1FFUA

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
155
Chain Sequence
KKIITVNVNGKAQEKAVEPRTLLIHFLREELNLTGAHIGCETSHCGACTVDIDGRSVKSCTHLAVQCDGSEVLTVEGLANKGVLHAVQEGFYKEHGLQCGFCTPGMLMRAYRFLQENPNPTEAEIRMGMTGNLCRCTGYQNIVKAVQYAARKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
total genus 45
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1ffuA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ffuA01
5EE1A 1NVID 1JQ4A 1OQRA 2Q5WD 3FAHA 3AE5B 2W54A 2WU2B 3AE4B 4ZHPA 2QIEB 2BS3B 5H8YE 1L5PA 1NI3A 1ZP0B 3PO0A 3VRBB 4YSXB 3P63A 1L6VA 1AWDA 2W3RA 2G1EA 4P6VF 3WCQA 4LTUA 2DWQA 1NYQA 2BT6A 3VRAB 1PUTA 2Y5CA 3LXFA 3P1MA 1SF0A 3SFEB 3AEDB 2L52A 3HRDD 3AM9A 1QF6A 1YJIA 1KFYB 1RYJA 3AE7B 4YSZB 1PFDA 1B9RA 3P4RB 1YJJA 3RPFC 2W55A 4N6EB 1J7AA 4JX1C 3AE8B 1ZOYB 4N59A 1XO3A 3AE9B 4ITKA 3P4PB 4FXCA 1VJKA 1IUEA 1J7BA 5AUIA 3CWIA 3NVZA 1SIJA 2WLBA 1XLPA 2K9XA 1I7HA 2WP9B 1QOGA 3BIID 4YT0B 1FRRA 2CJNA 1XLQA 3AB5A 1CZPA 5EE9A 1L0VB 1QOFA 1DOXA 2WS3B 3B2GA 3B9JA 1PDXA 1YQ4B 1FIQA 2AX5A 2WDVB 3AEFB 4IDIA 5GXGB 1E9MA 4N58A 5MPOA 1CJEA 3DWGC 4YTNB 3SFDB 2PIAA 1TJEA 1V8CA 2K22A 4ZOHC 1L6UA 1ZXIA 3W5VB 5C3JB 2QJLA 1JWBD 2JX5A 5C2TB 5G5HA 3L4PA 1UWMA 2WU5B 1N5WA 3AMZA 1SB3C 2JQRB 4HROA 2H89B 1XLNA 3NVWA 1QOBA 1FO4A 1T3QA 1N5XA 1KF6B 1JW9D 4C7ZA 1WXQA 2PVGC 1RFKA 5EE0A 2W3SA 2DBYA 1FFUA 1E6EB 3P4QB 2MJDA 3NVYA 4WQMA 1WYGA 2BS2B 1N61A 1FXAA 1KRHA 2K5PA 2FBWB 2EKIA 2HTME 1DOIA 4WWMA 1YQ3B 3ABVB 1OFFA 2H88B 1QOAA 3NVVA 2CJOA 1N62A 3LB8C 4US9A 2WDRB 1E0ZA 4JWSC 1AYFA 1R7SA 3NRZA 3KWLA 3W5UB 1EWYC 4YSYB 4USAA 1TKYA 1NEKB 2WQYB 5EE3A 1WRIA 4ZHOA 4HRSA 1JRPA 2ACZB 5H92C 3AE2B 3W9CB 1VLBA 3SR6A 2B76B 3ETRA 3AH7A 1RM6C 1ROEA 3B2FA 2M56B 2WDQB 1QLBB 1NENB 2L83A 1GPXA 1V97A 3VR9B 3DWMA 3ZYYX 1E7PB 2BS4B 1WWTA 2MH7A 3NS1A 1JWAD 2M19A 1A70A 2KAJA 2OHFA 1XLOA 2PVOD 1TYGB 3CIRB 1F0ZA 4KX6B 1N63A 4US8A 4C80A 1FMAD 1NYRA 3P4SB 3VR8B 1JROA 2N0SB 3AEGB 4YTMB 1DGJA 1RWSA 4YTPB 1TKGA 2LEKA 2KMMA 3AE1B 1TKEA 1DOYA 1GAQB 1FXIA 3AEAB 3AEEB 1E10A 1JALA 1QT9A 2MJEA 1FRDA 3AECB 1FFVA 1VDVA 2E3TA 3AV8A 3EUB2 3FC4A 1WGKA 4JWUC 1FM0D 4C7YA 4A9AA 2MJ3A 3AEBB 5G5GA 1OQQA 2CU3A 1J7CA 3AE6B 3AE3B 3HUIA 3HVZA 1ZUD2 2PKOA 5AUKA 4YXDB 3AN1A 1N60A
chains in the Genus database with same CATH superfamily
3H4BA 9ICRA 3AE4B 1K1QA 2BS3B 3PZPA 4RPXA 1BPBA 8ICMA 3SHQA 3JPTA 5CB1A 2UVUA 2HVIA 2QILA 3DVNU 3P63A 4PGXA 1F44A 1I4PA 4NL9A 3RFZB 5EWEA 1ZQNA 5EOZA 1Z2MA 3GE3C 1RPLA 1WSPA 3LXFA 2RP5A 2N4FA 1XT9B 5KFUA 3QU5A 2F76X 3SYZA 3AM9A 2FPKA 3B0YA 5KFYA 2R8IA 2JF5A 4YFKA 2J7QB 3WK5A 2J6TA 4M9GA 3CP8A 5ALIA 4F4KA 4KVGB 4KLMA 2EAMA 1KDHA 4EELA 1V9PA 3G6XA 2RHFA 3AE9B 4RMAA 3RNGC 3NVZA 3C1YA 5KL8B 3SU8X 4W9EA 1TKDA 1WXSA 4IQTA 2QARA 1TK8A 3CYMA 2K0PA 3ZDDA 4UB2A 1VZ6A 8ICZA 3KD3A 4B9NA 3V6HA 5MPOA 2JY6A 3L10B 1D5XC 1CK1A 1ZXIA 7ICLA 3GS2A 1WE7A 5AK3A 2F8KA 5ALKA 2IHNA 4O3MA 1RRBA 1EUVB 5J0OA 3MTNB 5BYQA 1YZ7A 4IRCA 3L54A 1VCBA 3NHEB 1S1QB 5ALXA 4D2KA 2HJ8A 2N9XA 4NLNA 4UATA 2KQSA 3OLMD 2DBYA 3U4EG 2KVZA 3FKYA 2JWUA 4GXJA 1RLFA 2KVCA 4C8KA 3NOBA 1WUDA 5KFEA 4TV3A 2QHOA 2KK8A 4Q45A 1ZD3A 4WJNA 5BMIA 4Q43A 4I2GA 1JXLA 2CHZA 2WDRB 4F4ZA 4UAYA 3BK1A 3KWLA 4USAA 3DCGA 4Y2PA 5DLGA 5TR5A 4TMAB 5GMVA 3J81j 3SR6A 4J9QA 2WXLA 2L7RA 1NNLA 2DZKA 3I28A 5DQHA 5ALDA 3ZXRA 5AM3A 2BCUA 3EECA 3B0AA 4P6VF 1X66A 1F0ZA 3QZ7A 3ZDBA 3E58A 2G5HB 5ALWA 4US8A 3RZWC 1JROA 2GWSA 3EWAA 3GILA 2Y5BB 3TQ1A 3H7SA 2JXTA 4FBJB 3PREA 1SJED 3C2KA 1GAQB 5AM4A 3Q8MA 4MGKE 4MJSA 4KLQA 1ZQIA 4CF5A 2G4DB 2YB1A 5J0RA 4FHJA 3VDZA 2W8LA 3VQIA 3U26A 1D5MC 5DG9A 1V1PA 4YXDB 2KYWA 5JH5C 1KLVA 5KFXA 3WKDA 1V86A 4KDLB 1JQ4A 4NJ8A 4ARIA 2PLPA 3LDZE 5J0WA 4PHDA 2WU2B 4YWGG 4WIPA 3SMVA 2D2QA 2ISPA 5H2FU 3RF9A 1BGXT 3HPOA 4K4GA 3AU2A 1D6EC 3ZO5B 3Q3MC 5AZFA 2QLTA 5J2DA 3AEVA 4B9TA 2BT6A 1UWXA 2Y5CA 1YZ6A 1OW5A 2J0KA 2UU7A 3H0LB 4DSKA 5DPTA 3H7IA 1OQYA 3UI3A 5C5JA 4E71A 4MEXA 1U49A 1SIFA 5D94A 1NZPA 3OTQA 8ICEA 2M4NA 2I1JA 5TZVA 2W7OA 2VH1A 3BZKA 3ZDTA 2KZRA 4NNJB 1MSWD 3ZGZA 4MHVA 3MFIA 2XGQA 3QEAZ 1KLGD 4GC6A 1QH9A 5A0LA 5EWGA 1E7UA 1FNVA 1NBFC 1RYUA 4LNOA 5BYRA 4DL4A 5B66U 4EZLA 1CJEA 3PT2B 5IA7A 4KMOB 1JXEA 1GC6A 1TJEA 2NCNA 2WGSA 2FNJB 2KTRA 4N9F4 1WX9A 3TARA 4B6WA 5DB9A 5ALNA 2VIXA 4RUCA 2KSOA 1Y56A 1X2IA 2REXA 2JQRB 2X8XX 4NLBA 3NVWA 4F8RA 2BYTA 1T3QA 4FS2A 3IG8A 3HWTA 1J19A 3QHTA 2CN1A 2FLNA 2LVOA 3FDSA 2KOBA 4HWIB 4YQWA 1ZQGA 4FLHA 4P4PA 2F1HA 3M6ZA 4PJ0U 3VCBA 4RUAA 3QU2A 1TAUA 2ZNVB 3KVFB 3APDA 3KKAC 4MELA 3F5AA 1FEHA 3VFKA 5J2AA 4JWMA 2K39A 2W9BA 3PR4A 4RT2A 5KTQA 4HCNB 3VVWB 2HW3A 3SI8A 3AU5A 2WDTB 1V1PB 4FJVB 3H8WA 1JRPA 3V3XA 3WKBA 3NGDA 2W82A 1K50A 3LVWA 3SAGA 2WDQB 5J0QA 4EYHB 4KLEA 4EE2A 2KZZA 8ICWA 2BS4B 4XWWA 1C20A 2LGYA 1N63A 1NYRA 3ICXA 5LNK1 4E0DA 1RWSA 4RF0A 4KN4A 3RAQA 1MC8A 1WY8A 9ICGA 4MFCA 1FXTB 4BOZB 5CR0A 3AV8A 2GRIA 1FFVA 1M94A 4RQ3A 4Y2VA 2GBMA 2Y3AA 4A9AA 3T5JA 3K4GA 2HBKA 3JPNA 4UAVA 8ICNA 1SE9A 3Q69A 4NJCA 2LGDA 3TAPA 3O13A 1JI7A 4KLFA 2M9NA 3OJUA 3T5LA 4ZHPA 2J4XA 3VXWA 4AWJA 5H8YE 1KLUD 1TV9A 3AU4A 3Q14C 4EBCA 9ICWA 5L95C 1L6VA 2BR0A 1ISNA 2DZIA 1SGHA 3D2QA 3FILB 4UAZA 8ICHA 2KTRB 1QTMA 4EEWA 1T5XD 1FCCC 1D9FA 3AUOA 5DPSA 1SWVA 2MLBA 1XNSA 2PI4A 5HR7A 5AM2A 5F3XB 2ZIVB 4MH8A 1SKRA 2HHXA 1PYWD 5CX3A 4C4VA 4KLSA 2I1QA 3RBDA 2LI6A 1T3NA 1T0RC 1UCVA 4KTQA 1QQ5A 4I2BA 1TIFA 2KJ9A 2KJ8A 3JVZX 1WMHB 1CZPA 3T3FA 1C3TA 4PS7A 1SZHA 1U4BA 4O5KA 1JWUD 1MHHE 3CSFA 1V85A 4GB9A 5BMGA 2A5UA 3IM1A 1L7YA 2BKFA 4W9IA 3C29A 4A20A 2WU5B 1N5WA 2O6KA 2UVRA 3VH3B 4J9SA 4DFPA 1XLNA 4DCCA 4TSSA 4H2AA 5AKLA 4P0QA 4DLGA 4OVZA 4F4WA 1FFUA 4HPLB 1E6EB 1R4MB 4B9MA 5ALTA 3MFGA 5JHBA 4GSWA 5KG3A 5AZHA 3VTUA 1X40A 2CKHB 4IR1A 1WGDA 4J9RA 3N7PD 1B22A 3GIKA 4R66A 4PYZA 3V7LA 1ZQEA 8ICYA 4UAUA 4TQSA 4QNLA 4IC9A 4US9A 1L3TA 3PPAA 1U47A 1ZQXA 4IS7A 3NUQA 3D32A 5AI9A 1RAXA 1C76A 4RNNA 3R8BA 4MT5A 4DSFA 1NJWA 1GJZA 2HHQA 5KT6A 4R8UB 3PTFC 3IT6B 2Z7JA 1NENB 2L83A 2ISOA 1RFAA 5HNKA 1LVHA 2FLPA 1E8WA 1TS2A 3EPGA 2UWQA 2OHFA 4QWBA 1SKSA 2Z0DB 3N30A 2M0AA 1YOVB 1V6EA 5ALVA 3IDWA 1FMAD 3QUCA 2HTHA 4K81A 4TURA 5D7GA 5ALYA 2BQ3A 1AQ6A 1NI2A 1QT9A 2DHZA 4NQLB 3WK6A 2MX2A 5G2NA 5HFYA 4C7YA 4KKJA 3J9CA 1S0OA 3RN9C 3AE3B 2RMMA 4ZRIA 4PL2A 1P98A 3BY4B 3HM6X 5ALPA 3C28A 4KGTA 1YN4A 3APCA 1UT8A 5DKWA 5CTRC 4YCXA 3LJ3A 3BQ0A 4GIBA 2BCSA 1QQ6A 2XO7A 3QUBA 5KG2A 4YR3A 2MA9B 2WXFA 1E8ZA 7ICOA 2QEJC 4UAWA 1T4GA 3WAMA 1TGZB 1XCQL 5IIOA 3PW4A 5AIAA 3A4RA 3ZDMC 3PSPA 2LM1A 4HVBA 5J0UA 4RQ5A 1TS5A 4BGDA 4Q44A 3TFRA 2WNMA 2JYTA 2R8GA 2UYZB 5CWRA 1Q1OA 2FUG1 4P0PA 4LVSA 3T3NA 2FE8A 4NL9C 1IUEA 4I2JA 4X57B 5J2KA 1SE4A 2BPFA 7ICQA 4KLJA 1XLPA 3GZNI 2DAJA 2A3VA 4NLZA 1L8LA 1XLQA 4RU9A 2BQQA 1WGGA 1JCKB 2WDVB 1YQ4B 1FIQA 1F9JA 5GXGB 1A0PA 1MFWA 5DLFA 1GNUA 5J0SA 2N1WA 3UXNA 2HHTA 1ACCA 1HZ6A 3NZSA 3MDAA 1COKA 4MGIE 5C2TB 3OG5A 4IG7B 3MC1A 1QSLA 2PFNA 1WM3A 4DL6A 2PMVA 2XY6A 4FHKA 2J52A 2GI9A 4PS3A 5JU5A 4C7ZA 1JN3A 4P4OA 5KFFA 1RFKA 2W3SA 2L0TA 3M62B 4KIKA 2MJDA 4R63A 4M02A 3TEZA 1Q8KA 4BWMA 1RXWA 2LRUA 4PK1A 1DOIA 2PE9A 2MBOA 5AK5A 1OFFA 3KZXA 2H88B 3NG0A 1YX5B 3GV5B 4DO9A 5J2JA 1SL2A 2H3FA 8ICQA 3RUIB 2HHUA 5CHFA 2WQYB 3PSIA 1O03A 3GIJA 3KKAA 2G3QB 3EA6A 1C1YB 5AK4A 4ECSA 2NO4A 4F4YA 4HK2A 2NMQA 4YXJA 4O0IA 2WX0A 3DHGC 1QQ7A 3AH7A 4B9UA 4F3OA 1ZDVA 3H8HA 1GB1A 2QCZA 4O3RA 5KNIA 3ZJTA 2KFKB 1S10A 3LVVA 2LMCA 3QAQA 3ZD8A 3BZDB 1B4FA 2O6VA 1N56A 4I6NB 2O2VA 1MPEA 2FDRA 4YVZA 3Q8QB 3CNHA 5B5EU 1EF5A 1TKGA 1UH6A 2KMMA 2LHDA 4YR0A 3UM9A 3T3OA 1S3SG 2ZJDA 3EHVA 2ZIXB 2Q0ZX 1Q46A 4M0WA 3M3JA 4A3PA 1MJDA 3N97B 3JYUA 4P0PB 3N20C 3ALBA 1N60A 1X42A 4B9SA 2HVHA 1HE8A 2Q5WD 1S0MA 1D8LA 4G3IA 3PRMB 2K4PA 3MDCA 4LK0M 4JK1A 3Q3OC 4DQPA 1ZQFA 3U52E 3U8ZA 3RMKC 2HBJA 2JH7A 2KMCA 2YEPF 5KFLA 5AEKB 2MWSB 2W04A 2LHTA 3DHHC 2N1RA 8ICXA 4JB3A 1JUDA 3HT3A 3TACB 2PJHA 2R61A 3RNBC 3ETLA 3WKCA 4MFAA 4DXAB 5HKHA 3S2AA 1WGHA 3SDLC 3BYYB 2AGOA 5HHDG 2B0CA 1NKCA 4EX7A 1BT0A 4JX1C 3WA0A 2INNE 4MEMA 1IP9A 2W43A 4N59A 2GLEA 1D5ZC 4L23A 4KIKB 2L5YA 2G45B 2JPHA 3L5KA 4YMMA 2D3GA 1P7DA 4G0NB 2XICA 5ALFA 3QX1A 2KHVA 7ICFA 4GDKB 3UF8A 3I5JC 3VUYA 1DOXA 4LLGM 4IDIA 4YMOA 2ASLA 5DGAA 4PT5A 3V6KA 1E9MA 2CXYA 3V05A 3IBEA 1BPZA 2C5LC 2ONQA 5AICA 5BMHA 1X9XA 2HOIA 2QJLA 3DDCB 3RCZA 2YTUA 5CEHA 1Q10A 2KFJA 4ARCA 3TIXA 1K52A 4KMUA 2ZW0A 3ISDA 9ICKA 1WXQA 2N7JA 1D8YA 1I4QA 4ACOA 4UASA 4NM2A 1UD7A 1CUKA 4RQ8A 4FS1A 2WYQA 3H9DA 4QWAA 1RQNA 2H3ZA 2FBWB 3RTVA 5E6JA 4QWEA 2ZCCA 3A9KA 4MSMB 2V4QA 2KQ7A 2O6VB 2KEYA 1ZQQA 2MAXA 2KX0A 2O2VB 2IHMA 2RD0A 2HCFA 3E56A 5CHGA 4P16A 3ZDCA 1YN5A 2A1AA 2KIWA 2KKCA 3SENA 3N4MB 2RR9A 1ET9A 9ICFA 3BK2A 1L4DB 5ALGA 2DQNB 4ECQA 2RDGA 3HX0A 4YD1A 4HRSA 5FP0A 3PNCA 4OJLA 2IJ0A 2B3AA 4XRHA 2NRTA 1CI4A 3A0HU 4CF4A 4I6LB 3VC8A 4GXIA 1ZQPA 1WX8A 2BWES 2LRWA 2JU6X 3H4DA 4XX5A 4Y2XA 3QE9Y 1VJ5A 3VR9B 1IPGA 3K9OB 2ZCBA 2C28A 3BYTB 1JWAD 3H8JA 2PVOD 1S0VA 1L7NA 3GIIA 3ZI4A 4YTMB 3PMLA 1AARA 2PI5A 4EX6A 2HSZA 2JHDA 5KT4A 3RI7C 4O1NA 4GFJA 2DAFA 1WXVA 2E3TA 3MHZA 5KFBA 