2E8OA

Solution structure of the n-terminal sam-domain of the sam domain and hd domain containing protein 1 (dendritic cell-derived ifng-induced protein) (dcip) (monocyte protein 5) (mop-5)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
GSSGSSGSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM domain and HD domain-containing protein 1
publication title Solution structure of the N-terminal SAM-domain of the SAM domain and HD domain containing protein 1 (Dendritic cell-derived IFNG-induced protein) (DCIP) (Monocyte protein 5) (MOP-5)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8oA01
2KIVA 1DXSA 1F0MA 4NL9C 2D3DA 1UQVA 2GLEA 2K4PA 2Y9UA 1UCVA 2QARB 3BS7A 3BQ7A 2ESEA 1V85A 3HILA 1SV4A 5F3XB 1PK1B 2QB0B 2E8PA 2E8NA 2KSOA 5JTIA 5J8YA 2KMDA 2K60A 4RQMA 2F8KA 2B6GA 2L5YA 3BS5B 1WWVA 1LKYB 2LPEA 3TADC 1OW5A 4NL9A 1X40A 3IDWA 2QARA 2JV3A 3H8MA 1SXDA 2EAOA 2ES6A 4PZOA 1PK1A 2E8OA 2QB0A 1SGGA 3K1RB 2DKXA 1X9XA 5JU5A 2KG5A 3SEIA 1B0XA 3BS5A 3TACB 1LKYA 1RG6A 2Y9TA 2DL0A 2EAMA 1SV0C 3KKAC 2EAPA 3TADA 5L1MA 1COKA 1JI7A 5KNIA 2EANA 2F44A 2LMRA 2QKQA 1SXEA 2F3NA 1X66A 2FE9A 4IS7A 4NJ8A 1PK3A 1V38A 2D8CA 2QB1A 1KW4A 1OXJA 2DKZA 1Z1VA 4MHVA 5JRTA 4RQNA 1B4FA 2E8MA 2KSOB 2KE7A 1SV0A 3KKAA 1WWUA 5J8YC 2YTUA 3SENA 4PZNA
chains in the Genus database with same CATH superfamily
5J2HA 3C2LA 1RXWA 3KHHA 5AM5A 2D3DA 2K4PA 7ICEA 2WF5A 5KFBA 2DPJA 5EE1A 1ECWA 7ICOA 3WKDA 1V97A 2YN4A 2P66A 4M6WB 5ALWA 1JROA 1K5OA 2IMWP 3AQFA 4Q44A 5J2CA 5J0XA 8ICSA 3AU2A 3B0YA 2JEJA 4UB1A 4UARA 4NL9A 4KTQA 4RPXA 4EBEA 3IHQB 5AK5A 3PX0A 2PFQA 2KD1A 2ZIWA 3LDAA 1L8OA 4YVZA 3WK7A 4J9KA 3T79A 3AM9A 2O6KA 3KHRA 2HBJA 2PFPA 4JK1A 2DPIA 3F53A 1PZNA 2R8KA 3RB6A 4IC9A 2BZFA 2A1JA 3PW2A 5IIMA 3SV4A 9ICFA 5CP2A 1IG6A 1VDVA 5J2AA 2P6UA 2A19A 2XI9A 3RAQA 1HIWA 2H3FA 5KL8B 5DBBA 9ICUA 5KAFU 3FDSA 4F4WA 5HMLA 3FM9A 4NJ8A 5KFPA 1L7NA 2G08A 4ECSA 4M47A 2ZTDA 2IOFA 2DWQA 2WFAA 3CP8A 1B4FA 8ICOA 5DDMA 2F1JA 7ICMA 1TAQA 2MUTB 4RT2A 2KICA 2ASLA 2F2AB 1WUDA 3GILA 5HR6A 5AM1A 3MDAA 3M6KA 4O5CA 1DXSA 5BOMA 1KRPA 4LZGA 5KFFA 4Y2YA 2GLEA 5KFTA 5AKKA 4KLSA 1PVRA 4G9BA 5IINA 3QNMA 2P6RA 4RNNA 1ZJMA 1RYSA 3HKZC 2V4RA 2KFZA 1T4GA 2NRXA 3FC4A 2F8KA 3QU2A 3RH5A 1L3SA 2ALZA 1SL1A 3WKBA 1L6NA 4O9MA 4P4OA 7ICKA 4GIBA 5DGBA 2ZJ5A 4EBCA 2BQUA 4U7CA 5ALJA 3ETRA 4GXKA 4ED8A 5ALTA 2OXOA 4R8UB 4OD0A 5JU5A 2HSZA 5E79U 3TKAA 3MR6A 4EENA 1ZETA 3KKAC 3G6YA 4YD2A 3PNCA 4CF4A 4G3IA 1CRXA 5DDYA 3KBBA 3NGDA 1HUZA 2XY5A 1A6SA 1JXLA 7ICUA 3RBDA 1URJA 5KFUA 3MGHA 4RPYA 1B43A 8ICJA 2ZIVB 5DB7A 5D49A 1IXRA 9ICLA 5HHHA 2KZMA 4J9NA 4ED1A 2Y1JA 3RJIA 5ALVA 1NI3A 5DQIA 1D8YA 3H4BA 3J81j 1ZQEA 4RPZA 1IIPA 4RUAA 4PGXA 3ISDA 3IP4B 2CXYA 3M7DA 1TAUA 4K4HA 4I2JA 2HHSA 1F0MA 3NRWA 3OSPA 3CRXA 2RDIA 4UAVA 4F91B 3GQCA 1YT3A 3Q8SB 1KFSA 5H2FU 2YB1A 2HI0A 5DKWA 1NK0A 4A8EA 3HILA 1K1SA 2AGQA 4JWNA 2E1EA 5ALMA 4CE6A 5KT5A 4UB2A 4NXZA 7ICJA 3M8SA 1KEJA 3KZIU 3C1ZA 4OJ6A 5KG5A 3LWMA 1SKWA 4JV0A 3GU3A 1SZHA 2L5YA 1WWVA 1S10A 4RU9A 2HBLA 5CWRA 2ZIVA 3ORYA 3ZDDA 1BPEA 2XO7A 4YG2A 2H3IA 8ICKA 3GIMA 4ECUA 4NLBA 4I2IA 3ONNA 2IHMA 3MGIA 4ECRA 1SL0A 3K1RB 4KN7A 5KFJA 1ZQFA 1BNPA 2ZG6A 3NTUA 1FO4A 1NKBA 4I2HA 4ACOA 9ICEA 4ICAA 4KLQA 3WKCA 4O3SA 4ECQA 2KFNA 1JI7A 3G6VA 4DF4A 3TAQA 1A0PA 5IILA 4RQ4A 2CN1A 2QKQA 1DK3A 9ICRA 3D2SA 1X66A 1ZRNA 4DSLA 2JRZA 3WK9A 2HMXA 3SD7A 2G0AA 5AI8A 1XSLA 1AROP 2R8HA 1OXJA 3UQ0A 1NK8A 8ICPA 2AGOA 3MGVA 1SB3C 4F5PA 3JPNA 4MFCA 4PHAA 1UPHA 4C80A 4C4TA 2JMGA 4YP3A 1UT5A 2PFOA 2K8BB 4QZFA 3SENA 2YY6A 2HBMA 4I2AA 2MA1A 4UAYA 4RQ0A 4QZCA 3OJUA 1N56A 5A0LA 4UB4A 1UCVA 8ICVA 3NRZA 2UVVA 4UB6U 3HKZF 5J0YA 4GXJA 4C0ZA 3GFKB 2BHNA 5KT6A 3JPSA 5ALGA 5TISU 4Q43A 1FFVA 1S0NA 3JPQA 4YR3A 2XICA 1JMSA 2LPEA 4Q8EA 3T3FA 2LYHA 4O5EA 3H0RB 1J97A 3SZ2A 1Z4NA 3QEAZ 4QZHA 5DB6A 2W7PA 3C29A 4FFDA 2MU2A 4IRKA 1M6YA 1ZD3A 4JMUA 4F3OA 1JN3A 4MFFA 3A0BU 1BPBA 1S9FA 1T94A 2FLLA 1XNSA 5J2FA 5CA7A 4XRHA 3V7JA 1RXVA 2HVHA 1TK5A 1XSNA 8ICWA 4F5QA 4RQ3A 1L3VA 1WCNA 1L3TA 1QQ7A 4DS5A 1S5LU 1IV8A 1ZQUA 2AGPA 1T8EA 