2NV3A

Solution structure of l8a mutant of hiv-1 myristoylated matrix protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
GARASVASGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Point mutations in the HIV-1 matrix protein turn off the myristyl switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 34
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2nv3A01
1HIWA 1ECWA 2K4EA 2K4HA 2JMGA 4IC9A 2H3QA 2NV3A 4JMUA 2H3IA 1L6NA 2H3ZA 1TAMA 4ICAA 2LYBA 2H3FA 2GOLA 2H3VA 2LYAA 1HEKA 2K4IA 1UPHA 1ED1A 1A6SA 2HMXA 2N1RA
chains in the Genus database with same CATH superfamily
4OD0A 2Y1IA 4J9PA 4JUZA 8ICSA 5F3XB 2IOHA 5AKXA 4NY8A 2HSZA 3LWLA 3JPPA 5KL1B 3KHHA 2KD1A 5EWGA 1ED1A 2CPRA 3RF9A 3PSTA 2EZXA 1MQ3A 3NVVA 4DLEA 2EQYA 4JV1A 4P0PB 3NVZA 5D4BA 1L3UA 1Z1BA 2JH7A 4TUQA 3NS1A 4RQMA 3IHQB 1OUQA 2ZIVA 1VJ5A 2KIWA 2WF9A 4DSJA 3NTUA 4YQWA 1ZQCA 2I6XA 3C2MA 3HKZC 1NK5A 1ZOLA 8ICAA 1JMSA 2H3QA 2UVUA 4KLOA 7ICRA 3SQIA 3ZDEA 2HHXA 3FM9A 2HDOA 5DQGA 1ZQFA 5L1IA 4BWMA 4GIBA 4RQ4A 1BPDA 2WF6A 1S0NA 2BCSA 3F53A 2AJQA 2EZZA 9ICIA 1TKDA 4DSLA 1N60A 3RFAA 4UATA 2YTUA 3PSPA 1TK0A 2C28A 1NK6A 3H8SA 3MR2A 4ED0A 3NVWA 2F1HA 7ICUA 2AH5A 4ED7A 3PSFA 3PR5B 2XY6A 3UM9A 4NXZA 2XY7A 5KT6A 3ZI4A 2CXYA 5AM1A 5IIKA 9ICQA 2EAMA 4YMOA 3WK8A 2BZFA 2LHTA 4OJ5A 1KL9A 5KFKA 5HR6A 4O9MA 5KG1A 1L7NA 3BQ0A 3QE9Y 5KFEA 4U7CA 4QW8A 2M0NA 4UB5A 5AM4A 4UARA 1WCNA 3ED5A 3H40A 7ICTA 3K4GA 4YMMA 2HHTA 5GTHU 2RLTA 2HHQA 2XVTA 2HOIA 4QZ8A 5ALMA 4I29A 2H3IA 2W03A 2BDUA 3RH6A 3PZPA 3OHAA 1KSPA 4G3IA 2KVSA 8ICNA 5J0TA 1ZQ1C 1NKCA 5KG5A 2JRZA 2ZIUA 3SMVA 1HJPA 4MF8A 2I1QA 4JV2A 3IV6A 2FMSA 4XQ8A 1U47A 2XY5A 4JWNA 4DL2A 4DLGA 3GZFA 2KOBA 4G9BA 2PMZC 3F5AA 4UB6U 4RUCA 3O0FA 5KG0A 1Z00A 2P35A 2C2DA 4PHEA 4U6PA 3JPRA 2FPLA 2AU0A 3AQFA 5KNIA 5IIIA 3C29A 1F5SA 9ICKA 3R9KA 1SKWA 5CR0A 1D8BA 3GV7B 1ZQXA 5J2GA 3ZDAA 2QARB 5AM0A 4B9SA 4QZHA 2FMPA 4J9SA 1UQVA 5DGAA 5AKYA 3IP4B 4O5KA 1JALA 4F4KA 1NK0A 5TZVA 2UVWA 5ALUA 4DQRA 4O3NA 3EYZA 3BQ1A 1ZQRA 4F50A 3TAPA 3M8SA 2KNJA 4C8KA 4P0PA 5KFJA 4KLEA 4UAZA 2VA2A 3TADC 2JGAA 2XICA 4DS5A 4YG2A 1L8LA 3AUOA 1NK4A 3RJJA 2W3SA 2ES6A 2ISPA 3N28A 4Y2RA 4F92B 2ASDA 1ZQYA 2LKYA 4YXMA 3V6HA 3PNCA 2J6UA 9ICSA 1ZQJA 4DSFA 5CEHA 9ICCA 3UXOA 2R8IA 2G08A 1H38A 5CWRA 4UAYA 4QWAA 1JX4A 4KLMA 2ASLA 2QB0B 5ALYA 4X5VA 2AHOB 8ICUA 2RDIA 2C22A 1IIPA 2W8LA 3EPIA 3WKCA 2W7PA 1X2IA 2NYVA 4LZGA 2NRTA 1B0XA 2W9CB 2H3VA 3V6JA 1L7MA 2UVRA 1SZPA 2GO7A 3VC8A 4DL7A 2KKVA 3KKAC 4PHDA 2KKPA 1U4BA 1QTMA 9ICOA 3M9NB 1ZQDA 1Z3EB 4B9NA 3AU2A 3GV8B 2RDJA 1NJWA 1D8YA 5KFIA 1L7OA 3RB4A 1K1QA 5J8YA 5HR7A 5DB9A 1ZQZA 4YD1A 4NLNA 1YZ6A 1QSYA 1UPHA 2WFAA 3QU5A 2HMXA 4MHVA 5JU5A 5J0QA 5J2KA 4F2RA 4R66A 1L7PA 2VANA 2Z7JA 3G6XA 5KL8B 3JPQA 1RPLA 2YMQA 4UAUA 2FDRA 1TV9A 4UQGA 2F3NA 1SL0A 5D46A 3A0HU 3WK7A 2FI1A 4EX6A 4ELVA 3PO5A 2F8KA 4MF2A 2IHNA 4MFCA 5DG8A 2HVIA 1NJYA 4JB3A 5J29A 4F5OA 2HOFA 3CRXA 4PH5A 1N56A 4DQSA 5KFOA 1GO3F 2W04A 2K4HA 2E8PA 1A76A 1ZQOA 5KG6A 4K4GA 4KLHA 3N7SC 5L1MA 5AM2A 2CN1A 5K4LA 2H3FA 2KZMA 3GU3A 3C2KA 2KZ3A 5AKGA 1J97A 3HPOA 4DOBA 2HI0A 2KN7A 2IOFA 4DFKA 4YFKA 3KD3A 2Y1JA 3U26A 4EYHB 5J0XA 1AQ6A 2IOFK 3OPXA 2F77X 4F8RA 2WAQF 1TK5A 1TK8A 1C7YA 1ZRNA 2DGZA 2ZIXB 2QARA 4DSKA 5ALXA 1NNLA 4DFJA 7ICPA 1NKEA 2KJ5A 4KX5A 3QEBZ 1RYUA 3RBDA 1X9XA 2WB1C 4P4OA 4CNQA 2OXOA 2ZXHA 5J2JA 4RPXA 3FAHA 5ALFA 1V85A 2DPIA 5KAFU 3I28A 4B9UA 4F93B 3N7PD 1O03A 1WCLA 2KIVA 3ISCA 3GDXA 4IQUA 1T8EA 3ONNA 1KRPA 3Q8MA 1XO0A 4ECZA 2K89A 2F1JA 2UVVA 4J9MA 4NLGA 1X9MA 2A19A 3L3FX 3C5FA 4PHPA 2BCRA 3RJHA 1LKYB 3CYMA 3UMBA 1X40A 3PW5A 2QB0A 4QZEA 1DK2A 3UQ0A 1X9SA 2W8KA 4US9A 5EOZA 2V4QA 1L5UA 2GLEA 8ICYA 4NLZA 2G5IB 1KFTA 3B9JA 3LWMA 3LDAA 3ZD9A 5AI9A 5KFBA 2W9CA 1S77D 4CF4A 4I2DA 3GILA 3RJIA 1JUDA 2F76X 4I28A 3C28A 1XU4A 2DPJA 5J2HA 3EPGA 4FBUA 2BDPA 4DL6A 5CP2A 2QKQA 2A3VA 5J0SA 2B21A 2NRWA 3ETRA 1ZRMA 2ZTCA 3ISBA 3SD7A 3MDAA 4RQ5A 3NGDA 4GXJA 2HHWA 4NLBA 4DQIA 4DWIA 1BPBA 4UASA 4C8OA 1ZQUA 4BWJA 1CUKA 3RB3A 7ICEA 3H4DA 8ICBA 8ICCA 1DK3A 1PZNA 3PW2A 4Y2YA 5KT5A 3PW7A 4IR9A 2MSNA 4EBDA 3OSNA 4NL9C 9ICJA 3RJFA 3M9OB 4A8EA 2GWSA 1WYGA 2R8JA 8ICRA 2NV3A 5DGBA 2OYYA 3D6JA 4ELUA 1RG6A 3V6KA 3FC4A 2PFOA 2AGOA 