2E8OA

Solution structure of the n-terminal sam-domain of the sam domain and hd domain containing protein 1 (dendritic cell-derived ifng-induced protein) (dcip) (monocyte protein 5) (mop-5)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
GSSGSSGSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SAM domain and HD domain-containing protein 1
publication title Solution structure of the N-terminal SAM-domain of the SAM domain and HD domain containing protein 1 (Dendritic cell-derived IFNG-induced protein) (DCIP) (Monocyte protein 5) (MOP-5)
rcsb
source organism Homo sapiens
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8oA01
5JU5A 1SV0C 1SXEA 1SV4A 1WWUA 3KKAC 3HILA 2QARA 4RQMA 2B6GA 1OXJA 2QARB 2JV3A 2ESEA 2F8KA 1LKYA 1LKYB 2EAPA 2ES6A 1JI7A 2F3NA 5J8YA 1X66A 2LMRA 1V85A 4NL9C 2E8PA 1OW5A 2KSOA 3TADC 3BQ7A 2KSOB 1COKA 2L5YA 2FE9A 1V38A 1PK1A 1X40A 5JTIA 1PK1B 4PZOA 2YTUA 2GLEA 2LPEA 4IS7A 2KG5A 1SXDA 5F3XB 2KMDA 2EAOA 1DXSA 2KE7A 1Z1VA 1UCVA 2E8NA 4MHVA 5L1MA 1SGGA 3SENA 3K1RB 2E8OA 4NJ8A 5J8YC 3TACB 3BS5A 2DKXA 1SV0A 3TADA 2QKQA 2D3DA 3BS7A 3BS5B 2KIVA 3KKAA 2K4PA 2DL0A 1B0XA 2D8CA 2F44A 1PK3A 1F0MA 4RQNA 2EANA 2DKZA 4PZNA 2E8MA 3IDWA 3H8MA 5JRTA 2Y9TA 2QB1A 3SEIA 1UQVA 2QB0A 5KNIA 2QB0B 4NL9A 2EAMA 1X9XA 1WWVA 1B4FA 1RG6A 1KW4A 2Y9UA 2K60A
chains in the Genus database with same CATH superfamily
1FFUA 5AK4A 2J6TA 5EWFA 4E0DA 3RAXA 1ED1A 5KFAA 1N56A 2QLTA 2FPKA 4BX9C 1TV9A 3QU2A 9ICSA 1L7MA 3WK4A 2W03A 2HVHA 1J2NA 3T3FA 1X6IA 1FIQA 9ICBA 3KHRA 3GIMA 4FE3A 2WF7A 1X66A 4KLOA 8ICZA 3ZD9A 2YMQA 3Q8QB 5KFYA 2EZZA 3H7IA 5KG7A 4DQPA 4I2EA 3IP4B 2RP5A 2H3ZA 5AK6A 5KG0A 2ZIUA 2ZUCA 3E2EA 7ICQA 2RDJA 4P0PA 4TURA 1Z4OA 2W55A 1ZQNA 2C22A 5F9LA 4CGZA 4C8NA 2N1RA 5J2FA 2NO5A 1N62A 3L4PA 5AKKA 5KFIA 4IQVA 4QZ8A 4ECTA 4U6PA 4YR0A 3SYZA 4DL2A 3WKAA 5KFVA 2DFLA 5J0XA 2WF9A 2K4EA 1H38A 4YP3A 3KKAA 3EYZA 2K4PA 4Y2YA 1JIHA 2NRTA 4ELTA 9ICIA 2NO4A 2HOQA 2OM6A 2EANA 3ZDCA 1XC9A 3KHLA 1QQ7A 2LM1A 4M04A 4MFCA 2VJ5A 3TARA 2HMXA 3ZDAA 1ZQSA 4K4HA 3ZD8A 3WK7A 4B6JA 3PSFA 3H0MB 1JXLA 2CN1A 3H8JA 1ZQMA 4ECVA 4RNOA 3CP8A 2R8GA 2IA6A 3RAQA 1KW4A 3SQIA 4RQ1A 1SKWA 3AQEA 5A0LA 3RJHA 5ALFA 5J29A 4FO6A 5AI5A 1BPEA 7ICUA 8ICQA 5KL8B 8ICBA 3BQ0A 4DL5A 1OW5A 3DEEA 4KLQA 4J9OA 4CRXA 4GLXA 1BPZA 3ALRA 1NJZA 3HP6A 3KOOA 5J2CA 5DGAA 1PVRA 3MR2A 1FFVA 2CPRA 4PZOA 3PSTA 9ICTA 9ICJA 1A77A 3D2QA 5AM4A 2DPIA 5KFTA 3QE9Y 4PHEA 2IBKA 4JV2A 2EAOA 4IQWA 3QUBA 4MHVA 4B9UA 1SGGA 4BXOB 3JPTA 1ZQWA 3RJKA 4JK1A 2FLPA 2K8CB 2RLTA 2IOFA 3M6KA 1KBUA 1ZQVA 2G09A 3IV6A 1U9LA 2F44A 3C21A 4PPXA 9ICUA 4UW9A 2YMLA 3GV7B 3RB4A 9ICEA 2G5HB 2LKYA 2ZUBA 4QZHA 3LVWA 2KVSA 1N60A 5ALRA 2KV2A 3ETLA 1KFSA 4RNNA 5CR0A 1NK8A 4J9RA 1VLBA 1WWVA 5AI0A 4I28A 2YX8A 1L7PA 1B4FA 2XCAA 3FAHA 2W43A 2K60A 5B5EU 2IOFK 4QWEA 2UVWA 2BDUA 5KFCA 3EPGA 2OYYA 4UB1A 1X9SA 4F5RA 4JMUA 4Q43A 2AHOB 3D2SA 3ISCA 2IHMA 2JGAA 2AQ4A 2AJQA 3GIIA 1HJPA 2XIDA 9ICHA 2BZFA 4BXOA 1BGXT 4DL3A 3HT3A 3RH5A 3MBYA 2FMQA 5J0YA 3F2DA 4OJOA 1XWLA 4Y2SA 2KHQA 2NYVA 2MSNA 2C2DA 2W54A 1JXEA 5K4LA 1LVHA 2ISPA 5KFMA 2W8KA 2HHXA 5ALKA 2KE7A 9ICAA 2A1AA 2AGOA 5L1MA 4F3OA 4IR1A 3T5JA 5AM0A 1K1SA 4UBBA 1MQ3A 3DV9A 1O03A 1X9MA 1MSWD 3TADA 2KVCA 2JEGA 1TKDA 5KFRA 1C7YA 3MGHA 4EZ9A 3N4MB 3KZXA 5E79U 5DG8A 3RRGA 1O08A 3RBEA 3M9NB 1PK3A 3SAHA 4OJLA 4OO1J 4O3NA 5KFJA 2GH1A 2KHVA 3H8MA 4NLBA 3M8RA 4OCZA 3TKAA 2RRDA 4C7YA 5HR6A 2HBKA 4U7CA 1SZPA 3I28A 2KICA 1Y88A 3EW9A 1KFDA 1IG6A 4DQRA 5DG7A 2HBJA 2MUTB 3QU5A 5IIOA 4RUCA 4EEKA 4NLGA 1QSYA 1QQ6A 1N61A 1YZ7A 5KFPA 4P4MA 5KT4A 5ALSA 1TVAA 2ZIWA 9ICXA 3PW2A 4ELUA 4KLJA 2ESEA 2ZXHA 4KLFA 1ECWA 1T4GA 4EBCA 3V6JA 4FZLA 1XU4A 5KG6A 4QZFA 2H3FA 2I6XA 8ICGA 3WKCA 3TADC 5IIMA 4I2BA 4LZDA 2ZTEA 5EOZA 4KLSA 3FDSA 5JTIA 1XNSA 1BPXA 1PK1B 1ZYQA 5KFWA 4UB4A 5DKWA 2WHEA 5BOLA 2GLEA 2OCEA 4USAA 2NRVA 1CI4A 2ZJ5A 4JWMA 2R8KA 5AKGA 5C0YA 4PHDA 2GWSA 3PMLA 3NVZA 4PL2A 1Z00B 3K75D 3M9OB 3NASA 4C80A 4R64A 4GXKA 3I1YA 2DL0A 1B0XA 2Y1IA 5ALXA 2HVIA 1BNPA 3NS1A 3QUTA 7ICIA 4F4ZA 5FP0A 1DOQA 4UAUA 2J6UA 