1FFUA

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
155
Chain Sequence
KKIITVNVNGKAQEKAVEPRTLLIHFLREELNLTGAHIGCETSHCGACTVDIDGRSVKSCTHLAVQCDGSEVLTVEGLANKGVLHAVQEGFYKEHGLQCGFCTPGMLMRAYRFLQENPNPTEAEIRMGMTGNLCRCTGYQNIVKAVQYAARKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 45
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1ffuA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ffuA01
1OQQA 1V8CA 1WRIA 1DGJA 1JW9D 4A9AA 3ZYYX 1QOFA 1WXQA 3AH7A 3P4QB 1QLBB 5AUIA 3AEAB 1WYGA 2W3SA 2BS2B 1FO4A 3ABVB 3AE7B 3AEBB 5GXGB 4YSXB 3AE1B 4IDIA 4YT0B 5G5GA 1A70A 1V97A 1ZOYB 2WU5B 2Y5CA 2L83A 4USAA 1SF0A 1JQ4A 1VLBA 4ZOHC 2FBWB 3DWGC 4LTUA 1FXAA 1F0ZA 3NS1A 1YQ3B 4P6VF 3P1MA 2K9XA 1RM6C 2WP9B 4C7YA 5EE9A 2BS4B 3AE2B 2K22A 4N58A 2KMMA 1YJIA 1XLNA 1TKGA 1AWDA 3AB5A 3AE3B 3KWLA 1L6UA 2DWQA 4JX1C 4N59A 1B9RA 1FRRA 2LEKA 2M19A 2W55A 1JALA 2OHFA 1JRPA 4C80A 1UWMA 5C2TB 1TJEA 1SIJA 4YTNB 3SFEB 1WWTA 3AE4B 1ZP0B 1EWYC 1WGKA 2CJOA 2CU3A 1XLPA 3P4SB 3NVZA 4ZHPA 4YSYB 3W5VB 4ZHOA 2WDRB 1PUTA 1J7AA 1RFKA 3VR9B 1PDXA 1TKYA 4HRSA 1I7HA 2DBYA 1KFYB 2WS3B 1DOYA 2N0SB 5EE1A 4YXDB 1J7CA 5C3JB 3AMZA 2ACZB 3AV8A 1AYFA 2W54A 2WDQB 4ITKA 5AUKA 1ROEA 3B2FA 2H89B 1FFVA 1KRHA 1CZPA 1QOAA 3AE8B 1GPXA 2MH7A 2E3TA 2JQRB 3DWMA 5H92C 5MPOA 3ETRA 3SFDB 4YTMB 4US8A 1NVID 2WQYB 3AEGB 5H8YE 4JWSC 3FAHA 4N6EB 1XLOA 2QIEB 5EE3A 2QJLA 1FXIA 1IUEA 3HRDD 2PVGC 1FMAD 3AN1A 3NVWA 1DOIA 2B76B 3AE9B 1JWBD 1TYGB 1OQRA 1N60A 3NVYA 3SR6A 5G5HA 1L5PA 1OFFA 1RWSA 1QOGA 2EKIA 2WLBA 3AE5B 3CIRB 1FRDA 4YTPB 1VDVA 3BIID 2WU2B 3AM9A 2PVOD 1GAQB 1PFDA 3AEDB 3W9CB 2JX5A 1QT9A 3CWIA 1CJEA 4C7ZA 1NYQA 1R7SA 2BT6A 4HROA 1YQ4B 2M56B 3PO0A 4KX6B 2W3RA 4WWMA 3VRBB 2MJ3A 4YSZB 1E10A 4FXCA 2H88B 1N61A 2PIAA 1VJKA 2L52A 2WDVB 4US9A 3EUB2 1L0VB 1JROA 2Q5WD 1E0ZA 1NEKB 1J7BA 1YJJA 1N63A 3LB8C 1E9MA 3B9JA 1N62A 1SB3C 1RYJA 1TKEA 3HVZA 1KF6B 1ZUD2 1N5XA 2G1EA 3B2GA 3RPFC 3HUIA 3AE6B 3P4RB 2CJNA 1XO3A 3LXFA 1NYRA 3FC4A 3P4PB 3WCQA 1QF6A 1N5WA 3AEFB 3W5UB 1NENB 3NVVA 2MJEA 4WQMA 3AEEB 4JWUC 3L4PA 1XLQA 1FFUA 1E6EB 3VR8B 3AECB 1DOXA 1QOBA 3NRZA 3VRAB 1T3QA 1L6VA 2K5PA 1JWAD 2AX5A 2PKOA 2MJDA 3P63A 1ZXIA 2KAJA 1NI3A 5EE0A 1FIQA 1FM0D 1E7PB 2BS3B 2HTME
chains in the Genus database with same CATH superfamily
3QUTA 4XX5A 1D8BA 1XC9A 4A9AA 3Q8EA 2JZBA 2WXMA 2DQNB 1WYGA 5GXGB 2L3ZA 3RULA 2W9NA 3R7RA 2INDC 1FCLA 1TVAA 4LJPB 4EEKA 2O6VB 3UI3A 3GOEA 2W9CA 4P4PA 4RQ8A 1WXAA 4ZOHC 1D9FA 3V6JA 2K8BA 2F77X 3T3FA 8ICXA 2AEHA 3ZJVA 1HXYD 3ZDTA 4JV1A 1F0ZA 3TEWA 2JRIB 2AL3A 3KVFB 3WALA 1S77D 2IYDB 1JWUD 1BMLC 3APCA 3PREA 2JXTA 5KFZA 2YMPA 3C28A 2V3PA 1X6JA 1ZYQA 1XXGA 4YXMA 3KHGA 4FBUA 3ZXVA 2D11A 4BOZB 3IT6B 5ALTA 2FPMA 2ZTEA 3T5LA 2WX1A 3GV5B 5AI8A 3TQ1A 1ZRNA 2XC9A 4IRCA 4MM3A 3M9OB 2J42A 1BPXA 4ARIA 2HBMA 2H3IA 1PUTA 3J9CA 3Q3MC 3BQ2A 2ZVOA 3T5JA 4FHKA 1X6IA 2KTQA 4TQRA 5ALVA 1Q3UA 4WH4A 3N3KB 4DXAB 1LKYA 3AMZA 2BR0A 1XF5L 4LJXA 1ROEA 4M9LA 4YP3A 2N4FA 1GPXA 4DQSA 2HVIA 3M3JA 1A76A 1WCNA 2MA9B 4XDCA 2KO3A 4LDTB 5FR6A 4IC9A 3DVGY 4O3QA 4RF0A 1OEYJ 3PW7A 1R4MI 3NVWA 2KZ3A 3PW4A 2WXQA 3TFSA 2OJRA 1JWBD 2VH1A 4NNJB 4LNKA 2HHVA 2FCNA 3AE5B 1RPLA 2ONQA 4ZDVA 5ALPA 1BUIC 5DGBA 2GLSA 2O2VB 5L83A 1D5MC 3QEAZ 3PSTA 3RRHA 3T79A 4YXJA 4QIWF 1ZQCA 1MFWA 3WK7A 2W3RA 1T3NA 2JH7A 3PVXA 4NLNA 2QSDA 3EC8A 1N61A 4XDDA 3T9LA 3CSFA 5G2NA 2KVSA 2L7RA 1KW4A 4F71A 1YD8U 2PI5A 3NZSA 2DPJA 3VUYA 1Q46A 1EWCA 1SE4A 2ODGA 3HM3A 4O0IA 3QARA 1ZQKA 2QC8A 3DDHA 3P42A 4MGZE 3C0RB 4P0PB 4HJKA 1IYFA 1EXNA 1ZETA 3TUOA 4QW8A 3IHQB 2XNAC 2LM1A 1NNLA 3QU5A 4Y2VA 5J0PA 7ICGA 2BYVE 4BOSC 5KFUA 3PY8A 4CRXA 5KFAA 4I6PA 2IO1B 2DNFA 3OJ4B 1QOBA 4HDOA 3KQ4A 3QZ8A 1NI3A 2LHEA 5AI9A 8ICVA 2VZKD 3T3NA 1P7DA 4M9GA 1VCBA 5HHHA 3HHMA 1NK8A 2ZNVC 3EECA 4WAAA 2IOFK 2JUOA 4G0NB 1QQ5A 1S0NA 1I4GA 2EH9A 4F91B 3N7RC 1L7OA 4RCOA 2BYTA 4RT2A 3GS2A 5AEKB 2W9BA 3TBLD 2C2EA 3IRUA 4DHZE 1NDDA 1ZOYB 3SHQA 2AH5A 4JIOU 1J8CA 4MJSA 3QJZA 4WURA 2ZIVB 5D7GA 2ZPNA 2NTTA 2JWUA 3NS1A 2KFKB 4C8KA 4JGHB 2HDOA 1ZQHA 5EDSA 1Z19A 1JWMD 5KG6A 3NGDA 4F2RA 4N58A 5DB7A 4KSKC 4NAWA 8ICNA 2P6UA 4EEWA 2WNMA 1UA0A 1HZ5A 3RUIB 3E9SA 2MSNA 2AQ4A 2MUTB 2FMSA 4TSSA 3S2AA 4DL7A 4KN7A 1NK6A 4IG7B 4HCPB 5C2TB 1SIJA 4B9NA 3EZ5A 4C4VB 3SFEB 1TKDA 3Q2AC 3SQIA 1EWYC 3NZUA 5ALEA 3D6JA 2K8CA 2DX5B 4PHAA 3VR9B 1L7NA 1F77A 1WGHA 4GXIA 1X66A 3QX7A 1L6NA 3V6CB 1DOYA 4IQUA 4NQKE 2XICA 5C3JB 9ICJA 4J9PA 2LD9A 2HOIA 3GIKA 4KLTA 1KRHA 2HDEA 1F52A 5MPOA 2G0AA 3ETRA 3SFDB 4WJOA 3SU8X 1UPHA 1SE9A 3BS7A 3PSEB 5D49A 1XLOA 2LI5A 2YMMA 2C7NB 3MR6A 3ZLZA 3QHTA 2WAQC 2W8KA 5ALMA 2KC1A 2AWTA 3UMGA 3D2QA 3DBSA 5DPRA 3D2NA 3N30A 4GDKB 2Y9UA 4QZIA 4II3B 4RF1A 3H8MA 2F44A 2KE7A 1JWSD 3C29A 2PJHA 4IWPA 4ED7A 2ZW1A 8ICYA 4LNIA 2LZ6A 1YZ6A 1MQ2A 2Y0SC 4PJ0U 3BZDB 4JMUA 1WFYA 4R8UA 4FLHA 3UPQA 2QDFA 4XWTA 1RYJA 2GMIC 1SJHD 3RJHA 1URJA 5CWRA 3PHWB 1ET6A 1MHHE 2BGWA 3GE3C 2LMRA 3KUDB 5AHXA 2K3UA 2N9EB 1BVSA 2I6XA 4CE6A 2JSVX 1D6EC 3LXFA 3ZUNA 4B6WA 5KFBA 2KHQA 4LCDE 3RB6A 1OUQA 4EBCA 2BQRA 2RHFA 3TSSA 4JWMA 1HJPA 3TEZA 1ZQQA 4YMNA 1UH6A 5ALDA 1IBXB 2ZG6A 4HDQA 4C00A 1S9FA 3DVNU 3GFKB 3PW5A 1RRBA 4YMMA 2HTME 3DHHC 2ZJ8A 3NHEB 2JZZA 5J2EA 4LNOA 3HWTA 5KT2A 2MLBA 3RRGA 3C1YA 2LPEA 1BNOA 5AM5A 1L4ZB 3ABVB 3OSPA 5CTRC 9ICMA 5ALIA 3M63B 2KV2A 2JH1A 1TS3A 3B1LX 4RQ2A 2EAPA 4O3SA 3B0XA 4P0QB 2W9AA 4FN2A 2QHOA 3L08A 1FNUA 3SDLC 4RNOA 3RNBC 4J9KA 2AYOB 4KZCA 2BKRB 2UVUA 4NLCA 3ZDCA 2KD0A 4E74A 4XQ8A 2MQJA 2ZUDA 9ICHA 3K1ZA 3RJJA 2LKYA 7ICNA 4DFPA 2XO7A 3AE3B 2L5YA 2F1JA 2KG5A 1PK1A 4FE3A 5CA7A 1XNSA 2VZKB 5CEHA 1SL2A 2INPE 2KHWB 5KT6A 4ECZA 2DZIA 1Q5WB 1SBBB 1YJ1A 3NY5A 4UB5A 3N28A 4GIBA 1T0RC 1OXJA 1ZQLA 4BXOA 3X23A 1WMHB 4XWWA 4KLHA 5IIOA 3G6YA 4J9SA 3Q8QB 4HRSA 4CO7A 3BVZA 3N9YC 3AU6A 1WRDB 2IO3B 3L16A 4DWIA 2KICA 5DQHA 4M8MA 3G6VA 4C8MA 9ICXA 1CZPA 3DPDA 1NKEA 2J0MA 1ZQZA 3VTVA 2JZ3B 2K6DB 4YTMB 2ZW0A 3KHLA 3AEGB 3ED5A 4FZNA 5C5JA 5KG7A 1WGDA 1UD7A 4C56C 2G07A 2ON8A 4MGKE 3RBDA 4IM3A 2QB0B 1V6EA 3SV3A 9ICVA 3N32A 4HEA1 2N9XA 4JE3B 4NAMA 1ZDXA 2EELA 2PI4A 1KM7A 2RGFA 1BPEA 3CIRB 5CB1A 9ICQA 1KLVA 4O3OA 2WAQF 3BY4B 3OHAA 1GAQB 2G45B 4C7ZA 5KL8B 3GV8B 4ELUA 1SIFA 2OWOA 3T8MA 3VQIA 4OJPA 5J0UA 2J53A 5FKAC 4DQRA 4RM8A 3VTWA 1VJKA 5FR3A 4KLGA 3ENEA 2CPRA 2LXAA 4DDID 4RPXA 3HW8A 4HLEA 1UHUA 3QNMA 8ICLA 2PFQA 2Y0SF 2M8SA 1WI0A 2YLMA 4QZEA 3FYHA 1B4FA 3UQ2A 2R2QA 1X9WA 2OCEA 4IR9A 2Y5BB 2QKQA 1ZQUA 4F4WA 2WXHA 5AKLA 2DENB 1HEZE 4F5OA 1P7FA 3BYYB 3I57A 4FS2A 7ICJA 1LQBA 4C0ZA 1ZQEA 3MBYA 3HILA 5E6NA 4YQWA 3WK6A 5EE0A 5KFIA 3BZCA 1FM0D 3Q3OC 2M17A 4DF4A 4M9NA 3U7DA 5CRXA 1SL1A 1JW9D 5E79U 1FEHA 1QLBB 5AK3A 2FIFA 4B9MA 1FXTB 5KT7A 2BS2B 2MSED 3MR3A 3L0WB 4II2B 3N7PD 1C3TA 3UIPB 2RQ5A 2PE6B 3FKYA 5K4LA 3QUBA 2BCUA 4USAA 4LK0M 3PZPA 4RQMA 5KFNA 5LNK1 1FXAA 4MEMA 4C8LA 4WQOB 4KLUA 2J6SA 1K8RB 4OZBA 2ZUCA 4I29A 2QARB 5AIAA 3GIJA 4X5VA 3KHRA 4KSLC 5DPWA 3H8HA 3RTVA 1C20A 5EOZA 4DQOC 3PV1A 4OJLA 7ICOA 2G4SA 2G9HD 4DOAA 1UWMA 1NZPA 4EBDA 3PO5A 4UASA 1WWTA 2ZZPB 3HIZA 4WWOA 4A3PA 3TAPA 3P4SB 3E0FA 2Y1IA 2E8NA 1ZW7A 3OGUA 3V7KA 5AK6A 2FNJB 4HCNB 3ZNHB 4IRDA 2LASA 2XI9A 2HHUA 1ESFA 3JW0X 5AM2A 4G50A 3AV8A 4RNNA 5AUKA 3K4GA 1E8WA 2H89B 2H3FA 1QOAA 3AXCA 4PS7A 2MH7A 3CNHA 2KZRA 4ED6A 4LNFA 3ZI4A 2WQYB 4RQ4A 5TR5A 4DLEA 3DBLB 1XQQA 3AU2A 5KG4A 3VC8A 4RUCA 4IKGA 1J2NA 2NRZA 3EFUA 5AKEA 3WKCA 2CKHB 2D10A 3FILA 3PT2B 3OTQA 1XS9D 2JU6X 3KYCD 2ZXIA 1NK9A 4P16A 1FEZA 4JWNA 4IR1A 2KKVA 4DS4A 3KLSX 1YT3A 4C8OA 1KLNA 2JZBB 3B08A 3RYTA 3BQ1A 1G6JA 4DSIA 3H7SA 2BB5A 3Q3JA 1F5SA 1C79A 5AKZA 1Z1BA 2L32A 1D8LA 1MQ3A 4NLKA 1UZXB 4J03A 4TQSA 5D6JB 1KFSA 2O6KA 1MC8A 1X1MA 2EZYA 2WF6A 1C9FA 4UB2A 1ED1A 3A0HU 1VRAB 4RU9A 2KQ7A 4O5EA 1GJZA 1EO6A 4EX7A 3AE6B 3LDZE 3V61A 4B9SA 1V49A 1VZ8A 2JR5A 1TGZB 8ICGA 3PPAA 4PL1A 2MJEA 3MHSD 1VJ5A 3M6KA 4TUQA 4IM2A 1S97A 2K6QA 3H8JA 2R8HA 3R9KA 2NTSA 4ARCA 2VIXA 2KDFB 2NYVA 3VR8B 3N1ZC 3LWLA 2K5PA 2QMTA 3EA6A 1LXDA 3IN5A 4BX9C 4MM3B 3QYPA 2KZMA 1UCVA 2YTUA 2R8GA 2I1QA 1S0OA 4P1CC 2HBLA 5ALXA 2Z7JA 5DG7A 2HJ1A 5J2IA 4FADA 2VA8A 1FO4A 5KFHA 3AEBB 4BAXA 4TQ1A 3BDPA 2OEHA 2M0XA 2L83A 1SF0A 4J9RA 1ZQJA 2MP2A 3THVA 3VTUA 1CEZA 2M9NA 2KDIA 3PGEA 2ZIWA 1GUAB 4BJQA 1OQYA 4NWIA 4ANXA 1IM4A 1Z00A 3DBRI 2WP9B 1YN3A 7ICQA 3ZIMA 5G55A 3BWUD 3QC8B 7ICUA 2ZNVB 5KT4A 3KWLA 1K52A 3ZGZA 5AIBA 2DYOA 3K9PB 3ZTDA 5CHVC 4EZJA 1L3TA 4HK2A 2E8MA 4F5PA 3V6HA 2C2RA 3QUCA 4UBBA 5JZEB 5AKKA 5IKCM 3BZKA 8ICMA 2JYEA 1KQQA 4ZHOA 1V2YA 3FDSA 1J7AA 5DDMA 1CUKA 3JPSA 1RXWA 4IM0A 2XK5A 2J7QB 4RZRA 2DBYA 3RFZB 3KTQA 5AKXA 8ICIA 4GB9A 5HNKA 2P66A 2UVWA 2KTRA 1RQLA 4DWFA 3RH5A 2OH2A 1WJ4A 5KFYA 4UAUA 1EUVB 1LO5D 5J0SA 3MHZA 4I2IA 4WJNA 4MF8A 5L1KA 1XU4A 2LMCA 5JHBA 1UBIA 1ZQXA 4UB4A 2W8LA 2JXXA 5EWGA 1P98A 2PPHA 3JPPA 2WXKA 1FD6A 1HUOA 2HHXA 1V38A 1Q10A 3RN9C 2PKEA 3ZDBA 5LLIA 4ANVA 1N60A 4NM2A 3APDA 3HT3A 1NJXA 1KDHA 4NLGA 4P4MA 1WUDA 3KD3A 4B6JA 1IV8A 1YN5A 2WU2B 1F1HA 2MA1A 3I1YA 5LXHA 2HHWA 1M94A 2MBHA 3VUWA 2BHNA 1WR6E 4W9DA 2MJ3A 2NO4A 