2NV3A

Solution structure of l8a mutant of hiv-1 myristoylated matrix protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
GARASVASGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Point mutations in the HIV-1 matrix protein turn off the myristyl switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 34
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2nv3A01
1ED1A 2JMGA 1UPHA 1HIWA 2H3ZA 2LYBA 2K4HA 2GOLA 4ICAA 1A6SA 2HMXA 2LYAA 2K4IA 1L6NA 2H3VA 1HEKA 2NV3A 2K4EA 4JMUA 4IC9A 2H3FA 2H3IA 2H3QA 1ECWA 2N1RA 1TAMA
chains in the Genus database with same CATH superfamily
3GZFA 2VA8A 3K1ZA 3BQTA 4GFJA 4YQWA 3VCBA 1ZJNA 3BZCA 3TAPA 3PW7A 2KJ5A 7ICEA 4DCCA 5KFIA 2XY5A 3C2MA 4KLTA 1L8OA 4B6JA 4PGYA 4I2HA 1NK7A 5AK3A 2JMGA 3TI0A 1X40A 4OD0A 2FMSA 3PX0A 2KE7A 2K4HA 3FDSA 1V38A 3C23A 1D8BA 4I28A 4UB6U 4KLGA 4O3SA 4EZ9A 2HBJA 2A3VA 3M8SA 4O5CA 2Y9UA 5JRTA 2DWQA 3GQCA 3RAXA 3ISDA 4KLDA 3ZI4A 4NL9A 2ZIVB 2OCEA 3FC4A 4UB8U 3BJYA 4ED3A 1AROP 5AKZA 1FFUA 3ZD8A 3QUQA 8ICLA 1Z3EB 1X66A 5F9NA 5ALTA 2FI1A 3QYPA 9ICJA 5ALMA 4DSIA 4R64A 3N4MB 2RHFA 8ICPA 3ZDBA 2XCAA 4XA5A 2XY6A 2PFQA 4UB1A 3BS7A 4UAUA 3IG8A 4FZNA 4UB4A 3HP6A 3MGIA 3QEBZ 9ICNA 2MSNA 1HEKA 4C80A 2AQ0A 1QTMA 2UVUA 1ZQEA 4ED2A 5CB1A 7ICUA 4DL2A 3QU2A 4F5RA 4ECYA 2DUYA 5ALRA 1QSLA 3M9MB 2W9MA 4R63A 4ECXA 2IHNA 2XC9A 5KAIU 1F5SA 4WJ3B 4ECTA 3T5HA 7ICTA 4QZ9A 2ATLA 2HW3A 1TAMA 5J2JA 4MEYA 5EWEA 3EYZA 4GIBA 1T3QA 4P4PA 3OJUA 1YZ7A 4ELUA 4QWDA 2HMXA 3MC1A 2ZIVA 1WWUA 4UAZA 2HHUA 3RBEA 1L3UA 2E8PA 1JRPA 1X9MA 1U47A 4DFMA 3F2DA 5J0QA 1HUOA 4KLIA 2KSOB 1JI7A 3NVYA 4TUSA 1SWVA 2GOLA 4O9MA 1PVRA 1M6YA 3QXGA 2BHNA 1K5OA 3MR5A 2ZUDA 5KFLA 4UB3A 2LBOA 2HHVA 2WF5A 3TQ1A 1NK4A 2W9CB 3TKAA 2XY7A 4ELVA 3DV9A 2DBYA 4FFDA 4EYHB 4F5PA 2R8GA 1LVHA 5G5GA 3EZ5A 1X2IA 2V4QA 1T3NA 1LKYB 4ECSA 1BPDA 3N28A 4MFAA 1PVQA 2VKQA 4NV0A 1MC8A 5ALFA 5ALJA 5AI4A 2N1RA 5AKYA 4YMNA 5J0SA 1SV4A 4TUPA 3H0MB 2EANA 3QUBA 4Y2QA 2DFLA 1NKEA 2WF6A 3RBDA 2HBKA 3B0YA 3T5KA 1SV0C 2ZTCA 4RPYA 2G0AA 4DSKA 4R65A 1NK6A 2K4IA 5KFHA 4RQ7A 1U48A 4RQ4A 4B9SA 5J2AA 4UQGA 3CNHA 2W54A 4XUSA 5J0TA 3GV5B 3EUB2 4ED0A 4C0ZA 2B0CA 1ZQOA 3AQEA 2BPCA 2FPMA 1S76D 2ES6A 1WWVA 1LV5A 1YT3A 3SR6A 3KBBA 4UB5A 3PO4A 4I27A 3N7PD 2ZJ8A 2ISOA 3C1ZA 1ZOLA 4IQWA 2JEFA 5DBAA 7ICQA 2L5YA 2W7OA 4KLJA 4JUZA 1D9DA 2BDPA 2OXOA 4US9A 3I76A 2W9AA 3R9KA 1UQVA 5ALLA 2W9CA 3B0XA 5KG6A 5TISU 4BXOA 3V7JA 2BQ3A 4NLZA 4R8UA 5KFNA 5J2KA 2WF7A 2NRVA 5IIKA 5ALNA 1LKYA 3KHGA 4G9BA 4FE3A 1Z1VA 1KRPA 4LVSA 2Y9TA 2PI4A 3H8SA 4Y2SA 4B9UA 2OEHA 4CRXA 2F44A 3V7LA 2YB1A 4IRKA 3SEIA 3RR8A 3AL0B 5J8YC 1COOA 4F4YA 2JV3A 1S0OA 2J6TA 1XWLA 5KG4A 8ICXA 8ICVA 4JV1A 5KFEA 2AHOB 3THVA 2W8LA 4OCZA 4M9JA 2YN4A 3AEVA 2C2DA 2LM4A 3SAHA 1QCKA 4O3MA 5EWFA 3RH5A 2PFOA 1ZD5A 3LVVA 1SV0A 1ZQVA 3V6JA 2Q0ZX 2H3IA 2K8BB 4J9RA 4QZHA 4ECVA 4EEKA 3UPQA 5KFGA 2IA6A 3NTUA 3ISBA 1ZRNA 1DRGA 5DBBA 2D3DA 4RQ6A 2WAQC 3T5JA 9ICCA 1RZTA 2ASLA 4Q45A 2XGQA 5JUMA 5AM1A 3PW2A 5D46A 5KNIA 8ICKA 1NK8A 1UT5A 4QZEA 5T14A 2XO7A 3C21A 2VJ4A 3ALRA 5HHIA 1JALA 2HSZA 2H3ZA 1S97A 1S0NA 1NJXA 3IM1A 3WK6A 1NZPA 3M8RA 5CWRA 2WTFA 1SL2A 3T79A 1XSNA 1YZ6A 4J9PA 1O08A 5KFKA 5HR7A 3PX4A 3HX0A 4PHPA 5D4BA 9ICUA 2R8HA 4F5QA 1ZQXA 2RQ5A 1XSPA 9ICRA 3MDCA 4F92B 4J9SA 3KKAC 2LMRA 1S9FA 5AKKA 4GXJA 2QB1A 1TVAA 3MR2A 2E1EA 4LZDA 5AI9A 4MF8A 1U45A 1N5XA 5J8YA 5J2HA 9ICWA 4NJ8A 1BPXA 3LVWA 2BQUA 3BQ1A 5J0YA 1IXRA 4EELA 2BCQA 2WAQF 5ALEA 5H2FU 5ALYA 3HJEA 3V7KA 3GU3A 2FJ6A 4Y2VA 4ED1A 3QEAZ 4F4ZA 1S8OA 1ZQYA 3G6YA 4PJ0U 1S0VA 3Q8LA 1KEJA 3FYHA 4Z6CA 1FIQA 1PK1B 3GIMA 4EENA 4AYBC 4IR1A 2JEGA 3QZ7A 1N63A 1TE2A 1N62A 2EH9A 1RM6C 4JWNA 1L6NA 2VJ5A 3RH6A 4JMUA 4EX6A 1H38A 5FP0A 5KFRA 3DDHA 3KFUF 2KIWA 2ZTEA 2DPIA 2C28A 4DOAA 2C2RA 1Q3VA 1XO1A 4JK1A 5AHXA 2WF8A 2ODGA 4C4RA 3BQ0A 5KT5A 5TZVA 1ZJMA 2BPGA 3PNCA 2F76X 3H8WA 1TV9A 2HCFA 2F8KA 4P2HA 4X5VA 4C8MA 1JIHA 2O6KA 3PX6A 2ISPA 3OGUA 1MSWD 3MFHA 3QZ8A 4ECUA 1N48A 1B0XA 1L3TA 2HHQA 4DSJA 3UXPA 3KKAA 3N97B 4YG2A 4RPZA 1COKA 4USAA 2H3FA 5DQHA 3BDPA 4NLNA 4AYBF 2G5IB 4F91B 1UPHA 3PSIA 1D8YA 5KFPA 2AU0A 3CP8A 2HHXA 2VA3A 1V85A 3PW0A 5DB7A 4EYIB 4PGQA 3QUTA 3HT3A 3RB0A 1PK1A 4P0PB 5BPCA 4QZCA 2ZTDA 2OM6A 5L1JA 