1GO3F

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
MIGKKILGERYVTVSEAAEIMYNRAQIGELSYEQGCALDYLQKFAKLDKEEAKKLVEELISLGIDEKTAVKIADILPEDLDDLRAIYYKRELPENAEEILEIVRKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 33
structure length 107
sequence length 107
chains with identical sequence N
ec nomenclature
pdb deposition date 2001-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1go3F01
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1go3F02
2RHFA 3SAFA 2E1FA 2KV2A 4NLBA 2DGZA 5C0YA 4CDGA 2RRDA 4NLCA 1D8BA 4QJFB 1GO3F 1YT3A 4OO1J 2HBMA 2E1EA 2CPRA 3SAHA 2MA1A 2HBJA 3CYMA 4QIWF 1WUDA 3SAGA 4O3MA 2HBKA 4CGZA 2HBLA
chains in the Genus database with same CATH superfamily
2KZ3A 5J2TA 3CPWU 1ZQXA 5D4BA 4EFBA 2PTMA 4FIPC 4WBNA 3E35A 2UXCB 1RPRA 5DGBA 1IXMA 4U3JB 4RQMA 4J9RA 3BEHA 3JPSA 4HAMA 2KSOB 3FFQA 4DK1A 1WAZA 2LGQA 2KN7A 1F44A 1QU7A 4TQRA 4LF9B 2XC9A 1SS3A 1ZRNA 3DDHA 3WK9A 4ECVA 1HNXB 2R8IA 2LQTA 2W03A 1XNQO 9ICMA 4DO2A 3SQIA 3RB0A 1GN4A 5J2HA 1I94B 1SGGA 3K1ZA 3MC1A 5JUMA 1GK9A 3H1LH 4ZI7A 1XOUA 1P84F 1SF9A 3MBYA 4FZMA 3N28A 1L1FA 3BQ1A 3Q8LA 4YN4A 2P90A 2XGQA 3JAWA 4UASA 5J2TB 4YR2A 4KLLA 2E8PA 2ZDIA 2XUMA 4WBNB 1V55B 1EN4A 1V55C 3ABTA 5LMNO 2Y1JA 3BPZA 5L1JA 1NBMG 2DPJA 2UVRA 3M9MB 1PKXA 1FEZA 4RPZA 2CPRA 2VKQA 5J0WA 2ZM6O 2R8KA 3EXAA 2LHTA 4I55A 1H8EG 1K8AW 4UB1A 1KP2A 2WAQF 3F7VC 2ZXHA 2EAMA 3C29A 1BHBA 1N62A 2Y0SF 5EWFA 2FJ6A 2IOFA 2JGAA 1I7FA 4KMOB 4B9MA 2XAFA 2YIAA 4US9A 4ZI7B 3MHHC 4WFFA 1YJWV 1R6TA 2W55A 2KV2A 3NVZA 2LMRA 4PELA 5C0YA 4C7ZA 2JEUA 5KL1B 2JEJA 3JAWB 4DF8A 2DN9A 2ZDIC 4I9QA 2EIMB 2EIMC 2I5HA 4H37A 4F50A 3PW0A 5BOMA 3HW8A 4MVMA 2CK3G 3WKCA 5AM5A 4LR3A 3QE9Y 5AIAA 4GIBA 4I55B 3C2MA 1X40A 4TV8A 1SZHA 4PL2A 2CXYA 4P2ZA 2KG7A 3WKAA 4JI5O 7ICRA 2I6XA 3E0FA 5HP4A 1ZQKA 1WPXA 3TXSA 2F1JA 1P49A 1SV0A 5C5JA 5CBHA 4M2YA 4Y2QA 4FFKA 5DN6G 4PHEA 3O0FA 4ZBMA 3IV6A 2YIBA 4FJCC 5EC2C 1H2LA 5EWEA 3RN4A 1F5SA 2RN9A 4TSFG 1D2DA 3K5OA 3M6ZA 4J9SA 2ZD9A 4O2AA 9ICIA 3JAKA 2XHBA 7ICJA 3KZXA 4CC6A 1JPXA 3HKDA 4NKGB 5JJEB 2NRXA 2JZBA 1YI2V 2WLHA 1N36O 2A3QA 3LVWA 2IOFK 4TV8B 5J29A 3OJSA 5KFUA 1Q8IA 2KG7B 2ILMA 1Q46A 3ED5A 4PHDA 3HILA 5IJ9A 1SV0C 2DYSB 2DYSC 5IYCO 4NLZA 1AR4A 4R8CA 3K1RB 5JH7A 3JCZA 3N2GA 4ED6A 4XBFA 1FAFA 2IBKA 3D8CA 4YHHO 5DDMA 3ETQA 7ICFA 3NUQA 3IC9A 4JI8B 4B3MO 3KHLA 2E5SA 4JZGA 1SL0A 3NXSA 1IBLO 4QWDA 2BCQA 4O2AB 3GU3A 3JAKB 4BIZA 1M1KW 2KNJA 5DDYA 4O4IA 1AILA 4M9GA 8ICLA 1SXDA 4J9MA 2JZBB 1KKCA 2KICA 1NZ6A 3HKDB 5ALRA 4I2FA 4DS5A 1ZL8B 3Q8SB 1Z4NA 2BCSA 3SPIA 2IJKA 5DB7A 2KTQA 4JI3O 3CHXA 1ZQUA 1CXZB 1BGYH 1VQOV 4JPRA 5IJ9B 1AR5A 3AM9A 2P66A 3QUQA 1V54B 1WWUA 4B9UA 4ZOHC 1V54C 1NK4A 2HKOA 5IYBO 5JH7B 3OPXA 4EYIB 3N2GB 5IINA 2A1AA 2ZE7A 2LKYA 1RPOA 4KHPB 5EYPA 1XSNA 4DQRA 1BL8A 2W7PA 4IQWA 4BR6A 5ALOA 2OIGA 4QWCA 4ED7A 4J10A 5DQHA 5J2CA 2DYRC 2DYRB 1S76D 2JJ2G 4O4IB 4ZH4A 2Q5ZA 3CWBH 4RNOA 3ZDDA 2W3RA 3J81N 7ICUA 1JIHA 4DRXA 4IQTA 1OCCC 1OCCB 2RNBA 2JJ1G 2IH1C 4CC5A 1Q7YW 1KU9A 4DR1B 4B9SA 3RJJA 3TGUH 3FAVA 1N63A 1GO3F 4GKJO 1NJWA 1SC5B 1K3EA 5F9NA 3EFFK 1HEKA 2UUBB 1JXLA 4FZNA 2ZINA 3CCMV 4CF3A 2GSMB 2EILB 2EILC 1NZPA 1NQTA 1WP8A 4LFCB 1IURA 1MSWD 4UAUA 1ZQSA 1XSPA 5KFOA 4B3TO 4J7ZA 2DE0X 2N1RA 2RHFA 2XASA 4NM1A 2KKPA 4DRXB 2E1FA 5LGTA 4N23A 4PHPA 1J5EB 5EE1A 2NR5A 4NXNO 3PSPA 5H5NA 1U48A 5F3XB 2WSSG 2QWNB 1TK8A 4DV2B 3BQ7A 3FAVB 2YICA 2F3NA 1QSLA 4O3OA 5AM4A 2UXDO 4YMMA 4DR5B 4Q6GA 3RT3C 4UV8A 8ICIA 2WB1F 5CA7A 9ICPA 4US8A 2DFLA 1ZQAA 2WAMA 5KHKA 5IILA 2XT9A 1JXEA 1Q86W 3IGAC 4ELVA 3SJQC 3RH5A 3QEBZ 4DV4B 4U7OA 2HHWA 3T5LA 4BUGA 1FXKA 1H2GA 4P2HA 5B1OA 2VA2A 3UKMA 4MTXA 2QEXV 1SL2A 4B7KA 1N33B 3RJIA 4B9LA 3AQEA 1M5IA 1ZQIA 3QNEA 1A77A 5LP6A 1VMGA 4X64O 3BQ2A 4DR2B 2ZKOA 2Q69A 5KX5A 1XNRO 1N5WA 2VQEB 3GIJA 2Y1IA 2H3ZA 4R50A 2H94A 2BR0A 4ED1A 1BS3A 3V7JA 1SWVA 4Y2XA 3ZDCA 2ZE6A 5B1AB 5B1AC 3PJSK 4WF9V 4HNAA 1NNLA 2B0CA 1HP8A 5AKKA 4W4LA 2HOQA 5J0UA 3MGVA 1FXKB 1FXKC 1EZVH 1XBLA 4Z6EA 4DFDA 4GKKB 2G07A 2FI1A 3AG2B 2KQXA 4CE6A 3AG2C 3D36A 1VLBA 4BXOA 4I4TA 2HDOA 1Q6IA 2YI9A 5LP6B 5LP6C 1X6JA 4X5VA 4JZ2A 4QE9A 3FAHA 5L1IA 3IDWA 4FLXA 3D2QA 1DK2A 3RVZA 4UV9A 4NLNA 1XSLA 3NVYA 1TVAA 5KX5B 3CCQV 4ED3A 5IT9N 4Y2PA 2H5XA 3APQA 1FS0G 3UQ0A 1DGSA 5BPCA 1NH2D 4ZHQA 4F4WA 7ICKA 2E3TA 4HNAB 5ALLA 3BABA 4JUZA 1JQ0A 2ZUBA 2ZIUA 3H40A 2DGZA 3ZD8A 3TFSA 8ICSA 3HKEA 5CEHA 1FJGB 4TUQA 2VIXA 4QJFB 2ZTDA 3HKBA 3AMZA 1YVWA 3D36C 4BXOB 4I4TB 5EC1C 2NRZA 1RM1B 1RM1C 4DK0A 4NXMB 3E8BA 2LJ2A 4RQFA 3ZHQA 4CNQA 1TK0A 1ZQLA 2XGPA 3FYEB 1F0MA 4DR7O 3MR2A 7ICVA 1BNPA 1R3LC 7ICQA 5D46A 4KXRA 4FM0A 4ZHQB 4DR3O 3AK2A 3H7IA 4I28A 8ICEA 2GTAA 4RQ2A 4PDRA 1RP3B 3G6VA 1YCIA 4Y2JA 1ZQBA 5F9LA 2Y69B 2Y69C 3SYOA 1X66A 5KFXA 2D2CB 2F4VB 5ALMA 4DV6B 3HKEB 3OMAB 5KT6A 4WCEV 3KZIU 1YT3A 4NWIA 1TAMA 2DOSA 2R9IA 2RP5A 2EIJB 3I76A 2EIJC 4RUFA 2BTQA 4DR4B 2AQ0A 1U9LA 5KL8B 3CD6V 4FLUA 1BCCH 4QIWF 3SD7A 3H9VA 2F95B 5CB4A 1EBOA 4DV7B 1SZXA 3RR7A 4J9PA 1HNZO 1Q3EA 5ALUA 4PDMA 5DKWA 1Z00A 2HP8A 2HBKA 5AKXA 4Y2VA 2UVUA 2HFEC 3ML0A 3RFRA 1XILA 1S72V 3ZDEA 5LBQA 3SYZA 1D5AA 4F2SA 5J0PA 4C7UA 5GW7A 3B9JA 4DV3B 3T1YO 5AIBA 1TKDA 1C7YA 2WLLA 1IBMB 4F5RA 4C8KA 2DBYA 1SWWA 2B1GA 3QU4A 3ETRA 3OGUA 3O65A 3V6HA 3SAHA 4Y2UA 3SYQA 2BTQB 4HAIA 2HLDG 4P4OA 2KHQA 5AKZA 4YMNA 3H4BA 4RWUA 1L7MA 3M6KA 5KFNA 2JMGA 2ATKC 2EX3A 4LH6A 5CB4B 4F4ZA 4YFKA 3EYZA 2GH1A 2KP7A 4O3MA 3CP8A 5FPOA 3RYIA 3SPJA 2ASJA 3B0YA 1W59A 5DG9A 1F51A 3RB3A 4DV5B 1ZQZA 1ORQC 4PZOA 4XUSA 2QKAA 1N5XA 1HJPA 3OSPA 5KFSA 1XO0A 5IJ0A 5DBBA 1Z00B 4KLHA 3EUB2 1X4TA 4LZGA 2V4QA 1SQGA 4X88A 2QM8A 2GOLA 4FZLA 4JAUA 1T7PA 2NO5A 4DXWA 2ZT9B 3WB1A 3BS7A 2WLLB 3T2MA 1JCHA 3R66A 4HZ3A 3BFRA 1S0MA 4B6JA 5KFFA 3M1YA 3TACB 1TV9A 5C8YA 4X62B 1YIJV 1PNKA 7ICMA 2KJ5A 5KAFZ 1VQ8V 3W7XA 1WUDA 5ALIA 1Q90D 1XEQA 3CRAA 3IJ4A 2XO7A 4IHJA 3RYIB 2DMXA 4BGDA 3DC6A 2F43G 4DOAA 2IHMA 4MVZA 4Z6CA 4E4EA 2BDPA 5IJ0B 2F66C 2R8JA 2EZOA 4Q20A 5KA5A 5DQIA 3JATA 3HB3B 1X59A 2VWJA 1BQZA 2P6RA 4KLQA 4K3AA 2W04A 2P6JA 1FXVA 3U11A 5C8YB 4KLIA 1KFSA 4OX9B 5L1LA 1CP9A 1N2XA 1EXNA 3F7YC 2KVCA 1XS9D 2HJDA 1OXJA 2YEVA 3CRRA 2XCPA 2QWQB 1ZETA 2BOBC 1KKDA 5E79Z 2WLNA 4IHJB 4ZIBA 4LF5B 2R18A 1QHTA 1BPDA 1YZ6A 3SV3A 2OIEA 1DK3A 1H8HG 3QO8A 1YDXA 4MHVA 3MFHA 1QLNA 1Y74A 3M9OB 4QWAA 1BPYA 3OUFA 4G27B 4I2EA 4LFBO 1JRPA 2Z7JA 3JATB 4Y2TA 3SZ2A 4I2BA 4QWEA 1HW7A 3CYOA 1K33A 5H6QA 2P4KA 3TANA 1BZKA 3QZ7A 3RFAA 1NJYA 1Q81W 4P0QA 3M9NB 4UB6Z 4X1KA 1PVQA 1U4BA 4KLFA 4Q45A 4LBEC 5HR6A 1QR8A 1QQCA 4UB6U 4OXSA 4MVUA 1M9NA 5KFCA 2UXCO 1NK7A 3KD3A 3OHAA 2VA3A 4CRXA 1JMKC 4X1IA 1QH9A 2YMMA 5KG6A 5L3GA 1Y74B 1F4MA 3T5HA 1JFFA 1JOYA 3CP1A 3QU5A 2IA6A 1UFIA 4CS2A 2CUGA 4KLUA 4LF9O 1O9HA 5GONA 4AYBC 2VS0A 5KG1A 1PM9A 4CH3A 1S8OA 4UBBA 1HNXO 5AM3A 5ALZA 4C80A 1VEWA 4IGGA 4XRHA 3WKEA 2PYLA 2AU0A 1I94O 1L5UA 4P0QB 4X1KB 2Q7EA 5J2EA 2KZZA 4K4GA 3TJTA 4UW9A 2IH3C 1L0NH 1N32B 3CXCU 2UXBO 1SQBH 4PZNA 3GIIA 3OEHG 5AI6A 4B3RO 1Y66A 1PK3A 4Z1VA 3VQYA 1WB7A 2JEGA 3KKAA 4MTOA 2Q9LA 4DWIA 4X1IB 4DL4A 4RU9A 3BCCH 3I55V 4AILC 4X1YA 2IW5A 1YJ9V 3IFXA 1JFFB 4EFEA 1KP3A 4YMOA 2ZCEA 2B21A 2HHTA 2A1JB 4PV1B 5EZYA 3RB4A 5GONB 4QZHA 1KB9F 9ICUA 1US6A 3J80N 4DYLA 3A8TA 1VIBA 3ZCCA 4BDPA 2X7RB 1OJHA 4JMUA 5AK6A 9ICAA 1DOQA 2P5OA 4O9MA 4R64A 4P9OA 2YX8A 3QUTA 2DQ0A 3C1ZA 3PMNA 5EIBC 2C2EA 4DFKA 2XVTA 2L35A 4JYBA 1V38A 9ICBA 3TXQA 4C8OA 4TWKA 3Q8QB 3P3PA 1UQVA 1ZQDA 5TZVA 3KKAC 9ICOA 4DSLA 3UXOA 4TURA 5B5EU 1SKRA 4PL1A 3CCLV 5LL6Y 1MNGA 3GV5B 2YC0A 4X1YB 2DJVA 2QWPB 1NT2B 2QDOA 4MTGA 5EZYB 4TUPA 5D5QA 1MSDA 2OTLV 5DLFA 4X89A 2YB4A 4DSKA 3G6YA 4IC9A 3NVWA 3PY8A 4FFDA 3QZ8A 5KFKA 4RQ4A 1JI7A 2E76B 4KLTA 3CS5A 2EQYA 1R1BA 4YXWG 5D49A 1NTMH 2BTOA 4JGSA 1MQ2A 1RQNA 2WTFA 3SMVA 9ICEA 1RG6A 3Q8RB 4QW8A 5CHGA 1S0NA 2XIDA 2Q0OC 5J2KA 4ED8A 1L3VA 2E8OA 4LFAO 4OD0A 5AK3A 1XMQB 3G71V 4FLWA 5KFYA 1NJZA 3ISBA 2HSZA 2HVKC 5IIJA 3AG1B 3AG1C 1YEWA 2KIVA 3WKBA 3JPPA 3H0MB 3D3QA 4NM2A 4M9LA 1VQLV 4DO9A 3FD9A 4J80A 4O3NA 5L3EA 1Q82W 2JEXA 3SPHA 4JI6B 1Z5VA 2C2DA 3CCJV 4JI2B 5IWAB 3AG7A 3J7AU 4TQDA 2EZXA 5HHHA 1X9WA 2W9CA 1BVSA 2ZNIA 1A76A 4LJXA 4W4KA 5CMUA 2G0AA 3EVKA 2KOBA 2XAQA 3AK3A 4QZIA 3OR6C 2LM1A 3ZHTA 1JA8A 4TV9A 3LWMA 5KNIA 2A9HA 3KHRA 2BQUA 3E89A 3F5WC 4YY3B 3G6EV 4B3SB 3DSQA 2DQ3A 4O0IA 3HKCA 1NI3A 2YUAA 4X66O 1B6QA 3IAYA 1GMGA 2YIBD 1WYGA 2F93B 3FB5C 4X20A 2OH2A 3RYHA 2R9RB 1KUQA 4QZDA 4IR9A 2W9CB 1W0JG 9ICHA 4MVOA 4KHPO 2KB1A 2ES6A 1KYOF 5J8YA 4DSFA 4F4YA 3RF9A 5E1AC 3IN5A 4MT8A 5L3DA 4PHAA 2OCHA 1B4FA 2W0XA 1TVKA 5KFLA 2RCVA 1IM4A 1S10A 2BZFA 3CMAV 1ECWA 4DR1O 2K89A 4YVZA 8ICWA 3CMEV 1RYRA 3HKCB 3BRCA 2X6CA 2PI4A 3RJGA 4X20B 1KFTA 3SENA 2IOHA 2NRTA 2W9AA 1COWG 3ABMC 3ABMB 3RYHB 5KFIA 4F8RA 3SI8A 3ZHRA 1UA0A 7ICGA 3L70H 2R70A 5J8YC 1K34A 1R6NA 3GZFA 2ALZA 2MAXA 4LFCO 2FB5A 3C1YA 3ALRA 3C5GA 1CPYA 4LF4B 1TVKB 4F3OA 3V7KA 1KSPA 2ADPA 2ZXIA 1D9FA 2ZR3A 3SAFA 2BOCC 3QUBA 2H3VA 3G6BA 1WA8A 1X9MA 1D9DA 4EBEA 4DV2O 1L3SA 1VQMV 4J9QA 3UXNA 5CJ7A 1GM7A 3CSXA 3I5DA 1XUQA 1SKWA 1FFVA 2A06H 4R63A 3P30A 4MVQA 3FDSA 3GB7C 5IY5B 5IY5C 2F1HA 5LGUA 3MD0A 4IQVA 5CBFA 3ZX6A 4YP3A 3BY6A 4JI4B 3WU2U 5LXTA 3OGIB 4DV4O 4PPXA 5KFBA 8ICNA 1QNMA 5BOLA 1CUKA 3UT5A 3KG2A 2CE4A 2HEPA 1N33O 5KT7A 5B1BB 5ALQA 3BDPA 5B1BC 4F5OA 1WA8B 4UB5A 4DR2O 3CC4V 1TAQA 