2E8OA

Solution structure of the n-terminal sam-domain of the sam domain and hd domain containing protein 1 (dendritic cell-derived ifng-induced protein) (dcip) (monocyte protein 5) (mop-5)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
GSSGSSGSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal SAM-domain of the SAM domain and HD domain containing protein 1 (Dendritic cell-derived IFNG-induced protein) (DCIP) (Monocyte protein 5) (MOP-5)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SAM domain and HD domain-containing protein 1
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8oA01
2QARA 3SENA 2KE7A 3BQ7A 1SV0C 3KKAA 1LKYB 2D8CA 1OXJA 3BS7A 2E8OA 1WWUA 3IDWA 5JTIA 1KW4A 2FE9A 1SXDA 2ES6A 5JRTA 1X66A 3HILA 4RQNA 5J8YA 2B6GA 2QB1A 2F3NA 1COKA 2QKQA 3TADC 2KMDA 1SV4A 3BS5A 2JV3A 3TACB 1UQVA 2DKXA 2F44A 4RQMA 1LKYA 2E8MA 1B0XA 4NL9A 2DKZA 1X9XA 1RG6A 2EAOA 1SV0A 3K1RB 2KG5A 1WWVA 5F3XB 2EAPA 2LMRA 1SXEA 2K4PA 1PK1B 2GLEA 3H8MA 2F8KA 2KSOB 4PZOA 2KSOA 4NJ8A 3KKAC 2EANA 1PK1A 1DXSA 2E8PA 1F0MA 5JU5A 1UCVA 1PK3A 2KIVA 5J8YC 4MHVA 1SGGA 1B4FA 2D3DA 2L5YA 3TADA 2K60A 2ESEA 2E8NA 2Y9TA 1OW5A 2QARB 2QB0A 4PZNA 4IS7A 5KNIA 2EAMA 2LPEA 3BS5B 1V85A 2Y9UA 1JI7A 3SEIA 1V38A 2YTUA 2DL0A 1X40A 1Z1VA 5L1MA 4NL9C 2QB0B
chains in the Genus database with same CATH superfamily
4KN7A 4BGDA 2KKVA 5EE3A 2Z7JA 3AQFA 3RH6A 4KX5A 3MFHA 2D8CA 1NJZA 2KZZA 3GQCA 1XSPA 3Q8MA 4GC7A 3LVWA 4DLEA 4YR0A 1TK0A 1X6JA 3NVYA 1N5WA 3BZCA 2NRZA 1ZQBA 1Z19A 1IXRA 1NJXA 5EWFA 4RQNA 5J8YA 3A0HU 5DBBA 1RDFA 3NTUA 9ICBA 2WB1F 2W7PA 1BPBA 4NLZA 1ZQDA 3MBYA 4QWCA 4RNMA 7ICOA 4I28A 4KMUA 3PO5A 3D2SA 2F44A 5KL8B 4RPXA 1N2XA 2EQYA 2EZYA 4FZNA 3PW5A 1H38A 2P35A 2K4EA 5KFNA 9ICPA 2ZIWA 5KFQA 1WWVA 8ICZA 4ECTA 5AKEA 2JH1A 2ZIXB 1JIHA 4DFDA 1ZETA 3SYZA 1ZQLA 5H2FU 1F0MA 3IRUA 1TV9A 2K4IA 4XA5A 2FPLA 4CDGA 4EZ9A 4US8A 5KG3A 5J2HA 1YZ6A 3UXNA 4DQIA 4P4PA 2JEIA 2LHTA 2YMMA 1X9MA 4BX9C 4NY8A 1NKBA 2E3TA 2UVRA 2F1IA 3NRZA 5J2EA 5C0YA 2ISPA 5CP2A 4OJ5A 1Q3VA 4KLQA 3ONNA 1JUDA 2WF5A 2KFZA 1QH9A 3M1YA 5AI8A 4EELA 5HNKA 3R9KA 5AKGA 2YY6A 1ZD5A 1CUKA 4IQVA 5JTIA 4QW9A 4DL3A 2XCAA 3TI0A 4I2FA 2J6UA 3HX0A 3BS5A 1Q8KA 1ZQIA 2WFAA 2NRXA 2HVIA 4ICAA 3WK4A 1O08A 4DSFA 1M6YA 2E8MA 2ZTCA 3FDSA 2FLLA 2DFLA 3ZDCA 3VC8A 1QQ5A 5DDYA 1D8BA 2FDRA 7ICKA 2Q0ZX 5AI4A 1XC9A 2KG5A 5HMLA 1HUZA 2WF9A 2MSNA 5DB8A 3KOOA 4M9NA 4KLHA 5GTIU 4WJ3B 1ZQEA 3KKAC 3EPIA 2RRDA 4IR1A 4YCXA 4ECWA 1S10A 2ATLA 4F5PA 4PJ0U 4RT3A 5ALMA 4PPXA 9ICIA 3QUCA 3EUB2 2F2AB 2QB0A 4ECQA 4P4MA 4QZAA 1PUZA 3BS5B 1UPHA 1A76A 4EBCA 4TUSA 2OXOA 3B0YA 4IRCA 2W55A 2BCRA 3MDCA 3ZD8A 3ALRA 2JHDA 3UMBA 2KFNA 1ZD4A 1OXJA 4TUQA 3MABA 5KG5A 1SZPA 3F2BA 5J0PA 1WYGA 4KLSA 1MN8A 1WWUA 4RU9A 4QZIA 5J2DA 5ALJA 3PZPA 2NRVA 4C7YA 4K4IA 3T79A 2FI1A 3FM9A 4F4WA 1S0MA 2B6GA 5AKZA 4R8UB 1RZTA 3L5KA 2QB1A 2H3IA 1U49A 1L3VA 3SR6A 4IL6U 5DDMA 4O9MA 5KTQA 4RPYA 3RJFA 4I2CA 1HEKA 3HT3A 1S0OA 1SKRA 8ICVA 2WF6A 1ZQHA 5AM2A 4PHDA 4F4XA 1K5OA 3H0RB 4O3NA 1U4BA 3RRHA 1DGSA 3PNCA 1SV0A 5DB9A 4UB5A 5DG8A 3H4DA 2EAPA 4NLNA 5KFFA 1UA0A 4R8UA 1ZXIA 3UMCA 3PW7A 1SL2A 4QW8A 4DL7A 3GIMA 1IIPA 1Z1BA 4UAZA 2YB4A 4RQ4A 2UVWA 3V6JA 1B4FA 5EE1A 3C2LA 1JMSA 4MEYA 2K8BB 2DGZA 1HJPA 4PZNA 2IHNA 4YQWA 2KIWA 1QSSA 4RNOA 4C4SA 4R65A 2OCEA 1N56A 5BOLA 2ZJ8A 4OJOA 2XY6A 4QNLA 4F2SA 4BUGA 3WKEA 3Q8LA 5ALIA 3D2QA 3OSPA 3LK9A 1LKYB 4NLKA 1ZQCA 4I2DA 1T94A 1SL1A 4Q8FA 4B9LA 2ZUCA 5DLFA 2HBLA 4CRXA 4EENA 4ECVA 3OHBA 5T14A 1AQ6A 1SKSA 4OD0A 4J9LA 5KG6A 2KZMA 3E0FA 3QXGA 4JK1A 2R8JA 4UB2A 4RQ6A 4AP9A 1NOMA 4M6WB 9ICFA 5F3XB 4DOBA 2LMRA 4J03A 2F76X 1PK1B 2CRXA 7ICQA 3JPOA 5CJ7A 5AKKA 5KFRA 3ISDA 2BPCA 1TE2A 4NXZA 4K4GA 1SZHA 4PGYA 2XVTA 2H3VA 5JU5A 1Q3UA 4P0QB 2I1QA 1ZJNA 3NASA 9ICGA 3V6KA 2JGAA 4RQ8A 9ICXA 2HSZA 2DF4B 3C1ZA 1OW5A 3OJUA 3GIKA 2C2EA 1ZQFA 5J2CA 2PFQA 1VDVA 3PW0A 3AUOA 4MFAA 1V85A 3KHHA 4DQQA 3DDHA 1Z1VA 5L1MA 4UAWA 2HBJA 4BWMA 5J0SA 2P6RA 4EX6A 3JPRA 3RB6A 5L9XA 2HCFA 2ZUBA 3B0XA 3IG8A 3IP4B 4YXJA 1N63A 4P0QA 4I2GA 2LYBA 5KFXA 4LZGA 1ZQSA 2A3VA 