3KOOA 5J2GA 2W9BB 4NM2A 4DS5A 5DG7A 2KVSA 1C20A 1N60A 7ICNA 4K4HA 3UQ0A 4ICAA 5KG1A 1DOQA 1TK5A 2HHWA 3AU2A 4EX7A 2PFNA 1BNOA 3O0FA 2ZJAA 3ICXA 1JUDA 4Y2XA 4G3IA 2IHMA 4AP9A 3Q8SB 3E2EA 2HHTA 4MFCA 2BDUA 2KKVA 1Z00B 1QQ6A 1NNLA 5EE9A 3E58A 2QARA 3MDAA 3S6JA 4FS1A 2BCRA 4J9QA 2PKEA 2G08A 5J2BA 1XU4A 4DL7A 1SXEA 2KK0A 4O0IA 3PY8A 4CGZA 5KFTA 4I2CA 4I29A 7ICSA 4PL2A 1IV8A 2DL0A 3SD7A 3L4PA 4KN4A 4F72A 2OH2A 2KFZA 2XVTA 3JPQA 2UVRA 3NGDA 5ALXA 1ZQNA 4KMOB 2JH7A 2GLEA 4RPXA 1SL0A 4YR3A 3SZ2A 9ICAA 4ACOA 2W7PA 2G09A 3V6HA 3A0HU 4U6PA 2ALZA 4KLLA 5B66U 3K1RB 4C4TA 3H4BA 2GO7A 4RQ2A 3G6XA 3K4GA 5J0WA 4P0PA 4KLOA 2FMPA 5KAFU 8ICYA 4YR0A 3WKDA 3JPNA 2BR0A 1NZBA 2ZUCA 4EZ6A 4HAIA 1TK8A 2E8MA 1JXLA 3HILA 5EE0A 5ALSA 4F2SA 4Z6FA 3PSPA 5DB8A 1Y88A 2W3SA 5AIBA 2OWOA 5KG3A 2KJ8A 8ICRA 1ZQZA 2FE9A 4F5OA 5J0OA 3CW2C 1QSYA 1SXDA 2JZBB 5L9XA 3UMBA 2NO5A 4BWJA 3TANA 1PZNA 1PVPA 1LB2B 1FO4A 5JTIA 2KZMA 5ALQA 4ECZA 2QLTA 3RH4A 4QIWC 1GO3F 4IQTA 2LYAA 3ZDEA 4J03A 5KFCA 3AU6A 4OO1J 4RUAA 2MU2A 2AGOA 1KFDA 3SQIA 4CF5A 2DGZA 8ICGA 3IP4B 2D8CA 3HW8A 3MABA 2BQRA 3GV8B 2KOBA 3RJFA 2PMZC 2JGAA 4Y2JA 5ALDA 2E5SA 1BGXT 1RYUA 4QZFA 2F1JA 7ICIA 1KFTA 5KG2A 2W03A 1CEZA 5KFYA 4DL6A 1L7MA 5EOZA 3GIJA 3JPTA 5CR0A 2XIDA 1B43A 1Z19A 4BJQA 2P35A 8ICWA 4NLCA 4M04A 2ZIWB 5DLFA 2ZG6A 4YVZA 2WHEA 3TARA 9ICQA 1RG6A 5DDYA 4PZOA 5DKWA 4F8RA 1VJ5A 3MGVA 3EW9A 1ZQQA 4QZAA 2Y1IA 3JPRA 2KHVA 2AXTU 5AM4A 9ICGA 1X9WA 1SGGA 3OHAA 4QIWF 4GC6A 1S10A 3T5LA 4UBCA 4J9NA 5KL8B 2JH1A 2PFPA 2KHQA 4J9KA 4M9NA 2IOHA 3PW4A 2IBKA 4A8EA 2YMQA 2M9NA 2F3NA 4KLHA 4RQ3A 2P6UA 5KFDA 2RP5A 1CRXA 3QUCA 2V4RA 5IINA 5F9LA 4IRCA 3AM9A 5AK5A 1QQ5A 2ZXIA 2BCUA 4RQ1A 4B9TA 4P4MA 2W43A 4DFPA 1ZQCA 3HRDD 1WCNA 3NVWA 1PK3A 2KSOA 3DEEA 5IIOA 4KN7A 1SIJA 1L3SA 3LWMA 1JMSA 5HMMA 5ALWA 5KFVA 5DLGA 5F3XB 5AKEA 1ZQFA 4PHDA 4KLQA 2PXIA 3Q8PB 4F2RA 2VIXA 1TFRA 7ICGA 3ZD9A 5EE1A 4RU9A 3GILA 1T7PA 5HNKA 1A0PA 2ZIWA 1AQ6A 1XSLA 3V6KA 5JU5A 2KVCA 4M9LA 5B5EU 2MRLA 2MUTB 3C1YA 2I6XA 1Z1BA 1ZD2P 4JV2A 3NUQA 3HWTA 1XO0A 3E0FA 5EWGA 1U9LA 5AM3A 9ICIA 2VANA 2XGPA 3I1YA 5C0YA 4UARA 4I2BA 4KLSA 2PI5A 3ONNA 2G5HB 1S77D 2YMLA 1BPYA 4NLKA 4IQVA 4RUCA 1RPLA 1K1QA 3GV7B 3AUOA 4XQ8A 4YD1A 4YMMA 4FZLA 3MGHA 3HKZC 2LHTA 5CJ7A 5CP2A 2KG5A 1L7PA 4M0AA 2EZXA 3WK4A 3H7IA 2EAPA 5AI5A 4YP3A 4C7ZA 4BGDA 4QZDA 4P4OA 1Z4OA 5CRXA 1X9XA 4RQ0A 5DGAA 2ASDA 8ICZA 5J2EA 4ED8A 2DKZA 2NRTA 2BPFA 4DSLA 2LYBA 3PVXA 4C8LA 4FZMA 5DGBA 4C8NA 8ICTA 5DDMA 1ECWA 4PHAA 3ISCA 5AKGA 4MEXA 2XI9A 1ZQHA 5AI6A 2YQEA 4C7YA 1EXNA 4YXMA 1JXEA 4ECQA 1RDFA 5ALUA 4UBBA 3L3FX 4QWAA 3JPOA 1ZQJA 4O5KA 3ZDDA 4JB3A 1FEZA 1L8LA 4DSFA 3F53A 4QZ8A 1SKWA 3WKEA 3F5EA 7ICOA 1RXVA 7ICPA 1BVSA 3HKZF 2Y0SC 5KFMA 1SB3C 4BWMA 1F0MA 1XC9A 2HVIA 1ZQAA 2UVWA 5ALZA 1ZRMA 5AKLA 2KIVA 1ZQDA 4F4XA 4YMOA 5AK4A 5KFOA 1VLBA 3C2KA 1CUKA 2HDOA 3PMLA 9ICTA 4KMUA 5IIIA 3IHQB 2G06A 3AN1A 3PW5A 3FAHA 3BQ7A 1WCLA 2AGPA 5J0PA 2BCVA 1QQ7A 2E3TA 4Y2UA 5KG5A 5DG9A 4QNLA 2ASJA 3D2QA 5KT4A 5ALOA 2XICA 5AI0A 2IOFA 2E8OA 5CA7A 3RJJA 4M6WB 5J2DA 4F50A 2KV2A 4TURA 3IG5A 1J2MA 4DL3A 4I2DA 5A0LA 4DL4A 4DSEA 3NASA 4PHEA 2RRDA 1NK0A 3BZKA 3IDWA 5AM5A 2R8KA 5L1MA 2ZIUB 5KFZA 5CEHA 4DOBA 3KZXA 4OJ6A 2JR5A 3PMNA 1RYSA 4KLFA 3C28A 3EWAA 4MHVA 4F3OA 3U26A 3K75D 3QE9Y 4UAWA 3TAQA 2ZXHA 3OTQA 2KICA 5DQIA 2I5HA 4GXKA 1MN8A 5AICA 1MQ2A 4QWBA 3EPIA 4B9MA 1K1SA 5J2FA 3F2CA 5DB9A 1SWWA 4ZH4A 2LKYA 1ZD4A 3NVVA 3ETRA 4M9HA 7ICLA 3PSFA 9ICPA 4FO6A 1BPEA 1WUDA 1ZQ1C 3RJHA 1ZQKA 3L5KA 2HHSA 2LPEA 3BS5B 1HIWA 3F5AA 4O5EA 4PPXA 3PR5B 3C2LA 3B9JA 5C5JA 9ICFA 2M0NA 1NK5A 1NJZA 2A19A 4F4WA 4QZGA 3KZIU 2ZUBA 3EPGA 4K4GA 3C5FA 4OJPA 4PGXA 3ED5A 4F93B 2EQYA 1Q46A 1SKRA 1B4FA 1IM4A 2NRWA 1UA1A 8ICQA 2WF9A 3UXNA 1DXSA 4NXZA 3D2NA 1ZETA 5KFSA 4UAVA 2ZIUA 3M1YA 3SAGA 3QNMA 2LI6A 4DO9A 4IR9A 3NRZA 3PSTA 4J9MA 3F2BA 4PL1A 3H4DA 4DOCA 4Z6EA 1ZQTA 5L1KA 4NWIA 8ICMA 2P6RA 4PZNA 5AM0A 3M7DA 4CCHA 4MFFA 4F4KA 1J97A 2DF4B 2DQNB 7ICHA 2KN7A 4UB2A 1UHUA 1XS9D 1RQNA 1X9SA 9ICKA 4DEZA 3OHBA 3UMGA 3OSPA 1DK2A 5ALVA 2K4EA 7ICMA 5BOLA 2ZJ5A 2JEIA 4RQNA 4Q8EA 4DQPA 4B9NA 2F77X 4C8OA 4UATA 1S5LU 4DWIA 3OJSA 3C5GA 3H8JA 1ZYQA 1CI4A 1N61A 5KFXA 3BS5A 1ZD3A 4OJ5A 3WKBA 4IS7A 3D2SA 