1FFUA

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
155
Chain Sequence
KKIITVNVNGKAQEKAVEPRTLLIHFLREELNLTGAHIGCETSHCGACTVDIDGRSVKSCTHLAVQCDGSEVLTVEGLANKGVLHAVQEGFYKEHGLQCGFCTPGMLMRAYRFLQENPNPTEAEIRMGMTGNLCRCTGYQNIVKAVQYAARKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
total genus 45
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1ffuA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ffuA01
2JX5A 1FFVA 3SFEB 5MPOA 4ZOHC 3DWMA 3W9CB 1SB3C 4C80A 3SFDB 1N62A 3SR6A 1JALA 2HTME 1ZOYB 2MJDA 3P4PB 5C2TB 1EWYC 2KMMA 1TKEA 3BIID 1VLBA 2G1EA 2M19A 2OHFA 2WDVB 1JQ4A 3LB8C 1J7CA 1N5XA 2EKIA 2W55A 1RWSA 1YJJA 3NVWA 2W3RA 4YTMB 1QT9A 3B2GA 1JRPA 1PDXA 1L5PA 2M56B 3PO0A 1NYRA 4HRSA 3AEFB 1XO3A 3P1MA 1A70A 2K22A 4WQMA 3AEDB 4LTUA 1NYQA 5EE9A 2PKOA 1XLNA 3NVVA 3AE5B 5EE0A 1ROEA 1WYGA 4C7YA 1PUTA 2KAJA 1YQ3B 3AE9B 2Q5WD 3ABVB 3AEBB 2BS3B 1J7BA 1QOBA 2WS3B 3LXFA 4US8A 5EE3A 1XLPA 2BT6A 1IUEA 3ZYYX 3CWIA 4WWMA 3NS1A 1KFYB 1NEKB 1L6UA 3AE8B 1DOXA 3HUIA 2PIAA 1L6VA 3P4RB 4YSYB 2E3TA 2AX5A 1WRIA 1UWMA 4P6VF 5H92C 1WWTA 3RPFC 3P63A 1V8CA 1XLQA 3AEAB 1OQRA 3AH7A 3AE6B 5H8YE 1FM0D 1RYJA 2PVGC 1RM6C 2W54A 3AV8A 1SIJA 1N61A 3L4PA 2CJOA 1AWDA 1E9MA 2QIEB 3AECB 3AE3B 1NVID 2BS4B 1AYFA 4A9AA 1JWBD 5G5HA 4US9A 1FIQA 2WU5B 4JWSC 4KX6B 1JROA 5AUIA 1N60A 4YTPB 1KF6B 1VDVA 1NENB 5EE1A 3B9JA 1CZPA 1RFKA 2WQYB 2Y5CA 3DWGC 4N6EB 2DBYA 2WU2B 3NVZA 2DWQA 3AE1B 1FXIA 2H88B 2JQRB 2K9XA 1WXQA 1FFUA 4USAA 2WDQB 1GPXA 1J7AA 2BS2B 3FC4A 1DOIA 1YQ4B 2H89B 2MH7A 3VR9B 1DOYA 1NI3A 1TKYA 1OFFA 4ZHPA 1QF6A 1YJIA 1OQQA 1I7HA 1XLOA 5GXGB 1ZXIA 1TJEA 2L83A 1ZP0B 4JX1C 1B9RA 3EUB2 4YSZB 3VRAB 2WP9B 1V97A 3AE4B 2L52A 3HRDD 4ITKA 3AN1A 4YTNB 4C7ZA 2CJNA 2FBWB 1L0VB 1GAQB 2B76B 2MJEA 3KWLA 1FRRA 4JWUC 3AMZA 3AE7B 3VR8B 1VJKA 1JWAD 3WCQA 4ZHOA 4HROA 2LEKA 2CU3A 2WLBA 1E0ZA 1DGJA 3AM9A 1E7PB 1N5WA 5G5GA 1KRHA 2K5PA 4N58A 4YSXB 1ZUD2 1QOFA 4IDIA 1WGKA 3AEGB 1FRDA 3B2FA 1FXAA 4N59A 2QJLA 3VRBB 2MJ3A 2N0SB 5C3JB 3AE2B 1FO4A 3W5UB 5AUKA 1JW9D 4FXCA 1N63A 1TKGA 2ACZB 3P4SB 4YXDB 3CIRB 1F0ZA 1CJEA 3AEEB 1E6EB 2W3SA 1QLBB 1SF0A 3FAHA 1TYGB 2PVOD 2WDRB 3NVYA 1PFDA 3ETRA 3P4QB 4YT0B 1FMAD 1E10A 1T3QA 3HVZA 1QOAA 3NRZA 3AB5A 3W5VB 1R7SA 1QOGA
chains in the Genus database with same CATH superfamily
1FFVA 1ZPSA 5IP4D 4MF8A 1Z1BA 2HHQA 4A8XC 4DFMA 1IGDA 3X23A 4IG7B 4UBBA 3QJZA 5J0QA 4M6WA 2DZIA 3LK9A 3PT2B 2LVPA 4MSMB 4M02A 4FADA 2BCUA 2RP5A 2P35A 2FAZA 2Y9TA 8ICZA 1TK8A 3OJUA 1V9PA 1QQ6A 4QZ8A 3T3OA 2OM6A 4I2FA 2FMSA 4EUTA 1QSLA 1S9FA 2ZIVA 2D11A 1PVRA 1N6ZA 2KKCA 4HKZE 2C5LC 8ICHA 1XLNA 3A9KB 3GP7A 4KSLC 2EMSA 2AYOB 2KAJA 1D5ZC 4Y2UA 1ZQMA 4ECXA 1E5WA 2DLBA 3GS2A 4YFKA 4US8A 5E6PA 4RQ1A 2IBKA 1VZ8A 3JPPA 1Q8KA 4O3RA 1EO6A 2MUTB 1L6UA 2E5SA 2H3QA 1HUOA 4OZBA 1WRIA 5KFPA 2J52A 4YMMA 1WRDB 2DFLA 2K60A 5H92C 4W9DA 4I2JA 3AE6B 5KFFA 9ICRA 4PT5A 2W8KA 4LDTB 3EZ5A 1J0GA 1DOQA 1TS2A 2E6XA 3QARA 3QZ7A 2AGPA 1AROP 2BS4B 4UDUC 1FIQA 2SAKA 3N1XC 4DSEA 4AUQC 5E6NA 3LVWA 1CZPA 1RFKA 1EXNA 2RQ5A 3DV9A 2DBYA 4DFJA 1YNTE 2FIDA 3NVZA 4ANVA 1PGBA 1BPBA 4HCPB 2KX0A 4USAA 3GDXA 4W9GA 3E56A 1ZDVA 4Y2QA 1KW4A 5KFUA 3DBHB 1HEKA 1PGAA 4REZA 4UBCA 5IIJA 5KFOA 2RR9A 2K3UA 1XLOA 2KDFB 2W9CA 1EM7A 3ZDMC 3Q2AC 5KT7A 3D2QA 2FE8A 5ALPA 4BWJA 5CHGA 3ECIA 5KHOA 3VRAB 1URJA 3ZKJC 1TK0A 3E9SA 5EDSA 3MJ5A 5AKJA 5FP0A 4ECWA 2LHEA 3BWUD 4ITKA 3HHMA 1GJZA 2ZIWB 5AKHA 4EENA 5KFWA 2QILA 2P6RA 3DBLI 1M4VA 1WR1A 5KFNA 4HWIB 4W9CA 3EGRA 2F3NA 2WF5A 3SAFA 1OEYJ 2F44A 1TKDA 4ARIA 4IC7B 4DQQA 2MA9B 2LI5A 2NYVA 4OVZA 2LYBA 3Q8SB 1SL0A 4ACFA 4I2HA 1T6BX 5BMIA 9ICGA 2IMWP 7ICPA 1TTNA 1QCKA 4K7UA 1DGSA 1KTKA 2KYWA 2G45B 2KOXA 4C4VA 5ALIA 4O3NA 5BPCA 4WAFA 4QZFA 9ICLA 2LXAA 5L1JA 2DGZA 1XO1A 8ICMA 3J9CA 2DF4B 4RT2A 3M95A 4NQLB 4GXIA 5T14A 4QJFB 4RU9A 2AGOA 2RDIA 1SV4A 3C21A 5AI4A 2UVVA 2PI5A 2WDVB 2LRWA 1GB4A 4DHJD 7ICOA 2Z7JA 2I9GA 1WWVA 3UQ2A 7ICLA 3KUZA 4IM0A 4KLMA 2WAQF 3H8WA 9ICXA 4XRHA 1RLFA 3RJEA 2MBEA 3TMPB 2MLBA 5ALNA 3QQ8B 4DSIA 1NYRA 3I3TB 2LGSA 2UU7A 2LUMA 3PRPB 1UGMA 2KKPA 3ISCA 4ECRA 3VXWA 3KH0A 7ICSA 3ICXA 3TADC 5EE3A 2G08A 7ICRA 2KHQA 4TUSA 3V6CB 1DOXA 3GB1A 2JRIB 4JMUA 2MX2A 4EZ6A 1D3ZA 1C20A 2RSUA 1ACCA 2J53A 3Q8FA 2NR2A 4XZ4A 1ZETA 1KL9A 2LYHA 3L4PA 4JE3B 2OXOA 2KIVA 3CNHA 2CRXA 3KYCD 1SE9A 4DQRA 3OSNA 3JPRA 1NENB 3K9PB 3KWVA 4TQSA 5J0PA 2BZFA 3A9JA 4HVBA 5L9XA 2V9HA 4N6EB 2BKEA 3QU2A 2ZUCA 7ICKA 2FIFA 1L8OA 2G06A 2ZJAA 4CHKA 1LB2B 3VUXA 5KT3A 1T0YA 1LQBA 1FEZA 2W9MA 5KAFU 1ZQVA 3CF6E 3PGEA 4XDCA 4UB5A 1NI3A 4TUQA 4PJ0U 3A9KA 4LVSA 2N4FA 4E0DA 3OJ3A 3PTFC 1LKYA 4NL9A 3NGDA 3AU4A 3ISBA 3ZO5B 4IRKA 2HHTA 2L8JA 2L52A 4UASA 4HYKA 3PREA 4PH5A 2F1JA 2ZIXA 3VAWA 3G6XA 3TEXA 2GMIC 3QC8B 4DQPA 3DVGY 2FLNA 4ECTA 3N1YC 4F7ZA 2C7NB 5IIOA 4WH4A 1ZQNA 4NLGA 1FXAA 4BOZB 3IG8A 5AKGA 2AEHA 2KJ5A 8ICSA 4EEYA 3RB0A 3CW2C 3Q8LA 1E6EB 2W3SA 4IR1A 2WDRB 5E79U 3AB5A 4EOYA 1HTOA 1K53A 3TFRA 1A0PA 3GFKB 2WXPA 2EAPA 4J9OA 2DPJA 3CSTA 3ZXRA 1DYQA 4C0ZA 5J0WA 2KMMA 2PTLA 4BBNF 1KFSA 2YEPB 2RRDA 4HLEA 1ZQAA 4Y2RA 1S0OA 4B9KA 1JCKB 1PK3A 4RQ5A 5G2NA 1L3VA 4J3OD 4NJ7A 4GXJA 5ALXA 1Z5SB 1QLNA 3WU2U 2WXGA 2PI4A 3PR4A 3W1SA 1QILA 3PZ8A 1ET9A 3V7KA 8ICGA 4HXDA 2DUYA 5J2EA 4MGYE 3N1ZC 1YQ3B 2PFNA 4ELVA 2DZJA 2MEKA 3IG3A 4HCNB 4IWPA 5T8IA 3RT3B 2W9BA 1TGZB 3ML9A 8ICYA 3DQVA 1XCTL 3NS1A 3N32A 3ZJTA 1FNVA 2KJRA 3DVNV 4G11A 4OZCA 2JZ3B 2P6UA 1WCLA 3DDHA 3QEBZ 2IGGA 2BCRA 1OGWA 1K51A 2GB1A 4O1NA 1QTMA 1BPXA 5KT2A 1MJDA 2QIEB 4ZYSA 3C19A 1RZTA 1KLNA 1BXTA 3WKAA 3UIOB 3RJIA 4OCZA 5J2CA 2WU5B 4KX6B 4Y2SA 1WX9A 4QZDA 5J2HA 3UINB 2YB4A 4YXJA 3HKZC 1YZ6A 3S6JA 2JXTA 4AYBF 1UT8A 1X42A 2J6SA 5L1KA 3ZDEA 4XQ8A 1N56A 8ICRA 2ZG6A 3B0YA 1S97A 1T7PA 3AE1B 3JPOA 2W03A 3THVA 5K4LA 1ZQEA 1C78A 2DZKA 2KWCA 2W9NA 1JXEA 3L16A 2XICA 1NJYA 2DPIA 4S0RA 4HKQA 1SV0C 4RNMA 1U4AA 5J2FA 2AL6A 3KKAA 4DXAB 4FBJB 3UQAA 4NQKE 3GIMA 4K7SA 4U6PA 1ZXIA 4YMNA 4GLSC 4A8EA 1NJZA 1KSPA 4DLEA 1TAQA 4LZGA 1I4PA 3AE4B 3LDZE 4UB3A 4C7ZA 3H0MB 4HDQA 4MH0E 1FRRA 4OJLA 3RRHA 2CR5A 3WK4A 1H38A 1HUZA 2WLBA 4MH8A 1Z4NA 1WXAA 5DCNA 1ZQKA 3RJHA 4RM9A 2F77X 2MBQA 2KN7A 9ICJA 2R61A 3VRBB 1A77A 4F8RA 3QAQA 5HI1A 2KSOB 4KITB 4EEKA 3MHZA 4MEXA 3I57A 4HPMB 4II2B 1JW9D 2ICIA 1J97A 3ISDA 1UUPA 3BQ0A 5J2DA 1I4HA 2LMRA 1ED1A 1OEYA 3PHXB 3NRZA 1S76D 1WXSA 3W5VB 1SKRA 5KL1B 1N48A 1E8ZA 2LZ6A 5JXVA 4C4VB 5GMVA 1B4FA 3V3XA 4AP9A 4KGRA 4K81A 1V1PB 9ICSA 1KRPA 1GB1A 2I1JA 1YOVB 3C2MA 5B5EU 1D8BA 1LM8B 4KLSA 1L0YB 4KZCA 3SFDB 2PEAA 5HKHA 5HHHA 3WK7A 5C2TB 2N9XA 5ALRA 4YMOA 1TAUA 1V38A 1Z00A 2NRWA 5AI0A 1L6NA 1EUVB 1Q1OA 1HE8A 2Z0EB 3BK2A 5HNKA 3RH6A 1KDHA 3LB8C 4QAYA 2NRZA 5KNIA 3DDCB 4AS1A 3BYTB 4BVUC 3VH4B 1QT9A 1TK5A 3PVXA 2ISPA 2ZIUA 2VZKB 5AKKA 3DEEA 4EBEA 3MGHA 4BXOA 5CJ7A 1IP9A 3PO0A 2YTUA 3Q3OC 5DKWA 5AK3A 3N7PD 4CE6A 4UAWA 5IILA 2JMGA 5ALHA 4AQ7A 2EQYA 3LVVA 1T5XD 1V49A 4BKSD 4JPSA 2BS3B 1P1AA 1SBBB 2LGIA 2W9AA 1K1SA 3RCZA 4JUZA 3GIJA 7ICFA 2KNBA 2JU6X 3ZI4A 2NTSA 1FEHA 2G4DB 1MHHE 2QMTA 1FCLA 3BZKA 2DKXA 5DPSA 2L3ZA 1COKA 4Q43A 9ICMA 1WJNA 2ZUDA 2WHEA 3L3FX 4QZGA 1SE3A 4Z6DA 1Y8RC 1MQ2A 1WX8A 4L23A 1L4ZB 2JHDA 4N9F4 1YN5A 3J81j 5D6JB 1TS3A 2BYEA 4CRXA 2LM1A 3B9JA 3E0FA 4DO9A 3SI8A 2AQ3B 2KXJA 1MC8A 3ZQ4A 3JYUA 5J2IA 1HZ6A 1VRAB 3TFSA 3PHWB 5C5JA 1F9JA 4NV0A 1GPXA 2YVCA 2G9HD 3BVZA 2J0KA 3VTUA 2N7DA 3FC4A 2ALZA 1E8YA 7ICEA 3NJTA 3MABA 1CK1A 2LVQA 4HAIA 2AQ4A 5KFMA 2KTFA 1NBFC 4MEMA 4Y2JA 1V86A 5F9NA 3QE9Y 2QB0A 4NLNA 4MT5A 2KLCA 2WXIA 3CRXA 2BQ3A 4IQUA 2FLLA 1TY0A 3TQ1A 2MSED 4X57B 1UNSA 5JH5C 2J7QB 4F2SA 2AQ1B 4ZHOA 3RNBC 3M3JA 2BVCA 3PX6A 3C28A 4I2GA 3IHQB 1WY8A 3ENEA 3HK0A 2N7JA 1Q3VA 1WXMA 3ZNGC 2ZTEA 2Y9UA 2XCAA 3PW0A 3DOWA 4F72A 1C76A 3F2BA 2IO2B 2V3PA 3VHTC 4KLEA 5KG1A 4UB2A 3U52E 3HP6A 3EC8A 3RNGC 1IBXB 1JMSA 3T5LA 1UELA 5AM1A 3BQTA 3U30A 3HM6X 4I2BA 1J2MA 3HVZA 2D3CA 3GE3C 4DOCA 1JN3A 2QHOA 3ZTCA 5J18A 3RFZB 2G5IB 4TV3A 3EHVA 1TVAA 4UQGA 3QHTA 2BTEA 4C80A 4G50A 4B9SA 2UVUA 5CRXA 4C8MA 2VA3A 4JV0A 2QSDA 1LO5D 2WF6A 3CMMB 4RQ4A 4OJ5A 1NZPA 2R8KA 1OXJA 1V1PA 3D32A 2KTRB 1E7UA 3NVWA 5ALOA 1OQYA 2KT7A 2HI0A 3EPIA 4W9FA 3MC8A 2INDC 7ICJA 2I1KA 2INCC 1L7NA 4QZAA 1X40A 4Z6EA 4I6PA 4DXFA 1XO3A 5AM3A 1A70A 3N97B 4F50A 1FD6A 2FLPA 2JWUA 3RBEA 5JU5A 2ZPNA 3F5EA 2VRRB 2FUG1 3BDPA 2GO7A 4J6IA 5JHAA 2LGXA 1SL2A 1NKCA 3KFUF 1WJ6A 4EBCA 4P4OA 4JIOU 2KEYA 2MBHA 5HHDG 1BPYA 3BZDB 2WX1A 1XEEA 3BVGA 2KVCA 2AQ2B 3G6YA 3Q8QB 2ZUBA 3I63C 1XNSA 2OOBB 4P1CC 2FCMA 4AJWA 2JZPA 3U4EG 3DPDA 2GLEA 2DL0A 1N61A 1H4RA 4YG2A 4EZ9A 2NPTA 2QARB 5AKEA 4DEZA 2D3DA 4RQMA 2TSSA 3WKBA 3T9LA 2L76A 2QEJC 5L1LA 4GMVA 3M63B 1ZQDA 2M0NA 2XGPA 2IOHA 1VD2A 2AH5A 3Q8CA 2ZIUB 1UBQA 2WNMA 5AK5A 3F2CA 4NLCA 3PPAA 3WK5A 3QA8A 3QWZB 4MHVA 3GZNB 1TE2A 1DOIA 1SKWA 2KVRA 4I2IA 4BKGA 4CF4A 1E7VA 1Z2MA 4ACOA 1SXDA 1XSNA 4WWNA 4LK0M 3AUOA 4JX1C 3RH4A 3PNCA 2LJIA 5KFEA 2WX0A 2K4EA 5J2BA 3AN1A 2ES6A 2DYOA 4C56C 1NK6A 4J9NA 1LFDA 3BY4B 4KGTA 4WAAA 5JHBA 4B9NA 3DBRB 2WXRA 9ICNA 1JWAD 2HSZA 2WB1F 3TIXA 4UB4A 2LPEA 4ECZA 