1U4BA

Extension of an adenine-8oxoguanine mismatch
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 213
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u4bA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u4bA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u4bA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u4bA01
4KHSA 3C2KA 4I2HA 3OYAA 8ICRA 2XO7A 2IS3A 4DS5A 1SKRA 1ZETA 4DTOA 5DLFA 1J54A 2G8HA 3JPNA 3LP1A 4PGYA 2R8JA 2VA8A 5KI6A 1XS9D 4YMNA 3HSTB 1TK8A 3SUPA 3RMBA 2IBKA 5KFQA 4QZAA 1NJYA 4PH5A 3H8SA 1IG9A 1W0HA 1TAQA 5KFDA 3NH1A 4CK1A 3SPZA 4DSIA 4F3TA 1BISA 2ZD1A 4M6WA 4DFJA 4CEQA 1BPZA 3OYGA 9ICQA 5DGBA 3C23A 4OKEA 5KT6A 2PXIA 4OGCA 4I2EA 1WAFA 1I3AA 3HM9A 3AU6A 3V9WA 1ZQUA 3DMJA 4ELUA 8ICTA 1BL3A 4CHOA 3LALA 4FZXC 3K5OA 5J0TA 2HMIA 1S0NA 4AHTA 3OVNA 4O9MA 1VSIA 3KK2A 5KFCA 3IRXA 3LWMA 3HW8A 8ICKA 2J6TA 1CUKA 4LY7A 4NCGA 3VQ9A 3LP0A 4IQTA 1ZQJA 5C5JA 2P51A 2BCRA 1LAWA 3AVAA 4FJ8A 1NJWA 4BE1A 1RT3A 3QEIA 1U9LA 1J9AA 1B9DA 2BPCA 5KFRA 4E7KA 2YNFA 5HMMA 3RMAA 1BIUA 4MF2A 3NGYA 5BOMA 3L3UA 2BKEA 3V1QA 5DK5A 4E89A 1X9MA 3QIPA 1MC8A 1ZBLA 5KFHA 2XY8A 4F5NA 2E4LA 5SZTA 1JLCA 4DLGA 4RNOA 4CERA 4UAWA 8ICUA 4DL4A 3PW5A 3SQ2A 1EP4A 4PWDA 1C7YA 1KVCA 1ZQMA 8ICIA 3H08A 3PX6A 4DQQA 3SZ2A 4R8UB 4KPYA 4J9RA 2W9BB 4BGDA 2W9CB 4YMOA 4H4OA 4LD0A 4R66A 3V6HA 3SNNA 2D0CA 1T7PA 3HJFA 3AV9A 4NYNA 4J9QA 4PQUA 1U4BA 1SL1A 3GFKB 3RRGA 4EP4A 1GOAA 3PR5B 1G15A 2OPRA 3TQ1A 4Z4GA 5FRMA 3WNEA 5IIOA 4GLXA 3L2WA 3VQ7A 4TQRA 4F2RA 7ICSA 3OGUA 2IA6A 2Y1JA 7ICTA 4FZZA 4RQ6A 4C8LA 2AU0A 2ETJA 3L2RA 5CB1A 4LZDA 1ZBHA 3SI6A 2XY7A 4IFYA 4W5QA 4MEYA 2RKIA 4ECXA 4QW8A 5J0UA 2QKBA 3OYHA 8ICFA 1EXNA 3BQTA 4CGGA 2BCSA 8ICBA 2IOCA 4M04A 4DOBA 1XI1A 5KT5A 3DLRA 4QZGA 7ICKA 5J2DA 5J0SA 4CK3A 4BDPA 5D3GA 7ICPA 1XC9A 4HVJA 3DI6A 4DL3A 3DLBA 4PHEA 5KFBA 2Z1HA 2W9BA 3RH4A 4KO0A 1SL0A 2IHNA 4RNMA 2W9CA 3H4DA 1TL3A 3G10A 3GIJA 1BQMA 1S0VA 1NKCA 4K4GA 3DLEA 1HUZA 4CHYA 2BDPA 2Z1GA 1CXQA 3S3NA 3RMDA 5FRNA 3MR2A 4B9NA 4L8RB 4QZIA 3T3FA 3JPPA 4H8KA 4HCCA 5L1IA 1A76A 1TV9A 3RB4A 9ICOA 3LPTA 1REVA 8ICNA 9ICTA 3V1RA 1DLOA 1KLNA 2V4QA 4KHYA 3K75D 2AQ0A 5KFAA 1WLJA 1S1VA 3M8QA 5DQHA 4KLSA 4ZTJA 4KLLA 1DTTA 1WSIA 2W9AA 7ICOA 4CECA 4KI4A 4CFCA 3NTUA 3OYBA 2I1QA 4I7FA 2JLEA 4ECVA 9ICCA 2NRZA 1HMVA 2ASLA 3BQ0A 2OA8A 4I2BA 3MGIA 3VA0A 1ZQDA 1UA1A 4EBEA 4RQ7A 9ICNA 2W9MA 2FPKA 4JV1A 4Q43A 2BGGA 4CHZA 4RZRA 2ASJA 1KSPA 5KFTA 4JS4A 4FM2A 3Q8KA 4CE9A 5L1JA 1WSFA 4HHTA 1S0OA 2ALZA 1TVAA 4CGFA 4O0IA 3K2PA 4CCHA 2VANA 4F5QA 4DTNA 3ZSOA 2W8KA 4DF8A 4KLHA 2ZQBA 3RR7A 3NHGA 1HJPA 5DB9A 2XCPA 4CEDA 1VSJA 4I27A 3QEPA 4Q8EA 2P66A 3N97B 4QOZB 2PI5A 2BGWA 4NLKA 4FLWA 4K4IA 1S1XA 3ISNC 3MEDA 2VWJA 4EP5A 4I2AA 2WTFA 3MR3A 3KIOA 1WSJA 3KHGA 3LPUA 3JPSA 5KG1A 4ZTFA 5BOLA 1V9PA 3LWLA 4CJ5A 1RCHA 1X1PA 5C42A 4ZHRA 3ZDAA 8ICCA 1J53A 3EPIA 4ED8A 3QESA 3NAEA 3JYTA 3TARA 3OSPA 4PHDA 1L3TA 4Y1CA 2FMSA 3K5LA 3EW9A 2B4JA 4RQ3A 1LWCA 1LWFA 1D9DA 8ICZA 5KFGA 5J1EA 3VQPA 3CYMA 3BQ1A 2BPFA 3QETA 4OJRA 8ICYA 3HK2A 5F9NA 4CJ4A 3IAYA 3OS2A 1GOCA 5CA7A 4RW6A 3OYKA 5KG4A 7ICQA 2IMWP 4FM1A 4FCYA 4Z6CA 4FJ5A 4CJVA 1PZNA 4FW1A 1I39A 2A1RA 3JPTA 1WSGA 4AILC 4J9NA 1HJRA 2NRXA 1BVSA 1RT1A 4DTRA 3HVRA 5DDYA 4MF8A 4PGXA 3AU2A 4CEZA 2E6MA 3M9MB 5TZVA 4IR1A 3Q8MA 4J9SA 1MQ3A 3GV8B 3BJYA 3K4GA 1ZQOA 4AH9A 4ED7A 3M8RA 4CIEA 3QEAZ 4F8RA 3ZSVA 2KTQA 4P4OA 1JXBA 1RBSA 1TVRA 4QZHA 4PHAA 3C6TA 2AGQA 2R7YA 4KTWA 3MXIA 3PV8A 4G3IA 1IKWA 1XHXA 4NCAA 3T5JA 2C28A 2PYJA 1ZQGA 5IIMA 3ORYA 3RB3A 1NK8A 4KLMA 2FLLA 4F4ZA 4LH5A 4ECRA 1XSPA 1U45A 1RBTA 3MR6A 3LP2A 2IGIA 4ELTA 2YKNA 4M41A 4Q44A 5HHIA 1RT7A 2DPIA 2P6UA 4DSLA 1TK5A 3TAPA 2YNIA 4N56A 3U3YA 1QSYA 2RPIA 3RB0A 3AVFA 3GDXA 3ITHA 4CGHA 4FK0A 4RU9A 3LAKA 4QZFA 5HROA 3ZCMA 4FJ9A 4CJFA 1JL2A 1S6QA 1YTAA 1S5JA 4DOCA 3QINA 2ZTCA 3E2EA 1TAUA 4M3RA 4I2PA 4O5KA 1WSEA 1IXRA 2KZ3A 2MUTA 1S1WA 8ICXA 5HRNA 1EETA 5J0RA 2B6AA 4FJNA 3VQ6A 3ISCA 3OYDA 3PW4A 2C2EA 2LYHA 9ICXA 1BI4A 3VQCA 4FLZA 2ZJAA 3ZDDA 1HNVA 2UVWA 2HVHA 5CZ2A 3SUQA 2R8IA 3HPGA 3V1OA 1U48A 4W5RA 3OYFA 1YT3A 4M9GA 4YP3A 3D0PA 3RMCA 3AVKA 4IRKA 3PO5A 2XHBA 2BQRA 2PFNA 1RT4A 1YTUA 4FK2A 1WCLA 4B9SA 4I2CA 4UB5A 4UQGA 3ZSZA 2FBYA 3KK1A 3QNOA 3B0XA 3GIMA 4EBDA 2UVRA 3MGHA 3T1AA 3EPGA 3AUOA 1CZBA 3H8WA 4TUQA 1HNIA 4DU1A 7ICRA 2BPGA 4IQVA 1T3NA 3ASMA 4M45A 1HUOA 1VSLA 4KMUA 4FM0A 4RQ8A 2YNGA 1QHTA 3ZSXA 3EY1A 4CEAA 4EEYA 3MABA 4DTSA 1Z25A 5KT7A 2YHAA 3AVBA 1S10A 4M9LA 7ICIA 1Z00A 2FMQA 2OZSA 4KLUA 3ULDA 4OVLA 2AJQA 5J0QA 3L2QA 5JUMA 3U6FA 3F9KA 4NM1A 2VA3A 7ICLA 5J0PA 4UAZA 2X74A 2JEJA 5J0XA 5SWMA 9ICUA 4FVMA 1S77D 4ICLA 4YFUA 2RDIA 9ICRA 3D45A 2ATLA 1WCNA 5F9LA 5CWRA 4F93B 4M3YA 1D5AA 5L9XA 4GXIA 5J0YA 5JS1A 3RBDA 2H5XA 3VQEA 4IG3A 3RJHA 4CIGA 1LAVA 3VQ8A 4KB0A 2BANA 8ICVA 3QEVA 4R64A 3SV3A 4HCBA 4M3TA 5J2MA 3NH0A 3ZT0A 3F73A 3RB6A 3OY9A 1S1TA 3PW0A 4K4HA 2P5OA 1N48A 1EKEA 4UAYA 3V6KA 4KLOA 3C21A 4J9MA 7ICJA 1RXWA 3T5LA 3HT3A 1EXQA 4O3QA 4DFKA 2G8VA 4TURA 4YMMA 5KFOA 4G1QA 4TUSA 5DBAA 3RH5A 3NE6A 