5ALMA 3KZIU 2BR0A 3H0RB 4RQ5A 1NK9A 4M9LA 1FO4A 4MEXA 3MR5A 5GTHU 1RPLA 1B22A 1S10A 2BPGA 4CF5A 5AIBA 2XGQA 4FS2A 2GO7A 1L7NA 7ICOA 2V4QA 4PGXA 3UMBA 4GC7A 2PMZF 3RB0A 1N5XA 5L1IA 1KEJA 2KEYA 3PNCA 3Q8RB 4KLEA 4ED7A 2B6GA 5DQHA 2QARB 1NJWA 2JZBB 7ICVA 4HAIA 5AM2A 4NXZA 4Y2JA 5DG9A 1JI7A 1D8BA 4YQWA 4QIWF 3GU3A 1NZBA 4F71A 2ISOA 3SZ2A 4UB2A 5DQIA 8ICCA 3JPPA 2DBYA 1Z00A 1ZD2P 3RRHA 3K1ZA 4F93B 8ICEA 1V38A 2JMGA 5J0WA 5KT7A 2YTUA 3NVYA 1FEZA 2HCFA 4IL6U 2JEIA 1L3UA 1ZQXA 5DDMA 4I2GA 1U49A 2UVUA 4ICAA 3D6JA 1KKXA 2JEFA 4YXJA 2LI6A 4ECRA 2WB1C 1ZQYA 1T7PA 8ICOA 3KHGA 4OD0A 4Y2RA 2D3DA 1NJXA 1ZD5A 1DGSA 2HHQA 3HKZC 2LBOA 4KLUA 1K5OA 1NKCA 3CNHA 5J0UA 5L1JA 5KFKA 4PHPA 4UAWA 2HBLA 3IHQB 1MC8A 5HP4A 4RZRA 4FS1A 4F5PA 4RT3A 2LM4A 5AKJA 2W9CB 1S97A 1KLNA 1S0MA 1RG6A 4DFDA 5DBAA 5ALNA 1IXRA 2OEHA 3QUQA 3HILA 2OHFA 4OJ6A 4J9SA 4XUSA 4BGDA 3F2BA 1OUQA 2JV3A 4O3OA 2AH5A 1Z1BA 4EENA 4YMNA 4BDPA 1ZQHA 1N2XA 4O5KA 2BPCA 5DB9A 1N48A 2WTFA 1SWVA 1ZQEA 5AKZA 4GXIA 2ODGA 2FPLA 2E8PA 2KSOA 4PGYA 2F1JA 1SL0A 4F4XA 3QU7A 4AP9A 5BOMA 3WK6A 1RYRA 5IIJA 2LYBA 4Q44A 1ZOLA 4Y2TA 3IRUA 3SV3A 1RYSA 2JXJA 5ALQA 5KFOA 4ECQA 3SR6A 4QZGA 1TE2A 2D6FC 3C29A 3NTUA 2KNJA 4QZAA 1HEKA 3V7KA 4YFKA 5J8YC 4C8LA 1UPHA 4M9NA 2W7OA 2DKXA 2ZIVA 5KL1B 9ICNA 2QKQA 3BS5B 5AKEA 3BQ2A 3PW7A 3PO5A 1D8YA 5D46A 2W9BB 1COOA 3RJEA 4I2IA 2HHSA 2OWOA 3NRWA 5AK5A 3AQFA 1U4BA 3VCBA 2KTQA 4C4RA 3PV8A 3N97B 2HHUA 5KNIA 2LYAA 2QB0B 2KKPA 2K4HA 2AGPA 3OHAA 3DDHA 5GTIU 1TFRA 9ICOA 4R8UB 3T79A 1Q8KA 3KHHA 4O9MA 5AI6A 1VDVA 4DFKA 3NUQA 3PMNA 4DL7A 2Q0ZX 1ZQPA 5AK3A 3T5LA 3AEVA 2WF8A 3ETRA 4KMUA 3WKBA 5IILA 2HSZA 3PY8A 2AGQA 3EZ5A 4I2JA 1ZQIA 3ED5A 3WK8A 1LV5A 1QLNA 4DF4A 1TAUA 3N28A 4EX6A 3SAGA 4DWIA 2LMRA 3JPQA 4B9SA 1S77D 3BZCA 2BQRA 4DL6A 2DWQA 3PZPA 4CDGA 1SL1A 3PSPA 2FE9A 4K4GA 4DSFA 4ECYA 3H0LB 2W9BA 5CEHA 1ZJMA 2WF6A 3ZI4A 5F3XB 3C5GA 3FYHA 4AYBC 1UA0A 2YB1A 5AIAA 4TUSA 2XI9A 7ICNA 4M9HA 7ICPA 2E8OA 2KN7A 4A8EA 4R8UA 1JALA 2W9MA 5KG1A 4UARA 3G6VA 1AQ6A 2K8BB 4DSKA 1YZ6A 3H8SA 2Y1JA 3GFKB 3AU6A 2I5HA 2DKZA 3QNMA 5J0PA 3IDWA 3KD3A 4BWMA 2YQEA 5AKLA 5JRTA 2Y9TA 4EZ6A 8ICFA 2W3RA 3OJSA 1X9WA 1HIWA 3L5KA 5T14A 2BCQA 4DLEA 3EUB2 3V6HA 4NM2A 4CF3A 3KBBA 1HUZA 4M6WB 2G07A 5IIKA 4JWNA 2ZG6A 3ONNA 2UVRA 1SXEA 4EELA 2G0AA 4EYIB 2FLNA 4F5QA 4RQ6A 2JR5A 1L8OA 1SL2A 4ZOHC 4RU9A 2KJ9A 2FMSA 4EYHB 1L3VA 3AUOA 1RDFA 3ZDEA 3UMGA 5DDYA 4RT2A 2UVVA 2XCPA 9ICQA 1L6NA 4Z6CA 2YY6A 4HYKA 3TI0A 1CUKA 4CF4A 1RQNA 1SKSA 4P0QB 4C4SA 3LYSA 5AHXA 2EDUA 5KG5A 3M1YA 4C8OA 5AI9A 4YD2A 5ALOA 5ALDA 1U47A 1RM6C 1XO1A 4NJ8A 4DSJA 5J0QA 3AMZA 2OXOA 3H4BA 2DQNB 3D2NA 3J81j 3F53A 8ICPA 1J2MA 2E5SA 1D9FA 4O5CA 1RZTA 2HDOA 3OGUA 3MDCA 1ZQRA 5KT3A 4MFAA 1IM4A 4IR9A 3SV4A 4KLDA 1RQLA 1UQVA 4Z6EA 3OPXA 4MF8A 3RR7A 3JPSA 3FC4A 5J2EA 3GZFA 4UB6U 4IRCA 2KJ5A 4CE6A 4ED0A 4UB5A 3HW8A 3AU2A 3Q8PB 3SMVA 8ICLA 1KDHA 4QWBA 2PFNA 2A19A 2ZIXB 2P66A 3JPNA 1UHUA 2HBMA 4QWDA 4KTQA 2RDIA 3SAFA 4QW9A 5H2FU 3QEBZ 2F76X 2XY5A 2C2RA 1LKYB 5J2BA 1F44A 1VJ5A 3RJFA 5ALPA 8ICWA 4QWCA 5HNKA 4B9MA 3TFRA 2WAQF 4LZGA 3BQ7A 3BZKA 5KFNA 4US9A 1QSLA 3R9KA 4P4PA 5J0RA 3HRDD 8ICKA 1L8LA 9ICMA 3GIJA 2FLLA 5B66U 1URJA 4ECUA 3UMCA 2P6RA 4J9LA 4DLGA 1ZRMA 2KMDA 4C8KA 3NRZA 4ED3A 3ISDA 4B9NA 4QZ9A 3LK9A 2KFZA 3TAQA 4XQ8A 3PX4A 1A76A 4NM1A 5TZVA 3C2MA 2ALZA 3A0BU 2Y0SC 1PZNA 7ICEA 2VIXA 4YCXA 1QQ5A 2ZTCA 3RFAA 2BQUA 4KN4A 3LWMA 1BNOA 4PZNA 1ZQZA 5AI8A 2BCVA 4QZEA 4NLKA 2W8LA 3NVVA 4EBDA 2XC9A 5J0TA 1QSSA 8ICTA 4RPYA 3PW4A 3WK9A 2MUTA 4IRKA 2V4RA 1MQ2A 4QJFB 1ZD3A 1JMSA 3Q8MA 8ICYA 9ICWA 3ICXA 7ICKA 1ZRNA 1LB2B 3N7SC 3ISBA 1SZHA 2JH1A 5DQGA 1ZQFA 1OXJA 5ALJA 3MDAA 2BCSA 2F8KA 4RPZA 5ALTA 1UT5A 2HOIA 3RH6A 2PFQA 4X5VA 4PHAA 3QZ7A 3RJIA 4NLNA 1IV8A 9ICFA 5DBBA 3GV8B 2E1EA 2ASJA 2R18A 4JV1A 5EE9A 2ZTDA 4YMOA 3RF9A 3M6ZA 1GO3F 3BJYA 1PUZA 2WB1F 1PK1A 1ZQKA 1JUDA 5HMMA 5ALZA 5CRXA 4UATA 3HKZF 1A0PA 3JPOA 5CA7A 1Z4NA 5ALGA 4FBTA 2F77X 1DGJA 3TANA 3IG5A 1DXSA 4KLMA 3RB6A 3IG8A 2KZZA 4I2DA 2VA2A 5ALVA 4QZCA 2W04A 3ZDDA 4DQIA 7ICFA 2ZUDA 4F2RA 2XGPA 1QCKA 5CP2A 