1U4BA

Extension of an adenine-8oxoguanine mismatch
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 213
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u4bA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u4bA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u4bA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u4bA01
1NJYA 8ICIA 3UQ2A 3VQ9A 4C8LA 4RQ5A 2Y1JA 4KFBA 4DF4A 4F4WA 2FLNA 3AVHA 2OPSA 2GWSA 2ISPA 1TKTA 5FRNA 4Z6FA 4E7KA 4KLOA 5DQGA 2X78A 5KG6A 1YTAA 8ICGA 1WSIA 4YR3A 5KRTA 5KT3A 5L1IA 4J9LA 2BQRA 4UAYA 2O4IA 4FJHA 2ZUDA 1KFSA 2F8TA 3AO1A 4KLSA 5J2AA 4YMMA 4F2RA 4C8NA 1GOAA 4YFUA 2W9MA 4FJ9A 3KHRA 3CG7A 4CGFA 4YVZA 5KI6A 2J6UA 4IKFA 4KI4A 8ICHA 3C6TA 3KKSA 4CGDA 3T5LA 3T19A 3PY8A 4MQ3A 3OHBA 1G15A 5KFYA 2HVIA 1LB2B 1ZQGA 3OVNA 2OYQA 1T03A 3TQ1A 2BHNA 1S10A 2FLPA 3V9WA 1EXQA 4CEFA 2YV0X 5KG4A 4CJLA 3M9OB 3VQ8A 3KLIA 2BPFA 4KHSA 2OWOA 2FPMA 3NH1A 1ZQFA 4RPZA 4ECYA 5IIJA 4JS4A 3HJFA 4FJ5A 3PW5A 1QSLA 5KFVA 4YD2A 2JGUA 1QE1A 9ICGA 5HRPA 4RPXA 1RZTA 3EPIA 2DPJA 3RH4A 4IFYA 4I27A 4KKOA 5KFSA 1L3VA 4F8RA 1WCNA 1RT1A 4BDZA 3C95A 2W42A 3NTUA 4K8XA 4NYFA 3HVTA 2ZUCA 1ZQPA 3OGUA 5KFJA 4DFJA 1ZQNA 4RW7A 3G10A 4DFPA 5HMMA 1U48A 4K4GA 4B9VA 1QSYA 1BPXA 4QZCA 4GC6A 4KB1A 2FC0A 3B6PA 2JZBA 5KFNA 3M9NB 5I42A 2O4GA 3HYFA 4QZHA 4OKKA 4FJKA 4O3PA 1Z00A 2AQ0A 4I2AA 2ISOA 2IAJA 4DSEA 3AVNA 5DGBA 4E7IA 3NAEA 4DOBA 3OJUA 5F9NA 3EZ5A 3MFHA 3F73A 1WLJA 3C6UA 3QERA 7ICMA 5C24A 2QXFA 3ZDEA 4O3RA 2IMWP 3TAPA 4I2GA 4GXJA 4DSJA 3BQ1A 5DB7A 3SPYA 4LSLA 3ZSVA 2VG7A 3QZ7A 4RQ6A 3GDXA 3F9KA 4ECWA 5C5JA 3LP3A 1C7YA 4CJ3A 4FW2A 2KZZA 7ICNA 3KD1E 1Z00B 4RG8A 2MAXA 4L8RB 2C28A 2EHGA 5DG8A 5KFEA 4N5SA 4FK4A 2ATQA 1JMSA 4J9QA 3CQ8A 3NDKA 4B08A 1WCLA 2OPRA 5KFGA 4FBUA 3PX6A 5KT6A 3C2MA 5DB6A 4HYKA 3AVMA 1T05A 2GUIA 1KLMA 1CXUA 3SUNA 3PW7A 3NF7A 1JN3A 3JPSA 4DFMA 4TUPA 4IQWA 5DKWA 1NKBA 4O4GA 4I2EA 4RUCA 4JLHA 3HO1A 4CJQA 3KJVA 1IKWA 4I2FA 1NJWA 3QIOA 1ZBHA 2F96A 1FXXA 2FLLA 3LP0A 4F5NA 4F3TA 4F4YA 2BR0A 3Q8MA 4CJVA 3LAKA 2R8GA 2ZUBA 1B9FA 4DSFA 1S9FA 2ETJA 3FFIA 1BI4A 3QEXA 3V9SA 3KK2A 3QEWA 2EX3A 5KG1A 4I2CA 4ED3A 3RH6A 3KHGA 1HYSA 4F5PA 3OYAA 2W8KA 5I3UA 4DLEA 2PYJA 3GV7B 2BQ3A 4M42A 4J2BA 3O3FA 4LY7A 2OA8A 2FBXA 3MXJA 3ASMA 2PYLA 3MXMA 3JPTA 3LPUA 4M9GA 5J0RA 4UB3A 1J53A 3TABA 4M3ZA 8ICPA 4DTSA 4PGXA 2BCVA 4CK2A 2F1HA 2PY5A 4DL2A 2V4QA 9ICUA 1N48A 1S0VA 1RDCA 3IS9A 4ECSA 1V9PA 4LD0A 5HRNA 4E3SA 1NK0A 3CYMA 1ASWA 4JK1A 2JLEA 1XI1A 4W5OA 4BACA 4RU9A 9ICWA 3GIIA 1RTJA 3ZT3A 3RR7A 3CM5A 1VSFA 1CZ9A 3ZSXA 3TAQA 1RDBA 4G1QA 4QZGA 5D46A 2YKMA 3I0SA 4ED0A 3VQ7A 2YNHA 4KLEA 2Z1JA 2JEIA 1RBUA 5IINA 8ICUA 4M0AA 2LYHA 4PGYA 4FJJA 4NCBA 4ECXA 3K5NA 4CGIA 1HNVA 4KN4A 2BCRA 1BISA 1KVAA 2XCAA 4B9MA 4I9QA 4NYNA 3GV5B 4F2SA 5FRMA 4FVMA 4I2IA 2PFQA 4MEYA 3AVCA 4I2DA 3QEAZ 1RT7A 1XHXA 3L2UA 3ZD9A 4O3OA 3HP9A 3P5JA 4XQ8A 2ZD1A 4AHCA 1VSIA 4QZAA 5J0SA 2BKEA 5KGWA 4ECRA 1RCHA 4IRKA 1FKOA 3V6JA 1ZQWA 5HHHA 4KLMA 1C1AA 4CJEA 1BVSA 3KLFA 4CF8A 4GXKA 4RQ4A 4CEBA 3AU6A 1HJPA 3PW2A 4YD1A 9ICCA 1DLOA 1QHTA 2W9CA 4CEEA 3LAMA 3HK2A 2BPCA 1LV5A 4FJMA 4J9RA 3ZT2A 2XO7A 3VA0A 1ZQMA 5HBMA 3NHGA 3NGIA 1T7PA 1TK8A 1BL3A 1BPBA 1ZQRA 1RT3A 4M3XA 3OYHA 4NXZA 4O5EA 4UB1A 4KTZA 2B6AA 2PI5A 4BWJA 1UA1A 4W5RA 1ZQDA 1VSKA 1J5OA 4CJSA 4J2AA 2HB5A 1JLCA 3Q8KA 2FMQA 5J0YA 4B9TA 4WE1A 7ICJA 4RPYA 1SKWA 1C1CA 5J2BA 4OJRA 2Z1IA 2PFOA 1L3TA 4EYIB 4M9JA 1ZBUA 3V1RA 2FBYA 5J2JA 1TKDA 4IDKA 4CIEA 3QEVA 1Z25A 4O3NA 2PZSA 2XGPA 3VQ6A 2D0AA 4IFVA 3V81A 4IG0A 3AA4A 1XWLA 3SQ0A 1X1PA 4I2JA 5KT4A 3EWAA 4EP5A 3K58A 1BHLA 3MABA 2DFLA 2G8IA 4ZH4A 8ICSA 1WSJA 4I9LA 1RXVA 5KFHA 4CGGA 1BPEA 2VA3A 5KFFA 4OGCA 2HNZA 3HP6A 3QEPA 3KHHA 3VQ5A 4HHTA 2FPKA 4CGHA 2OPQA 1JXBA 4CFDA 3C2KA 3VQQA 1D9DA 5DDYA 1KLNA 1VSEA 4CIGA 5J29A 5KFDA 4PY5A 1QSSA 9ICPA 5CWRA 2PXIA 4KTQA 1H38A 4PA1A 3U6FA 5BPCA 4B9LA 1TVAA 4BXOA 4FS2A 5D3GA 3VQDA 5K14A 3RJEA 1S1XA 8ICZA 3AVGA 4FJ7A 1LAWA 1D8LA 5KG3A 3H8SA 8ICWA 4IBNA 4DSLA 1VSDA 1DOQA 4C8KA 4B9SA 2B21A 1RILA 3K2PA 3PW0A 5KFBA 3RRHA 5J0QA 1RT5A 5DBBA 5DBCA 1XO1A 8ICLA 4FZZA 3C2LA 1B9DA 1B22A 4M3YA 4F93B 2HW3A 1A5XA 1FKPA 3G6VA 2ZTCA 4M6WB 2XCPA 2PI4A 3PUFA 3ZDDA 3QIPA 3N97B 2Q3SA 4EBEA 4QCLA 3RAQA 4I2BA 4PHAA 3ZT4A 4DTXA 4F92B 1U49A 4M45A 4DG1A 4Z4EA 3V9XA 8ICBA 3SUQA 1IKXA 4TUSA 1HJRA 1RNHA 1YVUA 1S6QA 1C6VA 2F8SA 4I2HA 1Q9YA 4YXMA 3AO5A 3LANA 5DDMA 4F5QA 8ICVA 1SKRA 2D5RA 2ZJ5A 1BPZA 4AHVA 3FYHA 5DLFA 1KTQA 3QESA 1QLNA 4G3IA 1I3AA 3D45A 1BGXT 2KTQA 1XC9A 5KFTA 4AILC 1HQUA 4O55A 3UXNA 3PMNA 4ID5A 4J9OA 4Z0UA 2WOMA 3L2VA 4QWDA 4BE1A 3JPPA 4BGDA 3ISCA 4B3OA 4Q0BA 4UAZA 1JLFA 4DSIA 2KN7A 2W9CB 1T8EA 5DMRA 4KLLA 3OSPA 4KI6A 1QS4A 1JIHA 1W0HA 4OPKA 4DLGA 4FBTA 3V9ZA 4E89A 5J2IA 4I2PA 3H40A 4RNOA 2ITGA 4M9HA 5KFIA 7ICPA 1S77D 1BCMA 1ZQKA 3SZ2A 2XY6A 2E6LA 2E4LA 1JXEA 5TZVA 4CHYA 2VWJA 4FLYA 4CJRA 1AROP 1A5WA 3RB3A 2G8HA 2DPIA 3Q8LA 1ZBLA 1BIUA 5J0PA 2B4JA 3PR4A 3L3VA 4EZ9A 5HRSA 4R8UA 4Z6EA 2C2RA 3QO9A 4R63A 3VQBA 4GXIA 1TKZA 3VQ4A 1N6QA 4FJGA 2NRTA 2P6UA 