1GO3F

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
b'MIGKKILGERYVTVSEAAEIMYNRAQIGELSYEQGCALDYLQKFAKLDKEEAKKLVEELISLGIDEKTAVKIADILPEDLDDLRAIYYKRELPENAEEILEIVRKYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 33
structure length 107
sequence length 107
chains with identical sequence N
ec nomenclature
pdb deposition date 2001-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1go3F01
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1go3F02
4QJFB 3SAHA 4NLCA 2E1FA 2HBKA 4QIWF 5C0YA 4O3MA 1GO3F 4NLBA 3CYMA 2HBMA 2RHFA 2CPRA 4CDGA 1YT3A 2E1EA 4CGZA 2DGZA 2HBLA 2HBJA 2RRDA 2KV2A 2MA1A 3SAGA 3SAFA 1WUDA 1D8BA 4OO1J
chains in the Genus database with same CATH superfamily
4L8JA 1NJIW 2EZYA 4J80A 2BPCA 2F43G 4PA6A 2KSOB 4UXNA 1ZQGA 2XGPA 3L70H 4ZI7B 4Z2WA 2XAQA 3NGDA 3LVVA 4IRKA 2MK3A 5KFEA 4QZBA 4I2BA 2OTLV 3P30A 2HP8A 1H2MA 4X8AA 1NQTA 4MVUA 4NV0A 1ZD2P 1BPZA 3RW0A 2P35A 1QQCA 3ED5A 3F7YC 3IG5A 2NRTA 5BMVB 1BPEA 2OYQA 2BOBC 5J0PA 3FDSA 5DDMA 1K1QA 1VP7A 3SEIA 4F5QA 1ZQFA 4X20A 4HZ3A 3BVOA 3HT3A 3H1HH 2PGGA 2BTQA 5DG9A 3T5KA 5HP4A 2HJFC 3UT5B 4KN7A 2WF8A 3HX0A 1QCEA 5DQHA 3CP1A 2B21A 1US6A 4UB3A 5EZYA 1W59A 3F53A 3SYAA 1LR1A 4DL7A 5IE9A 3IN5A 4YXJA 4NL9C 5KFPA 1K5SA 2LMRA 2YQEA 2FMSA 2JIZG 1KDHA 3TARA 1V54B 3SDLA 4DR3B 1R3JC 4DV3B 5J2BA 4J9RA 2JRZA 5KFZA 4UB4A 4TQRA 2Q69A 1IXMA 1BGYH 4YMMA 2EIMC 3JPQA 2DF4B 1D8BA 1S5HC 1K92A 5GTHZ 4E4EA 2IH1C 1J2MA 1TK8A 4Y2JA 1JFFB 3S3WA 5EBMC 4A5UB 1L7OA 4R8UB 2K8BB 2FLNA 3HKCB 4G28B 2EBOA 5H5NA 2K1EA 5AK3A 2NV3A 2HHTA 3G6XA 1U4BA 1YJ9V 3QG5A 1F7YA 4XA5A 1V85A 1Z2GA 2VRZA 5J2KA 4BIOA 2RHFA 3GU3A 3O9OA 3KOOA 3ZCCA 2Q7GA 1M56B 3K4GA 2WLIA 2JEFA 3QUBA 4RQEA 2NR5A 3ZHVA 4QZIA 4JZ2A 3D36A 2UVRA 4DR7O 3K03A 2AZ0A 1SWVA 1QLEB 5AG2A 1ZTEA 1PK3A 5JCOA 2LYHA 3LWMA 2A9HA 1P7BA 2PFOA 1K97A 3K59A 1Q6IA 4KN4A 4O3SA 2R18A 1KD1W 1KFTA 2NO5A 2FMPA 1K5OA 4I4TB 4PGXA 4QZ8A 1VQ8V 5EC1C 2R8KA 1FFVA 2IOFK 9ICNA 3JARB 5J2GA 1HUOA 5LMNB 2KP7A 4MFFA 1V38A 3GFKB 2QM4A 1BS3A 2NRXA 4J9SA 3M99B 2HLDG 4QE9A 3HKEA 3PZPA 1UA1A 3GIJA 3EWAA 3HKBB 4GX5A 4I2GA 5LGNA 1PPJH 4YJ2B 3B0XA 4YR0A 4ED1A 5EWFA 2EILB 3BCCH 2DYSB 2PUSA 2ZXWB 2F3NA 3Q4HB 4UV8A 2KEYA 2YIAA 1K7DA 3ZRSA 3CRAA 3AG1B 3ZMTA 1TE2A 4Y2XA 4C4TA 3O0FA 2HHUA 2DPIA 2OCCB 4LF8O 3MFHA 5FNVA 3WK8A 1Q5OA 2AXTZ 2Y48A 1T94A 5LBQA 3QEBZ 4WBNB 4I2HA 2KVCA 1RYUA 4NVPA 4IL6Z 4F6RB 1NVPB 4BW9A 5KUMA 5AI5A 4I50B 4TUYB 2ISOA 4FLZA 3P3PA 5KFHA 2VQEO 1KECA 1X9MA 4ECQA 2OYYA 4Y2QA 5D4BA 1MG1A 5KG3A 4JYAB 2UVUA 1K3EA 1V55C 2J6SA 3MR3A 2RN9A 2B1GA 2HDOA 1Z4OA 4QJFB 4X9QA 4X64O 3RYCB 3ZMZA 2MAXA 1TVKB 3J80N 4UAWA 4PGQA 2UUBO 1NI3A 2HHWA 8ICFA 5EYPA 3VQWA 5F3XB 2ZDIC 1NU1H 1R1BA 5GONA 3WFVA 5IYZA 5CBFA 4JI8O 2ZTCA 2Q8VA 4YMOA 5IYCO 3AM9A 5KT5A 4KLLA 5KT3A 2CN1A 1OCRB 5KFVA 4BXOA 1L8DA 4WFAV 1SB3C 2F77X 3B0YA 2HHHO 3M9NB 3E8HA 1Y4MA 1SERA 1VIBA 5B1NA 3I28A 4ECRA 4UCUA 2OM6A 4GZRB 3SGIA 1RPRA 4L87A 3BQTA 2KFNA 1WA8A 5AK6A 4J9LA 2FB5A 3CRRA 8ICEA 4EEKA 2FL4A 4PDVA 1VDVA 4EEYA 1Q90D 2WA4A 3OAAG 1YI2V 3F2DA 1D9DA 1I7FA 1RSOA 1FPOA 2HVJC 2P06A 4B3MO 1S0OA 2BPGA 3JPPA 2E3CA 2OEHA 2Y1IA 3AG3C 3A0BZ 4RUCA 4CS4A 5GTHU 4K4IA 2RRDA 8ICCA 2MRLA 1K73W 1BQZA 4YFKA 5EC2C 4I2CA 3GIKA 1NH2D 3N7PD 2KMDA 3VCBA 2P90A 2VWKA 5DEDA 2WA3A 3OUFA 2BCRA 2QJ1A 4KLUA 3KTQA 3MBYA 4RUEA 2FJ6A 4FZ1A 3QU9A 3VBBA 5KFLA 1NK7A 3JALB 4XRHA 2FYUH 3SPJA 4FLVA 4QNLA 2FPKA 1YJNV 3WU2Z 3RRHA 4YXMA 4UB8Z 2KJ5A 3CP8A 2JR5A 9ICEA 4JI1O 4O5KA 2CXYA 1M93A 3SYQA 4NWIA 3WB1A 5CB1A 3UQ2A 4K4GA 3OR7C 4LF9O 5IIJA 3FM9A 5LXTA 2RMKB 2ZUCA 1QQ6A 2KV2A 1ZQRA 2Y0PA 3K1RB 5KL8B 4ECUA 7ICHA 1YZ6A 2QB0B 1NTZH 2E8PA 2P67A 5C8YB 3H0RB 2JEJA 3C2KA 3EW9A 5AI0A 1XREA 2F4VO 4C8MA 3KCXA 1VF6A 4NXNB 1HNWB 3PR4A 4KLMA 2X6BA 2UUCB 5KFUA 4B9TA 4I2AA 2KB1A 1NJXA 1ZRNA 2NYVA 4UCSA 2KKWA 2ZD9A 2KE7A 3OSNA 5DN6G 4X66O 1QCKA 5BOMA 5JH7B 1EFRG 3FAHA 4YIOA 2WAMA 3ZBHA 4FE3A 3SR2C 4R8CA 3STZC 3Q8PB 1N36B 1IBLB 1NK6A 3OGCC 1VF7A 1SQQH 3C1YA 3IP4B 4UAYA 1ZQMA 2O57A 5G5GA 3M7MX 1AI6A 3E83A 4O5CA 1TAEA 3FAVB 5CA1B 2ZKOA 1DGSA 2HEPA 1T5EA 1AJQA 1X6JA 4KHPO 1CI4A 4DR1O 2AJQA 3UKMA 5LGTA 3Q8RB 2QSAA 3BEHA 1ZD5A 2AXTU 2ZIUB 5B66Z 5IIIA 3K0DA 2ETNA 1J2NA 4K35A 4BWMA 2XC9A 3K79A 4IL6U 5H2FZ 4F92B 4DSEA 4FFBA 1R3IC 2QDOA 1XU4A 3G4SV 5L1KA 4C7ZA 1NK5A 4ED7A 3DXRB 1QQ7A 2W04A 3CRXA 5L1LA 3CCSV 3RJKA 4O9MA 4ZOLB 1KP2A 1VQ5V 4J42A 2IJHA 2YXYA 4DQQA 4JV0A 5FL7G 3CMAV 2RJZA 4I5SA 5EE1A 1GM7A 4WFGA 2P7TC 4ABMA 4EFEA 2F1HA 1K4CC 5JWPA 1S0MA 1JXLA 2IM9A 2UXDO 3LDAA 1BPBA 2HBMA 3ZX6A 1I94O 2PI4A 5DQGA 1Y6XA 4EBDA 4F5NA 3BHPA 1ZQAA 4O4IB 1N8RW 3U11A 4Z6FA 4I29A 2RQ6A 2IHMA 3V7LA 2I1QA 4XDJA 3MDCA 2ZCEA 2ZIVB 4ZOHC 1XILA 2BOCC 3RYHA 1XMOB 1COKA 4F3OA 2VS0A 4HNAB 1K1SA 2A19A 4M9LA 5EK0A 5H6QA 3MC1A 4JTAB 4KLGA 2LYAA 2HR3A 2HVKC 4Z1MG 2H3OA 4I2JA 5EE3A 1YVWA 2RQ5A 4WFHA 4JASA 5B1OA 4DLEA 5J0TA 4KLDA 1Q82W 3A0BU 2E5SA 4I9WA 1NZPA 2BR0A 3KFUF 9ICQA 1BPYA 2ATLA 3PVXA 3SV4A 4BR6A 4DV1O 2RDJA 1SQXH 3T5HA 2OCEA 5DLGA 5DLFA 5CBHA 2MA1A 4F4KA 3IJ4A 1RYSA 3N4MB 5JTIA 1EZJA 2JS5A 1V97A 3V6HA 4DR7B 2AHYA 4M6WA 1WCLA 7ICUA 4X1YB 1EN4A 1COWG 5J2IA 3ISCA 2ZE7A 5DG7A 3BZCA 7ICRA 1WJZA 1AJPA 3OMAB 1WN7A 1OCCB 3GQCA 5F9LA 3WU2U 2BQ3A 3RJIA 1SC5B 2DWDC 4UB8U 2F1JA 3D8CA 4DSFA 2XUMA 3LNNA 2JH1A 1S77D 2Y4UA 4TOIA 5IYDO 2X0LA 3EXAA 1R6KA 5DBCA 4K8ZA 1BNOA 5CA3A 2QLTA 1SGGA 1LNQA 4LF4O 4UB2A 3QU5A 4IR1A 1WYGA 4DO2A 2LGQA 5J0UA 5JQGA 2ZE6A 5J2UB 4I2DA 2HHXA 2AW9A 5B1BC 3BAAA 1TAMA 4QW8A 3WB0A 4DR4B 3L74H 1XO0A 3AG2C 2XHBA 1ZRMA 2YY6A 3K75D 4B9UA 2QKCA 2ISPA 1L7MA 1WB8A 1KKXA 1FS0G 4Q20A 3OHAA 1WCNA 2A0LA 4P4OA 1Z5WA 3HKZC 2LKYA 3K3WA 5B3SB 8ICJA 1X9XA 2FTKA 1YCIA 3E22B 4DV3O 4DYLA 5AI8A 3SI8A 4P4MA 1KB9F 1OCOC 2WAQC 7ICIA 2CTQA 4LNUA 1RXVA 2JS3A 3T79A 4DF4A 2R9RB 4I9QA 5AI9A 4DV0O 2QARA 3ISDA 1H2SB 3IC7A 3EPGA 5KHJA 2VQEB 3UMBA 1Q3EA 5AK5A 7ICPA 4MVSA 3KHLA 4OJPA 1N56A 2P4VA 3BABA 1VQPV 4LWSB 4Q8EA 2HHVA 2B0CA 2EINC 4J9ZB 4BWJA 3AU2A 1MSDA 5B66U 5FLXN 4KLEA 3AMZA 3DEEA 2WLJA 2Q67A 3H9VA 1L0NH 3APQA 4X64B 2ADQB 1A0PA 4F4WA 5DECA 4MFAA 3T4DA 2GLEA 3F2BA 3Q8SB 3PY8A 1OCZC 2E75B 3ABLB 1VJ5A 4DV5O 2UUBB 4TUQA 9ICFA 3JATA 3PSPA 1XNQO 3KZXA 4JYYA 3D36C 1KC8W 2A1JB 4PA4A 2C2DA 2OXOA 4YMNA 3A2FA 3NASA 4KTQA 3I56V 3CHXA 4MF8A 1FD9A 3GVMA 2ZUDA 3F2CA 4JI8B 5JCOC 1Z1VA 4PHDA 2A3QA 5AKZA 1QQ5A 3GILA 5JJNB 3QTCA 1BSMA 3F5TA 2BSKA 4HYOA 2HHHB 4NTYA 1X59A 3MFIA 3CCUV 1ZL8A 2HBKA 8ICSA 4P9PA 1KBHA 4RNMA 3IM1A 2OTJV 4JTCB 1NK9A 5CN0A 3RF9A 3V6JA 3Q8QB 2XNDG 3JD2A 1TKDA 3QU7A 5ALDA 1A6SA 1BPXA 1FXKA 4FMTA 5DM6V 3QO8A 2IU0A 3CCJV 1UPHA 2FPLA 4R6ZA 3H40A 4DRXB 2DPJA 4TUSA 9ICWA 4MEYA 2JZBA 2RDIA 1N34O 1VMGA 5GW7A 4K0KO 1A32A 3FYHA 2AHZA 4J9PA 3JPOA 3UM7A 1HNZO 2XASA 3K04A 2JDIG 4RUFA 4R63A 2KFZA 2Y9UA 2GTAA 1N63A 2DWQA 5AHXA 3RJEA 4LH6A 4RQFA 5AKEA 4EELA 4RPXA 4Q6GA 1FO4A 4YR2A 4CCHA 2ASLA 1IZ3A 1M90W 3MR2A 4FJCC 1VQLV 3RJJA 2NLJC 1S97A 4CDGA 4DQPA 1XMQO 2RNBA 1AVMA 2PFNA 2C2AA 1TFRA 4KLSA 1X9WA 1JI7A 5L1IA 3TI0A 1SKSA 4F5PA 5EWEA 4RQ4A 2V9WA 4J10A 4JI1B 4LF6O 1QU7A 1H2LA 1HJPA 2Q4TA 1SQPH 4TQSA 4EYIB 8ICNA 4GX2A 1N4CA 4NYKA 3UCSC 1QSLA 2ASDA 4X1IB 3ASOB 4UQGA 3M6ZA 3F7VC 3OT7A 2ZXHA 4BDPA 9ICVA 2KIWA 2WF6A 3BDPA 1HNXO 1K5QA 1LUVA 3K57A 2GO7A 1N60A 1Z3EB 5KG5A 5IINA 1ZQ1C 3IG8A 2I9GA 4JPRA 5KG6A 3UQ8A 4B3TB 2DFLA 4FM0A 3M1YA 4M04A 3BS5A 5IIMA 3MGVA 2Q7HA 1ZQXA 5BY1A 2WF9A 1Q7YW 4LF7B 1B3QA 3OPXA 1MMMA 4X66B 2XI9A 3SYPA 3EPIA 5LHIA 5L1MA 5KG0A 1NS1A 3L5KA 3M6KA 1IDSA 3BPZA 4TURA 2VWJA 2E8MA 2N04A 1BQ0A 2CH7A 4YHHB 3CSXA 4FZNA 2HVHA 5C5JA 4KHPB 2QWNB 4CH6A 1DF5A 3ETRA 1L7PA 1N2XA 4F93B 4QW9A 3AG7A 3GB7C 2MUTB 1Z1BA 4QZAA 4ASUG 2G5IB 4UB1A 4JK1A 1B06A 4UAVA 4JV2A 3J81j 3DV9A 1JRPA 4RPYA 3RR8A 4PHEA 3ABUA 2ITCC 1N5XA 2P22C 4GX1A 3N7RC 5DQIA 5KFWA 3EFFK 5IJ0B 3AK3A 3ZI4A 2W3RA 4QWCA 1PKXA 3LDDA 3LSQA 2F76X 4ED8A 4IHJA 5CBGA 1XC9A 4JI7O 1KKCA 1QVFU 1AB3A 1ZQKA 3X2QB 5IY5B 4KMUA 4PDLA 3MR6A 3APOA 3G71V 4MVOA 3NTUA 4H44B 1L3TA 4IR9A 1AP6A 4O2BA 2A7WA 1I94B 3AK2A 3B40A 1TUEB 3KCYA 3QUQA 2YMLA 2VIXA 4EB6A 5AKYA 3AQFA 3SV3A 3ZRWA 4KLIA 4J7ZA 4KLQA 2W9MA 4F71A 3JYCA 1CPYA 4GIBA 4C7YA 4I0XB 9ICJA 4C8LA 3SPHA 4B9NA 4PDRA 3RR7A 2JGDB 9ICMA 1D5NA 4Z6CA 3QVNA 3TXSA 9ICHA 4GCZA 2GWSA 2LFRA 4NXNO 3EZ5A 2BQRA 2FLPA 1VF6C 1JN3A 2CGOA 2FMLA 4JAVA 1MA7A 1S0VA 1I0HA 3OW2U 2EJRA 2YMMA 2R8HA 3IV6A 9ICPA 2ODMA 3NR7A 5KT2A 1YEWA 4MTFA 3CRCA 4ZHQA 1FYJA 4PI0A 3E8FA 2R8IA 1EN5A 3TADA 4DFMA 4KX5A 1N36O 4RQ2A 1B04A 1GH6A 2DE0X 1IBLO 1G4YB 4ZKIA 2DBYA 2W6IG 1O03A 5IWAB 4DW1A 3CX5F 2EIJB 2C2RA 2LO1A 2YS8A 2WFAA 4ELUA 1NT2B 4DOAA 5LP6B 3PW0A 1BHAA 1N48A 4Z1VA 5DBBA 3PW7A 1PD3A 1MZFA 1JJOA 3PMLA 4Y2VA 1NH2B 4OJOA 5D5PA 2YIDA 1GK9A 4DS4A 4JYCA 5JVDA 2XGQA 2XCPA 1MN8A 3HKDA 1RZTA 3ETGA 2Y0SC 2Y0IA 3AG4C 1CEZA 2F8LA 3UM9A 2IBKA 3DSQA 1PNKA 2UUAO 3THOA 1LKYB 2BHNA 1U97A 4LCUC 4FM1A 3FX7A 5KFTA 4JWNA 2KHVA 3ETDA 4O2AB 4DW0A 1AP5A 4OCZA 3AK1A 1I08A 1ZQWA 4MW3A 2BGWA 9ICRA 3JASA 5K1PA 4MTOA 4PA9A 2ZM6O 3U10A 1NKBA 5AI4A 1TUBB 2L5YA 4LF4B 1FJGO 5LMUB 1O08A 1ZQCA 4C8OA 4UATA 2OHFA 2DYRC 4TV8A 3MGHA 4IIJB 1QR9A 5AKIA 5EYPB 4B6JA 4CC5A 1DOQA 4NLBA 1FFXA 3WG7C 1RPLA 3B8NA 1PL0A 1Y76A 2ZIOA 1YDXA 3ASNC 4UCTA 3KKYA 5KX5B 2IH3C 2A06H 1SL1A 1BVSA 1XI1A 2BE3A 2Q0AA 1RQNA 2X7RB 4LH7A 2ZIXB 5CA0A 3QO5A 