4B9VA

Structure of the high fidelity dna polymerase i with extending from an oxidative formamidopyrimidine-dg dna lesion -da basepair.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 210
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9vA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9vA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9vA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9vA01
3SV3A 4JLHA 5J2KA 5KFZA 5DBBA 3KK2A 1C0TA 1RYRA 1ZQYA 1EETA 3HSTB 1C1CA 2VWJA 3SQ4A 3HL8A 4UAWA 3DI6A 1N5YA 4ID1A 4NM2A 4DOCA 4J9QA 8ICQA 3HO1A 1RBRA 8ICEA 3B6PA 1RT6A 3ZT4A 2XHBA 5KG2A 4J2AA 1Y97A 1VSHA 3O4NA 4QZEA 2R8HA 2BGWA 3OYGA 4R66A 4KN4A 4C8OA 2EHGA 4MF2A 3JPTA 1A5WA 4CJUA 2ZJ8A 4FJ9A 1ZQCA 4JV0A 4QWBA 2G8UA 1R0AA 1JLCA 4DSJA 1U48A 1SL1A 1LB2B 1C1BA 3C1YA 4F4WA 1TK0A 4LY7A 4UB2A 1U4BA 3K75D 1RCHA 3MEEA 3HP6A 4QZBA 1HPZA 3SUQA 3TAQA 4E7LA 7ICVA 3V6HA 4F93B 7ICGA 1ZBHA 5HRPA 4M9HA 5IIKA 1ASVA 4UAZA 3V6KA 3I0RA 4JS4A 5JS1A 3PX0A 7ICSA 4K8XA 4CF8A 4NYFA 3FYHA 2XCAA 1KVAA 4MF8A 4L8RB 5KFPA 5KFWA 1HUZA 2J6TA 2G8IA 1ZQPA 5J0OA 2P5OA 1S6QA 4OKKA 4PGQA 4TQRA 4CEQA 2IS3A 3ZT2A 4B9TA 5J0WA 5DB9A 8ICWA 1ZQLA 9ICXA 1UAXA 4ZH4A 4RQ2A 3ULDA 3VA3A 4ZTJA 4TSXA 3RH6A 2YV0X 3AV9A 5CY4A 2HVHA 5CJ7A 8ICCA 1WSHA 1RT1A 5DGAA 4BGDA 4ED7A 4W5RA 3TABA 4HCBA 5HHHA 4IQTA 3NGZA 3SI6A 3QLHA 3U3GA 2V9WA 3VQ5A 4DFKA 2DFHA 2HHQA 3KHLA 1ZQMA 4EZ6A 9ICLA 4HHTA 1B22A 1KDHA 2HHTA 5DQHA 2OWOA 9ICOA 3Q8KA 1BIZA 3KKRA 3MAQA 4GVMA 2RDIA 1QLNA 4CJPA 3QNNA 4R65A 2C22A 3QZ8A 1PZNA 3M8QA 2OZSA 3OYLA 5DLFA 3V9ZA 4FK4A 4KLDA 1VSEA 1EP4A 1HJPA 2FPMA 1XSLA 4KLSA 1KVCA 2YKMA 5KT7A 2IC3A 3KD5E 2W8LA 4R64A 3PO5A 4IG3A 4CJSA 1AROP 2YNHA 4M6WB 4KLHA 1HRHA 1YVUA 2HVIA 4Z4GA 2BCSA 3ALYA 3WNFA 3GV5B 5T7BA 4GLXA 5CR0A 4O3NA 1UA1A 4QCLA 4CK2A 5KFBA 2E6MA 4YMNA 2Z1JA 1TKDA 2ZTEA 2UVWA 4IFVA 2PI4A 4CHQA 5KFTA 5CA7A 2R8GA 1VSKA 1YTUA 4CJLA 7ICRA 5SZTA 1L3TA 4RQ1A 4DL6A 4TUPA 2DPJA 1ZJNA 3ISBA 4PA1A 3TQ1A 3RJJA 1TV9A 2I9GA 3HT3A 4RQ7A 3AVBA 4F4ZA 3AUOA 4CHNA 3AVJA 3IHQB 4KI4A 5DQIA 4B9SA 3OYAA 5C24A 3KLHA 1W9HA 9ICPA 4DL7A 4ED0A 8ICSA 4RU9A 3KK1A 4K8ZA 2OYQA 1KLNA 1S76D 3H4BA 1ASWA 4QZHA 4CEDA 4EBEA 4MEYA 2BR0A 3PW0A 1IKXA 4Z6CA 2RN2A 4W5OA 1LW2A 1WSJA 4O3QA 4DMNA 4BDZA 4FLXA 3O3GA 2Y1IA 1TKZA 3PX4A 4MFCA 1S0MA 3GFKB 5J2FA 1B9DA 4I2IA 7ICJA 4DTXA 4M04A 4NY8A 2RDJA 2BDPA 5EWGA 4Q44A 5IIJA 3C23A 4B9VA 3AVGA 5CYQA 1SKSA 4RW9A 8ICXA 3EPGA 1IKYA 2BPCA 1ITGA 3UXNA 3UXPA 4RNOA 2RF2A 3JPRA 5KFAA 4O4GA 1RZTA 3OYMA 4IKFA 1ZQDA 5KFFA 3O4QA 1C0UA 8ICOA 2FBYA 1BVSA 3UPQA 1T3NA 2QXFA 2FPKA 3DRSA 4DLEA 9ICAA 1N56A 1S5JA 1KTQA 1S0OA 3M9MB 4E7IA 1NOMA 4KLMA 4F4XA 4FO6A 4F91B 4DTJA 4H8KA 3LZJA 4WE1A 1QQCA 3CG7A 4I2AA 1QTMA 2G8WA 1S9GA 1GOBA 4PGYA 4J9KA 3NCIA 1RDBA 4DU4A 5J2BA 1REVA 1KFTA 4OKJA 5J2HA 1YTAA 4DTUA 3G6VA 1VSLA 4O5KA 2OZMA 2QKKA 9ICFA 5F9LA 4FZYA 1CUKA 3VQBA 4CJ3A 2AGOA 4B9LA 4ED3A 1S9FA 2IBKA 3FFIA 9ICUA 4DTPA 2HW3A 1EKEA 2ISPA 4Y1DA 1HYVA 9ICNA 1B92A 3C2LA 3LWLA 2YNFA 4E3SA 9ICIA 4BDYA 4JRPA 4QAGA 4I28A 3M8SA 5KTQA 4FJ8A 4YMOA 4FJJA 2JLEA 4C8LA 5HP1A 3RBEA 4YR3A 3NAEA 2BQRA 4RQ8A 1SL0A 4FJXA 3ZSRA 2PI5A 3OYIA 3CYMA 3BJYA 2KTQA 5F9NA 3MXMA 4E7JA 3AVIA 4CEZA 3MR2A 4FJHA 2VANA 4RQ6A 4W5QA 4DQRA 2VA8A 3KTQA 4EYIB 4Q45A 2QK9A 1U9LA 4J2BA 2HB5A 5J0QA 4RPYA 3V7LA 5JUMA 1FKOA 1JLBA 4NCBA 3S3MA 4CJ5A 2B4JA 1NK7A 4QZCA 3C2KA 3IAYA 3C2MA 4I2EA 4F5NA 2VA2A 3SCXA 4M3XA 1KRPA 3OGUA 3ZSWA 3GV7B 3MDCA 4FLWA 4GW6A 4ELVA 3U3YA 1ZQZA 1BPDA 3ZCMA 5KT6A 1ZQKA 3CQ8A 1CZ9A 3VN5A 3V9UA 3K5MA 4X5VA 3RBDA 2FMSA 4CJWA 5IIIA 2ALZA 4PH5A 2PY5A 4M6WA 1IO2A 4RQ4A 2F1JA 9ICTA 4B8AB 3SQ2A 1D8LA 5TZVA 5BPCA 3RR8A 3ZDEA 3KHRA 2MUTB 4KMUA 3F9KA 1DTTA 7ICMA 4KAZA 3HP9A 3JYTA 1NJWA 4O44A 3ZT1A 1L3UA 2IMWP 4LZGA 2OPSA 2NRWA 3WNHA 4TUQA 1A5VA 3MEGA 1RPLA 8ICNA 3H4DA 3OY9A 1MQ3A 4XRHA 4Z4HA 4JS5A 8ICMA 4KHYA 5KFNA 4YD2A 3C5GA 5KFLA 3OYDA 5KFOA 4E89A 2VWKA 3SV4A 1LAVA 4O0JA 2HMIA 2DFEA 4QWDA 3AA5X 4I2QA 3T19A 9ICRA 4ELUA 5CP2A 4FJIA 3MR3A 7ICHA 5KG7A 4DTMA 4CGGA 4KTQA 3OS2A 1NK8A 5DB6A 2IHNA 4M3ZA 2X74A 3TFSA 1Q8IA 3LAKA 4QZGA 1BL3A 4GXIA 1HYZA 4PWDA 2DFFA 4KLFA 3PO4A 4HTUA 4ED2A 4JRQA 1HQEA 4DTRA 4ED8A 2FBTA 1ASUA 1XWLA 3T5KA 2M9NA 4Z6DA 1TV6A 1VRTA 4DWIA 3TAEA 5J2GA 4DFMA 1CLQA 1EXNA 4M9JA 5KFSA 4HVJA 1LW0A 4G1QA 1RT4A 8ICYA 4FJ5A 3OS1A 1IKWA 3K5OA 2O4GA 5KFJA 1S10A 3TAGA 4E0DA 3C1ZA 1TVAA 3OYNA 5DLGA 2G8FA 9ICBA 4M9NA 3V1QA 5J2PA 4DQQA 1FK9A 4I2GA 4IRKA 3ZSYA 7ICKA 3QEWA 3TR8A 5EOZA 3PW4A 3LDSA 4KB0A 1J54A 4ECVA 4CJVA 2LYHA 3V6JA 2F8TA 4DL3A 5KGWA 3RRGA 1ZQIA 2FMPA 4UBCA 3SYZA 2PFNA 2A1JA 1BQMA 2R8KA 4IRDA 1HNIA 5HRNA 2V4QA 3L2UA 3PW5A 2KFNA 3MXJA 1RBUA 2W9AA 3CFOA 4RW6A 3ZD8A 4Z4EA 8ICAA 5BOLA 3MDAA 2G8KA 4LZDA 1ZQNA 1ZQQA 4FK0A 1XC9A 2BCQA 1CXQA 3K59A 3ZSZA 7ICQA 2UVVA 8ICJA 3CM6A 2PZSA 2BKEA 2B21A 3AVHA 3NF7A 3EYZA 3TFRA 4NM1A 4ECRA 8ICTA 2YNIA 3KLIA 4QZDA 1RXWA 1WSGA 1C1AA 3K5LA 3AO3A 4IQVA 5KT3A 1N48A 5E41A 3OYEA 3FDSA 2ASLA 1TKTA 3MFHA 5KFUA 4F4YA 2DPIA 1WAFA 2W9CB 1ZQUA 3HJFA 5KFHA 