4B9VA

Structure of the high fidelity dna polymerase i with extending from an oxidative formamidopyrimidine-dg dna lesion -da basepair.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9vA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9vA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9vA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9vA01
1CXUA 2HNYA 5DB9A 4YD2A 3Q8KA 3KK2A 2W9BB 2JZBA 4IR1A 4O5KA 8ICAA 2NRVA 4DWIA 7ICFA 4B9SA 3RMCA 1ZBUA 2FPLA 4CIEA 4I2EA 5DGAA 3SQ4A 4UQGA 4CJFA 4EP4A 5I42A 4W5TA 4DU1A 3PMNA 4CHYA 1S0OA 2JEJA 3Q8QB 3M8SA 4KV8A 3VQQA 3RBEA 4RPZA 1BCMA 1LAVA 2B6AA 4C8NA 1EKEA 3SZ2A 4AHSA 2M9NA 1ZQQA 4BDPA 3MXMA 4CJRA 1EP4A 4KITB 4BWMA 1UT8A 2G8HA 3KLFA 4KLTA 3DMJA 1SKSA 4GMJB 4KLUA 2DPJA 3RWUA 5EWEA 1S97A 3K2PA 1GOBA 2VA8A 4PHPA 3BJYA 1HNIA 3PO5A 2P5OA 3LWMA 5HNKA 3GILA 3RMDA 5T7BA 3TI0A 2DFFA 2GV9A 1TK5A 4R8UB 1SKWA 4KTZA 4RQ5A 4EEYA 3V9ZA 2ASLA 1KLMA 4KTQA 5KFUA 1WSGA 4NCGA 5KGWA 1J53A 1QHTA 1TL1A 4DL7A 5DGBA 2HHXA 1C7YA 3AVJA 5KTQA 5KFMA 3K57A 4Z6FA 4F5PA 1QSLA 1RILA 1RTIA 4QWEA 3AO4A 3QZ8A 3DLKA 3VQ8A 3NFAA 4F8RA 1IKWA 1KEJA 2YKNA 4KLEA 4ECTA 3RRHA 1RT4A 4JS5A 3DI6A 3HPHA 4DFJA 9ICXA 5C42A 3C6UA 1JLEA 3L2VA 4BE2A 4M3YA 2DTUA 4EP5A 2YHBA 1RT3A 5BOMA 2HHTA 4PPXA 2VG5A 4FW2A 4AHCA 1NK5A 2XGPA 4DL3A 4YFKA 1X9WA 1TKDA 1LB2B 4E19A 4QZ9A 4M3UA 2KZMA 4DTNA 3ZSXA 1RDAA 4FVMA 2OPSA 4FLYA 4YR3A 4UB2A 3CM5A 4ED3A 3VQ6A 4FJLA 4O5BA 4OVLA 2VG7A 5J0UA 1RPLA 4J9NA 4HCCA 1DTQA 1ZQFA 5HMLA 1ZQAA 3EWAA 3VQEA 3M8PA 2PFPA 2E6MA 4J9RA 4DOCA 4CERA 3OJUA 4ECVA 2X6SA 4CK1A 2PYLA 3VQBA 3OYIA 2MUTB 4NLZA 4O0IA 5DG8A 1DLOA 1RBRA 2BCSA 3PNCA 3NGIA 3QINA 2GBZA 3UXOA 4GLXA 4YN4A 4Z4EA 3DRPA 5E41A 4FLXA 3AO5A 4CGGA 2I1QA 5JUMA 4BE0A 9ICCA 4Z4GA 5J2PA 4YMOA 5C5JA 1R0AA 1CZ9A 4ELVA 8ICKA 3G6XA 4YP3A 4I2FA 1WNSA 3VQPA 1S10A 1ZQVA 5J2DA 5KT4A 1IXRA 1RBVA 3L2RA 4QZDA 2BCVA 3OYGA 4CEEA 3O3GA 4CJLA 1RBTA 2ZD1A 4B9UA 2NRTA 4RZRA 5C24A 4RU9A 1FXXA 5KT5A 4QZCA 4CHNA 4CHOA 1TKZA 4CJ3A 1U47A 5DBCA 3RB6A 1KFDA 5DLGA 7ICKA 4DS4A 4CF2A 3PO4A 3LPUA 1UA1A 4UB1A 4NXZA 1AROP 4O3RA 1QTMA 2R8HA 1VK0A 2BGGA 4Q8EA 4M41A 3ZSWA 3MAQA 9ICLA 5CZ2A 2UVRA 3HX0A 3F9KA 8ICNA 3IHQB 1EETA 4CHQA 3GV8B 4KRFA 2YNHA 3ZSRA 3MR6A 1TAUA 4N5SA 3ZT0A 4RQ7A 1JXLA 1T7PA 4O44A 4FCYA 4QW9A 4QZFA 5KG1A 5DB8A 4HTUA 1QE1A 4E1NA 8ICMA 1RBUA 4Z4FA 3OSNA 3WNHA 2P6UA 1X2IA 4M6WA 5KFPA 4DSKA 4JUZA 4CJVA 5KG6A 4M0AA 9ICIA 1CUKA 1SZPA 3OYCA 1B9DA 3MXIA 4I2IA 5BPCA 4LY7A 4BE1A 1QQCA 4O3PA 9ICQA 5KG5A 1N48A 3EPIA 4CJ4A 3C1ZA 3QEXA 1KFSA 4RNOA 4FM0A 4ED6A 8ICSA 4ID5A 2BHNA 4CHZA 1JXEA 2JEGA 3C2KA 4CEZA 3HJFA 4M3RA 4DL4A 1IO2A 5DQHA 2HHVA 3K4GA 4ED2A 4F5NA 1A5VA 2OPPA 1VSEA 2D0CA 4M3TA 2BANA 4M2YA 4Y1DA 2IHMA 3ZD8A 4FM1A 1COOA 4E7IA 2V4QA 2DFHA 8ICPA 3OJSA 1CXQA 5J2EA 4DTXA 4YFUA 5CHGA 4I28A 4ECRA 4H4OA 3E2EA 3M9MB 4KN4A 3SYZA 3TAPA 4M42A 2XC9A 2OPQA 1D8YA 3HXMA 1RXVA 7ICUA 3V7KA 4O5CA 1WSEA 3VQ4A 4K8XA 1C1BA 4O4GA 2QXFA 9ICVA 1WAFA 1L3TA 1WSIA 2FLPA 4CJPA 3RJGA 4ZTJA 3AO3A 5JS2A 4KREA 1UWBA 4CGDA 1BL3A 3NF6A 2KQ2A 1YTUA 4E1MA 4RQ0A 4G3IA 1XWLA 3NDKA 1BQMA 2NRWA 2DPIA 4KI6A 1ZBLA 4KHSA 3C21A 3UQ0A 1ZQSA 3HT3A 3MFHA 4K4GA 4YG2A 5J0XA 8ICFA 2OZSA 1BHLA 2PXIA 3QEAZ 2RPIA 2IDOA 5L9XA 5DDMA 3GQCA 4IFVA 4K4IA 3QERA 2LYHA 1BQNA 3SI6A 1TAQA 5HHHA 4PHEA 4DF4A 4KLJA 3DM2A 2ZUCA 4M9HA 1N5YA 4JRQA 1ZQYA 3QE9Y 4PQUA 4JRPA 3KHRA 3KHGA 4B9MA 4DOBA 3DYAA 4RW7A 4N76A 5DG9A 4J2BA 3JYTA 4DS5A 3VQ9A 4QWDA 1ZJMA 5KFSA 5F9NA 4B9VA 1ASWA 2HW3A 4CJWA 1LAWA 2YNFA 2FC0A 3NGDA 1XSLA 1JLAA 4RT2A 2JZBB 8ICYA 3AO1A 4C8OA 5KFBA 1S5JA 4FJ9A 5J2QA 9ICEA 5KI6A 3AVIA 1D5AA 4HUEA 2WOMA 1U04A 3V6DA 3V9WA 3VN5A 4FXDA 1L3SA 9ICKA 3PW2A 4JWMA 4BXOB 2ZQBA 1SL1A 3PX4A 1VSLA 3SQ2A 4AHUA 2FMQA 1Q9YA 3LALA 4NYNA 4PGXA 9ICMA 2A1RA 4GVMA 2LSNA 1A77A 5J2HA 4QZIA 3IS9A 4E7JA 7ICQA 5HRNA 4KLGA 5CR0A 3H40A 1SL2A 1HQEA 4OLBA 4FLTA 1RT2A 2P6RA 5KFNA 3TAEA 5K14A 4RNMA 2X6NA 4YR0A 3BQ1A 2HNDA 7ICHA 1YT3A 1XS9D 3V6HA 4LD0A 3RB3A 1SKRA 3A2FA 3K59A 4UB3A 2AGQA 4XQ8A 1RTDA 2D0AA 1ZQWA 5DDYA 4UB4A 3O3HA 3BQ0A 3VA3A 4DTMA 2FMSA 3HSTB 4DTJA 2W9CA 9ICSA 8ICGA 3QEWA 3SQ0A 5HP1A 4R65A 5DB7A 4JWNA 1KCFA 2JGUA 4GW6A 4OPKA 1RDDA 3WNEA 5EOZA 4KFBA 4CEQA 4MFBA 3SNNA 3HVRA 3GIMA 4PY5A 1EXNA 4G1QA 4W5QA 1ZQNA 4NCBA 3RR7A 4ED1A 4FJHA 2O4IA 5CYMA 1BPBA 1XHZA 3ISCA 3QNNA 7ICPA 3NBPA 1XI1A 4KB0A 2F1JA 9ICNA 3FFIA 3EZ5A 1KLNA 4KLHA 3IG1A 1A76A 2FBTA 2AQ4A 3L3VA 8ICZA 3QIOA 2UVWA 4UBCA 3S9HA 3MBYA 2EX3A 3LDSA 8ICWA 3ORYA 7ICLA 3LP3A 4CGFA 4J9QA 3G0ZA 2HVHA 8ICTA 3ISDA 4J9PA 3DOKA 4OKEA 1TGOA 1BIZA 4DSEA 3ALYA 1MU2A 1LWCA 1UOCA 2W9MA 4W5NA 1FKOA 2O4GA 4F4WA 1Q9XA 4TUPA 4N47A 3LWLA 4LZGA 3M8RA 3JPRA 4FLZA 3MDCA 3T5KA 4CF9A 2H5XA 3RJJA 4M9LA 3RAXA 4CHPA 4ZTFA 3BGRA 1Z3EB 3OYDA 4FJGA 1RT6A 1BI4B 2Z1JA 4FK4A 4M9GA 4I2HA 4CJQA 4FJJA 3ZDEA 1K1SA 3CYMA 3L2QA 5CP2A 2FBVA 1LWFA 1TL3A 4CEBA 4DL5A 2IHNA 4K4HA 3K5OA 1TKXA 2IAJA 2HHWA 1EX4A 4F4ZA 3AVAA 1TV9A 3PW7A 3HPOA 1BVSA 3H4DA 8ICVA 3H4BA 2G8VA 1NK8A 2HNZA 4XRHA 4Q5VA 5DK5A 1RDBA 