2E8OA

Solution structure of the n-terminal sam-domain of the sam domain and hd domain containing protein 1 (dendritic cell-derived ifng-induced protein) (dcip) (monocyte protein 5) (mop-5)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
GSSGSSGSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM domain and HD domain-containing protein 1
publication title Solution structure of the N-terminal SAM-domain of the SAM domain and HD domain containing protein 1 (Dendritic cell-derived IFNG-induced protein) (DCIP) (Monocyte protein 5) (MOP-5)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8oA01
3IDWA 3BS5B 2KMDA 5JTIA 2E8NA 2KSOB 2JV3A 1SXDA 5JU5A 2LMRA 3SENA 1WWUA 4PZOA 2DL0A 1PK1A 2QB0B 4MHVA 1PK3A 1OW5A 5L1MA 2K60A 2QARB 2KSOA 2Y9UA 2E8OA 2EANA 3HILA 2YTUA 1X9XA 1OXJA 5J8YA 2GLEA 5JRTA 2QARA 2E8MA 2L5YA 2Y9TA 1B0XA 4RQNA 2KE7A 4RQMA 3BS5A 2DKXA 1JI7A 1X66A 2D3DA 2D8CA 4IS7A 2F44A 1COKA 1LKYB 2EAPA 1SXEA 5KNIA 1V85A 2QB0A 2F3NA 3SEIA 3BS7A 2LPEA 1B4FA 3H8MA 5F3XB 2FE9A 1PK1B 1UQVA 1Z1VA 4PZNA 1UCVA 2B6GA 1SV0C 2EAMA 1X40A 2ESEA 3KKAC 4NJ8A 2ES6A 3BQ7A 1V38A 1WWVA 2F8KA 1SGGA 1F0MA 1SV0A 1KW4A 3KKAA 3TADC 4NL9C 1DXSA 2KG5A 2QKQA 2KIVA 3TADA 4NL9A 2DKZA 2E8PA 2K4PA 3K1RB 3TACB 1RG6A 1SV4A 2EAOA 2QB1A 5J8YC 1LKYA
chains in the Genus database with same CATH superfamily
3FYHA 4CNQA 2G5HB 3QNMA 2DUYA 2BZFA 1N62A 4F4ZA 4EBDA 5C5JA 4J9KA 4NV0A 3TI0A 4KX5A 2HMXA 2K4EA 3NASA 3LDAA 4FS2A 4C80A 5AICA 2F1HA 1XC9A 5KFOA 5CWRA 2KHVA 2KSOA 4KX3A 4R8UB 3AL0B 4Y2SA 4Y2JA 2FLPA 1DGJA 4G9BA 1NJWA 1ZQSA 4AYBF 1SWWA 7ICTA 2WF8A 5F9LA 4ZH4A 3TQ1A 1BNPA 3G6XA 4CDGA 3BJYA 2YMPA 3FC4A 3JPOA 5AKJA 2MAXA 1NZBA 2BCRA 4XRHA 5KFLA 1TFRA 5IIKA 4KLIA 2ZUDA 4M0AA 2HHTA 1MC8A 1L8OA 4Q45A 5KFCA 2BQUA 1VJ5A 2AGOA 2MA1A 2OCEA 5J0WA 4MFAA 2QB0A 3M7DA 2E1FA 2OEHA 2R8KA 5AKYA 1Z00A 3B0XA 2R18A 1Z1VA 2D6FC 3BQ0A 4B9MA 1J2MA 1S77D 3PY8A 4C8MA 2NRZA 3BQ7A 3M1YA 3WK9A 4F91B 9ICPA 5KFRA 4QZIA 4RQ8A 2W55A 1QSLA 1VDVA 4DL2A 3MGHA 4Y2UA 5L1LA 4ACOA 4MFFA 2JMGA 1XSLA 3QUTA 4DQSA 2NV3A 1KKXA 3TACB 1RG6A 1ZQHA 3PSTA 2K8AA 3NRZA 5KFNA 7ICKA 1TE2A 3M8SA 1ZQVA 3M9NB 2E3TA 3L5KA 4M9LA 4QWBA 2GOLA 3C21A 5G5GA 2K4HA 4DQPA 1L7PA 5CHGA 1XS9D 1L3UA 8ICVA 1Z4OA 3MR2A 1T3QA 2ZIWB 3T5HA 4RPZA 2BPCA 2Y9UA 2RHFA 2FLLA 8ICNA 4F4YA 2JEJA 2Y0SF 2ZTDA 2MU2A 3V6KA 4EEKA 1IM4A 4EZ6A 4IQTA 2W03A 3QX7A 3TKAA 4ECXA 4F8RA 3SV3A 5J0QA 5DLFA 2YX8A 5KFHA 4R65A 1L8LA 2JGAA 3ALRA 3GFKB 4RQ4A 3JPPA 3PX6A 1A6SA 1B43A 4KTQA 1S0OA 2K8CB 4GXIA 2C28A 5ALOA 2D3DA 2D8CA 5DQHA 4GFJA 4KMOB 1L5UA 2W9CB 3RB0A 2BDUA 3A0BU 1A76A 3SYZA 1QSSA 5J0XA 4EX7A 1FFVA 2HHSA 4DF8A 1ZD5A 3DDHA 4I27A 2EAMA 1S0VA 4C8LA 5IILA 4F5RA 4ECTA 3ISCA 2ZIUA 4ECYA 5DBAA 3KKAA 4YXJA 3AEVA 4CGZA 3FAHA 3OSNA 3PW4A 4NM1A 2DKZA 2DFLA 1MQ3A 3QU5A 7ICFA 3QUCA 4C4RA 1KN5A 5J8YC 5HMLA 3F53A 5CP2A 4DL3A 4YP3A 1ZQWA 2ZUBA 2KVCA 4NLGA 9ICJA 3QU7A 2JV3A 9ICXA 4K4IA 1S0MA 1SZPA 1IG6A 2NRVA 4Z6EA 8ICTA 1L6NA 5KTQA 5AIAA 7ICNA 2H5XA 8ICSA 5AM2A 2K60A 4Q8EA 5J2IA 4FFDA 4F5QA 2E8OA 1FIQA 3PW2A 3SD7A 5IIJA 4EBCA 4DSIA 2FPKA 1RQNA 4UB6U 2XCAA 1O08A 1L3SA 5DGBA 4KMUA 1QLNA 9ICMA 1D8LA 1N5XA 1Z4NA 2DF4B 2JEIA 4UB8U 2I1QA 2HVIA 1QQ6A 2RLTA 3UXPA 1COKA 3JPSA 5HNKA 1V97A 2P35A 3NS1A 1V85A 3RBDA 1HUOA 4IL6U 4F71A 2J6SA 4UASA 3MBYA 5J2DA 5KFFA 3PO4A 5BOMA 3WKCA 2FPMA 3IG5A 1X40A 1ZQAA 2BDPA 1V38A 3DEEA 1Q8KA 4PJ0U 4X5VA 2V9WA 1ZJNA 9ICAA 2QKQA 4C4TA 1S10A 3BZCA 3RRGA 2P66A 4ECVA 3M8RA 2HCFA 2QB1A 2IOHA 3PZPA 4F93B 2HDOA 3IDWA 1KFDA 1ZQBA 3OTQA 3WK5A 5HR6A 4DOBA 1VLBA 2KNJA 1TK0A 3PR4A 5D49A 1U49A 1XO0A 1JMSA 4ICAA 2ZTEA 3UMGA 4NY8A 1FEZA 2ALZA 5AKGA 1SB3C 1OW5A 3C2LA 2HHWA 4EELA 1F44A 3RJGA 1TAMA 3PV8A 2KK0A 2R8GA 2W8KA 5DBBA 4RPXA 2HBLA 1OXJA 5KFVA 2JZBB 3KZIU 2AGQA 4BXOA 2HHUA 2NO4A 2XIDA 3OJUA 4QZHA 3M9OB 2C2EA 5JRTA 4TUSA 5F9NA 3PX0A 2W9BB 4O9MA 3H40A 1NNLA 2BKEA 1MQ2A 4F72A 3GV7B 3SQIA 3UPQA 4A8EA 2HVHA 5KL1B 4I2AA 1TVAA 2YQEA 2PFNA 5DDYA 1XU4A 5AM4A 4RPYA 5ALRA 2LKYA 4KLTA 2XY6A 4TQSA 4TQRA 3WK6A 2FE9A 1PK1B 3PNCA 4C7YA 2LHTA 2DPIA 