4ECTA 4LH5A 4F3OA 7ICSA 2VA8A 2XY8A 9ICJA 4LSNA 3SUOA 4CERA 5EWGA 3VN5A 2IGIA 4J9MA 3NF6A 1EP4A 4JV2A 3TI0A 1S1TA 4J9SA 9ICKA 4JRPA 1EETA 2A1SA 2VG6A 5KFQA 4RW9A 3OYNA 3JSMA 3EPGA 2NUBA 3AUOA 4NM1A 2RDJA 3TARA 9ICAA 2YNFA 4ZHRA 1RBVA 3ZSQA 2X74A 2Y1IA 1SUQA 4HTUA 4CJFA 4M3UA 4C8OA 3DLRA 4TURA 3BQ0A 4ED7A 2DFFA 3C1ZA 4I2QA 3RR8A 1W9HA 1ZQUA 3ISNC 4O0JA 3V6KA 3IM1A 4QZ9A 4LH4A 1D9FA 2NRWA 4B8AB 3MR5A 3SQ2A 2IC3A 1VSMA 4EEYA 1O1WA 3VQCA 1SV5A 3SUPA 2ASDA 3PO5A 5J0XA 1JL2A 4ELUA 4RW4A 4CJUA 3OS2A 4TQRA 3MEEA 4E1NA 1NK6A 5KGXA 3MDAA 4CHNA 1KVCA 1LWEA 1L3UA 1KEJA 4OLAA 1Q8IA 1U47A 4KHQA 3M8SA 2RPIA 5L1KA 3NGDA 1IM4A 3ZDBA 4YR0A 5KFPA 8ICXA 4DTJA 3O3HA 3MR3A 2BPGA 3AA5X 3DLEA 5KFUA 3ISBA 2ALZA 3DLHA 3AVBA 4C8MA 3HX0A 4M3TA 1NK9A 3MAQA 4DTOA 1XU4A 4YNQA 2C2EA 3T5JA 4J9KA 8ICJA 2Z1GA 4W5QA 4DTPA 4DQIA 1BQNA 3HW8A 3B0XA 4DL7A 1MQ3A 2UVWA 3RRGA 4RQ7A 1JXLA 4AHUA 3ULDA 4QWCA 3TAFA 2QK9A 4R8UB 3RTVA 4QW8A 3H8JA 4KRFA 4B8CA 3LZIA 2HHVA 3RJGA 3D0PA 2XRIA 5J2QA 3TAGA 4DQPA 1KFDA 2IOCA 4R5PA 2P66A 1ZQTA 1BQMA 2PFPA 1RPLA 5E41A 1A76A 3KKRA 9ICQA 3OYDA 3I0RA 3K4GA 2AGPA 1IH7A 4DTNA 5KFCA 2A1JB 5J2FA 4O0IA 1R0AA 4F50A 2YNGA 1NK4A 3NGZA 8ICEA 1NK5A 3BQTA 3ORYA 4HCCA 3HL8A 3OY9A 4DOAA 5J0WA 3AU2A 4KLHA 4P4MA 7ICRA 4CFCA 2AGOA 4ED1A 5J0TA 1WSEA 3NH0A 3NF9A 1HQEA 3QZ8A 4Z6CA 2XHBA 1NOZA 4M2YA 5EWEA 4F4XA 2HNDA 3OYMA 4QZEA 4CF1A 5KTQA 3KLEA 1UWBA 1HYZA 3DLBA 1GOBA 3SYZA 4M6WA 3AVIA 4F4KA 1BPYA 5CR0A 8ICAA 5JS2A 5C42A 2JZBB 2RDIA 3JPNA 1S6PA 4YP3A 1ZQJA 2UVVA 4JV0A 4FXDA 1KDHA 4M3RA 3T1AA 1HPZA 5KFRA 5HP4A 1IXRA 5IIMA 3UPQA 3KK1A 4RNNA 4JWNA 3ZT0A 3L2RA 4GW6A 4DU3A 4K8ZA 1N5YA 4KLFA 4H4OA 4RT2A 3S3MA 2XC9A 2HNYA 1RT4A 1U45A 2V9WA 1NOMA 7ICKA 1HUZA 1JKHA 3LALA 3OYKA 1S9EA 3HPGA 1EXNA 4OPJA 1RYSA 4CEZA 5CB1A 4I7FA 1A77A 4IRDA 3ZSYA 4JUZA 4ED6A 5J2NA 3RJIA 2FMPA 4DL5A 4KHNA 1RDAA 4QZ8A 3L3UA 4H8KA 4GLXA 3ZCMA 3HPOA 4B9UA 2XY5A 3UXPA 3ALYA 3H8WA 4QZIA 1WAFA 4UQGA 4IQTA 1WSHA 3JYTA 3RMBA 3TANA 5FDLA 1TVRA 1WN7A 2YHBA 1S9GA 3DLKA 4NM2A 3GIMA 4OVLA 5DLGA 2AJQA 4EBDA 1RBSA 4LZDA 3SCXA 1ZJNA 4UB4A 3RMAA 3GILA 4HUFA 3AA3A 2BGGA 4KLTA 8ICQA 4FJ8A 3O4NA 3V4IA 1TK0A 3CFRA 4Q45A 3S3NA 2X6NA 4E7LA 2DFEA 4N56A 2Z1HA 3TR8A 4KHYA 3Q8SB 4FK0A 3UQ0A 4AHRA 3AVAA 2R7YA 1UAXA 1WSGA 4EP4A 4FJIA 4R65A 3L2QA 1ZJMA 4JWMA 3UIQA 1B92A 4FM2A 4MEXA 2LSNA 4BXOB 3ZDCA 4FLXA 5CYMA 4DF8A 8ICYA 5CYQA 3T5KA 1F21A 1KVBA 9ICSA 9ICIA 5KFZA 1MU2A 3E2EA 3VA3A 2G8WA 3H7IA 2IS3A 4ZTFA 1NJZA 1T4GA 3RJFA 4CHZA 1JL1A 3M8RA 3N4MB 2JEJA 2IBKA 4RW6A 4Q43A 2BDPA 1J54A 4NCGA 4GC7A 1ZBFA 3B6OA 9ICHA 2GV9A 4KHUA 2NRXA 4CJ5A 1VRUA 1REVA 7ICLA 4QZBA 1Z26A 3JPOA 2RF2A 5KG5A 4BE2A 4XRHA 2GBZA 2I5JA 2I1QA 2BGWA 3AO3A 2DY4A 3V7KA 3RJKA 2F1IA 3C94A 2F1JA 4Q8EA 1C0TA 2IDOA 1CUKA 3SI8A 2R8JA 1ZQZA 2ZQBA 3DRPA 3MECA 4PGQA 2AU0A 1A5VA 4MFFA 3P83D 4YFKA 1QTMA 3TFSA 2P6RA 1Y97A 4QWEA 4IRCA 1WAJA 3VQAA 3AV9A 5CJ7A 7ICIA 2BCUA 2XGQA 1UOCA 4J9NA 2P1JA 4HUEA 4DU1A 2D0CA 1RBRA 1YT3A 4P4OA 5HMLA 3MEGA 1ZQEA 4O3SA 9ICNA 1VRTA 4X5VA 1Y88A 3GFKB 3ZD8A 3K75D 2BANA 3OYBA 2HHUA 5J2GA 4HVJA 4CF0A 1DTQA 5KG0A 4RQ1A 5J1EA 3DMJA 4KB0A 2R8HA 4FLTA 1KRPA 1PZNA 3KHLA 4CFBA 8ICNA 1N56A 3TAEA 2W9BA 5DG7A 3NF8A 1U9LA 4E0DA 4KLDA 1D5AA 4KTWA 3NH2A 4HCBA 4F4ZA 4BDYA 2E6MA 4M41A 3I8DA 4DL4A 2HHXA 4NLNA 2HHSA 1IKVA 4YR2A 1XSLA 3L2WA 3GIJA 1Q9XA 2G8UA 3RBEA 3V1OA 1VSHA 4M9NA 1RT2A 1C0UA 1JX4A 3OSNA 2RKIA 3KLHA 4ED2A 3MFIA 4EBCA 4ELTA 4FCYA 3B0YA 5DBAA 4W5NA 5HHIA 1U04A 3HVRA 3ZSRA 5DQHA 4N41A 2JEGA 3HSTB 4ICLA 3PVXA 5IIKA 8ICMA 3MBYA 1JLQA 3ITHA 4Q5VA 3VQEA 5JUMA 4DS4A 1CLQA 5IIIA 4K4HA 1I39A 1TKXA 5SZTA 1NJXA 4ECUA 1JLGA 2NRZA 3GV8B 1X9SA 4CEDA 5J2KA 4R64A 4MFAA 5SWMA 3S9HA 4PWDA 1RT6A 4FJLA 5CY4A 3KTQA 4ECVA 4CEAA 3KK3A 4BWMA 5CP2A 3H08A 3HM9A 5J2HA 3OYCA 1RTHA 1YTUA 2AGQA 4B9NA 2NRVA 3IHQB 1LWCA 3C23A 3V72A 3ETLA 3OJSA 2KFNA 4XIUA 2WTFA 1LW0A 5J0OA 7ICEA 2M9NA 9ICFA 2IA6A 5F9LA 1LWFA 1XHZA 3NE6A 3KIOA 2ZTEA 4DMNA 2QKKA 3LK9A 2KFZA 4M04A 5DGAA 1CZBA 2R8IA 2HMIA 4EZ6A 3KD5E 2FBTA 3QNNA 3MXIA 1XS9D 2YKNA 2QKBA 1IG9A 2Q0ZX 4DL6A 2ASJA 4W5TA 5KFAA 4CJWA 1HYVA 1SL1A 3RWUA 3ZSZA 5D4BA 4J2DA 4RZRA 3A2FA 2J6SA 2ZJ8A 3OYFA 5DB8A 5IILA 4NCAA 4IQVA 3C21A 3C5GA 3SI6A 4YMNA 9ICTA 1HUOA 4KREA 1HMVA 3V7LA 1MQ2A 2UVRA 3FDSA 3CM6A 3HT3A 1S0MA 2HHWA 3QNOA 4CCHA 3U3YA 5KFMA 4UBBA 2RN2A 3THVA 5J2MA 2WONA 3DLGA 3DRRA 5HROA 5HNKA 3EW9A 4YCXA 1SKSA 3O3GA 4Y1DA 1S76D 4FYDA 4IQUA 8ICRA 4OKEA 4CF2A 2MUTB 1HNIA 2BQUA 2ZJAA 1B43A 3E01A 4KITB 4O44A 3WNEA 3SQ4A 5L9XA 3SQ1A 7ICTA 3V6DA 4M3WA 8ICCA 3OYJA 4FZYA 3PO4A 1WNSA 4CK1A 4FZXC 1S1UA 4KN7A 3OYGA 3RB0A 1RDDA 4RQ0A 4FO6A 3Q8QB 4ECQA 3PR5B 1K1QA 2OZMA 4KV8A 1K1SA 2G8FA 1S0OA 5JS1A 3RMCA 1ZQCA 4H4MA 4RW8A 3H4BA 2MUTA 3V7JA 4KPYA 4YG2A 5HLFA 3LPTA 1VK0A 1X2IA 1Z3EB 5KT7A 1ZQAA 4FLVA 4CGJA 1L3SA 4RT3A 8ICFA 4FLUA 4J2EA 4CE9A 3OS0A 4UBCA 4YQWA 3HPHA 3MR6A 3U3GA 5CA7A 3AA2A 2P51A 1SL2A 2W9AA 1TV9A 4DQRA 4BDPA 5CHGA 1ZETA 2ZTDA 4AHTA 3IG1A 4QZFA 4KHWA 4O9MA 2BCQA 4DTRA 1BI4B 3CFOA 1BPDA 4AH9A 