1FFUA

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
155
Chain Sequence
KKIITVNVNGKAQEKAVEPRTLLIHFLREELNLTGAHIGCETSHCGACTVDIDGRSVKSCTHLAVQCDGSEVLTVEGLANKGVLHAVQEGFYKEHGLQCGFCTPGMLMRAYRFLQENPNPTEAEIRMGMTGNLCRCTGYQNIVKAVQYAARKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
total genus 45
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1ffuA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ffuA01
3DWMA 3VR8B 3VR9B 1YJIA 2HTME 2WS3B 2MJDA 2WP9B 1N61A 2W3SA 3P4PB 1RFKA 1E10A 1SF0A 5EE0A 2Y5CA 2L83A 2L52A 2MJEA 2WLBA 2WU2B 1WXQA 1JQ4A 4YT0B 1B9RA 1N5WA 3P4SB 3LXFA 1CJEA 2WQYB 1FO4A 2BS2B 5H92C 3AE8B 4YXDB 2KMMA 5C3JB 1CZPA 5H8YE 5AUKA 2BS3B 3PO0A 1QF6A 1FIQA 1WRIA 1YQ4B 1N5XA 1FRRA 1RWSA 1RYJA 2CJNA 1TKEA 3AECB 4N6EB 1FXIA 1VDVA 2JX5A 1J7BA 5AUIA 1KRHA 1OQQA 4USAA 3AB5A 1FFVA 4YTMB 1JWBD 3LB8C 5EE3A 1L5PA 1QOGA 1ZP0B 3FAHA 1T3QA 4US8A 1J7CA 1I7HA 4YTPB 1TJEA 1ZUD2 2DBYA 3FC4A 3SFEB 4ZOHC 3P63A 3AEEB 3P1MA 1J7AA 1UWMA 3NVVA 1FRDA 2B76B 2KAJA 1OQRA 2WDRB 3AEFB 3HUIA 3P4QB 5MPOA 3AMZA 1EWYC 2CJOA 1NEKB 1AYFA 1TKGA 1QLBB 2MJ3A 4YSYB 1FFUA 1F0ZA 1NENB 3W5UB 1IUEA 1E6EB 2EKIA 3W9CB 1VLBA 3CWIA 1QT9A 2K22A 4ITKA 3AV8A 3HVZA 4C80A 1N60A 3AE2B 1VJKA 5GXGB 4ZHOA 5G5HA 2WDVB 4C7ZA 1ZXIA 1NYQA 3AEGB 3BIID 3VRAB 4US9A 1TKYA 3KWLA 3AE7B 2N0SB 1QOAA 1FM0D 3B2FA 4FXCA 3B9JA 2E3TA 1FMAD 2WU5B 3AEBB 1JWAD 2H89B 3W5VB 1DGJA 4HROA 3NRZA 1JROA 1ZOYB 2BT6A 1SB3C 1DOIA 2MH7A 3CIRB 3EUB2 2PVGC 1E7PB 4HRSA 1PUTA 3NVYA 1XLQA 4YSZB 2ACZB 2M19A 3AM9A 2LEKA 4A9AA 2PIAA 2W3RA 3AE9B 1QOFA 1E0ZA 1AWDA 1L0VB 2H88B 1WGKA 3WCQA 3AEDB 2AX5A 1N63A 1OFFA 2FBWB 2K5PA 3NS1A 1KFYB 1TYGB 1PFDA 1XLPA 1L6VA 3SFDB 3P4RB 4WWMA 3ZYYX 2QIEB 4KX6B 1N62A 4JWUC 1NYRA 4WQMA 1R7SA 4N58A 1JW9D 1QOBA 2OHFA 2Q5WD 3HRDD 1GAQB 1YJJA 1XLOA 2WDQB 1WWTA 4YTNB 1DOXA 2PVOD 3NVZA 3NVWA 1YQ3B 3AEAB 1V97A 1XLNA 5EE1A 4LTUA 2BS4B 1SIJA 1GPXA 3RPFC 1XO3A 4JWSC 1NI3A 3ETRA 1KF6B 3SR6A 2CU3A 2M56B 2QJLA 3ABVB 1L6UA 4ZHPA 4C7YA 2K9XA 4N59A 3AE6B 3AE5B 4YSXB 1PDXA 1RM6C 1V8CA 3DWGC 1E9MA 1WYGA 2JQRB 3AH7A 1DOYA 2PKOA 1A70A 1JALA 1NVID 2DWQA 1JRPA 2G1EA 3B2GA 3AE4B 4JX1C 5EE9A 3L4PA 2W55A 3AE1B 3AN1A 2W54A 1ROEA 3AE3B 4P6VF 1FXAA 5C2TB 5G5GA 3VRBB 4IDIA
chains in the Genus database with same CATH superfamily
4ZDVA 4MHVA 4JUZA 3PZ8A 2LYBA 1TGZB 1J2MA 2L52A 5DGAA 4B9MA 2QMTA 1N5WA 5KFLA 5HMMA 2IOFK 3P4SB 2KE7A 1T6BX 2JT4B 1VD2A 3ED5A 4ACOA 2JHDA 2AGPA 1L0YB 4GC7A 3LDAA 4EOYA 4NV0A 4G9BA 4KTQA 4KLQA 1ZOLA 2KDMA 3JSVB 9ICXA 4G0NB 1FXIA 1L7MA 1KLGD 9ICKA 2W7OA 1ET6A 2IHMA 5D94A 2K4EA 3ZXRA 3IM1A 5TSSA 3UMBA 4B9TA 4DOCA 1NBFC 1V5OA 4AP9A 2GB1A 4BBNF 5D46A 3M9OB 1YT3A 3NRWA 5H2FU 1IGCA 2JUOA 1G6JA 2ASDA 1Q3VA 4A90A 2KNBA 5IA7A 3BYTB 4NM2A 1XD3B 1PGAA 4UB6U 3ZD8A 5KFHA 4K4GA 2C28A 3RR7A 4ED3A 3VH4B 3AULA 3RJEA 2FCNA 4GOCA 2UWQA 1ZKHA 4JE3B 3EGRA 4RFBA 1GJZA 2R8KA 8ICQA 3M63B 3ZTCA 2O6VD 2IBIB 3VRAB 2KIWA 4C7ZA 4MEXA 4ACFA 1SKWA 1ZYQA 4O3RA 4DHJB 2YVCA 2FMSA 5CHGA 5DG8A 1ZQCA 1SZPA 2UVVA 3DPDA 2LVQA 1JROA 1DOIA 4D2KA 2Y9UA 1E7PB 2E1FA 4DSIA 3RTVA 4F8CB 1IP9A 2RPQA 4PZNA 1WJUA 3A1QA 2IMWP 4RQ5A 2WAQC 2MSNA 1C4AA 2JZPA 2MBHA 4QAYA 4NAWA 3LYSA 1L5UA 3P4RB 4NL9C 2H3QA 2XICA 4QZDA 3E56A 2VJ4A 3SV3A 3T79A 2WDTB 2OM6A 3WKDA 3BDPA 2F44A 2KDFB 4BWMA 4CRXA 3V3XA 1YJJA 2BQUA 1Y88A 3URYA 1KW4A 2RDBC 4A20A 3NVZA 3T5HA 2D3AA 2REXA 4AJWA 2CHZA 2BS4B 2N9KA 3X23A 3L16A 3ZTDA 4O3QA 5LNK1 1KF6B 1P9DU 3H4DA 2HJ1A 2M56B 3OLMD 1L6UA 3BK1A 5CHFA 2X38A 2BQQA 2I5HA 4XE0A 4MELA 2FE8A 2LRUA 2G1EA 4O1NA 4S0RA 3A1QB 3ENEA 3ORYA 4PGQA 4ECYA 1ET9A 2ZNVC 3BS7A 4RT2A 3I57A 2R2OA 4EEKA 4OCZA 4TUQA 2E5SA 4W9IA 4XRHA 3L13A 2JXXA 2BPSA 2R2QA 4II3B 4RQ7A 3V6CB 2XY6A 4MJSA 4DEZA 4F5NA 5ALYA 3M62B 2IBKA 2WB1F 2JWZA 4J9QA 1MN8A 2SEBD 4J9NA 1E5WA 2BS2B 5KT7A 8ICWA 1GG3A 1NK0A 1A0PA 3LVVA 2WFAA 1KQQA 2E6XA 2BYEA 2CS4A 4FHJA 4I2CA 4XQ8A 4OW0A 4M00A 2KJ9A 1DK2A 1KRHA 4USAA 2AGQA 1XCQL 2JU6X 2OEDA 3RH6A 3I1YA 1X1MA 3FAHA 4ECVA 3PY8A 4UQGA 8ICUA 2K4PA 2KK8A 4AJYB 1J7CA 5JHBA 1Z1BA 1TJEA 4AWJA 1ZQFA 1A6SA 1CQVA 1V81A 3TEWA 5AM0A 1S1QB 4P1CC 3P63A 5ALJA 3D2NA 3H7PB 2D5GA 2K39A 4FJYA 3KLSX 2LPEA 2YQEA 1OEYJ 4DXFA 2HBMA 1L4DB 5KG5A 2BHNA 3GE3C 1EU4A 2EKIA 2W9AA 3C8YA 3RFAA 1QT9A 1ZQTA 4ITKA 3AV8A 3C29A 1WGRA 1ZD2P 5KFYA 7ICOA 2CU1A 4G11A 2GBRA 4WWOA 3HKZC 4NWIA 2LD9A 4QWAA 3MJ5A 2N1RA 2JH1A 4C8LA 2ASJA 3F5EA 3MR5A 4BAXA 2MUTA 5AKGA 2KN4A 2XK5A 2JGAA 4OJ5A 5CWRA 2MH7A 2QB0A 4IM3A 3OJUA 1XLQA 4B6WA 1NK9A 1KRPA 1KLNA 3QUBA 3RYTA 3ONSA 2V4LA 4EBDA 2RQ5A 1SBBB 2MBEA 4BX9C 3AEDB 2FLLA 4RPXA 5ALMA 3NS1A 3F2CA 1SZHA 4OVUA 2LM1A 1ZQBA 4YMNA 4EBCA 4QZAA 1F52A 1NYRA 2ZIXA 1KFDA 3N7SC 1NJXA 3ZDTA 2W8KA 1GAQB 5C0YA 3MTNB 4RQNA 2P6UA 2HHQA 3FDSA 2KXJA 2GBKA 3RPFC 3MR6A 4YP3A 3V7JA 2KNJA 4KX5A 4O5KA 3AEVA 9ICTA 1HE8A 2C2RA 8ICAA 3WKAA 3AE5B 2RMMA 2EDUA 4ZH4A 3EYZA 3H7IA 4DWFA 5AI6A 4E74A 2NTTA 5IIIA 3HWTA 1DK3A 2MRPA 2KQ7A 8ICKA 2QILA 4KN4A 2YN4A 1F9JA 4P6VF 4MH0E 2Y5BB 2A4ZA 3ISBA 2RD0A 2Z7JA 3EW9A 1L3VA 1RAXA 3MC8A 3W2DA 1NK6A 5DG9A 3C2KA 5AZHA 2DUYA 4KLUA 3VUWA 2WU2B 1WXQA 4TUSA 4IG7B 5CEHA 1XXGA 1IM4A 2LUEA 4BWJA 4W9EA 3KYDD 2JRZA 1TZ1A 1VRAB 4QZHA 4LK0M 4XDDA 3WA0A 3Q3MC 1BPDA 1RRBA 2F2AB 4F5OA 1YNTE 3PO0A 3QU5A 1L3UA 5AUKA 3V6EB 1FIQA 4KZCA 4FN2A 2KWUB 4AUQC 2AQ1B 1J2NA 3GQCA 2AQ0A 2OXOA 1LFDA 1NOMA 2ZIUA 2FNJB 2HD5B 2J0MA 2KVCA 2KV2A 4PL1A 4K4HA 3AB5A 3SDLC 4J9RA 5IIJA 1NK5A 2KIVA 4ECRA 3JW0X 4MM3A 2GOLA 5AKZA 4CF4A 3A9KB 1WG8A 5CA7A 3O65B 4PYUA 2LXAA 2B76B 4FS1A 4UB2A 3QXGA 2NCNA 4HJKA 3W1SC 2AQ4A 2G45B 2WGSA 4O5CA 2B3AA 2BPGA 3CMMB 2WB1C 3RNCC 2LVPA 1D9DA 2PEAA 2XK5B 3QC8B 2JYEA 1YJ1A 3QA8A 4B6JA 1QOAA 4KLJA 4XWTA 2VJ5A 9ICLA 2FUG1 2W9BA 2KLGA 4MFCA 5IO9A 2DFLA 3NRZA 1SKRA 4MGIE 7ICIA 2AH5A 3RJGA 3SI8A 4I27A 8ICTA 2BZFA 3BQTA 3MC1A 2DKZA 1B0XA 1X9XA 5ALWA 4NQLB 2UU7A 4G3XB 2G4DB 4BVUC 1ZQYA 2HHSA 4IRDA 1WWUA 2PTLA 5BOLA 1Z19A 8ICHA 2RPVA 4EENA 3DEEA 1L6VA 4FBUA 3PO4A 1ZQHA 2MX2A 1QOBA 2DX5B 4ZYNA 1MHHE 2KDEB 1DOXA 4EZ9A 4ECUA 1XLOA 3L17A 5CHVC 2BGFA 1EF5A 5ALDA 5J2KA 3RCZA 1RYUA 2AGOA 3SR6A 2INPE 3PSTA 4M6WA 5DPSA 3DWGC 4F4WA 3TJPA 4KLTA 2WX0A 1A70A 1KBUA 2K3UA 5KFAA 2KLCA 1T4GA 5IIMA 4PHPA 2PFPA 3DCGA 4JL9A 4UBCA 3V7LA 4DDID 3M8RA 4BGDA 2KYWA 3V62A 4FBJB 3ZRCA 3LDZE 5HI1A 2MJDA 3UINB 2HBLA 3PX6A 1IBXB 3M6KA 2KFZA 4EE2A 2J6SA 1RLFA 3ZW3A 3I76A 2GOWA 1D3ZA 4KSLC 2D3DA 4Y2SA 2KFJA 3R8BA 5KFGA 5KG0A 4DXAB 1FO4A 1LKYB 2G09A 3SEBA 3BZDB 3GV7B 4MGYE 1TY2A 1K52A 3VUYA 2KKCA 2M4NA 3BQ2A 3SYZA 4F71A 3ZRFA 2BWES 4IOIE 3EPGA 4J9KA 3A9KA 1FCCC 3Q8CA 3Q8MA 5ALNA 3PW5A 4Q8EA 3LVWA 2LFIA 2KANA 5D3DA 4UB3A 5DGBA 4US8A 2IGGA 1C3TA 2PXIA 2XVTA 4DL2A 1TS4A 1L4ZB 2HTHA 2LUMA 4QW9A 2FCSA 4NAMA 2ZPYA 8ICMA 4KGTA 5L1JA 3N7RC 3TMPB 3PMLA 1OEYA 4LLGM 2DLBA 2E8NA 1PUZA 2N9EB 1UA0A 3OJSA 4TMAB 3WAMA 1TS2A 4C80A 1N60A 4ZHOA 2ZW1A 2YB1A 4DXGA 4RQ6A 2N0SB 3MDCA 2E3TA 2VKQA 5L1LA 4E3CA 5FR3A 3PT2B 2GMIC 1DGJA 2YY6A 4OJPA 3W1SA 1RXWA 1TK5A 2AQ2B 3Q3NC 1VZ7A 5ALIA 4BKSD 4FFDA 3KUZA 4MGZE 1IG6A 1I4RA 5F9NA 1P0RA 2YMLA 9ICHA 4B9VA 4OZAA 5BPCA 2BCSA 3PX0A 1K8RB 2KMAA 3BYYB 5HP4A 4BFRA 2JXTA 4NZLB 1OFFA 3SAGA 1AARA 1V1OA 1XLPA 2I1JA 4DHJD 1XS9D 2QIEB 3OAWA 1WJNA 1EF1A 1V38A 1S76D 2O6VB 1HIWA 1YIWA 2LMRA 3KUDB 4REZA 3U7ZA 4QWBA 4MFAA 4YTNB 2J7QB 5KFPA 4F5PA 2MEKA 4W9GA 5J8YA 1TFRA 3SENA 2KOXA 2VH1A 1ZQMA 5HR7A 1J19A 1STEA 4DO9A 4L23A 4BOSC 1M94A 4UAUA 1WGGA 5JH5C 2N7JA 3H6NA 3QX1A 3N3KB 2YEPB 4G50A 1F5SA 8ICNA 3K4GA 5L1MA 2W55A 3QX7A 1ROEA 2C22A 1FXAA 5ALSA 2VA8A 2WXHA 5HMLA 1V6EA 5KG6A 1XC9A 2IDYA 2J53A 3DWMA 1WRDB 2CR5A 4YG2A 8ICIA 4KLEA 1GC6A 2AU0A 2XGPA 3IVFA 3TEXA 1FCLA 7ICKA 2G3QB 3DHIC 1O03A 2L83A 1TAUA 3H9DA 1B9RA 2AYOB 4L2YA 3PZ7A 1ZQPA 2ISPA 2L3ZA 4M02A 3K9OB 8ICOA 3C21A 2N9LA 5C5JA 1UPHA 1WX9A 4U6PA 1SKSA 4ECXA 3DBHI 7ICJA 1IYFA 1RWSA 2VA2A 1X6IA 4I28A 4XC2A 2KHQA 1L6NA 1J7BA 3D6JA 5FR6A 2Y0SC 3BQ7A 3QEBZ 8ICFA 1WCLA 4F2RA 4OZBA 3QAQA 3QZ8A 4NLBA 1Z4NA 4KLLA 2HJ8A 3DVNV 3E9SA 1ZUD2 3NGDA 3R2IA 3PSFA 3FC4A 3SFEB 2OJWA 3HM3A 1NK7A 7ICUA 7ICPA 1UWMA 1UT8A 1EWCA 4UB4A 2YMMA 4UB1A 3AMZA 1NEKB 7ICLA 5ALLA 2Y3AA 3BINA 1HEZE 1NENB 2L5YA 3A4RA 1AQ6A 4EX7A 1IUEA 1COOA 4DQOC 4RPYA 4CO7A 2W9MA 1UQVA 1FNWA 3WIMA 2V3NA 2K4HA 3PV1A 4Q43A 2DZIA 5B5EU 2LI5A 4F5RA 4Z6CA 4YQWA 3ISDA 1BNPA 2N4FA 3F53A 2NYVA 3RJJA 1I4QA 2PI4A 4ZRJA 3ZDEA 2ZUBA 5AKLA 4DSKA 1X42A 1GB1A 4MDKE 2UVWA 3PZPA 2K8HA 4WJQA 3V72A 1U4BA 3TUOA 4M9LA 2YEPF 5J2BA 4EZLA 2JF5A 2KTQA 3G6YA 2GBMA 1E0ZA 1L0VB 3SHQA 3WCQA 1ZDVA 3EC8A 9ICIA 2AX5A 2BWFA 2O6VA 4C00A 5AEKB 4R8UA 4KZ0A 3QZ7A 2HOQA 4ED1A 3T3NA 5ALQA 4P16A 2DQNB 1R4MI 1JIHA 4PHAA 3K1ZA 2O6KA 1WGYA 3U30A 4HK2A 3RZFA 4PL2A 4JWNA 2PVOD 4AYBF 1URJA 4JV1A 3WK8A 3N20C 4MF2A 1TTNA 4TV3A 4AS1A 5EE1A 2W04A 5FKAC 3ETRA 3EPIA 3WAOA 2YB4A 2ZXIA 2QJLA 2LVOA 4DFDA 4HPMB 3B0YA 4TUPA 1PDXA 3JPRA 4DS5A 1RM6C 2KJHB 1C20A 4F4YA 1E9MA 4HAIA 2XO7A 1D9FA 1L3SA 4EX6A 3N28A 9ICNA 1AN8A 3IDWA 2ZJAA 3ZVVA 3L4PA 3AN1A 3ZIMA 2UYZB 1GNUA 4IQVA 2KACA 4TUUA 1GB4A 