3HJEA 4LNFA 4AYBC 2A1JB 1KRHA 1XT9B 2CHXA 2ONQA 3HKZF 4GU2A 1ZD5A 2R2OA 2JVCA 3BS5A 1FRDA 4F4XA 3V7LA 2AJQA 4DL3A 4P0PB 5TISU 2N0SB 1WYWB 4ZH4A 3N20C 1KLUD 3ED5A 1KKXA 1TKGA 4FHKA 2M0XA 3R3MA 2D8CA 1MFWA 1CJEA 4K4HA 1TYGB 4GDLA 3ETRA 1L5UA 3B08A 4FO6A 3TCAA 2JUOA 3N30A 1ZJMA 4KTQA 1B0XA 3ZXVA 1KOTA 4Q44A 1KTQA 1UBIA 2KE7A 2Y0SF 1T8EA 3A9JB 2JF5A 4GDLB 2JRHA 2FDRA 1HQRD 4CDGA 2C28A 3C23A 3BK1A 4IS7A 2M4NA 8ICOA 1VLBA 2BR0A 8ICLA 2M19A 1Q10A 4IW0A 2LBOA 4GXBA 3H8JA 3PRZA 2K8BA 2W55A 2X8XX 2BPCA 4KLOA 2J6TA 4MJSB 4DQOC 2JEFA 4G3IA 4DHZE 3GILA 4F5QA 1F77A 5F3XB 4KZ0A 3JW0X 3V62A 2Q4TA 4KX3A 3RH5A 1L5PA 5AKXA 4NJ8A 1NK7A 3PR5B 3QX7A 1F1HA 1UZXB 4GB9A 4TMAB 5J0YA 2PE9A 2MA1A 4K7WA 4QIWF 3L5KA 3C1ZA 5F9LA 2WS3B 5L1IA 4DOBA 4DSFA 3CWIA 1Y88A 2KTQA 2KNJA 3R8BA 3V6KA 4K1RB 4KSKC 1U49A 4P6VF 4NWIA 1MN8A 2F1HA 5ALWA 2IO1B 4BDPA 4IOIE 1SJED 2XI9A 2PVGC 2G09A 4RH6A 3WANA 2VH1A 2XVTA 2XCPA 1R4MI 2KC1A 2KLGA 4ASWC 1L7YA 4C4RA 4K4IA 1XS9D 1IPGA 2Y0SC 4KMOB 4IWQA 2BCSA 4F93B 2LASA 2WDTB 2WF7A 1X9MA 5ALUA 5L1MA 5AZHA 1YN4A 4UAZA 4MEYA 2WFAA 2H89B 5J2KA 1YD8U 3IM1A 2WHIA 5CTRC 4Q8FA 4ZDVA 2AXTU 3GOEA 1EWCA 4C8NA 1B9RA 4QZEA 5D49A 2MBOA 3HRDD 2K1FA 1WWUA 3KUCB 4ZRIA 1BPEA 8ICWA 1GAQB 2B76B 4QWBA 2MJEA 1WX7A 3V05A 2V1YA 9ICBA 1YZ7A 3W2DA 3ONNA 4QZBA 1N5WA 1KN5A 1IIPA 5I4DA 1UH6A 1NK4A 2F2AB 2M8SA 4RPYA 4YWGG 3K4GA 2HW3A 5ALZA 1WF9A 1D6EC 5J2RA 4NL9C 3IT6B 3R9KA 5HHIA 4LJPB 1ZOLA 2UWQA 7ICVA 2YB1A 7ICMA 3L10B 2HOQA 3CIRB 8ICNA 3JSVA 2XNAC 3AEEB 2PVOD 4B6WA 3FAHA 3DHHC 5KFKA 3DHIC 1BGXT 1T3QA 3T5HA 5BYQA 1T0RC 3M9NB 2KFNA 4RGMA 3SV3A 1WG8A 2BQUA 2QCZA 3H4BA 1U48A 3QXGA 4ZOHC 4J9MA 1SB3C 4L2YA 3V72A 4Y2PA 5KG4A 2VIXA 3P4PB 3RNAC 2ZJ5A 1PGXA 5D7GA 4EEWA 4R8UB 2LYAA 1C4PA 4EZLA 3BIID 2OHFA 3BJYA 2LKYA 4O3OA 1RWSA 4CQNA 3R66C 3DBSA 1IM4A 4JWMA 3Q8AA 1GO3F 1VZ7A 5FR3A 4KGSA 4EYHB 1U9LA 3KHRA 2NBUA 3A0HU 2A1JA 1HA5A 3H8SA 2KDMA 3APDA 3ZDCA 3NVVA 2KICA 2K0PA 3AXCA 3PW4A 4O9MA 2Q0ZX 3SZ2A 2RD0A 4XE0A 4NXZA 3ABVB 4PGXA 5JRTA 5IIMA 3WAPA 1HTQA 3RZWC 2HHUA 5AI6A 3QU5A 4ECSA 5JZEB 2PXIA 1KFYB 3AU6A 2K4IA 2PFQA 1E8WA 2INPE 2Z0DB 1WGHA 2E3TA 2CKHB 2KJHB 4O3QA 3H7PA 3IAS1 4RFBA 9ICIA 3ONSA 1Z19A 4I28A 3Q8PB 5A0LA 3QIJA 4F4KA 4WURA 3H8MA 1X6IA 5LXIB 5DBAA 3M6ZA 9ICEA 1SIJA 2FPLA 3DBHI 2CJOA 4RF0A 3WIMA 2NTTA 5GTHU 4P0PA 4C8LA 2JH1A 2RGFA 4R63A 1WR6E 3QUCA 5DG8A 2JSVX 3QNMA 4YTPB 5AUIA 1KF6B 5IOIA 2XGQA 2CHZA 1OTRB 2V0GA 4P4MA 3MC0B 2ASDA 3PLUA 4YCXA 4I29A 1F52A 1NJWA 2K39A 5ALLA 2GOWA 5KFCA 2PJHA 1ZQBA 3RJFA 1XU4A 2K8BB 2MRLA 1AARA 5DQIA 3VR9B 1UPHA 2WAQC 3MR6A 3DBLB 4KDIC 1DOYA 1COOA 5HP4A 2GBMA 4CCHA 3G6VA 3QUTA 4F4WA 3MDAA 8ICPA 2C60A 2DENB 3FM9A 1ZGUB 4PHPA 5GXGB 1CMXB 5DB8A 3ZW3A 4ECUA 3T3NA 1UT5A 3F53A 3MC1A 5FK9C 2PE6B 3FILB 4MF2A 5J0RA 1NNLA 1ZDXA 3VR8B 1WM2A 2W8LA 9ICKA 4YSXB 4DSKA 1WFYA 4KLIA 2M17A 1Z3EB 3FILA 4IC9A 2KG5A 2HD5B 4IKGA 1R4NB 1MSWD 3WK9A 3Q8MA 4MGKE 3NZ3A 5C3JB 4LCDE 1JWUD 1T3NA 4UB6U 1XF5L 2R8HA 3P4SB 1D9FA 2EELA 5AI8A 1XO0A 1WUDA 2JYTA 2KX3A 3DHGC 1E10A 2KACA 4DL5A 3HIZA 2CPRA 4KLTA 4CGZA 4II3B 1ZD2P 3GZFA 5MPOA 4PYUA 1UWXA 4M9LA 2GBRA 3DWMA 1NI2A 2EH9A 3OLMD 5KFQA 3WAMA 1XD3B 4QW9A 4YR2A 3GIIA 3SQIA 3SAHA 1JQ4A 3JVZX 5DDYA 4UB1A 2W04A 2L1AA 3VC8A 5H2FU 4LDTD 2BHNA 2XIDA 1DRGA 5DLFA 1KBUA 2YQEA 5KG0A 4Q45A 2GWSA 4NY8A 1PQSA 1WIAA 3H6NA 4I6NB 4P0QB 1YQBA 2ASQA 2XK5A 2HDEA 3P42A 1ZQFA 1RQLA 1ET6A 3BINA 5ALKA 2V4QA 3AEDB 3TUOA 1NYQA 2KWVB 3A4RA 3UIPB 4A55A 5DBBA 2IDYA 1BNOA 2KZMA 1P0RA 4FJVB 2Q5WD 1L0XB 5HR6A 1J7BA 2EAMA 1FCCC 1F5SA 1XLPA 1J2NA 5KFXA 3PMLA 2D3GA 3EPGA 4W9LA 1X6JA 3EFCA 3KTQA 1NKBA 4FZLA 4B9TA 4NLZA 1V8CA 2V3SA 4C4TA 4XWWA 4Y2TA 3GQCA 4PPXA 3HPOA 2KKVA 4BX9C 1FM0D 2QB1A 2ZVNA 4A3OA 5ALEA 2KFKA 2UYZB 4JWSC 1JROA 2OJWA 8ICUA 2CS4A 1NK8A 2E8NA 5D3DA 2WF9A 4NAWB 2WF8A 3B0XA 1CEZA 1ZW7A 3AI5A 3MTNB 3RB6A 4RQ2A 3KKAC 4KMUA 2H88B 1KLGD 1ZQWA 1ZKHA 1D8YA 1RQNA 4BOSC 2D10A 2ON8A 1D5MC 2IA6A 5DPWA 1EU4A 1S8OA 5KFAA 1OQQA 3PO4A 3RD2A 3C5GA 3RBDA 3Q8EA 1S0MA 4RQ0A 4YTNB 3C1YA 4URKA 2ODGA 2ZXIA 5DB7A 2BCVA 2KN5A 2IO3B 2NS5A 3IP4B 4PK1A 4JWUC 3AMZA 1VJKA 3HWTA 1HJPA 5J2GA 1SKSA 3O65B 2O2VA 8ICKA 2FI1A 1RYRA 2D07B 1WGDA 3DVNU 4ANWA 4YQWA 4WJNA 4B9LA 8ICIA 4H2AA 2G3QB 2DAJA 3W5UB 1TT5B 5AKLA 5AUKA 4G3XB 5KTQA 2OEDA 4AOFA 2M1MA 3C5FA 4W9EA 1SF0A 3P4QB 4BJQA 4FBUA 2BYTA 5ALQA 3R2TA 5DB6A 4R66A 3MFGA 3SAGA 5C0YA 2DHZA 4IQTA 5CR0A 3L0WB 2HBJA 1XQQA 4CYEA 3OWEB 5HMMA 4KLHA 2ZPYA 5AZGA 1BPDA 1WH3A 1T4GA 5ALJA 3M62B 4ZYNA 2DQNB 4KLFA 3BS7A 3EW9A 1L7MA 5J8YA 5EWEA 2EKIA 5AIAA 1KFTA 4NLBA 5AI5A 4KLGA 4F3OA 4W9HA 1C9FA 4YTMB 1O03A 3E2EA 5J8YC 2WXNA 4M04A 2ZTCA 3B2GA 2AU0A 2ZEQA 3QYPA 1K8RB 4HRSA 3ZGZA 2L32A 4JB3A 4F91B 1Q3UA 4A3PA 4DBGA 1WZ3A 1MG4A 4QIWC 4A20A 1SZHA 2K4HA 1EU3A 3JPQA 4ICVA 2HHXA 1V80A 2K4PA 2VANA 1Q46A 1L7OA 1JIHA 4J9KA 3RAXA 3ZNHB 3Q3FA 1PVPA 2HE7A 1NKEA 2LVOA 4PS8A 3ZD8A 1K52A 2BQRA 4ZRJA 4KKJA 4RCOA 3KQ4A 3FDSA 3OG5A 3U7ZA 4F1SA 1NJXA 2ZCCA 4IUMB 3RRGA 1CRXA 2BPSA 5FKAC 5AK4A 3SV4A 4GDKA 5AZFA 5TR5A 4HDOA 3ZUNA 1WJ4A 3QK0A 4ZRPA 4QZIA 1MHXA 1VZ6A 3O0FA 3PS6A 3UMCA 4WWOA 3DWGC 2WU2B 2JRZA 5EOZA 4HK2A 5L95C 2LMCA 3MDCA 4RUCA 2XK5B 1J7AA 4PHEA 1UCVA 3Q8RB 4DFKA 3Q3MC 3EFUA 1P7DA 4GFJA 1E8XA 2WTFA 2N1WA 2LRUA 2OCEA 4XWTA 4RNNA 4C8OA 4PL1A 2V3NA 4YSZB 2IO0B 3ZTDA 4EKUA 3CP8A 1B1ZA 1QKZA 2J0JA 3RR8A 5AHXA 4RPZA 2P66A 8ICEA 2LEKA 4F5PA 2BDPA 1VR9A 4F5RA 3N4MB 2PLPA 3NS8A 4HEA1 2JPHA 2K5PA 4NY0A 2KIWA 2W9BB 2WXLA 3IHPC 1IBXA 5J17A 3AEGB 2KDEB 3RAQA 3KVFB 4PHDA 2KC2A 4KLLA 3BYYB 3UXNA 3JPTA 2BW2A 2L05A 3VQIA 3NUQA 4EX7A 3IT4B 1FO4A 1JMLA 3RNEC 2LFIA 2IJ0A 2KANA 3ZDDA 2KD0A 2FNJB 2YY6A 1QLBB 4KDLB 1HIWA 2VKQA 4RGNA 1QOAA 5KFDA 1WXVA 2JX5A 1ZQUA 5AEKB 3L54A 4B0EA 2AQ0A 9ICPA 2J4XA 2LGDA 3PX4A 4YR0A 2L5YA 2FMQA 1B22A 5KFSA 2MJDA 4M47A 1BVSA 2NV3A 1XSLA 3M8RA 5LXHA 2FMPA 1S5LU 2SEBD 1I35A 3M6KA 5DG9A 3TACB 1NK5A 4I27A 2YMMA 1YJJA 4E3CA 4TQ1A 1ZRNA 2N9KA 1BT0A 4ANUA 4WJQA 4FULA 3KUDB 2REXA 2XY7A 3OSPA 1WE7A 5GTIU 5KFRA 3ALRA 4DS5A 2JH7A 4WQMA 3PSFA 4PHAA 4F4YA 4LTUA 4DF8A 5EE0A 4C8KA 1A6SA 2K6DB 4RQNA 1ROEA 2PKOA 3FYHA 4KLUA 4C7YA 2KSOA 2Y1IA 3AE9B 5BO4B 1B43A 5EWFA 4YXMA 1K50A 1N2XA 4Y2XA 4LLGM 4NJCA 2RDHA 1L6VA 3IXSA 4J9SA 5TZVA 3QU9A 2ZW0A 4MACA 2IOFA 2O2VB 3AH7A 2J6UA 2XBBC 1ZQOA 1RYJA 1WMHB 3BS5B 3AECB 4IQWA 4XA5A 5BOLA 2H5XA 4LNKA 4Y2YA 2KOBA 3RB3A 3PO5A 2KMDA 5BOMA 3TEZA 1UA0A 1GG3A 1ZQYA 3D2SA 2KZRA 3PRMB 1KFDA 5EE1A 1ZD4A 2BWES 5KFLA 4JL9A 3T8MA 3OJSA 1NK9A 1AW7A 1BNPA 3PW2A 1HZ5A 1FXIA 2JQRB 2XN9C 1WXQA 2E8MA 2BS2B 1RAXA 1YQ4B 3LDAA 3KW5B 2V4LA 2NCNA 1TKYA 2JT4B 3QZ8A 4FA6A 2WXMA 1LVHA 2JZBB 4XUSA 4F8CB 9ICUA 1L0VB 1UD7A 4TQ0A 2HTHA 5J29A 7ICNA 2MP2B 1XXGA 2NMQA 3PSIA 5G5GA 2GI9A 3RULA 4CF3A 3KYDD 5IN7A 3I1YA 1RG6A 1SXEA 3HX0A 1WGKA 3T3FA 1ZQCA 2WXFA 3QX1A 1MVKA 3KLSX 4FS1A 4KKIA 1WCNA 2E1EA 1S0VA 2KDIA 3PW5A 2N1RA 2ISOA 3A1QB 1IG6A 4WQOB 3LWMA 1TFRA 3UMGA 1IGCA 4XX5A 3RMKC 4KLJA 4BFRA 3ZJVA 1PUZA 3KD3A 4GOCA 3SFEB 1Z1VA 4ED7A 5E6JA 1J8CA 4GXKA 3GU3A 3IBEA 1ZJNA 3UGBB 2UVRA 2EANA 2PFOA 1CI4A 1ZOYB 2HJ8A 1TV9A 3V61A 2XY5A 3PVLA 4UARA 4UW9A 4LJOB 4EE2A 4TUUA 2JZBA 2Z8LA 2JY6A 2RLTA 4KLDA 2RDGA 4QNLA 1C7YA 4IR9A 2FCNA 3S2AA 1SE4A 2YMLA 3M1YA 4I6LB 3ORYA 3KBBA 4FZNA 4Z6CA 4DFPA 4FLHA 3QU7A 1LXDA 4BBNC 5AK6A 4DDGD 4RPXA 2BGWA 4M9HA 4A6QA 4B9MA 1JWMD 8ICFA 4C4SA 2JEJA 4J9LA 2G0AA 2EZZA 3WKEA 4R64A 2HOFA 3R7QA 4RT3A 1WJUA 3C8YA 4DL6A 4M0WB 3SEIA 3Q8BA 2QKQA 2C2DA 4F5NA 4ED2A 4M9GA 4Q8EA 3ZDAA 2B0CA 4FS2A 3DVGX 5D3IB 2BPGA 1HXYD 3TAPA 1IUEA 3VUWA 4RQ3A 2N7EA 2GBNA 3TI0A 2CN1A 4DL4A 3HUIA 4DCCA 3KHHA 1UWMA 3P63A 4DFDA 1OQRA 3D2NA 2IHMA 4KN7A 1M6YA 1RM6C 2YX8A 3TADA 4I2EA 2IGHA 1NVID 3NTUA 5IAAC 4WJPA 1UQVA 3TL5A 1KEJA 1N60A 3SD7A 1SJHD 2XEWA 4QWCA 2KHVA 1UF0A 5HMLA 1WMHA 2KQ4X 4MM3A 5KFTA 2F8LA 2VZKD 3SMVA 2HMXA 5D94A 2E1FA 1GC6A 3PW7A 4TUPA 3OHAA 3M9OB 2MAXA 3U2SC 1V81A 1Q5WB 2BPFA 2KTRA 3PSEB 2LJ5A 4ANXA 3PZ7A 3WKCA 2NRVA 1OW5A 4O5CA 2JZZA 1RXWA 2LWPA 4GIVA 4OZAA 2FPMA 2WB1C 3WAOA 3MGVA 3I76A 1YIWA 5DGBA 4YN4A 3SHQA 1OUQA 1TJEA 4JGHB 1PZNA 1P7FA 1FPYA 4U7CA 1ZQIA 3Q8KA 4FE3A 5CB1A 1D9DA 2JGAA 2AHOB 3I28A 2AL3A 4EZKA 3KWLA 2BB5A 2KWUB 5BYRA 1I4RA 5BMHA 4FFDA 4HROA 2D6FC 2JR5A 2YMQA 1F0ZA 4NJ6A 4JV2A 3AQEA 2G5HB 1ZUD2 4IRCA 8ICTA 1KJTA 2X38A 1WGGA 3M7DA 4MFAA 1RYSA 1E90A 4P1BC 1ZE3D 1C3TA 3OGUA 4FXCA 1YX5B 2K89A 2ACZB 2I38A 2GBKA 2NBVB 3QUQA 4B9VA 4K3BA 2KHWB 1WZ0A 2N9PC 4O3MA 2B6GA 5IA7A 2FUHB 1DXSA 4BUGA 2IYDB 1FNUA 2ATLA 1DK2A 4B0MA 3RJJA 1SEBD 4RUAA 2K6QA 1I4QA 1JALA 3M8SA 8ICXA 3TARA 1C77A 2JV3A 4NM2A 5KFIA 1XSPA 1J7CA 1UGJA 5KL8B 2IPKD 4OD0A 3PZPA 4B95A 1VJ5A 1WI0A 2F76X 2I1QA 2WGSA 1QQ5A 1A5RA 1ZQRA 2B21A 4UATA 5AKZA 5AM5A 3KZIU 3M9MB 4DL2A 1V5OA 1EF5A 1PDXA 5ALDA 4JV1A 3IAM1 2DKZA 3ZDTA 3AEFB 3P1MA 2K22A 1TZOA 2ZZPB 1ESFA 2A3VA 1FXTB 3RNCC 4ECYA 2VA8A 3RZFA 3HM3A 1TS5A 1R4MB 2R8IA 3AEBB 2KQ7A 4D2KA 4ELUA 2KDBA 1PK1B 5CHFA 1NEKB 4QZCA 4JWNA 2JEIA 2LUEA 4YSYB 3P4RB 1X9XA 1S10A 5KFHA 2KJ6A 4BWMA 3RPFC 