4FLTA 3SQ0A 5EOZA 1TKTA 1EX4A 3VQDA 4FJLA 4TUPA 3IM1A 4UB3A 1JLEA 3PX0A 1RILA 3IHQB 4OPJA 4FJJA 4CJKA 4DS4A 4NY8A 2KZZA 4O5EA 4DOAA 4I29A 2BE2A 2QKKA 2ZTDA 2FBVA 3AVNA 5KFUA 4O4GA 3RJGA 3OJSA 4J2EA 3FYHA 4IKFA 4KLTA 4ECYA 4M0AA 3HP6A 4KHQA 3TAEA 3AVIA 4M42A 8ICJA 2AGPA 2HHVA 4CFAA 3VQQA 4AHCA 2F8SA 4F4KA 4GMJB 3L8BA 2F96A 4YFKA 1N6QA 3FFIA 2Y1IA 5DG7A 4YNQA 5KFPA 1MU2A 1ZQAA 5IIKA 9ICFA 1L3UA 1ZQPA 1ZQFA 1QQCA 1BCMA 5L1LA 7ICHA 3NF6A 4KN7A 4Z6FA 5DLGA 1NK5A 3NGZA 4ZH4A 5KTQA 2JEFA 7ICNA 1ZQTA 4FYDA 2J6UA 3LZJA 5IIJA 5DB6A 3RBEA 2FLNA 1KLMA 1NK0A 5KFEA 2F1IA 3KHLA 4FJGA 5IIIA 3V9UA 4M3WA 4BACA 5D46A 1MQ2A 4F50A 4RT3A 3AA4A 4ED0A 5I42A 1S1UA 3SJJA 4KKOA 1TK0A 1TKXA 3AO3A 1B9FA 2G8WA 3PNCA 2HNYA 4DSJA 5D49A 3KD1E 4FBTA 2Q3SA 4KREA 3WNHA 5HRSA 3GQCA 8ICLA 1NK4A 2XY6A 4YG2A 3ZT4A 1R0AA 1RTJA 5EWFA 1JLQA 1IKYA 1AROP 4JRPA 5KFYA 4F5OA 1Q8IA 4OKJA 2GV9A 4FLXA 4CF2A 5KG2A 1KTQA 3C1YA 9ICHA 1RT2A 5HBMA 2JZBB 2DY4A 3SQ4A 3UIQA 1HPZA 2MAXA 3OSNA 4NLNA 5CYMA 1QE1A 3A2FA 8ICAA 2W42A 4KLJA 4RPXA 3DLKA 1TFRA 4B9LA 4GW6A 3EYZA 2F8TA 4NCBA 1QTMA 1RBVA 1S9GA 1Q9YA 1CZ9A 2PI4A 5CP2A 1RBUA 2OWOA 4UBCA 1LWEA 5KFNA 5KG5A 4LH4A 2FBTA 4XUSA 4N76A 4B8AB 4UB1A 4FBUA 4O3OA 5FROA 4DEZA 4KFBA 3T19A 3AVHA 4DQSA 4PHPA 2PFQA 7ICFA 4DWIA 2G8FA 2BCUA 4E7JA 3PW2A 3CFRA 2ISOA 1WN7A 4CJTA 4XIUA 3Q8RB 4MQ3A 4DQPA 2O4GA 1BQNA 5FDLA 4FJIA 4J9LA 1B22A 1QSSA 3KLFA 4DFPA 2VWKA 4KTQA 1N5YA 4O5CA 1TV6A 2X78A 2ZTEA 3P83D 3V6JA 2DPJA 7ICUA 2BQ3A 3C95A 1CLQA 3AVGA 2PZSA 1NOMA 4QWAA 4DG1A 2HB5A 3RAXA 4RPYA 4BWJA 4CJRA 3TFRA 3B0YA 1IKXA 3AVLA 3SUOA 4M9NA 8ICEA 5DGAA 3DLHA 2JZBA 4E1NA 3UXNA 2C22A 5EU7A 4QZBA 2D5RA 2OPSA 5KRSA 3C1ZA 4I2FA 3AO2A 3DRPA 4R65A 2EHGA 5HRPA 4I2IA 3I8DA 1S0MA 1LW2A 4Z4EA 1SZPA 1ZQSA 4QWBA 1VRTA 4RUAA 5J2CA 2C2RA 4O3SA 4DQIA 1WSHA 4DMNA 3LAMA 5J2HA 4I9LA 1IO2A 3DOKA 3GILA 4OLAA 2BCQA 2XGQA 1NKBA 1DTQA 4FK4A 3DRRA 4RPZA 4YD2A 9ICSA 3KTQA 1BIZA 3K5MA 1KFDA 1VRUA 4DF4A 3MECA 2J6SA 1KFSA 4BXOA 3PO4A 4DLEA 2FPMA 5KGXA 1RDDA 1S9FA 4FXDA 3NBPA 4KN4A 3QO9A 7ICMA 2Z1IA 4KHNA 3S3OA 3QIOA 4PY5A 1S9EA 2FPLA 4KLEA 4NLGA 1ZQVA 1NKEA 2G8KA 4YXMA 4X5VA 1GOBA 3OYIA 3MAQA 3EZ5A 8ICQA 4E19A 2HVIA 1BCOA 4HUGA 4FLYA 4CJWA 3TAFA 5J0WA 2ISPA 4KLIA 2OZMA 2ZJ5A 4KB1A 1NK9A 2ZE2A 1A77A 4DO9A 3E01A 2YNHA 3SUNA 3KD5E 3V72A 2DFFA 4XRHA 4QW9A 4MFFA 3TANA 2A1JA 1HYSA 1D8LA 5DQIA 1FKPA 1K6YA 3ZD9A 1KVAA 5K14A 4FJ7A 2KFNA 1UT5A 3AVJA 3IG1A 3LANA 3UPQA 5L1KA 4M3UA 1C6VA 1SKWA 5J2NA 3HX0A 1LV5A 2HHWA 4M9JA 4OLBA 4O3RA 1S6PA 1ZJNA 1KDHA 5DKWA 2VG7A 3ZT1A 2HW3A 3JPQA 3ZSRA 3WNFA 4FS2A 3OJUA 3WNGA 4JV2A 4E3SA 3VQ4A 4ECZA 1VSKA 3CG7A 3ETLA 1XSLA 1QS4A 5KFSA 1NJXA 4AHUA 5DMRA 3VA3A 3KHRA 2MUTB 2GWSA 9ICJA 3OHAA 3V9XA 4CJQA 3OS0A 3H7IA 5J2BA 2NUBA 3ZSWA 3T5KA 1B92A 3BDPA 1A5WA 4BDYA 1BI4B 4R63A 3LDAA 3V4IA 9ICGA 4W5NA 4CJPA 4F5PA 4JUZA 4CGIA 3OYCA 3SPYA 4KRFA 3RWUA 1B43A 4Q5VA 1RT5A 3PR4A 4IG0A 2HHQA 3JPRA 2FMPA 3AA2A 3HO1A 4RW4A 5J29A 1ZQKA 3KLGA 4K8ZA 1WNSA 4IFVA 1RTDA 1VSDA 4WE1A 1JMSA 3C6UA 4ID5A 4B9VA 1BPEA 4E7IA 3RJIA 3UQ0A 4YVZA 4YN4A 4R5PA 2EX3A 1TGOA 5J2QA 2JEGA 4CFBA 3NH2A 4IRCA 4NLZA 4MEXA 2YV0X 8ICSA 5HLFA 4DL6A 1K1SA 4RG8A 1Z00B 4RQ5A 1ZQLA 4RW8A 4F2SA 5DG8A 2GBZA 5KFJA 1BHLA 1C1BA 4JRQA 4BE0A 5KRTA 3MBYA 2HHUA 4HYKA 8ICGA 3RJKA 4FJXA 1ZQXA 3ISDA 2VG6A 3M8PA 4TSXA 3MXMA 3QEXA 3S3MA 3CFPA 4YR3A 2V4RA 1C1CA 4Z0UA 2B5JA 4KLGA 3OYLA 4I9QA 4QZEA 4RUCA 3OS1A 5CY4A 4CEFA 1JIHA 2X6SA 3CM5A 4GC6A 3M9NB 4I2JA 3LK9A 4FLUA 4J2AA 4QZDA 1COOA 3P1GA 3HWTA 3O3HA 4C8NA 1L3VA 4LSLA 3HP9A 1Z3EB 2WONA 5KFXA 4KLDA 3T5HA 4N47A 1X9WA 3C5FA 5E41A 1SV5A 4DTXA 1ZBFA 4ECWA 4ED6A 4P4MA 8ICPA 1JLAA 4I2QA 3V81A 4MFCA 1JL1A 3QZ7A 4RQ0A 2BR0A 4DU3A 3P5JA 3VQ5A 1K1QA 3JPOA 4ED2A 4IR9A 4C8OA 2O4IA 5BPCA 5J2IA 4FJHA 4KITB 4CF8A 4OGEA 3MDCA 3K5NA 4XA5A 2M9NA 4KLQA 4N41A 3VQBA 2G8UA 1VSHA 2R8KA 4FO6A 3PMLA 4CJUA 4FJKA 1NJZA 4W5TA 5KG3A 3MR5A 4QWCA 4CJ3A 1UWBA 3L3VA 1IH7A 3UXOA 3K58A 4F4YA 2XCAA 8ICOA 4DL5A 2X6NA 3AO1A 4AHSA 4W5OA 1Y88A 4CHPA 4QZ8A 1ZBUA 4PUOA 4EYIB 3K57A 2V9WA 3RAQA 4KLFA 4MFBA 3OYMA 4FLVA 4M2YA 5J2GA 2UVUA 4CF0A 3O3FA 1D9FA 3C2LA 3LZIA 3TABA 2NRWA 4O3PA 2A1SA 2F1HA 3ZSQA 1HQEA 3CM6A 3I0RA 1UAXA 1RNHA 4DTMA 4DL7A 5J0OA 1ZQYA 1KCFA 4RQ2A 3ISBA 3KLIA 5KG6A 4DTJA 4B9TA 5J2EA 4P4PA 5J2FA 4M3XA 2R8HA 3V7LA 4B9MA 4CIFA 4I2GA 1HYVA 1KFTA 3HPHA 3OHBA 5CJ7A 4O0JA 3LDSA 3LP3A 5KFVA 2OYQA 1UT8A 1U47A 1ASVA 3RJEA 3BGRA 3H4BA 1FK9A 1NK6A 4Z6DA 2HNDA 3AO5A 1ZQWA 3Q8SB 1VSFA 2DFEA 4B3OA 8ICWA 3KK3A 4DFMA 1RPLA 3NGDA 1MSWD 3AA5X 3QE9Y 3MDAA 2YHBA 5KFMA 2WOMA 1BPYA 2LSNA 1X2IA 3OYEA 7ICGA 2OPPA 1RYRA 5HMLA 3NGIA 8ICHA 1RBRA 1O1WA 5J2AA 1YVUA 1ASUA 3KJVA 3RJJA 1VSEA 1DGSA 1BGXT 1ZQCA 1RXVA 4RQ4A 1SKSA 5DB7A 2KFZA 1IKVA 5KT4A 4F4WA 1KEJA 1HRHA 3UQ2A 3ZT2A 3Q8PB 1F21A 4YR0A 5EWGA 4QZ9A 5KFKA 3M8SA 7ICVA 4DSEA 5JS2A 4J9PA 4NXZA 4B8CA 3THVA 3Q8LA 3GV5B 4KV8A 1XO1A 1C0UA 1ASWA 3TI0A 2B21A 5CYQA 2P5GA 2RDJA 1ZQBA 4BDZA 4UB2A 4IRDA 4KAZA 2RF2A 4TQSA 3MEGA 3U3GA 3HVTA 9ICAA 1N56A 1T4GA 1RDCA 