1GO3F

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
MIGKKILGERYVTVSEAAEIMYNRAQIGELSYEQGCALDYLQKFAKLDKEEAKKLVEELISLGIDEKTAVKIADILPEDLDDLRAIYYKRELPENAEEILEIVRKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
total genus 33
structure length 107
sequence length 107
chains with identical sequence N
ec nomenclature
pdb deposition date 2001-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1go3F01
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1go3F02
4QIWF 4OO1J 2HBJA 2HBMA 5C0YA 2E1FA 4CDGA 2RHFA 4QJFB 3CYMA 2MA1A 4NLCA 2HBLA 3SAFA 1YT3A 2HBKA 2DGZA 2CPRA 4NLBA 1GO3F 3SAHA 4O3MA 2E1EA 1D8BA 1WUDA 4CGZA 3SAGA 2KV2A 2RRDA
chains in the Genus database with same CATH superfamily
5FPOA 3KG2A 1IM4A 2KZMA 4JV5B 3F2CA 1WLEA 4HYOA 1ZQHA 9ICMA 7ICVA 9ICOA 2E5LB 2F1JA 5J0YA 3LYSA 1JFFA 3Q8KA 4KLHA 1AI4A 3MDCA 4DSKA 5AI9A 2YIBD 3CS5A 1H38A 3C2MA 2YI8A 1GM7A 4PZNA 2QB0B 1J95A 1N4CA 3H1LH 5EC1C 3M9OB 2W9CB 4EFEA 2ZTCA 2ZD9A 1BT8A 1Z1BA 1OCZC 1SQBH 3T1HB 5CA1A 1Z5VA 3BS5A 4XDKA 3AU6A 3W7TA 4BWJA 3N28A 1X9MA 3NGDA 4KLTA 8ICNA 1SESA 2WLIA 1Q5OA 3IC7A 4BWMA 1FYJA 5KFHA 1M56C 3HR0A 5LHHA 3KKAC 4KLFA 2QM4A 1CUKA 4CDGA 4NR1A 1QNMA 5ALWA 3LSQA 2AHYA 3PO4A 4ECSA 2K8BB 2W6JG 1OUQA 4RQ0A 1S0VA 1AILA 2ARHA 1DXSA 1Y4MA 3ASNB 2FJ6A 4RPZA 4LFCB 1ZD2P 2KZ3A 4US8A 3SPIA 3ZDCA 4K0KO 3AG4B 5KAFZ 4JAAA 2YS8A 4R66A 2HHUA 1WPXA 5DECA 2XAQA 2JR5A 5DM6V 1H8HG 2JV3A 3OMAB 5HHHA 3NS1A 1XNQO 5AI4A 2DW4A 2EDUA 1L6NA 1LV5A 4PI0A 3WG7C 2N04A 1HNXO 1EN5A 1US6A 4RQ1A 2VA3A 1ZL8A 3CCJV 1C20A 1X4TA 2CGNA 5KG1A 1L5UA 4I27A 2ODMA 2OIEA 4DSFA 4W4LA 1ZD4A 3RJKA 1B6QA 5CB4A 4B3MO 1KBHA 4B3RB 5AKKA 1JA8A 5JTIA 4XDJA 5TZVA 3GWOA 4AQYB 1N32B 1SKRA 4DRXA 4YCXA 3CEIA 3CD6V 2I5HA 4YJ2B 1MSWD 4YMOA 1VARA 4E2LA 1E1RG 3QZ7A 2YMPA 4PZOA 1XNSA 3D2QA 2OTJV 3WB0A 1QLEC 4TUSA 7ICEA 2LP7A 5KX5A 2X6AA 1D8YA 1VQ9V 1KSPA 4DRXB 4KXRA 4JI4O 1KP3A 4DV2B 2ZIMA 4MVRA 1KECA 5B1AB 5LA6B 7ICTA 3F7YC 3KOOA 2RN9A 1J97A 1L7PA 4C80A 4PGXA 2IA6A 2BSKB 1I94O 2YIBA 2WLKA 2OYQA 4GKKB 2LYBA 4C8KA 4O4IB 2E76B 3CC2V 3RB3A 2HVHA 3HKZC 5C93A 3UQ0A 1XWLA 4F6RB 5AI8A 3CXCU 1THZA 3LDCA 3M7MX 4UB1A 4KN4A 1DRGA 4RT3A 4EX7A 2WTFA 2JJ1G 4YR2A 3G71V 2QDOA 3RYCB 2Q4TA 2F76X 4Q6GA 3SYZA 2CXYA 4OJOA 2YXLA 5IYBO 4FZLA 4C7ZA 1NZPA 1NT2B 4I9QA 1TK8A 1R1BA 2EZYA 4WFGA 2Y69C 1G8MA 3CC4V 4J9NA 1HNXB 5KTQA 3M9NB 2BQ3A 5BXZA 4IYHA 1OHHG 1KDHA 4JTAB 2B9ZA 1EXNA 2J6SA 2LM4A 1F44A 3PSIA 3Q8LA 3HKZF 1ZQZA 3N97B 5DLGA 4YG2A 1JR9A 3QE9Y 3ZBHA 4DOBA 4OPAA 1LUVA 2J6UA 2ATKC 1TFRA 3ZDAA 1Q8KA 5DB7A 2WPDG 2Q8VA 1D5NA 1FFXA 2KNJA 4CGZA 4M9JA 1Y67A 2LGQA 3GV5B 3BPZA 5AIAA 2JH7A 3OD4A 4ZHQB 3CWBH 3BS7A 5ALOA 2DYSC 1IXBA 2Y4TA 4YHHO 2ZTDA 4O2AA 3HKCB 1B3QA 3OUFA 2C22A 2Q7GA 2G0AA 5AHXA 2JH1A 4F6RA 4M04A 1Y6XA 2JEGA 4G28B 1YT3A 3GVMA 5D4BA 3E0FA 4D6TH 1AJQA 3SD7A 3H9VA 2E8NA 5LMNB 2QWNB 3GWKC 2FMSA 4X89A 4X20A 3RT3C 3JASA 2F77X 4DLGA 3MR6A 3F2DA 4E0DA 3LVVA 1MN8A 3SYPA 1L7NA 2P66A 1V97A 2JJ2G 5CA7A 4IRCA 4I28A 3PZPA 3K58A 1BHBA 3NUQA 1NJXA 5LL6Y 4KFMA 4QZGA 4USAA 1H2LA 2IU0A 4MW3A 1S5LU 2ZIWB 4GX2A 4RUCA 4NM1A 2H3OA 4L8JA 3S6JA 1X42A 4X8AA 4U7CA 1XHZA 2ZXHA 2V4RA 1K5SA 1KQQA 4B7EA 3ZJZA 3IDWA 5J2TB 3H4BA 5DB6A 2E3TA 3MD0A 1KKDA 5AM2A 3T4DA 2IMWP 5LGUA 4FLWA 5ALEA 3SQIA 1ZQNA 2YUAA 1NTMH 4YJ2A 3QEAZ 2AZ0A 4BIOA 3UO2A 4UCUA 1AI7A 1ENVA 4YIPA 4C4RA 1P84F 5KFUA 2ZM6B 2UU9B 5KT7A 5AKIA 1JJOA 5J0QA 5ALXA 1PZNA 5IILA 3M7DA 4B7KA 1FIQA 4FBUA 1N5XA 3BS5B 3QU4A 4ELUA 1MABG 5GTHU 1BPEA 3JALB 3QUTA 1S9FA 4UFZA 5FPRA 4WF9V 3RBZA 3PW2A 2CH7B 1I7FA 1M1KW 4O2AB 1VIBA 4OJ6A 1VEWA 3DTUB 2CDYA 5KHKA 4B3MB 2GBOA 3OT7A 3U11A 5GTIZ 4QW9A 3D3QA 3AG3C 4O5EA 4JI7O 2EX3A 4JI2B 4EB6A 3RYHA 2IHNA 5L3EA 1NI3A 2ZIUB 4F93B 1NKEA 4J11A 3B8NA 4M47A 2PZSA 4RQ3A 1Q46A 1HJPA 4DW0A 4QNHB 1NU1H 3I5DA 3ZDEA 4O4LA 1UHUA 2VKQA 2AZ2A 2A3VA 3FAVB 4F4LA 1J5EB 9ICKA 1ZTEA 2HJFC 3ZMSA 4YY3O 4OXSA 3CNHA 4YMNA 1M5IA 2E74B 5GTHZ 1TV9A 1NH2D 5LMNO 4MFFA 4DFDA 8ICVA 2P7TC 5KFQA 4RQEA 1N61A 3OM3B 1JALA 3D2NA 3P30A 4F2RA 2Y4UA 2UVUA 3C2LA 2ZR2A 1M6YA 2RHFA 1IX9A 1CPYA 4QPJA 3ZMVA 4ZI7A 5LOVA 4X5VA 3E22A 5H5NA 4GX5A 3HP6A 4BGDA 1NJWA 4J9OA 1ZQPA 2DBYA 1AR5A 2Y0SC 1NZBA 4DK0A 2CPRA 1SB3C 2NLJC 5J2BA 2ODGA 4PPXA 1X6IA 1I08A 4Q44A 4O3PA 1F4MA 5L1IA 5GW7A 4R8CA 2UUCB 3A2FA 1GH6A 2YI9A 3KHLA 1ZL8B 3CMEV 1TVKA 4XA5A 3E8HA 3TKAA 1WPBA 4P30A 1PVPA 4H0LB 1B22A 1SXEA 1Y76B 3ABKC 4PA6A 5BOLA 5JVDA 4DR3O 4MS2A 1A76A 3GU3A 3ISDA 2DKXA 1DF5A 2ZIOA 4JF3A 2E3CA 7ICNA 4J9MA 2QKQA 1KLNA 1FJGB 2C2AA 3FYEB 4G27B 2FDRA 4Z6DA 2GUZA 1Q3EA 2W9BB 2KJ9A 4IS7A 1SRYA 1KP2A 4QZ8A 4EFBA 1BPZA 2QB0A 1ZRNA 5HMLA 5JU5A 1U4BA 4R7CA 4KHPO 4OO1J 4J9KA 1A77A 2I1QA 8ICOA 4DV6O 4IHJA 2VIXA 3QYPA 4X62O 1B43A 4BXOA 5H2FZ 3NASA 1DK2A 1W0KG 3RYFA 1ZQYA 2CK3G 4JV0A 3R9KA 2XY7A 1OW5A 3F2BA 4WJ3B 3P32A 4RQ5A 2IH1C 4N23A 2QKCA 4KMOB 1DK3A 3MR2A 4U7NA 4K8XA 2V4QA 1S97A 4XRHA 2OXOA 3TFRA 3N7PD 1PK1A 5JJEB 4LF9B 2GWSA 3P3NA 4PHPA 2GO7A 5J2FA 2DQ0A 5KFWA 3J80N 4O5KA 2Z0AA 3CPWU 1OJHA 2XCAA 2QEXV 5L1JA 3RRGA 3ML0A 1FS0G 2XCPA 4DLEA 7ICMA 5E79U 4TUYA 2E8PA 3E8BA 2JXJA 4FBTA 5ALZA 1NK5A 4DV0B 2PGGA 4JI2O 4B3TB 4MFAA 2W04A 2AGQA 4WFEA 5DGAA 4CZZA 5HP4A 1PP9H 3BA8A 5JQGA 3GIJA 5B1OA 3K1ZA 1NQTA 1SQGA 2AW9A 3APQA 4UV9A 4D7TA 3PN1A 1EN6A 4J9YB 2W55A 4UXNA 2BCSA 2WLLB 1IVSA 1XL6A 3AN1A 2HHWA 2QTSA 1VF6C 1LB2B 4O5CA 5JWPA 1H2SB 2ZQMA 3PMLA 4JI0B 4N21A 4Q45A 4TQDA 1R73A 4UCVA 1K5QA 3W7SA 2DUYA 2YEVA 1NKDA 1K1SA 4NKGB 5CB1A 3L9DA 2VJ5A 9ICEA 1S3JA 2GHYA 4PGYA 4UVCA 3HKBA 3AG2B 3MGIA 4X64O 2KKVA 4JI5B 2P6RA 3RTVA 3VBBA 1TAEA 3AG1C 2F43G 1N56A 2BDPA 3ZHTA 3HILA 3SJAC 4QZBA 5EZYB 5J2KA 1HUZA 1M4UA 4LFAO 4JYBA 3PVXA 1NK7A 1RYSA 1OCOC 3HKDB 1ZD3A 3Q8PB 1RZTA 3PR5B 4LF8O 3ASOB 4FJCC 4LWSA 3AU2A 4I55A 1ORQC 5DDYA 2GLEA 4EZ6A 1BSMA 2FMPA 3M1YA 1QQ7A 5LHIA 4DUZB 4QZHA 1WCLA 1WNSA 2AHZA 3CCQV 3JD2A 3FB7C 5ALJA 5CP2A 5KFDA 3T1YO 4KLOA 4B3TO 3D8CA 4U6PA 4LNUA 4AHCA 2K4HA 7ICFA 1COOA 2IBKA 3SJBC 2R72A 4FK5C 4DV3B 3L72H 5DB8A 2PFOA 5FNVB 4HNAA 3W7UA 4NTXA 4LF6O 4DFPA 4EX6A 1JCHA 3OSNA 4IQVA 2HEPA 4QZDA 1H2MA 2BCVA 4ECWA 2JGDA 1YZ6A 1Z4OA 2RNBA 2H3VA 1T4GA 9ICJA 2WB1F 7ICHA 2CTQA 1UA1A 4F5QA 2MW2B 4JAVA 3SYAA 5IY5B 1V85A 1XO1A 4GX1A 4DR1B 3AEVA 1ZYQA 1HR0B 2J6TA 8ICAA 3ZDBA 1X2IA 9ICGA 1S5HC 1A0PA 3FB6C 4OPHA 4JI5O 3UPQA 4DQSA 3AL0B 1VQPV 3I1YA 4UBCA 4QWAA 4LF5B 2QWOB 4RQFA 1RDFA 4RUAA 3ICXA 3JD3A 1Z00A 2KP7A 2BTQA 4EEQA 3Q8MA 4JI1B 2FLNA 1RQNA 8ICBA 5CRXA 2UXXA 5D5PA 1RM1B 1XDCA 3OHAA 1K3EA 2ZE7A 3OEEG 4EKWA 2WAQF 1RG6A 5DN6G 7ICRA 1X59A 4KLLA 3OFNG 4LF9O 2HBLA 2A1JA 4TWKA 2G5HB 2HBKA 5TISZ 4EBCA 1JVMA 1N63A 1VQLV 1RPRA 3SPCA 3TANA 5AKGA 5KFGA 2R8GA 3V6KA 8ICJA 5E1AC 4B9NA 4M2YA 3ZRWA 1TAUA 2JRZA 1SWVA 3NRZA 2ZE8A 3JAMN 2QB1A 1K5OA 4Y2YA 5KG0A 4CNQA 2BOBC 2FL4A 2Q6AA 3IP4B 4RPYA 1B04A 3CW2C 2YMQA 5IDJA 1VQMV 4F5PA 2HBJA 5EE3A 1ZQSA 3CRAA 4IIJB 1HIWA 2XVTA 4X65O 1ZQBA 2M7WA 2GTSA 2JGAA 5GONA 4JI4B 5LHGA 4DXWA 1XBLA 4QZFA 1M57C 1RP3B 4J42A 3RBDA 1MOFA 1OCZB 3VQWA 5IJ0A 2HR3A 1JXLA 3Q4HB 4IQTA 3KFUF 2IJKA 1URFA 9ICWA 3T1YB 1JOYA 3B2EE 4ECVA 1MNGA 3BHPA 3NR7A 4MVQA 1HW7A 3C28A 2RDCA 4H44B 3UXOA 1SQFA 2A3QA 1E79G 2AXTU 2LM1A 2EULA 1VF7A 2V1DA 2P5OA 2BCQA 3UXNA 3DDHA 4FFBB 3UQ2A 1XI1A 1BQZA 4FVMA 2HG5C 2XIDA 4FFDA 4OJ5A 4J7JA 1I0HA 5ALSA 3UM9A 3O65A 8ICUA 4DL4A 1KC8W 5KG6A 4TV9B 2BCUA 2R70A 3K57A 4EBDA 1C7YA 2LW7A 4KTQA 2RMKB 4LH7A 2KK0A 3RRHA 1ZQKA 1L0NH 2IJJA 3F5EA 4X1YB 4F4KA 4JI3O 5CBHA 3WB1A 1ZETA 3UQ8A 3TGUH 4ELTA 3ZIAG 3BQ0A 4NB5A 2W0XA 5EE0A 3C2KA 1XS9D 2LQTA 2ZTEA 2D3OW 2JHDA 3TJTA 2WLIB 3RR7A 3CCSV 1MC8A 5KAIZ 1CP9A 1YZBA 5IY5C 3QX7A 2BGWA 1NK0A 2H5XA 3PW4A 2JZBB 5LA6A 4G9BA 1JIHA 1KYOF 1KKXA 2G09A 3ONNA 4OD0A 4UAZA 5KHHA 3OHBA 8ICXA 3RYFB 5J2DA 1IXMA 2PFNA 2EILB 3RB0A 4KLQA 1KRPA 5B66Z 3VQYA 2FPLA 4P4MA 1ROPA 2KFZA 4UB3A 2QM7A 3VQVA 2B1GA 2I6XA 5BOMA 2W8LA 1ED1A 1UT8A 5ALHA 2Y1IA 1ZQRA 1H2GA 1RSOB 1SZTA 1TGOA 2GUZB 4LR3A 4PI2A 2E8OA 1AQ6A 3R66A 3W7XA 1VQ5V 4LWSB 3QVNA 2F93B 1XOUA 3MHHC 1NJYA 3CHXA 5KFMA 3JSNA 2BSKA 4RNOA 4QIWC 5LP6C 4B9LA 1PD3A 3APOA 5L3CA 1K8AW 3QEBZ 4TOIA 3UMBA 3BQTA 1BNPA 3ZHRA 3ZDDA 3ABUA 3OAAG 1UCVA 4JWMA 4P4OA 2LKYA 3KCXA 2KSOA 1YDXA 3H8SA 5EOZA 3M6ZA 1NR7A 2W6IG 3K0GA 1XMQO 2ZXWB 1W59A 3OSPA 4DR5O 1NVPD 1MZEA 2YMLA 4J9LA 5GONB 1L3SA 5CBFA 4X65B 2LGWA 1Q81W 1MZFA 4TQRA 4UBBA 3QZ8A 2VJ4A 1R6NA 1FPOA 2DOSA 4F71A 5BZBA 1DLBA 2A9HA 3D36C 3H8JA 3ABLB 2OCHA 1Q8IA 3V7LA 2W9MA 2XI9A 3H4DA 5JH7A 3Q8QB 4QIWF 4B9UA 1N62A 2HSZA 3C1ZA 2EAMA 2Q7HA 3L5KA 4I0XB 4CC6A 1RM1C 3WU2U 2YDEA 4NTYA 3B0XA 4PJ0U 1NKBA 2KJ8A 3H8MA 4QJFB 3K59A 3KBBA 5J0UA 2QM8A 1LNQA 4O0IA 4NLCA 1XO0A 4C4SA 8ICGA 4X66B 2LYHA 2UU9O 4US9A 5ALPA 1W0JG 2KQXA 5KT6A 1CEZA 2ZIUA 2AU0A 2QTOA 4NLBA 4DV1B 3PW5A 1BCCH 5KL1B 4EEKA 3PX0A 4GKJO 5KFEA 3JD4A 1S0NA 3M9MB 4PDMA 5J0SA 4PL2A 5KHJA 5EE1A 4FIPC 3RFRA 2WA3A 1ZQGA 2YIDA 1D8LA 1B4FA 2OCEA 4HAIA 5DBBA 1WYGA 2QWRB 4JI7B 4JI6B 1M90W 2NRZA 3HKEB 1IBKB 1GM8A 2HJDA 3AG7A 5CN0A 3B9JA 2I9GA 3F53A 1QSYA 1SKVA 3CXHF 4DUYB 1JX4A 1PM9A 4X9QA 3V7KA 5ALGA 2DFLA 3C90A 2CTWA 1Z1VA 4RT2A 2Q68A 4F50A 1L0LH 4Z6FA 4KLUA 1ZAUA 3JATB 1GO3F 4DV4O 5J2AA 2KKWA 3WFVA 3AK2A 4PA9A 5IIIA 2HOIA 3HPLC 3MDAA 3LWMA 4YD2A 2WLMA 4MTXA 5FLXN 4A8EA 1QVGU 2GH1A 3F5AA 4OCZA 1SKWA 2H3IA 2BPCA 2K8CB 2FE9A 