2NV3A

Solution structure of l8a mutant of hiv-1 myristoylated matrix protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
GARASVASGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Point mutations in the HIV-1 matrix protein turn off the myristyl switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 34
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2nv3A01
2K4EA 2GOLA 2H3FA 2JMGA 2NV3A 4ICAA 4JMUA 2H3IA 1ECWA 2HMXA 1A6SA 2H3ZA 2LYAA 1TAMA 1ED1A 2N1RA 1L6NA 2LYBA 2K4HA 2H3QA 1HEKA 1UPHA 1HIWA 2H3VA 2K4IA 4IC9A
chains in the Genus database with same CATH superfamily
4I29A 2E5SA 3V6JA 4ED1A 3RRHA 2H3ZA 1TFRA 5KFFA 1Z4OA 1X9WA 2L5YA 1DXSA 4YFKA 2JHDA 4BUGA 4EYHB 4ELVA 1SWWA 1S9FA 2QKQA 1HIWA 3RAXA 2G09A 3BS5B 3T5KA 1L3UA 4OJLA 2K8BB 2CPRA 5DQIA 1ZQJA 2HHUA 3IHQB 1LV5A 3QEAZ 5HNKA 4K4IA 2ASLA 3AU2A 5KG3A 2FLPA 5G5HA 4O3RA 2VKQA 4RQ2A 4KX3A 1TK0A 3SV3A 4C8KA 3BQ7A 2JMGA 5ALHA 3BZKA 4I27A 5DB9A 3MBYA 5CHGA 2I6XA 4KLFA 4DSLA 1NK5A 5GTIU 1RPLA 3E0FA 1KFSA 4OJPA 3ETRA 8ICSA 4ECSA 2G06A 4ECZA 2Y9UA 3ALRA 3C23A 9ICPA 1XS9D 4CGZA 5KFJA 5ALTA 4C8MA 2KG5A 1L3TA 4KLOA 4UAWA 5CJ7A 1TAQA 7ICPA 4M0AA 3NRWA 1ZOLA 3C29A 2KJ5A 4CRXA 2PFPA 3NVVA 4RU9A 4TQRA 4DO9A 1NZBA 5KG6A 3SQIA 4C8OA 2GH1A 4UATA 3HWTA 3GZFA 2JR5A 3QU5A 4MFCA 3T5LA 2RDJA 4CE6A 2HHTA 3ISCA 1S97A 1OUQA 1D9DA 1L7MA 4DFKA 4BX9C 4KTQA 4AYBF 9ICIA 4UB4A 3SD7A 2R8IA 1X9SA 2ZJAA 1BPXA 3HJEA 3D2QA 4ED7A 4LZGA 1LB2B 1L8LA 2FLNA 5AK3A 4O3OA 3KZIU 3RTVA 4P0PA 1BPDA 4ED3A 3WKBA 4O5CA 2EH9A 1ZQTA 2PI5A 4EZ6A 2DQNB 3H0LB 4USAA 2D6FC 4DQPA 3G6VA 1MC8A 1D8BA 2ALZA 2XCPA 3K75D 1PVRA 3EW9A 3ZD9A 4NJ8A 2XVTA 1FEZA 4RQNA 2LM4A 1C7YA 8ICWA 2ZIWB 1S76D 2K4HA 5KFDA 3JPOA 4EEYA 2ATLA 3UMCA 2W9BB 3L4PA 1BVSA 3HKZF 1Z4NA 1SZPA 4F93B 5ALEA 4J9QA 2KVCA 1DK3A 3AM9A 1F5SA 5DBAA 4Q8FA 3BZCA 4O3SA 9ICSA 1N60A 4E0DA 3OGUA 4IR1A 4P4OA 2OH2A 5KFSA 5AK6A 1URJA 5J0QA 2KE7A 5KFXA 5A0LA 4ACOA 4GFJA 4PL1A 3OSNA 2BQ3A 2DUYA 1X42A 5KFHA 8ICRA 5F9NA 2KP7A 5DB6A 2W3SA 5DLFA 2LYHA 3Q8SB 4CF3A 2K60A 5J0UA 5AI0A 3WK9A 1SGGA 3C5FA 1FFVA 3QU2A 4DFJA 3TACB 5J0YA 2UVVA 3WKAA 3ZD8A 2G5IB 4EELA 3T5JA 5ALOA 1L7OA 3GFKB 8ICLA 2JRZA 1X2IA 4R8UA 2YX8A 2KTQA 1QQ5A 2YMPA 1ZQMA 2ZUBA 4C8NA 4EZ9A 4LVSA 2A19A 3CYMA 3FAHA 5KL1B 3ISBA 4DS4A 2Y1JA 7ICVA 2XY7A 2LMRA 2P6UA 4ELUA 3F5AA 4NLZA 2AHOB 3N4MB 4UB2A 1UCVA 3NTUA 4DLEA 5J0PA 4KLDA 4F2RA 4PL2A 5CRXA 5IIMA 2JV3A 4DQQA 1NJWA 3E58A 4FO6A 5ALZA 4IRDA 2EANA 2A1JB 2ZIXB 2KHQA 1S77D 5AKXA 2EQYA 3V7LA 4HYKA 2RQ5A 3TAPA 3RJEA 2LYAA 4YG2A 2F2AB 4JV2A 4RPZA 3H40A 4EEKA 4QWEA 5AKKA 2C2RA 1LVHA 3GILA 2BPFA 3IP4B 4EX7A 2W9CA 4QZ8A 1XU4A 2W3RA 3UQ0A 1SZHA 4ECRA 2R8KA 5KT5A 4B9MA 2MRLA 4IRKA 1NKCA 4YXJA 3ONNA 3K1ZA 3BDPA 1NI3A 2J6SA 3LK9A 4C8LA 5KFKA 1HEKA 3C5GA 1BPZA 3AUOA 2MUTB 2F1IA 2XY6A 5HHHA 5ALMA 8ICYA 1L7PA 3TFRA 1COOA 4R66A 2XI9A 2JEGA 2B6GA 9ICJA 1RYRA 4UARA 3GV7B 3QUTA 3HW8A 3EUB2 4RQ7A 5KT6A 1DK2A 4RPYA 4DSEA 2AGOA 4ED0A 2LYBA 4CF4A 4O3NA 5J2IA 3TADA 2YQEA 2F8LA 4DQRA 2FJ6A 5L1IA 2DFLA 5DGAA 3BS5A 1S0MA 1L8OA 1IXRA 4J9SA 1PVQA 2NRWA 2PMZF 4UB5A 5DG8A 2W7OA 5KG2A 3C21A 3GQCA 4X5VA 3V72A 4XUSA 5AKGA 2JEJA 4Z6EA 4MHVA 8ICZA 1ZD5A 1MSWD 2NO4A 2IOHA 4YR0A 1NK9A 4Y2XA 2W9CB 1X40A 4YQWA 1T4GA 4RUCA 1KTQA 3TAQA 1TE2A 1X9XA 2HOQA 4M6WB 4RQ5A 4IL6U 5KFZA 5D49A 2LM1A 3KZXA 7ICIA 4MFFA 5ALSA 4F5OA 3RJIA 1U4BA 3Q8QB 1DGJA 2CXYA 2ZUCA 3FM9A 4I2FA 2CN1A 2EZZA 2KZZA 5AM5A 2DPJA 1CEZA 4JUZA 5AKYA 1Z1BA 1L3VA 5J2HA 2KKPA 1SKWA 4FZMA 3MABA 2JH7A 4FS2A 5G5GA 4M04A 1A0PA 5HMLA 2FMQA 8ICEA 4PHDA 4UB8U 1HJPA 5AI4A 1UT5A 1TAUA 2F77X 5ALGA 1LKYB 5AI5A 5KFYA 1S0OA 3M6ZA 4DEZA 4ECXA 2P66A 1N2XA 1HUZA 4QWAA 1ZQYA 4RT3A 4UQGA 1V9PA 3HRDD 4C4TA 5KAIU 2VA8A 1D8YA 4DSKA 2W43A 1ZQUA 4GXIA 1NJYA 1T8EA 2BPGA 1P7DA 1L3SA 1SIJA 3K1RB 4U7CA 1J97A 1JMSA 3RH6A 2C2EA 7ICMA 3PSIA 4PZNA 4TQSA 4YR2A 4TURA 8ICHA 2LKYA 3K4GA 4NLGA 2W8KA 1NK4A 2ZTCA 2O6KA 2ISPA 7ICOA 9ICTA 4YP3A 3MGHA 4NLBA 4YCXA 3V6KA 5IILA 2UVWA 3Q8LA 2WAQC 2OCEA 2HSZA 3QXGA 2JZBA 1ED1A 1KDHA 2W9AA 3RBDA 3KHRA 1SKRA 4FE3A 4ZOHC 2B21A 5J2JA 1SKSA 1ZQCA 4DWIA 4ECUA 5AKEA 5AKLA 5DG9A 4IS7A 1F0MA 5KG7A 4NXZA 3IRUA 2VA2A 1Y88A 2K89A 4FBUA 1N63A 1JUDA 1L5UA 1JALA 2MUTA 1KSPA 