3IS9A 4FJMA 3I0SA 5J2PA 1Z26A 1JX4A 4ED3A 5HRRA 3QZ8A 3QNNA 2OPQA 3MXJA 2Z1JA 4ID1A 2G8IA 3ALYA 4M9HA 1ZQZA 3OYNA 2C2DA 4QZCA 3RR8A 4LVSA 2JEIA 2HHTA 3PMNA 3KHHA 1JN3A 1ZQIA 5D4BA 4F4XA 2IDOA 3DM2A 3NCIA 1C0MA 4F91B 1SL2A 3GIKA 1XWLA 5KG7A 2VA2A 4N5SA 3ZDEA 2DFHA 1RTHA 2ZJ8A 1X9SA 4C8KA 4PA1A 1HQUA 1RDBA 4IQWA 4E7LA 3UXPA 3VN5A 1ZQQA 3ZSYA 4J9OA 4BXOB 1WAJA 3GV7B 1XU4A 3H8JA 1TKZA 4IBNA 2E6LA 4ECSA 5IINA 2YKMA 1LB2B 4EZ9A 4BWMA 4R8UA 3PY8A 3NF7A 3KLEA 4QWEA 2FC0A 2BCVA 3NDKA 4DU4A 3KKSA 5HP4A 2P6RA 4P2HA 5DDMA 4CF9A 1BPBA 5EWEA 5C24A 4QAGA 5HHHA 2BQUA 2I5JA 2D0BA 4GXKA 3NFAA 3DOLA 5KFFA 4CESA 3SV4A 3KKRA 4QCLA 5KFWA 2ZUDA 1RTIA 4YD1A 2AQ4A 1ZQHA 3BQ2A 3PVXA 4ELVA 4O55A 1VSMA 1ITGA 3JSMA 3C2MA 2IHMA 2IAJA 4B9UA 2A1JB 5HNKA 4JWMA 1RZTA 4DTUA 1TKDA 4J2BA 1NK7A 1C1AA 5HP1A 4CJLA 4Z6EA 4XQ8A 3RTVA 2KQ2A 1U49A 4LSNA 2I9GA 4OPKA 4JV0A 2HHSA 1ZQNA 1A5XA 2DFLA 3MFHA 4HUEA 1JLGA 1SUQA 3QERA 3CFOA 2PFOA 4JLHA 4Q0BA 1S76D 3ZDBA 1KVBA 4KHUA 3C94A 4H4MA 2ASDA 3L2UA 1XSNA 4Q45A 3G6VA 4AHVA 2XGPA 4GXJA 5CZ1A 2PFPA 3SQ1A 5DQGA 5DG9A 1W9HA 3AA3A 4CEOA 2QXFA 4UBBA 4KI6A 1L3SA 4O5BA 5KFIA 3G6XA 2FLPA 3SCXA 3KLHA 4QWDA 3N4MB 1UOCA 3H40A 2XY5A 1KRPA 3V6DA 3PW7A 4AHRA 4GVMA 4MFAA 4J9KA 1NOYA 4IQUA 1BPXA 1ZQEA 3ZT3A 3C5GA 3G0ZA 4PGQA 4JWNA 4JK1A 1RDAA 3PUFA 4RW7A 1ZBIA 5DBCA 3GIIA 1JXLA 3TWHA 4YCXA 4BE2A 1T05A 3L2VA 2KZMA 4Z4HA 4DSKA 1IM4A 4O3NA 3V7JA 3M9OB 1ZJMA 1T8EA 5DBBA 2F1JA 5J2KA 4F3OA 4HUFA 4EZ6A 1NOZA 3Q8QB 3SYZA 2QK9A 9ICMA 4CJSA 3NF9A 4LZGA 2NRVA 4Y1DA 3V9ZA 2UVVA 2XRIA 4PPXA 4FS1A 9ICEA 4B08A 3HXMA 4RNNA 5DB8A 4E7HA 3AVCA 1S97A 5KGWA 3O4QA 1BPDA 3VQAA 2W8LA 2KN7A 3K59A 4ED1A 3HYFA 1JXEA 3PX4A 1HYZA 5KG0A 2XC9A 4KTZA 4RQ1A 2ZUBA 2JGUA 1CEZA 4CEBA 4CGDA 3HPOA 3MFIA 4YR2A 2Q0ZX 1LW0A 4E1MA 3V9SA 4FW2A 3OYJA 2BHNA 3TAQA 4YXJA 9ICIA 3HL8A 5KFLA 8ICMA 4UB4A 4JS5A 3FDSA 1DOQA 3AO4A 4F92B 3RJFA 4CK2A 4E0DA 9ICVA 5KT2A 3ZD8A 2GUIA 4RW9A 2IC3A 4Z4IA 1XHZA 3RRHA 1RYSA 3DRSA 4K8XA 1FXXA 9ICKA 5J2JA 2HNZA 3AVMA 5KFZA 1T03A 3TAMA 1J5OA 4Z4FA 1ZQRA 5C25A 5T7BA 3TAGA 2NRTA 4EBCA 1L5UA 4M3ZA 7ICEA 3EWAA 4I28A 1D8YA 3G6YA 3TR8A 2ATQA 1U04A 3MEEA 1H38A 2VG5A 4NYFA 1TL1A 2HHXA 5KT3A 3B6PA 4DTPA 1RT6A 1A5VA 3O3GA 4ECTA 4YQWA 2R8GA 2D0AA 4CHQA 2KW4A 2ZUCA 4NM2A 9ICWA 9ICPA 4GC7A 4DL2A 1JKHA 3QLHA 2ITGA 4OKKA 4C8MA 2RN2A 3V7KA 4I2DA 4FZYA 3DYAA 3SI8A 1C0TA 2DTUA 4CHNA 1ZYQA 4M47A 5IILA 1CXUA 4DSFA 2AGOA 3S9HA 3QEBZ 2FBXA 4M6WB 9ICBA 3B6OA 4F5RA 4DQRA 1JLBA 3O4NA 1QLNA 4CJEA 4CF1A 1Q9XA 5CHGA 3QEWA 4O44A 3ZDCA 4Z4CA 1FKOA 9ICLA 4HTUA 3RH6A 4CGJA 4IDKA 3NF8A 4J2DA 5I3UA 1UA0A 4CFDA 2P1JA 4CEEA 5CR0A 4EYHB 1Y97A 3TFSA 1JLFA 2PY5A 4Q8FA 3CQ8A 4ECUA 2PYLA 4RT2A 4ECQA 1VK0A 4KHWA 3DLGA 1QSLA
chains in the Genus database with same CATH superfamily
3T1YF 4DS5A 2E1FA 1RT3B 2RQ4A 1R6YA 4DTOA 3GMGA 1J54A 3JPNA 1PBAA 3LP1A 2EFQA 4PGYA 1TK8A 5CYJA 5C12A 2IBKA 3R1XA 3P3DA 1YJNN 2FHOB 5MAOA 5DDRC 2FZGB 1WYGA 4JI3J 2P6SA 1X5SA 3GE9A 1TAQA 1VQLN 1VHFA 4IO9Q 2P9NA 2HFSA 4USMA 2EQYA 4DSIA 4M6WA 2LI6A 1BPZA 1ULRA 4NYZA 3NASA 3CNQP 4AT1B 5KT6A 3ULHA 3A0IX 4YY3J 2BW2A 2QIFA 3DMJA 2O1PA 1BL3A 2X1BA 4CHOA 1EKSA 4ID8A 3K5OA 4LBPA 5AI0A 2Q36A 1S0NA 4JKFA 3F2DA 4O9MA 3TZXA 1VSIA 4U7CA 3LWMA 8ICKA 2J6TA 1CUKA 1R8PA 3EZUA 3CP8A 2LLZA 2FZCB 3MZIA 2JZ5A 4CLFA 3A1YG 1LAWA 3AVAA 4K0KJ 4I6MB 1NJWA 1RT3A 3RSEB 3EWGA 3CMAN 3QEIA 1PIEA 1T94A 2BPCA 5KFRA 4E7KA 5B8HA 2YNFA 4M5DA 1B0VA 3DM2B 3UKUB 4K25A 4MF2A 5LSLA 2IVNA 1FRIA 4ZKAA 3V1QA 4LBHA 3QBWA 2H3GX 1ZBLA 2GAGC 3PKYA 1K5OA 2E4LA 2G5IB 1JLCA 2GVDA 4DUYK 4UAWA 8ICUA 4DL4A 4FPAA 4PWDA 2AV5A 1ZQMA 4PR6A 8ICIA 3H08A 2JWNA 3M1VB 5EN1A 4E1JA 3BGFA 2CJBA 4KPYA 2W9BB 4BGDA 1RAJA 2Y8YA 2BE7D 3HJFA 3AV9A 5ALGA 5D0GA 4B3MK 4LF4K 3MOJB 2BTFA 1YJNS 1N0VC 4DR2J 4LRFA 2WFAA 4FE3A 2ZBIA 4HACA 5HQLA 1HD1A 1RKJA 2KOBA 2AYBA 4GLXA 5F3TA 1REVB 3VQ7A 1RACB 4F2RA 3D4JA 1RJJA 1CJVB 4U7UD 2DGZA 1BU6O 3RSEA 7ICTA 4YB7A 4QR0A 2AU0A 4QJFB 3WZ0A 3ONQA 5FPEA 1RHJB 3QFUA 4W5QA 1WUDA 2R7RA 5ETMA 4XPCA 4JI1F 5ADXH 3OYHA 1HMVB 4X4QA 2JDJA 1VQ9S 2MRLA 8ATCB 2BCSA 4BREA 3TOQA 3MM5B 1HEKA 5LMUF 3PG9A 4USVA 1XI1A 5KT5A 3F56A 3UCUP 3CCVN 5J2DA 4ZJLA 4BDPA 5L8RC 5F3ZA 3IO1A 4LFBJ 4DL3A 3M1VA 2YMQA 3OLBA 4WP9A 3R97A 5HVGA 2W9BA 1TL3A 3KMQA 2QGFB 2YHXA 2Q66A 1J6ZA 5KPRA 4OPHA 3FZBA 3DLEA 1GO3F 1RXOB 1HUZA 2Z1GA 3LVVA 2EAPA 3WQTA 2ZOMA 4H8KA 4HCCA 5L1IA 4ZJOA 3V6DB 4BG9A 2V67A 1REVA 4TXSA 3NMAA 9ICTA 4IH7A 4LRAA 1CJVA 4KHYA 3K75D 2RLTA 2XMKA 2Q6CA 4EENA 1FRKA 2NYVA 3M8QA 5DQHA 5HOOA 4OYOA 4ZTJA 3RAMA 1WSIA 4A8EA 2PEBA 7ICOA 3A5MC 4CECA 2EI5A 2DGTA 1VGYA 4CFCA 1HW8A 3CC4S 5AQMA 3NTUA 4OJOA 1KAZA 3EZOA 2HFVA 1U09A 2FVCA 4ECVA 1HMVA 3I31A 4GKJJ 4PG5A 3BQ0A 1DARA 3BGLA 3VA0A 4EBEA 2NZ4A 4JV1A 1ZBTA 1X0PA 3HX9A 1XQSC 3KVGA 2ASJA 3GBTA 1KSPA 4JHDA 4OZ1A 4JS4A 3NY0A 4CE9A 2X1FA 1TVAA 4DR6K 4NWBA 3K2PA 4CCHA 2GO9A 3MM7B 3VCDA 3ZSOA 3OR2B 1XMBA 4BRFA 2L5YA 4LUBA 1ZZNA 1GLDG 4ZVSB 2ZQBA 2ZC3A 3NS6A 3RR7A 3W3SA 2NXCA 4BRCA 3NHGA 1HJPA 3O44A 4KYZA 2P9GA 2A40A 4CEDA 