3AM9A 5TISU 1V55C 3L73H 1K9MW 1X9XA 2YQEA 2NNUA 4P4PA 3DSQA 3H1JH 5JUMA 1Y66A 2EH9A 2D6FC 1COKA 5D5QA 4ZIBA 2OH2A 1BPBA 3SYCA 4OJLA 1BL8A 2ISPA 4JTDB 4A5UB 3GQCA 1ZQWA 2FKXA 2KJ5A 4O4HA 4PHEA 1XMQB 3JD0A 5DG9A 1VF5B 1WP8A 3CRCA 4LJXA 2CE4A 1XSPA 2JDIG 4ZKIA 3CMAV 1TVAA 5IYDO 3ZN1A 5KT3A 3D6JA 3SAHA 1QTMA 4FLXA 3SMVA 4B08A 1OZ0A 3EPIA 5F9NA 5B5EU 5DBAA 2DGZA 3NRWA 1Y74A 3WKCA 3KTQA 4H37A 1N34B 2K9PA 5J0OA 1FFUA 1ZQCA 5IJ9B 3ZHQA 1OV9A 3BAAA 3BDPA 1OCRC 3MBYA 4PH5A 4DV5O 4ECXA 1MSDA 3EPGA 2EIMC 1IURA 3NVWA 3VCBA 2OYYA 2Q5ZA 1NKCA 5AK3A 3B09A 4DV0O 1N36B 4KLEA 4PHAA 3C29A 2HOQA 3FD9A 1KU9A 2E5SA 1HEKA 4JUZA 4PA7A 5J0XA 3UM7A 1ZQQA 1R3JC 1T8EA 1ZQ1C 4PELA 2BR0A 1MG1A 4CH4A 7ICSA 1VDVA 3QU9A 3IRUA 3WK6A 5B1BB 5LBQA 4DF4A 2FMQA 5J0TA 1G1XB 2YSUB 3SGIA 4EYHB 5C0YA 3PSTA 1AI6A 5KA5A 4QWEA 4TV8B 5DEDA 4AI8A 4HNAB 1GTOA 1SL0A 1PNLA 4DV6B 1N33O 4Z1VA 1NTZH 1Q6HA 1R3IC 3FYIB 1VQKV 1KD1W 1X66A 5KG5A 1MQ3A 2BPGA 8ICKA 2ZT9B 4RQ7A 1NBMG 4BW5A 4IT5A 2UXDO 4ED8A 1U9LA 3JSLA 5IWAB 2UVVA 4DQIA 1SV4A 1Z3EB 2W54A 2NN4A 2UUAO 2ZG6A 2A7WA 2KIWA 3K9SA 4MTFA 1K4DC 1QCEA 1XL4A 4DL6A 4H33A 1FFVA 4OGQB 5B3SB 4GUNA 3IHQB 3C21A 4M9NA 5IT9N 2DQ3A 4UAWA 3HRDD 4KX5A 4BIUA 2UXBB 2UXCB 4ECQA 4Z6CA 2CN1A 4B3RO 4I2DA 3ED5A 2Q9LA 3VOUA 1ZRMA 2JGDB 5FP0A 5DBCA 2H3ZA 2HVKC 1GM9A 3OEHG 3WK7A 5HMMA 4WFAV 1PK3A 5DQIA 4U3JB 4PHZA 4JB3A 4ECTA 2DL0A 3IV6A 2HHSA 3ZD9A 2DF4B 5AKLA 1U97A 2MU2A 3FYHA 3GIMA 3K08A 2EINC 3ETRA 9ICSA 1L7MA 2WF6A 5JRTA 2Z3YA 3NXSA 3G6EV 1FXVA 1SZHA 1COWG 3ABKB 4DL3A 4R65A 4QZAA 3X2QC 3QNMA 4YQWA 1TE2A 5ALKA 2E75B 5J8YC 4U3FH 4DW1A 1S10A 3RJFA 4BX9C 3BRCA 2H3FA 9ICPA 4J10A 4KLMA 3UKMA 2DYRC 3OTQA 4TQSA 4DWIA 3PY8A 4GXKA 5KFIA 4UW9A 3CCUV 4KL1A 3ABTA 4ZOLA 5B66U 4FO6A 4HBNA 4IIJA 3OTOB 1Q82W 1YSCA 3ISCA 1Z19A 2BQRA 1B06A 1H2KA 8ICTA 1UT5A 1TA8A 2OIGA 5KUKA 4DQRA 3K3WA 2AGOA 4UB2A 5B3SC 3SR6A 4YHHB 2BQUA 2AXTZ 3G4SV 9ICCA 2QKSA 1NK9A 5LYJA 2FMLA 2G38A 1Q6UA 2HOFA 5KG3A 4PGQA 1AR4A 2RDJA 1QLEB 1SQPH 2XAHA 2ZCEA 3QO5A 5KFKA 4Z1MG 4PD4F 4U3JA 3U10A 4MEXA 4LZGA 4P0QB 1SA0B 1QQ5A 3SENA 4PJ0Z 1OCRB 4NXNB 2YB4A 3DC5A 1HNWO 1NZ6A 1N36O 4OJPA 4AILC 2KVSA 1D8BA 2HLDG 3TFSA 5K4LA 3A0RA 1JUDA 4O3NA 4DSIA 2W8KA 5J2JA 3B4SA 7ICKA 3T4ZA 2C2DA 3CE2A 3OR6C 2PI4A 1I5XA 2EAPA 3RN4A 1KTQA 2R8IA 4DCCA 4DQQA 3ZMUA 3TQ1A 3D36A 3LNMB 2UUBB 3CCLV 4GC6A 2W9BA 3H0RB 4AYBF 2JVDA 8ICMA 5CA1B 2XAJA 1N34O 2VQEO 3BVOA 2EIMB 8ICLA 2AHOB 5CBGA 4FLVA 1HWYA 2WLJA 3CRMA 4U7OA 5EBWC 1L7OA 3QO7A 2F23A 2G07A 1R3KC 3UMGA 4O4HB 4IL6Z 2CGOA 4ABMA 2QARA 3ZN0A 3JALA 3M99B 1IZ3A 4NL9C 5AM4A 4PDRA 3SJQC 1B0XA 4I2CA 4JASA 1IDSA 4MSWC 3B0YA 1MA7A 2XAFA 3RVZA 4K4HA 3NVYA 4BIZA 2YN4A 4P0QA 2WA4A 2Y48A 1Q6IA 1L8DA 2BTOA 5ALQA 4AYBC 4X20B 3SPHA 3RJIA 3UT5A 1M93A 2Z7JA 2IOHA 4YXWG 2N1RA 4MFCA 2KIVA 1RXVA 1MMMA 1JROA 1AJNA 1DOQA 3JPTA 4CC5A 5L1MA 5ALRA 1IIPA 1NS1A 4UB8Z 4UB8U 4OX9O 1V54C 4XQ8A 1J2MA 3BZKA 2B6GA 2H3QA 4UAVA 1SF9A 5B1AC 1U48A 4DO9A 2R9AA 1FEZA 4IQUA 3GFKB 4IYIA 3STLC 3V7JA 4KLIA 5CA3A 3RF9A 1XHXA 4C0ZA 3GV8B 3ZX6A 5KFYA 4WFBV 1QCKA 3ZEDA 5H2FU 1ECWA 2V9WA 4JI8B 5ALFA 5IINA 1HUOA 2Y0SF 1F4NA 1M9NA 3B77A 1NK6A 4NYKA 2KSOB 4UB6Z 2K60A 1F0MA 4O4LB 4DR4O 1PVRA 2A1AA 2GDSA 4YD1A 3MR5A 4ICAA 4NXZA 4CF4A 1L8OA 3PW7A 2HHQA 2XASA 3K0DA 4I2JA 3MDSA 1M57B 4UV8A 3RGBA 1K1QA 2WF5A 2C28A 4I4TB 3V72A 4FLTA 1ZQAA 5AKXA 1D9DA 3K03A 2ALZA 4Y2RA 1FXHA 3SDLA 5AM1A 3VC8A 1KFDA 4Q8FA 3DXRA 3AG3B 5KMGB 3T1HO 1JMSA 3RYCA 3QUQA 7ICOA 3B40A 3TI0A 5GTIU 1HP8A 3AK1A 3JAWB 2UXDB 4NXMB 2IU3A 1GKFA 5EYPB 4JI0O 4PDVA 4KLDA 3OR7C 2PYJA 2Y9TA 2VQEB 4JZ2A 3HKDA 3I76A 3LDEA 1HNZB 4LFBB 3E8GA 4DO2A 4X88A 3ZI4A 3PSFA 7ICQA 2IW5A 5KA6A 4DS4A 5HR7A 5J2GA 1FXKB 4TUPA 4Y2JA 3ZS8C 1V38A 1HNWB 2FLLA 1EN4A 1LR1A 1FO4A 4DL5A 5J0WA 1GMGA 3TADC 1XU4A 1YEWA 1F23A 4WCEV 4ZH4A 2ZDIA 5C5JA 1ZJNA 3AG4C 5ALMA 2K1EA 3THOA 2MRLA 5E79Z 5JCOC 4DV2O 4P2ZA 1GN2A 4GT1A 1YJ9V 2UVWA 4ZBMA 2VWJA 5CB4B 3CCEV 4C7UA 2BDUA 4DV7O 2F8LA 3JPQA 8ICQA 2W0FC 3I28A 3AG1B 2P06A 1PL0A 2RP5A 4X62B 1XSNA 2EIKC 4RQ2A 3ISBA 2F8KA 4QGPA 2EQYA 2ZE6A 3IM1A 2XY6A 2UVRA 2EAOA 2PFPA 1XEQA 2G5IB 3HWTA 2Y0PA 4YMMA 1BQ0A 4I7ZB 3TAPA 5DG7A 4M9HA 4O9MA 5L9XA 4UCTA 2XGQA 4NXMO 1WA8A 1N2XA 3SEIA 4RU9A 3RAXA 4JYYA 4DR7B 4I2FA 1J2NA 1OCCC 4DOAA 3T5LA 5IJ0B 4IRKA 3SV4A 3ETDA 3M8SA 5HR6A 3DV9A 2X0LA 3GIKA 3NVZA 4CS3A 2KKPA 3B8MA 1LKYB 7ICGA 4C7YA 3ZD8A 5KFPA 2FB5A 3ABMB 2QWPB 4P0PA 5EWEA 2IJIA 5CA0B 1SIJA 5CR0A 3E83A 4I50B 2NRTA 3QNEA 2CRXA 5B1BC 2W3RA 2PMZF 1YTFB 8ICHA 2EZXA 3CRXA 4BW9A 5KT5A 1UA0A 3CJHA 2M9NA 4YXMA 3HB3B 1ZUQA 1GRJA 3L74H 1EZJA 3DGEA 4CF5A 4DV4B 1RSOA 5DQGA 4GC7A 1AP5A 4DYLA 3C5GA 3K75D 5KFNA 3NVVA 3HKBB 4W4KA 3K5MA 2ZUDA 2RDIA 2KD1A 2R8JA 3TACB 3CC7V 3G6BA 4ICGA 4XDLA 2VA8A 2F1IA 3PSPA 3FX7A 3O9OA 4DR4B 2YC0A 5KFSA 5H9CA 3J81N 2NO5A 3QU5A 1YF2A 3T2MA 1U96A 2KMDA 3FM9A 5L1KA 1XILA 4LP8A 2Q67A 1DF4A 1G6UA 1U49A 2Y0IA 3N2GB 4DUYO 2HP8A 3FB5C 5H6QA 5IIOA 4I2BA 2HW3A 1LKYA 2RQ6A 3F7VC 1ZSPA 1WCNA 4JI1O 4RQ8A 2KFNA 4Z2WA 3JAKA 1YJNV 4UVAA 4JWNA 4J80A 4DSEA 4I29A 1AB3A 3JCUZ 2YMMA 2LMRA 4YVZA 2W7OA 4PA3A 2CAZC 3CP8A 3EZ5A 2GSMB 2WB1C 3RR8A 4Q8EA 2KG5A 4MW8A 4OX9B 2AQ0A 4I2EA 1S0MA 1YZ7A 1NR1A 3OE7G 4WFFA 3X2QB 1K4CC 2D3DA 2IHMA 1GK9A 1ZQUA 5CA0A 1SZPA 4J9PA 1F51A 4CF3A 2Q7EA 2ZNJA 1HDJA 4M6WA 1NTKH 2N05A 1JFFB 3EYZA 3OMNB 1TUEB 3TK1A 2D2CB 3MABA 5AICA 4LFAB 1VF6A 2PY5A 4RAIA 3FDSA 4JV1A 4G3IA 3PW0A 1IBMO 5J2UB 3JARB 2DWEC 5KFBA 5J0PA 3SPJA 1L3UA 2WAQC 1K73W 2EINB 2XC9A 2L35A 5KFVA 2QWQB 4IR9A 3QU2A 3JD1A 4E4EA 4C8LA 1LVHA 4Y2TA 1M56B 1ZOLA 3SR2C 2MSNA 3HPOA 2P6UA 1S76D 4PDLA 5IWAO 2LBOA 3H1IH 4KN7A 8ICYA 1QHTA 2F4VO 4DR7O 2AQ4A 1S8OA 1S0OA 3ABMC 2ZIWA 1O9HA 4JTCB 3OPXA 3UXPA 4KP4A 4QZEA 1KFSA 5DLFA 2Q69A 2B5UA 4FPPA 1HNZO 4LF7B 2DQNB 1CRXA 3JASB 5IE9A 8ICCA 2W9CA 3CP1A 1HR0O 4J9RA 1Y88A 1RXWA 3OTOO 4I50A 1BHAA 1KB9F 1X9WA 3U26A 3KKAA 9ICQA 1BVSA 2W03A 4CCHA 3OJUA 4MVMA 2N74A 1IBLO 4FLUA 4I4TA 1RFYA 2E1EA 4Q20A 4R63A 3CJHB 2H94A 4UCSA 3ZMTA 1MA1A 1WJZA 8ICFA 8ICSA 1XNQB 3GZFA 5ALYA 2LFSA 1SL1A 2NO4A 4BJQA 2KHVA 4JYAB 1PKXA 1IBMB 3IC9A 3JATA 4RZRA 1RPLA 2F95B 5LXTA 4WBNB 3MC1A 3SYQA 1IG6A 2PKEA 4GCZA 3E8FA 5J2EA 3WKDA 3HKCA 3MAQA 4C8MA 3SAFA 4DV7B 3C23A 4NWIA 5BY1A 3THVA 2XUMA 2KE7A 4QNLA 5DG8A 3LSSA 2D8CA 1D2DA 4PL1A 3WKEA 2KZZA 2K89A 2MK3A 3J7AU 3NTUA 3BJYA 2JK5C 2FYUH 4P9OA 1ZX3A 5AM5A 2A06H 4M0AA 2KTQA 1SZXA 4MTOA 5KUMA 3JPRA 2XO7A 3R65A 4R50A 3JPPA 3IFXA 4J9ZB 1L8LA 3N2KB 5F2VO 3H7IA 4TV9A 2VQFB 2AJQA 4MHVA 4F6EA 1J5EO 4UB4A 2WLLA 4P9PA 5B1NA 3WKBA 2IM9A 4NY8A 1K92A 2ZINA 1T94A 1T3NA 2ZXWC 4UVBA 2JRIA 3UCSC 7ICPA 4DR6B 4UARA 5IIJA 5KFCA 2DYRB 2XICA 3CB2A 3G67A 3CX5F 4X1IB 4DR3B 3EW9A 3SV3A 1MQ2A 5AK6A 4UQGA 3OGCC 3DXRB 4X66O 1YCIA 3I55V 4QWCA 3DEEA 4I2GA 3ALRA 3D3IA 3EXAA 3QUCA 3LDAA 1IV8A 2LYAA 2VA2A 2QARB 1L1FA 2BPFA 1XNRB 3K79A 3QXGA 1O9GA 3A8TA 2PMZC 4NV0A 2ISOA 2DPIA 4K3AA 1S72V 1GAXA 1BZKA 3K5NA 1H2NA 4DK1A 4DSLA 5L3BA 1SERA 5EBMC 1W2BU 1NJZA 4CH5A 1Z00B 2O6KA 2LHTA 2OCCC 1SV0A 3MFHA 3G6XA 3JPOA 1NK8A 3A0BU 4CS2A 3MGHA 2E8MA 2RRDA 1PNKA 5EC2C 3UT5B 5AI6A 4BAYA 2ZIXA 3BFRA 5IYZB 4K4IA 5EWFA 3FFQA 3OUSA 3WU2Z 4B3SB 4ED2A 3C3SA 2K4IA 2WSSG 1URJA 2EJRA 1ZQTA 1QQCA 1QQ6A 2W11A 3ASNC 4LF4B 4DV1O 2BOCC 2EANA 4MTGA 4FM2A 2JEFA 2F2AB 3ZRWB 2XHBA 4FLYA 1WB7A 1GN3A 1IXRA 5AKZA 2KICA 9ICRA 5DB9A 5DGBA 4ED7A 5KG7A 1YHQV 2JEJA 4D7SA 4DR6O 4IR1A 2P4VA 2V4DA 5ALUA 4LF7O 5C8YA 3PV8A 2FTKA 4AQYO 1ZQVA 4F5NA 4IC9A 3F5TA 3RH5A 1N32O 2WLNA 5KNIA 4ECZA 1X6JA 4MVOA 5L3GA 9ICVA 5JJJB 2XGPA 3RH4A 3WK4A 4HYKA 5JQGB 2HBMA 1QBZA 1FKAO 5HFMA 3M8RA 3G80A 4FLZA 1PL4A 3LVWA 4RO2A 4MF2A 3L3FX 2HVIA 1SA0A 5C8YB 1SKSA 2DWDC 1SETA 1XNRO 1ZQLA 2ZKOA 4UASA 3E89A 1XQ8A 3RYIA 1NJIW 4FZNA 4RQNA 4JI8O 4J9SA 2NRVA 4QZCA 1P7DA 5LGNA 2LPEA 2QKAA 2Y69B 9ICAA 2A79B 4BUGA 4DL7A 3RAQA 3U0ZA 3LUTB 4DR1O 4TSFG 1KUQA 3JAWA 3IN5A 1T5EA 2W43A 1JRPA 1U45A 9ICFA 5KG4A 5EWGA 1Z4NA 1R6TA 2EIJB 4FFKA 2NYVA 4TV8A 4NXNO 5BMVB 4RNNA 3E2EA 1QU7A 1SQQH 2HHHB 4FM1A 1WWVA 1F5SA 3T5JA 1S5JA 4YXJA 2ADQB 4I0XA 2CUGA 5JCOA 5LP6B 4LCUC 5FNVA 3ZHSA 1N60A 3AQEA 5H6RA 3WB2A 2AH5A 5ITZB 5J2TA 4GIBA 4TT3G 4GKJB 1NVPB 2R8HA 1ZQIA 1ZQEA 5AKYA 2JEUA 2AGPA 3M6KA 2F1MA 1JJ2U 2B0CA 4FZ0A 4B9TA 1FXKC 2KEYA 4GKKO 1XMOO 4LFBO 4P2HA 5A2QN 1TKDA 4Y2SA 4DS5A 3QG5A 4I2AA 2Q4PA 3SYOA 4F72A 3E58A 3LNNA 3PJSK 4DQPA 4DR2B 1WA8B 5KFTA 5AK4A 4JMUA 4C8NA 3ETGA 4DV3O 2ASJA 5KX5B 2YY6A 4R6ZA 4CH6A 4HZ3A 4X1KA 3QTCA 1PV0A 1YJWV 4WBNA 4KMUA 1WAZA 1Z2GA 4NLNA 1N0JA 5J29A 4KITB 2HFEC 1NH2B 5AKHA 4C4TA 1JMKC 4WFHA 4LF8B 2HHVA 3T3FA 4F4YA 4F8RA 3EUB2 2E5LO 4RQMA 2MUTB 5J2CA 4UCOA 1YTFD 1QR9A 2PUSA 5KFRA 1K97A 2VWKA 5K1XA 3ZMZA 3KZXA 4ZOLB 5ITZA 2ZIXB 5LMUO 1FD9A 1Z5WA 3FAVA 5J2IA 2KN7A 3C5FA 3F5WC 1FFXB 3RH6A 4L87A 5HNKA 1BE3H 4O2BB 1O08A 3OGIB 4LF6B 3LWLA 2OWOA 3RW0A 3CRRA 3BA9A 4IQWA 1X9SA 4HAMA 1UPGA 2XY5A 4MVUA 1VQOV 1VQ6V 1P4RA 4LH6A 1WP7A 2P22C 3FAHA 3FC4A 9ICTA 9ICHA 2HVJC 2EZZA 2NRWA 3A0BZ 4JZGA 4YR0A 2JEXA 2LW1A 3E22B 1A32A 2EBOA 4FZ1A 4M6WB 1U47A 2L6LA 2QSAA 4FZMA 1QVFU 1SWWA 2WHEA 1P49A 1RPOA 5DKWA 1NI8A 2JS3A 2VRZA 4Y2UA 3C3TA 4FS1A 1RM6C 3CYMA 1BGYH 4ZHQA 3GDXA 1O03A 4NLZA 3IGAC 2FPKA 4R8UA 4KLGA 1ZQJA 3KCYA 1PVQA 4F5RA 4BDPA 4QZ9A 3CSXA 2IBZH 1KL9A 2OTLV 4R64A 7ICIA 2Q0AA 4EB6B 3QU7A 