4CF4A 1JN3A 1DK3A 2B6GA 4M47A 3PZPA 3WK5A 3RFAA 2P66A 3RRHA 5BOMA 3MR3A 3IRUA 4Q8FA 3AQFA 1OUQA 5J2CA 1X42A 1T8EA 4DLEA 2JHDA 1TAQA 2W9BA 8ICBA 3RTVA 3LWLA 4KX3A 5KTQA 3J81j 8ICNA 1D9FA 4Z6DA 3CRXA 1NI3A 4TQSA 1KLNA 1Q8KA 5ALIA 3OSNA 3TFRA 1FFVA 5ALPA 2NYVA 1XNSA 4Y2TA 9ICLA 2HBMA 4RT3A 4BUGA 3QU4A 1DGJA 8ICIA 2BGWA 5E79U 8ICSA 1BPZA 5AKHA 1Z00A 2W55A 2FLPA 3Q8MA 2KKPA 2NRZA 3RB4A 3TFSA 2A1JB 1QSSA 1RXWA 5DG8A 2R8JA 3SAFA 2Z7JA 3M6KA 3Q8KA 4O3QA 5KFWA 1ZQBA 4DFDA 1X6JA 3SV3A 3IN5A 2LM1A 8ICCA 1A6SA 4FS2A 3QU7A 2DKXA 2F1IA 5GTIU 1Q3UA 2OYYA 1TAUA 5J0XA 2QB0B 4CDGA 2JXJA 1MA7A 3JPSA 4KLEA 1ZQWA 4Y2RA 1NJWA 3UM9A 4Y2YA 4DF4A 2CN1A 3WU2U 2YTUA 2K4PA 3RJIA 4RQMA 4IRDA 4OJOA 2W3RA 1URJA 2AQ4A 1WYGA 3PR4A 5KFBA 3LDAA 3QU5A 3ZDAA 7ICKA 4KTQA 2BCSA 2KNJA 4CE6A 8ICHA 4YN4A 4EEYA 3NS1A 1N2XA 3SV4A 1IIPA 4J9LA 2W11A 1KSPA 4NM1A 4Q44A 2CPRA 1KDHA 3SI8A 1C7YA 1U49A 3RJKA 1ZQMA 2I9GA 3HPOA 3SYZA 3WK9A 4U7CA 2E8NA 3A0BU 3H0RB 5AK6A 2JRZA 2JZBA 2HOIA 4BXOB 3RJGA 2GWSA 2YX8A 1KQQA 4EBDA 1UCVA 1JROA 2A1JA 4R8UB 1N56A 8ICOA 4GC7A 4BX9C 1BPBA 4YCXA 4TQRA 5J0UA 4M9GA 1D8LA 2QKQA 4NLBA 3H8MA 1ZQPA 4J9OA 1BNPA 4ED7A 5AIAA 2HOFA 3PV8A 1A76A 1JX4A 3RJEA 2PMZF 2K60A 5J0RA 1KTQA 3LK9A 4DQSA 7ICJA 2KJ9A 2QB0A 5K4LA 3LYSA 1MQ3A 2BKEA 1X6IA 2A1AA 4I2IA 2Q4TA 4DFKA 1ED1A 1WG8A 2F1HA 1VDVA 3UQ2A 4KLMA 1SZHA 3QU9A 5HMLA 7ICRA 2KZ3A 1NK9A 2AJQA 5DBCA 4IC9A 3NRWA 3KHRA 5L1IA 4B9VA 4DL5A 1Z4NA 2YY6A 1V97A 5G5HA 3T3FA 5ALGA 2Y1JA 5CHGA 4YD2A 1L5UA 1L7NA 3WKAA 1KN5A 2KEYA 4B9LA 2DPJA 3GFKB 9ICXA 5KT2A 2NV3A 1T4GA 3RB3A 3UMCA 1U4BA 4DQRA 2AH5A 3JPPA 4P0QB 5AI8A 3RF9A 4ED6A 2K8AA 1PUZA 4F5NA 1UT8A 5KFFA 5J2IA 2W04A 2WB1C 2K8CB 9ICBA 2MA1A 5IIMA 4I2AA 4CF3A 2AGQA 8ICUA 2MAXA 4YFKA 1P7DA 5AM2A 4Y2PA 3ETLA 4KX5A 2K89A 2B21A 3C29A 2KD1A 4ECRA 3WK8A 3KHHA 1UA0A 3IV6A 4E0DA 1ZQGA 4IL6U 4JV0A 5KFUA 5KT3A 3N7SC 3WKCA 4R66A 9ICHA 4RQ5A 4QZBA 2EZZA 5AKXA 2FMQA 2ZIXB 4F71A 4RNOA 2BZFA 5KG7A 4C8KA 4IQUA 1B22A 2KP7A 2H3QA 2G07A 3M9OB 2C22A 7ICFA 8ICAA 1N5WA 4DQIA 5IILA 4I2JA 2HBLA 4UAYA 1L3VA 2VA2A 4GLXA 2C2EA 2KTQA 4O3RA 2CXYA 1KL9A 1QLNA 3MBYA 4MF2A 2KMDA 4ZOHC 3RAQA 2IMWP 2MUTA 5J29A 2F8LA 4QW8A 4NLGA 1DGSA 2WB1F 2KFNA 4TUQA 5ALKA 3RR7A 3VC8A 5KG0A 4I2FA 4CNQA 1ZQUA 4QW9A 4QWCA 4ECWA 3RRGA 3KHLA 2HOQA 3TADC 1F44A 5HP4A 3GIKA 4P0QA 3H0LB 5KFQA 5DB6A 2E1FA 5HR6A 4QWEA 2IOFK 4I2GA 3G6VA 2F2AB 3V72A 3PO5A 4Q43A 2NRXA 1ZXIA 1KW4A 4KLUA 3H40A 4RNMA 1A77A 2H5XA 4XRHA 2R8IA 1J2NA 3KD3A 3N7RC 3UXOA 5AKJA 3SMVA 4C4SA 3MR6A 1KBUA 3Q8QB 1O03A 3QX7A 5KFAA 4PH5A 1V9PA 2EAMA 1TKDA 1OXJA 9ICMA 2XCPA 5KT6A 1S0MA 2YB4A 2ZIXA 2FPLA 3ZDCA 5L1LA 4YR2A 5D49A 2GH1A 3ORYA 2EDUA 4LJXA 1QH9A 4DF8A 4KITB 2LYHA 1RYRA 4O3PA 4K4IA 2EZYA 2FLLA 2H3VA 3KTQA 4FBTA 2JEJA 9ICEA 3GIIA 2J6UA 1ZQSA 2Y0SF 4LZGA 3MFIA 5ALHA 3M6ZA 1T94A 2CRXA 1IG6A 3SENA 2OHFA 2RLTA 3Q8RB 1NOMA 3AMZA 2HVHA 4GXIA 1NKBA 4DFJA 5KT7A 2R18A 3BQ2A 4EBEA 2KZZA 1L7OA 2UVVA 2ESEA 3GDXA 1TK0A 2YMMA 5DQGA 4QZIA 2D6FC 2HI0A 3OPXA 4O3NA 9ICSA 5KL1B 4EBCA 1KFSA 5AKIA 4O3OA 3CYMA 1OW5A 4QJFB 4RQ8A 4ELTA 1SKSA 1NKCA 2WFAA 2EAOA 2QARB 4BDPA 1ZQIA 3TADA 1ZQLA 8ICJA 1ZQRA 9ICVA 4NL9C 2FLNA 2FPKA 4DQQA 2W8KA 2V9WA 1SZPA 1SL1A 3FM9A 4DLGA 4RNNA 1HUZA 3M9NB 4UW9A 1KKXA 2RDIA 2YMPA 2J6SA 8ICEA 4NY8A 4JWMA 4M6WA 2NO4A 1NJYA 3TACB 5EE3A 4RZRA 4FBUA 3RB6A 5HHHA 4M2YA 3NVZA 3WK7A 1RQLA 7ICVA 9ICOA 8ICFA 4OJLA 5GTHU 5IIJA 2I1QA 4RT2A 4I2EA 2RDJA 3I28A 4UASA 3D6JA 4HYKA 4YXJA 4DS4A 2FDRA 4US8A 1HJPA 5KFJA
chains in the Genus database with same CATH topology
2G5IB 3LVWA 1ED1A 4CDGA 2F77X 2KVCA 3GZFA 1UPHA 3HKZF 3K1ZA 3H0MB 3PSIA 1MA7A 4GFJA 2WAQF 2Y0SC 2MRLA 3CP8A 4P0PA 2HBLA 3M6ZA 1T94A 3VCBA 2CRXA 2XIDA 3F2CA 2HBKA 3SAHA 1Z19A 1Z1BA 2LKYA 4BJQA 4NLCA 3NUQA 2G0AA 1SZHA 2ZIWB 2CN1A 2KJ5A 3E0FA 1XO0A 1NZBA 2ZG6A 3GU3A 4O3MA 3PSFA 2K4IA 4WJ3B 2R18A 3LVVA 4OJ5A 4P0PB 4OJOA 3D2SA 1WUDA 1URJA 5C0YA 2F8LA 3MGVA 4IC9A 2H3IA 3NRWA 2K8BB 2OM6A 3PZPA 1ZQ1C 3RFAA 1TAMA 3ONNA 2KHVA 2G5HB 2D6FC 2WB1F 2JMGA 3PSPA 3OPXA 3VC8A 5KL1B 4QIWF 2KNJA 1HIWA 3F5AA 4C0ZA 3CYMA 1DRGA 3AQEA 2KJ8A 2G06A 5KL8B 2JH1A 2HOQA 4AYBC 3AQFA 2K4HA 4QJFB 1OUQA 1F44A 4FZLA 2M0NA 1YT3A 3HKZC 4P0QA 2KHQA 3H0LB 2JHDA 4ICAA 