2GOLA 5AM5A 4YR3A 5G5HA 4J03A 2F1IA 4QWAA 1ZQCA 2PI4A 4YN4A 1F0MA 3AM9A 4R63A 5J0OA 2R8JA 4Q8EA 7ICTA 2BDPA 3NVWA 4F91B 2JRZA 4EEYA 2HHTA 1JN3A 1XSLA 5AKIA 3V7JA 4IQTA 5IINA 4UB8U 3QX7A 5F9NA 2PXIA 1SV0C 4OJPA 3ZDBA 3HX0A 4F2SA 1WYGA 2QARA 2ZXIA 2JZBA 2V9WA 1ZQTA 3C23A 8ICNA 2A1JB 4J9NA 4I2FA 5J8YA 1KTQA 1S5LU 1SIJA 1KFTA 3OSNA 3PSIA 3HPOA 4NL9C 2MAXA 5DLFA 5KFGA 5KFBA 4Q8FA 4US8A 2BPFA 4F4WA 1NK5A 4C0ZA 5DB6A 2EQYA 2KOBA 3U26A 5J2DA 1WCLA 4RNMA 2ZIUB 5EE3A 5DGBA 4P0PB 2LPEA 2VANA 3VC8A 3UXOA 5AM3A 4ECWA 3QUCA 1S76D 3M7DA 2C2EA 4F5NA 3C1YA 2JH7A 4C4TA 3BQTA 1T3QA 3CRXA 2XO7A 3QU9A 4RQ4A 2AU0A 3CW2C 1S8OA 3K1RB 3N7PD 5KT2A 4DOBA 3TACB 1BVSA 1TK0A 5KFXA 1T8EA 9ICCA 1P7DA 5EE1A 4PL1A 3QZ8A 1L7OA 2M0NA 1NK6A 2A3VA 4I2CA 7ICLA 4KLGA 4RQNA 4Y2XA 2PKEA 3H8WA 5KAFU 4I2AA 3UM9A 1V9PA 2A1JA 2MU2A 2W9CA 3V7LA 2EZXA 5D49A 4TUQA 1CRXA 2DPJA 1ZQOA 4FZMA 3PW5A 1DK3A 2KKVA 3LWLA 4NWIA 4DS4A 2KK0A 4O3PA 4G9BA 4DFMA 4RQMA 5KG3A 4ED8A 4KLLA 3C2LA 8ICIA 2DGZA 2F3NA 2Z7JA 1L3TA 4J9PA 3PX0A 4LJXA 1V85A 1ZD4A 4KX3A 4AYBF 4R65A 7ICRA 4F4YA 8ICUA 4Z6DA 9ICGA 5TISU 5KFUA 2YN4A 1XO0A 1N63A 3RTVA 4PJ0U 1T3NA 5DB7A 1Z19A 9ICRA 1NK7A 4LVSA 2K89A 1SB3C 2BQ3A 2G06A 3C1ZA 2E3TA 4K4IA 2WFAA 4YVZA 4J9KA 4Y2VA 4MEYA 3GIKA 2G08A 3SI8A 3BS5A 5KFZA 3PX6A 3RR8A 3WKDA 4MFFA 5JUMA 3H4DA 1AROP 4ECXA 1S0VA 1KQQA 1BPBA 2CRXA 1XSPA 7ICHA 7ICJA 1ZQGA 3OTQA 2KIWA 1N5WA 1ZQUA 1ZQBA 2KJ8A 2QB0A 1L3SA 5DLGA 3RH4A 2VKQA 2CXYA 4KITB 2PFOA 5L1KA 4DQQA 4DQSA 3GV5B 1T94A 4O3MA 2VA8A 1CEZA 2YMMA 5JU5A 5AKXA 1BPYA 3BQ1A 3KKAC 7ICSA 4DS5A 4DFPA 3THVA 3T5HA 4F4KA 3MABA 1S9FA 1EXNA 2R8HA 1J97A 1XSNA 3UPQA 1S0NA 3GQCA 5ALUA 5DBCA 4DO9A 1WCNA 2EZYA 4GIBA 3E58A 4QNLA 3E0FA 3FM9A 5CB1A 2XY6A 1TAMA 8ICAA 2LYHA 2BCUA 4ECZA 2PI5A 3LVVA 1M6YA 3H40A 5ALLA 1WG8A 1PVQA 4RQ8A 5KFHA 2L5YA 2JHDA 1X40A 2OH2A 4RQ0A 5EWGA 1ZJNA 1DRGA 5ALHA 3M9MB 3EWAA 2HHVA 4ACOA 2FMPA 9ICPA 2LHTA 1X42A 4IS7A 2KG5A 4F72A 2F8LA 3O0FA 1NJYA 4EX7A 3OHBA 2F2AB 2Q4TA 2KZMA 1Z1VA 4DF8A 2NV3A 4O5EA 1XS9D 2HW3A 3B9JA 2H3QA 4GC6A 4C7ZA 4DOCA 3AL0B 1D8LA 2ASLA 2W7PA 3MGVA 4M47A 4UASA 2I9GA 3A0HU 3TAPA 4UAZA 2D8CA 4DCCA 1SWWA 1JRPA 4NV0A 2R8IA 4QZIA 1Z3EB 4RPXA 4KMOB 2DUYA 3MC1A 2VJ4A 4YR2A 1IIPA 1NKEA 2BGWA 4IRDA 2KZ3A 5J2HA 9ICKA 3SEIA 2YMPA 4F8RA 4CCHA 3QEAZ 2FDRA 4M6WA 2F1HA 3GILA 5J2GA 5EWEA 4G3IA 2Y9UA 1K1QA 3JPRA 4R66A 3MGIA 1SV4A 5G5GA 1WWUA 3MR3A 3UQ0A 2B21A 4JV0A 2G5IB 1MA7A 2PFPA 2ZIWB 3PO4A 1L5UA 2DF4B 1Q46A 5C5JA 2BHNA 3QXGA 4F92B 3F2CA 2H5XA 1TK5A 5J2AA 1HUOA 2IMWP 2ZJ8A 5J2KA 3UXPA 1NK0A 4O3SA 2E1FA 1X2IA 1SKRA 1DK2A 2W11A 3UQ2A 4Z6FA 3HWTA 5AI4A 3T5KA 4P0QA 5KFEA 1RXWA 1ZQJA 4PGQA 4KLHA 4C8MA 4J9MA 2Y0SF 3F5AA 3B0YA 4M2YA 4KLTA 1A6SA 1NI3A 3BDPA 5J0SA 5HMLA 4XA5A 8ICXA 4YD1A 4RQ3A 4Y2UA 3RBDA 2YB4A 4I29A 2W3SA 3N7RC 2J6SA 4NLZA 5AKHA 4DFJA 3PR5B 5HHIA 4P4OA 4Y2QA 4RQ7A 1YT3A 4NY8A 3RB3A 2H3IA 1TAQA 3AN1A 5CJ7A 1UA1A 2XY7A 4KX5A 4EBEA 3C2KA 3PVXA 4ED1A 3IM1A 3ORYA 4DSLA 1F5SA 3CYMA 5ALIA 4IQUA 3KFUF 5AKYA 3WKEA 4O3RA 4ELVA 5KFFA 3RJGA 1C20A 4M9JA 8ICVA 2AXTU 1Q3VA 2ATLA 2NRZA 2FPMA 5KT6A 2ZIXA 2XVTA 5AICA 1TK8A 5ALWA 8ICJA 4Y2PA 1V97A 5KFSA 3MR6A 1WUDA 2IHNA 1LKYA 3M8SA 4GFJA 4J9QA 4BJQA 4YMMA 4ECSA 2ES6A 5L9XA 1ZQAA 3WK5A 1S0OA 9ICLA 2B0CA 4TQRA 4Q45A 5AM1A 2WF5A 4YXMA 4M9GA 2WAQC 2HOFA 3K4GA 1ZETA 4CNQA 2XICA 2MRLA 1B43A 3MFIA 2JEJA 5CWRA 4UAYA 5HHHA 5KFDA 4IC9A 2C28A 3SD7A 3C28A 3RJJA 3PR4A 4FZNA 2H3VA 4QZDA 4UQGA 1SXDA 4WJ3B 5KTQA 4TUPA 4XRHA 2HHWA 4FBUA 1UCVA 1ZQQA 1KRPA 4DSEA 2VA3A 3SENA 1ZQLA 4B9TA 3EPIA 8ICRA 1SV0A 7ICGA 3I76A 4UAVA 3Q8LA 4ED2A 5KFQA 1JX4A 4PH5A 5KAIU 2EH9A 4B9LA 8ICHA 4P2HA 3TFSA 5KT5A 4DL4A 4ED6A 2I1QA 1ZXIA 2E8MA 2NRXA 3Q8KA 1KN5A 5ALEA 2QB1A 4ZH4A 3KTQA 4NL9A 1KSPA 2EAMA 4RQ2A 3L3FX 1NKBA 4RUAA 4KLIA 4FFDA 2FJ6A 4I2HA 3B0XA 3QU4A 5IIIA 3C5FA 3OJUA 3MFHA 1RYUA 2RQ5A 2KFNA 1Q3UA 3Q8SB 1ZQ1C 3QYPA 4B9VA 3TQ1A 3G6YA 5HR7A 3F5EA 4JB3A 2EAPA 4JUZA 3IN5A 3GDXA 1PVPA 3HJEA 9ICVA 4QW8A 3S6JA 1BPDA 3V72A 5ALYA 2PMZC 4NLCA 1QTMA 4I27A 2W9AA 4UB3A 8ICSA 2KSOB 1COKA 3V6KA 4DOAA 4OJ5A 1U45A 2KP7A 2MA1A 4UBCA 4F50A 1KL9A 5DB8A 4KN7A 5KFLA 2BCRA 3WU2U 5CHGA 2NRWA 5L1LA 2P6UA 4BWJA 4QIWC 2P35A 5BPCA 1U48A 4YG2A 5J2IA 1X6JA 4MF2A 7ICMA 2E8NA 1D9DA 4O3QA 4DSIA 2O6KA 1NZPA 2RHFA 5KG4A 2BKEA 4F5OA 2ZJAA 2M9NA 4O0IA 3LDAA 3BS7A 2HI0A 2KIVA 2ZIVB 2IOHA 3UXNA 2K4IA 3G6XA 4BUGA 1MN8A 1UT8A 2ASDA 4DEZA 2FI1A 4QZBA 2AQ0A 8ICMA 4GXJA 4TQSA 1RXVA 5D4BA 3OSPA 5KG2A 3NGDA 2K8AA 1NOMA 1X9XA 2KD1A 1QH9A 5J2JA 1NNLA 5EE0A 1NK4A 1JROA 3PW0A 1ZQDA 4M0AA