2FL4A 5LMUB 2VQEO 3E86A 4H13B 3WKDA 4M9HA 4DV0B 1D5NA 3ZN1A 5J9PC 4MF2A 5B1NA 4AQYB 1GKFA 1Q43A 5KFZA 1PZNA 2NLJC 2YN4A 5ALWA 4RQ1A 3DGEA 5J2GA 5ALKA 1H2MA 3ETEA 3BHPA 3L4PA 4PJ0U 4C0ZA 4O2BA 4YR3A 2PUSA 5J2DA 2F2AB 2OM6A 3RH4A 1I0HA 5LXTB 1ZL8A 3KHGA 4XDKA 2QM4A 4KLEA 1K5QA 4DLGA 4P0PB 7ICEA 3LDAA 3UT5B 4GKKO 1BHAA 4KN4A 4UBCA 1B43A 2MU2A 4CZZA 3ICXA 4G2KA 4QZGA 5H2FZ 7ICTA 2GTSA 5JQGA 2W9MA 4MFAA 1B22A 4MEYA 2J6UA 3PMLA 1ZD4A 2YMPA 5H2FU 1ZQ1C 1ZWIC 2WA4A 4PA7A 1NVPD 2BGWA 4F5NA 3E8GA 2ARHA 3VQVA 2P06A 2E3CA 3F5EA 3HRDD 1AJQA 1OCOC 1OCOB 5J0OA 1AI7A 3N4MB 4LH7A 3WB2A 1PNMA 1WCLA 2KE7A 5BMVA 2AZ2A 4JYAB 1C20A 3CEIA 4HBNA 3RVYA 4F4KA 5CA1A 1PP9H 4RQ0A 3ABLB 3ABLC 5TISU 4O2BB 4I2IA 3H1KH 1QVGU 3C28A 3UXPA 2YTUA 2F23A 5FNVA 1T94A 1FJGO 2A19A 4FBUA 1GM9A 4KUMA 4EEQA 3TADA 2RMKB 1O03A 2KEYA 3ZI4A 3ISCA 3R65A 3X2QC 3X2QB 2CTRA 5JQGB 4DL2A 3KCXA 2KHVA 3L73H 4NXMO 1UA1A 2D6FC 2DF4B 2PMZC 3ONNA 1PNLA 1N48A 1TK5A 3STZC 4GXIA 4JYCA 3MR6A 1LUWA 2RJZA 1JUDA 3QYPA 4CH5A 8ICUA 4FE3A 3BVOA 5BMVB 4P4MA 5IIIA 5CA1B 4D7TA 4C8LA 4U7CA 4K35A 2K4PA 2J6SA 4FO6A 4DV6O 2K4EA 2XY5A 1BE3H 2BCCH 4IIJA 3FM9A 1Z19A 5FNVB 5GTIZ 3IHQB 2EAOA 4E0DA 3TADC 2VJ4A 3Q8MA 1RXWA 2ZE5A 3K3WA 4UCRA 3L71H 4DR4O 3ABUA 4O5EA 3K57A 4K0KB 4M6WA 5GTIU 2HHSA 5EBWC 3VQWA 4I2AA 1NTKH 3RJHA 3IP4B 5H6RA 3JD1A 1KRPA 1NKDA 4AYBF 5LHIA 2ISPA 4I2HA 2KZMA 3UMBA 3JPTA 4UCUA 3LWLA 4EEKA 1XNQB 3HKZC 4KMUA 2R72A 4JB3A 1MA1A 3RJKA 2EBOA 3CCSV 2HBLA 1KEJA 5AI8A 4O3SA 1K4CC 2JV3A 1SL1A 4RPXA 1QCEA 4DV3O 8ICKA 1YITV 2F77X 3I28A 4IIJB 3K58A 1IBMO 2K4HA 2W3SA 4F6RA 5BZBA 5CBGA 2R8HA 4EYHB 2WHEA 5J0QA 2OHFA 2W8LA 4M6WB 2HVJC 2AJQA 2GDSA 2FE9A 1EFRG 5J0RA 4J41A 3GQCA 2BPFA 2JR5A 2Y0PA 3GWOA 4ZOLB 3TARA 4DV5O 3LNNA 2K4IA 5DBCA 4XQ8A 3G67A 2LP7A 2QB1A 2ZQMA 4CGZA 3CCEV 2Q73A 2C2AA 4DL7A 1ED1A 2UU9B 2C22A 3HT3A 2KJ9A 2BQRA 2CTQA 3E22B 3N2KA 3QU7A 3TCUA 5KUMA 2D3OW 4TOIA 4UCSA 9ICSA 4F6RB 4X62O 4RQNA 2E1EA 2A79B 1FD9A 2M9NA 2QR4A 1ZXIA 3BAAA 4Y2YA 2CH7A 4BIUA 5IDJA 1COKA 5AM1A 4Z6DA 3M8AA 2IJHA 2FDRA 1B0XA 3RGBA 5IIOA 3K79A 4UFZA 2W54A 2HHQA 5KFQA 2IJJA 4JI5B 2V7QG 2UXNA 1Y76A 1L3TA 2EULA 4ECWA 3E83A 1HNWB 3KFUF 3RRGA 4JI7B 3ZMUA 2AHOB 3V6JA 4RT3A 1VJ5A 3N2KB 4KL1A 1M56B 1EM1A 1M56C 3RRHA 4G28B 1OUQA 4I5SA 3M8SA 2JS5A 5BXZA 4OX9O 3CC2V 4JI0B 2YXYA 3AG3C 3AG3B 1WB8A 4YXMA 3QEAZ 2CH7B 2FPMA 8ICCA 3JASA 4O3PA 1H38A 3LSQA 4UVAA 3SPCA 3JPOA 1ZQRA 1HDJA 4QZAA 4LF5O 2FMSA 2DKXA 2WF6A 4Q43A 4GXKA 1S0OA 1G8MA 1ZTEA 2VQFB 1Y76B 4GYCB 3RYCA 2Z0AA 4DQPA 4IL6U 4NJ8A 4PH5A 4F5PA 1R6KA 3L75H 2HVIA 3JSLA 5KG0A 1Z1VA 1RPLA 1PPJH 2M7WA 4MVSA 4YD2A 2UUCB 3T1HO 3AG4B 3AG4C 2K8AA 5ALEA 3GFKB 1UPHA 3S3XA 2HJFC 2ASLA 2PFPA 3OTOB 3ZRSA 2HW3A 3L3FX 3L5KA 3PX0A 4LF8B 4BIOA 2HCFA 2RDJA 3K08A 4PA3A 1VF5B 3V7LA 2ISOA 3H01A 3JASB 5ALNA 5AI9A 5J2JA 4CS3A 4LF6O 9ICGA 4JV5O 1JJ2U 2DWEC 4WFBV 3KZIZ 3KOOA 4Z6FA 5DLGA 2JRZA 2OYQA 4JASA 4D7SA 3RYCB 8ICXA 4TQSA 3WG7B 3WG7C 4EEYA 5BR8B 4GXJA 5JTIA 3D2NA 3BQ0A 1V9PA 1SQQH 3CRCA 1ZQVA 1NK0A 2EZZA 1NR1A 4YR0A 5HHIA 1A6SA 1AP5A 3CE2A 4GX2A 3K9AA 4UB8Z 2BKEA 2BQ3A 3FYIB 1N60A 3WB0A 1N32O 3B0XA 3T5KA 4MFCA 1J97A 4UB8U 5KHGA 4MW3A 4Q8EA 3JAMN 5KFHA 3MABA 5DQGA 5IIMA 1A0PA 2VANA 2F1IA 4OGQB 5D5PA 1QQ5A 1WG8A 2BCVA 2LW1A 3ASOB 3ASOC 4QNHB 4UAWA 1ZQMA 2AXTZ 3QUCA 2V9WA 4N21A 4PA4A 5KFGA 2V1DA 4GKJB 4J7JA 3JD2A 4BAYA 1BGXT 2L5YA 2FPLA 1A32A 1TGOA 2AXTU 3EW9A 1KDHA 2JGUA 2O6KA 4TUSA 3K5MA 2CGOA 1VF7A 1AROP 2EJ7A 3K0GA 1XMOO 3T5JA 4LC1A 2Y9UA 5DB8A 1KW4A 3T3FA 2XICA 2E5LB 1IX9A 2WF7A 4B3TB 3F2BA 1KFDA 4QZ9A 4NTXA 5FLXN 4FLTA 5KT4A 2IHNA 5JRTA 2YMLA 5AHXA 3MDAA 2PXIA 4E2LA 4DUZB 5J2UA 4I2GA 4UVBA 3BS5A 3H0LB 3DEEA 4USAA 5J0TA 5CRXA 1ZUQA 2E74B 2F1MA 3H1JH 3P32A 3D6JA 4LCUC 4DR6B 2D8CA 4I2JA 4BJQA 2CGNA 2LGWA 3CYMA 4QZCA 4WFGA 2M0NA 4FS1A 1CI4A 1LKYA 1Z4OA 1WLEA 4DQQA 2ITDC 1X9SA 4RNNA 3EZ5A 1Z1BA 3B09A 3N7PD 2GWSA 1OCZB 5KFJA 1OCZC 2YB1A 2LM4A 1RSOA 5KAIU 1YSCA 4BWAA 4YJ2A 3QXGA 1K4DC 3N27A 3Q8KA 3ASNC 2WLKA 3ASNB 1IDSA 2F8LA 1NI8A 3ZDAA 4O3QA 3TFRA 2UVVA 1X6IA 4LZDA 3UO3A 4QZEA 4AHCA 2ZIOA 1G1XB 1N34B 3LSSA 1YZBA 4ICAA 4JYYA 5AG2A 5J2UB 4I2DA 5ALJA 3BS5B 1X9XA 4RQ7A 2JEIA 1NJIW 4KITB 2LO1A 1XNRB 1VQ5V 2OXOA 1S97A 5ITZA 4CF5A 2PFQA 3W7UA 2PF4E 1LKYB 1TA8A 5KFMA 4JI6O 3NASA 3PR5B 3QF7A 5JJJB 5A0LA 4ED2A 8ICVA 1ENVA 4OJ5A 4JI2O 1ZQCA 5IWAO 1RSOB 5KFRA 1JVMA 2ZJ5A 4YJ2B 4NTYA 3OTFA 3CCRV 1BT8A 2EDUA 3T79A 1G4YB 1CEZA 3H8JA 4DQSA 3U0ZA 3F5AA 4OJ6A 4JTCB 4C7YA 3K06A 4JV2A 3KCYA 1H2KA 5CWRA 3F5TA 4FVMA 1EN6A 1F7YA 1Q3VA 4LWSA 2FTKA 1BPEA 1BPBA 1SIJA 2ASDA 4IT5A 4C8NA 5ITZB 2VJ5A 3RAXA 4MS2A 4B3SO 1NK9A 2IM9A 5KFVA 1SERA 4X65O 2KMDA 1W0KG 1PL0A 5FPRA 3K5LA 2WF5A 1PD3A 3AQFA 4RPYA 1U97A 3SEIA 3E8HA 3OTQA 1MA7A 2UVWA 3G6XA 2ATLA 3LSUA 1SQVH 5JJNB 1BNOA 2VRZA 3HPLC 2ITCC 2A1JA 4FBTA 3M7MX 1ZQYA 2B5UA 4B9VA 1EN5A 2B6GA 1UT5A 1NK8A 2Q68A 2FYUH 2V4DA 4ECRA 1ZD3A 4JV0A 2M6YA 2X6BA 1SKSA 4Q44A 3MR5A 3E8FA 3OR7C 3M8RA 4LWSB 3U26A 2PMZF 1H2NA 3N7SC 4UCVA 1KKXA 4F4LA 4J9LA 4LNUA 4B9TA 4FLVA 2NRWA 1V85A 4R66A 1M93A 4KLMA 3QG5A 3EPGA 4RQ8A 4YD1A 4DUYB 1K5SA 1ZQWA 1P7DA 3NVVA 2PKEA 1GH6A 2JRIA 3IG5A 1HIWA 2K1EA 4I27A 3B2EE 2YS8A 1VP7A 5LYJA 1R3IC 2FPKA 1E79G 3BA9A 3IC7A 4JTDB 5GTHZ 8ICMA 3LDDA 4QZ8A 4R65A 3CC7V 3F53A 2ZIXA 4MVRA 2L6LA 5GTHU 2A3VA 1XNSA 2ZR2A 2CRXA 3L9DA 3B4SA 2XY6A 4M9NA 3TAQA 1R73A 2F76X 4LP8A 4UAYA 4LF4O 3W7SA 2Q7HA 4YJ3A 3CCVV 5LOVA 3MFIA 4JI1B 4DFJA 4LNUB 5DB6A 9ICNA 2OWOA 1ZLZA 3N97B 4FZ0A 1FYJA 4O4JA 4NLBA 3HKZF 2QJ1A 5B5EZ 4EZ6A 3ZD9A 2CDYA 4QPKA 2O57A 1VARA 2BCUA 1GM8A 1SRYA 3T1YB 1IZ3A 1I5XA 5KFTA 4X8AA 2XTAA 1TAEA 4J9KA 2QTOA 5LYJB 5J2AA 2HVHA 2ZIMA 3OHBA 1SETA 1Q8KA 4JI4O 3IRUA 1FFUA 9ICKA 1E1RG 1GAXA 3SPGA 4GFJA 5AM2A 3AEVA 3TETA 2ZIXB 4OPHA 1NZBA 4NV0A 3SR6A 4TV9B 3JD4A 3JD3A 4KLDA 2UXXA 8ICQA 4YJ3B 4UB4A 4NR1A 4UXNA 5KHHA 5LOVB 4P9PA 2BSKA 3LDCA 3T4ZA 3H1IH 4CDGA 1Q3UA 4J03A 3UMCA 1XO1A 2FKXA 2R9AA 4O4JB 5KFWA 3AU6A 2WFAA 5LMUO 4DL5A 4YG2A 1KN5A 2W11A 3FX7A 4BW5A 4DV0O 2YY6A 4AQYO 4QNLA 5AKYA 3C2LA 2QARA 2W7OA 3BZKA 5J2IA 4FMTA 2E8NA 2PFNA 5DG7A 4PGQA 1JMSA 2MSNA 2DWDC 3PW4A 1WCNA 4L87A 3DC5A 2ZXWB 2ZXWC 5HFLA 1RXVA 1QBZA 4C4RA 1DXSA 4DW0A 1YTFB 1M4UA 5K1XA 5L3BA 4F72A 3FC4A 1ZQFA 7ICLA 3UMGA 2BSKB 3A0BZ 1JN3A 5K4LA 4ACOA 3ZRWA 3ZHSA 4B7EA 2LYBA 3V72A 3H0RB 3A0BU 4TUYB 4JI8O 2WLIA 2WLJA 2QARB 2LI6A 4IYHA 4FLYA 5AI0A 4EX6A 4JYAO 1KC8W 2P67A 1BMFG 1AI4A 4DL6A 4P4PA 1FXHA 4XA5A 2PI5A 2XNDG 3K0DA 1KL9A 4NVPA 4GX5A 4KTQA 3ZBHA 3RJFA 1LUVA 2HHUA 3C23A 3FKSG 4ECSA 2KFNA 4ICGA 2AH5A 3H4DA 4YXJA 3PW2A 3M99B 3QO7A 4NB5A 3TK1A 3ZRWB 5IIKA 4CH6A 2UUAB 4DFMA 5EBLC 4KN7A 3RBZA 1J2NA 2EH9A 2QSAA 4G3IA 2G5IB 1GN2A 5L9XA 2WLIB 1VQPV 4PI2A 4GT1A 1VF6A 3WK6A 3CJHA 3SYPA 5HFMA 3AEIA 3THOA 2QKQA 8ICGA 4J11A 3V6KA 2OCCB 2OCCC 2WWWA 2ZG6A 1MG1A 4F71A 1AR1B 1ZJMA 2QWOB 4MF8A 5IYDO 2A0LA 3F2DA 2WF9A 3B8NA 1R3JC 2W6IG 8ICYA 1ZQOA 4K0KO 2FMLA 4QIWC 5AK5A 2UUBO 3JALA 5J0XA 1F23A 4LF7B 5KG2A 3Q4HA 5LGNA 3OEEG 2W43A 4H44B 5KTQA 7ICSA 1MQ3A 1VF6C 4RQEA 3CJHB 2FMPA 5AKEA 4QZFA 4I7ZB 2W9BB 4UARA 2UXBB 3GWKC 4NXZA 1XWLA 1Q6HA 1MZFA 3H8WA 2HI0A 4B3RB 3LK9A 1L7PA 3OM3B 1J5EO 1WP7A 4ABMA 1IBKB 8ICZA 4Z1MG 3SJBC 1QSSA 4ECUA 3A2FA 5EE0A 5IYZA 4YCXA 4QGPA 2HBMA 5CR0A 3JALB 1KBHA 1SA0A 3WU2Z 4DR5O 3HX0A 4ASUG 1T3NA 3GV8B 3Q4HB 3GV7B 4GC6A 1YXBA 2QGNA 1XL6A 5ALTA 3G80A 4YQWA 5CP2A 2JGDA 3QX7A 1XREA 4G9BA 5JWPA 3EHBB 1RZTA 2X6AA 4RNMA 1X2IA 2YDEA 2EJRA 3KTQA 3OT7A 4P0PA 3VQXA 2UU9O 3F2CA 4O5CA 3JD0A 1X42A 2IU3A 1L3UA 2V4RA 4M04A 3MAQA 1HR0B 2YQEA 4L8JA 2RQ5A 5C93A 2F44A 2P35A 1L6NA 1Q5OA 2H3IA 3SYCA 5IYZB 4PGXA 1B3QA 4KLOA 2BDUA 2EANA 1Y4MA 5AI4A 4F4XA 4RAIA 4PJ0Z 1SA0B 1QR9A 2ODGA 4KLGA 1QCKA 4DFPA 1NJXA 2IBZH 2P7TC 2Q4TA 3LUTB 3THVA 2DKZA 2JGDB 1VDVA 3JSNA 1HNWO 1FO4A 9ICQA 1AQ6A 2HOFA 1L7NA 1N0JA 2LPEA 4J9OA 2K9PA 4DV1B 4JI7O 1ZQTA 4DSIA 1UHUA 4ELUA 1SZTA 1SXEA 1GTOA 4MEXA 4H0LB 1ZQEA 5LHHA 1D8BA 4QPJA 9ICCA 1ZYQA 1KMIZ 4FFBA 4LFAB 3C90A 1L8OA 1K73W 2HHHB 1ZQHA 4JI0O 4PDLA 2G5HB 3CXHF 4F91B 3C3TA 2Y9TA 5TISZ 5ALXA 4C4TA 3GDXA 4CF4A 3BZCA 2H3OA 5KHIA 3PSFA 1FFXA 3PO5A 4AP9A 2ESEA 2VQFO 1IV8A 3JPRA 2RQ6A 3OUSA 4IS7A 1ZSPA 3BQTA 3WK5A 2GBOA 4YIOA 4F92B 4K8ZA 1B04A 4GX0A 2H3FA 4OJPA 3TQ1A 4JAAA 2HG5C 2UUCO 1PK1A 4JWNA 3UQ8A 4UQGA 2ZE8A 1HWYA 5A2QN 3OTOO 2RDCA 1NKCA 2P22C 2Q8VA 3ZJZA 2ZUCA 1Z5WA 4RQ3A 1K7DA 1LB2B 3CRXA 2IJIA 4FFBB 2K8CB 2FLLA 4LF8O 3AU2A 3UM7A 3SJAC 5AI5A 4QWBA 3PX6A 4M0AA 3H8MA 3VOUA 2LYHA 8ICBA 1S9FA 1KLNA 4CCHA 3STLC 3SV4A 1OZ0A 5DGAA 5KG3A 1WWVA 1L8DA 1LVHA 1BSMA 1ZRMA 5EE9A 1FFXB 1QLEB 1QLEC 2OCEA 1AI6A 3OMNB 3C21A 1BPXA 5J2FA 4J42A 4X66B 2F4VO 4OJLA 4O3RA 3K03A 5BR8O 3UQ2A 3K5NA 1FPOA 1PK1B 3PV8A 3RWRD 2KVSA 3RBEA 2AQ4A 3PNCA 1WJZA 3R9KA 1ZQNA 2YXHA 3HR0A 4K8XA 4RZRA 4KX3A 2DWQA 4O4LA 4EKWA 2HBJA 1L8LA 4C4SA 3M7DA 3JARA 4DV7O 3DV9A 4ZOLA 4JV1A 4OCZA 4KLJA 2GO7A 1UJWB 2NNUA 5KFDA 3N7RC 4R8UA 3K4GA 3K9SA 1NOMA 5J0SA 1DLBA 3ETLA 2OEHA 2B1IA 3AK1A 4FS2A 5ALSA 3OSNA 1HUZA 1OV9A 2VA8A 1UT8A 1AVMA 4KP4A 2Q4PA 4ELTA 4HYKA 3AUOA 1XDCA 3E22A 4UCOA 2MRLA 4RUEA 1WNSA 5AM0A 1VQ6V 2Y48A 2JH7A 3CB2A 2WA3A 1K9MW 2HHVA 3PN1A 5LMNB 1GN6A 3OD4A 4EB6A 9ICJA 5HMMA 2EZYA 5EYPB 3RBDA 1SZPA 5L1MA 3LDEA 4O4LB 3KBBA 3ZMTA 3WK4A 2W6JG 2ZM6B 2AGOA 3JARB 3NTUA 2XAJA 