1NK5A 3DCGA 1ZKHA 2KFJA 2JGAA 2DGZA 4Y2XA 5KG3A 4IS7A 4W9EA 2W9BB 3K75D 1NJYA 5AKJA 3DVNV 4PHPA 4DXGA 4J6IA 4K81A 4MJSB 2KDMA 2CRXA 3HVZA 3GIIA 3L5KA 4WAFA 4YR2A 2W7OA 2KN5A 3TMPB 5KFMA 3OSNA 8ICJA 2XY5A 1E8ZA 4WJQA 2GOLA 2IHMA 1ZE3D 3H0RB 5DBAA 1ZQRA 3QAQA 2C9WB 2QILA 4KKIA 3TARA 4DFKA 2ISPA 3VAWA 2DKZA 4ED0A 5AM4A 2L8JA 2FCMA 4NAWB 5DG9A 3SD7A 1QQ6A 3UQ0A 1AROP 3EPIA 1EF1A 3R3MA 2RD0A 5KAFU 1UT5A 4NJCA 3ZRCA 2M0AA 2XEWA 1NJWA 2K4PA 3MTNB 4ECQA 2ZTDA 1F9JA 3L3FX 2K8CB 3GV7B 5DGAA 3JSVA 2NPTA 5GTHU 2JHDA 1E7PB 1QSSA 1TE2A 1F2RC 4ZH4A 4L2YA 4YMOA 5C23A 1DOQA 1KLUD 3AEAB 2YY6A 9ICSA 2R8IA 4NL9C 4A55A 3Q8KA 2VKQA 1JQ4A 2BKEA 1A77A 4Q8EA 2GBNA 4FBTA 1YZ7A 4Z6EA 5DPSA 3R7QA 4RQ7A 3DBLI 4ICVA 4UAZA 3PX4A 2ASJA 4FA6A 4ICAA 1SKSA 5L1LA 2YB1A 1YQ3B 2KNJA 1WCLA 2OM6A 3I63C 4K1RB 2GWSA 4RFBA 5AZGA 8ICSA 5KFEA 1YJIA 3PR4A 1C7YA 4DFJA 2W11A 3TFRA 2K25A 4W9LA 3TIXA 3ECIA 4TKNA 5J2JA 1YMHE 2KJ5A 4YD2A 1LFDA 5ALLA 3L13A 4MEXA 4TV3A 2Q0ZX 4IC7B 4R8UB 4UAYA 4DS5A 4I2CA 7ICTA 3ISCA 4KLDA 1H4RA 1RFKA 3HK0A 1WJ6A 2LVOA 4NPNA 3ZTCA 4MH8A 5IIMA 3VUXA 4DL4A 4GMVA 1SZHA 1U48A 3PRMB 1J7CA 3EGRA 1SXDA 2LGXA 3H8WA 5BPCA 4JV2A 4W9GA 3AE8B 4AP4C 3HP6A 2AGPA 1WM3A 2E3TA 2V3NA 4UATA 1T0YA 3PW2A 3RB0A 7ICFA 4XA5A 4ELVA 1TV9A 3Q8AA 3GZNI 1GC6A 4PGXA 3KKAC 3A9JA 5B5EU 4BWJA 1PVPA 2IPKD 3IDWA 2B76B 4DF8A 5IA7A 4CCHA 1OFFA 4PPXA 2HE7A 3PRPB 2UU7A 4YCXA 4P4OA 5D3DA 1SZPA 4DOBA 1UT8A 2CHXA 1TBEA 3RBEA 4KVGB 4KX6B 1RZTA 1TTNA 5KFPA 4EYHB 2WF9A 2Z0EB 3AQEA 2N9PC 4TMAB 5IIKA 3TI0A 2YB4A 1R4NI 2KK8A 2W03A 1ZQVA 5AI5A 2WF8A 2KC2A 3VVWB 4ECTA 2IBKA 1TS5A 3P4RB 1ZXHA 3P4PB 1TFRA 2ZPYA 3I3TB 2BDPA 1J0GA 2LJIA 1AQ6A 2ASLA 2WHEA 3TAQA 5AI4A 5KFTA 2I9GA 1V85A 3HM6X 2FE8A 4Q44A 2AQ0A 4DSLA 1FFUA 1RDFA 2A1JB 3V6KA 1COKA 1IPGA 2WXPA 4M02A 4FJYA 3QU9A 3TEXA 2BPCA 5DLGA 4ICUA 4QNLA 4GXKA 4BXOB 2K4HA 2QCZA 3QZ7A 4K7SA 1ZD5A 2FI1A 2WYQA 2KIWA 2IGDA 4RGOS 2NR2A 3WK9A 4UW9A 3WK8A 4PGYA 2GH1A 2W3SA 5ALQA 2BCSA 2V4RA 3G6XA 3HJEA 5L95C 3AE1B 4I2AA 1SXTA 3ZVVA 1SV0C 4O3NA 2L0FA 2N1RA 7ICIA 3Q3NC 5HR7A 1VLBA 5J0YA 4KGRA 4J9NA 4JB3A 2BPFA 3PZDA 3I28A 3NS8A 2NBUA 2KSOA 3QU7A 1XEEA 1KH0A 4BKSD 1JXEA 5HHDG 5E6OA 5LXIB 3IAM1 2INCC 3OPXA 3H7PA 8ICRA 2D3GA 5J2RA 2M19A 2V4IB 1NOMA 2DZKA 4DLGA 2IMWP 2C28A 2DLBA 3HKZF 5KTQA 2LI6A 3MR2A 5IILA 2L05A 4YN4A 1V5OA 5DPTA 1TKYA 1I7HA 1L8OA 3P2BA 1L0YB 1S0VA 4I6NB 4ASWC 3IVFA 3AL0B 2A5UA 4M01A 3RCZA 2W54A 2XCPA 3GU3A 1EU4A 2HTHA 4A90A 4ZRIA 2K39A 2K8HA 4Y2JA 2RDJA 3WU2U 1GOZA 3LWMA 1XCTL 1VZ7A 4KGSA 3TANA 5ALOA 3KZIU 2KVRA 2RDGA 1A0PA 2KTFA 1SWVA 3H4BA 3F2BA 2E8OA 4RH6A 1ZOLA 8ICTA 2MHJA 3CP8A 1WGRA 1OGWA 3ZNGC 2BQUA 1HTQA 4NZLB 2VA3A 1X2IA 1FRDA 3HVDA 3JPNA 1ZQDA 1PVRA 4KKJA 2F3NA 1S1QB 1ZQTA 4B9VA 4O3PA 3L54A 4FBJB 1GB1A 1S5LU 3C1ZA 3EYZA 1PGXA 5ALZA 2N1WA 5D3IB 2FPKA 1WX7A 2YEPF 4HXDA 1JROA 4OHJA 3F2CA 2ZJ5A 4J9OA 1MSWD 2V1YA 5GMVA 4OD0A 1E9MA 2OXOA 2G1EA 5AZHA 3AUOA 4UDUC 3HUIA 3RPFC 2RDBC 2MW5A 2ASDA 3PSPA 1I35A 4GLXA 1QF6A 5J8YC 5J0WA 1UELA 4Z6FA 4QW9A 3QE9Y 1TZOA 2J6TA 1PUZA 2HJ8A 2IBIB 3FM9A 2AQ1B 3RB4A 2A19A 2C7HA 5KFKA 3ZNZB 1PYWD 4M00A 2LYBA 3NRZA 3MABA 9ICIA 3VRAB 1RXVA 1KN5A 3C21A 4F1SA 4MF2A 4XUSA 5JU5A 2DUYA 1A5RA 2K4IA 2BS3B 1OQQA 1UGMA 1MHXA 3BQTA 4WWPA 1TK0A 4DL3A 9ICUA 3A1QA 1C77A 4GOCA 4MACA 2AXTU 3BVGA 1ZD3A 2KT7A 3OHBA 5IO9A 2P6RA 3H4DA 4FHJA 5G5GA 2ZUBA 2DFLA 1GC7A 1V86A 3RZWC 3E56A 2D07B 3LDAA 5H2FU 3F5EA 4U7CA 4ED2A 3CW2C 2JXJA 3PVLA 3CRXA 5TSSA 1FCCC 2LXCA 4O3RA 2K9XA 2W82A 2BKFA 4QJFB 1WZ0A 4K4GA 2YMQA 2O6VA 1F0MA 4W9KA 4BKGA 3RFAA 4W9CA 4B9UA 3UMCA 2L1AA 3QCAA 4EBEA 2P35A 1Z4OA 2KVCA 4FJVB 5CR0A 5BYRA 1KTQA 4YSYB 3W5VB 1UF0A 2F76X 4M0AA 1DYQA 4GDLA 4ACFA 1ZQYA 2I1KA 3A9KA 4K7WA 1SV4A 3ICXA 4IWOA 2DZMA 3LVVA 3ZQ4A 2ZJDA 2FMQA 2PLPA 5D94A 1WM2A 2RDHA 2HI0A 4A8EA 2N7DA 3RJGA 3Q3FA 3D2SA 7ICMA 2WXGA 2AU0A 3PSIA 4P2HA 5J2CA 2WF5A 2CU1A 2J0JA 4DHZB 4R63A 3N20C 1FMAD 1Z1VA 1Z4NA 3U7ZA 2WHIA 1VD2A 4I2EA 2L00B 2BB6A 4J9QA 3ONSA 5CHWA 3LYSA 3T5HA 4M9JA 5G5HA 2D3BA 2CHWA 1PQSA 3O0FA 3TADC 5KNIA 1HE8A 4DL2A 1YX6B 2WB1C 4RQ0A 5KAIU 1R7SA 1PGAA 4PL2A 2AQ2B 2WXFA 2M56B 5J2AA 2CR5A 3PRZA 2OEDA 1ZQMA 4Q8FA 1BPBA 2K4EA 1K5OA 4PZNA 3MDCA 3SAFA 1WR1A 2B0CA 4CF5A 3MR5A 2BF8B 2WGSA 3ZJTA 3CF6E 2O2VA 1YJJA 2MP2B 3ZXRA 5DG8A 3T5KA 1RAXA 2W7PA 1KF6B 2MBEA 8ICUA 3DVGX 5B66U 1NKBA 4W9IA 5E6PA 1XO3A 4ZYSA 4HKQA 2FUHB 1D4BA 3GZFA 4J9LA 1I4RA 3RH4A 2LUEA 1MVKA 3RB3A 2F1HA 2MBOA 1T4GA 2IOFA 1QQRA 2N1VA 3AEEB 4EUTA 3PNCA 3L4PA 4IUMB 1N6ZA 4F4XA 2KMDA 5DBCA 1QLNA 3AECB 4PS3A 1SGHA 2KJ8A 1ZXIA 2N9KA 4NXZA 1HIWA 1XO1A 1ZQWA 2LM4A 1KL9A 5J17A 1I4QA 2XK5B 1V8CA 2KJ6A 3QU4A 4DHJD 3PO4A 2KQ4X 2EKEC 4UQGA 2D2QA 4EFOA 1TS4A 4EEYA 3AE7B 2UVRA 3E58A 4O1NA 2B21A 1E90A 4YR0A 4ANUA 4EE2A 1TY2A 5JUMA 1JMLA 2JEIA 3PZ8A 4CYEA 4FZLA 4ED8A 4LVSA 4CGZA 9ICKA 4MFAA 1ZD2P 2F2AB 8ICZA 3C8YA 3R8BA 1WWVA 5J2KA 3ZDAA 1STEA 4NLBA 1MN8A 3U4EG 5J0OA 2UYZB 5J2FA 4JX1C 4N59A 9ICCA 2RSUA 3IHPC 4CQNA 2MAXA 2YMLA 3EW9A 1QTMA 3ONNA 4Y2QA 4YTNB 2KN7A 2IY1B 4GIVA 1UQVA 3ZKJC 5AM3A 2BWES 3C2LA 5ALWA 4XYCA 1SSNA 1WE6A 4Y2SA 1SEBD 2NRXA 5ALJA 4DEZA 1YNTE 4C4VA 4F92B 1ZGUB 2WDQB 5BO4B 3LK9A 1E8XA 4I2JA 1WH3A 4XZ4A 4PHDA 2ZIUB 3VFKA 4WIPA 2EQYA 1JIHA 2ZIXA 4RQ1A 2RDIA 3HRDD 4G11A 2MU2A 1TY0A 2GI9A 3RI7C 3AE9B 2PIAA 2I2YA 3JSVB 2GLEA 1XO0A 2NPTB 2KP7A 1S0MA 2WDTB 2FMPA 4MFFA 3Q14C 3RNGC 4QZGA 3W9CB 4M9HA 1ZRMA 1RFAA 2BT6A 3F2DA 1IXRA 2L76A 4RNAA 7ICEA 1BPZA 2V4QA 2V9WA 1E5WA 2WXOA 3IFWB 2H88B 3MJ5A 4FXCA 1IP9A 3VH4B 4PK1A 2WB1F 5E6JA 3PX6A 3EUB2 3EFCA 2BBCA 2BW2A 1NEKB 4LNNA 4J9MA 2LJ5A 5HMMA 3VHTC 1S8OA 2HMXA 1L3SA 1L5UA 1SB3C 3M7DA 2KANA 4O9MA 3JPTA 3RZFA 1N5XA 1TAMA 2G06A 2N7EA 2VA2A 2FUG1 5HKHA 3MGIA 3WKEA 1WGGA 2PE9A 4B95A 9ICGA 1ZQSA 3AI5A 5HHIA 4REZA 2J0KA 2LRUA 4NJ8A 2KIVA 1ZQBA 1T8EA 1FPYA 1F44A 4HWIB 4P1BC 1L3UA 3M6ZA 2E1FA 5KFVA 5ALFA 3QA8A 4PT5A 3ZD8A 1AW7A 4X57B 4JWUC 3OLMD 3SYZA 7ICSA 4AJYB 4MHVA 4XRHA 2AX5A 5KT5A 3W1SC 5J2GA 1UGJA 2W9CB 2GBMA 1JMSA 1YOVB 1B1ZA 3UIOB 2BCRA 2K8BB 3OWEB 1JRUA 4YL8A 4BFRA 3SMVA 5AUIA 4EENA 5DCNA 4GC7A 5JHAA 4LZDA 1IBXA 4JUZA 1SKWA 3MFHA 1J2MA 4IW0A 3AULA 4ZYNA 3C19A 2LGYA 1C1YB 4ECXA 2LBOA 2KKCA 2GOWA 2KDBA 3SV4A 7ICVA 4LTUA 3A33B 4KLOA 2VANA 4A8XC 2F8KA 3M9MB 3A9JB 4W9HA 2KLGA 4IQVA 4A20A 2L0TA 4EZ6A 4PS8A 4YWGG 2KMMA 3MP9A 3D32A 9ICNA 1HQRD 1KOTA 1C4CA 2E6XA 5D4BA 2UVVA 1L6UA 2PMZC 1FRRA 5ALGA 3ISBA 2I1JA 3BS5A 2OHFA 4CF3A 1LKYB 1WJUA 2K89A 1HZ6A 4DHJB 3ZJUA 4O3MA 1ZP0B 4AQ7A 3IBEA 3MC0B 4RQNA 3KWVA 2MX2A 1OW5A 3NASA 5J0XA 4KV2A 4K4IA 2HVHA 2RR9A 3IG5A 5KG0A 1N56A 2BGFA 5GTIU 2ACZB 4ITKA 2J52A 2EZXA 1T0SC 1UWXA 1Q0WB 2HOQA 4JWSC 1L7YA 4M6WA 4MEYA 2QJLA 3PMNA 2IO0B 4GXBA 5L1JA 2DAFA 2EZZA 3UXOA 3O65B 2WXLA 1UA1A 3NVYA 1RWSA 3N97B 5D2MB 3AM9A 3QEBZ 2PVOD 3EHVA 2PFOA 1CJEA 4RQ6A 3KYDD 1JN3A 1X9XA 2QB0A 2Y5PA 4M04A 1QSLA 5ALUA 4IOIE 2JMGA 1WX8A 2KWCA 2FIDA 2WDVB 4B9KA 3UQBA 5JRTA 1J7BA 2UWQA 2KMAA 4KTQA 2G5IB 5BYSA 3V62A 3PTFC 5AK5A 1GG3A 1QKZA 2RP5A 4AS1A 7ICRA 2YN4A 2KSOB 2MRLA 1BPYA 4HVBA 3H40A 4DSFA 2YQEA 1DXSA 3KH0A 3JYUA 2MBQA 3IG8A 1E7UA 3N1YC 5I4DA 3SI8A 5IP4D 3N1XC 4RM9A 2FCQA 3H7PB 3WAOA 1XWLA 2PFPA 3ZRFA 2C5LC 4NL9A 9ICWA 4M0WA 1Y8RC 3NTUA 4FJZA 1B22A 2K60A 2INNE 1L0XB 1T3QA 2IA6A 1JWAD 4F72A 9ICBA 3GE8C 3WAPA 1FIQA 1KRPA 1QILA 2FLNA 3IXSA 4ANWA 3W2DA 1I42A 3IT4B 1RYRA 2KJ9A 4NV0A 7ICLA 2GO7A 1KFTA 1ZQPA 1A70A 4MDKE 4JK1A 3LVWA 2LGDA 4O5CA 3ORYA 3DQVA 4DQPA 2IGHA 4MSQB 3UQAA 4NY0A 9ICAA 1RYSA 4DL6A 3QX1A 4Z6DA 3Q8LA 3WK5A 3TEYA 2AGQA 4GU2A 4YTPB 1M6YA 1BPDA 3BVMA 3RNCC 2DKXA 3I76A 9ICPA 4B9LA 3ZNID 3RNAC 1Z2MA 3Q8CA 4RPYA 2XVTA 3RJIA 2LWPA 4M47A 1V9JA 4HJGE 3X0WA 4QWEA 3I9V1 1SJED 5KHOA 4XC2A 4WJPA 4WWNA 4GC6A 3UXPA 4QIWC 1JX4A 1QQ7A 3Q8MA 4QWCA 2OOBB 2V3SA 2CJOA 2MRPA 2PMZF 3V60A 2VJ4A 3S6JA 1YIWA 2JEFA 2KD1A 4QZFA 2KKPA 2I38A 2KXJA 3KKAA 5CJ7A 3IG3A 4B0EA 4O5KA 5EE1A 5IAAC 3K1RB 5AKGA 2NBVB 4YXDB 5ALNA 5HFYA 4I2BA 3MGVA 4I6LB 2A1AA 2LFIA 3BINA 1JCKB 3NUHB 4S17A 1B43A 5KG1A 1NK0A 2CXYA 3UF8A 4N6EB 3U8ZA 3U52E 1WIAA 8ICKA 3ZW3A 5L9XA 3OG5A 1ZDVA 1MI0A 4QZ9A 5T8IA 8ICFA 3RMKC 2HBJA 3DV9A 1TYGB 1PZNA 4KX3A 4F4KA 4EOYA 2HW3A 3IP4B 2NV3A 4QZBA 4MGYE 3AEDB 5DBBA 4F4YA 1MG8A 1QT9A 2JX5A 3PSFA 1NYQA 3A1QB 4YSZB 3UMBA 4QZ8A 1E10A 4OO1J 2HHSA 4DFDA 3SEBA 3WKAA 2XGPA 5KFQA 4KIKA 2BWFA 1MA7A 1L0VB 4RGTA 2JY6A 3W1YA 4TUPA 2JZPA 4F3OA 2Y9TA 3SZ2A 3PV8A 1TKEA 3RJEA 1L4DB 3O13A 2WTFA 2Z59B 4JLCA 4NQLB 2CS4A 3ML8A 7ICPA 2FJ6A 1XCQL 2BVCA 4DQIA 4AJWA 4F4ZA 4YFKA 2G08A 4R64A 1SKRA 2PEAA 5DB6A 2X38A 1CMXB 4YVZA 2KOBA 5L1IA 1EU3A 3WANA 1ZJNA 2V4LA 4G9BA 1XLQA 1TK5A 8ICOA 3RT3B 4C8NA 4KLJA 1SV0A 4N9F4 2MJDA 1NK7A 1WE7A 1KKXA 5ALHA 4GDLB 2C60A 1K51A 2WXRA 1WRIA 3C2MA 1PVQA 1KLGD 3A9KB 4UB1A 1YQBA 3OAWA 2G09A 4G3XB 4H2AA 1P3QU 4BUGA 2WXNA 3LJ3A 2FAZA 4EELA 1U4BA 1SE2A 3MGHA 4PYZA 4YSXB 4IDIA 8ICWA 4K7UA 2I5HA 1ZJMA 1T7PA 2NMQA 1V97A 3I5JC 2G4DB 2WU5B 3RR8A 2Y5CA 4DO9A 1K50A 5AKHA 4ZRKA 3MFGA 1Q8KA 2FDRA 3IM1A 4DBGA 1PK1B 5HMLA 