chains in the Genus database with same CATH topology
5JU5A 1SV0C 1SXEA 1SV4A 1WWUA 3KKAC 3HILA 2QARA 4RQMA 2B6GA 1OXJA 2QARB 2JV3A 2ESEA 2F8KA 1LKYA 1LKYB 2EAPA 2ES6A 1JI7A 2F3NA 5J8YA 1X66A 2LMRA 1V85A 4NL9C 2E8PA 1OW5A 2KSOA 3TADC 3BQ7A 2KSOB 1COKA 2L5YA 2FE9A 1V38A 1PK1A 1X40A 5JTIA 1PK1B 4PZOA 2YTUA 2GLEA 2LPEA 4IS7A 2KG5A 1SXDA 5F3XB 2KMDA 2EAOA 1DXSA 2KE7A 1Z1VA 1UCVA 2E8NA 4MHVA 5L1MA 1SGGA 3SENA 3K1RB 2E8OA 4NJ8A 5J8YC 3TACB 3BS5A 2DKXA 1SV0A 3TADA 2QKQA 2D3DA 3BS7A 3BS5B 2KIVA 3KKAA 2K4PA 2DL0A 1B0XA 2D8CA 2F44A 1PK3A 1F0MA 4RQNA 2EANA 2DKZA 4PZNA 2E8MA 3IDWA 3H8MA 5JRTA 2Y9TA 2QB1A 3SEIA 1UQVA 2QB0A 5KNIA 2QB0B 4NL9A 2EAMA 1X9XA 1WWVA 1B4FA 1RG6A 1KW4A 2Y9UA 2K60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JU5 A;  1SV0 C;  1SXE A;  1SV4 A;  1WWU A;  3KKA C;  3HIL A;  2QAR A;  4RQM A;  2B6G A;  1OXJ A;  2QAR B;  2JV3 A;  2ESE A;  2F8K A;  1LKY A;  1LKY B;  2EAP A;  2ES6 A;  1JI7 A;  2F3N A;  5J8Y A;  1X66 A;  2LMR A;  1V85 A;  4NL9 C;  2E8P A;  1OW5 A;  2KSO A;  3TAD C;  3BQ7 A;  2KSO B;  1COK A;  2L5Y A;  2FE9 A;  1V38 A;  1PK1 A;  1X40 A;  5JTI A;  1PK1 B;  4PZO A;  2YTU A;  2GLE A;  2LPE A;  4IS7 A;  2KG5 A;  1SXD A;  5F3X B;  2KMD A;  2EAO A;  1DXS A;  2KE7 A;  1Z1V A;  1UCV A;  2E8N A;  4MHV A;  5L1M A;  1SGG A;  3SEN A;  3K1R B;  2E8O A;  4NJ8 A;  5J8Y C;  3TAC B;  3BS5 A;  2DKX A;  1SV0 A;  3TAD A;  2QKQ A;  2D3D A;  3BS7 A;  3BS5 B;  2KIV A;  3KKA A;  2K4P A;  2DL0 A;  1B0X A;  2D8C A;  2F44 A;  1PK3 A;  1F0M A;  4RQN A;  2EAN A;  2DKZ A;  4PZN A;  2E8M A;  3IDW A;  3H8M A;  5JRT A;  2Y9T A;  2QB1 A;  3SEI A;  1UQV A;  2QB0 A;  5KNI A;  2QB0 B;  4NL9 A;  2EAM A;  1X9X A;  1WWV A;  1B4F A;  1RG6 A;  1KW4 A;  2Y9U A;  2K60 A; 
#chains in the Genus database with same CATH topology
 1FFU A;  5AK4 A;  2J6T A;  5EWF A;  4E0D A;  3RAX A;  1ED1 A;  5KFA A;  1N56 A;  2QLT A;  2FPK A;  4BX9 C;  1TV9 A;  3QU2 A;  9ICS A;  1L7M A;  3WK4 A;  2W03 A;  2HVH A;  1J2N A;  3T3F A;  1X6I A;  1FIQ A;  9ICB A;  3KHR A;  3GIM A;  4FE3 A;  2WF7 A;  1X66 A;  4KLO A;  8ICZ A;  3ZD9 A;  2YMQ A;  3Q8Q B;  5KFY A;  2EZZ A;  3H7I A;  5KG7 A;  4DQP A;  4I2E A;  3IP4 B;  2RP5 A;  2H3Z A;  5AK6 A;  5KG0 A;  2ZIU A;  2ZUC A;  3E2E A;  7ICQ A;  2RDJ A;  4P0P A;  4TUR A;  1Z4O A;  2W55 A;  1ZQN A;  2C22 A;  5F9L A;  4CGZ A;  4C8N A;  2N1R A;  5J2F A;  2NO5 A;  1N62 A;  3L4P A;  5AKK A;  5KFI A;  4IQV A;  4QZ8 A;  4ECT A;  4U6P A;  4YR0 A;  3SYZ A;  4DL2 A;  3WKA A;  5KFV A;  2DFL A;  5J0X A;  2WF9 A;  2K4E A;  1H38 A;  4YP3 A;  3KKA A;  3EYZ A;  2K4P A;  4Y2Y A;  1JIH A;  2NRT A;  4ELT A;  9ICI A;  2NO4 A;  2HOQ A;  2OM6 A;  2EAN A;  3ZDC A;  1XC9 A;  3KHL A;  1QQ7 A;  2LM1 A;  4M04 A;  4MFC A;  2VJ5 A;  3TAR A;  2HMX A;  3ZDA A;  1ZQS A;  4K4H A;  3ZD8 A;  3WK7 A;  4B6J A;  3PSF A;  3H0M B;  1JXL A;  2CN1 A;  3H8J A;  1ZQM A;  4ECV A;  4RNO A;  3CP8 A;  2R8G A;  2IA6 A;  3RAQ A;  1KW4 A;  3SQI A;  4RQ1 A;  1SKW A;  3AQE A;  5A0L A;  3RJH A;  5ALF A;  5J29 A;  4FO6 A;  5AI5 A;  1BPE A;  7ICU A;  8ICQ A;  5KL8 B;  8ICB A;  3BQ0 A;  4DL5 A;  1OW5 A;  3DEE A;  4KLQ A;  4J9O A;  4CRX A;  4GLX A;  1BPZ A;  3ALR A;  1NJZ A;  3HP6 A;  3KOO A;  5J2C A;  5DGA A;  1PVR A;  3MR2 A;  1FFV A;  2CPR A;  4PZO A;  3PST A;  9ICT A;  9ICJ A;  1A77 A;  3D2Q A;  5AM4 A;  2DPI A;  5KFT A;  3QE9 Y;  4PHE A;  2IBK A;  4JV2 A;  2EAO A;  4IQW A;  3QUB A;  4MHV A;  4B9U A;  1SGG A;  4BXO B;  3JPT A;  1ZQW A;  3RJK A;  4JK1 A;  2FLP A;  2K8C B;  2RLT A;  2IOF A;  3M6K A;  1KBU A;  1ZQV A;  2G09 