2NV3A

Solution structure of l8a mutant of hiv-1 myristoylated matrix protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
b'GARASVASGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Point mutations in the HIV-1 matrix protein turn off the myristyl switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 34
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2nv3A01
2LYBA 2LYAA 2H3VA 2K4EA 2H3IA 2K4IA 1UPHA 1TAMA 2HMXA 2NV3A 1L6NA 4JMUA 1ECWA 4ICAA 2H3ZA 1HEKA 2H3QA 4IC9A 2JMGA 2N1RA 2K4HA 1HIWA 2GOLA 2H3FA 1ED1A 1A6SA
chains in the Genus database with same CATH superfamily
5KFUA 5CP2A 1M6YA 3QZ8A 5KFSA 1L6NA 5KFPA 4J9SA 3C2MA 2R8IA 4KMUA 5DB7A 3C5GA 3M6ZA 2HOQA 1IXRA 1KFDA 2ZIVA 3QU9A 4J9PA 1B0XA 1TAQA 2KV2A 3PW4A 7ICRA 1PVRA 4ED3A 2Q4TA 3M6KA 5ALJA 2R8JA 4CCHA 3AQEA 3OJSA 5AI5A 3F53A 2PFNA 2IOHA 3H40A 5AK5A 4PL2A 4UW9A 3K1RB 4OD0A 2G5IB 1BPDA 1QQ7A 4I2CA 5J2FA 3OHBA 3ISBA 1MA7A 1ZQUA 3QXGA 3FM9A 2ZIXA 9ICMA 4DSKA 2WB1C 1X2IA 1NNLA 2RHFA 4Z6FA 3TFRA 1ZQAA 5J2IA 2W9BA 5A0LA 2YTUA 4RQ6A 4M47A 2QARA 2W9AA 2ZIUB 3KTQA 2RP5A 1SV0A 2L5YA 1JIHA 1BPBA 4Z6DA 4RT2A 2F44A 1YT3A 3G6VA 3AL0B 5EWEA 4KLDA 4DQIA 5IIMA 3Q8LA 2ZTDA 2IBKA 2YQEA 2EZZA 3RJKA 2A19A 3QE9Y 2MUTA 5ALYA 4UASA 8ICIA 3C1ZA 1NI3A 3U26A 1MSWD 5ALSA 3ZD8A 4PH5A 2XC9A 3ZDDA 1V38A 2JGAA 1GO3F 2F1HA 4NV0A 5KFIA 7ICQA 4GXKA 2ZIWB 1KFSA 1X66A 3MR3A 3Q8SB 5EE9A 2E1FA 4TQRA 4F4XA 4RQ2A 3EPGA 9ICKA 2AGQA 7ICPA 1KDHA 5DQIA 1N60A 2ISOA 2ZUBA 4C8MA 5FP0A 5AKLA 2IMWP 5KTQA 5EWFA 4M04A 3QUCA 2DF4B 2A3VA 4LVSA 2Y9TA 4KX3A 4OCZA 2HHQA 3BS5B 2XCAA 7ICHA 5ALPA 3OHAA 5CEHA 4XRHA 5KFAA 1S10A 4UB3A 2ES6A 5L1LA 4EELA 3M7DA 4C80A 1PUZA 2F77X 3I28A 4LZGA 3SV4A 4J9RA 1ECWA 4ICAA 1SKRA 3H8SA 3KZXA 3PO5A 4NLGA 1TFRA 4O3RA 1NK8A 7ICGA 4EYHB 4ELUA 5DGBA 4Q8FA 5J29A 4QIWC 3C2LA 1ZQHA 4O5CA 2KJ9A 2YB4A 2R8HA 4DQRA 5KG3A 4ELTA 3IG8A 4KLMA 1ZQYA 4JV1A 5KFEA 5AM4A 8ICFA 5F9LA 3GZFA 1ZQLA 4X5VA 5AKKA 1KKXA 9ICGA 3NUQA 4CNQA 4P0PB 1L7PA 2DBYA 5J2CA 1FFUA 2FI1A 2F1JA 4ECSA 3V7JA 4Y2SA 4F8RA 2KOBA 2F1IA 7ICMA 2JZBB 2I9GA 7ICJA 2H3QA 4RQ3A 2ZUDA 3J81j 2P35A 3TANA 5AHXA 2HVHA 3E2EA 2GO7A 4KN7A 2OHFA 4MFAA 3IRUA 3PSTA 5ALOA 4J9LA 1XSLA 2QB1A 1ZD4A 4JV0A 2IHNA 3QEAZ 4M2YA 4UQGA 2V4RA 4ED2A 4MHVA 1RM6C 2ODGA 3MDAA 1BPEA 2XCPA 4Y2VA 1L3TA 4MFCA 1A77A 2BDPA 2G08A 1NK0A 4QZ8A 8ICZA 3V6JA 4DEZA 2HHUA 5KFMA 2QKQA 4F93B 2DKZA 3BDPA 5AM3A 5GTIU 3KZIU 4M6WA 4DF8A 3SYZA 4MEYA 1SKWA 2OXOA 5ALQA 5J2GA 5ALWA 3F5EA 3MR6A 2ZIUA 3M9MB 2KVCA 4Y2QA 4UARA 4RQ7A 4O3SA 1O08A 2JEJA 2QB0B 2C2RA 3IDWA 4G9BA 4JV2A 1T3NA 3G6XA 5ALUA 3OPXA 5ALLA 4IRCA 4Z6EA 2HDOA 4KLUA 5DQHA 3Q8RB 1ZRMA 4QZAA 2ZJAA 1F0MA 3T5JA 4MF2A 3GIKA 2BZFA 4WJ3B 3JPTA 2KEYA 2ASDA 1ZQKA 4IRDA 1LVHA 3PSFA 4DL7A 3EZ5A 1A6SA 1ZD2P 3HRDD 4RQ8A 5KFCA 5C0YA 1TAUA 3WKBA 4C8OA 2H3VA 4FBUA 4QWAA 5AK4A 1ZQMA 4NXZA 3BJYA 5KFVA 4B9VA 4KLHA 4I2JA 1ZQTA 2JEGA 2WF8A 8ICWA 3PR5B 4I28A 3TI0A 3EUB2 4TUQA 1LB2B 2FPKA 9ICCA 2KHVA 2BCRA 1JN3A 2ZJ5A 4RUCA 4U7CA 3OJUA 9ICRA 3THVA 1URJA 2NRWA 2OCEA 5DBBA 4ECYA 4PPXA 4MEXA 5KL1B 4OJPA 4QZEA 2PMZC 3CP8A 1N56A 4PZOA 4KLJA 4J9QA 4QZDA 2W04A 4F72A 4XQ8A 2ISPA 4NM2A 2LYBA 2ZIVB 2W9CB 2WAQF 4US8A 5J0PA 4ZH4A 5ALEA 2BR0A 5KFLA 5AI9A 1X40A 1U49A 2BCUA 4RNNA 3I1YA 2HI0A 5IIOA 9ICQA 1BNOA 4QNLA 5J0OA 2C2DA 8ICUA 1ZQWA 4YP3A 4C4SA 5AKJA 4FFDA 4NJ8A 2BQ3A 3Q8PB 1ZQPA 3GILA 2MRLA 2ZTCA 3CNHA 4YFKA 1JROA 2W11A 4Y2PA 4AYBC 3UXOA 3RJGA 4E0DA 4JWNA 3T5LA 8ICMA 4BDPA 5KG5A 2HBKA 2HSZA 2W9BB 3C5FA 3QUQA 2KSOA 9ICBA 2KJ5A 2QARB 1X9XA 5HP4A 3GFKB 1D8LA 1NZBA 3QU5A 4IC9A 5JRTA 5KG4A 2BQUA 4JUZA 3GIMA 9ICWA 2KD1A 1N62A 5HHHA 2R8GA 5JU5A 5DDYA 3TADC 2EAOA 2Y1JA 1ZD3A 3GDXA 2J6SA 2MUTB 4KMOB 2KN7A 4TUPA 1V85A 4KLLA 3PY8A 4R66A 2ZUCA 2CRXA 2OEHA 4FBTA 3SQIA 8ICYA 3DEEA 4YN4A 4ECRA 4NLCA 2W8LA 1NK7A 2P6RA 1BGXT 3V6KA 5DLGA 3TKAA 2AXTU 4BJQA 5CRXA 3QNMA 4M9LA 5AKYA 4O3PA 3QUBA 4FS2A 3R9KA 5IILA 5KG6A 2W43A 8ICEA 4DSJA 4A8EA 5GTHU 1CI4A 2F76X 2W3RA 1KQQA 1A76A 4EENA 2XICA 4YMNA 4TQSA 3PNCA 2DGZA 4C8KA 3V72A 5KT7A 3LYSA 1NKEA 1KW4A 5AM5A 3PX0A 4QW9A 1QCKA 4F91B 1FIQA 8ICPA 4ED6A 4B9SA 1ZQBA 3ZDAA 3ONNA 3LVVA 4YR3A 5BOLA 3AN1A 4PHEA 4DQQA 2XI9A 4F5RA 3MR2A 2MU2A 4JK1A 3H8MA 4DFKA 