2B9ZA 3RYFA 2VWKA 3OE7G 4IR1A 1EZJA 2ODMA 2E5LO 4R8UB 3K04A 2XOKG 3CX5F 3W7TA 2EIKB 3FYHA 9ICWA 2EIKC 2PY5A 2N05A 1UCVA 1U47A 1IXRA 5KFEA 1DGJA 5B66Z 3RTVA 4IRCA 3JPQA 4ECTA 3QU2A 2QA4V 4DUZO 4TQFA 2KJ8A 1XHXA 4NLKA 1H2SB 1JROA 3OGCC 5AKHA 3ZIAG 5B66U 5ALDA 3G4SV 4DEZA 4DR6O 5HMLA 1KD1W 5L1KA 2PYJA 2ZNJA 4WJ3B 4X9QA 2ZJAA 2AHZA 3SDLA 4BW9A 4EB6B 2GV9A 3QVNA 3SR2C 4DOCA 2QTSA 3RYFB 5T14A 5EWGA 8ICHA 1XHZA 1ROPA 5KT3A 5CA3A 1ZQJA 1J2MA 2OYYA 4RUAA 4PHZA 3GIMA 4J9YB 1N34O 3RR8A 1O9GA 1QSYA 5CA0A 4DS4A 2QB0A 3DTUB 2DUYA 4YIPA 5KT2A 4HYOA 1Y6XA 1SQFA 4RT2A 2Q7GA 1KBUA 4GC7A 2HMXA 2LYAA 3B8MA 2RLTA 4QE7A 3L74H 2DL0A 8ICFA 4MSWC 3HPOA 5EE3A 1RM6C 4RQ6A 5JCOA 1M6YA 5LHGA 1N0NA 1NVPB 1VQ9V 4EENA 2ZIWA 8ICTA 1N36B 2KKWA 4LVSA 1T5EA 2GLEA 2RDIA 3QU9A 4J9NA 2Y0IA 4IL6Z 1QVFU 1ZD5A 1SKVA 3KKYA 4EZ9A 4A5UB 2D3DA 3UM9A 5KFPA 3WFVA 4ECXA 2ZIVA 3RAQA 1SV4A 2JDIG 2Z3YA 2XCAA 4U7NA 2AGQA 3DXRA 3MHSC 5CA0B 4JAVA 2QB0B 1PUZA 3A0RA 4ECQA 3NRWA 4DOBA 4YHHB 2ZUDA 5JU5A 2ADQB 3ABKB 3ABKC 4GZRB 4B3MB 3FB6C 3QO5A 1XI1A 1IBLB 3SAGA 1WN7A 1U45A 3TKAA 3PW5A 3ZRXA 5JCOC 5ALVA 3PSIA 4O4HA 4IRKA 2ZIWB 4F6EA 1PL4A 2LBOA 1QQ6A 1R3KC 4PD4F 4JI3B 1YZ7A 2ZIVB 4ED0A 1J95A 3VC8A 1K97A 5KFAA 1S5JA 1K1SA 8ICOA 5CB1A 5DECA 3DXRB 4KX5A 5K1PA 1OW5A 1BQ0A 1DTOA 2PFOA 1GN3A 4EBDA 4K4IA 8ICAA 2EAPA 3LYSA 3J81j 2HOIA 9ICFA 4NL9A 4P30A 3FB8C 1NU1H 1ZQPA 4FZ1A 1BPZA 4O4HB 1JJOA 4DUYO 2P4VA 4PGYA 4RO2A 3SJCC 4IQUA 4Q8FA 2ZIUB 3UCSC 3ZHUA 1D8LA 1K92A 2C28A 3SYAA 1ZD2P 4BWJA 4DSEA 4EELA 3PO4A 3HKBB 4IRDA 3SGIA 2WAQC 1ZQGA 4DF4A 1ZOLA 1TFRA 3S6JA 2Q0ZX 2LFSA 3QNMA 5JVDA 5L3CA 2MA1A 2Y0SC 3H8SA 1NK5A 2I1QA 1JX4A 1GRJA 5DM6V 3TI0A 2XAHA 1N61A 3GVMA 2JEFA 1XQ8A 4JI1O 1NTZH 2JK5C 1URJA 1PVPA 3E2EA 3OAAG 4NL9C 2YI8A 1TUEB 4UB2A 3HJEA 4JWMA 2X0LA 2YSUB 3JCUZ 1TE2A 4F93B 1PVRA 3PZPA 1DF5A 4GCZA 4BWMA 1OHHG 3CNHA 4I9WA 5LA6A 1RQLA 2W0FC 1AI5A 3EPIA 1MN8A 4NXNB 4I29A 1AB3A 1K1QA 1ZJNA 1B06A 1D8YA 2QM7A 1YHQV 1S5LZ 9ICTA 2Q0AA 3JPNA 2G08A 4OPAA 1P7GA 2OTJV 4U6PA 4MFFA 5AKJA 2HHXA 3MGIA 2UXDB 5JVDB 3PVXA 2AGPA 3AN1A 4I50A 5AK4A 5EIBD 1S5LU 5KAIZ 4JF3A 4PA9A 2GUZA 2OT5A 1MMMA 2E75B 4EX7A 3RH6A 1QQ7A 5ALPA 2YXLA 2K8BB 2BPGA 1W2BU 4M9JA 4CH4A 4JK1A 1SQXH 5KLVH 3LNMB 4ECYA 1QTMA 3H1HH 2NYVA 3OMIB 5LA6B 3IM1A 4KLSA 1T4GA 3FB7C 5KHJA 4OO1J 1XMQO 3GIKA 4X64B 3T1CA 4D6TH 2ZTCA 2AZ0A 2G06A 3C5FA 3ZRVA 1YJNV 1JALA 4QZBA 1VQ7V 3PSTA 4I50B 4J7KA 3S3WA 3A0HZ 3VBBA 4FK5C 2ZJ8A 5KAFU 2GUZB 2ZTEA 4TT3G 1RDFA 1V97A 1NH2B 2N04A 1ZAUA 3I56V 5DBAA 3CW2C 5ALGA 3KHHA 2IMWP 3ZDBA 3ETDA 5DEDA 3A0HU 4NY8A 1CRXA 4DSJA 3TAPA 1TAUA 2AW9A 1S77D 5DG8A 1KECA 1P4RA 4NYKA 4GUNA 4PDVA 2H3QA 2FLNA 5L3FA 4OJOA 1Y67A 4UVCA 5IE9A 1YTFD 7ICOA 2BCRA 4I0XA 4YY3O 3BA8A 1N4CA 2AGAA 1Z2GA 1L0LH 5KMGA 5F2VO 2W8KA 4U3FH 8ICPA 5AKGA 1S0VA 9ICXA 1S3JA 1L7OA 2Y4TA 1DF4A 1OCRB 1OCRC 4PI0A 2LFRA 1G6UA 5E79U 1E1QG 3P3NA 2UUAO 4FM1A 4K4HA 2C2RA 1VQ4V 1DRGA 3T1HB 3PW7A 1F4NA 1FKAO 4KFMA 2JXJA 2XI9A 3E58A 1XU4A 5FP0A 5J0YA 3C3SA 4ECZA 2WPDG 1VQKV 3PX4A 5EBMC 1MOFA 3NGDA 2FLPA 2KKVA 3B77A 3O9OA 2QKCA 2QLTA 4DR7B 2DQNB 2NO4A 2YEVB 3PR4A 1K5OA 4I0XB 4XDJA 2YMQA 2N74A 1YF2A 5KMGB 3HP6A 2YIDA 4DR3B 3L72H 4LF6B 1VQNV 3BJYA 1I08A 4JV5B 5KG7A 2JIZG 3CRQA 2IU0A 4GLXA 3K59A 4UATA 3OFNG 4DW1A 1MABG 4NLCA 5HNKA 4F2RA 2EZPA 2JHDA 8ICRA 5ALHA 3B40A 5HR7A 2I9GA 4WFHA 1Y88A 5KUKA 4LF7O 9ICRA 2JVDA 2DW4A 5KG4A 2GHYA 2XAGA 3U10A 2JS3A 7ICPA 1SB3C 3D2SA 2AHYA 4R6ZA 7ICIA 1Q6UA 4B9NA 5DB9A 1U96A 4UAVA 3MDSA 1M90W 3CRMA 3ZS8C 4NTWA 9ICVA 1HNZB 1T3QA 2KIWA 3Q8PB 2KSDA 2P6UA 1IBKO 2BE3A 5H9CA 2EINB 3RJEA 2EINC 1XL4A 2WF8A 3UPQA 5G5HA 1SQPH 3JYCA 1ZQQA 2WB1C 4I2CA 1M57B 1M57C 4MW8A 2MW2B 3OW2U 4UCTA 4CBCA 2CTPA 4WFEA 4AI8A 1IXBA 4WFAV 1URFA 5CN0A 2FMQA 1NKEA 1NR7A 3ZEDA 1MC8A 2Q6AA 1N56A 2NRVA 2KK0A 1IIPA 1XMOB 3ZMVA 2MUTA 4IYIA 1FIQA 5J2BA 4EBCA 2MK3A 3WK7A 1LV5A 2KD1A 1WPBA 4BX9C 2NV3A 2JH1A 4R7CA 3ZMZA 2CN1A 4UAZA 1AJNA 4A8EA 3D3IA 1NS1A 1N8RW 1HUOA 3UO2A 7ICHA 3MR3A 3NR7A 1ZX3A 1HR0O 4MTFA 3EWAA 2XY7A 2KFZA 2RRDA 1RYSA 4B08A 4RUCA 3APOA 4O5KA 3K75D 4TUYA 5ALFA 3IG8A 1AJPA 2HR3A 5AKIA 2QE7G 5KT5A 2QKSA 5B3SB 5B3SC 4DLEA 3QTCA 3OJUA 1U49A 3W7WA 5AKLA 2K60A 2DPIA 2ETNA 1IG6A 2BHNA 2CAZC 3RW0A 4RQ5A 8ICJA 4DL3A 2MUTB 2F8KA 4GX1A 4UUJC 2E8MA 4DV1O 1T8EA 3NRZA 3AL0B 5EOZA 3RB6A 1JX9A 2NN4A 1O08A 1FFTB 1TUBA 1Z3EB 1RYUA 2Q67A 1SESA 4FLZA 2LW7A 3WK8A 1S5HC 1IVSA 1DK1A 1COOA 3I1YA 4JTAB 3T4DA 2A7WA 4DCCA 1MZEA 2HHHO 4Z2WA 2G09A 5AICA 2BPCA 1AP6A 2WLMA 2Y4UA 3MDCA 4FPPA 1KQSU 3MGHA 4DQIA 1UPGA 3VCBA 3HWTA 1LNQA 1I5YA 1P7BA 5FL7G 4C8MA 3ISDA 3C2KA 4NLGA 4QW9A 2PZSA 3ZMSA 3ORYA 1PV0A 4U3JA 5A9GA 3GILA 2QWRB 1TUBB 2KSOA 4PA6A 2G38A 3ZHVA 3ETGA 3LVVA 5KA6A 1RFYA 5G5GA 1THZA 4XDLA 4Y2RA 1JR9A 4LFBB 3ZN0A 2H8PC 5KG5A 4F5QA 3CCUV 1KTQA 2R8GA 7ICNA 1KQQA 4CS4A 2KG5A 2CTWA 1XC9A 1NK6A 4M47A 1LR1A 4H33A 4J9ZB 1NKBA 4FM2A 2W9BA 5EK0A 9ICLA 2Z5UA 4UB3A 5BY1A 2J6TA 4Y2SA 4X65B 5ALYA 2PGGA 4ZKIA 3NS1A
chains in the Genus database with same CATH topology
3CPWU 4CRXA 4OJLA 3K03A 4JASA 4FIPC 3E35A 5L3GA 1RPRA 3WG7B 3WG7C 1IXMA 1F4MA 3BEHA 1JOYA 3D2NA 3CP1A 4HAMA 4WFHA 1NR1A 4AYBC 1A6SA 1F44A 4GX2A 3K9AA 4KX3A 4EKWA 2HBJA 3FYIB 3M7DA 2W03A 4DO2A 3SQIA 4P0QB 1UJWB 2NNUA 3N7RC 4MW3A 3K1ZA 2IH3C 3CXCU 1GK9A 1DLBA 2B1IA 4FZMA 1L1FA 1A0PA 3OEHG 1Y66A 4KP4A 2P90A 4QNHB 3ASOB 3ASOC 4MTOA 2MRLA 2ZDIA 4RUEA 1VQ6V 3I55V 1V55B 1V55C 2Y48A 2JH7A 3ABTA 4N21A 1K9MW 4PA4A 1NBMG 2IW5A 2V1DA 3IFXA 1YJ9V 1KP3A 3JD2A 4BAYA 1PKXA 2CPRA 2VKQA 2LHTA 3LDEA 1H8EG 1AROP 3K0GA 3ZCCA 1KP2A 2W6JG 2WAQF 2X7RB 3F7VC 3ZMTA 4LC1A 2XAJA 2ZXHA 4JMUA 3C29A 1BHBA 3OE7G 2Y0SF 2JGAA 1EZJA 4KMOB 2YX8A 2XAFA 2DQ0A 2XICA 2XOKG 3K04A 4P9OA 3W7TA 2EIKB 2EIKC 3MHHC 4WFFA 1YJWV 2XVTA 3F2BA 4JYBA 2KV2A 4PELA 5C0YA 4TWKA 2JEUA 5KL1B 2QA4V 2KJ8A 2ZDIC 3SPJA 2EIMB 2EIMC 4E2LA 3OGCC 3ZIAG 4PL1A 4H37A 3G4SV 3CCLV 4UVBA 3H0LB 5CRXA 3DEEA 1KD1W 4MVMA 3P32A 2CK3G 4WJ3B 4LCUC 2AHZA 4MTGA 4BJQA 2OTLV 4X89A 3CYMA 4WFGA 2YB4A 2M0NA 4IC9A 1WLEA 1SZHA 2ITDC 4PL2A 4P2ZA 1Z1BA 3E0FA 3N7PD 5T14A 1OCZB 1OCZC 4YXWG 2YB1A 4JGSA 1YSCA 1WPXA 1ROPA 5CA3A 1K4DC 3SMVA 3ASNB 3ASNC 2WLKA 2F8LA 2XIDA 2OYYA 5CBHA 5DN6G 3O0FA 4J9YB 4ZBMA 5EC2C 4FJCC 3DTUB 3LSSA 4ICAA 4HYOA 4TSFG 3M6ZA 1NJIW 2ZD9A 3G71V 1KBUA 2HMXA 2LYAA 3B8MA 1VQ5V 2OXOA 2HVKC 4QE7A 3KZXA 3AG1B 1JPXA 3AG1C 4MSWC 3W7UA 1YI2V 1NVPB 2WLHA 1VQ9V 5LHGA 3H0MB 3LVWA 2ZIWA 1VQLV 5A0LA 5L3EA 2JEXA 1Q82W 1ENVA 1QVFU 3SPHA 4OJ5A 1JVMA 3WFVA 3CCJV 3CCRV 2ZIVA 3T79A 1G4YB 2DYSB 2DYSC 2Z3YA 2JDIG 4R8CA 5IYCO 1CEZA 3JCZA 4U7NA 3F5AA 4XBFA 5CMUA 4OJ6A 3MHSC 4JTCB 2G0AA 3K06A 2KOBA 4JAVA 2XAQA 3A0RA 3OR6C 3NRWA 3NUQA 2E5SA 1Q3VA 3ABKB 3ABKC 3NXSA 2FTKA 3GU3A 4BIZA 3FB6C 2A9HA 3QO5A 2KNJA 2VJ5A 3SAGA 4MS2A 1M1KW 3ZRXA 3E89A 2KICA 3F5WC 3PSIA 3G6EV 1SERA 2DQ3A 2ZIWB 1W0KG 2LBOA 3SPIA 2IJKA 1PL0A 1B6QA 1R3KC 1PD3A 3AQFA 1GMGA 3E8HA 3FB5C 2OH2A 1MA7A 1VQOV 4JPRA 2ZIVB 1J95A 2R9RB 3VC8A 3HPLC 1K97A 1V54B 1V54C 2HKOA 5IYBO 2ITCC 1W0JG 4MVOA 3OPXA 2KB1A 2LKYA 4KX5A 2B5UA 1RPOA 1DTOA 2Q68A 3RF9A 5E1AC 2X6BA 3IN5A 4MT8A 5L3DA 1BL8A 2W7PA 3OR7C 3E8FA 2PMZF 3LYSA 3N7SC 2HOIA 4F4LA 2DYRB 2DYRC 2JJ2G 1S76D 4P30A 3FB8C 3CMAV 1ECWA 2K89A 1OCCB 1OCCC 3CMEV 2JJ1G 2IH1C 1Q7YW 4RO2A 2ZIUB 2X6CA 1K5SA 1K92A 2PI4A 1P7DA 2K1EA 3SYAA 3IG5A 1HIWA 1GO3F 1COWG 1R3IC 3ABMC 3ABMB 1E79G 1K3EA 3EFFK 4JTDB 3IC7A 1HEKA 2WAQC 3LDDA 4FZNA 2LFSA 3CCMV 3CC7V 5L3CA 2MA1A 3F53A 2Y0SC 2ZIXA 1K34A 2GSMB 4MVRA 5DM6V 1R6NA 2EILB 2EILC 3GZFA 2A3VA 1XNSA 2XAHA 2ZR2A 2CRXA 1NQTA 1R73A 4LP8A 2F76X 3W7SA 3ALRA 1CPYA 3CCVV 1MSWD 2JK5C 1URJA 1PVPA 3OAAG 3E2EA 1TUEB 2ZXIA 2ZR3A 2N1RA 2RHFA 3SAFA 2BOCC 2H3VA 2KKPA 2E1FA 3HKZF 4NLBA 2X0LA 2YSUB 4N23A 5LGTA 4QPKA 1PVRA 3PZPA 1DF5A 4GCZA 3PSPA 1OHHG 1GM8A 2XASA 4I9WA 2W0FC 1VQMV 1AI5A 1GM7A 2WSSG 1SRYA 1I5XA 2QM7A 4X8AA 1YHQV 2QTOA 3P30A 4MVQA 2G08A 3GB7C 2OTJV 4U6PA 1SETA 5IY5B 5IY5C 5LGUA 1E1RG 3MD0A 4UV8A 3SPGA 2WB1F 4GFJA 5CBFA 3BY6A 3TETA 2ZIXB 2WAMA 1NZBA 4NV0A 4JF3A 4PA9A 3JD4A 2OT5A 3JD3A 2UXXA 3IGAC 1Q86W 4R7CA 3SJQC 4UXNA 4U7OA 4P9PA 2K8BB 3LDCA 4BUGA 1FXKA 1H2GA 3KG2A 5B1OA 3T4ZA 3UKMA 4MTXA 1W2BU 2QEXV 4CDGA 1Q3UA 3LNMB 3AQEA 5B1BB 5B1BC 3OMIB 3QNEA 3CC4V 3FB7C 4BW5A 4QNLA 4OO1J 3E86A 2W7OA 2Q69A 4FMTA 3T1CA 3ZN1A 5J9PC 5B1NA 1GKFA 2G06A 2NLJC 2H3ZA 4R50A 2H94A 3DGEA 3ZRVA 2DWDC 1YJNV 3ETEA 1VQ7V 3PSTA 4L87A 4C0ZA 2ZXWB 2ZXWC 5B1AB 3PJSK 5B1AC 4FK5C 5HFLA 3VBBA 2F2AB 2OM6A 4WF9V 1QBZA 4XDKA 4TT3G 1NH2B 1K5QA 1YTFB 3I56V 5L3BA 4P0PB 1BHAA 3ETDA 2HOQA 3MGVA 1FXKB 1FXKC 1CRXA 4ACOA 4CZZA 3ICXA 2G07A 4G2KA 3ZRWA 2LYBA 3AG2B 3AG2C 3D36A 3H0RB 1S77D 1KECA 1P4RA 4QE9A 1ZQ1C 3D2QA 2WLIA 1ZWIC 2WLJA 4UV9A 3RVZA 4PA7A 3CCQV 4PDVA 1NVPD 2H3QA 5L3FA 3E8GA 4OJOA 4UVCA 3F5EA 1FS0G 1NH2D 1AJQA 1OCOC 1OCOB 1AI7A 1KC8W 1YTFD 2P67A 1BMFG 1AI4A 1PNMA 3RVYA 3ABLB 3ABLC 1FXHA 1S3JA 1S0VA 2XNDG 3K0DA 1QVGU 1K8AW 2PI5A 3C28A 1DF4A 1JQ0A 4GX5A 1OCRB 2ZIUA 1OCRC 2DGZA 1T94A 3FKSG 1GM9A 2LFRA 1E1QG 4KUMA 3M99B 2KEYA 3QO7A 3TK1A 3ZRWB 2VIXA 4QJFB 1VQ4V 3R65A 3X2QB 3X2QC 1DRGA 5EBLC 2KHVA 1F4NA 3RBZA 4KFMA 2XI9A 2D6FC 5EC1C 2DF4B 1RM1B 1RM1C 2PMZC 3ONNA 1PNLA 3E8BA 2G5IB 4RQFA 2WPDG 2WLIB 1VQKV 5EBMC 1VQPV 1MOFA 4GT1A 3FYEB 3STZC 2KKVA 3B77A 1R3LC 4JYCA 3SYPA 5HFMA 