;  2AZ2 A;  2DPJ A;  4PD4 F;  4HBN A;  1QHT A;  1F23 A;  4TQF A;  1QR9 A;  1G6U A;  5AI0 A;  2B21 A;  1ZQ1 C;  2KK0 A;  2RDI A;  2RMK B;  4PJ0 U;  4WFB V;  2WB1 C;  3FYH A;  3HKC B;  1CEZ A;  1RPR A;  1A32 A;  1L7N A;  3CHX A;  3TGU H;  5KHG A;  2R72 A;  4DV1 B;  2E1E A;  1QLE C;  3HIL A;  3JD4 A;  5CRX A;  1X2I A;  1I7F A;  2ETN A;  2Y69 C;  5F9N A;  5IY5 C;  8ICK A;  2JHD A;  3ZI4 A;  3JPR A;  3EYZ A;  3SQI A;  2HOF A;  4BDP A;  1MNG A;  4JUZ A;  1ECW A;  2AHY A;  2P90 A;  2F1I A;  2KD1 A;  2A7W A;  1FFU A;  3EWA A;  2LI6 A;  7ICV A;  1K3E A;  1UT5 A;  3RWR D;  2K8C B;  3B9J A;  3BPZ A;  3UQ8 A;  1FYJ A;  2HHQ A;  3RJJ A;  3DXR A;  3QG5 A;  4KHP O;  3SZ2 A;  3RRH A;  2ZCE A;  3OJS A;  3WKA A;  5FPO A;  3L3F X;  2ISO A;  1WAZ A;  3RYI B;  1NTK H;  3AG4 C;  3IG5 A;  3C5G A;  4B7E A;  3VQX A;  4LJX A;  4P4P A;  1IBM B;  2DQ0 A;  3H8W A;  4AYB F;  3PSP A;  4FZM A;  5IJ0 B;  4IIJ B;  5KNI A;  2KHV A;  4UAU A;  2QWR B;  4DV5 B;  1L8D A;  2VAN A;  1MZF A;  1PP9 H;  2EZX A;  1Z2G A;  2WSS G;  1NOM A;  4NJ8 A;  2YMM A;  4US9 A;  4TQD A;  4CH5 A;  3WKB A;  4KMO B;  3MDA A;  5FNV A;  3T5H A;  5KG4 A;  4J9R A;  3IC7 A;  3VBB A;  1UPH A;  3NAS A;  2CH7 A;  2R8I A;  4X64 O;  3JPP A;  3OSN A;  1X4T A;  4CGZ A;  4UCS A;  5CA3 A;  1Q3V A;  5J0P A;  1M57 C;  3U11 A;  1FD9 A;  1Q46 A;  2PXI A;  2XOK G;  5DDM A;  4HYO A;  5CBF A;  1GM8 A;  4F3O A;  1N33 B;  2PF4 E;  5DB6 A;  4X1I B;  1K5O A;  3OJU A;  3L73 H;  2QGN A;  4DV4 O;  3HKC A;  3ETR A;  4YP3 A;  3CNH A;  1YVW A;  3JAT A;  4Q45 A;  4M9N A;  2RQ5 A;  4DOA A;  1XIL A;  3BVO A;  3BS5 A;  8ICV A;  5J0Q A;  2DWD C;  3V7L A;  1ZRM A;  3QVN A;  1W0K G;  3WB2 A;  1HNW B;  2HOI A;  4WFA V;  5ALR A;  4J10 A;  3CD6 V;  5JTI A;  1BS3 A;  4MT8 A;  1ZQO A;  4FPP A;  1XSP A;  4I55 B;  1UT8 A;  3NGD A;  4O4L A;  2MW2 B;  4X65 B;  5KG2 A;  4NV0 A;  1I94 B;  3QNM A;  1V54 C;  5GW7 A;  1IBK O;  3ZBH A;  5IIJ A;  5ALQ A;  1HUO A;  3PO5 A;  5DBB A;  2P4K A;  3RYI A;  2A0L A;  3GVM A;  1S5H C;  3SMV A;  2NYV A;  3MC1 A;  4DF8 A;  