2WB1F 2WF6A 1NK9A 5ALPA 2K4IA 4RUAA 5AKXA 4M6WB 4KLDA 3PW0A 5E79U 1D8YA 4J03A 3RFAA 2K4PA 3ZDAA 3RF9A 2DBYA 3PVXA 1SV4A 1LKYA 5AK3A 1S0NA 4M9HA 2ZIVA 4IC9A 1X6JA 1RXVA 2M0NA 2VJ5A 1ZQQA 5DB7A 1Z3EB 5J2GA 1JXLA 5AI9A 4K4GA 4MEXA 7ICEA 3WK4A 1N48A 3KHHA 4F5NA 2R8JA 2C22A 3RRHA 4MF8A 2YB1A 1KFTA 4CF3A 4YMMA 1ZQNA 1RYRA 2C2DA 4UBCA 4GC6A 5J0SA 4PPXA 4I2BA 3NVZA 2GH1A 2RP5A 2Y9TA 2PMZC 4F2RA 1Q3VA 5KT4A 2BGWA 1WYGA 5J2EA 5ALHA 5ALFA 2QLTA 3BS5A 3K1ZA 4NLKA 5C0YA 4QIWC 5DQIA 3RR7A 2ASJA 1DGSA 5D4BA 5EOZA 2EAPA 2BQ3A 2F3NA 1DK3A 5KG1A 3SEIA 5AM0A 3IM1A 2WAQF 4QNLA 4RUCA 4IQWA 4NLBA 1H38A 5KG0A 3C1ZA 4DWIA 9ICTA 1RYSA 9ICHA 4B9TA 1SV0C 2ZJAA 1WWVA 5L1IA 2W7PA 3V72A 4J9LA 5KL8B 1KSPA 3LVWA 1DXSA 2MUTB 4DOCA 1QH9A 1PZNA 3UXOA 4GLXA 2KP7A 5KG3A 4YCXA 1SKWA 4YXMA 1ZQIA 3QUQA 4RZRA 3AUOA 2FDRA 5J0YA 4RQ1A 8ICHA 1SKRA 4Y2PA 4YMNA 2W11A 4UW9A 4QZBA 3V7JA 4IRCA 3H4BA 3KHRA 1JROA 1L7MA 1JN3A 5ALVA 9ICIA 3RB3A 4GIBA 4QWCA 4I2GA 8ICUA 1Z1BA 5ALLA 2BCSA 4O5KA 4DL5A 1ZQFA 1NK6A 4KLGA 2FPLA 4UATA 5DKWA 5KT3A 1QCKA 5ALWA 5EWGA 4YR3A 3GIIA 1ZD3A 5IIIA 4TURA 2F2AB 2F8LA 1ZRNA 4YR0A 1FO4A 2BHNA 1N2XA 2BPFA 4QZFA 4BJQA 2YY6A 3DV9A 3PSIA 3C5GA 4ECUA 5KFTA 2HBKA 1ZXIA 3EUB2 4Q44A 4QWAA 4J9PA 3F5EA 4FE3A 4PHDA 2PI4A 5A0LA 2B0CA 2LPEA 1NJYA 1KBUA 3SAHA 2J6TA 4RT3A 5ALNA 1BPBA 4P0QB 5AI8A 4QZEA 2VKQA 1RYUA 8ICPA 1HEKA 3NVYA 4J9QA 2JR5A 4K4HA 1TV9A 3PW7A 2RDIA 3N7RC 4QZCA 2AHOB 1NKBA 4ED8A 3GQCA 3Q8SB 4F2SA 9ICWA 3N97B 3Q8MA 3O0FA 1S97A 5KG7A 3TADC 4I2CA 1DOQA 1NJZA 3PO5A 2EH9A 4PH5A 1ZQPA 2IOFA 8ICOA 2FI1A 2G06A 4JMUA 4CCHA 2F1JA 4B6JA 9ICGA 2W9MA 4U6PA 3H0LB 1ZQOA 4ZOHC 2A1AA 1SWVA 3QEBZ 2E8NA 4C0ZA 1CRXA 2JHDA 3E0FA 2GO7A 4F5PA 2P6UA 4PGQA 4TUQA 2XC9A 1LB2B 3C1YA 4NM2A 4J9MA 3E2EA 1J97A 3I76A 2LBOA 3HPOA 5TISU 2VA2A 4I2DA 4F4XA 5TZVA 2GLEA 1AQ6A 1PVRA 2CRXA 1L7OA 5J0PA 3MR6A 2L5YA 7ICLA 4M9JA 2KVSA 4IRDA 1ZQTA 2ZG6A 2J6UA 7ICGA 4ECSA 3H8WA 3HRDD 3OSPA 2HOQA 3SAFA 2DGZA 4GXKA 4P2HA 5KNIA 2FJ6A 4IQVA 3BS7A 4J9SA 3SZ2A 2XCPA 4KLEA 2WF9A 1RDFA 1CUKA 1D9DA 4F3OA 2Q4TA 3QYPA 2KN7A 4DO9A 3BDPA 2AQ4A 4Z6CA 3MR3A 2OM6A 4UAUA 2OYYA 1SV0A 1K1SA 1ED1A 2MSNA 4P4MA 4AYBC 3HT3A 1QSYA 4DFJA 3V6HA 1DRGA 3SV4A 3WKAA 3MGVA 5ALTA 2ZIXA 1NOMA 3ED5A 1NK4A 5DDMA 5B5EU 1Q3UA 5AIBA 3KD3A 2KJ5A 5HP4A 4QW9A 5HMMA 4KLFA 3KHGA 1WWUA 1SZHA 3IP4B 2A1JB 2JEFA 4R66A 8ICAA 1ZOLA 4MHVA 3CRXA 1GO3F 1KEJA 1S9FA 2Q0ZX 3HILA 3D2QA 2A19A 2G09A 4O3NA 4C7ZA 1N63A 3RTVA 5AHXA 3EPGA 1XSPA 2W04A 2BCVA 3EW9A 4NLZA 3H8JA 4EBEA 2HW3A 1BVSA 3KZXA 4RQNA 3WKBA 3H7IA 1ZQ1C 3WK7A 4PL1A 4KLUA 3IRUA 2PXIA 1NK8A 4ECRA 4USAA 3G6YA 4YMOA 2KFNA 3NVVA 3VCBA 3T5LA 3OHAA 3H8SA 2LYHA 1ZQCA 5EWEA 2KIWA 1UCVA 9ICOA 2DPJA 1LV5A 3UMBA 4NJ8A 1YZ6A 1U4BA 4UB5A 1SGGA 2R8HA 4F4WA 4I2JA 5J2FA 1T3NA 4YVZA 4NL9C 4HYKA 3OHBA 3KBBA 2Y0SC 1S76D 3PR5B 2HHQA 1BPZA 4XA5A 3V7KA 5AI0A 3AQFA 3TADA 1X9MA 5ALKA 4OD0A 3C5FA 2Y1JA 2ASLA 4PHEA 1KLNA 4DOAA 4GXJA 4PGYA 2UVRA 5KAIU 2MUTA 5KT2A 3TANA 4EEYA 4PL2A 3H0MB 5DG7A 2YB4A 2DL0A 1BPDA 1X2IA 1KFSA 2QB0B 2G07A 5KT6A 5K4LA 1WCNA 4NLNA 1YZ7A 5AK4A 4FZMA 2UVVA 4P0PA 1Z00B 5KFIA 5DB9A 4DFMA 4YD1A 4DF4A 4YR2A 1QTMA 4QZ9A 3UMCA 3UXNA 4IRKA 2O6KA 1LVHA 5ALDA 4YG2A 4ECQA 3Q8RB 4O5CA 2AH5A 3RH6A 3ZDDA 1TAUA 1NJXA 2PFQA 2NO5A 1ZQYA 2VJ4A 4IS7A 2W8LA 1SL1A 4E0DA 4QWEA 5HR7A 4KLQA 4JV0A 5EE0A 1Z19A 4ELUA 5GTIU 3JPNA 2ASDA 4DSEA 3ZD8A 4R8UA 1SL0A 4LZGA 4ELTA 2KKVA 4R64A 2KZ3A 2JRZA 9ICVA 4C8OA 3QEAZ 7ICVA 2KTQA 4RQ2A 1XNSA 5CRXA 5CEHA 3RH5A 4NXZA 2I5HA 3HKZF 2HI0A 5AI4A 3GV8B 1MSWD 1ZJMA 5KG4A 3ZDBA 1WUDA 3LVVA 4O5EA 1FFUA 2RQ5A 2VANA 3TFRA 3NTUA 2F76X 4DL6A 5AKIA 2E8PA 2KV2A 1N60A 2W54A 1T7PA 5KFJA 2W7OA 2AU0A 3EWAA 3C29A 5J0OA 2G08A 2ZTCA 5ALXA 5DGAA 1SL2A 5L1KA 4M47A 3C2MA 1SXDA 3CW2C 3T3FA 4PZOA 8ICXA 7ICQA 3BQTA 1ECWA 3FM9A 1KRPA 1IV8A 2LM4A 4XUSA 1PK3A 4DLGA 4OJOA 1SKSA 3J81j 4B9UA 4CF4A 4Q8FA 2YMLA 4FS1A 2WF5A 1X9XA 3U26A 3M6KA 3M9MB 4DEZA 4I2EA 5KFGA 5J8YA 4QZDA 3NRWA 3PSPA 3LWLA 2ZIUB 1ZD2P 5KFAA 5ALZA 5D46A 2LI6A 2XGPA 3WU2U 2E8MA 3ETLA 1MA7A 2IBKA 2KD1A 4O3OA 4BWJA 3B0YA 