2NV3A

Solution structure of l8a mutant of hiv-1 myristoylated matrix protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
GARASVASGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Point mutations in the HIV-1 matrix protein turn off the myristyl switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 34
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2nv3A01
1ECWA 2JMGA 2H3ZA 1L6NA 2K4IA 2HMXA 2LYAA 4JMUA 2H3FA 2K4EA 2H3IA 2H3QA 2LYBA 1A6SA 4ICAA 2K4HA 2N1RA 1TAMA 1ED1A 1HEKA 2H3VA 2NV3A 4IC9A 2GOLA 1UPHA 1HIWA
chains in the Genus database with same CATH superfamily
4J9MA 3V7LA 2W3RA 1ZQNA 1D9DA 3SV3A 2W9BB 2K60A 2ATLA 2YN4A 3MFHA 4PZNA 3LVVA 2V4QA 4QW9A 3Q8QB 3RB0A 3HKZC 1SZPA 4C4TA 1BVSA 3UM9A 4YR0A 2XGPA 3NVVA 4JWMA 3PX6A 3C1YA 2E8NA 2Q4TA 5KFCA 2OM6A 4O0IA 3JPRA 1S5LU 2Y9UA 4RPYA 3OGUA 2HBLA 4BX9C 2E1EA 5AM0A 4IQWA 1VDVA 3UXPA 4PGYA 1J2NA 4HAIA 2HVHA 1RDFA 1UT8A 3ALRA 1C7YA 1BPYA 1TAQA 3K1ZA 3KTQA 3QU2A 2KFZA 4TUQA 1T7PA 3I28A 8ICXA 4P0PA 1IXRA 2G5HB 2RDIA 2PFQA 1Y88A 1XSPA 4F91B 4CGZA 2A19A 4F4ZA 4Z6FA 4IQUA 2E5SA 5T14A 4P0PB 1NK8A 4UAWA 4J9KA 3WKDA 4R65A 2RP5A 3RB4A 3GIJA 5CB1A 2W3SA 5AK3A 7ICFA 4BJQA 3CW2C 8ICGA 1UQVA 2KG5A 3F2CA 1ZQMA 1ZQGA 2KKVA 3EWAA 2HHXA 5BOMA 4KLLA 4AP9A 1PK1B 5J0QA 3FYHA 2DFLA 2W9AA 1S97A 5ALYA 5KFUA 3HILA 2PFPA 5E79U 5ALVA 3M7DA 5J2IA 5HHIA 3TKAA 2KIVA 3SYZA 2JV3A 2XCAA 4UATA 3LDAA 3C2MA 1IM4A 4KLIA 1LKYA 4Z6EA 1X40A 2FMSA 5JTIA 4DSLA 7ICNA 2Y1JA 3D6JA 2H3FA 2AJQA 4FS2A 1LKYB 5KT2A 4EX6A 2KNJA 2J6TA 2V4RA 2IMWP 5C0YA 2HOQA 1JX4A 4YD1A 2ASDA 5ALRA 4M47A 1KW4A 2G06A 3AEVA 7ICTA 4Y2XA 5AKZA 2KHQA 3KHHA 1ZQHA 2G08A 3DDHA 3AU6A 4US9A 1ZQXA 1Z4NA 1JUDA 1NZPA 1NK7A 2HMXA 1D9FA 9ICBA 2KZ3A 4C7YA 2D8CA 2XVTA 4Y2PA 9ICUA 4F4YA 5KT6A 4EBDA 2E8OA 1URJA 3M1YA 4C8OA 1YZ7A 4UB3A 3PR5B 1M6YA 4WJ3B 8ICBA 1KKXA 1N62A 4P4PA 4PL1A 3HPOA 4XA5A 5DB8A 4TUPA 4QIWF 4PZOA 3B0XA 1T3QA 3H40A 2DQNB 5J0WA 1DGSA 4PJ0U 3SZ2A 3PO5A 3D2NA 4F4KA 4Q43A 2YX8A 2XY7A 4F4XA 2M9NA 4P0QB 5AM1A 5BPCA 8ICPA 1S0OA 5AI8A 3T5JA 4QWEA 5JU5A 1Z00A 2ZUCA 1ZQDA 2R8GA 5ALHA 4EBCA 4CRXA 1SWVA 2NV3A 5KG6A 4M9HA 4EX7A 2AU0A 2UVRA 1Z00B 5ALLA 1X9SA 4OJPA 1PK3A 2WF6A 4R63A 1MQ3A 5AI5A 4CF4A 4Y2YA 2JRZA 3C23A 1X9WA 3C21A 5ALKA 2ZUDA 1RXVA 4Y2SA 4DQRA 1ZQUA 4IR9A 4JK1A 5AI0A 5J8YA 3QU5A 1KSPA 2KVSA 2B0CA 5HMLA 4RQ6A 3D2SA 3MC1A 4DSKA 4Q8FA 2NRVA 4RT2A 1ZD5A 2IOFK 2ISOA 2EZYA 4GC7A 1PVRA 4IRDA 2H3VA 4FZMA 2KSOA 3IG8A 5KFEA 2LYHA 5DLFA 1COOA 4LZDA 2GWSA 3ORYA 2KV2A 2KSOB 1F0MA 5DLGA 2WTFA 4Y2UA 3RH5A 4RT3A 5KT3A 1NJZA 4UAYA 1KLNA 5J2JA 1XWLA 2FDRA 3TACB 1ZQIA 1MN8A 3QUBA 2AXTU 2KHVA 4USAA 2YTUA 4EYIB 1A76A 1Q3UA 1PZNA 4ACOA 5IIJA 1N48A 4NY8A 4I28A 3H8MA 5ALPA 3TFRA 1JXLA 4NL9A 2AGPA 2QB0A 4RQ1A 4F2RA 2J6SA 3QU9A 4FBUA 2QB0B 1SL0A 1KTQA 1XSNA 4HYKA 1HIWA 4Z6DA 2O6KA 1T8EA 1QLNA 4YVZA 5KFVA 2HOIA 4NLGA 4UB2A 2OHFA 1RPLA 3PY8A 1V97A 1IV8A 3QZ7A 3T5HA 4KLEA 4YCXA 1KFSA 4O3RA 2P66A 3CP8A 3RH4A 4B9TA 4J9PA 3G6VA 2JGAA 4YR3A 2HHTA 4FZNA 2ZIWA 5KFFA 3U26A 3TANA 1WWVA 3NVWA 9ICMA 3QUQA 3HT3A 3HX0A 4M9LA 2UVVA 3IG5A 4TQRA 1L7OA 1S0NA 2KD1A 2HHSA 4DOBA 5KFKA 2ZG6A 2AQ0A 2MRLA 3KHGA 3UXNA 4PHDA 2AH5A 1Z1BA 3B9JA 2DBYA 1ZYQA 2BCSA 4F5QA 3C5FA 1UCVA 4QZDA 1UHUA 4I2JA 1XNSA 2N1RA 2IA6A 4Q8EA 4NLNA 1NKEA 2B21A 4GLXA 2E8PA 5AKIA 2VJ5A 4UAZA 2UVUA 5KG5A 4RQ0A 2OXOA 5IIOA 5J2DA 4DSFA 1NK9A 5AK5A 4DOCA 4FE3A 1RYUA 3PR4A 1QSLA 2MAXA 2PXIA 3SAGA 3PSTA 4YMNA 3SQIA 4F93B 4IR1A 2RLTA 4PHPA 7ICPA 2KP7A 2A1JA 3OPXA 2ZUBA 1OUQA 3C1ZA 2A1JB 1S76D 4YFKA 4RNNA 4B6JA 1U48A 1ZQTA 4TQSA 2C2DA 2EZZA 5J0OA 2VA3A 1B22A 2XICA 3H0MB 3GIMA 2A1AA 2ZTCA 3GV7B 4F2SA 3NVZA 2ASLA 2ZXHA 3JPNA 2HVIA 1RM6C 4PHEA 4C4SA 3RBEA 5DQHA 5AM2A 3MGIA 3SENA 4DS5A 2RDJA 8ICYA 3KFUF 1V9PA 3WK9A 4O3OA 1V85A 1ZQJA 3OSPA 2NO4A 1SZHA 1L7MA 4R8UB 3F2BA 1SKWA 2DPIA 8ICRA 2HCFA 5J0UA 1XSLA 3ONNA 2LM4A 5KFZA 3NGDA 2VA8A 1X9XA 4U6PA 5AK4A 4DFKA 3BZCA 3PZPA 4YQWA 4RQNA 5ALIA 2A3VA 5KFPA 4ECUA 4YMMA 4JV1A 2R8HA 4DL2A 2HHWA 3BJYA 9ICCA 1S10A 1AROP 4M2YA 3V72A 5G5HA 1X66A 3OHBA 2EDUA 4Q44A 5KTQA 2G5IB 4UB8U 2C2EA 2LI6A 5J8YC 1S8OA 3V6KA 9ICNA 5KFRA 1GO3F 1QH9A 1CEZA 3ISBA 2WF5A 1ZETA 1ZQSA 1WUDA 3WKCA 3IDWA 1IG6A 4M9GA 4F71A 