2R8GA 1SB3C 3Q8RB 4CDGA 2WB1C 2BPCA 3G6XA 1X6JA 4DS5A 3H8MA 8ICUA 2BR0A 3RJKA 4Z6FA 4BXOB 3F2DA 3PR5B 9ICUA 4RQ1A 1KKXA 3RJJA 2G07A 3KBBA 1TAMA 2PFNA 1NOMA 4G3IA 1EXNA 3R9KA 2F3NA 5E79U 3T5HA 2DF4B 5KFLA 4BDPA 3HKZC 4UBBA 3RJFA 5KFBA 1S0VA 3JPQA 4K4GA 5J2CA 3KD3A 5KFVA 5JUMA 2NRXA 2LI6A 4O5EA 3M9OB 2ESEA 5DQHA 4QIWC 3EZ5A 4J03A 1ZQNA 2W8LA 4UB3A 3MR2A 5ALPA 7ICKA 4NY8A 2W11A 1Z00A 5ALXA 3WKEA 2FE9A 7ICUA 1ZQOA 3QEBZ 4ELTA 2D3DA 2QARB 4F5PA 4F3OA 3SV4A 2W54A 3L5KA 3MFIA 1L6NA 2RHFA 1ZD4A 2RLTA 8ICXA 4KLSA 5ALYA 1ZQXA 2IA6A 3ZDEA 3SAHA 2H5XA 4QWDA 1NKBA 1PK1A 5AM4A 2E3TA 3RB6A 4RZRA 3T3FA 7ICGA 3F2CA 4DF8A 2IMWP 3TQ1A 4PGXA 4DFDA 2J6TA 2B0CA 3F53A 5ALLA 4I2IA 9ICLA 3OHAA 1JRPA 4J9PA 1N56A 1ZQPA 4NLKA 2HDOA 3LWLA 3ICXA 4QZAA 8ICVA 3ZDBA 4BWJA 3MFHA 5J29A 1QSLA 3M9MB 4QIWF 2BQUA 1AROP 4IQVA 5KFUA 3AEVA 3MR6A 9ICVA 2PFQA 5EE1A 5KFIA 1GO3F 5DDYA 3EWAA 3RH4A 4OCZA 4PH5A 3WKCA 4RPXA 2NRZA 2BHNA 3H4DA 3TADC 4PHPA 4R65A 3D2SA 1D8LA 4UASA 4LJXA 1KFTA 3SAGA 2ZXHA 1A77A 3OPXA 4QNLA 4YR3A 2ASJA 1BPEA 1S0NA 3KKAC 1QTMA 2XO7A 2KVSA 2JXJA 4F71A 2Q4TA 1OXJA 1PVPA 4US8A 4KLLA 4UAZA 4M47A 5KG0A 1QQ7A 4JB3A 2DWQA 4QZIA 2J6UA 5JTIA 1WUDA 2W03A 5IIIA 4ECTA 3VC8A 3JPSA 2JEIA 5B66U 4UB1A 3AL0B 5KFRA 4C7ZA 1DOQA 2HVHA 1O08A 4YXMA 5EE9A 2ZTDA 2HOFA 8ICIA 2BGWA 1IG6A 5BOMA 2ASDA 5HR7A 1N5WA 4YMMA 3UMGA 5KT4A 1SL2A 4Q8EA 2Y0SF 1T3QA 3SYZA 4JMUA 4B9TA 7ICTA 3QUBA 5CB1A 5ALKA 4M9GA 3NVZA 4J9OA 2YMMA 4I2CA 3O0FA 1SWVA 2KFZA 3BQ0A 4IQWA 3AQEA 4I28A 3H4BA 2M9NA 3RJGA 1ZQ1C 5J0SA 3PX0A 2A3VA 2K4EA 2NRVA 4F4YA 1TK5A 2RP5A 3RB4A 4BWMA 5J0RA 1RZTA 5KFQA 3MR3A 5JU5A 4F92B 2VIXA 3F2BA 4C4RA 4F4XA 5KFAA 5AK4A 2K8AA 5KFOA 4ECYA 2WB1F 3CRXA 2I9GA 2HOIA 2AXTU 1SV0A 4ECWA 5DB8A 1QSSA 3OSPA 2DPIA 3QZ7A 3NGDA 3Q8KA 1MA7A 4EYIB 4DSIA 2A1JA 2FPMA 2ZIXA 4ED2A 4GXJA 1CRXA 2EZXA 3Q8PB 1U47A 2K4PA 2Q0ZX 4PGQA 1XO1A 5D4BA 2KK0A 3J81j 2WTFA 2QARA 9ICCA 5L9XA 2WHEA 4M9NA 1ZQSA 3BS7A 4NWIA 2R8HA 2MAXA 4QZGA 3V7JA 2E8PA 2KIVA 3CNHA 4F91B 4M9JA 3FYHA 3HP6A 3S6JA 4F4ZA 2JH1A 1FIQA 4Q45A 2N1RA 4O9MA 1YT3A 1RYUA 3NVWA 1XO0A 1WWVA 1A76A 5DKWA 8ICAA 3OTQA 3EPGA 3BQTA 5F9LA 5L1JA 3LWMA 2QLTA 2V9WA 2FPLA 4JV1A 2KFNA 3ZI4A 2BCSA 1NJZA 1RXWA 2KD1A 5ALRA 1ZJNA 5EE0A 2Y9TA 2FDRA 4ED8A 2YMQA 4KN7A 2LBOA 3PW7A 4MF2A 3LDAA 5KFNA 5EWFA 3AMZA 2ISOA 1MN8A 1BPYA 5AHXA 4P4PA 2I1QA 8ICOA 1Q3UA 1UT8A 5ALIA 8ICJA 1X9MA 7ICEA 5EWGA 5J0WA 3NS1A 5KFMA 4NL9A 2HBMA 4O3QA 2MSNA 3ISDA 3V7KA 5KT3A 4OJ6A 4KLMA 1ZQKA 8ICPA 1JIHA 3TKAA 2HHQA 5AKZA 5EOZA 2I5HA 3WKDA 1S10A 1C20A 8ICCA 3UXNA 8ICQA 5DG7A 4KITB 3PSTA 1BPBA 5AICA 3GIKA 1A6SA 5ALUA 4F8RA 2W9BA 2Y0SC 4YD2A 3FDSA 2XGQA 7ICHA 4PPXA 3PVXA 1JROA 1VDVA 4K4HA 5KFGA 3KHGA 4B9LA 3GIIA 4F50A 2C22A 2H3VA 2DBYA 2KHVA 5AKIA 1RQNA 3SENA 4AYBC 9ICGA 4QZFA 5H2FU 3RR8A 4DQIA 5AIBA 4MFAA 3UXOA 1KLNA 3H8SA 3GIMA 1KN5A 1S8OA 2GO7A 4C4SA 5JRTA 4I2BA 1ZQQA 1ZQDA 9ICAA 1RXVA 4MEXA 4A8EA 7ICFA 3OHBA 2XICA 1MQ3A 5KL8B 4P0PB 3I76A 3SI8A 3GU3A 2E8MA 2KJ9A 3AU6A 4DL6A 5DLGA 3DEEA 3QYPA 2RRDA 4Y2UA 4YMOA 8ICTA 1F44A 1AQ6A 3WU2U 2YTUA 3IG5A 1B22A 2H3IA 2AU0A 2RDIA 4NV0A 4P0QA 3PO4A 3LYSA 1XWLA 2XC9A 4CCHA 2W7PA 1H38A 1NK6A 3SZ2A 4OJ5A 5AM1A 1T94A 1ZQHA 3EPIA 4Y2RA 3RFAA 2YB4A 5IIJA 2HCFA 3PW5A 2FMSA 1N62A 4F5QA 1FFUA 2C2DA 3C2MA 4IQTA 4Q44A 3V6HA 3E2EA 2YY6A 4KLUA 3WK8A 3PW2A 4KX5A 2OYYA 2QB0B 2HBKA 2QB0A 4J9LA 3MR5A 9ICQA 4I2AA 1D9FA 3C2KA 2CRXA 2G08A 2OM6A 4GC7A 1Z19A 3QNMA 1J2MA 1ZD3A 2MU2A 2ZIUB 2F1HA 1ZQZA 3RF9A 1TVAA 1PK1B 4I2JA 4Y2PA 4M6WA 4FFDA 1KBUA 1QLNA 1ECWA 3U26A 1Z1VA 2W04A 2BZFA 2C28A 4DL4A 2OHFA 8ICKA 4F5NA 2KSOB 1NK7A 1JX4A 3PV8A 2OWOA 5KG1A 3SAFA 3EYZA 5AK5A 2AH5A 3TFSA 3PY8A 3N7PD 4ECQA 3THVA 4KLIA 5HR6A 4DL2A 7ICRA 1WYGA 5CR0A 2WF6A 1UA0A 5J2FA 9ICRA 2XCAA 2KN7A 2KZMA 4Y2SA 5KFEA 2EZYA 2OEHA 1BNPA 3PSFA 5J0TA 1Z00B 2ZJ8A 5J0XA 2V4RA 4G9BA 5L1MA 2VANA 3C1YA 4I2DA 2Z7JA 2BQRA 2WF7A 4J9MA 3C1ZA 5B5EU 2AGPA 4JK1A 3BJYA 3FC4A 5AM3A 3BQ2A 2E8OA 1U49A 4R64A 4DSJA 3DV9A 5AM2A 2BKEA 2VJ4A 1ZQVA 4P2HA 5HHIA 2JGAA 4LZDA 2NV3A 1Q8KA 3HPOA 4ED6A 2G5HB 9ICHA 4JV0A 3TANA 4BXOA 1QQ6A 5IIOA 4IRCA 1JXEA 5J0OA 2W9MA 3MGIA 5KFCA 2IBKA 4TUSA 1RQLA 1ZYQA 2VJ5A 3L3FX 3B9JA 4M9LA 5KFTA 3NRZA 9ICKA 5ALFA 