3KD3A 4IS7A 4OJ5A 5ALVA 1RPLA 3T79A 3GV8B 3H4BA 5KFGA 4M9NA 3JPPA 2EDUA 2JMGA 2JV3A 5ALDA 2LBOA 3D2QA 3RTVA 3WK7A 4DOBA 1RG6A 5BPCA 3T5HA 2W9CA 1N5WA 1Z3EB 4P0QA 4UB5A 4FS1A 1J2MA 4DOCA 4KLGA 2ZG6A 5DB9A 3JPQA 3MC1A 5ALMA 3MABA 9ICPA 1B4FA 3RB4A 5E79U 3QUTA 4DF4A 2FMQA 4CDGA 1SGGA 3K4GA 2AH5A 1DOQA 1OUQA 1FO4A 3RBEA 1SL0A 4RNMA 2JEFA 2JH1A 1HJPA 5KFKA 9ICUA 3C21A 1WCNA 3Q8KA 5DBAA 2NYVA 4M6WB 8ICRA 2XY6A 4ED1A 3BZCA 2DL0A 4HAIA 4GLXA 2RDIA 2KE7A 8ICHA 4AP9A 5AI6A 5DDMA 3EYZA 4PL1A 5KFJA 4G3IA 4DS4A 3DV9A 1KEJA 3KBBA 5ALTA 1N5XA 1ZXIA 3AEVA 3A0BU 5AM2A 3QEBZ 4O3MA 4F4KA 1IG6A 5J0YA 1Q46A 1CUKA 5J0QA 4IR9A 4KLOA 2FJ6A 2HHVA 5DKWA 5HNKA 4DFPA 2V4QA 5TZVA 1ZQRA 4NLZA 4UAUA 3VCBA 4RQ0A 1QLNA 8ICVA 2YMMA 1O03A 3MBYA 3SEIA 2E5SA 1L7OA 1N61A 9ICFA 1X42A 2I1QA 1LV5A 4F2RA 3N28A 1Z19A 4NL9C 4EZ6A 2DPJA 4Q43A 1NK9A 1KSPA 5KFZA 3FDSA 1XNSA 2VA2A 3E58A 5F9NA 3LDAA 2EANA 3VC8A 3T5KA 1NZPA 1NK5A 1HUOA 4K4GA 3IN5A 3ED5A 3IM1A 1BPXA 2QLTA 5EOZA 4QZCA 4DFMA 3WKDA 2LYHA 4Y2YA 4BGDA 5AKEA 1QQ6A 4C0ZA 4F4YA 2D8CA 1DK3A 5HHIA 3UXNA 2Y9UA 3ALRA 4ECXA 1DGJA 4PGQA 3DDHA 1NOMA 3BQ1A 4QWEA 4UAYA 4PHPA 4F92B 1RZTA 3RB6A 4DLEA 2Z7JA 4RQ5A 3RF9A 4B9MA 1D8BA 4NY8A 2KICA 3TARA 5AKZA 4P2HA 3T3FA 5EE3A 4M0AA 1Q8KA 3E0FA 4FZNA 3ZI4A 3M1YA 4IQVA 1ZQ1C 1K1QA 2VA3A 3RAQA 1CEZA 1KLNA 4ELVA 1AQ6A 1N2XA 3HKZF 5L1KA 4YVZA 4RPXA 5JTIA 4O3QA 2KSOB 2WB1F 2BKEA 4QJFB 3SENA 4KLEA 3V7LA 3WK6A 2YN4A 3PW5A 3N7RC 2ESEA 1TKDA 4I2IA 1L3SA 2G07A 2KJ8A 3TQ1A 4I29A 1L8LA 5L1IA 1ZQVA 4PHAA 2E8MA 1VJ5A 3TAPA 1VLBA 1KTQA 1MN8A 4B9LA 2K4HA 9ICEA 2OM6A 3PW0A 2E3TA 1J97A 2M9NA 1DK2A 4PZNA 3RFAA 3G6YA 4RQ1A 4ECWA 1Z1BA 3BS7A 1K1SA 4UB8U 1WWUA 3SAFA 3HP6A 4IL6U 2PFQA 5K4LA 4YR0A 1BPYA 5J0TA 3ZD9A 1MQ3A 8ICAA 3JPOA 3WKAA 5DG8A 7ICSA 5B66U 2ZXIA 2Y1IA 2O6KA 3KOOA 2P6UA 3HJEA 3RB3A 1NK6A 3H4DA 3HW8A 3KHHA 2KKVA 5J2BA 4CGZA 3AMZA 3C29A 4C4TA 3RRGA 3V6HA 2F8KA 3RB0A 1NJWA 3M8SA 2D3DA 4O5EA 1SKSA 2C22A 5KAFU 5CB1A 1RYRA 2IHMA 4PGXA 2EAMA 2AJQA 9ICVA 1Z00A 1NJXA 5ALRA 3SR6A 8ICBA 7ICNA 3RH5A 1U47A 4PJ0U 4UB1A 1JI7A 1OXJA 4DL4A 4M9GA 4KITB 2W7PA 8ICCA 2OH2A 5J2HA 1UCVA 4C8NA 3NASA 5AKGA 3B9JA 4IQWA 7ICFA 3H0MB 3ETRA 3PSPA 4R65A 4YG2A 4Z6CA 1WCLA 1RQLA 1SV4A 5L1JA 2D6FC 2K4EA 1KBUA 2FPLA 2DPIA 3EWAA 2F2AB 4RPYA 2KKPA 4GFJA 2KIWA 3M9OB 3TACB 3TADA 2HBMA 3MFIA 2WF6A 5JUMA 1S0NA 2FLPA 2GLEA 2JHDA 4QWBA 2DQNB 4P0QB 3SV3A 3SMVA 7ICOA 1FFVA 7ICTA 1RYSA 2NRVA 1S0OA 4YQWA 1YZ6A 3FAHA 9ICXA 1TV9A 2K8BB 3UMBA 4KLFA 2J6TA 4NLKA 3RJIA 3RBDA 2H3IA 1NKCA 1P7DA 5CJ7A 2NV3A 4C7YA 3N97B 5IIKA 2W3SA 3WK4A 3M9NB 2Y0SF 3RR7A 1A0PA 5J0WA 1L3VA 8ICOA 3RH4A 1JXLA 5ALXA 1S0MA 2MAXA 1X6JA 2UVWA 3SD7A 1QSYA 4M9HA 3SZ2A 3QYPA 1D9FA 1UT5A 2A1JA 2W7OA 5DBCA 3RJHA 8ICNA 4FZMA 2H3ZA 3C2KA 1U4BA 1QSLA 1KN5A 3ZDCA 3WK8A 1X9MA 1SL1A 5L9XA 1LKYA 3NRZA 3PR4A 2YMLA 4YXJA 2BHNA 4R63A 4J9MA 2J6UA 5KFFA 3TAQA 3EPIA 3NGDA 1ZJMA 3LWMA 1QSSA 3IHQB 1ZETA 4NWIA 5G5HA 3OGUA 2G09A 3KKAC 2IOFA 3KHLA 3HT3A 3QU4A 1U9LA 3UMCA 5J0XA 2VA8A 1SZPA 3L3FX 4DL3A 1ZQEA 2WFAA 2W55A 1H38A 1XSNA 4UBCA 3KHRA 5KNIA 4DQPA 2FLLA 1UHUA 9ICSA 3UQ2A 2HW3A 2B21A 3B0XA 4R8UB 1ZQZA 5ALFA 1HEKA 2DFLA 5DGAA 4YD2A 2N1RA 1NK4A 2KZZA 1PK1B 1WWVA 1ZQGA 1PK3A 4F5NA 2KHQA 5AI8A 1VDVA 4KX5A 3Q8QB 3I76A 4Y2TA 2XO7A 4B9TA 2ASJA 5AIAA 3PW2A 4RQNA 5J8YC 1J2NA 2AGOA 3D2SA 2DUYA 4UAVA 1ZQNA 1U48A 8ICXA 2KIVA 4I27A 1F44A 4EBEA 4OJLA 5KG2A 5KFQA 2BCQA 4USAA 1SWWA 1U45A 4B6JA 3QU2A 2PFPA 4DSFA 3IV6A 3AQFA 1DXSA 2I6XA 4RT3A 5CR0A 1UQVA 4BWMA 2KTQA 4B9UA 2AGPA 8ICKA 1XWLA 5KG1A 4OO1J 3ETLA 4C4RA 5DLFA 4QWDA 4Y2XA 1Y88A 7ICKA 3ZDBA 8ICSA 5KFRA 2Q0ZX 4ECUA 2BDUA 3MFHA 4RZRA 1SWVA 2RLTA 4GC7A 1FEZA 5T14A 4KTQA 4P4MA 2DWQA 2CPRA 1WUDA 1JRPA 4BXOB 1ED1A 3MGVA 3PX6A 2KP7A 3D2NA 4DS5A 2WHEA 1N63A 5HR7A 1ZQXA 5DG7A 4UATA 2G5HB 5KFNA 5EWGA 4J9KA 1BPZA 1ZQJA 4ECTA 5ALKA 5J0RA 4Q44A 2KNJA 4NL9A 5CHGA 1ZQOA 4FE3A 4I2DA 2R18A 4KLTA 2EAPA 3AM9A 3EW9A 1WYGA 5KL8B 2MSNA 3H7IA 4KN4A 4M9JA 3RH6A 1EXNA 5J0SA 3IG5A 1SZHA 1ZJNA 5AI4A 4EX7A 4QZ9A 4LJXA 1ZD5A 3WK5A 4F5OA 3QX7A 3HKZC 1S5LU 3S6JA 2XGQA 2P66A 4C8LA 1Q3UA 4BWJA 2BPFA 4YCXA 3F2BA 4RNOA 1NJYA 4US9A 4I2HA 1L7NA 4DLGA 2W8KA 4K4HA 4CF5A 2BPGA 4TURA 4C7ZA 4GIBA 9ICIA 