1GO3F

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
MIGKKILGERYVTVSEAAEIMYNRAQIGELSYEQGCALDYLQKFAKLDKEEAKKLVEELISLGIDEKTAVKIADILPEDLDDLRAIYYKRELPENAEEILEIVRKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 33
structure length 107
sequence length 107
chains with identical sequence N
ec nomenclature
pdb deposition date 2001-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1go3F01
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1go3F02
1D8BA 2HBMA 3SAFA 2KV2A 1YT3A 1WUDA 2E1EA 4NLCA 2RHFA 4O3MA 2HBLA 4CDGA 4CGZA 3SAHA 4QIWF 4QJFB 2HBKA 2HBJA 2DGZA 2CPRA 2E1FA 2MA1A 4NLBA 3SAGA 4OO1J 3CYMA 2RRDA 1GO3F 5C0YA
chains in the Genus database with same CATH superfamily
2F1IA 5AK3A 1M4UA 3CSXA 1ED1A 4YXWG 5KHGA 3S3XA 2K9PA 5EE1A 2Q6AA 2ZCEA 2YQEA 3WU2U 3JD0A 2H3VA 1ZUQA 3K57A 4B6JA 1XBLA 4X66B 5IWAO 1A76A 5H2FU 1OCOB 3RYCB 1TAQA 5K4LA 5IE9A 5BMVA 1P4RA 3GQCA 2Y0IA 1WWVA 5ALPA 2ASJA 5LGNA 3B9JA 5KFFA 5ALTA 8ICSA 8ICMA 3N7SC 5AI8A 3X2QB 4K35A 3IGAC 3BRCA 3EFFK 4JZ2A 2ZUDA 3RAQA 4J9MA 2LGQA 5KFHA 2IOFK 2XOKG 5B5EZ 3H8WA 4HNAB 4TV8B 4LFAO 3CEIA 4RUCA 3KHHA 3ASNB 5IYZB 2UXCB 4DFDA 4YY3B 2EIKB 5FL7G 1XS9D 4M47A 1IBMB 4QZAA 3KZIZ 7ICOA 4DYLA 2CH7B 7ICIA 3DTUB 1K5SA 5C93A 5KA6A 1N34O 2BSKB 5IIJA 4DO2A 5KFYA 2ZD9A 3UQ2A 1UCVA 5KG2A 4OD0A 5BOMA 1N2XA 4DFKA 3M1YA 4IRDA 7ICTA 4U7CA 4UAZA 4YQWA 9ICNA 2HJDA 2YICA 2ZE5A 5KFAA 3AUOA 4E0DA 2FLPA 4I4TB 5AKZA 2KK0A 4U7OA 7ICSA 3ZDCA 4KLTA 9ICTA 1PNKA 3OM3B 5ALIA 1I7FA 4PHDA 2K4IA 5J2HA 2EZOA 4U7NA 5GONA 5CA0A 5DBAA 3LSQA 4FJCC 3H40A 4K4GA 2QWPB 2HJFC 1JMSA 4QZFA 4YMNA 3AG7A 4KHPB 4IS7A 2QKCA 5CJ7A 1MSDA 2F4VO 5L3BA 3LNNA 5FNVB 5LHGA 5C5JA 2N04A 4MEXA 4PDVA 3Q4HB 1FFVA 1N62A 2FI1A 3J80N 3I5DA 7ICFA 2JH7A 3CCUV 2UXDB 5E79Z 1GO3F 2LQTA 1VF6C 2NRTA 2RQ6A 2YUAA 1NBMG 2ZE8A 3SAFA 3V6JA 2F77X 3SYCA 2P66A 3B8MA 1S5HC 2QTSA 4DUZO 4UQGA 1Y74A 2XT9A 1TE2A 4TUSA 4O5EA 3PSFA 4F5RA 2KNJA 4Z6FA 2QLTA 2PI5A 1S5JA 8ICKA 1S0MA 4O2BB 3CJHA 4IR1A 2GUZB 4PDLA 4L8JA 1B0XA 4DL3A 1Q90D 2FB5A 5KT5A 3K1ZA 2XO7A 1QSLA 4X1YA 4DFPA 4UVAA 3GWKC 5EYPA 1ZQWA 1XSLA 1PV0A 4J80A 1T8EA 1ZQAA 1XMOO 2FMSA 4I2BA 1NR1A 4PA7A 1KEJA 4PZNA 3L72H 5AI6A 1SQVH 1ZX3A 3TFRA 2A1JB 1ZQKA 3ED5A 5KFXA 5HNKA 1UT8A 4I2IA 3KD3A 3F2CA 7ICHA 3NVVA 7ICPA 2ZTEA 2CTQA 2PUSA 1V55C 2W6IG 3D3QA 2JDIG 2EINB 5BY1A 4CS3A 4ZIBA 3R66A 3SR2C 5KFJA 1KP2A 1R3IC 4FLTA 1SV4A 2QWOB 2YTUA 3H0LB 3ISBA 5B1BB 2BTQB 4PA4A 2KIVA 1I94O 2K8BB 3SJBC 3QNEA 5KFIA 4EB6A 2KHVA 4R63A 4LF7O 2ODGA 2HG5C 3WFVA 1XWLA 2GHYA 1O03A 1RYSA 4DQQA 4PA3A 3LSSA 2FPKA 3V7LA 5AM5A 2GTSA 2Q0OC 4HAIA 4KLUA 1FFXB 4LFAB 5KLVH 2R8HA 2BGWA 4FZNA 1OHHG 5KFZA 4FLVA 3GV5B 5IDJA 4C7YA 2Q68A 4R8CA 5LMUO 4B3SO 5J2EA 4Y2UA 2Q4PA 1LKYA 1O9GA 1L7OA 4NJ8A 1ROPA 1W0JG 1N34B 4JWMA 4B3MB 4CS4A 4JI0O 1TKDA 2VJ5A 2YI8A 3TCUA 2LMRA 4DSJA 4U6PA 4JGSA 3JCUZ 2NNUA 5JWPA 1QSSA 3NASA 4EZ6A 1P7GA 4OJ6A 2ATKC 4Q8EA 4NYKA 4IQTA 3KZXA 2W8LA 4WFFA 2VRZA 2AGPA 4FFKA 1LUWA 1W59A 3EPGA 5AKIA 8ICJA 3ETQA 1KL9A 1RPLA 4N21A 3RYHB 3JSLA 1DGJA 3OSPA 5B3SC 3WK4A 3HILA 3IV6A 4NLBA 4XDJA 3GIMA 2O57A 4LCUC 1NH2B 4F8RA 4I2EA 3M7DA 1K7DA 2IJJA 2RMKB 4IIJA 2F4VB 4ZHQB 4M9HA 5ALQA 1KDHA 3MC1A 1PK1A 4KITB 1U4BA 1U48A 1QCKA 4P0QA 3AG2C 4DOBA 2XAQA 4M9GA 2LKYA 2MSNA 4UB6U 2NLJC 1OCCC 4ED1A 5KHIA 4I50B 1TAEA 3QTCA 2G09A 1EN4A 3D2NA 3VQXA 4F92B 4FIPC 1ZYQA 2BCUA 1B04A 2IJIA 3RJKA 3HW8A 1ZRNA 3MR6A 2HP8A 4DUZB 5KG3A 2A0LA 4ECZA 2Q0AA 1WAZA 3UO2A 2H3FA 1ZQHA 5ALDA 4PL2A 1ZQEA 5CBFA 3H1HH 2A9HA 1UQVA 4Y2YA 1XILA 2EIMB 1N5WA 1S97A 1XU4A 1SKSA 4IL6U 1CP9A 1TUEB 4DLGA 3UM9A 1TVKA 3L4PA 3FAHA 2KKWA 4O4HA 4YMOA 7ICEA 3DDHA 2B9ZA 5EIBC 3T5LA 2KQXA 1NZBA 1R1BA 4R6ZA 2IA6A 4NLNA 1XMOB 2Y9UA 9ICGA 3W7UA 1M90W 4LF7B 1SQXH 5J2TB 1H2NA 4P2ZA 2PFPA 4J9YB 3GIIA 1SC5B 1C7YA 3D3IA 5B66U 3M8RA 4ICGA 4DV5O 1MOFA 2WAQC 4K3AA 3FYHA 5CB4A 4LWSB 4MS2A 3BQ1A 2XGQA 4DL4A 2ZXIA 1FJGO 4H0LB 4RPXA 3SYPA 3BEHA 2YEVB 2QM8A 4CC6A 1GN3A 2HHSA 1JOYA 3ZMUA 4DF4A 4DSLA 1CUKA 2E8MA 4WBNB 1I94B 3M6KA 2CTRA 5T14A 1QQCA 1VQ7V 4K4IA 2EIKC 2R8GA 1BQZA 3LWMA 3T5HA 8ICEA 4O3QA 4DOCA 4DL7A 9ICOA 1DK2A 2PGGA 3ZDBA 3HKEA 4IYHA 1PUZA 3RB0A 1X59A 4UFZA 4EX7A 2WF8A 2Q9LA 3DEEA 3E86A 2Q0ZX 3FFQA 3C29A 1HDJA 3VC8A 5J0SA 5HMLA 4I2JA 5AKHA 4UBCA 4RQ3A 9ICJA 2VA2A 3OJUA 4B9MA 3FDSA 3B2EE 5L1JA 5J0TA 3L73H 1ZTEA 8ICYA 4LNUB 1YTFD 5AKYA 4I9WA 3ABLB 3DXRA 4NVPA 5J8YA 4B3SB 5LMUB 4MHVA 2YX8A 2LI6A 3L75H 2I6XA 2W9BB 3CB2A 1VQ5V 4A8EA 4QZ9A 1YSCA 4F4WA 4X1IB 2R9AA 4US8A 3E89A 4JI0B 8ICVA 2ZR3A 3E2EA 2YXHA 2AGQA 2BCRA 1BZKA 2DBYA 2RDIA 1K97A 4CF3A 3TANA 1V9PA 4BW5A 3MD0A 5KL1B 2XY7A 1ZQCA 4KP4A 3JPQA 4K4HA 3BPZA 2W03A 4DFJA 4UAWA 4DV4O 1M1KW 5ALJA 3G80A 1L0LH 1PNLA 2BOBC 1S72V 3G6VA 3BZCA 3T4ZA 3RYFB 4OPHA 1L8OA 4FZLA 1BL8A 4ELUA 4O4LA 4F4KA 4AI8A 1L0NH 4WFHA 3H1KH 3G6YA 2PXIA 4DL2A 2WLNA 3OD4A 5KHHA 4KMOB 5A0LA 3UM7A 2L5YA 4CNQA 2ZTCA 4PGYA 2HBJA 3RAXA 2DMXA 3WK9A 4ECUA 1RZTA 4N23A 2MA1A 4D7SA 3ZD9A 2E5LO 2H3ZA 1P7DA 4CZZA 2IU3A 1QQ7A 3QU7A 1BMFG 2WA4A 2AQ4A 4ZI7B 1MG1A 4GX2A 3PW2A 2DUYA 2XY5A 3V6KA 4KX5A 1MQ3A 1QLEC 1Y76B 3KHGA 4F50A 2AGOA 4DFMA 1M57B 4WFGA 5ITZA 3THVA 3VBBA 3ASOC 1RPRA 1BPZA 3CCQV 5LMNO 1KSPA 4RZRA 1KFDA 2ATLA 3FAVA 3ZX6A 2HW3A 1S0OA 1Q8IA 3OMAB 4YXMA 5EWGA 2LPEA 2EINC 5G5GA 2HEPA 1RM6C 2BZFA 1K3EA 3BDPA 5H9CA 3NVYA 3K4GA 4JUZA 1OZ0A 4DWIA 1XNRO 5B1BC 2KOBA 1Q8KA 5KA5A 2BPCA 5B1AB 2NN4A 4UAVA 2GH1A 4I7ZB 4UCTA 1N33O 2LYHA 1DF4A 3IFXA 1ZQRA 4DV5B 4G28B 2GTAA 5J0QA 5FLXN 2E8PA 2HHTA 1VQNV 2NRXA 4ICAA 3ABKB 2HLDG 3DC6A 1ZOLA 1ZQGA 5L1KA 2OH2A 5IYDO 1FJGB 3QU4A 3RVYA 4U3JA 1MN8A 3PX4A 2GSMB 4UASA 2QWNB 8ICWA 2MAXA 4JI2O 1S10A 4JPRA 1IURA 3K0GA 2D6FC 4LF9O 3IRUA 2P4VA 3VCBA 4M9NA 1NJWA 5JVDB 4PGXA 3RH4A 5IJ0A 3T1YO 4OPAA 4NB5A 2ZM6O 1G1XB 4J9RA 1MABG 1AP6A 3ZS8C 5J2UA 2FMPA 4ZOLB 4EKWA 1RPOA 3F2BA 2XTAA 1ZQNA 3BAAA 4EELA 2C2RA 4LP8A 4F6RA 3T2MA 1VQ8V 2D2CB 5DBBA 1NJYA 1JXLA 1JX9A 2CUGA 5JJEB 3RFAA 5GTHU 2DFLA 4NTWA 2FL4A 4F3OA 1YHQV 4KLEA 3KFUF 1OCZC 4F6EA 4PHZA 1COOA 1AJPA 4OO1J 3BJYA 3ALRA 4MF2A 1QHTA 1R73A 3LNMB 3NXSA 4BW9A 3WU2Z 1RSOB 3ISDA 3KOOA 1YF2A 3QF7A 3ZRWA 3P30A 5H2FZ 3JAMN 3KHRA 2VA8A 3U26A 5DQGA 3CRMA 1ZSPA 1A0PA 2WLIA 1BHAA 5AHXA 1E1QG 3CC4V 4MW3A 4P0PA 3D6JA 3MABA 4WFEA 1LB2B 1H2KA 2RN9A 2IW5A 2QJ1A 2HCFA 3GWOA 1Z00A 5DN6G 3EXAA 2KVSA 2BR0A 1DOQA 1AJNA 1PD3A 4DV4B 8ICRA 3K3WA 3UQ0A 1BE3H 2EQYA 1GTOA 2BDPA 1ZQSA 2ITCC 4AYBF 4M6WB 1M9NA 2WLLB 3Q8KA 2JR5A 4XQ8A 5L1MA 4CRXA 1VF5B 5JUMA 2FDRA 1L3UA 4JWNA 5KG7A 3JASB 3CW2C 4BJQA 4MFAA 1W0KG 2E1EA 1DGSA 1U45A 1IXBA 1GN2A 4NLZA 5FNVA 3TETA 3CCRV 2OYQA 2XCPA 3E22B 2RHFA 1FXKB 2QWQB 4JI6O 4UATA 4X20A 2BKEA 2E5LB 2W6JG 3OR6C 3UMCA 5KAIU 2GV9A 3CRQA 5AKEA 4YR3A 4F2SA 1X2IA 5HP4A 2XHBA 5L1IA 4DSFA 1H38A 3RBZA 1KKXA 2LW7A 5J0XA 4QE9A 3PV8A 4C4RA 3OAAG 3CRAA 4B9VA 4CC5A 1Q7YW 5DDYA 1XQ8A 3OGIB 1RXVA 1D8BA 1KBHA 4CE6A 4BDPA 2IJHA 4GT1A 3H0MB 3U11A 3E83A 5LMNB 2DKZA 9ICKA 3K08A 4O2AB 4X1KB 4DQRA 3ETRA 3SV4A 4IQVA 2YIAA 4I55A 3KHLA 4J9SA 4DLEA 1HP8A 2JRZA 9ICUA 5JJJB 4F72A 3KKAA 1H2MA 1DTOA 3RYIB 3OMNB 3ORYA 4TQRA 4IR9A 2E74B 1N33B 4LF6O 1NVPD 2BE3A 4O4IA 4FFBA 4LH6A 4OXSA 2ASLA 1BGYH 3ABUA 4B3RO 2ODMA 1AP5A 2KV2A 4Q20A 4ECYA 3UXPA 5ALRA 1R3LC 5G5HA 5ALLA 4GXKA 1CXZB 4C8MA 3ZDAA 2ZUCA 1ZQXA 2Z3YA 1SQFA 2O6KA 4JI2B 2P6RA 5F3XB 1NKEA 5CMUA 3JALB 1SIJA 2ISPA 3ABLC 3ZIAG 4LF9B 2AJQA 4X65O 1AROP 2JS3A 4BAYA 4DO9A 2AU0A 1DF5A 3T1YB 4D6TH 2VA3A 3NR7A 2IHMA 5AI4A 2W9AA 3EWAA 4R7CA 5KL8B 2Z7JA 3K0DA 3ETDA 2VQFO 5KHJA 2Q4TA 4GKJO 2NO5A 9ICHA 3CE2A 3JAWB 1EFRG 1CPYA 3I55V 5DECA 5D46A 2ZKOA 2XUMA 4JV0A 2CXYA 4NXNB 3MFHA 5EC2C 3HKBA 1UHUA 4JI3O 5LXTA 2OTLV 2BOCC 4JAVA 2KTQA 3RTVA 3BQ7A 1XO0A 2EANA 1GRJA 5L9XA 2FLLA 4KN7A 5LA6B 3UQ8A 1Q43A 3H1IH 3SR6A 1P84F 5KMGA 4UB4A 4O5KA 3A0HU 1I5XA 2ZXHA 4P4OA 1KFSA 2QA4V 5KX5A 4GCZA 3GZFA 2RRDA 4J9OA 1IG6A 4Q6GA 4R8UA 4OJLA 2Y1IA 3QX7A 5KG0A 4LFBO 4C80A 1AILA 2CN1A 5B1OA 3F5EA 3BZKA 1HEKA 4B9NA 1R6TA 3QNMA 3DC5A 1Z1VA 1BGXT 1X9XA 3AM9A 1M57C 1QH9A 1WB8A 3JPRA 4EYIB 1BPXA 2EAOA 2QARB 2W04A 3IM1A 1PKXA 1UFIA 4H33A 2HMXA 5LOVB 3AEIA 4PI0A 1UJWB 3N2GA 3RJJA 5EZYB 2CTWA 5L3CA 4Q45A 1X6JA 2H94A 2Y69B 2YXLA 4YD2A 4O4JB 1Q5OA 3BFRA 3OSNA 1VQKV 5EBMC 5DQIA 2YS8A 8ICHA 4JYAO 1WA8B 5AM1A 1SL2A 2FMQA 5B1AC 1BPDA 2YB4A 3JPSA 4GZRB 3CXCU 5KFLA 9ICWA 1NTMH 1XUQA 2ZIXA 5LGTA 1S76D 2F1MA 4C4TA 1K73W 1WJZA 3WK7A 1YZBA 4RQ4A 9ICFA 2P6UA 3ABKC 1EM1A 1ZQ1C 2HHUA 4MVMA 2EZPA 4PV1B 3ETGA 1QBZA 3PY8A 2DJVA 4OJOA 1PM9A 3JATA 4UVCA 2HVJC 3WB1A 2JEXA 1FYJA 2LM1A 3TAQA 4ZOHC 2R18A 5F2VO 3CXHF 4YG2A 4F5OA 1X66A 2DF4B 1Y66A 4UB6Z 4P9PA 4LF6B 4XA5A 4RQNA 4AQYO 3M9OB 2MRLA 2PFOA 9ICBA 4P4PA 2EIJB 3K75D 3CHXA 5LP6A 4WJ3B 3N28A 3QU2A 4QNHB 7ICUA 4YJ2A 3C23A 4B3RB 4O3SA 3OFNG 4NV0A 4KLHA 1F4MA 3CX5F 2OXOA 3OJSA 2JIZG 1N0JA 3JPNA 1AR5A 4PPXA 2YMMA 4M0AA 1URFA 1Z5VA 2QKSA 1URJA 4LC1A 2OCCC 4UB8Z 3TADA 2MUTA 2FE9A 3B09A 4AP9A 4F5QA 3DV9A 1Q82W 4IL6Z 1T94A 1BNOA 5CA1A 3FB7C 4X65B 2VQEO 4O0IA 1AI7A 2ZG6A 3E8HA 1IBLO 5IJ9B 2M6YA 4XBFA 1EN5A 4D7TA 5D4BA 4PZOA 1ZQPA 2UXXA 1ZWIC 2VQFB 1SV0C 1K34A 3IG8A 2JEIA 3JPOA 4EEKA 2JVDA 4HBNA 4GKJB 4GC6A 4UW9A 3EYZA 8ICAA 5B66Z 3BS5A 3GIKA 5F9LA 8ICQA 4TUYA 4JI8B 3RRHA 2KJ5A 3WKEA 2R9IA 4JI3B 2QSAA 2E1FA 2P90A 5A9GA 1HNZO 2V4RA 3RVZA 3CCEV 4JAAA 