1FFUA

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
155
Chain Sequence
b'KKIITVNVNGKAQEKAVEPRTLLIHFLREELNLTGAHIGCETSHCGACTVDIDGRSVKSCTHLAVQCDGSEVLTVEGLANKGVLHAVQEGFYKEHGLQCGFCTPGMLMRAYRFLQENPNPTEAEIRMGMTGNLCRCTGYQNIVKAVQYAARKLQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
molecule tags Hydrolase
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
total genus 45
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1ffuA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ffuA01
3VR9B 2M19A 3AE2B 1L5PA 2H89B 3AE8B 3CIRB 2E3TA 1PDXA 1E7PB 2LEKA 1RYJA 4YTPB 1A70A 2BS4B 1KF6B 2AX5A 4ZHOA 3NVZA 1V8CA 3B9JA 2JQRB 1GAQB 1TKYA 3DWGC 4YSZB 1F0ZA 1XO3A 1YJJA 1E6EB 1QF6A 1QOAA 2FBWB 4IDIA 2B76B 3EUB2 1DGJA 4FXCA 2Q5WD 2L83A 3AE6B 3NVYA 3NS1A 1R7SA 2QIEB 3AEEB 3AM9A 2Y5CA 2PVGC 3AE1B 1JQ4A 1RWSA 2W55A 1YJIA 3P63A 1FXIA 3AH7A 1XLOA 3HRDD 3ABVB 3W9CB 4C80A 2MH7A 1XLQA 2DBYA 3B2FA 4US9A 4C7YA 1AWDA 1FO4A 1JALA 4YT0B 4A9AA 1CZPA 2N0SB 1IUEA 2BS2B 3VRBB 1KRHA 3SR6A 1JRPA 1FXAA 3AEDB 1FFVA 1E9MA 1L6UA 2CU3A 1AYFA 5G5HA 2WQYB 3AEAB 3VR8B 1TYGB 3P4QB 1JWAD 1ZOYB 2WP9B 1QT9A 1SF0A 4JWUC 4P6VF 3FC4A 4C7ZA 3LXFA 1FM0D 5H92C 2KMMA 4HROA 4ITKA 1WYGA 1GPXA 1JW9D 2KAJA 5EE9A 1WWTA 3AE9B 4ZOHC 1I7HA 1TKGA 1WGKA 1WXQA 2PKOA 3ZYYX 3AE3B 2L52A 1WRIA 2W3RA 2M56B 1ZP0B 2CJOA 2PIAA 1OFFA 1OQRA 2CJNA 3B2GA 1L6VA 3KWLA 1NENB 1NEKB 3P4RB 5GXGB 3NVVA 4WWMA 1XLNA 1RFKA 1V97A 1ZXIA 2WS3B 3AV8A 1OQQA 1NI3A 3BIID 4KX6B 2W54A 2HTME 1KFYB 3AEBB 3AB5A 1TJEA 2OHFA 1QOBA 3AE4B 2MJ3A 3DWMA 3WCQA 1N5XA 5EE1A 4YTNB 3VRAB 3SFDB 5MPOA 1J7BA 1VLBA 3AN1A 1QOGA 1J7AA 4LTUA 1DOYA 5EE0A 3NVWA 2MJEA 2QJLA 2JX5A 1RM6C 1FRDA 3AE7B 4ZHPA 4US8A 1XLPA 2ACZB 3HVZA 3LB8C 3W5UB 2H88B 1YQ4B 1CJEA 4YXDB 2WDVB 3CWIA 1EWYC 1VDVA 1SB3C 1NYQA 2MJDA 2WLBA 5AUIA 5EE3A 3SFEB 1N5WA 3W5VB 4YTMB 4N59A 1B9RA 1T3QA 4YSYB 2PVOD 3RPFC 1ZUD2 1TKEA 2WU5B 4YSXB 2WU2B 1N60A 3P1MA 3AMZA 1YQ3B 1N61A 3AE5B 1NYRA 4N58A 1N62A 1DOIA 3AECB 1E10A 1SIJA 3ETRA 2BT6A 1J7CA 1PUTA 3PO0A 4JX1C 2WDQB 1N63A 2K22A 2K5PA 3P4PB 1QOFA 1DOXA 1QLBB 2WDRB 3FAHA 1L0VB 2G1EA 4HRSA 2BS3B 5C2TB 1VJKA 2EKIA 2K9XA 3AEFB 3NRZA 5AUKA 4USAA 1JWBD 3HUIA 4JWSC 1FRRA 3L4PA 1NVID 4N6EB 1PFDA 1FFUA 5G5GA 1FMAD 1FIQA 1ROEA 1UWMA 2DWQA 4WQMA 1E0ZA 5H8YE 1JROA 5C3JB 3AEGB 2W3SA 3P4SB
chains in the Genus database with same CATH superfamily
1U49A 2M19A 3OJ3A 1NJYA 5DB7A 2R8GA 2KJRA 1QQ6A 2UVUA 2M1MA 5KT2A 1L7PA 1RQNA 2BQUA 4LLGM 1DK3A 1KLNA 3UPQA 1F9JA 1JWMD 4LZDA 1D6EC 5IILA 2EANA 4IDIA 2K8CA 3ZD8A 4I2FA 1RDFA 1RXWA 5JHBA 1QQ5A 5AI9A 3R3MA 4B9UA 2KMCA 1YN3A 2JVCA 3Q8QB 2W55A 4DHJD 3PLUA 1ZQPA 4UDUC 4TMAB 2WXFA 3JYUA 1UT8A 1BGXT 2LRUA 2W9MA 5IINA 4I2CA 2XVTA 3PRMB 4YQWA 3PR4A 1NKEA 2RQ5A 2V9HA 3TBLD 1IUEA 3VRBB 1KRHA 1KH0A 3AEDB 5J0UA 4DXGA 1L7YA 1RZTA 2DHZA 4EEYA 2K89A 4F8CB 5DG8A 4IRDA 3IG5A 2KVCA 4ECUA 1EU3A 4ED0A 3IAM1 4KGTA 4KN4A 3GE8C 4QZHA 2PKOA 3ZYYX 8ICFA 2C7NB 3F2BA 5ALGA 1AN8A 3HW8A 2PIAA 5BMGA 3PZDA 4F93B 3GV5B 1MVKA 1V1PA 2O6VD 2KYWA 2XK5B 1P1AA 1ZXIA 1NI3A 2N9PC 3GILA 4DSJA 4F72A 1I4GA 2OHFA 2LYHA 2V4RA 4AJWA 1TVAA 1VRAB 2G08A 1ZJMA 4PS8A 2AXTU 3QU9A 2V1YA 5JXVA 5KFBA 2LYAA 2L00B 3QZ7A 4F71A 5FK9C 1ZQGA 4S17A 1ZOLA 5E6OA 3UQ2A 3Q3FA 1TK5A 4FHKA 3PREA 1S77D 2M0AA 3V3XA 3PNCA 2BF8B 2B3AA 2CRXA 4NV0A 7ICNA 1GC6A 4JL9A 4DDID 4YD1A 2KD1A 4KLFA 5D2MB 1WE6A 2IDYA 1IP9A 3W5VB 1Q1OA 3RULA 1WZ0A 4M00A 2EAOA 3Q8SB 3QX7A 4I2JA 1CEZA 1BPXA 1SXTA 5EWGA 2ZPNA 4KV2A 1YQ3B 4XQ8A 2YLMA 2LJ5A 4WIPA 4JK1A 4HDOA 3SEBA 1N63A 1QLBB 4YWGG 4QZEA 2KG5A 2XNAC 4HRSA 2BB5A 3QEAZ 3WAPA 3SZ2A 3E56A 1X9XA 3QAQA 3DVGY 5AUKA 1ZQRA 2RRDA 3ZJVA 4N6EB 4CDGA 3SEIA 1ESFA 3PX4A 2RPQA 1Z1VA 1UBQA 2KMDA 3QUCA 1WCNA 4RUCA 3GV8B 4KLHA 2MBBB 3VR9B 2GLEA 5AHXA 3PMLA 1WR1A 1RYUA 4NM2A 2HDEA 4LNIA 4ANXA 2E1FA 4PL1A 4QZGA 3OSNA 5AK5A 3HKZC 2D3AA 4M01A 5IP4D 5JU5A 1BNPA 1KEJA 4DDGD 4AUQC 4DFDA 4JV1A 1QF6A 1V80A 3JSVB 2W9AA 1ZW7A 4R63A 2L3ZA 2AU0A 1IGCA 4ED6A 3RT3B 5ALSA 1R7SA 1HXYD 1WX7A 9ICAA 2ZJAA 1YJIA 3KHHA 5JZEB 4RQMA 2PI4A 2J53A 4YCXA 3DHHC 2KOXA 2DPIA 4BXOB 2XY7A 4O5KA 4ZRJA 3RZWC 4G9BA 1NI2A 4GN1A 2YN4A 3QU2A 4GOCA 2PMZC 3C2LA 2N0SB 5ALTA 2BGFA 2FPMA 2W9CB 2DZMA 2LVPA 2UWQA 1AYFA 2O6VA 5G5HA 8ICWA 4RPYA 1T94A 3ENEA 2VH1A 2O6KA 1XXGA 4HJKA 4BKTA 2BR0A 4E71A 2KAJA 5KL8B 2QDFA 3LDAA 4CF5A 2DYOA 4JMUA 1TKGA 3KW5B 2OCEA 2JGAA 9ICBA 3V62A 2HHTA 2HOIA 2Q4TA 5LLIA 5DGBA 3ZNZB 4P0QA 4MEXA 2JF5A 1RFKA 4MEMA 1OQQA 1NK8A 4Z6EA 1T3NA 4KLMA 3AB5A 4ZRQA 1JMSA 5KFMA 1ZQTA 1AROP 1TAMA 1Q0WB 3TADC 1TK8A 7ICGA 2UU7A 5IIIA 4MF8A 4GDKA 5DPWA 1X9MA 2KHWB 4A8XC 1XCTL 4CO7A 4QIWF 5EOZA 4TUQA 3RH6A 4RNAA 4IS7A 4W9IA 5HMLA 4MF2A 3DBHB 3U8ZA 4C4VB 1SV0C 2PW9A 2ASDA 1MN8A 1UD7A 1YQ4B 2E1EA 4RPXA 4PHDA 1TAUA 1H4RA 4FULA 3ZDMC 1NK6A 2Z8LA 2DQNB 2KJHB 2FE8A 2ZXHA 2ON8A 2LMCA 2FLPA 1M4VA 4XYCA 1Q8KA 1ZXHA 2BPGA 5CEHA 1K53A 3SAGA 5E6NA 2E8MA 1WM3A 3DVNV 2K60A 1E10A 2N1RA 3WU2U 3JVZX 5AZGA 3VVWB 4WQOB 2D3BA 4RGOS 4EX6A 2KZ3A 5KG4A 1XWLA 1Z3EB 2E5SA 4NPNA 1KFDA 5J18A 4KGRA 3M7DA 4P0PB 4QJFB 3OAWA 2F3NA 1FEHA 1C4AA 3D2NA 3V7KA 4Y2XA 4M04A 1JROA 4NJ6A 1LQBA 3IT6B 4B9KA 3BZKA 4RQ2A 3ZD9A 3Q8PB 3AUOA 1HZ5A 3GZNB 4MGZE 2IYDB 1BPEA 1ZQYA 1BPZA 1Q3VA 3W1SC 4UB3A 5DDYA 2XGQA 1XF5L 2JPHA 3N1YC 1SE3A 2G5IB 1YD8U 3MTNB 3WA0A 4Z6DA 1HUZA 3LYSA 2CN1A 2B76B 2BQRA 5DQGA 2LGSA 1YX5B 1KLUD 1L3TA 3AE1B 2DL0A 5F3XB 1TZOA 2BW2A 3P2BA 4CRXA 3S6JA 3X0WA 2A4ZA 4QZIA 3BS7A 1RQLA 5KG5A 1V5TA 2HHWA 4L2YA 3ZVVA 3UXOA 2JHDA 1QLNA 1YIWA 4D2KA 3TEYA 2K4HA 2KZRA 1XC9A 4XUSA 4P7IA 3U52E 5J2CA 2NBVB 4O3SA 4BWJA 1TS2A 3PSTA 5DQHA 1ECWA 3KZIU 4BXOA 3HK0A 1WX8A 2WXRA 1Z4OA 1WR6E 2QSDA 1SE2A 2MLBA 5J2GA 3B2GA 5KG3A 1E5WA 4IQWA 4LNNA 3H4BA 2KTQA 3PSEB 1YZ6A 2R18A 2Y5BB 1G6JA 3QWZB 4ECZA 2NV3A 3RBDA 1OQYA 4RT2A 5BYSA 1TJEA 5JH5C 4EFOA 4UB4A 5CRXA 8ICBA 4ECYA 5DKWA 4GXJA 3QE9Y 4WH4A 4I2DA 2D07B 2DKXA 4KZCA 3NVWA 4ECWA 1QILA 8ICRA 4WAAA 3NUHB 1KN5A 4E3CA 3WK7A 1WXSA 3IN5A 3RD2A 3KLSX 3HVZA 3ZJTA 1NK9A 2R2OA 4BKSD 3MJWA 5CX3A 2ES6A 5AKZA 2IJ0A 2G09A 5ALLA 2M9NA 1T0SC 3QA8A 3SI8A 3C2MA 2HOQA 4QNLA 2ZUBA 1C7YA 1K1QA 1RFAA 2C7HA 1HTOA 1B43A 4I6LB 3P1MA 3L13A 4JWMA 4P2HA 3UXPA 4C4VA 3Q8FA 5CR0A 3EWAA 1L4ZB 3MC9A 3ICXA 3WK6A 3NASA 2ZCCA 4TQSA 1P9DU 4DFPA 4HEA1 3PZPA 3APCA 3IRUA 5KFOA 3HUIA 2L76A 3Q8KA 2IO0B 2ZJDA 3Q8EA 5C3JB 1COOA 3TAQA 3PV1A 4F4KA 4EYIB 2FLLA 2QARB 3JPQA 2F2AB 2C9WB 4K81A 3TAPA 4IL6U 1L0XB 3RTVA 4IQTA 1DXSA 1E7UA 1Z19A 2KICA 3NZUA 2AX5A 2Z59B 1OTRB 1SL1A 4RQ8A 4DL7A 1D8BA 2WYQA 1YJJA 3V05A 4EKUA 2JRZA 3RH4A 3EHVA 4JLCA 1I4QA 2WDTB 3T5JA 3MGVA 1OEYA 4GGQA 2LHDA 4MSQB 2E6XA 5BMIA 2CHWA 2PVGC 3TEXA 4P4OA 4DOBA 4KLOA 5L1LA 2F44A 1C76A 2AQ0A 2NRZA 1YJ1A 3V60A 1B4FA 5F9LA 3UXNA 1ZQOA 2XI9A 4RH6A 5KL1B 4UAYA 3MABA 4BOZB 1FO4A 4ECVA 1SL0A 4Z6CA 1CZPA 4I2AA 4ZRKA 3QNMA 2KQ7A 2ASLA 4OJ5A 1X1MA 1MG8A 4PGYA 3C23A 3MFIA 4DL2A 1QSSA 2RGFA 4LNKA 2JEFA 3BVZA 2KJ5A 4DWFA 5J2KA 2AJQA 1JWAD 4IOIE 4CQNA 1MQ2A 2A1JA 2JZ3B 5H92C 1ZQDA 2IGGA 4QAYA 3C8YA 2WF9A 2DF4B 4C0ZA 2O2VA 1N2XA 2ZIUB 3K1RB 2WTFA 4R65A 2K25A 3M62B 4UARA 3VQIA 2KC2A 2W3RA 1OFFA 1A5RA 1XNSA 2KDFB 5DPSA 2KK8A 4DOAA 2KWUB 1KTKA 2NPTA 1UELA 2PEAA 5FR3A 2FI1A 1HEKA 1D3ZA 4B9MA 4QZDA 3RNBC 4WURA 1ZQIA 5D46A 3DWMA 3F53A 1UNSA 2BVCA 1SWWA 4NJ7A 3SFDB 3K4GA 3AN1A 1WG8A 1WZ3A 2AQ3B 4F4YA 3OTQA 2QJLA 1U47A 3ZI4A 9ICRA 4K4IA 4KLLA 1Z1BA 1JCKB 1FRDA 3LJ3A 4CCHA 7ICTA 1OUQA 2H88B 5KFLA 4KLQA 3DBLB 2WDVB 3NZSA 4C4RA 1XSNA 2MSED 2EAPA 3BVMA 3WIMA 2BPSA 4JWNA 5KFHA 4ACFA 5KFSA 2QB1A 1WSPA 1D4BA 4EZKA 2C28A 3N7SC 5D49A 4ANUA 2VA8A 1AQ6A 2HHXA 1S0MA 2BWFA 9ICQA 5ALZA 5KFZA 4IM2A 5HNKA 2ESEA 1J7CA 1UF0A 7ICIA 3P4PB 2EZYA 2FCQA 2K4IA 3OJ4B 4NZLB 4ZYNA 1F77A 2BS3B 4DSIA 2ZW0A 3AEFB 3RZFA 2B6GA 2VANA 3C28A 4XC2A 5AM3A 2ZUCA 1EF1A 1FIQA 2MP2B 2WB1C 3QUQA 2W3SA 1L6NA 1TV9A 2MQJA 3UI3A 3TACB 3RI7C 4DXFA 3MR6A 2EZXA 2EMTA 3ZDCA 2ATLA 2Y9UA 3PZ8A 4RNOA 1V8CA 2JQRB 1QTMA 3PT2B 5LXIB 3WK9A 5J2DA 5HFYA 3N28A 5ALXA 4GXIA 1FNUA 2V9WA 3OJUA 2JXTA 1WGYA 1WJ6A 2ODGA 2WF7A 3HILA 2EDUA 2QIEB 1D8LA 3SYZA 4BAXA 4EYHB 2MBHA 1GB4A 1U4BA 2BCRA 5CHFA 2WXOA 2YQEA 2J0KA 4BUGA 1F5SA 1WUDA 1XLOA 4X57B 1MSWD 2DBYA 4C7YA 1NKBA 1J97A 2WXHA 4XWWA 5KTQA 3I63C 4DFKA 3RUIB 1KW4A 4GC6A 4RZRA 1NJZA 3SR6A 4L23A 4DSLA 4MT5A 3MDAA 2NBUA 4RPZA 1BT0A 1E8ZA 3TJPA 1TYGB 4DL5A 1ZOYB 2KD0A 1ZQAA 4Y2QA 4MFAA 1JN3A 2PFQA 4ZYSA 4QZ9A 2RSUA 4RGMA 2IO1B 3LWMA 4Q2JA 4KKJA 2G3QB 4BBNF 2SAKA 1ET9A 2DGZA 3QXGA 5TISU 1K50A 2HSZA 5J17A 4W9GA 2J4XA 2ZIXB 5KFQA 2CJNA 3P4RB 1L6VA 1NENB 3PW2A 4EZ9A 3BIID 4KLEA 4GXBA 2Y9TA 3PMNA 2HTME 2UYZB 1ZQKA 1KFSA 5CHVC 1ZD2P 4F5OA 4XA5A 2R8KA 1ZRMA 3V6KA 1GG3A 4ECQA 4KX5A 1E7VA 2IGHA 3Q3MC 4A6QA 3VRAB 5AM0A 1KLGD 3EZ5A 2ZW1A 3K75D 3GZNI 4M6WB 1QOGA 5DLGA 1L3VA 4F5PA 4M2YA 4XDDA 3BVGA 3AE7B 9ICXA 3K9PB 3LB8C 3GDXA 3I3TB 1Y56A 3NOBA 3H4DA 4FHJA 2HI0A 1TGZB 4GDLA 4QZAA 5CHWA 4DFMA 1EWYC 3W1SA 4YR2A 2XY5A 1WMHA 5DGAA 2KHVA 4A8EA 2AGQA 4YTMB 4RMAA 2W8LA 1F2RC 3NRWA 3VH4B 2KANA 3VDZA 5KFGA 1ZUD2 