2E5SA 9ICCA 2OWOA 3HKZC 3HJEA 4C8KA 2VJ4A 4JUZA 4UBCA 4NLCA 1KSPA 5B66U 1LV5A 3FYHA 4I27A 3KZXA 4I2BA 4AYBC 3RBEA 2OM6A 2YMPA 3QUBA 2PFPA 9ICOA 3DV9A 4B9MA 4F5NA 4Q43A 4O0IA 4RQ3A 8ICNA 5BOMA 4M9LA 5AK3A 4RQMA 3EW9A 2JZBA 8ICOA 2W9MA 1TAQA 2LI6A 2AQ4A 5CHGA 1X9XA 1NZBA 5EE9A 2ISOA 4BDPA 1ZOLA 1TK5A 4F8RA 2I9GA 3V7KA 4QZEA 2XIDA 4NWIA 5KL1B 4AYBF 2GWSA 2VA8A 9ICNA 2AHOB 1QCKA 3G6VA 5HHIA 4O3MA 2KZ3A 4NV0A 4R66A 8ICLA 2E8PA 3I28A 3MFIA 4ELUA 3F53A 1S0NA 5KFJA 2B0CA 2DQNB 2BCVA 5ALHA 4E0DA 4O3OA 1NJWA 4KLLA 4I2AA 4IRDA 1IV8A 4EBEA 4JV2A 5AM3A 2MUTA 2GO7A 3WK9A 8ICAA 1ZQMA 3OPXA 5AK5A 4BXOB 3BDPA 5J2KA 4IQWA 4Z6FA 3AMZA 4KMOB 3MDAA 3OJSA 3SV4A 4R64A 3KZIU 1NK4A 2ZIUB 5G5GA 7ICGA 4FE3A 4KTQA 4ELTA 3EYZA 5J0RA 1NKCA 4F4KA 4NLBA 5ALYA 5L1IA 3ETLA 1KFSA 5IIOA 3HILA 9ICMA 1UA1A 5ALDA 2BR0A 8ICIA 3WKBA 3WK7A 3EPGA 1NK5A 8ICGA 4IR9A 3IV6A 2ZJAA 4JWMA 4NM2A 2E1FA 5DQHA 4K4HA 2YX8A 2KP7A 3M7DA 3PVXA 1NJYA 2H3FA 4QZDA 4TURA 8ICPA 2F1JA 3PO4A 9ICWA 3Q8RB 8ICWA 3PSTA 3F5AA 1Z00A 5KFZA 1X42A 2HI0A 5AKYA 3J81j 4Z6DA 4F4YA 3ZD9A 1PVQA 5AHXA 5G5HA 4JV1A 3WK5A 2F8KA 4QZFA 2G08A 3PMLA 1XO0A 3LWLA 1PK1A 1Q46A 1WCNA 2XGPA 4XUSA 1PZNA 4OCZA 3M9MB 3RB0A 3PY8A 1BPZA 4U6PA 2BPFA 2D3DA 3THVA 2WHEA 2WB1C 2FPKA 2N1RA 4O3RA 1ZYQA 2PKEA 3C1YA 3SV3A 3HKZF 1BGXT 4UAYA 2UVVA 4QZBA 2LBOA 2VA2A 2XGQA 5AI5A 2AJQA 4IQUA 1V38A 4P0PA 3LVVA 5CR0A 4YMNA 4USAA 2MUTB 2F1HA 4F72A 5KAIU 5AM5A 4TUPA 3I76A 4DL6A 8ICBA 3IHQB 4U7CA 3QUQA 5KFTA 1X6IA 4Y2TA 1LVHA 1ZQGA 3T5HA 1ZQYA 1SXDA 4PL2A 3BQ1A 1XS9D 4ECUA 2NO4A 2KHQA 4Y2YA 1U48A 2CPRA 3N4MB 4ZH4A 4DS4A 1SWWA 1A0PA 2XCPA 3M6KA 3QX7A 4RZRA 5KFDA 4PGXA 4Z6EA 2HOIA 5KFHA 5KG7A 1T3QA 2WTFA 2H5XA 3BQ0A 2G07A 3AN1A 1EXNA 3C21A 4JMUA 2KJ5A 3PMNA 1L7PA 3D2NA 2EAOA 4KX3A 3HWTA 5KFVA 3PR4A 1ECWA 7ICHA 3H8JA 1FFUA 5TZVA 5HMMA 4YMOA 3MR5A 3H40A 2FLNA 8ICTA 7ICJA 1NK8A 2VIXA 1L7MA 4I29A 5DBAA 3CRXA 2W9CA 2W9CB 3RJJA 8ICMA 1SGGA 3QE9Y 5ALKA 4GC6A 2BDUA 1ZQXA 3KHGA 1ZRMA 5D46A 1A77A 3N7RC 5J29A 1JXLA 8ICSA 2ZTEA 4GIBA 9ICSA 2FJ6A 2DBYA 5HHHA 3F2DA 4ECRA 3K1ZA 2W7OA 4I2EA 4ED1A 4M04A 1X40A 2LM4A 5KFBA 2BQ3A 1JRPA 3BQ7A 3V72A 3NVZA 4PL1A 2HHXA 3GIIA 1COOA 5KFLA 1N60A 1BVSA 5CRXA 3H8SA 2E8OA 1Z4OA 2G5HB 4BXOA 1FFVA 5KFAA 4DL2A 5DB7A 1UHUA 3D6JA 2MAXA 5ALQA 3PX0A 4KLOA 5JRTA 2FMPA 1N62A 4P4OA 2HBMA 4J9OA 4ED7A 4NLGA 1FO4A 7ICLA 1COKA 3BQ2A 2HOQA 2IA6A 4YD1A 5KFSA 3RBDA 2JR5A 1D9DA 5ALVA 1NK6A 4FBUA 2LYHA 2VJ5A 1J2NA 1HUOA 3I1YA 1LKYA 3LWMA 2ASJA 4QWDA 2YQEA 2G5IB 3S6JA 4M47A 2JEFA 2HHSA 1MC8A 3BZKA 2BDPA 1U9LA 1B22A 5ALPA 5BPCA 4DS5A 4XQ8A 5L1KA 1U45A 3RB4A 2KSOA 5IIJA 2H3ZA 2KTQA 4J9PA 2PFOA 4Q8EA 3QU9A 1KRPA 4ECYA 2LYAA 4J9SA 4IQTA 3RJEA 4UB1A 4QWBA 2WAQF 3A0BU 1RYUA 2B21A 2L5YA 3M6ZA 3OTQA 3TADA 5KG0A 3ISBA 3RH4A 4HYKA 3LYSA 3WK6A 2CXYA 4C4RA 4FFDA 4TQRA 2EAMA 3TFSA 3UXPA 4YVZA 2I5HA 3SEIA 2R8HA 1JN3A 5CWRA 3QEBZ 1K1QA 4EYHB 1NI3A 5FP0A 4DCCA 3E58A 4Y2UA 1RM6C 1SKWA 2XI9A 1NZPA 5KT6A 4ACOA 4QWEA 9ICKA 5HR7A 8ICUA 3C28A 4DO9A 4C4TA 3Q8KA 5A0LA 2KEYA 2HDOA 3QUTA 3ZDEA 1DOQA 4DSJA 1S76D 4FS2A 9ICAA 2AXTU 4EYIB 4M9JA 2NRWA 5KT2A 4F5QA 4CF4A 8ICEA 3TAQA 5J2FA 4F50A 4JWNA 4FZLA 2JXJA 3UQ2A 1ED1A 2M0NA 4KN4A 4UBBA 1N61A 4UASA 3TAPA 5KFYA 2W11A 3Q8PB 4C8LA 5AICA 5ALSA 3QU5A 2BQUA 1L7OA 3TFRA 1XNSA 2IOHA 5ALRA 3ZDBA 1V97A 2ZIXA 5KFEA 4DSKA 2KKPA 4DF4A 4DFMA 1CI4A 1N5XA 4KLDA 4MF2A 5J2AA 2JEJA 1RYSA 5DQGA 3QU7A 1ZRNA 3SQIA 2AQ0A 4MHVA 2ZIUA 2DWQA 5HR6A 2PXIA 2MU2A 5EOZA 2W8LA 4F93B 1KEJA 4F5OA 1TKDA 4RNNA 4O3QA 2YMLA 3N97B 1KQQA 4JB3A 3NS1A 2I6XA 3FAHA 4UATA 1SWVA 4QZ9A 3DEEA 3H0MB 2EZXA 4F2RA 1JI7A 2YB1A 4C0ZA 3C2KA 2W43A 5AI9A 4OJLA 3O0FA 4YFKA 4KLUA 5C5JA 1ZQVA 3PX6A 2ZJ5A 4KLIA 2KN7A 4ECXA 2DUYA 3WU2U 3OGUA 4DL4A 3GV8B 3QZ7A 2MA1A 4O3PA 4OO1J 4NM1A 2LKYA 1ZQRA 2FMSA 1TK8A 3N7SC 5ALLA 2QKQA 4G9BA 1SV4A 3CP8A 3AM9A 5DKWA 2Q4TA 2LM1A 3KFUF 5DBCA 5ALTA 4C8MA 4YN4A 1NK7A 2HHVA 1UQVA 2FPMA 4I2HA 4ZOHC 2W54A 2NV3A 3CW2C 4Y2QA 4O5KA 2BCSA 5J0YA 1S0VA 1SIJA 3QNMA 1NKEA 2O6KA 1U47A 4QIWF 3K1RB 2ZG6A 1T7PA 4UQGA 4MFCA 3HP6A 2K4PA 2ZUDA 