4YD1A 1Q46A 2KKPA 5DGAA 4P0QB 4R66A 4Y2XA 1TFRA 4KLHA 3F5EA 3OHAA 2DBYA 1ZQYA 5D46A 2OYYA 7ICPA 4AP9A 5HHIA 2XIDA 5J8YC 1KL9A 2BGWA 4BWJA 2W9BA 4E0DA 3KD3A 1ED1A 4ED2A 2UVRA 4B9NA 3L3FX 4NM2A 2QARB 3BS7A 2LI6A 2BCSA 4B9SA 3BQTA 9ICNA 1DK2A 1KLNA 2WAQC 5J0RA 3NVWA 1XS9D 4CDGA 3G6XA 3HT3A 1PK1B 4F4KA 3SAGA 4OO1J 2MAXA 1J2NA 4EEYA 2CRXA 4KLTA 2K60A 5HNKA 3EYZA 4O0IA 2Y1IA 2JHDA 1A77A 4I28A 5AKZA 1NNLA 4C8LA 4OJPA 4QZ8A 4YCXA 4X5VA 3NASA 9ICKA 1GO3F 8ICAA 4P4MA 3N7SC 4UBCA 1ZQMA 3Q8MA 5J2BA 2YQEA 1U9LA 9ICHA 4QNLA 2WF6A 1X9XA 5KG7A 4I2BA 3CYMA 1NK9A 1H38A 3ZD9A 1TK8A 3TQ1A 3ED5A 3QU7A 1T7PA 4I2CA 4Z6DA 4YR0A 3BQ2A 4M04A 3RB4A 4I2EA 2JZBA 4DL3A 2BPFA 2ZXIA 3BZKA 1RPLA 1F5SA 2ZUCA 2AXTU 2R18A 4YN4A 1UHUA 1D9DA 7ICIA 3MC1A 3HX0A 3DEEA 4QZEA 5HR7A 2JGAA 8ICHA 4OCZA 3PX4A 1ZQRA 2W9AA 4JWMA 4TQSA 2KTQA 5ALRA 2BR0A 5F9NA 2IA6A 4PZNA 4ECTA 2Q4TA 2KIVA 2W8KA 5AIBA 1SZPA 4GFJA 2KVSA 5AI5A 3LVWA 2A1AA 2I5HA 5KFYA 4MEYA 2KJ9A 2FMQA 1LB2B 5J0UA 2ZIWB 1U4BA 4KX3A 1V85A 5F3XB 1EXNA 1BPZA 4QWCA 2KSOA 1ZQHA 1QQ5A 4M9HA 5ALKA 1NJYA 5ALZA 3I1YA 5KG4A 3M8RA 2F76X 3PSTA 5AIAA 5KG3A 3ZDAA 1Z1BA 4PH5A 3PZPA 1U47A 4UB5A 2ZJAA 2IOHA 5AKEA 3H8MA 1KKXA 9ICTA 3THVA 1A76A 3PW5A 8ICZA 3UM9A 4DSFA 1RQNA 2ES6A 5ALIA 2C28A 2MRLA 4C8OA 5AK6A 2FMPA 4IR1A 3RJFA 5KFOA 2FLPA 2VANA 3DV9A 1ZD2P 2D6FC 1JUDA 3B0XA 1LKYA 1NZPA 3TACB 1S97A 5KG6A 2HHQA 5FP0A 2QLTA 2Y0SC 4IL6U 5ALUA 1RQLA 3ISCA 1K1QA 2G09A 2H3QA 2C2EA 9ICXA 8ICUA 4FS2A 2E3TA 2PMZC 1ZQVA 9ICIA 2LYBA 2F77X 1QSLA 3OSNA 1SWWA 2V4QA 4UAZA 3KZXA 1N2XA 4EZ6A 2PI5A 4UAUA 1OUQA 1ZQLA 5J2KA 4RQ5A 4I27A 2G07A 5ALEA 2NYVA 2WAQF 5B66U 2WF7A 1D8LA 4IR9A 4Y2JA 5ALYA 4IQWA 2GWSA 2KHQA 4RZRA 5KFHA 2NRVA 2JEFA 3A0HU 4PPXA 1Q3UA 1BPDA 4DSIA 1NZBA 1JX4A 3SR6A 4I2GA 3ZDBA 1BGXT 3AUOA 3B9JA 4ECWA 1FEZA 1MQ3A 3QU9A 4F2RA 3K4GA 5J2GA 4M9GA 2XCPA 4R64A 3GV5B 2QB0A 8ICMA 4C8NA 9ICMA 4DFJA 5J0OA 3PY8A 4Y2TA 5B5EU 3NS1A 3H0MB 1SWVA 3R9KA 4FO6A 4KN4A 3FYHA 3QEBZ 5J0SA 4JV1A 1D8BA 1X9SA 1ZXIA 2YMLA 4Y2SA 5AKXA 2KVCA 3QUBA 2VA3A 1LV5A 5GTHU 1F44A 1YZ7A 2Z7JA 1X9MA 5KFDA 2KP7A 7ICVA 1C7YA 4B9VA 1MSWD 1VJ5A 2XC9A 4EYIB 4BJQA 5JRTA 2IHNA 4Z6CA 1CI4A 1UA1A 5J0TA 2XGQA 2OEHA 4F5OA 2EH9A 4F4XA 4KLUA 3N4MB 2ISOA 3KKAA 2HOIA 5DQGA 5CEHA 1Q3VA 4Q8FA 4QW9A 4DL7A 2UVUA 1ZOLA 2J6UA 3F2DA 3UPQA 3I28A 1ZJNA 4QWEA 1WCLA 4ELVA 2C2RA 4F50A 1XU4A 3QYPA 2WTFA 3C5GA 4PL2A 9ICOA 3D2NA 5AM0A 4DFDA 4F93B 4KLMA 1CUKA 3C21A 1L5UA 5ALXA 2H3ZA 4Y2RA 5CB1A 1JRPA 3N7RC 1SKSA 3K1ZA 3OTQA 4TUPA 3OJSA 4KMUA 1HJPA 5EE3A 3OHBA 4F92B 2XVTA 4DL5A 4RQ6A 1Q8KA 3T5KA 3PO5A 1NK5A 3ALRA 1X40A 3IDWA 1YZ6A 4TURA 2WF9A 1SXDA 4KLLA 5DG9A 1KDHA 4KITB 2EAOA 4PZOA 4J9QA 4RNMA 3PR4A 1SGGA 5KFWA 5F9LA 2G5HB 1X6JA 4KLIA 4B9TA 3AEVA 4AYBC 5KFGA 4MEXA 4QZIA 5KTQA 5L1MA 3RFAA 3TANA 1MQ2A 1T3NA 3UQ2A 4KLDA 4DFPA 2LMRA 1O08A 2XCAA 2PMZF 2OCEA 3RTVA 5KFQA 4CGZA 3BQ0A 3C2KA 3SAHA 4IS7A 7ICNA 5KFZA 9ICGA 4Y2QA 1V9PA 2FI1A 5KFSA 1X42A 4QWDA 3PSFA 3S6JA 3AQEA 1HUOA 1S0OA 2RP5A 4EX6A 5AI9A 2DGZA 4OJOA 4YXJA 4JB3A 4RUCA 5AM3A 3RAXA 1ZD5A 3MBYA 1TAMA 4YMMA 3AU6A 1DRGA 9ICSA 2FJ6A 1UQVA 2G5IB 3ISBA 3V7LA 5KT4A 4Z6EA 3H8SA 3RR7A 4DOCA 3M9NB 5AHXA 1P7DA 5EWEA 3GV7B 3ETLA 2E8NA 2VIXA 3CNHA 4CF3A 2FPMA 1QLNA 3N28A 3IV6A 3QZ8A 2BCUA 1N60A 3C28A 2EDUA 1PVPA 3L4PA 3TAPA 1Z19A 4GC6A 8ICLA 3E0FA 5ALFA 2KJ8A 5HP4A 2B0CA 2M9NA 5IIIA 3QUCA 2JV3A 2KN7A 3Q8PB 1JIHA 4TUSA 2ZJ8A 4C8KA 2EZXA 1Y88A 5KFKA 3PX6A 5KAIU 1ZQNA 2KG5A 8ICQA 1BNOA 5L1JA 3LYSA 1KQQA 8ICRA 2EAMA 1SV0C 2ASJA 1TVAA 3WKAA 2ATLA 5AK4A 5EWGA 2W9BB 3RF9A 3OGUA 3UMGA 1RYRA 2F3NA 3M9MB 4QIWC 3MFHA 4QJFB 5AKHA 4US8A 1BPYA 2ODGA 3RJGA 4F4ZA 1KW4A 4QWBA 3RB3A 2ZIUA 5KFLA 5KFMA 4BGDA 2EQYA 3EPGA 4U6PA 4JV2A 1WWUA 1ZQWA 4YR2A 1Z3EB 1MN8A 2ASDA 2BCRA 1N5XA 3GV8B 4IRCA 4DL2A 5KFEA 4J9PA 3PR5B 3GIKA 2VA8A 1KFDA 2RDJA 3PO4A 4UB3A 1SIJA 3M9OB 3BQ7A 5J2IA 3MR5A 4PGYA 5J0PA 3HP6A 2IOFK 4DEZA 4EYHB 3U26A 2LKYA 4ED6A 1NKEA 3HRDD 4I2DA 1RDFA 9ICCA 5EE9A 3SI8A 5J8YA 5L9XA 4F5NA 2NO4A 2NV3A 3NVYA 3AN1A 3MR3A 1NKCA 3SV3A 3TADC 1ZQCA 4FZNA 4FZLA 2JZBB 