5KFDA 1X9SA 1FKPA 1WSEA 2GWSA 2FLNA 4CJQA 5DBCA 3QEXA 4AHSA 5HHIA 4J9PA 2C2RA 1JXBA 1JX4A 5EWEA 2W8KA 3MABA 5J0PA 3GIJA 5HBMA 3ZDAA 4QW9A 3LPTA 4YCXA 1VSIA 2F1IA 1G15A 3T5JA 4M3UA 4DQPA 3RB0A 4UB5A 1BCMA 4B9MA 3MEDA 4K4IA 1N6QA 3CFRA 5D49A 5DG9A 1I3AA 3L8BA 4Z6FA 4YNQA 4FLVA 2B6AA 3JSMA 4KHNA 5L1IA 1C7YA 2I1QA 3VQQA 1RBTA 4GC6A 5J2IA 5L1LA 4KI6A 4AHUA 7ICIA 2VA3A 1S0NA 3KKSA 3ZSOA 2B5JA 4O55A 1IH7A 2ZD1A 4KFBA 2BQ3A 2JZBB 1NK0A 4PHAA 4AHCA 3NF9A 3ZSVA 4CEEA 4F50A 4CF9A 1COOA 3RB6A 4KLIA 5KRSA 1KFDA 5KFEA 3KIOA 4EP4A 2E4LA 2Z1IA 4F2SA 4IBNA 2X78A 4RZRA 3M8RA 5IILA 3RMCA 5IIMA 7ICNA 3LANA 4H4MA 1KEJA 2I5JA 1RNHA 2R7YA 2ZQBA 4J9LA 2XY6A 2MUTA 5BOMA 4JV2A 3F73A 4B9NA 4AH9A 3QZ7A 3BGRA 2XGQA 1T7PA 3H08A 3AU6A 3KHHA 3L3VA 2VG6A 4J9NA 4FLYA 1ZQFA 4RNMA 4CEBA 1IKVA 2PYJA 4PHDA 4GXKA 2ATLA 1JLEA 3HX0A 1WAJA 3KLFA 5KFKA 1Q9XA 1QHTA 2BQUA 3OYHA 2HHUA 1RBVA 3SPYA 4O5BA 1K1QA 1VSFA 4RNNA 4CF2A 4FJKA 3BQTA 3LZIA 1EXQA 3DOLA 4CFAA 2DY4A 1ZQHA 4OLAA 5KT5A 4YP3A 2IAJA 4I27A 2IDOA 5DK5A 4J2DA 4DL5A 5J2NA 3VQ6A 1SKWA 2AQ0A 4RT3A 3U6FA 4E7KA 3T5HA 5DB8A 2C2EA 3JPSA 3QEBZ 4CCHA 3C6TA 3NF6A 4CHOA 2UVUA 2GV9A 3V9SA 4DU1A 4QZ9A 3K58A 1W0HA 3SUOA 1Z00A 4FW1A 3V7KA 4M3WA 4P2HA 3D45A 4DTSA 1J5OA 1QSSA 3QEPA 3TI0A 1TAUA 3I0SA 1T05A 4GMJB 2BCRA 3B6OA 1TL3A 3LP1A 4KLLA 3P1GA 2P5GA 4HCCA 1UT8A 2HHVA 4I9QA 5J2MA 2MAXA 3H8SA 4DSFA 3ISDA 2KZMA 2OA8A 4J9SA 2V4RA 3RB3A 2NRVA 3BQ1A 4N76A 4QZFA 2Z1GA 2HNZA 1HQUA 3V7JA 5KFMA 4KLQA 3RJEA 2FMQA 4M41A 3HM9A 3DLRA 5J0UA 5C42A 4Q8FA 2KQ2A 3AA4A 1S1WA 3Q8LA 8ICLA 9ICHA 4FW2A 9ICSA 3DLGA 4OLBA 1F21A 2ETJA 3K57A 7ICPA 5CZ1A 4ECWA 3LAMA 3K5NA 3AU2A 3MECA 2AJQA 1RT2A 4FJGA 4RG8A 3M9OB 5J2AA 1C6VA 2FPLA 1BPZA 2BE2A 1NK5A 2IGIA 4M3RA 3IM1A 4MQ3A 1S1VA 1NJXA 5FRMA 2YHAA 1KSPA 2BGGA 1JLAA 4YVZA 4N47A 3K2PA 3LDAA 3C94A 1JLFA 3C95A 2C2DA 2W9BB 2JEJA 3VQCA 3OYKA 4PUOA 3RH5A 1MC8A 3ZDDA 1D9DA 4Q43A 8ICIA 3DYAA 4CJTA 3HYFA 3ASMA 3L2QA 4Y1CA 4LH4A 2W9CA 4EEYA 8ICUA 1XHXA 3RRHA 5C25A 2WTFA 3QE9Y 5J0YA 1LV5A 4ECTA 3Q8SB 4ED6A 4R63A 4N41A 4KKOA 4DSEA 1TK8A 4IQUA 3JPOA 4B9UA 2Y1JA 3BDPA 3SJJA 1QSLA 2BCUA 2BPGA 3ISCA 4BDPA 3RMAA 1WCNA 1BHLA 3G6YA 3M9NB 3IS9A 3OHBA 3ZDCA 3GIIA 4Z4IA 4RUCA 1DLOA 4FBUA 4FJNA 3SNNA 4HYKA 2FBXA 3H7IA 3OJSA 1D9FA 4KLJA 3UXOA 4O3SA 2FBVA 3OSNA 4DG1A 3PY8A 5KFYA 3GILA 5HNKA 3TAPA 1L5UA 3N97B 1TK5A 3PNCA 3LALA 2R8JA 4I2PA 3CFPA 3GQCA 4ECXA 1UWBA 4FJ7A 3S9HA 1BPEA 4KN7A 1NKBA 3VQ9A 2ZTDA 4ID5A 1RYSA 2JZBA 4FLUA 4KREA 5DKWA 2C28A 4RUAA 2NRXA 5HMLA 1MU2A 4CJEA 1Y88A 1VRUA 1ZYQA 2W42A 3RJHA 3VQ7A 4O5CA 4CGIA 2IA6A 2JEFA 4QWAA 4IDKA 4PY5A 4ECZA 1BGXT 4R8UB 2P66A 5DG8A 2BHNA 4K4GA 4LD0A 8ICPA 3G0ZA 4FXDA 3PR5B 4E1NA 4DSKA 4ICLA 2KZ3A 1JL2A 2FLPA 4M9GA 2XY8A 3Q8QB 1U47A 1SV5A 1C0MA 1QS4A 1TKXA 1K1SA 4CIFA 2ZUCA 5D46A 3B0YA 3QNOA 4YQWA 1LAWA 1DOQA 4M3TA 2JEIA 4YMMA 1ZQRA 4QW8A 1BCOA 3C6UA 3V72A 9ICGA 3AO4A 1KVBA 3TAMA 4AHVA 4DEZA 4CGFA 3QEAZ 5J2QA 3PW2A 1TFRA 4CEFA 4F2RA 4O3RA 1SUQA 5HRRA 4F3OA 3B0XA 4FLZA 2O4IA 1MSWD 8ICGA 4YR0A 2WONA 4ECQA 9ICEA 4JWNA 1ZQJA 5J0TA 4CEAA 3RMDA 3LP0A 2DFLA 3VQPA 2AGQA 2D0BA 3UQ2A 3EY1A 4OGCA 3TARA 4NXZA 3VQDA 4NCAA 1KLMA 4JV1A 4OVLA 3AVNA 3HVTA 1YT3A 3DRPA 3M8PA 4YXJA 4GC7A 4JK1A 3PX6A 4DL4A 1WLJA 4GXJA 4RQ3A 3RMBA 4BXOB 3ZT0A 4FM0A 4CFDA 1BPXA 4N5SA 2UVRA 2J6UA 4NLKA 3AA2A 3AVFA 3K4GA 4KTZA 9ICMA 2J6SA 2D0CA 4CGHA 2OPPA 4DLGA 4NLZA 1K6YA 4MFAA 1S1TA 5KFRA 3HXMA 2XY5A 2XCPA 4F5QA 3AO5A 4FCYA 2F8SA 1NJYA 8ICRA 2JEGA 1J53A 4DS5A 3NDKA 1WCLA 1KCFA 3AVCA 4XA5A 4H4OA 5J0RA 2OPRA 3OYBA 4CE9A 4JUZA 3DRRA 4CJ4A 3ZT3A 4F92B 4YN4A 1Q9YA 4XQ8A 3L2WA 2NUBA 4M2YA 1NKEA 1JXLA 1ZQBA 5CZ2A 1VSMA 4RW8A 1X2IA 2X6NA 3OJUA 1BISA 4Z0UA 4CGJA 3NGYA 9ICVA 4KTWA 4YFUA 4KV8A 4AILC 1HJRA 4KHQA 3OYJA 4W5NA 4CEOA 3WNGA 4OPKA 2Z1HA 5J0XA 2ATQA 5KFIA 4CJRA 1ZQSA 4M42A 2KFZA 1JXEA 4F5PA 2RKIA 4QZIA 3NFAA 2H5XA 3QIPA 3PV8A 4JWMA 4E1MA 4PHPA 2GBZA 1DTQA 3V1OA 5FRNA 5KFGA 3QETA 3SUPA 4O9MA 5DBAA 3OS0A 2AGPA 3SI8A 3Q8PB 2A1SA 2XGPA 1ZQWA 3AVLA 3NTUA 2Q0ZX 5KT4A 3PMNA 1RILA 4UAYA 2ZJAA 4KLEA 4YFKA 4UBBA 4IRCA 2WOMA 4K4HA 3L2VA 4BE1A 4M47A 4KRFA 2HHXA 2EX3A 1T03A 3QO9A 1S1XA 4FLTA 2ASDA 1NKCA 3RJGA 1JMSA 4DFPA 1XU4A 3O3HA 5CHGA 5KG4A 5SWMA 1U49A 3KLGA 2R8IA 1JLGA 1FXXA 4RQ5A 1JN3A 3DM2A 4F5OA 4KO0A 2KN7A 3MGIA 1RTIA 9ICQA 1VK0A 3DLEA 3AO1A 3VQAA 3HPHA 4CGDA 3HPGA 2P6UA 4P4MA 4KLOA 5D4BA 4IG0A 3V9XA 2FC0A 4XUSA 4IFYA 3IG1A 5KFVA 1ZQOA 2P1JA 3MFIA 3MBYA 4CHPA 4Q5VA 3PVXA 4HUGA 3H40A 3NH1A 1BI4B 2RPIA 4R8UA 1S0VA 4DF4A 4HUEA 1BIUA 4EBCA 3EWAA 4CESA 1H38A 9ICJA 4NYNA 1ZQVA 5DMRA 1JL1A 4P4PA 9ICWA 4DFJA 5DDMA 3PMLA 3OVNA 3RJFA 4FK2A 4ECSA 4YD1A 3SPZA 5KG5A 9ICKA 4B8CA 2ZTCA 3KLEA 4QOZB 3ORYA 5KG0A 2HHWA 4DO9A 2HNYA 1GOCA 5KG6A 4IR9A 5HLFA 3EZ5A 5DGBA 4MFFA 1S97A 2VG5A 3NH2A 3HVRA 4LSNA 4DL2A 3V4IA 4J9OA 4ELTA 8ICKA 3JPNA 4AHTA 3BQ0A 3RB4A 1ZBIA 2DTUA 1Z3EB 4EYHB 5L1KA 4FZZA 1I39A 3DOKA 4CF1A 2ZUDA 3OYFA 1XI1A 3SUNA 4CIEA 4B08A 2NRZA 2ZJ5A 5KT2A 4N56A 2YKNA 1QE1A 1X9MA 4EZ9A 1BQNA 8ICZA 4ECYA 3PR4A 1ZJMA 4NLGA 