1U4BA

Extension of an adenine-8oxoguanine mismatch
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 213
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u4bA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u4bA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u4bA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u4bA01
3O4QA 1RCHA 1A5XA 3KLIA 1UT5A 4CF2A 4Q45A 3DI6A 1I3AA 3ISCA 2XY7A 1BPYA 9ICTA 4B9UA 3OYJA 4I2FA 4FK4A 4UB1A 1KEJA 1ZQHA 7ICEA 3N4MB 4XRHA 1ZQQA 1FK9A 3QETA 4NLNA 3MBYA 3PV8A 4KV8A 5KT2A 3CQ8A 3ZSOA 4JS5A 4CHNA 1JX4A 3V6DA 2BDPA 5KFGA 3VQ9A 4XA5A 2HHQA 4ECVA 3U6FA 4O5BA 4M45A 2RF2A 3PO5A 4PUOA 1RBRA 3V1QA 2FBVA 4LSNA 3OYAA 2P5OA 3IHQB 1S0OA 3EW9A 1BHLA 3QERA 4KLOA 7ICFA 4KN7A 4C8KA 3QESA 4H8KA 3ZDEA 1C0UA 2IDOA 3AO4A 4F4WA 1GOAA 4OLAA 4Z6CA 4KLTA 4RQ7A 1J54A 4OLBA 4R63A 4CHZA 4F5RA 8ICKA 4PHEA 2AJQA 3RR8A 4CGGA 4ZTFA 4QZGA 3AU6A 4RW8A 3QZ8A 3CFOA 3ZSZA 4F4XA 4FJ5A 1Z3EB 2R8HA 4IQUA 4DTOA 4R65A 1BPDA 5KI6A 4KREA 2QXFA 3B6OA 3TR8A 5KTQA 1NK8A 3IRXA 1NJXA 1REVA 2BCVA 4I27A 1WSHA 3S3NA 1JLGA 1XI1A 5J2NA 4J9NA 4DEZA 4RQ3A 1NKCA 1VSFA 2ZD1A 9ICMA 4F5QA 4C8LA 1C0TA 1Z25A 3H8SA 4AHRA 3EPGA 3V6KA 3WNGA 4I2CA 4B08A 4EZ6A 1XU4A 4CJTA 1HUZA 3TWHA 4ED7A 2VG5A 3ZT0A 1ZETA 4FZYA 3L3UA 2PFPA 4F5PA 3WNFA 3VA3A 7ICPA 3DYAA 3C21A 8ICJA 4DMNA 3SQ2A 3OS1A 4B9MA 3E01A 4NXZA 5KT4A 1ZBUA 1XHZA 3KHHA 4IBNA 1HUOA 5DG8A 1L5UA 1C1CA 4F2RA 1ZQWA 3TFSA 3OS2A 2C2RA 3DLEA 4UAWA 5KT5A 1LWEA 4AHTA 1T03A 1RZTA 4NLGA 4PHAA 1RDCA 3C6UA 4Q8EA 2ZTCA 4YN4A 7ICSA 2HHTA 3HO1A 5CYMA 3SV4A 4H4MA 9ICBA 4BXOA 4PGXA 2FMPA 2DPIA 4B8CA 4BXOB 4QWBA 1XSLA 1IM4A 4Z4IA 4O5EA 2HVIA 1TKZA 4CGIA 3RMAA 1S76D 3HT3A 1W0HA 1WCLA 3ITHA 1ZQXA 3DOKA 2OZMA 4KAZA 4RZRA 4FZXC 1S10A 3NGYA 1WLJA 3DLKA 4J9KA 5KGXA 1HJPA 3QEVA 3DRRA 4M3WA 4OJRA 1XHXA 4F3OA 4JV2A 4DTSA 2ZTDA 4QWEA 8ICPA 3VQ8A 2IA6A 3ZCMA 1ZQYA 4PGYA 3OYMA 2FLNA 1CZBA 1U4BA 1HYVA 1RT2A 3ZT2A 3KLFA 4PQUA 4O9MA 4F92B 4FJLA 4B9NA 4M3UA 2BQ3A 2P51A 2LYHA 3AUOA 3NDKA 4G3IA 3THVA 1ITGA 5J2PA 4Y1DA 2P1JA 3QIPA 3OYHA 3M9NB 3Q8SB 1WN7A 5IIIA 4NM1A 3SUPA 3PW5A 4JRQA 4OKKA 4CERA 2GBZA 4LZDA 4OKJA 4QZHA 4GXIA 4KTZA 4E0DA 4CEDA 2BCQA 1LB2B 3ASMA 1VRUA 1ZQBA 3ZD8A 1GOBA 5FROA 5D49A 4I9LA 3C5FA 1XC9A 1IG9A 4G1QA 1NK5A 1SUQA 2FBXA 2XCAA 4LD0A 4CFCA 1EX4A 4NM2A 4CJWA 1BI4A 3KLGA 2E6MA 4RU9A 1ZYQA 1BI4B 3MEDA 2IHMA 1LAWA 9ICXA 1HNVA 1U45A 1COOA 2ZTEA 5SWMA 3E2EA 2KFNA 5FDLA 3M9OB 1U9LA 2ETJA 4FM1A 5KG4A 3JSMA 3BJYA 4LY7A 1BGXT 1YVUA 1SKSA 1S0NA 4UQGA 5L9XA 3WNEA 5CA7A 4N41A 3KKSA 3HP6A 4L8RB 5C25A 4FW2A 2DTUA 1WSFA 1RT3A 4QZ8A 4DL3A 1N5YA 2HHWA 4AH9A 4FJJA 4JS4A 4GVMA 3M8PA 1RXWA 1QLNA 5KRSA 2RPIA 2B21A 1JLAA 2D0BA 4B3OA 3EYZA 4ECXA 1A5WA 5CY4A 3ZSQA 3OYIA 5DGAA 4BWJA 1WSEA 5HP1A 3GFKB 2W9CB 4RQ2A 3HXMA 4FS1A 3NCIA 3KK3A 5CR0A 3KHRA 1UA1A 2FMQA 5CWRA 3QIOA 3LP3A 2KFZA 2A1JA 3ZD9A 1EXNA 2BPCA 5J2CA 2A1JB 4DTJA 2RDIA 4F93B 1UT8A 3D45A 2G8IA 3OS0A 3C6TA 4UAZA 1B9FA 3KHLA 4ED6A 3PR5B 2VG7A 4CF9A 8ICEA 4QZFA 3AA2A 2UVRA 1Y97A 4KB0A 2MAXA 4QZDA 1HPZA 1ZQPA 4QZCA 7ICOA 5J29A 8ICVA 3ALYA 1KRPA 2ZUDA 1BVSA 3ZDCA 3SJJA 4CGFA 1JLBA 3VN5A 3RH4A 1J5OA 2Z1HA 4YCXA 5KG6A 9ICKA 3AVHA 3V7JA 4N47A 8ICSA 1RT4A 4ICLA 2O4IA 3ZT1A 5KFQA 2XY6A 3G10A 2LSNA 2UVUA 8ICYA 3TQ1A 3SV3A 3L2VA 4W5TA 5J0QA 3GIIA 1EP4A 4CHYA 1D8YA 2F96A 2DFFA 3G6XA 1RYRA 3CM6A 1A76A 4NLZA 1BPEA 5BOMA 4DOBA 1SL1A 3PY8A 4DOAA 5CJ7A 3NBPA 4RT2A 2YNGA 1V9PA 4HVJA 1S1VA 4ECRA 3ISDA 3BDPA 1Y88A 4DQRA 4FJ7A 2ASJA 2M9NA 4TQSA 1UA0A 3M8RA 1RDBA 1HQEA 1K1QA 4DS4A 2OZSA 1QSLA 1O1WA 3LP1A 4KHYA 2Z1JA 4MFCA 4E7JA 5KFTA 3K5LA 2OPQA 5J0OA 4FXDA 3RRHA 4LH4A 3RH6A 4CK1A 9ICVA 3ULDA 4P4OA 4JWMA 1XS9D 3MGHA 4DWIA 1F21A 4YMMA 4IRKA 4RPZA 4CFDA 4KFBA 4Z6EA 3EZ5A 5KT3A 4DTRA 4B9LA 3PMNA 5J0XA 1C1AA 3SQ0A 5HMMA 1ZQZA 3AVGA 3ZDBA 5L1IA 5IILA 4FM0A 3H7IA 3RJHA 1S77D 4FYDA 3PX6A 4DSKA 5KRTA 3NE6A 3AVNA 4M3TA 3V9WA 4NY8A 3LDSA 5IIJA 3HPGA 5DDYA 4B9TA 4BE1A 4KHSA 3UIQA 1TK0A 3H08A 3V9UA 1T4GA 5SZTA 2KN7A 4JRPA 4ECUA 5KT7A 2BKEA 5HRNA 3OVNA 8ICWA 1VSLA 4M41A 1TL3A 3K5OA 4JLHA 3LDAA 2DFEA 4FS2A 1ZQFA 2HVHA 2HHVA 1X2IA 3HW8A 4F4YA 1BISA 4R5PA 1NOZA 1S1UA 4NCBA 2R8KA 1KLMA 3QEBZ 3RAXA 4DFPA 1ZQLA 5J2KA 5EWGA 4I2EA 4FLTA 5CHGA 1HJRA 3Q8QB 7ICIA 4IFYA 4YFUA 2B6AA 4I2GA 4KRFA 5J2IA 3O3HA 8ICIA 4I2DA 5J2JA 9ICFA 1NJYA 9ICCA 4DU4A 2VA3A 2JZBA 5L1LA 3AVMA 5KFLA 7ICUA 2O4GA 3RJFA 2AGQA 2IC3A 2JZBB 4FLXA 4R8UA 4RQ0A 3BQ0A 1WSIA 5HROA 4DQPA 4IQWA 8ICAA 4F50A 1ZQOA 4I28A 1FKOA 3AO1A 2PXIA 4R8UB 5D46A 3MR5A 4PA1A 4CGDA 3LAKA 4EBEA 3KD5E 3DRSA 1X9SA 4IQVA 2F1IA 2X78A 2JEJA 2VANA 7ICGA 5KFSA 1LW2A 1C0MA 8ICZA 1JMSA 3MR6A 1BPBA 3SI8A 2PFOA 5CP2A 1IXRA 5KFUA 4KLHA 3GIJA 1KFTA 4E19A 4E89A 5EWEA 5C24A 3OYBA 2ZJ8A 2W9MA 2ITGA 3AVBA 2NRZA 2ZUBA 2KZMA 4YQWA 5KFHA 4CJSA 5I42A 4OPKA 1ZBFA 3VQDA 3Q8KA 4QW8A 4R66A 3QEAZ 4UB4A 4FJKA 4J9QA 8ICGA 1N6QA 2J6SA 1KCFA 2ASLA 2BGWA 1T05A 4TUPA 3AO2A 3MEEA 1ASVA 4CJVA 2JLEA 1S9GA 4IR9A 4M9GA 1FXXA 4KTWA 3RMDA 3G0ZA 3VQCA 1NKEA 4ED3A 4NCGA 4GC6A 4UBBA 