2WAQC 2LHTA 1IIPA 2HMXA 2KEYA 3O0FA 2E1FA 3N7PD 5HR6A 1L6NA 2ZIVA 2VJ5A 4KX3A 4QNLA 1D8BA 3ICXA 4A8EA 3D2QA 2CPRA 2NV3A 4OJPA 4JMUA 2HBJA 2F2AB 2A3VA 3CRXA 2RP5A 2XICA 5T14A 1CRXA 3KFUF 2KIWA 3F2DA 1PVPA 4P0QB 2BDUA 3RF9A 2VJ4A 2KKVA 2W7OA 5CRXA 3ALRA 4U7CA 2OXOA 3H0RB 2HOIA 2ZIVB 1XNSA 2G08A 2ZXIA 2K8AA 3D2NA 3N7RC 2YX8A 2HBMA 3SMVA 2H3ZA 2LYBA 4BUGA 1KBUA 2KV2A 2W04A 1Q3VA 2WB1C 2ZIUA 2GOLA 3IG5A 4BX9C 2K8CB 4QIWC 2MA1A 3SAGA 1PVRA 1GO3F 5A0LA 2LYAA 3PSTA 4FZMA 4CGZA 2RRDA 3DEEA 3F2BA 4PL1A 1P7DA 4OO1J 4KX5A 2KKPA 2K89A 4NLBA 2LBOA 3T79A 2YB4A 3C29A 2KD1A 2F76X 4PL2A 1ECWA 4NWIA 2ZIUB 2ZIXA 5HR7A 2RHFA 3SQIA 3M7DA 3KZXA 4FE3A 3SAFA 2HOFA 2Z7JA 3M6KA 2OH2A 2XI9A 2XVTA 4OJ6A 2DGZA 3IP4B 2GH1A 2PMZF 2Q4TA 4CRXA 2DF4B 4KMOB 2JH7A 3N7SC 4OJLA 3C28A 2DQNB 2YB1A 2KOBA 3IG8A 4FZNA 3AL0B 3IN5A 2KJ9A 2ZIXB 2PMZC 2JGAA 1A6SA 3LYSA 2VIXA 3L3FX 4ACOA 2ZXHA 2W7PA 2G09A 2H3VA 1HEKA 2E5SA 2E1EA 1PVQA 2K4EA 2KICA 2VKQA 4NV0A 4U6PA 1A0PA 2H3FA 2H3QA 2W03A 2Y0SF 3F53A 1Q3UA 2OYYA 2N1RA 3F5EA 2G07A 2ZIWA 4AYBF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ED1 A;  2JMG A;  1UPH A;  1HIW A;  2H3Z A;  2LYB A;  2K4H A;  2GOL A;  4ICA A;  1A6S A;  2HMX A;  2LYA A;  2K4I A;  1L6N A;  2H3V A;  1HEK A;  2NV3 A;  2K4E A;  4JMU A;  4IC9 A;  2H3F A;  2H3I A;  2H3Q A;  1ECW A;  2N1R A;  1TAM A; 
#chains in the Genus database with same CATH topology
 3GZF A;  2VA8 A;  3K1Z A;  3BQT A;  4GFJ A;  4YQW A;  3VCB A;  1ZJN A;  3BZC A;  3TAP A;  3PW7 A;  2KJ5 A;  7ICE A;  4DCC A;  5KFI A;  2XY5 A;  3C2M A;  4KLT A;  1L8O A;  4B6J A;  4PGY A;  4I2H A;  1NK7 A;  5AK3 A;  2JMG A;  3TI0 A;  1X40 A;  4OD0 A;  2FMS A;  3PX0 A;  2KE7 A;  2K4H A;  3FDS A;  1V38 A;  3C23 A;  1D8B A;  4I28 A;  4UB6 U;  4KLG A;  4O3S A;  4EZ9 A;  2HBJ A;  2A3V A;  3M8S A;  4O5C A;  2Y9U A;  5JRT A;  2DWQ A;  3GQC A;  3RAX A;  3ISD A;  4KLD A;  3ZI4 A;  4NL9 A;  2ZIV B;  2OCE A;  3FC4 A;  4UB8 U;  3BJY A;  4ED3 A;  1ARO P;  5AKZ A;  1FFU A;  3ZD8 A;  3QUQ A;  8ICL A;  1Z3E B;  1X66 A;  5F9N A;  5ALT A;  2FI1 A;  3QYP A;  9ICJ A;  5ALM A;  4DSI A;  4R64 A;  3N4M B;  2RHF A;  8ICP A;  3ZDB A;  2XCA A;  4XA5 A;  2XY6 A;  2PFQ A;  4UB1 A;  3BS7 A;  4UAU A;  3IG8 A;  4FZN A;  4UB4 A;  3HP6 A;  3MGI A;  3QEB Z;  9ICN A;  2MSN A;  1HEK A;  4C80 A;  2AQ0 A;  1QTM A;  2UVU A;  1ZQE A;  4ED2 A;  5CB1 A;  7ICU A;  4DL2 A;  3QU2 A;  4F5R A;  4ECY A;  2DUY A;  5ALR A;  1QSL A;  3M9M B;  2W9M A;  4R63 A;  4ECX A;  2IHN A;  2XC9 A;  5KAI U;  1F5S A;  4WJ3 B;  4ECT A;  3T5H A;  7ICT A;  4QZ9 A;  2ATL A;  2HW3 A;  1TAM A;  5J2J A;  4MEY A;  5EWE A;  3EYZ A;  4GIB A;  1T3Q A;  4P4P A;  3OJU A;  1YZ7 A;  4ELU A;  4QWD A;  2HMX A;  3MC1 A;  2ZIV A;  1WWU A;  4UAZ A;  2HHU A;  3RBE A;  1L3U A;  2E8P A;  1JRP A;  1X9M A;  1U47 A;  4DFM A;  3F2D A;  5J0Q A;  1HUO A;  4KLI A;  2KSO B;  1JI7 A;  3NVY A;  4TUS A;  1SWV A;  2GOL A;  4O9M A;  1PVR A;  1M6Y A;  3QXG A;  2BHN A;  1K5O A;  3MR5 A;  2ZUD A;  5KFL A;  4UB3 A;  2LBO A;  2HHV A;  2WF5 A;  3TQ1 A;  1NK4 A;  2W9C B;  3TKA A;  2XY7 A;  4ELV A;  3DV9 A;  2DBY A;  4FFD A;  4EYH B;  4F5P A;  2R8G A;  1LVH A;  5G5G A;  3EZ5 A;  1X2I A;  2V4Q A;  1T3N A;  1LKY B;  4ECS A;  1BPD A;  3N28 A;  4MFA A;  1PVQ A;  2VKQ A;  4NV0 A;  1MC8 A;  5ALF A;  5ALJ A;  5AI4 A;  2N1R A;  5AKY A;  4YMN A;  5J0S A;  1SV4 A;  4TUP A;  3H0M B;  2EAN A;  3QUB A;  4Y2Q A;  2DFL A;  1NKE A;  2WF6 A;  3RBD A;  2HBK A;  3B0Y A;  3T5K A;  1SV0 C;  2ZTC A;  4RPY A;  2G0A A;  4DSK A;  4R65 A;  1NK6 A;  2K4I A;  5KFH A;  4RQ7 A;  1U48 A;  4RQ4 A;  4B9S A;  5J2A A;  4UQG A;  3CNH A;  2W54 A;  4XUS A;  5J0T A;  3GV5 B;  3EUB 2;  4ED0 A;  4C0Z A;  2B0C A;  1ZQO A;  3AQE A;  2BPC A;  2FPM A;  1S76 D;  2ES6 A;  1WWV A;  1LV5 A;  1YT3 A;  3SR6 A;  3KBB A;  4UB5 A;  3PO4 A;  4I27 A;  3N7P D;  2ZJ8 A;  2ISO A;  3C1Z A;  1ZOL A;  4IQW A;  2JEF A;  5DBA A;  7ICQ A;  2L5Y A;  2W7O A;  4KLJ A;  4JUZ A;  1D9D A;  2BDP A;  2OXO A;  4US9 A;  3I76 A;  2W9A A;  3R9K A;  1UQV A;  5ALL A;  2W9C A;  3B0X A;  5KG6 A;  5TIS U;  4BXO A;  3V7J A;  2BQ3 A;  4NLZ A;  4R8U A;  5KFN A;  5J2K A;  2WF7 A;  2NRV A;  5IIK A;  5ALN A;  