1NDDA 2JMGA 5E6OA 8ICRA 3TADC 3I63C 3OGUA 1SF0A 4NXZA 1K1QA 2KTFA 5G2NA 4DF4A 3DOWA 3M3JA 1WMHB 1BXTA 1UBQA 1NKEA 4WURA 2NS5A 2RSUA 4HYKA 5HR6A 3DBHB 5ALZA 2LI6A 1CJEA 2KDIA 4P4PA 2WQYB 3PW0A 2HBKA 5TR5A 1FD6A 1LVHA 1EU3A 2IO1B 5H92C 5J2CA 5C3JB 2XN9C 2WF6A 3RMKC 3IP4B 1N5XA 2KTRB 3Q8SB 4F4XA 1MPEA 3KFUF 4S17A 2D3BA 1T5XD 1O08A 3MDAA 7ICFA 2I38A 2QLTA 3CF6E 2JR5A 1YZ7A 2MA1A 4KV2A 2WF8A 3E58A 3Q6BA 8ICEA 1CI4A 4HCNB 1JX4A 9ICJA 4AOFA 2DBYA 2NBVB 3T8MA 4EFOA 2V0GA 1ZW7A 1WH3A 2W9NA 2KEYA 7ICMA 2M0AA 2ZTEA 2CJOA 3OHAA 2MJ3A 5LLIA 4EZJA 4LNNA 3E2EA 2JEIA 1WIAA 3ICXA 4HKQA 5BMHA 3FILB 4RQMA 2K8CB 4J9MA 3RBEA 4E0DA 3CWIA 3O0FA 3V05A 1HZ5A 3AEGB 5BMIA 3KOOA 3R9KA 4RNNA 3S6JA 1S0VA 4B9UA 2ZIWB 1XCTL 3B2FA 3TADA 1ACCA 4OVZA 2KJRA 2KMDA 2QB0B 4R63A 2DNFA 2ZIUB 4Y2TA 4O3OA 4P7IA 2L7RA 4FBTA 4LVSA 2PMVA 1SSNA 1SB3C 2KFNA 1WXVA 3Q3JA 2H3ZA 1COKA 2ES6A 4ZRKA 4YSZB 2V4RA 2M19A 5ALHA 1MC8A 2PFNA 3KZXA 2UVRA 4GXJA 3SD5A 2E8MA 3AUOA 1SXTA 3C0RB 1SE4A 4GGQA 4FLHA 1V80A 4NNJB 4RMAA 2RHFA 1KDHA 1UZXB 2ZIXB 2GH1A 5JHAA 2NO4A 3BJYA 5J18A 1E8WA 1I4HA 5KTQA 1KKXA 4CQNA 1DXSA 2M17A 4A8XC 1BPBA 3L08A 3RB6A 4RGNA 4YWGG 2KQ4X 7ICTA 2BTEA 3GP7A 5IILA 1V1PB 1WE6A 1WWTA 1WCNA 3PVLA 4GU2A 4I2EA 3AEAB 1XEEA 1V97A 4NLCA 5AM1A 4OJLA 4LTUA 5J0UA 1XO3A 1S3SG 4JWSC 4DQRA 1H8CA 2KHWB 2MWSB 2QARB 3IV6A 1CUKA 4C7YA 3F5AA 3GILA 1OQYA 4M9GA 4YVZA 2L00B 3QU4A 4NLGA 2MLBA 4GXKA 3RB3A 4R65A 1SJHD 1NVID 1XQQA 3Q8PB 2LGXA 5CR0A 2JSVX 4GIVA 2NR2A 2F77X 1BPXA 1D8YA 1RXVA 1WXSA 4K81A 4J6IA 4ELVA 1BMLC 1WR6E 2J6UA 1WMHA 1L7YA 1R4MB 1KTQA 1E10A 4IM2A 1JQ4A 3N4MB 1LB2B 1E7UA 1RG6A 1IPGA 3UIPB 5AIBA 4DCCA 3TSSA 4Q8FA 4A8EA 5DB6A 2A5UA 4A55A 4ICAA 1HUZA 4I2HA 5H8YE 2DZKA 2NO5A 2OWOA 1LM8B 1ZQXA 1I42A 1ZQEA 1QQ6A 5DBAA 2K8AA 4I2JA 3GFKB 2IY1B 2M8SA 5AK6A 4IR1A 5EE3A 2FPKA 3APDA 4H2AA 5AKEA 4I2IA 4DQPA 4M2YA 5BYRA 4UAYA 3EECA 5AKIA 1FEHA 4HCPB 3IT6B 2HOIA 1V49A 3JYUA 5ALOA 4O5EA 4Y2RA 4DSFA 4KLDA 4WJ3B 2CKHB 2W8LA 2MW5A 2NTSA 1UUPA 2SAKA 3BZKA 3U4EG 5JU5A 4KKIA 1WX7A 4DLEA 4A3PA 3RF9A 3ZXVA 3HKZF 1D5ZC 4HWIB 1EXNA 5L9XA 4C0ZA 1NYQA 3AE7B 5KFFA 2KJ6A 5GTHU 7ICNA 4A3OA 4I6NB 1JWAD 1TVAA 3W5VB 4F3OA 8ICZA 1ZOYB 3KHLA 8ICXA 3DQVA 4X57B 5KFVA 3H4BA 1BVSA 3O13A 3GIIA 4XWWA 3VVWB 8ICCA 4TQSA 5J2GA 2C5LC 5EWGA 2EANA 2DZMA 1B43A 3ALBA 3T9LA 5J0RA 5KFQA 4ICUA 5AK4A 2J4XA 2LGIA 1TIFA 2QSDA 3ZDMC 2DKXA 2MBBB 2G5HB 4I2DA 4YR2A 1QZEA 1ZXHA 2D07B 3SFDB 2AJQA 1PFDA 3Q3OC 4CYEA 2EZYA 2IHNA 3A0HU 2M9NA 1L7PA 2GWSA 1JW9D 3ETLA 2KC2A 1K51A 1V5TA 4ED7A 2QARA 4ANXA 3LWMA 2I9GA 3BQ1A 4ECSA 2VZKB 4YD1A 2BW2A 1T3NA 2BCUA 1F2RC 3DDHA 1YN3A 2KT7A 2WXIA 3U7DA 3UM9A 2WXFA 4YSXB 4UAVA 2LHDA 3WANA 5KAFU 2K25A 3B2GA 2DF4B 4DL3A 4I6PA 2AL3A 4EEYA 5AK5A 5J29A 5CJ7A 2KN7A 4C8NA 5C2TB 2F1IA 3RRGA 4NAWB 3RB4A 1KM7A 5BYSA 2PFOA 4DFPA 1YN4A 2LGSA 3KVFB 2ODGA 3C1ZA 4KITB 5KHQA 4B95A 5KG2A 5AI0A 2G5IB 2VIXA 2ZVNA 1ZQZA 2W7PA 4C8KA 4FZMA 1Z3EB 3K75D 4O3SA 3ZJVA 4NPNA 5JXVA 5KFUA 3M1YA 3SQIA 2WNMA 1HUOA 3MFIA 2KVZA 3TEZA 5ALRA 4PK1A 3V61A 4JV0A 4PS3A 3VDZA 2I6XA 3NUQA 1CZPA 3QK0A 2WXMA 5KFMA 4DFKA 4NLNA 1RYJA 4UASA 1UGJA 2GO7A 3UI3A 3MP9A 3PLVA 3X0WA 4QZ8A 4WIPA 2MP2B 2D2QA 4DDGD 4IWPA 3RNGC 4I29A 2JEJA 1NKCA 4IQUA 1T3QA 4ARIA 3PW4A 1SE3A 1KEJA 2C60A 3VAWA 4TQ0A 1J0GA 3BVMA 2WDRB 3AEFB 4J3OD 4R8UB 5TISU 5KT2A 4Q45A 2XI9A 4FZNA 4M0AA 1UD7A 2WXPA 1OUQA 4EEWA 3RFZB 5AI4A 4QZGA 2WXLA 4PYZA 2Y1JA 2O2VB 5GXGB 2W9CA 3I3TB 3R3MA 1RPLA 4C4TA 3JPPA 1CRXA 1UWXA 2BQ3A 2L76A 1ZXIA 4CNQA 4PT5A 1TKYA 3KWLA 4BZAA 1PK3A 4P2HA 2LMCA 1IIPA 4RNMA 5AM3A 5DCNA 4B0MA 4UARA 4HROA 3GDXA 5KL8B 2MP2A 5J2IA 2K0PA 4QZBA 3CIRB 4DFJA 5DG7A 5KFXA 1NJWA 1VR9A 2EQYA 1FEZA 1JWMD 2ACZB 3H0LB 3AE9B 2D3CA 4B0EA 5J2JA 3OSPA 1F77A 2A1AA 4RUAA 4KLGA 4ECTA 2HBJA 3PZDA 4YD2A 5AHXA 1AW7A 2Y0SF 3Q8QB 3CSFA 2G07A 2DYBA 3LYYA 3AU5A 3PSIA 2I2YA 3TAPA 3BS5A 3ECIA 2HHUA 3ZO5B 2JEGA 1I35A 1F0MA 1ZQIA 1S77D 4EYHB 3UQ0A 2PE9A 2E1EA 2HVHA 3IT4B 1D4BA 8ICYA 5AM5A 4U7CA 4KLFA 2AWTA 4W9JA 4ZHPA 4TQ1A 2UVUA 5IAAC 5EWEA 2EMSA 3EHVA 3ZGZA 1KL9A 4FULA 3D2QA 3H8HA 4PH5A 1MI0A 4GN1A 1UF0A 3D2SA 4QNLA 2F1JA 4ED8A 4IL6U 3UMCA 1OTRB 2DYOA 3NOBA 3VXWA 3RNBC 4N9F4 1SWVA 4ELTA 2JZ3B 4P4MA 1MJDA 4PHDA 4FS2A 1F1HA 3CW2C 1YMHE 5T14A 4CF3A 5KG3A 3RNAC 3ZUNA 5E6PA 5G55A 2ATLA 4P0QB 3K9PB 1ZQKA 3A0BU 5J0SA 3M7DA 1R4NB 3TIXA 1MVKA 3F2DA 2FE9A 3IXSA 3QHTA 4DL5A 5KT4A 5KT6A 3FKYA 4LNKA 4RH6A 2QCZA 3QUTA 1VDVA 3B0AA 4XX5A 4K3CA 1OQQA 2MBQA 3H7SA 3KH0A 4KIKB 1U49A 3BVGA 1MG8A 1M6YA 4NLZA 4DSEA 3TARA 1Q8KA 4KDIC 1NZPA 1YZ6A 4IS7A 1C7YA 4WAAA 3ISCA 4B9SA 2N9PC 3ZI4A 2K6QA 2JRIB 4IRKA 4MT5A 1OQRA 1P1AA 1XNSA 2KD1A 2ON8A 4C4VB 2BR0A 5HHHA 3V6KA 3QCAA 2BKRB 3DBSA 4IM0A 3U26A 1HEKA 2K8BB 3LK9A 1SL2A 1XSPA 1ENFA 4GXBA 1E6EB 3DV9A 4XUSA 2BGWA 1NK4A 1ZQ1C 4RF0A 4YMMA 3AXCA 1A76A 2L32A 2PJHA 3NHEB 2HHVA 2TSSA 1KSPA 5DDYA 5JUMA 3QARA 2KK0A 4RZRA 1FM0D 2AL6A 3RJKA 2HDEA 3PTFC 4FXCA 4JQWC 3WALA 2V3PA 1N6ZA 1C9FA 3RJFA 4NM1A 2K4IA 3M95A 2Z8LA 4AYBC 2KO3A 2PI5A 1PUTA 3MABA 2DPIA 2RLTA 2Y5PA 3ZLZA 2W9BB 4DQIA 3PSEB 1SXDA 3SD7A 2H88B 5DQIA 1WXAA 1SGGA 1NZBA 2FUHB 5KFDA 4QJFB 1QKZA 5DLGA 1PQSA 3PSPA 4BKGA 2WWZA 3OJ3A 1QLNA 2NRWA 3QE9Y 5GTIU 2NBUA 2R61A 5KNIA 2V4QA 1VZ8A 4M9HA 4DLGA 2FIDA 1UBIA 2Q5WD 3FILA 5C1ZA 1C79A 4JV2A 2OYYA 1ZQGA 1JRUA 4M8MA 1BUIC 4URKA 3KHRA 1UNSA 4QZEA 4B9KA 3RT3B 3WK7A 2KSOA 2M1MA 2XNAC 4F4ZA 4WQOB 3H8SA 2ZUCA 4N59A 3BQ0A 1D5MC 3EFUA 3P42A 1HTOA 2OOBB 4ELUA 3FM9A 1KOTA 5HNKA 2EAMA 1WYGA 2K60A 2ASQA 1DOYA 1SL0A 3Q8BA 2LKYA 5J0QA 1PVPA 4DL6A 1C76A 1PZNA 3L3FX 1I4PA 1BPYA 2RDHA 3AE1B 1EUVB 4PS8A 2MAXA 3HILA 2NRVA 2LXCA 1QQRA 3LJ3A 4Z6FA 4ANWA 1SV4A 1XU4A 2WP9B 2NV3A 3RNEC 4AP4C 3SMVA 1LO5D 4J9OA 1WY8A 2MJEA 8ICJA 1WZ0A 3IBEA 4F1SA 3MGVA 4YMOA 2XBBC 4YT0B 3GOEA 1XO0A 4RM9A 2EH9A 2F3NA 1LXDA 5IP4D 3GE8C 2ZTCA 1ZDXA 1ZD4A 5BMGA 3TANA 3EWAA 2FPLA 3DHGC 4IKGA 5ALTA 5DB7A 1LKYA 2ASLA 4DHZB 2I1QA 1TKEA 1WWVA 3CP8A 3M6ZA 2BB5A 4MSQB 3B1LX 5KHOA 4YR0A 1U47A 2GLSA 4J03A 4WJPA 4Y2YA 4JLCA 5BO4B 4M0WA 3QWZB 1ZQUA 3PW2A 2AQ3B 3ALRA 3MFHA 3TBLD 3PX4A 3PREA 3AEEB 4K4IA 2KWCA 1WSPA 3P4QB 5KFZA 2L05A 5AK3A 3AI5A 2IZVB 3H1UA 1WE7A 4GIBA 2K8CA 3KBBA 1U48A 1KTKA 4MEMA 3IRUA 1ZD3A 4FJZA 2IGDA 3CRXA 4LJOB 3ZJTA 4UAZA 2ZW0A 3PMNA 3ZKJC 5EOZA 1I4GA 1WX8A 1JXEA 1V86A 2RDGA 5D3IB 1C4PA 4NY8A 3RAQA 3B9JA 1FMAD 2NVUI 4LDTD 4EUTA 4GC6A 1XO1A 4W9HA 1X6JA 3BVZA 3JVZX 2PVGC 4MACA 3VH3B 3M9MB 4IC9A 5T8IA 4UDUC 1PK1A 2QEJC 1AWDA 4RU9A 3TFRA 2GRIA 3PLUA 5D2MB 3NUHB 5E6JA 4LNFA 1TE2A 3V60A 2K6DB 4YCXA 1CMXB 4DS4A 2BKEA 3RN9C 5KT3A 4QZFA 5ALPA 3T5LA 1E90A 1N62A 4RUCA 2R8IA 2V9WA 3RR8A 2KFKB 2LRWA 2KKPA 4KX6B 3PHXB 4RGOS 3DVGX 2WDQB 1Y56A 3R2TA 2P6RA 1SV0A 3APCA 7ICQA 1Z4OA 1YQ3B 1XLNA 4ICVA 4TURA 2CPRA 4Y2XA 2EKEC 4Y2VA 5ALVA 4W9KA 1X9SA 3Q69A 3QU7A 9ICFA 3PHWB 4JPSA 3DVNU 3BZCA 1Q5WB 3BY4B 2ESEA 2FI1A 1TS3A 4FA6A 5IN7A 4R3DA 1ZJNA 2P35A 1CK1A 1TAMA 3PS6A 4DFMA 5HHIA 3VRBB 1A5RA 2PMZC 3B08A 1YJIA 4DQQA 2WS3B 1L7NA 4KSKC 4OHJA 2YMPA 5J2DA 3C2LA 3OPXA 3DVGY 5EWFA 4RQ3A 1T0SC 3K1RB 1Z00A 5IIKA 2PPHA 3VTUA 4JB3A 5AM2A 1L3TA 2KZRA 3A33B 3Q8AA 3L5KA 2BB6A 2XY7A 1SE9A 1CEZA 2LM4A 4XZ4A 2FJ6A 4UB8U 4M04A 3CYMA 3QNMA 2JVCA 1ECWA 4Q44A 2KMMA 5L1KA 2ZJDA 2Q4TA 4KLSA 3GV5B 1S9FA 4JGHB 1ZQVA 1H38A 2KDBA 4OZCA 4BKSA 2C2EA 4ECZA 2WXJA 5AUIA 2CHXA 1IV8A 2EMTA 1JWBD 2ZJ5A 4QWDA 1KLVA 4RGTA 5A0LA 4DBGA 1HA5A 3EFCA 1QOGA 2WXOA 2VZKD 3ZDBA 1NNLA 3C23A 2LHEA 1VJ5A 3JPOA 1J7AA 3HUIA 4HJGE 1WM3A 2INDC 2ZZPB 4NY0A 3V6JA 1P7EA 4G3IA 2F8KA 1TKGA 2DL0A 1F0ZA 5GMVA 1MA7A 3H8JA 4I2AA 3DHHC 4I6LB 3H40A 3AU2A 3KTQA 2FAZA 5J0OA 2RP5A 3C28A 2H3IA 1Q3UA 4QZIA 3WAPA 3WKBA 3AE2B 4I2BA 5HHDG 5D4BA 3H8WA 5G5HA 3H0MB 4YFKA 2NRTA 3KZIU 3UPQA 1HZ6A 2I1KA 5DDMA 3J81j 2R8HA 3MJWA 9ICWA 4OVVA 3T5JA 3ZQ4A 1NKBA 2IOHA 4PZOA 2DENB 5ALKA 2LJIA 4W9LA 3N30A 2RDJA 9ICMA 3KHHA 3DBRB 4HLEA 1ZRMA 2HDOA 4DF8A 5ALFA 4YL8A 4GDLA 2WHEA 4DSJA 2XCAA 2KFKA 2GBNA 1A77A 2A3VA 3VQIA 4I2FA 2KX3A 2ONQA 3Q3FA 4DHZE 1S8OA 3T3FA 2N7DA 7ICSA 3T5KA 2O2VA 3HK0A 2D8CA 4MF8A 2Y1IA 2EAOA 4KVGB 3Q14C 3NVWA 5ALGA 4RQ8A 5FP0A 2J6TA 4F4KA 1FNVA 2P66A 2LWPA 2W82A 3ZDAA 1L0XB 3PRZA 3MHZA 4LZGA 4RQ2A 1L7OA 2CU3A 2KP7A 2DHZA 1YOVB 1RFAA 3UIOB 5KFIA 4IR9A 4EKUA 3F2BA 4BOZB 4CHKA 2JXJA 5J0YA 2IYDB 1E7VA 1YX6B 2INCC 2N1WA 3NJTA 3JPQA 4GDKA 4RF1A 4YTMB 1ESFA 5G5GA 4Q2JA 1WR1A 5AKKA 2PW9A 3C5FA 1E8XA 2XIDA 3IHQB 2E8PA 3DBRI 5LXHA 2HOFA 2WLBA 2JYTA 2FCQA 2NBWB 3Q2AC 4MFFA 3TI0A 1I4XA 2QC8A 2XEWA 2D3GA 4EZKA 4FADA 4YXDB 5IKCM 8ICSA 2LYHA 3IFWB 4TSSA 4WAFA 2MQJA 1QQ7A 3AQEA 1UA1A 1NJZA 3AECB 3KWVA 4N6EB 9ICAA 3U2SC 4IQTA 4R64A 4LJPB 3VTWA 1FPYA 1QCKA 5ALEA 1L2NA 1T8EA 1RQLA 3GIKA 1L5PA 4CE6A 1SIFA 2KN5A 1ZP0B 2R18A 4J9PA 2QDFA 2VRRB 1V9PA 2B6GA 3NG0A 9ICUA 3UMGA 2LBOA 3OJ4B 5F3XB 5HG2A 4ZOHC 3MR2A 1U4AA 3NVVA 3APFA 4TKNA 3QUQA 4RNAA 2WHIA 2W9CB 2JPHA 4YSYB 5L1IA 3DBLI 4GFJA 2K89A 1JUDA 1FXTB 4K3BA 5KT5A 3HX0A 1V2YA 5E6NA 4M9JA 3MGHA 2WTFA 3BIID 1QH9A 2D10A 4UW9A 4CF5A 2KTRA 2LYAA 2H89B 