1XMOO 2RP5A 1L7NA 3CXCU 4FS1A 5ALRA 3RJFA 2DOSA 4DV0B 8ICIA 2ATKC 4PPXA 4PHZA 5KMGA 3H8WA 3UMCA 3R9KA 2BCSA 2P66A 5ALXA 2IBZH 3M8AA 1OZ0A 4CS2A 2F8KA 1L3SA 1BT8A 2UXXA 4UAUA 1LV5A 1VQ9V 2EANA 1YIJV 4DV2O 1NOMA 1N61A 4OX9O 1GTOA 4TV9B 4G2KA 4LJXA 4MF2A 1H38A 1GAXA 5LOVA 2ZJ8A 3HP6A 4Y2TA 5L3DA 4DV5B 3KKAA 3JD0A 4EYHB 4FBTA 5KFDA 1XNQB 1Y74B 3L9DA 1TK0A 4MFCA 1YTFB 1Q3VA 1MQ3A 4P0QA 4K4HA 1GM9A 1Y66A 5J8YA 4R64A 4JV1A 5JRTA 5L9XA 5F9NA 2R9IA 1NKEA 2XICA 2WB1F 2CGNA 3KG2A 3ZHUA 4AQYO 2BCUA 2AQ4A 2ESEA 3HW8A 4RU9A 5AM1A 2E76B 3B2EE 2UVWA 4PELA 4GKJB 1ECWA 3PSFA 3C28A 1XWLA 2G38A 4LC1A 1SA0B 2Q9LA 1ZXIA 4CGZA 4P9OA 4EX6A 5B1AC 1N32O 4UW9A 3GZFA 1PL4A 3GWKC 1TV9A 1EM1A 3H1IH 1N34B 1D8YA 8ICWA 4DR4O 4K0KB 2KN7A 7ICOA 2DL0A 2ADPA 4GC7A 1HNZB 5J0QA 2AZ2A 4I2IA 3CJHB 2DUYA 4QWAA 1QR8A 1BMFG 5DDYA 3N2KB 1M57C 2K4EA 3IFXA 3JPRA 2GDSA 3ZD8A 2KG7A 3W7WA 2IOHA 2UXBO 4F4ZA 1KSPA 2LP7A 1XMQB 2C2EA 3GIIA 2PFQA 7ICSA 3KHHA 2M9NA 5ALQA 1GN6A 2IJKA 3JAWA 2Q7EA 1R3KC 1JMSA 2E74B 3IAYA 2BKEA 3ETLA 3ZJZA 4LF6B 3SAHA 4F91B 3TQ1A 5CB4B 2KSOA 2QTOA 3HB3B 4ZI7A 3SR6A 4J03A 1GN2A 1H2GA 5IIOA 1AQ6A 2QM7A 4MVRA 4QZDA 1XL6A 3QNMA 4O3RA 3RB3A 3DC6A 4CS3A 1IG6A 1EZVH 2ZE5A 3OEEG 4DV4O 2QA4V 3PSIA 2VA2A 3CW2C 4PV1B 4DR2O 4PDMA 5AKJA 5BMVA 3KZIZ 1HNXB 3D3QA 4FO6A 4YY3B 4OPHA 3PMNA 1R6TA 2HBJA 4QGPA 3WK4A 1XSPA 3CPWU 1B4FA 3UXPA 3S6JA 3SAFA 4W4LA 4ECVA 3WK6A 2W9AA 5EIBC 5L3CA 3TANA 3UT5A 4C8KA 4NLCA 3U0ZA 2M0NA 4IQUA 1S8OA 3RBZA 4J9KA 3E89A 1WAZA 1T4GA 4JI5O 5KTQA 4F72A 3CCEV 1FXKC 4JI3B 4B9MA 3W7TA 1X2IA 2CPRA 4KL1A 2HVIA 3I76A 4M2YA 4KXRA 3TK1A 3WK9A 1ZAUA 4P4PA 3RH4A 3WK5A 2EAPA 1R73A 1S0NA 3QO7A 2JRIA 1JFFA 1XS9D 3NVWA 2EIMB 4R8UA 3HKCA 2KZ3A 4DL6A 5ALWA 3PW2A 2WLMA 3IGAC 1WNSA 5AKKA 4LF5O 3K5MA 1GN3A 3N2GB 4DQIA 5HMLA 5KG1A 4KX3A 4O3NA 5KFAA 4NXZA 5EE0A 4CF3A 4JI7B 1ZJNA 2HOFA 4MEXA 3CS5A 1ZQYA 5J2EA 2MSNA 1E1RG 1MA1A 4NM1A 1NTKH 5IJ9B 3WKBA 3BS7A 5L1JA 3PSTA 4GUNA 4MT8A 4QZGA 3RFAA 4FLXA 1GN4A 4BGDA 2YDEA 2LM4A 3OE7G 2HJDA 1J97A 2BCQA 1QTMA 2LM1A 3OGUA 4E0DA 3BJYA 3RTVA 3PX6A 5KAFU 2B5UA 1ZJMA 1B22A 3OMNB 5KFJA 3ZS8C 4ECXA 4O4JB 1P84F 1S10A 1PK1B 2W8LA 5AM4A 4I4TA 2GH1A 4MS2A 4ECZA 3TAQA 3D2SA 2LW7A 8ICBA 3EUB2 3HILA 3H8SA 3WKCA 3JARA 3SJAC 2D3OW 4B3TO 2ARHA 4IRCA 5CEHA 3ETQA 3ABMB 2BZFA 4PA3A 5KUKA 2YIBA 3E35A 2EULA 7ICEA 2Y69C 4LF7O 1X6IA 4PHPA 4I28A 2HFEC 2XTAA 3HKBA 1NK4A 3CRQA 5J0WA 4YJ2A 1F4MA 5CA7A 3ZDCA 4CBCA 4QWEA 3V72A 4US9A 2C22A 2W54A 3Q4HA 4Q43A 2NNUA 2OT5A 3MDSA 4YHHO 1WWVA 2ES6A 1QHTA 1T3NA 5CRXA 2ZINA 4J9YB 4EBEA 4M9GA 3TFSA 8ICUA 2FKXA 1Z4NA 5HR6A 5B3SC 3TETA 5ALLA 3NRWA 1F5SA 1VF5B 3KHRA 1YZBA 1VQ6V 2RLTA 3N28A 4U3JB 3RYIB 1D5AA 4F6RA 8ICXA 4WBNA 1X40A 2P4KA 4TUYA 4I50A 4XQ8A 4B3SB 4Y2YA 1YT3A 2EZXA 2KKPA 4KLFA 2UUAB 3D2NA 4RNNA 3G67A 4UVCA 3JPNA 4GFJA 1I5YA 1YTFD 5KG2A 3CD6V 2NO4A 4GKKO 2QR4A 3RVZA 5HR7A 1V55B 4H33A 5DB6A 4RZRA 3E8GA 2ZM6B 4DSKA 4X89A 3RYCA 2W43A 1TVKA 1B43A 7ICGA 4H37A 5ALSA 2D8CA 2PF4E 1FJGB 4M9NA 1M6YA 5J2TB 2JH7A 1Z00B 5B5EU 1FKAO 4HAMA 3KD3A 1F44A 2BCVA 3KZIU 2YSUB 4UV9A 1VQOV 4NY8A 3P32A 1Q6HA 3RWRD 2IOFA 3BY6A 4JUZA 5LYJB 5BZBA 1SKWA 2DQNB 3L72H 4DV7B 4PJ0U 4OJ5A 3K5NA 2GUZB 1ZSPA 2EAMA 4GT1A 3CC2V 2YEVB 3NVVA 1DK3A 4RPZA 5AI6A 2ZXIA 3AQEA 1NBMG 4EKWA 5C0YA 1AR5A 2JV3A 1VEWA 1URFA 5AM2A 3PN1A 1ZQEA 4Y2PA 5AKLA 2W9BB 3TADC 3JAKB 3OFNG 3CCRV 4NR1A 3BZKA 3BA9A 5IWAO 4EBCA 4JGSA 4DV2B 1F0MA 4OX9B 1IM4A 3H0LB 1OHHG 3AG3B 1MABG 5ITZB 4PL2A 4YD2A 5KA5A 2GSMB 9ICBA 1SV4A 1YF2A 2W03A 8ICHA 4I27A 4B9LA 5D5QA 4O4LB 1PNLA 4DFKA 3AN1A 4YJ3B 1PUZA 2KD1A 2C28A 2Z0AA 3RYFB 4AI8A 3JSNA 4LR3A 4O3OA 3JALA 4X1KB 4CH3A 4AQYB 2PYJA 3L71H 3QUTA 4IRDA 1C20A 3FYIB 1Q86W 3L75H 5BOLA 2WLLB 2ZR2A 3NVYA 1L5UA 1H8EG 8ICZA 3OEHG 5ALYA 5LMUO 1HW7A 3HRDD 1JR9A 1N32B 5K4LA 3A0HZ 5KT4A 2QB0A 1JX4A 2ALZA 5C8YA 3SD7A 3HPOA 2V4RA 1L3VA 4RAIA 5AM0A 1Q6UA 3TACB 4ED6A 2LQTA 4F6EA 3MAQA 3E58A 3L3FX 3V7JA 2K9PA 5JH7A 1PVQA 2R8GA 8ICKA 2YC0A 4NKGB 3T1HO 3BQ2A 2UVVA 2W7PA 5ALTA 2D6FC 2F44A 4IQTA 2CAZC 3IHQB 2UXBB 4GXIA 2OIGA 4P0PB 2H8PC 4U7OA 4UAZA 2W7OA 3FAVA 5CA1A 8ICMA 3NRZA 4XDLA 3PX0A 1AILA 2ASJA 2PY5A 1SZPA 5ALMA 4X65O 1L6NA 2EZOA 4Z6DA 4YN4A 3C2LA 2W9CB 2CTRA 4RQ7A 2ZIUA 4DK1A 2LI6A 3SYOA 3ZDBA 1KL9A 3SJBC 1UT8A 3CYOA 5CWRA 3T5LA 4X5VA 4BUGA 8ICLA 3LDCA 4TQDA 3KBBA 2UXCO 8ICYA 5ALHA 3EYZA 4ICGA 4K8XA 3KKAC 4DV4B 1G6UA 2ZG6A 5J0SA 2ZIWB 4DR6B 2V4DA 3RAXA 3DXRA 3FB8C 3MGIA 3MD0A 4ZOLA 1SS3A 3W7XA 5J8YC 3K9SA 4I55B 5KG4A 3FKSG 3LUTB 4O4HB 1W0KG 4XUSA 4CF5A 1IVSA 2IA6A 4GC6A 4QZEA 4J9OA 3B4SA 4CH4A 4U7NA 5IIKA 2W0FC 5DGAA 1SWWA 4H13B 3ZHTA 2G06A 1U45A 4AILC 3ZMUA 4GKJO 1SKVA 4C4SA 3JD4A 1G1XB 1M9NA 4JI5B 1K33A 4O4IA 5DB7A 5LA6B 2Q5ZA 2DJVA 1NR1A 2KIVA 4R66A 3H8JA 3NS1A 1IBMO 4KITB 1SF9A 4J9NA 2ZIVA 1BPDA 2WPDG 1U9LA 4FFDA 2H3ZA 5KFRA 1ZOLA 3ISBA 1O9GA 3H01A 2FE9A 1YHQV 4HNAA 1ZD3A 1IURA 4OJLA 2BPFA 5CJ7A 2V1DA 2JJ1G 3CWBH 1Q8KA 5KT6A 4H0LB 1OW5A 4KLJA 2F1IA 5J2FA 2Y4TA 5A2QN 4LF5B 3MABA 3SYZA 2NRWA 4M47A 5J0RA 3K1ZA 5J0XA 1ZETA 2EIJC 2WLHA 4YR3A 5LP6C 1UJWB 2QB1A 1AROP 1L8OA 3QXGA 2AGAA 4XDKA 1BE3H 1KP3A 4PH5A 2XAJA 1DGJA 2GTSA 3RJGA 5KG7A 3C5GA 1X42A 3C90A 2Q0ZX 2K4PA 1DRGA 5AIBA 3TJTA 3V7KA 4X1YA 4AHCA 1WP8A 3W7UA 2KZZA 2N74A 4N23A 2HMXA 4NLGA 1Q8IA 4RO2A 9ICAA 1NI8A 3VOUA 1X9SA 1GO3F 1COOA 2CK3G 3OMIB 2AQ0A 2P5OA 1D9FA 2PMZF 2Z3YA 3QX7A 4DQRA 3A8TA 4C4RA 9ICUA 3B8MA 4F5RA 4D6TH 3RH6A 2EH9A 5KFMA 2BQUA 3RN4A 1KLNA 1YSCA 1ZQTA 4F4XA 4J7KA 1V9PA 1AR4A 3OTOO 3A0HU 2H94A 1P7DA 2L6LA 5J2UA 2N1RA 4X20B 1JCHA 1SV0A 1THZA 3VQXA 1JA8A 5J0OA 2Z5UA 2BTQB 5B1BB 1XQ8A 4FZMA 4FLWA 2VA8A 1UT5A 3EHBB 4O3MA 4NTWA 3D2QA 1S9FA 4JI3O 3IC9A 2Z7JA 5ALFA 1QLNA 5EZYB 2VKQA 1L8LA 1K9MW 3E22A 1V54C 1XHXA 3GWOA 4UUJC 4O0IA 5KFYA 4DSJA 1LB2B 5BR8O 1OCOB 1G8MA 4CC6A 1XSNA 2K8AA 4LZGA 7ICFA 1WP7A 4YY3O 5AK4A 4KLTA 1XHZA 3OJUA 1S3JA 1S5JA 2XCAA 3P3NA 2PTMA 1KUQA 5KFBA 3CCLV 4LWSA 4DSIA 2DKZA 5TISZ 1ZQJA 2QM8A 2OIEA 1NZBA 1OXJA 2KVSA 4AYBF 5JUMA 2X6CA 4US8A 7ICLA 2EINB 2F95B 4GKKB 3QU4A 2ZT9B 1M56C 5D46A 5DB9A 2XT9A 1ZQVA 1ZX3A 3HPLC 1NZ6A 2OH2A 4X88A 2HG5C 1IIPA 3ZHQA 2WLIB 2A1JA 1N62A 5T14A 4DQSA 3UPQA 1QLEC 3JD3A 4G27B 4ECSA 1MSWD 4JI6B 4F4LA 1N5WA 2M6YA 4OPAA 8ICRA 3H1KH 5F2VO 4D7TA 3T1YO 3GV8B 5AM3A 2BDUA 3FB6C 4C7UA 2H3FA 4QIWF 3OJSA 1L3UA 3ZRVA 4EENA 2VJ5A 2BDPA 1N33O 3FB7C 2O6KA 1M1KW 4CH5A 1QVGU 4DXWA 4FLYA 1TAUA 2AH5A 1IX9A 1ZQNA 4LBEC 1FXVA 3ZHRA 2XAGA 3JCZA 1FIQA 4ECTA 5KHHA 1S5LU 4YXWG 2DN9A 4B08A 1JPXA 1IBKO 3BQ0A 3HKEB 4DRXA 4DFPA 2KQXA 2YB1A 3BA8A 2EILC 5J2JA 1RQLA 2DYSC 2ZXWC 4BAYA 3UQ0A 1UFIA 1NTMH 3TXQA 2YN4A 1BHBA 1WPXA 3ZD9A 2MU2A 4RT2A 3K5LA 2ZIMA 4B3RO 1TA8A 3AG1C 1SL0A 4PI2A 4R65A 2OCCC 3CB2A 3H1JH 1GKFA 3RFRA 5K1XA 2P6JA 1GM8A 2KJ9A 1BCCH 2WHEA 2G09A 3OTQA 4DL4A 2XY7A 2HW3A 5FNVB 3J81N 1TVAA 4B3SO 2QKAA 4YIPA 2KSDA 5IDJA 1JMKC 1QH9A 3CCVV 4MTXA 5H6RA 2WLKA 1KEJA 4FVMA 4FS2A 3SPIA 4AP9A 4O3PA 3PNCA 3T5JA 1AJNA 4FBUA 3WK7A 2ZQMA 3STLC 3OHBA 2ZTEA 1P7GA 2G08A 4M0AA 4QE7A 2F1MA 5HNKA 2F23A 4KLOA 2WWWA 2FMQA 3ABKB 2EIKB 1VQ4V 4HAIA 2KOBA 5JJEB 3QZ7A 5AKHA 1KFSA 7ICQA 1ZUQA 3OUSA 4UASA 1NR7A 4TWKA 4X1IA 3CYMA 4J9MA 4ACOA 4Y2UA 5GONB 3H7IA 3CE2A 5IYZB 1SETA 1EN6A 3WKEA 4JZGA 1OCRC 1IV8A 5JU5A 3PW4A 7ICNA 1AI4A 3NVZA 2H3VA 4J7JA 4UB6Z 4DV7O 2ZE8A 4BXOB 4DV6O 3GIMA 3T1HB 1URJA 1ZD4A 1KFDA 4KMOB 1LUWA 1A76A 1WUDA 2PFPA 2WSSG 2JEXA 3TCUA 1JJ2U 3SENA 3ZDAA 5DGBA 3LSSA 1TK5A 3L4PA 4A8EA 1OJHA 3B09A 3ML0A 3OM3B 1WA8B 1MQ2A 3MHSC 3SYCA 4X65B 3ORYA 3SPGA 1ZQBA 1I5XA 2MW2B 5KFIA 2WLNA 3LSUA 9ICLA 2MUTA 4OD0A 1BNPA 1RSOB 4PL1A 2ILMA 3SJQC 5GTIZ 1SQBH 4X62O 2UXCB 3HJEA 5IILA 4UBBA 1J5EB 1D2DA 5KA6A 4FZLA 1CRXA 5LHGA 4GXKA 5TISU 4QNHB 1SRYA 3OD4A 1RFYA 4B9VA 1E79G 2YTUA 5IJ0A 1XOUA 4HYKA 3MDAA 5A9GA 1JALA 3RAQA 5E79U 5KAFZ 5LGUA 2Y1JA 1HR0O 1XUQA 4CE6A 9ICOA 2E8OA 1ENVA 4ZH4A 3SQIA 3PO4A 2JEUA 5KFSA 3I55V 2CTPA 9ICGA 2H5XA 4CRXA 5DBAA 2E5LO 1XNRB 4OJ6A 5AIAA 4F50A 4FIPC 3CEIA 1P49A 5AKXA 3CC7V 5LXTB 4I0XA 4YVZA 3ZHSA 1ZQQA 4Z6EA 4UCOA 2PI5A 1IBMB 2JGDA 2CE4A 2JGAA 1VQNV 5ALGA 4MW8A 2QWRB 4IGGA 4C0ZA 4DUZO 2D3DA 1CP9A 3G6EV 1KRPA 4LFCO 2QE7G 2W6JG 2NRZA 3OSPA 3ABMC 2JXJA 3KHGA 2FLLA 2WB1C 1PNMA 1WLEA 4JI4O 4QZFA 4DO9A 2AGQA 1F4NA 1U48A 1W0JG 1RG6A 2IW5A 4BW5A 5LP6A 1K8AW 1NJYA 4DWIA 4QPJA 1RM1B 3FYEB 2V7QG 3CC4V 3PO5A 5LL6Y 1VLBA 1RYRA 1MZEA 4JI0B 4EZ9A 2NN4A 1KTQA 4DR5B 3C3SA 3M7DA 4ED0A 5HHIA 4IS7A 4LFBO 2GV9A 1Q3UA 2Q68A 1ZQSA 2G07A 3UO3A 4KP4A 3AG4B 5DG8A 2VQFB 1LKYA 1RXWA 4B7EA 5B5EZ 4FFBB 4DOCA 4C80A 2K4HA 4DR6O 1JVMA 5FPOA 2LYBA 4O2AA 3T4ZA 1VQKV 1N0NA 3K0GA 5ALUA 1NKCA 1M4UA 5CHGA 3LYSA 3ZIAG 5EWGA 5KHIA 4RT3A 1XNSA 2WF7A 3SMVA 3UXNA 7ICVA 3JPSA 3O65A 1TUBA 1BZKA 1R3LC 1XL4A 3K08A 1ZQLA 1Q46A 3ALRA 1X4TA 1J95A 4PJ0Z 3OTOB 3QEAZ 4RQMA 3RJHA 2W0XA 3M8SA 5J2CA 4IIJA 2DYRB 5KFGA 4O3QA 1XO1A 5KFFA 1DK2A 2EDUA 4O5EA 2YXHA 1KW4A 4MHVA 3MR5A 3AUOA 3F5EA 2BTOA 2IJJA 3WG7B 5KX5A 3ZEDA 4TQFA 2KNJA 3ASNB 2LHTA 2ZIXA 2ITDC 4UB6U 2QKQA 4RQ1A 3AU6A 2LGWA 3CRMA 3K58A 2QWOB 5BR8B 1NK8A 3RYHB 3C2MA 1SZHA 3SAGA 2UU9O 3VQYA 3C5FA 3Q8LA 2YICA 2IMWP 3TKAA 3E0FA 8ICTA 1HP8A 4MVQA 1ZQHA 4LP8A 2KG5A 4UCRA 4NM2A 1HUZA 3V6KA 4QZHA 1ZYQA 3RB0A 1WWUA 9ICXA 4BJQA 3C21A 5D49A 4F2SA 2DQ0A 1SXDA 2Y9TA 5EE9A 3Q8KA 1WB7A 2A79B 4TV9A 4LFAO 