1Y74 B;  3M8R A;  3QX7 A;  2LYB A;  4F5N A;  3IHQ B;  1HWY A;  4F5O A;  4FLY A;  3NXS A;  5IJ0 A;  3SAG A;  3G4S V;  4TV9 B;  2W8K A;  3QTC A;  4KX5 A;  4BJQ A;  3SYC A;  2GLE A;  2IA6 A;  4DSI A;  1HNZ O;  3N7P D;  2X6A A;  4QW8 A;  4OPA A;  2UUA O;  4NM1 A;  1DF4 A;  1URJ A;  1MQ3 A;  4C8N A;  2KE7 A;  4NY8 A;  4EFE A;  5KFG A;  9ICS A;  1N2X A;  3JD1 A;  3QU9 A;  1R3L C;  2M0N A;  4PH5 A;  4ED6 A;  4F4K A;  3OR7 C;  5ALK A;  2CGN A;  3RYF A;  2RCV A;  4LWS B;  2LMR A;  7ICO A;  1L1F A;  1NJI W;  1LV5 A;  2D3O W;  1T8E A;  3ABL B;  4FZ0 A;  3RJG A;  5KFS A;  4MTG A;  4MVZ A;  7ICF A;  1KTQ A;  4LVS A;  3CXH F;  2BTQ B;  1L7M A;  1KSP A;  4PZO A;  4GX5 A;  3OEH G;  2BCR A;  2G09 A;  5IE9 A;  1SZX A;  5KMG B;  4K3A A;  2EIN B;  3LDA A;  3SEI A;  4Q8E A;  2PUS A;  3G67 A;  5G5G A;  1ZQV A;  4PA7 A;  3H0R B;  3P32 A;  4IRD A;  3DTU B;  5FLX N;  3HKD B;  2FPM A;  2KTQ A;  1K1Q A;  2WPD G;  4DFP A;  5C5J A;  2J6S A;  8ICL A;  2E5L O;  2AHO B;  3WG7 C;  3J7A U;  2EAP A;  4I55 A;  3DV9 A;  9ICP A;  2HHT A;  3RH4 A;  1YTF D;  4MVU A;  1BGX T;  4R6Z A;  4TSF G;  4M47 A;  4LF5 O;  5DBC A;  4LH7 A;  1BPZ A;  3UT5 B;  1WCN A;  1OUQ A;  4ZOH C;  3Q8K A;  1Y74 A;  3PY8 A;  4FLV A;  3TFR A;  1SF9 A;  4QW9 A;  4UV8 A;  5IYZ B;  1TFR A;  2CN1 A;  2UUB B;  2DWQ A;  4TV9 A;  2UUC B;  1GM9 A;  3H01 A;  4HNA B;  3BQ7 A;  3E89 A;  1XRE A;  4YJ2 A;  2I5H A;  5DDY A;  3OT7 A;  5EYP B;  4RPZ A;  1ZQB A;  1UCV A;  3E8H A;  5KX5 B;  3QUB A;  3UO2 A;  8ICT A;  1BT8 A;  4DK0 A;  2ZIM A;  3PW7 A;  3L4P A;  4JV1 A;  1XSN A;  3CWB H;  3N28 A;  1XOU A;  3CCM V;  3ED5 A;  2F8K A;  3AG7 A;  4DK1 A;  1K73 W;  1RYR A;  1L7O A;  1KFT A;  4DV7 B;  3PVX A;  4LWS A;  1E79 G;  3ETE A;  2JH7 A;  2KN7 A;  8ICY A;  2Y0S C;  5H6R A;  3PN1 A;  2R8J A;  4K4I A;  4GKK O;  5LYJ B;  4X66 B;  1FFV A;  5ALI A;  2Q5Z A;  1EN6 A;  4NM2 A;  3JD3 A;  4NXM B;  1ZD4 A;  5KMG A;  5ALU A;  4MVS A;  3C1Z A;  4ECS A;  2YXY A;  3L75 H;  2VQE B;  3KHG A;  1M1K W;  2ALZ A;  4IR1 A;  3EPI A;  1R3I C;  4AQY O;  5CEH