4IQUA 4F2RA 4BDZA 3MABA 1JLQA 1SV5A 3HL8A 2QK9A 3EW9A 4F3OA 4JLHA 3RTVA 1K1QA 4F4KA 4RW4A 1JL2A 1IM4A 3SI8A 5F9LA 4QZGA 1F21A 4OLAA 4NLNA 3ZDDA 3QZ7A 2XRIA 2UVVA 1WSFA 4RNNA 3PR4A 4KO0A 4O3QA 4CIFA 4QZBA 1KVAA 4FBTA 4C8KA 4N41A 1ZQIA 3WNFA 1O1WA 2YHAA 2KZ3A 3DRRA 5HRRA 4ZH4A 2X74A 5CY4A 3RH4A 1HUZA 2HHQA 4GXKA 3L3UA 3G6YA 4F4XA 4J9OA 8ICUA 2IA6A 3MECA 4QZEA 5D46A 4BACA 3OYLA 5J0PA 3HWTA 3AUOA 4KB1A 5JS1A 4FS2A 4J2EA 4Q8FA 4R66A 3KD5E 4QAGA 4DMNA 3OY9A 2G8KA 3OSPA 1WCLA 1RCHA 3ZSYA 1XSPA 3TABA 3AU2A 4DL2A 4ECSA 4CJTA 4EBCA 1LW2A 3TR8A 2BPCA 4F50A 4E89A 3PW0A 5IIKA 4HUFA 4DTUA 2AGPA 5KT6A 1BPZA 1X9MA 4JV2A 3KK1A 7ICGA 2Y1IA 1TFRA 4UB5A 5IIIA 4O9MA 2XY8A 4C8LA 4E7KA 1QSSA 3MGHA 1QS4A 4CJKA 1HJPA 3ISBA 5KFAA 3MGIA 3V6JA 4N56A 4TQSA 4EYHB 2BQUA 3OYEA 4DLGA 4ZHRA 2G8IA 3PW4A 4EBEA 1S9FA 3SCXA 3AO2A 1VSDA 3QIPA 2XCAA 4I29A 4FK0A 5EWGA 5J2JA 5J2NA 2W42A 3Q8MA 5J1EA 5FRNA 1U9LA 4F4YA 4F5RA 3HK2A 2PFNA 4CGIA 4ELTA 3TAMA 3ZSQA 1ZQEA 1ZQBA 5DLFA 3U3YA 4TUQA 4ED0A 2C22A 5J2BA 5L1KA 3V1QA 2B4JA 3K5NA 5KFIA 4IFYA 4CFAA 5KFTA 4RQ2A 5HRSA 1YTAA 1T03A 1S1TA 4R8UA 2E4LA 2FLNA 4YVZA 1ASUA 3HVTA 4CF1A 4J9SA 3KJVA 4F3TA 2P66A 2R8GA 4YNQA 4MF8A 5DB6A 4J9LA 3CQ8A 3L2UA 3AA5X 4NYFA 5KFEA 5FROA 3GDXA 1C0MA 4QZHA 3C5FA 4EBDA 1T3NA 1ZQUA 4TURA 1ZQPA 4M3XA 3ZT1A 1T05A 3B0YA 1NK0A 1ZQMA 4ECUA 3NF7A 3CFOA 1HPZA 4RW9A 4JS4A 3CM6A 3H08A 3OHBA 4Q45A 5EU7A 4JK1A 3FYHA 3DLEA 3T19A 1VSIA 2OPRA 3P83D 2JEFA 5DKWA 1GOAA 4O55A 4E7HA 4J9MA 4KHNA 4FO6A 3FDSA 4DLEA 5J2IA 3O4NA 4I2DA 4B8AB 1NK4A 4RQ3A 4JV0A 3LP2A 5D49A 4IG3A 2YKMA 5J2AA 3TFSA 4I9LA 2XO7A 4FJKA 4IQWA 2PY5A 4DL6A 3OVNA 1S1XA 3QEBZ 2BPFA 4KN7A 4F5OA 4MQ3A 3E01A 1J9AA 4F92B 4TUSA 2MUTA 1JLGA 5KFJA 5HLFA 3RJEA 8ICLA 1KVCA 3HYFA 3ZT2A 5IILA 4CJUA 4YXMA 4RT3A 3KD1E 4H4MA 3AV9A 5KFQA 3LP0A 3LAMA 2QKKA 1TV6A 2W9CB 4MFCA 3GFKB 4E3SA 4ECWA 3TANA 1I3AA 3WNGA 4Q43A 1S1VA 2DY4A 2VANA 1RTJA 4GXJA 1T4GA 5KFKA 5J29A 3ZD9A 4M04A 1RNHA 7ICEA 4W5OA 1UAXA 1HNVA 4OJRA 1ZQHA 9ICOA 1HJRA 1NJZA 4QWAA 2BGWA 5KFDA 2AJQA 3RB0A 1NJWA 7ICNA 3UPQA 1S1UA 2WONA 4KLQA 1B43A 1WSJA 1C1CA 3TFRA 5J2CA 1S0NA 4IQVA 4CCHA 3VQ5A 4UBBA 4B9NA 9ICWA 1NJYA 2ALZA 4I2JA 3HO1A 1U4BA 3SV3A 4CESA 2P5GA 1BPYA 5KFHA 4M3ZA 2F1IA 3H8JA 1ZBHA 2X78A 4CEDA 2R8KA 3I0RA 1NK6A 5CJ7A 4YD1A 4CK3A 1Y88A 4FK2A 4CK2A 1TVAA 5FDLA 4CJEA 3NE6A 4QZ8A 4P2HA 1IKXA 1ZBFA 4O3NA 4GC6A 2PFOA 1XO1A 5KFZA 4DEZA 3TQ1A 2IS3A 5KFVA 7ICRA 4NCAA 4PGYA 4IBNA 3KLGA 1SUQA 4PUOA 1RZTA 4YCXA 2EHGA 1NKCA 4CGJA 3KLIA 3C2LA 3K58A 5KFXA 3VQDA 3LANA 3C2MA 3NF9A 2RKIA 4KHUA 4DOAA 4MEXA 4QW8A 2FPMA 4I2AA 4IRKA 4B8CA 1Y97A 2W8KA 4FZXC 5CB1A 2F1HA 5EWFA 2ZTEA 4YMNA 3H8SA 5KG3A 4IDKA 1VRUA 4LH5A 3L8BA 5J0OA 3RJHA 2OZMA 3PVXA 3V9XA 3ZDCA 1ZJNA 5KG7A 3PR5B 3TARA 4PH5A 2A1JA 4DSFA 3SUQA 4RUAA 2FBXA 3NGZA 4Z4CA 1T8EA 3SPZA 3B6PA 5L1JA 1BIUA 1ZQLA 3LZIA 5HHIA 5C25A 4HCBA 1Z00A 4KHYA 2J6SA 1NOYA 2ZJAA 4QOZB 2RDIA 3RH5A 4DU3A 1ASVA 4YMMA 3TWHA 2HHUA 2C2EA 4JV1A 4CGHA 3I0SA 1VSJA 1TK8A 4KHQA 4CFCA 4RQ4A 3MDAA 4WE1A 1VSHA 5HROA 2BQRA 2MAXA 3V1RA 3G10A 1WSHA 4KLLA 1KTQA 4Q0BA 4XUSA 2AU0A 3V9SA 3PX0A 4FLVA 1JIHA 1JX4A 2IC3A 3T5HA 2JLEA 4HUGA 4FM2A 2G8UA 3QO9A 4B08A 3SUOA 4KTWA 1ZQGA 1ZQTA 4AHVA 2IGIA 1S0MA 3V72A 2ATLA 7ICVA 2J6UA 3C6TA 4KPYA 2W9AA 4IKFA 4OGEA 3K75D 4RPYA 3KKRA 5HRPA 3IRXA 2PZSA 1ZETA 4GC7A 1U45A 1ZQJA 3SV4A 1D9FA 2I5JA 4MF2A 2JEIA 3MR2A 2V9WA 5D3GA 2FLLA 4XA5A 5KRSA 4R63A 4PGQA 3NCIA 1J54A 1ZYQA 4QWBA 1NKEA 1MQ3A 1MC8A 5CA7A 4I2CA 1RDCA 5KT7A 1RT5A 1NKBA 7ICJA 2KTQA 4UAYA 3TAFA 4P4MA 3CG7A 3OHAA 3L2WA 2F8SA 1QSYA 3NH1A 4CF0A 2ZUDA 3KTQA 4UAZA 5J2MA 2Z1HA 1XSNA 3OS0A 1KRPA 3HPGA 4YR2A 5CZ1A 1B92A 4NM2A 1V9PA 3C5GA 3LPTA 4CEAA 2XGQA 9ICGA 3AVKA 3H7IA 5SZTA 2Q3SA 9ICFA 3QEIA 3QLHA 4Z6CA 4DSIA 8ICOA 4LH4A 3GIIA 2R8IA 3BQ2A 2XY6A 3Q8LA 1IKYA 4AILC 3C1YA 3UXNA 1NK7A 3P1GA 4K8ZA 3ZCMA 5KFLA 3MR3A 1LW0A 3OS2A 2V4RA 8ICHA 3RB4A 1CZBA 1WLJA 4F93B 4RQ8A 4KLDA 4KI4A 1I39A 4F91B 4CFBA 4H8KA 2ISOA 4BXOA 3QNOA 1JKHA 5KFCA 1RBSA 3Q8RB 2VG6A 3PV8A 1Z26A 1S76D 3AVNA 3AU6A 4ED8A 3N97B 5KT3A 4X5VA 3AA3A 4KMUA 5KGXA 1Z25A 4DTPA 1ZQRA 1B9FA 2DFEA 3EY1A 4RW6A 4CJ5A 5TZVA 2Z1GA 2Z1IA 3TAQA 4LSNA 2B5JA 3HP9A 2BR0A 4ICLA 1BPEA 3KLHA 2ZJ8A 3HW8A 5KFFA 4XIUA 3O4QA 3RJKA 4FJIA 1ZBIA 9ICBA 4Y1CA 4GXIA 3U3GA 3CFRA 1N56A 1L3VA 3RH6A 5BOLA 4M45A 1G15A 2ASDA 4M6WB 3OYKA 1ZQDA 4W5RA 1BCOA 5CWRA 1RT1A 3S3OA 2PI4A 4FLWA 7ICTA 3JPTA 1HUOA 8ICXA 2RDJA 4R64A 1S9GA 7ICOA 4EZ9A 3AA4A 1LWEA 4CIGA 4I9QA 4DQQA 4OGCA 1U48A 4ECZA 4IG0A 2PI5A 4E0DA 2G8FA 3K5MA 4DFPA 3VQAA 1JL1A 2RF2A 1L5UA 3P5JA 2E6LA 2ZE2A 3AVBA 4DU4A 3ZSZA 4HYKA 3KIOA 3JPOA 3IM1A 2ETJA 3JSMA 5KG4A 9ICUA 4M47A 4CJSA 3LK9A 2B21A 4DQSA 4M3WA 1CLQA 4DF8A 3NF8A 1C0UA 4FJ8A 3VA0A 3U6FA 3GV5B 3SJJA 1U49A 1S1WA 2XY7A 3TAGA 4DO9A 3ZT3A 4FW1A 3I8DA 5J0RA 2D0BA 4NM1A 3DLRA 8ICIA 1HYVA 3OYHA 2G8WA 3V7JA 2W9BA 3AVLA 3KK3A 4IR9A 8ICCA 1IH7A 2BQ3A 5L1IA 9ICPA 4J2AA 1TKTA 5IINA 3MEGA 1S9EA 4FZYA 1QLNA 3JPQA 1MSWD 3ZT4A 4MFAA 3Q8SB 4M9JA 2W8LA 3LAKA 4DG1A 4QWCA 