4KLTA 3DLBA 1ZETA 5CWRA 3LP2A 5JS2A 1T4GA 4Z4CA 4DOAA 4DTOA 2HNDA 4YXMA 4CIGA 1RDAA 4BXOA 4DSIA 3LWMA 4ZHRA 2D5RA 1V9PA 2Q3SA 3RWUA 3P83D 3NGIA 2YNGA 4I2DA 3NH0A 3ETLA 1VSDA 3C5FA 1NK9A 3P5JA 1WNSA 3PW7A 3AVMA 2G8HA 5KG1A 5DQGA 1L3VA 3ZDBA 1XS9D 3ISNC 4I2CA 5CB1A 5DDYA 3NHGA 4BWJA 2IHMA 1LWFA 2P6RA 1LWEA 3T3FA 4R5PA 1NK6A 1HYSA 4UB1A 1EX4A 1RDDA 8ICBA 3OYCA 3H8WA 4C8NA 3EW9A 4UB4A 1XO1A 3HPOA 1IXRA 4DF8A 4F3TA 1ZQTA 3L3UA 1WSFA 5KFCA 1IG9A 4YR2A 1IM4A 1S6PA 5DG7A 1RTJA 2OPQA 5K14A 1WN7A 1RDCA 3S3OA 3AA3A 4FJMA 4FS2A 3UIQA 2XY7A 1NK4A 4C8KA 1NOYA 4BWMA 1VSJA 7ICOA 4FBTA 2ASJA 2W9MA 7ICTA 4BACA 4PHEA 3NE6A 4B3OA 4QWEA 4M9LA 3DMJA 2D0AA 2PYLA 3RJKA 5KFXA 4Z4FA 3LK9A 1ZQEA 3QIOA 4KHUA 2IOCA 3CM5A 3E2EA 4E19A 4LVSA 1HNVA 3G10A 4QWCA 5KG3A 3ZD9A 4QZAA 3ITHA 4OPJA 3TWHA 4CHZA 3RTVA 1JLQA 3QEVA 3MR5A 4I9LA 8ICFA 3O3FA 4W5TA 2G8VA 4QZ8A 2NRTA 3E01A 4RW7A 3WNEA 4M3YA 4NLNA 2XC9A 3IRXA 4I2FA 5J2CA 3MR6A 1U45A 4CERA 3JPQA 2ISOA 3HW8A 4CFBA 4OJRA 2X6SA 3NF8A 3SQ1A 1X9WA 5J2EA 4MFBA 4RW4A 4O5EA 3KJVA 1HMVA 1A5XA 2LSNA 1B9FA 4F4KA 2A1JB 2KW4A 2ZUBA 4M0AA 4J2EA 5EWFA 4E7HA 4KLGA 4DOBA 5L1JA 5IIOA 3S3NA 1XSNA 2YHBA 2JGUA 1TL1A 1ZQXA 3DLKA 9ICCA 7ICFA 4G3IA 2AU0A 3G6XA 4F5RA 4DQIA 1Z26A 3DLHA 4CJKA 1GOAA 5J29A 2BANA 3D0PA 1KFSA 3RJIA 4J9RA 5C5JA 1HUOA 7ICEA 4PGXA 4NCGA 1T8EA 3RR7A 1SL2A 1BI4A 3V6DA 3A2FA 2ITGA 3SZ2A 3AVKA 2F1HA 4Q8EA 4HUFA 4LSLA 3THVA 2HHSA 4CF0A 3VA0A 4FZXC 3TAFA 5KI6A 3KHGA 1NOZA 4O3PA 3L2RA 4KLUA 4I2JA 8ICHA 1UA0A 3GIKA 4I2HA 4UQGA 1LWCA 3AO2A 4Q0BA 1D8YA 2F96A 3RAQA 4FM2A 4RPXA 5I3UA 1NJZA 2P51A 5I42A 2PFOA 4MEXA 1MQ2A 4DU3A 4ED1A 3VQ8A 3VQ4A 1XSPA 4DQSA 1TVRA 4FS1A 4KHWA 2QKBA 5J0SA 2PFQA 2GUIA 3SQ0A 4ECUA 4KB1A 4PQUA 3AVAA 3RAXA 5FROA 4EP5A 3MXIA 3ZSXA 3EPIA 7ICUA 4F8RA 4RQ0A 4LH5A 5CYMA 3BQ2A 4O3OA 3VQEA 1ZBLA 1A77A 5IINA 2BPFA 4I29A 1WSIA 4YG2A 3I8DA 1X1PA 1ZQGA 4DTNA 4KPYA 1U04A 2ZE2A 4AHRA 1CZBA 1RT5A 4CECA 2PFPA 1Z25A 4TUSA 3GIMA 1ZBFA 2E6LA 5HMMA 5FDLA 3QESA 4KHSA 4DSLA 4TQSA 3QERA 3KD1E 4M45A 4EBDA 5KGXA 4UB3A 5HRSA 4IQWA 1TGOA 4TURA 1UT5A 1O1WA 3Q8RB 4I7FA 1RXVA 5EU7A 3OHAA 3HWTA 4CK3A 4Z6EA 5HROA 3V9WA 4BE2A 5HP4A 1RTDA 4CHYA 1QSYA 3PUFA 1B43A 1A76A 4PPXA 4P4OA 1BPYA 1J9AA 5J2JA 4FM1A 1ZQAA 3LPUA 4FYDA 3RH4A 2A1RA 4RT2A 1TAQA 5J1EA 3V1RA 2AQ4A 3Q8MA 2XRIA 1RTHA 1UOCA 1RT7A 3GDXA 4I2BA 3T1AA 3GV8B 3LP3A 1RT3A 3C21A 4FVMA 4C8MA 4KITB 3V81A 1S77D 5KRTA 3UQ0A 3H8JA 4CFCA 3MGHA 1Z00B 4J9MA 1S1UA 5J2DA 4FJLA 2PXIA 8ICVA 3N4MB 7ICLA 3QINA 3NGDA 1SKRA 4CK1A 3QEIA 1SZPA 2BCVA 5DB7A 1JKHA 4ZTFA 5KFQA 1CXUA 1ZBUA 1JIHA 2FLLA 4BE0A 3OSPA 4RPZA 1XHZA 5L9XA 1RBSA 4O0IA 2VG7A 4OGEA 2KZZA 3TANA 3T5LA 4CJFA 1DGSA 3KK3A 4OKEA 1D5AA 4XIUA 2W9BA 3NBPA 1S9EA 2XO7A 1L3SA 3ZSQA 3HK2A 5D3GA 1CEZA 3JPPA 4DS4A 1BPBA 4IR1A
chains in the Genus database with same CATH superfamily
3ILIA 2MZJA 1MMNA 3MGJA 2P9GA 4CO1A 4RW9B 4QR1A 1U0HB 3VAKA 3C15B 1IKYB 3M3ZA 5EE3A 2D9OA 2GA7A 3SQ4A 3I9ZA 5IV3A 2QE5A 3MN7A 4MIWA 3W8PA 3NUQA 4NM2A 3ALRA 1GTHA 2HOQA 1Z05A 1IJJA 3ZT4A 2LU2A 2KJVA 1Y97A 1VSHA 3JSYA 1UVNA 4QZEA 2R8HA 3C19A 3MI7X 1AA1B 4A61A 5GAGU 2L9DA 4ENOA 1H0HB 4FJ9A 2PKEA 4C0OC 1S99A 5A6PA 2A3VA 4IQMA 4OYXA 1U48A 1LB2B 4CP5A 2DY9A 5LY3A 1OMSA 1KQKA 4UB2A 1T9XA 3DXKB 2FUG9 3PEHA 3W2WA 1RCHA 3MEEA 5ALSA 1M1GA 4LFBF 2IBOA 3PIPQ 4QZBA 1Q81O 4E7LA 5HVFA 3LGHA 3NCPA 7ICGA 1ZBHA 1E6YB 1LFWA 5FLXO 3H6EA 1ASVA 1VQMN 2DYAA 5ALOA 5LM7E 2KL8A 4IKAA 1VJQA 5EXWA 3IS9B 2J6TA 2ZIUB 3MR7A 1Y00A 4IYQA 1S6QA 3EZOA 4PGQA 3EKUA 2XS7A 2KJWA 5J0WA 1EARA 1VISA 8ICWA 1ZQLA 3P96A 3QU2A 4J9UE 1BG3A 2O67A 4ZH4A 2V7ZA 3RH6A 2MQQA 4LVNP 2DJWA 3VAHA 2Y9UA 3UCGA 3HHNB 3TU5A 4ZPWR 4W5RA 2ITMA 2UXBJ 1PILA 1EKSA 3U3GA 3VQ5A 2HHQA 4ZP6A 4B1YB 2YQ3A 4NA2A 3KHLA 1ZQMA 4ZITA 1XK8A 3IAM9 4FPIA 4QNLA 1B0VA 5MLCV 4YHHK 3SAGA 2RDIA 1BUXA 5ALIA 4L76A 5BPMA 1YJ9S 4NI2A 2ZZNA 2OZSA 4PXDA 3QICA 1Y64A 5DLFA 1GQEA 2B43A 4OI4A 1EWQA 1WHVA 4KLDA 3PRBA 5B0AA 4IO9L 1XSLA 3VAJA 4HLBA 3O9TA 3THWA 4IG3A 1P6TA 4CJSA 3WIUA 4UOHA 1AROP 2YNHA 2DT9A 2BCSA 3HMJG 2GX9A 4NXMF 5CR0A 1S79A 4O3NA 2BXJA 1ITPA 4F71A 2LI6A 5ETQA 2ZTEA 2IJNA 2CRLA 1DTTB 2LBOA 2UXCJ 4M5LA 3I56S 3JYTB 1ELOA 1X6JA 2O66A 5EOYA 3ID6A 2BKNA 3T1HK 1L3TA 4RQ1A 2JH7A 1ZJNA 2I9SA 2B4OA 5LMUF 1U6BA 3TQ1A 4FKYA 2I9GA 4PHTX 1NEEA 1LK7A 2ZFHA 4TY8B 4LF4J 3AVBA 5G5GA 4CHNA 2CGLA 4ZPDA 2B9WA 1GAOA 3QT7A 3KK1A 5EUHA 4OYBA 1IG8A 2P9IB 5M2UA 3O1WA 1ASWA 4QZHA 2MKYA 2A5XA 2BR0A 3PW0A 1IKXA 4Y2JA 4Z6CA 1UVMA 3MEKA 5H1SV 2QMUB 4A8KA 1FE0A 4FLXA 5AK5A 4WZQA 1HA1A 2HSEB 2R2RA 1PK1A 4DTXA 4M04A 1VHFA 3SCIE 4ZVTB 4FWOA 1PVPA 1RT4B 4Q44A 1CULA 4O23A 2UUBF 2KJ5A 1HNWK 3C23A 4YMEA 2BJEA 3CE8A 3MMBB 1SKSA 2AD9A 8ICXA 3NS1A 4DN9A 3EPGA 3GFHA 2BPCA 1KXPA 3UXNA 2P9KB 3K0JA 3TUJC 4O4GA 3OYMA 3I9V9 1U6ZA 2DL0A 3DC2A 5F3XB 2V34A 1CPZA 3QRRA 8ICOA 2NUHA 3PKMA 3RJMB 1T3NA 2QXFA 4GKKF 3DV9A 2H5EA 1K0TA 3CGIA 4DV4K 9ICAA 1S5JA 4ZP9A 3MM5B 1KTQA 4E7IA 4DV5J 1Y5IB 3T1YJ 4FO6A 4DTJA 2LEPA 2NYVA 4P10A 4ZA1A 3H1VX 4WE1A 3BS5B 3GOIA 3HLUA 4X66K 2P35A 1XMQJ 