2A1AA 3AMZA 1HZ6A 4ECXA 4N58A 1M94A 1EM7A 2ZIUA 3RYTA 2KX0A 3V61A 2RDIA 2NO5A 5JUMA 3E0FA 2ZCBA 3KUDB 4A55A 2EKIA 4PPXA 2VJ5A 1KKXA 5L83A 3ZO5B 2MP2A 2JUOA 5KFCA 2XICA 4HK2A 4RGTA 3OGUA 1ZQHA 3GE3C 3PSIA 3V7LA 1PZNA 9ICPA 4A3OA 1TE2A 3ISDA 1SE4A 2R8IA 2INDC 2UVWA 3OSPA 2Y1IA 3V72A 2LEKA 4O3MA 4M0WB 1KF6B 5J2AA 4ZHOA 1A76A 5DG7A 2LM4A 3DWGC 2KFKB 2K3UA 1XSLA 1V38A 3D32A 2ZTEA 3EECA 4EX7A 2H3FA 1JXEA 2GB1A 2L7RA 5KG6A 3BQTA 2EKEC 3TKAA 2INCC 3ZUNA 1T0RC 2VKQA 2GWSA 3P63A 4IUMB 4NQKE 1L5UA 2OYYA 1AW7A 3CMMB 1WE7A 3OPXA 2JZBA 4YT0B 3WKDA 3PRZA 1ZE3D 4TURA 2XK5A 2LXAA 3WAMA 5KT3A 5ALMA 1YT3A 3C0RB 3URYA 2XC9A 4BGDA 1JRPA 1E8XA 1RYRA 2GOWA 5KAFU 3SDLC 3MDCA 1SKWA 4HLEA 7ICLA 3H1UA 5HI1A 4ED7A 2AGOA 1XCQL 2NTTA 1VD2A 3ZTCA 2K8BB 4EZLA 4MGIE 1SZPA 1T4GA 4ZRIA 4PHAA 3SENA 2I1QA 2J7QB 2LGDA 2PE6B 2Q0ZX 5J0WA 1NK4A 1S76D 1S1QB 1WRIA 2MRLA 3L17A 4J3OD 1KFTA 2AEHA 1NEKB 1AARA 4I2HA 2KK0A 3IBEA 1COKA 4NLGA 3AI5A 3QUTA 1D9FA 1MA7A 3AU6A 2LGYA 1I35A 2HHVA 4DHJB 2BB6A 2UVRA 2MJ3A 3NG0A 1S97A 3PW0A 3AULA 2INNE 7ICJA 1D5ZC 1TKDA 5KT6A 5EE0A 5C0YA 2DNFA 4G3XB 4BVUC 3KYCD 5AM5A 4A20A 4IKGA 1I42A 2BTEA 2IOFA 1Q46A 1I4RA 4C8OA 4FZNA 4NLBA 3T5LA 3EC8A 4YXDB 4Y2UA 1UUPA 4OW0A 3PO4A 1DYQA 2KHQA 3GIIA 2JEGA 2WLBA 5EE3A 4QWCA 5J0XA 1DK2A 4HPMB 1SJED 4I29A 3ZRFA 3BY4B 5G2NA 3QUBA 2N1VA 4PS7A 5DG9A 1YX6B 4BBNC 3ONSA 2HVHA 1L0YB 1E8WA 2OH2A 4O5CA 2PFOA 4KLUA 2K8AA 1ZQVA 2BT6A 2WFAA 3UQAA 3ALBA 3KKAA 3A4SC 3PHWB 2KFZA 4HCNB 2G1EA 1ZQUA 3PW5A 3HVDA 4QZBA 4RNMA 5IIOA 1NVID 3M9NB 5KFXA 4IR9A 2XBBC 2YVCA 1SIFA 5H8YE 4G11A 4HVBA 3LYYA 1KDHA 4FBTA 1SEBD 2K6DB 2D6FC 2YMPA 1DGSA 4CF4A 2CR5A 5ALJA 5AKHA 2W7OA 3TANA 2JU6X 4MFFA 1D8YA 2NVUI 3PR5B 4P0QB 3DCGA 4EBEA 3ML8A 3HX0A 4EELA 3QJZA 3UIPB 2GLSA 2FPKA 1K51A 3JSVA 2Q5WD 3QX1A 1Z2MA 4ICUA 5JRTA 3T8MA 4WJOA 4OZAA 4IQUA 3H0RB 2J52A 3ZDAA 1ZDVA 2KDEB 3HRDD 4Y2PA 2L1AA 1ZQFA 1EF5A 2LGIA 2VZKB 4PT5A 4ZDVA 3PX6A 4F2SA 5CTRC 9ICSA 3HHMA 4B9LA 7ICQA 3WKAA 1MG4A 5KFVA 2I5HA 4G3IA 4DL4A 2G0AA 2ZTCA 3A0BU 3T3FA 1UGMA 3AEAB 2NRTA 4BDPA 3JPOA 3IHPC 4C7ZA 3CW2C 1WYGA 2RHFA 2QILA 4IG7B 1Y88A 3NS8A 5J0YA 3Q3OC 1PUZA 4HYKA 2J0JA 3W2DA 4ZOHC 4NY0A 3KWVA 4AJYB 4CYEA 4OZBA 4O9MA 2NR2A 4KLIA 4BX9C 5CB1A 1SE9A 3BS5A 2FCMA 4QWEA 4K4GA 1KFYB 1KJTA 3BQ1A 3F5AA 3Q8RB 1V81A 1NBFC 2HW3A 1V86A 4GIBA 1SWVA 5EE1A 8ICSA 3ZNID 3LK9A 4K4HA 2WF8A 1X9WA 2HE7A 2YTUA 4A90A 1D9DA 5FP0A 5D3IB 4Q8FA 3Q3NC 2GH1A 2ASQA 2GMIC 4TKNA 5BYRA 1QQRA 2ACZB 4DQPA 3W5UB 2E8PA 1KRPA 2N7JA 4NL9C 1FXTB 5KT7A 3C2KA 3VTVA 1U45A 3RAXA 3CRXA 2KQ4X 2N4FA 2QC8A 4JIOU 3L54A 1VR9A 2KTRA 2ONQA 4WWNA 4II2B 4B9SA 3WK4A 1B0XA 2GI9A 4YMMA 2KE7A 1ZPSA 2RPVA 1EU4A 1HIWA 2K8HA 2JXJA 2NS5A 4JB3A 1OEYJ 3RRHA 3AL0B 3L10B 3RMKC 5J2HA 1VZ8A 1UBIA 1L3UA 3B0YA 3RB6A 2KEYA 1S10A 1EXNA 4UAWA 5J2JA 8ICYA 1STEA 4YG2A 4HJGE 4PH5A 2KN4A 2DWQA 5IKCM 4UBBA 4E0DA 4HXDA 1UT5A 4I2BA 1SXEA 3P4SB 2HOFA 1TT5B 3M9MB 1MPEA 2IBKA 2FIFA 2HBJA 2H89B 3K1ZA 2E3TA 1WXMA 1PDXA 4QWBA 2KNJA 1DRGA 2BS4B 3V6CB 4TUSA 1R4NI 2G07A 3NVZA 4YFKA 4RQ6A 4J9NA 1B22A 4YXJA 5BYQA 1GAQB 1XO3A 1HQRD 1M6YA 4NLCA 5AI4A 4DFJA 1XEEA 1PVPA 1NZPA 2C2EA 2HCFA 3EUB2 2MBOA 3DBRI 4OJOA 2KDMA 4ANVA 2PKEA 4I2EA 3TL5A 2DYBA 2SEBD 1WGHA 2BPCA 2JMGA 4DSFA 2ZVNA 1BXTA 3BYTB 4MEYA 4O1NA 5FKAC 1X9SA 3DVGX 2JWZA 3BINA 4HCPB 4ELUA 3JW0X 4MELA 4ASWC 3M8SA 1RYSA 4M6WA 1ZD3A 4US9A 5D4BA 1SKRA 2X8XX 2BCVA 3HT3A 1LKYA 1FNVA 2BS2B 8ICVA 1S9FA 3Q8CA 3ZGZA 1L7OA 2BCUA 4DQSA 2AQ2B 3RJIA 2LKYA 2K0PA 1X2IA 2HTHA 2KMMA 2ZG6A 2HDOA 2BCQA 9ICNA 2LI5A 4HROA 4OVVA 2ZNVB 4J9PA 4DBGA 1WWTA 2MUTA 7ICVA 4K7SA 4KIKA 3ZLZA 3ZQ4A 3Q14C 3QQ8B 2M4NA 1FD6A 1WGKA 4HPLB 5ALWA 2L52A 2MBQA 2CJOA 3NHEB 2MAXA 3MR3A 4B95A 3PO5A 1S5LU 1Z4NA 4IRCA 2KT7A 2L05A 2V4IB 2WS3B 4RF0A 3JPPA 3AEVA 1R4MB 2W03A 5E6PA 4UW9A 2LPEA 5AI8A 5C5JA 2JXXA 2G45B 3D2QA 2GRIA 2NMQA 4LDTB 2F1HA 4LNFA 1NK5A 3WCQA 2XGPA 1SKSA 5HMMA 2BCSA 1WJNA 4EEWA 4DQRA 2E8NA 1SBBB 2WAQC 1J2MA 3QU4A 1YOVB 1C3TA 3GB1A 2WF5A 4UASA 4U7CA 4E74A 1ZQ1C 2KLGA 2ZNVC 3RJFA 3T5HA 3R9KA 4NLNA 4G50A 3ZIMA 4MDKE 2MJDA 3QU5A 1IBXB 3TMPB 5AIBA 4YN4A 5LNK1 2R61A 4WWOA 1IG6A 2GOLA 4YSYB 2PVOD 5AK4A 2W9BA 2QB0B 2WB1F 2WU2B 5L1IA 2HHSA 1WXVA 5ALDA 2HVIA 4YSXB 3AE5B 4PK1A 4DSKA 3AECB 4XDCA 3ZW3A 3ZTDA 2BDUA 1SIJA 1PUTA 3OG5A 2JWUA 4DSEA 1R4NB 3PO0A 5KT5A 4MSMB 2C2RA 2PI5A 5DB6A 2W9NA 2MEKA 1VJKA 3A9JB 3RJEA 2KTRB 5KFNA 2JZBB 1LGRA 4JWSC 2D5GA 3B08A 2OEHA 1FFUA 4O3PA 1E0ZA 3DDHA 1U4AA 3ETLA 5KFFA 2AQ1B 2JYTA 4ED1A 4ED2A 1B1ZA 3OHAA 4CF3A 1TFRA 4Q44A 2W8KA 4NJCA 4YTPB 1L2NA 4W9JA 3MR5A 1GC7A 2V3SA 2H5XA 5DDMA 2DZKA 3P42A 2XIDA 5JHAA 3TSSA 9ICFA 1QOAA 1KBUA 1ZDXA 5TZVA 4KTQA 2CKHB 4DS4A 3EGRA 2HMXA 3DV9A 2NYVA 4J9KA 3VC8A 2IMWP 3RJHA 3H0MB 4JV0A 4EEKA 2V3NA 3RNCC 4LVSA 3PSPA 1LM8B 4J9SA 1LKYB 3BQ0A 1JALA 1MC8A 1L7MA 1WM2A 2P35A 2BKRB 3PLVA 4AYBF 4F1SA 4IWPA 3ZRCA 3J81j 3H8MA 1FXAA 2V0GA 2CU3A 5AI6A 5AIAA 2WP9B 4IC7B 2W82A 5GTIU 4P1BC 3M3JA 1K1SA 2FIDA 2JEJA 5IA7A 1UGJA 1OGWA 2IGDA 2J6UA 3FILA 3I28A 8ICNA 4TSSA 4PL2A 1ZQZA 1WCLA 4MH8A 2H3VA 4FZLA 2WXMA 3BQ2A 3AV8A 4YD2A 2I2YA 1V5OA 3KHLA 2R8JA 1VZ7A 3DHGC 3RNGC 5F9NA 5DBAA 4AS1A 2LXCA 3CSTA 1JMLA 1O03A 4X5VA 4YTNB 2RDGA 2Z7JA 3C1YA 3KYDD 2ZUDA 2NBWB 4O5EA 1PQSA 2FE9A 3IP4B 1ZGUB 1QCKA 1WWUA 1V9JA 4OHJA 3PTFC 4UATA 2AWTA 2PXIA 5KG0A 1SB3C 4AP4C 4AQ7A 4O0IA 2N7EA 5AUIA 2GO7A 4URKA 3L5KA 1T3QA 2EELA 4QWAA 4M02A 4EE2A 2BBCA 1O08A 3RPFC 1ZQSA 3N3KB 2JZPA 4KDLB 7ICEA 2YY6A 3H8JA 1E90A 3PVXA 4DLEA 4Q8EA 4C8MA 3N9YC 3GP7A 2G9HD 2JR5A 2BYFA 3DBHI 3B1LX 4UQGA 1KQQA 1YMHE 1ENFA 4YL8A 5KFIA 2C2DA 1L0VB 3UMGA 4K7UA 3R7QA 2A5UA 2C7MB 5C23A 3NRZA 5CWRA 4F4ZA 3RFAA 3KFUF 1JWBD 3O0FA 1KSPA 2HBLA 2N9EB 2I6XA 3AU2A 1PFDA 3SAHA 5G5GA 4M47A 4RM8A 3TIXA 2BYTA 2KVRA 3KH0A 5KG2A 3ALRA 1A77A 1NZBA 3H8SA 4K3BA 1UPHA 3PVLA 4FN2A 4QZFA 2W43A 4TUUA 5CJ7A 3B9JA 1TKYA 3RB0A 2WGSA 2X38A 3IDWA 7ICSA 4JQWC 1L3SA 5KFRA 2AQ4A 2PFNA 3F5EA 4C8NA 4LNOA 4FS2A 2LASA 3B0XA 2BGWA 1YQBA 5T8IA 1K8RB 1LVHA 3BYYB 2YMMA 3BS5B 1WGDA 1T5XD 3NVYA 4K7WA 7ICKA 3RJGA 2Y5CA 3DHIC 5J2EA 1X6JA 1RWSA 2LUMA 4C56C 4HPPA 1J2NA 1ZQEA 1I4HA 3EA6A 3NTUA 1LV5A 2ZIXA 2UVVA 3RNFC 1LB2B 1ET6A 1AWDA 1YNTE 2RDHA 4MGKE 3MC1A 3A9JA 5KFAA 2KKPA 2QLTA 5KFEA 2FMPA 1TBEA 4B9TA 1L6UA 3RNAC 4DXAB 2YEPB 3RF9A 3P4QB 1QT9A 4KLGA 1Q10A 3V7JA 2QHOA 2LJIA 3DBLI 2KSOB 3BDPA 3OWEB 5E6JA 4ICAA 3U30A 2GBRA 2M8SA 3SHQA 3E2EA 1WGGA 5I4DA 1TY0A 2YMQA 3UINB 1YZ7A 1L8LA 4B9VA 2G4DB 3ZDTA 4FJYA 1K5OA 1NNLA 1P7DA 3L08A 4WWMA 5CP2A 3TI0A 4NLKA 4FBJB 8ICZA 1ZD4A 1V49A 3N1XC 1F1HA 3C29A 3RR8A 4L1BA 1N5XA 4GLSC 3GZFA 3NGDA 3M8RA 4XE0A 1JRUA 3N30A 3VXWA 2AL6A 2DENB 5BOMA 4FE3A 1ZQNA 4AYBC 1ED1A 1QZEA 3BQ7A 4B9NA 3Q3JA 5L1JA 5TR5A 3RNEC 1XD3B 2PMZF 2BDPA 2PFPA 1MFWA 3KTQA 2CHXA 2KWDA 3SFEB 1N5WA 2KJ9A 3DBRB 3I57A 3TFRA 5HR6A 1B9RA 3L3FX 4I6PA 2KZMA 3CSFA 4CE6A 1E8YA 2FUHB 4N9F4 4DLGA 1N61A 3PV8A 2F1IA 3RH5A 4BOSC 9ICGA 4M9NA 4GMVA 4JUZA 1LXDA 1ZKHA 4JX1C 3Q2AC 1T8EA 4P1CC 3RCZA 4KSKC 2EZZA 3EYZA 2GBMA 1JXLA 4F3OA 4UB2A 1A0PA 1L8OA 3TADA 3VUYA 3DEEA 1GOZA 3CP8A 2G4SA 2W9CA 1S8OA 9ICTA 3UF8A 2MU2A 5CHGA 2XN9C 1YN4A 3UQ0A 2REXA 3PY8A 2F8KA 3X23A 5KFDA 2EMSA 4DO9A 7ICMA 3AE8B 2KV2A 1I4PA 3CIRB 8ICKA 4YMOA 2CHZA 4QIWC 2J42A 2OEDA 4F2RA 5AKLA 3WKEA 3VTUA 1MI0A 2MSNA 1TS4A 4F4WA 5AI5A 9ICLA 3TCAA 4TQRA 5K4LA 4DQIA 7ICRA 2FBWB 4ELVA 3ZDDA 2Y3AA 3V6HA 3RJKA 1R4MI 3C1ZA 3TFSA 2IO3B 3ISCA 8ICOA 2PMVA 2KN5A 4XZ4A 4QW8A 1LO5D 4M9LA 4W9KA 1FXIA 2M17A 3AQEA 1BPYA 4CHKA 4FO6A 1RAXA 3IT4B 4C80A 1ISNA 2KX3A 2MH7A 3OJSA 1ZQBA 4U6PA 2LZ6A 4GSWA 1WWVA 1PGAA 2BYEA 2N1WA 4NNJB 2DX5B 4EOYA 5DB9A 4P4MA 3H7PB 3HPOA 2LRWA 1GO3F 2RD0A 1RLFA 5IOIA 4P6VF 2WXGA 4UAVA 3I1YA 3RAQA 4WJQA 1FM0D 4RQ1A 3GIJA 4M0AA 1HEZE 2KO3A 3TEWA 2D8CA 1XS9D 1ZQJA 4R3DA 4JGHB 1XT9B 5J8YA 8ICQA 4F91B 1CK1A 4J9MA 4GLXA 2JZZA 1I7HA 2BHNA 1WXQA 1IIPA 1XO0A 3QZ8A 9ICEA 1WI0A 2K8BA 4ED8A 3J9CA 4BZAA 4EBCA 5GXGB 4Y2VA 5HHHA 1KLVA 3IG3A 2JV3A 4RU9A 4F4XA 1WRDB 3L0WB 3NY5A 4KX6B 4IWOA 1N48A 3THVA 3HM3A 3W1YA 3BWUD 2D2QA 9ICWA 4AOFA 1WXAA 2VH2A 2FPLA 2JRHA 5MPOA 1WJ4A 1J7BA 1SJHD 1JUDA 2IHNA 2IY0B 4CNQA 2N9LA 2ZIWA 4TUPA 2JX5A 4H2AA 1NKCA 4YP3A 2I9GA 2IOHA 2ZJ8A 3GS2A 2ISPA 1FNWA 3MHSD 4PS3A 4XX5A 4ZHPA 4FFDA 3GV7B 8ICTA 3M63B 5CA7A 3WAOA 1I4XA 1X6IA 3RB4A 2YB1A 4N59A 1ZQMA 3RR7A 2KACA 3ORYA 2AGPA 4W9DA 4UB1A 1KOTA 2FUG1 5J0SA 2B21A 4DQQA 4BFRA 4IQVA 4J9LA 1WIAA 1N6ZA 5AKGA 1PK1A 1Z00A 1X40A 4R66A 2OWOA 2DZJA 1BPDA 2LYBA 4DHZB 4EENA 2F1JA 4PYZA 4WJ3B 2WDQB 3PHXB 1TIFA 2VZKD 5HKHA 2YB4A 5KG7A 4NWIA 4RQNA 1T7PA 3QK0A 5GTHU 4RFBA 5D7GA 1EUVB 1Z00B 5KFWA 2L5YA 1NK0A 2VA2A 4WQMA 2LBOA 3MC8A 3AEGB 2WF6A 3CYMA 2KWCA 3AE2B 3A4RA 3VCBA 4DS5A 3U26A 5H2FU 2EAMA 4Y2JA 8ICCA 2RDBC 3ONNA 5KT4A 4MJSA 2KNBA 4DK5A 2YX8A 4Q45A 1V85A 4ARCA 4C8KA 3WKCA 1E6EB 4C00A 2AH5A 2K8CB 5AKEA 3GIKA 3DPDA 5ALVA 3EFUA 2V3PA 2MW5A 1DGJA 4M0WA 3TARA 4EZJA 2L83A 3QCAA 5BMHA 3PSFA 1GB1A 4OJPA 4LJPB 2KFKA 3AM9A 3AEEB 5AKYA 2KIWA 1JQ4A 4O3NA 1QH9A 2LHEA 1NJXA 3I9V1 3W9CB 3RFZB 1XLQA 3QC8B 5ALIA 3B2FA 3EW9A 4A9AA 4DL6A 1C79A 1P7FA 1CI4A 1U48A 3QHTA 1BUIC 2NCNA 3MGHA 4HDQA 3HWTA 4O3QA 2LHTA 5ALYA 5IIMA 2CS4A 3VR8B 1BVSA 3EFCA 1EO6A 3PW7A 3DQVA 3ZDEA 4C8LA 5AICA 3A1QA 4ITKA 2V4QA 4REZA 2BKEA 4IRKA 4ACOA 9ICCA 1ZD5A 3AE9B 4F5NA 3H9DA 4XWTA 3D6JA 1J8CA 5ALPA 3AE3B 5DCNA 2M56B 8ICGA 2R2QA 3KWLA 2NRXA 2RDJA 1ZQLA 4KLDA 2PLPA 4F5QA 2WXLA 2BKFA 1C20A 2LD9A 3Q8AA 5AEKB 1P98A 7ICUA 2WHEA 9ICKA 2JSVX 1C4PA 1WGRA 5J2BA 2JYEA 5AZHA 3U2SC 2NTSA 4YXMA 4TQ1A 2KQSA 4LTUA 3RRGA 1J7AA 4FBUA 5DLFA 5KFTA 4I2GA 4PZNA 1FCCC 3SD5A 2DKZA 3SD7A 2QARA 4KKIA 4US8A 8ICPA 2MX2A 4RGNA 4RQ3A 5AI0A 2KJ8A 4W9EA 4MFCA 4RM9A 5ALKA 1QKZA 1V6EA 3CWIA 3IHQB 4KLSA 3A0HU 4EBDA 3EPGA 3LVWA 2J6TA 4LK0M 1CUKA 2L0TA 5L1KA 2KC1A 2P6RA 2PE9A 3WKBA 4ZH4A 1N62A 1ZQCA 2DYMA 3RN9C 3ECIA 5E79U 3N20C 4P0PA 9ICVA 4RF1A 1KTQA 3KUZA 2K22A 3MJ5A 5ALEA 2AYOB 3IM1A 4KLTA 4USAA 3L4PA 2K39A 3F2DA 5HG2A 2CU1A 9ICOA 1TTNA 4QWDA 2LMRA 4UB5A 4JV2A 5G55A 7ICPA 4GC7A 4NY8A 3PGEA 2BQQA 2K4EA 3OLMD 2XY6A 4IWQA 4UB6U 1CQVA 3FM9A 3ED5A 2C22A 4YSZB 3IV6A 4F5RA 3MR2A 1WMHB 3N32A 1JIHA 1F0ZA 4KLJA 2LI6A 1KM7A 4M9JA 8ICXA 3IFWB 4UBCA 2F8LA 1Q5WB 4FXCA 4RQ5A 3FILB 1S0OA 4PYUA 2C60A 4GXKA 3TUOA 4ZRPA 2L32A 1IM4A 4R64A 2Z0DB 2QCZA 2A1JB 4GU2A 2WXPA 4IW0A 3ABVB 3RB3A 1V9PA 2KP7A 3H8WA 5J0QA 4K1RB 3SMVA 3Q8MA 1FEZA 3KZXA 4OJ6A 1UQVA 1SZHA 5AM2A 3KQ4A 1XQQA 1E9MA 3APDA 1UHUA 1SV0A 1ZRNA 2LFIA 3M6ZA 2QEJC 2XO7A 3FC4A 3LXFA 4EZ6A 4EUTA 3GFKB 4Z6FA 1JW9D 2D3CA 2KJ6A 1JWSD 2HBKA 4MM3B 4HKZE 9ICHA 5KFYA 2MUTB 2I1KA 4KIKB 3ML9A 1V1OA 4OJLA 3RJJA 4MJSB 4W9HA 5AKXA 2KOBA 2N9KA 1EWCA 3Q69A 4OVUA 2K6QA 1XLNA 2L8JA 4NXZA 5ALNA 5DQIA 5L95C 4GDKB 4OVZA 5HP4A 3ZXRA 2NO4A 9ICMA 2JY6A 3VHTC 2HHQA 4XRHA 4PGQA 2I1JA 5EWFA 2MJEA 1HA5A 1LFDA 3MC0B 1RM6C 4RQ7A 3BK1A 3H0LB 2IO2B 4C4TA 3ZXVA 1UCVA 1ZQWA 2H3ZA 2RLTA 5D94A 5AK3A 5B66U 5IIKA 1VDVA 4MGYE 3AQFA 1WF9A 3PZ7A 3TQ1A 3MP9A 5DBBA 3L16A 4BWMA 3SV3A 4KX3A 1SGHA 1IBXA 1JWUD 2D3DA 2INPE 3A1QB 1N60A 1SSNA 3U4EG 1FPYA 2KFJA 1IGDA 4UAZA 1IPGA 5BOLA 1L7NA 4KMUA 3ETRA 4I2IA 4YR3A 2C5LC 4LJOB 5KHOA 3KVFB 2JRIB 3JPRA 1Q3UA 8ICMA 4PJ0U 4PGXA 2KXJA 3MFGA 2WDRB 1URJA 5IIJA 4Q43A 3HIZA 3N1ZC 4NQLB 7ICOA 4LDTD 2FLNA 3Q6BA 3GU3A 2IY1B 3TEZA 1ROEA 4FJVB 5AM4A 2PJHA 3CF6E 3ZKJC 4K3CA 1ZQQA 3JPTA 4Y2SA 5ALRA 2IHMA 2QB0A 2IPKD 3E58A 4W9CA 4J9QA 1L5PA 1PVQA 1FCLA 4PHPA 4NM1A 2FMSA 3UMCA 4GFJA 2HD5B 2Z0EB 2B0CA 3QU7A 1MJDA 3I76A 2G5HB 1TK0A 1HJPA 2OXOA 5J0PA 2DPJA 1UH6A 2YEPF 2WX0A 2MBEA 1WJUA 1MHHE 2PTLA 1BNOA 3KOOA 2QKQA 2WX1A 2RP5A 3ZNHB 2ZTDA 1C4CA 1BPBA 1N56A 2ASJA 3IVFA 3LDZE 1YN5A 3O13A 1GJZA 2JH7A 1JI7A 3T79A 3AH7A 4KVGB 2D11A 2W04A 1P3QU 3QIJA 5B5EU 2BQ3A 1OXJA 1D5XC 4J9RA 2N9XA 9ICUA 4PZOA 4IR1A 3V6EB 4B6WA 4KITB 4GDLB 3WALA 4JWUC 4P16A 3KBBA 2WXNA 2W7PA 3PRPB 1F0MA 1T6BX 2LWPA 5BPCA 5KG1A 3JPNA 4DEZA 5ALOA 2KFNA 1K52A 4KDIC 1WX9A 1GPXA 2MHJA 3AU5A 3T5KA 3FDSA 3F2CA 2L0FA 2ZEQA 3R2IA 2WXQA 3BZCA 3GQCA 4B0EA 2DLBA 3G6VA 3R7RA 1RPLA 2R8HA 2P66A 3H40A 4NAMA 2FCNA 4ELTA 3C5FA 4AWJA 3IG8A 3AEBB 4JE3B 1SV4A 5DPRA 4P4PA 4QW9A 2ZVOA 3M95A 4DQOC 4ECSA 3OHBA 1VLBA 1DOYA 2WAQF 2NRVA 2CPRA 3R2TA 1F52A 2KTFA 5KNIA 4WJNA 4YVZA 8ICUA 2D10A 1QQ7A 3C19A 4HWIB 1SGGA 2EQYA 4GB9A 3EPIA 4ARIA 4RUAA 2HJ1A 2PPHA 2JT4B 5DB8A 4MH0E 2VJ4A 1T0QC 4LJXA 2XCPA 2XCAA 3U7ZA 3LWLA 4BKGA 1XO1A 2TSSA 1CMXB 5TSSA 2GBKA 5J2IA 2ZJ5A 5IO9A 3N7PD 1TS5A 1V1PB 2OM6A 2ZIVA 2WXJA 3H7PA 3UMBA 4QZCA 3R8BA 1J0GA 4J6IA 3FAHA 5C2TB 2LVQA 2K9XA 3QEBZ 2ICIA 3UGBB 4RQ4A 1V2YA 3ISBA 4GIVA 4RCOA 8ICJA 4FZMA 1HUOA 4IM3A 3VAWA 4LZGA 5AK6A 2JH1A 1UWMA 5D3DA 3AXCA 3ZDBA 1NJWA 5HHIA 3S2AA 3QARA 1UA0A 2KIVA 5T14A 1WYWB 2DAJA 2CXYA 2AHOB 1A70A 2M0NA 5AZFA 4OO1J 4DWIA 1HE8A 4DCCA 5A0LA 8ICLA 1WFYA 2OJRA 4ED3A 3VUXA 2FJ6A 1D5MC 3IAS1 3PS6A 2FDRA 4A3PA 4B6JA 2KMAA 5KFPA 1T0YA 2DZIA 2IBIB 3UQBA 2ZIWB 1RXVA 4ECRA 2KDBA 2F76X 1WY8A 3SQIA 5DPTA 2IZVB 4Y2RA 8ICEA 1TAQA 1CRXA 2H3IA 5J0TA 1J19A 4DHZE 4M8NA 1MQ3A 3V6JA 2KKVA 3Q8LA 3D2SA 3R66C 1U9LA 5DBCA 5AKJA 3N97B 4JPSA 1QSYA 4FS1A 1ZQXA 4Y2TA 2KLCA 3RBEA 3T9LA 2VRRB 2WQYB 5GMVA 2ZZPB 4LCDE 3M1YA 3SV4A 5D6JB 3BZDB 2DUYA 2VIXA 4FADA 8ICIA 1TZ1A 1ACCA 1OW5A 2O2VB 1S3SG 7ICHA 2KN7A 2RMMA 3WK5A 5J2FA 4DOCA 1P0RA 1GNUA 5HR7A 1ZP0B 1OQRA 1XSPA 3JPSA 5ALUA 2KKCA 4F92B 3NVVA 5KFJA 2MA9B 4OZCA 3MBYA 1V97A 2Y0SC 4O3OA 4OCZA 3HP6A 2W54A 4CGZA 5HHDG 3CNHA 1RG6A 4I27A 4YR0A 3VH3B 3NZ3A 3VFKA 2JEIA 4B0MA 3GOEA 2K1FA 2FMQA 4O3RA 4NJ8A 2KDIA 3M6KA 2FNJB 5BO4B 2A19A 1X42A 2BWES 3K9OB 3KHGA 1PGBA 3C21A 4W9LA 2HBMA 5L1MA 2LGXA 3BK2A 4ICVA 3PX0A 2DFLA 2IOFK 9ICJA 3KD3A 3APFA 4FJZA 1CJEA 3HKZF 4G0NB 4I28A 5ALFA 3KHRA 4HKQA 9ICIA 2Y0SF 5AKIA 1RRBA 2WHIA 3U7DA 4C4SA 1JX4A 4MACA 1ZETA 3A9KB 2J6SA 2I38A 1Z5SB 2H3QA 2K4PA 2WU5B 1SL2A 3DVNU 2E8OA 2RR9A 5EDSA 2NRWA 3UIOB 1NYRA 3KUCB 4XGAB 4I6NB 4NAWA 1S0VA 3O65B 3SU8X 7ICFA 4TV3A 2O6VB 1Y8RC 4ANWA 1DOXA 2P6UA 2HJ8A 1PGXA 5ALHA 2KVZA 2F77X 2LUEA 4FLHA 4MM3A 4BJQA 3SAFA 2NPTB 1PYWD 4II3B 4YMNA 4RT3A 1UWXA 2W9BB 2MCNB 2Y5PA 1FMAD 2FCSA 4UAUA 1NOMA 1VJ5A 1X66A 2WNMA 2W11A 4KN7A 3GIMA 2WWZA 3VUWA 4J03A 3WK8A 3MHZA 4F50A 3N7RC 1IXRA 5J0RA 2HHUA 1E7PB 2G06A 3C5GA 3BJYA 1RYJA 5KAIU 3A33B 4HAIA 2WXKA 1PVRA 5LXHA 4NLZA 2KWVB 1F2RI 3WANA 1IYFA 3T3NA 3AE6B 1UA1A 1KL9A 3NS1A 5AKKA 1VZ6A 4NL9A 2VA3A 2V4LA 1XU4A 3PW4A 2BZFA 3T3OA 3I5JC 2EH9A 3MFHA 8ICHA 3E9SA 1DOQA 2D3GA 3ZNGC 3H7IA 1F44A 5JTIA 2GBJA 2ZIVB 4IM0A 1NK7A 4MHVA 3H7SA 3QYPA 2Y1JA 3FKYA 1C78A 3UM9A 5KFUA 1FFVA 4J9OA 4AP9A 3ZJUA 4BKSA 5J29A 4DF4A 3LVVA 1TY2A 1SF0A 2MA1A 1UZXB 2FAZA 4QZ8A 3IXSA 4W9FA 5J2RA 5C1ZA 3KKAC 2WXIA 2KVSA 3H8HA 5EE9A 4DF8A 1C9FA 4F7ZA 3PPAA 5ALQA 5AM1A 4WWPA 5IAAC 1NDDA 1C1YB 2LM1A 1BMLC 2KSOA 3HM6X 1MHXA 2QMTA 5FR6A 4F8RA 4KSLC 1IV8A 2LVOA 4TQ0A 2N7DA 1PK3A 1WH3A 1A6SA 3G6YA 5KFKA 1QOBA 4KMOB 3DBSA 3AE4B 5IN7A 4M9HA 1TS3A 5J8YC 3B0AA 4DL3A 3MGIA 2A3VA 2BPFA 1QSLA 2M0XA 4RQ0A 1H38A 1XLPA 4Y2YA 5J0OA 2ZPYA 5KHQA 4M9GA 3NUQA 1ZYQA 2MWSB 2KZZA 1SXDA 3HJEA 1NYQA 2XEWA 4WJPA 2DAFA 4R8UA 2ZXIA 4S0RA 3M9OB 2BYVE 1TKEA 4IC9A 2OJWA 3DDCB 4NAWB 3VTWA 1DOIA 8ICAA 2ISOA 3AU4A 1H8CA 5EWEA 4R8UB 1PK1B 4PHEA 1L4DB 4M8MA 1P7EA 2YMLA 4UB8U 2K5PA 2AL3A 1QOFA 1GUAB 3DOWA 5L9XA 3G6XA 4RNNA 2J0MA 3H6NA 1C77A 3A9KA 4WAFA 4OD0A 1ZJNA 3NJTA 2ALZA 4FA6A 1HTQA 1FRRA 4ECTA 2GBNA 1VCBA 2MRPA 4KGSA 4KZ0A 3FYHA 2OOBB 2IA6A 3Q8BA 3N4MB 1S0NA
chains in the Genus database with same CATH topology
3UI3A 1B1ZA 2M19A 4DXFA 4YTPB 4NJCA 1CQVA 3PZ8A 3P42A 1V8CA 4YSZB 2JQRB 1F0ZA 4LLGM 5HFYA 3TSSA 1QOAA 1JWMD 1FNUA 1D6EC 4IDIA 4FXCA 1ZDXA 2JXTA 3FILB 2QIEB 3EGRA 3TUOA 1YN3A 2V3NA 4ZRPA 2L32A 1GB4A 2W55A 2WXOA 4UDUC 4TMAB 1XLOA 2WXFA 2WXPA 3ABVB 2DBYA 4C7YA 1JALA 4XWWA 2WXHA 1IUEA 3VRBB 3KQ4A 1KRHA 3SR6A 1FXAA 1KH0A 3AEDB 4L23A 4MT5A 1E9MA 2V0GA 2CU3A 2LFIA 4DXGA 1TYGB 2WP9B 1ZOYB 2QEJC 2W82A 3FC4A 3LXFA 4RGMA 4ZYSA 4Q2JA 4KKJA 1JW9D 1UGJA 1JWSD 2IGDA 2SAKA 1ET9A 1EU3A 1K50A 3FILA 4HKZE 3IAM1 4MM3B 4KGTA 2PKOA 4TSSA 3ZYYX 5BMGA 1V1OA 1AN8A 2J4XA 2PIAA 2CJNA 3P4RB 1L6VA 1MVKA 1NENB 4MH8A 2N9KA 1EWCA 1V1PA 3Q69A 1XLNA 2WXMA 1ZXIA 3BIID 3AV8A 2I2YA 1NI3A 2HTME 1I4GA 4GDKB 4OVZA 1VZ7A 2OHFA 4AS1A 1JMLA 1VRAB 2IGHA 4A6QA 4YTNB 3VRAB 1KLGD 2ZW1A 1QOGA 2RDGA 5JXVA 2MJEA 1HA5A 5FK9C 4XDDA 3BVGA 1RM6C 3AE7B 3BK1A 3MC0B 3LB8C 1Y56A 2M0AA 3V3XA 4OHJA 1EWYC 3W1SA 1VDVA 4AQ7A 1SB3C 2IDYA 3PZ7A 5AUIA 3W5VB 4YTMB 3MP9A 1F2RC 1T3QA 2EELA 1IBXA 4EE2A 1JWUD 2BBCA 2INPE 3RPFC 1ZUD2 2JZPA 1SXTA 1N60A 1SSNA 3U4EG 3AMZA 1YQ3B 1IGDA 1HZ6A 4N58A 3N9YC 1EM7A 2G9HD 3GP7A 3ETRA 4WIPA 3SEBA 1YMHE 1N63A 1ENFA 3MFGA 1QLBB 2WDRB 1L0VB 4YWGG 2XNAC 4HRSA 4A55A 2BB5A 2EKIA 3NRZA 3E56A 5AUKA 1JWBD 3ZJVA 4N6EB 3TEZA 1PFDA 4RGTA 5G5GA 1ESFA 1ROEA 2BYTA 3VR9B 1SE4A 2IPKD 2HDEA 1L5PA 2LEKA 1FCLA 1KF6B 4ZHOA 3B9JA 3DWGC 1TKYA 2X38A 2K3UA 1QF6A 2YEPF 1MHHE 2GB1A 1IGCA 2PTLA 3BYYB 5T8IA 1T5XD 3NVYA 1R7SA 1C4CA 2Y5CA 1HXYD 1RWSA 1YJIA 1YN5A 2LUMA 3O13A 3P63A 4C56C 2J53A 3AH7A 1AW7A 1I4HA 3EA6A 1ET6A 1AWDA 4YT0B 1ZE3D 1YNTE 2N0SB 2RDHA 1D5XC 3URYA 1JRPA 1L6UA 1AYFA 5G5HA 2YEPB 3P4QB 4GDLB 1QT9A 4JWUC 1Q10A 4P16A 2WXNA 1T6BX 1XXGA 2LJIA 5HI1A 1K52A 3OWEB 5E6JA 1XCQL 1GPXA 2KAJA 2NTTA 2DYOA 5I4DA 1TKGA 1TY0A 3R2IA 2WXQA 1WRIA 4J3OD 4B0EA 2DLBA 1NEKB 4WWMA 1RFKA 4NAMA 1OQQA 3AEBB 3AB5A 4ZRQA 4JE3B 2BB6A 2MJ3A 4DQOC 4L1BA 1N5XA 4A8XC 1XCTL 4GLSC 4XE0A 2INNE 1VLBA 1DOYA 1D5ZC 4RNAA 5EE0A 3R2TA 4IKGA 2BTEA 2PW9A 1I4RA 1YQ4B 4YXDB 4ARIA 1UUPA 4OW0A 2Z8LA 1DYQA 2KWDA 2WLBA 3SFEB 5EE3A 1N5WA 2FE8A 2ON8A 3I57A 1B9RA 1SJED 1M4VA 2LMCA 3U7ZA 1ZXHA 2TSSA 1K53A 5TSSA 1N61A 1TS5A 1L0YB 1E10A 1V1PB 2BT6A 2WXJA 3R8BA 4JX1C 4RGOS 3FAHA 2G1EA 5C2TB 2K9XA 2ICIA 4KGRA 3HVDA 4RCOA 1NVID 1FEHA 1C4AA 1GOZA 1UWMA 5D3DA 5H8YE 1JROA 2XN9C 3IT6B 1YN4A 3LYYA 1HZ5A 1SEBD 3AE8B 1I4PA 3CIRB 2J42A 2OEDA 1A70A 1XF5L 1MI0A 1SE3A 2JU6X 1TS4A 1D5MC 3IAS1 2FBWB 2B76B 2Y3AA 1K51A 2Q5WD 1KLUD 4OZAA 2PMVA 2J52A 3AE1B 1ZDVA 1TZOA 1LO5D 2BW2A 1FXIA 3HRDD 3IT4B 4C80A 2L1AA 2LGIA 