1SBRA 5HN0A 1Q0NA 3QEPA 2P66A 5ALHA 3N97B 5JLHA 2DCLA 4A57A 4FLWA 2KM8C 4JI6F 3L7OA 1XJWB 2DNZA 3C66A 2VQEK 4K4IA 4EFAC 4ZPBA 2LEBA 1KAYA 4DUYJ 4EP5A 4I2AA 3FZMA 3KIOA 1UZHA 1EO1A 3DDIA 3C16B 4MDAA 3JPSA 5KG1A 1M5PC 4ZTFA 5BOLA 3AL0B 1IV0A 1C20A 3H5UA 3TA1A 3LWLA 1N36J 3CPEA 2VYPA 2X7IA 2QO3A 3TARA 5A2QY 2ZGYA 2HWHA 1D3WA 2H3IA 1VK3A 5DDOC 3EW9A 3ZTPA 4RX6A 2Q1LA 3ZNJ1 1LWCA 4HEA9 3B54A 4BR4A 2W04A 1CS4A 1D9DA 8ICZA 4XH1A 2G2ZA 2UUTA 5KFGA 2VOPA 1BA1A 3BQ1A 2LFVA 1ZRNA 4JD2A 2RE2A 1F3VA 3T41A 1T03B 2YNIB 2M4MA 2IJNA 4Y2YA 3IAYA 1P9QC 3PHEA 3VAMA 1N8RT 2N3OA 5H1SV 3OR2A 4C8ZA 4FKXA 4JMUA 3HFKA 1PZNA 1HJOA 2JC1A 1I39A 3JPTA 4CYUA 3FAHA 2BJ7A 4DV0K 5CEHA 2NRXA 2J9DA 4DBQA 4KBOA 2NXNA 1RFQA 1S1WB 2VIXA 4IR1A 3P49B 5IC6B 2YBVA 3GV8B 4KSEB 3M8RA 2CQCA 5GAHI 1WOQA 4JI4K 3G8QA 3QEAZ 1UVMA 4F8RA 1RAFB 4ZIWA 4K43A 1JXBA 4WJ3B 2MZQA 4WQ4A 4PHAA 1U24A 2R7YA 4X62F 1FNOA 2C42A 3QWUA 3IFEA 1Q3UA 4BRDA 1GXUA 3T5JA 4UARA 2JSXA 2C28A 3MD3A 3KWMA 1NK8A 1TQLA 2FLLA 2AJFE 4OMFG 4LH5A 1PK1B 2F5GA 2W4PA 3SBGA 1XSPA 2W24A 3J7YI 3LP2A 4MN4C 1WC1A 5J1PA 2E88A 2QTDA 3UQSA 4FWMA 1RT7A 2FTRA 4CO2A 5C2FA 3W62A 2QWRA 4WP3A 2YNIA 3QUCA 3U3YA 2CQBA 2RPIA 2FF3B 2MSSA 3WKAA 2M7SA 3RB0A 1L8OA 4O44B 2WMMA 4NASA 3GDXA 2V50A 3BPSP 1U7LA 5GAGI 4IJNA 1ATSA 1Q8BA 1RAGB 4RU9A 3LAKA 1SC4B 1YJVA 1I6JA 1JL2A 4UOFA 4CLKA 1S5JA 1C4AA 1XMOK 4UY8T 3HKZD 2ZTCA 2JV3A 4O5KA 1WSEA 2ZIUA 4DPWA 4NLQA 3ZX0A 4UASA 1S1WA 1EETA 2K4HA 2KKHA 2HBYB 4NJ8A 2B6AA 3W66A 2IM1A 5C2CA 4WIQA 3Q86A 3QMQA 3A5OC 3VTHA 3PLAA 3RBZA 1QH9A 3VQCA 4XH4A 1B4SA 4YB6A 2UVWA 2HOFA 2YMLA 2GS8A 3OTEA 2R8IA 2QARB 2ASYA 2Q43A 3RMCA 3AVKA 3NL0A 2P9PB 3CCSN 3AA9A 2BQRA 1UVNA 4MAKA 4A5BA 3OL6A 1XNRK 5ETRA 2DKXA 2FBYA 1K8AO 2P2CB 5A2QO 7FD1A 4AE5A 3MGHA 1FE0A 1HNXK 4DV4F 5E33A 4OD0A 3H59A 2EPIA 4TUQA 3MR7A 4HR2A 4ZOHC 3BGUA 2YX7A 1V38A 7ICRA 2XULA 2BPGA 4ZLLA 1DGKN 4DU1A 4LF7K 2CJXB 4IQVA 2HMIB 1VSLA 4FM0A 4RQ8A 1QHTA 1NO8A 4OLOA 4DTSA 3G6ES 2CPZA 4NZ0A 5KT7A 3ZETB 3A12A 3Q7BA 2ZH4A 1S59A 1YAGA 4LREA 2G2YA 2CQIA 1TKTB 2VPZB 2FMQA 3CC7S 1URNA 1JLEB 4DR5J 5T7LB 4LF2A 2AJQA 5JUMA 1FJCA 4UAZA 3UN3A 4WFBL 9ICUA 3CDAA 1SV4A 4HI2A 2CADA 1HR0J 3UVJB 4WKYA 1F44A 9ICRA 5CWRA 1EJ7L 1PVQA 3F9MA 5L9XA 2QARA 2I0XA 3WHIA 3QIPB 3VV2B 5AZJB 3RJHA 4JKBA 3AAWB 4C4SA 5JU5A 3HOSA 1D9AA 3Q89A 1VDVA 4BC7A 4R64A 3SV3A 5J2MA 1IBMK 3RB6A 1FXDA 4LFAJ 4B3SJ 4JKHA 3PW0A 1LEOA 5C2GA 3IAM9 1OY6A 4JI4J 2QB1A 4KLOA 4K4VA 1SQGA 2H9ZA 4O3QA 4DFKA 4TURA 4YMMA 4LVOP 4C3LA 1R6VA 2Z56B 3UKRB 5GAEP 4G1QA 3CCJS 3R8EA 3QGPA 3NE6A 4FLTA 2HG4A 3HFZB 1TKTA 3MGVA 1QUVA 3VQDA 3IM1A 4EWTA 3MPVA 1JLEA 3PX0A 4F36A 4IOAL 3IHQB 3A4TA 2IRYA 1XMQF 4CJKA 2YXLA 4WFYA 4JKAA 1CULA 2J7WA 2ZTDA 5K5MA 3AVNA 4L75A 2IPOB 4N77A 1NB2A 2JX2A 3MMBA 4KLTA 1TELA 5EE3A 3UVJA 3SFGA 5A0LA 2Q97A 4IFYB 4KHQA 1URJA 2HIQA 4CFAA 2CH6A 3CETA 4H0VB 1RE1B 4ANDA 3L8BA 5CE3A 4WIIA 4X4PA 3HVAA 4YNQA 3AY0A 3PSIA 9ICFA 2BV3A 3DLKB 4HDGA 4KR0B 2QWLA 2GHVC 1VLBA 7ICHA 3UE5A 4I6AA 5DLGA 1NK5A 3JAMU 3NGZA 3PDNA 1FDNA 3NWGA 5ETOA 1XO0A 2ADBA 3D2QA 3LZJA 5GMKa 5EXWA 5AQLA 2F1IA 5KL8B 2SXLA 4CNQA 1S1UA 3UKRA 4KKOA 2DKZA 5FDLB 1XNQK 3AMZA 2G8WA 1ZTTA 1NGIA 3FEZA 3NRZA 5ALUA 5L38A 2EW9A 3M32A 4DSJA 2NSCA 3CB4A 2BM0A 1XNRJ 2Q3SA 3NVWA 4DR1J 3AAQA 2X3DA 1Q81O 2XY6A 4NLWA 4YG2A 4WYLA 3ZT4A 1IKYA 4DG1B 3PJXA 3THTA 2KG0A 5ALVA 4FLXA 3NXZA 4CF2A 1WEYA 3C1YA 3C6AA 1AW0A 3IWLA 3BP8A 2YH1A 3SQ4A 5IZHA 3CCLS 3MHYA 2OPSB 4L72B 1P90A 1FWLA 4LF8K 2MAXA 2KIVA 2DNOA 3NVZA 3RFAA 1VDHA 2F65A 4RPXA 3DLKA 4B9LA 4EUVA 2R42A 1Q9YA 3T9ZA 2K7JA 2OWOA 1LWEA 2ZJRQ 2KHVA 3ID8A 4LH4A 3UWTA 3ENOA 2FBTA 2NZTA 1UTAA 1GH8A 4LRDA 4YOTA 4O3OA 5FROA 4DEZA 3T19A 3CJ7A 4DQSA 4JI5K 4PHPA 7ICFA 2HAIA 5M1FA 4X65K 1T3QA 2VC1A 1LK7A 3MMJA 4ZP6A 2HFUA 3OA9A 1RKIA 2O4GA 2ZBQA 5FDLA 4Z37A 2PSZA 3VETA 3VAHA 2VWKA 2GIFA 4O5CA 2XNQA 1RHMB 3QU5A 5ETVA 2H5EA 1WKJA 2KE7A 5H2FU 2P9EA 1IBMJ 2PZSA 2AXTU 3W9JA 2CRLA 4DG1A 2YY6A 4AQYK 2DY1A 2CH5A 2JHDA 4C3KA 3B0YA 1IKXA 4ILMA 3W2WB 3C2PA 5DGAA 3JYTB 5EY4A 2D5RA 3SCJE 2OPSA 5KRSA 3AO2A 4R65A 2PT0A 5HRPA 4Z4EA 1S8OA 4QWBA 5J2CA 2C2RA 4F4AA 2GV1A 2H5IB 1K73T 2QW9A 5B0BA 4CLZA 4O8UA 4DMNA 3LAMA 5AQOA 3IG1B 1IO2A 4HLBA 2IJRA 3GILA 2CDRB 1NKBA 1DTQA 4RNFA 1WTBA 3DRRA 9ICSA 1KFDA 5ALMA 1BOTO 2GVZA 3ZZOA 3MECA 3ENVA 1NGDA 4Y2IA 3TPQA 4DUZK 1YHQN 4DLEA 3BM7A 2OFHX 2V2VA 2E5LJ 1OH8A 4JI2F 3QIOA 2ZBCA 3CCUS 4PY5A 3OLAA 4YHHK 2KHDA 4GRSA 4KLEA 2ZXIA 4M94A 4NLGA 4EI2A 4DV5F 8ICQA 4ITSA 3EKUA 4E19A 4LF1A 2IRUA 4FLYA 3N28A 4CJWA 1J2MA 1SPBP 3SMSA 2IYIA 2ISPA 4DV3F 1NK9A 1HIYA 2ZE2A 4H54A 3E01A 3S6JA 3KBBA 3SUNA 1UVJA 1YJ9N 1NNDA 2FJAB 4XRHA 4MFFA 1I51B 2A1JA 3UB5A 2KRRA 1PVRA 2OI2A 1EQMA 2YKNB 1KVAA 4GVEA 2KFNA 3AVJA 3IG1A 5L1KA 3G8TA 1C6VA 2MEWA 3D2NA 4O3RA 3BN7A 4JK9A 3ITHB 4ZVTB 4BLGA 3JPQA 4JV2A 4E3SA 2HLUA 1FJEB 1RHKB 1VSKA 1N32J 1QS4A 3VMFB 3CJKA 2GWSA 1C1BB 3N4QA 9ICJA 5JVGQ 2PMHA 2LA6A 3ZLJA 2NUBA 3H7HB 1B92A 3BDPA 3MEKA 3N79A 4JI3F 1C1CB 2D9PA 3V4IA 4IFEA 4P74A 3NGUA 2OELA 3ILJA 4CJPA 