1GO3F

Structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
MIGKKILGERYVTVSEAAEIMYNRAQIGELSYEQGCALDYLQKFAKLDKEEAKKLVEELISLGIDEKTAVKIADILPEDLDDLRAIYYKRELPENAEEILEIVRKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Archaeal Homolog of the Eukaryotic RNA Polymerase II Rpb4/Rpb7 Complex
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE SUBUNIT E
total genus 33
structure length 107
sequence length 107
chains with identical sequence N
ec nomenclature
pdb deposition date 2001-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1go3F01
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1go3F02
4CGZA 4QJFB 4OO1J 1WUDA 2HBKA 4CDGA 4QIWF 3SAHA 2KV2A 2HBLA 3SAGA 4NLCA 2CPRA 2HBJA 2MA1A 1GO3F 2DGZA 3SAFA 2E1EA 4NLBA 1YT3A 3CYMA 2E1FA 2RHFA 4O3MA 1D8BA 2HBMA 5C0YA 2RRDA
chains in the Genus database with same CATH superfamily
4JAAA 3OTQA 4JV2A 2CUGA 1Q8KA 4NTWA 3ZDCA 3CMEV 2ETNA 4CDGA 3BQ2A 2QARA 4BW5A 4JTAB 3GIKA 2VIXA 3IC9A 2ZE8A 3SAGA 4WBNA 4P9OA 4J9PA 7ICLA 2R9IA 4NJ8A 4UAUA 1W0KG 3V72A 2ZNIA 3SZ2A 5J2EA 3D8CA 2LPEA 2ZIWB 2ZQMA 2HOQA 4GLXA 3WK5A 4DR7O 3V7JA 3K5NA 4FLZA 4N21A 2JV3A 4RNOA 2W3RA 2P5OA 1XNQO 3ISCA 1S0OA 3ASNB 5CA1A 4DQPA 1YJNV 3C5FA 3A0BU 5LHGA 4D7SA 3KOOA 4Y2RA 5ALLA 1P7GA 4DK0A 4FZLA 1I5XA 3K4GA 4X20A 1ZYQA 4P30A 1FAFA 4C8LA 1DGSA 2P6UA 3H8SA 1OCRC 1ZQMA 4GFJA 3KG2A 4UCRA 5KFOA 1XHXA 1H2GA 3H1LH 3LDEA 3IJ4A 5T14A 4Y2JA 5F9LA 1PVRA 3QZ7A 5DECA 5AKKA 1YCIA 3UO3A 1AR5A 2ZXHA 1ZQQA 2FE9A 1IURA 1YJWV 1VQOV 3OW2U 3CEIA 5KG1A 4YN4A 1J2MA 4UCTA 2ATLA 3PMNA 4ECVA 3AG3C 3MGHA 5J2TA 1GN6A 2QM4A 4P2ZA 4I2IA 5AM5A 4JI8O 5LHHA 1TGOA 1LV5A 4QZDA 1X66A 2EAPA 1SB3C 4FLVA 4UB4A 4DLEA 2B1GA 1FXKB 2OTLV 3RYCB 4B3SO 2WAQC 3STLC 5IJ0A 1C7YA 3AMZA 8ICSA 5DBAA 3ZEDA 1SXEA 4LFCO 1NKDA 5KT5A 4OXSA 4L8JA 5LMNO 2HBJA 4O9MA 1PKXA 4ECSA 2CGNA 4O3PA 3WKEA 5B66U 2WTFA 1GO3F 4OJPA 1IIPA 3OTFA 2D2CB 4WFFA 2UXCB 3P3NA 4AHCA 2KZ3A 5ITZA 3PSIA 4MHVA 1H2KA 1K5QA 4PA7A 1U47A 2E74B 7ICGA 2W9CB 4Q6GA 2IW5A 3EHBB 1JXLA 3DV9A 3VQWA 5KFBA 4LP8A 1FXKC 2D3OW 1X6JA 2ZCEA 4RQ4A 3T3FA 2BDPA 4NB5A 1IBMO 2W3SA 3CRRA 4EELA 3OMIB 5H6QA 2E8PA 5J2BA 2JGUA 2A1JA 4EZ9A 5JCOC 2WF5A 5AKXA 1HWYA 2QKCA 4HYOA 5KFAA 3AG1B 1VDVA 2F1JA 4MVRA 5JVDA 3GWKC 1ZQWA 1SZHA 3Q8RB 2AGPA 3ABKB 5GONB 2YB1A 2P22C 2DUYA 3AK2A 1UQVA 4Y2PA 4CBCA 2XGQA 4FS1A 3OE7G 5DB6A 3M9MB 7ICSA 1L8OA 2IU0A 2K1EA 1Q6UA 4OJ6A 1PD3A 1L7NA 3K58A 7ICQA 2FMPA 1WP8A 2P4VA 3WKBA 2CE4A 4M9NA 5BOLA 4DOBA 4JB3A 3B40A 1KW4A 1ZL8A 4ECYA 2WB1F 5ALZA 4MVUA 3TAPA 5LGTA 1TK8A 4MVZA 4XDLA 5JWPA 2XHBA 2XTAA 1RG6A 5JQGA 1BSMA 5CWRA 4C8NA 3PW0A 1NKEA 3PR4A 4DRXB 4WJ3B 5AKLA 1H38A 3CCJV 1RM6C 3AN1A 4DR7B 5ALIA 5EE3A 4I50A 2JS3A 3BQTA 1SWVA 8ICZA 2DOSA 1RP3B 2KJ5A 2A0LA 2XGPA 5IIJA 1ZQKA 1N36O 2R70A 1BQZA 1M4UA 4B9TA 1VQKV 4B9UA 5DBCA 2FB5A 4GX5A 3GIMA 2LFRA 2DKZA 3D3QA 3AU2A 1RPLA 2L6LA 2IM9A 2RNBA 4NXMB 3JD3A 5JUMA 2IBKA 1XI1A 1ZQZA 2I6XA 5DQGA 4LFBO 1M6YA 5E79U 3QVNA 2XAQA 3K79A 3CC2V 2CGOA 2AHZA 3UMCA 3CD6V 3T1HO 2FTKA 3SAFA 4F5RA 1R6NA 2XAHA 3D2NA 4F4LA 4E2LA 4QZHA 4I2GA 4ED7A 4KMUA 1FFXA 2QA4V 5ALNA 4J41A 2F43G 5KUKA 3EZ5A 3PW4A 3ZS8C 2LM4A 5AKZA 2LGQA 2J6TA 2DL0A 5KFYA 2JGDB 4FLWA 2UXBO 2YB4A 1KP3A 3CW2C 1PL0A 5ALKA 4ZI7B 1Y66A 4JI5B 2HDOA 4CC6A 1E1QG 3ZRWA 5KMGA 1BPBA 4U3FH 3I76A 2QE7G 2OCCC 3ZMTA 2EJRA 2EZYA 2KSOA 2IOFA 3GDXA 3C21A 4BIZA 4UARA 4FO6A 2X6CA 3L9DA 4BR6A 3HKDB 9ICWA 4GC6A 5KX5A 3K5LA 5ALDA 2UXDB 3T1YB 1IXBA 5JRTA 2YS8A 5FP0A 3RYFB 2WB1C 3GFKB 5DBBA 4MEXA 2HKOA 4DR4B 1VEWA 4ELUA 1JOYA 2JZBA 2YEVB 2NO5A 4LJXA 2Q6AA 9ICHA 4F50A 1L3VA 3MAQA 4E4EA 4C0ZA 1OZ0A 5GTHU 3SYAA 3SYOA 4X1KB 4UV9A 4FPPA 3C28A 3WKDA 3QNEA 4DV3O 1N5XA 4RNNA 4X62B 1XNRO 3ZMUA 2EIKB 1VQNV 3L3FX 4M0AA 1BPXA 4YJ3B 4QW9A 1X6IA 2Z7JA 1W0JG 2BTQB 1RDFA 4ECZA 1BGYH 5A2QN 5J0RA 1WAZA 1TFRA 4I2BA 4F92B 2UXDO 3CRCA 2A3QA 3QO5A 4MVMA 2F2AB 3N2GA 4QZAA 3RYHB 4DUYO 9ICAA 1NS1A 1YXBA 5B1NA 4UQGA 4O4IA 1ZLZA 1OJHA 1Y6XA 4JI1O 1Z19A 2BPFA 2OEHA 1OCRB 4DL3A 2EIKC 4PD4F 2ILMA 1UJWB 3CYMA 5CA0B 4MW3A 2K60A 4UB3A 1MOFA 1D5AA 4PELA 3G6YA 4BWJA 2AGAA 4AYBC 3EPIA 3CNHA 3NASA 2CTQA 4JGSA 2KKPA 2P06A 3W7SA 1QVGU 1Q82W 2KKVA 4M9LA 2OT5A 3ABLB 4NM2A 9ICVA 3CYOA 3APQA 3ZHVA 9ICCA 5AK3A 5IYZB 2ZXWC 3T1HB 2W55A 4DV5B 4X1IA 4U6PA 5L3GA 3BRCA 1OCOB 1N62A 3OSPA 3Q8KA 2PFQA 1HNWB 3GV7B 4FZ0A 3RYIA 3NGDA 2CH7A 3BFRA 3THOA 1FJGO 2YX8A 4DQQA 3HRDD 5KL1B 5BY1A 4JI0B 3LSQA 5EE9A 4RUEA 4OD0A 2YIAA 2EZZA 1WCLA 4Z6EA 4TV9B 3ZHSA 3F7YC 4RQ2A 2ALZA 4J7ZA 3TJTA 8ICUA 3Q4HB 4P2HA 2KG7B 5J2FA 5D46A 5IJ9B 2V9WA 4MSWC 4FFBA 4J9ZB 4PGQA 5BMVB 4P4OA 4RUAA 5FNVA 1VF7A 1YI2V 4XDJA 3HP6A 4YFKA 4X8AA 5C8YA 2W11A 1J95A 1T5EA 3J80N 1W2BU 4DSIA 4NXNB 2YTUA 3SJQC 3MDSA 1MC8A 1D9FA 1R6TA 8ICJA 2E5LO 2KN7A 1TVKB 1VF6C 5JH7B 3B0YA 3D6JA 1BQ0A 1ZOLA 4RQ5A 1SIJA 3HPOA 7ICNA 4JZ2A 1HW7A 5KFGA 4LF9B 4NXMO 4RPXA 3ABLC 9ICTA 4NY8A 1ZQFA 1XDCA 3FYHA 3BABA 5KL8B 3SYCA 1XUQA 4YHHB 2KB1A 4YJ2B 4DV7B 3MDCA 4RPZA 2F93B 2QM7A 4BIOA 2BCRA 2WSSG 1HNXB 2F3NA 3OR7C 1N2XA 3IN5A 1KLNA 4WFAV 5LMUO 5H9CA 2C2EA 2KFNA 3LNNA 1SQVH 5BR8O 5KFXA 1QLNA 2F95B 5CBHA 3GILA 3P3PA 4U7NA 2VA2A 3LWLA 3HKCB 4BJQA 3HWTA 9ICOA 4D6TH 1VQ6V 2HHUA 2ZG6A 4AQYO 2K8CB 3PW2A 4QZCA 2W54A 3PX6A 3T5JA 4J7KA 4YXWG 3JCZA 2W9BB 4C7YA 1EZJA 2BQRA 1XMOB 3OJSA 5ALEA 2GUZB 4JI0O 3NTUA 1YZ7A 5L1KA 3F7VC 5KFSA 2WA4A 1PM9A 1IZ3A 4I2AA 1A6SA 4LZGA 4USAA 5EWGA 5IIIA 4LNUA 2ZTDA 3WFVA 3H40A 1QSLA 4YMOA 4O2BB 1GM7A 4PHAA 2Q5ZA 4QZBA 2K4HA 4UASA 3L74H 2ASLA 1KU9A 3OFNG 4Q8FA 2KV2A 2BZFA 5KFTA 2HHQA 2XY7A 1D2DA 4HNAB 5F2VO 4LF6B 3JSNA 1PK3A 1COOA 2JJ1G 3BHPA 1J5EB 2I5HA 5KHHA 4H37A 1YDXA 3DXRB 4UBBA 1GN4A 2VKQA 1XBLA 4EB6B 2HBMA 5C0YA 3H1JH 4MS2A 2EQYA 3E8FA 1Q3UA 4GYCB 2XNDG 1JN3A 5J0PA 5AICA 1IX9A 1PNMA 1DK2A 2ZTCA 1FPOA 3TAQA 1O9HA 4GZRB 3M8SA 3PX0A 3JD0A 2IH3C 2FLPA 3SPIA 1BZKA 1PL4A 1MSDA 3VQYA 2HVIA 2W8LA 1YVWA 1LB2B 4K4HA 2MA1A 1PVQA 3M8RA 2YIDA 4M6WA 2EILC 3RF9A 4QZIA 3C3SA 1SETA 2EINC 3UXPA 4YXJA 5BZBA 4IQTA 2FDRA 3CCVV 5EE1A 4O4JA 1Z1BA 2YI9A 3M99B 4DFPA 3MGVA 4IYHA 3TADA 1BNPA 4KLFA 4WF9V 2PYJA 5EE0A 1K73W 4O4LA 1WUDA 3OGCC 1SXDA 2KICA 3N7SC 2ZR3A 3QU2A 2KG5A 4P0PA 1F5SA 3GU3A 2WHEA 3B9JA 1Z1VA 1VQ8V 3AEIA 4DEZA 2AQ4A 2NRWA 4YIPA 4I7ZB 1Z5WA 4UAWA 4YQWA 3V6HA 4PHDA 3FB7C 3TACB 3DC5A 4UAYA 4XBFA 3BPZA 2IOFK 4G3IA 3AUOA 1CRXA 4PA3A 4PH5A 3OT7A 4BGDA 1NBMG 3AG7A 5ALYA 1S77D 3SPHA 2W6JG 4OX9B 1NZ6A 3JARB 3H4BA 3BQ0A 5J2HA 2C2DA 5FPOA 2B9ZA 4TQSA 3MR2A 1RYSA 2CTWA 1F7YA 4O0IA 3MFHA 4IRKA 1GH6A 4PDMA 3TK1A 5EWFA 2YMPA 1JMSA 9ICMA 3IM1A 3NRWA 3NS1A 1K34A 2QARB 5EIBD 3PSTA 3AG1C 1S8OA 4K35A 4JV5O 5CB4A 4PL1A 4M9JA 5EBMC 5DG8A 2LHTA 4FZ1A 5L3EA 3ZIAG 1N8RW 5KT2A 3E8GA 2X6AA 3N28A 2LI6A 3QU5A 1L3SA 3MFIA 2EBOA 3RH6A 2PFOA 3F53A 3ZRVA 3K04A 4TURA 1VF6A 4DV5O 3S3XA 2AZ0A 3J81j 2RQ6A 2UUCB 3AG2C 2XY5A 3KZXA 5J8YC 4RQEA 2H3OA 5DQHA 3THVA 1ZQNA 5CA1B 1Q8IA 1QNMA 3FAVA 1IBKB 2ODGA 3RW0A 1BHBA 4G2KA 1JA8A 1RM1B 1BHAA 2EIJB 3RJEA 1PVPA 2OM6A 2DQ0A 4NLCA 2HHXA 2Z3YA 3PVXA 2W0FC 5DB9A 4LR3A 2DKXA 1N32O 5CA7A 4RT3A 4DR3O 4ED2A 3LSSA 2A79B 1PK1A 5DG9A 4Y2XA 3RWRD 4DR2O 3QU9A 1SESA 5KG3A 1X9WA 2VS0A 3MBYA 5LYJB 3K57A 1UA1A 4JYAO 3SDLA 3KHLA 2K89A 2AHOB 4OCZA 2H3IA 3BJYA 3FB5C 5KT7A 1PNKA 5CP2A 5J2TB 4I28A 2YIBD 4K3AA 1M56C 4DR2B 1VARA 4FM0A 5IYCO 2VJ4A 1AJQA 3SENA 1ZQYA 3LK9A 4PPXA 3M9OB 5JJNB 1NKCA 1RZTA 1S0MA 1T8EA 4C7ZA 3H0MB 3CX5F 3C2MA 4I4TB 1FXHA 1ECWA 2JVDA 4C8OA 3SYPA 2JXJA 1QR8A 2EANA 4ZKIA 4LF6O 1SV0A 4RUCA 3ASNC 3G80A 3T2MA 2Y9TA 3KTQA 1YHQV 1ZQSA 1SGGA 3NUQA 5KLVH 3CCRV 2QB0A 3ZMSA 1ZRMA 1EN4A 2W9CA 3LSUA 5AHXA 2Y4UA 4DV1B 5D49A 4P0QB 4O2AB 5H2FZ 4XDKA 2ZINA 3T1YO 3TXSA 4IS7A 8ICIA 1S0VA 4US8A 4R7CA 2OCCB 2HJDA 3E0FA 1L7PA 2ZXIA 9ICRA 1K8AW 3B0XA 4R8UB 2ITCC 4UAVA 1SL0A 1BPEA 4C4TA 4MF2A 1ZSPA 3BQ1A 1NK0A 4TUYB 2MUTB 2EINB 2PI5A 5CN0A 1DF4A 1GM9A 4DFMA 5IIMA 2VA8A 3H8WA 5KFJA 1K9MW 4UCSA 4UCUA 4J9RA 4ECWA 3LNMB 1MSWD 1M57C 5L1LA 2KQXA 5DB7A 4CS4A 1R6KA 2ZDIC 2D3DA 4EBEA 4DRXA 5KHJA 3C1YA 3FM9A 3V7LA 5ALTA 2GWSA 1A0PA 2NYVA 4C4SA 5KT4A 4K8XA 4C8MA 1TK5A 3MR5A 4ICGA 4Z6CA 2ADPA 3ZD8A 2LO1A 1TV9A 4I2DA 5KFUA 4LFAO 4JI2B 1P7DA 3U10A 5H6RA 4DFDA 2UVUA 4RQ0A 4LBEC 1D9DA 5B1AB 1TE2A 9ICLA 2YSUB 4RPYA 3E2EA 4CS2A 1FXVA 1ZQDA 4NLGA 1OCCC 2ZUCA 1ZQUA 2XT9A 1EBOA 4DO9A 4KHPB 3LDDA 1MQ2A 1SZXA 9ICKA 9ICGA 7ICVA 3CHXA 5LA6A 4CF3A 5KFFA 3HKZF 2K4IA 1QVFU 2CRXA 3AQEA 2JRZA 4U7OA 5LHIA 3JCUZ 3BEHA 1G8MA 2W03A 4PA4A 2ZJ8A 5G5HA 1F0MA 1H2NA 4PI0A 2N1RA 4EEKA 5JTIA 1OW5A 4F8RA 5BOMA 2GV9A 2WLNA 1SQGA 3SEIA 2Y0PA 1NK6A 4B9SA 8ICOA 2DBYA 1NTZH 1A76A 8ICNA 5L3CA 3H8MA 1SS3A 1VMGA 2Q7EA 4DL5A 1TUEB 3V6KA 1NZPA 4YD2A 2XCAA 3O65A 3QEAZ 1IXRA 4DL7A 2ZJAA 2ZKOA 2AW9A 1U4BA 2BSKB 4DR6B 2X0LA 1K3EA 5ALWA 3GIJA 3BA9A 4DF8A 4KLMA 3ASOB 2CDYA 3QG5A 2K8AA 3ISBA 2H3QA 4EYHB 4O4HA 5AG2A 1QR9A 3HPLC 3C23A 3RB6A 5B1BB 3H0RB 4GXJA 2XCPA 4DV1O 3A8TA 2VRZA 1KFSA 4F6RB 4JK1A 1IG6A 2HW3A 1R3IC 3KHHA 3CRAA 2ASJA 2HMXA 5KX5B 4OJLA 1ZD4A 4UAZA 1MQ3A 1D8LA 1R3KC 3BZCA 3WK8A 1XS9D 3L71H 5K1PA 4EEYA 4EZ6A 4Y2UA 4BX9C 5AM1A 4RNMA 3ZHRA 1ZQVA 4TV8A 3C2KA 5IYBO 3A2FA 3OUSA 4G27B 2ESEA 5LMNB 2H3ZA 5KFDA 3QUBA 1NJYA 2EX3A 4UVCA 4J9SA 4LF5B 2HHVA 1D8BA 4J9YB 4DSJA 2P4KA 1RSOB 4JI1B 3AG2B 1FFTB 1DK3A 4B9VA 3A0HZ 5AIAA 3ZN0A 2BTQA 4I2JA 2BQ3A 1RYRA 4I29A 