2MH7A 2VZKB 4L2YA 4PT5A 4JPSA 1PGAA 4D2KA 3TEYA 3U52E 3AEAB 2WQYB 3BZDB 2WXGA 4C7ZA 4P6VF 1FM0D 1TS2A 1ACCA 1WYGA 1HEZE 2QILA 3TEWA 2RMMA 4R3DA 2WXRA 1CK1A 2QSDA 3W2DA 4ZOHC 1I7HA 1SE2A 3KWVA 1WXQA 4OZBA 3B2GA 3J9CA 1ZP0B 1OQRA 5GXGB 3NVVA 4OZCA 1V97A 4KX6B 2W54A 1KFYB 5BYSA 1TJEA 5HHDG 3BWUD 3NZ3A 4B0MA 5EE1A 5MPOA 1J7BA 1SJHD 4A90A 4WH4A 5D3IB 3NVWA 2N9LA 2JX5A 4H2AA 1QILA 1PGBA 3NUHB 4ZHPA 5BYRA 1QQRA 2ACZB 1FNWA 3GS2A 3BK2A 3HVZA 3KLSX 3W5UB 3ZJTA 2N7JA 4HKQA 1CJEA 2KQ4X 2IJ0A 1I4XA 4MACA 1VR9A 4N59A 2ONQA 2I38A 2KACA 2GI9A 2FUG1 2WU5B 1ZPSA 2RPVA 3P1MA 1EU4A 1NYRA 3Q8FA 1VZ8A 1L4ZB 2WDQB 1DOXA 2VZKD 5D7GA 4RFBA 1PGXA 4HEA1 3HUIA 1PYWD 1STEA 1UWXA 4HJGE 2KN4A 2DWQA 1FMAD 2Y5PA 4WQMA 2WNMA 3Q8EA 5C3JB 3AEGB 3P4SB 1MPEA 3AE2B 2H89B 1L0XB 3MHZA 2E3TA 1PDXA 1E7PB 1RYJA 2BS4B 2AX5A 3NVZA 2WXKA 1GAQB 5BYQA 4ARCA 1XO3A 1YJJA 3V05A 1HQRD 1E6EB 1XEEA 1I4QA 1F2RI 2V3PA 3T3NA 3EUB2 1DGJA 4M0WA 2KDMA 2L83A 5BMHA 3AE6B 2LHDA 3NS1A 2SEBD 2E6XA 1VZ6A 1GB1A 3AEEB 3AM9A 3TEXA 2PVGC 5BMIA 1BXTA 3T3OA 1JQ4A 3BYTB 1C76A 2LHEA 4O1NA 5FKAC 3I9V1 3E9SA 3W9CB 3RFZB 4RH6A 1XLQA 3B2FA 4A9AA 4US9A 1C79A 1FO4A 1P7FA 1CZPA 1BUIC 1FNVA 2BS2B 1C78A 1FFVA 3Q8CA 3ZGZA 3VR8B 3ZJUA 3BVZA 2AQ2B 1JWAD 1TY2A 1SF0A 4IOIE 4CQNA 2K0PA 5H92C 3IXSA 2KMMA 4HROA 4ITKA 2IGGA 4REZA 2WXIA 3C8YA 3H8HA 5EE9A 1C9FA 1WWTA 3ZQ4A 3AE9B 4XWTA 1FD6A 1WGKA 3VQIA 3AE3B 2L52A 2W3RA 2M56B 2CJOA 3KWLA 1OFFA 1BMLC 1MHXA 2QMTA 2PLPA 2WS3B 1KTKA 2WXLA 4RF0A 2V4IB 4TQ0A 5FR3A 3Q8AA 1QOBA 2JSVX 3AE4B 1C4PA 2GRIA 2NMQA 2JYEA 1TS3A 4WURA 3DWMA 3U2SC 3WCQA 1UNSA 2NTSA 3SFDB 4TQ1A 3AN1A 4LTUA 1J7AA 1SBBB 2AQ3B 2QJLA 1FCCC 1FRDA 1JCKB 4KKIA 4US8A 1XLPA 3GB1A 4RGNA 2H88B 2WDVB 1QKZA 3CWIA 3BVMA 1NYQA 2MJDA 1IBXB 5LNK1 4LK0M 2R61A 4YSYB 1WSPA 2PVOD 1D4BA 1TKEA 4YSXB 2WU2B 4NAWB 3AE5B 1N62A 1DOIA 2DYMA 3AECB 4XDCA 1SIJA 1J7CA 1PUTA 1L4DB 1P7EA 2JWUA 3PO0A 4RF1A 3P4PB 2K22A 2K5PA 3MJ5A 1QOFA 4NZLB 1F77A 2MEKA 2BS3B 1VJKA 4WAFA 3AEFB 1C77A 2ZW0A 4USAA 4JWSC 1FRRA 2D5GA 3L4PA 4KGSA 1FFUA 5HG2A 1FIQA 1E0ZA 2JYTA 2AQ1B 2W3SA 3Q8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR9 B;  2M19 A;  3AE2 B;  1L5P A;  2H89 B;  3AE8 B;  3CIR B;  2E3T A;  1PDX A;  1E7P B;  2LEK A;  1RYJ A;  4YTP B;  1A70 A;  2BS4 B;  1KF6 B;  2AX5 A;  4ZHO A;  3NVZ A;  1V8C A;  3B9J A;  2JQR B;  1GAQ B;  1TKY A;  3DWG C;  4YSZ B;  1F0Z A;  1XO3 A;  1YJJ A;  1E6E B;  1QF6 A;  1QOA A;  2FBW B;  4IDI A;  2B76 B;  3EUB 2;  1DGJ A;  4FXC A;  2Q5W D;  2L83 A;  3AE6 B;  3NVY A;  3NS1 A;  1R7S A;  2QIE B;  3AEE B;  3AM9 A;  2Y5C A;  2PVG C;  3AE1 B;  1JQ4 A;  1RWS A;  2W55 A;  1YJI A;  3P63 A;  1FXI A;  3AH7 A;  1XLO A;  3HRD D;  3ABV B;  3W9C B;  4C80 A;  2MH7 A;  1XLQ A;  2DBY A;  3B2F A;  4US9 A;  4C7Y A;  1AWD A;  1FO4 A;  1JAL A;  4YT0 B;  4A9A A;  1CZP A;  2N0S B;  1IUE A;  2BS2 B;  3VRB B;  1KRH A;  3SR6 A;  1JRP A;  1FXA A;  3AED B;  1FFV A;  1E9M A;  1L6U A;  2CU3 A;  1AYF A;  5G5H A;  2WQY B;  3AEA B;  3VR8 B;  1TYG B;  3P4Q B;  1JWA D;  1ZOY B;  2WP9 B;  1QT9 A;  1SF0 A;  4JWU C;  4P6V F;  3FC4 A;  4C7Z A;  3LXF A;  1FM0 D;  5H92 C;  2KMM A;  4HRO A;  4ITK A;  1WYG A;  1GPX A;  1JW9 D;  2KAJ A;  5EE9 A;  1WWT A;  3AE9 B;  4ZOH C;  1I7H A;  1TKG A;  1WGK A;  1WXQ A;  2PKO A;  3ZYY X;  3AE3 B;  2L52 A;  1WRI A;  2W3R A;  2M56 B;  1ZP0 B;  2CJO A;  2PIA A;  1OFF A;  1OQR A;  2CJN A;  3B2G A;  1L6V A;  3KWL A;  1NEN B;  1NEK B;  3P4R B;  5GXG B;  3NVV A;  4WWM A;  1XLN A;  1RFK A;  1V97 A;  1ZXI A;  2WS3 B;  3AV8 A;  1OQQ A;  1NI3 A;  3BII D;  4KX6 B;  2W54 A;  2HTM E;  1KFY B;  3AEB B;  3AB5 A;  1TJE A;  2OHF A;  1QOB A;  3AE4 B;  2MJ3 A;  3DWM A;  3WCQ A;  1N5X A;  5EE1 A;  4YTN B;  3VRA B;  3SFD B;  5MPO A;  1J7B A;  1VLB A;  3AN1 A;  1QOG A;  1J7A A;  4LTU A;  1DOY A;  5EE0 A;  3NVW A;  2MJE A;  2QJL A;  2JX5 A;  1RM6 C;  1FRD A;  3AE7 B;  4ZHP A;  4US8 A;  1XLP A;  2ACZ B;  3HVZ A;  3LB8 C;  3W5U B;  2H88 B;  1YQ4 B;  1CJE A;  4YXD B;  2WDV B;  3CWI A;  1EWY C;  1VDV A;  1SB3 C;  1NYQ A;  2MJD A;  2WLB A;  5AUI A;  5EE3 A;  3SFE B;  1N5W A;  3W5V B;  4YTM B;  4N59 A;  1B9R A;  1T3Q A;  4YSY B;  2PVO D;  3RPF C;  1ZUD 2;  1TKE A;  2WU5 B;  4YSX B;  2WU2 B;  1N60 A;  3P1M A;  3AMZ A;  1YQ3 B;  1N61 A;  3AE5 B;  1NYR A;  4N58 A;  1N62 A;  1DOI A;  3AEC B;  1E10 A;  1SIJ A;  3ETR A;  2BT6 A;  1J7C A;  1PUT A;  3PO0 A;  4JX1 C;  2WDQ B;  1N63 A;  2K22 A;  2K5P A;  3P4P B;  1QOF A;  1DOX A;  1QLB B;  2WDR B;  3FAH A;  1L0V B;  2G1E A;  4HRS A;  2BS3 B;  5C2T B;  1VJK A;  2EKI A;  2K9X A;  3AEF B;  3NRZ A;  5AUK A;  4USA A;  1JWB D;  3HUI A;  4JWS C;  1FRR A;  3L4P A;  1NVI D;  4N6E B;  1PFD A;  1FFU A;  5G5G A;  1FMA D;  1FIQ A;  1ROE A;  1UWM A;  2DWQ A;  4WQM A;  1E0Z A;  5H8Y E;  1JRO A;  5C3J B;  3AEG B;  2W3S A;  3P4S B; 
#chains in the Genus database with same CATH topology
 1U49 A;  2M19 A;  3OJ3 A;  1NJY A;  5DB7 A;  2R8G A;  2KJR A;  1QQ6 A;  2UVU A;  2M1M A;  5KT2 A;  1L7P A;  1RQN A;  2BQU A;  4LLG M;  1DK3 A;  1KLN A;  3UPQ A;  1F9J A;  1JWM D;  4LZD A;  1D6E C;  5IIL A;  2EAN A;  4IDI A;  2K8C A;  3ZD8 A;  4I2F A;  1RDF A;  1RXW A;  5JHB A;  1QQ5 A;  5AI9 A;  3R3M A;  4B9U A;  2KMC A;  1YN3 A;  2JVC A;  3Q8Q B;  2W55 A;  4DHJ D;  3PLU A;  1ZQP A;  4UDU C;  4TMA B;  2WXF A;  3JYU A;  1UT8 A;  1BGX T;  2LRU A;  2W9M A;  5IIN A;  4I2C A;  2XVT A;  3PRM B;  4YQW A;  3PR4 A;  1NKE A;  2RQ5 A;  2V9H A;  3TBL D;  1IUE A;  3VRB B;  1KRH A;  1KH0 A;  3AED B;  5J0U A;  4DXG A;  1L7Y A;  1RZT A;  2DHZ A;  4EEY A;  2K89 A;  4F8C B;  5DG8 A;  4IRD A;  3IG5 A;  2KVC A;  4ECU A;  1EU3 A;  4ED0 A;  3IAM 1;  4KGT A;  4KN4 A;  3GE8 C;  4QZH A;  2PKO A;  3ZYY X;  8ICF A;  2C7N B;  3F2B A;  5ALG A;  1AN8 A;  3HW8 A;  2PIA A;  5BMG A;  3PZD A;  4F93 B;  3GV5 B;  1MVK A;  1V1P A;  2O6V D;  2KYW A;  2XK5 B;  1P1A A;  1ZXI A;  1NI3 A;  2N9P C;  3GIL A;  4DSJ A;  4F72 A;  1I4G A;  2OHF A;  2LYH A;  2V4R A;  4AJW A;  1TVA A;  1VRA B;  2G08 A;  1ZJM A;  4PS8 A;  2AXT U;  3QU9 A;  2V1Y A;  5JXV A;  5KFB A;  2LYA A;  2L00 B;  3QZ7 A;  4F71 A;  5FK9 C;  1ZQG A;  4S17 A;  1ZOL A;  5E6O A;  3UQ2 A;  3Q3F A;  1TK5 A;  4FHK A;  3PRE A;  1S77 D;  2M0A A;  3V3X A;  3PNC A;  2BF8 B;  2B3A A;  2CRX A;  4NV0 A;  7ICN A;  1GC6 A;  4JL9 A;  4DDI D;  4YD1 A;  2KD1 A;  4KLF A;  5D2M B;  1WE6 A;  2IDY A;  1IP9 A;  3W5V B;  1Q1O A;  3RUL A;  1WZ0 A;  4M00 A;  2EAO A;  3Q8S B;  3QX7 A;  4I2J A;  1CEZ A;  1BPX A;  1SXT A;  5EWG A;  2ZPN A;  4KV2 A;  1YQ3 B;  4XQ8 A;  2YLM A;  2LJ5 A;  4WIP A;  4JK1 A;  4HDO A;  3SEB A;  1N63 A;  1QLB B;  4YWG G;  4QZE A;  2KG5 A;  2XNA C;  4HRS A;  2BB5 A;  3QEA Z;  3WAP A;  3SZ2 A;  3E56 A;  1X9X A;  3QAQ A;  3DVG Y;  5AUK A;  1ZQR A;  2RRD A;  3ZJV A;  4N6E B;  4CDG A;  3SEI A;  1ESF A;  3PX4 A;  2RPQ A;  1Z1V A;  1UBQ A;  2KMD A;  3QUC A;  1WCN A;  4RUC A;  3GV8 B;  4KLH A;  2MBB B;  3VR9 B;  2GLE A;  5AHX A;  3PML A;  1WR1 A;  1RYU A;  4NM2 A;  2HDE A;  4LNI A;  4ANX A;  2E1F A;  4PL1 A;  4QZG A;  3OSN A;  5AK5 A;  3HKZ C;  2D3A A;  4M01 A;  5IP4 D;  5JU5 A;  1BNP A;  1KEJ A;  4DDG D;  4AUQ C;  4DFD A;  4JV1 A;  1QF6 A;  1V80 A;  3JSV B;  2W9A A;  1ZW7 A;  4R63 A;  2L3Z A;  2AU0 A;  1IGC A;  4ED6 A;  3RT3 B;  5ALS A;  1R7S A;  1HXY D;  1WX7 A;  9ICA A;  2ZJA A;  1YJI A;  3KHH A;  5JZE B;  4RQM A;  2PI4 A;  2J53 A;  4YCX A;  3DHH C;  2KOX A;  2DPI A;  4BXO B;  2XY7 A;  4O5K A;  4ZRJ A;  3RZW C;  4G9B A;  1NI2 A;  4GN1 A;  2YN4 A;  3QU2 A;  4GOC A;  2PMZ C;  3C2L A;  2N0S B;  5ALT A;  2BGF A;  2FPM A;  2W9C B;  2DZM A;  2LVP A;  2UWQ A;  1AYF A;  2O6V A;  5G5H A;  8ICW A;  4RPY A;  1T94 A;  3ENE A;  2VH1 A;  2O6K A;  1XXG A;  4HJK A;  4BKT A;  2BR0 A;  4E71 A;  2KAJ A;  5KL8 B;  2QDF A;  3LDA A;  4CF5 A;  2DYO A;  4JMU A;  1TKG A;  3KW5 B;  2OCE A;  2JGA A;  9ICB A;  3V62 A;  2HHT A;  2HOI A;  2Q4T A;  5LLI A;  5DGB A;  3ZNZ B;  4P0Q A;  4MEX A;  2JF5 A;  1RFK A;  4MEM A;  1OQQ A;  1NK8 A;  4Z6E A;  1T3N A;  4KLM A;  3AB5 A;  4ZRQ A;  1JMS A;  5KFM A;  1ZQT A;  1ARO P;  1TAM A;  1Q0W B;  3TAD C;  1TK8 A;  7ICG A;  2UU7 A;  5III A;  4MF8 A;  4GDK A;  5DPW A;  1X9M A;  2KHW B;  4A8X C;  1XCT L;  4CO7 A;  4QIW F;  5EOZ A;  4TUQ A;  3RH6 A;  4RNA A;  4IS7 A;  4W9I A;  5HML A;  4MF2 A;  3DBH B;  3U8Z A;  4C4V B;  1SV0 C;  2PW9 A;  2ASD A;  1MN8 A;  1UD7 A;  1YQ4 B;  2E1E A;  4RPX A;  4PHD A;  1TAU A;  1H4R A;  4FUL A;  3ZDM C;  1NK6 A;  2Z8L A;  2DQN B;  2KJH B;  2FE8 A;  2ZXH A;  2ON8 A;  2LMC A;  2FLP A;  1M4V A;  4XYC A;  1Q8K A;  1ZXH A;  2BPG A;  5CEH A;  1K53 A;  3SAG A;  5E6N A;  2E8M A;  1WM3 A;  3DVN V;  2K60 A;  1E10 A;  2N1R A;  3WU2 U;  3JVZ X;  5AZG A;  3VVW B;  4WQO B;  2D3B A;  4RGO S;  4EX6 A;  2KZ3 A;  5KG4 A;  1XWL A;  1Z3E B;  2E5S A;  4NPN A;  1KFD A;  5J18 A;  4KGR A;  3M7D A;  4P0P B;  4QJF B;  3OAW A;  2F3N A;  1FEH A;  1C4A A;  3D2N A;  3V7K A;  4Y2X A;  4M04 A;  1JRO A;  