1LKY A;  3KHG A;  4G9B A;  4FE3 A;  1Z1V A;  1KRP A;  4LVS A;  2Y9T A;  2PI4 A;  3H8S A;  4Y2S A;  4B9U A;  2OEH A;  4CRX A;  2F44 A;  3V7L A;  2YB1 A;  4IRK A;  3SEI A;  3RR8 A;  3AL0 B;  5J8Y C;  1COO A;  4F4Y A;  2JV3 A;  1S0O A;  2J6T A;  1XWL A;  5KG4 A;  8ICX A;  8ICV A;  4JV1 A;  5KFE A;  2AHO B;  3THV A;  2W8L A;  4OCZ A;  4M9J A;  2YN4 A;  3AEV A;  2C2D A;  2LM4 A;  3SAH A;  1QCK A;  4O3M A;  5EWF A;  3RH5 A;  2PFO A;  1ZD5 A;  3LVV A;  1SV0 A;  1ZQV A;  3V6J A;  2Q0Z X;  2H3I A;  2K8B B;  4J9R A;  4QZH A;  4ECV A;  4EEK A;  3UPQ A;  5KFG A;  2IA6 A;  3NTU A;  3ISB A;  1ZRN A;  1DRG A;  5DBB A;  2D3D A;  4RQ6 A;  2WAQ C;  3T5J A;  9ICC A;  1RZT A;  2ASL A;  4Q45 A;  2XGQ A;  5JUM A;  5AM1 A;  3PW2 A;  5D46 A;  5KNI A;  8ICK A;  1NK8 A;  1UT5 A;  4QZE A;  5T14 A;  2XO7 A;  3C21 A;  2VJ4 A;  3ALR A;  5HHI A;  1JAL A;  2HSZ A;  2H3Z A;  1S97 A;  1S0N A;  1NJX A;  3IM1 A;  3WK6 A;  1NZP A;  3M8R A;  5CWR A;  2WTF A;  1SL2 A;  3T79 A;  1XSN A;  1YZ6 A;  4J9P A;  1O08 A;  5KFK A;  5HR7 A;  3PX4 A;  3HX0 A;  4PHP A;  5D4B A;  9ICU A;  2R8H A;  4F5Q A;  1ZQX A;  2RQ5 A;  1XSP A;  9ICR A;  3MDC A;  4F92 B;  4J9S A;  3KKA C;  2LMR A;  1S9F A;  5AKK A;  4GXJ A;  2QB1 A;  1TVA A;  3MR2 A;  2E1E A;  4LZD A;  5AI9 A;  4MF8 A;  1U45 A;  1N5X A;  5J8Y A;  5J2H A;  9ICW A;  4NJ8 A;  1BPX A;  3LVW A;  2BQU A;  3BQ1 A;  5J0Y A;  1IXR A;  4EEL A;  2BCQ A;  2WAQ F;  5ALE A;  5H2F U;  5ALY A;  3HJE A;  3V7K A;  3GU3 A;  2FJ6 A;  4Y2V A;  4ED1 A;  3QEA Z;  4F4Z A;  1S8O A;  1ZQY A;  3G6Y A;  4PJ0 U;  1S0V A;  3Q8L A;  1KEJ A;  3FYH A;  4Z6C A;  1FIQ A;  1PK1 B;  3GIM A;  4EEN A;  4AYB C;  4IR1 A;  2JEG A;  3QZ7 A;  1N63 A;  1TE2 A;  1N62 A;  2EH9 A;  1RM6 C;  4JWN A;  1L6N A;  2VJ5 A;  3RH6 A;  4JMU A;  4EX6 A;  1H38 A;  5FP0 A;  5KFR A;  3DDH A;  3KFU F;  2KIW A;  2ZTE A;  2DPI A;  2C28 A;  4DOA A;  2C2R A;  1Q3V A;  1XO1 A;  4JK1 A;  5AHX A;  2WF8 A;  2ODG A;  4C4R A;  3BQ0 A;  5KT5 A;  5TZV A;  1ZJM A;  2BPG A;  3PNC A;  2F76 X;  3H8W A;  1TV9 A;  2HCF A;  2F8K A;  4P2H A;  4X5V A;  4C8M A;  1JIH A;  2O6K A;  3PX6 A;  2ISP A;  3OGU A;  1MSW D;  3MFH A;  3QZ8 A;  4ECU A;  1N48 A;  1B0X A;  1L3T A;  2HHQ A;  4DSJ A;  3UXP A;  3KKA A;  3N97 B;  4YG2 A;  4RPZ A;  1COK A;  4USA A;  2H3F A;  5DQH A;  3BDP A;  4NLN A;  4AYB F;  2G5I B;  4F91 B;  1UPH A;  3PSI A;  1D8Y A;  5KFP A;  2AU0 A;  3CP8 A;  2HHX A;  2VA3 A;  1V85 A;  3PW0 A;  5DB7 A;  4EYI B;  4PGQ A;  3QUT A;  3HT3 A;  3RB0 A;  1PK1 A;  4P0P B;  5BPC A;  4QZC A;  2ZTD A;  2OM6 A;  5L1J A;  3KOO A;  5J2G A;  2W9B B;  4NM2 A;  4DS5 A;  5DG7 A;  2KVS A;  1C20 A;  1N60 A;  7ICN A;  4K4H A;  3UQ0 A;  4ICA A;  5KG1 A;  1DOQ A;  1TK5 A;  2HHW A;  3AU2 A;  4EX7 A;  2PFN A;  1BNO A;  3O0F A;  2ZJA A;  3ICX A;  1JUD A;  4Y2X A;  4G3I A;  2IHM A;  4AP9 A;  3Q8S B;  3E2E A;  2HHT A;  4MFC A;  2BDU A;  2KKV A;  1Z00 B;  1QQ6 A;  1NNL A;  5EE9 A;  3E58 A;  2QAR A;  3MDA A;  3S6J A;  4FS1 A;  2BCR A;  4J9Q A;  2PKE A;  2G08 A;  5J2B A;  1XU4 A;  4DL7 A;  1SXE A;  2KK0 A;  4O0I A;  3PY8 A;  4CGZ A;  5KFT A;  4I2C A;  4I29 A;  7ICS A;  4PL2 A;  1IV8 A;  2DL0 A;  3SD7 A;  3L4P A;  4KN4 A;  4F72 A;  2OH2 A;  2KFZ A;  2XVT A;  3JPQ A;  2UVR A;  3NGD A;  5ALX A;  1ZQN A;  4KMO B;  2JH7 A;  2GLE A;  4RPX A;  1SL0 A;  4YR3 A;  3SZ2 A;  9ICA A;  4ACO A;  2W7P A;  2G09 A;  3V6H A;  3A0H U;  4U6P A;  2ALZ A;  4KLL A;  5B66 U;  3K1R B;  4C4T A;  3H4B A;  2GO7 A;  4RQ2 A;  3G6X A;  3K4G A;  5J0W A;  4P0P A;  4KLO A;  2FMP A;  5KAF U;  8ICY A;  4YR0 A;  3WKD A;  3JPN A;  2BR0 A;  1NZB A;  2ZUC A;  4EZ6 A;  4HAI A;  1TK8 A;  2E8M A;  1JXL A;  3HIL A;  5EE0 A;  5ALS A;  4F2S A;  4Z6F A;  3PSP A;  5DB8 A;  1Y88 A;  2W3S A;  5AIB A;  2OWO A;  5KG3 A;  2KJ8 A;  8ICR A;  1ZQZ A;  2FE9 A;  4F5O A;  5J0O A;  3CW2 C;  1QSY A;  1SXD A;  2JZB B;  5L9X A;  3UMB A;  2NO5 A;  4BWJ A;  3TAN A;  1PZN A;  1PVP A;  1LB2 B;  1FO4 A;  5JTI A;  2KZM A;  5ALQ A;  4ECZ A;  2QLT A;  3RH4 A;  4QIW C;  1GO3 F;  4IQT A;  2LYA A;  3ZDE A;  4J03 A;  5KFC A;  3AU6 A;  4OO1 J;  4RUA A;  2MU2 A;  2AGO A;  1KFD A;  3SQI A;  4CF5 A;  2DGZ A;  8ICG A;  3IP4 B;  2D8C