1ZQNA 1RPLA 2VANA 2GLEA 1BPEA 3RH5A 4C80A 5AK4A 3NVVA 5AIBA 4B9NA 5J2JA 4B9UA 4UARA 2EANA 1DXSA 2A1AA 2Y0SC 7ICVA 3ORYA 1T8EA 5AM1A 3SAHA 1BPXA 1PK3A 3RJGA 1XU4A 4YR3A 2F77X 1SL0A 2P66A 3KHRA 1D8LA 4QZCA 1UT5A 3M8RA 1MQ3A 4O5CA 9ICJA 1KBUA 2D6FC 2HHUA 2RP5A 3ISCA 4IS7A 3T5LA 2LPEA 1X9WA 2KNJA 1KKXA 3U26A 2J6TA 2Y9UA 5KG2A 2C2DA 2YTUA 3GDXA 4DQPA 1WUDA 4M6WA 3UXOA 4C8NA 2P6UA 3RR8A 2HBKA 3IG5A 5KFCA 4C8OA 1CRXA 4F4ZA 4R63A 3EWAA 3G6XA 1KL9A 5KG4A 4I2IA 2BPGA 4CF5A 3GIJA 3RFAA 5DGBA 1TFRA 4Y2JA 7ICIA 3RJKA 5L1LA 3PW2A 4RQ7A 5CEHA 4TQSA 2UVUA 4X5VA 4M0AA 2J6SA 2AH5A 7ICMA 4CCHA 2KD1A 3FC4A 4FO6A 4A8EA 4Y2PA 2KMDA 2WF7A 3M9OB 3PW4A 5EWGA 4B6JA 4F5RA 2KVCA 3MR6A 3NUQA 9ICLA 2Y0SF 4OJ6A 1B0XA 4QZGA 5DQIA 2HOFA 2WF8A 1MQ2A 2BCQA 5CB1A 1ZQ1C 2ZXHA 3AL0B 4CNQA 5AM4A 4GLXA 4O3SA 1SXEA 1CEZA 5ALNA 2NYVA 5AKHA 1AROP 4EBDA 4DFJA 3V7JA 4GXKA 5HP4A 5ALXA 4OJPA 5J2IA 3UMGA 4RQ2A 2Y1JA 2KJ8A 2ASLA 4M2YA 2ZXIA 7ICPA 1JX4A 8ICXA 4KLGA 1NK0A 4ECZA 3N28A 1X9SA 3ED5A 2F8LA 2NO5A 3QU4A 2ESEA 2PI4A 3B9JA 2H3QA 2E8NA 2W04A 2Y9TA 2JRZA 3Q8SB 9ICVA 5DGAA 5IINA 1QSLA 4RQ0A 4KLMA 2IHMA 4KLFA 1ZQZA 3MR3A 3NVWA 2C2RA 2KJ9A 4ELVA 9ICTA 8ICKA 3UPQA 3KKAA 1D8YA 1C20A 2W9BA 2W9BB 5EE0A 1X2IA 2KV2A 2IOFA 5AI6A 3N7PD 1KFTA 3WKAA 2FE9A 2W9AA 4CGZA 2HHQA 1X66A 4GXIA 1L3TA 3TANA 3JPTA 7ICNA 5AKLA 5KT3A 2VKQA 1RYRA 2DPIA 1QQ6A 5DLGA 1ZQQA 2W3SA 2FMQA 2G0AA 5KAFU 2G06A 8ICYA 1JROA 2DKXA 4P2HA 4US9A 3Q8QB 4DSIA 2K89A 3SI8A 3AU2A 3JPNA 1Z4NA 4HAIA 2YMQA 2R8GA 4RQ1A 4QZHA 1Z3EB 7ICSA 2Y1IA 3ETRA 1TAUA 1NNLA 3GU3A 1ZQJA 3QYPA 3PX4A 5E79U 2KSOB 3H7IA 4PZOA 1F5SA 4B9TA 3QZ8A 1ZD2P 1DGJA 5JUMA 1MA7A 4M9HA 2C28A 1YZ7A 4ED0A 3C5FA 1VJ5A 2ZIVA 7ICFA 4DLGA 2C22A 3MC1A 5TISU 4Z6CA 4C7ZA 2AGOA 5KFMA 4ED2A 2RHFA 2AGQA 7ICUA 2HHTA 3WKCA 5ALWA 7ICEA 4DOAA 1L5UA 2AU0A 5IIKA 5KNIA 7ICRA 2RDJA 3VCBA 1KDHA 8ICQA 2QB0B 3F2CA 5CA7A 3SENA 2KE7A 5J0TA 4MEXA 4UB8U 3SD7A 3TARA 2XY5A 1JXEA 3L4PA 3BS7A 5KFIA 3PSIA 1XSLA 2OH2A 4RPZA 4YXMA 4ED8A 4J9MA 5KFWA 3UQ0A 2GOLA 2BQRA 2JEGA 1D9FA 4MF8A 1J2MA 4Y2VA 3KHLA 3GZFA 3WKDA 1PVRA 8ICCA 4YR2A 4RQ5A 3TADC 2KVSA 1FEZA 1SB3C 2V4RA 1VLBA 5AKXA 5DB6A 2CN1A 1T3NA 5K4LA 3JPPA 5IILA 5AK6A 3SZ2A 4QIWC 3BQTA 3SAFA 1BNPA 1ZD3A 1RG6A 3HW8A 2E1EA 4UB3A 3ZI4A 4Y2XA 4ED3A 4CE6A 4FZMA 4DFPA 3EZ5A 8ICRA 8ICJA 1GO3F 2V4QA 1QLNA 2V9WA 3UM9A 2G09A 3H8WA 4RUCA 3T5KA 3E2EA 3HPOA 3SAGA 4DSEA 4UB6U 4O5EA 1UCVA 3RB3A 5ALEA 1ZQAA 2KK0A 1L8OA 4YMMA 2ASDA 5ALZA 1DRGA 1L3SA 2GH1A 1RXWA 2HW3A 2PMZC 3CNHA 3OSNA 3RF9A 3C23A 5KG1A 3PSFA 4QWAA 3M9NB 4DF8A 4NL9C 2JV3A 2QARA 2FLPA 4PHPA 3MR2A 1F44A 1K1SA 2PFNA 2W3RA 1KN5A 4GXJA 3GV5B 1L3UA 1ZQKA 1QQ7A 3RJIA 5B5EU 2PI5A 4KLEA 1B43A 2ES6A 4YP3A 3PR5B 3RAQA 3AEVA 4DWIA 2EH9A 3C29A 3HRDD 3MGHA 5J0XA 1BPYA 2HHWA 3LDAA 4DL5A 2BGWA 4PGQA 2RLTA 1BPDA 5KFOA 5AKJA 1XSNA 2OEHA 2A19A 2VA3A 3ZDAA 3RAXA 5DG9A 5KFPA 4ECSA 1ZQOA 4NL9A 5J0OA 5IIMA 4IRKA 3K4GA 3NGDA 3C5GA 5L1JA 2A1JB 4LJXA 2K4HA 2MRLA 2AGPA 2HMXA 5IIIA 3T5JA 4RUAA 1DK2A 3AQEA 3V6HA 3RRGA 2JZBB 2HVHA 3RR7A 1WG8A 1ZQTA 4FS1A 1RXVA 5AI0A 2R8IA 2EDUA 3JPSA 1XO1A 1DK3A 2K60A 2JMGA 2QARB 4J9QA 3GFKB 1YT3A 2R8KA 1Y88A 3L3FX 9ICRA 4YD2A 1IM4A 3F5EA 2IBKA 3M8SA 4B9SA 1OUQA 1SV0C 1TAMA 4UAUA 2EZZA 1V9PA 1ZQUA 2IOFK 3CYMA 1S9FA 9ICEA 1WCLA 3IDWA 1FIQA 1KTQA 3PSPA 8ICFA 5J2BA 4B9VA 5ALGA 2RQ5A 2OYYA 5ALUA 1RQNA 5KFGA 3GV7B 2F3NA 3RJHA 1C7YA 5ALFA 3H0LB 4J9NA 1QTMA 4DQRA 1PVPA 3AU6A 2YN4A 3TACB 1MSWD 2ZTDA 2JH7A 5KT5A 2KHVA 2BCUA 4Y2SA 2DPJA 5DG7A 3IM1A 2WAQC 3WK8A 7ICTA 4KITB 1S97A 5AIAA 3KTQA 4MFFA 1UT8A 4DQSA 1S77D 3H8MA 4LZDA 4UAVA 1NK9A 2NRTA 2QLTA 4PH5A 4EZ6A 1J97A 4NJ8A 8ICHA 5ALOA 1L7NA 4RT2A 3ICXA 2BKEA 3PV8A 4Q44A 5KFUA 4F92B 3TQ1A 4BJQA 5AKIA 2ZIVB 1ZQPA 9ICHA 1P7DA 2IMWP 3G6YA 3NRWA 4IC9A 1URJA 4UW9A 4YG2A 4QZ8A 1TVAA 2XY7A 4XRHA 2K8CB 3SMVA 4J9RA 4ED6A 3KD3A 2DL0A 1BNOA 2KICA 4CF3A 1JALA 2BZFA 3IN5A 3MGIA 5J0UA 4GFJA 3BJYA 2BHNA 3TKAA 1XWLA 1QSYA 4F3OA 1N48A 4LVSA 4EX7A 4PHAA 3QEAZ 4P0PB 3JPQA 4UB4A 1KW4A 1S5LU 5J2GA 2XC9A 1O03A 2KOBA 5KT7A 1S8OA 5KFKA 2W8KA 3H4BA 5AM0A 1LB2B 2ODGA 1KFDA 1ZQWA 4DEZA 2XO7A 1Z00B 9ICQA 3T3FA 4EEKA 4EEYA 1ZJMA 2DKZA 5D49A 5F9LA 3OHAA 3C2MA 1IG6A 4JV0A 1KLNA 1L6NA 4KLJA 5D4BA 4G3IA 3RTVA 4F71A 2M9NA 3KBBA 4BWJA 4F91B 2RDIA 2PMZF 5KT4A 1L8LA 4J9KA 3QU2A 1A6SA 5GTHU 5J0WA 4Q45A 4DOCA 9ICUA 2K8AA 4DFKA 2W03A 4QJFB 4DSLA 2XICA 1T4GA 3K75D 3GILA 2KIVA 4M9GA 5J8YC 5EWEA 2R18A 5J0QA 1RQLA 3MGVA 4PHEA 4FBTA 2ALZA 3ZDDA 5F9NA 2OHFA 4Y2RA 1HIWA 4KLTA 2ZIWB 3V7LA 2A1JA 4I2JA