1E8XA 4XC2A 4PS8A 2ZUCA 5KFTA 2K4HA 4UB3A 5FR3A 1SE2A 1ZQCA 4REZA 9ICQA 5AK6A 5EE1A 5AI6A 1VR9A 4HKZE 3ZRFA 4I2EA 1ZP0B 1WZ3A 1JMSA 5KFRA 4Q8FA 4DQSA 4UB6U 4M9LA 2AQ3B 4LNIA 1OEYA 8ICRA 1ZQLA 4Z6EA 9ICEA 3OJ4B 4RQ1A 3JPQA 2ZEQA 2K6DB 4NAMA 3TSSA 5ALUA 1U9LA 2HMXA 3E9SA 3C0RB 1SBBB 4NV0A 2NBWB 4N6EB 2R8KA 5AKYA 4XA5A 3T79A 3ZUNA 2JMGA 3HK0A 2BTEA 5JHAA 5D46A 2KJ5A 2LXCA 4X5VA 2ATLA 4K4HA 5KFNA 1UBQA 2VA8A 1UF0A 4KV2A 4WWNA 2M1MA 4WJ3B 3MGHA 3B9JA 4CRXA 4RCOA 1UGJA 2BWFA 3I63C 3SEIA 2L00B 4WAFA 2JXJA 2M17A 9ICBA 1V8CA 4QZFA 1SE3A 2TSSA 4P2HA 8ICVA 4MH0E 4PL1A 4HEA1 4HXDA 1X9SA 1NZBA 2AQ2B 2MBEA 5GTHU 2JV3A 5ALMA 4L1BA 2OJRA 4ZYNA 4ED0A 4CCHA 2RDIA 4QW8A 2NTSA 1N5XA 9ICSA 2XN9C 3RT3B 3RJKA 3B1LX 2ZIWA 2XIDA 1E8YA 4DWFA 2HE7A 3QXGA 2XEWA 5LXHA 1Z00B 2WXJA 2EKIA 3HW8A 2OXOA 1Z3EB 5KAFU 2HTME 3JPRA 3ZJUA 2ZJ8A 2AQ1B 2LGIA 5AM5A 2IMWP 4KLHA 2M8SA 2EZXA 3VUWA 4DXFA 1S5LU 3PLUA 2CJOA 5L1MA 4ED7A 3TADA 1VRAB 5DDMA 4KGSA 1F0MA 2RQ5A 7ICGA 3KYCD 3NZ3A 5E6PA 3ZXVA 1WRIA 4ECTA 2MRPA 3EGRA 2L0FA 5H92C 4CDGA 1KM7A 4MF2A 2NS5A 1MVKA 4KKIA 3Q8PB 2HDOA 4M9NA 2WB1C 1NK4A 3RB6A 2K8CA 1X6JA 1WWTA 2MHJA 3CF6E 3N1XC 2RPVA 1BXTA 4RF1A 1KTKA 3WK7A 3RB4A 1JWSD 3IHPC 4IWPA 1ZD2P 2GH1A 3H8SA 3WK4A 1NK9A 2KTQA 3URYA 2DYOA 8ICLA 3CW2C 1UUPA 5C23A 4FZMA 3DBHB 1ZQUA 2EELA 3GP7A 1U48A 2EAPA 9ICNA 1ZXHA 3PS6A 1FRDA 4ECYA 3V72A 1HTQA 1I35A 2PKEA 2I6XA 2WF7A 1Z5SB 1ZQMA 4QIWC 4IRDA 5AI0A 2XY5A 2ASQA 2Y0SC 3BDPA 2FLLA 1WJUA 2A19A 4RQ2A 1E7VA 2FAZA 2ZTEA 5DBCA 2KJ6A 4UBBA 5KHQA 5KT2A 2JR5A 3LDAA 3PR5B 4HPPA 3VRBB 3HIZA 1WJ4A 2L32A 3N1ZC 4UDUC 2VANA 4ANVA 2VRRB 4KLOA 1ZQSA 4IOIE 1ECWA 3FM9A 5AI8A 3U30A 5J2IA 5ALRA 4FZLA 2K8BA 2OOBB 3QIJA 4MM3A 4WJQA 2F8LA 2RRDA 2KWCA 4XDCA 3V7JA 1MG8A 3CMMB 4GIVA 4MGYE 1XO3A 4GLSC 1DOQA 4J3OD 1WE6A 3MR2A 5FK9C 2DL0A 1WWVA 3CWIA 3GDXA 3KLSX 2VA2A 5TISU 4MGZE 2QARB 5AM1A 3PVXA 3RJGA 3U7DA 3MBYA 2J0MA 1F5SA 1TVAA 5EE9A 3AB5A 3SD5A 4XQ8A 2BGWA 2NYVA 4Y2RA 3L16A 5J0YA 4DQOC 2PMZC 1ET6A 3QWZB 1P3QU 9ICUA 2A1JA 2NBUA 3IV6A 2PIAA 1ZQKA 8ICKA 2PPHA 2G0AA 4AJWA 4GXBA 1MQ2A 2LD9A 1FD6A 1HEZE 1WGYA 5T8IA 1DK3A 3MJ5A 4ECUA 1SB3C 4PGYA 1CQVA 1OXJA 3DQVA 4ZH4A 3KUCB 4YSZB 2GBRA 1JW9D 5KFZA 4C4SA 1YQBA 1UA0A 3OGUA 3GV7B 3X23A 4A90A 4K7WA 2FPMA 4J6IA 4YP3A 3K75D 3AQFA 2AL6A 3M6KA 2KANA 2IA6A 4C00A 3QA8A 4AYBC 2K25A 2KN7A 2JXXA 2J6UA 1LKYA 2DZJA 3NVVA 3DDHA 4R64A 5T14A 7ICMA 4M04A 4W9FA 3P2BA 1ZRNA 1BNPA 2Y5PA 1J2NA 4LNFA 3ZNZB 2G08A 3QCAA 5E6OA 3N28A 4BZAA 4XZ4A 4KLIA 2C7HA 1L3UA 5IIMA 1C7YA 2JEIA 3AI5A 3RJEA 4JL9A 2B76B 4XDDA 4FO6A 4F5NA 2I1KA 4RZRA 3ZW3A 1V97A 4OJ6A 5CRXA 2WX1A 4MFFA 2WXMA 7ICUA 3BS7A 3NS1A 4O5CA 4FBTA 2EANA 4PGQA 2WAQC 7ICRA 2V4LA 2WTFA 4MDKE 3QU4A 4P4MA 4GN1A 1JIHA 1I4GA 1SJHD 1UGMA 2X38A 1UBIA 2N1VA 3PMNA 2NBVB 3AE1B 2K8BB 3PHWB 4MM3B 2BYVE 1E10A 4MJSB 1JALA 2YMQA 3PLVA 2ZXHA 2L76A 4FADA 2ODGA 2GOWA 2HDEA 2MJ3A 5G5GA 4NM1A 3TL5A 1UELA 4ECXA 2JEJA 3ZD9A 4EEYA 1OQRA 2LGSA 2EKEC 1GUAB 4LCDE 1PGXA 1L4ZB 2IO3B 3F53A 4CF3A 1F2RC 4MEYA 2PFQA 4JV0A 2C60A 5BPCA 3I1YA 1MQ3A 1T0YA 2MBQA 2AQ0A 2A1JB 3AULA 2WXOA 2VKQA 5BOLA 4IUMB 4P1BC 2JYEA 5J0XA 3GB1A 2EQYA 3Q8AA 2KJRA 3PW2A 4O3OA 1JRUA 2DNFA 1L7MA 3R7RA 1JMLA 5L1IA 2FCMA 1PFDA 4IM0A 4RQNA 4TUQA 3IVFA 2GBNA 3ZKJC 4IQVA 3M9NB 2V3SA 3PX0A 1WIAA 5HHIA 1N48A 1V2YA 4EBEA 1BUIC 2D3CA 3KWVA 5J2EA 2AGPA 4RM8A 4DOBA 4QZ9A 3A9JA 1WGRA 2Y1IA 4KLDA 4I2CA 3S6JA 3TCAA 2JZ3B 2OWOA 3JPPA 1Z1VA 4DF4A 2IO0B 4K3CA 2PEAA 3QC8B 1KW4A 1QQRA 1TS4A 4JQWC 3V62A 2YVCA 3SFDB 4XWTA 3HKZF 4I2IA 3RR7A 4ZOHC 3DPDA 3W5VB 3UQ2A 4K7UA 1C77A 2E8PA 4R65A 2JWZA 4RM9A 2KSOB 4J9LA 4OZCA 3QUTA 2K4EA 7ICSA 3SV3A 4BBNC 2FCQA 2ALZA 3V61A 2YMMA 3M8RA 4ZHOA 1MN8A 9ICOA 1WJNA 5DPRA 2AGQA 3EC8A 1IIPA 1QSYA 2V1YA 1DK2A 1TE2A 3WKAA 1YQ3B 5FR6A 2M0NA 4ELVA 1L7OA 1K8RB 3DBRI 1S8OA 4RNAA 4F5QA 2D11A 4J9MA 3KHHA 4EYIB 4F5OA 3IHQB 3JPOA 2W9BB 1HTOA 4ZYSA 3W5UB 2MSNA 7ICNA 5KFWA 1EWYC 4YSYB 4B6JA 2KVSA 2LJ5A 2DLBA 3KBBA 2MUTA 4QZCA 1FCLA 3UGBB 4W9HA 4F1SA 5HMLA 3TFSA 1V5TA 1ROEA 3QU7A 2JH1A 1XD3B 3GV8B 3I76A 4Z6FA 4M47A 2JEFA 3T8MA 2LYBA 1V9JA 3T5HA 1HA5A 4RGNA 4FN2A 4FE3A 2AJQA 3RB3A 1H8CA 1LQBA 3IRUA 5IIKA 4NQKE 4DEZA 3OWEB 4W9LA 1X6IA 1SXTA 4EEKA 2L1AA 5J29A 3MC9A 2N7DA 1C79A 1Y8RC 3DBLI 1ZDXA 5AUKA 1YN3A 2WXHA 1FNWA 4I2AA 4TQ1A 4NLGA 3A4SC 1B1ZA 1NKEA 2Y1JA 4GDLA 4RQ0A 1L5PA 3Q8FA 2C22A 4HDOA 3HVDA 2J53A 2NR2A 4KZCA 5J8YA 2KLGA 3PW5A 5JRTA 3DVNV 4ZRPA 1PUTA 2K89A 3MABA 4F71A 3SFEB 2FPLA 1ZRMA 1VD2A 3ML9A 4K3BA 2PXIA 1ZD5A 1SXEA 2LFIA 3WANA 1Z1BA 1STEA 4NLKA 3AE7B 5DB6A 4BKSA 4O3NA 2XVTA 4QWDA 2HBMA 2PTLA 2KX3A 4XGAB 1A77A 4F93B 1I42A 3QNMA 3KUZA 4AOFA 4BXOA 4C4VB 1AN8A 3TBLD 4G11A 4NXZA 4F8CB 2BF8B 5KFQA 5J0TA 5J2CA 1C9FA 3G6VA 4DSLA 1YNTE 3R3MA 1QOGA 1BPDA 2JZBA 4RPYA 5KFCA 9ICJA 2KN5A 1SXDA 5D4BA 2ZG6A 2DFLA 3B2GA 3C8YA 1HUZA 2IY1B 3DWGC 4LDTB 2NRXA 2C2DA 4J9NA 2Z8LA 4EZ6A 3SAFA 3RAXA 4C0ZA 1JWBD 5AI5A 4DFDA 1SEBD 2DZMA 5G5HA 3IXSA 3EYZA 3GZFA 2KNJA 5CHVC 1Z4OA 4Y2UA 4BJQA 1BMLC 1Q5WB 2LYAA 5KFAA 4P0QB 2PVGC 4W9DA 3KH0A 2BZFA 3RD2A 3RNEC 5J2HA 2FCSA 4ECVA 2XBBC 2ZVNA 1D8BA 4AJYB 1WYGA 3HHMA 2OJWA 3WAPA 5JTIA 3DVGY 1KLNA 2DKZA 4W9JA 4IW0A 2CPRA 2Y9TA 2BCVA 4GGQA 3BQ7A 1HIWA 3R9KA 3E0FA 3QK0A 1EWCA 2KKPA 3C1ZA 1N6ZA 4KX5A 3OJ3A 1LGRA 4DDGD 1TKYA 4UB8U 5EE3A 3WK9A 2D5GA 2V4IB 3H6NA 3ZIMA 5HMMA 3DBSA 2O6VD 1VLBA 4DSEA 4YXMA 4GDLB 3U2SC 4C4RA 1I4RA 4IRKA 1WRDB 4KN7A 5KAIU 4OHJA 5E79U 3BS5A 9ICLA 1SKWA 2KHWB 3WALA 2F1IA 2IBIB 4FJYA 3VR8B 3TADC 3CRXA 3AL0B 2ZJ5A 1B43A 4DFMA 2QB0A 4OCZA 1F77A 3BVZA 3H7PA 2LJIA 2YX8A 5DPWA 3AECB 3I57A 1SZPA 2DGZA 2MEKA 1WWUA 2I2YA 3W2DA 1XSNA 5AKJA 3ISCA 1F2RI 4WAAA 1J7CA 3AE6B 2AQ4A 3IAS1 2AHOB 5DB7A 2FCNA 3A33B 1IG6A 4BKTA 1JWMD 1L5UA 2GOLA 8ICBA 1EU3A 3V6JA 1NI3A 1ZKHA 2JZBB 3NZUA 1KEJA 4TQ0A 1NK7A 3DEEA 1PVRA 3KW5B 1A6SA 5IOIA 1P0RA 2DPJA 2K4IA 1WG8A 2PE6B 3O65B 5LLIA 5DBBA 5IILA 3AEDB 3UXPA 1RDFA 2HHWA 2R8HA 3KFUF 1YJJA 3TANA 2WXNA 2W55A 1G6JA 1J7AA 2E8MA 4M9JA 2AH5A 4Y2TA 4DF8A 2HOFA 2LXAA 4W9KA 2XGPA 4ITKA 3IG5A 1EU4A 1XU4A 1YT3A 1K53A 3FYHA 1SIJA 3NJTA 1F52A 3MR6A 4M00A 4I27A 2IOFA 2YY6A 4MF8A 4CO7A 4UQGA 4ED8A 1M6YA 3GIMA 1SL0A 3TUOA 1K5OA 4PHPA 4P1CC 5IIJA 1WI0A 3EPIA 2LVPA 1DRGA 4F7ZA 3BVGA 9ICXA 1R4NI 3KHLA 1XCTL 4LZDA 2FUHB 1ZW7A 2EMSA 4BKGA 1Q3UA 3K1RB 1TK5A 5AZGA 3GZNB 2R2OA 2LGXA 3V60A 8ICOA 4IM3A 4WQMA 2BW2A 1FNUA 1C78A 3C23A 1N61A 1O08A 2NRVA 3SEBA 4W9CA 4RT3A 4I2FA 2V4RA 2D07B 5KFOA 5ALJA 2GO7A 4II2B 2IGDA 4L2YA 5J18A 3M9MB 2DX5B 3IG3A 3TI0A 4NY0A 3C5GA 4A8XC 4DHZB 1PQSA 1L2NA 3DOWA 5GTIU 5KT3A 3UQAA 4QZEA 3Q8KA 1Z19A 3F2CA 3THVA 4KLLA 2KDMA 2V3NA 2VJ5A 3T9LA 4E3CA 2H3VA 2IY0B 3LWLA 2IOFK 5AM0A 1GB4A 1GPXA 5KT7A 4PH5A 2WF5A 1J8CA 3DWMA 4Q2JA 4PZNA 1E7PB 3C2LA 1IGCA 4B0EA 2VJ4A 4AP9A 2BB6A 2D3AA 2B21A 5D3IB 5BO4B 5BYSA 4W9GA 2N0SB 5CHWA 3ONSA 1DGJA 2RLTA 4RQ6A 1WX7A 3MJWA 4UB1A 3IT4B 2WF8A 1L7PA 2BQUA 1S77D 1TZ1A 4PHAA 4JMUA 1L8OA 2IYDB 4O3QA 4M0WB 3FC4A 5DG7A 5KFGA 4I28A 1L0XB 5AKZA 5ALOA 5AKXA 2SEBD 2W11A 2V0GA 3OAWA 1ZYQA 1P7EA 3NY5A 1HEKA 4BAXA 5JXVA 5DDYA 5KT5A 1PGAA 4HJKA 3HP6A 5G55A 4GC7A 1P1AA 2MQJA 3K9PB 4F50A 4O9MA 2OYYA 1DXSA 3PO4A 3Q3NC 2G1EA 2WXGA 3WCQA 2DWQA 1SF0A 2MSED 1IXRA 5DG8A 5CA7A 2HOQA 3DHIC 1PVPA 2NTTA 2OEDA 3G6YA 3C2MA 2DENB 3APFA 5KG4A 3BVMA 4ANWA 2IPKD 1NOMA 2JUOA 2MBBB 2ZTCA 3ED5A 2FMSA 2LM4A 3PSTA 2KDIA 5KL1B 4M6WA 3IAM1 3SD7A 5KG0A 1TT5B 1IV8A 4ZRKA 3F5EA 2AWTA 3UIOB 1AW7A 1QOFA 2CS4A 4OJPA 1K1SA 3OPXA 3VTVA 2AX5A 4DBGA 5IKCM 4BFRA 4ECWA 1TFRA 1AROP 8ICJA 1QILA 2JZZA 1SV0C 4C56C 1L6NA 1UZXB 3A1QA 1ZQVA 3M9OB 4HCPB 2R8JA 4OVVA 1BPXA 2P6RA 9ICAA 1ESFA 3AMZA 1YIWA 4S17A 2N9KA 2K60A 1CRXA 4JUZA 1WCNA 2CHWA 2QMTA 3UIPB 1VZ7A 4M8NA 4WQOB 3OHAA 1V38A 3PO5A 3VAWA 1KRHA 1XO1A 5AKIA 4EBDA 4ECZA 1TAMA 3A9KB 5LXIB 5L1JA 4WWMA 1MI0A 2EDUA 1KFDA 2E1FA 2OH2A 2K8AA 4RQ4A 5KFSA 1UHUA 3AXCA 2K3UA 3N1YC 1UQVA 2E5SA 4NJ6A 2MRLA 2HI0A 2LUEA 4JWSC 1R7SA 3TEYA 1RYRA 4UW9A 9ICPA 3TJPA 4K1RB 1B0XA 2H3IA 2Y9UA 9ICIA 2BDUA 3WAOA 3M7DA 3JW0X 4NLCA 1I4HA 3B2FA 1HXYD 9ICHA 1QLBB 3R2IA 1KH0A 2KTFA 4ICVA 1A70A 1XEEA 4DL5A 4KLTA 4KX6B 4QJFB 8ICUA 4RQMA 2C2RA 5J0PA 3Q8CA 5KHOA 4TUUA 4DFKA 4F92B 2Q4TA 5F9LA 1QZEA 5J2FA 1TBEA 1KFSA 4FJZA 1TKEA 3NTUA 4GXKA 4M9HA 3AEEB 3ML8A 2MP2A 2ZXIA 3C19A 2JZPA 4R3DA 2F3NA 4IWOA 3H1UA 4BUGA 2A4ZA 1ZUD2 3DVGX 1ZJNA 4DQIA 4KX3A 5ALSA 1XXGA 2YB4A 3HILA 8ICTA 4IQWA 4OW0A 4MSQB 4M6WB 1XQQA 3MHSD 4WJOA 3TEWA 2B6GA 4A3OA 3SQIA 3PGEA 2FIDA 5L83A 1T0QC 5KFHA 4ACFA 2DF4B 1OTRB 3VRAB 4EZJA 4CE6A 1A5RA 1WR1A 2YN4A 4KLUA 2KP7A 4ASWC 2SAKA 1WZ0A 4GOCA 3W1SA 3A1QB 3I9V1 5ALHA 1NK8A 2INCC 1YD8U 3N32A 2YMPA 3KOOA 4A8EA 5IIIA 1HUOA 3TEXA 5I4DA 3P4PB 2H3QA 7ICVA 3B0XA 5HHHA 2LWPA 2KKVA 3BZCA 5J8YC 5KFPA 3N9YC 4CYEA 2GLSA 4FZNA 1X9MA 2K9XA 3D2SA 2WP9B 1NK6A 1KQQA 5DB8A 2J0JA 5D49A 3VH4B 1NJXA 4DDID 4Y2SA 1WCLA 2XC9A 5D3DA 1IYFA 2EZYA 2C7MB 2DPIA 1PDXA 2WS3B 1QF6A 1UNSA 4AUQC 4EFOA 2FMQA 2KFNA 2W03A 3PRZA 3RBEA 2KE7A 5ALZA 2JX5A 1N2XA 2XCPA 4QW9A 