1U4BA

Extension of an adenine-8oxoguanine mismatch
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 213
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u4bA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u4bA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u4bA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u4bA01
3PO4A 4B9VA 3RR8A 5L1KA 3ZD8A 2YNIA 5KFQA 3NDKA 3QNNA 4Q5VA 2ZJ8A 2KW4A 4ECYA 1JKHA 4H8KA 1RYRA 5KFPA 4FW1A 4ED0A 1ZBFA 4I2QA 3VQEA 4E1MA 3KHGA 2Y1IA 4FO6A 3K5OA 1RDBA 1QSYA 8ICGA 1A76A 2KZ3A 2R7YA 1B43A 4LY7A 1RPLA 1FXXA 3DLRA 4M6WB 3LWMA 4YXJA 1MSWD 2RDJA 1PZNA 2O4GA 3K2PA 3Q8MA 3ZSZA 1ZQSA 3I8DA 3VA3A 4AHSA 3QIPA 2XC9A 8ICLA 1WSFA 4W5RA 4QCLA 4TQRA 4KLSA 1WSJA 4RQ0A 4P4OA 5CA7A 3ISCA 4DMNA 1KLNA 9ICOA 2X6NA 4KO0A 4KI4A 4TUQA 1S9GA 5I3UA 2ATLA 3ZSYA 1RT5A 1RXWA 4IRCA 5FRMA 4CEZA 4JS5A 2VG6A 4I2HA 9ICPA 3BGRA 1UT8A 3U6FA 4NM2A 4FLYA 5KG2A 4ECUA 3DLBA 1BI4B 1XO1A 3SUNA 2W8LA 3MGHA 8ICEA 4FJ9A 4QZBA 4CFAA 3NF7A 4UAWA 5KFZA 2E6LA 3O4QA 4C8KA 4JWMA 1UOCA 3OHBA 9ICSA 1DOQA 3C5GA 3LP2A 4W5QA 4GVMA 2XRIA 3NF8A 1JL1A 4G1QA 3LP3A 1VSLA 5KFXA 2PFQA 2P1JA 4FK4A 4CEOA 4Z4CA 4TQSA 4ELTA 4O3SA 3H7IA 4LSNA 2ZUCA 1IH7A 3AU2A 4M9HA 4CHYA 1NJWA 1SL1A 4J9SA 4RW9A 3TI0A 1WAJA 1KCFA 3MEEA 4PA1A 1BPXA 1TVAA 1JMSA 3PVXA 2FPLA 2I1QA 1LAWA 4MF2A 3ZT1A 1JLFA 2DFFA 1ZJMA 3VQ9A 5KT5A 4GMJB 4DTSA 3V81A 5FDLA 1B92A 2W8KA 4EYHB 4O3OA 1NOZA 5DG8A 2HNYA 2ZTEA 4F92B 1BI4A 5KFTA 2AGOA 3V7KA 1TKTA 3ZDBA 3AA5X 3ZT2A 2YV0X 3LPTA 3BQ2A 2QXFA 3OYAA 1V9PA 1CXQA 4CHNA 1KVAA 5J2NA 2BCVA 3T5JA 1R0AA 4CJ3A 3CQ8A 5D46A 3DRPA 1JLEA 8ICFA 3WNEA 2IS3A 2R8KA 1MC8A 4DU4A 2NRZA 1WN7A 5KFAA 4E7IA 1L3SA 9ICHA 1D8LA 1XU4A 3EWAA 3RB6A 3LAKA 1UWBA 4FK0A 1TL3A 4PGQA 5KFIA 7ICUA 5J2QA 1Y88A 4QWCA 3KLHA 4FM2A 1QQCA 4YFUA 4H4OA 4GXIA 4YP3A 5D49A 4BXOA 3DRRA 3VQCA 1UA0A 4YG2A 3M9OB 4I7FA 4M9NA 1JL2A 3O3GA 4YFKA 1NK4A 1COOA 5DKWA 4E7JA 4HHTA 3RJEA 3DI6A 4PPXA 2XY8A 1ZQVA 2W9CA 7ICKA 1ASUA 3DOKA 4DL2A 1ZBUA 3LPUA 5CB1A 1TL1A 5KFRA 1RBUA 4OGCA 1CLQA 4XA5A 4CJ4A 3GQCA 3AO5A 5DK5A 7ICOA 8ICAA 1N56A 2YNFA 4C8LA 4FM1A 1Z00A 2J6SA 1VK0A 3CM6A 3OYMA 4KLMA 1XSLA 1WSEA 4AILC 8ICVA 4B08A 3AVAA 4L8RB 5DBBA 4ECVA 1TKXA 3GV8B 2AJQA 2AU0A 2C2EA 2E4LA 3RB0A 7ICHA 1TV6A 4KLTA 3ZSXA 1HRHA 3ISDA 5IILA 3HWTA 1LAVA 3KKSA 4KHSA 2FLLA 4KLOA 3SV3A 3TWHA 4DOAA 3OYJA 4YMNA 4AHVA 8ICXA 2A1SA 3PUFA 4ELUA 1ASWA 2VG5A 3O4NA 3RMBA 2FLPA 4J9LA 1TFRA 5HHHA 3HPGA 4PHAA 3VQ7A 3K5LA 3Q8PB 2FBXA 4EYIB 5J0UA 5KFUA 4I2GA 4DTOA 4J2EA 4HVJA 1DTTA 3N97B 3B6OA 4H4MA 1BPZA 5J2GA 4QZ8A 1GOCA 4M41A 1S9FA 2DPIA 3MEGA 1VRUA 4KLLA 1IM4A 2BGWA 1QSSA 4RPYA 1J5OA 2FMSA 2O4IA 3SQ1A 3QE9Y 3KIOA 5J2BA 3NGDA 4O3RA 4UAZA 4E19A 3NBPA 2BQRA 3SCXA 3OYBA 4CEFA 4FS2A 3MABA 3HPOA 1FKPA 3OYGA 3BDPA 5KT7A 3SQ2A 3K58A 2IHNA 2WTFA 4KKOA 2Z1HA 3KK2A 2G8KA 2W9MA 1ZQCA 5DDMA 2AGPA 1Q8IA 4CHZA 2KZZA 4Z6FA 3KK3A 3ZSRA 4MF8A 4CJFA 3QERA 4MFAA 1NJYA 1S9EA 4OVLA 9ICTA 2BANA 1KFTA 1WSHA 2NUBA 1XI1A 8ICNA 3TAMA 4O3PA 4I2IA 1QLNA 4YR0A 3LK9A 2JZBA 2YHAA 2OPSA 3QEXA 9ICCA 3PX0A 4KLJA 3NFAA 4QZEA 9ICAA 1LW0A 4YVZA 3O3HA 2DFHA 1RDCA 2IBKA 2OPRA 1RXVA 2FLNA 1RT3A 4B9TA 4OLBA 2G8VA 1JX4A 3SI6A 4QWEA 5KG1A 4O44A 3PW7A 1A5XA 4F5OA 1J53A 1RBVA 5J0PA 5CP2A 5KT4A 5DG9A 5IIOA 2KN7A 1W0HA 2B5JA 2G8IA 5IIKA 4M3UA 4FJ5A 4QOZB 5JUMA 3EY1A 3V6KA 4KN4A 1C0TA 1T7PA 3IM1A 4Q44A 4ED6A 1ZBIA 2JEGA 3V9UA 4CJTA 4O5BA 4ZH4A 4EP4A 3RWUA 2ASJA 4EBCA 1WCNA 4YMOA 4DFJA 8ICJA 5EWEA 3OJUA 4F4YA 4DL4A 1NK9A 3VQAA 3RJGA 1U4BA 5DMRA 3C2MA 3T3FA 4K8XA 2WOMA 4DSJA 3ZSOA 4NCGA 4CFCA 4CE9A 4BDZA 1CZBA 5DQHA 4KLDA 4KHNA 9ICRA 4Z4HA 2ZUBA 1O1WA 3QEBZ 5FROA 1X2IA 2P66A 3HSTB 3SZ2A 3OYFA 1S6QA 2P51A 2D5RA 3OY9A 3QESA 1EX4A 3TARA 4XQ8A 2HW3A 2AGQA 1RNHA 3AVGA 2QKBA 3F9KA 2OPQA 4Q8EA 4NYFA 5JS1A 4NM1A 4AH9A 3RH6A 4Z4IA 4PY5A 2R8JA 2Z1GA 4UB5A 3NGIA 1IG9A 1C1BA 4ED8A 2I5JA 4QZFA 2BPFA 3NCIA 4KRFA 3ASMA 4DTUA 1U49A 2H5XA 1NJZA 1RYSA 4FZZA 4R64A 4N56A 4FLUA 4E7KA 4Q0BA 4DU1A 4M0AA 3EPGA 3LANA 1LV5A 4DSLA 2ITGA 4R8UB 3KK1A 1NKBA 4O0JA 4ZTJA 3LDAA 4QZGA 4F5PA 4FJGA 4KI6A 3WNHA 1NK8A 4FK2A 4CEAA 3NE6A 5DB8A 3ZDAA 5KFWA 3RAQA 7ICLA 5JS2A 4JRQA 4XIUA 3V9ZA 3BQ0A 4DF8A 1NKEA 1S77D 3ZDDA 4I2JA 4O5KA 2EHGA 1KDHA 4PUOA 3V9WA 4W5OA 5IIMA 4DG1A 3UQ0A 5SWMA 3RJFA 3C94A 4Z4EA 1EXNA 1ZQNA 3HL8A 3KLEA 2NRVA 3NH1A 1ZQMA 1BQMA 3KD1E 4ECZA 4KHUA 1UAXA 1KLMA 1ZQDA 1ZQBA 4TUPA 1K1SA 4J2BA 9ICJA 3MEDA 3OYCA 9ICFA 3OYHA 4KHWA 4O9MA 4PHEA 1ZETA 2VA2A 3OYDA 3AA3A 3LAMA 4DLEA 3H8WA 4N5SA 4MFBA 5HRSA 3RRGA 4GC7A 3L2VA 1UA1A 4CF2A 4ED2A 3DRSA 3BQTA 4ED3A 4K4GA 3U3YA 2IOCA 5DLFA 2UVWA 7ICEA 4CK1A 5F9LA 1TAUA 3MXJA 4Y1DA 5KG7A 2JEIA 1CEZA 1C6VA 4BACA 1NJXA 3QLHA 1CUKA 3QETA 4CEEA 4CIEA 1XSNA 2LSNA 4CEBA 4FJ8A 1WCLA 4BE0A 2HHXA 1ZJNA 2R8HA 3UXPA 4F3TA 3OSPA 1FK9A 1BISA 4G3IA 4KPYA 5KFJA 3OS0A 4CGFA 1XWLA 5HRPA 2OWOA 1AROP 1ZQLA 2BCQA 4ECXA 1LB2B 2IHMA 3ZT4A 5HRNA 4ICLA 4F5NA 2YNHA 1B9DA 1D9FA 5KFDA 4QZ9A 4FM0A 1BCMA 4E7LA 3H4BA 3RBDA 4N76A 3M8RA 1SKSA 3CFRA 2Z1JA 8ICMA 1QE1A 