4PGYA 3NXSA 5GTIU 3JAMN 1F51A 5J2AA 4D7SA 4F4YA 2YB4A 3QUCA 3QE9Y 4WCEV 3I5DA 4DCCA 3BQ1A 2EX3A 2JEIA 1L0LH 3H4DA 3JSLA 1JQ0A 1RP3B 1Y74A 5BPCA 1KQQA 3H1LH 2XAFA 5H9CA 4JAAA 4Q44A 3M8RA 5KFCA 4M6WB 4KLHA 4GYCB 4RQ3A 4DL2A 4U7CA 2HOQA 7ICJA 1OCCC 4F8RA 4GLXA 3PR5B 4RQNA 2WTFA 2X6AA 3T1YB 1NKDA 5A0LA 1NJZA 5ALZA 1Q81W 1ZQDA 1XDCA 3K06A 2ZNJA 4NTXA 3VQVA 3FB5C 9ICIA 5IT9N 1DTOA 1SA0A 3K9AA 3TAPA 2IU3A 2DGZA 2PZSA 4DF8A 1IBKB 5KNIA 1HDJA 2JJ2G 5KFXA 5B1AB 1SV0C 2P6UA 5EBWC 5KFKA 4WFEA 5JQGB 2OCHA 4JWMA 3H4BA 3ETEA 2FPMA 4ZBMA 2QWPB 2K4IA 8ICGA 2A1AA 1JIHA 4B3RB 1L1FA 4PA7A 1C7YA 4JV5B 2ODGA 3CJHA 2KJ8A 5DKWA 4P2HA 3N2KA 1EBOA 1QBZA 4JI2O 3CMEV 3Q8MA 1UPGA 2XAHA 1ZQPA 5FPRA 1N33B 1M57B 2EZZA 1VQ7V 5L3FA 2CUGA 4LNUB 2EZPA 1WG8A 4KUMA 4Q45A 1E1QG 3ICXA 1CXZB 3WB2A 2QARB 3D6JA 4M9JA 1F23A 1U49A 3G6BA 1H2NA 1PVPA 2IJIA 3QU2A 3GDXA 4RNOA 1UHUA 4J9QA 1SL2A 1VARA 3OTFA 5CB4A 3JCUZ 3N7SC 5TZVA 2GHYA 4WF9V 4B9SA 2YX8A 1UCVA 4DL5A 3MHHC 4EFBA 3ABLC 3OR6C 4EEQA 2K8CB 3C23A 4ELTA 5FP0A 5ALPA 5J2HA 2DWEC 4U3FH 4ECWA 4OXSA 3JATB 1AI5A 4JI6O 2GOLA 4J41A 2W55A 3NUQA 1N0JA 4FZ0A 2J6UA 1U47A 2KKVA 4DV6B 3E8BA 1YZ7A 4UARA 2BSKB 2M7WA 4JB3A 4NXMO 2F2AB 1S76D 1ZL8B 4B7KA 4YG2A 4JTDB 2BCCH 1MC8A 2EQYA 4DS5A 2RCVA 1NK0A 3PV8A 3UXOA 2YIBD 2XIDA 3AEVA 1PVRA 1SKRA 1K4DC 1R6NA 1FXKB 4RUAA 3QF7A 3TGUH 4NL9A 1SESA 5ALJA 4DR2B 3T2MA 3PX4A 1A77A 5KL1B 1Y67A 4BIZA 5ALEA 2JZBB 4IYHA 5ALOA 3FFQA 1X66A 4MVZA 4TSFG 2CRXA 1T8EA 4Y2SA 3CCQV 4X62B 3JPTA 4F2RA 3ZDDA 1Q43A 4OGQB 3S3XA 1XBLA 1FFUA 1KKDA 3THVA 3T3FA 4FLUA 3N2GA 1UQVA 5AKGA 1Z5VA 2WF5A 3SJCC 4U6PA 1XEQA 1NVPD 1IXRA 3PW5A 2HSZA 3LVWA 3RVYA 4MTGA 1SQFA 4UVBA 1HR0B 2FDRA 1XSLA 1B6QA 2UXNA 5IJ9A 2KZMA 4XBFA 1MNGA 5CMUA 4LZDA 4QWBA 2E5LB 3A0RA 1FAFA 4DUYO 4I2EA 1IXBA 3PJSK 2PYLA 7ICTA 3HKZF 3W7SA 2Q4PA 2E1FA 2YI9A 4BX9C 3ASOC 3CXHF 1ED1A 4O4JA 1PK1A 2WAQF 4RQ5A 4RWUA 1FXHA 3SZ2A 4DUZB 4W4KA 4RQ6A 4LFCB 2EJ7A 1OUQA 2F66C 2HHSA 4FFKA 1ORQC 4PZOA 4EX7A 5EOZA 2QKSA 3R65A 3QNEA 2GBOA 2E1EA 2YUAA 3BS5B 1Y88A 2K60A 1DXSA 2Y69B 4FK5C 4JI4B 4NB5A 1JXEA 1YJWV 2YMQA 8ICVA 3ZDEA 2VANA 3DGEA 3SPCA 4G9BA 1SQGA 3CNHA 2KK0A 5L3BA 2CH7B 4NLKA 3E86A 2AU0A 4ED3A 4ED2A 4DFJA 1SXEA 2L35A 3GV7B 1PM9A 5ALKA 2EAOA 2JK5C 4DR3O 4LF8B 4UB5A 2DMXA 4U3JA 2KHQA 2KTQA 4CF4A 3RYIA 4LFBB 4QWDA 2QEXV 3G80A 4DEZA 2YI8A 2KICA 1J5EO 1JOYA 4FLTA 3WKDA 2P6RA 4MSWC 4K3AA 2XOKG 5AICA 2G5HB 5AM5A 2ZTDA 3BFRA 2DQ3A 5IYBO 2W8KA 1MOFA 3TFRA 2D2CB 3N97B 1AR1B 9ICCA 4ICAA 3L73H 2H3QA 1UA0A 1PP9H 5J2TA 5H2FU 3FC4A 1Z00A 4YQWA 2DW4A 3X2QC 4IHJB 5IY5C 5KLVH 1FEZA 1OV9A 2YMPA 2N05A 1PZNA 2ZDIA 5KHKA 2B6GA 1XNRO 1CUKA 3N27A 2A3VA 4FM2A 3WKAA 1DK1A 1D8LA 4O2BB 1T3QA 3LK9A 4NLZA 3OGIB 5LYJA 8ICQA 1S5LZ 3LDEA 5DB8A 2LJ2A 2HBLA 2DKXA 5KFQA 3ZRWB 4EB6B 1LVHA 3ZN0A 2QGNA 3HR0A 1ZLZA 2GUZA 2YEVA 3RGBA 3RT3C 1SZXA 4RQ8A 2UU9B 3ZMVA 1H2KA 3FD9A 5LMNO 1DF4A 1NJWA 1RM6C 5LHHA 2G0AA 2FI1A 1GMGA 4ZHQB 2W9BA 4YD1A 3IRUA 3D3IA 3JAKA 2B9ZA 2QWQB 4NLNA 2Q6AA 4I2FA 4C8NA 4G3IA 4QZCA 2RDCA 4Q8FA 1M5IA 4B3MB 4ZIBA 3AL0B 4LFAB 2E8NA 5KFNA 2E3TA 5ITZA 3DDHA 3VC8A 4IT5A 4DR5O 9ICSA 4WJ3B 3C3TA 4JI0O 1Z19A 5C93A 1NNLA 4IQWA 1PV0A 4QZ9A 4O4LA 5KAIZ 4NJ8A 2ZNIA 3RRGA 1WPBA 2ZR3A 4QPKA 8ICOA 3RB4A 2XVTA 4YJ3A 4DK0A 5HFLA 5JVDB 2ZJ5A 3RYFA 3HKDB 8ICPA 2LW1A 4X1KA 5JJJB 1QSSA 5L3EA 2VQFO 2PKEA 3F5WC 5EBLC 5ALIA 3U26A 1SQVH 4YP3A 3RB6A 1JUDA 2WLLA 5CR0A 3AEIA 1YXBA 4JYBA 2QTSA 1U96A 1W2BU 4JYAO 9ICTA 3DC5A 2J6TA 1JX9A 1HIWA 3ABKC 3GV5B 3JASB 2EIKC 4J11A 4LF9B 2JGUA 4PD4F 3H8MA 2HHQA 3ABTA 1K34A 5EIBD 3HWTA 4HBNA 2AHOB 3J7AU 1BGXT 4M9HA 5J29A 3B77A 4GX0A 4TV8B 2I5HA 2W3SA 3RBEA 3QYPA 1T7PA 4I7ZB 2HKOA 2HOIA 4IYIA 1HEKA 2F4VB 3AG2B 2V4QA 3ONNA 1FFXB 2LBOA 3I1YA 5J9PC 1Y76B 3IDWA 1P4RA 3JD1A 2ZJAA 2JEGA 3E2EA 4JI2B 1SIJA 3RBDA 5J2DA 5CA0B 4IC9A 1KMIZ 2XO7A 2PMZC 1QNMA 4P0PA 3ZMSA 5L3GA 5ALNA 2AGOA 1ZQIA 2H3IA 3K5OA 4ECYA 5KMGB 1ZWIC 1DLBA 1KQSU 1SZTA 4YCXA 2CDYA 2R9AA 3QZ8A 2W9CA 9ICKA 3LNMB 1TAQA 2ZUBA 4DLGA 5HMMA 2LPEA 4DR1B 4LVSA 3M9MB 2R72A 1RPOA 4N21A 5E79Z 5BXZA 5HFMA 4IQVA 1S72V 1KYOF 4USAA 1OCZB 2AGPA 1JROA 4GXJA 2Q73A 5LOVB 2VA3A 1GRJA 2Q0OC 1ROPA 1EXNA 2HI0A 2ZIWA 1HWYA 3ZN1A 4UVAA 4WFFA 4I55A 3T1CA 5KHGA 4O4HA 4OO1J 4P0QB 4DFDA 1ZQOA 4BIUA 3BQ7A 4PZNA 7ICKA 1VQMV 2YXLA 2XY6A 1TGOA 2JVDA 4Y2RA 4F5OA 3DTUB 4E2LA 4UCVA 4R7CA 5KT7A 2LFSA 4ELVA 4DSLA 3M9OB 3H0MB 4NXMB 1RDFA 3EVKA 4TT3G 4RQ0A 2UXDB 4AYBC 2K89A 2F93B 5LA6A 1KBUA 3CCMV 1H8HG 5G5HA 4R50A 4JAUA 3C1ZA 4UFZA 3LWLA 4DOBA 3C29A 2Y0SF 8ICAA 3G6VA 2W11A 7ICMA 1HNWO 2IHNA 1O9HA 4CZZA 1KU9A 4JV5O 5J0YA 2UUCO 3ZRXA 4JMUA 5KFOA 4BWAA 4JF3A 1ZQUA 2PXIA 5E1AC 4EZ6A 3R66A 4WFBV 4PHAA 2R8JA 2XY5A 1QSYA 4TUPA 1ZQZA 2NRVA 4P30A 1YITV 4CNQA 4UBCA 4DL3A 1AI7A 4QIWC 2JMGA 5HHHA 2R70A 2KG7B 3UO2A 1FFTB 3B9JA 4FPPA 2CTWA 3RH5A 1KN5A 3F5AA 3BRCA 2B1IA 2OWOA 1RM1C 1B0XA 5CP2A 5ALVA 3G6YA 4MVMA 2VJ4A 4P2ZA 3UMGA 2JHDA 4KFMA 4DV1B 3JAWB 2I6XA 5KAIU 2HCFA 1BL8A 4DUYB
chains in the Genus database with same CATH topology
4RUFA 3ALRA 1NJIW 1J95A 2F43G 4PA6A 4UXNA 2ZXIA 3AQEA 1NBMG 2DYRB 4EKWA 5C0YA 4RQFA 2XAQA 3LVVA 2MK3A 2OTLV 1M90W 3P30A 4FJCC 4X8AA 1NQTA 3OFNG 4MVUA 3F5EA 2NLJC 2IJJA 4NV0A 3WG7B 3CCRV 3RW0A 4CDGA 3F7YC 3IG5A 2KNJA 3ASNB 2LHTA 2ZIXA 2C2AA 2ITDC 4JGSA 2BOBC 3H0LB 1OHHG 3AG3B 1MABG 4PL2A 1SZHA 3SAGA 5KA5A 2GSMB 2Q4TA 4HZ3A 2W03A 1PNLA 2HJFC 3E0FA 4GX2A 4MVQA 4LP8A 1QCEA 2KD1A 3CP1A 3ASOB 3M6ZA 3F7VC 2ZXHA 4BJQA 2DQ0A 2KIWA 3F53A 3SYAA 1K5QA 4JPRA 3IN5A 2A79B 1ZQ1C 3IG8A 1K5SA 3NXSA 2JIZG 1F51A 1V54B 3FYIB 1Q86W 1R3JC 2WLLB 2YB4A 2ZR2A 4WCEV 3MGVA 1Q7YW 3OPXA 1H8EG 2Q69A 1JQ0A 2XI9A 3SYPA 5LHIA 1IXMA 3OEHG 2EIMC 3M6KA 2DF4B 1D8BA 1S5HC 1K92A 2XAFA 5H9CA 2IH1C 5EBMC 2K8BB 4G28B 4U7CA 2EBOA 2HOQA 2K1EA 4FZNA 2NV3A 1OCCC 4RAIA 1YJ9V 2X6AA 1NKDA 5A0LA 1Q81W 1DF5A 2RHFA 3GU3A 3ZCCA 3GB7C 3K06A 3L3FX 1Z1BA 1M56B 2WLIA 3FB5C 1PVQA 4ASUG 1DTOA 2G5IB 4RQEA 1VQLV 3K9AA 3D36A 2IU3A 2DGZA 2W7PA 3K03A 2D6FC 1QLEB 2JJ2G 5B1AB 4U7OA 4P0PB 2H8PC 5EBWC 2W7OA 2A9HA 1P7BA 4WFEA 4XDLA 3ABUA 1K97A 2ITCC 4GX1A 3ETEA 4ZBMA 1L6NA 2K4IA 3N7RC 2R18A 2EZOA 1KD1W 3EFFK 1L1FA 1PKXA 2ZIUA 3LDDA 3LSQA 4PA7A 3SYOA 2F76X 2KJ8A 5CBGA 1VQ8V 1QVFU 3CYOA 1EBOA 1QBZA 5EC1C 3CMEV 2XAHA 3X2QB 5IY5B 4BUGA 4PDLA 3G71V 3LDCA 4MVOA 1M57B 3M99B 2HLDG 1VQ7V 4QE9A 5L3FA 3PZPA 1TUEB 2EZPA 4KUMA 2VIXA 2ZG6A 3ICXA 2ZIWB 3AQFA 1E1QG 4GX5A 3ZRWA 5LGNA 1F23A 3FB8C 1CPYA 2EILB 3JYCA 3MD0A 3W7XA 2DYSB 2ZXWB 3SPHA 3FKSG 1PVPA 2IJIA 3LUTB 4PDRA 4UV8A 2KEYA 1W0KG 4GCZA 1K7DA 3ZRSA 2LFRA 3AG1B 3N7SC 4JAVA 3ZMTA 2GHYA 3O0FA 1MA7A 4WF9V 2YX8A 2OCCB 1S0VA 3MHHC 4U7NA 2W0FC 3OW2U 2EJRA 3ABLC 3OR6C 2K8CB 2G06A 4MTFA 2Y48A 1T94A 5LBQA 3ZMUA 3JD4A 3E8FA 2DWEC 2KVCA 1M9NA 1K33A 1NVPB 4OXSA 4KX5A 5KUMA 1AI5A 1NR1A 2GOLA 3NUQA 1G4YB 1KECA 4ZKIA 2W6IG 2OYYA 1MG1A 2EIJB 2ZIVA 2WPDG 1K3EA 1BHAA 2H3ZA 1YHQV 1V55C 3H01A 2KKVA 2B1GA 1PD3A 4OJLA 3E8BA 4QJFB 2M7WA 1NH2B 3ZMZA 2F2AB 4OJOA 2JJ1G 2V1DA 1S76D 1GK9A 4JYCA 4JTDB 3ETGA 2Y0SC 2ZDIC 3AG4C 1CEZA 2F8LA 2XIDA 1PNKA 1PVRA 1K4DC 1R6NA 3WFVA 1FXKB 4LCUC 5CBFA 3K1ZA 1SESA 2EIJC 2WLHA 2KHVA 3T2MA 5IYCO 1UJWB 3ETDA 5KL1B 1AROP 4BIZA 2CN1A 1OCRB 4MVZA 4TSFG 4WFAV 2F77X 4MW3A 2CRXA 4XDKA 1KP3A 2XAJA 4MTOA 1SERA 3CCQV 3E8HA 1Y4MA 4PA9A 5B1NA 1DRGA 2OM6A 3W7UA 1RPRA 2DYRC 4L87A 1KKDA 4N23A 2HMXA 1QR9A 4RO2A 3VOUA 1GO3F 4NLBA 4U6PA 4PDVA 2CK3G 3OMIB 3WG7C 1NVPD 3B8NA 1PL0A 3OAAG 3LVWA 2PMZF 1YI2V 3ASNC 3F2DA 3RVYA 4MTGA 2IH3C 2HVJC 2Z3YA 4UVBA 2X7RB 3B8MA 2ZIXB 1B6QA 3QO5A 2UXNA 4XBFA 3AG3C 1YSCA 5CMUA 2RP5A 3A0RA 2RRDA 3CXCU 2MRLA 1K73W 2H94A 1P7DA 5EC2C 2N1RA 1JCHA 1THZA 2ATKC 3PJSK 1NH2D 3N7PD 2Z5UA 3VCBA 3HKZF 2P90A 5B1BB 3W7SA 3OUFA 2E1FA 4FZMA 4BX9C 1OZ0A 3ASOC 1ED1A 2WAQF 3EHBB 4O3MA 2UXXA 3D2QA 4RUEA 1VQ9V 2Z7JA 1FXHA 3VBBA 1YIJV 1QLNA 2VKQA 3SPJA 4QNLA 1K9MW 1OUQA 1V54C 1YJNV 1GTOA 1ORQC 4G2KA 2KJ5A 3CP8A 2QKSA 3GWOA 3R65A 4UUJC 3QNEA 1H38A 2E1EA 3SYQA 2Y69B 1OCOB 1G8MA 4NWIA 5L3DA 3OR7C 2K8AA 3JD0A 1YJWV 2KV2A 1S3JA 3DGEA 3SPCA 1YTFB 1Q3VA 4P0QA 5KL8B 1GM9A 1Y66A 3CCLV 2QM8A 2R9IA 2XICA 2P67A 2WB1F 5L3BA 3H0RB 1NZBA 4AYBF 3E86A 2X6CA 3KG2A 4FK5C 2EINB 2X6BA 2JK5C 2KB1A 1M56C 2KHQA 3HPLC 2QEXV 4PELA 2OH2A 2ZD9A 4X88A 2HG5C 5DN6G 1IIPA 1ECWA 2WLIB 2KICA 3PSFA 3C28A 1EFRG 4LC1A 2WAMA 1JOYA 5T14A 4FE3A 4CGZA 1QLEC 3JD3A 4G27B 4MSWC 4P9OA 4R8CA 2XOKG 5B1AC 3STZC 4F4LA 1MSWD 3GZFA 3OGCC 2G5HB 3IP4B 5IYBO 2DQ3A 1AI6A 3E83A 1MOFA 1AR1B 1AJQA 2BDUA 3FB6C 4ICAA 2H3FA 3UKMA 5LGTA 2H3QA 4QIWF 3ZRVA 2VJ5A 3BEHA 3FB7C 2ZIUB 1M1KW 1QVGU 2DW4A 4DXWA 3X2QC 5IY5C 1QR8A 1BMFG 3K0DA 3K79A 4LBEC 2ZDIA 1FXVA 1M57C 2K4EA 2A3VA 3IFXA 2XAGA 3JCZA 1R3IC 4YXWG 3G4SV 1JPXA 3W7WA 2LP7A 3LDEA 2YB1A 2HBLA 2EILC 3ZRWB 3CRXA 2W04A 2DYSC 2ZXWC 4BAYA 3CCSV 3ZN0A 2IJKA 1KP2A 1VQ5V 1BHBA 1R3KC 2IJHA 1WPXA 2YEVA 5FL7G 3AG1C 3ZJZA 3CMAV 4I5SA 3SAHA 2OCCC 1GM7A 2QTOA 4WFGA 2P7TC 3HB3B 3ZMVA 1GKFA 1H2GA 2P6JA 1GM8A 1K4CC 2KJ9A 1DF4A 2QM7A 2G09A 4MVRA 5LHHA 1XL6A 2G0AA 2HBMA 1GMGA 2PI4A 3OEEG 3D3IA 5IDJA 3CCVV 2QA4V 3PSIA 4MTXA 2Q6AA 4PDMA 5H6RA 1N8RW 2WLKA 3SPIA 1AJNA 2ZQMA 3STLC 3AL0B 2HBJA 2G08A 4XDJA 3CPWU 2ZIVB 2BOCC 4QE7A 3VC8A 3SAFA 4WJ3B 1Z19A 2WWWA 5C93A 3ABKB 5L3CA 2EIKB 5H6QA 5EK0A 1VQ4V 4NLCA 2KOBA 2ZR3A 4JTAB 3OUSA 4QPKA 