4L1BA 1JXLA 1QILA 4ECWA 1S10A 5AICA 1K50A 2A1JB 4GDLB 4BUGA 2FIFA 2XY5A 1DYQA 2MCNB 1XT9B 4BBNC 4BJQA 2LEKA 2PIAA 3H8MA 3L10B 5CHWA 1L8OA 5KFCA 2NRXA 3BS5B 1N63A 1U9LA 3E0FA 2BCRA 4KKJA 2PFQA 3HW8A 3I5JC 3BK2A 5EDSA 3IG3A 2W03A 2MHJA 5KG4A 2FPMA 2L0FA 2OHFA 3AU4A 2HE7A 4PS7A 2J0KA 4IRCA 4CGZA 4C8OA 5KG7A 3KW5B 3UF8A 1LGRA 3NASA 2IA6A 2AEHA 4II2B 1D8LA 1FNUA 9ICRA 3L0WB 3RULA 1K5OA 5DPWA 3RJHA 4P4OA 2L8JA 3VCBA 2GLEA 4F93B 2YTUA 5KFEA 2EZZA 5ALXA 3N97B 1WFYA 3AE6B 3GS2A 2R8JA 4GDKB 4KGSA 4X5VA 2DZJA 2WAQF 3AH7A 2JY6A 4DL4A 8ICLA 3MBYA 1JALA 4PPXA 4NQKE 3HVDA 2WF9A 3V6HA 9ICOA 3S2AA 2W54A 5IIOA 3HPOA 2LJ5A 7ICEA 4Y2UA 2BQRA 3WK9A 2HTME 5F9LA 1SWWA 1Z5SB 1WZ3A 5AI8A 4ANVA 5J0XA 3QJZA 5AZGA 1GUAB 5J17A 2Y5CA 1TS5A 2H5XA 2QKQA 2QB1A 1IBXA 1QTMA 4K7WA 5IINA 4M01A 3UGBB 1RDFA 4W9CA 4GMVA 3IG8A 4DK5A 3AL0B 1KFTA 4O3NA 4F5QA 3AE8B 2V1YA 4O3PA 1T0RC 1TKDA 1YQ4B 2JV3A 3P1MA 2CJNA 1ZRNA 1Q0WB 5J0WA 4J9LA 4O0IA 4MM3B 2JX5A 1BGXT 2ZPNA 4ZRQA 2FLPA 1FFVA 1P3QU 2BDPA 1YN5A 4WJNA 3R7QA 3RNFC 1X2IA 2LZ6A 4IWQA 2ICIA 1V85A 1MSWD 3KUCB 5DLFA 4GLSC 1WJ4A 3OG5A 1SL1A 4W9DA 5J0TA 1SE2A 2F76X 1AROP 3TQ1A 4IQWA 2ZEQA 4YXMA 2CRXA 1D5XC 4F92B 2XCPA 4CDGA 1QLBB 5DBCA 3ONNA 2FCMA 4E71A 2FMPA 2MRLA 1JWSD 4F91B 3GZFA 1N48A 4P1BC 4F7ZA 4GXIA 3CSTA 1C78A 4US9A 2DPJA 3BWUD 4OO1J 2KZZA 2V9HA 1JCKB 2J0JA 4Z6DA 5KL1B 1UH6A 2WU5B 4ASWC 1Y8RC 1SEBD 3P2BA 4M6WB 5AI5A 1BPZA 4K1RB 3IG5A 2KVSA 3NY5A 1JWUD 3TEYA 3UQAA 2DAFA 1ZQOA 2LASA 5CRXA 4M0WB 2V4IB 4R66A 2OJRA 2W3RA 5KAIU 2WYQA 1WGDA 3OSNA 2N1VA 1YQBA 1ZQJA 2KZ3A 3QYPA 3ZNGC 2LHTA 4KX3A 1ZQWA 3M8SA 3R66C 2N9XA 3DDCB 2A19A 3C5GA 2F1HA 2XGQA 1WYWB 2J42A 1V1PA 4ZRIA 1D6EC 4FHKA 7ICHA 2IGHA 4WQMA 4N58A 1Z00B 4F72A 2JEFA 1F44A 9ICCA 2ZVOA 4KMUA 5JZEB 3RD2A 2WF7A 1B4FA 1SIJA 4NJ6A 1DOQA 2HW3A 4YR3A 1ZQLA 4KLMA 2M0NA 3RRHA 2FMQA 1WJ6A 2HHXA 1DGSA 3MHSD 1T0QC 2YMQA 3TACB 4HPPA 4TQRA 1F2RI 4XA5A 2KVRA 2PKOA 3HIZA 5EE9A 4Y2PA 2G06A 2OEHA 1UGMA 1IXRA 3PVXA 1YX5B 3HHMA 2HHWA 3HP6A 2INNE 3QU2A 1LQBA 2IO3B 4GB9A 4XGAB 2ZTDA 4RPZA 3QEAZ 3IN5A 1XSNA 1S97A 4HXDA 1TAQA 5JRTA 3Q8FA 1EO6A 5CX3A 1JMSA 3P4PB 1EM7A 4K7UA 5EE0A 3TL5A 9ICBA 2F8LA 3WKCA 3RAXA 4MH8A 1VCBA 3LXFA 1C77A 4KLHA 3J9CA 2NPTB 3RI7C 4NLKA 1P98A 5DQGA 1WGHA 4QWCA 4QIWF 2ZXHA 3C19A 2IJ0A 7ICVA 4DOBA 1GO3F 4NL9A 4PHEA 3KKAA 3N7PD 2KICA 3N9YC 1PGXA 3I28A 4IWOA 1QQ5A 5AIAA 5J2AA 1B22A 5LXIB 3Q8LA 3B0XA 1MQ3A 4BKTA 1X66A 3PRMB 2JH7A 4M47A 3KKAC 1S0OA 1I7HA 4HKZE 3UQ2A 2QHOA 1T94A 3H0RB 3A4SC 4CCHA 4DOAA 1HQRD 2ZCBA 3N1YC 5KFJA 1UCVA 3FYHA 5J0PA 4HEA1 3PV8A 4FO6A 2BCVA 4GLXA 3W5UB 4JK1A 3CNHA 3WU2U 1VZ6A 4NJ8A 2C7NB 2OH2A 3W9CB 2MSED 1MQ2A 4JIOU 1S5LU 1SXEA 4PGYA 4C56C 1YD8U 2G9HD 2WXRA 5KFTA 1KFSA 2FLNA 1KH0A 4AQ7A 3IHPC 1QSYA 1TV9A 1MG4A 4MGKE 1L8LA 2NRZA 4YXJA 4P0PB 5D49A 4FZLA 4DL7A 3RH4A 1LV5A 2WXKA 4ED0A 1C4CA 1H4RA 3QU9A 2C9WB 2YLMA 2BKFA 2MUTB 2VA3A 3Q8KA 2BPCA 4EELA 5AKYA 4EBEA 1PGBA 2E8OA 2W11A 2BDUA 1QSSA 4RT3A 1WGKA 3LWLA 4UB5A 3MGIA 1BT0A 1SGHA 5HFYA 1ZQRA 4IW0A 5DPRA 1KFYB 1NI2A 1TYGB 3ZNZB 3ZD9A 1RZTA 4HDQA 2MA9B 1S0MA 4JWUC 4KLOA 2BVCA 1TY0A 4YN4A 4RQ4A 3SU8X 4M8NA 3HT3A 3I9V1 2EZXA 4QIWC 5FK9C 5J2FA 2JZZA 1E8ZA 3PR5B 2WF5A 2IY0B 2V3SA 4OD0A 4EYIB 1RYRA 3MC0B 1GPXA 2IOFA 4LZDA 2Z0DB 4XDCA 5J2HA 2L1AA 4ZRPA 4KMOB 2KJ5A 4MSMB 2XC9A 1GOZA 2K9XA 2ZIVB 3WKEA 1E8YA 4NJ7A 4ECQA 4UATA 5DB8A 1OGWA 2JQRB 2KMCA 2G08A 3JPTA 1T7PA 3KHGA 1ZPSA 5BYQA 2ZJ8A 1HJPA 3GIMA 2PKEA 4A6QA 1Q46A 2AXTU 1K1SA 4KLIA 2BYFA 2ZNVB 1ED1A 2ZCCA 3MC9A 4Y2QA 2RRDA 2BYTA 4B9LA 4IDIA 4C4RA 3VR9B 4QWEA 1WUDA 2GBJA 3ZNHB 3N1ZC 2KX0A 4F2SA 2W3SA 4RGMA 2LGDA 5DKWA 1Z1VA 3G6XA 2BPFA 1MFWA 3H7PA 3NZ3A 2FDRA 3JPNA 1TBEA 5AI9A 4EZ6A 1P7FA 5KFOA 1X9WA 5KFSA 2G0AA 2W43A 1D8BA 4JMUA 2JRHA 3HJEA 2B21A 2HMXA 4QZ9A 3EA6A 4K7SA 3RH5A 4WWPA 1QF6A 4O9MA 1BNOA 1FRRA 5I4DA 3ZNID 5JTIA 5IOIA 2H3FA 1XWLA 2ISOA 3VTVA 4F8RA 5J2EA 3Q8EA 3QQ8B 2PLPA 3MFGA 1HXYD 2ZUDA 1TZOA 1SJED 4BXOB 3PW7A 3GZNI 2Z0EB 3RUIB 4KGRA 4JWMA 3HM6X 2JZBA 2D6FC 4HVBA 5AKXA 5DQHA 2HHTA 3RJIA 3VFKA 4RQ1A 2KAJA 1EWYC 4MJSB 3THVA 1P7DA 4RQ0A 3V7KA 1TK8A 4P0QA 1PYWD 3TCAA 3N1XC 3EZ5A 2K22A 3HVZA 1VJKA 4P0PA 3WK4A 3M9NB 3UXPA 2C2DA 1NK8A 1PVQA 1SV0C 3Q8RB 1WM2A 2PE6B 2WX1A 4IUMB 5AKHA 2KG5A 1UELA 7ICGA 3U8ZA 4HRSA 1Q10A 3NS8A 4GSWA 3AM9A 3PPAA 5HKHA 1JN3A 1ZQNA 2AHOB 5KFNA 3C1YA 1Q1OA 4QZCA 2CHWA 2FBWB 1UT5A 5TZVA 1BPEA 2BF8B 4C4VA 4WWMA 3ZYYX 2NMQA 2BYVE 4PJ0U 5DB9A 2K8BA 1ZQAA 2MBOA 1R7SA 4IC7B 1J8CA 2IO0B 2C7MB 8ICGA 2M0XA 2RDIA 3IAM1 4M9NA 3T3OA 2DGZA 3HRDD 3G6VA 2KWDA 9ICVA 2LGYA 2HI0A 3VHTC 3PR4A 2KD0A 2EAPA 1TT5B 2ZIVA 8ICBA 4LCDE 1NI3A 4Y2JA 3UXOA 4F50A 1JMLA 3QIJA 1ZD5A 2Q0ZX 3UXNA 1ZJMA 2Z59B 2IPKD 2A1JA 2G4SA 5KFRA 4DQSA 1T0YA 3IAS1 1OXJA 3C2MA 2KSOB 1XSLA 9ICGA 1WF9A 2KZMA 1HTQA 2DAJA 5B66U 3AQFA 2JWUA 5AKJA 3A9JA 1S0NA 3AU6A 3NTUA 4RNOA 2KKVA 2EELA 3AE4B 2MU2A 2ALZA 4OJ6A 1C1YB 3AE3B 1PVRA 3NZSA 4WH4A 4J9SA 5J8YC 1IGDA 3WK5A 1RYSA 1R4NI 5D7GA 3UQBA 5KFKA 4ARCA 3VR8B 3OHBA 2Y9TA 2DYMA 3ZJUA 1N61A 2BCQA 1B1ZA 5K4LA 1ZE3D 2K1FA 4WWNA 5CB1A 1RFKA 3OWEB 2OCEA 2CXYA 2VANA 4LNIA 3PNCA 4UAWA 3KD3A 4ANUA 3L54A 4W9FA 3GU3A 5ALUA 5BOMA 1M4VA 1Z2MA 2H3VA 3SEIA 9ICEA 2HVIA 1MHXA 1OW5A 2BS3B 2KHVA 4KN7A 4LJXA 3N32A 1WRIA 1TK0A 2ZIWA 4KIKA 3RZWC 2WXNA 1J97A 1UHUA 1GC7A 1ZGUB 4WJOA 3QUCA 4BXOA 2KC1A 1DRGA 1KLUD 3A9JB 2L0TA 4KDLB 3LB8C 2KOBA 2JZBB 2YX8A 2ZG6A 3RB0A 4Z6EA 5DPTA 1ISNA 3SAHA 3PRPB 2KWVB 4YTPB 4HDOA 1ZQDA 1NJYA 3U52E 1FRDA 3DBLB 9ICQA 5MPOA 4OJOA 4ZYSA 3GIJA 2PMZF 1U45A 3GB1A 1AYFA 4HPLB 3KQ4A 1FFUA 1KN5A 1WI0A 4ED6A 2HSZA 5CTRC 3RBDA 4PGXA 2R8GA 9ICSA 1VLBA 2WXGA 5DBBA 5E79U 2J52A 1QSLA 2BBCA 4I2GA 2WDVB 3ML8A 8ICPA 3AEBB 3ZDCA 3TAQA 2BT6A 4DSLA 1V9JA 5C23A 3EUB2 1WXMA 4LDTB 2RGFA 5AZFA 3NVYA 4C4SA 4A9AA 8ICVA 2C7HA 5L83A 1QOFA 2X8XX 2VH2A 5CP2A 7ICRA 1ZQQA 1N2XA 1X9MA 1ZQSA 4C8MA 3NZUA 2RR9A 2K5PA 4RM8A 4O3MA 3PGEA 1ZETA 3VUXA 4QW8A 3W1YA 1X40A 1KJTA 4NJCA 3VC8A 3MR3A 9ICPA 4FJVB 5AM4A 3ZDDA 5KFWA 3GV8B 2N7EA 1RQNA 3D32A 2B0CA 3JPSA 4UBBA 3ML9A 2NPTA 5KG1A 3OTQA 3SAFA 1K53A 3KYCD 4XYCA 5L95C 3PO5A 2CN1A 3SV4A 2IO2B 3ABVB 2GI9A 5KFBA 3GZNB 1JI7A 2KJ8A 2D11A 3TKAA 3JSVA 1V8CA 4RCOA 5D6JB 2KQSA 3SZ2A 4DWIA 1N56A 5J2RA 3TFSA 3WK6A 2DWQA 1JRPA 4FE3A 4MEYA 2HCFA 1PK1B 4BDPA 2WXQA 4JX1C 3R7RA 4ED2A 4B9NA 1XF5L 4LNOA
chains in the Genus database with same CATH topology
3DWMA 2IDYA 2HTME 2J53A 1YMHE 3TEXA 3PZ8A 1FCLA 2Y5CA 1TS5A 2L52A 2L83A 2QMTA 1B9RA 1N5WA 1IBXA 4L2YA 3PZ7A 3P4SB 1T6BX 2N9LA 1L0YB 3AE8B 1MVKA 3IXSA 1YQ4B 3P1MA 2KDMA 1RWSA 2CJNA 4RH6A 1FXIA 1VDVA 1KLGD 2JX5A 4MM3B 1J7BA 1ET6A 1OQQA 4ZRQA 1YN5A 1FFVA 3BVGA 4OZBA 2ICIA 5TSSA 4GLSC 3E9SA 1ZUD2 2GB1A 3R2IA 1SE2A 3FC4A 3SFEB 1IGCA 4MT5A 1UWMA 1EWCA 1OQRA 4A90A 3BYTB 3AMZA 1D5XC 1NEKB 1PGAA 2ON8A 1QLBB 2Y3AA 1HEZE 1NENB 1ENFA 1IUEA 1E6EB 4RF0A 4DQOC 1JWSD 4JE3B 3EGRA 2L32A 4RFBA 1FNWA 2TSSA 3VRAB 4C7ZA 2V3NA 1C78A 4US9A 3BWUD 1FM0D 2HDEA 4FXCA 1JCKB 2WU5B 2V3PA 1C9FA 1I4QA 1SEBD 1JROA 1DOIA 4D2KA 2Z8LA 3TEYA 1GB1A 1E7PB 1JWUD 1PUTA 2Y5PA 3TUOA 2YEPF 2V4IB 2W3RA 1E0ZA 1L0VB 2H88B 3WCQA 1ZDVA 1C4AA 2AX5A 2JZPA 1QKZA 3P4RB 2J42A 1V1PA 3E56A 3T3NA 1D6EC 2R61A 4P16A 2IGHA 4WQMA 1VZ8A 4N58A 3FILA 2Q5WD 3V3XA 1YJJA 1C79A 3URYA 2PVOD 3NVZA 4AS1A 5EE1A 2BS4B 1SIJA 2N9KA 5FKAC 1BUIC 5LNK1 1UNSA 3ETRA 1KF6B 2M56B 2QJLA 2XNAC 1L6UA 3BK1A 4N59A 1D5MC 1PDXA 3P42A 2X38A 1RM6C 1E9MA 1WYGA 1F2RI 4XE0A 1DOYA 1AN8A 2FE8A 2PKOA 3Q8BA 5EE9A 1C76A 2G1EA 4O1NA 2RDHA 1I4PA 3L4PA 3AE1B 3AN1A 1ET9A 2INNE 2KACA 3I57A 1GB4A 1QQRA 2WP9B 3Q8FA 3P4PB 1LO5D 1EM7A 1SF0A 5EE0A 2MJEA 1BXTA 4YT0B 4MH8A 4WURA 2SEBD 3LXFA 1C77A 1CJEA 3J9CA 2WQYB 2BS2B 1FD6A 1EU3A 5H92C 5C3JB 1ZDXA 5BMGA 2XN9C 4IKGA 2E6XA 1N5XA 2IJ0A 1MPEA 1TKEA 4OW0A 1T5XD 2BB5A 1KRHA 4USAA 2I38A 3N9YC 1PGXA 1XCQL 2JU6X 2OEDA 3FAHA 4M0WA 1J7CA 1I7HA 1TJEA 1CQVA 4HKZE 2AQ3B 2DBYA 3TEWA 2V0GA 3P63A 3AEEB 1WSPA 3P4QB 1HQRD 2M0AA 2CJOA 2D5GA 4HEA1 3KLSX 2MJ3A 4DXFA 3W5UB 1KTKA 1L4DB 1VZ6A 4HKQA 1EU4A 5BMHA 2EKIA 3FILB 2IGDA 3C8YA 3CWIA 3W9CB 1QT9A 3ZJTA 4ITKA 3AV8A 4C56C 2ZW0A 3V05A 1HZ5A 3AEGB 5BMIA 1I4GA 2G9HD 2RDGA 2WXRA 1XCTL 1KH0A 3MJ5A 3B2FA 1C4PA 1ACCA 4OVZA 5D3IB 3B9JA 1FMAD 4AQ7A 2KN4A 2PMVA 1SSNA 1SB3C 2WXKA 2MH7A 3BVZA 4MACA 2PVGC 1C4CA 1XLQA 4YSZB 2M19A 1PGBA 5T8IA 4UDUC 2QEJC 1AWDA 1SXTA 1SE4A 1WGKA 2GRIA 3AEDB 1SBBB 3NUHB 5E6JA 5HFYA 3NS1A 1KFYB 1TYGB 1I4HA 4CQNA 2YEPB 4KX6B 1N62A 4JWUC 4A8XC 1NYRA 1TY0A 4RGNA 4YWGG 2KQ4X 4RGOS 3I9V1 3GP7A 1GAQB 2WDQB 5FK9C 1Y56A 1V1PB 1WWTA 3R2TA 2BTEA 1YQ3B 1XEEA 1V97A 1XLNA 3AEAB 3MC0B 4LTUA 1GPXA 3RPFC 1XO3A 4JWSC 4XDCA 2L1AA 3Q69A 4ZRPA 4C7YA 1GOZA 2K9XA 4JPSA 3AE5B 2RMMA 2JQRB 1TS3A 1ZPSA 1SJHD 2NTTA 1NVID 5BYQA 4R3DA 4A6QA 1CK1A 2QILA 2JSVX 4P6VF 3VRBB 2BYTA 4IDIA 3VR9B 1YJIA 2WS3B 1BMLC 4RGMA 2W3SA 4OHJA 3W2DA 1E10A 3NZ3A 1JQ4A 2WU2B 1WXQA 3Q8AA 2BB6A 1P7FA 1XXGA 3TSSA 1VRAB 4LK0M 4XDDA 4A55A 2KMMA 5H8YE 5AUKA 1YNTE 3PO0A 3EA6A 1QF6A 1FIQA 1FRRA 5I4DA 2AQ1B 4OZCA 