4P4PA 1JLBA 2OYQA 3RJFA 4RUCA 2IMWP 1X9SA 4Z0UA 1BI4A 3QEPA 4R5PA 8ICBA 3SUNA 1Q8IA 3JPPA 9ICJA 3T1AA 2D5RA 2ITGA 2UVUA 3D45A 5IIOA 2AGOA 3M8QA 4PWDA 7ICSA 5DG7A 3V9UA 3KLEA 4DFKA 3NTUA 4RW8A 1NJXA 4RG8A 2A1SA 8ICJA 3THVA 3C23A 1S77D 3OGUA 1LV5A 3V81A 1REVA 1MQ2A 2KN7A 1S6PA 2P51A 1JN3A 1DOQA 3UXPA 1D8LA 1A5WA 2VA2A 4C8MA 2BPGA 4KLFA 3B6OA 3T5LA 4DQPA 4DQIA 2ZJ5A 1XHXA 5KT2A 2F8TA 4RQ6A 3ZDBA 5J2KA 5L1LA 1UT5A 5DBAA 5KFWA 4O3OA 4NLGA 1HRHA 4PHDA 3QEVA 5KFYA 5J0SA 5I3UA 2BKEA 4FLUA 3GIJA 4J2DA 1VSFA 1JMSA 4MFFA 3C94A 4AHTA 4Z6DA 3V4IA 1VSMA 2FBYA 1BPDA 5KRTA 4FJ5A 5KFGA 2I9GA 1A5XA 2VWKA 1HYSA 3OYMA 2F96A 4KKOA 1TK0A 4KLMA 3UQ2A 3T3FA 2J6TA 4PA1A 4Q44A 4ED7A 3ITHA 3OYAA 3AA2A 3PX6A 4LZDA 8ICEA 4YXJA 3B0XA 3G6VA 2XCPA 2BCRA 1ZQOA 9ICTA 4IRDA 4BGDA 5D4BA 2YNIA 3AVCA 3H8WA 1EXQA 1KSPA 1C0TA 2YV0X 4CF8A 2ZTCA 4DSJA 3GV7B 2A1JB 3DLHA 4RQ1A 4O3SA 4FJNA 2Y1JA 2OWOA 4KLOA 4BDYA 4FYDA 3CFPA 1RT7A 4YQWA 1NOMA 1WCNA 3MEDA 3F73A 2HHSA 4DQRA 1Z00B 4B3OA 3Q8PB 2ZTDA 5KG0A 5J0WA 2NRXA 1S0VA 3DLGA 4OPJA 3RR8A 3V1OA 2NUBA 1ZQXA 4FJ7A 2AQ0A 4DFMA 4RPXA 1JLFA 2HMIA 4P4OA 2WTFA 1DTTA 1X1PA 2ASJA 5HMMA 1VSKA 3GIKA 5IIJA 1WAJA 1VRTA 1W9HA 5J0TA 4I2GA 3S3MA 2KW4A 4DTRA 1FK9A 3BDPA 2BE2A 4LSLA 1IG9A 3PMLA 1KVBA 2ATQA 3NH2A 3M9OB 3KKSA 2BCUA 3LZJA 3AVFA 2ZUBA 3PY8A 4CFDA 4DTSA 1XU4A 1KFTA 4I2QA 1JXBA 2Q0ZX 2BCQA 2YNGA 2R7YA 4Z4IA 3AVMA 1PZNA 1ZQCA 3MFIA 4M9NA 4FJMA 3N4MB 1N6QA 2FPKA 2HVIA 1NK9A 4I27A 1DGSA 3MXJA 7ICIA 3V6KA 2VA3A 3RMAA 4FS1A 2GWSA 4ECYA 1HQUA 3NHGA 4TQRA 9ICRA 3ASMA 3RMBA 4AHRA 1BGXT 4NLKA 9ICAA 5HBMA 5FRMA 1K6YA 3IAYA 2C28A 3MR5A 3D0PA 4TSXA 3RRGA 1D9DA 1L3UA 3LDAA 4CECA 5HP4A 1CEZA 2KFNA 4CEFA 3BQTA 3QETA 3SUPA 1RXWA 1YVUA 3RAQA 1ZQKA 4KLIA 3EYZA 2OA8A 4I7FA 4CE9A 5SWMA 3DLBA 4FZZA 4UAWA 3SPYA 4DTOA 3DOLA 1B22A 3JPSA 3KHLA 4AH9A 3LP1A 4BWJA 3ULDA 5IIMA 4PHAA 4ELUA 1UA0A 3K5LA 2BDPA 1H38A 2IBKA 2C2RA 4IRCA 4IQTA 4MEYA 3NH0A 3PUFA 3OYFA 3RBDA 1WN7A 3S3NA 1TVRA 1BPXA 4OKJA 1J5OA 2R8JA 3OYJA 4ECXA 4QZAA 3ISNC 4I2PA 3RJIA 3VQCA 4DSLA 3HP6A 3ZSOA 3AVGA 3O3FA 5DMRA 1KDHA 4B9TA 3JPNA 1JLCA 2NRZA 3MEEA 4Z4HA 2DFLA 1SL0A 4F2SA 8ICQA 2P1JA 1ZQZA 4CEOA 2KZZA 3M9NB 1C1AA 5J0QA 3SQ1A 1NOZA 3AVHA 5KFRA 3NGYA 3T5JA 5CYQA 2QKBA 3VQ7A 1HMVA 3ZSVA 4KAZA 1HYZA 5J2FA 1C6VA 4EZ6A 1S6QA 2HB5A 2PFQA 3QESA 3ETLA 4KHWA 4Z6EA 2ISPA 2XHBA 1RYSA 1IKVA 4OKKA 1RTHA 4KLSA 5J0YA 4QCLA 1ITGA 5J2GA 2IOCA 4FJXA 4L8RB 4B9LA 2FMPA 8ICRA 4LVSA 4HVJA 3KHHA 3OYNA 3EPGA 3OS1A 5DBBA 1RYRA 3C95A 4J9KA 5KG2A 2XY5A 4NY8A 1BISA 3OYBA 2C2DA 2PYJA 2KFZA 4I2BA 1XC9A 5KFOA 4ECQA 4O5EA 4F5QA 3HM9A 1W0HA 4HHTA 9ICHA 5DQGA 2VWJA 1FKPA 3NAEA 3UIQA 4ID1A 1GOCA 3ZDAA 3V7LA 3DRSA 7ICMA 2RN2A 4O0JA 5DQIA 2GUIA 4FBUA 4EYIB 3PW5A 4E7LA
chains in the Genus database with same CATH superfamily
5AJ3K 2HNYA 2PO4A 3F41A 2RRNA 4GMKA 5K8OA 1SJ3P 2KJ9A 8ICAA 4NA1A 1PGZA 3LH2S 1NSQA 4B9SA 4WU2A 5K9FA 3UO0A 1ZBUA 4LRAA 3EE9A 4CIEA 4I2EA 5HR6A 5DGAA 4LRCA 3NMAA 3SQIA 1FI4A 1Y3KA 4W5TA 3PMNA 1F9FA 1TL4A 4CHYA 3O5TB 2JEJA 3Q8QB 1HBNB 1V38A 2D4WA 2X1FA 4RPZA 2HS3A 4R5PB 1KBUA 3SSSA 4HDGA 1FEHA 2M9NA 1ZQQA 3FEXB 4M95A 4BDPA 3DNCA 1EP4A 4RR5A 4KITB 2G8HA 3KLFA 4IQMA 1GTEA 5D8HB 1SKSA 5L46A 4RPFA 4LFCJ 3ZTPA 1HNXF 4F04B 3RWUA 2EKNA 1K9MO 1HLWA 1GOBA 3ZZOA 1HHSA 2N4DA 4PHPA 5D15A 2P5OA 5HNKA 3JB9k 4CTAA 1TK5A 4PXEA 4R8UB 1SKWA 3J80Y 4RQ5A 3QFWA 4EEYA 3VEOA 2ASLA 3C6AA 1SWWA 5KFUA 3TA1A 1M5HA 4HL9A 2K4PA 5KGWA 2GQQA 4ZITA 2KG0A 4DL7A 5DGBA 1C7YA 3AVJA 4F72A 9RUBA 5KTQA 2DTJA 3HVWA 2WMMA 2M9KA 4CT8A 1RILA 2D8CA 4ZVHA 5KAKA 2HRUA 1ZAWA 4TLQA 3AO4A 1QZ5A 2CNLB 3DLKA 2KKZA 1IKWA 1OY6A 1HPZB 4RW9B 4BRMA 4ECTA 3RRHA 1FJ7A 3HHLB 4IJNA 3HPHA 1CS4B 4DV3F 1ZXIA 2RT3A 3CB4A 4F3QA 4JI2K 2O8CB 1RQNA 4KKOB 2YHBA 5BOMA 2HHTA 2VG5A 2BV3A 4FW2A 4AHCA 1LB2B 1TKDA 5AQKA 2K4EA 3TO8A 4M3UA 2KZMA 5AZIB 4RO0A 4OYBA 4NLDA 1RDAA 4FVMA 2OPSA 4IOXA 2QIFA 4YR3A 4KHPK 3PYFA 5J0UA 1RPLA 4JI8K 1ZZFA 4DHVA 4OI0A 1APSA 1IJFB 2D0PA 4M5NA 3KBBA 1CJUB 4I6WA 4KE5A 3VHQA 1T11A 4DOCA 2NO5A 2VQFF 4CERA 2AHOB 1JJ2R 3DFEA 5DG8A 3F5TA 2BCSA 1V85A 3PNCA 5DZ7A 1J6ZA 2FSKA 3QINA 1OQ3A 1OW5A 2DNOA 1D4XA 2BDUA 2XI9A 3UXOA 3BF3A 4GLXA 1YUWA 3DRPA 4FLXA 5F3ZA 5AI5A 3AO5A 2X1GA 1UMJA 3KJNB 3JSBA 4AE5A 4Z4GA 3OL8A 2A40A 2CUYA 1R0AA 4ELVA 3I5CA 2YKOA 4I2FA 1S10A 4FNIA 2EANA 3JTPA 2O8BB 4FF4A 1F60B 2BE2B 5M1QA 1IXRA 1RBVA 2G06A 2ZD1A 3UDCA 4B9UA 5F8LA 4RZRA 4QZCA 4F25A 4CHNA 1TKZA 1KS2A 2E1MC 1C1CB 4LR7A 2PMZF 2QWRA 4P2FA 4NXZA 1AROP 2DPNA 2P6TA 2XTJP 2AX0A 2BGGA 3VZIA 4Q8EA 4NLWA 3LDLA 2DY1A 4B3RJ 1SQFA 2M8DB 5CZ2A 4NRTA 4JKFA 2HQCA 1HD0A 1HQUB 4DJBA 2HOIA 3BGLA 1IVZA 1EETA 2YNHA 3ZSRA 3A3OB 1XEZA 4FCYA 1GMWA 3MCAB 4HTUA 1QE1A 2KE7A 2XYHB 1U6BA 4E1NA 4Z4FA 1N5TA 3T1HF 3WNHA 2A3VA 4FO0A 2HKEA 1FHTA 4M6WA 3HD1A 4CJVA 4OO1J 1SUQB 4Y2SA 3QGPA 3H2UB 2IMOA 2IIRA 9ICIA 1N34J 3OYCA 5BPCA 3TPQA 4KBOA 4PKHA 2VGNA 2LQ9A 1N48A 2ACMA 3EPIA 4FXVA 1BE4A 1ILYA 2HHPA 4YY3K 4M94A 3QEXA 1KFSA 4RNOA 4FM0A 5ETMA 1BHNA 3VAHA 2UUBJ 1C2PA 1JXEA 3C16A 3R7SB 2JEGA 