3AEIA 2DQNB 2YEVB 4FE3A 4XDJA 2OCCB 2OCCC 1VQNV 2WWWA 2ZG6A 1MG1A 4PDRA 4U7CA 2JIZG 1AR1B 2Y69B 2Y69C 2K4EA 2IU0A 3SYOA 5IYDO 2A0LA 3F2DA 3B8NA 1Z19A 3OMAB 1R3JC 3OFNG 4WCEV 1MABG 4NLCA 2W6IG 2VJ4A 1YT3A 4NWIA 1TAMA 2JHDA 4QIWC 2RP5A 2EZPA 5HR7A 2EIJB 2EIJC 2R9IA 3K3WA 3ABUA 4RUFA 5KUKA 1F23A 2DW4A 5EBWC 5LGNA 5KL8B 2GHYA 3OEEG 2XAGA 3IP4B 3CD6V 5H6RA 4QIWF 3D2SA 2AHYA 3JD1A 1NKDA 4AYBF 1EBOA 4R6ZA 5LHIA 4RQEA 3HKZC 1M90W 4PDMA 2KIWA 2EBOA 3CCSV 2HBKA 2HFEC 3ML0A 2HBLA 1S72V 1K4CC 5H9CA 2EINB 2EINC 3OM3B 1QCEA 1XL4A 5LBQA 1YITV 2F77X 4Z1MG 5GW7A 2K4HA 3JYCA 2WLLA 5BZBA 2WB1C 1M57B 1M57C 4MW8A 5CBGA 2B1GA 3OW2U 2HBMA 4CBCA 4WFEA 3SAHA 3SYQA 4ASUG 4WFAV 5CN0A 2HVJC 2HLDG 1NR7A 1XL6A 2KHQA 1EFRG 2Q6AA 3M6KA 2ATKC 3GWOA 1IIPA 2JMGA 3ZMVA 2GH1A 2K4IA 4O3MA 3CP8A 2MK3A 3EHBB 2LP7A 2KD1A 2X6AA 4BX9C 2NV3A 2JH1A 1F51A 3ZMZA 1ORQC 2CN1A 1AJNA 2EJRA 2ZQMA 4A8EA 4CGZA 1XO0A 4P0PA 3D3IA 3CCEV 3F2CA 1N8RW 2C2AA 3JD0A 1ED1A 2IU3A 4MTFA 4X88A 2KJ9A 2QM8A 2GOLA 2RRDA 4FZLA 4JAUA 3TCUA 5C93A 5KUMA 4DXWA 2D3OW 1L6NA 2H3IA 3IG8A 1AJPA 2HR3A 2QE7G 2WLLB 3SYCA 1JCHA 3T2MA 4HZ3A 2QKSA 2E1EA 2BDUA 2A79B 5B3SC 1Y4MA 5B3SB 1YIJV 4RAIA 1QR9A 1PNKA 2KJ5A 4BIUA 5IDJA 3W7XA 3W7WA 1WUDA 1VQ8V 2IJHA 3RW0A 3K79A 2P7TC 2Q4TA 3LUTB 2IJJA 4GX1A 2V7QG 2UXNA 4UUJC 2HOFA 3AL0B 2F43G 3E83A 3KFUF 1SZTA 4MVZA 1JX9A 1FFTB 1GTOA 2Q67A 3ZMUA 5KA5A 1SESA 2EZOA 4Q20A 1S5HC 5LHHA 1D8BA 3HB3B 4QPJA 4JTAB 3T4DA 2G09A 1M56B 1M56C 2W04A 1K73W 4G28B 1OUQA 2P6JA 1FXVA 4I5SA 2WLMA 4PDLA 2G5HB 3CC2V 3AG3B 3AG3C 4FPPA 1CP9A 3F7YC 2KVCA 4UVAA 2YEVA 3PSFA 3LSQA 3SPCA 1KQSU 1H38A 3VCBA 1LNQA 2BOBC 1KKDA 1I5YA 2WLNA 3OUSA 2R18A 1P7BA 1G8MA 5FL7G 1H8HG 3QO8A 4GX0A 3ZMSA 1QLNA 2H3FA 4OJPA 1R6KA 2HG5C 3OUFA 4G27B 4PA6A 2M7WA 4MVSA 3ETGA 3LVVA 2Z7JA 5KA6A 1THZA 1HWYA 4XDLA 3AG4B 3AG4C 3CYOA 2K8AA 3ZJZA 3ZN0A 1UPHA 1K7DA 2H8PC 3CRXA 2HJFC 2IJIA 2K8CB 1K33A 5H6QA 3ZRSA 3CCUV 3L3FX 3UM7A 3RFAA 1Q81W 4P0QA 3VOUA 1PVQA 3K08A 4PA3A 3STLC 4H33A 1OZ0A 3H01A 4LBEC 4J9ZB 5HR6A 1QR8A 5EK0A 2Z5UA 1QLEB 1QLEC 4OXSA 1AI6A 3OMNB 4MVUA 1JJ2U 2DWEC 4WFBV 4ZKIA 1M9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHF A;  3SAF A;  2E1F A;  2KV2 A;  4NLB A;  2DGZ A;  5C0Y A;  4CDG A;  2RRD A;  4NLC A;  1D8B A;  4QJF B;  1GO3 F;  1YT3 A;  4OO1 J;  2HBM A;  2E1E A;  2CPR A;  3SAH A;  2MA1 A;  2HBJ A;  3CYM A;  4QIW F;  1WUD A;  3SAG A;  4O3M A;  2HBK A;  4CGZ A;  2HBL A; 
#chains in the Genus database with same CATH topology
 2KZ3 A;  5J2T A;  3CPW U;  1ZQX A;  5D4B A;  4EFB A;  2PTM A;  4FIP C;  4WBN A;  3E35 A;  2UXC B;  1RPR A;  5DGB A;  1IXM A;  4U3J B;  4RQM A;  4J9R A;  3BEH A;  3JPS A;  4HAM A;  2KSO B;  3FFQ A;  4DK1 A;  1WAZ A;  2LGQ A;  2KN7 A;  1F44 A;  1QU7 A;  4TQR A;  4LF9 B;  2XC9 A;  1SS3 A;  1ZRN A;  3DDH A;  3WK9 A;  4ECV A;  1HNX B;  2R8I A;  2LQT A;  2W03 A;  1XNQ O;  9ICM A;  4DO2 A;  3SQI A;  3RB0 A;  1GN4 A;  5J2H A;  1I94 B;  1SGG A;  3K1Z A;  3MC1 A;  5JUM A;  1GK9 A;  3H1L H;  4ZI7 A;  1XOU A;  1P84 F;  1SF9 A;  3MBY A;  4FZM A;  3N28 A;  1L1F A;  3BQ1 A;  3Q8L A;  4YN4 A;  2P90 A;  2XGQ A;  3JAW A;  4UAS A;  5J2T B;  4YR2 A;  4KLL A;  2E8P A;  2ZDI A;  2XUM A;  4WBN B;  1V55 B;  1EN4 A;  1V55 C;  3ABT A;  5LMN O;  2Y1J A;  3BPZ A;  5L1J A;  1NBM G;  2DPJ A;  2UVR A;  3M9M B;  1PKX A;  1FEZ A;  4RPZ A;  2CPR A;  2VKQ A;  5J0W A;  2ZM6 O;  2R8K A;  3EXA A;  2LHT A;  4I55 A;  1H8E G;  1K8A W;  4UB1 A;  1KP2 A;  2WAQ F;  3F7V C;  2ZXH A;  2EAM A;  3C29 A;  1BHB A;  1N62 A;  2Y0S F;  5EWF A;  2FJ6 A;  2IOF A;  2JGA A;  1I7F A;  4KMO B;  4B9M A;  2XAF A;  2YIA A;  4US9 A;  4ZI7 B;  3MHH C;  4WFF A;  1YJW V;  1R6T A;  2W55 A;  2KV2 A;  3NVZ A;  2LMR A;  4PEL A;  5C0Y A;  4C7Z A;  2JEU A;  5KL1 B;  2JEJ A;  3JAW B;  4DF8 A;  2DN9 A;  2ZDI C;  4I9Q A;  2EIM B;  2EIM C;  2I5H A;  4H37 A;  4F50 A;  3PW0 A;  5BOM A;  3HW8 A;  4MVM A;  2CK3 G;  3WKC A;  5AM5 A;  4LR3 A;  3QE9 Y;  5AIA A;  4GIB A;  4I55 B;  3C2M A;  1X40 A;  4TV8 A;  1SZH A;  4PL2 A;  2CXY A;  4P2Z A;  2KG7 A;  3WKA A;  4JI5 O;  7ICR A;  2I6X A;  3E0F A;  5HP4 A;  1ZQK A;  1WPX A;  3TXS A;  2F1J A;  1P49 A;  1SV0 A;  5C5J A;  5CBH A;  4M2Y A;  4Y2Q A;  4FFK A;  5DN6 G;  4PHE A;  3O0F A;  4ZBM A;  3IV6 A;  2YIB A;  4FJC C;  5EC2 C;  1H2L A;  5EWE A;  3RN4 A;  1F5S A;  2RN9 A;  4TSF G;  1D2D A;  3K5O A;  3M6Z A;  4J9S A;  2ZD9 A;  4O2A A;  9ICI A;  3JAK A;  2XHB A;  7ICJ A;  3KZX A;  4CC6 A;  1JPX A;  3HKD A;  4NKG B;  5JJE B;  2NRX A;  2JZB A;  1YI2 V;  2WLH A;  1N36 O;  2A3Q A;  3LVW A;  2IOF K;  4TV8 B;  5J29 A;  3OJS A;  5KFU A;  1Q8I A;  2KG7 B;  2ILM A;  1Q46 A;  3ED5 A;  4PHD A;  3HIL A;  5IJ9 A;  1SV0 C;  2DYS B;  2DYS C;  5IYC O;  4NLZ A;  1AR4 A;  4R8C A;  3K1R B;  5JH7 A;  3JCZ A;  3N2G A;  4ED6 A;  4XBF A;  1FAF A;  2IBK A;  3D8C A;  4YHH O;  5DDM A;  3ETQ A;  7ICF A;  3NUQ A;  3IC9 A;  4JI8 B;  4B3M O;  3KHL A;  2E5S A;  4JZG A;  1SL0 A;  3NXS A;  1IBL O;  4QWD A;  2BCQ A;  4O2A B;  3GU3 A;  3JAK B;  4BIZ A;  1M1K W;  2KNJ A;  5DDY A;  4O4I A;  1AIL A;  4M9G A;  8ICL A;  1SXD A;  4J9M A;  2JZB B;  1KKC A;  2KIC A;  1NZ6 A;  3HKD B;  5ALR A;  4I2F A;  4DS5 A;  1ZL8 B;  3Q8S B;  1Z4N A;  2BCS A;  3SPI A;  2IJK A;  5DB7 A;  2KTQ A;  4JI3 O;  3CHX A;  1ZQU A;  1CXZ B;  1BGY H;  1VQO V;  4JPR A;  5IJ9 B;  1AR5 A;  3AM9 A;  2P66 A;  3QUQ A;  1V54 B;  1WWU A;  4B9U A;  4ZOH C;  1V54 C;  1NK4 A;  2HKO A;  5IYB O;  5JH7 B;  3OPX A;  4EYI B;  3N2G B;  5IIN A;  2A1A A;  2ZE7 A;  2LKY A;  1RPO A;  4KHP B;  5EYP A;  1XSN A;  4DQR A;  1BL8 A;  2W7P A;  4IQW A;  4BR6 A;  5ALO A;  2OIG A;  4QWC A;  4ED7 A;  4J10 A;  5DQH A;  5J2C A;  2DYR C;  2DYR B;  1S76 D;  2JJ2 G;  4O4I B;  4ZH4 A;  2Q5Z A;  3CWB H;  4RNO A;  3ZDD A;  2W3R A;  3J81 N;  7ICU A;  1JIH A;  4DRX A;  4IQT A;  1OCC C;  1OCC B;  2RNB A;  2JJ1 G;  2IH1 C;  4CC5 A;  1Q7Y W;  1KU9 A;  4DR1 B;  4B9S A;  3RJJ A;  3TGU H;  3FAV A;  1N63 A;  1GO3 F;  4GKJ O;  1NJW A;  1SC5 B;  1K3E A;  5F9N A;  3EFF K;  1HEK A;  2UUB B;  1JXL A;  4FZN A;  2ZIN A;  3CCM V;  4CF3 A;  2GSM B;  2EIL B;  2EIL C;  1NZP A;  1NQT A;  1WP8 A;  4LFC B;  1IUR A;  1MSW D;  4UAU A;  1ZQS A;  1XSP A;  5KFO A;  4B3T O;  4J7Z A;  2DE0 X;  2N1R A;  2RHF A;  2XAS A;  4NM1 A;  2KKP A;  4DRX B;  2E1F A;  5LGT A;  4N23 A;  4PHP A;  1J5E B;  5EE1 A;  2NR5 A;  4NXN O;  3PSP A;  5H5N A;  1U48 A;  5F3X B;  2WSS G;  2QWN B;  1TK8 A;  4DV2 B;  3BQ7 A;  3FAV B;  2YIC A;  2F3N A;  1QSL A;  4O3O A;  5AM4 A;  2UXD O;  4YMM A;  4DR5 B;  4Q6G A;  3RT3 C;  4UV8 A;  8ICI A;  2WB1 F;  5CA7 A;  9ICP A;  4US8 A;  2DFL A;  1ZQA A;  2WAM A;  5KHK A;  5IIL A;  2XT9 A;  1JXE A;  1Q86 W;  3IGA C;  4ELV A;  3SJQ C;  3RH5 A;  3QEB Z;  4DV4 B;  4U7O A;  2HHW A;  3T5L A;  4BUG A;  1FXK A;  1H2G A;  4P2H A;  5B1O A;  2VA2 A;  3UKM A;  4MTX A;  2QEX V;  1SL2 A;  4B7K A;  1N33 B;  3RJI A;  4B9L A;  3AQE A;  1M5I A;  1ZQI A;  3QNE A;  1A77 A;  5LP6 A;  1VMG A;  4X64 O;  3BQ2 A;  4DR2 B;  2ZKO A;  2Q69 A;  5KX5 A;  1XNR O;  1N5W A;  2VQE B;  3GIJ A;  2Y1I A;  2H3Z A;  4R50 A;  2H94 A;  2BR0 A;  4ED1 A;  1BS3 A;  3V7J A;  1SWV A;  4Y2X A;  3ZDC A;  2ZE6 A;  5B1A B;  5B1A C;  3PJS K;  4WF9 V;  4HNA A;  1NNL A;  2B0C A;  1HP8 A;  5AKK A;  4W4L A;  2HOQ A;  5J0U A;  3MGV A;  1FXK B;  1FXK C;  1EZV H;  1XBL A;  4Z6E A;  4DFD A;  4GKK B;  2G07 A;  2FI1 A;  3AG2 B;  2KQX A;  4CE6 A;  3AG2 C;  3D36 A;  1VLB A;  4BXO A;  4I4T A;  2HDO A;  1Q6I A;  2YI9 A;  5LP6 B;  5LP6 C;  1X6J A;  4X5V A;  4JZ2 A;  4QE9 A;  3FAH A;  5L1I A;  3IDW A;  4FLX A;  3D2Q A;  1DK2 A;  3RVZ A;  4UV9 A;  4NLN A;  1XSL A;  3NVY A;  1TVA A;  5KX5 B;  3CCQ V;  4ED3 A;  5IT9 N;  4Y2P A;  2H5X A;  3APQ A;  1FS0 G;  3UQ0 A;  1DGS A;  5BPC A;  1NH2 D;  4ZHQ A;  4F4W A;  7ICK A;  2E3T A;  4HNA B;  5ALL A;  3BAB A;  4JUZ A;  1JQ0 A;  2ZUB A;  2ZIU A;  3H40 A;  2DGZ A;  3ZD8 A;  3TFS A;  8ICS A;  3HKE A;  5CEH A;  1FJG B;  4TUQ A;  2VIX A;  4QJF B;  2ZTD A;  3HKB A;  3AMZ A;  1YVW A;  3D36 C;  4BXO B;  4I4T B;  5EC1 C;  2NRZ A;  1RM1 B;  1RM1 C;  4DK0 A;  4NXM B;  3E8B A;  2LJ2 A;  4RQF A;  3ZHQ A;  4CNQ A;  1TK0 A;  1ZQL A;  2XGP A;  3FYE B;  1F0M A;  4DR7 O;  3MR2 A;  7ICV A;  1BNP A;  1R3L C;  7ICQ A;  5D46 A;  4KXR A;  4FM0 A;  4ZHQ B;  4DR3 O;  3AK2 A;  3H7I A;  4I28 A;  8ICE A;  2GTA A;  4RQ2 A;  4PDR A;  1RP3 B;  3G6V A;  1YCI A;  4Y2J A;  1ZQB A;  5F9L A;  2Y69 B;  2Y69 C;  3SYO A;  1X66 A;  5KFX A;  2D2C B;  2F4V B;  5ALM A;  4DV6 B;  3HKE B;  3OMA B;  5KT6 A;  4WCE V;  3KZI U;  1YT3 A;  4NWI A;  1TAM A;  2DOS A;  2R9I A;  2RP5 A;  2EIJ B;  3I76 A;  2EIJ C;  4RUF A;  2BTQ A;  4DR4 B;  2AQ0 A;  1U9L A;  5KL8 B;  3CD6 V;  4FLU A;  1BCC H;  4QIW F;  3SD7 A;  3H9V A;  2F95 B;  5CB4 A;  1EBO A;  4DV7 B;  1SZX A;  3RR7 A;  4J9P A;  1HNZ O;  1Q3E A;  5ALU A;  4PDM A;  5DKW A;  1Z00 A;  2HP8 A;  2HBK A;  5AKX A;  4Y2V A;  2UVU A;  2HFE C;  3ML0 A;  3RFR A;  1XIL A;  1S72 V;  3ZDE A;  5LBQ A;  3SYZ A;  1D5A A;  4F2S A;  5J0P A;  4C7U A;  5GW7 A;  3B9J A;  4DV3 B;  3T1Y O;  5AIB A;  1TKD A;  1C7Y A;  2WLL A;  1IBM B;  4F5R A;  4C8K A;  2DBY A;  1SWW A;  2B1G A;  3QU4 A;  3ETR A;  3OGU A;  3O65 A;  3V6H A;  3SAH A;  