4F5PA 3QAEA 2W41A 4CD1A 4DV7K 1PAEX 1WACA 1FFVA 3KG4A 4DPTA 4O0NA 1YHQS 3N5FA 4Q5VA 1X31C 3LGHA 3W9HA 4JI5J 3NGSA 3TSPA 1SIWB 2HHQA 4HH0A 3OTBA 3NS7B 2DGQA 3EVMA 4YY3F 3F2CA 4WF9Q 3SIPB 2HOIA 2JL9A 3HSCA 4Y2XA 5CD4A 4C98A 2IJFA 2ADCA 2E2PA 4QYRA 2DHXA 4K8ZA 2OMLA 1RTDA 2O8EB 4Z7CA 2PA3A 4B9VA 5KOXA 1BPEA 2MTLA 1A6SA 1WG5A 3H3NO 5IC4B 4BRIA 4YVZA 5AKKA 3H5XA 2YNGB 1TGOA 1N33K 1OPZA 2NLXA 1BLUA 4A2BA 4CFBA 3NH2A 5ALEA 1FWKA 3K17A 8ICSA 4OYMA 2I5HA 2WBMA 4RG8A 2XMMA 2RD5C 2GBZA 3U9ZA 1C1BA 1RTZA 5KRTA 2AEFA 1G1XA 4TYAA 4HYKA 1OYDA 4FJXA 3ISDA 2GX9A 2LQBA 1Y5NB 4TSXA 2VFRA 2PC6A 4DV6K 2H3ZA 4B3TJ 2V4RA 1C1CA 2CJQA 2GQQA 3BREA 5CR4A 4DPOA 3BO2A 4HTLA 1BUXA 3ICLA 3MK6A 2A0FB 2CPIA 3PACA 2E7XA 6FD1A 4IEIA 2D41A 2EFPA 4CEFA 2GZOA 4ER8A 3HHLB 3MX2A 2LXFA 4EFHA 4A8KA 1NRKA 4M1KA 1DEJA 1ZAXA 4PUOB 3EE9A 3R1LA 1QQOA 3VVTA 4LRBA 2N7CA 4C8NA 1HWUA 3PYFA 4ZVEA 2D8CA 3T5HA 4U67L 1W2BR 1X9WA 4X4SA 1DK3A 1V4SA 2HMPA 4DR2F 2FJBB 2O6KA 2CJAA 4QR2A 3MCNA 4MFCA 1HNWK 3KXDA 4HDHA 4LSZB 5B7WA 4LR8A 2W4DA 3U8XA 4DR7K 2O4IA 5BPCA 2CQ3A 4FJHA 4KITB 1MWQA 1U1OA 3QUTA 3BY5A 2H5JB 1SC3B 1HWKA 4N41A 3VQBA 3C65A 1FCAA 1U25A 2FSKA 4UUXA 4CZCA 2WVFA 4FJKA 3DN9A 2BE2B 2DBBA 4QWCA 3CMQA 2NRHA 2ZGZA 1N8RO 1WC4A 4NPOA 3WC2A 3UXOA 2IFXA 2MLZA 4M95A 3I1YA 5B08A 5LJWA 3OQ2A 3AO1A 4AHSA 1Y88A 3HHLA 4LFBF 1UKUA 3AD9C 3WIVA 1B99A 3RJMB 4ALZA 5JVHL 4PUOA 4EYIB 1NBWA 2G2OA 4XK8C 3PFEA 1FWPA 1VQNS 2F3JA 4FLVA 1NZ8A 4AD6A 5DM7Q 1NDCA 3O3FA 5LT5A 3LZIA 2B0CA 3TABA 3J7A1 2LMIA 2QA4N 1GX5A 1SQEA 3CJ3A 2F1HA 1UAXA 1NHKL 2GO7A 4Z7YA 1RNHA 1F1BB 4J8FA 2L3MA 1IKVB 5E0OA 4BCAA 4Y6IA 2MB0B 4DR3J 4B1UB 2MGZA 1OXJA 3M7VA 3ISBA 5KG6A 4B9TA 4DV7J 4P4PA 5K9FA 4H4KC 1I1GA 3G8SA 1TKXB 2WVDA 3VF6A 5CYQB 1KXPA 1KFTA 3HPHA 5MLCQ 3S8SA 2XSJB 4FF4A 2OYQA 1UT8A 4OJGA 1P9YA 1QQ5A 1NMDA 1PAUB 4CZFA 3H4BA 2LXUA 4GKJF 3Q8SB 3N7PD 2DFEA 3GJSB 3LDPA 3CCZA 5J2PB 2OEHA 1R3NA 1RG6A 4OYXA 4ZVRB 4P2XA 1HHQA 2KL8A 4F0HA 3AAPA 2LSNA 4UY8O 4ANCA 1HPZB 3ZTQA 8ICHA 2DH9A 1QE1B 3THWB 4IO8A 2CG4A 4KGZB 1N2XA 1NCLA 1OS5A 1HLUA 4W98A 1ASUA 2WCXA 3GG1A 3IG5A 2LP4A 2H1YA 5JJBA 4U7BA 3PRDA 2A3ZA 1RXVA 3MUTP 5AXLA 2E1EA 1ZM3A 1SKSA 4TY8B 2Z58B 1IKVA 4DV6J 2BZ2A 2W6LA 5DETA 3O3LA 4QIEA 1F21A 3AJ1A 4CT9A 4C48A 1TKZB 4M5JA 2QZ8A 4NXZA 2FDRA 4LJXA 3THVA 3Q8LA 1B7FA 1BQNB 1I94J 1NGFA 2LHTA 1C0UA 3I5AA 3CJBA 5CYQA 4U96A 4WFAQ 1C2PA 1N36F 2DNLA 5LL6Z 2E7VA 2XSJA 4BDZA 2DHAA 6FDRA 5HO4A 2Y8WA 4IRDA 5D0EA 4KAZA 3W63A 4PKIA 9ICAA 1T4GA 1DQ9A 4A48A 1RDCA 4FJMA 1KD1T 5J2PA 3JQMA 4ED3A 3QNNA 1ACMB 2OPQA 1WKKA 1HNWJ 4I68A 4ID1A 2G8IA 4C4RA 3G2XA 4M7YA 2DL0A 3JSMB 2M5YA 2C2DA 4DR7J 2IHR1 4P75A 2GGPB 3NS5A 3UD3P 2AIRB 3WEEA 3DOMB 4X4NA 3THWA 4F4XA 1Q8LA 2HRYA 4F91B 1SL2A 4PKDB 5KAFU 3K5PA 5KG7A 4LSNB 2VA2A 2VPYB 4N5SA 3ZDEA 1RTHA 3W60A 4TY8A 2KG1A 3IRUA 4PA1A 3L4PA 2L9WA 3M2UA 3ZSYA 1VQ6N 2M2BA 3H8JA 1TKZA 2JWLA 4IBNA 2E6LA 4ECSA 1D8ZA 5IINA 5BRFA 2W55A 2YKMA 4EZ9A 2VKQA 3KLEA 3NF7A 1G4CA 3O08A 4DU4A 3BQ7A 3WQUA 5HP4A 2P6RA 4A2AA 1HARA 2NUUG 2DQNB 3DDKA 4C6AA 2H3QA 4CF9A 3LGMA 3FUYA 2NPFA 1BPBA 3D66A 4QAGA 1RU2A 5GINA 5E26A 4GXKA 5BYRA 2DR7A 4OYIA 3D3CJ 1F5BA 3KKRA 3R7BB 2RUGA 1RTIA 1ZQHA 3ET6B 3PVXA 2B9YA 2FXUA 4ZN3A 2YNHB 1VSMA 3JSMA 2RVJA 1SB6A 2GGPA 4B9UA 3DOMA 5DM6L 5HNKA 4NLPA 4DTUA 1IBLK 4RBVA 1LXJA 4BHQA 4AXJA 1VQON 5A0YB 2G0JA 2VFUA 4MKBA 4RL1A 3CQXA 4LSNA 2I9GA 1UL3A 4JV0A 1HFEL 1Z05A 2HHSA 1A5XA 3DDHA 5EE1A 1AT1B 3MFHA 2XS5A 2QN6B 3KFUF 3OHRA 2CJKA 3HRDD 3MF5A 3ZDBA 2D4WA 4KH5A 3CW2C 4CZHA 3H0MB 2ASDA 1XSNA 2LECA 1Y3KA 5F8JA 4GXJA 1GNKA 5DG9A 3OFFA 3P5BP 2CPHA 4DR4K 3O9RA 1VIOA 4L6V3 4Y2SA 4PPZA 1HBOB 2YMPA 1VJQA 4UY85 1D1UA 4JYAK 2OD4A 3OTOK 4AM7A 1RSCA 2MZ1A 1NOYA 2NXJA 1UWAA 4X64K 1ZQEA 2BACA 3NUQA 3G0ZA 4PGQA 4ETZA 2P35A 3ALRA 5B09A 4J7CA 2JRZA 1F3FA 2XQCA 2GX8A 4L3QA 5AQZA 5BJRA 4RW4B 4TNOA 1Y9OA 4NRUA 4YORA 4IFVB 3ZXWA 2V63A 4Y2TA 2QA2A 4C4TA 2P9IA 2V7YA 4RW9B 1ZJMA 1A9NB 5ADXA 2PFDA 4DR5F 3FZ2A 4DV2K 2LVWA 4MIWA 1N54B 2O8FA 1YBTA 3IM9A 5HLFB 1AA1B 9ICMA 3BZKA 5TKYA 1M5OC 4CJSA 1GT8A 1WHWA 3V9ZA 3SSSA 3THXA 3VERA 2GHWA 2XRIA 4PPXA 4B08A 4RNNA 3RGIA 1HR0F 5DB8A 2DH8A 5C10A 3B8HA 4WFZA 1FX2A 2P5VA 3E9PA 1S97A 1NWKA 2ZKTA 3TTCA 3VQAA 2CRXA 2MQOA 1YI2S 4W90B 3CO9A 1HBOA 4ZPTR 2RRAA 2QLXA 3HYFA 3HF5A 3JS9A 4M5GA 3VEOA 3ETRA 5G4DA 1H3DA 1B0TA 4KTZA 2YTCA 1M5VC 2ZUBA 4Y2QA 1BWVA 4LFAF 4B3SF 3MFIA 4YB1P 3L3FX 1D09B 1LW0A 5E7OB 5H9FJ 4E8UA 4FW2A 3TAQA 4JI4F 3D28A 2ZH5A 5LJ3Y 2A2CA 2EFNA 2WONB 3NCPA 3EMTA 4WPAA 3WT0A 4PPDA 4CK2A 4E0DA 2NYHA 5KT2A 4RW9A 1Q1KA 2QV6A 3ZZYA 5F0UA 4WU2A 1RYSA 1ZPWX 1FXXA 3MGJA 2V68A 2CGLA 5KFZA 3MM8B 1VC5A 1VHXA 1QVFR 5C25A 4LFCK 3OXGA 3M2VA 4IDKB 3PXGa 5ETTA 4JP8A 3EWAA 2VHGA 1AB8A 1F5SA 5IQ6A 4OJHA 1IBLJ 1YJTA 4FZNA 2RQ5A 1FFGB 1YG0A 1U1KA 4JI0K 2MQQA 5DZ6A 1QQ7A 1QVGR 3Q2TC 2W2OP 3M30B 1RYUA 2R7XA 1BO5O 3L9ZA 2R8GA 2HOQA 3PZPA 2QLTA 2GJ2A 3RVCA 2ZUCA 2VJ4A 9ICWA 4EELA 3QLHA 4Z94A 3CSKA 2CVIA 2R2RA 2CAJA 7AT1B 4OKKA 5AKEA 4BX9C 1X4HA 2RN2A 1NPPA 2LYVA 4RR5A 3OXFA 4P2SA 