7ICHA 4YMOA 5KG0A 4TUQA 3ZDEA 8ICBA 5CHGA 4DQPA 3F5AA 5AKLA 4QZDA 1LVHA 5TZVA 2W9CA 4M9NA 3D6JA 3RJEA 2DUYA 3IN5A 2E8OA 7ICGA 5IIOA 4XQ8A 4ZOHC 4AYBF 3V7KA 5AICA 1ZQQA 2K4HA 3SEIA 4O3MA 2KNJA 2Y9TA 8ICCA 2PXIA 1XO1A 4DQQA 4DL4A 1KN5A 1COKA 3C1YA 2JEIA 2EANA 3WK4A 4B9MA 2R8GA 2LYAA 4LVSA 3T5LA 3T5JA 4LJXA 2R8IA 3V6HA 2JEGA 5EE0A 3WK6A 4BXOA 1KSPA 2YMMA 2HHTA 2KSOB 4O3RA 2DFLA 5K4LA 2YTUA 1NK4A 8ICTA 3IG8A 5J0WA 8ICEA 3QX7A 2ZUBA 8ICIA 2N1RA 1SL2A 3VC8A 4DS4A 4IQTA 1CEZA 2WB1C 1N5WA 5BOLA 5DB8A 3RBEA 4O3OA 4CRXA 2E1FA 5ALQA 2GO7A 2I6XA 3RH6A 1L7MA 4BX9C 2VKQA 2IBKA 5EWFA 3PMLA 5G5GA 4ED0A 4J9OA 2BDUA 2OHFA 1ZD4A 2KMDA 4RQMA 5ALSA 5DQHA 4P0PA 9ICJA 5AI4A 1ZQGA 1LKYB 4R63A 4UBBA 1NOMA 2RQ5A 1OW5A 2A3VA 3NUQA 3QE9Y 3KOOA 3SYZA 2NRWA 5AKJA 4IRDA 3PSIA 2AHOB 2H5XA 3JPRA 2W43A 1ZQPA 1QSSA 4PHDA 4C4SA 2DKXA 3C2MA 3RR8A 4YXMA 2YB4A 7ICSA 3BS5A 3H4DA 3JPTA 1ZQXA 2K4IA 3GIIA 3N7PD 3QUQA 4EBDA 4EX7A 4QIWF 2F44A 1SXEA 8ICFA 2AJQA 9ICQA 1C20A 3TI0A 4UASA 1RM6C 2D8CA 1X9WA 5KG1A 3T5HA 2JR5A 4FS1A 5AM2A 1SKRA 3H7IA 3PVXA 1ZQZA 4CNQA 5KT3A 1S0VA 2E8MA 2W9MA 4TQRA 3TFSA 2LHTA 4DWIA 4PL1A 9ICPA 2I1QA 4MFAA 4NL9C 5HMMA 2KK0A 3AL0B 4P4PA 4IQVA 2ESEA 4NLCA 2PKEA 2F1HA 4M9LA 4F8RA 2QB0B 1FFUA 1NK7A 1KBUA 3LK9A 3WK8A 3WU2U 4UW9A 3LVVA 4XA5A 1U45A 1TK0A 1WYGA 2RHFA 1NJZA 1D9FA 9ICBA 4ECXA 1TV9A 4QW8A 3WK5A 2OM6A 4YQWA 4ED3A 1RYUA 4B6JA 4M6WA 2MSNA 4QZ9A 4FZMA 1TE2A 4F4YA 1XC9A 1S76D 7ICFA 2W04A 2WF8A 2HBKA 2HOFA 5T14A 2LM4A 2K8CB 2VJ4A 4F71A 4PHEA 2CPRA 2AQ4A 2LBOA 2KKVA 2KZZA 3MFIA 5KT7A 4B9UA 4DLGA 5AI0A 2QB1A 4P2HA 4RQ1A 1Z00B 2C22A 2EZZA 4HYKA 4RQ7A 3RJHA 5CR0A 1U49A 5KFIA 5ALLA 2K8AA 2HHVA 4FBTA 1ZQBA 4PHPA 4KLFA 2ZTCA 3UXNA 2B21A 3HWTA 2RRDA 2NRTA 2WB1F 3E58A 5AK3A 1UT8A 4UQGA 5AKGA 2R8JA 1ZRMA 8ICGA 4LZDA 5GTIU 2ISPA 3KTQA 5CJ7A 3OPXA 8ICNA 1COOA 5DBCA 1L7PA 4O5KA 4NLGA 3CW2C 4NM1A 2VJ5A 2MUTA 4HAIA 4OJLA 1BPXA 3MR2A 2HVIA 3VCBA 1Z00A 1T3QA 4ED7A 2HOQA 4US9A 3BDPA 4ZH4A 4I29A 5G5HA 5J2JA 5DLFA 1ZQKA 3Q8KA 2HCFA 4J9LA 5KL1B 1DGSA 4DF8A 3PV8A 1RG6A 2DL0A 2BCVA 2EAPA 3M6ZA 3SQIA 4F72A 1WG8A 1ZQJA 2BPGA 1UA0A 4YFKA 4ECZA 4BWMA 1PK3A 2GH1A 3BQ1A 4GLXA 2J6TA 4Z6FA 2NO5A 4PJ0U 2OH2A 2Y0SF 4R8UA 5KFNA 2JXJA 3ZI4A 5KFCA 3RRHA 4RQNA 4EZ9A 2XY6A 7ICLA 2AU0A 4QZBA 4M2YA 2W11A 4UB8U 1PVQA 3NVZA 3PW4A 4KX5A 5AKIA 7ICTA 3QU4A 3SMVA 5ALOA 1ZQOA 9ICWA 3H0LB 4Y2UA 3KHLA 2HHUA 2KHVA 3IRUA 3K75D 2EZYA 2W55A 1SV4A 2J6SA 3ZDCA 4DSKA 4C7ZA 3EUB2 4XUSA 4NWIA 3RJJA 1PUZA 2Q0ZX 4RT3A 4K4GA 9ICVA 3GDXA 3QZ7A 4UATA 4PGQA 5ALNA 4Y2PA 2HHWA 4DOBA 1QQ6A 2YMQA 1N48A 2JH7A 5J29A 2M0NA 4MF8A 5CRXA 5DBAA 2FDRA 2K89A 1L3UA 4WJ3B 3IM1A 2KJ5A 2WHEA 2ZIUB 3D2QA 1B0XA 1ZQDA 4ELTA 1NJXA 2KOBA 1U48A 4QZAA 3H40A 4M9JA 2YMPA 3V72A 4ECVA 4R65A 1QCKA 2W54A 4CCHA 3JPPA 4UAWA 2BDPA 2BPCA 4NY8A 1J2MA 4J9SA 4MHVA 4GXIA 3EPIA 4FBUA 4DO9A 4K4IA 3Q8LA 2F8LA 3RH4A 1SV0A 3BZCA 4NLNA 1KTQA 3BJYA 2KV2A 4DQSA 5KFAA 3EZ5A 3M1YA 4C7YA 4M0AA 2I9GA 1N63A 4DOAA 1X2IA 4CF5A 3SAFA 2Y9UA 1ZYQA 3V6JA 3TARA 2W9CB 1NK6A 3IG5A 1ZQSA 3C5FA 4KLEA 3H8WA 5AI6A 5DG8A 2V9WA 1JXEA 4NLKA 8ICYA 4KMOB 3PW7A 1XO0A 2C2DA 3KHGA 3PSPA 5JTIA 4QZGA 4QWAA 2B6GA 3AMZA 5BPCA 5ALDA 5IIJA 2KIWA 2BCQA 1ZQ1C 2RLTA 3ZD8A 5J2DA 5JUMA 2XY7A 2ZXHA 4GC7A 4DL6A 1X6IA 5C0YA 4F2SA 1L7OA 1ZQIA 2ZUDA 4RQ8A 4I2FA 5J0QA 3NVVA 2GOLA 4DQRA 3O0FA 5C5JA 4BXOB 3UMCA 1AQ6A 2DQNB 2ZTEA 3MDCA 2KZ3A 5KG2A 1S8OA 3TADA 1XSPA 5DLGA 2LM1A 4BUGA 1S0MA 3KFUF 2E5SA 5KFRA 2FPKA 2G06A 2FLNA 1ZQAA 1DGJA 1N61A 3Q8QB 2OWOA 2JH1A 4JUZA 1Z1VA 1B22A 4O3QA 2H3VA 4ELUA 3MABA 3GIJA 3TFRA 1O03A 1XWLA 3UXPA 2HDOA 2KE7A 4FE3A 5L1IA 4P0PB 4DFKA 1ZQTA 4ECYA 4DFMA 1JALA 4YMNA 1TKDA 3Q8RB 2W7OA 1KFTA 4B9LA 4F5RA 2KEYA 5KFXA 3QUTA 4O3PA 3WKEA 4RQ2A 4KLGA 4P0QA 5L1LA 4DSEA 4DQIA 2E8PA 4EELA 2UVWA 2W03A 7ICQA 8ICXA 3H8JA 4O3NA 4RNOA 3I76A 2DF4B 3EW9A 3DDHA 3UXOA 5L1KA 1HEKA 3BS5B 5KT2A 3QU5A 5J2EA 5EOZA 2NRZA 1DOQA 3E2EA 4DLEA 3F2BA 4NLZA 4C8MA 3F2CA 1QSYA 1N62A 9ICAA 4C4RA 2BKEA 2HW3A 2QARA 3HW8A 2PFNA 2W3SA 4J9RA 4OJ5A 2ZIXB 1IM4A 4DCCA 3HPOA 2YX8A 1PK1A 4KLJA 5IIKA 4EEKA 2XGPA 3JPOA 2AH5A 3RB0A 2HHXA 1NJWA 1MA7A 2VA2A 2PI4A 3C23A 3PMNA 4J9MA 1VLBA 5DG7A 3N97B 3UMBA 1Z4OA 2AQ0A 4USAA 4Y2VA 5D4BA 2BQ3A 4J03A 5ALPA 4KLOA 2FMSA 4BDPA 4MF2A 5KNIA 1QTMA 2FPLA 3QXGA 2W8LA 2BQRA 5ALHA 3EWAA 2FE9A 2P35A 1BVSA 5AM4A 3RJKA 3HJEA 1QH9A 1RZTA 4NV0A 2W3RA 3GZFA 1L8LA 1V38A 4IQUA 5KFVA 3L5KA 3V6KA 7ICRA 2DKZA 3FAHA 4Q45A 5DB9A 1MC8A 3RRGA 3ICXA 1FIQA 5AKYA 2K4EA 1S77D 4DSJA 2F1IA 2A1JB 3LWLA 3PW0A 2ZIXA