4Y2U A;  3SYQ A;  2BTQ B;  4HAI A;  2HLD G;  4P4O A;  2KHQ A;  5AKZ A;  4YMN A;  3H4B A;  4RWU A;  1L7M A;  3M6K A;  5KFN A;  2JMG A;  2ATK C;  2EX3 A;  4LH6 A;  5CB4 B;  4F4Z A;  4YFK A;  3EYZ A;  2GH1 A;  2KP7 A;  4O3M A;  3CP8 A;  5FPO A;  3RYI A;  3SPJ A;  2ASJ A;  3B0Y A;  1W59 A;  5DG9 A;  1F51 A;  3RB3 A;  4DV5 B;  1ZQZ A;  1ORQ C;  4PZO A;  4XUS A;  2QKA A;  1N5X A;  1HJP A;  3OSP A;  5KFS A;  1XO0 A;  5IJ0 A;  5DBB A;  1Z00 B;  4KLH A;  3EUB 2;  1X4T A;  4LZG A;  2V4Q A;  1SQG A;  4X88 A;  2QM8 A;  2GOL A;  4FZL A;  4JAU A;  1T7P A;  2NO5 A;  4DXW A;  2ZT9 B;  3WB1 A;  3BS7 A;  2WLL B;  3T2M A;  1JCH A;  3R66 A;  4HZ3 A;  3BFR A;  1S0M A;  4B6J A;  5KFF A;  3M1Y A;  3TAC B;  1TV9 A;  5C8Y A;  4X62 B;  1YIJ V;  1PNK A;  7ICM A;  2KJ5 A;  5KAF Z;  1VQ8 V;  3W7X A;  1WUD A;  5ALI A;  1Q90 D;  1XEQ A;  3CRA A;  3IJ4 A;  2XO7 A;  4IHJ A;  3RYI B;  2DMX A;  4BGD A;  3DC6 A;  2F43 G;  4DOA A;  2IHM A;  4MVZ A;  4Z6C A;  4E4E A;  2BDP A;  5IJ0 B;  2F66 C;  2R8J A;  2EZO A;  4Q20 A;  5KA5 A;  5DQI A;  3JAT A;  3HB3 B;  1X59 A;  2VWJ A;  1BQZ A;  2P6R A;  4KLQ A;  4K3A A;  2W04 A;  2P6J A;  1FXV A;  3U11 A;  5C8Y B;  4KLI A;  1KFS A;  4OX9 B;  5L1L A;  1CP9 A;  1N2X A;  1EXN A;  3F7Y C;  2KVC A;  1XS9 D;  2HJD A;  1OXJ A;  2YEV A;  3CRR A;  2XCP A;  2QWQ B;  1ZET A;  2BOB C;  1KKD A;  5E79 Z;  2WLN A;  4IHJ B;  4ZIB A;  4LF5 B;  2R18 A;  1QHT A;  1BPD A;  1YZ6 A;  3SV3 A;  2OIE A;  1DK3 A;  1H8H G;  3QO8 A;  1YDX A;  4MHV A;  3MFH A;  1QLN A;  1Y74 A;  3M9O B;  4QWA A;  1BPY A;  3OUF A;  4G27 B;  4I2E A;  4LFB O;  1JRP A;  2Z7J A;  3JAT B;  4Y2T A;  3SZ2 A;  4I2B A;  4QWE A;  1HW7 A;  3CYO A;  1K33 A;  5H6Q A;  2P4K A;  3TAN A;  1BZK A;  3QZ7 A;  3RFA A;  1NJY A;  1Q81 W;  4P0Q A;  3M9N B;  4UB6 Z;  4X1K A;  1PVQ A;  1U4B A;  4KLF A;  4Q45 A;  4LBE C;  5HR6 A;  1QR8 A;  1QQC A;  4UB6 U;  4OXS A;  4MVU A;  1M9N A;  5KFC A;  2UXC O;  1NK7 A;  3KD3 A;  3OHA A;  2VA3 A;  4CRX A;  1JMK C;  4X1I A;  1QH9 A;  2YMM A;  5KG6 A;  5L3G A;  1Y74 B;  1F4M A;  3T5H A;  1JFF A;  1JOY A;  3CP1 A;  3QU5 A;  2IA6 A;  1UFI A;  4CS2 A;  2CUG A;  4KLU A;  4LF9 O;  1O9H A;  5GON A;  4AYB C;  2VS0 A;  5KG1 A;  1PM9 A;  4CH3 A;  1S8O A;  4UBB A;  1HNX O;  5AM3 A;  5ALZ A;  4C80 A;  1VEW A;  4IGG A;  4XRH A;  3WKE A;  2PYL A;  2AU0 A;  1I94 O;  1L5U A;  4P0Q B;  4X1K B;  2Q7E A;  5J2E A;  2KZZ A;  4K4G A;  3TJT A;  4UW9 A;  2IH3 C;  1L0N H;  1N32 B;  3CXC U;  2UXB O;  1SQB H;  4PZN A;  3GII A;  3OEH G;  5AI6 A;  4B3R O;  1Y66 A;  1PK3 A;  4Z1V A;  3VQY A;  1WB7 A;  2JEG A;  3KKA A;  4MTO A;  2Q9L A;  4DWI A;  4X1I B;  4DL4 A;  4RU9 A;  3BCC H;  3I55 V;  4AIL C;  4X1Y A;  2IW5 A;  1YJ9 V;  3IFX A;  1JFF B;  4EFE A;  1KP3 A;  4YMO A;  2ZCE A;  2B21 A;  2HHT A;  2A1J B;  4PV1 B;  5EZY A;  3RB4 A;  5GON B;  4QZH A;  1KB9 F;  9ICU A;  1US6 A;  3J80 N;  4DYL A;  3A8T A;  1VIB A;  3ZCC A;  4BDP A;  2X7R B;  1OJH A;  4JMU A;  5AK6 A;  9ICA A;  1DOQ A;  2P5O A;  4O9M A;  4R64 A;  4P9O A;  2YX8 A;  3QUT A;  2DQ0 A;  3C1Z A;  3PMN A;  5EIB C;  2C2E A;  4DFK A;  2XVT A;  2L35 A;  4JYB A;  1V38 A;  9ICB A;  3TXQ A;  4C8O A;  4TWK A;  3Q8Q B;  3P3P A;  1UQV A;  1ZQD A;  5TZV A;  3KKA C;  9ICO A;  4DSL A;  3UXO A;  4TUR A;  5B5E U;  1SKR A;  4PL1 A;  3CCL V;  5LL6 Y;  1MNG A;  3GV5 B;  2YC0 A;  4X1Y B;  2DJV A;  2QWP B;  1NT2 B;  2QDO A;  4MTG A;  5EZY B;  4TUP A;  5D5Q A;  1MSD A;  2OTL V;  5DLF A;  4X89 A;  2YB4 A;  4DSK A;  3G6Y A;  4IC9 A;  3NVW A;  3PY8 A;  4FFD A;  3QZ8 A;  5KFK A;  4RQ4 A;  1JI7 A;  2E76 B;  4KLT A;  3CS5 A;  2EQY A;  1R1B A;  4YXW G;  5D49 A;  1NTM H;  2BTO A;  4JGS A;  1MQ2 A;  1RQN A;  2WTF A;  3SMV A;  9ICE A;  1RG6 A;  3Q8R B;  4QW8 A;  5CHG A;  1S0N A;  2XID A;  2Q0O C;  5J2K A;  4ED8 A;  1L3V A;  2E8O A;  4LFA O;  4OD0 A;  5AK3 A;  1XMQ B;  3G71 V;  4FLW A;  5KFY A;  1NJZ A;  3ISB A;  2HSZ A;  2HVK C;  5IIJ A;  3AG1 B;  3AG1 C;  1YEW A;  2KIV A;  3WKB A;  3JPP A;  3H0M B;  3D3Q A;  4NM2 A;  4M9L A;  1VQL V;  4DO9 A;  3FD9 A;  4J80 A;  4O3N A;  5L3E A;  1Q82 W;  2JEX A;  3SPH A;  4JI6 B;  1Z5V A;  2C2D A;  3CCJ V;  4JI2 B;  5IWA B;  3AG7 A;  3J7A U;  4TQD A;  2EZX A;  5HHH A;  1X9W A;  2W9C A;  1BVS A;  2ZNI A;  1A76 A;  4LJX A;  4W4K A;  5CMU A;  2G0A A;  3EVK A;  2KOB A;  2XAQ A;  3AK3 A;  4QZI A;  3OR6 C;  2LM1 A;  3ZHT A;  1JA8 A;  4TV9 A;  3LWM A;  5KNI A;  2A9H A;  3KHR A;  2BQU A;  3E89 A;  3F5W C;  4YY3 B;  3G6E V;  4B3S B;  3DSQ A;  2DQ3 A;  4O0I A;  3HKC A;  1NI3 A;  2YUA A;  4X66 O;  1B6Q A;  3IAY A;  1GMG A;  2YIB D;  1WYG A;  2F93 B;  3FB5 C;  4X20 A;  2OH2 A;  3RYH A;  2R9R B;  1KUQ A;  4QZD A;  4IR9 A;  2W9C B;  1W0J G;  9ICH A;  4MVO A;  4KHP O;  2KB1 A;  2ES6 A;  1KYO F;  5J8Y A;  4DSF A;  4F4Y A;  3RF9 A;  5E1A C;  3IN5 A;  4MT8 A;  5L3D A;  4PHA A;  2OCH A;  1B4F A;  2W0X A;  1TVK A;  5KFL A;  2RCV A;  1IM4 A;  1S10 A;  2BZF A;  3CMA V;  1ECW A;  4DR1 O;  2K89 A;  4YVZ A;  8ICW A;  3CME V;  1RYR A;  3HKC B;  3BRC A;  2X6C A;  2PI4 A;  3RJG A;  4X20 B;  1KFT A;  3SEN A;  2IOH A;  2NRT A;  2W9A A;  1COW G;  3ABM C;  3ABM B;  3RYH B;  5KFI A;  4F8R A;  3SI8 A;  3ZHR A;  1UA0 A;  7ICG A;  3L70 H;  2R70 A;  5J8Y C;  1K34 A;  1R6N A;  3GZF A;  2ALZ A;  2MAX A;  4LFC O;  2FB5 A;  3C1Y A;  3ALR A;  3C5G A;  1CPY A;  4LF4 B;  1TVK B;  4F3O A;  3V7K A;  1KSP A;  2ADP A;  2ZXI A;  1D9F A;  2ZR3 A;  3SAF A;  2BOC C;  3QUB A;  2H3V A;  3G6B A;  1WA8 A;  1X9M A;  1D9D A;  4EBE A;  4DV2 O;  1L3S A;  1VQM V;  4J9Q A;  3UXN A;  5CJ7 A;  1GM7 A;  3CSX A;  3I5D A;  1XUQ A;  1SKW A;  1FFV A;  2A06 H;  4R63 A;  3P30 A;  4MVQ A;  3FDS A;  3GB7 C;  5IY5 B;  5IY5 C;  2F1H A;  5LGU A;  3MD0 A;  4IQV A;  5CBF A;  3ZX6 A;  4YP3 A;  3BY6 A;  4JI4 B;  3WU2 U;  5LXT A;  3OGI B;  4DV4 O;  4PPX A;  5KFB A;  8ICN A;  1QNM A;  5BOL A;  1CUK A;  3UT5 A;  3KG2 A;  2CE4 A;  2HEP A;  1N33 O;  5KT7 A;  5B1B B;  5ALQ A;  3BDP A;  5B1B C;  4F5O A;  1WA8 B;  4UB5 A;  4DR2 O;  3CC4 V;  1TAQ A;  2FL4 A;  5LMU B;  2VQE O;  3E86 A;  4H13 B;  3WKD A;  4M9H A;  4DV0 B;  1D5N A;  3ZN1 A;  5J9P C;  4MF2 A;  5B1N A;  4AQY B;  1GKF A;  1Q43 A;  5KFZ A;  1PZN A;  2NLJ C;  2YN4 A;  5ALW A;  4RQ1 A;  3DGE A;  5J2G A;  5ALK A;  1H2M A;  3ETE A;  3BHP A;  3L4P A;  4PJ0 U;  4C0Z A;  4O2B A;  4YR3 A;  2PUS A;  5J2D A;  2F2A B;  2OM6 A;  3RH4 A;  1I0H A;  5LXT B;  1ZL8 A;  3KHG A;  4XDK A;  2QM4 A;  4KLE A;  1K5Q A;  4DLG A;  4P0P B;  7ICE A;  3LDA A;  3UT5 B;  4GKK O;  1BHA A;  4KN4 A;  4UBC A;  1B43 A;  2MU2 A;  4CZZ A;  3ICX A;  4G2K A;  4QZG A;  5H2F Z;  7ICT A;  2GTS A;  5JQG A;  2W9M A;  4MFA A;  1B22 A;  4MEY A;  2J6U A;  3PML A;  1ZD4 A;  2YMP A;  5H2F U;  1ZQ1 C;  1ZWI C;  2WA4 A;  4PA7 A;  1NVP D;  2BGW A;  4F5N A;  3E8G A;  2ARH A;  3VQV A;  2P06 A;  2E3C A;  3F5E A;  3HRD D;  1AJQ A;  1OCO C;  1OCO B;  5J0O A;  1AI7 A;  3N4M B;  4LH7 A;  3WB2 A;  1PNM A;  1WCL A;  2KE7 A;  5BMV A;  2AZ2 A;  4JYA B;  1C20 A;  3CEI A;  4HBN A;  3RVY A;  4F4K A;  5CA1 A;  1PP9 H;  4RQ0 A;  3ABL B;  3ABL C;  5TIS U;  4O2B B;  4I2I A;  3H1K H;  1QVG U;  3C28 A;  3UXP A;  2YTU A;  2F23 A;  5FNV A;  1T94 A;  1FJG O;  2A19 A;  4FBU A;  1GM9 A;  4KUM A;  4EEQ A;  3TAD A;  2RMK B;  1O03 A;  2KEY A;  3ZI4 A;  3ISC A;  3R65 A;  3X2Q C;  3X2Q B;  2CTR A;  5JQG B;  4DL2 A;  3KCX A;  2KHV A;  3L73 H;  4NXM O;  1UA1 A;  2D6F C;  2DF4 B;  2PMZ C;  3ONN A;  1PNL A;  1N48 A;  1TK5 A;  3STZ C;  4GXI A;  4JYC A;  3MR6 A;  1LUW A;  2RJZ A;  1JUD A;  3QYP A;  4CH5 A;  8ICU A;  4FE3 A;  3BVO A;  5BMV B;  4P4M A;  5III A;  5CA1 B;  4D7T A;  4C8L A;  4U7C A;  4K35 A;  2K4P A;  2J6S A;  4FO6 A;  4DV6 O;  2K4E A;  2XY5 A;  1BE3 H;  2BCC H;  4IIJ A;  3FM9 A;  1Z19 A;  5FNV B;  5GTI Z;  3IHQ B;  2EAO A;  4E0D A;  3TAD C;  2VJ4 A;  3Q8M A;  1RXW A;  2ZE5 A;  3K3W A;  4UCR A;  3L71 H;  4DR4 O;  3ABU A;  4O5E A;  3K57 A;  4K0K B;  4M6W A;  5GTI U;  2HHS A;  5EBW C;  3VQW A;  4I2A A;  1NTK H;  3RJH A;  3IP4 B;  5H6R A;  3JD1 A;  1KRP A;  1NKD A;  4AYB F;  5LHI A;  2ISP A;  4I2H A;  2KZM A;  3UMB A;  3JPT A;  4UCU A;  3LWL A;  4EEK A;  1XNQ B;  3HKZ C;  4KMU A;  2R72 A;  4JB3 A;  1MA1 A;  3RJK A;  2EBO A;  3CCS V;  2HBL A;  1KEJ A;  5AI8 A;  4O3S A;  1K4C C;  2JV3 A;  1SL1 A;  4RPX A;  1QCE A;  4DV3 O;  8ICK A;  1YIT V;  2F77 X;  3I28 A;  4IIJ B;  3K58 A;  1IBM O;  2K4H A;  2W3S A;  4F6R A;  5BZB A;  5CBG A;  2R8H A;  4EYH B;  2WHE A;  5J0Q A;  2OHF A;  2W8L A;  4M6W B;  2HVJ C;  2AJQ A;  2GDS A;  2FE9 A;  1EFR G;  5J0R A;  4J41 A;  3GQC A;  2BPF A;  2JR5 A;  2Y0P A;  3GWO A;  4ZOL B;  3TAR A;  4DV5 O;  3LNN A;  2K4I A;  5DBC A;  4XQ8 A;  3G67 A;  2LP7 A;  2QB1 A;  2ZQM A;  4CGZ A;  3CCE V;  2Q73 A;  2C2A A;  4DL7 A;  1ED1 A;  2UU9 B;  2C22 A;  3HT3 A;  2KJ9 A;  2BQR A;  2CTQ A;  3E22 B;  3N2K A;  3QU7 A;  3TCU A;  5KUM A;  2D3O W;  4TOI A;  4UCS A;  9ICS A;  4F6R B;  4X62 O;  4RQN A;  2E1E A;  2A79 B;  1FD9 A;  2M9N A;  2QR4 A;  1ZXI A;  3BAA A;  4Y2Y A;  2CH7 A;  4BIU A;  5IDJ A;  1COK A;  5AM1 A;  4Z6D A;  3M8A A;  2IJH A;  2FDR A;  1B0X A;  3RGB A;  5IIO A;  3K79 A;  4UFZ A;  2W54 A;  2HHQ A;  5KFQ A;  2IJJ A;  4JI5 B;  2V7Q G;  2UXN A;  1Y76 