2EJ7A 3OMNB 5LGUA 3E58A 4LWSA 3W7UA 4F4ZA 4GXKA 3RFRA 2Q4TA 4JI8B 3NVYA 4H13B 2ZUBA 3UKMA 1RYUA 2JEUA 5J2CA 3D36C 3SAHA 2QSAA 2KD1A 1ZQOA 3EFFK 4ELVA 1ZX3A 4RQMA 2HP8A 4J9OA 4O4IB 4O5EA 1F4NA 2OH2A 2BCSA 3P32A 4X66O 3HKEA 4DV3B 4UB2A 2NO4A 1RPOA 1AR1B 3RJFA 1JFFA 5IT9N 4IIJB 4MTGA 1U45A 4O3MA 4C7UA 3Q8MA 2G5IB 4JPRA 4LF9O 1JROA 2RLTA 2IJKA 3Q8QB 7ICKA 2H3FA 2PTMA 2L35A 4NV0A 1SZPA 4F4KA 2MU2A 1G6UA 5D5QA 3X2QC 3MGIA 5B3SB 1V55C 2B0CA 4NXNO 2ES6A 4JUZA 4EX6A 1NK8A 2ZXWB 4FM2A 5D4BA 2O6KA 4UXNA 4UW9A 1QQ6A 5ALGA 3JD4A 2W8KA 2QTOA 2Y69C 3RYIB 2BQUA 4M47A 2CH7B 1JJ2U 4RUFA 2WF8A 4FZMA 5KNIA 5HFLA 5J2DA 1D5NA 2HVJC 2LW1A 3RH5A 3ABMC 4UATA 1VF5B 2XVTA 1AQ6A 5TISU 1AJPA 3HKBB 1VIBA 2R8KA 4TV9A 2FPKA 1S97A 1JX4A 4PV1B 1KB9F 5KHKA 3TFSA 3E22B 2HHHB 4J03A 3UXNA 3CRXA 3RR8A 3Q4HA 2A19A 5IJ9A 2YI8A 4B7EA 1NR1A 4DW1A 5DKWA 3HR0A 3KKYA 1HNWO 1SC5B 3E83A 8ICRA 5KAIU 4TQFA 5BMVA 2DQNB 2WLLB 4ZOLB 3D2QA 5LP6A 2JH1A 1WYGA 5F9NA 3SV3A 3G71V 4JWMA 3V6JA 4DV6B 1BNOA 2DPJA 4KLTA 1GKFA 5KUMA 2ZM6O 1ORQC 2N04A 9ICIA 4DSLA 3FKSG 4OGQB 1EN5A 3JPPA 2EIJC 2DWQA 3GQCA 4BWAA 4JYYA 4EFEA 3UMGA 2C22A 1I5YA 2KJ8A 1G4YB 3JAKA 4TQDA 3JAWA 4IRCA 1XL6A 4M9GA 3IDWA 1KBUA 1GTOA 3CSXA 1KYOF 1NR7A 1S5LU 5FL7G 3TCUA 2G08A 2XICA 4UFZA 4QNLA 5KG2A 5EYPA 1Z4OA 1ZWIC 1VQMV 4Y2TA 4IQVA 4UBCA 3SPCA 1M1KW 1LKYB 2GOLA 4BXOA 1ENVA 2WLKA 2WF9A 1UCVA 9ICUA 4I27A 4A5UB 5LOVB 7ICIA 2KK0A 3E89A 3FB8C 4KLIA 3SD7A 4X9QA 2LKYA 4FS2A 4HBNA 4KFMA 1COKA 1V38A 4X65B 2Q69A 2XY6A 1N56A 4F5QA 2PGGA 2EZPA 1TK0A 3CS5A 3HKCA 2I1QA 3PY8A 2LBOA 1T94A 3CJHB 3BY6A 3TXQA 3QX7A 1E79G 2FI1A 3ZD9A 2GDSA 4B9NA 1WG8A 5IY5B 2BPGA 2LJ2A 4BDPA 1DGJA 2W04A 2Y1JA 3C3TA 4X5VA 4WBNB 4ED3A 4JV0A 3V7KA 2L5YA 1V54B 3HW8A 1HUOA 4G9BA 4YXMA 2GO7A 2G5HB 8ICCA 1Y74B 1NTKH 4B7KA 2UVVA 4MFAA 1NVPD 4B08A 4ZIBA 1OCZB 1SZTA 1KN5A 5J0UA 2LGWA 1MA1A 4WFHA 3UCSC 3SR6A 1VQLV 1NQTA 5EZYA 2QKSA 2NLJC 5D5PA 5ALSA 4PA6A 4LH7A 5KG5A 4UB8U 3AEVA 4ECXA 3G6EV 3K3WA 4YVZA 1QLEB 4GXIA 2Q4PA 4DW0A 5H2FU 4DR1B 2DWDC 2EULA 1TUBA 4GCZA 2HG5C 2WLMA 1Z5VA 3R9KA 2D6FC 2E8NA 1QSYA 2KOBA 2UXCO 4US9A 3C1ZA 2WLHA 3RH4A 3MHSC 5EOZA 4DR5O 2XUMA 4GKKB 4UCOA 5L1JA 1KKXA 4QGPA 5L3DA 5KT6A 3RRHA 3AG4C 3K0DA 2Y69B 4UUJC 4B3SB 2RP5A 3ZDAA 3A0HU 2ASDA 2BCUA 1ZAUA 3CP1A 2ATKC 3LUTB 5FPRA 3STZC 2LYBA 3N2KB 3GZFA 3WG7B 1X2IA 2Y9UA 5JCOA 2EIMB 3G67A 3WB2A 3X2QB 1HEKA 1XC9A 3JSLA 4YMNA 1O9GA 4RAIA 3RTVA 5IIKA 5EWEA 1P84F 1XL4A 2QTSA 4R6ZA 3TGUH 4ZHQA 4I55B 3ICXA 4FFDA 1SKVA 3A0RA 4KL1A 5IJ0B 4F4YA 4LFBB 4PZNA 1OCZC 3KFUF 1CP9A 3RR7A 4WFEA 1X9MA 3ZDBA 3BS5B 3DGEA 2IJJA 1QTMA 1NJZA 1PZNA 2H3VA 3G4SV 4TUSA 1SL1A 4KLLA 1V97A 3F5AA 3QUTA 3PJSK 1XO0A 3OHAA 4Z1VA 4RO2A 5AKIA 8ICYA 3EW9A 2PF4E 2E5LB 4W4LA 1YTFD 1NI8A 1MN8A 2LM1A 1I0HA 4O4LB 3UT5A 5AKEA 1ZRNA 2DYRC 2A1JB 2ZD9A 2ZE5A 3H1IH 1IVSA 1ZQ1C 3RBEA 2WF6A 2OWOA 4I2FA 3BS7A 2X7RB 4EBDA 1BE3H 4JAUA 1OCOC 5GONA 4Z6DA 5KAIZ 2HR3A 4J9KA 4IQWA 4JI4B 3RJJA 5ALJA 4I2EA 1UHUA 2XO7A 4FBUA 2ADQB 2R9AA 3O9OA 1N0JA 4AI8A 3CPWU 1S72V 3LVWA 3E8HA 4Q8EA 5KFQA 4KLGA 4J9LA 4LF7B 4F72A 1FYJA 1YF2A 2QLTA 4DV0O 1DTOA 1ZD3A 5AM2A 4DFKA 2HOIA 1YIJV 5KFRA 4MTFA 2V4DA 3C90A 3KZIU 3C2LA 2W0XA 4TWKA 5JQGB 1IBLO 4ICAA 1OUQA 3ZHQA 1X9XA 3P30A 4JTCB 1SQBH 3N97B 1M93A 3RVYA 3SJBC 2KVCA 4YD1A 3EPGA 1EN6A 3DTUB 1BGXT 4WFBV 3DC6A 1PPJH 2P6JA 5CB4B 4JYBA 3BVOA 1Y88A 1HR0O 2ZIVB 2ODMA 3N27A 3HILA 3T5LA 4GKJO 4JASA 3QUCA 1KQQA 2P67A 4F91B 3IHQB 2ISOA 4L87A 2ZTEA 3I56V 3TFRA 1AI6A 4KLUA 5TISZ 4DV2O 3QUQA 3B8MA 4QZEA 1XEQA 5LXTA 1UT8A 4Q45A 2HBLA 1TAEA 2JJ2G 4OPHA 3PNCA 2Q73A 3FAVB 4QZGA 1LNQA 5IE9A 5AKYA 3OJUA 3ZBHA 1W59A 4DK1A 4MVOA 4ACOA 2VANA 3NVZA 1ZQLA 1FS0G 5AI4A 7ICPA 4DR1O 1Y76B 4QWBA 3WU2Z 3K9AA 1KTQA 7ICOA 9ICPA 1KQSU 4PDLA 1PK1B 1NJIW 4DOAA 1ZD5A 1KDHA 1Y4MA 4JI7B 5KFMA 5LYJA 2Q7HA 4OPAA 1FFXB 5JJEB 2VQEO 1TAMA 1WCNA 3ETRA 1T4GA 1L7MA 1JRPA 2ZR2A 4PDRA 4O3QA 1AI7A 4LF4B 4XQ8A 4QZ9A 1K4CC 2JGDA 1I94O 3JATA 4YR3A 1K97A 3W7TA 9ICXA 1TAQA 2CTRA 4ZI7A 1JXEA 4DL4A 2JRIA 3B8NA 2QEXV 1DRGA 3I55V 2ZT9B 2P7TC 5KMGB 1X42A 4I4TA 2A3VA 2H94A 1AILA 2KSOB 3CCQV 2ZIUB 1B06A 3RJIA 2AJQA 4QWCA 4DS5A 3WK7A 2H5XA 4HZ3A 3JASB 3A0BZ 4HAMA 4JI7O 2QKAA 4KN4A 3LWMA 3MABA 1HUZA 1QCKA 5DM6V 1GN3A 3VCBA 3SQIA 2Y0IA 2WAQF 2JZBB 2YEVA 4O3RA 4B3RO 9ICBA 2Q68A 3SGIA 4YG2A 4O2AA 4D7TA 4IC9A 1THZA 2IHNA 2EIMC 1WB7A 3E86A 1FEZA 3GV5B 3ZRXA 4DR3B 5AK6A 8ICXA 4UB6U 2E1EA 4DQIA 3WK9A 4F2SA 2WFAA 7ICHA 1L6NA 4I0XA 2RQ5A 1ED1A 3M6ZA 4FZNA 1RXWA 2PFNA 3KKAC 5KFPA 5AM0A 3IGAC 2RRDA 4DV2B 4YR0A 3K06A 3HKZC 2BKEA 4TUYA 4NLZA 3OPXA 4JYCA 1I08A 1COWG 2HBKA 4IR1A 1SQXH 4EKWA 2VWJA 2K9PA 4Y2YA 3RYHA 1N48A 3N2GB 5K4LA 3GB7C 2NRVA 2K8BB 2M9NA 4IHJA 4DQRA 3PW5A 1QU7A 1QLEC 4NR1A 4WCEV 2ZIWA 4O5KA 4F93B 1EM1A 1G1XB 3LDAA 2B1IA 2KEYA 1IBLB 2O57A 1A77A 2M0NA 2IJIA 2CK3G 1P7BA 1RPRA 2QKQA 1K1SA 2UU9O 1ROPA 1AI4A 2UXBB 4KLSA 3OEHG 3TKAA 4CNQA 5KT3A 2UUBO 1H2LA 4H33A 1QHTA 4B3MO 1U96A 2WAMA 5IYZA 5L3FA 2VQFB 2YMMA 1H8HG 2G0AA 3ABKC 3QYPA 3MR6A 5AI0A 3GIIA 4K8ZA 1JR9A 5KFKA 4DQSA 5LA6B 3TQ1A 4QE7A 4KLJA 2Q0OC 3RJHA 2HEPA 2W6IG 5IILA 4ED0A 2PMZC 1FD9A 1ZQEA 2EZOA 3ZJZA 4FM1A 3G6VA 2DE0X 5KAFZ 2E75B 4J7JA 1FXKA 3CCMV 5AI5A 1V85A 4CH6A 1XO1A 1I7FA 3QF7A 2HCFA 2E8OA 1F51A 5B1OA 5J2UA 3T5HA 2YC0A 2G07A 4C8KA 1L0LH 3OMAB 4GT1A 3KHGA 1ZD2P 2JHDA 1DOQA 1WJZA 4TUQA 1EXNA 1WWVA 4FFBB 4CZZA 2AH5A 1HDJA 2NRXA 5DQIA 3SPGA 1WPBA 1E1RG 5KHIA 3SPJA 2DGZA 2AQ0A 3L70H 3RJGA 1Q81W 5AM4A 3CC4V 1XWLA 3LYSA 3BA8A 2ZJ5A 1YITV 3WU2U 4F71A 3TI0A 1ZQTA 2YDEA 3UQ2A 1YTFB 2GHYA 2BPCA 8ICKA 3SYQA 1AVMA 3AG3B 5L9XA 3TANA 4GX1A 2PFPA 2KKWA 4X1YB 3ABMB 2F1MA 1R3JC 2Y0SC 3M1YA 1HJPA 2V4RA 4LH6A 2KZZA 5E79Z 1AP5A 2MK3A 1BCCH 2QJ1A 4LFCB 5KA5A 3U11A 4MVSA 5KFIA 5IYDO 2BTOA 5BXZA 3CMAV 1Q46A 2AGQA 1JMKC 1ZL8B 2WLJA 3RGBA 2RDIA 4NM1A 2W7OA 2LYAA 3FDSA 8ICWA 1JIHA 2BDUA 1QQ5A 1KRPA 1WLEA 1J2NA 3RN4A 1ZQXA 2EAMA 4QJFB 1RSOA 2LMRA 1X59A 1N5WA 3WKCA 1N34O 1NJXA 8ICAA 3JPRA 4ZOHC 4F5OA 4JMUA 2B6GA 1XNSA 3HX0A 3CRQA 4X88A 1K33A 2KVSA 1VQ5V 4DSEA 1V55B 4GUNA 5DB8A 3N4MB 3TARA 1UFIA 5JU5A 1WN7A 1KEJA 1ZQIA 2GUZA 4PJ0Z 4O3NA 5CHGA 5DN6G 4DV0B 2YMQA 1SA0A 2EILB 4PGYA 3HKEB 1K5OA 1XMOO 1EZVH 1URFA 1EFRG 3SJCC 4BAYA 1Q43A 4IIJA 3K75D 4LNUB 1Q90D 4UCVA 5J8YA 3WK4A 1Z2GA 2BE3A 4JI4O 3ZN1A 2HVKC 2BGWA 2J6SA 4R50A 4B3RB 3SYZA 2R8JA 5HR7A 1NT2B 2FJ6A 3VBBA 4DUYB 5DGBA 2ZIXA 4HAIA 2V4QA 4EX7A 3PN1A 3F5EA 1NVPB 2PZSA 4CRXA 1ZQGA 4NTXA 2OTJV 2MSNA 1FO4A 5ALRA 5AIBA 4DWIA 1LR1A 4HNAA 2M7WA 5LMUB 2NV3A 3Q8LA 3BQ7A 4RZRA 3KKAA 4J11A 1KL9A 3JYCA 4YHHO 5HFMA 1T7PA 3G6XA 4B9LA 2HHWA 4RQ1A 1YJ9V 2IU3A 5AI9A 1Z00B 2A06H 5F3XB 3BAAA 3WK6A 1IV8A 2NNUA 4DL2A 2N05A 2WLIA 4O3OA 1UA0A 1S5JA 4I9QA 1C20A 4PHEA 1U48A 2K4PA 4JF3A 2ZDIA 1K4DC 3E22A 2VQEB 2VA3A 1JUDA 1CUKA 5LP6C 5ALPA 3RB0A 3K1ZA 2IH1C 3HKDA 1S9FA 4U3JA 3F2DA 4X64B 4GIBA 4TQRA 3ASOC 5IDJA 8ICGA 2Q0ZX 2F66C 2OXOA 3UPQA 3HT3A 2HHHO 1XSNA 1IM4A 4KMOB 5L1MA 2E8MA 1X9SA 2MRLA 5JJJB 2PKEA 2JR5A 3C5GA 1KC8W 1NOMA 1URJA 4ECTA 1L3UA 3I28A 2FMSA 1O03A 2FMLA 3B2EE 4HYKA 1DK1A 2UUBB 3PR5B 1ZQRA 5J29A 3ZDDA 4JI3O 3D36A 1X40A 2KIVA 5CRXA 5J0YA 5CBFA 4P0PB 2FLNA 1XMQO 4J9QA 2KHVA 2A7WA 3JAWB 2F4VB 2UUAO 5CR0A 1NK4A 3RAQA 1L0NH 4YR2A 2FMQA 5KTQA 5KFNA 2JK5C 5J2AA 2G38A 3ZI4A 1ZQPA 3L72H 1HNZO 2W7PA 1TA8A 1AB3A 2OYYA 4RQ3A 4BXOB 8ICLA 5ALHA 3NR7A 5DLFA 2BCVA 2HI0A 4I2CA 1Q6HA 2W43A 3IFXA 3MD0A 2QR4A 4QWEA 1FKAO 1SKRA 3H8JA 7ICFA 2XI9A 1H2SB 2DYRB 4EYIB 1GMGA 2C2RA 4QIWF 8ICMA 5B1AC 3MDAA 4R65A 3NVWA 4NL9C 3IAYA 2K4EA 5DGAA 3FYIB 3MC1A 5ALMA 8ICTA 1GK9A 1NKBA 5KHGA 2KNJA 4QZFA 2WWWA 4PZOA 1SQQH 5CA0A 3FAHA 1GN2A 4RU9A 1JX9A 5E1AC 3WB1A 3R66A 5J0XA 2KSDA 2C28A 1U9LA 4IRDA 1S0NA 2QWOB 1RQNA 1M5IA 2AGOA 2E1FA 3JALA 4AP9A 4M9HA 5KAFU 2NN4A 1SQPH 2LFSA 5GTIU 1MA7A 4R64A 3J7AU 2F76X 2F23A 3H9VA 5KA6A 5EZYB 3SI8A 4NXZA 4QIWC 1U97A 3UXOA 5AKGA 3OTOB 3QXGA 2KE7A 3ETLA 1S10A 3FX7A 3WG7C 2DYSC 2B21A 2DFLA 2HHSA 4IT5A 5EBLC 5GW7A 3CC7V 3J81N 1TUBB 5ALVA 3PW7A 3R65A 2IA6A 3KBBA 1NK5A 3ML0A 1XNRB 3AG4B 3G6BA 2KZMA 4PJ0U 2Q7GA 1OV9A 4UB6Z 3IV6A 3OR6C 4RWUA 1H8EG 1I94B 2FPLA 4Y2SA 2Z5UA 4LF4O 3EUB2 2BHNA 2C2AA 2KG7A 4TSFG 4XA5A 3EYZA 9ICEA 3LDCA 5KG4A 4N23A 4JV1A 4UB8Z 2LW7A 1N34B 2XAFA 4DSKA 9ICFA 3N2KA 1WA8B 3ZMZA 8ICEA 4RQ7A 3E8BA 2ITDC 1NK7A 3B77A 5B1BC 1P49A 4KTQA 2KTQA 2JS5A 4DV4O 2R8HA 8ICPA 4RQNA 3NVVA 4ZHQB 4DYLA 4DFJA 4I55A 4XUSA 2E76B 2YXHA 4LF5O 5AK5A 3PMLA 1ZTEA 2GH1A 1JCHA 4JI5O 4GKKO 2PMZF 2QWRB 4KLOA 4UVAA 4RT2A 1K1QA 4LF7O 2WF7A 3K5MA 2E3CA 3BS5A 2ZE7A 1D8YA 5EC2C 2F8KA 2R9RB 5EBWC 9ICSA 3MHHC 3ZCCA 4YJ2A 3MR3A 4U7CA 2QB0B 3RBDA 3SMVA 1PV0A 4Q20A 3T4ZA 4NL9A 2BR0A 2CXYA 2AXTU 2E5SA 3ETQA 4WFGA 1Q86W 1OXJA 3UM7A 4GKJB 2HFEC 2XIDA 4UB5A 2V1DA 5KFCA 3CCUV 4DL6A 4ZH4A 4FMTA 4ED8A 2FYUH 2CAZC 4KXRA 5CEHA 7ICRA 1LUVA 3PSPA 1SQFA 2QWQB 1UPHA 1L7OA 2KP7A 3M8AA 2MUTA 4F5PA 4I9WA 2JEJA 1SL2A 2XASA 4FVMA 4CH3A 1P4RA 4XRHA 2W9BA 3I5DA 1X4TA 3FB6C 3K1RB 2VJ5A 2OCHA 1NTMH 2BOBC 3WB0A 5BPCA 3W7XA 3H4DA 4CE6A 3CE2A 2UXXA 3AU6A 3CCSV 1XNQB 3VOUA 1QQCA 2P66A 1UPGA 1AJNA 4J9MA 2PXIA 4MEYA 4EBCA 5C93A 3PO4A 1BT8A 1N0NA 3TETA 4DOCA 2JMGA 1SV0C 4A8EA 3T1CA 4MW8A 5AKHA 1JQ0A 5HMMA 4NLKA 2DF4B 4KLEA 2ZIMA 4PA9A 2QWNB 1ZETA 4CGZA 4X20B 4Z2WA 4RQ8A 4Q43A 1GM8A 2J6UA 2DJVA 4MTOA 2YXYA 2GTAA 4DR5B 