2FI1A 4PGYA 4QZEA 1S5LU 4Y2YA 4F4WA 2R18A 3H0MB 4US9A 3G6YA 2WAQF 4UAVA 4Y2QA 3IDWA 1Q3VA 2HI0A 5J8YC 5J2DA 2W55A 3AQFA 4NL9C 2F44A 4DOCA 4UB6U 3M8RA 4FZLA 1RM6C 2NRTA 4ECVA 2HHWA 2AQ0A 1L7NA 4RUAA 2BDPA 3C28A 3UMBA 4DOAA 4RT2A 4UAUA 1NJXA 1JN3A 4B9VA 1WCNA 4DOBA 3RR7A 4EENA 1OW5A 3RJHA 4YN4A 2PFOA 9ICOA 3H7IA 2YN4A 1T3NA 1SV4A 2ZIVB 5ALWA 5CEHA 3RRGA 2P6RA 4IQUA 5AIAA 2EDUA 3C2LA 8ICNA 2AQ4A 1KQQA 4RNNA 3I1YA 1SL0A 4M2YA 4RQMA 4DFPA 2WFAA 4CNQA 2KJ8A 5AKJA 5F3XB 3TI0A 4Y2VA 4RQ0A 3QUCA 2ZJ5A 5DDMA 4EBCA 5L1LA 3IV6A 2BCQA 5CWRA 1ZJMA 2XY5A 1ZQAA 1IIPA 2EAOA 2NYVA 2KIWA 1SXEA 4O5KA 2LPEA 3CW2C 5D46A 3ZDCA 1WG8A 4J9NA 3OJSA 3IG8A 4KMUA 4XRHA 5AM0A 3CP8A 5KNIA 5KT2A 5C0YA 4Y2TA 4ICAA 2IOFK 3N7SC 5KG4A 4DCCA 1V97A 1ZQGA 1IM4A 7ICQA 5KT7A 4DL3A 2IOFA 4DL5A 4TUPA 1N5XA 3PO5A 1ZD2P 1CUKA 3JPRA 4NLCA 4QZBA 3IM1A 5ALJA 2OXOA 4QW9A 2GWSA 4IC9A 2PXIA 5GTHU 1X6IA 1ZQBA 4OO1J 9ICBA 4PHAA 5AKHA 1IV8A 4AP9A 3KFUF 3QU7A 5BPCA 1ZQIA 1U45A 3HILA 1J2NA 1BGXT 3RB0A 4PHEA 3M6KA 3NASA 3PW0A 4WJ3B 1QCKA 5J2AA 4OD0A 4XQ8A 4ZH4A 1NK0A 7ICNA 1UA1A 2KNJA 3H0RB 4YVZA 1YZ6A 1TKDA 5EE3A 2H3QA 1Q46A 2BDUA 4KLEA 4QZCA 4C80A 4B6JA 3UPQA 4QZHA 3GDXA 7ICSA 2E1EA 4UBCA 2ZXIA 4JWMA 3KHLA 1TK8A 1VLBA 3ORYA 4I2EA 4JWNA 4XA5A 2R8JA 4HAIA 1QSYA 1DGSA 5DBBA 4P0QB 4RQ8A 3N28A 3D6JA 1FO4A 2AJQA 1N61A 2K4IA 3JPPA 3M1YA 2ZUDA 5ALDA 3AN1A 1K5OA 3ETLA 4KLJA 1XSLA 1XNSA 5DGBA 4GXKA 1DRGA 2PMZC 5J2BA 3N7RC 3LVWA 3MC1A 4EBDA 2KSOA 3B0YA 2ZIVA 2F1JA 4FZNA 3PMNA 2Y1IA 8ICBA 1UPHA 1QH9A 4GIBA 3GIJA 2YMLA 2XGPA 3UM9A 2KICA 3RBEA 9ICNA 4QWBA 3WK7A 2KZ3A 3ED5A 3KOOA 1TV9A 1T7PA 3M9NB 2IHNA 2WF9A 3PMLA 3HX0A 9ICEA 4CF5A 4RQ6A 4R8UB 1JI7A 2D8CA 3KTQA 4Z6CA 3I28A 4GLXA 9ICFA 1VJ5A 3SEIA 1KL9A 8ICMA 1SL1A 3WK4A 2F8KA 4P4MA 2P35A 2KV2A 4FS1A 3RH5A 3UXPA 5ALQA 2FPKA 1K1QA 3RB3A 4J9KA 3QX7A 4KLGA 2AGQA 5AI8A 4KLHA 4F2SA 5K4LA 4F5RA 1V85A 1KEJA 3WK6A 4MF8A 2M0NA 5C5JA 2KKVA 4QZDA 4PZOA 4U6PA 2WF8A 2WF5A 4RNMA 3H8JA 5T14A 4OJOA 3M8SA 3WK5A 4RQ3A 1KRPA 3HT3A 5AI9A 4QW8A 8ICGA 5HP4A 2KEYA 4KLTA 4PJ0U 3GV5B 2ES6A 1WWUA 2ODGA 1K1SA 2XIDA 1NK8A 1M6YA 4TUQA 4M9HA 1KW4A 4F4KA 3PNCA 1XC9A 1RYSA 1LKYA 5KTQA 4Y2JA 3PW4A 3A0HU 4MEYA 1ZQFA 4BGDA 1PK3A 4QJFB 2ZG6A 3RAQA 4B9UA 5CA7A 2DL0A 3JPTA 4KLQA 4RQ4A 4EBEA 2A1AA 3DDHA 4O3MA 1RDFA 5TZVA 2JZBB 2KMDA 4UW9A 2DKZA 3NUQA 4R63A 2GLEA 4KN4A 4NM2A 3LVVA 1U9LA 3IN5A 2IHMA 3PZPA 3A0BU 2PKEA 4J9RA 3H8WA 4YD1A 2HHXA 5DBCA 3D2NA 1ZXIA 1ZQEA 4IR9A 2F76X 3SMVA 3Q8MA 2FLLA 1YZ7A 4EX6A 2LHTA 5HMMA 1NNLA 5ALNA 2VA3A 1Z3EB 3UQ2A 5TISU 5J2GA 9ICXA 2UVRA 3GV8B 4QZ9A 3M7DA 4DF4A 1RG6A 1ZETA 5DQGA 2HVIA 3MDAA 7ICLA 2EAMA 1SV0C 4DSFA 5KFPA 3QU4A 2H3FA 2HHSA 1COKA 3T79A 5KAFU 2BCUA 4F72A 4DQSA 1KFDA 4BJQA 2V4QA 4NLNA 2NO5A 3JPNA 3ZDDA 1HUOA 1X66A 4NM1A 1B4FA 2BCVA 2BCRA 5AI6A 3TARA 2ZTEA 3SR6A 1ZQLA 8ICFA 4DFMA 3BQ1A 7ICJA 4QWCA 2E8NA 3QUQA 2HHVA 4Q43A 3OJUA 3VCBA 2ZIWA 3QE9Y 1XSPA 1ZQWA 5IINA 1XSNA 3PR4A 3PX4A 4O3PA 9ICMA 5FP0A 2ZIUA 3MGVA 5ALVA 5CP2A 3F5EA 5KG5A 1ZRMA 4I2HA 4GC6A 4B9SA 1O03A 1CI4A 4DL7A 1B0XA 3QZ8A 1U48A 1NKEA 1V38A 4C7YA 3N97B 4UAYA 5IIKA 4C0ZA 3ZDAA 1MQ2A 1WCLA 4KMOB 2DKXA 1N48A 2GOLA 4YMNA 2EAPA 3NVYA 1JXLA 1ZRNA 5J2EA 3B0XA 4RNOA 4B9NA 2HBJA 2HBLA 3KKAA 2PI4A 1UQVA 5DB7A 4I2GA 2K8CB 5L1KA 4FBTA 3KHHA 1PZNA 2JEFA 2DGZA 4O0IA 2UVUA 2MA1A 1SXDA 5BOLA 2QB1A 2KOBA 3PSPA 2E1FA 1PUZA 1ZQRA 5EWEA 2HMXA 3PX6A 2FMPA 1BNOA 2YB1A 1UHUA 5J8YA 4DLGA 2HW3A 4Z6DA 5J2KA 5KFWA 3MDCA 2G0AA 3QU9A 1B43A 1NZPA 9ICWA
chains in the Genus database with same CATH topology
1WUDA 2E5SA 4AYBC 5A0LA 2W03A 4FZMA 3GZFA 4ACOA 1SZHA 2KEYA 3VC8A 4GFJA 2E1EA 4PL1A 1KBUA 2JH7A 1ECWA 2MRLA 1OUQA 3AL0B 1A0PA 2ZXIA 2H3ZA 2JH1A 2W04A 4BX9C 3F2CA 3ONNA 2VJ5A 2XIDA 3K1ZA 3L3FX 3VCBA 4AYBF 2K89A 2ZIWA 2N1RA 2HOFA 2F77X 1YT3A 1IIPA 3F53A 2JHDA 4BUGA 1XO0A 2KIWA 1HEKA 3D2QA 4CDGA 3M6ZA 4P0QB 5HR7A 3SAFA 2WB1C 4A8EA 1HIWA 3IG8A 3N7PD 2XICA 2K4IA 2G09A 2R18A 2ZIUA 3CP8A 2Y0SF 2ZG6A 3H0MB 4QJFB 4OJLA 3MGVA 3F5EA 5KL8B 2G5IB 5HR6A 5C0YA 4P0PB 4JMUA 4P0PA 4ICAA 2K8BB 3N7SC 2XI9A 2WAQF 3GU3A 3F2DA 2CPRA 2KJ9A 4O3MA 1XNSA 2KD1A 3ICXA 1Q3VA 2DQNB 2PMZC 2G07A 1DRGA 1TAMA 3H0LB 3N7RC 1P7DA 3NUQA 2D6FC 2YX8A 2LYBA 3O0FA 