2R8KA 2YX8A 4UB6U 3K4GA 4QWDA 1RYUA 5ALIA 4O3OA 2IH3C 1EBOA 3H0LB 1V54B 3VQXA 4BWAA 2XTAA 3PR4A 2RCVA 4NL9A 1KFTA 2DE0X 2CTPA 3KZIZ 2B21A 5AK5A 5IIKA 5AM3A 3ETLA 3PNCA 5IIMA 4DF8A 1D5AA 2X6BA 4YN4A 2P90A 2YXHA 3KHHA 3BZCA 2JS5A 1FXKA 5HHIA 9ICLA 4ECYA 3RWRD 2XAGA 5J0RA 1PK1B 2K4PA 1L3TA 3GB7C 1BGXT 9ICIA 1KKCA 9ICUA 3AUOA 1XC9A 4QWBA 4J41A 4X1IA 1BS3A 3RJJA 3SPGA 4CE6A 2A0LA 5IJ9A 5KFZA 4Z6EA 1Y76A 2ZE5A 3ETEA 2FPMA 4I2IA 2ZIVA 1SGGA 1BNOA 2ZUBA 1F7YA 4CH3A 3LSUA 1S5LZ 4LF4O 1EZVH 4LBEC 2KV2A 3RVYA 1VQ4V 3JPNA 2ASLA 3O0FA 1KW4A 1ZQOA 2Y1JA 1QLNA 4JYCA 2KG7A 2ZR3A 1ZXIA 2BCRA 1YXBA 1YI2V 1RYRA 1VQNV 3QUBA 2ITCC 5HFLA 3KHGA 1P7BA 2BKEA 2V7QG 4GYCB 4BR6A 4JI3B 4NLGA 1WWUA 2WF8A 4ZI7B 4LFCO 2PYLA 5J2UA 1Q3VA 1XREA 4KLSA 1K7DA 4QPKA 3RJGA 5DQHA 1T7PA 5K1PA 3SAGA 4RWUA 5ALDA 3JCZA 5D46A 1N5WA 2ZDIC 5JVDB 4MVZA 1X40A 2QJ1A 2Q0OC 4KLJA 4JPRA 2UUAB 1UQVA 5EE9A 2EZPA 4XBFA 2F1HA 3BQ2A 4DOCA 4YY3B 5EBLC 1JX9A 1YVWA 4JV5O 2HMXA 5L3FA 1AR1B 2MA1A 4TURA 2KB1A 1A6SA 4NM2A 1CI4A 3QO8A 3Q8RB 3IJ4A 2UXCO 4NVPA 1IBLB 5EK0A 4C8OA 4ECRA 3K9AA 2JMGA 2HHHO 3AMZA 2GTAA 4JV2A 5AKEA 1G4YB 2EILC 2KG7B 1Q43A 2Q0ZX 4IL6U 4ED1A 1Q3UA 2DMXA 2WLHA 5ALLA 5BR8B 5J9PC 1PUZA 4MEYA 4PA4A 2EIKB 2ZUCA 1JXEA 4RPXA 3V6JA 1VP7A 3RJHA 2NR5A 5AM0A 4XUSA 3OTFA 5IYCO 2GV9A 1I94B 2ILMA 2PXIA 5JH7B 2ZXIA 1PPJH 3L75H 1P7GA 4IHJB 2G08A 3HKEA 2QLTA 4M9LA 2HHTA 1T3QA 5LMUB 3N2KA 1SXDA 1ZWIC 1SV0C 4R8UB 2PTMA 5KFFA 1WUDA 2OM6A 2ATLA 3H40A 3S3XA 2KHQA 2YXYA 2FI1A 2X6CA 3BEHA 3ETQA 9ICNA 2LI6A 4Y2XA 3CCMV 3W7WA 5D49A 1AROP 1KMIZ 2B1IA 2NRXA 3MFIA 1NOMA 1JN3A 3FKSG 3L71H 3H1HH 1QR8A 8ICRA 1EFRG 2VANA 7ICJA 2YIAA 1DGSA 1BPYA 5ALVA 2WAMA 4I5SA 2WFAA 5CJ7A 3OW2U 2PFQA 4JI6O 4H13B 5KL8B 2EJ7A 2HI0A 1UPHA 3AG2C 1GN6A 4YP3A 4ED6A 2JGUA 1WN7A 5CWRA 5KAIU 3N4MB 1AI5A 2ZJ8A 3E86A 1Q86W 1OXJA 1BMFG 3H8WA 2DJVA 1ZD5A 1Q90D 4UAYA 3D2SA 3BY6A 3H0MB 3N7RC 3K1RB 4Q43A 5A9GA 4X1YA 2VQFO 7ICLA 3K5OA 4UAUA 2GOLA 4TUQA 4JGSA 2ETNA 4ACOA 4GXJA 3WK9A 4RUEA 4GLXA 9ICXA 3JARA 2L5YA 4DV5B 5KHIA 2A19A 2LJ2A 4B9SA 5KFLA 1VQ7V 3KHRA 2IJHA 4ASUG 4DFJA 4O3MA 4MT8A 4CRXA 2BHNA 2JZBA 1TAQA 3UMCA 5AI5A 4J7ZA 2IOFK 4O3SA 2Z5UA 3EFFK 2ZM6O 3KZIU 3MGVA 3ZHVA 4M9GA 3HJEA 2P35A 3S3WA 3MR3A 3RFAA 4F5OA 1KN5A 3HW8A 3ZHUA 2Y9UA 2M6YA 4JYAO 2UXNA 5BMVA 4O3RA 3TADA 2ES6A 4CS4A 8ICIA 4GFJA 4DSJA 3EVKA 2OCCB 2X7RB 4NTWA 3KD3A 3G6VA 2O57A 2P4KA 4RQ6A 5AIBA 1VLBA 2OHFA 4FFBA 2ZJ5A 1NNLA 3GV7B 4LC1A 4QZIA 1V55B 3TCUA 4G2KA 5ALTA 2XNDG 3EHBB 4QE9A 2A1JB 2F66C 3RYIB 4GZRB 5LOVB 4YR3A 3RB6A 3ABLC 2YB1A 4GX0A 5G5HA 5EIBC 1OCCB 4B3SO 5EYPA 2CH7A 2DYSB 2ZIVB 3WK8A 3N2GA 5CMUA 4RQ4A 3GILA 1R3LC 2WWWA 4NJ8A 2YTUA 3AK3A 3IAYA 3JAKB 5KHGA 7ICUA 1H8EG 1JI7A 3RBEA 5LXTB 1JPXA 4DFMA 1N48A 2R9IA 1AJPA 3RJEA 4O4IA 4X1KB 2VS0A 2UXBO 1VJ5A 4RUFA 4KUMA 1YITV 2HCFA 1PNMA 4DUZO 1AVMA 3TXQA 4EEYA 5BPCA 1N33B 3BABA 2JEIA 3AEIA 3I56V 3KKYA 1DK1A 2K8AA 3K06A 4DEZA 2HDOA 4FMTA 3UO3A 4EZ9A 2DKZA 5ALNA 2OEHA 1FFTB 1K33A 1LUWA 5L1LA 2XOKG 2E1FA 3RB4A 1DTOA 4NLKA 4O2BA 5J8YA 2QR4A 3CRQA 2MUTA 3JPSA 2KVCA 5KFAA 1XSLA 5BR8O 5IYZA 4P0PB 1KBUA 3C1YA 2W9AA 1WG8A 1AP6A 4B9MA 3IG5A 1IBKO 4KHPB 1TK0A 4I55B 8ICEA 4GXIA 4I2HA 3OMIB 3WK5A 4YJ3A 3SI8A 1R6KA 1QSLA 4LNUB 2W7PA 5KMGA 3OJSA 3M8AA 3SZ2A 3N27A 2LFRA 4K4GA 3ZCCA 2MAXA 4DR2O 2H8PC 4B6JA 3ASOC 2KSDA 2RJZA 1ZQXA 1KEJA 3GIIA 4F3OA 1SQVH 4LF5O 5KFOA 3E35A 1S77D 4ECUA 1TK5A 1UJWB 2F3NA 4LVSA 4O4JB 1Y74B 2EZOA 4YIOA 5JJNB 4O3QA 2FLPA 4DL2A 3K5LA 1UFIA 1Q7YW 2BTQB 2QA4V 3L4PA 2M0NA 2BE3A 1VQ8V 8ICWA 5FL7G 3H1KH 3T1CA 5T14A 5AKJA 3Q4HA 3MHSC 2RQ5A 2ZJAA 4UB5A 2Q73A 2P67A 3T79A 5A0LA 1BPXA 4MVSA 1SC5B 5F3XB 4J7KA 5LP6A 2HKOA 3P3PA 3DC6A 3H01A 4J03A 4Y2VA 4ED3A 2ZNIA 1JQ0A 2JIZG 4RNMA 5AG2A 1BPDA 1SS3A 3BQ7A 3TAQA 2QE7G 2ADPA 3JYCA 3CCVV 4UATA 1ZQDA 1V9PA 4F91B 3T5HA 5B5EZ 5L3DA 2DWQA 1L3VA 1TAMA 1DGJA 2WF7A 4TUYB 3G6YA 2QGNA 5KAFU 2UUBO 4J9QA 4QE7A 5EIBD 1VMGA 2DN9A 1SQXH 3PMNA 3N7SC 2IOFA 3ORYA 4Y2QA 3WKAA 1ZLZA 3CCRV 4EBEA 9ICBA 2C2RA 4PV1B 2OT5A 1QH9A 1QSSA 5KT4A 2R9RB 4JAUA 5G5GA 3AQFA 4Y2PA 4B9VA 5CHGA 2K4EA 5AI0A 4LZDA 1SL2A 3QF7A 4K35A 1FAFA 2LO1A 1TUBA 3T5KA 4UUJC 3TXSA 1D9FA 4IRDA 2AGAA 3BCCH 3STZC 2G06A 4FE3A 4YFKA 1N0NA 2PF4E 2F44A 4PHDA 4DR5B 5KT2A 3TARA 4BXOB 5LYJB 1KQSU 5F9LA 5KG2A 1NK4A 1TUBB 3HX0A 2CTRA 4CBCA 3RYHB 4QW8A 4F4XA 4KX3A 2ITDC 3ZRSA 4O4JA 4DFKA 1ZQFA 3TETA 4FM0A 4F2SA 4MF8A 1K34A 4IGGA 5J2HA 1YIJV 2UUCO 3V6HA 1XUQA 1XMOB 3Q8SB 2DPJA 3OGUA 3L70H 2YICA 1GN4A 2XT9A 2ESEA 2RLTA 4I9WA 3SJCC 3A0HZ 3A0HU 1RQLA 4ELVA 5DDMA 5KFXA 2NV3A 4AP9A 8ICZA 4K0KB 3K04A 4TQFA 3J81j 4JK1A 4UCRA 3BQ1A 3PX6A 2R18A 4F92B 1E1QG 4F4WA 3CYOA 1FJGO 5CEHA 2BZFA 3ZRXA 1ZJMA 4EELA 5LGTA 4ED0A 3PO5A 3EWAA 1EM1A 4YJ3B 3HT3A 3WG7B 4F4ZA 4EYIB 3PX4A 1CXZB 3FB8C 2W3SA 1WB8A 3ZRVA 1ZQMA 5KLVH 4X64B 3LK9A 5KFJA 4FS2A 5EZYA 8ICPA 4ZOHC 4K8ZA 2KOBA 3IG8A 2PI5A 1I5YA 2BCCH 2YEVB 4EENA 2C2EA 2P6JA 2WF9A 1TVKB 1OCOB 1N8RW 2HHXA 2EIJC 2ASDA 2F4VB 3LDDA
chains in the Genus database with same CATH topology
3JD3A 1V54C 2H3QA 3KG2A 5B1AC 1YTFD 1QR9A 1K97A 3ZMZA 3F2CA 3KZXA 3STLC 5CRXA 1WLEA 4HYOA 2ZIXB 2UXXA 5CA3A 3RF9A 1RM1B 5DN6G 1K3EA 3OEEG 4EKWA 4C0ZA 2WAQF 4WFBV 3F5WC 3LYSA 3OFNG 2HBLA 1ECWA 4L87A 1AI4A 4TWKA 2G5HB 2HBKA 1JVMA 1VQLV 2Y0SF 1F4NA 1M9NA 1RPRA 3B77A 3SPCA 1H38A 1GM7A 3RW0A 1J95A 5E1AC 5EC1C 3ZRWA 4HAMA 4MVUA 2ZD9A 1VQOV 1VQ6V 1PVRA 1Z1BA 1P4RA 1OCZC 4ICAA 2XASA 3K0DA 2HVJC 4XDKA 3W7TA 2BOBC 1M57B 4UV8A 2Q6AA 3IP4B 1SESA 3IC7A 2JEXA 2WLIA 1VQMV 2EBOA 5IDJA 1M56C 2HBJA 3K03A 5LHHA 4FZMA 1HIWA 2XVTA 1FXHA 1QVFU 1RPOA 2M7WA 3VC8A 4CDGA 2JGAA 5LHGA 4DXWA 3LSQA 2AHYA 3AG3B 3CYMA 1M57C 2K8BB 3IGAC 1MOFA 1OCZB 2W6JG 1OUQA 1S0VA 2HR3A 1Y4MA 3ASNB 1PVQA 3KFUF 1GKFA 2IJKA 2IU3A 4PDVA 3OR7C 3SPIA 2OTLV 3AG4B 1JOYA 2YX8A 4MVQA 3LDEA 3C28A 2IH3C 1EBOA 1WPXA 3H0LB 2XAQA 4X88A 1V54B 5DM6V 4DO2A 1E79G 1H8HG 3PSFA 3OMAB 2IW5A 5KA6A 5HR7A 1FXKB 2DW4A 1L6NA 2X6BA 2V1DA 3WG7C 2P90A 3CCJV 1FXKA 2HG5C 2XIDA 1B6QA 1GMGA 4OJ5A 2XAGA 3GB7C 1F23A 4WCEV 4XDJA 2ZDIA 3GWOA 3SPGA 3AG4C 1KC8W 2A0LA 2K1EA 3ETEA 2MRLA 2ZIVA 3CD6V 4P2ZA 4GT1A 1YJ9V 1MSWD 4E2LA 1E1RG 4ZBMA 1XNSA 2IJJA 3D2QA 4LBEC 2KV2A 1QLEC 3RVYA 2BDUA 3F5EA 2F8LA 5CBHA 3CCEV 1VQ4V 2LP7A 2W0FC 3O0FA 2X6AA 3AG1B 1QLNA 1PL0A 4JYCA 2RP5A 1VQ9V 2ZR3A 3ZIAG 2EIKC 2D3OW 1KP3A 4MVRA 5B1AB 1KECA 2JHDA 1YI2V 3F7YC 1VQNV 2WLIB 2ITCC 3CCSV 1CP9A 2WLKA 5HFLA 2G5IB 2LYBA 1P7BA 2V7QG 5IY5C 3CC2V 3HKZC 5C93A 3CXCU 1Q3VA 1THZA 2G09A 3LDCA 1K7DA 3ONNA 1OCCC 4QPKA 1DRGA 2JJ1G 3ETDA 3G71V 3SAGA 5HR6A 2Q4TA 2F76X 1IXMA 4OJOA 2X0LA 3JCZA 2EILB 2KKPA 5IYBO 4FZLA 2ZDIC 3B8MA 4MVZA 3ABMB 4JPRA 2EZPA 4XBFA 4P0PA 4WFGA 2IJIA 1G8MA 1JX9A 2Y69C 5EBLC 3CC4V 1ROPA 3E83A 2HMXA 2QM7A 5L3FA 2B1GA 3QNEA 1OHHG 2CRXA 2MA1A 2KB1A 4JTAB 5B1BC 1A6SA 2PMZF 1AR1B 1ED1A 1F44A 1SZTA 1H2GA 3PSIA 3CRXA 3QO8A 1YTFB 3HKZF 5EK0A 3HB3B 3W7XA 1VQ5V 3K9AA 2JMGA 1EZJA 3DGEA 2ATKC 3MHHC 2WPDG 1G4YB 2EILC 2KNJA 4CGZA 1Q3UA 4QIWC 2WLHA 1PD3A 5L3CA 1K8AW 2KD1A 3CC7V 5J9PC 2JH7A 4PA4A 3ABUA 3OAAG 4XDLA 2EIKB 2DYSC 2LKYA 3PSPA 3OUFA 3M6ZA 1NR7A 2W6IG 3K0GA 5H9CA 2G0AA 2ZXWB 2JH1A 5IYCO 3T2MA 1NVPD 4LP8A 2Q67A 1DF4A 2ZXIA 4G28B 5CBFA 1YT3A 2G08A 1Q81W 2VJ4A 1R6NA 3FB5C 3E0FA 5H6QA 5BZBA 1AJQA 1DLBA 2A9HA 3F7VC 1ZWIC 3ABLB 4X89A 2OM6A 1WUDA 2XI9A 1YJNV 4QIWF 2KHQA 4UVAA 2X6CA 2F77X 3BEHA 1RM1C 3SYPA 3F2DA 3LVVA 2W7OA 2JJ2G 2KJ8A 4PA3A 3CCMV 3CP8A 3W7WA 3PZPA 2GSMB 4QJFB 1AROP 1BHBA 2WB1C 2B1IA 3NUQA 2QM8A 1LNQA 4KFMA 1XO0A 4NLCA 3FKSG 2IU0A 1QR8A 4MW3A 2ZIWB 4MW8A 1EFRG 4GX2A 1W0JG 1CEZA 3OE7G 4U7CA 2ZIUA 1NR1A 4WFFA 2ZXHA 4X8AA 2QTOA 4NLBA 2WAMA 4I5SA 1K4CC 5KL1B 1GK9A 3X2QB 3OW2U 1K5SA 1F51A 3JD4A 3ZJZA 5KL8B 4PDMA 1UPHA 3AG2C 3MD0A 4PL2A 1KKDA 3OMNB 3T4DA 1TUEB 4FIPC 3TK1A 5LGUA 3SQIA 1AI5A 3E86A 1Q86W 4RAIA 1BMFG 1AI7A 3D2SA 3BY6A 1ENVA 3H0MB 3N7RC 2DWEC 1M90W 3SPJA 2GOLA 3M7DA 4JGSA 1GM8A 2WAQC 5CN0A 1K73W 3F53A 1MABG 2EINB 4ACOA 4RUEA 4WF9V 2Q68A 3RBZA 1M1KW 1VQ7V 1GO3F 3JD1A 2IJHA 1M56B 4O3MA 4OJ6A 4MT8A 4CRXA 3WFVA 4PA9A 4ASUG 2HOIA 3DTUB 3HPLC 2WLMA 4MTXA 1S76D 4A8EA 2Z5UA 4PDLA 2GH1A 3F5AA 3AG3C 1QVGU 3EFFK 2H3IA 1V55C 2K8CB 2LBOA 3MGVA 1K9MW 5L3EA 2NNUA 2ZIUB 3RFAA 1Y66A 3B8NA 2D6FC 3ABMC 2ZIWA 4JTCB 3OPXA 2OH2A 4KP4A 3SYCA 4OJLA 1BL8A 2B5UA 2Q69A 4JTDB 2UXNA 4FPPA 2DQNB 1CRXA 2KJ5A 4QNHB 3CP1A 2VKQA 4GFJA 3JD0A 2A3VA 2OCCB 2X7RB 1BHAA 2JDIG 4F4LA 4ZKIA 2W03A 3CMAV 2HJFC 4MVMA 3ZN1A 3ZMSA 5IYDO 3SAHA 2E1EA 3SMVA 4LC1A 4OXSA 4Q20A 1OZ0A 1V55B 2H94A 3TCUA 4G2KA 3ZMTA 3EHBB 2XNDG 2DGZA 1NH2D 3NRWA 4QE9A 3GZFA 4H37A 2LFSA 2P7TC 3ABLC 4GX0A 2YB1A 4RQEA 4BJQA 1OCCB 2KHVA 1PKXA 3OM3B 3D2NA 3P30A 2DYSB 1OCRC 2ZIVB 5CMUA 2ZR2A 2EIMC 2RHFA 1CPYA 4QPJA 2WWWA 3VCBA 2OYYA 1R3LC 3ZMVA 4GX5A 3SYQA 4GCZA 3E8FA 1H8EG 3C29A 2HOQA 3SAFA 2E5SA 1HEKA 2Y0SC 1NZBA 4NWIA 2CPRA 4PA7A 1JPXA 2R9IA 2NLJC 3UM7A 1AJPA 4QNLA 1R3JC 3LSSA 1ZQ1C 4PELA 4PL1A 2K89A 4RUFA 4KUMA 1MG1A 1F4MA 1YITV 2MK3A 1PNMA 5GW7A 4R8CA 2JK5C 3LDDA 4P9OA 5B1BB 5LBQA 3CMEV 3I56V 3AEIA 4MTOA 5KUMA 2K8AA 3K06A 3E8HA 3R65A 4P30A 4R50A 4FMTA 1PVPA 3IFXA 2YSUB 4J9ZB 1FFTB 1K33A 5C0YA 2XOKG 3ABKC 3PSTA 2E1FA 4PA6A 1DTOA 1AI6A 5KA5A 4MS2A 2KVCA 1GTOA 1PNLA 2WLLA 3GU3A 4P9PA 5B1NA 1DF5A 4JF3A 4P0PB 1KBUA 1R3IC 3FYIB 1VQKV 4UVBA 