A;  1OCO C;  2IOF K;  3W7X A;  1B22 A;  4O4J B;  9ICF A;  4DSE A;  3HKD A;  4H33 A;  5KA5 A;  1ZLZ A;  2XI9 A;  1SKW A;  1LVH A;  1HP8 A;  2E3C A;  2K4E A;  1VQ5 V;  2HMX A;  3IG8 A;  4W4L A;  2QEX V;  1W59 A;  4LF4 O;  2B6G A;  1XS9 D;  1WJZ A;  5E1A C;  1SWW A;  4J9Y B;  3ZMV A;  1N36 B;  2W43 A;  3E86 A;  2DQN B;  2ZD9 A;  4RQM A;  2XHB A;  2QWN B;  4QGP A;  3UT5 A;  1NNL A;  2HHV A;  2YIB D;  5ALY A;  5DBA A;  1SXE A;  5HHI A;  4N21 A;  3B8N A;  4DUZ B;  1XDC A;  4QNH B;  4PA3 A;  2JZB B;  3IN5 A;  1ZQY A;  2AW9 A;  5IYZ A;  2ZNI A;  3K0D A;  2B5U A;  3PR5 B;  2ITC C;  2OT5 A;  5JJN B;  3BRC A;  1Z5W A;  2BSK B;  2HI0 A;  5KFD A;  3CB2 A;  1KKX A;  1PNM A;  4YY3 O;  3AN1 A;  5EYP A;  3E58 A;  5J2F A; 
#chains in the Genus database with same CATH homology
 3QO5 A;  1VQ4 V;  1EBO A;  3RVZ A;  1DRG A;  3LVW A;  1D8B A;  1H8H G;  2WLI B;  1H8E G;  2G5I B;  1YI2 V;  4LCU C;  1S76 D;  5L3E A;  2WLJ A;  4UV9 A;  2ZIX A;  1K97 A;  2WB1 F;  1KP3 A;  4FK5 C;  2WLN A;  1B6Q A;  2W7P A;  3OMA B;  1ORQ C;  4HZ3 A;  2P7T C;  1R6K A;  4NLB A;  4MVR A;  3I55 V;  4U7C A;  2H3F A;  1RM1 C;  3OR6 C;  1CRX A;  1KQS U;  1OZ0 A;  4XDL A;  3C28 A;  2VJ4 A;  2R18 A;  2ZR2 A;  4DXW A;  4NLC A;  2ZIW B;  1JJ2 U;  2OCC C;  3ABU A;  1Q81 W;  4GX2 A;  3CMA V;  1SZH A;  2JK5 C;  4P9O A;  1M56 B;  2BDU A;  2WAQ C;  3E8G A;  1YJ9 V;  4QPK A;  2WWW A;  2KEY A;  1OCZ B;  1DF5 A;  3RVY A;  5BZB A;  3TET A;  2IU3 A;  4OO1 J;  3K1Z A;  1P4R A;  2JJ1 G;  3D2N A;  2ATK C;  3AG1 C;  1R3K C;  2ZIU A;  1SZT A;  3ASN B;  3K08 A;  3ZMZ A;  3E8F A;  4OJL A;  1Z19 A;  2WLL B;  3CCS V;  1VQ7 V;  4QIW F;  1QVG U;  2EIJ B;  4LP8 A;  2V7Q G;  4JYC A;  4TT3 G;  3CCJ V;  3I56 V;  3A0R A;  2GOL A;  2KV2 A;  3AG4 B;  3HPL C;  4ASU G;  1NQT A;  1VQ8 V;  4G28 B;  2C2A A;  3FB6 C;  3CC2 V;  2XID A;  5KUM A;  2MK3 A;  4UVA A;  2GSM B;  4JTA B;  2KVC A;  1KBU A;  3T4Z A;  2QKS A;  1AJQ A;  2QM8 A;  2UXN A;  2ZQM A;  1H2G A;  1WPX A;  2X7R B;  4PDL A;  3ZN0 A;  1M90 W;  5L3C A;  3H0L B;  4FZL A;  2YB4 A;  