4JUZA 3L3UA 2HHVA 3GFKB 1D9DA 1IXRA 5C24A 2WONA 3GIIA 1XC9A 4NYNA 8ICWA 2JEFA 1RILA 4CF1A 1BVSA 1D5AA 4CF8A 3BQ1A 4YNQA 3H8JA 3UXNA 1KVCA 4RPXA 3GIKA 3QEWA 4RNOA 7ICSA 4FYDA 4CECA 4I2BA 5CYQA 3ULDA 4EBDA 3NAEA 2YNGA 1RT7A 2DPJA 3RMCA 5J1EA 5KT3A 4DSIA 2LYHA 5I42A 1IKWA 3QZ7A 4MEXA 3C2LA 2JZBB 3H8SA 4YN4A 3MAQA 3KHRA 1KRPA 1T03A 3AVIA 2ALZA 1JN3A 4CGDA 2X74A 5J2JA 8ICRA 1REVA 3NGYA 2VANA 2GBZA 4FXDA 1CXUA 1ZQEA 3PO5A 3HP6A 2W42A 5J2MA 2DY4A 3RJKA 3PW2A 3EZ5A 4IQVA 4AHCA 3D45A 3QO9A 4DO9A 4UAYA 5DBCA 9ICNA 1T8EA 4RG8A 2FPKA 4PWDA 7ICQA 5CJ7A 4FW2A 4HCCA 3SUOA 4I27A 5KFSA 5DB6A 5DQIA 2W9AA 4BGDA 4UBBA 1ZQJA 2NRTA 1XHXA 1LWCA 3SV4A 2BCUA 4BWMA 5EOZA 4PH5A 4LVSA 4B9LA 4CHPA 4B8AB 3AVCA 4DOCA 2OZMA 4IKFA 3JPNA 3UQ2A 1TK0A 1HJRA 2FC0A 4Q43A 3ETLA 4OGEA 4F5RA 1VSEA 3JPQA 3G6YA 4FBTA 3PW0A 3TANA 3ZT3A 4K8ZA 4R63A 4DFMA 2XCAA 4O5CA 4M42A 1VSHA 3DLKA 1ZQFA 1RCHA 1S6PA 1RTIA 2G8HA 1ZQOA 3TFSA 4KITB 2X78A 4I2CA 3E2EA 2HHWA 3GIJA 4YCXA 3NTUA 3AVBA 4JV0A 1U48A 1S97A 3IHQB 3SJJA 9ICVA 1HYSA 2W9CB 4KLUA 4GXJA 3C5FA 4KREA 1K6YA 3T1AA 3V9XA 3RB4A 2ZQBA 1YTAA 3C6UA 3OYKA 9ICGA 4FJHA 3CFOA 5IIIA 4EEYA 4CGGA 4XUSA 4F4KA 4O0IA 1Z26A 4KFBA 1MQ2A 4KLFA 5EWGA 1HJPA 5EWFA 1WLJA 1BQNA 1ZQHA 4FS1A 3V6DA 2B21A 1I39A 3K4GA 2PFOA 4FJJA 2F1IA 3AVMA 3SQ0A 3HJFA 3MR2A 3A2FA 4R5PA 4R66A 5J2EA 3LZJA 3HO1A 3RR7A 5KI6A 4CJWA 1BPBA 1IO2A 2XHBA 5KRSA 4M9JA 5J2FA 8ICTA 1TGOA 4NXZA 3KLFA 3RRHA 2ZD1A 2VA8A 1RT4A 1NOMA 3ZCMA 2P5OA 3UIQA 3T5KA 5KFEA 3PR5B 3MECA 2R8IA 3TFRA 2D0AA 4EZ6A 1ZQWA 4PHDA 2BKEA 2FBTA 4FLZA 4KTWA 3MR6A 3IG1A 1HYZA 1S0MA 3B6PA 5CR0A 2X6SA 3DYAA 4QZCA 1NK7A 3QEIA 2A1RA 5HRRA 3ZDCA 3ZD9A 2BHNA 4YMMA 1WAFA 1L3UA 1JXLA 1LWFA 4CJEA 4CEDA 8ICSA 3MGIA 4FZYA 3C2KA 2ETJA 3AO3A 4NLKA 4DFKA 1KVBA 2YKNA 5HP1A 3AVJA 4CJVA 4FCYA 4W5TA 4DTJA 2ZJ5A 7ICJA 1Z25A 4HUGA 3VQBA 2ASDA 2BQ3A 5HP4A 3S3OA 3E01A 3I0SA 3L3VA 1Z3EB 8ICHA 3V1RA 1VSFA 4QZDA 4Z6DA 3AVKA 4LZGA 4CJKA 4DTNA 5DGAA 3RAXA 3GIMA 3RH4A 2XY7A 3V72A 1HUZA 5DLGA 1VSKA 4YR3A 1VRTA 8ICYA 1X9WA 3HX0A 1S76D 1JLBA 3MXMA 1HQUA 2HB5A 2G8UA 3JPRA 4RQ3A 1GOAA 2Q0ZX 4OPKA 4Z6EA 2MUTA 3OVNA 2Z1IA 5HNKA 5L1IA 3SUPA 5T7BA 8ICCA 2EX3A 9ICKA 1TK8A 4CJLA 4P4MA 4C8OA 1RT1A 1WSGA 1YTUA 5DBAA 3PW4A 2BPCA 5KG6A 5C5JA 1VSDA 4OKEA 3ZSVA 2F96A 3SYZA 3RTVA 4YQWA 1X9MA 2A1JB 4BWJA 4F4XA 1QSLA 3P1GA 5CYMA 3HM9A 3T5HA 4EP5A 3GV7B 5J0SA 8ICOA 4CJSA 3C95A 2GUIA 1TV9A 5HHIA 3OS2A 4RW4A 4YD1A 5J2CA 3Q8KA 1S1XA 3KHLA 5J0XA 5CY4A 1QTMA 3HW8A 3V9SA 4CIFA 3MDAA 1RTHA 1YT3A 3LDSA 3VN5A 2IGIA 4DSKA 1S10A 1D8YA 4BE2A 1XS9D 5J2DA 1RTDA 4FJMA 4O55A 2PY5A 4CGHA 2GWSA 1ZQAA 4M3WA 4JLHA 3S9HA 3D0PA 4YR2A 4FJIA 7ICVA 3Q8LA 4LSLA 4NLZA 1KSPA 4I28A 1MU2A 4TUSA 2ZTCA 5L9XA 4F50A 3O3FA 4Z6CA 4I2AA 4XRHA 2RF2A 4QZAA 4FLXA 4DTRA 2OYQA 3JPPA 4M04A 3VQDA 4CERA 5HBMA 1IKYA 4KB1A 4RUAA 1C0UA 9ICMA 3C23A 3RBEA 2B6AA 1BL3A 4CFBA 5DGBA 4DFPA 5D4BA 3M8PA 2AQ4A 2HMIA 1GOBA 2J6UA 4F2SA 4M9LA 1I3AA 1NKCA 4I2DA 4GC6A 4UB3A 1LW2A 4CHQA 4J9QA 4ECWA 3FFIA 1ZQRA 1X9SA 2KTQA 4R8UA 4FZXC 2ZTDA 2YKMA 3THVA 4KHYA 3PX4A 1T05A 4QAGA 5SZTA 4LH4A 2E6MA 4LZDA 3Q8RB 4KHQA 4B9NA 1L3TA 4QW8A 1TKZA 3OYEA 3L2QA 5KFYA 1HNIA 1SKWA 4KLIA 3MFHA 3TAEA 1BPDA 2XY5A 1S1VA 1NK5A 4CEQA 2V4QA 3RJIA 1BPYA 3L8BA 5KFMA 4IDKA 5CZ1A 4WE1A 3HPHA 4DL6A 4BXOB 3PV8A 3KHHA 4MEYA 4RT3A 4ZTFA 4Z4FA 4IR9A 5J0WA 3F73A 3TQ1A 2G8FA 1ZQIA 2C28A 4NLGA 2VWJA 1JLGA 2BPGA 4RQ1A 4W5NA 4PGYA 4Z4GA 1BIUA 4K4HA 3DMJA 2FBVA 3ISNC 3V7JA 4RQ2A 2F8TA 3AVNA 9ICLA 3S3NA 7ICPA 4DQRA 5C25A 1ITGA 4CJRA 2GV9A 2PYLA 3CM5A 3KLIA 1TK5A 9ICWA 2Y1JA 1TKDA 4IFYA 4FJXA 4RQ8A 1C1CA 3GILA 5KT6A 3AA4A 3ALYA 1K1QA 3PMNA 1DGSA 8ICKA 3TR8A 8ICBA 3AO2A 3DLEA 4J9NA 5J2HA 3BJYA 2BR0A 3V4IA 3K59A 4OJRA 1L3VA 4DU3A 4DSEA 2IMWP 1HQEA 8ICIA 3AUOA 4KB0A 4OKJA 9ICUA 5DQGA 5CHGA 3MR5A 5DG7A 4KLHA 4FLWA 4J9KA 2HNZA 1ZQQA 4RU9A 4M9GA 4M6WA 5DDYA 3GDXA 3V6JA 5FRNA 4IRKA 9ICXA 3PMLA 7ICRA 2RN2A 4ECTA 3KLGA 4DQIA 3QEAZ 5E41A 1TVRA 5L1LA 3AVLA 7ICIA 4CGIA 4ECSA 1RDAA 5KRTA 4M3TA 3G6XA 3SUQA 3HYFA 2W9BB 7ICFA 3SI8A 1S0NA 3NF6A 4JK1A 1S5JA 4F3OA 4FJKA 4FJLA 4RUCA 2VA3A 4Q8FA 4KLQA 3DLGA 3UXOA 3OYIA 4CK2A 5J29A 1ZQYA 2FPMA 4MFCA 3CYMA 4JS4A 1U47A 4RW6A 3K5NA 3SPYA 3S3MA 4IQWA 1A77A 4UQGA 1C1AA 1LWEA 1W9HA 1X1PA 4E1NA 4DQQA 2P5GA 1TAQA 4CGJA 1HUOA 4E3SA 4FJ7A 4IRDA 2BDPA 3MXIA 1RZTA 4M3XA 3JYTA 3LWLA 4QZHA 3IRXA 2PXIA 4F91B 1U04A 4KTZA 2B4JA 1SKRA 2R8GA 4DTXA 4I9QA 4MFFA 4ED1A 4FBUA 2QKKA 2AQ0A 5J0RA 1ZQGA 3M9MB 3OHAA 1KEJA 5CWRA 4M3YA 4I2PA 7ICTA 4E0DA 4B3OA 3VQ5A 3L2WA 1ZQXA 5D3GA 3M8QA 5KFKA 4CJUA 4M47A 2PYJA 7ICNA 3MDCA 3MR3A 5J0TA 3QINA 5J0QA 1HPZA 4DEZA 4DL3A 2G8WA 5KFHA 4DQPA 3QEPA 4KMUA 5KG3A 4F4WA 3IS9A 2PI4A 1ZBLA 3K57A 3M9NB 3K75D 1YVUA 4B9UA 3JPSA 4B9SA 2DFLA 4RQ6A 1HNVA 4EZ9A 3RJJA 1NOYA 2I9GA 4J9RA 3EW9A 5HLFA 2XGPA 3WNFA 2BCRA 1S1TA 4C8NA 5KGXA 1U9LA 4Z0UA 4QWAA 4O3QA 1SUQA 1H38A 1A5WA 5KT2A 3L2UA 3HP9A 4PHPA 4IR1A 3JPTA 5J2IA 3AO1A 3NHGA 1S1UA 3P83D 1S1WA 2PZSA 2FMQA 4LD0A 4P4PA 3JPOA 4KAZA 4UB1A 5DB9A 3B0YA 1BGXT 