3CC2N 4NRUA 2VBWA 4NLQA 4P52A 5DQHA 2OPPA 4M3TA 2BANA 2W24A 2CG8A 4Y1DA 3QPIA 3ZD8A 4FM1A 1COOA 3BN4A 3AJDA 2ZOGA 3C28A 2DFHA 3CC7N 3OVSA 5H9FJ 4JK7A 4NXNJ 3GWCA 3UD5A 4WKRA 5C2GA 1CXQA 5J2EA 2YKPA 5CHGA 4ECRA 3Q8UA 3E2EA 4K4ZA 4KN4A 2B0CA 4KJIA 4QJFB 1WSEA 3W2WA 5H2FU 5J1PA 4K8XA 3ZZZA 1C1BA 4MIAA 3IR7B 3HKZC 2QFJA 2FLPA 4CJPA 3AO3A 5JS2A 4KREA 4WP9A 4EHUA 1BL3A 3M2UB 3UR3C 3U9DA 2KQ2A 1P90A 3QUTA 1XWLA 1HMVB 4UOHA 1KAZA 1KL9A 4KHSA 4JV5J 4JI5F 4P2XA 3RBZA 1S6QB 3ETRA 1O8BA 1Q7YO 3BS5B 4GVBB 2Q1LA 3G8QA 3CMAN 4DR3K 5JLFA 3NRWA 8ICFA 3GG4A 2OZSA 2DH9A 2VICA 4CLPA 2RNEA 2W7OA 4EWTA 3J7A1 1H3DA 3JXUA 2IDOA 5D3GB 4YB7A 5FPEA 1P8GA 2G5IB 4J9UE 4K4IA 1IV8A 2MZQA 3CCSN 1EZZB 3QERA 1I51B 3ZTQA 4PHEA 3DM2A 4KH0B 2JX2A 4WYLA 4JRPA 3KHGA 2ZH2A 4LR8A 3D1OA 2CRLA 4EFHA 4B3SF 2LECA 1IXKA 3MD3A 1WF0A 4RBUA 5J2MB 5F8MA 4J2BA 1G4CA 2G09A 1QM9A 4DS5A 3VC8A 4LF2A 1DXSA 2HW3A 1LAWA 4C3MA 3PFOA 1XSLA 1JLAA 2JZBB 3NS7B 3K9JA 1RDUA 1R0CB 3TTDA 3HD2A 4C8OA 3BO4A 4LF4K 4FJ9A 1GLAG 5J2QA 5KI6A 3AVIA 4HUEA 1XIQA 2X3DA 3GCWP 5A8RB 2WOMA 4NXMK 3ONNA 3NWRA 4LF5F 4Y28C 3PW2A 2ZQBA 3PX4A 2DGOA 2E66A 3SQ2A 2OANA 3R6MA 2DNKA 2VG6B 2FMQA 3IN5A 3LALA 2W7AA 3VAGA 2A1RA 1VQ7N 2E8NA 4GVMA 1R6YA 4IH7A 1RWVB 3IC1A 2HZAA 4V1Ak 3H40A 1RT2A 1U09A 4C1NI 5K14A 2HHHJ 4MDAA 3TP2A 4LSNB 2FJXA 2B5JB 4NYOA 2KT2A 2WCXA 3RB3A 1SKRA 3D68A 3VWSA 3WBZA 2AGQA 1SVDA 2HFUA 4URQU 1KEKA 2KH9A 2D0AA 2HAIA 1KLMB 1Q3UA 2DL0A 1U0HB 5GIPA 4MKYA 2QX0A 4B3MJ 3CJ1A 2HRYA 5DM7Q 5LJ5Y 4CZFA 3BSCA 4DTJA 2HBRB 2W9CA 2RE2A 3AA9A 3BBFA 1KCFA 3DDKA 4XDDA 3CJ5A 4GW6A 3SAGA 4OPKA 3WK8A 3N4WA 2KT3A 1UPHA 3KVGA 3I1YA 3ZX0A 3H0PA 4WBFA 2RS8A 1JLEB 4BVOA 3O9TA 4BQLA 3SCJE 2YPYA 2RRAA 1EXNA 4G1QA 1XMOJ 3EE8A 4ED1A 5ALVA 2O4IA 3D1QA 1XHZA 1KC8T 3ISCA 3QNNA 7ICPA 3VCDA 3UMBA 4BRPA 3UE2A 1RWMB 4KLHA 3QU7A 2AV5A 3G25A 4ZP6A 3OVBA 4K4YA 4C8ZA 1UZHA 2EX3A 3TRGA 4MO5A 7ICLA 3LP3A 3S01A 1OJ4A 5CCLA 5C2CA 5CQGA 8ICTA 1VR6A 3DOKA 2QWLA 5B8HA 4DSEA 3Q2SC 2Z8QA 1MU2A 2G07A 1ZRNA 2CVIA 2M70A 3CCSS 2W9MA 4W5NA 4CW7B 1RYUA 3B8HA 3EUB2 1S9EB 3LWLA 3WZ0A 3OPXA 1RAJA 3BGOP 3B9JA 1SJ1A 4FLZA 3T5KA 5E5NA 1LKZA 1N32F 3MMCA 3RJJA 3RAXA 2ZITA 4CHPA 4J7CA 3FLCO 2KXFA 1RU2A 1RT6A 2Z1JA 2ZZMA 2Q43A 3W9HA 4FK4A 2QGFB 4I2HA 1HKAA 2JMGA 4BC4A 3LF0A 3M8QB 2KVCA 1S5LU 4BR5A 2IVOA 1LWFA 3C46A 3VOVA 4CEBA 3K5OA 4FWKA 2KJWA 3OV7A 2YTUA 4F4ZA 4GVLA 5EX0A 5IC4B 3H4DA 1S6PB 5DDRC 5B7WA 1G99A 4XRHA 1S7HA 2OD4A 3I31A 3CD6S 4USUA 3DLJA 4IQUA 3P49B 2I7PA 4JP8A 1SV5A 4BGBA 1NSPA 2YH1A 4JKCA 4G1IA 4FYYB 1IM4A 5HQLA 3PLAA 1W7WA 4QZGA 3TSQA 2FJWA 4LRFA 4OLAA 2D6FC 4O44B 4P75A 2AA4A 2NREA 2WVDA 4CIFA 2DIUA 2MEWA 4C8KA 2J9EA 2OTLN 1PYOB 1HYSB 5CD4H 3O44A 4GVEA 3HZEA 3A0IX 5AKXA 2ZBQA 3RH4A 2HHQA 5K4LA 3SMVA 3WK9A 3G6YA 5L38A 3ITHB 1YG0A 4U7BA 2FD2A 2G2YA 2K4HA 2IA6A 8ICUA 4KGVB 1FDAA 5D46A 2NXJA 2RQKA 1VQ8S 3A3PB 3UR0A 3ADAC 1SH2A 4EO6A 3DGVA 3MI7X 4JI3J 4Q8FA 3OBWA 5LJVA 4R66A 1RADB 3QWPA 3J7YU 3OY9A 2UXCF 4DR6K 5A2QO 2YWHA 2YWEA 1FE4A 4CJTA 1LW2A 1IBLK 3EDQB 2BPCA 1MWQA 2HI0A 4XH1A 1I3OB 2B6GA 2F4VK 1L7MA 4DPUA 3KK1A 1OYDA 4M5HA 4FYXB 1ZTTA 2AYEA 3AB2B 4O9MA 2KXNB 4FWRA 2QO3A 1ZC6A 3PHTA 1HUXA 3SD7A 2CZ4A 4DX7A 4OX6A 1Q4RA 2I6XA 4DCHA 1QSSA 5GAGU 3MGHA 2ZZNA 4PYDA 1QS4A 2V51B 4CJKA 2A2DA 2W40A 3WKAA 2QA4N 1S4EA 1N36F 3V6JA 4YHHJ 2EK1A 1QQ5A 1VQLS 1T3QA 1RKIA 4EU0A 1HNZF 1RAGB 1JCGA 4DLGA 5C2DA 2G8IA 4LSLB 2VKQA 1BQMB 2ZGZA 1D8BA 4XEIA 3QIPA 3Q86A 3A8KA 5HR7A 3ONQA 1CJTB 3BN7A 5AZJA 4FK0A 2W25A 2W42A 3UM9A 2GH1A 1KHWA 2V0NA 4MYTA 5AK3A 5J1EA 2G0JA 4OJPA 2LQJA 1RXOB 4F4YA 2IA0A 3U1MA 3HK2A 1UPMB 2YMPA 4LIWA 3SIPB 2XWYA 3BSAA 2V8VA 5ADZA 1FWLA 2D3OR 2NRRA 3CCZA 4I56A 5J2BA 4WP8A 3ENQA 1AA1B 1HBOA 2CA9A 2GUPA 4TU8A 4PQUB 3WX4A 2ZDPA 4LF8J 2B4JA 3M2RB 3DYAB 1RWOB 3L4BC 4IFYA 4RW7B 1YTAA 5A2QY 3KJFB 3MDFA 2FLNA 1ASUA 3RU0A 1PVRA 1HA1A 4ZPTR 4J9SA 2V94A 1LXJA 4M5DA 1O5JA 3KJVA 4F3TA 4EK2A 5TISU 2YKAA 3RBXA 1YJUA 4F67A 3GDXA 3ENHA 3AXMA 4QZHA 3C5FA 1WEZA 1MA7A 1T3NA 2ZUGA 2QLFB 4BRIA 1ZPVA 4ECUA 5G5GA 3EUNA 4EFAC 4RNFA 2RHSB 3CM6A 2NXUA 5CD4A 3LP1B 1NJIT 2EI5A 3DCAA 1FFWB 2JL9A 2F8KA 1NMEB 2DB1A 1MWYA 3R8YA 4PR6A 4FOEA 5DKWA 4Y0FA 4E7HA 1FXLA 3C15A 3ZTOA 2J76E 3FDSA 4X65K 3CJSA 3NLCA 1TVRB 4CIOA 4RQ3A 4JV0A 5D49A 4DUYK 1HQEB 1MMDA 3N6NA 4FKYA 3KZXA 4CP5A 5ELZA 2PY5A 2K1RB 2VD3A 3OXFA 3QEBZ 4Y65A 1RSCA 4WTYA 3E01A 4BRLA 1J9AA 2LM4A 4F92B 3D2EB 2MUTA 3QU9A 1PJ7A 2Z56B 4WIIA 1AB8A 2FYXA 3QWUA 5JU5A 1BWEA 4PAAA 3CCES 5IILA 1KKXA 1HHQA 3R5JB 2FZCB 4H4MA 2EVZA 5B0CA 3AV9A 1WHVA 2FC8A 3IG8A 2A5XA 3POTA 2QKKA 2HQIA 3EL2A 4WYBA 2W6KA 4QQBA 2P9SA 2OLWA 1ZOLA 1M1GA 3GBTA 3WNGA 1P9QC 5MLCQ 2UUCJ 4M04A 2DNQA 1PC4A 4B3TF 1UAXA 2ADBA 1XMQK 7FD1A 2ZJPL 1KTVA 3P39A 2MQOA 1NJWA 2J0QD 2WONA 4KLQA 1B43A 3AB4B 2MU2A 1L7PA 3G2XA 3NBPB 2E2QA 3FFIB 1FEEA 3EM1A 1GXTA 5U47A 4X84A 3J7YI 2IDEA 2CQ3A 3IA0A 2P5GA 2NZ4A 4M3ZA 4KGZB 5GAEP 4CEDA 4JAXA 3C19A 3IP4B 1NK6A 3I0RA 3SEOA 5CJ7A 4FSVA 4CK3A 4A46A 4BROA 4F0HA 5K5MA 3ICXA 2HNYB 4QZ8A 2V2ZA 5AM3A 1IKXA 4X64K 