chains in the Genus database with same CATH topology
2QARA 3SENA 2KE7A 3BQ7A 1SV0C 3KKAA 1LKYB 2D8CA 1OXJA 3BS7A 2E8OA 1WWUA 3IDWA 5JTIA 1KW4A 2FE9A 1SXDA 2ES6A 5JRTA 1X66A 3HILA 4RQNA 5J8YA 2B6GA 2QB1A 2F3NA 1COKA 2QKQA 3TADC 2KMDA 1SV4A 3BS5A 2JV3A 3TACB 1UQVA 2DKXA 2F44A 4RQMA 1LKYA 2E8MA 1B0XA 4NL9A 2DKZA 1X9XA 1RG6A 2EAOA 1SV0A 3K1RB 2KG5A 1WWVA 5F3XB 2EAPA 2LMRA 1SXEA 2K4PA 1PK1B 2GLEA 3H8MA 2F8KA 2KSOB 4PZOA 2KSOA 4NJ8A 3KKAC 2EANA 1PK1A 1DXSA 2E8PA 1F0MA 5JU5A 1UCVA 1PK3A 2KIVA 5J8YC 4MHVA 1SGGA 1B4FA 2D3DA 2L5YA 3TADA 2K60A 2ESEA 2E8NA 2Y9TA 1OW5A 2QARB 2QB0A 4PZNA 4IS7A 5KNIA 2EAMA 2LPEA 3BS5B 1V85A 2Y9UA 1JI7A 3SEIA 1V38A 2YTUA 2DL0A 1X40A 1Z1VA 5L1MA 4NL9C 2QB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAR A;  3SEN A;  2KE7 A;  3BQ7 A;  1SV0 C;  3KKA A;  1LKY B;  2D8C A;  1OXJ A;  3BS7 A;  2E8O A;  1WWU A;  3IDW A;  5JTI A;  1KW4 A;  2FE9 A;  1SXD A;  2ES6 A;  5JRT A;  1X66 A;  3HIL A;  4RQN A;  5J8Y A;  2B6G A;  2QB1 A;  2F3N A;  1COK A;  2QKQ A;  3TAD C;  2KMD A;  1SV4 A;  3BS5 A;  2JV3 A;  3TAC B;  1UQV A;  2DKX A;  2F44 A;  4RQM A;  1LKY A;  2E8M A;  1B0X A;  4NL9 A;  2DKZ A;  1X9X A;  1RG6 A;  2EAO A;  1SV0 A;  3K1R B;  2KG5 A;  1WWV A;  5F3X B;  2EAP A;  2LMR A;  1SXE A;  2K4P A;  1PK1 B;  2GLE A;  3H8M A;  2F8K A;  2KSO B;  4PZO A;  2KSO A;  4NJ8 A;  3KKA C;  2EAN A;  1PK1 A;  1DXS A;  2E8P A;  1F0M A;  5JU5 A;  1UCV A;  1PK3 A;  2KIV A;  5J8Y C;  4MHV A;  1SGG A;  1B4F A;  2D3D A;  2L5Y A;  3TAD A;  2K60 A;  2ESE A;  2E8N A;  2Y9T A;  1OW5 A;  2QAR B;  2QB0 A;  4PZN A;  4IS7 A;  5KNI A;  2EAM A;  2LPE A;  3BS5 B;  1V85 A;  2Y9U A;  1JI7 A;  3SEI A;  1V38 A;  2YTU A;  2DL0 A;  1X40 A;  1Z1V A;  5L1M A;  4NL9 C;  2QB0 B; 
#chains in the Genus database with same CATH topology
 4KN7 A;  4BGD A;  2KKV A;  5EE3 A;  2Z7J A;  3AQF A;  3RH6 A;  4KX5 A;  3MFH A;  2D8C A;  1NJZ A;  2KZZ A;  3GQC A;  1XSP A;  3Q8M A;  4GC7 A;  3LVW A;  4DLE A;  4YR0 A;  1TK0 A;  1X6J A;  3NVY A;  1N5W A;  3BZC A;  2NRZ A;  1ZQB A;  1Z19 A;  1IXR A;  1NJX A;  5EWF A;  4RQN A;  5J8Y A;  3A0H U;  5DBB A;  1RDF A;  3NTU A;  9ICB A;  2WB1 F;  2W7P A;  1BPB A;  4NLZ A;  1ZQD A;  3MBY A;  4QWC A;  4RNM A;  7ICO A;  4I28 A;  4KMU A;  3PO5 A;  3D2S A;  2F44 A;  5KL8 B;  4RPX A;  1N2X A;  2EQY A;  2EZY A;  4FZN A;  3PW5 A;  1H38 A;  2P35 A;  2K4E A;  5KFN A;  9ICP A;  2ZIW A;  5KFQ A;  1WWV A;  8ICZ A;  4ECT A;  5AKE A;  2JH1 A;  2ZIX B;  1JIH A;  4DFD A;  1ZET A;  3SYZ A;  1ZQL A;  5H2F U;  1F0M A;  3IRU A;  1TV9 A;  2K4I A;  4XA5 A;  2FPL A;  4CDG A;  4EZ9 A;  4US8 A;  5KG3 A;  5J2H A;  1YZ6 A;  3UXN A;  4DQI A;  4P4P A;  2JEI A;  2LHT A;  2YMM A;  1X9M A;  4BX9 C;  4NY8 A;  1NKB A;  2E3T A;  2UVR A;  2F1I A;  3NRZ A;  5J2E A;  5C0Y A;  2ISP A;  5CP2 A;  4OJ5 A;  1Q3V A;  4KLQ A;  3ONN A;  1JUD A;  2WF5 A;  2KFZ A;  1QH9 A;  3M1Y A;  5AI8 A;  4EEL A;  5HNK A;  3R9K A;  5AKG A;  2YY6 A;  1ZD5 A;  1CUK A;  4IQV A;  5JTI A;  4QW9 A;  4DL3 A;  2XCA A;  3TI0 A;  4I2F A;  2J6U A;  3HX0 A;  3BS5 A;  1Q8K A;  1ZQI A;  2WFA A;  2NRX A;  2HVI A;  4ICA A;  3WK4 A;  1O08 A;  4DSF A;  1M6Y A;  2E8M A;  2ZTC A;  3FDS A;  2FLL A;  2DFL A;  3ZDC A;  3VC8 A;  1QQ5 A;  5DDY A;  1D8B A;  2FDR A;  7ICK A;  2Q0Z X;  5AI4 A;  1XC9 A;  2KG5 A;  5HML A;  1HUZ A;  2WF9 A;  2MSN A;  5DB8 A;  3KOO A;  4M9N A;  4KLH A;  5GTI U;  4WJ3 B;  1ZQE A;  3KKA C;  3EPI A;  2RRD A;  4IR1 A;  4YCX A;  4ECW A;  1S10 A;  2ATL A;  4F5P A;  4PJ0 U;  4RT3 A;  5ALM A;  4PPX A;  9ICI A;  3QUC A;  3EUB 2;  2F2A B;  2QB0 A;  4ECQ A;  4P4M A;  4QZA A;  1PUZ A;  3BS5 B;  1UPH A;  1A76 A;  4EBC A;  4TUS A;  2OXO A;  3B0Y A;  4IRC A;  2W55 A;  2BCR A;  3MDC A;  3ZD8 A;  3ALR A;  2JHD A;  3UMB A;  2KFN A;  1ZD4 A;  1OXJ A;  4TUQ A;  3MAB A;  5KG5 A;  1SZP A;  3F2B A;  5J0P A;  1WYG A;  4KLS A;  1MN8 A;  1WWU A;  4RU9 A;  4QZI A;  5J2D A;  5ALJ A;  3PZP A;  2NRV A;  4C7Y A;  4K4I A;  3T79 A;  2FI1 A;  3FM9 A;  4F4W A;  1S0M A;  2B6G A;  5AKZ A;  4R8U B;  1RZT A;  3L5K A;  2QB1 A;  2H3I A;  1U49 A;  1L3V A;  3SR6 A;  4IL6 U;  5DDM A;  4O9M A;  5KTQ A;  4RPY A;  3RJF A;  4I2C A;  1HEK A;  3HT3 A;  1S0O A;  1SKR A;  8ICV A;  2WF6 A;  1ZQH A;  5AM2 A;  4PHD A;  4F4X A;  1K5O A;  3H0R B;  4O3N A;  1U4B A;  3RRH A;  1DGS A;  3PNC A;  1SV0 A;  5DB9 A;  4UB5 A;  5DG8 A;  3H4D A;  2EAP A;  4NLN A;  5KFF A;  1UA0 A;  4R8U A;  1ZXI A;  3UMC A;  3PW7 A;  1SL2 A;  4QW8 A;  4DL7 A;  3GIM A;  1IIP A;  1Z1B A;  4UAZ A;  2YB4 A;  4RQ4 A;  2UVW A;  3V6J A;  1B4F A;  5EE1 A;  3C2L A;  1JMS A;  4MEY A;  2K8B B;  2DGZ A;  1HJP A;  4PZN A;  2IHN A;  4YQW A;  2KIW A;  1QSS A;  4RNO A;  4C4S A;  4R65 A;  2OCE A;  1N56 A;  5BOL A;  2ZJ8 A;  4OJO A;  2XY6 A;  4QNL A;  4F2S A;  4BUG A;  3WKE A;  3Q8L A;  5ALI A;  3D2Q A;  3OSP A;  3LK9 A;  1LKY B;  4NLK A;  1ZQC A;  4I2D A;  1T94 A;  1SL1 A;  4Q8F A;  4B9L A;  2ZUC A;  5DLF A;  2HBL A;  4CRX A;  4EEN A;  4ECV A;  3OHB A;  5T14 A;  1AQ6 A;  1SKS A;  4OD0 A;  4J9L A;  5KG6 A;  2KZM A;  3E0F A;  3QXG A;  4JK1 A;  2R8J A;  4UB2 A;  4RQ6 A;  4AP9 A;  1NOM A;  4M6W B;  9ICF A;  5F3X B;  4DOB A;  2LMR A;  4J03 A;  2F76 X;  1PK1 B;  2CRX A;  7ICQ A;  3JPO A;  5CJ7 A;  5AKK A;  5KFR A;  3ISD A;  2BPC A;  1TE2 A;  4NXZ A;  4K4G A;  1SZH A;  4PGY A;  2XVT A;  2H3V A;  5JU5 A;  1Q3U A;  4P0Q B;  2I1Q A;  1ZJN A;  3NAS A;  9ICG A;  3V6K A;  2JGA A;  4RQ8 A;  9ICX A;  2HSZ A;  2DF4 B;  3C1Z A;  1OW5 A;  3OJU A;  3GIK A;  2C2E A;  1ZQF A;  5J2C A;  2PFQ A;  1VDV A;  3PW0 A;  3AUO A;  4MFA A;  1V85 A;  3KHH A;  4DQQ A;  3DDH A;  1Z1V A;  5L1M A;  4UAW A;  2HBJ A;  4BWM A;  5J0S A;  2P6R A;  4EX6 A;  3JPR A;  3RB6 A;  5L9X A;  2HCF A;  2ZUB A;  3B0X A;  3IG8 A;  3IP4 B;  4YXJ A;  1N63 A;  4P0Q A;  4I2G A;  2LYB A;  5KFX A;  4LZG A;  1ZQS A;  2A3V A;  2E5S A;  9ICC A;  2OWO A;  3HKZ C;  3HJE A;  4C8K A;  2VJ4 A;  4JUZ A;  4UBC A;  4NLC A;  1KSP A;  5B66 U;  1LV5 A;  3FYH A;  4I27 A;  3KZX A;  4I2B A;  4AYB C;  3RBE A;  2OM6 A;  2YMP A;  3QUB A;  2PFP A;  9ICO A;  3DV9 A;  4B9M A;  4F5N A;  4Q43 A;  4O0I A;  4RQ3 A;  8ICN A;  5BOM A;  4M9L A;  5AK3 A;  4RQM A;  3EW9 A;  2JZB A;  8ICO A;  2W9M A;  1TAQ A;  2LI6 A;  2AQ4 A;  5CHG A;  1X9X A;  1NZB A;  5EE9 A;  2ISO A;  4BDP A;  1ZOL A;  1TK5 A;  4F8R A;  2I9G A;  3V7K A;  4QZE A;  2XID A;  4NWI A;  5KL1 B;  4AYB F;  2GWS A;  2VA8 A;  9ICN A;  2AHO B;  1QCK A;  3G6V A;  5HHI A;  4O3M A;  2KZ3 A;  4NV0 A;  4R66 A;  8ICL A;  2E8P A;  3I28 A;  3MFI A;  4ELU A;  3F53 A;  1S0N A;  5KFJ A;  2B0C A;  2DQN B;  2BCV A;  5ALH A;  4E0D A;  4O3O A;  1NJW A;  4KLL A;  4I2A A;  4IRD A;  1IV8 A;  4EBE A;  4JV2 A;  5AM3 A;  2MUT A;  2GO7 A;  3WK9 A;  8ICA A;  1ZQM A;  3OPX A;  5AK5 A;  4BXO B;  3BDP A;  5J2K A;  4IQW A;  4Z6F A;  3AMZ A;  4KMO B;  3MDA A;  3OJS A;  3SV4 A;  4R64 A;  3KZI U;  1NK4 A;  2ZIU B;  5G5G A;  7ICG A;  4FE3 A;  4KTQ A;  4ELT A;  3EYZ A;  5J0R A;  1NKC A;  4F4K A;  4NLB A;  5ALY A;  5L1I A;  3ETL A;  1KFS A;  5IIO A;  3HIL A;  9ICM A;  1UA1 A;  5ALD A;  2BR0 A;  8ICI A;  3WKB A;  3WK7 A;  3EPG A;  1NK5 A;  8ICG A;  4IR9 A;  3IV6 A;  2ZJA A;  4JWM A;  4NM2 A;  2E1F A;  5DQH A;  4K4H A;  2YX8 A;  2KP7 A;  3M7D A;  3PVX A;  1NJY A;  2H3F A;  4QZD A;  4TUR A;  8ICP A;  2F1J A;  3PO4 A;  9ICW A;  3Q8R B;  8ICW A;  3PST A;  3F5A A;  1Z00 A;  5KFZ A;  1X42 A;  2HI0 A;  5AKY A;  3J81 j;  4Z6D A;  4F4Y A;  3ZD9 A;  1PVQ A;  5AHX A;  5G5H A;  4JV1 A;  3WK5 A;  2F8K A;  4QZF A;  2G08 A;  3PML A;  1XO0 A;  3LWL A;  1PK1 A;  1Q46 A;  1WCN A;  2XGP A;  4XUS A;  1PZN A;  4OCZ A;  3M9M B;  