3LVWA 3AQFA 3DEEA 1D8BA 2LBOA 2F8LA 4U7CA 2ZIVA 3AQEA 3LVVA 3PSFA 1PVRA 4FZNA 4QIWF 2RRDA 3IN5A 4FZLA 3PZPA 4NLCA 2DF4B 1UPHA 1ZQ1C 3CYMA 4C0ZA 2VKQA 5KL1B 2OXOA 1F44A 3PSIA 2XVTA 4KX3A 4IC9A 4KMOB 3HKZC 2A3VA 3D2NA 2K4EA 2KICA 3C28A 2GOLA 2RP5A 3IG5A 1PVQA 2F76X 2LKYA 2JMGA 3SMVA 2PMZF 3F5AA 4OO1J 2H3IA 4NV0A 4P0QA 1Q3UA 2W7OA 3LYSA 2LHTA 2Z7JA 3KFUF 2VIXA 1GO3F 2HBJA 2ZIWB 2W7PA 3F2BA 2HBLA 2HBMA 4PL2A 5CRXA 2K4HA 3E0FA 4OJ5A 2K8AA 2WB1F 4QIWC 3CRXA 4OJ6A 4OJPA 2K8CB 3M6KA 1T94A 3M7DA 2HOIA 3D2SA 4WJ3B 2ZIXB 3RFAA 2DGZA 2G06A 2KHQA 2YB4A 4NLBA 2KV2A 2VJ4A 3SAGA 2MA1A 2ZXHA 2JGAA 3ALRA 3HKZF 2KOBA 2ZIVB 3OPXA 2H3FA 2HOQA 2KNJA 2NV3A 3PSPA 2E1FA 4QNLA 3T79A 1MA7A 2KVCA 3KZXA 2WAQC 2HMXA 3PSTA 2G5HB 4BJQA 4CGZA 1A6SA 2ZIXA 1CRXA 3H0RB 2LYAA 2OYYA 2Y0SC 1ED1A 4KX5A 2HBKA 2M0NA 2Q4TA 2F2AB 2YB1A 1L6NA 1PVPA 2CN1A 2KKVA 3NRWA 2H3QA 2RHFA 3C29A 2CRXA 2G08A 2KJ5A 4U6PA 2OH2A 2BDUA 2OM6A 4CRXA 1Z19A 4NWIA 5T14A 4FE3A 2ZIUB 1URJA 4OJOA 1Z1BA 2KKPA 2G0AA 3SQIA 2H3VA 2KHVA 2KJ8A 3RF9A 2GH1A 1NZBA 3SAHA 3IP4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4E A;  2GOL A;  2H3F A;  2JMG A;  2NV3 A;  4ICA A;  4JMU A;  2H3I A;  1ECW A;  2HMX A;  1A6S A;  2H3Z A;  2LYA A;  1TAM A;  1ED1 A;  2N1R A;  1L6N A;  2LYB A;  2K4H A;  2H3Q A;  1HEK A;  1UPH A;  1HIW A;  2H3V A;  2K4I A;  4IC9 A; 
#chains in the Genus database with same CATH topology
 4I29 A;  2E5S A;  3V6J A;  4ED1 A;  3RRH A;  2H3Z A;  1TFR A;  5KFF A;  1Z4O A;  1X9W A;  2L5Y A;  1DXS A;  4YFK A;  2JHD A;  4BUG A;  4EYH B;  4ELV A;  1SWW A;  1S9F A;  2QKQ A;  1HIW A;  3RAX A;  2G09 A;  3BS5 B;  3T5K A;  1L3U A;  4OJL A;  2K8B B;  2CPR A;  5DQI A;  1ZQJ A;  2HHU A;  3IHQ B;  1LV5 A;  3QEA Z;  5HNK A;  4K4I A;  2ASL A;  3AU2 A;  5KG3 A;  2FLP A;  5G5H A;  4O3R A;  2VKQ A;  4RQ2 A;  4KX3 A;  1TK0 A;  3SV3 A;  4C8K A;  3BQ7 A;  2JMG A;  5ALH A;  3BZK A;  4I27 A;  5DB9 A;  3MBY A;  5CHG A;  2I6X A;  4KLF A;  4DSL A;  1NK5 A;  5GTI U;  1RPL A;  3E0F A;  1KFS A;  4OJP A;  3ETR A;  8ICS A;  4ECS A;  2G06 A;  4ECZ A;  2Y9U A;  3ALR A;  3C23 A;  9ICP A;  1XS9 D;  4CGZ A;  5KFJ A;  5ALT A;  4C8M A;  2KG5 A;  1L3T A;  4KLO A;  4UAW A;  5CJ7 A;  1TAQ A;  7ICP A;  4M0A A;  3NRW A;  1ZOL A;  3C29 A;  2KJ5 A;  4CRX A;  2PFP A;  3NVV A;  4RU9 A;  4TQR A;  4DO9 A;  1NZB A;  5KG6 A;  3SQI A;  4C8O A;  2GH1 A;  4UAT A;  3HWT A;  3GZF A;  2JR5 A;  3QU5 A;  4MFC A;  3T5L A;  2RDJ A;  4CE6 A;  2HHT A;  3ISC A;  1S97 A;  1OUQ A;  1D9D A;  1L7M A;  4DFK A;  4BX9 C;  4KTQ A;  4AYB F;  9ICI A;  4UB4 A;  3SD7 A;  2R8I A;  1X9S A;  2ZJA A;  1BPX A;  3HJE A;  3D2Q A;  4ED7 A;  4LZG A;  1LB2 B;  1L8L A;  2FLN A;  5AK3 A;  4O3O A;  3KZI U;  3RTV A;  4P0P A;  1BPD A;  4ED3 A;  3WKB A;  4O5C A;  2EH9 A;  1ZQT A;  2PI5 A;  4EZ6 A;  2DQN B;  3H0L B;  4USA A;  2D6F C;  4DQP A;  3G6V A;  1MC8 A;  1D8B A;  2ALZ A;  2XCP A;  3K75 D;  1PVR A;  3EW9 A;  3ZD9 A;  4NJ8 A;  2XVT A;  1FEZ A;  4RQN A;  2LM4 A;  1C7Y A;  8ICW A;  2ZIW B;  1S76 D;  2K4H A;  5KFD A;  3JPO A;  4EEY A;  2ATL A;  3UMC A;  2W9B B;  3L4P A;  1BVS A;  3HKZ F;  1Z4N A;  1SZP A;  4F93 B;  5ALE A;  4J9Q A;  2KVC A;  1DK3 A;  3AM9 A;  1F5S A;  5DBA A;  4Q8F A;  3BZC A;  4O3S A;  9ICS A;  1N60 A;  4E0D A;  3OGU A;  4IR1 A;  4P4O A;  2OH2 A;  5KFS A;  5AK6 A;  1URJ A;  5J0Q A;  2KE7 A;  5KFX A;  5A0L A;  4ACO A;  4GFJ A;  4PL1 A;  3OSN A;  2BQ3 A;  2DUY A;  1X42 A;  5KFH A;  8ICR A;  5F9N A;  2KP7 A;  5DB6 A;  2W3S A;  5DLF A;  2LYH A;  3Q8S B;  4CF3 A;  2K60 A;  5J0U A;  5AI0 A;  3WK9 A;  1SGG A;  3C5F A;  1FFV A;  3QU2 A;  4DFJ A;  3TAC B;  5J0Y A;  2UVV A;  3WKA A;  3ZD8 A;  2G5I B;  4EEL A;  3T5J A;  5ALO A;  1L7O A;  3GFK B;  8ICL A;  2JRZ A;  1X2I A;  4R8U A;  2YX8 A;  2KTQ A;  1QQ5 A;  2YMP A;  1ZQM A;  2ZUB A;  4C8N A;  4EZ9 A;  4LVS A;  2A19 A;  3CYM A;  3FAH A;  5KL1 B;  3ISB A;  4DS4 A;  2Y1J A;  7ICV A;  2XY7 A;  2LMR A;  2P6U A;  4ELU A;  3F5A A;  4NLZ A;  2AHO B;  3N4M B;  4UB2 A;  1UCV A;  3NTU A;  4DLE A;  5J0P A;  4KLD A;  4F2R A;  4PL2 A;  5CRX A;  5IIM A;  2JV3 A;  4DQQ A;  1NJW A;  3E58 A;  4FO6 A;  5ALZ A;  4IRD A;  2EAN A;  2A1J B;  2ZIX B;  2KHQ A;  