3HWTA 3OTQA 5KFTA 5KFDA 4I2FA 3IP4B 5IIIA 2W54A 2PI4A 4ECQA 1SXDA 1Z00B 1SB3C 2EQYA 5KFOA 4IR1A 1RDFA 3QU7A 2YMQA 4FO6A 2FMPA 1SXEA 1PZNA 1T94A 4O3NA 3PV8A 5C5JA 2FLNA 2K8AA 2WF5A 3RJJA 1COKA 4R8UA 2XGPA 1S8OA 1IM4A 5BOMA 5CA7A 5J2DA 7ICIA 1PK1A 4BUGA 4I2GA 2JR5A 3UXPA 2G0AA 1BVSA 3N4MB 3F5AA 4JMUA 3PO4A 5ALIA 4F2SA 4RQMA 2BGWA 3AUOA 1TK0A 4F3OA 4OJOA 3Q8MA 4PHDA 2AU0A 2RQ5A 2KK0A 2HBLA 2OWOA 4NLNA 2XVTA 4ZOHC 5AK6A 2I5HA 4GXIA 1QH9A 5ALHA 4QZBA 5KT5A 2AQ4A 1L5UA 4KLSA 4IQTA 4I2BA 1Z1VA 4J03A 3TFSA 4ECVA 1COOA 1B22A 4RPZA 3PW7A 1JX4A 3ORYA 3ISDA 1KL9A 4RU9A 2B0CA 2H3FA 4YMMA 4B9NA 1TK8A 8ICLA 3SAGA 1SV0C 7ICEA 3FC4A 2JH7A 2LYAA 3B0YA 4Y2JA 4GC6A 3CYMA 4Y2RA 4OJ6A 5IIJA 8ICJA 4QZFA 3BQ2A 1ZOLA 2LMRA 3PMNA 4YD1A 4F5PA 3JPNA 1YZ7A 5D49A 4DFJA 4QZHA 4UB6U 2K60A 3O0FA 5DB6A 2LKYA 5B5EU 1BNPA 3RJFA 5AKIA 4P4PA 2HCFA 1UA0A 5J2JA 2M0NA 4BXOA 5KFXA 2ZXHA 4KLIA 2HOFA 4P4OA 2KZ3A 2A1JB 1JXEA 1T4GA 4F4ZA 4XUSA 4CF4A 3HPOA 2WAQC 4CE6A 1QTMA 3KFUF 1ZYQA 3UPQA 4KLQA 4YR2A 1UA1A 3LK9A 2K4IA 1LKYB 1XO0A 1N48A 4EBCA 2BCVA 3UM9A 2LM1A 1S97A 3LVWA 5J0UA 2E1EA 1Q3VA 1HIWA 4F71A 3OSPA 2GOLA 1ZQIA 5KFYA 3H0RB 4U6PA 4UAZA 1NJZA 3GU3A 3PX4A 2Y0SC 4Q45A 2HVIA 5AI0A 4R64A 2ASLA 3JPRA 3H8WA 3C23A 4TUSA 2YX8A 3UQ0A 1MC8A 2IA6A 4UB2A 5AKXA 3ISCA 4CRXA 2KZMA 2XY5A 1Z4OA 2B6GA 5KT3A 2YMPA 3ICXA 2H5XA 2HHTA 3NVWA 1V9PA 4RUAA 2F8LA 2FDRA 3WKEA 1CRXA 5KFWA 2WTFA 2PFOA 4IRKA 5KT2A 3PMLA 4J9OA 2UVRA 4DCCA 5HMLA 3HX0A 9ICLA 1L8OA 4I2EA 2LPEA 3LWLA 4DFDA 2UVVA 2LHTA 4UB4A 3H8JA 1ZRNA 2AQ0A 2LM4A 5ALNA 5EE0A 2E8NA 2R8KA 1T7PA 3NS1A 3MR5A 4NM1A 3CW2C 5KT6A 2V9WA 2PI5A 1SL2A 9ICJA 5F3XB 4MF8A 2ZIWA 1OW5A 2YY6A 5DQGA 1TK5A 3PSIA 5H2FU 2RRDA 5HMMA 4DO9A 3NVVA 4ED8A 2W03A 1V97A 2ZJ8A 2KVSA 1X9SA 3AU2A 2DKXA 1HUZA 4QIWF 5DB8A 2NRTA 3WKCA 3GQCA 2E8OA 2K89A 1F5SA 2HBJA 2XIDA 4O3OA 5AKHA 4QZIA 3H0LB 2ALZA 4HYKA 5KAIU 1KRPA 1ZQFA 3BS5A 4YMOA 4FZLA 4UAWA 3F2DA 1D9DA 5D46A 1S77D 1S9FA 2AHOB 2BQRA 4ACOA 3AU6A 3BQ0A 3UMGA 4DL5A 3KKAA 1JMSA 1SIJA 4F50A 2EZXA 1S76D 4Y2UA 2NRXA 1DRGA 2NRZA 3RJEA 3SAHA 9ICOA 3NTUA 5DG9A 4QWCA 3CRXA 5AM0A 4QW8A 3N7PD 3N7SC 2JEIA 4QZGA 1ZQDA 1C7YA 1JALA 3L5KA 1K5OA 2ZTEA 2IOFK 4EEYA 2OYYA 2VJ5A 2YB1A 3MDCA 1AROP 4YXMA 1RQNA 5D4BA 5KFHA 4ED0A 2EH9A 4DWIA 4O0IA 3PZPA 4MFFA 4PGYA 5EE1A 2PXIA 3JPSA 3RRHA 4JWMA 5J8YA 1RXVA 1UPHA 1ZQCA 2HHWA 2CXYA 3F2CA 4F5QA 4DSIA 4P0PA 4LZDA 2ZIXB 2MA1A 2KMDA 1T8EA 1MQ2A 5G5GA 1S0VA 4Q8EA 5AICA 4I2AA 2GH1A 5HR6A 1XU4A 2PKEA 5TISU 4UBBA 3MGIA 2JZBA 1ZQSA 8ICGA 1XO1A 9ICHA 4IQUA 3MGHA 4EEKA 1X9WA 2HOIA 5KFBA 3WK9A 3HILA 5ALZA 2KFZA 5CWRA 5KG7A 4CF3A 2E8PA 4F4WA 3V7KA 2K8CB 2FE9A 2NO4A 3OSNA 3GV5B 4EX6A 5ALGA 2EZYA 3FYHA 4O9MA 2CN1A 3RAXA 5J2EA 3NRWA 2WF9A 2JXJA 1D8YA 1WG8A 3SI8A 4EZ9A 2BPCA 3PVXA 1L3UA 7ICLA 2RDJA 1T3QA 1UT8A 4J9NA 2WF7A 5AM1A 3NVZA 4DOAA 1IV8A 3C28A 2GWSA 7ICVA 3A0HU 3KHGA 5J2AA 1Z4NA 1ZQQA 5L1MA 2F3NA 2QB0A 3GIIA 2G06A 1XS9D 9ICNA 2C2EA 3K1ZA 5AIBA 5IINA 2VIXA 4ED7A 2VANA 1TVAA 2XY7A 4XA5A 1RYUA 1IIPA 4EBDA 4ECZA 2HHXA 4BX9C 8ICTA 4K4IA 3WU2U 4EYIB 2PMZF 2FMSA 4DSEA 1X6IA 4JB3A 7ICUA 1L7MA 3NVYA 2A1AA 4GXJA 3GIJA 3RR8A 2C28A 8ICQA 1XSPA 2KFNA 1PVQA 2VKQA 3K75D 1B43A 1RXWA 2UVUA 4DQSA 1NKBA 3BQ7A 2NO5A 4RQ4A 2W9MA 1XC9A 4DSLA 3C1YA 4NLBA 3QZ7A 2FPMA 3BQTA 4O5KA 2BCSA 2K4PA 1QQ5A 3BZKA 2HHSA 1TAMA 2ATLA 2HMXA 9ICTA 3GV7B 3L4PA 5J2KA 4DL6A 1C20A 2VJ4A 5AK3A 3M8RA 5KT4A 1KFTA 1JUDA 9ICAA 2JRZA 1PVPA 3ZDEA 2KG5A 5KG0A 2LI6A 4DL2A 3D6JA 1DGSA 4AYBF 1TE2A
chains in the Genus database with same CATH topology
3NRWA 2H3VA 2ZIWB 2KJ5A 4FZLA 4PL1A 2Z7JA 2H3IA 3F2DA 5KL8B 1P7DA 2KKVA 3LVVA 3ONNA 4ACOA 2KOBA 3RF9A 1NZBA 2NV3A 1D8BA 2KICA 2YX8A 1L6NA 2XI9A 4CGZA 2E1FA 3C29A 3D2SA 2Y0SF 2H3QA 4IC9A 1A0PA 3M6ZA 3IG5A 1SZHA 4O3MA 2HOQA 4CRXA 1F44A 2KD1A 2ZIVA 3E0FA 1DRGA 4FZNA 3C28A 3ICXA 4OJ5A 2KHVA 3PSTA 3SAHA 2H3FA 3HKZC 4OJLA 4U7CA 3CRXA 3SAGA 2F8LA 3T79A 3N7PD 3N7SC 1Q3UA 1ZQ1C 1URJA 2JH7A 2LYAA 2KV2A 4KMOB 2W7OA 2G06A 3CYMA 3AQFA 3VCBA 4OJ6A 3K1ZA 1CRXA 1PVRA 3HKZF 2Q4TA 3M6KA 3F2BA 4FZMA 2OYYA 2VIXA 2VJ5A 2DF4B 3AQEA 2A3VA 2E5SA 5KL1B 2H3ZA 2YB1A 3F53A 4KX3A 4OJPA 2W7PA 2PMZC 3CP8A 1IIPA 2G08A 2JMGA 2OH2A 2WB1F 4PL2A 2LBOA 3D2QA 