A;  3IV6 A;  1U9L A;  2F44 A;  3C21 A;  4PPX A;  9ICU A;  4UW9 A;  2YML A;  3GV7 B;  3RB4 A;  9ICE A;  2G5H B;  2LKY A;  2ZUB A;  4QZH A;  3LVW A;  2KVS A;  1N60 A;  5ALR A;  2KV2 A;  3ETL A;  1KFS A;  4RNN A;  5CR0 A;  1NK8 A;  4J9R A;  1VLB A;  1WWV A;  5AI0 A;  4I28 A;  2YX8 A;  1L7P A;  1B4F A;  2XCA A;  3FAH A;  2W43 A;  2K60 A;  5B5E U;  2IOF K;  4QWE A;  2UVW A;  2BDU A;  5KFC A;  3EPG A;  2OYY A;  4UB1 A;  1X9S A;  4F5R A;  4JMU A;  4Q43 A;  2AHO B;  3D2S A;  3ISC A;  2IHM A;  2JGA A;  2AQ4 A;  2AJQ A;  3GII A;  1HJP A;  2XID A;  9ICH A;  2BZF A;  4BXO A;  1BGX T;  4DL3 A;  3HT3 A;  3RH5 A;  3MBY A;  2FMQ A;  5J0Y A;  3F2D A;  4OJO A;  1XWL A;  4Y2S A;  2KHQ A;  2NYV A;  2MSN A;  2C2D A;  2W54 A;  1JXE A;  5K4L A;  1LVH A;  2ISP A;  5KFM A;  2W8K A;  2HHX A;  5ALK A;  2KE7 A;  9ICA A;  2A1A A;  2AGO A;  5L1M A;  4F3O A;  4IR1 A;  3T5J A;  5AM0 A;  1K1S A;  4UBB A;  1MQ3 A;  3DV9 A;  1O03 A;  1X9M A;  1MSW D;  3TAD A;  2KVC A;  2JEG A;  1TKD A;  5KFR A;  1C7Y A;  3MGH A;  4EZ9 A;  3N4M B;  3KZX A;  5E79 U;  5DG8 A;  3RRG A;  1O08 A;  3RBE A;  3M9N B;  1PK3 A;  3SAH A;  4OJL A;  4OO1 J;  4O3N A;  5KFJ A;  2GH1 A;  2KHV A;  3H8M A;  4NLB A;  3M8R A;  4OCZ A;  3TKA A;  2RRD A;  4C7Y A;  5HR6 A;  2HBK A;  4U7C A;  1SZP A;  3I28 A;  2KIC A;  1Y88 A;  3EW9 A;  1KFD A;  1IG6 A;  4DQR A;  5DG7 A;  2HBJ A;  2MUT B;  3QU5 A;  5IIO A;  4RUC A;  4EEK A;  4NLG A;  1QSY A;  1QQ6 A;  1N61 A;  1YZ7 A;  5KFP A;  4P4M A;  5KT4 A;  5ALS A;  1TVA A;  2ZIW A;  9ICX A;  3PW2 A;  4ELU A;  4KLJ A;  2ESE A;  2ZXH A;  4KLF A;  1ECW A;  1T4G A;  4EBC A;  3V6J A;  4FZL A;  1XU4 A;  5KG6 A;  4QZF A;  2H3F A;  2I6X A;  8ICG A;  3WKC A;  3TAD C;  5IIM A;  4I2B A;  4LZD A;  2ZTE A;  5EOZ A;  4KLS A;  3FDS A;  5JTI A;  1XNS A;  1BPX A;  1PK1 B;  1ZYQ A;  5KFW A;  4UB4 A;  5DKW A;  2WHE A;  5BOL A;  2GLE A;  2OCE A;  4USA A;  2NRV A;  1CI4 A;  2ZJ5 A;  4JWM A;  2R8K A;  5AKG A;  5C0Y A;  4PHD A;  2GWS A;  3PML A;  3NVZ A;  4PL2 A;  1Z00 B;  3K75 D;  3M9O B;  3NAS A;  4C80 A;  4R64 A;  4GXK A;  3I1Y A;  2DL0 A;  1B0X A;  2Y1I A;  5ALX A;  2HVI A;  1BNP A;  3NS1 A;  3QUT A;  7ICI A;  4F4Z A;  5FP0 A;  1DOQ A;  4UAU A;  2J6U A;  5ALM A;  3KZI U;  2BR0 A;  3H0R B;  4RQ5 A;  1NK9 A;  4M9L A;  1FO4 A;  4MEX A;  3MR5 A;  5GTH U;  1RPL A;  1B22 A;  1S10 A;  2BPG A;  4CF5 A;  5AIB A;  2XGQ A;  4FS2 A;  2GO7 A;  1L7N A;  7ICO A;  2V4Q A;  4PGX A;  3UMB A;  4GC7 A;  2PMZ F;  3RB0 A;  1N5X A;  5L1I A;  1KEJ A;  2KEY A;  3PNC A;  3Q8R B;  4KLE A;  4ED7 A;  2B6G A;  5DQH A;  2QAR B;  1NJW A;  2JZB B;  7ICV A;  4HAI A;  5AM2 A;  4NXZ A;  4Y2J A;  5DG9 A;  1JI7 A;  1D8B A;  4YQW A;  4QIW F;  3GU3 A;  1NZB A;  4F71 A;  2ISO A;  3SZ2 A;  4UB2 A;  5DQI A;  8ICC A;  3JPP A;  2DBY A;  1Z00 A;  1ZD2 P;  3RRH A;  3K1Z A;  4F93 B;  8ICE A;  1V38 A;  2JMG A;  5J0W A;  5KT7 A;  2YTU A;  3NVY A;  1FEZ A;  2HCF A;  4IL6 U;  2JEI A;  1L3U A;  1ZQX A;  5DDM A;  4I2G A;  1U49 A;  2UVU A;  4ICA A;  3D6J A;  1KKX A;  2JEF A;  4YXJ A;  2LI6 A;  4ECR A;  2WB1 C;  1ZQY A;  1T7P A;  8ICO A;  3KHG A;  4OD0 A;  4Y2R A;  2D3D A;  1NJX A;  1ZD5 A;  1DGS A;  2HHQ A;  3HKZ C;  2LBO A;  4KLU A;  1K5O A;  1NKC A;  3CNH A;  5J0U A;  5L1J A;  5KFK A;  4PHP A;  4UAW A;  2HBL A;  3IHQ B;  1MC8 A;  5HP4 A;  4RZR A;  4FS1 A;  4F5P A;  4RT3 A;  2LM4 A;  5AKJ A;  2W9C B;  1S97 A;  1KLN A;  1S0M A;  1RG6 A;  4DFD A;  5DBA A;  5ALN A;  1IXR A;  2OEH A;  3QUQ A;  3HIL A;  2OHF A;  4OJ6 A;  4J9S A;  4XUS A;  4BGD A;  3F2B A;  1OUQ A;  2JV3 A;  4O3O A;  2AH5 A;  1Z1B A;  4EEN A;  4YMN A;  4BDP A;  1ZQH A;  1N2X A;  4O5K A;  2BPC A;  5DB9 A;  1N48 A;  2WTF A;  1SWV A;  1ZQE A;  5AKZ A;  4GXI A;  2ODG A;  2FPL A;  2E8P A;  2KSO A;  4PGY A;  2F1J A;  1SL0 A;  4F4X A;  3QU7 A;  4AP9 A;  5BOM A;  3WK6 A;  1RYR A;  5IIJ A;  2LYB A;  4Q44 A;  1ZOL A;  4Y2T A;  3IRU A;  3SV3 A;  1RYS A;  2JXJ A;  5ALQ A;  5KFO A;  4ECQ A;  3SR6 A;  4QZG A;  1TE2 A;  2D6F C;  3C29 A;  3NTU A;  2KNJ A;  4QZA A;  1HEK