2HJF C;  2EIL B;  2ZIV B;  1F4N A;  3ZRW B;  1DTO A;  2YEV B;  4WFE A;  1FS0 G;  2KIW A;  3T79 A;  2RP5 A;  1KP2 A;  2DYS B;  2P67 A;  4U7N A;  1OCR B;  5CMU A;  5KL8 B;  1OCC B;  4MW3 A;  1K34 A;  3SPI A;  1M56 C;  1YHQ V;  2CPR A;  2OTL V;  4F4L A;  3ZJZ A;  1OCZ C;  5B1O A;  2D6F C;  3STL C;  4P0P A;  1M57 B;  3UKM A;  1XNS A;  3TCU A;  4P2Z A;  4IC9 A;  1PNL A;  4Q20 A;  4ICA A;  1COW G;  2H8P C;  4XDK A;  3ASN C;  2W6J G;  2JEU A;  4O3M A;  2WLK A;  5L3F A;  3CCU V;  3LNM B;  4I5S A;  1ARO P;  4G27 B;  3SPC A;  4MTF A;  5IYC O;  2Q67 A;  4RQF A;  1F4M A;  2IJH A;  2PI4 A;  1VQN V;  1ROP A;  3ABM C;  5J9P C;  1Y66 A;  1K92 A;  1FXH A;  2H94 A;  4MTO A;  3D3I A;  3OMI B;  4JAU A;  2DYR C;  4JAS A;  2ZIW A;  4C0Z A;  4FZN A;  2HOQ A;  4GX0 A;  2B1I A;  1AJN A;  2PI5 A;  4CZZ A;  4OJO A;  2HVJ C;  1GTO A;  2ITD C;  1YTF B;  2CK3 G;  2CRX A;  5B1A B;  3NRW A;  2KIC A;  4DO2 A;  2EZO A;  1R73 A;  2LBO A;  2ZDI C;  4QE9 A;  4OXS A;  1M9N A;  4PL2 A;  2EIL C;  3LSS A;  1JCH A;  5LHG A;  3LDC A;  2EIK C;  2XND G;  2DYS C;  2WLL A;  1V54 B;  2EBO A;  1OCC C;  2YX8 A;  1VQ6 V;  2K89 A;  3ETD A;  3CC7 V;  2R9R B;  3CYO A;  5B1B B;  3CP8 A;  4A8E A;  3FYE B;  1JQ0 A;  1LNQ A;  3AG2 B;  1G4Y B;  3PJS K;  2LYA A;  1HEK A;  2GHY A;  2KOB A;  3FYI B;  3RFA A;  1NH2 D;  2R9I A;  4Z1M G;  1I5X A;  1AR1 B;  1BHA A;  1HIW A;  2K4I A;  3FB5 C;  3E8B A;  3ZMS A;  2ZXH A;  2KKV A;  2DGZ A;  2HBK A;  1FXV A;  3BY6 A;  2K4H A;  4I9W A;  1AI5 A;  3K3W A;  3F5A A;  5HR7 A;  4UVC A;  3GB7 C;  3ZRS A;  3E2E A;  3CPW U;  1F44 A;  1AJP A;  2JDI G;  3BEH A;  2A3V A;  2DW4 A;  2A9H A;  4KP4 A;  2KJ8 A;  5KA6 A;  2ZIV A;  1P7D A;  4WCE V;  1ENV A;  3ZRW A;  1JOY A;  4EKW A;  4ZBM A;  2IU0 A;  2V1D A;  1N8R W;  2H3Q A;  1KEC A;  3CYM A;  5B3S B;  2Z7J A;  1P7B A;  1CP9 A;  3KG2 A;  1NR1 A;  1GM7 A;  2IJI A;  5B1A C;  4MVO A;  3IP4 B;  2XAF A;  4UVB A;  1XO0 A;  3AQE A;  3NUQ A;  1PVR A;  2HBL A;  2DQ3 A;  3KFU F;  4P0P B;  1GKF A;  3SYO A;  3ZMU A;  4PDR A;  2A79 B;  3OM3 B;  3GU3 