4BX9C 4QJFB 2CRXA 3SQIA 3H0MB 4OO1J 4P0QA 1Z19A 2W04A 3DEEA 3PSPA 4AYBF 3O0FA 2PMZF 3PZPA 3N7RC 3M7DA 4NLCA 2LKYA 1MA7A 2LYBA 2D6FC 2LHTA 2ZIXA 2ZIVB 2K4EA 2G07A 2F77X 2KJ8A 2WAQF 2WB1C 2ZG6A 2M0NA 1UPHA 2RHFA 1KBUA 2OXOA 3IP4B 2BDUA 1ECWA 2VKQA 3F5EA 4BJQA 1PVQA 3F2CA 2ZIUA 1XNSA 2F2AB 2ZXHA 4ICAA 4NWIA 4P0PA 5CRXA 2KKPA 2KVCA 2ZIXB 5A0LA 2MA1A 5T14A 2HOFA 4GFJA 3KZXA 2KIWA 2G09A 2K4HA 2OM6A 2ZIWA 1WUDA 2CPRA 2GH1A 4CDGA 1T94A 5HR6A 2HBMA 4NLBA 3RFAA 2WAQC 2ZIUB 3L3FX 1ED1A 2K8AA 2RP5A 3PSIA 4QNLA 2RRDA 3MGVA 3KFUF 1Z1BA 3OPXA 1OUQA 3VC8A 3D2NA 2W03A 4A8EA 4QIWC 2JH1A 3IN5A 2HOIA 1YT3A 2F76X 4BUGA 3SAFA 3AL0B 2JHDA 2DQNB 2K4IA 1TAMA 1XO0A 5HR7A 2G0AA 4P0QB 2HMXA 2KJ9A 2YB4A 3F5AA 4JMUA 3SMVA 3IG8A 1HEKA 2XICA 4QIWF 2MRLA 2N1RA 4WJ3B 3LVWA 2G5HB 2VJ4A 4C0ZA 4OJOA 2KEYA 4AYBC 2E1EA 2K89A 2DGZA 2KHQA 1Q3VA 1HIWA 2ZXIA 2K8CB 2KNJA 3ALRA 2HBJA 2HBLA 3GZFA 2GOLA 3LYSA 3PSFA 2XIDA 4KX5A 2XVTA 4FE3A 1PVPA 2R18A 3H0LB 3NUQA 1A6SA 2JGAA 4P0PB 2K8BB 3H0RB 1GO3F 2HBKA 4NV0A 4U6PA 2CN1A 2G5IB 5C0YA 3GU3A 2Y0SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYB A;  2LYA A;  2H3V A;  2K4E A;  2H3I A;  2K4I A;  1UPH A;  1TAM A;  2HMX A;  2NV3 A;  1L6N A;  4JMU A;  1ECW A;  4ICA A;  2H3Z A;  1HEK A;  2H3Q A;  4IC9 A;  2JMG A;  2N1R A;  2K4H A;  1HIW A;  2GOL A;  2H3F A;  1ED1 A;  1A6S A; 
#chains in the Genus database with same CATH topology
 5KFU A;  5CP2 A;  1M6Y A;  3QZ8 A;  5KFS A;  1L6N A;  5KFP A;  4J9S A;  3C2M A;  2R8I A;  4KMU A;  5DB7 A;  3C5G A;  3M6Z A;  2HOQ A;  1IXR A;  1KFD A;  2ZIV A;  3QU9 A;  4J9P A;  1B0X A;  1TAQ A;  2KV2 A;  3PW4 A;  7ICR A;  1PVR A;  4ED3 A;  2Q4T A;  3M6K A;  5ALJ A;  2R8J A;  4CCH A;  3AQE A;  3OJS A;  5AI5 A;  3F53 A;  2PFN A;  2IOH A;  3H40 A;  5AK5 A;  4PL2 A;  4UW9 A;  3K1R B;  4OD0 A;  2G5I B;  1BPD A;  1QQ7 A;  4I2C A;  5J2F A;  3OHB A;  3ISB A;  1MA7 A;  1ZQU A;  3QXG A;  3FM9 A;  2ZIX A;  9ICM A;  4DSK A;  2WB1 C;  1X2I A;  1NNL A;  2RHF A;  4Z6F A;  3TFR A;  1ZQA A;  5J2I A;  2W9B A;  5A0L A;  2YTU A;  4RQ6 A;  4M47 A;  2QAR A;  2W9A A;  2ZIU B;  3KTQ A;  2RP5 A;  1SV0 A;  2L5Y A;  1JIH A;  1BPB A;  4Z6D A;  4RT2 A;  2F44 A;  1YT3 A;  3G6V A;  3AL0 B;  5EWE A;  4KLD A;  4DQI A;  5IIM A;  3Q8L A;  2ZTD A;  2IBK A;  2YQE A;  2EZZ A;  3RJK A;  2A19 A;  3QE9 Y;  2MUT A;  5ALY A;  4UAS A;  8ICI A;  3C1Z A;  1NI3 A;  3U26 A;  1MSW D;  5ALS A;  3ZD8 A;  4PH5 A;  2XC9 A;  3ZDD A;  1V38 A;  2JGA A;  1GO3 F;  2F1H A;  4NV0 A;  5KFI A;  7ICQ A;  4GXK A;  2ZIW B;  1KFS A;  1X66 A;  3MR3 A;  3Q8S B;  5EE9 A;  2E1F A;  4TQR A;  4F4X A;  4RQ2 A;  3EPG A;  9ICK A;  2AGQ A;  7ICP A;  1KDH A;  5DQI A;  1N60 A;  2ISO A;  2ZUB A;  4C8M A;  5FP0 A;  5AKL A;  2IMW P;  5KTQ A;  5EWF A;  4M04 A;  3QUC A;  2DF4 B;  2A3V A;  4LVS A;  2Y9T A;  4KX3 A;  4OCZ A;  2HHQ A;  3BS5 B;  2XCA A;  7ICH A;  5ALP A;  3OHA A;  5CEH A;  4XRH A;  5KFA A;  1S10 A;  4UB3 A;  2ES6 A;  5L1L A;  4EEL A;  3M7D A;  4C80 A;  1PUZ A;  2F77 X;  3I28 A;  4LZG A;  3SV4 A;  4J9R A;  1ECW A;  4ICA A;  1SKR A;  3H8S A;  3KZX A;  3PO5 A;  4NLG A;  1TFR A;  4O3R A;  1NK8 A;  7ICG A;  4EYH B;  4ELU A;  5DGB A;  4Q8F A;  5J29 A;  4QIW C;  3C2L A;  1ZQH A;  4O5C A;  2KJ9 A;  2YB4 A;  2R8H A;  4DQR A;  5KG3 A;  4ELT A;  3IG8 A;  4KLM A;  1ZQY A;  4JV1 A;  5KFE A;  5AM4 A;  8ICF A;  5F9L A;  3GZF A;  1ZQL A;  4X5V A;  5AKK A;  1KKX A;  9ICG A;  3NUQ A;  4CNQ A;  4P0P B;  1L7P A;  2DBY A;  5J2C A;  1FFU A;  2FI1 A;  2F1J A;  4ECS A;  3V7J A;  4Y2S A;  4F8R A;  2KOB A;  2F1I A;  7ICM A;  2JZB B;  2I9G A;  7ICJ A;  2H3Q A;  4RQ3 A;  2ZUD A;  3J81 j;  2P35 A;  3TAN A;  5AHX A;  2HVH A;  3E2E A;  2GO7 A;  4KN7 A;  2OHF A;  4MFA A;  3IRU A;  3PST A;  5ALO A;  4J9L A;  1XSL A;  2QB1 A;  1ZD4 A;  4JV0 A;  2IHN A;  3QEA Z;  4M2Y A;  4UQG A;  2V4R A;  4ED2 A;  4MHV A;  1RM6 C;  2ODG A;  3MDA A;  1BPE A;  2XCP A;  4Y2V A;  1L3T A;  4MFC A;  1A77 A;  2BDP A;  2G08 A;  1NK0 A;  4QZ8 A;  8ICZ A;  3V6J A;  4DEZ A;  2HHU A;  5KFM A;  2QKQ A;  4F93 B;  2DKZ A;  3BDP A;  5AM3 A;  5GTI U;  3KZI U;  4M6W A;  4DF8 A;  3SYZ A;  4MEY A;  1SKW A;  2OXO A;  5ALQ A;  5J2G A;  5ALW A;  3F5E A;  