1N48A 3SQ4A 4CJ5A 3ITHA 2M9NA 4CFDA 3OGUA 3N4MB 3AVHA 1HMVA 1JLCA 4IQUA 4AHUA 5KFNA 1J54A 5BOLA 1T4GA 4FLVA 3G0ZA 3UPQA 4X5VA 1RBTA 4E89A 5KFBA 2ATQA 2UVRA 2FBYA 1XHZA 4NY8A 1F21A 4JV1A 1QHTA 3NH0A 9ICBA 4RT2A 2P6UA 3TAGA 1T3NA 4TURA 2ISOA 4F8RA 3HVTA 4DTMA 3H08A 4I29A 3IAYA 2JEJA 2J6TA 3LP1A 4JRPA 4FVMA 5KG4A 4F93B 1VSMA 2ZE2A 4CK3A 5DB7A 1C7YA 1ZBHA 3V6HA 3OYNA 4N47A 1BPEA 4DTPA 4UB2A 4F4ZA 2C2RA 2ZUDA 2MUTB 2DTUA 2HVIA 3NH2A 3HVRA 1Z00B 2Q3SA 2UVUA 4CHOA 4O3NA 2HVHA 3G6VA 3HT3A 3VQQA 3L2RA 4KLEA 1JLAA 2OZSA 5J2AA 3ZDEA 4I2EA 3KD5E 3CG7A 2IC3A 5KFCA 4O5EA 4QW9A 2HHUA 2W9BA 3TAPA 5L1JA 1ZQKA 2XGQA 1Y97A 3VQ6A 2FMPA 4NCBA 3SPZA 2F1JA 3ZSWA 2RKIA 5KFLA 2OPPA 4HYKA 1XSPA 1SL0A 5J2PA 8ICZA 2IA6A 8ICUA 1NK0A 3JSMA 4QZIA 3WNGA 2C22A 2OA8A 1EKEA 3ZSQA 4DOBA 2C2DA 4RQ7A 4PQUA 4NLNA 1EETA 4AHRA 3OYLA 3PX6A 3OS1A 4AHTA 4RNNA 3V7LA 3K5MA 2HHQA 1A5VA 4RW8A 2A1JA 4DL5A 2ZJAA 3RH5A 5KFGA 4IQTA 1JLQA 4OKKA 1DTQA 4OLAA 1RBSA 5J2KA 4P2HA 4TSXA 2F1HA 1HYVA 4O4GA 5HMLA 4BE1A 5TZVA 4IFVA 1CZ9A 2ISPA 1KFDA 4RPZA 3AVFA 2D0CA 4DL7A 2HHSA 1B9FA 5C42A 2P6RA 2KFZA 3QZ8A 2JLEA 4M45A 1VSJA 1C0MA 1N5YA 3C6TA 3LALA 1BHLA 4BDYA 4ELVA 3T5LA 4ECQA 3CFPA 4ECRA 5KG5A 5KTQA 9ICIA 4FJNA 3ISBA 8ICQA 4Y1CA 3C1YA 2IAJA 3PNCA 3KTQA 1RT2A 4I2FA 5CZ2A 4J9PA 1B22A 3C1ZA 4HTUA 2NRXA 4GXKA 4MQ3A 4B9MA 5J0OA 3AU6A 5KFOA 4RZRA 4DQSA 7ICGA 3U3GA 4IBNA 5KFFA 4J2DA 3MFIA 3C21A 4NCAA 4J2AA 3PY8A 5K14A 4YXMA 4JV2A 3EPIA 3HXMA 1BIZA 5HMMA 3Q8QB 2V4RA 5BPCA 1FKOA 5HROA 2ASLA 4B8CA 3FDSA 2KZMA 3NGZA 4KLGA 2F8SA 2V9WA 2BE2A 3QNOA 5IIJA 4YD2A 3Q8SB 3VQ4A 4N41A 3RJHA 2IDOA 3DOLA 3VA0A 3PW5A 3GV5B 3AA2A 1G15A 4GW6A 1ZQZA 3RMDA 1MQ3A 1ZQPA 8ICPA 3PR4A 1Q9XA 3NF9A 4KN7A 5BOMA 1JXEA 3RMAA 4DF4A 4J9MA 1S0OA 2PFPA 4CF0A 1QS4A 3B0XA 9ICQA 4RNMA 3ORYA 3EYZA 1EXQA 4HCBA 2RDIA 4I9LA 3DM2A 2XY6A 2BCSA 2QK9A 1NK6A 1WNSA 7ICMA 1ZQUA 3H4DA 2KQ2A 1WSIA 1BCOA 4KV8A 3KJVA 2PI5A 4EBEA 4M3RA 1KFSA 1JXBA 4ID1A 2DFEA 3H40A 3FYHA 1U45A 4QWDA 4E7HA 1KTQA 2JGUA 3AO4A 1J9AA 2RPIA 1DLOA 3T19A 1RDDA 4Q45A 1S0VA 5EU7A 2XCPA 3G10A 1ASVA 3TAQA 3RB3A 1ZQTA 1L5UA 4M2YA 3ZT0A 3V1QA 3TAFA 4DSFA 4GLXA 2HHTA 4C8MA 5IINA 4LH5A 2VWKA 5F9NA 3OJSA 3I0RA 3LZIA 4IG0A 3OSNA 1ZYQA 3MBYA 3VQPA 4FLTA 3HK2A 1EP4A 2HNDA 4OPJA 4UB4A 2PFNA 3VQ8A 4ED7A 4DS4A 4HUEA 4HUFA 5KFVA 4CJPA 4F5QA 4CJQA 4JWNA 4RW7A 4PGXA 1IKVA 4RQ5A 4CF9A 1Q9YA 4F2RA 1UT5A 5KG0A 3LP0A 4CIGA 9ICEA 1N6QA 3SNNA 1SL2A 2KFNA 3P5JA 4RQ4A 4K4IA 4KTQA 1SV5A 4R65A 3KKRA 2NRWA 2BGGA 4DWIA 2YHBA 2XO7A 2VG7A 3QEVA 4DS5A 4M3ZA 1RBRA 2BQUA 4CESA 3DLHA 4CCHA 4J9OA 5KGWA 5J0YA 2MAXA 4BDPA 4IG3A 3QIOA 1IKXA 3V1OA 1JIHA 4ZHRA 3M8SA 4UBCA 2D0BA 1SZPA 2UVVA 1RTJA 4QWBA 4DLGA 1RT6A 3AV9A 3TABA 1VSIA 4ID5A
chains in the Genus database with same CATH superfamily
3THPA 3RR8A 5L1KA 3ZD8A 4NLXA 4RWWA 5D78A 1U6BA 3Q7BA 4FW1A 4I2QA 3AD7C 4E1MA 2E8AA 4YOTA 2A6MA 1X5PA 2KI2A 8ICGA 4JD2B 2K4PA 2GW8A 3D6MB 4HKQA 4LY7A 2KYZA 2YN4A 1RPLA 1BNPA 4WZMA 2O8DA 1HNWJ 4WQ4C 2B6AB 3MMJA 4M6WB 2CQCA 1PZNA 5DM7Q 2O4GA 4CD1A 1YRXA 1M90T 2VJVA 4OCZA 3D3BJ 2HBZB 3M2UB 1RK8A 1EO1A 7FD1A 1C0TB 5DZ7A 2XMUA 1WSJA 4P4OA 2YKMB 5AJ3F 3JAMU 3TWZA 5ETMA 3F5TA 3GYGA 5KNIA 3PZPA 3NLCA 3BQ7A 5D0EA 2GVZA 2X6NA 4DUZJ 2UU9J 5AIBA 3MDFA 4UUWA 4JKCA 3ZSYA 1EKSA 2BJ8A 3Q24A 2PBDA 3JSBA 9ICPA 3Q23A 1OMSA 3U6FA 4CLSA 2KN4A 3ETRA 4NM2A 5KG2A 3W63A 4GY2B 4B3MK 2W8LA 3MGHA 4LMZA 4QZBA 4H54A 3BB5A 2HGLA 3N6NA 5ALLA 3LQVA 3CO0P 2YWKA 1UJ6A 2D1CA 4NA1A 4ZVSB 2XRIA 3NF8A 2P9KA 4JKEA 2ZVSA 4IOCQ 4KAIA 1M90O 3V2UC 1O6XA 3W65A 3LP3A 1KS2A 4V19S 4FYWB 2BJDA 4OL8A 1MN8A 2K06A 4Z4CA 4UUXA 1IXKA 3SQOP 3H7IA 1XIQA 2BOPA 3R5BA 2Q36A 1OWXA 2VODA 4Y2XA 1FT8A 4RW9A 3BM7A 3G71N 4XPCA 5E3QA 1L8OA 4AL5A 4BRCA 2I6XA 1BPXA 4RW4B 2M7SA 4J7CA 2LPEA 2FPLA 1VDVA 4RPFA 3W8GA 5CR4A 2I1QA 4MF2A 3BSOA 3ENOA 1ZJMA 1RTHB 1A9NB 4DTSA 3V81A 1L7OA 5LJVA 4OQJA 3HSCA 4O3OA 5JLFA 3CC7N 5DG8A 5B0BA 1MG7A 5CCLA 3OR2B 1ZXOA 1S72S 3ZT2A 4NMLA 3BQ2A 2QXFA 1V9PA 2MZJA 5LOQA 3T5JA 1RDWX 5AE1A 3CQ8A 1HNVB 1YJUA 2ILZA 3DRPA 8ICFA 2IS3A 1RCXB 3IWNC 4GVLA 2CWKA 5KFAA 1TV6B 2KFYA 9ICHA 3TX0A 3RB6A 2UUBF 4AQYK 3IKMA 2GZOA 2DKXA 1P6TA 2BW7A 4QWCA 3T1HF 4JI8F 3L7UA 4KH1B 2R4FA 4H4OA 4JK9A 3C15B 3VQCA 2EAOA 2H54B 2I2YA 3I32A 3PYGA 1EHWA 5IQ6A 4DCCA 1RHRB 3DOKA 3VEXA 2ZJRL 2E8PA 2F8KA 2Q43A 3UR3C 3O6QA 2QXLA 1WF2A 1N32F 3Q8VA 4J8FA 3LW5C 3NCRA 3GQCA 2RHFA 3AO5A 1B0XA 8ICAA 1N56A 3KG0A 4PEOA 4ZVQB 2MZTA 1H2VZ 1VK0A 3OYMA 2GCFA 3FMBA 3H7HB 2FVSA 4K4XA 4P75A 3WHIA 1F9FA 3QUTA 4HWIA 4AILC 3CQYA 3F5EA 8ICVA 4ILRA 5DBBA 3TNVA 4ECVA 3UE5A 1HHSA 4Y3CA 3PIOL 3RB0A 2GTDA 4X84A 3ISDA 4B3MJ 3KKSA 2N7CA 2FLLA 3IRXB 2ZIUA 3MN5A 1V5IB 1HD1A 3OYJA 3OBWA 2FZCB 2HQ3A 3RRKA 2YQ3A 1NMNA 1KVJA 5KOWA 4JI6J 4I7FB 3JS6A 2VG5A 3O4NA 3BF1A 3TU5A 4BRFA 1XR6A 1TFRA 4PHAA 1NGDA 3VQ7A 4CZHA 3Q8PB 4I56A 1HBUA 4EYIB 4USAA 2QX0A 4ZJLA 3N97B 1HQUB 5J2GA 2I7NA 4QIWC 2C1EB 1XMOK 3M1YA 2FJAB 2DPIA 3CC2N 3MEGA 4FO0A 3R7BB 1RLCL 1ZOLA 1IM4A 4LFBK 3TEGA 1HIWA 2BGWA 1Q3UA 2H3GX 4FL9A 4B3TF 