4PQUA 2P5OA 4CHPA 3QLHA 5HRRA 4ZTJA 4QZDA 3PMLA 3KLGA 3MDCA 4Z6DA 4Z4IA 3QINA 1RTIA 1VSLA 1GOCA 4CEOA 3T5HA 4E1MA 2W8LA 2ATLA 2VG5A 9ICOA 1CEZA 2J6TA 3SPZA 4UB5A 4BE0A 4OGEA 4CJ4A 4NY8A 3NGYA 3WNHA 3GQCA 4PH5A 5KFLA 3NCIA 4NLKA 2BCSA 3DYAA 1TAUA 7ICUA 5KRSA 4KLUA 4Q44A 4I29A 3VQPA 4FS1A 9ICEA 4KAZA 4FJXA 4E7HA 4Y1CA 1C1BA 4DL3A 5D49A 2UVUA 3OS1A 4DFKA 3BJYA 4DQSA 3QE9Y 1TL1A 4JRQA 4LVSA 4CJPA 3GIKA 2VANA 3UXOA 1SL0A 1BIZA 1U4BA 5KT5A 9ICVA 3O4QA 1UT8A 3NBPA 4CHQA 7ICOA 1ZQIA 1D8YA 4DO9A 1LW2A 2HHQA 3MEDA 4J9PA 5KG7A 1NKCA 4R66A 2V4RA 3ZSWA 4KLGA 3SJJA 4PPXA 4TUQA 3BGRA 3M9MB 5J2DA 5IIOA 4FW1A 3AO2A 3G0ZA 9ICMA 3PX4A 1MSWD 4CIFA 5J0UA 3HWTA 3P1GA 4QOZB 5KFKA 1VSJA 1TAQA 2FBVA 1EKEA 4O5KA 4LZGA 4DS5A 1RBTA 4CFAA 1FK9A 8ICKA 4M9LA 3PNCA 4QWBA 3RH5A 2IHMA 7ICVA 1LAVA 4DTMA 1X9MA 4K4IA 4GMJB 1MC8A 2KZ3A 1K6YA 3LP2A 2XY7A 5DB9A 1S1WA 3G6YA 4Z4GA 5J2EA 9ICLA 1EX4A 3OYLA 4CJKA 1ZQSA 4IG3A 4MFCA 1QQCA 4KLQA 5KFOA 9ICBA 1HRHA 1ZQOA 2I9GA 3H4DA 1ITGA 4CHOA 5J2PA 4DU4A 4XA5A 1CXQA 1SZPA 5DG9A 4N47A 1ZQXA 1ZQHA 1C0MA 2C22A 4IR1A 4CF9A 2KZMA 9ICRA 3RB4A 1S0NA 5KG2A 3JPQA 3K5LA 5DQIA 3ISDA 3RB6A 4CECA 3S3OA 1JLAA 2FPLA 3G6XA 1DGSA 3M8QA 4P2HA 1ZBIA 4KMUA 1KSPA 4ELVA 4IR9A 4MFBA 3WNFA 2P5GA 3DM2A 1ZQVA 1L5UA 4ED8A 7ICGA 4CK3A 5FROA 2D0BA 3MGIA 4KO0A 5EOZA 1RXWA 3PX0A 4E19A 1KFTA 2G8KA 3RMDA 1ZYQA 4RQ2A 1NOYA 3AVKA 3JPRA 3V6HA 1J9AA 4ID1A 3AO4A 3PV8A 2G8VA 4Z4HA 3IRXA 4YN4A 3Q8RB 1XSNA 8ICTA 3LDAA 3AVLA 4F5RA 2R8KA 1NKEA 1UA0A 3V9UA 5CZ2A 2IHNA 5J2CA 3PW4A 1TGOA 3MGHA 3TAMA 4RUAA 3T3FA 4YXJA 3AVJA 3DI6A 3QEBZ 3AVFA 1ZQYA 4F5OA 3M8PA 4AHSA 7ICFA 1BCOA 5L1LA 4RQ3A 3DOLA 4FLWA 1JLEA 5HP1A 5KFXA 2FMSA 4FK2A 4I28A 1S1VA 4CESA 4FLZA 4Z4CA 1TFRA 4TQSA 4QWAA 3K5MA 4QAGA 3ZT1A 2VA2A 5CZ1A 1NK7A 1X9WA 1S97A 2VWKA 2W9BB 1ZQLA 4M47A 1ZQQA 3BDPA 3C5FA 4CEQA 2C2DA 4DWIA 5KT2A 3LZJA 4FJNA 4NLZA 2A1RA 1ZQBA 4MF2A 4RNMA 4Z4FA 4JS5A 4TSXA 3SV4A 1COOA 3QEIA 3L8BA 3V1QA 3LP1A 5EWFA 5BOLA 4N76A 3RAXA 4NLGA 1ASVA 1JLBA 1S5JA 2YHAA 1WSFA 4O5CA 4DQQA 3K5OA 2X6SA 3K57A 3RBDA 1XSPA 4F91B 2OZSA 4UAWA 1UT5A 2KW4A 5DK5A 2HVHA 3RJJA 5L1JA 4OLBA 4QW9A 4O3QA 3QETA 2B5JA 4O5BA 4KLIA 1TK5A 4ECZA 2BE2A 1RTDA 2AQ4A 1DTTA 5EU7A 4FM1A 8ICOA 3TFRA 1KCFA 3SV3A 1T3NA 3LWLA 2OPPA 4KLJA 2YNIA 2DFHA 2ZE2A 3BQ2A 3WNGA 3EY1A 4YMOA 3DRSA 4PHEA 1ASUA 3OYEA 1IKYA 4XUSA 4DTUA 3LWMA 4E7JA 2PFNA 3C1YA 4Q8FA 4HUGA 2A1JA 3HXMA 3DOKA 1TV6A 3CFPA 1RYRA 4RQ8A 3RJHA 4UB2A 4MF8A 7ICQA 3SNNA 4JV1A 1TL3A 4PHPA 4PHDA 3TWHA 5C25A 3OYIA 2ASLA 4P4PA 2DTUA 3IAYA 4GVMA 4DEZA 9ICXA 4CJTA 3ZDAA 5KFWA 4OKJA 3LDSA 3NFAA 2H5XA 2KQ2A 3K59A 2HHTA 3EYZA 1IO2A 4DSKA 4DOCA 5T7BA 4PUOA 3MR2A 1NK8A 4FM0A 3Q8PB 3OHAA 4EYHB 7ICHA 5BOMA 2JEFA 3ZSOA
chains in the Genus database with same CATH superfamily
1BNOA 3DLKB 1NJYA 1Z4OA 2FJXA 3UQ2A 1LWCB 1SH3A 2MZ1A 2UXDF 2PFUA 1K8AT 1XNRF 3CJ3A 4MYUA 4F4WA 4M63A 3UCGA 5EDWA 1JB0C 3E9OA 1ZA2B 3O9TA 4G1IA 5CZVA 4OHWA 4DV5F 5FRNA 5AQIA 4E7KA 1T95A 1DRZA 5KG6A 4IH5A 2KD1A 3D6JA 5IC6B 4YR3A 3J80Y 5KT3A 5M2RA 4J9LA 2D41A 1KQFB 2GS8A 2F8TA 2J7WA 3PSIA 4YMMA 4F2RA 1GOAA 2OPSB 3KHRA 4CGFA 4YB7A 4TLQA 5KI6A 4OZ0A 2J6UA 4KI4A 8ICHA 1FFWB 3VGUA 3EX7B 1R0AB 4CGDA 4NRTA 3PY8A 2ATCB 2KIWA 4DV2J 2XI3A 1RKJA 2FY1A 1RJJA 2MHEA 3R6GB 3W1YC 3KWGA 2FLPA 2Q66A 3CETA 3R2DJ 1SAZA 5KG4A 3UM9A 2JWNA 3M9OB 4YUDA 3VQ8A 2BPFA 4KHSA 3M6ZA 2FPMA 2ERRA 1N6QB 1U0SA 2HBQB 3IS9B 4RPZA 4FNHA 1RHMB 1GQEA 3HJFA 1L3KA 1IG6A 3QRQA 3D7EO 2JGUA 4NWIA 2Z58B 1QE1A 4JD2A 2HRUA 1XEZA 2GX9A 2UV8A 3MM7A 3TTCA 4RPXA 1VIXA 2WFBA 2JDJA 2YB4A 4I27A 1KTVA 2RD5C 3K17A 3M2RB 1VS3A 4KKOA 1L3VA 2L3MA 4F8RA 5AK3A 1WCNA 2VWBA 3C95A 4PQUB 3SCJE 3UFCX 5CR4A 4UOGA 1ZQPA 3AT1B 1BWVA 2AX0A 4BR7A 2L9WA 3G10A 3TNVA 3QMQA 1T03B 4YOXA 4B9VA 1R0CB 3IGNA 4QZCA 1HQUB 4C3LA 4FWSA 5T7LA 2FC0A 1QTNB 1ZOTA 1FA0A 5I42A 1MMDA 3I8BA 4NLVA 4FJKA 2BBEA 2KVSA 1Z00A 2VIHA 4I2AA 2ISOA 3IUCA 2R7QA 4DSEA 4M7YA 2ZH2A 4B1XB 4DOBA 4FZMA 3OJUA 1BY9A 5F9NA 4S0MA 2L48A 3F73A 7ICMA 1XJWB 2ZUGA 5C24A 1WEZA 2QLBB 2IMWP 3G86A 1VQ8S 3IP0A 2AEMA 1JLEB 3FSYA 1X4AA 3ZSVA 3QZ7A 4JI0F 3TU5A 3SQGB 1RGIA 5C5JA 2ADBA 1C7YA 3LP3A 4Q2MA 1JJ2R 4CJ3A 4FW2A 5JVGL 1VGYA 1Z00B 3CQYA 4BBYA 5IXUA 1NUEA 1CC8A 4FK4A 2QB0A 1FDDA 1Q7YT 3K8WA 3CQ8A 1YGYA 1M1HA 4B08A 1WCLA 5KFGA 4FBUA 1HWUA 2MKIA 4I6YA 4HYKA 4LQ3A 4X62K 4CF5A 2H4YB 1CXUA 3SUNA 5C7PA 4WKYA 1JN3A 2OTJN 1X3MA 4C8ZA 1UP1A 4DFMA 2KI2A 4TUPA 2A19A 5AJ3F 1NKBA 1HKAA 2HLTA 2V2VA 3A13A 3UR0A 2ZH7A 1ZM4A 4I2EA 5AQTA 2DHHA 4MKYA 3KJVA 3AAQA 1TUGB 3CEDA 4H5WA 3QIOA 1ZBHA 4NLWA 4KH1B 3HHLD 2FLLA 3LP0A 3BN7A 4OYOA 4CJVA 2EZXA 4C11A 2ZGZA 4PPZA 3N7RC 2ZUBA 1UAWA 3RAMA 5D0RA 4USMA 1S9FA 2ETJA 1BI4A 1HIWA 5J2NB 1M1GA 1SWWA 2BKPA 3G8QA 1NDPA 1R8BA 4OIXA 3C8YA 4F5PA 3L6QA 2W8KA 4DLEA 2BQ3A 3NGUA 2O8EB 5CHCB 2KB2A 1MWMA 3DRSB 4ZCLA 1U1NA 2YNHB 4XDDA 2RHSB 1VLOA 3WC2A 4M9GA 3ZX2A 2W25A 2F4VJ 3IRXB 1YJRA 4RNHA 3OLAA 2F1HA 1WUUA 2RUSA 1ZZNA 2P6TA 3IS9A 4BVOA 1V9PA 4LD0A 4AD6A 3CJTA 4E3SA 2WF8A 4R25A 3TSPA 4JK1A 4DU7A 4BACA 