2LMIA 1XO1A 4OJHA 2P9EA 5B0EA 3THXA 1ZQ1C 1N54B 2E7VA 3PDNA 4WFAL 2HGNA 3G6ES 4DUZJ 1N52B 4PUOA 1UVLA 4CGJA 4AQYJ 1IBKF 2OJ3A 3C2LA 1VBXA 3K58A 1KD1T 1E6VB 2YWWA 3W7BA 3S1TA 4QW8A 4IOBA 4ETXA 4B8CA 1PVQA 1EP4B 2CDQA 2OSRA 4M8LA 1Y97A 2W8KA 5CB1A 2F1HA 2ZTEA 1T95A 1NWKA 3RJHA 1P27B 3GDQA 3L4IA 3W5ZA 5HJYA 3ZDCA 1ZJNA 1TKXB 3PR5B 4DSFA 1FRJA 4OI1A 4RUHA 5DRKA 4BC7A 1WHXA 5AE1A 4BC5A 2EXUA 3C66A 1GLDG 2YPZA 1N0UA 2HNZB 4ZOHC 4FPIA 4DR5K 2E5HA 1VRQC 1Z00A 4P0PB 4CTAB 4XPEA 4DU3A 1ASVA 3W8GA 3KHYA 2GFFA 4CGHA 3JSYA 3I0SA 2M0NA 4XTTA 4ZJQA 1XERA 4FF3A 3WUHA 3MDAA 4PZOA 4MJKA 4JI1F 2XLJA 2D7SA 4ES2A 4KLLA 1X4EA 2AU0A 3PX0A 4FLVA 2AJ0A 2V8DA 3T5HA 4HUGA 2KO1A 4FM2A 3SUOA 2WF5A 3TJ8A 2DRAA 4AHVA 4HWIA 4CD3A 4RJVA 3QNMA 3CCWA 4DV0J 2GO9A 4IS7A 1F0MA 2FJEB 2VG5B 4OGEA 5AKYA 3NS5A 4RPYA 1ZETA 1U45A 1VJQA 1KVIA 5AQRA 2FLLA 5KRSA 2OPSB 4QIWF 3WDOA 1T9XA 2W04A 4JMUA 1SH0A 2HFVA 4NLYA 2FJAB 3OBIA 3EDRB 1NPKA 3M6VA 4KH4A 3RSEA 1MQ3A 2WB1D 5CA7A 5KNIA 1BQXA 2OFHX 3OR1A 2VHGA 3VMFB 1FTCA 1RT5A 2XYPB 4PXBA 3ZXWA 7ICJA 1FT8A 4P4MA 1U8WA 3LPYA 2W7PA 4QS9A 1QSYA 3KTQA 2ZJPQ 3MURP 4D3HA 1KRPA 1B92A 1X4CA 4ISGA 1V9PA 1TMMA 1Q95G 2RQ5A 2JC0A 1NI3A 3DRPB 2B3TB 3J81Y 2MY8A 2RVJA 4LF7J 1NAQA 1DY3A 1BXNA 3QLHA 3R2DJ 4DSIA 4LH4A 2SXLA 2BJEA 2XY6A 3BYPA 1FX4A 3CDAA 2JLFA 3E0FA 4JOUA 1KQGB 3ZCMA 5KFLA 3MR3A 1LW0A 4ZHRB 3OS2A 8ICHA 3RB4A 1RWUA 3OTEA 4RCHA 2E2OA 4KI4A 3MM7A 2ZD1B 3QNOA 2E7XA 4PYAA 2GLEA 3NNAA 1Z6RA 3C14A 4IOAL 3CDBA 2ZH8A 4OD0A 5KFCA 3UKUA 3PJ9A 2N7YA 4FPBA 2UUWA 1X4DA 1V5VA 1FRIA 4E1JA 4CGZA 3AA3A 1Z25A 4WFAQ 3O5BA 3EY1A 3CNHA 4DB3A 2Y3YA 1S6OA 4RW6A 3NCRA 4UB6U 4CJ5A 5TZVA 2V69A 3BZCA 4G9ZA 1V3ZA 5K8MA 5AM4A 3QJPA 4FWOA 4BRAA 2Z1IA 3B78A 1HNXJ 1U1QA 1ZM9A 1EETB 5E2QA 3HP9A 2YNHB 1S4FA 3M1VA 3CD5A 1EWRA 3O4QA 2JGAA 3VZHA 2ROEA 4FWPA 4CT9A 3CIMA 2CDRB 1QE1B 4FKXA 4FJIA 5AM5A 9ICBA 1KQKA 4A8SA 4Y1CA 1N56A 4NLPA 1GXUA 1L3VA 1X4HA 2AP1A 1G15A 2ASDA 4M6WB 3WXJA 3AAWB 4W5RA 2VQEJ 5CWRA 1MN8A 5F3TA 2EAPA 4URSA 2Y0BB 4OZ1A 5AKGA 1X7VA 5LL6d 4CE6A 2R2SA 5ALHA 3AA4A 2BJ7A 3W60A 3CGIA 3GMGA 1YXQA 3V5RA 3HM8A 5ETLA 4ZP9A 4I9QA 4DQQA 4AFFA 3CPWM 3SAHA 1RAEB 4DUTA 2PI5A 2G8FA 2ZC3A 1GO3F 1JL1A 4KGXB 2DH8A 3C16B 1BMQB 4DU4A 1TTHB 4ANEA 4A48A 2ZEJA 1WUUA 2JXJA 3S7RA 3JPOA 3IM1A 2OPPB 3JSMA 9ICUA 2BANB 1XC3A 4CJSA 3LK9A 1FWPA 2B21A 4M3WA 2UUAK 1C0UA 3LP2B 3J7ZO 3H0LB 3SJJA 5AIBA 3AQEA 4EMDA 3IR6B 1D9AA 1K9MT 1S1WA 2XY7A 2W2QP 3ZT3A 5IWAK 4L3QA 3IXQA 3VF0B 3W2WB 4UW9A 1N63A 1HYVA 3LQVA 2IM1A 1Y5LB 4H5VA 1R31A 3D2WA 4IR9A 1XNQJ 4GKJJ 1IH7A 1JLGB 3OTCA 1X5OA 5HLFB 1QVGM 2KHQA 3OPKA 3W1YC 3VGVA 5IINA 3MEGA 1QLNA 1MSWD 2D69A 3ZT4A 1OMSA 2JWNA 5A8WA 1JLBA 2CPHA 3RJFA 1VHXA 3DEEA 1TV6B 5EXWA 3K9KA 1Q86O 3M4XA 1X9SA 4Z0UA 2PKEA 3M6XA 2PFFB 5LMUF 4LFCK 8ICBA 2N4CA 1Z4OA 2H48B 9ICJA 3D6JA 3RW6A 4PWDA 2AGOA 3KLEA 2FF6A 1UVJA 1RABB 2A1AA 2HSZA 5EE1A 4OYOA 3NTUA 4RW8A 1NJXA 4DZDA 2RSQA 3ENAA 2A1SA 3GG1A 3NOGA 3OGUA 3EVMA 4MK8A 1VQON 3TYTA 1M5KC 1REVA 2MGZA 3CCUS 2V9KA 1JN3A 3U26A 1VAZA 1D8LA 2BW7A 5G4DA 2VA2A 3CF5L 4LR9A 4IOAQ 5M2PA 3ILJA 2ILYA 3M8ZA 2F8TA 4KY3A 4ISEA 1UEKA 1Z05A 3O9RA 3P4UB 5J2KA 5L1LA 3LGNA 4O3OA 4NLGA 2JWLA 3MDQA 1SC3B 4I64A 6FD1A 3EKUA 1JLAB 3QEVA 3OT9A 4IQXA 5KFYA 2BKEA 1YHQN 3GIJA 4OYMA 1VSFA 2JZ5A 5J2QB 3Q23A 3PM9A 4BR0A 1F3VA 3GCXP 3GYGA 4BBYA 3DHXA 4IH5A 3KOAA 2I9GA 1NZAA 5K8PA 4AF1A 3OYMA 3G71S 5TKYA 4K25A 3QUBA 1ZPWX 2WAQD 4PA1A 2FF3B 3AA2A 2XEXA 4LZDA 2FVCA 2N3LA 1SGGA 1FX2A 2XCPA 2LI6A 4NB4A 3K89A 4C4RA 2MB0B 2WF6A 1BC6A 4IDKB 1LVHA 1R6VA 3A5MC 3AVCA 2QLWA 3OD2A 3PFEA 3F5AA 2O8DA 2CJQA 1RT2B 2A1JB 3DLHA 5K14B 4FJNA 1X5SA 2OWOA 2EFOA 1M6YA 4NWBA 1WG5A 4JI6K 4ZCMA 4YQWA 3IMXA 1VQ5N 4GO5X 3N4PA 3MTKA 5ALKA 2YB4A 3UKRA 3M6KA 3CCRS 3DLGA 1S0VA 2NUBA 1ZQXA 2CQIA 1NO8A 4H03B 2F4FA 1WOOA 1UJ6A 2HMIA 4JHDB 4PWWA 3ZTSA 4YB5A 4USIA 1TYQA 1OH6A 2ASJA 4PQAA 5IIJA 4Q0BB 1VRTA 2AWZA 3KJQB 3S3MA 2H3VA 4QPTA 3VF4A 5F0UA 1NGCA 4UY8O 4OX9F 4AYBF 9ATCB 2ZUAA 3MGJA 2BCUA 4ES1A 1EJ7L 3LZJA 4M5IA 3DOMA 3LPEA 1XU4A 5LMNF 3FZBA 4G1QB 4X4TA 4HVZA 4JI5J 3C6TB 4DV1F 4OZ3A 2GHPA 4DR4J 4OJ6A 2W2PP 4DV5F 1URJA 2YI1A 2PMHA 2PDAA 3DU5A 2CQCA 4XK8C 2P9GA 3R5CA 4B9QA 2FPKA 1Z19A 7ICIA 2M4MA 2VA3A 3NHGA 4ECYA 4QBUA 9ICRA 3ASMA 5LJ3Y 1HD1A 3D7EO 4JI0K 1Q78A 1Q1KA 3DAWA 3OTBA 5HO4A 2H4YB 4NLKA 2EAMA 2J0XA 1MU2B 2E5GA 1E4GT 2GV1A 2FXUA 4IO9L 4B3SJ 2P9PA 2WBNA 1D9DA 1L3UA 3LDAA 1NDPA 3BQTA 5CHCB 4MMOA 1K44A 1V6HA 4R0EA 3WQUA 3MMCB 3CMEN 1NGBA 3CF5Q 2UUBK 3LDPA 3IG5A 4XAKA 3DLBA 3MMAA 3DOLA 4JI7J 3SMZA 2UXDF 1RT6B 4H5RA 3JPSA 5ADXH 2BXJA 4ANCA 1VIOA 4IYQA 1NB2A 1RLDA 3ULDA 1Q7YT 5BYSA 4CLTA 1NGDA 4P73A 3RF9A 2VWBA 1JKHB 4C98A 4YOUA 3UN2A 5AR0A 2IBKA 3EZOA 1VYAA 3D67A 4LBPA 1BWFO 2BJ8A 1M5SA 3OYFA 2M3DA 5LY3A 3AEVA 1E6YA 4C7ZA 5LSLA 4DR2F 1NH8A 1J5OA 1SJQA 4BGAA 4CYUB 2ZWOA 3OYJA 3ISNC 3VQCA 4DSLA 1SV5B 3HP6A 2RLTA 5BR8F 5AKEA 1KDHA 4B9TA 2O1PA 1JLCA 2NRZA 2XMJA 1HW8A 1L8LA 4H0TB 2KEYA 1ZQZA 3D7SB 4X62F 1UHUA 3FSIA 4OPAA 2HWTA 2NS1B 3QU5A 2KZZA 1C1AA 