1S77 D;  5AKX A;  2EQY A;  3V7L A;  4HYK A;  2RQ5 A;  3TAP A;  3RJE A;  2LYA A;  4YG2 A;  2F2A B;  4JV2 A;  4RPZ A;  3H40 A;  4EEK A;  4QWE A;  5AKK A;  2C2R A;  1LVH A;  3GIL A;  2BPF A;  3IP4 B;  4EX7 A;  2W9C A;  4QZ8 A;  1XU4 A;  2W3R A;  3UQ0 A;  1SZH A;  4ECR A;  2R8K A;  5KT5 A;  4B9M A;  2MRL A;  4IRK A;  1NKC A;  4YXJ A;  3ONN A;  3K1Z A;  3BDP A;  1NI3 A;  2J6S A;  3LK9 A;  4C8L A;  5KFK A;  1HEK A;  3C5G A;  1BPZ A;  3AUO A;  2MUT B;  2F1I A;  2XY6 A;  5HHH A;  5ALM A;  8ICY A;  1L7P A;  3TFR A;  1COO A;  4R66 A;  2XI9 A;  2JEG A;  2B6G A;  9ICJ A;  1RYR A;  4UAR A;  3GV7 B;  3QUT A;  3HW8 A;  3EUB 2;  4RQ7 A;  5KT6 A;  1DK2 A;  4RPY A;  4DSE A;  2AGO A;  4ED0 A;  2LYB A;  4CF4 A;  4O3N A;  5J2I A;  3TAD A;  2YQE A;  2F8L A;  4DQR A;  2FJ6 A;  5L1I A;  2DFL A;  5DGA A;  3BS5 A;  1S0M A;  1L8O A;  1IXR A;  4J9S A;  1PVQ A;  2NRW A;  2PMZ F;  4UB5 A;  5DG8 A;  2W7O A;  5KG2 A;  3C21 A;  3GQC A;  4X5V A;  3V72 A;  4XUS A;  5AKG A;  2JEJ A;  4Z6E A;  4MHV A;  8ICZ A;  1ZD5 A;  1MSW D;  2NO4 A;  2IOH A;  4YR0 A;  1NK9 A;  4Y2X A;  2W9C B;  1X40 A;  4YQW A;  1T4G A;  4RUC A;  1KTQ A;  3TAQ A;  1TE2 A;  1X9X A;  2HOQ A;  4M6W B;  4RQ5 A;  4IL6 U;  5KFZ A;  5D49 A;  2LM1 A;  3KZX A;  7ICI A;  4MFF A;  5ALS A;  4F5O A;  3RJI A;  1U4B A;  3Q8Q B;  1DGJ A;  2CXY A;  2ZUC A;  3FM9 A;  4I2F A;  2CN1 A;  2EZZ A;  2KZZ A;  5AM5 A;  2DPJ A;  1CEZ A;  4JUZ A;  5AKY A;  1Z1B A;  1L3V A;  5J2H A;  2KKP A;  1SKW A;  4FZM A;  3MAB A;  2JH7 A;  4FS2 A;  5G5G A;  4M04 A;  1A0P A;  5HML A;  2FMQ A;  8ICE A;  4PHD A;  4UB8 U;  1HJP A;  5AI4 A;  1UT5 A;  1TAU A;  2F77 X;  5ALG A;  1LKY B;  5AI5 A;  5KFY A;  1S0O A;  3M6Z A;  4DEZ A;  4ECX A;  2P66 A;  1N2X A;  1HUZ A;  4QWA A;  1ZQY A;  4RT3 A;  4UQG A;  1V9P A;  3HRD D;  4C4T A;  5KAI U;  2VA8 A;  1D8Y A;  4DSK A;  2W43 A;  1ZQU A;  4GXI A;  1NJY A;  1T8E A;  2BPG A;  1P7D A;  1L3S A;  1SIJ A;  3K1R B;  4U7C A;  1J97 A;  1JMS A;  3RH6 A;  2C2E A;  7ICM A;  3PSI A;  4PZN A;  4TQS A;  4YR2 A;  4TUR A;  8ICH A;  2LKY A;  3K4G A;  4NLG A;  2W8K A;  1NK4 A;  2ZTC A;  2O6K A;  2ISP A;  7ICO A;  9ICT A;  4YP3 A;  3MGH A;  4NLB A;  4YCX A;  3V6K A;  5IIL A;  2UVW A;  3Q8L A;  2WAQ C;  2OCE A;  2HSZ A;  3QXG A;  2JZB A;  1ED1 A;  1KDH A;  2W9A A;  3RBD A;  3KHR A;  1SKR A;  4FE3 A;  4ZOH C;  2B21 A;  5J2J A;  1SKS A;  1ZQC A;  4DWI A;  4ECU A;  5AKE A;  5AKL A;  5DG9 A;  4IS7 A;  1F0M A;  5KG7 A;  4NXZ A;  3IRU A;  2VA2 A;  1Y88 A;  2K89 A;  4FBU A;  1N63 A;  1JUD A;  1L5U A;  1JAL A;  2MUT A;  1KSP A;  2R8G A;  1SB3 C;  3Q8R B;  4CDG A;  2WB1 C;  2BPC A;  3G6X A;  1X6J A;  4DS5 A;  3H8M A;  8ICU A;  2BR0 A;  3RJK A;  4Z6F A;  4BXO B;  3F2D A;  3PR5 B;  9ICU A;  4RQ1 A;  1KKX A;  3RJJ A;  2G07 A;  3KBB A;  1TAM A;  2PFN A;  1NOM A;  4G3I A;  1EXN A;  3R9K A;  2F3N A;  5E79 U;  3T5H A;  2DF4 B;  5KFL A;  4BDP A;  3HKZ C;  4UBB A;  3RJF A;  5KFB A;  1S0V A;  3JPQ A;  4K4G A;  5J2C A;  3KD3 A;  5KFV A;  5JUM A;  2NRX A;  2LI6 A;  4O5E A;  3M9O B;  2ESE A;  5DQH A;  4QIW C;  3EZ5 A;  4J03 A;  1ZQN A;  2W8L A;  4UB3 A;  3MR2 A;  5ALP A;  7ICK A;  4NY8 A;  2W11 A;  1Z00 A;  5ALX A;  3WKE A;  2FE9 A;  7ICU A;  1ZQO A;  3QEB Z;  4ELT A;  2D3D A;  2QAR B;  4F5P A;  4F3O A;  3SV4 A;  2W54 A;  3L5K A;  3MFI A;  1L6N A;  2RHF A;  1ZD4 A;  2RLT A;  8ICX A;  4KLS A;  5ALY A;  1ZQX A;  2IA6 A;  3ZDE A;  3SAH A;  2H5X A;  4QWD A;  1NKB A;  1PK1 A;  5AM4 A;  2E3T A;  3RB6 A;  4RZR A;  3T3F A;  7ICG A;  3F2C A;  4DF8 A;  2IMW P;  3TQ1 A;  4PGX A;  4DFD A;  2J6T A;  2B0C A;  3F53 A;  5ALL A;  4I2I A;  9ICL A;  3OHA A;  1JRP A;  4J9P A;  1N56 A;  1ZQP A;  4NLK A;  2HDO A;  3LWL A;  3ICX A;  4QZA A;  8ICV A;  3ZDB A;  4BWJ A;  3MFH A;  5J29 A;  1QSL A;  3M9M B;  4QIW F;  2BQU A;  1ARO P;  4IQV A;  5KFU A;  3AEV A;  3MR6 A;  9ICV A;  2PFQ A;  5EE1 A;  5KFI A;  1GO3 F;  5DDY A;  3EWA A;  3RH4 A;  4OCZ A;  4PH5 A;  3WKC A;  4RPX A;  2NRZ A;  2BHN A;  3H4D A;  3TAD C;  4PHP A;  4R65 A;  3D2S A;  1D8L A;  4UAS A;  4LJX A;  1KFT A;  3SAG A;  2ZXH A;  1A77 A;  3OPX A;  4QNL A;  4YR3 A;  2ASJ A;  1BPE A;  1S0N A;  3KKA C;  1QTM A;  2XO7 A;  2KVS