2LYAA 2M0NA 2XVTA 2HR3A 1NR7A 4TWKA 2HVKC 5HFLA 3RBZA 4Z1MG 3E89A 3CYMA 3CCEV 5L3EA 4WFHA 1FXKC 4ACOA 4JASA 3F5WC 5EBLC 5B1OA 3W7TA 2CPRA 1SETA 3TK1A 1Q82W 2WLLA 3AEIA 2E5SA 4JYBA 1OCRC 3KFUF 4I9WA 1W2BU 1AI4A 2H3VA 1JX9A 1R73A 1HIWA 3ABKC 3QO7A 1URJA 2MA1A 4KMOB 2EIKC 5CBHA 1WUDA 2WSSG 3TCUA 1JJ2U 2JEXA 3ABTA 1EZJA 1K34A 2EIMB 2AHYA 1COWG 3LSSA 3B77A 2WLMA 4GX0A 4A8EA 3IGAC 3ML0A 3OM3B 3OMAB 1AJPA 2HKOA 2HOIA 3MHSC 1HEKA 3SYCA 3AG2B 1OCCB 3SPGA 3ONNA 4KX3A 2LBOA 1I5XA 2DWDC 2WLNA 5J9PC 1P4RA 3JD1A 2HOFA 4PL1A 3E2EA 2JH1A 5IYDO 1S77D 2X0LA 1E1RG 3SJQC 4IC9A 1R6KA 5CA3A 3PSTA 5KA6A 1LNQA 4MT8A 2PMZC 4FZLA 3RFAA 4DO2A 4P0PA 3ZMSA 1CRXA 5L3GA 4QNHB 5LHGA 2H3IA 1SRYA 3OE7G 5B1BC 2YEVB 1TAMA 1DLBA 1ZWIC 1KQSU 1SZTA 1E79G 2B5UA 1XO0A 3AG2C 3OMNB 3LNMB 2GH1A 4MS2A 5LGUA 1FS0G 3D2SA 4Q20A 2A0LA 2D3OW 1ENVA 2JEUA 3HKZC 2LKYA 3SQIA 1RPOA 3K3WA 4N21A 5B3SB 5HFMA 2FTKA 3ABMB 4PA3A 5KUKA 3E35A 3I55V 1S72V 4CRXA 2Y69C 1OCOC 1OCZB 2WAQC 4OJ6A 3T79A 2HFEC 2R9RB 1ROPA 2ZIWA 1HWYA 4FIPC 3ZN1A 3CC7V 1F4MA 3IC7A 4CBCA 4UVAA 4WFFA 3T1CA 4MVSA 2PI5A 2NNUA 4OO1J 4P0QB 4OJPA 2OT5A 1VQPV 2JGAA 4BIUA 1VQNV 4MW8A 1VQMV 2EINC 5CRXA 4J9ZB 4C0ZA 4J9YB 3DTUB 4E2LA 1CP9A 3DEEA 2WLJA 3G6EV 4R7CA 3TETA 5HR6A 2LFSA 2Q67A 5B3SC 2QE7G 3NRWA 2W6JG 3H0MB 3ABMC 1A0PA 3T4DA 4TT3G 3F2BA 1OCZC 3ABLB 1VQ6V 2WB1C 1PNMA 4AYBC 1WLEA 2K89A 3PSPA 1KBUA 3KZXA 3CCMV 1H8HG 1YT3A 2KKPA 1F4NA 4PA4A 4R50A 1KC8W 2OXOA 3I56V 4JAUA 3D2NA 1W0JG 3F2CA 4UVCA 2IW5A 4GFJA 1I5YA 4BW5A 1K8AW 1YTFD 4QPJA 3C29A 1RM1B 2Y0SF 3FYEB 3CD6V 2V7QG 3RVZA 3CC4V 5HR7A 1V55B 4HYOA 4H33A 4CZZA 3E8GA 4X89A 3CCUV 2HBKA 4H37A 4P9PA 3ZRXA 4JMUA 3M7DA 2OTJV 4JF3A 4JTCB 2JH7A 5CN0A 3RF9A 5E1AC 4WFBV 1Q3UA 2Q68A 2XNDG 3JD2A 4HAMA 2G07A 1A6SA 4KP4A 4P30A 3AG4B 1F44A 1FXKA 2YSUB 4FMTA 1YITV 1XL4A 3K08A 4UV9A 1AI7A 4QIWC 2JMGA 3QO8A 5DM6V 2IU0A 3CCJV 1VQOV 2K4HA 3P32A 1UPHA 1JVMA 1FFTB 4FPPA 2LYBA 4R6ZA 3BY6A 3T4ZA 1VQKV 3K0GA 3F5AA 5BZBA 2B1IA 3LYSA 1RM1C 5GW7A 3ZIAG 4MVMA 2VJ4A 4P2ZA 2AHZA 1XNSA 2DQNB 2JHDA 3SMVA 4KFMA 4OJ5A 3UM7A 2XASA 3K04A 2JDIG 1BL8A 4GT1A 3CC2V 1R3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJF B;  3SAH A;  4NLC A;  2E1F A;  2HBK A;  4QIW F;  5C0Y A;  4O3M A;  1GO3 F;  4NLB A;  3CYM A;  2HBM A;  2RHF A;  2CPR A;  4CDG A;  1YT3 A;  2E1E A;  4CGZ A;  2DGZ A;  2HBL A;  2HBJ A;  2RRD A;  2KV2 A;  2MA1 A;  3SAG A;  3SAF A;  1WUD A;  1D8B A;  4OO1 J; 
#chains in the Genus database with same CATH topology
 4L8J A;  1NJI W;  2EZY A;  4J80 A;  2BPC A;  2F43 G;  4PA6 A;  2KSO B;  4UXN A;  1ZQG A;  2XGP A;  3L70 H;  4ZI7 B;  4Z2W A;  2XAQ A;  3NGD A;  3LVV A;  4IRK A;  2MK3 A;  5KFE A;  4QZB A;  4I2B A;  2OTL V;  3P30 A;  2HP8 A;  1H2M A;  4X8A A;  1NQT A;  4MVU A;  4NV0 A;  1ZD2 P;  1BPZ A;  3RW0 A;  2P35 A;  1QQC A;  3ED5 A;  3F7Y C;  3IG5 A;  2NRT A;  5BMV B;  1BPE A;  2OYQ A;  2BOB C;  5J0P A;  3FDS A;  5DDM A;  1K1Q A;  1VP7 A;  3SEI A;  4F5Q A;  1ZQF A;  4X20 A;  4HZ3 A;  3BVO A;  3HT3 A;  3H1H H;  2PGG A;  2BTQ A;  5DG9 A;  3T5K A;  5HP4 A;  2HJF C;  3UT5 B;  4KN7 A;  2WF8 A;  3HX0 A;  1QCE A;  5DQH A;  3CP1 A;  2B21 A;  1US6 A;  4UB3 A;  5EZY A;  1W59 A;  3F53 A;  3SYA A;  1LR1 A;  4DL7 A;  5IE9 A;  3IN5 A;  4YXJ A;  4NL9 C;  5KFP A;  1K5S A;  2LMR A;  2YQE A;  2FMS A;  2JIZ G;  1KDH A;  3TAR A;  1V54 B;  3SDL A;  4DR3 B;  1R3J C;  4DV3 B;  5J2B A;  4J9R A;  2JRZ A;  5KFZ A;  4UB4 A;  4TQR A;  2Q69 A;  1IXM A;  1BGY H;  4YMM A;  2EIM C;  3JPQ A;  2DF4 B;  1D8B A;  1S5H C;  1K92 A;  5GTH Z;  4E4E A;  2IH1 C;  1J2M A;  1TK8 A;  4Y2J A;  1JFF B;  3S3W A;  5EBM C;  4A5U B;  1L7O A;  4R8U B;  2K8B B;  2FLN A;  3HKC B;  4G28 B;  2EBO A;  5H5N A;  2K1E A;  5AK3 A;  2NV3 A;  2HHT A;  3G6X A;  1U4B A;  1YJ9 V;  3QG5 A;  1F7Y A;  4XA5 A;  1V85 A;  1Z2G A;  2VRZ A;  5J2K A;  4BIO A;  2RHF A;  3GU3 A;  3O9O A;  3KOO A;  3ZCC A;  2Q7G A;  1M56 B;  3K4G A;  2WLI A;  2JEF A;  3QUB A;  4RQE A;  2NR5 A;  3ZHV A;  4QZI A;  4JZ2 A;  3D36 A;  2UVR A;  4DR7 O;  3K03 A;  2AZ0 A;  1SWV A;  1QLE B;  5AG2 A;  1ZTE A;  1PK3 A;  5JCO A;  2LYH A;  3LWM A;  2A9H A;  1P7B A;  2PFO A;  1K97 A;  3K59 A;  1Q6I A;  4KN4 A;  4O3S A;  2R18 A;  1KD1 W;  1KFT A;  2NO5 A;  2FMP A;  1K5O A;  4I4T B;  4PGX A;  4QZ8 A;  1VQ8 V;  5EC1 C;  2R8K A;  1FFV A;  2IOF K;  9ICN A;  3JAR B;  5J2G A;  1HUO A;  5LMN B;  2KP7 A;  4MFF A;  1V38 A;  3GFK B;  2QM4 A;  1BS3 A;  2NRX A;  4J9S A;  3M99 B;  2HLD G;  4QE9 A;  3HKE A;  3PZP A;  1UA1 A;  3GIJ A;  3EWA A;  3HKB B;  4GX5 A;  4I2G A;  5LGN A;  1PPJ H;  4YJ2 B;  3B0X A;  4YR0 A;  4ED1 A;  5EWF A;  2EIL B;  3BCC H;  2DYS B;  2PUS A;  2ZXW B;  2F3N A;  3Q4H B;  4UV8 A;  2KEY A;  2YIA A;  1K7D A;  3ZRS A;  3CRA A;  3AG1 B;  3ZMT A;  1TE2 A;  4Y2X A;  4C4T A;  3O0F A;  2HHU A;  2DPI A;  2OCC B;  4LF8 O;  3MFH A;  5FNV A;  3WK8 A;  1Q5O A;  2AXT Z;  2Y48 A;  1T94 A;  5LBQ A;  3QEB Z;  4WBN B;  4I2H A;  2KVC A;  1RYU A;  4NVP A;  4IL6 Z;  4F6R B;  1NVP B;  4BW9 A;  5KUM A;  5AI5 A;  4I50 B;  4TUY B;  2ISO A;  4FLZ A;  3P3P A;  5KFH A;  2VQE O;  1KEC A;  1X9M A;  4ECQ A;  2OYY A;  4Y2Q A;  5D4B A;  1MG1 A;  5KG3 A;  4JYA B;  2UVU A;  1K3E A;  1V55 C;  2J6S A;  3MR3 A;  2RN9 A;  2B1G A;  2HDO A;  1Z4O A;  4QJF B;  4X9Q A;  4X64 O;  3RYC B;  3ZMZ A;  2MAX A;  1TVK B;  3J80 N;  4UAW A;  4PGQ A;  2UUB O;  1NI3 A;  2HHW A;  8ICF A;  5EYP A;  3VQW A;  5F3X B;  2ZDI C;  1NU1 H;  1R1B A;  5GON A;  3WFV A;  5IYZ A;  5CBF A;  4JI8 O;  2ZTC A;  2Q8V A;  4YMO A;  5IYC O;  3AM9 A;  5KT5 A;  4KLL A;  5KT3 A;  2CN1 A;  1OCR B;  5KFV A;  4BXO A;  1L8D A;  4WFA V;  1SB3 C;  2F77 X;  3B0Y A;  2HHH O;  3M9N B;  3E8H A;  1Y4M A;  1SER A;  1VIB A;  5B1N A;  3I28 A;  4ECR A;  4UCU A;  2OM6 A;  4GZR B;  3SGI A;  1RPR A;  4L87 A;  3BQT A;  2KFN A;  1WA8 A;  5AK6 A;  4J9L A;  2FB5 A;  3CRR A;  8ICE A;  4EEK A;  2FL4 A;  4PDV A;  1VDV A;  4EEY A;  1Q90 D;  2WA4 A;  3OAA G;  1YI2 V;  3F2D A;  1D9D A;  1I7F A;  1RSO A;  1FPO A;  2HVJ C;  2P06 A;  4B3M O;  1S0O A;  2BPG A;  3JPP A;  2E3C A;  2OEH A;  2Y1I A;  3AG3 C;  3A0B Z;  4RUC A;  4CS4 A;  5GTH U;  4K4I A;  2RRD A;  8ICC A;  2MRL A;  1K73 W;  1BQZ A;  4YFK A;  5EC2 C;  4I2C A;  3GIK A;  1NH2 D;  3N7P D;  2KMD A;  3VCB A;  2P90 A;  2VWK A;  5DED A;  2WA3 A;  3OUF A;  2BCR A;  2QJ1 A;  4KLU A;  3KTQ A;  3MBY A;  4RUE A;  2FJ6 A;  4FZ1 A;  3QU9 A;  3VBB A;  5KFL A;  1NK7 A;  3JAL B;  4XRH A;  2FYU H;  3SPJ A;  4FLV A;  4QNL A;  2FPK A;  1YJN V;  3WU2 Z;  3RRH A;  4YXM A;  4UB8 Z;  2KJ5 A;  3CP8 A;  2JR5 A;  9ICE A;  4JI1 O;  4O5K A;  2CXY A;  1M93 A;  3SYQ A;  4NWI A;  3WB1 A;  5CB1 A;  3UQ2 A;  4K4G A;  3OR7 C;  4LF9 O;  5IIJ A;  3FM9 A;  5LXT A;  2RMK B;  2ZUC A;  1QQ6 A;  2KV2 A;  1ZQR A;  2Y0P A;  3K1R B;  5KL8 B;  4ECU A;  7ICH A;  1YZ6 A;  2QB0 B;  1NTZ H;  2E8P A;  2P67 A;  5C8Y B;  3H0R B;  2JEJ A;  3C2K A;  3EW9 A;  5AI0 A;  1XRE A;  2F4V O;  4C8M A;  3KCX A;  1VF6 A;  4NXN B;  1HNW B;  3PR4 A;  4KLM A;  2X6B A;  2UUC B;  5KFU A;  4B9T A;  4I2A A;  2KB1 A;  1NJX A;  1ZRN A;  2NYV A;  4UCS A;  2KKW A;  2ZD9 A;  2KE7 A;  3OSN A;  5DN6 G;  4X66 O;  1QCK A;  5BOM A;  5JH7 B;  1EFR G;  3FAH A;  4YIO A;  2WAM A;  3ZBH A;  4FE3 A;  3SR2 C;  4R8C A;  3STZ C;  3Q8P B;  1N36 B;  1IBL B;  1NK6 A;  3OGC C;  1VF7 A;  1SQQ H;  3C1Y A;  3IP4 B;  4UAY A;  1ZQM A;  2O57 A;  5G5G A;  3M7M X;  1AI6 A;  3E83 A;  4O5C A;  1TAE A;  3FAV B;  5CA1 B;  2ZKO A;  1DGS A;  2HEP A;  1T5E A;  1AJQ A;  1X6J A;  4KHP O;  1CI4 A;  4DR1 O;  2AJQ A;  3UKM A;  5LGT A;  3Q8R B;  2QSA A;  3BEH A;  1ZD5 A;  2AXT U;  2ZIU B;  5B66 Z;  5III A;  3K0D A;  2ETN A;  1J2N A;  4K35 A;  4BWM A;  2XC9 A;  3K79 A;  4IL6 U;  5H2F Z;  4F92 B;  4DSE A;  4FFB A;  1R3I C;  2QDO A;  1XU4 A;  3G4S V;  5L1K A;  4C7Z A;  1NK5 A;  4ED7 A;  3DXR B;  1QQ7 A;  2W04 A;  3CRX A;  5L1L A;  3CCS V;  3RJK A;  4O9M A;  4ZOL B;  1KP2 A;  1VQ5 V;  4J42 A;  2IJH A;  2YXY A;  4DQQ A;  4JV0 A;  5FL7 G;  3CMA V;  2RJZ A;  4I5S A;  5EE1 A;  1GM7 A;  4WFG A;  2P7T C;  4ABM A;  4EFE A;  2F1H A;  1K4C C;  5JWP A;  1S0M A;  1JXL A;  2IM9 A;  2UXD O;  3LDA A;  1BPB A;  2HBM A;  3ZX6 A;  1I94 O;  2PI4 A;  5DQG A;  1Y6X A;  4EBD A;  4F5N A;  3BHP A;  1ZQA A;  4O4I B;  1N8R W;  3U11 A;  4Z6F A;  4I29 A;  2RQ6 A;  2IHM A;  3V7L A;  2I1Q A;  4XDJ A;  3MDC A;  2ZCE A;  2ZIV B;  4ZOH C;  1XIL A;  2BOC C;  3RYH A;  1XMO B;  1COK A;  4F3O A;  2VS0 A;  4HNA B;  1K1S A;  2A19 A;  4M9L A;  5EK0 A;  5H6Q A;  3MC1 A;  4JTA B;  4KLG A;  2LYA A;  2HR3 A;  2HVK C;  4Z1M G;  2H3O A;  4I2J A;  5EE3 A;  1YVW A;  2RQ5 A;  4WFH A;  4JAS A;  5B1O A;  4DLE A;  5J0T A;  4KLD A;  1Q82 W;  3A0B U;  2E5S A;  4I9W A;  1NZP A;  2BR0 A;  3KFU F;  9ICQ A;  1BPY A;  2ATL A;  3PVX A;  3SV4 A;  4BR6 A;  4DV1 O;  2RDJ A;  1SQX H;  3T5H A;  2OCE A;  5DLG A;  5DLF A;  5CBH A;  2MA1 A;  4F4K A;  3IJ4 A;  1RYS A;  3N4M B;  5JTI A;  1EZJ A;  2JS5 A;  1V97 A;  3V6H A;  4DR7 B;  2AHY A;  4M6W A;  1WCL A;  7ICU A;  4X1Y B;  1EN4 A;  1COW G;  5J2I A;  3ISC A;  2ZE7 A;  5DG7 A;  3BZC A;  7ICR A;  1WJZ A;  1AJP A;  3OMA B;  1WN7 A;  1OCC B;  3GQC A;  5F9L A;  3WU2 U;  2BQ3 A;  3RJI A;  1SC5 B;  2DWD C;  4UB8 U;  