A;  1L3T A;  2EUL A;  4ECW A;  3E83 A;  1HNW B;  3KFU F;  3RRG A;  4JI7 B;  3ZMU A;  2AHO B;  3V6J A;  4RT3 A;  1VJ5 A;  3N2K B;  4KL1 A;  1M56 B;  1EM1 A;  1M56 C;  3RRH A;  4G28 B;  1OUQ A;  4I5S A;  3M8S A;  2JS5 A;  5BXZ A;  4OX9 O;  3CC2 V;  4JI0 B;  2YXY A;  3AG3 C;  3AG3 B;  1WB8 A;  4YXM A;  3QEA Z;  2CH7 B;  2FPM A;  8ICC A;  3JAS A;  4O3P A;  1H38 A;  3LSQ A;  4UVA A;  3SPC A;  3JPO A;  1ZQR A;  1HDJ A;  4QZA A;  4LF5 O;  2FMS A;  2DKX A;  2WF6 A;  4Q43 A;  4GXK A;  1S0O A;  1G8M A;  1ZTE A;  2VQF B;  1Y76 B;  4GYC B;  3RYC A;  2Z0A A;  4DQP A;  4IL6 U;  4NJ8 A;  4PH5 A;  4F5P A;  1R6K A;  3L75 H;  2HVI A;  3JSL A;  5KG0 A;  1Z1V A;  1RPL A;  1PPJ H;  2M7W A;  4MVS A;  4YD2 A;  2UUC B;  3T1H O;  3AG4 B;  3AG4 C;  2K8A A;  5ALE A;  3GFK B;  1UPH A;  3S3X A;  2HJF C;  2ASL A;  2PFP A;  3OTO B;  3ZRS A;  2HW3 A;  3L3F X;  3L5K A;  3PX0 A;  4LF8 B;  4BIO A;  2HCF A;  2RDJ A;  3K08 A;  4PA3 A;  1VF5 B;  3V7L A;  2ISO A;  3H01 A;  3JAS B;  5ALN A;  5AI9 A;  5J2J A;  4CS3 A;  4LF6 O;  9ICG A;  4JV5 O;  1JJ2 U;  2DWE C;  4WFB V;  3KZI Z;  3KOO A;  4Z6F A;  5DLG A;  2JRZ A;  2OYQ A;  4JAS A;  4D7S A;  3RYC B;  8ICX A;  4TQS A;  3WG7 B;  3WG7 C;  4EEY A;  5BR8 B;  4GXJ A;  5JTI A;  3D2N A;  3BQ0 A;  1V9P A;  1SQQ H;  3CRC A;  1ZQV A;  1NK0 A;  2EZZ A;  1NR1 A;  4YR0 A;  5HHI A;  1A6S A;  1AP5 A;  3CE2 A;  4GX2 A;  3K9A A;  4UB8 Z;  2BKE A;  2BQ3 A;  3FYI B;  1N60 A;  3WB0 A;  1N32 O;  3B0X A;  3T5K A;  4MFC A;  1J97 A;  4UB8 U;  5KHG A;  4MW3 A;  4Q8E A;  3JAM N;  5KFH A;  3MAB A;  5DQG A;  5IIM A;  1A0P A;  2VAN A;  2F1I A;  4OGQ B;  5D5P A;  1QQ5 A;  1WG8 A;  2BCV A;  2LW1 A;  3ASO B;  3ASO C;  4QNH B;  4UAW A;  1ZQM A;  2AXT Z;  3QUC A;  2V9W A;  4N21 A;  4PA4 A;  5KFG A;  2V1D A;  4GKJ B;  4J7J A;  3JD2 A;  4BAY A;  1BGX T;  2L5Y A;  2FPL A;  1A32 A;  1TGO A;  2AXT U;  3EW9 A;  1KDH A;  2JGU A;  2O6K A;  4TUS A;  3K5M A;  2CGO A;  1VF7 A;  1ARO P;  2EJ7 A;  3K0G A;  1XMO O;  3T5J A;  4LC1 A;  2Y9U A;  5DB8 A;  1KW4 A;  3T3F A;  2XIC A;  2E5L B;  1IX9 A;  2WF7 A;  4B3T B;  3F2B A;  1KFD A;  4QZ9 A;  4NTX A;  5FLX N;  4FLT A;  5KT4 A;  2IHN A;  5JRT A;  2YML A;  5AHX A;  3MDA A;  2PXI A;  4E2L A;  4DUZ B;  5J2U A;  4I2G A;  4UVB A;  3BS5 A;  3H0L B;  3DEE A;  4USA A;  5J0T A;  5CRX A;  1ZUQ A;  2E74 B;  2F1M A;  3H1J H;  3P32 A;  3D6J A;  4LCU C;  4DR6 B;  2D8C A;  4I2J A;  4BJQ A;  2CGN A;  2LGW A;  3CYM A;  4QZC A;  4WFG A;  2M0N A;  4FS1 A;  1CI4 A;  1LKY A;  1Z4O A;  1WLE A;  4DQQ A;  2ITD C;  1X9S A;  4RNN A;  3EZ5 A;  1Z1B A;  3B09 A;  3N7P D;  2GWS A;  1OCZ B;  5KFJ A;  1OCZ C;  2YB1 A;  2LM4 A;  1RSO A;  5KAI U;  1YSC A;  4BWA A;  4YJ2 A;  3QXG A;  1K4D C;  3N27 A;  3Q8K A;  3ASN C;  2WLK A;  3ASN B;  1IDS A;  2F8L A;  1NI8 A;  3ZDA A;  4O3Q A;  3TFR A;  2UVV A;  1X6I A;  4LZD A;  3UO3 A;  4QZE A;  4AHC A;  2ZIO A;  1G1X B;  1N34 B;  3LSS A;  1YZB A;  4ICA A;  4JYY A;  5AG2 A;  5J2U B;  4I2D A;  5ALJ A;  3BS5 B;  1X9X A;  4RQ7 A;  2JEI A;  1NJI W;  4KIT B;  2LO1 A;  1XNR B;  1VQ5 V;  2OXO A;  1S97 A;  5ITZ A;  4CF5 A;  2PFQ A;  3W7U A;  2PF4 E;  1LKY B;  1TA8 A;  5KFM A;  4JI6 O;  3NAS A;  3PR5 B;  3QF7 A;  5JJJ B;  5A0L A;  4ED2 A;  8ICV A;  1ENV A;  4OJ5 A;  4JI2 O;  1ZQC A;  5IWA O;  1RSO B;  5KFR A;  1JVM A;  2ZJ5 A;  4YJ2 B;  4NTY A;  3OTF A;  3CCR V;  1BT8 A;  2EDU A;  3T79 A;  1G4Y B;  1CEZ A;  3H8J A;  4DQS A;  3U0Z A;  3F5A A;  4OJ6 A;  4JTC B;  4C7Y A;  3K06 A;  4JV2 A;  3KCY A;  1H2K A;  5CWR A;  3F5T A;  4FVM A;  1EN6 A;  1F7Y A;  1Q3V A;  4LWS A;  2FTK A;  1BPE A;  1BPB A;  1SIJ A;  2ASD A;  4IT5 A;  4C8N A;  5ITZ B;  2VJ5 A;  3RAX A;  4MS2 A;  4B3S O;  1NK9 A;  2IM9 A;  5KFV A;  1SER A;  4X65 O;  2KMD A;  1W0K G;  1PL0 A;  5FPR A;  3K5L A;  2WF5 A;  1PD3 A;  3AQF A;  4RPY A;  1U97 A;  3SEI A;  3E8H A;  3OTQ A;  1MA7 A;  2UVW A;  3G6X A;  2ATL A;  3LSU A;  1SQV H;  5JJN B;  1BNO A;  2VRZ A;  3HPL C;  2ITC C;  2A1J A;  4FBT A;  3M7M X;  1ZQY A;  2B5U A;  4B9V A;  1EN5 A;  2B6G A;  1UT5 A;  1NK8 A;  2Q68 A;  2FYU H;  2V4D A;  4ECR A;  1ZD3 A;  4JV0 A;  2M6Y A;  2X6B A;  1SKS A;  4Q44 A;  3MR5 A;  3E8F A;  3OR7 C;  3M8R A;  4LWS B;  3U26 A;  2PMZ F;  1H2N A;  3N7S C;  4UCV A;  1KKX A;  4F4L A;  4J9L A;  4LNU A;  4B9T A;  4FLV A;  2NRW A;  1V85 A;  4R66 A;  1M93 A;  4KLM A;  3QG5 A;  3EPG A;  4RQ8 A;  4YD1 A;  4DUY B;  1K5S A;  1ZQW A;  1P7D A;  3NVV A;  2PKE A;  1GH6 A;  2JRI A;  3IG5 A;  1HIW A;  2K1E A;  4I27 A;  3B2E E;  2YS8 A;  1VP7 A;  5LYJ A;  1R3I C;  2FPK A;  1E79 G;  3BA9 A;  3IC7 A;  4JTD B;  5GTH Z;  8ICM A;  3LDD A;  4QZ8 A;  4R65 A;  3CC7 V;  3F53 A;  2ZIX A;  4MVR A;  2L6L A;  5GTH U;  2A3V A;  1XNS A;  2ZR2 A;  2CRX A;  3L9D A;  3B4S A;  2XY6 A;  4M9N A;  3TAQ A;  1R73 A;  2F76 X;  4LP8 A;  4UAY A;  4LF4 O;  3W7S A;  2Q7H A;  4YJ3 A;  3CCV V;  5LOV A;  3MFI A;  4JI1 B;  4DFJ A;  4LNU B;  5DB6 A;  9ICN A;  2OWO A;  1ZLZ A;  3N97 B;  4FZ0 A;  1FYJ A;  4O4J A;  4NLB A;  3HKZ F;  2QJ1 A;  5B5E Z;  4EZ6 A;  3ZD9 A;  2CDY A;  4QPK A;  2O57 A;  1VAR A;  2BCU A;  1GM8 A;  1SRY A;  3T1Y B;  1IZ3 A;  1I5X A;  5KFT A;  4X8A A;  2XTA A;  1TAE A;  4J9K A;  2QTO A;  5LYJ B;  5J2A A;  2HVH A;  2ZIM A;  3OHB A;  1SET A;  1Q8K A;  4JI4 O;  3IRU A;  1FFU A;  9ICK A;  1E1R G;  1GAX A;  3SPG A;  4GFJ A;  5AM2 A;  3AEV A;  3TET A;  2ZIX B;  4OPH A;  1NZB A;  4NV0 A;  3SR6 A;  4TV9 B;  3JD4 A;  3JD3 A;  4KLD A;  2UXX A;  8ICQ A;  4YJ3 B;  4UB4 A;  4NR1 A;  4UXN A;  5KHH A;  5LOV B;  4P9P A;  2BSK A;  3LDC A;  3T4Z A;  3H1I H;  4CDG A;  1Q3U A;  4J03 A;  3UMC A;  1XO1 A;  2FKX A;  2R9A A;  4O4J B;  5KFW A;  3AU6 A;  2WFA A;  5LMU O;  4DL5 A;  4YG2 A;  1KN5 A;  2W11 A;  3FX7 A;  4BW5 A;  4DV0 O;  2YY6 A;  4AQY O;  4QNL A;  5AKY A;  3C2L A;  2QAR A;  2W7O A;  3BZK A;  5J2I A;  4FMT A;  2E8N A;  2PFN A;  5DG7 A;  4PGQ A;  1JMS A;  2MSN A;  2DWD C;  3PW4 A;  1WCN A;  4L87 A;  3DC5 A;  2ZXW B;  2ZXW C;  5HFL A;  1RXV A;  1QBZ A;  4C4R A;  1DXS A;  4DW0 A;  1YTF B;  1M4U A;  5K1X A;  5L3B A;  4F72 A;  3FC4 A;  1ZQF A;  7ICL A;  3UMG A;  2BSK B;  3A0B Z;  1JN3 A;  5K4L A;  4ACO A;  3ZRW A;  3ZHS A;  4B7E A;  2LYB A;  3V72 A;  3H0R B;  3A0B U;  4TUY B;  4JI8 O;  2WLI A;  2WLJ A;  2QAR B;  2LI6 A;  4IYH A;  4FLY A;  5AI0 A;  4EX6 A;  4JYA O;  1KC8 W;  2P67 A;  1BMF G;  1AI4 A;  4DL6 A;  4P4P A;  1FXH A;  4XA5 A;  2PI5 A;  2XND G;  3K0D A;  1KL9 A;  4NVP A;  4GX5 A;  4KTQ A;  3ZBH A;  3RJF A;  1LUV A;  2HHU A;  3C23 A;  3FKS G;  4ECS A;  2KFN A;  4ICG A;  2AH5 A;  3H4D A;  4YXJ A;  3PW2 A;  3M99 B;  3QO7 A;  4NB5 A;  3TK1 A;  3ZRW B;  5IIK A;  4CH6 A;  2UUA B;  4DFM A;  5EBL C;  4KN7 A;  3RBZ A;  1J2N A;  2EH9 A;  2QSA A;  4G3I A;  2G5I B;  1GN2 A;  5L9X A;  2WLI B;  1VQP V;  4PI2 A;  4GT1 A;  1VF6 A;  3WK6 A;  3CJH A;  3SYP A;  5HFM A;  3AEI A;  3THO A;  2QKQ A;  8ICG A;  4J11 A;  3V6K A;  2OCC B;  2OCC C;  2WWW A;  2ZG6 A;  1MG1 A;  4F71 A;  1AR1 B;  1ZJM A;  2QWO B;  4MF8 A;  5IYD O;  2A0L A;  3F2D A;  2WF9 A;  3B8N A;  1R3J C;  2W6I G;  8ICY A;  1ZQO A;  4K0K O;  2FML A;  4QIW C;  5AK5 A;  2UUB O;  3JAL A;  5J0X A;  1F23 A;  4LF7 B;  5KG2 A;  3Q4H A;  5LGN A;  3OEE G;  2W43 A;  4H44 B;  5KTQ A;  7ICS A;  1MQ3 A;  1VF6 C;  4RQE A;  3CJH B;  2FMP A;  5AKE A;  4QZF A;  4I7Z B;  2W9B B;  4UAR A;  2UXB B;  3GWK C;  4NXZ A;  1XWL A;  1Q6H A;  1MZF A;  3H8W A;  2HI0 A;  4B3R B;  3LK9 A;  1L7P A;  3OM3 B;  1J5E O;  1WP7 A;  4ABM A;  1IBK B;  8ICZ A;  4Z1M G;  3SJB C;  1QSS A;  4ECU A;  3A2F A;  5EE0 A;  5IYZ A;  4YCX A;  4QGP A;  2HBM A;  5CR0 A;  3JAL B;  1KBH A;  1SA0 A;  3WU2 Z;  4DR5 O;  3HX0 A;  4ASU G;  1T3N A;  3GV8 B;  3Q4H B;  3GV7 B;  4GC6 A;  1YXB A;  2QGN A;  1XL6 A;  5ALT A;  3G80 A;  4YQW A;  5CP2 A;  2JGD A;  3QX7 A;  1XRE A;  4G9B A;  5JWP A;  3EHB B;  1RZT A;  2X6A A;  4RNM A;  1X2I A;  2YDE A;  2EJR A;  3KTQ A;  3OT7 A;  4P0P A;  3VQX A;  2UU9 O;  3F2C A;  4O5C A;  3JD0 A;  1X42 A;  2IU3 A;  1L3U A;  2V4R A;  4M04 A;  3MAQ A;  1HR0 B;  2YQE A;  4L8J A;  2RQ5 A;  5C93 A;  2F44 A;  2P35 A;  1L6N A;  1Q5O A;  2H3I A;  3SYC A;  5IYZ B;  4PGX A;  1B3Q A;  4KLO A;  2BDU A;  2EAN A;  1Y4M A;  5AI4 A;  4F4X A;  4RAI A;  4PJ0 Z;  1SA0 B;  1QR9 A;  2ODG A;  4KLG A;  1QCK A;  4DFP A;  1NJX A;  2IBZ H;  2P7T C;  2Q4T A;  3LUT B;  3THV A;  2DKZ A;  2JGD B;  1VDV A;  3JSN A;  1HNW O;  1FO4 A;  9ICQ A;  1AQ6 A;  2HOF A;  1L7N A;  1N0J A;  2LPE A;  4J9O A;  2K9P A;  4DV1 B;  4JI7 O;  1ZQT A;  4DSI A;  1UHU A;  4ELU A;  1SZT A;  1SXE A;  1GTO A;  4MEX A;  4H0L B;  1ZQE A;  5LHH A;  1D8B A;  4QPJ A;  9ICC A;  1ZYQ A;  1KMI Z;  4FFB A;  4LFA B;  3C90 A;  1L8O A;  1K73 W;  2HHH B;  1ZQH A;  4JI0 O;  4PDL A;  2G5H B;  3CXH F;  4F91 B;  3C3T A;  2Y9T A;  5TIS Z;  5ALX A;  4C4T A;  3GDX A;  4CF4 A;  3BZC A;  2H3O A;  5KHI A;  3PSF A;  1FFX A;  3PO5 A;  4AP9 A;  2ESE A;  2VQF O;  1IV8 A;  3JPR A;  2RQ6 A;  3OUS A;  4IS7 A;  1ZSP A;  3BQT A;  3WK5 A;  2GBO A;  4YIO A;  4F92 B;  4K8Z A;  1B04 A;  4GX0 A;  2H3F A;  4OJP A;  3TQ1 A;  4JAA A;  2HG5 C;  2UUC O;  1PK1 A;  4JWN A;  3UQ8 A;  4UQG A;  2ZE8 A;  1HWY A;  5A2Q N;  3OTO O;  2RDC A;  1NKC A;  2P22 C;  2Q8V A;  