3L4PA 3ZQ4A 3QYPA 3A0BU 4XYCA 4M0AA 4OVUA 2XNAC 4LJPB 5EE0A 1Q0WB 1BNOA 8ICCA 1XSPA 4F72A 2NRWA 2CHXA 4NPNA 2VZKD 2HJ1A 3TKAA 1C4AA 2ZIWB 2KN4A 2BQRA 3KHGA 2QDFA 4B9KA 2AEHA 1FXAA 8ICIA 4Y2QA 1YJ1A 1UT5A 9ICVA 1TS3A 2KO3A 3ABVB 1TZOA 5J2BA 4FBUA 7ICKA 2I38A 1DGSA 4F5PA 3BINA 2CR5A 2MP2B 3NRZA 5AKHA 4GMVA 4KSLC 2Z0EB 2BDPA 5C0YA 1P7FA 2KDEB 4DHJD 1J97A 3PV8A 3RJFA 2LBOA 3OSPA 1VZ8A 4CQNA 4HAIA 5IINA 2XK5A 3W9CB 1RYSA 8ICGA 1IGDA 1RM6C 4QZBA 4OZAA 1LV5A 2M56B 5J17A 2PFPA 4JPSA 8ICAA 2K8CB 3H0MB 4F2RA 2UVWA 1NJYA 2OM6A 5HG2A 1SV4A 2MCNB 3VTWA 1SL1A 2WWZA 3RNFC 1MA7A 4ED3A 1M4VA 4WH4A 3RH5A 1WH3A 1DOYA 5DQGA 4OJOA 5AI4A 5L9XA 2V9WA 4AS1A 1WGKA 4JWUC 1COOA 3ZDAA 3KUDB 1ZQ1C 2NRZA 3SAHA 4CGZA 3C5FA 2NV3A 4HPMB 2ON8A 1V49A 3AE5B 3LYSA 2LUMA 5E6NA 1WJ6A 4A55A 4XUSA 2D3BA 4B0MA 4OD0A 3QARA 3WKEA 2RDJA 1J0GA 4J9KA 1E5WA 5FKAC 2KHQA 2AYOB 4YSXB 2G4SA 3B08A 3RJHA 3UQ0A 4AQ7A 3I3TB 1NDDA 2WF6A 2BVCA 1ZQZA 5ALEA 2BCQA 3FILA 3V6CB 3Q8EA 1KOTA 3MGVA 1PVQA 2ZUBA 1RYJA 2AU0A 3P4RB 3NASA 3RPFC 2JRZA 3AE8B 1LM8B 2WXQA 1PUZA 4DL2A 2ZIVA 1TTNA 3PZDA 1T0SC 1Z4NA 5AUIA 4LNKA 2LKYA 3PZ8A 1XS9D 3Q8LA 3ALRA 4M8MA 4DQQA 2BKRB 3RH6A 1L3VA 2AXTU 4J9PA 2BPGA 1WF9A 2EMTA 2ICIA 1KJTA 1EF1A 1RG6A 2ZJAA 4UARA 1WMHA 1R4MI 2CU1A 4HDQA 1CMXB 3RNCC 4ICAA 4ZRJA 2ZTDA 5KG5A 4HLEA 4I2DA 1E90A 7ICJA 1L6UA 5C1ZA 3PSEB 3Q8RB 1UWMA 2QKQA 3DV9A 2YLMA 3KQ4A 2XK5B 1PK1A 4RGTA 1QOBA 2ES6A 1FO4A 1SV0A 2V3PA 4M2YA 2GB1A 4BVUC 2JSVX 4LDTD 2XCAA 3RJJA 1IBXA 1ZOLA 1HZ5A 2BS2B 3O0FA 3PVLA 1S76D 2KWUB 4TKNA 5DBAA 4YR2A 2KZ3A 5AKEA 4E74A 2DKXA 4RNOA 2CRXA 2RDBC 1LKYB 2LI5A 8ICPA 3GE8C 3UINB 5ALQA 2H5XA 2VZKB 2C7NB 2NO5A 3PZ7A 3VUXA 3W1YA 3R7QA 2BHNA 1H4RA 4FULA 1BVSA 4OZBA 1T7PA 5KG1A 3GOEA 1KSPA 4KLGA 5EWFA 2ACZB 1D4BA 3UQBA 2E8NA 1P9DU 1TK0A 3TMPB 1PK3A 4R8UA 1IM4A 4QZAA 4WURA 2KVRA 2R18A 1KTQA 2BKEA 2ZW1A 3VHTC 2MH7A 2R2QA 2M19A 3V7KA 2VA3A 3Q3JA 3CIRB 4DHJB 2RSUA 2ASDA 5CJ7A 7ICEA 4YTPB 2LEKA 2GMIC 3ZRCA 3RRHA 3RR8A 1TY0A 5JUMA 8ICSA 1FM0D 2F2AB 3AEBB 2IDYA 2N7EA 2L05A 2C9WB 4YL8A 2MBHA 1NVID 4Y2YA 3ONNA 1S97A 2G9HD 2W54A 4RQ7A 2D3DA 4JWNA 1V81A 1URJA 3JSVA 3M8SA 1LB2B 4LNNA 2P66A 4DL3A 3PO0A 4BKSD 4YD2A 2P6UA 5L1LA 2J6SA 2BCRA 4UBCA 3Q3FA 1FPYA 4LZGA 3PX6A 4LTUA 1NYQA 4ELTA 4GU2A 2WHEA 4HKQA 1KRPA 2YQEA 1KN5A 2BPSA 3HRDD 2KK0A 4UB5A 3L17A 2IBKA 4JGHB 1KFYB 2OCEA 2WXRA 3X0WA 3UPQA 1EO6A 1PK1B 2L8JA 2WB1F 2ZIUA 2EAOA 1J7BA 3NRWA 3A9JB 4P7IA 1IBXB 4ED1A 4QZIA 3UMGA 2N9EB 5KG6A 3RFAA 4YG2A 5DGBA 1NK5A 7ICIA 1C4PA 4DS5A 2NVUI 1I7HA 1T8EA 1ZE3D 4DWIA 2KXJA 1FRRA 4YT0B 1L0VB 4PZOA 1ZQWA 2HHVA 2AL3A 2KOXA 3SZ2A 3ZNHB 9ICCA 3F2DA 4N58A 5IO9A 4JE3B 2IZVB 2KD1A 2W9AA 4QIWF 2ESEA 1ZGUB 3M95A 4OO1J 3TAQA 4I6PA 3KHRA 3RNAC 2Y0SF 4PPXA 3QUQA 1X1MA 2F44A 2WFAA 2YMLA 1ZD4A 1C4CA 1D3ZA 2L3ZA 3PW7A 2JVCA 3AU6A 3R66C 5ALLA 4C8OA 1A76A 4IR9A 2BBCA 3D2NA 5KFJA 4F4XA 3T5KA 2FI1A 1I4XA 1FEZA 1KFTA 3EFCA 1T94A 4DSJA 4ANXA 4FFDA 2M0XA 5HP4A 5K4LA 2IGHA 3QQ8B 4UB4A 2LZ6A 5KFIA 4QZDA 3ENEA 1N62A 2D8CA 3Q2AC 3ZYYX 4C8NA 1YMHE 1E0ZA 3R2TA 4GLXA 4JV1A 1HQRD 1F1HA 2KIVA 3OJSA 2DYMA 2W9CA 5IAAC 5IN7A 1GO3F 2FJ6A 2KDFB 1SGGA 2MUTB 2KDBA 2JRHA 2QC8A 5AKKA 1DYQA 3ETRA 3JSVB 4EZKA 3M63B 1RQLA 4BOSC 4S0RA 3ZNGC 2ZPYA 2F1JA 1EXNA 2PMZF 7ICPA 4BWJA 1U45A 1ZETA 2KFKA 4OJ5A 3DBRB 3MFHA 2ZZPB 1QKZA 2E8OA 2QB1A 2LHEA 1ZQYA 5AHXA 2WF9A 3M1YA 3AEGB 3F2BA 3MR5A 2D6FC 2ZUDA 2D10A 2KZMA 1V80A 3ZTDA 3OHBA 4KSKC 2W9NA 4EZ9A 2BGFA 3AEAB 1GC7A 2G06A 2ZIXA 3D6JA 4KZ0A 3EUB2 1ZQBA 4QZ8A 4PYUA 4ZRQA 2JT4B 5KG7A 1L3SA 1BPEA 2ZIUB 4G50A 4B9VA 2W7PA 3AN1A 4NJ7A 4RH6A 2KNBA 5KFVA 3FAHA 2OEHA 3WIMA 1U4AA 4AYBF 3OSNA 2F77X 3KTQA 4C8MA 4ECRA 4F91B 3RH4A 4JV2A 3MC8A 2KD0A 3PSFA 3C21A 4QZHA 3ZJVA 1NJZA 3BQ1A 4NAWA 1KKXA 4TUSA 1SSNA 2N9LA 1ZPSA 5DCNA 3RRGA 3ORYA 3DBLB 1B9RA 2BYEA 2P35A 2JGAA 4IC7B 3RB0A 4Z6DA 3KZIU 1ZQRA 1D9DA 3AQEA 4BXOB 5HI1A 3RZFA 4FXCA 3HM3A 4Y2JA 1GOZA 2WAQF 3IP4B 1BPYA 1YX6B 2KC2A 2V9HA 3N3KB 5D2MB 4EUTA 3QZ8A 2MU2A 4XE0A 2BPCA 1XO0A 3BIID 1PGBA 2CJNA 2J42A 3W1SC 4GDKA 2N9PC 3U7ZA 5KFKA 5HR6A 2MW5A 1KBUA 4IL6U 3PW0A 3KYDD 2W9CB 4NWIA 1WYWB 7ICTA 1OEYJ 3LWMA 4F5RA 2KQ4X 4U6PA 7ICHA 4DFJA 2H89B 1H38A 1KF6B 1XC9A 4RGMA 1ZQJA 1OGWA 2KMDA 2WHIA 3GFKB 4O3PA 3P42A 2K5PA 8ICFA 2I5HA 2DUYA 4CHKA 3H8MA 4LJXA 4IWQA 1JX4A 3QEBZ 1LXDA 4G9BA 1QOAA 2KFZA 3ZVVA 5JZEB 3PY8A 5AIBA 2LVQA 4TUPA 4G3XB 2UVVA 4DLEA 5J2GA 4KDIC 3MC0B 2G09A 2HBLA 2XY7A 1UPHA 1T6BX 1HJPA 1WFYA 1WM2A 2BYFA 1MHXA 3RJIA 3EFUA 4IKGA 5AKGA 1ZQHA 4J03A 2WXKA 3PX4A 3BWUD 1J2MA 1V1OA 2ZNVC 4RPZA 3BS5B 4DK5A 5IP4D 4DQRA 2C2EA 3IN5A 4I2HA 3E2EA 1TY2A 2ZVOA 4C80A 3P4SB 9ICMA 1K51A 4NAWB 2QB0B 3H7PB 2KWVB 2E1EA 3EZ5A 4NY8A 3K1ZA 1CEZA 3Q6BA 4BBNF 2W9MA 2VH2A 1FXIA 3N7SC 2MJEA 3GU3A 2ASJA 1WR6E 3HJEA 3ISBA 2LYHA 2W8KA 4HYKA 1Q3VA 1GG3A 4BX9C 2NPTA 4WWPA 3ZLZA 4BDPA 3Q8BA 3HUIA 1UA1A 3PV1A 3HVZA 2KICA 4RFBA 2KC1A 5L1KA 1OUQA 3WU2U 2RGFA 4HJGE 1ZJMA 1SWWA 2QSDA 2FMPA 9ICTA 3QU9A 5CP2A 2QIEB 3PRPB 2K6QA 3MGIA 4U7CA 3BJYA 3ECIA 4URKA 1WXMA 4ZDVA 2G07A 1AWDA 4QWCA 2W3RA 3BQTA 2WXIA 5F9NA 5BOMA 1XSLA 4IM2A 4FA6A 1LO5D 3P1MA 2G5IB 2L52A 3JPSA 2K1FA 1Y88A 1YJIA 2JEGA 3H40A 2KLCA 4Q8EA 4ICUA 5EDSA 2JRIB 4J9OA 2ZPNA 1XF5L 5J2RA 4DHZE 2GBKA 5TSSA 1ZOYB 4DOAA 1QSSA 3SV4A 3UMBA 2MA1A 1S9FA 2LMRA 4C8LA 1VJKA 2EH9A 2INPE 2KG5A 2IO2B 1QLNA 2EZZA 3NUHB 3L3FX 3QJZA 2LASA 1L0YB 2KACA 2KJHB 2WLBA 4ED2A 4KITB 2I9GA 4B9LA 1EM7A 2XI9A 2INDC 3MR3A 1NKBA 2KV2A 1X9WA 3AEFB 4ELUA 3LYYA 4RGOS 4EKUA 4YN4A 4YTNB 4QZGA 4DS4A 3PHXB 2K22A 3UXOA 5KFDA 2GBJA 4PHEA 3Q8SB 3RYTA 5C3JB 2HD5B 4K4IA 2K8HA 4K7SA 1S0NA 3EW9A 2YEPB 4B95A 4HROA 3GQCA 5KFMA 1LFDA 4DSIA 1MG4A 1ZQOA 4C4TA 4KGRA 4WWOA 3P4QB 3NVYA 2PFOA 4JLCA 3N7RC 4RNMA 1ZQDA 1Z00A 3LK9A 2HHSA 4JIOU 4IQUA 5D6JB 4I29A 2WXPA 4AP4C 4MACA 4YMNA 3ZTCA 1XWLA 1R4NB 1QCKA 4A6QA 4DXGA 1PZNA 3ZNID 4DL7A 3RULA 3LB8C 4TQRA 1AYFA 2E6XA 3H0RB 4ED6A 2FE9A 3IFWB 1NEKB 2NPTB 4F2SA 3QX7A 2FIFA 3DBHI 2RDHA 1ED1A 2BB5A 1NK0A 2IO1B 4O5EA 3AE2B 1WXAA 2PW9A 1ZQTA 3L0WB 3L13A 4WJPA 1ZQAA 4DOCA 2Z59B 2KMAA 4EOYA 2DYBA 3L08A 2KAJA 4ANUA 1XLOA 1TYGB 3CSTA 4EENA 3V6EB 3NS8A 4O3SA 3ZDEA 2IGGA 2KWDA 4Z6CA 3WK8A 4QAYA 2KT7A 3MP9A 4CNQA 2LPEA 1TAQA 2IOHA 1ENFA 1VDVA 1KL9A 5DQIA 1V5OA 4II3B 4LJOB 3BQ2A 4M01A 1OQQA 3HKZC 2CU3A 3UMCA 2RPQA 1RXVA 2PKOA 4NZLB 1RZTA
chains in the Genus database with same CATH topology
2Q5WD 2ON8A 1B1ZA 3AE5B 2LUMA 3AE4B 4LK0M 4A55A 4B0MA 2BS3B 1L5PA 3Q8FA 2QILA 3HVDA 5FKAC 3U52E 2J53A 4YSXB 3P63A 1I4PA 2YEPF 3RFZB 4XDDA 4AQ7A 4ZRPA 1PUTA 1WSPA 3LXFA 3SFEB 3FILA 2R61A 2LFIA 3AM9A 3Q8EA 1STEA 1RYJA 3AE7B 3BYYB 3P4RB 5HHDG 2PTLA 3RPFC 4JX1C 2INNE 3AE8B 2WXQA 4N59A 3AE9B 1D5ZC 1AN8A 4L23A 5AUIA 3PZ8A 3NVZA 1C9FA 1YNTE 1QOGA 4GDKB 2ICIA 2K0PA 1DOXA 1VZ6A 4LLGM 4IDIA 3B2GA 3C8YA 4PT5A 5MPOA 1E9MA 3V05A 3DWGC 2Z8LA 2ONQA 1D5XC 1L6UA 1CK1A 1ZXIA 3GS2A 5BMHA 2QJLA 1JWBD 3IXSA 1Q10A 1SEBD 5G5HA 3KQ4A 1UWMA 4ARCA 5BYQA 1K52A 2ZW0A 4RGTA 1BMLC 1QOBA 1FO4A 1WXQA 2N7JA 1I4QA 4D2KA 2PVGC 2V3PA 2GB1A 2DBYA 2JSVX 3U4EG 2JWUA 1IBXA 1HZ5A 1WYGA 2BS2B 2FBWB 5E6JA 3E56A 5BMIA 4P16A 1YN5A 2VZKB 1EWCA 3PZ7A 2WDRB 1ET9A 3BK2A 1L4DB 3BK1A 3KWLA 4OZBA 4USAA 1TKYA 2RDGA 2V4IB 2D5GA 5EE3A 4HRSA 4TMAB 2ACZB 2IJ0A 1D4BA 1VLBA 3SR6A 4GDLB 3U2SC 2WXLA 1I4RA 4WURA 2JU6X 4OHJA 3VR9B 3ZYYX 2ZW1A 2MH7A 3BYTB 4P6VF 1JWAD 2M19A 2PVOD 3CIRB 1F0ZA 4US8A 3VR8B 1JROA 4YTMB 4YTPB 3BVZA 1F77A 2JXTA 2LEKA 1SJED 2LJIA 1GAQB 1TY0A 4O1NA 3AECB 3I57A 2E3TA 2MEKA 3MHZA 2I2YA 3W2DA 1FM0D 1F2RI 3AEBB 3VQIA 2IDYA 1J7CA 3AE6B 1D5MC 3IAS1 1V1PA 4YXDB 5FR3A 1SE2A 4REZA 5EE1A 1NVID 1VR9A 2G9HD 4HKZE 1JWMD 2PLPA 4ARIA 2W54A 2WU2B 4YWGG 1JQ4A 4WIPA 1EU3A 1NI3A 1ZP0B 3PO0A 4TQ0A 2AQ3B 1D6EC 4LTUA 1NYQA 2BT6A 4HKQA 1UWXA 2Y5CA 3AEDB 3HRDD 4NAMA 3TSSA 3UI3A 1KFYB 3E9SA 1YJJA 2WXRA 1SBBB 2WXNA 2W55A 4N6EB 1J7AA 4ITKA 1EU4A 1J7BA 2BTEA 1IBXB 1K53A 1SIJA 3ZGZA 1C4PA 1KLGD 1I7HA 1ZE3D 4YT0B 1FRRA 1L0VB 1FNVA 5BYRA 3B9JA 4RCOA 1UGJA 3TUOA 4WAFA 4N58A 1CJEA 4JE3B 1TJEA 1V8CA 3BVGA 1SE3A 2TSSA 1XCTL 4HEA1 2AQ2B 1Y56A 1C4CA 4L1BA 2JQRB 3NVWA 2NTSA 2BYTA 1T3QA 1N5XA 2XN9C 2BBCA 1I4XA 4WQMA 2BW2A 1FNUA 1C78A 1N61A 2WXJA 2EKIA 2HTME 3SEBA 2IGHA 3ZJUA 2AQ1B 2LGIA 4DXFA 2IGDA 4L2YA 1FEHA 2CJOA 1N62A 1YMHE 1E0ZA 4A8XC 1VRAB 3R2TA 4KGSA 1HQRD 2DYMA 3NZ3A 1WRIA 1V1PB 3EGRA 2V3NA 1JRPA 2KDMA 5H92C 3V3XA 1MVKA 1DYQA 1K50A 2W82A 3ETRA 4KKIA 1GB4A 2WDQB 1GPXA 4EE2A 3DWMA 4Q2JA 1E7PB 2BS4B 1WWTA 4XWWA 1IGCA 4B0EA 2RPVA 1BXTA 1QKZA 1KTKA 1JWSD 2LHEA 2BB6A 1N63A 4RF1A 3URYA 5D3IB 1NYRA 5BYSA 2DYOA 2N0SB 3AEGB 1UUPA 5LNK1 1DGJA 1RWSA 4RF0A 3IT4B 3AEAB 2EELA 3GP7A 1ZXHA 3AV8A 1FRDA 2GRIA 1FFVA 3EUB2 3FC4A 4ZRQA 2Y3AA 4A9AA 1L0XB 2SEBD 2V0GA 1P7EA 3Q69A 3AN1A 4NJCA 3O13A 4RH6A 5JXVA 3FAHA 1PGAA 4ZHPA 2J4XA 5H8YE 1KLUD 3VRBB 1L6VA 2L32A 4UDUC 2G1EA 2WXGA 3WCQA 2DWQA 3ZJVA 1SF0A 3FILB 4IOIE 1SSNA 2N9LA 1ZPSA 1T5XD 1FCCC 1B9RA 2NTTA 2OEDA 4XDCA 3BVMA 2IPKD 1XO3A 4GLSC 4MH8A 4J3OD 1PYWD 5HI1A 4FXCA 5FK9C 3CWIA 