1UT8A 2ZXIA 3Q8LA 1KL9A 4MEYA 1TK8A 3THVA 4DFKA 2HBMA 1B4FA 4BUGA 4OJLA 2ZIWA 5AI5A 4PHPA 2BCUA 3KHLA 4KLSA 2IMWP 8ICEA 1XSNA 2NRTA 2G0AA 4CE6A 2ES6A 5J0RA 3SI8A 5DLGA 4DSLA 4DQQA 8ICKA 2HSZA 5JUMA 3ISDA 4ED1A 4NL9A 5ALQA 7ICIA 2ZXHA 2OH2A 1U47A 4KLHA 2G5IB 2XI9A 2W9CA 1TKDA 2DWQA 4RNMA 2KICA 4KITB 5ALUA 2AXTU 1BPEA 1X9WA 3Q8KA 3FDSA 5AI6A 3PX4A 3ORYA 2XVTA 2JH1A 1BPYA 5KFBA 4UQGA 5CR0A 4TUPA 2FMSA 3UQ0A 4M2YA 1WG8A 1ZQUA 1KTQA 4FZLA 4US8A 3LWMA 5EE3A 4F92B 3C2KA 5KFUA 2WB1C 3PW5A 1ZQLA 1UA1A 5B66U 4ED2A 1NKEA 2XY5A 5G5HA 4JK1A 1ZQJA 2C2RA 1ZQZA 4DLEA 1ZQXA 5ALSA 2DKXA 2PI5A 1O03A 3F2BA 1T94A 5HHIA 2KFZA 3HW8A 5DBCA 1NK7A 3C28A 9ICBA 2AGPA 2EZZA 1J2NA 3OJSA 4UARA 4JWMA 3V6JA 1CEZA 4PZNA 3AU2A 2ESEA 5J2JA 3LK9A 4QZGA 1X42A 4ED0A 1F0MA 5GTHU 4QJFB 3QXGA 1TAQA 1UT5A 5AM5A 2KG5A 3ISBA 1UHUA 4QZAA 2KZZA 4BXOB 3JPQA 2WTFA 2KHQA 4WJ3B 2WFAA 1YT3A 3AU6A 3GU3A 4OJPA 4JV1A 2EAOA 2I6XA 4DSJA 8ICGA 2OXOA 2IA6A 4GC7A 4RNNA 3D6JA 4Z6DA 4XQ8A 3ICXA 2Y1IA 2WAQC 2VA3A 1ZYQA 2KOBA 7ICOA 4CRXA 1SIJA 3BZKA 2V4QA 2EZXA 2QARB 1UA0A 5IIMA 2YTUA 1IIPA 4PHAA 3G6VA 2ATLA 4EZ9A 4M9GA 7ICUA 2F1IA 4HAIA 5EE1A 2YMMA 3TFSA 3PMNA 1U9LA 4O0IA 1COOA 2ODGA 2KJ9A 5FP0A 1NI3A 1B0XA 3NUQA 2KE7A 2ISOA 4DS5A 5AKHA 1Y88A 5AM1A 1LKYB 2ZIVB 4I2HA 1V9PA 9ICLA 4UB1A 3HWTA 4PGXA 4EENA 3R9KA 4KLOA 4EYIB 1JRPA 3QU9A 4BDPA 3HJEA 4FZNA 4UAZA 2PFPA 3OGUA 9ICSA 4C8NA 1RQLA 2ZJ8A 1S5LU 2JZBA 2JH7A 2B6GA 1ZQDA 1BGXT 7ICMA 3N4MB 2HOFA 4RQ3A 4F5OA 8ICZA 2E5SA 4ECZA 3MFIA 5CJ7A 2EDUA 3VC8A 5AM3A 2OWOA 2W9BA 9ICQA 2RRDA 4Y2QA 4B9LA 1U45A 1L7NA 2E1EA 4ED3A 2IOFK 8ICRA 5DB6A 3GIMA 2H3VA 2JEGA 1N5WA 5IINA 5AKEA 3BS5B 7ICHA 2KMDA 1RM6C 5JU5A 2LMRA 4LVSA 1PVQA 2YMQA 3ZI4A 3MGIA 4RNOA 1PK1A 2CN1A 2FMPA 4DSKA 2CXYA 5KAFU 4C4SA 5KFYA 5J0TA 3RB4A 2K8BB 3HX0A 4O3QA 4YQWA 5BOLA 1K5OA 1HIWA 4M6WA 4UB4A 3IN5A 7ICJA 4RQ7A 5J2AA 3OPXA 3D2NA 2EQYA 1JX4A 4M04A 4UB3A 3MDCA 4B9VA 3AN1A 2PFOA 4JWNA 4OJ6A 5L9XA 4DL4A 3E58A 3N7PD 4DSFA 4ECWA 2W43A 5KT5A 5KFXA 4RQMA 1NK0A 1RPLA 4BWMA 4Y2TA 1KDHA 1HJPA 2F44A 1SXEA 2LYBA 2GWSA 4BX9C 4I29A 5DG8A 5J2BA 3GIKA 2IHMA 5ALGA 1B22A 1NK5A 3QUBA 9ICFA 3H8MA 3UQ2A 2Z7JA 1XWLA 5ALYA 1RXWA 4O3PA 1JALA 3RR8A 3CYMA 1BNOA 1D9FA 3T5KA 1C20A 2KIVA 3V7LA 5KG6A 4Y2XA 3IG8A 2B21A 5AKLA 4NWIA 5DB8A 2ISPA 4RU9A 3RB6A 1OUQA 4YD2A 2KEYA 5HHHA 4KLLA 3ZD9A 5J2CA 2XICA 2KSOB 3WKEA 4P4PA 4KN4A 3AMZA 2BCQA 2H3FA 3QZ8A 4QZ8A 4RQ5A 1L3VA 4UBBA 3GILA 3RBEA 1T8EA 3B9JA 2FLNA 2HHXA 3NGDA 3ONNA 4NLCA 4RQ6A 3TAQA 2VA8A 4IR1A 3K75D 2HOIA 5KFKA 1RZTA 3L4PA 4UB2A 2F77X 9ICKA 3EYZA 5KFWA 8ICCA 3D2SA 4CF5A 1T4GA 3MR5A 4QWDA 3AM9A 2WHEA 4BGDA 1A0PA 7ICRA 1BPXA 4UAYA 4EYHB 4RT2A 3CP8A 1U48A 1JI7A 1WCLA 1X66A 3S6JA 3CNHA 5ALJA 3H4DA 2P6RA 2K89A 5EE9A 2VIXA 3M6ZA 3PMLA 3IV6A 1N61A 4KLJA 4DL7A 4FBUA 8ICIA 2W9AA 4R63A 1JUDA 4JV2A 1D8BA 5F3XB 4KN7A 4Q43A 3JPRA 1QQ5A 3EPIA 7ICPA 3BQ1A 5KG5A 2BPGA 2W3SA 5H2FU 1AROP 1S8OA 5ALMA 2BQRA 5KG2A 3PSFA 2PKEA 4DS4A 2XO7A 1CI4A 2NRWA 2PMZF 1P7DA 2MRLA 4EX6A 2FMQA 2KJ8A 3F2CA 4OO1J 3TARA 3K1RB 4QIWF 3ZDEA 3RJFA 3RAXA 3LYSA 8ICMA 2EZYA 4MF2A 1UPHA 2ZJ5A 3ZDCA 1ZQKA 3SENA 4P0QA 4F50A 4O3MA 1K1QA 5AK5A 3GZFA 3A0HU 2V4RA 2OHFA 4IQUA 1TK5A 2YN4A 5L1MA 4OJ5A 5KT7A 3QU4A 9ICUA 5AKZA 2EANA 3L3FX 5KFZA 3SMVA 2NRXA 2A3VA 1KQQA 1L3TA 3BQ2A 5J29A 2DQNB 5T14A 1C7YA 4UAVA 3IHQB 4Z6FA 4C8KA 5ALIA 2QARA 4ELVA 2ZUCA 4OCZA 5CB1A 1ZQEA 2IHNA 2AQ0A 4Y2YA 7ICSA 3KFUF 1EXNA 1A77A 5EWFA 2KZMA 2ZIXB 1NKCA 2R8IA 4U7CA 1DK2A 3JPTA 4LJXA 4J9OA 1IXRA 3N28A 8ICWA 2LM1A 4I2IA 3TAPA 1M6YA 3MFHA 1UQVA 3K4GA 5KFDA 5J0UA 4J9NA 2H3IA 3EZ5A 8ICLA 3T5JA 2F8KA 1ZRMA 2H3ZA 4ED7A 1KW4A 4O3RA 8ICQA 4MFCA 1ZD4A 5KFEA 2CPRA 2WF7A 4JUZA 4G3IA 5IIOA 2JXJA 5ALEA 3UM9A 8ICFA 3KTQA 1Q46A 3RJIA 3GIJA 3QU2A 1PUZA 5DQGA 4DQIA 1JIHA 4DFDA 4Y2RA 2HBJA 5JTIA 5KFMA 9ICNA 4FO6A 4F4KA 5KFSA 1URJA 5L1JA 3KOOA 5AKKA 1F5SA 2HHVA 3T79A 9ICRA 4DFPA 4LZDA 4UAWA 4I28A 3RJEA 3MC1A 4J9RA 1JXEA 5DG9A 3Q8QB 2XY7A 4Y2VA 3GV5B 2H3QA 4JB3A 3HP6A 3WK8A 1ZQRA 2UVUA 3N7SC 1MN8A 4US9A 3RAQA 3WKDA 2I9GA 8ICJA 4IR9A 3RJKA 3C23A 1NZPA 8ICBA 1XO1A 3NVWA 5KFQA 3AQEA 3HKZC 4RQ0A 3H0RB 9ICCA 8ICYA 4DCCA 3MABA 2N1RA 4DQRA 4YFKA 4P4OA 3RH4A 4KLMA 5J2HA 4I2FA 4M9NA 3F5AA 2M9NA 5J2KA 5CA7A 2A1JA 1X6IA 3QE9Y 3I28A 4O3SA 3MDAA 1N56A 5BPCA 4ED6A 3SAGA 3F2DA 3RJJA 9ICEA 3Q8PB 3RJHA 4QW8A 1ZQMA 3KKAC 2KKPA 4P0PB 5KFPA 1ZQGA 1PVPA 1HUZA 2AJQA 4YN4A 4B9SA 3GDXA 2NYVA 3I1YA 5AK6A 2XGQA 2BR0A 2UVWA 4B9NA 3ETRA 3SR6A 2W3RA 1QQ7A 3QZ7A 4AP9A 1ZETA 1X9SA 4FBTA 2RDJA 2LYAA