chains in the Genus database with same CATH topology
2KIVA 1DXSA 1F0MA 4NL9C 2D3DA 1UQVA 2GLEA 2K4PA 2Y9UA 1UCVA 2QARB 3BS7A 3BQ7A 2ESEA 1V85A 3HILA 1SV4A 5F3XB 1PK1B 2QB0B 2E8PA 2E8NA 2KSOA 5JTIA 5J8YA 2KMDA 2K60A 4RQMA 2F8KA 2B6GA 2L5YA 3BS5B 1WWVA 1LKYB 2LPEA 3TADC 1OW5A 4NL9A 1X40A 3IDWA 2QARA 2JV3A 3H8MA 1SXDA 2EAOA 2ES6A 4PZOA 1PK1A 2E8OA 2QB0A 1SGGA 3K1RB 2DKXA 1X9XA 5JU5A 2KG5A 3SEIA 1B0XA 3BS5A 3TACB 1LKYA 1RG6A 2Y9TA 2DL0A 2EAMA 1SV0C 3KKAC 2EAPA 3TADA 5L1MA 1COKA 1JI7A 5KNIA 2EANA 2F44A 2LMRA 2QKQA 1SXEA 2F3NA 1X66A 2FE9A 4IS7A 4NJ8A 1PK3A 1V38A 2D8CA 2QB1A 1KW4A 1OXJA 2DKZA 1Z1VA 4MHVA 5JRTA 4RQNA 1B4FA 2E8MA 2KSOB 2KE7A 1SV0A 3KKAA 1WWUA 5J8YC 2YTUA 3SENA 4PZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIV A;  1DXS A;  1F0M A;  4NL9 C;  2D3D A;  1UQV A;  2GLE A;  2K4P A;  2Y9U A;  1UCV A;  2QAR B;  3BS7 A;  3BQ7 A;  2ESE A;  1V85 A;  3HIL A;  1SV4 A;  5F3X B;  1PK1 B;  2QB0 B;  2E8P A;  2E8N A;  2KSO A;  5JTI A;  5J8Y A;  2KMD A;  2K60 A;  4RQM A;  2F8K A;  2B6G A;  2L5Y A;  3BS5 B;  1WWV A;  1LKY B;  2LPE A;  3TAD C;  1OW5 A;  4NL9 A;  1X40 A;  3IDW A;  2QAR A;  2JV3 A;  3H8M A;  1SXD A;  2EAO A;  2ES6 A;  4PZO A;  1PK1 A;  2E8O A;  2QB0 A;  1SGG A;  3K1R B;  2DKX A;  1X9X A;  5JU5 A;  2KG5 A;  3SEI A;  1B0X A;  3BS5 A;  3TAC B;  1LKY A;  1RG6 A;  2Y9T A;  2DL0 A;  2EAM A;  1SV0 C;  3KKA C;  2EAP A;  3TAD A;  5L1M A;  1COK A;  1JI7 A;  5KNI A;  2EAN A;  2F44 A;  2LMR A;  2QKQ A;  1SXE A;  2F3N A;  1X66 A;  2FE9 A;  4IS7 A;  4NJ8 A;  1PK3 A;  1V38 A;  2D8C A;  2QB1 A;  1KW4 A;  1OXJ A;  2DKZ A;  1Z1V A;  4MHV A;  5JRT A;  4RQN A;  1B4F A;  2E8M A;  2KSO B;  2KE7 A;  1SV0 A;  3KKA A;  1WWU A;  5J8Y C;  2YTU A;  3SEN A;  4PZN A; 
#chains in the Genus database with same CATH topology
 5J2H A;  3C2L A;  1RXW A;  3KHH A;  5AM5 A;  2D3D A;  2K4P A;  7ICE A;  2WF5 A;  5KFB A;  2DPJ A;  5EE1 A;  1ECW A;  7ICO A;  3WKD A;  1V97 A;  2YN4 A;  2P66 A;  4M6W B;  5ALW A;  1JRO A;  1K5O A;  2IMW P;  3AQF A;  4Q44 A;  5J2C A;  5J0X A;  8ICS A;  3AU2 A;  3B0Y A;  2JEJ A;  4UB1 A;  4UAR A;  4NL9 A;  4KTQ A;  4RPX A;  4EBE A;  3IHQ B;  5AK5 A;  3PX0 A;  2PFQ A;  2KD1 A;  2ZIW A;  3LDA A;  1L8O A;  4YVZ A;  3WK7 A;  4J9K A;  3T79 A;  3AM9 A;  2O6K A;  3KHR A;  2HBJ A;  2PFP A;  4JK1 A;  2DPI A;  3F53 A;  1PZN A;  2R8K A;  3RB6 A;  4IC9 A;  2BZF A;  2A1J A;  3PW2 A;  5IIM A;  3SV4 A;  9ICF A;  5CP2 A;  1IG6 A;  1VDV A;  5J2A A;  2P6U A;  2A19 A;  2XI9 A;  3RAQ A;  1HIW A;  2H3F A;  5KL8 B;  5DBB A;  9ICU A;  5KAF U;  3FDS A;  4F4W A;  5HML A;  3FM9 A;  4NJ8 A;  5KFP A;  1L7N A;  2G08 A;  4ECS A;  4M47 A;  2ZTD A;  2IOF A;  2DWQ A;  2WFA A;  3CP8 A;  1B4F A;  8ICO A;  5DDM A;  2F1J A;  7ICM A;  1TAQ A;  2MUT B;  4RT2 A;  2KIC A;  2ASL A;  2F2A B;  1WUD A;  3GIL A;  5HR6 A;  5AM1 A;  3MDA A;  3M6K A;  4O5C A;  1DXS A;  5BOM A;  1KRP A;  4LZG A;  5KFF A;  4Y2Y A;  2GLE A;  5KFT A;  5AKK A;  4KLS A;  1PVR A;  4G9B A;  5IIN A;  3QNM A;  2P6R A;  4RNN A;  1ZJM A;  1RYS A;  3HKZ C;  2V4R A;  2KFZ A;  1T4G A;  2NRX A;  3FC4 A;  2F8K A;  3QU2 A;  3RH5 A;  1L3S A;  2ALZ A;  1SL1 A;  3WKB A;  1L6N A;  4O9M A;  4P4O A;  7ICK A;  4GIB A;  5DGB A;  2ZJ5 A;  4EBC A;  2BQU A;  4U7C A;  5ALJ A;  3ETR A;  4GXK A;  4ED8 A;  5ALT A;  2OXO A;  4R8U B;  4OD0 A;  5JU5 A;  2HSZ A;  5E79 U;  3TKA A;  3MR6 A;  4EEN A;  1ZET A;  3KKA C;  3G6Y A;  4YD2 A;  3PNC A;  4CF4 A;  4G3I A;  1CRX A;  5DDY A;  3KBB A;  3NGD A;  1HUZ A;  2XY5 A;  1A6S A;  1JXL A;  7ICU A;  3RBD A;  1URJ A;  5KFU A;  3MGH A;  4RPY