2F1J A;  3D8C A;  4DSF A;  2XUM A;  3LNN A;  2JH1 A;  1S77 D;  2Y4U A;  4TOI A;  5IYD O;  2X0L A;  3EXA A;  1R6K A;  5DBC A;  4K8Z A;  1BNO A;  5CA3 A;  2QLT A;  1SGG A;  1LNQ A;  4LF4 O;  4UB2 A;  3QU5 A;  4IR1 A;  1WYG A;  4DO2 A;  2LGQ A;  5J0U A;  5JQG A;  2ZE6 A;  5J2U B;  4I2D A;  2HHX A;  2AW9 A;  5B1B C;  3BAA A;  1TAM A;  4QW8 A;  3WB0 A;  4DR4 B;  3L74 H;  1XO0 A;  3AG2 C;  2XHB A;  1ZRM A;  2YY6 A;  3K75 D;  4B9U A;  2QKC A;  2ISP A;  1L7M A;  1WB8 A;  1KKX A;  1FS0 G;  4Q20 A;  3OHA A;  1WCN A;  2A0L A;  4P4O A;  1Z5W A;  3HKZ C;  2LKY A;  3K3W A;  5B3S B;  8ICJ A;  1X9X A;  2FTK A;  1YCI A;  3E22 B;  4DV3 O;  4DYL A;  5AI8 A;  3SI8 A;  4P4M A;  1KB9 F;  1OCO C;  2WAQ C;  7ICI A;  2CTQ A;  4LNU A;  1RXV A;  2JS3 A;  3T79 A;  4DF4 A;  2R9R B;  4I9Q A;  5AI9 A;  4DV0 O;  2QAR A;  3ISD A;  1H2S B;  3IC7 A;  3EPG A;  5KHJ A;  2VQE B;  3UMB A;  1Q3E A;  5AK5 A;  7ICP A;  4MVS A;  3KHL A;  4OJP A;  1N56 A;  2P4V A;  3BAB A;  1VQP V;  4LWS B;  4Q8E A;  2HHV A;  2B0C A;  2EIN C;  4J9Z B;  4BWJ A;  3AU2 A;  1MSD A;  5B66 U;  5FLX N;  4KLE A;  3AMZ A;  3DEE A;  2WLJ A;  2Q67 A;  3H9V A;  1L0N H;  3APQ A;  4X64 B;  2ADQ B;  1A0P A;  4F4W A;  5DEC A;  4MFA A;  3T4D A;  2GLE A;  3F2B A;  3Q8S B;  3PY8 A;  1OCZ C;  2E75 B;  3ABL B;  1VJ5 A;  4DV5 O;  2UUB B;  4TUQ A;  9ICF A;  3JAT A;  3PSP A;  1XNQ O;  3KZX A;  4JYY A;  3D36 C;  1KC8 W;  2A1J B;  4PA4 A;  2C2D A;  2OXO A;  4YMN A;  3A2F A;  3NAS A;  4KTQ A;  3I56 V;  3CHX A;  4MF8 A;  1FD9 A;  3GVM A;  2ZUD A;  3F2C A;  4JI8 B;  5JCO C;  1Z1V A;  4PHD A;  2A3Q A;  5AKZ A;  1QQ5 A;  3GIL A;  5JJN B;  3QTC A;  1BSM A;  3F5T A;  2BSK A;  4HYO A;  2HHH B;  4NTY A;  1X59 A;  3MFI A;  3CCU V;  1ZL8 A;  2HBK A;  8ICS A;  4P9P A;  1KBH A;  4RNM A;  3IM1 A;  2OTJ V;  4JTC B;  1NK9 A;  5CN0 A;  3RF9 A;  3V6J A;  3Q8Q B;  2XND G;  3JD2 A;  1TKD A;  3QU7 A;  5ALD A;  1A6S A;  1BPX A;  1FXK A;  4FMT A;  5DM6 V;  3QO8 A;  2IU0 A;  3CCJ V;  1UPH A;  2FPL A;  4R6Z A;  3H40 A;  4DRX B;  2DPJ A;  4TUS A;  9ICW A;  4MEY A;  2JZB A;  2RDI A;  1N34 O;  1VMG A;  5GW7 A;  4K0K O;  1A32 A;  3FYH A;  2AHZ A;  4J9P A;  3JPO A;  3UM7 A;  1HNZ O;  2XAS A;  3K04 A;  2JDI G;  4RUF A;  4R63 A;  2KFZ A;  2Y9U A;  2GTA A;  1N63 A;  2DWQ A;  5AHX A;  3RJE A;  4LH6 A;  4RQF A;  5AKE A;  4EEL A;  4RPX A;  4Q6G A;  1FO4 A;  4YR2 A;  4CCH A;  2ASL A;  1IZ3 A;  1M90 W;  3MR2 A;  4FJC C;  1VQL V;  3RJJ A;  2NLJ C;  1S97 A;  4CDG A;  4DQP A;  1XMQ O;  2RNB A;  1AVM A;  2PFN A;  2C2A A;  1TFR A;  4KLS A;  1X9W A;  1JI7 A;  5L1I A;  3TI0 A;  1SKS A;  4F5P A;  5EWE A;  4RQ4 A;  2V9W A;  4J10 A;  4JI1 B;  4LF6 O;  1QU7 A;  1H2L A;  1HJP A;  2Q4T A;  1SQP H;  4TQS A;  4EYI B;  8ICN A;  4GX2 A;  1N4C A;  4NYK A;  3UCS C;  1QSL A;  2ASD A;  4X1I B;  3ASO B;  4UQG A;  3M6Z A;  3F7V C;  3OT7 A;  2ZXH A;  4BDP A;  9ICV A;  2KIW A;  2WF6 A;  3BDP A;  1HNX O;  1K5Q A;  1LUV A;  3K57 A;  2GO7 A;  1N60 A;  1Z3E B;  5KG5 A;  5IIN A;  1ZQ1 C;  3IG8 A;  2I9G A;  4JPR A;  5KG6 A;  3UQ8 A;  4B3T B;  2DFL A;  4FM0 A;  3M1Y A;  4M04 A;  3BS5 A;  5IIM A;  3MGV A;  2Q7H A;  1ZQX A;  5BY1 A;  2WF9 A;  1Q7Y W;  4LF7 B;  1B3Q A;  3OPX A;  1MMM A;  4X66 B;  2XI9 A;  3SYP A;  3EPI A;  5LHI A;  5L1M A;  5KG0 A;  1NS1 A;  3L5K A;  3M6K A;  1IDS A;  3BPZ A;  4TUR A;  2VWJ A;  2E8M A;  2N04 A;  1BQ0 A;  2CH7 A;  4YHH B;  3CSX A;  4FZN A;  2HVH A;  5C5J A;  4KHP B;  2QWN B;  4CH6 A;  1DF5 A;  3ETR A;  1L7P A;  1N2X A;  4F93 B;  4QW9 A;  3AG7 A;  3GB7 C;  2MUT B;  1Z1B A;  4QZA A;  4ASU G;  2G5I B;  4UB1 A;  4JK1 A;  1B06 A;  4UAV A;  4JV2 A;  3J81 j;  3DV9 A;  1JRP A;  4RPY A;  3RR8 A;  4PHE A;  3ABU A;  2ITC C;  1N5X A;  2P22 C;  4GX1 A;  3N7R C;  5DQI A;  5KFW A;  3EFF K;  5IJ0 B;  3AK3 A;  3ZI4 A;  2W3R A;  4QWC A;  1PKX A;  3LDD A;  3LSQ A;  2F76 X;  4ED8 A;  4IHJ A;  5CBG A;  1XC9 A;  4JI7 O;  1KKC A;  1QVF U;  1AB3 A;  1ZQK A;  3X2Q B;  5IY5 B;  4KMU A;  4PDL A;  3MR6 A;  3APO A;  3G71 V;  4MVO A;  3NTU A;  4H44 B;  1L3T A;  4IR9 A;  1AP6 A;  4O2B A;  2A7W A;  1I94 B;  3AK2 A;  3B40 A;  1TUE B;  3KCY A;  3QUQ A;  2YML A;  2VIX A;  4EB6 A;  5AKY A;  3AQF A;  3SV3 A;  3ZRW A;  4KLI A;  4J7Z A;  4KLQ A;  2W9M A;  4F71 A;  3JYC A;  1CPY A;  4GIB A;  4C7Y A;  4I0X B;  9ICJ A;  4C8L A;  3SPH A;  4B9N A;  4PDR A;  3RR7 A;  2JGD B;  9ICM A;  1D5N A;  4Z6C A;  3QVN A;  3TXS A;  9ICH A;  4GCZ A;  2GWS A;  2LFR A;  4NXN O;  3EZ5 A;  2BQR A;  2FLP A;  1VF6 C;  1JN3 A;  2CGO A;  2FML A;  4JAV A;  1MA7 A;  1S0V A;  1I0H A;  3OW2 U;  2EJR A;  2YMM A;  2R8H A;  3IV6 A;  9ICP A;  2ODM A;  3NR7 A;  5KT2 A;  1YEW A;  4MTF A;  3CRC A;  4ZHQ A;  1FYJ A;  4PI0 A;  3E8F A;  2R8I A;  1EN5 A;  3TAD A;  4DFM A;  4KX5 A;  1N36 O;  4RQ2 A;  1B04 A;  1GH6 A;  2DE0 X;  1IBL O;  1G4Y B;  4ZKI A;  2DBY A;  2W6I G;  1O03 A;  5IWA B;  4DW1 A;  3CX5 F;  2EIJ B;  2C2R A;  2LO1 A;  2YS8 A;  2WFA A;  4ELU A;  1NT2 B;  4DOA A;  5LP6 B;  3PW0 A;  1BHA A;  1N48 A;  4Z1V A;  5DBB A;  3PW7 A;  1PD3 A;  1MZF A;  1JJO A;  3PML A;  4Y2V A;  1NH2 B;  4OJO A;  5D5P A;  2YID A;  1GK9 A;  4DS4 A;  4JYC A;  5JVD A;  2XGQ A;  2XCP A;  1MN8 A;  3HKD A;  1RZT A;  3ETG A;  2Y0S C;  2Y0I A;  3AG4 C;  1CEZ A;  2F8L A;  3UM9 A;  2IBK A;  3DSQ A;  1PNK A;  2UUA O;  3THO A;  1LKY B;  2BHN A;  1U97 A;  4LCU C;  4FM1 A;  3FX7 A;  5KFT A;  4JWN A;  2KHV A;  3ETD A;  4O2A B;  4DW0 A;  1AP5 A;  4OCZ A;  3AK1 A;  1I08 A;  1ZQW A;  4MW3 A;  2BGW A;  9ICR A;  3JAS A;  5K1P A;  4MTO A;  4PA9 A;  2ZM6 O;  3U10 A;  1NKB A;  5AI4 A;  1TUB B;  2L5Y A;  4LF4 B;  1FJG O;  5LMU B;  1O08 A;  1ZQC A;  4C8O A;  4UAT A;  2OHF A;  2DYR C;  4TV8 A;  3MGH A;  4IIJ B;  1QR9 A;  5AKI A;  5EYP B;  4B6J A;  4CC5 A;  1DOQ A;  4NLB A;  1FFX A;  3WG7 C;  1RPL A;  3B8N A;  1PL0 A;  1Y76 A;  2ZIO A;  1YDX A;  3ASN C;  4UCT A;  3KKY A;  5KX5 B;  2IH3 C;  2A06 H;  1SL1 A;  1BVS A;  1XI1 A;  2BE3 A;  2Q0A A;  1RQN A;  2X7R B;  4LH7 A;  2ZIX B;  5CA0 A;  3QO5 A;  1XMO O;  2RP5 A;  1L7N A;  3CXC U;  4FS1 A;  5ALR A;  3RJF A;  2DOS A;  4DV0 B;  8ICI A;  2ATK C;  4PPX A;  4PHZ A;  5KMG A;  3H8W A;  3UMC A;  3R9K A;  2BCS A;  2P66 A;  5ALX A;  2IBZ H;  3M8A A;  1OZ0 A;  4CS2 A;  2F8K A;  1L3S A;  1BT8 A;  2UXX A;  4UAU A;  1LV5 A;  1VQ9 V;  2EAN A;  1YIJ V;  4DV2 O;  1NOM A;  1N61 A;  4OX9 O;  1GTO A;  4TV9 B;  4G2K A;  4LJX A;  4MF2 A;  1H38 A;  1GAX A;  5LOV A;  2ZJ8 A;  3HP6 A;  4Y2T A;  5L3D A;  4DV5 B;  3KKA A;  3JD0 A;  4EYH B;  4FBT A;  5KFD A;  1XNQ B;  1Y74 B;  3L9D A;  1TK0 A;  4MFC A;  1YTF B;  1Q3V A;  1MQ3 A;  4P0Q A;  4K4H A;  1GM9 A;  1Y66 A;  5J8Y A;  4R64 A;  4JV1 A;  5JRT A;  5L9X A;  5F9N A;  2R9I A;  1NKE A;  2XIC A;  2WB1 F;  2CGN A;  3KG2 A;  3ZHU A;  4AQY O;  2BCU A;  2AQ4 A;  2ESE A;  3HW8 A;  4RU9 A;  5AM1 A;  2E76 B;  3B2E E;  2UVW A;  4PEL A;  4GKJ B;  1ECW A;  3PSF A;  3C28 A;  1XWL A;  2G38 A;  4LC1 A;  1SA0 B;  2Q9L A;  1ZXI A;  4CGZ A;  4P9O A;  4EX6 A;  5B1A C;  1N32 O;  4UW9 A;  3GZF A;  1PL4 A;  3GWK C;  1TV9 A;  1EM1 A;  3H1I H;  1N34 B;  1D8Y A;  8ICW A;  4DR4 O;  4K0K B;  2KN7 A;  7ICO A;  2DL0 A;  2ADP A;  4GC7 A;  1HNZ B;  5J0Q A;  2AZ2 A;  4I2I A;  3CJH B;  2DUY A;  4QWA A;  1QR8 A;  1BMF G;  5DDY A;  3N2K B;  1M57 C;  2K4E A;  3IFX A;  3JPR A;  2GDS A;  3ZD8 A;  2KG7 A;  3W7W A;  2IOH A;  2UXB O;  4F4Z A;  1KSP A;  2LP7 A;  1XMQ B;  2C2E A;  3GII A;  2PFQ A;  7ICS A;  3KHH A;  2M9N A;  5ALQ A;  1GN6 A;  2IJK A;  3JAW A;  2Q7E A;  1R3K C;  1JMS A;  2E74 B;  3IAY A;  2BKE A;  3ETL A;  3ZJZ A;  4LF6 B;  3SAH A;  4F91 B;  3TQ1 A;  5CB4 B;  2KSO A;  2QTO A;  3HB3 B;  4ZI7 A;  3SR6 A;  4J03 A;  1GN2 A;  1H2G A;  5IIO A;  1AQ6 A;  2QM7 A;  4MVR A;  4QZD A;  1XL6 A;  3QNM A;  4O3R A;  3RB3 A;  3DC6 A;  4CS3 A;  1IG6 A;  1EZV H;  2ZE5 A;  3OEE G;  4DV4 O;  2QA4 V;  3PSI A;  2VA2 A;  3CW2 C;  4PV1 B;  4DR2 O;  4PDM A;  5AKJ A;  5BMV A;  3KZI Z;  1HNX B;  3D3Q A;  4FO6 A;  4YY3 B;  4OPH A;  3PMN A;  1R6T A;  2HBJ A;  4QGP A;  3WK4 A;  1XSP A;  3CPW U;  1B4F A;  3UXP A;  3S6J A;  3SAF A;  4W4L A;  4ECV A;  3WK6 A;  2W9A A;  5EIB C;  5L3C A;  3TAN A;  3UT5 A;  4C8K A;  4NLC A;  3U0Z A;  2M0N A;  4IQU A;  1S8O A;  3RBZ A;  4J9K A;  3E89 A;  1WAZ A;  1T4G A;  4JI5 O;  5KTQ A;  4F72 A;  3CCE V;  1FXK C;  4JI3 B;  4B9M A;  3W7T A;  1X2I A;  2CPR A;  4KL1 A;  2HVI A;  3I76 A;  4M2Y A;  4KXR A;  3TK1 A;  3WK9 A;  1ZAU A;  4P4P A;  3RH4 A;  3WK5 A;  2EAP A;  1R73 A;  1S0N A;  3QO7 A;  2JRI A;  1JFF A;  1XS9 D;  3NVW A;  2EIM B;  4R8U A;  3HKC A;  2KZ3 A;  4DL6 A;  5ALW A;  3PW2 A;  2WLM A;  3IGA C;  1WNS A;  5AKK A;  4LF5 O;  3K5M A;  1GN3 A;  3N2G B;  4DQI A;  5HML A;  5KG1 A;  4KX3 A;  4O3N A;  5KFA A;  4NXZ A;  5EE0 A;  4CF3 A;  4JI7 B;  1ZJN A;  2HOF A;  4MEX A;  3CS5 A;  1ZQY A;  5J2E A;  2MSN A;  1E1R G;  1MA1 A;  4NM1 A;  1NTK H;  5IJ9 B;  3WKB A;  3BS7 A;  5L1J A;  3PST A;  4GUN A;  4MT8 A;  4QZG A;  3RFA A;  4FLX A;  1GN4 A;  4BGD A;  2YDE A;  2LM4 A;  3OE7 G;  2HJD A;  1J97 A;  2BCQ A;  1QTM A;  2LM1 A;  3OGU A;  4E0D A;  3BJY A;  3RTV A;  3PX6 A;  5KAF U;  2B5U A;  1ZJM A;  1B22 A;  3OMN B;  5KFJ A;  3ZS8 C;  4ECX A;  4O4J B;  1P84 F;  1S10 