2JZBB 4KX3A 2JEJA 5F9LA 2Q0ZX 2QARA 4F4WA 4KMOB 2W43A 4KMUA 5GTIU 3UMBA 3MR3A 3MDAA 3BZKA 7ICMA 2VJ4A 4KLMA 2QARB 4QZGA 1ZQKA 5BOLA 5KFMA 3QU7A 5ALMA 2PFNA 4MFCA 4P2HA 4Y2QA 5AKLA 3GIIA 1KN5A 5L1KA 1EXNA 3F2DA 1BPBA 4DSJA 4GXJA 3M8RA 4DFPA 2J6UA 3A0HU 3O0FA 5J2FA 4NJ8A 2ZTEA 2NYVA 1JROA 2LHTA 1NJXA 4DQPA 3M8SA 1FFUA 3A0BU 2OEHA 4CDGA 2KN7A 4NL9C 5DDMA 3QX7A 4DQSA 1ZQ1C 8ICJA 3E2EA 3T3FA 1ZOLA 1MC8A 4RQ8A 5HR6A 2XO7A 3EW9A 3EPIA 2BR0A 4UW9A 3H4BA 1NKBA 3EYZA 7ICKA 3C2LA 2E3TA 2HOFA 1NJWA 5KFOA 2FMQA 3QEAZ 4C80A 3GQCA 4LJXA 5KAIU 3ZD8A 4J9LA 2DL0A 3D2QA 4UQGA 2PMZF 5KFXA 2WAQF 3GILA 2DKZA 4O5EA 1UA1A 1F5SA 3OTQA 1NK5A 3KKAA 2HHQA 4RZRA 2ZJAA 4KX5A 9ICKA 1FIQA 3NS1A 1KFTA 4JUZA 5IIIA 3B0YA 4QZFA 3T79A 4UBCA 3ZDDA 2ZIVA 2MA1A 5DQGA 3BS7A 2F1HA 1RYRA 7ICQA 1XU4A 2EZXA 5KFYA 5KFNA 4MF8A 1PK1A 2YY6A 2ZIVB 1X9MA 3QU4A 4FFDA 1ZRMA 3UQ0A 9ICAA 4DL7A 1XC9A 9ICXA 1Z19A 3GZFA 1WCNA 4I2DA 2FLNA 1OXJA 3V6HA 2HHVA 4ELTA 2H3QA 4O3SA 2ZIXB 2ZXIA 2ZTDA 4PHAA 4ED0A 1QSSA 2OWOA 1BGXT 1ZXIA 3CNHA 8ICMA 4ECXA 5ALZA 9ICFA 3WU2U 4QIWC 1ZJNA 3RJGA 4YN4A 9ICWA 5CHGA 4DLGA 3L3FX 4I2HA 5J0PA 2BGWA 2XY6A 3RJJA 4BWJA 3UPQA 3NTUA 1ZQYA 1N60A 4CE6A 4F92B 5AI6A 4C4RA 3AN1A 9ICPA 1ZRNA 5ALXA 1NOMA 9ICVA 4C8MA 5HHHA 2F2AB 3QXGA 3UMCA 1TK8A 4RUCA 7ICJA 1VJ5A 1BNOA 3C29A 2KKPA 3PW2A 2KEYA 7ICVA 3OHAA 4OJOA 1P7DA 1SIJA 4ECYA 2GLEA 2VIXA 3H0LB 7ICOA 4Y2VA 4QWBA 4J9NA 1NK4A 4RQ2A 2BCRA 1ZQRA 4DL4A 4DLEA 4EEYA 1SV0A 2WB1C 2HBKA 1DRGA 1Z4OA 2LYAA 5CA7A 4J9OA 1LB2B 1YZ6A 5AI4A 3AQFA 3KD3A 3MDCA 8ICUA 3Q8SB 1SB3C 5EE9A 3L5KA 4ICAA 1L3VA 4ELVA 4RQ3A 3AQEA 4P0QA 4KITB 4C8KA 4B9MA 4K4HA 5B66U 2HDOA 4I2IA 2HBJA 3TAPA 1D8YA 2P6RA 3M9MB 4DWIA 8ICNA 3MR5A 1L8LA 1DK2A 5DB9A 3EUB2 4C8NA 8ICCA 2HBMA 3QZ8A 3MFIA 5KFWA 3HWTA 1SWWA 5TISU 3Q8PB 5J0TA 1Q3VA 1SGGA 2AGOA 2IBKA 3PX4A 5D4BA 2BDUA 3RJIA 4CCHA 2EAPA 4EBEA 4GIBA 4O9MA 2YB1A 1A6SA 2R8JA 2MSNA 3TADA 1NKCA 5AICA 3MBYA 3KHRA 2RHFA 3H4DA 1K1SA 3BQTA 4KLTA 7ICSA 5DQIA 4RQ5A 4DFMA 4B9NA 4RUAA 2R8KA 2AQ4A 4NXZA 3UQ2A 3PW7A 4RPZA 1HUZA 4QZ9A 3QE9Y 2K4HA 2KZZA 2G0AA 5L1IA 2IOFA 2KICA 5J2HA 1JN3A 2BCVA 4M04A 5TZVA 9ICJA 4NLKA 2AHOB 4KN4A 2FJ6A 2DF4B 4CNQA 2DPJA 3WKEA 1BPDA 5EE1A 4YR2A 3AU2A 4UB5A 2BCUA 4M0AA 1LV5A 3QNMA 4UB4A 5CP2A 2I6XA 1ZQVA 5ALNA 1A0PA 2D3DA 2OH2A 3WK7A 2NRZA 5AM4A 1U45A 4I2CA 3PW0A 4C8LA 2W7OA 4DSIA 4TUSA 4YMOA 3AM9A 2DUYA 4ED7A 3RR7A 2IHMA 5JUMA 3NVYA 4QZ8A 7ICIA 2KOBA 3M6ZA 2Y1IA 1SL2A 8ICOA 3KKAC 1ECWA 2XGQA 4DQQA 4PPXA 1MA7A 1T4GA 3I76A 2ZJ8A 3TAQA 5KFHA 4KLFA 3K4GA 5CWRA 1QTMA 3M9NB 1SKRA 1JALA 4MHVA 2KE7A 1SXEA 3JPOA 5ALOA 2W11A 2FMPA 4DQIA 3RF9A 2HSZA 2YQEA 8ICAA 3RRGA 1X6JA 4XQ8A 2I9GA 5K4LA 2KMDA 1T94A 2BCQA 4Y2RA 3UMGA 4KTQA 2Y0SF 8ICKA 3MGHA 2B6GA 4ED1A 1H38A 1ZQEA 3WK5A 3RH6A 4U7CA 5DGAA 4I29A 4RU9A 2DGZA 3WK4A 4QZBA 5DG8A 1MQ2A 4DF4A 2WF9A 4MEXA 4J03A 4OJ6A 9ICOA 2ESEA 4YXJA 4ECTA 2KFNA 5G5GA 4XUSA 3EZ5A 4A8EA 3IRUA 2IOHA 2EH9A 3NRZA 1JRPA 9ICGA 1DGJA 2PKEA 5EWFA 2VKQA 3PW4A 4AYBF 3RJKA 2UVWA 2KZMA 3PVXA 3MR6A 3F53A 5KFLA 3KHLA 3HJEA 1TK0A 1WWUA 1WCLA 3BQ1A 3N7PD 1KRPA 3SV4A 3RTVA 1N61A 5JRTA 1V38A 4DF8A 4OD0A 3Q8KA 5KFJA 1SV0C 4F5OA 3ZDCA 2BQUA 4O3QA 3TFSA 3PNCA 3C28A 1FFVA 1L8OA 3GFKB 4G9BA 4QWCA 1A77A 1J97A 3Q8LA 1O08A 3LWMA 4FO6A 1ZQWA 1DOQA 7ICUA 5ALJA 5J0RA 2MU2A 4R8UA 8ICIA 3BDPA 3T5KA 1RZTA 1BPEA 4FBTA 3HRDD 5KFAA 2FLPA 1COKA 5KAFU 3AUOA 8ICSA 2OCEA 2WHEA 7ICLA 1WYGA 9ICIA 4IS7A 3DEEA 3TQ1A 4ECRA 1L3TA 3SEIA 2NRWA 3ZDBA 3ZI4A 4DL3A 4UAUA 1TKDA 5L1LA 2HI0A 5DGBA 1SKSA 3RJHA 1HUOA 2G07A 3GV8B 1L7NA 2BPCA 8ICZA 1ZQPA 4DL6A 3TADC 2OYYA 1HEKA 2LM1A 9ICSA 2ES6A 2EAOA 4UB1A 4JV2A 4LVSA 2JZBA 3V7JA 3ED5A 2DKXA 1Q8KA 1ZD2P 5AI9A 3ZDEA 4I2AA 4DCCA 5D49A 2K4EA 3N7RC 4NLBA 1FEZA 3H8WA 3KZXA 1N5XA 1IIPA 2ISPA 4I27A 2KK0A 4ELUA 2W9CA 1KDHA 5J0XA 5KG2A 5J0YA 4BDPA 2NO5A 1XO1A 9ICLA 3SR6A 2RQ5A 4DL5A 3PSFA 3G6YA 2W9CB 4BXOA 2LBOA 5AKEA 1QSYA 4FZLA 2I5HA 3OSNA 2K8BB 2JEIA 4R66A 9ICQA 1CRXA 1ZJMA 4J9QA 3E58A 4BXOB 3Q8MA 9ICRA 4I2EA 2QKQA 3TI0A 2PMZC 4F3OA 5ALDA 3RR8A 3WK6A 2F76X 2Z7JA 3N7SC 3FAHA 8ICVA 1VLBA 2Y9TA 5J2EA 4OCZA 5ALUA 4F8RA 4O5KA 2E8MA 3N28A 2JEFA 1U9LA 3THVA 1D8BA 4Y2JA 1C20A 3SAFA 2V9WA 4QJFB 4QZEA 5KFDA 2WFAA 