3ZJZ A;  2ZUC A;  1Z5W A;  4RQ3 A;  1K7D A;  1LB2 B;  3CRX A;  2IJI A;  4FFB B;  2K8C B;  2FLL A;  4LF8 O;  3AU2 A;  3UM7 A;  3SJA C;  5AI5 A;  4QWB A;  3PX6 A;  4M0A A;  3H8M A;  3VOU A;  2LYH A;  8ICB A;  1S9F A;  1KLN A;  4CCH A;  3STL C;  3SV4 A;  1OZ0 A;  5DGA A;  5KG3 A;  1WWV A;  1L8D A;  1LVH A;  1BSM A;  1ZRM A;  5EE9 A;  1FFX B;  1QLE B;  1QLE C;  2OCE A;  1AI6 A;  3OMN B;  3C21 A;  1BPX A;  5J2F A;  4J42 A;  4X66 B;  2F4V O;  4OJL A;  4O3R A;  3K03 A;  5BR8 O;  3UQ2 A;  3K5N A;  1FPO A;  1PK1 B;  3PV8 A;  3RWR D;  2KVS A;  3RBE A;  2AQ4 A;  3PNC A;  1WJZ A;  3R9K A;  1ZQN A;  2YXH A;  3HR0 A;  4K8X A;  4RZR A;  4KX3 A;  2DWQ A;  4O4L A;  4EKW A;  2HBJ A;  1L8L A;  4C4S A;  3M7D A;  3JAR A;  4DV7 O;  3DV9 A;  4ZOL A;  4JV1 A;  4OCZ A;  4KLJ A;  2GO7 A;  1UJW B;  2NNU A;  5KFD A;  3N7R C;  4R8U A;  3K4G A;  3K9S A;  1NOM A;  5J0S A;  1DLB A;  3ETL A;  2OEH A;  2B1I A;  3AK1 A;  4FS2 A;  5ALS A;  3OSN A;  1HUZ A;  1OV9 A;  2VA8 A;  1UT8 A;  1AVM A;  4KP4 A;  2Q4P A;  4ELT A;  4HYK A;  3AUO A;  1XDC A;  3E22 A;  4UCO A;  2MRL A;  4RUE A;  1WNS A;  5AM0 A;  1VQ6 V;  2Y48 A;  2JH7 A;  3CB2 A;  2WA3 A;  1K9M W;  2HHV A;  3PN1 A;  5LMN B;  1GN6 A;  3OD4 A;  4EB6 A;  9ICJ A;  5HMM A;  2EZY A;  5EYP B;  3RBD A;  1SZP A;  5L1M A;  3LDE A;  4O4L B;  3KBB A;  3ZMT A;  3WK4 A;  2W6J G;  2ZM6 B;  2AGO A;  3JAR B;  3NTU A;  2XAJ A;  2B9Z A;  3RYF A;  2VWK A;  3OE7 G;  4IR1 A;  1EZJ A;  2ODM A;  2E5L O;  4R8U B;  3K04 A;  2XOK G;  3CX5 F;  3W7T A;  2EIK B;  3FYH A;  9ICW A;  2EIK C;  2PY5 A;  2N05 A;  1UCV A;  1U47 A;  1IXR A;  5KFE A;  1DGJ A;  5B66 Z;  3RTV A;  4IRC A;  3JPQ A;  4ECT A;  3QU2 A;  2QA4 V;  4DUZ O;  4TQF A;  2KJ8 A;  1XHX A;  4NLK A;  1H2S B;  1JRO A;  3OGC C;  5AKH A;  3ZIA G;  5B66 U;  5ALD A;  3G4S V;  4DEZ A;  4DR6 O;  5HML A;  1KD1 W;  5L1K A;  2PYJ A;  2ZNJ A;  4WJ3 B;  4X9Q A;  2ZJA A;  2AHZ A;  3SDL A;  4BW9 A;  4EB6 B;  2GV9 A;  3QVN A;  3SR2 C;  4DOC A;  2QTS A;  3RYF B;  5T14 A;  5EWG A;  8ICH A;  1XHZ A;  1ROP A;  5KT3 A;  5CA3 A;  1ZQJ A;  1J2M A;  2OYY A;  4RUA A;  4PHZ A;  3GIM A;  4J9Y B;  1N34 O;  3RR8 A;  1O9G A;  1QSY A;  5CA0 A;  4DS4 A;  2QB0 A;  3DTU B;  2DUY A;  4YIP A;  5KT2 A;  4HYO A;  1Y6X A;  1SQF A;  4RT2 A;  2Q7G A;  1KBU A;  4GC7 A;  2HMX A;  2LYA A;  3B8M A;  2RLT A;  4QE7 A;  3L74 H;  2DL0 A;  8ICF A;  4MSW C;  3HPO A;  5EE3 A;  1RM6 C;  4RQ6 A;  5JCO A;  1M6Y A;  5LHG A;  1N0N A;  1NVP B;  1VQ9 V;  4EEN A;  2ZIW A;  8ICT A;  1N36 B;  2KKW A;  4LVS A;  1T5E A;  2GLE A;  2RDI A;  3QU9 A;  4J9N A;  2Y0I A;  4IL6 Z;  1QVF U;  1ZD5 A;  1SKV A;  3KKY A;  4EZ9 A;  4A5U B;  2D3D A;  3UM9 A;  5KFP A;  3WFV A;  4ECX A;  2ZIV A;  3RAQ A;  1SV4 A;  2JDI G;  2Z3Y A;  2XCA A;  4U7N A;  2AGQ A;  3DXR A;  3MHS C;  5CA0 B;  4JAV A;  2QB0 B;  1PUZ A;  3A0R A;  4ECQ A;  3NRW A;  4DOB A;  4YHH B;  2ZUD A;  5JU5 A;  2ADQ B;  3ABK B;  3ABK C;  4GZR B;  4B3M B;  3FB6 C;  3QO5 A;  1XI1 A;  1IBL B;  3SAG A;  1WN7 A;  1U45 A;  3TKA A;  3PW5 A;  3ZRX A;  5JCO C;  5ALV A;  3PSI A;  4O4H A;  4IRK A;  2ZIW B;  4F6E A;  1PL4 A;  2LBO A;  1QQ6 A;  1R3K C;  4PD4 F;  4JI3 B;  1YZ7 A;  2ZIV B;  4ED0 A;  1J95 A;  3VC8 A;  1K97 A;  5KFA A;  1S5J A;  1K1S A;  8ICO A;  5CB1 A;  5DEC A;  3DXR B;  4KX5 A;  5K1P A;  1OW5 A;  1BQ0 A;  1DTO A;  2PFO A;  1GN3 A;  4EBD A;  4K4I A;  8ICA A;  2EAP A;  3LYS A;  3J81 j;  2HOI A;  9ICF A;  4NL9 A;  4P30 A;  3FB8 C;  1NU1 H;  1ZQP A;  4FZ1 A;  1BPZ A;  4O4H B;  1JJO A;  4DUY O;  2P4V A;  4PGY A;  4RO2 A;  3SJC C;  4IQU A;  4Q8F A;  2ZIU B;  3UCS C;  3ZHU A;  1D8L A;  1K92 A;  2C28 A;  3SYA A;  1ZD2 P;  4BWJ A;  4DSE A;  4EEL A;  3PO4 A;  3HKB B;  4IRD A;  3SGI A;  2WAQ C;  1ZQG A;  4DF4 A;  1ZOL A;  1TFR A;  3S6J A;  2Q0Z X;  2LFS A;  3QNM A;  5JVD A;  5L3C A;  2MA1 A;  2Y0S C;  3H8S A;  1NK5 A;  2I1Q A;  1JX4 A;  1GRJ A;  5DM6 V;  3TI0 A;  2XAH A;  1N61 A;  3GVM A;  2JEF A;  1XQ8 A;  4JI1 O;  1NTZ H;  2JK5 C;  1URJ A;  1PVP A;  3E2E A;  3OAA G;  4NL9 C;  2YI8 A;  1TUE B;  4UB2 A;  3HJE A;  4JWM A;  2X0L A;  2YSU B;  3JCU Z;  1TE2 A;  4F93 B;  1PVR A;  3PZP A;  1DF5 A;  4GCZ A;  4BWM A;  1OHH G;  3CNH A;  4I9W A;  5LA6 A;  1RQL A;  2W0F C;  1AI5 A;  3EPI A;  1MN8 A;  4NXN B;  4I29 A;  1AB3 A;  1K1Q A;  1ZJN A;  1B06 A;  1D8Y A;  2QM7 A;  1YHQ V;  1S5L Z;  9ICT A;  2Q0A A;  3JPN A;  2G08 A;  4OPA A;  1P7G A;  2OTJ V;  4U6P A;  4MFF A;  5AKJ A;  2HHX A;  3MGI A;  2UXD B;  5JVD B;  3PVX A;  2AGP A;  3AN1 A;  4I50 A;  5AK4 A;  5EIB D;  1S5L U;  5KAI Z;  4JF3 A;  4PA9 A;  2GUZ A;  2OT5 A;  1MMM A;  2E75 B;  4EX7 A;  3RH6 A;  1QQ7 A;  5ALP A;  2YXL A;  2K8B B;  2BPG A;  1W2B U;  4M9J A;  4CH4 A;  4JK1 A;  1SQX H;  5KLV H;  3LNM B;  4ECY A;  1QTM A;  3H1H H;  2NYV A;  3OMI B;  5LA6 B;  3IM1 A;  4KLS A;  1T4G A;  3FB7 C;  5KHJ A;  4OO1 J;  1XMQ O;  3GIK A;  4X64 B;  3T1C A;  4D6T H;  2ZTC A;  2AZ0 A;  2G06 A;  3C5F A;  3ZRV A;  1YJN V;  1JAL A;  4QZB A;  1VQ7 V;  3PST A;  4I50 B;  4J7K A;  3S3W A;  3A0H Z;  3VBB A;  4FK5 C;  2ZJ8 A;  5KAF U;  2GUZ B;  2ZTE A;  4TT3 G;  1RDF A;  1V97 A;  1NH2 B;  2N04 A;  1ZAU A;  3I56 V;  5DBA A;  3CW2 C;  5ALG A;  3KHH A;  2IMW P;  3ZDB A;  3ETD A;  5DED A;  3A0H U;  4NY8 A;  1CRX A;  4DSJ A;  3TAP A;  1TAU A;  2AW9 A;  1S77 D;  5DG8 A;  1KEC A;  1P4R A;  4NYK A;  4GUN A;  4PDV A;  2H3Q A;  2FLN A;  5L3F A;  4OJO A;  1Y67 A;  4UVC A;  5IE9 A;  1YTF D;  7ICO A;  2BCR A;  4I0X A;  4YY3 O;  3BA8 A;  1N4C A;  2AGA A;  1Z2G A;  1L0L H;  5KMG A;  5F2V O;  2W8K A;  4U3F H;  8ICP A;  5AKG A;  1S0V A;  9ICX A;  1S3J A;  1L7O A;  2Y4T A;  1DF4 A;  1OCR B;  1OCR C;  4PI0 A;  2LFR A;  1G6U A;  5E79 U;  1E1Q G;  3P3N A;  2UUA O;  4FM1 A;  4K4H A;  2C2R A;  1VQ4 V;  1DRG A;  3T1H B;  3PW7 A;  1F4N A;  1FKA O;  4KFM A;  2JXJ A;  2XI9 A;  3E58 A;  1XU4 A;  5FP0 A;  5J0Y A;  3C3S A;  4ECZ A;  2WPD G;  1VQK V;  3PX4 A;  5EBM C;  1MOF A;  3NGD A;  2FLP A;  2KKV A;  3B77 A;  3O9O A;  2QKC A;  2QLT A;  4DR7 B;  2DQN B;  2NO4 A;  2YEV B;  3PR4 A;  1K5O A;  4I0X B;  4XDJ A;  2YMQ A;  2N74 A;  1YF2 A;  5KMG B;  3HP6 A;  2YID A;  4DR3 B;  3L72 H;  4LF6 B;  1VQN V;  3BJY A;  1I08 A;  4JV5 B;  5KG7 A;  2JIZ G;  3CRQ A;  2IU0 A;  4GLX A;  3K59 A;  4UAT A;  3OFN G;  4DW1 A;  1MAB G;  4NLC A;  5HNK A;  4F2R A;  2EZP A;  2JHD A;  8ICR A;  5ALH A;  3B40 A;  5HR7 A;  2I9G A;  4WFH A;  1Y88 A;  5KUK A;  4LF7 O;  9ICR A;  2JVD A;  2DW4 A;  5KG4 A;  2GHY A;  2XAG A;  3U10 A;  2JS3 A;  7ICP A;  1SB3 C;  3D2S A;  2AHY A;  4R6Z A;  7ICI A;  1Q6U A;  4B9N A;  5DB9 A;  1U96 A;  4UAV A;  3MDS A;  1M90 W;  3CRM A;  3ZS8 C;  4NTW A;  9ICV A;  1HNZ B;  1T3Q A;  2KIW A;  3Q8P B;  2KSD A;  2P6U A;  1IBK O;  2BE3 A;  5H9C A;  2EIN B;  3RJE A;  2EIN C;  1XL4 A;  2WF8 A;  3UPQ A;  5G5H A;  1SQP H;  3JYC A;  1ZQQ A;  2WB1 C;  4I2C A;  1M57 B;  1M57 C;  4MW8 A;  2MW2 B;  3OW2 U;  4UCT A;  4CBC A;  2CTP A;  4WFE A;  4AI8 A;  1IXB A;  4WFA V;  1URF A;  5CN0 A;  2FMQ A;  1NKE A;  1NR7 A;  3ZED A;  1MC8 A;  2Q6A A;  1N56 A;  2NRV A;  2KK0 A;  1IIP A;  1XMO B;  3ZMV A;  2MUT A;  4IYI A;  1FIQ A;  5J2B A;  4EBC A;  2MK3 A;  3WK7 A;  1LV5 A;  2KD1 A;  1WPB A;  4BX9 C;  2NV3 A;  2JH1 A;  4R7C A;  3ZMZ A;  2CN1 A;  4UAZ A;  1AJN A;  4A8E A;  3D3I A;  1NS1 A;  1N8R W;  1HUO A;  3UO2 A;  7ICH A;  3MR3 A;  3NR7 A;  1ZX3 A;  1HR0 O;  4MTF A;  3EWA A;  2XY7 A;  2KFZ A;  2RRD A;  1RYS A;  4B08 A;  4RUC A;  3APO A;  4O5K A;  3K75 D;  4TUY A;  5ALF A;  3IG8 A;  1AJP A;  2HR3 A;  5AKI A;  2QE7 G;  5KT5 A;  2QKS A;  5B3S B;  5B3S C;  4DLE A;  3QTC A;  3OJU A;  1U49 A;  3W7W A;  5AKL A;  2K60 A;  2DPI A;  2ETN A;  1IG6 A;  2BHN A;  2CAZ C;  3RW0 A;  4RQ5 A;  8ICJ A;  4DL3 A;  2MUT B;  2F8K A;  4GX1 A;  4UUJ C;  2E8M A;  4DV1 O;  1T8E A;  3NRZ A;  3AL0 B;  5EOZ A;  3RB6 A;  1JX9 A;  2NN4 A;  1O08 A;  1FFT B;  1TUB A;  1Z3E B;  1RYU A;  2Q67 A;  1SES A;  4FLZ A;  2LW7 A;  3WK8 A;  1S5H C;  1IVS A;  1DK1 A;  1COO A;  3I1Y A;  4JTA B;  3T4D A;  2A7W A;  4DCC A;  1MZE A;  2HHH O;  4Z2W A;  2G09 A;  5AIC A;  2BPC A;  1AP6 A;  2WLM A;  2Y4U A;  3MDC A;  4FPP A;  1KQS U;  3MGH A;  4DQI A;  1UPG A;  3VCB A;  3HWT A;  1LNQ A;  1I5Y A;  1P7B A;  5FL7 G;  4C8M A;  3ISD A;  3C2K A;  4NLG A;  4QW9 A;  2PZS A;  3ZMS A;  3ORY A;  1PV0 A;  4U3J A;  5A9G A;  3GIL A;  2QWR B;  1TUB B;  2KSO A;  4PA6 A;  2G38 A;  3ZHV A;  3ETG A;  3LVV A;  5KA6 A;  1RFY A;  5G5G A;  1THZ A;  4XDL A;  4Y2R A;  1JR9 A;  4LFB B;  3ZN0 A;  2H8P C;  5KG5 A;  4F5Q A;  3CCU V;  1KTQ A;  2R8G A;  7ICN A;  1KQQ A;  4CS4 A;  2KG5 A;  2CTW A;  1XC9 A;  1NK6 A;  4M47 A;  1LR1 A;  4H33 A;  4J9Z B;  1NKB A;  4FM2 A;  2W9B A;  5EK0 A;  9ICL A;  2Z5U A;  4UB3 A;  5BY1 A;  2J6T A;  4Y2S A;  4X65 B;  5ALY A;  2PGG A;  4ZKI A;  3NS1 A; 
#chains in the Genus database with same CATH homology