A;  1B43 A;  8ICJ A;  2ZIV B;  5DB7 A;  5D49 A;  1IXR A;  9ICL A;  5HHH A;  2KZM A;  4J9N A;  4ED1 A;  2Y1J A;  3RJI A;  5ALV A;  1NI3 A;  5DQI A;  1D8Y A;  3H4B A;  3J81 j;  1ZQE A;  4RPZ A;  1IIP A;  4RUA A;  4PGX A;  3ISD A;  3IP4 B;  2CXY A;  3M7D A;  1TAU A;  4K4H A;  4I2J A;  2HHS A;  1F0M A;  3NRW A;  3OSP A;  3CRX A;  2RDI A;  4UAV A;  4F91 B;  3GQC A;  1YT3 A;  3Q8S B;  1KFS A;  5H2F U;  2YB1 A;  2HI0 A;  5DKW A;  1NK0 A;  4A8E A;  3HIL A;  1K1S A;  2AGQ A;  4JWN A;  2E1E A;  5ALM A;  4CE6 A;  5KT5 A;  4UB2 A;  4NXZ A;  7ICJ A;  3M8S A;  1KEJ A;  3KZI U;  3C1Z A;  4OJ6 A;  5KG5 A;  3LWM A;  1SKW A;  4JV0 A;  3GU3 A;  1SZH A;  2L5Y A;  1WWV A;  1S10 A;  4RU9 A;  2HBL A;  5CWR A;  2ZIV A;  3ORY A;  3ZDD A;  1BPE A;  2XO7 A;  4YG2 A;  2H3I A;  8ICK A;  3GIM A;  4ECU A;  4NLB A;  4I2I A;  3ONN A;  2IHM A;  3MGI A;  4ECR A;  1SL0 A;  3K1R B;  4KN7 A;  5KFJ A;  1ZQF A;  1BNP A;  2ZG6 A;  3NTU A;  1FO4 A;  1NKB A;  4I2H A;  4ACO A;  9ICE A;  4ICA A;  4KLQ A;  3WKC A;  4O3S A;  4ECQ A;  2KFN A;  1JI7 A;  3G6V A;  4DF4 A;  3TAQ A;  1A0P A;  5IIL A;  4RQ4 A;  2CN1 A;  2QKQ A;  1DK3 A;  9ICR A;  3D2S A;  1X66 A;  1ZRN A;  4DSL A;  2JRZ A;  3WK9 A;  2HMX A;  3SD7 A;  2G0A A;  5AI8 A;  1XSL A;  1ARO P;  2R8H A;  1OXJ A;  3UQ0 A;  1NK8 A;  8ICP A;  2AGO A;  3MGV A;  1SB3 C;  4F5P A;  3JPN A;  4MFC A;  4PHA A;  1UPH A;  4C80 A;  4C4T A;  2JMG A;  4YP3 A;  1UT5 A;  2PFO A;  2K8B B;  4QZF A;  3SEN A;  2YY6 A;  2HBM A;  4I2A A;  2MA1 A;  4UAY A;  4RQ0 A;  4QZC A;  3OJU A;  1N56 A;  5A0L A;  4UB4 A;  1UCV A;  8ICV A;  3NRZ A;  2UVV A;  4UB6 U;  3HKZ F;  5J0Y A;  4GXJ A;  4C0Z A;  3GFK B;  2BHN A;  5KT6 A;  3JPS A;  5ALG A;  5TIS U;  4Q43 A;  1FFV A;  1S0N A;  3JPQ A;  4YR3 A;  2XIC A;  1JMS A;  2LPE A;  4Q8E A;  3T3F A;  2LYH A;  4O5E A;  3H0R B;  1J97 A;  3SZ2 A;  1Z4N A;  3QEA Z;  4QZH A;  5DB6 A;  2W7P A;  3C29 A;  4FFD A;  2MU2 A;  4IRK A;  1M6Y A;  1ZD3 A;  4JMU A;  4F3O A;  1JN3 A;  4MFF A;  3A0B U;  1BPB A;  1S9F A;  1T94 A;  2FLL A;  1XNS A;  5J2F A;  5CA7 A;  4XRH A;  3V7J A;  1RXV A;  2HVH A;  1TK5 A;  1XSN A;  8ICW A;  4F5Q A;  4RQ3 A;  1L3V A;  1WCN A;  1L3T A;  1QQ7 A;  4DS5 A;  1S5L U;  1IV8 A;  1ZQU A;  2AGP A;  1T8E A;  4YD1 A;  1Q46 A;  2KKP A;  5DGA A;  4P0Q B;  4R66 A;  4Y2X A;  1TFR A;  4KLH A;  3F5E A;  3OHA A;  2DBY A;  1ZQY A;  5D46 A;  2OYY A;  7ICP A;  4AP9 A;  5HHI A;  2XID A;  5J8Y C;  1KL9 A;  2BGW A;  4BWJ A;  2W9B A;  4E0D A;  3KD3 A;  1ED1 A;  4ED2 A;  2UVR A;  4B9N A;  3L3F X;  4NM2 A;  2QAR B;  3BS7 A;  2LI6 A;  2BCS A;  4B9S A;  3BQT A;  9ICN A;  1DK2 A;  1KLN A;  2WAQ C;  5J0R A;  3NVW A;  1XS9 D;  4CDG A;  3G6X A;  3HT3 A;  1PK1 B;  4F4K A;  3SAG A;  4OO1 J;  2MAX A;  1J2N A;  4EEY A;  2CRX A;  4KLT A;  2K60 A;  5HNK A;  3EYZ A;  4O0I A;  2Y1I A;  2JHD A;  1A77 A;  4I28 A;  5AKZ A;  1NNL A;  4C8L A;  4OJP A;  4QZ8 A;  4YCX A;  4X5V A;  3NAS A;  9ICK A;  1GO3 F;  8ICA A;  4P4M A;  3N7S C;  4UBC A;  1ZQM A;  3Q8M A;  5J2B A;  2YQE A;  1U9L A;  9ICH A;  4QNL A;  2WF6 A;  1X9X A;  5KG7 A;  4I2B A;  3CYM A;  1NK9 A;  1H38 A;  3ZD9 A;  1TK8 A;  3TQ1 A;  3ED5 A;  3QU7 A;  1T7P A;  4I2C A;  4Z6D A;  4YR0 A;  3BQ2 A;  4M04 A;  3RB4 A;  4I2E A;  2JZB A;  4DL3 A;  2BPF A;  2ZXI A;  3BZK A;  1RPL A;  1F5S A;  2ZUC A;  2AXT U;  2R18 A;  4YN4 A;  1UHU A;  1D9D A;  7ICI A;  3MC1 A;  3HX0 A;  3DEE A;  4QZE A;  5HR7 A;  2JGA A;  8ICH A;  4OCZ A;  3PX4 A;  1ZQR A;  2W9A A;  4JWM A;  4TQS A;  2KTQ A;  5ALR A;  2BR0 A;  5F9N A;  2IA6 A;  4PZN A;  4ECT A;  2Q4T A;  2KIV A;  2W8K A;  5AIB A;  1SZP A;  4GFJ A;  2KVS A;  5AI5 A;  3LVW A;  2A1A A;  2I5H A;  5KFY A;  4MEY A;  2KJ9 A;  2FMQ A;  1LB2 B;  5J0U A;  2ZIW B;  1U4B A;  4KX3 A;  1V85 A;  5F3X B;  1EXN A;  1BPZ A;  4QWC A;  2KSO A;  1ZQH A;  1QQ5 A;  4M9H A;  5ALK A;  1NJY A;  5ALZ A;  3I1Y A;  5KG4 A;  3M8R A;  2F76 X;  3PST A;  5AIA A;  5KG3 A;  3ZDA A;  1Z1B A;  4PH5 A;  3PZP A;  1U47 A;  4UB5 A;  2ZJA A;  2IOH A;  5AKE A;  3H8M A;  1KKX A;  