2FLPA 2KJRA 4KLFA 2B6GA 4IL6U 3M9NB 2NS5A 3QUQA 1ACCA 2BS4B 3NUQA 2G3QB 2K22A 2PTLA 2DZJA 2FCSA 3L10B 1U9LA 1AWDA 3ZO5B 4PH5A 3WA0A 3N7SC 4Y2RA 1I4HA 4C80A 3SEIA 1ET9A 4PHEA 1ENFA 4ECVA 4JPSA 5AICA 1LM8B 4IRKA 3AE4B 2WWZA 2NRVA 1RQNA 2IDYA 1XLPA 3M95A 1JUDA 2DYBA 4F7ZA 2JV3A 9ICTA 2KHVA 2GB1A 5F9LA 3Q69A 3TCAA 4GFJA 2KX0A 3RAQA 2KN4A 2FE9A 5FP0A 2V0GA 1FFVA 2W04A 2AHOB 4C4SA 3DWMA 5H92C 2WXIA 3H0MB 1K1SA 4US8A 1ZQGA 1HTOA 3R66C 1XSNA 4I2HA 1C4PA 3ALBA 3PLVA 1IUEA 2KJHB 1Z3EB 2DPIA 2PVGC 1WJNA 5F3XB 4BGDA 4M2YA 1V9PA 5KT3A 1DGSA 1L8LA 2EKIA 2ICIA 2W9MA 5ALYA 1P7EA 5AM0A 3BIID 3MFIA 4MGIE 4YT0B 4Y2TA 2BQ3A 2ALZA 4F8CB 1D9DA 5AI6A 4YR3A 4DL5A 5T14A 5J8YA 2AGOA 5CX3A 3KOOA 1N48A 4HKZE 1E8YA 2LRWA 1BXTA 1TT5B 1X42A 3UINB 4I2GA 4URKA 2XCAA 2H5XA 4KMOB 2EMTA 2V9HA 1N62A 2XBBC 2REXA 2R61A 3H6NA 3B2GA 4BZAA 2FPLA 3HX0A 4A3OA 3UGBB 2BYFA 2CJNA 2QLTA 4OZCA 5CP2A 2XY7A 2R2OA 1NBFC 5FK9C 1N5WA 4D2KA 1NENB 1IIPA 3NVVA 4C4RA 2MCNB 2XN9C 5DDYA 2D5GA 1KTKA 5D46A 1WY8A 7ICHA 1NI2A 3P63A 3L17A 5C0YA 3CYMA 3KUCB 5CHFA 4KN4A 3BQ0A 2KWVB 5HR6A 5KL1B 4HPPA 4QAYA 1AN8A 2YEPB 1ZQNA 2CHZA 4RT3A 9ICFA 3C23A 3UM9A 2HHQA 4S0RA 1CRXA 2Z0DB 4E71A 4RGNA 1TAUA 2Y3AA 4I2FA 1S76D 2DL0A 5AI0A 2NRTA 2BQQA 1I4XA 5HG2A 1X9MA 2ZIXB 4I2DA 3V05A 3ETLA 4Y2YA 5KFDA 5J2BA 4NLZA 1K53A 2XY6A 1V1PA 1U45A 4OVZA 3TL5A 4FULA 4IQTA 2QB1A 2M1MA 2D6FC 1QZEA 1NJZA 2SEBD 4EYIB 4GXJA 1CI4A 3M62B 3PZ7A 2AQ3B 3AB5A 3JPOA 2D3CA 3GP7A 1P1AA 1L7MA 1D5XC 4WJ3B 1T0QC 1H8CA 2HBKA 4OVUA 3NG0A 4J3OD 2LHTA 4E3CA 3BYTB 4B0MA 3AU4A 3C5GA 2F8LA 3SD5A 4F5QA 5EWFA 1QCKA 4MSMB 5IN7A 2RMMA 2JRZA 2N0SB 5BMIA 3RNEC 4AOFA 1L7PA 4UB8U 1KBUA 1S10A 3FILB 3TADA 5BYQA 4RQ3A 4IQWA 2KWUB 5C1ZA 1NVID 1B0XA 2BCQA 2QIEB 2BDUA 5KHQA 5KG2A 5IINA 4DFMA 5J29A 3A0BU 3NOBA 4F8RA 4NJ6A 1OQRA 2EDUA 1U4AA 3OJSA 1KJTA 4BKTA 3H7IA 2LYHA 1YN4A 3WAMA 1GO3F 1VZ6A 3Q8PB 3F5AA 2MBBB 1ZPSA 5KFLA 2Q4TA 3CMMB 4HROA 1YX5B 1FNWA 2D3AA 5AM1A 1SE3A 5AKYA 3GDXA 1Q1OA 2L52A 2JWZA 2IOHA 1IG6A 5HI1A 4JV0A 1AARA 3KW5B 4TQ0A 3ZDDA 1N63A 3NRWA 3K9OB 3SENA 5KFSA 4RUAA 2EAOA 1JXLA 1EM7A 2YVCA 1J97A 4QZAA 2KYWA 2E1EA 5L1MA 5F9NA 8ICAA 1TS2A 4ELTA 3Q8FA 3QWZB 1COOA 4RNMA 1IGDA 1Z5SB 4BWMA 2FLLA 2IY0B 4AYBC 5BOLA 2WXJA 3GB1A 3ZDEA 5KFCA 3RNFC 3BS5B 2IJ0A 1V1OA 1E6EB 3RD2A 9ICOA 3VH3B 4RPZA 1L6VA 4Q2JA 4RGMA 3SAHA 2PKOA 2K1FA 1ISNA 2BPGA 9ICEA 4HPMB 1L2NA 1UBQA 4ECYA 2LYAA 4PYUA 1SGGA 4YG2A 1C4AA 2M0NA 2D8CA 1DGJA 3RJKA 2JEJA 1QOFA 3P4QB 1ZD4A 1OEYA 2A1JA 3TKAA 2ZIWB 1DRGA 1MJDA 3ML9A 1KSPA 1Z00B 1OTRB 5DLFA 2G5HB 2JVCA 3V72A 4M6WB 3DWGC 5A0LA 4CHKA 1SL0A 3TACB 4P0PA 3GIMA 4P6VF 7ICKA 4A6QA 4ED1A 3MC8A 5TZVA 3MC1A 5EE9A 3MDAA 4JL9A 1H38A 4MT5A 2JF5A 4GLSC 4R65A 5DB9A 2DWQA 1SWWA 2PW9A 2LEKA 2MWSB 2W55A 1JALA 4DSKA 1WGYA 2QEJC 5IOIA 2LHDA 5ALSA 1TJEA 2KTRB 5KFOA 3DBRB 1T94A 3VCBA 4ED3A 2CU3A 1K1QA 5ALRA 1PDXA 3PR5B 2WS3B 3N4MB 2GRIA 3WK4A 2XIDA 5HP4A 2EAMA 4DDGD 3F53A 8ICQA 4PGQA 1D5ZC 4LJOB 3B2FA 3DOWA 3KBBA 4EX6A 1BT0A 1CK1A 5J0TA 1FNVA 2AL6A 2KOXA 2OYYA 2W43A 3QQ8B 2GBKA 3AQFA 3FAHA 4EZKA 1ECWA 2VJ5A 5EE3A 2ZIVA 4M0WB 2A3VA 3QIJA 3WKBA 4QWDA 2KFKA 2NCNA 4OCZA 4NY8A 1MG4A 1V81A 2ZCCA 1QOGA 2ISOA 1WZ3A 3ISDA 1LV5A 4UB6U 9ICRA 1UUPA 2R18A 4TURA 4ECUA 2ESEA 1PFDA 2ZVNA 3CWIA 2NO5A 4G3IA 3JPRA 4NJ7A 3R2TA 1YQ4B 8ICHA 4KLIA 2MUTA 5EWEA 3IAS1 3IV6A 2K0PA 3GQCA 1N2XA 4HPLB 4L1BA 4F5RA 2PMVA 1NK4A 4ZRJA 3LB8C 2KNBA 3ZDMC 2GBJA 4GSWA 3RF9A 5J0RA 3V7JA 9ICLA 3H9DA 2JRHA 1RG6A 1XSLA 2N9LA 3W1SA 4FS1A 1RLFA 3WCQA 3FC4A 5TISU 3A4RA 3Q6BA 3AEFB 1HA5A 5JTIA 4TUSA 3PHXB 2C2DA 2BTEA 2KVZA 3RR7A 4RMAA 2DF4B 1XSPA 1ZQOA 3A4SC 4Y2PA 1QSYA 2KZZA 1CQVA 1PGBA 2B3AA 4BDPA 2DAJA 4AYBF 3R2IA 4R3DA 3HPOA 3RJFA 2D3DA 3PW0A 4GDKA 5J2HA 1TAQA 2BPSA 4I28A 4CF4A 2KWDA 3NZ3A 1WXQA 2X8XX 1EF5A 4Z6CA 5DQIA 2WX0A 2DYMA 2KACA 2Z8LA 4MELA 4Q43A 1KEJA 3KFUF 4UAVA 2FBWB 5ALKA 3E2EA 2KLCA 8ICBA 3VDZA 3DBHB 2LGSA 1IGCA 1P9DU 2BYEA 4F93B 3P1MA 1BNPA 4XGAB 4C7YA 3VXWA 3AE2B 4K3BA 3AU5A 1U49A 4KLQA 5J0QA 2BZFA 2HCFA 2EMSA 3C5FA 3H0LB 3KUZA 1TIFA 4F2SA 4DK5A 4FZMA 5JH5C 1JRPA 2C22A 4QWAA 1WXSA 4YD1A 1I4PA 1L3VA 4KIKB 3U2SC 1WGKA 2WFAA 3V6EB 2WDRB 2ZTCA 3OJ3A 3ZD9A 8ICCA 2KDEB 3URYA 4EZ9A 1KFYB 1T5XD 3EWAA 5KFXA 2F1IA 4UB3A 2RRDA 2BCVA 1AYFA 2VRRB 1J19A 4KMUA 3OJUA 2M4NA 5BMHA 2IO2B 2LGIA 4KLSA 2ZEQA 1XT9B 2LVQA 5AK4A 3DHGC 1V80A 1LVHA 4CDGA 4QZHA 4KLMA 1FXIA 4KDLB 3V3XA 4P0QA 4HAIA 1T6BX 5AKIA 5KFFA 5BOMA 3BK2A 4BBNC 4F5NA 1DOIA 1P0RA 1X40A 3SAGA 3SR6A 3U26A 1L5PA 1U47A 2HOFA 3H1UA 4OJ5A 2ES6A 4DXFA 3BJYA 2KEYA 4BKSA 3GZNB 2XGQA 1O03A 2KQSA 1HUZA 3PLUA 3Q8BA 4WWMA 1B9RA 3PO0A 4P7IA 5AZFA 4K3CA 4EKUA 1WX9A 4BVUC 2N7JA 3RAXA 2PXIA 2DHZA 1HEKA 2ZXHA 1ZQFA 1C76A 2Q5WD 3WIMA 1WMHA 1S3SG 3WKDA 4DCCA 4KZ0A 3PX0A 4UARA 3QU2A 3BK1A 3B9JA 2ATLA 2EANA 1ZQIA 2LVPA 4F50A 1BGXT 1MPEA 2O6VD 2ASQA 1WYWB 2E5SA 2NBWB 2JYTA 4IWQA 3PMLA 1XD3B 4OW0A 2IHNA 4XE0A 3W5UB 1V5TA 2H3QA 4RQ5A 1R4NB 4AUQC 1QH9A 1GB4A 4WQMA 4W9FA 4U6PA 4CNQA 3M8RA 2ZCBA 2KMCA 1R4MB 2GBRA 1WSPA 4NM1A 1DOXA 3KHHA 2KX3A 4ZRQA 2KFZA 4GN1A 1LGRA 4EZLA 2KAJA 3DDCB 4M8NA 5DKWA 4UBCA 2HHTA 2TSSA 3H8SA 4KLEA 4OVVA 3ZYYX 1KFDA 3AH7A 1VR9A 3UXNA 2J4XA 1F2RI 4FFDA 4ZRPA 5KFRA 5IIIA 4QZCA 4OZAA 5KFWA 2CN1A 3PS6A 3Q8RB 1GNUA 1C78A 3CSTA 5BMGA 1Y56A 3TJPA 4HYKA 4ECWA 1RM6C 1SXEA 2NRWA 2JT4B 3MJWA 4LDTD 4KLLA 3EPGA 4KITB 2C7MB 3GILA 1XLNA 1TKGA 4GGQA 2HSZA 1JI7A 3JPQA 3APFA 1RYUA 2HD5B 4DOCA 3Q8SB 3RH6A 1Y88A 4AP9A 4Q45A 2IZVB 4W9JA 2VH2A 3KZXA 5IIJA 2R8KA 4ECRA 3NVZA 4ZHPA 2OJWA 5KG5A 4KX5A 1WXMA 5KFJA 3U30A 2H3ZA 2KK0A 2YX8A 3DEEA 4QWBA 1D3ZA 5KFGA 4B9TA 4MH0E 4ACOA 4L23A 1PK3A 2K8AA 1WF9A 1TZ1A 3DHIC 2JEGA 2JQRB 3M8SA 2R8JA 3NJTA 5H8YE 1WWUA 4OJOA 4ECSA 4DSEA 3AN1A 1WXVA 1Q3VA 2PFNA 3C2KA 2J6UA 4QZDA 2WLBA 2H3VA 2ZIUA 2QARA 3QXGA 4R66A 1A6SA 5DB8A 3MC9A 1VDVA 2A4ZA 1ZQ1C 4BBNF 3M1YA 2ZJAA 1E7VA 4PZOA 4TUUA 3VRBB 4DQQA 2IGGA 3QK0A 1X9SA 2RPVA 1TK8A 1NZBA 2RPQA 4E0DA 2JPHA 2SAKA 1DK3A 4UAWA 2NVUI 4K4HA 4DSJA 3B0AA 3LYYA 4AWJA 4KGTA 2AJQA 4C4TA 4US9A 1UNSA 1DK2A 3JVZX 1E0ZA 2WF7A 4KDIC 5J2DA 2LUMA 5JXVA 4LZGA 1V1PB 2RLTA 1D8YA 3B0YA 1ZUD2 3V7LA 3DBHI 1LB2B 4FO6A 1NYRA 5DQGA 4JQWC 3J81j 2KFNA 2MEKA 1M4VA 3ALRA 8ICEA 4Y2UA 4MFCA 1O08A 1ZQAA 5J18A 4OJ6A 1NKCA 4I27A 8ICPA 5CHGA 2Y1JA 4LLGM 2E8PA 3T3OA 3AEVA 3BQ7A 3HKZC 1WG8A
chains in the Genus database with same CATH topology
1AN8A 2YEPB 1V8CA 4A9AA 3Q8EA 2WXMA 2KQ4X 4RGNA 1WYGA 1FO4A 1TS4A 2Y3AA 3AE7B 3AEBB 5GXGB 4TQ1A 1FCLA 4O1NA 3UI3A 1I4XA 5HG2A 4EE2A 2L83A 1SF0A 1TY2A 4ZOHC 3ZJVA 3V05A 1K53A 1V1PA 1HXYD 1JMLA 1F0ZA 3PZ8A 4OVZA 3TEWA 3C8YA 3R8BA 1JWUD 1BMLC 2WP9B 1YN3A 1STEA 2JXTA 3BWUD 2SEBD 2V3PA 3U4EG 3PZ7A 1XXGA 3KWLA 1K52A 2AQ3B 3AB5A 3GP7A 4JX1C 4N59A 3IT6B 2DYOA 1D5XC 4CQNA 4J3OD 4YTNB 3BYTB 4B0MA 2J42A 2JYEA 4ZHOA 4ARIA 1PUTA 3J9CA 1J7AA 1SSNA 2DBYA 3RFZB 2RMMA 2N0SB 1SEBD 5BMIA 4WH4A 1YNTE 3AMZA 2WDQB 1XF5L 1ROEA 3FILB 1LO5D 1GPXA 5BYQA 3MHZA 4WIPA 1NVID 4XDCA 2LMCA 2QIEB 4RF0A 3HRDD 3NVWA 1TY0A 2WXQA 2WXKA 1FD6A 2GI9A 1Q10A 3AE9B 1JWBD 2PIAA 1OQRA 1N60A 2I2YA 3AE5B 2ONQA 4YTPB 2YEPF 1BUIC 1YN4A 1YN5A 2WU2B 1D5MC 1VZ6A 3W9CB 1ZPSA 2BT6A 4HROA 4RNAA 2W3RA 2MJ3A 1FNWA 2WXOA 4FXCA 2H88B 2QSDA 3MJ5A 1N61A 4XDDA 1SE3A 2L52A 5E6JA 5HI1A 3EUB2 2BBCA 2BW2A 1I4QA 1NEKB 4DXGA 4TQ0A 1N63A 1EWCA 1SE4A 2KDMA 3P42A 3HVZA 1SB3C 4WAFA 1EM7A 1N5XA 2FUG1 3TUOA 1ZE3D 1TS2A 3Q8FA 2QILA 2XNAC 4KKIA 4REZA 1IGDA 4NAWB 2WXJA 3GB1A 4PT5A 1AW7A 4JWUC 2IJ0A 1V1OA 4NJCA 1E6EB 1QOBA 2M0AA 1L6VA 4Q2JA 4RGMA 2AX5A 2PKOA 3KQ4A 1NI3A 2LHEA 1E7PB 2VZKD 1C4AA 1F2RC 3T3NA 1UGJA 4L2YA 1DGJA 1B1ZA 1QOFA 3OWEB 3P4QB 1KLUD 5AUIA 3AEAB 1IBXA 1I4GA 4RCOA 2BYTA 3GS2A 4A55A 1ZOYB 1JQ4A 4WURA 5D7GA 3DWGC 4LTUA 4A8XC 2NTTA 2JWUA 3NS1A 1YQ3B 4P6VF 4A6QA 1JWMD 5EE9A 4MT5A 4YWGG 4N58A 2KMMA 3MP9A 4RFBA 4GLSC 1HQRD 1YJIA 1C4CA 2E6XA 2WNMA 1L6UA 2DWQA 1HZ5A 1FRRA 2PW9A 3E9SA 2LEKA 2W55A 1JALA 2OHFA 2QEJC 4TSSA 2LHDA 5C2TB 1TJEA 1SIJA 3ZJUA 1HZ6A 1YMHE 3SFEB 1ZP0B 1EWYC 4AQ7A 2CU3A 3MC0B 3KWVA 1RFKA 3VR9B 1F77A 1PDXA 4MH8A 2WS3B 2GRIA 1DOYA 1D5ZC 1J7CA 5C3JB 3EGRA 2ACZB 4ITKA 2J52A 3B2FA 3AE8B 1KRHA 2HDEA 1CK1A 2E3TA 1FNVA 2V3NA 1UWXA 5MPOA 3ETRA 3SFDB 4JWSC 3Q8AA 3FAHA 1XLOA 5EE3A 2QJLA 2WXLA 2IPKD 2B76B 3NVYA 1OFFA 1RWSA 1QOGA 4GDKB 1UUPA 4RF1A 5D3DA 3AM9A 2PVOD 1JWSD 1PFDA 3CWIA 1CJEA 2ZW1A 3R2TA 4KX6B 1YQ4B 2Y5PA 3IAS1 2K0PA 4IOIE 3BZDB 2WDVB 4L1BA 2PMVA 4TMAB 1J7BA 3LB8C 5BYSA 4XWTA 1RYJA 1SJHD 1QKZA 1ET6A 1TS5A 1MHHE 2N9LA 4AS1A 2K3UA 3W1SA 3P4RB 1ZXHA 2JSVX 3LXFA 1D6EC 3FC4A 3P4PB 3WCQA 2LJIA 3AEFB 1HA5A 2BTEA 5I4DA 3TSSA 2FE8A 4M0WA 1FFUA 3TEZA 2WXPA 2INNE 1CQVA 1PGBA 1L0XB 1T3QA 1IBXB 3TEXA 1JWAD 3R2IA 4R3DA 1FIQA 1QILA 3IXSA 4RGOS 2IGDA 3W2DA 2KWDA 3IT4B 3NZ3A 1WXQA 2W3SA 1L4ZB 2DYMA 2KACA 2Z8LA 3ABVB 3AE1B 1SXTA 1A70A 1TS3A 4KGRA 1VLBA 2FBWB 2IGHA 1FNUA 1IGCA 3TEYA 3P1MA 4C7YA 1XEEA 3AE2B 1KH0A 3BVMA 5HHDG 3IAM1 3AE3B 3Q8CA 2M19A 2V4IB 2VZKB 1JRPA 4HJGE 2INPE 3I9V1 1SJED 1I4PA 2DLBA 1SBBB 3U2SC 