1TUYA 4BR5A 3QE9Y 3NGDA 3WKBA 2HHHF 4X4UA 2VB6A 4E19A 2BQRA 2VG5B 3SCXA 4FS2A 4KPCA 3OYGA 1SXEA 2DBYA 3FLCO 1JJ2M 3KK2A 1WSRA 2MY8A 3I56S 4CBXA 2V51B 3KNGA 3KK3A 1YITN 4NA3A 5D4PA 2B4PA 5D0HA 5CYJA 2P5VA 2PA3A 5FD1A 1WSHA 4LFAF 8ICNA 1S48A 4JKBA 3T6JA 1NAQA 2D8CA 4UOHA 5B0AA 1NB2A 4I2IA 2ZKTA 4YR0A 3LK9A 4G65A 3QEXA 3CCQS 4E2FB 3N7SC 4QZEA 3SENA 2V5HG 3O3HA 2H3IA 1TP7A 1VJQA 2H3ZA 1N0VC 1RXVA 2FLNA 1RT3A 2VDHA 4B9TA 1Q53A 2XLIA 1S1VB 5CHIA 2QTWA 4F5OA 2KVIA 3QSYB 1XMQJ 2WBMA 2R7RA 5J0PA 2W2OP 5KT4A 3O0FA 4UTGA 5DG9A 1IM6A 1J27A 3HSDA 1M5OC 1X3NA 2B5JA 4WCEQ 2G8IA 5D3GB 5AQRA 4M3UA 4M63C 2Y9HA 3KK7A 2HRYA 4ZMMA 2HGMA 4WKYA 1T7PA 4KHMA 2CH5A 4H5NA 1ZBIA 4JI3F 1G4CA 3CW2C 1HBMA 3RFAA 4O5BA 1FHTA 4P74A 4F0HA 4PL7A 2DGOA 2CGKA 3RWUA 2POKA 1WCNA 4YMOA 4XPEA 8ICJA 2RE2A 5EWEA 1M5VC 2DF4B 1NCLA 3B8HA 1NK9A 3KZBA 4BRKA 1U4BA 2O01C 1TU0B 4NOHA 1UTAA 3ZSOA 4DSJA 4CO1A 2NSCA 1DBDA 5K4LA 3FQKA 3KMQA 1V3ZA 4DV1F 3DU5A 1N63A 3NASA 5DM6Q 3HTVA 3X3UA 2ZH4A 2VKRA 1X4AA 4DR4J 5CD4H 3BO4A 2FJVA 3SZ2A 3D6TB 3CJKB 3QESA 1CI4A 2DCUB 3TARA 4XQ8A 3D2SA 2HW3A 2IDLA 5LJ5Y 4UY85 2QKBA 4CLUA 4NM1A 1LEOA 2OEMA 1IBKJ 2NYVA 2VF3A 1SI9A 1G1XA 9RUBA 3AGRA 2RJZA 2VD3A 2YKOA 3IRWP 5EXWA 1T94A 3I9ZA 2I5HA 1UFWA 2DNPA 3WEEB 1KC8O 4CDGA 3W8PA 3VEYA 3H42A 1RLDA 2ASOA 4N56A 4NLTA 4FLUA 2DNYA 2UUBK 3QSIA 4NXNJ 1BA0A 2CPEA 2L3MA 3LANA 2O8FB 4DSLA 4YY3K 3LDAA 5I3QA 3KBBA 4QZGA 3JXOA 5IT9U 4PXDA 1EKRA 4KI6A 1NK8A 3NE6A 5DB8A 3ZDAA 7ICLA 4BRGA 5ADZA 4V1Ak 3PHEA 1GLFO 4JKGB 1VC0A 4XIUA 5F0UA 4V19X 3BQ0A 1NKEA 4LQ9A 4C0ZA 3BS7A 3TO8A 1Q5YA 2EHGA 3PIPQ 2JWNA 2NXEA 2QL5B 4W5OA 5IIMA 2DH8A 3UQ0A 3C94A 4ERDA 2NRVA 3NH1A 4NXMJ 3P31A 3KD1E 4ECZA 4KHUA 1KLMA 4J90A 2DEJA 4QOTA 1S59A 5SUHA 4TUPA 4X4QA 2QEXN 4LF4F 9ICJA 2HF4A 4C23A 4KHPJ 4KHWA 3QBXA 3L3FX 3VETA 3AA3A 3IDHA 3WU2U 2GAHC 2OMLA 2ROGA 4N5SA 1S3XA 4MFBA 1RWMB 3GP9A 4GC7A 2Z2YB 3M6WA 3J80U 5LMNF 2L9WA 2KJVA 3SCLE 1XERA 2JC0A 4U8YA 3U3YA 5DLFA 2DT9A 3MXJA 4M7XA 1OSCA 2FSKA 5F8HA 2B56A 5AQSA 1CEZA 1C6VA 4BACA 1FFVA 3Q7CA 1CUKA 4MFBB 1YIJS 1YQHA 2QWMA 3BO2A 4PXBA 5EE3A 2LSNA 4FJ8A 1W26A 2R8HA 3OSPA 4XDDA 1IJFB 4MHVA 3QGPA 1HBOA 1BISA 1RAHB 4G3IA 3CDBA 5M2PA 4M7YA 4AM7A 2AYMA 2W2PP 5C12A 4ECXA 3UB5A 1HX1A 3ZT4A 2Q79A 2C3MA 2P9GA 2XZTB 4F5NA 2Q1LA 3QIPB 4OZJA 5H9FK 3VGMA 1D9FA 4DDFA 5KFDA 4NLQA 4FM0A 4LF5K 1BCMA 1Y5NB 3H4BA 2IM1A 2MQOA 1QQ5A 4N76A 3M8RA 1SKSA 4LFCJ 1D9AA 2Z1JA 8ICMA 1QE1A 3L3UA 1Q5VA 2HHVA 1GLLO 3OR2A 2HWTA 2F7VA 2E2PA 1IQTA 3GONA 3ULHA 1IXRA 2OMOA 1U2CA 2CPFA 4DV1J 8ICWA 3I8BA 1BVSA 1D5AA 2WZ1A 5KPZA 3UXNA 4USKA 3M6GA 2ZFHA 3GIKA 1W2BR 4ZK7M 4RBVA 1BDGA 1Z4OA 3ZEUA 5C2DA 3NAEA 4YOEA 4DU7A 2YNGA 2K4EA 3RMCA 2BKNA 4X62F 2M8DB 1FA0A 1DHMA 2QSFA 2YVSA 2DR7A 3C6HA 5T41A 3LVVA 4X65F 4MEXA 3Q2TC 3JS9A 3C2LA 2W04A 4LF8K 5AKLA 1WHYA 2A18A 3H8SA 5AK3A 3KHRA 4AL7A 1T03A 3AVIA 4FWNA 1NNEA 5LSOA 2FJBB 1FJCA 2IOHA 8ICRA 2ZGZA 3NS1A 2IRUA 2N4DA 4WJ3B 3CMEN 5AI6A 2EPIA 4H5TA 4GO7X 4HAIA 2M9KA 1UHUA 2ASPA 2B7BB 4ZVRB 3D45A 2MRLA 3WKCA 4DO9A 4YOUA 1L3KA 2BM1A 2FHKA 1VJ5A 5DBCA 3SCIE 9ICNA 1FO1A 3TRGA 5IM0A 2D1KA 2WFAA 3N5FA 2B4OA 4JB8B 3R1HA 2FHOB 1XHXA 1LWCA 1VQOS 2BCUA 1ZBTA 4B9LA 4CHPA 2OZMA 4IKFA 2PFFB 2HYIB 2FC0A 4Q43A 2W54A 4F5RA 4USHA 2XB2D 5M1QA 3PW0A 2IVYA 4CIOA 4JI6F 3H1QA 3ZT3A 4K8ZA 3KKAA 2E88A 4R63A 2XNQA 3W2VB 3QUCA 2RQ5A 4BR2A 4CZGA 3TX8A 1RCHA 4BJQA 2W03A 1ZQOA 3TFSA 5FPMA 2PE8A 2QJ3A 3C7NB 1FX2A 1ROFA 2X3GA 4BY9C 3CC4S 4DR7K 4WQ4A 4I2CA 1AB8A 1P27B 3VVUA 5D15A 1PJ5A 5A8WA 3O8WA 3AVBA 2E8NA 1FFUA 3KZXA 3NS7B 3IHQB 3SJJA 3POTB 9ICVA 3VGTA 5LY3A 3LM9A 1HYSA 3CCTA 3G82A 4GXJA 3MD3A 1K6YA 2HMXA 4FJHA 9ICGA 4PQAA 3IG5A 3CFOA 5GADI 4XUSA 2UUCK 1JRPA 4KFBA 1Z26A 1VLBA 4KLFA 2RS8A 3HVTB 1HJPA 1X66A 1ZRMA 1WLJA 1WI8A 5ETPA 4ILLA 5CCMA 3D0IE 3GG0A 5DDPC 2ERRA 4Y2AA 3AVMA 1JQGA 4FFDA 3P49B 2WC9A 2A0FB 3HO1A 5KI6A 2WRMA 2VFRA 1FO4A 2A6AA 5GAGU 1IO2A 5HROB 3DYAB 2R2UA 3J7Z5 1B70B 4DR1K 1Q7LB 1OIAA 3S7RA 1HJOA 2ZOMA 3D7EO 2CZ4A 2HBYB 2P5OA 3T5KA 3KLIB 2B5JB 3PR5B 3MECA 2V2ZA 3TFRA 3QFPA 2D0AA 1BHNA 3RSEB 3G71S 2KIWA 2BW2A 2ROPA 4KTWA 3CDUA 4GFJA 4JV5K 4F26A 3IA0A 2DJWA 1ZA2B 2BDUA 3D2WA 2KKPA 2X6SA 2MLZA 3DYAA 2A1RA 2YQEA 2LU1A 1YJVA 1Q81T 3TZYA 3PYEA 3EL2A 4YMMA 4NB4A 2FSNA 1U1LA 3ISZA 3ZTOA 3TZZA 4CJEA 2X1GA 3N79A 4GVBB 3TQEA 8ICSA 2IM2A 2ILYA 5AJ3J 2UXBK 4PWUA 2ZH8A 1FW6A 5I3PA 1B4FA 4U7UK 3GZ7A 4W5TA 3K0SA 4LFAK 3QU4A 4KE5A 3VQBA 2BQ3A 3PIPL 3AA8A 4Z6DA 3AVKA 2DHGA 4LZGA 2X1BA 1S1XB 2AIRB 3M2VB 3ETOA 3RH4A 3V72A 4WU2A 3LPYA 5DLGA 2VC0A 4BC3A 1VSKA 1ZM3A 4OI2A 3IUCA 5AFUA 1X9WA 3MMCA 3HX0A 1NDKA 1PVRA 4DV4K 1NGCA 1VBXA 2E7WA 4RQ3A 4GKJJ 2Q0ZX 4OPKA 1N5WA 1GLDG 5HNKA 2HG4A 4IG0B 4Q2MA 3BBFA 1TK8A 4CJLA 3CNQP 1YTUA 1ATSA 4LFBF 3T41A 4DPYA 1T11A 3A8JA 4PG8A 5DBAA 1YJTA 3TTFA 3E58A 4OO1J 4QPTA 3EKUA 3HSJA 5C5JA 2R9LA 1D09B 4OKEA 4L75A 3P5TL 2K2PA 3J81O 5DO2A 2LQ8A 1JI7A 1X9MA 2LYBA 3MX2A 3HKZD 1IKXB 1P1LA 1JWWA 1Y0HA 4HHUA 4CJSA 1HHQA 2E8OA 2GUIA 4XEIA 1Y64A 3QPIA 1QVFR 5CY4A 4A46A 2XYHB 2XMAA 3LDSA 