9ICCA 1RRBA 1NZBA 3SDLC 2L00B 2IBIB 1X9SA 4DHZB 4YD1A 1K1QA 4G0NB 2WYQA 2W54A 4RNAA 3A0BU 1ZQPA 5KFBA 5DGAA 3PMNA 2K25A 1SSNA 1SL1A 1JWBD 1YN3A 2N9EB 4MGIE 1O08A 1VDVA 4B9UA 4XYCA 3WALA 2OYYA 2IZVB 4E71A 4M6WB 4GC7A 5IINA 3H4DA 2KVSA 2NRTA 1D4BA 4O3SA 1TBEA 7ICQA 4DXGA 2NO5A 3APCA 1JWSD 3U7DA 3AULA 3BQ1A 1QSSA 2C7MB 2J0MA 3H9DA 1STEA 2XO7A 1OFFA 4ZHPA 3UM9A 3NOBA 2A19A 7ICTA 4OJPA 4FHJA 3LJ3A 5IIKA 2CHWA 2DYBA 2WP9B 4MJSA 3Q69A 3T5KA 2FBWB 1I42A 3N28A 3PZDA 2FCQA 2EKEC 2MQJA 3NG0A 4DS4A 4FJYA 1QOFA 5JUMA 2FPKA 4EYIB 3UPQA 2AWTA 5IO9A 1ZQHA 3LYSA 3VCBA 1UHUA 5D46A 2BWFA 2HDOA 3Q14C 1H8CA 7ICGA 1PFDA 3W1SC 1P98A 1BPZA 2KZZA 3EYZA 1C1YB 1QOGA 4EELA 4UAUA 3SYZA 2KK8A 4F71A 4LZDA 5L83A 1QZEA 2KN4A 2QC8A 2R8JA 3B1LX 2NVUI 7ICUA 1J19A 2BF8B 3H8HA 3WKDA 2Z59B 3P2BA 2KP7A 1YJ1A 4RGOS 3IG5A 1ZQ1C 3NASA 4KN4A 5JTIA 5J0OA 1KM7A 2ZVOA 1NK0A 2L0TA 3TJPA 5J2AA 2EZXA 5EE9A 5KFJA 2BCQA 3AE5B 1L2NA 1KLVA 4QW8A 3RR7A 2IY0B 4EFOA 3HT3A 1PUTA 1V2YA 3TBLD 2HHSA 2YEPF 3FKYA 2BT6A 4YP3A 3Q3NC 4J9QA 5AKIA 4IRDA 4M01A 3WA0A 4KV2A 1D8LA 4P4PA 3V6EB 4XDDA 4M9NA 3U26A 1WM3A 3TANA 3AEAB 3H40A 4Z6FA 2C2EA 1ZQGA 4GGQA 4DSJA 4XC2A 1IV8A 4IL6U 2OWOA 1C79A 1ZRMA 2FE9A 4GIBA 2O6VD 2ZXHA 1E9MA 2BKFA 2WXJA 4FZMA 1ZQLA 2QARA 4UAYA 1ZQQA 1AYFA 1QQRA 5G5HA 4RQ6A 2NRXA 5DQHA 3HILA 2ZTDA 3KHGA 3GV8B 1P7EA 1T0QC 2KFKB 2E8PA 2KJ9A 1L3TA 2A1AA 4WJ3B 3QEAZ 2V4IB 3NUHB 4MFCA 3UMBA 5KG5A 3MJWA 1SGHA 4LNIA 4PGYA 1G6JA 1GC7A 2D2QA 2KK0A 3ZVVA 2I5HA 1YMHE 3LWLA 2I2YA 4BZAA 3SEBA 1P3QU 2D5GA 2MH7A 2N1VA 2QLTA 3EA6A 1Q0WB 2K8AA 5AIBA 4RQ8A 1R4NI 1YJIA 2C7HA 3UXPA 1I7HA 4RMAA 2HHVA 3I5JC 2H3VA 3JPNA 1MG8A 2WWZA 3V6HA 2PW9A 4R65A 1IXRA 3SENA 2JEGA 2KD1A 2MP2A 1S77D 3AE7B 3MP9A 3VFKA 1WGYA 2HHWA 4RZRA 1NOMA 2RPQA 4W9IA 1X66A 3K1ZA 1L4DB 1DGJA 3AM9A 4ICAA 3ZNZB 2DNFA 8ICAA 4LNNA 4OVVA 2NPTB 1WE6A 1MA7A 3BZCA 1SWWA 2BB6A 4MSQB 3PV8A 2F8KA 1X1MA 2PMVA 1N63A 5DLGA 4YXDB 5KHQA 4RQ7A 5ALGA 3IN5A 1JXLA 1FMAD 5KT6A 5KFZA 2D3BA 4ED6A 3HVDA 2W43A 4HPLB 1RFAA 3PSPA 5J0TA 3A1QA 1SV0A 2V9WA 1V1OA 2KV2A 4B6JA 4TQRA 3SR6A 4GLXA 2LXCA 3NHEB 3SD5A 3C29A 2HTME 4YL8A 1Z00B 1MPEA 3H7SA 1LKYB 4ICUA 2G1EA 7ICHA 4OJOA 1ZQJA 1QQ7A 2E8OA 2WXQA 3NZUA 1TAMA 5KT5A 4ECVA 4ED1A 4NAMA 3RB4A 4ARCA 4G9BA 5KFYA 2HOIA 2Y3AA 2W3RA 2XC9A 3H7IA 4KX5A 1S0NA 3IDWA 1WGRA 4X5VA 4BXOB 2I6XA 2G07A 2PMZC 1ZQTA 1AN8A 1GUAB 1JRUA 4IWOA 4RF1A 1FNWA 5ALTA 2BKRB 3R2IA 8ICVA 1L3SA 2KVZA 1TS4A 2MUTA 4BGDA 4M0WA 3QU4A 4DWIA 5AM4A 4P7IA 4WWPA 1WYGA 1V6EA 5KG7A 3PX0A 4NM1A 4IM2A 3KZXA 3AEVA 1QOBA 4I2DA 4KLQA 2L0FA 2VJ5A 5KAIU 3AE8B 2MHJA 4HJKA 3SU8X 5AICA 4MGZE 2MWSB 2KFZA 2YMPA 1RYUA 5AI9A 2MRPA 4BAXA 3NZSA 1RDFA 3GE8C 3K1RB 5C1ZA 3LYYA 1LGRA 1AQ6A 1S3SG 2J42A 3AV8A 2EDUA 1AWDA 3APFA 3VTWA 2FJ6A 2HBLA 2INNE 3K9OB 2YN4A 2ZJ8A 4J9RA 2BYFA 4JQWC 1IYFA 2MU2A 4LJXA 1TY2A 4FJZA 9ICTA 1X9WA 5DB9A 2ZNVB 2KO3A 4W9KA 2Y5CA 3MBYA 4EX6A 4F92B 5D2MB 1L8LA 4O3PA 2JXXA 1ZYQA 2RDBC 2QB0B 1BMLC 2IY1B 3T5JA 3N7SC 7ICIA 1ZQXA 4MELA 9ICOA 3AU2A 2LGYA 2H3FA 3UQ0A 4J03A 2IHNA 2W9CB 2H3ZA 3VTVA 1JUDA 2L83A 1ZP0B 5FR6A 4BKSA 3EUB2 3MR5A 3AL0B 1V97A 4IQVA 3F2DA 2GRIA 1A76A 2BDUA 2M0AA 1PYWD 1ZQSA 3VUYA 3ZNID 4WJOA 3H0LB 2LHDA 3WK6A 1MQ3A 3RUIB 3A4SC 2CU3A 2R2QA 1I4GA 1E7PB 4M9JA 4KIKB 3EECA 1V5TA 3CSFA 5IKCM 1SZPA 1KQQA 2DX5B 3Q3JA 3MGIA 3GV7B 5AM2A 1SGGA 2A5UA 1CQVA 1D5XC 2MJ3A 2MCNB 2W7OA 3AE2B 3IVFA 3OAWA 4OVUA 2HBMA 3X0WA 4KVGB 8ICJA 4C00A 4DL7A 1NDDA 3MR3A 4LNOA 3UXOA 2UVWA 2ZJDA 3A33B 3Q6BA 4RGTA 4O5KA 3B2FA 2HBKA 4S17A 3IRUA 2JXJA 3KOOA 1HEZE 3BQ2A 2ZW1A 2O6KA 1MI0A 4ZRKA 5DBCA 4F5OA 2Y5PA 3ZD9A 1N62A 2LM4A 2PFPA 2C2RA 4HJGE 4ECQA 4FBTA 4QWDA 4DLGA 2LHTA 3UF8A 1TKEA 4AWJA 2F1IA 5ALVA 1N5XA 2W11A 3AQFA 1V9JA 4GSWA 3MHSD 4MDKE 4M8NA 4XGAB 4PGQA 4DK5A 1T0SC 1BUIC 3ZDBA 1S1QB 2VH2A 1TZ1A 5BMGA 4QZ9A 4L1BA 2NBWB 2XY6A 2M56B 2OJRA 1WSPA 2GBJA 3NY5A 4PS7A 2JYEA 4TSSA 4BKTA 1U4BA 4QWAA 2KJ8A 4YVZA 4J9PA 2RHFA 4PYZA 1DK3A 2HCFA 5LNK1 3LXFA 3K75D 5KG6A 3MR2A 4K3CA 3ZYYX 4EBDA 5CP2A 4PL2A 5KG2A 4M00A 5C23A 2AX5A 2ZIXB 2H3IA 2O6VB 2RMMA 2YLMA 3I9V1 4K4GA 4JLCA 5H8YE 5E6OA 2ASLA 1U45A 3ML8A 3AE3B 2MSNA 8ICBA 3RNFC 3PLVA 2M9NA 3N7RC 2IGDA 1PVQA 4Y2VA 1VCBA 4GDKB 2GOLA 2R8GA 5DQGA 2ZCBA 3OPXA 1ENFA 1ZXHA 3DCGA 2PKEA 2DWQA 3N9YC 5KFVA 2D3AA 2N9LA 2GH1A 1QH9A 3L08A 2KMAA 1FFUA 1JX4A 2WDQB 1P9DU 4E74A 1RPLA 4DHJB 4ZRQA 5KT4A 1L7PA 4AP4C 1LV5A 2IOFK 3V6JA 2W7PA 4DSLA 4IM3A 3UQBA 2K8HA 3C0RB 4YR3A 1X2IA 4O0IA 1ISNA 3PY8A 4RNOA 1M94A 5J0SA 4HPPA 3PSTA 3IV6A 2CJNA 1I4XA 2C22A 3MC9A 5ALMA 3CYMA 3ZIMA 5G55A 3C2LA 3H7PB 3U8ZA 4P0QA 3WCQA 2WXOA 1K5OA 3RFAA 1QSYA 4P2HA 3GZNI 4N58A 3ZRCA 1XC9A 3RJKA 2K8CB 2KZ3A 4IDIA 4DF4A 1GOZA 2EMTA 1PK1A 4DOAA 2OEHA 4N59A 2QJLA 1GNUA 1TIFA 4KIKA 4M0AA 2BQQA 1ZQZA 4CO7A 4EZJA 2HVHA 4YT0B 3URYA 1ZD3A 3NVYA 5IIIA 3EWAA 4ED8A 2HJ1A 3V7JA 3DBRI 1R7SA 1T94A 2OH2A 2WXHA 5ALFA 4A90A 9ICVA 4DQSA 3IFWB 5CX3A 1SE2A 3JSVB 3W9CB 2RPVA 4MM3B 1XWLA 2Y5BB 4Q2JA 2CU1A 2LI6A 2G4SA 5B66U 1EWYC 5DG7A 3L17A 1V85A 2PMZF 4YD2A 3ZLZA 3ZRFA 1Y56A 2ZNVC 2MW5A 2PPHA 2ZIVB 4ELTA 2BYVE 4M2YA 5J2JA 3VDZA 5HFYA 1F2RI 3KHLA 2A4ZA 2EZYA 5DPRA 2BBCA 1JRPA 2WXKA 4GC6A 1KH0A 4DDID 3W1YA 5EWGA 3PV1A 3TAQA 3F5AA 5CA7A 2EAOA 1F44A 4TKNA 5D4BA 3ALBA 4R3DA 3MFHA 4MFFA 4GN1A 3RF9A 3N3KB 2VJ4A 3TKAA 1EF1A 2VA2A 4DQIA 3B0AA 4WWMA 2LD9A 3RI7C 5CEHA 2C9WB 4CNQA 4JK1A 2GLSA 2PIAA 3NRWA 5HR7A 4M8MA 2ESEA 5LLIA 2V4RA 3GIKA 3C2KA 1WWTA 3D6JA 2B3AA 3VVWB 3WK8A 1UA1A 1XLQA 4UAVA 3TEWA 3TSSA 9ICFA 8ICQA 9ICHA 3UI3A 4PZOA 5AM0A 5J0UA 3T79A 3QCAA 4R8UA 8ICCA 4NAWA 4O5EA 3OJ4B 3GV5B 4A9AA 4US9A 9ICWA 1SXTA 2KMCA 3VH3B 5ALYA 5J0XA 3R7RA 2QDFA 1JI7A 2AGQA 4NNJB 1SIFA 3RTVA 2Y1JA 2WQYB 2W82A 5KG3A 3ZJUA 3QUBA 2BGFA 1YT3A 2K9XA 5KFGA 3JPSA 3HW8A 3E58A 1U47A 3AU5A 4PS3A 4PZNA 2KFJA 1SWVA 4ED3A 2ASJA 2DAFA 4ED0A 4CF5A 2CXYA 3TEYA 4F2RA 2KQSA 1Z4OA 5AKYA 2DZMA 1QF6A 3BQ7A 2ZIWA 4F4ZA 5CWRA 1F2RC 2FCSA 1ECWA 5DDMA 4FN2A 2JWZA 5ALSA 1YX6B 4NLKA 3O13A 4RM8A 4NPNA 5HG2A 4NZLB 5DPTA 1CUKA 4AJYB 9ICQA 3OHBA 4OO1J 4W9JA 4DWFA 1L3UA 1C4AA 2RDJA 2O6VA 1XCQL 3V60A 4P16A 1E0ZA 9ICAA 2MBBB 4OJ6A 2NO4A 1C4CA 1F0MA 4I2CA 3RN9C 2KWDA 4OHJA 5BYSA 5TSSA 5CHWA 5CHVC 4QZHA 3RJGA 3H1UA 3H0RB 3L13A 2HVIA 4UB8U 4QWEA 4OW0A 3OTQA 4TURA 4WIPA 2K8CA 2R18A 3BVMA 3ETLA 3RYTA 2DYMA 2L7RA 1RXVA 3MFIA 4I2AA
chains in the Genus database with same CATH topology
3RFZB 1FFVA 1ZPSA 4A8XC 1IGDA 3OWEB 2BTEA 4C80A 2QSDA 2KN4A 1LO5D 2EKIA 3H8HA 1V1PA 1C9FA 3NVWA 4YTMB 3T3OA 3B2GA 2WXNA 4RGOS 4HRSA 4DXFA 1XO3A 3ZGZA 1A70A 2L32A 5EE9A 1FD6A 4HKZE 2JWUA 3AE5B 1XLNA 3GP7A 2FUG1 1PUTA 1D5ZC 2DLBA 1EU3A 2KAJA 3GS2A 2YEPF 4US8A 2BT6A 1VZ8A 5HHDG 1L6UA 3BZDB 1XEEA 3BVGA 2AQ2B 4OZBA 1WRIA 2J52A 5H92C 4XDDA 1K52A 2JZPA 4KKJA 3AEAB 3KQ4A 4RCOA 3U4EG 3AE6B 4PT5A 3U7ZA 1C79A 1N61A 1E9MA 1TS2A 2E6XA 2TSSA 2WXJA 2BS4B 1AYFA 1QQRA 4UDUC 5FKAC 5G5HA 1FIQA 2QEJC 1P7EA 2SAKA 4ZRPA 1MHXA 2V4IB 1VZ6A 3NUHB 1CZPA 1RFKA 3Q8CA 3DWGC 2DBYA 1YNTE 2WU2B 3NVZA 2WNMA 1PGBA 2LMCA 1YMHE 2I2YA 4USAA 3SEBA 1J7AA 2D5GA 3E56A 1DOIA 1ZDVA 2MH7A 3EA6A 1PGAA 4REZA 4XWTA 1YJIA 1I7HA 2K3UA 1XLOA 4LK0M 1EM7A 4JX1C 2LJIA 2V3NA 4YSZB 2FE8A 3VRAB 3AN1A 2DYOA 2PW9A 4C56C 1QKZA 1B1ZA 3E9SA 4KGTA 3MJ5A 2LHEA 2WXRA 3AE7B 3BWUD 3MP9A 1JWAD 2LEKA 1VR9A 1L4DB 1DGJA 3AM9A 2PLPA 4HEA1 1KRHA 2K5PA 2ONQA 2QILA 1M4VA 2WXLA 1IBXA 3AEGB 1FRDA 3EGRA 3BYYB 2BB6A 2BW2A 3VQIA 4ARIA 3IT4B 2N0SB 1FO4A 1JMLA 2LFIA 1KLUD 1N63A 2PMVA 1TKGA 4OVZA 4YXDB 2IJ0A 1CJEA 1TYGB 1QLBB 1T6BX 5BMIA 3ETRA 4RGNA 1FMAD 1QOAA 3HVDA 1KTKA 2JX5A 4B0EA 4WAFA 1V1OA 2J4XA 3J9CA 4GDLB 3SR6A 1HQRD 2HTME 2MJDA 3BK1A 1MPEA 1VLBA 2G1EA 2M19A 2WDVB 2WXQA 1Q10A 1GB4A 2W55A 2SEBD 4NAMA 4ARCA 4DQOC 1YJJA 4TQ1A 2Y3AA 2W3RA 1F77A 2N9KA 1AN8A 1L5PA 4RF1A 1FNWA 3R2IA 1NYRA 2LUMA 4WQMA 1TS4A 4LTUA 2PKOA 4M0WA 5EE0A 1ROEA 4TMAB 1WYGA 4C7YA 3AE9B 1QOBA 2WS3B 5EE3A 1K50A 3CWIA 3AE8B 4LLGM 4NJCA 1DOXA 2RDHA 1L6VA 3R8BA 3GB1A 3IXSA 4P6VF 4MACA 2ZW0A 1ACCA 3AH7A 2J53A 3Q8FA 3LYYA 4IOIE 1SJED 1RYJA 2PVGC 2J42A 3AV8A 4JE3B 3L4PA 3AECB 4RH6A 1AWDA 2INNE 3TEZA 1TY2A 1NENB 3KWVA 5EE1A 2Y5CA 4N6EB 1AW7A 1HZ5A 1YN4A 1FXIA 2JQRB 2XN9C 1WXQA 1BMLC 2BS2B 1YQ4B 2H89B 4XDCA 1NI3A 1TKYA 2WXMA 1EWCA 2L83A 1ZP0B 1B9RA 3EUB2 1V97A 2M0AA 2GRIA 3HRDD 2L52A 1PYWD 1L0VB 1GAQB 2B76B 2MJEA 3V05A 4TQ0A 2LHDA 1XXGA 3TEXA 2CU3A 3W2DA 2NMQA 1I4GA 1E7PB 1N5WA 5G5GA 2GI9A 5I4DA 4YWGG 1WGKA 4WH4A 1FXAA 1D6EC 2WXFA 3IT6B 1MVKA 3KLSX 1CQVA 1D5XC 2MJ3A 4KKIA 3AE2B 3CIRB 2XNAC 1E6EB 2W3SA 2PVOD 2WDRB 3FAHA 3AEEB 1T3QA 4RGTA 5BYQA 3AB5A 1IGCA 3B2FA 1K53A 3ZJVA 4RGMA 1HEZE 2WXPA 3SFEB 5E6JA 2ZW1A 1MI0A 4ZOHC 1DYQA 1SB3C 2Y5PA 4L2YA 1N62A 4HJGE 3P4PB 1ZOYB 1PGXA 5D7GA 1C4PA 4EE2A 2KMMA 1TKEA 2PTLA 3BIID 2Z8LA 2OHFA 2YEPB 1N5XA 2RDGA 1RWSA 4CQNA 1JCKB 1SE4A 4J3OD 1BUIC 3Q8AA 1VZ7A 5BMGA 4L1BA 4KGSA 5FR3A 2M56B 2WXGA 1WSPA 4A6QA 3W1SA 1JWMD 1HA5A 1QILA 2JYEA 3PZ8A 2KDMA 4TSSA 1ET9A 3NVVA 2K0PA 3C8YA 1YQ3B 4XE0A 2MEKA 3ABVB 3Q8BA 5LNK1 5T8IA 3LXFA 