1WGKA 2CJOA 2WDRB 4XWWA 1TKYA 2I38A 1I7HA 4HRSA 3URYA 1KFYB 1T5XD 1L0YB 4B0EA 3BVZA 3N9YC 5EE1A 4YXDB 1AYFA 2W54A 5HFYA 1EU4A 4A90A 1CZPA 5BMHA 2LFIA 2LGIA 3NUHB 1JCKB 4YTMB 2ZW0A 3AEGB 1GOZA 1XCTL 1VZ7A 4KGSA 4N6EB 3U52E 3ZGZA 2RDGA 1FXIA 4C56C 3V3XA 2ON8A 1ZDVA 1MI0A 1T6BX 5T8IA 3BK2A 1DOIA 4RH6A 4HEA1 4JE3B 1TYGB 4NAMA 1ZDXA 3SR6A 1L5PA 2EELA 4NZLB 3CIRB 1FRDA 3HVDA 4DXFA 4KKJA 1GAQB 3AEDB 2JX5A 1QT9A 3Q8BA 4C7ZA 1NYQA 4WWMA 1B9RA 4YSZB 3PO0A 1GB1A 1E10A 3SEBA 1PGXA 3VQIA 2J53A 2N7JA 5D3IB 5FKAC 1VJKA 5FR3A 1C76A 1L0VB 1JROA 2Q5WD 4OHJA 4RGTA 2JZPA 1E9MA 3BK1A 3B9JA 1TKEA 1L4DB 3O13A 2G1EA 4UDUC 3RPFC 3HUIA 1XCQL 1MPEA 2JYTA 1QF6A 4OW0A 4XE0A 3W5UB 2X38A 1TZOA 2WXHA 1GB4A 1EU3A 4WQMA 1HEZE 1P7FA 2AQ1B 3BYYB 1XLQA 1PYWD 1WSPA 3I57A 1DOXA 3NRZA 4ZRQA 3VRAB 2MJDA 2KAJA 5EE0A 1FM0D 4GDLB 2BS3B 2TSSA 1OQQA 1MHXA 1K51A 2WXRA 1WRIA 3ZYYX 1JW9D 1KLGD 3AH7A 1C77A 1FEHA 1QLBB 4MACA 3BVGA 4H2AA 1VR9A 2WXNA 2BS2B 2J4XA 1SE2A 4YSXB 1F2RI 4IDIA 4ZRPA 2NMQA 5G5GA 1V97A 2WU5B 2Y5CA 3E56A 4USAA 1K50A 4OZAA 4LK0M 3MFGA 5LNK1 1FXAA 1C78A 5BMGA 1Y56A 5TSSA 1FCCC 4OZBA 2W82A 2K9XA 1RM6C 1ACCA 2BS4B 2PTLA 2K22A 1XLNA 1TKGA 1AWDA 3H8HA 4DQOC 2G9HD 1I4HA 4C80A 1ET9A 1UWMA 2L1AA 1ENFA 4JPSA 1WWTA 3AE4B 5BYRA 3P4SB 2IDYA 1XLPA 3NVZA 4ZHPA 4YSYB 3W5VB 1DYQA 2GB1A 3Q69A 1ESFA 3AV8A 4L23A 3ZQ4A 2PLPA 2KN4A 5AUKA 2V0GA 2H89B 2RDHA 1FFVA 1QOAA 2MH7A 2JQRB 3DWMA 2WXIA 5H92C 2WXGA 4US8A 5H8YE 2WQYB 1C4PA 1IUEA 2PVGC 1FMAD 3AN1A 4IKGA 3U7ZA 2BB6A 3FILA 2EKIA 2WLBA 5G5HA 2ICIA 2JU6X 1VDVA 1P7EA 3BIID 4P16A 3KLSX 4YT0B 1R7SA 1PGAA 2AQ2B 2WXFA 2M56B 3VRBB 2IGGA 2RPVA 2BB5A 2OEDA 2SAKA 3LYYA 1C79A 2L32A 4HKZE 4KGTA 4US9A 1UNSA 3ZJTA 1E0ZA 1BXTA 1YJJA 2LUMA 5JXVA 1N62A 1V1PB 1C9FA 1KF6B 2R61A 1ZUD2 1VRAB 3B2GA 3AE6B 4HKQA 1D4BA 2CJNA 1XO3A 4ZYSA 1NYRA 4OZCA 5FK9C 1VZ8A 1N5WA 4D2KA 1NENB 3NVVA 1I4RA 2MJEA 1MVKA 2MEKA 1M4VA 2XN9C 1QQRA 3AEEB 2NTSA 2D5GA 4ARCA 1KTKA 3L4PA 3VR8B 3AECB 3EA6A 2K5PA 2QMTA 3P63A 4MM3B 1ZXIA 2N9KA 4LLGM 3T3OA 2HTME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQQ A;  1V8C A;  1WRI A;  1DGJ A;  1JW9 D;  4A9A A;  3ZYY X;  1QOF A;  1WXQ A;  3AH7 A;  3P4Q B;  1QLB B;  5AUI A;  3AEA B;  1WYG A;  2W3S A;  2BS2 B;  1FO4 A;  3ABV B;  3AE7 B;  3AEB B;  5GXG B;  4YSX B;  3AE1 B;  4IDI A;  4YT0 B;  5G5G A;  1A70 A;  1V97 A;  1ZOY B;  2WU5 B;  2Y5C A;  2L83 A;  4USA A;  1SF0 A;  1JQ4 A;  1VLB A;  4ZOH C;  2FBW B;  3DWG C;  4LTU A;  1FXA A;  1F0Z A;  3NS1 A;  1YQ3 B;  4P6V F;  3P1M A;  2K9X A;  1RM6 C;  2WP9 B;  4C7Y A;  5EE9 A;  2BS4 B;  3AE2 B;  2K22 A;  4N58 A;  2KMM A;  1YJI A;  1XLN A;  1TKG A;  1AWD A;  3AB5 A;  3AE3 B;  3KWL A;  1L6U A;  2DWQ A;  4JX1 C;  4N59 A;  1B9R A;  1FRR A;  2LEK A;  2M19 A;  2W55 A;  1JAL A;  2OHF A;  1JRP A;  4C80 A;  1UWM A;  5C2T B;  1TJE A;  1SIJ A;  4YTN B;  3SFE B;  1WWT A;  3AE4 B;  1ZP0 B;  1EWY C;  1WGK A;  2CJO A;  2CU3 A;  1XLP A;  3P4S B;  3NVZ A;  4ZHP A;  4YSY B;  3W5V B;  4ZHO A;  2WDR B;  1PUT A;  1J7A A;  1RFK A;  3VR9 B;  1PDX A;  1TKY A;  4HRS A;  1I7H A;  2DBY A;  1KFY B;  2WS3 B;  1DOY A;  2N0S B;  5EE1 A;  4YXD B;  1J7C A;  5C3J B;  3AMZ A;  2ACZ B;  3AV8 A;  1AYF A;  2W54 A;  2WDQ B;  4ITK A;  5AUK A;  1ROE A;  3B2F A;  2H89 B;  1FFV A;  1KRH A;  1CZP A;  1QOA A;  3AE8 B;  1GPX A;  2MH7 A;  2E3T A;  2JQR B;  3DWM A;  5H92 C;  5MPO A;  3ETR A;  3SFD B;  4YTM B;  4US8 A;  1NVI D;  2WQY B;  3AEG B;  5H8Y E;  4JWS C;  3FAH A;  4N6E B;  1XLO A;  2QIE B;  5EE3 A;  2QJL A;  1FXI A;  1IUE A;  3HRD D;  2PVG C;  1FMA D;  3AN1 A;  3NVW A;  1DOI A;  2B76 B;  3AE9 B;  1JWB D;  1TYG B;  1OQR A;  1N60 A;  3NVY A;  3SR6 A;  5G5H A;  1L5P A;  1OFF A;  1RWS A;  1QOG A;  2EKI A;  2WLB A;  3AE5 B;  3CIR B;  1FRD A;  4YTP B;  1VDV A;  3BII D;  2WU2 B;  3AM9 A;  2PVO D;  1GAQ B;  1PFD A;  3AED B;  3W9C B;  2JX5 A;  1QT9 A;  3CWI A;  1CJE A;  4C7Z A;  1NYQ A;  1R7S A;  2BT6 A;  4HRO A;  1YQ4 B;  2M56 B;  3PO0 A;  4KX6 B;  2W3R A;  4WWM A;  3VRB B;  2MJ3 A;  4YSZ B;  1E10 A;  4FXC A;  2H88 B;  1N61 A;  2PIA A;  1VJK A;  2L52 A;  2WDV B;  4US9 A;  3EUB 2;  1L0V B;  1JRO A;  2Q5W D;  1E0Z A;  1NEK B;  1J7B A;  1YJJ A;  1N63 A;  3LB8 C;  1E9M A;  3B9J A;  1N62 A;  1SB3 C;  1RYJ A;  1TKE A;  3HVZ A;  1KF6 B;  1ZUD 2;  1N5X A;  2G1E A;  3B2G A;  3RPF C;  3HUI A;  3AE6 B;  3P4R B;  2CJN A;  1XO3 A;  3LXF A;  1NYR A;  3FC4 A;  3P4P B;  3WCQ A;  1QF6 A;  1N5W A;  3AEF B;  3W5U B;  1NEN B;  3NVV A;  2MJE A;  4WQM A;  3AEE B;  4JWU C;  3L4P A;  1XLQ A;  1FFU A;  1E6E B;  3VR8 B;  3AEC B;  1DOX A;  1QOB A;  3NRZ A;  3VRA B;  1T3Q A;  1L6V A;  2K5P A;  1JWA D;  2AX5 A;  2PKO A;  2MJD A;  3P63 A;  1ZXI A;  2KAJ A;  1NI3 A;  5EE0 A;  1FIQ A;  1FM0 D;  1E7P B;  2BS3 B;  2HTM E; 
#chains in the Genus database with same CATH topology
 3QUT A;  4XX5 A;  1D8B A;  1XC9 A;  4A9A A;  3Q8E A;  2JZB A;  2WXM A;  2DQN B;  1WYG A;  5GXG B;  2L3Z A;  3RUL A;  2W9N A;  3R7R A;  2IND C;  1FCL A;  1TVA A;  4LJP B;  4EEK A;  2O6V B;  3UI3 A;  3GOE A;  2W9C A;  4P4P A;  4RQ8 A;  1WXA A;  4ZOH C;  1D9F A;  3V6J A;  2K8B A;  2F77 X;  3T3F A;  8ICX A;  2AEH A;  3ZJV A;  1HXY D;  3ZDT A;  4JV1 A;  1F0Z A;  3TEW A;  2JRI B;  2AL3 A;  3KVF B;  3WAL A;  1S77 D;  2IYD B;  1JWU D;  1BML C;  3APC A;  3PRE A;  2JXT A;  5KFZ A;  2YMP A;  3C28 A;  2V3P A;  1X6J A;  1ZYQ A;  1XXG A;  4YXM A;  3KHG A;  4FBU A;  3ZXV A;  2D11 A;  4BOZ B;  3IT6 B;  5ALT A;  2FPM A;  2ZTE A;  3T5L A;  2WX1 A;  3GV5 B;  5AI8 A;  3TQ1 A;  1ZRN A;  2XC9 A;  4IRC A;  4MM3 A;  3M9O B;  2J42 A;  1BPX A;  4ARI A;  2HBM A;  2H3I A;  1PUT A;  3J9C A;  3Q3M C;  3BQ2 A;  2ZVO A;  3T5J A;  4FHK A;  1X6I A;  2KTQ A;  4TQR A;  5ALV A;  1Q3U A;  4WH4 A;  3N3K B;  4DXA B;  1LKY A;  3AMZ A;  2BR0 A;  1XF5 L;  4LJX A;  1ROE A;  4M9L A;  4YP3 A;  2N4F A;  1GPX A;  4DQS A;  2HVI A;  3M3J A;  1A76 A;  1WCN A;  2MA9 B;  4XDC A;  2KO3 A;  4LDT B;  5FR6 A;  4IC9 A;  3DVG Y;  4O3Q A;  4RF0 A;  1OEY J;  3PW7 A;  1R4M I;  3NVW A;  2KZ3 A;  3PW4 A;  2WXQ A;  3TFS A;  2OJR A;  1JWB D;  2VH1 A;  4NNJ B;  4LNK A;  2HHV A;  2FCN A;  3AE5 B;  1RPL A;  2ONQ A;  4ZDV A;  5ALP A;  1BUI C;  5DGB A;  2GLS A;  2O2V B;  5L83 A;  1D5M C;  3QEA Z;  3PST A;  3RRH A;  3T79 A;  4YXJ A;  4QIW F;  1ZQC A;  1MFW A;  3WK7 A;  2W3R A;  1T3N A;  2JH7 A;  3PVX A;  4NLN A;  2QSD A;  3EC8 A;  1N61 A;  4XDD A;  3T9L A;  3CSF A;  5G2N A;  2KVS A;  2L7R A;  1KW4 A;  4F71 A;  1YD8 U;  2PI5 A;  3NZS A;  2DPJ A;  3VUY A;  1Q46 A;  1EWC A;  1SE4 A;  2ODG A;  3HM3 A;  4O0I A;  3QAR A;  1ZQK A;  2QC8 A;  3DDH A;  3P42 A;  4MGZ E;  3C0R B;  4P0P B;  4HJK A;  1IYF A;  1EXN A;  1ZET A;  3TUO A;  4QW8 A;  3IHQ B;  2XNA C;  2LM1 A;  1NNL A;  3QU5 A;  4Y2V A;  5J0P A;  7ICG A;  2BYV E;  4BOS C;  5KFU A;  3PY8 A;  4CRX A;  5KFA A;  4I6P A;  2IO1 B;  2DNF A;  3OJ4 B;  1QOB A;  4HDO A;  3KQ4 A;  3QZ8 A;  1NI3 A;  2LHE A;  5AI9 A;  8ICV A;  2VZK D;  3T3N A;  1P7D A;  4M9G A;  1VCB A;  5HHH A;  3HHM A;  1NK8 A;  2ZNV C;  3EEC A;  4WAA A;  2IOF K;  2JUO A;  4G0N B;  1QQ5 A;  1S0N A;  1I4G A;  2EH9 A;  4F91 B;  3N7R C;  1L7O A;  4RCO A;  2BYT A;  4RT2 A;  3GS2 A;  5AEK B;  2W9B A;  3TBL D;  2C2E A;  3IRU A;  4DHZ E;  1NDD A;  1ZOY B;  3SHQ A;  2AH5 A;  4JIO U;  1J8C A;  4MJS A;  3QJZ A;  4WUR A;  2ZIV B;  5D7G A;  2ZPN A;  2NTT A;  2JWU A;  3NS1 A;  2KFK B;  4C8K A;  4JGH B;  2HDO A;  1ZQH A;  5EDS A;  1Z19 A;  1JWM D;  5KG6 A;  3NGD A;  4F2R A;  4N58 A;  5DB7 A;  4KSK C;  4NAW A;  8ICN A;  2P6U A;  4EEW A;  2WNM A;  1UA0 A;  1HZ5 A;  3RUI B;  3E9S A;  2MSN A;  2AQ4 A;  2MUT B;  2FMS A;  4TSS A;  3S2A A;  4DL7 A;  4KN7 A;  1NK6 A;  4IG7 B;  4HCP B;  5C2T B;  1SIJ A;  4B9N A;  3EZ5 A;  4C4V B;  3SFE B;  1TKD A;  3Q2A C;  3SQI A;  1EWY C;  3NZU A;  5ALE A;  3D6J A;  2K8C A;  2DX5 B;  4PHA A;  3VR9 B;  1L7N A;  1F77 A;  1WGH A;  4GXI A;  1X66 A;  3QX7 A;  1L6N A;  3V6C B;  1DOY A;  4IQU A;  4NQK E;  2XIC A;  5C3J B;  9ICJ A;  4J9P A;  2LD9 A;  2HOI A;  3GIK A;  4KLT A;  1KRH A;  2HDE A;  1F52 A;  5MPO A;  2G0A A;  3ETR A;  3SFD B;  4WJO A;  3SU8 X;  1UPH A;  1SE9 A;  3BS7 A;  3PSE B;  5D49 A;  1XLO A;  2LI5 A;  2YMM A;  2C7N B;  3MR6 A;  3ZLZ A;  3QHT A;  2WAQ C;  2W8K A;  5ALM A;  2KC1 A;  2AWT A;  3UMG A;  3D2Q A;  3DBS A;  5DPR A;  3D2N A;  3N30 A;  4GDK B;  2Y9U A;  4QZI A;  4II3 B;  4RF1 A;  3H8M A;  2F44 A;  2KE7 A;  1JWS D;  3C29 A;  2PJH A;  4IWP A;  4ED7 A;  2ZW1 A;  8ICY A;  4LNI A;  2LZ6 A;  1YZ6 A;  1MQ2 A;  2Y0S C;  4PJ0 U;  3BZD B;  4JMU A;  1WFY A;  4R8U A;  4FLH A;  3UPQ A;  2QDF A;  4XWT A;  1RYJ A;  2GMI C;  1SJH D;  3RJH A;  1URJ A;  5CWR A;  3PHW B;  1ET6 A;  1MHH E;  2BGW A;  3GE3 C;  2LMR A;  3KUD B;  5AHX A;  2K3U A;  2N9E B;  1BVS A;  2I6X A;  4CE6 A;  2JSV X;  1D6E C;  3LXF A;  3ZUN A;  4B6W A;  5KFB A;  2KHQ A;  4LCD E;  3RB6 A;  1OUQ A;  4EBC A;  2BQR A;  2RHF A;  3TSS A;  4JWM A;  1HJP A;  