chains in the Genus database with same CATH topology
3IDWA 3BS5B 2KMDA 5JTIA 2E8NA 2KSOB 2JV3A 1SXDA 5JU5A 2LMRA 3SENA 1WWUA 4PZOA 2DL0A 1PK1A 2QB0B 4MHVA 1PK3A 1OW5A 5L1MA 2K60A 2QARB 2KSOA 2Y9UA 2E8OA 2EANA 3HILA 2YTUA 1X9XA 1OXJA 5J8YA 2GLEA 5JRTA 2QARA 2E8MA 2L5YA 2Y9TA 1B0XA 4RQNA 2KE7A 4RQMA 3BS5A 2DKXA 1JI7A 1X66A 2D3DA 2D8CA 4IS7A 2F44A 1COKA 1LKYB 2EAPA 1SXEA 5KNIA 1V85A 2QB0A 2F3NA 3SEIA 3BS7A 2LPEA 1B4FA 3H8MA 5F3XB 2FE9A 1PK1B 1UQVA 1Z1VA 4PZNA 1UCVA 2B6GA 1SV0C 2EAMA 1X40A 2ESEA 3KKAC 4NJ8A 2ES6A 3BQ7A 1V38A 1WWVA 2F8KA 1SGGA 1F0MA 1SV0A 1KW4A 3KKAA 3TADC 4NL9C 1DXSA 2KG5A 2QKQA 2KIVA 3TADA 4NL9A 2DKZA 2E8PA 2K4PA 3K1RB 3TACB 1RG6A 1SV4A 2EAOA 2QB1A 5J8YC 1LKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IDW A;  3BS5 B;  2KMD A;  5JTI A;  2E8N A;  2KSO B;  2JV3 A;  1SXD A;  5JU5 A;  2LMR A;  3SEN A;  1WWU A;  4PZO A;  2DL0 A;  1PK1 A;  2QB0 B;  4MHV A;  1PK3 A;  1OW5 A;  5L1M A;  2K60 A;  2QAR B;  2KSO A;  2Y9U A;  2E8O A;  2EAN A;  3HIL A;  2YTU A;  1X9X A;  1OXJ A;  5J8Y A;  2GLE A;  5JRT A;  2QAR A;  2E8M A;  2L5Y A;  2Y9T A;  1B0X A;  4RQN A;  2KE7 A;  4RQM A;  3BS5 A;  2DKX A;  1JI7 A;  1X66 A;  2D3D A;  2D8C A;  4IS7 A;  2F44 A;  1COK A;  1LKY B;  2EAP A;  1SXE A;  5KNI A;  1V85 A;  2QB0 A;  2F3N A;  3SEI A;  3BS7 A;  2LPE A;  1B4F A;  3H8M A;  5F3X B;  2FE9 A;  1PK1 B;  1UQV A;  1Z1V A;  4PZN A;  1UCV A;  2B6G A;  1SV0 C;  2EAM A;  1X40 A;  2ESE A;  3KKA C;  4NJ8 A;  2ES6 A;  3BQ7 A;  1V38 A;  1WWV A;  2F8K A;  1SGG A;  1F0M A;  1SV0 A;  1KW4 A;  3KKA A;  3TAD C;  4NL9 C;  1DXS A;  2KG5 A;  2QKQ A;  2KIV A;  3TAD A;  4NL9 A;  2DKZ A;  2E8P A;  2K4P A;  3K1R B;  3TAC B;  1RG6 A;  1SV4 A;  2EAO A;  2QB1 A;  5J8Y C;  1LKY A; 
#chains in the Genus database with same CATH topology
 3FYH A;  4CNQ A;  2G5H B;  3QNM A;  2DUY A;  2BZF A;  1N62 A;  4F4Z A;  4EBD A;  5C5J A;  4J9K A;  4NV0 A;  3TI0 A;  4KX5 A;  2HMX A;  2K4E A;  3NAS A;  3LDA A;  4FS2 A;  4C80 A;  5AIC A;  2F1H A;  1XC9 A;  5KFO A;  5CWR A;  2KHV A;  2KSO A;  4KX3 A;  4R8U B;  3AL0 B;  4Y2S A;  4Y2J A;  2FLP A;  1DGJ A;  4G9B A;  1NJW A;  1ZQS A;  4AYB F;  1SWW A;  7ICT A;  2WF8 A;  5F9L A;  4ZH4 A;  3TQ1 A;  1BNP A;  3G6X A;  4CDG A;  3BJY A;  2YMP A;  3FC4 A;  3JPO A;  5AKJ A;  2MAX A;  1NZB A;  2BCR A;  4XRH A;  5KFL A;  1TFR A;  5IIK A;  4KLI A;  2ZUD A;  4M0A A;  2HHT A;  1MC8 A;  1L8O A;  4Q45 A;  5KFC A;  2BQU A;  1VJ5 A;  2AGO A;  2MA1 A;  2OCE A;  5J0W A;  4MFA A;  2QB0 A;  3M7D A;  2E1F A;  2OEH A;  2R8K A;  5AKY A;  1Z00 A;  3B0X A;  2R18 A;  1Z1V A;  2D6F C;  3BQ0 A;  4B9M A;  1J2M A;  1S77 D;  3PY8 A;  4C8M A;  2NRZ A;  3BQ7 A;  3M1Y A;  3WK9 A;  4F91 B;  9ICP A;  5KFR A;  4QZI A;  4RQ8 A;  2W55 A;  1QSL A;  1VDV A;  4DL2 A;  3MGH A;  4Y2U A;  5L1L A;  4ACO A;  4MFF A;  2JMG A;  1XSL A;  3QUT A;  4DQS A;  2NV3 A;  1KKX A;  3TAC B;  1RG6 A;  1ZQH A;  3PST A;  2K8A A;  3NRZ A;  5KFN A;  7ICK A;  1TE2 A;  3M8S A;  1ZQV A;  3M9N B;  2E3T A;  3L5K A;  4M9L A;  4QWB A;  2GOL A;  3C21 A;  5G5G A;  2K4H A;  4DQP A;  1L7P A;  5CHG A;  1XS9 D;  1L3U A;  8ICV A;  1Z4O A;  3MR2 A;  1T3Q A;  2ZIW B;  3T5H A;  4RPZ A;  2BPC A;  2Y9U A;  2RHF A;  2FLL A;  8ICN A;  4F4Y A;  2JEJ A;  2Y0S F;  2ZTD A;  2MU2 A;  3V6K A;  4EEK A;  1IM4 A;  4EZ6 A;  4IQT A;  2W03 A;  3QX7 A;  3TKA A;  4ECX A;  4F8R A;  3SV3 A;  5J0Q A;  5DLF A;  2YX8 A;  5KFH A;  4R65 A;  1L8L A;  2JGA A;  3ALR A;  3GFK B;  4RQ4 A;  3JPP A;  3PX6 A;  1A6S A;  1B43 A;  4KTQ A;  1S0O A;  2K8C B;  4GXI A;  2C28 A;  5ALO A;  2D3D A;  2D8C