4B9VA

Structure of the high fidelity dna polymerase i with extending from an oxidative formamidopyrimidine-dg dna lesion -da basepair.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
579
structure length
579
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9vA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9vA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9vA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9vA01
4CK3A 4M45A 5KFTA 4DL6A 3AVKA 4M2YA 3V6DA 4O3RA 3PR4A 3NGZA 4O3PA 4Z4EA 2MAXA 4C8LA 1S5JA 2DFHA 4KAZA 1IM4A 5KG1A 3K59A 3RRHA 4FK0A 3PVXA 4K8XA 4KHWA 4F4KA 3TWHA 7ICKA 4CHNA 1TAQA 1NK4A 1DTTA 3M8PA 1N5YA 4DO9A 5J0YA 3ZSRA 3HJFA 9ICLA 4I2QA 2BGWA 4JK1A 4RU9A 3V7KA 1JLAA 4P4OA 3SCXA 2QKKA 1EP4A 4YXJA 1RILA 4DF4A 3HW8A 3L2RA 4RNOA 4CEOA 1ZBUA 4F2RA 3NF7A 4OKJA 4G3IA 1TAUA 1ZJMA 4CJ5A 1BVSA 8ICMA 4JWMA 3V4IA 4NLGA 2A1SA 3AO3A 3EY1A 1S9FA 2WTFA 2G8WA 3RR8A 4KKOA 4RPYA 5IIMA 1U47A 1VSHA 2IHNA 1BCOA 3H8WA 2DFLA 5HNKA 2ISOA 9ICPA 3ISNC 3OY9A 4ZTFA 3GV8B 4J9PA 1LV5A 2YNGA 4P2HA 1CUKA 4F92B 3AUOA 4C8MA 4CFDA 1JXEA 2P5OA 1IXRA 9ICKA 4DFJA 4QWBA 3ZDBA 4EP5A 3WNFA 7ICOA 4HUGA 1RT2A 4BE2A 5CYQA 3OYMA 3QEAZ 1T03A 4KHYA 1UAXA 1DGSA 1CXUA 1TL3A 3LP3A 4O5CA 3QEXA 9ICCA 4KO0A 2IC3A 5J2CA 1R0AA 2ZJ8A 3C6TA 3AO1A 4KITB 4Z4GA 3C5GA 3C21A 4FM0A 1HNIA 3VQEA 2C28A 3L2WA 1S10A 5CY4A 3KK2A 4KLHA 2VG7A 1TKXA 4RQ1A 1J54A 2W9CA 1QSLA 3C6UA 4YMNA 5HP4A 2GBZA 4B9NA 1UOCA 8ICWA 5KT4A 1GOCA 4YCXA 3V7LA 2A1JA 1REVA 4NLNA 9ICMA 1RBUA 5DMRA 4RNMA 4DFKA 3MDAA 5J2IA 8ICNA 1VSDA 4CJEA 4YFKA 3NDKA 1SUQA 3K58A 5CJ7A 4QWEA 5HP1A 3PV8A 4N56A 5KFZA 4XA5A 5L1IA 2G8UA 2BCSA 5KG0A 4MF2A 1IKWA 3HK2A 4F4YA 4H8KA 4CJTA 1RXWA 3EWAA 4CIFA 3NH1A 1T05A 2XY5A 4JS5A 1JIHA 3GILA 3C5FA 5KFDA 3L3UA 3ZDCA 5DG7A 4GXIA 3Q8RB 3G0ZA 5C42A 4I2DA 1DOQA 4B9TA 3H8JA 5J2GA 4FJXA 3MGHA 3RBDA 4AHRA 1Z25A 2ISPA 3I0RA 4KMUA 5J29A 3SYZA 4R64A 3RB3A 3ZSXA 2FLLA 1QLNA 3JPRA 9ICUA 4OVLA 5KFPA 5HRPA 4DG1A 4FLTA 4F5NA 4NYFA 3OHBA 3SJJA 4QW9A 2W9BA 1ZQBA 3MR5A 2A1RA 5CB1A 1EKEA 1LWEA 1S9EA 4N41A 4CGHA 1I39A 2P51A 1S0VA 4KLLA 4QCLA 4QAGA 4CHYA 4YG2A 2NUBA 3MXIA 9ICRA 3V72A 1D9DA 3AVLA 1SL2A 3MFHA 3RTVA 3V6JA 2KFNA 1HQUA 1RBVA 4Q8EA 4M3ZA 4JUZA 9ICJA 3WNEA 2IHMA 4M3UA 3VQPA 1BHLA 4M41A 3LALA 5IIKA 1JMSA 3V1OA 1IKYA 3RMCA 4RPXA 3SV4A 2Y1IA 5KG7A 1ZETA 1JKHA 3MBYA 2C2RA 3HX0A 9ICAA 5HROA 1C1CA 5JS1A 2DFFA 4GW6A 3HM9A 1B92A 3ISDA 5FRMA 4LD0A 4PHDA 2PYJA 1H38A 2IMWP 3EZ5A 3OJUA 2R8IA 3MFIA 4YR3A 3HO1A 4F5QA 4PHPA 3OHAA 4NM2A 4Z6CA 5DLGA 5HBMA 4IQWA 1K1SA 1S9GA 5CZ2A 4CF9A 1NK9A 5KFYA 8ICLA 2W9AA 3AA2A 4W5TA 3UXPA 5KTQA 1NOYA 4B8CA 1ZQYA 4HTUA 5CA7A 8ICEA 4CHPA 5DKWA 3GIKA 4DQIA 4FZXC 5KT6A 4YD1A 3AV9A 1S6PA 3OYDA 4TUSA 1RBSA 1D8YA 1A5WA 4E7HA 1KTQA 3O3GA 4RZRA 4LY7A 3AA5X 3QIPA 2HHSA 4ED0A 2JEIA 3NHGA 3AA4A 4DTJA 1U04A 2LSNA 3QEWA 4F8RA 4BWJA 3QLHA 3TQ1A 1IKVA 4UBCA 9ICVA 4MEYA 4FBUA 4WE1A 3UXNA 1VRTA 4M04A 9ICIA 4FJIA 3OSNA 4FJKA 4KLJA 3CG7A 4R65A 8ICYA 3ZD8A 4RQ8A 2MUTA 2P1JA 1TVRA 5TZVA 3BQ0A 4KREA 4AILC 5KFIA 4CGJA 1QSYA 2KZMA 2IDOA 4CFCA 9ICNA 3FYHA 4KB0A 4O5BA 3HP6A 2FPMA 5J2HA 2ASLA 3ETLA 1RT3A 1S1XA 1MQ3A 7ICJA 3A2FA 3VQDA 4CEDA 1IO2A 3KLEA 3MR3A 1RDBA 1BPEA 3LPTA 2PFNA 4F50A 5DB9A 2PFQA 3ZD9A 1LAWA 5JUMA 3JSMA 4JS4A 3RH4A 3SQ1A 5DB6A 3QEIA 4O44A 4Q44A 1WLJA 4KLMA 4DQRA 3D45A 3AVCA 3U3GA 1HQEA 2VWJA 3RJIA 1RBTA 3PMNA 4J9KA 2BHNA 4J9OA 4I2FA 1BPYA 2IOCA 4ECYA 3C1YA 1ZQFA 2G8KA 1BQNA 3DYAA 5KFRA 2ASJA 4KLIA 1BPXA 3B6OA 1RYSA 3V1RA 3SUNA 2B21A 9ICGA 3VQCA 3VQ8A 4L8RB 4QZHA 4ECXA 2FMSA 1CEZA 1JLGA 3DM2A 4FJ9A 5L1LA 1FKOA 4FZZA 4DQPA 4CEZA 4DOCA 4FLWA 4M9JA 5J0TA 1BIUA 2EX3A 4O3OA 1VSKA 5CP2A 4RQ0A 4R66A 2QKBA 4O9MA 1JX4A 2IGIA 4I2IA 4F3OA 4RQ4A 4BGDA 2I5JA 4Q43A 1WAJA 3TFRA 4LH5A 4HUFA 4Z4IA 1HJPA 4NYNA 5D49A 4EYHB 4J2BA 2YNIA 4UAWA 1TKZA 1JL2A 3NGYA 1ZBLA 4XUSA 1TK0A 4ECTA 1QHTA 1ZQUA 5EWGA 4OLAA 2NRXA 5J2EA 3RB4A 4B3OA 3ZSOA 2VA3A 1XSNA 2OPPA 4I2PA 2UVVA 4ED2A 3KLIA 3VQ5A 1W0HA 5CWRA 3QINA 4KLFA 2JEJA 4FJ7A 1ZQAA 1EXNA 4UB4A 1U49A 3EW9A 1XWLA 3KHHA 3L3VA 4FYDA 3Q8PB 1D5AA 2BCUA 4I2CA 4BACA 1I3AA 4FW2A 4ED1A 2J6SA 3UPQA 2BCRA 5IILA 5L1JA 4DQQA 8ICJA 1Z26A 4QZAA 3HXMA 3EYZA 4DQSA 4TURA 3PUFA 4OKKA 1KFSA 3TARA 3NH0A 4CF8A 4PWDA 1ZQZA 1S1VA 5J2DA 4MFBA 3NF8A 4O55A 4YP3A 3AVGA 4C8KA 4Z0UA 4Q5VA 1UT8A 2BDPA 2BE2A 1ZQMA 4CJSA 3TAEA 3OYJA 1CXQA 4QZCA 4F5PA 4FW1A 3LP1A 4LZDA 1B9DA 2GV9A 4FLUA 3IHQB 4ZH4A 3I8DA 2BCVA 3TAQA 1BIZA 4M3WA 4IQVA 1JN3A 1XSLA 2ATLA 3HYFA 5KRSA 3AVMA 1C7YA 1Q8IA 4I9LA 4P4MA 5L9XA 2R8KA 1MU2A 4E19A 2BQ3A 3QNOA 3QETA 3K75D 2PY5A 3BQTA 3G6VA 2JZBA 5KT2A 2V9WA 9ICEA 5F9LA 4M3YA 3GDXA 4Z6EA 4E7IA 3SNNA 3TFSA 4NXZA 3AVIA 1ZBFA 3B6PA 1T8EA 1RT7A 1TKTA 3TAGA 3F73A 4MF8A 3ZSYA 4E3SA 4IQTA 2BANA 2HW3A 1CLQA 4I2AA 4UAZA 4DL7A 4KLDA 4Z4CA 4K4IA 4KI4A 2ZTCA 2DFEA 4ED3A 3GQCA 3SQ0A 1S77D 1A76A 2VG6A 2PI5A 4DFMA 2LYHA 4CGIA 2AU0A 2HHWA 8ICTA 3PW4A 3T1AA 1S1UA 3CQ8A 4DL5A 4G1QA 4OKEA 4CJRA 1JXBA 1S1TA 4F5RA 4Z6DA 3RH6A 8ICBA 1ZQJA 2KFZA 2UVWA 3L8BA 4Z4HA 4M6WB 5J0RA 4M3RA 3LP2A 3I0SA 5DQIA 3MXMA 4YR0A 3LZJA 1PZNA 4YD2A 1ASWA 1C0UA 4I28A 2HHTA 3LDSA 5J2FA 3IRXA 3O3FA 2BCQA 2VA2A 3BQ1A 3H40A 3OYAA 4EZ6A 1X2IA 3T3FA 3ZCMA 1WCLA 2FPLA 5KFCA 4IR1A 5KG4A 4QZBA 4IRDA 5J2BA 4P4PA 3JPSA 3OJSA 2JGUA 2F1JA 5DG8A 1HUOA 9ICSA 3E01A 2AJQA 3NF6A 4PUOA 1UA1A 5KFXA 1B22A 2UVUA 4FXDA 3KTQA 2NRWA 1Q9XA 5J0PA 4OPJA 3MR6A 3M8RA 4N76A 3P5JA 3RAQA 3V9ZA 1L5UA 2ASDA 3V6HA 3V9UA 4DSJA 1HYVA 3NFAA 4ELUA 1Z00B 1A5XA 4CJPA 5L1KA 1ZQTA 1RT1A 4MFAA 1VK0A 4J2EA 2OWOA 2Z1HA 5DGAA 5KGWA 1KCFA 3S3NA 3KK3A 4KPYA 5CHGA 4O5KA 5KRTA 1WSJA 4OLBA 7ICGA 1ZQGA 4B08A 1X9WA 8ICRA 4O3SA 4F2SA 2IS3A 3VA0A 5J2QA 3KIOA 4J9LA 1KLNA 4IR9A 1YTUA 3QIOA 4CEEA 7ICLA 3QERA 2XGQA 5CR0A 4QZ8A 4PPXA 3RMBA 5KFJA 3RJKA 1U9LA 2F1IA 2X6SA 4ICLA 5BOMA 3C2MA 2RN2A 3C94A 3ZSZA 3THVA 4KV8A 4J9RA 4BXOA 4Z6FA 7ICNA 2R7YA 4RQ3A 1ZQQA 2DPIA 4OGEA 4J2DA 3GIJA 3KD5E 3V7JA 3H8SA 4B8AB 3Q8SB 4B9MA 2P66A 3H08A 2O4IA 3TAMA 4IG3A 1BISA 4X5VA 5KT5A 3ZT2A 5KFNA 3HVTA 3PO5A 3OYEA 1F21A 3CM6A 4LZGA 1Z3EB 2GWSA 4LSNA 8ICZA 4NLKA 4FS2A 4R5PA 4ECUA 2BGGA 1HYZA 2D0BA 3KJVA 9ICBA 5HRNA 3RR7A 3QE9Y 4IQUA 4M9HA 5DB7A 1DLOA 4RW7A 2G8VA 1RT4A 2ETJA 5J2MA 4M9NA 4I2GA 4PA1A 1HJRA 3B0XA 4DU1A 2BPFA 1D9FA 3QEPA 2PXIA 4HUEA 4PGYA 1QS4A 2GUIA 3OGUA 1L3VA 4BDPA 3G6XA 4Y1DA 7ICVA 3QEVA 2OPSA 1S0OA 8ICUA 3T19A 4RQ6A 5D3GA 4CF1A 1WSGA 1S97A 1WSIA 3KD1E 4IFYA 2W9MA 4CEBA 2PZSA 3C2KA 2F1HA 3BJYA 5D4BA 4ECRA 2KZ3A 4HHTA 3DMJA 4NCBA 4ELVA 2XY8A 5DK5A 4DTXA 1ZQLA 2FLPA 8ICVA 2W9CB 2NRVA 3NTUA 7ICSA 4CHOA 3UIQA 2BQRA 3H7IA 3MR2A 1X9SA 2X74A 3GFKB 2R8JA 3ASMA 3O4QA 3JPPA 1ZQSA 1SV5A 4DLEA 3OYGA 1VSIA 3AVFA 4Y1CA 8ICOA 3ISCA 3QZ8A 1HNVA 3DLRA 2ZJ5A 7ICEA 3VN5A 2O4GA 1C0TA 3RJJA 4IRKA 2JLEA 2M9NA 4CIEA 2HNDA 4EZ9A 4NCAA 1IG9A 4RW8A 1RCHA 4I9QA 5J2NA 1HPZA 3LWMA 3MECA 3JPOA 1HUZA 8ICIA 3PY8A 1NOMA 4DTUA 3K2PA 4I27A 2G8HA 3PO4A 4CFAA 3OYCA 1NKEA 2FBVA 5KG6A 1RDCA 3HWTA 3E2EA 1ZBHA 3DLBA 4QZEA 4UB3A 3RMDA 1A77A 1NK7A 3IM1A 4M3TA 4CECA 1NJYA 4QZIA 4DTNA 1YTAA 5KFMA 4PQUA 5EWEA 3ZDAA 5I3UA 1ZJNA 2YHBA 4I2EA 4I2BA 4KLSA 5J0OA 4F4ZA 5I42A 2FBTA 4RT2A 3M8QA 4E7LA 3RBEA 4F93B 3T5KA 1RTJA 2F8TA 4UAYA 2W9BB 5KG5A 3PMLA 1FK9A 4HCCA 2C2DA 4OPKA 2XY7A 1CZBA 3V81A 1D8LA 9ICHA 4W5OA 3EPIA 1U45A 5J0QA 3CFRA 1UWBA 2EHGA 4KHSA 1BQMA 4M47A 1RTDA 4PY5A 4QW8A 8ICQA 2H5XA 4QOZB 3OYNA 3N4MB 4F5OA 2X78A 3AVJA 1YVUA 3HPHA 1NK6A 1G15A 3FDSA 4DTMA 2RDJA 4RW4A 1JLBA 4K8ZA 4YQWA 4E89A 5EU7A 1KVCA 4E0DA 2P5GA 2RPIA 7ICQA 4DS5A 4JWNA 4GXKA 4DOBA 2I9GA 3KHLA 3AVAA 3KLFA 4RQ7A 4W5QA 3ZSQA 4EP4A 2XC9A 1WNSA 1TK8A 5J0UA 1TVAA 4CIGA 3T5JA 1LW2A 3O4NA 4GLXA 3QESA 1QQCA 2HMIA 2R8HA 1SL0A 7ICTA 4C8OA 4B9UA 2G8FA 1KDHA 3NGIA 2YKMA 3V9WA 3MEGA 1Y97A 4UB5A 3RRGA 3LAMA 5KFOA 1C0MA 4QWDA 3NF9A 2UVRA 4B9SA 1LAVA 1LW0A 3S9HA 3MAQA 1NK8A 1BI4B 2ZJAA 1O1WA 3TR8A 1YT3A 1ASUA 2YHAA 3RJHA 3SV3A 3DLHA 5DG9A 1TV9A 1NKCA 3OVNA 2XGPA 1RXVA 8ICFA 3JPNA 1VSLA 3M9NB 5BOLA 4QZGA 4FS1A 1KVAA 4DSLA 2PFOA 5DQHA 1ASVA 4PH5A 1CZ9A 4JLHA 2P6UA 1VSMA 3SPZA 4QWCA 4CJ4A 4K4HA 3O3HA 3HL8A 4JRQA 5IIOA 4NY8A 3DRRA 3K57A 3D0PA 1JXLA 5K14A 3SZ2A 1RT5A 5KFSA 3CYMA 1S0MA 8ICCA 1NOZA 4O3QA 5J2AA 1HRHA 1L3UA 5HHHA 2ZTDA 4MQ3A 3JPQA 2XHBA 3P1GA 8ICKA 3TABA 4J2AA 5HRSA 4R8UB 2NRTA 4ECVA 4GXJA 3LZIA 3S3OA 2OYQA 1VSJA 2AQ0A 2DPJA 2D5RA 3FFIA 1TL1A 1Q9YA 1KVBA 1QSSA 4ECQA 3C23A 1NJZA 2KN7A 4BWMA 1T7PA 4UQGA 4FM2A 3G6YA 1TK5A 1VRUA 1ZQPA 4CHQA 3GIMA 5DDYA 3PX6A 3VQ6A 1C6VA 1ZQXA 1N56A 3DLGA 2G8IA 4RNNA 1VSFA 3KKSA 9ICQA 4KLUA 3OYIA 1BPBA 4CJQA 3ZT1A 4JV1A 1ZQKA 3DI6A 5DDMA 1XHZA 1ZBIA 5E41A 9ICFA 4N5SA 3V9XA 4B9VA 1TFRA 1ZYQA 4CGDA 1COOA 4UB1A 4TSXA 1JLEA 1B9FA 5KFKA 3LWLA 5J0XA 2J6TA 4CEQA 4KRFA 2C2EA 4IDKA 2KW4A 3AO2A 4DSFA 5IINA 4O5EA 2KQ2A 1RTIA 7ICPA 1TV6A 4IFVA 4AH9A 4FLYA 3NBPA 3UQ2A 3ORYA 3ISBA 3AU6A 4ID5A 3VQQA 5J2KA 4CJFA 8ICAA 1BGXT 1JLCA 2Q0ZX 3VQ7A 2HVIA 3T5LA 1N6QA 4KLTA 4KTWA 3S3MA 4FK2A 9ICOA 3TANA 4CJUA 4E1NA 3IG1A 4KLEA 3RJGA 1ZQNA 3AVHA 3F9KA 5EOZA 3LP0A 4ECZA 5CYMA 2IBKA 4DTSA 1KEJA 4B9LA 5KFWA 3NGDA 1UT5A 2HNZA 4KLGA 4DSKA 2P6RA 4TQRA 1JLQA 2NRZA 4RPZA 4OGCA 5C25A 2ATQA 4M0AA 2DY4A 4YNQA 1U4BA 4LH4A 2W8LA 4DSEA 3GV5B 3ULDA 2FBXA 3JYTA 5CZ1A 7ICFA 4ECSA 1DTQA 5EWFA 2HHXA 2F96A 1S1WA 3KK1A 3OYLA 4IBNA 3OS1A 3BGRA 4DWIA 3RAXA 4MFCA 5KG2A 4DL4A 1XI1A 2XO7A 4BE0A 3HPGA 3L2UA 3V6KA 2FBYA 2HHUA 5F9NA 4I29A 2YNFA 3C1ZA 2XCAA 3KHGA 4Q45A 1QE1A 4YR2A 4F91B 3C95A 4O4GA 4AHCA 4KHUA 8ICXA 5J2PA 3KLHA 9ICTA 2B6AA 5KFGA 4RW9A 1ZQWA 2E6MA 3HSTB 4CK1A 3JPTA 1ZQCA 4Z4FA 2OZSA 4ED7A 4J9NA 1TKDA 1NJXA 5KFVA 3T5HA 1XHXA 5KFFA 2WONA 3QO9A 4DFPA 4FVMA 4CCHA 4FJHA 2ZUCA 3ZDEA 3VQAA 1KSPA 1HMVA 1U48A 4J9MA 2XCPA 3HT3A 4R63A 5KT7A 4BDYA 3K5LA 5J1EA 4PHAA 5KFLA 3LANA 2ZTEA 4QZFA 3QNNA 3U3YA 4FZYA 4H4MA 3SUQA 2ALZA 4FJJA 1RTHA 3IAYA 3DRPA 4DOAA 4RQ2A 2BR0A 4CJ3A 3PR5B 5D46A 2FPKA 3DLKA 1XS9D 2ZUBA 2HHVA 3SUPA 4RQ5A 3L2QA 4O3NA 2ZD1A 1ZQEA 3OYKA 1X9MA 3LDAA 8ICHA 2PFPA 1BCMA 1WCNA 3M9OB 3BDPA 4CEFA 2C22A 1T4GA 4CEAA 3OYHA 3Q8MA 1BPDA 4ZTJA 3NCIA 2JZBB 