4B9VA

Structure of the high fidelity dna polymerase i with extending from an oxidative formamidopyrimidine-dg dna lesion -da basepair.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 210
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9vA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9vA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9vA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9vA01
5DK5A 3RWUA 1LWFA 3OS0A 2RPIA 3LP0A 5DB6A 5HP4A 4M9NA 1UT5A 4UBCA 4FZYA 1F21A 5DQGA 2ZJAA 5EWGA 4QWEA 4P2HA 9ICTA 1C1CA 3PX0A 1HNVA 4RNMA 4J9LA 4M9GA 1KFSA 1WN7A 1U04A 1WSEA 5KT2A 1TK0A 3DRRA 4RQ8A 4KLIA 4DOCA 3SV3A 7ICHA 2ATLA 5KFAA 1NJXA 1JLFA 4YN4A 1U45A 1EETA 3MEEA 7ICUA 2DFLA 2KTQA 4KLDA 1HYVA 2UVRA 4DS4A 1BPYA 4DOBA 4PHEA 1JIHA 8ICXA 1VSJA 4OKJA 2DFFA 4B8CA 7ICTA 1KRPA 3KLIA 3ZT1A 1SKWA 4Z4IA 4FLVA 4UAZA 1IM4A 2AGQA 1VSEA 2O4IA 1BISA 4NYNA 1KDHA 4O3SA 4F92B 3N97B 2E6LA 1NOZA 4EZ9A 4ZH4A 4IRKA 2H5XA 3M8SA 3PMNA 4GXIA 2IHNA 5I3UA 1RBUA 3OYKA 4FLXA 5KT4A 3SPZA 2ASLA 1ZQTA 3T5LA 3TAPA 4M3XA 3S9HA 3TAGA 1SKRA 3EYZA 4UB2A 5HRRA 3NH0A 2PXIA 3V6JA 1B22A 4NCBA 4UAWA 2F1IA 3PNCA 8ICBA 3NF7A 4CIFA 1KVBA 8ICHA 5D3GA 3PR4A 2BKEA 1ZQUA 3JPOA 4E7LA 3DLHA 4J9KA 4Z4EA 4RPZA 4M47A 2A1SA 4ECUA 2OA8A 3QE9Y 4R63A 4CF2A 8ICWA 3NGDA 3RRHA 1BIUA 1RZTA 1JMSA 4CEOA 4FW1A 3ZSYA 1GOCA 3M8PA 3JPQA 1ZQFA 4M3UA 5J2EA 4I2IA 5F9LA 1C0MA 4DU3A 4NYFA 2QK9A 5HMLA 1VSKA 8ICQA 3LANA 5J0TA 4GC6A 2ASDA 2W42A 4RZRA 4Z4GA 3KK1A 3OYCA 4B8AB 2R8GA 1WSIA 4NCGA 2ZUCA 2FLLA 3I0SA 1TL1A 5IIJA 5J0SA 1S9FA 9ICXA 4M3RA 4DSLA 3AUOA 3KKSA 3AA2A 4KHQA 3OHAA 3UXOA 1N48A 4RPYA 3M9MB 4RT3A 7ICIA 5KFVA 1WCNA 4RUAA 4JV2A 4BACA 4DL4A 5BPCA 8ICZA 3VQ6A 4F4ZA 3MFIA 2FLPA 5KFOA 3CG7A 3IS9A 4CIGA 1D8LA 3NE6A 3BQ0A 4JS5A 4FYDA 4PQUA 4CERA 1KFDA 3C5GA 3IHQB 1SL0A 3E2EA 5IIIA 1UA1A 1N5YA 1K6YA 