A;  5DQH A;  4GFJ A;  4KMO B;  1L5U A;  2W9C B;  3RB0 A;  2BDU A;  3A0B U;  1A76 A;  3SYZ A;  1QSS A;  5J0X A;  4EX7 A;  1FFV A;  2HHS A;  4DF8 A;  1ZD5 A;  3DDH A;  4I27 A;  2EAM A;  1S0V A;  4C8L A;  5IIL A;  4F5R A;  4ECT A;  3ISC A;  2ZIU A;  4ECY A;  5DBA A;  3KKA A;  4YXJ A;  3AEV A;  4CGZ A;  3FAH A;  3OSN A;  3PW4 A;  4NM1 A;  2DKZ A;  2DFL A;  1MQ3 A;  3QU5 A;  7ICF A;  3QUC A;  4C4R A;  1KN5 A;  5J8Y C;  5HML A;  3F53 A;  5CP2 A;  4DL3 A;  4YP3 A;  1ZQW A;  2ZUB A;  2KVC A;  4NLG A;  9ICJ A;  3QU7 A;  2JV3 A;  9ICX A;  4K4I A;  1S0M A;  1SZP A;  1IG6 A;  2NRV A;  4Z6E A;  8ICT A;  1L6N A;  5KTQ A;  5AIA A;  7ICN A;  2H5X A;  8ICS A;  5AM2 A;  2K60 A;  4Q8E A;  5J2I A;  4FFD A;  4F5Q A;  2E8O A;  1FIQ A;  3PW2 A;  3SD7 A;  5IIJ A;  4EBC A;  4DSI A;  2FPK A;  1RQN A;  4UB6 U;  2XCA A;  1O08 A;  1L3S A;  5DGB A;  4KMU A;  1QLN A;  9ICM A;  1D8L A;  1N5X A;  1Z4N A;  2DF4 B;  2JEI A;  4UB8 U;  2I1Q A;  2HVI A;  1QQ6 A;  2RLT A;  3UXP A;  1COK A;  3JPS A;  5HNK A;  1V97 A;  2P35 A;  3NS1 A;  1V85 A;  3RBD A;  1HUO A;  4IL6 U;  4F71 A;  2J6S A;  4UAS A;  3MBY A;  5J2D A;  5KFF A;  3PO4 A;  5BOM A;  3WKC A;  2FPM A;  3IG5 A;  1X40 A;  1ZQA A;  2BDP A;  1V38 A;  3DEE A;  1Q8K A;  4PJ0 U;  4X5V A;  2V9W A;  1ZJN A;  9ICA A;  2QKQ A;  4C4T A;  1S10 A;  3BZC A;  3RRG A;  2P66 A;  4ECV A;  3M8R A;  2HCF A;  2QB1 A;  2IOH A;  3PZP A;  4F93 B;  2HDO A;  3IDW A;  1KFD A;  1ZQB A;  3OTQ A;  3WK5 A;  5HR6 A;  4DOB A;  1VLB A;  2KNJ A;  1TK0 A;  3PR4 A;  5D49 A;  1U49 A;  1XO0 A;  1JMS A;  4ICA A;  2ZTE A;  3UMG A;  4NY8 A;  1FEZ A;  2ALZ A;  5AKG A;  1SB3 C;  1OW5 A;  3C2L A;  2HHW A;  4EEL A;  1F44 A;  3RJG A;  1TAM A;  3PV8 A;  2KK0 A;  2R8G A;  2W8K A;  5DBB A;  4RPX A;  2HBL A;  1OXJ A;  5KFV A;  2JZB B;  3KZI U;  2AGQ A;  4BXO A;  2HHU A;  2NO4 A;  2XID A;  3OJU A;  4QZH A;  3M9O B;  2C2E A;  5JRT A;  4TUS A;  5F9N A;  3PX0 A;  2W9B B;  4O9M A;  3H40 A;  1NNL A;  2BKE A;  1MQ2 A;  4F72 A;  3GV7 B;  3SQI A;  3UPQ A;  4A8E A;  2HVH A;  5KL1 B;  4I2A A;  1TVA A;  2YQE A;  2PFN A;  5DDY A;  1XU4 A;  5AM4 A;  4RPY A;  5ALR A;  2LKY A;  4KLT A;  2XY6 A;  4TQS A;  4TQR A;  3WK6 A;  2FE9 A;  1PK1 B;  3PNC A;  4C7Y A;  2LHT A;  2DPI A;  2WB1 F;  2WF6 A;  1NK9 A;  5ALP A;  2K4I A;  4RUA A;  5AKX A;  4M6W B;  4KLD A;  3PW0 A;  5E79 U;  1D8Y A;  4J03 A;  3RFA A;  2K4P A;  3ZDA A;  3RF9 A;  2DBY A;  3PVX A;  1SV4 A;  1LKY A;  5AK3 A;  1S0N A;  4M9H A;  2ZIV A;  4IC9 A;  1X6J A;  1RXV A;  2M0N A;  2VJ5 A;  1ZQQ A;  5DB7 A;  1Z3E B;  5J2G A;  1JXL A;  5AI9 A;  4K4G A;  4MEX A;  7ICE A;  3WK4 A;  1N48 A;  3KHH A;  4F5N A;  2R8J A;  2C22 A;  3RRH A;  4MF8 A;  2YB1 A;  1KFT A;  4CF3 A;  4YMM A;  1ZQN A;  1RYR A;  2C2D A;  4UBC A;  4GC6 A;  5J0S A;  4PPX A;  4I2B A;  3NVZ A;  2GH1 A;  2RP5 A;  2Y9T A;  2PMZ C;  4F2R A;  1Q3V A;  5KT4 A;  2BGW A;  1WYG A;  5J2E A;  5ALH A;  5ALF A;  2QLT A;  3BS5 A;  3K1Z A;  4NLK A;  5C0Y A;  4QIW C;  5DQI A;  3RR7 A;  2ASJ A;  1DGS A;  5D4B A;  5EOZ A;  2EAP A;  2BQ3 A;  2F3N A;  1DK3 A;  5KG1 A;  3SEI A;  5AM0 A;  3IM1 A;  2WAQ F;  4QNL A;  4RUC A;  4IQW A;  4NLB A;  1H38 A;  5KG0 A;  3C1Z A;  4DWI A;  9ICT A;  1RYS A;  9ICH A;  4B9T A;  1SV0 C;  2ZJA A;  1WWV A;  5L1I A;  2W7P A;  3V72 A;  4J9L A;  5KL8 B;  1KSP A;  3LVW A;  1DXS A;  2MUT B;  4DOC A;  1QH9 A;  1PZN A;  3UXO A;  4GLX A;  2KP7 A;  5KG3 A;  4YCX A;  1SKW A;  4YXM A;  1ZQI A;  3QUQ A;  4RZR A;  3AUO A;  2FDR A;  5J0Y A;  4RQ1 A;  8ICH A;  1SKR A;  4Y2P A;  4YMN A;  2W11 A;  4UW9 A;  4QZB A;  3V7J A;  4IRC A;  3H4B A;  3KHR A;  1JRO A;  1L7M A;  1JN3 A;  5ALV A;  9ICI A;  3RB3 A;  4GIB A;  4QWC A;  4I2G A;  8ICU A;  1Z1B A;  5ALL A;  2BCS A;  4O5K A;  4DL5 A;  1ZQF A;  1NK6 A;  4KLG A;  2FPL A;  4UAT A;  5DKW A;  5KT3 A;  1QCK A;  5ALW A;  5EWG A;  4YR3 A;  3GII A;  1ZD3 A;  5III A;  4TUR A;  2F2A B;  2F8L A;  1ZRN A;  4YR0 A;  1FO4 A;  2BHN A;  1N2X A;  2BPF A;  4QZF A;  4BJQ A;  2YY6 A;  3DV9 A;  3PSI A;  3C5G A;  4ECU A;  