4NJ6 A;  1LQB A;  3IT6 B;  4B9K A;  3BZK A;  4RQ2 A;  3ZD9 A;  3Q8P B;  3AUO A;  1HZ5 A;  3GZN B;  4MGZ E;  2IYD B;  1BPE A;  1ZQY A;  1BPZ A;  1Q3V A;  3W1S C;  4UB3 A;  5DDY A;  2XGQ A;  1XF5 L;  2JPH A;  3N1Y C;  1SE3 A;  2G5I B;  1YD8 U;  3MTN B;  3WA0 A;  4Z6D A;  1HUZ A;  3LYS A;  2CN1 A;  2B76 B;  2BQR A;  5DQG A;  2LGS A;  1YX5 B;  1KLU D;  1L3T A;  3AE1 B;  2DL0 A;  5F3X B;  1TZO A;  2BW2 A;  3P2B A;  4CRX A;  3S6J A;  3X0W A;  2A4Z A;  4QZI A;  3BS7 A;  1RQL A;  5KG5 A;  1V5T A;  2HHW A;  4L2Y A;  3ZVV A;  3UXO A;  2JHD A;  1QLN A;  1YIW A;  4D2K A;  3TEY A;  2K4H A;  2KZR A;  1XC9 A;  4XUS A;  4P7I A;  3U52 E;  5J2C A;  2NBV B;  4O3S A;  4BWJ A;  1TS2 A;  3PST A;  5DQH A;  1ECW A;  3KZI U;  4BXO A;  3HK0 A;  1WX8 A;  2WXR A;  1Z4O A;  1WR6 E;  2QSD A;  1SE2 A;  2MLB A;  5J2G A;  3B2G A;  5KG3 A;  1E5W A;  4IQW A;  4LNN A;  3H4B A;  2KTQ A;  3PSE B;  1YZ6 A;  2R18 A;  2Y5B B;  1G6J A;  3QWZ B;  4ECZ A;  2NV3 A;  3RBD A;  1OQY A;  4RT2 A;  5BYS A;  1TJE A;  5JH5 C;  4EFO A;  4UB4 A;  5CRX A;  8ICB A;  4ECY A;  5DKW A;  4GXJ A;  3QE9 Y;  4WH4 A;  4I2D A;  2D07 B;  2DKX A;  4KZC A;  3NVW A;  4ECW A;  1QIL A;  8ICR A;  4WAA A;  3NUH B;  1KN5 A;  4E3C A;  3WK7 A;  1WXS A;  3IN5 A;  3RD2 A;  3KLS X;  3HVZ A;  3ZJT A;  1NK9 A;  2R2O A;  4BKS D;  3MJW A;  5CX3 A;  2ES6 A;  5AKZ A;  2IJ0 A;  2G09 A;  5ALL A;  2M9N A;  1T0S C;  3QA8 A;  3SI8 A;  3C2M A;  2HOQ A;  4QNL A;  2ZUB A;  1C7Y A;  1K1Q A;  1RFA A;  2C7H A;  1HTO A;  1B43 A;  4I6L B;  3P1M A;  3L13 A;  4JWM A;  4P2H A;  3UXP A;  4C4V A;  3Q8F A;  5CR0 A;  3EWA A;  1L4Z B;  3MC9 A;  3ICX A;  3WK6 A;  3NAS A;  2ZCC A;  4TQS A;  1P9D U;  4DFP A;  4HEA 1;  3PZP A;  3APC A;  3IRU A;  5KFO A;  3HUI A;  2L76 A;  3Q8K A;  2IO0 B;  2ZJD A;  3Q8E A;  5C3J B;  1COO A;  3TAQ A;  3PV1 A;  4F4K A;  4EYI B;  2FLL A;  2QAR B;  3JPQ A;  2F2A B;  2C9W B;  4K81 A;  3TAP A;  4IL6 U;  1L0X B;  3RTV A;  4IQT A;  1DXS A;  1E7U A;  1Z19 A;  2KIC A;  3NZU A;  2AX5 A;  2Z59 B;  1OTR B;  1SL1 A;  4RQ8 A;  4DL7 A;  1D8B A;  2WYQ A;  1YJJ A;  3V05 A;  4EKU A;  2JRZ A;  3RH4 A;  3EHV A;  4JLC A;  1I4Q A;  2WDT B;  3T5J A;  3MGV A;  1OEY A;  4GGQ A;  2LHD A;  4MSQ B;  2E6X A;  5BMI A;  2CHW A;  2PVG C;  3TEX A;  4P4O A;  4DOB A;  4KLO A;  5L1L A;  2F44 A;  1C76 A;  2AQ0 A;  2NRZ A;  1YJ1 A;  3V60 A;  1B4F A;  5F9L A;  3UXN A;  1ZQO A;  2XI9 A;  4RH6 A;  5KL1 B;  4UAY A;  3MAB A;  4BOZ B;  1FO4 A;  4ECV A;  1SL0 A;  4Z6C A;  1CZP A;  4I2A A;  4ZRK A;  3QNM A;  2KQ7 A;  2ASL A;  4OJ5 A;  1X1M A;  1MG8 A;  4PGY A;  3C23 A;  3MFI A;  4DL2 A;  1QSS A;  2RGF A;  4LNK A;  2JEF A;  3BVZ A;  2KJ5 A;  4DWF A;  5J2K A;  2AJQ A;  1JWA D;  4IOI E;  4CQN A;  1MQ2 A;  2A1J A;  2JZ3 B;  5H92 C;  1ZQD A;  2IGG A;  4QAY A;  3C8Y A;  2WF9 A;  2DF4 B;  4C0Z A;  2O2V A;  1N2X A;  2ZIU B;  3K1R B;  2WTF A;  4R65 A;  2K25 A;  3M62 B;  4UAR A;  3VQI A;  2KC2 A;  2W3R A;  1OFF A;  1A5R A;  1XNS A;  2KDF B;  5DPS A;  2KK8 A;  4DOA A;  2KWU B;  1KTK A;  2NPT A;  1UEL A;  2PEA A;  5FR3 A;  2FI1 A;  1HEK A;  1D3Z A;  4B9M A;  4QZD A;  3RNB C;  4WUR A;  1ZQI A;  5D46 A;  3DWM A;  3F53 A;  1UNS A;  2BVC A;  1SWW A;  4NJ7 A;  3SFD B;  3K4G A;  3AN1 A;  1WG8 A;  1WZ3 A;  2AQ3 B;  4F4Y A;  3OTQ A;  2QJL A;  1U47 A;  3ZI4 A;  9ICR A;  4K4I A;  4KLL A;  1Z1B A;  1JCK B;  1FRD A;  3LJ3 A;  4CCH A;  7ICT A;  1OUQ A;  2H88 B;  5KFL A;  4KLQ A;  3DBL B;  2WDV B;  3NZS A;  4C4R A;  1XSN A;  2MSE D;  2EAP A;  3BVM A;  3WIM A;  2BPS A;  4JWN A;  5KFH A;  4ACF A;  5KFS A;  2QB1 A;  1WSP A;  1D4B A;  4EZK A;  2C28 A;  3N7S C;  5D49 A;  4ANU A;  2VA8 A;  1AQ6 A;  2HHX A;  1S0M A;  2BWF A;  9ICQ A;  5ALZ A;  5KFZ A;  4IM2 A;  5HNK A;  2ESE A;  1J7C A;  1UF0 A;  7ICI A;  3P4P B;  2EZY A;  2FCQ A;  2K4I A;  3OJ4 B;  4NZL B;  4ZYN A;  1F77 A;  2BS3 B;  4DSI A;  2ZW0 A;  3AEF B;  3RZF A;  2B6G A;  2VAN A;  3C28 A;  4XC2 A;  5AM3 A;  2ZUC A;  1EF1 A;  1FIQ A;  2MP2 B;  2WB1 C;  3QUQ A;  2W3S A;  1L6N A;  1TV9 A;  2MQJ A;  3UI3 A;  3TAC B;  3RI7 C;  4DXF A;  3MR6 A;  2EZX A;  2EMT A;  3ZDC A;  2ATL A;  2Y9U A;  3PZ8 A;  4RNO A;  1V8C A;  2JQR B;  1QTM A;  3PT2 B;  5LXI B;  3WK9 A;  5J2D A;  5HFY A;  3N28 A;  5ALX A;  4GXI A;  1FNU A;  2V9W A;  3OJU A;  2JXT A;  1WGY A;  1WJ6 A;  2ODG A;  2WF7 A;  3HIL A;  2EDU A;  2QIE B;  1D8L A;  3SYZ A;  4BAX A;  4EYH B;  2MBH A;  1GB4 A;  1U4B A;  2BCR A;  5CHF A;  2WXO A;  2YQE A;  2J0K A;  4BUG A;  1F5S A;  1WUD A;  1XLO A;  4X57 B;  1MSW D;  2DBY A;  4C7Y A;  1NKB A;  1J97 A;  2WXH A;  4XWW A;  5KTQ A;  3I63 C;  4DFK A;  3RUI B;  1KW4 A;  4GC6 A;  4RZR A;  1NJZ A;  3SR6 A;  4L23 A;  4DSL A;  4MT5 A;  3MDA A;  2NBU A;  4RPZ A;  1BT0 A;  1E8Z A;  3TJP A;  1TYG B;  4DL5 A;  1ZOY B;  2KD0 A;  1ZQA A;  4Y2Q A;  4MFA A;  1JN3 A;  2PFQ A;  4ZYS A;  4QZ9 A;  2RSU A;  4RGM A;  2IO1 B;  3LWM A;  4Q2J A;  4KKJ A;  2G3Q B;  4BBN F;  2SAK A;  1ET9 A;  2DGZ A;  3QXG A;  5TIS U;  1K50 A;  2HSZ A;  5J17 A;  4W9G A;  2J4X A;  2ZIX B;  5KFQ A;  2CJN A;  3P4R B;  1L6V A;  1NEN B;  3PW2 A;  4EZ9 A;  3BII D;  4KLE A;  4GXB A;  2Y9T A;  3PMN A;  2HTM E;  2UYZ B;  1ZQK A;  1KFS A;  5CHV C;  1ZD2 P;  4F5O A;  4XA5 A;  2R8K A;  1ZRM A;  3V6K A;  1GG3 A;  4ECQ A;  4KX5 A;  1E7V A;  2IGH A;  3Q3M C;  4A6Q A;  3VRA B;  5AM0 A;  1KLG D;  3EZ5 A;  2ZW1 A;  3K75 D;  3GZN I;  4M6W B;  1QOG A;  5DLG A;  1L3V A;  4F5P A;  4M2Y A;  4XDD A;  3BVG A;  3AE7 B;  9ICX A;  3K9P B;  3LB8 C;  3GDX A;  3I3T B;  1Y56 A;  3NOB A;  3H4D A;  4FHJ A;  2HI0 A;  1TGZ B;  4GDL A;  4QZA A;  5CHW A;  4DFM A;  1EWY C;  3W1S A;  4YR2 A;  2XY5 A;  1WMH A;  5DGA A;  2KHV A;  4A8E A;  2AGQ A;  4YTM B;  4RMA A;  2W8L A;  1F2R C;  3NRW A;  3VH4 B;  2KAN A;  3VDZ A;  5KFG A;  1ZUD 2;  2A1A A;  3AMZ A;  1HZ6 A;  4ECX A;  4N58 A;  1M94 A;  1EM7 A;  2ZIU A;  3RYT A;  2KX0 A;  3V61 A;  2RDI A;  2NO5 A;  5JUM A;  3E0F A;  2ZCB A;  3KUD B;  4A55 A;  2EKI A;  4PPX A;  2VJ5 A;  1KKX A;  5L83 A;  3ZO5 B;  2MP2 A;  2JUO A;  5KFC A;  2XIC A;  4HK2 A;  4RGT A;  3OGU A;  1ZQH A;  3GE3 C;  3PSI A;  3V7L A;  1PZN A;  9ICP A;  4A3O A;  1TE2 A;  3ISD A;  1SE4 A;  2R8I A;  2IND C;  2UVW A;  3OSP A;  2Y1I A;  3V72 A;  2LEK A;  4O3M A;  4M0W B;  1KF6 B;  5J2A A;  4ZHO A;  1A76 A;  5DG7 A;  2LM4 A;  3DWG C;  2KFK B;  2K3U A;  1XSL A;  1V38 A;  3D32 A;  2ZTE A;  3EEC A;  4EX7 A;  2H3F A;  1JXE A;  2GB1 A;  2L7R A;  5KG6 A;  3BQT A;  2EKE C;  3TKA A;  2INC C;  3ZUN A;  1T0R C;  2VKQ A;  2GWS A;  3P63 A;  4IUM B;  4NQK E;  1L5U A;  2OYY A;  1AW7 A;  3CMM B;  1WE7 A;  3OPX A;  2JZB A;  4YT0 B;  3WKD A;  3PRZ A;  1ZE3 D;  4TUR A;  2XK5 A;  2LXA A;  3WAM A;  5KT3 A;  5ALM A;  1YT3 A;  3C0R B;  3URY A;  2XC9 A;  4BGD A;  1JRP A;  1E8X A;  1RYR A;  2GOW A;  5KAF U;  3SDL C;  3MDC A;  1SKW A;  4HLE A;  7ICL A;  3H1U A;  5HI1 A;  4ED7 A;  2AGO A;  1XCQ L;  2NTT A;  1VD2 A;  3ZTC A;  2K8B B;  4EZL A;  4MGI E;  1SZP A;  1T4G A;  4ZRI A;  4PHA A;  3SEN A;  2I1Q A;  2J7Q B;  2LGD A;  2PE6 B;  2Q0Z X;  5J0W A;  1NK4 A;  1S76 D;  1S1Q B;  1WRI A;  2MRL A;  3L17 A;  4J3O D;  1KFT A;  2AEH A;  1NEK B;  1AAR A;  4I2H A;  2KK0 A;  3IBE A;  1COK A;  4NLG A;  3AI5 A;  3QUT A;  1D9F A;  1MA7 A;  3AU6 A;  2LGY A;  1I35 A;  2HHV A;  4DHJ B;  2BB6 A;  2UVR A;  2MJ3 A;  3NG0 A;  1S97 A;  3PW0 A;  3AUL A;  2INN E;  7ICJ A;  1D5Z C;  1TKD A;  5KT6 A;  5EE0 A;  5C0Y A;  2DNF A;  4G3X B;  4BVU C;  3KYC D;  5AM5 A;  4A20 A;  4IKG A;  1I42 A;  2BTE A;  2IOF A;  1Q46 A;  1I4R A;  4C8O A;  4FZN A;  4NLB A;  3T5L A;  3EC8 A;  4YXD B;  4Y2U A;  1UUP A;  4OW0 A;  3PO4 A;  1DYQ A;  2KHQ A;  3GII A;  2JEG A;  2WLB A;  5EE3 A;  4QWC A;  5J0X A;  1DK2 A;  4HPM B;  1SJE D;  4I29 A;  3ZRF A;  3BY4 B;  5G2N A;  3QUB A;  2N1V A;  4PS7 A;  5DG9 A;  1YX6 B;  4BBN C;  3ONS A;  2HVH A;  1L0Y B;  1E8W A;  2OH2 A;  4O5C A;  2PFO A;  4KLU A;  2K8A A;  1ZQV A;  2BT6 A;  2WFA A;  3UQA A;  3ALB A;  3KKA A;  3A4S C;  3PHW B;  2KFZ A;  4HCN B;  2G1E A;  1ZQU A;  3PW5 A;  3HVD A;  4QZB A;  4RNM A;  5IIO A;  1NVI D;  3M9N B;  5KFX A;  4IR9 A;  2XBB C;  2YVC A;  1SIF A;  5H8Y E;  4G11 A;  4HVB A;  3LYY A;  1KDH A;  4FBT A;  1SEB D;  2K6D B;  2D6F C;  2YMP A;  1DGS A;  4CF4 A;  2CR5 A;  5ALJ A;  5AKH A;  2W7O A;  3TAN A;  2JU6 X;  4MFF A;  1D8Y A;  2NVU I;  3PR5 B;  4P0Q B;  3DCG A;  4EBE A;  3ML8 A;  3HX0 A;  4EEL A;  3QJZ A;  3UIP B;  2GLS A;  2FPK A;  1K51 A;  3JSV A;  2Q5W D;  3QX1 A;  1Z2M A;  4ICU A;  5JRT A;  3T8M A;  4WJO A;  4OZA A;  4IQU A;  3H0R B;  2J52 A;  3ZDA A;  1ZDV A;  2KDE B;  3HRD D;  4Y2P A;  2L1A A;  1ZQF A;  1EF5 A;  2LGI A;  2VZK B;  4PT5 A;  4ZDV A;  3PX6 A;  4F2S A;  5CTR C;  9ICS A;  3HHM A;  4B9L A;  7ICQ A;  3WKA A;  1MG4 A;  5KFV A;  2I5H A;  4G3I A;  4DL4 A;  2G0A A;  2ZTC A;  3A0B U;  3T3F A;  1UGM A;  3AEA B;  2NRT A;  4BDP A;  3JPO A;  3IHP C;  4C7Z A;  3CW2 C;  1WYG A;  2RHF A;  2QIL A;  