3PW5A 1NKBA 4EEYA 1SKRA 3NH2A 4BE1A 1BPZA 4KTZA 5JS2A 4YN4A 3MXJA 4I2JA 1XSPA 4CJKA 4N47A 1S76D 3EPGA 3SI8A 1FXXA 3B0YA 1LWFA 5SWMA 2V4RA 4E1MA 4CGFA 4DMNA 1C1BA 1ZQHA 3RWUA 4FJ5A 1V9PA 4AHTA 3VQ4A 3V9SA 1RDAA 4TQSA 4CFBA 3RJEA 1Y88A 3AVBA 3ZT4A 4KTQA 4QWAA 2ZE2A 3VQ9A 4J9SA 4FJNA 1MQ2A 5DBAA 5IIJA 3RJFA 3MDCA 2YKNA 4NCGA 3SPYA 4C8NA 2Z1GA 4ECWA 1RDDA 4MFFA 4K4GA 4ELTA 4ED6A 4O0IA 1BL3A 4I7FA 5DB8A 2FMPA 2Z1IA 1KRPA 1ZQIA 4IRCA 5FRNA 4F4WA 3PX0A 1N48A 4YFUA 1SZPA 2W42A 3TI0A 1RT6A 3IS9A 3KLGA 3K4GA 5KT3A 4PGQA 3WNGA 1RBRA 2OA8A 3OSPA 3OYFA 8ICPA 4AHSA 2VWKA 3MABA 4CGGA 4QZDA 4DU4A 5KG3A 1VSEA 3AO5A 2BPGA 2F8SA 3NAEA 3V1QA 1AROP 4RUCA 3L2VA 2VG5A 4JV2A 2JEGA 3OS2A 4FCYA 1RNHA 2KZZA 4CE9A 3RB0A 3DRSA 2E4LA 3ZT0A 4FK4A 4KN4A 1UA0A 3MGIA 4YVZA 3H4BA 1SL1A 1B43A 4EBDA 2AQ4A 4CK2A 2A1JB 1XU4A 1KLMA 1XC9A 1J53A 5KI6A 2ITGA 3AVNA 1C1AA 4KI6A 4DL2A 5KFBA 3TAPA 1EXQA 4XRHA 5DBBA 3RH5A 1BI4A 1S6QA 4XIUA 1XO1A 3N97B 3K5MA 5HHIA 1WSHA 3P83D 2ZUDA 2ZQBA 4KN7A 2FLNA 3ITHA 5IIIA 1J9AA 2BKEA 1TGOA 3MEEA 2BQUA 4CERA 3ZSVA 4F3TA 5DBCA 5KFUA 4E7JA 2J6UA 4CESA 1LWCA 4W5NA 3ZDDA 3DOLA 2E6LA 4YMOA 5HMMA 4NM1A 4ID1A 4HVJA 4KFBA 4YXMA 1LB2B 9ICWA 3LK9A 2XY6A 4IG0A 4FJ8A 4DL3A 2YNHA 5DQGA 1SKSA 4FO6A 4LVSA 2R8GA 3HP9A 4HCBA 2WOMA 4R8UA 5HLFA 7ICIA 4FM1A 4FJLA 5HMLA 3ALYA 1T3NA 1EX4A 2HNYA 3MEDA 3G10A 4DTOA 5DLFA 3K5NA 1W9HA 1ITGA 4TUPA 7ICMA 2D0AA 1RZTA 1A5VA 3GV7B 4E7KA 4Q8FA 4BXOB 2OPQA 2QK9A 4ED8A 1ZQDA 1WSEA 1L3TA 1WN7A 3K5OA 4M3XA 4EYIB 4W5RA 7ICUA 4ZHRA 1KFDA 2RF2A 1NK5A 4H4OA 4EBCA 3Q8QB 1GOAA 3AO4A 2HHQA 1X1PA 3SUOA 4M9LA 4KLQA 4DS4A 3QEBZ 5HRRA 3ZT3A 4CHZA 1J5OA 1ZQRA 4RW6A 3AU2A 4DU3A 4FLZA 2YV0X 5KFQA 2OZMA 1S0NA 4GC7A 2AGOA 7ICHA 4GMJB 3CM5A 4QZ9A 2PYLA 1SKWA 3CFOA 3RB6A 4FBTA 5BPCA 4FLXA 4HYKA 3HVRA 9ICXA 2B5JA 3SQ4A 5FROA 4JRPA 3BQ2A 3WNHA 1GOBA 4KHNA 4Q0BA 2RKIA 3Q8LA 3LPUA 4OJRA 4I2HA 3PW7A 3QZ7A 4EBEA 1L3SA 7ICRA 1WSFA 1JL1A 1RPLA 4DEZA 4FLVA 3DLEA 4M9GA 4KB1A 4O0JA 1HYSA 1ZQOA 3NE6A 4F4XA 4IKFA 3Q8KA 4GVMA 3PNCA 4CF0A 1IKXA 2RDIA 3DOKA 4CJVA 3PX4A 4DF8A 5J0SA 4TUQA 2AGQA 2HB5A 5C5JA 8ICGA 2HVHA 3ZSWA 3AA3A 3C2LA 4DSIA 2Z1JA 3M8SA 1K1QA 3UXOA 1MSWD 5DGBA 5KGXA 5T7BA 4FJGA 4MEXA 5KFHA 4LSLA 4AHVA 1NK0A 1ZQVA 8ICSA 1KFTA 2W8KA 4UB2A 4M6WA 1EETA 1NJWA 4M42A 4DLGA 4RT3A 1IH7A 4RG8A 3OS0A 3GIIA 2D0CA 3HPOA 3M9MB 4AHUA 5SZTA 4GC6A 1WAFA 3VQBA 2DTUA 1FKPA 2Y1JA 4PGXA 4CF2A 3KHRA 3LAKA 3KKRA 4DTPA 3TAFA 2IAJA 3SI6A 1QTMA 4KHQA 1K6YA 4RUAA 2V4QA 4KLOA 2FMQA 2VANA 2I1QA 2BPCA 3VA3A 5FDLA 1RYRA 4FJMA 4UBBA 2QXFA 3OYBA 4CJWA 2MUTB 4DTRA 2X6NA 2PI4A 5J0WA 2B4JA 5KFEA 2AGPA 4J9QA 3SQ2A 4XQ8A 1JLFA 3PW2A 4JV0A 3RMAA 5J2JA 2OPRA 2VA8A 3U6FA 4BDZA 2Q3SA 4CJLA 5KFAA 1Z00A 3H4DA 3UQ0A 2JEFA 3CFPA 2FC0A 1MC8A 3PW0A 5C24A 2IA6A 4NLZA 4PHEA 2XRIA 4YMMA 2KTQA
chains in the Genus database with same CATH superfamily
4FPBA 5KFTA 2V2VA 3TX0A 2JLFA 3JSMB 3NGZA 2ZOGA 6FD1A 1HIYA 3H7HB 3KG1A 3R9LA 5B5EU 4C8LA 1KAYA 2H9ZA 2AF6A 2YX6A 2DFHA 4PKGA 3K59A 4YB6A 3VZHA 4KHWA 3M8YA 4JKHA 1JJ2M 4DUZK 4GRSA 5J0YA 2F4FA 3ZSRA 2LQ8A 4ZMMA 2E5LK 2WVFA 2BGWA 2CN1A 1AW0A 1BQMB 2KRBA 4CZCA 1L6NA 3ZZZA 3SCXA 3MM5B 3EO3A 2IVPA 1NDPA 1CJTA 1EP4A 2MKYA 4YXJA 1YBAA 3BGLA 5C7PA 4HT7A 1ZJMA 4ZVEA 4B1WB 4ED5A 2NLXA 1TUWA 1S9FA 3HJEA 3OTOF 2CKWA 3NUQA 4EO8A 3FCVA 4I69A 4RPYA 5IIMA 2H65B 4WQ4C 2YI1A 5GAGI 3KOOA 1W25A 1YVFA 2IHNA 1EO1A 4WZQA 2CZ9A 1BDGA 3DOMA 3D1QA 3ISNC 3QU2A 3EZWA 2EH9A 3GV8B 2E8AA 2YNIB 2DNHA 2HMIB 2NR0A 2YBVA 1QD1A 1UCNA 3CJ2A 2P5OA 4ZN1A 4LF7J 3CB4A 2E20A 4QWBA 2YKMB 4EP5A 1VQ4N 2F8LA 1QAXA 4NRTA 1BWEA 4GKKJ 1OMSA 4DPXA 5RUBA 2VYPA 3CSKA 3W7BA 3I82A 4DV5F 1UAXA 1FWKA 3CWJA 3LP3A 3KLIB 1IXKA 2M5YA 1R0AA 2ZJ8A 4KITB 5T14A 2VB6A 3C21A 1HNIA 3NVVA 4KGMA 3A3PB 3A0HU 1S10A 1TKXA 5ADZA 4RKUC 4CZIA 2HK3A 1DURA 4CD3A 2FVCA 2BE7D 5KQDA 3THWA 5HP4A 1P1TA 2GMHA 3P49B 2EW9A 2O8CA 8ICWA 2ZM6J 3BO2A 1JRPA 2QX0A 2CYYA 2ZFHA 2E2NA 1ICEB 4YCXA 4OX7A 2DO0A 3SEOA 2A1JA 4DFKA 2F8HA 1RU1A 5J2IA 4MJKA 1S4EA 4CJEA 4YFKA 4X4NA 3DCAA 3K58A 3DJCA 4QWEA 4GKKK 3IRWP 3PV8A 4LSZB 4QJFB 5L1IA 1QVGR 1VQ7S 2DY9A 5GADU 4H8KA 4CJTA 1MROA 1OSCA 4ZCIA 1HARA 3NH1A 2I6WA 3N7PD 4PWWA 2LCWA 1RWUA 5KFDA 4NLQA 1YJ9S 4DKWA 4PL2A 3Q8RB 3GJSB 4I2DA 1HL6A 3KDOA 4B9TA 1CBKA 1GMUA 2E1YA 4C4SA 5A8WA 2AEJA 2ZM6K 4ZPBA 3P6YC 2OM6A 3MGHA 1ZPWX 1CZAN 4F02A 2NUHA 2LECA 3I0RA 2VFVA 3SYZA 3DI6B 2A5XA 3ZSXA 4ALZA 1VQKS 2R7QA 1K5OA 4OVLA 3WC0A 1SQEA 1WOOA 1ZRNA 3BGUA 4DV4J 3IXQA 2LDYA 2UUWA 4NYFA 2WF7A 1CI4A 4QW9A 2HVDA 3CQXA 3M8ZA 2A1RA 5CB1A 4XK8C 3NS6A 4N41A 1U1MA 4FWPA 4IJNA 4CGHA 1RT7B 4LREA 3CCLS 2R7XA 4CHYA 2ZH1A 1Q82T 3R5CA 5ETVA 2VDIA 2CJAA 3V72A 4JI0K 1D9DA 1RWMB 1SB6A 1KD1O 3M2VB 3V6JA 2R7OA 2NYVA 3UKRB 3CJ3A 2E5JA 2O6KA 5JRTA 2QE5A 4M41A 3LALA 5IIKA 2QV6A 1IKYA 4OYOA 5KG7A 1QY7A 1JKHA 3ADAC 4GMKA 2C2RA 4ZP9A 2D3O1 3HX0A 1NGIA 9ICAA 1S1UB 4DV4K 2AJ0A 2IVOA 2DFFA 3HM9A 1JLQB 1FRMA 4FZVA 2PYJA 3O0FA 2IMWP 2GA7A 2B0CA 1KBRA 1ZA1B 4ZJOA 3EZ5A 1M5HA 1FRKA 2R8IA 3MFIA 2LYBA 5AXKA 5LL6Z 1GLJO 4QR2A 2QWMA 2HPUA 