3BS5B 1JIHA 4QZAA 3ZD9A 1AQ6A 2ASJA 4F5NA 4DEZA 5ALSA 5J2BA 4KLQA 3KZIU 3BQ7A 1K5OA 1Z3EB 4QW8A 4MF2A 5HR7A 5KL1B 3V7KA 2FPKA 4UB6U 2KJ9A 4K4GA 1UT5A 4NLCA 5AKJA 3NUQA 4LZGA 1KEJA 4J9SA 3M9OB 5B5EU 5DKWA 2DWQA 1ZD4A 2YMPA 3IP4B 4MEYA 3HW8A 1O03A 3EPGA 8ICTA 5EE0A 4GXKA 2D6FC 1L3SA 3C5GA 1ED1A 3NASA 3RBDA 2XC9A 2ZJ5A 5HNKA 4UASA 2R18A 4QWDA 3GDXA 5KT4A 1SXDA 8ICFA 2ZIXA 1NNLA 4IRCA 2CRXA 1X2IA 3ISDA 1TFRA 1S77D 3HKZF 5IIKA 3HP6A 1QQ7A 1N56A 3R9KA 1T3NA 4P4OA 4O5CA 4I2FA 4PL2A 4G3IA 3PO4A 3LVWA 3BQ2A 3J81j 1QCKA 1S0MA 4IQTA 3H0RB 3PX0A 5AM5A 4M9JA 2JH1A 2K89A 2XCPA 5AIBA 1N2XA 1RQLA 2FPMA 1ZQQA 4UBBA 1TAUA 5EE3A 3N4MB 4ECQA 4TURA 4KLGA 1L7PA 4F5RA 5A0LA 2GO7A 1N5WA 2HW3A 5AM3A 4KN7A 4IL6U 2JMGA 4DS4A 3RAXA 4OJ5A 5L1JA 1TVAA 2F1IA 1KBUA 4IRKA 2KTQA 5D46A 5KG3A 5DB7A 2EAMA 5GTHU 5J29A 1KL9A 5KFGA 2P6UA 4ECSA 4PGXA 1JI7A 1D8LA 5AKYA 3JPSA 4ED3A 1S0VA 2FLLA 3PMLA 4EENA 2ZIUA 4BGDA 2WF8A 1QQ6A 4KLHA 1B4FA 4Z6CA 5ALEA 2F3NA 2ZIUB 2W54A 4ECZA 2W55A 7ICGA 4RQ7A 4KLJA 3SAHA 5KNIA 2ALZA 3RRHA 4JB3A 2XY5A 2ODGA 2W04A 4JV0A 1NJYA 4F5PA 5DG7A 2BPGA 5ALQA 4E0DA 4YP3A 2XI9A 4KLOA 5IILA 2K4IA 8ICQA 2F8LA 3CRXA 4OJLA 2YMLA 5CR0A 3T5LA 1F44A 5ALFA 1ZQZA 4PH5A 2FI1A 3GIKA 1ZQLA 5DDYA 3K75D 4KLDA 1XO0A 3UXOA 1X42A 5L9XA 1TK5A 1Z1VA 4MFAA 5ALWA 2WB1F 9ICHA 2F1JA 2P35A 3RFAA 2W9MA 1ZQBA 5KG7A 3MABA 5CJ7A 3K1RB 4NM1A 3ETRA 4EYHB 3IM1A 4F50A 1UA0A 1QQ5A 2BHNA 2W7PA 2VANA 4BWMA 2LPEA 2GH1A 4GFJA 1XS9D 4IQVA 4K4IA 3NRWA 2JEGA 1HJPA 3QUTA 3PSIA 2L5YA 5AKGA 4OO1J 4O3MA 4RPXA 5KFTA 1BNPA 2RRDA 4KLSA 1L5UA 4NLZA 3V6JA 2Y0SC 3PV8A 1U47A 3ICXA 1S9FA 5ALTA 2CXYA 4YXMA 5CEHA 2EQYA 5J2KA 3OJSA 5L1MA 2JH7A 2K4PA 1TAMA 4DOAA 2YMQA 4I2BA 1PUZA 3VCBA 2K8AA 4IC9A 1UPHA 5ALGA 4YD2A 3C2KA 2IHNA 1ZQAA 4C0ZA 2CPRA 2H5XA 1L6NA 1CI4A 4GXIA 1TV9A 4FS1A 2I1QA 4YG2A 3H7IA 4BUGA 4AYBC 8ICEA 1YT3A 3OJUA 4NV0A 1KQQA 3AL0B 1NI3A 5DBAA 2PI4A 4F72A 4ZH4A 2BDPA 4ED6A 3QYPA 4DFDA 3VC8A 3DV9A 4XRHA 1WG8A 2H3IA 2YB4A 3SI8A 2CN1A 9ICTA 5C5JA 4RQ4A 2EANA 3RJFA 1DXSA 2VA2A 4P4MA 1BPXA 2KIWA 2NRTA 1U4BA 4ECWA 2LMRA 3H8JA 2JHDA 2K8CB 4QZHA 4EEKA 2KJ8A 5DG9A 1JXEA 1KFDA 2M0NA 1CUKA 1Q46A 2ZIWB 2F77X 4Q45A 4EZ6A 4NM2A 3SD7A 3RB3A 1L3UA 2G09A 3WKAA 4DO9A 1LVHA 5KG1A 4B9VA 2C22A 3KOOA 2FE9A 2KVCA 3FC4A 1B43A 1DK3A 4UARA 2W8LA 3E0FA 1SL1A 5KT5A 5KT7A 5J2CA 1U49A 5IIMA 4RQMA 1PVPA 4NWIA 1N63A 5DBBA 5AKKA 5CRXA 5KL8B 3LK9A 2GOLA 4MFFA 2NRXA 4B9SA 4X5VA 3SMVA 1ZD3A 3Q8RB 2BPFA 5J0SA 5IINA 5KFIA 3FM9A 1NK0A 4EELA 3TARA 2W03A 3G6XA 1ZQCA 4RNMA 2LYBA 4DSEA 4M6WA 5HMMA 3F5AA 3WKBA 4J9RA 2XIDA 1SV4A 2W8KA 2AGQA 4M6WB 7ICRA 5AIAA 4DFJA 5AKXA 2KJ5A 1ZQFA 3JPPA 5EWGA 1FO4A 5DB6A 4I2GA 5KFQA 5AK6A 2C28A 2YMMA 3LWLA 4QZCA 3PMNA 2BQRA 5J2AA 5DBCA 4O3PA 2MUTA 5AHXA 4RNOA 3PW5A 3RB6A 3RAQA 1TE2A 3CYMA 1RXWA 2MUTB 1J2MA 2F8KA 8ICWA 1K1QA 3JPTA 3RJEA 3JPQA 7ICHA 3MR2A 3WK8A 3IHQB 5KFSA 2BQ3A 3LYSA 5F3XB 4ECVA 4KLUA 4B9UA 4ZOHC 4C7ZA 4PGQA 5AKHA 5EWEA 3M6KA 1B0XA 5FP0A 5HP4A 4GC6A 3IN5A 2JR5A 3S6JA 3ISCA 3QEBZ 2C2RA 1X6IA 3AMZA 3QUCA 4EZ9A 2LKYA 3H8SA 1RG6A 4ED2A 3N97B 2QB1A 1MSWD 8ICLA 3MGVA 8ICHA 1OW5A 2E1FA 2H3ZA 1NZBA 4M9NA 3IV6A 4B9LA 2BZFA 4JMUA 4QNLA 3KBBA 2QLTA 1PVQA 4UAVA 3GV5B 3F5EA 5H2FU 1JMSA 1BPZA 2JXJA 1NK6A 2HHUA 2BKEA 2WAQC 3L4PA 2F44A 4R64A 7ICEA 2FPLA 3ZDAA 4CF3A 9ICEA 4JWNA 2PI5A 5KFBA 4Y2TA 4US8A 3PSPA 5KG0A 1RQNA 3I1YA 3BQ0A 1ZQOA 5F9NA 4ED8A 3BS5A 2PFOA 2R8IA 4QWAA 3GU3A 1RYSA 4O3NA 5KG4A 3ETLA 2WF7A 4QZIA 5EOZA 5J2GA 3FDSA 2W9BA 4CF5A
chains in the Genus database with same CATH topology
4OJPA 4P0QA 2JMGA 2W7OA 4OJ5A 3F53A 2HBJA 2GH1A 2JHDA 2K8CB 3IP4B 3GZFA 2KJ8A 4GFJA 3NRWA 1Z19A 1P7DA 2HOIA 2H3FA 2XICA 2K4EA 3H0MB 3LVVA 3N7RC 2M0NA 4NLBA 3HKZC 2H3QA 2ZIWB 3KZXA 2KNJA 1IIPA 2F77X 3N7PD 3F2DA 2ZXHA 3PSIA 5C0YA 2ZIXB 2HOQA 3LYSA 1KBUA 2ZXIA 2D6FC 2G09A 1ED1A 2HBMA 2KOBA 3M6ZA 2G06A 2R18A 2Q4TA 3O0FA 4O3MA 4OO1J 2KHQA 3CP8A 2RRDA 3M6KA 3PSFA 1ECWA 1Q3VA 2G08A 2KVCA 2JGAA 2ZIUA 3D2SA 2LBOA 3KFUF 2Y0SC 2LHTA 3IN5A 1MA7A 4FZNA 2ZIWA 4FZLA 2OM6A 4QIWC 2K8BB 4CDGA 3E0FA 2BDUA 2ZIXA 3ICXA 3C28A 2HMXA 1SZHA 1CRXA 2HBLA 2LKYA 3F2BA 2CRXA 4BX9C 2ZIUB 2E1EA 2YB1A 2XVTA 3ONNA 3L3FX 2PMZC 1PVPA 1A6SA 1ZQ1C 3SAHA 1PVRA 