3MR6 A;  2ZIU A;  3M9M B;  2KVC A;  4Y2Q A;  4UAR A;  4RQ7 A;  4O3S A;  1O08 A;  2JEJ A;  2QB0 B;  2C2R A;  3IDW A;  4G9B A;  4JV2 A;  1T3N A;  3G6X A;  5ALU A;  3OPX A;  5ALL A;  4IRC A;  4Z6E A;  2HDO A;  4KLU A;  5DQH A;  3Q8R B;  1ZRM A;  4QZA A;  2ZJA A;  1F0M A;  3T5J A;  4MF2 A;  3GIK A;  2BZF A;  4WJ3 B;  3JPT A;  2KEY A;  2ASD A;  1ZQK A;  4IRD A;  1LVH A;  3PSF A;  4DL7 A;  3EZ5 A;  1A6S A;  1ZD2 P;  3HRD D;  4RQ8 A;  5KFC A;  5C0Y A;  1TAU A;  3WKB A;  4C8O A;  2H3V A;  4FBU A;  4QWA A;  5AK4 A;  1ZQM A;  4NXZ A;  3BJY A;  5KFV A;  4B9V A;  4KLH A;  4I2J A;  1ZQT A;  2JEG A;  2WF8 A;  8ICW A;  3PR5 B;  4I28 A;  3TI0 A;  3EUB 2;  4TUQ A;  1LB2 B;  2FPK A;  9ICC A;  2KHV A;  2BCR A;  1JN3 A;  2ZJ5 A;  4RUC A;  4U7C A;  3OJU A;  9ICR A;  3THV A;  1URJ A;  2NRW A;  2OCE A;  5DBB A;  4ECY A;  4PPX A;  4MEX A;  5KL1 B;  4OJP A;  4QZE A;  2PMZ C;  3CP8 A;  1N56 A;  4PZO A;  4KLJ A;  4J9Q A;  4QZD A;  2W04 A;  4F72 A;  4XQ8 A;  2ISP A;  4NM2 A;  2LYB A;  2ZIV B;  2W9C B;  2WAQ F;  4US8 A;  5J0P A;  4ZH4 A;  5ALE A;  2BR0 A;  5KFL A;  5AI9 A;  1X40 A;  1U49 A;  2BCU A;  4RNN A;  3I1Y A;  2HI0 A;  5IIO A;  9ICQ A;  1BNO A;  4QNL A;  5J0O A;  2C2D A;  8ICU A;  1ZQW A;  4YP3 A;  4C4S A;  5AKJ A;  4FFD A;  4NJ8 A;  2BQ3 A;  3Q8P B;  1ZQP A;  3GIL A;  2MRL A;  2ZTC A;  3CNH A;  4YFK A;  1JRO A;  2W11 A;  4Y2P A;  4AYB C;  3UXO A;  3RJG A;  4E0D A;  4JWN A;  3T5L A;  8ICM A;  4BDP A;  5KG5 A;  2HBK A;  2HSZ A;  2W9B B;  3C5F A;  3QUQ A;  2KSO A;  9ICB A;  2KJ5 A;  2QAR B;  1X9X A;  5HP4 A;  3GFK B;  1D8L A;  1NZB A;  3QU5 A;  4IC9 A;  5JRT A;  5KG4 A;  2BQU A;  4JUZ A;  3GIM A;  9ICW A;  2KD1 A;  1N62 A;  5HHH A;  2R8G A;  5JU5 A;  5DDY A;  3TAD C;  2EAO A;  2Y1J A;  1ZD3 A;  3GDX A;  2J6S A;  2MUT B;  4KMO B;  2KN7 A;  4TUP A;  1V85 A;  4KLL A;  3PY8 A;  4R66 A;  2ZUC A;  2CRX A;  2OEH A;  4FBT A;  3SQI A;  8ICY A;  3DEE A;  4YN4 A;  4ECR A;  4NLC A;  2W8L A;  1NK7 A;  2P6R A;  1BGX T;  3V6K A;  5DLG A;  3TKA A;  2AXT U;  4BJQ A;  5CRX A;  3QNM A;  4M9L A;  5AKY A;  4O3P A;  3QUB A;  4FS2 A;  3R9K A;  5IIL A;  5KG6 A;  2W43 A;  8ICE A;  4DSJ A;  4A8E A;  5GTH U;  1CI4 A;  2F76 X;  2W3R A;  1KQQ A;  1A76 A;  4EEN A;  2XIC A;  4YMN A;  4TQS A;  3PNC A;  2DGZ A;  4C8K A;  3V72 A;  5KT7 A;  3LYS A;  1NKE A;  1KW4 A;  5AM5 A;  3PX0 A;  4QW9 A;  1QCK A;  4F91 B;  1FIQ A;  8ICP A;  4ED6 A;  4B9S A;  1ZQB A;  3ZDA A;  3ONN A;  3LVV A;  4YR3 A;  5BOL A;  3AN1 A;  4PHE A;  4DQQ A;  2XI9 A;  4F5R A;  3MR2 A;  2MU2 A;  4JK1 A;  3H8M A;  4DFK A;  3KD3 A;  4IS7 A;  4OJ5 A;  5ALV A;  1RPL A;  3T79 A;  3GV8 B;  3H4B A;  5KFG A;  4M9N A;  3JPP A;  2EDU A;  2JMG A;  2JV3 A;  5ALD A;  2LBO A;  3D2Q A;  3RTV A;  3WK7 A;  4DOB A;  1RG6 A;  5BPC A;  3T5H A;  2W9C A;  1N5W A;  1Z3E B;  4P0Q A;  4UB5 A;  4FS1 A;  1J2M A;  4DOC A;  4KLG A;  2ZG6 A;  5DB9 A;  3JPQ A;  3MC1 A;  5ALM A;  3MAB A;  9ICP A;  1B4F A;  3RB4 A;  5E79 U;  3QUT A;  4DF4 A;  2FMQ A;  4CDG A;  1SGG A;  3K4G A;  2AH5 A;  1DOQ A;  1OUQ A;  1FO4 A;  3RBE A;  1SL0 A;  4RNM A;  2JEF A;  2JH1 A;  1HJP A;  5KFK A;  9ICU A;  3C21 A;  1WCN A;  3Q8K A;  5DBA A;  2NYV A;  4M6W B;  8ICR A;  2XY6 A;  4ED1 A;  3BZC A;  2DL0 A;  4HAI A;  4GLX A;  2RDI A;  2KE7 A;  8ICH A;  4AP9 A;  5AI6 A;  5DDM A;  3EYZ A;  4PL1 A;  5KFJ A;  4G3I A;  4DS4 A;  3DV9 A;  1KEJ A;  3KBB A;  5ALT A;  1N5X A;  1ZXI A;  3AEV A;  3A0B U;  5AM2 A;  3QEB Z;  4O3M A;  4F4K A;  1IG6 A;  5J0Y A;  1Q46 A;  1CUK A;  5J0Q A;  4IR9 A;  4KLO A;  2FJ6 A;  2HHV A;  5DKW A;  5HNK A;  4DFP A;  2V4Q A;  5TZV A;  1ZQR A;  4NLZ A;  4UAU A;  3VCB A;  4RQ0 A;  1QLN A;  8ICV A;  2YMM A;  1O03 A;  3MBY A;  3SEI A;  2E5S A;  1L7O A;  1N61 A;  9ICF A;  1X42 A;  2I1Q A;  1LV5 A;  4F2R A;  3N28 A;  1Z19 A;  4NL9 C;  4EZ6 A;  2DPJ A;  4Q43 A;  1NK9 A;  1KSP A;  5KFZ A;  3FDS A;  1XNS A;  2VA2 A;  3E58 A;  5F9N A;  3LDA A;  2EAN A;  3VC8 A;  3T5K A;  1NZP A;  1NK5 A;  1HUO A;  4K4G A;  3IN5 A;  3ED5 A;  3IM1 A;  1BPX A;  2QLT A;  5EOZ A;  4QZC A;  4DFM A;  3WKD A;  2LYH A;  4Y2Y A;  4BGD A;  5AKE A;  1QQ6 A;  4C0Z A;  4F4Y A;  2D8C A;  1DK3 A;  5HHI A;  3UXN A;  