5KFT A;  2HBK A;  1ZXI A;  3EUB 2;  4Q44 A;  4QWA A;  4J9P A;  3F5E A;  4FE3 A;  4PHD A;  2PI4 A;  5A0L A;  2B0C A;  2LPE A;  1NJY A;  1KBU A;  3SAH A;  2J6T A;  4RT3 A;  5ALN A;  1BPB A;  4P0Q B;  5AI8 A;  4QZE A;  2VKQ A;  1RYU A;  8ICP A;  1HEK A;  3NVY A;  4J9Q A;  2JR5 A;  4K4H A;  1TV9 A;  3PW7 A;  2RDI A;  3N7R C;  4QZC A;  2AHO B;  1NKB A;  4ED8 A;  3GQC A;  3Q8S B;  4F2S A;  9ICW A;  3N97 B;  3Q8M A;  3O0F A;  1S97 A;  5KG7 A;  3TAD C;  4I2C A;  1DOQ A;  1NJZ A;  3PO5 A;  2EH9 A;  4PH5 A;  1ZQP A;  2IOF A;  8ICO A;  2FI1 A;  2G06 A;  4JMU A;  4CCH A;  2F1J A;  4B6J A;  9ICG A;  2W9M A;  4U6P A;  3H0L B;  1ZQO A;  4ZOH C;  2A1A A;  1SWV A;  3QEB Z;  2E8N A;  4C0Z A;  1CRX A;  2JHD A;  3E0F A;  2GO7 A;  4F5P A;  2P6U A;  4PGQ A;  4TUQ A;  2XC9 A;  1LB2 B;  3C1Y A;  4NM2 A;  4J9M A;  3E2E A;  1J97 A;  3I76 A;  2LBO A;  3HPO A;  5TIS U;  2VA2 A;  4I2D A;  4F4X A;  5TZV A;  2GLE A;  1AQ6 A;  1PVR A;  2CRX A;  1L7O A;  5J0P A;  3MR6 A;  2L5Y A;  7ICL A;  4M9J A;  2KVS A;  4IRD A;  1ZQT A;  2ZG6 A;  2J6U A;  7ICG A;  4ECS A;  3H8W A;  3HRD D;  3OSP A;  2HOQ A;  3SAF A;  2DGZ A;  4GXK A;  4P2H A;  5KNI A;  2FJ6 A;  4IQV A;  3BS7 A;  4J9S A;  3SZ2 A;  2XCP A;  4KLE A;  2WF9 A;  1RDF A;  1CUK A;  1D9D A;  4F3O A;  2Q4T A;  3QYP A;  2KN7 A;  4DO9 A;  3BDP A;  2AQ4 A;  4Z6C A;  3MR3 A;  2OM6 A;  4UAU A;  2OYY A;  1SV0 A;  1K1S A;  1ED1 A;  2MSN A;  4P4M A;  4AYB C;  3HT3 A;  1QSY A;  4DFJ A;  3V6H A;  1DRG A;  3SV4 A;  3WKA A;  3MGV A;  5ALT A;  2ZIX A;  1NOM A;  3ED5 A;  1NK4 A;  5DDM A;  5B5E U;  1Q3U A;  5AIB A;  3KD3 A;  2KJ5 A;  5HP4 A;  4QW9 A;  5HMM A;  4KLF A;  3KHG A;  1WWU A;  1SZH A;  3IP4 B;  2A1J B;  2JEF A;  4R66 A;  8ICA A;  1ZOL A;  4MHV A;  3CRX A;  1GO3 F;  1KEJ A;  1S9F A;  2Q0Z X;  3HIL A;  3D2Q A;  2A19 A;  2G09 A;  4O3N A;  4C7Z A;  1N63 A;  3RTV A;  5AHX A;  3EPG A;  1XSP A;  2W04 A;  2BCV A;  3EW9 A;  4NLZ A;  3H8J A;  4EBE A;  2HW3 A;  1BVS A;  3KZX A;  4RQN A;  3WKB A;  3H7I A;  1ZQ1 C;  3WK7 A;  4PL1 A;  4KLU A;  3IRU A;  2PXI A;  1NK8 A;  4ECR A;  4USA A;  3G6Y A;  4YMO A;  2KFN A;  3NVV A;  3VCB A;  3T5L A;  3OHA A;  3H8S A;  2LYH A;  1ZQC A;  5EWE A;  2KIW A;  1UCV A;  9ICO A;  2DPJ A;  1LV5 A;  3UMB A;  4NJ8 A;  1YZ6 A;  1U4B A;  4UB5 A;  1SGG A;  2R8H A;  4F4W A;  4I2J A;  5J2F A;  1T3N A;  4YVZ A;  4NL9 C;  4HYK A;  3OHB A;  3KBB A;  2Y0S C;  1S76 D;  3PR5 B;  2HHQ A;  1BPZ A;  4XA5 A;  3V7K A;  5AI0 A;  3AQF A;  3TAD A;  1X9M A;  5ALK A;  4OD0 A;  3C5F A;  2Y1J A;  2ASL A;  4PHE A;  1KLN A;  4DOA A;  4GXJ A;  4PGY A;  2UVR A;  5KAI U;  2MUT A;  5KT2 A;  3TAN A;  4EEY A;  4PL2 A;  3H0M B;  5DG7 A;  2YB4 A;  2DL0 A;  1BPD A;  1X2I A;  1KFS A;  2QB0 B;  2G07 A;  5KT6 A;  5K4L A;  1WCN A;  4NLN A;  1YZ7 A;  5AK4 A;  4FZM A;  2UVV A;  4P0P A;  1Z00 B;  5KFI A;  5DB9 A;  4DFM A;  4YD1 A;  4DF4 A;  4YR2 A;  1QTM A;  4QZ9 A;  3UMC A;  3UXN A;  4IRK A;  2O6K A;  1LVH A;  5ALD A;  4YG2 A;  4ECQ A;  3Q8R B;  4O5C A;  2AH5 A;  3RH6 A;  3ZDD A;  1TAU A;  1NJX A;  2PFQ A;  2NO5 A;  1ZQY A;  2VJ4 A;  4IS7 A;  2W8L A;  1SL1 A;  4E0D A;  4QWE A;  5HR7 A;  4KLQ A;  4JV0 A;  5EE0 A;  1Z19 A;  4ELU A;  5GTI U;  3JPN A;  2ASD A;  4DSE A;  3ZD8 A;  4R8U A;  1SL0 A;  4LZG A;  4ELT A;  2KKV A;  4R64 A;  2KZ3 A;  2JRZ A;  9ICV A;  4C8O A;  3QEA Z;  7ICV A;  2KTQ A;  4RQ2 A;  1XNS A;  5CRX A;  5CEH A;  3RH5 A;  4NXZ A;  2I5H A;  3HKZ F;  2HI0 A;  5AI4 A;  3GV8 B;  1MSW D;  1ZJM A;  5KG4 A;  3ZDB A;  1WUD A;  3LVV A;  4O5E A;  1FFU A;  2RQ5 A;  2VAN A;  3TFR A;  3NTU A;  2F76 X;  4DL6 A;  5AKI A;  2E8P A;  2KV2 A;  1N60 A;  2W54 A;  1T7P A;  5KFJ A;  2W7O A;  2AU0 A;  3EWA A;  3C29 A;  5J0O A;  2G08 A;  2ZTC A;  5ALX A;  5DGA A;  1SL2 A;  5L1K A;  4M47 A;  3C2M A;  1SXD A;  3CW2 C;  3T3F A;  4PZO A;  8ICX A;  7ICQ A;  3BQT A;  1ECW A;  3FM9 A;  1KRP A;  1IV8 A;  2LM4 A;  4XUS A;  1PK3 A;  4DLG A;  4OJO A;  1SKS A;  3J81 j;  4B9U A;  4CF4 A;  4Q8F A;  2YML A;  4FS1 A;  2WF5 A;  1X9X A;  3U26 A;  3M6K