2E8OA

Solution structure of the n-terminal sam-domain of the sam domain and hd domain containing protein 1 (dendritic cell-derived ifng-induced protein) (dcip) (monocyte protein 5) (mop-5)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
b'GSSGSSGSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM domain and HD domain-containing protein 1
molecule tags Signaling protein
source organism Homo sapiens
publication title Solution structure of the N-terminal SAM-domain of the SAM domain and HD domain containing protein 1 (Dendritic cell-derived IFNG-induced protein) (DCIP) (Monocyte protein 5) (MOP-5)
rcsb
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8oA01
2ESEA 2F3NA 2E8MA 3BS5A 1X66A 2KE7A 5JU5A 1WWUA 2E8NA 3KKAC 1X9XA 1KW4A 2D3DA 2B6GA 1COKA 4RQMA 3BS5B 1DXSA 3TACB 2FE9A 3IDWA 1SGGA 2D8CA 1SV4A 2Y9TA 2E8PA 3K1RB 5F3XB 1UCVA 2L5YA 5KNIA 3H8MA 4NL9A 1F0MA 4RQNA 3HILA 5L1MA 1B4FA 1RG6A 2QARB 2GLEA 1PK1A 2KMDA 2KSOA 3SEIA 1JI7A 1V38A 2EANA 3TADA 1WWVA 2F8KA 2EAPA 2LMRA 3BS7A 5J8YC 1UQVA 5J8YA 5JTIA 2QB0B 5JRTA 2ES6A 4NJ8A 2JV3A 2YTUA 4NL9C 1LKYA 3TADC 2QARA 4PZOA 2QKQA 1SV0C 2KSOB 1B0XA 1SV0A 3SENA 1LKYB 2QB1A 1SXDA 2QB0A 1X40A 1V85A 3BQ7A 1OW5A 4IS7A 2DL0A 4MHVA 2KG5A 1Z1VA 2E8OA 1PK1B 1SXEA 2F44A 2EAOA 2K4PA 4PZNA 2DKZA 2K60A 1PK3A 3KKAA 2KIVA 2Y9UA 1OXJA 2EAMA 2LPEA 2DKXA
chains in the Genus database with same CATH superfamily
1Y88A 5HHIA 4F5QA 4JV0A 5CJ7A 8ICFA 1BVSA 4DOBA 2OM6A 9ICNA 4RQ3A 4MF2A 5FP0A 5EE0A 2B6GA 3QE9Y 5AM4A 2FLLA 1NZBA 1RXVA 2ZXIA 5ALPA 4ELVA 4IL6U 3RB4A 4JV1A 2BQRA 3V7KA 1YT3A 2ZIVA 3HRDD 2WFAA 5ALIA 4EEYA 4R63A 4O3MA 2KKPA 4LZGA 7ICEA 3NRWA 1L3SA 7ICFA 2C2RA 4QZGA 4YQWA 1BPBA 4GXKA 5KFJA 2PMZC 3JPSA 3M9OB 3LYSA 1BPDA 2KOBA 1MC8A 5AKIA 3WK8A 3F5AA 4KMOB 5H2FU 2BPFA 3TADA 4ED0A 2UVWA 3QUBA 2OWOA 9ICGA 4DOCA 1HIWA 2JR5A 1Q3UA 5KFRA 2JEGA 4QZ9A 4F2RA 3GILA 4ICAA 5C0YA 4EYHB 2ZIUB 1Q3VA 3KFUF 1SL0A 4O5CA 2J6UA 1UHUA 1P7DA 8ICSA 9ICEA 3RJHA 2XY7A 4M2YA 1T3QA 2AGQA 5DG8A 2DL0A 4RPYA 4Z6EA 2GO7A 1BPYA 5ALJA 1RQNA 2V4RA 3NVYA 4Y2TA 3C2MA 2E3TA 2W9AA 4I29A 4MEXA 3ISDA 3QU5A 3K4GA 1X42A 3PNCA 4C8LA 5DKWA 3RAQA 4DQRA 4CF5A 4KLJA 3F2DA 4ECXA 1WWUA 2AU0A 1AROP 3B9JA 1D9FA 3BZKA 1TK0A 2P66A 3Q8QB 5KT5A 2WF5A 3TI0A 2D8CA 1SV4A 2E8PA 4O5KA 2W3SA 4GIBA 7ICOA 4KN4A 3FDSA 2ASDA 4BGDA 4C7ZA 2W8KA 3GIJA 2B21A 4P0PA 3D6JA 4FS1A 4IC9A 1NNLA 4PGQA 2H5XA 2W7PA 3WK6A 5ALQA 2F1JA 3E2EA 1B4FA 1D8LA 1ZD3A 4FE3A 5ALFA 1PUZA 2H3VA 3OJUA 4M47A 5ALEA 1SL2A 4DQPA 2A1AA 2F76X 4I2CA 2ALZA 5G5HA 5KFHA 1ZQEA 5JRTA 2ES6A 1LKYA 5KFDA 2R18A 4KLUA 5AI8A 5D4BA 5ALOA 3UXOA 5DDMA 1A77A 4YR0A 2QB0A 5KG3A 3HPOA 5J2EA 3A0HU 1VLBA 3RR8A 3H40A 2KG5A 5AKHA 4F50A 1UA0A 2JEJA 3SAFA 4RNNA 3KBBA 3N7RC 5AKJA 1TVAA 1S10A 4NXZA 2XCAA 3IRUA 4PZNA 4E0DA 2W9CB 2ZTEA 1N61A 3JPRA 4DO9A 3RJJA 3ED5A 2E1EA 3BZCA 4Q45A 4MF8A 5ALDA 3C21A 4EX7A 4UAZA 2F3NA 2ZIWB 2WTFA 5KT7A 2RRDA 4PHDA 4WJ3B 3M6KA 3PMNA 1ZQMA 1ZQYA 1X9XA 1X9SA 3B0XA 5HR7A 7ICSA 1ZQOA 2NRXA 8ICCA 3PSPA 3UPQA 1SKWA 4LZDA 2XGPA 3MGHA 5KFSA 1U4BA 2WB1C 4RU9A 1PVRA 4YN4A 2HHVA 4PGXA 2A1JB 3JPPA 1ZQHA 4KTQA 2KHQA 2NRVA 4U6PA 2AXTU 2JZBA 4C7YA 2AH5A 2RDJA 2GLEA 1ZRMA 5F9LA 4KLDA 1XU4A 3PVXA 2MAXA 3PSFA 1N62A 3T5LA 4M9HA 3IG8A 4IRDA 7ICUA 1L3VA 4HAIA 3UXNA 3BJYA 2V9WA 2A1JA 4OO1J 5DBAA 1SKSA 5KFNA 4AYBC 2PKEA 4XA5A 5KTQA 2VANA 4I2FA 1LKYB 4M6WA 9ICAA 1SKRA 3PW4A 1XWLA 1YZ7A 5AK3A 1NJYA 2NRWA 5ALXA 7ICHA 2PFPA 5J0RA 2IOHA 3L5KA 5J0OA 4NWIA 4DL6A 8ICMA 2ZUCA 5JUMA 1BPZA 1ZYQA 4DFJA 5KFVA 1KFTA 3HWTA 4BJQA 4CF3A 2XY5A 4BUGA 2OEHA 3KHLA 4J9SA 5KFLA 3HP6A 2BGWA 2F1IA 2XIDA 3U26A 5IIOA 1QSYA 4ELTA 4Q44A 5KFYA 5IIJA 4O3OA 1HEKA 3M1YA 2A3VA 3EPGA 4RQ5A 5L1IA 3TAPA 8ICYA 3N28A 5BPCA 3D2SA 4AYBF 4DL3A 2IHMA 7ICNA 8ICRA 2NO4A 2L5YA 2HOQA 4DWIA 1ZQZA 2KHVA 3PO5A 4J9MA 4DLEA 2KJ9A 3SI8A 2FMSA 1JMSA 5DG9A 2F77X 5KAFU 3H0LB 4BDPA 5CRXA 4QJFB 5CP2A 1ZD5A 1XNSA 5J8YC 4DSFA 1K1QA 4M9JA 3ZDEA 2KZ3A 4QZFA 5D49A 3FM9A 3ZD9A 3HT3A 3RB6A 5ALGA 4DFPA 3PR5B 2PI4A 7ICJA 5DB8A 1S0MA 3SV3A 2WF8A 2EDUA 1U49A 3DV9A 