4DF8A 3WB0A 2KP7A 1YJNV 3D8CA 1YTFB 2ZJ5A 1QQ5A 2EJ7A 5TZVA 5HFLA 4GFJA 4YFKA 1MA1A 4DR1O 1JRPA 5AM0A 2Y48A 5HFMA 1T3NA 1ZQJA 4KLJA 4JI4O 4BXOB 5JQGA 4O3MA 1WP8A 2P6JA 4JYBA 2A06H 1MZFA 3FC4A 4UB1A 4LF4O 1K1SA 5AI5A 1FXKC 3OUFA 3SAHA 3SPJA 1H2LA 3BQ0A 2L35A 1X6IA 2F93B 2BCCH 1JPXA 2M9NA 1BVSA 1EZVH 5KAFU 4I2AA 1TUBB 2AQ0A 4LFBB 4DSKA 4AYBC 4DQPA 3SQIA 5HHHA 3ZMTA 4LR3A 3M9NB 4MF8A 1U9LA 2GWSA 1SZHA 5EE9A 5DB6A 3LDDA 5JH7B 1QTMA 1QR8A 4C8OA 1TK5A 2F23A 4QZIA 2Q7HA 4DK0A 4F4LA 4DR2O 1VQ9V 3QUQA 5KTQA 5CP2A 2G38A 2A19A 1JCHA 3WKBA 4FK5C 3HPOA 4KLQA 3E8FA 3HKCA 5KG5A 4R50A 3GFKB 4QWBA 4X62O 2Q69A 4JYAB 3B0XA 1VQ4V 5IWAB 4B9LA 4ECVA 3WK8A 3D2SA 9ICVA 1VQLV 4Z1VA 5KFWA 1JX4A 2IOFA 1H8EG 3UT5A 3MGIA 4C7ZA 4PD4F 3OUSA 4PHAA 4NL9A 4KLSA 3ZN0A 2E8NA 5HMMA 3IHQB 2JEGA 1HW7A 2F66C 4PJ0U 2QKAA 5J9PC 2NRVA 2XAHA 1GMGA 1XC9A 1VDVA 1NJXA 2KZZA 8ICXA 4WCEV 3JAKB 4TOIA 5ALKA 4ECTA 5AK4A 2P7TC 2WWWA 1JR9A 1V54B 2Y0PA 5JJNB 3H8JA 5AM4A 3OE7G 4MSWC 1LR1A 1JA8A 3LSUA 1M56B 4AQYB 1AI6A 2R70A 2WPDG 4B3TO 3ZHSA 2VJ4A 3CNHA 5J0WA 4JTDB 2GDSA 1YJ9V 1XHZA 3ETEA 2JXJA 2ZIWA 3IC7A 4GYCB 4P9OA 1XHXA 1OUQA 3J81N 3ZEDA 4F5PA 4K8ZA 4QWDA 3JARA 1KFTA 2WA3A 4QNLA 1BHBA 2GOLA 2HHQA 4QZBA 1T7PA 1GM9A 3RW0A 4ABMA 4YIPA 4G3IA 2VQEB 2WLHA 1SXDA 3V7JA 3HJEA 4ECSA 5LGUA 1J97A 2UVRA 2EZZA 4FZ1A 2HOIA 2DQ0A 3BS7A 2CAZC 4DV2O 3OEEG 5AICA 2JZBB 5H6QA 4J9PA 3M7MX 1KW4A 4JV2A 4J7JA 4CH6A 3K58A 1NKCA 2DWDC 4FMTA 4X9QA 4KLOA 3QO5A 2MU2A 3N7PD 4ZBMA 3G6XA 1ZD3A 3KCXA 4YMMA 4RQ8A 1VIBA 5LYJB 4NLCA 2G5IB 1XEQA 1HIWA 3C2KA 2W9CA 4MVRA 3SDLA 1HNZB 2KG7B 4BIOA 2W8KA 9ICLA 4JK1A 1OCRB 4YJ3B 3ML0A 1SA0A 4DR1B 4QPKA 4PGQA 1ZQMA 3C3TA 1HUOA 4JI4B 3ONNA 4NY8A 2XVTA 4PELA 3N2KB 4WFBV 4LF4B 3B4SA 1TGOA 3WKDA 2QB0A 1Q6HA 4UB8U 4FBUA 2JGUA 3FYEB 7ICNA 4JI5O 5AM2A 2Y69C 2EULA 1SETA 3KBBA 2E3CA 1Z4NA 2H8PC 3F53A 1RYRA 4I0XA 5L3FA 5KG1A 1Q81W 3S6JA 5GTHZ 1VF6A 3FX7A 5DQHA 1NJIW 1F44A 2G06A 2ZIOA 2EZYA 4TUPA 4DW0A 1OCOC 2RCVA 2A79B 1L8DA 1JVMA 1NZ6A 4J41A 4EEQA 2JH1A 2AHYA 5KT2A 4F4ZA 4TQSA 3M9MB 5BMVB 1K4DC 4PI2A 2HI0A 4NM2A 4KFMA 3O0FA 5ALEA 2JHDA 4PHPA 3GVMA 3OR7C 1TV9A 4HYOA 5IYBO 1X4TA 4DR2B 4JV5O 3X2QC 3L9DA 1SQGA 4CH5A 2ZNIA 1ZQUA 3NRZA 1SKVA 2ZIVA 1SKWA 8ICBA 4I2FA 4DK1A 1L3TA 1B22A 2NRWA 2LGWA 4X62B 3OHAA 1TAMA 1U47A 8ICIA 1KU9A 3IN5A 4CS2A 5DGAA 3ASNC 2AW9A 4DR4O 2KSOA 2EIJC 2PMZF 2KKVA 4DRXA 2JRIA 3TXSA 3NUQA 5JRTA 5J2DA 4RPZA 3G4SV 2V4DA 1GM8A 5EC1C 1XDCA 1H8HG 2JGDA 1ENVA 4O3RA 3B77A 4IHJA 3FM9A 3HX0A 2AGAA 1L3SA 3TFSA 2Z0AA 1B06A 2LM4A 9ICRA 4C8NA 3H1LH 2Z5UA 4XRHA 1WYGA 1DXSA 2R8KA 5KAIZ 3SENA 2PF4E 4TV9A 4JV1A 2IBZH 4UCVA 4B3TB 5AKXA 1J5EO 1O08A 5BR8O 4CGZA 1S3JA 3MFIA 5GONB 5CA0B 4DV1O 5A2QN 1BPBA 1NVPB 3V7KA 5AKKA 4MFCA 1NK0A 9ICAA 5DEDA 2P06A 4O3PA 1FFTB 1WLEA 4YP3A 1UT5A 1JQ0A 1U96A 1YXBA 5DG7A 1QLNA 4DR6O 1NK8A 4NXZA 5JCOC 1Y4MA 3STLC 2DL0A 2C28A 2YIBA 2QM7A 3ZHTA 7ICRA 4Z6DA 4CH3A 3AN1A 1FXHA 4GXIA 4DV2B 4I29A 8ICFA 4OJ5A 3CCMV 3ZRVA 1IM4A 5CWRA 3SMVA 2BTOA 1S5LU 1ZLZA 1ZQQA 1Y74B 3K04A 2VKQA 1VQ6V 1X9MA 4TT3G 4QWAA 1N63A 2F1HA 2ADQB 1TAUA 4CH4A 1KTQA 2KEYA 3PO4A 4C8LA 4YR0A 3F5TA 4UUJC 1MMMA 4NKGB 3CJHB 3ZCCA 1Q46A 2VWKA 3W7SA 2OHFA 1NK6A 2V1DA 4X1YB 5EYPB 1AR4A 1L7MA 1S0NA 4DUYO 2WSSG 4ACOA 1JFFA 3OTFA 8ICCA 2ZIUA 4OJPA 3RJEA 2P5OA 1FFUA 1L1FA 3ICXA 3ZMZA 5C8YA 5KNIA 4JI5B 2PFQA 2G0AA 3TI0A 2I5HA 8ICOA 4I2CA 3CP1A 5ALYA 3FB8C 4YHHO 4U3FH 3GIJA 2EH9A 3JD4A 2E76B 1CI4A 4C0ZA 9ICXA 2E3TA 3K59A 1ZL8A 1IV8A 5EE3A 8ICPA 5J2GA 1E1RG 1EXNA 1FAFA 1L7NA 4J11A 2MK3A 4DR3O 4G27B 2ZNJA 4JV5B 3E8BA 1TVAA 4X88A 2FPLA 3PMNA 1X40A 4NLGA 3A0HZ 4J7KA 5LHHA 2Q67A 4ECQA 5BXZA 1N60A 1PP9H 1QNMA 1NK7A 3WB2A 2W43A 2DN9A 1JUDA 2AXTU 3VQVA 4OX9O 4Y2SA 5L3EA 4EZ9A 5KFOA 1M56C 1SQBH 3RYCA 3I56V 4DR4B 1YJWV 2XI9A 5TISU 2E5SA 1KP3A 5KFCA 3OEHG 5KFBA 3AK1A 1L7PA 4QZHA 3OW2U 1LKYB 2R8IA 3CRCA 1QR9A 3JCZA 5D5QA 5IIMA 4MFFA 2XASA 2IH3C 3QO7A 2AZ0A 4QIWF 2RDJA 4ED0A 3C90A 1R6NA 1VQMV 4ED8A 1J95A 1XOUA 2WAMA 4GX5A 3ZN1A 3SPHA 4HNAA 7ICLA 1BSMA 3F2DA 4TV8A 5BPCA 3GV7B 3AU2A 5IINA 4DW1A 4YD1A 1Z5WA 2ETNA 5IYZA 3BA8A 3CCJV 4MEYA 2NYVA 1WNSA 4JTCB 4DV7O 4FM0A 1J5EB 3KCYA 5BR8B 2CE4A 1RG6A 5E1AC 4DV1B 3QEBZ 2CH7A 4RQ1A 2C2AA 2W55A 4DSIA 2BSKA 4B08A 3UXNA 3BVOA 4DR6B 3AL0B 5KUKA 4IIJB 2FYUH 4GUNA 1XREA 2OCHA 3BQTA 1ZAUA 4QW8A 5EWEA 4I4TA 4LH7A 4TSFG 1YZ7A 3OTQA 1PK1B 2OEHA 4US9A 1OCRC 4P0QB 2ZXWB 3K79A 2CPRA 3AQFA 5DGBA 2BPGA 2W11A 4QZCA 5BZBA 3CCSV 2JEUA 2HOFA 1RM1B 3V6HA 1AR1B 2A3VA 4XDKA 1RP3B 3SJQC 2YB1A 4NTYA 4DR5O 5H6RA 1S8OA 3ABMB 2FLNA 1MC8A 1HWYA 2LFRA 1UPGA 3MGVA 1COWG 2B21A 3JD2A 9ICPA 3APQA 5CHGA 1M5IA 3Q4HA 4B9TA 4M2YA 2ZDIC 2XGPA 2EIMC 3TK1A 3WKAA 3JPPA 4UCUA 2ES6A 4UAUA 4YXJA 4ASUG 2QM4A 5FPRA 3OMIB 4DV6O 1IX9A 1TVKB 2FTKA 4O4HB 1D2DA 1UA1A 3AG3B 1GAXA 2WF9A 1RQLA 2HHXA 1Q3UA 4DS4A 4A5UB 3FKSG 4DUYB 4J03A 8ICGA 3TACB 2H3IA 1IBKO 4UV8A 3PSIA 7ICVA 2KMDA 1KQQA 3ABTA 5AK6A 1S77D 2OTJV 3RGBA 2ZUBA 3QUTA 2FJ6A 1SS3A 3T1HO 2DYRB 1U49A 3NGDA 2HHVA 1XSPA 1SKRA 3CWBH 4O2BA 2WLMA 3C1YA 5KT4A 4RWUA 2GUZA 2AH5A 4J9KA 5CB4B 5ALFA 4YHHB 4KLFA 5J2JA 2EJRA 3K1RB 2GBOA 1F7YA 3CRXA 3AEVA 4O3OA 4DS5A 5L1LA 2KSDA 3D36C 3FD9A 1XNRB 2B1GA 2BQ3A 5J2BA 4RPYA 2X7RB 3TJTA 1CEZA 2EAPA 3QU9A 2A1JA 2K4HA 1PVQA 1M93A 4WF9V 1AI5A 4DR3B 4IC9A 1Z2GA 9ICIA 3T1CA 2UXBO 5AI9A 3HKEB 3IP4B 3A0BU 1US6A 1WN7A 4ECRA 3ZHQA 2VANA 4NLKA 2N05A 1YEWA 1V55B 5EBWC 3BQ2A 1XL4A 3CC7V 4OX9B 4LBEC 2YC0A 4IQWA 1BS3A 1NJZA 4QZEA 2OYYA 3CC2V 1ZJNA 5EWFA 1NK5A 2BTQA 4P2HA 2PMZC 3QE9Y 3DXRB 5KAFZ 2LW1A 2LP7A 5KFEA 2EILB 2JMGA 2ZM6B 4UCOA 4QZDA 3M99B 4DEZA 3ISCA 3R9KA 1S9FA 2ZTDA 3MR5A 5KG4A 4NTXA 4W4KA 1CRXA 2PZSA 1TFRA 1Z3EB 4LZGA 4FPPA 4FLYA 1JIHA 2YY6A 1GN4A 1THZA 3RF9A 2WTFA 4PDRA 3PN1A 4C8KA 1FFXA 1SRYA 3NS1A 4JZGA 4DV7B 4UAYA 3ZJZA 4RQ7A 3PSTA 1K5OA 1XL6A 2PI4A 4DOAA 2RDCA 1KQSU 2FKXA 4PA9A 4F4YA 1T5EA 4GC7A 4O4LB 3ZRXA 2ZE6A 3PX0A 2CGNA 2EDUA 3H8SA 4Y2TA 1N0NA 4Y2QA 2QE7G 2ZIMA 4MVOA 1TK0A 4OCZA 3MR2A 5L3DA 1TK8A 4PJ0Z 3N97B 1BCCH 2ESEA 4M04A 5KFTA 4OGQB 2HKOA 2KFZA 1I0HA 3H4BA 3RT3C 2OIEA 2KN7A 1GK9A 3ZI4A 3M8SA 5KFNA 1PPJH 3RYHA 5ALZA 3ETLA 2W9MA 4USAA 3A2FA 3W7XA 2HHHO 1L5UA 1F4NA 2RJZA 4UARA 1FXVA 3MDSA 3TXQA 3Q8RB 5B3SB 5LL6Y 4DR5B 4JI7O 4JI1O 1L8LA 4X5VA 3H9VA 1NI3A 1BT8A 4ZHQA 4P30A 5IY5B 3RJGA 5ITZB 4JI6B 1MQ2A 5FPOA 2Y4UA 1X9SA 3ZHRA 2HBMA 4G2KA 4FM2A 3U0ZA 3FAVB 3I1YA 2HSZA 5LHIA 4FZ0A 4DV6B 3AG2B 4I50A 1QVFU 3Q8PB 4ED3A 3F7VC 4DSEA 5ALWA 1OCCB 1FKAO 1VARA 3ZHUA 3C2LA 1FS0G 2A3QA 2NRZA 1NR7A 2KKPA 2AHZA 3RRGA 2BQRA 3HT3A 3IAYA 2XAJA 3UKMA 1Q6UA 3C5FA 1IBKB 1Q6IA 5DM6V 3B40A 2WF7A 5ALUA 2IM9A 1Q86W 2Q73A 3T1HB 2JGAA 4RUEA 4RQ2A 1OXJA 1P7BA 2I9GA 5EK0A 5L3GA 2JV3A 4KTQA 1OW5A 4Y2VA 2OM6A 3P32A 5KFGA 2K89A 4EBEA 2XIDA 3G67A 2IHNA 3PNCA 1VP7A 4U3JB 1SWVA 2EZXA 2H3QA 4O3NA 1AI4A 5ALXA 1JJOA 4X8AA 1N8RW 4YVZA 1EZJA 5J2TA 2R72A 2X0LA 2XCAA 4UB3A 4BX9C 5GW7A 5KFUA 3N4MB 1Y88A 2WHEA 3UCSC 2E8OA 3MHHC 1QSYA 5IJ0B 1ZETA 2UXBB 3LDAA 1BQ0A 2WB1F 2DYSB 4LWSA 1PL4A 5J2UB 5IT9N 1F51A 1SERA 1D9FA 1NS1A 1SXEA 4RU9A 1ZRMA 2D3DA 2L6LA 4F6RB 3EUB2 3TAPA 1B4FA 3D36A 2YEVA 5CBGA 2RP5A 3LWLA 5AM3A 2JEJA 3JD1A 1D9DA 4PDMA 4WBNA 2DOSA 5JTIA 3DGEA 1K4CC 2UUBO 1YDXA 2W0XA 1ZQLA 1N36O 2ZQMA 4LJXA 1BPYA 1Q3VA 1JN3A 3JPTA 3ZRWB 4B3MO 3B0YA 4MW8A 4QIWC 3PR5B 4NR1A 3E58A 4RQMA 2Y9TA 2W0FC 1YVWA 1B43A 2XC9A 2C2EA 2WLIB 4K0KO 4LNUA 2H5XA 4P0PB 2KZ3A 5KT7A 1YI2V 1PK3A 4I2HA 1KYOF 2ZXWC 5KFVA 5IIOA 4MTFA 2QKQA 4CF4A 1Z00B 3BY6A 2X6CA 1MSWD 1SB3C 1WCNA 1ZQVA 1WPBA 2W9BA 3LUTB 1RM1C 5BOLA 4X1IA 2F8LA 3H01A 4F93B 2CGOA 1EN6A 3ABMC 4J9NA 4UVBA 4Y2PA 4JYCA 4EENA 3HKDB 3BABA 4RNOA 4JYYA 1FD9A 2A7WA 3L70H 4BIZA 5AIBA 3J7AU 1XSNA 4XUSA 2RLTA 1COKA 2P67A 5HR7A 4X20B 4EEYA 2AHOB 4EFBA 3AK3A 2ZINA 4MVQA 1JJ2U 3H4DA 1ZQTA 2JJ2G 2P22C 1S0VA 2CRXA 4RUFA 4B7KA 2ZE7A 1NI8A 4LFCO 3AG3C 2HHHB 3G71V 4KLMA 3RYFA 1YZ6A 4MTOA 1NTZH 3SYOA 3OGUA 3GDXA 4JI1B 3RB3A 4JI7B 3K5MA 4GXJA 4UV9A 2YI9A 1GH6A 4FLXA 1Z19A 2DWQA 2BHNA 3N7RC 4EYHB 2DYRC 3SZ2A 2BCSA 2M7WA 1G8MA 3SYQA 1A77A 5IIIA 1XNSA 5EOZA 4KLDA 3SD7A 3IG5A 1WPXA 3T3FA 4L87A 5AK5A 2ADPA 3ZMSA 4I55B 3WK5A 4ZI7A 3MBYA 4B7EA 4KLLA 4B9UA 3BCCH 1PZNA 2HVHA 1Y76A 4I9QA 4F2RA 2J6UA 1QLEB 5DKWA 2PTMA 2XICA 3KKYA 1YITV 5KFSA 4TWKA 5J0OA 3GV8B 4RNMA 3AG4B 2GO7A 3C28A 4FFBB 3ASOB 4O4IB 4NM1A 5IIKA 2BQUA 1VQPV 1S5LZ 4RO2A 1D8YA 3IC9A 1KRPA 3QVNA 4ED7A 3PVXA 2DWEC 5DB9A 8ICLA 4RQ0A 2YIBD 1Z4OA 4BGDA 2UUAO 3BA9A 5J2FA 4NXMO 1ECWA 5J8YC 1EBOA 2B5UA 3AG1B 2ALZA 5CRXA 2EILC 3CYMA 4DV3O 2D8CA 4LF5O 1Y67A 3CS5A 1SL1A 3WG7B 1JXEA 1IVSA 2NO4A 1K9MW 1N56A 5DBCA 7ICQA 4KUMA 4MTGA 1MNGA 2XAGA 4X64O 3IDWA 4GLXA 2DQ3A 5CEHA 2YMPA 1RXWA 3SPIA 3EZ5A 4E4EA 4TUQA 1QCEA 2BCVA 8ICTA 2CDYA 3HPLC 3C3SA 2E75B 2YN4A 3HKBB 5LXTB 1VJ5A 5KFQA 5JVDA 3V72A 4ED2A 2A1AA 5KG6A 2QWRB 5IYCO 1N36B 1IBLB 5GTIU 2UUBB 2DPIA 5J0UA 8ICUA 2OWOA 3ZD8A 4F5NA 2K60A 4DL6A 2EBOA 3SJCC 4W4LA 1VQOV 5CR0A 4ZOLA 1AB3A 1NTKH 5KMGB 4DR7O 1BPEA 3MHSC 2PYJA 5K1PA 1ZD2P 3NTUA 1F23A 3RH6A 4FM1A 1SL0A 4RQ6A 5J0RA 5KX5B 3K9AA 7ICKA 3O65A 4K0KB 4RAIA 2UVUA 5ALOA 4R8UB 3W7TA 2M0NA 1LV5A 4JMUA 2LHTA 4Y2XA 1OCZB 4FO6A 3E35A 4J10A 1RSOA 4GX0A 1T3QA 1ZD4A 2DQNB 5J2IA 2AXTZ 4FLZA 4MVSA 4LZDA 2Y4TA 1SV0A 2W7PA 5TISZ 1K1QA 3OT7A 1E79G 1TA8A 5KUMA 