1GOZA 3KLSX 3IAM1 4XE0A 3BIID 1PGBA 2CJNA 2J42A 5EE9A 3AB5A 1CZPA 1AW7A 1QOFA 4DQOC 3U7ZA 1ET6A 2AX5A 1JWUD 1MHHE 2PIAA 5BMGA 1QILA 4C56C 1FD6A 2KQ4X 2WU5B 1HEZE 5T8IA 1ESFA 1N5WA 3AMZA 1SB3C 3MJ5A 2N9KA 2H89B 1XLNA 1CQVA 1KF6B 4TSSA 4YSZB 1JW9D 4H2AA 2QMTA 4OVZA 4RGMA 1FFUA 1VZ7A 4A90A 1E6EB 3MFGA 1KRHA 3P42A 2K5PA 4WWMA 1MI0A 1QOAA 3NVVA 2K3UA 4US9A 4JWSC 1R7SA 3TEYA 2Y5PA 3MC0B 1T6BX 1C76A 1MHXA 3R8BA 4MT5A 4IKGA 2B76B 1I4HA 2WXKA 3B2FA 1HXYD 1QLBB 1NENB 2L83A 3BWUD 1V1OA 3IT6B 1V97A 1KH0A 3R2IA 1TS2A 2WXMA 3NS1A 1A70A 1TY2A 2OHFA 1XEEA 2M0AA 4KX6B 4C80A 1FMAD 3P4SB 3Q8CA 1K51A 4NAWB 1I4GA 1SJHD 2X38A 3AE1B 4MM3B 1TKEA 5D7GA 1FXIA 3AEEB 1E10A 1JALA 1QT9A 2MJEA 5HFYA 4C7YA 4KKJA 2HDEA 2JZPA 5G5GA 2MJ3A 3J9CA 3Q8BA 3HUIA 3AE3B 2RMMA 4R3DA 3HVZA 1ZUD2 1XXGA 4RFBA 4HJGE 2QSDA 1OQRA 4KGTA 1YN4A 4OW0A 3TEWA 2QIEB 1PGXA 1L4ZB 1F2RC 1AWDA 2WXFA 2W3RA 2WXIA 2QEJC 2WXOA 3VRAB 1LO5D 1XCQL 3P1MA 2JYEA 2L52A 2SAKA 3GB1A 3W1SA 3Q8AA 1YJIA 3I9V1 1JMLA 1PFDA 1TS5A 1XF5L 2WNMA 2JYTA 5TSSA 1ZOYB 2FUG1 4TQ1A 3KWVA 1BUIC 3TEXA 5I4DA 3T3NA 3P4PB 1VJKA 2FE8A 1IUEA 2INPE 3NUHB 2WLBA 1L0YB 1SE4A 1XLPA 2KACA 3N9YC 2K9XA 2WP9B 1XLQA 1EM7A 5D3DA 1JCKB 2WS3B 1QF6A 1PDXA 2WDVB 1YQ4B 1FIQA 3AEFB 1UNSA 4RGOS 1QQRA 1TS4A 3LYYA 5GXGB 4YTNB 3SFDB 4XWTA 2K22A 4ZOHC 1ACCA 1HZ6A 3W5VB 5C3JB 1C77A 2JX5A 5C2TB 4OZCA 3L4PA 3ZQ4A 2YEPB 4HROA 2PMVA 2XNAC 2J52A 2GI9A 5EE0A 4ZHOA 4C7ZA 1RFKA 2W3SA 2VZKD 1C4AA 2KN4A 4KGRA 3P4QB 2MJDA 3NVYA 3TEZA 1FXAA 1DOIA 1TS3A 1YQ3B 2WXPA 3ABVB 1TZOA 4MACA 1OFFA 2I38A 2H88B 4A6QA 4DXGA 4RNAA 3LB8C 1AYFA 4ZYSA 3NRZA 3W5UB 2E6XA 1EWYC 4YSYB 2WQYB 1NEKB 1P7FA 2RDHA 2DLBA 3EA6A 2BB5A 1VZ8A 4CQNA 3AE2B 3W9CB 2NMQA 2PW9A 1FCLA 1IGDA 3AH7A 1RM6C 1ZDVA 1ROEA 3H8HA 4OZAA 2M56B 1GB1A 4JPSA 3ZJTA 5HG2A 2KAJA 1XLOA 2LMCA 1TYGB 3BZDB 2IGGA 2KWDA 1M4VA 4WH4A 1HA5A 1MPEA 1TKGA 4RGNA 2LHDA 3MP9A 2KMMA 1DOYA 3T3OA 1ENFA 1VDVA 3OWEB 4M0WA 4AS1A 1WGKA 4JWUC 1SXTA 2L1AA 1OQQA 1C79A 2CU3A 5AUKA 1ZDXA 2PKOA 1YN3A 4NZLB 1N60A 2WXHA 1FNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE1 A;  1NVI D;  1JQ4 A;  1OQR A;  2Q5W D;  3FAH A;  3AE5 B;  2W54 A;  2WU2 B;  3AE4 B;  4ZHP A;  2QIE B;  2BS3 B;  5H8Y E;  1L5P A;  1NI3 A;  1ZP0 B;  3PO0 A;  3VRB B;  4YSX B;  3P63 A;  1L6V A;  1AWD A;  2W3R A;  2G1E A;  4P6V F;  3WCQ A;  4LTU A;  2DWQ A;  1NYQ A;  2BT6 A;  3VRA B;  1PUT A;  2Y5C A;  3LXF A;  3P1M A;  1SF0 A;  3SFE B;  3AED B;  2L52 A;  3HRD D;  3AM9 A;  1QF6 A;  1YJI A;  1KFY B;  1RYJ A;  3AE7 B;  4YSZ B;  1PFD A;  1B9R A;  3P4R B;  1YJJ A;  3RPF C;  2W55 A;  4N6E B;  1J7A A;  4JX1 C;  3AE8 B;  1ZOY B;  4N59 A;  1XO3 A;  3AE9 B;  4ITK A;  3P4P B;  4FXC A;  1VJK A;  1IUE A;  1J7B A;  5AUI A;  3CWI A;  3NVZ A;  1SIJ A;  2WLB A;  1XLP A;  2K9X A;  1I7H A;  2WP9 B;  1QOG A;  3BII D;  4YT0 B;  1FRR A;  2CJN A;  1XLQ A;  3AB5 A;  1CZP A;  5EE9 A;  1L0V B;  1QOF A;  1DOX A;  2WS3 B;  3B2G A;  3B9J A;  1PDX A;  1YQ4 B;  1FIQ A;  2AX5 A;  2WDV B;  3AEF B;  4IDI A;  5GXG B;  1E9M A;  4N58 A;  5MPO A;  1CJE A;  3DWG C;  4YTN B;  3SFD B;  2PIA A;  1TJE A;  1V8C A;  2K22 A;  4ZOH C;  1L6U A;  1ZXI A;  3W5V B;  5C3J B;  2QJL A;  1JWB D;  2JX5 A;  5C2T B;  5G5H A;  3L4P A;  1UWM A;  2WU5 B;  1N5W A;  3AMZ A;  1SB3 C;  2JQR B;  4HRO A;  2H89 B;  1XLN A;  3NVW A;  1QOB A;  1FO4 A;  1T3Q A;  1N5X A;  1KF6 B;  1JW9 D;  4C7Z A;  1WXQ A;  2PVG C;  1RFK A;  5EE0 A;  2W3S A;  2DBY A;  1FFU A;  1E6E B;  3P4Q B;  2MJD A;  3NVY A;  4WQM A;  1WYG A;  2BS2 B;  1N61 A;  1FXA A;  1KRH A;  2K5P A;  2FBW B;  2EKI A;  2HTM E;  1DOI A;  4WWM A;  1YQ3 B;  3ABV B;  1OFF A;  2H88 B;  1QOA A;  3NVV A;  2CJO A;  1N62 A;  3LB8 C;  4US9 A;  2WDR B;  1E0Z A;  4JWS C;  1AYF A;  1R7S A;  3NRZ A;  3KWL A;  3W5U B;  1EWY C;  4YSY B;  4USA A;  1TKY A;  1NEK B;  2WQY B;  5EE3 A;  1WRI A;  4ZHO A;  4HRS A;  1JRP A;  2ACZ B;  5H92 C;  3AE2 B;  3W9C B;  1VLB A;  3SR6 A;  2B76 B;  3ETR A;  3AH7 A;  1RM6 C;  1ROE A;  3B2F A;  2M56 B;  2WDQ B;  1QLB B;  1NEN B;  2L83 A;  1GPX A;  1V97 A;  3VR9 B;  3DWM A;  3ZYY X;  1E7P B;  2BS4 B;  1WWT A;  2MH7 A;  3NS1 A;  1JWA D;  2M19 A;  1A70 A;  2KAJ A;  2OHF A;  1XLO A;  2PVO D;  1TYG B;  3CIR B;  1F0Z A;  4KX6 B;  1N63 A;  4US8 A;  4C80 A;  1FMA D;  1NYR A;  3P4S B;  3VR8 B;  1JRO A;  2N0S B;  3AEG B;  4YTM B;  1DGJ A;  1RWS A;  4YTP B;  1TKG A;  2LEK A;  2KMM A;  3AE1 B;  1TKE A;  1DOY A;  1GAQ B;  1FXI A;  3AEA B;  3AEE B;  1E10 A;  1JAL A;  1QT9 A;  2MJE A;  1FRD A;  3AEC B;  1FFV A;  1VDV A;  2E3T A;  3AV8 A;  3EUB 2;  3FC4 A;  1WGK A;  4JWU C;  1FM0 D;  4C7Y A;  4A9A A;  2MJ3 A;  3AEB B;  5G5G A;  1OQQ A;  2CU3 A;  1J7C A;  3AE6 B;  3AE3 B;  3HUI A;  3HVZ A;  1ZUD 2;  2PKO A;  5AUK A;  4YXD B;  3AN1 A;  1N60 A; 
#chains in the Genus database with same CATH topology
 3H4B A;  9ICR A;  3AE4 B;  1K1Q A;  2BS3 B;  3PZP A;  4RPX A;  1BPB A;  8ICM A;  3SHQ A;  3JPT A;  5CB1 A;  2UVU A;  2HVI A;  2QIL A;  3DVN U;  3P63 A;  4PGX A;  1F44 A;  1I4P A;  4NL9 A;  3RFZ B;  5EWE A;  1ZQN A;  5EOZ A;  1Z2M A;  3GE3 C;  1RPL A;  1WSP A;  3LXF A;  2RP5 A;  2N4F A;  1XT9 B;  5KFU A;  3QU5 A;  2F76 X;  3SYZ A;  3AM9 A;  2FPK A;  3B0Y A;  5KFY A;  2R8I A;  2JF5 A;  4YFK A;  2J7Q B;  3WK5 A;  2J6T A;  4M9G A;  3CP8 A;  5ALI A;  4F4K A;  4KVG B;  4KLM A;  2EAM A;  1KDH A;  4EEL A;  1V9P A;  3G6X A;  2RHF A;  3AE9 B;  4RMA A;  3RNG C;  3NVZ A;  3C1Y A;  5KL8 B;  3SU8 X;  4W9E A;  1TKD A;  1WXS A;  4IQT A;  2QAR A;  1TK8 A;  3CYM A;  2K0P A;  3ZDD A;  4UB2 A;  1VZ6 A;  8ICZ A;  3KD3 A;  4B9N A;  3V6H A;  5MPO A;  2JY6 A;  3L10 B;  1D5X C;  1CK1 A;  1ZXI A;  7ICL A;  3GS2 A;  1WE7 A;  5AK3 A;  2F8K A;  5ALK A;  2IHN A;  4O3M A;  1RRB A;  1EUV B;  5J0O A;  3MTN B;  5BYQ A;  1YZ7 A;  4IRC A;  3L54 A;  1VCB A;  3NHE B;  1S1Q B;  5ALX A;  4D2K A;  2HJ8 A;  2N9X A;  4NLN A;  4UAT A;  2KQS A;  3OLM D;  2DBY A;  3U4E G;  2KVZ A;  3FKY A;  2JWU A;  4GXJ A;  1RLF A;  2KVC A;  4C8K A;  3NOB A;  1WUD A;  5KFE A;  4TV3 A;  2QHO A;  2KK8 A;  4Q45 A;  1ZD3 A;  4WJN A;  5BMI A;  4Q43 A;  4I2G A;  1JXL A;  2CHZ A;  2WDR B;  4F4Z A;  4UAY A;  3BK1 A;  3KWL A;  4USA A;  3DCG A;  4Y2P A;  5DLG A;  5TR5 A;  4TMA B;  5GMV A;  3J81 j;  3SR6 A;  4J9Q A;  2WXL A;  2L7R A;  1NNL A;  2DZK A;  3I28 A;  5DQH A;  5ALD A;  3ZXR A;  5AM3 A;  2BCU A;  3EEC A;  3B0A A;  4P6V F;  1X66 A;  1F0Z A;  3QZ7 A;  3ZDB A;  3E58 A;  2G5H B;  5ALW A;  4US8 A;  3RZW C;  1JRO A;  2GWS A;  3EWA A;  3GIL A;  2Y5B B;  3TQ1 A;  3H7S A;  2JXT A;  4FBJ B;  3PRE A;  1SJE D;  3C2K A;  1GAQ B;  5AM4 A;  3Q8M A;  4MGK E;  4MJS A;  4KLQ A;  1ZQI A;  4CF5 A;  2G4D B;  2YB1 A;  5J0R A;  4FHJ A;  3VDZ A;  2W8L A;  3VQI A;  3U26 A;  1D5M C;  5DG9 A;  1V1P A;  4YXD B;  2KYW A;  5JH5 C;  1KLV A;  5KFX A;  3WKD A;  1V86 A;  4KDL B;  1JQ4 A;  4NJ8 A;  4ARI A;  2PLP A;  3LDZ E;  5J0W A;  4PHD A;  2WU2 B;  4YWG G;  4WIP A;  3SMV A;  2D2Q A;  2ISP A;  5H2F U;  3RF9 A;  1BGX T;  3HPO A;  4K4G A;  3AU2 A;  1D6E C;  3ZO5 B;  3Q3M C;  5AZF A;  2QLT A;  5J2D A;  3AEV A;  4B9T A;  2BT6 A;  1UWX A;  2Y5C A;  1YZ6 A;  1OW5 A;  2J0K A;  2UU7 A;  3H0L B;  4DSK A;  5DPT A;  3H7I A;  1OQY A;  3UI3 A;  5C5J A;  4E71 A;  4MEX A;  1U49 A;  1SIF A;  5D94 A;  1NZP A;  3OTQ A;  8ICE A;  2M4N A;  2I1J A;  5TZV A;  2W7O A;  2VH1 A;  3BZK A;  3ZDT A;  2KZR A;  4NNJ B;  1MSW D;  3ZGZ A;  4MHV A;  3MFI A;  2XGQ A;  3QEA Z;  1KLG D;  4GC6 A;  1QH9 A;  5A0L A;  5EWG A;  1E7U A;  1FNV A;  1NBF C;  1RYU A;  4LNO A;  5BYR A;  4DL4 A;  5B66 U;  4EZL A;  1CJE A;  3PT2 B;  5IA7 A;  4KMO B;  1JXE A;  1GC6 A;  1TJE A;  2NCN A;  2WGS A;  2FNJ B;  2KTR A;  4N9F 4;  1WX9 A;  3TAR A;  4B6W A;  5DB9 A;  5ALN A;  2VIX A;  4RUC A;  2KSO A;  1Y56 A;  1X2I A;  2REX A;  2JQR B;  2X8X X;  4NLB A;  3NVW A;  4F8R A;  2BYT A;  1T3Q A;  4FS2 A;  3IG8 A;  3HWT A;  1J19 A;  3QHT A;  2CN1 A;  2FLN A;  2LVO A;  3FDS A;  2KOB A;  4HWI B;  4YQW A;  1ZQG A;  4FLH A;  4P4P A;  2F1H A;  3M6Z A;  4PJ0 U;  3VCB A;  4RUA A;  3QU2 A;  1TAU A;  2ZNV B;  3KVF B;  3APD A;  3KKA C;  4MEL A;  3F5A A;  1FEH A;  3VFK A;  5J2A A;  4JWM A;  2K39 A;  2W9B A;  3PR4 A;  4RT2 A;  5KTQ A;  4HCN B;  3VVW B;  2HW3 A;  3SI8 A;  3AU5 A;  2WDT B;  1V1P B;  4FJV B;  3H8W A;  1JRP A;  3V3X A;  3WKB A;  3NGD A;  2W82 A;  1K50 A;  3LVW A;  3SAG A;  2WDQ B;  5J0Q A;  4EYH B;  4KLE A;  4EE2 A;  2KZZ A;  8ICW A;  2BS4 B;  4XWW A;  1C20 A;  2LGY A;  1N63 A;  1NYR A;  3ICX A;  5LNK 1;  4E0D A;  1RWS A;  4RF0 A;  4KN4 A;  3RAQ A;  1MC8 A;  1WY8 A;  9ICG A;  4MFC A;  1FXT B;  4BOZ B;  5CR0 A;  3AV8 A;  2GRI A;  1FFV A;  1M94 A;  4RQ3 A;  4Y2V A;  2GBM A;  2Y3A A;  4A9A A;  3T5J A;  3K4G A;  2HBK A;  3JPN A;  4UAV A;  8ICN A;  1SE9 A;  3Q69 A;  4NJC A;  2LGD A;  3TAP A;  3O13 A;  1JI7 A;  4KLF A;  2M9N A;  3OJU A;  3T5L A;  4ZHP A;  2J4X A;  3VXW A;  4AWJ A;  5H8Y E;  1KLU D;  1TV9 A;  3AU4 A;  3Q14 