4F5PA 2W03A 4ECTA 2QB1A 4CE6A 5J2JA 1ZJNA 4GFJA 4EZ9A 3IG5A 4RPXA 4TUPA 1XO0A 3EPIA 2KFNA 5DB7A 2K8AA 2HI0A 4UW9A 1X9WA 3KOOA 4BX9C 1BNOA 4IQUA 4P4OA 5KFOA 4R8UB 4EBEA 3AM9A 5HP4A 4ECVA 2ASJA 9ICBA 1RYRA 4Y2PA 5J29A 2KP7A 5DB6A 2YB4A 2GOLA 5AKLA 4K4HA 2ZXHA 3QUCA 1ZQTA 4QW9A 3KHGA 2HBMA 3RH4A 3ZDBA 4UARA 3QEBZ 3ETLA 4RQ1A 4YXMA 4TURA 2VA2A 4DSKA 4R64A 3UMBA 1N56A 2EZZA 7ICLA 1TE2A 4FO6A 2Y1JA 2KVSA 1L7NA 2HW3A 1RM6C 4P4PA 3I76A 2EZXA 2N1RA 3HILA 4FZNA 1S0VA 2ZUBA 1QQ5A 4KX3A 3DEEA 3CP8A 4KLGA 2HHSA 1X2IA 3NS1A 4ED3A 4F2SA 5KFPA 4EEKA 1UQVA 2JXJA 2YB1A 4DF4A 1RYSA 4NJ8A 5AM5A 4NLCA 3H8WA 2WAQF 1KEJA 5AIBA 3BDPA 4P0QA 4MFFA 3GQCA 2ZG6A 4J9KA 2W8LA 4PHPA 2RQ5A 3TQ1A 2IA6A 2WF9A 1NK7A 1X40A 2I1QA 1AQ6A 5KFFA 1WCLA 1Z4NA 2G0AA 1XSPA 1OW5A 4J9LA 2ZTDA 5J2HA 2E1FA 1Z00B 2KN7A 4YG2A 1OUQA 8ICZA 5J0SA 3RRHA 4RQ7A 3L4PA 4QZEA 3H4BA 2NO5A 3V6JA 3GIKA 1YZ6A 1TK5A 3QZ7A 5AIAA 4IRCA 1HUZA 4FBUA 1TAUA 9ICQA 2HDOA 3PW2A 3MFIA 2Q0ZX 2YY6A 3WK9A 3MR2A 3JPOA 4DQSA 4QZBA 3NVVA 4YD1A 3QZ8A 4CGZA 4B9MA 3LVVA 1FIQA 1TK8A 5KT4A 2ATLA 3G6YA 4IQTA 3T3FA 5AI4A 2BQUA 3KHRA 2M9NA 4JUZA 2OYYA 1RDFA 3G6VA 4PJ0U 4US9A 4EENA 2DGZA 4NLKA 3H8MA 5ALZA 2BCVA 2KKVA 4M9GA 4RNOA 3GDXA 3SEIA 1T4GA 4M9NA 2PMZF 1NK4A 1C20A 3QXGA 3VCBA 9ICHA 4Q8FA 4QWEA 8ICEA 4YVZA 3Q8PB 5BOLA 3JPNA 4DSJA 4JB3A 3F5EA 2GWSA 2UVUA 5DLFA 2MRLA 2HSZA 5ALSA 3SQIA 2MUTA 3IN5A 3MDAA 3SZ2A 1UA1A 5AHXA 2W11A 2W9BA 2ZJ8A 5AM3A 1QSLA 2LYAA 5AICA 4DOAA 2KTQA 1IG6A 5KL8B 1KDHA 1IXRA 2JH1A 5G5GA 4DS4A 5L1KA 2ZIVB 4FZLA 2DPIA 1OXJA 5DGAA 1COOA 8ICOA 4OJ6A 5J0TA 4O3NA 5HR6A 3MR6A 1U45A 1PZNA 4C4RA 9ICPA 3Q8MA 1KW4A 2GH1A 4Y2YA 3PR4A 3GIMA 3RRGA 1COKA 4I2BA 3BS5B 2HOFA 2FPKA 3IDWA 3AN1A 2IOFK 4NLNA 3LWLA 5J0WA 4OJLA 3MGVA 5KFEA 2LI6A 3NUQA 3EZ5A 2RDIA 4B9NA 3TKAA 1XSLA 3RJEA 3TFRA 3GV8B 4C80A 4K4GA 3V6KA 4NL9A 2LHTA 4B9UA 4O3QA 5KFBA 4DS5A 1ZQGA 8ICBA 3Q8LA 2BR0A 2ISOA 1JRPA 1U9LA 1L7OA 4DCCA 1NKEA 2EH9A 2O6KA 2LMRA 1ZQRA 4I2HA 2A19A 1DOQA 2QLTA 5KT3A 2G5HB 2OCEA 2HHUA 1JUDA 3H4DA 5AKGA 4BWJA 4J9RA 2KSOB 4F92B 4Z6CA 2G08A 5ALKA 3UMGA 2DFLA 3SENA 5EWFA 1SXDA 3PZPA 3PX6A 5AK5A 4EYIB 4F93B 3JPQA 3H8JA 2R8KA 3NRZA 3OPXA 2VJ4A 1SWWA 3UQ0A 4G3IA 1QH9A 3LDAA 4QWDA 5A0LA 3C5FA 1NK5A 1UT8A 3AUOA 5KAIU 2KIVA 3WKBA 8ICGA 3NTUA 4F4YA 4CNQA 2LM1A 2DKXA 3N7PD 2XCPA 3LWMA 1JIHA 3AU6A 8ICHA 7ICQA 7ICVA 5L9XA 3AU2A 3ALRA 4M9LA 2IHNA 3TFSA 1IV8A 5F9NA 2EZYA 2VIXA 4ECWA 3SR6A 1GO3F 2HHXA 4YP3A 2LBOA 1ZD4A 2P35A 1S8OA 3OHAA 4F4WA 4BXOB 3KHHA 2WF7A 2Y0SF 3V72A 3J81j 2YX8A 4LVSA 4CCHA 4GC7A 8ICLA 1J2MA 1ZQLA 4RQNA 2DWQA 1D8BA 4ECYA 3T5KA 2KMDA 1JI7A 3C28A 3WU2U 2PFNA 1U48A 2FLPA 1HJPA 3AQFA 2F8KA 4QWBA 4FS2A 5AKYA 4F3OA 3BS7A 7ICKA 4UBCA 5HMLA 3V6HA 4ZH4A 2P6RA 4DSEA 4I2GA 2F8LA 8ICJA 3LVWA 4CDGA 4O3RA 5BOMA 5DQIA 2JMGA 4QZ8A 4RPZA 2UVVA 1BNPA 2I5HA 3QX7A 2MU2A 4NM1A 4NLZA 4XUSA 1XO1A 4M6WB 4OD0A 2ZIXA 1XS9D 3FAHA 5TZVA 3TARA 4QZIA 1PK1B 2H3QA 4USAA 4QZCA 4F8RA 3MR5A 4Z6DA 5KFTA 4U7CA 3RJKA 2HBJA 2FI1A 3QEAZ 4ED6A 2WHEA 4P2HA 2DQNB 4UATA 5ALTA 1Q46A 2W9MA 4B9TA 1CEZA 4MEYA 5EE3A 3RJGA 1F5SA 3IV6A 5JU5A 9ICWA 4ED7A 1MQ3A 1L5UA 1ZQDA 4RQMA 5L1LA 4C4TA 3PX4A 2VA3A 3CRXA 1B43A 5DBBA 4RT3A 3UXPA 4GXJA 5AKEA 4UB3A 1LVHA 3C23A 4ECZA 2G07A 2AJQA 3N4MB 2XICA 3SD7A 1NK9A 2J6SA 3WKEA 1KLNA 2WB1F 1DGJA 1L6NA 2ZIWA 3UMCA 3PX0A 5IIKA 2HHQA 4I2IA 4A8EA 4F4KA 1QQ6A 2KEYA 2J6TA 2BCSA 4UB8U 2EAPA 4UAVA 4XRHA 4YD2A 1MQ2A 4ECRA 5JTIA 9ICIA 3N7SC 1RXWA 1QSSA 2XVTA 3M9MB 2YTUA 4KLOA 4YCXA 3B0YA 4PZOA 5J2DA 1SV0C 1KBUA 2W54A 1RPLA 4O3PA 5L1JA 4I2DA 5CEHA 2R8HA 4EBCA 2KIWA 2ISPA 1Z19A 2NRZA 2NYVA 4I2EA 5IIMA 1T94A 3S6JA 4I28A 9ICOA 4UAWA 1NOMA 3MGIA 2VA8A 1SXEA 5ALYA 5AM1A 8ICNA 3SV4A 2H3IA 4TQRA 5J0XA 1LB2B 2DKZA 1KL9A 2XC9A 5GTHU 2LYBA 4DLGA 2BPGA 5AKKA 4DFDA 3SYZA 1HUOA 5KFZA 4EELA 4IQWA 8ICVA 2ESEA 3WKAA 2E8MA 4OJ5A 2E8NA 1L7PA 3WK7A 5KFIA 3RBDA 4NV0A 2HBKA 5CWRA 2KK0A 2CPRA 2W9CA 2JRZA 4F5RA 1ZQUA 5B66U 1O08A 2DF4B 2KV2A 2MA1A 1LV5A 2ASLA 5IIIA 1T8EA 8ICXA 4J9OA 4KITB 3K1RB 1J97A 2M0NA 5KT2A 5J2CA 4QW8A 1WUDA 3ONNA 1TKDA 5DGBA 5KG7A 