5IY5C 1RQNA 4AHCA 3K5OA 1XI1A 2W3SA 1V97A 4Z2WA 2ITDC 4EX6A 1SZPA 5B5EU 1HNWO 3N2GB 3VQWA 5EIBD 5DB7A 4LFCB 4DL5A 7ICGA 4BR6A 3P3PA 1Q3EA 4M6WA 4J42A 4LVSA 2WLLA 1N32O 2ZR2A 2QDOA 3KZIU 5H5NA 4QJFB 5KFPA 4FS2A 4CF5A 1A6SA 3FYIB 3JASA 5EBLC 3QO8A 4UBBA 1L3VA 3STZC 5CN0A 4UB2A 2ZIXB 2C2DA 4HAMA 3RWRD 2KJ8A 4Y2JA 3SAGA 3GILA 3E22A 4K8XA 1FXKA 3QU5A 2LFSA 1OV9A 2N74A 1Z1BA 5CA7A 3C21A 4YR2A 1NNLA 1N5XA 4PA6A 2VWJA 4UCRA 2J6SA 3JATB 1DK3A 4FLUA 2KZMA 1NZPA 4XDLA 1JI7A 1ZQDA 1R3JC 3WKCA 1QQ6A 2HBLA 4GX1A 2G07A 3PMLA 3GB7C 2G5HB 1RDFA 4ECXA 4O5CA 1ZQIA 5LP6B 2HBKA 1K92A 1J2NA 4QZGA 1OJHA 2D3OW 1WCLA 2DYSC 4O2AA 2KVCA 2RQ5A 2IOHA 4X1KA 4YJ2B 4GKKO 1X9WA 2YMQA 1ZJMA 2ZJAA 5KT3A 2EAMA 5D5PA 1U97A 4JTAB 2F76X 1PNMA 5E79U 3SEIA 5CB1A 1IIPA 2IH1C 2V4QA 3QG5A 3BHPA 3TKAA 2F8KA 3F5AA 2UUAB 3RYIA 3T5JA 2PFNA 2MUTB 2ISOA 4NXMB 1XMQO 4RT3A 1ORQC 5CA1B 4DV3B 3JD3A 4BWJA 4KLIA 4DCCA 3PW7A 4LF5B 1NQTA 1QVGU 1IDSA 3JSNA 4BWAA 2WB1C 2JK5C 2LYAA 4X64B 4CBCA 3VQYA 9ICEA 1ZQFA 1SF9A 3Q8LA 4MVZA 3P3NA 7ICJA 4R66A 3LYSA 1KBUA 3BS5B 4TUYB 1SZTA 4TQDA 3JALA 1LVHA 3K03A 1L6NA 4B9SA 1A32A 1N48A 3LDEA 3HKZF 2X6AA 5HHIA 3RJIA 3SI8A 1R3KC 3TQ1A 2QR4A 1NK4A 2DW4A 3W7WA 3F7YC 3EVKA 1WB7A 2CK3G 2V9WA 3RJHA 3MGHA 3E8GA 2EX3A 1KN5A 3T79A 3QUCA 3OTOO 4DQIA 4RQEA 4CDGA 4DR7B 2W54A 2AZ2A 5JQGB 2Y0SF 1VMGA 3JAWA 1B3QA 4RUAA 3OHBA 2G08A 4Q44A 9ICCA 4DV0O 4H44B 2PY5A 3CCVV 3A0BZ 1D5AA 4H37A 3GU3A 2I1QA 3H8MA 4JB3A 2HDOA 5KFRA 1R6KA 4DXWA 3CP8A 2YSUB 5CBHA 1SQQH 4QE7A 5KT6A 4IGGA 1O9HA 3SYAA 4ECWA 3T5KA 2HR3A 5LA6A 3H7IA 4J7ZA 1V85A 4BIUA 2V7QG 2X6BA 3KTQA 4RQFA 2ARHA 3OGCC 2JJ1G 4O9MA 4MT8A 1IXMA 2QTOA 3A0RA 4Q43A 1IXRA 5HR6A 4G9BA 3APOA 4ELTA 1H2SB 1AJQA 2IMWP 4FZMA 1KMIZ 4TQFA 3ZBHA 3MDAA 1HNWB 2KICA 1MZEA 2XAFA 1X42A 1VLBA 1FO4A 4R64A 5IILA 3TARA 3A8TA 4QGPA 5F9NA 1K5QA 5KFDA 3HKCB 5ALNA 3UPQA 1N32B 3KKAC 5ALGA 1UPHA 2Y1JA 1XNQO 3EW9A 2ZJ8A 4M9LA 1I08A 3G6BA 3LDCA 5B1NA 5JU5A 4ELVA 2JS5A 2QARA 3UT5B 3ZDEA 3AG4C 4RQ5A 4IQUA 5LOVA 1W2BU 3PW5A 4EB6B 1ZD5A 4ED6A 4DQSA 3F5WC 1SESA 5EZYA 3UMGA 3LVWA 3THOA 1NOMA 4IRKA 1GKFA 1HR0O 1UA0A 2K4EA 4ZH4A 4FFDA 4IYIA 4UXNA 3CCLV 1FEZA 1BNPA 4PHEA 4O4JA 5FP0A 4Z6EA 3FB5C 1V54C 1HNXO 2F44A 1WA8A 2JEFA 2MW2B 4E2LA 3RBEA 2ILMA 4IRCA 3AG1C 1SGGA 4KL1A 1KB9F 3L71H 2P35A 3ZMVA 3WG7C 2FPMA 5ALSA 3CMAV 4GKKB 3CYOA 4BWMA 4HZ3A 2NV3A 3O9OA 4JASA 3U10A 2OCEA 1T4GA 3Q8MA 2OIGA 2QB1A 4I2GA 4FLWA 2ZIWB 3HRDD 3M8AA 4JAUA 3PSPA 3RH5A 3CRRA 4QPJA 4C7UA 3JARB 4LF8O 1IZ3A 2DE0X 1F0MA 1XMQB 2B1IA 1D5NA 3RB6A 2OT5A 5J0YA 2ZT9B 3RB4A 3L74H 4KLGA 3SJAC 1YIJV 1FIQA 5AKLA 3G6EV 2Q5ZA 4P4MA 4M9JA 1VEWA 1XO1A 1NH2D 2UU9O 1PVRA 2IU0A 4YCXA 4RNNA 2LYBA 4UB5A 4HYKA 5J29A 8ICNA 2WF5A 4Z6CA 3DSQA 2H3OA 2LJ2A 2OCCB 5KHKA 5AG2A 3Q8SB 4NXNO 2W9CB 5DDMA 5EE0A 5J2CA 5IJ9A 2HFEC 3JYCA 3OTOB 1G4YB 1ZQYA 3FB6C 1SA0B 2UVVA 4PH5A 3WK6A 1MA7A 4I5SA 4IT5A 4FE3A 1YCIA 2RNBA 3UXOA 1GM7A 1YT3A 1WUDA 3E0FA 3PW0A 3PW4A 1HUZA 3HWTA 2YMLA 1NKBA 1N61A 4DV0B 2F95B 4UCSA 2IBKA 2QB0B 3NVWA 5KFMA 3RR8A 1K33A 4JF3A 3EPIA 5JCOA 3H0RB 3UMBA 1P49A 1RFYA 3CMEV 2IJKA 4F91B 3AQEA 4QWCA 3LK9A 4I0XB 1SZXA 2HVKC 3QZ7A 3D2QA 1KKCA 1N4CA 2BDUA 3QYPA 1ZQBA 1WG8A 3R65A 1VF7A 4YN4A 1V38A 3OPXA 2BPFA 4BXOA 4FVMA 5ALMA 3ZHVA 1AVMA 4X89A 5C0YA 3HKDA 5DG8A 4PL1A 1KLNA 2LO1A 5AKGA 4MTXA 2B0CA 1ZQOA 3SPCA 1Y6XA 3L3FX 3AU6A 3AK2A 1KECA 5J2KA 3RFRA 2UUCO 2KIWA 2B6GA 3CD6V 4I28A 1AQ6A 1H2GA 1TUBA 4ZKIA 1D8LA 3UO3A 2ZIVB 1FPOA 2WF6A 4F4XA 4EBCA 3C5GA 1ZXIA 1NKDA 1NT2B 5CA3A 2FMLA 4AILC 9ICMA 1KKDA 2Q8VA 2PKEA 2F1JA 4X66O 1HJPA 1G6UA 1XNQB 2KB1A 2BCQA 3RR7A 5JH7A 5LP6C 1ZQZA 2KSOB 4DRXB 1F5SA 3AMZA 3SV3A 3SYZA 3KG2A 2HHWA 3L5KA 3PO5A 2WLKA 4KXRA 1HR0B 1PVPA 1I5YA 2JGDB 7ICMA 3Q8QB 5DLFA 3MAQA 2K8CB 4IHJB 4H13B 1HNXB 3TADC 4YIOA 3RBDA 3MDCA 4Q8FA 2DKXA 3HP6A 3B8NA 2DPJA 1M6YA 3C1ZA 3N27A 4TV9B 2VIXA 1C20A 4J9LA 3PX6A 3H1JH 3IJ4A 1KUQA 4J9QA 3PZPA 4I2DA 2UXCO 4YY3O 2UXNA 2N1RA 4RT2A 3TGUH 3PJSK 1IBMO 1JMKC 4F71A 2W7OA 3ZDDA 3MR3A 3M6ZA 5LBQA 3JAKA 2HVIA 3QXGA 3ZRSA 2YIDA 4GIBA 1B6QA 4J9ZB 5AI0A 4LF8B 3NVZA 3SGIA 1K8AW 5KFKA 2HOQA 4TURA 5J0PA 4EBDA 1DLBA 1SQPH 1GN6A 2XY6A 2F2AB 2CTPA 4WFAV 2UU9B 4NWIA 3K9SA 2Q7EA 1WP7A 4Z1MG 2WLJA 1KC8W 1DK1A 4FBTA 2XNDG 4KHPO 3SPGA 3T4DA 2KG5A 1SWWA 2KJ9A 3I28A 4JI8O 3HKZC 2YXYA 1WWUA 2KFNA 2P4KA 2VS0A 3HR0A 2W3RA 9ICSA 5AIAA 1QU7A 5AKJA 2K8AA 2Q7GA 2UXDO 8ICZA 2PYLA 2K4PA 4QZ8A 4R65A 2KE7A 4EFEA 1RYUA 5K1XA 2KHQA 3EHBB 2GLEA 2JZBA 4QW9A 4KX3A 3S3WA 4CCHA 4I27A 1NK9A 2K1EA 1NU1H 3QUBA 2Y0SC 4Y2RA 4BUGA 1JROA 2QEXV 2C22A 3QZ8A 9ICQA 1LNQA 1LUVA 1JFFB 2ZIUB 5DB8A 5LYJA 5DLGA 5ALHA 4MVUA 4KMUA 3J81j 3K06A 3RN4A 3VOUA 5C8YB 2KG7A 2NR5A 3K5LA 3RJFA 3LVVA 5DG9A 2WFAA 3PR4A 2YDEA 2UVWA 3HB3B 4YJ3A 2R9RB 3I76A 4KN4A 1DRGA 1PL0A 2J6TA 2KD1A 2R8JA 3NRWA 1KD1W 4C4SA 1ZL8B 2QGNA 4FS1A 3N2KA 5GTIZ 2ASDA 1JALA 4QWEA 3QEAZ 5D49A 3K5NA 2LBOA 4NL9C 3CPWU 2DGZA 3C2MA 2ZDIA 2F3NA 2F43G 2WAQF 2UUCB 5J2AA 5ALVA 1J2MA
chains in the Genus database with same CATH topology
4CRXA 4YXWG 1ED1A 3WG7B 1Y4MA 1K9MW 3STLC 2Q6AA 4KUMA 4MTGA 4BJQA 2QM7A 2XAGA 3JD0A 2H3VA 2E1EA 1W0KG 2DQ3A 3TETA 3CCRV 2RHFA 1FXHA 1FXKB 1OCOB 3SPIA 2W6JG 3OR6C 1QCEA 1P4RA 4OJ5A 3CCMV 3HPLC 3ZRVA 3SMVA 5LGNA 1H38A 3RBZA 3K04A 2VKQA 4QE9A 3OAAG 5IYCO 1VQ6V 3N7SC 4TT3G 3X2QB 3IGAC 3EFFK 1Q7YW 2KEYA 2EBOA 1VQOV 1D8BA 4UUJC 2IJHA 2XOKG 4GT1A 3H0MB 3E83A 3MHSC 3ZCCA 1F23A 3W7SA 3K08A 2V1DA 3K9AA 3ASNB 2EIKB 5FL7G 4RAIA 3W7TA 2M0NA 2WSSG 5KA6A 4JMUA 2LHTA 4ACOA 1K5SA 2ZIUA 4OJPA 1OCZB 3DTUB 5C93A 4DO2A 3E35A 2ZD9A 1DTOA 1L1FA 3ICXA 3ZMZA 3OMNB 4GX0A 2DQNB 2G0AA 4MVSA 4U7CA 3CP1A 1NVPD 2W7PA 1E79G 3FB8C 4OXSA 3ABUA 3JD4A 4U7OA 5KUMA 5IY5C 1PNKA 3OM3B 4C0ZA 2KV2A 4Q20A 1R3LC 2K4IA 2EZOA 2ITDC 4U7NA 1E1RG 2Z3YA 3LSQA 4FJCC 2MK3A 2HJFC 4G27B 5CMUA 3ABLC 3ZIAG 3E8BA 4X88A 1AROP 2WLLA 2ZR2A 5LHHA 4BAYA 2Q67A 5L3BA 4QJFB 1DF5A 5LHGA 4PDVA 1A6SA 3FYIB 5EBLC 3QO8A 4R7CA 3STZC 5KL8B 5CN0A 2Z7JA 2JH7A 2ZIXB 3K0DA 3ETDA 4HAMA 2KJ8A 3SAGA 3CCUV 1FXKA 1GO3F 1S0VA 5L3EA 2Q4TA 1M56C 3I56V 2LFSA 1YJWV 2XI9A 1EFRG 1Z1BA 1NBMG 2E5SA 1CPYA 3I55V 3SAFA 2F77X 4PA6A 3SYCA 1KP3A 1S5HC 3B8MA 3OEHG 5EC2C 3OW2U 4XDLA 2OTLV 1QR9A 2BOCC 3JCZA 1R3JC 4JAVA 1KC8W 2HBLA 3PSFA 1XO0A 4GX1A 2G07A 2KNJA 2XASA 2IH3C 3GB7C 3QO7A 2G5HB 4QIWF 1R6NA 1VQMV 2PI5A 1J95A 2WAMA 4GX5A 3ZN1A 3SPHA 2HBKA 1K92A 4PDLA 3F2DA 2D3OW 1I5XA 2DYSC 2ZXHA 2KVCA 3K1ZA 2QA4V 4GCZA 3GZFA 4UVAA 3CCJV 4JTCB 2RRDA 4JTAB 5E1AC 2F76X 1PNMA 4OJLA 1NR1A 4PA7A 1IIPA 2C2AA 2IH1C 3F5AA 3F2CA 2CN1A 1ORQC 3AL0B 5B1OA 5KUKA 3F5EA 3JD3A 1HEKA 1NQTA 1V55C 2W6IG 2JDIG 1QVGU 1M57C 2WB1C 2EINB 2LYAA 2JK5C 4TSFG 4CBCA 2ZXWB 1KP2A 1OCRC 4P0QB 1R3IC 2W04A 1PKXA 3K79A 4H33A 2CPRA 2HMXA 3H0LB 3AQFA 4MVZA 3AEIA 5B1BB 5BZBA 1UJWB 4PA4A 2JEUA 3LYSA 2HOFA 1AR1B 3CCSV 2K8BB 1KBUA 2A3VA 1RM1B 3QNEA 1SZTA 5L3CA 4XDKA 2H94A 2Y69B 3SJQC 2YB1A 3K03A 1L6NA 3LDEA 5H6RA 3ABMB 2KHVA 3HKZF 2X6AA 1VQKV 1R3KC 1HWYA 2HG5C 2LFRA 3WFVA 5EBMC 3MGVA 1COWG 2DW4A 3W7WA 3JD2A 3F7YC 2GHYA 2CK3G 3E8GA 5B1AC 2ZDIC 2EIMC 2YB4A 3TK1A 3T79A 4PA3A 3LSSA 3CXCU 5LGTA 2ZIXA 4RQEA 4ASUG 4CDGA 1S76D 1K73W 3OMIB 3ABKC 2FTKA 2Y0SF 1ZQ1C 4MVMA 4FZNA 2EZPA 1OHHG 3ETGA 1QBZA 3AG3B 2G08A 1Q3UA 4R8CA 2Q68A 4OJOA 4UVCA 5IDJA 3CCVV 3FKSG 1ROPA 2HVJC 1W0JG 3GU3A 4H37A 2H3IA 4DXWA 4UV8A 5CBHA 3PSIA 1R6KA 3CP8A 2JEXA 2YSUB 3ABTA 1S77D 2OTJV 2R18A 4QE7A 2VJ5A 3TCUA 2WLLB 4JGSA 4U6PA 3SYAA 2DF4B 1Y66A 2DYRB 2HR3A 2NNUA 4P9PA 4BIUA 2MRLA 2V7QG 2WLMA 2X6BA 4RQFA 2EIJB 4OJ6A 4WJ3B 3OGCC 2ATKC 2EJRA 2JJ1G 4QNHB 3CRXA 1IXMA 2QTOA 4MT8A 3A0RA 3KZXA 4WFFA 5HR6A 3OFNG 4NV0A 1F4MA 2B1GA 2OXOA 1AJQA 2JIZG 4FZMA 2X7RB 1CEZA 4N21A 2QKSA 1PVQA 2K4HA 1URJA 2KICA 5B3SC 4LC1A 1AI5A 2OCCC 2XAFA 4NLBA 4WF9V 4IC9A 4XDJA 4LCUC 3T1CA 1NH2B 1Q82W 1T94A 1K5QA 3IP4B 3FB7C 3M7DA 1K7DA 2IJJA 1AI7A 2ZG6A 3E8HA 1UPHA 4XBFA 3LDCA 5B1NA 1V55B 5EBWC 1YIJV 2UXXA 4P0QA 1ZWIC 3AG2C 1K34A 1XL4A 3IG8A 2LKYA 2NLJC 2XAQA 3AG4C 4LBEC 3CC7V 1OCCC 1W2BU 2OYYA 2G09A 3CC2V 3F5WC 2PMZC 1SESA 3D2NA 3LVWA 1GKFA 4FIPC 2LP7A 2K4EA 2KJ5A 2EILB 2JMGA 2IJIA 4UXNA 3CCLV 2R9IA 2A0LA 2E1FA 2P90A 1V54C 3FB5C 3M99B 3RVZA 3CCEV 2H3FA 1YTFB 4PL2A 1YJNV 5CBFA 2A9HA 1CRXA 4E2LA 5HFLA 3AG1C 4FPPA 4GFJA 1THZA 2EIMB 3RF9A 2Y48A 5HFMA 3ZMVA 1CP9A 4PDRA 1TUEB 3WG7C 1SRYA 4O3MA 3CMAV 2P6JA 3CYOA 1NZBA 4HZ3A 4JYBA 2NV3A 4JASA 4R6ZA 1FXKC 3OUFA 3ZJZA 3PSTA 3SAHA 1XL6A 3W7UA 1M90W 3SPJA 2PI4A 2ZIWB 1KQSU 4P2ZA 4JAUA 4QPJA 3PSPA 4PA9A 4J9YB 1JPXA 3ZRXA 3D3IA 2B1IA 2OT5A 4AYBC 2WAQC 1MOFA 2QE7G 4MVOA 3SQIA 3ZMTA 4MS2A 5L3DA 3G6EV 2ZXIA 2HKOA 1NH2D 1PVRA 2IU0A 1SZHA 3SYPA 3LDDA 3BEHA 2YEVB 1GK9A 2QM8A 2LYBA 1JOYA 3ZMUA 1QR8A 4F4LA 1VQ9V 4Z1MG 3M6KA 3W7XA 5T14A 1VQ7V 2EIKC 1F4NA 1FXVA 5B3SB 2OCCB 1JCHA 4FK5C 4R50A 3E8FA 2Q69A 3DEEA 3E86A 5IY5B 1VQ4V 4P30A 2HFEC 3JYCA 3D2SA 1VQLV 3C29A 1G4YB 1H8EG 3VC8A 3FB6C 2HBMA 1MA7A 4G2KA 4I5SA 4FE3A 5LHIA 3OUSA 1QVFU 3AG2B 1GM7A 1YT3A 1YTFD 3F7VC 1WUDA 3E0FA 3ZN0A 1OCCB 4I9WA 3ABLB 1FS0G 5J9PC 2XAHA 1NR7A 2KKPA 2AHZA 1GMGA 2YX8A 4WCEV 1K33A 2XAJA 4JF3A 3UKMA 1VQ5V 2WWWA 4A8EA 3H0RB 1YSCA 2P7TC 5DM6V 3E89A 2ZR3A 3CMEV 2IJKA 1V54B 3E2EA 1Q86W 3AQEA 3OE7G 2HVKC 4MSWC 2JGAA 4RUEA 5EK0A 3D2QA 1P7BA 5L3GA 2BDUA 3R65A 1M56B 1AI6A 4RUFA 2OM6A 3OPXA 