2JH7A 4NWIA 4U6PA 1TAMA 3HKZF 3PZPA 2H3VA 4FZMA 3MGVA 2RHFA 3IG5A 5CRXA 3IG8A 5KL8B 1URJA 3RF9A 3VCBA 3ALRA 5HR6A 2K8AA 4IC9A 2F76X 2KD1A 3K1ZA 2GOLA 2Z7JA 3N7SC 1UPHA 2W04A 3SMVA 4P0PA 2A3VA 2ZG6A 2G5HB 2E1FA 1NZBA 2H3ZA 2KV2A 4WJ3B 2MRLA 4C0ZA 2CPRA 4PL1A 1L6NA 2XI9A 4CGZA 1T94A 2HOFA 2F2AB 2K4IA 4JMUA 4PL2A 1Z1BA 2F8LA 2E5SA 2Y0SF 3LVWA 4QNLA 5T14A 4OJLA 3CRXA 4P0PB 1PVQA 2W03A 4QIWF 1OUQA 1F44A 3F5EA 2LYBA 2G5IB 3C29A 2KKPA 1D8BA 4BUGA 4U7CA 1XNSA 4AYBC 2KEYA 3F5AA 2WAQC 1YT3A 2DQNB 2K4HA 2N1RA 2RP5A 3DEEA 3H0RB 4OJOA 3SAFA 2DGZA 2G0AA 4NV0A 1GO3F 4QJFB 2VIXA 2KICA 2XIDA 3D2QA 2PMZF 3H0LB 2WAQF 3AL0B 2KHVA 2JH1A 2VJ5A 2K89A 4BJQA 3D2NA 1Q3UA 2OXOA 1XO0A 4ACOA 1WUDA 4OJ6A 3PSPA 3F2CA 2KKVA 2YX8A 2DF4B 2WB1C 2KJ5A 2HBKA 4KX5A 4FE3A 1DRGA 4KX3A 2G07A 2LYAA 3VC8A 4P0QB 2H3IA 2WB1F 2YB4A 5HR7A 2CN1A 4KMOB 3SAGA 3PSTA 3AQFA 5A0LA 3SQIA 5KL1B 4A8EA 3T79A 3RFAA 3GU3A 2OYYA 2ZIVA 2KJ9A 2MA1A 4ICAA 3M7DA 1HEKA 2VJ4A 4NLCA 3OPXA 4CRXA 2VKQA 3NUQA 3AQEA 2NV3A 1A0PA 4AYBF 2KIWA 2OH2A 3CYMA 2ZIVB 1HIWA 2W7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ECW A;  2JMG A;  2H3Z A;  1L6N A;  2K4I A;  2HMX A;  2LYA A;  4JMU A;  2H3F A;  2K4E A;  2H3I A;  2H3Q A;  2LYB A;  1A6S A;  4ICA A;  2K4H A;  2N1R A;  1TAM A;  1ED1 A;  1HEK A;  2H3V A;  2NV3 A;  4IC9 A;  2GOL A;  1UPH A;  1HIW A; 
#chains in the Genus database with same CATH topology
 4J9M A;  3V7L A;  2W3R A;  1ZQN A;  1D9D A;  3SV3 A;  2W9B B;  2K60 A;  2ATL A;  2YN4 A;  3MFH A;  4PZN A;  3LVV A;  2V4Q A;  4QW9 A;  3Q8Q B;  3RB0 A;  3HKZ C;  1SZP A;  4C4T A;  1BVS A;  3UM9 A;  4YR0 A;  2XGP A;  3NVV A;  4JWM A;  3PX6 A;  3C1Y A;  2E8N A;  2Q4T A;  5KFC A;  2OM6 A;  4O0I A;  3JPR A;  1S5L U;  2Y9U A;  4RPY A;  3OGU A;  2HBL A;  4BX9 C;  2E1E A;  5AM0 A;  4IQW A;  1VDV A;  3UXP A;  4PGY A;  1J2N A;  4HAI A;  2HVH A;  1RDF A;  1UT8 A;  3ALR A;  1C7Y A;  1BPY A;  1TAQ A;  3K1Z A;  3KTQ A;  3QU2 A;  2KFZ A;  4TUQ A;  1T7P A;  3I28 A;  8ICX A;  4P0P A;  1IXR A;  2G5H B;  2RDI A;  2PFQ A;  1Y88 A;  1XSP A;  4F91 B;  4CGZ A;  2A19 A;  4F4Z A;  4Z6F A;  4IQU A;  2E5S A;  5T14 A;  4P0P B;  1NK8 A;  4UAW A;  4J9K A;  3WKD A;  4R65 A;  2RP5 A;  3RB4 A;  3GIJ A;  5CB1 A;  2W3S A;  5AK3 A;  7ICF A;  4BJQ A;  3CW2 C;  8ICG A;  1UQV A;  2KG5 A;  3F2C A;  1ZQM A;  1ZQG A;  2KKV A;  3EWA A;  2HHX A;  5BOM A;  4KLL A;  4AP9 A;  1PK1 B;  5J0Q A;  3FYH A;  2DFL A;  2W9A A;  1S97 A;  5ALY A;  5KFU A;  3HIL A;  2PFP A;  5E79 U;  5ALV A;  3M7D A;  5J2I A;  5HHI A;  3TKA A;  2KIV A;  3SYZ A;  2JV3 A;  2XCA A;  4UAT A;  3LDA A;  3C2M A;  1IM4 A;  4KLI A;  1LKY A;  4Z6E A;  1X40 A;  2FMS A;  5JTI A;  4DSL A;  7ICN A;  2Y1J A;  3D6J A;  2H3F A;  2AJQ A;  4FS2 A;  1LKY B;  5KT2 A;  4EX6 A;  2KNJ A;  2J6T A;  2V4R A;  2IMW P;  5C0Y A;  2HOQ A;  1JX4 A;  4YD1 A;  2ASD A;  5ALR A;  4M47 A;  1KW4 A;  2G06 A;  3AEV A;  7ICT A;  4Y2X A;  5AKZ A;  2KHQ A;  3KHH A;  1ZQH A;  2G08 A;  3DDH A;  3AU6 A;  4US9 A;  1ZQX A;  1Z4N A;  1JUD A;  1NZP A;  1NK7 A;  2HMX A;  1D9F A;  9ICB A;  2KZ3 A;  4C7Y A;  2D8C A;  2XVT A;  4Y2P A;  9ICU A;  4F4Y A;  5KT6 A;  4EBD A;  2E8O A;  1URJ A;  3M1Y A;  4C8O A;  1YZ7 A;  4UB3 A;  3PR5 B;  1M6Y A;  4WJ3 B;  8ICB A;  1KKX A;  1N62 A;  4P4P A;  4PL1 A;  3HPO A;  4XA5 A;  5DB8 A;  4TUP A;  4QIW F;  4PZO A;  3B0X A;  1T3Q A;  3H40 A;  2DQN B;  5J0W A;  1DGS A;  4PJ0 U;  3SZ2 A;  3PO5 A;  3D2N A;  4F4K A;  4Q43 A;  2YX8 A;  2XY7 A;  4F4X A;  2M9N A;  4P0Q B;  5AM1 A;  5BPC A;  8ICP A;  1S0O A;  5AI8 A;  3T5J A;  4QWE A;  5JU5 A;  1Z00 A;  2ZUC A;  1ZQD A;  2R8G A;  5ALH A;  4EBC A;  4CRX A;  1SWV A;  2NV3 A;  5KG6 A;  4M9H A;  4EX7 A;  2AU0 A;  2UVR A;  1Z00 B;  5ALL A;  1X9S A;  4OJP A;  1PK3 A;  2WF6 A;  4R63 A;  1MQ3 A;  5AI5 A;  4CF4 A;  4Y2Y A;  2JRZ A;  3C23 A;  1X9W A;  3C21 A;  5ALK A;  2ZUD A;  1RXV A;  4Y2S A;  4DQR A;  1ZQU A;  4IR9 A;  4JK1 A;  5AI0 A;  5J8Y A;  3QU5 A;  1KSP A;  2KVS A;  2B0C A;  5HML A;  4RQ6 A;  3D2S A;  3MC1 A;  4DSK A;  4Q8F A;  2NRV A;  4RT2 A;  1ZD5 A;  2IOF K;  2ISO A;  2EZY A;  4GC7 A;  1PVR A;  4IRD A;  2H3V A;  4FZM A;  2KSO A;  3IG8 A;  5KFE A;  2LYH A;  5DLF A;  