A;  3M9M B;  4DEZ A;  4I2E A;  5KFG A;  5J8Y A;  4QZD A;  3NRW A;  3PSP A;  3LWL A;  2ZIU B;  1ZD2 P;  5KFA A;  5ALZ A;  5D46 A;  2LI6 A;  2XGP A;  3WU2 U;  2E8M A;  3ETL A;  1MA7 A;  2IBK A;  2KD1 A;  4O3O A;  4BWJ A;  3B0Y A;  1UT8 A;  2ZXI A;  3Q8L A;  1KL9 A;  4MEY A;  1TK8 A;  3THV A;  4DFK A;  2HBM A;  1B4F A;  4BUG A;  4OJL A;  2ZIW A;  5AI5 A;  4PHP A;  2BCU A;  3KHL A;  4KLS A;  2IMW P;  8ICE A;  1XSN A;  2NRT A;  2G0A A;  4CE6 A;  2ES6 A;  5J0R A;  3SI8 A;  5DLG A;  4DSL A;  4DQQ A;  8ICK A;  2HSZ A;  5JUM A;  3ISD A;  4ED1 A;  4NL9 A;  5ALQ A;  7ICI A;  2ZXH A;  2OH2 A;  1U47 A;  4KLH A;  2G5I B;  2XI9 A;  2W9C A;  1TKD A;  2DWQ A;  4RNM A;  2KIC A;  4KIT B;  5ALU A;  2AXT U;  1BPE A;  1X9W A;  3Q8K A;  3FDS A;  5AI6 A;  3PX4 A;  3ORY A;  2XVT A;  2JH1 A;  1BPY A;  5KFB A;  4UQG A;  5CR0 A;  4TUP A;  2FMS A;  3UQ0 A;  4M2Y A;  1WG8 A;  1ZQU A;  1KTQ A;  4FZL A;  4US8 A;  3LWM A;  5EE3 A;  4F92 B;  3C2K A;  5KFU A;  2WB1 C;  3PW5 A;  1ZQL A;  1UA1 A;  5B66 U;  4ED2 A;  1NKE A;  2XY5 A;  5G5H A;  4JK1 A;  1ZQJ A;  2C2R A;  1ZQZ A;  4DLE A;  1ZQX A;  5ALS A;  2DKX A;  2PI5 A;  1O03 A;  3F2B A;  1T94 A;  5HHI A;  2KFZ A;  3HW8 A;  5DBC A;  1NK7 A;  3C28 A;  9ICB A;  2AGP A;  2EZZ A;  1J2N A;  3OJS A;  4UAR A;  4JWM A;  3V6J A;  1CEZ A;  4PZN A;  3AU2 A;  2ESE A;  5J2J A;  3LK9 A;  4QZG A;  1X42 A;  4ED0 A;  1F0M A;  5GTH U;  4QJF B;  3QXG A;  1TAQ A;  1UT5 A;  5AM5 A;  2KG5 A;  3ISB A;  1UHU A;  4QZA A;  2KZZ A;  4BXO B;  3JPQ A;  2WTF A;  2KHQ A;  4WJ3 B;  2WFA A;  1YT3 A;  3AU6 A;  3GU3 A;  4OJP A;  4JV1 A;  2EAO A;  2I6X A;  4DSJ A;  8ICG A;  2OXO A;  2IA6 A;  4GC7 A;  4RNN A;  3D6J A;  4Z6D A;  4XQ8 A;  3ICX A;  2Y1I A;  2WAQ C;  2VA3 A;  1ZYQ A;  2KOB A;  7ICO A;  4CRX A;  1SIJ A;  3BZK A;  2V4Q A;  2EZX A;  2QAR B;  1UA0 A;  5IIM A;  2YTU A;  1IIP A;  4PHA A;  3G6V A;  2ATL A;  4EZ9 A;  4M9G A;  7ICU A;  2F1I A;  4HAI A;  5EE1 A;  2YMM A;  3TFS A;  3PMN A;  1U9L A;  4O0I A;  1COO A;  2ODG A;  2KJ9 A;  5FP0 A;  1NI3 A;  1B0X A;  3NUQ A;  2KE7 A;  2ISO A;  4DS5 A;  5AKH A;  1Y88 A;  5AM1 A;  1LKY B;  2ZIV B;  4I2H A;  1V9P A;  9ICL A;  4UB1 A;  3HWT A;  4PGX A;  4EEN A;  3R9K A;  4KLO A;  4EYI B;  1JRP A;  3QU9 A;  4BDP A;  3HJE A;  4FZN A;  4UAZ A;  2PFP A;  3OGU A;  9ICS A;  4C8N A;  1RQL A;  2ZJ8 A;  1S5L U;  2JZB A;  2JH7 A;  2B6G A;  1ZQD A;  1BGX T;  7ICM A;  3N4M B;  2HOF A;  4RQ3 A;  4F5O A;  8ICZ A;  2E5S A;  4ECZ A;  3MFI A;  5CJ7 A;  2EDU A;  3VC8 A;  5AM3 A;  2OWO A;  2W9B A;  9ICQ A;  2RRD A;  4Y2Q A;  4B9L A;  1U45 A;  1L7N A;  2E1E A;  4ED3 A;  2IOF K;  8ICR A;  5DB6 A;  3GIM A;  2H3V A;  2JEG A;  1N5W A;  5IIN A;  5AKE A;  3BS5 B;  7ICH A;  2KMD A;  1RM6 C;  5JU5 A;  2LMR A;  4LVS A;  1PVQ A;  2YMQ A;  3ZI4 A;  3MGI A;  4RNO A;  1PK1 A;  2CN1 A;  2FMP A;  4DSK A;  2CXY A;  5KAF U;  4C4S A;  5KFY A;  5J0T A;  3RB4 A;  2K8B B;  3HX0 A;  4O3Q A;  4YQW A;  5BOL A;  1K5O A;  1HIW A;  4M6W A;  4UB4 A;  3IN5 A;  7ICJ A;  4RQ7 A;  5J2A A;  3OPX A;  3D2N A;  2EQY A;  1JX4 A;  4M04 A;  4UB3 A;  3MDC A;  4B9V A;  3AN1 A;  2PFO A;  4JWN A;  4OJ6 A;  5L9X A;  4DL4 A;  3E58 A;  3N7P D;  4DSF A;  4ECW A;  2W43 A;  5KT5 A;  5KFX A;  4RQM A;  1NK0 A;  1RPL A;  4BWM A;  4Y2T A;  1KDH A;  1HJP A;  2F44 A;  1SXE A;  2LYB A;  2GWS A;  4BX9 C;  4I29 A;  5DG8 A;  5J2B A;  3GIK A;  2IHM A;  5ALG A;  1B22 A;  1NK5 A;  3QUB A;  9ICF A;  3H8M A;  3UQ2 A;  2Z7J A;  1XWL A;  5ALY A;  1RXW A;  4O3P A;  1JAL A;  3RR8 A;  3CYM A;  1BNO A;  1D9F A;  3T5K A;  1C20 A;  2KIV A;  3V7L A;  5KG6 A;  4Y2X A;  3IG8 A;  2B21 A;  5AKL A;  4NWI A;  5DB8 A;  2ISP A;  4RU9 A;  3RB6 A;  1OUQ A;  4YD2 A;  2KEY A;  5HHH A;  4KLL A;  3ZD9 A;  5J2C A;  2XIC A;  2KSO B;  3WKE A;  4P4P A;  4KN4 A;  3AMZ A;  2BCQ A;  2H3F A;  3QZ8 A;  4QZ8 A;  4RQ5 A;  1L3V A;  4UBB A;  3GIL A;  3RBE A;  1T8E A;  3B9J A;  2FLN A;  2HHX A;  3NGD A;  3ONN A;  4NLC A;  4RQ6 A;  3TAQ A;  2VA8 A;  4IR1 A;  3K75 D;  2HOI A;  5KFK A;  1RZT A;  3L4P A;  