3H0RB 1LB2B 2NRVA 5ALQA 3MR3A 4FBTA 2K8CB 3MFHA 4QZBA 3B0YA 1DRGA 4RNOA 3K1RB 8ICQA 2ZUCA 4US8A 5KFCA 3BZCA 4I2FA 1ZJNA 1QLNA 1XSNA 1SV4A 5KFNA 5DB7A 3IDWA 4ACOA 1UA1A 2ZIXA 2F8LA 2R8GA 4C0ZA 4LJXA 1ZQBA 2WB1F 1DGJA 3SAFA 2ASJA 2XI9A 4TQSA 4ED1A 5KT7A 4ICAA 2RP5A 1N5XA 3C23A 5KTQA 3K75D 4PGQA 4O3PA 4KITB 1NI3A 5DBCA 2KJ8A 5AK5A 1KFSA 4KLSA 1HUOA 1KFDA 3KHRA 5DB8A 4OJOA 4R8UB 3QU4A 5ALRA 2JH1A 4PZNA 1X42A 2E8NA 1PVQA 3QXGA 1LKYA 4K4IA 9ICMA 1ZD4A 5AICA 5AI5A 4Y2UA 2KVCA 1A6SA 5FP0A 3E0FA 1ZQKA 1HIWA 5KFQA 3GIKA 4EEKA 3IN5A 1N61A 1SWWA 4ECTA 5GTIU 1ZYQA 9ICWA 1RDFA 4ED6A 1COOA 1K1SA 4YVZA 3QU9A 1Z19A 3T79A 3PY8A 2BCUA 3MC1A 5ALPA 5ALSA 3AEVA 9ICHA 4PL1A 3M6KA 3QZ7A 5KFPA 3NVYA 1FFUA 1JIHA 3PVXA 3PO4A 2WF7A 2FJ6A 5KG4A 4UBCA 1D9FA 2AQ4A 3BS5B 4GXIA 4ELTA 5CHGA 4DSEA 4C8MA 3SR6A 1KW4A 3UXNA 5DB6A 4K4HA 3UMCA 1PK1B 3ICXA 3N4MB 1V9PA 4KLFA 3SEIA 2AXTU 3LYSA 5KFGA 5A0LA 2EDUA 5IILA 1JI7A 2O6KA 4J9QA 2LI6A 4XA5A 4PGYA 4YCXA 4I27A 5KFDA 3CP8A 3T5LA 5KG2A 3Q8RB 1WUDA 2XGQA 3WU2U 4FZMA 5DDMA 2VIXA 5EWFA 3Q8PB 4OJLA 5AKKA 4R64A 4NLKA 1NK7A 5KT4A 4Z6EA 2W11A 1ZETA 5JRTA 4F4WA 4CF5A 4EX7A 1SGGA 4OCZA 4QZIA 5BOMA 3S6JA 4AYBF 2ZJ8A 2Q0ZX 2XIDA 1U45A 1L3SA 5CB1A 4RQ0A 3JPNA 4KLIA 1ZD5A 3BZKA 3MGIA 3D2SA 5DG7A 3MR6A 5AI6A 4M9HA 9ICPA 2W55A 1B4FA 1KEJA 3IG8A 8ICJA 5CRXA 4IQTA 1ZQVA 4EYIB 5EWEA 2R8HA 3H7IA 1S0MA 2YMLA 4E0DA 3WKAA 1F0MA 4R63A 1RZTA 5L1JA 1ZQGA 1MN8A 2HBMA 1BNOA 2FMQA 4ED3A 1ZQTA 4JV0A 3OJSA 4I2EA 2G5HB 2NO5A 1QQ7A 5DBAA 2FLPA 2PFNA 4DCCA 1SIJA 4HYKA 3ZDDA 4P2HA 4YN4A 1NK8A 5KFYA 2KP7A 8ICMA 1KN5A 3HKZF 4KLGA 3Q8SB 4Q45A 2XC9A 4R8UA 3F5EA 3M8RA 1ZJMA 4IQVA 5AKIA 1V38A 8ICXA 4J9NA 3F2DA 4I2HA 2BQRA 7ICQA 1BPEA 4F3OA 2DKXA 3DEEA 1IG6A 2W9AA 1T94A 1MA7A 5JTIA 2KTQA 4RNMA 2HBKA 1ECWA 3QEAZ 4B9LA 3TI0A 1QQ6A 4O3MA 2P6UA 4DFDA 5DLGA 3QUBA 4NM2A 1LV5A 4EENA 1ZD3A 3HRDD 8ICGA 3UQ2A 3HWTA 2Y0SC 2BCVA 3WKEA 2W9BB 3OJUA 5BPCA 3J81j 9ICXA 2H5XA 1N48A 4C80A 4KLQA 4M9NA 3TKAA 3T3FA 2JEFA 3BS5A 1RQLA 3WK9A 4F5RA 3SAGA 1S0OA 2HVHA 3PMNA 2A1JB 1COKA 4PGXA 2LPEA 4FFDA 3ETLA 3FYHA 1PK1A 4RQ2A 2DQNB 2VKQA 2JV3A 5DQHA 4TQRA 2G07A 4O0IA 5IIMA 4QZCA 5KFMA 4M2YA 4RQ6A 3WK6A 3KTQA 2ZJAA 3D2NA 2MRLA 1ZQIA 1X6IA 4KLLA 2K4IA 4ECWA 4IQWA 4ECRA 2NRZA 2HW3A 3L4PA 3GV5B 5HHHA 4YXJA 5IIOA 3IRUA 1B43A 3F2CA 2E3TA 1SKSA 1KBUA 4UB8U 2KJ9A 4RU9A 4F5PA 2PMZF 2JXJA 2FE9A 3GFKB 2LBOA 4I2AA 4RT3A 1IM4A 3PX4A 7ICGA 1X66A 3RB0A 4RPZA 3M1YA 4DFPA 1KKXA 3IG5A 1A0PA 1Z4OA 4CGZA 5EE3A 5IINA 2M9NA 4O3OA 2E1EA 4DS4A 2RRDA 3QU7A 3MGHA 4JMUA 2ZG6A 2K8BB 4Y2XA 1ZQWA 2LYBA 2GOLA 1FIQA 9ICEA 1JXLA 4PJ0U 2KHVA 1QH9A 1TFRA 1SXDA 2FPMA 2N1RA 5J8YC 2KZZA 4F5QA 4C7YA 1MC8A 5KFUA 1NOMA 2PKEA 5T14A 4M9JA 4UB3A 2XCAA 5KG3A 5DKWA 3A0BU 5J0RA 3BDPA 4I2IA 8ICVA 3MGVA 4NM1A 1RYSA 2V9WA 1UT5A 1LVHA 4DFMA 1WWVA 5HMMA 2EAOA 4WJ3B 2I5HA 2ZUDA 7ICHA 2ZJ5A 2YY6A 2YQEA 1RXWA 4QZFA 1WWUA 4DF4A 4Y2QA 1ZQMA 5J2DA 3C21A 4DSIA 2KSOB 2W9MA 5ALNA 2BKEA 3I76A 3ZD8A 2W54A 5HNKA 5ALKA 4F2SA 4EZ6A 2DFLA 9ICNA 4YR0A 4RPYA 3PV8A 1ZQLA 5KFRA 3MR5A 1SV0A 4GXKA 2BR0A 4MFFA 1QCKA 2DWQA 3RH5A 1MQ2A 4O5CA 3T5HA 5ALVA 1N2XA 4UB2A 1L8OA 3OTQA 1XSLA 3GIIA 4C4SA 2Y0SF 4IS7A 5ALGA 5EE1A 5F9LA 2HBLA 5KT3A 4BGDA 1SB3C 3H8WA 2W9BA 4UB4A 3RTVA 4AP9A 3M9MB 5KG7A 3RJGA 3AM9A 3F2BA 2XCPA 1NZBA 4DL3A 2W7OA 4NLCA 2ESEA 3KBBA 9ICAA 2LYAA 3K1ZA 1UCVA 2A1JA 7ICVA 4LZDA 1SWVA 1F44A 2VJ5A 2A1AA 3H8JA 4EELA 1Z4NA 5KFXA 4IR1A 2E8MA 5J2CA 2AGQA 1DGSA 5DBBA 3BQ2A 2BPFA 1ZQSA 4RQ1A 4QIWC 2BQ3A 4TUSA 3TFSA 4F91B 2F1IA 4RUAA 2HHSA 4MEXA 2DBYA 3RJEA 1M6YA 5EE0A 3RB6A 2B0CA 2G0AA 3KOOA 1A77A 1SL2A 4FZLA 2W43A 3V72A 5ALEA 1Z1VA 1SV0C 2RQ5A 4I2BA 3SENA 1IXRA 4EBEA 4O5EA 2VA3A 2ZTDA 3RRGA 1DXSA 1QSLA 5DDYA 2D3DA 4ECUA 1N5WA 2OM6A 4Z6DA 1RYRA 3RJKA 3T5KA 4RQ7A 2KMDA 4M47A 1FEZA 2H3ZA 4F4XA 4FS2A 5ALHA 9ICRA 8ICIA 4EEYA 8ICFA 2ALZA 1S0VA 1HEKA 4Q43A 3I1YA 3AQEA 2OHFA 5CJ7A 3TANA 3QUQA 3HT3A 3DV9A 5J2BA 1S8OA 4QWBA 8ICLA 5ALZA 4CF3A 4MFAA 4Y2PA 1JN3A 7ICMA 1PK3A 3EW9A 4QWDA 4QZGA 4DL4A 1U49A 5AKJA 2YB4A 5L1LA 3KFUF 3H8MA 3NRWA 2D6FC 4LVSA 2WF8A 7ICLA 3EUB2 5ALDA 2IHMA 1RXVA 2ZTEA 2C2RA 2JEJA 2VJ4A 5TISU 2JZBB 5KFLA 3RAQA 9ICUA 2WF5A 3THVA 3BJYA 2QB1A 1S9FA 5ALIA 4PL2A 