2DH7A 4NM2A 4Z6CA 4TNOA 5ALNA 4IQWA 3KNAA 2V6AA 2AW0A 4YOXA 5H2FU 3BGRB 3AAWB 2FI1A 2DNKA 2I8EA 4YDDB 5KPTA 8ICEA 2CDRB 2XO6A 3SSQA 2XM3A 4DQIA 2YKAA 1BUPA 2YMLA 1Q16B 2B6AB 3HM8A 2APOA 2H3IA 4E7HA 3PHTA 3H0MB 4RZRA 4L3NA 1NHVA 1WEYA 2WUSA 5GVQA 3AA4A 3T6BA 3KKAA 1RP5A 1GMVA 2WONB 2GGPB 4JI2J 3QLHA 4OI0A 3LDOA 4C0ZA 1R3NA 3I33A 1ZM9A 1IBLF 1Z2ZA 4NXMF 5H9EJ 2ZZTA 9ICIA 4FJIA 3OSNA 4FJKA 4K4YA 2BZ2A 2D9PA 5B08A 4R65A 3CG7A 2OTJN 4EUVA 8ICYA 3FBFA 2F9TA 2QL7B 3UE5A 4LR7A 4TU9A 2OMLA 3A1YG 1X0PA 1BG3A 1SV4A 4AXJA 3H90A 3BQ0A 2RS2A 2K2PA 2LQJA 4CO4A 3DLKB 3CCJS 3E9OA 4EENA 5BRFA 1T9TA 3K0JA 1GLEG 2HS0A 2BJ3A 4CFCA 5EHHA 3DXMB 2IRXA 3RUBL 1TFYA 2WC9A 2WVEA 1S1XA 2IVFB 1XMBA 3HVWA 4JI2K 3FKBA 3HHDA 1IO2A 1BPEA 3LPTA 4LF1A 5DB9A 1UZHA 2GIQA 3AOCA 5H9EK 1LAWA 2FF3B 5JUMA 5H1SQ 1M0SA 4B3SF 2YX7A 3IM8A 2VGNA 4NZ7A 3P96A 3QEIA 3T79A 3EGWB 3ZO7A 1NB2A 4TXSA 2MY7A 3D45A 3PLAA 3BZKA 2E7WA 2G0IA 4FXVA 1RBTA 4J9KA 5DZ6A 1YBTA 8AT1B 2UYTA 3LPYA 4ECYA 3GZFA 2G8KA 1DLOB 3L3CA 3DYAA 1OVYA 4NLVA 2ZE2B 5AE3A 2CVIA 3N6LA 4ZVQB 5D8HB 3ID8A 2RRAA 3CO0P 4QZHA 2VJUA 1VQPS 1X3MA 3BSCA 2A40A 3DM2A 3DN9A 5L1LA 5ALUA 4MKBA 3FZHA 2XWYA 2QM1A 4IOCL 4FZZA 3MPWA 4DOCA 2CNNB 3BUZB 4N8OA 4MKVA 4O3OA 1RFQA 5AR0A 4CZLA 3DDKA 2B9XA 1PG5B 3R27A 4O9MA 4JI5J 1SXLA 2IGIA 3I31A 3WQPA 4RQ4A 4UF4A 1L7MA 4TYAA 2VG5B 4KH5A 3FEZA 5M1PA 1N0VC 4ZCMA 3NGYA 4TN2A 4RBUA 1T3VA 1NGHA 4ECTA 5IQQA 4DHYA 2B4PA 1ZQUA 5LSOA 2GO8A 2NRXA 2C1EB 4IEEA 4CBWA 4YHHJ 5GAEP 4NB4A 3Q8YA 3G71N 2XI3A 4I2PA 2IMOA 1S6QB 1F9EB 5CWRA 2LPEA 2JXJA 3QINA 4FJ7A 4UB4A 3G8SA 1XWLA 4BBYA 4JI5K 4L3KA 2FY1A 2ZJRQ 2XQCA 1UPPA 3UCUP 2WB4A 3MEEB 5BR8F 3UPQA 4BGBA 4QYRA 2BCRA 2B8PA 2RQCA 4LF8F 1XMQF 2DGZA 3W0LA 1S5ZA 2PKEA 2YB4A 2DISA 1GK8A 3IV6A 3HXMA 3EYZA 4YHHK 4AYBF 3HSJA 4JI8J 3KWGA 2ZEJA 2JC1A 3GWCA 3W2VB 2OJ3A 4IXCA 1ZQZA 2ZVSA 1WG4A 5I3UB 2KSOB 3O9RA 1URRA 3KFWX 4X4RA 2BDPA 4C7QA 2C3OA 1CXQA 3M8QB 3QU5A 4LZDA 1B9DA 5AHXA 1HNXF 2A6AA 3ZTQA 2BCVA 3OXGA 1FK9B 3LGNA 4IQVA 1OXJA 1JN3A 5AI5A 1XSLA 3RAMA 1OUQA 3IWLA 4FN5A 3E0FA 4WZMA 3AVMA 2RF2B 1Q8IA 2UXCK 4P4MA 4DV2J 1ZRMA 5ALHA 3K8VA 4E19A 3QNOA 1H2TZ 4JI8K 2J0SD 3B9JA 3BQTA 3VEYA 2MQ8A 2VDHA 4DV3J 2Q36A 5G5GA 5KT2A 9ICEA 4RW6B 2LKZA 2MEWA 2EAPA 3BS5B 3MM9A 4URSA 2KVSA 2QLJB 4FWRA 1KR4A 3SNNA 2GVZA 4NXZA 2KHCA 1HNZJ 4DV1J 1I94J 1M6YA 2JX2A 4KBIA 1Q5VA 4Q0BB 4FYVB 3F73A 1B0XA 5L39A 2WHEA 2Q6CA 1HIWA 3KLFB 3QFUA 4BRQA 3CC7S 2AP1A 4UAZA 2R7UA 4IEIA 4KLDA 2PAVA 4K4IA 3VESA 4H5WA 2WAQF 2ZTCA 2G5HB 2CQPA 2XMJA 3GQCA 4DV2K 3SQ0A 1A76A 2E2QA 1WUUA 3QRQA 4WFZA 1SXDA 3DOKB 3M1VB 2AU0A 3D0IE 4DV3K 3ZNUA 3VAFA 1HNWJ 2HEKA 5EOYA 4M5MA 2R7SA 4CLFA 3AB2B 5BRDA 4DL5A 4G1QA 2R18A 1S1TA 4F5RA 3RH6A 1LW0B 2FSJA 1HNZK 4DV1K 2QZ8A 1I94K 2NNWA 4JV5F 4PQAA 3I55S 3JAMY 5DQIA 3T1HJ 3EVOA 3LZJA 4MIAA 2J7UA 5D4LA 4RUHA 2ADCA 1ASWA 3Q7CA 2GHWA 3HDSA 3M05A 2D3UA 4I56A 3C16A 5J2FA 4H5RA 3JSRA 1YLXA 2A1AA 1RZMA 3WU2U 4P10A 1WCLA 5JLHA 4EHTA 3PFOA 5J2BA 3JPSA 4ZCKA 5AM1A 1TL7A 2P9KA 5HO4A 1HNWK 3E01A 1IQZA 4L75A 2ZC4A 1J27A 3KFUF 2UVUA 3KTQA 1DJ0A 2AJ4A 2ZUAA 2E88A 3A3OB 4JKBA 4QR0A 3T1HK 4W98A 2X1GA 2ASDA 3V9UA 1RWPB 2H4YB 1HYVA 2YQ1A 3O1WA 4ELUA 1NZPA 4UUWA 4WYWA 4OJ5A 2OWOA 4OYPA 2IVNA 3LGHA 4DCJB 3KK3A 1Z19A 5C24B 4O5KA 2H5IB 3UNYA 3PIOL 1QVGM 4B08A 3D2WA 8ICRA 4KH6A 4O3SA 4QNLA 5KAIU 2FC9A 5J2QA 3KIOA 7ICLA 4CRJA 3SK3A 4QZ8A 2RS8A 1NGEA 2BUPA 1BMQB 3ZEUA 2F8MA 1QUPA 5GAEI 4I6MB 4JP8A 2QWPA 4USMA 1ZTWA 4ICLA 1FNXH 2RN2A 4KV8A 1F2GA 1AA1B 3TTCA 2LM4A 2FHKA 1KKXA 5JVHL 5GTHU 1L3KA 1WHWA 3H8SA 3NBPB 1S57A 3D28A 3RZAA 4O23A 1P6TA 1U1PA 4IG3A 3KHYA 1BISA 2GO7A 2YXLA 1MN7A 1HKCA 5KFNA 3HVTA 3QAUA 2H54B 4ATNA 3HTVA 2GLEA 4R79A 3CM6A 4M1KA 4OZ0A 8ICZA 2Y9UA 4XH4A 4NLKA 1FFSB 4ECUA 1MN8A 1HWJA 1FEHA 3MAAB 1Y4ZB 1HYZA 3KJVA 9ICBA 4OX9J 5HRNA 3I5BA 4IQUA 4RW7A 4NLXA 1RT4A 1R27B 5J2MA 3FSYA 3R8YA 1FERA 3KVGA 4DU1A 1LVHA 3FUYA 5LSLA 1SIWB 2BPFA 1D9FA 1KVIA 4DHVA 4HUEA 3MMCA 4PGYA 3JYTB 2Y9TA 3THXB 1L3VA 2XMWA 3MDFA 1WNEA 4Y1DA 7ICVA 1T03B 1Q1KA 2RUGA 3U9DA 2FJVA 3IR5B 3T19A 4RQ6A 4PEOA 1S97A 1P27B 1WSIA 3AD8C 1YJUA 1NEEA 3BJYA 1WOQA 4NCBA 2IY5B 1HWKA 5E3AA 3GZ7A 4ZS6A 2IOHA 3RW6A 2F9JA 4OX9K 2GH1A 2VKQA 2BJ9A 3BS7A 2ZH6A 1ZH5A 4OQJA 3VTIA 5BPLA 4B6JA 3L0QA 1B7FA 5ITHA 4CP5A 3OR1B 2LYAA 1KNZA 1REVB 3ASMA 1SV5A 1ZQSA 5AK5A 3QJLA 2E29A 1RHQB 4LFAF 3AVFA 1HNVA 2PMZC 4P52A 3QZ8A 4F72A 3ENHA 2JWKA 1C0TA 3UMCA 3I96A 1SC6A 4HLBA 2M9NA 2CNOB 1WORA 2HNDA 3U1MA 1Y9OA 4RW8A 4I9QA 1HMVB 2HURA 5J2NA 5LT5A 1HPZA 4WXWA 4L6V3 4LF9J 4C4TA 3UCZP 8ICIA 4IH7A 3J80Y 2P9NA 1VQMS 4Z2XA 3PO4A 1ESVA 3LF0A 1YIJN 1KOOA 2XYHB 4DV0J 4X66F 1TP7A 4B02A 1LCUA 1RDCA 3E2EA 4QZEA 2YMQA 4UB3A 2J76E 4CVNE 4AYBD 3QICA 4NMXA 2A41A 4WQ5A 1NK7A 3AY0A 3D2NA 4QZIA 1XMOF 4DTNA 3K0SA 3NCPA 4DR7F 1YTAA 5KFMA 4PQUA 4QBUA 1WF1A 2E1CA 3VOVA 2CPDA 4IL6U 2R7RA 4BRGA 4RT2A 4LF9K 4LRDA 2RP5A 3A4TA 3BSOA 2WMMA 3MURP 3JS9A 3AGKA 3CJQA 1RTJA 4UAYA 1WOPA 5KG5A 2PA8D 1SKUB 4Z94A 4HCCA 3M6UA 5AZJA 3KG4A 4W5OA 1Y3KA 3EPIA 1ZAWA 4DV0K 1U0HA 