3TEZ A;  1ZQQ A;  4YMN A;  1UH6 A;  5ALD A;  1IBX B;  2ZG6 A;  4HDQ A;  4C00 A;  1S9F A;  3DVN U;  3GFK B;  3PW5 A;  1RRB A;  4YMM A;  2HTM E;  3DHH C;  2ZJ8 A;  3NHE B;  2JZZ A;  5J2E A;  4LNO A;  3HWT A;  5KT2 A;  2MLB A;  3RRG A;  3C1Y A;  2LPE A;  1BNO A;  5AM5 A;  1L4Z B;  3ABV B;  3OSP A;  5CTR C;  9ICM A;  5ALI A;  3M63 B;  2KV2 A;  2JH1 A;  1TS3 A;  3B1L X;  4RQ2 A;  2EAP A;  4O3S A;  3B0X A;  4P0Q B;  2W9A A;  4FN2 A;  2QHO A;  3L08 A;  1FNU A;  3SDL C;  4RNO A;  3RNB C;  4J9K A;  2AYO B;  4KZC A;  2BKR B;  2UVU A;  4NLC A;  3ZDC A;  2KD0 A;  4E74 A;  4XQ8 A;  2MQJ A;  2ZUD A;  9ICH A;  3K1Z A;  3RJJ A;  2LKY A;  7ICN A;  4DFP A;  2XO7 A;  3AE3 B;  2L5Y A;  2F1J A;  2KG5 A;  1PK1 A;  4FE3 A;  5CA7 A;  1XNS A;  2VZK B;  5CEH A;  1SL2 A;  2INP E;  2KHW B;  5KT6 A;  4ECZ A;  2DZI A;  1Q5W B;  1SBB B;  1YJ1 A;  3NY5 A;  4UB5 A;  3N28 A;  4GIB A;  1T0R C;  1OXJ A;  1ZQL A;  4BXO A;  3X23 A;  1WMH B;  4XWW A;  4KLH A;  5IIO A;  3G6Y A;  4J9S A;  3Q8Q B;  4HRS A;  4CO7 A;  3BVZ A;  3N9Y C;  3AU6 A;  1WRD B;  2IO3 B;  3L16 A;  4DWI A;  2KIC A;  5DQH A;  4M8M A;  3G6V A;  4C8M A;  9ICX A;  1CZP A;  3DPD A;  1NKE A;  2J0M A;  1ZQZ A;  3VTV A;  2JZ3 B;  2K6D B;  4YTM B;  2ZW0 A;  3KHL A;  3AEG B;  3ED5 A;  4FZN A;  5C5J A;  5KG7 A;  1WGD A;  1UD7 A;  4C56 C;  2G07 A;  2ON8 A;  4MGK E;  3RBD A;  4IM3 A;  2QB0 B;  1V6E A;  3SV3 A;  9ICV A;  3N32 A;  4HEA 1;  2N9X A;  4JE3 B;  4NAM A;  1ZDX A;  2EEL A;  2PI4 A;  1KM7 A;  2RGF A;  1BPE A;  3CIR B;  5CB1 A;  9ICQ A;  1KLV A;  4O3O A;  2WAQ F;  3BY4 B;  3OHA A;  1GAQ B;  2G45 B;  4C7Z A;  5KL8 B;  3GV8 B;  4ELU A;  1SIF A;  2OWO A;  3T8M A;  3VQI A;  4OJP A;  5J0U A;  2J53 A;  5FKA C;  4DQR A;  4RM8 A;  3VTW A;  1VJK A;  5FR3 A;  4KLG A;  3ENE A;  2CPR A;  2LXA A;  4DDI D;  4RPX A;  3HW8 A;  4HLE A;  1UHU A;  3QNM A;  8ICL A;  2PFQ A;  2Y0S F;  2M8S A;  1WI0 A;  2YLM A;  4QZE A;  3FYH A;  1B4F A;  3UQ2 A;  2R2Q A;  1X9W A;  2OCE A;  4IR9 A;  2Y5B B;  2QKQ A;  1ZQU A;  4F4W A;  2WXH A;  5AKL A;  2DEN B;  1HEZ E;  4F5O A;  1P7F A;  3BYY B;  3I57 A;  4FS2 A;  7ICJ A;  1LQB A;  4C0Z A;  1ZQE A;  3MBY A;  3HIL A;  5E6N A;  4YQW A;  3WK6 A;  5EE0 A;  5KFI A;  3BZC A;  1FM0 D;  3Q3O C;  2M17 A;  4DF4 A;  4M9N A;  3U7D A;  5CRX A;  1SL1 A;  1JW9 D;  5E79 U;  1FEH A;  1QLB B;  5AK3 A;  2FIF A;  4B9M A;  1FXT B;  5KT7 A;  2BS2 B;  2MSE D;  3MR3 A;  3L0W B;  4II2 B;  3N7P D;  1C3T A;  3UIP B;  2RQ5 A;  2PE6 B;  3FKY A;  5K4L A;  3QUB A;  2BCU A;  4USA A;  4LK0 M;  3PZP A;  4RQM A;  5KFN A;  5LNK 1;  1FXA A;  4MEM A;  4C8L A;  4WQO B;  4KLU A;  2J6S A;  1K8R B;  4OZB A;  2ZUC A;  4I29 A;  2QAR B;  5AIA A;  3GIJ A;  4X5V A;  3KHR A;  4KSL C;  5DPW A;  3H8H A;  3RTV A;  1C20 A;  5EOZ A;  4DQO C;  3PV1 A;  4OJL A;  7ICO A;  2G4S A;  2G9H D;  4DOA A;  1UWM A;  1NZP A;  4EBD A;  3PO5 A;  4UAS A;  1WWT A;  2ZZP B;  3HIZ A;  4WWO A;  4A3P A;  3TAP A;  3P4S B;  3E0F A;  2Y1I A;  2E8N A;  1ZW7 A;  3OGU A;  3V7K A;  5AK6 A;  2FNJ B;  4HCN B;  3ZNH B;  4IRD A;  2LAS A;  2XI9 A;  2HHU A;  1ESF A;  3JW0 X;  5AM2 A;  4G50 A;  3AV8 A;  4RNN A;  5AUK A;  3K4G A;  1E8W A;  2H89 B;  2H3F A;  1QOA A;  3AXC A;  4PS7 A;  2MH7 A;  3CNH A;  2KZR A;  4ED6 A;  4LNF A;  3ZI4 A;  2WQY B;  4RQ4 A;  5TR5 A;  4DLE A;  3DBL B;  1XQQ A;  3AU2 A;  5KG4 A;  3VC8 A;  4RUC A;  4IKG A;  1J2N A;  2NRZ A;  3EFU A;  5AKE A;  3WKC A;  2CKH B;  2D10 A;  3FIL A;  3PT2 B;  3OTQ A;  1XS9 D;  2JU6 X;  3KYC D;  2ZXI A;  1NK9 A;  4P16 A;  1FEZ A;  4JWN A;  4IR1 A;  2KKV A;  4DS4 A;  3KLS X;  1YT3 A;  4C8O A;  1KLN A;  2JZB B;  3B08 A;  3RYT A;  3BQ1 A;  1G6J A;  4DSI A;  3H7S A;  2BB5 A;  3Q3J A;  1F5S A;  1C79 A;  5AKZ A;  1Z1B A;  2L32 A;  1D8L A;  1MQ3 A;  4NLK A;  1UZX B;  4J03 A;  4TQS A;  5D6J B;  1KFS A;  2O6K A;  1MC8 A;  1X1M A;  2EZY A;  2WF6 A;  1C9F A;  4UB2 A;  1ED1 A;  3A0H U;  1VRA B;  4RU9 A;  2KQ7 A;  4O5E A;  1GJZ A;  1EO6 A;  4EX7 A;  3AE6 B;  3LDZ E;  3V61 A;  4B9S A;  1V49 A;  1VZ8 A;  2JR5 A;  1TGZ B;  8ICG A;  3PPA A;  4PL1 A;  2MJE A;  3MHS D;  1VJ5 A;  3M6K A;  4TUQ A;  4IM2 A;  1S97 A;  2K6Q A;  3H8J A;  2R8H A;  3R9K A;  2NTS A;  4ARC A;  2VIX A;  2KDF B;  2NYV A;  3VR8 B;  3N1Z C;  3LWL A;  2K5P A;  2QMT A;  3EA6 A;  1LXD A;  3IN5 A;  4BX9 C;  4MM3 B;  3QYP A;  2KZM A;  1UCV A;  2YTU A;  2R8G A;  2I1Q A;  1S0O A;  4P1C C;  2HBL A;  5ALX A;  2Z7J A;  5DG7 A;  2HJ1 A;  5J2I A;  4FAD A;  2VA8 A;  1FO4 A;  5KFH A;  3AEB B;  4BAX A;  4TQ1 A;  3BDP A;  2OEH A;  2M0X A;  2L83 A;  1SF0 A;  4J9R A;  1ZQJ A;  2MP2 A;  3THV A;  3VTU A;  1CEZ A;  2M9N A;  2KDI A;  3PGE A;  2ZIW A;  1GUA B;  4BJQ A;  1OQY A;  4NWI A;  4ANX A;  1IM4 A;  1Z00 A;  3DBR I;  2WP9 B;  1YN3 A;  7ICQ A;  3ZIM A;  5G55 A;  3BWU D;  3QC8 B;  7ICU A;  2ZNV B;  5KT4 A;  3KWL A;  1K52 A;  3ZGZ A;  5AIB A;  2DYO A;  3K9P B;  3ZTD A;  5CHV C;  4EZJ A;  1L3T A;  4HK2 A;  2E8M A;  4F5P A;  3V6H A;  2C2R A;  3QUC A;  4UBB A;  5JZE B;  5AKK A;  5IKC M;  3BZK A;  8ICM A;  2JYE A;  1KQQ A;  4ZHO A;  1V2Y A;  3FDS A;  1J7A A;  5DDM A;  1CUK A;  3JPS A;  1RXW A;  4IM0 A;  2XK5 A;  2J7Q B;  4RZR A;  2DBY A;  3RFZ B;  3KTQ A;  5AKX A;  8ICI A;  4GB9 A;  5HNK A;  2P66 A;  2UVW A;  2KTR A;  1RQL A;  4DWF A;  3RH5 A;  2OH2 A;  1WJ4 A;  5KFY A;  4UAU A;  1EUV B;  1LO5 D;  5J0S A;  3MHZ A;  4I2I A;  4WJN A;  4MF8 A;  5L1K A;  1XU4 A;  2LMC A;  5JHB A;  1UBI A;  1ZQX A;  4UB4 A;  2W8L A;  2JXX A;  5EWG A;  1P98 A;  2PPH A;  3JPP A;  2WXK A;  1FD6 A;  1HUO A;  2HHX A;  1V38 A;  1Q10 A;  3RN9 C;  2PKE A;  3ZDB A;  5LLI A;  4ANV A;  1N60 A;  4NM2 A;  3APD A;  3HT3 A;  1NJX A;  1KDH A;  4NLG A;  4P4M A;  1WUD A;  3KD3 A;  4B6J A;  1IV8 A;  1YN5 A;  2WU2 B;  1F1H A;  2MA1 A;  3I1Y A;  5LXH A;  2HHW A;  1M94 A;  2MBH A;  3VUW A;  2BHN A;  1WR6 E;  4W9D A;  2MJ3 A;  2NO4 A;  1NK5 A;  3DCG A;  1ZKH A;  2KFJ A;  2JGA A;  2DGZ A;  4Y2X A;  5KG3 A;  4IS7 A;  4W9E A;  2W9B B;  3K75 D;  1NJY A;  5AKJ A;  3DVN V;  4PHP A;  4DXG A;  4J6I A;  4K81 A;  4MJS B;  2KDM A;  2CRX A;  3HVZ A;  3GII A;  3L5K A;  4WAF A;  4YR2 A;  2W7O A;  2KN5 A;  3TMP B;  5KFM A;  3OSN A;  8ICJ A;  2XY5 A;  1E8Z A;  4WJQ A;  2GOL A;  2IHM A;  1ZE3 D;  3H0R B;  5DBA A;  1ZQR A;  3QAQ A;  2C9W B;  2QIL A;  4KKI A;  3TAR A;  4DFK A;  2ISP A;  3VAW A;  2DKZ A;  4ED0 A;  5AM4 A;  2L8J A;  2FCM A;  4NAW B;  5DG9 A;  3SD7 A;  1QQ6 A;  3UQ0 A;  1ARO P;  3EPI A;  1EF1 A;  3R3M A;  2RD0 A;  5KAF U;  1UT5 A;  4NJC A;  3ZRC A;  2M0A A;  2XEW A;  1NJW A;  2K4P A;  3MTN B;  4ECQ A;  2ZTD A;  1F9J A;  3L3F X;  2K8C B;  3GV7 B;  5DGA A;  3JSV A;  2NPT A;  5GTH U;  2JHD A;  1E7P B;  1QSS A;  1TE2 A;  1F2R C;  4ZH4 A;  4L2Y A;  4YMO A;  5C23 A;  1DOQ A;  1KLU D;  3AEA B;  2YY6 A;  9ICS A;  2R8I A;  4NL9 C;  4A55 A;  3Q8K A;  2VKQ A;  1JQ4 A;  2BKE A;  1A77 A;  4Q8E A;  2GBN A;  4FBT A;  1YZ7 A;  4Z6E A;  5DPS A;  3R7Q A;  4RQ7 A;  3DBL I;  4ICV A;  4UAZ A;  3PX4 A;  2ASJ A;  4FA6 A;  4ICA A;  1SKS A;  5L1L A;  2YB1 A;  1YQ3 B;  2KNJ A;  1WCL A;  2OM6 A;  3I63 C;  4K1R B;  2GWS A;  4RFB A;  5AZG A;  8ICS A;  5KFE A;  1YJI A;  3PR4 A;  1C7Y A;  4DFJ A;  2W11 A;  3TFR A;  2K25 A;  4W9L A;  3TIX A;  3ECI A;  4TKN A;  5J2J A;  1YMH E;  2KJ5 A;  4YD2 A;  1LFD A;  5ALL A;  3L13 A;  4MEX A;  4TV3 A;  2Q0Z X;  4IC7 B;  4R8U B;  4UAY A;  4DS5 A;  4I2C A;  7ICT A;  3ISC A;  4KLD A;  1H4R A;  1RFK A;  3HK0 A;  1WJ6 A;  2LVO A;  4NPN A;  3ZTC A;  4MH8 A;  5IIM A;  3VUX A;  4DL4 A;  4GMV A;  1SZH A;  1U48 A;  3PRM B;  1J7C A;  3EGR A;  1SXD A;  2LGX A;  3H8W A;  5BPC A;  4JV2 A;  4W9G A;  3AE8 B;  4AP4 C;  3HP6 A;  2AGP A;  1WM3 A;  2E3T A;  2V3N A;  4UAT A;  1T0Y A;  3PW2 A;  3RB0 A;  7ICF A;  4XA5 A;  4ELV A;  1TV9 A;  3Q8A A;  3GZN I;  1GC6 A;  4PGX A;  3KKA C;  3A9J A;  5B5E U;  4BWJ A;  1PVP A;  2IPK D;  3IDW A;  2B76 B;  4DF8 A;  5IA7 A;  4CCH A;  1OFF A;  4PPX A;  2HE7 A;  3PRP B;  2UU7 A;  4YCX A;  4P4O A;  5D3D A;  1SZP A;  4DOB A;  1UT8 A;  2CHX A;  1TBE A;  3RBE A;  4KVG B;  4KX6 B;  1RZT A;  1TTN A;  5KFP A;  4EYH B;  2WF9 A;  2Z0E B;  3AQE A;  2N9P C;  4TMA B;  5IIK A;  3TI0 A;  2YB4 A;  1R4N I;  2KK8 A;  2W03 A;  1ZQV A;  5AI5 A;  2WF8 A;  2KC2 A;  3VVW B;  4ECT A;  2IBK A;  1TS5 A;  3P4R B;  1ZXH A;  3P4P B;  1TFR A;  2ZPY A;  3I3T B;  2BDP A;  1J0G A;  2LJI A;  1AQ6 A;  2ASL A;  2WHE A;  3TAQ A;  5AI4 A;  5KFT A;  2I9G A;  1V85 A;  3HM6 X;  2FE8 A;  4Q44 A;  2AQ0 A;  4DSL A;  1FFU A;  1RDF A;  2A1J B;  3V6K A;  1COK A;  1IPG A;  2WXP A;  4M02 A;  4FJY A;  3QU9 A;  3TEX A;  2BPC A;  5DLG A;  4ICU A;  4QNL A;  4GXK A;  4BXO B;  2K4H A;  2QCZ A;  3QZ7 A;  4K7S A;  1ZD5 A;  2FI1 A;  2WYQ A;  2KIW A;  2IGD A;  4RGO S;  2NR2 A;  3WK9 A;  4UW9 A;  3WK8 A;  4PGY A;  2GH1 A;  2W3S A;  5ALQ A;  2BCS A;  2V4R A;  3G6X A;  3HJE A;  5L95 C;  3AE1 B;  4I2A A;  1SXT A;  3ZVV A;  1SV0 C;  4O3N A;  2L0F A;  