3MFIA 2KSOA 5AM5A 1NJXA 4TURA 5J2FA 4HAIA 1BPYA 1CEZA 2OWOA 1VDVA 4QWEA 2IA6A 2K4EA 4RQNA 4F71A 1BPXA 1WG8A 4MEYA 2YB1A 3NRZA 2NRXA 4ECQA 2BGWA 4Y2JA 4QW9A 4FE3A 2Q4TA 3T5JA 1P7DA 2MUTB 3C5GA 2DUYA 1XWLA 4Q8FA 4QZ9A 4UBBA 5E79U 2HHUA 4IL6U 1Q3UA 4FS1A 5ALTA 4M0AA 3G6YA 1KDHA 1T3NA 3ZDBA 2E5SA 5KAIU 3WKDA 5J0PA 5C0YA 2DKZA 3RH4A 2BQUA 3BQTA 1ZXIA 4YP3A 4BDPA 3ZDCA 2IBKA 4B9VA 4TUPA 3GQCA 1UT8A 1XS9D 1K5OA 1KTQA 2ZIWB 5B5EU 3LK9A 2G09A 4B9MA 2JEGA 1OXJA 4F5NA 1JROA 3Q8KA 2WTFA 2Y9TA 3C2LA 3GIMA 2V4RA 4YMNA 4QIWF 3ORYA 1HUZA 4Y2TA 3PX6A 5ALLA 5DQIA 2ATLA 1X9WA 1Q8KA 3JPSA 2NO4A 1BVSA 3H0LB 3KZIU 4UB1A 4I2GA 3HX0A 3TADA 5AK3A 2LMRA 3HJEA 1KQQA 1V97A 4C4TA 3KHLA 1NJZA 3AL0B 1N62A 1ZD2P 3AN1A 2PFPA 3KHGA 2YN4A 1D8LA 4Q44A 2E1FA 3PW4A 4I2CA 3CW2C 3SYZA 3RBEA 3OGUA 3N97B 4QZAA 8ICZA 4BUGA 5J2EA 3ISDA 1UHUA 2K60A 1N63A 3L5KA 2XO7A 2JEIA 5ALOA 5AHXA 4O3RA 3AU6A 4BJQA 5B66U 3QU2A 5DLFA 5HP4A 2E8OA 5G5HA 4CDGA 2Y9UA 4CRXA 3E58A 1Y88A 1J2MA 1XC9A 9ICLA 4JWMA 1ZQPA 5KFAA 1S5LU 2J6TA 2BPGA 2QLTA 4NV0A 4KX3A 2D8CA 3LVWA 5AM3A 4XRHA 3KKAA 2P66A 3JPTA 3WK5A 4PZOA 3MBYA 2WAQC 2LYHA 5KFVA 2KICA 5J2AA 4ED8A 4JK1A 2P6RA 2HBJA 5JUMA 9ICGA 4KN4A 1PVPA 1ZQAA 5AK4A 4YD2A 3PSIA 1L3TA 2EANA 2JMGA 4CCHA 4KMUA 5AKLA 1ZQNA 2JZBA 4OJPA 5AIBA 2KK0A 4CE6A 4ECVA 1VLBA 4M04A 2DF4B 3TARA 2CRXA 5DG9A 3GIJA 2R18A 4C8LA 4J9OA 5L9XA 1T3QA 1S10A 1CRXA 2KHQA 4KMOB 4RZRA 2BHNA 3V7KA 2YMMA 1EXNA 3PX0A 1CI4A 3M6ZA 3MABA 1S97A 1T4GA 5D49A 4PPXA 3PR4A 4J9KA 1ZQHA 7ICIA 2HHVA 1XSPA 4DO9A 2MUTA 5HMLA 2W3RA 4Z6CA 2WHEA 5KFZA 3IM1A 1UA0A 2JHDA 2KV2A 4FZNA 1ZQEA 1NK9A 7ICOA 1XNSA 1Q46A 4GC6A 3ALRA 4KTQA 8ICHA 5CA7A 1RQNA 1DOQA 5AKEA 3CNHA 3QYPA 5AK6A 4DF8A 2K4PA 2PI4A 4P0QB 3RR8A 4J9RA 3HW8A 3LVVA 3PMLA 7ICSA 1NKBA 1IV8A 1L3VA 4OO1J 1NZPA 2ZIWA 3DDHA 2OH2A 4RQ3A 3UXPA 2GH1A 1TAMA 1RM6C 1FFVA 7ICJA 4GFJA 2AGPA 9ICTA 1YT3A 4BXOB 4RQ8A 1KLNA 3N7RC 4GC7A 1SL1A 4DQPA 2AQ0A 8ICPA 2FLLA 3TAQA 5ALJA 1U48A 4Z6FA 2KFZA 4R65A 2KE7A 1T7PA 5AKHA 2HCFA 1L6NA 2DL0A 2C2EA 2XGPA 1TE2A 1YZ7A 3SV3A 4KLDA 5EE9A 5J0WA 3G6VA 3WK4A 2KG5A 5G5GA 4OJ6A 3HP6A 1QSSA 4DQQA 4DEZA 2EZYA 5BOLA 1Q3VA 4Y2SA 3SZ2A 4O3QA 3QUCA 2KEYA 1O08A 5AKZA 4M9GA 1B22A 4M6WB 4M9LA 4ED2A 3SV4A 7ICFA 5J0OA 9ICBA 1ZQQA 3V7JA 5C5JA 5AI8A 3QZ8A 4J9LA 2EH9A 1C20A 3HILA 2K8AA 1BGXT 1TAQA 3D2QA 1MSWD 3H0MB 1AROP 4YR3A 4O3SA 5L1KA 2B6GA 3RAXA 3NASA 4UAVA 4C7ZA 2ZXIA 3Q8LA 1TAUA 1URJA 3UMGA 3VCBA 3Q8QB 2PI5A 4P4MA 2MU2A 4J03A 2KFNA 3QNMA 9ICFA 5J0YA 3PW0A 3EWAA 4PHAA 1XO1A 5KFHA 4DOAA 4ECYA 2F2AB 3FDSA 4DL5A 5HHIA 4F72A 2ZIVB 2LM1A 4KLUA 4UW9A 4NJ8A 4NWIA 4EBCA 5AI4A 4GLXA 1S76D 2G06A 4XUSA 5AIAA 2PXIA 3OSPA 1BNPA 4NL9A 9ICVA 2VA8A 4P4PA 7ICKA 8ICOA 2PFQA 5ALWA 7ICNA 1OW5A 1PVRA 2HOQA 2LM4A 5H2FU 2JR5A 4IRCA 3M7DA 4B9TA 3H4BA 3MDCA 4ZOHC 4BX9C 5J0UA 4QJFB 4C8NA 4DOCA 2RHFA 8ICEA 2FPKA 1SZHA 4P0QA 1X6JA 3C1ZA 3BQ7A 2J6SA 3TFRA 3TACB 1BPZA 1PUZA 3KZXA 4ECSA 4KN7A 4YR2A 4I2JA 5IIJA 4F4ZA 8ICTA 5J2IA 4QZDA 4ECXA 2OEHA 5AI0A 4RNNA 1JRPA 4Q8EA 2F44A 3C1YA 4B6JA 4BXOA 4RT2A 2FLNA 3RR7A 5F9NA 5KFFA 3RRHA 2ODGA 2OCEA 1D9DA 3SAHA 3NUQA 1U9LA 4KLJA 4QNLA 3AMZA 3EZ5A 2R8KA 3WKBA 4EZ9A 8ICWA 3UPQA 1SKRA 3OHBA 4Y2VA 3SI8A 4FO6A 1SXEA 3QX7A 2MAXA 4C4RA 2L5YA 2BCQA 2ZIUB 4F4YA 5KFTA 1TVAA 3B0XA 2YX8A 2BPCA 1J2NA 8ICKA 4USAA 4IC9A 4IRKA 4KLTA 2YMPA 3TQ1A 5KFSA 1JXEA 3QUTA 5KT2A 2EAPA 3BS7A 3V7LA 4AYBC 4M6WA 3JPOA 1QQ5A 2ZUBA 1FO4A 3E2EA 1Z00B 2MA1A 2IMWP 4QWCA 5KFWA 2I9GA 4UAWA 2ISOA 4IRDA 4ZH4A
chains in the Genus database with same CATH topology
1HIWA 2VJ5A 5KL8B 1PVRA 1XO0A 2K89A 3IN5A 2VJ4A 1Q3VA 2HOQA 1CRXA 4A8EA 3D2SA 2KHQA 3L3FX 4KMOB 5T14A 2KEYA 3AL0B 2KNJA 2NV3A 3M7DA 4P0PA 2LHTA 4OJ5A 5HR6A 2OYYA 1Z19A 4BX9C 3M6ZA 3T79A 4QJFB 3SAGA 2JGAA 2E1FA 2XICA 3CYMA 2RHFA 4PL2A 3MGVA 4PL1A 4QIWC 3IG8A 4U7CA 3M6KA 5KL1B 5CRXA 2M0NA 2KD1A 2HOFA 1ED1A 1SZHA 2CPRA 3CRXA 4P0QA 3H0RB 4WJ3B 4BUGA 2DQNB 2VKQA 3RF9A 3PSTA 2LKYA 2K8AA 1GO3F 2JHDA 2KV2A 2W04A 4FZNA 2K8CB 2K4EA 2K4HA 1XNSA 2G0AA 3D2QA 2XVTA 1DRGA 2HBMA 3KZXA 4P0PB 3ALRA 2G07A 2HOIA 3H0MB 2YB1A 2G5HB 4FZLA 4BJQA 3N7SC 2H3IA 2W03A 2BDUA 2G08A 2G5IB 1Z1BA 2JH7A 2CN1A 2H3FA 1OUQA 4CDGA 2ZIVA 3PZPA 2KIWA 3D2NA 4CRXA 