1U45A 4M5DA 1IBMF 1N36F 3CO9A 2EHGA 2ROPA 4LRCA 4JKCA 4PY5A 8ICQA 2H5XA 2KU7A 2R42A 2LQ5A 2RRDA 2I9SA 2QMWA 1YVUA 3P8BB 2ATCB 4TY8B 4IOCQ 1G15A 2XI2A 3EWGA 4NCGB 5A0YA 1HW8A 4RW4A 2EAOA 4YQWA 2ZWHA 1MA7A 5EU7A 1KVCA 1FEEA 3W3DA 4ZP6A 3CVKA 5MLCV 1P8ZA 4JWNA 7FDRA 1Q5YA 4DOBA 1E3MA 3P5TL 4NLTA 3SMPA 5F8LA 2N4DA 1T9WA 2XYGB 2RT3A 4RQ7A 3T41A 3ZSQA 4W5QA 3NGSA 3K9JA 2WAQD 2QLXA 1RDUA 3BREA 4BR9A 1TVAA 4AT1B 3T5JA 1N34J 4GLXA 2R8HA 4RU2A 3VETA 3L6QA 2G8FA 4ZP8A 4ZJQA 1RAJA 3TADC 3MEGA 4YOVA 1Y97A 2I7NA 5DDPC 3CULA 4B9SA 4RJVA 4JI4J 1PBUA 3CJRA 2MZ1A 1S7HA 4A62A 5DDQC 2I1RA 3TR8A 1YT3A 4DR3J 1WB9A 1TV9A 1ULRA 1BA1A 1RXVA 3TUPA 2CQDA 1R8AA 1PBAA 4BR4A 5BOLA 4M5LA 4DSLA 2XHWA 2J9CA 4KY3A 4F26A 1RYUA 1N34K 4K41A 2RHQB 3HFKA 2P6UA 2L9DA 3UMBA 2E2PA 2QSWA 5K14A 3G4SN 1RT5A 2OSRA 3NNCA 3F2BA 5HI7A 1S0MA 1NOZA 5J2AA 4CI0B 2QL5B 1U1NA 2DB1A 3DHXA 1DARA 4DBQA 2FZKB 4JI4K 3NAHA 3HKZF 3TABA 3H46O 1VHIA 2NRTA 4A47A 4GXJA 2COLA 5LM7E 3LZIA 4DR3K 4MYTA 1KVBA 2Q6BA 4ECQA 3M1FA 2V8DA 1NJZA 1VS3A 3J80U 4UQGA 4FM2A 3H5YA 4Y0FA 3G6YA 1VRUA 2OIHA 3H2VE 3G9CA 4CHQA 2P9IB 3VF6A 2J4RA 2MLYA 1T94A 2A3JA 4ZVGA 4NLWA 1VQ9N 1KQGB 1XO0A 1BPBA 5AM4A 5AQOA 2V51B 4O44B 4HKQA 4A8WA 5E41A 9ICFA 3V9XA 1TFRA 3I9V9 1COOA 4UB1A 1XQIA 3VVUA 1OY9A 1M1HA 3TACB 1KAZA 5IWAJ 2F5GA 3L4PA 2J6TA 3G96A 5TKWA 1U1KA 4CEQA 5CCMA 1NJIO 1NZBA 3MAHA 3B54A 3H5SA 3ULEB 1OQ6A 2KW4A 2DH9A 4O5EA 2KQ2A 5FLXO 4CNZA 4IFVA 4M5JA 2L3MA 3AEVA 5GMEA 3ISBA 2GS8A 2C3YA 1HLWA 3LDQA 4WBFA 2B6GA 3CCUN 1BGXT 1XR7A 1BHNA 2RUSA 2MDAA 2F4VF 3VQ7A 2KI2A 3QGIA 7AT1B 1E4GT 3H2UB 3S3MA 4FK2A 1YITS 3AH6A 9ICOA 3TANA 1NM1A 4E1NA 1QZ6A 4DX5A 4KLEA 3AVHA 3LP0A 1H7XA 5CYMA 2UUBF 1V5IB 3R9PA 2I5JB 3RSEA 2HNZA 5IWAK 2NXJA 2PA3A 1FRJA 1U25A 4TQRA 4RPZA 4LSLB 1MDUB 5EVZA 2O8EB 3PHEA 4KPCA 4F36A 2JWNA 2ZIXA 4YNQA 2W8LA 2FBXA 3L7PA 2F40A 1NBWA 3NWRA 4IKAA 3WXIA 2F96A 1S1WA 3KK1A 4BVPA 2OPPB 1U6FA 4MFCA 2QEXS 1VQ8S 5KG2A 3CMEN 2XO7A 1WWUA 2CXEA 1RB0A 1VAZA 2M2BA 3L3FX 1M5VC 1CC7A 4XTTA 2JV3A 3KHGA 4YR2A 4AHCA 5J2PA 9ICTA 2M0GB 3FR0A 4WCEL 5KFGA 4RW9A 1ZQWA 4CK1A 1B4SA 4Z4FA 4C8ZA 2PT0A 3OVSA 3PRDA 4ED7A 4J9NA 1JLFB 1WF0A 2C2MB 2KM8C 2OPRB 1GLFO 2W7AA 2EI5A 2MZQA 3QO9A 2PMHA 4WFBL 3U1LA 3MX5A 2DHHA 2LU1A 1XC3A 1Q86O 4FVMA 2CFXA 4PWDB 4FJHA 4M95A 3FRZA 5IC4B 1UVMA 2QA2A 1FDBA 3G82A 2VIXA 4ZCLA 2P9PA 4R63A 2VL1A 4BDYA 2QRRA 4UOCA 5J1EA 2PO4A 3K5LA 4PHAA 2JHDA 2ZTEA 2JOQA 3SUQA 5AKXA 3TA0A 3VAKA 3EX7B 3CCTA 3DRPA 5HVHA 2DD8S 2LI6A 3VF4A 4UB8U 3D4JA 1XS9D 3MMJA 4O3NA 1TELA 3V2UC 3LDAA 3O1BA 5JVHQ 4NL9C 4GVEA 1J2NA 3AAPA 3BR8A 1EP4B 3VGVA 1BPDA 5AK3A 1PYOB 3CC4S 1RQ0A 3IC1A 3PW5A 1VBYA 1GXUA 2AXTU 5FIIA 4C3KA 2KHQA 2V63A 5CXTA 2FE9A 4MKAA 2YHYA 4KTZA 4QU6A 4YN4A 5AI4A 4P6QA 4L72B 4CJKA 4NZ6A 3EPGA 2WB1F 1TKTB 3FSXA 5E79U 2WW8A 1LWFA 2QYCA 3W9JA 4P2FA 3VALA 4E1MA 4B1ZA 4IYQA 2BACA 1RDAA 3DOMB 4I6YA 3ZT4A 1B0TA 5IC6B 2LDIA 4QWAA 5HMXA 5DBAA 2KVCA 2P2CB 1YHQS 3R1XA 4OV1A 1ITPA 1MNEA 4BS2A 1TYQA 1YJRA 1HBNB 4I7FA 2OHDA 2Z1IA 2Z57B 1URJA 3WC2A 4F4WA 3TI0A 2CNKB 1NB7A 5KT3A 3WNGA 1RBRA 5KOXA 2OA8A 2E8OA 5AZIB 1E6VB 4CE6A 3DLLL 3LP2B 1RBLA 1HNIB 4AHSA 4OYZA 3MABA 5KG3A 4A8KA 1VSEA 3V1QA 1TKXB 4OIXA 2EVZA 4J90A 1N5VA 2F8KA 3OS2A 1KS2A 4H03B 1YRTA 2KZZA 3K5PA 3QB0A 5B0EA 3DRSA 1FXRA 2E4LA 2Y8YA 1X7VA 4FK4A 1XR6A 1YF5L 2O8CB 2LA4A 1UA0A 4YVZA 1RHJB 1SL1A 2GAHC 3NNHA 4CK2A 2A1JB 3N4WA 3TVYA 1UCVA 2ACMA 1U7LA 3AVNA 2YH0A 1C1AA 2XHCA 4KI6A 3I76A 5E2QA 3TAPA 3CDUA 3RH5A 4XIUA 3K5MA 3OHRA 3MM8A 3RW7A 3MUMP 2ZQBA 4XO0A 1O0PA 3ITHA 1G1XA 3OD2A 3E1YA 2QFIA 3EVMA 1R0CB 2HRUA 4DN9A 2R2TA 3CC2S 2E1EA 3TNVA 4CERA 5K8MA 2VUGA 3FLCO 4F3TA 2WF5A 2KK0A 5KFUA 2E5LF 3IBPA 3UMGA 5A2QY 1LWCA 4W5NA 2OLWA 3DOLA 4YMOA 4NM1A 2GVDA 4ID1A 3BEXA 4IG0A 1Z4UA 3I0RB 3MMBA 5DQGA 1SKSA 3Q2SC 1X6JA 2P9CA 2POKA 1PSDA 2G2YA 4M5KA 2HOFA 3M30A 7ICIA 4IO8A 2DEIA 1QAIA 2HNYA 3WXMB 3FBEA 3MEDA 1YJTA 3FBBA 7ICMA 1E6YA 2RDDA 3W1YC 1UEKA 4Q8FA 3NG8A 2OPQA 4IDHA 2QB0A 4EYIB 7ICUA 2UXBJ 3H3OB 3LO3A 3P31A 2JHEA 2UUTA 4YB5A 3AODA 1FTRA 2EZYA 5HR7A 2ZNYA 1HI1A 1BWVA 1X1PA 4OHXA 3OR2B 1R6VA 4OI3A 3ET6A 3ZT3A 1J5OA 1JCGA 1ZQRA 4AE5A 5IM0A 3ENQA 1PYSB 1EQYA 3FC4A 1JJ4A 4FLZA 2OZMA 3U7JA 4GMJB 2BMBA 4QZ9A 2X7IA 1SKWA 3CFOA 1KL9A 5BPCA 4FLXA 4HYKA 9ICXA 1J2MA 1V3ZA 3BQ2A 2W3RA 4CZHA 2VU5A 3WNHA 1HHSA 2RKIA 4PABA 4OJRA 4I2HA 3PW7A 3PNIA 4EBEA 1S4FA 2OI2A 4NYPA 3CXCM 4DPTA 1ZAVA 4HDGA 2UXBK 4CLSA 5C2CA 4OZJA 4FLVA 4DL0C 3PSTA 4M9GA 1HYSA 4KB1A 4F25A 3VEZA 4IKFA 3Q8KA 2Q1LA 1IKXA 3HHNB 2FF6A 2W04A 2B9EA 4DF8A 1RISA 3UVJA 3Q22A 4TUQA 4GKKF 4WPAA 2HB5A 3J7ZO 2JR5A 1T9VA 2CDQA 3THPA 4P0PA 2Z1JA 4BJQA 4BGAA 2IM0A 2ASPA 5KFHA 1NK0A 5D4OA 4UB2A 2R2RA 4M6WA 1EETA 4ZPCA 4RG8A 3OS0A 5AXMA 1UWAA 4DCPB 2HK2A 3MX2A 4GC6A 1Z4NA 2ZM6F 4BQLA 4HL9A 3QLHB 1QTMA 1KP6A 4OPAA 4KLOA 4JAXA 5J8YA 4XPEA 2I1QA 2BPCA 3VA3A 1OSDA 1MMNA 1FDDA 3A8KA 4DTRA 2YWGA 2ZKTA 3CTRA 2GJIA 2W4DA 2B4UA 3IMQJ 5F8JA 5JTIA 3TZYA 4ISGA 4DR6J 2CPZA 2DT9A 3ZTOA 3I8BA 4CJLA 1HPMA 3CFPA 4JI0F 2LQ9A 3R5BA 4HWIA 1S1XB 