4IG7 B;  1Y88 A;  3NS8 A;  5J0Y A;  3Q3O C;  1PUZ A;  4HYK A;  2J0J A;  3W2D A;  4ZOH C;  4NY0 A;  3KWV A;  4AJY B;  4CYE A;  4OZB A;  4O9M A;  2NR2 A;  4KLI A;  4BX9 C;  5CB1 A;  1SE9 A;  3BS5 A;  2FCM A;  4QWE A;  4K4G A;  1KFY B;  1KJT A;  3BQ1 A;  3F5A A;  3Q8R B;  1V81 A;  1NBF C;  2HW3 A;  1V86 A;  4GIB A;  1SWV A;  5EE1 A;  8ICS A;  3ZNI D;  3LK9 A;  4K4H A;  2WF8 A;  1X9W A;  2HE7 A;  2YTU A;  4A90 A;  1D9D A;  5FP0 A;  5D3I B;  4Q8F A;  3Q3N C;  2GH1 A;  2ASQ A;  2GMI C;  4TKN A;  5BYR A;  1QQR A;  2ACZ B;  4DQP A;  3W5U B;  2E8P A;  1KRP A;  2N7J A;  4NL9 C;  1FXT B;  5KT7 A;  3C2K A;  3VTV A;  1U45 A;  3RAX A;  3CRX A;  2KQ4 X;  2N4F A;  2QC8 A;  4JIO U;  3L54 A;  1VR9 A;  2KTR A;  2ONQ A;  4WWN A;  4II2 B;  4B9S A;  3WK4 A;  1B0X A;  2GI9 A;  4YMM A;  2KE7 A;  1ZPS A;  2RPV A;  1EU4 A;  1HIW A;  2K8H A;  2JXJ A;  2NS5 A;  4JB3 A;  1OEY J;  3RRH A;  3AL0 B;  3L10 B;  3RMK C;  5J2H A;  1VZ8 A;  1UBI A;  1L3U A;  3B0Y A;  3RB6 A;  2KEY A;  1S10 A;  1EXN A;  4UAW A;  5J2J A;  8ICY A;  1STE A;  4YG2 A;  4HJG E;  4PH5 A;  2KN4 A;  2DWQ A;  5IKC M;  4UBB A;  4E0D A;  4HXD A;  1UT5 A;  4I2B A;  1SXE A;  3P4S B;  2HOF A;  1TT5 B;  3M9M B;  1MPE A;  2IBK A;  2FIF A;  2HBJ A;  2H89 B;  3K1Z A;  2E3T A;  1WXM A;  1PDX A;  4QWB A;  2KNJ A;  1DRG A;  2BS4 B;  3V6C B;  4TUS A;  1R4N I;  2G07 A;  3NVZ A;  4YFK A;  4RQ6 A;  4J9N A;  1B22 A;  4YXJ A;  5BYQ A;  1GAQ B;  1XO3 A;  1HQR D;  1M6Y A;  4NLC A;  5AI4 A;  4DFJ A;  1XEE A;  1PVP A;  1NZP A;  2C2E A;  2HCF A;  3EUB 2;  2MBO A;  3DBR I;  4OJO A;  2KDM A;  4ANV A;  2PKE A;  4I2E A;  3TL5 A;  2DYB A;  2SEB D;  1WGH A;  2BPC A;  2JMG A;  4DSF A;  2ZVN A;  1BXT A;  3BYT B;  4MEY A;  4O1N A;  5FKA C;  1X9S A;  3DVG X;  2JWZ A;  3BIN A;  4HCP B;  4ELU A;  3JW0 X;  4MEL A;  4ASW C;  3M8S A;  1RYS A;  4M6W A;  1ZD3 A;  4US9 A;  5D4B A;  1SKR A;  2X8X X;  2BCV A;  3HT3 A;  1LKY A;  1FNV A;  2BS2 B;  8ICV A;  1S9F A;  3Q8C A;  3ZGZ A;  1L7O A;  2BCU A;  4DQS A;  2AQ2 B;  3RJI A;  2LKY A;  2K0P A;  1X2I A;  2HTH A;  2KMM A;  2ZG6 A;  2HDO A;  2BCQ A;  9ICN A;  2LI5 A;  4HRO A;  4OVV A;  2ZNV B;  4J9P A;  4DBG A;  1WWT A;  2MUT A;  7ICV A;  4K7S A;  4KIK A;  3ZLZ A;  3ZQ4 A;  3Q14 C;  3QQ8 B;  2M4N A;  1FD6 A;  1WGK A;  4HPL B;  5ALW A;  2L52 A;  2MBQ A;  2CJO A;  3NHE B;  2MAX A;  3MR3 A;  4B95 A;  3PO5 A;  1S5L U;  1Z4N A;  4IRC A;  2KT7 A;  2L05 A;  2V4I B;  2WS3 B;  4RF0 A;  3JPP A;  3AEV A;  1R4M B;  2W03 A;  5E6P A;  4UW9 A;  2LPE A;  5AI8 A;  5C5J A;  2JXX A;  2G45 B;  3D2Q A;  2GRI A;  2NMQ A;  4LDT B;  2F1H A;  4LNF A;  1NK5 A;  3WCQ A;  2XGP A;  1SKS A;  5HMM A;  2BCS A;  1WJN A;  4EEW A;  4DQR A;  2E8N A;  1SBB B;  2WAQ C;  1J2M A;  3QU4 A;  1YOV B;  1C3T A;  3GB1 A;  2WF5 A;  4UAS A;  4U7C A;  4E74 A;  1ZQ1 C;  2KLG A;  2ZNV C;  3RJF A;  3T5H A;  3R9K A;  4NLN A;  4G50 A;  3ZIM A;  4MDK E;  2MJD A;  3QU5 A;  1IBX B;  3TMP B;  5AIB A;  4YN4 A;  5LNK 1;  2R61 A;  4WWO A;  1IG6 A;  2GOL A;  4YSY B;  2PVO D;  5AK4 A;  2W9B A;  2QB0 B;  2WB1 F;  2WU2 B;  5L1I A;  2HHS A;  1WXV A;  5ALD A;  2HVI A;  4YSX B;  3AE5 B;  4PK1 A;  4DSK A;  3AEC B;  4XDC A;  3ZW3 A;  3ZTD A;  2BDU A;  1SIJ A;  1PUT A;  3OG5 A;  2JWU A;  4DSE A;  1R4N B;  3PO0 A;  5KT5 A;  4MSM B;  2C2R A;  2PI5 A;  5DB6 A;  2W9N A;  2MEK A;  1VJK A;  3A9J B;  3RJE A;  2KTR B;  5KFN A;  2JZB B;  1LGR A;  4JWS C;  2D5G A;  3B08 A;  2OEH A;  1FFU A;  4O3P A;  1E0Z A;  3DDH A;  1U4A A;  3ETL A;  5KFF A;  2AQ1 B;  2JYT A;  4ED1 A;  4ED2 A;  1B1Z A;  3OHA A;  4CF3 A;  1TFR A;  4Q44 A;  2W8K A;  4NJC A;  4YTP B;  1L2N A;  4W9J A;  3MR5 A;  1GC7 A;  2V3S A;  2H5X A;  5DDM A;  2DZK A;  3P42 A;  2XID A;  5JHA A;  3TSS A;  9ICF A;  1QOA A;  1KBU A;  1ZDX A;  5TZV A;  4KTQ A;  2CKH B;  4DS4 A;  3EGR A;  2HMX A;  3DV9 A;  2NYV A;  4J9K A;  3VC8 A;  2IMW P;  3RJH A;  3H0M B;  4JV0 A;  4EEK A;  2V3N A;  3RNC C;  4LVS A;  3PSP A;  1LM8 B;  4J9S A;  1LKY B;  3BQ0 A;  1JAL A;  1MC8 A;  1L7M A;  1WM2 A;  2P35 A;  2BKR B;  3PLV A;  4AYB F;  4F1S A;  4IWP A;  3ZRC A;  3J81 j;  3H8M A;  1FXA A;  2V0G A;  2CU3 A;  5AI6 A;  5AIA A;  2WP9 B;  4IC7 B;  2W82 A;  5GTI U;  4P1B C;  3M3J A;  1K1S A;  2FID A;  2JEJ A;  5IA7 A;  1UGJ A;  1OGW A;  2IGD A;  2J6U A;  3FIL A;  3I28 A;  8ICN A;  4TSS A;  4PL2 A;  1ZQZ A;  1WCL A;  4MH8 A;  2H3V A;  4FZL A;  2WXM A;  3BQ2 A;  3AV8 A;  4YD2 A;  2I2Y A;  1V5O A;  3KHL A;  2R8J A;  1VZ7 A;  3DHG C;  3RNG C;  5F9N A;  5DBA A;  4AS1 A;  2LXC A;  3CST A;  1JML A;  1O03 A;  4X5V A;  4YTN B;  2RDG A;  2Z7J A;  3C1Y A;  3KYD D;  2ZUD A;  2NBW B;  4O5E A;  1PQS A;  2FE9 A;  3IP4 B;  1ZGU B;  1QCK A;  1WWU A;  1V9J A;  4OHJ A;  3PTF C;  4UAT A;  2AWT A;  2PXI A;  5KG0 A;  1SB3 C;  4AP4 C;  4AQ7 A;  4O0I A;  2N7E A;  5AUI A;  2GO7 A;  4URK A;  3L5K A;  1T3Q A;  2EEL A;  4QWA A;  4M02 A;  4EE2 A;  2BBC A;  1O08 A;  3RPF C;  1ZQS A;  3N3K B;  2JZP A;  4KDL B;  7ICE A;  2YY6 A;  3H8J A;  1E90 A;  3PVX A;  4DLE A;  4Q8E A;  4C8M A;  3N9Y C;  3GP7 A;  2G9H D;  2JR5 A;  2BYF A;  3DBH I;  3B1L X;  4UQG A;  1KQQ A;  1YMH E;  1ENF A;  4YL8 A;  5KFI A;  2C2D A;  1L0V B;  3UMG A;  4K7U A;  3R7Q A;  2A5U A;  2C7M B;  5C23 A;  3NRZ A;  5CWR A;  4F4Z A;  3RFA A;  3KFU F;  1JWB D;  3O0F A;  1KSP A;  2HBL A;  2N9E B;  2I6X A;  3AU2 A;  1PFD A;  3SAH A;  5G5G A;  4M47 A;  4RM8 A;  3TIX A;  2BYT A;  2KVR A;  3KH0 A;  5KG2 A;  3ALR A;  1A77 A;  1NZB A;  3H8S A;  4K3B A;  1UPH A;  3PVL A;  4FN2 A;  4QZF A;  2W43 A;  4TUU A;  5CJ7 A;  3B9J A;  1TKY A;  3RB0 A;  2WGS A;  2X38 A;  3IDW A;  7ICS A;  4JQW C;  1L3S A;  5KFR A;  2AQ4 A;  2PFN A;  3F5E A;  4C8N A;  4LNO A;  4FS2 A;  2LAS A;  3B0X A;  2BGW A;  1YQB A;  5T8I A;  1K8R B;  1LVH A;  3BYY B;  2YMM A;  3BS5 B;  1WGD A;  1T5X D;  3NVY A;  4K7W A;  7ICK A;  3RJG A;  2Y5C A;  3DHI C;  5J2E A;  1X6J A;  1RWS A;  2LUM A;  4C56 C;  4HPP A;  1J2N A;  1ZQE A;  1I4H A;  3EA6 A;  3NTU A;  1LV5 A;  2ZIX A;  2UVV A;  3RNF C;  1LB2 B;  1ET6 A;  1AWD A;  1YNT E;  2RDH A;  4MGK E;  3MC1 A;  3A9J A;  5KFA A;  2KKP A;  2QLT A;  5KFE A;  2FMP A;  1TBE A;  4B9T A;  1L6U A;  3RNA C;  4DXA B;  2YEP B;  3RF9 A;  3P4Q B;  1QT9 A;  4KLG A;  1Q10 A;  3V7J A;  2QHO A;  2LJI A;  3DBL I;  2KSO B;  3BDP A;  3OWE B;  5E6J A;  4ICA A;  3U30 A;  2GBR A;  2M8S A;  3SHQ A;  3E2E A;  1WGG A;  5I4D A;  1TY0 A;  2YMQ A;  3UIN B;  1YZ7 A;  1L8L A;  4B9V A;  2G4D B;  3ZDT A;  4FJY A;  1K5O A;  1NNL A;  1P7D A;  3L08 A;  4WWM A;  5CP2 A;  3TI0 A;  4NLK A;  4FBJ B;  8ICZ A;  1ZD4 A;  1V49 A;  3N1X C;  1F1H A;  3C29 A;  3RR8 A;  4L1B A;  1N5X A;  4GLS C;  3GZF A;  3NGD A;  3M8R A;  4XE0 A;  1JRU A;  3N30 A;  3VXW A;  2AL6 A;  2DEN B;  5BOM A;  4FE3 A;  1ZQN A;  4AYB C;  1ED1 A;  1QZE A;  3BQ7 A;  4B9N A;  3Q3J A;  5L1J A;  5TR5 A;  3RNE C;  1XD3 B;  2PMZ F;  2BDP A;  2PFP A;  1MFW A;  3KTQ A;  2CHX A;  2KWD A;  3SFE B;  1N5W A;  2KJ9 A;  3DBR B;  3I57 A;  3TFR A;  5HR6 A;  1B9R A;  3L3F X;  4I6P A;  2KZM A;  3CSF A;  4CE6 A;  1E8Y A;  2FUH B;  4N9F 4;  4DLG A;  1N61 A;  3PV8 A;  2F1I A;  3RH5 A;  4BOS C;  9ICG A;  4M9N A;  4GMV A;  4JUZ A;  1LXD A;  1ZKH A;  4JX1 C;  3Q2A C;  1T8E A;  4P1C C;  3RCZ A;  4KSK C;  2EZZ A;  3EYZ A;  2GBM A;  1JXL A;  4F3O A;  4UB2 A;  1A0P A;  1L8O A;  3TAD A;  3VUY A;  3DEE A;  1GOZ A;  3CP8 A;  2G4S A;  2W9C A;  1S8O A;  9ICT A;  3UF8 A;  2MU2 A;  5CHG A;  2XN9 C;  1YN4 A;  3UQ0 A;  2REX A;  3PY8 A;  2F8K A;  3X23 A;  5KFD A;  2EMS A;  4DO9 A;  7ICM A;  3AE8 B;  2KV2 A;  1I4P A;  3CIR B;  8ICK A;  4YMO A;  2CHZ A;  4QIW C;  2J42 A;  2OED A;  4F2R A;  5AKL A;  3WKE A;  3VTU A;  1MI0 A;  2MSN A;  1TS4 A;  4F4W A;  5AI5 A;  9ICL A;  3TCA A;  4TQR A;  5K4L A;  4DQI A;  7ICR A;  2FBW B;  4ELV A;  3ZDD A;  2Y3A A;  3V6H A;  3RJK A;  1R4M I;  3C1Z A;  3TFS A;  2IO3 B;  3ISC A;  8ICO A;  2PMV A;  2KN5 A;  4XZ4 A;  4QW8 A;  1LO5 D;  4M9L A;  4W9K A;  1FXI A;  2M17 A;  3AQE A;  1BPY A;  4CHK A;  4FO6 A;  1RAX A;  3IT4 B;  4C80 A;  1ISN A;  2KX3 A;  2MH7 A;  3OJS A;  1ZQB A;  4U6P A;  2LZ6 A;  4GSW A;  1WWV A;  1PGA A;  2BYE A;  2N1W A;  4NNJ B;  2DX5 B;  4EOY A;  5DB9 A;  4P4M A;  3H7P B;  3HPO A;  2LRW A;  1GO3 F;  2RD0 A;  1RLF A;  5IOI A;  4P6V F;  2WXG A;  4UAV A;  3I1Y A;  3RAQ A;  4WJQ A;  1FM0 D;  4RQ1 A;  3GIJ A;  4M0A A;  1HEZ E;  2KO3 A;  3TEW A;  2D8C A;  1XS9 D;  1ZQJ A;  4R3D A;  4JGH B;  1XT9 B;  5J8Y A;  8ICQ A;  4F91 B;  1CK1 A;  4J9M A;  4GLX A;  2JZZ A;  1I7H A;  2BHN A;  1WXQ A;  1IIP A;  1XO0 A;  3QZ8 A;  9ICE A;  1WI0 A;  2K8B A;  4ED8 A;  3J9C A;  4BZA A;  4EBC A;  5GXG B;  4Y2V A;  5HHH A;  1KLV A;  3IG3 A;  2JV3 A;  4RU9 A;  4F4X A;  1WRD B;  3L0W B;  3NY5 A;  4KX6 B;  4IWO A;  1N48 A;  3THV A;  3HM3 A;  3W1Y A;  3BWU D;  2D2Q A;  9ICW A;  4AOF A;  1WXA A;  2VH2 A;  2FPL A;  2JRH A;  5MPO A;  1WJ4 A;  1J7B A;  1SJH D;  1JUD A;  2IHN A;  2IY0 B;  4CNQ A;  2N9L