2WPDG 3P32A 2K89A 2VJ4A 1K97A 4JTDB 1YJ9V 4X89A 5C0YA 4BW5A 2XIDA 3MD0A 5KL1B 4PL1A 3ETEA 4X8AA 1N8RW 2H3QA 1AI4A 4KP4A 2W03A 4MTXA 1M1KW 1EZJA 2ZIWA 2X0LA 1PNLA 3IC7A 2BOBC 4P9OA 1OUQA 4BX9C 3SPCA 5GW7A 1S72V 3L3FX 1KECA 4QNLA 3T4ZA 1BL8A 2GOLA 2KIWA 4FZLA 3CD6V 1BHBA 4WFHA 1H2GA 4ZKIA 3MHHC 1GM9A 3RW0A 2ZIVB 2WB1F 2DYSB 2WLNA 5CA3A 4KMOB 1NKDA 5A0LA 2WLHA 1F51A 3UM7A 5LGUA 1SERA 1KKDA 2HBJA 2HOIA 2KB1A 4N23A 2DQ0A 2MA1A 3OEEG 2H3ZA 1P7DA 3D36A 5H6QA 4CZZA 2IU3A 2YEVA 5CBGA 2RP5A 1BMFG 2DWDC 3KG2A 4FMTA 3JD1A 4PDMA 1MG1A 4GX2A 3QO5A 3DGEA 3N7PD 4ZBMA 2WLKA 4KX5A 1PVPA 1I5YA 1QLEC 1K4CC 4NLCA 2G5IB 2K8CB 1HIWA 2ZQMA 4MVRA 1M57B 1Q3VA 3ZRWB 4WFGA 4MW8A 3VBBA 1OCRB 1RPRA 3ASOC 3B8NA 4QIWC 3ML0A 3CCQV 2W0FC 4QPKA 2VIXA 2WLIB 3OMAB 3ONNA 3PZPA 4P0PB 2EINC 1YI2V 2XVTA 2UXNA 2N1RA 2ZXWC 4PELA 3PJSK 1K3EA 4MTFA 3BY6A 5H9CA 4WFBV 2W7OA 2X6CA 1MSWD 1OZ0A 3M6ZA 5B1BC 2KOBA 3LUTB 1RM1C 3ZRSA 3FYEB 5KA5A 5B1AB 1B6QA 4J9ZB 2GH1A 3IFXA 1DF4A 2Y69C 2F8LA 1SETA 3H01A 4G28B 2H8PC 3F53A 4UVBA 3ABMC 5L3FA 1Q81W 1K8AW 4JYCA 2HOQA 1NJIW 1VQNV 3ABKB 4ICAA 1F44A 2G06A 2HLDG 1DLBA 1OCOC 4BIZA 2A79B 1JVMA 2F2AB 4WFAV 2OH2A 2JH1A 2AHYA 2P67A 5IYDO 5HR7A 3RVYA 4NWIA 2GSMB 1K4DC 4MVQA 1JJ2U 4JPRA 4KFMA 3O0FA 2JJ2G 2JHDA 2CRXA 2D6FC 2WLJA 3K0GA 3OR7C 2XNDG 3AG3C 4HYOA 3SPGA 5IYBO 3G71V 3T4DA 3VCBA 4MTOA 2KJ9A 3X2QC 3SYOA 3HKZC 2ZIVA 1MABG 1TAMA 4UV9A 2K8AA 3IN5A 4EKWA 1Z19A 1RPOA 3F2BA 3N7RC 2DYRC 4LP8A 2M7WA 1VQ8V 3T2MA 1G8MA 1JX9A 2KHQA 3ASNC 3EHBB 3SYQA 1XNSA 2EIJC 3RFAA 2PMZF 2KKVA 4KX3A 1YHQV 4L87A 3IG5A 1WPXA 2K1EA 3ZMSA 3NUQA 2Y0SC 4BUGA 3KFUF 1OCZC 3G4SV 2QEXV 1GM8A 1LNQA 5EC1C 1H8HG 2ZIUB 1AJPA 1ENVA 4OO1J 4MVUA 3ALRA 1R73A 3K06A 3B77A 3LNMB 3NXSA 1QLEB 3VOUA 5LBQA 2XICA 1YITV 4TWKA 3LVVA 3ZRWA 3P30A 3HB3B 2Z5UA 2R9RB 3AG4B 3C28A 1DRGA 3ASOB 1PL0A 2WLIA 1A0PA 2KD1A 1BHAA 1E1QG 3CC4V 1VQPV 4MW3A 4P0PA 4RO2A 4WFEA 3NRWA 1KD1W 4CGZA 1S3JA 2IW5A 2DWEC 3GWOA 5DN6G 1NVPB 1PD3A 1AJNA 3K3WA 2LBOA 3CPWU 2DGZA 1FFTB 1GTOA 1WLEA 2ZDIA 1ECWA 1JQ0A 1EBOA 2ITCC 4AYBF 2WAQF 1M9NA 5CRXA 2B5UA 2EILC 3CYMA 2F43G 3AG1B 1QLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8B A;  2HBM A;  3SAF A;  2KV2 A;  1YT3 A;  1WUD A;  2E1E A;  4NLC A;  2RHF A;  4O3M A;  2HBL A;  4CDG A;  4CGZ A;  3SAH A;  4QIW F;  4QJF B;  2HBK A;  2HBJ A;  2DGZ A;  2CPR A;  2E1F A;  2MA1 A;  4NLB A;  3SAG A;  4OO1 J;  3CYM A;  2RRD A;  1GO3 F;  5C0Y A; 
#chains in the Genus database with same CATH topology
 2F1I A;  5AK3 A;  1M4U A;  3CSX A;  1ED1 A;  4YXW G;  5KHG A;  3S3X A;  2K9P A;  5EE1 A;  2Q6A A;  2ZCE A;  2YQE A;  3WU2 U;  3JD0 A;  2H3V A;  1ZUQ A;  3K57 A;  4B6J A;  1XBL A;  4X66 B;  5IWA O;  1A76 A;  5H2F U;  1OCO B;  3RYC B;  1TAQ A;  5K4L A;  5IE9 A;  5BMV A;  1P4R A;  3GQC A;  2Y0I A;  1WWV A;  5ALP A;  2ASJ A;  5LGN A;  3B9J A;  5KFF A;  5ALT A;  8ICS A;  8ICM A;  3N7S C;  5AI8 A;  3X2Q B;  4K35 A;  3IGA C;  3BRC A;  3EFF K;  4JZ2 A;  2ZUD A;  3RAQ A;  4J9M A;  2LGQ A;  5KFH A;  2IOF K;  2XOK G;  5B5E Z;  3H8W A;  4HNA B;  4TV8 B;  4LFA O;  3CEI A;  4RUC A;  3KHH A;  3ASN B;  5IYZ B;  2UXC B;  4DFD A;  4YY3 B;  2EIK B;  5FL7 G;  1XS9 D;  4M47 A;  1IBM B;  4QZA A;  3KZI Z;  7ICO A;  4DYL A;  2CH7 B;  7ICI A;  3DTU B;  1K5S A;  5C93 A;  5KA6 A;  1N34 O;  2BSK B;  5IIJ A;  4DO2 A;  5KFY A;  2ZD9 A;  3UQ2 A;  1UCV A;  5KG2 A;  4OD0 A;  5BOM A;  1N2X A;  4DFK A;  3M1Y A;  4IRD A;  7ICT A;  4U7C A;  4UAZ A;  4YQW A;  9ICN A;  2HJD A;  2YIC A;  2ZE5 A;  5KFA A;  3AUO A;  4E0D A;  2FLP A;  4I4T B;  5AKZ A;  2KK0 A;  4U7O A;  7ICS A;  3ZDC A;  4KLT A;  9ICT A;  1PNK A;  3OM3 B;  5ALI A;  1I7F A;  4PHD A;  2K4I A;  5J2H A;  2EZO A;  4U7N A;  5GON A;  5CA0 A;  5DBA A;  3LSQ A;  4FJC C;  3H40 A;  4K4G A;  2QWP B;  2HJF C;  1JMS A;  4QZF A;  4YMN A;  3AG7 A;  4KHP B;  4IS7 A;  2QKC A;  5CJ7 A;  1MSD A;  2F4V O;  5L3B A;  3LNN A;  5FNV B;  5LHG A;  5C5J A;  2N04 A;  4MEX A;  4PDV A;  3Q4H B;  1FFV A;  1N62 A;  2FI1 A;  3J80 N;  3I5D A;  7ICF A;  2JH7 A;  3CCU V;  2UXD B;  5E79 Z;  1GO3 F;  2LQT A;  1VF6 C;  2NRT A;  2RQ6 A;  2YUA A;  1NBM G;  2ZE8 A;  3SAF A;  3V6J A;  2F77 X;  3SYC A;  2P66 A;  3B8M A;  1S5H C;  2QTS A;  4DUZ O;  4UQG A;  1Y74 A;  2XT9 A;  1TE2 A;  4TUS A;  4O5E A;  3PSF A;  4F5R A;  2KNJ A;  4Z6F A;  2QLT A;  2PI5 A;  1S5J A;  8ICK A;  1S0M A;  4O2B B;  3CJH A;  4IR1 A;  2GUZ B;  4PDL A;  4L8J A;  1B0X A;  4DL3 A;  1Q90 D;  2FB5 A;  5KT5 A;  3K1Z A;  2XO7 A;  1QSL A;  4X1Y A;  4DFP A;  4UVA A;  3GWK C;  5EYP A;  1ZQW A;  1XSL A;  1PV0 A;  4J80 A;  1T8E A;  1ZQA A;  1XMO O;  2FMS A;  4I2B A;  1NR1 A;  4PA7 A;  1KEJ A;  4PZN A;  3L72 H;  5AI6 A;  1SQV H;  1ZX3 A;  3TFR A;  2A1J B;  1ZQK A;  3ED5 A;  5KFX A;  5HNK A;  1UT8 A;  4I2I A;  3KD3 A;  3F2C A;  7ICH A;  3NVV A;  7ICP A;  2ZTE A;  2CTQ A;  2PUS A;  1V55 C;  2W6I G;  3D3Q A;  2JDI G;  2EIN B;  5BY1 A;  4CS3 A;  4ZIB A;  3R66 A;  3SR2 C;  5KFJ A;  1KP2 A;  1R3I C;  4FLT A;  1SV4 A;  2QWO B;  2YTU A;  3H0L B;  3ISB A;  5B1B B;  2BTQ B;  4PA4 A;  2KIV A;  1I94 O;  2K8B B;  3SJB C;  3QNE A;  5KFI A;  4EB6 A;  2KHV A;  4R63 A;  4LF7 O;  2ODG A;  2HG5 C;  3WFV A;  1XWL A;  2GHY A;  1O03 A;  1RYS A;  4DQQ A;  4PA3 A;  3LSS A;  2FPK A;  3V7L A;  5AM5 A;  2GTS A;  2Q0O C;  4HAI A;  4KLU A;  1FFX B;  4LFA B;  5KLV H;  2R8H A;  2BGW A;  4FZN A;  1OHH G;  5KFZ A;  4FLV A;  3GV5 B;  5IDJ A;  4C7Y A;  2Q68 A;  4R8C A;  5LMU O;  4B3S O;  5J2E A;  4Y2U A;  2Q4P A;  1LKY A;  1O9G A;  1L7O A;  4NJ8 A;  1ROP A;  1W0J G;  1N34 B;  4JWM A;  4B3M B;  4CS4 A;  4JI0 O;  1TKD A;  2VJ5 A;  2YI8 A;  3TCU A;  2LMR A;  4DSJ A;  4U6P A;  4JGS A;  3JCU Z;  2NNU A;  5JWP A;  1QSS A;  3NAS A;  4EZ6 A;  1P7G A;  4OJ6 A;  2ATK C;  4Q8E A;  4NYK A;  4IQT A;  3KZX A;  2W8L A;  4WFF A;  2VRZ A;  2AGP A;  4FFK A;  1LUW A;  1W59 A;  3EPG A;  5AKI A;  8ICJ A;  3ETQ A;  1KL9 A;  1RPL A;  4N21 A;  3RYH B;  3JSL A;  1DGJ A;  3OSP A;  5B3S C;  3WK4 A;  3HIL A;  3IV6 A;  4NLB A;  4XDJ A;  3GIM A;  2O57 A;  4LCU C;  1NH2 B;  4F8R A;  4I2E A;  3M7D A;  1K7D A;  2IJJ A;  2RMK B;  4IIJ A;  2F4V B;  4ZHQ B;  4M9H A;  5ALQ A;  1KDH A;  3MC1 A;  1PK1 A;  4KIT B;  1U4B A;  1U48 A;  1QCK A;  4P0Q A;  3AG2 C;  4DOB A;  2XAQ A;  4M9G A;  2LKY A;  2MSN A;  4UB6 U;  2NLJ C;  1OCC C;  4ED1 A;  5KHI A;  4I50 B;  1TAE A;  3QTC A;  2G09 A;  1EN4 A;  3D2N A;  3VQX A;  4F92 B;  4FIP C;  1ZYQ A;  2BCU A;  1B04 A;  2IJI A;  3RJK A;  3HW8 A;  1ZRN A;  3MR6 A;  2HP8 A;  4DUZ B;  5KG3 A;  2A0L A;  4ECZ A;  2Q0A A;  1WAZ A;  3UO2 A;  2H3F A;  1ZQH A;  5ALD A;  4PL2 A;  1ZQE A;  5CBF A;  3H1H H;  2A9H A;  1UQV A;  4Y2Y A;  1XIL A;  2EIM B;  1N5W A;  1S97 A;  1XU4 A;  1SKS A;  4IL6 U;  1CP9 A;  1TUE B;  4DLG A;  3UM9 A;  1TVK A;  3L4P A;  3FAH A;  2KKW A;  4O4H A;  4YMO A;  7ICE A;  3DDH A;  2B9Z A;  5EIB C;  3T5L A;  2KQX A;  1NZB A;  1R1B A;  4R6Z A;  2IA6 A;  4NLN A;  1XMO B;  2Y9U A;  9ICG A;  3W7U A;  1M90 W;  4LF7 B;  1SQX H;  5J2T B;  1H2N A;  4P2Z A;  2PFP A;  4J9Y B;  3GII A;  1SC5 B;  1C7Y A;  3D3I A;  5B66 U;  3M8R A;  4ICG A;  4DV5 O;  1MOF A;  2WAQ C;  4K3A A;  3FYH A;  5CB4 A;  4LWS B;  4MS2 A;  3BQ1 A;  2XGQ A;  4DL4 A;  2ZXI A;  1FJG O;  4H0L B;  4RPX A;  3SYP A;  3BEH A;  2YEV B;  2QM8 A;  4CC6 A;  1GN3 A;  2HHS A;  1JOY A;  3ZMU A;  4DF4 A;  4DSL A;  1CUK A;  2E8M A;  4WBN B;  1I94 B;  3M6K A;  2CTR A;  5T14 A;  1QQC A;  1VQ7 V;  4K4I A;  2EIK C;  2R8G A;  1BQZ A;  3LWM A;  3T5H A;  8ICE A;  4O3Q A;  4DOC A;  4DL7 A;  9ICO A;  1DK2 A;  2PGG A;  3ZDB A;  3HKE A;  4IYH A;  1PUZ A;  3RB0 A;  1X59 A;  4UFZ A;  4EX7 A;  2WF8 A;  2Q9L A;  3DEE A;  3E86 A;  2Q0Z X;  3FFQ A;  3C29 A;  1HDJ A;  3VC8 A;  5J0S A;  5HML A;  4I2J A;  5AKH A;  4UBC A;  4RQ3 A;  9ICJ A;  2VA2 A;  3OJU A;  4B9M A;  3FDS A;  3B2E E;  5L1J A;  5J0T A;  3L73 H;  1ZTE A;  8ICY A;  4LNU B;  1YTF D;  5AKY A;  4I9W A;  3ABL B;  3DXR A;  4NVP A;  5J8Y A;  4B3S B;  5LMU B;  4MHV A;  2YX8 A;  2LI6 A;  3L75 H;  2I6X A;  2W9B B;  3CB2 A;  1VQ5 V;  4A8E A;  4QZ9 A;  1YSC A;  4F4W A;  4X1I B;  2R9A A;  4US8 A;  3E89 A;  4JI0 B;  8ICV A;  2ZR3 A;  3E2E A;  2YXH A;  2AGQ A;  2BCR A;  1BZK A;  2DBY A;  2RDI A;  1K97 A;  4CF3 A;  3TAN A;  1V9P A;  4BW5 A;  3MD0 A;  5KL1 B;  2XY7 A;  1ZQC A;  4KP4 A;  3JPQ A;  4K4H A;  3BPZ A;  2W03 A;  4DFJ A;  4UAW A;  4DV4 O;  1M1K W;  5ALJ A;  3G80 A;  1L0L H;  1PNL A;  2BOB C;  1S72 V;  3G6V A;  3BZC A;  3T4Z A;  3RYF B;  4OPH A;  1L8O A;  4FZL A;  1BL8 A;  4ELU A;  4O4L A;  4F4K A;  4AI8 A;  1L0N H;  4WFH A;  3H1K H;  3G6Y A;  2PXI A;  4DL2 A;  2WLN A;  3OD4 A;  5KHH A;  4KMO B;  5A0L A;  3UM7 A;  2L5Y A;  4CNQ A;  2ZTC A;  4PGY A;  2HBJ A;  3RAX A;  2DMX A;  3WK9 A;  4ECU A;  1RZT A;  4N23 A;  2MA1 A;  4D7S A;  3ZD9 A;  2E5L O;  2H3Z A;  1P7D A;  4CZZ A;  2IU3 A;  1QQ7 A;  3QU7 A;  1BMF G;  2WA4 A;  2AQ4 A;  4ZI7 B;  1MG1 A;  4GX2 A;  3PW2 A;  2DUY A;  2XY5 A;  3V6K A;  4KX5 A;  1MQ3 A;  1QLE C;  1Y76 B;  3KHG A;  4F50 A;  2AGO A;  4DFM A;  1M57 B;  4WFG A;  5ITZ A;  3THV A;  3VBB A;  3ASO C;  1RPR A;  1BPZ A;  3CCQ V;  5LMN O;  1KSP A;  4RZR A;  1KFD A;  2ATL A;  3FAV A;  3ZX6 A;  2HW3 A;  1S0O A;  1Q8I A;  