3LGMA 3VAIA 4PGYA 2Y8WA 5M1KA 3NCIA 4DU4A 2G9OA 2V7YA 3GLJA 4BR9A 5KPTA 4YOVA 5J2BA 4ZPAA 1NH8A 4OJGA 1KFTA 4DUYK 2R7SA 2JOQA 3EO3A 1RDUA 4TLRA 2LU1A 3KFWX 3MPUB 1VSLA 4LBIA 1QZ5A 3VGUA 1DTQB 5ALFA 3VQBA 4CJ3A 4AF1A 6AT1B 2E9TA 3A5OC 2RIJA 3WK7A 1YI2S 4DCOB 4FF3A 2AYEA 2XG8A 1EKEA 4Y1DA 3DAWA 2XBPA 9ICNA 3C2LA 1NH7A 2WSEC 3LWLA 1YJNN 9ICIA 2RVJA 3H20A 2KVQE 2VOOA 1MROB 4NLQA 4FJJA 5HP1A 1L7NA 4RQ8A 2AP1A 4MJKA 1SL0A 4U67Q 2PI5A 2EZXA 2XZWA 1KVKA 5E5NA 3BJYA 2DGXA 5BRDA 4CQ1A 4E7JA 2VH7A 4CEZA 3O6WA 5HBMB 3MMAB 4RQ6A 2AJ0A 4WQ5C 3DLEB 4Q45A 3H2VE 2ZJQL 2QK9A 1NGCA 2CVIA 3GR0A 4LC9B 2BM1A 5JUMA 2I6XA 2MHEA 3MEDB 2YTCA 1RLDA 3FZBA 2VDHA 2B4JA 1FJEB 3C2KA 1HNXF 2VA2A 3R5BA 2B6AB 3WDOA 4M3XA 4R79A 3ZSWA 2I38A 3GV7B 4ZPCA 1ZQZA 1BPDA 2CG4A 3WQPA 3ZCMA 5F1XA 1HWKA 2B9YA 4O0NA 3VN5A 1KHVA 2FVCA 3ETMA 3BSOA 5F0XA 3K5MA 1EB0A 2VCPA 4ZCMA 4KHMA 3HTVA 2ZD1B 1HL6A 2FMSA 2MSSA 2BACA 4V19S 3LVWA 2ALZA 3CJSA 2PY5A 1RWVB 2UP1A 4UY8O 3KLEB 3QFUA 3A0HU 5IWAK 4JI3J 4JP8A 5KOXA 5BPCA 4H4MB 1U2VA 2I5JB 4NOHA 3CJ8A 5KOWA 3T6BA 5DM7L 3HP9A 4O44A 4I4BA 2HFSA 3BGRB 3BSNA 2OPSA 1GX5A 4JI7J 3AGRA 4TUQA 3MEGA 3FBFA 2Z30B 4OZNA 1MQ3A 4JS5A 1JQGA 1KQGB 1VYAA 2IOHA 3I1YA 3D1OA 2HHPA 4Y2SA 1UZHA 1U26A 1YRUA 3SV4A 3CQYA 4K41A 4A59A 4F67A 4JI5K 5D4LA 4OQJA 4QWDA 4FDFA 3AA5X 1VLOA 4BVOA 5HMZA 1J5EK 3CJQA 4KHPK 4DTMA 3EXCX 2HNDB 4PKHA 4DR3K 3P31A 4DR7J 2RE1A 4MDAA 2IAJB 2X74A 3TFSA 1Q8IA 1TMJA 4QZGA 5J2NB 3GP9A 2QX0A 2Q3PA 1SKUB 2DFFA 2G1DA 4ED2A 4JRQA 1HQEA 1X4BA 4DTRA 4M5JA 3CT9A 3NMUA 3T5KA 2M9NA 5AM1A 2ZOMA 1KQFB 2P9NB 2WUSA 3CMEN 2QWPA 4CW7B 3JTOA 2BUPA 4RJVA 2LQ9A 4M9JA 1LW0A 3CCMS 3W63A 4FJ5A 1Q7LB 2N7YA 3NAHA 2FJDB 3OS1A 4MLHA 3K5OA 2O4GA 4WF9L 4E0DA 3C1ZA 5A8RA 1B3TA 5DLGA 2G8FA 1VDHA 5J2PA 1J27A 4FXVA 4KHPF 1FWLA 5BJRA 3DLJA 4NYZA 1I94K 3KZIU 2KJ9A 3E58A 3H8MA 4K42A 3SK3A 1T94A 2J0WA 3IR7B 2M5YA 1J54A 1S1WB 3WIVA 3V6JA 3Q0AA 4IOAL 2FJWA 1V4TA 2M2BA 3QB0A 3R5CA 5AE2A 3MECB 4UF4A 4JKDA 3QRPA 3UCUP 2V4QA 4HDHA 4OZ2A 3L2UA 4YOXA 5J1NA 2BW2A 5JLHA 4OYMA 3KOAA 3R2CJ 2W9AA 4RW6A 1CQMA 2G13A 1ZQNA 1S1VB 3O1LA 1XC9A 2BCQA 3OW2R 3D1HA 4NLPA 1CXQA 3OVBA 3W64A 1KS2A 2HBLA 1WHXA 3QSIA 4F0HA 3G25A 2PZSA 2J0QD 2ZM6K 2R18A 1MMLA 2MKJA 1K5OA 2YNIA 1PO6A 3GL1A 2RS8A 1RXWA 3KJNB 2CYYA 3K5LA 4OJ1A 1KVIA 3PYEA 1N48A 4PUOB 3LF0A 2HOEA 1XC3A 3KJVB 1AZSB 5KFUA 4F4YA 2G06A 1ILYA 3LW5C 1WAFA 4N8NA 4LFCF 5M1NA 1ZQUA 5KFHA 4ALZA 5AQHA 1WSEA 3M7VA 2FLNA 5DBCA 2YQEA 5HHIA 4AHSA 2J0SD 4QJVA 2C2RA 1SJ1A 2ROPA 1V85A 2HGNA 3GPAA 5EWEA 5J0PA 4UW2A 1RAIB 1SJQA 4OZ0A 3ADAC 4HTIA 4U95A 1FE4A 4LJMA 2F1IA 5HVHA 2W4CA 4PPZA 1WF1A 3RB0A 4UB5A 1BCMA 2DRAA 3CFRA 5D49A 1N5TA 3GMGA 5DG9A 2D41A 3ONNA 4DUZJ 1TELA 2YBVA 4FLVA 3BV8A 5CZVA 3EL2A 4KHNA 1C7YA 2I1QA 3VQQA 4RKUC 2OANA 4FWSA 3V6DB 1XNQF 5J2IA 2PD1A 2IDEA 7ICIA 3GYNA 2B9EA 4O55A 5EE0A 2JWLA 1NK0A 4JB8B 4KLIA 1NUEA 1ZAWA 1VQNN 5IFMA 5FPNA 3KIOA 2ADBA 1DQAA 2UXDK 4YEAA 2MQMA 3SSSA 2X78A 3U9ZA 4RZRA 5IILA 7ICNA 3H5SA 1NM1A 1RNHA 2ZQBA 2DKOB 3QZ7A 1LQ9A 2QN6B 4OJHA 1YITN 1WOPA 2Q31A 4GY2B 1P9QC 1T7PA 1DZ5A 2VG6A 4J9NA 2PMWA 3JSBA 2XWXA 1AB8A 3EJMA 1XNRJ 4DR6J 2VFVA 1SV5B 1IBLJ 4DX6A 1HWUA 1UW4A 1QHTA 1D0EA 3OYHA 2HHUA 5DS7A 5ELZA 4C23A 2BVZA 4RNNA 3OLAA 3H0MB 2HBQB 2ACYA 4ERDA 2ZJRQ 4KRWA 4CD1A 3L7UA 3ZZTA 2BOPA 3C6UB 3LZIA 3DOLA 4H0VB 1TL7A 2G4BA 5CYMB 4RX6A 4J2DA 3VQ6A 2FY1A 2MKCA 3CCQN 2NSCA 3N7RC 2WVDA 5BRFA 3T5HA 2WONB 3QEBZ 1YVFA 2UVUA 2HZAA 2KHCA 1FXLA 1H2VZ 3IA0A 3V9SA 3WZ0A 4CZLA 1Z00A 3FVYA 3LP0B 1HLUA 3ZNUA 4P7TA 3D45A 1QSSA 1TL4A 3TI0A 2DNMA 3B6OA 4GMJB 3ZYYX 3IMQJ 3LP1A 4C8YA 4KLLA 1UL3A 2H3ZA 3M8PB 2Y1RI 3KKAA 3CI5A 4PJ0U 3ENBA 4UOCA 2KMDA 2N4CA 4DSFA 1XN9A 2HVZA 1W2BM 2OA8A 4J9SA 2ZWHA 1T9TA 5AQLA 2GV1A 1RTDB 4PR6A 1PBAA 3BKFA 1HQUA 3V7JA 5KFMA 3MMJA 3T6JA 2ZOFA 2XB2D 2DBYA 2FMQA 4IO8A 3DLRA 3GE1A 5U47A 4AL6A 5J0UA 3POTB 3P3DA 3Q8LA 1Q0NA 2OPPB 2YJFA 4CE6A 5D0EA 3SMPA 3M4XA 3NLCA 4ES3A 2ETJA 3O9UA 3TZYA 4ECWA 3D6TB 3PFEA 4F0KA 1U0HA 4OYWA 4B3TK 1BOTO 3I55S 1SS6A 2VBYA 3HHLB 3AODA 2GJFA 1RWWB 4H4OB 2W25A 2FPLA 3VETA 2W2PP 3KKFA 2CVEA 1NK5A 2IGIA 4BC3A 5EGYA 1JWWA 3LPYA 1AT1B 1Y3KA 4MIBA 3GCXP 4K2JA 3F5EA 4I6WA 4YVZA 5AM5A 2NZTA 3KDOA 1DEJA 1JLFA 3GJRB 4GKJK 4Y2MA 3C95A 2R2SA 1A0OB 1BWFO 3NKYA 2VQFJ 2JEJA 3GBTA 1WACA 2XYGB 2Q6BA 1UAWA 4Q43A 3DXKA 2GAGC 5HK4A 1VMBA 2QGFB 2RS2A 4WFAQ 3VGTA 4Y1CA 2L08A 3L2QA 4LF8K 2QFJA 8ICUA 1XHXA 2WTFA 3QE9Y 4ECTA 4C6AA 2FY8A 1KONA 2BDUA 4B9UA 2EFQA 1QSLA 3MM6B 3SQGA 2BPGA 1M5SA 1Q5YA 1IWAA 2MQ8A 4A8WA 1N36J 5HMWA 2AA4A 1RT6B 3G6YA 3M9NB 4K7QA 4CLWA 1X3MA 3IS9A 2YJEA 4Z4IA 4RUCA 3QMLA 3ET6B 2CZ9A 3L0QA 3SNNA 4UAVA 3FUYA 3OJSA 1XMOJ 4DX5A 1QQ7A 3CPWM 1FO4A 3M32B 3EVMA 1D4XA 5K20B 4DG1A 2KHVA 2B6GA 3GILA 2DO0A 1L5UA 1RGVA 1GMWA 3LALA 4HHUA 4UZBA 3H3NO 1GXUA 3ENAA 3GG1A 3S9HA 3DM2B 2ZUAA 5CXTA 4LF8F 1R43A 2ZIWA 2ZTDA 1RTIB 4KREA 1FFSB 2D6FC 4ZPTR 3PIPL 3IDWA 1MW7A 2NRXA 4MKBA 4IG0B 4MH8A 4CGIA 3OVAA 2IA6A 2VPYB 2WHOA 3SEIA 2ZH7A 2D0OA 4OI1A 4ECZA 1NPRA 5DETA 2OP5A 2YKAA 3DXSX 2V69A 