A;  2ZIW A;  4TUP A;  2JX5 A;  4H2A A;  1NKC A;  4YP3 A;  2I9G A;  2IOH A;  2ZJ8 A;  3GS2 A;  2ISP A;  1FNW A;  3MHS D;  4PS3 A;  4XX5 A;  4ZHP A;  4FFD A;  3GV7 B;  8ICT A;  3M63 B;  5CA7 A;  3WAO A;  1I4X A;  1X6I A;  3RB4 A;  2YB1 A;  4N59 A;  1ZQM A;  3RR7 A;  2KAC A;  3ORY A;  2AGP A;  4W9D A;  4UB1 A;  1KOT A;  2FUG 1;  5J0S A;  2B21 A;  4DQQ A;  4BFR A;  4IQV A;  4J9L A;  1WIA A;  1N6Z A;  5AKG A;  1PK1 A;  1Z00 A;  1X40 A;  4R66 A;  2OWO A;  2DZJ A;  1BPD A;  2LYB A;  4DHZ B;  4EEN A;  2F1J A;  4PYZ A;  4WJ3 B;  2WDQ B;  3PHX B;  1TIF A;  2VZK D;  5HKH A;  2YB4 A;  5KG7 A;  4NWI A;  4RQN A;  1T7P A;  3QK0 A;  5GTH U;  4RFB A;  5D7G A;  1EUV B;  1Z00 B;  5KFW A;  2L5Y A;  1NK0 A;  2VA2 A;  4WQM A;  2LBO A;  3MC8 A;  3AEG B;  2WF6 A;  3CYM A;  2KWC A;  3AE2 B;  3A4R A;  3VCB A;  4DS5 A;  3U26 A;  5H2F U;  2EAM A;  4Y2J A;  8ICC A;  2RDB C;  3ONN A;  5KT4 A;  4MJS A;  2KNB A;  4DK5 A;  2YX8 A;  4Q45 A;  1V85 A;  4ARC A;  4C8K A;  3WKC A;  1E6E B;  4C00 A;  2AH5 A;  2K8C B;  5AKE A;  3GIK A;  3DPD A;  5ALV A;  3EFU A;  2V3P A;  2MW5 A;  1DGJ A;  4M0W A;  3TAR A;  4EZJ A;  2L83 A;  3QCA A;  5BMH A;  3PSF A;  1GB1 A;  4OJP A;  4LJP B;  2KFK A;  3AM9 A;  3AEE B;  5AKY A;  2KIW A;  1JQ4 A;  4O3N A;  1QH9 A;  2LHE A;  1NJX A;  3I9V 1;  3W9C B;  3RFZ B;  1XLQ A;  3QC8 B;  5ALI A;  3B2F A;  3EW9 A;  4A9A A;  4DL6 A;  1C79 A;  1P7F A;  1CI4 A;  1U48 A;  3QHT A;  1BUI C;  2NCN A;  3MGH A;  4HDQ A;  3HWT A;  4O3Q A;  2LHT A;  5ALY A;  5IIM A;  2CS4 A;  3VR8 B;  1BVS A;  3EFC A;  1EO6 A;  3PW7 A;  3DQV A;  3ZDE A;  4C8L A;  5AIC A;  3A1Q A;  4ITK A;  2V4Q A;  4REZ A;  2BKE A;  4IRK A;  4ACO A;  9ICC A;  1ZD5 A;  3AE9 B;  4F5N A;  3H9D A;  4XWT A;  3D6J A;  1J8C A;  5ALP A;  3AE3 B;  5DCN A;  2M56 B;  8ICG A;  2R2Q A;  3KWL A;  2NRX A;  2RDJ A;  1ZQL A;  4KLD A;  2PLP A;  4F5Q A;  2WXL A;  2BKF A;  1C20 A;  2LD9 A;  3Q8A A;  5AEK B;  1P98 A;  7ICU A;  2WHE A;  9ICK A;  2JSV X;  1C4P A;  1WGR A;  5J2B A;  2JYE A;  5AZH A;  3U2S C;  2NTS A;  4YXM A;  4TQ1 A;  2KQS A;  4LTU A;  3RRG A;  1J7A A;  4FBU A;  5DLF A;  5KFT A;  4I2G A;  4PZN A;  1FCC C;  3SD5 A;  2DKZ A;  3SD7 A;  2QAR A;  4KKI A;  4US8 A;  8ICP A;  2MX2 A;  4RGN A;  4RQ3 A;  5AI0 A;  2KJ8 A;  4W9E A;  4MFC A;  4RM9 A;  5ALK A;  1QKZ A;  1V6E A;  3CWI A;  3IHQ B;  4KLS A;  3A0H U;  4EBD A;  3EPG A;  3LVW A;  2J6T A;  4LK0 M;  1CUK A;  2L0T A;  5L1K A;  2KC1 A;  2P6R A;  2PE9 A;  3WKB A;  4ZH4 A;  1N62 A;  1ZQC A;  2DYM A;  3RN9 C;  3ECI A;  5E79 U;  3N20 C;  4P0P A;  9ICV A;  4RF1 A;  1KTQ A;  3KUZ A;  2K22 A;  3MJ5 A;  5ALE A;  2AYO B;  3IM1 A;  4KLT A;  4USA A;  3L4P A;  2K39 A;  3F2D A;  5HG2 A;  2CU1 A;  9ICO A;  1TTN A;  4QWD A;  2LMR A;  4UB5 A;  4JV2 A;  5G55 A;  7ICP A;  4GC7 A;  4NY8 A;  3PGE A;  2BQQ A;  2K4E A;  3OLM D;  2XY6 A;  4IWQ A;  4UB6 U;  1CQV A;  3FM9 A;  3ED5 A;  2C22 A;  4YSZ B;  3IV6 A;  4F5R A;  3MR2 A;  1WMH B;  3N32 A;  1JIH A;  1F0Z A;  4KLJ A;  2LI6 A;  1KM7 A;  4M9J A;  8ICX A;  3IFW B;  4UBC A;  2F8L A;  1Q5W B;  4FXC A;  4RQ5 A;  3FIL B;  1S0O A;  4PYU A;  2C60 A;  4GXK A;  3TUO A;  4ZRP A;  2L32 A;  1IM4 A;  4R64 A;  2Z0D B;  2QCZ A;  2A1J B;  4GU2 A;  2WXP A;  4IW0 A;  3ABV B;  3RB3 A;  1V9P A;  2KP7 A;  3H8W A;  5J0Q A;  4K1R B;  3SMV A;  3Q8M A;  1FEZ A;  3KZX A;  4OJ6 A;  1UQV A;  1SZH A;  5AM2 A;  3KQ4 A;  1XQQ A;  1E9M A;  3APD A;  1UHU A;  1SV0 A;  1ZRN A;  2LFI A;  3M6Z A;  2QEJ C;  2XO7 A;  3FC4 A;  3LXF A;  4EZ6 A;  4EUT A;  3GFK B;  4Z6F A;  1JW9 D;  2D3C A;  2KJ6 A;  1JWS D;  2HBK A;  4MM3 B;  4HKZ E;  9ICH A;  5KFY A;  2MUT B;  2I1K A;  4KIK B;  3ML9 A;  1V1O A;  4OJL A;  3RJJ A;  4MJS B;  4W9H A;  5AKX A;  2KOB A;  2N9K A;  1EWC A;  3Q69 A;  4OVU A;  2K6Q A;  1XLN A;  2L8J A;  4NXZ A;  5ALN A;  5DQI A;  5L95 C;  4GDK B;  4OVZ A;  5HP4 A;  3ZXR A;  2NO4 A;  9ICM A;  2JY6 A;  3VHT C;  2HHQ A;  4XRH A;  4PGQ A;  2I1J A;  5EWF A;  2MJE A;  1HA5 A;  1LFD A;  3MC0 B;  1RM6 C;  4RQ7 A;  3BK1 A;  3H0L B;  2IO2 B;  4C4T A;  3ZXV A;  1UCV A;  1ZQW A;  2H3Z A;  2RLT A;  5D94 A;  5AK3 A;  5B66 U;  5IIK A;  1VDV A;  4MGY E;  3AQF A;  1WF9 A;  3PZ7 A;  3TQ1 A;  3MP9 A;  5DBB A;  3L16 A;  4BWM A;  3SV3 A;  4KX3 A;  1SGH A;  1IBX A;  1JWU D;  2D3D A;  2INP E;  3A1Q B;  1N60 A;  1SSN A;  3U4E G;  1FPY A;  2KFJ A;  1IGD A;  4UAZ A;  1IPG A;  5BOL A;  1L7N A;  4KMU A;  3ETR A;  4I2I A;  4YR3 A;  2C5L C;  4LJO B;  5KHO A;  3KVF B;  2JRI B;  3JPR A;  1Q3U A;  8ICM A;  4PJ0 U;  4PGX A;  2KXJ A;  3MFG A;  2WDR B;  1URJ A;  5IIJ A;  4Q43 A;  3HIZ A;  3N1Z C;  4NQL B;  7ICO A;  4LDT D;  2FLN A;  3Q6B A;  3GU3 A;  2IY1 B;  3TEZ A;  1ROE A;  4FJV B;  5AM4 A;  2PJH A;  3CF6 E;  3ZKJ C;  4K3C A;  1ZQQ A;  3JPT A;  4Y2S A;  5ALR A;  2IHM A;  2QB0 A;  2IPK D;  3E58 A;  4W9C A;  4J9Q A;  1L5P A;  1PVQ A;  1FCL A;  4PHP A;  4NM1 A;  2FMS A;  3UMC A;  4GFJ A;  2HD5 B;  2Z0E B;  2B0C A;  3QU7 A;  1MJD A;  3I76 A;  2G5H B;  1TK0 A;  1HJP A;  2OXO A;  5J0P A;  2DPJ A;  1UH6 A;  2YEP F;  2WX0 A;  2MBE A;  1WJU A;  1MHH E;  2PTL A;  1BNO A;  3KOO A;  2QKQ A;  2WX1 A;  2RP5 A;  3ZNH B;  2ZTD A;  1C4C A;  1BPB A;  1N56 A;  2ASJ A;  3IVF A;  3LDZ E;  1YN5 A;  3O13 A;  1GJZ A;  2JH7 A;  1JI7 A;  3T79 A;  3AH7 A;  4KVG B;  2D11 A;  2W04 A;  1P3Q U;  3QIJ A;  5B5E U;  2BQ3 A;  1OXJ A;  1D5X C;  4J9R A;  2N9X A;  9ICU A;  4PZO A;  4IR1 A;  3V6E B;  4B6W A;  4KIT B;  4GDL B;  3WAL A;  4JWU C;  4P16 A;  3KBB A;  2WXN A;  2W7P A;  3PRP B;  1F0M A;  1T6B X;  2LWP A;  5BPC A;  5KG1 A;  3JPN A;  4DEZ A;  5ALO A;  2KFN A;  1K52 A;  4KDI C;  1WX9 A;  1GPX A;  2MHJ A;  3AU5 A;  3T5K A;  3FDS A;  3F2C A;  2L0F A;  2ZEQ A;  3R2I A;  2WXQ A;  3BZC A;  3GQC A;  4B0E A;  2DLB A;  3G6V A;  3R7R A;  1RPL A;  2R8H A;  2P66 A;  3H40 A;  4NAM A;  2FCN A;  4ELT A;  3C5F A;  4AWJ A;  3IG8 A;  3AEB B;  4JE3 B;  1SV4 A;  5DPR A;  4P4P A;  4QW9 A;  2ZVO A;  3M95 A;  4DQO C;  4ECS A;  3OHB A;  1VLB A;  1DOY A;  2WAQ F;  2NRV A;  2CPR A;  3R2T A;  1F52 A;  2KTF A;  5KNI A;  4WJN A;  4YVZ A;  8ICU A;  2D10 A;  1QQ7 A;  3C19 A;  4HWI B;  1SGG A;  2EQY A;  4GB9 A;  3EPI A;  4ARI A;  4RUA A;  2HJ1 A;  2PPH A;  2JT4 B;  5DB8 A;  4MH0 E;  2VJ4 A;  1T0Q C;  4LJX A;  2XCP A;  2XCA A;  3U7Z A;  3LWL A;  4BKG A;  1XO1 A;  2TSS A;  1CMX B;  5TSS A;  2GBK A;  5J2I A;  2ZJ5 A;  5IO9 A;  3N7P D;  1TS5 A;  1V1P B;  2OM6 A;  2ZIV A;  2WXJ A;  3H7P A;  3UMB A;  4QZC A;  3R8B A;  1J0G A;  4J6I A;  3FAH A;  5C2T B;  2LVQ A;  2K9X A;  3QEB Z;  2ICI A;  3UGB B;  4RQ4 A;  1V2Y A;  3ISB A;  4GIV A;  4RCO A;  8ICJ A;  4FZM A;  1HUO A;  4IM3 A;  3VAW A;  4LZG A;  5AK6 A;  2JH1 A;  1UWM A;  5D3D A;  3AXC A;  3ZDB A;  1NJW A;  5HHI A;  3S2A A;  3QAR A;  1UA0 A;  2KIV A;  5T14 A;  1WYW B;  2DAJ A;  2CXY A;  2AHO B;  1A70 A;  2M0N A;  5AZF A;  4OO1 J;  4DWI A;  1HE8 A;  4DCC A;  5A0L A;  8ICL A;  1WFY A;  2OJR A;  4ED3 A;  3VUX A;  2FJ6 A;  1D5M C;  3IAS 1;  3PS6 A;  2FDR A;  4A3P A;  4B6J A;  2KMA A;  5KFP A;  1T0Y A;  2DZI A;  2IBI B;  3UQB A;  2ZIW B;  1RXV A;  4ECR A;  2KDB A;  2F76 X;  1WY8 A;  3SQI A;  5DPT A;  2IZV B;  4Y2R A;  8ICE A;  1TAQ A;  1CRX A;  2H3I A;  5J0T A;  1J19 A;  4DHZ E;  4M8N A;  1MQ3 A;  3V6J A;  2KKV A;  3Q8L A;  3D2S A;  3R66 C;  1U9L A;  5DBC A;  5AKJ A;  3N97 B;  4JPS A;  1QSY A;  4FS1 A;  1ZQX A;  4Y2T A;  2KLC A;  3RBE A;  3T9L A;  2VRR B;  2WQY B;  5GMV A;  2ZZP B;  4LCD E;  3M1Y A;  3SV4 A;  5D6J B;  3BZD B;  2DUY A;  2VIX A;  4FAD A;  8ICI A;  1TZ1 A;  1ACC A;  1OW5 A;  2O2V B;  1S3S G;  7ICH A;  2KN7 A;  2RMM A;  3WK5 A;  5J2F A;  4DOC A;  1P0R A;  1GNU A;  5HR7 A;  1ZP0 B;  1OQR A;  1XSP A;  3JPS A;  5ALU A;  2KKC A;  4F92 B;  3NVV A;  5KFJ A;  2MA9 B;  4OZC A;  3MBY A;  1V97 A;  2Y0S C;  4O3O A;  4OCZ A;  3HP6 A;  2W54 A;  4CGZ A;  5HHD G;  3CNH A;  1RG6 A;  4I27 A;  4YR0 A;  3VH3 B;  3NZ3 A;  3VFK A;  2JEI A;  4B0M A;  3GOE A;  2K1F A;  2FMQ A;  4O3R A;  4NJ8 A;  2KDI A;  3M6K A;  2FNJ B;  5BO4 B;  2A19 A;  1X42 A;  2BWE S;  3K9O B;  3KHG A;  1PGB A;  3C21 A;  4W9L A;  2HBM A;  5L1M A;  2LGX A;  3BK2 A;  4ICV A;  3PX0 A;  2DFL A;  2IOF K;  9ICJ A;  3KD3 A;  3APF A;  4FJZ A;  1CJE A;  3HKZ F;  4G0N B;  4I28 A;  5ALF A;  3KHR A;  4HKQ A;  9ICI A;  2Y0S F;  5AKI A;  1RRB A;  2WHI A;  3U7D A;  4C4S A;  1JX4 A;  4MAC A;  1ZET A;  3A9K B;  2J6S A;  2I38 A;  1Z5S B;  2H3Q A;  2K4P A;  2WU5 B;  1SL2 A;  3DVN U;  2E8O A;  2RR9 A;  5EDS A;  2NRW A;  3UIO B;  1NYR A;  3KUC B;  4XGA B;  4I6N B;  4NAW A;  1S0V A;  3O65 B;  3SU8 X;  7ICF A;  4TV3 A;  2O6V B;  1Y8R C;  4ANW A;  1DOX A;  2P6U A;  2HJ8 A;  1PGX A;  5ALH A;  2KVZ A;  2F77 X;  2LUE A;  4FLH A;  4MM3 A;  4BJQ A;  3SAF A;  2NPT B;  1PYW D;  4II3 B;  4YMN A;  4RT3 A;  1UWX A;  2W9B B;  2MCN B;  2Y5P A;  1FMA D;  2FCS A;  4UAU A;  1NOM A;  1VJ5 A;  1X66 A;  2WNM A;  2W11 A;  4KN7 A;  3GIM A;  2WWZ A;  3VUW A;  4J03 