A;  3LVV A;  4MVQ A;  2MRL A;  3HB3 B;  5CN0 A;  5B1B C;  1Q86 W;  4PL1 A;  3AG2 C;  3E0F A;  2WLM A;  3OUF A;  3RF9 A;  5EBL C;  1E1R G;  1K5S A;  4OJ6 A;  2EZP A;  3F7Y C;  1MG1 A;  1AI7 A;  1MOF A;  1QLE B;  3STZ C;  5CBH A;  1NH2 B;  3SYQ A;  1Q82 W;  2Z5U A;  1SRY A;  3IFX A;  2Y69 B;  5IY5 B;  4BX9 C;  3SAF A;  3F2D A;  2Q6A A;  3CC4 V;  4JTC B;  2Y48 A;  1GK9 A;  1NKD A;  3TK1 A;  2GH1 A;  3ASO B;  1NR7 A;  2KB1 A;  5EBW C;  1GO3 F;  4N23 A;  1KC8 W;  2WAM A;  2HFE C;  4FIP C;  1OHH G;  2JGA A;  2ZXW B;  3VCB A;  3K0G A;  4WFF A;  2HVK C;  4YXW G;  3SPG A;  5B3S C;  3E83 A;  3O0F A;  1R6N A;  3JYC A;  3OUS A;  3CME V;  4G2K A;  3MD0 A;  5T14 A;  4WFG A;  2VKQ A;  3PSF A;  1WLE A;  1YIJ V;  1XL4 A;  3EHB B;  1JVM A;  1S0V A;  1Y4M A;  1BL8 A;  1F23 A;  2LP7 A;  3K06 A;  1QR9 A;  2PMZ F;  1VQP V;  2RRD A;  1ZQ1 C;  2K8A A;  1Z1B A;  4OJP A;  1W0J G;  4GT1 A;  4CBC A;  1K4C C;  4WFB V;  2WB1 C;  1VQ9 V;  3QO7 A;  1PVP A;  4HAM A;  1CEZ A;  1A0P A;  1RPR A;  2IJK A;  2W0F C;  2YSU B;  3B77 A;  3K9A A;  4JF3 A;  4GCZ A;  3D2S A;  4P30 A;  3SYP A;  2E1E A;  1G8M A;  1QLE C;  1CPY A;  4RUF A;  4JTD B;  1YJW V;  4P9P A;  1VQK V;  4U6P A;  5CRX A;  4NWI A;  3JD4 A;  1V55 B;  2F77 X;  2Y69 C;  3MGV A;  5IY5 C;  3VC8 A;  3RBZ A;  1SET A;  2JHD A;  3SQI A;  2HOF A;  4KX3 A;  2HR3 A;  4MSW C;  3ASO C;  2Y0S F;  1THZ A;  1ECW A;  2AHY A;  4CDG A;  2P90 A;  2ZXI A;  5LGU A;  2KD1 A;  3LYS A;  3K03 A;  1K3E A;  3AG3 B;  3MHH C;  1K8A W;  2K8C B;  4JPR A;  1FFT B;  2F43 G;  1QLN A;  2EIJ C;  2AHZ A;  4QIW C;  5HR6 A;  1I5Y A;  2LFS A;  2JJ2 G;  5CBG A;  1MSW D;  1ED1 A;  1TUE B;  4BW5 A;  3L3F X;  3T4D A;  3ALR A;  1A6S A;  3AG4 C;  3IG5 A;  4H37 A;  5KUK A;  5EC1 C;  4BIU A;  3JCZ A;  4LC1 A;  3CCR V;  2JMG A;  2DQ0 A;  4AYB F;  1T94 A;  3PSP A;  2W6I G;  3F53 A;  4FZM A;  3FB7 C;  3ZRV A;  5C93 A;  2Q69 A;  2KHV A;  4P0Q B;  3F5W C;  1QR8 A;  2X0L A;  5H6Q A;  2W7O A;  2WSS G;  2KJ5 A;  2XAG A;  5EK0 A;  3WFV A;  3CCL V;  4JGS A;  5L3G A;  3HKZ F;  3W7S