3W3DA 1SQEA 3TUPA 3NGKA 4XH4A 4K4GA 2UU9K 5T14A 3G0ZA 4GVBB 4FXDA 3PR5B 2IRUA 4ES2A 4DSKA 2WBRA 2N3OA 2RQKA 2KZ3A 2D69A 2XY8A 3PJ9A 3CCVS 5GMKa 3H98A 3VERA 2GEMA 1QS4A 1K1SA 5GADP 3HKZC 1WEXA 5ADXH 2W6KA 5D46A 5CR4A 3ZZOA 4KYZA 4M3TA 4M5IA 2JEIA 5HLFB 1ZQRA 5C2DA 4QW8A 2OSRA 2XNQA 4LSNB 5F8IA 4AHVA 4J37A 5J2QA 5LXYA 2F9TA 1TFRA 4F3OA 3B0XA 1U0SA 3C6AA 1RKIA 1ZA1B 4QIFA 4FLZA 5L9NA 2O4IA 1MSWD 2UUCF 5FPEA 2KXNB 2F2AB 9ICEA 3WKCA 2E7VA 1CJTB 2AW0A 2K3IA 4BC7A 1Q18A 3VAGA 2PEHA 4USIA 1ZQJA 5J0TA 4CEAA 4ZVRB 1M90O 1WHYA 4ILHA 3TARA 4NXZA 1EP4B 3AGKA 3AVNA 2JMGA 2IA0A 1CQNA 4LVOP 1CG2A 2H5IB 5BN9A 4JK1A 4DL4A 2P9IA 4RQ3A 1KBUA 3MZIA 2F44A 2XLJA 1HD0A 3RGIA 4DV6K 4EELA 4RLEA 4NYOA 2UVRA 5B5EU 6FDRA 4NLYA 3K4GA 4FXWA 3AAWB 3HSCA 4CGHA 3AMZA 1Q8LA 1C0GA 1S1TA 2GTDA 4U7UK 3CCSS 5IT9U 3TTCA 5I3QA 4F5QA 4CH7A 4K4ZA 5ETMA 2HRUA 1HYSB 2WF5A 1J53A 4YY3K 4DR5J 1YHQN 2DD8S 1VQ8S 2LDIA 5H9EJ 1KCFA 4P52A 1TUGB 2FQQB 2ZWPA 3MM9A 2C3OA 2HFZA 4IFEA 3W66A 4CE9A 1G3OA 1S6PB 2WSFC 2BBEA 2K7KA 3JXUA 2B3TB 2Z56B 1GH8A 4CDIA 1N32K 2ZZTA 4ZVFA 2CPRA 2KP7A 4F92B 3KYLA 2IDLA 4M2YA 1R7IA 4DV3K 1R8CA 2B8PA 4B3OB 3NS5A 1QCKA 1LW2B 2X6NA 2KVIA 3WXKA 4H0YB 1WKKA 4RCHA 3WXMB 1N33J 2HMXA 4YFUA 4KV8A 3VGSA 4BR4A 4KHQA 2H1YA 3OYJA 4ANDA 4P0QB 4HACA 2Z0GA 5J0XA 2EFNA 4ZCIA 3M2VB 1ZQSA 3QGIA 2KFZA 5CYQB 4CJRA 4OJOA 3QIPA 5LMNK 2MHNA 2FPHX 4LF5F 4CF3A 1SB6A 4DU7A 2GBZA 1DTQA 5FRNA 2HCFA 4OZ3A 3UCZP 3IRXB 5KFGA 3AJ1A 1VFJA 5DBAA 2HSZA 1YJ7A 3OS0A 5AICA 2AGPA 1FKAF 3SI8A 4UY85 3J7AN 4A8YA 4BREA 1FFUA 1A7GE 5KT4A 2BKPA 1N0UA 4UBBA 1TUYA 5AI6A 4IRCA 2XSJB 3QFHA 4RW4B 1UVLA 3V2UC 1S1XA 1ZA2B 4FLTA 5ALQA 4CH1A 4M63A 4JI1F 4ZVEA 3WK6A 3H5UA 1NKCA 1BDGA 1RACB 4DFPA 3O3HA 3CF5L 4NEYA 3QWPA 1TAMA 5SWMA 1U49A 4L72B 1YVNA 1ZPWX 3BY5A 2F8MA 1UEVA 4RQ5A 5K8OA 1JN3A 4A48A 2V8GA 2KN7A 2KT3A 1WHWA 3DLEA 3MPVA 2D3O1 3AO1A 1DQ8A 3VQAA 4XDCA 4CGDA 2P6UA 2G07A 2MGZB 4JI4F 5C7PA 1ED1A 3CXCR 3P38A 2E5LK 1MN7A 2BANB 2CQ1A 4TXSA 3BR8A 3PVXA 3PG9A 4B3SK 4R8UA 5EE9A 4WYBA 4DF4A 3DXBA 2YB4A 4EBCA 1H38A 2E1YA 4NYNA 4PG6A 1ZQVA 3AY9A 3VEYA 4P73A 1IBMK 5ALDA 3PMLA 3OVNA 4O8KA 2IYIA 5JVGQ 2CQ4A 4YD1A 3NY0A 5KG5A 4B3MF 4U67L 1BUPA 9ICKA 4B8CA 2ZTCA 1N5XA 1VK8A 3KLEA 3NVZA 3A5LC 2BX6A 2GELA 2DF4B 2GNKA 5KG0A 4I6MB 2HHWA 2HFUA 3UVJA 2HNYA 3PKYA 1GOCA 5KG6A 2A19A 3J80Y 3EZ5A 5EN1A 2ZHBA 2E2OA 2QWLA 2GX8A 5IV4A 4DL2A 2GZOA 4J9OA 3QAEA 4QYRA 4WCEQ 4FPBA 2K4IA 3JPNA 1OS5A 3BQ0A 2QB0A 3RB4A 3CJTA 4KGXB 2DTUA 1KN5A 4EYHB 2CPHA 5L1KA 4JKGB 4CF1A 1JB0C 1LCUA 3CDBA 1YWXA 4B3SF 4B08A 4PG7A 1HBMA 2QIFA 2B51A 2YMMA 4L6V3 1BQNA 2JRZA 1C0FA 3RW7A 2HS3A 4KLTA 4J90A 3DLBA 1ZETA 3MPWA 5HJYA 5JS2A 2O8BB 1U2RA 1JALA 4ZVGA 3TKAA 2XO6A 2CJKA 2HNDA 3W8GA 3OTQA 3KUGA 1X60A 1GLLO 4OL8A 3D2SA 3HKZD 1RDAA 4ZHRA 2CXYA 3RU0A 3EE9A 5BREA 4PCQA 1H2UX 2D9PA 1HJOA 4C3LA 2QLBB 2EAPA 1KDNA 2IVFB 3ATVA 1FW6A 5AKLA 2MZSA 1NK9A 3P5JA 3DKDA 4UT4A 3OTOF 2R42A 2XICA 5TKYA 2G8HA 2RHSB 4ANEA 5DQGA 5AE3A 4PG4A 3ISNC 3G2XA 3RUBL 5CB1A 1I6JA 1LWFA 2RHKA 3MUMP 2KLAA 3T3FA 2HHHF 5AKGA 4UB1A 2ZWOA 4OLPA 2IM1A 8ICBA 3H8WA 4C8NA 2QEXS 5DDOC 1XO1A 1NLVA 4M5MA 4OYIA 1ZQTA 3ZFVA 2GCFA 4KBOA 4JI6K 5KFCA 3OFFA 5DG7A 1RTJA 1NZBA 1N34K 1WN7A 1RDCA 2KSOB 3VALA 1HR0F 4FS2A 2F1FA 2XY7A 4YB1P 1NK4A 1ZOTA 1YBTA 7ICOA 5LSRA 4JV5K 1M6YA 3GWCA 2H3VA 2W9MA 2OD6A 3ZETB 1IVZA 3V81B 3NE6A 4QWEA 4M9LA 3WX8A 3DOMA 1DAXA 3DMJA 2J5AA 5HJXA 1NGGA 3M1VA 4KHUA 3CM5A 3TA2A 5CCMA 3G9CA 1HNVA 4QWCA 2K8CB 4OX9K 3RTVA 1JLQA 1O5JA 5AQNA 3MR5A 4I9LA 3O3FA 4RW7A 1FK9B 3FM9A 3WNEA 5LMUJ 2XC9A 1AW0A 3NBPB 4BJQA 3M6KA 4CFBA 2RMLA 2X6SA 3NF8A 2R7XA 3VCBA 1YJWN 4H03B 2W7OA 2QC3A 4O5EA 4USVA 3KJVA 2R4FA 3F5TA 1Z2ZA 2Y0SC 1A5XA 4RUHA 1B9FA 4F4KA 1KAZA 3UD3P 5BR8F 1HBUB 4LT6A 2J76E 1EETB 2QLFB 3M30B 4J7CA 4KLGA 1C1CB 2M52A 4PZNA 2YHBA 4MTPA 1RAGB 2YWKA 5CCLA 1TL1A 4X4PA 3ZX2A 2P9EA 4CZIA 1YF5L 3K1RB 3VCDA 3QGPA 2CJYB 2DNNA 2XULA 5AQYA 4RNHA 1PAEX 2AU0A 4PL8A 4F5RA 4DQIA 3HFZB 2XM3A 1IR2A 3DLHA 3Q8VA 4B3RF 5J29A 3W7BA 2MU2A 3RJIA 5C5JA 2VC1A 1CJKA 7ICEA 3RR7A 3KZXA 3FQLA 3V6DA 1VQMS 1RA6A 4PG8A 2NQPA 4FSVA 1C1BB 2WBMA 4OV1A 4NE9C 1HKAA 3VA0A 2DQNB 4C0HA 4FZXC 3KHGA 4DV2K 4O3PA 1K9MO 4B1WB 4GKKJ 3GJQB 2EZZA 2ZVIA 3NGUA 1UA0A 3GIKA 3HSJA 1UHUA 2VQEK 4MKYA 3AO2A 5K8MA 3RAQA 4J03A 4C4WA 4BRFA 4RPXA 2AIRB 5A8WA 4Y0FA 2DVIA 1M0SA 1Z4OA 2PA8D 2CWKA 3TEGA 2GVZA 4ED1A 4DQSA 2W7AA 1FWPA 1FT8A 2E66A 3QAUA 5I4MA 2KIWA 2WF8A 1FESA 2F3NA 2RH3A 4FS1A 2HQGA 2DGWA 2QKBA 4DHVA 2IYGA 3R9PA 1IBKK 4X65F 1ZRMA 1P8GA 4KGZB 3SQ0A 4NX9A 2J9EA 1RT1B 4DR1F 3HDSA 5FROA 5AQQA 3EPIA 7ICUA 3B8AX 1F9FA 1M5HA 4RQ0A 3V5RA 3OA9A 1Q79A 2RHFA 5CYMA 3N28A 4IJNA 4V19X 2GWKA 1X66A 5LJVA 4I29A 4FZMA 2RQMA 5HANA 1RQNA 4ZS6A 1ZTWA 1RT5A 3OFEA 3F2CA 3NVYA 4RBVA 5AQFA 5HMMA 2BV3A 5FDLA 4KHSA 3WC0A 4Z7CA 4LIWA 3KD1E 1IR1A 3HKZF 2XHWA 3JSRA 2YKMB 1APSA 1MWKA 1HNZK 4IQWA 4X4OA 1N60A 4TURA 1UT5A 4LF6K 1O1WA 3Q8RB 4I7FA 1RXVA 5EU7A 1X5SA 2M70A 3BGOP 1FIQA 3W60A 2VKRA 3M5RA 3UD5A 2YWEA 1Z4UA 4X62F 2X51A 1RU1A 1RTDA 2AX0A 