2N1R A;  7ICI A;  3Q3N C;  5HR7 A;  1VLB A;  5J0Y A;  4KGR A;  4J9N A;  4JB3 A;  2BPF A;  3PZD A;  3I28 A;  3NS8 A;  2NBU A;  2KSO A;  3QU7 A;  1XEE A;  1KH0 A;  4BKS D;  1JXE A;  5HHD G;  5E6O A;  5LXI B;  3IAM 1;  2INC C;  3OPX A;  3H7P A;  8ICR A;  2D3G A;  5J2R A;  2M19 A;  2V4I B;  1NOM A;  2DZK A;  4DLG A;  2IMW P;  2C28 A;  2DLB A;  3HKZ F;  5KTQ A;  2LI6 A;  3MR2 A;  5IIL A;  2L05 A;  4YN4 A;  1V5O A;  5DPT A;  1TKY A;  1I7H A;  1L8O A;  3P2B A;  1L0Y B;  1S0V A;  4I6N B;  4ASW C;  3IVF A;  3AL0 B;  2A5U A;  4M01 A;  3RCZ A;  2W54 A;  2XCP A;  3GU3 A;  1EU4 A;  2HTH A;  4A90 A;  4ZRI A;  2K39 A;  2K8H A;  4Y2J A;  2RDJ A;  3WU2 U;  1GOZ A;  3LWM A;  1XCT L;  1VZ7 A;  4KGS A;  3TAN A;  5ALO A;  3KZI U;  2KVR A;  2RDG A;  1A0P A;  2KTF A;  1SWV A;  3H4B A;  3F2B A;  2E8O A;  4RH6 A;  1ZOL A;  8ICT A;  2MHJ A;  3CP8 A;  1WGR A;  1OGW A;  3ZNG C;  2BQU A;  1HTQ A;  4NZL B;  2VA3 A;  1X2I A;  1FRD A;  3HVD A;  3JPN A;  1ZQD A;  1PVR A;  4KKJ A;  2F3N A;  1S1Q B;  1ZQT A;  4B9V A;  4O3P A;  3L54 A;  4FBJ B;  1GB1 A;  1S5L U;  3C1Z A;  3EYZ A;  1PGX A;  5ALZ A;  2N1W A;  5D3I B;  2FPK A;  1WX7 A;  2YEP F;  4HXD A;  1JRO A;  4OHJ A;  3F2C A;  2ZJ5 A;  4J9O A;  1MSW D;  2V1Y A;  5GMV A;  4OD0 A;  1E9M A;  2OXO A;  2G1E A;  5AZH A;  3AUO A;  4UDU C;  3HUI A;  3RPF C;  2RDB C;  2MW5 A;  2ASD A;  3PSP A;  1I35 A;  4GLX A;  1QF6 A;  5J8Y C;  5J0W A;  1UEL A;  4Z6F A;  4QW9 A;  3QE9 Y;  1TZO A;  2J6T A;  1PUZ A;  2HJ8 A;  2IBI B;  3FM9 A;  2AQ1 B;  3RB4 A;  2A19 A;  2C7H A;  5KFK A;  3ZNZ B;  1PYW D;  4M00 A;  2LYB A;  3NRZ A;  3MAB A;  9ICI A;  3VRA B;  1RXV A;  1KN5 A;  3C21 A;  4F1S A;  4MF2 A;  4XUS A;  5JU5 A;  2DUY A;  1A5R A;  2K4I A;  2BS3 B;  1OQQ A;  1UGM A;  1MHX A;  3BQT A;  4WWP A;  1TK0 A;  4DL3 A;  9ICU A;  3A1Q A;  1C77 A;  4GOC A;  4MAC A;  2AXT U;  3BVG A;  1ZD3 A;  2KT7 A;  3OHB A;  5IO9 A;  2P6R A;  3H4D A;  4FHJ A;  5G5G A;  2ZUB A;  2DFL A;  1GC7 A;  1V86 A;  3RZW C;  3E56 A;  2D07 B;  3LDA A;  5H2F U;  3F5E A;  4U7C A;  4ED2 A;  3CW2 C;  2JXJ A;  3PVL A;  3CRX A;  5TSS A;  1FCC C;  2LXC A;  4O3R A;  2K9X A;  2W82 A;  2BKF A;  4QJF B;  1WZ0 A;  4K4G A;  2YMQ A;  2O6V A;  1F0M A;  4W9K A;  4BKG A;  3RFA A;  4W9C A;  4B9U A;  3UMC A;  2L1A A;  3QCA A;  4EBE A;  2P35 A;  1Z4O A;  2KVC A;  4FJV B;  5CR0 A;  5BYR A;  1KTQ A;  4YSY B;  3W5V B;  1UF0 A;  2F76 X;  4M0A A;  1DYQ A;  4GDL A;  4ACF A;  1ZQY A;  2I1K A;  3A9K A;  4K7W A;  1SV4 A;  3ICX A;  4IWO A;  2DZM A;  3LVV A;  3ZQ4 A;  2ZJD A;  2FMQ A;  2PLP A;  5D94 A;  1WM2 A;  2RDH A;  2HI0 A;  4A8E A;  2N7D A;  3RJG A;  3Q3F A;  3D2S A;  7ICM A;  2WXG A;  2AU0 A;  3PSI A;  4P2H A;  5J2C A;  2WF5 A;  2CU1 A;  2J0J A;  4DHZ B;  4R63 A;  3N20 C;  1FMA D;  1Z1V A;  1Z4N A;  3U7Z A;  2WHI A;  1VD2 A;  4I2E A;  2L00 B;  2BB6 A;  4J9Q A;  3ONS A;  5CHW A;  3LYS A;  3T5H A;  4M9J A;  5G5H A;  2D3B A;  2CHW A;  1PQS A;  3O0F A;  3TAD C;  5KNI A;  1HE8 A;  4DL2 A;  1YX6 B;  2WB1 C;  4RQ0 A;  5KAI U;  1R7S A;  1PGA A;  4PL2 A;  2AQ2 B;  2WXF A;  2M56 B;  5J2A A;  2CR5 A;  3PRZ A;  2OED A;  1ZQM A;  4Q8F A;  1BPB A;  2K4E A;  1K5O A;  4PZN A;  3MDC A;  3SAF A;  1WR1 A;  2B0C A;  4CF5 A;  3MR5 A;  2BF8 B;  2WGS A;  3ZJT A;  3CF6 E;  2O2V A;  1YJJ A;  2MP2 B;  3ZXR A;  5DG8 A;  3T5K A;  1RAX A;  2W7P A;  1KF6 B;  2MBE A;  8ICU A;  3DVG X;  5B66 U;  1NKB A;  4W9I A;  5E6P A;  1XO3 A;  4ZYS A;  4HKQ A;  2FUH B;  1D4B A;  3GZF A;  4J9L A;  1I4R A;  3RH4 A;  2LUE A;  1MVK A;  3RB3 A;  2F1H A;  2MBO A;  1T4G A;  2IOF A;  1QQR A;  2N1V A;  3AEE B;  4EUT A;  3PNC A;  3L4P A;  4IUM B;  1N6Z A;  4F4X A;  2KMD A;  5DBC A;  1QLN A;  3AEC B;  4PS3 A;  1SGH A;  2KJ8 A;  1ZXI A;  2N9K A;  4NXZ A;  1HIW A;  1XO1 A;  1ZQW A;  2LM4 A;  1KL9 A;  5J17 A;  1I4Q A;  2XK5 B;  1V8C A;  2KJ6 A;  3QU4 A;  4DHJ D;  3PO4 A;  2KQ4 X;  2EKE C;  4UQG A;  2D2Q A;  4EFO A;  1TS4 A;  4EEY A;  3AE7 B;  2UVR A;  3E58 A;  4O1N A;  2B21 A;  1E90 A;  4YR0 A;  4ANU A;  4EE2 A;  1TY2 A;  5JUM A;  1JML A;  2JEI A;  3PZ8 A;  4CYE A;  4FZL A;  4ED8 A;  4LVS A;  4CGZ A;  9ICK A;  4MFA A;  1ZD2 P;  2F2A B;  8ICZ A;  3C8Y A;  3R8B A;  1WWV A;  5J2K A;  3ZDA A;  1STE A;  4NLB A;  1MN8 A;  3U4E G;  5J0O A;  2UYZ B;  5J2F A;  4JX1 C;  4N59 A;  9ICC A;  2RSU A;  3IHP C;  4CQN A;  2MAX A;  2YML A;  3EW9 A;  1QTM A;  3ONN A;  4Y2Q A;  4YTN B;  2KN7 A;  2IY1 B;  4GIV A;  1UQV A;  3ZKJ C;  5AM3 A;  2BWE S;  3C2L A;  5ALW A;  4XYC A;  1SSN A;  1WE6 A;  4Y2S A;  1SEB D;  2NRX A;  5ALJ A;  4DEZ A;  1YNT E;  4C4V A;  4F92 B;  1ZGU B;  2WDQ B;  5BO4 B;  3LK9 A;  1E8X A;  4I2J A;  1WH3 A;  4XZ4 A;  4PHD A;  2ZIU B;  3VFK A;  4WIP A;  2EQY A;  1JIH A;  2ZIX A;  4RQ1 A;  2RDI A;  3HRD D;  4G11 A;  2MU2 A;  1TY0 A;  2GI9 A;  3RI7 C;  3AE9 B;  2PIA A;  2I2Y A;  3JSV B;  2GLE A;  1XO0 A;  2NPT B;  2KP7 A;  1S0M A;  2WDT B;  2FMP A;  4MFF A;  3Q14 C;  3RNG C;  4QZG A;  3W9C B;  4M9H A;  1ZRM A;  1RFA A;  2BT6 A;  3F2D A;  1IXR A;  2L76 A;  4RNA A;  7ICE A;  1BPZ A;  2V4Q A;  2V9W A;  1E5W A;  2WXO A;  3IFW B;  2H88 B;  3MJ5 A;  4FXC A;  1IP9 A;  3VH4 B;  4PK1 A;  2WB1 F;  5E6J A;  3PX6 A;  3EUB 2;  3EFC A;  2BBC A;  2BW2 A;  1NEK B;  4LNN A;  4J9M A;  2LJ5 A;  5HMM A;  3VHT C;  1S8O A;  2HMX A;  1L3S A;  1L5U A;  1SB3 C;  3M7D A;  2KAN A;  4O9M A;  3JPT A;  3RZF A;  1N5X A;  1TAM A;  2G06 A;  2N7E A;  2VA2 A;  2FUG 1;  5HKH A;  3MGI A;  3WKE A;  1WGG A;  2PE9 A;  4B95 A;  9ICG A;  1ZQS A;  3AI5 A;  5HHI A;  4REZ A;  2J0K A;  2LRU A;  4NJ8 A;  2KIV A;  1ZQB A;  1T8E A;  1FPY A;  1F44 A;  4HWI B;  4P1B C;  1L3U A;  3M6Z A;  2E1F A;  5KFV A;  5ALF A;  3QA8 A;  4PT5 A;  3ZD8 A;  1AW7 A;  4X57 B;  4JWU C;  3OLM D;  3SYZ A;  7ICS A;  4AJY B;  4MHV A;  4XRH A;  2AX5 A;  5KT5 A;  3W1S C;  5J2G A;  1UGJ A;  2W9C B;  2GBM A;  1JMS A;  1YOV B;  1B1Z A;  3UIO B;  2BCR A;  2K8B B;  3OWE B;  1JRU A;  4YL8 A;  4BFR A;  3SMV A;  5AUI A;  4EEN A;  5DCN A;  4GC7 A;  5JHA A;  4LZD A;  1IBX A;  4JUZ A;  1SKW A;  3MFH A;  1J2M A;  4IW0 A;  3AUL A;  4ZYN A;  3C19 A;  2LGY A;  1C1Y B;  4ECX A;  2LBO A;  2KKC A;  2GOW A;  2KDB A;  3SV4 A;  7ICV A;  4LTU A;  3A33 B;  4KLO A;  2VAN A;  4A8X C;  2F8K A;  3M9M B;  3A9J B;  4W9H A;  2KLG A;  4IQV A;  4A20 A;  2L0T A;  4EZ6 A;  4PS8 A;  4YWG G;  2KMM A;  3MP9 A;  3D32 A;  9ICN A;  1HQR D;  1KOT A;  1C4C A;  2E6X A;  5D4B A;  2UVV A;  1L6U A;  2PMZ C;  1FRR A;  5ALG A;  3ISB A;  2I1J A;  3BS5 A;  2OHF A;  4CF3 A;  1LKY B;  1WJU A;  2K89 A;  1HZ6 A;  4DHJ B;  3ZJU A;  4O3M A;  1ZP0 B;  4AQ7 A;  3IBE A;  3MC0 B;  4RQN A;  3KWV A;  2MX2 A;  1OW5 A;  3NAS A;  5J0X A;  4KV2 A;  4K4I A;  2HVH A;  2RR9 A;  3IG5 A;  5KG0 A;  1N56 A;  2BGF A;  5GTI U;  2ACZ B;  4ITK A;  2J52 A;  2EZX A;  1T0S C;  1UWX A;  1Q0W B;  2HOQ A;  4JWS C;  1L7Y A;  4M6W A;  4MEY A;  2QJL A;  3PMN A;  2IO0 B;  4GXB A;  5L1J A;  2DAF A;  2EZZ A;  3UXO A;  3O65 B;  2WXL A;  1UA1 A;  3NVY A;  1RWS A;  3N97 B;  5D2M B;  3AM9 A;  3QEB Z;  2PVO D;  3EHV A;  2PFO A;  1CJE A;  4RQ6 A;  3KYD D;  1JN3 A;  1X9X A;  2QB0 A;  2Y5P A;  4M04 A;  1QSL A;  5ALU A;  4IOI E;  2JMG A;  1WX8 A;  2KWC A;  2FID A;  2WDV B;  4B9K A;  3UQB A;  5JRT A;  1J7B A;  2UWQ A;  2KMA A;  4KTQ A;  2G5I B;  5BYS A;  3V62 A;  3PTF C;  5AK5 A;  1GG3 A;  1QKZ A;  2RP5 A;  4AS1 A;  7ICR A;  2YN4 A;  2KSO B;  2MRL A;  1BPY A;  4HVB A;  3H40 A;  4DSF A;  2YQE A;  1DXS A;  3KH0 A;  3JYU A;  2MBQ A;  3IG8 A;  1E7U A;  3N1Y C;  5I4D A;  3SI8 A;  5IP4 D;  3N1X C;  4RM9 A;  2FCQ A;  3H7P B;  3WAO A;  1XWL A;  2PFP A;  3ZRF A;  2C5L C;  4NL9 A;  9ICW A;  4M0W A;  1Y8R C;  3NTU A;  4FJZ A;  1B22 A;  2K60 A;  2INN E;  1L0X B;  1T3Q A;  2IA6 A;  1JWA D;  4F72 A;  9ICB A;  3GE8 C;  3WAP A;  1FIQ A;  1KRP A;  1QIL A;  2FLN A;  3IXS A;  4ANW A;  3W2D A;  1I42 A;  3IT4 B;  1RYR A;  2KJ9 A;  4NV0 A;  7ICL A;  2GO7 A;  1KFT A;  1ZQP A;  1A70 A;  4MDK E;  4JK1 A;  3LVW A;  2LGD A;  4O5C A;  3ORY A;  3DQV A;  4DQP A;  2IGH A;  4MSQ B;  3UQA A;  4NY0 A;  9ICA A;  1RYS A;  4DL6 A;  3QX1 A;  4Z6D A;  3Q8L A;  3WK5 A;  3TEY A;  2AGQ A;  4GU2 A;  4YTP B;  1M6Y A;  1BPD A;  3BVM A;  3RNC C;  2DKX A;  3I76 A;  9ICP A;  4B9L A;  3ZNI D;  3RNA C;  1Z2M A;  3Q8C A;  4RPY A;  2XVT A;  3RJI A;  2LWP A;  4M47 A;  1V9J A;  4HJG E;  3X0W A;  4QWE A;  3I9V 1;  1SJE D;  5KHO A;  4XC2 A;  4WJP A;  4WWN A;  4GC6 A;  3UXP A;  4QIW C;  1JX4 A;  1QQ7 A;  3Q8M A;  4QWC A;  2OOB B;  2V3S A;  2CJO A;  2MRP A;  2PMZ F;  3V60 A;  2VJ4 A;  3S6J A;  1YIW A;  2JEF A;  2KD1 A;  4QZF A;  2KKP A;  2I38 A;  2KXJ A;  3KKA A;  5CJ7 A;  3IG3 A;  4B0E A;  4O5K A;  5EE1 A;  5IAA C;  3K1R B;  5AKG A;  2NBV B;  4YXD B;  5ALN A;  5HFY A;  4I2B A;  3MGV A;  4I6L B;  2A1A A;  2LFI A;  3BIN A;  1JCK B;  3NUH B;  4S17 A;  1B43 A;  5KG1 A;  1NK0 A;  2CXY A;  3UF8 A;  4N6E B;  3U8Z A;  3U52 E;  1WIA A;  8ICK A;  3ZW3 A;  