4NEYA 1WKKA 2IGIA 3P38A 3OPKA 3VN5A 1CULB 3CCJN 3HULA 1COKA 2JLGA 2M0GB 4BC4A 3OTOK 2EH9A 1SJFA 4WFBQ 3R9LA 3NRZA 1S57A 1ZQAA 4K4WA 4JLHA 3S9HA 3D0PA 1VQYA 5ALEA 2HMIB 2QWRA 2CXEA 1KSPA 2QC3A 2B43A 2V8PA 1HW9A 4WBFA 1VQ9S 4JAXA 3UD3P 2YNIB 3O9RA 4XRHA 1B4SA 2RF2A 3CD0A 4DTRA 2JJ4D 3OLBA 1XN9A 1IKYA 4LBPA 4DR6K 4ETXA 2XBPA 1RAOA 2D41A 1BL3A 1UVIA 3HVAA 3I5CA 5D4BA 2OSRA 4ES2A 3A5NC 3N7PD 4LVOP 2HMIA 1HNWF 4F2SA 1ZD3A 2KJWA 5MLCQ 2A1AA 2C3PA 1U1OA 5H9EJ 4B3OB 4BVPA 4P2XA 4LF4J 4ZIVA 3PDNA 1XBWA 1RZMA 1X9SA 3VERA 1SBRA 4ANCA 1SXLA 3THVA 3D66A 3A5LC 3TR5A 1JJ2R 3FZMA 1WG5A 5ALUA 4NLWA 4QAGA 3EEQA 1Z4NA 3DNCA 3D9BA 2ZD1B 2HFOA 4B9NA 1AZSB 1MROB 1TUGB 3OYEA 3L2QA 2KSOA 5KFYA 1H0HB 1SKWA 1HL6A 1F5AA 1VQ8N 2E2OA 3VGLA 2GHPA 4HT5A 4BR7A 3L8BA 2MKCA 2IFXA 1HI8A 2VC1A 5CZ1A 1IR0A 4RUBA 2AJ1A 1RHMB 2AEFA 3C15A 3KHHA 1LK7A 2CJKA 4IR9A 2UUAK 4NJ8A 1NPKA 2G2OA 2G8FA 2QW9A 2C28A 1OH8A 2VWJA 3ZEUB 1JLGA 5EE0A 2Z57B 4CD3A 4O5FA 4W5NA 2WB4A 2YB4A 2HSTA 1RA6A 1HNXF 2ATCB 4RQ2A 1GMWD 4DR4F 3QMQA 7ICPA 3R27A 1V3RA 3MPVA 1FD2A 1NM1A 2OHFA 5KAIU 2PYLA 3L0QA 1IQZA 2HPUA 5ALWA 3CM5A 3A8YA 2W55A 1TKDA 1GH8A 1PBUA 4DI6A 2QTDA 1WJ9A 2AJ4A 2VL1A 2RE1A 3ALYA 2BANB 2P9CA 3MPWA 2FGOA 3BS9A 3P4UB 1GLAG 3FGUA 3HZGA 3BJYA 2BR0A 4CTAA 3OUYB 3HI0A 1RDFA 4DU3A 3UMBA 2LQJA 2VONA 4DSEA 3MM8B 1YBUA 2MTLA 4PL1A 1KOHA 4KIAA 4JI5J 9ICUA 2NLWA 2HIYA 5LMNK 2UXDK 3M7DA 5DDYA 2F65A 4B1XB 3HJEA 4IRKA 3PMLA 2RN2A 5LSLA 4DQIA 1NXIA 3OTEA 1RQ0A 5L1LA 3FRZA 1ZM4A 1IKVB 2ZIWA 1I94F 3R9PA 1B3TA 4K59A 4KQZA 4GMKA 3SUQA 1S0NA 1QZ5A 3MMVA 4FJLA 4RUCA 3OYIA 2MPUA 5J29A 1ZQYA 4OYPA 1PVPA 1X42A 1ZM2A 1U47A 4RW6A 3K5NA 2KNJA 2YKPA 5AQGA 4IUFA 1LOTB 5ELZA 3K2YA 1W9HA 3CCRN 4CO0A 5AKIA 3QUBA 5F3TA 5F8JA 1C0UB 1Q0NA 4UQTA 3MXIA 1TR0A 1PJ7A 3NWRA 2ZH7A 2XHCA 3JYTA 3FFKB 4QZHA 2DH9A 1RADB 2RH3A 3AAWB 2KM8B 2BZ2A 4KTZA 3KZIU 1T9VA 3UE2A 4I9QA 3OR1B 4FBUA 1W2BM 3OQ2A 5CWRA 4E0DA 1WWVA 2KM8C 3SMZA 1FRLA 5D3GA 3IBPA 4WJBA 4DV6K 1VIXA 7ICNA 3MDCA 2V8GA 2HOIA 3MR3A 5J0QA 4R25A 4BVOA 3D0HE 3DRXA 5C15A 4YHHJ 2H65B 5KFHA 4PG7A 3IS9A 4EX6A 1ZBLA 3M9NB 3JPSA 2NZTA 3MUTP 4J03A 5JMNA 4YDUC 3RJJA 2I9GA 3OFEA 4TYAA 5HLFA 1N52B 5F8GA 1K8AO 4Z0UA 2GJ2A 4DN9A 3IBCB 2FJEB 2E3TA 2CPZA 2APOA 3HP9A 4PHPA 3NHGA 2MLXA 5GINA 1S1UA 1S1WA 2FMQA 4LD0A 1OS5A 5AQKA 2QARA 3TTDA 2Y0SD 3NMRA 1BGXT 1NGIA 5AKHA 4CJ5A 3ITHA 5LMUJ 3A5MC 3OGUA 2CADA 3L95X 3N4MB 4KHPK 2GV1A 3AVHA 4M1KA 4IQUA 4AHUA 4ZVGA 1J54A 5BOLA 4X4SA 2W2MP 4E89A 5KFBA 2VPZB 4UASA 2YBVA 4DCHA 1XHZA 2CPYA 9ICBA 2NZCA 2V2QA 3N7RC 4KT0C 3FEYB 1S1UB 3IDWA 1FDNA 2D3OR 3HDSA 3N5BA 2ZOFA 3K1ZA 4FF2A 2Q0UA 4H4KA 3KOOA 4A2BA 3LP1A 4F93B 2ZE2A 2BXJA 2H5IB 1GLJO 1NJIT 4OYOA 4K42A 2QEXS 3OYNA 1FX4A 1MWQA 4N47A 1T9XA 2FHJD 3AQFA 4NRUA 4DTPA 4UB2A 3UMGA 4B9QA 2E5LF 3HVRA 2FJWA 1Z00B 4KFBB 2DNZA 2CJAA 4IDKB 4BC5A 4O3NA 4L76A 3G6VA 2ZXHA 3TUIC 1RISA 2F8MA 3UD4P 1PUZA 3DXMB 5J2AA 3O80A 3I28A 4I2EA 2NR0A 5AJ3K 1LKYA 1N60A 5KFCA 4O5EA 1XQSC 3GCXP 2W9BA 3I33A 4KR0B 2DVIA 5K9FA 1ZQKA 1D4XA 2FMPA 2YWWA 3SPZA 2IRYA 1VFJA 2F1JA 3MM9A 5KFLA 1SS6A 1XSPA 3PEHA 3F44A 1SL0A 4TKTA 2XS7A 1DRZA 8ICUA 4L6V3 3JSMA 1N5SA 3WNGA 2C22A 2OA8A 4JI2F 2VFTA 3ZSQA 2C2DA 4RQ7A 1NH8A 4DV6J 2DO4A 4AHTA 4RNNA 4K2XA 2WCXA 2MQNA 3EDQB 4L3KA 4OYBA 4RW8A 4DL5A 3H90A 2ZJAA 1VQ7S 4RW7B 2D6FC 4P2HA 4I6AA 1HYVA 4O4GA 3ZNUA 5HMLA 4IO1A 3MMBA 2HOFA 1OXJA 3CXCM 4BCAA 2ISPA 1SIJA 2G0AA 2D0CA 1M5SA 2RF2B 3GLJA 2P6RA 2KFZA 2QMUB 4WFAQ 3UN2A 4U67Q 1N5YA 3J8AA 3IM9A 1NDLA 1BHLA 4BDYA 2IYGA 3P96A 4ELVA 4KX3A 4FWPA 2FDRA 3CCWA 4O44B 3CI5A 2Q4TA 2VFVA 5BYQA 3EUB2 1HKCA 2M3DA 1TKXB 2FY1A 2FJDB 4OI0A 2W4CA 1VC5A 1VQLS 2LHTA 4HR2A 2CQIA 3PSFA 1CSJA 5G0RA 2JWKA 2CQ4A 3VF4A 2HS3A 3NCQA 5AQXA 2F1FA 1Y7PA 2NRXA 5JVGL 2W41A 2HLTA 5KFOA 2X7IA 1LCUA 4NLSA 1HNZK 3O5BA 4IBNA 3U3GA 1IBMF 1YJRA 2K8AA 3MFIA 3ELHA 4NCAA 1DQ8A 3FSIA 5I4MA 3N4QA 2N1RA 4JV2A 3HXMA 4CP5A 2J0XA 4JI8K 3Q8QB 2OGUA 4HI1A 5ETLA 3HRDD 5BPCA 4S0MA 2ASLA 4JI0J 3FDSA 2KZMA 1M1GA 3PM9A 4KLGA 2V9WA 2BE2A 2R18A 5IS2A 5AQWA 2VFSA 1NSKL 4WWSA 3GV5B 1CJVB 4MDAA 5AXMA 3DRPB 2J4RA 1VQ4S 1ZQPA 3ATUA 4XTTA 1RWWB 3D4JA 2FF3B 1YJ7A 5ETOA 3RMAA 4DF4A 5B7WA 5CXTA 3HOSA 4DBQA 2OELA 1FK9B 2XMKA 4RNMA 3THWB 4O23A 5JICA 3EYZA 1S7IA 1EXQA 4C48A 2C42A 4NMXA 4TXSA 4HCBA 3CJTA 4EAHD 4FXWA 1U6FA 3FUYA 2ZIXA 2HBRB 3IWLA 2KXHA 2CQ2A 3LUYA 3ZNJ1 1WG1A 3KJNB 4NEZA 3OFHA 4RO0A 2AA4A 5HQLA 3KLHB 4I6YA 4TVAB 2AV5A 3H40A 2DUYA 4A59A 1CJKB 4E7HA 1KTQA 4H03B 3RW7A 1N61A 3AO4A 1VGYA 2BJ3A 4HDHA 1S0VA 3I9V9 3GPAA 1GLBG 5AI9A 1ASVA 3I5BA 3RB3A 3VAKA 3ZFVA 3BSAA 3E8OA 5GAEU 1Y5LB 3MCMA 4N7TA 4DZDA 4Y2MA 5IINA 3O1LA 4LH5A 4OX9J 3OJSA 4ID5B 3NVZA 3SSQA 2AHOB 1HWLA 2DGQA 4FLTA 1EP4A 4OPJA 3VQ8A 1SPBP 4DV1K 2LYAA 2OCEA 4HUFA 5KFVA 4JKFA 1D1UA 1URJA 1WTBA 2HBQB 1IKVA 1KR4A 3LVWA 2JHEA 2KJ9A 2KH9A 1N6QA 3BH6B 3A1YG 4K4IA 3MN9A 2DGVA 2ZZTA 2BGGA 3FRYA 4CZIA 3GYNA 4WQ5A 1XNRF 1N36F 1KDNA 4M3ZA 4CESA 3MN6A 1X4FA 3SEIA 3DI6B 4ZP8A 5KGWA 5HP1B 2HFVA 4M63A 5ITHA 1S99A 2DHAA 1JIHA 4ZHRA 2QL9B 