1QSYA 1V5VA 1B43A 1BPYA 1N88A 4FM1A 1ZBSA 1E6VB 3RH4A 2QA4N 4FVCA 4RT2A 4JYAJ 3QNMA 4NEZA 1Q8BA 3V1RA 3POTA 2F8EX 2KJ8A 1NHKL 1YUWA 1RT7A 3CJ3A 4U8YA 3T1AA 1KD1T 2RU9A 4XDDA 2HPUA 4CBUA 4US9A 4C8MA 4KITB 3DRYA 3TJAA 2W2OP 1FRJA 3W2VA 3WXJA 4KE5A 1RQ0A 1V3RA 4BHQA 3HHLA 3H8JA 3VVTA 2PO4A 3AH6A 3KG4A 3AHPA 4OI3A 1B7FA 4FJLA 4KGVB 1RAFB 3PACA 1NMNA 2OEHA 3KLHB 2Z2ZA 1SKRA 2XYHB 4P6QA 3FRYA 3P39A 5B0EA 2YKQA 5ALLA 4BE0A 3Q2SC 1LVHA 4O0IA 4USUA 3P49B 4BC2A 3KG1A 2KZZA 3TANA 1NXIA 3H0PA 1NJIT 1DGSA 3TUZC 3GDQA 2UXBK 3HK2A 2EAOA 4CI6A 3HX9A 1W97L 2MLZA 4O0JA 3SV3A 2HBZB 2W2MP 4JLHA 5J2KA 1WSVA 3MOZA 1NU0A 2O8FB 1HWIA 3KK2A 3DGVA 5B0DA 4CLZA 4LRAA 1NHVA 1RT2B 1C0TA 1ZQYA 2VV5A 3HSTB 1DK2A 1SBRA 5A0LA 4X4TA 3DI6A 3PYFA 1N5YA 2BE2B 1S72N 4XH1A 2XQCA 3MM6A 4FWPA 4YN3B 2EQYA 1V3ZA 3A3OB 2QTDA 4YDUA 1RT6A 2O3DA 2R9LA 1TU0B 1ZM9A 3C66A 2C2ZB 3NOCA 2RT3A 3OYGA 1R8AA 4C8OA 3FBBA 4MF2A 2M8HA 3VGMA 4HHHA 8RUCA 4NZ6A 1VC0A 3R1XA 2ZJ8A 2ZG6A 1DXSA 1Y5NB 1L6NA 4JV0A 1R0AA 1JLCA 4K59A 4F4WA 3FJ2A 4LY7A 4Y2YA 1U4BA 2J9DA 3ATUA 1YJNS 4CTAA 2VC0A 1O13A 4X4QA 1YI2N 3SUQA 4BC9A 7ICVA 5A76A 2KYZA 5GTHU 1QY7A 5E33A 1SIJA 2NZCA 3A8JA 3V6KA 3I0RA 4JS4A 5KL1B 1IV0A 4K8XA 4NYFA 4NLCA 3G4SN 2XCAA 1X4HA 4MF8A 2VBZA 3SQOP 5AQSA 5KFPA 2GHWA 2L3MA 5T7LB 1ZQPA 5J0OA 2XI2A 4GVBA 2P9UA 4TQRA 4CEQA 5ALJA 3ZT2A 2CNOB 1CLFA 3DLLQ 1YLXA 5LL6d 4PKIA 4DCCA 2HFNA 2J4RA 1KL9A 3U26A 2ZH5A 1SH3A 4RQ2A 3EDQB 3PIOL 2UXCF 2IVPA 3X3UA 4O5FA 4BGDA 4ED7A 4A8XA 1PBUA 2P2CB 4HCBA 4ID5B 3QLHA 2V9WA 4JB3A 4DFKA 4WWSA 3ZEUA 4NLSA 2CJQA 3UWTA 1JLBB 4ED4A 1VBYA 2WZ1A 3CJCA 3L7OA 1S59A 1WKJA 4LF4F 3NNHA 3OPKA 3KKRA 3MAQA 1BA1A 2F4VK 2P9SB 1F44A 4DHYA 1RKJA 1CJTA 4EIAA 2C22A 4CT9A 5GMDA 4ZPBA 4RQNA 2JH3A 1W7WA 2LFVA 3QT6A 3OYLA 1NPKA 3TP2A 4AQYJ 5F0UA 4DV0K 1PJ5A 4ILMA 4FK4A 1NU4A 3G82A 1HJPA 1EP4A 4ICLB 4KLSA 3QWUA 2IC3A 2W8LA 1JXVA 3PO5A 3HSZA 4P9SA 3E9PA 5HOOA 4M6WB 2HVIA 3CNHA 2V8PA 1RZMA 3GV5B 2IY5B 1P1TA 5AZIB 5L38A 1UA1A 4QCLA 2U1AA 4KH1B 5AQGA 2E6MA 2JH1A 1B64A 1XMQK 4Y2KA 1TKDA 1LXJA 4F0MA 3O9SA 2UVWA 2PI4A 4CHQA 2GW8A 4E1JA 2D3UA 5HQMA 4HT7A 4DN0A 1YTUA 4FWMA 4B17A 1LKYA 2EK6A 4UTGA 2H4WB 4OX7A 2MY7A 2D0PA 3I87A 2LMIA 2QARB 1UJ5A 3ISBA 5ADZA 5AXNA 1PG5B 2WVCA 2JFKA 3I32A 1TV9A 3CHWA 4RQ7A 3S7RA 1ESVA 1RHKB 3OBWA 3AVJA 3UR0A 3IHQB 1H1VA 3W62A 5DQIA 2O8CA 3OYAA 5C24A 2EH9A 1FA0A 3CMES 4DV5F 2ZOGA 3CUNA 3T1YF 8ICSA 2VJ4A 4KMOB 1B99A 1U8WA 2WK4A 4K8ZA 4OHXA 2RLTA 1S76D 1X9JA 4F4AA 3FZLA 3H4BA 1LNQA 4Y34A 2QMXA 4CBXA 4MEYA 4WU2A 3J7YU 1NDCA 4L73A 2WF7A 2RN2A 2C2MB 1LW2A 1WSJA 5AQMA 4DPWA 4BDZA 1TV6B 2Y1IA 4BR5A 1S0MA 1W25A 1B9DA 4ES1A 3JTPA 2EXUA 4NY8A 2RDJA 4ISFA 1UWAA 5IIJA 1U25A 2HK2A 1XEZA 2E1MC 3AVGA 4BC5A 5CYQA 2DNQA 4X2BA 4H5TA 5AFUA 2XMWA 5HR7A 1M5PC 3F9MA 5JICA 3UXPA 4RNOA 2QI2A 3JPRA 1LOTB 3CCUN 4ZVPB 3FR0A 3CIMA 3M1YA 4DQ8A 2NZ4A 1ZQDA 4NXNJ 1MDUB 3O4QA 1C0UA 5AQJA 4KY3A 3R9KA 3O4WA 1NDLA 1P90A 1A0PA 4RTFD 4CLSA 1FD2A 4JI3K 3QJPA 4H8KA 1Q8KA 1QQCA 3CG7A 3K9KA 1QTMA 2G8WA 4Y2XA 1S9GA 3LTOA 1GOBA 4J9KA 5EE1A 4WK3A 3CO0P 1MN8A 2P6SA 4NRTA 1BU6O 4JI7K 1REVA 3A0BU 5IQQA 1YTAA 1CBKA 2CKWA 3G6VA 3CWJA 3LQVA 4GFJA 3VTIA 4RL1A 3U8XA 5L46A 3WBZA 4X64J 2FHKA 1CUKA 1OQ3A 3VGLA 2MZQA 1RAJA 3Q23A 1Y4ZB 4B9LA 4YDDB 3KLIB 3FFIA 4DTPA 2ZIVA 1HYVA 1I51B 3MF5A 1B92A 4M1KA 3WK5A 2YNFA 3OTBA 1Q78A 4BDYA 4JRPA 4C48A 4QAGA 4I28A 3MDQA 4FJ8A 4JI3F 4YMOA 3AEVA 4P72A 3IRWP 4U6PA 1RUSA 4P75A 1GO3F 4FJXA 1RFQA 1FKPB 2R2TA 2VGNA 2KTQA 2YX4A 4FE3A 4JI2J 4I6MA 1JLGB 5AKKA 1K0VA 1WUAA 5BYSA 2VB6A 4DQRA 3KTQA 2V0NA 1R6VA 1U9LA 2P9LB 1UVKA 5J0QA 4RPYA 3V7LA 2GS8A 1FKOA 4TU7A 4NCBA 3S3MA 2QWNA 4FWQA 2K4EA 2GIFA 3DU6A 2V8HA 4QZCA 1S5LU 3C2MA 5B0GA 1R8HA 3QIDA 2H3IA 1P27B 3JSMB 1VQNS 3SCXA 3OGUA 1VR6A 4N8OA 1VQKN 2EFPA 2XIDA 3Q83A 1CZ9A 3PFOA 4DR7F 1PVQA 3A0IX 2B5JB 4OYZA 2PBDA 4IEEA 4ICAA 2RRBA 1YITS 5ALHA 4PH5A 2O8BA 5JVGL 2GMJA 1OSDA 4OZ5A 4YORA 1F2HA 4FF2A 1IQZA 4BG9A 3CJ2A 1SCJB 4USWA 4YOUA 4H0OA 3NCRA 3ZDEA 7AT1B 4NMXA 2X7IA 3BF4A 1VBXA 3KHRA 1S4EA 4KMUA 1VQOS 4DUTA 1S57A 3O2IA 5IT0A 4JKEA 4WCEL 1A5VA 2OIHA 3IP0A 1N0VC 2WB1D 3H4DA 4X4UA 3DOKB 1IKVB 2RU3A 3RSEB 4Z4HA 3IFEA 3MAAA 3C5GA 2ES6A 1YQHA 2H3EB 3D1QA 3AQPA 2GC8A 2GQQA 4M7YA 3CCQS 4E89A 4OX8A 4BR0A 1P9YA 2HMIA 2DFEA 2KVSA 4I2QA 5A8KB 4QS7A 4LR8A 5ALPA 4ELUA 4Z7YA 4FJIA 2GO8A 3MR3A 7ICHA 2KOBA 3OXLA 5KQ8A 2BRKA 4KTQA 2H51B 4TYBA 3PRVA 4M3ZA 3T9NA 3IBCB 3HI9A 4ZLJA 1HYZA 4PWDA 4KLFA 2CH6A 3PO4A 3VV2B 4K43A 4HTUA 4AM7A 1YZ7A 3FCWA 5E26A 4JKHA 2AJFE 5DDQC 3AD8C 2FBTA 3BPSP 4U8VA 1YX2A 4M5NA 2DR8A 3WXIA 4GV6A 3MTKA 1EXNA 2G2YA 4HVJA 3K1ZA 8ICYA 3HHDA 1TL3B 3ULEB 4W4MA 1IKWA 3OL6A 5KFJA 1MWQA 4R5PB 4DUZK 5ALYA 3TAGA 3L7PA 1IJEB 4OCZA 3OYNA 9ICBA 2KHOA 1C4CA 1FK9A 2GQCA 2C2NA 2UUCJ 3ZSYA 7ICKA 2BJ8A 3QEWA 4CO0A 4A46A 1FVSA 5K14B 4LRBA 2F4FA 3TZWA 4QU7A 1ATNA 1IR0A 4CRXA 1NGEA 3N5BA 4NL5A 3C7NA 2UUAK 3MOJB 2A40A 3D2EA 4CJVA 4JK8A 5ETOA 2CUYA 3I55N 2F8TA 3VF4A 2PC6A 3MTJA 2UUTA 4DBQA 4DV7K 4IO1A 1PYSB 4DPUA 4IRDA 1HNIA 1H3DA 5IM0B 2GGPA 