3OMA B;  4YXM A;  5EWG A;  2LPE A;  2EIN C;  5G5G A;  2HEP A;  1RM6 C;  2BZF A;  1K3E A;  3BDP A;  5H9C A;  3NVY A;  3K4G A;  4JUZ A;  1OZ0 A;  4DWI A;  1XNR O;  5B1B C;  2KOB A;  1Q8K A;  5KA5 A;  2BPC A;  5B1A B;  2NN4 A;  4UAV A;  2GH1 A;  4I7Z B;  4UCT A;  1N33 O;  2LYH A;  1DF4 A;  3IFX A;  1ZQR A;  4DV5 B;  4G28 B;  2GTA A;  5J0Q A;  5FLX N;  2E8P A;  2HHT A;  1VQN V;  2NRX A;  4ICA A;  3ABK B;  2HLD G;  3DC6 A;  1ZOL A;  1ZQG A;  5L1K A;  2OH2 A;  5IYD O;  1FJG B;  3QU4 A;  3RVY A;  4U3J A;  1MN8 A;  3PX4 A;  2GSM B;  4UAS A;  2QWN B;  8ICW A;  2MAX A;  4JI2 O;  1S10 A;  4JPR A;  1IUR A;  3K0G A;  2D6F C;  4LF9 O;  3IRU A;  2P4V A;  3VCB A;  4M9N A;  1NJW A;  5JVD B;  4PGX A;  3RH4 A;  5IJ0 A;  3T1Y O;  4OPA A;  4NB5 A;  2ZM6 O;  1G1X B;  4J9R A;  1MAB G;  1AP6 A;  3ZS8 C;  5J2U A;  2FMP A;  4ZOL B;  4EKW A;  1RPO A;  3F2B A;  2XTA A;  1ZQN A;  3BAA A;  4EEL A;  2C2R A;  4LP8 A;  4F6R A;  3T2M A;  1VQ8 V;  2D2C B;  5DBB A;  1NJY A;  1JXL A;  1JX9 A;  2CUG A;  5JJE B;  3RFA A;  5GTH U;  2DFL A;  4NTW A;  2FL4 A;  4F3O A;  1YHQ V;  4KLE A;  3KFU F;  1OCZ C;  4F6E A;  4PHZ A;  1COO A;  1AJP A;  4OO1 J;  3BJY A;  3ALR A;  4MF2 A;  1QHT A;  1R73 A;  3LNM B;  3NXS A;  4BW9 A;  3WU2 Z;  1RSO B;  3ISD A;  3KOO A;  1YF2 A;  3QF7 A;  3ZRW A;  3P30 A;  5H2F Z;  3JAM N;  3KHR A;  2VA8 A;  3U26 A;  5DQG A;  3CRM A;  1ZSP A;  1A0P A;  2WLI A;  1BHA A;  5AHX A;  1E1Q G;  3CC4 V;  4MW3 A;  4P0P A;  3D6J A;  3MAB A;  4WFE A;  1LB2 B;  1H2K A;  2RN9 A;  2IW5 A;  2QJ1 A;  2HCF A;  3GWO A;  1Z00 A;  5DN6 G;  3EXA A;  2KVS A;  2BR0 A;  1DOQ A;  1AJN A;  1PD3 A;  4DV4 B;  8ICR A;  3K3W A;  3UQ0 A;  1BE3 H;  2EQY A;  1GTO A;  2BDP A;  1ZQS A;  2ITC C;  4AYB F;  4M6W B;  1M9N A;  2WLL B;  3Q8K A;  2JR5 A;  4XQ8 A;  5L1M A;  4CRX A;  1VF5 B;  5JUM A;  2FDR A;  1L3U A;  4JWN A;  5KG7 A;  3JAS B;  3CW2 C;  4BJQ A;  4MFA A;  1W0K G;  2E1E A;  1DGS A;  1U45 A;  1IXB A;  1GN2 A;  4NLZ A;  5FNV A;  3TET A;  3CCR V;  2OYQ A;  2XCP A;  3E22 B;  2RHF A;  1FXK B;  2QWQ B;  4JI6 O;  4UAT A;  4X20 A;  2BKE A;  2E5L B;  2W6J G;  3OR6 C;  3UMC A;  5KAI U;  2GV9 A;  3CRQ A;  5AKE A;  4YR3 A;  4F2S A;  1X2I A;  5HP4 A;  2XHB A;  5L1I A;  4DSF A;  1H38 A;  3RBZ A;  1KKX A;  2LW7 A;  5J0X A;  4QE9 A;  3PV8 A;  4C4R A;  3OAA G;  3CRA A;  4B9V A;  4CC5 A;  1Q7Y W;  5DDY A;  1XQ8 A;  3OGI B;  1RXV A;  1D8B A;  1KBH A;  4CE6 A;  4BDP A;  2IJH A;  4GT1 A;  3H0M B;  3U11 A;  3E83 A;  5LMN B;  2DKZ A;  9ICK A;  3K08 A;  4O2A B;  4X1K B;  4DQR A;  3ETR A;  3SV4 A;  4IQV A;  2YIA A;  4I55 A;  3KHL A;  4J9S A;  4DLE A;  1HP8 A;  2JRZ A;  9ICU A;  5JJJ B;  4F72 A;  3KKA A;  1H2M A;  1DTO A;  3RYI B;  3OMN B;  3ORY A;  4TQR A;  4IR9 A;  2E74 B;  1N33 B;  4LF6 O;  1NVP D;  2BE3 A;  4O4I A;  4FFB A;  4LH6 A;  4OXS A;  2ASL A;  1BGY H;  3ABU A;  4B3R O;  2ODM A;  1AP5 A;  2KV2 A;  4Q20 A;  4ECY A;  3UXP A;  5ALR A;  1R3L C;  5G5H A;  5ALL A;  4GXK A;  1CXZ B;  4C8M A;  3ZDA A;  2ZUC A;  1ZQX A;  2Z3Y A;  1SQF A;  2O6K A;  4JI2 B;  2P6R A;  5F3X B;  1NKE A;  5CMU A;  3JAL B;  1SIJ A;  2ISP A;  3ABL C;  3ZIA G;  4LF9 B;  2AJQ A;  4X65 O;  1ARO P;  2JS3 A;  4BAY A;  4DO9 A;  2AU0 A;  1DF5 A;  3T1Y B;  4D6T H;  2VA3 A;  3NR7 A;  2IHM A;  5AI4 A;  2W9A A;  3EWA A;  4R7C A;  5KL8 B;  2Z7J A;  3K0D A;  3ETD A;  2VQF O;  5KHJ A;  2Q4T A;  4GKJ O;  2NO5 A;  9ICH A;  3CE2 A;  3JAW B;  1EFR G;  1CPY A;  3I55 V;  5DEC A;  5D46 A;  2ZKO A;  2XUM A;  4JV0 A;  2CXY A;  4NXN B;  3MFH A;  5EC2 C;  3HKB A;  1UHU A;  4JI3 O;  5LXT A;  2OTL V;  2BOC C;  4JAV A;  2KTQ A;  3RTV A;  3BQ7 A;  1XO0 A;  2EAN A;  1GRJ A;  5L9X A;  2FLL A;  4KN7 A;  5LA6 B;  3UQ8 A;  1Q43 A;  3H1I H;  3SR6 A;  1P84 F;  5KMG A;  4UB4 A;  4O5K A;  3A0H U;  1I5X A;  2ZXH A;  4P4O A;  1KFS A;  2QA4 V;  5KX5 A;  4GCZ A;  3GZF A;  2RRD A;  4J9O A;  1IG6 A;  4Q6G A;  4R8U A;  4OJL A;  2Y1I A;  3QX7 A;  5KG0 A;  4LFB O;  4C80 A;  1AIL A;  2CN1 A;  5B1O A;  3F5E A;  3BZK A;  1HEK A;  4B9N A;  1R6T A;  3QNM A;  3DC5 A;  1Z1V A;  1BGX T;  1X9X A;  3AM9 A;  1M57 C;  1QH9 A;  1WB8 A;  3JPR A;  4EYI B;  1BPX A;  2EAO A;  2QAR B;  2W04 A;  3IM1 A;  1PKX A;  1UFI A;  4H33 A;  2HMX A;  5LOV B;  3AEI A;  4PI0 A;  1UJW B;  3N2G A;  3RJJ A;  5EZY B;  2CTW A;  5L3C A;  4Q45 A;  1X6J A;  2H94 A;  2Y69 B;  2YXL A;  4YD2 A;  4O4J B;  1Q5O A;  3BFR A;  3OSN A;  1VQK V;  5EBM C;  5DQI A;  2YS8 A;  8ICH A;  4JYA O;  1WA8 B;  5AM1 A;  1SL2 A;  2FMQ A;  5B1A C;  1BPD A;  2YB4 A;  3JPS A;  4GZR B;  3CXC U;  5KFL A;  9ICW A;  1NTM H;  1XUQ A;  2ZIX A;  5LGT A;  1S76 D;  2F1M A;  4C4T A;  1K73 W;  1WJZ A;  3WK7 A;  1YZB A;  4RQ4 A;  9ICF A;  2P6U A;  3ABK C;  1EM1 A;  1ZQ1 C;  2HHU A;  4MVM A;  2EZP A;  4PV1 B;  3ETG A;  1QBZ A;  3PY8 A;  2DJV A;  4OJO A;  1PM9 A;  3JAT A;  4UVC A;  2HVJ C;  3WB1 A;  2JEX A;  1FYJ A;  2LM1 A;  3TAQ A;  4ZOH C;  2R18 A;  5F2V O;  3CXH F;  4YG2 A;  4F5O A;  1X66 A;  2DF4 B;  1Y66 A;  4UB6 Z;  4P9P A;  4LF6 B;  4XA5 A;  4RQN A;  4AQY O;  3M9O B;  2MRL A;  2PFO A;  9ICB A;  4P4P A;  2EIJ B;  3K75 D;  3CHX A;  5LP6 A;  4WJ3 B;  3N28 A;  3QU2 A;  4QNH B;  7ICU A;  4YJ2 A;  3C23 A;  4B3R B;  4O3S A;  3OFN G;  4NV0 A;  4KLH A;  1F4M A;  3CX5 F;  2OXO A;  3OJS A;  2JIZ G;  1N0J A;  3JPN A;  1AR5 A;  4PPX A;  2YMM A;  4M0A A;  1URF A;  1Z5V A;  2QKS A;  1URJ A;  4LC1 A;  2OCC C;  4UB8 Z;  3TAD A;  2MUT A;  2FE9 A;  3B09 A;  4AP9 A;  4F5Q A;  3DV9 A;  1Q82 W;  4IL6 Z;  1T94 A;  1BNO A;  5CA1 A;  3FB7 C;  4X65 B;  2VQE O;  4O0I A;  1AI7 A;  2ZG6 A;  3E8H A;  1IBL O;  5IJ9 B;  2M6Y A;  4XBF A;  1EN5 A;  4D7T A;  5D4B A;  4PZO A;  1ZQP A;  2UXX A;  1ZWI C;  2VQF B;  1SV0 C;  1K34 A;  3IG8 A;  2JEI A;  3JPO A;  4EEK A;  2JVD A;  4HBN A;  4GKJ B;  4GC6 A;  4UW9 A;  3EYZ A;  8ICA A;  5B66 Z;  3BS5 A;  3GIK A;  5F9L A;  8ICQ A;  4TUY A;  4JI8 B;  3RRH A;  2KJ5 A;  3WKE A;  2R9I A;  4JI3 B;  2QSA A;  2E1F A;  2P90 A;  5A9G A;  1HNZ O;  2V4R A;  3RVZ A;  3CCE V;  4JAA A;  4DF8 A;  3WB0 A;  2KP7 A;  1YJN V;  3D8C A;  1YTF B;  2ZJ5 A;  1QQ5 A;  2EJ7 A;  5TZV A;  5HFL A;  4GFJ A;  4YFK A;  1MA1 A;  4DR1 O;  1JRP A;  5AM0 A;  2Y48 A;  5HFM A;  1T3N A;  1ZQJ A;  4KLJ A;  4JI4 O;  4BXO B;  5JQG A;  4O3M A;  1WP8 A;  2P6J A;  4JYB A;  2A06 H;  1MZF A;  3FC4 A;  4UB1 A;  4LF4 O;  1K1S A;  5AI5 A;  1FXK C;  3OUF A;  3SAH A;  3SPJ A;  1H2L A;  3BQ0 A;  2L35 A;  1X6I A;  2F93 B;  2BCC H;  1JPX A;  2M9N A;  1BVS A;  1EZV H;  5KAF U;  4I2A A;  1TUB B;  2AQ0 A;  4LFB B;  4DSK A;  4AYB C;  4DQP A;  3SQI A;  5HHH A;  3ZMT A;  4LR3 A;  3M9N B;  4MF8 A;  1U9L A;  2GWS A;  1SZH A;  5EE9 A;  5DB6 A;  3LDD A;  5JH7 B;  1QTM A;  1QR8 A;  4C8O A;  1TK5 A;  2F23 A;  4QZI A;  2Q7H A;  4DK0 A;  4F4L A;  4DR2 O;  1VQ9 V;  3QUQ A;  5KTQ A;  5CP2 A;  2G38 A;  2A19 A;  1JCH A;  3WKB A;  4FK5 C;  3HPO A;  4KLQ A;  3E8F A;  3HKC A;  5KG5 A;  4R50 A;  3GFK B;  4QWB A;  4X62 O;  2Q69 A;  4JYA B;  3B0X A;  1VQ4 V;  5IWA B;  4B9L A;  4ECV A;  3WK8 A;  3D2S A;  9ICV A;  1VQL V;  4Z1V A;  5KFW A;  1JX4 A;  2IOF A;  1H8E G;  3UT5 A;  3MGI A;  4C7Z A;  4PD4 F;  3OUS A;  4PHA A;  4NL9 A;  4KLS A;  3ZN0 A;  2E8N A;  5HMM A;  3IHQ B;  2JEG A;  1HW7 A;  2F66 C;  4PJ0 U;  2QKA A;  5J9P C;  2NRV A;  2XAH A;  1GMG A;  1XC9 A;  1VDV A;  1NJX A;  2KZZ A;  8ICX A;  4WCE V;  3JAK B;  4TOI A;  5ALK A;  4ECT A;  5AK4 A;  2P7T C;  2WWW A;  1JR9 A;  1V54 B;  2Y0P A;  5JJN B;  3H8J A;  5AM4 A;  3OE7 G;  4MSW C;  1LR1 A;  1JA8 A;  3LSU A;  1M56 B;  4AQY B;  1AI6 A;  2R70 A;  2WPD G;  4B3T O;  3ZHS A;  2VJ4 A;  3CNH A;  5J0W A;  4JTD B;  2GDS A;  1YJ9 V;  1XHZ A;  3ETE A;  2JXJ A;  2ZIW A;  3IC7 A;  4GYC B;  4P9O A;  1XHX A;  1OUQ A;  3J81 N;  3ZED A;  4F5P A;  4K8Z A;  4QWD A;  3JAR A;  1KFT A;  2WA3 A;  4QNL A;  1BHB A;  2GOL A;  2HHQ A;  4QZB A;  1T7P A;  1GM9 A;  3RW0 A;  4ABM A;  4YIP A;  4G3I A;  2VQE B;  2WLH A;  1SXD A;  3V7J A;  3HJE A;  4ECS A;  5LGU A;  1J97 A;  2UVR A;  2EZZ A;  4FZ1 A;  2HOI A;  2DQ0 A;  3BS7 A;  2CAZ C;  4DV2 O;  3OEE G;  5AIC A;  2JZB B;  5H6Q A;  4J9P A;  3M7M X;  1KW4 A;  4JV2 A;  4J7J A;  4CH6 A;  3K58 A;  1NKC A;  2DWD C;  4FMT A;  4X9Q A;  4KLO A;  3QO5 A;  2MU2 A;  3N7P D;  4ZBM A;  3G6X A;  1ZD3 A;  3KCX A;  4YMM A;  4RQ8 A;  1VIB A;  5LYJ B;  4NLC A;  2G5I B;  1XEQ A;  1HIW A;  3C2K A;  2W9C A;  4MVR A;  3SDL A;  1HNZ B;  2KG7 B;  4BIO A;  2W8K A;  9ICL A;  4JK1 A;  1OCR B;  4YJ3 B;  3ML0 A;  1SA0 A;  4DR1 B;  4QPK A;  4PGQ A;  1ZQM A;  3C3T A;  1HUO A;  4JI4 B;  3ONN A;  4NY8 A;  2XVT A;  4PEL A;  3N2K B;  4WFB V;  4LF4 B;  3B4S A;  1TGO A;  3WKD A;  2QB0 A;  1Q6H A;  4UB8 U;  4FBU A;  2JGU A;  3FYE B;  7ICN A;  4JI5 O;  5AM2 A;  2Y69 C;  2EUL A;  1SET A;  3KBB A;  2E3C A;  1Z4N A;  2H8P C;  3F53 A;  1RYR A;  4I0X A;  5L3F A;  5KG1 A;  1Q81 W;  3S6J A;  5GTH Z;  1VF6 A;  3FX7 A;  5DQH A;  1NJI W;  1F44 A;  2G06 A;  2ZIO A;  2EZY A;  4TUP A;  4DW0 A;  1OCO C;  2RCV A;  2A79 B;  1L8D A;  1JVM A;  1NZ6 A;  4J41 A;  4EEQ A;  2JH1 A;  2AHY A;  5KT2 A;  4F4Z A;  4TQS A;  3M9M B;  5BMV B;  1K4D C;  4PI2 A;  2HI0 A;  4NM2 A;  4KFM A;  3O0F A;  5ALE A;  2JHD A;  4PHP A;  3GVM A;  3OR7 C;  1TV9 