2WXJA 3AB5A 5AUIA 3Q8EA 1JWBD 2PLPA 5EE3A 4RGTA 3MFGA 1HA5A 1QOGA 2WXOA 2VZKD 4H2AA 1HXYD 1TZOA 1SJED 5BYRA 4KGRA 1FEHA 2LHEA 3IT6B 1J7AA 2B76B 3HUIA 2KAJA 4HJGE 1P7EA 1EWYC 1TKGA 2NTSA 1F0ZA 1UUPA 2SAKA 3U4EG 4KKIA 1PYWD 2K22A 3HVZA 1D5ZC 3AE2B 1VJKA 5HHDG 5G5HA 1NYQA 1HZ6A 2JYEA 3AE7B 1QOAA 3ZQ4A 4XWTA 1JWAD 2FUG1 3W5VB 2LJIA 3NRZA 1ZOYB 4HRSA 1Q10A 3O13A 4XWWA 3AM9A 2J4XA 2LGIA 2QSDA 2PTLA 2RPVA 2FBWB 1ZXHA 3SFDB 1PFDA 1L6VA 3VQIA 4WWMA 3ZYYX 2NMQA 2ONQA 1R7SA 1JW9D 1QOBA 3IAM1 3T3OA 1MHHE 3HRDD 1K51A 1DOXA 1XLOA 2KWDA 3NVWA 1FNVA 2W82A 1L0XB 2VZKB 1NI3A 3MHZA 2BW2A 3SR6A 2CU3A 2INPE 1F2RC 1JMLA 1YN3A 2WXIA 2WXFA 2IPKD 4YSXB 3DWGC 2LHDA 3IAS1 1A70A 3B2GA 2JWUA 4RF1A 2K3UA 3AE4B 2EELA 4WH4A 3AE3B 1IGDA 1ESFA 5G5GA 5C2TB 5D7GA 4YTMB 4Q2JA 4ARCA 3VR8B 4NAWB 5HI1A 2MJDA 2PW9A 2DYMA 5BYSA 3ZJUA 1N61A 1B1ZA 1YN4A 1ZE3D 1IBXB 1RFKA 4EE2A 3OWEB 2WLBA 3ZJVA 2JYTA 3R8BA 5JXVA 1M4VA 2WNMA 1I4XA 1FO4A 3SEBA 3BZDB 3TEZA 4YXDB 1TY2A 1K52A 1CZPA 2WXMA 1MHXA 2BS3B 4TSSA 4WAFA 1WRIA 3AECB 3KWVA 1RYJA 4N6EB 2WXNA 1UGJA 3U2SC 3UI3A 3MP9A 4IOIE 4WIPA 1FCCC 1KLUD 3Q8CA 3LB8C 1L5PA 2LFIA 1ZP0B 5D3DA 1T3QA 4ARIA 4US8A 1SE3A 4YTPB 2IGGA 4TQ0A 5HG2A 4ZOHC 1TS4A 1L4ZB 2LUMA 3BVMA 3U52E 2WDRB 3NVVA 1FRDA 3AEFB 4J3OD 4KGTA 4NAMA 4RNAA 5MPOA 4ZYSA 3GB1A 1AYFA 3KQ4A 1FFUA 2WXPA 4LLGM 4YSYB 2DLBA 3RFZB 2WXLA 4TMAB 1VLBA 2WXGA 5GXGB 1TS2A 2J52A 4C80A 1N60A 4ZHOA 1UWXA 2BBCA 2ZW1A 2WDVB 3BIID 1ZXIA 4PT5A 1TKYA 4DXGA 3KWLA 2N0SB 2E3TA 2LMCA 3AEBB 5FR3A 2H89B 4B0MA 1DGJA 4L1BA 4HROA 3W1SA 1QILA 2BT6A 2K0PA 2AQ2B 1VZ7A 1K50A 3CIRB 3EUB2 4GDLB 1VR9A 1DYQA 3NVYA 1I4RA 1JWMD 2ACZB 4OZAA 2LEKA 4A9AA 2PIAA 3AE9B 1QOFA 4B0EA 3BYYB 1F77A 2JXTA 4NZLB 1N63A 4KKJA 1OFFA 2K5PA 1V1OA 1AW7A 1XLPA 3LYYA 3BK2A 2I2YA 4NJCA 2QIEB 2OHFA 4REZA 3U7ZA 4YTNB 2MEKA 3IT4B 1D4BA 1K53A 1FNUA 3ABVB 4TQ1A 4ZHPA 2GI9A 3AE6B 3GS2A 4GDKB 1V8CA 4KGSA 4RCOA 1STEA 3ZGZA 4L23A 3H8HA 1MI0A 3AH7A 2N7JA 1JALA 2DYOA 2DWQA 1JRPA 2WXQA 3HVDA 4JX1C 2W55A 2W54A 1ROEA 1FXAA 1XF5L 2WXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWM A;  3VR8 B;  3VR9 B;  1YJI A;  2HTM E;  2WS3 B;  2MJD A;  2WP9 B;  1N61 A;  2W3S A;  3P4P B;  1RFK A;  1E10 A;  1SF0 A;  5EE0 A;  2Y5C A;  2L83 A;  2L52 A;  2MJE A;  2WLB A;  2WU2 B;  1WXQ A;  1JQ4 A;  4YT0 B;  1B9R A;  1N5W A;  3P4S B;  3LXF A;  1CJE A;  2WQY B;  1FO4 A;  2BS2 B;  5H92 C;  3AE8 B;  4YXD B;  2KMM A;  5C3J B;  1CZP A;  5H8Y E;  5AUK A;  2BS3 B;  3PO0 A;  1QF6 A;  1FIQ A;  1WRI A;  1YQ4 B;  1N5X A;  1FRR A;  1RWS A;  1RYJ A;  2CJN A;  1TKE A;  3AEC B;  4N6E B;  1FXI A;  1VDV A;  2JX5 A;  1J7B A;  5AUI A;  1KRH A;  1OQQ A;  4USA A;  3AB5 A;  1FFV A;  4YTM B;  1JWB D;  3LB8 C;  5EE3 A;  1L5P A;  1QOG A;  1ZP0 B;  3FAH A;  1T3Q A;  4US8 A;  1J7C A;  1I7H A;  4YTP B;  1TJE A;  1ZUD 2;  2DBY A;  3FC4 A;  3SFE B;  4ZOH C;  3P63 A;  3AEE B;  3P1M A;  1J7A A;  1UWM A;  3NVV A;  1FRD A;  2B76 B;  2KAJ A;  1OQR A;  2WDR B;  3AEF B;  3HUI A;  3P4Q B;  5MPO A;  3AMZ A;  1EWY C;  2CJO A;  1NEK B;  1AYF A;  1TKG A;  1QLB B;  2MJ3 A;  4YSY B;  1FFU A;  1F0Z A;  1NEN B;  3W5U B;  1IUE A;  1E6E B;  2EKI A;  3W9C B;  1VLB A;  3CWI A;  1QT9 A;  2K22 A;  4ITK A;  3AV8 A;  3HVZ A;  4C80 A;  1N60 A;  3AE2 B;  1VJK A;  5GXG B;  4ZHO A;  5G5H A;  2WDV B;  4C7Z A;  1ZXI A;  1NYQ A;  3AEG B;  3BII D;  3VRA B;  4US9 A;  1TKY A;  3KWL A;  3AE7 B;  2N0S B;  1QOA A;  1FM0 D;  3B2F A;  4FXC A;  3B9J A;  2E3T A;  1FMA D;  2WU5 B;  3AEB B;  1JWA D;  2H89 B;  3W5V B;  1DGJ A;  4HRO A;  3NRZ A;  1JRO A;  1ZOY B;  2BT6 A;  1SB3 C;  1DOI A;  2MH7 A;  3CIR B;  3EUB 2;  2PVG C;  1E7P B;  4HRS A;  1PUT A;  3NVY A;  1XLQ A;  4YSZ B;  2ACZ B;  2M19 A;  3AM9 A;  2LEK A;  4A9A A;  2PIA A;  2W3R A;  3AE9 B;  1QOF A;  1E0Z A;  1AWD A;  1L0V B;  2H88 B;  1WGK A;  3WCQ A;  3AED B;  2AX5 A;  1N63 A;  1OFF A;  2FBW B;  2K5P A;  3NS1 A;  1KFY B;  1TYG B;  1PFD A;  1XLP A;  1L6V A;  3SFD B;  3P4R B;  4WWM A;  3ZYY X;  2QIE B;  4KX6 B;  1N62 A;  4JWU C;  1NYR A;  4WQM A;  1R7S A;  4N58 A;  1JW9 D;  1QOB A;  2OHF A;  2Q5W D;  3HRD D;  1GAQ B;  1YJJ A;  1XLO A;  2WDQ B;  1WWT A;  4YTN B;  1DOX A;  2PVO D;  3NVZ A;  3NVW A;  1YQ3 B;  3AEA B;  1V97 A;  1XLN A;  5EE1 A;  4LTU A;  2BS4 B;  1SIJ A;  1GPX A;  3RPF C;  1XO3 A;  4JWS C;  1NI3 A;  3ETR A;  1KF6 B;  3SR6 A;  2CU3 A;  2M56 B;  2QJL A;  3ABV B;  1L6U A;  4ZHP A;  4C7Y A;  2K9X A;  4N59 A;  3AE6 B;  3AE5 B;  4YSX B;  1PDX A;  1RM6 C;  1V8C A;  3DWG C;  1E9M A;  1WYG A;  2JQR B;  3AH7 A;  1DOY A;  2PKO A;  1A70 A;  1JAL A;  1NVI D;  2DWQ A;  1JRP A;  2G1E A;  3B2G A;  3AE4 B;  4JX1 C;  5EE9 A;  3L4P A;  2W55 A;  3AE1 B;  3AN1 A;  2W54 A;  1ROE A;  3AE3 B;  4P6V F;  1FXA A;  5C2T B;  5G5G A;  3VRB B;  4IDI A; 
#chains in the Genus database with same CATH topology
 4ZDV A;  4MHV A;  4JUZ A;  3PZ8 A;  2LYB A;  1TGZ B;  1J2M A;  2L52 A;  5DGA A;  4B9M A;  2QMT A;  1N5W A;  5KFL A;  5HMM A;  2IOF K;  3P4S B;  2KE7 A;  1T6B X;  2JT4 B;  1VD2 A;  3ED5 A;  4ACO A;  2JHD A;  2AGP A;  1L0Y B;  4GC7 A;  3LDA A;  4EOY A;  4NV0 A;  4G9B A;  4KTQ A;  4KLQ A;  1ZOL A;  2KDM A;  3JSV B;  9ICX A;  4G0N B;  1FXI A;  1L7M A;  1KLG D;  9ICK A;  2W7O A;  1ET6 A;  2IHM A;  5D94 A;  2K4E A;  3ZXR A;  3IM1 A;  5TSS A;  3UMB A;  4B9T A;  4DOC A;  1NBF C;  1V5O A;  4AP9 A;  2GB1 A;  4BBN F;  5D46 A;  3M9O B;  1YT3 A;  3NRW A;  5H2F U;  1IGC A;  2JUO A;  1G6J A;  2ASD A;  1Q3V A;  4A90 A;  2KNB A;  5IA7 A;  3BYT B;  4NM2 A;  1XD3 B;  1PGA A;  4UB6 U;  3ZD8 A;  5KFH A;  4K4G A;  2C28 A;  3RR7 A;  4ED3 A;  3VH4 B;  3AUL A;  3RJE A;  2FCN A;  4GOC A;  2UWQ A;  1ZKH A;  4JE3 B;  3EGR A;  4RFB A;  1GJZ A;  2R8K A;  8ICQ A;  3M63 B;  3ZTC A;  2O6V D;  2IBI B;  3VRA B;  2KIW A;  4C7Z A;  4MEX A;  4ACF A;  1SKW A;  1ZYQ A;  4O3R A;  4DHJ B;  2YVC A;  2FMS A;  5CHG A;  5DG8 A;  1ZQC A;  1SZP A;  2UVV A;  3DPD A;  2LVQ A;  1JRO A;  1DOI A;  4D2K A;  2Y9U A;  1E7P B;  2E1F A;  4DSI A;  3RTV A;  4F8C B;  1IP9 A;  2RPQ A;  4PZN A;  1WJU A;  3A1Q A;  2IMW P;  4RQ5 A;  2WAQ C;  2MSN A;  1C4A A;  2JZP A;  2MBH A;  4QAY A;  4NAW A;  3LYS A;  1L5U A;  3P4R B;  4NL9 C;  2H3Q A;  2XIC A;  4QZD A;  3E56 A;  2VJ4 A;  3SV3 A;  3T79 A;  2WDT B;  2OM6 A;  3WKD A;  3BDP A;  2F44 A;  2KDF B;  4BWM A;  4CRX A;  3V3X A;  1YJJ A;  2BQU A;  1Y88 A;  3URY A;  1KW4 A;  2RDB C;  4A20 A;  3NVZ A;  3T5H A;  2D3A A;  2REX A;  4AJW A;  2CHZ A;  2BS4 B;  2N9K A;  3X23 A;  3L16 A;  3ZTD A;  4O3Q A;  5LNK 1;  1KF6 B;  1P9D U;  3H4D A;  2HJ1 A;  2M56 B;  3OLM D;  1L6U A;  3BK1 A;  5CHF A;  2X38 A;  2BQQ A;  2I5H A;  4XE0 A;  4MEL A;  2FE8 A;  2LRU A;  2G1E A;  4O1N A;  4S0R A;  3A1Q B;  3ENE A;  3ORY A;  4PGQ A;  4ECY A;  1ET9 A;  2ZNV C;  3BS7 A;  4RT2 A;  3I57 A;  2R2O A;  4EEK A;  4OCZ A;  4TUQ A;  2E5S A;  4W9I A;  4XRH A;  3L13 A;  2JXX A;  2BPS A;  2R2Q A;  4II3 B;  4RQ7 A;  3V6C B;  2XY6 A;  4MJS A;  4DEZ A;  4F5N A;  5ALY A;  3M62 B;  2IBK A;  2WB1 F;  2JWZ A;  4J9Q A;  1MN8 A;  2SEB D;  4J9N A;  1E5W A;  2BS2 B;  5KT7 A;  8ICW A;  1GG3 A;  1NK0 A;  1A0P A;  3LVV A;  2WFA A;  1KQQ A;  2E6X A;  2BYE A;  2CS4 A;  4FHJ A;  4I2C A;  4XQ8 A;  4OW0 A;  4M00 A;  2KJ9 A;  1DK2 A;  1KRH A;  4USA A;  2AGQ A;  1XCQ L;  2JU6 X;  2OED A;  3RH6 A;  3I1Y A;  1X1M A;  3FAH A;  4ECV A;  3PY8 A;  4UQG A;  8ICU A;  2K4P A;  2KK8 A;  4AJY B;  1J7C A;  5JHB A;  1Z1B A;  1TJE A;  4AWJ A;  1ZQF A;  1A6S A;  1CQV A;  1V81 A;  3TEW A;  5AM0 A;  1S1Q B;  4P1C C;  3P63 A;  5ALJ A;  3D2N A;  3H7P B;  2D5G A;  2K39 A;  4FJY A;  3KLS X;  2LPE A;  2YQE A;  1OEY J;  4DXF A;  2HBM A;  1L4D B;  5KG5 A;  2BHN A;  3GE3 C;  1EU4 A;  2EKI A;  2W9A A;  3C8Y A;  3RFA A;  1QT9 A;  1ZQT A;  4ITK A;  3AV8 A;  3C29 A;  1WGR A;  1ZD2 P;  5KFY A;  7ICO A;  2CU1 A;  4G11 A;  2GBR A;  4WWO A;  3HKZ C;  4NWI A;  2LD9 A;  4QWA A;  3MJ5 A;  2N1R A;  2JH1 A;  4C8L A;  2ASJ A;  3F5E A;  3MR5 A;  4BAX A;  2MUT A;  5AKG A;  2KN4 A;  2XK5 A;  2JGA A;  4OJ5 A;  5CWR A;  2MH7 A;  2QB0 A;  4IM3 A;  3OJU A;  1XLQ A;  4B6W A;  1NK9 A;  1KRP A;  1KLN A;  3QUB A;  3RYT A;  3ONS A;  2V4L A;  4EBD A;  2RQ5 A;  1SBB B;  2MBE A;  4BX9 C;  3AED B;  2FLL A;  4RPX A;  5ALM A;  3NS1 A;  3F2C A;  1SZH A;  4OVU A;  2LM1 A;  1ZQB A;  4YMN A;  4EBC A;  4QZA A;  1F52 A;  1NYR A;  2ZIX A;  1KFD A;  3N7S C;  1NJX A;  3ZDT A;  2W8K A;  1GAQ B;  5C0Y A;  3MTN B;  4RQN A;  2P6U A;  2HHQ A;  3FDS A;  2KXJ A;  2GBK A;  3RPF C;  3MR6 A;  4YP3 A;  3V7J A;  2KNJ A;  4KX5 A;  4O5K A;  3AEV A;  9ICT A;  1HE8 A;  2C2R A;  8ICA A;  3WKA A;  3AE5 B;  2RMM A;  2EDU A;  4ZH4 A;  3EYZ A;  3H7I A;  4DWF A;  5AI6 A;  4E74 A;  2NTT A;  5III A;  3HWT A;  1DK3 A;  2MRP A;  2KQ7 A;  8ICK A;  2QIL A;  4KN4 A;  2YN4 A;  1F9J A;  4P6V F;  4MH0 E;  2Y5B B;  2A4Z A;  3ISB A;  2RD0 A;  2Z7J A;  3EW9 A;  1L3V A;  1RAX A;  3MC8 A;  3W2D A;  1NK6 A;  5DG9 A;  3C2K A;  5AZH A;  2DUY