1K92A 1KD1W 1T94A 2ZXWC 3IG5A 2C2AA 3FYEB 4G27B 3OMIB 2DYRB 2XICA 1R6KA 1NBMG 2KJ9A 2W7PA 4BW5A 1SRYA 3OGCC 1KP2A 2LFRA 4R7CA 3ZCCA 3I55V 3DEEA 2H8PC 3ALRA 4OO1J 3D3IA 2ZG6A 3ASOC 2KIWA 2LYAA 4MTFA 1K4DC 1QCEA 1XL4A 1L1FA 4H33A 2VIXA 3E35A 5B3SB 1S77D 1UJWB 3K79A 2DQ3A 2PMZC 4NV0A 1W0KG 2EZOA 4KX5A 4BIUA 1S72V 2CK3G 2CN1A 3VOUA 5L3BA 1SERA 5EBMC 1W2BU 3F2BA 4WJ3B 1Q7YW 2H3ZA 3P32A 2HVKC 2QA4V 1VQ8V 2M0NA 1GM9A 2IH1C 4KMOB 3OEHG 4N23A 2LHTA 4U7NA 4WFAV 2OCCC 5FL7G 3T1CA 5T14A 3K08A 2DF4B 3MHSC 2EINC 2P67A 2RRDA 2OXOA 3N7PD 5A0LA 3T79A 1PNKA 5EC2C 2ZIXA 4MVSA 4BAYA 2Z3YA 3NXSA 3OUSA 3G6EV 1FXVA 1SZHA 1COWG 2HKOA 2DQ0A 3ABKB 3H01A 2K4IA 2WSSG 3CPWU 1URJA 2EJRA 3X2QC 1JQ0A 2JIZG 3ML0A 3ASNC 2QEXV 1FS0G 2BOCC 3E8BA 2QE7G 3JYCA 4BX9C 3CCVV 4MTGA 2F2AB 2H3FA 3ZRWB 3UKMA 2W04A 2DYRC 5L3DA 4WFEA 1TAMA 2KICA 4CZZA 3CCUV 3ABTA 1YHQV 4QE7A 3N7SC 3K1ZA 1NQTA 4UV9A 1YSCA 5B1OA 1Z19A 3CCRV 1Q82W 4J9YB 2FTKA 4UXNA 2OTJV 2WLLB 4IC9A 2OT5A 1XL6A 2WLNA 5KUKA 4MVOA 3K3WA 5L3GA 5B3SC 2R9RB 2ZQMA 4JAUA 3AQFA 3G4SV 2QKSA 2K4EA 2HBMA 4N21A 1QBZA 5HFMA 1R73A 4RO2A 3LVWA 1K5QA 3W7SA 2YEVA 1NKDA 4UUJC 3L3FX 2VJ5A 3E8GA 2HOFA 1S3JA 2DWDC 1QLEB 1SETA 2GHYA 2XAHA 3QO5A 4UVCA 3E89A 4Z1MG 3STZC 3AG2B 2G06A 4FE3A 1NJIW 4FZNA 2KKVA 1P7DA 5LGNA 4P0QB 1KQSU 2Y69B 2A79B 3VBBA 1OCRB 2YB4A 4BUGA 3LUTB 3AG1C 2F43G 4TSFG 4CBCA 2ITDC 4KX3A 4OJPA 3IN5A 1D8BA 2HLDG 3ZRSA 3TETA 3A0RA 3T4ZA 1K34A 2EIJB 3OR6C 4JYBA 1YIJV 2PI4A 1I5XA 1OCOC 3E2EA 3ASOB 4FJCC 3ZMUA 4I9WA 1ORQC 3D36A 3LNMB 2NV3A 5LHIA 4LCUC 3CCLV 5H6RA 3AQEA 3H0RB 4AYBF 2AHZA 2XAJA 3CCQV 3JD2A 3FB7C 4TT3G 3K04A 1NVPB 4U6PA 2EIMB 2K4HA 2JEUA 1JJ2U 3M6KA 5CBGA 1HWYA 2WLJA 4FK5C 4U7OA 5EBWC 2R18A 1E1QG 3QO7A 3CYOA 2G07A 1FXKC 2KEYA 3ZRXA 3W7UA 1R3KC 5LGTA 1JCHA 3ZN0A 3M99B 4PDRA 3SYOA 3SJQC 4JASA 3PJSK 3WG7B 4MSWC 1MA7A 4JMUA 2H3VA 3ETGA 2XAFA 3RVZA 3FB8C 4BIZA 4P0QA 2WB1F 2Y48A 3ZRVA 4AYBC 4JAVA 4R6ZA 3SPHA 3SYAA 4GX1A 4HZ3A 5IY5B 2Z7JA 2KOBA 3IG8A 1S5HC 4YXWG 3FB6C 1A0PA 2N1RA 1I5YA 2YEVB 1YJWV 2PI5A 2P6JA 3AL0B 1VQPV 1AJNA 2HFEC 4RQFA 1NH2B 1OCOB 4WFHA 1N8RW 2EIJC 1IIPA 3ICXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW F;  4OO1 J;  2HBJ A;  2HBM A;  5C0Y A;  2E1F A;  4CDG A;  2RHF A;  4QJF B;  3CYM A;  2MA1 A;  4NLC A;  2HBL A;  3SAF A;  1YT3 A;  2HBK A;  2DGZ A;  2CPR A;  4NLB A;  1GO3 F;  3SAH A;  4O3M A;  2E1E A;  1D8B A;  1WUD A;  4CGZ A;  3SAG A;  2KV2 A;  2RRD A; 
#chains in the Genus database with same CATH topology
 5FPO A;  3KG2 A;  1IM4 A;  2KZM A;  4JV5 B;  3F2C A;  1WLE A;  4HYO A;  1ZQH A;  9ICM A;  7ICV A;  9ICO A;  2E5L B;  2F1J A;  5J0Y A;  3LYS A;  1JFF A;  3Q8K A;  4KLH A;  1AI4 A;  3MDC A;  4DSK A;  5AI9 A;  2YIB D;  3CS5 A;  1H38 A;  3C2M A;  2YI8 A;  1GM7 A;  4PZN A;  2QB0 B;  1J95 A;  1N4C A;  3H1L H;  5EC1 C;  3M9O B;  2W9C B;  4EFE A;  2ZTC A;  2ZD9 A;  1BT8 A;  1Z1B A;  1OCZ C;  1SQB H;  3T1H B;  5CA1 A;  1Z5V A;  3BS5 A;  4XDK A;  3AU6 A;  3W7T A;  4BWJ A;  3N28 A;  1X9M A;  3NGD A;  4KLT A;  8ICN A;  1SES A;  2WLI A;  1Q5O A;  3IC7 A;  4BWM A;  1FYJ A;  5KFH A;  1M56 C;  3HR0 A;  5LHH A;  3KKA C;  4KLF A;  2QM4 A;  1CUK A;  4CDG A;  4NR1 A;  1QNM A;  5ALW A;  3LSQ A;  2AHY A;  3PO4 A;  4ECS A;  2K8B B;  2W6J G;  1OUQ A;  4RQ0 A;  1S0V A;  1AIL A;  2ARH A;  1DXS A;  1Y4M A;  3ASN B;  2FJ6 A;  4RPZ A;  4LFC B;  1ZD2 P;  2KZ3 A;  4US8 A;  3SPI A;  3ZDC A;  4K0K O;  3AG4 B;  5KAF Z;  4JAA A;  2YS8 A;  4R66 A;  2HHU A;  1WPX A;  5DEC A;  2XAQ A;  2JR5 A;  5DM6 V;  1H8H G;  2JV3 A;  3OMA B;  5HHH A;  3NS1 A;  1XNQ O;  5AI4 A;  2DW4 A;  2EDU A;  1L6N A;  1LV5 A;  4PI0 A;  3WG7 C;  2N04 A;  1HNX O;  1EN5 A;  1US6 A;  4RQ1 A;  2VA3 A;  1ZL8 A;  3CCJ V;  1C20 A;  1X4T A;  2CGN A;  5KG1 A;  1L5U A;  4I27 A;  2ODM A;  2OIE A;  4DSF A;  4W4L A;  1ZD4 A;  3RJK A;  1B6Q A;  5CB4 A;  4B3M O;  1KBH A;  4B3R B;  5AKK A;  1JA8 A;  5JTI A;  4XDJ A;  5TZV A;  3GWO A;  4AQY B;  1N32 B;  1SKR A;  4DRX A;  4YCX A;  3CEI A;  3CD6 V;  2I5H A;  4YJ2 B;  1MSW D;  4YMO A;  1VAR A;  4E2L A;  1E1R G;  3QZ7 A;  2YMP A;  4PZO A;  1XNS A;  3D2Q A;  2OTJ V;  3WB0 A;  1QLE C;  4TUS A;  7ICE A;  2LP7 A;  5KX5 A;  2X6A A;  1D8Y A;  1VQ9 V;  1KSP A;  4DRX B;  4KXR A;  4JI4 O;  1KP3 A;  4DV2 B;  2ZIM A;  4MVR A;  1KEC A;  5B1A B;  5LA6 B;  7ICT A;  3F7Y C;  3KOO A;  2RN9 A;  1J97 A;  1L7P A;  4C80 A;  4PGX A;  2IA6 A;  2BSK B;  1I94 O;  2YIB A;  2WLK A;  2OYQ A;  4GKK B;  2LYB A;  4C8K A;  4O4I B;  2E76 B;  3CC2 V;  3RB3 A;  2HVH A;  3HKZ C;  5C93 A;  3UQ0 A;  1XWL A;  4F6R B;  5AI8 A;  3CXC U;  1THZ A;  3LDC A;  3M7M X;  4UB1 A;  4KN4 A;  1DRG A;  4RT3 A;  4EX7 A;  2WTF A;  2JJ1 G;  4YR2 A;  3G71 V;  2QDO A;  3RYC B;  2Q4T A;  2F76 X;  4Q6G A;  3SYZ A;  2CXY A;  4OJO A;  2YXL A;  5IYB O;  4FZL A;  4C7Z A;  1NZP A;  1NT2 B;  4I9Q A;  1TK8 A;  1R1B A;  2EZY A;  4WFG A;  2Y69 C;  1G8M A;  3CC4 V;  4J9N A;  1HNX B;  5KTQ A;  3M9N B;  2BQ3 A;  5BXZ A;  4IYH A;  1OHH G;  1KDH A;  4JTA B;  2B9Z A;  1EXN A;  2J6S A;  2LM4 A;  1F44 A;  3PSI A;  3Q8L A;  3HKZ F;  1ZQZ A;  3N97 B;  5DLG A;  4YG2 A;  1JR9 A;  3QE9 Y;  3ZBH A;  4DOB A;  4OPA A;  1LUV A;  2J6U A;  2ATK C;  1TFR A;  3ZDA A;  1Q8K A;  5DB7 A;  2WPD G;  2Q8V A;  1D5N A;  1FFX A;  2KNJ A;  4CGZ A;  4M9J A;  1Y67 A;  2LGQ A;  3GV5 B;  3BPZ A;  5AIA A;  2JH7 A;  3OD4 A;  4ZHQ B;  3CWB H;  3BS7 A;  5ALO A;  2DYS C;  1IXB A;  2Y4T A;  4YHH O;  2ZTD A;  4O2A A;  3HKC B;  1B3Q A;  3OUF A;  2C22 A;  2Q7G A;  2G0A A;  5AHX A;  2JH1 A;  4F6R A;  4M04 A;  1Y6X A;  2JEG A;  4G28 B;  1YT3 A;  3GVM A;  5D4B A;  3E0F A;  4D6T H;  1AJQ A;  3SD7 A;  3H9V A;  2E8N A;  5LMN B;  2QWN B;  3GWK C;  2FMS A;  4X89 A;  4X20 A;  3RT3 C;  3JAS A;  2F77 X;  4DLG A;  3MR6 A;  3F2D A;  4E0D A;  3LVV A;  1MN8 A;  3SYP A;  1L7N A;  2P66 A;  1V97 A;  2JJ2 G;  5CA7 A;  4IRC A;  4I28 A;  3PZP A;  3K58 A;  1BHB A;  3NUQ A;  1NJX A;  5LL6 Y;  4KFM A;  4QZG A;  4USA A;  1H2L A;  2IU0 A;  4MW3 A;  1S5L U;  2ZIW B;  4GX2 A;  4RUC A;  4NM1 A;  2H3O A;  4L8J A;  3S6J A;  1X42 A;  4X8A A;  4U7C A;  1XHZ A;  2ZXH A;  2V4R A;  1K5S A;  1KQQ A;  4B7E A;  3ZJZ A;  3IDW A;  5J2T B;  3H4B A;  5DB6 A;  2E3T A;  3MD0 A;  1KKD A;  5AM2 A;  3T4D A;  2IMW P;  5LGU A;  4FLW A;  5ALE A;  3SQI A;  1ZQN A;  2YUA A;  1NTM H;  4YJ2 A;  3QEA Z;  2AZ0 A;  4BIO A;  3UO2 A;  4UCU A;  1AI7 A;  1ENV A;  4YIP A;  4C4R A;  1P84 F;  5KFU A;  2ZM6 B;  2UU9 B;  5KT7 A;  5AKI A;  1JJO A;  5J0Q A;  5ALX A;  1PZN A;  5IIL A;  3M7D A;  4B7K A;  1FIQ A;  4FBU A;  1N5X A;  3BS5 B;  3QU4 A;  4ELU A;  1MAB G;  5GTH U;  1BPE A;  3JAL B;  3QUT A;  1S9F A;  4UFZ A;  5FPR A;  4WF9 V;  3RBZ A;  3PW2 A;  2CH7 B;  1I7F A;  1M1K W;  4O2A B;  1VIB A;  4OJ6 A;  1VEW A;  3DTU B;  2CDY A;  5KHK A;  4B3M B;  2GBO A;  3OT7 A;  3U11 A;  5GTI Z;  4QW9 A;  3D3Q A;  3AG3 C;  4O5E A;  4JI7 O;  2EX3 A;  4JI2 B;  4EB6 A;  3RYH A;  2IHN A;  5L3E A;  1NI3 A;  2ZIU B;  4F93 B;  1NKE A;  4J11 A;  3B8N A;  4M47 A;  2PZS A;  4RQ3 A;  1Q46 A;  1HJP A;  4DW0 A;  4QNH B;  1NU1 H;  3I5D A;  3ZDE A;  4O4L A;  1UHU A;  2VKQ A;  2AZ2 A;  2A3V A;  3FAV B;  4F4L A;  1J5E B;  9ICK A;  1ZTE A;  2HJF C;  3ZMS A;  4YY3 O;  4OXS A;  3CNH A;  4YMN A;  1M5I A;  2E74 B;  5GTH Z;  1TV9 A;  1NH2 D;  5LMN O;  4MFF A;  4DFD A;  8ICV A;  2P7T C;  5KFQ A;  4RQE A;  1N61 A;  3OM3 B;  1JAL A;  3D2N A;  3P30 A;  4F2R A;  2Y4U A;  2UVU A;  3C2L A;  2ZR2 A;  1M6Y A;  2RHF A;  1IX9 A;  1CPY A;  4QPJ A;  3ZMV A;  4ZI7 A;  5LOV A;  4X5V A;  3E22 A;  5H5N A;  4GX5 A;  3HP6 A;  4BGD A;  1NJW A;  4J9O A;  1ZQP A;  2DBY A;  1AR5 A;  2Y0S C;  1NZB A;  4DK0 A;  2CPR A;  1SB3 C;  2NLJ C;  5J2B A;  2ODG A;  4PPX A;  1X6I A;  1I08 A;  4Q44 A;  4O3P A;  1F4M A;  5L1I A;  5GW7 A;  4R8C A;  2UUC B;  3A2F A;  1GH6 A;  2YI9 A;  3KHL A;  1ZL8 B;  3CME V;  1TVK A;  4XA5 A;  3E8H A;  3TKA A;  1WPB A;  4P30 A;  1PVP A;  4H0L B;  1B22 A;  1SXE A;  1Y76 B;  3ABK C;  4PA6 A;  5BOL A;  5JVD A;  4DR3 O;  4MS2 A;  1A76 A;  3GU3 A;  3ISD A;  2DKX A;  1DF5 A;  2ZIO A;  4JF3 A;  2E3C A;  7ICN A;  4J9M A;  2QKQ A;  1KLN A;  1FJG B;  2C2A A;  3FYE B;  4G27 B;  2FDR A;  4Z6D A;  2GUZ A;  1Q3E A;  2W9B B;  2KJ9 A;  4IS7 A;  1SRY A;  1KP2 A;  4QZ8 A;  4EFB A;  1BPZ A;  2QB0 A;  1ZRN A;  5HML A;  5JU5 A;  1U4B A;  4R7C A;  4KHP O;  4OO1 J;  4J9K A;  1A77 A;  2I1Q A;  8ICO A;  4DV6 O;  4IHJ A;  2VIX A;  3QYP A;  4X62 O;  1B43 A;  4BXO A;  5H2F Z;  3NAS A;  1DK2 A;  1W0K G;  3RYF A;  1ZQY A;  2CK3 G;  4JV0 A;  3R9K A;  2XY7 A;  1OW5 A;  3F2B A;  4WJ3 B;  3P32 A;  4RQ5 A;  2IH1 C;  4N23 A;  2QKC A;  4KMO B;  1DK3 A;  3MR2 A;  4U7N A;  4K8X A;  2V4Q A;  1S97 A;  4XRH A;  2OXO A;  3TFR A;  3N7P D;  1PK1 A;  5JJE B;  4LF9 B;  2GWS A;  3P3N A;  4PHP A;  2GO7 A;  5J2F A;  2DQ0 A;  5KFW A;  3J80 N;  4O5K A;  2Z0A A;  3CPW U;  1OJH A;  2XCA A;  2QEX V;  5L1J A;  3RRG A;  3ML0 A;  1FS0 G;  2XCP A;  4DLE A;  7ICM A;  5E79 U;  4TUY A;  2E8P A;  3E8B A;  2JXJ A;  4FBT A;  5ALZ A;  1NK5 A;  4DV0 B;  2PGG A;  4JI2 O;  4B3T B;  4MFA A;  2W04 A;  2AGQ A;  4WFE A;  5DGA A;  4CZZ A;  5HP4 A;  1PP9 H;  3BA8 A;  5JQG A;  3GIJ A;  5B1O A;  3K1Z A;  1NQT A;  1SQG A;  2AW9 A;  3APQ A;  4UV9 A;  4D7T A;  3PN1 A;  1EN6 A;  4J9Y B;  2W55 A;  4UXN A;  2BCS A;  2WLL B;  1IVS A;  1XL6 A;  3AN1 A;  2HHW A;  2QTS A;  1VF6 C;  1LB2 B;  4O5C A;  5JWP A;  1H2S B;  2ZQM A;  3PML A;  4JI0 B;  4N21 A;  4Q45 A;  4TQD A;  1R73 A;  4UCV A;  1K5Q A;  3W7S A;  2DUY A;  2YEV A;  1NKD A;  1K1S A;  4NKG B;  5CB1 A;  3L9D A;  2VJ5 A;  9ICE A;  1S3J A;  2GHY A;  4PGY A;  4UVC A;  3HKB A;  3AG2 B;  3MGI A;  4X64 O;  2KKV A;  4JI5 B;  2P6R A;  3RTV A;  3VBB A;  1TAE A;  3AG1 C;  2F43 G;  1N56 A;  2BDP A;  3ZHT A;  3HIL A;  3SJA C;  4QZB A;  5EZY B;  5J2K A;  1HUZ A;  1M4U A;  4LFA O;  4JYB A;  3PVX A;  1NK7 A;  1RYS A;  1OCO C;  3HKD B;  1ZD3 A;  3Q8P B;  1RZT A;  3PR5 B;  4LF8 O;  3ASO B;  4FJC C;  4LWS A;  3AU2 A;  4I55 A;  1ORQ C;  5DDY A;  2GLE A;  4EZ6 A;  1BSM A;  2FMP A;  3M1Y A;  1QQ7 A;  5LHI A;  4DUZ B;  4QZH A;  1WCL A;  1WNS A;  2AHZ A;  3CCQ V;  3JD2 A;  3FB7 C;  5ALJ A;  5CP2 A;  5KFD A;  3T1Y O;  4KLO A;  4B3T O;  3D8C A;  4U6P A;  4LNU A;  4AHC A;  2K4H A;  7ICF A;  1COO A;  2IBK A;  3SJB C;  2R72 A;  4FK5 C;  4DV3 B;  3L72 H;  5DB8 A;  2PFO A;  5FNV B;  4HNA A;  3W7U A;  4NTX A;  4LF6 O;  4DFP A;  4EX6 A;  1JCH A;  3OSN A;  4IQV A;  2HEP A;  4QZD A;  1H2M A;  2BCV A;  4ECW A;  2JGD A;  1YZ6 A;  1Z4O A;  2RNB A;  2H3V A;  1T4G A;  9ICJ A;  2WB1 F;  7ICH A;  2CTQ A;  1UA1 A;  4F5Q A;  2MW2 B;  4JAV A;  3SYA A;  5IY5 B;  1V85 A;  1XO1 A;  4GX1 A;  4DR1 B;  3AEV A;  1ZYQ A;  1HR0 B;  2J6T A;  8ICA A;  3ZDB A;  1X2I A;  9ICG A;  1S5H C;  1A0P A;  3FB6 C;  4OPH A;  4JI5 O;  3UPQ A;  4DQS A;  3AL0 B;  1VQP V;  3I1Y A;  4UBC A;  4QWA A;  4LF5 B;  2QWO B;  4RQF A;  1RDF A;  4RUA A;  3ICX A;  3JD3 A;  1Z00 A;  2KP7 A;  2BTQ A;  4EEQ A;  3Q8M A;  4JI1 B;  2FLN A;  1RQN A;  8ICB A;  5CRX A;  2UXX A;  5D5P A;  1RM1 B;  1XDC A;  3OHA A;  1K3E A;  2ZE7 A;  3OEE G;  4EKW A;  2WAQ F;  1RG6 A;  5DN6 G;  7ICR A;  1X59 A;  4KLL A;  3OFN G;  4LF9 O;  2HBL A;  2A1J A;  4TWK A;  2G5H B;  2HBK A;  5TIS Z;  4EBC A;  1JVM A;  1N63 A;  1VQL V;  1RPR A;  3SPC A;  3TAN A;  5AKG A;  5KFG A;  2R8G A;  3V6K A;  8ICJ A;  5E1A C;  4B9N A;  4M2Y A;  3ZRW A;  1TAU A;  2JRZ A;  1SWV A;  3NRZ A;  2ZE8 A;  3JAM N;  2QB1 A;  1K5O A;  4Y2Y A;  5KG0 A;  4CNQ A;  2BOB C;  2FL4 A;  2Q6A A;  3IP4 B;  4RPY A;  1B04 A;  3CW2 C;  2YMQ A;  5IDJ A;  1VQM V;  4F5P A;  2HBJ A;  5EE3 A;  1ZQS A;  3CRA A;  4IIJ B;  1HIW A;  2XVT A;  4X65 O;  1ZQB A;  2M7W A;  2GTS A;  2JGA A;  5GON A;  4JI4 B;  5LHG A;  4DXW A;  1XBL A;  4QZF A;  1M57 C;  1RP3 B;  4J42 A;  3RBD A;  1MOF A;  1OCZ B;  3VQW A;  5IJ0 A;  2HR3 A;  1JXL A;  3Q4H B;  4IQT A;  3KFU F;  2IJK A;  1URF A;  9ICW A;  3T1Y B;  1JOY A;  3B2E E;  4ECV A;  1MNG A;  3BHP A;  3NR7 A;  4MVQ A;  1HW7 A;  3C28 A;  2RDC A;  4H44 B;  3UXO A;  1SQF A;  2A3Q A;  1E79 G;  2AXT U;  2LM1 A;  2EUL A;  1VF7 A;  2V1D A;  2P5O A;  2BCQ A;  3UXN A;  3DDH A;  4FFB B;  3UQ2 A;  1XI1 A;  1BQZ A;  4FVM A;  2HG5 C;  2XID A;  4FFD A;  4OJ5 A;  4J7J A;  1I0H A;  5ALS A;  3UM9 A;  3O65 A;  8ICU A;  4DL4 A;  1KC8 W;  5KG6 A;  4TV9 B;  2BCU A;  2R70 A;  3K57 A;  4EBD A;  1C7Y A;  2LW7 A;  4KTQ A;  2RMK B;  4LH7 A;  2KK0 A;  3RRH A;  1ZQK A;  1L0N H;  2IJJ A;  3F5E A;  4X1Y B;  4F4K A;  4JI3 O;  5CBH A;  3WB1 A;  1ZET A;  3UQ8 A;  3TGU H;  4ELT A;  3ZIA G;  3BQ0 A;  4NB5 A;  2W0X A;  5EE0 A;  3C2K A;  1XS9 D;  2LQT A;  2ZTE A;  2D3O W;  2JHD A;  3TJT A;  2WLI B;  3RR7 A;  3CCS V;  1MC8 A;  5KAI Z;  1CP9 A;  1YZB A;  5IY5 C;  3QX7 A;  2BGW A;  1NK0 A;  2H5X A;  3PW4 A;  2JZB B;  5LA6 A;  4G9B A;  1JIH A;  1KYO F;  1KKX A;  2G09 A;  3ONN A;  4OD0 A;  4UAZ A;  5KHH A;  3OHB A;  8ICX A;  3RYF B;  5J2D A;  1IXM A;  2PFN A;  2EIL B;  3RB0 A;  4KLQ A;  1KRP A;  5B66 Z;  3VQY A;  2FPL A;  4P4M A;  1ROP A;  2KFZ A;  4UB3 A;  2QM7 A;  3VQV A;  2B1G A;  2I6X A;  5BOM A;  2W8L A;  1ED1 A;  1UT8 A;  5ALH A;  2Y1I A;  1ZQR A;  1H2G A;  1RSO B;  1SZT A;  1TGO A;  2GUZ B;  4LR3 A;  4PI2 A;  2E8O A;  1AQ6 A;  3R66 A;  3W7X A;  1VQ5 V;  4LWS B;  3QVN A;  2F93 B;  1XOU A;  3MHH C;  1NJY A;  3CHX A;  5KFM A;  3JSN A;  2BSK A;  4RNO A;  4QIW C;  5LP6 C;  4B9L A;  1PD3 A;  3APO A;  5L3C A;  1K8A W;  3QEB Z;  4TOI A;  3UMB A;  3BQT A;  1BNP A;  3ZHR A;  3ZDD A;  3ABU A;  3OAA G;  1UCV A;  4JWM A;  4P4O A;  2LKY A;  3KCX A;  2KSO A;  1YDX A;  3H8S A;  5EOZ A;  3M6Z A;  1NR7 A;  2W6I G;  3K0G A;  1XMQ O;  2ZXW B;  1W59 A;  3OSP A;  4DR5 O;  1NVP D;  1MZE A;  2YML A;  4J9L A;  5GON B;  1L3S A;  5CBF A;  4X65 B;  2LGW A;  1Q81 W;  1MZF A;  4TQR A;  4UBB A;  3QZ8 A;  2VJ4 A;  1R6N A;  1FPO A;  2DOS A;  4F71 A;  5BZB A;  1DLB A;  2A9H A;  3D36 C;  3H8J A;  3ABL B;  2OCH A;  1Q8I A;  3V7L A;  2W9M A;  2XI9 A;  3H4D A;  5JH7 A;  3Q8Q B;  4QIW F;  4B9U A;  1N62 A;  2HSZ A;  3C1Z A;  2EAM A;  2Q7H A;  3L5K A;  4I0X B;  4CC6 A;  1RM1 C;  3WU2 U;  2YDE A;  4NTY A;  3B0X A;  4PJ0 U;  1NKB A;  2KJ8 A;  3H8M A;  4QJF B;  3K59 A;  3KBB A;  5J0U A;  2QM8 A;  1LNQ A;  4O0I A;  4NLC A;  1XO0 A;  4C4S A;  8ICG A;  4X66 B;  2LYH A;  2UU9 O;  4US9 A;  5ALP A;  1W0J G;  2KQX A;  5KT6 A;  1CEZ A;  2ZIU A;  2AU0 A;  2QTO A;  4NLB A;  4DV1 B;  3PW5 A;  1BCC H;  5KL1 B;  4EEK A;  3PX0 A;  4GKJ O;  5KFE A;  3JD4 A;  1S0N A;  3M9M B;  4PDM A;  5J0S A;  4PL2 A;  5KHJ A;  5EE1 A;  4FIP C;  3RFR A;  2WA3 A;  1ZQG A;  2YID A;  1D8L A;  1B4F A;  2OCE A;  4HAI A;  5DBB A;  1WYG A;  2QWR B;  4JI7 B;  4JI6 B;  1M90 W;  2NRZ A;  3HKE B;  1IBK B;  1GM8 A;  2HJD A;  3AG7 A;  5CN0 A;  3B9J A;  2I9G A;  3F53 A;  1QSY A;  1SKV A;  3CXH F;  4DUY B;  1JX4 A;  1PM9 A;  4X9Q A;  3V7K A;  5ALG A;  2DFL A;  3C90 A;  2CTW A;  1Z1V A;  4RT2 A;  2Q68 A;  4F50 A;  1L0L H;  4Z6F A;  4KLU A;  1ZAU A;  3JAT B;  1GO3 F;  4DV4 O;  5J2A A;  2KKW A;  3WFV A;  3AK2 A;  4PA9 A;  5III A;  2HOI A;  3HPL C;  3MDA A;  3LWM A;  4YD2 A;  2WLM A;  4MTX A;  5FLX N;  4A8E A;  1QVG U;  2GH1 A;  3F5A A;  4OCZ A;  1SKW A;  2H3I A;  2BPC A;  2K8C B;  2FE9 A;  3AM9 A;  5TIS U;  1V55 C;  3L73 H;  1K9M W;  1X9X A;  2YQE A;  2NNU A;  4P4P A;  3DSQ A;  3H1J H;  5JUM A;  1Y66 A;  2EH9 A;  2D6F C;  1COK A;  5D5Q A;  4ZIB A;  2OH2 A;  1BPB A;  3SYC A;  4OJL A;  1BL8 A;  2ISP A;  4JTD B;  4A5U B;  3GQC A;  1ZQW A;  2FKX A;  2KJ5 A;  4O4H A;  4PHE A;  1XMQ B;  3JD0 A;  5DG9 A;  1VF5 B;  1WP8 A;  3CRC A;  4LJX A;  2CE4 A;  1XSP A;  2JDI G;  4ZKI A;  3CMA V;  1TVA A;  5IYD O;  3ZN1 A;  5KT3 A;  3D6J A;  3SAH A;  1QTM A;  4FLX A;  3SMV A;  4B08 A;  1OZ0 A;  3EPI A;  5F9N A;  5B5E U;  5DBA A;  2DGZ A;  3NRW A;  1Y74 A;  3WKC A;  3KTQ A;  4H37 A;  1N34 B;  2K9P A;  5J0O A;  1FFU A;  1ZQC A;  5IJ9 B;  3ZHQ A;  1OV9 A;  3BAA A;  3BDP A;  1OCR C;  3MBY A;  4PH5 A;  4DV5 O;  4ECX A;  1MSD A;  3EPG A;  2EIM C;  1IUR A;  3NVW A;  3VCB A;  2OYY A;  2Q5Z A;  1NKC A;  5AK3 A;  3B09 A;  4DV0 O;  1N36 B;  4KLE A;  4PHA A;  3C29 A;  2HOQ A;  3FD9 A;  1KU9 A;  2E5S A;  1HEK A;  4JUZ A;  4PA7 A;  5J0X A;  3UM7 A;  1ZQQ A;  1R3J C;  1T8E A;  1ZQ1 C;  4PEL A;  2BR0 A;  1MG1 A;  4CH4 A;  7ICS A;  1VDV A;  3QU9 A;  3IRU A;  3WK6 A;  5B1B B;  5LBQ A;  4DF4 A;  2FMQ A;  5J0T A;  1G1X B;  2YSU B;  3SGI A;  4EYH B;  5C0Y A;  3PST A;  1AI6 A;  5KA5 A;  4QWE A;  4TV8 B;  5DED A;  4AI8 A;  4HNA B;  1GTO A;  1SL0 A;  1PNL A;  4DV6 B;  1N33 O;  4Z1V A;  1NTZ H;  1Q6H A;  1R3I C;  3FYI B;  1VQK V;  1KD1 W;  1X66 A;  5KG5 A;  1MQ3 A;  2BPG A;  8ICK A;  2ZT9 B;  4RQ7 A;  1NBM G;  4BW5 A;  4IT5 A;  2UXD O;  4ED8 A;  1U9L A;  3JSL A;  5IWA B;  2UVV A;  4DQI A;  1SV4 A;  1Z3E B;  2W54 A;  2NN4 A;  2UUA O;  2ZG6 A;  2A7W A;  2KIW A;  3K9S A;  4MTF A;  1K4D C;  1QCE A;  1XL4 A;  4DL6 A;  4H33 A;  1FFV A;  4OGQ B;  5B3S B;  4GUN A;  3IHQ B;  3C21 A;  4M9N A;  5IT9 N;  2DQ3 A;  4UAW A;  3HRD D;  4KX5 A;  4BIU A;  2UXB B;  2UXC B;  4ECQ A;  4Z6C A;  2CN1 A;  4B3R O;  4I2D A;  3ED5 A;  2Q9L A;  3VOU A;  1ZRM A;  2JGD B;  5FP0 A;  5DBC A;  2H3Z A;  2HVK C;  1GM9 A;  3OEH G;  3WK7 A;  5HMM A;  4WFA V;  1PK3 A;  5DQI A;  4U3J B;  4PHZ A;  4JB3 A;  4ECT A;  2DL0 A;  3IV6 A;  2HHS A;  3ZD9 A;  2DF4 B;  5AKL A;  1U97 A;  2MU2 A;  3FYH A;  3GIM A;  3K08 A;  2EIN C;  3ETR A;  9ICS A;  1L7M A;  2WF6 A;  5JRT A;  2Z3Y A;  3NXS A;  3G6E V;  1FXV A;  1SZH A;  1COW G;  3ABK B;  4DL3 A;  4R65 A;  4QZA A;  3X2Q C;  3QNM A;  4YQW A;  1TE2 A;  5ALK A;  2E75 B;  5J8Y C;  4U3F H;  4DW1 A;  1S10 A;  3RJF A;  4BX9 C;  3BRC A;  2H3F A;  9ICP A;  4J10 A;  4KLM A;  3UKM A;  2DYR C;  3OTQ A;  4TQS A;  4DWI A;  3PY8 A;  4GXK A;  5KFI A;  4UW9 A;  3CCU V;  4KL1 A;  3ABT A;  4ZOL A;  5B66 U;  4FO6 A;  4HBN A;  4IIJ A;  3OTO B;  1Q82 W;  1YSC A;  3ISC A;  1Z19 A;  2BQR A;  1B06 A;  1H2K A;  8ICT A;  1UT5 A;  1TA8 A;  2OIG A;  5KUK A;  4DQR A;  3K3W A;  2AGO A;  4UB2 A;  5B3S C;  3SR6 A;  4YHH B;  2BQU A;  2AXT Z;  3G4S V;  9ICC A;  2QKS A;  1NK9 A;  5LYJ A;  2FML A;  2G38 A;  1Q6U A;  2HOF A;  5KG3 A;  4PGQ A;  1AR4 A;  2RDJ A;  1QLE B;  1SQP H;  2XAH A;  2ZCE A;  3QO5 A;  5KFK A;  4Z1M G;  4PD4 F;  4U3J A;  3U10 A;  4MEX A;  4LZG A;  4P0Q B;  1SA0 B;  1QQ5 A;  3SEN A;  4PJ0 Z;  1OCR B;  4NXN B;  2YB4 A;  3DC5 A;  1HNW O;  1NZ6 A;  1N36 O;  4OJP A;  