A;  3V7K A;  4YFK A;  5J8Y C;  4C8L A;  1UPH A;  4M9N A;  2W7O A;  2DKX A;  2ZIV A;  5KL1 B;  9ICN A;  2QKQ A;  3BS5 B;  5AKE A;  3BQ2 A;  3PW7 A;  3PO5 A;  1D8Y A;  5D46 A;  2W9B B;  1COO A;  3RJE A;  4I2I A;  2HHS A;  2OWO A;  3NRW A;  5AK5 A;  3AQF A;  1U4B A;  3VCB A;  2KTQ A;  4C4R A;  3PV8 A;  3N97 B;  2HHU A;  5KNI A;  2LYA A;  2QB0 B;  2KKP A;  2K4H A;  2AGP A;  3OHA A;  3DDH A;  5GTI U;  1TFR A;  9ICO A;  4R8U B;  3T79 A;  1Q8K A;  3KHH A;  4O9M A;  5AI6 A;  1VDV A;  4DFK A;  3NUQ A;  3PMN A;  4DL7 A;  2Q0Z X;  1ZQP A;  5AK3 A;  3T5L A;  3AEV A;  2WF8 A;  3ETR A;  4KMU A;  3WKB A;  5IIL A;  2HSZ A;  3PY8 A;  2AGQ A;  3EZ5 A;  4I2J A;  1ZQI A;  3ED5 A;  3WK8 A;  1LV5 A;  1QLN A;  4DF4 A;  1TAU A;  3N28 A;  4EX6 A;  3SAG A;  4DWI A;  2LMR A;  3JPQ A;  4B9S A;  1S77 D;  3BZC A;  2BQR A;  4DL6 A;  2DWQ A;  3PZP A;  4CDG A;  1SL1 A;  3PSP A;  2FE9 A;  4K4G A;  4DSF A;  4ECY A;  3H0L B;  2W9B A;  5CEH A;  1ZJM A;  2WF6 A;  3ZI4 A;  5F3X B;  3C5G A;  3FYH A;  4AYB C;  1UA0 A;  2YB1 A;  5AIA A;  4TUS A;  2XI9 A;  7ICN A;  4M9H A;  7ICP A;  2E8O A;  2KN7 A;  4A8E A;  4R8U A;  1JAL A;  2W9M A;  5KG1 A;  4UAR A;  3G6V A;  1AQ6 A;  2K8B B;  4DSK A;  1YZ6 A;  3H8S A;  2Y1J A;  3GFK B;  3AU6 A;  2I5H A;  2DKZ A;  3QNM A;  5J0P A;  3IDW A;  3KD3 A;  4BWM A;  2YQE A;  5AKL A;  5JRT A;  2Y9T A;  4EZ6 A;  8ICF A;  2W3R A;  3OJS A;  1X9W A;  1HIW A;  3L5K A;  5T14 A;  2BCQ A;  4DLE A;  3EUB 2;  3V6H A;  4NM2 A;  4CF3 A;  3KBB A;  1HUZ A;  4M6W B;  2G07 A;  5IIK A;  4JWN A;  2ZG6 A;  3ONN A;  2UVR A;  1SXE A;  4EEL A;  2G0A A;  4EYI B;  2FLN A;  4F5Q A;  4RQ6 A;  2JR5 A;  1L8O A;  1SL2 A;  4ZOH C;  4RU9 A;  2KJ9 A;  2FMS A;  4EYH B;  1L3V A;  3AUO A;  1RDF A;  3ZDE A;  3UMG A;  5DDY A;  4RT2 A;  2UVV A;  2XCP A;  9ICQ A;  1L6N A;  4Z6C A;  2YY6 A;  4HYK A;  3TI0 A;  1CUK A;  4CF4 A;  1RQN A;  1SKS A;  4P0Q B;  4C4S A;  3LYS A;  5AHX A;  2EDU A;  5KG5 A;  3M1Y A;  4C8O A;  5AI9 A;  4YD2 A;  5ALO A;  5ALD A;  1U47 A;  1RM6 C;  1XO1 A;  4NJ8 A;  4DSJ A;  5J0Q A;  3AMZ A;  2OXO A;  3H4B A;  2DQN B;  3D2N A;  3J81 j;  3F53 A;  8ICP A;  1J2M A;  2E5S A;  1D9F A;  4O5C A;  1RZT A;  2HDO A;  3OGU A;  3MDC A;  1ZQR A;  5KT3 A;  4MFA A;  1IM4 A;  4IR9 A;  3SV4 A;  4KLD A;  1RQL A;  1UQV A;  4Z6E A;  3OPX A;  4MF8 A;  3RR7 A;  3JPS A;  3FC4 A;  5J2E A;  3GZF A;  4UB6 U;  4IRC A;  2KJ5 A;  4CE6 A;  4ED0 A;  4UB5 A;  3HW8 A;  3AU2 A;  3Q8P B;  3SMV A;  8ICL A;  1KDH A;  4QWB A;  2PFN A;  2A19 A;  2ZIX B;  2P66 A;  3JPN A;  1UHU A;  2HBM A;  4QWD A;  4KTQ A;  2RDI A;  3SAF A;  4QW9 A;  5H2F U;  3QEB Z;  2F76 X;  2XY5 A;  2C2R A;  1LKY B;  5J2B A;  1F44 A;  1VJ5 A;  3RJF A;  5ALP A;  8ICW A;  4QWC A;  5HNK A;  4B9M A;  3TFR A;  2WAQ F;  4LZG A;  3BQ7 A;  3BZK A;  5KFN A;  4US9 A;  1QSL A;  3R9K A;  4P4P A;  5J0R A;  3HRD D;  8ICK A;  1L8L A;  9ICM A;  3GIJ A;  2FLL A;  5B66 U;  1URJ A;  4ECU A;  3UMC A;  2P6R A;  4J9L A;  4DLG A;  1ZRM A;  2KMD A;  4C8K A;  3NRZ A;  4ED3 A;  3ISD A;  4B9N A;  4QZ9 A;  3LK9 A;  2KFZ A;  3TAQ A;  4XQ8 A;  3PX4 A;  1A76 A;  4NM1 A;  5TZV A;  3C2M A;  2ALZ A;  3A0B U;  2Y0S C;  1PZN A;  7ICE A;  2VIX A;  4YCX A;  1QQ5 A;  2ZTC A;  3RFA A;  2BQU A;  4KN4 A;  3LWM A;  1BNO A;  4PZN A;  1ZQZ A;  5AI8 A;  2BCV A;  4QZE A;  4NLK A;  2W8L A;  3NVV A;  4EBD A;  2XC9 A;  5J0T A;  1QSS A;  8ICT A;  4RPY A;  3PW4 A;  3WK9 A;  2MUT A;  4IRK A;  2V4R A;  1MQ2 A;  4QJF B;  1ZD3 A;  1JMS A;  3Q8M A;  8ICY A;  9ICW A;  3ICX A;  7ICK A;  1ZRN A;  1LB2 B;  3N7S C;  3ISB A;  1SZH A;  2JH1 A;  5DQG A;  1ZQF A;  1OXJ A;  5ALJ A;  3MDA A;  2BCS A;  2F8K A;  4RPZ A;  5ALT A;  1UT5 A;  2HOI A;  3RH6 A;  2PFQ A;  4X5V A;  4PHA A;  3QZ7 A;  3RJI A;  4NLN A;  1IV8 A;  9ICF A;  5DBB A;  3GV8 B;  2E1E A;  2ASJ A;  2R18 A;  4JV1 A;  5EE9 A;  2ZTD A;  4YMO A;  3RF9 A;  3M6Z A;  1GO3 F;  3BJY A;  1PUZ A;  2WB1 F;  1PK1 A;  1ZQK A;  1JUD A;  5HMM A;  5ALZ A;  5CRX A;  4UAT A;  3HKZ F;  1A0P A;  3JPO A;  5CA7 A;  1Z4N A;  5ALG A;  4FBT