4CFDA 4FO6A 5KG6A 1S9GA 4QZCA 4O0JA 1B9FA 4F4WA 2UVVA 3KJVA 3P5JA 3NGZA 3NBPA 3HP9A 3NHGA 3PX6A 1HJPA 4BXOA 2VA2A 5KFLA 3SI6A 4CHNA 1U47A 5IIKA 3HM9A 4KLHA 3KLGA 3C2KA 5KT5A 4DF8A 3UXNA 1ZQZA 5C5JA 3AVAA 4K4HA 4YFKA 9ICJA 2HHWA 8ICEA 3HPGA 1C0UA 3SJJA 2RF2A 3TANA 2BR0A 4KHSA 5KFFA 3C6UA 1I39A 4CEFA 4OKEA 1MU2A 2D0CA 4KB1A 4LVSA 4OLBA 1EX4A 1C1AA 3SPYA 1GOAA 5J0WA 5DGBA 4M9HA 1JXBA 1BCOA 1VSFA 2VWKA 3MECA 4I2AA 3LP1A 2YNHA 2IA6A 4IBNA 4J9MA 4DL3A 4I2EA 3G0ZA 4O3RA 3VQEA 2P66A 2YNFA 4QWDA 3RB6A 5DBCA 1NK8A 3K59A 1T7PA 4MEXA 7ICFA 4N5SA 3N4MB 2E6MA 4I2CA 2FPKA 2XCPA 4CJKA 1V9PA 3T19A 3S3MA 4EBDA 4ID1A 3U3YA 4KLTA 5J1EA 2WOMA 3IG1A 4F5RA 9ICFA 5SZTA 1SZPA 1Q9XA 4DTOA 4YCXA 2DPIA 4CECA 3BQ2A 5EOZA 3LP2A 2C2DA 1RTHA 4ECSA 4JWNA 4BGDA 3VA0A 3AV9A 1XO1A 4MF2A 4FJIA 4M6WA 3GIMA 3B0YA 3LWLA 4ECQA 3V1QA 3UPQA 5L1IA 7ICLA 2NRZA 3ZSOA 4RNNA 3WNHA 2IDOA 3VQPA 3WNEA 5KFUA 3MGIA 4HHTA 3NTUA 1ASWA 4CGDA 3G10A 4W5RA 2XRIA 5KGWA 1ZQPA 4MFFA 5EU7A 4EEYA 3ZT2A 3VN5A 1Z3EB 4C8NA 2IHMA 4BE0A 5KFNA 2F8SA 4I2QA 5EWFA 3PW4A 4R8UB 1HQUA 1TAUA 2E4LA 3LDAA 5DB8A 1CZ9A 7ICJA 7ICGA 5DDMA 4M41A 3C2MA 5KI6A 4RG8A 4C8LA 4CE9A 4M3ZA 5DB7A 3V4IA 3LK9A 1RTJA 4NLGA 4KITB 2BCQA 3D0PA 2J6TA 4PHDA 1RXVA 5J2KA 4M45A 5FRNA 4ECXA 3H4BA 4TUQA 3QEBZ 1JLAA 3OYDA 3PR5B 3M8RA 2P5GA 5KG4A 4O5BA 5T7BA 1XHXA 4IG0A 3V1RA 2AQ0A 1QHTA 5L9XA 5CB1A 4MEYA 3H4DA 4F5QA 3JPRA 4GXJA 2RDJA 8ICOA 5J0PA 4ECTA 3TFRA 3KLFA 1J5OA 3DLKA 5J2FA 3VQ7A 3BGRA 3ZSZA 2ATQA 5KGXA 3RAQA 4Z6EA 3HK2A 3DLEA 9ICHA 2OZSA 3PW2A 4ED7A 1T8EA 5KFWA 4RT2A 2QKKA 2F8TA 1XC9A 3TFSA 3VQQA 4N56A 3LALA 8ICUA 5CYQA 4DTRA 4KMUA 1UA0A 4YR3A 1ZQAA 7ICSA 3LPUA 1QSSA 4J9PA 3LAMA 2BPGA 4N41A 3Q8LA 4LD0A 5KFBA 4W5OA 1RYSA 3B6PA 3QZ8A 2HW3A 1B43A 2FBVA 3AVHA 3DOLA 4KHNA 3DLRA 2RN2A 1DTQA 4NM1A 3SUPA 4FK0A 4AHRA 1S1TA 4O3NA 2YHBA 2Y1JA 4Q43A 4RUCA 2ETJA 