A;  2JXJ A;  4F71 A;  2Q4T A;  1OXJ A;  1PVP A;  4US8 A;  4KLL A;  4UAZ A;  4M47 A;  5KG0 A;  1QQ7 A;  4JB3 A;  2DWQ A;  4QZI A;  2J6U A;  5JTI A;  1WUD A;  2W03 A;  5III A;  4ECT A;  3VC8 A;  3JPS A;  2JEI A;  5B66 U;  4UB1 A;  3AL0 B;  5KFR A;  4C7Z A;  1DOQ A;  2HVH A;  1O08 A;  4YXM A;  5EE9 A;  2ZTD A;  2HOF A;  8ICI A;  2BGW A;  1IG6 A;  5BOM A;  2ASD A;  5HR7 A;  1N5W A;  4YMM A;  3UMG A;  5KT4 A;  1SL2 A;  4Q8E A;  2Y0S F;  1T3Q A;  3SYZ A;  4JMU A;  4B9T A;  7ICT A;  3QUB A;  5CB1 A;  5ALK A;  4M9G A;  3NVZ A;  4J9O A;  2YMM A;  4I2C A;  3O0F A;  1SWV A;  2KFZ A;  3BQ0 A;  4IQW A;  3AQE A;  4I28 A;  3H4B A;  2M9N A;  3RJG A;  1ZQ1 C;  5J0S A;  3PX0 A;  2A3V A;  2K4E A;  2NRV A;  4F4Y A;  1TK5 A;  2RP5 A;  3RB4 A;  4BWM A;  5J0R A;  1RZT A;  5KFQ A;  3MR3 A;  5JU5 A;  4F92 B;  2VIX A;  3F2B A;  4C4R A;  4F4X A;  5KFA A;  5AK4 A;  2K8A A;  5KFO A;  4ECY A;  2WB1 F;  3CRX A;  2I9G A;  2HOI A;  2AXT U;  1SV0 A;  4ECW A;  5DB8 A;  1QSS A;  3OSP A;  2DPI A;  3QZ7 A;  3NGD A;  3Q8K A;  1MA7 A;  4EYI B;  4DSI A;  2A1J A;  2FPM A;  2ZIX A;  4ED2 A;  4GXJ A;  1CRX A;  2EZX A;  3Q8P B;  1U47 A;  2K4P A;  2Q0Z X;  4PGQ A;  1XO1 A;  5D4B A;  2KK0 A;  3J81 j;  2WTF A;  2QAR A;  9ICC A;  5L9X A;  2WHE A;  4M9N A;  1ZQS A;  3BS7 A;  4NWI A;  2R8H A;  2MAX A;  4QZG A;  3V7J A;  2E8P A;  2KIV A;  3CNH A;  4F91 B;  4M9J A;  3FYH A;  3HP6 A;  3S6J A;  4F4Z A;  2JH1 A;  1FIQ A;  4Q45 A;  2N1R A;  4O9M A;  1YT3 A;  1RYU A;  3NVW A;  1XO0 A;  1WWV A;  1A76 A;  5DKW A;  8ICA A;  3OTQ A;  3EPG A;  3BQT A;  5F9L A;  5L1J A;  3LWM A;  2QLT A;  2V9W A;  2FPL A;  4JV1 A;  2KFN A;  3ZI4 A;  2BCS A;  1NJZ A;  1RXW A;  2KD1 A;  5ALR A;  1ZJN A;  5EE0 A;  2Y9T A;  2FDR A;  4ED8 A;  2YMQ A;  4KN7 A;  2LBO A;  3PW7 A;  4MF2 A;  3LDA A;  5KFN A;  5EWF A;  3AMZ A;  2ISO A;  1MN8 A;  1BPY A;  5AHX A;  4P4P A;  2I1Q A;  8ICO A;  1Q3U A;  1UT8 A;  5ALI A;  8ICJ A;  1X9M A;  7ICE A;  5EWG A;  5J0W A;  3NS1 A;  5KFM A;  4NL9 A;  2HBM A;  4O3Q A;  2MSN A;  3ISD A;  3V7K A;  5KT3 A;  4OJ6 A;  4KLM A;  1ZQK A;  8ICP A;  1JIH A;  3TKA A;  2HHQ A;  5AKZ A;  5EOZ A;  2I5H A;  3WKD A;  1S10 A;  1C20 A;  8ICC A;  3UXN A;  8ICQ A;  5DG7 A;  4KIT B;  3PST A;  1BPB A;  5AIC A;  3GIK A;  1A6S A;  5ALU A;  4F8R A;  2W9B A;  2Y0S C;  4YD2 A;  3FDS A;  2XGQ A;  7ICH A;  4PPX A;  3PVX A;  1JRO A;  1VDV A;  4K4H A;  5KFG A;  3KHG A;  4B9L A;  3GII A;  4F50 A;  2C22 A;  2H3V A;  2DBY A;  2KHV A;  5AKI A;  1RQN A;  3SEN A;  4AYB C;  9ICG A;  4QZF A;  5H2F U;  3RR8 A;  4DQI A;  5AIB A;  4MFA A;  3UXO A;  1KLN A;  3H8S A;  3GIM A;  1KN5 A;  1S8O A;  2GO7 A;  4C4S A;  5JRT A;  4I2B A;  1ZQQ A;  1ZQD A;  9ICA A;  1RXV A;  4MEX A;  4A8E A;  7ICF A;  3OHB A;  2XIC A;  1MQ3 A;  5KL8 B;  4P0P B;  3I76 A;  3SI8 A;  3GU3 A;  2E8M A;  2KJ9 A;  3AU6 A;  4DL6 A;  5DLG A;  3DEE A;  3QYP A;  2RRD A;  4Y2U A;  4YMO A;  8ICT A;  1F44 A;  1AQ6 A;  3WU2 U;  2YTU A;  3IG5 A;  1B22 A;  2H3I A;  2AU0 A;  2RDI A;  4NV0 A;  4P0Q A;  3PO4 A;  3LYS A;  1XWL A;  2XC9 A;  4CCH A;  2W7P A;  1H38 A;  1NK6 A;  3SZ2 A;  4OJ5 A;  5AM1 A;  1T94 A;  1ZQH A;  3EPI A;  4Y2R A;  3RFA A;  2YB4 A;  5IIJ A;  2HCF A;  3PW5 A;  2FMS A;  1N62 A;  4F5Q A;  1FFU A;  2C2D A;  3C2M A;  4IQT A;  4Q44 A;  3V6H A;  3E2E A;  2YY6 A;  4KLU A;  3WK8 A;  3PW2 A;  4KX5 A;  2OYY A;  2QB0 B;  2HBK A;  2QB0 A;  4J9L A;  3MR5 A;  9ICQ A;  4I2A A;  1D9F A;  3C2K A;  2CRX A;  2G08 A;  2OM6 A;  4GC7 A;  1Z19 A;  3QNM A;  1J2M A;  1ZD3 A;  2MU2 A;  2ZIU B;  2F1H A;  1ZQZ A;  3RF9 A;  1TVA A;  1PK1 B;  4I2J A;  4Y2P A;  4M6W A;  4FFD A;  1KBU A;  1QLN A;  1ECW A;  3U26 A;  1Z1V A;  2W04 A;  2BZF A;  2C28 A;  4DL4 A;  2OHF A;  8ICK A;  4F5N A;  2KSO B;  1NK7 A;  1JX4 A;  3PV8 A;  2OWO A;  5KG1 A;  3SAF A;  3EYZ A;  5AK5 A;  2AH5 A;  3TFS A;  3PY8 A;  3N7P D;  4ECQ A;  3THV A;  4KLI A;  5HR6 A;  4DL2 A;  7ICR A;  1WYG A;  5CR0 A;  2WF6 A;  1UA0 A;  5J2F A;  9ICR A;  2XCA A;  2KN7 A;  2KZM A;  4Y2S A;  5KFE A;  2EZY A;  2OEH A;  1BNP A;  3PSF A;  5J0T A;  1Z00 B;  2ZJ8 A;  5J0X A;  2V4R A;  4G9B A;  5L1M A;  2VAN A;  3C1Y A;  4I2D A;  2Z7J A;  2BQR A;  2WF7 