A;  4HYO A;  5IYB O;  1X4T A;  4DR2 B;  4JV5 O;  3X2Q C;  3L9D A;  1SQG A;  4CH5 A;  2ZNI A;  1ZQU A;  3NRZ A;  1SKV A;  2ZIV A;  1SKW A;  8ICB A;  4I2F A;  4DK1 A;  1L3T A;  1B22 A;  2NRW A;  2LGW A;  4X62 B;  3OHA A;  1TAM A;  1U47 A;  8ICI A;  1KU9 A;  3IN5 A;  4CS2 A;  5DGA A;  3ASN C;  2AW9 A;  4DR4 O;  2KSO A;  2EIJ C;  2PMZ F;  2KKV A;  4DRX A;  2JRI A;  3TXS A;  3NUQ A;  5JRT A;  5J2D A;  4RPZ A;  3G4S V;  2V4D A;  1GM8 A;  5EC1 C;  1XDC A;  1H8H G;  2JGD A;  1ENV A;  4O3R A;  3B77 A;  4IHJ A;  3FM9 A;  3HX0 A;  2AGA A;  1L3S A;  3TFS A;  2Z0A A;  1B06 A;  2LM4 A;  9ICR A;  4C8N A;  3H1L H;  2Z5U A;  4XRH A;  1WYG A;  1DXS A;  2R8K A;  5KAI Z;  3SEN A;  2PF4 E;  4TV9 A;  4JV1 A;  2IBZ H;  4UCV A;  4B3T B;  5AKX A;  1J5E O;  1O08 A;  5BR8 O;  4CGZ A;  1S3J A;  3MFI A;  5GON B;  5CA0 B;  4DV1 O;  5A2Q N;  1BPB A;  1NVP B;  3V7K A;  5AKK A;  4MFC A;  1NK0 A;  9ICA A;  5DED A;  2P06 A;  4O3P A;  1FFT B;  1WLE A;  4YP3 A;  1UT5 A;  1JQ0 A;  1U96 A;  1YXB A;  5DG7 A;  1QLN A;  4DR6 O;  1NK8 A;  4NXZ A;  5JCO C;  1Y4M A;  3STL C;  2DL0 A;  2C28 A;  2YIB A;  2QM7 A;  3ZHT A;  7ICR A;  4Z6D A;  4CH3 A;  3AN1 A;  1FXH A;  4GXI A;  4DV2 B;  4I29 A;  8ICF A;  4OJ5 A;  3CCM V;  3ZRV A;  1IM4 A;  5CWR A;  3SMV A;  2BTO A;  1S5L U;  1ZLZ A;  1ZQQ A;  1Y74 B;  3K04 A;  2VKQ A;  1VQ6 V;  1X9M A;  4TT3 G;  4QWA A;  1N63 A;  2F1H A;  2ADQ B;  1TAU A;  4CH4 A;  1KTQ A;  2KEY A;  3PO4 A;  4C8L A;  4YR0 A;  3F5T A;  4UUJ C;  1MMM A;  4NKG B;  3CJH B;  3ZCC A;  1Q46 A;  2VWK A;  3W7S A;  2OHF A;  1NK6 A;  2V1D A;  4X1Y B;  5EYP B;  1AR4 A;  1L7M A;  1S0N A;  4DUY O;  2WSS G;  4ACO A;  1JFF A;  3OTF A;  8ICC A;  2ZIU A;  4OJP A;  3RJE A;  2P5O A;  1FFU A;  1L1F A;  3ICX A;  3ZMZ A;  5C8Y A;  5KNI A;  4JI5 B;  2PFQ A;  2G0A A;  3TI0 A;  2I5H A;  8ICO A;  4I2C A;  3CP1 A;  5ALY A;  3FB8 C;  4YHH O;  4U3F H;  3GIJ A;  2EH9 A;  3JD4 A;  2E76 B;  1CI4 A;  4C0Z A;  9ICX A;  2E3T A;  3K59 A;  1ZL8 A;  1IV8 A;  5EE3 A;  8ICP A;  5J2G A;  1E1R G;  1EXN A;  1FAF A;  1L7N A;  4J11 A;  2MK3 A;  4DR3 O;  4G27 B;  2ZNJ A;  4JV5 B;  3E8B A;  1TVA A;  4X88 A;  2FPL A;  3PMN A;  1X40 A;  4NLG A;  3A0H Z;  4J7K A;  5LHH A;  2Q67 A;  4ECQ A;  5BXZ A;  1N60 A;  1PP9 H;  1QNM A;  1NK7 A;  3WB2 A;  2W43 A;  2DN9 A;  1JUD A;  2AXT U;  3VQV A;  4OX9 O;  4Y2S A;  5L3E A;  4EZ9 A;  5KFO A;  1M56 C;  1SQB H;  3RYC A;  3I56 V;  4DR4 B;  1YJW V;  2XI9 A;  5TIS U;  2E5S A;  1KP3 A;  5KFC A;  3OEH G;  5KFB A;  3AK1 A;  1L7P A;  4QZH A;  3OW2 U;  1LKY B;  2R8I A;  3CRC A;  1QR9 A;  3JCZ A;  5D5Q A;  5IIM A;  4MFF A;  2XAS A;  2IH3 C;  3QO7 A;  2AZ0 A;  4QIW F;  2RDJ A;  4ED0 A;  3C90 A;  1R6N A;  1VQM V;  4ED8 A;  1J95 A;  1XOU A;  2WAM A;  4GX5 A;  3ZN1 A;  3SPH A;  4HNA A;  7ICL A;  1BSM A;  3F2D A;  4TV8 A;  5BPC A;  3GV7 B;  3AU2 A;  5IIN A;  4DW1 A;  4YD1 A;  1Z5W A;  2ETN A;  5IYZ A;  3BA8 A;  3CCJ V;  4MEY A;  2NYV A;  1WNS A;  4JTC B;  4DV7 O;  4FM0 A;  1J5E B;  3KCY A;  5BR8 B;  2CE4 A;  1RG6 A;  5E1A C;  4DV1 B;  3QEB Z;  2CH7 A;  4RQ1 A;  2C2A A;  2W55 A;  4DSI A;  2BSK A;  4B08 A;  3UXN A;  3BVO A;  4DR6 B;  3AL0 B;  5KUK A;  4IIJ B;  2FYU H;  4GUN A;  1XRE A;  2OCH A;  3BQT A;  1ZAU A;  4QW8 A;  5EWE A;  4I4T A;  4LH7 A;  4TSF G;  1YZ7 A;  3OTQ A;  1PK1 B;  2OEH A;  4US9 A;  1OCR C;  4P0Q B;  2ZXW B;  3K79 A;  2CPR A;  3AQF A;  5DGB A;  2BPG A;  2W11 A;  4QZC A;  5BZB A;  3CCS V;  2JEU A;  2HOF A;  1RM1 B;  3V6H A;  1AR1 B;  2A3V A;  4XDK A;  1RP3 B;  3SJQ C;  2YB1 A;  4NTY A;  4DR5 O;  5H6R A;  1S8O A;  3ABM B;  2FLN A;  1MC8 A;  1HWY A;  2LFR A;  1UPG A;  3MGV A;  1COW G;  2B21 A;  3JD2 A;  9ICP A;  3APQ A;  5CHG A;  1M5I A;  3Q4H A;  4B9T A;  4M2Y A;  2ZDI C;  2XGP A;  2EIM C;  3TK1 A;  3WKA A;  3JPP A;  4UCU A;  2ES6 A;  4UAU A;  4YXJ A;  4ASU G;  2QM4 A;  5FPR A;  3OMI B;  4DV6 O;  1IX9 A;  1TVK B;  2FTK A;  4O4H B;  1D2D A;  1UA1 A;  3AG3 B;  1GAX A;  2WF9 A;  1RQL A;  2HHX A;  1Q3U A;  4DS4 A;  4A5U B;  3FKS G;  4DUY B;  4J03 A;  8ICG A;  3TAC B;  2H3I A;  1IBK O;  4UV8 A;  3PSI A;  7ICV A;  2KMD A;  1KQQ A;  3ABT A;  5AK6 A;  1S77 D;  2OTJ V;  3RGB A;  2ZUB A;  3QUT A;  2FJ6 A;  1SS3 A;  3T1H O;  2DYR B;  1U49 A;  3NGD A;  2HHV A;  1XSP A;  1SKR A;  3CWB H;  4O2B A;  2WLM A;  3C1Y A;  5KT4 A;  4RWU A;  2GUZ A;  2AH5 A;  4J9K A;  5CB4 B;  5ALF A;  4YHH B;  4KLF A;  5J2J A;  2EJR A;  3K1R B;  2GBO A;  1F7Y A;  3CRX A;  3AEV A;  4O3O A;  4DS5 A;  5L1L A;  2KSD A;  3D36 C;  3FD9 A;  1XNR B;  2B1G A;  2BQ3 A;  5J2B A;  4RPY A;  2X7R B;  3TJT A;  1CEZ A;  2EAP A;  3QU9 A;  2A1J A;  2K4H A;  1PVQ A;  1M93 A;  4WF9 V;  1AI5 A;  4DR3 B;  4IC9 A;  1Z2G A;  9ICI A;  3T1C A;  2UXB O;  5AI9 A;  3HKE B;  3IP4 B;  3A0B U;  1US6 A;  1WN7 A;  4ECR A;  3ZHQ A;  2VAN A;  4NLK A;  2N05 A;  1YEW A;  1V55 B;  5EBW C;  3BQ2 A;  1XL4 A;  3CC7 V;  4OX9 B;  4LBE C;  2YC0 A;  4IQW A;  1BS3 A;  1NJZ A;  4QZE A;  2OYY A;  3CC2 V;  1ZJN A;  5EWF A;  1NK5 A;  2BTQ A;  4P2H A;  2PMZ C;  3QE9 Y;  3DXR B;  5KAF Z;  2LW1 A;  2LP7 A;  5KFE A;  2EIL B;  2JMG A;  2ZM6 B;  4UCO A;  4QZD A;  3M99 B;  4DEZ A;  3ISC A;  3R9K A;  1S9F A;  2ZTD A;  3MR5 A;  5KG4 A;  4NTX A;  4W4K A;  1CRX A;  2PZS A;  1TFR A;  1Z3E B;  4LZG A;  4FPP A;  4FLY A;  1JIH A;  2YY6 A;  1GN4 A;  1THZ A;  3RF9 A;  2WTF A;  4PDR A;  3PN1 A;  4C8K A;  1FFX A;  1SRY A;  3NS1 A;  4JZG A;  4DV7 B;  4UAY A;  3ZJZ A;  4RQ7 A;  3PST A;  1K5O A;  1XL6 A;  2PI4 A;  4DOA A;  2RDC A;  1KQS U;  2FKX A;  4PA9 A;  4F4Y A;  1T5E A;  4GC7 A;  4O4L B;  3ZRX A;  2ZE6 A;  3PX0 A;  2CGN A;  2EDU A;  3H8S A;  4Y2T A;  1N0N A;  4Y2Q A;  2QE7 G;  2ZIM A;  4MVO A;  1TK0 A;  4OCZ A;  3MR2 A;  5L3D A;  1TK8 A;  4PJ0 Z;  3N97 B;  1BCC H;  2ESE A;  4M04 A;  5KFT A;  4OGQ B;  2HKO A;  2KFZ A;  1I0H A;  3H4B A;  3RT3 C;  2OIE A;  2KN7 A;  1GK9 A;  3ZI4 A;  3M8S A;  5KFN A;  1PPJ H;  3RYH A;  5ALZ A;  3ETL A;  2W9M A;  4USA A;  3A2F A;  3W7X A;  2HHH O;  1L5U A;  1F4N A;  2RJZ A;  4UAR A;  1FXV A;  3MDS A;  3TXQ A;  3Q8R B;  5B3S B;  5LL6 Y;  4DR5 B;  4JI7 O;  4JI1 O;  1L8L A;  4X5V A;  3H9V A;  1NI3 A;  1BT8 A;  4ZHQ A;  4P30 A;  5IY5 B;  3RJG A;  5ITZ B;  4JI6 B;  1MQ2 A;  5FPO A;  2Y4U A;  1X9S A;  3ZHR A;  2HBM A;  4G2K A;  4FM2 A;  3U0Z A;  3FAV B;  3I1Y A;  2HSZ A;  5LHI A;  4FZ0 A;  4DV6 B;  3AG2 B;  4I50 A;  1QVF U;  3Q8P B;  4ED3 A;  3F7V C;  4DSE A;  5ALW A;  1OCC B;  1FKA O;  1VAR A;  3ZHU A;  3C2L A;  1FS0 G;  2A3Q A;  2NRZ A;  1NR7 A;  2KKP A;  2AHZ A;  3RRG A;  2BQR A;  3HT3 A;  3IAY A;  2XAJ A;  3UKM A;  1Q6U A;  3C5F A;  1IBK B;  1Q6I A;  5DM6 V;  3B40 A;  2WF7 A;  5ALU A;  2IM9 A;  1Q86 W;  2Q73 A;  3T1H B;  2JGA A;  4RUE A;  4RQ2 A;  1OXJ A;  1P7B A;  2I9G A;  5EK0 A;  5L3G A;  2JV3 A;  4KTQ A;  1OW5 A;  4Y2V A;  2OM6 A;  3P32 A;  5KFG A;  2K89 A;  4EBE A;  2XID A;  3G67 A;  2IHN A;  3PNC A;  1VP7 A;  4U3J B;  1SWV A;  2EZX A;  2H3Q A;  4O3N A;  1AI4 A;  5ALX A;  1JJO A;  4X8A A;  1N8R W;  4YVZ A;  1EZJ A;  5J2T A;  2R72 A;  2X0L A;  2XCA A;  4UB3 A;  4BX9 C;  5GW7 A;  5KFU A;  3N4M B;  1Y88 A;  2WHE A;  3UCS C;  2E8O A;  3MHH C;  1QSY A;  5IJ0 B;  1ZET A;  2UXB B;  3LDA A;  1BQ0 A;  2WB1 F;  2DYS B;  4LWS A;  1PL4 A;  5J2U B;  5IT9 N;  1F51 A;  1SER A;  1D9F A;  1NS1 A;  1SXE A;  4RU9 A;  1ZRM A;  2D3D A;  2L6L A;  4F6R B;  3EUB 2;  3TAP A;  1B4F A;  3D36 A;  2YEV A;  5CBG A;  2RP5 A;  3LWL A;  5AM3 A;  2JEJ A;  3JD1 A;  1D9D A;  4PDM A;  4WBN A;  2DOS A;  5JTI A;  3DGE A;  1K4C C;  2UUB O;  1YDX A;  2W0X A;  1ZQL A;  1N36 O;  2ZQM A;  4LJX A;  1BPY A;  1Q3V A;  1JN3 A;  3JPT A;  3ZRW B;  4B3M O;  3B0Y A;  4MW8 A;  4QIW C;  3PR5 B;  4NR1 A;  3E58 A;  4RQM A;  2Y9T A;  2W0F C;  1YVW A;  1B43 A;  2XC9 A;  2C2E A;  2WLI B;  4K0K O;  4LNU A;  2H5X A;  4P0P B;  2KZ3 A;  5KT7 A;  1YI2 V;  1PK3 A;  4I2H A;  1KYO F;  2ZXW C;  5KFV A;  5IIO A;  4MTF A;  2QKQ A;  4CF4 A;  1Z00 B;  3BY6 A;  2X6C A;  1MSW D;  1SB3 C;  1WCN A;  1ZQV A;  1WPB A;  2W9B A;  3LUT B;  1RM1 C;  5BOL A;  4X1I A;  2F8L A;  3H01 A;  4F93 B;  2CGO A;  1EN6 A;  3ABM C;  4J9N A;  4UVB A;  4Y2P A;  4JYC A;  4EEN A;  3HKD B;  3BAB A;  4RNO A;  4JYY A;  1FD9 A;  2A7W A;  3L70 H;  4BIZ A;  5AIB A;  3J7A U;  1XSN A;  4XUS A;  2RLT A;  1COK A;  2P67 A;  5HR7 A;  4X20 B;  4EEY A;  2AHO B;  4EFB A;  3AK3 A;  2ZIN A;  4MVQ A;  1JJ2 U;  3H4D A;  1ZQT A;  2JJ2 G;  2P22 C;  1S0V A;  2CRX A;  4RUF A;  4B7K A;  2ZE7 A;  1NI8 A;  4LFC O;  3AG3 C;  2HHH B;  3G71 V;  4KLM A;  3RYF A;  1YZ6 A;  4MTO A;  1NTZ H;  3SYO A;  3OGU A;  3GDX A;  4JI1 B;  3RB3 A;  4JI7 B;  3K5M A;  4GXJ A;  4UV9 A;  2YI9 A;  1GH6 A;  4FLX A;  1Z19 A;  2DWQ A;  2BHN A;  3N7R C;  4EYH B;  2DYR C;  3SZ2 A;  2BCS A;  2M7W A;  1G8M A;  3SYQ A;  1A77 A;  5III A;  1XNS A;  5EOZ A;  4KLD A;  3SD7 A;  3IG5 A;  1WPX A;  3T3F A;  4L87 A;  5AK5 A;  2ADP A;  3ZMS A;  4I55 B;  3WK5 A;  4ZI7 A;  3MBY A;  4B7E A;  4KLL A;  4B9U A;  3BCC H;  1PZN A;  2HVH A;  1Y76 A;  4I9Q A;  4F2R A;  2J6U A;  1QLE B;  5DKW A;  2PTM A;  2XIC A;  3KKY A;  1YIT V;  5KFS A;  4TWK A;  5J0O A;  3GV8 B;  4RNM A;  3AG4 B;  2GO7 A;  3C28 A;  4FFB B;  3ASO B;  4O4I B;  4NM1 A;  5IIK A;  