5D3IB 1HXYD 1IUEA 3ZYYX 3ZJTA 1XCTL 3NS1A 1KFYB 1FNVA 4OZCA 3HUIA 2INPE 2E3TA 2AX5A 1UWMA 4RFBA 2IGGA 3IAS1 3P63A 2RMMA 1K51A 2GB1A 1OQRA 3I9V1 4WURA 4O1NA 5H8YE 1RM6C 1SIJA 4RF0A 2CJOA 2QIEB 3AE3B 4ZYSA 2IGHA 2NTTA 1BXTA 1NVID 4KX6B 2IGDA 2WU5B 2JSVX 1N60A 1SJHD 4YTPB 1KF6B 4GDKB 5AUIA 2JXTA 2V0GA 3MC0B 2KQ4X 1ENFA 2VZKD 1ZXHA 2DWQA 3N9YC 3AE1B 2N9LA 1C78A 1FFUA 2WDQB 3U2SC 4ZRQA 3VR9B 3PZ7A 1DOYA 4HKQA 4OZAA 5GXGB 1ZXIA 1TJEA 1P7FA 4GLSC 1I4PA 3AE4B 4ITKA 3T3NA 5FK9C 4C7ZA 1I4XA 2CJNA 3FILB 3KWLA 1ZDXA 1FRRA 3VR8B 2BB5A 5BYRA 1I4RA 3WCQA 4HROA 2WXOA 5BMHA 2WLBA 1F0ZA 4MH8A 4N58A 4YSXB 1ZUD2 4IDIA 1GOZA 2X38A 3FILA 4N59A 2R61A 2QJLA 4IKGA 3VRBB 5HI1A 3NZ3A 5C3JB 1ZE3D 3MHZA 3I57A 1JWUD 1JW9D 4FXCA 2ICIA 1XF5L 2ACZB 2I38A 1UUPA 3P4SB 1I4HA 2EELA 4YT0B 3URYA 3NVYA 2JYTA 1E10A 2KACA 3NRZA 3W5VB 1R7SA 5JXVA 2WXHA 1FNUA 3V3XA 4A90A 4KGRA 5MPOA 4B0MA 1V1PB 1UWXA 3DWMA 1SE2A 1GB1A 3W9CB 2RPVA 1SEBD 4MM3B 3SFDB 1L0YB 1I4QA 1JALA 4Q2JA 5C2TB 1C77A 1EWYC 3BK2A 1JQ4A 3LB8C 1J7CA 1UGJA 1Y56A 2IPKD 4AS1A 2L1AA 3BYTB 1QT9A 5HFYA 1F2RI 2VZKB 2BBCA 1JRPA 2WXKA 1PDXA 1KH0A 2HDEA 3IAM1 3P42A 3PO0A 1ET6A 3AEFB 3P1MA 2K22A 1TZOA 1ESFA 3AEDB 1NYQA 3TUOA 4A55A 2IDYA 1TS5A 4AQ7A 1T5XD 2Q5WD 1L0XB 3AEBB 2BS3B 1J7BA 1FCCC 4JPSA 1SBBB 2LGIA 4R3DA 4D2KA 1XLPA 4WWMA 2JU6X 1NEKB 2NTSA 1FEHA 2PIAA 4YSYB 1MHHE 3P4RB 2QMTA 1FCLA 1WWTA 3RPFC 1V8CA 1XLQA 4XWWA 3TEWA 1FM0D 3TSSA 1SE3A 2W54A 4RNAA 3UI3A 1SSNA 4L23A 4US9A 1JWBD 1L4ZB 4JWSC 4A9AA 1JROA 1SXTA 1YN3A 1VDVA 1YN5A 1TS3A 5D3DA 3ZQ4A 3B9JA 2AQ3B 2WQYB 2W82A 4NAWB 1HZ6A 1VRAB 3ZJUA 1D4BA 2H88B 2K9XA 2G9HD 3BVZA 4DXGA 1GPXA 1KLGD 3FC4A 1JWSD 2ON8A 1CK1A 1D5MC 1STEA 1OFFA 4ZHPA 3TEYA 1EU4A 1QF6A 1F2RC 1OQQA 3O13A 3Q8EA 2WP9B 4MT5A 3Q69A 4YTNB 2WXIA 2FBWB 4NZLB 5HG2A 1TY0A 1UNSA 4JWUC 3AMZA 2AQ1B 1C4AA 1VJKA 4ZHOA 1XCQL 4P16A 1E0ZA 1C4CA 2N7JA 1QOFA 2KWDA 4OHJA 5BYSA 5TSSA 4H2AA 1C76A 2V3PA 3W5UB 5AUKA 4OW0A 3U52E 4WIPA 2OEDA 1IBXB 1SF0A 3BVMA 1PFDA 3P4QB 2BYTA 2DYMA 3HVZA 3R2TA 1QOGA 3MFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JX5 A;  1FFV A;  3SFE B;  5MPO A;  4ZOH C;  3DWM A;  3W9C B;  1SB3 C;  4C80 A;  3SFD B;  1N62 A;  3SR6 A;  1JAL A;  2HTM E;  1ZOY B;  2MJD A;  3P4P B;  5C2T B;  1EWY C;  2KMM A;  1TKE A;  3BII D;  1VLB A;  2G1E A;  2M19 A;  2OHF A;  2WDV B;  1JQ4 A;  3LB8 C;  1J7C A;  1N5X A;  2EKI A;  2W55 A;  1RWS A;  1YJJ A;  3NVW A;  2W3R A;  4YTM B;  1QT9 A;  3B2G A;  1JRP A;  1PDX A;  1L5P A;  2M56 B;  3PO0 A;  1NYR A;  4HRS A;  3AEF B;  1XO3 A;  3P1M A;  1A70 A;  2K22 A;  4WQM A;  3AED B;  4LTU A;  1NYQ A;  5EE9 A;  2PKO A;  1XLN A;  3NVV A;  3AE5 B;  5EE0 A;  1ROE A;  1WYG A;  4C7Y A;  1PUT A;  2KAJ A;  1YQ3 B;  3AE9 B;  2Q5W D;  3ABV B;  3AEB B;  2BS3 B;  1J7B A;  1QOB A;  2WS3 B;  3LXF A;  4US8 A;  5EE3 A;  1XLP A;  2BT6 A;  1IUE A;  3ZYY X;  3CWI A;  4WWM A;  3NS1 A;  1KFY B;  1NEK B;  1L6U A;  3AE8 B;  1DOX A;  3HUI A;  2PIA A;  1L6V A;  3P4R B;  4YSY B;  2E3T A;  2AX5 A;  1WRI A;  1UWM A;  4P6V F;  5H92 C;  1WWT A;  3RPF C;  3P63 A;  1V8C A;  1XLQ A;  3AEA B;  1OQR A;  3AH7 A;  3AE6 B;  5H8Y E;  1FM0 D;  1RYJ A;  2PVG C;  1RM6 C;  2W54 A;  3AV8 A;  1SIJ A;  1N61 A;  3L4P A;  2CJO A;  1AWD A;  1E9M A;  2QIE B;  3AEC B;  3AE3 B;  1NVI D;  2BS4 B;  1AYF A;  4A9A A;  1JWB D;  5G5H A;  4US9 A;  1FIQ A;  2WU5 B;  4JWS C;  4KX6 B;  1JRO A;  5AUI A;  1N60 A;  4YTP B;  1KF6 B;  1VDV A;  1NEN B;  5EE1 A;  3B9J A;  1CZP A;  1RFK A;  2WQY B;  2Y5C A;  3DWG C;  4N6E B;  2DBY A;  2WU2 B;  3NVZ A;  2DWQ A;  3AE1 B;  1FXI A;  2H88 B;  2JQR B;  2K9X A;  1WXQ A;  1FFU A;  4USA A;  2WDQ B;  1GPX A;  1J7A A;  2BS2 B;  3FC4 A;  1DOI A;  1YQ4 B;  2H89 B;  2MH7 A;  3VR9 B;  1DOY A;  1NI3 A;  1TKY A;  1OFF A;  4ZHP A;  1QF6 A;  1YJI A;  1OQQ A;  1I7H A;  1XLO A;  5GXG B;  1ZXI A;  1TJE A;  2L83 A;  1ZP0 B;  4JX1 C;  1B9R A;  3EUB 2;  4YSZ B;  3VRA B;  2WP9 B;  1V97 A;  3AE4 B;  2L52 A;  3HRD D;  4ITK A;  3AN1 A;  4YTN B;  4C7Z A;  2CJN A;  2FBW B;  1L0V B;  1GAQ B;  2B76 B;  2MJE A;  3KWL A;  1FRR A;  4JWU C;  3AMZ A;  3AE7 B;  3VR8 B;  1VJK A;  1JWA D;  3WCQ A;  4ZHO A;  4HRO A;  2LEK A;  2CU3 A;  2WLB A;  1E0Z A;  1DGJ A;  3AM9 A;  1E7P B;  1N5W A;  5G5G A;  1KRH A;  2K5P A;  4N58 A;  4YSX B;  1ZUD 2;  1QOF A;  4IDI A;  1WGK A;  3AEG B;  1FRD A;  3B2F A;  1FXA A;  4N59 A;  2QJL A;  3VRB B;  2MJ3 A;  2N0S B;  5C3J B;  3AE2 B;  1FO4 A;  3W5U B;  5AUK A;  1JW9 D;  4FXC A;  1N63 A;  1TKG A;  2ACZ B;  3P4S B;  4YXD B;  3CIR B;  1F0Z A;  1CJE A;  3AEE B;  1E6E B;  2W3S A;  1QLB B;  1SF0 A;  3FAH A;  1TYG B;  2PVO D;  2WDR B;  3NVY A;  1PFD A;  3ETR A;  3P4Q B;  4YT0 B;  1FMA D;  1E10 A;  1T3Q A;  3HVZ A;  1QOA A;  3NRZ A;  3AB5 A;  3W5V B;  1R7S A;  1QOG A; 
#chains in the Genus database with same CATH topology
 1FFV A;  1ZPS A;  5IP4 D;  4MF8 A;  1Z1B A;  2HHQ A;  4A8X C;  4DFM A;  1IGD A;  3X23 A;  4IG7 B;  4UBB A;  3QJZ A;  5J0Q A;  4M6W A;  2DZI A;  3LK9 A;  3PT2 B;  2LVP A;  4MSM B;  4M02 A;  4FAD A;  2BCU A;  2RP5 A;  2P35 A;  2FAZ A;  2Y9T A;  8ICZ A;  1TK8 A;  3OJU A;  1V9P A;  1QQ6 A;  4QZ8 A;  3T3O A;  2OM6 A;  4I2F A;  2FMS A;  4EUT A;  1QSL A;  1S9F A;  2ZIV A;  2D11 A;  1PVR A;  1N6Z A;  2KKC A;  4HKZ E;  2C5L C;  8ICH A;  1XLN A;  3A9K B;  3GP7 A;  4KSL C;  2EMS A;  2AYO B;  2KAJ A;  1D5Z C;  4Y2U A;  1ZQM A;  4ECX A;  1E5W A;  2DLB A;  3GS2 A;  4YFK A;  4US8 A;  5E6P A;  4RQ1 A;  2IBK A;  1VZ8 A;  3JPP A;  1Q8K A;  4O3R A;  1EO6 A;  2MUT B;  1L6U A;  2E5S A;  2H3Q A;  1HUO A;  4OZB A;  1WRI A;  5KFP A;  2J52 A;  4YMM A;  1WRD B;  2DFL A;  2K60 A;  5H92 C;  4W9D A;  4I2J A;  3AE6 B;  5KFF A;  9ICR A;  4PT5 A;  2W8K A;  4LDT B;  3EZ5 A;  1J0G A;  1DOQ A;  1TS2 A;  2E6X A;  3QAR A;  3QZ7 A;  2AGP A;  1ARO P;  2BS4 B;  4UDU C;  1FIQ A;  2SAK A;  3N1X C;  4DSE A;  4AUQ C;  5E6N A;  3LVW A;  1CZP A;  1RFK A;  1EXN A;  2RQ5 A;  3DV9 A;  2DBY A;  4DFJ A;  1YNT E;  2FID A;  3NVZ A;  4ANV A;  1PGB A;  1BPB A;  4HCP B;  2KX0 A;  4USA A;  3GDX A;  4W9G A;  3E56 A;  1ZDV A;  4Y2Q A;  1KW4 A;  5KFU A;  3DBH B;  1HEK A;  1PGA A;  4REZ A;  4UBC A;  5IIJ A;  5KFO A;  2RR9 A;  2K3U A;  1XLO A;  2KDF B;  2W9C A;  1EM7 A;  3ZDM C;  3Q2A C;  5KT7 A;  3D2Q A;  2FE8 A;  5ALP A;  4BWJ A;  5CHG A;  3ECI A;  5KHO A;  3VRA B;  1URJ A;  3ZKJ C;  1TK0 A;  3E9S A;  5EDS A;  3MJ5 A;  5AKJ A;  5FP0 A;  4ECW A;  2LHE A;  3BWU D;  4ITK A;  3HHM A;  1GJZ A;  2ZIW B;  5AKH A;  4EEN A;  5KFW A;  2QIL A;  2P6R A;  3DBL I;  1M4V A;  1WR1 A;  5KFN A;  4HWI B;  4W9C A;  3EGR A;  2F3N A;  2WF5 A;  3SAF A;  1OEY J;  2F44 A;  1TKD A;  4ARI A;  4IC7 B;  4DQQ A;  2MA9 B;  2LI5 A;  2NYV A;  4OVZ A;  2LYB A;  3Q8S B;  1SL0 A;  4ACF A;  4I2H A;  1T6B X;  5BMI A;  9ICG A;  2IMW P;  7ICP A;  1TTN A;  1QCK A;  4K7U A;  1DGS A;  1KTK A;  2KYW A;  2G45 B;  2KOX A;  4C4V A;  5ALI A;  4O3N A;  5BPC A;  4WAF A;  4QZF A;  9ICL A;  2LXA A;  5L1J A;  2DGZ A;  1XO1 A;  8ICM A;  3J9C A;  2DF4 B;  4RT2 A;  3M95 A;  4NQL B;  4GXI A;  5T14 A;  4QJF B;  4RU9 A;  2AGO A;  2RDI A;  1SV4 A;  3C21 A;  5AI4 A;  2UVV A;  2PI5 A;  2WDV B;  2LRW A;  1GB4 A;  4DHJ D;  7ICO A;  2Z7J A;  2I9G A;  1WWV A;  3UQ2 A;  7ICL A;  3KUZ A;  4IM0 A;  4KLM A;  2WAQ F;  3H8W A;  9ICX A;  4XRH A;  1RLF A;  3RJE A;  2MBE A;  3TMP B;  2MLB A;  5ALN A;  3QQ8 B;  4DSI A;  1NYR A;  3I3T B;  2LGS A;  2UU7 A;  2LUM A;  3PRP B;  1UGM A;  2KKP A;  3ISC A;  4ECR A;  3VXW A;  3KH0 A;  7ICS A;  3ICX A;  3TAD C;  5EE3 A;  2G08 A;  7ICR A;  2KHQ A;  4TUS A;  3V6C B;  1DOX A;  3GB1 A;  2JRI B;  4JMU A;  2MX2 A;  4EZ6 A;  1D3Z A;  1C20 A;  2RSU A;  1ACC A;  2J53 A;  3Q8F A;  2NR2 A;  4XZ4 A;  1ZET A;  1KL9 A;  2LYH A;  3L4P A;  4JE3 B;  2OXO A;  2KIV A;  3CNH A;  2CRX A;  3KYC D;  1SE9 A;  4DQR A;  3OSN A;  3JPR A;  1NEN B;  3K9P B;  3KWV A;  4TQS A;  5J0P A;  2BZF A;  3A9J A;  4HVB A;  5L9X A;  2V9H A;  4N6E B;  2BKE A;  3QU2 A;  2ZUC A;  7ICK A;  2FIF A;  1L8O A;  2G06 A;  2ZJA A;  4CHK A;  1LB2 B;  3VUX A;  5KT3 A;  1T0Y A;  1LQB A;  1FEZ A;  2W9M A;  5KAF U;  1ZQV A;  3CF6 E;  3PGE A;  4XDC A;  4UB5 A;  1NI3 A;  4TUQ A;  4PJ0 U;  3A9K A;  4LVS A;  2N4F A;  4E0D A;  3OJ3 A;  3PTF C;  1LKY A;  4NL9 A;  3NGD A;  3AU4 A;  3ISB A;  3ZO5 B;  4IRK A;  2HHT A;  2L8J A;  2L52 A;  4UAS A;  4HYK A;  3PRE A;  4PH5 A;  2F1J A;  2ZIX A;  3VAW A;  3G6X A;  3TEX A;  2GMI C;  3QC8 B;  4DQP A;  3DVG Y;  2FLN A;  4ECT A;  3N1Y C;  4F7Z A;  2C7N B;  5IIO A;  4WH4 A;  1ZQN A;  4NLG A;  1FXA A;  4BOZ B;  3IG8 A;  5AKG A;  2AEH A;  2KJ5 A;  8ICS A;  4EEY A;  3RB0 A;  3CW2 C;  3Q8L A;  1E6E B;  2W3S A;  4IR1 A;  2WDR B;  5E79 U;  3AB5 A;  4EOY A;  1HTO A;  1K53 A;  3TFR A;  1A0P A;  3GFK B;  2WXP A;  2EAP A;  4J9O A;  2DPJ A;  3CST A;  3ZXR A;  1DYQ A;  4C0Z A;  5J0W A;  2KMM A;  2PTL A;  4BBN F;  1KFS A;  2YEP B;  2RRD A;  4HLE A;  1ZQA A;  4Y2R A;  1S0O A;  4B9K A;  1JCK