3BQ0A 4PH5A 2C28A 4M04A 2OXOA 4UBBA 3HJEA 1F0MA 2RHFA 9ICSA 2QARB 1NKBA 5J2KA 1PK1A 7ICMA 1JROA 1SL1A 2P6UA 1A6SA 3RH6A 4QNLA 1JXEA 2MSNA 4NL9C 3WK5A 2KVCA 1NJZA 2W7OA 1KTQA 1ZQWA 2KFZA 4RQ4A 1CRXA 4I2JA 2FMQA 5IILA 3OTQA 5AM0A 4P0PB 9ICRA 1NJXA 4JWNA 1EXNA 3OJSA 1SIJA 5KFGA 2KNJA 4RUAA 1KSPA 3NVWA 1S97A 2E8OA 4BXOA 3M7DA 1JN3A 4UB2A 4OJPA 2JZBB 1L3UA 1VJ5A 3C1YA 1PK3A 3KKAA 5J2AA 1ED1A 3CYMA 1ZJMA 2IOFA 8ICPA 2LPEA 4XQ8A 1JALA 4GLXA 1ZQVA 1X66A 2CN1A 3PW5A 4UQGA 4CF4A 4RQ0A 2BZFA 4X5VA 1DXSA 4Y2JA 4IRKA 5CHGA 2K4EA 1NK6A 3MFHA 1ZQBA 4NY8A 1BPXA 4UASA 3PO4A 5HNKA 8ICAA 4QZDA 3OHBA 2W3RA 1U47A 2HBLA 3IP4B 1NI3A 3VC8A 4F71A 5ALWA 2FPMA 4Y2XA 4R65A 3C2KA 5KFKA 3UQ2A 3T5HA 3CW2C 1KFSA 4TUSA 2KJ8A 1DK3A 4F5NA 5J8YA 1Z00A 2BCRA 3Q8KA 3KZIU 2K8CB 1NZPA 2JV3A 5ALRA 5ALHA 1ZQFA 4YR2A 3M8SA 3ISCA 5DBCA 2WF6A 2BDPA 3QU4A 3MC1A 2LYHA 5EOZA 8ICQA 9ICXA 1UPHA 1X6JA 4C8KA 4O0IA 3F2BA 5DB9A 1URJA 3K75D 5AI6A 1QCKA 3H0MB 3ZDDA 3EW9A 3M9NB 1KFDA 4C8NA 3TAQA 1XSNA 2PXIA 4CRXA 3SAGA 2MUTB 2Y9UA 2F1HA 4J9PA 9ICKA 2NV3A 1O03A 3EUB2 5K4LA 2YMLA 2CRXA 2R8JA 3BS5A 4PGYA 4PHEA 3HX0A 2Z7JA 2G06A 5ALMA 4DL7A 5CR0A 3WKDA 2Q4TA 3M6ZA 5KG6A 4Y2RA 3TACB 4JV2A 5KG1A 2K4HA 3D2QA 1M6YA 5EE1A 4P4MA 1B22A 3RBEA 2ZJ5A 4ED8A 1V9PA 4F5OA 2BPCA 1WG8A 2H3ZA 2D6FC 4F4XA 1N5WA 1BGXT 8ICKA 3IHQB 2I6XA 4B6JA 3RTVA 1H38A 5AK6A 1SWVA 4GC6A 3FYHA 2DBYA 5ALVA 4C8MA 5AI9A 2K4IA 2DPJA 5J0QA 3THVA 5B5EU 2HHWA 2ZIUA 2QKQA 3QU2A 4F4ZA 3ICXA 5CA7A 4KLTA 1SV0A 4MFCA 4ED1A 4Y2QA 1L8OA 4C8OA 5AKXA 3BQ1A 5CB1A 1T3NA 2JH7A 4NLBA 4IS7A 4DQIA 2ZTCA 4GXIA 2KJ5A 4DQQA 1DRGA 3ZDAA 1MA7A 4B9SA 1ZQKA 3AEVA 2AQ4A 1ZXIA 2F44A 3RAXA 1TV9A 5J2FA 4FBTA 5KG2A 2EAMA 4PPXA 3QUTA 4ECQA 2HHTA 3KTQA 4QZAA 3RFAA 4Q43A 3C1ZA 2C2DA 4I2AA 4JWMA 4Z6FA 2AGOA 5KFUA 3AMZA 2BQ3A 2KD1A 4TUQA 3KKAC 2NRTA 4YMNA 1RQLA 4O9MA 4QZHA 2FDRA 1K5OA 2FJ6A 3GV7B 2I9GA 2XI9A 5KNIA 1ZQNA 1N48A 3PW0A 3KZXA 4KLSA 5TISU 4HYKA 3NGDA 5AI0A 5J0YA 1ZQJA 4EX6A 2JEFA 4UAUA 1CI4A 3FC4A 3JPTA 3QNMA 5DQHA 5ALUA 3RF9A 1V97A 3BQTA 2PFQA 9ICCA 5GTIU 5KFAA 3QU7A 2HOIA 4F72A 1J2NA 3MBYA 1ZQIA 4KLMA 7ICRA 2Y0SC 1C7YA 1X6IA 2V4QA 5DQGA 1JX4A 4YR3A 3QYPA 4J9NA 4FFDA 3LK9A 1ZQXA 1IIPA 5EE9A 9ICFA 3V7JA 2PFOA 2OH2A 4PL2A 4YXJA 3MABA 1ZQPA 2HVIA 3BQ7A 3Q8SB 2CXYA 2G5IB 3SMVA 4LJXA 3H8SA 4DL2A 4US8A 3RB3A 4DF8A 4ECUA 3H7IA 2YN4A 5C5JA 2JGAA 3ZI4A 1X9MA 3ZD8A 4ACOA 1IM4A 4RQ6A 4UAYA 2HMXA 4JMUA 8ICWA 4RT2A 2JHDA 3ORYA 4C0ZA 5AM2A 2B0CA 2KE7A 4RQ8A 1N60A 5KFCA 1ZD2P 2HCFA 1L8LA 2BHNA 3E58A 5KG5A 3NASA 4BWMA 5KFQA 4ELUA 4QWCA 3RR7A 3L3FX 5AI5A 3QU9A 3H0RB 1ZQ1C 1MSWD 2W04A 4JK1A 4R8UA 1N63A 4DFMA 1KN5A 3TANA 9ICUA 5L1MA 1RG6A 1V38A 4QIWC 1RYUA 2XY6A 1SB3C 2ZJAA 3CNHA 4YMOA 1KRPA 1N2XA 1Z1BA 1WWVA 4F91B 3K1ZA 1N5XA 2AGPA 4NM2A 2PI5A 4Y2VA 8ICUA 4KMUA 9ICJA 3TADC 2KZMA 5J2GA 1B0XA 1KKXA 5KG0A 3O0FA 3C2LA 3PSTA 3UM9A 2R8IA 4RUCA 2DUYA 1S77D 2BKEA 4J03A 2YMQA 3G6XA 4KN7A 3EWAA 3OSNA 4MHVA 1L7MA 3SAHA 2C2EA 1JXLA 2JEIA 2K60A 4ECSA 2BDUA 2E5SA 2K89A 4DSIA 4IQVA 1Z4OA 2FPLA 5J0PA 4KLQA 4C4SA 2AQ0A 2RLTA 1PVQA 4O5EA 3PV8A 4UB6U 3HKZC 1ZETA 3WK4A 3GFKB 3Q8RB 1DGSA 1ZQCA 1SZHA 7ICGA 2FE9A 5DG7A 5ALNA 1SGGA 1FFUA 1S0NA 4Y2SA 1A0PA 3T5JA 5F3XB 4UB4A 4DL5A 2KICA 3A0BU 4PL1A 3R9KA 3ZDCA 2ZIXB 4UB1A 2LKYA 1QLNA 2Y1IA 4P0QB 3N97B 4KLHA 3E0FA 1Q8KA 5J0UA 4I27A 1S9FA 4ED2A 1S0OA 4RQ2A 5KFXA 3C29A 5HHHA 2W9BB 2RP5A 2VJ5A 1TAQA 1ZQQA 2QARA 3EYZA 2VKQA 1TFRA 2ODGA 1BPEA 2WAQC 3ISBA 2OHFA 3BQ2A 2FLNA 5KL1B 3D2NA 5EWGA 9ICVA 1V85A 4TQSA 4OCZA 3F2CA 1UT5A 2LM4A 3RB0A 3AQEA 3I1YA 1DK2A 3F53A 1FO4A 1S76D 4DFKA 1Z1VA 2EQYA 1A76A 1F44A 4IR9A 9ICMA 1QQ7A 2XGQA 2G09A 2EAOA 2K4PA 9ICLA 4K4IA 2W55A 1QTMA 5J2IA 3HKZF 5AKZA 5DLGA 1ZQSA 5HMMA 1ECWA 4OJOA 3V7LA 2FMPA 3WKCA 4M0AA 5E79U 1NKCA 4R66A 3GIIA 3GV5B 4QIWF 1S5LU 1FFVA 1NK8A 2W43A 4UB5A 4EBDA 5ALLA 1FEZA 2D3DA 2KZZA 3I28A 4RNMA 7ICIA 3PMLA 2H3FA 2YQEA 2C22A 4O3SA 1ZRNA 2AHOB 4KLEA 1NJWA 2Y9TA 5EWEA 5DDYA 3MDCA 9ICTA 1VDVA 2ZUDA 4ZOHC 3GZFA 4FZMA 1UCVA 5D46A 3OSPA 1SZPA 4J9QA 4KX5A 4EZ6A 4DEZA 1ZOLA 1T7PA 4RZRA 4G9BA 5KG4A 1MN8A 4B9LA 3RJFA 3PSIA 2KSOA 2EANA 1PVPA 1D9DA 3M8RA 1K1SA 1WCNA 1RZTA 1TAMA 1KQQA 2XO7A 3C5GA 3DDHA 5IINA 4Y2UA 1XC9A 2K8BB 1Z3EB 2QB0B 2UVRA 3NVZA 2IMWP 5KFWA 1D8YA 3OGUA 1CUKA 4MFAA 4PHAA 2YMPA 5KFMA 3IM1A 1L3TA 3QUQA 3KD3A 4KLFA 4YMMA 2YMMA 5J2BA 5T14A 7ICTA 1NK0A 2BCUA 3RJIA 4DL4A 2IBKA 4DSLA 3HW8A 2R8GA 4KLIA 2HVHA 3PY8A 3MR3A 4IR1A 3ETRA 3RH5A 1ZQAA 4NLGA 4Q8EA 3PW7A 3GU3A 4YFKA 4B9VA 2F2AB 2BCQA 4QWAA 3AL0B 5AK4A 4AP9A 4KLLA 3T79A 8ICIA 8ICTA 5KT6A 7ICPA 1WYGA