A;  3HW8 A;  3MAB A;  2BQR A;  3GV8 B;  2KOB A;  3RJF A;  2PMZ C;  2JGA A;  4Y2J A;  5ALD A;  2E5S A;  1BGX T;  1RYU A;  4QZF A;  2F1J A;  7ICI A;  1KFT A;  5KG2 A;  2W03 A;  1CEZ A;  5KFY A;  4DL6 A;  1L7M A;  5EOZ A;  3GIJ A;  3JPT A;  5CR0 A;  2XID A;  1B43 A;  1Z19 A;  4BJQ A;  2P35 A;  8ICW A;  4NLC A;  4M04 A;  2ZIW B;  5DLF A;  2ZG6 A;  4YVZ A;  2WHE A;  3TAR A;  9ICQ A;  1RG6 A;  5DDY A;  4PZO A;  5DKW A;  4F8R A;  1VJ5 A;  3MGV A;  3EW9 A;  1ZQQ A;  4QZA A;  2Y1I A;  3JPR A;  2KHV A;  2AXT U;  5AM4 A;  9ICG A;  1X9W A;  1SGG A;  3OHA A;  4QIW F;  4GC6 A;  1S10 A;  3T5L A;  4UBC A;  4J9N A;  5KL8 B;  2JH1 A;  2PFP A;  2KHQ A;  4J9K A;  4M9N A;  2IOH A;  3PW4 A;  2IBK A;  4A8E A;  2YMQ A;  2M9N A;  2F3N A;  4KLH A;  4RQ3 A;  2P6U A;  5KFD A;  2RP5 A;  1CRX A;  3QUC A;  2V4R A;  5IIN A;  5F9L A;  4IRC A;  3AM9 A;  5AK5 A;  1QQ5 A;  2ZXI A;  2BCU A;  4RQ1 A;  4B9T A;  4P4M A;  2W43 A;  4DFP A;  1ZQC A;  3HRD D;  1WCN A;  3NVW A;  1PK3 A;  2KSO A;  3DEE A;  5IIO A;  4KN7 A;  1SIJ A;  1L3S A;  3LWM A;  1JMS A;  5HMM A;  5ALW A;  5KFV A;  5DLG A;  5F3X B;  5AKE A;  1ZQF A;  4PHD A;  4KLQ A;  2PXI A;  3Q8P B;  4F2R A;  2VIX A;  1TFR A;  7ICG A;  3ZD9 A;  5EE1 A;  4RU9 A;  3GIL A;  1T7P A;  5HNK A;  1A0P A;  2ZIW A;  1AQ6 A;  1XSL A;  3V6K A;  5JU5 A;  2KVC A;  4M9L A;  5B5E U;  2MRL A;  2MUT B;  3C1Y A;  2I6X A;  1Z1B A;  1ZD2 P;  4JV2 A;  3NUQ A;  3HWT A;  1XO0 A;  3E0F A;  5EWG A;  1U9L A;  5AM3 A;  9ICI A;  2VAN A;  2XGP A;  3I1Y A;  5C0Y A;  4UAR A;  4I2B A;  4KLS A;  2PI5 A;  3ONN A;  2G5H B;  1S77 D;  2YML A;  1BPY A;  4NLK A;  4IQV A;  4RUC A;  1RPL A;  1K1Q A;  3GV7 B;  3AUO A;  4XQ8 A;  4YD1 A;  4YMM A;  4FZL A;  3MGH A;  3HKZ C;  2LHT A;  5CJ7 A;  5CP2 A;  2KG5 A;  1L7P A;  4M0A A;  2EZX A;  3WK4 A;  3H7I A;  2EAP A;  5AI5 A;  4YP3 A;  4C7Z A;  4BGD A;  4QZD A;  4P4O A;  1Z4O A;  5CRX A;  1X9X A;  4RQ0 A;  5DGA A;  2ASD A;  8ICZ A;  5J2E A;  4ED8 A;  2DKZ A;  2NRT A;  2BPF A;  4DSL A;  2LYB A;  3PVX A;  4C8L A;  4FZM A;  5DGB A;  4C8N A;  8ICT A;  5DDM A;  1ECW A;  4PHA A;  3ISC A;  5AKG A;  4MEX A;  2XI9 A;  1ZQH A;  5AI6 A;  2YQE A;  4C7Y A;  1EXN A;  4YXM A;  1JXE A;  4ECQ A;  1RDF A;  5ALU A;  4UBB A;  3L3F X;  4QWA A;  3JPO A;  1ZQJ A;  4O5K A;  3ZDD A;  4JB3 A;  1FEZ A;  1L8L A;  4DSF A;  3F53 A;  4QZ8 A;  1SKW A;  3WKE A;  3F5E A;  7ICO A;  1RXV A;  7ICP A;  1BVS A;  3HKZ F;  2Y0S C;  5KFM A;  1SB3 C;  4BWM A;  1F0M A;  1XC9 A;  2HVI A;  1ZQA A;  2UVW A;  5ALZ A;  1ZRM A;  5AKL A;  2KIV A;  1ZQD A;  4F4X A;  4YMO A;  5AK4 A;  5KFO A;  1VLB A;  3C2K A;  1CUK A;  2HDO A;  3PML A;  9ICT A;  4KMU A;  5III A;  3IHQ B;  2G06 A;  3AN1 A;  3PW5 A;  3FAH A;  3BQ7 A;  1WCL A;  2AGP A;  5J0P A;  2BCV A;  1QQ7 A;  2E3T A;  4Y2U A;  5KG5 A;  5DG9 A;  4QNL A;  2ASJ A;  3D2Q A;  5KT4 A;  5ALO A;  2XIC A;  5AI0 A;  2IOF A;  2E8O A;  5CA7 A;  3RJJ A;  4M6W B;  5J2D A;  4F50 A;  2KV2 A;  4TUR A;  3IG5 A;  1J2M A;  4DL3 A;  4I2D A;  5A0L A;  4DL4 A;  4DSE A;  3NAS A;  4PHE A;  2RRD A;  1NK0 A;  3BZK A;  3IDW A;  5AM5 A;  2R8K A;  5L1M A;  2ZIU B;  5KFZ A;  5CEH A;  4DOB A;  3KZX A;  4OJ6 A;  2JR5 A;  3PMN A;  1RYS A;  4KLF A;  3C28 A;  3EWA A;  4MHV A;  4F3O A;  3U26 A;  3K75 D;  3QE9 Y;  4UAW A;  3TAQ A;  2ZXH A;  3OTQ A;  2KIC A;  5DQI A;  2I5H A;  4GXK A;  1MN8 A;  5AIC A;  1MQ2 A;  4QWB A;  3EPI A;  4B9M A;  1K1S A;  5J2F A;  3F2C A;  5DB9 A;  1SWW A;  4ZH4 A;  2LKY A;  1ZD4 A;  3NVV A;  3ETR A;  4M9H A;  7ICL A;  3PSF A;  9ICP A;  4FO6 A;  1BPE A;  1WUD A;  1ZQ1 C;  3RJH A;  1ZQK A;  3L5K A;  2HHS A;  2LPE A;  3BS5 B;  1HIW A;  3F5A A;  4O5E A;  4PPX A;  3PR5 B;  3C2L A;  3B9J A;  5C5J A;  9ICF A;  2M0N A;  1NK5 A;  1NJZ A;  2A19 A;  4F4W A;  4QZG A;  3KZI U;  2ZUB A;  3EPG A;  4K4G A;  3C5F A;  4OJP A;  4PGX A;  3ED5 A;  4F93 B;  2EQY A;  1Q46 A;  1SKR A;  1B4F A;  1IM4 A;  2NRW A;  1UA1 A;  8ICQ A;  2WF9 A;  3UXN A;  1DXS A;  4NXZ A;  3D2N A;  1ZET A;  5KFS A;  4UAV A;  2ZIU A;  3M1Y A;  3SAG A;  3QNM A;  2LI6 A;  4DO9 A;  4IR9 A;  3NRZ A;  3PST A;  4J9M A;  3F2B A;  4PL1 A;  3H4D A;  4DOC A;  4Z6E A;  1ZQT A;  5L1K A;  4NWI A;  8ICM