B;  1PK3 A;  4RQ5 A;  5G2N A;  1L3V A;  4J3O D;  4NJ7 A;  4GXJ A;  5ALX A;  1Z5S B;  1QLN A;  3WU2 U;  2WXG A;  2PI4 A;  3PR4 A;  3W1S A;  1QIL A;  3PZ8 A;  1ET9 A;  3V7K A;  8ICG A;  4HXD A;  2DUY A;  5J2E A;  4MGY E;  3N1Z C;  1YQ3 B;  2PFN A;  4ELV A;  2DZJ A;  2MEK A;  3IG3 A;  4HCN B;  4IWP A;  5T8I A;  3RT3 B;  2W9B A;  1TGZ B;  3ML9 A;  8ICY A;  3DQV A;  1XCT L;  3NS1 A;  3N32 A;  3ZJT A;  1FNV A;  2KJR A;  3DVN V;  4G11 A;  4OZC A;  2JZ3 B;  2P6U A;  1WCL A;  3DDH A;  3QEB Z;  2IGG A;  2BCR A;  1OGW A;  1K51 A;  2GB1 A;  4O1N A;  1QTM A;  1BPX A;  5KT2 A;  1MJD A;  2QIE B;  4ZYS A;  3C19 A;  1RZT A;  1KLN A;  1BXT A;  3WKA A;  3UIO B;  3RJI A;  4OCZ A;  5J2C A;  2WU5 B;  4KX6 B;  4Y2S A;  1WX9 A;  4QZD A;  5J2H A;  3UIN B;  2YB4 A;  4YXJ A;  3HKZ C;  1YZ6 A;  3S6J A;  2JXT A;  4AYB F;  1UT8 A;  1X42 A;  2J6S A;  5L1K A;  3ZDE A;  4XQ8 A;  1N56 A;  8ICR A;  2ZG6 A;  3B0Y A;  1S97 A;  1T7P A;  3AE1 B;  3JPO A;  2W03 A;  3THV A;  5K4L A;  1ZQE A;  1C78 A;  2DZK A;  2KWC A;  2W9N A;  1JXE A;  3L16 A;  2XIC A;  1NJY A;  2DPI A;  4S0R A;  4HKQ A;  1SV0 C;  4RNM A;  1U4A A;  5J2F A;  2AL6 A;  3KKA A;  4DXA B;  4FBJ B;  3UQA A;  4NQK E;  3GIM A;  4K7S A;  4U6P A;  1ZXI A;  4YMN A;  4GLS C;  4A8E A;  1NJZ A;  1KSP A;  4DLE A;  1TAQ A;  4LZG A;  1I4P A;  3AE4 B;  3LDZ E;  4UB3 A;  4C7Z A;  3H0M B;  4HDQ A;  4MH0 E;  1FRR A;  4OJL A;  3RRH A;  2CR5 A;  3WK4 A;  1H38 A;  1HUZ A;  2WLB A;  4MH8 A;  1Z4N A;  1WXA A;  5DCN A;  1ZQK A;  3RJH A;  4RM9 A;  2F77 X;  2MBQ A;  2KN7 A;  9ICJ A;  2R61 A;  3VRB B;  1A77 A;  4F8R A;  3QAQ A;  5HI1 A;  2KSO B;  4KIT B;  4EEK A;  3MHZ A;  4MEX A;  3I57 A;  4HPM B;  4II2 B;  1JW9 D;  2ICI A;  1J97 A;  3ISD A;  1UUP A;  3BQ0 A;  5J2D A;  1I4H A;  2LMR A;  1ED1 A;  1OEY A;  3PHX B;  3NRZ A;  1S76 D;  1WXS A;  3W5V B;  1SKR A;  5KL1 B;  1N48 A;  1E8Z A;  2LZ6 A;  5JXV A;  4C4V B;  5GMV A;  1B4F A;  3V3X A;  4AP9 A;  4KGR A;  4K81 A;  1V1P B;  9ICS A;  1KRP A;  1GB1 A;  2I1J A;  1YOV B;  3C2M A;  5B5E U;  1D8B A;  1LM8 B;  4KLS A;  1L0Y B;  4KZC A;  3SFD B;  2PEA A;  5HKH A;  5HHH A;  3WK7 A;  5C2T B;  2N9X A;  5ALR A;  4YMO A;  1TAU A;  1V38 A;  1Z00 A;  2NRW A;  5AI0 A;  1L6N A;  1EUV B;  1Q1O A;  1HE8 A;  2Z0E B;  3BK2 A;  5HNK A;  3RH6 A;  1KDH A;  3LB8 C;  4QAY A;  2NRZ A;  5KNI A;  3DDC B;  4AS1 A;  3BYT B;  4BVU C;  3VH4 B;  1QT9 A;  1TK5 A;  3PVX A;  2ISP A;  2ZIU A;  2VZK B;  5AKK A;  3DEE A;  4EBE A;  3MGH A;  4BXO A;  5CJ7 A;  1IP9 A;  3PO0 A;  2YTU A;  3Q3O C;  5DKW A;  5AK3 A;  3N7P D;  4CE6 A;  4UAW A;  5IIL A;  2JMG A;  5ALH A;  4AQ7 A;  2EQY A;  3LVV A;  1T5X D;  1V49 A;  4BKS D;  4JPS A;  2BS3 B;  1P1A A;  1SBB B;  2LGI A;  2W9A A;  1K1S A;  3RCZ A;  4JUZ A;  3GIJ A;  7ICF A;  2KNB A;  2JU6 X;  3ZI4 A;  2NTS A;  1FEH A;  2G4D B;  1MHH E;  2QMT A;  1FCL A;  3BZK A;  2DKX A;  5DPS A;  2L3Z A;  1COK A;  4Q43 A;  9ICM A;  1WJN A;  2ZUD A;  2WHE A;  3L3F X;  4QZG A;  1SE3 A;  4Z6D A;  1Y8R C;  1MQ2 A;  1WX8 A;  4L23 A;  1L4Z B;  2JHD A;  4N9F 4;  1YN5 A;  3J81 j;  5D6J B;  1TS3 A;  2BYE A;  4CRX A;  2LM1 A;  3B9J A;  3E0F A;  4DO9 A;  3SI8 A;  2AQ3 B;  2KXJ A;  1MC8 A;  3ZQ4 A;  3JYU A;  5J2I A;  1HZ6 A;  1VRA B;  3TFS A;  3PHW B;  5C5J A;  1F9J A;  4NV0 A;  1GPX A;  2YVC A;  2G9H D;  3BVZ A;  2J0K A;  3VTU A;  2N7D A;  3FC4 A;  2ALZ A;  1E8Y A;  7ICE A;  3NJT A;  3MAB A;  1CK1 A;  2LVQ A;  4HAI A;  2AQ4 A;  5KFM A;  2KTF A;  1NBF C;  4MEM A;  4Y2J A;  1V86 A;  5F9N A;  3QE9 Y;  2QB0 A;  4NLN A;  4MT5 A;  2KLC A;  2WXI A;  3CRX A;  2BQ3 A;  4IQU A;  2FLL A;  1TY0 A;  3TQ1 A;  2MSE D;  4X57 B;  1UNS A;  5JH5 C;  2J7Q B;  4F2S A;  2AQ1 B;  4ZHO A;  3RNB C;  3M3J A;  2BVC A;  3PX6 A;  3C28 A;  4I2G A;  3IHQ B;  1WY8 A;  3ENE A;  3HK0 A;  2N7J A;  1Q3V A;  1WXM A;  3ZNG C;  2ZTE A;  2Y9U A;  2XCA A;  3PW0 A;  3DOW A;  4F72 A;  1C76 A;  3F2B A;  2IO2 B;  2V3P A;  3VHT C;  4KLE A;  5KG1 A;  4UB2 A;  3U52 E;  3HP6 A;  3EC8 A;  3RNG C;  1IBX B;  1JMS A;  3T5L A;  1UEL A;  5AM1 A;  3BQT A;  3U30 A;  3HM6 X;  4I2B A;  1J2M A;  3HVZ A;  2D3C A;  3GE3 C;  4DOC A;  1JN3 A;  2QHO A;  3ZTC A;  5J18 A;  3RFZ B;  2G5I B;  4TV3 A;  3EHV A;  1TVA A;  4UQG A;  3QHT A;  2BTE A;  4C80 A;  4G50 A;  4B9S A;  2UVU A;  5CRX A;  4C8M A;  2VA3 A;  4JV0 A;  2QSD A;  1LO5 D;  2WF6 A;  3CMM B;  4RQ4 A;  4OJ5 A;  1NZP A;  2R8K A;  1OXJ A;  1V1P A;  3D32 A;  2KTR B;  1E7U A;  3NVW A;  5ALO A;  1OQY A;  2KT7 A;  2HI0 A;  3EPI A;  4W9F A;  3MC8 A;  2IND C;  7ICJ A;  2I1K A;  2INC C;  1L7N A;  4QZA A;  1X40 A;  4Z6E A;  4I6P A;  4DXF A;  1XO3 A;  5AM3 A;  1A70 A;  3N97 B;  4F50 A;  1FD6 A;  2FLP A;  2JWU A;  3RBE A;  5JU5 A;  2ZPN A;  3F5E A;  2VRR B;  2FUG 1;  3BDP A;  2GO7 A;  4J6I A;  5JHA A;  2LGX A;  1SL2 A;  1NKC A;  3KFU F;  1WJ6 A;  4EBC A;  4P4O A;  4JIO U;  2KEY A;  2MBH A;  5HHD G;  1BPY A;  3BZD B;  2WX1 A;  1XEE A;  3BVG A;  2KVC A;  2AQ2 B;  3G6Y A;  3Q8Q B;  2ZUB A;  3I63 C;  1XNS A;  2OOB B;  4P1C C;  2FCM A;  4AJW A;  2JZP A;  3U4E G;  3DPD A;  2GLE A;  2DL0 A;  1N61 A;  1H4R A;  4YG2 A;  4EZ9 A;  2NPT A;  2QAR B;  5AKE A;  4DEZ A;  2D3D A;  4RQM A;  2TSS A;  3WKB A;  3T9L A;  2L76 A;  2QEJ C;  5L1L A;  4GMV A;  3M63 B;  1ZQD A;  2M0N A;  2XGP A;  2IOH A;  1VD2 A;  2AH5 A;  3Q8C A;  2ZIU B;  1UBQ A;  2WNM A;  5AK5 A;  3F2C A;  4NLC A;  3PPA A;  3WK5 A;  3QA8 A;  3QWZ B;  4MHV A;  3GZN B;  1TE2 A;  1DOI A;  1SKW A;  2KVR A;  4I2I A;  4BKG A;  4CF4 A;  1E7V A;  1Z2M A;  4ACO A;  1SXD A;  1XSN A;  4WWN A;  4LK0 M;  3AUO A;  4JX1 C;  3RH4 A;  3PNC A;  2LJI A;  5KFE A;  2WX0 A;  2K4E A;  5J2B A;  3AN1 A;  2ES6 A;  2DYO A;  4C56 C;  1NK6 A;  4J9N A;  1LFD A;  3BY4 B;  4KGT A;  4WAA A;  5JHB A;  4B9N A;  3DBR B;  2WXR A;  9ICN A;  1JWA D;  2HSZ A;  2WB1 F;  3TIX A;  4UB4 A;  2LPE A;  4ECZ A;  3HJE A;  4LNF A;  4AYB C;  2A1J B;  1KRH A;  1XT9 B;  2CHX A;  2ONQ A;  3HKZ F;  4GU2 A;  1ZD5 A;  2R2O A;  2JVC A;  3BS5 A;  1FRD A;  4F4X A;  3V7L A;  2AJQ A;  4DL3 A;  4P0P B;  5TIS U;  2N0S B;  1WYW B;  4ZH4 A;  3N20 C;  1KLU D;  3ED5 A;  1KKX A;  1TKG A;  4FHK A;  2M0X A;  3R3M A;  2D8C A;  1MFW A;  1CJE A;  4K4H A;  1TYG B;  4GDL A;  3ETR A;  1L5U A;  3B08 A;  4FO6 A;  3TCA A;  2JUO A;  3N30 A;  1ZJM A;  4KTQ A;  1B0X A;  3ZXV A;  1KOT A;  4Q44 A;  1KTQ A;  1UBI A;  2KE7 A;  2Y0S F;  1T8E A;  3A9J B;  2JF5 A;  4GDL B;  2JRH A;  2FDR A;  1HQR D;  4CDG A;  2C28 A;  3C23 A;  3BK1 A;  4IS7 A;  2M4N A;  8ICO A;  1VLB A;  2BR0 A;  8ICL A;  2M19 A;  1Q10 A;  4IW0 A;  2LBO A;  4GXB A;  3H8J A;  3PRZ A;  2K8B A;  2W55 A;  2X8X X;  2BPC A;  4KLO A;  2J6T A;  4MJS B;  4DQO C;  2JEF A;  4G3I A;  4DHZ E;  3GIL A;  4F5Q A;  1F77 A;  5F3X B;  4KZ0 A;  3JW0 X;  3V62 A;  2Q4T A;  4KX3 A;  3RH5 A;  1L5P A;  5AKX A;  4NJ8 A;  1NK7 A;  3PR5 B;  3QX7 A;  1F1H A;  1UZX B;  4GB9 A;  4TMA B;  5J0Y A;  2PE9 A;  2MA1 A;  4K7W A;  4QIW F;  3L5K A;  3C1Z A;  5F9L A;  2WS3 B;  5L1I A;  4DOB A;  4DSF A;  3CWI A;  1Y88 A;  2KTQ A;  2KNJ A;  3R8B A;  3V6K A;  4K1R B;  4KSK C;  1U49 A;  4P6V F;  4NWI A;  1MN8 A;  2F1H A;  5ALW A;  2IO1 B;  4BDP A;  4IOI E;  1SJE D;  2XI9 A;  2PVG C;  2G09 A;  4RH6 A;  3WAN A;  2VH1 A;  2XVT A;  2XCP A;  1R4M I;  2KC1 A;  2KLG A;  4ASW C;  1L7Y A;  4C4R A;  4K4I A;  1XS9 D;  1IPG A;  2Y0S C;  4KMO B;  4IWQ A;  2BCS A;  4F93 B;  2LAS A;  2WDT B;  2WF7 A;  1X9M A;  5ALU A;  5L1M A;  5AZH A;  1YN4 A;  4UAZ A;  4MEY A;  2WFA A;  2H89 B;  5J2K A;  1YD8 U;  3IM1 A;  2WHI A;  5CTR C;  4Q8F A;  4ZDV A;  2AXT U;  3GOE A;  1EWC A;  4C8N A;  1B9R A;  4QZE A;  5D49 A;  2MBO A;  3HRD D;  2K1F A;  1WWU A;  3KUC B;  4ZRI A;  1BPE A;  8ICW A;  1GAQ B;  2B76 B;  4QWB A;  2MJE A;  1WX7 A;  3V05 A;  2V1Y A;  9ICB A;  1YZ7 A;  3W2D A;  3ONN A;  4QZB A;  1N5W A;  1KN5 A;  1IIP A;  5I4D A;  1UH6 A;  1NK4 A;  2F2A B;  2M8S A;  4RPY A;  4YWG G;  3K4G A;  2HW3 A;  5ALZ A;  1WF9 A;  1D6E C;  5J2R A;  4NL9 C;  3IT6 B;  3R9K A;  5HHI A;  4LJP B;  1ZOL A;  2UWQ A;  7ICV A;  2YB1 A;  7ICM A;  3L10 B;  2HOQ A;  3CIR B;  8ICN A;  3JSV A;  2XNA C;  3AEE B;  2PVO D;  4B6W A;  3FAH A;  3DHH C;  5KFK A;  3DHI C;  1BGX T;  1T3Q A;  3T5H A;  5BYQ A;  1T0R C;  3M9N B;  2KFN A;  4RGM A;  3SV3 A;  1WG8 A;  2BQU A;  2QCZ A;  3H4B A;  1U48 A;  3QXG A;  4ZOH C;  4J9M A;  1SB3 C;  4L2Y A;  3V72 A;  4Y2P A;  5KG4 A;  2VIX A;  3P4P B;  3RNA C;  2ZJ5 A;  1PGX A;  5D7G A;  4EEW A;  4R8U B;  2LYA A;  1C4P A;  4EZL A;  3BII D;  2OHF A;  3BJY A;  2LKY A;  4O3O A;  1RWS A;  4CQN A;  3R66 C;  3DBS A;  1IM4 A;  4JWM A;  3Q8A A;  1GO3 F;  1VZ7 A;  5FR3 A;  4KGS A;  4EYH B;  1U9L A;  3KHR A;  2NBU A;  3A0H U;  2A1J A;  1HA5 A;  3H8S A;  2KDM A;  3APD A;  3ZDC A;  3NVV A;  2KIC A;  2K0P A;  3AXC A;  3PW4 A;  4O9M A;  2Q0Z X;  3SZ2 A;  2RD0 A;  4XE0 A;  4NXZ A;  3ABV B;  4PGX A;  5JRT A;  5IIM A;  3WAP A;  1HTQ A;  3RZW C;  2HHU A;  5AI6 