4DO2A 4MF8A 4QNHB 4IR9A 1ZQCA 4J42A 3I1YA 2KMDA 4H44B 5LXTB 1B04A 5B66Z 4I2HA 4ASUG 2JH7A 2F1IA 2GSMB 2UXNA 3JD2A 1SKWA 2P35A 4EB6A 2ZM6B 1MMMA 1R73A 4GX2A 1NNLA 4KLHA 4UV8A 1K92A 3ETGA 2ZUDA 4M04A 2WA3A 4FE3A 3K0GA 4LCUC 3JPOA 4NLNA 3RYCA 1AR4A 1MG1A 2PI4A 1B22A 3U0ZA 3KZIZ 4Y2QA 1B4FA 5KFVA 3OD4A 1ZJMA 4I5SA 1SWWA 2MAXA 2IBZH 2RJZA 4M6WB 4JAVA 4BIUA 5ITZB 1N60A 5DLGA 4PL2A 1SERA 1MNGA 3RT3C 4NLBA 4O4JB 3ZHTA 2CTPA 3NXSA 3QE9Y 2F77X 1T3QA 1XQ8A 1YEWA 2R72A 1KKCA 5DG7A 2ZNJA 4O4HB 5G5GA 1LUWA 5JVDB 1JPXA 3RRGA 1M56B 4F6RA 1XOUA 2LQTA 1YSCA 4E0DA 4IYIA 5IWAO 2A9HA 3RVZA 4ED1A 5J0TA 2YUAA 3JASA 2PY5A 4R8CA 5EC1C 5BR8B 1L5UA 3JPQA 1F4MA 3HJEA 3F5WC 3UM9A 3QNMA 1QCEA 1N32B 2Y1IA 4KHPO 3E35A 2F44A 4QWDA 3IRUA 5KG6A 2G06A 4DV7O 5IY5C 2N74A 4DSFA 4O3SA 5ALUA 4KX3A 3Q8SB 3JARA 3CCEV 1NH2D 2XAJA 1TKDA 1N36B 3H01A 4KLQA 2W9AA 4B6JA 4TUPA 3KHRA 3F5TA 3TADC 5J2GA 3AK3A 2FLLA 1N63A 2H8PC 2YN4A 5AI8A 2JEGA 1L8LA 2E3TA 2R8IA 4Q44A 3ABTA 2JEIA 4AILC 1S76D 7ICJA 4I50B 2AZ2A 3UQ0A 2DN9A 2RCVA 2P6RA 1QBZA 4X65O 2X6BA 3AL0B 4K0KO 3SV4A 2AXTZ 3UQ8A 3KCXA 5J2JA 4H0LB 4F5NA 3QU7A 3T4DA 2FKXA 5L1IA 1FFVA 5AI6A 1BMFG 4IHJB 2Q67A 3APOA 4DCCA 2PYLA 2F4VO 2F8LA 5TZVA 4J10A 1GAXA 2Q8VA 1ZXIA 3AK1A 4GX0A 3OGIB 5DEDA 1M9NA 2Y4TA 3OHBA 1JFFB 4JI3B 1B0XA 4ED6A 4Y2VA 5J0SA 1B3QA 4F2RA 2YIBA 4OX9O 3JPTA 2IMWP 3AQFA 3Q8PB 1ZUQA 1VLBA 4FFKA 1Q3VA 3QO7A 3QEBZ 5GTHZ 4R66A 5HP4A 3ZX6A 4DV4B 3WKAA 3ETDA 1PP9H 2JDIG 2HLDG 4O5CA 3DEEA 4IL6U 1JI7A 1KSPA 1SRYA 3CXCU 4B3TB 1Z3EB 3BDPA 1Z4NA 4PHPA 5HNKA 8ICVA 3IP4B 1XREA 2ARHA 4R63A 1L1FA 4FLYA 2JEXA 2OIEA 1NZBA 1MZEA 2QWPB 1U49A 4KITB 2FL4A 3K03A 1OHHG 3N7PD 4DUZB 1RQLA 5DDYA 1WP7A 3ALRA 5ALOA 3ZRWB 3HKBA 1WNSA 5J2UB 2ISPA 5J2KA 3OEEG 2JIZG 3RJKA 4YY3O 1NH2B 1XU4A 1SKSA 2ZE6A 3F2BA 3SR2C 1JVMA 3OGUA 4MFCA 1QH9A 1BPZA 4RQ6A 1HP8A 3ZRSA 3OTOO 7ICTA 1Q5OA 3OM3B 3K5OA 4CC5A 1T3NA 3RYFA 5HMLA 5KFZA 2WLLA 4ZOLA 5IWAB 2NR5A 3GVMA 2DMXA 5KFLA 1VQ7V 2YICA 3L5KA 3IG5A 4JYAB 1DLBA 4P0QA 3RFAA 3QZ8A 3CRMA 3D3IA 4G28B 2OYQA 4K0KB 1QQ7A 1Q6IA 5AK4A 1ZQHA 1N33B 1DF5A 1KFTA 4X1KA 1ZJNA 1S3JA 4P4PA 3S3WA 3K59A 1BS3A 5CA3A 2YY6A 3JPNA 4KN7A 4X1YA 3JAKB 3EXAA 2CN1A 4R8UA 1J5EO 5A9GA 1J97A 5HHHA 4YJ3A 4RQFA 3BZKA 4J80A 1YT3A 4LFAB 1IDSA 2BCCH 4KX5A 3H7IA 7ICEA 5EYPB 1B43A 5B5EU 4ZBMA 4F6EA 1LKYA 2G09A 4Z1MG 2UUCO 4P4MA 1SV4A 1L3TA 3JPSA 1AI5A 2RN9A 3ABUA 2YXLA 2BOCC 2OCEA 4JI6O 3ED5A 2KIWA 2NRZA 3H0LB 3M9NB 2B5UA 2LYHA 4ECRA 1PUZA 1HNZB 1IBMB 1R3LC 4DLGA 2IOHA 2HOFA 4LC1A 2HJFC 3JAMN 1Q7YW 9ICJA 2RMKB 3CJHA 3S6JA 4DR6O 5LL6Y 4PHZA 3GWOA 1L8DA 4FJCC 2RDJA 1XMQB 1RM1C 4YCXA 4Z6FA 4GC7A 4CF4A 5KG7A 1SF9A 2NRTA 1VQ9V 2Q9LA 2RHFA 2XOKG 1Y74A 4W4KA 3UO2A 1KP2A 4DXWA 1SA0B 1B6QA 1VQ4V 4P9PA 4X1IB 1BPYA 1CI4A 3C29A 8ICQA 1VQPV 2A1AA 4OJ5A 2EDUA 1V9PA 4ECUA 3RBZA 3OSNA 4F4XA 4BW9A 3RB3A 1F44A 4FBTA 1BVSA 3VC8A 3N7RC 4PDVA 2ZIXB 5KFHA 4FLTA 2IJHA 3ONNA 3D2SA 1R1BA 2JGAA 3RAXA 3KD3A 5ALFA 5LBQA 4OJOA 4LVSA 5CMUA 1KKDA 3DSQA 1NI3A 1RFYA 1HIWA 2EH9A 3QTCA 5KFEA 4JI2O 3PO5A 3M7DA 1KECA 2ZIOA 5KG0A 4KUMA 3L4PA 2BSKA 2M6YA 2YMLA 5FNVB 3BCCH 2LP7A 1Z00A 4AQYB 4KLDA 5C8YB 4QPKA 2D8CA 4F3OA 3PZPA 2WLIB 2DPIA 2DWEC 2EAOA 3O0FA 4IL6Z 1TVKA 2OIGA 5JH7A 1CPYA 3CP8A 4B3MB 5HHIA 1Y67A 4PGXA 2W9MA 1F23A 1IXMA 4MVQA 4U3JB 1N4CA 4JZGA 1DXSA 3CXHF 1KMIZ 3ETEA 5B3SC 4M2YA 2GTSA 1NU1H 1HNXO 5J0QA 2UU9B 2RDCA 5IINA 2KHQA 4YMMA 3OUFA 4FIPC 3ZDEA 1NK9A 4ABMA 4TV8B 4DUZO 4EENA 4NKGB 2KFZA 2DW4A 1H2MA 2V7QG 3CCLV 4MT8A 3UT5B 4LF8O 1FJGB 2DYSB 4CCHA 2QM8A 3AM9A 3FC4A 3NRZA 4PI2A 3DDHA 4K4GA 2FPMA 5K1XA 3T5KA 2AU0A 5ALQA 1QSSA 2IHMA 1KFDA 4B3TO 4BUGA 2R8GA 2QDOA 1JALA 1US6A 4LWSB 1M57B 2EZXA 3VQXA 5LGNA 1XSLA 1WPXA 7ICMA 3M6KA 3ISDA 2GBOA 4QZ8A 4DF4A 2JEFA 1Q3EA 8ICFA 4QW8A 5AKJA 1UT5A 3T79A 3K08A 2HHTA 1O08A 4NWIA 2HSZA 3B4SA 4ELTA 1WB8A 3B09A 3OAAG 4YP3A 4MTXA 1N61A 1YZBA 3PX4A 4O2BA 2ZIVA 4JWNA 2KJ9A 5EIBC 4UVBA 3JALB 3JD1A 4CS3A 4QWAA 4LZDA 2QGNA 1PNLA 4QPJA 4FLUA 1WWUA 1ZQBA 1GRJA 3K9SA 2YQEA 2BCQA 4EFBA 4JI6B 2R18A 5H5NA 1TAUA 3PV8A 1NJWA 1ZQAA 4QE9A 1FFUA 1VJ5A 1CEZA 1V54C 5J9PC 2Z0AA 2VWKA 5EK0A 4FK5C 2F1HA 1S5LZ 1JJOA 3CB2A 4UB1A 5IIOA 1XHZA 5ALXA 3DXRA 3FFQA 1TVAA 4KP4A 4X89A 5J0OA 1IBKO 3QU4A 1MZFA 1BPDA 3ZHUA 3PSFA 4X66B 5J0WA 3L73H 1LVHA 1XSPA 5KFWA 8ICHA 3HB3B 5CJ7A 4NVPA 4C4RA 4J9NA 8ICBA 2OHFA 1Y76A 5AM3A 5J2IA 5C5JA 5L3BA 1M90W 1N33O 3F2CA 5GTIZ 4K4IA 2UVWA 3L75H 3FD9A 5DDMA 7ICUA 9ICNA 3IC7A 4CH5A 3W7WA 3KCYA 2Y0SF 2WPDG 3U26A 3FYEB 2DQ3A 4NYKA 3H1KH 1KBHA 5LP6B 2PUSA 3UMBA 2UUAB 2CPRA 1RXVA 2HVHA 5A0LA 5FLXN 2VQFO 1WA8A 3EWAA 3LVVA 1VP7A 9ICQA 4IQUA 2AHYA 2QB1A 3JATB 4CH4A 5B5EZ 1FIQA 4YY3B 1KD1W 1S5HC 1OCCB 4X62O 3H1HH 1XILA 2ZIUA 4JTDB 4MFFA 4OO1J 4CF5A 1BL8A 1MABG 1ZQJA 3IG8A 5HR6A 2Q0AA 2I9GA 1CXZB 4TT3G 5CBGA 1AP6A 1A32A 4FLXA 4ECQA 1YZ6A 3SJAC 4X64O 2P90A 4AYBF 4DV6O 1HR0B 3QO8A 4B9MA 4BWMA 2UVRA 4EEQA 4C80A 5LOVA 1AROP 4DR4O 2MW2B 4DS4A 2XC9A 3ORYA 3RB4A 4YIOA 2GLEA 3ZMVA 1K5SA 3EVKA 4TOIA 4LF8B 4F4WA 3GV8B 3M7MX 3VQVA 4I0XB 4JV5B 4NTYA 1K7DA 2XAGA 3CWBH 1KUQA 4IGGA 2Y48A 5CB1A
chains in the Genus database with same CATH topology
1UPHA 4I9WA 2XASA 1P4RA 1DTOA 4PDMA 3TK1A 3CMEV 2HOIA 1YIJV 4CDGA 4MTFA 4BW5A 4JTAB 2VIXA 3FB6C 4TWKA 3NRWA 2VJ5A 4ICAA 3SAGA 1OUQA 2BOBC 4P9OA 3P30A 4JTCB 3W7XA 1K34A 3PSTA 2R9IA 2UXXA 1W0KG 3AG1C 3CCSV 4PL1A 3RVYA 3VOUA 2KVCA 5EBMC 1AJNA 3DTUB 2LHTA 5L3EA 4WFBV 2P6JA 3ZIAG 1N8RW 2ZIWB 2ZQMA 5C93A 2HOQA 3TETA 3E8GA 2X6AA 4JYBA 2JMGA 2ZIVB 2EBOA 4A8EA 3F53A 4N21A 3T1CA 4MW8A 3ZRVA 3K04A 4JASA 1JQ0A 2DF4B 2P67A 3ASNB 1YJNV 4L87A 4PA9A 4CGZA 3I56V 3AG2C 1AI6A 3KZXA 4RQEA 5LHGA 1GM8A 3B8MA 4MTOA 4FZLA 1I5XA 4P30A 3RW0A 4DO2A 1BHBA 4G2KA 4QNHB 1RM1B 1BHAA 2HBLA 2EIJB 1PVPA 2OM6A 1OCRC 2DQ0A 4NLCA 4GFJA 2JJ2G 2Z3YA 3KG2A 2W0FC 1H2GA 1LNQA 3LDEA 5T14A 1PVRA 4MVOA 2JH7A 4ASUG 4ACOA 2GSMB 2UXNA 3JD2A 2ZXHA 1FS0G 3LSSA 1YJWV 2A79B 1VQOV 3OW2U 1R73A 1SESA 4GX2A 4UV8A 3K9AA 3AG3C 1KQSU 1K92A 3ETGA 4PDLA 4P2ZA 2K89A 1NJIW 4FE3A 2H3IA 1Y4MA 3FB5C 5LHHA 1PNKA 3K0GA 4LCUC 1MG1A 1TAMA 2PI4A 1M56C 5IYCO 2B1GA 2VJ4A 1AJQA 1FXKB 2OTLV 2ZR2A 2WAQC 3STLC 4PDRA 1AI7A 4I5SA 1NKDA 1K4CC 4JAVA 3H0MB 4OXSA 4BIUA 3W7TA 1K97A 1FXHA 1ECWA 2HBJA 1PKXA 3SYPA 3B8NA 2QEXV 1QR8A 4ZKIA 1DRGA 1GO3F 1IIPA 4OJPA 4PL2A 4WFFA 3I55V 1SERA 2P7TC 4NLBA 3PSIA 3ASNC 2A3VA 2H94A 3NXSA 3T2MA 1K5QA 4PA7A 2F77X 3CCQV 2ZIUB 1YHQV 3NUQA 2IW5A 3EHBB 4LP8A 3CCRV 1FXKC 2D3OW 3ZMSA 1JPXA 1M56B 4HZ3A 4HAMA 3OMIB 5H6QA 1YSCA 2A9HA 3RVZA 5DM6V 1HWYA 4HYOA 4P0QB 3VCBA 3SQIA 3AG1B 4MVRA 4XDKA 2WAQF 2YEVA 4R8CA 5EC1C 1SZHA 2Q68A 1S0VA 3ABKB 1F4MA 2YB1A 3F5WC 2OCCB 4IC9A 1THZA 4R7CA 2EIMC 1QCEA 3E86A 4CBCA 3E0FA 3E35A 2ZXIA 3OE7G 3ZRXA 1K8AW 2IU0A 2K1EA 2E1EA 2ITCC 1L6NA 2G06A 5IY5C 4OJ6A 1PD3A 1ED1A 3M6ZA 4KX3A 4FZNA 3CCEV 1NH2D 2XAJA 3H01A 2EINB 3IGAC 5CN0A 2WB1F 4MVUA 5LGTA 1DF4A 1GM9A 2RRDA 2PI5A 4MVZA 3K06A 4XDLA 2H8PC 1K9MW 3HKZC 3OPXA 4JYCA 1COWG 3LNMB 3ABTA 2HBKA 1MSWD 1M57C 1S76D 4EKWA 5CBFA 4WJ3B 3CCJV 1H38A 3GB7C 1QBZA 1R6KA 2X6BA 2K8BB 3AL0B 2ZDIC 1QLEC 4WCEV 2ZIWA 3T4DA 1A0PA 1BMFG 2Q67A 2KJ5A 2A0LA 2F8LA 2B1IA 2KEYA 2M0NA 4GX0A 2IJIA 1P7DA 1M9NA 2CK3G 1P7BA 5H6RA 1VQKV 4GX5A 1RPRA 4LBEC 5B1AB 2LFRA 1ROPA 2YSUB 1AI4A 3E2EA 1FXVA 3OEHG 1OCCC 3JD3A 3AQFA 1EBOA 4H33A 1Q3VA 3QO7A 3LDDA 2WAMA 5L3FA 2XAQA 3K79A 1H8HG 3ETDA 3CC2V 2AHZA 2G0AA 2JDIG 2HLDG 3ABKC 1QVFU 3DEEA 2K4IA 3HKZF 3CD6V 1SRYA 3CXCU 2CRXA 3AQEA 2FTKA 3SAFA 4U7OA 5LHIA 1R6NA 2XAHA 3D2NA 4F4LA 4E2LA 3IP4B 1G8MA 2W03A 3BEHA 4PA4A 4QE7A 2W6IG 2PMZC 2EZOA 1L1FA 3ZJZA 2QA4V 2N1RA 2JEXA 1NZBA 5KUKA 2F43G 2WLNA 3CCMV 1FXKA 3K03A 5L3CA 1F51A 1OHHG 3N7PD 5B1OA 1TUEB 3ALRA 3ZRWB 2G07A 2YB4A 3OMAB 4GT1A 1KP3A 1PL0A 2JHDA 1Y66A 2X0LA 1NH2B 1K3EA 2JIZG 3OEEG 1E1QG 3ZRWA 4CZZA 3F2BA 3SPGA 2QE7G 3ASOB 1E1RG 1JVMA 2OCCC 3ZMTA 2K8AA 3SPJA 2EJRA 3ZRSA 2DGZA 3OM3B 2H3QA 4BIZA 1Q81W 3CC4V 5B1BB 3LYSA 1QR9A 2X6CA 3HPLC 3H0RB 2WLLA 1YITV 1VQ7V 2WB1C 1R3IC 3IG5A 2HKOA 1JOYA 1DLBA 4P0QA 2HMXA 3RFAA 4OJLA 2GHYA 3D3IA 4G28B 3AG3B 3SYQA 2YEVB 1R3KC 2Q6AA 4GX1A 1DF5A 3ABMB 1R3JC 2Y0SC 1S3JA 4C0ZA 1OZ0A 4BX9C 3SYAA 5CA3A 3SYOA 4UV9A 2CN1A 4FPPA 3C28A 3QNEA 2MK3A 5KA5A 4RQFA 5IYBO 3ZMUA 3OUSA 4MVSA 4G27B 5IYDO 2EIKB 1VQNV 1YT3A 2H3ZA 3L3FX 3CMAV 4KX5A 4UVCA 2WLJA 1W0JG 2Z7JA 2W7OA 2LYAA 4ZBMA 2G09A 1D8BA 4J9YB 4Z1MG 2BDUA 3AG2B 3ABUA 1AI5A 1FFTB 2BOCC 1WLEA 3ZN0A 3OMNB 5LGUA 4QJFB 3W7UA 3QO5A 4MVMA 2KIWA 2F2AB 3H0LB 2B5UA 2Q4TA 5B1NA 1R3LC 3UKMA 2JEUA 4JMUA 3SAHA 1XNSA 2HOFA 1Z19A 2KD1A 2HJFC 3EFFK 4LC1A 1Q7YW 4X88A 1K33A 1VQ5V 1F4NA 1V55B 2OH2A 1OCRB 2EIKC 3GWOA 4FJCC 3P32A 1RM1C 1UJWB 3CYMA 4MW3A 1RPOA 4PELA 1MOFA 5DN6G 1AR1B 1VQ9V 2EILB 4MTGA 4AYBC 2RHFA 4O3MA 2XOKG 2G5IB 1EFRG 3W7SA 4JGSA 4JPRA 2KKPA 4BAYA 1QVGU 1KP2A 4DXWA 1Q82W 2KKVA 1B6QA 2IJKA 2OT5A 3ABLB 2H3FA 1VQ4V 3CYOA 4NV0A 4P9PA 3ZN1A 2HVKC 3X2QC 3C29A 4R50A 5B3SB 1VQPV 1V55C 4OJ5A 2ZXWC 5HR7A 3RBZA 3VBBA 4U6PA 5L3GA 1F44A 1OCOB 2ZIXA 2ZXWB 3F5EA 4UXNA 3VC8A 1NVPB 3N7RC 4PDVA 4CRXA 2ZIXB 2OTJV 3JD4A 2IJHA 3ONNA 2YX8A 3D2SA 2QTOA 2Y69C 2M7WA 2JGAA 2NV3A 5KL1B 5LBQA 1JJ2U 4OJOA 4RUFA 4FZMA 5CMUA 5HFLA 1KKDA 3LSQA 4RUEA 1HIWA 3JYCA 2HVJC 5HFMA 3ABMC 2XVTA 3M7DA 1KECA 3F7YC 4KUMA 1YJ9V 1AJPA 2IU3A 2NNUA 4MSWC 4J9ZB 2WLIA 2LP7A 3CRXA 