1COO A;  4LZD A;  2GWS A;  3ORY A;  2KV2 A;  2KSO B;  1F0M A;  5DLG A;  2WTF A;  4Y2U A;  3RH5 A;  4RT3 A;  5KT3 A;  1NJZ A;  4UAY A;  1KLN A;  5J2J A;  1XWL A;  2FDR A;  3TAC B;  1ZQI A;  1MN8 A;  3QUB A;  2AXT U;  2KHV A;  4USA A;  2YTU A;  4EYI B;  1A76 A;  1Q3U A;  1PZN A;  4ACO A;  5IIJ A;  1N48 A;  4NY8 A;  4I28 A;  3H8M A;  5ALP A;  3TFR A;  1JXL A;  4NL9 A;  2AGP A;  2QB0 A;  4RQ1 A;  4F2R A;  2J6S A;  3QU9 A;  4FBU A;  2QB0 B;  1SL0 A;  1KTQ A;  1XSN A;  4HYK A;  1HIW A;  4Z6D A;  2O6K A;  1T8E A;  1QLN A;  4YVZ A;  5KFV A;  2HOI A;  4NLG A;  4UB2 A;  2OHF A;  1RPL A;  3PY8 A;  1V97 A;  1IV8 A;  3QZ7 A;  3T5H A;  4KLE A;  4YCX A;  1KFS A;  4O3R A;  2P66 A;  3CP8 A;  3RH4 A;  4B9T A;  4J9P A;  3G6V A;  2JGA A;  4YR3 A;  2HHT A;  4FZN A;  2ZIW A;  5KFF A;  3U26 A;  3TAN A;  1WWV A;  3NVW A;  9ICM A;  3QUQ A;  3HT3 A;  3HX0 A;  4M9L A;  2UVV A;  3IG5 A;  4TQR A;  1L7O A;  1S0N A;  2KD1 A;  2HHS A;  4DOB A;  5KFK A;  2ZG6 A;  2AQ0 A;  2MRL A;  3KHG A;  3UXN A;  4PHD A;  2AH5 A;  1Z1B A;  3B9J A;  2DBY A;  1ZYQ A;  2BCS A;  4F5Q A;  3C5F A;  1UCV A;  4QZD A;  1UHU A;  4I2J A;  1XNS A;  2N1R A;  2IA6 A;  4Q8E A;  4NLN A;  1NKE A;  2B21 A;  4GLX A;  2E8P A;  5AKI A;  2VJ5 A;  4UAZ A;  2UVU A;  5KG5 A;  4RQ0 A;  2OXO A;  5IIO A;  5J2D A;  4DSF A;  1NK9 A;  5AK5 A;  4DOC A;  4FE3 A;  1RYU A;  3PR4 A;  1QSL A;  2MAX A;  2PXI A;  3SAG A;  3PST A;  4YMN A;  3SQI A;  4F93 B;  4IR1 A;  2RLT A;  4PHP A;  7ICP A;  2KP7 A;  2A1J A;  3OPX A;  2ZUB A;  1OUQ A;  3C1Z A;  2A1J B;  1S76 D;  4YFK A;  4RNN A;  4B6J A;  1U48 A;  1ZQT A;  4TQS A;  2C2D A;  2EZZ A;  5J0O A;  2VA3 A;  1B22 A;  2XIC A;  3H0M B;  3GIM A;  2A1A A;  2ZTC A;  3GV7 B;  4F2S A;  3NVZ A;  2ASL A;  2ZXH A;  3JPN A;  2HVI A;  1RM6 C;  4PHE A;  4C4S A;  3RBE A;  5DQH A;  5AM2 A;  3MGI A;  3SEN A;  4DS5 A;  2RDJ A;  8ICY A;  3KFU F;  1V9P A;  3WK9 A;  4O3O A;  1V85 A;  1ZQJ A;  3OSP A;  2NO4 A;  1SZH A;  1L7M A;  4R8U B;  3F2B A;  1SKW A;  2DPI A;  8ICR A;  2HCF A;  5J0U A;  1XSL A;  3ONN A;  2LM4 A;  5KFZ A;  3NGD A;  2VA8 A;  1X9X A;  4U6P A;  5AK4 A;  4DFK A;  3BZC A;  3PZP A;  4YQW A;  4RQN A;  5ALI A;  2A3V A;  5KFP A;  4ECU A;  4YMM A;  4JV1 A;  2R8H A;  4DL2 A;  2HHW A;  3BJY A;  9ICC A;  1S10 A;  1ARO P;  4M2Y A;  3V72 A;  5G5H A;  1X66 A;  3OHB A;  2EDU A;  4Q44 A;  5KTQ A;  2G5I B;  4UB8 U;  2C2E A;  2LI6 A;  5J8Y C;  1S8O A;  3V6K A;  9ICN A;  5KFR A;  1GO3 F;  1QH9 A;  1CEZ A;  3ISB A;  2WF5 A;  1ZET A;  1ZQS A;  1WUD A;  3WKC A;  3IDW A;  1IG6 A;  4M9G A;  4F71 A;  2JZB B;  4KX3 A;  2JEJ A;  5F9L A;  2Q0Z X;  2QAR A;  4F4W A;  4KMO B;  2W43 A;  4KMU A;  5GTI U;  3UMB A;  3MR3 A;  3MDA A;  3BZK A;  7ICM A;  2VJ4 A;  4KLM A;  2QAR B;  4QZG A;  1ZQK A;  5BOL A;  5KFM A;  3QU7 A;  5ALM A;  2PFN A;  4MFC A;  4P2H A;  4Y2Q A;  5AKL A;  3GII A;  1KN5 A;  5L1K A;  1EXN A;  3F2D A;  1BPB A;  4DSJ A;  4GXJ A;  3M8R A;  4DFP A;  2J6U A;  3A0H U;  3O0F A;  5J2F A;  4NJ8 A;  2ZTE A;  2NYV A;  1JRO A;  2LHT A;  1NJX A;  4DQP A;  3M8S A;  1FFU A;  3A0B U;  2OEH A;  4CDG A;  2KN7 A;  4NL9 C;  5DDM A;  3QX7 A;  4DQS A;  1ZQ1 C;  8ICJ A;  3E2E A;  3T3F A;  1ZOL A;  1MC8 A;  4RQ8 A;  5HR6 A;  2XO7 A;  3EW9 A;  3EPI A;  2BR0 A;  4UW9 A;  3H4B A;  1NKB A;  3EYZ A;  7ICK A;  3C2L A;  2E3T A;  2HOF A;  1NJW A;  5KFO A;  2FMQ A;  3QEA Z;  4C80 A;  3GQC A;  4LJX A;  5KAI U;  3ZD8 A;  4J9L A;  2DL0 A;  3D2Q A;  4UQG A;  2PMZ F;  5KFX A;  2WAQ F;  3GIL A;  2DKZ A;  4O5E A;  1UA1 A;  1F5S A;  3OTQ A;  1NK5 A;  3KKA A;  2HHQ A;  4RZR A;  2ZJA A;  4KX5 A;  9ICK A;  1FIQ A;  3NS1 A;  1KFT A;  4JUZ A;  5III A;  3B0Y A;  4QZF A;  3T79 A;  4UBC A;  3ZDD A;  2ZIV A;  2MA1 A;  5DQG A;  3BS7 A;  2F1H A;  1RYR A;  7ICQ A;  1XU4 A;  2EZX A;  5KFY A;  5KFN A;  4MF8 A;  1PK1 A;  2YY6 A;  2ZIV B;  1X9M A;  3QU4 A;  4FFD A;  1ZRM A;  3UQ0 A;  9ICA A;  4DL7 A;  1XC9 A;  9ICX A;  1Z19 A;  3GZF A;  1WCN A;  4I2D A;  2FLN A;  1OXJ A;  3V6H A;  2HHV A;  4ELT A;  2H3Q A;  4O3S A;  2ZIX B;  2ZXI A;  2ZTD A;  4PHA A;  4ED0 A;  1QSS A;  2OWO A;  1BGX T;  1ZXI A;  3CNH A;  8ICM A;  4ECX A;  5ALZ A;  9ICF A;  3WU2 U;  4QIW C;  1ZJN