4DMZA 5ALRA 1YJWS 4PHEA 5A2QU 2CUYA 3X1LB 1RKIA 2GJ2A 2GAGC 3V6DA 4O3RA 5I42B 3TTFA 2W2PP 1KQQA 2KDOA 4US8A 2XB2D 5AKYA 4O3PA 2H5JB 4LIWA 1S8OA 2LXFA 2G2ZA 3D0GE 4C11A 4CZGA 2HWIA 1S5JA 2QB1A 3J8AA 4IJAA 4CZFA 5AQTA 3JTPA 1SXEA 5D4PA 7ICKA 2NXEA 2YWKA 4I2QA 4DR6K 3C8YA 1JLAA 3DYAB 1HBMA 3I4PA 3DC2A 3OBWA 1O5JA 4DF4A 3L2RA 2MKJA 4RNOA 4CEOA 3WEEA 3NF7A 1RACB 4CJ5A 4Y6IA 3DM2B 4CGZA 3AD9C 3V4IA 4NLGA 1PVRA 5K5MA 2NYHA 2G8WA 2HFSA 4KKOA 3WKCA 1U47A 1FE4A 1VSHA 5A8KA 3H8WA 4FF1A 3EL2A 1PK1B 3OY9A 1LW2B 2UP1A 2XICA 2HI0A 4J9PA 4ZTFA 2W6KA 2YNGA 1CUKA 4NE9C 3F5AA 1JCFA 3FZFA 4C8MA 1VQ7N 4DFJA 3CRXA 3IA0A 1QH9A 3WK8A 3WNFA 7ICOA 1RT2A 1DT9A 4XH1A 5JVGL 3UI3A 4WFNQ 2QA4G 5GADP 1DGSA 1YJ9N 1DRZA 4O5CA 4X62K 4KO0A 4JMUA 3AO1A 5D6GA 4Z4GA 4WCEQ 3C5GA 3U1NA 2ZH3A 2ZITA 2BW7A 3PYDA 4KHRA 4KLHA 3DV9A 2ILYA 4V19X 3ILLA 1QSLA 1NSPA 3D6TB 4YMNA 5GIOA 1UKUA 6AT1B 3MMAA 1VQKN 2FPHX 3QQCD 4B9NA 2RMLA 3QRRA 1UOCA 3N7RC 2IJRA 3MXHP 4PKDB 1Z6RA 3V7LA 3CE8A 1QQ7A 3H98A 5DMRA 3DDIA 3FCHA 3WK7A 2E9TA 8ICNA 2EAMA 2GJFA 5FPMA 5IT9O 2HCFA 4ERDA 2E1MC 5HP1A 4G6VB 4N56A 2XTJP 1TE2A 2XSJA 3QSYB 4OJPA 3I1YA 4UB6U 1Z1ZA 3PJXA 1RWWB 5AQVA 5KG0A 2H3EB 4EGLA 4TVAB 3EWAA 2RVJA 4CIFA 2ZIWA 2MQMA 4FE3A 2VJ5A 3GILA 2Y0SD 3C5FA 2OUGA 5GTIU 3G25A 1A6LA 4KGVB 3QFHA 3G0ZA 2VPXB 4WU3A 4WKYA 2Q1NA 1VQ6S 4CH1A 3CD6S 3R97A 2FVRA 5J2GA 5BPNA 1Z25A 2ISPA 3SDEA 4BROA 4O8KA 4ANDA 1X0FA 4R64A 3I56S 4R0JA 3RB3A 4A2AA 3S8SA 3FBCA 3KWMA 2FLLA 1PAUB 2D69A 1N60A 3JPRA 5HRPA 3Q8VA 1IBCB 1WSRA 2QT7A 3IG8A 2XLIA 1TL5A 3SJJA 2NUUG 2GVZB 2ZXHA 2W9BA 2QIFA 1ZQBA 1S9EA 3K17A 1I39A 2P51A 1S0VA 1V3RA 4P75A 2WAQC 2F65A 1R8BA 3VV2B 3QT8A 3H6EA 1RTIB 4YOTA 3O44A 2BH1A 2NUBA 3UN5A 3P4IA 3S7RA 3AVLA 5DS7A 4KR0B 3LGMA 3VEVA 1Q3UA 2YTUA 9ICJA 3CMAS 1JLCB 2IHMA 3WNEA 4M3UA 3I9ZA 1NRKA 1F9HA 2LVWA 3O80A 5LJ3Y 2HBQB 2J7WA 4N77A 2FY8A 3EJMA 3V5RA 3RMCA 2IFXA 3SV4A 2Y1IA 1HR0J 4CLTA 2ZUGA 3CF5L 4IWVA 5HROA 1C1CA 3ENAA 3DLLQ 1B92A 3ISDA 5FRMA 2K8AA 4PHDA 1H38A 3CUNA 4JI5F 2BW2A 1WI8A 2FJWA 4PG5A 4P74A 2AYGA 4U9RA 3D2EA 3N28A 3L7UA 2W7PA 4YR3A 1B99A 4F5QA 4USVA 2L41A 2E9RX 1OW5A 2E1AA 4NLDA 3CCQS 4TU8A 3C16B 1WEXA 5CZ2A 1KQFB 4LRFA 4M63C 8ICLA 1GT8A 1YUWA 1KN5A 3SCIE 3CCJN 1QQ5A 3TADA 4B3TF 4J37A 2OEHA 2LBOA 3B8AX 1HR0K 3FZBA 2B8QA 2JWLA 3E01B 4O4GB 3NGRA 5DKWA 1GLDG 3GIKA 2KIWA 2A2CA 2KB2A 3OT9A 3ZETB 3E9PA 3AV9A 1S6PA 4NXNJ 4Y0WA 1RBSA 3PXGa 2A6MA 3SCJE 3NGTA 5JMVA 4F67A 3QIPA 2HHSA 4ER8A 2JEIA 1ZQ1C 3SQIA 1PYTA 1FJGF 1WC5A 1AXQA 1U09A 1QDUB 3L4BC 4PXBA 3QEWA 1XTZA 1ELOA 2HRYA 2J9DE 4BWJA 4C4RA 1SJRA 2UXCF 4MEYA 4FBUA 4WE1A 3KK3B 4NEZA 1SZHA 1X8DA 4JI8F 4LQ3A 1T9YA 1VIXA 4KLJA 3AY9A 1JJCB 3RU0A 1GXLA 2CQBA 1Q7YO 2FB0A 3MCPA 3ZD8A 2CRXA 4H4MB 4RQ8A 2MUTA 3E9LA 1RTHB 4A4JA 5TZVA 4CO0A 2F8EX 3RG6A 5F8HA 4NXNK 2PD1A 3ZEUB 1X40A 1QSYA 3ENWA 3CPWM 1CLFA 4KHPJ 5GADI 4ICLB 2DQNB 9ICNA 3FYHA 2YWEA 2AZ3A 4USAA 4KV8B 1VDHA 5J2HA 1RT3A 1MG7A 2F7TA 3TEGA 3A8EA 3A2FA 4K43A 3VQDA 4CEDA 3RGIA 4I6WA 1QQ6A 2Y1LB 3KLEA 1FWPA 5M1FA 2C2ZB 2PFQA 1ZA2B 3D0HE 1NGJA 1HKBA 2QA4S 3LDNA 4JS4A 3RH4A 1X5SA 1SGGA 3SQ1A 4DX8H 1HBUA 3B8HA 1WLJA 3CCZA 1RM6C 3BPDA 3RJIA 4OZ3A 1HNZF 4DV1F 5LY3A 1I94F 3L4IA 4I2FA 2H3VA 2IOCA 3PRBA 3KJVB 1ZQFA 1NNDA 4FOEA 2YX1A 4ZVHA 1BQNA 4KHPK 5BJRA 2NCKL 5J2MB 3B6OA 2GTDA 2OSQA 5F3ZA 3SUNA 3MM7A 3LUYA 3OFHA 3CETA 4UW2A 3M2UB 5G5HA 1CEZA 3OUYA 3MMCB 4G1IA 5BR9A 5F8MA 4G65A 1FA0A 4DQPA 3W64A 1BIUA 4UUXA 1RT6B 1HNWF 2RQKA 5CP2A 1PUZA 1VSKA 1RG6A 2QMUB 4IOBA 4CLUA 4EEKA 1N5WA 1RAHB 4WJBA 1FJCA 2QKBA 4UASA 3EUB2 1Z1VA 4F3OA 3SXLA 2KIVA 4BGDA 3KKFA 3QUBA 2HS3A 4PKHA 2H3QA 4Z4IA 2J8SA 2OMOA 2V94A 3O8MA 3GR1A 4UAWA 2X1AA 1JL2A 3T1HF 3T1YJ 1TK0A 4HVZA 2EZXA 1RQLA 2CPYA 1DRGA 3K7RA 2O3DA 3RB4A 4NWBA 3BN7A 4B3OA 1AB8A 1NAQA 1IWGA 4TLRA 2VA3A 2YKPA 1NGCA 4IC9A 1HNVB 2BDUA 3VQ5A 1C0TB 1K8AO 1BUXA 3HX9A 3H3NO 1S6UA 2HNDB 5ETRA 1U1OA 1J6ZA 1U49A 2XS7A 1KONA 3KHHA 1VJQA 4FYDA 4X4UA 5J2NB 2DKOB 3L3VA 1HD0A 4BACA 2E3TA 5AK4A 2QLFB 3M8WA 2RQ4A 3KKAC 1LKZA 1OO0B 2P9NB 4LFAJ 4GFJA 3OQ2A 1TL4A 3RJMB 3T1YK 4AQYF 5IQ6A 5L1JA 2X51A 8ICJA 4BC4A 4ZLJA 3NVMA 4KFBB 3AT1B 1Z26A 4DQSA 4DV6J 2YNHB 3J7YU 3HSDA 3TARA 2B51A 5ETPA 3NH0A 4CF8A 3KK7A 1S1VA 2WOMB 1OYEA 1U2VB 5AQNA 3AJ2A 3NF8A 3MPYA 3CC7N 4CYUA 3QYYA 5AQKA 4YOEA 4CJSA 3SCLE 2A19A 4FW1A 4KT0C 4ZH4A 5M1OA 3I8DA 3TAQA 3ZI4A 2MLXA 4ZIWA 5AZJB 1P9YA 1N5QA 1YTYA 4ZHRB 1WHVA 3HYFA 1C7YA 5DM6Q 2W24A 3PJ9A 3UDVA 4EK2A 4I9LA 3WUHA 2W55A 3ETMA 1A9NB 1MU2A 4DV6K 1D1UA 5B0AA 1FF2A 2GX9A 3IAM9 3S1TA 4WF9L 3ZLJA 3R5DA 2JZBA 3AM9A 4AUKA 3I55N 2V9WA 4PKIA 3GFXA 3HI9A 3GDXA 1FKAF 3C0BA 3FK4A 3VGSA 3VCBA 5F1XA 4E7IA 4WYBA 3D6MB 4CTAB 2HZVA 3B6PA 4IOAL 1IR1A 2D0PA 1HJOA 3ZSYA 1LNQA 4OX9F 3VZIA 2CG8A 1X9JA 3HMJG 4I2AA 2JJ4D 4DL7A 2H3FA 1GX6A 1WUDA 2JNJA 1RWXB 5GAHU 3E51A 2DFEA 4ED3A 2HG4A 4OYAA 4ILHA 3N4QA 4X84A 3ILOA 1SJ3P 4ZK7M 4ZVOB 1RHMB 4HHJA 3H25A 7FD1A 4CGIA 2HHWA 1WJ9A 3IUCA 1FDAA 2YMMA 8ICTA 3T1AA 1IV0A 3CQ8A 4J91A 5MLCQ 4Z6DA 2V2QA 2HGLA 3O6QA 2HGNA 4Z4HA 3C46A 2J0XA 2NLWA 