3PW5A 5D0GA 2KFNA 2AT1B 1SQKA 3DNCA 4RPFA 4K4UA 3DDKA 3ZD8A 4ILRA 4KH5A 4Y2IA 2IVOA 1Q3VA 2WCXA 4Z2XA 4KAIA 3K59A 3ZSZA 7ICQA 4CZKA 2UVVA 4G6VB 2FC8A 3CM6A 3MWPA 4DR6K 1CJVA 3AVHA 2HBKA 2DH7A 3D0HE 5ALVA 1WSGA 4C7YA 3GYGA 1ZAVA 3AO3A 5FPMA 2F9DA 5DRKA 4F26A 2HF4A 3FDSA 3OYEA 4K8RA 1TKTA 3VWSA 3MFHA 4W92B 1UJ4A 2NYHA 3WQUA 2O8DA 3FC4A 2W9CB 2OLWA 3QATA 3NGSA 5C25B 1YXQA 1KW4A 1FXDA 2RNEA 4KKOB 4CJQA 3QEXA 2ERRA 2DCUB 2HS4A 3GIJA 1HX1A 4DFDA 3HF5A 2QV6A 3FE1A 4YCXA 4CZGA 2OD4A 1G15A 1XNRF 4DR6F 3UN3A 5ETSA 2JWNA 1IBLF 2IMOA 5CYJA 4B9MA 1DLOB 4PABA 1N6QA 1JRPA 4ETXA 4CM2A 3TPQA 4ZN1A 3CJKA 3CERA 3UMBA 4LF5J 4PG5A 1HD1A 1UMJA 5L1LA 1OVYA 4KI6A 3ILOA 1Q53A 2GIQA 4I2PB 2GO9A 2WFBA 1TYQB 2ZIXB 1UWBB 3ZSOA 4ZP7A 1GNKA 2ZH3A 3N6MA 3GZ7A 2JZBB 3FK4A 4PHAA 3ZSVA 4KT0C 4CF9A 1NPPA 1COOA 2OI2A 1K8KA 2OKQA 1CVJA 2Q66A 3IM9A 4PZOA 4A8OA 2E4LA 3BZQA 4BRHA 1I5OB 1MU2B 5THWA 1T6CA 1X5OA 2C3UA 1L3KA 2VPZB 3RMCA 3LANA 1HHTP 3MCOA 4ISGA 4JI0K 4KBIA 4JI1J 4OMFG 3H2LA 2MUTA 4CZEA 2ZBCA 2XVTA 4JV2A 3F73A 4CH0S 3KFUF 3H08A 3KHHA 2CQ2A 4FLYA 4HL9A 5AK3A 1ZQFA 1E3MA 3KD3A 4OX6A 5HO4A 2ROEA 1JLEA 2LKZA 3KLFA 1WAJA 2I8EA 4B6JA 2F40A 1Q9XA 1N5VA 3TZZA 4H4KC 4ZK7M 3SPYA 4O5BA 1VSFA 4P2XA 3BQ7A 4G9BA 2VQFK 4FJKA 1BLUA 4LQ9A 3C14A 2WB1F 4KH4A 4BRMA 2CQHA 2E8MA 3KHYA 5GAHI 4R0EA 4JD2B 2DY4A 4OLAA 2FVQA 4BVPA 5KT5A 1BMQB 4I27A 4DL5A 4RT3A 3U6FA 4KC5A 2CGJA 2ZE2B 3JPSA 4LJXA 3C6TA 5LJ5Y 4Y2CA 3SDEB 1TZ0A 2F3JA 3TW0A 4FW1A 7FDRA 3DHWC 1WEYA 1RHUB 3D2FB 1UCVA 2QWMA 1KLMB 1WOSA 1QVGM 2BCRA 1X0PA 4JK7A 3P1GA 1V9OA 1UT8A 2HHVA 4C98A 2MAXA 4LQ3A 2AKWB 1F5BA 2BW7A 3BGLA 2PA3A 3V4MA 4N76A 2IRXA 2Z1GA 3QJJA 2ZH8A 4KLQA 2BUNA 3RJEA 1SH0A 3CDEA 1YHQS 1WWVA 4NV0A 1JI7A 2NXNA 5C42A 1FRHA 2KQ2A 3D0IE 4M5DA 9ICHA 3DLGA 4OLBA 2NSBA 1RT3B 3K57A 5CZ1A 3LAMA 2UV8A 1FFWB 2O8FA 1HIWA 4YHHJ 3AU2A 2AJQA 1RT2A 3W3SA 3NOGA 4H0XB 4ILJA 3J80O 1N36F 1UKUA 3M9OB 5J2AA 3I5AA 4LF7K 2JZ5A 1GLCG 1BPZA 5EHHA 2BE2A 3PM9A 2ROGA 2EFVA 1FJGK 3VAMA 5FRMA 3DRRB 1FEEA 1XMOF 1MNEA 4C9DA 3NNCA 2FIUA 1FI4A 1SIZA 2E1ZA 4ZCLA 4LFAF 1JLAA 2VG7B 3K2PA 3LDAA 3DGPA 2HGLA 2HHHJ 1D09B 1D3WA 1OO0B 2DHAA 4MMOA 4PKGA 3CCWA 5E3RA 1V5IB 1N8RT 1SQGA 3VQCA 3RH5A 4CLFA 5AKZA 3DYAA 4CJTA 3T1HJ 3BO4A 4WBFA 2QG9B 2RP5A 3WU2U 5D0RA 2YX1A 4ED6A 2VGMA 2JWKA 3B6BA 2RJZA 4N41A 3DXMB 4DSEA 3O5TB 4IQUA 1SV0C 1RAEB 4DPTA 5A0YA 1IV8A 3SJJA 4L3NA 2E2NA 2FJVA 5D4OA 1ZM4A 1OWXA 1O0PA 3K89A 3EGZA 3FKBA 3R8YA 3TVYA 4QS9A 1FCAA 2H9ZA 1M1HA 2IIHA 3OHBA 4NL9A 4FZVA 4FBUA 3OBIA 4LRCA 3K9JA 3E0FA 4HYKA 2EW9A 3JXOA 1NCLA 2NS1B 5AJ3K 4O3SA 2ZBQA 5A2QO 4OHWA 1SGGA 1RADB 4PWUA 4LF9K 5HNKA 3B4DA 4FPAA 3N97B 3S01A 2R8JA 1FO1A 4X4NA 4KO0B 1K47A 1NKBA 1YJRA 4OZJA 4ID5A 1RYSA 4DOZA 2C28A 4RUAA 1AUSL 3TUIC 3PSPA 2W6LA 4C11B 1HNWJ 2QXLA 1OPIA 1VRUA 3GG4A 1WOQA 4DR5K 1KQQA 3RJHA 2I1RA 4WFNQ 5IC4B 4IFYB 3IG1B 1DFDA 2QM1A 1NHUA 4QWAA 4ZIWA 4PY5A 1N54B 3QBWA 4FWKA 2HQCA 2P66A 3GSDA 5HN0A 2BHNA 2EK1A 3HOTA 2DHHA 2LQBA 2DR9A 5AQZA 3CMAN 3MN6A 4ICLA 3DLLL 4EU0A 3L6QA 1K73T 4K0KF 4DV4J 2CZ4A 4IDHA 3IMXA 4M95A 4K5RA 1NZPA 1VIXA 1ZH5A 4RBTA 4IOXA 3QNOA 4YQWA 1KVJA 2RRNA 1Z2LA 1HUXA 1QAYA 1N33K 2AJ2A 3UDVA 4YMMA 4WP3A 4X66J 2ACMA 2VG5B 1BCOA 3RBZA 1QAJA 3AO4A 3WEEA 3TAMA 1WWHA 4UUWA 3PW2A 2PT0A 4CZHA 4F2RA 4DUYJ 5HRRA 5FJ4A 2W41A 2NXUA 1VBKA 4OZLA 1EX8A 2QARA 8ICGA 3W9JA 3IDHA 4ECQA 1QTNB 1NI3A 1R3NA 1KNZA 1QE1B 3P8BB 1WKLA 2B8QA 1X4DA 2EFGA 1B70B 3CIPA 3HHKA 3VQPA 1KBRA 3UQ2A 3EY1A 1QAIA 4E98A 3U02A 4NCAA 3LP2B 4JV1A 3HVTA 3DRPA 2LM4A 4GC7A 4M5GA 3MM7B 1WLJA 2DIVA 3R9LA 3RMBA 4QIWF 4LSZB 4KR0B 4FM0A 4DR4K 5AR0A 3D54A 1JJ4A 4AXIA 4B1UB 1KD1O 5GAHP 2HQDA 1QQNA 5ETKA 2X1FA 3OR2B 2J6UA 4PL2A 4ZOHC 3M8YA 4X65J 5FLXY 3AA2A 1FEHA 4KTZA 4K4VA 2J6SA 3CCEN 3W1YC 4NLZA 2JNJA 1K6YA 4MFAA 4QQBA 4FVUA 1UW9A 3HHEA 2GO7A 5AXLA 2XY5A 2XCPA 4NWBA 4FCYA 2F8SA 2V4JA 4C97A 3BKTA 2GJ2A 4XK8C 4BRNA 2HOFA 1RGIA 1WCLA 5K4LA 3QUQA 4OPAA 2MQNA 4CF5A 4NLXA 2F8LA 2XS5A 4B1XB 3TVZA 3TX8A 2KN4A 1NJIO 3GIRA 3CD0A 3LA0A 1VJWA 3EZUA 4CZCA 3AJDA 2Z2MA 1KR4A 3EM1A 1T3OA 3FC9A 3ZT3A 2BEFA 4ZLLA 2DBBA 4TVAB 3L2WA 2NUBA 1NKEA 1Y0HA 1RBAA 2RQ4A 3B4MA 4K2XA 3T41A 2M0NA 5CZ2A 4RW8A 5IWAJ 5G0RB 3U1MA 1RYUA 4CGJA 3NGYA 1TKZB 3CJRA 2NO4A 9ICVA 4MK7A 4AILC 3JAMU 5ETPA 2DGOA 2ATQA 3ITHB 1JXEA 4F5PA 4UZCA 2H5XA 3M6WA 5E0OA 1YJWS 2E9RX 4LFBK 4JWMA 2RF2B 1KAYA 4PHPA 1IIPA 3V1OA 2RSQA 2ZHOA 1UFLA 4JI5J 1K44A 4EO8A 4BS2A 3Q8PB 2DGUA 2A1SA 2XGPA 3OUYA 3NTUA 2Q0ZX 3AVLA 1NZ8A 1RILA 3R6GB 1J5EJ 3LOUA 4KLEA 1DT9A 3FRZA 3SSQA 2WOMA 2MSTA 4BE1A 4DR3J 4M47A 1W7AA 2YHYA 3QO9A 4NLRA 1OY9A 1KKHA 5CHGA 3TACB 1YRTA 1AXQA 5KG4A 2MDAA 3CJ1A 3KLGA 4IOCQ 2R8IA 1JLGA 2GVDA 4NLTA 1Q5VA 5KPRA 3IBWA 2DISA 3H90A 1UQVA 3DLKB 2COLA 2G0JA 3H0LB 9ICQA 3JS9A 5IOLA 1VK0A 1KOOA 3PRDA 3HZGA 2P9LA 3IKMA 3SLCA 2IM0A 2LQJA 5D4BA 3NS6A 2D3OR 3V9XA 2FC0A 1D9AA 4XUSA 1HBOA 4WFBQ 3H5XA 5GAEP 4CT8A 1S6OA 4E2FB 2P1JA 4CYUB 3MBYA 4GVLA 4CHPA 4NCGB 3H40A 3HZEA 2RPIA 3I5BA 2NLWA 2CDRB 3ZTRA 2EEYA 3EWAA 4J91A 2EDUA 3AARA 4CLKA 3RFAA 