A;  3WK8 A;  3MHZ A;  4F50 A;  3N7R C;  1IXR A;  5J0R A;  2HHU A;  1E7P B;  2G06 A;  3C5G A;  3BJY A;  1RYJ A;  5KAI U;  3A33 B;  4HAI A;  2WXK A;  1PVR A;  5LXH A;  4NLZ A;  2KWV B;  1F2R I;  3WAN A;  1IYF A;  3T3N A;  3AE6 B;  1UA1 A;  1KL9 A;  3NS1 A;  5AKK A;  1VZ6 A;  4NL9 A;  2VA3 A;  2V4L A;  1XU4 A;  3PW4 A;  2BZF A;  3T3O A;  3I5J C;  2EH9 A;  3MFH A;  8ICH A;  3E9S A;  1DOQ A;  2D3G A;  3ZNG C;  3H7I A;  1F44 A;  5JTI A;  2GBJ A;  2ZIV B;  4IM0 A;  1NK7 A;  4MHV A;  3H7S A;  3QYP A;  2Y1J A;  3FKY A;  1C78 A;  3UM9 A;  5KFU A;  1FFV A;  4J9O A;  4AP9 A;  3ZJU A;  4BKS A;  5J29 A;  4DF4 A;  3LVV A;  1TY2 A;  1SF0 A;  2MA1 A;  1UZX B;  2FAZ A;  4QZ8 A;  3IXS A;  4W9F A;  5J2R A;  5C1Z A;  3KKA C;  2WXI A;  2KVS A;  3H8H A;  5EE9 A;  4DF8 A;  1C9F A;  4F7Z A;  3PPA A;  5ALQ A;  5AM1 A;  4WWP A;  5IAA C;  1NDD A;  1C1Y B;  2LM1 A;  1BML C;  2KSO A;  3HM6 X;  1MHX A;  2QMT A;  5FR6 A;  4F8R A;  4KSL C;  1IV8 A;  2LVO A;  4TQ0 A;  2N7D A;  1PK3 A;  1WH3 A;  1A6S A;  3G6Y A;  5KFK A;  1QOB A;  4KMO B;  3DBS A;  3AE4 B;  5IN7 A;  4M9H A;  1TS3 A;  5J8Y C;  3B0A A;  4DL3 A;  3MGI A;  2A3V A;  2BPF A;  1QSL A;  2M0X A;  4RQ0 A;  1H38 A;  1XLP A;  4Y2Y A;  5J0O A;  2ZPY A;  5KHQ A;  4M9G A;  3NUQ A;  1ZYQ A;  2MWS B;  2KZZ A;  1SXD A;  3HJE A;  1NYQ A;  2XEW A;  4WJP A;  2DAF A;  4R8U A;  2ZXI A;  4S0R A;  3M9O B;  2BYV E;  1TKE A;  4IC9 A;  2OJW A;  3DDC B;  4NAW B;  3VTW A;  1DOI A;  8ICA A;  2ISO A;  3AU4 A;  1H8C A;  5EWE A;  4R8U B;  1PK1 B;  4PHE A;  1L4D B;  4M8M A;  1P7E A;  2YML A;  4UB8 U;  2K5P A;  2AL3 A;  1QOF A;  1GUA B;  3DOW A;  5L9X A;  3G6X A;  4RNN A;  2J0M A;  3H6N A;  1C77 A;  3A9K A;  4WAF A;  4OD0 A;  1ZJN A;  3NJT A;  2ALZ A;  4FA6 A;  1HTQ A;  1FRR A;  4ECT A;  2GBN A;  1VCB A;  2MRP A;  4KGS A;  4KZ0 A;  3FYH A;  2OOB B;  2IA6 A;  3Q8B A;  3N4M B;  1S0N A; 
#chains in the Genus database with same CATH homology
 3UI3 A;  1B1Z A;  2M19 A;  4DXF A;  4YTP B;  4NJC A;  1CQV A;  3PZ8 A;  3P42 A;  1V8C A;  4YSZ B;  2JQR B;  1F0Z A;  4LLG M;  5HFY A;  3TSS A;  1QOA A;  1JWM D;  1FNU A;  1D6E C;  4IDI A;  4FXC A;  1ZDX A;  2JXT A;  3FIL B;  2QIE B;  3EGR A;  3TUO A;  1YN3 A;  2V3N A;  4ZRP A;  2L32 A;  1GB4 A;  2W55 A;  2WXO A;  4UDU C;  4TMA B;  1XLO A;  2WXF A;  2WXP A;  3ABV B;  2DBY A;  4C7Y A;  1JAL A;  4XWW A;  2WXH A;  1IUE A;  3VRB B;  3KQ4 A;  1KRH A;  3SR6 A;  1FXA A;  1KH0 A;  3AED B;  4L23 A;  4MT5 A;  1E9M A;  2V0G A;  2CU3 A;  2LFI A;  4DXG A;  1TYG B;  2WP9 B;  1ZOY B;  2QEJ C;  2W82 A;  3FC4 A;  3LXF A;  4RGM A;  4ZYS A;  4Q2J A;  4KKJ A;  1JW9 D;  1UGJ A;  1JWS D;  2IGD A;  2SAK A;  1ET9 A;  1EU3 A;  1K50 A;  3FIL A;  4HKZ E;  3IAM 1;  4MM3 B;  4KGT A;  2PKO A;  4TSS A;  3ZYY X;  5BMG A;  1V1O A;  1AN8 A;  2J4X A;  2PIA A;  2CJN A;  3P4R B;  1L6V A;  1MVK A;  1NEN B;  4MH8 A;  2N9K A;  1EWC A;  1V1P A;  3Q69 A;  1XLN A;  2WXM A;  1ZXI A;  3BII D;  3AV8 A;  2I2Y A;  1NI3 A;  2HTM E;  1I4G A;  4GDK B;  4OVZ A;  1VZ7 A;  2OHF A;  4AS1 A;  1JML A;  1VRA B;  2IGH A;  4A6Q A;  4YTN B;  3VRA B;  1KLG D;  2ZW1 A;  1QOG A;  2RDG A;  5JXV A;  2MJE A;  1HA5 A;  5FK9 C;  4XDD A;  3BVG A;  1RM6 C;  3AE7 B;  3BK1 A;  3MC0 B;  3LB8 C;  1Y56 A;  2M0A A;  3V3X A;  4OHJ A;  1EWY C;  3W1S A;  1VDV A;  4AQ7 A;  1SB3 C;  2IDY A;  3PZ7 A;  5AUI A;  3W5V B;  4YTM B;  3MP9 A;  1F2R C;  1T3Q A;  2EEL A;  1IBX A;  4EE2 A;  1JWU D;  2BBC A;  2INP E;  3RPF C;  1ZUD 2;  2JZP A;  1SXT A;  1N60 A;  1SSN A;  3U4E G;  3AMZ A;  1YQ3 B;  1IGD A;  1HZ6 A;  4N58 A;  3N9Y C;  1EM7 A;  2G9H D;  3GP7 A;  3ETR A;  4WIP A;  3SEB A;  1YMH E;  1N63 A;  1ENF A;  3MFG A;  1QLB B;  2WDR B;  1L0V B;  4YWG G;  2XNA C;  4HRS A;  4A55 A;  2BB5 A;  2EKI A;  3NRZ A;  3E56 A;  5AUK A;  1JWB D;  3ZJV A;  4N6E B;  3TEZ A;  1PFD A;  4RGT A;  5G5G A;  1ESF A;  1ROE A;  2BYT A;  3VR9 B;  1SE4 A;  2IPK D;  2HDE A;  1L5P A;  2LEK A;  1FCL A;  1KF6 B;  4ZHO A;  3B9J A;  3DWG C;  1TKY A;  2X38 A;  2K3U A;  1QF6 A;  2YEP F;  1MHH E;  2GB1 A;  1IGC A;  2PTL A;  3BYY B;  5T8I A;  1T5X D;  3NVY A;  1R7S A;  1C4C A;  2Y5C A;  1HXY D;  1RWS A;  1YJI A;  1YN5 A;  2LUM A;  3O13 A;  3P63 A;  4C56 C;  2J53 A;  3AH7 A;  1AW7 A;  1I4H A;  3EA6 A;  1ET6 A;  1AWD A;  4YT0 B;  1ZE3 D;  1YNT E;  2N0S B;  2RDH A;  1D5X C;  3URY A;  1JRP A;  1L6U A;  1AYF A;  5G5H A;  2YEP B;  3P4Q B;  4GDL B;  1QT9 A;  4JWU C;  1Q10 A;  4P16 A;  2WXN A;  1T6B X;  1XXG A;  2LJI A;  5HI1 A;  1K52 A;  3OWE B;  5E6J A;  1XCQ L;  1GPX A;  2KAJ A;  2NTT A;  2DYO A;  5I4D A;  1TKG A;  1TY0 A;  3R2I A;  2WXQ A;  1WRI A;  4J3O D;  4B0E A;  2DLB A;  1NEK B;  4WWM A;  1RFK A;  4NAM A;  1OQQ A;  3AEB B;  3AB5 A;  4ZRQ A;  4JE3 B;  2BB6 A;  2MJ3 A;  4DQO C;  4L1B A;  1N5X A;  4A8X C;  1XCT L;  4GLS C;  4XE0 A;  2INN E;  1VLB A;  1DOY A;  1D5Z C;  4RNA A;  5EE0 A;  3R2T A;  4IKG A;  2BTE A;  2PW9 A;  1I4R A;  1YQ4 B;  4YXD B;  4ARI A;  1UUP A;  4OW0 A;  2Z8L A;  1DYQ A;  2KWD A;  2WLB A;  3SFE B;  5EE3 A;  1N5W A;  2FE8 A;  2ON8 A;  3I57 A;  1B9R A;  1SJE D;  1M4V A;  2LMC A;  3U7Z A;  1ZXH A;  2TSS A;  1K53 A;  5TSS A;  1N61 A;  1TS5 A;  1L0Y B;  1E10 A;  1V1P B;  2BT6 A;  2WXJ A;  3R8B A;  4JX1 C;  4RGO S;  3FAH A;  2G1E A;  5C2T B;  2K9X A;  2ICI A;  4KGR A;  3HVD A;  4RCO A;  1NVI D;  1FEH A;  1C4A A;  1GOZ A;  1UWM A;  5D3D A;  5H8Y E;  1JRO A;  2XN9 C;  3IT6 B;  1YN4 A;  3LYY A;  1HZ5 A;  1SEB D;  3AE8 B;  1I4P A;  3CIR B;  2J42 A;  2OED A;  1A70 A;  1XF5 L;  1MI0 A;  1SE3 A;  2JU6 X;  1TS4 A;  1D5M C;  3IAS 1;  2FBW B;  2B76 B;  2Y3A A;  1K51 A;  2Q5W D;  1KLU D;  4OZA A;  2PMV A;  2J52 A;  3AE1 B;  1ZDV A;  1TZO A;  1LO5 D;  2BW2 A;  1FXI A;  3HRD D;  3IT4 B;  4C80 A;  2L1A A;  2LGI A;  2MH7 A;  2VZK B;  4L2Y A;  4PT5 A;  4JPS A;  1PGA A;  4D2K A;  3TEY A;  3U52 E;  3AEA B;  2WQY B;  3BZD B;  2WXG A;  4C7Z A;  4P6V F;  1FM0 D;  1TS2 A;  1ACC A;  1WYG A;  1HEZ E;  2QIL A;  3TEW A;  2RMM A;  4R3D A;  2WXR A;  1CK1 A;  2QSD A;  3W2D A;  4ZOH C;  1I7H A;  1SE2 A;  3KWV A;  1WXQ A;  4OZB A;  3B2G A;  3J9C A;  1ZP0 B;  1OQR A;  5GXG B;  3NVV A;  4OZC A;  1V97 A;  4KX6 B;  2W54 A;  1KFY B;  5BYS A;  1TJE A;  5HHD G;  3BWU D;  3NZ3 A;  4B0M A;  5EE1 A;  5MPO A;  1J7B A;  1SJH D;  4A90 A;  4WH4 A;  5D3I B;  3NVW A;  2N9L A;  2JX5 A;  4H2A A;  1QIL A;  1PGB A;  3NUH B;  4ZHP A;  5BYR A;  1QQR A;  2ACZ B;  1FNW A;  3GS2 A;  3BK2 A;  3HVZ A;  3KLS X;  3W5U B;  3ZJT A;  2N7J A;  4HKQ A;  1CJE A;  2KQ4 X;  2IJ0 A;  1I4X A;  4MAC A;  1VR9 A;  4N59 A;  2ONQ A;  2I38 A;  2KAC A;  2GI9 A;  2FUG 1;  2WU5 B;  1ZPS A;  2RPV A;  3P1M A;  1EU4 A;  1NYR A;  3Q8F A;  1VZ8 A;  1L4Z B;  2WDQ B;  1DOX A;  2VZK D;  5D7G A;  4RFB A;  1PGX A;  4HEA 1;  3HUI A;  1PYW D;  1STE A;  1UWX A;  4HJG E;  2KN4 A;  2DWQ A;  1FMA D;  2Y5P A;  4WQM A;  2WNM A;  3Q8E A;  5C3J B;  3AEG B;  3P4S B;  1MPE A;  3AE2 B;  2H89 B;  1L0X B;  3MHZ A;  2E3T A;  1PDX A;  1E7P B;  1RYJ A;  2BS4 B;  2AX5 A;  3NVZ A;  2WXK A;  1GAQ B;  5BYQ A;  4ARC A;  1XO3 A;  1YJJ A;  3V05 A;  1HQR D;  1E6E B;  1XEE A;  1I4Q A;  1F2R I;  2V3P A;  3T3N A;  3EUB 2;  1DGJ A;  4M0W A;  2KDM A;  2L83 A;  5BMH A;  3AE6 B;  2LHD A;  3NS1 A;  2SEB D;  2E6X A;  1VZ6 A;  1GB1 A;  3AEE B;  3AM9 A;  3TEX A;  2PVG C;  5BMI A;  1BXT A;  3T3O A;  1JQ4 A;  3BYT B;  1C76 A;  2LHE A;  4O1N A;  5FKA C;  3I9V 1;  3E9S A;  3W9C B;  3RFZ B;  4RH6 A;  1XLQ A;  3B2F A;  4A9A A;  4US9 A;  1C79 A;  1FO4 A;  1P7F A;  1CZP A;  1BUI C;  1FNV A;  2BS2 B;  1C78 A;  1FFV A;  3Q8C A;  3ZGZ A;  3VR8 B;  3ZJU A;  3BVZ A;  2AQ2 B;  1JWA D;  1TY2 A;  1SF0 A;  4IOI E;  4CQN A;  2K0P A;  5H92 C;  3IXS A;  2KMM A;  4HRO A;  4ITK A;  2IGG A;  4REZ A;  2WXI A;  3C8Y A;  3H8H A;  5EE9 A;  1C9F A;  1WWT A;  3ZQ4 A;  3AE9 B;  4XWT A;  1FD6 A;  1WGK A;  3VQI A;  3AE3 B;  2L52 A;  2W3R A;  2M56 B;  2CJO A;  3KWL A;  1OFF A;  1BML C;  1MHX A;  2QMT A;  2PLP A;  2WS3 B;  1KTK A;  2WXL A;  4RF0 A;  2V4I B;  4TQ0 A;  5FR3 A;  3Q8A A;  1QOB A;  2JSV X;  3AE4 B;  1C4P A;  2GRI A;  2NMQ A;  2JYE A;  1TS3 A;  4WUR A;  3DWM A;  3U2S C;  3WCQ A;  1UNS A;  2NTS A;  3SFD B;  4TQ1 A;  3AN1 A;  4LTU A;  1J7A A;  1SBB B;  2AQ3 B;  2QJL A;  1FCC C;  1FRD A;  1JCK B;  4KKI A;  4US8 A;  1XLP A;  3GB1 A;  4RGN A;  2H88 B;  2WDV B;  1QKZ A;  3CWI A;  3BVM A;  1NYQ A;  2MJD A;  1IBX B;  5LNK 1;  4LK0 M;  2R61 A;  4YSY B;  1WSP A;  2PVO D;  1D4B A;  1TKE A;  4YSX B;  2WU2 B;  4NAW B;  3AE5 B;  1N62 A;  1DOI A;  2DYM A;  3AEC B;  4XDC A;  1SIJ A;  1J7C A;  1PUT A;  1L4D B;  1P7E A;  2JWU A;  3PO0 A;  4RF1 A;  3P4P B;  2K22 A;  2K5P A;  3MJ5 A;  1QOF A;  4NZL B;  1F77 A;  2MEK A;  2BS3 B;  1VJK A;  4WAF A;  3AEF B;  1C77 A;  2ZW0 A;  4USA A;  4JWS C;  1FRR A;  2D5G A;  3L4P A;  4KGS A;  1FFU A;  5HG2 A;  1FIQ A;  1E0Z A;  2JYT A;  2AQ1 B;  2W3S A;  3Q8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...