2MRLA 4FE3A 2ZXIA 3GU3A 4P0QB 2Q4TA 3ICXA 4ACOA 2ZIXA 2K4IA 2F8LA 1P7DA 1URJA 1ZQ1C 3VCBA 3HKZF 4C0ZA 3NUQA 3SAHA 3LVVA 4NV0A 3LYSA 3HKZC 4KX3A 4QNLA 2WB1F 1Q3UA 1IIPA 3LVWA 2ZIUA 3SMVA 4OO1J 2H3QA 2OM6A 2W7PA 3F2CA 2ZIWA 5A0LA 2OH2A 3SAFA 3SQIA 3F5EA 2GH1A 2F2AB 3OPXA 1KBUA 2F77X 2E5SA 2XI9A 2H3ZA 2WAQF 1TAMA 2F76X 2KJ9A 2WAQC 2ZIVB 2RP5A 3GZFA 4GFJA 4ICAA 5C0YA 3CP8A 3F2DA 2PMZF 3C28A 1WUDA 1YT3A 2DGZA 2KOBA 2LBOA 2KICA 2H3VA 2PMZC 3F5AA 4FZMA 2ZIXB 3O0FA 1HEKA 3N7RC 2HBJA 2VIXA 2Y0SF 3VC8A 3AQEA 2A3VA 2KJ8A 2KKVA 3DEEA 4OJLA 2KKPA 1T94A 2HBLA 4NWIA 1MA7A 3IG5A 4U6PA 1A0PA 2ZIUB 4CGZA 2KJ5A 1PVPA 4KX5A 2HBKA 1ECWA 4NLBA 3AQFA 2YX8A 2E1EA 4OJOA 2ZIWB 3PSIA 2JMGA 2G09A 2RRDA 2WB1C 3F53A 4IC9A 3C29A 2G06A 2JH1A 4O3MA 4JMUA 2ZG6A 2K8BB 3RFAA 1L6NA 3F2BA 2OXOA 2ZXHA 4OJPA 1D8BA 3PSPA 1NZBA 2LYBA 2GOLA 4AYBF 1PVQA 5HR7A 4QIWF 2W7OA 4AYBC 2DF4B 4NLCA 2LYAA 2YB4A 2XIDA 2MA1A 3K1ZA 3PSFA 2CRXA 3KFUF 2KHVA 3N7PD 2KVCA 3NRWA 1UPHA 4OJ6A 3H0LB 1F44A 3IP4B 2D6FC 1A6SA 2Y0SC 2HMXA 2R18A 3E0FA 3ONNA 2N1RA 2Z7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HIW A;  1ECW A;  2K4E A;  2K4H A;  2JMG A;  4IC9 A;  2H3Q A;  2NV3 A;  4JMU A;  2H3I A;  1L6N A;  2H3Z A;  1TAM A;  4ICA A;  2LYB A;  2H3F A;  2GOL A;  2H3V A;  2LYA A;  1HEK A;  2K4I A;  1UPH A;  1ED1 A;  1A6S A;  2HMX A;  2N1R A; 
#chains in the Genus database with same CATH topology
 4OD0 A;  2Y1I A;  4J9P A;  4JUZ A;  8ICS A;  5F3X B;  2IOH A;  5AKX A;  4NY8 A;  2HSZ A;  3LWL A;  3JPP A;  5KL1 B;  3KHH A;  2KD1 A;  5EWG A;  1ED1 A;  2CPR A;  3RF9 A;  3PST A;  2EZX A;  1MQ3 A;  3NVV A;  4DLE A;  2EQY A;  4JV1 A;  4P0P B;  3NVZ A;  5D4B A;  1L3U A;  1Z1B A;  2JH7 A;  4TUQ A;  3NS1 A;  4RQM A;  3IHQ B;  1OUQ A;  2ZIV A;  1VJ5 A;  2KIW A;  2WF9 A;  4DSJ A;  3NTU A;  4YQW A;  1ZQC A;  2I6X A;  3C2M A;  3HKZ C;  1NK5 A;  1ZOL A;  8ICA A;  1JMS A;  2H3Q A;  2UVU A;  4KLO A;  7ICR A;  3SQI A;  3ZDE A;  2HHX A;  3FM9 A;  2HDO A;  5DQG A;  1ZQF A;  5L1I A;  4BWM A;  4GIB A;  4RQ4 A;  1BPD A;  2WF6 A;  1S0N A;  2BCS A;  3F53 A;  2AJQ A;  2EZZ A;  9ICI A;  1TKD A;  4DSL A;  1N60 A;  3RFA A;  4UAT A;  2YTU A;  3PSP A;  1TK0 A;  2C28 A;  1NK6 A;  3H8S A;  3MR2 A;  4ED0 A;  3NVW A;  2F1H A;  7ICU A;  2AH5 A;  4ED7 A;  3PSF A;  3PR5 B;  2XY6 A;  3UM9 A;  4NXZ A;  2XY7 A;  5KT6 A;  3ZI4 A;  2CXY A;  5AM1 A;  5IIK A;  9ICQ A;  2EAM A;  4YMO A;  3WK8 A;  2BZF A;  2LHT A;  4OJ5 A;  1KL9 A;  5KFK A;  5HR6 A;  4O9M A;  5KG1 A;  1L7N A;  3BQ0 A;  3QE9 Y;  5KFE A;  4U7C A;  4QW8 A;  2M0N A;  4UB5 A;  5AM4 A;  4UAR A;  1WCN A;  3ED5 A;  3H40 A;  7ICT A;  3K4G A;  4YMM A;  2HHT A;  5GTH U;  2RLT A;  2HHQ A;  2XVT A;  2HOI A;  4QZ8 A;  5ALM A;  4I29 A;  2H3I A;  2W03 A;  2BDU A;  3RH6 A;  3PZP A;  3OHA A;  1KSP A;  4G3I A;  2KVS A;  8ICN A;  5J0T A;  1ZQ1 C;  1NKC A;  5KG5 A;  2JRZ A;  2ZIU A;  3SMV A;  1HJP A;  4MF8 A;  2I1Q A;  4JV2 A;  3IV6 A;  2FMS A;  4XQ8 A;  1U47 A;  2XY5 A;  4JWN A;  4DL2 A;  4DLG A;  3GZF A;  2KOB A;  4G9B A;  2PMZ C;  3F5A A;  4UB6 U;  4RUC A;  3O0F A;  5KG0 A;  1Z00 A;  2P35 A;  2C2D A;  4PHE A;  4U6P A;  3JPR A;  2FPL A;  2AU0 A;  3AQF A;  5KNI A;  5III A;  3C29 A;  1F5S A;  9ICK A;  3R9K A;  1SKW A;  5CR0 A;  1D8B A;  3GV7 B;  1ZQX A;  5J2G A;  3ZDA A;  2QAR B;  5AM0 A;  4B9S A;  4QZH A;  2FMP A;  4J9S A;  1UQV A;  5DGA A;  5AKY A;  3IP4 B;  4O5K A;  1JAL A;  4F4K A;  1NK0 A;  5TZV A;  2UVW A;  5ALU A;  4DQR A;  4O3N A;  3EYZ A;  3BQ1 A;  1ZQR A;  4F50 A;  3TAP A;  3M8S A;  2KNJ A;  4C8K A;  4P0P A;  5KFJ A;  4KLE A;  4UAZ A;  2VA2 A;  3TAD C;  2JGA A;  2XIC A;  4DS5 A;  4YG2 A;  1L8L A;  3AUO A;  1NK4 A;  3RJJ A;  2W3S A;  2ES6 A;  2ISP A;  3N28 A;  4Y2R A;  4F92 B;  2ASD A;  1ZQY A;  2LKY A;  4YXM A;  3V6H A;  3PNC A;  2J6U A;  9ICS A;  1ZQJ A;  4DSF A;  5CEH A;  9ICC A;  3UXO A;  2R8I A;  2G08 A;  1H38 A;  5CWR A;  4UAY A;  4QWA A;  1JX4 A;  4KLM A;  2ASL A;  2QB0 B;  5ALY A;  4X5V A;  2AHO B;  8ICU A;  2RDI A;  2C22 A;  1IIP A;  2W8L A;  3EPI A;  3WKC A;  2W7P A;  1X2I A;  2NYV A;  4LZG A;  2NRT A;  1B0X A;  2W9C B;  2H3V A;  3V6J A;  1L7M A;  2UVR A;  1SZP A;  2GO7 A;  3VC8 A;  4DL7 A;  