1XNQJ 4YR0A 2Z0GA 1SH0A 5HQLA 3LDSA 3IRXA 3H40A 2A1BA 5AM3A 3IFEA 3D6HB 4EZ6A 5KFCA 4IR1A 2GWKA 4QYZJ 4IRDA 4EIAA 3TZZA 2VBWA 4NX9A 1QVFM 3OJSA 2V8HA 1REGX 2WF9A 1HUOA 3BQ7A 2AJQA 2BM1A 3L95X 5FDLB 4PAAA 3VTHA 3NF6A 3TA1A 5KFXA 4LF9F 1X9XA 5MAOA 2D7SA 5J0PA 2B9WA 3B4DA 4M8LA 5DETA 3W3SA 4XAKA 3WBZA 1NJIT 5LXRA 1XNQK 2RU3A 5ALZA 3DDHA 4N8NA 4C1NK 4DV0F 1YJNN 4PRFA 1W97L 4CJPA 5L1KA 1RT1A 3KUEA 1VK0A 5AQQA 5DGAA 5KGWA 3S3NA 2AHOB 2PMZF 4KPYA 1X4BA 3QMQA 2OCEA 3AXMA 4QYZK 5KRTA 1IWAA 4OLBA 1ZQGA 2M3DA 4IS7A 2FDRA 4JD2B 2Q0UA 1NU4A 5B7WA 1C0FA 2Y0BB 3BGOP 1F60B 2ALYB 4KSEB 1ROFA 1DTTB 1N5YB 1KQSM 2KJ5A 2UU9J 1U9LA 2F1IA 5AK6A 1M90O 2FUG9 1JNZB 1UW9A 3ZSZA 4A57A 4J9RA 4BXOA 7ICNA 4NLUA 2R7YA 1VISA 2DPIA 1WC3A 3MK6A 4BC5A 4BR5A 5KPRA 3V7JA 4B8AB 2G1HA 4DUTA 2DNLA 3H08A 2O4IA 2HFZA 2HQIA 4AD6A 2O66A 5AQYA 2ROEA 2E1PA 3ZT2A 3PO5A 3KBBA 2DO4A 4LZGA 2GWSA 2WZ1A 4LSNA 4B1UB 1YJ7A 2ASYA 4P2MA 5D0RA 4RQMA 1NPPA 2BGGA 1VMBA 2AX0A 3RRKA 3RR7A 4M9HA 2G8VA 2UU9K 4C6AA 1ATRA 2W43A 4M9NA 3G6ES 2AKWB 2HLUA 2RHFA 2ZIUA 4PA1A 2F4VJ 1HJRA 3B0XA 5HSPA 1N34F 1RWOB 1ZZNA 4IOXA 3QEPA 3AXKA 3K8WA 1Q53A 4F4AA 3OGUA 2NPFA 3G6XA 1VQMN 3KK1B 3K1ZA 4QS7A 2OPSA 8ICUA 2KV2A 4CF1A 1FI4A 2W9MA 4CEBA 2HIYA 3BBBA 3C6TB 3VF0B 5D15A 2KOBA 4JI4F 3CI5A 1PJ7A 2AD9A 3DMJA 2V4JB 1PC5A 1ZQLA 3GONA 2BV3A 8ICVA 3S41A 1WG8A 2W9CB 2NRVA 1ED1A 4DR3F 7ICSA 4CHOA 3C66A 1L8LA 4RW9B 4ILJA 2WBNA 2R8JA 4O0NA 3A5LC 2F4VK 5ALQA 1N32F 4KH1B 3JPPA 1VSIA 2KKZA 3FZMA 3ISCA 2ZJ5A 7ICEA 4CM0A 1SUQB 2X3GA 2EG1A 5AQMA 2HFUA 3ZTSA 4NCAA 2EK6A 1TAMA 4X65J 2MXYA 2P9PB 3LWMA 4X64J 1SC1B 2Y3YA 2KN4A 3JPOA 5J1EB 3PY8A 1NOMA 1U8SA 4CO3A 3K2PA 3VERA 5G0RA 3A8YA 4O8UA 2JDJA 5M1NA 1RXOB 4U67Q 2G8HA 4RNHA 3NS1A 4CFAA 4P71A 3DRPB 3TYTA 5LL6d 1W2BR 3FFKB 2L9NA 4LBIA 3HWTA 1U2CA 1ZBHA 2GFFA 3DLBA 1ZM3A 3PIPQ 3SSSA 2N7YA 1U2RA 4KX3A 1F5SA 4M3TA 2K7JA 2DXEA 2RRBA 4RWWA 4CECA 3CJ1A 5DDOC 1LKYA 5D77A 3QU7A 2FHJA 3NS5A 3KZBA 2GMJA 2YHBA 4DI6A 4CLPA 4ZPWR 5L1MA 4D3GA 2I2YA 4ANEA 4KLSA 2NXCA 5IT0A 2IJFA 3L09A 4DG1B 2FBTA 1X4CA 4X65K 4JKEA 4K5RA 1H1VA 4ES1A 4E7LA 1S12A 3VAJA 3TU5A 4X64K 4F93B 3QUTA 2FJDB 3THTA 4OZ2A 3TOQA 3T5KA 2F44A 4OJLA 3D6RA 2O01C 4GVBA 1NGFA 1LOUA 4JYAF 5IWAF 4GVLA 2WRMA 3V81A 9ICHA 2QI2A 3CFRA 2R7TA 3GLJA 1UTAA 4KHSA 3CMQA 1BQMA 4IH5A 3A5OC 2XSFA 1EX8A 3MM5A 2YJFA 1ZPVA 4F5OA 2X78A 2DR8A 2NZ4A 1NK6A 3J7A1 2P35A 4DTMA 4IQMA 2RDJA 4DZDA 2MSTA 1JLBA 4K8ZA 3A8IA 1E4FT 4I7FB 4E89A 2OFGX 1Y5IB 4LJMA 3PSFA 2RPIA 2YMPA 3EZUA 4GXKA 2FDNA 3CCRS 2WFAA 2I9GA 1FJEB 2P9SB 3NS7B 4BRIA 4BRMA 1V9OA 3VQSA 1Y3JA 1QHAA 5U47A 4OL8A 4CZKA 4M7YA 1RLCL 4CIGA 5HBMB 2OD6A 3FVYA 2G9OA 2RB7A 3O4NA 1S9GB 3SAHA 2BBEA 2HMIA 3RFAA 2O1PA 2HYIB 4C8OA 4KQZA 3NGIA 4NLBA 2BJEA 2YKMA 5LMUF 3V9WA 1SQKA 2FXUA 5AKLA 5JMNA 4USKA 1WG5A 3MZIA 3WX4A 2UVRA 2VQEK 3ZYYX 1WC0A 3MI7X 3S9HA 3MAQA 4FFDA 1RAFB 2ZJAA 1O1WA 2B9YA 4NPOA 1Q18A 2RNEA 1F6TA 3RJHA 3SV3A 4FWOA 3DLHA 2DEJA 1NKCA 4ZVPB 3P39A 3OVNA 2PFFB 1VSLA 4FKXA 1U1LA 2JSXA 3ITHB 2Y0SC 2HBJA 4QZGA 1RAIB 4FS1A 1KVAA 2QWQA 4KYZA 5DQHA 1ASVA 1CJUA 3ID6A 2E5SA 2NSCA 1LWXA 1F9FA 1VSMA 1ZZFA 1IKVB 1LFPA 4QWCA 4CJ4A 3O3HA 3HL8A 4NY8A 3QFWA 4F3MA 5AI6A 5BXIA 1VHFA 1WD6A 1JXLA 1K0TA 1VRTB 5KFSA 4CQ1A 2GVDB 2XHBA 1VQLS 3MMBB 2D3DA 2G08A 1AQ6A 5GAEU 3TR5A 4CW7B 4ECVA 2CJBA 3MF5A 3HOSA 2OYQA 1VSJA 2AQ0A 2MQPA 1Q8BA 1TL1A 4ILGB 5HN0A 1TMJA 1QSSA 3MEDB 4A5AA 3C23A 1X6IA 3ONQA 2GX8A 2KN7A 1E6YB 4BWMA 4YY3K 3EE9A 2HHPA 2OPQB 1D0EA 4QR1A 2YQ0A 4Y2YA 1YITN 4UATA 2QB0B 4CT9A 3VQ6A 4PG6A 5HK4A 2LFVA 1WBDA 4WF9Q 4RNNA 2G8IA 1VSFA 3IRUA 4CJQA 1ZQKA 3DI6A 5D0GA 2HOEA 5DDMA 4ZVUB 2AJFE 2GHVC 2FZGB 1ZYQA 5IM0B 4FYXB 4NASA 4QS9A 4UY85 3BH7B 5E3QA 4IOAQ 3VENA 3N0VA 2AP6A 1JLEA 1ZXOA 5F41A 4URGA 4ES2A 2BOAA 2D74B 2G1DA 3F41A 3H0LB 2MY8A 3BO4A 3VC8A 3S6JA 2RQ5A 2QEXN 4ITSA 1VQ8N 4IDKA 2KVIA 2CH6A 1X3NA 1C20A 4AH9A 3S6EA 4FLYA 2V2ZA 3J7AN 3UQ2A 1JLGB 3VQQA 2HFNA 8ICAA 1FKOB 1HYSB 2Q0ZX 2F3NA 1R31A 1SZ2A 2MGZA 1IKXB 3ELHA 1YRXA 3H1QA 1K73O 3IG1A 5AKGA 2AEFA 1ZQNA 5EOZA 1KEJA 1XERA 2DHGA 3NLCA 4GIBA 5KFWA 3UN3A 1UT5A 1X4HA 4KLGA 4DSKA 1JLQA 4K59A 3Q0AA 4OGCA 1ZD5A 3H2LA 2EEYA 2BX6A 1EETB 2CZ4A 1JI7A 3NMRA 2KXHA 4DSEA 1Q79A 3N79A 7ICFA 4ECSA 4WIQA 4ZP7A 4F71A 2VPZB 2DGTA 5AE1A 3OYLA 4M63A 1VRQC 3TVKA 2FVSA 1NM2A 4IBNA 3BGRA 4H0XB 1XQSC 3NL0A 2HDOA 3T69A 3L2UA 2MB0B 4CO2A 5F9NA 4I29A 2YNFA 2XCAA 2V7YA 1CS4B 2LLZA 3C95A 3VGLA 4UARA 4KHUA 1UVIA 1DHMA 5ALIA 2B6AA 2ZH4A 3OFEA 1FXDA 3JPTA 4TU7A 3QPIA 5D0EA 3OLAA 2OZSA 1TKDA 2DGVA 3BV8A 4FP9A 3M3ZA 3SAGA 1HBOB 3G87A 2RAQA 3W5YA 2D1KA 3CCVS 3OVBA 5KFFA 2WONA 2MSSA 5GINA 3NVZA 3WXJA 4CCHA 3ZDEA 3VQAA 1H74A 5HAOA 1KSPA 4MFBB 4NRUA 3D5MA 3RVCA 3F2CA 5KT7A 3V6DB 3O2IA 1N8RT 3G8TA 1VBXA 1G99A 4FZNA 4NL5A 2K4IA 3U3YA 1RDRA 2ALZA 2G09A 3NEKA 3M6XA 4I0WA 3ZTRA 4C11B 4RQ2A 2J9EA 3DLKA 4WFXA 1IJEB 2QW9A 4JI0J 2C3UA 1ZAXA 5M2RA 3C14B 4BR0A 2DNGA 4PXDA 1S59A 3JB9k 1V4TA 1DZ5A 1Z05A 8ICHA 3QU4A 2PFPA 1WCNA 3NCQA 4R25A 4J5OA 4K4SA 3M9OB 2AWZA 1JLAB 4X4QA 3BDPA 2UXBF 