9ICT A;  3THV A;  1A76 A;  3PW5 A;  8ICZ A;  3UM9 A;  4DSF A;  1RQN A;  2ES6 A;  5ALI A;  2C28 A;  2MRL A;  4C8O A;  5AK6 A;  2FMP A;  4IR1 A;  3RJF A;  5KFO A;  2FLP A;  2VAN A;  3DV9 A;  1ZD2 P;  2D6F C;  1JUD A;  3B0X A;  1LKY A;  1NZP A;  3TAC B;  1S97 A;  5KG6 A;  2HHQ A;  5FP0 A;  2QLT A;  2Y0S C;  4IL6 U;  5ALU A;  1RQL A;  3ISC A;  1K1Q A;  2G09 A;  2H3Q A;  2C2E A;  9ICX A;  8ICU A;  4FS2 A;  2E3T A;  2PMZ C;  1ZQV A;  9ICI A;  2LYB A;  2F77 X;  1QSL A;  3OSN A;  1SWW A;  2V4Q A;  4UAZ A;  3KZX A;  1N2X A;  4EZ6 A;  2PI5 A;  4UAU A;  1OUQ A;  1ZQL A;  5J2K A;  4RQ5 A;  4I27 A;  2G07 A;  5ALE A;  2NYV A;  2WAQ F;  5B66 U;  2WF7 A;  1D8L A;  4IR9 A;  4Y2J A;  5ALY A;  4IQW A;  2GWS A;  2KHQ A;  4RZR A;  5KFH A;  2NRV A;  2JEF A;  3A0H U;  4PPX A;  1Q3U A;  1BPD A;  4DSI A;  1NZB A;  1JX4 A;  3SR6 A;  4I2G A;  3ZDB A;  1BGX T;  3AUO A;  3B9J A;  4ECW A;  1FEZ A;  1MQ3 A;  3QU9 A;  4F2R A;  3K4G A;  5J2G A;  4M9G A;  2XCP A;  4R64 A;  3GV5 B;  2QB0 A;  8ICM A;  4C8N A;  9ICM A;  4DFJ A;  5J0O A;  3PY8 A;  4Y2T A;  5B5E U;  3NS1 A;  3H0M B;  1SWV A;  3R9K A;  4FO6 A;  4KN4 A;  3FYH A;  3QEB Z;  5J0S A;  4JV1 A;  1D8B A;  1X9S A;  1ZXI A;  2YML A;  4Y2S A;  5AKX A;  2KVC A;  3QUB A;  2VA3 A;  1LV5 A;  5GTH U;  1F44 A;  1YZ7 A;  2Z7J A;  1X9M A;  5KFD A;  2KP7 A;  7ICV A;  1C7Y A;  4B9V A;  1MSW D;  1VJ5 A;  2XC9 A;  4EYI B;  4BJQ A;  5JRT A;  2IHN A;  4Z6C A;  1CI4 A;  1UA1 A;  5J0T A;  2XGQ A;  2OEH A;  4F5O A;  2EH9 A;  4F4X A;  4KLU A;  3N4M B;  2ISO A;  3KKA A;  2HOI A;  5DQG A;  5CEH A;  1Q3V A;  4Q8F A;  4QW9 A;  4DL7 A;  2UVU A;  1ZOL A;  2J6U A;  3F2D A;  3UPQ A;  3I28 A;  1ZJN A;  4QWE A;  1WCL A;  4ELV A;  2C2R A;  4F50 A;  1XU4 A;  3QYP A;  2WTF A;  3C5G A;  4PL2 A;  9ICO A;  3D2N A;  5AM0 A;  4DFD A;  4F93 B;  4KLM A;  1CUK A;  3C21 A;  1L5U A;  5ALX A;  2H3Z A;  4Y2R A;  5CB1 A;  1JRP A;  3N7R C;  1SKS A;  3K1Z A;  3OTQ A;  4TUP A;  3OJS A;  4KMU A;  1HJP A;  5EE3 A;  3OHB A;  4F92 B;  2XVT A;  4DL5 A;  4RQ6 A;  1Q8K A;  3T5K A;  3PO5 A;  1NK5 A;  3ALR A;  1X40 A;  3IDW A;  1YZ6 A;  4TUR A;  2WF9 A;  1SXD A;  4KLL A;  5DG9 A;  1KDH A;  4KIT B;  2EAO A;  4PZO A;  4J9Q A;  4RNM A;  3PR4 A;  1SGG A;  5KFW A;  5F9L A;  2G5H B;  1X6J A;  4KLI A;  4B9T A;  3AEV A;  4AYB C;  5KFG A;  4MEX A;  4QZI A;  5KTQ A;  5L1M A;  3RFA A;  3TAN A;  1MQ2 A;  1T3N A;  3UQ2 A;  4KLD A;  4DFP A;  2LMR A;  1O08 A;  2XCA A;  2PMZ F;  2OCE A;  3RTV A;  5KFQ A;  4CGZ A;  3BQ0 A;  3C2K A;  3SAH A;  4IS7 A;  7ICN A;  5KFZ A;  9ICG A;  4Y2Q A;  1V9P A;  2FI1 A;  5KFS A;  1X42 A;  4QWD A;  3PSF A;  3S6J A;  3AQE A;  1HUO A;  1S0O A;  2RP5 A;  4EX6 A;  5AI9 A;  2DGZ A;  4OJO A;  4YXJ A;  4JB3 A;  4RUC A;  5AM3 A;  3RAX A;  1ZD5 A;  3MBY A;  1TAM A;  4YMM A;  3AU6 A;  1DRG A;  9ICS A;  2FJ6 A;  1UQV A;  2G5I B;  3ISB A;  3V7L A;  5KT4 A;  4Z6E A;  3H8S A;  3RR7 A;  4DOC A;  3M9N B;  5AHX A;  1P7D A;  5EWE A;  3GV7 B;  3ETL A;  2E8N A;  2VIX A;  3CNH A;  4CF3 A;  2FPM A;  1QLN A;  3N28 A;  3IV6 A;  3QZ8 A;  2BCU A;  1N60 A;  3C28 A;  2EDU A;  1PVP A;  3L4P A;  3TAP A;  1Z19 A;  4GC6 A;  8ICL A;  3E0F A;  5ALF A;  2KJ8 A;  5HP4 A;  2B0C A;  2M9N A;  5III A;  3QUC A;  2JV3 A;  2KN7 A;  3Q8P B;  1JIH A;  4TUS A;  2ZJ8 A;  4C8K A;  2EZX A;  1Y88 A;  5KFK A;  3PX6 A;  5KAI U;  1ZQN A;  2KG5 A;  8ICQ A;  1BNO A;  5L1J A;  3LYS A;  1KQQ A;  8ICR A;  2EAM A;  1SV0 C;  2ASJ A;  1TVA A;  3WKA A;  2ATL A;  5AK4 A;  5EWG A;  2W9B B;  3RF9 A;  3OGU A;  3UMG A;  1RYR A;  2F3N A;  3M9M B;  4QIW C;  3MFH A;  4QJF B;  5AKH A;  4US8 A;  1BPY A;  2ODG A;  3RJG A;  4F4Z A;  1KW4 A;  4QWB A;  3RB3 A;  2ZIU A;  5KFL A;  5KFM A;  4BGD A;  2EQY A;  3EPG A;  4U6P A;  4JV2 A;  1WWU A;  1ZQW A;  4YR2 A;  1Z3E B;  1MN8 A;  2ASD A;  2BCR A;  1N5X A;  3GV8 B;  4IRC A;  4DL2 A;  5KFE A;  4J9P A;  3PR5 B;  3GIK A;  2VA8 A;  1KFD A;  2RDJ A;  3PO4 A;  4UB3 A;  1SIJ A;  3M9O B;  3BQ7 A;  5J2I A;  3MR5 A;  4PGY A;  5J0P A;  3HP6 A;  2IOF K;  4DEZ A;  4EYH