1YTFB 4JF3A 4QPKA 1NR1A 2ZDIA 2WLIB 3PZPA 1K4DC 1YI2V 4XDJA 2DWEC 3E83A 2IH1C 3K1ZA 3O0FA 4X8AA 2DQNB 1J95A 2WLLB 3D2QA 1W2BU 2JH1A 3G71V 3F2DA 1CPYA 5IDJA 3ASOC 3SJQC 3CP8A 2OXOA 1F23A 1IXMA 1GKFA 4MVQA 5KUMA 1ORQC 4KMOB 2MRLA 3ETEA 3FKSG 5B3SC 1KC8W 1URJA 2EIJC 3ABLC 2KHQA 1I5YA 3D36A 2KJ8A 1G4YB 5KL8B 3OUFA 4FIPC 3SYCA 5CRXA 2KB1A 2DW4A 1XL6A 4P0PB 2QM7A 2V7QG 1KBUA 1GTOA 4MT8A 2WSSG 1NR7A 2KHVA 5FL7G 3TCUA 3CCLV 3OR7C 2G08A 2XICA 4QNLA 3IN5A 2DYSB 1ZWIC 1VQMV 4WFAV 3SPCA 5H9CA 2QM8A 1M1KW 2GOLA 1ENVA 2JK5C 2WLKA 3E89A 1QLNA 5CBHA 4BUGA 2W7PA 3FB8C 2OYYA 4U7NA 2LKYA 4KFMA 3IFXA 1M57B 3MD0A 2Q69A 5LGNA 4BJQA 2XI9A 1WPXA 2EZPA 1VQ6V 3M6KA 2ZG6A 2DYRB 1GMGA 2K8CB 4QIWF 1T94A 2LBOA 3BY6A 5B1AC 4YXWG 1E79G 3JCZA 2K4EA 3FYIB 3T79A 1EZJA 1GK9A 3K08A 2KNJA 5IY5B 2WWWA 3F7VC 2W04A 4NWIA 5E1AC 1JX9A 1V54B 2G5HB 1A6SA 3OAAG 4MTXA 1NVPD 2E1FA 1OCZB 1SZTA 3WFVA 1VQLV 4WFHA 1NQTA 2ZIVA 2KJ9A 2QKSA 2LFSA 2NLJC 4UVBA 1MA7A 3JD1A 4PA6A 2F76X 1PNLA 4QPJA 5KA6A 1GM7A 3G6EV 2R18A 4QIWC 3K3WA 2K4HA 1QLEB 3OFNG 2KV2A 4QE9A 2DWDC 4GCZA 3WG7C 1CEZA 1V54C 2HG5C 2DYSC 5J9PC 2WLMA 5EK0A 2D6FC 4FK5C 2KOBA 5EBLC 5GW7A 3CC7V 2WLHA 3R65A 2JJ1G 4KP4A 3ML0A 4X89A 3MHSC 4H37A 3AG4B 3PSFA 5L3DA 3HB3B 3AG4C 3K0DA 2Y69B 1H8EG 3OR6C 2VKQA 4UUJC 2RP5A 2Z5UA 2HBMA 5C0YA 4MS2A 3CP1A 3E8FA 1Q3UA 2C2AA 4TSFG 2XNDG 2ATKC 3LDCA 3LUTB 5L3BA 1M90W 3STZC 3F2CA 1PNMA 2LYBA 4N23A 3GZFA 3WG7B 2EIMB 2XAFA 3IC7A 3W7WA 3X2QB 3JD0A 1HEKA 2Y0SF 2IH3C 2WPDG 3FYEB 2DQ3A 4RAIA 3ZMZA 3SPIA 1XL4A 2CPRA 4R6ZA 3E8BA 2ITDC 5A0LA 3B77A 5B1BC 3ICXA 3A0RA 2MA1A 1OCZC 1PVQA 3LVVA 3KFUF 1CP9A 2EILC 3RF9A 4WFEA 2AHYA 1SETA 2EINC 3DGEA 2GH1A 1JCHA 5BZBA 2IJJA 1KD1W 3CCVV 2H3VA 2PMZF 4UVAA 1Z1BA 1S5HC 3M99B 3G4SV 3MGVA 3F5AA 1OCCB 3PJSK 1XO0A 2ZIUA 4JTDB 4WF9V 1BL8A 4OO1J 1MABG 4RO2A 1WUDA 5EC2C 1K73W 3IG8A 3OGCC 2R9RB 5EBWC 5HR6A 3MHHC 2KICA 3N7SC 2ZR3A 4U7CA 3ZCCA 4P0PA 3GU3A 4TT3G 5CBGA 1YTFD 3SMVA 1VQ8V 4Q20A 2P90A 3AEIA 2DYRC 2ZD9A 4AYBF 3T4ZA 4WFGA 1Q86W 2E5SA 1ZQ1C 3QO8A 3FB7C 2X7RB 3UM7A 2HFEC 2XIDA 2V1DA 1AROP 4JAUA 3CCUV 1OCOC 4XBFA 4FMTA 4PA3A 2HR3A 1CRXA 3ZMVA 1K5SA 1NBMG 3PSPA 3SPHA 3CPWU 1S72V 2W6JG 1S77D 1K7DA 3LVWA 2XAGA 3E8HA 2Y48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGZ A;  4QJF B;  4OO1 J;  1WUD A;  2HBK A;  4CDG A;  4QIW F;  3SAH A;  2KV2 A;  2HBL A;  3SAG A;  4NLC A;  2CPR A;  2HBJ A;  2MA1 A;  1GO3 F;  2DGZ A;  3SAF A;  2E1E A;  4NLB A;  1YT3 A;  3CYM A;  2E1F A;  2RHF A;  4O3M A;  1D8B A;  2HBM A;  5C0Y A;  2RRD A; 
#chains in the Genus database with same CATH topology
 4JAA A;  3OTQ A;  4JV2 A;  2CUG A;  1Q8K A;  4NTW A;  3ZDC A;  3CME V;  2ETN A;  4CDG A;  3BQ2 A;  2QAR A;  4BW5 A;  4JTA B;  3GIK A;  2VIX A;  3IC9 A;  2ZE8 A;  3SAG A;  4WBN A;  4P9O A;  4J9P A;  7ICL A;  2R9I A;  4NJ8 A;  4UAU A;  1W0K G;  3V72 A;  2ZNI A;  3SZ2 A;  5J2E A;  3D8C A;  2LPE A;  2ZIW B;  2ZQM A;  2HOQ A;  4GLX A;  3WK5 A;  4DR7 O;  3V7J A;  3K5N A;  4FLZ A;  4N21 A;  2JV3 A;  4RNO A;  2W3R A;  2P5O A;  1XNQ O;  3ISC A;  1S0O A;  3ASN B;  5CA1 A;  4DQP A;  1YJN V;  3C5F A;  3A0B U;  5LHG A;  4D7S A;  3KOO A;  4Y2R A;  5ALL A;  1P7G A;  4DK0 A;  4FZL A;  1I5X A;  3K4G A;  4X20 A;  1ZYQ A;  4P30 A;  1FAF A;  4C8L A;  1DGS A;  2P6U A;  3H8S A;  1OCR C;  1ZQM A;  4GFJ A;  3KG2 A;  4UCR A;  5KFO A;  1XHX A;  1H2G A;  3H1L H;  3LDE A;  3IJ4 A;  5T14 A;  4Y2J A;  5F9L A;  1PVR A;  3QZ7 A;  5DEC A;  5AKK A;  1YCI A;  3UO3 A;  1AR5 A;  2ZXH A;  1ZQQ A;  2FE9 A;  1IUR A;  1YJW V;  1VQO V;  3OW2 U;  3CEI A;  5KG1 A;  4YN4 A;  1J2M A;  4UCT A;  2ATL A;  3PMN A;  4ECV A;  3AG3 C;  3MGH A;  5J2T A;  1GN6 A;  2QM4 A;  4P2Z A;  4I2I A;  5AM5 A;  4JI8 O;  5LHH A;  1TGO A;  1LV5 A;  4QZD A;  1X66 A;  2EAP A;  1SB3 C;  4FLV A;  4UB4 A;  4DLE A;  2B1G A;  1FXK B;  2OTL V;  3RYC B;  4B3S O;  2WAQ C;  3STL C;  5IJ0 A;  1C7Y A;  3AMZ A;  8ICS A;  5DBA A;  3ZED A;  1SXE A;  4LFC O;  1NKD A;  5KT5 A;  4OXS A;  4L8J A;  5LMN O;  2HBJ A;  4O9M A;  1PKX A;  4ECS A;  2CGN A;  4O3P A;  3WKE A;  5B66 U;  2WTF A;  1GO3 F;  4OJP A;  1IIP A;  3OTF A;  2D2C B;  4WFF A;  2UXC B;  3P3N A;  4AHC A;  2KZ3 A;  5ITZ A;  3PSI A;  4MHV A;  1H2K A;  1K5Q A;  4PA7 A;  1U47 A;  2E74 B;  7ICG A;  2W9C B;  4Q6G A;  2IW5 A;  3EHB B;  1JXL A;  3DV9 A;  3VQW A;  5KFB A;  4LP8 A;  1FXK C;  2D3O W;  1X6J A;  2ZCE A;  4RQ4 A;  3T3F A;  2BDP A;  4NB5 A;  1IBM O;  2W3S A;  3CRR A;  4EEL A;  3OMI B;  5H6Q A;  2E8P A;  5J2B A;  2JGU A;  2A1J A;  4EZ9 A;  5JCO C;  2WF5 A;  5AKX A;  1HWY A;  2QKC A;  4HYO A;  5KFA A;  3AG1 B;  1VDV A;  2F1J A;  4MVR A;  5JVD A;  3GWK C;  1ZQW A;  1SZH A;  3Q8R B;  2AGP A;  3ABK B;  5GON B;  2YB1 A;  2P22 C;  2DUY A;  3AK2 A;  1UQV A;  4Y2P A;  4CBC A;  2XGQ A;  4FS1 A;  3OE7 G;  5DB6 A;  3M9M B;  7ICS A;  1L8O A;  2IU0 A;  2K1E A;  1Q6U A;  4OJ6 A;  1PD3 A;  1L7N A;  3K58 A;  7ICQ A;  2FMP A;  1WP8 A;  2P4V A;  3WKB A;  2CE4 A;  4M9N A;  5BOL A;  4DOB A;  4JB3 A;  3B40 A;  1KW4 A;  1ZL8 A;  4ECY A;  2WB1 F;  5ALZ A;  4MVU A;  3TAP A;  5LGT A;  1TK8 A;  4MVZ A;  4XDL A;  5JWP A;  2XHB A;  2XTA A;  1RG6 A;  5JQG A;  1BSM A;  5CWR A;  4C8N A;  3PW0 A;  1NKE A;  3PR4 A;  4DRX B;  4WJ3 B;  5AKL A;  1H38 A;  3CCJ V;  1RM6 C;  3AN1 A;  4DR7 B;  5ALI A;  5EE3 A;  4I50 A;  2JS3 A;  3BQT A;  1SWV A;  8ICZ A;  2DOS A;  1RP3 B;  2KJ5 A;  2A0L A;  2XGP A;  5IIJ A;  1ZQK A;  1N36 O;  2R70 A;  1BQZ A;  1M4U A;  4B9T A;  1VQK V;  4B9U A;  5DBC A;  2FB5 A;  4GX5 A;  3GIM A;  2LFR A;  2DKZ A;  3D3Q A;  3AU2 A;  1RPL A;  2L6L A;  2IM9 A;  2RNB A;  4NXM B;  3JD3 A;  5JUM A;  2IBK A;  1XI1 A;  1ZQZ A;  2I6X A;  5DQG A;  4LFB O;  1M6Y A;  5E79 U;  3QVN A;  2XAQ A;  3K79 A;  3CC2 V;  2CGO A;  2AHZ A;  3UMC A;  3CD6 V;  3T1H O;  2FTK A;  3SAF A;  4F5R A;  1R6N A;  2XAH A;  3D2N A;  4F4L A;  4E2L A;  4QZH A;  4I2G A;  4ED7 A;  4KMU A;  1FFX A;  2QA4 V;  5ALN A;  4J41 A;  2F43 G;  5KUK A;  3EZ5 A;  3PW4 A;  3ZS8 C;  2LM4 A;  5AKZ A;  2LGQ A;  2J6T A;  2DL0 A;  5KFY A;  2JGD B;  4FLW A;  2UXB O;  2YB4 A;  1KP3 A;  3CW2 C;  1PL0 A;  5ALK A;  4ZI7 B;  1Y66 A;  4JI5 B;  2HDO A;  4CC6 A;  1E1Q G;  3ZRW A;  5KMG A;  1BPB A;  4U3F H;  3I76 A;  2QE7 G;  2OCC C;  3ZMT A;  2EJR A;  2EZY A;  2KSO A;  2IOF A;  3GDX A;  3C21 A;  4BIZ A;  4UAR A;  4FO6 A;  2X6C A;  3L9D A;  4BR6 A;  3HKD B;  9ICW A;  4GC6 A;  5KX5 A;  3K5L A;  5ALD A;  2UXD B;  3T1Y B;  1IXB A;  5JRT A;  2YS8 A;  5FP0 A;  3RYF B;  2WB1 C;  3GFK B;  5DBB A;  4MEX A;  2HKO A;  4DR4 B;  1VEW A;  4ELU A;  1JOY A;  2JZB A;  2YEV B;  2NO5 A;  4LJX A;  2Q6A A;  9ICH A;  4F50 A;  1L3V A;  3MAQ A;  4E4E A;  4C0Z A;  1OZ0 A;  5GTH U;  3SYA A;  3SYO A;  4X1K B;  4UV9 A;  4FPP A;  3C28 A;  3WKD A;  3QNE A;  4DV3 O;  1N5X A;  4RNN A;  4X62 B;  1XNR O;  3ZMU A;  2EIK B;  1VQN V;  3L3F X;  4M0A A;  1BPX A;  4YJ3 B;  4QW9 A;  1X6I A;  2Z7J A;  1W0J G;  2BTQ B;  1RDF A;  4ECZ A;  1BGY H;  5A2Q N;  5J0R A;  1WAZ A;  1TFR A;  4I2B A;  4F92 B;  2UXD O;  3CRC A;  2A3Q A;  3QO5 A;  4MVM A;  2F2A B;  3N2G A;  4QZA A;  3RYH B;  4DUY O;  9ICA A;  1NS1 A;  1YXB A;  5B1N A;  4UQG A;  4O4I A;  1ZLZ A;  1OJH A;  1Y6X A;  4JI1 O;  1Z19 A;  2BPF A;  2OEH A;  1OCR B;  4DL3 A;  2EIK C;  4PD4 F;  2ILM A;  1UJW B;  3CYM A;  5CA0 B;  4MW3 A;  2K60 A;  4UB3 A;  1MOF A;  1D5A A;  4PEL A;  3G6Y A;  4BWJ A;  2AGA A;  4AYB C;  3EPI A;  3CNH A;  3NAS A;  2CTQ A;  4JGS A;  2KKP A;  2P06 A;  3W7S A;  1QVG U;  1Q82 W;  2KKV A;  4M9L A;  2OT5 A;  3ABL B;  4NM2 A;  9ICV A;  3CYO A;  3APQ A;  3ZHV A;  9ICC A;  5AK3 A;  5IYZ B;  2ZXW C;  3T1H B;  2W55 A;  4DV5 B;  4X1I A;  4U6P A;  5L3G A;  3BRC A;  1OCO B;  1N62 A;  3OSP A;  3Q8K A;  2PFQ A;  1HNW B;  3GV7 B;  4FZ0 A;  3RYI A;  3NGD A;  2CH7 A;  3BFR A;  3THO A;  1FJG O;  2YX8 A;  4DQQ A;  3HRD D;  5KL1 B;  5BY1 A;  4JI0 B;  3LSQ A;  5EE9 A;  4RUE A;  4OD0 A;  2YIA A;  2EZZ A;  1WCL A;  4Z6E A;  4TV9 B;  3ZHS A;  3F7Y C;  4RQ2 A;  2ALZ A;  4J7Z A;  3TJT A;  8ICU A;  3Q4H B;  4P2H A;  2KG7 B;  5J2F A;  5D46 A;  5IJ9 B;  2V9W A;  4MSW C;  4FFB A;  4J9Z B;  4PGQ A;  5BMV B;  4P4O A;  4RUA A;  5FNV A;  1VF7 A;  1YI2 V;  4XDJ A;  3HP6 A;  4YFK A;  4X8A A;  5C8Y A;  2W11 A;  1J95 A;  1T5E A;  3J80 N;  1W2B U;  4DSI A;  4NXN B;  2YTU A;  3SJQ C;  3MDS A;  1MC8 A;  1D9F A;  1R6T A;  8ICJ A;  2E5L O;  2KN7 A;  1TVK B;  1VF6 C;  5JH7 B;  3B0Y A;  3D6J A;  1BQ0 A;  1ZOL A;  4RQ5 A;  1SIJ A;  3HPO A;  7ICN A;  4JZ2 A;  1HW7 A;  5KFG A;  4LF9 B;  4NXM O;  4RPX A;  3ABL C;  9ICT A;  4NY8 A;  1ZQF A;  1XDC A;  3FYH A;  3BAB A;  5KL8 B;  3SYC A;  1XUQ A;  4YHH B;  2KB1 A;  4YJ2 B;  4DV7 B;  3MDC A;  4RPZ A;  2F93 B;  2QM7 A;  4BIO A;  2BCR A;  2WSS G;  1HNX B;  2F3N A;  3OR7 C;  1N2X A;  3IN5 A;  1KLN A;  4WFA V;  5LMU O;  5H9C A;  2C2E A;  2KFN A;  3LNN A;  1SQV H;  5BR8 O;  5KFX A;  1QLN A;  2F95 B;  5CBH A;  3GIL A;  3P3P A;  4U7N A;  2VA2 A;  3LWL A;  3HKC B;  4BJQ A;  3HWT A;  9ICO A;  4D6T H;  1VQ6 V;  2HHU A;  2ZG6 A;  4AQY O;  2K8C B;  3PW2 A;  4QZC A;  2W54 A;  3PX6 A;  3T5J A;  4J7K A;  4YXW G;  3JCZ A;  2W9B B;  4C7Y A;  1EZJ A;  2BQR A;  1XMO B;  3OJS A;  5ALE A;  2GUZ B;  4JI0 O;  3NTU A;  1YZ7 A;  5L1K A;  3F7V C;  5KFS