A;  4KLU A;  3VUW A;  2WU2 B;  1WXQ A;  4TUS A;  4IG7 B;  5CEH A;  1XXG A;  1IM4 A;  2LUE A;  4BWJ A;  4W9E A;  3KYD D;  2JRZ A;  1TZ1 A;  1VRA B;  4QZH A;  4LK0 M;  4XDD A;  3WA0 A;  3Q3M C;  1BPD A;  1RRB A;  2F2A B;  4F5O A;  1YNT E;  3PO0 A;  3QU5 A;  1L3U A;  5AUK A;  3V6E B;  1FIQ A;  4KZC A;  4FN2 A;  2KWU B;  4AUQ C;  2AQ1 B;  1J2N A;  3GQC A;  2AQ0 A;  2OXO A;  1LFD A;  1NOM A;  2ZIU A;  2FNJ B;  2HD5 B;  2J0M A;  2KVC A;  2KV2 A;  4PL1 A;  4K4H A;  3AB5 A;  3SDL C;  4J9R A;  5IIJ A;  1NK5 A;  2KIV A;  4ECR A;  3JW0 X;  4MM3 A;  2GOL A;  5AKZ A;  4CF4 A;  3A9K B;  1WG8 A;  5CA7 A;  3O65 B;  4PYU A;  2LXA A;  2B76 B;  4FS1 A;  4UB2 A;  3QXG A;  2NCN A;  4HJK A;  3W1S C;  2AQ4 A;  2G45 B;  2WGS A;  4O5C A;  2B3A A;  2BPG A;  3CMM B;  2WB1 C;  3RNC C;  2LVP A;  1D9D A;  2PEA A;  2XK5 B;  3QC8 B;  2JYE A;  1YJ1 A;  3QA8 A;  4B6J A;  1QOA A;  4KLJ A;  4XWT A;  2VJ5 A;  9ICL A;  2FUG 1;  2W9B A;  2KLG A;  4MFC A;  5IO9 A;  2DFL A;  3NRZ A;  1SKR A;  4MGI E;  7ICI A;  2AH5 A;  3RJG A;  3SI8 A;  4I27 A;  8ICT A;  2BZF A;  3BQT A;  3MC1 A;  2DKZ A;  1B0X A;  1X9X A;  5ALW A;  4NQL B;  2UU7 A;  4G3X B;  2G4D B;  4BVU C;  1ZQY A;  2HHS A;  4IRD A;  1WWU A;  2PTL A;  5BOL A;  1Z19 A;  8ICH A;  2RPV A;  4EEN A;  3DEE A;  1L6V A;  4FBU A;  3PO4 A;  1ZQH A;  2MX2 A;  1QOB A;  2DX5 B;  4ZYN A;  1MHH E;  2KDE B;  1DOX A;  4EZ9 A;  4ECU A;  1XLO A;  3L17 A;  5CHV C;  2BGF A;  1EF5 A;  5ALD A;  5J2K A;  3RCZ A;  1RYU A;  2AGO A;  3SR6 A;  2INP E;  3PST A;  4M6W A;  5DPS A;  3DWG C;  4F4W A;  3TJP A;  4KLT A;  2WX0 A;  1A70 A;  1KBU A;  2K3U A;  5KFA A;  2KLC A;  1T4G A;  5IIM A;  4PHP A;  2PFP A;  3DCG A;  4JL9 A;  4UBC A;  3V7L A;  4DDI D;  3M8R A;  4BGD A;  2KYW A;  3V62 A;  4FBJ B;  3ZRC A;  3LDZ E;  5HI1 A;  2MJD A;  3UIN B;  2HBL A;  3PX6 A;  1IBX B;  3M6K A;  2KFZ A;  4EE2 A;  2J6S A;  1RLF A;  3ZW3 A;  3I76 A;  2GOW A;  1D3Z A;  4KSL C;  2D3D A;  4Y2S A;  2KFJ A;  3R8B A;  5KFG A;  5KG0 A;  4DXA B;  1FO4 A;  1LKY B;  2G09 A;  3SEB A;  3BZD B;  3GV7 B;  4MGY E;  1TY2 A;  1K52 A;  3VUY A;  2KKC A;  2M4N A;  3BQ2 A;  3SYZ A;  4F71 A;  3ZRF A;  2BWE S;  4IOI E;  3EPG A;  4J9K A;  3A9K A;  1FCC C;  3Q8C A;  3Q8M A;  5ALN A;  3PW5 A;  4Q8E A;  3LVW A;  2LFI A;  2KAN A;  5D3D A;  4UB3 A;  5DGB A;  4US8 A;  2IGG A;  1C3T A;  2PXI A;  2XVT A;  4DL2 A;  1TS4 A;  1L4Z B;  2HTH A;  2LUM A;  4QW9 A;  2FCS A;  4NAM A;  2ZPY A;  8ICM A;  4KGT A;  5L1J A;  3N7R C;  3TMP B;  3PML A;  1OEY A;  4LLG M;  2DLB A;  2E8N A;  1PUZ A;  2N9E B;  1UA0 A;  3OJS A;  4TMA B;  3WAM A;  1TS2 A;  4C80 A;  1N60 A;  4ZHO A;  2ZW1 A;  2YB1 A;  4DXG A;  4RQ6 A;  2N0S B;  3MDC A;  2E3T A;  2VKQ A;  5L1L A;  4E3C A;  5FR3 A;  3PT2 B;  2GMI C;  1DGJ A;  2YY6 A;  4OJP A;  3W1S A;  1RXW A;  1TK5 A;  2AQ2 B;  3Q3N C;  1VZ7 A;  5ALI A;  4BKS D;  4FFD A;  3KUZ A;  4MGZ E;  1IG6 A;  1I4R A;  5F9N A;  1P0R A;  2YML A;  9ICH A;  4B9V A;  4OZA A;  5BPC A;  2BCS A;  3PX0 A;  1K8R B;  2KMA A;  3BYY B;  5HP4 A;  4BFR A;  2JXT A;  4NZL B;  1OFF A;  3SAG A;  1AAR A;  1V1O A;  1XLP A;  2I1J A;  4DHJ D;  1XS9 D;  2QIE B;  3OAW A;  1WJN A;  1EF1 A;  1V38 A;  1S76 D;  2O6V B;  1HIW A;  1YIW A;  2LMR A;  3KUD B;  4REZ A;  3U7Z A;  4QWB A;  4MFA A;  4YTN B;  2J7Q B;  5KFP A;  4F5P A;  2MEK A;  4W9G A;  5J8Y A;  1TFR A;  3SEN A;  2KOX A;  2VH1 A;  1ZQM A;  5HR7 A;  1J19 A;  1STE A;  4DO9 A;  4L23 A;  4BOS C;  1M94 A;  4UAU A;  1WGG A;  5JH5 C;  2N7J A;  3H6N A;  3QX1 A;  3N3K B;  2YEP B;  4G50 A;  1F5S A;  8ICN A;  3K4G A;  5L1M A;  2W55 A;  3QX7 A;  1ROE A;  2C22 A;  1FXA A;  5ALS A;  2VA8 A;  2WXH A;  5HML A;  1V6E A;  5KG6 A;  1XC9 A;  2IDY A;  2J53 A;  3DWM A;  1WRD B;  2CR5 A;  4YG2 A;  8ICI A;  4KLE A;  1GC6 A;  2AU0 A;  2XGP A;  3IVF A;  3TEX A;  1FCL A;  7ICK A;  2G3Q B;  3DHI C;  1O03 A;  2L83 A;  1TAU A;  3H9D A;  1B9R A;  2AYO B;  4L2Y A;  3PZ7 A;  1ZQP A;  2ISP A;  2L3Z A;  4M02 A;  3K9O B;  8ICO A;  3C21 A;  2N9L A;  5C5J A;  1UPH A;  1WX9 A;  4U6P A;  1SKS A;  4ECX A;  3DBH I;  7ICJ A;  1IYF A;  1RWS A;  2VA2 A;  1X6I A;  4I28 A;  4XC2 A;  2KHQ A;  1L6N A;  1J7B A;  3D6J A;  5FR6 A;  2Y0S C;  3BQ7 A;  3QEB Z;  8ICF A;  1WCL A;  4F2R A;  4OZB A;  3QAQ A;  3QZ8 A;  4NLB A;  1Z4N A;  4KLL A;  2HJ8 A;  3DVN V;  3E9S A;  1ZUD 2;  3NGD A;  3R2I A;  3PSF A;  3FC4 A;  3SFE B;  2OJW A;  3HM3 A;  1NK7 A;  7ICU A;  7ICP A;  1UWM A;  1UT8 A;  1EWC A;  4UB4 A;  2YMM A;  4UB1 A;  3AMZ A;  1NEK B;  7ICL A;  5ALL A;  2Y3A A;  3BIN A;  1HEZ E;  1NEN B;  2L5Y A;  3A4R A;  1AQ6 A;  4EX7 A;  1IUE A;  1COO A;  4DQO C;  4RPY A;  4CO7 A;  2W9M A;  1UQV A;  1FNW A;  3WIM A;  2V3N A;  2K4H A;  3PV1 A;  4Q43 A;  2DZI A;  5B5E U;  2LI5 A;  4F5R A;  4Z6C A;  4YQW A;  3ISD A;  1BNP A;  2N4F A;  3F53 A;  2NYV A;  3RJJ A;  1I4Q A;  2PI4 A;  4ZRJ A;  3ZDE A;  2ZUB A;  5AKL A;  4DSK A;  1X42 A;  1GB1 A;  4MDK E;  2UVW A;  3PZP A;  2K8H A;  4WJQ A;  3V72 A;  1U4B A;  3TUO A;  4M9L A;  2YEP F;  5J2B A;  4EZL A;  2JF5 A;  2KTQ A;  3G6Y A;  2GBM A;  1E0Z A;  1L0V B;  3SHQ A;  3WCQ A;  1ZDV A;  3EC8 A;  9ICI A;  2AX5 A;  2BWF A;  2O6V A;  4C00 A;  5AEK B;  4R8U A;  4KZ0 A;  3QZ7 A;  2HOQ A;  4ED1 A;  3T3N A;  5ALQ A;  4P16 A;  2DQN B;  1R4M I;  1JIH A;  4PHA A;  3K1Z A;  2O6K A;  1WGY A;  3U30 A;  4HK2 A;  3RZF A;  4PL2 A;  4JWN A;  2PVO D;  4AYB F;  1URJ A;  4JV1 A;  3WK8 A;  3N20 C;  4MF2 A;  1TTN A;  4TV3 A;  4AS1 A;  5EE1 A;  2W04 A;  5FKA C;  3ETR A;  3EPI A;  3WAO A;  2YB4 A;  2ZXI A;  2QJL A;  2LVO A;  4DFD A;  4HPM B;  3B0Y A;  4TUP A;  1PDX A;  3JPR A;  4DS5 A;  1RM6 C;  2KJH B;  1C20 A;  4F4Y A;  1E9M A;  4HAI A;  2XO7 A;  1D9F A;  1L3S A;  4EX6 A;  3N28 A;  9ICN A;  1AN8 A;  3IDW A;  2ZJA A;  3ZVV A;  3L4P A;  3AN1 A;  3ZIM A;  2UYZ B;  1GNU A;  4IQV A;  2KAC A;  4TUU A;  1GB4 A;  1NDD A;  2JMG A;  5E6O A;  8ICR A;  3TAD C;  3I63 C;  3OGU A;  1SF0 A;  4NXZ A;  1K1Q A;  2KTF A;  5G2N A;  4DF4 A;  3DOW A;  3M3J A;  1WMH B;  1BXT A;  1UBQ A;  1NKE A;  4WUR A;  2NS5 A;  2RSU A;  4HYK A;  5HR6 A;  3DBH B;  5ALZ A;  2LI6 A;  1CJE A;  2KDI A;  4P4P A;  2WQY B;  3PW0 A;  2HBK A;  5TR5 A;  1FD6 A;  1LVH A;  1EU3 A;  2IO1 B;  5H92 C;  5J2C A;  5C3J B;  2XN9 C;  2WF6 A;  3RMK C;  3IP4 B;  1N5X A;  2KTR B;  3Q8S B;  4F4X A;  1MPE A;  3KFU F;  4S17 A;  2D3B A;  1T5X D;  1O08 A;  3MDA A;  7ICF A;  2I38 A;  2QLT A;  3CF6 E;  2JR5 A;  1YZ7 A;  2MA1 A;  4KV2 A;  2WF8 A;  3E58 A;  3Q6B A;  8ICE A;  1CI4 A;  4HCN B;  1JX4 A;  9ICJ A;  4AOF A;  2DBY A;  2NBV B;  3T8M A;  4EFO A;  2V0G A;  1ZW7 A;  1WH3 A;  2W9N A;  2KEY A;  7ICM A;  2M0A A;  2ZTE A;  2CJO A;  3OHA A;  2MJ3 A;  5LLI A;  4EZJ A;  4LNN A;  3E2E A;  2JEI A;  1WIA A;  3ICX A;  4HKQ A;  5BMH A;  3FIL B;  4RQM A;  2K8C B;  4J9M A;  3RBE A;  4E0D A;  3CWI A;  3O0F A;  3V05 A;  1HZ5 A;  3AEG B;  5BMI A;  3KOO A;  3R9K A;  4RNN A;  3S6J A;  1S0V A;  4B9U A;  2ZIW B;  1XCT L;  3B2F A;  3TAD A;  1ACC A;  4OVZ A;  2KJR A;  2KMD A;  2QB0 B;  4R63 A;  2DNF A;  2ZIU B;  4Y2T A;  4O3O A;  4P7I A;  2L7R A;  4FBT A;  4LVS A;  2PMV A;  1SSN A;  1SB3 C;  2KFN A;  1WXV A;  3Q3J A;  2H3Z A;  1COK A;  2ES6 A;  4ZRK A;  4YSZ B;  2V4R A;  2M19 A;  5ALH A;  1MC8 A;  2PFN A;  3KZX A;  2UVR A;  4GXJ A;  3SD5 A;  2E8M A;  3AUO A;  1SXT A;  3C0R B;  1SE4 A;  4GGQ A;  4FLH A;  1V80 A;  4NNJ B;  4RMA A;  2RHF A;  1KDH A;  1UZX B;  2ZIX B;  2GH1 A;  5JHA A;  2NO4 A;  3BJY A;  5J18 A;  1E8W A;  1I4H A;  5KTQ A;  1KKX A;  4CQN A;  1DXS A;  2M17 A;  4A8X C;  1BPB A;  3L08 A;  3RB6 A;  4RGN A;  4YWG G;  2KQ4 X;  7ICT A;  2BTE A;  3GP7 A;  5IIL A;  1V1P B;  1WE6 A;  1WWT A;  1WCN A;  3PVL A;  4GU2 A;  4I2E A;  3AEA B;  1XEE A;  1V97 A;  4NLC A;  5AM1 A;  4OJL A;  4LTU A;  5J0U A;  1XO3 A;  1S3S G;  4JWS C;  4DQR A;  1H8C A;  2KHW B;  2MWS B;  2QAR B;  3IV6 A;  1CUK A;  4C7Y A;  3F5A A;  3GIL A;  1OQY A;  4M9G A;  4YVZ A;  2L00 B;  3QU4 A;  4NLG A;  2MLB A;  4GXK A;  3RB3 A;  4R65 A;  1SJH D;  1NVI D;  1XQQ A;  3Q8P B;  2LGX A;  5CR0 A;  2JSV X;  4GIV A;  2NR2 A;  2F77 X;  1BPX A;  1D8Y A;  1RXV A;  1WXS A;  4K81 A;  4J6I A;  4ELV A;  1BML C;  1WR6 E;  2J6U A;  1WMH A;  1L7Y A;  1R4M B;  1KTQ A;  1E10 A;  4IM2 A;  1JQ4 A;  3N4M B;  1LB2 B;  1E7U A;  1RG6 A;  1IPG A;  3UIP B;  5AIB A;  4DCC A;  3TSS A;  4Q8F A;  4A8E A;  5DB6 A;  2A5U A;  4A55 A;  4ICA A;  1HUZ A;  4I2H A;  5H8Y E;  2DZK A;  2NO5 A;  2OWO A;  1LM8 B;  1ZQX A;  1I42 A;  1ZQE A;  1QQ6 A;  5DBA A;  2K8A A;  4I2J A;  3GFK B;  2IY1 B;  2M8S A;  5AK6 A;  4IR1 A;  5EE3 A;  2FPK A;  3APD A;  4H2A A;  5AKE A;  4I2I A;  4DQP A;  4M2Y A;  5BYR A;  4UAY A;  3EEC A;  5AKI A;  1FEH A;  4HCP B;  3IT6 B;  2HOI A;  1V49 A;  3JYU A;  5ALO A;  4O5E A;  4Y2R A;  4DSF A;  4KLD A;  4WJ3 B;  2CKH B;  2W8L A;  2MW5 A;  2NTS A;  1UUP A;  2SAK A;  3BZK A;  3U4E G;  5JU5 A;  4KKI A;  1WX7 A;  4DLE A;  4A3P A;  3RF9 