C;  4EBC A;  9ICW A;  5L95 C;  1L6V A;  2BR0 A;  1ISN A;  2DZI A;  1SGH A;  3D2Q A;  3FIL B;  4UAZ A;  8ICH A;  2KTR B;  1QTM A;  4EEW A;  1T5X D;  1FCC C;  1D9F A;  3AUO A;  5DPS A;  1SWV A;  2MLB A;  1XNS A;  2PI4 A;  5HR7 A;  5AM2 A;  5F3X B;  2ZIV B;  4MH8 A;  1SKR A;  2HHX A;  1PYW D;  5CX3 A;  4C4V A;  4KLS A;  2I1Q A;  3RBD A;  2LI6 A;  1T3N A;  1T0R C;  1UCV A;  4KTQ A;  1QQ5 A;  4I2B A;  1TIF A;  2KJ9 A;  2KJ8 A;  3JVZ X;  1WMH B;  1CZP A;  3T3F A;  1C3T A;  4PS7 A;  1SZH A;  1U4B A;  4O5K A;  1JWU D;  1MHH E;  3CSF A;  1V85 A;  4GB9 A;  5BMG A;  2A5U A;  3IM1 A;  1L7Y A;  2BKF A;  4W9I A;  3C29 A;  4A20 A;  2WU5 B;  1N5W A;  2O6K A;  2UVR A;  3VH3 B;  4J9S A;  4DFP A;  1XLN A;  4DCC A;  4TSS A;  4H2A A;  5AKL A;  4P0Q A;  4DLG A;  4OVZ A;  4F4W A;  1FFU A;  4HPL B;  1E6E B;  1R4M B;  4B9M A;  5ALT A;  3MFG A;  5JHB A;  4GSW A;  5KG3 A;  5AZH A;  3VTU A;  1X40 A;  2CKH B;  4IR1 A;  1WGD A;  4J9R A;  3N7P D;  1B22 A;  3GIK A;  4R66 A;  4PYZ A;  3V7L A;  1ZQE A;  8ICY A;  4UAU A;  4TQS A;  4QNL A;  4IC9 A;  4US9 A;  1L3T A;  3PPA A;  1U47 A;  1ZQX A;  4IS7 A;  3NUQ A;  3D32 A;  5AI9 A;  1RAX A;  1C76 A;  4RNN A;  3R8B A;  4MT5 A;  4DSF A;  1NJW A;  1GJZ A;  2HHQ A;  5KT6 A;  4R8U B;  3PTF C;  3IT6 B;  2Z7J A;  1NEN B;  2L83 A;  2ISO A;  1RFA A;  5HNK A;  1LVH A;  2FLP A;  1E8W A;  1TS2 A;  3EPG A;  2UWQ A;  2OHF A;  4QWB A;  1SKS A;  2Z0D B;  3N30 A;  2M0A A;  1YOV B;  1V6E A;  5ALV A;  3IDW A;  1FMA D;  3QUC A;  2HTH A;  4K81 A;  4TUR A;  5D7G A;  5ALY A;  2BQ3 A;  1AQ6 A;  1NI2 A;  1QT9 A;  2DHZ A;  4NQL B;  3WK6 A;  2MX2 A;  5G2N A;  5HFY A;  4C7Y A;  4KKJ A;  3J9C A;  1S0O A;  3RN9 C;  3AE3 B;  2RMM A;  4ZRI A;  4PL2 A;  1P98 A;  3BY4 B;  3HM6 X;  5ALP A;  3C28 A;  4KGT A;  1YN4 A;  3APC A;  1UT8 A;  5DKW A;  5CTR C;  4YCX A;  3LJ3 A;  3BQ0 A;  4GIB A;  2BCS A;  1QQ6 A;  2XO7 A;  3QUB A;  5KG2 A;  4YR3 A;  2MA9 B;  2WXF A;  1E8Z A;  7ICO A;  2QEJ C;  4UAW A;  1T4G A;  3WAM A;  1TGZ B;  1XCQ L;  5IIO A;  3PW4 A;  5AIA A;  3A4R A;  3ZDM C;  3PSP A;  2LM1 A;  4HVB A;  5J0U A;  4RQ5 A;  1TS5 A;  4BGD A;  4Q44 A;  3TFR A;  2WNM A;  2JYT A;  2R8G A;  2UYZ B;  5CWR A;  1Q1O A;  2FUG 1;  4P0P A;  4LVS A;  3T3N A;  2FE8 A;  4NL9 C;  1IUE A;  4I2J A;  4X57 B;  5J2K A;  1SE4 A;  2BPF A;  7ICQ A;  4KLJ A;  1XLP A;  3GZN I;  2DAJ A;  2A3V A;  4NLZ A;  1L8L A;  1XLQ A;  4RU9 A;  2BQQ A;  1WGG A;  1JCK B;  2WDV B;  1YQ4 B;  1FIQ A;  1F9J A;  5GXG B;  1A0P A;  1MFW A;  5DLF A;  1GNU A;  5J0S A;  2N1W A;  3UXN A;  2HHT A;  1ACC A;  1HZ6 A;  3NZS A;  3MDA A;  1COK A;  4MGI E;  5C2T B;  3OG5 A;  4IG7 B;  3MC1 A;  1QSL A;  2PFN A;  1WM3 A;  4DL6 A;  2PMV A;  2XY6 A;  4FHK A;  2J52 A;  2GI9 A;  4PS3 A;  5JU5 A;  4C7Z A;  1JN3 A;  4P4O A;  5KFF A;  1RFK A;  2W3S A;  2L0T A;  3M62 B;  4KIK A;  2MJD A;  4R63 A;  4M02 A;  3TEZ A;  1Q8K A;  4BWM A;  1RXW A;  2LRU A;  4PK1 A;  1DOI A;  2PE9 A;  2MBO A;  5AK5 A;  1OFF A;  3KZX A;  2H88 B;  3NG0 A;  1YX5 B;  3GV5 B;  4DO9 A;  5J2J A;  1SL2 A;  2H3F A;  8ICQ A;  3RUI B;  2HHU A;  5CHF A;  2WQY B;  3PSI A;  1O03 A;  3GIJ A;  3KKA A;  2G3Q B;  3EA6 A;  1C1Y B;  5AK4 A;  4ECS A;  2NO4 A;  4F4Y A;  4HK2 A;  2NMQ A;  4YXJ A;  4O0I A;  2WX0 A;  3DHG C;  1QQ7 A;  3AH7 A;  4B9U A;  4F3O A;  1ZDV A;  3H8H A;  1GB1 A;  2QCZ A;  4O3R A;  5KNI A;  3ZJT A;  2KFK B;  1S10 A;  3LVV A;  2LMC A;  3QAQ A;  3ZD8 A;  3BZD B;  1B4F A;  2O6V A;  1N56 A;  4I6N B;  2O2V A;  1MPE A;  2FDR A;  4YVZ A;  3Q8Q B;  3CNH A;  5B5E U;  1EF5 A;  1TKG A;  1UH6 A;  2KMM A;  2LHD A;  4YR0 A;  3UM9 A;  3T3O A;  1S3S G;  2ZJD A;  3EHV A;  2ZIX B;  2Q0Z X;  1Q46 A;  4M0W A;  3M3J A;  4A3P A;  1MJD A;  3N97 B;  3JYU A;  4P0P B;  3N20 C;  3ALB A;  1N60 A;  1X42 A;  4B9S A;  2HVH A;  1HE8 A;  2Q5W D;  1S0M A;  1D8L A;  4G3I A;  3PRM B;  2K4P A;  3MDC A;  4LK0 M;  4JK1 A;  3Q3O C;  4DQP A;  1ZQF A;  3U52 E;  3U8Z A;  3RMK C;  2HBJ A;  2JH7 A;  2KMC A;  2YEP F;  5KFL A;  5AEK B;  2MWS B;  2W04 A;  2LHT A;  3DHH C;  2N1R A;  8ICX A;  4JB3 A;  1JUD A;  3HT3 A;  3TAC B;  2PJH A;  2R61 A;  3RNB C;  3ETL A;  3WKC A;  4MFA A;  4DXA B;  5HKH A;  3S2A A;  1WGH A;  3SDL C;  3BYY B;  2AGO A;  5HHD G;  2B0C A;  1NKC A;  4EX7 A;  1BT0 A;  4JX1 C;  3WA0 A;  2INN E;  4MEM A;  1IP9 A;  2W43 A;  4N59 A;  2GLE A;  1D5Z C;  4L23 A;  4KIK B;  2L5Y A;  2G45 B;  2JPH A;  3L5K A;  4YMM A;  2D3G A;  1P7D A;  4G0N B;  2XIC A;  5ALF A;  3QX1 A;  2KHV A;  7ICF A;  4GDK B;  3UF8 A;  3I5J C;  3VUY A;  1DOX A;  4LLG M;  4IDI A;  4YMO A;  2ASL A;  5DGA A;  4PT5 A;  3V6K A;  1E9M A;  2CXY A;  3V05 A;  3IBE A;  1BPZ A;  2C5L C;  2ONQ A;  5AIC A;  5BMH A;  1X9X A;  2HOI A;  2QJL A;  3DDC B;  3RCZ A;  2YTU A;  5CEH A;  1Q10 A;  2KFJ A;  4ARC A;  3TIX A;  1K52 A;  4KMU A;  2ZW0 A;  3ISD A;  9ICK A;  1WXQ A;  2N7J A;  1D8Y A;  1I4Q A;  4ACO A;  4UAS A;  4NM2 A;  1UD7 A;  1CUK A;  4RQ8 A;  4FS1 A;  2WYQ A;  3H9D A;  4QWA A;  1RQN A;  2H3Z A;  2FBW B;  3RTV A;  5E6J A;  4QWE A;  2ZCC A;  3A9K A;  4MSM B;  2V4Q A;  2KQ7 A;  2O6V B;  2KEY A;  1ZQQ A;  2MAX A;  2KX0 A;  2O2V B;  2IHM A;  2RD0 A;  2HCF A;  3E56 A;  5CHG A;  4P16 A;  3ZDC A;  1YN5 A;  2A1A A;  2KIW A;  2KKC A;  3SEN A;  3N4M B;  2RR9 A;  1ET9 A;  9ICF A;  3BK2 A;  1L4D B;  5ALG A;  2DQN B;  4ECQ A;  2RDG A;  3HX0 A;  4YD1 A;  4HRS A;  5FP0 A;  3PNC A;  4OJL A;  2IJ0 A;  2B3A A;  4XRH A;  2NRT A;  1CI4 A;  3A0H U;  4CF4 A;  4I6L B;  3VC8 A;  4GXI A;  1ZQP A;  1WX8 A;  2BWE S;  2LRW A;  2JU6 X;  3H4D A;  4XX5 A;  4Y2X A;  3QE9 Y;  1VJ5 A;  3VR9 B;  1IPG A;  3K9O B;  2ZCB A;  2C28 A;  3BYT B;  1JWA D;  3H8J A;  2PVO D;  1S0V A;  1L7N A;  3GII A;  3ZI4 A;  4YTM B;  3PML A;  1AAR A;  2PI5 A;  4EX6 A;  2HSZ A;  2JHD A;  5KT4 A;  3RI7 C;  4O1N A;  4GFJ A;  2DAF A;  1WXV A;  2E3T A;  3MHZ A;  5KFB A;  1E8X A;  4XC2 A;  4PS8 A;  2ZUC A;  5KFT A;  2K4H A;  4UB3 A;  5FR3 A;  1SE2 A;  1ZQC A;  4REZ A;  9ICQ A;  5AK6 A;  5EE1 A;  5AI6 A;  1VR9 A;  4HKZ E;  3ZRF A;  4I2E A;  1ZP0 B;  1WZ3 A;  1JMS A;  5KFR A;  4Q8F A;  4DQS A;  4UB6 U;  4M9L A;  2AQ3 B;  4LNI A;  1OEY A;  8ICR A;  1ZQL A;  4Z6E A;  9ICE A;  3OJ4 B;  4RQ1 A;  3JPQ A;  2ZEQ A;  2K6D B;  4NAM A;  3TSS A;  5ALU A;  1U9L A;  2HMX A;  3E9S A;  3C0R B;  1SBB B;  4NV0 A;  2NBW B;  4N6E B;  2R8K A;  5AKY A;  4XA5 A;  3T79 A;  3ZUN A;  2JMG A;  3HK0 A;  2BTE A;  5JHA A;  5D46 A;  2KJ5 A;  2LXC A;  4X5V A;  2ATL A;  4K4H A;  5KFN A;  1UBQ A;  2VA8 A;  1UF0 A;  4KV2 A;  4WWN A;  2M1M A;  4WJ3 B;  3MGH A;  3B9J A;  4CRX A;  4RCO A;  1UGJ A;  2BWF A;  3I63 C;  3SEI A;  2L00 B;  4WAF A;  2JXJ A;  2M17 A;  9ICB A;  1V8C A;  4QZF A;  1SE3 A;  2TSS A;  4P2H A;  8ICV A;  4MH0 E;  4PL1 A;  4HEA 1;  4HXD A;  1X9S A;  1NZB A;  2AQ2 B;  2MBE A;  5GTH U;  2JV3 A;  5ALM A;  4L1B A;  2OJR A;  4ZYN A;  4ED0 A;  4CCH A;  2RDI A;  4QW8 A;  2NTS A;  1N5X A;  9ICS A;  2XN9 C;  3RT3 B;  3RJK A;  3B1L X;  2ZIW A;  2XID A;  1E8Y A;  4DWF A;  2HE7 A;  3QXG A;  2XEW A;  5LXH A;  1Z00 B;  2WXJ A;  2EKI A;  3HW8 A;  2OXO A;  1Z3E B;  5KAF U;  2HTM E;  3JPR A;  3ZJU A;  2ZJ8 A;  2AQ1 B;  2LGI A;  5AM5 A;  2IMW P;  4KLH A;  2M8S A;  2EZX A;  3VUW A;  4DXF A;  1S5L U;  3PLU A;  2CJO A;  5L1M A;  4ED7 A;  3TAD A;  1VRA B;  5DDM A;  4KGS A;  1F0M A;  2RQ5 A;  7ICG A;  3KYC D;  3NZ3 A;  5E6P A;  3ZXV A;  1WRI A;  4ECT A;  2MRP A;  3EGR A;  2L0F A;  5H92 C;  4CDG A;  1KM7 A;  4MF2 A;  2NS5 A;  1MVK A;  4KKI A;  3Q8P B;  2HDO A;  4M9N A;  2WB1 C;  1NK4 A;  3RB6 A;  2K8C A;  1X6J A;  1WWT A;  2MHJ A;  3CF6 E;  3N1X C;  2RPV A;  1BXT A;  4RF1 A;  1KTK A;  3WK7 A;  3RB4 A;  1JWS D;  3IHP C;  4IWP A;  1ZD2 P;  2GH1 A;  3H8S A;  3WK4 A;  1NK9 A;  2KTQ A;  3URY A;  2DYO A;  8ICL A;  3CW2 C;  1UUP A;  5C23 A;  4FZM A;  3DBH B;  1ZQU A;  2EEL A;  3GP7 A;  1U48 A;  2EAP A;  9ICN A;  1ZXH A;  3PS6 A;  1FRD A;  4ECY A;  3V72 A;  1HTQ A;  1I35 A;  2PKE A;  2I6X A;  2WF7 A;  1Z5S B;  1ZQM A;  4QIW C;  4IRD A;  5AI0 A;  2XY5 A;  2ASQ A;  2Y0S C;  3BDP A;  2FLL A;  1WJU A;  2A19 A;  4RQ2 A;  1E7V A;  2FAZ A;  2ZTE A;  5DBC A;  2KJ6 A;  4UBB A;  5KHQ A;  5KT2 A;  2JR5 A;  3LDA A;  3PR5 B;  4HPP A;  3VRB B;  3HIZ A;  1WJ4 A;  2L32 A;  3N1Z C;  4UDU C;  2VAN A;  4ANV A;  2VRR B;  4KLO A;  1ZQS A;  4IOI E;  1ECW A;  3FM9 A;  5AI8 A;  3U30 A;  5J2I A;  5ALR A;  4FZL A;  2K8B A;  2OOB B;  3QIJ A;  4MM3 A;  4WJQ A;  2F8L A;  2RRD A;  2KWC A;  4XDC A;  3V7J A;  1MG8 A;  3CMM B;  4GIV A;  4MGY E;  1XO3 A;  4GLS C;  1DOQ A;  4J3O D;  1WE6 A;  3MR2 A;  5FK9 C;  2DL0 A;  1WWV A;  3CWI A;  3GDX A;  3KLS X;  2VA2 A;  5TIS U;  4MGZ E;  2QAR B;  5AM1 A;  3PVX A;  3RJG A;  3U7D A;  3MBY A;  2J0M A;  1F5S A;  1TVA A;  5EE9 A;  3AB5 A;  3SD5 A;  4XQ8 A;  2BGW A;  2NYV A;  4Y2R A;  3L16 A;  5J0Y A;  4DQO C;  2PMZ C;  1ET6 A;  3QWZ B;  1P3Q U;  9ICU A;  2A1J A;  2NBU A;  3IV6 A;  2PIA A;  1ZQK A;  8ICK