A;  2WA4 A;  1PM9 A;  1IZ3 A;  4I2A A;  1A6S A;  4LZG A;  4USA A;  5EWG A;  5III A;  4LNU A;  2ZTD A;  3WFV A;  3H40 A;  1QSL A;  4YMO A;  4O2B B;  1GM7 A;  4PHA A;  2Q5Z A;  4QZB A;  2K4H A;  4UAS A;  3L74 H;  2ASL A;  1KU9 A;  3OFN G;  4Q8F A;  2KV2 A;  2BZF A;  5KFT A;  2HHQ A;  2XY7 A;  1D2D A;  4HNA B;  5F2V O;  4LF6 B;  3JSN A;  1PK3 A;  1COO A;  2JJ1 G;  3BHP A;  1J5E B;  2I5H A;  5KHH A;  4H37 A;  1YDX A;  3DXR B;  4UBB A;  1GN4 A;  2VKQ A;  1XBL A;  4EB6 B;  2HBM A;  5C0Y A;  3H1J H;  4MS2 A;  2EQY A;  3E8F A;  1Q3U A;  4GYC B;  2XND G;  1JN3 A;  5J0P A;  5AIC A;  1IX9 A;  1PNM A;  1DK2 A;  2ZTC A;  1FPO A;  3TAQ A;  1O9H A;  4GZR B;  3M8S A;  3PX0 A;  3JD0 A;  2IH3 C;  2FLP A;  3SPI A;  1BZK A;  1PL4 A;  1MSD A;  3VQY A;  2HVI A;  2W8L A;  1YVW A;  1LB2 B;  4K4H A;  2MA1 A;  1PVQ A;  3M8R A;  2YID A;  4M6W A;  2EIL C;  3RF9 A;  4QZI A;  3C3S A;  1SET A;  2EIN C;  3UXP A;  4YXJ A;  5BZB A;  4IQT A;  2FDR A;  3CCV V;  5EE1 A;  4O4J A;  1Z1B A;  2YI9 A;  3M99 B;  4DFP A;  3MGV A;  4IYH A;  3TAD A;  1BNP A;  4KLF A;  4WF9 V;  2PYJ A;  5EE0 A;  1K73 W;  4O4L A;  1WUD A;  3OGC C;  1SXD A;  2KIC A;  3N7S C;  2ZR3 A;  3QU2 A;  2KG5 A;  4P0P A;  1F5S A;  3GU3 A;  2WHE A;  3B9J A;  1Z1V A;  1VQ8 V;  3AEI A;  4DEZ A;  2AQ4 A;  2NRW A;  4YIP A;  4I7Z B;  1Z5W A;  4UAW A;  4YQW A;  3V6H A;  4PHD A;  3FB7 C;  3TAC B;  3DC5 A;  4UAY A;  4XBF A;  3BPZ A;  2IOF K;  4G3I A;  3AUO A;  1CRX A;  4PA3 A;  4PH5 A;  3OT7 A;  4BGD A;  1NBM G;  3AG7 A;  5ALY A;  1S77 D;  3SPH A;  2W6J G;  4OX9 B;  1NZ6 A;  3JAR B;  3H4B A;  3BQ0 A;  5J2H A;  2C2D A;  5FPO A;  2B9Z A;  4TQS A;  3MR2 A;  1RYS A;  2CTW A;  1F7Y A;  4O0I A;  3MFH A;  4IRK A;  1GH6 A;  4PDM A;  3TK1 A;  5EWF A;  2YMP A;  1JMS A;  9ICM A;  3IM1 A;  3NRW A;  3NS1 A;  1K34 A;  2QAR B;  5EIB D;  3PST A;  3AG1 C;  1S8O A;  4K35 A;  4JV5 O;  5CB4 A;  4PL1 A;  4M9J A;  5EBM C;  5DG8 A;  2LHT A;  4FZ1 A;  5L3E A;  3ZIA G;  1N8R W;  5KT2 A;  3E8G A;  2X6A A;  3N28 A;  2LI6 A;  3QU5 A;  1L3S A;  3MFI A;  2EBO A;  3RH6 A;  2PFO A;  3F53 A;  3ZRV A;  3K04 A;  4TUR A;  1VF6 A;  4DV5 O;  3S3X A;  2AZ0 A;  3J81 j;  2RQ6 A;  2UUC B;  3AG2 C;  2XY5 A;  3KZX A;  5J8Y C;  4RQE A;  2H3O A;  5DQH A;  3THV A;  1ZQN A;  5CA1 B;  1Q8I A;  1QNM A;  3FAV A;  1IBK B;  2ODG A;  3RW0 A;  1BHB A;  4G2K A;  1JA8 A;  1RM1 B;  1BHA A;  2EIJ B;  3RJE A;  1PVP A;  2OM6 A;  2DQ0 A;  4NLC A;  2HHX A;  2Z3Y A;  3PVX A;  2W0F C;  5DB9 A;  4LR3 A;  2DKX A;  1N32 O;  5CA7 A;  4RT3 A;  4DR3 O;  4ED2 A;  3LSS A;  2A79 B;  1PK1 A;  5DG9 A;  4Y2X A;  3RWR D;  4DR2 O;  3QU9 A;  1SES A;  5KG3 A;  1X9W A;  2VS0 A;  3MBY A;  5LYJ B;  3K57 A;  1UA1 A;  4JYA O;  3SDL A;  3KHL A;  2K89 A;  2AHO B;  4OCZ A;  2H3I A;  3BJY A;  3FB5 C;  5KT7 A;  1PNK A;  5CP2 A;  5J2T B;  4I28 A;  2YIB D;  4K3A A;  1M56 C;  4DR2 B;  1VAR A;  4FM0 A;  5IYC O;  2VJ4 A;  1AJQ A;  3SEN A;  1ZQY A;  3LK9 A;  4PPX A;  3M9O B;  5JJN B;  1NKC A;  1RZT A;  1S0M A;  1T8E A;  4C7Z A;  3H0M B;  3CX5 F;  3C2M A;  4I4T B;  1FXH A;  1ECW A;  2JVD A;  4C8O A;  3SYP A;  2JXJ A;  1QR8 A;  2EAN A;  4ZKI A;  4LF6 O;  1SV0 A;  4RUC A;  3ASN C;  3G80 A;  3T2M A;  2Y9T A;  3KTQ A;  1YHQ V;  1ZQS A;  1SGG A;  3NUQ A;  5KLV H;  3CCR V;  2QB0 A;  3ZMS A;  1ZRM A;  1EN4 A;  2W9C A;  3LSU A;  5AHX A;  2Y4U A;  4DV1 B;  5D49 A;  4P0Q B;  4O2A B;  5H2F Z;  4XDK A;  2ZIN A;  3T1Y O;  3TXS A;  4IS7 A;  8ICI A;  1S0V A;  4US8 A;  4R7C A;  2OCC B;  2HJD A;  3E0F A;  1L7P A;  2ZXI A;  9ICR A;  1K8A W;  3B0X A;  4R8U B;  2ITC C;  4UAV A;  1SL0 A;  1BPE A;  4C4T A;  4MF2 A;  1ZSP A;  3BQ1 A;  1NK0 A;  4TUY B;  2MUT B;  2EIN B;  2PI5 A;  5CN0 A;  1DF4 A;  1GM9 A;  4DFM A;  5IIM A;  2VA8 A;  3H8W A;  5KFJ A;  1K9M W;  4UCS A;  4UCU A;  4J9R A;  4ECW A;  3LNM B;  1MSW D;  1M57 C;  5L1L A;  2KQX A;  5DB7 A;  4CS4 A;  1R6K A;  2ZDI C;  2D3D A;  4EBE A;  4DRX A;  5KHJ A;  3C1Y A;  3FM9 A;  3V7L A;  5ALT A;  2GWS A;  1A0P A;  2NYV A;  4C4S A;  5KT4 A;  4K8X A;  4C8M A;  1TK5 A;  3MR5 A;  4ICG A;  4Z6C A;  2ADP A;  3ZD8 A;  2LO1 A;  1TV9 A;  4I2D A;  5KFU A;  4LFA O;  4JI2 B;  1P7D A;  3U10 A;  5H6R A;  4DFD A;  2UVU A;  4RQ0 A;  4LBE C;  1D9D A;  5B1A B;  1TE2 A;  9ICL A;  2YSU B;  4RPY A;  3E2E A;  4CS2 A;  1FXV A;  1ZQD A;  4NLG A;  1OCC C;  2ZUC A;  1ZQU A;  2XT9 A;  1EBO A;  4DO9 A;  4KHP B;  3LDD A;  1MQ2 A;  1SZX A;  9ICK A;  9ICG A;  7ICV A;  3CHX A;  5LA6 A;  4CF3 A;  5KFF A;  3HKZ F;  2K4I A;  1QVF U;  2CRX A;  3AQE A;  2JRZ A;  4U7O A;  5LHI A;  3JCU Z;  3BEH A;  1G8M A;  2W03 A;  4PA4 A;  2ZJ8 A;  5G5H A;  1F0M A;  1H2N A;  4PI0 A;  2N1R A;  4EEK A;  5JTI A;  1OW5 A;  4F8R A;  5BOM A;  2GV9 A;  2WLN A;  1SQG A;  3SEI A;  2Y0P A;  1NK6 A;  4B9S A;  8ICO A;  2DBY A;  1NTZ H;  1A76 A;  8ICN A;  5L3C A;  3H8M A;  1SS3 A;  1VMG A;  2Q7E A;  4DL5 A;  1TUE B;  3V6K A;  1NZP A;  4YD2 A;  2XCA A;  3O65 A;  3QEA Z;  1IXR A;  4DL7 A;  2ZJA A;  2ZKO A;  2AW9 A;  1U4B A;  2BSK B;  4DR6 B;  2X0L A;  1K3E A;  5ALW A;  3GIJ A;  3BA9 A;  4DF8 A;  4KLM A;  3ASO B;  2CDY A;  3QG5 A;  2K8A A;  3ISB A;  2H3Q A;  4EYH B;  4O4H A;  5AG2 A;  1QR9 A;  3HPL C;  3C23 A;  3RB6 A;  5B1B B;  3H0R B;  4GXJ A;  2XCP A;  4DV1 O;  3A8T A;  2VRZ A;  1KFS A;  4F6R B;  4JK1 A;  1IG6 A;  2HW3 A;  1R3I C;  3KHH A;  3CRA A;  2ASJ A;  2HMX A;  5KX5 B;  4OJL A;  1ZD4 A;  4UAZ A;  1MQ3 A;  1D8L A;  1R3K C;  3BZC A;  3WK8 A;  1XS9 D;  3L71 H;  5K1P A;  4EEY A;  4EZ6 A;  4Y2U A;  4BX9 C;  5AM1 A;  4RNM A;  3ZHR A;  1ZQV A;  4TV8 A;  3C2K A;  5IYB O;  3A2F A;  3OUS A;  4G27 B;  2ESE A;  5LMN B;  2H3Z A;  5KFD A;  3QUB A;  1NJY A;  2EX3 A;  4UVC A;  4J9S A;  4LF5 B;  2HHV A;  1D8B A;  4J9Y B;  4DSJ A;  2P4K A;  1RSO B;  4JI1 B;  3AG2 B;  1FFT B;  1DK3 A;  4B9V A;  3A0H Z;  5AIA A;  3ZN0 A;  2BTQ A;  4I2J A;  2BQ3 A;  1RYR A;  4I29 A;  2EJ7 A;  3OMN B;  5LGU A;  3E58 A;  4LWS A;  3W7U A;  4F4Z A;  4GXK A;  3RFR A;  2Q4T A;  4JI8 B;  3NVY A;  4H13 B;  2ZUB A;  3UKM A;  1RYU A;  2JEU A;  5J2C A;  3D36 C;  3SAH A;  2QSA A;  2KD1 A;  1ZQO A;  3EFF K;  4ELV A;  1ZX3 A;  4RQM A;  2HP8 A;  4J9O A;  4O4I B;  4O5E A;  1F4N A;  2OH2 A;  2BCS A;  3P32 A;  4X66 O;  3HKE A;  4DV3 B;  4UB2 A;  2NO4 A;  1RPO A;  1AR1 B;  3RJF A;  1JFF A;  5IT9 N;  4IIJ B;  4MTG A;  1U45 A;  4O3M A;  4C7U A;  3Q8M A;  2G5I B;  4JPR A;  4LF9 O;  1JRO A;  2RLT A;  2IJK A;  3Q8Q B;  7ICK A;  2H3F A;  2PTM A;  2L35 A;  4NV0 A;  1SZP A;  4F4K A;  2MU2 A;  1G6U A;  5D5Q A;  3X2Q C;  3MGI A;  5B3S B;  1V55 C;  2B0C A;  4NXN O;  2ES6 A;  4JUZ A;  4EX6 A;  1NK8 A;  2ZXW B;  4FM2 A;  5D4B A;  2O6K A;  4UXN A;  4UW9 A;  1QQ6 A;  5ALG A;  3JD4 A;  2W8K A;  2QTO A;  2Y69 C;  3RYI B;  2BQU A;  4M47 A;  2CH7 B;  1JJ2 U;  4RUF A;  2WF8 A;  4FZM A;  5KNI A;  5HFL A;  5J2D A;  1D5N A;  2HVJ C;  2LW1 A;  3RH5 A;  3ABM C;  4UAT A;  1VF5 B;  2XVT A;  1AQ6 A;  5TIS U;  1AJP A;  3HKB B;  1VIB A;  2R8K A;  4TV9 A;  2FPK A;  1S97 A;  1JX4 A;  4PV1 B;  1KB9 F;  5KHK A;  3TFS A;  3E22 B;  2HHH B;  4J03 A;  3UXN A;  3CRX A;  3RR8 A;  3Q4H A;  2A19 A;  5IJ9 A;  2YI8 A;  4B7E A;  1NR1 A;  4DW1 A;  5DKW A;  3HR0 A;  3KKY A;  1HNW O;  1SC5 B;  3E83 A;  8ICR A;  5KAI U;  4TQF A;  5BMV A;  2DQN B;  2WLL B;  4ZOL B;  3D2Q A;  5LP6 A;  2JH1 A;  1WYG A;  5F9N A;  3SV3 A;  3G71 V;  4JWM A;  3V6J A;  4DV6 B;  1BNO A;  2DPJ A;  4KLT A;  1GKF A;  5KUM A;  2ZM6 O;  1ORQ C;  2N04 A;  9ICI A;  4DSL A;  3FKS G;  4OGQ B;  1EN5 A;  3JPP A;  2EIJ C;  2DWQ A;  3GQC A;  4BWA A;  4JYY A;  4EFE A;  3UMG A;  2C22 A;  1I5Y A;  2KJ8 A;  1G4Y B;  3JAK A;  4TQD A;  3JAW A;  4IRC A;  1XL6 A;  4M9G A;  3IDW A;  1KBU A;  1GTO A;  3CSX A;  1KYO F;  1NR7 A;  1S5L U;  5FL7 G;  3TCU A;  2G08 A;  2XIC A;  4UFZ A;  4QNL A;  5KG2 A;  5EYP A;  1Z4O A;  1ZWI C;  1VQM V;  4Y2T A;  4IQV A;  4UBC A;  3SPC A;  1M1K W;  1LKY B;  2GOL A;  4BXO A;  1ENV A;  2WLK A;  2WF9 A;  1UCV A;  9ICU A;  4I27 A;  4A5U B;  5LOV B;  7ICI A;  2KK0 A;  3E89 A;  3FB8 C;  4KLI A;  3SD7 A;  4X9Q A;  2LKY A;  4FS2 A;  4HBN A;  4KFM A;  1COK A;  1V38 A;  4X65 B;  2Q69 A;  2XY6 A;  1N56 A;  4F5Q A;  2PGG A;  2EZP A;  1TK0 A;  3CS5 A;  3HKC A;  2I1Q A;  3PY8 A;  2LBO A;  1T94 A;  3CJH B;  3BY6 A;  3TXQ A;  3QX7 A;  1E79 G;  2FI1 A;  3ZD9 A;  2GDS A;  4B9N A;  1WG8 A;  5IY5 B;  2BPG A;  2LJ2 A;  4BDP A;  1DGJ A;  2W04 A;  2Y1J A;  3C3T A;  4X5V A;  4WBN B;  4ED3 A;  4JV0 A;  3V7K A;  2L5Y A;  1V54 B;  3HW8 A;  1HUO A;  4G9B A;  4YXM A;  2GO7 A;  2G5H B;  8ICC A;  1Y74 B;  1NTK H;  4B7K A;  2UVV A;  4MFA A;  1NVP D;  4B08 A;  4ZIB A;  1OCZ B;  1SZT A;  1KN5 A;  5J0U A;  2LGW A;  1MA1 A;  4WFH A;  3UCS C;  3SR6 A;  1VQL V;  1NQT A;  5EZY A;  2QKS A;  2NLJ C;  5D5P A;  5ALS A;  4PA6 A;  4LH7 A;  5KG5 A;  4UB8 U;  3AEV A;  4ECX A;  3G6E V;  3K3W A;  4YVZ A;  1QLE B;  4GXI A;  2Q4P A;  4DW0 A;  5H2F U;  4DR1 B;  2DWD C;  2EUL A;  1TUB A;  4GCZ A;  2HG5 C;  2WLM A;  1Z5V A;  3R9K A;  2D6F C;  2E8N A;  1QSY A;  2KOB A;  2UXC O;  4US9 A;  3C1Z A;  2WLH A;  3RH4 A;  3MHS C;  5EOZ A;  4DR5 O;  2XUM A;  4GKK B;  4UCO A;  5L1J A;  1KKX A;  4QGP A;  5L3D A;  5KT6 A;  3RRH A;  3AG4 C;  3K0D A;  2Y69 B;  4UUJ C;  4B3S B;  