A;  4J9M A;  3C1Z A;  5B5E U;  2AGP A;  4JK1 A;  3BJY A;  3FC4 A;  5AM3 A;  3BQ2 A;  2E8O A;  1U49 A;  4R64 A;  4DSJ A;  3DV9 A;  5AM2 A;  2BKE A;  2VJ4 A;  1ZQV A;  4P2H A;  5HHI A;  2JGA A;  4LZD A;  2NV3 A;  1Q8K A;  3HPO A;  4ED6 A;  2G5H B;  9ICH A;  4JV0 A;  3TAN A;  4BXO A;  1QQ6 A;  5IIO A;  4IRC A;  1JXE A;  5J0O A;  2W9M A;  3MGI A;  5KFC A;  2IBK A;  4TUS A;  1RQL A;  1ZYQ A;  2VJ5 A;  3L3F X;  3B9J A;  4M9L A;  5KFT A;  3NRZ A;  9ICK A;  5ALF A;  2FI1 A;  4PGY A;  4QZE A;  1S5L U;  4Y2Y A;  4F4W A;  2R18 A;  3H0M B;  4US9 A;  3G6Y A;  2WAQ F;  4UAV A;  4Y2Q A;  3IDW A;  1Q3V A;  2HI0 A;  5J8Y C;  5J2D A;  2W55 A;  3AQF A;  4NL9 C;  2F44 A;  4DOC A;  4UB6 U;  3M8R A;  4FZL A;  1RM6 C;  2NRT A;  4ECV A;  2HHW A;  2AQ0 A;  1L7N A;  4RUA A;  2BDP A;  3C28 A;  3UMB A;  4DOA A;  4RT2 A;  4UAU A;  1NJX A;  1JN3 A;  4B9V A;  1WCN A;  4DOB A;  3RR7 A;  4EEN A;  1OW5 A;  3RJH A;  4YN4 A;  2PFO A;  9ICO A;  3H7I A;  2YN4 A;  1T3N A;  1SV4 A;  2ZIV B;  5ALW A;  5CEH A;  3RRG A;  2P6R A;  4IQU A;  5AIA A;  2EDU A;  3C2L A;  8ICN A;  2AQ4 A;  1KQQ A;  4RNN A;  3I1Y A;  1SL0 A;  4M2Y A;  4RQM A;  4DFP A;  2WFA A;  4CNQ A;  2KJ8 A;  5AKJ A;  5F3X B;  3TI0 A;  4Y2V A;  4RQ0 A;  3QUC A;  2ZJ5 A;  5DDM A;  4EBC A;  5L1L A;  3IV6 A;  2BCQ A;  5CWR A;  1ZJM A;  2XY5 A;  1ZQA A;  1IIP A;  2EAO A;  2NYV A;  2KIW A;  1SXE A;  4O5K A;  2LPE A;  3CW2 C;  5D46 A;  3ZDC A;  1WG8 A;  4J9N A;  3OJS A;  3IG8 A;  4KMU A;  4XRH A;  5AM0 A;  3CP8 A;  5KNI A;  5KT2 A;  5C0Y A;  4Y2T A;  4ICA A;  2IOF K;  3N7S C;  5KG4 A;  4DCC A;  1V97 A;  1ZQG A;  1IM4 A;  7ICQ A;  5KT7 A;  4DL3 A;  2IOF A;  4DL5 A;  4TUP A;  1N5X A;  3PO5 A;  1ZD2 P;  1CUK A;  3JPR A;  4NLC A;  4QZB A;  3IM1 A;  5ALJ A;  2OXO A;  4QW9 A;  2GWS A;  4IC9 A;  2PXI A;  5GTH U;  1X6I A;  1ZQB A;  4OO1 J;  9ICB A;  4PHA A;  5AKH A;  1IV8 A;  4AP9 A;  3KFU F;  3QU7 A;  5BPC A;  1ZQI A;  1U45 A;  3HIL A;  1J2N A;  1BGX T;  3RB0 A;  4PHE A;  3M6K A;  3NAS A;  3PW0 A;  4WJ3 B;  1QCK A;  5J2A A;  4OD0 A;  4XQ8 A;  4ZH4 A;  1NK0 A;  7ICN A;  1UA1 A;  2KNJ A;  3H0R B;  4YVZ A;  1YZ6 A;  1TKD A;  5EE3 A;  2H3Q A;  1Q46 A;  2BDU A;  4KLE A;  4QZC A;  4C80 A;  4B6J A;  3UPQ A;  4QZH A;  3GDX A;  7ICS A;  2E1E A;  4UBC A;  2ZXI A;  4JWM A;  3KHL A;  1TK8 A;  1VLB A;  3ORY A;  4I2E A;  4JWN A;  4XA5 A;  2R8J A;  4HAI A;  1QSY A;  1DGS A;  5DBB A;  4P0Q B;  4RQ8 A;  3N28 A;  3D6J A;  1FO4 A;  2AJQ A;  1N61 A;  2K4I A;  3JPP A;  3M1Y A;  2ZUD A;  5ALD A;  3AN1 A;  1K5O A;  3ETL A;  4KLJ A;  1XSL A;  1XNS A;  5DGB A;  4GXK A;  1DRG A;  2PMZ C;  5J2B A;  3N7R C;  3LVW A;  3MC1 A;  4EBD A;  2KSO A;  3B0Y A;  2ZIV A;  2F1J A;  4FZN A;  3PMN A;  2Y1I A;  8ICB A;  1UPH A;  1QH9 A;  4GIB A;  3GIJ A;  2YML A;  2XGP A;  3UM9 A;  2KIC A;  3RBE A;  9ICN A;  4QWB A;  3WK7 A;  2KZ3 A;  3ED5 A;  3KOO A;  1TV9 A;  1T7P A;  3M9N B;  2IHN A;  2WF9 A;  3PML A;  3HX0 A;  9ICE A;  4CF5 A;  4RQ6 A;  4R8U B;  1JI7 A;  2D8C A;  3KTQ A;  4Z6C A;  3I28 A;  4GLX A;  9ICF A;  1VJ5 A;  3SEI A;  1KL9 A;  8ICM A;  1SL1 A;  3WK4 A;  2F8K A;  4P4M A;  2P35 A;  2KV2 A;  4FS1 A;  3RH5 A;  3UXP A;  5ALQ A;  2FPK A;  1K1Q A;  3RB3 A;  4J9K A;  3QX7 A;  4KLG A;  2AGQ A;  5AI8 A;  4KLH A;  4F2S A;  5K4L A;  4F5R A;  1V85 A;  1KEJ A;  3WK6 A;  4MF8 A;  2M0N A;  5C5J A;  2KKV A;  4QZD A;  4PZO A;  4U6P A;  2WF8 A;  2WF5 A;  4RNM A;  3H8J A;  5T14 A;  4OJO A;  3M8S A;  3WK5 A;  4RQ3 A;  1KRP A;  3HT3 A;  5AI9 A;  4QW8 A;  8ICG A;  5HP4 A;  2KEY A;  4KLT A;  4PJ0 U;  3GV5 B;  2ES6 A;  1WWU A;  2ODG A;  1K1S A;  2XID A;  1NK8 A;  1M6Y A;  4TUQ A;  4M9H A;  1KW4 A;  4F4K A;  3PNC A;  1XC9 A;  1RYS A;  1LKY A;  5KTQ A;  4Y2J A;  3PW4 A;  3A0H U;  4MEY A;  1ZQF A;  4BGD A;  1PK3 A;  4QJF B;  2ZG6 A;  3RAQ A;  4B9U A;  5CA7 A;  2DL0 A;  3JPT A;  4KLQ A;  4RQ4 A;  4EBE A;  2A1A A;  3DDH A;  4O3M A;  1RDF A;  5TZV A;  2JZB B;  2KMD A;  4UW9 A;  2DKZ A;  3NUQ A;  4R63 A;  2GLE A;  4KN4 A;  4NM2 A;  3LVV A;  1U9L A;  3IN5 A;  2IHM A;  3PZP A;  3A0B U;  2PKE A;  4J9R A;  3H8W A;  4YD1 A;  2HHX A;  5DBC A;  3D2N A;  1ZXI A;  1ZQE A;  4IR9 A;  2F76 X;  3SMV A;  3Q8M