A;  3RJG A;  4YN4 A;  9ICW A;  5CHG A;  4DLG A;  3L3F X;  4I2H A;  5J0P A;  2BGW A;  2XY6 A;  3RJJ A;  4BWJ A;  3UPQ A;  3NTU A;  1ZQY A;  1N60 A;  4CE6 A;  4F92 B;  5AI6 A;  4C4R A;  3AN1 A;  9ICP A;  1ZRN A;  5ALX A;  1NOM A;  9ICV A;  4C8M A;  5HHH A;  2F2A B;  3QXG A;  3UMC A;  1TK8 A;  4RUC A;  7ICJ A;  1VJ5 A;  1BNO A;  3C29 A;  2KKP A;  3PW2 A;  2KEY A;  7ICV A;  3OHA A;  4OJO A;  1P7D A;  1SIJ A;  4ECY A;  2GLE A;  2VIX A;  3H0L B;  7ICO A;  4Y2V A;  4QWB A;  4J9N A;  1NK4 A;  4RQ2 A;  2BCR A;  1ZQR A;  4DL4 A;  4DLE A;  4EEY A;  1SV0 A;  2WB1 C;  2HBK A;  1DRG A;  1Z4O A;  2LYA A;  5CA7 A;  4J9O A;  1LB2 B;  1YZ6 A;  5AI4 A;  3AQF A;  3KD3 A;  3MDC A;  8ICU A;  3Q8S B;  1SB3 C;  5EE9 A;  3L5K A;  4ICA A;  1L3V A;  4ELV A;  4RQ3 A;  3AQE A;  4P0Q A;  4KIT B;  4C8K A;  4B9M A;  4K4H A;  5B66 U;  2HDO A;  4I2I A;  2HBJ A;  3TAP A;  1D8Y A;  2P6R A;  3M9M B;  4DWI A;  8ICN A;  3MR5 A;  1L8L A;  1DK2 A;  5DB9 A;  3EUB 2;  4C8N A;  8ICC A;  2HBM A;  3QZ8 A;  3MFI A;  5KFW A;  3HWT A;  1SWW A;  5TIS U;  3Q8P B;  5J0T A;  1Q3V A;  1SGG A;  2AGO A;  2IBK A;  3PX4 A;  5D4B A;  2BDU A;  3RJI A;  4CCH A;  2EAP A;  4EBE A;  4GIB A;  4O9M A;  2YB1 A;  1A6S A;  2R8J A;  2MSN A;  3TAD A;  1NKC A;  5AIC A;  3MBY A;  3KHR A;  2RHF A;  3H4D A;  1K1S A;  3BQT A;  4KLT A;  7ICS A;  5DQI A;  4RQ5 A;  4DFM A;  4B9N A;  4RUA A;  2R8K A;  2AQ4 A;  4NXZ A;  3UQ2 A;  3PW7 A;  4RPZ A;  1HUZ A;  4QZ9 A;  3QE9 Y;  2K4H A;  2KZZ A;  2G0A A;  5L1I A;  2IOF A;  2KIC A;  5J2H A;  1JN3 A;  2BCV A;  4M04 A;  5TZV A;  9ICJ A;  4NLK A;  2AHO B;  4KN4 A;  2FJ6 A;  2DF4 B;  4CNQ A;  2DPJ A;  3WKE A;  1BPD A;  5EE1 A;  4YR2 A;  3AU2 A;  4UB5 A;  2BCU A;  4M0A A;  1LV5 A;  3QNM A;  4UB4 A;  5CP2 A;  2I6X A;  1ZQV A;  5ALN A;  1A0P A;  2D3D A;  2OH2 A;  3WK7 A;  2NRZ A;  5AM4 A;  1U45 A;  4I2C A;  3PW0 A;  4C8L A;  2W7O A;  4DSI A;  4TUS A;  4YMO A;  3AM9 A;  2DUY A;  4ED7 A;  3RR7 A;  2IHM A;  5JUM A;  3NVY A;  4QZ8 A;  7ICI A;  2KOB A;  3M6Z A;  2Y1I A;  1SL2 A;  8ICO A;  3KKA C;  1ECW A;  2XGQ A;  4DQQ A;  4PPX A;  1MA7 A;  1T4G A;  3I76 A;  2ZJ8 A;  3TAQ A;  5KFH A;  4KLF A;  3K4G A;  5CWR A;  1QTM A;  3M9N B;  1SKR A;  1JAL A;  4MHV A;  2KE7 A;  1SXE A;  3JPO A;  5ALO A;  2W11 A;  2FMP A;  4DQI A;  3RF9 A;  2HSZ A;  2YQE A;  8ICA A;  3RRG A;  1X6J A;  4XQ8 A;  2I9G A;  5K4L A;  2KMD A;  1T94 A;  2BCQ A;  4Y2R A;  3UMG A;  4KTQ A;  2Y0S F;  8ICK A;  3MGH A;  2B6G A;  4ED1 A;  1H38 A;  1ZQE A;  3WK5 A;  3RH6 A;  4U7C A;  5DGA A;  4I29 A;  4RU9 A;  2DGZ A;  3WK4 A;  4QZB A;  5DG8 A;  1MQ2 A;  4DF4 A;  2WF9 A;  4MEX A;  4J03 A;  4OJ6 A;  9ICO A;  2ESE A;  4YXJ A;  4ECT A;  2KFN A;  5G5G A;  4XUS A;  3EZ5 A;  4A8E A;  3IRU A;  2IOH A;  2EH9 A;  3NRZ A;  1JRP A;  9ICG A;  1DGJ A;  2PKE A;  5EWF A;  2VKQ A;  3PW4 A;  4AYB F;  3RJK A;  2UVW A;  2KZM A;  3PVX A;  3MR6 A;  3F53 A;  5KFL A;  3KHL A;  3HJE A;  1TK0 A;  1WWU A;  1WCL A;  3BQ1 A;  3N7P D;  1KRP A;  3SV4 A;  3RTV A;  1N61 A;  5JRT A;  1V38 A;  4DF8 A;  4OD0 A;  3Q8K A;  5KFJ A;  1SV0 C;  4F5O A;  3ZDC A;  2BQU A;  4O3Q A;  3TFS A;  3PNC A;  3C28 A;  1FFV A;  1L8O A;  3GFK B;  4G9B A;  4QWC A;  1A77 A;  1J97 A;  3Q8L A;  1O08 A;  3LWM A;  4FO6 A;  1ZQW A;  1DOQ A;  7ICU A;  5ALJ A;  5J0R A;  2MU2 A;  4R8U A;  8ICI A;  3BDP A;  3T5K A;  1RZT A;  1BPE A;  4FBT A;  3HRD D;  5KFA A;  2FLP A;  1COK A;  5KAF U;  3AUO A;  8ICS A;  2OCE A;  2WHE A;  7ICL A;  1WYG A;  9ICI A;  4IS7 A;  3DEE A;  3TQ1 A;  4ECR A;  1L3T A;  3SEI A;  2NRW A;  3ZDB A;  3ZI4 A;  4DL3 A;  4UAU A;  1TKD A;  5L1L A;  2HI0 A;  5DGB A;  1SKS A;  3RJH A;  1HUO A;  2G07 A;  3GV8 B;  1L7N A;  2BPC A;  8ICZ A;  1ZQP A;  4DL6 A;  3TAD C;  2OYY A;  1HEK A;  2LM1 A;  9ICS A;  2ES6 A;  2EAO A;  4UB1 A;  4JV2 A;  4LVS A;  2JZB A;  3V7J A;  3ED5 A;  2DKX A;  1Q8K A;  1ZD2 P;  5AI9 A;  3ZDE A;  4I2A A;  4DCC A;  5D49 A;  2K4E A;  3N7R C;  4NLB A;  1FEZ A;  3H8W A;  3KZX A;  1N5X A;  1IIP A;  2ISP A;  4I27 A;  2KK0 A;  4ELU A;  2W9C A;  1KDH A;  5J0X A;  5KG2 A;  5J0Y A;  4BDP A;  2NO5 A;  1XO1 A;  9ICL A;  3SR6 A;  2RQ5 A;  4DL5 A;  3PSF A;  3G6Y A;  2W9C B;  4BXO