chains in the Genus database with same CATH topology
2ESEA 2F3NA 2E8MA 3BS5A 1X66A 2KE7A 5JU5A 1WWUA 2E8NA 3KKAC 1X9XA 1KW4A 2D3DA 2B6GA 1COKA 4RQMA 3BS5B 1DXSA 3TACB 2FE9A 3IDWA 1SGGA 2D8CA 1SV4A 2Y9TA 2E8PA 3K1RB 5F3XB 1UCVA 2L5YA 5KNIA 3H8MA 4NL9A 1F0MA 4RQNA 3HILA 5L1MA 1B4FA 1RG6A 2QARB 2GLEA 1PK1A 2KMDA 2KSOA 3SEIA 1JI7A 1V38A 2EANA 3TADA 1WWVA 2F8KA 2EAPA 2LMRA 3BS7A 5J8YC 1UQVA 5J8YA 5JTIA 2QB0B 5JRTA 2ES6A 4NJ8A 2JV3A 2YTUA 4NL9C 1LKYA 3TADC 2QARA 4PZOA 2QKQA 1SV0C 2KSOB 1B0XA 1SV0A 3SENA 1LKYB 2QB1A 1SXDA 2QB0A 1X40A 1V85A 3BQ7A 1OW5A 4IS7A 2DL0A 4MHVA 2KG5A 1Z1VA 2E8OA 1PK1B 1SXEA 2F44A 2EAOA 2K4PA 4PZNA 2DKZA 2K60A 1PK3A 3KKAA 2KIVA 2Y9UA 1OXJA 2EAMA 2LPEA 2DKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESE A;  2F3N A;  2E8M A;  3BS5 A;  1X66 A;  2KE7 A;  5JU5 A;  1WWU A;  2E8N A;  3KKA C;  1X9X A;  1KW4 A;  2D3D A;  2B6G A;  1COK A;  4RQM A;  3BS5 B;  1DXS A;  3TAC B;  2FE9 A;  3IDW A;  1SGG A;  2D8C A;  1SV4 A;  2Y9T A;  2E8P A;  3K1R B;  5F3X B;  1UCV A;  2L5Y A;  5KNI A;  3H8M A;  4NL9 A;  1F0M A;  4RQN A;  3HIL A;  5L1M A;  1B4F A;  1RG6 A;  2QAR B;  2GLE A;  1PK1 A;  2KMD A;  2KSO A;  3SEI A;  1JI7 A;  1V38 A;  2EAN A;  3TAD A;  1WWV A;  2F8K A;  2EAP A;  2LMR A;  3BS7 A;  5J8Y C;  1UQV A;  5J8Y A;  5JTI A;  2QB0 B;  5JRT A;  2ES6 A;  4NJ8 A;  2JV3 A;  2YTU A;  4NL9 C;  1LKY A;  3TAD C;  2QAR A;  4PZO A;  2QKQ A;  1SV0 C;  2KSO B;  1B0X A;  1SV0 A;  3SEN A;  1LKY B;  2QB1 A;  1SXD A;  2QB0 A;  1X40 A;  1V85 A;  3BQ7 A;  1OW5 A;  4IS7 A;  2DL0 A;  4MHV A;  2KG5 A;  1Z1V A;  2E8O A;  1PK1 B;  1SXE A;  2F44 A;  2EAO A;  2K4P A;  4PZN A;  2DKZ A;  2K60 A;  1PK3 A;  3KKA A;  2KIV A;  2Y9U A;  1OXJ A;  2EAM A;  2LPE A;  2DKX A; 
#chains in the Genus database with same CATH topology
 1Y88 A;  5HHI A;  4F5Q A;  4JV0 A;  5CJ7 A;  8ICF A;  1BVS A;  4DOB A;  2OM6 A;  9ICN A;  4RQ3 A;  4MF2 A;  5FP0 A;  5EE0 A;  2B6G A;  3QE9 Y;  5AM4 A;  2FLL A;  1NZB A;  1RXV A;  2ZXI A;  5ALP A;  4ELV A;  4IL6 U;  3RB4 A;  4JV1 A;  2BQR A;  3V7K A;  1YT3 A;  2ZIV A;  3HRD D;  2WFA A;  5ALI A;  4EEY A;  4R63 A;  4O3M A;  2KKP A;  4LZG A;  7ICE A;  3NRW A;  1L3S A;  7ICF A;  2C2R A;  4QZG A;  4YQW A;  1BPB A;  4GXK A;  5KFJ A;  2PMZ C;  3JPS A;  3M9O B;  3LYS A;  1BPD A;  2KOB A;  1MC8 A;  5AKI A;  3WK8 A;  3F5A A;  4KMO B;  5H2F U;  2BPF A;  3TAD A;  4ED0 A;  2UVW A;  3QUB A;  2OWO A;  9ICG A;  4DOC A;  1HIW A;  2JR5 A;  1Q3U A;  5KFR A;  2JEG A;  4QZ9 A;  4F2R A;  3GIL A;  4ICA A;  5C0Y A;  4EYH B;  2ZIU B;  1Q3V A;  3KFU F;  1SL0 A;  4O5C A;  2J6U A;  1UHU A;  1P7D A;  8ICS A;  9ICE A;  3RJH A;  2XY7 A;  4M2Y A;  1T3Q A;  2AGQ A;  5DG8 A;  2DL0 A;  4RPY A;  4Z6E A;  2GO7 A;  1BPY A;  5ALJ A;  1RQN A;  2V4R A;  3NVY A;  4Y2T A;  3C2M A;  2E3T A;  2W9A A;  4I29 A;  4MEX A;  3ISD A;  3QU5 A;  3K4G A;  1X42 A;  3PNC A;  4C8L A;  5DKW A;  3RAQ A;  4DQR A;  4CF5 A;  4KLJ A;  3F2D A;  4ECX A;  1WWU A;  2AU0 A;  1ARO P;  3B9J A;  1D9F A;  3BZK A;  1TK0 A;  2P66 A;  3Q8Q B;  5KT5 A;  2WF5 A;  3TI0 A;  2D8C A;  1SV4 A;  2E8P A;  4O5K A;  2W3S A;  4GIB A;  7ICO A;  4KN4 A;  3FDS A;  2ASD A;  4BGD A;  4C7Z A;  2W8K A;  3GIJ A;  2B21 A;  4P0P A;  3D6J A;  4FS1 A;  4IC9 A;  1NNL A;  4PGQ A;  2H5X A;  2W7P A;  3WK6 A;  5ALQ A;  2F1J A;  3E2E A;  1B4F A;  1D8L A;  1ZD3 A;  4FE3 A;  5ALF A;  1PUZ A;  2H3V A;  3OJU A;  4M47 A;  5ALE A;  1SL2 A;  4DQP A;  2A1A A;  2F76 X;  4I2C A;  2ALZ A;  5G5H A;  5KFH A;  1ZQE A;  5JRT A;  2ES6 A;  1LKY A;  5KFD A;  2R18 