A;  2PPH A;  2G0A A;  4AJW A;  4GXB A;  1MQ2 A;  2LD9 A;  1FD6 A;  1HEZ E;  1WGY A;  5T8I A;  1DK3 A;  3MJ5 A;  4ECU A;  1SB3 C;  4PGY A;  1CQV A;  1OXJ A;  3DQV A;  4ZH4 A;  3KUC B;  4YSZ B;  2GBR A;  1JW9 D;  5KFZ A;  4C4S A;  1YQB A;  1UA0 A;  3OGU A;  3GV7 B;  3X23 A;  4A90 A;  4K7W A;  2FPM A;  4J6I A;  4YP3 A;  3K75 D;  3AQF A;  2AL6 A;  3M6K A;  2KAN A;  2IA6 A;  4C00 A;  3QA8 A;  4AYB C;  2K25 A;  2KN7 A;  2JXX A;  2J6U A;  1LKY A;  2DZJ A;  3NVV A;  3DDH A;  4R64 A;  5T14 A;  7ICM A;  4M04 A;  4W9F A;  3P2B A;  1ZRN A;  1BNP A;  2Y5P A;  1J2N A;  4LNF A;  3ZNZ B;  2G08 A;  3QCA A;  5E6O A;  3N28 A;  4BZA A;  4XZ4 A;  4KLI A;  2C7H A;  1L3U A;  5IIM A;  1C7Y A;  2JEI A;  3AI5 A;  3RJE A;  4JL9 A;  2B76 B;  4XDD A;  4FO6 A;  4F5N A;  2I1K A;  4RZR A;  3ZW3 A;  1V97 A;  4OJ6 A;  5CRX A;  2WX1 A;  4MFF A;  2WXM A;  7ICU A;  3BS7 A;  3NS1 A;  4O5C A;  4FBT A;  2EAN A;  4PGQ A;  2WAQ C;  7ICR A;  2V4L A;  2WTF A;  4MDK E;  3QU4 A;  4P4M A;  4GN1 A;  1JIH A;  1I4G A;  1SJH D;  1UGM A;  2X38 A;  1UBI A;  2N1V A;  3PMN A;  2NBV B;  3AE1 B;  2K8B B;  3PHW B;  4MM3 B;  2BYV E;  1E10 A;  4MJS B;  1JAL A;  2YMQ A;  3PLV A;  2ZXH A;  2L76 A;  4FAD A;  2ODG A;  2GOW A;  2HDE A;  2MJ3 A;  5G5G A;  4NM1 A;  3TL5 A;  1UEL A;  4ECX A;  2JEJ A;  3ZD9 A;  4EEY A;  1OQR A;  2LGS A;  2EKE C;  1GUA B;  4LCD E;  1PGX A;  1L4Z B;  2IO3 B;  3F53 A;  4CF3 A;  1F2R C;  4MEY A;  2PFQ A;  4JV0 A;  2C60 A;  5BPC A;  3I1Y A;  1MQ3 A;  1T0Y A;  2MBQ A;  2AQ0 A;  2A1J B;  3AUL A;  2WXO A;  2VKQ A;  5BOL A;  4IUM B;  4P1B C;  2JYE A;  5J0X A;  3GB1 A;  2EQY A;  3Q8A A;  2KJR A;  3PW2 A;  4O3O A;  1JRU A;  2DNF A;  1L7M A;  3R7R A;  1JML A;  5L1I A;  2FCM A;  1PFD A;  4IM0 A;  4RQN A;  4TUQ A;  3IVF A;  2GBN A;  3ZKJ C;  4IQV A;  3M9N B;  2V3S A;  3PX0 A;  1WIA A;  5HHI A;  1N48 A;  1V2Y A;  4EBE A;  1BUI C;  2D3C A;  3KWV A;  5J2E A;  2AGP A;  4RM8 A;  4DOB A;  4QZ9 A;  3A9J A;  1WGR A;  2Y1I A;  4KLD A;  4I2C A;  3S6J A;  3TCA A;  2JZ3 B;  2OWO A;  3JPP A;  1Z1V A;  4DF4 A;  2IO0 B;  4K3C A;  2PEA A;  3QC8 B;  1KW4 A;  1QQR A;  1TS4 A;  4JQW C;  3V62 A;  2YVC A;  3SFD B;  4XWT A;  3HKZ F;  4I2I A;  3RR7 A;  4ZOH C;  3DPD A;  3W5V B;  3UQ2 A;  4K7U A;  1C77 A;  2E8P A;  4R65 A;  2JWZ A;  4RM9 A;  2KSO B;  4J9L A;  4OZC A;  3QUT A;  2K4E A;  7ICS A;  3SV3 A;  4BBN C;  2FCQ A;  2ALZ A;  3V61 A;  2YMM A;  3M8R A;  4ZHO A;  1MN8 A;  9ICO A;  1WJN A;  5DPR A;  2AGQ A;  3EC8 A;  1IIP A;  1QSY A;  2V1Y A;  1DK2 A;  1TE2 A;  3WKA A;  1YQ3 B;  5FR6 A;  2M0N A;  4ELV A;  1L7O A;  1K8R B;  3DBR I;  1S8O A;  4RNA A;  4F5Q A;  2D11 A;  4J9M A;  3KHH A;  4EYI B;  4F5O A;  3IHQ B;  3JPO A;  2W9B B;  1HTO A;  4ZYS A;  3W5U B;  2MSN A;  7ICN A;  5KFW A;  1EWY C;  4YSY B;  4B6J A;  2KVS A;  2LJ5 A;  2DLB A;  3KBB A;  2MUT A;  4QZC A;  1FCL A;  3UGB B;  4W9H A;  4F1S A;  5HML A;  3TFS A;  1V5T A;  1ROE A;  3QU7 A;  2JH1 A;  1XD3 B;  3GV8 B;  3I76 A;  4Z6F A;  4M47 A;  2JEF A;  3T8M A;  2LYB A;  1V9J A;  3T5H A;  1HA5 A;  4RGN A;  4FN2 A;  4FE3 A;  2AJQ A;  3RB3 A;  1H8C A;  1LQB A;  3IRU A;  5IIK A;  4NQK E;  4DEZ A;  3OWE B;  4W9L A;  1X6I A;  1SXT A;  4EEK A;  2L1A A;  5J29 A;  3MC9 A;  2N7D A;  1C79 A;  1Y8R C;  3DBL I;  1ZDX A;  5AUK A;  1YN3 A;  2WXH A;  1FNW A;  4I2A A;  4TQ1 A;  4NLG A;  3A4S C;  1B1Z A;  1NKE A;  2Y1J A;  4GDL A;  4RQ0 A;  1L5P A;  3Q8F A;  2C22 A;  4HDO A;  3HVD A;  2J53 A;  2NR2 A;  4KZC A;  5J8Y A;  2KLG A;  3PW5 A;  5JRT A;  3DVN V;  4ZRP A;  1PUT A;  2K89 A;  3MAB A;  4F71 A;  3SFE B;  2FPL A;  1ZRM A;  1VD2 A;  3ML9 A;  4K3B A;  2PXI A;  1ZD5 A;  1SXE A;  2LFI A;  3WAN A;  1Z1B A;  1STE A;  4NLK A;  3AE7 B;  5DB6 A;  4BKS A;  4O3N A;  2XVT A;  4QWD A;  2HBM A;  2PTL A;  2KX3 A;  4XGA B;  1A77 A;  4F93 B;  1I42 A;  3QNM A;  3KUZ A;  4AOF A;  4BXO A;  4C4V B;  1AN8 A;  3TBL D;  4G11 A;  4NXZ A;  4F8C B;  2BF8 B;  5KFQ A;  5J0T A;  5J2C A;  1C9F A;  3G6V A;  4DSL A;  1YNT E;  3R3M A;  1QOG A;  1BPD A;  2JZB A;  4RPY A;  5KFC A;  9ICJ A;  2KN5 A;  1SXD A;  5D4B A;  2ZG6 A;  2DFL A;  3B2G A;  3C8Y A;  1HUZ A;  2IY1 B;  3DWG C;  4LDT B;  2NRX A;  2C2D A;  4J9N A;  2Z8L A;  4EZ6 A;  3SAF A;  3RAX A;  4C0Z A;  1JWB D;  5AI5 A;  4DFD A;  1SEB D;  2DZM A;  5G5H A;  3IXS A;  3EYZ A;  3GZF A;  2KNJ A;  5CHV C;  1Z4O A;  4Y2U A;  4BJQ A;  1BML C;  1Q5W B;  2LYA A;  5KFA A;  4P0Q B;  2PVG C;  4W9D A;  3KH0 A;  2BZF A;  3RD2 A;  3RNE C;  5J2H A;  2FCS A;  4ECV A;  2XBB C;  2ZVN A;  1D8B A;  4AJY B;  1WYG A;  3HHM A;  2OJW A;  3WAP A;  5JTI A;  3DVG Y;  1KLN A;  2DKZ A;  4W9J A;  4IW0 A;  2CPR A;  2Y9T A;  2BCV A;  4GGQ A;  3BQ7 A;  1HIW A;  3R9K A;  3E0F A;  3QK0 A;  1EWC A;  2KKP A;  3C1Z A;  1N6Z A;  4KX5 A;  3OJ3 A;  1LGR A;  4DDG D;  1TKY A;  4UB8 U;  5EE3 A;  3WK9 A;  2D5G A;  2V4I B;  3H6N A;  3ZIM A;  5HMM A;  3DBS A;  2O6V D;  1VLB A;  4DSE A;  4YXM A;  4GDL B;  3U2S C;  4C4R A;  1I4R A;  4IRK A;  1WRD B;  4KN7 A;  5KAI U;  4OHJ A;  5E79 U;  3BS5 A;  9ICL A;  1SKW A;  2KHW B;  3WAL A;  2F1I A;  2IBI B;  4FJY A;  3VR8 B;  3TAD C;  3CRX A;  3AL0 B;  2ZJ5 A;  1B43 A;  4DFM A;  2QB0 A;  4OCZ A;  1F77 A;  3BVZ A;  3H7P A;  2LJI A;  2YX8 A;  5DPW A;  3AEC B;  3I57 A;  1SZP A;  2DGZ A;  2MEK A;  1WWU A;  2I2Y A;  3W2D A;  1XSN A;  5AKJ A;  3ISC A;  1F2R I;  4WAA A;  1J7C A;  3AE6 B;  2AQ4 A;  3IAS 1;  2AHO B;  5DB7 A;  2FCN A;  3A33 B;  1IG6 A;  4BKT A;  1JWM D;  1L5U A;  2GOL A;  8ICB A;  1EU3 A;  3V6J A;  1NI3 A;  1ZKH A;  2JZB B;  3NZU A;  1KEJ A;  4TQ0 A;  1NK7 A;  3DEE A;  1PVR A;  3KW5 B;  1A6S A;  5IOI A;  1P0R A;  2DPJ A;  2K4I A;  1WG8 A;  2PE6 B;  3O65 B;  5LLI A;  5DBB A;  5IIL A;  3AED B;  3UXP A;  1RDF A;  2HHW A;  2R8H A;  3KFU F;  1YJJ A;  3TAN A;  2WXN A;  2W55 A;  1G6J A;  1J7A A;  2E8M A;  4M9J A;  2AH5 A;  4Y2T A;  4DF8 A;  2HOF A;  2LXA A;  4W9K A;  2XGP A;  4ITK A;  3IG5 A;  1EU4 A;  1XU4 A;  1YT3 A;  1K53 A;  3FYH A;  1SIJ A;  3NJT A;  1F52 A;  3MR6 A;  4M00 A;  4I27 A;  2IOF A;  2YY6 A;  4MF8 A;  4CO7 A;  4UQG A;  4ED8 A;  1M6Y A;  3GIM A;  1SL0 A;  3TUO A;  1K5O A;  4PHP A;  4P1C C;  5IIJ A;  1WI0 A;  3EPI A;  2LVP A;  1DRG A;  4F7Z A;  3BVG A;  9ICX A;  1R4N I;  3KHL A;  1XCT L;  4LZD A;  2FUH B;  1ZW7 A;  2EMS A;  4BKG A;  1Q3U A;  3K1R B;  1TK5 A;  5AZG A;  3GZN B;  2R2O A;  2LGX A;  3V60 A;  8ICO A;  4IM3 A;  4WQM A;  2BW2 A;  1FNU A;  1C78 A;  3C23 A;  1N61 A;  1O08 A;  2NRV A;  3SEB A;  4W9C A;  4RT3 A;  4I2F A;  2V4R A;  2D07 B;  5KFO A;  5ALJ A;  2GO7 A;  4II2 B;  2IGD A;  4L2Y A;  5J18 A;  3M9M B;  2DX5 B;  3IG3 A;  3TI0 A;  4NY0 A;  3C5G A;  4A8X C;  4DHZ B;  1PQS A;  1L2N A;  3DOW A;  5GTI U;  5KT3 A;  3UQA A;  4QZE A;  3Q8K A;  1Z19 A;  3F2C A;  3THV A;  4KLL A;  2KDM A;  2V3N A;  2VJ5 A;  3T9L A;  4E3C A;  2H3V A;  2IY0 B;  3LWL A;  2IOF K;  5AM0 A;  1GB4 A;  1GPX A;  5KT7 A;  4PH5 A;  2WF5 A;  1J8C A;  3DWM A;  4Q2J A;  4PZN A;  1E7P B;  3C2L A;  1IGC A;  4B0E A;  2VJ4 A;  4AP9 A;  2BB6 A;  2D3A A;  2B21 A;  5D3I B;  5BO4 B;  5BYS A;  4W9G A;  2N0S B;  5CHW A;  3ONS A;  1DGJ A;  2RLT A;  4RQ6 A;  1WX7 A;  3MJW A;  4UB1 A;  3IT4 B;  2WF8 A;  1L7P A;  2BQU A;  1S77 D;  1TZ1 A;  4PHA A;  4JMU A;  1L8O A;  2IYD B;  4O3Q A;  4M0W B;  3FC4 A;  5DG7 A;  5KFG A;  4I28 A;  1L0X B;  5AKZ A;  5ALO A;  5AKX A;  2SEB D;  2W11 A;  2V0G A;  3OAW A;  1ZYQ A;  1P7E A;  3NY5 A;  1HEK A;  4BAX A;  5JXV A;  5DDY A;  5KT5 A;  1PGA A;  4HJK A;  3HP6 A;  5G55 A;  4GC7 A;  1P1A A;  2MQJ A;  3K9P B;  4F50 A;  4O9M A;  2OYY A;  1DXS A;  3PO4 A;  3Q3N C;  2G1E A;  2WXG A;  3WCQ A;  2DWQ A;  1SF0 A;  2MSE D;  1IXR A;  5DG8 A;  5CA7 A;  2HOQ A;  3DHI C;  1PVP A;  2NTT A;  2OED A;  3G6Y A;  3C2M A;  2DEN B;  3APF A;  5KG4 A;  3BVM A;  4ANW A;  2IPK D;  1NOM A;  2JUO A;  2MBB B;  2ZTC A;  3ED5 A;  2FMS A;  2LM4 A;  3PST A;  2KDI A;  5KL1 B;  4M6W A;  3IAM 1;  3SD7 A;  5KG0 A;  1TT5 B;  1IV8 A;  4ZRK A;  3F5E A;  2AWT A;  3UIO B;  1AW7 A;  1QOF A;  2CS4 A;  4OJP A;  1K1S A;  3OPX A;  3VTV A;  2AX5 A;  4DBG A;  5IKC M;  4BFR A;  4ECW A;  1TFR A;  1ARO P;  8ICJ A;  1QIL A;  2JZZ A;  1SV0 C;  4C56 C;  1L6N A;  1UZX B;  3A1Q A;  1ZQV A;  3M9O B;  4HCP B;  2R8J A;  4OVV A;  1BPX A;  2P6R A;  9ICA A;  1ESF A;  3AMZ A;  1YIW A;  4S17 A;  2N9K A;  2K60 A;  1CRX A;  4JUZ A;  1WCN A;  2CHW A;  2QMT A;  3UIP B;  1VZ7 A;  4M8N A;  4WQO B;  3OHA A;  1V38 A;  3PO5 A;  3VAW A;  1KRH A;  1XO1 A;  5AKI A;  4EBD A;  4ECZ A;  1TAM A;  3A9K B;  5LXI B;  5L1J A;  4WWM A;  1MI0 A;  2EDU A;  1KFD A;  2E1F A;  2OH2 A;  2K8A A;  4RQ4 A;  5KFS A;  1UHU A;  3AXC A;  2K3U A;  3N1Y C;  1UQV A;  2E5S A;  4NJ6 A;  2MRL A;  2HI0 A;  2LUE A;  4JWS C;  1R7S A;  3TEY A;  1RYR A;  4UW9 A;  9ICP A;  3TJP A;  4K1R B;  1B0X A;  2H3I A;  2Y9U A;  9ICI A;  2BDU A;  3WAO A;  3M7D A;  3JW0 X;  4NLC A;  1I4H A;  3B2F A;  1HXY D;  9ICH A;  1QLB B;  3R2I