2C22A 4FSVA 1T4GA 2K3IA 4CEAA 3OYHA 1G7CB 2E8MA 4Z7YA 1ZC6A 4A8EA 2OEJA 4EEYA 2MHEA 1GXTA 3OPXA 1BPZA 4WIIA 3CCWA 3A5MC 3MXJA 1XSPA 1HA1A 2HKEA 1S76D 1SQFA 3SI8A 1Z1BA 5F0UA 4DCHA 2YKOA 1FXXA 3B0YA 3D6JA 3H1VX 5SWMA 2V4RA 3J80O 4Y2XA 2BANB 3AAQA 2K60A 4Y2PA 3VQ4A 2HHHJ 5AI9A 4KTQA 5IV4A 3CJ5A 2ZE2A 2VG6B 4FJNA 2YNGB 5D0HA 2FSNA 5IIJA 3MDCA 4USIA 1N0UA 4C8NA 5F8IA 4ECWA 4MFFA 1B0VA 4ELTA 1KVJA 2EG2A 1RT2B 1NWKA 4QIGA 4E1JA 2FZCB 3EMTA 2W42A 3IS9A 3K4GA 4FPIA 3MCMA 4PGQA 1U2FA 4EI2A 3R2CJ 2HSZA 3K9KA 4MLEA 3OSPA 4Y2TA 3OYFA 1N88A 1D9AA 8ICPA 3UB5A 3I0SB 2VWKA 4QZDA 4DU4A 1FRLA 1N63A 3AO5A 1EARA 1L8OA 1BC6A 1PO6A 1DXSA 1SJQA 4OV6A 1QQOA 2VG5A 1SIZA 2CPXA 3W5ZA 3ZZPA 2HHHK 4BC2A 4CE9A 4FDFA 4CZJA 3ZT0A 3BY5A 5IT4A 1EIYB 1SQGA 1B43A 3VCDA 2AQ4A 4H54A 3NRWA 1KLMA 2AEMA 3MOZA 1J53A 3HI0A 4RWTA 1Q4RA 2ITGA 2ZBRA 4HAIA 1DK3A 4PUOB 4H5TA 3CDWA 5DBBA 1Q46A 1S6QA 4Y28C 2PFDA 2ERRA 1XO1A 3N97B 2CAJA 5HHIA 1WSHA 3P83D 4HHUA 3TWZA 2N1RA 5AKIA 5AKZA 4JHDA 4RL1A 2QL9B 1PGZA 2FLNA 3I28A 3M6GA 1ZOTA 5F3TA 5IIIA 2XMAA 1J9AA 4PG7A 4URQU 4IQXA 3MEEA 3U02A 4C0HA 3ZSVA 2DL0A 2DH8A 2VKRA 4DR6F 4CESA 3ZDDA 3IBCB 9RUBA 2W6LA 2DWQA 2XBPA 3C7NA 1CJVA 4H4KA 2XY6A 4JI1J 3SDEB 5FLXU 3BO3A 4FO6A 3W2VA 2R8GA 2HBMA 1Z2LA 1NHUA 5HLFA 2KSOA 4FM1A 1VK3A 3ALYA 5B66U 2DBBA 5LJVA 3BS9A 5ALEA 2R3VA 3G10A 4TUPA 2YQ3A 5E0OA 1TUGB 1RZTA 1H73A 2DNRA 3GR0A 5CH7B 1HFEL 4OHVA 3ONNA 3UD3P 3UDEA 1WN7A 4M3XA 2U2FA 2D0OA 2MSNA 4W5RA 5D4NA 3JXOA 3P38A 2RF2A 1NK5A 3U4LA 2Z2ZA 2ZH9A 4JI1K 1GOAA 4GV9A 4U8YA 4X2BA 5G4DA 1QQMA 4KLQA 3NGUA 3UD5A 2W1BA 4CHZA 4EMDA 2D4WA 2HF4A 2WSFC 4RW6A 3PACA 4DU3A 5KFQA 3BS5A 7ICHA 4R5PB 3OTCA 4HACB 2JLGA 3QWPA 4X62F 3P5BP 1Q0NA 3CM5A 3RB6A 2VCPA 1C1CB 3HVRA 3SQ4A 5FROA 2WVCA 4PPZA 2O8FB 1ZXIA 2MYFA 1I5OB 3DRYA 4Q0BA 3Q8LA 1HQ2A 4FZMA 3QZ7A 4OI1A 3DXSX 5BRHA 1WSFA 2F2AB 3FM9A 1VLBA 3HKWA 4G1PA 3R3TA 4PZVA 4F4XA 5HOOA 2Z2MA 2GO9A 2RDIA 5DM7Q 3DOKA 4CJVA 1JXVA 4IFYB 5J0SA 4CLWA 3GPAA 2J5AA 2HVHA 3AA3A 3C2LA 3A0IX 2IRUA 1K1QA 3UXOA 2F77X 1MSWD 2E66A 4MEXA 5AIAA 4FO0A 4AHVA 1OPZA 8ICSA 3Q7BA 3QX7A 4UOFA 3C15B 3BZCA 1YJWN 4ZVRB 4M42A 2W2MP 3GIRA 5K8OA 2ZWPA 4QIWF 2D0CA 3QIPB 5BREA 4ID8A 4P7TA 4AHUA 2ES6A 2AA4A 4B3TJ 3U9ZA 3VQBA 4K42A 4D3HA 3DRXA 3SAFA 2EPIA 4RX6A 1FKPA 2I7PA 2Y1JA 3VGMA 1ZBSA 4CF2A 1GO3F 3KHRA 3C19A 2IDEA 4DTPA 2CQ0A 3TKAA 4KH4A 4WE1B 1K6YA 4KB7A 4RUAA 4H5VA 2YJEA 2FMQA 4DUYF 3DU5A 4ZLNA 4FJMA 3LM2A 4UBBA 2HFOA 2J9DA 1FJGJ 2MUTB 1UVKA 2PN6A 2OO4A 1NDKA 2X6NA 2PI4A 5EX3A 1X4EA 2B4JA 1VI7A 1Q78A 1DFDA 1MWKA 2AGPA 1NNEA 2UXCJ 4A59A 3PW2A 1P1LA 2G2OA 4LFBJ 3U6FA 2CG4A 4BC7A 1Q3VA 2K4PA 3UQSA 1CSJA 5KFAA 4B3TK 1GNKA 3HZGA 3UQ0A 5EGYA 3UDCA 2RILA 3SBMA 2HZCA 3DHWC 3D66A 4CI6A 4OHWA 2BRLA 5C24A 4RCHA 4NLZA 2XRIA 2KTQA 2GELA 4CK3A 1IR0A 4DPYA 3AVKA 1FE0A 2H3ZA 4WFAQ 3SJHA 5JU5A 4U7BA 3GP9A 1D4XA 3SFUA 5CQGA 1M5KC 4A8MP 4Z4EA 5CEHA 3KDNA 1FJGK 1IM4A 3M6KA 4EU0A 5KG1A 3UR0A 3NCRA 2QLTA 4FK0A 2DRDA 3PVXA 4K8XA 4F4KA 3TWHA 3DXKA 4CHNA 1TAQA 1NK4A 4DO9A 9ICLA 1QTNB 4LFBK 1RTDB 3T9NA 3I5CA 3V7KA 4P4OA 2JC0A 2G4BA 3GSIA 3HW8A 2DUYA 4KGKA 1ZBUA 3CD0A 4G3IA 4A46A 1BVSA 2EKNA 8ICMA 4JWMA 2OTLN 1WWVA 2NREA 3EY1A 4MYUA 3NOGA 3L5KA 1KTVA 2MKSA 2ODGA 2A42A 2LXUA 1HR0F 1T9UA 2U1AA 1RK8A 2W25A 1T0TV 3ATUA 3CJKB 1PVPA 3FC9A 2MKCA 2DFLA 5HNKA 2AZ1A 1Y7PA 2ISOA 9ICPA 3OFGA 5ETOA 4FPRA 4PJ0U 2XNRA 1XUPO 1LV5A 2D1CA 4P2HA 2NO4A 4EFHA 4F92B 4RBTA 1M1GA 3AUOA 3H45C 4CFDA 2D9OA 1JXEA 3A5NC 2OKQA 2UV8G 3GSDA 3E58A 2G07A 1EZZB 1FXLA 4BE2A 5CYQA 3CJCA 3OVAA 4NYOA 3O4WA 3QEAZ 1T03A 5HMZA 4ZIVA 1TL3A 1ZOLA 3BF1A 3GOIA 3QEXA 3MD3A 2IC3A 1TZ0A 1VQ6N 3CD6N 5AKKA 3VQEA 1WKLA 4NI2B 5B0FA 1K8KB 2K4EA 5CY4A 1NHKL 4AP9A 1J54A 1WHXA 3GJTB 3PFEA 1VJ5A 4NXNF 2HQ3A 4ZLLA 2CGKA 3C6UA 3ULHA 4WP9A 3I56N 4DR1J 3POTB 5B0DA 1WF2A 1T95A 3M5RA 5KT4A 3NNAA 1OWXA 1REVA 4NLNA 4JKFA 9ICMA 2J0WA 1RBUA 4RNMA 5AQRA 5J8YC 1YQHA 2KM8B 3CW2C 3NDKA 2Q97A 1KC8T 2GIFA 5CJ7A 1J5EJ 4FF4A 2CPJA 3EXCX 3WK5A 5KFZA 4XA5A 2B4VA 2Y9HA 1RE1B 1JK9B 3GU3A 4AL6A 4MF2A 1IKWA 3ETRA 3HK2A 4CYUB 4AQYJ 2WSCC 1T05A 5AFUH 2XY5A 1UPHA 4JS5A 5I3PA 2Q0RA 2WVDA 5DG7A 2JVRA 4DR1K 5IV3A 5K8PA 5C42A 1DOQA 4KHPF 4FJXA 3DLGB 3RBDA 2DR6A 4UQTA 3HZEA 1RA7A 1YRUA 2HGMA 2JRSA 2V69A 1J5EK 1JWWA 3BBFA 1M1KO 2WVBA 5ETQA 2KHDA 2V50A 4W92B 3WKAA 4CF4A 1QLNA 4V19S 1TU0B 5KFPA 4WU2A 3HCXA 2KMDA 1UPMB 1GX5A 3LH2S 3CJTA 3IG5A 4F5NA 2UXDF 3OHBA 4X4VA 2HAFA 3CCQN 4AQYK 3GG0A 5HVFA 1LWEA 3QYPA 1RAGB 1RGIA 4KLLA 2ZGZA 4DB3A 2FHJD 4YG2A 2DTJA 9ICRA 1SL2A 3D1OA 4ID5B 1HQUA 1WG1A 5A2QO 2DNNA 4JUZA 3VQPA 1WHYA 3I4HX 1BHLA 4TY8A 3ZZYA 5AQGA 1JMSA 3V1OA 2Q4TA 3LVVA 3N4PA 1LXNA 3MMVA 1ZETA 4RR5A 3MBYA 1DQAA 2FLOA 1BNPA 2QSFA 2KE7A 4LD0A 3VGUA 3E3XA 3VGTA 4FNIA 2F7VA 5JLFA 5C25B 2K7KA 1JCEA 1UJ5A 3OJUA 3ENBA 5K20B 3HO1A 4NLPA 2EFVA 4UZCA 2VKZG 2RSQA 5ALTA 3LOUA 3T1YF 5AQJA 2MMYA 2MKHA 4ILLA 3IRXB 4CF9A 1XNRK 3P4UB 2H51B 2NS1B 1A0OB 2KLAA 4W5TA 3UXPA 2A3VA 5AQZA 1NOYA 4OX8A 3BKFA 1OKJA 1QE1B 3AARA 1ZQYA 5CA7A 4C23A 2FJAB 3DGPA 3DLJA 4P2XA 1N5XA