A;  3ZXV A;  3HKZ F;  1D5Z C;  4HWI B;  1EXN A;  5L9X A;  4C0Z A;  1NYQ A;  3AE7 B;  5KFF A;  2KJ6 A;  5GTH U;  7ICN A;  4A3O A;  4I6N B;  1JWA D;  1TVA A;  3W5V B;  4F3O A;  8ICZ A;  1ZOY B;  3KHL A;  8ICX A;  3DQV A;  4X57 B;  5KFV A;  3H4B A;  1BVS A;  3O13 A;  3GII A;  4XWW A;  3VVW B;  8ICC A;  4TQS A;  5J2G A;  2C5L C;  5EWG A;  2EAN A;  2DZM A;  1B43 A;  3ALB A;  3T9L A;  5J0R A;  5KFQ A;  4ICU A;  5AK4 A;  2J4X A;  2LGI A;  1TIF A;  2QSD A;  3ZDM C;  2DKX A;  2MBB B;  2G5H B;  4I2D A;  4YR2 A;  1QZE A;  1ZXH A;  2D07 B;  3SFD B;  2AJQ A;  1PFD A;  3Q3O C;  4CYE A;  2EZY A;  2IHN A;  3A0H U;  2M9N A;  1L7P A;  2GWS A;  1JW9 D;  3ETL A;  2KC2 A;  1K51 A;  1V5T A;  4ED7 A;  2QAR A;  4ANX A;  3LWM A;  2I9G A;  3BQ1 A;  4ECS A;  2VZK B;  4YD1 A;  2BW2 A;  1T3N A;  2BCU A;  1F2R C;  3DDH A;  1YN3 A;  2KT7 A;  2WXI A;  3U7D A;  3UM9 A;  2WXF A;  4YSX B;  4UAV A;  2LHD A;  3WAN A;  5KAF U;  2K25 A;  3B2G A;  2DF4 B;  4DL3 A;  4I6P A;  2AL3 A;  4EEY A;  5AK5 A;  5J29 A;  5CJ7 A;  2KN7 A;  4C8N A;  5C2T B;  2F1I A;  3RRG A;  4NAW B;  3RB4 A;  1KM7 A;  5BYS A;  2PFO A;  4DFP A;  1YN4 A;  2LGS A;  3KVF B;  2ODG A;  3C1Z A;  4KIT B;  5KHQ A;  4B95 A;  5KG2 A;  5AI0 A;  2G5I B;  2VIX A;  2ZVN A;  1ZQZ A;  2W7P A;  4C8K A;  4FZM A;  1Z3E B;  3K75 D;  4O3S A;  3ZJV A;  4NPN A;  5JXV A;  5KFU A;  3M1Y A;  3SQI A;  2WNM A;  1HUO A;  3MFI A;  2KVZ A;  3TEZ A;  5ALR A;  4PK1 A;  3V61 A;  4JV0 A;  4PS3 A;  3VDZ A;  2I6X A;  3NUQ A;  1CZP A;  3QK0 A;  2WXM A;  5KFM A;  4DFK A;  4NLN A;  1RYJ A;  4UAS A;  1UGJ A;  2GO7 A;  3UI3 A;  3MP9 A;  3PLV A;  3X0W A;  4QZ8 A;  4WIP A;  2MP2 B;  2D2Q A;  4DDG D;  4IWP A;  3RNG C;  4I29 A;  2JEJ A;  1NKC A;  4IQU A;  1T3Q A;  4ARI A;  3PW4 A;  1SE3 A;  1KEJ A;  2C60 A;  3VAW A;  4TQ0 A;  1J0G A;  3BVM A;  2WDR B;  3AEF B;  4J3O D;  4R8U B;  5TIS U;  5KT2 A;  4Q45 A;  2XI9 A;  4FZN A;  4M0A A;  1UD7 A;  2WXP A;  1OUQ A;  4EEW A;  3RFZ B;  5AI4 A;  4QZG A;  2WXL A;  4PYZ A;  2Y1J A;  2O2V B;  5GXG B;  2W9C A;  3I3T B;  3R3M A;  1RPL A;  4C4T A;  3JPP A;  1CRX A;  1UWX A;  2BQ3 A;  2L76 A;  1ZXI A;  4CNQ A;  4PT5 A;  1TKY A;  3KWL A;  4BZA A;  1PK3 A;  4P2H A;  2LMC A;  1IIP A;  4RNM A;  5AM3 A;  5DCN A;  4B0M A;  4UAR A;  4HRO A;  3GDX A;  5KL8 B;  2MP2 A;  5J2I A;  2K0P A;  4QZB A;  3CIR B;  4DFJ A;  5DG7 A;  5KFX A;  1NJW A;  1VR9 A;  2EQY A;  1FEZ A;  1JWM D;  2ACZ B;  3H0L B;  3AE9 B;  2D3C A;  4B0E A;  5J2J A;  3OSP A;  1F77 A;  2A1A A;  4RUA A;  4KLG A;  4ECT A;  2HBJ A;  3PZD A;  4YD2 A;  5AHX A;  1AW7 A;  2Y0S F;  3Q8Q B;  3CSF A;  2G07 A;  2DYB A;  3LYY A;  3AU5 A;  3PSI A;  2I2Y A;  3TAP A;  3BS5 A;  3ECI A;  2HHU A;  3ZO5 B;  2JEG A;  1I35 A;  1F0M A;  1ZQI A;  1S77 D;  4EYH B;  3UQ0 A;  2PE9 A;  2E1E A;  2HVH A;  3IT4 B;  1D4B A;  8ICY A;  5AM5 A;  4U7C A;  4KLF A;  2AWT A;  4W9J A;  4ZHP A;  4TQ1 A;  2UVU A;  5IAA C;  5EWE A;  2EMS A;  3EHV A;  3ZGZ A;  1KL9 A;  4FUL A;  3D2Q A;  3H8H A;  4PH5 A;  1MI0 A;  4GN1 A;  1UF0 A;  3D2S A;  4QNL A;  2F1J A;  4ED8 A;  4IL6 U;  3UMC A;  1OTR B;  2DYO A;  3NOB A;  3VXW A;  3RNB C;  4N9F 4;  1SWV A;  4ELT A;  2JZ3 B;  4P4M A;  1MJD A;  4PHD A;  4FS2 A;  1F1H A;  3CW2 C;  1YMH E;  5T14 A;  4CF3 A;  5KG3 A;  3RNA C;  3ZUN A;  5E6P A;  5G55 A;  2ATL A;  4P0Q B;  3K9P B;  1ZQK A;  3A0B U;  5J0S A;  3M7D A;  1R4N B;  3TIX A;  1MVK A;  3F2D A;  2FE9 A;  3IXS A;  3QHT A;  4DL5 A;  5KT4 A;  5KT6 A;  3FKY A;  4LNK A;  4RH6 A;  2QCZ A;  3QUT A;  1VDV A;  3B0A A;  4XX5 A;  4K3C A;  1OQQ A;  2MBQ A;  3H7S A;  3KH0 A;  4KIK B;  1U49 A;  3BVG A;  1MG8 A;  1M6Y A;  4NLZ A;  4DSE A;  3TAR A;  1Q8K A;  4KDI C;  1NZP A;  1YZ6 A;  4IS7 A;  1C7Y A;  4WAA A;  3ISC A;  4B9S A;  2N9P C;  3ZI4 A;  2K6Q A;  2JRI B;  4IRK A;  4MT5 A;  1OQR A;  1P1A A;  1XNS A;  2KD1 A;  2ON8 A;  4C4V B;  2BR0 A;  5HHH A;  3V6K A;  3QCA A;  2BKR B;  3DBS A;  4IM0 A;  3U26 A;  1HEK A;  2K8B B;  3LK9 A;  1SL2 A;  1XSP A;  1ENF A;  4GXB A;  1E6E B;  3DV9 A;  4XUS A;  2BGW A;  1NK4 A;  1ZQ1 C;  4RF0 A;  4YMM A;  3AXC A;  1A76 A;  2L32 A;  2PJH A;  3NHE B;  2HHV A;  2TSS A;  1KSP A;  5DDY A;  5JUM A;  3QAR A;  2KK0 A;  4RZR A;  1FM0 D;  2AL6 A;  3RJK A;  2HDE A;  3PTF C;  4FXC A;  4JQW C;  3WAL A;  2V3P A;  1N6Z A;  1C9F A;  3RJF A;  4NM1 A;  2K4I A;  3M95 A;  2Z8L A;  4AYB C;  2KO3 A;  2PI5 A;  1PUT A;  3MAB A;  2DPI A;  2RLT A;  2Y5P A;  3ZLZ A;  2W9B B;  4DQI A;  3PSE B;  1SXD A;  3SD7 A;  2H88 B;  5DQI A;  1WXA A;  1SGG A;  1NZB A;  2FUH B;  5KFD A;  4QJF B;  1QKZ A;  5DLG A;  1PQS A;  3PSP A;  4BKG A;  2WWZ A;  3OJ3 A;  1QLN A;  2NRW A;  3QE9 Y;  5GTI U;  2NBU A;  2R61 A;  5KNI A;  2V4Q A;  1VZ8 A;  4M9H A;  4DLG A;  2FID A;  1UBI A;  2Q5W D;  3FIL A;  5C1Z A;  1C79 A;  4JV2 A;  2OYY A;  1ZQG A;  1JRU A;  4M8M A;  1BUI C;  4URK A;  3KHR A;  1UNS A;  4QZE A;  4B9K A;  3RT3 B;  3WK7 A;  2KSO A;  2M1M A;  2XNA C;  4F4Z A;  4WQO B;  3H8S A;  2ZUC A;  4N59 A;  3BQ0 A;  1D5M C;  3EFU A;  3P42 A;  1HTO A;  2OOB B;  4ELU A;  3FM9 A;  1KOT A;  5HNK A;  2EAM A;  1WYG A;  2K60 A;  2ASQ A;  1DOY A;  1SL0 A;  3Q8B A;  2LKY A;  5J0Q A;  1PVP A;  4DL6 A;  1C76 A;  1PZN A;  3L3F X;  1I4P A;  1BPY A;  2RDH A;  3AE1 B;  1EUV B;  4PS8 A;  2MAX A;  3HIL A;  2NRV A;  2LXC A;  1QQR A;  3LJ3 A;  4Z6F A;  4ANW A;  1SV4 A;  1XU4 A;  2WP9 B;  2NV3 A;  3RNE C;  4AP4 C;  3SMV A;  1LO5 D;  4J9O A;  1WY8 A;  2MJE A;  8ICJ A;  1WZ0 A;  3IBE A;  4F1S A;  3MGV A;  4YMO A;  2XBB C;  4YT0 B;  3GOE A;  1XO0 A;  4RM9 A;  2EH9 A;  2F3N A;  1LXD A;  5IP4 D;  3GE8 C;  2ZTC A;  1ZDX A;  1ZD4 A;  5BMG A;  3TAN A;  3EWA A;  2FPL A;  3DHG C;  4IKG A;  5ALT A;  5DB7 A;  1LKY A;  2ASL A;  4DHZ B;  2I1Q A;  1TKE A;  1WWV A;  3CP8 A;  3M6Z A;  2BB5 A;  4MSQ B;  3B1L X;  5KHO A;  4YR0 A;  1U47 A;  2GLS A;  4J03 A;  4WJP A;  4Y2Y A;  4JLC A;  5BO4 B;  4M0W A;  3QWZ B;  1ZQU A;  3PW2 A;  2AQ3 B;  3ALR A;  3MFH A;  3TBL D;  3PX4 A;  3PRE A;  3AEE B;  4K4I A;  2KWC A;  1WSP A;  3P4Q B;  5KFZ A;  2L05 A;  5AK3 A;  3AI5 A;  2IZV B;  3H1U A;  1WE7 A;  4GIB A;  2K8C A;  3KBB A;  1U48 A;  1KTK A;  4MEM A;  3IRU A;  1ZD3 A;  4FJZ A;  2IGD A;  3CRX A;  4LJO B;  3ZJT A;  4UAZ A;  2ZW0 A;  3PMN A;  3ZKJ C;  5EOZ A;  1I4G A;  1WX8 A;  1JXE A;  1V86 A;  2RDG A;  5D3I B;  1C4P A;  4NY8 A;  3RAQ A;  3B9J A;  1FMA D;  2NVU I;  4LDT D;  4EUT A;  4GC6 A;  1XO1 A;  4W9H A;  1X6J A;  3BVZ A;  3JVZ X;  2PVG C;  4MAC A;  3VH3 B;  3M9M B;  4IC9 A;  5T8I A;  4UDU C;  1PK1 A;  2QEJ C;  1AWD A;  4RU9 A;  3TFR A;  2GRI A;  3PLU A;  5D2M B;  3NUH B;  5E6J A;  4LNF A;  1TE2 A;  3V60 A;  2K6D B;  4YCX A;  1CMX B;  4DS4 A;  2BKE A;  3RN9 C;  5KT3 A;  4QZF A;  5ALP A;  3T5L A;  1E90 A;  1N62 A;  4RUC A;  2R8I A;  2V9W A;  3RR8 A;  2KFK B;  2LRW A;  2KKP A;  4KX6 B;  3PHX B;  4RGO S;  3DVG X;  2WDQ B;  1Y56 A;  3R2T A;  2P6R A;  1SV0 A;  3APC A;  7ICQ A;  1Z4O A;  1YQ3 B;  1XLN A;  4ICV A;  4TUR A;  2CPR A;  4Y2X A;  2EKE C;  4Y2V A;  5ALV A;  4W9K A;  1X9S A;  3Q69 A;  3QU7 A;  9ICF A;  3PHW B;  4JPS A;  3DVN U;  3BZC A;  1Q5W B;  3BY4 B;  2ESE A;  2FI1 A;  1TS3 A;  4FA6 A;  5IN7 A;  4R3D A;  1ZJN A;  2P35 A;  1CK1 A;  1TAM A;  3PS6 A;  4DFM A;  5HHI A;  3VRB B;  1A5R A;  2PMZ C;  3B08 A;  1YJI A;  4DQQ A;  2WS3 B;  1L7N A;  4KSK C;  4OHJ A;  2YMP A;  5J2D A;  3C2L A;  3OPX A;  3DVG Y;  5EWF A;  4RQ3 A;  1T0S C;  3K1R B;  1Z00 A;  5IIK A;  2PPH A;  3VTU A;  4JB3 A;  5AM2 A;  1L3T A;  2KZR A;  3A33 B;  3Q8A A;  3L5K A;  2BB6 A;  2XY7 A;  1SE9 A;  1CEZ A;  2LM4 A;  4XZ4 A;  2FJ6 A;  4UB8 U;  4M04 A;  3CYM A;  3QNM A;  2JVC A;  1ECW A;  4Q44 A;  2KMM A;  5L1K A;  2ZJD A;  2Q4T A;  4KLS A;  3GV5 B;  1S9F A;  4JGH B;  1ZQV A;  1H38 A;  2KDB A;  4OZC A;  4BKS A;  2C2E A;  4ECZ A;  2WXJ A;  5AUI A;  2CHX A;  1IV8 A;  2EMT A;  1JWB D;  2ZJ5 A;  4QWD A;  1KLV A;  4RGT A;  5A0L A;  4DBG A;  1HA5 A;  3EFC A;  1QOG A;  2WXO A;  2VZK D;  3ZDB A;  1NNL A;  3C23 A;  2LHE A;  1VJ5 A;  3JPO A;  1J7A A;  3HUI A;  4HJG E;  1WM3 A;  2IND C;  2ZZP B;  4NY0 A;  3V6J A;  1P7E A;  4G3I A;  2F8K A;  1TKG A;  2DL0 A;  1F0Z A;  5GMV A;  1MA7 A;  3H8J A;  4I2A A;  3DHH C;  4I6L B;  3H40 A;  3AU2 A;  3KTQ A;  2FAZ A;  5J0O A;  2RP5 A;  3C28 A;  2H3I A;  1Q3U A;  4QZI A;  3WAP A;  3WKB A;  3AE2 B;  4I2B A;  5HHD G;  5D4B A;  3H8W A;  5G5H A;  3H0M B;  4YFK A;  2NRT A;  3KZI U;  3UPQ A;  1HZ6 A;  2I1K A;  5DDM A;  3J81 j;  2R8H A;  3MJW A;  9ICW A;  4OVV A;  3T5J A;  3ZQ4 A;  1NKB A;  2IOH A;  4PZO A;  2DEN B;  5ALK A;  2LJI A;  4W9L A;  3N30 A;  2RDJ A;  9ICM A;  3KHH A;  3DBR B;  4HLE A;  1ZRM A;  2HDO A;  4DF8 A;  5ALF A;  4YL8 A;  4GDL A;  2WHE A;  4DSJ A;  2XCA A;  2KFK A;  2GBN A;  1A77 A;  2A3V A;  3VQI A;  4I2F A;  2KX3 A;  2ONQ A;  3Q3F A;  4DHZ E;  1S8O A;  3T3F A;  2N7D A;  7ICS A;  3T5K A;  2O2V A;  3HK0 A;  2D8C A;  4MF8 A;  2Y1I A;  2EAO A;  4KVG B;  3Q14 