2RP5 A;  3ZDA A;  3A0H U;  2ASD A;  2BCU A;  1ZAU A;  3CP1 A;  2ATK C;  3LUT B;  5FPR A;  3STZ C;  2LYB A;  3N2K B;  3GZF A;  3WG7 B;  1X2I A;  2Y9U A;  5JCO A;  2EIM B;  3G67 A;  3WB2 A;  3X2Q B;  1HEK A;  1XC9 A;  3JSL A;  4YMN A;  1O9G A;  4RAI A;  3RTV A;  5IIK A;  5EWE A;  1P84 F;  1XL4 A;  2QTS A;  4R6Z A;  3TGU H;  4ZHQ A;  4I55 B;  3ICX A;  4FFD A;  1SKV A;  3A0R A;  4KL1 A;  5IJ0 B;  4F4Y A;  4LFB B;  4PZN A;  1OCZ C;  3KFU F;  1CP9 A;  3RR7 A;  4WFE A;  1X9M A;  3ZDB A;  3BS5 B;  3DGE A;  2IJJ A;  1QTM A;  1NJZ A;  1PZN A;  2H3V A;  3G4S V;  4TUS A;  1SL1 A;  4KLL A;  1V97 A;  3F5A A;  3QUT A;  3PJS K;  1XO0 A;  3OHA A;  4Z1V A;  4RO2 A;  5AKI A;  8ICY A;  3EW9 A;  2PF4 E;  2E5L B;  4W4L A;  1YTF D;  1NI8 A;  1MN8 A;  2LM1 A;  1I0H A;  4O4L B;  3UT5 A;  5AKE A;  1ZRN A;  2DYR C;  2A1J B;  2ZD9 A;  2ZE5 A;  3H1I H;  1IVS A;  1ZQ1 C;  3RBE A;  2WF6 A;  2OWO A;  4I2F A;  3BS7 A;  2X7R B;  4EBD A;  1BE3 H;  4JAU A;  1OCO C;  5GON A;  4Z6D A;  5KAI Z;  2HR3 A;  4J9K A;  4IQW A;  4JI4 B;  3RJJ A;  5ALJ A;  4I2E A;  1UHU A;  2XO7 A;  4FBU A;  2ADQ B;  2R9A A;  3O9O A;  1N0J A;  4AI8 A;  3CPW U;  1S72 V;  3LVW A;  3E8H A;  4Q8E A;  5KFQ A;  4KLG A;  4J9L A;  4LF7 B;  4F72 A;  1FYJ A;  1YF2 A;  2QLT A;  4DV0 O;  1DTO A;  1ZD3 A;  5AM2 A;  4DFK A;  2HOI A;  1YIJ V;  5KFR A;  4MTF A;  2V4D A;  3C90 A;  3KZI U;  3C2L A;  2W0X A;  4TWK A;  5JQG B;  1IBL O;  4ICA A;  1OUQ A;  3ZHQ A;  1X9X A;  3P30 A;  4JTC B;  1SQB H;  3N97 B;  1M93 A;  3RVY A;  3SJB C;  2KVC A;  4YD1 A;  3EPG A;  1EN6 A;  3DTU B;  1BGX T;  4WFB V;  3DC6 A;  1PPJ H;  2P6J A;  5CB4 B;  4JYB A;  3BVO A;  1Y88 A;  1HR0 O;  2ZIV B;  2ODM A;  3N27 A;  3HIL A;  3T5L A;  4GKJ O;  4JAS A;  3QUC A;  1KQQ A;  2P67 A;  4F91 B;  3IHQ B;  2ISO A;  4L87 A;  2ZTE A;  3I56 V;  3TFR A;  1AI6 A;  4KLU A;  5TIS Z;  4DV2 O;  3QUQ A;  3B8M A;  4QZE A;  1XEQ A;  5LXT A;  1UT8 A;  4Q45 A;  2HBL A;  1TAE A;  2JJ2 G;  4OPH A;  3PNC A;  2Q73 A;  3FAV B;  4QZG A;  1LNQ A;  5IE9 A;  5AKY A;  3OJU A;  3ZBH A;  1W59 A;  4DK1 A;  4MVO A;  4ACO A;  2VAN A;  3NVZ A;  1ZQL A;  1FS0 G;  5AI4 A;  7ICP A;  4DR1 O;  1Y76 B;  4QWB A;  3WU2 Z;  3K9A A;  1KTQ A;  7ICO A;  9ICP A;  1KQS U;  4PDL A;  1PK1 B;  1NJI W;  4DOA A;  1ZD5 A;  1KDH A;  1Y4M A;  4JI7 B;  5KFM A;  5LYJ A;  2Q7H A;  4OPA A;  1FFX B;  5JJE B;  2VQE O;  1TAM A;  1WCN A;  3ETR A;  1T4G A;  1L7M A;  1JRP A;  2ZR2 A;  4PDR A;  4O3Q A;  1AI7 A;  4LF4 B;  4XQ8 A;  4QZ9 A;  1K4C C;  2JGD A;  1I94 O;  3JAT A;  4YR3 A;  1K97 A;  3W7T A;  9ICX A;  1TAQ A;  2CTR A;  4ZI7 A;  1JXE A;  4DL4 A;  2JRI A;  3B8N A;  2QEX V;  1DRG A;  3I55 V;  2ZT9 B;  2P7T C;  5KMG B;  1X42 A;  4I4T A;  2A3V A;  2H94 A;  1AIL A;  2KSO B;  3CCQ V;  2ZIU B;  1B06 A;  3RJI A;  2AJQ A;  4QWC A;  4DS5 A;  3WK7 A;  2H5X A;  4HZ3 A;  3JAS B;  3A0B Z;  4HAM A;  4JI7 O;  2QKA A;  4KN4 A;  3LWM A;  3MAB A;  1HUZ A;  1QCK A;  5DM6 V;  1GN3 A;  3VCB A;  3SQI A;  2Y0I A;  2WAQ F;  2JZB B;  2YEV A;  4O3R A;  4B3R O;  9ICB A;  2Q68 A;  3SGI A;  4YG2 A;  4O2A A;  4D7T A;  4IC9 A;  1THZ A;  2IHN A;  2EIM C;  1WB7 A;  3E86 A;  1FEZ A;  3GV5 B;  3ZRX A;  4DR3 B;  5AK6 A;  8ICX A;  4UB6 U;  2E1E A;  4DQI A;  3WK9 A;  4F2S A;  2WFA A;  7ICH A;  1L6N A;  4I0X A;  2RQ5 A;  1ED1 A;  3M6Z A;  4FZN A;  1RXW A;  2PFN A;  3KKA C;  5KFP A;  5AM0 A;  3IGA C;  2RRD A;  4DV2 B;  4YR0 A;  3K06 A;  3HKZ C;  2BKE A;  4TUY A;  4NLZ A;  3OPX A;  4JYC A;  1I08 A;  1COW G;  2HBK A;  4IR1 A;  1SQX H;  4EKW A;  2VWJ A;  2K9P A;  4Y2Y A;  3RYH A;  1N48 A;  3N2G B;  5K4L A;  3GB7 C;  2NRV A;  2K8B B;  2M9N A;  4IHJ A;  4DQR A;  3PW5 A;  1QU7 A;  1QLE C;  4NR1 A;  4WCE V;  2ZIW A;  4O5K A;  4F93 B;  1EM1 A;  1G1X B;  3LDA A;  2B1I A;  2KEY A;  1IBL B;  2O57 A;  1A77 A;  2M0N A;  2IJI A;  2CK3 G;  1P7B A;  1RPR A;  2QKQ A;  1K1S A;  2UU9 O;  1ROP A;  1AI4 A;  2UXB B;  4KLS A;  3OEH G;  3TKA A;  4CNQ A;  5KT3 A;  2UUB O;  1H2L A;  4H33 A;  1QHT A;  4B3M O;  1U96 A;  2WAM A;  5IYZ A;  5L3F A;  2VQF B;  2YMM A;  1H8H G;  2G0A A;  3ABK C;  3QYP A;  3MR6 A;  5AI0 A;  3GII A;  4K8Z A;  1JR9 A;  5KFK A;  4DQS A;  5LA6 B;  3TQ1 A;  4QE7 A;  4KLJ A;  2Q0O C;  3RJH A;  2HEP A;  2W6I G;  5IIL A;  4ED0 A;  2PMZ C;  1FD9 A;  1ZQE A;  2EZO A;  3ZJZ A;  4FM1 A;  3G6V A;  2DE0 X;  5KAF Z;  2E75 B;  4J7J A;  1FXK A;  3CCM V;  5AI5 A;  1V85 A;  4CH6 A;  1XO1 A;  1I7F A;  3QF7 A;  2HCF A;  2E8O A;  1F51 A;  5B1O A;  5J2U A;  3T5H A;  2YC0 A;  2G07 A;  4C8K A;  1L0L H;  3OMA B;  4GT1 A;  3KHG A;  1ZD2 P;  2JHD A;  1DOQ A;  1WJZ A;  4TUQ A;  1EXN A;  1WWV A;  4FFB B;  4CZZ A;  2AH5 A;  1HDJ A;  2NRX A;  5DQI A;  3SPG A;  1WPB A;  1E1R G;  5KHI A;  3SPJ A;  2DGZ A;  2AQ0 A;  3L70 H;  3RJG A;  1Q81 W;  5AM4 A;  3CC4 V;  1XWL A;  3LYS A;  3BA8 A;  2ZJ5 A;  1YIT V;  3WU2 U;  4F71 A;  3TI0 A;  1ZQT A;  2YDE A;  3UQ2 A;  1YTF B;  2GHY A;  2BPC A;  8ICK A;  3SYQ A;  1AVM A;  3AG3 B;  5L9X A;  3TAN A;  4GX1 A;  2PFP A;  2KKW A;  4X1Y B;  3ABM B;  2F1M A;  1R3J C;  2Y0S C;  3M1Y A;  1HJP A;  2V4R A;  4LH6 A;  2KZZ A;  5E79 Z;  1AP5 A;  2MK3 A;  1BCC H;  2QJ1 A;  4LFC B;  5KA5 A;  3U11 A;  4MVS A;  5KFI A;  5IYD O;  2BTO A;  5BXZ A;  3CMA V;  1Q46 A;  2AGQ A;  1JMK C;  1ZL8 B;  2WLJ A;  3RGB A;  2RDI A;  4NM1 A;  2W7O A;  2LYA A;  3FDS A;  8ICW A;  1JIH A;  2BDU A;  1QQ5 A;  1KRP A;  1WLE A;  1J2N A;  3RN4 A;  1ZQX A;  2EAM A;  4QJF B;  1RSO A;  2LMR A;  1X59 A;  1N5W A;  3WKC A;  1N34 O;  1NJX A;  8ICA A;  3JPR A;  4ZOH C;  4F5O A;  4JMU A;  2B6G A;  1XNS A;  3HX0 A;  3CRQ A;  4X88 A;  1K33 A;  2KVS A;  1VQ5 V;  4DSE A;  1V55 B;  4GUN A;  5DB8 A;  3N4M B;  3TAR A;  1UFI A;  5JU5 A;  1WN7 A;  1KEJ A;  1ZQI A;  2GUZ A;  4PJ0 Z;  4O3N A;  5CHG A;  5DN6 G;  4DV0 B;  2YMQ A;  1SA0 A;  2EIL B;  4PGY A;  3HKE B;  1K5O A;  1XMO O;  1EZV H;  1URF A;  1EFR G;  3SJC C;  4BAY A;  1Q43 A;  4IIJ A;  3K75 D;  4LNU B;  1Q90 D;  4UCV A;  5J8Y A;  3WK4 A;  1Z2G A;  2BE3 A;  4JI4 O;  3ZN1 A;  2HVK C;  2BGW A;  2J6S A;  4R50 A;  4B3R B;  3SYZ A;  2R8J A;  5HR7 A;  1NT2 B;  2FJ6 A;  3VBB A;  4DUY B;  5DGB A;  2ZIX A;  4HAI A;  2V4Q A;  4EX7 A;  3PN1 A;  3F5E A;  1NVP B;  2PZS A;  4CRX A;  1ZQG A;  4NTX A;  2OTJ V;  2MSN A;  1FO4 A;  5ALR A;  5AIB A;  4DWI A;  1LR1 A;  4HNA A;  2M7W A;  5LMU B;  2NV3 A;  3Q8L A;  3BQ7 A;  4RZR A;  3KKA A;  4J11 A;  1KL9 A;  3JYC A;  4YHH O;  5HFM A;  1T7P A;  3G6X A;  4B9L A;  2HHW A;  4RQ1 A;  1YJ9 V;  2IU3 A;  5AI9 A;  1Z00 B;  2A06 H;  5F3X B;  3BAA A;  3WK6 A;  1IV8 A;  2NNU A;  4DL2 A;  2N05 A;  2WLI A;  4O3O A;  1UA0 A;  1S5J A;  4I9Q A;  1C20 A;  4PHE A;  1U48 A;  2K4P A;  4JF3 A;  2ZDI A;  1K4D C;  3E22 A;  2VQE B;  2VA3 A;  1JUD A;  1CUK A;  5LP6 C;  5ALP A;  3RB0 A;  3K1Z A;  2IH1 C;  3HKD A;  1S9F A;  4U3J A;  3F2D A;  4X64 B;  4GIB A;  4TQR A;  3ASO C;  5IDJ A;  8ICG A;  2Q0Z X;  2F66 C;  2OXO A;  3UPQ A;  3HT3 A;  2HHH O;  1XSN A;  1IM4 A;  4KMO B;  5L1M A;  2E8M A;  1X9S A;  2MRL A;  5JJJ B;  2PKE A;  2JR5 A;  3C5G A;  1KC8 W;  1NOM A;  1URJ A;  4ECT A;  1L3U A;  3I28 A;  2FMS A;  1O03 A;  2FML A;  3B2E E;  4HYK A;  1DK1 A;  2UUB B;  3PR5 B;  1ZQR A;  5J29 A;  3ZDD A;  4JI3 O;  3D36 A;  1X40 A;  2KIV A;  5CRX A;  5J0Y A;  5CBF A;  4P0P B;  2FLN A;  1XMQ O;  4J9Q A;  2KHV A;  2A7W A;  3JAW B;  2F4V B;  2UUA O;  5CR0 A;  1NK4 A;  3RAQ A;  1L0N H;  4YR2 A;  2FMQ A;  5KTQ A;  5KFN A;  2JK5 C;  5J2A A;  2G38 A;  3ZI4 A;  1ZQP A;  3L72 H;  1HNZ O;  2W7P A;  1TA8 A;  1AB3 A;  2OYY A;  4RQ3 A;  4BXO B;  8ICL A;  5ALH A;  3NR7 A;  5DLF A;  2BCV A;  2HI0 A;  4I2C A;  1Q6H A;  2W43 A;  3IFX A;  3MD0 A;  2QR4 A;  4QWE A;  1FKA O;  1SKR A;  3H8J A;  7ICF A;  2XI9 A;  1H2S B;  2DYR B;  4EYI B;  1GMG A;  2C2R A;  4QIW F;  8ICM A;  5B1A C;  3MDA A;  4R65 A;  3NVW A;  4NL9 C;  3IAY A;  2K4E A;  5DGA A;  3FYI B;  3MC1 A;  5ALM A;  8ICT A;  1GK9 A;  1NKB A;  5KHG A;  2KNJ A;  4QZF A;  2WWW A;  4PZO A;  1SQQ H;  5CA0 A;  3FAH A;  1GN2 A;  4RU9 A;  1JX9 A;  5E1A C;  3WB1 A;  3R66 A;  5J0X A;  2KSD A;  2C28 A;  1U9L A;  4IRD A;  1S0N A;  2QWO B;  1RQN A;  1M5I A;  2AGO A;  2E1F A;  3JAL A;  4AP9 A;  4M9H A;  5KAF U;  2NN4 A;  1SQP H;  2LFS A;  5GTI U;  1MA7 A;  4R64 A;  3J7A U;  2F76 X;  2F23 A;  3H9V A;  5KA6 A;  5EZY B;  3SI8 A;  4NXZ A;  4QIW C;  1U97 A;  3UXO A;  5AKG A;  3OTO B;  3QXG A;  2KE7 A;  3ETL A;  1S10 A;  3FX7 A;  3WG7 C;  2DYS C;  2B21 A;  2DFL A;  2HHS A;  4IT5 A;  5EBL C;  5GW7 A;  3CC7 V;  3J81 N;  1TUB B;  5ALV A;  3PW7 A;  3R65 A;  2IA6 A;  3KBB A;  1NK5 A;  3ML0 A;  1XNR B;  3AG4 B;  3G6B A;  2KZM A;  4PJ0 U;  2Q7G A;  1OV9 A;  4UB6 Z;  3IV6 A;  3OR6 C;  4RWU A;  1H8E G;  1I94 B;  2FPL A;  4Y2S A;  2Z5U A;  4LF4 O;  3EUB 2;  2BHN A;  2C2A A;  2KG7 A;  4TSF G;  4XA5 A;  3EYZ A;  9ICE A;  3LDC A;  5KG4 A;  4N23 A;  4JV1 A;  4UB8 Z;  2LW7 A;  1N34 B;  2XAF A;  4DSK A;  9ICF A;  3N2K A;  1WA8 B;  3ZMZ A;  8ICE A;  4RQ7 A;  3E8B A;  2ITD C;  1NK7 A;  3B77 A;  5B1B C;  1P49 A;  4KTQ A;  2KTQ A;  2JS5 A;  4DV4 O;  2R8H A;  8ICP A;  4RQN A;  3NVV A;  4ZHQ B;  4DYL A;  4DFJ A;  4I55 A;  4XUS A;  2E76 B;  2YXH A;  4LF5 O;  5AK5 A;  3PML A;  1ZTE A;  2GH1 A;  1JCH A;  4JI5 