2V8DA 3V1OA 1CBKA 5CZVA 4TY8B 3M8SA 3G86A 4DV7J 4UBCA 3D5MA 2UVVA 4IJNA 1UL3A 4QWBA 1RQLA 1NSQA 1AW0A 2E29A 2E7XA 4AXIA 2ZVIA 2XSJB 1GLCG 3WX8A 4OPHA 5KFQA 3NDKA 2YHXA 1SJRA 4Q5VA 5BRDA 2V94A 2KW4A 1VAZA 1JKHA 4UARA 1Y10A 1QCKA 5ALHA 2H3QA 3MAAB 4C6AA 1SIWB 1X4HA 1R8CA 1ZBFA 5D4OA 3KHGA 4FO6A 3ZZYA 4EHTA 1V4SA 1QSYA 1A76A 1DAXA 3DLKB 1RU1A 2IIHA 2R7YA 4UZBA 3PNIA 1DQ9A 1FXXA 1FIQA 5LL6d 2LBOA 1ZM9A 2FF6A 4BC2A 3HKZF 3LWMA 4YXJA 4JI7J 3K2PA 3ZSZA 3UO0A 3I8DA 1UVJA 3W5ZA 2XC9A 1F60B 2VIXA 2FGCA 8ICLA 2OD6A 1PKUA 4NXNK 2B9XA 4RU2A 3THYA 1NSAA 1C0GA 4QS9A 3ISCA 4DMNA 2QA4N 3AAPA 2E1EA 9ICOA 4TUQA 3SDEA 3FM9A 4LF7K 3WKEA 1RT5A 1D0EA 5FRMA 3L7PA 4CEZA 4JS5A 1YG0A 4I2HA 3SAGA 2D9PA 1HNIB 4N8NA 4FLYA 4OJOA 2MLYA 3RSEA 3DLBA 1BI4B 1W97L 1SZHA 1XO1A 8ICEA 4DV4F 2HWIA 3CDWA 4EELA 3ILOA 5J2MB 4C8YA 3AXMA 2R2TA 2HS4A 3OHBA 4I69A 1ZD5A 3TTCA 1VQMN 4ZN1A 4G1QA 2G9OA 5KFXA 1P8GA 4TQSA 4O3SA 4ZPWR 4LSNA 1IH7A 1EQMA 1RU2A 2HVZA 2JR5A 1VQ9N 4J5OA 3HD1A 4OYMA 5AXKA 3DLLQ 4DCPB 4U67L 5A8WB 3TEHB 2CPIA 2CQPA 3KVGA 1JMSA 4X64J 2VOOA 2MU2A 1HBNA 3TW0A 1LAWA 1LKYB 5DM6L 1KVKA 1EARA 4GMJB 5FDLA 2W8KA 2ZTEA 1ZZNA 1T44A 5KFTA 5B0DA 1LK5A 5B0CA 4WKRA 3CJAA 3I55N 2BCVA 2G13A 4CF3A 2F4VF 3TA2A 2W43A 4CLKA 1H72C 4ENOA 3U9ZA 1N0UA 3WKAA 1CQMA 1MC8A 2BMBA 3HFZB 1WG8A 4E7IA 1L3SA 4C1NI 1FRMA 3Q86A 1D8LA 4X4RA 2EQYA 3FC4A 3LAKA 1UWBA 3KG4A 1DRGA 1SVDA 4QIWD 1TL3A 3H2UB 7ICUA 4ZP7A 1Y88A 3A0HU 1R89A 2QO3A 3AJ1A 4Q7AA 3CD7A 3U1NA 4FPBA 4GXIA 3UFCX 5D49A 4PAAA 4PG5A 3KWGA 1JL2A 3O3GA 1C4AA 1R8AA 2YPZA 2VQEF 1UEUA 2PO4A 3S6EA 4HTIA 2CPRA 3BUZB 2CZ9A 2PC6A 1CLQA 4XA5A 2OAUA 2IVNA 7ICOA 2YNFA 3R1XA 2J6SA 3CCRS 3CM6A 3CCLS 3S6JA 3CJKA 2V52B 1WKJA 2F8HA 1WSEA 5AHXA 5HQ8A 3V6DB 4B08A 4L8RB 3QU5A 1TKXA 3KWMA 4OI1A 3DLLL 2E4LA 3TADC 1NZBA 1ZZFA 3VZHA 3ZSXA 3CP8A 1GQEA 2OTLS 1LAVA 1Q95G 4KLOA 1P90A 4C4SA 1ZPWX 3CIPA 1NNLA 4B3TK 4DOAA 4YMNA 4AUKA 1XNRJ 2FLOA 5FJ4A 5F2RA 8ICXA 3PUFA 2W7PA 2WB1C 2EK6A 3EGWB 4R79A 2K1RB 3RMBA 3V4IB 4LF7F 5IT9O 2NCKL 2XEXA 3CC2S 2FBXA 3BR8A 4PUOB 2O8BB 4YY3J 4H4MA 1KQGB 4DG1B 4QZ8A 1U1RA 4ZPVR 4ZN3A 2UU9K 4DR7F 1S5ZA 4M95A 5HR6A 1RCOB 3WK6A 4QZVB 3ZYYX 1UZDA 2HIQA 1Y5IB 2LM4A 2O4IA 4C4WA 3I56N 5J2BA 4UAZA 2UUBJ 2HQIA 4CEFA 3MABA 1CJVA 4MIAA 1M1KO 2SXLA 3R2CJ 3SQ2A 3K58A 2NO4A 2IHNA 2WTFA 3R5JB 2Z1HA 4U95A 1ZQCA 5DDMA 2AGPA 1Q8IA 4JN4A 1Y3KA 4HTJA 4Z6FA 2LP4A 4EIAA 5HN0A 4MF8A 2YI1A 4CJFA 4MFAA 2BANA 3IR7B 3EVWA 2HFSA 1Q8BA 1M1KT 2O8CB 4M5GA 3KFUF 4AL6A 4F3MA 2OPSA 2BH1A 3HZEA 1PO6A 3NFAA 1NDCA 1LW0A 4YVZA 2QLTA 3A5OC 4QR1A 4FWSA 4DCJB 4CZFA 2VU5A 1RGVA 4OZLA 2OPRA 2AJ0A 2ZJPQ 2ZBPA 4NLOA 1KHWA 2X3DA 4NL9C 1JX4A 3SI6A 4O44A 3NXZA 4ACOA 1RBVA 5CP2A 1KD1T 3BP8A 1WG4A 2KN7A 2ZJQQ 3O3LA 3O2IA 3QFUA 5IIKA 4CYUB 5IT9Y 4GV3A 3U8XA 2GJFA 1YTYA 2IJRA 3SQGA 5B66U 2RS2A 1BUXA 2RQMA 1DT9A 2GIRA 2GH1A 3EMTA 3FK4A 3M05A 1NMEB 3DFEA 4XDCA 4C7QA 5M1NA 2P9PB 4MIBA 4ANDA 4CJTA 1AFIA 5HJYA 4EP4A 3CF5L 1KKHA 1XMOF 1U0HA 4FSVA 3DOLB 3UVJB 2R7SA 3Q22A 4DL4A 1MU2B 3F53A 3RJGA 4CT9A 3MZIA 1KQKA 5DMRA 1L7MA 4K8XA 4USVA 4NCGA 3W2VA 3B78A 4H5WA 3F0NA 4BDZA 2KG1A 5DQHA 3MOZA 4XH4A 4Z4HA 1O1WA 5FROA 5LT5A 2CPDA 2XLJA 3Q8YA 4H4OB 2OD4A 1YHQS 1E4FT 1S6QA 2P51A 3UW1A 1IBCB 1XNRK 1T9YA 5RUBA 3WXIA 4BR4A 2VQFK 1T02A 3ZZTA 2AGQA 2F4VJ 1RNHA 1PCAA 2Z7JA 3AVGA 4BRPA 3CCUS 5GMKa 3LH2S 2OPQA 3VOVA 4AH9A 2Z1GA 4TY8A 4UB5A 3DU6A 3NGIA 4A2AA 1C1BA 1FNXH 5ALMA 3C16A 3FBFA 5A2QU 4ZLLA 5AQHA 3NCIA 4DTUA 3HHLB 2ZGYA 1NJZA 4HH1A 2JWLA 5B0EA 4Y28C 2UZAA 4R64A 2J8AA 2BE7D 2MZSA 4Q0BA 3AQEA 3EX7B 4BC7A 2WOMB 3Q89A 4OYXA 4CBWA 1DXSA 2J0SD 5C42B 1D8ZA 2MY7A 3CMQA 3D3CJ 2ADBA 2ITGA 3U26A 4O0JA 2EXUA 3D6HB 4F5PA 5A8RA 2QWLA 4XH5A 1U2FA 3C8YA 3WNHA 2NXNA 3RAQA 4JRQA 3CNHA 4USWA 2KYXA 3ED5A 1S77D 3ZDDA 3VWSA 1OUQA 3D28A 3J7YI 1LOUA 3RZAA 1P8ZA 3ZLJA 3F2BA 5F3XB 1KBRA 1FEEA 4K4UA 1LWEB 1OY8A 1X5OA 3RJFA 4Z4EA 1ZQNA 5ETQA 5LXRA 1ZQMA 3R3TA 5HBMB 1QUVA 4OFZA 1RTDB 4CE6A 2RRNA 4R0JA 2BYCA 3AHPA 1UW9A 2I1RA 3FZ2A 2DWQA 4DV5K 3QBWA 2KU7A 9ICFA 5ETVA 3M8QB 3OYDA 3LAMA 5HL7Q 3H8WA 3SXLA 3F2CA 1OKJA 1IBKF 3L2VA 1HKBA 3PSIA 1YBAA 3GWCA 1UA1A 3CMAS 1NG9A 2QLBB 2ODGA 4FOEA 1CJUA 2RLTA 1BC6A 4IDHA 3DCAA 1YLXA 2MQMA 3BQTA 4ED3A 2IOCA 5ADXH 5F9LA 3BV8A 4CVNE 2DIUA 2DHHA 5BN9A 2JEIA 4LUBA 1N33J 1OQ3A 1QDUB 4EWTA 1NJXA 2Q31A 3BPDA 2Y0SC 2LXUA 1SQKA 4A8EA 3AH6A 2KVQE 4CEEA 1XSNA 2MGZB 4CEBA 2UXCK 4P0QA 1T95A 4BE0A 2HHXA 5L46A 4F3TA 2WSCC 2A2CA 4IQMA 1F44A 2OWOA 1AROP 5BXIA 3A13A 4D3GA 1Q4RA 3CETA 2CKWA 5D8HB 3K8WA 1NGBA 2YNHA 4EGLA 4KGMA 3IR6B 4AYBD 2BBEA 1Q1KA 4YOXA 1GXLA 5AKZA 4DPOA 3RBDA 5CEHA 3MCNA 3KK3B 3CHWA 5L38A 2XMJA 1MW7A 2W4PA 1XC9A 4NYNA 2W24A 3D2QA 4PKDB 3UQSA 4MO5A 3QEWA 4CECA 4I2BA 5AKEA 1BD6A 1NBWA 1YJNN 5CYQA 3ULDA 4EBDA 4JP8A 3IS9B 1RT7A 2IOFK 4J37A 3E0FA 5J8YA 5J1NA 5KT3A 4DSIA 2YX1A 3Q0AA 3H8MA 1ZQ1C 2PKEA 5I42A 2YKAA 3BF4A 5AR0A 1E3MA 3QZ7A 1I1GA 2JZBB 1L6NA 4YB1P 5GIPA 1KRPA 2IOFA 2DO0A 3MCOA 2F9DA 1REGX 2VQEK 5J2JA 3D6FB 2XS2A 4FPIA 1HBMB 2VANA 4DZ6A 3HP6A 2RKIB 