A;  1KH0 A;  2KTF A;  4ICV A;  1A70 A;  1XEE A;  4DL5 A;  4KLT A;  4KX6 B;  4QJF B;  8ICU A;  4RQM A;  2C2R A;  5J0P A;  3Q8C A;  5KHO A;  4TUU A;  4DFK A;  4F92 B;  2Q4T A;  5F9L A;  1QZE A;  5J2F A;  1TBE A;  1KFS A;  4FJZ A;  1TKE A;  3NTU A;  4GXK A;  4M9H A;  3AEE B;  3ML8 A;  2MP2 A;  2ZXI A;  3C19 A;  2JZP A;  4R3D A;  2F3N A;  4IWO A;  3H1U A;  4BUG A;  2A4Z A;  1ZUD 2;  3DVG X;  1ZJN A;  4DQI A;  4KX3 A;  5ALS A;  1XXG A;  2YB4 A;  3HIL A;  8ICT A;  4IQW A;  4OW0 A;  4MSQ B;  4M6W B;  1XQQ A;  3MHS D;  4WJO A;  3TEW A;  2B6G A;  4A3O A;  3SQI A;  3PGE A;  2FID A;  5L83 A;  1T0Q C;  5KFH A;  4ACF A;  2DF4 B;  1OTR B;  3VRA B;  4EZJ A;  4CE6 A;  1A5R A;  1WR1 A;  2YN4 A;  4KLU A;  2KP7 A;  4ASW C;  2SAK A;  1WZ0 A;  4GOC A;  3W1S A;  3A1Q B;  3I9V 1;  5ALH A;  1NK8 A;  2INC C;  1YD8 U;  3N32 A;  2YMP A;  3KOO A;  4A8E A;  5III A;  1HUO A;  3TEX A;  5I4D A;  3P4P B;  2H3Q A;  7ICV A;  3B0X A;  5HHH A;  2LWP A;  2KKV A;  3BZC A;  5J8Y C;  5KFP A;  3N9Y C;  4CYE A;  2GLS A;  4FZN A;  1X9M A;  2K9X A;  3D2S A;  2WP9 B;  1NK6 A;  1KQQ A;  5DB8 A;  2J0J A;  5D49 A;  3VH4 B;  1NJX A;  4DDI D;  4Y2S A;  1WCL A;  2XC9 A;  5D3D A;  1IYF A;  2EZY A;  2C7M B;  2DPI A;  1PDX A;  2WS3 B;  1QF6 A;  1UNS A;  4AUQ C;  4EFO A;  2FMQ A;  2KFN A;  2W03 A;  3PRZ A;  3RBE A;  2KE7 A;  5ALZ A;  2JX5 A;  1N2X A;  2XCP A;  4QW9 A;  3L4P A;  3ZQ4 A;  3QYP A;  3A0B U;  4XYC A;  4M0A A;  4OVU A;  2XNA C;  4LJP B;  5EE0 A;  1Q0W B;  1BNO A;  8ICC A;  1XSP A;  4F72 A;  2NRW A;  2CHX A;  4NPN A;  2VZK D;  2HJ1 A;  3TKA A;  1C4A A;  2ZIW B;  2KN4 A;  2BQR A;  3KHG A;  2QDF A;  4B9K A;  2AEH A;  1FXA A;  8ICI A;  4Y2Q A;  1YJ1 A;  1UT5 A;  9ICV A;  1TS3 A;  2KO3 A;  3ABV B;  1TZO A;  5J2B A;  4FBU A;  7ICK A;  2I38 A;  1DGS A;  4F5P A;  3BIN A;  2CR5 A;  2MP2 B;  3NRZ A;  5AKH A;  4GMV A;  4KSL C;  2Z0E B;  2BDP A;  5C0Y A;  1P7F A;  2KDE B;  4DHJ D;  1J97 A;  3PV8 A;  3RJF A;  2LBO A;  3OSP A;  1VZ8 A;  4CQN A;  4HAI A;  5IIN A;  2XK5 A;  3W9C B;  1RYS A;  8ICG A;  1IGD A;  1RM6 C;  4QZB A;  4OZA A;  1LV5 A;  2M56 B;  5J17 A;  2PFP A;  4JPS A;  8ICA A;  2K8C B;  3H0M B;  4F2R A;  2UVW A;  1NJY A;  2OM6 A;  5HG2 A;  1SV4 A;  2MCN B;  3VTW A;  1SL1 A;  2WWZ A;  3RNF C;  1MA7 A;  4ED3 A;  1M4V A;  4WH4 A;  3RH5 A;  1WH3 A;  1DOY A;  5DQG A;  4OJO A;  5AI4 A;  5L9X A;  2V9W A;  4AS1 A;  1WGK A;  4JWU C;  1COO A;  3ZDA A;  3KUD B;  1ZQ1 C;  2NRZ A;  3SAH A;  4CGZ A;  3C5F A;  2NV3 A;  4HPM B;  2ON8 A;  1V49 A;  3AE5 B;  3LYS A;  2LUM A;  5E6N A;  1WJ6 A;  4A55 A;  4XUS A;  2D3B A;  4B0M A;  4OD0 A;  3QAR A;  3WKE A;  2RDJ A;  1J0G A;  4J9K A;  1E5W A;  5FKA C;  2KHQ A;  2AYO B;  4YSX B;  2G4S A;  3B08 A;  3RJH A;  3UQ0 A;  4AQ7 A;  3I3T B;  1NDD A;  2WF6 A;  2BVC A;  1ZQZ A;  5ALE A;  2BCQ A;  3FIL A;  3V6C B;  3Q8E A;  1KOT A;  3MGV A;  1PVQ A;  2ZUB A;  1RYJ A;  2AU0 A;  3P4R B;  3NAS A;  3RPF C;  2JRZ A;  3AE8 B;  1LM8 B;  2WXQ A;  1PUZ A;  4DL2 A;  2ZIV A;  1TTN A;  3PZD A;  1T0S C;  1Z4N A;  5AUI A;  4LNK A;  2LKY A;  3PZ8 A;  1XS9 D;  3Q8L A;  3ALR A;  4M8M A;  4DQQ A;  2BKR B;  3RH6 A;  1L3V A;  2AXT U;  4J9P A;  2BPG A;  1WF9 A;  2EMT A;  2ICI A;  1KJT A;  1EF1 A;  1RG6 A;  2ZJA A;  4UAR A;  1WMH A;  1R4M I;  2CU1 A;  4HDQ A;  1CMX B;  3RNC C;  4ICA A;  4ZRJ A;  2ZTD A;  5KG5 A;  4HLE A;  4I2D A;  1E90 A;  7ICJ A;  1L6U A;  5C1Z A;  3PSE B;  3Q8R B;  1UWM A;  2QKQ A;  3DV9 A;  2YLM A;  3KQ4 A;  2XK5 B;  1PK1 A;  4RGT A;  1QOB A;  2ES6 A;  1FO4 A;  1SV0 A;  2V3P A;  4M2Y A;  2GB1 A;  4BVU C;  2JSV X;  4LDT D;  2XCA A;  3RJJ A;  1IBX A;  1ZOL A;  1HZ5 A;  2BS2 B;  3O0F A;  3PVL A;  1S76 D;  2KWU B;  4TKN A;  5DBA A;  4YR2 A;  2KZ3 A;  5AKE A;  4E74 A;  2DKX A;  4RNO A;  2CRX A;  2RDB C;  1LKY B;  2LI5 A;  8ICP A;  3GE8 C;  3UIN B;  5ALQ A;  2H5X A;  2VZK B;  2C7N B;  2NO5 A;  3PZ7 A;  3VUX A;  3W1Y A;  3R7Q A;  2BHN A;  1H4R A;  4FUL A;  1BVS A;  4OZB A;  1T7P A;  5KG1 A;  3GOE A;  1KSP A;  4KLG A;  5EWF A;  2ACZ B;  1D4B A;  3UQB A;  2E8N A;  1P9D U;  1TK0 A;  3TMP B;  1PK3 A;  4R8U A;  1IM4 A;  4QZA A;  4WUR A;  2KVR A;  2R18 A;  1KTQ A;  2BKE A;  2ZW1 A;  3VHT C;  2MH7 A;  2R2Q A;  2M19 A;  3V7K A;  2VA3 A;  3Q3J A;  3CIR B;  4DHJ B;  2RSU A;  2ASD A;  5CJ7 A;  7ICE A;  4YTP B;  2LEK A;  2GMI C;  3ZRC A;  3RRH A;  3RR8 A;  1TY0 A;  5JUM A;  8ICS A;  1FM0 D;  2F2A B;  3AEB B;  2IDY A;  2N7E A;  2L05 A;  2C9W B;  4YL8 A;  2MBH A;  1NVI D;  4Y2Y A;  3ONN A;  1S97 A;  2G9H D;  2W54 A;  4RQ7 A;  2D3D A;  4JWN A;  1V81 A;  1URJ A;  3JSV A;  3M8S A;  1LB2 B;  4LNN A;  2P66 A;  4DL3 A;  3PO0 A;  4BKS D;  4YD2 A;  2P6U A;  5L1L A;  2J6S A;  2BCR A;  4UBC A;  3Q3F A;  1FPY A;  4LZG A;  3PX6 A;  4LTU A;  1NYQ A;  4ELT A;  4GU2 A;  2WHE A;  4HKQ A;  1KRP A;  2YQE A;  1KN5 A;  2BPS A;  3HRD D;  2KK0 A;  4UB5 A;  3L17 A;  2IBK A;  4JGH B;  1KFY B;  2OCE A;  2WXR A;  3X0W A;  3UPQ A;  1EO6 A;  1PK1 B;  2L8J A;  2WB1 F;  2ZIU A;  2EAO A;  1J7B A;  3NRW A;  3A9J B;  4P7I A;  1IBX B;  4ED1 A;  4QZI A;  3UMG A;  2N9E B;  5KG6 A;  3RFA A;  4YG2 A;  5DGB A;  1NK5 A;  7ICI A;  1C4P A;  4DS5 A;  2NVU I;  1I7H A;  1T8E A;  1ZE3 D;  4DWI A;  2KXJ A;  1FRR A;  4YT0 B;  1L0V B;  4PZO A;  1ZQW A;  2HHV A;  2AL3 A;  2KOX A;  3SZ2 A;  3ZNH B;  9ICC A;  3F2D A;  4N58 A;  5IO9 A;  4JE3 B;  2IZV B;  2KD1 A;  2W9A A;  4QIW F;  2ESE A;  1ZGU B;  3M95 A;  4OO1 J;  3TAQ A;  4I6P A;  3KHR A;  3RNA C;  2Y0S F;  4PPX A;  3QUQ A;  1X1M A;  2F44 A;  2WFA A;  2YML A;  1ZD4 A;  1C4C A;  1D3Z A;  2L3Z A;  3PW7 A;  2JVC A;  3AU6 A;  3R66 C;  5ALL A;  4C8O A;  1A76 A;  4IR9 A;  2BBC A;  3D2N A;  5KFJ A;  4F4X A;  3T5K A;  2FI1 A;  1I4X A;  1FEZ A;  1KFT A;  3EFC A;  1T94 A;  4DSJ A;  4ANX A;  4FFD A;  2M0X A;  5HP4 A;  5K4L A;  2IGH A;  3QQ8 B;  4UB4 A;  2LZ6 A;  5KFI A;  4QZD A;  3ENE A;  1N62 A;  2D8C A;  3Q2A C;  3ZYY X;  4C8N A;  1YMH E;  1E0Z A;  3R2T A;  4GLX A;  4JV1 A;  1HQR D;  1F1H A;  2KIV A;  3OJS A;  2DYM A;  2W9C A;  5IAA C;  5IN7 A;  1GO3 F;  2FJ6 A;  2KDF B;  1SGG A;  2MUT B;  2KDB A;  2JRH A;  2QC8 A;  5AKK A;  1DYQ A;  3ETR A;  3JSV B;  4EZK A;  3M63 B;  1RQL A;  4BOS C;  4S0R A;  3ZNG C;  2ZPY A;  2F1J A;  1EXN A;  2PMZ F;  7ICP A;  4BWJ A;  1U45 A;  1ZET A;  2KFK A;  4OJ5 A;  3DBR B;  3MFH A;  2ZZP B;  1QKZ A;  2E8O A;  2QB1 A;  2LHE A;  1ZQY A;  5AHX A;  2WF9 A;  3M1Y A;  3AEG B;  3F2B A;  3MR5 A;  2D6F C;  2ZUD A;  2D10 A;  2KZM A;  1V80 A;  3ZTD A;  3OHB A;  4KSK C;  2W9N A;  4EZ9 A;  2BGF A;  3AEA B;  1GC7 A;  2G06 A;  2ZIX A;  3D6J A;  4KZ0 A;  3EUB 2;  1ZQB A;  4QZ8 A;  4PYU A;  4ZRQ A;  2JT4 B;  5KG7 A;  1L3S A;  1BPE A;  2ZIU B;  4G50 A;  4B9V A;  2W7P A;  3AN1 A;  4NJ7 A;  4RH6 A;  2KNB A;  5KFV A;  3FAH A;  2OEH A;  3WIM A;  1U4A A;  4AYB F;  3OSN A;  2F77 X;  3KTQ A;  4C8M A;  4ECR A;  4F91 B;  3RH4 A;  4JV2 A;  3MC8 A;  2KD0 A;  3PSF A;  3C21 A;  4QZH A;  3ZJV A;  1NJZ A;  3BQ1 A;  4NAW A;  1KKX A;  4TUS A;  1SSN A;  2N9L A;  1ZPS A;  5DCN A;  3RRG A;  3ORY A;  3DBL B;  1B9R A;  2BYE A;  2P35 A;  2JGA A;  4IC7 B;  3RB0 A;  4Z6D A;  3KZI U;  1ZQR A;  1D9D A;  3AQE A;  4BXO B;  5HI1 A;  3RZF A;  4FXC A;  3HM3 A;  4Y2J A;  1GOZ A;  2WAQ F;  3IP4 B;  1BPY A;  1YX6 B;  2KC2 A;  2V9H A;  3N3K B;  5D2M B;  4EUT A;  3QZ8 A;  2MU2 A;  4XE0 A;  2BPC A;  1XO0 A;  3BII D;  1PGB A;  2CJN A;  2J42 A;  3W1S C;  4GDK A;  2N9P C;  3U7Z A;  5KFK A;  5HR6 A;  2MW5 A;  1KBU A;  4IL6 U;  3PW0 A;  3KYD D;  2W9C B;  4NWI A;  1WYW B;  7ICT A;  1OEY J;  3LWM A;  4F5R A;  2KQ4 X;  4U6P A;  7ICH A;  4DFJ A;  2H89 B;  1H38 A;  1KF6 B;  1XC9 A;  4RGM A;  1ZQJ A;  1OGW A;  2KMD A;  2WHI A;  3GFK B;  4O3P A;  3P42 A;  2K5P A;  8ICF A;  2I5H A;  2DUY A;  4CHK A;  3H8M A;  4LJX A;  4IWQ A;  1JX4 A;  3QEB Z;  1LXD A;  4G9B A;  1QOA A;  2KFZ A;  3ZVV A;  5JZE B;  3PY8 A;  5AIB A;  2LVQ A;  4TUP A;  4G3X B;  2UVV A;  4DLE A;  5J2G A;  4KDI C;  3MC0 B;  2G09 A;  2HBL A;  2XY7 A;  1UPH A;  1T6B X;  1HJP A;  1WFY A;  1WM2 A;  2BYF A;  1MHX A;  3RJI A;  3EFU A;  4IKG A;  5AKG A;  1ZQH A;  4J03 A;  2WXK A;  3PX4 A;  3BWU D;  1J2M A;  1V1O A;  2ZNV C;  4RPZ A;  3BS5 B;  4DK5 A;  5IP4 D;  4DQR A;  2C2E A;  3IN5 A;  4I2H A;  3E2E A;  1TY2 A;  2ZVO A;  4C80 A;  3P4S B;  9ICM A;  1K51 A;  4NAW B;  2QB0 B;  3H7P B;  2KWV B;  2E1E A;  3EZ5 A;  4NY8 A;  3K1Z A;  1CEZ A;  3Q6B A;  4BBN F;  2W9M A;  2VH2 A;  1FXI A;  3N7S C;  2MJE A;  3GU3 A;  2ASJ A;  1WR6 E;  3HJE A;  3ISB A;  2LYH A;  2W8K A;  4HYK A;  1Q3V A;  1GG3 A;  4BX9 C;  2NPT A;  4WWP A;  3ZLZ A;  4BDP A;  3Q8B A;  3HUI A;  1UA1 A;  3PV1 A;  3HVZ A;  2KIC A;  4RFB A;  2KC1 A;  5L1K A;  1OUQ A;  3WU2 U;  2RGF A;  4HJG E;  1ZJM A;  1SWW A;  2QSD A;  2FMP A;  9ICT A;  3QU9 A;  5CP2 A;  2QIE B;  3PRP B;  2K6Q A;  3MGI A;  4U7C A;  3BJY A;  3ECI A;  4URK A;  1WXM A;  4ZDV A;  2G07 A;  1AWD A;  4QWC A;  2W3R A;  3BQT