4AIL C;  2KVS A;  1D8B A;  2HLD G;  3TFS A;  5K4L A;  3A0R A;  1JUD A;  4O3N A;  4DSI A;  2W8K A;  5J2J A;  3B4S A;  7ICK A;  3T4Z A;  2C2D A;  3CE2 A;  3OR6 C;  2PI4 A;  1I5X A;  2EAP A;  3RN4 A;  1KTQ A;  2R8I A;  4DCC A;  4DQQ A;  3ZMU A;  3TQ1 A;  3D36 A;  3LNM B;  2UUB B;  3CCL V;  4GC6 A;  2W9B A;  3H0R B;  4AYB F;  2JVD A;  8ICM A;  5CA1 B;  2XAJ A;  1N34 O;  2VQE O;  3BVO A;  2EIM B;  8ICL A;  2AHO B;  5CBG A;  4FLV A;  1HWY A;  2WLJ A;  3CRM A;  4U7O A;  5EBW C;  1L7O A;  3QO7 A;  2F23 A;  2G07 A;  1R3K C;  3UMG A;  4O4H B;  4IL6 Z;  2CGO A;  4ABM A;  2QAR A;  3ZN0 A;  3JAL A;  3M99 B;  1IZ3 A;  4NL9 C;  5AM4 A;  4PDR A;  3SJQ C;  1B0X A;  4I2C A;  4JAS A;  1IDS A;  4MSW C;  3B0Y A;  1MA7 A;  2XAF A;  3RVZ A;  4K4H A;  3NVY A;  4BIZ A;  2YN4 A;  4P0Q A;  2WA4 A;  2Y48 A;  1Q6I A;  1L8D A;  2BTO A;  5ALQ A;  4AYB C;  4X20 B;  3SPH A;  3RJI A;  3UT5 A;  1M93 A;  2Z7J A;  2IOH A;  4YXW G;  2N1R A;  4MFC A;  2KIV A;  1RXV A;  1MMM A;  1JRO A;  1AJN A;  1DOQ A;  3JPT A;  4CC5 A;  5L1M A;  5ALR A;  1IIP A;  1NS1 A;  4UB8 Z;  4UB8 U;  4OX9 O;  1V54 C;  4XQ8 A;  1J2M A;  3BZK A;  2B6G A;  2H3Q A;  4UAV A;  1SF9 A;  5B1A C;  1U48 A;  4DO9 A;  2R9A A;  1FEZ A;  4IQU A;  3GFK B;  4IYI A;  3STL C;  3V7J A;  4KLI A;  5CA3 A;  3RF9 A;  1XHX A;  4C0Z A;  3GV8 B;  3ZX6 A;  5KFY A;  4WFB V;  1QCK A;  3ZED A;  5H2F U;  1ECW A;  2V9W A;  4JI8 B;  5ALF A;  5IIN A;  1HUO A;  2Y0S F;  1F4N A;  1M9N A;  3B77 A;  1NK6 A;  4NYK A;  2KSO B;  4UB6 Z;  2K60 A;  1F0M A;  4O4L B;  4DR4 O;  1PVR A;  2A1A A;  2GDS A;  4YD1 A;  3MR5 A;  4ICA A;  4NXZ A;  4CF4 A;  1L8O A;  3PW7 A;  2HHQ A;  2XAS A;  3K0D A;  4I2J A;  3MDS A;  1M57 B;  4UV8 A;  3RGB A;  1K1Q A;  2WF5 A;  2C28 A;  4I4T B;  3V72 A;  4FLT A;  1ZQA A;  5AKX A;  1D9D A;  3K03 A;  2ALZ A;  4Y2R A;  1FXH A;  3SDL A;  5AM1 A;  3VC8 A;  1KFD A;  4Q8F A;  3DXR A;  3AG3 B;  5KMG B;  3T1H O;  1JMS A;  3RYC A;  3QUQ A;  7ICO A;  3B40 A;  3TI0 A;  5GTI U;  1HP8 A;  3AK1 A;  3JAW B;  2UXD B;  4NXM B;  2IU3 A;  1GKF A;  5EYP B;  4JI0 O;  4PDV A;  4KLD A;  3OR7 C;  2PYJ A;  2Y9T A;  2VQE B;  4JZ2 A;  3HKD A;  3I76 A;  3LDE A;  1HNZ B;  4LFB B;  3E8G A;  4DO2 A;  4X88 A;  3ZI4 A;  3PSF A;  7ICQ A;  2IW5 A;  5KA6 A;  4DS4 A;  5HR7 A;  5J2G A;  1FXK B;  4TUP A;  4Y2J A;  3ZS8 C;  1V38 A;  1HNW B;  2FLL A;  1EN4 A;  1LR1 A;  1FO4 A;  4DL5 A;  5J0W A;  1GMG A;  3TAD C;  1XU4 A;  1YEW A;  1F23 A;  4WCE V;  4ZH4 A;  2ZDI A;  5C5J A;  1ZJN A;  3AG4 C;  5ALM A;  2K1E A;  3THO A;  2MRL A;  5E79 Z;  5JCO C;  4DV2 O;  4P2Z A;  1GN2 A;  4GT1 A;  1YJ9 V;  2UVW A;  4ZBM A;  2VWJ A;  5CB4 B;  3CCE V;  4C7U A;  2BDU A;  4DV7 O;  2F8L A;  3JPQ A;  8ICQ A;  2W0F C;  3I28 A;  3AG1 B;  2P06 A;  1PL0 A;  2RP5 A;  4X62 B;  1XSN A;  2EIK C;  4RQ2 A;  3ISB A;  2F8K A;  4QGP A;  2EQY A;  2ZE6 A;  3IM1 A;  2XY6 A;  2UVR A;  2EAO A;  2PFP A;  1XEQ A;  2G5I B;  3HWT A;  2Y0P A;  4YMM A;  1BQ0 A;  4I7Z B;  3TAP A;  5DG7 A;  4M9H A;  4O9M A;  5L9X A;  4UCT A;  2XGQ A;  4NXM O;  1WA8 A;  1N2X A;  3SEI A;  4RU9 A;  3RAX A;  4JYY A;  4DR7 B;  4I2F A;  1J2N A;  1OCC C;  4DOA A;  3T5L A;  5IJ0 B;  4IRK A;  3SV4 A;  3ETD A;  3M8S A;  5HR6 A;  3DV9 A;  2X0L A;  3GIK A;  3NVZ A;  4CS3 A;  2KKP A;  3B8M A;  1LKY B;  7ICG A;  4C7Y A;  3ZD8 A;  5KFP A;  2FB5 A;  3ABM B;  2QWP B;  4P0P A;  5EWE A;  2IJI A;  5CA0 B;  1SIJ A;  5CR0 A;  3E83 A;  4I50 B;  2NRT A;  3QNE A;  2CRX A;  5B1B C;  2W3R A;  2PMZ F;  1YTF B;  8ICH A;  2EZX A;  3CRX A;  4BW9 A;  5KT5 A;  1UA0 A;  3CJH A;  2M9N A;  4YXM A;  3HB3 B;  1ZUQ A;  1GRJ A;  3L74 H;  1EZJ A;  3DGE A;  4CF5 A;  4DV4 B;  1RSO A;  5DQG A;  4GC7 A;  1AP5 A;  4DYL A;  3C5G A;  3K75 D;  5KFN A;  3NVV A;  3HKB B;  4W4K A;  3K5M A;  2ZUD A;  2RDI A;  2KD1 A;  2R8J A;  3TAC B;  3CC7 V;  3G6B A;  4ICG A;  4XDL A;  2VA8 A;  2F1I A;  3PSP A;  3FX7 A;  3O9O A;  4DR4 B;  2YC0 A;  5KFS A;  5H9C A;  3J81 N;  2NO5 A;  3QU5 A;  1YF2 A;  3T2M A;  1U96 A;  2KMD A;  3FM9 A;  5L1K A;  1XIL A;  4LP8 A;  2Q67 A;  1DF4 A;  1G6U A;  1U49 A;  2Y0I A;  3N2G B;  4DUY O;  2HP8 A;  3FB5 C;  5H6Q A;  5IIO A;  4I2B A;  2HW3 A;  1LKY A;  2RQ6 A;  3F7V C;  1ZSP A;  1WCN A;  4JI1 O;  4RQ8 A;  2KFN A;  4Z2W A;  3JAK A;  1YJN V;  4UVA A;  4JWN A;  4J80 A;  4DSE A;  4I29 A;  1AB3 A;  3JCU Z;  2YMM A;  2LMR A;  4YVZ A;  2W7O A;  4PA3 A;  2CAZ C;  3CP8 A;  3EZ5 A;  2GSM B;  2WB1 C;  3RR8 A;  4Q8E A;  2KG5 A;  4MW8 A;  4OX9 B;  2AQ0 A;  4I2E A;  1S0M A;  1YZ7 A;  1NR1 A;  3OE7 G;  4WFF A;  3X2Q B;  1K4C C;  2D3D A;  2IHM A;  1GK9 A;  1ZQU A;  5CA0 A;  1SZP A;  4J9P A;  1F51 A;  4CF3 A;  2Q7E A;  2ZNJ A;  1HDJ A;  4M6W A;  1NTK H;  2N05 A;  1JFF B;  3EYZ A;  3OMN B;  1TUE B;  3TK1 A;  2D2C B;  3MAB A;  5AIC A;  4LFA B;  1VF6 A;  2PY5 A;  4RAI A;  3FDS A;  4JV1 A;  4G3I A;  3PW0 A;  1IBM O;  5J2U B;  3JAR B;  2DWE C;  5KFB A;  5J0P A;  3SPJ A;  1L3U A;  2WAQ C;  1K73 W;  2EIN B;  2XC9 A;  2L35 A;  5KFV A;  2QWQ B;  4IR9 A;  3QU2 A;  3JD1 A;  4E4E A;  4C8L A;  1LVH A;  4Y2T A;  1M56 B;  1ZOL A;  3SR2 C;  2MSN A;  3HPO A;  2P6U A;  1S76 D;  4PDL A;  5IWA O;  2LBO A;  3H1I H;  4KN7 A;  8ICY A;  1QHT A;  2F4V O;  4DR7 O;  2AQ4 A;  1S8O A;  1S0O A;  3ABM C;  2ZIW A;  1O9H A;  4JTC B;  3OPX A;  3UXP A;  4KP4 A;  4QZE A;  1KFS A;  5DLF A;  2Q69 A;  2B5U A;  4FPP A;  1HNZ O;  4LF7 B;  2DQN B;  1CRX A;  3JAS B;  5IE9 A;  8ICC A;  2W9C A;  3CP1 A;  1HR0 O;  4J9R A;  1Y88 A;  1RXW A;  3OTO O;  4I50 A;  1BHA A;  1KB9 F;  1X9W A;  3U26 A;  3KKA A;  9ICQ A;  1BVS A;  2W03 A;  4CCH A;  3OJU A;  4MVM A;  2N74 A;  1IBL O;  4FLU A;  4I4T A;  1RFY A;  2E1E A;  4Q20 A;  4R63 A;  3CJH B;  2H94 A;  4UCS A;  3ZMT A;  1MA1 A;  1WJZ A;  8ICF A;  8ICS A;  1XNQ B;  3GZF A;  5ALY A;  2LFS A;  1SL1 A;  2NO4 A;  4BJQ A;  2KHV A;  4JYA B;  1PKX A;  1IBM B;  3IC9 A;  3JAT A;  4RZR A;  1RPL A;  2F95 B;  5LXT A;  4WBN B;  3MC1 A;  3SYQ A;  1IG6 A;  2PKE A;  4GCZ A;  3E8F A;  5J2E A;  3WKD A;  3HKC A;  3MAQ A;  4C8M A;  3SAF A;  4DV7 B;  3C23 A;  4NWI A;  5BY1 A;  3THV A;  2XUM A;  2KE7 A;  4QNL A;  5DG8 A;  3LSS A;  2D8C A;  1D2D A;  4PL1 A;  3WKE A;  2KZZ A;  2K89 A;  2MK3 A;  3J7A U;  3NTU A;  3BJY A;  2JK5 C;  2FYU H;  4P9O A;  1ZX3 A;  5AM5 A;  2A06 H;  4M0A A;  2KTQ A;  1SZX A;  4MTO A;  5KUM A;  3JPR A;  2XO7 A;  3R65 A;  4R50 A;  3JPP A;  3IFX A;  4J9Z B;  1L8L A;  3N2K B;  5F2V O;  3H7I A;  4TV9 A;  2VQF B;  2AJQ A;  4MHV A;  4F6E A;  1J5E O;  4UB4 A;  2WLL A;  4P9P A;  5B1N A;  3WKB A;  2IM9 A;  4NY8 A;  1K92 A;  2ZIN A;  1T94 A;  1T3N A;  2ZXW C;  4UVB A;  2JRI A;  3UCS C;  7ICP A;  4DR6 B;  4UAR A;  5IIJ A;  5KFC A;  2DYR B;  2XIC A;  3CB2 A;  3G67 A;  3CX5 F;  4X1I B;  4DR3 B;  3EW9 A;  3SV3 A;  1MQ2 A;  5AK6 A;  4UQG A;  3OGC C;  3DXR B;  4X66 O;  1YCI A;  3I55 V;  4QWC A;  3DEE A;  4I2G A;  3ALR A;  3D3I A;  3EXA A;  3QUC A;  3LDA A;  1IV8 A;  2LYA A;  2VA2 A;  2QAR B;  1L1F A;  2BPF A;  1XNR B;  3K79 A;  3QXG A;  1O9G A;  3A8T A;  2PMZ C;  4NV0 A;  2ISO A;  2DPI A;  4K3A A;  1S72 V;  1GAX A;  1BZK A;  3K5N A;  1H2N A;  4DK1 A;  4DSL A;  5L3B A;  1SER A;  5EBM C;  1W2B U;  1NJZ A;  4CH5 A;  1Z00 B;  2O6K A;  2LHT A;  2OCC C;  1SV0 A;  3MFH A;  3G6X A;  3JPO A;  1NK8 A;  3A0B U;  4CS2 A;  3MGH A;  2E8M A;  2RRD A;  1PNK A;  5EC2 C;  3UT5 B;  5AI6 A;  4BAY A;  2ZIX A;  3BFR A;  5IYZ B;  4K4I A;  5EWF A;  3FFQ A;  3OUS A;  3WU2 Z;  4B3S B;  4ED2 A;  3C3S A;  2K4I A;  2WSS G;  1URJ A;  2EJR A;  1ZQT A;  1QQC A;  1QQ6 A;  2W11 A;  3ASN C;  4LF4 B;  4DV1 O;  2BOC C;  2EAN A;  4MTG A;  4FM2 A;  2JEF A;  2F2A B;  3ZRW B;  2XHB A;  4FLY A;  1WB7 A;  1GN3 A;  1IXR A;  5AKZ A;  2KIC A;  9ICR A;  5DB9 A;  5DGB A;  4ED7 A;  5KG7 A;  1YHQ V;  2JEJ A;  4D7S A;  4DR6 O;  4IR1 A;  2P4V A;  2V4D A;  5ALU A;  4LF7 O;  5C8Y A;  3PV8 A;  2FTK A;  4AQY O;  1ZQV A;  4F5N A;  4IC9 A;  3F5T A;  3RH5 A;  1N32 O;  2WLN A;  5KNI A;  4ECZ A;  1X6J A;  4MVO A;  5L3G A;  9ICV A;  5JJJ B;  2XGP A;  3RH4 A;  3WK4 A;  4HYK A;  5JQG B;  2HBM A;  1QBZ A;  1FKA O;  5HFM A;  3M8R A;  3G80 A;  4FLZ A;  1PL4 A;  3LVW A;  4RO2 A;  4MF2 A;  3L3F X;  2HVI A;  1SA0 A;  5C8Y B;  1SKS A;  2DWD C;  1SET A;  1XNR O;  1ZQL A;  2ZKO A;  4UAS A;  3E89 A;  1XQ8 A;  3RYI A;  1NJI W;  4FZN A;  4RQN A;  4JI8 O;  4J9S A;  2NRV A;  4QZC A;  1P7D A;  5LGN A;  2LPE A;  2QKA A;  2Y69 B;  9ICA A;  2A79 B;  4BUG A;  4DL7 A;  3RAQ A;  3U0Z A;  3LUT B;  4DR1 O;  4TSF G;  1KUQ A;  3JAW A;  3IN5 A;  1T5E A;  2W43 A;  1JRP A;  1U45 A;  9ICF A;  5KG4 A;  5EWG A;  1Z4N A;  1R6T A;  2EIJ B;  4FFK A;  2NYV A;  4TV8 A;  4NXN O;  5BMV B;  4RNN A;  3E2E A;  1QU7 A;  1SQQ H;  2HHH B;  4FM1 A;  1WWV A;  1F5S A;  3T5J A;  1S5J A;  4YXJ A;  2ADQ B;  4I0X A;  2CUG A;  5JCO A;  5LP6 B;  4LCU C;  5FNV A;  3ZHS A;  1N60 A;  3AQE A;  5H6R A;  3WB2 A;  2AH5 A;  5ITZ B;  5J2T A;  4GIB A;  4TT3 G;  4GKJ B;  1NVP B;  2R8H A;  1ZQI A;  1ZQE A;  5AKY A;  2JEU A;  2AGP A;  3M6K A;  2F1M A;  1JJ2 U;  2B0C A;  4FZ0 A;  4B9T A;  1FXK C;  2KEY A;  4GKK O;  1XMO O;  4LFB O;  4P2H A;  5A2Q N;  1TKD A;  4Y2S A;  4DS5 A;  3QG5 A;  4I2A A;  2Q4P A;  3SYO A;  4F72 A;  3E58 A;  3LNN A;  3PJS