4ZCKA 2W42A 5J2MA 3CMAN 4IWVA 1QVFM 3PW2A 1V38A 2BZFA 3C14B 4AHCA 3CMES 5ALZA 3QO9A 2KT3A 4J91A 4UZCA 2F8EX 2XNRA 4CZMA 1T8EA 2PFUA 2FPKA 3J7AP 2CG8A 2DCLA 3SUOA 4I27A 3NGRA 2W9AA 4GKJK 4BGDA 4UBBA 2NRTA 2K3IA 1GTHA 1MN7A 2EFVA 4GO5X 2LEAA 4ZCMA 2XVTA 4DR6F 4BWMA 5EOZA 2CPXA 3CJ5A 3AVCA 4DOZA 3FKBA 3CTRA 3P45B 3JPNA 3UQ2A 3WIUA 1S8OA 1WC3A 2CQDA 1VSEA 2XSFA 3IMXA 2RDDA 3TANA 1SJ3P 1KL9A 2Q3PA 3C6TB 4M42A 3O9SA 4MO4A 4RCHA 1ZQFA 2HCFA 2VASA 1M5KC 4CBUA 3MF5A 1UFKA 4JHDB 3EXYA 1H73A 2X78A 3BBCA 2EKYA 4DV7F 3S8SA 2HHWA 2YMPA 3H8YA 4YCXA 4AYBF 2KHOA 3NTUA 5TISU 3PSTA 5T7LA 5E33A 2WVEA 2QWPA 3DXMA 1CLFA 1S97A 2PAVA 2QA4S 2W9CB 4B1UB 3D1OA 2HDOA 4MK8A 2MZRA 1UCNA 3D0GE 1T6DA 3VAHA 1JLGB 4NX9A 2ZQBA 1YTAA 2BUNA 3E66A 5MAOA 3OTOJ 5IIIA 4EEYA 4C9DA 4F4KA 3AOAA 2OLWA 5JLHA 1HKGA 2AX1A 4TLRA 3VF6A 3H5UA 4ETZA 5EWFA 3R5AA 1BQNA 1FFWB 4A57A 1JLAB 5CAAA 2PFOA 3CIZA 1UW4A 5AM0A 4PL8A 2ASMA 2YJFA 3HJFA 1U0SA 4BQZA 4NLUA 4CO4A 1OYEA 5AQJA 2AKWB 3CDAA 3LZJA 2XICA 4EO8A 1LXNA 1IKYB 2ZZMA 3RR7A 1X5TA 2IJNA 4ILHA 1S9GB 2KKZA 2FD2A 5KRSA 3QIDA 1XO0A 4ED5A 1HPMA 1NSPA 4M9JA 1FJGK 5J2FA 1TGOA 4ILJA 3RRHA 4DHVA 1RFQA 3UIQA 2WF5A 1OJ4A 2YTUA 5KFEA 2P9KB 3N28A 2ZIXB 2CRLA 4IFYB 2E5IA 5ADXA 4EZ6A 2XLKA 2P9UB 5HMZA 2AWZA 4FLZA 2KJ8A 4IH6A 3PRBA 3W2WB 4CLYA 2KT2A 2QLXA 3G4SS 3JTPA 4QZCA 5E3PA 3MX5A 4OHYA 1FVSA 2JZ5A 5ETNA 3W9IA 1L3UA 4FWKA 3MGIA 4FZYA 2ETJA 2ZZNA 4DFKA 5G0RB 2LXIA 3JSYA 5HP1A 3AJDA 3EGNA 4RLEA 4NCGB 5AXNA 4M5IA 4YOWA 3CJ8A 3UPFA 3OW2M 4DTJA 2ZJ5A 4HUGA 2LMIA 2ASDA 4JEPA 5HP4A 3L3VA 3V1RA 2VBZA 2WB1D 3ZX2A 3RAMA 2OEHA 2XY7A 1HUZA 4CJ7A 4P6QA 3PFOA 2EG2A 4YDUA 4ALZA 3MMAB 1RWKB 2A41A 4ZCIA 1JLBA 3MXMA 1DKGD 2MJNA 1VS3A 2DXEA 4JV5J 2CQBA 1YJWS 5AQPA 2U2FA 1WB9A 2L9DA 4BHQA 5L1IA 2VZ9A 3SUPA 3MWBA 5T7BA 3EICA 2RRAA 2UU9F 8ICCA 3VTHA 2EX3A 9ICKA 1URNA 1XNQK 4P7TA 1NHUA 3G8SA 4TU9A 4E98A 3WZ0A 1MA7A 4WIQA 5CD4A 1WNEA 3KJQB 2NO5A 5KG6A 2CJ9A 3D2EB 4WQ5C 3IBFB 2F96A 4YN3B 4L74A 2LECA 3DXSX 3RTVA 3B4MA 3PLAA 4CQ1A 2QN6B 3GFHA 2WW8A 2CQ1A 2CUYA 4BWJA 4F4XA 1YI2S 3BBBA 3S1TA 2NZ4A 3ZI4A 1R8BA 2D4WA 2ZWHA 3W0LA 2ZH5A 3PCOB 4DR7J 3KHLA 4C1NK 2QT7A 2J76E 2JL9A 1JLFB 3ICXA 4PQUB 1YT3A 1B99A 3FMWA 4X2BA 5E84A 4MN4C 1PILA 1VQSA 2PMWA 2E1ZA 1D8YA 4BE2A 2H3EB 5EGYA 4JI5K 5J2DA 1S1WB 1RTDA 2XO6A 4FJMA 2GWSA 4OD0A 1XJWB 4CZLA 3KKAC 2YB1A 2J9DA 4FJIA 3Q8LA 4LSLA 1TFWA 1MU2A 4QIFA 5L9XA 4P9SA 5K8PA 4YOVA 2V63A 3T7ZA 2MQQA 4Z6CA 2MKSA 3ONNA 1SH3A 4HEA9 4CERA 4KB1A 3R97A 1HUXA 1J2MA 3DHXA 1RYUA 4FXVA 5DGBA 4DFPA 4H0XB 5HMXA 2ZH6A 1WDDA 2COLA 2UP1A 5AZJA 1T9TA 1GOBA 1WC0A 1EP4B 4I2DA 4GC6A 1RT5B 3VEVA 3ZTRA 1LW2A 3M30A 1HNZF 4J9QA 1RWPB 1F6TA 2E5HA 2R7QA 4G1PA 3FBCA 2JMGA 2CNKB 3DV9A 4R8UA 5ALQA 4FZXC 2HBKA 4Y2VA 4KHYA 2AD9A 1C1BB 3M6KA 1RBLA 3PX4A 1SH2A 2VPYB 3NS6A 2RHSB 1FE4A 3QT7A 4LH4A 1E6VB 4JI6K 4P2SA 5ALOA 1P9YA 3G6EN 3RGIA 3SMSA 3X1LB 1O51A 1YJWN 2C3OA 5AZIB 2ZG6A 5GAHI 3MR7A 4OJGA 1S4FA 1I6JA 4DUYF 1SC1B 5F8IA 3CUNA 4KLIA 3MFHA 3TAEA 2XY5A 1S1VA 2LDIA 5LMUF 4USUA 2V4QA 3RJIA 1BPYA 1E4GT 3B6BA 2GHVC 2GEMA 2ZUGA 3E01B 4WE1A 4ZVFA 2F9JA 1KQFB 3HPHA 3NKYA 4QQBA 1V4TA 1VQ8S 5THWA 4OZNA 5BR9A 2UXBJ 4Z4FA 4CNYA 5J0WA 5T14A 1R43A 3F73A 1Y9OA 4UW2A 3TQ1A 2O8EA 4YHHK 4OHZA 4CO3A 1SZ2A 5CYQB 5I9EB 2R7OA 2IVOA 3DMJA 2FBVA 3ISNC 4KV8B 3SD7A 2F8TA 3D1QA 1WD6A 2KE7A 1HIYA 1FERA 1GO3F 1FD8A 1B0TA 1SQEA 4Y2KA 4X65K 1I3OB 2UXCF 3KLIA 9ICWA 4QR2A 4DPTA 1C1CA 3H5YA 3GILA 1HWJA 2VBYA 5KT6A 2HVDA 2EVZA 2O66A 3SR6A 4RTFD 2RRDA 5BR8J 5LJ3Y 3PMNA 1DGSA 2KEYA 4KSEB 1OPIA 4A5AA 1OQ6A 1QQ6A 3AO2A 4BGAA 5AQIA 1H74A 2EBGA 4CT8A 4J9NA 2JFDA 5J2HA 3V5RA 2ACYA 3QO9B 3KLGB 3V4IA 4OJ5A 3R7SB 4PKIA 1L3VA 3FCHA 3C14A 1FKAF 2IMWP 5ALVA 2PMZC 3R8EA 4QJVA 3TSQA 8ICIA 1SC3B 2GX9A 3QNMA 4L3QA 4FLWA 4QIWF 4J9KA 2HNZA 2YNFB 4M6WA 2ZXIA 1NH7A 3GDXA 3V6JA 4DXLA 3RW6A 3WEEA 2BX6A 4WFAL 4K4YA 3LM2A 3DEEA 4ECTA 3KLGA 3QEAZ 1X5SA 3M2UA 7ICIA 2I6WA 5FLXU 2YKNB 4WFBL 1RDAA 5KRTA 3NMAA 1YK9A 3GJRB 2W9BB 7ICFA 3SI8A 3NF6A 4OV6A 3K9KA 4U96A 1IG8A 3ID6A 2AW0A 2W11A 1DTQB 4ZPAA 4FKXA 3DLGA 3UXOA 2PMZD 1QHAA 2QM1A 4JKGA 4DUZK 4CK2A 3A3OB 1VR6A 2FPMA 1RSCA 5AE2A 3S3MA 4ICLB 5F3ZA 4IQWA 7FDRA 1A77A 4UQGA 2OPSB 1LQ9A 4ZPCA 3ETMA 1H98A 2W6KA 4W4MA 2K1RA 3BH7B 5JVGQ 4M5DA 2JH3A 1HUOA 2KO1A 4CGJA 4E3SA 2BDPA 4OYWA 3HKWA 4PZOA 3GMGA 4M3XA 3EVOA 1NI3A 3LWLA 2MA1A 5HMYA 3NG8A 3R5DA 1H6KX 1U04A 4MK9A 2MQ8A 2MJUA 3LOUA 1D3WA 2OTJN 2B4JA 4MFFA 1ZOTA 3HMJG 1HHTP 5L39A 1ZQGA 4M3YA 4I2PA 1SXDA 1I94K 4B3OA 4DPXA 3L2WA 1ZQXA 3C46A 3O9TA 5KFKA 4M47A 1TVRB 2ZNYA 1K5OA 4WP8A 1K9MT 1WHXA 4M5DB 4OZ1A 3C6UB 3EZOA 4DEZA 2IVFB 3LDLA 5KPTA 2G8WA 4DQPA 3DOMB 4IQXA 3QEPA 2F7TA 4RW9B 3K57A 3LL3A 3K75D 1YVUA 4ZVOB 2QIFA 2DFLA 4UB6U 3MHYA 4EZ9A 4J9RA 3CQXA 2GNKA 2MKYA 3EW9A 6FDRA 4KHPF 4NLYA 4ICAA 4U8VA 1S1TA 2E1RA 3EM1A 4FN5A 1RABB 1QVGR 1N32J 5M2RA 2LLZA 3JPTA 2DGXA 3P83D 4P4PA 3CJ2A 5J2QB 3MOJB 5DRKA 4KAZA 1O13A 2V67A 4ID8A 4LF6K 4CFDA 2G06A 3PFEA 3H3OB 3D2FA 4DV0J 5AQLA 9ATCB 3TOQA 1CC7A 4C4TA 1T4GA 3G0ZA 3O5TB 