A;  3QU5 A;  4ECS A;  5JZE B;  2PXI A;  1KFY B;  3AU6 A;  2K4I A;  2PFQ A;  1E8W A;  2INP E;  2Z0D B;  1WGH A;  2E3T A;  2CKH B;  2KJH B;  4O3Q A;  3H7P A;  3IAS 1;  4RFB A;  9ICI A;  3ONS A;  1Z19 A;  4I28 A;  3Q8P B;  5A0L A;  3QIJ A;  4F4K A;  4WUR A;  3H8M A;  1X6I A;  5LXI B;  5DBA A;  3M6Z A;  9ICE A;  1SIJ A;  2FPL A;  3DBH I;  2CJO A;  4RF0 A;  3WIM A;  2NTT A;  5GTH U;  4P0P A;  4C8L A;  2JH1 A;  2RGF A;  4R63 A;  1WR6 E;  3QUC A;  5DG8 A;  2JSV X;  3QNM A;  4YTP B;  5AUI A;  1KF6 B;  5IOI A;  2XGQ A;  2CHZ A;  1OTR B;  2V0G A;  4P4M A;  3MC0 B;  2ASD A;  3PLU A;  4YCX A;  4I29 A;  1F52 A;  1NJW A;  2K39 A;  5ALL A;  2GOW A;  5KFC A;  2PJH A;  1ZQB A;  3RJF A;  1XU4 A;  2K8B B;  2MRL A;  1AAR A;  5DQI A;  3VR9 B;  1UPH A;  2WAQ C;  3MR6 A;  3DBL B;  4KDI C;  1DOY A;  1COO A;  5HP4 A;  2GBM A;  4CCH A;  3G6V A;  3QUT A;  4F4W A;  3MDA A;  8ICP A;  2C60 A;  2DEN B;  3FM9 A;  1ZGU B;  4PHP A;  5GXG B;  1CMX B;  5DB8 A;  3ZW3 A;  4ECU A;  3T3N A;  1UT5 A;  3F53 A;  3MC1 A;  5FK9 C;  2PE6 B;  3FIL B;  4MF2 A;  5J0R A;  1NNL A;  1ZDX A;  3VR8 B;  1WM2 A;  2W8L A;  9ICK A;  4YSX B;  4DSK A;  1WFY A;  4KLI A;  2M17 A;  1Z3E B;  3FIL A;  4IC9 A;  2KG5 A;  2HD5 B;  4IKG A;  1R4N B;  1MSW D;  3WK9 A;  3Q8M A;  4MGK E;  3NZ3 A;  5C3J B;  4LCD E;  1JWU D;  1T3N A;  4UB6 U;  1XF5 L;  2R8H A;  3P4S B;  1D9F A;  2EEL A;  5AI8 A;  1XO0 A;  1WUD A;  2JYT A;  2KX3 A;  3DHG C;  1E10 A;  2KAC A;  4DL5 A;  3HIZ A;  2CPR A;  4KLT A;  4CGZ A;  4II3 B;  1ZD2 P;  3GZF A;  5MPO A;  4PYU A;  1UWX A;  4M9L A;  2GBR A;  3DWM A;  1NI2 A;  2EH9 A;  3OLM D;  5KFQ A;  3WAM A;  1XD3 B;  4QW9 A;  4YR2 A;  3GII A;  3SQI A;  3SAH A;  1JQ4 A;  3JVZ X;  5DDY A;  4UB1 A;  2W04 A;  2L1A A;  3VC8 A;  5H2F U;  4LDT D;  2BHN A;  2XID A;  1DRG A;  5DLF A;  1KBU A;  2YQE A;  5KG0 A;  4Q45 A;  2GWS A;  4NY8 A;  1PQS A;  1WIA A;  3H6N A;  4I6N B;  4P0Q B;  1YQB A;  2ASQ A;  2XK5 A;  2HDE A;  3P42 A;  1ZQF A;  1RQL A;  1ET6 A;  3BIN A;  5ALK A;  2V4Q A;  3AED B;  3TUO A;  1NYQ A;  2KWV B;  3A4R A;  3UIP B;  4A55 A;  5DBB A;  2IDY A;  1BNO A;  2KZM A;  1P0R A;  4FJV B;  2Q5W D;  1L0X B;  5HR6 A;  1J7B A;  2EAM A;  1FCC C;  1F5S A;  1XLP A;  1J2N A;  5KFX A;  3PML A;  2D3G A;  3EPG A;  4W9L A;  1X6J A;  3EFC A;  3KTQ A;  1NKB A;  4FZL A;  4B9T A;  4NLZ A;  1V8C A;  2V3S A;  4C4T A;  4XWW A;  4Y2T A;  3GQC A;  4PPX A;  3HPO A;  2KKV A;  4BX9 C;  1FM0 D;  2QB1 A;  2ZVN A;  4A3O A;  5ALE A;  2KFK A;  2UYZ B;  4JWS C;  1JRO A;  2OJW A;  8ICU A;  2CS4 A;  1NK8 A;  2E8N A;  5D3D A;  2WF9 A;  4NAW B;  2WF8 A;  3B0X A;  1CEZ A;  1ZW7 A;  3AI5 A;  3MTN B;  3RB6 A;  4RQ2 A;  3KKA C;  4KMU A;  2H88 B;  1KLG D;  1ZQW A;  1ZKH A;  1D8Y A;  1RQN A;  4BOS C;  2D10 A;  2ON8 A;  1D5M C;  2IA6 A;  5DPW A;  1EU4 A;  1S8O A;  5KFA A;  1OQQ A;  3PO4 A;  3RD2 A;  3C5G A;  3RBD A;  3Q8E A;  1S0M A;  4RQ0 A;  4YTN B;  3C1Y A;  4URK A;  2ODG A;  2ZXI A;  5DB7 A;  2BCV A;  2KN5 A;  2IO3 B;  2NS5 A;  3IP4 B;  4PK1 A;  4JWU C;  3AMZ A;  1VJK A;  3HWT A;  1HJP A;  5J2G A;  1SKS A;  3O65 B;  2O2V A;  8ICK A;  2FI1 A;  1RYR A;  2D07 B;  1WGD A;  3DVN U;  4ANW A;  4YQW A;  4WJN A;  4B9L A;  8ICI A;  4H2A A;  2G3Q B;  2DAJ A;  3W5U B;  1TT5 B;  5AKL A;  5AUK A;  4G3X B;  5KTQ A;  2OED A;  4AOF A;  2M1M A;  3C5F A;  4W9E A;  1SF0 A;  3P4Q B;  4BJQ A;  4FBU A;  2BYT A;  5ALQ A;  3R2T A;  5DB6 A;  4R66 A;  3MFG A;  3SAG A;  5C0Y A;  2DHZ A;  4IQT A;  5CR0 A;  3L0W B;  2HBJ A;  1XQQ A;  4CYE A;  3OWE B;  5HMM A;  4KLH A;  2ZPY A;  5AZG A;  1BPD A;  1WH3 A;  1T4G A;  5ALJ A;  3M62 B;  4ZYN A;  2DQN B;  4KLF A;  3BS7 A;  3EW9 A;  1L7M A;  5J8Y A;  5EWE A;  2EKI A;  5AIA A;  1KFT A;  4NLB A;  5AI5 A;  4KLG A;  4F3O A;  4W9H A;  1C9F A;  4YTM B;  1O03 A;  3E2E A;  5J8Y C;  2WXN A;  4M04 A;  2ZTC A;  3B2G A;  2AU0 A;  2ZEQ A;  3QYP A;  1K8R B;  4HRS A;  3ZGZ A;  2L32 A;  4JB3 A;  4F91 B;  1Q3U A;  4A3P A;  4DBG A;  1WZ3 A;  1MG4 A;  4QIW C;  4A20 A;  1SZH A;  2K4H A;  1EU3 A;  3JPQ A;  4ICV A;  2HHX A;  1V80 A;  2K4P A;  2VAN A;  1Q46 A;  1L7O A;  1JIH A;  4J9K A;  3RAX A;  3ZNH B;  3Q3F A;  1PVP A;  2HE7 A;  1NKE A;  2LVO A;  4PS8 A;  3ZD8 A;  1K52 A;  2BQR A;  4ZRJ A;  4KKJ A;  4RCO A;  3KQ4 A;  3FDS A;  3OG5 A;  3U7Z A;  4F1S A;  1NJX A;  2ZCC A;  4IUM B;  3RRG A;  1CRX A;  2BPS A;  5FKA C;  5AK4 A;  3SV4 A;  4GDK A;  5AZF A;  5TR5 A;  4HDO A;  3ZUN A;  1WJ4 A;  3QK0 A;  4ZRP A;  4QZI A;  1MHX A;  1VZ6 A;  3O0F A;  3PS6 A;  3UMC A;  4WWO A;  3DWG C;  2WU2 B;  2JRZ A;  5EOZ A;  4HK2 A;  5L95 C;  2LMC A;  3MDC A;  4RUC A;  2XK5 B;  1J7A A;  4PHE A;  1UCV A;  3Q8R B;  4DFK A;  3Q3M C;  3EFU A;  1P7D A;  4GFJ A;  1E8X A;  2WTF A;  2N1W A;  2LRU A;  2OCE A;  4XWT A;  4RNN A;  4C8O A;  4PL1 A;  2V3N A;  4YSZ B;  2IO0 B;  3ZTD A;  4EKU A;  3CP8 A;  1B1Z A;  1QKZ A;  2J0J A;  3RR8 A;  5AHX A;  4RPZ A;  2P66 A;  8ICE A;  2LEK A;  4F5P A;  2BDP A;  1VR9 A;  4F5R A;  3N4M B;  2PLP A;  3NS8 A;  4HEA 1;  2JPH A;  2K5P A;  4NY0 A;  2KIW A;  2W9B B;  2WXL A;  3IHP C;  1IBX A;  5J17 A;  3AEG B;  2KDE B;  3RAQ A;  3KVF B;  4PHD A;  2KC2 A;  4KLL A;  3BYY B;  3UXN A;  3JPT A;  2BW2 A;  2L05 A;  3VQI A;  3NUQ A;  4EX7 A;  3IT4 B;  1FO4 A;  1JML A;  3RNE C;  2LFI A;  2IJ0 A;  2KAN A;  3ZDD A;  2KD0 A;  2FNJ B;  2YY6 A;  1QLB B;  4KDL B;  1HIW A;  2VKQ A;  4RGN A;  1QOA A;  5KFD A;  1WXV A;  2JX5 A;  1ZQU A;  5AEK B;  3L54 A;  4B0E A;  2AQ0 A;  9ICP A;  2J4X A;  2LGD A;  3PX4 A;  4YR0 A;  2L5Y A;  2FMQ A;  1B22 A;  5KFS A;  2MJD A;  4M47 A;  1BVS A;  2NV3 A;  1XSL A;  3M8R A;  5LXH A;  2FMP A;  1S5L U;  2SEB D;  1I35 A;  3M6K A;  5DG9 A;  3TAC B;  1NK5 A;  4I27 A;  2YMM A;  1YJJ A;  4E3C A;  4TQ1 A;  1ZRN A;  2N9K A;  1BT0 A;  4ANU A;  4WJQ A;  4FUL A;  3KUD B;  2REX A;  2XY7 A;  3OSP A;  1WE7 A;  5GTI U;  5KFR A;  3ALR A;  4DS5 A;  2JH7 A;  4WQM A;  3PSF A;  4PHA A;  4F4Y A;  4LTU A;  4DF8 A;  5EE0 A;  4C8K A;  1A6S A;  2K6D B;  4RQN A;  1ROE A;  2PKO A;  3FYH A;  4KLU A;  4C7Y A;  2KSO A;  2Y1I A;  3AE9 B;  5BO4 B;  1B43 A;  5EWF A;  4YXM A;  1K50 A;  1N2X A;  4Y2X A;  4LLG M;  4NJC A;  2RDH A;  1L6V A;  3IXS A;  4J9S A;  5TZV A;  3QU9 A;  2ZW0 A;  4MAC A;  2IOF A;  2O2V B;  3AH7 A;  2J6U A;  2XBB C;  1ZQO A;  1RYJ A;  1WMH B;  3BS5 B;  3AEC B;  4IQW A;  4XA5 A;  5BOL A;  2H5X A;  4LNK A;  4Y2Y A;  2KOB A;  3RB3 A;  3PO5 A;  2KMD A;  5BOM A;  3TEZ A;  1UA0 A;  1GG3 A;  1ZQY A;  3D2S A;  2KZR A;  3PRM B;  1KFD A;  5EE1 A;  1ZD4 A;  2BWE S;  5KFL A;  4JL9 A;  3T8M A;  3OJS A;  1NK9 A;  1AW7 A;  1BNP A;  3PW2 A;  1HZ5 A;  1FXI A;  2JQR B;  2XN9 C;  1WXQ A;  2E8M A;  2BS2 B;  1RAX A;  1YQ4 B;  3LDA A;  3KW5 B;  2V4L A;  2NCN A;  1TKY A;  2JT4 B;  3QZ8 A;  4FA6 A;  2WXM A;  1LVH A;  2JZB B;  4XUS A;  4F8C B;  9ICU A;  1L0V B;  1UD7 A;  4TQ0 A;  2HTH A;  5J29 A;  7ICN A;  2MP2 B;  1XXG A;  2NMQ A;  3PSI A;  5G5G A;  2GI9 A;  3RUL A;  4CF3 A;  3KYD D;  5IN7 A;  3I1Y A;  1RG6 A;  1SXE A;  3HX0 A;  1WGK A;  3T3F A;  1ZQC A;  2WXF A;  3QX1 A;  1MVK A;  3KLS X;  4FS1 A;  4KKI A;  1WCN A;  2E1E A;  1S0V A;  2KDI A;  3PW5 A;  2N1R A;  2ISO A;  3A1Q B;  1IG6 A;  4WQO B;  3LWM A;  1TFR A;  3UMG A;  1IGC A;  4XX5 A;  3RMK C;  4KLJ A;  4BFR A;  3ZJV A;  1PUZ A;  3KD3 A;  4GOC A;  3SFE B;  1Z1V A;  4ED7 A;  5E6J A;  1J8C A;  4GXK A;  3GU3 A;  3IBE A;  1ZJN A;  3UGB B;  2UVR A;  2EAN A;  2PFO A;  1CI4 A;  1ZOY B;  2HJ8 A;  1TV9 A;  3V61 A;  2XY5 A;  3PVL A;  4UAR A;  4UW9 A;  4LJO B;  4EE2 A;  4TUU A;  2JZB A;  2Z8L A;  2JY6 A;  2RLT A;  4KLD A;  2RDG A;  4QNL A;  1C7Y A;  4IR9 A;  2FCN A;  3S2A A;  1SE4 A;  2YML A;  3M1Y A;  4I6L B;  3ORY A;  3KBB A;  4FZN A;  4Z6C A;  4DFP A;  4FLH A;  3QU7 A;  1LXD A;  4BBN C;  5AK6 A;  4DDG D;  4RPX A;  2BGW A;  4M9H A;  4A6Q A;  4B9M A;  1JWM D;  8ICF A;  4C4S A;  2JEJ A;  4J9L A;  2G0A A;  2EZZ A;  3WKE A;  4R64 A;  2HOF A;  3R7Q A;  4RT3 A;  1WJU A;  3C8Y A;  4DL6 A;  4M0W B;  3SEI A;  3Q8B A;  2QKQ A;  2C2D A;  4F5N A;  4ED2 A;  4M9G A;  4Q8E A;  3ZDA A;  2B0C A;  4FS2 A;  3DVG X;  5D3I B;  2BPG A;  1HXY D;  3TAP A;  1IUE A;  3VUW A;  4RQ3 A;  2N7E A;  2GBN A;  3TI0 A;  2CN1 A;  4DL4 A;  3HUI A;  4DCC A;  3KHH A;  1UWM A;  3P63 A;  4DFD A;  1OQR A;  3D2N A;  2IHM A;  4KN7 A;  1M6Y A;  1RM6 C;  2YX8 A;  3TAD A;  4I2E A;  2IGH A;  1NVI D;  3NTU A;  5IAA C;  4WJP A;  1UQV A;  3TL5 A;  1KEJ A;  1N60 A;  3SD7 A;  1SJH D;  2XEW A;  4QWC A;  2KHV A;  1UF0 A;  5HML A;  1WMH A;  2KQ4 X;  4MM3 A;  5KFT A;  2F8L A;  2VZK D;  3SMV A;  2HMX A;  5D94 A;  2E1F A;  1GC6 A;  3PW7 A;  4TUP A;  3OHA A;  3M9O B;  2MAX A;  3U2S C;  1V81 A;  1Q5W B;  2BPF A;  2KTR A;  3PSE B;  2LJ5 A;  4ANX A;  3PZ7 A;  3WKC A;  2NRV A;  1OW5 A;  4O5C A;  2JZZ A;  1RXW A;  2LWP A;  4GIV A;  4OZA A;  2FPM A;  2WB1 C;  3WAO A;  3MGV A;  3I76 A;  1YIW A;  5DGB A;  4YN4 A;  3SHQ A;  1OUQ A;  1TJE A;  4JGH