B;  3U26 A;  2LKY A;  4ED6 A;  1NKE A;  3HRD D;  4I2D A;  1RDF A;  9ICC A;  5EE9 A;  3SI8 A;  5J8Y A;  5L9X A;  4F5N A;  2NO4 A;  2NV3 A;  3NVY A;  3AN1 A;  3MR3 A;  1NKC A;  3SV3 A;  3TAD C;  1ZQC A;  4FZN A;  4FZL A;  2JZB B;  7ICH A;  4YMO A;  5KG0 A;  4TUQ A;  3ZDE A;  8ICB A;  5CHG A;  4DQP A;  3F5A A;  5AKL A;  4QZD A;  1LVH A;  5TZV A;  2W9C A;  4M9N A;  3D6J A;  3RJE A;  2DUY A;  3IN5 A;  2E8O A;  7ICG A;  5IIO A;  4XQ8 A;  4ZOH C;  4AYB F;  3V7K A;  5AIC A;  1ZQQ A;  2K4H A;  3SEI A;  4O3M A;  2KNJ A;  2Y9T A;  8ICC A;  2PXI A;  1XO1 A;  4DQQ A;  4DL4 A;  1KN5 A;  1COK A;  3C1Y A;  2JEI A;  2EAN A;  3WK4 A;  4B9M A;  2R8G A;  2LYA A;  4LVS A;  3T5L A;  3T5J A;  4LJX A;  2R8I A;  3V6H A;  2JEG A;  5EE0 A;  3WK6 A;  4BXO A;  1KSP A;  2YMM A;  2HHT A;  2KSO B;  4O3R A;  2DFL A;  5K4L A;  2YTU A;  1NK4 A;  8ICT A;  3IG8 A;  5J0W A;  8ICE A;  3QX7 A;  2ZUB A;  8ICI A;  2N1R A;  1SL2 A;  3VC8 A;  4DS4 A;  4IQT A;  1CEZ A;  2WB1 C;  1N5W A;  5BOL A;  5DB8 A;  3RBE A;  4O3O A;  4CRX A;  2E1F A;  5ALQ A;  2GO7 A;  2I6X A;  3RH6 A;  1L7M A;  4BX9 C;  2VKQ A;  2IBK A;  5EWF A;  3PML A;  5G5G A;  4ED0 A;  4J9O A;  2BDU A;  2OHF A;  1ZD4 A;  2KMD A;  4RQM A;  5ALS A;  5DQH A;  4P0P A;  9ICJ A;  5AI4 A;  1ZQG A;  1LKY B;  4R63 A;  4UBB A;  1NOM A;  2RQ5 A;  1OW5 A;  2A3V A;  3NUQ A;  3QE9 Y;  3KOO A;  3SYZ A;  2NRW A;  5AKJ A;  4IRD A;  3PSI A;  2AHO B;  2H5X A;  3JPR A;  2W43 A;  1ZQP A;  1QSS A;  4PHD A;  4C4S A;  2DKX A;  3C2M A;  3RR8 A;  4YXM A;  2YB4 A;  7ICS A;  3BS5 A;  3H4D A;  3JPT A;  1ZQX A;  2K4I A;  3GII A;  3N7P D;  3QUQ A;  4EBD A;  4EX7 A;  4QIW F;  2F44 A;  1SXE A;  8ICF A;  2AJQ A;  9ICQ A;  1C20 A;  3TI0 A;  4UAS A;  1RM6 C;  2D8C A;  1X9W A;  5KG1 A;  3T5H A;  2JR5 A;  4FS1 A;  5AM2 A;  1SKR A;  3H7I A;  3PVX A;  1ZQZ A;  4CNQ A;  5KT3 A;  1S0V A;  2E8M A;  2W9M A;  4TQR A;  3TFS A;  2LHT A;  4DWI A;  4PL1 A;  9ICP A;  2I1Q A;  4MFA A;  4NL9 C;  5HMM A;  2KK0 A;  3AL0 B;  4P4P A;  4IQV A;  2ESE A;  4NLC A;  2PKE A;  2F1H A;  4M9L A;  4F8R A;  2QB0 B;  1FFU A;  1NK7 A;  1KBU A;  3LK9 A;  3WK8 A;  3WU2 U;  4UW9 A;  3LVV A;  4XA5 A;  1U45 A;  1TK0 A;  1WYG A;  2RHF A;  1NJZ A;  1D9F A;  9ICB A;  4ECX A;  1TV9 A;  4QW8 A;  3WK5 A;  2OM6 A;  4YQW A;  4ED3 A;  1RYU A;  4B6J A;  4M6W A;  2MSN A;  4QZ9 A;  4FZM A;  1TE2 A;  4F4Y A;  1XC9 A;  1S76 D;  7ICF A;  2W04 A;  2WF8 A;  2HBK A;  2HOF A;  5T14 A;  2LM4 A;  2K8C B;  2VJ4 A;  4F71 A;  4PHE A;  2CPR A;  2AQ4 A;  2LBO A;  2KKV A;  2KZZ A;  3MFI A;  5KT7 A;  4B9U A;  4DLG A;  5AI0 A;  2QB1 A;  4P2H A;  4RQ1 A;  1Z00 B;  2C22 A;  2EZZ A;  4HYK A;  4RQ7 A;  3RJH A;  5CR0 A;  1U49 A;  5KFI A;  5ALL A;  2K8A A;  2HHV A;  4FBT A;  1ZQB A;  4PHP A;  4KLF A;  2ZTC A;  3UXN A;  2B21 A;  3HWT A;  2RRD A;  2NRT A;  2WB1 F;  3E58 A;  5AK3 A;  1UT8 A;  4UQG A;  5AKG A;  2R8J A;  1ZRM A;  8ICG A;  4LZD A;  5GTI U;  2ISP A;  3KTQ A;  5CJ7 A;  3OPX A;  8ICN A;  1COO A;  5DBC A;  1L7P A;  4O5K A;  4NLG A;  3CW2 C;  4NM1 A;  2VJ5 A;  2MUT A;  4HAI A;  4OJL A;  1BPX A;  3MR2 A;  2HVI A;  3VCB A;  1Z00 A;  1T3Q A;  4ED7 A;  2HOQ A;  4US9 A;  3BDP A;  4ZH4 A;  4I29 A;  5G5H A;  5J2J A;  5DLF A;  1ZQK A;  3Q8K A;  2HCF A;  4J9L A;  5KL1 B;  1DGS A;  4DF8 A;  3PV8 A;  1RG6 A;  2DL0 A;  2BCV A;  2EAP A;  3M6Z A;  3SQI A;  4F72 A;  1WG8 A;  1ZQJ A;  2BPG A;  1UA0 A;  4YFK A;  4ECZ A;  4BWM A;  1PK3 A;  2GH1 A;  3BQ1 A;  4GLX A;  2J6T A;  4Z6F A;  2NO5 A;  4PJ0 U;  2OH2 A;  2Y0S F;  4R8U A;  5KFN A;  2JXJ A;  3ZI4 A;  5KFC A;  3RRH A;  4RQN A;  4EZ9 A;  2XY6 A;  7ICL A;  2AU0 A;  4QZB A;  4M2Y A;  2W11 A;  4UB8 U;  1PVQ A;  3NVZ A;  3PW4 A;  4KX5 A;  5AKI A;  7ICT A;  3QU4 A;  3SMV A;  5ALO A;  1ZQO A;  9ICW A;  3H0L B;  4Y2U A;  3KHL A;  2HHU A;  2KHV A;  3IRU A;  3K75 D;  2EZY A;  2W55 A;  1SV4 A;  2J6S A;  3ZDC A;  4DSK A;  4C7Z A;  3EUB 2;  4XUS A;  4NWI A;  3RJJ A;  1PUZ A;  2Q0Z X;  4RT3 A;  4K4G A;  9ICV A;  3GDX A;  3QZ7 A;  4UAT A;  4PGQ A;  5ALN A;  4Y2P A;  