A;  2LBO A;  5AKE A;  1QSY A;  4FZL A;  2I5H A;  3OSN A;  2K8B B;  2JEI A;  4R66 A;  9ICQ A;  1CRX A;  1ZJM A;  4J9Q A;  3E58 A;  4BXO B;  3Q8M A;  9ICR A;  4I2E A;  2QKQ A;  3TI0 A;  2PMZ C;  4F3O A;  5ALD A;  3RR8 A;  3WK6 A;  2F76 X;  2Z7J A;  3N7S C;  3FAH A;  8ICV A;  1VLB A;  2Y9T A;  5J2E A;  4OCZ A;  5ALU A;  4F8R A;  4O5K A;  2E8M A;  3N28 A;  2JEF A;  1U9L A;  3THV A;  1D8B A;  4Y2J A;  1C20 A;  3SAF A;  2V9W A;  4QJF B;  4QZE A;  5KFD A;  2WFA A;  3BS5 B;  1JIH A;  4QZA A;  3ZD9 A;  1AQ6 A;  2ASJ A;  4F5N A;  4DEZ A;  5ALS A;  5J2B A;  4KLQ A;  3KZI U;  3BQ7 A;  1K5O A;  1Z3E B;  4QW8 A;  4MF2 A;  5HR7 A;  5KL1 B;  3V7K A;  2FPK A;  4UB6 U;  2KJ9 A;  4K4G A;  1UT5 A;  4NLC A;  5AKJ A;  3NUQ A;  4LZG A;  1KEJ A;  4J9S A;  3M9O B;  5B5E U;  5DKW A;  2DWQ A;  1ZD4 A;  2YMP A;  3IP4 B;  4MEY A;  3HW8 A;  1O03 A;  3EPG A;  8ICT A;  5EE0 A;  4GXK A;  2D6F C;  1L3S A;  3C5G A;  1ED1 A;  3NAS A;  3RBD A;  2XC9 A;  2ZJ5 A;  5HNK A;  4UAS A;  2R18 A;  4QWD A;  3GDX A;  5KT4 A;  1SXD A;  8ICF A;  2ZIX A;  1NNL A;  4IRC A;  2CRX A;  1X2I A;  3ISD A;  1TFR A;  1S77 D;  3HKZ F;  5IIK A;  3HP6 A;  1QQ7 A;  1N56 A;  3R9K A;  1T3N A;  4P4O A;  4O5C A;  4I2F A;  4PL2 A;  4G3I A;  3PO4 A;  3LVW A;  3BQ2 A;  3J81 j;  1QCK A;  1S0M A;  4IQT A;  3H0R B;  3PX0 A;  5AM5 A;  4M9J A;  2JH1 A;  2K89 A;  2XCP A;  5AIB A;  1N2X A;  1RQL A;  2FPM A;  1ZQQ A;  4UBB A;  1TAU A;  5EE3 A;  3N4M B;  4ECQ A;  4TUR A;  4KLG A;  1L7P A;  4F5R A;  5A0L A;  2GO7 A;  1N5W A;  2HW3 A;  5AM3 A;  4KN7 A;  4IL6 U;  2JMG A;  4DS4 A;  3RAX A;  4OJ5 A;  5L1J A;  1TVA A;  2F1I A;  1KBU A;  4IRK A;  2KTQ A;  5D46 A;  5KG3 A;  5DB7 A;  2EAM A;  5GTH U;  5J29 A;  1KL9 A;  5KFG A;  2P6U A;  4ECS A;  4PGX A;  1JI7 A;  1D8L A;  5AKY A;  3JPS A;  4ED3 A;  1S0V A;  2FLL A;  3PML A;  4EEN A;  2ZIU A;  4BGD A;  2WF8 A;  1QQ6 A;  4KLH A;  1B4F A;  4Z6C A;  5ALE A;  2F3N A;  2ZIU B;  2W54 A;  4ECZ A;  2W55 A;  7ICG A;  4RQ7 A;  4KLJ A;  3SAH A;  5KNI A;  2ALZ A;  3RRH A;  4JB3 A;  2XY5 A;  2ODG A;  2W04 A;  4JV0 A;  1NJY A;  4F5P A;  5DG7 A;  2BPG A;  5ALQ A;  4E0D A;  4YP3 A;  2XI9 A;  4KLO A;  5IIL A;  2K4I A;  8ICQ A;  2F8L A;  3CRX A;  4OJL A;  2YML A;  5CR0 A;  3T5L A;  1F44 A;  5ALF A;  1ZQZ A;  4PH5 A;  2FI1 A;  3GIK A;  1ZQL A;  5DDY A;  3K75 D;  4KLD A;  1XO0 A;  3UXO A;  1X42 A;  5L9X A;  1TK5 A;  1Z1V A;  4MFA A;  5ALW A;  2WB1 F;  9ICH A;  2F1J A;  2P35 A;  3RFA A;  2W9M A;  1ZQB A;  5KG7 A;  3MAB A;  5CJ7 A;  3K1R B;  4NM1 A;  3ETR A;  4EYH B;  3IM1 A;  4F50 A;  1UA0 A;  1QQ5 A;  2BHN A;  2W7P A;  2VAN A;  4BWM A;  2LPE A;  2GH1 A;  4GFJ A;  1XS9 D;  4IQV A;  4K4I A;  3NRW A;  2JEG A;  1HJP A;  3QUT A;  3PSI A;  2L5Y A;  5AKG A;  4OO1 J;  4O3M A;  4RPX A;  5KFT A;  1BNP A;  2RRD A;  4KLS A;  1L5U A;  4NLZ A;  3V6J A;  2Y0S C;  3PV8 A;  1U47 A;  3ICX A;  1S9F A;  5ALT A;  2CXY A;  4YXM A;  5CEH A;  2EQY A;  5J2K A;  3OJS A;  5L1M A;  2JH7 A;  2K4P A;  1TAM A;  4DOA A;  2YMQ A;  4I2B A;  1PUZ A;  3VCB A;  2K8A A;  4IC9 A;  1UPH A;  5ALG A;  4YD2 A;  3C2K A;  2IHN A;  1ZQA A;  4C0Z A;  2CPR A;  2H5X A;  1L6N A;  1CI4 A;  4GXI A;  1TV9 A;  4FS1 A;  2I1Q A;  4YG2 A;  3H7I A;  4BUG A;  4AYB C;  8ICE A;  1YT3 A;  3OJU A;  4NV0 A;  1KQQ A;  3AL0 B;  1NI3 A;  5DBA A;  2PI4 A;  4F72 A;  4ZH4 A;  2BDP A;  4ED6 A;  3QYP A;  4DFD A;  3VC8 A;  3DV9 A;  4XRH A;  1WG8 A;  2H3I A;  2YB4 A;  3SI8 A;  2CN1 A;  9ICT A;  5C5J A;  4RQ4 A;  2EAN A;  3RJF A;  1DXS A;  2VA2 A;  4P4M A;  1BPX A;  2KIW A;  2NRT A;  1U4B A;  4ECW A;  2LMR A;  3H8J A;  2JHD A;  2K8C B;  4QZH A;  4EEK A;  2KJ8 A;  5DG9 A;  1JXE A;  1KFD A;  2M0N A;  1CUK A;  1Q46 A;  2ZIW B;  2F77 X;  4Q45 A;  4EZ6 A;  4NM2 A;  3SD7 A;  3RB3 A;  1L3U A;  2G09 A;  3WKA A;  4DO9 A;  1LVH A;  5KG1 A;  4B9V A;  2C22 A;  3KOO A;  2FE9 A;  2KVC A;  3FC4 A;  1B43 A;  1DK3 A;  4UAR A;  2W8L A;  3E0F A;  1SL1 A;  5KT5 A;  5KT7 A;  5J2C A;  1U49 A;  5IIM A;  4RQM A;  1PVP A;  4NWI A;  1N63 A;  5DBB A;  5AKK A;  5CRX A;  5KL8 B;  3LK9 A;  2GOL A;  4MFF A;  2NRX A;  4B9S A;  4X5V A;  3SMV A;  1ZD3 A;  3Q8R B;  2BPF A;  5J0S A;  5IIN A;  5KFI A;  3FM9 