1W7AA 9ICWA 1QAYA 5IWAJ 3GG4A 2Y0SD 1RDBA 1O13A 2ABYA 2G2ZA 2F77X 3VAJA 4QZGA 4X2BA 1W25A 3W5ZA 2HSTA 4JK8A 4H0XB 2Z1JA 5IINA 2LYHA 2DY1A 4FJJA 4NCBA 3JTOA 1N54B 1S7HA 2O8FB 4I9QA 2EC0A 2ASPA 2ZOMA 3UB5A 2HOIA 2HK2A 3R7BB 1RWPB 2PFQA 3L2UA 5ALOA 1G6BA 1PO6A 3HP9A 4OD0A 3IXQA 3P5JA 5AFUA 3MUVP 1V38A 1JLBB 3VPZA 1HKBA 3DXKA 2LDIA 2CJYB 4M8LA 4UT4A 3CGIA 1AZSA 2E7WA 1WI6A 1P9QC 2UXCJ 4U8VA 1C0TB 2KT3A 1C1AA 4LF9J 3KLFA 4CF8A 2HAFA 4DL0C 2BJEA 3AU6A 4EO8A 3I4PA 2GMJA 4HI2A 2BJ1A 2ROEA 5AT1B 1HNXF 1QHTA 3J81Y 4OLOA 1LV5A 4FJMA 4X64K 4BR0A 3NHGA 2A40A 1RT5B 2MKJA 3DKDA 3GJQB 2LI6A 1TK8A 3D7SB 3RGIA 1PG5B 3MCAB 1RT3A 4QQBA 3OYHA 1RISA 1W26A 2F8MA 1RWWB 2B6AA 1RTHB 3NY0A 4W5RA 1ZQDA 2OH2A 5AKGA 3EE3A 2CWXA 2UXDK 3IR7B 1EJ7L 4CJSA 2HB5A 1V5IB 3Q8KA 2GQQA 4I64A 4KHPJ 5J0YA 4OI6A 7ICJA 1C1CA 4OJRA 3F2DA 3QYYA 1RLDA 2ZH3A 2EVZA 1ZBUA 1IBMK 1Z2LA 5FLXO 4JMUA 2D6FC 2XGPA 1ZPWX 3NG8A 5K8PA 2OPQB 2O8EA 4J37A 4QIWF 4IFVA 2Q1LA 4UY8T 4IG0A 3HFKA 1FX4A 2GVZA 4U96A 2YQ3A 5KT4A 5L39A 8ICSA 5ALZA 1RACB 3J7YI 1BPEA 4CGGA 1NZBA 4CNYA 3H8YA 3QEPA 3VQ5A 4HHTA 3OTOF 4DUZJ 4CGHA 1JXBA 4DV4J 4A4JA 1LCUA 1JQGA 4A46A 3HDSA 3A8EA 2WVFA 4PY5A 1QSSA 3ILOA 3OXGA 2J9CA 4BRFA 2PXIA 1HMVB 4RBTA 1V5VA 2KDOA 3DGVA 4Y28C 3M2RA 4KKOB 1TVAA 3DXBA 4JYAF 4FS2A 2V63A 1Z1VA 2V8DA 4C9DA 5K14A 2YX6A 2QWPA 4URSA 1BD6A 2W54A 2Q2RA 4QIWD 4FJ7A 1LAWA 3TA2A 2J0WA 5CCMA 2ZNZA 5TKYA 1UL3A 1VSDA 5AQLA 4B9SA 2HS0A 2E5LK 2GIQA 4GVBA 2LU2A 3R5DA 2VOOA 4DR4J 3QSIA 3JS9A 4LT6A 4ZIWA 1ATSA 6FDRA 4LFCJ 4FZZA 2QL5B 3KJVB 1UVLA 3AEVA 5AQNA 2NREA 5DM6Q 4F93B 1FKPA 2GAHC 2H3EB 1A5XA 4LFBK 2ZTCA 4P10A 2XCPA 2VYPA 2PI4A 1K47A 2DGVA 4QCLA 4DG1A 3HHLA 8ICBA 3SUQA 2H3ZA 4TUSA 3KLGB 3I55N 1HNZF 4HLBA 3FBBA 3QT8A 3M8PB 3Q22A 1N5YB 4LFAK 1EAYC 2LEAA 8ICVA 4ZDNA 3ZXWA 2ASMA 1P6TA 1SKRA 3ENVA 4AHVA 3SMVA 4HVZA 4DUYF 3VVUA 2I7PA 5F8IA 2Q0RA 4AUKA 1BGXT 2KTQA 3MUTP 4BR4A 4O55A 2FJBB 4Z0UA 1KN5A 4BE1A 4K4ZA 2P5VA 2F8EX 1JLFA 3FGVA 4J8FA 5DMRA 2ZH5A 2K8CB 1W0HA 3OUYB 5GADI 2YH1A 1TFYA 3CDEA 2E5JA 4WQ5A 2HG4A 4RNOA 1VQMS 5D8HB 3QO9B 1CLFA 5DRKA 2CQBA 4HH1A 3SCIE 2E4LA 1RTJB 3FZHA 2RUGA 3H2LA 2GHWA 4CHYA 3UPFA 2BTFA 4NYOA 4C98A 2DPIA 2OD6A 4JV5J 1BIUA 2QARA 3L3VA 3ZZYA 5ALDA 1X5TA 4R8UA 3UNGC 4OJ1A 4R63A 4DV3K 4GXIA 3TADA 2AWZA 2YB1A 4ECTA 1WDDA 3DOMA 4YHHJ 3HX9A 4C6AA 2HWTA 2GUPA 3SUOA 2V8VA 2WF9A 1FRJA 4CLFA 3ITHB 4YDDB 5GAGI 1EP4A 4PEOA 5IT4A 3CJKB 9ICKA 4OYIA 1ZBSA 1Q53A 1VR6A 5LSOA 1EETA 4RW9A 3OYNA 3JSMA 3EPGA 4W4MA 3UN2A 1O8BA 3AUOA 4NM1A 4AQYF 9ICAA 2AHOB 3TARA 2YNFA 1UFLA 3RSEB 2ZIUA 3VQSA 1Y10A 2KT5A 1SUQA 2ROPA 1RHRB 4CJFA 3CCMN 4M3UA 4TURA 1E3MA 3CC2S 3QATA 1H98A 4B3TJ 1TKXB 4QZ9A 1D9FA 2E1FA 2NRWA 4L3KA 4DCOB 3MR5A 2QE5A 3SQ2A 4DR6K 4DV5K 1PIEA 4DBQA 3LVWA 3VQCA 7FDRA 3K8VA 3L7UA 2ASDA 3HT0A 2RF2B 1U02A 5GVQA 3OS2A 4ZLNA 4TQRA 1QM9A 2F4VK 4OI4A 4Y2UA 2DXDA 5AQOA 1L3UA 1KEJA 1V9OA 4TU7A 2I5HA 1X0FA 2IIHA 1T9TA 4X4UA 5GMEA 1Q8IA 3SK3A 4KHQA 1B0PA 3VWSA 3NGDA 1IM4A 1PJ6A 4M7XA 1Q7YO 3THYB 1VDVA 4DTJA 3TUJC 1PYTA 1ECWA 1FXRA 2HVZA 1VQ5S 4M3TA 1FE4A 2DNGA 4YNQA 3R97A 2CA9A 2C2EA 1O08A 8ICJA 4W5QA 3N5FA 2E44A 3ILJA 1N63A 3HW8A 2CJKA 3L4BC 4DL7A 4RQ7A 3TAFA 4QWCA 4U95A 4QW8A 3AB2B 3H8JA 2MLZA 1TYQA 1LK7A 3C65A 4K2JA 4DCPB 1MNEA 4DZ6A 1Y5IB 1KFDA 4R5PA 1BQMA 5E41A 1BA1A 4FWQA 3P38A 4MK7A 2RLTA 1JJ4A 3CD6N 4MK8A 3KVGA 4O3MA 4DTNA 2F44A 3DLLL 4ZVUB 1FD2A 4EFHA 3W64A 1R0AA 4F50A 4RNFA 4C4SA 1NK4A 4Y2MA 4KY3A 2LXIA 3NGZA 4AXJA 5B8HA 1NK5A 4N77A 3BQTA 5CZXA 2P9EA 1W7WA 2WAQD 3D1HA 2VC1A 4KLHA 3CJAA 3J7A1 1FO1A 1S1VB 1HQEA 2QB1A 1YWXA 4DUZF 5EXWA 2XHBA 1NOZA 4OYAA 4F4XA 1WHWA 3N4QA 5KTQA 2QWNA 1N4LA 1N32J 1U2CA 4F4KA 5CR0A 1KOHA 2AYEA 2H3IA 8ICAA 4OYZA 1RADB 3MCMA 4WPAA 4O8KA 2E88A 2YNGB 1XNRJ 3AOAA 4FXDA 2QWLA 1KDHA 2VB6A 2OTJS 3CCVN 2BANB 5HP4A 5IIMA 3UPQA 4H4KC 5AQMA 3TA1A 4RNNA 5JICA 1PYOB 2NR0A 2V69A 2WHEA 4L76A 2PMZD 2JVRA 4CLKA 4RX6A 4FF2A 1FVSA 4KLFA 4H4OA 4NI2B 2OTLS 4BRQA 2YI1A 3KDOA 1U6FA 1U45A 1KC8T 3CCRN 2HRYA 2W3RA 1HUZA 1JKHA 3LALA 4RWWA 5HN0A 1VCTA 4O4RA 1Q82T 4ZCKA 1A77A 4IRDA 5AJ3K 4JUZA 3KUGA 4DL5A 1RDAA 3L3UA 4GLXA 3ZCMA 4NLTA 3R1HA 1BA0A 4U7BA 3UD3P 3KHYA 1YXQA 3ALYA 5HMWA 1MA9B 3QWUA 4NMLA 4AL5A 4UQGA 2UUBJ 1WSHA 2IVNA 3NNAA 2W11A 3RMBA 3U26A 4BJQA 3TANA 2NYHA 3PYFA 2CNLB 4IZ9A 5AKIA 3MN9A 5AXKA 4OVLA 4CI6A 1RG6A 4EBDA 3I32A 4LZDA 2VQFJ 2R2TA 1XMOF 2BGGA 2RMLA 3RBZA 8ICQA 3CVKA 4FNIA 4TNOA 1DURA 3UI3A 3O4NA 4TKTA 1TK0A 4C2MA 3S3NA 3M6VA 2X7IA 4USVA 4OX9K 4YDXA 4BC4A 4JYAJ 1VQKN 5IV4A 3NVVA 3E0FA 3TJ8A 4DPOA 1UAXA 4FJIA 1N36J 3L2QA 2XZWA 1B92A 4FM2A 4MEXA 4MIAA 2GJFA 2KSOB 1SXEA 2GO7A 2UU9J 3TA0A 3UDVA 2Z8QA 3JAMO 1F21A 4JI0K 2OGUA 2W40A 2FUG9 1WNEA 2B56A 5E7OB 1TUUA 3F0NA 1UPHA 4B3OB 4Q0BB 1DGJA 2H51B 2G8WA 1NSAA 4O44B 2KG1A 3W8PA 1JL1A 2DJWA 2KXFA 3C19A 3QWPA 1VHXA 4GC7A 1ZBFA 1RYUA 3W2VA 9ICHA 3ETOA 1QAIA 5EVZA 4PZOA 2B0GA 2OSQA 4NXNK 2RRDA 2FJDB 1REVA 5D4LA 1XR7A 2RF2A 3IFEA 1F5SA 1C1CB 2IRUA 2UU9F 4M63C 2I5JA 2JRSA 4Y2XA 1N88A 3SEIA 2HRTA 2I1QA 2BGWA 1NGFA 