1NOZA 2EZXA 5CYQA 3T5JA 3NGYA 2QKBA 3CJKA 4DDFA 1ZTWA 3CCJS 2HCFA 1HYZA 5CE3A 1CSJA 3B4MA 5J2FA 4EZ6A 4USJC 4P9SA 3H5XA 2CKWA 1LFPA 1IKVA 5AQMA 1L7OA 1RTHA 3W66A 1EAYC 4B9LA 4OX8A 4PKDB 1J2NA 1FD8A 2AEFA 1X4FA 2K2PA 1FJGK 1BO5O 5A6PA 3C95A 2ZE2B 4NY8A 3OW2R 2MSNA 4WQ5A 4UOFA 2HFSA 2C2DA 5BXIA 1LW2B 2ZM6F 3CJ7A 1UVNA 5DQGA 3ZZTA 3T9NA 4PG4A 4M1KA 3V7LA 4DCPB 7ICMA 2BW2A 2RN2A 5DQIA 1M0SA 4E7LA 2ZHOA 1CXUA 2IJRA 4YD2A 4KMOB 3EMTA 1N5WA 3BM7A 4J8FA 4ES3A 2KB2A 5A76A 3HHDA 3R5BA 2RMLA 2FPLA 2E8AA 5C0YA 3QIPB 4DG1B 4UQGA 2XIDA 1H74A 5I42A 4CJFA 3QU2A 4K59A 1BNOA 5AZJB 1N32J 1DAXA 3QU4A 2C3UA 5ADXA 3M8SA 1J2MA 1LAVA 3GU0A 2J7WA 3PHEA 4IO9Q 4C8NA 3D6MB 5M1FA 3ZZYA 3SZ2A 1IG8A 4K0KF 3G82B 5AXNA 2EC0A 4BWMA 4KLTA 3CMES 2O66A 5HATA 4CBXA 4GMJB 1RGVA 2VBXA 2YKQA 1B99A 2DGUA 1S97A 4OIXA 1OKJA 3BH6B 4CDIA 3VGUA 2P9UB 4P0QA 3LWMA 4BS2A 3TI0A 4PL2A 4NLUA 3OLBA 4JKAA 1YRXA 4USVA 3KJVB 4M5DB 2LXIA 2B9EA 4JBCA 1QHTA 2HHXA 1TL1A 3I33A 3KNAA 3FR0A 8AT1B 4Z6FA 3G8TA 1RTIA 2M0GB 1V3RA 5HMZA 3GJTB 1HPMA 3QZ8A 4Y2MA 3CCMS 1R0BG 3TZWA 4A57A 1KXPA 2YHXA 3DI6A 9ICXA 2IPOB 4C3LA 4M3YA 3AD7C 2P9LA 3O6QA 1VQMS 8ATCB 4ZDNA 4Y2CA 1NK5A 2GMHA 4DL3A 4DV4J 2AH5A 5H1SQ 4QZ9A 1J27A 2NXNA 2FZKB 4A8FA 4DTNA 3ZNUA 1F5AA 2QM1A 2WZ1A 1TUGB 5ALOA 3DDIA 2W6LA 4FLYA 1X31C 4ED3A 3IMQJ 1HKBA 2ZNYA 4XH4A 2D3DA 3KK7A 1EWQA 2UUTA 2VG7A 4DXLA 2QXLA 2KD1A 3VQSA 3EWAA 3N7PD 3M8PA 3QFPA 4KSEB 1RGIA 2QARA 1U1RA 1RT7B 2E6MA 3SK3A 3NVWA 2MQMA 3E01B 4DV7J 4CK1A 1YZ6A 3VQBA 2MUTB 4O0IA 3NGIA 3FBEA 2RH3A 4Z4EA 4YN4A 2DHHA 4AM6A 2O6KA 1VCTA 4A8KA 2G0AA 4H4MB 2FDRA 4NOHA 2MKSA 5J2PA 3SMSA 2JH7A 3POTB 5C5JA 4MDBA 1CZ9A 1MN7A 3ULEB 1ZQVA 3R6LB 5J2DA 1Y3JA 1UCNA 5C7PA 4CBUA 3CO9A 2R3VA 3MM9B 4OI6A 3H20A 3L2RA 2X1BA 2BCVA 2FSNA 4CWBA 2HBKA 4CJLA 4LFAK 3ZFVA 2F8HA 2Y0SC 1TELA 5KT5A 4I2QB 2Q6CA 2WONB 3IWXA 4CZKA 3L5KA 4CJ3A 1U47A 2CGJA 5DBCA 3RB6A 1H98A 2YNGB 3TWZA 5DLGA 4BRGA 2HS0A 4AT1B 4DV6K 2F7TA 1K8KB 4WP3A 7ICKA 3ILOA 3PO4A 3I8BA 2MZSA 3N6MA 4A47A 1IG6A 4B3RF 3ELHA 1AZSB 2R8HA 1Y9OA 2HSTA 2E1EA 4I68A 2CQBA 1RBLA 2VV5A 4MO4A 1RB0A 1N5VA 3MAQA 2UVRA 3AL0B 3IHQB 4BVPA 2QFIA 2CJYB 3FK4A 3GV8B 4KRFA 2OO4A 2JVRA 2MSSA 3ZT0A 4RQ7A 1JXLA 4X66K 1IKXB 1PKUA 2DHSA 4QW9A 4QZFA 3T41A 1N5XA 1U26A 1S6UA 4PXCA 8ICMA 1RBUA 4CM0A 1QZ6A 1OH5A 2DNHA 1P6TA 3PRVA 4LF6F 3UWTA 4DSKA 5KG6A 2KNJA 4PUOB 4M0AA 1CULA 2CQ2A 1I94K 3B8AX 1WG1A 3MXIA 1MDUB 2FGOA 3SQGB 4CH7A 9ICQA 3H6EA 2DKXA 2PSZA 3W0LA 2RQMA 3C1ZA 2ZWHA 3D6RA 2ROGA 8ICSA 5ETNA 4ID5A 2FQQB 4PWUA 2GJ2A 2A6AA 3D2FA 3A5OC 1WC6A 5CABA 1SIWB 3IFEA 4Z7YA 4DL4A 1IO2A 5IFMA 2B8PA 3BBBA 2HHVA 4HEA9 2D0CA 4DBQA 1YJNN 4NXNF 3TUJC 2IHMA 1HWJA 2V4QA 2GAGC 4L3NA 3OJSA 4I2PB 5DO2A 5GTHU 3US5A 1DZ5A 2Q66A 3BKTA 3FE1A 3SYZA 2EZZA 1D8YA 3I0SB 3HXMA 2XS2A 2O8FB 3N0VA 1BD6A 7ICUA 4O5CA 2H3IA 5ALJA 2V63A 3QT5A 3OFEA 5JVHL 3EO3A 1WAFA 1L3TA 2IJFA 1WSIA 3P6YC 2VFRA 4KR0B 3RJGA 4ZTJA 1MWMA 1RAOA 4JKGA 1QQNA 2L9DA 1Q82T 4FE3A 2DNNA 3NF6A 3TSPA 4A4JA 4RQ0A 2Z2YB 3NDKA 4JV5F 3H3OB 4NL5A 3U9ZA 1ZBLA 3MUMP 3AOBA 4K4GA 3HZGA 2PAVA 3BY5A 7AT1B 4OYXA 3DLLL 4CNQA 4TU9A 2Z4PA 4B02A 1AUSL 1RHQB 1X8DA 3GFXA 3VR1A 3GQCA 1GLLO 3ZTRA 1LEOA 2LYHA 1BQNA 3RSEB 3OTOF 3SI6A 3OR1B 1RT5B 1ZQYA 3R97A 3D2QA 3CJAA 2V68A 1REGX 4Y0WA 4DOBA 2P9KA 2KKHA 5EGYA 2UU9K 1M1HA 4CI0B 4AUKA 4IEEA 3JYTA 3N79A 2B9WA 4Q2MA 4C48A 2OH2A 2JNJA 2E5LK 4B9VA 4WFBL 1JK9B 1WF1A 2FC0A 3NGDA 1FDDA 2L9WA 1HHTP 3QLHB 4RT2A 4K50A 2W4PA 3M6ZA 4Y6IA 2QZ8A 3AO1A 3X3UA 5KFBA 1S5JA 9ICEA 1D5AA 2V4JB 3PZPA 4FZNA 3V6DA 1U1OA 3V9WA 2C42A 3VN5A 2E8PA 1L3SA 1KR4A 3F53A 3MM7B 3N4QA 1SL1A 3DXKA 3UKUB 4AHUA 2NQPA 4C11A 2WSCC 2DHAA 4PGXA 9ICMA 1VBKA 5AQUA 3CVKA 1A77A 1RWKB 2HDOA 5JRTA 4ZCKA 1S72N 4F71A 1UEVA 5CR0A 3DMJB 1SL2A 2A41A 2FTRA 2HHHF 1WEYA 4X2BA 5KFNA 4RNMA 2YH0A 4ZPVR 3BQ1A 1P8ZA 5A0YA 5BRDA 2KL8A 2E88A 1HNIB 3RAMA 1XS9D 1OVQA 4LD0A 3HSDA 3O0FA 4ZPWR 1R59O 2A1BA 5HQ8A 1ICEB 5A8KA 4XQ8A 4B3MF 1ZQWA 3EVOA 4CLKA 4QS7A 4UB4A 4M7YA 1WC3A 3BQ0A 4PPZA 3MMBA 3VA3A 2IVYA 2BUPA 4UB8U 2FMSA 1RE1B 2K3IA 1HWLA 3SQ0A 2BE9B 3OFFA 3TTFA 3KYLA 4R65A 3KMQA 4DV2F 3K1RB 4WFXA 4LJMA 4KFBA 4CEQA 1JJ2M 3WK5A 1HR0K 2FIUA 1XMOF 3M2VA 3GIMA 1RT3B 3TOQA 3VEWA 4YOVA 3BR9A 3SBTA 3WK6A 4ZP7A 2R7XA 3L7UA 1KW4A 4A61A 3JSMB 2B9YA 3EZ5A 4KRWA 3IG1A 2AQ4A 3L3VA 8ICZA 3NVVA 3N7RC 1N5QA 4FXWA 1S1WB 2MKKA 4CGFA 2CH5A 3G0ZA 3G8SA 4DUZK 1WHYA 4DU8A 3ISDA 4J9PA 5HSPA 3QUCA 1PYTA 1EB0A 2ZIXA 3CD0A 2ACYA 2COLA 3SXLA 4AQYK 2PE8A 1DLOB 1LWCA 1W97L 1KONA 5BJRA 3QAUA 3MEGB 4N47A 3JPRA 1UP1A 3MDCA 3BF4A 2GIQA 4QIFA 1JLBB 3R27A 1V9OA 4LT6A 1S12A 3BGRA 3H5YA 5IXUA 3OYDA 1YI2S 4M9GA 3SJHA 2W03A 5ALIA 3NAHA 1PILA 5F0WA 1HBUA 3VV2B 3P38A 1K1SA 4RQMA 4UW2A 1QH9A 5AM2A 1XN9A 4WFBQ 3KLEB 5CP2A 4I6AA 5I9EB 1IBMJ 3F2CA 2IM2A 2FBVA 2P9NA 4CDGA 1O08A 2F9WA 2FC9A 2PC6A 2CJKA 3BSNA 4K4HA 2ZH6A 2IAJA 2HHWA 1EX4A 4LVNP 5GIOA 5BYRA 1U6FA 2BOPA 4YOYA 1REVB 2FJBB 2MGZB 1NK8A 3QICA 2DEJA 5ALQA 1B0TA 3TZYA 4CQ1A 4F2RA 2HGLA 2QEXS 2QYCA 1JLQA 1OSCA 5F8GA 5AKKA 3AOCA 3IM9A 