3L8BA 5J0RA 3MR3A 4I2QA 4F91B 4DTPA 4O44A 3V81A 4M2YA 3G6VA 2YNFA 1VRTA 3JPPA 4DTUA 2YKMA 4Z6FA 1KFDA 3MABA 3OHBA 5J0SA 4FBUA 4KHQA 1S5JA 1ZQNA 1TFRA 1NJZA 1ZQSA 4EZ9A 2VG6A 3ETLA 2BQRA 9ICGA 1I39A 4Z6DA 4CJLA 4K4GA 4GMJB 4QWDA 5DB8A 9ICRA 4CEOA 3DRPA 5BPCA 3V1OA 1BPZA 3WNHA 2X74A 1QQCA 9ICLA 5KFRA 1YTAA 4W5NA 4ELTA 5KFJA 4RQ4A 5HNKA 1TV6A 2F8TA 1TKXA 3NH1A 3SCXA 3LPTA 1CXQA 3TAPA 4CK2A 4KHNA 4HHTA 1H38A 1ZBLA 1HRHA 4NYFA 3SUOA 4F8RA 1S1XA 3C1YA 2E4LA 3RB6A 1KDHA 2HHXA 2HNDA 4CJ3A 4QWAA 3NGIA 5JS2A 3DLGA 4NCAA 3TAMA 4M42A 3VQ6A 5KG0A 3PR4A 5DB6A 2HHUA 3HX0A 3N97B 4CF1A 2FBTA 3P5JA 4I2BA 3GDXA 3V9ZA 3V4IA 4LZGA 5KFBA 5JUMA 4DO9A 5J2FA 3SPYA 2C2DA 3ORYA 2KW4A 4DU1A 9ICUA 4N5SA 3VQ4A 4HUEA 3NHGA 4JV1A 4FJNA 1KVCA 3KHGA 3RJGA 3EWAA 4FJ8A 2C28A 5KFEA 3C23A 1UWBA 4RW4A 5DGBA 2W9AA 4CESA 1JXBA 5TZVA 4CHOA 4E7KA 4CFAA 3V7LA 4DTMA 1SV5A 4BDPA 3PNCA 2C22A 4KKOA 2JGUA 3MFIA 2RDJA 2ZUCA 4E7HA 4RW7A 3RR7A 4KLUA 1ZQIA 4CIFA 4YD2A 3GV7B 1CLQA 3T5KA 1ASUA 3F73A 1ZQKA 1RNHA 4CHQA 5KG2A 8ICNA 3B6PA 2XGQA 1UAXA 4K4IA 4ID1A 4CEEA 7ICJA 4YXMA 3TI0A 4EYIB 4MF8A 8ICFA 3AU2A 3KD1E 5IIKA 5KT6A 2GV9A 3RBEA 2AQ0A 1R0AA 3D0PA 3V9SA 4QAGA 3CG7A 3EY1A 5IIMA 3OSNA 1DOQA 3AV9A 4CJQA 5HP4A 2G8VA 4KI6A 3TAEA 2VWKA 1TAQA 1TK5A 3LWLA 1SZPA 3CFRA 3LZIA 1RBUA 2AGPA 1CUKA 3RBDA 3VQEA 3IS9A 5DK5A 4Z4GA 2YV0X 2G8KA 1NK9A 2P66A 9ICSA 3VA0A 4M9JA 9ICOA 1LWCA 2IHNA 3G6YA 1TVAA 1UOCA 4M0AA 5DBBA 1JXLA 4XUSA 4DL7A 3NH2A 4QZIA 4Q8FA 2ISPA 1WAJA 4FO6A 4RQ8A 2W9BA 3JPOA 4CIGA 1MQ3A 4FLYA 4NLKA 3IAYA 3SI6A 4B9SA 1KFSA 2KZZA 2XY5A 1IKVA 1A5VA 4KLDA 2PFQA 1ZBHA 5CYQA 9ICAA 2D0AA 3L3VA 1XSNA 3S3OA 5FRMA 4QWCA 2YHAA 3VQ7A 3RH5A 4FLUA 4XQ8A 3TARA 5BOLA 4HTUA 2ZJ5A 4M9LA 3U3GA 3C2MA 3SQ4A 4RQ1A 4M9NA 3T5HA 3M8QA 1HYSA 3T5JA 1RTJA 1VK0A 4FJMA 3V6HA 2FPKA 4GXJA 2DFHA 1L3UA 1TKTA 8ICUA 5KFYA 3HK2A 1KVAA 3LP2A 1T8EA 4M6WA 3Q8MA 1Q9YA 3KTQA 2AU0A 4YNQA 4QZEA 4M6WB 4J2BA 1RDDA 4OPJA 4F4ZA 4LVSA 4QZBA 4YMOA 2EX3A 4PH5A 2G8UA 3QO9A 4JWNA 1RBSA 4O3NA 2BCRA 3SNNA 4EEYA 3HVTA 4E7LA 4Q0BA 1MU2A 1Z00A 4HCCA 2NRXA 2P6UA 2XC9A 4Q43A 4KLIA 5F9NA 1U47A 2F8SA 2PI4A 4K8XA 1Z00B 1B9DA 3K2PA 4ELUA 4J2DA 3C5GA 1ZQDA 1X9MA 2XRIA 1SKWA 4Q44A 5JS1A 1LW0A 4FJXA 3V9XA 3ZSVA 2IOCA 4CE9A 7ICQA 5D3GA 3PX4A 4P2HA 3PW0A 2PYJA 2VA8A 2NRWA 4OVLA 1JIHA 1IO2A 4KLSA 1VSHA 3HPHA 2HMIA 2FLPA 2JEGA 3ISBA 3O3FA 2KTQA 4FLVA 8ICMA 4GC7A 1C6VA 3U3YA 1T3NA 1G15A 4M47A 4C8OA 3AA3A 2ALZA 5L1JA 2YNHA 2J6TA 2EHGA 3PUFA 3MDAA 3S3MA 1ZQEA 4RPYA 5CB1A 1TKDA 5KFIA 1N56A 4DTXA 1TK8A 3QEWA 4GXKA 8ICRA 4YXJA 2P6RA 9ICHA 3H40A 1TV9A 1DTQA 4ECYA 7ICVA 3S9HA 5DBCA 4FM2A 4KLEA 3MGIA 3LZJA 1K1SA 4EBDA 4IRDA 4KLLA 2HW3A 3RJJA 3OHAA 1QHTA 1HQUA 2BQUA 2QKBA 4ECSA 4J9RA 1MQ2A 2PI5A 2WOMA 3SUQA 4JUZA 3PW7A 2YNIA 3FFIA 1NK7A 3DM2A 2R8JA 4O3PA 4DOCA 1JLEA 2Y1JA 4CEFA 1NOMA 2XO7A 4DL2A 4J9LA 4M3RA 4KPYA 4TUSA 3OJSA 1VSIA 4QCLA 1QE1A 4KLGA 4CECA 4OKEA 3ZT4A 1C7YA 2J6UA 2R7YA 1S1WA 2DPJA 1JKHA 4OGEA 4YR0A 3O3GA 5KFVA 4ZH4A 1ZQTA 3RWUA 4FJIA 1Q8IA 3AO3A 3T19A 4CIEA 2OPPA 3QZ7A 3HJFA 3NF7A 3NGDA 5KFCA 4ECTA 3AVJA 5J0UA 4RG8A 4Q5VA 5DQHA 3IM1A 4GLXA 1Z26A 3UPQA 3KK1A 4O3OA 1JN3A 1J9AA 1BL3A 2PZSA 2IGIA 3RMBA 4ED2A 5KG3A 3NF6A 4FCYA 4FK2A 4I2IA 2BCUA 2GUIA 4BACA 2W42A 1NK0A 4J2AA 4BE2A 4YVZA 4Z4CA 1RYSA 1J53A 3AVLA 2B4JA 5KFNA 2RKIA 1WSJA 1ZQRA 3PX0A 4WE1A 2DFLA 2GWSA 4IQTA 3MAQA 2IBKA 4RUCA 4Z0UA 4MFAA 3PO4A 3OJUA 2XGPA 4HYKA 4ECQA 4B9VA 4RW6A 4I7FA 1JL2A 4DL4A 1KVBA 2Z1GA 2YKNA 1XO1A 3V7KA 2X6SA 3OYKA 5T7BA 4RQ6A 4TSXA 3B0YA 4J9SA 4LH5A 3B0XA 3RTVA 4FLWA 3NTUA 5DB9A 1A77A 2ISOA 3QEIA 4C8NA 4DFMA 8ICTA 3LAMA 3JPNA 7ICMA 2IS3A 4CK3A 4BGDA 5KFZA 3C2LA 4CCHA 1TAUA 3QEPA 1ZQAA 4YP3A 2V9WA 1D5AA 4M3ZA 3OSPA 5IIOA 3SZ2A 3I8DA 3JPTA 3TANA 3KIOA 3HP9A 3QLHA 1SL2A 8ICOA 2FLLA 4CFBA 5HRPA 4DF8A 1DGSA 5J0YA 4F4KA 3JYTA 1YTUA 2HHSA 4YR2A 5DB7A 5HHHA 3V6JA 4O0JA 2OPSA 1AROP 1WCNA 2XHBA 4I2HA 3K5MA 3KK2A 3O4NA 2OYQA 4LSLA 7ICTA 3KLEA 3LK9A 3UQ2A 2ATQA 9ICEA 4IKFA 1N48A 2Q0ZX 2WONA 4W5QA 4FZZA 2I1QA 4I2JA 4Z4HA 3MR2A 4DSEA 1DLOA 1VSEA 3ISNC 3I0SA 1RBTA 5KG7A 1CZ9A 3UQ0A 3KJVA 4ECWA 3GIKA 2JEFA 5J0TA 3RJKA 1XWLA 4DSFA 1BPXA 4W5OA 3MDCA 4FVMA 4IFVA 4DG1A 2G8WA 9ICQA 2Q3SA 5J2AA 3P1GA 2V4QA 4HUFA 7ICHA 4E7IA 3NFAA 4RPXA 1BIZA 3HVRA 3PW2A 2ZQBA 4QW9A 4QOZB 3Q8LA 3C95A 3T1AA 4RNOA 3H8WA 4I2PA 5DQGA 4MFBA 3TAFA 3K58A 4DLGA 4O3QA 4IRCA 5CZ1A 3V1RA 3OGUA 3AA4A 3BQTA 1L3TA 8ICLA 2F1HA 4RUAA 3VQBA 4CEAA 2G8HA 2R8GA 2E6LA 1JL1A 1SKRA 2XCPA 4KLJA 1EETA 4IG0A 1WAFA 2G8FA 3DMJA 1BIUA 3FDSA 1MSWD 4KITB 4FK0A 4DSLA 4DL5A 1ZQUA 3AVIA 3K5NA 4FBTA 4KLQA 1ZBIA 2ASDA 4I2AA 3OYNA 2OA8A 3P83D 3JPSA 1DTTA 1VSMA 5J0WA 3QNNA 9ICPA 3MFHA 2FPMA 7ICKA 4PHPA 4O0IA 3IG1A 4EP5A 8ICQA 1RTIA 1VSJA 4ECZA 1KTQA 2NRTA 5J2QA 2MUTA 4KTQA 9ICWA 2MUTB 4W5RA 1JLQA 2IAJA 3SUNA 2W8LA 4DL6A 2BR0A 4JV0A 4I9QA 2H5XA 8ICCA 4ED8A 3CYMA 4KO0A 3OYEA 1RXVA 1PZNA 3C94A 3ZSXA 4BWMA 1U04A 2A1RA 2ATLA 1YT3A 4F3TA 4CJEA 1ZQJA 1MC8A 5HMLA 4PGQA 4F5NA 5HHIA 2C2EA 1RBVA 3K4GA 3TAQA 2QKKA 3RB0A 