K;  4DQP A;  4DR2 B;  1WA8 B;  5KFT A;  5AK4 A;  4JMU A;  4C8N A;  3ETG A;  4DV3 O;  2ASJ A;  5KX5 B;  2YY6 A;  4R6Z A;  4CH6 A;  4HZ3 A;  4X1K A;  3QTC A;  1PV0 A;  1YJW V;  4WBN A;  4KMU A;  1WAZ A;  1Z2G A;  4NLN A;  1N0J A;  5J29 A;  4KIT B;  2HFE C;  1NH2 B;  5AKH A;  4C4T A;  1JMK C;  4WFH A;  4LF8 B;  2HHV A;  3T3F A;  4F4Y A;  4F8R A;  3EUB 2;  2E5L O;  4RQM A;  2MUT B;  5J2C A;  4UCO A;  1YTF D;  1QR9 A;  2PUS A;  5KFR A;  1K97 A;  2VWK A;  5K1X A;  3ZMZ A;  3KZX A;  4ZOL B;  5ITZ A;  2ZIX B;  5LMU O;  1FD9 A;  1Z5W A;  3FAV A;  5J2I A;  2KN7 A;  3C5F A;  3F5W C;  1FFX B;  3RH6 A;  4L87 A;  5HNK A;  1BE3 H;  4O2B B;  1O08 A;  3OGI B;  4LF6 B;  3LWL A;  2OWO A;  3RW0 A;  3CRR A;  3BA9 A;  4IQW A;  1X9S A;  4HAM A;  1UPG A;  2XY5 A;  4MVU A;  1VQO V;  1VQ6 V;  1P4R A;  4LH6 A;  1WP7 A;  2P22 C;  3FAH A;  3FC4 A;  9ICT A;  9ICH A;  2HVJ C;  2EZZ A;  2NRW A;  3A0B Z;  4JZG A;  4YR0 A;  2JEX A;  2LW1 A;  3E22 B;  1A32 A;  2EBO A;  4FZ1 A;  4M6W B;  1U47 A;  2L6L A;  2QSA A;  4FZM A;  1QVF U;  1SWW A;  2WHE A;  1P49 A;  1RPO A;  5DKW A;  1NI8 A;  2JS3 A;  2VRZ A;  4Y2U A;  3C3T A;  4FS1 A;  1RM6 C;  3CYM A;  1BGY H;  4ZHQ A;  3GDX A;  1O03 A;  4NLZ A;  3IGA C;  2FPK A;  4R8U A;  4KLG A;  1ZQJ A;  3KCY A;  1PVQ A;  4F5R A;  4BDP A;  4QZ9 A;  3CSX A;  2IBZ H;  1KL9 A;  2OTL V;  4R64 A;  7ICI A;  2Q0A A;  4EB6 B;  3QU7 A;  2R8K A;  2YX8 A;  4UB6 U;  3K4G A;  4QWD A;  1RYU A;  5ALI A;  4O3O A;  2IH3 C;  1EBO A;  3H0L B;  1V54 B;  3VQX A;  4BWA A;  2XTA A;  3PR4 A;  2RCV A;  4NL9 A;  1KFT A;  2DE0 X;  2CTP A;  3KZI Z;  2B21 A;  5AK5 A;  5IIK A;  5AM3 A;  3ETL A;  3PNC A;  5IIM A;  4DF8 A;  1D5A A;  2X6B A;  4YN4 A;  2P90 A;  2YXH A;  3KHH A;  3BZC A;  2JS5 A;  1FXK A;  5HHI A;  9ICL A;  4ECY A;  3RWR D;  2XAG A;  5J0R A;  1PK1 B;  2K4P A;  1L3T A;  3GB7 C;  1BGX T;  9ICI A;  1KKC A;  9ICU A;  3AUO A;  1XC9 A;  4QWB A;  4J41 A;  4X1I A;  1BS3 A;  3RJJ A;  3SPG A;  4CE6 A;  2A0L A;  5IJ9 A;  5KFZ A;  4Z6E A;  1Y76 A;  2ZE5 A;  3ETE A;  2FPM A;  4I2I A;  2ZIV A;  1SGG A;  1BNO A;  2ZUB A;  1F7Y A;  4CH3 A;  3LSU A;  1S5L Z;  4LF4 O;  1EZV H;  4LBE C;  2KV2 A;  3RVY A;  1VQ4 V;  3JPN A;  2ASL A;  3O0F A;  1KW4 A;  1ZQO A;  2Y1J A;  1QLN A;  4JYC A;  2KG7 A;  2ZR3 A;  1ZXI A;  2BCR A;  1YXB A;  1YI2 V;  1RYR A;  1VQN V;  3QUB A;  2ITC C;  5HFL A;  3KHG A;  1P7B A;  2BKE A;  2V7Q G;  4GYC B;  4BR6 A;  4JI3 B;  4NLG A;  1WWU A;  2WF8 A;  4ZI7 B;  4LFC O;  2PYL A;  5J2U A;  1Q3V A;  1XRE A;  4KLS A;  1K7D A;  4QPK A;  3RJG A;  5DQH A;  1T7P A;  5K1P A;  3SAG A;  4RWU A;  5ALD A;  3JCZ A;  5D46 A;  1N5W A;  2ZDI C;  5JVD B;  4MVZ A;  1X40 A;  2QJ1 A;  2Q0O C;  4KLJ A;  4JPR A;  2UUA B;  1UQV A;  5EE9 A;  2EZP A;  4XBF A;  2F1H A;  3BQ2 A;  4DOC A;  4YY3 B;  5EBL C;  1JX9 A;  1YVW A;  4JV5 O;  2HMX A;  5L3F A;  1AR1 B;  2MA1 A;  4TUR A;  2KB1 A;  1A6S A;  4NM2 A;  1CI4 A;  3QO8 A;  3Q8R B;  3IJ4 A;  2UXC O;  4NVP A;  1IBL B;  5EK0 A;  4C8O A;  4ECR A;  3K9A A;  2JMG A;  2HHH O;  3AMZ A;  2GTA A;  4JV2 A;  5AKE A;  1G4Y B;  2EIL C;  2KG7 B;  1Q43 A;  2Q0Z X;  4IL6 U;  4ED1 A;  1Q3U A;  2DMX A;  2WLH A;  5ALL A;  5BR8 B;  5J9P C;  1PUZ A;  4MEY A;  4PA4 A;  2EIK B;  2ZUC A;  1JXE A;  4RPX A;  3V6J A;  1VP7 A;  3RJH A;  2NR5 A;  5AM0 A;  4XUS A;  3OTF A;  5IYC O;  2GV9 A;  1I94 B;  2ILM A;  2PXI A;  5JH7 B;  2ZXI A;  1PPJ H;  3L75 H;  1P7G A;  4IHJ B;  2G08 A;  3HKE A;  2QLT A;  4M9L A;  2HHT A;  1T3Q A;  5LMU B;  3N2K A;  1SXD A;  1ZWI C;  1SV0 C;  4R8U B;  2PTM A;  5KFF A;  1WUD A;  2OM6 A;  2ATL A;  3H40 A;  3S3X A;  2KHQ A;  2YXY A;  2FI1 A;  2X6C A;  3BEH A;  3ETQ A;  9ICN A;  2LI6 A;  4Y2X A;  3CCM V;  3W7W A;  5D49 A;  1ARO P;  1KMI Z;  2B1I A;  2NRX A;  3MFI A;  1NOM A;  1JN3 A;  3FKS G;  3L71 H;  3H1H H;  1QR8 A;  8ICR A;  1EFR G;  2VAN A;  7ICJ A;  2YIA A;  1DGS A;  1BPY A;  5ALV A;  2WAM A;  4I5S A;  2WFA A;  5CJ7 A;  3OW2 U;  2PFQ A;  4JI6 O;  4H13 B;  5KL8 B;  2EJ7 A;  2HI0 A;  1UPH A;  3AG2 C;  1GN6 A;  4YP3 A;  4ED6 A;  2JGU A;  1WN7 A;  5CWR A;  5KAI U;  3N4M B;  1AI5 A;  2ZJ8 A;  3E86 A;  1Q86 W;  1OXJ A;  1BMF G;  3H8W A;  2DJV A;  1ZD5 A;  1Q90 D;  4UAY A;  3D2S A;  3BY6 A;  3H0M B;  3N7R C;  3K1R B;  4Q43 A;  5A9G A;  4X1Y A;  2VQF O;  7ICL A;  3K5O A;  4UAU A;  2GOL A;  4TUQ A;  4JGS A;  2ETN A;  4ACO A;  4GXJ A;  3WK9 A;  4RUE A;  4GLX A;  9ICX A;  3JAR A;  2L5Y A;  4DV5 B;  5KHI A;  2A19 A;  2LJ2 A;  4B9S A;  5KFL A;  1VQ7 V;  3KHR A;  2IJH A;  4ASU G;  4DFJ A;  4O3M A;  4MT8 A;  4CRX A;  2BHN A;  2JZB A;  1TAQ A;  3UMC A;  5AI5 A;  4J7Z A;  2IOF K;  4O3S A;  2Z5U A;  3EFF K;  2ZM6 O;  3KZI U;  3MGV A;  3ZHV A;  4M9G A;  3HJE A;  2P35 A;  3S3W A;  3MR3 A;  3RFA A;  4F5O A;  1KN5 A;  3HW8 A;  3ZHU A;  2Y9U A;  2M6Y A;  4JYA O;  2UXN A;  5BMV A;  4O3R A;  3TAD A;  2ES6 A;  4CS4 A;  8ICI A;  4GFJ A;  4DSJ A;  3EVK A;  2OCC B;  2X7R B;  4NTW A;  3KD3 A;  3G6V A;  2O57 A;  2P4K A;  4RQ6 A;  5AIB A;  1VLB A;  2OHF A;  4FFB A;  2ZJ5 A;  1NNL A;  3GV7 B;  4LC1 A;  4QZI A;  1V55 B;  3TCU A;  4G2K A;  5ALT A;  2XND G;  3EHB B;  4QE9 A;  2A1J B;  2F66 C;  3RYI B;  4GZR B;  5LOV B;  4YR3 A;  3RB6 A;  3ABL C;  2YB1 A;  4GX0 A;  5G5H A;  5EIB C;  1OCC B;  4B3S O;  5EYP A;  2CH7 A;  2DYS B;  2ZIV B;  3WK8 A;  3N2G A;  5CMU A;  4RQ4 A;  3GIL A;  1R3L C;  2WWW A;  4NJ8 A;  2YTU A;  3AK3 A;  3IAY A;  3JAK B;  5KHG A;  7ICU A;  1H8E G;  1JI7 A;  3RBE A;  5LXT B;  1JPX A;  4DFM A;  1N48 A;  2R9I A;  1AJP A;  3RJE A;  4O4I A;  4X1K B;  2VS0 A;  2UXB O;  1VJ5 A;  4RUF A;  4KUM A;  1YIT V;  2HCF A;  1PNM A;  4DUZ O;  1AVM A;  3TXQ A;  4EEY A;  5BPC A;  1N33 B;  3BAB A;  2JEI A;  3AEI A;  3I56 V;  3KKY A;  1DK1 A;  2K8A A;  3K06 A;  4DEZ A;  2HDO A;  4FMT A;  3UO3 A;  4EZ9 A;  2DKZ A;  5ALN A;  2OEH A;  1FFT B;  1K33 A;  1LUW A;  5L1L A;  2XOK G;  2E1F A;  3RB4 A;  1DTO A;  4NLK A;  4O2B A;  5J8Y A;  2QR4 A;  3CRQ A;  2MUT A;  3JPS A;  2KVC A;  5KFA A;  1XSL A;  5BR8 O;  5IYZ A;  4P0P B;  1KBU A;  3C1Y A;  2W9A A;  1WG8 A;  1AP6 A;  4B9M A;  3IG5 A;  1IBK O;  4KHP B;  1TK0 A;  4I55 B;  8ICE A;  4GXI A;  4I2H A;  3OMI B;  3WK5 A;  4YJ3 A;  3SI8 A;  1R6K A;  1QSL A;  4LNU B;  2W7P A;  5KMG A;  3OJS A;  3M8A A;  3SZ2 A;  3N27 A;  2LFR A;  4K4G A;  3ZCC A;  2MAX A;  4DR2 O;  2H8P C;  4B6J A;  3ASO C;  2KSD A;  2RJZ A;  1ZQX A;  1KEJ A;  3GII A;  4F3O A;  1SQV H;  4LF5 O;  5KFO A;  3E35 A;  1S77 D;  4ECU A;  1TK5 A;  1UJW B;  2F3N A;  4LVS A;  4O4J B;  1Y74 B;  2EZO A;  4YIO A;  5JJN B;  4O3Q A;  2FLP A;  4DL2 A;  3K5L A;  1UFI A;  1Q7Y W;  2BTQ B;  2QA4 V;  3L4P A;  2M0N A;  2BE3 A;  1VQ8 V;  8ICW A;  5FL7 G;  3H1K H;  3T1C A;  5T14 A;  5AKJ A;  3Q4H A;  3MHS C;  2RQ5 A;  2ZJA A;  4UB5 A;  2Q73 A;  2P67 A;  3T79 A;  5A0L A;  1BPX A;  4MVS A;  1SC5 B;  5F3X B;  4J7K A;  5LP6 A;  2HKO A;  3P3P A;  3DC6 A;  3H01 A;  4J03 A;  4Y2V A;  4ED3 A;  2ZNI A;  1JQ0 A;  2JIZ G;  4RNM A;  5AG2 A;  1BPD A;  1SS3 A;  3BQ7 A;  3TAQ A;  2QE7 G;  2ADP A;  3JYC A;  3CCV V;  4UAT A;  1ZQD A;  1V9P A;  4F91 B;  3T5H A;  5B5E Z;  5L3D A;  2DWQ A;  1L3V A;  1TAM A;  1DGJ A;  2WF7 A;  4TUY B;  3G6Y A;  2QGN A;  5KAF U;  2UUB O;  4J9Q A;  4QE7 A;  5EIB D;  1VMG A;  2DN9 A;  1SQX H;  3PMN A;  3N7S C;  2IOF A;  3ORY A;  4Y2Q A;  3WKA A;  1ZLZ A;  3CCR V;  4EBE A;  9ICB A;  2C2R A;  4PV1 B;  2OT5 A;  1QH9 A;  1QSS A;  5KT4 A;  2R9R B;  4JAU A;  5G5G A;  3AQF A;  4Y2P A;  4B9V A;  5CHG A;  2K4E A;  5AI0 A;  4LZD A;  1SL2 A;  3QF7 A;  4K35 A;  1FAF A;  2LO1 A;  1TUB A;  3T5K A;  4UUJ C;  3TXS A;  1D9F A;  4IRD A;  2AGA A;  3BCC H;  3STZ C;  2G06 A;  4FE3 A;  4YFK A;  1N0N A;  2PF4 E;  2F44 A;  4PHD A;  4DR5 B;  5KT2 A;  3TAR A;  4BXO B;  5LYJ B;  1KQS U;  5F9L A;  5KG2 A;  1NK4 A;  1TUB B;  3HX0 A;  2CTR A;  4CBC A;  3RYH B;  4QW8 A;  4F4X A;  4KX3 A;  2ITD C;  3ZRS A;  4O4J A;  4DFK A;  1ZQF A;  3TET A;  4FM0 A;  4F2S A;  4MF8 A;  1K34 A;  4IGG A;  5J2H A;  1YIJ V;  2UUC O;  3V6H A;  1XUQ A;  1XMO B;  3Q8S B;  2DPJ A;  3OGU A;  3L70 H;  2YIC A;  1GN4 A;  2XT9 A;  2ESE A;  2RLT A;  4I9W A;  3SJC C;  3A0H Z;  3A0H U;  1RQL A;  4ELV A;  5DDM A;  5KFX A;  2NV3 A;  4AP9 A;  8ICZ A;  4K0K B;  3K04 A;  4TQF A;  3J81 j;  4JK1 A;  4UCR A;  3BQ1 A;  3PX6 A;  2R18 A;  4F92 B;  1E1Q G;  4F4W A;  3CYO A;  1FJG O;  5CEH A;  2BZF A;  3ZRX A;  1ZJM A;  4EEL A;  5LGT A;  4ED0 A;  3PO5 A;  3EWA A;  1EM1 A;  4YJ3 B;  3HT3 A;  3WG7 B;  4F4Z A;  4EYI B;  3PX4 A;  1CXZ B;  3FB8 C;  2W3S A;  1WB8 A;  3ZRV A;  1ZQM A;  5KLV H;  4X64 B;  3LK9 A;  5KFJ A;  4FS2 A;  5EZY A;  8ICP A;  4ZOH C;  4K8Z A;  2KOB A;  3IG8 A;  2PI5 A;  1I5Y A;  2BCC H;  2YEV B;  4EEN A;  2C2E A;  2P6J A;  2WF9 A;  1TVK B;  1OCO B;  1N8R W;  2HHX A;  2EIJ C;  2ASD A;  2F4V B;  3LDD A; 
#chains in the Genus database with same CATH homology