4UB2 A;  2F77 X;  9ICK A;  3EYZ A;  5KFW A;  8ICC A;  3D2S A;  4CF5 A;  1T4G A;  3MR5 A;  4QWD A;  3AM9 A;  2WHE A;  4BGD A;  1A0P A;  7ICR A;  1BPX A;  4UAY A;  4EYH B;  4RT2 A;  3CP8 A;  1U48 A;  1JI7 A;  1WCL A;  1X66 A;  3S6J A;  3CNH A;  5ALJ A;  3H4D A;  2P6R A;  2K89 A;  5EE9 A;  2VIX A;  3M6Z A;  3PML A;  3IV6 A;  1N61 A;  4KLJ A;  4DL7 A;  4FBU A;  8ICI A;  2W9A A;  4R63 A;  1JUD A;  4JV2 A;  1D8B A;  5F3X B;  4KN7 A;  4Q43 A;  3JPR A;  1QQ5 A;  3EPI A;  7ICP A;  3BQ1 A;  5KG5 A;  2BPG A;  2W3S A;  5H2F U;  1ARO P;  1S8O A;  5ALM A;  2BQR A;  5KG2 A;  3PSF A;  2PKE A;  4DS4 A;  2XO7 A;  1CI4 A;  2NRW A;  2PMZ F;  1P7D A;  2MRL A;  4EX6 A;  2FMQ A;  2KJ8 A;  3F2C A;  4OO1 J;  3TAR A;  3K1R B;  4QIW F;  3ZDE A;  3RJF A;  3RAX A;  3LYS A;  8ICM A;  2EZY A;  4MF2 A;  1UPH A;  2ZJ5 A;  3ZDC A;  1ZQK A;  3SEN A;  4P0Q A;  4F50 A;  4O3M A;  1K1Q A;  5AK5 A;  3GZF A;  3A0H U;  2V4R A;  2OHF A;  4IQU A;  1TK5 A;  2YN4 A;  5L1M A;  4OJ5 A;  5KT7 A;  3QU4 A;  9ICU A;  5AKZ A;  2EAN A;  3L3F X;  5KFZ A;  3SMV A;  2NRX A;  2A3V A;  1KQQ A;  1L3T A;  3BQ2 A;  5J29 A;  2DQN B;  5T14 A;  1C7Y A;  4UAV A;  3IHQ B;  4Z6F A;  4C8K A;  5ALI A;  2QAR A;  4ELV A;  2ZUC A;  4OCZ A;  5CB1 A;  1ZQE A;  2IHN A;  2AQ0 A;  4Y2Y A;  7ICS A;  3KFU F;  1EXN A;  1A77 A;  5EWF A;  2KZM A;  2ZIX B;  1NKC A;  2R8I A;  4U7C A;  1DK2 A;  3JPT A;  4LJX A;  4J9O A;  1IXR A;  3N28 A;  8ICW A;  2LM1 A;  4I2I A;  3TAP A;  1M6Y A;  3MFH A;  1UQV A;  3K4G A;  5KFD A;  5J0U A;  4J9N A;  2H3I A;  3EZ5 A;  8ICL A;  3T5J A;  2F8K A;  1ZRM A;  2H3Z A;  4ED7 A;  1KW4 A;  4O3R A;  8ICQ A;  4MFC A;  1ZD4 A;  5KFE A;  2CPR A;  2WF7 A;  4JUZ A;  4G3I A;  5IIO A;  2JXJ A;  5ALE A;  3UM9 A;  8ICF A;  3KTQ A;  1Q46 A;  3RJI A;  3GIJ A;  3QU2 A;  1PUZ A;  5DQG A;  4DQI A;  1JIH A;  4DFD A;  4Y2R A;  2HBJ A;  5JTI A;  5KFM A;  9ICN A;  4FO6 A;  4F4K A;  5KFS A;  1URJ A;  5L1J A;  3KOO A;  5AKK A;  1F5S A;  2HHV A;  3T79 A;  9ICR A;  4DFP A;  4LZD A;  4UAW A;  4I28 A;  3RJE A;  3MC1 A;  4J9R A;  1JXE A;  5DG9 A;  3Q8Q B;  2XY7 A;  4Y2V A;  3GV5 B;  2H3Q A;  4JB3 A;  3HP6 A;  3WK8 A;  1ZQR A;  2UVU A;  3N7S C;  1MN8 A;  4US9 A;  3RAQ A;  3WKD A;  2I9G A;  8ICJ A;  4IR9 A;  3RJK A;  3C23 A;  1NZP A;  8ICB A;  1XO1 A;  3NVW A;  5KFQ A;  3AQE A;  3HKZ C;  4RQ0 A;  3H0R B;  9ICC A;  8ICY A;  4DCC A;  3MAB A;  2N1R A;  4DQR A;  4YFK A;  4P4O A;  3RH4 A;  4KLM A;  5J2H A;  4I2F A;  4M9N A;  3F5A A;  2M9N A;  5J2K A;  5CA7 A;  2A1J A;  1X6I A;  3QE9 Y;  3I28 A;  4O3S A;  3MDA A;  1N56 A;  5BPC A;  4ED6 A;  3SAG A;  3F2D A;  3RJJ A;  9ICE A;  3Q8P B;  3RJH A;  4QW8 A;  1ZQM A;  3KKA C;  2KKP A;  4P0P B;  5KFP A;  1ZQG A;  1PVP A;  1HUZ A;  2AJQ A;  4YN4 A;  4B9S A;  3GDX A;  2NYV A;  3I1Y A;  5AK6 A;  2XGQ A;  2BR0 A;  2UVW A;  4B9N A;  3ETR A;  3SR6 A;  2W3R A;  1QQ7 A;  3QZ7 A;  4AP9 A;  1ZET A;  1X9S A;  4FBT A;  2RDJ A;  2LYA A; 
#chains in the Genus database with same CATH homology
 3IDW A;  3BS5 B;  2KMD A;  5JTI A;  2E8N A;  2KSO B;  2JV3 A;  1SXD A;  5JU5 A;  2LMR A;  3SEN A;  1WWU A;  4PZO A;  2DL0 A;  1PK1 A;  2QB0 B;  4MHV A;  1PK3 A;  1OW5 A;  5L1M A;  2K60 A;  2QAR B;  2KSO A;  2Y9U A;  2E8O A;  2EAN A;  3HIL A;  2YTU A;  1X9X A;  1OXJ A;  5J8Y A;  2GLE A;  5JRT A;  2QAR A;  2E8M A;  2L5Y A;  2Y9T A;  1B0X A;  4RQN A;  2KE7 A;  4RQM A;  3BS5 A;  2DKX A;  1JI7 A;  1X66 A;  2D3D A;  2D8C A;  4IS7 A;  2F44 A;  1COK A;  1LKY B;  2EAP A;  1SXE A;  5KNI A;  1V85 A;  2QB0 A;  2F3N A;  3SEI A;  3BS7 A;  2LPE A;  1B4F A;  3H8M A;  5F3X B;  2FE9 A;  1PK1 B;  1UQV A;  1Z1V A;  4PZN A;  1UCV A;  2B6G A;  1SV0 C;  2EAM A;  1X40 A;  2ESE A;  3KKA C;  4NJ8 A;  2ES6 A;  3BQ7 A;  1V38 A;  1WWV A;  2F8K A;  1SGG A;  1F0M A;  1SV0 A;  1KW4 A;  3KKA A;  3TAD C;  4NL9 C;  1DXS A;  2KG5 A;  2QKQ A;  2KIV A;  3TAD A;  4NL9 A;  2DKZ A;  2E8P A;  2K4P A;  3K1R B;  3TAC B;  1RG6 A;  1SV4 A;  2EAO A;  2QB1 A;  5J8Y C;  1LKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...