A;  2F77 X;  1DGJ A;  3TAN A;  3IG5 A;  1DXS A;  4KLM A;  3RB6 A;  3IG8 A;  2KZZ A;  4I2D A;  2VA2 A;  5ALV A;  4QZC A;  2W04 A;  3ZDD A;  4DQI A;  7ICF A;  2ZUD A;  4F2R A;  2XGP A;  1QCK A;  5CP2 A;  2GOL A;  5AM5 A;  4YR3 A;  5G5H A;  4J03 A;  2F1I A;  4QWA A;  1ZQC A;  2PI4 A;  4YN4 A;  1F0M A;  3AM9 A;  4R63 A;  5J0O A;  2R8J A;  4Q8E A;  7ICT A;  2BDP A;  3NVW A;  4F91 B;  2JRZ A;  4EEY A;  2HHT A;  1JN3 A;  1XSL A;  5AKI A;  3V7J A;  4IQT A;  5IIN A;  4UB8 U;  3QX7 A;  5F9N A;  2PXI A;  1SV0 C;  4OJP A;  3ZDB A;  3HX0 A;  4F2S A;  1WYG A;  2QAR A;  2ZXI A;  2JZB A;  2V9W A;  1ZQT A;  3C23 A;  8ICN A;  2A1J B;  4J9N A;  4I2F A;  5J8Y A;  1KTQ A;  1S5L U;  1SIJ A;  1KFT A;  3OSN A;  3PSI A;  3HPO A;  4NL9 C;  2MAX A;  5DLF A;  5KFG A;  5KFB A;  4Q8F A;  4US8 A;  2BPF A;  4F4W A;  1NK5 A;  4C0Z A;  5DB6 A;  2EQY A;  2KOB A;  3U26 A;  5J2D A;  1WCL A;  4RNM A;  2ZIU B;  5EE3 A;  5DGB A;  4P0P B;  2LPE A;  2VAN A;  3VC8 A;  3UXO A;  5AM3 A;  4ECW A;  3QUC A;  1S76 D;  3M7D A;  2C2E A;  4F5N A;  3C1Y A;  2JH7 A;  4C4T A;  3BQT A;  1T3Q A;  3CRX A;  2XO7 A;  3QU9 A;  4RQ4 A;  2AU0 A;  3CW2 C;  1S8O A;  3K1R B;  3N7P D;  5KT2 A;  4DOB A;  3TAC B;  1BVS A;  1TK0 A;  5KFX A;  1T8E A;  9ICC A;  1P7D A;  5EE1 A;  4PL1 A;  3QZ8 A;  1L7O A;  2M0N A;  1NK6 A;  2A3V A;  4I2C A;  7ICL A;  4KLG A;  4RQN A;  4Y2X A;  2PKE A;  3H8W A;  5KAF U;  4I2A A;  3UM9 A;  1V9P A;  2A1J A;  2MU2 A;  2W9C A;  3V7L A;  2EZX A;  5D49 A;  4TUQ A;  1CRX A;  2DPJ A;  1ZQO A;  4FZM A;  3PW5 A;  1DK3 A;  2KKV A;  3LWL A;  4NWI A;  4DS4 A;  2KK0 A;  4O3P A;  4G9B A;  4DFM A;  4RQM A;  5KG3 A;  4ED8 A;  4KLL A;  3C2L A;  8ICI A;  2DGZ A;  2F3N A;  2Z7J A;  1L3T A;  4J9P A;  3PX0 A;  4LJX A;  1V85 A;  1ZD4 A;  4KX3 A;  4AYB F;  4R65 A;  7ICR A;  4F4Y A;  8ICU A;  4Z6D A;  9ICG A;  5TIS U;  5KFU A;  2YN4 A;  1XO0 A;  1N63 A;  3RTV A;  4PJ0 U;  1T3N A;  5DB7 A;  1Z19 A;  9ICR A;  1NK7 A;  4LVS A;  2K89 A;  1SB3 C;  2BQ3 A;  2G06 A;  3C1Z A;  2E3T A;  4K4I A;  2WFA A;  4YVZ A;  4J9K A;  4Y2V A;  4MEY A;  3GIK A;  2G08 A;  3SI8 A;  3BS5 A;  5KFZ A;  3PX6 A;  3RR8 A;  3WKD A;  4MFF A;  5JUM A;  3H4D A;  1ARO P;  4ECX A;  1S0V A;  1KQQ A;  1BPB A;  2CRX A;  1XSP A;  7ICH A;  7ICJ A;  1ZQG A;  3OTQ A;  2KIW A;  1N5W A;  1ZQU A;  1ZQB A;  2KJ8 A;  2QB0 A;  1L3S A;  5DLG A;  3RH4 A;  2VKQ A;  2CXY A;  4KIT B;  2PFO A;  5L1K A;  4DQQ A;  4DQS A;  3GV5 B;  1T94 A;  4O3M A;  2VA8 A;  1CEZ A;  2YMM A;  5JU5 A;  5AKX A;  1BPY A;  3BQ1 A;  3KKA C;  7ICS A;  4DS5 A;  4DFP A;  3THV A;  3T5H A;  4F4K A;  3MAB A;  1S9F A;  1EXN A;  2R8H A;  1J97 A;  1XSN A;  3UPQ A;  1S0N A;  3GQC A;  5ALU A;  5DBC A;  4DO9 A;  1WCN A;  2EZY A;  4GIB A;  3E58 A;  4QNL A;  3E0F A;  3FM9 A;  5CB1 A;  2XY6 A;  1TAM A;  8ICA A;  2LYH A;  2BCU A;  4ECZ A;  2PI5 A;  3LVV A;  1M6Y A;  3H40 A;  5ALL A;  1WG8 A;  1PVQ A;  4RQ8 A;  5KFH A;  2L5Y A;  2JHD A;  1X40 A;  2OH2 A;  4RQ0 A;  5EWG A;  1ZJN A;  1DRG A;  5ALH A;  3M9M B;  3EWA A;  2HHV A;  4ACO A;  2FMP A;  9ICP A;  2LHT A;  1X42 A;  4IS7 A;  2KG5 A;  4F72 A;  2F8L A;  3O0F A;  1NJY A;  4EX7 A;  3OHB A;  2F2A B;  2Q4T A;  2KZM A;  1Z1V A;  4DF8 A;  2NV3 A;  4O5E A;  1XS9 D;  2HW3 A;  3B9J A;  2H3Q A;  4GC6 A;  4C7Z A;  4DOC A;  3AL0 B;  1D8L A;  2ASL A;  2W7P A;  3MGV A;  4M47 A;  4UAS A;  2I9G A;  3A0H U;  3TAP A;  4UAZ A;  2D8C A;  4DCC A;  1SWW A;  1JRP A;  4NV0 A;  2R8I A;  4QZI A;  1Z3E B;  4RPX A;  4KMO B;  2DUY A;  3MC1 A;  2VJ4 A;  4YR2 A;  1IIP A;  1NKE A;  2BGW A;  4IRD A;  2KZ3 A;  5J2H A;  9ICK A;  3SEI A;  2YMP A;  4F8R A;  4CCH A;  3QEA Z;  2FDR A;  4M6W A;  2F1H A;  3GIL A;  5J2G A;  5EWE A;  4G3I A;  2Y9U A;  1K1Q A;  3JPR A;  4R66 A;  3MGI A;  1SV4 A;  5G5G A;  1WWU A;  3MR3 A;  3UQ0 A;  2B21 A;  4JV0 A;  2G5I B;  1MA7 A;  2PFP A;  2ZIW B;  3PO4 A;  1L5U A;  2DF4 B;  1Q46 A;  5C5J A;  2BHN A;  3QXG A;  4F92 B;  3F2C A;  2H5X A;  1TK5 A;  5J2A A;  1HUO A;  2IMW P;  2ZJ8 A;  5J2K A;  3UXP A;  1NK0 A;  4O3S A;  2E1F