3RB0 A;  3PY8 A;  1BPZ A;  4U6P A;  2BPF A;  2D3D A;  3THV A;  2WHE A;  2WB1 C;  2FPK A;  2N1R A;  4O3R A;  1ZYQ A;  2PKE A;  3C1Y A;  3SV3 A;  3HKZ F;  1BGX T;  4UAY A;  2UVV A;  4QZB A;  2LBO A;  2VA2 A;  2XGQ A;  5AI5 A;  2AJQ A;  4IQU A;  1V38 A;  4P0P A;  3LVV A;  5CR0 A;  4YMN A;  4USA A;  2MUT B;  2F1H A;  4F72 A;  5KAI U;  5AM5 A;  4TUP A;  3I76 A;  4DL6 A;  8ICB A;  3IHQ B;  4U7C A;  3QUQ A;  5KFT A;  1X6I A;  4Y2T A;  1LVH A;  1ZQG A;  3T5H A;  1ZQY A;  1SXD A;  4PL2 A;  3BQ1 A;  1XS9 D;  4ECU A;  2NO4 A;  2KHQ A;  4Y2Y A;  1U48 A;  2CPR A;  3N4M B;  4ZH4 A;  4DS4 A;  1SWW A;  1A0P A;  2XCP A;  3M6K A;  3QX7 A;  4RZR A;  5KFD A;  4PGX A;  4Z6E A;  2HOI A;  5KFH A;  5KG7 A;  1T3Q A;  2WTF A;  2H5X A;  3BQ0 A;  2G07 A;  3AN1 A;  1EXN A;  3C21 A;  4JMU A;  2KJ5 A;  3PMN A;  1L7P A;  3D2N A;  2EAO A;  4KX3 A;  3HWT A;  5KFV A;  3PR4 A;  1ECW A;  7ICH A;  3H8J A;  1FFU A;  5TZV A;  5HMM A;  4YMO A;  3MR5 A;  3H40 A;  2FLN A;  8ICT A;  7ICJ A;  1NK8 A;  2VIX A;  1L7M A;  4I29 A;  5DBA A;  3CRX A;  2W9C A;  2W9C B;  3RJJ A;  8ICM A;  1SGG A;  3QE9 Y;  5ALK A;  4GC6 A;  2BDU A;  1ZQX A;  3KHG A;  1ZRM A;  5D46 A;  1A77 A;  3N7R C;  5J29 A;  1JXL A;  8ICS A;  2ZTE A;  4GIB A;  9ICS A;  2FJ6 A;  2DBY A;  5HHH A;  3F2D A;  4ECR A;  3K1Z A;  2W7O A;  4I2E A;  4ED1 A;  4M04 A;  1X40 A;  2LM4 A;  5KFB A;  2BQ3 A;  1JRP A;  3BQ7 A;  3V72 A;  3NVZ A;  4PL1 A;  2HHX A;  3GII A;  1COO A;  5KFL A;  1N60 A;  1BVS A;  5CRX A;  3H8S A;  2E8O A;  1Z4O A;  2G5H B;  4BXO A;  1FFV A;  5KFA A;  4DL2 A;  5DB7 A;  1UHU A;  3D6J A;  2MAX A;  5ALQ A;  3PX0 A;  4KLO A;  5JRT A;  2FMP A;  1N62 A;  4P4O A;  2HBM A;  4J9O A;  4ED7 A;  4NLG A;  1FO4 A;  7ICL A;  1COK A;  3BQ2 A;  2HOQ A;  2IA6 A;  4YD1 A;  5KFS A;  3RBD A;  2JR5 A;  1D9D A;  5ALV A;  1NK6 A;  4FBU A;  2LYH A;  2VJ5 A;  1J2N A;  1HUO A;  3I1Y A;  1LKY A;  3LWM A;  2ASJ A;  4QWD A;  2YQE A;  2G5I B;  3S6J A;  4M47 A;  2JEF A;  2HHS A;  1MC8 A;  3BZK A;  2BDP A;  1U9L A;  1B22 A;  5ALP A;  5BPC A;  4DS5 A;  4XQ8 A;  5L1K A;  1U45 A;  3RB4 A;  2KSO A;  5IIJ A;  2H3Z A;  2KTQ A;  4J9P A;  2PFO A;  4Q8E A;  3QU9 A;  1KRP A;  4ECY A;  2LYA A;  4J9S A;  4IQT A;  3RJE A;  4UB1 A;  4QWB A;  2WAQ F;  3A0B U;  1RYU A;  2B21 A;  2L5Y A;  3M6Z A;  3OTQ A;  3TAD A;  5KG0 A;  3ISB A;  3RH4 A;  4HYK A;  3LYS A;  3WK6 A;  2CXY A;  4C4R A;  4FFD A;  4TQR A;  2EAM A;  3TFS A;  3UXP A;  4YVZ A;  2I5H A;  3SEI A;  2R8H A;  1JN3 A;  5CWR A;  3QEB Z;  1K1Q A;  4EYH B;  1NI3 A;  5FP0 A;  4DCC A;  3E58 A;  4Y2U A;  1RM6 C;  1SKW A;  2XI9 A;  1NZP A;  5KT6 A;  4ACO A;  4QWE A;  9ICK A;  5HR7 A;  8ICU A;  3C28 A;  4DO9 A;  4C4T A;  3Q8K A;  5A0L A;  2KEY A;  2HDO A;  3QUT A;  3ZDE A;  1DOQ A;  4DSJ A;  1S76 D;  4FS2 A;  9ICA A;  2AXT U;  4EYI B;  4M9J A;  2NRW A;  5KT2 A;  4F5Q A;  4CF4 A;  8ICE A;  3TAQ A;  5J2F A;  4F50 A;  4JWN A;  4FZL A;  2JXJ A;  3UQ2 A;  1ED1 A;  2M0N A;  4KN4 A;  4UBB A;  1N61 A;  4UAS A;  3TAP A;  5KFY A;  2W11 A;  3Q8P B;  4C8L A;  5AIC A;  5ALS A;  3QU5 A;  2BQU A;  1L7O A;  3TFR A;  1XNS A;  2IOH A;  5ALR A;  3ZDB A;  1V97 A;  2ZIX A;  5KFE A;  4DSK A;  2KKP A;  4DF4 A;  4DFM A;  1CI4 A;  1N5X A;  4KLD A;  4MF2 A;  5J2A A;  2JEJ A;  1RYS A;  5DQG A;  3QU7 A;  1ZRN A;  3SQI A;  2AQ0 A;  4MHV A;  2ZIU A;  2DWQ A;  5HR6 A;  2PXI A;  2MU2 A;  5EOZ A;  2W8L A;  4F93 B;  1KEJ A;  4F5O A;  1TKD A;  4RNN A;  4O3Q A;  2YML A;  3N97 B;  1KQQ A;  4JB3 A;  3NS1 A;  2I6X A;  3FAH A;  4UAT A;  1SWV A;  4QZ9 A;  3DEE A;  3H0M B;  2EZX A;  4F2R A;  1JI7 A;  2YB1 A;  4C0Z A;  3C2K A;  2W43 A;  5AI9 A;  4OJL A;  3O0F A;  4YFK A;  4KLU A;  5C5J A;  1ZQV A;  3PX6 A;  2ZJ5 A;  4KLI A;  2KN7 A;  4ECX A;  2DUY A;  3WU2 U;  3OGU A;  4DL4 A;  3GV8 B;  3QZ7 A;  2MA1 A;  4O3P A;  4OO1 J;  4NM1 A;  2LKY A;  1ZQR A;  2FMS A;  1TK8 A;  3N7S C;  5ALL A;  2QKQ A;  4G9B A;  1SV4 A;  3CP8 A;  3AM9 A;  5DKW A;  2Q4T A;  2LM1 A;  3KFU F;  5DBC A;  5ALT A;  4C8M A;  4YN4 A;  1NK7 A;  2HHV A;  1UQV