2B5JA 4ZTJA 3RRGA 1LWFA 4ID5A 3TFRA 1XSPA 2VA2A 1BQNA 1RDAA 4DU3A 2I5JA 4DLEA 3K57A 4DSIA 3DLBA 4CHPA 4ZHRA 3M9MB 4BDZA 1LAVA 3K75D 5KFDA 2NUBA 3HPOA 1S9EA 1S6PA 3LWMA 1NKBA 3VQPA 5C5JA 4CGHA 3MXIA 4KB1A 1RT5A 4KHWA 1RT1A 3CFPA 3AVFA 4RW9A 4FLZA 3RMCA 4CJ4A 2XY8A 4YFKA 5KG1A 3F9KA 4AILC 2Z1IA 5DBAA 3HYFA 1X9WA 3EPIA 2AGOA 4KI4A 4O5KA 3AVKA 2Y1IA 1L3VA 2D5RA 4PHDA 4CJUA 2JEIA 4MF2A 1JXEA 4O3SA 4Y1CA 4CJRA 2PFNA 4AHCA 2BPFA 4M04A 4ED1A 4J9MA 2W9BB 4CF8A 5HRRA 2RN2A 1RPLA 5KFWA 5J2HA 4O4GA 1HMVA 4O5CA 3LANA 3SPZA 4PPXA 5HRSA 3ZT3A 4KHUA 3RJIA 3RB3A 3T3FA 3HL8A 4J9OA 3MXMA 4PWDA 1ZJNA 1RTHA 3NH0A 2OPRA 1TGOA 5F9LA 3C2KA 1S97A 1SL0A 2BE2A 3H4BA 4F2SA 1IKWA 5J2EA 3MXJA 1ZQGA 5KFAA 4NYNA 5E41A 2BANA 5FRNA 2DY4A 2P5GA 5EOZA 3VQAA 4MFFA 3DLRA 5D4BA 5DKWA 3SYZA 4OGCA 1QTMA 1ZJMA 1D8LA 9ICIA 1FKPA 4N76A 2BHNA 5DMRA 4CEZA 1QSSA 1VSDA 3QNOA 1RT6A 2QK9A 4FJGA 3AO5A 3L2QA 1K6YA 3ZSWA 1S1TA 3TAGA 4R64A 4P4MA 5HBMA 4JK1A 4FW1A 4EP4A 5K14A 1QS4A 1TL1A 5HLFA 3RJEA 4K4HA 8ICBA 1B92A 3VQ5A 3GQCA 2W9CA 5L1KA 3HSTB 2UVVA 3L2RA 3GV8B 4CJ5A 3K59A 3RB4A 2BPGA 4IG3A 3VQQA 5KFOA 3UXNA 5C42A 4DFKA 1KSPA 2FC0A 1ASWA 3M8SA 3C1ZA 4EBCA 3LP0A 1JLCA 4FJHA 4YD1A 2R8IA 2HB5A 3OYCA 5IINA 4KMUA 1D9DA 4EYHB 4N56A 2FPLA 4XIUA 1RTDA 4CGJA 3OYDA 4UAYA 4MQ3A 4AHSA 5DDMA 5DG7A 2WTFA 1W9HA 1S9FA 3ZDAA 4I29A 4K8ZA 2NRVA 1BCOA 4HCBA 3TABA 1LV5A 5J2DA 4O3RA 3QEXA 5KGWA 3HM9A 3LPUA 3OY9A 5KG5A 4DSJA 1GOCA 4E3SA 2IMWP 5J0PA 5DG9A 4RNMA 1NJWA 2HNZA 1RILA 3Q8RB 4DQQA 2AQ4A 1EKEA 3I0RA 1U49A 4DFJA 4UBCA 3DOLA 4RNNA 3SQ1A 4IDKA 4J9PA 4CJKA 1B43A 4Z4EA 4ELVA 2KQ2A 5KFKA 2FMSA 4FJ9A 2BCSA 2BGGA 4X5VA 3NF8A 4B8AB 1TVRA 1WNSA 2UVWA 5I3UA 4TURA 4F5OA 4DF4A 1NK4A 4QZAA 1U48A 2PY5A 5DQIA 3GILA 2FBYA 5CZ2A 3BQ1A 3DLHA 1JLFA 4CEBA 1S0VA 3AVAA 4DS5A 3AA5X 3GIMA 1L3SA 1IH7A 4Z4FA 5KFFA 3BGRA 4CJPA 1CXUA 8ICXA 3UXPA 3MEGA 4MEYA 3KLHA 5J2GA 1IKXA 1RT7A 9ICNA 3PW4A 1B22A 3RAQA 4H4OA 4UB5A 4ED0A 4O55A 3H4DA 4DQSA 4QZ9A 2YHBA 1Q9XA 3LALA 1NK6A 5KFMA 4CEQA 8ICHA 5EU7A 4KLFA 3PVXA 1C1BA 3NF9A 1VSKA 2ZE2A 3QINA 1IKYA 1HYZA 4AHUA 4AHVA 3L2UA 3H8JA 5EWFA 5J2BA 4DQIA 2HNYA 2A1SA 3MECA 5DLFA 1T7PA 5DLGA 4YG2A 3UXOA 4CJFA 4TQRA 4E1MA 3ZDDA 4E1NA 4RT3A 3T5LA 4J2EA 3JPQA 4M3YA 1ZQCA 3CM5A 4IR1A 3ZSYA 3V72A 5J2MA 3GV5B 1WSGA 4UB3A 3OYFA 3BQ2A 3L2WA 4MEXA 3JPRA 1S0MA 1BQMA 3AVCA 4M9HA 3ZSRA 1CEZA 7ICRA 2W8KA 1QSYA 2OWOA 3OYGA 3Q8PB 4P4PA 2F1JA 5J1EA 4YMNA 3PMLA 3QE9Y 2D0CA 2PYLA 1EXQA 1X1PA 4TUQA 1S6QA 4KN4A 9ICJA 5KFPA 2ZJAA 3FYHA 1BCMA 1KLNA 4KLMA 4BDYA 5KFXA 4RQ5A 2VWJA 3KKRA 4CF0A 4UB2A 7ICNA 4HUGA 3A2FA 4GW6A 4C8MA 4BE0A 1ZQVA 1D9FA 4PY5A 2X6NA 1HNIA 4DTNA 2KZ3A 3NAEA 2V4RA 3OYLA 4YR3A 3NGZA 7ICLA 1NOYA 3HWTA 2I9GA 4M3XA 1ZQMA
chains in the Genus database with same CATH superfamily
3HOTA 1UT5A 3ZNUA 5AXMA 2YWGA 3ISCA 2J7WA 3VF6A 9ICTA 3IA0A 4OJLA 4WWSA 4B9UA 1HKAA 2K89A 4DR3F 2MZTA 1KEJA 3VF4A 2YWWA 2KJWA 3N4MB 3SLCA 1SWWA 1DKGD 2G0AA 4KV8A 2IYGA 1LXJA 2ZOGA 5FLXU 3V6DA 2ZUAA 3WX8A 2HHQA 3SCKE 4M45A 3V1QA 4PUOB 3IHQB 1TP7A 3CCRS 1VQ9S 5BR9A 3EW9A 2IPOB 4BR7A 3AA8A 5F3XB 3QERA 4QIFA 4C8KA 3QESA 3ZDEA 2IDOA 1R31A 3AO4A 2FJBB 4G65A 3GIRA 1F9FA 1WOSA 4KLTA 2L9WA 3FBCA 4LF8K 4OLBA 4R63A 4YB7A 3BN4A 4CHZA 5HQ8A 4WYBA 1O6XA 4A5AA 3J7YU 1X6JA 3CGIA 1BWVA 1VBYA 4QIWF 3MR7A 2E5GA 3VCDA 4F4XA 3VERA 4FJ5A 2KKZA 2V5HG 4NOHA 1BPDA 4KREA 3B6OA 4V19S 3B6BA 1REVA 2VBZA 2EK6A 1WSHA 3DDNA 3QYYA 1JI7A 1JLGA 1U24A 1R6YA 1UFKA 3TUZC 1WORA 9ICMA 5J2NB 4A47A 2AD9A 1YI2N 3OD2A 3MM6A 2GJ2A 5A8RA 5AM3A 1E3MA 1U2VA 4OMFG 4WIIA 1C0TB 5ALFA 1FI4A 2KVCA 4JB3A 3N9UC 4DR1K 2VJUA 2N4CA 3QT6A 1O13A 2MQPA 4C23A 4EZ6A 2F1FA 3IXQA 1HUZA 4X65K 3ZT0A 3FVYA 3CJ7A 4FZYA 1RDRA 3CEDA 2PFPA 2KM8B 3VAGA 3M2RA 3WNFA 3VA3A 2GHWA 3DYAA 4DMNA 1SV4A 1N36F 3OS1A 1UFWA 4JI1J 5BN8A 3JXUA 4NXZA 1CBKA 1HI0P 2PEHA 1ZBUA 5DG8A 4F2RA 1WSRA 1C1CB 2GAGC 2EFPA 3QT8A 3M1FA 5KT5A 2VOOA 4WFNL 4QZVB 4U9RA 4PHAA 2CPHA 1RDCA 3C6UA 2PKEA 4Q8EA 4OX9K 1T03B 2DUYA 2Y9UA 4YN4A 5IC4B 1TFWA 2H3EB 2XQCA 2Q4TA 4JYAK 1GFWB 3W63A 3CPWM 1T94A 5E2QA 2AYBA 3WQPA 5CYMB 2VPZB 3DAWA 9ICBA 2RS8A 4AP9A 4B8CA 3UDVA 1XSLA 4Z4IA 4H5NA 1VLOA 1WHXA 1FTRA 1BNOA 1W0HA 1WCLA 3ITHA 1TKZB 1PG5B 1X4HA 2P5VA 1MNEA 4FZXC 4Y2TA 3DOKB 2QJ3A 2E8AA 3NGYA 3KJNB 3GP9A 2R7OA 5FLXY 4JEPA 3MMAB 3DLKB 3DRRA 4M3WA 1XHXA 5HO4A 1RA7A 4QWEA 1CJKB 5EX3A 4LUBA 3ZCMA 2CPEA 1J5EK 2OFHX 2W2NP 1YJ9S 1BOTO 1N34K 1ZA1B 3DWLA 1IJFB 2FLNA 4CBXA 1RT2A 4PQUA 5M2UA 1EB0A 4F92B 3OUYB 3IM9A 3P5TL 2QEXN 4NLQA 1T6CA 2JLFA 2EBGA 1Q7YO 4CI6A 4PL1A 4Y1DA 1JMTA 3I4HX 5IT9U 4C0ZA 3NMAA 2QL5B 3T6BA 2QFJA 3M9NB 3QIPB 3Q8SB 1I3OB 4M5IA 5IIIA 2HBLA 3K1ZA 2IJRA 2F8MA 3G82A 1NGEA 3M8ZA 4JRQA 2GBZA 4AD6A 2HOEA 1SH3A 5LJ3Y 4CEDA 4R79A 2B8QA 2MGZB 2BYCA 3ZD8A 3LGHA 3CCMS 5FROA 4I9LA 1XC9A 2K2PA 1FDAA 3R7BB 3H0PA 4B3RF 3KLGB 3MEDA 2WF7A 5DM6Q 1LAWA 3H45C 4FWKA 9ICXA 5E3CA 2ZTEA 4ZS6A 5FDLA 1U9LA 2ETJA 2KHDA 1FX2A 4LY7A 4MMOA 1S0NA 1PYOB 2RUSA 3WNEA 4N41A 3EXYA 2A40A 2QLBB 4NZ7A 4FW2A 3MPYA 3MN9A 1WB9A 1RT3A 2LU2A 