A;  1NK0 A;  4EEL A;  3TAR A;  2W03 A;  3G6X A;  1ZQC A;  4RNM A;  2LYB A;  4DSE A;  4M6W A;  5HMM A;  3F5A A;  3WKB A;  4J9R A;  2XID A;  1SV4 A;  2W8K A;  2AGQ A;  4M6W B;  7ICR A;  5AIA A;  4DFJ A;  5AKX A;  2KJ5 A;  1ZQF A;  3JPP A;  5EWG A;  1FO4 A;  5DB6 A;  4I2G A;  5KFQ A;  5AK6 A;  2C28 A;  2YMM A;  3LWL A;  4QZC A;  3PMN A;  2BQR A;  5J2A A;  5DBC A;  4O3P A;  2MUT A;  5AHX A;  4RNO A;  3PW5 A;  3RB6 A;  3RAQ A;  1TE2 A;  3CYM A;  1RXW A;  2MUT B;  1J2M A;  2F8K A;  8ICW A;  1K1Q A;  3JPT A;  3RJE A;  3JPQ A;  7ICH A;  3MR2 A;  3WK8 A;  3IHQ B;  5KFS A;  2BQ3 A;  3LYS A;  5F3X B;  4ECV A;  4KLU A;  4B9U A;  4ZOH C;  4C7Z A;  4PGQ A;  5AKH A;  5EWE A;  3M6K A;  1B0X A;  5FP0 A;  5HP4 A;  4GC6 A;  3IN5 A;  2JR5 A;  3S6J A;  3ISC A;  3QEB Z;  2C2R A;  1X6I A;  3AMZ A;  3QUC A;  4EZ9 A;  2LKY A;  3H8S A;  1RG6 A;  4ED2 A;  3N97 B;  2QB1 A;  1MSW D;  8ICL A;  3MGV A;  8ICH A;  1OW5 A;  2E1F A;  2H3Z A;  1NZB A;  4M9N A;  3IV6 A;  4B9L A;  2BZF A;  4JMU A;  4QNL A;  3KBB A;  2QLT A;  1PVQ A;  4UAV A;  3GV5 B;  3F5E A;  5H2F U;  1JMS A;  1BPZ A;  2JXJ A;  1NK6 A;  2HHU A;  2BKE A;  2WAQ C;  3L4P A;  2F44 A;  4R64 A;  7ICE A;  2FPL A;  3ZDA A;  4CF3 A;  9ICE A;  4JWN A;  2PI5 A;  5KFB A;  4Y2T A;  4US8 A;  3PSP A;  5KG0 A;  1RQN A;  3I1Y A;  3BQ0 A;  1ZQO A;  5F9N A;  4ED8 A;  3BS5 A;  2PFO A;  2R8I A;  4QWA A;  3GU3 A;  1RYS A;  4O3N A;  5KG4 A;  3ETL A;  2WF7 A;  4QZI A;  5EOZ A;  5J2G A;  3FDS A;  2W9B A;  4CF5 A; 
#chains in the Genus database with same CATH homology
 4OJP A;  4P0Q A;  2JMG A;  2W7O A;  4OJ5 A;  3F53 A;  2HBJ A;  2GH1 A;  2JHD A;  2K8C B;  3IP4 B;  3GZF A;  2KJ8 A;  4GFJ A;  3NRW A;  1Z19 A;  1P7D A;  2HOI A;  2H3F A;  2XIC A;  2K4E A;  3H0M B;  3LVV A;  3N7R C;  2M0N A;  4NLB A;  3HKZ C;  2H3Q A;  2ZIW B;  3KZX A;  2KNJ A;  1IIP A;  2F77 X;  3N7P D;  3F2D A;  2ZXH A;  3PSI A;  5C0Y A;  2ZIX B;  2HOQ A;  3LYS A;  1KBU A;  2ZXI A;  2D6F C;  2G09 A;  1ED1 A;  2HBM A;  2KOB A;  3M6Z A;  2G06 A;  2R18 A;  2Q4T A;  3O0F A;  4O3M A;  4OO1 J;  2KHQ A;  3CP8 A;  2RRD A;  3M6K A;  3PSF A;  1ECW A;  1Q3V A;  2G08 A;  2KVC A;  2JGA A;  2ZIU A;  3D2S A;  2LBO A;  3KFU F;  2Y0S C;  2LHT A;  3IN5 A;  1MA7 A;  4FZN A;  2ZIW A;  4FZL A;  2OM6 A;  4QIW C;  2K8B B;  4CDG A;  3E0F A;  2BDU A;  2ZIX A;  3ICX A;  3C28 A;  2HMX A;  1SZH A;  1CRX A;  2HBL A;  2LKY A;  3F2B A;  2CRX A;  4BX9 C;  2ZIU B;  2E1E A;  2YB1 A;  2XVT A;  3ONN A;  3L3F X;  2PMZ C;  1PVP A;  1A6S A;  1ZQ1 C;  3SAH A;  1PVR A;  2JH7 A;  4NWI A;  4U6P A;  1TAM A;  3HKZ F;  3PZP A;  2H3V A;  4FZM A;  3MGV A;  2RHF A;  3IG5 A;  5CRX A;  3IG8 A;  5KL8 B;  1URJ A;  3RF9 A;  3VCB A;  3ALR A;  5HR6 A;  2K8A A;  4IC9 A;  2F76 X;  2KD1 A;  3K1Z A;  2GOL A;  2Z7J A;  3N7S C;  1UPH A;  2W04 A;  3SMV A;  4P0P A;  2A3V A;  2ZG6 A;  2G5H B;  2E1F A;  1NZB A;  2H3Z A;  2KV2 A;  4WJ3 B;  2MRL A;  4C0Z A;  2CPR A;  4PL1 A;  1L6N A;  2XI9 A;  4CGZ A;  1T94 A;  2HOF A;  2F2A B;  2K4I A;  4JMU A;  4PL2 A;  1Z1B A;  2F8L A;  2E5S A;  2Y0S F;  3LVW A;  4QNL A;  5T14 A;  4OJL A;  3CRX A;  4P0P B;  1PVQ A;  2W03 A;  4QIW F;  1OUQ A;  1F44 A;  3F5E A;  2LYB A;  2G5I B;  3C29 A;  2KKP A;  1D8B A;  4BUG A;  4U7C A;  1XNS A;  4AYB C;  2KEY A;  3F5A A;  2WAQ C;  1YT3 A;  2DQN B;  2K4H A;  2N1R A;  2RP5 A;  3DEE A;  3H0R B;  4OJO A;  3SAF A;  2DGZ A;  2G0A A;  4NV0 A;  1GO3 F;  4QJF B;  2VIX A;  2KIC A;  2XID A;  3D2Q A;  2PMZ F;  3H0L B;  2WAQ F;  3AL0 B;  2KHV A;  2JH1 A;  2VJ5 A;  2K89 A;  4BJQ A;  3D2N A;  1Q3U A;  2OXO A;  1XO0 A;  4ACO A;  1WUD A;  4OJ6 A;  3PSP A;  3F2C A;  2KKV A;  2YX8 A;  2DF4 B;  2WB1 C;  2KJ5 A;  2HBK A;  4KX5 A;  4FE3 A;  1DRG A;  4KX3 A;  2G07 A;  2LYA A;  3VC8 A;  4P0Q B;  2H3I A;  2WB1 F;  2YB4 A;  5HR7 A;  2CN1 A;  4KMO B;  3SAG A;  3PST A;  3AQF A;  5A0L A;  3SQI A;  5KL1 B;  4A8E A;  3T79 A;  3RFA A;  3GU3 A;  2OYY A;  2ZIV A;  2KJ9 A;  2MA1 A;  4ICA A;  3M7D A;  1HEK A;  2VJ4 A;  4NLC A;  3OPX A;  4CRX A;  2VKQ A;  3NUQ A;  3AQE A;  2NV3 A;  1A0P A;  4AYB F;  2KIW A;  2OH2 A;  3CYM A;  2ZIV B;  1HIW A;  2W7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...