2KKV A;  3KKA C;  4PHD A;  2KKP A;  1U4B A;  1QTM A;  9ICO A;  3M9N B;  1ZQD A;  1Z3E B;  4B9N A;  3AU2 A;  3GV8 B;  2RDJ A;  1NJW A;  1D8Y A;  5KFI A;  1L7O A;  3RB4 A;  1K1Q A;  5J8Y A;  5HR7 A;  5DB9 A;  1ZQZ A;  4YD1 A;  4NLN A;  1YZ6 A;  1QSY A;  1UPH A;  2WFA A;  3QU5 A;  2HMX A;  4MHV A;  5JU5 A;  5J0Q A;  5J2K A;  4F2R A;  4R66 A;  1L7P A;  2VAN A;  2Z7J A;  3G6X A;  5KL8 B;  3JPQ A;  1RPL A;  2YMQ A;  4UAU A;  2FDR A;  1TV9 A;  4UQG A;  2F3N A;  1SL0 A;  5D46 A;  3A0H U;  3WK7 A;  2FI1 A;  4EX6 A;  4ELV A;  3PO5 A;  2F8K A;  4MF2 A;  2IHN A;  4MFC A;  5DG8 A;  2HVI A;  1NJY A;  4JB3 A;  5J29 A;  4F5O A;  2HOF A;  3CRX A;  4PH5 A;  1N56 A;  4DQS A;  5KFO A;  1GO3 F;  2W04 A;  2K4H A;  2E8P A;  1A76 A;  1ZQO A;  5KG6 A;  4K4G A;  4KLH A;  3N7S C;  5L1M A;  5AM2 A;  2CN1 A;  5K4L A;  2H3F A;  2KZM A;  3GU3 A;  3C2K A;  2KZ3 A;  5AKG A;  1J97 A;  3HPO A;  4DOB A;  2HI0 A;  2KN7 A;  2IOF A;  4DFK A;  4YFK A;  3KD3 A;  2Y1J A;  3U26 A;  4EYH B;  5J0X A;  1AQ6 A;  2IOF K;  3OPX A;  2F77 X;  4F8R A;  2WAQ F;  1TK5 A;  1TK8 A;  1C7Y A;  1ZRN A;  2DGZ A;  2ZIX B;  2QAR A;  4DSK A;  5ALX A;  1NNL A;  4DFJ A;  7ICP A;  1NKE A;  2KJ5 A;  4KX5 A;  3QEB Z;  1RYU A;  3RBD A;  1X9X A;  2WB1 C;  4P4O A;  4CNQ A;  2OXO A;  2ZXH A;  5J2J A;  4RPX A;  3FAH A;  5ALF A;  1V85 A;  2DPI A;  5KAF U;  3I28 A;  4B9U A;  4F93 B;  3N7P D;  1O03 A;  1WCL A;  2KIV A;  3ISC A;  3GDX A;  4IQU A;  1T8E A;  3ONN A;  1KRP A;  3Q8M A;  1XO0 A;  4ECZ A;  2K89 A;  2F1J A;  2UVV A;  4J9M A;  4NLG A;  1X9M A;  2A19 A;  3L3F X;  3C5F A;  4PHP A;  2BCR A;  3RJH A;  1LKY B;  3CYM A;  3UMB A;  1X40 A;  3PW5 A;  2QB0 A;  4QZE A;  1DK2 A;  3UQ0 A;  1X9S A;  2W8K A;  4US9 A;  5EOZ A;  2V4Q A;  1L5U A;  2GLE A;  8ICY A;  4NLZ A;  2G5I B;  1KFT A;  3B9J A;  3LWM A;  3LDA A;  3ZD9 A;  5AI9 A;  5KFB A;  2W9C A;  1S77 D;  4CF4 A;  4I2D A;  3GIL A;  3RJI A;  1JUD A;  2F76 X;  4I28 A;  3C28 A;  1XU4 A;  2DPJ A;  5J2H A;  3EPG A;  4FBU A;  2BDP A;  4DL6 A;  5CP2 A;  2QKQ A;  2A3V A;  5J0S A;  2B21 A;  2NRW A;  3ETR A;  1ZRM A;  2ZTC A;  3ISB A;  3SD7 A;  3MDA A;  4RQ5 A;  3NGD A;  4GXJ A;  2HHW A;  4NLB A;  4DQI A;  4DWI A;  1BPB A;  4UAS A;  4C8O A;  1ZQU A;  4BWJ A;  1CUK A;  3RB3 A;  7ICE A;  3H4D A;  8ICB A;  8ICC A;  1DK3 A;  1PZN A;  3PW2 A;  4Y2Y A;  5KT5 A;  3PW7 A;  4IR9 A;  2MSN A;  4EBD A;  3OSN A;  4NL9 C;  9ICJ A;  3RJF A;  3M9O B;  4A8E A;  2GWS A;  1WYG A;  2R8J A;  8ICR A;  2NV3 A;  5DGB A;  2OYY A;  3D6J A;  4ELU A;  1RG6 A;  3V6K A;  3FC4 A;  2PFO A;  2AGO A;  3H0R B;  1LB2 B;  2NRV A;  5ALQ A;  3MR3 A;  4FBT A;  2K8C B;  3MFH A;  4QZB A;  3B0Y A;  1DRG A;  4RNO A;  3K1R B;  8ICQ A;  2ZUC A;  4US8 A;  5KFC A;  3BZC A;  4I2F A;  1ZJN A;  1QLN A;  1XSN A;  1SV4 A;  5KFN A;  5DB7 A;  3IDW A;  4ACO A;  1UA1 A;  2ZIX A;  2F8L A;  2R8G A;  4C0Z A;  4LJX A;  1ZQB A;  2WB1 F;  1DGJ A;  3SAF A;  2ASJ A;  2XI9 A;  4TQS A;  4ED1 A;  5KT7 A;  4ICA A;  2RP5 A;  1N5X A;  3C23 A;  5KTQ A;  3K75 D;  4PGQ A;  4O3P A;  4KIT B;  1NI3 A;  5DBC A;  2KJ8 A;  5AK5 A;  1KFS A;  4KLS A;  1HUO A;  1KFD A;  3KHR A;  5DB8 A;  4OJO A;  4R8U B;  3QU4 A;  5ALR A;  2JH1 A;  4PZN A;  1X42 A;  2E8N A;  1PVQ A;  3QXG A;  1LKY A;  4K4I A;  9ICM A;  1ZD4 A;  5AIC A;  5AI5 A;  4Y2U A;  2KVC A;  1A6S A;  5FP0 A;  3E0F A;  1ZQK A;  1HIW A;  5KFQ A;  3GIK A;  4EEK A;  3IN5 A;  1N61 A;  1SWW A;  4ECT A;  5GTI U;  1ZYQ A;  9ICW A;  1RDF A;  4ED6 A;  1COO A;  1K1S A;  4YVZ A;  3QU9 A;  1Z19 A;  3T79 A;  3PY8 A;  2BCU A;  3MC1 A;  5ALP A;  5ALS A;  3AEV A;  9ICH A;  4PL1 A;  3M6K A;  3QZ7 A;  5KFP A;  3NVY A;  1FFU A;  1JIH A;  3PVX A;  3PO4 A;  2WF7 A;  2FJ6 A;  5KG4 A;  4UBC A;  1D9F A;  2AQ4 A;  3BS5 B;  4GXI A;  4ELT A;  5CHG A;  4DSE A;  4C8M A;  3SR6 A;  1KW4 A;  3UXN A;  5DB6 A;  4K4H A;  3UMC A;  1PK1 B;  3ICX A;  3N4M B;  1V9P A;  4KLF A;  3SEI A;  2AXT U;  3LYS A;  5KFG A;  5A0L A;  2EDU A;  5IIL A;  1JI7 A;  2O6K A;  4J9Q A;  2LI6 A;  4XA5 A;  4PGY A;  4YCX A;  4I27 A;  5KFD A;  3CP8 A;  3T5L A;  5KG2 A;  3Q8R B;  1WUD A;  2XGQ A;  3WU2 U;  4FZM A;  5DDM A;  2VIX A;  5EWF A;  3Q8P B;  4OJL A;  5AKK A;  4R64 