C;  3NVW A;  5ALG A;  4RQ8 A;  5FP0 A;  2J6T A;  4F4K A;  1FNV A;  2P66 A;  2LWP A;  2W82 A;  3ZDA A;  1L0X B;  3PRZ A;  3MHZ A;  4LZG A;  4RQ2 A;  1L7O A;  2CU3 A;  2KP7 A;  2DHZ A;  1YOV B;  1RFA A;  3UIO B;  5KFI A;  4IR9 A;  4EKU A;  3F2B A;  4BOZ B;  4CHK A;  2JXJ A;  5J0Y A;  2IYD B;  1E7V A;  1YX6 B;  2INC C;  2N1W A;  3NJT A;  3JPQ A;  4GDK A;  4RF1 A;  4YTM B;  1ESF A;  5G5G A;  4Q2J A;  1WR1 A;  5AKK A;  2PW9 A;  3C5F A;  1E8X A;  2XID A;  3IHQ B;  2E8P A;  3DBR I;  5LXH A;  2HOF A;  2WLB A;  2JYT A;  2FCQ A;  2NBW B;  3Q2A C;  4MFF A;  3TI0 A;  1I4X A;  2QC8 A;  2XEW A;  2D3G A;  4EZK A;  4FAD A;  4YXD B;  5IKC M;  8ICS A;  2LYH A;  3IFW B;  4TSS A;  4WAF A;  2MQJ A;  1QQ7 A;  3AQE A;  1UA1 A;  1NJZ A;  3AEC B;  3KWV A;  4N6E B;  9ICA A;  3U2S C;  4IQT A;  4R64 A;  4LJP B;  3VTW A;  1FPY A;  1QCK A;  5ALE A;  1L2N A;  1T8E A;  1RQL A;  3GIK A;  1L5P A;  4CE6 A;  1SIF A;  2KN5 A;  1ZP0 B;  2R18 A;  4J9P A;  2QDF A;  2VRR B;  1V9P A;  2B6G A;  3NG0 A;  9ICU A;  3UMG A;  2LBO A;  3OJ4 B;  5F3X B;  5HG2 A;  4ZOH C;  3MR2 A;  1U4A A;  3NVV A;  3APF A;  4TKN A;  3QUQ A;  4RNA A;  2WHI A;  2W9C B;  2JPH A;  4YSY B;  5L1I A;  3DBL I;  4GFJ A;  2K89 A;  1JUD A;  1FXT B;  4K3B A;  5KT5 A;  3HX0 A;  1V2Y A;  5E6N A;  4M9J A;  3MGH A;  2WTF A;  3BII D;  1QH9 A;  2D10 A;  4UW9 A;  4CF5 A;  2KTR A;  2LYA A;  2H89 B;  4L1B A;  1JXL A;  1QIL A;  4ECW A;  1S10 A;  5AIC A;  1K50 A;  2A1J B;  4GDL B;  4BUG A;  2FIF A;  2XY5 A;  1DYQ A;  2MCN B;  1XT9 B;  4BBN C;  4BJQ A;  2LEK A;  2PIA A;  3H8M A;  3L10 B;  5CHW A;  1L8O A;  5KFC A;  2NRX A;  3BS5 B;  1N63 A;  1U9L A;  3E0F A;  2BCR A;  4KKJ A;  2PFQ A;  3HW8 A;  3I5J C;  3BK2 A;  5EDS A;  3IG3 A;  2W03 A;  2MHJ A;  5KG4 A;  2FPM A;  2L0F A;  2OHF A;  3AU4 A;  2HE7 A;  4PS7 A;  2J0K A;  4IRC A;  4CGZ A;  4C8O A;  5KG7 A;  3KW5 B;  3UF8 A;  1LGR A;  3NAS A;  2IA6 A;  2AEH A;  4II2 B;  1D8L A;  1FNU A;  9ICR A;  3L0W B;  3RUL A;  1K5O A;  5DPW A;  3RJH A;  4P4O A;  2L8J A;  3VCB A;  2GLE A;  4F93 B;  2YTU A;  5KFE A;  2EZZ A;  5ALX A;  3N97 B;  1WFY A;  3AE6 B;  3GS2 A;  2R8J A;  4GDK B;  4KGS A;  4X5V A;  2DZJ A;  2WAQ F;  3AH7 A;  2JY6 A;  4DL4 A;  8ICL A;  3MBY A;  1JAL A;  4PPX A;  4NQK E;  3HVD A;  2WF9 A;  3V6H A;  9ICO A;  3S2A A;  2W54 A;  5IIO A;  3HPO A;  2LJ5 A;  7ICE A;  4Y2U A;  2BQR A;  3WK9 A;  2HTM E;  5F9L A;  1SWW A;  1Z5S B;  1WZ3 A;  5AI8 A;  4ANV A;  5J0X A;  3QJZ A;  5AZG A;  1GUA B;  5J17 A;  2Y5C A;  1TS5 A;  2H5X A;  2QKQ A;  2QB1 A;  1IBX A;  1QTM A;  4K7W A;  5IIN A;  4M01 A;  3UGB B;  1RDF A;  4W9C A;  4GMV A;  3IG8 A;  4DK5 A;  3AL0 B;  1KFT A;  4O3N A;  4F5Q A;  3AE8 B;  2V1Y A;  4O3P A;  1T0R C;  1TKD A;  1YQ4 B;  2JV3 A;  3P1M A;  2CJN A;  1ZRN A;  1Q0W B;  5J0W A;  4J9L A;  4O0I A;  4MM3 B;  2JX5 A;  1BGX T;  2ZPN A;  4ZRQ A;  2FLP A;  1FFV A;  1P3Q U;  2BDP A;  1YN5 A;  4WJN A;  3R7Q A;  3RNF C;  1X2I A;  2LZ6 A;  4IWQ A;  2ICI A;  1V85 A;  1MSW D;  3KUC B;  5DLF A;  4GLS C;  1WJ4 A;  3OG5 A;  1SL1 A;  4W9D A;  5J0T A;  1SE2 A;  2F76 X;  1ARO P;  3TQ1 A;  4IQW A;  2ZEQ A;  4YXM A;  2CRX A;  1D5X C;  4F92 B;  2XCP A;  4CDG A;  1QLB B;  5DBC A;  3ONN A;  2FCM A;  4E71 A;  2FMP A;  2MRL A;  1JWS D;  4F91 B;  3GZF A;  1N48 A;  4P1B C;  4F7Z A;  4GXI A;  3CST A;  1C78 A;  4US9 A;  2DPJ A;  3BWU D;  4OO1 J;  2KZZ A;  2V9H A;  1JCK B;  2J0J A;  4Z6D A;  5KL1 B;  1UH6 A;  2WU5 B;  4ASW C;  1Y8R C;  1SEB D;  3P2B A;  4M6W B;  5AI5 A;  1BPZ A;  4K1R B;  3IG5 A;  2KVS A;  3NY5 A;  1JWU D;  3TEY A;  3UQA A;  2DAF A;  1ZQO A;  2LAS A;  5CRX A;  4M0W B;  2V4I B;  4R66 A;  2OJR A;  2W3R A;  5KAI U;  2WYQ A;  1WGD A;  3OSN A;  2N1V A;  1YQB A;  1ZQJ A;  2KZ3 A;  3QYP A;  3ZNG C;  2LHT A;  4KX3 A;  1ZQW A;  3M8S A;  3R66 C;  2N9X A;  3DDC B;  2A19 A;  3C5G A;  2F1H A;  2XGQ A;  1WYW B;  2J42 A;  1V1P A;  4ZRI A;  1D6E C;  4FHK A;  7ICH A;  2IGH A;  4WQM A;  4N58 A;  1Z00 B;  4F72 A;  2JEF A;  1F44 A;  9ICC A;  2ZVO A;  4KMU A;  5JZE B;  3RD2 A;  2WF7 A;  1B4F A;  1SIJ A;  4NJ6 A;  1DOQ A;  2HW3 A;  4YR3 A;  1ZQL A;  4KLM A;  2M0N A;  3RRH A;  2FMQ A;  1WJ6 A;  2HHX A;  1DGS A;  3MHS D;  1T0Q C;  2YMQ A;  3TAC B;  4HPP A;  4TQR A;  1F2R I;  4XA5 A;  2KVR A;  2PKO A;  3HIZ A;  5EE9 A;  4Y2P A;  2G06 A;  2OEH A;  1UGM A;  1IXR A;  3PVX A;  1YX5 B;  3HHM A;  2HHW A;  3HP6 A;  2INN E;  3QU2 A;  1LQB A;  2IO3 B;  4GB9 A;  4XGA B;  2ZTD A;  4RPZ A;  3QEA Z;  3IN5 A;  1XSN A;  1S97 A;  4HXD A;  1TAQ A;  5JRT A;  3Q8F A;  1EO6 A;  5CX3 A;  1JMS A;  3P4P B;  1EM7 A;  4K7U A;  5EE0 A;  3TL5 A;  9ICB A;  2F8L A;  3WKC A;  3RAX A;  4MH8 A;  1VCB A;  3LXF A;  1C77 A;  4KLH A;  3J9C A;  2NPT B;  3RI7 C;  4NLK A;  1P98 A;  5DQG A;  1WGH A;  4QWC A;  4QIW F;  2ZXH A;  3C19 A;  2IJ0 A;  7ICV A;  4DOB A;  1GO3 F;  4NL9 A;  4PHE A;  3KKA A;  3N7P D;  2KIC A;  3N9Y C;  1PGX A;  3I28 A;  4IWO A;  1QQ5 A;  5AIA A;  5J2A A;  1B22 A;  5LXI B;  3Q8L A;  3B0X A;  1MQ3 A;  4BKT A;  1X66 A;  3PRM B;  2JH7 A;  4M47 A;  3KKA C;  1S0O A;  1I7H A;  4HKZ E;  3UQ2 A;  2QHO A;  1T94 A;  3H0R B;  3A4S C;  4CCH A;  4DOA A;  1HQR D;  2ZCB A;  3N1Y C;  5KFJ A;  1UCV A;  3FYH A;  5J0P A;  4HEA 1;  3PV8 A;  4FO6 A;  2BCV A;  4GLX A;  3W5U B;  4JK1 A;  3CNH A;  3WU2 U;  1VZ6 A;  4NJ8 A;  2C7N B;  2OH2 A;  3W9C B;  2MSE D;  1MQ2 A;  4JIO U;  1S5L U;  1SXE A;  4PGY A;  4C56 C;  1YD8 U;  2G9H D;  2WXR A;  5KFT A;  1KFS A;  2FLN A;  1KH0 A;  4AQ7 A;  3IHP C;  1QSY A;  1TV9 A;  1MG4 A;  4MGK E;  1L8L A;  2NRZ A;  4YXJ A;  4P0P B;  5D49 A;  4FZL A;  4DL7 A;  3RH4 A;  1LV5 A;  2WXK A;  4ED0 A;  1C4C A;  1H4R A;  3QU9 A;  2C9W B;  2YLM A;  2BKF A;  2MUT B;  2VA3 A;  3Q8K A;  2BPC A;  4EEL A;  5AKY A;  4EBE A;  1PGB A;  2E8O A;  2W11 A;  2BDU A;  1QSS A;  4RT3 A;  1WGK A;  3LWL A;  4UB5 A;  3MGI A;  1BT0 A;  1SGH A;  5HFY A;  1ZQR A;  4IW0 A;  5DPR A;  1KFY B;  1NI2 A;  1TYG B;  3ZNZ B;  3ZD9 A;  1RZT A;  4HDQ A;  2MA9 B;  1S0M A;  4JWU C;  4KLO A;  2BVC A;  1TY0 A;  4YN4 A;  4RQ4 A;  3SU8 X;  4M8N A;  3HT3 A;  3I9V 1;  2EZX A;  4QIW C;  5FK9 C;  5J2F A;  2JZZ A;  1E8Z A;  3PR5 B;  2WF5 A;  2IY0 B;  2V3S A;  4OD0 A;  4EYI B;  1RYR A;  3MC0 B;  1GPX A;  2IOF A;  4LZD A;  2Z0D B;  4XDC A;  5J2H A;  2L1A A;  4ZRP A;  4KMO B;  2KJ5 A;  4MSM B;  2XC9 A;  1GOZ A;  2K9X A;  2ZIV B;  3WKE A;  1E8Y A;  4NJ7 A;  4ECQ A;  4UAT A;  5DB8 A;  1OGW A;  2JQR B;  2KMC A;  2G08 A;  3JPT A;  1T7P A;  3KHG A;  1ZPS A;  5BYQ A;  2ZJ8 A;  1HJP A;  3GIM A;  2PKE A;  4A6Q A;  1Q46 A;  2AXT U;  1K1S A;  4KLI A;  2BYF A;  2ZNV B;  1ED1 A;  2ZCC A;  3MC9 A;  4Y2Q A;  2RRD A;  2BYT A;  4B9L A;  4IDI A;  4C4R A;  3VR9 B;  4QWE A;  1WUD A;  2GBJ A;  3ZNH B;  3N1Z C;  2KX0 A;  4F2S A;  2W3S A;  4RGM A;  2LGD A;  5DKW A;  1Z1V A;  3G6X A;  2BPF A;  1MFW A;  3H7P A;  3NZ3 A;  2FDR A;  3JPN A;  1TBE A;  5AI9 A;  4EZ6 A;  1P7F A;  5KFO A;  1X9W A;  5KFS A;  2G0A A;  2W43 A;  1D8B A;  4JMU A;  2JRH A;  3HJE A;  2B21 A;  2HMX A;  4QZ9 A;  3EA6 A;  4K7S A;  3RH5 A;  4WWP A;  1QF6 A;  4O9M A;  1BNO A;  1FRR A;  5I4D A;  3ZNI D;  5JTI A;  5IOI A;  2H3F A;  1XWL A;  2ISO A;  3VTV A;  4F8R A;  5J2E A;  3Q8E A;  3QQ8 B;  2PLP A;  3MFG A;  1HXY D;  2ZUD A;  1TZO A;  1SJE D;  4BXO B;  3PW7 A;  3GZN I;  2Z0E B;  3RUI B;  4KGR A;  4JWM A;  3HM6 X;  2JZB A;  2D6F C;  4HVB A;  5AKX A;  5DQH A;  2HHT A;  3RJI A;  3VFK A;  4RQ1 A;  2KAJ A;  1EWY C;  4MJS B;  3THV A;  1P7D A;  4RQ0 A;  3V7K A;  1TK8 A;  4P0Q A;  1PYW D;  3TCA A;  3N1X C;  3EZ5 A;  2K22 A;  3HVZ A;  1VJK A;  4P0P A;  3WK4 A;  3M9N B;  3UXP A;  2C2D A;  1NK8 A;  1PVQ A;  1SV0 C;  3Q8R B;  1WM2 A;  2PE6 B;  2WX1 A;  4IUM B;  5AKH A;  2KG5 A;  1UEL A;  7ICG A;  3U8Z A;  4HRS A;  1Q10 A;  3NS8 A;  4GSW A;  3AM9 A;  3PPA A;  5HKH A;  1JN3 A;  1ZQN A;  2AHO B;  5KFN A;  3C1Y A;  1Q1O A;  4QZC A;  2CHW A;  2FBW B;  1UT5 A;  5TZV A;  1BPE A;  2BF8 B;  4C4V A;  4WWM A;  3ZYY X;  2NMQ A;  2BYV E;  4PJ0 U;  5DB9 A;  2K8B A;  1ZQA A;  2MBO A;  1R7S A;  4IC7 B;  1J8C A;  2IO0 B;  2C7M B;  8ICG A;  2M0X A;  2RDI A;  3IAM 1;  4M9N A;  3T3O A;  2DGZ A;  3HRD D;  3G6V A;  2KWD A;  9ICV A;  2LGY A;  2HI0 A;  3VHT C;  3PR4 A;  2KD0 A;  2EAP A;  1TT5 B;  2ZIV A;  8ICB A;  4LCD E;  1NI3 A;  4Y2J A;  3UXO A;  4F50 A;  1JML A;  3QIJ A;  1ZD5 A;  2Q0Z X;  3UXN A;  1ZJM A;  2Z59 B;  2IPK D;  2A1J A;  2G4S A;  5KFR A;  4DQS A;  1T0Y A;  3IAS 1;  1OXJ A;  3C2M A;  2KSO B;  1XSL A;  9ICG A;  1WF9 A;  2KZM A;  1HTQ A;  2DAJ A;  5B66 U;  3AQF A;  2JWU A;  5AKJ A;  3A9J A;  1S0N A;  3AU6 A;  3NTU A;  4RNO A;  2KKV A;  2EEL A;  3AE4 B;  2MU2 A;  2ALZ A;  4OJ6 A;  1C1Y B;  3AE3 B;  1PVR A;  3NZS A;  4WH4 A;  4J9S A;  5J8Y C;  1IGD A;  3WK5 A;  1RYS A;  1R4N I;  5D7G A;  3UQB A;  5KFK A;  4ARC A;  3VR8 B;  3OHB A;  2Y9T A;  2DYM A;  3ZJU A;  1N61 A;  2BCQ A;  1B1Z A;  5K4L A;  1ZE3 D;  2K1F A;  4WWN