5B0GA 1UP1A 4X5VA 4CO2A 1O08A 2XI9A 3FE1A 4B1WB 3IG1B 1F21A 2IYIA 3UI3A 4JV1A 1S22A 4DR4K 1O8BA 2F9WA 3NP5A 5K5MA 2CNLB 4TURA 1NGHA 2BE2B 2ISOA 2EBEA 2JGAA 1VISA 3H08A 5AM3A 4I29A 4FVMA 2N3OA 4OJ1A 1VSMA 2QA2A 3M8WA 2XMWA 1C7YA 3V6HA 1BXNA 1BPEA 2UXCJ 1T9WA 2ZUDA 3HT0A 5AICA 5A8RB 3H0LB 2HVIA 3GZFA 2NPFA 2IY5B 3WQPA 3M6UA 4P2MA 3GCWP 2FZGB 1U1KA 2XG8A 1JLAA 5G5HA 3UWTA 3BYRA 2NS1B 3WQUA 5AQVA 4QW9A 1YKWA 2HHUA 4NE9C 3CCMS 5LMNJ 4K0KK 2L5YA 3SAHA 3DDIA 3QX7A 1AQ6A 5CRXA 1DARA 2LCWA 1BNOA 2BJ9A 4BR0A 4JI3J 1S79A 5ALIA 2O8CA 5GAEI 1NK0A 1Q7YO 4QZIA 1FXLA 1Q8LA 4DOBA 1F1BB 4PQUA 3IG8A 4M5NA 3JQKA 8AT1B 1VQNS 2Y9TA 3V7LA 2HHQA 1N5QA 1REVB 2WAQF 1YVFA 4F3QA 2A1JA 1JLQA 1NGEA 3JTNA 1RBSA 1FCAA 1YIJN 4TSXA 2KD1A 5IWAK 4NZ6A 3T1YJ 2QLJB 2JH1A 4BE1A 3WT0A 5TZVA 2WVCA 4J9VA 2ZHAA 3CSKA 4A61A 2HURA 4FWOA 2DD8S 1KFDA 3F41A 1TL7B 3CT9A 4DL7A 4CNQA 1RHKB 1S49A 4ZPTR 1RP5A 1C0MA 3LGHA 4MT1A 1A6LA 2P9PA 1YBTA 5D0RA 4UOGA 5AK5A 4ZPDA 5KTQA 3O9QA 2ASYA 4FJNA 4DJBA 2MZQA 2Y1RI 5GVQA 3WK8A 2A10A 1YJNS 2DXDA 4ZJQA 8ICQA 3J7YP 4Y1CA 1JJHA 3PNCA 3PJXA 4KGZB 3GDQA 5AQOA 3POTA 1B22A 2DGSA 2LQ9A 1C4CA 4JI0F 8RUCA 3C1ZA 2Z2MA 1WKLA 3KLVA 3TZXA 4GXKA 1O0PA 2DGZA 4ZHRB 2HK2A 1X4EA 1YWXA 3MEDB 4JK8A 4FVUA 3AU6A 1KC8T 1RKJA 5C2GA 1TE2A 3VENA 4NA2A 2J9CA 5H2FU 2GVDA 1JJ4A 1FDBA 2V6AA 5KFFA 2ZJPL 2VICA 4J2DA 4A8KA 3EJMA 3C21A 1WEXA 4DUYK 3PY8A 1JKHB 1ZAXA 2WTUA 5HAOA 5AZIA 4AT1B 1HFEL 3VEWA 4NYPA 3RF9A 5U47A 5HROA 2AZ3A 2ZEJA 3J81U 2D9OA 5JMVA 3IN5A 5EX0A 3QNOA 1X31C 3Q8SB 3RJHA 2HAFA 4BC9A 3HFVA 3VA0A 3EZUA 3ZZRA 4YB6A 3PW5A 2MEWA 3A3NB 1MQ3A 2FYXA 5CHCB 1Q9XA 2KRBA 5BOMA 2RQKA 3L3CA 1QS4A 3CVKA 1FWKA 3B0XA 4ZLJA 9ICQA 2YMQA 1YUWA 5A0LA 2XZDB 4IEEA 5ALXA 1IBMK 1K73O 2GOLA 2V2KA 3DM2A 5IT0A 4DV0F 2CQ3A 4QJFB 3EWGA 1N34F 2W7OA 4K2JA 5BPMA 2O5DA 1BCOA 3P3DA 4KGVB 3KJVA 4M3RA 3OHRA 4JMUA 1Q82O 4P0PA 1JXBA 3W5XA 5DDQC 2DFEA 3PJ9A 3ITHB 1R31A 1DFDA 2G4BA 2JGUA 2WONB 1J9AA 1DLOA 2GHWA 3KKFA 3A8EA 1VLOA 3T19A 4Q45A 4KGKA 4WXOA 4DV2J 4CW7B 2M8HA 4KY3A 3D6RA 1L5UA 3ZT0A 4DSFA 3NAHA 3BY5A 1WYGA 4KH6A 2DY1A 2R3VA 2DQNB 4AYBC 2KHCA 4IG0A 5AK4A 4IFVB 2V7ZA 4ZKAA 5FP0A 2PFNA 2EW9A 4DS4A 1Q18A 4IZ9A 4JWNA 4OJPA 4RW7A 3NOCA 1Q9YA 4F2RA 4RR5A 1UT5A 5KG0A 2CGLA 1W7WA 3VQTA 1SL2A 2EC0A 2OKQA 1PAUB 3DLGB 2D3O1 1RT6B 3P5JA 4KTQA 4NO7A 3KKRA 3K5PA 2VJ5A 2Z0GA 2BABA 3BDEA 5LJWA 2Q0RA 2VG7A 3QEVA 4DS5A 1RBRA 3KD3A 2FIUA 4CCHA 1EIYB 4YORA 4K0KF 2VKQA 3H1VX 2B3TB 3L5KA 5J0YA 2K7JA 1VQ5N 2O8FA 3EVMA 3KJFB 3MM9B 1RT6A 3AV9A 3TABA 4I2PB 4OI6A 2Y9UA 4LF6F 3ZZUA 3M8YA 2YNIA 3QNNA 5GAEP 4AM6A 4X64F 3BYPA 5GMEA 2BV3A 4FZNA 5BREA 4ECYA 1S72N 1RYRA 4YY3F 4Y2YA 2P9UA 1IG6A 2AEMA 4WYBA 3F5AA 1TUWA 1I51B 1YF5L 2GWJA 1HLUA 3DLRA 1VI7A 2DY9A 4B3SF 3FBBA 3TAMB 1SV5B 1MSWD 2FJXA 2RDJA 3NGSA 3THXB 3Q8MA 1IR1A 1KOOA 4CH1A 4LF4K 2R2SA 3QIPA 4C0OC 4JNEA 1FXDA 4P71A 3WUHA 3IFRA 4U7BA 2G1HA 4HACA 1WSFA 2V4JB 4W5RA 4QCLA 4TQRA 4KLSA 4B3RK 4RQ0A 2V8HA 2VIHA 4LF5J 2P9SA 4IEIA 1KLNA 1U1QA 5H1SV 1Q7YT 3GBTA 5BYRA 4KI4A 4IKAA 1S9GA 2QB0B 5I3UA 1IR2A 1X4CA 3MXHP 3PRDA 4H4KC 1RXWA 3THXA 3HHLC 4AE5A 4CLPA 2VG6A 1ED1A 2CAJA 4M5LA 5HI7A 5JJBA 3LDNA 2QYGA 5AQZA 1RBOB 4JI1J 1EWQA 1N36K 5AI5A 4ECUA 4DR3J 4NLPA 4BS2A 3DJCA 3DRSB 5FPNA 4PJ0U 3U02A 1AT1B 3OBYA 3CJRA 4AF1A 1ICEB 2Q1NA 1EJ7L 3NF7A 2XMMA 4UAWA 1YRTA 5KFZA 1UAWA 2E6LA 3O4QA 3CD5A 1UOCA 3MCPA 3C5GA 1U1MA 4W5QA 1XNSA 1X4GA 4GVMA 5IZHA 5AIAA 2W3SA 3CCES 2OPQB 2GMJA 1VK8A 4QYRA 2PFQA 2P1JA 1VHFA 1WDTA 4ELTA 3OL6A 3ZTQA 2A40A 2ZUCA 1HPZB 3AU2A 4JHDA 4CHYA 4FYVB 1SL1A 3FC9A 4XO0A 4WTOB 1X60A 2W1BA 1TVAA 1HWKA 3ZETB 3PVXA 3ZT1A 2FB0A 1Z4UA 1JLFA 3VGSA 3SCJE 1BOTO 3VQ9A 1TL5A 3JSRA 2YXLA 2E1FA 4OLOA 1NOZA 3HHDA 3GFYA 2HNYA 4F92B 1S6PB 2D3ZA 2VBWA 3IAM9 3ZDBA 2YV0X 2HFNA 3LPTA 3MUMP 1CXQA 4CHNA 3TPQA 1T3QA 3CPWM 1HQ2A 5CH7B 4CTAB 4NL9A 5AE3A 2B4VA 3D2NA 2K8GA 1JLEA 3WNEA 2R8KA 1YITS 3KUHA 3IBWA 5ETTA 2CPJA 1BLUA 3L4BC 3PXGa 3MM8A 4FK0A 3KHYA 2NPIA 1N6QB 3HSZA 5D4NA 5BJRA 3VVTA 5KFIA 2E2NA 5J2QA 3KLHA 4ZLPA 4HL9A 4FM2A 1C20A 1QQCA 3IXQA 3R5CA 4JI4J 4BXOA 1WWHA 1AUSL 2KOBA 3M9OB 4I7FA 4M9NA 3LDQA 1COOA 5DKWA 2YHWA 4E7JA 4HHTA 3RJEA 3DI6A 2XY8A 1ZQVA 1O03A 1TL1A 4FKYA 1JALA 1RBUA 5HVGA 3T69A 3IFEA 2W40A 1ELOA 4DB3A 3LGNA 3KDOA 3H20A 1QJHA 2L48A 4KLMA 1XSLA 1E6VA 3MGVA 3ZC4A 4YDXA 2P9NB 1AA1B 3FJ2A 3ZTPA 2ZBCA 3R8YA 3GV8B 1GLEG 3QWPA 3MAAA 3FEZA 3VF2A 5ALPA 3C6AA 4QR0A 3BS5B 1E6YB 2LQBA 1TV6A 4Y2CA 2MSTA 3HWTA 4KHSA 1WF1A 4BRQA 4MJKA 2P6SA 1G2EA 4OMFG 2XTJP 3HM8A 5L1MA 3DLEB 1U02A 4AHVA 2JXJA 2CH6A 3MURP 2A1SA 4O4RA 3WC0A 1ASWA 2BKOA 5A8KA 3VQSA 3EO3A 2DNQA 4J9LA 1N34K 5HHHA 2GVDB 3WXMB 3MMAA 3K5LA 4Q0BB 1VCTA 2FQQB 1SQFA 3M30B 2JVRA 5J0UA 4DTOA 4J2EA 4HVJA 1DTTA 2ACMA 1XMQF 3I6PA 1BPZA 1DY3A 4LR7A 2J0WA 4CI0B 1S9FA 1IN0A 1FRXA 3BZQA 4Y2IA 5GTIU 2YY6A 2E9ZA 4UF4A 4OYZA 1QSSA 4GV6A 4RQMA 2UUCF 3GL1A 1XQIA 4RPYA 1J5OA 5F0WA 2FMSA 3SQ1A 1XEZA 3KIOA 8ATCB 3QWUA 1I5OB 4KKOA 4YDDB 2G8KA 4IOCL 4CHZA 4DV2K 4FWRA 2BRLA 4OYAA 1Q16B 2A3ZA 2IM3A 3QFHA</