A;  2FPM A;  4I2H A;  4ZOH C;  2W54 A;  2NV3 A;  3CW2 C;  4Y2Q A;  4O5K A;  2BCS A;  5J0Y A;  1S0V A;  1SIJ A;  3QNM A;  1NKE A;  2O6K A;  1U47 A;  4QIW F;  3K1R B;  2ZG6 A;  1T7P A;  4UQG A;  4MFC A;  3HP6 A;  2K4P A;  2ZUD A;  1ZQN A;  1RPL A;  2VAN A;  2GLE A;  1BPE A;  3RH5 A;  4C80 A;  5AK4 A;  3NVV A;  5AIB A;  4B9N A;  5J2J A;  4B9U A;  4UAR A;  2EAN A;  1DXS A;  2A1A A;  2Y0S C;  7ICV A;  3ORY A;  1T8E A;  5AM1 A;  3SAH A;  1BPX A;  1PK3 A;  3RJG A;  1XU4 A;  4YR3 A;  2F77 X;  1SL0 A;  2P66 A;  3KHR A;  1D8L A;  4QZC A;  1UT5 A;  3M8R A;  1MQ3 A;  4O5C A;  9ICJ A;  1KBU A;  2D6F C;  2HHU A;  2RP5 A;  3ISC A;  4IS7 A;  3T5L A;  2LPE A;  1X9W A;  2KNJ A;  1KKX A;  3U26 A;  2J6T A;  2Y9U A;  5KG2 A;  2C2D A;  2YTU A;  3GDX A;  4DQP A;  1WUD A;  4M6W A;  3UXO A;  4C8N A;  2P6U A;  3RR8 A;  2HBK A;  3IG5 A;  5KFC A;  4C8O A;  1CRX A;  4F4Z A;  4R63 A;  3EWA A;  3G6X A;  1KL9 A;  5KG4 A;  4I2I A;  2BPG A;  4CF5 A;  3GIJ A;  3RFA A;  5DGB A;  1TFR A;  4Y2J A;  7ICI A;  3RJK A;  5L1L A;  3PW2 A;  4RQ7 A;  5CEH A;  4TQS A;  2UVU A;  4X5V A;  4M0A A;  2J6S A;  2AH5 A;  7ICM A;  4CCH A;  2KD1 A;  3FC4 A;  4FO6 A;  4A8E A;  4Y2P A;  2KMD A;  2WF7 A;  3M9O B;  3PW4 A;  5EWG A;  4B6J A;  4F5R A;  2KVC A;  3MR6 A;  3NUQ A;  9ICL A;  2Y0S F;  4OJ6 A;  1B0X A;  4QZG A;  5DQI A;  2HOF A;  2WF8 A;  1MQ2 A;  2BCQ A;  5CB1 A;  1ZQ1 C;  2ZXH A;  3AL0 B;  4CNQ A;  5AM4 A;  4GLX A;  4O3S A;  1SXE A;  1CEZ A;  5ALN A;  2NYV A;  5AKH A;  1ARO P;  4EBD A;  4DFJ A;  3V7J A;  4GXK A;  5HP4 A;  5ALX A;  4OJP A;  5J2I A;  3UMG A;  4RQ2 A;  2Y1J A;  2KJ8 A;  2ASL A;  4M2Y A;  2ZXI A;  7ICP A;  1JX4 A;  8ICX A;  4KLG A;  1NK0 A;  4ECZ A;  3N28 A;  1X9S A;  3ED5 A;  2F8L A;  2NO5 A;  3QU4 A;  2ESE A;  2PI4 A;  3B9J A;  2H3Q A;  2E8N A;  2W04 A;  2Y9T A;  2JRZ A;  3Q8S B;  9ICV A;  5DGA A;  5IIN A;  1QSL A;  4RQ0 A;  4KLM A;  2IHM A;  4KLF A;  1ZQZ A;  3MR3 A;  3NVW A;  2C2R A;  2KJ9 A;  4ELV A;  9ICT A;  8ICK A;  3UPQ A;  3KKA A;  1D8Y A;  1C20 A;  2W9B A;  2W9B B;  5EE0 A;  1X2I A;  2KV2 A;  2IOF A;  5AI6 A;  3N7P D;  1KFT A;  3WKA A;  2FE9 A;  2W9A A;  4CGZ A;  2HHQ A;  1X66 A;  4GXI A;  1L3T A;  3TAN A;  3JPT A;  7ICN A;  5AKL A;  5KT3 A;  2VKQ A;  1RYR A;  2DPI A;  1QQ6 A;  5DLG A;  1ZQQ A;  2W3S A;  2FMQ A;  2G0A A;  5KAF U;  2G06 A;  8ICY A;  1JRO A;  2DKX A;  4P2H A;  4US9 A;  3Q8Q B;  4DSI A;  2K89 A;  3SI8 A;  3AU2 A;  3JPN A;  1Z4N A;  4HAI A;  2YMQ A;  2R8G A;  4RQ1 A;  4QZH A;  1Z3E B;  7ICS A;  2Y1I A;  3ETR A;  1TAU A;  1NNL A;  3GU3 A;  1ZQJ A;  3QYP A;  3PX4 A;  5E79 U;  2KSO B;  3H7I A;  4PZO A;  1F5S A;  4B9T A;  3QZ8 A;  1ZD2 P;  1DGJ A;  5JUM A;  1MA7 A;  4M9H A;  2C28 A;  1YZ7 A;  4ED0 A;  3C5F A;  1VJ5 A;  2ZIV A;  7ICF A;  4DLG A;  2C22 A;  3MC1 A;  5TIS U;  4Z6C A;  4C7Z A;  2AGO A;  5KFM A;  4ED2 A;  2RHF A;  2AGQ A;  7ICU A;  2HHT A;  3WKC A;  5ALW A;  7ICE A;  4DOA A;  1L5U A;  2AU0 A;  5IIK A;  5KNI A;  7ICR A;  2RDJ A;  3VCB A;  1KDH A;  8ICQ A;  2QB0 B;  3F2C A;  5CA7 A;  3SEN A;  2KE7 A;  5J0T A;  4MEX A;  4UB8 U;  3SD7 A;  3TAR A;  2XY5 A;  1JXE A;  3L4P A;  3BS7 A;  5KFI A;  3PSI A;  1XSL A;  2OH2 A;  4RPZ A;  4YXM A;  4ED8 A;  4J9M A;  5KFW A;  3UQ0 A;  2GOL A;  2BQR A;  2JEG A;  1D9F A;  4MF8 A;  1J2M A;  4Y2V A;  3KHL A;  3GZF A;  3WKD A;  1PVR A;  8ICC A;  4YR2 A;  4RQ5 A;  3TAD C;  2KVS A;  1FEZ A;  1SB3 C;  2V4R A;  1VLB A;  5AKX A;  5DB6 A;  2CN1 A;  1T3N A;  5K4L A;  3JPP A;  5IIL A;  5AK6 A;  3SZ2 A;  4QIW C;  3BQT A;  3SAF A;  1BNP A;  1ZD3 A;  1RG6 A;  3HW8 A;  2E1E A;  4UB3 A;  3ZI4 A;  4Y2X A;  4ED3 A;  4CE6 A;  4FZM A;  4DFP A;  3EZ5 A;  8ICR A;  8ICJ A;  1GO3 F;  2V4Q A;  1QLN A;  2V9W A;  3UM9 A;  2G09 A;  3H8W A;  4RUC A;  3T5K A;  3E2E A;  3HPO A;  3SAG A;  4DSE A;  4UB6 U;  4O5E A;  1UCV A;  3RB3 A;  5ALE A;  1ZQA A;  2KK0 A;  1L8O A;  4YMM A;  2ASD A;  5ALZ A;  1DRG A;  1L3S A;  2GH1 A;  1RXW A;  2HW3 A;  2PMZ C;  3CNH A;  3OSN A;  3RF9 A;  3C23 A;  5KG1 A;  3PSF A;  4QWA A;  