4F0KA 4EIAA 3DXMB 1F3FA 2F1IA 2W55A 2MYFA 3WKEA 3DFEA 3U27A 1HD0A 1KBRA 2IDOA 1TMJA 3SSSA 3THWB 4DR1J 5D78A 1OMSA 3M1VB 2GIRA 3DRPA 3E3XA 1M5VC 2HFUA 3R1XA 1N33J 4MFFA 4DJBA 3P83D 4YFKA 1QTMA 4OV1A 5LL6d 1WAJA 3KZXA 3UMBA 4BC5A 3LH2S 3QXGA 1QVFM 3WHIA 1RAHB 1MA7A 1KQGB 2XGQA 1UOCA 4J9NA 4KE5A 2P1JA 1LKYA 1U26A 1QZ6A 4DU1A 1Z05A 4P4OA 3OV7A 2VFUA 2LKYA 9ICNA 3ENWA 1ZRMA 2L5YA 3K75D 2BANA 4DPWA 2HHUA 2GQ2A 6FD1A 4MK9A 4RQ1A 4IDHA 3DMJA 2R8HA 4X4OA 1PZNA 1LXNA 3EVMA 2DNKA 2KXNB 4BGBA 4CFBA 1UVIA 2BJ9A 3DOLB 3UCZP 8ICNA 5B0EA 3TAEA 4Y0WA 1N34J 1U9LA 3MURP 1Z1ZA 1D5AA 3R5BA 4JI7J 3QNWB 5AI9A 4F4ZA 2KT2A 2V7ZA 1GMVA 4BDYA 2E6MA 4M41A 2OELA 1QAJA 4JN4A 4DX8H 2B9XA 3QIPB 3U4LA 3G82B 2XO6A 4FZLA 1HHTP 2PSZA 1VSHA 4DR2J 3WK9A 4F9OA 2K06A 2EFVA 5F8JA 5CHIA 1RT2A 2EZYA 2WC9A 3ZTRA 3BYRA 1N0VC 4ED2A 3MFIA 4LF5J 1KKXA 3D6HB 5DBAA 5ALFA 1YLXA 3MAAB 4X4PA 3DOMB 5D6GA 3ZSRA 2GJIA 5DQHA 2JEGA 8ICMA 1JLQA 3ITHA 1HPMA 3A8IA 1NH7A 3MCPA 1CLQA 3MMAA 1TKXA 1VQ7N 4F72A 5SZTA 1NJXA 3CJ2A 5KQ8A 2NRZA 3GV8B 1R8CA 1R59O 2W3SA 4R64A 4MFAA 5SWMA 2O66A 4PWDA 1RT6A 3AFGA 4FJLA 3KTQA 4IDKB 4EGLA 1UETA 1J5OB 4BWMA 2KJVA 5U47A 1L7MA 3H08A 2WVDA 1S5ZA 1XUPO 5J2HA 4M5KA 3ONQA 3QRRA 4B9NA 2NRVA 1RDUA 5J1NA 4IKAA 3R5AA 4OI2A 4QYZJ 3GSDA 3OW2R 4LQ9A 3OJSA 2KFNA 1JLCB 3W60A 1LW0A 2M9NA 2GLEA 2YKAA 5D15A 2XS2A 1K44A 2ZTEA 4MJKA 1NBWA 1FESA 3BGFA 4PL7A 4ERDA 5AK5A 3TUPA 2KFZA 4M04A 4N7TA 4CP5A 3ZZRA 5EHHA 4K0KF 2ZBQA 4X64F 5EE3A 2JJ4D 2VPZB 4MFBB 5C25B 4TN2A 2ASJA 2XQCA 2BOPA 3A5MC 2NZCA 1BWEA 2ZJ8A 5ALHA 4IQVA 4DHVA 1Z4NA 4F02A 4CZGA 3D1OA 4JKGB 2ROGA 1HUOA 1F9FA 1HMVA 3THWA 2QL7B 3PFOA 4IJNA 2VQFF 1FRHA 5AZIB 1PK1B 2UVRA 4DUZK 1CJTB 3CCZA 3DCAA 4IG3B 1UCVA 5GAGP 3W7BA 3U3YA 3Q7CA 2EG1A 4HL9A 1FE0A 2P9UA 4UBBA 5HJYA 1BE4A 1FXDA 3J81U 2A6AA 5H2FU 1I51B 5GIOA 4MO5A 1XBWA 2W04A 5AK6A 2YWEA 3CCUS 2MDAA 4C0OC 3O3GA 4Y1DA 4P7TA 2E1PA 4ZPWR 4DR7F 4BC2A 4CF2A 2KJ5A 2CNKB 4C0ZA 1VBYA 2EWSA 5AKJA 2BJ7A 4KITB 3WXLA 4J9UE 4O44A 3V6DA 3EE9A 3QJLA 3J7AP 2PA8D 5CYQB 3O1WA 2JV3A 3WT0A 3IBWA 4B1VA 3CCSS 3KLEB 4FZXC 3AD9C 4C48A 4IOCQ 3OYGA 4F67A 2QGFB 3N4WA 1RDDA 5FLXU 3ZTSA 2XM3A 5BREA 1K1QA 1KAYA 5GTIU 3BGUA 2VKRA 5FPMA 1V97A 3DNCA 4A62A 2VJVA 2JMGA 1ILYA 1S0OA 4JAXA 1J2NA 5ALTA 1WI8A 3O9QA 2X3GA 2OMLA 1ZXIA 4XK8C 4RW8A 3A0IX 1EB0A 3GFZA 4CZCA 4NL9C 2M4MA 4YG2A 5HBMB 5HLFA 5AKEA 4YB1P 1GXUA 3N4PA 5AM3A 1ED1A 1RKIA 1SH2A 3IM8A 3OS0A 4UBCA 3D66A 2B51A 5CA7A 2MXYA 4IFVB 3I9V9 1JLFB 2E20A 1ZETA 2QG9B 3I87A 1P7DA 1CBKA 4QZFA 4OI3A 3N5BA 3KKFA 2OIHA 2QARB 2V2ZA 4UOFA 5B0CA 2QI2A 4EWTA 3EICA 2PDAA 4ZTJA 4QZDA 3PMLA 1J5EF 3VEXA 4QPXA 1DGKN 3EKSA 4CEOA 4JB8B 2HHHJ 2ZZNA 4YDUA 5E33A 2X51A 3R8EA 2UXDJ 2VG5A 2E1CA 5T41A 1WWHA 1N5WA 2LFVA 4OGEA 4NY8A 5KOWA 3NCIA 2HMXA 3DYAA 2XG8A 1TAUA 4CZEA 2B6AB 2RT3A 4UY85 1GX5A 4Q44A 4I29A 4KAZA 9ICEA 4X66F 2YX7A 2R18A 3CJBA 5KAIU 3SEOA 1KVKA 1FCAA 3QE9Y 1TVRB 3QT7A 3UXOA 1SL0A 3G4SS 5KT5A 9ICVA 4MO4A 2L9DA 1UT8A 4CHQA 1IBKK 4B3TK 4WYLA 1ZQIA 1D8YA 1LW2A 2HHQA 3MEDA 1HW8A 2V4RA 3W2WA 3NASA 3D3BJ 3PHEA 4KLGA 3BR9A 5CA5A 3CC2N 4TUQA 2XMUA 3AO2A 9ICMA 4MLEA 1Q4RA 1MSWD 4JI2J 2A3JA 2RB7A 1X42A 3ZO7A 1PUZA 3HWTA 1TAQA 4H03B 1EKEA 4O5KA 5E3AA 5LMNF 3UKUA 1RBTA 4DV6F 1NXIA 2KYZA 2BJ8A 1SI9A 3R5CA 1BG3A 1UHUA 3PNCA 2HS3A 2YQ0A 3U7JA 3RH5A 2QT7A 2YHXA 7ICVA 4DTMA 3W2VB 3K1ZA 1DZ5A 4K4IA 1Q95G 1MC8A 2JC0A 3T9NA 3LP2A 1FJEB 3G6YA 2LQBA 4Z4GA 4IO9L 4RW6B 2XLIA 4CJKA 3VEVA 1W2BR 1EWRA 2ZKTA 5KFOA 4JI6J 4LF9K 4USAA 2ZUAA 1CXQA 5DG9A 3R7NB 4ILRA 4N47A 3UVJB 1WC4A 3I4HX 4GV6A 1JRPA 2DF4B 1RAFB 9ICRA 4OX9J 2QFJA 3ISDA 2Q79A 3UNYA 4PJ0U 3S3OA 4Q7AA 1DHMA 1JCEA 1DGSA 1ZBIA 4KMUA 4K50A 3H42A 1E6YA 7ICGA 2IHR1 4OQJA 1B3TA 3NGTA 2OEMA 3MGIA 4KO0A 4DPYA 4ANCA 4E19A 4FVUA 2VONA 3O9SA 1K0VA 3RMDA 1ZYQA 4NXNJ 3CCJN 1J9AA 3AO4A 1R89A 4G9BA 4IG0B 2GV1A 4USHA 4YN4A 5AQXA 8ICTA 5IFMA 2IMOA 1C4AA 1OWXA 2ZJQQ 2JL9A 2E5LJ 4F5RA 2R8KA 1UA0A 3G8TA 3V9UA 5CZ2A 1VRTB 3FMBA 3NWRA 4QIEA 3ET6A 4YXJA 1RT1B 4WTOB 3PJ9A 3TYTA 2WVCA 3HHLC 1SV5B 1ZQYA 4F5OA 4RCHA 2G08A 1A0OB 2CPIA 3MN7A 1BCOA 3HSDA 4NXMF 2MKSA 1YITN 3I5AA 2UXBF 3QUBA 3GE1A 1SXDA 1MN9A 1FRMA 1S1VA 1IQZA 3NGRA 1OH5A 2IRYA 2G06A 3ZT1A 3H0MB 4NO7A 1X9WA 1S97A 2HFSA 2VWKA 4ZMMA 4U67L 2W9BB 2NNWA 1KAZA 1ZQQA 1REVB 5F3ZA 1S7IA 1FFVA 3VAGA 3KOAA 3BYPA 3GG1A 2CNNB 3LZJA 1FTCA 1D8ZA 3EGVA 2E2PA 4DUYJ 3PXGa 4F7VA 1UMJA 4NYZA 3OR1A 2D4WA 4PL1A 4C7YA 3SV4A 1U6BA 4IH6A 3IG8A 1OIAA 1B4FA 3NVYA 3V1QA 2VFTA 2EWHA 5A8KA 2VQEF 5HLFB 2A2CA 4CIOA 1IV8A 2VKZG 3JXOA 1PGZA 5HOOA 4QJFB 3K57A 1XSPA 4F91B 5AQWA 5DK5A 2HVHA 3HJVA 4LMZA 1UPPA 1YAGA 4OLBA 1OXJA 4PYAA 1DK3A 2B5JA 2YCHA 1RT4B 4O5BA 4USKA 2NO5A 2DT9A 2B8PA 1WF0A 1FIQA 1E4FT 3FE1A 3FR0A 5J8YA 4CZIA 2ZF5O 3RSEA 1T3NA 2IRXA 3HHEA 3EMTA 1MLAA 2OPPA 3JSRA 5IT9U 4WZMA 3FNNA 2YWGA 2DFHA 3WNGA 2WBNA 4YMOA 1X4DA 2EAPA 2ZOGA 2FHJA 4UZCA 1QHAA 4W90B 3UR3C 4XUSA 4F3MA 4US8A 3C1YA 2YKQA 4BG8A 2WB1C 3QUTA 3CMAN 4HUGA 2FY8A 1QY7A 4CO1A 3HXMA 2O8CB 2E1RA 3CFPA 4C3MA 4MIBA 2IC3B 2ASOA 2E9TA 