1YVNA 4HDHA 1MWZA 3M1VB 4OL8A 3R3LA 2APOA 2HLUA 4GVMA 4RQNA 5KRSA 3TUIC 3CCES 4BC9A 4I69A 5ELZA 1IBLK 2J9EA 2D0BA 3EYZA 1YQHA 5CY4A 3ZX2A 1JB0C 2YTCA 3FMBA 3NS6A 5HSPA 4B3OB 5AQSA 4BWJA 4EX7A 5AQTA 4RQ2A 3LA0A 5AQIA 2ZKUA 1UA1A 5CWRA 2DNZA 3QIOA 4ATNA 1KKXA 5HVHA 1FESA 1HL6A 4ZVHA 4F93B 1CQMA 5CHCB 3EUNA 3C6TA 2GIQA 4DX5A 5HATA 3BGOP 3KHLA 3L4BC 3PR5B 4E8UA 4CF9A 4M5JA 8ICEA 2E5JA 2UVRA 1Y97A 4JI4F 2NRHA 1XIQA 4QZDA 1HPZA 1ZQPA 4QZCA 3ICXA 4DXLA 3MOJB 2VASA 4FFDA 2RHQB 4JI8K 3H0MB 9ICKA 3D6JA 3V7JA 2OLWA 3TRGA 2W6LA 3UNYA 4IOXA 1G1XA 8ICSA 1P6TA 3MAAB 3ATVA 1RT4B 5KFQA 3W3SA 5FD1A 1L7MA 3UM9A 4WIQA 5FPEA 3CO0P 4OZ0A 5JMVA 1M5PC 2Q79A 3LL3A 3UCUP 4P0QB 3GSIA 3L2VA 1NDKA 4UF4A 1HBOB 2W2QP 4H03B 3CJCA 1EP4A 5J8YA 2VUGA 1D8YA 4P2FA 4RWXA 4NLZA 3CD6S 3PY8A 3MMCB 3NBPA 4RT2A 1V9PA 4CDGA 1IUJA 3ISDA 1HI8A 4JI3K 1RKIA 1S1VB 5D15A 2F8HA 2M9NA 3IV6A 1P9QC 4CZGA 4FO0A 1VQ8N 3QRPA 3F53A 1CS4A 1HQEB 4ZPTR 4DOZA 1O1WA 4ZJOA 3M6XA 2Z1JA 4Y0WA 2YY3A 4DR6F 3LP1B 4E7JA 3SK3A 1BQXA 4A2BA 1RQNA 1GTHA 9ICVA 3NCRA 4CM0A 4JWMA 2KG1A 3OLAA 3R2CJ 1XS9D 1X5SA 3FZHA 2V8DA 4RPZA 3EZ5A 4EIAA 4Y2AA 5KT3A 4NO7A 3PMNA 5J0XA 1C1AA 4WCEL 3ZDBA 4FP9A 5L1IA 4TLQA 2VFTA 3EVMA 3VEVA 3JTPA 3PX6A 3PIPQ 4DSKA 2NRRA 4AYBF 1UEUA 4M3TA 3IC1A 1SC3B 4A48A 3N7RC 3V9WA 3AQEA 3CULA 3H08A 2WCXA 2LM4A 5HQLA 1GLLO 4ILGB 2IIRA 1QVGM 1YUWA 2Q0RA 1ROFA 1ZH5A 3OVBA 3EKUA 4JI6K 2CNNB 1Z2ZA 4KE5A 5KAKA 1A0OB 1TL3A 1O03A 1RM6C 3AEVA 3F0NA 4RBVA 4JLHA 2FGOA 3LDAA 3G25A 2KB2A 2QXLA 3CJKA 2HHVA 3HW8A 4KGVB 4R5PA 2DKXA 2AJ4A 5JICA 1KLMA 2P9SA 1K0TA 1WKJA 1S1UB 2VFSA 3U26A 4WFYA 3PRVA 2B6AA 4ZJQA 4IFYB 4XAKA 2ZH5A 4I2DA 4FN5A 3M6GA 4F36A 2DXDA 3OL8A 2JHEA 1MWMA 3ID8A 2HSEB 4BRPA 1NJYA 9ICCA 2L5YA 1W2IA 1PAUB 3OXGA 2MKCA 3QXGA 2BJEA 1OYEA 3L6QA 2V8HA 3AVMA 5KFLA 2JZBB 3WK9A 4OV6A 4FLXA 3BQ0A 1WSIA 4DR3K 2IC3B 3KFWX 4OZNA 2PXIA 3MR5A 3BQ7A 1FKOB 3NVYA 1S4FA 5ETMA 1XQIA 3FZBA 3TZXA 2HFSA 4KHPJ 2MKSA 3ENHA 2BKNA 7ICGA 2E20A 3DDIA 2ZFHA 1X5PA 4MLEA 1JMSA 4CLPA 3N6MA 2PFOA 2D3UA 1S99A 1A6LA 5AZIB 2QA4N 1F9HA 5EWEA 3C3LA 2W9MA 4HAIA 3DOMA 3AVBA 5KFHA 1XNQF 3U1LA 4QW8A 3QT5A 5I42B 3QEAZ 2EVZA 2XICA 2GVZA 3I9V9 1IBKJ 2DNPA 2E1AA 4MJKA 2SXLA 5CD4H 3T9NA 2R18A 2J6SA 2DR5A 4PXDA 1RE1B 1KCFA 4DV7J 2YX6A 1N6QB 4L76A 5DM6L 2RQCA 3D2FB 1ASVA 1J2MA 1QHAA 1S9GA 4C98A 3MEEB 1V38A 4KTWA 1VQSA 4JB8B 3RMDA 5L46A 3VQCA 5A8WA 2ILZA 4ZCIA 4BR4A 3L8BA 4NRTA 5AQZA 4F91B 3CJSA 2UUBK 3V81A 1Y5LB 2KFYA 1VIOA 2YNFA 4DTUA 1Z4NA 4NA3A 3KKAA 3CTRA 1NPRA 4AL6A 3QT7A 5CABA 2MRLA 4JI7J 1GAOA 2BQRA 9ICGA 3QGGA 3Q22A 4HDGA 3M8YA 4K4GA 4QWDA 3BZKA 3DRPA 4YDUA 2DNKA 1NCLA 1GMWD 1QQCA 3MCAB 3RSEB 3W9HA 5KFJA 1TV6A 2F8TA 1CG2A 5LT5A 3SCXA 1CXQA 1MN9A 2JVOA 4WYLA 1N36K 2K4EA 5GADU 4X4TA 4FWRA 3SUOA 5GAHU 1ZBLA 4U7BA 2UUAK 3ZO7A 1Q53A 3VAMA 3I56S 4YY3J 4P6QA 1Q79A 3L4QA 4USAA 3RB6A 2ZBCA 2NXCA 3K89A 4Y2IA 4QWAA 3NNHA 2FF6A 2HNDB 2AX0A 3S41A 3BZCA 4M42A 3VQ6A 3A0HU 3PR4A 3DLGB 5ALWA 3ISND 2FBTA 5IS2A 1WHVA 2RHSB 4TYBA 3V9ZA 2VH7A 2N7CA 5AQHA 1IBMK 2HZVA 1UVJA 3V4IB 1N32J 3PEJA 4DO9A 1RAOA 3SPYA 2C2DA 5EHHA 4CE6A 9ICUA 2ZJPQ 2G0CA 1VQLN 4MN4C 2KJ8A 4DU7A 2HBMA 3RGIA 3HSGA 4DL0C 1SJ1A 3RJGA 3EWAA 5K4LA 1S72S 2E1CA 4BLGA 3OA9A 1UWBA 1UETA 4WU3A 2W43A 4OZ1A 1S6OA 4RW4B 4E7KA 1Q3UA 3V7LA 3EGNA 3EXCX 1YIJN 2C22A 5C2CA 2JGUA 3MFIA 2RDJA 2H3GX 1GEHA 5ALUA 4KKOB 1LFWA 5LL6d 4QIVA 2MLZA 3U4LA 3C66A 1ZQKA 1WBBA 2OAUA 2KN4A 5KG2A 2VBXA 2M88A 1NSQA 1H7WA 2XGQA 1UAXA 3QBXA 4ID1A 1U8SA 4KHPF 5M1NA 2QL7B 1MN7A 4YXMA 2W7OA 5KT6A 3C7NB 2A2DA 2E9TA 3MK6A 3AAWB 1L8LA 2AXTU 3V9SA 1DOQA 4CJQA 4KI6A 3TWZA 3MCPA 2D8CA 2KJVA 1VK3A 2Q66A 1RBUA 3VQEA 1IBKF 4QPTA 3W2WB 4W92B 4HTJA 4Z4GA 4DV7F 3PIPL 3T1HK 9ICSA 3VA0A 2NZTA 9ICOA 1RWWB 4DPOA 2ES6A 4P75A 1JXLA 1LWCB 3GYXB 4B3RK 1WAJA 4RQ8A 1B4FA 3N7PD 4URGA 1WTBA 2YN4A 2GS8A 1NDCA 4KLDA 5F8GA 5CYQA 9ICAA 3S3OA 2YHAA 3VQ7A 3RH5A 1GLEG 4XQ8A 2YQ0A 3SSRA 3OBIA 4DZDA 4M9LA 3TVKA 3U3GA 2AJ1A 4RQ1A 3DHXA 4W90B 5CZVA 1RWOB 5C25B 2RAQA 2AZ3A 3M8QB 1VK0A 2DNRA 3FZFA 3V6HA 2FPKA 2YQ3A 3J7ZT 1RTJB 3MN6A 1RYUA 2DFHA 1L3UA 8ICUA 1VJWA 4LJMA 2N4DA 2IIHA 1VQ4N 1TKTB 5EE1A 1FEZA 1HNWJ 5AFUH 3R2DJ 4F0HA 3HILA 3QUCA 1T8EA 2D0PA 3IP4B 4M6WA 2OGUA 1MG7A 3LP2B 1Q9YA 1DGKN 2NREA 4YNQA 2NXJA 4OPJA 3MHYA 4LVSA 4P0PB 5BRFA 2F4VJ 1U0HA 3QO9A 4IOBA 3CB4A 2P9IA 3HFKA 4GVBB 1KONA 1CJVA 1MU2A 2NZ4A 3NGKA 2RMLA 1B0VA 4ALZA 4WP3A 2H3VA 2R2TA 4XTTA 4RQMA 1X9MA 2XRIA 4JI4K 4Q44A 1ZOTA 3PKYA 2IDLA 4LRFA 4RTFD 4FJXA 3QFHA 4NI2A 2E7WA 2J7UA 2IOCA 1GXTA 5D3GA 3KOOA 2HOIA 2VA8A 4OVLA 4KLSA 1HHTP 4AXJA 3HPHA 2YTUA 2LYBA 4OZ5A 2JEGA 2ROPA 2QYGA 3BSCA 1QJHA 1XBWA 1SJ4P 4LFBK 4BC3A 1T3NA 4KIAA 1OH5A 4ZPDA 3IDWA 5CQGA 5LL6Z 1PCAA 3KNAA 2B43A 2P6SA 2ALZA 5L1JA 2ZWPA 2F8LA 3PUFA 2CRXA 4K43A 3CJ2A 3HKZD 2UUCF 4IO1A 2Z2MA 5KFIA 4MHVA 3TJAA 2FY8A 1K8KA 4DR4K 1VQON 4GXKA 3RYLA 4OJPA 8ICRA 1TV9A 1BWFO 1DTQA 1TUVA 2AKWB 2MSTA 5ETRA 4FM2A 4WKRA 1SQFA 5C0YA 3OHAA 3VV2B 4B3MK 3TZYA 1QHTA 3G87A 3Q24A 1S48A 3IMQJ 3NLCA 4H54A 3UVJB 4EI2A 