2BQU A;  1VQP V;  1S5L Z;  4RO2 A;  1D8Y A;  3IC9 A;  1KRP A;  3QVN A;  4ED7 A;  3PVX A;  2DWE C;  5DB9 A;  8ICL A;  4RQ0 A;  2YIB D;  1Z4O A;  4BGD A;  2UUA O;  3BA9 A;  5J2F A;  4NXM O;  1ECW A;  5J8Y C;  1EBO A;  2B5U A;  3AG1 B;  2ALZ A;  5CRX A;  2EIL C;  3CYM A;  4DV3 O;  2D8C A;  4LF5 O;  1Y67 A;  3CS5 A;  1SL1 A;  3WG7 B;  1JXE A;  1IVS A;  2NO4 A;  1K9M W;  1N56 A;  5DBC A;  7ICQ A;  4KUM A;  4MTG A;  1MNG A;  2XAG A;  4X64 O;  3IDW A;  4GLX A;  2DQ3 A;  5CEH A;  2YMP A;  1RXW A;  3SPI A;  3EZ5 A;  4E4E A;  4TUQ A;  1QCE A;  2BCV A;  8ICT A;  2CDY A;  3HPL C;  3C3S A;  2E75 B;  2YN4 A;  3HKB B;  5LXT B;  1VJ5 A;  5KFQ A;  5JVD A;  3V72 A;  4ED2 A;  2A1A A;  5KG6 A;  2QWR B;  5IYC O;  1N36 B;  1IBL B;  5GTI U;  2UUB B;  2DPI A;  5J0U A;  8ICU A;  2OWO A;  3ZD8 A;  4F5N A;  2K60 A;  4DL6 A;  2EBO A;  3SJC C;  4W4L A;  1VQO V;  5CR0 A;  4ZOL A;  1AB3 A;  1NTK H;  5KMG B;  4DR7 O;  1BPE A;  3MHS C;  2PYJ A;  5K1P A;  1ZD2 P;  3NTU A;  1F23 A;  3RH6 A;  4FM1 A;  1SL0 A;  4RQ6 A;  5J0R A;  5KX5 B;  3K9A A;  7ICK A;  3O65 A;  4K0K B;  4RAI A;  2UVU A;  5ALO A;  4R8U B;  3W7T A;  2M0N A;  1LV5 A;  4JMU A;  2LHT A;  4Y2X A;  1OCZ B;  4FO6 A;  3E35 A;  4J10 A;  1RSO A;  4GX0 A;  1T3Q A;  1ZD4 A;  2DQN B;  5J2I A;  2AXT Z;  4FLZ A;  4MVS A;  4LZD A;  2Y4T A;  1SV0 A;  2W7P A;  5TIS Z;  1K1Q A;  3OT7 A;  1E79 G;  1TA8 A;  5KUM A;  5IY5 C;  1RQN A;  4AHC A;  3K5O A;  1XI1 A;  2W3S A;  1V97 A;  4Z2W A;  2ITD C;  4EX6 A;  1SZP A;  5B5E U;  1HNW O;  3N2G B;  3VQW A;  5EIB D;  5DB7 A;  4LFC B;  4DL5 A;  7ICG A;  4BR6 A;  3P3P A;  1Q3E A;  4M6W A;  4J42 A;  4LVS A;  2WLL A;  1N32 O;  2ZR2 A;  2QDO A;  3KZI U;  5H5N A;  4QJF B;  5KFP A;  4FS2 A;  4CF5 A;  1A6S A;  3FYI B;  3JAS A;  5EBL C;  3QO8 A;  4UBB A;  1L3V A;  3STZ C;  5CN0 A;  4UB2 A;  2ZIX B;  2C2D A;  4HAM A;  3RWR D;  2KJ8 A;  4Y2J A;  3SAG A;  3GIL A;  3E22 A;  4K8X A;  1FXK A;  3QU5 A;  2LFS A;  1OV9 A;  2N74 A;  1Z1B A;  5CA7 A;  3C21 A;  4YR2 A;  1NNL A;  1N5X A;  4PA6 A;  2VWJ A;  4UCR A;  2J6S A;  3JAT B;  1DK3 A;  4FLU A;  2KZM A;  1NZP A;  4XDL A;  1JI7 A;  1ZQD A;  1R3J C;  3WKC A;  1QQ6 A;  2HBL A;  4GX1 A;  2G07 A;  3PML A;  3GB7 C;  2G5H B;  1RDF A;  4ECX A;  4O5C A;  1ZQI A;  5LP6 B;  2HBK A;  1K92 A;  1J2N A;  4QZG A;  1OJH A;  2D3O W;  1WCL A;  2DYS C;  4O2A A;  2KVC A;  2RQ5 A;  2IOH A;  4X1K A;  4YJ2 B;  4GKK O;  1X9W A;  2YMQ A;  1ZJM A;  2ZJA A;  5KT3 A;  2EAM A;  5D5P A;  1U97 A;  4JTA B;  2F76 X;  1PNM A;  5E79 U;  3SEI A;  5CB1 A;  1IIP A;  2IH1 C;  2V4Q A;  3QG5 A;  3BHP A;  3TKA A;  2F8K A;  3F5A A;  2UUA B;  3RYI A;  3T5J A;  2PFN A;  2MUT B;  2ISO A;  4NXM B;  1XMQ O;  4RT3 A;  1ORQ C;  5CA1 B;  4DV3 B;  3JD3 A;  4BWJ A;  4KLI A;  4DCC A;  3PW7 A;  4LF5 B;  1NQT A;  1QVG U;  1IDS A;  3JSN A;  4BWA A;  2WB1 C;  2JK5 C;  2LYA A;  4X64 B;  4CBC A;  3VQY A;  9ICE A;  1ZQF A;  1SF9 A;  3Q8L A;  4MVZ A;  3P3N A;  7ICJ A;  4R66 A;  3LYS A;  1KBU A;  3BS5 B;  4TUY B;  1SZT A;  4TQD A;  3JAL A;  1LVH A;  3K03 A;  1L6N A;  4B9S A;  1A32 A;  1N48 A;  3LDE A;  3HKZ F;  2X6A A;  5HHI A;  3RJI A;  3SI8 A;  1R3K C;  3TQ1 A;  2QR4 A;  1NK4 A;  2DW4 A;  3W7W A;  3F7Y C;  3EVK A;  1WB7 A;  2CK3 G;  2V9W A;  3RJH A;  3MGH A;  3E8G A;  2EX3 A;  1KN5 A;  3T79 A;  3QUC A;  3OTO O;  4DQI A;  4RQE A;  4CDG A;  4DR7 B;  2W54 A;  2AZ2 A;  5JQG B;  2Y0S F;  1VMG A;  3JAW A;  1B3Q A;  4RUA A;  3OHB A;  2G08 A;  4Q44 A;  9ICC A;  4DV0 O;  4H44 B;  2PY5 A;  3CCV V;  3A0B Z;  1D5A A;  4H37 A;  3GU3 A;  2I1Q A;  3H8M A;  4JB3 A;  2HDO A;  5KFR A;  1R6K A;  4DXW A;  3CP8 A;  2YSU B;  5CBH A;  1SQQ H;  4QE7 A;  5KT6 A;  4IGG A;  1O9H A;  3SYA A;  4ECW A;  3T5K A;  2HR3 A;  5LA6 A;  3H7I A;  4J7Z A;  1V85 A;  4BIU A;  2V7Q G;  2X6B A;  3KTQ A;  4RQF A;  2ARH A;  3OGC C;  2JJ1 G;  4O9M A;  4MT8 A;  1IXM A;  2QTO A;  3A0R A;  4Q43 A;  1IXR A;  5HR6 A;  4G9B A;  3APO A;  4ELT A;  1H2S B;  1AJQ A;  2IMW P;  4FZM A;  1KMI Z;  4TQF A;  3ZBH A;  3MDA A;  1HNW B;  2KIC A;  1MZE A;  2XAF A;  1X42 A;  1VLB A;  1FO4 A;  4R64 A;  5IIL A;  3TAR A;  3A8T A;  4QGP A;  5F9N A;  1K5Q A;  5KFD A;  3HKC B;  5ALN A;  3UPQ A;  1N32 B;  3KKA C;  5ALG A;  1UPH A;  2Y1J A;  1XNQ O;  3EW9 A;  2ZJ8 A;  4M9L A;  1I08 A;  3G6B A;  3LDC A;  5B1N A;  5JU5 A;  4ELV A;  2JS5 A;  2QAR A;  3UT5 B;  3ZDE A;  3AG4 C;  4RQ5 A;  4IQU A;  5LOV A;  1W2B U;  3PW5 A;  4EB6 B;  1ZD5 A;  4ED6 A;  4DQS A;  3F5W C;  1SES A;  5EZY A;  3UMG A;  3LVW A;  3THO A;  1NOM A;  4IRK A;  1GKF A;  1HR0 O;  1UA0 A;  2K4E A;  4ZH4 A;  4FFD A;  4IYI A;  4UXN A;  3CCL V;  1FEZ A;  1BNP A;  4PHE A;  4O4J A;  5FP0 A;  4Z6E A;  3FB5 C;  1V54 C;  1HNX O;  2F44 A;  1WA8 A;  2JEF A;  2MW2 B;  4E2L A;  3RBE A;  2ILM A;  4IRC A;  3AG1 C;  1SGG A;  4KL1 A;  1KB9 F;  3L71 H;  2P35 A;  3ZMV A;  3WG7 C;  2FPM A;  5ALS A;  3CMA V;  4GKK B;  3CYO A;  4BWM A;  4HZ3 A;  2NV3 A;  3O9O A;  4JAS A;  3U10 A;  2OCE A;  1T4G A;  3Q8M A;  2OIG A;  2QB1 A;  4I2G A;  4FLW A;  2ZIW B;  3HRD D;  3M8A A;  4JAU A;  3PSP A;  3RH5 A;  3CRR A;  4QPJ A;  4C7U A;  3JAR B;  4LF8 O;  1IZ3 A;  2DE0 X;  1F0M A;  1XMQ B;  2B1I A;  1D5N A;  3RB6 A;  2OT5 A;  5J0Y A;  2ZT9 B;  3RB4 A;  3L74 H;  4KLG A;  3SJA C;  1YIJ V;  1FIQ A;  5AKL A;  3G6E V;  2Q5Z A;  4P4M A;  4M9J A;  1VEW A;  1XO1 A;  1NH2 D;  2UU9 O;  1PVR A;  2IU0 A;  4YCX A;  4RNN A;  2LYB A;  4UB5 A;  4HYK A;  5J29 A;  8ICN A;  2WF5 A;  4Z6C A;  3DSQ A;  2H3O A;  2LJ2 A;  2OCC B;  5KHK A;  5AG2 A;  3Q8S B;  4NXN O;  2W9C B;  5DDM A;  5EE0 A;  5J2C A;  5IJ9 A;  2HFE C;  3JYC A;  3OTO B;  1G4Y B;  1ZQY A;  3FB6 C;  1SA0 B;  2UVV A;  4PH5 A;  3WK6 A;  1MA7 A;  4I5S A;  4IT5 A;  4FE3 A;  1YCI A;  2RNB A;  3UXO A;  1GM7 A;  1YT3 A;  1WUD A;  3E0F A;  3PW0 A;  3PW4 A;  1HUZ A;  3HWT A;  2YML A;  1NKB A;  1N61 A;  4DV0 B;  2F95 B;  4UCS A;  2IBK A;  2QB0 B;  3NVW A;  5KFM A;  3RR8 A;  1K33 A;  4JF3 A;  3EPI A;  5JCO A;  3H0R B;  3UMB A;  1P49 A;  1RFY A;  3CME V;  2IJK A;  4F91 B;  3AQE A;  4QWC A;  3LK9 A;  4I0X B;  1SZX A;  2HVK C;  3QZ7 A;  3D2Q A;  1KKC A;  1N4C A;  2BDU A;  3QYP A;  1ZQB A;  1WG8 A;  3R65 A;  1VF7 A;  4YN4 A;  1V38 A;  3OPX A;  2BPF A;  4BXO A;  4FVM A;  5ALM A;  3ZHV A;  1AVM A;  4X89 A;  5C0Y A;  3HKD A;  5DG8 A;  4PL1 A;  1KLN A;  2LO1 A;  5AKG A;  4MTX A;  2B0C A;  1ZQO A;  3SPC A;  1Y6X A;  3L3F X;  3AU6 A;  3AK2 A;  1KEC A;  5J2K A;  3RFR A;  2UUC O;  2KIW A;  2B6G A;  3CD6 V;  4I28 A;  1AQ6 A;  1H2G A;  1TUB A;  4ZKI A;  1D8L A;  3UO3 A;  2ZIV B;  1FPO A;  2WF6 A;  4F4X A;  4EBC A;  3C5G A;  1ZXI A;  1NKD A;  1NT2 B;  5CA3 A;  2FML A;  4AIL C;  9ICM A;  1KKD A;  2Q8V A;  2PKE A;  2F1J A;  4X66 O;  1HJP A;  1G6U A;  1XNQ B;  2KB1 A;  2BCQ A;  3RR7 A;  5JH7 A;  5LP6 C;  1ZQZ A;  2KSO B;  4DRX B;  1F5S A;  3AMZ A;  3SV3 A;  3SYZ A;  3KG2 A;  2HHW A;  3L5K A;  3PO5 A;  2WLK A;  4KXR A;  1HR0 B;  1PVP A;  1I5Y A;  2JGD B;  7ICM A;  3Q8Q B;  5DLF A;  3MAQ A;  2K8C B;  4IHJ B;  4H13 B;  1HNX B;  3TAD C;  4YIO A;  3RBD A;  3MDC A;  4Q8F A;  2DKX A;  3HP6 A;  3B8N A;  2DPJ A;  1M6Y A;  3C1Z A;  3N27 A;  4TV9 B;  2VIX A;  1C20 A;  4J9L A;  3PX6 A;  3H1J H;  3IJ4 A;  1KUQ A;  4J9Q A;  3PZP A;  4I2D A;  2UXC O;  4YY3 O;  2UXN A;  2N1R A;  4RT2 A;  3TGU H;  3PJS K;  1IBM O;  1JMK C;  4F71 A;  2W7O A;  3ZDD A;  3MR3 A;  3M6Z A;  5LBQ A;  3JAK A;  2HVI A;  3QXG A;  3ZRS A;  2YID A;  4GIB A;  1B6Q A;  4J9Z B;  5AI0 A;  4LF8 B;  3NVZ A;  3SGI A;  1K8A W;  5KFK A;  2HOQ A;  4TUR A;  5J0P A;  4EBD A;  1DLB A;  1SQP H;  1GN6 A;  2XY6 A;  2F2A B;  2CTP A;  4WFA V;  2UU9 B;  4NWI A;  3K9S A;  2Q7E A;  1WP7 A;  4Z1M G;  2WLJ A;  1KC8 W;  1DK1 A;  4FBT A;  2XND G;  4KHP O;  3SPG A;  3T4D A;  2KG5 A;  1SWW A;  2KJ9 A;  3I28 A;  4JI8 O;  3HKZ C;  2YXY A;  1WWU A;  2KFN A;  2P4K A;  2VS0 A;  3HR0 A;  2W3R A;  9ICS A;  5AIA A;  1QU7 A;  5AKJ A;  2K8A A;  2Q7G A;  2UXD O;  8ICZ A;  2PYL A;  2K4P A;  4QZ8 A;  4R65 A;  2KE7 A;  4EFE A;  1RYU A;  5K1X A;  2KHQ A;  3EHB B;  2GLE A;  2JZB A;  4QW9 A;  4KX3 A;  3S3W A;  4CCH A;  4I27 A;  1NK9 A;  2K1E A;  1NU1 H;  3QUB A;  2Y0S C;  4Y2R A;  4BUG A;  1JRO A;  2QEX V;  2C22 A;  3QZ8 A;  9ICQ A;  1LNQ A;  1LUV A;  1JFF B;  2ZIU B;  5DB8 A;  5LYJ A;  5DLG A;  5ALH A;  4MVU A;  4KMU A;  3J81 j;  3K06 A;  3RN4 A;  3VOU A;  5C8Y B;  2KG7 A;  2NR5 A;  3K5L A;  3RJF A;  3LVV A;  5DG9 A;  2WFA A;  3PR4 A;  2YDE A;  2UVW A;  3HB3 B;  4YJ3 A;  2R9R B;  3I76 A;  4KN4 A;  1DRG A;  1PL0 A;  2J6T A;  2KD1 A;  2R8J A;  3NRW A;  1KD1 W;  4C4S A;  1ZL8 B;  2QGN A;  4FS1 A;  3N2K A;  5GTI Z;  2ASD A;  1JAL A;  4QWE A;  3QEA Z;  5D49 A;  3K5N A;  2LBO A;  4NL9 C;  3CPW U;  2DGZ A;  3C2M A;  2ZDI A;  2F3N A;  2F43 G;  2WAQ F;  2UUC B;  5J2A A;  5ALV A;  1J2M A; 
#chains in the Genus database with same CATH homology