A;  4KLU A;  5AI8 A;  5D4B A;  5ALO A;  3UXO A;  5DDM A;  1A77 A;  4YR0 A;  2QB0 A;  5KG3 A;  3HPO A;  5J2E A;  3A0H U;  1VLB A;  3RR8 A;  3H40 A;  2KG5 A;  5AKH A;  4F50 A;  1UA0 A;  2JEJ A;  3SAF A;  4RNN A;  3KBB A;  3N7R C;  5AKJ A;  1TVA A;  1S10 A;  4NXZ A;  2XCA A;  3IRU A;  4PZN A;  4E0D A;  2W9C B;  2ZTE A;  1N61 A;  3JPR A;  4DO9 A;  3RJJ A;  3ED5 A;  2E1E A;  3BZC A;  4Q45 A;  4MF8 A;  5ALD A;  3C21 A;  4EX7 A;  4UAZ A;  2F3N A;  2ZIW B;  2WTF A;  5KT7 A;  2RRD A;  4PHD A;  4WJ3 B;  3M6K A;  3PMN A;  1ZQM A;  1ZQY A;  1X9X A;  1X9S A;  3B0X A;  5HR7 A;  7ICS A;  1ZQO A;  2NRX A;  8ICC A;  3PSP A;  3UPQ A;  1SKW A;  4LZD A;  2XGP A;  3MGH A;  5KFS A;  1U4B A;  2WB1 C;  4RU9 A;  1PVR A;  4YN4 A;  2HHV A;  4PGX A;  2A1J B;  3JPP A;  1ZQH A;  4KTQ A;  2KHQ A;  2NRV A;  4U6P A;  2AXT U;  2JZB A;  4C7Y A;  2AH5 A;  2RDJ A;  2GLE A;  1ZRM A;  5F9L A;  4KLD A;  1XU4 A;  3PVX A;  2MAX A;  3PSF A;  1N62 A;  3T5L A;  4M9H A;  3IG8 A;  4IRD A;  7ICU A;  1L3V A;  4HAI A;  3UXN A;  3BJY A;  2V9W A;  2A1J A;  4OO1 J;  5DBA A;  1SKS A;  5KFN A;  4AYB C;  2PKE A;  4XA5 A;  5KTQ A;  2VAN A;  4I2F A;  1LKY B;  4M6W A;  9ICA A;  1SKR A;  3PW4 A;  1XWL A;  1YZ7 A;  5AK3 A;  1NJY A;  2NRW A;  5ALX A;  7ICH A;  2PFP A;  5J0R A;  2IOH A;  3L5K A;  5J0O A;  4NWI A;  4DL6 A;  8ICM A;  2ZUC A;  5JUM A;  1BPZ A;  1ZYQ A;  4DFJ A;  5KFV A;  1KFT A;  3HWT A;  4BJQ A;  4CF3 A;  2XY5 A;  4BUG A;  2OEH A;  3KHL A;  4J9S A;  5KFL A;  3HP6 A;  2BGW A;  2F1I A;  2XID A;  3U26 A;  5IIO A;  1QSY A;  4ELT A;  4Q44 A;  5KFY A;  5IIJ A;  4O3O A;  1HEK A;  3M1Y A;  2A3V A;  3EPG A;  4RQ5 A;  5L1I A;  3TAP A;  8ICY A;  3N28 A;  5BPC A;  3D2S A;  4AYB F;  4DL3 A;  2IHM A;  7ICN A;  8ICR A;  2NO4 A;  2L5Y A;  2HOQ A;  4DWI A;  1ZQZ A;  2KHV A;  3PO5 A;  4J9M A;  4DLE A;  2KJ9 A;  3SI8 A;  2FMS A;  1JMS A;  5DG9 A;  2F77 X;  5KAF U;  3H0L B;  4BDP A;  5CRX A;  4QJF B;  5CP2 A;  1ZD5 A;  1XNS A;  5J8Y C;  4DSF A;  1K1Q A;  4M9J A;  3ZDE A;  2KZ3 A;  4QZF A;  5D49 A;  3FM9 A;  3ZD9 A;  3HT3 A;  3RB6 A;  5ALG A;  4DFP A;  3PR5 B;  2PI4 A;  7ICJ A;  5DB8 A;  1S0M A;  3SV3 A;  2WF8 A;  2EDU A;  1U49 A;  3DV9 A;  4F5P A;  2W03 A;  4ECT A;  2QB1 A;  4CE6 A;  5J2J A;  1ZJN A;  4GFJ A;  4EZ9 A;  3IG5 A;  4RPX A;  4TUP A;  1XO0 A;  3EPI A;  2KFN A;  5DB7 A;  2K8A A;  2HI0 A;  4UW9 A;  1X9W A;  3KOO A;  4BX9 C;  1BNO A;  4IQU A;  4P4O A;  5KFO A;  4R8U B;  4EBE A;  3AM9 A;  5HP4 A;  4ECV A;  2ASJ A;  9ICB A;  1RYR A;  4Y2P A;  5J29 A;  2KP7 A;  5DB6 A;  2YB4 A;  2GOL A;  5AKL A;  4K4H A;  2ZXH A;  3QUC A;  1ZQT A;  4QW9 A;  3KHG A;  2HBM A;  3RH4 A;  3ZDB A;  4UAR A;  3QEB Z;  3ETL A;  4RQ1 A;  4YXM A;  4TUR A;  2VA2 A;  4DSK A;  4R64 A;  3UMB A;  1N56 A;  2EZZ A;  7ICL A;  1TE2 A;  4FO6 A;  2Y1J A;  2KVS A;  1L7N A;  2HW3 A;  1RM6 C;  4P4P A;  3I76 A;  2EZX A;  2N1R A;  3HIL A;  4FZN A;  1S0V A;  2ZUB A;  1QQ5 A;  4KX3 A;  3DEE A;  3CP8 A;  4KLG A;  2HHS A;  1X2I A;  3NS1 A;  4ED3 A;  4F2S A;  5KFP A;  4EEK A;  1UQV A;  2JXJ A;  2YB1 A;  4DF4 A;  1RYS A;  4NJ8 A;  5AM5 A;  4NLC A;  3H8W A;  2WAQ F;  1KEJ A;  5AIB A;  3BDP A;  4P0Q A;  4MFF A;  3GQC A;  2ZG6 A;  4J9K A;  2W8L A;  4PHP A;  2RQ5 A;  3TQ1 A;  2IA6 A;  2WF9 A;  1NK7 A;  1X40 A;  2I1Q A;  1AQ6 A;  5KFF A;  1WCL A;  1Z4N A;  2G0A A;  1XSP A;  1OW5 A;  4J9L A;  2ZTD A;  5J2H A;  2E1F A;  1Z00 B;  2KN7 A;  4YG2 A;  1OUQ A;  8ICZ A;  5J0S A;  3RRH A;  4RQ7 A;  3L4P A;  4QZE A;  3H4B A;  2NO5 A;  3V6J A;  3GIK A;  1YZ6 A;  1TK5 A;  3QZ7 A;  5AIA A;  4IRC A;  1HUZ A;  4FBU A;  1TAU A;  9ICQ A;  2HDO A;  3PW2 A;  3MFI A;  2Q0Z X;  2YY6 A;  3WK9 A;  3MR2 A;  3JPO A;  4DQS A;  4QZB A;  3NVV A;  4YD1 A;  3QZ8 A;  4CGZ A;  4B9M A;  3LVV A;  1FIQ A;  1TK8 A;  5KT4 A;  2ATL A;  3G6Y A;  4IQT A;  3T3F A;  5AI4 A;  2BQU A;  3KHR A;  2M9N A;  4JUZ A;  2OYY A;  1RDF A;  3G6V A;  4PJ0 U;  4US9 A;  4EEN A;  2DGZ A;  4NLK A;  3H8M A;  5ALZ A;  2BCV A;  2KKV A;  4M9G A;  4RNO A;  3GDX A;  3SEI A;  1T4G A;  4M9N A;  