A;  4NLK A;  1NK7 A;  5KT4 A;  4Z6E A;  2W11 A;  1ZET A;  5JRT A;  4F4W A;  4CF5 A;  4EX7 A;  1SGG A;  4OCZ A;  4QZI A;  5BOM A;  3S6J A;  4AYB F;  2ZJ8 A;  2Q0Z X;  2XID A;  1U45 A;  1L3S A;  5CB1 A;  4RQ0 A;  3JPN A;  4KLI A;  1ZD5 A;  3BZK A;  3MGI A;  3D2S A;  5DG7 A;  3MR6 A;  5AI6 A;  4M9H A;  9ICP A;  2W55 A;  1B4F A;  1KEJ A;  3IG8 A;  8ICJ A;  5CRX A;  4IQT A;  1ZQV A;  4EYI B;  5EWE A;  2R8H A;  3H7I A;  1S0M A;  2YML A;  4E0D A;  3WKA A;  1F0M A;  4R63 A;  1RZT A;  5L1J A;  1ZQG A;  1MN8 A;  2HBM A;  1BNO A;  2FMQ A;  4ED3 A;  1ZQT A;  4JV0 A;  3OJS A;  4I2E A;  2G5H B;  2NO5 A;  1QQ7 A;  5DBA A;  2FLP A;  2PFN A;  4DCC A;  1SIJ A;  4HYK A;  3ZDD A;  4P2H A;  4YN4 A;  1NK8 A;  5KFY A;  2KP7 A;  8ICM A;  1KN5 A;  3HKZ F;  4KLG A;  3Q8S B;  4Q45 A;  2XC9 A;  4R8U A;  3F5E A;  3M8R A;  1ZJM A;  4IQV A;  5AKI A;  1V38 A;  8ICX A;  4J9N A;  3F2D A;  4I2H A;  2BQR A;  7ICQ A;  1BPE A;  4F3O A;  2DKX A;  3DEE A;  1IG6 A;  2W9A A;  1T94 A;  1MA7 A;  5JTI A;  2KTQ A;  4RNM A;  2HBK A;  1ECW A;  3QEA Z;  4B9L A;  3TI0 A;  1QQ6 A;  4O3M A;  2P6U A;  4DFD A;  5DLG A;  3QUB A;  4NM2 A;  1LV5 A;  4EEN A;  1ZD3 A;  3HRD D;  8ICG A;  3UQ2 A;  3HWT A;  2Y0S C;  2BCV A;  3WKE A;  2W9B B;  3OJU A;  5BPC A;  3J81 j;  9ICX A;  2H5X A;  1N48 A;  4C80 A;  4KLQ A;  4M9N A;  3TKA A;  3T3F A;  2JEF A;  3BS5 A;  1RQL A;  3WK9 A;  4F5R A;  3SAG A;  1S0O A;  2HVH A;  3PMN A;  2A1J B;  1COK A;  4PGX A;  2LPE A;  4FFD A;  3ETL A;  3FYH A;  1PK1 A;  4RQ2 A;  2DQN B;  2VKQ A;  2JV3 A;  5DQH A;  4TQR A;  2G07 A;  4O0I A;  5IIM A;  4QZC A;  5KFM A;  4M2Y A;  4RQ6 A;  3WK6 A;  3KTQ A;  2ZJA A;  3D2N A;  2MRL A;  1ZQI A;  1X6I A;  4KLL A;  2K4I A;  4ECW A;  4IQW A;  4ECR A;  2NRZ A;  2HW3 A;  3L4P A;  3GV5 B;  5HHH A;  4YXJ A;  5IIO A;  3IRU A;  1B43 A;  3F2C A;  2E3T A;  1SKS A;  1KBU A;  4UB8 U;  2KJ9 A;  4RU9 A;  4F5P A;  2PMZ F;  2JXJ A;  2FE9 A;  3GFK B;  2LBO A;  4I2A A;  4RT3 A;  1IM4 A;  3PX4 A;  7ICG A;  1X66 A;  3RB0 A;  4RPZ A;  3M1Y A;  4DFP A;  1KKX A;  3IG5 A;  1A0P A;  1Z4O A;  4CGZ A;  5EE3 A;  5IIN A;  2M9N A;  4O3O A;  2E1E A;  4DS4 A;  2RRD A;  3QU7 A;  3MGH A;  4JMU A;  2ZG6 A;  2K8B B;  4Y2X A;  1ZQW A;  2LYB A;  2GOL A;  1FIQ A;  9ICE A;  1JXL A;  4PJ0 U;  2KHV A;  1QH9 A;  1TFR A;  1SXD A;  2FPM A;  2N1R A;  5J8Y C;  2KZZ A;  4F5Q A;  4C7Y A;  1MC8 A;  5KFU A;  1NOM A;  2PKE A;  5T14 A;  4M9J A;  4UB3 A;  2XCA A;  5KG3 A;  5DKW A;  3A0B U;  5J0R A;  3BDP A;  4I2I A;  8ICV A;  3MGV A;  4NM1 A;  1RYS A;  2V9W A;  1UT5 A;  1LVH A;  4DFM A;  1WWV A;  5HMM A;  2EAO A;  4WJ3 B;  2I5H A;  2ZUD A;  7ICH A;  2ZJ5 A;  2YY6 A;  2YQE A;  1RXW A;  4QZF A;  1WWU A;  4DF4 A;  4Y2Q A;  1ZQM A;  5J2D A;  3C21 A;  4DSI A;  2KSO B;  2W9M A;  5ALN A;  2BKE A;  3I76 A;  3ZD8 A;  2W54 A;  5HNK A;  5ALK A;  4F2S A;  4EZ6 A;  2DFL A;  9ICN A;  4YR0 A;  4RPY A;  3PV8 A;  1ZQL A;  5KFR A;  3MR5 A;  1SV0 A;  4GXK A;  2BR0 A;  4MFF A;  1QCK A;  2DWQ A;  3RH5 A;  1MQ2 A;  4O5C A;  3T5H A;  5ALV A;  1N2X A;  4UB2 A;  1L8O A;  3OTQ A;  1XSL A;  3GII A;  4C4S A;  2Y0S F;  4IS7 A;  5ALG A;  5EE1 A;  5F9L A;  2HBL A;  5KT3 A;  4BGD A;  1SB3 C;  3H8W A;  2W9B A;  4UB4 A;  3RTV A;  4AP9 A;  3M9M B;  5KG7 A;  3RJG A;  3AM9 A;  3F2B A;  2XCP A;  1NZB A;  4DL3 A;  2W7O A;  4NLC A;  2ESE A;  3KBB A;  9ICA A;  2LYA A;  3K1Z A;  1UCV A;  2A1J A;  7ICV A;  4LZD A;  1SWV A;  1F44 A;  2VJ5 A;  2A1A A;  3H8J A;  4EEL A;  1Z4N A;  5KFX A;  4IR1 A;  2E8M A;  5J2C A;  2AGQ A;  1DGS A;  5DBB A;  3BQ2 A;  2BPF A;  1ZQS A;  4RQ1 A;  4QIW C;  2BQ3 A;  4TUS A;  3TFS A;  4F91 B;  2F1I A;  4RUA A;  2HHS A;  4MEX A;  2DBY A;  3RJE A;  1M6Y A;  5EE0 A;  3RB6 A;  2B0C A;  2G0A A;  3KOO A;  1A77 A;  1SL2 A;  4FZL A;  2W43 A;  3V72 A;  5ALE A;  1Z1V A;  1SV0 C;  2RQ5 A;  4I2B A;  3SEN A;  1IXR A;  4EBE A;  4O5E A;  2VA3 A;  2ZTD A;  3RRG A;  1DXS A;  1QSL A;  5DDY A;  2D3D A;  4ECU A;  1N5W A;  2OM6 A;  4Z6D A;  1RYR A;  3RJK A;  3T5K A;  4RQ7 A;  2KMD A;  4M47 A;  1FEZ A;  2H3Z A;  4F4X A;  4FS2 A;  5ALH A;  9ICR A;  8ICI A;  4EEY A;  8ICF A;  2ALZ A;  1S0V A;  1HEK A;  4Q43 A;  3I1Y A;  3AQE A;  2OHF