A;  4KMO B;  3ABK B;  1K7D A;  3VOU A;  2JEX A;  2XAQ A;  3IC7 A;  3VBB A;  2MA1 A;  1UPH A;  2OTJ V;  1OCR C;  3OAA G;  4BUG A;  4KFM A;  1NVP D;  3F5E A;  4CGZ A;  5CA3 A;  5C0Y A;  1Q3V A;  1M57 C;  1K33 A;  5FL7 G;  2XOK G;  3W7U A;  2H3I A;  2NV3 A;  4HYO A;  3X2Q B;  2HBM A;  5CBF A;  1GM8 A;  4R7C A;  2F2A B;  2Q4T A;  1YJN V;  3SJQ C;  2KHQ A;  3LDE A;  1ZWI C;  3W7T A;  1W2B U;  2KJ9 A;  3PST A;  2QE7 G;  5LHI A;  3DGE A;  2XVT A;  1YT3 A;  4X8A A;  1FXK A;  3SAH A;  4QE7 A;  1MAB G;  2KNJ A;  2DWD C;  2IH3 C;  5L3B A;  2W03 A;  1MA7 A;  1AI6 A;  1W0K G;  2HOI A;  5IYB O;  4WFA V;  1JX9 A;  3CD6 V;  2RHF A;  2QM7 A;  1RM1 B;  2K1E A;  3P30 A;  4MT8 A;  4X88 A;  5HFL A;  2HLD G;  2B1G A;  4FPP A;  5EBM C;  5LHH A;  3JD2 A;  3HKZ C;  1PD3 A;  3T1C A;  1AI4 A;  3IGA C;  4U7O A;  4NV0 A;  4WJ3 B;  1V54 C;  2OCC B;  5GW7 A;  3ZCC A;  4RO2 A;  1S77 D;  3K79 A;  4MS2 A;  1J95 A;  3SYA A;  2WAQ F;  1VQO V;  1PKX A;  1NZB A;  3H0M B;  2A0L A;  1S5H C;  3OFN G;  3SMV A;  3AL0 B;  1IIP A;  3X2Q C;  2LYB A;  2W04 A;  3GWO A;  3AG1 B;  3UM7 A;  1HWY A;  3N7R C;  1R3J C;  2DWE C;  3ZMT A;  3NXS A;  2HG5 C;  3SAG A;  1K5Q A;  3G4S V;  4P0Q A;  4KX5 A;  4BJQ A;  2G08 A;  4PEL A;  3SYC A;  3RW0 A;  3FKS G;  3M7D A;  1WUD A;  3N7P D;  3KZX A;  2X6A A;  2XIC A;  3WG7 B;  1DF4 A;  1URJ A;  2BOC C;  4XBF A;  3PZP A;  5DN6 G;  4KUM A;  3DEE A;  2E5S A;  3JD1 A;  5B1N A;  1R3L C;  3EFF K;  3G6E V;  2M0N A;  3SPJ A;  3OGC C;  2F76 X;  3OR7 C;  2G07 A;  3G71 V;  3SPH A;  3OPX A;  2OYY A;  3E35 A;  1L1F A;  2G06 A;  3PSI A;  1NJI W;  2WLH A;  2D3O W;  3ABL B;  2XAH A;  3LSQ A;  4RUE A;  4MTG A;  5LGN A;  1F51 A;  2G0A A;  3LUT B;  3ONN A;  4MVZ A;  1NBM G;  2VJ5 A;  1PVQ A;  4GX5 A;  4RQE A;  3F7V C;  3OEH G;  2G09 A;  1RPO A;  1QCE A;  3ABT A;  2X6C A;  3CRX A;  2EIN B;  2HBJ A;  2Q68 A;  4RAI A;  3F2B A;  4LBE C;  1EFR G;  1VQM V;  4PA7 A;  3H0R B;  4JAV A;  2OH2 A;  4PDM A;  4WF9 V;  4CRX A;  3P32 A;  1FXK B;  4XDJ A;  3CCE V;  3DTU B;  2YB1 A;  5H9C A;  3M6K A;  