5L9X A;  3OG5 A;  1ZDV A;  1MI0 A;  4QZ9 A;  5T8I A;  8ICF A;  3RMK C;  2HBJ A;  3DV9 A;  1TYG B;  1PZN A;  4KX3 A;  4F4K A;  4EOY A;  2HW3 A;  3IP4 B;  2NV3 A;  4QZB A;  4MGY E;  3AED B;  5DBB A;  4F4Y A;  1MG8 A;  1QT9 A;  2JX5 A;  3PSF A;  1NYQ A;  3A1Q B;  4YSZ B;  3UMB A;  4QZ8 A;  1E10 A;  4OO1 J;  2HHS A;  4DFD A;  3SEB A;  3WKA A;  2XGP A;  5KFQ A;  4KIK A;  2BWF A;  1MA7 A;  1L0V B;  4RGT A;  2JY6 A;  3W1Y A;  4TUP A;  2JZP A;  4F3O A;  2Y9T A;  3SZ2 A;  3PV8 A;  1TKE A;  3RJE A;  1L4D B;  3O13 A;  2WTF A;  2Z59 B;  4JLC A;  4NQL B;  2CS4 A;  3ML8 A;  7ICP A;  2FJ6 A;  1XCQ L;  2BVC A;  4DQI A;  4AJW A;  4F4Z A;  4YFK A;  2G08 A;  4R64 A;  1SKR A;  2PEA A;  5DB6 A;  2X38 A;  1CMX B;  4YVZ A;  2KOB A;  5L1I A;  1EU3 A;  3WAN A;  1ZJN A;  2V4L A;  4G9B A;  1XLQ A;  1TK5 A;  8ICO A;  3RT3 B;  4C8N A;  4KLJ A;  1SV0 A;  4N9F 4;  2MJD A;  1NK7 A;  1WE7 A;  1KKX A;  5ALH A;  4GDL B;  2C60 A;  1K51 A;  2WXR A;  1WRI A;  3C2M A;  1PVQ A;  1KLG D;  3A9K B;  4UB1 A;  1YQB A;  3OAW A;  2G09 A;  4G3X B;  4H2A A;  1P3Q U;  4BUG A;  2WXN A;  3LJ3 A;  2FAZ A;  4EEL A;  1U4B A;  1SE2 A;  3MGH A;  4PYZ A;  4YSX B;  4IDI A;  8ICW A;  4K7U A;  2I5H A;  1ZJM A;  1T7P A;  2NMQ A;  1V97 A;  3I5J C;  2G4D B;  2WU5 B;  3RR8 A;  2Y5C A;  4DO9 A;  1K50 A;  5AKH A;  4ZRK A;  3MFG A;  1Q8K A;  2FDR A;  3IM1 A;  4DBG A;  1PK1 B;  5HML A;  2FLP A;  2KJR A;  4KLF A;  2B6G A;  4IL6 U;  3M9N B;  2NS5 A;  3QUQ A;  1ACC A;  2BS4 B;  3NUQ A;  2G3Q B;  2K22 A;  2PTL A;  2DZJ A;  2FCS A;  3L10 B;  1U9L A;  1AWD A;  3ZO5 B;  4PH5 A;  3WA0 A;  3N7S C;  4Y2R A;  1I4H A;  4C80 A;  3SEI A;  1ET9 A;  4PHE A;  1ENF A;  4ECV A;  4JPS A;  5AIC A;  1LM8 B;  4IRK A;  3AE4 B;  2WWZ A;  2NRV A;  1RQN A;  2IDY A;  1XLP A;  3M95 A;  1JUD A;  2DYB A;  4F7Z A;  2JV3 A;  9ICT A;  2KHV A;  2GB1 A;  5F9L A;  3Q69 A;  3TCA A;  4GFJ A;  2KX0 A;  3RAQ A;  2KN4 A;  2FE9 A;  5FP0 A;  2V0G A;  1FFV A;  2W04 A;  2AHO B;  4C4S A;  3DWM A;  5H92 C;  2WXI A;  3H0M B;  1K1S A;  4US8 A;  1ZQG A;  1HTO A;  3R66 C;  1XSN A;  4I2H A;  1C4P A;  3ALB A;  3PLV A;  1IUE A;  2KJH B;  1Z3E B;  2DPI A;  2PVG C;  1WJN A;  5F3X B;  4BGD A;  4M2Y A;  1V9P A;  5KT3 A;  1DGS A;  1L8L A;  2EKI A;  2ICI A;  2W9M A;  5ALY A;  1P7E A;  5AM0 A;  3BII D;  3MFI A;  4MGI E;  4YT0 B;  4Y2T A;  2BQ3 A;  2ALZ A;  4F8C B;  1D9D A;  5AI6 A;  4YR3 A;  4DL5 A;  5T14 A;  5J8Y A;  2AGO A;  5CX3 A;  3KOO A;  1N48 A;  4HKZ E;  1E8Y A;  2LRW A;  1BXT A;  1TT5 B;  1X42 A;  3UIN B;  4I2G A;  4URK A;  2XCA A;  2H5X A;  4KMO B;  2EMT A;  2V9H A;  1N62 A;  2XBB C;  2REX A;  2R61 A;  3H6N A;  3B2G A;  4BZA A;  2FPL A;  3HX0 A;  4A3O A;  3UGB B;  2BYF A;  2CJN A;  2QLT A;  4OZC A;  5CP2 A;  2XY7 A;  2R2O A;  1NBF C;  5FK9 C;  1N5W A;  4D2K A;  1NEN B;  1IIP A;  3NVV A;  4C4R A;  2MCN B;  2XN9 C;  5DDY A;  2D5G A;  1KTK A;  5D46 A;  1WY8 A;  7ICH A;  1NI2 A;  3P63 A;  3L17 A;  5C0Y A;  3CYM A;  3KUC B;  5CHF A;  4KN4 A;  3BQ0 A;  2KWV B;  5HR6 A;  5KL1 B;  4HPP A;  4QAY A;  1AN8 A;  2YEP B;  1ZQN A;  2CHZ A;  4RT3 A;  9ICF A;  3C23 A;  3UM9 A;  2HHQ A;  4S0R A;  1CRX A;  2Z0D B;  4E71 A;  4RGN A;  1TAU A;  2Y3A A;  4I2F A;  1S76 D;  2DL0 A;  5AI0 A;  2NRT A;  2BQQ A;  1I4X A;  5HG2 A;  1X9M A;  2ZIX B;  4I2D A;  3V05 A;  3ETL A;  4Y2Y A;  5KFD A;  5J2B A;  4NLZ A;  1K53 A;  2XY6 A;  1V1P A;  1U45 A;  4OVZ A;  3TL5 A;  4FUL A;  4IQT A;  2QB1 A;  2M1M A;  2D6F C;  1QZE A;  1NJZ A;  2SEB D;  4EYI B;  4GXJ A;  1CI4 A;  3M62 B;  3PZ7 A;  2AQ3 B;  3AB5 A;  3JPO A;  2D3C A;  3GP7 A;  1P1A A;  1L7M A;  1D5X C;  4WJ3 B;  1T0Q C;  1H8C A;  2HBK A;  4OVU A;  3NG0 A;  4J3O D;  2LHT A;  4E3C A;  3BYT B;  4B0M A;  3AU4 A;  3C5G A;  2F8L A;  3SD5 A;  4F5Q A;  5EWF A;  1QCK A;  4MSM B;  5IN7 A;  2RMM A;  2JRZ A;  2N0S B;  5BMI A;  3RNE C;  4AOF A;  1L7P A;  4UB8 U;  1KBU A;  1S10 A;  3FIL B;  3TAD A;  5BYQ A;  4RQ3 A;  4IQW A;  2KWU B;  5C1Z A;  1NVI D;  1B0X A;  2BCQ A;  2QIE B;  2BDU A;  5KHQ A;  5KG2 A;  5IIN A;  4DFM A;  5J29 A;  3A0B U;  3NOB A;  4F8R A;  4NJ6 A;  1OQR A;  2EDU A;  1U4A A;  3OJS A;  1KJT A;  4BKT A;  3H7I A;  2LYH A;  1YN4 A;  3WAM A;  1GO3 F;  1VZ6 A;  3Q8P B;  3F5A A;  2MBB B;  1ZPS A;  5KFL A;  2Q4T A;  3CMM B;  4HRO A;  1YX5 B;  1FNW A;  2D3A A;  5AM1 A;  1SE3 A;  5AKY A;  3GDX A;  1Q1O A;  2L52 A;  2JWZ A;  2IOH A;  1IG6 A;  5HI1 A;  4JV0 A;  1AAR A;  3KW5 B;  4TQ0 A;  3ZDD A;  1N63 A;  3NRW A;  3K9O B;  3SEN A;  5KFS A;  4RUA A;  2EAO A;  1JXL A;  1EM7 A;  2YVC A;  1J97 A;  4QZA A;  2KYW A;  2E1E A;  5L1M A;  5F9N A;  8ICA A;  1TS2 A;  4ELT A;  3Q8F A;  3QWZ B;  1COO A;  4RNM A;  1IGD A;  1Z5S B;  4BWM A;  2FLL A;  2IY0 B;  4AYB C;  5BOL A;  2WXJ A;  3GB1 A;  3ZDE A;  5KFC A;  3RNF C;  3BS5 B;  2IJ0 A;  1V1O A;  1E6E B;  3RD2 A;  9ICO A;  3VH3 B;  4RPZ A;  1L6V A;  4Q2J A;  4RGM A;  3SAH A;  2PKO A;  2K1F A;  1ISN A;  2BPG A;  9ICE A;  4HPM B;  1L2N A;  1UBQ A;  4ECY A;  2LYA A;  4PYU A;  1SGG A;  4YG2 A;  1C4A A;  2M0N A;  2D8C A;  1DGJ A;  3RJK A;  2JEJ A;  1QOF A;  3P4Q B;  1ZD4 A;  1OEY A;  2A1J A;  3TKA A;  2ZIW B;  1DRG A;  1MJD A;  3ML9 A;  1KSP A;  1Z00 B;  1OTR B;  5DLF A;  2G5H B;  2JVC A;  3V72 A;  4M6W B;  3DWG C;  5A0L A;  4CHK A;  1SL0 A;  3TAC B;  4P0P A;  3GIM A;  4P6V F;  7ICK A;  4A6Q A;  4ED1 A;  3MC8 A;  5TZV A;  3MC1 A;  5EE9 A;  3MDA A;  4JL9 A;  1H38 A;  4MT5 A;  2JF5 A;  4GLS C;  4R65 A;  5DB9 A;  2DWQ A;  1SWW A;  2PW9 A;  2LEK A;  2MWS B;  2W55 A;  1JAL A;  4DSK A;  1WGY A;  2QEJ C;  5IOI A;  2LHD A;  5ALS A;  1TJE A;  2KTR B;  5KFO A;  3DBR B;  1T94 A;  3VCB A;  4ED3 A;  2CU3 A;  1K1Q A;  5ALR A;  1PDX A;  3PR5 B;  2WS3 B;  3N4M B;  2GRI A;  3WK4 A;  2XID A;  5HP4 A;  2EAM A;  4DDG D;  3F53 A;  8ICQ A;  4PGQ A;  1D5Z C;  4LJO B;  3B2F A;  3DOW A;  3KBB A;  4EX6 A;  1BT0 A;  1CK1 A;  5J0T A;  1FNV A;  2AL6 A;  2KOX A;  2OYY A;  2W43 A;  3QQ8 B;  2GBK A;  3AQF A;  3FAH A;  4EZK A;  1ECW A;  2VJ5 A;  5EE3 A;  2ZIV A;  4M0W B;  2A3V A;  3QIJ A;  3WKB A;  4QWD A;  2KFK A;  2NCN A;  4OCZ A;  4NY8 A;  1MG4 A;  1V81 A;  2ZCC A;  1QOG A;  2ISO A;  1WZ3 A;  3ISD A;  1LV5 A;  4UB6 U;  9ICR A;  1UUP A;  2R18 A;  4TUR A;  4ECU A;  2ESE A;  1PFD A;  2ZVN A;  3CWI A;  2NO5 A;  4G3I A;  3JPR A;  4NJ7 A;  3R2T A;  1YQ4 B;  8ICH A;  4KLI A;  2MUT A;  5EWE A;  3IAS 1;  3IV6 A;  2K0P A;  3GQC A;  1N2X A;  4HPL B;  4L1B A;  4F5R A;  2PMV A;  1NK4 A;  4ZRJ A;  3LB8 C;  2KNB A;  3ZDM C;  2GBJ A;  4GSW A;  3RF9 A;  5J0R A;  3V7J A;  9ICL A;  3H9D A;  2JRH A;  1RG6 A;  1XSL A;  2N9L A;  3W1S A;  4FS1 A;  1RLF A;  3WCQ A;  3FC4 A;  5TIS U;  3A4R A;  3Q6B A;  3AEF B;  1HA5 A;  5JTI A;  4TUS A;  3PHX B;  2C2D A;  2BTE A;  2KVZ A;  3RR7 A;  4RMA A;  2DF4 B;  1XSP A;  1ZQO A;  3A4S C;  4Y2P A;  1QSY A;  2KZZ A;  1CQV A;  1PGB A;  2B3A A;  4BDP A;  2DAJ A;  4AYB F;  3R2I A;  4R3D A;  3HPO A;  3RJF A;  2D3D A;  3PW0 A;  4GDK A;  5J2H A;  1TAQ A;  2BPS A;  4I28 A;  4CF4 A;  2KWD A;  3NZ3 A;  1WXQ A;  2X8X X;  1EF5 A;  4Z6C A;  5DQI A;  2WX0 A;  2DYM A;  2KAC A;  2Z8L A;  4MEL A;  4Q43 A;  1KEJ A;  3KFU F;  4UAV A;  2FBW B;  5ALK A;  3E2E A;  2KLC A;  8ICB A;  3VDZ A;  3DBH B;  2LGS A;  1IGC A;  1P9D U;  2BYE A;  4F93 B;  3P1M A;  1BNP A;  4XGA B;  4C7Y A;  3VXW A;  3AE2 B;  4K3B A;  3AU5 A;  1U49 A;  4KLQ A;  5J0Q A;  2BZF A;  2HCF A;  2EMS A;  3C5F A;  3H0L B;  3KUZ A;  1TIF A;  4F2S A;  4DK5 A;  4FZM A;  5JH5 C;  1JRP A;  2C22 A;  4QWA A;  1WXS A;  4YD1 A;  1I4P A;  1L3V A;  4KIK B;  3U2S C;  1WGK A;  2WFA A;  3V6E B;  2WDR B;  2ZTC A;  3OJ3 A;  3ZD9 A;  8ICC A;  2KDE B;  3URY A;  4EZ9 A;  1KFY B;  1T5X D;  3EWA A;  5KFX A;  2F1I A;  4UB3 A;  2RRD A;  2BCV A;  1AYF A;  2VRR B;  1J19 A;  4KMU A;  3OJU A;  2M4N A;  5BMH A;  2IO2 B;  2LGI A;  4KLS A;  2ZEQ A;  1XT9 B;  2LVQ A;  5AK4 A;  3DHG C;  1V80 A;  1LVH A;  4CDG A;  4QZH A;  4KLM A;  1FXI A;  4KDL B;  3V3X A;  4P0Q A;  4HAI A;  1T6B X;  5AKI A;  5KFF A;  5BOM A;  3BK2 A;  4BBN C;  4F5N A;  1DOI A;  1P0R A;  1X40 A;  3SAG A;  3SR6 A;  3U26 A;  1L5P A;  1U47 A;  2HOF A;  3H1U A;  4OJ5 A;  2ES6 A;  4DXF A;  3BJY A;  2KEY A;  4BKS A;  3GZN B;  2XGQ A;  1O03 A;  2KQS A;  1HUZ A;  3PLU A;  3Q8B A;  4WWM A;  1B9R A;  3PO0 A;  4P7I A;  5AZF A;  4K3C A;  4EKU A;  1WX9 A;  4BVU C;  2N7J A;  3RAX A;  2PXI A;  2DHZ A;  1HEK A;  2ZXH A;  1ZQF A;  1C76 A;  2Q5W D;  3WIM A;  1WMH A;  1S3S G;  3WKD A;  4DCC A;  4KZ0 A;  3PX0 A;  4UAR A;  3QU2 A;  3BK1 A;  3B9J A;  2ATL A;  2EAN A;  1ZQI A;  2LVP A;  4F50 A;  1BGX T;  1MPE A;  2O6V D;  2ASQ A;  1WYW B;  2E5S A;  2NBW B;  2JYT A;  4IWQ A;  3PML A;  1XD3 B;  4OW0 A;  2IHN A;  4XE0 A;  3W5U B;  1V5T A;  2H3Q A;  4RQ5 A;  1R4N B;  4AUQ C;  1QH9 A;  1GB4 A;  4WQM A;  4W9F A;  4U6P A;  4CNQ A;  3M8R A;  2ZCB A;  2KMC A;  1R4M B;  2GBR A;  1WSP A;  4NM1 A;  1DOX A;  3KHH A;  2KX3 A;  4ZRQ A;  2KFZ A;  