5LMNK 3SNNA 2O3DA 2DISA 1ELOA 3AOCA 3W5XA 3ATVA 1PKUA 4KSEB 1IBLF 4HEA9 5ALMA 1G1XA 1S6QB 3CNHA 3QU4A 1WWVA 4OJPA 3NBPB 2E2QA 2FPHX 1PVQA 2CXEA 5AQFA 1YBAA 2GWJA 3FZKA 4I7FB 3PRVA 4DOCA 4KHPF 1NZPA 3A3OB 4K41A 2FGOA 1Z6RA 3AXMA 4KGXB 4YB5A 4JHDB 1RDRA 2P9KA 4B9QA 3QSYB 3QT6A 3B8AX 4RQ5A 4I6MB 3AHPA 2OPSA 2HFOA 2VOPA 2GWSA 1CI4A 2ISPA 3G8SA 4Z6FA 3OQ2A 4KLOA 2X78A 1JCFA 2HDOA 4PKIA 4CZFA 4P71A 5KRTA 1NM2A 5K9FA 2BQRA 4UAYA 2O4IA 2ZUDA 1KFSA 1I5OB 1NJIT 4NJ8A 4C8NA 2ZJPL 4OX7A 2W9MA 3CG7A 4NEZA 2V5HG 3BZKA 3EM1A 5AIBA 1XR5A 4USIA 2DR9A 3DGPA 1NB2A 3KKSA 1LOTB 4C80A 3T5LA 1FNOA 3T19A 1ZOLA 4MQ3A 3OHBA 3LPYA 5GMDA 2FJAB 5KFYA 4QS8A 4EMDA 2UXCF 3OVNA 4KX3A 1T03A 3FEYB 4DV2K 3V9WA 1HW9A 1TFWA 1CQNA 2HFZA 3MEGB 2W2NP 5IM0A 2M52A 2YV0X 3LGMA 3KLIA 4ZPDA 5JRTA 5A6WA 4RW7B 4FJ5A 3PW5A 1NDCA 2YMPA 4AYBC 2KJWA 5HRPA 2QTWA 2G09A 2ZWPA 3EPIA 2IM2A 4IFYA 3O9RA 5FLXY 5ETSA 3CCUN 5KFSA 4CLLA 5AI8A 1KQSM 1WJ9A 1RT1A 4BDZA 1SB6A 4PXCA 1T0TV 3HVTA 3OXLA 4LIRA 1X3NA 2NSCA 3OGUA 2GO8A 3ZX0A 5HMMA 1U48A 3MM6B 4K4GA 5G5GA 2WOMB 3T6BA 4GC6A 4PKGA 3B6PA 4P52A 4B1WB 4QZHA 2CPYA 4O3PA 2HSZA 2GFFA 5BYRA 1FTRA 3FBCA 2MRLA 3H98A 5DGBA 2OANA 1YDLA 2MSTA 1RCOB 2B9WA 3TVKA 2HI0A 4WTYA 1BDGA 2E7XA 3FEZA 3EZ5A 2KM8C 3SLCA 1VQ8N 1WLJA 3BH6B 2WF5A 3ZDEA 3H3NO 1RWMB 4GXJA 4DSJA 3VC8A 3R3TA 3SPYA 2ZH9A 1IKWB 5I3PA 1HLUA 4NWBA 2VG7A 4RQ6A 1IQTA 3ELHA 3F9KA 3GONA 1HHQA 1A6SA 2ZC4A 2PN6A 1ZAXA 2P9IA 5G0RB 1RBAA 4ER8A 2K8GA 2KEYA 5ALQA 1VRUB 1LVHA 2B9EA 4V19J 4L8RB 5DG8A 4E1JA 5KFEA 4N5SA 3GFYA 1JJHA 4J9QA 2XEXA 3CJKA 3NDKA 1C4CA 2OPRA 3KG4A 1NCLA 5KT6A 3C2MA 5DB6A 1KLMA 4IEIA 4ZK7M 2K89A 3NF7A 4DV1F 1VK8A 1MWYA 2M7SA 3MN6A 3MTJA 1WELA 4O4GA 1OW5A 2LYAA 3SFGA 3HO1A 4MH8A 4FPAA 4CJQA 3WU2U 2P9GA 8RUCA 2DNOA 1FO4A 1MW7A 2ZG6A 2PMHA 1FXXA 2HVEA 4B6JA 4F4YA 4FYYB 3SSRA 2VUGA 2UZAA 3E9PA 2QSFA 4K25A 3FFIA 3NKYA 2BUPA 1M5HA 3V9SA 4MHVA 1PBUA 1WSVA 2NLWA 2QKQA 3PDNA 2ACYA 4LRDA 3ZZPA 3ZETB 4GKJF 2PYJA 4NI2A 4UAUA 4M42A 2ILZA 1HBNA 4A61A 2OA8A 5ETKA 3M6WA 3E9LA 3F5TA 3MXJA 3ASMA 1Q18A 2Q36A 2W2PP 2NV3A 3JPTA 3LVVA 5H9FK 3LPUA 3FM9A 5J0RA 4KO0B 2KXHA 2C3PA 4FF1A 1J53A 3RYLA 1ZM9A 3M8WA 4CK2A 5AI6A 4IQXA 3SDEA 2PY5A 3FZMA 2F3NA 2V4QA 9ICUA 2GQCA 2XYHB 2YY6A 4ECSA 2FJ6A 3T9ZA 3TZZA 4OPHA 1QUPA 3HVWA 2CGJA 4EFAC 5CD4A 1ASWA 3H2UB 4NLPA 2A0FB 4XEIA 4JKBA 4RU9A 4LBHA 3GIIA 3IAS9 2C1EB 3BEGB 3GZFA 4WF9Q 3ZSXA 3EGWB 2PD1A 5CEHA 4QIFA 4LFAF 3EZWA 2HGMA 3V2UC 1HA1A 4KAIA 5D46A 1CJVA 2DGZA 2WK4A 2AIRB 2EC2A 2YKMA 3GFXA 1U1MA 2XMWA 4ED0A 3MAAA 2YNHA 1FWKA 3HM8A 2JEIA 1IBCB 3DJCA 3HBTA 2YPZA 1B7YB 4ZLPA 4ECXA 3K5NA 3VGTA 4KGZB 2BCRA 5ETPA 2XCAA 4B3TF 4B9MA 2RU9A 5M2PA 2P9SA 1DXSA 2YXLA 1K73O 3GV5B 4I2IA 2XIDA 5DM6L 1Y5NB 5M1NA 3AVCA 4DV6K 2V34A 5AM4A 2NUUG 5GMKa 2M5YA 4AHCA 4WZQA 1VSIA 4RPFA 2QA4N 3IDHA 4KHPK 3MXHP 2HNDB 4KRWA 4JI1J 3C29A 1N5QA 2YX8A 1ZAWA 4JKHA 2VJ4A 1ZQWA 1WYGA 5HHHA 2IM0A 1BVSA 2LA6A 2XMAA 2OPRB 4ZP6A 3AD8C 2H4WB 3HKZF 2U1AA 2YKNB 2HMPA 3QJJA 3EO3A 2A1BA 2DKZA 3S01A 3HK2A 4RWTA 2V2QA 4J9RA 2XO7A 1ZQMA 4JNEA 2OM6A 1UPMB 2PC6A 1T7PA 2RE2A 3P5TL 5A2QO 2R7OA 1KNZA 1ZQRA 1QVFR 4NXZA 4O5EA 4KT0C 3D2WA 1CULB 2PI5A 1VQ7S 1WHXA 4L3QA 1Y11A 3WC0A 1C0GA 1VSKA 1FEEA 3R9KA 2NXJA 4J2AA 5CYJA 1JLCA 3NMRA 2FMQA 5J2BA 2FDRA 2PFOA 3TP2A 3CQXA 4DI6A 4ZVHA 2YN4A 5EE9A 5J2JA 1TKDA 3JSMB 3NRWA 3CJRA 4BC9A 5M1FA 3D6FB 1TR0A 3SQ0A 2FF6A 1S1TB 4I2JA 2YWKA 4IO8A 4P75A 4M5JA 3THXA 3VEYA 2VHGA 1X4CA 2I2YA 1BHLA 1LWXA 1FKAF 3F5EA 4ZH4A 1WSJA 1RI7A 2VJUA 2DY9A 3BGLA 2HNZA 4OGCA 4UW9A 3KHHA 2N7CA 4X65F 3JB9k 5E79U 4DU8A 2HHPA 4CFDA 3C2KA 5AZIA 2DBYA 5CRXA 4ISGA 1PK1A 4CIGA 2E8NA 2HSEB 5KNIA 5CWRA 4EI2A 5BR8J 2G2OA 4CE6A 2W43A 1ZQ1C 3U6FA 1PILA 1K8AO 1NGGA 5BPCA 2VFSA 3HHDA 4CO2A 4BRDA 1GLFO 4B3MF 2QTDA 2G1HA 5F8HA 2DR7A 3HLUA 1RA7A 4IL6U 1EHWA 5GIPA 3RJEA 8ICZA 1MN8A 5CQGA 5KG3A 2JX2A 2HHHF 3THYA 2B21A 2MQOA 4KBOA 1FI4A 3LA0A 1RILA 4KH5A 3K2PA 1NNLA 3PW0A 5KFBA 2JH1A 1U24A 3QYPA 2VPYB 2CDRB 3JXUA 5DBBA 5DBCA 1XO1A 3R6LB 3L09A 2K60A 3SJHA 2W01A 3BKTA 4M3YA 1S99A 2RJZA 1TL5A 1H74A 3N6MA 3A5NC 2Q4TA 3ZDDA 1KEKA 5LMUF 4DR5F 2HIQA 4MN4C 1Q5YA 3RAQA 4I2BA 1S6PB 2HZVA 1Y4ZB 1T9XA 2K3KA 4PHAA 4Z4EA 2GTDA 2RE1A 1IKXA 1HJRA 1V6HA 1S6QA 2VBXA 4I2HA 1OVYA 1FJGK 4YXMA 3I55S 3GE9A 4DV5J 2JXJA 2IVYA 1B0XA 2D5RA 2ZJ5A 4OX9F 5THWA 5DLFA 3WK7A 4G3IA 3D45A 4JHDA 3WXMB 2RQMA 2MGZB 1NMDA 1O0PA 1HQUA 1DEJA 2M88A 4QWDA 2CH5A 4I6MA 2ZDPA 3I96A 2DNRA 1AT1B 4BGDA 2IJRA 3ISCA 1VI7A 4PRFA 1B64A 4JI4J 4C4TA 3OSPA 3AODA 4ED5A 4OPKA 4DLGA 2P9PA 4FBTA 4E89A 1TMMA 1WSRA 3QB0A 2WSFC 3EVOA 2KFYA 3DHXA 2R7WA 1F0MA 4MLHA 1TE2A 4GKJJ 4M9HA 3A5LC 7ICPA 1S77D 2F3JA 4L73A 3SZ2A 2XY6A 2E6LA 3E51A 4FPIA 5DDQC 5BPNA 4CJRA 1A5WA 5AQYA 1BC6A 5HQ8A 3RB3A 3CI5A 5IC4B 2YJEA 2G8HA 9RUBA 3Q8LA 2VH7A 1ZBLA 2ZXHA 2G4BA 1N5TA 3FC4A 3PR4A 3GR1A 4UUWA 2YTCA 4EZ9A 2UU9K 4KH6A 4HDGA 2C2RA 3GG0A 3QO9A 2PAVA 3VQBA 2E1EA 3AA9A 1TKZA 1GEHA 4FJGA 2P6UA 1S3XA 5DDRC 3OUYA 1K8KA 4LH5A 4CLPA 4F3OA 5HQMA 5RUBA 3F5AA 4QBUA 3PYGA 2VA8A 