2PMZ F;  1NK4 A;  1C20 A;  3QXG A;  3VCB A;  9ICH A;  4Q8F A;  4QWE A;  8ICE A;  4YVZ A;  3Q8P B;  5BOL A;  3JPN A;  4DSJ A;  4JB3 A;  3F5E A;  2GWS A;  2UVU A;  5DLF A;  2MRL A;  2HSZ A;  5ALS A;  3SQI A;  2MUT A;  3IN5 A;  3MDA A;  3SZ2 A;  1UA1 A;  5AHX A;  2W11 A;  2W9B A;  2ZJ8 A;  5AM3 A;  1QSL A;  2LYA A;  5AIC A;  4DOA A;  2KTQ A;  1IG6 A;  5KL8 B;  1KDH A;  1IXR A;  2JH1 A;  5G5G A;  4DS4 A;  5L1K A;  2ZIV B;  4FZL A;  2DPI A;  1OXJ A;  5DGA A;  1COO A;  8ICO A;  4OJ6 A;  5J0T A;  4O3N A;  5HR6 A;  3MR6 A;  1U45 A;  1PZN A;  4C4R A;  9ICP A;  3Q8M A;  1KW4 A;  2GH1 A;  4Y2Y A;  3PR4 A;  3GIM A;  3RRG A;  1COK A;  4I2B A;  3BS5 B;  2HOF A;  2FPK A;  3IDW A;  3AN1 A;  2IOF K;  4NLN A;  3LWL A;  5J0W A;  4OJL A;  3MGV A;  5KFE A;  2LI6 A;  3NUQ A;  3EZ5 A;  2RDI A;  4B9N A;  3TKA A;  1XSL A;  3RJE A;  3TFR A;  3GV8 B;  4C80 A;  4K4G A;  3V6K A;  4NL9 A;  2LHT A;  4B9U A;  4O3Q A;  5KFB A;  4DS5 A;  1ZQG A;  8ICB A;  3Q8L A;  2BR0 A;  2ISO A;  1JRP A;  1U9L A;  1L7O A;  4DCC A;  1NKE A;  2EH9 A;  2O6K A;  2LMR A;  1ZQR A;  4I2H A;  2A19 A;  1DOQ A;  2QLT A;  5KT3 A;  2G5H B;  2OCE A;  2HHU A;  1JUD A;  3H4D A;  5AKG A;  4BWJ A;  4J9R A;  2KSO B;  4F92 B;  4Z6C A;  2G08 A;  5ALK A;  3UMG A;  2DFL A;  3SEN A;  5EWF A;  1SXD A;  3PZP A;  3PX6 A;  5AK5 A;  4EYI B;  4F93 B;  3JPQ A;  3H8J A;  2R8K A;  3NRZ A;  3OPX A;  2VJ4 A;  1SWW A;  3UQ0 A;  4G3I A;  1QH9 A;  3LDA A;  4QWD A;  5A0L A;  3C5F A;  1NK5 A;  1UT8 A;  3AUO A;  5KAI U;  2KIV A;  3WKB A;  8ICG A;  3NTU A;  4F4Y A;  4CNQ A;  2LM1 A;  2DKX A;  3N7P D;  2XCP A;  3LWM A;  1JIH A;  3AU6 A;  8ICH A;  7ICQ A;  7ICV A;  5L9X A;  3AU2 A;  3ALR A;  4M9L A;  2IHN A;  3TFS A;  1IV8 A;  5F9N A;  2EZY A;  2VIX A;  4ECW A;  3SR6 A;  1GO3 F;  2HHX A;  4YP3 A;  2LBO A;  1ZD4 A;  2P35 A;  1S8O A;  3OHA A;  4F4W A;  4BXO B;  3KHH A;  2WF7 A;  2Y0S F;  3V72 A;  3J81 j;  2YX8 A;  4LVS A;  4CCH A;  4GC7 A;  8ICL A;  1J2M A;  1ZQL A;  4RQN A;  2DWQ A;  1D8B A;  4ECY A;  3T5K A;  2KMD A;  1JI7 A;  3C28 A;  3WU2 U;  2PFN A;  1U48 A;  2FLP A;  1HJP A;  3AQF A;  2F8K A;  4QWB A;  4FS2 A;  5AKY A;  4F3O A;  3BS7 A;  7ICK A;  4UBC A;  5HML A;  3V6H A;  4ZH4 A;  2P6R A;  4DSE A;  4I2G A;  2F8L A;  8ICJ A;  3LVW A;  4CDG A;  4O3R A;  5BOM A;  5DQI A;  2JMG A;  4QZ8 A;  4RPZ A;  2UVV A;  1BNP A;  2I5H A;  3QX7 A;  2MU2 A;  4NM1 A;  4NLZ A;  4XUS A;  1XO1 A;  4M6W B;  4OD0 A;  2ZIX A;  1XS9 D;  3FAH A;  5TZV A;  3TAR A;  4QZI A;  1PK1 B;  2H3Q A;  4USA A;  4QZC A;  4F8R A;  3MR5 A;  4Z6D A;  5KFT A;  4U7C A;  3RJK A;  2HBJ A;  2FI1 A;  3QEA Z;  4ED6 A;  2WHE A;  4P2H A;  2DQN B;  4UAT A;  5ALT A;  1Q46 A;  2W9M A;  4B9T A;  1CEZ A;  4MEY A;  5EE3 A;  3RJG A;  1F5S A;  3IV6 A;  5JU5 A;  9ICW A;  4ED7 A;  1MQ3 A;  1L5U A;  1ZQD A;  4RQM A;  5L1L A;  4C4T A;  3PX4 A;  2VA3 A;  3CRX A;  1B43 A;  5DBB A;  4RT3 A;  3UXP A;  4GXJ A;  5AKE A;  4UB3 A;  1LVH A;  3C23 A;  4ECZ A;  2G07 A;  2AJQ A;  3N4M B;  2XIC A;  3SD7 A;  1NK9 A;  2J6S A;  3WKE A;  1KLN A;  2WB1 F;  1DGJ A;  1L6N A;  2ZIW A;  3UMC A;  3PX0 A;  5IIK A;  2HHQ A;  4I2I A;  4A8E A;  4F4K A;  1QQ6 A;  2KEY A;  2J6T A;  2BCS A;  4UB8 U;  2EAP A;  4UAV A;  4XRH A;  4YD2 A;  1MQ2 A;  4ECR A;  5JTI A;  9ICI A;  3N7S C;  1RXW A;  1QSS A;  2XVT A;  3M9M B;  2YTU A;  4KLO A;  4YCX A;  3B0Y A;  4PZO A;  5J2D A;  1SV0 C;  1KBU A;  2W54 A;  1RPL A;  4O3P A;  5L1J A;  4I2D A;  5CEH A;  2R8H A;  4EBC A;  2KIW A;  2ISP A;  1Z19 A;  2NRZ A;  2NYV A;  4I2E A;  5IIM A;  1T94 A;  3S6J A;  4I28 A;  9ICO A;  4UAW A;  1NOM A;  3MGI A;  2VA8 A;  1SXE A;  5ALY A;  5AM1 A;  8ICN A;  3SV4 A;  2H3I A;  4TQR A;  5J0X A;  1LB2 B;  2DKZ A;  1KL9 A;  2XC9 A;  5GTH U;  2LYB A;  4DLG A;  2BPG A;  5AKK A;  4DFD A;  3SYZ A;  1HUO A;  5KFZ A;  4EEL A;  4IQW A;  8ICV A;  2ESE A;  3WKA A;  2E8M A;  4OJ5 A;  2E8N A;  1L7P A;  3WK7 A;  5KFI A;  3RBD A;  4NV0 A;  2HBK A;  5CWR A;  2KK0 A;  2CPR A;  2W9C A;  2JRZ A;  4F5R A;  1ZQU A;  5B66 U;  1O08 A;  2DF4 B;  2KV2 