3M9N B;  4DF8 A;  4NL9 C;  2JV3 A;  2QAR A;  2FLP A;  4PHP A;  3MR2 A;  1F44 A;  1K1S A;  2PFN A;  2W3R A;  1KN5 A;  4GXJ A;  3GV5 B;  1L3U A;  1ZQK A;  1QQ7 A;  3RJI A;  5B5E U;  2PI5 A;  4KLE A;  1B43 A;  2ES6 A;  4YP3 A;  3PR5 B;  3RAQ A;  3AEV A;  4DWI A;  2EH9 A;  3C29 A;  3HRD D;  3MGH A;  5J0X A;  1BPY A;  2HHW A;  3LDA A;  4DL5 A;  2BGW A;  4PGQ A;  2RLT A;  1BPD A;  5KFO A;  5AKJ A;  1XSN A;  2OEH A;  2A19 A;  2VA3 A;  3ZDA A;  3RAX A;  5DG9 A;  5KFP A;  4ECS A;  1ZQO A;  4NL9 A;  5J0O A;  5IIM A;  4IRK A;  3K4G A;  3NGD A;  3C5G A;  5L1J A;  2A1J B;  4LJX A;  2K4H A;  2MRL A;  2AGP A;  2HMX A;  5III A;  3T5J A;  4RUA A;  1DK2 A;  3AQE A;  3V6H A;  3RRG A;  2JZB B;  2HVH A;  3RR7 A;  1WG8 A;  1ZQT A;  4FS1 A;  1RXV A;  5AI0 A;  2R8I A;  2EDU A;  3JPS A;  1XO1 A;  1DK3 A;  2K60 A;  2JMG A;  2QAR B;  4J9Q A;  3GFK B;  1YT3 A;  2R8K A;  1Y88 A;  3L3F X;  9ICR A;  4YD2 A;  1IM4 A;  3F5E A;  2IBK A;  3M8S A;  4B9S A;  1OUQ A;  1SV0 C;  1TAM A;  4UAU A;  2EZZ A;  1V9P A;  1ZQU A;  2IOF K;  3CYM A;  1S9F A;  9ICE A;  1WCL A;  3IDW A;  1FIQ A;  1KTQ A;  3PSP A;  8ICF A;  5J2B A;  4B9V A;  5ALG A;  2RQ5 A;  2OYY A;  5ALU A;  1RQN A;  5KFG A;  3GV7 B;  2F3N A;  3RJH A;  1C7Y A;  5ALF A;  3H0L B;  4J9N A;  1QTM A;  4DQR A;  1PVP A;  3AU6 A;  2YN4 A;  3TAC B;  1MSW D;  2ZTD A;  2JH7 A;  5KT5 A;  2KHV A;  2BCU A;  4Y2S A;  2DPJ A;  5DG7 A;  3IM1 A;  2WAQ C;  3WK8 A;  7ICT A;  4KIT B;  1S97 A;  5AIA A;  3KTQ A;  4MFF A;  1UT8 A;  4DQS A;  1S77 D;  3H8M A;  4LZD A;  4UAV A;  1NK9 A;  2NRT A;  2QLT A;  4PH5 A;  4EZ6 A;  1J97 A;  4NJ8 A;  8ICH A;  5ALO A;  1L7N A;  4RT2 A;  3ICX A;  2BKE A;  3PV8 A;  4Q44 A;  5KFU A;  4F92 B;  3TQ1 A;  4BJQ A;  5AKI A;  2ZIV B;  1ZQP A;  9ICH A;  1P7D A;  2IMW P;  3G6Y A;  3NRW A;  4IC9 A;  1URJ A;  4UW9 A;  4YG2 A;  4QZ8 A;  1TVA A;  2XY7 A;  4XRH A;  2K8C B;  3SMV A;  4J9R A;  4ED6 A;  3KD3 A;  2DL0 A;  1BNO A;  2KIC A;  4CF3 A;  1JAL A;  2BZF A;  3IN5 A;  3MGI A;  5J0U A;  4GFJ A;  3BJY A;  2BHN A;  3TKA A;  1XWL A;  1QSY A;  4F3O A;  1N48 A;  4LVS A;  4EX7 A;  4PHA A;  3QEA Z;  4P0P B;  3JPQ A;  4UB4 A;  1KW4 A;  1S5L U;  5J2G A;  2XC9 A;  1O03 A;  2KOB A;  5KT7 A;  1S8O A;  5KFK A;  2W8K A;  3H4B A;  5AM0 A;  1LB2 B;  2ODG A;  1KFD A;  1ZQW A;  4DEZ A;  2XO7 A;  1Z00 B;  9ICQ A;  3T3F A;  4EEK A;  4EEY A;  1ZJM A;  2DKZ A;  5D49 A;  5F9L A;  3OHA A;  3C2M A;  1IG6 A;  4JV0 A;  1KLN A;  1L6N A;  4KLJ A;  5D4B A;  4G3I A;  3RTV A;  4F71 A;  2M9N A;  3KBB A;  4BWJ A;  4F91 B;  2RDI A;  2PMZ F;  5KT4 A;  1L8L A;  4J9K A;  3QU2 A;  1A6S A;  5GTH U;  5J0W A;  4Q45 A;  4DOC A;  9ICU A;  2K8A A;  4DFK A;  2W03 A;  4QJF B;  4DSL A;  2XIC A;  1T4G A;  3K75 D;  3GIL A;  2KIV A;  4M9G A;  5J8Y C;  5EWE A;  2R18 A;  5J0Q A;  1RQL A;  3MGV A;  4PHE A;  4FBT A;  2ALZ A;  3ZDD A;  5F9N A;  2OHF A;  4Y2R A;  1HIW A;  4KLT A;  2ZIW B;  3V7L A;  2A1J A;  4I2J A; 
#chains in the Genus database with same CATH homology
 2QAR A;  3SEN A;  2KE7 A;  3BQ7 A;  1SV0 C;  3KKA A;  1LKY B;  2D8C A;  1OXJ A;  3BS7 A;  2E8O A;  1WWU A;  3IDW A;  5JTI A;  1KW4 A;  2FE9 A;  1SXD A;  2ES6 A;  5JRT A;  1X66 A;  3HIL A;  4RQN A;  5J8Y A;  2B6G A;  2QB1 A;  2F3N A;  1COK A;  2QKQ A;  3TAD C;  2KMD A;  1SV4 A;  3BS5 A;  2JV3 A;  3TAC B;  1UQV A;  2DKX A;  2F44 A;  4RQM A;  1LKY A;  2E8M A;  1B0X A;  4NL9 A;  2DKZ A;  1X9X A;  1RG6 A;  2EAO A;  1SV0 A;  3K1R B;  2KG5 A;  1WWV A;  5F3X B;  2EAP A;  2LMR A;  1SXE A;  2K4P A;  1PK1 B;  2GLE A;  3H8M A;  2F8K A;  2KSO B;  4PZO A;  2KSO A;  4NJ8 A;  3KKA C;  2EAN A;  1PK1 A;  1DXS A;  2E8P A;  1F0M A;  5JU5 A;  1UCV A;  1PK3 A;  2KIV A;  5J8Y C;  4MHV A;  1SGG A;  1B4F A;  2D3D A;  2L5Y A;  3TAD A;  2K60 A;  2ESE A;  2E8N A;  2Y9T A;  1OW5 A;  2QAR B;  2QB0 A;  4PZN A;  4IS7 A;  5KNI A;  2EAM A;  2LPE A;  3BS5 B;  1V85 A;  2Y9U A;  1JI7 A;  3SEI A;  1V38 A;  2YTU A;  2DL0 A;  1X40 A;  1Z1V A;  5L1M A;  4NL9 C;  2QB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...