3PO4A 1QLNA 2NRWA 3CFOA 3RMBA 3Q8RB 5J0XA 1B92A 4F5OA 4JS4A 1ZQEA 3ISDA 1ZBLA 1TV9A 2HHUA 3JYTA 2HVIA 1TVRA 4EYHB 2FMQA 4F5NA 4AHTA 5J0RA 4NLKA 4B3OA 5DG9A 2ZQBA 4F2SA 2KZMA 3Q8SB 3RB0A 4TURA 2Z1GA 3E01A 4ED1A 1L5UA 1VRUA 2QXFA 3P83D 1UWBA 5CA7A 1BI4B 4ICLA 3ZT0A 4FJXA 3MFHA 4O0IA 3OVNA 4M3WA 3TAQA 1RDCA 3GV5B 4DTJA 1A5WA 4PGQA 4CJ4A 1WAFA 4DTMA 1SV5A 4B08A 1RTDA 2AJQA 5DQIA 3ALYA 3L2UA 2JZBB 2BQUA 1RYRA 4MFCA 4IDKA 3F9KA 3LWMA 3RR8A 3KHLA 5KFDA 1TKDA 2I5JA 3QO9A 2F96A 1S0VA 3VQ5A 1ZQSA 3G6XA 3PUFA 3K4GA 4GXKA 4CJFA 1ZQJA 7ICNA 2JLEA 1U9LA 3AA4A 3MEDA 4KRFA 3L2WA 3DRSA 1JN3A 4XQ8A 3CYMA 3HVTA 1S6PA 4IFVA 1NK0A 4DSKA 4FJKA 2X78A 5FROA 4CK1A 3OYIA 1BPZA 1HUOA 3AU6A 4I2BA 1IKVA 1CXUA 8ICKA 2J6UA 1YTAA 2DPJA 1QS4A 2ZUBA 5TZVA 1COOA 3DLBA 2XHBA 1RT7A 4E19A 2VG5A 4DLGA 2BCUA 2ASJA 4KKOA 1RPLA 1A5VA 4CGFA 1LWEA 3MR3A 1NK6A 4DEZA 4TQRA 4KI4A 3T5JA 4QZDA 3ZD9A 1ZQLA 3P1GA 3RB3A 3HT3A 4J2BA 1A5XA 1CLQA 3GIJA 2Y1IA 4IR9A 4W5NA 5E41A 3ISCA 4IR1A 3HX0A 2QKBA 4RQ5A 4DTSA 5J2JA 4Z6FA 4RQ2A 3QZ7A 4YR2A 2GUIA 4B9NA 4CJLA 5J2AA 3I8DA 3PW0A 2A1JB 4Y1CA 1RT4A 3AVFA 4J2DA 3LP3A 3QEAZ 1RCHA 2BE2A 9ICVA 1RDAA 4DWIA 3L2RA 5I42A 1O1WA 3AVBA 2DTUA 1LB2B 1C7YA 1VSMA 2IOCA 3ZDDA 3QEWA 3V81A 3UXPA 4Y1DA 1ASUA 2UVUA 5J0YA 2NRTA 5KG1A 4O5CA 4ED0A 4FJNA 3NH1A 2HMIA 4UAYA 1RT1A 4IFYA 3RJKA 3PW7A 1RBVA 2YV0X 3PV8A 3OJSA 3BDPA 4MQ3A 7ICEA 1JX4A 4N47A 1WLJA 5CZ2A 1RILA 4CHZA 4HVJA 2NRVA 3OYMA 2PYJA 4CHYA 1BPXA 4JUZA 1RXWA 1LWCA 4ZTJA 1NOYA 4KPYA 5DGAA 4P4MA 3M9NB 3RMDA 3NGIA 3C94A 2PFPA 1KTQA 5KRTA 1EXNA 3ZDBA 4QCLA 8ICTA 4Q8FA 4J9OA 1Q9YA 4QWCA 1BVSA 2AQ4A 9ICEA 4CK3A 4UB3A 3Q8PB 4HUGA 5KT3A 4R66A 2Q3SA 4B9VA 1BHLA 5DQHA 2FBYA 4ECVA 1J54A 2G8VA 3QESA 1XI1A 1TV6A 3Q8KA 4NM2A 1KLNA 4E89A 2OPQA 4YD1A 2P6RA 1XU4A 3T3FA 4JRQA 4RNOA 2GBZA 9ICRA 4DOAA 1YVUA 5DDYA 4PA1A 5L1LA 3AVMA 3A2FA 