 3JD3 A;  1V54 C;  2H3Q A;  3KG2 A;  5B1A C;  1YTF D;  1QR9 A;  1K97 A;  3ZMZ A;  3F2C A;  3KZX A;  3STL C;  5CRX A;  1WLE A;  4HYO A;  2ZIX B;  2UXX A;  5CA3 A;  3RF9 A;  1RM1 B;  5DN6 G;  1K3E A;  3OEE G;  4EKW A;  4C0Z A;  2WAQ F;  4WFB V;  3F5W C;  3LYS A;  3OFN G;  2HBL A;  1ECW A;  4L87 A;  1AI4 A;  4TWK A;  2G5H B;  2HBK A;  1JVM A;  1VQL V;  2Y0S F;  1F4N A;  1M9N A;  1RPR A;  3B77 A;  3SPC A;  1H38 A;  1GM7 A;  3RW0 A;  1J95 A;  5E1A C;  5EC1 C;  3ZRW A;  4HAM A;  4MVU A;  2ZD9 A;  1VQO V;  1VQ6 V;  1PVR A;  1Z1B A;  1P4R A;  1OCZ C;  4ICA A;  2XAS A;  3K0D A;  2HVJ C;  4XDK A;  3W7T A;  2BOB C;  1M57 B;  4UV8 A;  2Q6A A;  3IP4 B;  1SES A;  3IC7 A;  2JEX A;  2WLI A;  1VQM V;  2EBO A;  5IDJ A;  1M56 C;  2HBJ A;  3K03 A;  5LHH A;  4FZM A;  1HIW A;  2XVT A;  1FXH A;  1QVF U;  1RPO A;  2M7W A;  3VC8 A;  4CDG A;  2JGA A;  5LHG A;  4DXW A;  3LSQ A;  2AHY A;  3AG3 B;  3CYM A;  1M57 C;  2K8B B;  3IGA C;  1MOF A;  1OCZ B;  2W6J G;  1OUQ A;  1S0V A;  2HR3 A;  1Y4M A;  3ASN B;  1PVQ A;  3KFU F;  1GKF A;  2IJK A;  2IU3 A;  4PDV A;  3OR7 C;  3SPI A;  2OTL V;  3AG4 B;  1JOY A;  2YX8 A;  4MVQ A;  3LDE A;  3C28 A;  2IH3 C;  1EBO A;  1WPX A;  3H0L B;  2XAQ A;  4X88 A;  1V54 B;  5DM6 V;  4DO2 A;  1E79 G;  1H8H G;  3PSF A;  3OMA B;  2IW5 A;  5KA6 A;  5HR7 A;  1FXK B;  2DW4 A;  1L6N A;  2X6B A;  2V1D A;  3WG7 C;  2P90 A;  3CCJ V;  1FXK A;  2HG5 C;  2XID A;  1B6Q A;  1GMG A;  4OJ5 A;  2XAG A;  3GB7 C;  1F23 A;  4WCE V;  4XDJ A;  2ZDI A;  3GWO A;  3SPG A;  3AG4 C;  1KC8 W;  2A0L A;  2K1E A;  3ETE A;  2MRL A;  2ZIV A;  3CD6 V;  4P2Z A;  4GT1 A;  1YJ9 V;  1MSW D;  4E2L A;  1E1R G;  4ZBM A;  1XNS A;  2IJJ A;  3D2Q A;  4LBE C;  2KV2 A;  1QLE C;  3RVY A;  2BDU A;  3F5E A;  2F8L A;  5CBH A;  3CCE V;  1VQ4 V;  2LP7 A;  2W0F C;  3O0F A;  2X6A A;  3AG1 B;  1QLN A;  1PL0 A;  4JYC A;  2RP5 A;  1VQ9 V;  2ZR3 A;  3ZIA G;  2EIK C;  2D3O W;  1KP3 A;  4MVR A;  5B1A B;  1KEC A;  2JHD A;  1YI2 V;  3F7Y C;  1VQN V;  2WLI B;  2ITC C;  3CCS V;  1CP9 A;  2WLK A;  5HFL A;  2G5I B;  2LYB A;  1P7B A;  2V7Q G;  5IY5 C;  3CC2 V;  3HKZ C;  5C93 A;  3CXC U;  1Q3V A;  1THZ A;  2G09 A;  3LDC A;  1K7D A;  3ONN A;  1OCC C;  4QPK A;  1DRG A;  2JJ1 G;  3ETD A;  3G71 V;  3SAG A;  5HR6 A;  2Q4T A;  2F76 X;  1IXM A;  4OJO A;  2X0L A;  3JCZ A;  2EIL B;  2KKP A;  5IYB O;  4FZL A;  2ZDI C;  3B8M A;  4MVZ A;  3ABM B;  4JPR A;  2EZP A;  4XBF A;  4P0P A;  4WFG A;  2IJI A;  1G8M A;  1JX9 A;  2Y69 C;  5EBL C;  3CC4 V;  1ROP A;  3E83 A;  2HMX A;  2QM7 A;  5L3F A;  2B1G A;  3QNE A;  1OHH G;  2CRX A;  2MA1 A;  2KB1 A;  4JTA B;  5B1B C;  1A6S A;  2PMZ F;  1AR1 B;  1ED1 A;  1F44 A;  1SZT A;  1H2G A;  3PSI A;  3CRX A;  3QO8 A;  1YTF B;  3HKZ F;  5EK0 A;  3HB3 B;  3W7X A;  1VQ5 V;  3K9A A;  2JMG A;  1EZJ A;  3DGE A;  2ATK C;  3MHH C;  2WPD G;  1G4Y B;  2EIL C;  2KNJ A;  4CGZ A;  1Q3U A;  4QIW C;  2WLH A;  1PD3 A;  5L3C A;  1K8A W;  2KD1 A;  3CC7 V;  5J9P C;  2JH7 A;  4PA4 A;  3ABU A;  3OAA G;  4XDL A;  2EIK B;  2DYS C;  2LKY A;  3PSP A;  3OUF A;  3M6Z A;  1NR7 A;  2W6I G;  3K0G A;  5H9C A;  2G0A A;  2ZXW B;  2JH1 A;  5IYC O;  3T2M A;  1NVP D;  4LP8 A;  2Q67 A;  1DF4 A;  2ZXI A;  4G28 B;  5CBF A;  1YT3 A;  2G08 A;  1Q81 W;  2VJ4 A;  1R6N A;  3FB5 C;  3E0F A;  5H6Q A;  5BZB A;  1AJQ A;  1DLB A;  2A9H A;  3F7V C;  1ZWI C;  3ABL B;  4X89 A;  2OM6 A;  1WUD A;  2XI9 A;  1YJN V;  4QIW F;  2KHQ A;  4UVA A;  2X6C A;  2F77 X;  3BEH A;  1RM1 C;  3SYP A;  3F2D A;  3LVV A;  2W7O A;  2JJ2 G;  2KJ8 A;  4PA3 A;  3CCM V;  3CP8 A;  3W7W A;  3PZP A;  2GSM B;  4QJF B;  1ARO P;  1BHB A;  2WB1 C;  2B1I A;  3NUQ A;  2QM8 A;  1LNQ A;  4KFM A;  1XO0 A;  4NLC A;  3FKS G;  2IU0 A;  1QR8 A;  4MW3 A;  2ZIW B;  4MW8 A;  1EFR G;  4GX2 A;  1W0J G;  1CEZ A;  3OE7 G;  4U7C A;  2ZIU A;  1NR1 A;  4WFF A;  2ZXH A;  4X8A A;  2QTO A;  4NLB A;  2WAM A;  4I5S A;  1K4C C;  5KL1 B;  1GK9 A;  3X2Q B;  3OW2 U;  1K5S A;  1F51 A;  3JD4 A;  3ZJZ A;  5KL8 B;  4PDM A;  1UPH A;  3AG2 C;  3MD0 A;  4PL2 A;  1KKD A;  3OMN B;  3T4D A;  1TUE B;  4FIP C;  3TK1 A;  5LGU A;  3SQI A;  1AI5 A;  3E86 A;  1Q86 W;  4RAI A;  1BMF G;  1AI7 A;  3D2S A;  3BY6 A;  1ENV A;  3H0M B;  3N7R C;  2DWE C;  1M90 W;  3SPJ A;  2GOL A;  3M7D A;  4JGS A;  1GM8 A;  2WAQ C;  5CN0 A;  1K73 W;  3F53 A;  1MAB G;  2EIN B;  4ACO A;  4RUE A;  4WF9 V;  2Q68 A;  3RBZ A;  1M1K W;  1VQ7 V;  1GO3 F;  3JD1 A;  2IJH A;  1M56 B;  4O3M A;  4OJ6 A;  4MT8 A;  4CRX A;  3WFV A;  4PA9 A;  4ASU G;  2HOI A;  3DTU B;  3HPL C;  2WLM A;  4MTX A;  1S76 D;  4A8E A;  2Z5U A;  4PDL A;  2GH1 A;  3F5A A;  3AG3 C;  1QVG U;  3EFF K;  2H3I A;  1V55 C;  2K8C B;  2LBO A;  3MGV A;  1K9M W;  5L3E A;  2NNU A;  2ZIU B;  3RFA A;  1Y66 A;  3B8N A;  2D6F C;  3ABM C;  2ZIW A;  4JTC B;  3OPX A;  2OH2 A;  4KP4 A;  3SYC A;  4OJL A;  1BL8 A;  2B5U A;  2Q69 A;  4JTD B;  2UXN A;  4FPP A;  2DQN B;  1CRX A;  2KJ5 A;  4QNH B;  3CP1 A;  2VKQ A;  4GFJ A;  3JD0 A;  2A3V A;  2OCC B;  2X7R B;  1BHA A;  2JDI G;  4F4L A;  4ZKI A;  2W03 A;  3CMA V;  2HJF C;  4MVM A;  3ZN1 A;  3ZMS A;  5IYD O;  3SAH A;  2E1E A;  3SMV A;  4LC1 A;  4OXS A;  4Q20 A;  1OZ0 A;  1V55 B;  2H94 A;  3TCU A;  4G2K A;  3ZMT A;  3EHB B;  2XND G;  2DGZ A;  1NH2 D;  3NRW A;  4QE9 A;  3GZF A;  4H37 A;  2LFS A;  2P7T C;  3ABL C;  4GX0 A;  2YB1 A;  4RQE A;  4BJQ A;  1OCC B;  2KHV A;  1PKX A;  3OM3 B;  3D2N A;  3P30 A;  2DYS B;  1OCR C;  2ZIV B;  5CMU A;  2ZR2 A;  2EIM C;  2RHF A;  1CPY A;  4QPJ A;  2WWW A;  3VCB A;  2OYY A;  1R3L C;  3ZMV A;  4GX5 A;  3SYQ A;  4GCZ A;  3E8F A;  1H8E G;  3C29 A;  2HOQ A;  3SAF A;  2E5S A;  1HEK A;  2Y0S C;  1NZB A;  4NWI A;  2CPR A;  4PA7 A;  1JPX A;  2R9I A;  2NLJ C;  3UM7 A;  1AJP A;  4QNL A;  1R3J C;  3LSS A;  1ZQ1 C;  4PEL A;  4PL1 A;  2K89 A;  4RUF A;  4KUM A;  1MG1 A;  1F4M A;  1YIT V;  2MK3 A;  1PNM A;  5GW7 A;  4R8C A;  2JK5 C;  3LDD A;  4P9O A;  5B1B B;  5LBQ A;  3CME V;  3I56 V;  3AEI A;  4MTO A;  5KUM A;  2K8A A;  3K06 A;  3E8H A;  3R65 A;  4P30 A;  4R50 A;  4FMT A;  1PVP A;  3IFX A;  2YSU B;  4J9Z B;  1FFT B;  1K33 A;  5C0Y A;  2XOK G;  3ABK C;  3PST A;  2E1F A;  4PA6 A;  1DTO A;  1AI6 A;  5KA5 A;  4MS2 A;  2KVC A;  1GTO A;  1PNL A;  2WLL A;  3GU3 A;  4P9P A;  5B1N A;  1DF5 A;  4JF3 A;  4P0P B;  1KBU A;  1R3I C;  3FYI B;  1VQK V;  4UVB A;  1K92 A;  1KD1 W;  1T94 A;  2ZXW C;  3IG5 A;  2C2A A;  3FYE B;  4G27 B;  3OMI B;  2DYR B;  2XIC A;  1R6K A;  1NBM G;  2KJ9 A;  2W7P A;  4BW5 A;  1SRY A;  3OGC C;  1KP2 A;  2LFR A;  4R7C A;  3ZCC A;  3I55 V;  3DEE A;  2H8P C;  3ALR A;  4OO1 J;  3D3I A;  2ZG6 A;  3ASO C;  2KIW A;  2LYA A;  4MTF A;  1K4D C;  1QCE A;  1XL4 A;  1L1F A;  4H33 A;  2VIX A;  3E35 A;  5B3S B;  1S77 D;  1UJW B;  3K79 A;  2DQ3 A;  2PMZ C;  4NV0 A;  1W0K G;  2EZO A;  4KX5 A;  4BIU A;  1S72 V;  2CK3 G;  2CN1 A;  3VOU A;  5L3B A;  1SER A;  5EBM C;  1W2B U;  3F2B A;  4WJ3 B;  1Q7Y W;  2H3Z A;  3P32 A;  2HVK C;  2QA4 V;  1VQ8 V;  2M0N A;  1GM9 A;  2IH1 C;  4KMO B;  3OEH G;  4N23 A;  2LHT A;  4U7N A;  4WFA V;  2OCC C;  5FL7 G;  3T1C A;  5T14 A;  3K08 A;  2DF4 B;  3MHS C;  2EIN C;  2P67 A;  2RRD A;  2OXO A;  3N7P D;  5A0L A;  3T79 A;  1PNK A;  5EC2 C;  2ZIX A;  4MVS A;  4BAY A;  2Z3Y A;  3NXS A;  3OUS A;  3G6E V;  1FXV A;  1SZH A;  1COW G;  2HKO A;  2DQ0 A;  3ABK B;  3H01 A;  2K4I A;  2WSS G;  3CPW U;  1URJ A;  2EJR A;  3X2Q C;  1JQ0 A;  2JIZ G;  3ML0 A;  3ASN C;  2QEX V;  1FS0 G;  2BOC C;  3E8B A;  2QE7 G;  3JYC A;  4BX9 C;  3CCV V;  4MTG A;  2F2A B;  2H3F A;  3ZRW B;  3UKM A;  2W04 A;  2DYR C;  5L3D A;  4WFE A;  1TAM A;  2KIC A;  4CZZ A;  3CCU V;  3ABT A;  1YHQ V;  4QE7 A;  3N7S C;  3K1Z A;  1NQT A;  4UV9 A;  1YSC A;  5B1O A;  1Z19 A;  3CCR V;  1Q82 W;  4J9Y B;  2FTK A;  4UXN A;  2OTJ V;  2WLL B;  4IC9 A;  2OT5 A;  1XL6 A;  2WLN A;  5KUK A;  4MVO A;  3K3W A;  5L3G A;  5B3S C;  2R9R B;  2ZQM A;  4JAU A;  3AQF A;  3G4S V;  2QKS A;  2K4E A;  2HBM A;  4N21 A;  1QBZ A;  5HFM A;  1R73 A;  4RO2 A;  3LVW A;  1K5Q A;  3W7S A;  2YEV A;  1NKD A;  4UUJ C;  3L3F X;  2VJ5 A;  3E8G A;  2HOF A;  1S3J A;  2DWD C;  1QLE B;  1SET A;  2GHY A;  2XAH A;  3QO5 A;  4UVC A;  3E89 A;  4Z1M G;  3STZ C;  3AG2 B;  2G06 A;  4FE3 A;  1NJI W;  4FZN A;  2KKV A;  1P7D A;  5LGN A;  4P0Q B;  1KQS U;  2Y69 B;  2A79 B;  3VBB A;  1OCR B;  2YB4 A;  4BUG A;  3LUT B;  3AG1 C;  2F43 G;  4TSF G;  4CBC A;  2ITD C;  4KX3 A;  4OJP A;  3IN5 A;  1D8B A;  2HLD G;  3ZRS A;  3TET A;  3A0R A;  3T4Z A;  1K34 A;  2EIJ B;  3OR6 C;  4JYB A;  1YIJ V;  2PI4 A;  1I5X A;  1OCO C;  3E2E A;  3ASO B;  4FJC C;  3ZMU A;  4I9W A;  1ORQ C;  3D36 A;  3LNM B;  2NV3 A;  5LHI A;  4LCU C;  3CCL V;  5H6R A;  3AQE A;  3H0R B;  4AYB F;  2AHZ A;  2XAJ A;  3CCQ V;  3JD2 A;  3FB7 C;  4TT3 G;  3K04 A;  1NVP B;  4U6P A;  2EIM B;  2K4H A;  2JEU A;  1JJ2 U;  3M6K A;  5CBG A;  1HWY A;  2WLJ A;  4FK5 C;  4U7O A;  5EBW C;  2R18 A;  1E1Q G;  3QO7 A;  3CYO A;  2G07 A;  1FXK C;  2KEY A;  3ZRX A;  3W7U A;  1R3K C;  5LGT A;  1JCH A;  3ZN0 A;  3M99 B;  4PDR A;  3SYO A;  3SJQ C;  4JAS A;  3PJS K;  3WG7 B;  4MSW C;  1MA7 A;  4JMU A;  2H3V A;  3ETG A;  2XAF A;  3RVZ A;  3FB8 C;  4BIZ A;  4P0Q A;  2WB1 F;  2Y48 A;  3ZRV A;  4AYB C;  4JAV A;  4R6Z A;  3SPH A;  3SYA A;  4GX1 A;  4HZ3 A;  5IY5 B;  2Z7J A;  2KOB A;  3IG8 A;  1S5H C;  4YXW G;  3FB6 C;  1A0P A;  2N1R A;  1I5Y A;  2YEV B;  1YJW V;  2PI5 A;  2P6J A;  3AL0 B;  1VQP V;  1AJN A;  2HFE C;  4RQF A;  1NH2 B;  1OCO B;  4WFH A;  1N8R W;  2EIJ C;  1IIP A;  3ICX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...