A;  1X2I A;  1SKR A;  1DK2 A;  2W11 A;  3UQ2 A;  4Z6F A;  3HWT A;  5AI4 A;  3T5K A;  4P0Q A;  5KFE A;  1RXW A;  1ZQJ A;  4PGQ A;  4KLH A;  4C8M A;  4J9M A;  2Y0S F;  3F5A A;  3B0Y A;  4M2Y A;  4KLT A;  1A6S A;  1NI3 A;  3BDP A;  5J0S A;  5HML A;  4XA5 A;  8ICX A;  4YD1 A;  4RQ3 A;  4Y2U A;  3RBD A;  2YB4 A;  4I29 A;  2W3S A;  3N7R C;  2J6S A;  4NLZ A;  5AKH A;  4DFJ A;  3PR5 B;  5HHI A;  4P4O A;  4Y2Q A;  4RQ7 A;  1YT3 A;  4NY8 A;  3RB3 A;  2H3I A;  1TAQ A;  3AN1 A;  5CJ7 A;  1UA1 A;  2XY7 A;  4KX5 A;  4EBE A;  3C2K A;  3PVX A;  4ED1 A;  3IM1 A;  3ORY A;  4DSL A;  1F5S A;  3CYM A;  5ALI A;  4IQU A;  3KFU F;  5AKY A;  3WKE A;  4O3R A;  4ELV A;  5KFF A;  3RJG A;  1C20 A;  4M9J A;  8ICV A;  2AXT U;  1Q3V A;  2ATL A;  2NRZ A;  2FPM A;  5KT6 A;  2ZIX A;  2XVT A;  5AIC A;  1TK8 A;  5ALW A;  8ICJ A;  4Y2P A;  1V97 A;  5KFS A;  3MR6 A;  1WUD A;  2IHN A;  1LKY A;  3M8S A;  4GFJ A;  4J9Q A;  4BJQ A;  4YMM A;  4ECS A;  2ES6 A;  5L9X A;  1ZQA A;  3WK5 A;  1S0O A;  9ICL A;  2B0C A;  4TQR A;  4Q45 A;  5AM1 A;  2WF5 A;  4YXM A;  4M9G A;  2WAQ C;  2HOF A;  3K4G A;  1ZET A;  4CNQ A;  2XIC A;  2MRL A;  1B43 A;  3MFI A;  2JEJ A;  5CWR A;  4UAY A;  5HHH A;  5KFD A;  4IC9 A;  2C28 A;  3SD7 A;  3C28 A;  3RJJ A;  3PR4 A;  4FZN A;  2H3V A;  4QZD A;  4UQG A;  1SXD A;  4WJ3 B;  5KTQ A;  4TUP A;  4XRH A;  2HHW A;  4FBU A;  1UCV A;  1ZQQ A;  1KRP A;  4DSE A;  2VA3 A;  3SEN A;  1ZQL A;  4B9T A;  3EPI A;  8ICR A;  1SV0 A;  7ICG A;  3I76 A;  4UAV A;  3Q8L A;  4ED2 A;  5KFQ A;  1JX4 A;  4PH5 A;  5KAI U;  2EH9 A;  4B9L A;  8ICH A;  4P2H A;  3TFS A;  5KT5 A;  4DL4 A;  4ED6 A;  2I1Q A;  1ZXI A;  2E8M A;  2NRX A;  3Q8K A;  1KN5 A;  5ALE A;  2QB1 A;  4ZH4 A;  3KTQ A;  4NL9 A;  1KSP A;  2EAM A;  4RQ2 A;  3L3F X;  1NKB A;  4RUA A;  4KLI A;  4FFD A;  2FJ6 A;  4I2H A;  3B0X A;  3QU4 A;  5III A;  3C5F A;  3OJU A;  3MFH A;  1RYU A;  2RQ5 A;  2KFN A;  1Q3U A;  3Q8S B;  1ZQ1 C;  3QYP A;  4B9V A;  3TQ1 A;  3G6Y A;  5HR7 A;  3F5E A;  4JB3 A;  2EAP A;  4JUZ A;  3IN5 A;  3GDX A;  1PVP A;  3HJE A;  9ICV A;  4QW8 A;  3S6J A;  1BPD A;  3V72 A;  5ALY A;  2PMZ C;  4NLC A;  1QTM A;  4I27 A;  2W9A A;  4UB3 A;  8ICS A;  2KSO B;  1COK A;  3V6K A;  4DOA A;  4OJ5 A;  1U45 A;  2KP7 A;  2MA1 A;  4UBC A;  4F50 A;  1KL9 A;  5DB8 A;  4KN7 A;  5KFL A;  2BCR A;  3WU2 U;  5CHG A;  2NRW A;  5L1L A;  2P6U A;  4BWJ A;  4QIW C;  2P35 A;  5BPC A;  1U48 A;  4YG2 A;  5J2I A;  1X6J A;  4MF2 A;  7ICM A;  2E8N A;  1D9D A;  4O3Q A;  4DSI A;  2O6K A;  1NZP A;  2RHF A;  5KG4 A;  2BKE A;  4F5O A;  2ZJA A;  2M9N A;  4O0I A;  3LDA A;  3BS7 A;  2HI0 A;  2KIV A;  2ZIV B;  2IOH A;  3UXN A;  2K4I A;  3G6X A;  4BUG A;  1MN8 A;  1UT8 A;  2ASD A;  4DEZ A;  2FI1 A;  4QZB A;  2AQ0 A;  8ICM A;  4GXJ A;  4TQS A;  1RXV A;  5D4B A;  3OSP A;  5KG2 A;  3NGD A;  2K8A A;  1NOM A;  1X9X A;  2KD1 A;  1QH9 A;  5J2J A;  1NNL A;  5EE0 A;  1NK4 A;  1JRO A;  3PW0 A;  1ZQD A;  4M0A A; 
#chains in the Genus database with same CATH homology
 5JU5 A;  1SV0 C;  1SXE A;  1SV4 A;  1WWU A;  3KKA C;  3HIL A;  2QAR A;  4RQM A;  2B6G A;  1OXJ A;  2QAR B;  2JV3 A;  2ESE A;  2F8K A;  1LKY A;  1LKY B;  2EAP A;  2ES6 A;  1JI7 A;  2F3N A;  5J8Y A;  1X66 A;  2LMR A;  1V85 A;  4NL9 C;  2E8P A;  1OW5 A;  2KSO A;  3TAD C;  3BQ7 A;  2KSO B;  1COK A;  2L5Y A;  2FE9 A;  1V38 A;  1PK1 A;  1X40 A;  5JTI A;  1PK1 B;  4PZO A;  2YTU A;  2GLE A;  2LPE A;  4IS7 A;  2KG5 A;  1SXD A;  5F3X B;  2KMD A;  2EAO A;  1DXS A;  2KE7 A;  1Z1V A;  1UCV A;  2E8N A;  4MHV A;  5L1M A;  1SGG A;  3SEN A;  3K1R B;  2E8O A;  4NJ8 A;  5J8Y C;  3TAC B;  3BS5 A;  2DKX A;  1SV0 A;  3TAD A;  2QKQ A;  2D3D A;  3BS7 A;  3BS5 B;  2KIV A;  3KKA A;  2K4P A;  2DL0 A;  1B0X A;  2D8C A;  2F44 A;  1PK3 A;  1F0M A;  4RQN A;  2EAN A;  2DKZ A;  4PZN A;  2E8M A;  3IDW A;  3H8M A;  5JRT A;  2Y9T A;  2QB1 A;  3SEI A;  1UQV A;  2QB0 A;  5KNI A;  2QB0 B;  4NL9 A;  2EAM A;  1X9X A;  1WWV A;  1B4F A;  1RG6 A;  1KW4 A;  2Y9U A;  2K60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...