 4CRX A;  4YXW G;  1ED1 A;  3WG7 B;  1Y4M A;  1K9M W;  3STL C;  2Q6A A;  4KUM A;  4MTG A;  4BJQ A;  2QM7 A;  2XAG A;  3JD0 A;  2H3V A;  2E1E A;  1W0K G;  2DQ3 A;  3TET A;  3CCR V;  2RHF A;  1FXH A;  1FXK B;  1OCO B;  3SPI A;  2W6J G;  3OR6 C;  1QCE A;  1P4R A;  4OJ5 A;  3CCM V;  3HPL C;  3ZRV A;  3SMV A;  5LGN A;  1H38 A;  3RBZ A;  3K04 A;  2VKQ A;  4QE9 A;  3OAA G;  5IYC O;  1VQ6 V;  3N7S C;  4TT3 G;  3X2Q B;  3IGA C;  3EFF K;  1Q7Y W;  2KEY A;  2EBO A;  1VQO V;  1D8B A;  4UUJ C;  2IJH A;  2XOK G;  4GT1 A;  3H0M B;  3E83 A;  3MHS C;  3ZCC A;  1F23 A;  3W7S A;  3K08 A;  2V1D A;  3K9A A;  3ASN B;  2EIK B;  5FL7 G;  4RAI A;  3W7T A;  2M0N A;  2WSS G;  5KA6 A;  4JMU A;  2LHT A;  4ACO A;  1K5S A;  2ZIU A;  4OJP A;  1OCZ B;  3DTU B;  5C93 A;  4DO2 A;  3E35 A;  2ZD9 A;  1DTO A;  1L1F A;  3ICX A;  3ZMZ A;  3OMN B;  4GX0 A;  2DQN B;  2G0A A;  4MVS A;  4U7C A;  3CP1 A;  1NVP D;  2W7P A;  1E79 G;  3FB8 C;  4OXS A;  3ABU A;  3JD4 A;  4U7O A;  5KUM A;  5IY5 C;  1PNK A;  3OM3 B;  4C0Z A;  2KV2 A;  4Q20 A;  1R3L C;  2K4I A;  2EZO A;  2ITD C;  4U7N A;  1E1R G;  2Z3Y A;  3LSQ A;  4FJC C;  2MK3 A;  2HJF C;  4G27 B;  5CMU A;  3ABL C;  3ZIA G;  3E8B A;  4X88 A;  1ARO P;  2WLL A;  2ZR2 A;  5LHH A;  4BAY A;  2Q67 A;  5L3B A;  4QJF B;  1DF5 A;  5LHG A;  4PDV A;  1A6S A;  3FYI B;  5EBL C;  3QO8 A;  4R7C A;  3STZ C;  5KL8 B;  5CN0 A;  2Z7J A;  2JH7 A;  2ZIX B;  3K0D A;  3ETD A;  4HAM A;  2KJ8 A;  3SAG A;  3CCU V;  1FXK A;  1GO3 F;  1S0V A;  5L3E A;  2Q4T A;  1M56 C;  3I56 V;  2LFS A;  1YJW V;  2XI9 A;  1EFR G;  1Z1B A;  1NBM G;  2E5S A;  1CPY A;  3I55 V;  3SAF A;  2F77 X;  4PA6 A;  3SYC A;  1KP3 A;  1S5H C;  3B8M A;  3OEH G;  5EC2 C;  3OW2 U;  4XDL A;  2OTL V;  1QR9 A;  2BOC C;  3JCZ A;  1R3J C;  4JAV A;  1KC8 W;  2HBL A;  3PSF A;  1XO0 A;  4GX1 A;  2G07 A;  2KNJ A;  2XAS A;  2IH3 C;  3GB7 C;  3QO7 A;  2G5H B;  4QIW F;  1R6N A;  1VQM V;  2PI5 A;  1J95 A;  2WAM A;  4GX5 A;  3ZN1 A;  3SPH A;  2HBK A;  1K92 A;  4PDL A;  3F2D A;  2D3O W;  1I5X A;  2DYS C;  2ZXH A;  2KVC A;  3K1Z A;  2QA4 V;  4GCZ A;  3GZF A;  4UVA A;  3CCJ V;  4JTC B;  2RRD A;  4JTA B;  5E1A C;  2F76 X;  1PNM A;  4OJL A;  1NR1 A;  4PA7 A;  1IIP A;  2C2A A;  2IH1 C;  3F5A A;  3F2C A;  2CN1 A;  1ORQ C;  3AL0 B;  5B1O A;  5KUK A;  3F5E A;  3JD3 A;  1HEK A;  1NQT A;  1V55 C;  2W6I G;  2JDI G;  1QVG U;  1M57 C;  2WB1 C;  2EIN B;  2LYA A;  2JK5 C;  4TSF G;  4CBC A;  2ZXW B;  1KP2 A;  1OCR C;  4P0Q B;  1R3I C;  2W04 A;  1PKX A;  3K79 A;  4H33 A;  2CPR A;  2HMX A;  3H0L B;  3AQF A;  4MVZ A;  3AEI A;  5B1B B;  5BZB A;  1UJW B;  4PA4 A;  2JEU A;  3LYS A;  2HOF A;  1AR1 B;  3CCS V;  2K8B B;  1KBU A;  2A3V A;  1RM1 B;  3QNE A;  1SZT A;  5L3C A;  4XDK A;  2H94 A;  2Y69 B;  3SJQ C;  2YB1 A;  3K03 A;  1L6N A;  3LDE A;  5H6R A;  3ABM B;  2KHV A;  3HKZ F;  2X6A A;  1VQK V;  1R3K C;  1HWY A;  2HG5 C;  2LFR A;  3WFV A;  5EBM C;  3MGV A;  1COW G;  2DW4 A;  3W7W A;  3JD2 A;  3F7Y C;  2GHY A;  2CK3 G;  3E8G A;  5B1A C;  2ZDI C;  2EIM C;  2YB4 A;  3TK1 A;  3T79 A;  4PA3 A;  3LSS A;  3CXC U;  5LGT A;  2ZIX A;  4RQE A;  4ASU G;  4CDG A;  1S76 D;  1K73 W;  3OMI B;  3ABK C;  2FTK A;  2Y0S F;  1ZQ1 C;  4MVM A;  4FZN A;  2EZP A;  1OHH G;  3ETG A;  1QBZ A;  3AG3 B;  2G08 A;  1Q3U A;  4R8C A;  2Q68 A;  4OJO A;  4UVC A;  5IDJ A;  3CCV V;  3FKS G;  1ROP A;  2HVJ C;  1W0J G;  3GU3 A;  4H37 A;  2H3I A;  4DXW A;  4UV8 A;  5CBH A;  3PSI A;  1R6K A;  3CP8 A;  2JEX A;  2YSU B;  3ABT A;  1S77 D;  2OTJ V;  2R18 A;  4QE7 A;  2VJ5 A;  3TCU A;  2WLL B;  4JGS A;  4U6P A;  3SYA A;  2DF4 B;  1Y66 A;  2DYR B;  2HR3 A;  2NNU A;  4P9P A;  4BIU A;  2MRL A;  2V7Q G;  2WLM A;  2X6B A;  4RQF A;  2EIJ B;  4OJ6 A;  4WJ3 B;  3OGC C;  2ATK C;  2EJR A;  2JJ1 G;  4QNH B;  3CRX A;  1IXM A;  2QTO A;  4MT8 A;  3A0R A;  3KZX A;  4WFF A;  5HR6 A;  3OFN G;  4NV0 A;  1F4M A;  2B1G A;  2OXO A;  1AJQ A;  2JIZ G;  4FZM A;  2X7R B;  1CEZ A;  4N21 A;  2QKS A;  1PVQ A;  2K4H A;  1URJ A;  2KIC A;  5B3S C;  4LC1 A;  1AI5 A;  2OCC C;  2XAF A;  4NLB A;  4WF9 V;  4IC9 A;  4XDJ A;  4LCU C;  3T1C A;  1NH2 B;  1Q82 W;  1T94 A;  1K5Q A;  3IP4 B;  3FB7 C;  3M7D A;  1K7D A;  2IJJ A;  1AI7 A;  2ZG6 A;  3E8H A;  1UPH A;  4XBF A;  3LDC A;  5B1N A;  1V55 B;  5EBW C;  1YIJ V;  2UXX A;  4P0Q A;  1ZWI C;  3AG2 C;  1K34 A;  1XL4 A;  3IG8 A;  2LKY A;  2NLJ C;  2XAQ A;  3AG4 C;  4LBE C;  3CC7 V;  1OCC C;  1W2B U;  2OYY A;  2G09 A;  3CC2 V;  3F5W C;  2PMZ C;  1SES A;  3D2N A;  3LVW A;  1GKF A;  4FIP C;  2LP7 A;  2K4E A;  2KJ5 A;  2EIL B;  2JMG A;  2IJI A;  4UXN A;  3CCL V;  2R9I A;  2A0L A;  2E1F A;  2P90 A;  1V54 C;  3FB5 C;  3M99 B;  3RVZ A;  3CCE V;  2H3F A;  1YTF B;  4PL2 A;  1YJN V;  5CBF A;  2A9H A;  1CRX A;  4E2L A;  5HFL A;  3AG1 C;  4FPP A;  4GFJ A;  1THZ A;  2EIM B;  3RF9 A;  2Y48 A;  5HFM A;  3ZMV A;  1CP9 A;  4PDR A;  1TUE B;  3WG7 C;  1SRY A;  4O3M A;  3CMA V;  2P6J A;  3CYO A;  1NZB A;  4HZ3 A;  4JYB A;  2NV3 A;  4JAS A;  4R6Z A;  1FXK C;  3OUF A;  3ZJZ A;  3PST A;  3SAH A;  1XL6 A;  3W7U A;  1M90 W;  3SPJ A;  2PI4 A;  2ZIW B;  1KQS U;  4P2Z A;  4JAU A;  4QPJ A;  3PSP A;  4PA9 A;  4J9Y B;  1JPX A;  3ZRX A;  3D3I A;  2B1I A;  2OT5 A;  4AYB C;  2WAQ C;  1MOF A;  2QE7 G;  4MVO A;  3SQI A;  3ZMT A;  4MS2 A;  5L3D A;  3G6E V;  2ZXI A;  2HKO A;  1NH2 D;  1PVR A;  2IU0 A;  1SZH A;  3SYP A;  3LDD A;  3BEH A;  2YEV B;  1GK9 A;  2QM8 A;  2LYB A;  1JOY A;  3ZMU A;  1QR8 A;  4F4L A;  1VQ9 V;  4Z1M G;  3M6K A;  3W7X A;  5T14 A;  1VQ7 V;  2EIK C;  1F4N A;  1FXV A;  5B3S B;  2OCC B;  1JCH A;  4FK5 C;  4R50 A;  3E8F A;  2Q69 A;  3DEE A;  3E86 A;  5IY5 B;  1VQ4 V;  4P30 A;  2HFE C;  3JYC A;  3D2S A;  1VQL V;  3C29 A;  1G4Y B;  1H8E G;  3VC8 A;  3FB6 C;  2HBM A;  1MA7 A;  4G2K A;  4I5S A;  4FE3 A;  5LHI A;  3OUS A;  1QVF U;  3AG2 B;  1GM7 A;  1YT3 A;  1YTF D;  3F7V C;  1WUD A;  3E0F A;  3ZN0 A;  1OCC B;  4I9W A;  3ABL B;  1FS0 G;  5J9P C;  2XAH A;  1NR7 A;  2KKP A;  2AHZ A;  1GMG A;  2YX8 A;  4WCE V;  1K33 A;  2XAJ A;  4JF3 A;  3UKM A;  1VQ5 V;  2WWW A;  4A8E A;  3H0R B;  1YSC A;  2P7T C;  5DM6 V;  3E89 A;  2ZR3 A;  3CME V;  2IJK A;  1V54 B;  3E2E A;  1Q86 W;  3AQE A;  3OE7 G;  2HVK C;  4MSW C;  2JGA A;  4RUE A;  5EK0 A;  3D2Q A;  1P7B A;  5L3G A;  2BDU A;  3R65 A;  1M56 B;  1AI6 A;  4RUF A;  2OM6 A;  3OPX A;  2WPD G;  3P32 A;  2K89 A;  2VJ4 A;  1K97 A;  4JTD B;  1YJ9 V;  4X89 A;  5C0Y A;  4BW5 A;  2XID A;  3MD0 A;  5KL1 B;  4PL1 A;  3ETE A;  4X8A A;  1N8R W;  2H3Q A;  1AI4 A;  4KP4 A;  2W03 A;  4MTX A;  1M1K W;  1EZJ A;  2ZIW A;  2X0L A;  1PNL A;  3IC7 A;  2BOB C;  4P9O A;  1OUQ A;  4BX9 C;  3SPC A;  5GW7 A;  1S72 V;  3L3F X;  1KEC A;  4QNL A;  3T4Z A;  1BL8 A;  2GOL A;  2KIW A;  4FZL A;  3CD6 V;  1BHB A;  4WFH A;  1H2G A;  4ZKI A;  3MHH C;  1GM9 A;  3RW0 A;  2ZIV B;  2WB1 F;  2DYS B;  2WLN A;  5CA3 A;  4KMO B;  1NKD A;  5A0L A;  2WLH A;  1F51 A;  3UM7 A;  5LGU A;  1SER A;  1KKD A;  2HBJ A;  2HOI A;  2KB1 A;  4N23 A;  2DQ0 A;  2MA1 A;  3OEE G;  2H3Z A;  1P7D A;  3D36 A;  5H6Q A;  4CZZ A;  2IU3 A;  2YEV A;  5CBG A;  2RP5 A;  1BMF G;  2DWD C;  3KG2 A;  4FMT A;  3JD1 A;  4PDM A;  1MG1 A;  4GX2 A;  3QO5 A;  3DGE A;  3N7P D;  4ZBM A;  2WLK A;  4KX5 A;  1PVP A;  1I5Y A;  1QLE C;  1K4C C;  4NLC A;  2G5I B;  2K8C B;  1HIW A;  2ZQM A;  4MVR A;  1M57 B;  1Q3V A;  3ZRW B;  4WFG A;  4MW8 A;  3VBB A;  1OCR B;  1RPR A;  3ASO C;  3B8N A;  4QIW C;  3ML0 A;  3CCQ V;  2W0F C;  4QPK A;  2VIX A;  2WLI B;  3OMA B;  3ONN A;  3PZP A;  4P0P B;  2EIN C;  1YI2 V;  2XVT A;  2UXN A;  2N1R A;  2ZXW C;  4PEL A;  3PJS K;  1K3E A;  4MTF A;  3BY6 A;  5H9C A;  4WFB V;  2W7O A;  2X6C A;  1MSW D;  1OZ0 A;  3M6Z A;  5B1B C;  2KOB A;  3LUT B;  1RM1 C;  3ZRS A;  3FYE B;  5KA5 A;  5B1A B;  1B6Q A;  4J9Z B;  2GH1 A;  3IFX A;  1DF4 A;  2Y69 C;  2F8L A;  1SET A;  3H01 A;  4G28 B;  2H8P C;  3F53 A;  4UVB A;  3ABM C;  5L3F A;  1Q81 W;  1K8A W;  4JYC A;  2HOQ A;  1NJI W;  1VQN V;  3ABK B;  4ICA A;  1F44 A;  2G06 A;  2HLD G;  1DLB A;  1OCO C;  4BIZ A;  2A79 B;  1JVM A;  2F2A B;  4WFA V;  2OH2 A;  2JH1 A;  2AHY A;  2P67 A;  5IYD O;  5HR7 A;  3RVY A;  4NWI A;  2GSM B;  1K4D C;  4MVQ A;  1JJ2 U;  4JPR A;  4KFM A;  3O0F A;  2JJ2 G;  2JHD A;  2CRX A;  2D6F C;  2WLJ A;  3K0G A;  3OR7 C;  2XND G;  3AG3 C;  4HYO A;  3SPG A;  5IYB O;  3G71 V;  3T4D A;  3VCB A;  4MTO A;  2KJ9 A;  3X2Q C;  3SYO A;  3HKZ C;  2ZIV A;  1MAB G;  1TAM A;  4UV9 A;  2K8A A;  3IN5 A;  4EKW A;  1Z19 A;  1RPO A;  3F2B A;  3N7R C;  2DYR C;  4LP8 A;  2M7W A;  1VQ8 V;  3T2M A;  1G8M A;  1JX9 A;  2KHQ A;  3ASN C;  3EHB B;  3SYQ A;  1XNS A;  2EIJ C;  3RFA A;  2PMZ F;  2KKV A;  4KX3 A;  1YHQ V;  4L87 A;  3IG5 A;  1WPX A;  2K1E A;  3ZMS A;  3NUQ A;  2Y0S C;  4BUG A;  3KFU F;  1OCZ C;  3G4S V;  2QEX V;  1GM8 A;  1LNQ A;  5EC1 C;  1H8H G;  2ZIU B;  1AJP A;  1ENV A;  4OO1 J;  4MVU A;  3ALR A;  1R73 A;  3K06 A;  3B77 A;  3LNM B;  3NXS A;  1QLE B;  3VOU A;  5LBQ A;  2XIC A;  1YIT V;  4TWK A;  3LVV A;  3ZRW A;  3P30 A;  3HB3 B;  2Z5U A;  2R9R B;  3AG4 B;  3C28 A;  1DRG A;  3ASO B;  1PL0 A;  2WLI A;  1A0P A;  2KD1 A;  1BHA A;  1E1Q G;  3CC4 V;  1VQP V;  4MW3 A;  4P0P A;  4RO2 A;  4WFE A;  3NRW A;  1KD1 W;  4CGZ A;  1S3J A;  2IW5 A;  2DWE C;  3GWO A;  5DN6 G;  1NVP B;  1PD3 A;  1AJN A;  3K3W A;  2LBO A;  3CPW U;  2DGZ A;  1FFT B;  1GTO A;  1WLE A;  2ZDI A;  1ECW A;  1JQ0 A;  1EBO A;  2ITC C;  4AYB F;  2WAQ F;  1M9N A;  5CRX A;  2B5U A;  2EIL C;  3CYM A;  2F43 G;  3AG1 B;  1QLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...