4R8C A;  2WPD G;  4GX1 A;  4MTX A;  5EC2 C;  3CXC U;  4L87 A;  5KL1 B;  2BOB C;  4ZKI A;  1QBZ A;  3ABM B;  3WG7 C;  5IYD O;  1YSC A;  2M7W A;  2G5H B;  1H38 A;  1SER A;  4GFJ A;  5L3D A;  1PL0 A;  2DYR B;  3OE7 G;  1YTF D;  4MVU A;  2UXX A;  2ZXW C;  5A0L A;  2XAJ A;  4R6Z A;  4TSF G;  4PA4 A;  3QNE A;  3M99 B;  1S72 V;  1UJW B;  1VQL V;  2E1F A;  3ICX A;  1OUQ A;  4BIZ A;  2HKO A;  1QVF U;  2IW5 A;  3FB8 C;  4QPJ A;  2EIM B;  3D2Q A;  1L6N A;  3ABL C;  4UV8 A;  2IH1 C;  2CN1 A;  2EIK B;  2PMZ C;  2H3Z A;  1OCO B;  3M6Z A;  2DF4 B;  3N7S C;  2FTK A;  3OW2 U;  1GM9 A;  3H01 A;  1Q3U A;  1PNK A;  2VIX A;  2P6J A;  3E89 A;  2OM6 A;  1K9M W;  2EIN C;  3B8M A;  2EJR A;  2WLI A;  2H3V A;  3E8H A;  1KKD A;  5LGT A;  5LBQ A;  1KD1 W;  4R50 A;  2LHT A;  3QO8 A;  1FXK C;  3OEE G;  3CCM V;  3MHS C;  2ZIX B;  2QA4 V;  1V55 C;  4FE3 A;  5HFM A;  1K73 W;  1XL6 A;  4FMT A;  3AQF A;  3W7W A;  2Z3Y A;  1Q7Y W;  1E79 G;  3ETE A;  2JH7 A;  4MVM A;  3ZN1 A;  4E2L A;  5H6R A;  2Y0S C;  4QJF B;  3D36 A;  2KKP A;  4PA9 A;  2LKY A;  3R65 A;  3C29 A;  4WFH A;  2K8B B;  3OMN B;  3AG3 C;  2JH1 A;  2ZR3 A;  4X89 A;  1IXM A;  3JD3 A;  3CCV V;  2NNU A;  3T2M A;  4ACO A;  4MVS A;  3K04 A;  1YIT V;  2EIM C;  2QTO A;  1EZJ A;  4TWK A;  1M1K W;  4UUJ C;  1R3I C;  4FJC C;  1OCO C;  2ZIU B;  5DM6 V;  3W7X A;  3JD0 A;  4BAY A;  2XAS A;  4H33 A;  3F2C A;  4AYB C;  1JPX A;  5KA5 A;  2XI9 A;  1S3J A;  4OJ5 A;  4PA6 A;  1VQ5 V;  2K4E A;  4JMU A;  2HMX A;  3IG8 A;  4QNL A;  2QEX V;  1BHB A;  1SES A;  5E1A C;  4J9Y B;  3ZMV A;  1TAM A;  2LFR A;  3ABK C;  3CCQ V;  3E86 A;  1DLB A;  3ZIA G;  2DQN B;  3LDD A;  2ZG6 A;  2F8L A;  2NLJ C;  2ZD9 A;  5IDJ A;  4UXN A;  2ZDI A;  4N21 A;  3B8N A;  3CP1 A;  4QNH B;  1GMG A;  4PA3 A;  2OXO A;  3IN5 A;  4J9Z B;  1NVP B;  2YEV A;  4PDV A;  1BMF G;  2B5U A;  2OT5 A;  2IJJ A;  2ITC C;  3K0D A;  3GZF A;  2X6B A;  4JYB A;  3ML0 A;  2N1R A;  2JIZ G;  4MW8 A;  3AEI A;  3ETG A;  1PNM A;  1E1Q G;  3ZRX A;  1K4D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...