5C2GA 1KOHA 4GNIA 4ECSA 4J9RA 2PI5A 1YG0A 4DR6K 3TJ8A 1PJ7A 4JUZA 2E7VA 4TY8A 3I82A 5D78A 3HI0A 1NK7A 2B0CA 2YNIB 3ZETB 2LEAA 3DM2B 1SGGA 2XO7A 1JLEB 3E51A 4WXWA 3A5LC 2EAPA 4NA2A 3OJSA 4QCLA 5BYRA 4DUYF 4GKJJ 1N5XA 2PO4A 1FJ7A 1T3QA 5F0UA 4UT4A 4KFBB 1JKHA 3NY0A 3O3GA 2DH7A 1XTZA 5F3ZA 1RDFA 3MWBA 1ZQTA 3MPDA 4ZPWR 4H0PA 3FBEA 4CIEA 1GLCG 4F9OA 1S8OA 4NWIA 2IOFK 5KFCA 4ECTA 4GKKJ 4F04B 2OPPB 1B4SA 4Q5VA 3FBFA 2U2FA 3IM1A 1ZZFA 1YXQA 1Z26A 4KYZA 2MY8A 3DXBA 2AH5A 4A61A 1J9AA 4EO8A 2BACA 3KK1B 1G3OA 3CJ1A 4ED2A 2CG8A 5HJYA 1T11A 4DDFA 1VQMS 4I2IA 2BCUA 3BB5A 5BR8K 4TLRA 4CDIA 1NK0A 3GR0A 4J2AA 1Y0HA 3GFHA 4BE2A 1RYSA 1DXSA 2HWHA 3AVLA 1GXLA 4A8KA 3Q83A 2RKIA 4NLOA 1WSJA 1KVJA 2MQMA 2VQEF 4HR2A 3D0IE 4ZOHC 3CC7S 3THWB 2KMDA 3ULHA 1HNWF 3MAQA 3KKFA 2J76E 4Z0UA 3C15B 3PO4A 3WEEB 1ZQ1C 2XGPA 3P45B 3PACA 4B9VA 4RW6A 1RBLA 1KW4A 4I7FA 1QQNA 4Z7CA 2ADBA 5HN0A 1XO1A 1U6BA 3V7KA 2F4VF 4XK8C 1XEZA 1T9XA 4J9SA 2YKNB 6FDRA 3HKZF 2KYXA 8ICTA 3JPNA 4UY85 4LFCF 2IS3A 1MMDA 2G1HA 3CSKA 3MI7X 3C2LA 2AZ1A 1ZQAA 4JHDA 4L72B 5IIOA 4PL7A 1U1NA 4FZLA 3C8YA 3TANA 4KGZB 2FJWA 1KS2A 1UTAA 3I28A 3HZEA 1Y7PA 8ICOA 4JV5K 1OWXA 2F76X 2WK4A 3KXDA 2E1FA 1OH8A 4DF8A 4F4KA 4UTGA 4AL5A 5DB7A 1WKLA 2Q36A 3JYTB 4A8EA 2KXHA 2K8AA 3BSAA 4WQ5A 1XNQK 1GT8A 1XERA 3AD9C 2VD3A 3O8MA 4L3KA 5J8YC 4B3SJ 2OYQA 2XZDB 3CCVS 3AXKA 4ETXA 2CKWA 3UQ2A 3KK2B 2B9WA 2ATQA 2RE1A 1H73A 2E2NA 3O9SA 1XMOJ 1Q8KA 4W5QA 2I1QA 4I2JA 1T0TV 5B0GA 4Z4HA 4DSEA 1VSEA 2KHVA 2EW9A 3QNMA 3QNWB 3GE9A 1CZ9A 2D74B 1IR0A 4IS7A 3U9ZA 2JEFA 2RB7A 1PK3A 3RJKA 4LMZA 1FT8A 1XWLA 4DSFA 1DGJA 2PFFB 5J2AA 2LMIA 2E9RX 3W60A 4DG1B 4XH1A 2V4QA 2PMHA 1SH0A 1E6YB 3OBYA 3AOBA 4RPXA 5AQWA 2JL9A 3NOCA 2MSSA 2MA1A 1ICEB 4BRFA 2ZVIA 1KKHA 4OZJA 1X9JA 3BDEA 2LP4A 3CMEN 4F26A 2UUTA 3OFEA 3IWNC 3K2YA 2XHCA 4O3QA 4IRCA 3MM8B 3MUVP 4MFBB 3OGUA 1L3TA 2DPNA 4Y2PA 8ICLA 2F1HA 2QARA 4RUAA 3NEKA 2G8HA 3ALRA 3TOQA 2YMLA 4GKJF 4OHZA 1T9WA 2E6LA 2E9ZA 4CW7B 2P9LB 3TVZA 3S6JA 2O8CA 1X4DA 3CJ9A 2H5EA 1BIUA 1PVQA 1MSWD 4DN0A 3DMJB 1XJWB 4DL5A 4A8XA 4FBTA 1YLXA 5H1SV 4I2AA 2OI2A 3P83D 1XMQK 1NM2A 1DTTA 2ZEJA 3UDLA 3GFZA 2KP7A 3C14B 2CXYA 1QAJA 1FHTA 3NWGA 2OKQA 1KEKA 3MUMP 2FPMA 2AP1A 2HGNA 1RKJA 3BR8A 4AXIA 5CRXA 4RWTA 4C11B 1TL7B 1O0PA 3PDNA 1RTIB 4ECZA 1KTQA 3M7VA 5J2QA 1URNA 4KTQA 9ICWA 2MUTB 2V8GA 2IAJA 1HIWA 3EZWA 3OT9A 4DL6A 5ALZA 4OI1A 4I9QA 1JLQB 4LVNP 3BUZB 3CYMA 2JRSA 4FSVA 3OYEA 1RXVA 2QE5A 5AQUA 2CZVC 2HQGA 2ZZMA 1T9VA 4UAVA 3T7ZA 3HTVA 3VEZA 4KY3A 4F3TA 4A2AA 1P1TA 1ZQJA 2VF3A 1TUYA 3UD4P 4YN3B 4WZQA 2C2EA 3K4GA 4M1KA 2ZC3A 3M6UA 3PIOQ 2HZCA 3TAQA 2QLFB 3H3OB 5A6WA 5B0DA 2Z8QA 4LF4J 1NNEA 3VVUA 3RB0A 4RJVA 5BRHA 1J2NA 4TN2A 4A8YA 2BE7D 3MTJA 3TFRA 4L6V3 1XSPA 4CVNE 1LWFB 1RDAA 4DU3A 1VQYA 3VC8A 1BQNB 4DSIA 2JNJA 3DLBA 2LCWA 4BDZA 4CGZA 2HEKA 5KFDA 2DJWA 1NH8A 5DM7Q 1NKBA 5ADZA 2PFUA 3E66A 2FE9A 2B4PA 3VQPA 3OR1A 5C5JA 2EG1A 2RDDA 3MXIA 3CNQP 4KHWA 5AKEA 1U25A 3WC0A 1FVSA 4B3SF 3LDNA 5EOYA 2IRXA 2W4DA 2LI6A 2KRBA 4CLWA 1XMOF 2Z1IA 3DJCA 1FRXA 4QBUA 3EPIA 4KI4A 1WBDA 4X4RA 1MA9B 1TYQB 1N4LA 4KGKA 1ZA2B 4G1IA 1PGZA 1ZD5A 2D5RA 4PHDA 3H5SA 3SBGA 2JEIA 4MF2A 4O3SA 4NLYA 1RAAB 2GO9A 2ZIUB 2D4WA 4CBWA 1EQ0A 4CF8A 2Y1LB 5D4NA 2W3RA 5A8KB 1HMVA 4O5CA 2VQFJ 1B3TA 5FPMA 3SPZA 2KV2A 1HNXJ 2HCFA 2XULA 3ZT3A 3DN9A 3AAPA 4BRMA 1RWVB 4KHUA 2ZC4A 3RB3A 2BABA 5E33A 1Y5IB 5H9EJ 1K8AT 1SIJA 2DNYA 3NH0A 1QVFM 1TGOA 3N79A 2CRLA 5F9LA 4PWDB 2KG5A 1SL0A 2BE2A 4YOXA 4F2SA 4X4VA 4PZVA 4GO5X 5CZXA 3QBWA 3EM1A 5KFAA 1UVMA 2HURA 1XR6A 2RJZA 1UKUA 3CI5A 1FA0A 3NS7B 2P5GA 5EOZA 4QPXA 1M0SA 1QTMA 3C28A 2GIRA 4FXVA 1D8LA 3WXLA 4WFXA 3MGJA 3A13A 1R0CB 1YRXA 2QK9A 5HJXA 3OL7A 2ZH8A 1S1TA 4R64A 1TL5A 4M5DB 4IJNA 2QX0A 3EKSA 4JK1A 5IFMA 4FW1A 4EP4A 2RQMA 4EFHA 2DGWA 5DO2A 2O5DA 8ICBA 3W65A 4YB6A 4Z37A 1T02A 2QKQA 1M6YA 2FPHX 4PXEA 3L7UA 1F6TA 5I4MA 4QYZJ 3UR3C 2BPGA 5C42A 3HSJA 1KSPA 2FC0A 4IG3B 2HQIA 2GO7A 3GJTB 4I6MA 3SCLE 4FJHA 2DTJA 3VPZA 1YKWA 3LP0B 3H5YA 3MN7A 4QQBA 1VQNS 1RTDA 3G86A 4CGJA 1GTEA 3GWCA 3OTCA 1ITPA 4K4YA 3W7BA 3AGKA 1W9HA 2OP5A 3WUHA 4K8ZA 1LV5A 3JTOA 3HM9A 4CO4A 1YI2S 3F56A 4E3SA 2E3TA 2UUCK 5J0PA 3SXLA 3H20A 3Q2SC 1RILA 3HKWA 1RCOB 2B51A 3Q8RB 1H0HB 1FRMA 2J8AA 3H98A 4PHTX 2HNZB 3OVAA 3I0RA 4LF4F 5IQ6A 3E8OA 1NNLA 2B4UA 1RAFB 4IDKA 4CJKA 4Z4EA 1B43A 1SH2A 2KQ2A 4YOWA 2FMSA 3IR6B 3PHTA 4K41A 2HKEA 3MMBA 1WNSA 1IWAA 4QZAA 1U48A 1XR5A 5DQIA 4XH5A 2I7NA 3O1BA 5I3UB 3GILA 3BQ1A 4WK1A 3DLHA 2RVJA 2YH1A 3FM9A 3N6LA 3WKDA 3AVAA 3AA5X 2EAMA 4DCCA 1L3SA 1U0SA 1WJ9A 2M0NA 2DGUA 1WF2A 3BGRA 4CJPA 5BN9A 3UXPA 4ZOSA 4FPBA 1YHQN 1IKXA 3I5CA 3PW4A 1B22A 3KLHB 1LQ9A 4EEKA 1M1GA 4UB5A 2O1PA 1B0XA 4OJ5A 4O55A 4DUYK 4I64A 1Q86O 1JCGA 2AJ0A 4H4OB 8ICHA 3VESA 5A2QO 5EU7A 4K4UA 3O0FA 2FGCA 3C16A 4MIAA 1FJGJ 2P8IA 4AE5A 2L48A 2CYYA 4LF7K 3CJ0A 2YPYA 3DDKA 1HI1A 2HNYA 1TUGB 2FHJD 2A1SA 2VQFF 3O9UA 2FJEB 1EO1A 1HNXF 2V4JB 3UXOA 2HWIA 1K73O 2R2SA 3SCJE 4EK2A 3E0FA 4PPDA 1D8BA 5CA5A 5F0XA 1Z1ZA 3CM5A 5AXKA 5EE9A 3MMJA 2IM2A 2C3PA 1EAYC 