A;  2WXI A;  5F9N A;  5BOM A;  1XSL A;  4IM2 A;  4FA6 A;  1LO5 D;  3P1M A;  2G5I B;  2L52 A;  3JPS A;  2K1F A;  1Y88 A;  1YJI A;  2JEG A;  3H40 A;  2KLC A;  4Q8E A;  4ICU A;  5EDS A;  2JRI B;  4J9O A;  2ZPN A;  1XF5 L;  5J2R A;  4DHZ E;  2GBK A;  5TSS A;  1ZOY B;  4DOA A;  1QSS A;  3SV4 A;  3UMB A;  2MA1 A;  1S9F A;  2LMR A;  4C8L A;  1VJK A;  2EH9 A;  2INP E;  2KG5 A;  2IO2 B;  1QLN A;  2EZZ A;  3NUH B;  3L3F X;  3QJZ A;  2LAS A;  1L0Y B;  2KAC A;  2KJH B;  2WLB A;  4ED2 A;  4KIT B;  2I9G A;  4B9L A;  1EM7 A;  2XI9 A;  2IND C;  3MR3 A;  1NKB A;  2KV2 A;  1X9W A;  3AEF B;  4ELU A;  3LYY A;  4RGO S;  4EKU A;  4YN4 A;  4YTN B;  4QZG A;  4DS4 A;  3PHX B;  2K22 A;  3UXO A;  5KFD A;  2GBJ A;  4PHE A;  3Q8S B;  3RYT A;  5C3J B;  2HD5 B;  4K4I A;  2K8H A;  4K7S A;  1S0N A;  3EW9 A;  2YEP B;  4B95 A;  4HRO A;  3GQC A;  5KFM A;  1LFD A;  4DSI A;  1MG4 A;  1ZQO A;  4C4T A;  4KGR A;  4WWO A;  3P4Q B;  3NVY A;  2PFO A;  4JLC A;  3N7R C;  4RNM A;  1ZQD A;  1Z00 A;  3LK9 A;  2HHS A;  4JIO U;  4IQU A;  5D6J B;  4I29 A;  2WXP A;  4AP4 C;  4MAC A;  4YMN A;  3ZTC A;  1XWL A;  1R4N B;  1QCK A;  4A6Q A;  4DXG A;  1PZN A;  3ZNI D;  4DL7 A;  3RUL A;  3LB8 C;  4TQR A;  1AYF A;  2E6X A;  3H0R B;  4ED6 A;  2FE9 A;  3IFW B;  1NEK B;  2NPT B;  4F2S A;  3QX7 A;  2FIF A;  3DBH I;  2RDH A;  1ED1 A;  2BB5 A;  1NK0 A;  2IO1 B;  4O5E A;  3AE2 B;  1WXA A;  2PW9 A;  1ZQT A;  3L0W B;  3L13 A;  4WJP A;  1ZQA A;  4DOC A;  2Z59 B;  2KMA A;  4EOY A;  2DYB A;  3L08 A;  2KAJ A;  4ANU A;  1XLO A;  1TYG B;  3CST A;  4EEN A;  3V6E B;  3NS8 A;  4O3S A;  3ZDE A;  2IGG A;  2KWD A;  4Z6C A;  3WK8 A;  4QAY A;  2KT7 A;  3MP9 A;  4CNQ A;  2LPE A;  1TAQ A;  2IOH A;  1ENF A;  1VDV A;  1KL9 A;  5DQI A;  1V5O A;  4II3 B;  4LJO B;  3BQ2 A;  4M01 A;  1OQQ A;  3HKZ C;  2CU3 A;  3UMC A;  2RPQ A;  1RXV A;  2PKO A;  4NZL B;  1RZT A; 
#chains in the Genus database with same CATH homology
 2Q5W D;  2ON8 A;  1B1Z A;  3AE5 B;  2LUM A;  3AE4 B;  4LK0 M;  4A55 A;  4B0M A;  2BS3 B;  1L5P A;  3Q8F A;  2QIL A;  3HVD A;  5FKA C;  3U52 E;  2J53 A;  4YSX B;  3P63 A;  1I4P A;  2YEP F;  3RFZ B;  4XDD A;  4AQ7 A;  4ZRP A;  1PUT A;  1WSP A;  3LXF A;  3SFE B;  3FIL A;  2R61 A;  2LFI A;  3AM9 A;  3Q8E A;  1STE A;  1RYJ A;  3AE7 B;  3BYY B;  3P4R B;  5HHD G;  2PTL A;  3RPF C;  4JX1 C;  2INN E;  3AE8 B;  2WXQ A;  4N59 A;  3AE9 B;  1D5Z C;  1AN8 A;  4L23 A;  5AUI A;  3PZ8 A;  3NVZ A;  1C9F A;  1YNT E;  1QOG A;  4GDK B;  2ICI A;  2K0P A;  1DOX A;  1VZ6 A;  4LLG M;  4IDI A;  3B2G A;  3C8Y A;  4PT5 A;  5MPO A;  1E9M A;  3V05 A;  3DWG C;  2Z8L A;  2ONQ A;  1D5X C;  1L6U A;  1CK1 A;  1ZXI A;  3GS2 A;  5BMH A;  2QJL A;  1JWB D;  3IXS A;  1Q10 A;  1SEB D;  5G5H A;  3KQ4 A;  1UWM A;  4ARC A;  5BYQ A;  1K52 A;  2ZW0 A;  4RGT A;  1BML C;  1QOB A;  1FO4 A;  1WXQ A;  2N7J A;  1I4Q A;  4D2K A;  2PVG C;  2V3P A;  2GB1 A;  2DBY A;  2JSV X;  3U4E G;  2JWU A;  1IBX A;  1HZ5 A;  1WYG A;  2BS2 B;  2FBW B;  5E6J A;  3E56 A;  5BMI A;  4P16 A;  1YN5 A;  2VZK B;  1EWC A;  3PZ7 A;  2WDR B;  1ET9 A;  3BK2 A;  1L4D B;  3BK1 A;  3KWL A;  4OZB A;  4USA A;  1TKY A;  2RDG A;  2V4I B;  2D5G A;  5EE3 A;  4HRS A;  4TMA B;  2ACZ B;  2IJ0 A;  1D4B A;  1VLB A;  3SR6 A;  4GDL B;  3U2S C;  2WXL A;  1I4R A;  4WUR A;  2JU6 X;  4OHJ A;  3VR9 B;  3ZYY X;  2ZW1 A;  2MH7 A;  3BYT B;  4P6V F;  1JWA D;  2M19 A;  2PVO D;  3CIR B;  1F0Z A;  4US8 A;  3VR8 B;  1JRO A;  4YTM B;  4YTP B;  3BVZ A;  1F77 A;  2JXT A;  2LEK A;  1SJE D;  2LJI A;  1GAQ B;  1TY0 A;  4O1N A;  3AEC B;  3I57 A;  2E3T A;  2MEK A;  3MHZ A;  2I2Y A;  3W2D A;  1FM0 D;  1F2R I;  3AEB B;  3VQI A;  2IDY A;  1J7C A;  3AE6 B;  1D5M C;  3IAS 1;  1V1P A;  4YXD B;  5FR3 A;  1SE2 A;  4REZ A;  5EE1 A;  1NVI D;  1VR9 A;  2G9H D;  4HKZ E;  1JWM D;  2PLP A;  4ARI A;  2W54 A;  2WU2 B;  4YWG G;  1JQ4 A;  4WIP A;  1EU3 A;  1NI3 A;  1ZP0 B;  3PO0 A;  4TQ0 A;  2AQ3 B;  1D6E C;  4LTU A;  1NYQ A;  2BT6 A;  4HKQ A;  1UWX A;  2Y5C A;  3AED B;  3HRD D;  4NAM A;  3TSS A;  3UI3 A;  1KFY B;  3E9S A;  1YJJ A;  2WXR A;  1SBB B;  2WXN A;  2W55 A;  4N6E B;  1J7A A;  4ITK A;  1EU4 A;  1J7B A;  2BTE A;  1IBX B;  1K53 A;  1SIJ A;  3ZGZ A;  1C4P A;  1KLG D;  1I7H A;  1ZE3 D;  4YT0 B;  1FRR A;  1L0V B;  1FNV A;  5BYR A;  3B9J A;  4RCO A;  1UGJ A;  3TUO A;  4WAF A;  4N58 A;  1CJE A;  4JE3 B;  1TJE A;  1V8C A;  3BVG A;  1SE3 A;  2TSS A;  1XCT L;  4HEA 1;  2AQ2 B;  1Y56 A;  1C4C A;  4L1B A;  2JQR B;  3NVW A;  2NTS A;  2BYT A;  1T3Q A;  1N5X A;  2XN9 C;  2BBC A;  1I4X A;  4WQM A;  2BW2 A;  1FNU A;  1C78 A;  1N61 A;  2WXJ A;  2EKI A;  2HTM E;  3SEB A;  2IGH A;  3ZJU A;  2AQ1 B;  2LGI A;  4DXF A;  2IGD A;  4L2Y A;  1FEH A;  2CJO A;  1N62 A;  1YMH E;  1E0Z A;  4A8X C;  1VRA B;  3R2T A;  4KGS A;  1HQR D;  2DYM A;  3NZ3 A;  1WRI A;  1V1P B;  3EGR A;  2V3N A;  1JRP A;  2KDM A;  5H92 C;  3V3X A;  1MVK A;  1DYQ A;  1K50 A;  2W82 A;  3ETR A;  4KKI A;  1GB4 A;  2WDQ B;  1GPX A;  4EE2 A;  3DWM A;  4Q2J A;  1E7P B;  2BS4 B;  1WWT A;  4XWW A;  1IGC A;  4B0E A;  2RPV A;  1BXT A;  1QKZ A;  1KTK A;  1JWS D;  2LHE A;  2BB6 A;  1N63 A;  4RF1 A;  3URY A;  5D3I B;  1NYR A;  5BYS A;  2DYO A;  2N0S B;  3AEG B;  1UUP A;  5LNK 1;  1DGJ A;  1RWS A;  4RF0 A;  3IT4 B;  3AEA B;  2EEL A;  3GP7 A;  1ZXH A;  3AV8 A;  1FRD A;  2GRI A;  1FFV A;  3EUB 2;  3FC4 A;  4ZRQ A;  2Y3A A;  4A9A A;  1L0X B;  2SEB D;  2V0G A;  1P7E A;  3Q69 A;  3AN1 A;  4NJC A;  3O13 A;  4RH6 A;  5JXV A;  3FAH A;  1PGA A;  4ZHP A;  2J4X A;  5H8Y E;  1KLU D;  3VRB B;  1L6V A;  2L32 A;  4UDU C;  2G1E A;  2WXG A;  3WCQ A;  2DWQ A;  3ZJV A;  1SF0 A;  3FIL B;  4IOI E;  1SSN A;  2N9L A;  1ZPS A;  1T5X D;  1FCC C;  1B9R A;  2NTT A;  2OED A;  4XDC A;  3BVM A;  2IPK D;  1XO3 A;  4GLS C;  4MH8 A;  4J3O D;  1PYW D;  5HI1 A;  4FXC A;  5FK9 C;  3CWI A;  1GOZ A;  3KLS X;  3IAM 1;  4XE0 A;  3BII D;  1PGB A;  2CJN A;  2J42 A;  5EE9 A;  3AB5 A;  1CZP A;  1AW7 A;  1QOF A;  4DQO C;  3U7Z A;  1ET6 A;  2AX5 A;  1JWU D;  1MHH E;  2PIA A;  5BMG A;  1QIL A;  4C56 C;  1FD6 A;  2KQ4 X;  2WU5 B;  1HEZ E;  5T8I A;  1ESF A;  1N5W A;  3AMZ A;  1SB3 C;  3MJ5 A;  2N9K A;  2H89 B;  1XLN A;  1CQV A;  1KF6 B;  4TSS A;  4YSZ B;  1JW9 D;  4H2A A;  2QMT A;  4OVZ A;  4RGM A;  1FFU A;  1VZ7 A;  4A90 A;  1E6E B;  3MFG A;  1KRH A;  3P42 A;  2K5P A;  4WWM A;  1MI0 A;  1QOA A;  3NVV A;  2K3U A;  4US9 A;  4JWS C;  1R7S A;  3TEY A;  2Y5P A;  3MC0 B;  1T6B X;  1C76 A;  1MHX A;  3R8B A;  4MT5 A;  4IKG A;  2B76 B;  1I4H A;  2WXK A;  3B2F A;  1HXY D;  1QLB B;  1NEN B;  2L83 A;  3BWU D;  1V1O A;  3IT6 B;  1V97 A;  1KH0 A;  3R2I A;  1TS2 A;  2WXM A;  3NS1 A;  1A70 A;  1TY2 A;  2OHF A;  1XEE A;  2M0A A;  4KX6 B;  4C80 A;  1FMA D;  3P4S B;  3Q8C A;  1K51 A;  4NAW B;  1I4G A;  1SJH D;  2X38 A;  3AE1 B;  4MM3 B;  1TKE A;  5D7G A;  1FXI A;  3AEE B;  1E10 A;  1JAL A;  1QT9 A;  2MJE A;  5HFY A;  4C7Y A;  4KKJ A;  2HDE A;  2JZP A;  5G5G A;  2MJ3 A;  3J9C A;  3Q8B A;  3HUI A;  3AE3 B;  2RMM A;  4R3D A;  3HVZ A;  1ZUD 2;  1XXG A;  4RFB A;  4HJG E;  2QSD A;  1OQR A;  4KGT A;  1YN4 A;  4OW0 A;  3TEW A;  2QIE B;  1PGX A;  1L4Z B;  1F2R C;  1AWD A;  2WXF A;  2W3R A;  2WXI A;  2QEJ C;  2WXO A;  3VRA B;  1LO5 D;  1XCQ L;  3P1M A;  2JYE A;  2L52 A;  2SAK A;  3GB1 A;  3W1S A;  3Q8A A;  1YJI A;  3I9V 1;  1JML A;  1PFD A;  1TS5 A;  1XF5 L;  2WNM A;  2JYT A;  5TSS A;  1ZOY B;  2FUG 1;  4TQ1 A;  3KWV A;  1BUI C;  3TEX A;  5I4D A;  3T3N A;  3P4P B;  1VJK A;  2FE8 A;  1IUE A;  2INP E;  3NUH B;  2WLB A;  1L0Y B;  1SE4 A;  1XLP A;  2KAC A;  3N9Y C;  2K9X A;  2WP9 B;  1XLQ A;  1EM7 A;  5D3D A;  1JCK B;  2WS3 B;  1QF6 A;  1PDX A;  2WDV B;  1YQ4 B;  1FIQ A;  3AEF B;  1UNS A;  4RGO S;  1QQR A;  1TS4 A;  3LYY A;  5GXG B;  4YTN B;  3SFD B;  4XWT A;  2K22 A;  4ZOH C;  1ACC A;  1HZ6 A;  3W5V B;  5C3J B;  1C77 A;  2JX5 A;  5C2T B;  4OZC A;  3L4P A;  3ZQ4 A;  2YEP B;  4HRO A;  2PMV A;  2XNA C;  2J52 A;  2GI9 A;  5EE0 A;  4ZHO A;  4C7Z A;  1RFK A;  2W3S A;  2VZK D;  1C4A A;  2KN4 A;  4KGR A;  3P4Q B;  2MJD A;  3NVY A;  3TEZ A;  1FXA A;  1DOI A;  1TS3 A;  1YQ3 B;  2WXP A;  3ABV B;  1TZO A;  4MAC A;  1OFF A;  2I38 A;  2H88 B;  4A6Q A;  4DXG A;  4RNA A;  3LB8 C;  1AYF A;  4ZYS A;  3NRZ A;  3W5U B;  2E6X A;  1EWY C;  4YSY B;  2WQY B;  1NEK B;  1P7F A;  2RDH A;  2DLB A;  3EA6 A;  2BB5 A;  1VZ8 A;  4CQN A;  3AE2 B;  3W9C B;  2NMQ A;  2PW9 A;  1FCL A;  1IGD A;  3AH7 A;  1RM6 C;  1ZDV A;  1ROE A;  3H8H A;  4OZA A;  2M56 B;  1GB1 A;  4JPS A;  3ZJT A;  5HG2 A;  2KAJ A;  1XLO A;  2LMC A;  1TYG B;  3BZD B;  2IGG A;  2KWD A;  1M4V A;  4WH4 A;  1HA5 A;  1MPE A;  1TKG A;  4RGN A;  2LHD A;  3MP9 A;  2KMM A;  1DOY A;  3T3O A;  1ENF A;  1VDV A;  3OWE B;  4M0W A;  4AS1 A;  1WGK A;  4JWU C;  1SXT A;  2L1A A;  1OQQ A;  1C79 A;  2CU3 A;  5AUK A;  1ZDX A;  2PKO A;  1YN3 A;  4NZL B;  1N60 A;  2WXH A;  1FNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...