A;  2FLL A;  1YZ7 A;  4EX6 A;  2LHT A;  5HMM A;  1NNL A;  5ALN A;  2VA3 A;  1Z3E B;  3UQ2 A;  5TIS U;  5J2G A;  9ICX A;  2UVR A;  3GV8 B;  4QZ9 A;  3M7D A;  4DF4 A;  1RG6 A;  1ZET A;  5DQG A;  2HVI A;  3MDA A;  7ICL A;  2EAM A;  1SV0 C;  4DSF A;  5KFP A;  3QU4 A;  2H3F A;  2HHS A;  1COK A;  3T79 A;  5KAF U;  2BCU A;  4F72 A;  4DQS A;  1KFD A;  4BJQ A;  2V4Q A;  4NLN A;  2NO5 A;  3JPN A;  3ZDD A;  1HUO A;  1X66 A;  4NM1 A;  1B4F A;  2BCV A;  2BCR A;  5AI6 A;  3TAR A;  2ZTE A;  3SR6 A;  1ZQL A;  8ICF A;  4DFM A;  3BQ1 A;  7ICJ A;  4QWC A;  2E8N A;  3QUQ A;  2HHV A;  4Q43 A;  3OJU A;  3VCB A;  2ZIW A;  3QE9 Y;  1XSP A;  1ZQW A;  5IIN A;  1XSN A;  3PR4 A;  3PX4 A;  4O3P A;  9ICM A;  5FP0 A;  2ZIU A;  3MGV A;  5ALV A;  5CP2 A;  3F5E A;  5KG5 A;  1ZRM A;  4I2H A;  4GC6 A;  4B9S A;  1O03 A;  1CI4 A;  4DL7 A;  1B0X A;  3QZ8 A;  1U48 A;  1NKE A;  1V38 A;  4C7Y A;  3N97 B;  4UAY A;  5IIK A;  4C0Z A;  3ZDA A;  1MQ2 A;  1WCL A;  4KMO B;  2DKX A;  1N48 A;  2GOL A;  4YMN A;  2EAP A;  3NVY A;  1JXL A;  1ZRN A;  5J2E A;  3B0X A;  4RNO A;  4B9N A;  2HBJ A;  2HBL A;  3KKA A;  2PI4 A;  1UQV A;  5DB7 A;  4I2G A;  2K8C B;  5L1K A;  4FBT A;  3KHH A;  1PZN A;  2JEF A;  2DGZ A;  4O0I A;  2UVU A;  2MA1 A;  1SXD A;  5BOL A;  2QB1 A;  2KOB A;  3PSP A;  2E1F A;  1PUZ A;  1ZQR A;  5EWE A;  2HMX A;  3PX6 A;  2FMP A;  1BNO A;  2YB1 A;  1UHU A;  5J8Y A;  4DLG A;  2HW3 A;  4Z6D A;  5J2K A;  5KFW A;  3MDC A;  2G0A A;  3QU9 A;  1B43 A;  1NZP A;  9ICW A; 
#chains in the Genus database with same CATH homology
 1WUD A;  2E5S A;  4AYB C;  5A0L A;  2W03 A;  4FZM A;  3GZF A;  4ACO A;  1SZH A;  2KEY A;  3VC8 A;  4GFJ A;  2E1E A;  4PL1 A;  1KBU A;  2JH7 A;  1ECW A;  2MRL A;  1OUQ A;  3AL0 B;  1A0P A;  2ZXI A;  2H3Z A;  2JH1 A;  2W04 A;  4BX9 C;  3F2C A;  3ONN A;  2VJ5 A;  2XID A;  3K1Z A;  3L3F X;  3VCB A;  4AYB F;  2K89 A;  2ZIW A;  2N1R A;  2HOF A;  2F77 X;  1YT3 A;  1IIP A;  3F53 A;  2JHD A;  4BUG A;  1XO0 A;  2KIW A;  1HEK A;  3D2Q A;  4CDG A;  3M6Z A;  4P0Q B;  5HR7 A;  3SAF A;  2WB1 C;  4A8E A;  1HIW A;  3IG8 A;  3N7P D;  2XIC A;  2K4I A;  2G09 A;  2R18 A;  2ZIU A;  3CP8 A;  2Y0S F;  2ZG6 A;  3H0M B;  4QJF B;  4OJL A;  3MGV A;  3F5E A;  5KL8 B;  2G5I B;  5HR6 A;  5C0Y A;  4P0P B;  4JMU A;  4P0P A;  4ICA A;  2K8B B;  3N7S C;  2XI9 A;  2WAQ F;  3GU3 A;  3F2D A;  2CPR A;  2KJ9 A;  4O3M A;  1XNS A;  2KD1 A;  3ICX A;  1Q3V A;  2DQN B;  2PMZ C;  2G07 A;  1DRG A;  1TAM A;  3H0L B;  3N7R C;  1P7D A;  3NUQ A;  2D6F C;  2YX8 A;  2LYB A;  3O0F A;  3LVW A;  3AQF A;  3DEE A;  1D8B A;  2LBO A;  2F8L A;  4U7C A;  2ZIV A;  3AQE A;  3LVV A;  3PSF A;  1PVR A;  4FZN A;  4QIW F;  2RRD A;  3IN5 A;  4FZL A;  3PZP A;  4NLC A;  2DF4 B;  1UPH A;  1ZQ1 C;  3CYM A;  4C0Z A;  2VKQ A;  5KL1 B;  2OXO A;  1F44 A;  3PSI A;  2XVT A;  4KX3 A;  4IC9 A;  4KMO B;  3HKZ C;  2A3V A;  3D2N A;  2K4E A;  2KIC A;  3C28 A;  2GOL A;  2RP5 A;  3IG5 A;  1PVQ A;  2F76 X;  2LKY A;  2JMG A;  3SMV A;  2PMZ F;  3F5A A;  4OO1 J;  2H3I A;  4NV0 A;  4P0Q A;  1Q3U A;  2W7O A;  3LYS A;  2LHT A;  2Z7J A;  3KFU F;  2VIX A;  1GO3 F;  2HBJ A;  2ZIW B;  2W7P A;  3F2B A;  2HBL A;  2HBM A;  4PL2 A;  5CRX A;  2K4H A;  3E0F A;  4OJ5 A;  2K8A A;  2WB1 F;  4QIW C;  3CRX A;  4OJ6 A;  4OJP A;  2K8C B;  3M6K A;  1T94 A;  3M7D A;  2HOI A;  3D2S A;  4WJ3 B;  2ZIX B;  3RFA A;  2DGZ A;  2G06 A;  2KHQ A;  2YB4 A;  4NLB A;  2KV2 A;  2VJ4 A;  3SAG A;  2MA1 A;  2ZXH A;  2JGA A;  3ALR A;  3HKZ F;  2KOB A;  2ZIV B;  3OPX A;  2H3F A;  2HOQ A;  2KNJ A;  2NV3 A;  3PSP A;  2E1F A;  4QNL A;  3T79 A;  1MA7 A;  2KVC A;  3KZX A;  2WAQ C;  2HMX A;  3PST A;  2G5H B;  4BJQ A;  4CGZ A;  1A6S A;  2ZIX A;  1CRX A;  3H0R B;  2LYA A;  2OYY A;  2Y0S C;  1ED1 A;  4KX5 A;  2HBK A;  2M0N A;  2Q4T A;  2F2A B;  2YB1 A;  1L6N A;  1PVP A;  2CN1 A;  2KKV A;  3NRW A;  2H3Q A;  2RHF A;  3C29 A;  2CRX A;  2G08 A;  2KJ5 A;  4U6P A;  2OH2 A;  2BDU A;  2OM6 A;  4CRX A;  1Z19 A;  4NWI A;  5T14 A;  4FE3 A;  2ZIU B;  1URJ A;  4OJO A;  1Z1B A;  2KKP A;  2G0A A;  3SQI A;  2H3V A;  2KHV A;  2KJ8 A;  3RF9 A;  2GH1 A;  1NZB A;  3SAH A;  3IP4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...