A;  2P6R A;  4PZN A;  5AM0 A;  3M7D A;  4CCH A;  4MFF A;  4F4K A;  1J97 A;  2DF4 B;  2DQN B;  7ICH A;  2KN7 A;  4UB2 A;  1UHU A;  1XS9 D;  1RQN A;  1X9S A;  9ICK A;  4DEZ A;  3OHB A;  3UMG A;  3OSP A;  1DK2 A;  5ALV A;  2K4E A;  7ICM A;  5BOL A;  2ZJ5 A;  2JEI A;  4RQN A;  4Q8E A;  4DQP A;  4B9N A;  2F77 X;  4C8O A;  4UAT A;  1S5L U;  4DWI A;  3OJS A;  3C5G A;  3H8J A;  1ZYQ A;  1CI4 A;  1N61 A;  5KFX A;  3BS5 A;  1ZD3 A;  4OJ5 A;  3WKB A;  4IS7 A;  3D2S A;  4CF4 A;  1JN3 A;  1DK3 A;  2B6G A;  4M47 A;  3PZP A;  3WK5 A;  3RFA A;  2P66 A;  3RRH A;  5BOM A;  3MR3 A;  3IRU A;  4Q8F A;  3AQF A;  1OUQ A;  5J2C A;  1X42 A;  1T8E A;  4DLE A;  2JHD A;  1TAQ A;  2W9B A;  8ICB A;  3RTV A;  3LWL A;  4KX3 A;  5KTQ A;  3J81 j;  8ICN A;  1D9F A;  4Z6D A;  3CRX A;  1NI3 A;  4TQS A;  1KLN A;  1Q8K A;  5ALI A;  3OSN A;  3TFR A;  1FFV A;  5ALP A;  2NYV A;  1XNS A;  4Y2T A;  9ICL A;  2HBM A;  4RT3 A;  4BUG A;  3QU4 A;  1DGJ A;  8ICI A;  2BGW A;  5E79 U;  8ICS A;  1BPZ A;  5AKH A;  1Z00 A;  2W55 A;  2FLP A;  3Q8M A;  2KKP A;  2NRZ A;  3RB4 A;  3TFS A;  2A1J B;  1QSS A;  1RXW A;  5DG8 A;  2R8J A;  3SAF A;  2Z7J A;  3M6K A;  3Q8K A;  4O3Q A;  5KFW A;  1ZQB A;  4DFD A;  1X6J A;  3SV3 A;  3IN5 A;  2LM1 A;  8ICC A;  1A6S A;  4FS2 A;  3QU7 A;  2DKX A;  2F1I A;  5GTI U;  1Q3U A;  2OYY A;  1TAU A;  5J0X A;  2QB0 B;  4CDG A;  2JXJ A;  1MA7 A;  3JPS A;  4KLE A;  1ZQW A;  4Y2R A;  1NJW A;  3UM9 A;  4Y2Y A;  4DF4 A;  2CN1 A;  3WU2 U;  2YTU A;  2K4P A;  3RJI A;  4RQM A;  4IRD A;  4OJO A;  2W3R A;  1URJ A;  2AQ4 A;  1WYG A;  3PR4 A;  5KFB A;  3LDA A;  3QU5 A;  3ZDA A;  7ICK A;  4KTQ A;  2BCS A;  2KNJ A;  4CE6 A;  8ICH A;  4YN4 A;  4EEY A;  3NS1 A;  1N2X A;  3SV4 A;  1IIP A;  4J9L A;  2W11 A;  1KSP A;  4NM1 A;  4Q44 A;  2CPR A;  1KDH A;  3SI8 A;  1C7Y A;  1U49 A;  3RJK A;  1ZQM A;  2I9G A;  3HPO A;  3SYZ A;  3WK9 A;  4U7C A;  2E8N A;  3A0B U;  3H0R B;  5AK6 A;  2JRZ A;  2JZB A;  2HOI A;  4BXO B;  3RJG A;  2GWS A;  2YX8 A;  1KQQ A;  4EBD A;  1UCV A;  1JRO A;  2A1J A;  4R8U B;  1N56 A;  8ICO A;  4GC7 A;  4BX9 C;  1BPB A;  4YCX A;  4TQR A;  5J0U A;  4M9G A;  1D8L A;  2QKQ A;  4NLB A;  3H8M A;  1ZQP A;  4J9O A;  1BNP A;  4ED7 A;  5AIA A;  2HOF A;  3PV8 A;  1A76 A;  1JX4 A;  3RJE A;  2PMZ F;  2K60 A;  5J0R A;  1KTQ A;  3LK9 A;  4DQS A;  7ICJ A;  2KJ9 A;  2QB0 A;  5K4L A;  3LYS A;  1MQ3 A;  2BKE A;  1X6I A;  2A1A A;  4I2I A;  2Q4T A;  4DFK A;  1ED1 A;  1WG8 A;  2F1H A;  1VDV A;  3UQ2 A;  4KLM A;  1SZH A;  3QU9 A;  5HML A;  7ICR A;  2KZ3 A;  1NK9 A;  2AJQ A;  5DBC A;  4IC9 A;  3NRW A;  3KHR A;  5L1I A;  4B9V A;  4DL5 A;  1Z4N A;  2YY6 A;  1V97 A;  5G5H A;  3T3F A;  5ALG A;  2Y1J A;  5CHG A;  4YD2 A;  1L5U A;  1L7N A;  3WKA A;  1KN5 A;  2KEY A;  4B9L A;  2DPJ A;  3GFK B;  9ICX A;  5KT2 A;  2NV3 A;  1T4G A;  3RB3 A;  3UMC A;  1U4B A;  4DQR A;  2AH5 A;  3JPP A;  4P0Q B;  5AI8 A;  3RF9 A;  4ED6 A;  2K8A A;  1PUZ A;  4F5N A;  1UT8 A;  5KFF A;  5J2I A;  2W04 A;  2WB1 C;  2K8C B;  9ICB A;  2MA1 A;  5IIM A;  4I2A A;  4CF3 A;  2AGQ A;  8ICU A;  2MAX A;  4YFK A;  1P7D A;  5AM2 A;  4Y2P A;  3ETL A;  4KX5 A;  2K89 A;  2B21 A;  3C29 A;  2KD1 A;  4ECR A;  3WK8 A;  3KHH A;  1UA0 A;  3IV6 A;  4E0D A;  1ZQG A;  4IL6 U;  4JV0 A;  5KFU A;  5KT3 A;  3N7S C;  3WKC A;  4R66 A;  9ICH A;  4RQ5 A;  4QZB A;  2EZZ A;  5AKX A;  2FMQ A;  2ZIX B;  4F71 A;  4RNO A;  2BZF A;  5KG7 A;  4C8K A;  4IQU A;  1B22 A;  2KP7 A;  2H3Q A;  2G07 A;  3M9O B;  2C22 A;  7ICF A;  8ICA A;  1N5W A;  4DQI A;  5IIL A;  4I2J A;  2HBL A;  4UAY A;  1L3V A;  2VA2 A;  4GLX A;  2C2E A;  2KTQ A;  4O3R A;  2CXY A;  1KL9 A;  1QLN A;  3MBY A;  4MF2 A;  2KMD A;  4ZOH C;  3RAQ A;  2IMW P;  2MUT A;  5J29 A;  2F8L A;  4QW8 A;  4NLG A;  1DGS A;  2WB1 F;  2KFN A;  4TUQ A;  5ALK A;  3RR7 A;  3VC8 A;  5KG0 A;  4I2F A;  4CNQ A;  1ZQU A;  4QW9 A;  4QWC A;  4ECW A;  3RRG A;  3KHL A;  2HOQ A;  3TAD C;  1F44 A;  5HP4 A;  3GIK A;  4P0Q A;  3H0L B;  5KFQ A;  5DB6 A;  2E1F A;  5HR6 A;  4QWE A;  2IOF K;  4I2G A;  3G6V A;  2F2A B;  3V72 A;  3PO5 A;  4Q43 A;  2NRX A;  1ZXI A;  1KW4 A;  4KLU A;  3H40 A;  4RNM A;  1A77 A;  2H5X A;  4XRH A;  2R8I A;  1J2N A;  3KD3 A;  