2Y9U A;  3ALR A;  4ECX A;  1DGJ A;  4PGQ A;  3DDH A;  1NOM A;  3BQ1 A;  4QWE A;  4UAY A;  4PHP A;  4F92 B;  1RZT A;  3RB6 A;  4DLE A;  2Z7J A;  4RQ5 A;  3RF9 A;  4B9M A;  1D8B A;  4NY8 A;  2KIC A;  3TAR A;  5AKZ A;  4P2H A;  3T3F A;  5EE3 A;  4M0A A;  1Q8K A;  3E0F A;  4FZN A;  3ZI4 A;  3M1Y A;  4IQV A;  1ZQ1 C;  1K1Q A;  2VA3 A;  3RAQ A;  1CEZ A;  1KLN A;  4ELV A;  1AQ6 A;  1N2X A;  3HKZ F;  5L1K A;  4YVZ A;  4RPX A;  5JTI A;  4O3Q A;  2KSO B;  2WB1 F;  2BKE A;  4QJF B;  3SEN A;  4KLE A;  3V7L A;  3WK6 A;  2YN4 A;  3PW5 A;  3N7R C;  2ESE A;  1TKD A;  4I2I A;  1L3S A;  2G07 A;  2KJ8 A;  3TQ1 A;  4I29 A;  1L8L A;  5L1I A;  1ZQV A;  4PHA A;  2E8M A;  1VJ5 A;  3TAP A;  1VLB A;  1KTQ A;  1MN8 A;  4B9L A;  2K4H A;  9ICE A;  2OM6 A;  3PW0 A;  2E3T A;  1J97 A;  2M9N A;  1DK2 A;  4PZN A;  3RFA A;  3G6Y A;  4RQ1 A;  4ECW A;  1Z1B A;  3BS7 A;  1K1S A;  4UB8 U;  1WWU A;  3SAF A;  3HP6 A;  4IL6 U;  2PFQ A;  5K4L A;  4YR0 A;  1BPY A;  5J0T A;  3ZD9 A;  1MQ3 A;  8ICA A;  3JPO A;  3WKA A;  5DG8 A;  7ICS A;  5B66 U;  2ZXI A;  2Y1I A;  2O6K A;  3KOO A;  2P6U A;  3HJE A;  3RB3 A;  1NK6 A;  3H4D A;  3HW8 A;  3KHH A;  2KKV A;  5J2B A;  4CGZ A;  3AMZ A;  3C29 A;  4C4T A;  3RRG A;  3V6H A;  2F8K A;  3RB0 A;  1NJW A;  3M8S A;  2D3D A;  4O5E A;  1SKS A;  2C22 A;  5KAF U;  5CB1 A;  1RYR A;  2IHM A;  4PGX A;  2EAM A;  2AJQ A;  9ICV A;  1Z00 A;  1NJX A;  5ALR A;  3SR6 A;  8ICB A;  7ICN A;  3RH5 A;  1U47 A;  4PJ0 U;  4UB1 A;  1JI7 A;  1OXJ A;  4DL4 A;  4M9G A;  4KIT B;  2W7P A;  8ICC A;  2OH2 A;  5J2H A;  1UCV A;  4C8N A;  3NAS A;  5AKG A;  3B9J A;  4IQW A;  7ICF A;  3H0M B;  3ETR A;  3PSP A;  4R65 A;  4YG2 A;  4Z6C A;  1WCL A;  1RQL A;  1SV4 A;  5L1J A;  2D6F C;  2K4E A;  1KBU A;  2FPL A;  2DPI A;  3EWA A;  2F2A B;  4RPY A;  2KKP A;  4GFJ A;  2KIW A;  3M9O B;  3TAC B;  3TAD A;  2HBM A;  3MFI A;  2WF6 A;  5JUM A;  1S0N A;  2FLP A;  2GLE A;  2JHD A;  4QWB A;  2DQN B;  4P0Q B;  3SV3 A;  3SMV A;  7ICO A;  1FFV A;  7ICT A;  1RYS A;  2NRV A;  1S0O A;  4YQW A;  1YZ6 A;  3FAH A;  9ICX A;  1TV9 A;  2K8B B;  3UMB A;  4KLF A;  2J6T A;  4NLK A;  3RJI A;  3RBD A;  2H3I A;  1NKC A;  1P7D A;  5CJ7 A;  2NV3 A;  4C7Y A;  3N97 B;  5IIK A;  2W3S A;  3WK4 A;  3M9N B;  2Y0S F;  3RR7 A;  1A0P A;  5J0W A;  1L3V A;  8ICO A;  3RH4 A;  1JXL A;  5ALX A;  1S0M A;  2MAX A;  1X6J A;  2UVW A;  3SD7 A;  1QSY A;  4M9H A;  3SZ2 A;  3QYP A;  1D9F A;  1UT5 A;  2A1J A;  2W7O A;  5DBC A;  3RJH A;  8ICN A;  4FZM A;  2H3Z A;  3C2K A;  1U4B A;  1QSL A;  1KN5 A;  3ZDC A;  3WK8 A;  1X9M A;  1SL1 A;  5L9X A;  1LKY A;  3NRZ A;  3PR4 A;  2YML A;  4YXJ A;  2BHN A;  4R63 A;  4J9M A;  2J6U A;  5KFF A;  3TAQ A;  3EPI A;  3NGD A;  1ZJM A;  3LWM A;  1QSS A;  3IHQ B;  1ZET A;  4NWI A;  5G5H A;  3OGU A;  2G09 A;  3KKA C;  2IOF A;  3KHL A;  3HT3 A;  3QU4 A;  1U9L A;  3UMC A;  5J0X A;  2VA8 A;  1SZP A;  3L3F X;  4DL3 A;  1ZQE A;  2WFA A;  2W55 A;  1H38 A;  1XSN A;  4UBC A;  3KHR A;  5KNI A;  4DQP A;  2FLL A;  1UHU A;  9ICS A;  3UQ2 A;  2HW3 A;  2B21 A;  3B0X A;  4R8U B;  1ZQZ A;  5ALF A;  1HEK A;  2DFL A;  5DGA A;  4YD2 A;  2N1R A;  1NK4 A;  2KZZ A;  1PK1 B;  1WWV A;  1ZQG A;  1PK3 A;  4F5N A;  2KHQ A;  5AI8 A;  1VDV A;  4KX5 A;  3Q8Q B;  3I76 A;  4Y2T A;  2XO7 A;  4B9T A;  2ASJ A;  5AIA A;  3PW2 A;  4RQN A;  5J8Y C;  1J2N A;  2AGO A;  3D2S A;  2DUY A;  4UAV A;  1ZQN A;  1U48 A;  8ICX A;  2KIV A;  4I27 A;  1F44 A;  4EBE A;  4OJL A;  5KG2 A;  5KFQ A;  2BCQ A;  4USA A;  1SWW A;  1U45 A;  4B6J A;  3QU2 A;  2PFP A;  4DSF A;  3IV6 A;  3AQF A;  1DXS A;  2I6X A;  4RT3 A;  5CR0 A;  1UQV A;  4BWM A;  2KTQ A;  4B9U A;  2AGP A;  8ICK A;  1XWL A;  5KG1 A;  4OO1 J;  3ETL A;  4C4R A;  5DLF A;  4QWD A;  4Y2X A;  1Y88 A;  7ICK A;  3ZDB A;  8ICS A;  5KFR A;  2Q0Z X;  4ECU A;  2BDU A;  3MFH A;  4RZR A;  1SWV A;  2RLT A;  4GC7 A;  1FEZ A;  5T14 A;  4KTQ A;  4P4M A;  2DWQ A;  2CPR A;  1WUD A;  1JRP A;  4BXO B;  1ED1 A;  3MGV A;  3PX6 A;  2KP7 A;  3D2N A;  4DS5 A;  2WHE A;  1N63 A;  5HR7 A;  1ZQX A;  5DG7 A;  4UAT A;  2G5H B;  5KFN A;  5EWG A;  4J9K A;  1BPZ A;  1ZQJ A;  4ECT A;  5ALK A;  5J0R A;  4Q44 A;  2KNJ A;  4NL9 A;  5CHG A;  1ZQO A;  4FE3 