1JNZB 4DZ6A 1XIQA 1NU0A 3I0RB 4M5MA 3F53A 4CHNA 3BS9A 4G9ZA 4DR4J 1CXUA 2V7ZA 2FF6A 3KMSA 2Y0SC 3S9HA 3QEBZ 4FXVA 3DU6A 2QMXA 3HM8A 2VQFK 2HGNA 2X1AA 5F2RA 3J7YU 4Z2XA 1Z19A 3B6OA 1ZM4A 2CGJA 2B56A 3OTOJ 1JLBA 3MM8A 1QLNA 1RAEB 4DR1F 1AUDA 1S6UA 1Q9XA 4CZEA 4USUA 2YPYA 4MYTA 3ICXA 3ENAA 3G4SS 4QPXA 4Z4CA 1FKOA 9ICLA 4JBCA 3DDNA 4IDKA 4XDCA 2Y1RI 5HMZA 1FK9B 3IRXB 1UA0A 2HNDB 2ILYA 3FMWA 2P1JA 4CEEA 5CR0A 3JSRA 2C3UA 2PFUA 3ENHA 2FQQB 4ZDNA 2PYLA 1VK0A 3I33A 2GMHA 1EHWA 4KHSA 3M30A 3OYAA 8ICRA 4FYXB 1V97A 5KOWA 1HKAA 4DV2J 1SKRA 2QX0A 3J81Y 1YUWA 5IFMA 3UDVA 2G8HA 3KFWX 3FK4A 2E44A 4MH8A 1XS9D 4YMNA 2B4OA 3P96A 2W11A 3EM1A 3SQGA 5KFQA 1G3OA 4QZAA 1WI8A 1YJWN 1R8HA 4RUHA 1IG9A 5FJ4A 3MPWA 2ROEA 1SH0A 3LDOA 4PZVA 4L3NA 2BKOA 4CK1A 3DFEA 2HBJA 5AZIA 4DFJA 2WVBA 4CEQA 3DXKA 1TUGB 3AD8C 3QPIA 3RW7A 2VZ9A 2FZKB 5DGBA 4OKEA 3OFHA 3VAJA 4OGCA 4I2EA 2KV2A 1XQIA 2HEKA 4CBUA 1N61A 1WNEA 2XWYA 2WF7A 1IBMF 4DUTA 1HI8A 4OHWA 5J0TA 4FWPA 2J7KA 5M2PA 3OVNA 3WXLA 3S7RA 3KK2A 4C11A 3IBPA 3IRXA 2WW8A 3MEGB 1OQ3A 3CCEN 1S3XA 2K60A 3VQ9A 1UFWA 1VQ5S 4FYWB 1ZQJA 4WFXA 4QIWC 2E8PA 2BCRA 3EL2A 4FJ8A 1RWKB 2ZEJA 5AI4A 3FBCA 4BC2A 2CPXA 2AEJA 1VLOA 1Y7PA 4LIWA 2GOLA 4WCEQ 2JLFA 2AJ0A 1KQSR 5HMMA 3ENWA 3CJSA 1MA9B 3RMAA 1EQ0A 1BIUA 3R2DJ 3NGYA 3VF4A 2BKEA 1HIWA 1MC8A 5AR0A 1WHYA 3ID6A 4AL7A 4Y28C 2E5LF 5SZTA 2EK1A 3CJ9A 1U02A 3D2EB 3SQ2A 1EP4A 1C7YA 1HI0P 2Z0GA 1KVCA 4NV0A 4TU9A 2M52A 2C1EB 4DQQA 1NZPA 2M0GB 4CO1A 4WFNQ 3I32A 4HT5A 4Q2MA 1Q7YT 1X4AA 2YKAA 1BQMB 2D0CA 3E66A 3WXMB 4NEZA 4JKGA 5AJ3F 1V85A 1PJ6A 1EWRA 2QWMA 2HQ3A 1HBUB 4PQUA 3RRGA 4BRPA 4EP4A 3J7AN 5C24B 2GAHC 2FUG9 2RILA 1FEHA 3FEYB 1JWWA 2H65B 4Z4GA 1SQFA 5FRMA 5ALRA 3I5CA 3GYGA 5DDQC 1H1VA 1WORA 1GMUA 2BVZA 4UOCA 4TQRA 4YDDB 5JXSA 2VQFJ 2Y1JA 4AP9A 1H72C 3WDOA 4C8LA 3PIPQ 4GV9A 1DTTB 4YN3B 3H2LA 5ETNA 3SD7A 4LZDA 3W5ZA 4JI1K 2XY7A 4MEYA 3E3XA 2EAMA 5AXMA 3CUNA 5CCMA 4LF5J 2WB1C 1SJRA 5LMUK 1HBNB 2ZFHA 1N32F 1X3MA 4BRNA 3D2EA 1F5CA 3UFCX 1SC6A 1RDWX 1SH3A 3S01A 1XC9A 3DI6A 3MCOA 3OPKA 5IT0A 3UN2A 2GEMA 1MMDA 4A8YA 2VL1A 3FZFA 1SL0A 2IHNA 3H4DA 4MYUA 3GIJA 1BQMA 2AX1A 1B4FA 1S12A 3M6WA 2J5AA 3BV8A 4IOCL 2O8BA 2FVSA 2LQ9A 1HBUA 2BDPA 2HF3A 2ZH3A 2NR0A 3RMDA 5FRNA 4B9NA 4QZIA 4X4UA 1TV9A 9ICOA 3LPTA 4UW2A 2Y0SD 8ICNA 3V1RA 4CO5A 1KLNA 3TADA 5ETQA 1EARA 3JXUA 2AQ0A 3TU5A 4I6WA 1S1VA 2AHOB 4RW7B 1DTTA 4NZ6A 2W9AA 3PFOA 4ZVHA 4KGXB 1SAZA 3EICA 5KNIA 1R0CB 4TU8A 4X4VA 3PJ9A 4XDDA 3CCQN 1UJ4A 1W26A 4I7FA 2JLEA 2GELA 9ICCA 2ZVSA 4O23A 3GFYA 3V5RA 2OA8A 1UA1A 2YHYA 4BVPA 2E5HA 1OVYA 2CQ2A 2RJZA 2FPKA 2G0AA 4Q43A 4ZVOB 4B1ZA 2EK6A 4CZLA 4ILRA 4EAHD 4RZRA 4L76A 3M05A 1B3TA 5KFTA 3I9ZA 3EGNA 2HRTA 4KQZA 4QYZK 3CJRA 3Q8KA 1IR1A 2NV3A 5L1JA 4HHTA 5GMEA 4B3TF 2EBGA 3IP4B 4DF8A 1KKXA 4Q2LA 2R7VA 4PZOA 2XCPA 4I64A 4V19J 4LF9F 1VSJA 5CHIA 2PI5A 2A2DA 2RT3A 3OL8A 3L7UA 2WSEC 4MKVA 2E8MA 1U8SA 1OW5A 3LPUA 2JVRA 3T6JA 1V9PA 2XLJA 1CJTA 3C15B 1RCHA 2YB4A 4FPBA 4ZHRA 3ZDAA 5AKJA 3CD5A 3GWCA 5LSOA 3ISZA 4I0WA 3CC2S 2KD1A 1AYEA 3TEGA 4RQ3A 1KD1O 1VRQC 4J90A 2BPFA 2FJ6A 4QIWD 4RWXA 2WHOA 3THYB 4CRJA 3IRWP 3OYKA 5KG4A 3CJ8A 7ICQA 5LL6d 4FCYA 1T95A 4Z6CA 1ZA2B 4EO8A 3CCQS 2WK4A 4N8OA 3QU9A 4JI1J 2DK2A 4FW1A 2EEYA 1S6QB 2A1RA 2Z2ZA 2K3IA 2VB6A 4J9NA 2G4BA 5BRHA 3HVRA 3QDKA 4MF8A 3Q8VA 3MX5A 5LMUJ 4PGXA 3E8OA 1K8KB 3I55S 1RT6B 2E6MA 2K7KA 3M9MB 5TZVA 1WOOA 2WUSA 1TUWA 2CYYA 3KKFA 3KNAA 4YOXA 1JKHB 1VOMA 1TR0A 1S72N 3C6TA 1PO6A 1LKYB 4KTWA 3MXIA 3PV8A 4DR3F 1LQ9A 5ETLA 4DV7F 3ORYA 1M1GA 1MMLA 4F4ZA 4DCPB 1T9TA 1Z1BA 1FD2A 3MR6A 3KK1B 1R7IA 4OIXA 3IMQJ 2BKPA 1R0BG 3THYA 1QSYA 2XS2A 2DISA 3MWTA 3K0SA 1TE2A 4HAIA 1OH6A 3GCWP 3VC8A 3M1YA 5CQGA 2J0SD 3UCZP 1UVLA 1S6QA 2HIYA 1YTAA 4CO0A 3IKMA 2HK3A 4HHUA 4DOCA 2FSJA 1FTRA 2WB1D 1WOSA 3VF2A 1K8KA 2HWTA 1IXRA 3R3LA 4K4UA 3K7RA 1Q53A 1URRA 4FF3A 4PXEA 2NPIA 5IM0A 2QA4G 4ZK7M 2K8BB 2C2EA 1HX1A 3LPEA 4CM2A 4HH1A 3N5BA 1BI4A 1UQVA 4P7TA 1PYOB 3QATA 1VBXA 5K8PA 4FLZA 2ZJAA 1AZSB 1HNVA 2ZKUA 2V0NA 5E2QA 4H5WA 2HVHA 1U48A 4FOIA 4W5RA 3CCRS 5GIPA 2G09A 3FBBA 5AKIA 2O8CA 2HHHJ 3PO5A 4UOGA 1I94F 2PFNA 4FK2A 4AXIA 3VESA 4UQGA 1UJ6A 1KEKA 3KK1A 2MA1A 4DV4K 3B0XA 3AEVA 1RHUB 2BANB 2RSQA 1KVJA 4JK7A 1CZBA 3BBFA 1S1TB 5DS7A 1A0PA 1CVJA 5AM4A 4NI2B 4U6PA 3DCAA 2UXDJ 4UT4A 1RCXB 2KU7A 4OI2A 4MO4A 3CE8A 3EY1A 5ALWA 1W25A 3RW6A 3R1HA 2YHAA 5AT1B 3VEXA 3OUYB 4NCGB 3ILOA 4DR7F 4ILHA 3CTRA 1GFWB 4KLUA 5J0QA 3L2QA 2WSCC 1B0XA 2CDQA 3LYSA 2VA3A 4UATA 3D0GE 3AD7C 1RI7A 4C3MA 3CJ4A 3FKBA 2JEJA 4O4GB 2H4YB 4US9A 1YIJN 2HGMA 1RHRB 4FVMA 3WK8A 1LNQA 1S77D 5AKGA 2NUHA 4C2MA 1WC0A 4G9BA 5F9LA 1M90O 4F93B 3AQOA 4GXIA 2MMYA 5J0YA 1GTEA 2BJ9A 1Q18A 1ILYA 1BE4A 3KKAA 4IG3A 3NP5A 5BXIA 2EH9A 2DCUB 3A3NB 1LAVA 3CDWA 1RDRA 3VQ8A 2VKRA 4TY9A 2BANA 2WZ1A 3WKDA 5BYSA 4HCBA 1RUSA 3F73A 1NEEA 4DZDA 3CJ2A 1S1TA 2GWKA 2BM1A 4NI2A 2OP5A 2P5OA 1PUZA 5AK5A 2AZ1A 1O0PA 1EKEA 2MJNA 4UAYA 3V6KA 4J9MA 7ICJA 1DBDA 2VONA 1NGAA 1RBLA 3T5LA 2BJDA 5KFOA 3RH5A 4F72A 2V52B 3AY9A 3OUYA 3SQ0A 1VQPN 5EOZA 