A;  1PK1 B;  2W8L A;  5AM4 A;  4I4T A;  2GH1 A;  4MS2 A;  4ECZ A;  3TAQ A;  3D2S A;  2LW7 A;  8ICB A;  3EUB 2;  3HIL A;  3H8S A;  3WKC A;  3JAR A;  3SJA C;  2D3O W;  4B3T O;  2ARH A;  4IRC A;  5CEH A;  3ETQ A;  3ABM B;  2BZF A;  4PA3 A;  5KUK A;  2YIB A;  3E35 A;  2EUL A;  7ICE A;  2Y69 C;  4LF7 O;  1X6I A;  4PHP A;  4I28 A;  2HFE C;  2XTA A;  3HKB A;  1NK4 A;  3CRQ A;  5J0W A;  4YJ2 A;  1F4M A;  5CA7 A;  3ZDC A;  4CBC A;  4QWE A;  3V72 A;  4US9 A;  2C22 A;  2W54 A;  3Q4H A;  4Q43 A;  2NNU A;  2OT5 A;  3MDS A;  4YHH O;  1WWV A;  2ES6 A;  1QHT A;  1T3N A;  5CRX A;  2ZIN A;  4J9Y B;  4EBE A;  4M9G A;  3TFS A;  8ICU A;  2FKX A;  1Z4N A;  5HR6 A;  5B3S C;  3TET A;  5ALL A;  3NRW A;  1F5S A;  1VF5 B;  3KHR A;  1YZB A;  1VQ6 V;  2RLT A;  3N28 A;  4U3J B;  3RYI B;  1D5A A;  4F6R A;  8ICX A;  4WBN A;  1X40 A;  2P4K A;  4TUY A;  4I50 A;  4XQ8 A;  4B3S B;  4Y2Y A;  1YT3 A;  2EZX A;  2KKP A;  4KLF A;  2UUA B;  3D2N A;  4RNN A;  3G67 A;  4UVC A;  3JPN A;  4GFJ A;  1I5Y A;  1YTF D;  5KG2 A;  3CD6 V;  2NO4 A;  4GKK O;  2QR4 A;  3RVZ A;  5HR7 A;  1V55 B;  4H33 A;  5DB6 A;  4RZR A;  3E8G A;  2ZM6 B;  4DSK A;  4X89 A;  3RYC A;  2W43 A;  1TVK A;  1B43 A;  7ICG A;  4H37 A;  5ALS A;  2D8C A;  2PF4 E;  1FJG B;  4M9N A;  1M6Y A;  5J2T B;  2JH7 A;  1Z00 B;  5B5E U;  1FKA O;  4HAM A;  3KD3 A;  1F44 A;  2BCV A;  3KZI U;  2YSU B;  4UV9 A;  1VQO V;  4NY8 A;  3P32 A;  1Q6H A;  3RWR D;  2IOF A;  3BY6 A;  4JUZ A;  5LYJ B;  5BZB A;  1SKW A;  2DQN B;  3L72 H;  4DV7 B;  4PJ0 U;  4OJ5 A;  3K5N A;  2GUZ B;  1ZSP A;  2EAM A;  4GT1 A;  3CC2 V;  2YEV B;  3NVV A;  1DK3 A;  4RPZ A;  5AI6 A;  2ZXI A;  3AQE A;  1NBM G;  4EKW A;  5C0Y A;  1AR5 A;  2JV3 A;  1VEW A;  1URF A;  5AM2 A;  3PN1 A;  1ZQE A;  4Y2P A;  5AKL A;  2W9B B;  3TAD C;  3JAK B;  3OFN G;  3CCR V;  4NR1 A;  3BZK A;  3BA9 A;  5IWA O;  4EBC A;  4JGS A;  4DV2 B;  1F0M A;  4OX9 B;  1IM4 A;  3H0L B;  1OHH G;  3AG3 B;  1MAB G;  5ITZ B;  4PL2 A;  4YD2 A;  5KA5 A;  2GSM B;  9ICB A;  1SV4 A;  1YF2 A;  2W03 A;  8ICH A;  4I27 A;  4B9L A;  5D5Q A;  4O4L B;  1PNL A;  4DFK A;  3AN1 A;  4YJ3 B;  1PUZ A;  2KD1 A;  2C28 A;  2Z0A A;  3RYF B;  4AI8 A;  3JSN A;  4LR3 A;  4O3O A;  3JAL A;  4X1K B;  4CH3 A;  4AQY B;  2PYJ A;  3L71 H;  3QUT A;  4IRD A;  1C20 A;  3FYI B;  1Q86 W;  3L75 H;  5BOL A;  2WLL B;  2ZR2 A;  3NVY A;  1L5U A;  1H8E G;  8ICZ A;  3OEH G;  5ALY A;  5LMU O;  1HW7 A;  3HRD D;  1JR9 A;  1N32 B;  5K4L A;  3A0H Z;  5KT4 A;  2QB0 A;  1JX4 A;  2ALZ A;  5C8Y A;  3SD7 A;  3HPO A;  2V4R A;  1L3V A;  4RAI A;  5AM0 A;  1Q6U A;  3TAC B;  4ED6 A;  2LQT A;  4F6E A;  3MAQ A;  3E58 A;  3L3F X;  3V7J A;  2K9P A;  5JH7 A;  1PVQ A;  2R8G A;  8ICK A;  2YC0 A;  4NKG B;  3T1H O;  3BQ2 A;  2UVV A;  2W7P A;  5ALT A;  2D6F C;  2F44 A;  4IQT A;  2CAZ C;  3IHQ B;  2UXB B;  4GXI A;  2OIG A;  4P0P B;  2H8P C;  4U7O A;  4UAZ A;  2W7O A;  3FAV A;  5CA1 A;  8ICM A;  3NRZ A;  4XDL A;  3PX0 A;  1AIL A;  2ASJ A;  2PY5 A;  1SZP A;  5ALM A;  4X65 O;  1L6N A;  2EZO A;  4Z6D A;  4YN4 A;  3C2L A;  2W9C B;  2CTR A;  4RQ7 A;  2ZIU A;  4DK1 A;  2LI6 A;  3SYO A;  3ZDB A;  1KL9 A;  3SJB C;  1UT8 A;  3CYO A;  5CWR A;  3T5L A;  4X5V A;  4BUG A;  8ICL A;  3LDC A;  4TQD A;  3KBB A;  2UXC O;  8ICY A;  5ALH A;  3EYZ A;  4ICG A;  4K8X A;  3KKA C;  4DV4 B;  1G6U A;  2ZG6 A;  5J0S A;  2ZIW B;  4DR6 B;  2V4D A;  3RAX A;  3DXR A;  3FB8 C;  3MGI A;  3MD0 A;  4ZOL A;  1SS3 A;  3W7X A;  5J8Y C;  3K9S A;  4I55 B;  5KG4 A;  3FKS G;  3LUT B;  4O4H B;  1W0K G;  4XUS A;  4CF5 A;  1IVS A;  2IA6 A;  4GC6 A;  4QZE A;  4J9O A;  3B4S A;  4CH4 A;  4U7N A;  5IIK A;  2W0F C;  5DGA A;  1SWW A;  4H13 B;  3ZHT A;  2G06 A;  1U45 A;  4AIL C;  3ZMU A;  4GKJ O;  1SKV A;  4C4S A;  3JD4 A;  1G1X B;  1M9N A;  4JI5 B;  1K33 A;  4O4I A;  5DB7 A;  5LA6 B;  2Q5Z A;  2DJV A;  1NR1 A;  2KIV A;  4R66 A;  3H8J A;  3NS1 A;  1IBM O;  4KIT B;  1SF9 A;  4J9N A;  2ZIV A;  1BPD A;  2WPD G;  1U9L A;  4FFD A;  2H3Z A;  5KFR A;  1ZOL A;  3ISB A;  1O9G A;  3H01 A;  2FE9 A;  1YHQ V;  4HNA A;  1ZD3 A;  1IUR A;  4OJL A;  2BPF A;  5CJ7 A;  2V1D A;  2JJ1 G;  3CWB H;  1Q8K A;  5KT6 A;  4H0L B;  1OW5 A;  4KLJ A;  2F1I A;  5J2F A;  2Y4T A;  5A2Q N;  4LF5 B;  3MAB A;  3SYZ A;  2NRW A;  4M47 A;  5J0R A;  3K1Z A;  5J0X A;  1ZET A;  2EIJ C;  2WLH A;  4YR3 A;  5LP6 C;  1UJW B;  2QB1 A;  1ARO P;  1L8O A;  3QXG A;  2AGA A;  4XDK A;  1BE3 H;  1KP3 A;  4PH5 A;  2XAJ A;  1DGJ A;  2GTS A;  3RJG A;  5KG7 A;  3C5G A;  1X42 A;  3C90 A;  2Q0Z X;  2K4P A;  1DRG A;  5AIB A;  3TJT A;  3V7K A;  4X1Y A;  4AHC A;  1WP8 A;  3W7U A;  2KZZ A;  2N74 A;  4N23 A;  2HMX A;  4NLG A;  1Q8I A;  4RO2 A;  9ICA A;  1NI8 A;  3VOU A;  1X9S A;  1GO3 F;  1COO A;  2CK3 G;  3OMI B;  2AQ0 A;  2P5O A;  1D9F A;  2PMZ F;  2Z3Y A;  3QX7 A;  4DQR A;  3A8T A;  4C4R A;  9ICU A;  3B8M A;  4F5R A;  4D6T H;  3RH6 A;  2EH9 A;  5KFM A;  2BQU A;  3RN4 A;  1KLN A;  1YSC A;  1ZQT A;  4F4X A;  4J7K A;  1V9P A;  1AR4 A;  3OTO O;  3A0H U;  2H94 A;  1P7D A;  2L6L A;  5J2U A;  2N1R A;  4X20 B;  1JCH A;  1SV0 A;  1THZ A;  3VQX A;  1JA8 A;  5J0O A;  2Z5U A;  2BTQ B;  5B1B B;  1XQ8 A;  4FZM A;  4FLW A;  2VA8 A;  1UT5 A;  3EHB B;  4O3M A;  4NTW A;  3D2Q A;  1S9F A;  4JI3 O;  3IC9 A;  2Z7J A;  5ALF A;  1QLN A;  5EZY B;  2VKQ A;  1L8L A;  1K9M W;  3E22 A;  1V54 C;  1XHX A;  3GWO A;  4UUJ C;  4O0I A;  5KFY A;  4DSJ A;  1LB2 B;  5BR8 O;  1OCO B;  1G8M A;  4CC6 A;  1XSN A;  2K8A A;  4LZG A;  7ICF A;  1WP7 A;  4YY3 O;  5AK4 A;  4KLT A;  1XHZ A;  3OJU A;  1S3J A;  1S5J A;  2XCA A;  3P3N A;  2PTM A;  1KUQ A;  5KFB A;  3CCL V;  4LWS A;  4DSI A;  2DKZ A;  5TIS Z;  1ZQJ A;  2QM8 A;  2OIE A;  1NZB A;  1OXJ A;  2KVS A;  4AYB F;  5JUM A;  2X6C A;  4US8 A;  7ICL A;  2EIN B;  2F95 B;  4GKK B;  3QU4 A;  2ZT9 B;  1M56 C;  5D46 A;  5DB9 A;  2XT9 A;  1ZQV A;  1ZX3 A;  3HPL C;  1NZ6 A;  2OH2 A;  4X88 A;  2HG5 C;  1IIP A;  3ZHQ A;  2WLI B;  2A1J A;  1N62 A;  5T14 A;  4DQS A;  3UPQ A;  1QLE C;  3JD3 A;  4G27 B;  4ECS A;  1MSW D;  4JI6 B;  4F4L A;  1N5W A;  2M6Y A;  4OPA A;  8ICR A;  3H1K H;  5F2V O;  4D7T A;  3T1Y O;  3GV8 B;  5AM3 A;  2BDU A;  3FB6 C;  4C7U A;  2H3F A;  4QIW F;  3OJS A;  1L3U A;  3ZRV A;  4EEN A;  2VJ5 A;  2BDP A;  1N33 O;  3FB7 C;  2O6K A;  1M1K W;  4CH5 A;  1QVG U;  4DXW A;  4FLY A;  1TAU A;  2AH5 A;  1IX9 A;  1ZQN A;  4LBE C;  1FXV A;  3ZHR A;  2XAG A;  3JCZ A;  1FIQ A;  4ECT A;  5KHH A;  1S5L U;  4YXW G;  2DN9 A;  4B08 A;  1JPX A;  1IBK O;  3BQ0 A;  3HKE B;  4DRX A;  4DFP A;  2KQX A;  2YB1 A;  3BA8 A;  2EIL C;  5J2J A;  1RQL A;  2DYS C;  2ZXW C;  4BAY A;  3UQ0 A;  1UFI A;  1NTM H;  3TXQ A;  2YN4 A;  1BHB A;  1WPX A;  3ZD9 A;  2MU2 A;  4RT2 A;  3K5L A;  2ZIM A;  4B3R O;  1TA8 A;  3AG1 C;  1SL0 A;  4PI2 A;  4R65 A;  2OCC C;  3CB2 A;  3H1J H;  1GKF A;  3RFR A;  5K1X A;  2P6J A;  1GM8 A;  2KJ9 A;  1BCC H;  2WHE A;  2G09 A;  3OTQ A;  4DL4 A;  2XY7 A;  2HW3 A;  5FNV B;  3J81 N;  1TVA A;  4B3S O;  2QKA A;  4YIP A;  2KSD A;  5IDJ A;  1JMK C;  1QH9 A;  3CCV V;  4MTX A;  5H6R A;  2WLK A;  1KEJ A;  4FVM A;  4FS2 A;  3SPI A;  4AP9 A;  4O3P A;  3PNC A;  3T5J A;  1AJN A;  4FBU A;  3WK7 A;  2ZQM A;  3STL C;  3OHB A;  2ZTE A;  1P7G A;  2G08 A;  4M0A A;  4QE7 A;  2F1M A;  5HNK A;  2F23 A;  4KLO A;  2WWW A;  2FMQ A;  3ABK B;  2EIK B;  1VQ4 V;  4HAI A;  2KOB A;  5JJE B;  3QZ7 A;  5AKH A;  1KFS A;  7ICQ A;  1ZUQ A;  3OUS A;  4UAS A;  1NR7 A;  4TWK A;  4X1I A;  3CYM A;  4J9M A;  4ACO A;  4Y2U A;  5GON B;  3H7I A;  3CE2 A;  5IYZ B;  1SET A;  1EN6 A;  3WKE A;  4JZG A;  1OCR C;  1IV8 A;  5JU5 A;  3PW4 A;  7ICN A;  1AI4 A;  3NVZ A;  2H3V A;  4J7J A;  4UB6 Z;  4DV7 O;  2ZE8 A;  4BXO B;  4DV6 O;  3GIM A;  3T1H B;  1URJ A;  1ZD4 A;  1KFD A;  4KMO B;  1LUW A;  1A76 A;  1WUD A;  2PFP A;  2WSS G;  2JEX A;  3TCU A;  1JJ2 U;  3SEN A;  3ZDA A;  5DGB A;  3LSS A;  1TK5 A;  3L4P A;  4A8E A;  1OJH A;  3B09 A;  3ML0 A;  3OM3 B;  1WA8 B;  1MQ2 A;  3MHS C;  3SYC A;  4X65 B;  3ORY A;  3SPG A;  1ZQB A;  1I5X A;  2MW2 B;  5KFI A;  2WLN A;  3LSU A;  9ICL A;  2MUT A;  4OD0 A;  1BNP A;  1RSO B;  4PL1 A;  2ILM A;  3SJQ C;  5GTI Z;  1SQB H;  4X62 O;  2UXC B;  3HJE A;  5IIL A;  4UBB A;  1J5E B;  1D2D A;  5KA6 A;  4FZL A;  1CRX A;  5LHG A;  4GXK A;  5TIS U;  4QNH B;  1SRY A;  3OD4 A;  1RFY A;  4B9V A;  1E79 G;  2YTU A;  5IJ0 A;  1XOU A;  4HYK A;  3MDA A;  5A9G A;  1JAL A;  3RAQ A;  5E79 U;  5KAF Z;  5LGU A;  2Y1J A;  1HR0 O;  1XUQ A;  4CE6 A;  9ICO A;  2E8O A;  1ENV A;  4ZH4 A;  3SQI A;  3PO4 A;  2JEU A;  5KFS A;  3I55 V;  2CTP A;  9ICG A;  2H5X A;  4CRX A;  5DBA A;  2E5L O;  1XNR B;  4OJ6 A;  5AIA A;  4F50 A;  4FIP C;  3CEI A;  1P49 A;  5AKX A;  3CC7 V;  5LXT B;  4I0X A;  4YVZ A;  3ZHS A;  1ZQQ A;  4Z6E A;  4UCO A;  2PI5 A;  1IBM B;  2JGD A;  2CE4 A;  2JGA A;  1VQN V;  5ALG A;  4MW8 A;  2QWR B;  4IGG A;  4C0Z A;  4DUZ O;  2D3D A;  1CP9 A;  3G6E V;  1KRP A;  4LFC O;  2QE7 G;  2W6J G;  2NRZ A;  3OSP A;  3ABM C;  2JXJ A;  3KHG A;  2FLL A;  2WB1 C;  1PNM A;  1WLE A;  4JI4 O;  4QZF A;  4DO9 A;  2AGQ A;  1F4N A;  1U48 A;  1W0J G;  1RG6 A;  2IW5 A;  4BW5 A;  5LP6 A;  1K8A W;  1NJY A;  4DWI A;  4QPJ A;  1RM1 B;  3FYE B;  2V7Q G;  3CC4 V;  3PO5 A;  5LL6 Y;  1VLB A;  