A;  4I2D A;  2R18 A;  4KLT A;  2EAP A;  3AM9 A;  3EW9 A;  1WYG A;  5KL8 B;  2MSN A;  3H7I A;  4KN4 A;  4M9J A;  3RH6 A;  1EXN A;  5J0S A;  3IG5 A;  1SZH A;  1ZJN A;  5AI4 A;  4EX7 A;  4QZ9 A;  4LJX A;  1ZD5 A;  3WK5 A;  4F5O A;  3QX7 A;  3HKZ C;  1S5L U;  3S6J A;  2XGQ A;  2P66 A;  4C8L A;  1Q3U A;  4BWJ A;  2BPF A;  4YCX A;  3F2B A;  4RNO A;  1NJY A;  4US9 A;  4I2H A;  1L7N A;  4DLG A;  2W8K A;  4K4H A;  4CF5 A;  2BPG A;  4TUR A;  4C7Z A;  4GIB A;  9ICI A;  3HWT A;  3OTQ A;  5KFT A;  5KFD A;  4I2F A;  3IP4 B;  5III A;  2W54 A;  2PI4 A;  4ECQ A;  1SXD A;  1Z00 B;  1SB3 C;  2EQY A;  5KFO A;  4IR1 A;  1RDF A;  3QU7 A;  2YMQ A;  4FO6 A;  2FMP A;  1SXE A;  1PZN A;  1T94 A;  4O3N A;  3PV8 A;  5C5J A;  2FLN A;  2K8A A;  2WF5 A;  3RJJ A;  1COK A;  4R8U A;  2XGP A;  1S8O A;  1IM4 A;  5BOM A;  5CA7 A;  5J2D A;  7ICI A;  1PK1 A;  4BUG A;  4I2G A;  2JR5 A;  3UXP A;  2G0A A;  1BVS A;  3N4M B;  3F5A A;  4JMU A;  3PO4 A;  5ALI A;  4F2S A;  4RQM A;  2BGW A;  3AUO A;  1TK0 A;  4F3O A;  4OJO A;  3Q8M A;  4PHD A;  2AU0 A;  2RQ5 A;  2KK0 A;  2HBL A;  2OWO A;  4NLN A;  2XVT A;  4ZOH C;  5AK6 A;  2I5H A;  4GXI A;  1QH9 A;  5ALH A;  4QZB A;  5KT5 A;  2AQ4 A;  1L5U A;  4KLS A;  4IQT A;  4I2B A;  1Z1V A;  4J03 A;  3TFS A;  4ECV A;  1COO A;  1B22 A;  4RPZ A;  3PW7 A;  1JX4 A;  3ORY A;  3ISD A;  1KL9 A;  4RU9 A;  2B0C A;  2H3F A;  4YMM A;  4B9N A;  1TK8 A;  8ICL A;  3SAG A;  1SV0 C;  7ICE A;  3FC4 A;  2JH7 A;  2LYA A;  3B0Y A;  4Y2J A;  4GC6 A;  3CYM A;  4Y2R A;  4OJ6 A;  5IIJ A;  8ICJ A;  4QZF A;  3BQ2 A;  1ZOL A;  2LMR A;  3PMN A;  4YD1 A;  4F5P A;  3JPN A;  1YZ7 A;  5D49 A;  4DFJ A;  4QZH A;  4UB6 U;  2K60 A;  3O0F A;  5DB6 A;  2LKY A;  5B5E U;  1BNP A;  3RJF A;  5AKI A;  4P4P A;  2HCF A;  1UA0 A;  5J2J A;  2M0N A;  4BXO A;  5KFX A;  2ZXH A;  4KLI A;  2HOF A;  4P4O A;  2KZ3 A;  2A1J B;  1JXE A;  1T4G A;  4F4Z A;  4XUS A;  4CF4 A;  3HPO A;  2WAQ C;  4CE6 A;  1QTM A;  3KFU F;  1ZYQ A;  3UPQ A;  4KLQ A;  4YR2 A;  1UA1 A;  3LK9 A;  2K4I A;  1LKY B;  1XO0 A;  1N48 A;  4EBC A;  2BCV A;  3UM9 A;  2LM1 A;  1S97 A;  3LVW A;  5J0U A;  2E1E A;  1Q3V A;  1HIW A;  4F71 A;  3OSP A;  2GOL A;  1ZQI A;  5KFY A;  3H0R B;  4U6P A;  4UAZ A;  1NJZ A;  3GU3 A;  3PX4 A;  2Y0S C;  4Q45 A;  2HVI A;  5AI0 A;  4R64 A;  2ASL A;  3JPR A;  3H8W A;  3C23 A;  4TUS A;  2YX8 A;  3UQ0 A;  1MC8 A;  2IA6 A;  4UB2 A;  5AKX A;  3ISC A;  4CRX A;  2KZM A;  2XY5 A;  1Z4O A;  2B6G A;  5KT3 A;  2YMP A;  3ICX A;  2H5X A;  2HHT A;  3NVW A;  1V9P A;  4RUA A;  2F8L A;  2FDR A;  3WKE A;  1CRX A;  5KFW A;  2WTF A;  2PFO A;  4IRK A;  5KT2 A;  3PML A;  4J9O A;  2UVR A;  4DCC A;  5HML A;  3HX0 A;  9ICL A;  1L8O A;  4I2E A;  2LPE A;  3LWL A;  4DFD A;  2UVV A;  2LHT A;  4UB4 A;  3H8J A;  1ZRN A;  2AQ0 A;  2LM4 A;  5ALN A;  5EE0 A;  2E8N A;  2R8K A;  1T7P A;  3NS1 A;  3MR5 A;  4NM1 A;  3CW2 C;  5KT6 A;  2V9W A;  2PI5 A;  1SL2 A;  9ICJ A;  5F3X B;  4MF8 A;  2ZIW A;  1OW5 A;  2YY6 A;  5DQG A;  1TK5 A;  3PSI A;  5H2F U;  2RRD A;  5HMM A;  4DO9 A;  3NVV A;  4ED8 A;  2W03 A;  1V97 A;  2ZJ8 A;  2KVS A;  1X9S A;  3AU2 A;  2DKX A;  1HUZ A;  4QIW F;  5DB8 A;  2NRT A;  3WKC A;  3GQC A;  2E8O A;  2K89 A;  1F5S A;  2HBJ A;  2XID A;  4O3O A;  5AKH A;  4QZI A;  3H0L B;  2ALZ A;  4HYK A;  5KAI U;  1KRP A;  1ZQF A;  3BS5 A;  4YMO A;  4FZL A;  4UAW A;  3F2D A;  1D9D A;  5D46 A;  1S77 D;  1S9F A;  2AHO B;  2BQR A;  4ACO A;  3AU6 A;  3BQ0 A;  3UMG A;  4DL5 A;  3KKA A;  1JMS A;  1SIJ A;  4F50 A;  2EZX A;  1S76 D;  4Y2U A;  2NRX A;  1DRG A;  2NRZ A;  3RJE A;  3SAH A;  9ICO A;  3NTU A;  5DG9 A;  4QWC A;  3CRX A;  5AM0 A;  4QW8 A;  3N7P D;  3N7S C;  2JEI A;  4QZG A;  1ZQD A;  1C7Y A;  1JAL A;  3L5K A;  1K5O A;  2ZTE A;  2IOF K;  4EEY A;  2OYY A;  2VJ5 A;  2YB1 A;  3MDC A;  1ARO P;  4YXM A;  1RQN A;  5D4B A;  5KFH A;  4ED0 A;  2EH9 A;  4DWI A;  4O0I A;  3PZP A;  4MFF A;  4PGY A;  5EE1 A;  2PXI A;  3JPS A;  3RRH A;  4JWM A;  5J8Y A;  1RXV A;  1UPH A;  1ZQC A;  2HHW A;  2CXY A;  3F2C A;  4F5Q A;  4DSI A;  4P0P A;  4LZD A;  2ZIX B;  2MA1 A;  2KMD A;  1T8E A;  1MQ2 A;  5G5G A;  1S0V A;  4Q8E A;  5AIC A;  4I2A A;  2GH1 A;  5HR6 A;  1XU4 A;  2PKE