3P8BB 5HMYA 4CLUA 4FJLA 1XMQK 4UB3A 2J0XA 4YDUC 1RILA 5BRDA 4FJJA 4NY8A 2KZZA 3NGKA 4HI1A 3PHTA 2QKKA 2FBVA 2HS4A 1PKUA 4O4GA 3OJSA 4J2EA 2W2QP 5EX3A 1DURA 3R2CJ 4ECYA 4ZPDA 3HP6A 3ULEB 5AFUA 3AVIA 3H25A 2AGPA 5F0WA 2F8SA 4F4KA 5LXRA 4CLTA 1OYEA 3QSYB 4EMDA 2ZH1A 4PKHA 4IH6A 1MU2A 4MT1A 5CYMB 4URGA 2DR8A 1N5WA 2CKWA 3AJ2A 1BCMA 4KN7A 2K06A 3QUBA 3C3LA 5TKWA 4Y2CA 3Q22A 2J8SA 5E3RA 3IA0A 4CI6A 1WF0A 3C0BA 2R7TA 3LL3A 1NK0A 1KLMA 4FJGA 3K1ZA 2VFVA 4BACA 2KHOA 2XVTA 4F50A 1P27B 1IBCB 1VR6A 3SJJA 3JAMY 5CH7B 3WU2U 1DY3A 1SZ2A 1RWXB 3U1MA 2HS0A 2LM1A 1YRUA 2ZBRA 2MQLA 3W2VA 4P10A 1U6ZA 4YDXA 1B9FA 4MK8A 3HJEA 2NLWA 1NDLA 5D49A 4FBTA 3NS1A 4DV4J 1DLOB 4CZJA 3BSCA 3WNHA 3BYRA 5AQYA 2QRRA 3CF5L 3GQCA 2RHSB 5D4NA 4WU3A 1VISA 4ZVQB 4CTAA 5EWFA 3OTCA 2ZZMA 4OI3A 5KFYA 4OO1J 3ULEA 4CNZA 3TUZC 1NJIO 2E1ZA 5KG2A 2D74B 9ICHA 1RT2A 1U2CA 3UMCA 3I96A 5HBMA 5AXNA 2DY4A 1VQPS 1WHVA 2E2OA 3I56S 3MN7A 3OSNA 4NLNA 5CYMA 4OI6A 3A2FA 1VRTB 2W42A 1OMSA 3EYZA 3NEKA 4NCBA 2F8TA 1S9GA 1JQGA 5CP2A 1RBUA 4Y2UA 1RGIA 4Y2RA 5KG5A 2YWKA 2FHMA 4OYAA 4MKYA 3P5TL 4NZ7A 2AYEA 5AKHA 4LRCA 3GE1A 2PFQA 1Z1ZA 1Q5YA 3ZZZA 2ISOA 5AI8A 2DNMA 4KE5A 4XIUA 2F77X 4MQ3A 1ZQ1C 4WFBQ 4DQPA 4Y2AA 2G13A 1KTVA 1QQ6A 1QSSA 3KLFA 4DFPA 2DNQA 1N5YA 4B3RJ 1ZXIA 3MEDB 2X78A 3CO0P 3V6JA 2M8DB 2NXUA 2H54B 2CQ0A 2HFNA 1HHTP 2BQ3A 4FWRA 4LMZA 3WXKA 4KX3A 1NOMA 5AKZA 4RPYA 4CJRA 3NVKA 3SUOA 4M9NA 4U7UK 4QZVB 4FOEA 3DLHA 1Q8KA 2KXFA 3CJ0A 2C22A 4QZBA 4FPRA 2O5DA 2QG9B 5AQWA 4I2IA 3HHNB 1HYSB 3HT0A 1LWFB 1SZPA 1ZQSA 3AOBA 1VRTA 1HA1A 3IDHA 1XMQJ 4NLBA 1F2HA 4OZNA 4ZITA 4YOEA 1Q46A 4R0JA 2CVEA 2RB7A 1T11A 4L3KA 4C0ZA 2XGQA 4CP5A 4FK4A 4RW6B 4RPZA 2OXOA 4YD2A 3POTA 4USHA 2NS1B 1NLVA 4DF4A 3U26A 3D7EO 5HK4A 4A62A 2J6SA 4IOAQ 4BXOA 3PO4A 3EJMA 3O6WA 4ZCLA 4JI2K 2ZBPA 5KGXA 2YMMA 3NBPA 1IBKJ 2EFGA 4KN4A 7ICMA 2Z1IA 4KHNA 1OY9A 4CI0B 4M5NA 1UW4A 2ATCB 1QJHA 4LIRA 3GP9A 3KZIU 2O3DA 3H42A 3JAMO 4DV5K 1VAZA 1ZQVA 1NKEA 3TWZA 4CJ7A 2V4JB 4X5VA 1GOBA 1XN9A 3FC4A 4WTYA 1Q7YO 2RU9A 2E7WA 3ATVA 4DV3K 4HUGA 1H2VZ 3UD5A 1NB7A 4DR4F 2RHFA 1RBAA 1IKWB 1HWLA 4ED4A 2BZFA 3GSIA 1ITPA 2O8DB 3DHXA 3ILLA 4IG0B 2Y0SF 2R7QA 1TFYA 3S41A 4UOHA 1SJFA 4ES1A 5HL7Q 4IKAA 2J4RA 3UMBA 2M8HA 4RWWA 3TANA 1HYSA 2NCKL 3PNIA 1S99A 4C8YA 4ZPCA 4QPTA 3KOOA 1WJ9A 2EC2A 5K14A 4FJ7A 3LANA 3D2SA 2V34A 3UPQA 1DKGD 1SKWA 3AA8A 3HX0A 2HHWA 4E98A 4OLBA 3LTOA 5K20B 4R5PB 4PKGA 2VG7A 3LO3A 3VAFA 3ZT1A 1NI3A 1XC3A 3WNFA 4M5LA 3W1YC 5HROB 3H0LB 1NSAA 2N4DA 4ECZA 4DV2F 1N52B 4X2BA 2KM8B 4M5KA 3CG7A 3HFVA 4AHUA 5DMRA 2XB2D 2MUTB 2FHKA 3LF0A 3OHAA 2BABA 4JB3A 2ZJQL 3QT5A 5F8HA 3V9XA 3H7IA 3VZHA 1CPZA 3BS5B 2B51A 4K7QA 3KZBA 4WQ5A 4R63A 3CD6S 2B5JB 9ICGA 3RG6A 5F8MA 3GG4A 4JUZA 4CGIA 3OYCA 2W3SA 2E1PA 1X42A 1J2NA 4YY3K 1GTHA 4IG0A 3T6BA 2K89A 4DX8H 2FMPA 1MWZA 3HO1A 4F0MA 5GADI 5J29A 2G0IA 3VALA 3ZYYX 1VSDA 3H1QA 3C6UA 1SV5B 1KN5A 2LYBA 4OLPA 1HNIB 4E7IA 4DXLA 4LR7A 3RJIA 2IYGA 4A8MP 1JMTA 2QFIA 1CI4A 4R5PA 4O4RA 5IOLA 4MEXA 2BYCA 4P52A 1Z00B 4B9QA 4QIWF 1ZQLA 1AFIA 4WJBA 2CA9A 3R5GA 2DY9A 4BE0A 2DIVA 4UZBA 3DXMA 1S48A 3MM9B 1ZQXA 2VG6A 3M8PA 3MXMA 3QEXA 1KR4A 2BOPA 2YKOA 4TLRA 2Y9HA 3S3MA 2Z4PA 2XMAA 4NA1A 4U8VA 2XMTA 4RKUC 2B5JA 2NQPA 3WKEA 4ZP9A 2C2NA 5C7PA 2OGUA 2UXBK 4MIBA 2WB4A 1G2EA 3OS1A 2VOOA 1H0HB 5CY4A 2E1YA 3TSQA 1JIHA 2OTJS 2EANA 3MOZA 4GC6A 3LK9A 3CJTA 3HWTA 3O3HA 3R6MA 4KH0B 3IMXA 3Q23A 3ZTOA 2OEMA 2DR9A 4X66F 4DV5J 1FW6A 1ZOLA 3C5FA 5E41A 1SV5A 1ZBFA 1RLDA 4ECWA 1W2IA 3HZ6A 2I1RA 4ED6A 2DVIA 4DV3J 4RQ0A 2BR0A 4BRKA 2V2ZA 2KICA 4ED2A 1FEZA 4IQMA 5AQJA 3PIOL 3K5NA 1PYSB 2LDIA 2QYGA 2G8UA 1VSHA 1QY7A 2R8KA 2MHNA 2YVSA 2Z8QA 1SKUB 3VCBA 3N0VA 3F41A 3PMLA 1NJZA 1EZZB 1Q5VA 3TW0A 3U4LA 2OO4A 3MR5A 4LF5F 4CJ3A 1CQNA 3BF4A 4ZVFA 2FVRA 4AFFA 3VGMA 1UEKA 2WB1F 5EE0A 1I3OB 3SCLE 4LFBK 4A8SA 4F4YA 2XCAA 3VGTA 4H5VA 3E9LA 2WOMB 3BUZB 5EOYA 3R27A 1NMEB 4QZ8A 3G86A 2OPPB 3K57A 1KDNA 2V9WA 3RAQA 4MFBA 3J8AA 2ZWPA 2I9SA 2B4UA 5J2GA 5BYQA 4Y00A 5T14A 2HAFA 4CF0A 1S6OA 1D9FA 3KJVB 3C2LA 5G0RB 3BPDA 2NRWA 1C4CA 1HQEA 3CM6A 3IV6A 2FGCA 5D78A 2FYXA 2XHCA 1YK9A 4DPYA 4P71A 2A3JA 5A6PA 1WC5A 2NREA 2NRRA 5J2FA 2QI2A 2UU9J 3KHYA 3BEGB 4OJ5A 3DGPA 2HNYB 3OHBA 5CJ7A 1U26A 5ALQA 3GG0A 4JAXA 3E9OA 3LP3A 2QLJB 4GKJK 3O9TA 1U47A 3H3OB 1X3NA 3TJAA 1N34J 4Z6DA 2JFKA 1ZQWA 1JLQB 1R89A 1VQ9N 5E79U 5BPLA 3I0SB 2JXJA 3BN4A 5AKXA 3R8YA 1OQ6A 1RPLA 1MSWD 2QLBB 2VJUA 2ZM6F 3CXCM 4Y2JA 2DNKA 3BKUA 4K4WA 2WOMA 1BPYA 5LM7E 1X2IA 3VAGA 3OYEA 3HOTA 7ICGA 2OPPA 3NGIA 5HMLA 2G9OA 4J9VA 1RBRA 4DHVA 2EFOA 5K4LA 5J2AA 1WG1A 4DB3A 3TUIC 3KJVA 3SQOP 3HRGA 1QM9A 4H5RA 1VSEA 1IR0A 3GZFA 1PSDA 3EZWA 4RQ4A 1VYAA 2KFZA 4FVUA 2PMWA 2P9UB 1JB0C 4QOTA 2YQ1A 3BO3A 1AXQA 2KVSA 5KFKA 3HHKA 7ICVA 2UXBJ 4J9PA 2BRLA 1ZAVA 1N36K 3MTJA 3ETMA 1ASWA 1C0FA 2B21A 4OZ0A 1YF5L 2VDHA 4NX9A 2P5GA 3QU4A 3OPXA 1GLEG 4BRQA 1TV6B 3LVWA 3CC4N 3TZZA 1VJWA 2DO0A 3C46A 3U3GA 4ZPVR 2I5JB 3TYTA 4Y0FA 3I0SA 2CZ4A 1HW9A 3A3PB 4CRXA 3GSDA 2FVPA 5C2DA 2ODGA 1F5AA 4U67Q 4I6MA 1ZQZA 1KQQA 