3BQ2A 2MHEA 2VQEK 4LR9A 1CQNA 1U7LA 3UNGC 3F5EA 1N5SA 1C0GA 4OPAA 4Z7YA 1BQMB 2WW8A 2R7WA 4ED4A 2B4VA 2P9KB 4U96A 2GA7A 5J1EA 3PIOL 4YMNA 2FTRA 3RBXA 4NZ6A 1LWXA 2D0CA 3E3XA 4KN4A 9ICJA 5KFPA 1YJ7A 4BR5A 1CC8A 1FFGB 2DQNB 4Y65A 1K9MT 4ANDA 3DV9A 2DNLA 4BDYA 4LFCK 4P9SA 2I6WA 2VWJA 2LA4A 4F3QA 5A76A 3J7AP 1ZC6A 4HUGA 5THWA 5T14A 4BE0A 1NGCA 4ITSA 3CDBA 5DM7L 2GQ2A 1D9FA 4PY5A 4MK9A 1PC5A 4DTNA 1FWKA 3AY0A 3OYLA 2VV5A 1Z05A 5AQLA 5H9FJ 3VZIA 2AW0A 1QY7A 3FGUA 2DEJA 2VGNA 3HSZA 5JJBA 3W62A 1I3AA 4IO8A 3DI6B 2YB1A 2O8EA 4FVUA 3RAMA 3AOAA 4FK4A 1NMDA 5IV4A 4UB1A 1Y3KA 3MM5B 4IUFA 2GAHC 3ZSOA 4LSLB 4CHNA 2OMOA 5AQYA 3U6FA 2P9PB 4PUOA 3B8AX 2WVDA 3ZYYX 1QTNB 5ALMA 4OJGA 3M30B 2IM1A 2ZVSA 4HEA9 4LIWA 3CMAS 1M90O 3WX4A 3GJRB 3LGNA 1C0UB 3UI3A 4OLAA 4Z6CA 1WOOA 2XNQA 5E79U 2B7BB 1AT1B 2AV5A 4F5RA 4O4RA 2NO4A 2OTLS 1G6BA 2AJQA 2PMZC 4N8NA 4OZLA 1NB7A 4ZTFA 5CCMA 3CHWA 3AU6A 2DGQA 4RW8A 3TA0A 4JBCA 4NB4A 2N7YA 2R8HA 2VGMA 4DTOA 1ATRA 5ETPA 5KI6A 2IOFA 1NK8A 1HWUA 3V4MA 3D9BA 3O5TB 1VQ6N 3J80U 2BCVA 1CULB 4YHHJ 1RHUB 3S3NA 2DB1A 5J2NA 1PK1B 4J9NA 1VSFA 3LPEA 3CJRA 4F5QA 3O9QA 2DGSA 4NL9C 1FJGF 1SQEA 3T69A 2XS5A 1NJIT 1C0TA 3QIDA 5ETKA 2HFZA 1DURA 3H8SA 3MX5A 4TU9A 5AQMA 3UO0A 1F5BA 4I2CA 2AJFE 2XI3A 3AAQA 4B08A 5G0RB 4CJTA 5HVFA 3TWHA 4C7ZA 3H3NO 4DR7J 3SMZA 3FEXB 2B9XA 2QWRA 3GE1A 2ZIXB 2O66A 3SQGB 1H6KX 3H8MA 4YOUA 3JSBA 2HMPA 1R7IA 2CGKA 4OJ6A 3SDEB 4LF5J 2HLTA 3BY5A 1WI8A 2C2KB 5AJ3J 2AYEA 3E01B 3QU7A 2AEJA 1DQ8A 2QB0B 1C1CA 3GJSB 1N5VA 3CQYA 4PKDB 4DV0K 4LF6K 2J4RA 2L08A 2QA4G 4UAWA 2YCHA 1T03A 3MPWA 4NLGA 2ZTCA 4X66J 2RUGA 5CYMA 2FJVA 3BM7A 4ZLJA 5JXSA 1U1KA 2D1KA 2JRZA 2EWHA 2GVDB 3VTIA 3RBZA 4QOTA 4H4MB 1B99A 2DPIA 2QA1A 4AQYJ 4BXOB 4DR5J 2GX8A 4X2BA 4QWBA 3CCWA 2XYHB 1I6JA 1TKZA 3FR0A 4CGIA 3G71N 1NXIA 2CAJA 4W98A 3PSIA 1ZQXA 3R1HA 1NGDA 3DOKA 2OZMA 4KAZA 3M6WA 4RZRA 2BDUA 3B4MA 2MEWA 4CLTA 3TX0A 5AKGA 3MMAA 3DLKA 1WLJA 1Q8LA 2V2QA 1FRJA 3PG9A 3FZLA 1CJKA 4F3OA 2RS2A 1DAXA 3SSQA 2IA6A 4DV6J 2OHFA 4PGYA 3OYMA 4C3MA 5EUHA 3OUYA 2IJFA 4PL8A 1CZBA 1HYVA 2XEXA 2GMJA 1HFEL 4B9NA 2XZWA 2BQ3A 4YOVA 1ZAWA 3J7YI 2X3DA 3QATA 3NDKA 4G3IA 2X51A 1ITGA 1VQPN 3QIPA 1KD1T 3HLUA 5J2PB 4CZCA 3RW6A 5AI5A 2Y3YA 5LMUJ 1RSCA 3A8IA 3SUPA 5RUBA 3PW5A 4CERA 2BJ1A 4OKJA 4P2XA 2MGZA 4QZHA 4GXIA 4KTZA 1LB2B 2OFGX 3I76A 1ZQBA 1GOBA 3A1YG 4MKBA 4CBUA 2FC8A 1S5ZA 3C5FA 4GO7X 1VRUB 1NK5A 2BOAA 2XCAA 4LD0A 4NM2A 3KLGA 4CJWA 3R1LA 2E6MA 3QMQA 1V97A 1SUQB 1KQSM 4RU9A 1ZYQA 3KLVA 2IHMA 3KMSA 1BUPA 1TUWA 2B56A 4M5GA 1COOA 2W3SA 3NUQA 3G8QA 5FLXO 3E2EA 2KFNA 1VISA 2ZBPA 2B0GA 4YHHF 4FM1A 2M8HA 1NSAA 4Y00A 3H2VE 1JCFA 1U2FA 1U26A 3JSMB 3HFZB 1X0FA 2ZOFA 1AB8A 1N0UA 3MXHP 5B66U 1MMNA 1WSFA 4Y2UA 1YRTA 4FZMA 4FWOA 4QZ8A 3M1VA 4DL3A 2CZ4A 1HBNB 2NR0A 2ZH2A 4ZVGA 4C9DA 4FJJA 4JS4A 1Q8BA 1N5YB 1Q7LB 1VQ5N 4TU7A 4JK8A 3MEKA 2A3ZA 2KHOA 3HHKA 2K8CB 4DR7F 2EFVA 4B3OA 4K4ZA 3CCJN 4O8KA 3ZSQA 5DGAA 4LF5F 5AJ3F 3HXMA 3QYPA 3KHRA 2FMQA 3LP3A 3K5PA 5AKHA 2QFIA 3GPAA 5J2CA 4USUA 4H0TB 2A1JB 1LKYB 4PXBA 1UT8A 3OS0A 1NHKL 4PG7A 5F3TA 3V2UC 4UAZA 1B9FA 2GLEA 2EEYA 4I68A 2MQNA 4K59A 3KUGA 5ITHA 4KB0A 2EKYA 2XYGB 3BS9A 3WIVA 1R8HA 5J29A 1KC8T 4AQYF 2G2OA 4DR5F 3UE5A 4M95A 2ZXIA 4YCXA 5KG6A 4QIWC 3AVHA 4N47A 1J5OB 3MAAA 3ETRA 1GMWA 3VGTA 5HR6A 3O9RA 1RT4A 1XR7A 4ICLA 5TKWA 1S59A 2O4IA 1XN9A 3OV7A 3G10A 2A6AA 4P0QA 1RWUA 8ICYA 1HBOA 1VR6A 2F40A 3DLJA 4Y2XA 3PEHA 2MLXA 5HMZA 4W5TA 5J0QA 2E1ZA 3DHWC 5B5EU 4CHYA 3G6XA 1RYRA 3CM6A 2OIHA 1N2XA 3MMCA 4DOBA 3AHPA 4HI1A 2CPIA 1GLFO 5K8OA 3RF9A 4KH6A 4M8LA 1S1VA 4KBIA 4ECRA 2C2ZB 4FJ7A 2PFDA 1TE2A 1RQ0A 3M8RA 1RDBA 2UU9J 1HQEA 1R8PA 2DNGA 1K1QA 4DS4A 4I6WA 3CT9A 1KVKA 2OZSA 1TMMA 4CLZA 2QWQA 2CDQA 4K0KK 5AKLA 5AKKA 4UQTA 3ENOA 3LP1A 1N8RO 2HS3A 1B7FA 2DITA 4N77A 2MKKA 5KFTA 5LMUF 3K5LA 4FXDA 3HX9A 3ULDA 1OQ6A 2OPQB 3M6KA 1SPBP 1WG4A 3MGHA 1F21A 1K8AO 4IRKA 4X64J 4CFDA 2O8DB 1YIJS 4DTRA 4B9LA 3AVGA 4M5NA 4C2MA 3TVYA 5AE2A 2XM3A 3RJHA 1S77D 1S6UA 4A46A 4MDAA 3G6ES 5KRTA 4K4VA 3QFUA 3H0RB 3F2BA 3LDSA 4UW2A 5IIJA 5DDYA 4B9TA 5T7LA 1RBAA 1T4GA 4IDHA 3WZ0A 4BS2A 1WC0A 1RI7A 2V94A 1NB2A 2CQBA 5HRNA 4GV3A 3OVNA 8ICWA 1NZBA 5EN1A 4IJAA 3K5OA 5I3PA 1WC6A 3PNIA 3E9OA 4FS2A 1X4EA 3CCLN 4TVAB 1UJ6A 4F4YA 2NXUA 2HRUA 1BISA 1S1UA 2LQBA 4ZP8A 4DFPA 4UUWA 4FLTA 2QRRA 1RB0A 4KGXB 4IFYA 3UD3P 4YFUA 2QWNA 2LQJA 2BMBA 1UPMB 3WU2U 3CDUA 4CZJA 4A8QA 3NVZA 5J2JA 4DU4A 2ZM6J 3CJQA 4CF4A 2JZBA 5H2FU 1RGIA 4OYMA 7ICUA 1DARA 1RQLA 4HWIA 2IC3A 4CNYA 9RUBA 2IY5B 4RQ0A 3H0LB 2OEJA 2HVDA 4ZVSB 3K8WA 4F50A 1ZQOA 2YY6A 4KAIA 5B0FA 4I28A 1P7DA 1FKOA 3AO1A 2DR9A 5J1PA 3WKEA 3KD5E 1X9SA 2WF6A 2QWMA 4IQVA 2XMWA 5A0YB 3SAFA 1S12A 4BVPA 2X78A 2F5GA 2JEJA 2VANA 4HT7A 3I96A 3VALA 3ZTRA 4B02A 8ICZA 4EU0A 2ZBRA 2W2OP 2KXFA 1BPBA 3SI8A 1N33K 5AZIA 2Y0SD 1KFTA 2MZSA 3AH6A 4E89A 3WKBA 4CO3A 3MF5A 3V6DB 2ZJ8A 4Y2RA 4JI2J 4YQWA 5I42A 4OPKA 2Z30B 5AK3A 4R66A 4QIGA 1VQ4S 1P90A 4UB4A 2K1RB 4BCAA 8ICGA 1N6QA 1S3XA 3AGRA 4CO0A 5HI7A 3MAHA 2JDJA 3T79A 3CJTA 2W2PP 4DV5J 