A;  5TIS U;  4UBB A;  3MGI A;  2JZB A;  1ZQS A;  8ICG A;  1XO1 A;  9ICH A;  4IQU A;  3MGH A;  4EEK A;  1X9W A;  2HOI A;  5KFB A;  3WK9 A;  3HIL A;  5ALZ A;  2KFZ A;  5CWR A;  5KG7 A;  4CF3 A;  2E8P A;  4F4W A;  3V7K A;  2K8C B;  2FE9 A;  2NO4 A;  3OSN A;  3GV5 B;  4EX6 A;  5ALG A;  2EZY A;  3FYH A;  4O9M A;  2CN1 A;  3RAX A;  5J2E A;  3NRW A;  2WF9 A;  2JXJ A;  1D8Y A;  1WG8 A;  3SI8 A;  4EZ9 A;  2BPC A;  3PVX A;  1L3U A;  7ICL A;  2RDJ A;  1T3Q A;  1UT8 A;  4J9N A;  2WF7 A;  5AM1 A;  3NVZ A;  4DOA A;  1IV8 A;  3C28 A;  2GWS A;  7ICV A;  3A0H U;  3KHG A;  5J2A A;  1Z4N A;  1ZQQ A;  5L1M A;  2F3N A;  2QB0 A;  3GII A;  2G06 A;  1XS9 D;  9ICN A;  2C2E A;  3K1Z A;  5AIB A;  5IIN A;  2VIX A;  4ED7 A;  2VAN A;  1TVA A;  2XY7 A;  4XA5 A;  1RYU A;  1IIP A;  4EBD A;  4ECZ A;  2HHX A;  4BX9 C;  8ICT A;  4K4I A;  3WU2 U;  4EYI B;  2PMZ F;  2FMS A;  4DSE A;  1X6I A;  4JB3 A;  7ICU A;  1L7M A;  3NVY A;  2A1A A;  4GXJ A;  3GIJ A;  3RR8 A;  2C28 A;  8ICQ A;  1XSP A;  2KFN A;  1PVQ A;  2VKQ A;  3K75 D;  1B43 A;  1RXW A;  2UVU A;  4DQS A;  1NKB A;  3BQ7 A;  2NO5 A;  4RQ4 A;  2W9M A;  1XC9 A;  4DSL A;  3C1Y A;  4NLB A;  3QZ7 A;  2FPM A;  3BQT A;  4O5K A;  2BCS A;  2K4P A;  1QQ5 A;  3BZK A;  2HHS A;  1TAM A;  2ATL A;  2HMX A;  9ICT A;  3GV7 B;  3L4P A;  5J2K A;  4DL6 A;  1C20 A;  2VJ4 A;  5AK3 A;  3M8R A;  5KT4 A;  1KFT A;  1JUD A;  9ICA A;  2JRZ A;  1PVP A;  3ZDE A;  2KG5 A;  5KG0 A;  2LI6 A;  4DL2 A;  3D6J A;  1DGS A;  4AYB F;  1TE2 A; 
#chains in the Genus database with same CATH homology
 3NRW A;  2H3V A;  2ZIW B;  2KJ5 A;  4FZL A;  4PL1 A;  2Z7J A;  2H3I A;  3F2D A;  5KL8 B;  1P7D A;  2KKV A;  3LVV A;  3ONN A;  4ACO A;  2KOB A;  3RF9 A;  1NZB A;  2NV3 A;  1D8B A;  2KIC A;  2YX8 A;  1L6N A;  2XI9 A;  4CGZ A;  2E1F A;  3C29 A;  3D2S A;  2Y0S F;  2H3Q A;  4IC9 A;  1A0P A;  3M6Z A;  3IG5 A;  1SZH A;  4O3M A;  2HOQ A;  4CRX A;  1F44 A;  2KD1 A;  2ZIV A;  3E0F A;  1DRG A;  4FZN A;  3C28 A;  3ICX A;  4OJ5 A;  2KHV A;  3PST A;  3SAH A;  2H3F A;  3HKZ C;  4OJL A;  4U7C A;  3CRX A;  3SAG A;  2F8L A;  3T79 A;  3N7P D;  3N7S C;  1Q3U A;  1ZQ1 C;  1URJ A;  2JH7 A;  2LYA A;  2KV2 A;  4KMO B;  2W7O A;  2G06 A;  3CYM A;  3AQF A;  3VCB A;  4OJ6 A;  3K1Z A;  1CRX A;  1PVR A;  3HKZ F;  2Q4T A;  3M6K A;  3F2B A;  4FZM A;  2OYY A;  2VIX A;  2VJ5 A;  2DF4 B;  3AQE A;  2A3V A;  2E5S A;  5KL1 B;  2H3Z A;  2YB1 A;  3F53 A;  4KX3 A;  4OJP A;  2W7P A;  2PMZ C;  3CP8 A;  1IIP A;  2G08 A;  2JMG A;  2OH2 A;  2WB1 F;  4PL2 A;  2LBO A;  3D2Q A;  4BX9 C;  4QJF B;  2CRX A;  3SQI A;  3H0M B;  4OO1 J;  4P0Q A;  1Z19 A;  2W04 A;  3DEE A;  3PSP A;  4AYB F;  3O0F A;  2PMZ F;  3PZP A;  3N7R C;  3M7D A;  4NLC A;  2LKY A;  1MA7 A;  2LYB A;  2D6F C;  2LHT A;  2ZIX A;  2ZIV B;  2K4E A;  2G07 A;  2F77 X;  2KJ8 A;  2WAQ F;  2WB1 C;  2ZG6 A;  2M0N A;  1UPH A;  2RHF A;  1KBU A;  2OXO A;  3IP4 B;  2BDU A;  1ECW A;  2VKQ A;  3F5E A;  4BJQ A;  1PVQ A;  3F2C A;  2ZIU A;  1XNS A;  2F2A B;  2ZXH A;  4ICA A;  4NWI A;  4P0P A;  5CRX A;  2KKP A;  2KVC A;  2ZIX B;  5A0L A;  2MA1 A;  5T14 A;  2HOF A;  4GFJ A;  3KZX A;  2KIW A;  2G09 A;  2K4H A;  2OM6 A;  2ZIW A;  1WUD A;  2CPR A;  2GH1 A;  4CDG A;  1T94 A;  5HR6 A;  2HBM A;  4NLB A;  3RFA A;  2WAQ C;  2ZIU B;  3L3F X;  1ED1 A;  2K8A A;  2RP5 A;  3PSI A;  4QNL A;  2RRD A;  3MGV A;  3KFU F;  1Z1B A;  3OPX A;  1OUQ A;  3VC8 A;  3D2N A;  2W03 A;  4A8E A;  4QIW C;  2JH1 A;  3IN5 A;  2HOI A;  1YT3 A;  2F76 X;  4BUG A;  3SAF A;  3AL0 B;  2JHD A;  2DQN B;  2K4I A;  1TAM A;  1XO0 A;  5HR7 A;  2G0A A;  4P0Q B;  2HMX A;  2KJ9 A;  2YB4 A;  3F5A A;  4JMU A;  3SMV A;  3IG8 A;  1HEK A;  2XIC A;  4QIW F;  2MRL A;  2N1R A;  4WJ3 B;  3LVW A;  2G5H B;  2VJ4 A;  4C0Z A;  4OJO A;  2KEY A;  4AYB C;  2E1E A;  2K89 A;  2DGZ A;  2KHQ A;  1Q3V A;  1HIW A;  2ZXI A;  2K8C B;  2KNJ A;  3ALR A;  2HBJ A;  2HBL A;  3GZF A;  2GOL A;  3LYS A;  3PSF A;  2XID A;  4KX5 A;  2XVT A;  4FE3 A;  1PVP A;  2R18 A;  3H0L B;  3NUQ A;  1A6S A;  2JGA A;  4P0P B;  2K8B B;  3H0R B;  1GO3 F;  2HBK A;  4NV0 A;  4U6P A;  2CN1 A;  2G5I B;  5C0Y A;  3GU3 A;  2Y0S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...