A;  5CB1 A;  1RFK A;  3OWE B;  2OCE A;  2CXY A;  2VAN A;  4LNI A;  3PNC A;  4UAW A;  3KD3 A;  4ANU A;  3L54 A;  4W9F A;  3GU3 A;  5ALU A;  5BOM A;  1M4V A;  1Z2M A;  2H3V A;  3SEI A;  9ICE A;  2HVI A;  1MHX A;  1OW5 A;  2BS3 B;  2KHV A;  4KN7 A;  4LJX A;  3N32 A;  1WRI A;  1TK0 A;  2ZIW A;  4KIK A;  3RZW C;  2WXN A;  1J97 A;  1UHU A;  1GC7 A;  1ZGU B;  4WJO A;  3QUC A;  4BXO A;  2KC1 A;  1DRG A;  1KLU D;  3A9J B;  2L0T A;  4KDL B;  3LB8 C;  2KOB A;  2JZB B;  2YX8 A;  2ZG6 A;  3RB0 A;  4Z6E A;  5DPT A;  1ISN A;  3SAH A;  3PRP B;  2KWV B;  4YTP B;  4HDO A;  1ZQD A;  1NJY A;  3U52 E;  1FRD A;  3DBL B;  9ICQ A;  5MPO A;  4OJO A;  4ZYS A;  3GIJ A;  2PMZ F;  1U45 A;  3GB1 A;  1AYF A;  4HPL B;  3KQ4 A;  1FFU A;  1KN5 A;  1WI0 A;  4ED6 A;  2HSZ A;  5CTR C;  3RBD A;  4PGX A;  2R8G A;  9ICS A;  1VLB A;  2WXG A;  5DBB A;  5E79 U;  2J52 A;  1QSL A;  2BBC A;  4I2G A;  2WDV B;  3ML8 A;  8ICP A;  3AEB B;  3ZDC A;  3TAQ A;  2BT6 A;  4DSL A;  1V9J A;  5C23 A;  3EUB 2;  1WXM A;  4LDT B;  2RGF A;  5AZF A;  3NVY A;  4C4S A;  4A9A A;  8ICV A;  2C7H A;  5L83 A;  1QOF A;  2X8X X;  2VH2 A;  5CP2 A;  7ICR A;  1ZQQ A;  1N2X A;  1X9M A;  1ZQS A;  4C8M A;  3NZU A;  2RR9 A;  2K5P A;  4RM8 A;  4O3M A;  3PGE A;  1ZET A;  3VUX A;  4QW8 A;  3W1Y A;  1X40 A;  1KJT A;  4NJC A;  3VC8 A;  3MR3 A;  9ICP A;  4FJV B;  5AM4 A;  3ZDD A;  5KFW A;  3GV8 B;  2N7E A;  1RQN A;  3D32 A;  2B0C A;  3JPS A;  4UBB A;  3ML9 A;  2NPT A;  5KG1 A;  3OTQ A;  3SAF A;  1K53 A;  3KYC D;  4XYC A;  5L95 C;  3PO5 A;  2CN1 A;  3SV4 A;  2IO2 B;  3ABV B;  2GI9 A;  5KFB A;  3GZN B;  1JI7 A;  2KJ8 A;  2D11 A;  3TKA A;  3JSV A;  1V8C A;  4RCO A;  5D6J B;  2KQS A;  3SZ2 A;  4DWI A;  1N56 A;  5J2R A;  3TFS A;  3WK6 A;  2DWQ A;  1JRP A;  4FE3 A;  4MEY A;  2HCF A;  1PK1 B;  4BDP A;  2WXQ A;  4JX1 C;  3R7R A;  4ED2 A;  4B9N A;  1XF5 L;  4LNO A; 
#chains in the Genus database with same CATH homology
 3DWM A;  2IDY A;  2HTM E;  2J53 A;  1YMH E;  3TEX A;  3PZ8 A;  1FCL A;  2Y5C A;  1TS5 A;  2L52 A;  2L83 A;  2QMT A;  1B9R A;  1N5W A;  1IBX A;  4L2Y A;  3PZ7 A;  3P4S B;  1T6B X;  2N9L A;  1L0Y B;  3AE8 B;  1MVK A;  3IXS A;  1YQ4 B;  3P1M A;  2KDM A;  1RWS A;  2CJN A;  4RH6 A;  1FXI A;  1VDV A;  1KLG D;  2JX5 A;  4MM3 B;  1J7B A;  1ET6 A;  1OQQ A;  4ZRQ A;  1YN5 A;  1FFV A;  3BVG A;  4OZB A;  2ICI A;  5TSS A;  4GLS C;  3E9S A;  1ZUD 2;  2GB1 A;  3R2I A;  1SE2 A;  3FC4 A;  3SFE B;  1IGC A;  4MT5 A;  1UWM A;  1EWC A;  1OQR A;  4A90 A;  3BYT B;  3AMZ A;  1D5X C;  1NEK B;  1PGA A;  2ON8 A;  1QLB B;  2Y3A A;  1HEZ E;  1NEN B;  1ENF A;  1IUE A;  1E6E B;  4RF0 A;  4DQO C;  1JWS D;  4JE3 B;  3EGR A;  2L32 A;  4RFB A;  1FNW A;  2TSS A;  3VRA B;  4C7Z A;  2V3N A;  1C78 A;  4US9 A;  3BWU D;  1FM0 D;  2HDE A;  4FXC A;  1JCK B;  2WU5 B;  2V3P A;  1C9F A;  1I4Q A;  1SEB D;  1JRO A;  1DOI A;  4D2K A;  2Z8L A;  3TEY A;  1GB1 A;  1E7P B;  1JWU D;  1PUT A;  2Y5P A;  3TUO A;  2YEP F;  2V4I B;  2W3R A;  1E0Z A;  1L0V B;  2H88 B;  3WCQ A;  1ZDV A;  1C4A A;  2AX5 A;  2JZP A;  1QKZ A;  3P4R B;  2J42 A;  1V1P A;  3E56 A;  3T3N A;  1D6E C;  2R61 A;  4P16 A;  2IGH A;  4WQM A;  1VZ8 A;  4N58 A;  3FIL A;  2Q5W D;  3V3X A;  1YJJ A;  1C79 A;  3URY A;  2PVO D;  3NVZ A;  4AS1 A;  5EE1 A;  2BS4 B;  1SIJ A;  2N9K A;  5FKA C;  1BUI C;  5LNK 1;  1UNS A;  3ETR A;  1KF6 B;  2M56 B;  2QJL A;  2XNA C;  1L6U A;  3BK1 A;  4N59 A;  1D5M C;  1PDX A;  3P42 A;  2X38 A;  1RM6 C;  1E9M A;  1WYG A;  1F2R I;  4XE0 A;  1DOY A;  1AN8 A;  2FE8 A;  2PKO A;  3Q8B A;  5EE9 A;  1C76 A;  2G1E A;  4O1N A;  2RDH A;  1I4P A;  3L4P A;  3AE1 B;  3AN1 A;  1ET9 A;  2INN E;  2KAC A;  3I57 A;  1GB4 A;  1QQR A;  2WP9 B;  3Q8F A;  3P4P B;  1LO5 D;  1EM7 A;  1SF0 A;  5EE0 A;  2MJE A;  1BXT A;  4YT0 B;  4MH8 A;  4WUR A;  2SEB D;  3LXF A;  1C77 A;  1CJE A;  3J9C A;  2WQY B;  2BS2 B;  1FD6 A;  1EU3 A;  5H92 C;  5C3J B;  1ZDX A;  5BMG A;  2XN9 C;  4IKG A;  2E6X A;  1N5X A;  2IJ0 A;  1MPE A;  1TKE A;  4OW0 A;  1T5X D;  2BB5 A;  1KRH A;  4USA A;  2I38 A;  3N9Y C;  1PGX A;  1XCQ L;  2JU6 X;  2OED A;  3FAH A;  4M0W A;  1J7C A;  1I7H A;  1TJE A;  1CQV A;  4HKZ E;  2AQ3 B;  2DBY A;  3TEW A;  2V0G A;  3P63 A;  3AEE B;  1WSP A;  3P4Q B;  1HQR D;  2M0A A;  2CJO A;  2D5G A;  4HEA 1;  3KLS X;  2MJ3 A;  4DXF A;  3W5U B;  1KTK A;  1L4D B;  1VZ6 A;  4HKQ A;  1EU4 A;  5BMH A;  2EKI A;  3FIL B;  2IGD A;  3C8Y A;  3CWI A;  3W9C B;  1QT9 A;  3ZJT A;  4ITK A;  3AV8 A;  4C56 C;  2ZW0 A;  3V05 A;  1HZ5 A;  3AEG B;  5BMI A;  1I4G A;  2G9H D;  2RDG A;  2WXR A;  1XCT L;  1KH0 A;  3MJ5 A;  3B2F A;  1C4P A;  1ACC A;  4OVZ A;  5D3I B;  3B9J A;  1FMA D;  4AQ7 A;  2KN4 A;  2PMV A;  1SSN A;  1SB3 C;  2WXK A;  2MH7 A;  3BVZ A;  4MAC A;  2PVG C;  1C4C A;  1XLQ A;  4YSZ B;  2M19 A;  1PGB A;  5T8I A;  4UDU C;  2QEJ C;  1AWD A;  1SXT A;  1SE4 A;  1WGK A;  2GRI A;  3AED B;  1SBB B;  3NUH B;  5E6J A;  5HFY A;  3NS1 A;  1KFY B;  1TYG B;  1I4H A;  4CQN A;  2YEP B;  4KX6 B;  1N62 A;  4JWU C;  4A8X C;  1NYR A;  1TY0 A;  4RGN A;  4YWG G;  2KQ4 X;  4RGO S;  3I9V 1;  3GP7 A;  1GAQ B;  2WDQ B;  5FK9 C;  1Y56 A;  1V1P B;  1WWT A;  3R2T A;  2BTE A;  1YQ3 B;  1XEE A;  1V97 A;  1XLN A;  3AEA B;  3MC0 B;  4LTU A;  1GPX A;  3RPF C;  1XO3 A;  4JWS C;  4XDC A;  2L1A A;  3Q69 A;  4ZRP A;  4C7Y A;  1GOZ A;  2K9X A;  4JPS A;  3AE5 B;  2RMM A;  2JQR B;  1TS3 A;  1ZPS A;  1SJH D;  2NTT A;  1NVI D;  5BYQ A;  4R3D A;  4A6Q A;  1CK1 A;  2QIL A;  2JSV X;  4P6V F;  3VRB B;  2BYT A;  4IDI A;  3VR9 B;  1YJI A;  2WS3 B;  1BML C;  4RGM A;  2W3S A;  4OHJ A;  3W2D A;  1E10 A;  3NZ3 A;  1JQ4 A;  2WU2 B;  1WXQ A;  3Q8A A;  2BB6 A;  1P7F A;  1XXG A;  3TSS A;  1VRA B;  4LK0 M;  4XDD A;  4A55 A;  2KMM A;  5H8Y E;  5AUK A;  1YNT E;  3PO0 A;  3EA6 A;  1QF6 A;  1FIQ A;  1FRR A;  5I4D A;  2AQ1 B;  4OZC A;  2WXJ A;  3AB5 A;  5AUI A;  3Q8E A;  1JWB D;  2PLP A;  5EE3 A;  4RGT A;  3MFG A;  1HA5 A;  1QOG A;  2WXO A;  2VZK D;  4H2A A;  1HXY D;  1TZO A;  1SJE D;  5BYR A;  4KGR A;  1FEH A;  2LHE A;  3IT6 B;  1J7A A;  2B76 B;  3HUI A;  2KAJ A;  4HJG E;  1P7E A;  1EWY C;  1TKG A;  2NTS A;  1F0Z A;  1UUP A;  2SAK A;  3U4E G;  4KKI A;  1PYW D;  2K22 A;  3HVZ A;  1D5Z C;  3AE2 B;  1VJK A;  5HHD G;  5G5H A;  1NYQ A;  1HZ6 A;  2JYE A;  3AE7 B;  1QOA A;  3ZQ4 A;  4XWT A;  1JWA D;  2FUG 1;  3W5V B;  2LJI A;  3NRZ A;  1ZOY B;  4HRS A;  1Q10 A;  3O13 A;  4XWW A;  3AM9 A;  2J4X A;  2LGI A;  2QSD A;  2PTL A;  2RPV A;  2FBW B;  1ZXH A;  3SFD B;  1PFD A;  1L6V A;  3VQI A;  4WWM A;  3ZYY X;  2NMQ A;  2ONQ A;  1R7S A;  1JW9 D;  1QOB A;  3IAM 1;  3T3O A;  1MHH E;  3HRD D;  1K51 A;  1DOX A;  1XLO A;  2KWD A;  3NVW A;  1FNV A;  2W82 A;  1L0X B;  2VZK B;  1NI3 A;  3MHZ A;  2BW2 A;  3SR6 A;  2CU3 A;  2INP E;  1F2R C;  1JML A;  1YN3 A;  2WXI A;  2WXF A;  2IPK D;  4YSX B;  3DWG C;  2LHD A;  3IAS 1;  1A70 A;  3B2G A;  2JWU A;  4RF1 A;  2K3U A;  3AE4 B;  2EEL A;  4WH4 A;  3AE3 B;  1IGD A;  1ESF A;  5G5G A;  5C2T B;  5D7G A;  4YTM B;  4Q2J A;  4ARC A;  3VR8 B;  4NAW B;  5HI1 A;  2MJD A;  2PW9 A;  2DYM A;  5BYS A;  3ZJU A;  1N61 A;  1B1Z A;  1YN4 A;  1ZE3 D;  1IBX B;  1RFK A;  4EE2 A;  3OWE B;  2WLB A;  3ZJV A;  2JYT A;  3R8B A;  5JXV A;  1M4V A;  2WNM A;  1I4X A;  1FO4 A;  3SEB A;  3BZD B;  3TEZ A;  4YXD B;  1TY2 A;  1K52 A;  1CZP A;  2WXM A;  1MHX A;  2BS3 B;  4TSS A;  4WAF A;  1WRI A;  3AEC B;  3KWV A;  1RYJ A;  4N6E B;  2WXN A;  1UGJ A;  3U2S C;  3UI3 A;  3MP9 A;  4IOI E;  4WIP A;  1FCC C;  1KLU D;  3Q8C A;  3LB8 C;  1L5P A;  2LFI A;  1ZP0 B;  5D3D A;  1T3Q A;  4ARI A;  4US8 A;  1SE3 A;  4YTP B;  2IGG A;  4TQ0 A;  5HG2 A;  4ZOH C;  1TS4 A;  1L4Z B;  2LUM A;  3BVM A;  3U52 E;  2WDR B;  3NVV A;  1FRD A;  3AEF B;  4J3O D;  4KGT A;  4NAM A;  4RNA A;  5MPO A;  4ZYS A;  3GB1 A;  1AYF A;  3KQ4 A;  1FFU A;  2WXP A;  4LLG M;  4YSY B;  2DLB A;  3RFZ B;  2WXL A;  4TMA B;  1VLB A;  2WXG A;  5GXG B;  1TS2 A;  2J52 A;  4C80 A;  1N60 A;  4ZHO A;  1UWX A;  2BBC A;  2ZW1 A;  2WDV B;  3BII D;  1ZXI A;  4PT5 A;  1TKY A;  4DXG A;  3KWL A;  2N0S B;  2E3T A;  2LMC A;  3AEB B;  5FR3 A;  2H89 B;  4B0M A;  1DGJ A;  4L1B A;  4HRO A;  3W1S A;  1QIL A;  2BT6 A;  2K0P A;  2AQ2 B;  1VZ7 A;  1K50 A;  3CIR B;  3EUB 2;  4GDL B;  1VR9 A;  1DYQ A;  3NVY A;  1I4R A;  1JWM D;  2ACZ B;  4OZA A;  2LEK A;  4A9A A;  2PIA A;  3AE9 B;  1QOF A;  4B0E A;  3BYY B;  1F77 A;  2JXT A;  4NZL B;  1N63 A;  4KKJ A;  1OFF A;  2K5P A;  1V1O A;  1AW7 A;  1XLP A;  3LYY A;  3BK2 A;  2I2Y A;  4NJC A;  2QIE B;  2OHF A;  4REZ A;  3U7Z A;  4YTN B;  2MEK A;  3IT4 B;  1D4B A;  1K53 A;  1FNU A;  3ABV B;  4TQ1 A;  4ZHP A;  2GI9 A;  3AE6 B;  3GS2 A;  4GDK B;  1V8C A;  4KGS A;  4RCO A;  1STE A;  3ZGZ A;  4L23 A;  3H8H A;  1MI0 A;  3AH7 A;  2N7J A;  1JAL A;  2DYO A;  2DWQ A;  1JRP A;  2WXQ A;  3HVD A;  4JX1 C;  2W55 A;  2W54 A;  1ROE A;  1FXA A;  1XF5 L;  2WXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...