A;  5CJ7 A;  3TAN A;  3QUQ A;  3HT3 A;  3DV9 A;  5J2B A;  1S8O A;  4QWB A;  8ICL A;  5ALZ A;  4CF3 A;  4MFA A;  4Y2P A;  1JN3 A;  7ICM A;  1PK3 A;  3EW9 A;  4QWD A;  4QZG A;  4DL4 A;  1U49 A;  5AKJ A;  2YB4 A;  5L1L A;  3KFU F;  3H8M A;  3NRW A;  2D6F C;  4LVS A;  2WF8 A;  7ICL A;  3EUB 2;  5ALD A;  2IHM A;  1RXV A;  2ZTE A;  2C2R A;  2JEJ A;  2VJ4 A;  5TIS U;  2JZB B;  5KFL A;  3RAQ A;  9ICU A;  2WF5 A;  3THV A;  3BJY A;  2QB1 A;  1S9F A;  5ALI A;  4PL2 A;  3MFI A;  2KSO A;  5AM5 A;  1NJX A;  4TUR A;  5J2F A;  4HAI A;  1BPY A;  1CEZ A;  2OWO A;  1VDV A;  4QWE A;  2IA6 A;  2K4E A;  4RQN A;  4F71 A;  1BPX A;  1WG8 A;  4MEY A;  2YB1 A;  3NRZ A;  2NRX A;  4ECQ A;  2BGW A;  4Y2J A;  4QW9 A;  4FE3 A;  2Q4T A;  3T5J A;  1P7D A;  2MUT B;  3C5G A;  2DUY A;  1XWL A;  4Q8F A;  4QZ9 A;  4UBB A;  5E79 U;  2HHU A;  4IL6 U;  1Q3U A;  4FS1 A;  5ALT A;  4M0A A;  3G6Y A;  1KDH A;  1T3N A;  3ZDB A;  2E5S A;  5KAI U;  3WKD A;  5J0P A;  5C0Y A;  2DKZ A;  3RH4 A;  2BQU A;  3BQT A;  1ZXI A;  4YP3 A;  4BDP A;  3ZDC A;  2IBK A;  4B9V A;  4TUP A;  3GQC A;  1UT8 A;  1XS9 D;  1K5O A;  1KTQ A;  2ZIW B;  5B5E U;  3LK9 A;  2G09 A;  4B9M A;  2JEG A;  1OXJ A;  4F5N A;  1JRO A;  3Q8K A;  2WTF A;  2Y9T A;  3C2L A;  3GIM A;  2V4R A;  4YMN A;  4QIW F;  3ORY A;  1HUZ A;  4Y2T A;  3PX6 A;  5ALL A;  5DQI A;  2ATL A;  1X9W A;  1Q8K A;  3JPS A;  2NO4 A;  1BVS A;  3H0L B;  3KZI U;  4UB1 A;  4I2G A;  3HX0 A;  3TAD A;  5AK3 A;  2LMR A;  3HJE A;  1KQQ A;  1V97 A;  4C4T A;  3KHL A;  1NJZ A;  3AL0 B;  1N62 A;  1ZD2 P;  3AN1 A;  2PFP A;  3KHG A;  2YN4 A;  1D8L A;  4Q44 A;  2E1F A;  3PW4 A;  4I2C A;  3CW2 C;  3SYZ A;  3RBE A;  3OGU A;  3N97 B;  4QZA A;  8ICZ A;  4BUG A;  5J2E A;  3ISD A;  1UHU A;  2K60 A;  1N63 A;  3L5K A;  2XO7 A;  2JEI A;  5ALO A;  5AHX A;  4O3R A;  3AU6 A;  4BJQ A;  5B66 U;  3QU2 A;  5DLF A;  5HP4 A;  2E8O A;  5G5H A;  4CDG A;  2Y9U A;  4CRX A;  3E58 A;  1Y88 A;  1J2M A;  1XC9 A;  9ICL A;  4JWM A;  1ZQP A;  5KFA A;  1S5L U;  2J6T A;  2BPG A;  2QLT A;  4NV0 A;  4KX3 A;  2D8C A;  3LVW A;  5AM3 A;  4XRH A;  3KKA A;  2P66 A;  3JPT A;  3WK5 A;  4PZO A;  3MBY A;  2WAQ C;  2LYH A;  5KFV A;  2KIC A;  5J2A A;  4ED8 A;  4JK1 A;  2P6R A;  2HBJ A;  5JUM A;  9ICG A;  4KN4 A;  1PVP A;  1ZQA A;  5AK4 A;  4YD2 A;  3PSI A;  1L3T A;  2EAN A;  2JMG A;  4CCH A;  4KMU A;  5AKL A;  1ZQN A;  2JZB A;  4OJP A;  5AIB A;  2KK0 A;  4CE6 A;  4ECV A;  1VLB A;  4M04 A;  2DF4 B;  3TAR A;  2CRX A;  5DG9 A;  3GIJ A;  2R18 A;  4C8L A;  4J9O A;  5L9X A;  1T3Q A;  1S10 A;  1CRX A;  2KHQ A;  4KMO B;  4RZR A;  2BHN A;  3V7K A;  2YMM A;  1EXN A;  3PX0 A;  1CI4 A;  3M6Z A;  3MAB A;  1S97 A;  1T4G A;  5D49 A;  4PPX A;  3PR4 A;  4J9K A;  1ZQH A;  7ICI A;  2HHV A;  1XSP A;  4DO9 A;  2MUT A;  5HML A;  2W3R A;  4Z6C A;  2WHE A;  5KFZ A;  3IM1 A;  1UA0 A;  2JHD A;  2KV2 A;  4FZN A;  1ZQE A;  1NK9 A;  7ICO A;  1XNS A;  1Q46 A;  4GC6 A;  3ALR A;  4KTQ A;  8ICH A;  5CA7 A;  1RQN A;  1DOQ A;  5AKE A;  3CNH A;  3QYP A;  5AK6 A;  4DF8 A;  2K4P A;  2PI4 A;  4P0Q B;  3RR8 A;  4J9R A;  3HW8 A;  3LVV A;  3PML A;  7ICS A;  1NKB A;  1IV8 A;  1L3V A;  4OO1 J;  1NZP A;  2ZIW A;  3DDH A;  2OH2 A;  4RQ3 A;  3UXP A;  2GH1 A;  1TAM A;  1RM6 C;  1FFV A;  7ICJ A;  4GFJ A;  2AGP A;  9ICT A;  1YT3 A;  4BXO B;  4RQ8 A;  1KLN A;  3N7R C;  4GC7 A;  1SL1 A;  4DQP A;  2AQ0 A;  8ICP A;  2FLL A;  3TAQ A;  5ALJ A;  1U48 A;  4Z6F A;  2KFZ A;  4R65 A;  2KE7 A;  1T7P A;  5AKH A;  2HCF A;  1L6N A;  2DL0 A;  2C2E A;  2XGP A;  1TE2 A;  1YZ7 A;  3SV3 A;  4KLD A;  5EE9 A;  5J0W A;  3G6V A;  3WK4 A;  2KG5 A;  5G5G A;  4OJ6 A;  3HP6 A;  1QSS A;  4DQQ A;  4DEZ A;  2EZY A;  5BOL A;  1Q3V A;  4Y2S A;  3SZ2 A;  4O3Q A;  3QUC A;  2KEY A;  1O08 A;  5AKZ A;  4M9G A;  1B22 A;  4M6W B;  4M9L A;  4ED2 A;  3SV4 A;  7ICF A;  5J0O A;  9ICB A;  1ZQQ A;  3V7J A;  5C5J A;  5AI8 A;  3QZ8 A;  4J9L A;  2EH9 A;  1C20 A;  3HIL A;  2K8A A;  1BGX T;  1TAQ A;  3D2Q A;  1MSW D;  3H0M B;  1ARO P;  4YR3 A;  4O3S A;  5L1K A;  2B6G A;  3RAX A;  3NAS A;  4UAV A;  4C7Z A;  2ZXI A;  3Q8L A;  1TAU A;  1URJ A;  3UMG A;  3VCB A;  3Q8Q B;  2PI5 A;  4P4M A;  2MU2 A;  4J03 A;  2KFN A;  3QNM