3MEEA 5ADXH 4OI6A 3UDCA 2JLEA 4IR9A 2G5IB 1M1HA 2UXBF 1FXXA 1AYEA 3HJEA 2PGCA 1Q7YT 2E1YA 4ED3A 4BX9C 1HNZJ 4NCGB 2E44A 4O44A 1RAHB 4O0NA 4OX6A 3NL0A 2KU7A 1J6ZA 1D9AA 3JPPA 2MYFA 4K4TA 1KFDA 1VRTB 2VU5A 3BP8A 1S5JA 2HAIA 2UU9F 2FZKB 2V0NA 2ZDOA 5BYSA 2ZJQQ 5AK5A 2VG6B 1ZPWX 5AHXA 4GMJB 2IVMA 5DB8A 5LMNJ 3V1OA 1N5QA 2IVYA 3RSEA 1DK2A 2YJFA 5AFUA 5KFRA 3JQKA 3QQCD 4W5NA 3VF2A 4RQ4A 5HNKA 2ZWOA 3THYB 5AM5A 4X64F 3LVVA 1QQMA 4J9UE 4KHNA 2H3ZA 3JAMU 4FYWB 2AA4A 4NYFA 5I9EB 4WTOB 4K5RA 3VQTA 1LCUA 5IWAJ 1WHWA 1S1XA 2XS2A 1KDHA 2HNDA 2ZHOA 3SMPA 4CJ3A 1KXPA 3R3TA 3NGIA 5JS2A 2YPZA 3DLGA 2E5LF 4NCAA 1VQOS 1AA1B 1U2RA 1TU0B 5ALLA 5DB6A 4MYUA 3UR0A 3FC9A 2XWYA 4CF1A 1UPHA 2XMAA 4I2BA 3V4IA 3OW2M 5KFBA 5JUMA 2D41A 2M4MA 2A2CA 2A1BA 2L3MA 4NLTA 5GAHP 2D7SA 3ZEUA 4N5SA 2YH0A 5EVZA 3D4JA 2Y0SF 3CJ4A 4JV1A 2CJXB 4FJ8A 2BE9B 2DGVA 4Y0FA 3B9JA 4RW4A 2KD1A 2VPYB 2ATCB 3NAHA 1VJ5A 3CCUN 4DTMA 4KKOA 2ZM6F 2ZUCA 1ZQIA 5AM1A 4DJBA 4X4OA 4RW7B 3CC4S 1H98A 4A8WA 4F72A 4K25A 1ASUA 4YMEA 1M1KO 5A2QU 4CHQA 8ICNA 3ICLA 2AHOB 1N60A 4K4IA 1JQGA 3KD3A 4CEEA 2OSRA 3C7NA 2XTJP 2OM6A 5IIKA 2GV9A 2IMOA 2G5HB 1YJUA 2YKPA 4MH8A 3VWSA 4QAGA 3CG7A 3AV9A 1R0AB 4ES2A 2HGMA 1U1MA 2IVNA 3TAEA 4WQ4A 2VWKA 1I94J 1ELOA 2PA8D 3EX7B 4JI2F 1K44A 4UZCA 3L5KA 3NCPA 3TO8A 2QWOA 4ZVRB 2KVIA 2AGPA 1CUKA 3RBDA 1FRLA 3W2WA 2CJAA 2RT3A 7AT1B 1FNXH 2O8BB 3M8WA 4BC5A 3BGLA 2YV0X 1NK9A 4DV5F 2HMXA 4CT9A 1NLKL 1LWCA 2A41A 2VZ9A 1TR0A 5DBBA 4MKYA 3AL0B 4DR2J 1RACB 4QZIA 2ISPA 4FO6A 3P3DA 2JWNA 1U6ZA 1MQ3A 2IVFB 4FLYA 1RLDA 1ZXOA 3D2NA 2CJBA 2HF4A 3IAYA 3H90A 4B9SA 3M4XA 2KZZA 4NL5A 4F02A 2HG4A 2JFKA 2D0AA 4B1UB 1P8ZA 2JWKA 3CDAA 4HTIA 2QLXA 1YGYA 5GADI 5BOLA 5GAHI 2KM8C 2HHPA 3QU4A 3C2MA 3SQ4A 4YOYA 5LMNF 3T1YJ 3D2SA 3ATUA 3M8QA 2CNLB 1H2UX 1RT3B 1RTJA 2UXDJ 1W25A 2QLJB 4FJMA 4USHA 3CCRN 1VQ9N 3GLJA 1TKTA 1UAWA 2GCFA 3U1NA 3J7Z5 1HWLA 3OTOK 3LP2A 2WC9A 3QSYB 4LF5K 3CNHA 3GYGA 3Q8MA 1KL9A 3IFEA 4P0PA 4CD3A 4CQ1A 1RA6A 4F4ZA 1ZRMA 5AQXA 4FWPA 5IT4A 4YMOA 3GDQA 4GVBA 2V34A 2XHWA 2I5HA 3HVTA 2RRAA 4E98A 2P6UA 2XC9A 4XDDA 3IMXA 2PMWA 2AP6A 4K8XA 1B9DA 1M5OC 4USMA 3C5GA 1ZQDA 4NWBA 3CO9A 1NMNA 1SKWA 3O6QA 3V9XA 1FNMA 4C7YA 1L6NA 7ICQA 5BYQA 4V1Ak 3PX4A 4JKFA 3PW0A 4B3TF 3R7NB 2ZITA 1JIHA 4RBUA 4HT5A 5D0HA 2ZIWB 4JN4A 2KTQA 2DGXA 1P27B 2RE2A 4FLVA 2HMIB 8ICMA 1IXKA 4GC7A 3U3YA 1KQSR 3NG8A 4DQ8A 4MTPA 1G15A 1YJWS 5AZJB 5C12A 4M47A 2O8FB 4C8OA 4LF9F 2PAVA 2ALYB 3A8EA 4FPAA 2FLOA 1VLYA 3JXOA 3MD1A 2J6TA 3EUB2 2ABYA 3BEXA 1ZQEA 1XNRJ 4RPYA 3L9ZA 2G4BA 3K0SA 1H3DA 4RPFA 2YX4A 1TKDA 1N56A 2F9WA 4DTXA 3GYNA 1JJ2M 3M7DA 1OMSA 2P6RA 9ICHA 4NLWA 2ZJQL 2C3YA 4KH0B 4DV4J 4F3MA 5GMEA 3TNVA 4FKYA 2ASOA 2C3OA 4FPRA 4EBDA 3RJJA 2YMQA 3NBPB 4IKAA 1TUUA 5FIIA 4K4XA 1YITS 3UVJA 3A8JA 3MCSA 1I94F 1HQUB 4KPCA 4YS2A 1SVDA 4UOFA 2YNIA 3ZETA 2H54B 3DM2A 2R8JA 2B8PA 4RKUC 4DOCA 1JLEA 2Y1JA 1NOMA 4DL2A 1NU4A 1F44A 1TQLA 3IRUA 4KLGA 4CECA 4OKEA 1XC3A 4X62K 4DR2F 1L3KA 1QE1B 2J6UA 1JUDA 2XBPA 4NA1A 2KRRA 2DPJA 2KDOA 2ERRA 4JI5J 1S1WB 3RWUA 2HVZA 4AF1A 4DV1J 4A62A 3AO3A 2OPPA 3FGVA 3HJFA 2MQQA 3NF7A 3W9JA 4PG5A 3NGDA 4C6AA 2FDRA 1S49A 2Q1LA 5DQHA 5BPLA 5LOQA 4GLXA 5AQPA 3UPQA 3KK1A 4LREA 2H3FA 1JN3A 1BL3A 2IGIA 1YJ9N 1YWXA 5KAIU 4FCYA 2GC8A 2FI1A 1Q4RA 4QNLA 2A19A 1VDHA 2GUIA 2F8EX 3N7SC 4YVZA 1RABB 3CC2S 1J53A 2BKOA 2E1PA 4ZLNA 1ZQRA 1GMVA 3S01A 3PX0A 4I0WA 3THWA 1KQGB 2BEFA 3D28A 3WEEA 1KLMB 4NASA 4WE1B 3W8PA 4RUCA 3VMFB 2VBYA 3UMBA 4HYKA 4RR5A 4B1ZA 1BU6O 3AN1A 3R5GA 4J7CA 2XZTB 1KVBA 2K3KA 1WELA 2PIIA 2Z1GA 2YKNA 3CCMN 3LPYA 2X6SA 4TSXA 5KOWA 3I8BA 2W7PA 4E2FB 3RTVA 5DB9A 4NYPA 3QEIA 4PYAA 3GG1A 3QWPA 1WDDA 2FD2A 1RAIB 3FCWA 4CK3A 1NUEA 4CCHA 2BM1A 3KZXA 3M1YA 3KDOA 4YP3A 3M05A 4DUTA 2W04A 3M2UB 4M3ZA 5ALKA 4H5RA 1JNZB 3SZ2A 1R0BG 1KC8O 1KWMA 2UZAA 4Z94A 1SL2A 2FLLA 5HRPA 1Q16B 4NXNJ 5L38A 3JYTA 5JVGQ 1YTUA 4YR2A 4ZMMA 4UOHA 2DYAA 3P4IA 4O0JA 1RHRB 1T95A 3BO2A 1WCNA 2OPSB 3G2XA 4I2HA 3QAEA 5IQQA 3TTDA 4IOCQ 2A42A 3FQKA 4X4QA 2POKA 3KK2A 3R1XA 3CCEN 5L1MA 1E4FT 1KAZA 1N48A 3D66A 4PEOA 2GVZB 2WONB 3THXB 1NG9A 2UXBK 4FDFA 3ISNC 2QLWA 3TA2A 2KT2A 1QZ6A 1Y5NB 4PKIA 3I0SB 4ECWA 5J0TA 3UN3A 4W5OA 4FVMA 1LOUA 4DG1A 2G8WA 9ICQA 4DV4F 1AZSA 1E6YA 2DHSA 3P1GA 4IFVB 2MPUA 4E7IA 4QU7A 5AQOA 1FF2A 3TUJC 3PW2A 3A0IX 4A57A 2Y8WA 2ZQBA 2AEFA 4QOZB 3Q8LA 5C7PA 2MKHA 3LH2S 5EGYA 2DF4B 4RNOA 2MQLA 4F67A 1TTHB 2HVEA 3MM8A 4MFBA 4I2PB 3K58A 4DLGA 3DXKB 3V1RA 1UZDA 2JSXA 3VQBA 1KN5A 4CEAA 4WP8A 1WEYA 2P9LA 4WF9Q 5C15A 2BV3A 3D3CJ 2J0SD 4JD2B 2GX9A 1JL1A 2XCPA 5GMKa 3Q23A 4JI5F 4NE9C 5AKYA 4DV1F 4XPEA 2G8FA 3DMJA 3AM9A 1EETB 2LHTA 4IG0B 2E5LK 1UL3A 5KNIA 1F5CA 2VKZG 4KLQA 2C42A 1ZBIA 3OYNA 3C14A 4YB1P 1AUDA 2OA8A 1ZOLA 3JPSA 5J0WA 3CD6N 1YJNS 2FQQB 2GW8A 2BRLA 2DO4A 4C11A 1TL7A 5EE0A 4MKVA 3PKMA 4R0EA 4PHPA 2UV8A 3UDEA 1HUXA 4DUZJ 8ICQA 1RTIA 2BKPA 4ISGA 4LSZB 5B08A 5EX0A 4Y2KA 1UVNA 2DHXA 4H5TA 2G13A 3G8TA 2GFFA 2MUTA 3NGUA 2I2YA 1QAYA 4WCEQ 1E4GT 1BG3A 2MSNA 1JLQA 3NGTA 2DNOA 2K7KA 2R2RA 1EHWA 3LOUA 4HLBA 