2HHW A;  4DOB A;  1QQ6 A;  2YMQ A;  1N48 A;  2JH7 A;  5J29 A;  2M0N A;  4MF8 A;  5CRX A;  5DBA A;  2FDR A;  2K89 A;  1L3U A;  4WJ3 B;  3IM1 A;  2KJ5 A;  2WHE A;  2ZIU B;  3D2Q A;  1B0X A;  1ZQD A;  4ELT A;  1NJX A;  2KOB A;  1U48 A;  4QZA A;  3H40 A;  4M9J A;  2YMP A;  3V72 A;  4ECV A;  4R65 A;  1QCK A;  2W54 A;  4CCH A;  3JPP A;  4UAW A;  2BDP A;  2BPC A;  4NY8 A;  1J2M A;  4J9S A;  4MHV A;  4GXI A;  3EPI A;  4FBU A;  4DO9 A;  4K4I A;  3Q8L A;  2F8L A;  3RH4 A;  1SV0 A;  3BZC A;  4NLN A;  1KTQ A;  3BJY A;  2KV2 A;  4DQS A;  5KFA A;  3EZ5 A;  3M1Y A;  4C7Y A;  4M0A A;  2I9G A;  1N63 A;  4DOA A;  1X2I A;  4CF5 A;  3SAF A;  2Y9U A;  1ZYQ A;  3V6J A;  3TAR A;  2W9C B;  1NK6 A;  3IG5 A;  1ZQS A;  3C5F A;  4KLE A;  3H8W A;  5AI6 A;  5DG8 A;  2V9W A;  1JXE A;  4NLK A;  8ICY A;  4KMO B;  3PW7 A;  1XO0 A;  2C2D A;  3KHG A;  3PSP A;  5JTI A;  4QZG A;  4QWA A;  2B6G A;  3AMZ A;  5BPC A;  5ALD A;  5IIJ A;  2KIW A;  2BCQ A;  1ZQ1 C;  2RLT A;  3ZD8 A;  5J2D A;  5JUM A;  2XY7 A;  2ZXH A;  4GC7 A;  4DL6 A;  1X6I A;  5C0Y A;  4F2S A;  1L7O A;  1ZQI A;  2ZUD A;  4RQ8 A;  4I2F A;  5J0Q A;  3NVV A;  2GOL A;  4DQR A;  3O0F A;  5C5J A;  4BXO B;  3UMC A;  1AQ6 A;  2DQN B;  2ZTE A;  3MDC A;  2KZ3 A;  5KG2 A;  1S8O A;  3TAD A;  1XSP A;  5DLG A;  2LM1 A;  4BUG A;  1S0M A;  3KFU F;  2E5S A;  5KFR A;  2FPK A;  2G06 A;  2FLN A;  1ZQA A;  1DGJ A;  1N61 A;  3Q8Q B;  2OWO A;  2JH1 A;  4JUZ A;  1Z1V A;  1B22 A;  4O3Q A;  2H3V A;  4ELU A;  3MAB A;  3GIJ A;  3TFR A;  1O03 A;  1XWL A;  3UXP A;  2HDO A;  2KE7 A;  4FE3 A;  5L1I A;  4P0P B;  4DFK A;  1ZQT A;  4ECY A;  4DFM A;  1JAL A;  4YMN A;  1TKD A;  3Q8R B;  2W7O A;  1KFT A;  4B9L A;  4F5R A;  2KEY A;  5KFX A;  3QUT A;  4O3P A;  3WKE A;  4RQ2 A;  4KLG A;  4P0Q A;  5L1L A;  4DSE A;  4DQI A;  2E8P A;  4EEL A;  2UVW A;  2W03 A;  7ICQ A;  8ICX A;  3H8J A;  4O3N A;  4RNO A;  3I76 A;  2DF4 B;  3EW9 A;  3DDH A;  3UXO A;  5L1K A;  1HEK A;  3BS5 B;  5KT2 A;  3QU5 A;  5J2E A;  5EOZ A;  2NRZ A;  1DOQ A;  3E2E A;  4DLE A;  3F2B A;  4NLZ A;  4C8M A;  3F2C A;  1QSY A;  1N62 A;  9ICA A;  4C4R A;  2BKE A;  2HW3 A;  2QAR A;  3HW8 A;  2PFN A;  2W3S A;  4J9R A;  4OJ5 A;  2ZIX B;  1IM4 A;  4DCC A;  3HPO A;  2YX8 A;  1PK1 A;  4KLJ A;  5IIK A;  4EEK A;  2XGP A;  3JPO A;  2AH5 A;  3RB0 A;  2HHX A;  1NJW A;  1MA7 A;  2VA2 A;  2PI4 A;  3C23 A;  3PMN A;  4J9M A;  1VLB A;  5DG7 A;  3N97 B;  3UMB A;  1Z4O A;  2AQ0 A;  4USA A;  4Y2V A;  5D4B A;  2BQ3 A;  4J03 A;  5ALP A;  4KLO A;  2FMS A;  4BDP A;  4MF2 A;  5KNI A;  1QTM A;  2FPL A;  3QXG A;  2W8L A;  2BQR A;  5ALH A;  3EWA A;  2FE9 A;  2P35 A;  1BVS A;  5AM4 A;  3RJK A;  3HJE A;  1QH9 A;  1RZT A;  4NV0 A;  2W3R A;  3GZF A;  1L8L A;  1V38 A;  4IQU A;  5KFV A;  3L5K A;  3V6K A;  7ICR A;  2DKZ A;  3FAH A;  4Q45 A;  5DB9 A;  1MC8 A;  3RRG A;  3ICX A;  1FIQ A;  5AKY A;  2K4E A;  1S77 D;  4DSJ A;  2F1I A;  2A1J B;  3LWL A;  3PW0 A;  2ZIX A; 
#chains in the Genus database with same CATH homology
 2KIV A;  1DXS A;  1F0M A;  4NL9 C;  2D3D A;  1UQV A;  2GLE A;  2K4P A;  2Y9U A;  1UCV A;  2QAR B;  3BS7 A;  3BQ7 A;  2ESE A;  1V85 A;  3HIL A;  1SV4 A;  5F3X B;  1PK1 B;  2QB0 B;  2E8P A;  2E8N A;  2KSO A;  5JTI A;  5J8Y A;  2KMD A;  2K60 A;  4RQM A;  2F8K A;  2B6G A;  2L5Y A;  3BS5 B;  1WWV A;  1LKY B;  2LPE A;  3TAD C;  1OW5 A;  4NL9 A;  1X40 A;  3IDW A;  2QAR A;  2JV3 A;  3H8M A;  1SXD A;  2EAO A;  2ES6 A;  4PZO A;  1PK1 A;  2E8O A;  2QB0 A;  1SGG A;  3K1R B;  2DKX A;  1X9X A;  5JU5 A;  2KG5 A;  3SEI A;  1B0X A;  3BS5 A;  3TAC B;  1LKY A;  1RG6 A;  2Y9T A;  2DL0 A;  2EAM A;  1SV0 C;  3KKA C;  2EAP A;  3TAD A;  5L1M A;  1COK A;  1JI7 A;  5KNI A;  2EAN A;  2F44 A;  2LMR A;  2QKQ A;  1SXE A;  2F3N A;  1X66 A;  2FE9 A;  4IS7 A;  4NJ8 A;  1PK3 A;  1V38 A;  2D8C A;  2QB1 A;  1KW4 A;  1OXJ A;  2DKZ A;  1Z1V A;  4MHV A;  5JRT A;  4RQN A;  1B4F A;  2E8M A;  2KSO B;  2KE7 A;  1SV0 A;  3KKA A;  1WWU A;  5J8Y C;  2YTU A;  3SEN A;  4PZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...