B;  1PZN A;  1P7F A;  1FPY A;  4U7C A;  1ZQI A;  3Q8K A;  4FE3 A;  5CB1 A;  1D9D A;  2JGA A;  2AHO B;  3I28 A;  2AL3 A;  4EZK A;  3KWL A;  2BB5 A;  2KWU B;  5BYR A;  1I4R A;  5BMH A;  4FFD A;  4HRO A;  2D6F C;  2JR5 A;  2YMQ A;  1F0Z A;  4NJ6 A;  4JV2 A;  3AQE A;  2G5H B;  1ZUD 2;  4IRC A;  8ICT A;  1KJT A;  2X38 A;  1WGG A;  3M7D A;  4MFA A;  1RYS A;  1E90 A;  4P1B C;  1ZE3 D;  1C3T A;  3OGU A;  4FXC A;  1YX5 B;  2K89 A;  2ACZ B;  2I38 A;  2GBK A;  2NBV B;  3QUQ A;  4B9V A;  4K3B A;  2KHW B;  1WZ0 A;  2N9P C;  4O3M A;  2B6G A;  5IA7 A;  2FUH B;  1DXS A;  4BUG A;  2IYD B;  1FNU A;  2ATL A;  1DK2 A;  4B0M A;  3RJJ A;  1SEB D;  4RUA A;  2K6Q A;  1I4Q A;  1JAL A;  3M8S A;  8ICX A;  3TAR A;  1C77 A;  2JV3 A;  4NM2 A;  5KFI A;  1XSP A;  1J7C A;  1UGJ A;  5KL8 B;  2IPK D;  4OD0 A;  3PZP A;  4B95 A;  1VJ5 A;  1WI0 A;  2F76 X;  2I1Q A;  2WGS A;  1QQ5 A;  1A5R A;  1ZQR A;  2B21 A;  4UAT A;  5AKZ A;  5AM5 A;  3KZI U;  3M9M B;  4DL2 A;  1V5O A;  1EF5 A;  1PDX A;  5ALD A;  4JV1 A;  3IAM 1;  2DKZ A;  3ZDT A;  3AEF B;  3P1M A;  2K22 A;  1TZO A;  2ZZP B;  1ESF A;  2A3V A;  1FXT B;  3RNC C;  4ECY A;  2VA8 A;  3RZF A;  3HM3 A;  1TS5 A;  1R4M B;  2R8I A;  3AEB B;  2KQ7 A;  4D2K A;  4ELU A;  2KDB A;  1PK1 B;  5CHF A;  1NEK B;  4QZC A;  4JWN A;  2JEI A;  2LUE A;  4YSY B;  3P4R B;  1X9X A;  1S10 A;  5KFH A;  2KJ6 A;  4BWM A;  3RPF C;  9ICC A;  1RRB A;  1NZB A;  3SDL C;  2L00 B;  2IBI B;  1X9S A;  4DHZ B;  4YD1 A;  1K1Q A;  4G0N B;  2WYQ A;  2W54 A;  4RNA A;  3A0B U;  1ZQP A;  5KFB A;  5DGA A;  3PMN A;  2K25 A;  1SSN A;  1SL1 A;  1JWB D;  1YN3 A;  2N9E B;  4MGI E;  1O08 A;  1VDV A;  4B9U A;  4XYC A;  3WAL A;  2OYY A;  2IZV B;  4E71 A;  4M6W B;  4GC7 A;  5IIN A;  3H4D A;  2KVS A;  2NRT A;  1D4B A;  4O3S A;  1TBE A;  7ICQ A;  4DXG A;  2NO5 A;  3APC A;  1JWS D;  3U7D A;  3AUL A;  3BQ1 A;  1QSS A;  2C7M B;  2J0M A;  3H9D A;  1STE A;  2XO7 A;  1OFF A;  4ZHP A;  3UM9 A;  3NOB A;  2A19 A;  7ICT A;  4OJP A;  4FHJ A;  3LJ3 A;  5IIK A;  2CHW A;  2DYB A;  2WP9 B;  4MJS A;  3Q69 A;  3T5K A;  2FBW B;  1I42 A;  3N28 A;  3PZD A;  2FCQ A;  2EKE C;  2MQJ A;  3NG0 A;  4DS4 A;  4FJY A;  1QOF A;  5JUM A;  2FPK A;  4EYI B;  3UPQ A;  2AWT A;  5IO9 A;  1ZQH A;  3LYS A;  3VCB A;  1UHU A;  5D46 A;  2BWF A;  2HDO A;  3Q14 C;  1H8C A;  7ICG A;  1PFD A;  3W1S C;  1P98 A;  1BPZ A;  2KZZ A;  3EYZ A;  1C1Y B;  1QOG A;  4EEL A;  4UAU A;  3SYZ A;  2KK8 A;  4F71 A;  4LZD A;  5L83 A;  1QZE A;  2KN4 A;  2QC8 A;  2R8J A;  3B1L X;  2NVU I;  7ICU A;  1J19 A;  2BF8 B;  3H8H A;  3WKD A;  2Z59 B;  3P2B A;  2KP7 A;  1YJ1 A;  4RGO S;  3IG5 A;  1ZQ1 C;  3NAS A;  4KN4 A;  5JTI A;  5J0O A;  1KM7 A;  2ZVO A;  1NK0 A;  2L0T A;  3TJP A;  5J2A A;  2EZX A;  5EE9 A;  5KFJ A;  2BCQ A;  3AE5 B;  1L2N A;  1KLV A;  4QW8 A;  3RR7 A;  2IY0 B;  4EFO A;  3HT3 A;  1PUT A;  1V2Y A;  3TBL D;  2HHS A;  2YEP F;  3FKY A;  2BT6 A;  4YP3 A;  3Q3N C;  4J9Q A;  5AKI A;  4IRD A;  4M01 A;  3WA0 A;  4KV2 A;  1D8L A;  4P4P A;  3V6E B;  4XDD A;  4M9N A;  3U26 A;  1WM3 A;  3TAN A;  3AEA B;  3H40 A;  4Z6F A;  2C2E A;  1ZQG A;  4GGQ A;  4DSJ A;  4XC2 A;  1IV8 A;  4IL6 U;  2OWO A;  1C79 A;  1ZRM A;  2FE9 A;  4GIB A;  2O6V D;  2ZXH A;  1E9M A;  2BKF A;  2WXJ A;  4FZM A;  1ZQL A;  2QAR A;  4UAY A;  1ZQQ A;  1AYF A;  1QQR A;  5G5H A;  4RQ6 A;  2NRX A;  5DQH A;  3HIL A;  2ZTD A;  3KHG A;  3GV8 B;  1P7E A;  1T0Q C;  2KFK B;  2E8P A;  2KJ9 A;  1L3T A;  2A1A A;  4WJ3 B;  3QEA Z;  2V4I B;  3NUH B;  4MFC A;  3UMB A;  5KG5 A;  3MJW A;  1SGH A;  4LNI A;  4PGY A;  1G6J A;  1GC7 A;  2D2Q A;  2KK0 A;  3ZVV A;  2I5H A;  1YMH E;  3LWL A;  2I2Y A;  4BZA A;  3SEB A;  1P3Q U;  2D5G A;  2MH7 A;  2N1V A;  2QLT A;  3EA6 A;  1Q0W B;  2K8A A;  5AIB A;  4RQ8 A;  1R4N I;  1YJI A;  2C7H A;  3UXP A;  1I7H A;  4RMA A;  2HHV A;  3I5J C;  2H3V A;  3JPN A;  1MG8 A;  2WWZ A;  3V6H A;  2PW9 A;  4R65 A;  1IXR A;  3SEN A;  2JEG A;  2KD1 A;  2MP2 A;  1S77 D;  3AE7 B;  3MP9 A;  3VFK A;  1WGY A;  2HHW A;  4RZR A;  1NOM A;  2RPQ A;  4W9I A;  1X66 A;  3K1Z A;  1L4D B;  1DGJ A;  3AM9 A;  4ICA A;  3ZNZ B;  2DNF A;  8ICA A;  4LNN A;  4OVV A;  2NPT B;  1WE6 A;  1MA7 A;  3BZC A;  1SWW A;  2BB6 A;  4MSQ B;  3PV8 A;  2F8K A;  1X1M A;  2PMV A;  1N63 A;  5DLG A;  4YXD B;  5KHQ A;  4RQ7 A;  5ALG A;  3IN5 A;  1JXL A;  1FMA D;  5KT6 A;  5KFZ A;  2D3B A;  4ED6 A;  3HVD A;  2W43 A;  4HPL B;  1RFA A;  3PSP A;  5J0T A;  3A1Q A;  1SV0 A;  2V9W A;  1V1O A;  2KV2 A;  4B6J A;  4TQR A;  3SR6 A;  4GLX A;  2LXC A;  3NHE B;  3SD5 A;  3C29 A;  2HTM E;  4YL8 A;  1Z00 B;  1MPE A;  3H7S A;  1LKY B;  4ICU A;  2G1E A;  7ICH A;  4OJO A;  1ZQJ A;  1QQ7 A;  2E8O A;  2WXQ A;  3NZU A;  1TAM A;  5KT5 A;  4ECV A;  4ED1 A;  4NAM A;  3RB4 A;  4ARC A;  4G9B A;  5KFY A;  2HOI A;  2Y3A A;  2W3R A;  2XC9 A;  3H7I A;  4KX5 A;  1S0N A;  3IDW A;  1WGR A;  4X5V A;  4BXO B;  2I6X A;  2G07 A;  2PMZ C;  1ZQT A;  1AN8 A;  1GUA B;  1JRU A;  4IWO A;  4RF1 A;  1FNW A;  5ALT A;  2BKR B;  3R2I A;  8ICV A;  1L3S A;  2KVZ A;  1TS4 A;  2MUT A;  4BGD A;  4M0W A;  3QU4 A;  4DWI A;  5AM4 A;  4P7I A;  4WWP A;  1WYG A;  1V6E A;  5KG7 A;  3PX0 A;  4NM1 A;  4IM2 A;  3KZX A;  3AEV A;  1QOB A;  4I2D A;  4KLQ A;  2L0F A;  2VJ5 A;  5KAI U;  3AE8 B;  2MHJ A;  4HJK A;  3SU8 X;  5AIC A;  4MGZ E;  2MWS B;  2KFZ A;  2YMP A;  1RYU A;  5AI9 A;  2MRP A;  4BAX A;  3NZS A;  1RDF A;  3GE8 C;  3K1R B;  5C1Z A;  3LYY A;  1LGR A;  1AQ6 A;  1S3S G;  2J42 A;  3AV8 A;  2EDU A;  1AWD A;  3APF A;  3VTW A;  2FJ6 A;  2HBL A;  2INN E;  3K9O B;  2YN4 A;  2ZJ8 A;  4J9R A;  2BYF A;  4JQW C;  1IYF A;  2MU2 A;  4LJX A;  1TY2 A;  4FJZ A;  9ICT A;  1X9W A;  5DB9 A;  2ZNV B;  2KO3 A;  4W9K A;  2Y5C A;  3MBY A;  4EX6 A;  4F92 B;  5D2M B;  1L8L A;  4O3P A;  2JXX A;  1ZYQ A;  2RDB C;  2QB0 B;  1BML C;  2IY1 B;  3T5J A;  3N7S C;  7ICI A;  1ZQX A;  4MEL A;  9ICO A;  3AU2 A;  2LGY A;  2H3F A;  3UQ0 A;  4J03 A;  2IHN A;  2W9C B;  2H3Z A;  3VTV A;  1JUD A;  2L83 A;  1ZP0 B;  5FR6 A;  4BKS A;  3EUB 2;  3MR5 A;  3AL0 B;  1V97 A;  4IQV A;  3F2D A;  2GRI A;  1A76 A;  2BDU A;  2M0A A;  1PYW D;  1ZQS A;  3VUY A;  3ZNI D;  4WJO A;  3H0L B;  2LHD A;  3WK6 A;  1MQ3 A;  3RUI B;  3A4S C;  2CU3 A;  2R2Q A;  1I4G A;  1E7P B;  4M9J A;  4KIK B;  3EEC A;  1V5T A;  3CSF A;  5IKC M;  1SZP A;  1KQQ A;  2DX5 B;  3Q3J A;  3MGI A;  3GV7 B;  5AM2 A;  1SGG A;  2A5U A;  1CQV A;  1D5X C;  2MJ3 A;  2MCN B;  2W7O A;  3AE2 B;  3IVF A;  3OAW A;  4OVU A;  2HBM A;  3X0W A;  4KVG B;  8ICJ A;  4C00 A;  4DL7 A;  1NDD A;  3MR3 A;  4LNO A;  3UXO A;  2UVW A;  2ZJD A;  3A33 B;  3Q6B A;  4RGT A;  4O5K A;  3B2F A;  2HBK A;  4S17 A;  3IRU A;  2JXJ A;  3KOO A;  1HEZ E;  3BQ2 A;  2ZW1 A;  2O6K A;  1MI0 A;  4ZRK A;  5DBC A;  4F5O A;  2Y5P A;  3ZD9 A;  1N62 A;  2LM4 A;  2PFP A;  2C2R A;  4HJG E;  4ECQ A;  4FBT A;  4QWD A;  4DLG A;  2LHT A;  3UF8 A;  1TKE A;  4AWJ A;  2F1I A;  5ALV A;  1N5X A;  2W11 A;  3AQF A;  1V9J A;  4GSW A;  3MHS D;  4MDK E;  4M8N A;  4XGA B;  4PGQ A;  4DK5 A;  1T0S C;  1BUI C;  3ZDB A;  1S1Q B;  2VH2 A;  1TZ1 A;  5BMG A;  4QZ9 A;  4L1B A;  2NBW B;  2XY6 A;  2M56 B;  2OJR A;  1WSP A;  2GBJ A;  3NY5 A;  4PS7 A;  2JYE A;  4TSS A;  4BKT A;  1U4B A;  4QWA A;  2KJ8 A;  4YVZ A;  4J9P A;  2RHF A;  4PYZ A;  1DK3 A;  2HCF A;  5LNK 1;  3LXF A;  3K75 D;  5KG6 A;  3MR2 A;  4K3C A;  3ZYY X;  4EBD A;  5CP2 A;  4PL2 A;  5KG2 A;  4M00 A;  5C23 A;  2AX5 A;  2ZIX B;  2H3I A;  2O6V B;  2RMM A;  2YLM A;  3I9V 1;  4K4G A;  4JLC A;  5H8Y E;  5E6O A;  2ASL A;  1U45 A;  3ML8 A;  3AE3 B;  2MSN A;  8ICB A;  3RNF C;  3PLV A;  2M9N A;  3N7R C;  2IGD A;  1PVQ A;  4Y2V A;  1VCB A;  4GDK B;  2GOL A;  2R8G A;  5DQG A;  2ZCB A;  3OPX A;  1ENF A;  1ZXH A;  3DCG A;  2PKE A;  2DWQ A;  3N9Y C;  5KFV A;  2D3A A;  2N9L A;  2GH1 A;  1QH9 A;  3L08 A;  2KMA A;  1FFU A;  1JX4 A;  2WDQ B;  1P9D U;  4E74 A;  1RPL A;  4DHJ B;  4ZRQ A;  5KT4 A;  1L7P A;  4AP4 C;  1LV5 A;  2IOF K;  3V6J A;  2W7P A;  4DSL A;  4IM3 A;  3UQB A;  2K8H A;  3C0R B;  4YR3 A;  1X2I A;  4O0I A;  1ISN A;  3PY8 A;  4RNO A;  1M94 A;  5J0S A;  4HPP A;  3PST A;  3IV6 A;  2CJN A;  1I4X A;  2C22 A;  3MC9 A;  5ALM A;  3CYM A;  3ZIM A;  5G55 A;  3C2L A;  3H7P B;  3U8Z A;  4P0Q A;  3WCQ A;  2WXO A;  1K5O A;  3RFA A;  1QSY A;  4P2H A;  3GZN I;  4N58 A;  3ZRC A;  1XC9 A;  3RJK A;  2K8C B;  2KZ3 A;  4IDI A;  4DF4 A;  1GOZ A;  2EMT A;  1PK1 A;  4DOA A;  2OEH A;  4N59 A;  2QJL A;  1GNU A;  1TIF A;  4KIK A;  4M0A A;  2BQQ A;  1ZQZ A;  4CO7 A;  4EZJ A;  2HVH A;  4YT0 B;  3URY A;  1ZD3 A;  3NVY A;  5III A;  3EWA A;  4ED8 A;  2HJ1 A;  3V7J A;  3DBR I;  1R7S A;  1T94 A;  2OH2 A;  2WXH A;  5ALF A;  4A90 A;  9ICV A;  4DQS A;  3IFW B;  5CX3 A;  1SE2 A;  3JSV B;  3W9C B;  2RPV A;  4MM3 B;  1XWL A;  2Y5B B;  4Q2J A;  2CU1 A;  2LI6 A;  2G4S A;  5B66 U;  1EWY C;  5DG7 A;  3L17 A;  1V85 A;  2PMZ F;  4YD2 A;  3ZLZ A;  3ZRF A;  1Y56 A;  2ZNV C;  2MW5 A;  2PPH