3NNCA 2H5XA 4WJ3B 4ED8A 4USTA 1CJTB 4P7VA 4KO0B 3FFKB 3ZSXA 4U8YA 3G4SS 1NZPA 2Q43A 2DHHA 1MC8A 4HACB 2AYMA 5HMLA 1HR0J 2V63A 4OI2A 2HRYA 1RBVA 1VHXA 4JKGB 1WSVA 2EI5A 3RRGA 1LWFA 3D3BJ 2JV3A 3UD5A 2B5JB 2VA2A 5B8HA 2E1RA 2FHJA 4IH7A 1BQNA 5C2DA 3HVWA 5LJWA 1LK5A 3LM2A 3HRGA 3R5JB 4M5KA 1U1PA 1H72C 1P8GA 1HHSA 3LWMA 2Y1RI 1NU0A 4CGHA 1WC3A 3ETMA 3CFPA 4FLZA 4ID8A 3SMSA 2XY8A 5ALRA 2XLKA 2FVSA 3O3LA 4RW9B 2LXIA 1RBOB 4C1NI 2Q3PA 2CPYA 5DBAA 1TYQA 4FWMA 2HOFA 5GTHU 2FJAB 2ASYA 1L3VA 1RAEB 2GTDA 1SV0A 4CJUA 3F41A 2ZIUA 3OR2A 2XMMA 3OW2R 4RWWA 3D1OA 2PFNA 2BPFA 4N7TA 3EGZA 4J9MA 5KOXA 4ILHA 2KSOB 3GONA 2RN2A 5A8KA 2EC0A 1IBCB 1RPLA 2EFGA 3LANA 3E9LA 1BWEA 2Z7JA 4JI0K 3BBFA 4CNZA 3ILIA 3B54A 3HL8A 1N5WA 1SI9A 1VC0A 4BQZA 4PWDA 1ZJNA 3C2KA 4ZCMA 4PPZA 2OPRB 3H4BA 4X4UA 2Q97A 1FJEB 1URRA 3DRXA 2QWPA 4OLOA 1ZQGA 4ILJA 4NYNA 4LFAJ 3HKZC 3I9ZA 3OL9A 3VQAA 5HMWA 4BRQA 2V50A 3CIPA 1ZJMA 2HK2A 9ICIA 1H2VZ 3Q8VA 4N76A 4DV3J 1RUSA 5KL1B 1FKPB 1QSSA 1WKKA 4CLSA 4M5DA 5AQQA 2CNOB 1K6YA 1B7YB 4GRSA 3TAGA 1HBMB 5HMXA 3F2DA 3QSIA 4P4MA 2GMLA 4OI0A 5M1OA 1U0HB 4KHRA 3TSUA 1TL1A 1FERA 3RJEA 1WOQA 5K14B 3VQ5A 5JVGL 2W9CA 5HLFB 5L1KA 4JI1F 3HSTB 1FO4A 4DUZF 4FWNA 3L2RA 2OEKA 4CJ5A 3OPKA 4IG3A 3WBZA 4AYBD 1SJ3P 3MX2A 3VQQA 2HAFA 4DFKA 4B3TK 4IOCL 1NPPA 3LP0A 2OTJS 2EQYA 2CFXA 2HB5A 1EWRA 5IINA 4EYHB 3T6JA 4XIUA 1JLCB 2V68A 4UAYA 3BF4A 3D6MB 4FNHA 4MQ3A 4AHSA 3FK4A 5DG7A 2CQHA 4ISFA 4IL6U 4I29A 4LF9K 4CZHA 2NLXA 3DEEA 3TABA 1FWPA 5J2DA 5KGWA 3LPUA 4AUKA 4MO4A 1GOCA 1HR0F 4DV2K 5DG9A 2HNZA 1WC4A 2FF3B 2IOHA 3I56N 1U49A 4UBCA 2VJ4A 1ZS6A 2YX7A 3DOLA 2MZJA 3D67A 5CEHA 4PABA 1PUZA 1RK8A 4WQ4C 3SQ1A 1U2CA 2F44A 3D2QA 4ES3A 5KFKA 2X1BA 4H0YB 2DNMA 4WFAQ 4B8AB 3MC1A 5I3UA 4TURA 4F5OA 3A0BU 2FBYA 4C3LA 1I94K 2E8PA 4K2JA 4HKQA 2GNKA 2Q2RA 5DJBA 3U27A 2NZCA 1S0VA 2LKYA 3ADAC 5F8JA 3O4WA 1KNZA 5AI9A 2ZUGA 4LF8J 5KFFA 2VONA 3HCXA 2OXOA 4WF9L 8ICXA 3A12A 1RGVA 4HTLA 2DR6A 5J2GA 1HWKA 3KLHA 5LY3A 2GEMA 2P9NA 4MK8A 5EXWA 4YUDA 2CQCA 4OV1A 4H4OA 3IDHA 1KR4A 3H4DA 4DQSA 4OYPA 4DR2K 4K4WA 3LALA 3O80A 1Q5VA 4AT1B 4KLFA 3PVXA 3NF9A 1CVJA 1ZD3A 3L2UA 2BOPA 1IKYB 4OI3A 1Q82O 1VOMA 2R4FA 5J2BA 2V4JA 2CQ1A 4GVLA 4DR1J 2A5XA 3JSYA 5GIOA 3WC2A 3MECB 3VAHA 1VQ7S 4E1MA 4X65J 4FOEA 3T5LA 3K8VA 3EDQB 4C80A 3RZAA 4M3YA 1ZQCA 2HHHK 2NS1B 2UP1A 1GLJO 4IR1A 3ZSYA 3NGRA 2EFQA 3I32A 1WSGA 3L2WA 4MEXA 5J2MB 2JX2A 1S0MA 4K42A 1PVRA 4K5SA 4P10A 1BQMA 4LFAF 3AVCA 3BS7A 1IQTA 3ZSRA 5JRTA 5GAEU 2P9KA 2W8KA 3QICA 4IXCA 3IUCA 4S0MA 1QSYA 2OWOA 1M5VC 3Q8PB 2V7YA 4P4PA 4C0BA 3TX8A 2DGTA 4ZN3A 3PMLA 3WKCA 3QE9Y 1JJ2R 3VEYA 1EXQA 2CVEA 1SZ2A 3BS5A 3S7RA 4XPCA 1Z1BA 4OX9J 3N4PA 3FYHA 1BCMA 1KLNA 3QBCA 1Z1VA 4I7FB 2O3DA 2BM0A 4JYAJ 5KFXA 1AW0A 1UCVA 4US9A 5K9FA 6AT1B 4CH1A 1GLBG 4IFEA 2XB2D 1LEOA 4M5MA 3A2FA 4GW6A 3IBPA 3IM8A 1ZQVA 3NAEA 1ED1A 2V4RA 4OYZA 3R97A 3P39A 1HNIB 1X4GA 2P35A 2IRUA 4YR3A 7ICLA 1NOYA 3R5AA 1FW6A 2PDAA 3CIMA 5AE1A 3O4QA 4CF2A 2YKQA 4EGLA 3DI6A 3NOGA 4DCPB 1BPYA 1JJCB 3HD2A 3KLIB 4CYUB 2F65A 4I2FA 4JAXA 1FIQA 4PG6A 4ZA1A 1S5LU 3D7EO 2NYVA 3GOIA 1URJA 4OO1J 3MM5A 2WSFC 1R59O 3HHDA 3SFGA 1ZQHA 2ZH1A 7ICEA 3BPDA 5B0CA 3QETA 4NLNA 1J5EJ 3F44A 5AIAA 1FK9B 1JX4A 2P9PA 2BDPA 5KFGA 2DH9A 4ECVA 1N34J 4O5BA 3MDFA 2VPXB 3QGPA 3M30A 3PO5A 1R43A 1RBRA 4IWVA 3W2VB 2ZDPA 2FBVA 2RF2B 3OYAA 4ZVQB 2VCPA 1AFJA 1FFWB 1VQ5S 4LSNB 5FPNA 1BHLA 7ICFA 4KN7A 2QYCA 1SJQA 5HQMA 1C0UA 3QUTA 2RU3A 2KKPA 2GUPA 5FJ4A 3ILLA 1DJ0A 2LM1A 2JZ5A 1JJ4A 4RQ7A 3LVWA 4PHEA 3MMVA 4R25A 3IBFB 3CVKA 3W66A 4UASA 1WC5A 3QZ8A 3OFFA 3ZSZA 4Q2MA 3VOVA 4IQUA 4R65A 4Y3CA 2QXFA 5AI8A 3BGUA 5KTQA 1CULA 1NJXA 3FQLA 4NLVA 2Z4PA 1PK1A 4I27A 3S1TA 1WG5A 3FSYA 3IRXB 2FIUA 2QO3A 2DCUB 4RQ3A 2QARB 3RVCA 2DBYA 4JI5K 3DNCA 4C8LA 1FX4A 2IYIA 2ZD1B 1UEVA 1Z25A 1RP5A 5DZ7A 3NVWA 1L7OA 2XVTA 4AHRA 5G0RA 3HF5A 4BY9C 4ILLA 1XU4A 4DR1F 4ED7A 1S57A 1O8BA 5E3RA 1ZETA 2OJ3A 2ZIXA 3SQGA 1IJJA 2VG5B 4NV0A 2WTUA 1NGJA 1E6VB 3TSQA 7ICPA 3UKUB 3C21A 8ICJA 1IBLJ 3SQ2A 2IVPA 4B9MA 3E01A 3L09A 1L7NA 2XIDA 5KT4A 4X4PA 2GQCA 2BZ2A 3ZZ0A 5LSLA 5IV3A 2QB0A 5AT1B 3KHHA 4IBNA 1HUOA 1ZQWA 3K1RB 2K60A 1C20A 4P72A 3OS2A 2C2RA 4QS8A 4LBHA 3R6GB 3CCQS 2HK3A 4AHTA 2OUGA 3DLEB 1R8AA 3JTNA 1CJUB 1LWEB 3ZZPA 7ICSA 3D5MA 4PL2A 2QTWA 2HHTA 3HO1A 4CH7A 3R9LA 1ZZNA 2GVDA 4OX9F 3M32B 4H4MA 4BXOA 4PGXA 3UKRB 4WFAL 5AQJA 4BJQA 2K7JA 5ALPA 2J9DE 2IBOA 1QUVA 1IM4A 1FVQA 1ECWA 2YWKA 3RMAA 1S76D 3HT3A 2IA0A 4OFZA 4B9QA 3ONNA 4JI8J 5AKIA 2QMUB 1HW9A 3Q0AA 3FJ2A 1NRKA 4KSEB 2H3QA 4KJIA 3FKBA 1S10A 1WG1A 1V5IB 2AIRB 4WJBA 3I55S 2YBVA 3EN9A 2D6FC 5ETOA 2EKNA 1VQMN 3DFEA 4KQZA 2YQEA 4OJRA 5EX5A 2J0XA 3MCMA 4JV2A 2Y9TA 2ZTDA 2HBYB 8ICPA 3VQ8A 2Z57B 4FF1A 5LSOA 1ZQYA 2Q0UA 5CR4A 4TNOA 1O5JA 2KE7A 3P96A 4J9VA 2V2ZA 1J5EF 3ZT2A 3CC7N 4V19J 4P2SA 1N34F 3KLFB 2EBEA 2P51A 2EZXA 3LQVA 2LYHA 2NQPA 2K8GA 1IR2A 3THVA 2BRKA 4JI3J 2Y8YA 5J2PA 4NEYA 1WG8A 2QA2A 1T9UA 1VBZA 3LTOA 4L73A 3N5FA 4NM1A 3GG4A 4GVEA 1IQZA 1S7HA 2K4IA 3H42A 1MDUB 2F3NA 4LZDA 2OEMA 4JK7A 1RWMB 5AI4A