3EW9A 2GJFA 4C0HA 4F3OA 1UFKA 3CCTA 3T79A 4F4KA 3GTYX 1JL2A 3SI8A 5F9LA 4A59A 1N33F 3AQPA 3BREA 1BU6O 3ALRA 4NLNA 4DV0K 2J7KA 5AQWA 3HRDD 3NS1A 4DU7A 3HDSA 1WSFA 5MAOA 3PR4A 4Y2IA 5LSRA 4KO0A 3S6EA 4O3QA 2B4UA 1KVAA 4FBTA 1R8CA 3BV8A 5D0EA 4PHTX 1O1WA 1RFQA 2YHAA 3FMBA 2KZ3A 1FRLA 2K7JA 1BNPA 3CPEA 3QT8A 2X74A 4RKUC 3FVYA 2F5GA 3L3UA 2XNQA 4DR1K 1WDTA 4YS2A 3CCVN 1K5OA 1SJRA 4QZEA 2NPFA 2XM3A 4FVUA 4BACA 3OYLA 1JRPA 3HWTA 4Y2JA 3QAEA 1M5VC 3V2UC 4JI3F 3NG8A 3BPDA 4FS2A 4DCJB 2QA2A 2O8DB 3KD5E 1FVSA 2D1KA 4DMNA 5LOQA 3J7YP 2G8KA 3ZSYA 1YIJS 1SQKA 3AU2A 2P9CA 2LM1A 1PK3A 1AYEA 1HI8A 1VQ6S 4ACOA 4CO4A 1UZDA 3GOIA 4I67A 1Y10A 4AD6A 4HUFA 4DTUA 1BPZA 1X9MA 4JK9A 3DLGB 2CJBA 1DRGA 2FB0A 3ZZ0A 1S3XA 1FRHA 1U2VA 2DGWA 4C8LA 2ZH9A 1VI7A 2IBOA 4E7KA 2AYGA 4CLLA 4YHHF 1KWMA 1Z4NA 4TQSA 3GJRB 1KAXA 4EBEA 2RAQA 4DHYA 3HJEA 3R9PA 1VSDA 4JI4J 2E29A 2FUG9 3DOMB 1YJ7A 2O67A 4I29A 3G86A 4ZS6A 5EWGA 1QCKA 3Q8MA 4ILHA 5LMUJ 1HNXK 5IT9O 2PFNA 4CGIA 3BUZB 3TAMA 1N8RT 1ZQEA 3M05A 4TUQA 2FVPA 2C22A 4MHVA 1SC4B 3H46O 4NI2A 1QJHA 1HWIA 1VQNN 2KSOA 2NXCA 2JH3A 3MWTA 4LF8F 2NRHA 2FPHX 2N82B 2QC3A 4UTGA 4CH1A 2QYGA 1U1LA 4Y2VA 4P6QA 1FJCA 2PD1A 3VCBA 5KFIA 5D0HA 1VQKN 5KFTA 4RQ2A 3BKFA 2DITA 2KT5A 5HRSA 1NSAA 1S1TA 2E4LA 4YVZA 2ES6A 3HVTA 4I6MA 4CF1A 2BKNA 1SB6A 5DB6A 1FKAF 4J9LA 1JWWA 3L2UA 4NYFA 3CQ8A 5FROA 3H2VE 2OTJS 1KAYA 4DV3K 1P7DA 5D0RA 1RBOB 1MWKA 4TURA 2A0FB 5ETVA 3PEJA 5JMNA 4M3XA 1URRA 3MMAB 3DOLB 2LYAA 3NF7A 2WW8A 4ER8A 4ICAA 4JS4A 3H08A 4KQZA 1PYSB 4JK1A 4AYBC 4EUVA 2Y8WA 1B0VA 3DLEA 3T19A 4LC9B 1VSIA 4HTIA 3KWGA 4WCEL 3HCXA 4MYUA 3BGUA 3ET6B 3H2LA 4OZ5A 3ZO7A 4C0BA 1WTBA 1MMLA 3EGVA 1Q16B 2H5IB 4OZLA 1WBBA 1RHKB 3SR6A 4DLEA 3W64A 2B4VA 1SPBP 3M30A 3CJ0A 4I2DA 8RUCA 2VQFK 1J5OB 2YKMA 2VUGA 5J2AA 2W2OP 1FNXH 1PSDA 4A2AA 2J9DE 1F5BA 2XO7A 5FPNA 4CLFA 4Y2KA 4JN4A 1SCJB 5D6GA 2BPFA 1JLCB 2HBZB 3J7AP 3THWA 2RUSA 2I5HA 4F5OA 4MQ3A 2HNDB 3WXKA 4TUSA 5BR9A 1Q81O 2DNMA 1R89A 2XMTA 3O1BA 1KVCA 3HYFA 1RTDB 2QWOA 4CF4A 1RG6A 4CJUA 4YXMA 4RT3A 2K60A 3THYA 3KD1E 1GTHA 2RJZA 3TVYA 4IO8A 4NEYA 4F02A 2KVQE 5KFQA 3LP0A 3LAMA 2WW4A 4ALZA 2UXBF 1FDBA 4MFCA 4US8A 2HFZA 2JFKA 1IKVB 3BYRA 1IQTA 2UUCF 1ED1A 4ECWA 3TANA 2V2KA 1I3AA 3KFWX 1RA6A 2DY4A 1VQPN 4A8XA 4GXJA 5KFKA 3FZ2A 5J29A 1RNHA 2LQ8A 4W5OA 1DBDA 1ZQHA 1T6DA 9ICOA 3EXYA 4MFBB 1NJZA 3KD3A 3CD7A 3KUGA 1IBCB 3W8PA 1DHMA 3IDWA 3H5UA 3HHLC 3GR1A 3HBTA 1S1UA 4CO5A 2ZKUA 5JVGL 5LMNJ 4O8KA 1Z2ZA 2N1RA 1WSJA 3TADC 1J5EJ 4DV1J 1WYGA 4IQVA 1N4LA 2RS2A 3O4WA 1H72C 4X4NA 1GAOA 4FF1A 3VQ5A 2EFQA 4UBBA 5AQYA 2K8AA 9ICWA 1ZS6A 1NJYA 2ALZA 3HSGA 2Z2ZA 3A13A 3HO1A 1U4BA 1BPYA 5KFHA 1B64A 2F1IA 1ZBHA 2X78A 3SCLE 1UVMA 2Y0SD 1YJWS 3NXZA 1Y88A 4FK2A 3T1HK 3LW5C 2YTCA 4CJEA 1X60A 2NUHA 1MLAA 2ASPA 3I4PA 4BRNA 5KFZA 4KHMA 1NGFA 2BJ1A 1VQNS 4QR2A 2DNZA 3MR7A 3R9KA 3Q8VA 4IBNA 1IJEB 3E51A 1QAIA 3KLGA 5GINA 5AJ3J 2AJ1A 4U7UK 5I42B 2GVDB 4YCXA 2W2MP 3P5BP 2OFGX 4JKEA 1K8AT 3KWMA 2RKIA 2DR6A 1RCXB 5AQSA 4MEXA 4BJQA 2KLAA 4X4UA 3AQOA 4IRKA 1NRKA 2LU2A 5B08A 4YMNA 5EWFA 1IWGA 1VRUA 2EWSA 5J0OA 5E3CA 1WWVA 1TL3B 2BX6A 1NMNA 3GE1A 4PKIA 3MUTP 5ALGA 5KG7A 4LUBA 1SV0C 4RUAA 3NGZA 1SJ4P 1TL7A 4Z4CA 1T8EA 2APOA 5L39A 2E20A 5HHIA 5C25A 3AMZA 1WSRA 4NEZA 4HCBA 4WCEQ 4KAIA 5B0DA 1NOYA 2WK4A 4QYZK 4DR2J 4FZMA 3RH5A 1RWNB 2I6WA 4YMMA 4ILMA 2HHUA 4JV1A 4OJ3A 1URNA 4RW4B 1HIWA 4WE1A 1TL1B 2XMMA 1VSHA 1HX1A 2JHDA 2DD8S 2MAXA 5AQTA 4MLEA 2IVNA 2H3GX 2GWKA 1RTIB 2BZFA 4JI5K 4XUSA 2CQ0A 3N7SC 4X62J 5C15A 1NZBA 2IC3A 1JX4A 4ZIVA 4ZVRB 3CTRA 3QO9A 2L08A 3AHPA 3QDKA 2W01A 3TQEA 1ZQTA 3DI6B 5E84A 3PKYA 3MN6A 2GEMA 2RP5A 3PSPA 3P96A 1ACMB 3K17A 3V72A 2QLTA 7ICVA 2L9NA 5E0OA 3C2PA 3CCLN 2P9LB 3QUQA 2POKA 3BS9A 2PZSA 3IRXA 2PA3A 2I5JA 4ZVFA 4Z2XA 4XPCA 2JRSA 5CXTA 4OYZA 3MR2A 3HFZB 2W43A 5AXLA 5J1NA 4PGQA 3H25A 2HBQB 3HFVA 4JI2J 2A2CA 1TUWA 1ZYQA 1X6JA 1JUDA 1MC8A 2VG7B 4B3SK 5KT7A 2LU1A 3FBFA 1ESVA 3M8PB 3TAFA 1P1TA 3PEHA 3J80O 2QSWA 3L2WA 1RWPB 1G7CB 2NSCA 2ZUDA 4KHPJ 3MK6A 1M1KT 2Z1HA 3HPGA 1RK8A 1SZ2A 3C5GA 1S5ZA 1NH7A 4JI8J 4LF7F 1JI7A 2XQCA 1DGKN 3VESA 4DQ8A 3AVKA 3O1LA 3H7IA 1RDFA 2MLXA 2Q3SA 3D6TB 5AM0A 9ICFA 2R42A 1F2GA 5J2PB 3KKAC 8ICOA 1LKYA 2CAJA 2WFAA 4LF5K 2R8IA 3BQ2A 4AILC 2A6OA 1DEJA 3FZFA 2FI1A 3GE9A 1YF5L 1CJKA 1RHMB 4FP9A 2F8EX 4F93B 4F91B 4BXOA 3QXGA 2VC0A 5J2NB 5BN8A 3IV6A 3FC4A 5H9EK 1XUPO 3AU6A 3N97B 2CQ1A 4X5VA 3C65A 4A8WA 4YOXA 3WC2A 4K0KJ 2W3SA 1ZQRA 1B9FA 3H1QA 5EVZA 1NBEB 5GTIU 1VIXA 2XULA 4ILGB 2G1DA 1QQMA 3HHKA 2D9PA 1VK8A 5FIIA 1KQFB 4D3GA 1M90O 2IVMA 2Z1GA 3BP8A 3QT6A 3BH7B 3LO3A 2KYXA 2M7SA 3SENA 4OHWA 1BPEA 2ZZTA 2ZJ8A 5KFFA 4XIUA 2ZIWB 4WIQA 3QBXA 2VQEF 5BOLA 4M45A 4KH1B 2EAOA 2M52A 1YJVA 2BYCA 2PI4A 3OXLA 4FLWA 4FZLA 3JPTA 1HUOA 3EICA 5AM1A 3BO3A 3A0HU 3CJRA 1T05B 2B56A 7ICOA 3OFGA 4F0MA 2HQGA 3L95X 3H8YA 4CIGA 1V3SA 4UATA 2J7UA 2BA9A 3SBGA 4LRBA 4Z37A 1U24A 2MY7A 4ID5B 3ZETB 2OPRB 3PYEA 5HOOA 3K5MA 2C3PA 2MZ1A 1PCAA 1GQEA 3VQAA 5HVHA 2RF2A 4DZ6A 1L5UA 1TFYA 1X42A 2QWPA 2E6LA 2I38A 2ZJRL 3ZSZA 