9ICJA 4KPCA 1UVJA 4P0PB 3ZZZA 2HZAA 2HFNA 4CERA 2C2MB 1M90O 8AT1B 3MEEB 3NF6A 5JXSA 3TI0A 1S1TA 1U1LA 3SCLE 4JRPA 2QLJB 3OD2A 3H0PA 4CH1A 4PCQA 2PBDA 2VF3A 4Y2JA 2NUBA 3MDFA 2LP4A 2RDJA 3Q8VA 1N33F 5E0OA 1RBVA 5F8MA 2Y1IA 4AP9A 5ETVA 5HROB 4HTUA 3BS5A 1PSDA 2VPWB 4A8OA 1RZMA 3OL6A 1HWKA 4C8OA 5HQLA 1Q1KA 3RR8A 3D2SA 4CW7B 2YVSA 4Z2XA 1W9HA 1ZQUA 4IOBA 4O0JA 5AQUA 3V6KA 3SAGA 1LW2B 3IM1A 2ZZMA 4LH4A 4ILGB 2MZRA 4JKDA 1HD1A 2NQPA 4CNZA 1S4EA 1P1LA 1VSMA 1O1WA 3C6UB 1SV5A 3RU0A 3CULA 3C16A 4QIGA 2ZIWA 4LF7K 3M6UA 5J0XA 2FVSA 2H9ZA 4RW4A 1PBAA 3Q89A 4CTAB 4NLSA 4LSLB 4E1NA 1OYDA 5KGXA 2B6GA 3PEHA 2DHXA 1KVCA 3CE8A 4ILLA 1A0PA 1XNQF 2VG6B 3KBBA 4B3RJ 3D2QA 1B7FA 3M8SA 2RPIA 5L1KA 1Q16B 1WC6A 3ZDBA 3VGVA 2DGSA 3KDNA 3MR3A 1HBUB 3DLEA 3AA5X 4WFAL 3QAEA 3AVBA 3I31A 4JB3A 3N79A 4ENOA 2BW7A 2Z1GA 4DQIA 3DU5A 3H90A 3QIDA 3RRGA 3CJ7A 4AHUA 3R3LA 2QK9A 1RQ0A 4CT9A 5F3XB 3IWNC 4LF5F 3CJ8A 3PNIA 1RWKB 1D0EA 2C2OB 3HF5A 2FGCA 4A8QA 4CT8A 3D0PA 1CRXA 1OH7A 1DBDA 3NNCA 4DQPA 1ZH5A 3ZEUA 2IOCA 2PFPA 2NPFA 1RPLA 2IBOA 1GXLA 5ETQA 1D09B 2YQEA 1VDHA 4WFBQ 4CH0S 3JTNA 1Q86O 3KKRA 4JI4F 3KD3A 1N34F 2CJ9A 1U2RA 3K4GA 2AGPA 4AM6A 3KWIA 1HL6A 5KFCA 5M1PA 2O8FA 2W03A 4ZPCA 1CC7A 2YNGA 3UN5A 3I33A 5DDPC 1D3WA 3NS5A 4FN5A 5MLCV 2FSJA 3HL8A 2I6WA 1X4GA 3O80A 2HPUA 3H1QA 5LJWA 1ULRA 4H4MB 3NF9A 3QZ8A 4Z6CA 3SIPB 4X84A 2HBMA 4M5IA 3LDPA 1O6XA 4QZEA 1TU0B 4CF1A 3QBWA 3KLEA 3HKZC 3DLBA 3ULEA 3FCHA 4M6WA 4YY3J 3I6PA 3FUYA 3OVAA 3SCKE 2CQCA 3LOUA 5M2UA 3PIOQ 4OZ2A 3CC4S 1S6PA 4AYBF 2V4JA 1F5AA 1T3QA 1L8OA 1J2MA 1YG0A 4M3RA 2B7BB 3M7VA 2CQ2A 1QZ5A 3WXJA 3GIRA 4JWNA 2WB1F 3ZT0A 2E5IA 4WP8A 3CJ5A 1SQEA 4GW6A 4I68A 1IR1A 4DU3A 5B66U 1WG4A 3DHWC 2UXBK 3UE5A 2Z2YB 3S6JA 7ICKA 4Y2KA 2BZFA 2F7TA 2KV2A 3BS5B 3IMQJ 1K9MT 4YB6A 1RYSA 3VF6A 5J2NA 1YJNN 4OYPA 3C46A 4BRNA 4C97A 4H8KA 2M0GB 3MWPA 1X66A 3HPOA 1PVPA 1SCJB 1WF1A 4H4OB 1N62A 2HNYB 2JRZA 3THTA 2XY5A 1KDNA 4DR5J 3K9JA 3H0RB 5ALRA 1NJIO 4KFBB 5DM7Q 1S9EB 3AARA 3JYTA 2Y0BB 5FDLA 1TVRA 2G0JA 2V8HA 3L7PA 4NM2A 2K8BB 3HI0A 3GIMA 5DLGA 2YHYA 1U2VA 3SCXA 2QM1A 2AXTU 3GILA 3BQ7A 5IT9Y 3HVTB 4Y2QA 2NCKL 5IQ6A 3PKMA 4FJ8A 3ENHA 5T7LB 3TUZC 4CZMA 1WBBA 3CIMA 1OUQA 3MM6A 4KGKA 3KFWX 1NLKL 4AHRA 4C1NI 3AVAA 2O1PA 1LK5A 4LF4F 4GRSA 4LF7F 2EFOA 5CE3A 2F8KA 1RQLA 3B4MA 2IVMA 2J8SA 3KLIB 1QQ5A 3BSOA 3VALA 1H3DA 2R3VA 1IR2A 1HI0P 1GMWD 3QFPA 5FPNA 2KRRA 4FPRA 3E2EA 3VA3A 2IS3A 2GC8A 1T4GA 2BDUA 3AQFA 3M6GA 2P9PB 1J54A 2EEYA 4RWXA 4WQ5C 4BCAA 2LMIA 4NX9A 2GV9A 4W98A 2CUYA 4FYVB 5AQGA 3W3DA 2PEBA 4J7CA 4CLUA 3H5UA 1VRUA 1RSCA 1UVKA 3SXLA 1U1QA 4GV9A 3MM8A 2LM1A 2YKPA 4I56A 3C94A 2DGUA 1KAXA 5I9EB 1XTZA 2B0CA 2D3DA 2YMMA 3IKMA 1CUKA 2R8JA 4LF8F 3P6YC 1ZQZA 2UXBJ 2J9DA 2ZQBA 3DMJB 3MECA 4PGQA 3LP0B 1YJTA 1VMBA 4GFJA 1IKXB 4UF4A 5JJBA 3VF4A 4H5NA 4DV7J 2VU5A 1NMNA 2P6RA 4QWEA 3AV9A 1XNSA 4OJ5A 7ICIA 3ZZOA 2P2CB 3M3ZA 3W5YA 3DDHA 1RBRA 1YT3A 2G0IA 3M05A 1ZQEA 2KHVA 4Z94A 3WKAA 4A48A 1MWKA 4H0PA 4P74A 1Y88A 3GFKB 3HRDD 3KFUF 1PAEX 5AE2A 3NWGA 2MZTA 4W92B 3EKUA 5KG0A 4JI1F 1WBDA 3PKYA 3LGNA 5FIIA 2DGXA 4NASA 4WCEL 1C0FA 2W9BA 4CZHA 5DG7A 2RRAA 4UQTA 2WRMA 4E0DA 4KLDA 2LLZA 4C23A 1X9XA 3CF5Q 4LF6F 4JV5F 1RHJB 2E2NA 3MMAB 1VBKA 4PL2A 2QWQA 2QEXS 4NLNA 2HHSA 1Q9XA 2G8UA 1EETB 2R2RA 2RRNA 2OEJA 1LXJA 3HZ6A 4M9NA 3LW5C 3OSNA 4EX7A 3HVAA 2ZJQL 3B0YA 5TISU 2CVIA 4LSNB 5HHIA 1U04A 3WEEB 1X4EA 1OKJA 2BM0A 5AI0A 2HWHA 1FFGB 2V4JB 5IIKA 4ZCMA 3ISND 1VQ6N 4ZP9A 2UXCK 3VQEA 4DS4A 5JU5A 5IIIA 2DB1A 2VV5A 1I39A 3PSTA 3BN4A 4PWUA 5BN8A 1X9SA 4LBIA 1NRKA 5CYMB 3S9HA 2WF7A 2WMMA 5CY4A 3LO3A 3OHRA 2OO4A 4ZPBA 2GOLA 1Q86T 2HS4A 4R79A 3HM9A 3NMAA 1YTUA 2OJ3A 3IHQB 2IA0A 3N9UC 5AXLA 1R6YA 5ETLA 3VAFA 4NA3A 2MQPA 3C23A 3V72A 3ETLA 3QAUA 2WTFA 7ICEA 5J0OA 2HEKA 5ALJA 2GWKA 4JI6K 1XHZA 2BX6A 2RAQA 4LJXA 4DV7F 3NE6A 2VASA 3CC7S 3T7ZA 4K7QA 1XMQJ 1RWOB 1T9YA 2WBRA 1CZBA 4Y2VA 4EZ6A 3QGHA 3KD5E 3QNNA 3OVBA 2LHTA 2YKNA 2DVIA 3NS7B 5AKKA 2FVCA 4DL6A 4KB7A 2IY5B 4BREA 5KFAA 1PAUB 1CSJA 3FZ2A 1SL1A 4CJWA 4DR1F 5D4BA 3DLGB 3TQEA 3HZEA 1QVGR 1DY3A 3A2FA 4MYTA 3A8JA 1SJQA 1Q46A 4FDFA 6AT1B 5C2FA 5IILA 4NCAA 2W1BA 4KQZA 5LMNJ 3C21A 1VJ5A 3SI6A 4AL6A 3AOBA 1HFEL 2F1FA 3LM2A 3V7LA 1MQ2A 3MCOA 4DFDA 3BO2A 1SGGA 4F36A 4P9SA 4JEPA 1OY9A 3FDSA 5D3GB 4BQZA 2DNQA 3E58A 3HT3A 1S0MA 3WK5A 2E1MC 3O08A 3QNOA 2HK3A 5KFMA 2BOAA 2RS8A 1N5SA 1NBEB 4HDHA 2ITMA 5J2MA 3AGRA 2MSSA 1YZ7A 3OPKA 3DLGA 4H5TA 3DRRA 5HROA 1URJA 3VAIA 5HNKA 1HNZJ 4PWWA 3NVZA 2LA4A 1UZDA 4Y00A 1X5PA 4IQUA 7AT1B 4Y2SA 8ICRA 5AIAA 3TTFA 2BQUA 4ISFA 4P0QA 1Y7PA 3CJ0A 3US5A 1ZTWA 3GSIA 3J81j 3EVWA 3HKWA 3PO4A 1OO0B 3LDLA 4RLEA 1S79A 4IO9Q 4OHVA 4YHHK 3OA9A 2Y3YA 4BLGA 2RRBA 2Q3PA 5A76A 2K3IA 3WKCA 1VQKS 3VTHA 3BZQA 3QPIA 4WU3A 1MMNA 3PR5B 2HKEA 2CAJA 2G8FA 3IG1B 3GWCA 2RQKA 3QX7A 1F44A 5JS1A 1XMOK 1NPRA 1W97L 1ZQCA 1HNIB 3H4BA 4Z37A 1ZZFA 2MUTA 3HZGA 3V7JA 1CVJA 4KPYA 2DYAA 3AQEA 3FCVA 1Z3EB 2J0XA 3TAMB 5KT7A 2BABA 4FLVA 4CGJA 3DLJA 1L3SA 2V50A 1M5PC 4RT3A 3VEWA 4TY8B 1YJ7A 8ICFA 4DOZA 2E2OA 4YQWA 