1RYR A;  1MZE A;  4JI0 B;  4EZ9 A;  2NN4 A;  1KTQ A;  4DR5 B;  3C3S A;  3M7D A;  4ED0 A;  5HHI A;  4IS7 A;  4LFB O;  2GV9 A;  1Q3U A;  2Q68 A;  1ZQS A;  2G07 A;  3UO3 A;  4KP4 A;  3AG4 B;  5DG8 A;  2VQF B;  1LKY A;  1RXW A;  4B7E A;  5B5E Z;  4FFB B;  4DOC A;  4C80 A;  2K4H A;  4DR6 O;  1JVM A;  5FPO A;  2LYB A;  4O2A A;  3T4Z A;  1VQK V;  1N0N A;  3K0G A;  5ALU A;  1NKC A;  1M4U A;  5CHG A;  3LYS A;  3ZIA G;  5EWG A;  5KHI A;  4RT3 A;  1XNS A;  2WF7 A;  3SMV A;  3UXN A;  7ICV A;  3JPS A;  3O65 A;  1TUB A;  1BZK A;  1R3L C;  1XL4 A;  3K08 A;  1ZQL A;  1Q46 A;  3ALR A;  1X4T A;  1J95 A;  4PJ0 Z;  3OTO B;  3QEA Z;  4RQM A;  3RJH A;  2W0X A;  3M8S A;  5J2C A;  4IIJ A;  2DYR B;  5KFG A;  4O3Q A;  1XO1 A;  5KFF A;  1DK2 A;  2EDU A;  4O5E A;  2YXH A;  1KW4 A;  4MHV A;  3MR5 A;  3AUO A;  3F5E A;  2BTO A;  2IJJ A;  3WG7 B;  5KX5 A;  3ZED A;  4TQF A;  2KNJ A;  3ASN B;  2LHT A;  2ZIX A;  2ITD C;  4UB6 U;  2QKQ A;  4RQ1 A;  3AU6 A;  2LGW A;  3CRM A;  3K58 A;  2QWO B;  5BR8 B;  1NK8 A;  3RYH B;  3C2M A;  1SZH A;  3SAG A;  2UU9 O;  3VQY A;  3C5F A;  3Q8L A;  2YIC A;  2IMW P;  3TKA A;  3E0F A;  8ICT A;  1HP8 A;  4MVQ A;  1ZQH A;  4LP8 A;  2KG5 A;  4UCR A;  4NM2 A;  1HUZ A;  3V6K A;  4QZH A;  1ZYQ A;  3RB0 A;  1WWU A;  9ICX A;  4BJQ A;  3C21 A;  5D49 A;  4F2S A;  2DQ0 A;  1SXD A;  2Y9T A;  5EE9 A;  3Q8K A;  1WB7 A;  2A79 B;  4TV9 A;  4LFA O;  4PGY A;  3NXS A;  5GTI U;  3JAM N;  1F51 A;  5J2A A;  4D7S A;  4F4Y A;  2YB4 A;  3QUC A;  3QE9 Y;  4WCE V;  3I5D A;  4DCC A;  3BQ1 A;  2EX3 A;  2JEI A;  1L0L H;  3H4D A;  3JSL A;  1JQ0 A;  1RP3 B;  1Y74 A;  5BPC A;  1KQQ A;  3H1L H;  2XAF A;  5H9C A;  4JAA A;  4Q44 A;  3M8R A;  5KFC A;  4M6W B;  4KLH A;  4GYC B;  4RQ3 A;  4DL2 A;  4U7C A;  2HOQ A;  7ICJ A;  1OCC C;  4F8R A;  4GLX A;  3PR5 B;  4RQN A;  2WTF A;  2X6A A;  3T1Y B;  1NKD A;  5A0L A;  1NJZ A;  5ALZ A;  1Q81 W;  1ZQD A;  1XDC A;  3K06 A;  2ZNJ A;  4NTX A;  3VQV A;  3FB5 C;  9ICI A;  5IT9 N;  1DTO A;  1SA0 A;  3K9A A;  3TAP A;  2IU3 A;  2DGZ A;  2PZS A;  4DF8 A;  1IBK B;  5KNI A;  1HDJ A;  2JJ2 G;  5KFX A;  5B1A B;  1SV0 C;  2P6U A;  5EBW C;  5KFK A;  4WFE A;  5JQG B;  2OCH A;  4JWM A;  3H4B A;  3ETE A;  2FPM A;  4ZBM A;  2QWP B;  2K4I A;  8ICG A;  2A1A A;  1JIH A;  4B3R B;  1L1F A;  4PA7 A;  1C7Y A;  4JV5 B;  2ODG A;  3CJH A;  2KJ8 A;  5DKW A;  4P2H A;  3N2K A;  1EBO A;  1QBZ A;  4JI2 O;  3CME V;  3Q8M A;  1UPG A;  2XAH A;  1ZQP A;  5FPR A;  1N33 B;  1M57 B;  2EZZ A;  1VQ7 V;  5L3F A;  2CUG A;  4LNU B;  2EZP A;  1WG8 A;  4KUM A;  4Q45 A;  1E1Q G;  3ICX A;  1CXZ B;  3WB2 A;  2QAR B;  3D6J A;  4M9J A;  1F23 A;  1U49 A;  3G6B A;  1H2N A;  1PVP A;  2IJI A;  3QU2 A;  3GDX A;  4RNO A;  1UHU A;  4J9Q A;  1SL2 A;  1VAR A;  3OTF A;  5CB4 A;  3JCU Z;  3N7S C;  5TZV A;  2GHY A;  4WF9 V;  4B9S A;  2YX8 A;  1UCV A;  4DL5 A;  3MHH C;  4EFB A;  3ABL C;  3OR6 C;  4EEQ A;  2K8C B;  3C23 A;  4ELT A;  5FP0 A;  5ALP A;  5J2H A;  2DWE C;  4U3F H;  4ECW A;  4OXS A;  3JAT B;  1AI5 A;  4JI6 O;  2GOL A;  4J41 A;  2W55 A;  3NUQ A;  1N0J A;  4FZ0 A;  2J6U A;  1U47 A;  2KKV A;  4DV6 B;  3E8B A;  1YZ7 A;  4UAR A;  2BSK B;  2M7W A;  4JB3 A;  4NXM O;  2F2A B;  1S76 D;  1ZL8 B;  4B7K A;  4YG2 A;  4JTD B;  2BCC H;  1MC8 A;  2EQY A;  4DS5 A;  2RCV A;  1NK0 A;  3PV8 A;  3UXO A;  2YIB D;  2XID A;  3AEV A;  1PVR A;  1SKR A;  1K4D C;  1R6N A;  1FXK B;  4RUA A;  3QF7 A;  3TGU H;  4NL9 A;  1SES A;  5ALJ A;  4DR2 B;  3T2M A;  3PX4 A;  1A77 A;  5KL1 B;  1Y67 A;  4BIZ A;  5ALE A;  2JZB B;  4IYH A;  5ALO A;  3FFQ A;  1X66 A;  4MVZ A;  4TSF G;  2CRX A;  1T8E A;  4Y2S A;  3CCQ V;  4X62 B;  3JPT A;  4F2R A;  3ZDD A;  1Q43 A;  4OGQ B;  3S3X A;  1XBL A;  1FFU A;  1KKD A;  3THV A;  3T3F A;  4FLU A;  3N2G A;  1UQV A;  5AKG A;  1Z5V A;  2WF5 A;  3SJC C;  4U6P A;  1XEQ A;  1NVP D;  1IXR A;  3PW5 A;  2HSZ A;  3LVW A;  3RVY A;  4MTG A;  1SQF A;  4UVB A;  1HR0 B;  2FDR A;  1XSL A;  1B6Q A;  2UXN A;  5IJ9 A;  2KZM A;  4XBF A;  1MNG A;  5CMU A;  4LZD A;  4QWB A;  2E5L B;  3A0R A;  1FAF A;  4DUY O;  4I2E A;  1IXB A;  3PJS K;  2PYL A;  7ICT A;  3HKZ F;  3W7S A;  2Q4P A;  2E1F A;  2YI9 A;  4BX9 C;  3ASO C;  3CXH F;  1ED1 A;  4O4J A;  1PK1 A;  2WAQ F;  4RQ5 A;  4RWU A;  1FXH A;  3SZ2 A;  4DUZ B;  4W4K A;  4RQ6 A;  4LFC B;  2EJ7 A;  1OUQ A;  2F66 C;  2HHS A;  4FFK A;  1ORQ C;  4PZO A;  4EX7 A;  5EOZ A;  2QKS A;  3R65 A;  3QNE A;  2GBO A;  2E1E A;  2YUA A;  3BS5 B;  1Y88 A;  2K60 A;  1DXS A;  2Y69 B;  4FK5 C;  4JI4 B;  4NB5 A;  1JXE A;  1YJW V;  2YMQ A;  8ICV A;  3ZDE A;  2VAN A;  3DGE A;  3SPC A;  4G9B A;  1SQG A;  3CNH A;  2KK0 A;  5L3B A;  2CH7 B;  4NLK A;  3E86 A;  2AU0 A;  4ED3 A;  4ED2 A;  4DFJ A;  1SXE A;  2L35 A;  3GV7 B;  1PM9 A;  5ALK A;  2EAO A;  2JK5 C;  4DR3 O;  4LF8 B;  4UB5 A;  2DMX A;  4U3J A;  2KHQ A;  2KTQ A;  4CF4 A;  3RYI A;  4LFB B;  4QWD A;  2QEX V;  3G80 A;  4DEZ A;  2YI8 A;  2KIC A;  1J5E O;  1JOY A;  4FLT A;  3WKD A;  2P6R A;  4MSW C;  4K3A A;  2XOK G;  5AIC A;  2G5H B;  5AM5 A;  2ZTD A;  3BFR A;  2DQ3 A;  5IYB O;  2W8K A;  1MOF A;  3TFR A;  2D2C B;  3N97 B;  1AR1 B;  9ICC A;  4ICA A;  3L73 H;  2H3Q A;  1UA0 A;  1PP9 H;  5J2T A;  5H2F U;  3FC4 A;  1Z00 A;  4YQW A;  2DW4 A;  3X2Q C;  4IHJ B;  5IY5 C;  5KLV H;  1FEZ A;  1OV9 A;  2YMP A;  2N05 A;  1PZN A;  2ZDI A;  5KHK A;  2B6G A;  1XNR O;  1CUK A;  3N27 A;  2A3V A;  4FM2 A;  3WKA A;  1DK1 A;  1D8L A;  4O2B B;  1T3Q A;  3LK9 A;  4NLZ A;  3OGI B;  5LYJ A;  8ICQ A;  1S5L Z;  3LDE A;  5DB8 A;  2LJ2 A;  2HBL A;  2DKX A;  5KFQ A;  3ZRW B;  4EB6 B;  1LVH A;  3ZN0 A;  2QGN A;  3HR0 A;  1ZLZ A;  2GUZ A;  2YEV A;  3RGB A;  3RT3 C;  1SZX A;  4RQ8 A;  2UU9 B;  3ZMV A;  1H2K A;  3FD9 A;  5LMN O;  1DF4 A;  1NJW A;  1RM6 C;  5LHH A;  2G0A A;  2FI1 A;  1GMG A;  4ZHQ B;  2W9B A;  4YD1 A;  3IRU A;  3D3I A;  3JAK A;  2B9Z A;  2QWQ B;  4NLN A;  2Q6A A;  4I2F A;  4C8N A;  4G3I A;  4QZC A;  2RDC A;  4Q8F A;  1M5I A;  4B3M B;  4ZIB A;  3AL0 B;  4LFA B;  2E8N A;  5KFN A;  2E3T A;  5ITZ A;  3DDH A;  3VC8 A;  4IT5 A;  4DR5 O;  9ICS A;  4WJ3 B;  3C3T A;  4JI0 O;  1Z19 A;  5C93 A;  1NNL A;  4IQW A;  1PV0 A;  4QZ9 A;  4O4L A;  5KAI Z;  4NJ8 A;  2ZNI A;  3RRG A;  1WPB A;  2ZR3 A;  4QPK A;  8ICO A;  3RB4 A;  2XVT A;  4YJ3 A;  4DK0 A;  5HFL A;  5JVD B;  2ZJ5 A;  3RYF A;  3HKD B;  8ICP A;  2LW1 A;  4X1K A;  5JJJ B;  1QSS A;  5L3E A;  2VQF O;  2PKE A;  3F5W C;  5EBL C;  5ALI A;  3U26 A;  1SQV H;  4YP3 A;  3RB6 A;  1JUD A;  2WLL A;  5CR0 A;  3AEI A;  1YXB A;  4JYB A;  2QTS A;  1U96 A;  1W2B U;  4JYA O;  9ICT A;  3DC5 A;  2J6T A;  1JX9 A;  1HIW A;  3ABK C;  3GV5 B;  3JAS B;  2EIK C;  4J11 A;  4LF9 B;  2JGU A;  4PD4 F;  3H8M A;  2HHQ A;  3ABT A;  1K34 A;  5EIB D;  3HWT A;  4HBN A;  2AHO B;  3J7A U;  1BGX T;  4M9H A;  5J29 A;  3B77 A;  4GX0 A;  4TV8 B;  2I5H A;  2W3S A;  3RBE A;  3QYP A;  1T7P A;  4I7Z B;  2HKO A;  2HOI A;  4IYI A;  1HEK A;  2F4V B;  3AG2 B;  2V4Q A;  3ONN A;  1FFX B;  2LBO A;  3I1Y A;  5J9P C;  1Y76 B;  3IDW A;  1P4R A;  3JD1 A;  2ZJA A;  2JEG A;  3E2E A;  4JI2 B;  1SIJ A;  3RBD A;  5J2D A;  5CA0 B;  4IC9 A;  1KMI Z;  2XO7 A;  2PMZ C;  1QNM A;  4P0P A;  3ZMS A;  5L3G A;  5ALN A;  2AGO A;  1ZQI A;  2H3I A;  3K5O A;  4ECY A;  5KMG B;  1ZWI C;  1DLB A;  1KQS U;  1SZT A;  4YCX A;  2CDY A;  2R9A A;  3QZ8 A;  2W9C A;  9ICK A;  3LNM B;  1TAQ A;  2ZUB A;  4DLG A;  5HMM A;  2LPE A;  4DR1 B;  4LVS A;  3M9M B;  2R72 A;  1RPO A;  4N21 A;  5E79 Z;  5BXZ A;  5HFM A;  4IQV A;  1S72 V;  1KYO F;  4USA A;  1OCZ B;  2AGP A;  1JRO A;  4GXJ A;  2Q73 A;  5LOV B;  2VA3 A;  1GRJ A;  2Q0O C;  1ROP A;  1EXN A;  2HI0 A;  2ZIW A;  1HWY A;  3ZN1 A;  4UVA A;  4WFF A;  4I55 A;  3T1C A;  5KHG A;  4O4H A;  4OO1 J;  4P0Q B;  4DFD A;  1ZQO A;  4BIU A;  3BQ7 A;  4PZN A;  7ICK A;  1VQM V;  2YXL A;  2XY6 A;  1TGO A;  2JVD A;  4Y2R A;  4F5O A;  3DTU B;  4E2L A;  4UCV A;  4R7C A;  5KT7 A;  2LFS A;  4ELV A;  4DSL A;  3M9O B;  3H0M B;  4NXM B;  1RDF A;  3EVK A;  4TT3 G;  4RQ0 A;  2UXD B;  4AYB C;  2K89 A;  2F93 B;  5LA6 A;  1KBU A;  3CCM V;  1H8H G;  5G5H A;  4R50 A;  4JAU A;  3C1Z A;  4UFZ A;  3LWL A;  4DOB A;  3C29 A;  2Y0S F;  8ICA A;  3G6V A;  2W11 A;  7ICM A;  1HNW O;  2IHN A;  1O9H A;  4CZZ A;  1KU9 A;  4JV5 O;  5J0Y A;  2UUC O;  3ZRX A;  4JMU A;  5KFO A;  4BWA A;  4JF3 A;  1ZQU A;  2PXI A;  5E1A C;  4EZ6 A;  3R66 A;  4WFB V;  4PHA A;  2R8J A;  2XY5 A;  1QSY A;  4TUP A;  1ZQZ A;  2NRV A;  4P30 A;  1YIT V;  4CNQ A;  4UBC A;  4DL3 A;  1AI7 A;  4QIW C;  2JMG A;  5HHH A;  2R70 A;  2KG7 B;  3UO2 A;  1FFT B;  3B9J A;  4FPP A;  2CTW A;  3RH5 A;  1KN5 A;  3F5A A;  3BRC A;  2B1I A;  2OWO A;  1RM1 C;  1B0X A;  5CP2 A;  5ALV A;  3G6Y A;  4MVM A;  2VJ4 A;  4P2Z A;  3UMG A;  2JHD A;  4KFM A;  4DV1 B;  3JAW B;  2I6X A;  5KAI U;  2HCF A;  1BL8 A;  4DUY B; 
#chains in the Genus database with same CATH homology