O;  4GKK O;  2PMZ F;  2QWR B;  4KLO A;  4UVA A;  4RT2 A;  1K1Q A;  4LF7 O;  2WF7 A;  3K5M A;  2E3C A;  3BS5 A;  2ZE7 A;  1D8Y A;  5EC2 C;  2F8K A;  2R9R B;  5EBW C;  9ICS A;  3MHH C;  3ZCC A;  4YJ2 A;  3MR3 A;  4U7C A;  2QB0 B;  3RBD A;  3SMV A;  1PV0 A;  4Q20 A;  3T4Z A;  4NL9 A;  2BR0 A;  2CXY A;  2AXT U;  2E5S A;  3ETQ A;  4WFG A;  1Q86 W;  1OXJ A;  3UM7 A;  4GKJ B;  2HFE C;  2XID A;  4UB5 A;  2V1D A;  5KFC A;  3CCU V;  4DL6 A;  4ZH4 A;  4FMT A;  4ED8 A;  2FYU H;  2CAZ C;  4KXR A;  5CEH A;  7ICR A;  1LUV A;  3PSP A;  1SQF A;  2QWQ B;  1UPH A;  1L7O A;  2KP7 A;  3M8A A;  2MUT A;  4F5P A;  4I9W A;  2JEJ A;  1SL2 A;  2XAS A;  4FVM A;  4CH3 A;  1P4R A;  4XRH A;  2W9B A;  3I5D A;  1X4T A;  3FB6 C;  3K1R B;  2VJ5 A;  2OCH A;  1NTM H;  2BOB C;  3WB0 A;  5BPC A;  3W7X A;  3H4D A;  4CE6 A;  3CE2 A;  2UXX A;  3AU6 A;  3CCS V;  1XNQ B;  3VOU A;  1QQC A;  2P66 A;  1UPG A;  1AJN A;  4J9M A;  2PXI A;  4MEY A;  4EBC A;  5C93 A;  3PO4 A;  1BT8 A;  1N0N A;  3TET A;  4DOC A;  2JMG A;  1SV0 C;  4A8E A;  3T1C A;  4MW8 A;  5AKH A;  1JQ0 A;  5HMM A;  4NLK A;  2DF4 B;  4KLE A;  2ZIM A;  4PA9 A;  2QWN B;  1ZET A;  4CGZ A;  4X20 B;  4Z2W A;  4RQ8 A;  4Q43 A;  1GM8 A;  2J6U A;  2DJV A;  4MTO A;  2YXY A;  2GTA A;  4DR5 B;  4DO2 A;  4MF8 A;  4QNH B;  4IR9 A;  1ZQC A;  4J42 A;  3I1Y A;  2KMD A;  4H44 B;  5LXT B;  1B04 A;  5B66 Z;  4I2H A;  4ASU G;  2JH7 A;  2F1I A;  2GSM B;  2UXN A;  3JD2 A;  1SKW A;  2P35 A;  4EB6 A;  2ZM6 B;  1MMM A;  1R73 A;  4GX2 A;  1NNL A;  4KLH A;  4UV8 A;  1K92 A;  3ETG A;  2ZUD A;  4M04 A;  2WA3 A;  4FE3 A;  3K0G A;  4LCU C;  3JPO A;  4NLN A;  3RYC A;  1AR4 A;  1MG1 A;  2PI4 A;  1B22 A;  3U0Z A;  3KZI Z;  4Y2Q A;  1B4F A;  5KFV A;  3OD4 A;  1ZJM A;  4I5S A;  1SWW A;  2MAX A;  2IBZ H;  2RJZ A;  4M6W B;  4JAV A;  4BIU A;  5ITZ B;  1N60 A;  5DLG A;  4PL2 A;  1SER A;  1MNG A;  3RT3 C;  4NLB A;  4O4J B;  3ZHT A;  2CTP A;  3NXS A;  3QE9 Y;  2F77 X;  1T3Q A;  1XQ8 A;  1YEW A;  2R72 A;  1KKC A;  5DG7 A;  2ZNJ A;  4O4H B;  5G5G A;  1LUW A;  5JVD B;  1JPX A;  3RRG A;  1M56 B;  4F6R A;  1XOU A;  2LQT A;  1YSC A;  4E0D A;  4IYI A;  5IWA O;  2A9H A;  3RVZ A;  4ED1 A;  5J0T A;  2YUA A;  3JAS A;  2PY5 A;  4R8C A;  5EC1 C;  5BR8 B;  1L5U A;  3JPQ A;  1F4M A;  3HJE A;  3F5W C;  3UM9 A;  3QNM A;  1QCE A;  1N32 B;  2Y1I A;  4KHP O;  3E35 A;  2F44 A;  4QWD A;  3IRU A;  5KG6 A;  2G06 A;  4DV7 O;  5IY5 C;  2N74 A;  4DSF A;  4O3S A;  5ALU A;  4KX3 A;  3Q8S B;  3JAR A;  3CCE V;  1NH2 D;  2XAJ A;  1TKD A;  1N36 B;  3H01 A;  4KLQ A;  2W9A A;  4B6J A;  4TUP A;  3KHR A;  3F5T A;  3TAD C;  5J2G A;  3AK3 A;  2FLL A;  1N63 A;  2H8P C;  2YN4 A;  5AI8 A;  2JEG A;  1L8L A;  2E3T A;  2R8I A;  4Q44 A;  3ABT A;  2JEI A;  4AIL C;  1S76 D;  7ICJ A;  4I50 B;  2AZ2 A;  3UQ0 A;  2DN9 A;  2RCV A;  2P6R A;  1QBZ A;  4X65 O;  2X6B A;  3AL0 B;  4K0K O;  3SV4 A;  2AXT Z;  3UQ8 A;  3KCX A;  5J2J A;  4H0L B;  4F5N A;  3QU7 A;  3T4D A;  2FKX A;  5L1I A;  1FFV A;  5AI6 A;  1BMF G;  4IHJ B;  2Q67 A;  3APO A;  4DCC A;  2PYL A;  2F4V O;  2F8L A;  5TZV A;  4J10 A;  1GAX A;  2Q8V A;  1ZXI A;  3AK1 A;  4GX0 A;  3OGI B;  5DED A;  1M9N A;  2Y4T A;  3OHB A;  1JFF B;  4JI3 B;  1B0X A;  4ED6 A;  4Y2V A;  5J0S A;  1B3Q A;  4F2R A;  2YIB A;  4OX9 O;  3JPT A;  2IMW P;  3AQF A;  3Q8P B;  1ZUQ A;  1VLB A;  4FFK A;  1Q3V A;  3QO7 A;  3QEB Z;  5GTH Z;  4R66 A;  5HP4 A;  3ZX6 A;  4DV4 B;  3WKA A;  3ETD A;  1PP9 H;  2JDI G;  2HLD G;  4O5C A;  3DEE A;  4IL6 U;  1JI7 A;  1KSP A;  1SRY A;  3CXC U;  4B3T B;  1Z3E B;  3BDP A;  1Z4N A;  4PHP A;  5HNK A;  8ICV A;  3IP4 B;  1XRE A;  2ARH A;  4R63 A;  1L1F A;  4FLY A;  2JEX A;  2OIE A;  1NZB A;  1MZE A;  2QWP B;  1U49 A;  4KIT B;  2FL4 A;  3K03 A;  1OHH G;  3N7P D;  4DUZ B;  1RQL A;  5DDY A;  1WP7 A;  3ALR A;  5ALO A;  3ZRW B;  3HKB A;  1WNS A;  5J2U B;  2ISP A;  5J2K A;  3OEE G;  2JIZ G;  3RJK A;  4YY3 O;  1NH2 B;  1XU4 A;  1SKS A;  2ZE6 A;  3F2B A;  3SR2 C;  1JVM A;  3OGU A;  4MFC A;  1QH9 A;  1BPZ A;  4RQ6 A;  1HP8 A;  3ZRS A;  3OTO O;  7ICT A;  1Q5O A;  3OM3 B;  3K5O A;  4CC5 A;  1T3N A;  3RYF A;  5HML A;  5KFZ A;  2WLL A;  4ZOL A;  5IWA B;  2NR5 A;  3GVM A;  2DMX A;  5KFL A;  1VQ7 V;  2YIC A;  3L5K A;  3IG5 A;  4JYA B;  1DLB A;  4P0Q A;  3RFA A;  3QZ8 A;  3CRM A;  3D3I A;  4G28 B;  2OYQ A;  4K0K B;  1QQ7 A;  1Q6I A;  5AK4 A;  1ZQH A;  1N33 B;  1DF5 A;  1KFT A;  4X1K A;  1ZJN A;  1S3J A;  4P4P A;  3S3W A;  3K59 A;  1BS3 A;  5CA3 A;  2YY6 A;  3JPN A;  4KN7 A;  4X1Y A;  3JAK B;  3EXA A;  2CN1 A;  4R8U A;  1J5E O;  5A9G A;  1J97 A;  5HHH A;  4YJ3 A;  4RQF A;  3BZK A;  4J80 A;  1YT3 A;  4LFA B;  1IDS A;  2BCC H;  4KX5 A;  3H7I A;  7ICE A;  5EYP B;  1B43 A;  5B5E U;  4ZBM A;  4F6E A;  1LKY A;  2G09 A;  4Z1M G;  2UUC O;  4P4M A;  1SV4 A;  1L3T A;  3JPS A;  1AI5 A;  2RN9 A;  3ABU A;  2YXL A;  2BOC C;  2OCE A;  4JI6 O;  3ED5 A;  2KIW A;  2NRZ A;  3H0L B;  3M9N B;  2B5U A;  2LYH A;  4ECR A;  1PUZ A;  1HNZ B;  1IBM B;  1R3L C;  4DLG A;  2IOH A;  2HOF A;  4LC1 A;  2HJF C;  3JAM N;  1Q7Y W;  9ICJ A;  2RMK B;  3CJH A;  3S6J A;  4DR6 O;  5LL6 Y;  4PHZ A;  3GWO A;  1L8D A;  4FJC C;  2RDJ A;  1XMQ B;  1RM1 C;  4YCX A;  4Z6F A;  4GC7 A;  4CF4 A;  5KG7 A;  1SF9 A;  2NRT A;  1VQ9 V;  2Q9L A;  2RHF A;  2XOK G;  1Y74 A;  4W4K A;  3UO2 A;  1KP2 A;  4DXW A;  1SA0 B;  1B6Q A;  1VQ4 V;  4P9P A;  4X1I B;  1BPY A;  1CI4 A;  3C29 A;  8ICQ A;  1VQP V;  2A1A A;  4OJ5 A;  2EDU A;  1V9P A;  4ECU A;  3RBZ A;  3OSN A;  4F4X A;  4BW9 A;  3RB3 A;  1F44 A;  4FBT A;  1BVS A;  3VC8 A;  3N7R C;  4PDV A;  2ZIX B;  5KFH A;  4FLT A;  2IJH A;  3ONN A;  3D2S A;  1R1B A;  2JGA A;  3RAX A;  3KD3 A;  5ALF A;  5LBQ A;  4OJO A;  4LVS A;  5CMU A;  1KKD A;  3DSQ A;  1NI3 A;  1RFY A;  1HIW A;  2EH9 A;  3QTC A;  5KFE A;  4JI2 O;  3PO5 A;  3M7D A;  1KEC A;  2ZIO A;  5KG0 A;  4KUM A;  3L4P A;  2BSK A;  2M6Y A;  2YML A;  5FNV B;  3BCC H;  2LP7 A;  1Z00 A;  4AQY B;  4KLD A;  5C8Y B;  4QPK A;  2D8C A;  4F3O A;  3PZP A;  2WLI B;  2DPI A;  2DWE C;  2EAO A;  3O0F A;  4IL6 Z;  1TVK A;  2OIG A;  5JH7 A;  1CPY A;  3CP8 A;  4B3M B;  5HHI A;  1Y67 A;  4PGX A;  2W9M A;  1F23 A;  1IXM A;  4MVQ A;  4U3J B;  1N4C A;  4JZG A;  1DXS A;  3CXH F;  1KMI Z;  3ETE A;  5B3S C;  4M2Y A;  2GTS A;  1NU1 H;  1HNX O;  5J0Q A;  2UU9 B;  2RDC A;  5IIN A;  2KHQ A;  4YMM A;  3OUF A;  4FIP C;  3ZDE A;  1NK9 A;  4ABM A;  4TV8 B;  4DUZ O;  4EEN A;  4NKG B;  2KFZ A;  2DW4 A;  1H2M A;  2V7Q G;  3CCL V;  4MT8 A;  3UT5 B;  4LF8 O;  1FJG B;  2DYS B;  4CCH A;  2QM8 A;  3AM9 A;  3FC4 A;  3NRZ A;  4PI2 A;  3DDH A;  4K4G A;  2FPM A;  5K1X A;  3T5K A;  2AU0 A;  5ALQ A;  1QSS A;  2IHM A;  1KFD A;  4B3T O;  4BUG A;  2R8G A;  2QDO A;  1JAL A;  1US6 A;  4LWS B;  1M57 B;  2EZX A;  3VQX A;  5LGN A;  1XSL A;  1WPX A;  7ICM A;  3M6K A;  3ISD A;  2GBO A;  4QZ8 A;  4DF4 A;  2JEF A;  1Q3E A;  8ICF A;  4QW8 A;  5AKJ A;  1UT5 A;  3T79 A;  3K08 A;  2HHT A;  1O08 A;  4NWI A;  2HSZ A;  3B4S A;  4ELT A;  1WB8 A;  3B09 A;  3OAA G;  4YP3 A;  4MTX A;  1N61 A;  1YZB A;  3PX4 A;  4O2B A;  2ZIV A;  4JWN A;  2KJ9 A;  5EIB C;  4UVB A;  3JAL B;  3JD1 A;  4CS3 A;  4QWA A;  4LZD A;  2QGN A;  1PNL A;  4QPJ A;  4FLU A;  1WWU A;  1ZQB A;  1GRJ A;  3K9S A;  2YQE A;  2BCQ A;  4EFB A;  4JI6 B;  2R18 A;  5H5N A;  1TAU A;  3PV8 A;  1NJW A;  1ZQA A;  4QE9 A;  1FFU A;  1VJ5 A;  1CEZ A;  1V54 C;  5J9P C;  2Z0A A;  2VWK A;  5EK0 A;  4FK5 C;  2F1H A;  1S5L Z;  1JJO A;  3CB2 A;  4UB1 A;  5IIO A;  1XHZ A;  5ALX A;  3DXR A;  3FFQ A;  1TVA A;  4KP4 A;  4X89 A;  5J0O A;  1IBK O;  3QU4 A;  1MZF A;  1BPD A;  3ZHU A;  3PSF A;  4X66 B;  5J0W A;  3L73 H;  1LVH A;  1XSP A;  5KFW A;  8ICH A;  3HB3 B;  5CJ7 A;  4NVP A;  4C4R A;  4J9N A;  8ICB A;  2OHF A;  1Y76 A;  5AM3 A;  5J2I A;  5C5J A;  5L3B A;  1M90 W;  1N33 O;  3F2C A;  5GTI Z;  4K4I A;  2UVW A;  3L75 H;  3FD9 A;  5DDM A;  7ICU A;  9ICN A;  3IC7 A;  4CH5 A;  3W7W A;  3KCY A;  2Y0S F;  2WPD G;  3U26 A;  3FYE B;  2DQ3 A;  4NYK A;  3H1K H;  1KBH A;  5LP6 B;  2PUS A;  3UMB A;  2UUA B;  2CPR A;  1RXV A;  2HVH A;  5A0L A;  5FLX N;  2VQF O;  1WA8 A;  3EWA A;  3LVV A;  1VP7 A;  9ICQ A;  4IQU A;  2AHY A;  2QB1 A;  3JAT B;  4CH4 A;  5B5E Z;  1FIQ A;  4YY3 B;  1KD1 W;  1S5H C;  1OCC B;  4X62 O;  3H1H H;  1XIL A;  2ZIU A;  4JTD B;  4MFF A;  4OO1 J;  4CF5 A;  1BL8 A;  1MAB G;  1ZQJ A;  3IG8 A;  5HR6 A;  2Q0A A;  2I9G A;  1CXZ B;  4TT3 G;  5CBG A;  1AP6 A;  1A32 A;  4FLX A;  4ECQ A;  1YZ6 A;  3SJA C;  4X64 O;  2P90 A;  4AYB F;  4DV6 O;  1HR0 B;  3QO8 A;  4B9M A;  4BWM A;  2UVR A;  4EEQ A;  4C80 A;  5LOV A;  1ARO P;  4DR4 O;  2MW2 B;  4DS4 A;  2XC9 A;  3ORY A;  3RB4 A;  4YIO A;  2GLE A;  3ZMV A;  1K5S A;  3EVK A;  4TOI A;  4LF8 B;  4F4W A;  3GV8 B;  3M7M X;  3VQV A;  4I0X B;  4JV5 B;  4NTY A;  1K7D A;  2XAG A;  3CWB H;  1KUQ A;  4IGG A;  2Y48 A;  5CB1 A; 
#chains in the Genus database with same CATH homology