4HYKA 5B0FA 1WELA 3OHRA 4YY3J 2XMAA 3H7HB 4FJ8A 2R18A 2DRBA 4Z94A 2V7ZA 3KMSA 3CCLS 2YQEA 4DO9A 1S1XB 4K42A 5J0RA 4NM1A 1SC1B 3ID6A 3DLRA 1XNQF 4GKJF 8ICIA 3WC0A 3OYHA 2G8WA 1NM1A 3AVLA 3Q83A 4YB1P 1B70B 8ICCA 4Y00A 1DK3A 1N32K 3I6PA 5D4NA 5L1IA 3RJMB 4J2AA 1TKTA 2O01C 4JKGB 2E1FA 3OUYB 4BRKA 4BC2A 2EPIA 2LQ5A 2ZH5A 4CZMA 2ILZA 4OI2A 5E7OB 3PSTA 2OYQA 2BJ9A 2VFUA 1HBNA 2K8CB 3UCGA 1BI4A 2AIRB 4R5PA 4RNHA 2OYYA 3SUNA 3JPPA 3D45A 5D4OA 7ICSA 3MCPA 1WHWA 3MEKA 1KNZA 3CJ3A 4L73A 1HNVB 4U96A 5JXSA 4RG8A 1IQZA 1BQNB 4DR3J 2YMMA 8ICJA 1S77D 4MAKA 4ZPBA 1EQ0A 3SCIE 3MX5A 3M32A 3V81A 1NPRA 2NLWA 2DH7A 4C8MA 2P9KB 5GAHI 1F3FA 4A8OA 4DQPA 4HTJA 3B6OA 1OYEA 3P5TL 2ZJ5A 1FF2A 1XHXA 2D41A 3MN9A 5F3XB 2FHOB 3ZDBA 4J90A 1UT5A 1R8PA 5FDLB 5KFWA 3RGIA 4UOGA 4QYRA 2W2NP 2JLGA 4PHDA 3QFUA 2PMWA 5J0SA 2QTDA 4FLUA 3TNVA 4J2DA 4MFFA 4Z6DA 4EX6A 1YJ9S 1VSMA 1VJ5A 2FBYA 4ZJLA 3HHLA 1VQYA 5KRTA 1CS4A 4FJ5A 4LF6J 3V6DB 2JHEA 1A5XA 3TADA 2O8CA 4KKOA 2JOQA 1TK0A 3DXKB 3KLIB 1WACA 2J6TA 3P45B 2QKQA 1Y4ZB 4OJOA 2HEKA 4ED7A 1D8ZA 2DGXA 2KMDA 4C11B 3OYAA 3OL6A 2M8HA 3A0BU 3B0XA 1XK8A 2UXCK 1ZQOA 4IRDA 4BGDA 5D4BA 5JICA 1JCFA 3O6WA 3N28A 2GGPB 1KSPA 4CF8A 4UUXA 2AEMA 3GV7B 4NJ8A 2MKCA 3KZIU 4KLOA 4BDYA 4CZLA 2NV3A 4O4RA 3CFPA 1CJUA 5DM7L 3PJXA 2DKOB 1NOMA 1NB7A 4M63C 1DURA 1R27B 2G08A 3CPWR 3SMPA 2OEKA 4FF2A 4DQRA 1VOMA 3KUHA 2W54A 3Q8PB 2ZTDA 5J0WA 3UMCA 3ILIA 2GVZA 2B4PA 4KC5A 4OPJA 3QSIA 2DGTA 1U2FA 2QWQA 1N36K 2ZJRQ 4FNHA 1HNZK 3HTVA 5HROB 4P4OA 2WTFA 3NS6A 3A3NB 2CPYA 4IWVA 2YQ0A 1P9YA 4H5WA 4OL8A 2V8PA 3Q24A 3TZZA 5J0TA 4I2GA 2EBEA 1O0PA 2BE2A 2AZ1A 4UAVA 2ZHAA 5ALZA 3FEZA 4XO0A 2PBDA 3AVFA 1UJ4A 2CPDA 4OJGA 3M2VB 4CFDA 1C4AA 4PPDA 5AI6A 1JXBA 2Q0ZX 2BCQA 3RRKA 2ATCB 4DR4F 2R7YA 1QVGR 2LMRA 2OM6A 1YBAA 2NSBA 3ZX3A 1Q5YA 4YMEA 3FEYB 2G13A 5GVQA 5LXRA 1YITN 3M8YA 3CULA 3F5EA 3IG1B 1A0PA 4BC3A 2VPYB 4M9NA 4HHUA 1HQ2A 2VH7A 4MKAA 2R7TA 3N4MB 3G96A 5ALEA 2XO6A 1DGSA 2XI3A 3LA0A 5M2RA 2OAUA 2FVRA 3RMAA 3OTOJ 2GWSA 1HQUA 4M5GA 5AQFA 3HKZF 4BUGA 5C10A 4RQNA 2C2ZB 1YJTA 5KL8B 2VIHA 4DX5A 4CECA 4MK7A 1NHKL 4CEFA 3QETA 2WB1F 2ZBPA 5AKHA 1ZQKA 4KLIA 3EYZA 5FD1A 4DL0C 4JI7F 2HMPA 2HGMA 3VAFA 2OMLA 4CE9A 3FFKB 4DTOA 4KX3A 3MTJA 3VENA 4JB3A 2K3KA 3KHLA 2MSTA 2E1AA 3VTHA 2GMLA 4MKVA 3BEXA 5HAOA 2YB1A 3HHEA 4ZVGA 5IIMA 3CD6N 1UA0A 3K5LA 1XQIA 2BDPA 1H2TZ 2VJ4A 4GKKF 4USTA 5GMEA 5E3PA 1H38A 1BOTO 4DPOA 5F1XA 2P5VA 4MEYA 3NH0A 1IR0A 4GNIA 3PUFA 2U1AA 4HH0A 5BPNA 1TMJA 1X4GA 4CZEA 1ITPA 3GG0A 3EGWB 4ECXA 2ZXIA 1JLQB 1SV4A 1DFDA 4G65A 3ZSOA 3O3FA 5DMRA 2LEAA 4DN0A 3I32A 4N8OA 3HSCA 3MEEA 1A0OB 2DFLA 1SL0A 4ICLB 2GQ2A 2NYHA 4NL9C 2P2CB 3GSIA 3QBWA 2HVEA 3M9NB 3AVHA 1AT1B 4KX5A 4KO0B 4OHYA 2DIVA 3NY0A 3ID8A 2ZH1A 1HMVA 1VQ8N 3ZSVA 2B0GA 4KHRA 2E7WA 5EOYA 1S6QA 4JYAF 2PFQA 4CRJA 4B3TK 4GVBA 4ILLA 3PIOQ 3E9PA 3C29A 1B4FA 1WC1A 3P31A 4DV2J 5HMYA 4HVJA 5IV4A 3KHHA 4IG0B 5DZ6A 1RM6C 4GO7X 5DJBA 2V52B 3MM6A 4EELA 1GMUA 1XNRF 2EDUA 3OYBA 4YDUC 2PYJA 2KFZA 4I2BA 5KFOA 4ECQA 1ZAXA 3DXMA 3MGVA 2LKZA 1W0HA 1GMWD 1TFWA 2QE5A 3LOUA 2QN6B 3CW2C 3IFRA 1FKPA 2E1PA 1NLVA 3NAEA 4JD2A 3PCOB 1VQLN 2CZVC 3JQMA 4CNZA 3DRSA 2F7VA 3DC2A 2DGQA 4O0JA 4DR6J 4UT4A 2W1BA 3W9JA 3SBMA 3AA8A 4EYIB 3PW5A 1YITS 1IBLJ 5DB9A 1OXJA 2W9BB 2JZBA 4IR1A 3KK3B 2HZVA 4MIBA 2NRVA 4DWIA 7ICFA 3T6JA 1M5PC 4WXWA 3FZKA 3JTNA 2CQGA 2F4VJ 1W2BR 1IBKK 4USMA 2QA1A 3R7NB 1PJ6A 4RLEA 3CIZA 5AHXA 1VFJA 4EP4A 2Z57B 3AARA 3KOOA 4DU1A 2FHJA 2NUUG 4KV8A 3VQQA 3RBEA 3NAIA 2V67A 2V8GA 4X4OA 1BCMA 2B6AA 3L4QA 5LT5A 1P1LA 1O13A 4CZJA 2HYIB 1EKEA 2XI2A 4AHSA 4O5FA 2Q0RA 5ETSA 4FWMA 3MXMA 3MCOA 1UT8A 3TAMB 2OELA 1UW9A 2AKWB 3K0SA 4B1YB 2H3ZA 2KSOB 4BRDA 4A8EA 2DPJA 1OPIA 5ETQA 2CGLA 2G4BA 3K2PA 3FZLA 1JJCB 3FCHA 4BRCA 1CC8A 2CNKB 2GO8A 1LOTB 3MPDA 2VA8A 3OQ2A 2WBRA 4DKWA 3GILA 2ZBIA 3RMDA 5T7BA 4JI1K 3VGMA 4KTZA 3L0QA 2DNYA 4RX6A 2BKOA 5HI7A 2YJEA 1KLMA 2Z2MA 3HVTB 4I6MB 1DQ9A 1WSGA 5AKIA 2O5DA 5F8JA 4B1ZA 2R2RA 1UVIA 1QD1A 1U1NA 1MW7A 4C0ZA 4F5PA 4ILJA 4QWEA 5I3UB 1N33J 2OMOA 2YKNA 3MPYA 3MPVA 1RT4A 4JS5A 4HI1A 2MZTA 4DFJA 2BACA 5LM7E 1JLEA 4BE2A 2HOEA 3CHWA 1SI9A 2UZAA 4DV4F 4PPXA 2YMLA 4YFKA 5HQMA 1CLFA 4QIGA 3UI3A 3ZSXA 4WZMA 3M30B 1F9HA 2FJDB 4ZVSB 4UB2A 1ZD3A 3CM5A 2YNIB 4FJLA 3VQ6A 3C7NA 2HVDA 3SSRA 2K7KA 3QJJA 4I6YA 4Q2LA 3QGIA 1FDNA 4O5BA 4OVLA 1C0TB 4J9NA 4HCCA 2E1CA 3CCEN 2K4IA 1DTQA 5HMLA 1ZQAA 3LTOA 4OYPA 2F65A 3VQEA 4DV7F 2CIMA 3I5BA 4UZCA 3THWB 1GLBG 3I87A 2HG4A 3OJUA 2WAQF 4ZN1A 3CJ9A 2MYFA 2H5JB 1K73T 3NL0A 4NLZA 5F41A 3VEXA 2GBZA 2QA4G 1VLOA 3PJWA 1UFWA 2B4OA 5E41A 2OCEA 1HWKA 3EGZA 3THYB 4CGGA 2I1QA 3A5LC 1JLFB 9ICCA 1E3MA 3LP0B 4MTPA 1NJIO 2HLTA 3G6XA 3EZUA 3FNNA 5M2UA 2BRKA 1FTRA 1CPZA 2ZH3A 5E79U 5G0RA 2HF4A 3OYGA 3NGTA 1RBTA 3VPZA 4P2SA 1PBUA 2E9ZA 5BN9A 2F44A 1FXXA 1S1UB 3O8WA 4IFEA 3R6GB 1KFDA 3NEKA 2C2NA 2OEJA 3FM9A 4L74A 4G1PA 1XMQJ 1HW9A 1ZXOA 1QTMA 1FD2A 4ZN3A 3UNYA 1N6QB 2DGZA 2R7OA 4M41A 1S8OA 2LYBA 1QHAA 2FVQA 4LFBF 3TJ9A 4CHQA 3G6EN 3MR6A 3GFHA 2JC1A 1WOQA 3G4SS 1B4SA 1T7PA 4O44A