2D1KA 2JEIA 2HHTA 5HVFA 4NXMK 1ZQIA 4LJMA 3DM2A 2ABYA 3UKUA 1C0MA 3MC1A 1W2BM 2HVDA 4DCHA 1XWLA 3SAFA 3HKZC 2DNRA 2YX6A 3DOKB 2E5SA 4BGAA 4WF9L 4HTIA 4MK9A 2DFHA 2RU3A 4QIGA 2OM6A 1WTFA 2ZJ8A 1RLCL 3O4WA 2L41A 1VRUB 1RDBA 4EU0A 4MK7A 1ZQQA 4J9OA 1HD0A 1WAJA 4L73A 2FVQA 1SIJA 2F76X 4H4MB 1VC6A 3PY8A 3C19A 2E29A 4QWEA 2A42A 1S9EB 4C0BA 2BCVA 4FKYA 3KKSA 3GPAA 2JR5A 2Y3YA 2I7PA 2WBNA 4RLEA 2ZUAA 4OI0A 2OEKA 2A41A 3W9IA 5EWEA 2A6OA 2I5JA 2BQUA 2OFGX 2XSFA 5JVHQ 2D0BA 5KFFA 3SV4A 3KWGA 5ALJA 3BQ2A 4ELVA 2MSNA 2VGNA 1ITGA 1E4GT 3C2MA 4DKWA 4MDBA 1NSKL 2IHMA 2PMZC 3BF1A 3I5BA 5D4LA 1NDPA 2D9OA 4OZJA 2MU2A 1NK7A 2VPWB 1C1AA 5AQKA 4XQ8A 3WUHA 4OJLA 5F8IA 1IIPA 2DNNA 4ZP8A 3IR7B 5J2NB 1ZQNA 5B66U 1YGYA 3GJQB 3SSRA 3MM5A 1UPHA 3TA0A 3PYDA 4OHXA 4IOBA 3CFOA 2PFOA 4JLHA 3C7NB 3D2WA 2AYGA 3C94A 3SCIE 4H4MA 3GYXB 3QXGA 4Q45A 2R2SA 3G6VA 4AHVA 5CZ1A 1T6CA 1FI4A 2U2FA 1W9HA 3MTKA 4UBBA 2QXFA 2LXIA 3A8JA 4FYYB 1FD8A 5KFIA 3CCWA 2CQ1A 2HHHF 4U8YA 4QWDA 1UOCA 2AEMA 2DGXA 3OD2A 4WXOA 2XY5A 5GVQA 4RWTA 3V6DA 3TVYA 3DRYA 2GQ2A 4FWLA 3G87A 1SC1B 1TUYA 3ZT3A 4FWSA 3C5GA 2AD9A 4GV3A 1MWYA 3D6TB 3MM6B 1ZBIA 2UXDF 3H0RB 1X6JA 4OJ3A 4USWA 4YCXA 4BE2A 3KLGB 1TMJA 3FMBA 1GXTA 3CNHA 5CA5A 4ID5B 1IM4A 3M9OB 4DR5K 1T8EA 3NMUA 5DBBA 2F1JA 3UE2A 4J91A 1FO1A 4EZ6A 3K8WA 4CLSA 2BDUA 3MXHP 2QK9A 2AP6A 3JSBA 1RDUA 1HR0K 2UVVA 4RW8B 2KT2A 3VTIA 9ICEA 4ZPAA 2FC9A 2KN4A 3MM7A 2P9KB 4OX7A 3NNAA 4NXMJ 1T0TV 4KHMA 1X9XA 5KGWA 2IOHA 1BPDA 1NUEA 5HVHA 2VG5B 3O4QA 4ILGB 2W03A 2PA8D 2LA4A 2KN7A 3K59A 4ED1A 4IEEA 4R0EA 1WELA 2K8AA 1JXEA 1TL1B 4U95A 2L08A 1XK8A 3T9NA 5A8RB 5KG0A 4TVAB 2COLA 4LFAK 4B3SK 2YPZA 4PABA 3R9PA 2ZH9A 4RQ1A 3WQPA 4CGDA 1H73A 3C16A 3H8YA 2LCWA 4NXNF 3V9SA 4OJPA 1SCJB 3OYJA 1KBUA 1VQ4S 2UXCJ 4ETXA 2KVIA 3HL8A 3GZ7A 4JS5A 4F92B 2XEXA 3G6EN 2KRBA 9ICVA 1C0TB 1FEEA 1MWMA 2GUIA 1JLAB 4Z4IA 2EZYA 3H98A 3CC7N 2NZCA 2FJVA 3AOAA 2CZ9A 1K0VA 3QT6A 4K8XA 9ICKA 3CD0A 4ZA1A 3JQJA 3AVMA 3ZEUB 2FC8A 2BJEA 1T03A 1A0OB 1X5OA 2F2AB 2OIHA 1FRLA 2R7UA 2IDEA 2L9DA 3TAGA 2KHCA 4EBCA 4M3ZA 2RH3A 2DO4A 1YKWA 3QICA 4DU7A 5ALFA 3G6YA 4YS2A 2ATQA 3TR8A 1H38A 2VG5A 3MPUB 2YCHA 1OPIA 4NYFA 1UWBB 4RJVA 4Q7AA 1JLFB 5AQXA 3GFHA 1TL1A 3LDQA 3NAHA 1YITS 5DM6Q 5A8RA 2K1RB 4M7XA 1A5VA 1PJ5A 4JOUA 5ALXA 3VEZA 1WF2A 4FF2A 3QT8A 1SJQA 2RQMA 2MQNA 5HJYA 2KKPA 2YJEA 2RAQA 9ICPA 4GC7A 4DL2A 3NVVA 1M5KC 4C23A 4C8MA 2UUBJ 2JVOA 4I2DA 1C0TA 3CCJN 2DTUA 3ETOA 1ZYQA 3EVOA 1S49A 1MW7A 5K8NA 1SXLA 3ELHA 1PK1A 2ZD1B 4DR1K 3D0IE 4OZ5A 5HI7A 4ZMMA 2FLOA 2Q0UA 2M9KA 5AM3A 3ZEUA 4CJEA 4CF1A 4BS2A 4A8WA 3VOVA 5CHGA 3I87A 2ZZNA 4O44A 1S5LU 4F04B 3R6GB 1DFDA 2CGKA 2PMZD 3M5RA 2IM0A 2IVOA 4UB8U 1VQKS 1TYQB 1W7AA 4J2DA 1BWFO 1QAJA 4Y65A 2D3UA 1SV0C 3TFSA 1JLFA 1K47A 5BR8J 3KK3B 4ECUA 2E9ZA 4RT2A 4ECQA 4KHWA 2HQCA 1JJ2M 1QSLA 3K2YA 2DGOA 2XO7A 2IS3A 2GTDA 1H7WA 1SGGA 2QMWA 2FJWA 1J5EK 5DLFA 2K4EA 5KI6A 3SUPA 1CJKB 2RHQB 4NOHA 1FRXA 1WHXA 1NJYA 2CNLB 5ETSA 2P9PA 5KFDA 4CH0S 3U1LA 5IXUA 4WP8A 4F3TA 1BISA 2ZD1A 3FVYA 4B3RF 1YDLA 2BX6A 3EEQA 3WKBA 3KG0A 1I3AA 1WAFA 4S0MA 3HM9A 3AU6A 4P6QA 3V9WA 1ZQUA 4ELUA 4KV8B 8ICTA 2JWKA 3BSAA 5HMXA 4FZXC 4WK3A 2F4FA 2HMIA 1UVKA 4AHTA 1RWPB 2GMJA 4F7VA 3ZETA 4JI8J 2RF2B 3HW8A 1U6FA 3CCLN 4KHPK 2OPRB 2W7PA 3D1QA 5BPNA 5T7LA 3N4PA 2F63A 1R31A 1U2VB 4AF1A 2WF8A 1NMNA 4QBUA 2OHDA 4BE1A 2YKPA 1GMVA 2FPHX 2F8MA 4EO6A 3D9BA 2CPDA 3RUBL 2A1BA 3W0LA 1FA0A 2RKIB 2KJWA 2E5LK 2R7OA 3U27A 5DK5A 1X9MA 3QIPA 1IBKF 2DXFA 5KFHA 5AZJA 2XY8A 4BVOA 4PG8A 4DLGA 2VGMA 1HQUB 2DITA 3IP0A 2N82B 3PW5A 1IWAA 5D3GB 3PX6A 5AJ3K 4LVNP 4R8UB 1KQGB 4J9RA 4KO0B 2W9CB 3CERA 4LD0A 1N5XA 4R66A 4DFDA 3V6HA 2W2NP 1T7PA 3SNNA 1RAOA 4LT6A 3SR6A 3B6BA 4G1PA 2WAQC 1U4BA 3GFKB 1SL1A 2YX4A 1HNZF 1GOAA 5G5HA 1WWVA 3DXSX 2KO1A 3ZTRA 3PR5B 2OPRA 2XYGB 1BUPA 3HSZA 3TQ1A 2AW0A 3DOLB 3P38A 4BQZA 3WNEA 5ETPA 1QVGM 4K2XA 2LBOA 4PQAA 3L2WA 1V9OA 4X4OA 3OGUA 3QWPA 3O2IA 2IA6A 1IQTA 4K41A 1JJCB 4ZVGA 1WUAA 4RQ6A 2IAJB 3ZZPA 2FI1A 1VQSA 4YOUA 3L2RA 4C1NK 5CB1A 3SI6A 4IFYA 5AE1A 1YXQA 1Z6RA 4BJQA 2RKIA 1N32K 5J0UA 5GAHP 2QKBA 3VAIA 4MMOA 5EDWA 3BQTA 8ICBA 2IOCA 4DOBA 3CCUN 1JLGB 4H4KA 4QZGA 7ICKA 5J0SA 1GMWA 3HD1A 4CK3A 5D3GA 4Q0BB 2DNHA 7ICPA 2RRBA 2B7CB 1WC6A 3SBMA 3DLBA 3QBXA 5KFBA 3CJAA 5JLFA 2WW4A 4UF4A 2JC0A 2F40A 3RH4A 4KO0A 4RNMA 2W9CA 3L0QA 5AXKA 1J5EJ 3J7YP 1S4EA 5AI5A 1R43A 4H0TB 3L09A 4K4GA 2UV8A 2V5HG 2XMUA 4CHYA 5DRKA 2QM1A 1CXQA 3S3NA 3ONNA 5DDPC 2C2KB 3L4BC 1I5OB 3F44A 1N63A 2CG8A 2Q6BA 2HK2A 3JPPA 1UZDA 1A76A 3RB4A 4IO1A 3DLLQ 5GAGP 2KVCA 4JI7J 2Q3PA 1M5SA 1ZH5A 1Q86T 4DCCA 2V2KA 1WLJA 5CD4H 3U1NA 1JK9B 3M8ZA 2K8GA 3D0HE 4OX6A 3UCGA 1T05B 3H90A 3J80U 3LDNA 1COKA 1SWVA 1CG2A 2XM3A 5AKYA 2I1QA 4H0PA 4WYBA 4NLDA 3AGKA 3MUVP 5ALKA 4CDIA 1NM1A 2W9MA 9ICNA 4BUGA 4KHPJ 3WK9A 2XZTB 1DZ5A 5F8NA 4CHZA 3MI7X 1LFWA 4B3TK 4NA3A 1KAXA 3H20A 3ZZ0A 1EQYA 1WSFA 1ZAWA 1S0OA 4DV1F 3M4XA 3GR0A 3ZZRA 2ZOFA 4CGFA 3GL1A 3SEIA 2M88A 4DOZA 2ZXHA 1VS3A 3KUEA 3IAS9 5AQGA 2OMOA 4IWVA 4KLHA 2YY3A 1X4DA 4LF9K 3D3BJ 5A8KB