 1UPH A;  4I9W A;  2XAS A;  1P4R A;  1DTO A;  4PDM A;  3TK1 A;  3CME V;  2HOI A;  1YIJ V;  4CDG A;  4MTF A;  4BW5 A;  4JTA B;  2VIX A;  3FB6 C;  4TWK A;  3NRW A;  2VJ5 A;  4ICA A;  3SAG A;  1OUQ A;  2BOB C;  4P9O A;  3P30 A;  4JTC B;  3W7X A;  1K34 A;  3PST A;  2R9I A;  2UXX A;  1W0K G;  3AG1 C;  3CCS V;  4PL1 A;  3RVY A;  3VOU A;  2KVC A;  5EBM C;  1AJN A;  3DTU B;  2LHT A;  5L3E A;  4WFB V;  2P6J A;  3ZIA G;  1N8R W;  2ZIW B;  2ZQM A;  5C93 A;  2HOQ A;  3TET A;  3E8G A;  2X6A A;  4JYB A;  2JMG A;  2ZIV B;  2EBO A;  4A8E A;  3F53 A;  4N21 A;  3T1C A;  4MW8 A;  3ZRV A;  3K04 A;  4JAS A;  1JQ0 A;  2DF4 B;  2P67 A;  3ASN B;  1YJN V;  4L87 A;  4PA9 A;  4CGZ A;  3I56 V;  3AG2 C;  1AI6 A;  3KZX A;  4RQE A;  5LHG A;  1GM8 A;  3B8M A;  4MTO A;  4FZL A;  1I5X A;  4P30 A;  3RW0 A;  4DO2 A;  1BHB A;  4G2K A;  4QNH B;  1RM1 B;  1BHA A;  2HBL A;  2EIJ B;  1PVP A;  2OM6 A;  1OCR C;  2DQ0 A;  4NLC A;  4GFJ A;  2JJ2 G;  2Z3Y A;  3KG2 A;  2W0F C;  1H2G A;  1LNQ A;  3LDE A;  5T14 A;  1PVR A;  4MVO A;  2JH7 A;  4ASU G;  4ACO A;  2GSM B;  2UXN A;  3JD2 A;  2ZXH A;  1FS0 G;  3LSS A;  1YJW V;  2A79 B;  1VQO V;  3OW2 U;  1R73 A;  1SES A;  4GX2 A;  4UV8 A;  3K9A A;  3AG3 C;  1KQS U;  1K92 A;  3ETG A;  4PDL A;  4P2Z A;  2K89 A;  1NJI W;  4FE3 A;  2H3I A;  1Y4M A;  3FB5 C;  5LHH A;  1PNK A;  3K0G A;  4LCU C;  1MG1 A;  1TAM A;  2PI4 A;  1M56 C;  5IYC O;  2B1G A;  2VJ4 A;  1AJQ A;  1FXK B;  2OTL V;  2ZR2 A;  2WAQ C;  3STL C;  4PDR A;  1AI7 A;  4I5S A;  1NKD A;  1K4C C;  4JAV A;  3H0M B;  4OXS A;  4BIU A;  3W7T A;  1K97 A;  1FXH A;  1ECW A;  2HBJ A;  1PKX A;  3SYP A;  3B8N A;  2QEX V;  1QR8 A;  4ZKI A;  1DRG A;  1GO3 F;  1IIP A;  4OJP A;  4PL2 A;  4WFF A;  3I55 V;  1SER A;  2P7T C;  4NLB A;  3PSI A;  3ASN C;  2A3V A;  2H94 A;  3NXS A;  3T2M A;  1K5Q A;  4PA7 A;  2F77 X;  3CCQ V;  2ZIU B;  1YHQ V;  3NUQ A;  2IW5 A;  3EHB B;  4LP8 A;  3CCR V;  1FXK C;  2D3O W;  3ZMS A;  1JPX A;  1M56 B;  4HZ3 A;  4HAM A;  3OMI B;  5H6Q A;  1YSC A;  2A9H A;  3RVZ A;  5DM6 V;  1HWY A;  4HYO A;  4P0Q B;  3VCB A;  3SQI A;  3AG1 B;  4MVR A;  4XDK A;  2WAQ F;  2YEV A;  4R8C A;  5EC1 C;  1SZH A;  2Q68 A;  1S0V A;  3ABK B;  1F4M A;  2YB1 A;  3F5W C;  2OCC B;  4IC9 A;  1THZ A;  4R7C A;  2EIM C;  1QCE A;  3E86 A;  4CBC A;  3E0F A;  3E35 A;  2ZXI A;  3OE7 G;  3ZRX A;  1K8A W;  2IU0 A;  2K1E A;  2E1E A;  2ITC C;  1L6N A;  2G06 A;  5IY5 C;  4OJ6 A;  1PD3 A;  1ED1 A;  3M6Z A;  4KX3 A;  4FZN A;  3CCE V;  1NH2 D;  2XAJ A;  3H01 A;  2EIN B;  3IGA C;  5CN0 A;  2WB1 F;  4MVU A;  5LGT A;  1DF4 A;  1GM9 A;  2RRD A;  2PI5 A;  4MVZ A;  3K06 A;  4XDL A;  2H8P C;  1K9M W;  3HKZ C;  3OPX A;  4JYC A;  1COW G;  3LNM B;  3ABT A;  2HBK A;  1MSW D;  1M57 C;  1S76 D;  4EKW A;  5CBF A;  4WJ3 B;  3CCJ V;  1H38 A;  3GB7 C;  1QBZ A;  1R6K A;  2X6B A;  2K8B B;  3AL0 B;  2ZDI C;  1QLE C;  4WCE V;  2ZIW A;  3T4D A;  1A0P A;  1BMF G;  2Q67 A;  2KJ5 A;  2A0L A;  2F8L A;  2B1I A;  2KEY A;  2M0N A;  4GX0 A;  2IJI A;  1P7D A;  1M9N A;  2CK3 G;  1P7B A;  5H6R A;  1VQK V;  4GX5 A;  1RPR A;  4LBE C;  5B1A B;  2LFR A;  1ROP A;  2YSU B;  1AI4 A;  3E2E A;  1FXV A;  3OEH G;  1OCC C;  3JD3 A;  3AQF A;  1EBO A;  4H33 A;  1Q3V A;  3QO7 A;  3LDD A;  2WAM A;  5L3F A;  2XAQ A;  3K79 A;  1H8H G;  3ETD A;  3CC2 V;  2AHZ A;  2G0A A;  2JDI G;  2HLD G;  3ABK C;  1QVF U;  3DEE A;  2K4I A;  3HKZ F;  3CD6 V;  1SRY A;  3CXC U;  2CRX A;  3AQE A;  2FTK A;  3SAF A;  4U7O A;  5LHI A;  1R6N A;  2XAH A;  3D2N A;  4F4L A;  4E2L A;  3IP4 B;  1G8M A;  2W03 A;  3BEH A;  4PA4 A;  4QE7 A;  2W6I G;  2PMZ C;  2EZO A;  1L1F A;  3ZJZ A;  2QA4 V;  2N1R A;  2JEX A;  1NZB A;  5KUK A;  2F43 G;  2WLN A;  3CCM V;  1FXK A;  3K03 A;  5L3C A;  1F51 A;  1OHH G;  3N7P D;  5B1O A;  1TUE B;  3ALR A;  3ZRW B;  2G07 A;  2YB4 A;  3OMA B;  4GT1 A;  1KP3 A;  1PL0 A;  2JHD A;  1Y66 A;  2X0L A;  1NH2 B;  1K3E A;  2JIZ G;  3OEE G;  1E1Q G;  3ZRW A;  4CZZ A;  3F2B A;  3SPG A;  2QE7 G;  3ASO B;  1E1R G;  1JVM A;  2OCC C;  3ZMT A;  2K8A A;  3SPJ A;  2EJR A;  3ZRS A;  2DGZ A;  3OM3 B;  2H3Q A;  4BIZ A;  1Q81 W;  3CC4 V;  5B1B B;  3LYS A;  1QR9 A;  2X6C A;  3HPL C;  3H0R B;  2WLL A;  1YIT V;  1VQ7 V;  2WB1 C;  1R3I C;  3IG5 A;  2HKO A;  1JOY A;  1DLB A;  4P0Q A;  2HMX A;  3RFA A;  4OJL A;  2GHY A;  3D3I A;  4G28 B;  3AG3 B;  3SYQ A;  2YEV B;  1R3K C;  2Q6A A;  4GX1 A;  1DF5 A;  3ABM B;  1R3J C;  2Y0S C;  1S3J A;  4C0Z A;  1OZ0 A;  4BX9 C;  3SYA A;  5CA3 A;  3SYO A;  4UV9 A;  2CN1 A;  4FPP A;  3C28 A;  3QNE A;  2MK3 A;  5KA5 A;  4RQF A;  5IYB O;  3ZMU A;  3OUS A;  4MVS A;  4G27 B;  5IYD O;  2EIK B;  1VQN V;  1YT3 A;  2H3Z A;  3L3F X;  3CMA V;  4KX5 A;  4UVC A;  2WLJ A;  1W0J G;  2Z7J A;  2W7O A;  2LYA A;  4ZBM A;  2G09 A;  1D8B A;  4J9Y B;  4Z1M G;  2BDU A;  3AG2 B;  3ABU A;  1AI5 A;  1FFT B;  2BOC C;  1WLE A;  3ZN0 A;  3OMN B;  5LGU A;  4QJF B;  3W7U A;  3QO5 A;  4MVM A;  2KIW A;  2F2A B;  3H0L B;  2B5U A;  2Q4T A;  5B1N A;  1R3L C;  3UKM A;  2JEU A;  4JMU A;  3SAH A;  1XNS A;  2HOF A;  1Z19 A;  2KD1 A;  2HJF C;  3EFF K;  4LC1 A;  1Q7Y W;  4X88 A;  1K33 A;  1VQ5 V;  1F4N A;  1V55 B;  2OH2 A;  1OCR B;  2EIK C;  3GWO A;  4FJC C;  3P32 A;  1RM1 C;  1UJW B;  3CYM A;  4MW3 A;  1RPO A;  4PEL A;  1MOF A;  5DN6 G;  1AR1 B;  1VQ9 V;  2EIL B;  4MTG A;  4AYB C;  2RHF A;  4O3M A;  2XOK G;  2G5I B;  1EFR G;  3W7S A;  4JGS A;  4JPR A;  2KKP A;  4BAY A;  1QVG U;  1KP2 A;  4DXW A;  1Q82 W;  2KKV A;  1B6Q A;  2IJK A;  2OT5 A;  3ABL B;  2H3F A;  1VQ4 V;  3CYO A;  4NV0 A;  4P9P A;  3ZN1 A;  2HVK C;  3X2Q C;  3C29 A;  4R50 A;  5B3S B;  1VQP V;  1V55 C;  4OJ5 A;  2ZXW C;  5HR7 A;  3RBZ A;  3VBB A;  4U6P A;  5L3G A;  1F44 A;  1OCO B;  2ZIX A;  2ZXW B;  3F5E A;  4UXN A;  3VC8 A;  1NVP B;  3N7R C;  4PDV A;  4CRX A;  2ZIX B;  2OTJ V;  3JD4 A;  2IJH A;  3ONN A;  2YX8 A;  3D2S A;  2QTO A;  2Y69 C;  2M7W A;  2JGA A;  2NV3 A;  5KL1 B;  5LBQ A;  1JJ2 U;  4OJO A;  4RUF A;  4FZM A;  5CMU A;  5HFL A;  1KKD A;  3LSQ A;  4RUE A;  1HIW A;  3JYC A;  2HVJ C;  5HFM A;  3ABM C;  2XVT A;  3M7D A;  1KEC A;  3F7Y C;  4KUM A;  1YJ9 V;  1AJP A;  2IU3 A;  2NNU A;  4MSW C;  4J9Z B;  2WLI A;  2LP7 A;  3CRX A;  1YTF B;  4JF3 A;  4QPK A;  1NR1 A;  2ZDI A;  2WLI B;  3PZP A;  1K4D C;  1YI2 V;  4XDJ A;  2DWE C;  3E83 A;  2IH1 C;  3K1Z A;  3O0F A;  4X8A A;  2DQN B;  1J95 A;  2WLL B;  3D2Q A;  1W2B U;  2JH1 A;  3G71 V;  3F2D A;  1CPY A;  5IDJ A;  3ASO C;  3SJQ C;  3CP8 A;  2OXO A;  1F23 A;  1IXM A;  1GKF A;  4MVQ A;  5KUM A;  1ORQ C;  4KMO B;  2MRL A;  3ETE A;  3FKS G;  5B3S C;  1KC8 W;  1URJ A;  2EIJ C;  3ABL C;  2KHQ A;  1I5Y A;  3D36 A;  2KJ8 A;  1G4Y B;  5KL8 B;  3OUF A;  4FIP C;  3SYC A;  5CRX A;  2KB1 A;  2DW4 A;  1XL6 A;  4P0P B;  2QM7 A;  2V7Q G;  1KBU A;  1GTO A;  4MT8 A;  2WSS G;  1NR7 A;  2KHV A;  5FL7 G;  3TCU A;  3CCL V;  3OR7 C;  2G08 A;  2XIC A;  4QNL A;  3IN5 A;  2DYS B;  1ZWI C;  1VQM V;  4WFA V;  3SPC A;  5H9C A;  2QM8 A;  1M1K W;  2GOL A;  1ENV A;  2JK5 C;  2WLK A;  3E89 A;  1QLN A;  5CBH A;  4BUG A;  2W7P A;  3FB8 C;  2OYY A;  4U7N A;  2LKY A;  4KFM A;  3IFX A;  1M57 B;  3MD0 A;  2Q69 A;  5LGN A;  4BJQ A;  2XI9 A;  1WPX A;  2EZP A;  1VQ6 V;  3M6K A;  2ZG6 A;  2DYR B;  1GMG A;  2K8C B;  4QIW F;  1T94 A;  2LBO A;  3BY6 A;  5B1A C;  4YXW G;  1E79 G;  3JCZ A;  2K4E A;  3FYI B;  3T79 A;  1EZJ A;  1GK9 A;  3K08 A;  2KNJ A;  5IY5 B;  2WWW A;  3F7V C;  2W04 A;  4NWI A;  5E1A C;  1JX9 A;  1V54 B;  2G5H B;  1A6S A;  3OAA G;  4MTX A;  1NVP D;  2E1F A;  1OCZ B;  1SZT A;  3WFV A;  1VQL V;  4WFH A;  1NQT A;  2ZIV A;  2KJ9 A;  2QKS A;  2LFS A;  2NLJ C;  4UVB A;  1MA7 A;  3JD1 A;  4PA6 A;  2F76 X;  1PNL A;  4QPJ A;  5KA6 A;  1GM7 A;  3G6E V;  2R18 A;  4QIW C;  3K3W A;  2K4H A;  1QLE B;  3OFN G;  2KV2 A;  4QE9 A;  2DWD C;  4GCZ A;  3WG7 C;  1CEZ A;  1V54 C;  2HG5 C;  2DYS C;  5J9P C;  2WLM A;  5EK0 A;  2D6F C;  4FK5 C;  2KOB A;  5EBL C;  5GW7 A;  3CC7 V;  2WLH A;  3R65 A;  2JJ1 G;  4KP4 A;  3ML0 A;  4X89 A;  3MHS C;  4H37 A;  3AG4 B;  3PSF A;  5L3D A;  3HB3 B;  3AG4 C;  3K0D A;  2Y69 B;  1H8E G;  3OR6 C;  2VKQ A;  4UUJ C;  2RP5 A;  2Z5U A;  2HBM A;  5C0Y A;  4MS2 A;  3CP1 A;  3E8F A;  1Q3U A;  2C2A A;  4TSF G;  2XND G;  2ATK C;  3LDC A;  3LUT B;  5L3B A;  1M90 W;  3STZ C;  3F2C A;  1PNM A;  2LYB A;  4N23 A;  3GZF A;  3WG7 B;  2EIM B;  2XAF A;  3IC7 A;  3W7W A;  3X2Q B;  3JD0 A;  1HEK A;  2Y0S F;  2IH3 C;  2WPD G;  3FYE B;  2DQ3 A;  4RAI A;  3ZMZ A;  3SPI A;  1XL4 A;  2CPR A;  4R6Z A;  3E8B A;  2ITD C;  5A0L A;  3B77 A;  5B1B C;  3ICX A;  3A0R A;  2MA1 A;  1OCZ C;  1PVQ A;  3LVV A;  3KFU F;  1CP9 A;  2EIL C;  3RF9 A;  4WFE A;  2AHY A;  1SET A;  2EIN C;  3DGE A;  2GH1 A;  1JCH A;  5BZB A;  2IJJ A;  1KD1 W;  3CCV V;  2H3V A;  2PMZ F;  4UVA A;  1Z1B A;  1S5H C;  3M99 B;  3G4S V;  3MGV A;  3F5A A;  1OCC B;  3PJS K;  1XO0 A;  2ZIU A;  4JTD B;  4WF9 V;  1BL8 A;  4OO1 J;  1MAB G;  4RO2 A;  1WUD A;  5EC2 C;  1K73 W;  3IG8 A;  3OGC C;  2R9R B;  5EBW C;  5HR6 A;  3MHH C;  2KIC A;  3N7S C;  2ZR3 A;  4U7C A;  3ZCC A;  4P0P A;  3GU3 A;  4TT3 G;  5CBG A;  1YTF D;  3SMV A;  1VQ8 V;  4Q20 A;  2P90 A;  3AEI A;  2DYR C;  2ZD9 A;  4AYB F;  3T4Z A;  4WFG A;  1Q86 W;  2E5S A;  1ZQ1 C;  3QO8 A;  3FB7 C;  2X7R B;  3UM7 A;  2HFE C;  2XID A;  2V1D A;  1ARO P;  4JAU A;  3CCU V;  1OCO C;  4XBF A;  4FMT A;  4PA3 A;  2HR3 A;  1CRX A;  3ZMV A;  1K5S A;  1NBM G;  3PSP A;  3SPH A;  3CPW U;  1S72 V;  2W6J G;  1S77 D;  1K7D A;  3LVW A;  2XAG A;  3E8H A;  2Y48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...