A;  2MA1 A;  1LV5 A;  2ASL A;  5III A;  1T8E A;  8ICX A;  4J9O A;  4KIT B;  3K1R B;  1J97 A;  2M0N A;  5KT2 A;  5J2C A;  4QW8 A;  1WUD A;  3ONN A;  1TKD A;  5DGB A;  5KG7 A;  3BQ0 A;  4PH5 A;  2C28 A;  4M04 A;  2OXO A;  4UBB A;  3HJE A;  1F0M A;  2RHF A;  9ICS A;  2QAR B;  1NKB A;  5J2K A;  1PK1 A;  7ICM A;  1JRO A;  1SL1 A;  2P6U A;  1A6S A;  3RH6 A;  4QNL A;  1JXE A;  2MSN A;  4NL9 C;  3WK5 A;  2KVC A;  1NJZ A;  2W7O A;  1KTQ A;  1ZQW A;  2KFZ A;  4RQ4 A;  1CRX A;  4I2J A;  2FMQ A;  5IIL A;  3OTQ A;  5AM0 A;  4P0P B;  9ICR A;  1NJX A;  4JWN A;  1EXN A;  3OJS A;  1SIJ A;  5KFG A;  2KNJ A;  4RUA A;  1KSP A;  3NVW A;  1S97 A;  2E8O A;  4BXO A;  3M7D A;  1JN3 A;  4UB2 A;  4OJP A;  2JZB B;  1L3U A;  1VJ5 A;  3C1Y A;  1PK3 A;  3KKA A;  5J2A A;  1ED1 A;  3CYM A;  1ZJM A;  2IOF A;  8ICP A;  2LPE A;  4XQ8 A;  1JAL A;  4GLX A;  1ZQV A;  1X66 A;  2CN1 A;  3PW5 A;  4UQG A;  4CF4 A;  4RQ0 A;  2BZF A;  4X5V A;  1DXS A;  4Y2J A;  4IRK A;  5CHG A;  2K4E A;  1NK6 A;  3MFH A;  1ZQB A;  4NY8 A;  1BPX A;  4UAS A;  3PO4 A;  5HNK A;  8ICA A;  4QZD A;  3OHB A;  2W3R A;  1U47 A;  2HBL A;  3IP4 B;  1NI3 A;  3VC8 A;  4F71 A;  5ALW A;  2FPM A;  4Y2X A;  4R65 A;  3C2K A;  5KFK A;  3UQ2 A;  3T5H A;  3CW2 C;  1KFS A;  4TUS A;  2KJ8 A;  1DK3 A;  4F5N A;  5J8Y A;  1Z00 A;  2BCR A;  3Q8K A;  3KZI U;  2K8C B;  1NZP A;  2JV3 A;  5ALR A;  5ALH A;  1ZQF A;  4YR2 A;  3M8S A;  3ISC A;  5DBC A;  2WF6 A;  2BDP A;  3QU4 A;  3MC1 A;  2LYH A;  5EOZ A;  8ICQ A;  9ICX A;  1UPH A;  1X6J A;  4C8K A;  4O0I A;  3F2B A;  5DB9 A;  1URJ A;  3K75 D;  5AI6 A;  1QCK A;  3H0M B;  3ZDD A;  3EW9 A;  3M9N B;  1KFD A;  4C8N A;  3TAQ A;  1XSN A;  2PXI A;  4CRX A;  3SAG A;  2MUT B;  2Y9U A;  2F1H A;  4J9P A;  9ICK A;  2NV3 A;  1O03 A;  3EUB 2;  5K4L A;  2YML A;  2CRX A;  2R8J A;  3BS5 A;  4PGY A;  4PHE A;  3HX0 A;  2Z7J A;  2G06 A;  5ALM A;  4DL7 A;  5CR0 A;  3WKD A;  2Q4T A;  3M6Z A;  5KG6 A;  4Y2R A;  3TAC B;  4JV2 A;  5KG1 A;  2K4H A;  3D2Q A;  1M6Y A;  5EE1 A;  4P4M A;  1B22 A;  3RBE A;  2ZJ5 A;  4ED8 A;  1V9P A;  4F5O A;  2BPC A;  1WG8 A;  2H3Z A;  2D6F C;  4F4X A;  1N5W A;  1BGX T;  8ICK A;  3IHQ B;  2I6X A;  4B6J A;  3RTV A;  1H38 A;  5AK6 A;  1SWV A;  4GC6 A;  3FYH A;  2DBY A;  5ALV A;  4C8M A;  5AI9 A;  2K4I A;  2DPJ A;  5J0Q A;  3THV A;  5B5E U;  2HHW A;  2ZIU A;  2QKQ A;  3QU2 A;  4F4Z A;  3ICX A;  5CA7 A;  4KLT A;  1SV0 A;  4MFC A;  4ED1 A;  4Y2Q A;  1L8O A;  4C8O A;  5AKX A;  3BQ1 A;  5CB1 A;  1T3N A;  2JH7 A;  4NLB A;  4IS7 A;  4DQI A;  2ZTC A;  4GXI A;  2KJ5 A;  4DQQ A;  1DRG A;  3ZDA A;  1MA7 A;  4B9S A;  1ZQK A;  3AEV A;  2AQ4 A;  1ZXI A;  2F44 A;  3RAX A;  1TV9 A;  5J2F A;  4FBT A;  5KG2 A;  2EAM A;  4PPX A;  3QUT A;  4ECQ A;  2HHT A;  3KTQ A;  4QZA A;  3RFA A;  4Q43 A;  3C1Z A;  2C2D A;  4I2A A;  4JWM A;  4Z6F A;  2AGO A;  5KFU A;  3AMZ A;  2BQ3 A;  2KD1 A;  4TUQ A;  3KKA C;  2NRT A;  4YMN A;  1RQL A;  4O9M A;  4QZH A;  2FDR A;  1K5O A;  2FJ6 A;  3GV7 B;  2I9G A;  2XI9 A;  5KNI A;  1ZQN A;  1N48 A;  3PW0 A;  3KZX A;  4KLS A;  5TIS U;  4HYK A;  3NGD A;  5AI0 A;  5J0Y A;  1ZQJ A;  4EX6 A;  2JEF A;  4UAU A;  1CI4 A;  3FC4 A;  3JPT A;  3QNM A;  5DQH A;  5ALU A;  3RF9 A;  1V97 A;  3BQT A;  2PFQ A;  9ICC A;  5GTI U;  5KFA A;  3QU7 A;  2HOI A;  4F72 A;  1J2N A;  3MBY A;  1ZQI A;  4KLM A;  7ICR A;  2Y0S C;  1C7Y A;  1X6I A;  2V4Q A;  5DQG A;  1JX4 A;  4YR3 A;  3QYP A;  4J9N A;  4FFD A;  3LK9 A;  1ZQX A;  1IIP A;  5EE9 A;  9ICF A;  3V7J A;  2PFO A;  2OH2 A;  4PL2 A;  4YXJ A;  3MAB A;  1ZQP A;  2HVI A;  3BQ7 A;  3Q8S B;  2CXY A;  2G5I B;  3SMV A;  4LJX A;  3H8S A;  4DL2 A;  4US8 A;  3RB3 A;  4DF8 A;  4ECU A;  3H7I A;  2YN4 A;  5C5J A;  2JGA A;  3ZI4 A;  1X9M A;  3ZD8 A;  4ACO A;  1IM4 A;  4RQ6 A;  4UAY A;  2HMX A;  4JMU A;  8ICW A;  4RT2 A;  2JHD A;  3ORY A;  4C0Z A;  5AM2 A;  2B0C A;  2KE7 A;  4RQ8 A;  1N60 A;  5KFC A;  1ZD2 P;  2HCF A;  1L8L A;  2BHN A;  3E58 A;  5KG5 A;  3NAS A;  4BWM A;  5KFQ A;  4ELU A;  4QWC A;  3RR7 A;  3L3F X;  5AI5 A;  3QU9 A;  3H0R B;  