3N7R C;  3UXO A;  5AKJ A;  3SMV A;  4C4S A;  3MR6 A;  1KBU A;  3Q8Q B;  1O03 A;  3QX7 A;  5KFA A;  4PH5 A;  1V9P A;  2EAM A;  1TKD A;  1OXJ A;  9ICM A;  2XCP A;  5KT6 A;  1S0M A;  2YB4 A;  2ZIX A;  2FPL A;  3ZDC A;  5L1L A;  4YR2 A;  5D49 A;  2GH1 A;  3ORY A;  2EDU A;  4LJX A;  1QH9 A;  4DF8 A;  4KIT B;  2LYH A;  1RYR A;  4O3P A;  4K4I A;  2EZY A;  2FLL A;  2H3V A;  3KTQ A;  4FBT A;  2JEJ A;  9ICE A;  3GII A;  2J6U A;  1ZQS A;  2Y0S F;  4LZG A;  3MFI A;  5ALH A;  3M6Z A;  1T94 A;  2CRX A;  1IG6 A;  3SEN A;  2OHF A;  2RLT A;  3Q8R B;  1NOM A;  3AMZ A;  2HVH A;  4GXI A;  1NKB A;  4DFJ A;  5KT7 A;  2R18 A;  3BQ2 A;  4EBE A;  2KZZ A;  1L7O A;  2UVV A;  2ESE A;  3GDX A;  1TK0 A;  2YMM A;  5DQG A;  4QZI A;  2D6F C;  2HI0 A;  3OPX A;  4O3N A;  9ICS A;  5KL1 B;  4EBC A;  1KFS A;  5AKI A;  4O3O A;  3CYM A;  1OW5 A;  4QJF B;  4RQ8 A;  4ELT A;  1SKS A;  1NKC A;  2WFA A;  2EAO A;  2QAR B;  4BDP A;  1ZQI A;  3TAD A;  1ZQL A;  8ICJ A;  1ZQR A;  9ICV A;  4NL9 C;  2FLN A;  2FPK A;  4DQQ A;  2W8K A;  2V9W A;  1SZP A;  1SL1 A;  3FM9 A;  4DLG A;  4RNN A;  1HUZ A;  3M9N B;  4UW9 A;  1KKX A;  2RDI A;  2YMP A;  2J6S A;  8ICE A;  4NY8 A;  4JWM A;  4M6W A;  2NO4 A;  1NJY A;  3TAC B;  5EE3 A;  4RZR A;  4FBU A;  3RB6 A;  5HHH A;  4M2Y A;  3NVZ A;  3WK7 A;  1RQL A;  7ICV A;  9ICO A;  8ICF A;  4OJL A;  5GTH U;  5IIJ A;  2I1Q A;  4RT2 A;  4I2E A;  2RDJ A;  3I28 A;  4UAS A;  3D6J A;  4HYK A;  4YXJ A;  4DS4 A;  2FDR A;  4US8 A;  1HJP A;  5KFJ A; 
#chains in the Genus database with same CATH homology
 2G5I B;  3LVW A;  1ED1 A;  4CDG A;  2F77 X;  2KVC A;  3GZF A;  1UPH A;  3HKZ F;  3K1Z A;  3H0M B;  3PSI A;  1MA7 A;  4GFJ A;  2WAQ F;  2Y0S C;  2MRL A;  3CP8 A;  4P0P A;  2HBL A;  3M6Z A;  1T94 A;  3VCB A;  2CRX A;  2XID A;  3F2C A;  2HBK A;  3SAH A;  1Z19 A;  1Z1B A;  2LKY A;  4BJQ A;  4NLC A;  3NUQ A;  2G0A A;  1SZH A;  2ZIW B;  2CN1 A;  2KJ5 A;  3E0F A;  1XO0 A;  1NZB A;  2ZG6 A;  3GU3 A;  4O3M A;  3PSF A;  2K4I A;  4WJ3 B;  2R18 A;  3LVV A;  4OJ5 A;  4P0P B;  4OJO A;  3D2S A;  1WUD A;  1URJ A;  5C0Y A;  2F8L A;  3MGV A;  4IC9 A;  2H3I A;  3NRW A;  2K8B B;  2OM6 A;  3PZP A;  1ZQ1 C;  3RFA A;  1TAM A;  3ONN A;  2KHV A;  2G5H B;  2D6F C;  2WB1 F;  2JMG A;  3PSP A;  3OPX A;  3VC8 A;  5KL1 B;  4QIW F;  2KNJ A;  1HIW A;  3F5A A;  4C0Z A;  3CYM A;  1DRG A;  3AQE A;  2KJ8 A;  2G06 A;  5KL8 B;  2JH1 A;  2HOQ A;  4AYB C;  3AQF A;  2K4H A;  4QJF B;  1OUQ A;  1F44 A;  4FZL A;  2M0N A;  1YT3 A;  3HKZ C;  4P0Q A;  2KHQ A;  3H0L B;  2JHD A;  4ICA A;  2WAQ C;  2LHT A;  1IIP A;  2HMX A;  2KEY A;  3O0F A;  2E1F A;  3N7P D;  5HR6 A;  1L6N A;  2ZIV A;  2VJ5 A;  4KX3 A;  4QNL A;  1D8B A;  3ICX A;  4A8E A;  3D2Q A;  2CPR A;  2NV3 A;  4OJP A;  4JMU A;  2HBJ A;  2F2A B;  2A3V A;  3CRX A;  2RP5 A;  2XIC A;  5T14 A;  1CRX A;  3KFU F;  2KIW A;  3F2D A;  1PVP A;  4P0Q B;  2BDU A;  3RF9 A;  2VJ4 A;  2KKV A;  2W7O A;  5CRX A;  3ALR A;  4U7C A;  2OXO A;  3H0R B;  2HOI A;  2ZIV B;  1XNS A;  2G08 A;  2ZXI A;  2K8A A;  3D2N A;  3N7R C;  2YX8 A;  2HBM A;  3SMV A;  2H3Z A;  2LYB A;  4BUG A;  1KBU A;  2KV2 A;  2W04 A;  1Q3V A;  2WB1 C;  2ZIU A;  2GOL A;  3IG5 A;  4BX9 C;  2K8C B;  4QIW C;  2MA1 A;  3SAG A;  1PVR A;  1GO3 F;  5A0L A;  2LYA A;  3PST A;  4FZM A;  4CGZ A;  2RRD A;  3DEE A;  3F2B A;  4PL1 A;  1P7D A;  4OO1 J;  4KX5 A;  2KKP A;  2K89 A;  4NLB A;  2LBO A;  3T79 A;  2YB4 A;  3C29 A;  2KD1 A;  2F76 X;  4PL2 A;  1ECW A;  4NWI A;  2ZIU B;  2ZIX A;  5HR7 A;  2RHF A;  3SQI A;  3M7D A;  3KZX A;  4FE3 A;  3SAF A;  2HOF A;  2Z7J A;  3M6K A;  2OH2 A;  2XI9 A;  2XVT A;  4OJ6 A;  2DGZ A;  3IP4 B;  2GH1 A;  2PMZ F;  2Q4T A;  4CRX A;  2DF4 B;  4KMO B;  2JH7 A;  3N7S C;  4OJL A;  3C28 A;  2DQN B;  2YB1 A;  2KOB A;  3IG8 A;  4FZN A;  3AL0 B;  3IN5 A;  2KJ9 A;  2ZIX B;  2PMZ C;  2JGA A;  1A6S A;  3LYS A;  2VIX A;  3L3F X;  4ACO A;  2ZXH A;  2W7P A;  2G09 A;  2H3V A;  1HEK A;  2E5S A;  2E1E A;  1PVQ A;  2K4E A;  2KIC A;  2VKQ A;  4NV0 A;  4U6P A;  1A0P A;  2H3F A;  2H3Q A;  2W03 A;  2Y0S F;  3F53 A;  1Q3U A;  2OYY A;  2N1R A;  3F5E A;  2G07 A;  2ZIW A;  4AYB F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...