 4RUF A;  3ALR A;  1NJI W;  1J95 A;  2F43 G;  4PA6 A;  4UXN A;  2ZXI A;  3AQE A;  1NBM G;  2DYR B;  4EKW A;  5C0Y A;  4RQF A;  2XAQ A;  3LVV A;  2MK3 A;  2OTL V;  1M90 W;  3P30 A;  4FJC C;  4X8A A;  1NQT A;  3OFN G;  4MVU A;  3F5E A;  2NLJ C;  2IJJ A;  4NV0 A;  3WG7 B;  3CCR V;  3RW0 A;  4CDG A;  3F7Y C;  3IG5 A;  2KNJ A;  3ASN B;  2LHT A;  2ZIX A;  2C2A A;  2ITD C;  4JGS A;  2BOB C;  3H0L B;  1OHH G;  3AG3 B;  1MAB G;  4PL2 A;  1SZH A;  3SAG A;  5KA5 A;  2GSM B;  2Q4T A;  4HZ3 A;  2W03 A;  1PNL A;  2HJF C;  3E0F A;  4GX2 A;  4MVQ A;  4LP8 A;  1QCE A;  2KD1 A;  3CP1 A;  3ASO B;  3M6Z A;  3F7V C;  2ZXH A;  4BJQ A;  2DQ0 A;  2KIW A;  3F53 A;  3SYA A;  1K5Q A;  4JPR A;  3IN5 A;  2A79 B;  1ZQ1 C;  3IG8 A;  1K5S A;  3NXS A;  2JIZ G;  1F51 A;  1V54 B;  3FYI B;  1Q86 W;  1R3J C;  2WLL B;  2YB4 A;  2ZR2 A;  4WCE V;  3MGV A;  1Q7Y W;  3OPX A;  1H8E G;  2Q69 A;  1JQ0 A;  2XI9 A;  3SYP A;  5LHI A;  1IXM A;  3OEH G;  2EIM C;  3M6K A;  2DF4 B;  1D8B A;  1S5H C;  1K92 A;  2XAF A;  5H9C A;  2IH1 C;  5EBM C;  2K8B B;  4G28 B;  4U7C A;  2EBO A;  2HOQ A;  2K1E A;  4FZN A;  2NV3 A;  1OCC C;  4RAI A;  1YJ9 V;  2X6A A;  1NKD A;  5A0L A;  1Q81 W;  1DF5 A;  2RHF A;  3GU3 A;  3ZCC A;  3GB7 C;  3K06 A;  3L3F X;  1Z1B A;  1M56 B;  2WLI A;  3FB5 C;  1PVQ A;  4ASU G;  1DTO A;  2G5I B;  4RQE A;  1VQL V;  3K9A A;  3D36 A;  2IU3 A;  2DGZ A;  2W7P A;  3K03 A;  2D6F C;  1QLE B;  2JJ2 G;  5B1A B;  4U7O A;  4P0P B;  2H8P C;  5EBW C;  2W7O A;  2A9H A;  1P7B A;  4WFE A;  4XDL A;  3ABU A;  1K97 A;  2ITC C;  4GX1 A;  3ETE A;  4ZBM A;  1L6N A;  2K4I A;  3N7R C;  2R18 A;  2EZO A;  1KD1 W;  3EFF K;  1L1F A;  1PKX A;  2ZIU A;  3LDD A;  3LSQ A;  4PA7 A;  3SYO A;  2F76 X;  2KJ8 A;  5CBG A;  1VQ8 V;  1QVF U;  3CYO A;  1EBO A;  1QBZ A;  5EC1 C;  3CME V;  2XAH A;  3X2Q B;  5IY5 B;  4BUG A;  4PDL A;  3G71 V;  3LDC A;  4MVO A;  1M57 B;  3M99 B;  2HLD G;  1VQ7 V;  4QE9 A;  5L3F A;  3PZP A;  1TUE B;  2EZP A;  4KUM A;  2VIX A;  2ZG6 A;  3ICX A;  2ZIW B;  3AQF A;  1E1Q G;  4GX5 A;  3ZRW A;  5LGN A;  1F23 A;  3FB8 C;  1CPY A;  2EIL B;  3JYC A;  3MD0 A;  3W7X A;  2DYS B;  2ZXW B;  3SPH A;  3FKS G;  1PVP A;  2IJI A;  3LUT B;  4PDR A;  4UV8 A;  2KEY A;  1W0K G;  4GCZ A;  1K7D A;  3ZRS A;  2LFR A;  3AG1 B;  3N7S C;  4JAV A;  3ZMT A;  2GHY A;  3O0F A;  1MA7 A;  4WF9 V;  2YX8 A;  2OCC B;  1S0V A;  3MHH C;  4U7N A;  2W0F C;  3OW2 U;  2EJR A;  3ABL C;  3OR6 C;  2K8C B;  2G06 A;  4MTF A;  2Y48 A;  1T94 A;  5LBQ A;  3ZMU A;  3JD4 A;  3E8F A;  2DWE C;  2KVC A;  1M9N A;  1K33 A;  1NVP B;  4OXS A;  4KX5 A;  5KUM A;  1AI5 A;  1NR1 A;  2GOL A;  3NUQ A;  1G4Y B;  1KEC A;  4ZKI A;  2W6I G;  2OYY A;  1MG1 A;  2EIJ B;  2ZIV A;  2WPD G;  1K3E A;  1BHA A;  2H3Z A;  1YHQ V;  1V55 C;  3H01 A;  2KKV A;  2B1G A;  1PD3 A;  4OJL A;  3E8B A;  4QJF B;  2M7W A;  1NH2 B;  3ZMZ A;  2F2A B;  4OJO A;  2JJ1 G;  2V1D A;  1S76 D;  1GK9 A;  4JYC A;  4JTD B;  3ETG A;  2Y0S C;  2ZDI C;  3AG4 C;  1CEZ A;  2F8L A;  2XID A;  1PNK A;  1PVR A;  1K4D C;  1R6N A;  3WFV A;  1FXK B;  4LCU C;  5CBF A;  3K1Z A;  1SES A;  2EIJ C;  2WLH A;  2KHV A;  3T2M A;  5IYC O;  1UJW B;  3ETD A;  5KL1 B;  1ARO P;  4BIZ A;  2CN1 A;  1OCR B;  4MVZ A;  4TSF G;  4WFA V;  2F77 X;  4MW3 A;  2CRX A;  4XDK A;  1KP3 A;  2XAJ A;  4MTO A;  1SER A;  3CCQ V;  3E8H A;  1Y4M A;  4PA9 A;  5B1N A;  1DRG A;  2OM6 A;  3W7U A;  1RPR A;  2DYR C;  4L87 A;  1KKD A;  4N23 A;  2HMX A;  1QR9 A;  4RO2 A;  3VOU A;  1GO3 F;  4NLB A;  4U6P A;  4PDV A;  2CK3 G;  3OMI B;  3WG7 C;  1NVP D;  3B8N A;  1PL0 A;  3OAA G;  3LVW A;  2PMZ F;  1YI2 V;  3ASN C;  3F2D A;  3RVY A;  4MTG A;  2IH3 C;  2HVJ C;  2Z3Y A;  4UVB A;  2X7R B;  3B8M A;  2ZIX B;  1B6Q A;  3QO5 A;  2UXN A;  4XBF A;  3AG3 C;  1YSC A;  5CMU A;  2RP5 A;  3A0R A;  2RRD A;  3CXC U;  2MRL A;  1K73 W;  2H94 A;  1P7D A;  5EC2 C;  2N1R A;  1JCH A;  1THZ A;  2ATK C;  3PJS K;  1NH2 D;  3N7P D;  2Z5U A;  3VCB A;  3HKZ F;  2P90 A;  5B1B B;  3W7S A;  3OUF A;  2E1F A;  4FZM A;  4BX9 C;  1OZ0 A;  3ASO C;  1ED1 A;  2WAQ F;  3EHB B;  4O3M A;  2UXX A;  3D2Q A;  4RUE A;  1VQ9 V;  2Z7J A;  1FXH A;  3VBB A;  1YIJ V;  1QLN A;  2VKQ A;  3SPJ A;  4QNL A;  1K9M W;  1OUQ A;  1V54 C;  1YJN V;  1GTO A;  1ORQ C;  4G2K A;  2KJ5 A;  3CP8 A;  2QKS A;  3GWO A;  3R65 A;  4UUJ C;  3QNE A;  1H38 A;  2E1E A;  3SYQ A;  2Y69 B;  1OCO B;  1G8M A;  4NWI A;  5L3D A;  3OR7 C;  2K8A A;  3JD0 A;  1YJW V;  2KV2 A;  1S3J A;  3DGE A;  3SPC A;  1YTF B;  1Q3V A;  4P0Q A;  5KL8 B;  1GM9 A;  1Y66 A;  3CCL V;  2QM8 A;  2R9I A;  2XIC A;  2P67 A;  2WB1 F;  5L3B A;  3H0R B;  1NZB A;  4AYB F;  3E86 A;  2X6C A;  3KG2 A;  4FK5 C;  2EIN B;  2X6B A;  2JK5 C;  2KB1 A;  1M56 C;  2KHQ A;  3HPL C;  2QEX V;  4PEL A;  2OH2 A;  2ZD9 A;  4X88 A;  2HG5 C;  5DN6 G;  1IIP A;  1ECW A;  2WLI B;  2KIC A;  3PSF A;  3C28 A;  1EFR G;  4LC1 A;  2WAM A;  1JOY A;  5T14 A;  4FE3 A;  4CGZ A;  1QLE C;  3JD3 A;  4G27 B;  4MSW C;  4P9O A;  4R8C A;  2XOK G;  5B1A C;  3STZ C;  4F4L A;  1MSW D;  3GZF A;  3OGC C;  2G5H B;  3IP4 B;  5IYB O;  2DQ3 A;  1AI6 A;  3E83 A;  1MOF A;  1AR1 B;  1AJQ A;  2BDU A;  3FB6 C;  4ICA A;  2H3F A;  3UKM A;  5LGT A;  2H3Q A;  4QIW F;  3ZRV A;  2VJ5 A;  3BEH A;  3FB7 C;  2ZIU B;  1M1K W;  1QVG U;  2DW4 A;  4DXW A;  3X2Q C;  5IY5 C;  1QR8 A;  1BMF G;  3K0D A;  3K79 A;  4LBE C;  2ZDI A;  1FXV A;  1M57 C;  2K4E A;  2A3V A;  3IFX A;  2XAG A;  3JCZ A;  1R3I C;  4YXW G;  3G4S V;  1JPX A;  3W7W A;  2LP7 A;  3LDE A;  2YB1 A;  2HBL A;  2EIL C;  3ZRW B;  3CRX A;  2W04 A;  2DYS C;  2ZXW C;  4BAY A;  3CCS V;  3ZN0 A;  2IJK A;  1KP2 A;  1VQ5 V;  1BHB A;  1R3K C;  2IJH A;  1WPX A;  2YEV A;  5FL7 G;  3AG1 C;  3ZJZ A;  3CMA V;  4I5S A;  3SAH A;  2OCC C;  1GM7 A;  2QTO A;  4WFG A;  2P7T C;  3HB3 B;  3ZMV A;  1GKF A;  1H2G A;  2P6J A;  1GM8 A;  1K4C C;  2KJ9 A;  1DF4 A;  2QM7 A;  2G09 A;  4MVR A;  5LHH A;  1XL6 A;  2G0A A;  2HBM A;  1GMG A;  2PI4 A;  3OEE G;  3D3I A;  5IDJ A;  3CCV V;  2QA4 V;  3PSI A;  4MTX A;  2Q6A A;  4PDM A;  5H6R A;  1N8R W;  2WLK A;  3SPI A;  1AJN A;  2ZQM A;  3STL C;  3AL0 B;  2HBJ A;  2G08 A;  4XDJ A;  3CPW U;  2ZIV B;  2BOC C;  4QE7 A;  3VC8 A;  3SAF A;  4WJ3 B;  1Z19 A;  2WWW A;  5C93 A;  3ABK B;  5L3C A;  2EIK B;  5H6Q A;  5EK0 A;  1VQ4 V;  4NLC A;  2KOB A;  2ZR3 A;  4JTA B;  3OUS A;  4QPK A;  2LYA A;  2M0N A;  2XVT A;  2HR3 A;  1NR7 A;  4TWK A;  2HVK C;  5HFL A;  3RBZ A;  4Z1M G;  3E89 A;  3CYM A;  3CCE V;  5L3E A;  4WFH A;  1FXK C;  4ACO A;  4JAS A;  3F5W C;  5EBL C;  5B1O A;  3W7T A;  2CPR A;  1SET A;  3TK1 A;  1Q82 W;  2WLL A;  3AEI A;  2E5S A;  4JYB A;  1OCR C;  3KFU F;  4I9W A;  1W2B U;  1AI4 A;  2H3V A;  1JX9 A;  1R73 A;  1HIW A;  3ABK C;  3QO7 A;  1URJ A;  2MA1 A;  4KMO B;  2EIK C;  5CBH A;  1WUD A;  2WSS G;  3TCU A;  1JJ2 U;  2JEX A;  3ABT A;  1EZJ A;  1K34 A;  2EIM B;  2AHY A;  1COW G;  3LSS A;  3B77 A;  2WLM A;  4GX0 A;  4A8E A;  3IGA C;  3ML0 A;  3OM3 B;  3OMA B;  1AJP A;  2HKO A;  2HOI A;  3MHS C;  1HEK A;  3SYC A;  3AG2 B;  1OCC B;  3SPG A;  3ONN A;  4KX3 A;  2LBO A;  1I5X A;  2DWD C;  2WLN A;  5J9P C;  1P4R A;  3JD1 A;  2HOF A;  4PL1 A;  3E2E A;  2JH1 A;  5IYD O;  1S77 D;  2X0L A;  1E1R G;  3SJQ C;  4IC9 A;  1R6K A;  5CA3 A;  3PST A;  5KA6 A;  1LNQ A;  4MT8 A;  2PMZ C;  4FZL A;  3RFA A;  4DO2 A;  4P0P A;  3ZMS A;  1CRX A;  5L3G A;  4QNH B;  5LHG A;  2H3I A;  1SRY A;  3OE7 G;  5B1B C;  2YEV B;  1TAM A;  1DLB A;  1ZWI C;  1KQS U;  1SZT A;  1E79 G;  2B5U A;  1XO0 A;  3AG2 C;  3OMN B;  3LNM B;  2GH1 A;  4MS2 A;  5LGU A;  1FS0 G;  3D2S A;  4Q20 A;  2A0L A;  2D3O W;  1ENV A;  2JEU A;  3HKZ C;  2LKY A;  3SQI A;  1RPO A;  3K3W A;  4N21 A;  5B3S B;  5HFM A;  2FTK A;  3ABM B;  4PA3 A;  5KUK A;  3E35 A;  3I55 V;  1S72 V;  4CRX A;  2Y69 C;  1OCO C;  1OCZ B;  2WAQ C;  4OJ6 A;  3T79 A;  2HFE C;  2R9R B;  1ROP A;  2ZIW A;  1HWY A;  4FIP C;  3ZN1 A;  3CC7 V;  1F4M A;  3IC7 A;  4CBC A;  4UVA A;  4WFF A;  3T1C A;  4MVS A;  2PI5 A;  2NNU A;  4OO1 J;  4P0Q B;  4OJP A;  2OT5 A;  1VQP V;  2JGA A;  4BIU A;  1VQN V;  4MW8 A;  1VQM V;  2EIN C;  5CRX A;  4J9Z B;  4C0Z A;  4J9Y B;  3DTU B;  4E2L A;  1CP9 A;  3DEE A;  2WLJ A;  3G6E V;  4R7C A;  3TET A;  5HR6 A;  2LFS A;  2Q67 A;  5B3S C;  2QE7 G;  3NRW A;  2W6J G;  3H0M B;  3ABM C;  1A0P A;  3T4D A;  4TT3 G;  3F2B A;  1OCZ C;  3ABL B;  1VQ6 V;  2WB1 C;  1PNM A;  4AYB C;  1WLE A;  2K89 A;  3PSP A;  1KBU A;  3KZX A;  3CCM V;  1H8H G;  1YT3 A;  2KKP A;  1F4N A;  4PA4 A;  4R50 A;  1KC8 W;  2OXO A;  3I56 V;  4JAU A;  3D2N A;  1W0J G;  3F2C A;  4UVC A;  2IW5 A;  4GFJ A;  1I5Y A;  4BW5 A;  1K8A W;  1YTF D;  4QPJ A;  3C29 A;  1RM1 B;  2Y0S F;  3FYE B;  3CD6 V;  2V7Q G;  3RVZ A;  3CC4 V;  5HR7 A;  1V55 B;  4HYO A;  4H33 A;  4CZZ A;  3E8G A;  4X89 A;  3CCU V;  2HBK A;  4H37 A;  4P9P A;  3ZRX A;  4JMU A;  3M7D A;  2OTJ V;  4JF3 A;  4JTC B;  2JH7 A;  5CN0 A;  3RF9 A;  5E1A C;  4WFB V;  1Q3U A;  2Q68 A;  2XND G;  3JD2 A;  4HAM A;  2G07 A;  1A6S A;  4KP4 A;  4P30 A;  3AG4 B;  1F44 A;  1FXK A;  2YSU B;  4FMT A;  1YIT V;  1XL4 A;  3K08 A;  4UV9 A;  1AI7 A;  4QIW C;  2JMG A;  3QO8 A;  5DM6 V;  2IU0 A;  3CCJ V;  1VQO V;  2K4H A;  3P32 A;  1UPH A;  1JVM A;  1FFT B;  4FPP A;  2LYB A;  4R6Z A;  3BY6 A;  3T4Z A;  1VQK V;  3K0G A;  3F5A A;  5BZB A;  2B1I A;  3LYS A;  1RM1 C;  5GW7 A;  3ZIA G;  4MVM A;  2VJ4 A;  4P2Z A;  2AHZ A;  1XNS A;  2DQN B;  2JHD A;  3SMV A;  4KFM A;  4OJ5 A;  3UM7 A;  2XAS A;  3K04 A;  2JDI G;  1BL8 A;  4GT1 A;  3CC2 V;  1R3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...