 3CPW U;  4CRX A;  4OJL A;  3K03 A;  4JAS A;  4FIP C;  3E35 A;  5L3G A;  1RPR A;  3WG7 B;  3WG7 C;  1IXM A;  1F4M A;  3BEH A;  1JOY A;  3D2N A;  3CP1 A;  4HAM A;  4WFH A;  1NR1 A;  4AYB C;  1A6S A;  1F44 A;  4GX2 A;  3K9A A;  4KX3 A;  4EKW A;  2HBJ A;  3FYI B;  3M7D A;  2W03 A;  4DO2 A;  3SQI A;  4P0Q B;  1UJW B;  2NNU A;  3N7R C;  4MW3 A;  3K1Z A;  2IH3 C;  3CXC U;  1GK9 A;  1DLB A;  2B1I A;  4FZM A;  1L1F A;  1A0P A;  3OEH G;  1Y66 A;  4KP4 A;  2P90 A;  4QNH B;  3ASO B;  3ASO C;  4MTO A;  2MRL A;  2ZDI A;  4RUE A;  1VQ6 V;  3I55 V;  1V55 B;  1V55 C;  2Y48 A;  2JH7 A;  3ABT A;  4N21 A;  1K9M W;  4PA4 A;  1NBM G;  2IW5 A;  2V1D A;  3IFX A;  1YJ9 V;  1KP3 A;  3JD2 A;  4BAY A;  1PKX A;  2CPR A;  2VKQ A;  2LHT A;  3LDE A;  1H8E G;  1ARO P;  3K0G A;  3ZCC A;  1KP2 A;  2W6J G;  2WAQ F;  2X7R B;  3F7V C;  3ZMT A;  4LC1 A;  2XAJ A;  2ZXH A;  4JMU A;  3C29 A;  1BHB A;  3OE7 G;  2Y0S F;  2JGA A;  1EZJ A;  4KMO B;  2YX8 A;  2XAF A;  2DQ0 A;  2XIC A;  2XOK G;  3K04 A;  4P9O A;  3W7T A;  2EIK B;  2EIK C;  3MHH C;  4WFF A;  1YJW V;  2XVT A;  3F2B A;  4JYB A;  2KV2 A;  4PEL A;  5C0Y A;  4TWK A;  2JEU A;  5KL1 B;  2QA4 V;  2KJ8 A;  2ZDI C;  3SPJ A;  2EIM B;  2EIM C;  4E2L A;  3OGC C;  3ZIA G;  4PL1 A;  4H37 A;  3G4S V;  3CCL V;  4UVB A;  3H0L B;  5CRX A;  3DEE A;  1KD1 W;  4MVM A;  3P32 A;  2CK3 G;  4WJ3 B;  4LCU C;  2AHZ A;  4MTG A;  4BJQ A;  2OTL V;  4X89 A;  3CYM A;  4WFG A;  2YB4 A;  2M0N A;  4IC9 A;  1WLE A;  1SZH A;  2ITD C;  4PL2 A;  4P2Z A;  1Z1B A;  3E0F A;  3N7P D;  5T14 A;  1OCZ B;  1OCZ C;  4YXW G;  2YB1 A;  4JGS A;  1YSC A;  1WPX A;  1ROP A;  5CA3 A;  1K4D C;  3SMV A;  3ASN B;  3ASN C;  2WLK A;  2F8L A;  2XID A;  2OYY A;  5CBH A;  5DN6 G;  3O0F A;  4J9Y B;  4ZBM A;  5EC2 C;  4FJC C;  3DTU B;  3LSS A;  4ICA A;  4HYO A;  4TSF G;  3M6Z A;  1NJI W;  2ZD9 A;  3G71 V;  1KBU A;  2HMX A;  2LYA A;  3B8M A;  1VQ5 V;  2OXO A;  2HVK C;  4QE7 A;  3KZX A;  3AG1 B;  1JPX A;  3AG1 C;  4MSW C;  3W7U A;  1YI2 V;  1NVP B;  2WLH A;  1VQ9 V;  5LHG A;  3H0M B;  3LVW A;  2ZIW A;  1VQL V;  5A0L A;  5L3E A;  2JEX A;  1Q82 W;  1ENV A;  1QVF U;  3SPH A;  4OJ5 A;  1JVM A;  3WFV A;  3CCJ V;  3CCR V;  2ZIV A;  3T79 A;  1G4Y B;  2DYS B;  2DYS C;  2Z3Y A;  2JDI G;  4R8C A;  5IYC O;  1CEZ A;  3JCZ A;  4U7N A;  3F5A A;  4XBF A;  5CMU A;  4OJ6 A;  3MHS C;  4JTC B;  2G0A A;  3K06 A;  2KOB A;  4JAV A;  2XAQ A;  3A0R A;  3OR6 C;  3NRW A;  3NUQ A;  2E5S A;  1Q3V A;  3ABK B;  3ABK C;  3NXS A;  2FTK A;  3GU3 A;  4BIZ A;  3FB6 C;  2A9H A;  3QO5 A;  2KNJ A;  2VJ5 A;  3SAG A;  4MS2 A;  1M1K W;  3ZRX A;  3E89 A;  2KIC A;  3F5W C;  3PSI A;  3G6E V;  1SER A;  2DQ3 A;  2ZIW B;  1W0K G;  2LBO A;  3SPI A;  2IJK A;  1PL0 A;  1B6Q A;  1R3K C;  1PD3 A;  3AQF A;  1GMG A;  3E8H A;  3FB5 C;  2OH2 A;  1MA7 A;  1VQO V;  4JPR A;  2ZIV B;  1J95 A;  2R9R B;  3VC8 A;  3HPL C;  1K97 A;  1V54 B;  1V54 C;  2HKO A;  5IYB O;  2ITC C;  1W0J G;  4MVO A;  3OPX A;  2KB1 A;  2LKY A;  4KX5 A;  2B5U A;  1RPO A;  1DTO A;  2Q68 A;  3RF9 A;  5E1A C;  2X6B A;  3IN5 A;  4MT8 A;  5L3D A;  1BL8 A;  2W7P A;  3OR7 C;  3E8F A;  2PMZ F;  3LYS A;  3N7S C;  2HOI A;  4F4L A;  2DYR B;  2DYR C;  2JJ2 G;  1S76 D;  4P30 A;  3FB8 C;  3CMA V;  1ECW A;  2K89 A;  1OCC B;  1OCC C;  3CME V;  2JJ1 G;  2IH1 C;  1Q7Y W;  4RO2 A;  2ZIU B;  2X6C A;  1K5S A;  1K92 A;  2PI4 A;  1P7D A;  2K1E A;  3SYA A;  3IG5 A;  1HIW A;  1GO3 F;  1COW G;  1R3I C;  3ABM C;  3ABM B;  1E79 G;  1K3E A;  3EFF K;  4JTD B;  3IC7 A;  1HEK A;  2WAQ C;  3LDD A;  4FZN A;  2LFS A;  3CCM V;  3CC7 V;  5L3C A;  2MA1 A;  3F53 A;  2Y0S C;  2ZIX A;  1K34 A;  2GSM B;  4MVR A;  5DM6 V;  1R6N A;  2EIL B;  2EIL C;  3GZF A;  2A3V A;  1XNS A;  2XAH A;  2ZR2 A;  2CRX A;  1NQT A;  1R73 A;  4LP8 A;  2F76 X;  3W7S A;  3ALR A;  1CPY A;  3CCV V;  1MSW D;  2JK5 C;  1URJ A;  1PVP A;  3OAA G;  3E2E A;  1TUE B;  2ZXI A;  2ZR3 A;  2N1R A;  2RHF A;  3SAF A;  2BOC C;  2H3V A;  2KKP A;  2E1F A;  3HKZ F;  4NLB A;  2X0L A;  2YSU B;  4N23 A;  5LGT A;  4QPK A;  1PVR A;  3PZP A;  1DF5 A;  4GCZ A;  3PSP A;  1OHH G;  1GM8 A;  2XAS A;  4I9W A;  2W0F C;  1VQM V;  1AI5 A;  1GM7 A;  2WSS G;  1SRY A;  1I5X A;  2QM7 A;  4X8A A;  1YHQ V;  2QTO A;  3P30 A;  4MVQ A;  2G08 A;  3GB7 C;  2OTJ V;  4U6P A;  1SET A;  5IY5 B;  5IY5 C;  5LGU A;  1E1R G;  3MD0 A;  4UV8 A;  3SPG A;  2WB1 F;  4GFJ A;  5CBF A;  3BY6 A;  3TET A;  2ZIX B;  2WAM A;  1NZB A;  4NV0 A;  4JF3 A;  4PA9 A;  3JD4 A;  2OT5 A;  3JD3 A;  2UXX A;  3IGA C;  1Q86 W;  4R7C A;  3SJQ C;  4UXN A;  4U7O A;  4P9P A;  2K8B B;  3LDC A;  4BUG A;  1FXK A;  1H2G A;  3KG2 A;  5B1O A;  3T4Z A;  3UKM A;  4MTX A;  1W2B U;  2QEX V;  4CDG A;  1Q3U A;  3LNM B;  3AQE A;  5B1B B;  5B1B C;  3OMI B;  3QNE A;  3CC4 V;  3FB7 C;  4BW5 A;  4QNL A;  4OO1 J;  3E86 A;  2W7O A;  2Q69 A;  4FMT A;  3T1C A;  3ZN1 A;  5J9P C;  5B1N A;  1GKF A;  2G06 A;  2NLJ C;  2H3Z A;  4R50 A;  2H94 A;  3DGE A;  3ZRV A;  2DWD C;  1YJN V;  3ETE A;  1VQ7 V;  3PST A;  4L87 A;  4C0Z A;  2ZXW B;  2ZXW C;  5B1A B;  3PJS K;  5B1A C;  4FK5 C;  5HFL A;  3VBB A;  2F2A B;  2OM6 A;  4WF9 V;  1QBZ A;  4XDK A;  4TT3 G;  1NH2 B;  1K5Q A;  1YTF B;  3I56 V;  5L3B A;  4P0P B;  1BHA A;  3ETD A;  2HOQ A;  3MGV A;  1FXK B;  1FXK C;  1CRX A;  4ACO A;  4CZZ A;  3ICX A;  2G07 A;  4G2K A;  3ZRW A;  2LYB A;  3AG2 B;  3AG2 C;  3D36 A;  3H0R B;  1S77 D;  1KEC A;  1P4R A;  4QE9 A;  1ZQ1 C;  3D2Q A;  2WLI A;  1ZWI C;  2WLJ A;  4UV9 A;  3RVZ A;  4PA7 A;  3CCQ V;  4PDV A;  1NVP D;  2H3Q A;  5L3F A;  3E8G A;  4OJO A;  4UVC A;  3F5E A;  1FS0 G;  1NH2 D;  1AJQ A;  1OCO C;  1OCO B;  1AI7 A;  1KC8 W;  1YTF D;  2P67 A;  1BMF G;  1AI4 A;  1PNM A;  3RVY A;  3ABL B;  3ABL C;  1FXH A;  1S3J A;  1S0V A;  2XND G;  3K0D A;  1QVG U;  1K8A W;  2PI5 A;  3C28 A;  1DF4 A;  1JQ0 A;  4GX5 A;  1OCR B;  2ZIU A;  1OCR C;  2DGZ A;  1T94 A;  3FKS G;  1GM9 A;  2LFR A;  1E1Q G;  4KUM A;  3M99 B;  2KEY A;  3QO7 A;  3TK1 A;  3ZRW B;  2VIX A;  4QJF B;  1VQ4 V;  3R65 A;  3X2Q B;  3X2Q C;  1DRG A;  5EBL C;  2KHV A;  1F4N A;  3RBZ A;  4KFM A;  2XI9 A;  2D6F C;  5EC1 C;  2DF4 B;  1RM1 B;  1RM1 C;  2PMZ C;  3ONN A;  1PNL A;  3E8B A;  2G5I B;  4RQF A;  2WPD G;  2WLI B;  1VQK V;  5EBM C;  1VQP V;  1MOF A;  4GT1 A;  3FYE B;  3STZ C;  2KKV A;  3B77 A;  1R3L C;  4JYC A;  3SYP A;  5HFM A;  3AEI A;  2DQN B;  2YEV B;  4FE3 A;  4XDJ A;  2OCC B;  2OCC C;  1VQN V;  2WWW A;  2ZG6 A;  1MG1 A;  4PDR A;  4U7C A;  2JIZ G;  1AR1 B;  2Y69 B;  2Y69 C;  2K4E A;  2IU0 A;  3SYO A;  5IYD O;  2A0L A;  3F2D A;  3B8N A;  1Z19 A;  3OMA B;  1R3J C;  3OFN G;  4WCE V;  1MAB G;  4NLC A;  2W6I G;  2VJ4 A;  1YT3 A;  4NWI A;  1TAM A;  2JHD A;  4QIW C;  2RP5 A;  2EZP A;  5HR7 A;  2EIJ B;  2EIJ C;  2R9I A;  3K3W A;  3ABU A;  4RUF A;  5KUK A;  1F23 A;  2DW4 A;  5EBW C;  5LGN A;  5KL8 B;  2GHY A;  3OEE G;  2XAG A;  3IP4 B;  3CD6 V;  5H6R A;  4QIW F;  3D2S A;  2AHY A;  3JD1 A;  1NKD A;  4AYB F;  1EBO A;  4R6Z A;  5LHI A;  4RQE A;  3HKZ C;  1M90 W;  4PDM A;  2KIW A;  2EBO A;  3CCS V;  2HBK A;  2HFE C;  3ML0 A;  2HBL A;  1S72 V;  1K4C C;  5H9C A;  2EIN B;  2EIN C;  3OM3 B;  1QCE A;  1XL4 A;  5LBQ A;  1YIT V;  2F77 X;  4Z1M G;  5GW7 A;  2K4H A;  3JYC A;  2WLL A;  5BZB A;  2WB1 C;  1M57 B;  1M57 C;  4MW8 A;  5CBG A;  2B1G A;  3OW2 U;  2HBM A;  4CBC A;  4WFE A;  3SAH A;  3SYQ A;  4ASU G;  4WFA V;  5CN0 A;  2HVJ C;  2HLD G;  1NR7 A;  1XL6 A;  2KHQ A;  1EFR G;  2Q6A A;  3M6K A;  2ATK C;  3GWO A;  1IIP A;  2JMG A;  3ZMV A;  2GH1 A;  2K4I A;  4O3M A;  3CP8 A;  2MK3 A;  3EHB B;  2LP7 A;  2KD1 A;  2X6A A;  4BX9 C;  2NV3 A;  2JH1 A;  1F51 A;  3ZMZ A;  1ORQ C;  2CN1 A;  1AJN A;  2EJR A;  2ZQM A;  4A8E A;  4CGZ A;  1XO0 A;  4P0P A;  3D3I A;  3CCE V;  3F2C A;  1N8R W;  2C2A A;  3JD0 A;  1ED1 A;  2IU3 A;  4MTF A;  4X88 A;  2KJ9 A;  2QM8 A;  2GOL A;  2RRD A;  4FZL A;  4JAU A;  3TCU A;  5C93 A;  5KUM A;  4DXW A;  2D3O W;  1L6N A;  2H3I A;  3IG8 A;  1AJP A;  2HR3 A;  2QE7 G;  2WLL B;  3SYC A;  1JCH A;  3T2M A;  4HZ3 A;  2QKS A;  2E1E A;  2BDU A;  2A79 B;  5B3S C;  1Y4M A;  5B3S B;  1YIJ V;  4RAI A;  1QR9 A;  1PNK A;  2KJ5 A;  4BIU A;  5IDJ A;  3W7X A;  3W7W A;  1WUD A;  1VQ8 V;  2IJH A;  3RW0 A;  3K79 A;  2P7T C;  2Q4T A;  3LUT B;  2IJJ A;  4GX1 A;  2V7Q G;  2UXN A;  4UUJ C;  2HOF A;  3AL0 B;  2F43 G;  3E83 A;  3KFU F;  1SZT A;  4MVZ A;  1JX9 A;  1FFT B;  1GTO A;  2Q67 A;  3ZMU A;  5KA5 A;  1SES A;  2EZO A;  4Q20 A;  1S5H C;  5LHH A;  1D8B A;  3HB3 B;  4QPJ A;  4JTA B;  3T4D A;  2G09 A;  1M56 B;  1M56 C;  2W04 A;  1K73 W;  4G28 B;  1OUQ A;  2P6J A;  1FXV A;  4I5S A;  2WLM A;  4PDL A;  2G5H B;  3CC2 V;  3AG3 B;  3AG3 C;  4FPP A;  1CP9 A;  3F7Y C;  2KVC A;  4UVA A;  2YEV A;  3PSF A;  3LSQ A;  3SPC A;  1KQS U;  1H38 A;  3VCB A;  1LNQ A;  2BOB C;  1KKD A;  1I5Y A;  2WLN A;  3OUS A;  2R18 A;  1P7B A;  1G8M A;  5FL7 G;  1H8H G;  3QO8 A;  4GX0 A;  3ZMS A;  1QLN A;  2H3F A;  4OJP A;  1R6K A;  2HG5 C;  3OUF A;  4G27 B;  4PA6 A;  2M7W A;  4MVS A;  3ETG A;  3LVV A;  2Z7J A;  5KA6 A;  1THZ A;  1HWY A;  4XDL A;  3AG4 B;  3AG4 C;  3CYO A;  2K8A A;  3ZJZ A;  3ZN0 A;  1UPH A;  1K7D A;  2H8P C;  3CRX A;  2HJF C;  2IJI A;  2K8C B;  1K33 A;  5H6Q A;  3ZRS A;  3CCU V;  3L3F X;  3UM7 A;  3RFA A;  1Q81 W;  4P0Q A;  3VOU A;  1PVQ A;  3K08 A;  4PA3 A;  3STL C;  4H33 A;  1OZ0 A;  3H01 A;  4LBE C;  4J9Z B;  5HR6 A;  1QR8 A;  5EK0 A;  2Z5U A;  1QLE B;  1QLE C;  4OXS A;  1AI6 A;  3OMN B;  4MVU A;  1JJ2 U;  2DWE C;  4WFB V;  4ZKI A;  1M9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...