4GN1 A;  1LGR A;  4EZL A;  2KAJ A;  3DDC B;  4M8N A;  5DKW A;  4UBC A;  2HHT A;  2TSS A;  3H8S A;  4KLE A;  4OVV A;  3ZYY X;  1KFD A;  3AH7 A;  1VR9 A;  3UXN A;  2J4X A;  1F2R I;  4FFD A;  4ZRP A;  5KFR A;  5III A;  4QZC A;  4OZA A;  5KFW A;  2CN1 A;  3PS6 A;  3Q8R B;  1GNU A;  1C78 A;  3CST A;  5BMG A;  1Y56 A;  3TJP A;  4HYK A;  4ECW A;  1RM6 C;  1SXE A;  2NRW A;  2JT4 B;  3MJW A;  4LDT D;  4KLL A;  3EPG A;  4KIT B;  2C7M B;  3GIL A;  1XLN A;  1TKG A;  4GGQ A;  2HSZ A;  1JI7 A;  3JPQ A;  3APF A;  1RYU A;  2HD5 B;  4DOC A;  3Q8S B;  3RH6 A;  1Y88 A;  4AP9 A;  4Q45 A;  2IZV B;  4W9J A;  2VH2 A;  3KZX A;  5IIJ A;  2R8K A;  4ECR A;  3NVZ A;  4ZHP A;  2OJW A;  5KG5 A;  4KX5 A;  1WXM A;  5KFJ A;  3U30 A;  2H3Z A;  2KK0 A;  2YX8 A;  3DEE A;  4QWB A;  1D3Z A;  5KFG A;  4B9T A;  4MH0 E;  4ACO A;  4L23 A;  1PK3 A;  2K8A A;  1WF9 A;  1TZ1 A;  3DHI C;  2JEG A;  2JQR B;  3M8S A;  2R8J A;  3NJT A;  5H8Y E;  1WWU A;  4OJO A;  4ECS A;  4DSE A;  3AN1 A;  1WXV A;  1Q3V A;  2PFN A;  3C2K A;  2J6U A;  4QZD A;  2WLB A;  2H3V A;  2ZIU A;  2QAR A;  3QXG A;  4R66 A;  1A6S A;  5DB8 A;  3MC9 A;  1VDV A;  2A4Z A;  1ZQ1 C;  4BBN F;  3M1Y A;  2ZJA A;  1E7V A;  4PZO A;  4TUU A;  3VRB B;  4DQQ A;  2IGG A;  3QK0 A;  1X9S A;  2RPV A;  1TK8 A;  1NZB A;  2RPQ A;  4E0D A;  2JPH A;  2SAK A;  1DK3 A;  4UAW A;  2NVU I;  4K4H A;  4DSJ A;  3B0A A;  3LYY A;  4AWJ A;  4KGT A;  2AJQ A;  4C4T A;  4US9 A;  1UNS A;  1DK2 A;  3JVZ X;  1E0Z A;  2WF7 A;  4KDI C;  5J2D A;  2LUM A;  5JXV A;  4LZG A;  1V1P B;  2RLT A;  1D8Y A;  3B0Y A;  1ZUD 2;  3V7L A;  3DBH I;  1LB2 B;  4FO6 A;  1NYR A;  5DQG A;  4JQW C;  3J81 j;  2KFN A;  2MEK A;  1M4V A;  3ALR A;  8ICE A;  4Y2U A;  4MFC A;  1O08 A;  1ZQA A;  5J18 A;  4OJ6 A;  1NKC A;  4I27 A;  8ICP A;  5CHG A;  2Y1J A;  4LLG M;  2E8P A;  3T3O A;  3AEV A;  3BQ7 A;  3HKZ C;  1WG8 A; 
#chains in the Genus database with same CATH homology
 1AN8 A;  2YEP B;  1V8C A;  4A9A A;  3Q8E A;  2WXM A;  2KQ4 X;  4RGN A;  1WYG A;  1FO4 A;  1TS4 A;  2Y3A A;  3AE7 B;  3AEB B;  5GXG B;  4TQ1 A;  1FCL A;  4O1N A;  3UI3 A;  1I4X A;  5HG2 A;  4EE2 A;  2L83 A;  1SF0 A;  1TY2 A;  4ZOH C;  3ZJV A;  3V05 A;  1K53 A;  1V1P A;  1HXY D;  1JML A;  1F0Z A;  3PZ8 A;  4OVZ A;  3TEW A;  3C8Y A;  3R8B A;  1JWU D;  1BML C;  2WP9 B;  1YN3 A;  1STE A;  2JXT A;  3BWU D;  2SEB D;  2V3P A;  3U4E G;  3PZ7 A;  1XXG A;  3KWL A;  1K52 A;  2AQ3 B;  3AB5 A;  3GP7 A;  4JX1 C;  4N59 A;  3IT6 B;  2DYO A;  1D5X C;  4CQN A;  4J3O D;  4YTN B;  3BYT B;  4B0M A;  2J42 A;  2JYE A;  4ZHO A;  4ARI A;  1PUT A;  3J9C A;  1J7A A;  1SSN A;  2DBY A;  3RFZ B;  2RMM A;  2N0S B;  1SEB D;  5BMI A;  4WH4 A;  1YNT E;  3AMZ A;  2WDQ B;  1XF5 L;  1ROE A;  3FIL B;  1LO5 D;  1GPX A;  5BYQ A;  3MHZ A;  4WIP A;  1NVI D;  4XDC A;  2LMC A;  2QIE B;  4RF0 A;  3HRD D;  3NVW A;  1TY0 A;  2WXQ A;  2WXK A;  1FD6 A;  2GI9 A;  1Q10 A;  3AE9 B;  1JWB D;  2PIA A;  1OQR A;  1N60 A;  2I2Y A;  3AE5 B;  2ONQ A;  4YTP B;  2YEP F;  1BUI C;  1YN4 A;  1YN5 A;  2WU2 B;  1D5M C;  1VZ6 A;  3W9C B;  1ZPS A;  2BT6 A;  4HRO A;  4RNA A;  2W3R A;  2MJ3 A;  1FNW A;  2WXO A;  4FXC A;  2H88 B;  2QSD A;  3MJ5 A;  1N61 A;  4XDD A;  1SE3 A;  2L52 A;  5E6J A;  5HI1 A;  3EUB 2;  2BBC A;  2BW2 A;  1I4Q A;  1NEK B;  4DXG A;  4TQ0 A;  1N63 A;  1EWC A;  1SE4 A;  2KDM A;  3P42 A;  3HVZ A;  1SB3 C;  4WAF A;  1EM7 A;  1N5X A;  2FUG 1;  3TUO A;  1ZE3 D;  1TS2 A;  3Q8F A;  2QIL A;  2XNA C;  4KKI A;  4REZ A;  1IGD A;  4NAW B;  2WXJ A;  3GB1 A;  4PT5 A;  1AW7 A;  4JWU C;  2IJ0 A;  1V1O A;  4NJC A;  1E6E B;  1QOB A;  2M0A A;  1L6V A;  4Q2J A;  4RGM A;  2AX5 A;  2PKO A;  3KQ4 A;  1NI3 A;  2LHE A;  1E7P B;  2VZK D;  1C4A A;  1F2R C;  3T3N A;  1UGJ A;  4L2Y A;  1DGJ A;  1B1Z A;  1QOF A;  3OWE B;  3P4Q B;  1KLU D;  5AUI A;  3AEA B;  1IBX A;  1I4G A;  4RCO A;  2BYT A;  3GS2 A;  4A55 A;  1ZOY B;  1JQ4 A;  4WUR A;  5D7G A;  3DWG C;  4LTU A;  4A8X C;  2NTT A;  2JWU A;  3NS1 A;  1YQ3 B;  4P6V F;  4A6Q A;  1JWM D;  5EE9 A;  4MT5 A;  4YWG G;  4N58 A;  2KMM A;  3MP9 A;  4RFB A;  4GLS C;  1HQR D;  1YJI A;  1C4C A;  2E6X A;  2WNM A;  1L6U A;  2DWQ A;  1HZ5 A;  1FRR A;  2PW9 A;  3E9S A;  2LEK A;  2W55 A;  1JAL A;  2OHF A;  2QEJ C;  4TSS A;  2LHD A;  5C2T B;  1TJE A;  1SIJ A;  3ZJU A;  1HZ6 A;  1YMH E;  3SFE B;  1ZP0 B;  1EWY C;  4AQ7 A;  2CU3 A;  3MC0 B;  3KWV A;  1RFK A;  3VR9 B;  1F77 A;  1PDX A;  4MH8 A;  2WS3 B;  2GRI A;  1DOY A;  1D5Z C;  1J7C A;  5C3J B;  3EGR A;  2ACZ B;  4ITK A;  2J52 A;  3B2F A;  3AE8 B;  1KRH A;  2HDE A;  1CK1 A;  2E3T A;  1FNV A;  2V3N A;  1UWX A;  5MPO A;  3ETR A;  3SFD B;  4JWS C;  3Q8A A;  3FAH A;  1XLO A;  5EE3 A;  2QJL A;  2WXL A;  2IPK D;  2B76 B;  3NVY A;  1OFF A;  1RWS A;  1QOG A;  4GDK B;  1UUP A;  4RF1 A;  5D3D A;  3AM9 A;  2PVO D;  1JWS D;  1PFD A;  3CWI A;  1CJE A;  2ZW1 A;  3R2T A;  4KX6 B;  1YQ4 B;  2Y5P A;  3IAS 1;  2K0P A;  4IOI E;  3BZD B;  2WDV B;  4L1B A;  2PMV A;  4TMA B;  1J7B A;  3LB8 C;  5BYS A;  4XWT A;  1RYJ A;  1SJH D;  1QKZ A;  1ET6 A;  1TS5 A;  1MHH E;  2N9L A;  4AS1 A;  2K3U A;  3W1S A;  3P4R B;  1ZXH A;  2JSV X;  3LXF A;  1D6E C;  3FC4 A;  3P4P B;  3WCQ A;  2LJI A;  3AEF B;  1HA5 A;  2BTE A;  5I4D A;  3TSS A;  2FE8 A;  4M0W A;  1FFU A;  3TEZ A;  2WXP A;  2INN E;  1CQV A;  1PGB A;  1L0X B;  1T3Q A;  1IBX B;  3TEX A;  1JWA D;  3R2I A;  4R3D A;  1FIQ A;  1QIL A;  3IXS A;  4RGO S;  2IGD A;  3W2D A;  2KWD A;  3IT4 B;  3NZ3 A;  1WXQ A;  2W3S A;  1L4Z B;  2DYM A;  2KAC A;  2Z8L A;  3ABV B;  3AE1 B;  1SXT A;  1A70 A;  1TS3 A;  4KGR A;  1VLB A;  2FBW B;  2IGH A;  1FNU A;  1IGC A;  3TEY A;  3P1M A;  4C7Y A;  1XEE A;  3AE2 B;  1KH0 A;  3BVM A;  5HHD G;  3IAM 1;  3AE3 B;  3Q8C A;  2M19 A;  2V4I B;  2VZK B;  1JRP A;  4HJG E;  2INP E;  3I9V 1;  1SJE D;  1I4P A;  2DLB A;  1SBB B;  3U2S C;  1WGK A;  2CJO A;  2WDR B;  4XWW A;  1TKY A;  2I38 A;  1I7H A;  4HRS A;  3URY A;  1KFY B;  1T5X D;  1L0Y B;  4B0E A;  3BVZ A;  3N9Y C;  5EE1 A;  4YXD B;  1AYF A;  2W54 A;  5HFY A;  1EU4 A;  4A90 A;  1CZP A;  5BMH A;  2LFI A;  2LGI A;  3NUH B;  1JCK B;  4YTM B;  2ZW0 A;  3AEG B;  1GOZ A;  1XCT L;  1VZ7 A;  4KGS A;  4N6E B;  3U52 E;  3ZGZ A;  2RDG A;  1FXI A;  4C56 C;  3V3X A;  2ON8 A;  1ZDV A;  1MI0 A;  1T6B X;  5T8I A;  3BK2 A;  1DOI A;  4RH6 A;  4HEA 1;  4JE3 B;  1TYG B;  4NAM A;  1ZDX A;  3SR6 A;  1L5P A;  2EEL A;  4NZL B;  3CIR B;  1FRD A;  3HVD A;  4DXF A;  4KKJ A;  1GAQ B;  3AED B;  2JX5 A;  1QT9 A;  3Q8B A;  4C7Z A;  1NYQ A;  4WWM A;  1B9R A;  4YSZ B;  3PO0 A;  1GB1 A;  1E10 A;  3SEB A;  1PGX A;  3VQI A;  2J53 A;  2N7J A;  5D3I B;  5FKA C;  1VJK A;  5FR3 A;  1C76 A;  1L0V B;  1JRO A;  2Q5W D;  4OHJ A;  4RGT A;  2JZP A;  1E9M A;  3BK1 A;  3B9J A;  1TKE A;  1L4D B;  3O13 A;  2G1E A;  4UDU C;  3RPF C;  3HUI A;  1XCQ L;  1MPE A;  2JYT A;  1QF6 A;  4OW0 A;  4XE0 A;  3W5U B;  2X38 A;  1TZO A;  2WXH A;  1GB4 A;  1EU3 A;  4WQM A;  1HEZ E;  1P7F A;  2AQ1 B;  3BYY B;  1XLQ A;  1PYW D;  1WSP A;  3I57 A;  1DOX A;  3NRZ A;  4ZRQ A;  3VRA B;  2MJD A;  2KAJ A;  5EE0 A;  1FM0 D;  4GDL B;  2BS3 B;  2TSS A;  1OQQ A;  1MHX A;  1K51 A;  2WXR A;  1WRI A;  3ZYY X;  1JW9 D;  1KLG D;  3AH7 A;  1C77 A;  1FEH A;  1QLB B;  4MAC A;  3BVG A;  4H2A A;  1VR9 A;  2WXN A;  2BS2 B;  2J4X A;  1SE2 A;  4YSX B;  1F2R I;  4IDI A;  4ZRP A;  2NMQ A;  5G5G A;  1V97 A;  2WU5 B;  2Y5C A;  3E56 A;  4USA A;  1K50 A;  4OZA A;  4LK0 M;  3MFG A;  5LNK 1;  1FXA A;  1C78 A;  5BMG A;  1Y56 A;  5TSS A;  1FCC C;  4OZB A;  2W82 A;  2K9X A;  1RM6 C;  1ACC A;  2BS4 B;  2PTL A;  2K22 A;  1XLN A;  1TKG A;  1AWD A;  3H8H A;  4DQO C;  2G9H D;  1I4H A;  4C80 A;  1ET9 A;  1UWM A;  2L1A A;  1ENF A;  4JPS A;  1WWT A;  3AE4 B;  5BYR A;  3P4S B;  2IDY A;  1XLP A;  3NVZ A;  4ZHP A;  4YSY B;  3W5V B;  1DYQ A;  2GB1 A;  3Q69 A;  1ESF A;  3AV8 A;  4L23 A;  3ZQ4 A;  2PLP A;  2KN4 A;  5AUK A;  2V0G A;  2H89 B;  2RDH A;  1FFV A;  1QOA A;  2MH7 A;  2JQR B;  3DWM A;  2WXI A;  5H92 C;  2WXG A;  4US8 A;  5H8Y E;  2WQY B;  1C4P A;  1IUE A;  2PVG C;  1FMA D;  3AN1 A;  4IKG A;  3U7Z A;  2BB6 A;  3FIL A;  2EKI A;  2WLB A;  5G5H A;  2ICI A;  2JU6 X;  1VDV A;  1P7E A;  3BII D;  4P16 A;  3KLS X;  4YT0 B;  1R7S A;  1PGA A;  2AQ2 B;  2WXF A;  2M56 B;  3VRB B;  2IGG A;  2RPV A;  2BB5 A;  2OED A;  2SAK A;  3LYY A;  1C79 A;  2L32 A;  4HKZ E;  4KGT A;  4US9 A;  1UNS A;  3ZJT A;  1E0Z A;  1BXT A;  1YJJ A;  2LUM A;  5JXV A;  1N62 A;  1V1P B;  1C9F A;  1KF6 B;  2R61 A;  1ZUD 2;  1VRA B;  3B2G A;  3AE6 B;  4HKQ A;  1D4B A;  2CJN A;  1XO3 A;  4ZYS A;  1NYR A;  4OZC A;  5FK9 C;  1VZ8 A;  1N5W A;  4D2K A;  1NEN B;  3NVV A;  1I4R A;  2MJE A;  1MVK A;  2MEK A;  1M4V A;  2XN9 C;  1QQR A;  3AEE B;  2NTS A;  2D5G A;  4ARC A;  1KTK A;  3L4P A;  3VR8 B;  3AEC B;  3EA6 A;  2K5P A;  2QMT A;  3P63 A;  4MM3 B;  1ZXI A;  2N9K A;  4LLG M;  3T3O A;  2HTM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...