1SL2A 4EK2A 4BDPA 2ZWHA 2E5HA 1M5KC 2ZTDA 3IG1A 3CC4N 1ZRNA 1FKOB 2BCQA 2MQLA 1BPDA 4AH9A 3TTDA 4N8NA 4ILHA 2CFXA 3P49B 2P5OA 5K20B 4CHPA 3QLHA 2Z2LA 3A12A 5L1MA 1NPKA 1RAIB 3FK4A 4IFYB 4ZLLA 3KLGA 3MDCA 3KYLA 1DJ0A 1ICEB 3EUNA 5HR7A 4C7QA 4J91A 1F2HA 2ALYB 3ZX3A 2LXUA 3C66A 5AM5A 1U8SA 2KU7A 1OY6A 2R7XA 2A6OA 2WUSA 3IG5A 3OR2B 1E4GT 3SPZA 4UB5A 3WNHA 3PACA 1KVJA 3TACB 3GQCA 4B3SF 2M70A 3POTA 5AFUH 1TQLA 4KLUA 4FJXA 4E7HA 4JI7F 2UUCF 4WXOA 1GTEA 4Y1CA 2PMZC 1C1BA 4DL3A 2UVUA 2C3MA 4DFKA 1VQPN 5LJ5Y 1TL1A 2MZQA 3TZXA 4M94A 1UZHA 3ISZA 1ZD5A 3IR6B 1V4TA 4K4VA 3MPUB 2BACA 4HWIA 1I3OB 2PO4A 3ZSWA 4UOHA 3SJJA 3TX8A 1KN6A 4FW1A 3MX5A 3G0ZA 1UCNA 4CIFA 5J0UA 2ZEJA 1EO1A 1S5LU 5B0DA 1SZHA 3P1GA 5KFKA 4DS5A 2KKPA 1KKHA 1FK9A 3CTRA 4M9LA 4LF5K 4UOCA 1HBOB 4PKHA 3K1RB 4ILMA 4AT1B 2FB0A 1LAVA 5ALKA 4GVLA 4DR2K 3MMBB 2KZ3A 3CO9A 3S1TA 2B43A 1K6YA 4ZOHC 5DB9A 2XY7A 1S1WA 4LFBJ 1U8WA 4WXWA 4P73A 9ICLA 3GMGA 2MGZA 3CXCM 3OYLA 2FVRA 1YK9A 2GEMA 3FQKA 4IG3A 3EXYA 1MU2B 4DR2F 4KLQA 4H0OA 4DR4K 3R6MA 1FJGF 1F9EB 1OJ4A 4NCGB 4DU4A 4IJAA 1W2BM 2UUTA 3AD7C 3D54A 2XWYA 4JV5K 5L9NA 2E8PA 1M5OC 1ZQXA 5AXNA 4YY3F 1C0MA 1QQ7A 2KZMA 2Q97A 3D4JA 3C28A 3FEXB 2W4DA 2HOEA 5DQIA 2WTUA 4CLZA 3RB6A 1VQ9S 3G6XA 2E29A 3M8QA 2K2PA 4ELVA 2P5GA 1B0TA 3RJMB 3DM2A 1ZQVA 3SBGA 3AJ2A 1L5UA 4ED8A 2DKXA 4CK3A 5FROA 2D0BA 1Q7LB 1Y00A 2DNLA 3WBZA 4Y2TA 3CPWR 2IOFA 2RIJA 4NYPA 3UW1A 1KFTA 3I5BA 4B3RK 4BY9C 5BRFA 2BMBA 5T14A 1JMTA 2EXUA 4CM0A 1DTTB 1GFWB 3AVKA 4ID1A 1R8HA 3PV8A 4Z4HA 2QWOA 5KPRA 4DDFA 3G6ES 3H3OB 3EDRB 3AVLA 3BKFA 1NKEA 4ZN1A 5K8MA 1SJRA 4NZ6A 4TYAA 1TGOA 2VIXA 3MGHA 4UASA 3T3FA 2PT0A 4OX6A 1HKCA 1JI7A 2G1DA 2BH1A 3AVFA 4AHSA 1CJTA 5DDOC 4IOAL 2OSRA 3MGJA 1JLEA 4BC3A 1APSA 4CDIA 2CQGA 3AXKA 2OHFA 1ZPVA 2AEJA 1U1OA 1BUPA 3Q83A 4RKUC 4QAGA 1IVZA 3BS9A 3DI6B 3RG6A 3CCES 3R2CJ 1QAXA 2AP6A 4X4VA 1ZQLA 3GR0A 3BDPA 5AQKA 1WKLA 3MM5A 3IP4B 4GV3A 4HT5A 2XB2D 3UDLA 2RSQA 2UUAF 1NZAA 1QQ6A 2WFAA 1RTZA 1WWUA 1ZS6A 4NLZA 1PYSB 5C12A 4FYWB 4MF2A 3MWBA 3ZZTA 1MG7A 2JWKA 1H0HB 3H46O 2Y1LB 2K1RB 3QEIA 2FVPA 1L7PA 4WQ4C 4IUFA 5FP0A 3HHKA 1HUXA 4HR2A 4AFFA 3M30A 3MECB 1LKYB 2NXNA 1KP6A 1TKZB 2ZD1B 1QE1B 2YHAA 1WSFA 2O8CA 3HRGA 4BGAA 3DLLQ 3K5OA 2J8AA 4A47A 3RBDA 2OZSA 1X4BA 3GL1A 1T9UA 4CRJA 4UAWA 5IV3A 2LPEA 3RJJA 1JLQB 3K89A 4DR1K 1RT6B 4O3QA 2ZHOA 2XLKA 4WFAQ 4KLIA 3SQOP 1UVNA 2BE2A 1EP4B 1IWGA 2A6MA 2CJQA 3CDWA 1XN9A 2WZ1A 3EZUA 1T3VA 4BRIA 4FM1A 4ZHRB 1AW0A 2FZCB 1Q3UA 5C10A 1S8OA 1FXLA 4RW9B 5ALXA 4NXNF 3NAHA 2N1RA 4U9RA 2EH9A 5B5EU 2YNIA 4IYQA 3BP8A 5I3UB 4U67Q 4XPEA 3BQ2A 1CJKA 1AUSL 2VJ5A 2R7RA 1IKYA 2WHOA 4ES3A 3CUNA 4BX9C 4X62F 4CVNE 3G82A 1JJ2M 4DCHA 1TL4A 3U1MA 4ALZA 2NRHA 1TV6A 3CRXA 4WJ3B 2C2ZB 1WTFA 5B0AA 3OW2M 1X5OA 1HWIA 4UB2A 4MF8A 1RP5A 3VGSA 7ICQA 4PHPA 1YI2S 2EPIA 3H45C 2GELA 3TWHA 2V51B 4JI3K 2FHKA 5C25A 2QRRA 4J9VA 2MKCA 3CD5A 5GINA 2ASLA 1H6KX 2DEIA 1FW6A 3IAYA 4DEZA 9ICXA 4CJTA 1DT9A 4NMXA 4LF1A 3QJPA 1N34K 1UJ6A 2WVEA 5KFWA 4OKJA 2H5XA 2HF3A 1XIQA 4DSKA 2Y0SF 5JVHL 3A0HU 1B70B 4PUOA 3MR2A 1NK8A 1C1BB 4A8SA 4QIWC 4FM0A 4DR4F 1SC6A 4DV3F 3OHAA 2QB0B 4B1ZA 2E9ZA 3ZSOA 4EHUA 3VQ9A 4RQMA 3J80O 1Z2ZA 2JOQA 3LDNA 4C8LA 2Y1JA 4QYZK 4KFBA 4DF4A 1HBOA 2FLNA 2VZ9A 2W6KA 3AVHA 1RAJA 2P9NB 5AM1A 1B99A 3R7SB 1TKTA 1YJUA 2M8HA 5F1XA 1VOMA 1H2TZ 5AZJA 5BR8K 8ICGA 5L1IA 2R42A 3OFFA 3M8ZA 2QEXN 2FQQB 1BMQB 2OP5A 3AO1A 4KLSA 2I5JB 5GAHP 5J2AA 2Y8YA 4FJ9A 4V1Ak 1GMUA 4K4YA 2LXFA 4YVZA 4IKFA 3H8MA 1IWAA 3C6TA 3OVSA 4K8RA 1RT2B 2EW9A 3SDEB 4ILJA 1WG5A 4OZ5A 1G15A 3CO0P 2HVIA 3PRDA 1ZQGA 2EFNA 5EE0A 3TQ1A 4FWNA 3MX2A 2BHNA 1Q81T 4U7CA 1G2EA 3OTQA 4OL8A 3F53A 5E3QA 4ZCIA 1VLBA 5AQQA 4CEFA 4CJLA 4DX7A 1H1VA 5EX5A 1XNQK 2JNJA 2OWOA 1QUVA 1ZQFA 4ECYA 3KLFB 4C0HA 1KQKA 3C15B 3AQPA 1NSQA 5KFVA 2CQ1A 1RZTA 4FFDA 2DPJA 3RH4A 4WFBL 5HSPA 1YKWA 4V19X 2AJFE 2MY7A 4X65J 2BJ3A 3K9KA 3NTUA 1VQ9N 3HOTA 3VAKA 1QH9A 3BH7B 2AD9A 4F25A 4DFJA 2A2DA 2KOBA 4RW7A 2BUNA 1SPBP 2DO0A 3U02A 4EEKA 2ZE2B 4P0QB 3VVTA 1YHQN 2YKOA 4OJGA 1QSYA 1BPXA 2F9DA 1UW4A 5EN1A 4M5HA 5CABA 4BR2A 2J4RA 2QLTA 4ZVPB 5H9FJ 1X40A 3M9NB 4EUVA 5AKXA 4OKKA 1WC5A 2K4EA 2IDLA 1HBNB 2ES6A 2IAJA 2Z0GA 3NAEA 1SIWB 2POKA 3MFHA 2LYBA 3C6UA 2QXFA 4I2GA 1FD8A 1T6CA 3ETRA 4LSLA 4HACA 3MM5B 5BPLA 2CJAA 3GDXA 1A7GE 4BUGA 1R0BG 3D5MA 3N6NA 2KMDA 2ZH8A 2XNQA 2QJ3A 3FCWA 1YITS 4PAAA 4RG8A 1YRTA 2EHGA 2DNZA 4F26A 4NLUA 2RQCA 4UY8O 4QU6A 2FHOB 1SJ4P 3KNAA 4KH4A 1N8RT 3G9CA 1SIZA 1IBMF 1U09A 3ZTPA 5ETOA 3QICA 3PSFA 2BYCA 2W7PA 5IM0B 2GUIA 2NXEA 2XYPB 4ZVOB 3BF4A 1O51A 3PW7A 2CJBA 4GNIA 1X4FA 1NPPA 4IQWA 5DKWA 2FSKA 3CWJA 4PUOB 2QX0A 4HTLA 4RUCA 4JLHA 2ASYA 1YX2A 1IKWA 2OFGX 1NJWA 2WW8A 2IVOA 1YJVA 4F3QA 2PFFB 5CCLA 1J6ZA 1S57A 1TAMA 3ID8A 2GGPB 1QQNA 1H72C 4JK7A 5ALYA 1I94K 3JTPA 2C3OA 1NEEA 4HT7A 3ZLJA 3KK2A 3WK4A 4ED3A 3WK6A 2AZ3A 3RH6A 5EX3A 3KHGA 5IZHA 3GYGA 1HYSA 3NEKA 5IT0A 5I3UA 3D6TB 3FKBA 4LRFA 4BROA 3OBWA 4OJ3A 1HWJA 4J2BA 2YTUA 2VBYA 3O3FA 2NZ4A 2P9LB 2HF4A 2FBXA 2AJ4A 4GIBA 3MXMA 3N0VA 4K59A 2BV3A</