A;  2ZIV B;  4ELT A;  2BYV E;  4M2Y A;  5J2J A;  3VDZ A;  5HFY A;  1F2R I;  3KHL A;  2A4Z A;  2EZY A;  5DPR A;  2BBC A;  1JRP A;  2WXK A;  4GC6 A;  1KH0 A;  4DDI D;  3W1Y A;  5EWG A;  3PV1 A;  3TAQ A;  3F5A A;  5CA7 A;  2EAO A;  1F44 A;  4TKN A;  5D4B A;  3ALB A;  4R3D A;  3MFH A;  4MFF A;  4GN1 A;  3RF9 A;  3N3K B;  2VJ4 A;  3TKA A;  1EF1 A;  2VA2 A;  4DQI A;  3B0A A;  4WWM A;  2LD9 A;  3RI7 C;  5CEH A;  2C9W B;  4CNQ A;  4JK1 A;  2GLS A;  2PIA A;  3NRW A;  5HR7 A;  4M8M A;  2ESE A;  5LLI A;  2V4R A;  3GIK A;  3C2K A;  1WWT A;  3D6J A;  2B3A A;  3VVW B;  3WK8 A;  1UA1 A;  1XLQ A;  4UAV A;  3TEW A;  3TSS A;  9ICF A;  8ICQ A;  9ICH A;  3UI3 A;  4PZO A;  5AM0 A;  5J0U A;  3T79 A;  3QCA A;  4R8U A;  8ICC A;  4NAW A;  4O5E A;  3OJ4 B;  3GV5 B;  4A9A A;  4US9 A;  9ICW A;  1SXT A;  2KMC A;  3VH3 B;  5ALY A;  5J0X A;  3R7R A;  2QDF A;  1JI7 A;  2AGQ A;  4NNJ B;  1SIF A;  3RTV A;  2Y1J A;  2WQY B;  2W82 A;  5KG3 A;  3ZJU A;  3QUB A;  2BGF A;  1YT3 A;  2K9X A;  5KFG A;  3JPS A;  3HW8 A;  3E58 A;  1U47 A;  3AU5 A;  4PS3 A;  4PZN A;  2KFJ A;  1SWV A;  4ED3 A;  2ASJ A;  2DAF A;  4ED0 A;  4CF5 A;  2CXY A;  3TEY A;  4F2R A;  2KQS A;  1Z4O A;  5AKY A;  2DZM A;  1QF6 A;  3BQ7 A;  2ZIW A;  4F4Z A;  5CWR A;  1F2R C;  2FCS A;  1ECW A;  5DDM A;  4FN2 A;  2JWZ A;  5ALS A;  1YX6 B;  4NLK A;  3O13 A;  4RM8 A;  4NPN A;  5HG2 A;  4NZL B;  5DPT A;  1CUK A;  4AJY B;  9ICQ A;  3OHB A;  4OO1 J;  4W9J A;  4DWF A;  1L3U A;  1C4A A;  2RDJ A;  2O6V A;  1XCQ L;  3V60 A;  4P16 A;  1E0Z A;  9ICA A;  2MBB B;  4OJ6 A;  2NO4 A;  1C4C A;  1F0M A;  4I2C A;  3RN9 C;  2KWD A;  4OHJ A;  5BYS A;  5TSS A;  5CHW A;  5CHV C;  4QZH A;  3RJG A;  3H1U A;  3H0R B;  3L13 A;  2HVI A;  4UB8 U;  4QWE A;  4OW0 A;  3OTQ A;  4TUR A;  4WIP A;  2K8C A;  2R18 A;  3BVM A;  3ETL A;  3RYT A;  2DYM A;  2L7R A;  1RXV A;  3MFI A;  4I2A A; 
#chains in the Genus database with same CATH homology
 3RFZ B;  1FFV A;  1ZPS A;  4A8X C;  1IGD A;  3OWE B;  2BTE A;  4C80 A;  2QSD A;  2KN4 A;  1LO5 D;  2EKI A;  3H8H A;  1V1P A;  1C9F A;  3NVW A;  4YTM B;  3T3O A;  3B2G A;  2WXN A;  4RGO S;  4HRS A;  4DXF A;  1XO3 A;  3ZGZ A;  1A70 A;  2L32 A;  5EE9 A;  1FD6 A;  4HKZ E;  2JWU A;  3AE5 B;  1XLN A;  3GP7 A;  2FUG 1;  1PUT A;  1D5Z C;  2DLB A;  1EU3 A;  2KAJ A;  3GS2 A;  2YEP F;  4US8 A;  2BT6 A;  1VZ8 A;  5HHD G;  1L6U A;  3BZD B;  1XEE A;  3BVG A;  2AQ2 B;  4OZB A;  1WRI A;  2J52 A;  5H92 C;  4XDD A;  1K52 A;  2JZP A;  4KKJ A;  3AEA B;  3KQ4 A;  4RCO A;  3U4E G;  3AE6 B;  4PT5 A;  3U7Z A;  1C79 A;  1N61 A;  1E9M A;  1TS2 A;  2E6X A;  2TSS A;  2WXJ A;  2BS4 B;  1AYF A;  1QQR A;  4UDU C;  5FKA C;  5G5H A;  1FIQ A;  2QEJ C;  1P7E A;  2SAK A;  4ZRP A;  1MHX A;  2V4I B;  1VZ6 A;  3NUH B;  1CZP A;  1RFK A;  3Q8C A;  3DWG C;  2DBY A;  1YNT E;  2WU2 B;  3NVZ A;  2WNM A;  1PGB A;  2LMC A;  1YMH E;  2I2Y A;  4USA A;  3SEB A;  1J7A A;  2D5G A;  3E56 A;  1DOI A;  1ZDV A;  2MH7 A;  3EA6 A;  1PGA A;  4REZ A;  4XWT A;  1YJI A;  1I7H A;  2K3U A;  1XLO A;  4LK0 M;  1EM7 A;  4JX1 C;  2LJI A;  2V3N A;  4YSZ B;  2FE8 A;  3VRA B;  3AN1 A;  2DYO A;  2PW9 A;  4C56 C;  1QKZ A;  1B1Z A;  3E9S A;  4KGT A;  3MJ5 A;  2LHE A;  2WXR A;  3AE7 B;  3BWU D;  3MP9 A;  1JWA D;  2LEK A;  1VR9 A;  1L4D B;  1DGJ A;  3AM9 A;  2PLP A;  4HEA 1;  1KRH A;  2K5P A;  2ONQ A;  2QIL A;  1M4V A;  2WXL A;  1IBX A;  3AEG B;  1FRD A;  3EGR A;  3BYY B;  2BB6 A;  2BW2 A;  3VQI A;  4ARI A;  3IT4 B;  2N0S B;  1FO4 A;  1JML A;  2LFI A;  1KLU D;  1N63 A;  2PMV A;  1TKG A;  4OVZ A;  4YXD B;  2IJ0 A;  1CJE A;  1TYG B;  1QLB B;  1T6B X;  5BMI A;  3ETR A;  4RGN A;  1FMA D;  1QOA A;  3HVD A;  1KTK A;  2JX5 A;  4B0E A;  4WAF A;  1V1O A;  2J4X A;  3J9C A;  4GDL B;  3SR6 A;  1HQR D;  2HTM E;  2MJD A;  3BK1 A;  1MPE A;  1VLB A;  2G1E A;  2M19 A;  2WDV B;  2WXQ A;  1Q10 A;  1GB4 A;  2W55 A;  2SEB D;  4NAM A;  4ARC A;  4DQO C;  1YJJ A;  4TQ1 A;  2Y3A A;  2W3R A;  1F77 A;  2N9K A;  1AN8 A;  1L5P A;  4RF1 A;  1FNW A;  3R2I A;  1NYR A;  2LUM A;  4WQM A;  1TS4 A;  4LTU A;  2PKO A;  4M0W A;  5EE0 A;  1ROE A;  4TMA B;  1WYG A;  4C7Y A;  3AE9 B;  1QOB A;  2WS3 B;  5EE3 A;  1K50 A;  3CWI A;  3AE8 B;  4LLG M;  4NJC A;  1DOX A;  2RDH A;  1L6V A;  3R8B A;  3GB1 A;  3IXS A;  4P6V F;  4MAC A;  2ZW0 A;  1ACC A;  3AH7 A;  2J53 A;  3Q8F A;  3LYY A;  4IOI E;  1SJE D;  1RYJ A;  2PVG C;  2J42 A;  3AV8 A;  4JE3 B;  3L4P A;  3AEC B;  4RH6 A;  1AWD A;  2INN E;  3TEZ A;  1TY2 A;  1NEN B;  3KWV A;  5EE1 A;  2Y5C A;  4N6E B;  1AW7 A;  1HZ5 A;  1YN4 A;  1FXI A;  2JQR B;  2XN9 C;  1WXQ A;  1BML C;  2BS2 B;  1YQ4 B;  2H89 B;  4XDC A;  1NI3 A;  1TKY A;  2WXM A;  1EWC A;  2L83 A;  1ZP0 B;  1B9R A;  3EUB 2;  1V97 A;  2M0A A;  2GRI A;  3HRD D;  2L52 A;  1PYW D;  1L0V B;  1GAQ B;  2B76 B;  2MJE A;  3V05 A;  4TQ0 A;  2LHD A;  1XXG A;  3TEX A;  2CU3 A;  3W2D A;  2NMQ A;  1I4G A;  1E7P B;  1N5W A;  5G5G A;  2GI9 A;  5I4D A;  4YWG G;  1WGK A;  4WH4 A;  1FXA A;  1D6E C;  2WXF A;  3IT6 B;  1MVK A;  3KLS X;  1CQV A;  1D5X C;  2MJ3 A;  4KKI A;  3AE2 B;  3CIR B;  2XNA C;  1E6E B;  2W3S A;  2PVO D;  2WDR B;  3FAH A;  3AEE B;  1T3Q A;  4RGT A;  5BYQ A;  3AB5 A;  1IGC A;  3B2F A;  1K53 A;  3ZJV A;  4RGM A;  1HEZ E;  2WXP A;  3SFE B;  5E6J A;  2ZW1 A;  1MI0 A;  4ZOH C;  1DYQ A;  1SB3 C;  2Y5P A;  4L2Y A;  1N62 A;  4HJG E;  3P4P B;  1ZOY B;  1PGX A;  5D7G A;  1C4P A;  4EE2 A;  2KMM A;  1TKE A;  2PTL A;  3BII D;  2Z8L A;  2OHF A;  2YEP B;  1N5X A;  2RDG A;  1RWS A;  4CQN A;  1JCK B;  1SE4 A;  4J3O D;  1BUI C;  3Q8A A;  1VZ7 A;  5BMG A;  4L1B A;  4KGS A;  5FR3 A;  2M56 B;  2WXG A;  1WSP A;  4A6Q A;  3W1S A;  1JWM D;  1HA5 A;  1QIL A;  2JYE A;  3PZ8 A;  2KDM A;  4TSS A;  1ET9 A;  3NVV A;  2K0P A;  3C8Y A;  1YQ3 B;  4XE0 A;  2MEK A;  3ABV B;  3Q8B A;  5LNK 1;  5T8I A;  3LXF A;  5D3I B;  1HXY D;  1IUE A;  3ZYY X;  3ZJT A;  1XCT L;  3NS1 A;  1KFY B;  1FNV A;  4OZC A;  3HUI A;  2INP E;  2E3T A;  2AX5 A;  1UWM A;  4RFB A;  2IGG A;  3IAS 1;  3P63 A;  2RMM A;  1K51 A;  2GB1 A;  1OQR A;  3I9V 1;  4WUR A;  4O1N A;  5H8Y E;  1RM6 C;  1SIJ A;  4RF0 A;  2CJO A;  2QIE B;  3AE3 B;  4ZYS A;  2IGH A;  2NTT A;  1BXT A;  1NVI D;  4KX6 B;  2IGD A;  2WU5 B;  2JSV X;  1N60 A;  1SJH D;  4YTP B;  1KF6 B;  4GDK B;  5AUI A;  2JXT A;  2V0G A;  3MC0 B;  2KQ4 X;  1ENF A;  2VZK D;  1ZXH A;  2DWQ A;  3N9Y C;  3AE1 B;  2N9L A;  1C78 A;  1FFU A;  2WDQ B;  3U2S C;  4ZRQ A;  3VR9 B;  3PZ7 A;  1DOY A;  4HKQ A;  4OZA A;  5GXG B;  1ZXI A;  1TJE A;  1P7F A;  4GLS C;  1I4P A;  3AE4 B;  4ITK A;  3T3N A;  5FK9 C;  4C7Z A;  1I4X A;  2CJN A;  3FIL B;  3KWL A;  1ZDX A;  1FRR A;  3VR8 B;  2BB5 A;  5BYR A;  1I4R A;  3WCQ A;  4HRO A;  2WXO A;  5BMH A;  2WLB A;  1F0Z A;  4MH8 A;  4N58 A;  4YSX B;  1ZUD 2;  4IDI A;  1GOZ A;  2X38 A;  3FIL A;  4N59 A;  2R61 A;  2QJL A;  4IKG A;  3VRB B;  5HI1 A;  3NZ3 A;  5C3J B;  1ZE3 D;  3MHZ A;  3I57 A;  1JWU D;  1JW9 D;  4FXC A;  2ICI A;  1XF5 L;  2ACZ B;  2I38 A;  1UUP A;  3P4S B;  1I4H A;  2EEL A;  4YT0 B;  3URY A;  3NVY A;  2JYT A;  1E10 A;  2KAC A;  3NRZ A;  3W5V B;  1R7S A;  5JXV A;  2WXH A;  1FNU A;  3V3X A;  4A90 A;  4KGR A;  5MPO A;  4B0M A;  1V1P B;  1UWX A;  3DWM A;  1SE2 A;  1GB1 A;  3W9C B;  2RPV A;  1SEB D;  4MM3 B;  3SFD B;  1L0Y B;  1I4Q A;  1JAL A;  4Q2J A;  5C2T B;  1C77 A;  1EWY C;  3BK2 A;  1JQ4 A;  3LB8 C;  1J7C A;  1UGJ A;  1Y56 A;  2IPK D;  4AS1 A;  2L1A A;  3BYT B;  1QT9 A;  5HFY A;  1F2R I;  2VZK B;  2BBC A;  1JRP A;  2WXK A;  1PDX A;  1KH0 A;  2HDE A;  3IAM 1;  3P42 A;  3PO0 A;  1ET6 A;  3AEF B;  3P1M A;  2K22 A;  1TZO A;  1ESF A;  3AED B;  1NYQ A;  3TUO A;  4A55 A;  2IDY A;  1TS5 A;  4AQ7 A;  1T5X D;  2Q5W D;  1L0X B;  3AEB B;  2BS3 B;  1J7B A;  1FCC C;  4JPS A;  1SBB B;  2LGI A;  4R3D A;  4D2K A;  1XLP A;  4WWM A;  2JU6 X;  1NEK B;  2NTS A;  1FEH A;  2PIA A;  4YSY B;  1MHH E;  3P4R B;  2QMT A;  1FCL A;  1WWT A;  3RPF C;  1V8C A;  1XLQ A;  4XWW A;  3TEW A;  1FM0 D;  3TSS A;  1SE3 A;  2W54 A;  4RNA A;  3UI3 A;  1SSN A;  4L23 A;  4US9 A;  1JWB D;  1L4Z B;  4JWS C;  4A9A A;  1JRO A;  1SXT A;  1YN3 A;  1VDV A;  1YN5 A;  1TS3 A;  5D3D A;  3ZQ4 A;  3B9J A;  2AQ3 B;  2WQY B;  2W82 A;  4NAW B;  1HZ6 A;  1VRA B;  3ZJU A;  1D4B A;  2H88 B;  2K9X A;  2G9H D;  3BVZ A;  4DXG A;  1GPX A;  1KLG D;  3FC4 A;  1JWS D;  2ON8 A;  1CK1 A;  1D5M C;  1STE A;  1OFF A;  4ZHP A;  3TEY A;  1EU4 A;  1QF6 A;  1F2R C;  1OQQ A;  3O13 A;  3Q8E A;  2WP9 B;  4MT5 A;  3Q69 A;  4YTN B;  2WXI A;  2FBW B;  4NZL B;  5HG2 A;  1TY0 A;  1UNS A;  4JWU C;  3AMZ A;  2AQ1 B;  1C4A A;  1VJK A;  4ZHO A;  1XCQ L;  4P16 A;  1E0Z A;  1C4C A;  2N7J A;  1QOF A;  2KWD A;  4OHJ A;  5BYS A;  5TSS A;  4H2A A;  1C76 A;  2V3P A;  3W5U B;  5AUK A;  4OW0 A;  3U52 E;  4WIP A;  2OED A;  1IBX B;  1SF0 A;  3BVM A;  1PFD A;  3P4Q B;  2BYT A;  2DYM A;  3HVZ A;  3R2T A;  1QOG A;  3MFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...