5DMRA 1SXDA 2CQBA 4N77A 4P4PA 9ICWA 4DFJA 3NGTA 1P1LA 3SPZA 5KNIA 2MKSA 4AP9A 1JUDA 5ALKA 4IXCA 4G65A 3EE3A 2DIUA 3W5XA 4NXMK 4TYAA 4IR9A 2IRYA 2KI2A 2FTRA 3KNAA 4MFFA 3HVRA 3CJ0A 3A8KA 4BBYA 3PSIA 1ZBIA 3AM9A 2OHDA 2Z4PA 2K1RB 3BYRA 4FZZA 3DOKA 3BH6B 3KK7A 1XI1A 1TVRB 2I7PA 2Q0RA 1BNPA 3OTDA 4CIEA 5LMUK 2QLJB 2ZM6J 2YKNA 3I28A 3UD4P 8ICZA 3B9JA 3TR5A 5AZJA 1ZJMA 5A8KA 4NLGA 3BF3A 1Q86O 1X9XA 1OH8A 1T4GA 3OLBA 4DOAA 1QQOA 2DR7A 5AIBA 4CIGA 1XUPO 4BXOA 4DSIA 3LWMA 4IS7A 1MA7A 3E9OA 2D5RA 1NNEA 2Q3SA 3UKUA 3P83D 4I2DA 3ETLA 2E5JA 5FP0A 3SFUA 3PW7A 2HKEA 1BD6A 3MM8B 4N7TA 1YIJN 1T3VA 3D6MB 5KG1A 2MJNA 1L3VA 3TTFA 4HEA9 1RWOB 2LEBA 2QA4S 4I2CA 2EFOA 5DDYA 3NHGA 2IHMA 2P6RA 1LWEA 1W2IA 2UUBK 2DXFA 4R5PA 3FSXA 4FPRA 3CSKA 2FHJD 1HI0P 4C0ZA 4DI6A 3OYCA 3FZHA 3EW9A 3LYSA 1RDFA 4DF8A 4F3TA 2O8EB 2QA4G 2OPQA 1RCXB 5K14A 3S3OA 5J1EB 4FJMA 3UIQA 2WC9A 3NP5A 4XPCA 4C8KA 1NOYA 4BWMA 4Y28C 4GKKK 4FBTA 1FNXH 3TSQA 2QRRA 1EQMA 3NWRA 2P9PA 1VQ9N 1UPMB 4IUFA 3VQSA 5KFXA 3KDNA 2V2ZA 3LK9A 1ZQEA 4CO4A 1OH5A 1VDVA 3SAFA 4E19A 4G1QB 2LHTA 1UTAA 2C1EB 5DJBA 3ZD9A 4QZAA 2V2VA 4WQ5A 2OGUA 4OPJA 2ZDOA 2UYTA 2MSNA 1JKHB 3HI0A 3QEVA 3HZ6A 8ICFA 4ZCKA 2LA4A 4W5TA 3FMBA 1B0PA 2E5SA 5ALUA 3UDEA 4U7BA 2C3PA 1FTRA 1CZAN 3QDKA 1QQ6A 4BR7A 5D0HA 3SBMA 2KIVA 1UETA 4PYAA 2VKQA 2ISOA 3HW8A 2X3GA 5D3GB 1U1RA 2VICA 4ID8A 5H2FU 1S72S 3L4BC 5J2EA 4Y2QA 3THYB 4MFBA 2Z7JA 1PUZA 2YN4A 5ETLA 2C2OB 3B54A 2ZUGA 2A1JB 2ASOA 4M0AA 4J2EA 5EWFA 1HIYA 3BS9A 2VUGA 1DK3A 4WJ3B 1RE1B 4DOBA 1URRA 5IIOA 3S3NA 4A8FA 2CNNB 3RVCA 1XSNA 3A5MC 1SH2A 3JQMA 3WUHA 4BRPA 1ZQXA 2BOAA 3A8IA 3A5NC 7ICFA 2JL9A 2H48B 5LJ3Y 3W9IA 5AK4A 1NSQA 1VLBA 2ILZA 5B08A 3ENHA 5GAGP 4GV3A 3R5DA 2RAQA 1ZD5A 1G4CA 4B1VA 1NAQA 1UEUA 2AZ3A 5B7WA 4JHDA 1JCFA 3UI3A 1HNXK 4J9RA 5C0YA 4DX7A 5LSLA 2QSWA 2MY8A 2RUGA 1SL2A 2BJ9A 1BI4A 2KHDA 4I68A 4CNQA 3SZ2A 2IFXA 3CDWA 1A6SA 2QO3A 2F1HA 4Q8EA 4LSLA 2KKPA 5AKEA 5F8LA 3G4SS 4JI8J 3TAFA 2W1BA 3MEEB 5KI6A 1NOZA 3OW2M 4TKTA 1XNSA 1W26A 2O5DA 4A5BA 4I2JA 8ICHA 2F65A 3E3XA 2OHFA 3N7SC 2G08A 3FEZA 3OFHA 4I2HA 3WKEA 1LWCA 3WKBA 4Q0BA 3LGNA 3CETA 3SMSA 2ZGYA 4O3MA 1Q1KA 2P51A 4DL0C 2NR0A 4IZ9A 1S6QB 1HWLA 3K7RA 3IN5A 1WORA 3SXLA 5K9FA 3UDLA 5A6WA 5J0SA 2PFQA 2KT2A 4M5HA 2GUIA 2YQ1A 3GFYA 4JYAF 3C8YA 1HBNB 3EUB2 4PQUA 4GKJJ 4AYBC 3RAXA 4AXJA 5ADXA 4EP5A 3MXIA 3ZSXA 4W98A 3PNIA 4UOFA 2EBGA 4C1NK 1S7HA 4YOYA 2VASA 4C7QA 1KTVA 2U2FA 4UY8T 4JD2A 1NNDA 4WP8A 2K8BB 3M6UA 3BQ2A 5J1PA 4O3OA 5IINA 2BPFA 2E7WA 2F76X 4MK9A 2J0XA 2ESEA 3I8DA 2W11A 2NCKL 1ZQGA 1X1PA 2OXOA 2FB0A 2ZE2A 4CECA 1RTZA 4NI2B 3QFWA 2Y0BB 4MT1A 1Z25A 4L3QA 4TUSA 1ZM3A 3GIMA 2DWQA 2JGAA 3QERA 2BE9B 4M45A 2CJAA 1CJUB 3NEKA 3THWB 5HRSA 4IG3B 1NBEB 2HOIA 3VEXA 1P7DA 2YNHB 4BRDA 1NB7A 1KWMA 3NS7B 2VPXB 4BRAA 5HROA 1DRGA 4A8QA 2D3DA 2BRLA 4M5KA 2CJ9A 3PUFA 4PPXA 5J2JA 2HQIA 1ZQAA 3ULHA 3MURP 3AL0B 5AE1A 4CNYA 3S8SA 1F3VA 3AFGA 3LM9A 2XRIA 1U24A 2HURA 1RTHA 2LLZA 2DNGA 1UOCA 4Q2LA 1RT3A 3R2DJ 3P4IA 4BR2A 4CFCA 3MGHA 4FF1A 1J5OB 3I96A 2PXIA 2V8DA 3N4MB 1FJCA 7ICLA 2JX2A 2OM6A 5F8MA 1T05B 3T69A 1KQSM 2MA1A 1BWVA 2UU9J 1SZPA 4F72A 3KK1B 3BUZB 2JDJA 4TY9A 2LPEA 3KUEA 1ZBUA 1JIHA 3FCHA 1PC5A 3ZI4A 4RPZA 3ZXWA 2CIMA 2I2YA 2W2NP 4NLVA 2V50A 1RBSA 3WT0A 2VG7A 2XLIA 4YOTA 2HNZB 3T5LA 6FD1A 4I69A 4OKEA 3CCUS 3ILJA 1S9EA 1PK1B 1SWVA 1XQIA 1CEZA 2KG1A 1CULB 1BPBA 3KMSA 3J81U 1ZTTA 5KFZA 1RI7A 5DBBA 1OXJA 4FNHA 4LFCK 2CG8A 2UV8G 3LDLA 3DXMA 2MLYA 5ALEA 3HL8A 4ID1A 2FGOA 4HWIA 4MKVA 5BR9A 4J9QA 2E1EA 8ICQA 2LYAA 3EEQA 3HO1A 4OHZA 4USHA 3SENA 4J2AA 3O4NA 2H5JB 2VIHA 1S6UA 4F02A 1A5WA 2FYXA 4CJUA 1VC5A 4WE1B 4HDGA 3FZMA 3MAHA 2HEKA 4DV6J 4DSJA 1SL1A 1XNQK 1VGYA 4PXEA 4Q7AA 3R7NB 2XLKA 1Y5LB 3GZFA 1NSPA 3K75D 1F9EB 1NZAA 2I6WA 3Q2TC 3V6HA 4F93B 2WSCC 4M9HA 3RZAA 5IIKA 4ZPVR 4AQYF 5JS1A 4YY3J 3PX0A 7ICSA 5M1QA 4C2MA 4WYWA 1VQ5N 5KFWA 3F2BA 1HUZA 1NB2A 4USAA 2GHVC 4RNFA 2G8IA 2HF3A 2P5OA 3D67A 3I33A 2ASYA 5I9EB 1Q95G 5HP1B 2IS3A 4DMZA 1Q82O 5M2RA 1N32J 4A2AA 1X0FA 1RAHB 3VA3A 4ZTJA 3ZZZA 2HVHA 1WSHA 3QRQA 5DGAA 3SBTA 5GADI 1VQKS 3PTWA 1GLEG 3NGZA 4FYYB 5CA5A 4BQLA 2VWBA 2XMMA 5K5MA 4EZ6A 9ICLA 4HHTA 1B22A 1AQ6A 2HHTA 1FX4A 9ICOA 3HBTA 3Q8KA 9ATCB 1BIZA 9RUBA 5LMNJ 4GVMA 2IJFA 4QPXA 4WFNL 3PSFA 4XAKA 5AKIA 1OJ4A 2VDIA 4CJPA 3H46O 4XPEA 2OTJN 4R65A 2IVYA 2YMQA 5K8NA 2MKIA 1YDLA 4CZJA 3EDRB 3J7ZO 1PZNA 5CD4A 3D9BA 5BN8A 3QU9A 3V9ZA 1VSEA 2YKOA 1U2FA 3NRWA 1QZ6A 5BPLA 2YI1A 3WK8A 3KD5E 1PCAA 4ZMMA 2O01C 1HRHA 1YVUA 1TKXB 3VVUA 3C2PA 1RBLA 1FEZA 2APOA 3ALYA 3WNFA 1VQON 4GLXA 1FVQA 3LL3A 4AYBD 1VIOA 4CK2A 5KFBA 4NA1A 1JJ2R 2EG2A 4YMNA 2H3FA 4IFVA 3K8WA 3OR2A 2CPDA 3CULA 3CD6N 4O44B 3BBBA 5KFTA 5CEHA 2R8GA 1RCOB 3ZNJ1 1NMEB 2OPSB 5IS2A 1VSKA 2KKZA 4CJLA 7ICRA 1SUQB 5SZTA 3MEGB 3CEDA 4TUPA 2DPJA 3J7AP 2IIRA 4X64K 4YOEA 2RD5C 3C46A 3HT3A 1WBDA 4NXNF 1AYEA 2E5LJ 2K7JA 2ABYA 3X1LB 3ETOA 3MCMA 1NMDA 1IN0A 4F3QA 2N7CA 2JSXA 3IRUA 1L7OA 3VEOA 4HHJA 2KG5A 9ICPA 2ZEJA 1O8BA 4DL7A 4KJIA 4RU9A 4DXLA 3IG5A 4CM0A 2K3KA 1D1UA 1Y9OA 1IBMJ 3PJWA