1ZQ1 C;  1MSW D;  2W04 A;  4JK1 A;  4R8U A;  1N63 A;  4DFM A;  1KN5 A;  3TAN A;  9ICU A;  5L1M A;  1RG6 A;  1V38 A;  4QIW C;  1RYU A;  2XY6 A;  1SB3 C;  2ZJA A;  3CNH A;  4YMO A;  1KRP A;  1N2X A;  1Z1B A;  1WWV A;  4F91 B;  3K1Z A;  1N5X A;  2AGP A;  4NM2 A;  2PI5 A;  4Y2V A;  8ICU A;  4KMU A;  9ICJ A;  3TAD C;  2KZM A;  5J2G A;  1B0X A;  1KKX A;  5KG0 A;  3O0F A;  3C2L A;  3PST A;  3UM9 A;  2R8I A;  4RUC A;  2DUY A;  1S77 D;  2BKE A;  4J03 A;  2YMQ A;  3G6X A;  4KN7 A;  3EWA A;  3OSN A;  4MHV A;  1L7M A;  3SAH A;  2C2E A;  1JXL A;  2JEI A;  2K60 A;  4ECS A;  2BDU A;  2E5S A;  2K89 A;  4DSI A;  4IQV A;  1Z4O A;  2FPL A;  5J0P A;  4KLQ A;  4C4S A;  2AQ0 A;  2RLT A;  1PVQ A;  4O5E A;  3PV8 A;  4UB6 U;  3HKZ C;  1ZET A;  3WK4 A;  3GFK B;  3Q8R B;  1DGS A;  1ZQC A;  1SZH A;  7ICG A;  2FE9 A;  5DG7 A;  5ALN A;  1SGG A;  1FFU A;  1S0N A;  4Y2S A;  1A0P A;  3T5J A;  5F3X B;  4UB4 A;  4DL5 A;  2KIC A;  3A0B U;  4PL1 A;  3R9K A;  3ZDC A;  2ZIX B;  4UB1 A;  2LKY A;  1QLN A;  2Y1I A;  4P0Q B;  3N97 B;  4KLH A;  3E0F A;  1Q8K A;  5J0U A;  4I27 A;  1S9F A;  4ED2 A;  1S0O A;  4RQ2 A;  5KFX A;  3C29 A;  5HHH A;  2W9B B;  2RP5 A;  2VJ5 A;  1TAQ A;  1ZQQ A;  2QAR A;  3EYZ A;  2VKQ A;  1TFR A;  2ODG A;  1BPE A;  2WAQ C;  3ISB A;  2OHF A;  3BQ2 A;  2FLN A;  5KL1 B;  3D2N A;  5EWG A;  9ICV A;  1V85 A;  4TQS A;  4OCZ A;  3F2C A;  1UT5 A;  2LM4 A;  3RB0 A;  3AQE A;  3I1Y A;  1DK2 A;  3F53 A;  1FO4 A;  1S76 D;  4DFK A;  1Z1V A;  2EQY A;  1A76 A;  1F44 A;  4IR9 A;  9ICM A;  1QQ7 A;  2XGQ A;  2G09 A;  2EAO A;  2K4P A;  9ICL A;  4K4I A;  2W55 A;  1QTM A;  5J2I A;  3HKZ F;  5AKZ A;  5DLG A;  1ZQS A;  5HMM A;  1ECW A;  4OJO A;  3V7L A;  2FMP A;  3WKC A;  4M0A A;  5E79 U;  1NKC A;  4R66 A;  3GII A;  3GV5 B;  4QIW F;  1S5L U;  1FFV A;  1NK8 A;  2W43 A;  4UB5 A;  4EBD A;  5ALL A;  1FEZ A;  2D3D A;  2KZZ A;  3I28 A;  4RNM A;  7ICI A;  3PML A;  2H3F A;  2YQE A;  2C22 A;  4O3S A;  1ZRN A;  2AHO B;  4KLE A;  1NJW A;  2Y9T A;  5EWE A;  5DDY A;  3MDC A;  9ICT A;  1VDV A;  2ZUD A;  4ZOH C;  3GZF A;  4FZM A;  1UCV A;  5D46 A;  3OSP A;  1SZP A;  4J9Q A;  4KX5 A;  4EZ6 A;  4DEZ A;  1ZOL A;  1T7P A;  4RZR A;  4G9B A;  5KG4 A;  1MN8 A;  4B9L A;  3RJF A;  3PSI A;  2KSO A;  2EAN A;  1PVP A;  1D9D A;  3M8R A;  1K1S A;  1WCN A;  1RZT A;  1TAM A;  1KQQ A;  2XO7 A;  3C5G A;  3DDH A;  5IIN A;  4Y2U A;  1XC9 A;  2K8B B;  1Z3E B;  2QB0 B;  2UVR A;  3NVZ A;  2IMW P;  5KFW A;  1D8Y A;  3OGU A;  1CUK A;  4MFA A;  4PHA A;  2YMP A;  5KFM A;  3IM1 A;  1L3T A;  3QUQ A;  3KD3 A;  4KLF A;  4YMM A;  2YMM A;  5J2B A;  5T14 A;  7ICT A;  1NK0 A;  2BCU A;  3RJI A;  4DL4 A;  2IBK A;  4DSL A;  3HW8 A;  2R8G A;  4KLI A;  2HVH A;  3PY8 A;  3MR3 A;  4IR1 A;  3ETR A;  3RH5 A;  1ZQA A;  4NLG A;  4Q8E A;  3PW7 A;  3GU3 A;  4YFK A;  4B9V A;  2F2A B;  2BCQ A;  4QWA A;  3AL0 B;  5AK4 A;  4AP9 A;  4KLL A;  3T79 A;  8ICI A;  8ICT A;  5KT6 A;  7ICP A;  1WYG A; 
#chains in the Genus database with same CATH homology
 2ESE A;  2F3N A;  2E8M A;  3BS5 A;  1X66 A;  2KE7 A;  5JU5 A;  1WWU A;  2E8N A;  3KKA C;  1X9X A;  1KW4 A;  2D3D A;  2B6G A;  1COK A;  4RQM A;  3BS5 B;  1DXS A;  3TAC B;  2FE9 A;  3IDW A;  1SGG A;  2D8C A;  1SV4 A;  2Y9T A;  2E8P A;  3K1R B;  5F3X B;  1UCV A;  2L5Y A;  5KNI A;  3H8M A;  4NL9 A;  1F0M A;  4RQN A;  3HIL A;  5L1M A;  1B4F A;  1RG6 A;  2QAR B;  2GLE A;  1PK1 A;  2KMD A;  2KSO A;  3SEI A;  1JI7 A;  1V38 A;  2EAN A;  3TAD A;  1WWV A;  2F8K A;  2EAP A;  2LMR A;  3BS7 A;  5J8Y C;  1UQV A;  5J8Y A;  5JTI A;  2QB0 B;  5JRT A;  2ES6 A;  4NJ8 A;  2JV3 A;  2YTU A;  4NL9 C;  1LKY A;  3TAD C;  2QAR A;  4PZO A;  2QKQ A;  1SV0 C;  2KSO B;  1B0X A;  1SV0 A;  3SEN A;  1LKY B;  2QB1 A;  1SXD A;  2QB0 A;  1X40 A;  1V85 A;  3BQ7 A;  1OW5 A;  4IS7 A;  2DL0 A;  4MHV A;  2KG5 A;  1Z1V A;  2E8O A;  1PK1 B;  1SXE A;  2F44 A;  2EAO A;  2K4P A;  4PZN A;  2DKZ A;  2K60 A;  1PK3 A;  3KKA A;  2KIV A;  2Y9U A;  1OXJ A;  2EAM A;  2LPE A;  2DKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...