A;  9ICF A;  5J0Y A;  3PW0 A;  3EWA A;  4PHA A;  1XO1 A;  5KFH A;  4DOA A;  4ECY A;  2F2A B;  3FDS A;  4DL5 A;  5HHI A;  4F72 A;  2ZIV B;  2LM1 A;  4KLU A;  4UW9 A;  4NJ8 A;  4NWI A;  4EBC A;  5AI4 A;  4GLX A;  1S76 D;  2G06 A;  4XUS A;  5AIA A;  2PXI A;  3OSP A;  1BNP A;  4NL9 A;  9ICV A;  2VA8 A;  4P4P A;  7ICK A;  8ICO A;  2PFQ A;  5ALW A;  7ICN A;  1OW5 A;  1PVR A;  2HOQ A;  2LM4 A;  5H2F U;  2JR5 A;  4IRC A;  3M7D A;  4B9T A;  3H4B A;  3MDC A;  4ZOH C;  4BX9 C;  5J0U A;  4QJF B;  4C8N A;  4DOC A;  2RHF A;  8ICE A;  2FPK A;  1SZH A;  4P0Q A;  1X6J A;  3C1Z A;  3BQ7 A;  2J6S A;  3TFR A;  3TAC B;  1BPZ A;  1PUZ A;  3KZX A;  4ECS A;  4KN7 A;  4YR2 A;  4I2J A;  5IIJ A;  4F4Z A;  8ICT A;  5J2I A;  4QZD A;  4ECX A;  2OEH A;  5AI0 A;  4RNN A;  1JRP A;  4Q8E A;  2F44 A;  3C1Y A;  4B6J A;  4BXO A;  4RT2 A;  2FLN A;  3RR7 A;  5F9N A;  5KFF A;  3RRH A;  2ODG A;  2OCE A;  1D9D A;  3SAH A;  3NUQ A;  1U9L A;  4KLJ A;  4QNL A;  3AMZ A;  3EZ5 A;  2R8K A;  3WKB A;  4EZ9 A;  8ICW A;  3UPQ A;  1SKR A;  3OHB A;  4Y2V A;  3SI8 A;  4FO6 A;  1SXE A;  3QX7 A;  2MAX A;  4C4R A;  2L5Y A;  2BCQ A;  2ZIU B;  4F4Y A;  5KFT A;  1TVA A;  3B0X A;  2YX8 A;  2BPC A;  1J2N A;  8ICK A;  4USA A;  4IC9 A;  4IRK A;  4KLT A;  2YMP A;  3TQ1 A;  5KFS A;  1JXE A;  3QUT A;  5KT2 A;  2EAP A;  3BS7 A;  3V7L A;  4AYB C;  4M6W A;  3JPO A;  1QQ5 A;  2ZUB A;  1FO4 A;  3E2E A;  1Z00 B;  2MA1 A;  2IMW P;  4QWC A;  5KFW A;  2I9G A;  4UAW A;  2ISO A;  4IRD A;  4ZH4 A; 
#chains in the Genus database with same CATH homology
 1HIW A;  2VJ5 A;  5KL8 B;  1PVR A;  1XO0 A;  2K89 A;  3IN5 A;  2VJ4 A;  1Q3V A;  2HOQ A;  1CRX A;  4A8E A;  3D2S A;  2KHQ A;  3L3F X;  4KMO B;  5T14 A;  2KEY A;  3AL0 B;  2KNJ A;  2NV3 A;  3M7D A;  4P0P A;  2LHT A;  4OJ5 A;  5HR6 A;  2OYY A;  1Z19 A;  4BX9 C;  3M6Z A;  3T79 A;  4QJF B;  3SAG A;  2JGA A;  2E1F A;  2XIC A;  3CYM A;  2RHF A;  4PL2 A;  3MGV A;  4PL1 A;  4QIW C;  3IG8 A;  4U7C A;  3M6K A;  5KL1 B;  5CRX A;  2M0N A;  2KD1 A;  2HOF A;  1ED1 A;  1SZH A;  2CPR A;  3CRX A;  4P0Q A;  3H0R B;  4WJ3 B;  4BUG A;  2DQN B;  2VKQ A;  3RF9 A;  3PST A;  2LKY A;  2K8A A;  1GO3 F;  2JHD A;  2KV2 A;  2W04 A;  4FZN A;  2K8C B;  2K4E A;  2K4H A;  1XNS A;  2G0A A;  3D2Q A;  2XVT A;  1DRG A;  2HBM A;  3KZX A;  4P0P B;  3ALR A;  2G07 A;  2HOI A;  3H0M B;  2YB1 A;  2G5H B;  4FZL A;  4BJQ A;  3N7S C;  2H3I A;  2W03 A;  2BDU A;  2G08 A;  2G5I B;  1Z1B A;  2JH7 A;  2CN1 A;  2H3F A;  1OUQ A;  4CDG A;  2ZIV A;  3PZP A;  2KIW A;  3D2N A;  4CRX A;  2MRL A;  4FE3 A;  2ZXI A;  3GU3 A;  4P0Q B;  2Q4T A;  3ICX A;  4ACO A;  2ZIX A;  2K4I A;  2F8L A;  1P7D A;  1URJ A;  1ZQ1 C;  3VCB A;  3HKZ F;  4C0Z A;  3NUQ A;  3SAH A;  3LVV A;  4NV0 A;  3LYS A;  3HKZ C;  4KX3 A;  4QNL A;  2WB1 F;  1Q3U A;  1IIP A;  3LVW A;  2ZIU A;  3SMV A;  4OO1 J;  2H3Q A;  2OM6 A;  2W7P A;  3F2C A;  2ZIW A;  5A0L A;  2OH2 A;  3SAF A;  3SQI A;  3F5E A;  2GH1 A;  2F2A B;  3OPX A;  1KBU A;  2F77 X;  2E5S A;  2XI9 A;  2H3Z A;  2WAQ F;  1TAM A;  2F76 X;  2KJ9 A;  2WAQ C;  2ZIV B;  2RP5 A;  3GZF A;  4GFJ A;  4ICA A;  5C0Y A;  3CP8 A;  3F2D A;  2PMZ F;  3C28 A;  1WUD A;  1YT3 A;  2DGZ A;  2KOB A;  2LBO A;  2KIC A;  2H3V A;  2PMZ C;  3F5A A;  4FZM A;  2ZIX B;  3O0F A;  1HEK A;  3N7R C;  2HBJ A;  2VIX A;  2Y0S F;  3VC8 A;  3AQE A;  2A3V A;  2KJ8 A;  2KKV A;  3DEE A;  4OJL A;  2KKP A;  1T94 A;  2HBL A;  4NWI A;  1MA7 A;  3IG5 A;  4U6P A;  1A0P A;  2ZIU B;  4CGZ A;  2KJ5 A;  1PVP A;  4KX5 A;  2HBK A;  1ECW A;  4NLB A;  3AQF A;  2YX8 A;  2E1E A;  4OJO A;  2ZIW B;  3PSI A;  2JMG A;  2G09 A;  2RRD A;  2WB1 C;  3F53 A;  4IC9 A;  3C29 A;  2G06 A;  2JH1 A;  4O3M A;  4JMU A;  2ZG6 A;  2K8B B;  3RFA A;  1L6N A;  3F2B A;  2OXO A;  2ZXH A;  4OJP A;  1D8B A;  3PSP A;  1NZB A;  2LYB A;  2GOL A;  4AYB F;  1PVQ A;  5HR7 A;  4QIW F;  2W7O A;  4AYB C;  2DF4 B;  4NLC A;  2LYA A;  2YB4 A;  2XID A;  2MA1 A;  3K1Z A;  3PSF A;  2CRX A;  3KFU F;  2KHV A;  3N7P D;  2KVC A;  3NRW A;  1UPH A;  4OJ6 A;  3H0L B;  1F44 A;  3IP4 B;  2D6F C;  1A6S A;  2Y0S C;  2HMX A;  2R18 A;  3E0F A;  3ONN A;  2N1R A;  2Z7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...