3U3GA 3MAQA 5HHIA 4KLUA 3V6HA 3AVLA 7ICPA 5CYMA 2AGOA 2FPLA 4OVLA 3PMLA 4E7HA 1BQMA 2IAJA 4KHYA 5J2DA 2W9MA 1RNHA 4FS1A 2KN7A 1LV5A 1BI4A 1HYZA 4PHAA 1RT5A 1SL1A 7ICRA 2JEJA 1JLQA 2KFNA 3QEPA 4FBUA 4Z6CA 4UBBA 4N76A 4F2RA 4O44A 8ICRA 3MEGA 1J9AA 3C23A 3T5HA 4DO9A 4WE1A 1ZYQA 3VQ8A 5BOLA 3RMCA 3EZ5A 4O3PA 3V6DA 4F4YA 5HNKA 3G6YA 3Q8MA 3EW9A 4QZ8A 1ZBUA 9ICSA 3KTQA 4FJGA 4DL6A 3ZDEA 3CFPA 5KFJA 2C2EA 1S10A 3RJHA 3LAKA 1YTUA 2YKNA 4XA5A 5KTQA 2Z1IA 4FLUA 2FBXA 2HNZA 5HROA 3SQ1A 4QW8A 8ICMA 3RBEA 4F91B 4GLXA 2DFHA 3MR2A 1Z00A 5IIMA 2HHQA 5KFXA 1G15A 5CHGA 1RBSA 4UB4A 4I27A 4JRPA 3BQTA 1JXLA 3MR6A 4BDPA 3ULDA 4KLJA 4DSIA 4I2FA 1IG9A 1Q8IA 4DSEA 4HUFA 3AO1A 2W9CA 8ICGA 4IQUA 1S77D 2WONA 3AVGA 3V72A 3OS2A 3VQAA 3SV4A 1A77A 4KFBA 1IH7A 1BPEA 4M3YA 3ZT3A 4E0DA 4X5VA 4ID5A 3M9OB 2IBKA 1T05A 1L3VA 4Q45A 1C0TA 4FJLA 2YKMA 4CIEA 1A76A 4B9UA 3O3FA 5KT6A 3OGUA 4DU1A 1AROP 4I29A 2VWJA 4ZTFA 2EX3A 3AVKA 3RTVA 1ZQWA 9ICIA 5JUMA 4RU9A 1ZQRA 1JL2A 1W0HA 4KAZA 1S76D 5IINA 5J2CA 7ICQA 3RJJA 1X9MA 3M8QA 1ZQBA 2AU0A 3WNFA 2LYHA 4O4GA 4DSJA 2W9BB 3RMAA 2KZZA 4DFPA 1HPZA 1T3NA 5DG8A 1U48A 4DMNA 3IRXA 2HB5A 1ITGA 4RW4A 4H4MA 5BOMA 3K5NA 2YNGA 8ICIA 5K14A 4I2GA 5JS1A 3AO2A 3QEVA 4M6WB 3CFRA 9ICBA 4OPKA 4ED3A 1DOQA 4OJRA 3O4NA 4YG2A 4Q8EA 4GW6A 5FRMA 3RJGA 1SUQA 1J53A 4LY7A 2HHVA 3VQDA 4AHSA 2VA3A 5J29A 4QZ9A 1REVA 4E7JA 3GFKB 4FJJA 4F8RA 3U6FA 7ICVA 5KT7A 4E1MA 3HYFA 4RQ6A 8ICNA 4K4IA 4I28A 4RQ0A 3BQ1A 3RRGA 1BL3A 2A1JA 4KLOA 1FXXA 4CFCA 4RQ4A 5KFEA 8ICSA 2B4JA 4O3OA 1TVAA 4J9NA 2XY7A 4B9TA 2HHXA 4CGIA 4FLWA 1JL1A 2OYQA 2G8WA 3MR5A 2VA8A 1BQNA 4HCCA 2ZTDA 4CGGA 4YD2A 5CJ7A 1WSFA 3V7KA 2OZMA 5KG0A 3RJFA 2ZUDA 3TQ1A 2AGPA 4ELVA 3DMJA 4FBTA 4C8MA 3LPTA 2KZ3A 5HRPA 4FLYA 4NY8A 4P4PA 1UAXA 3AVJA 3HPHA 2PFOA 4O5KA 4FJ9A 1WAJA 3TABA 4QWAA 1D9FA 2MUTB 4PH5A 4QOZB 1S1XA 3HL8A 2NUBA 4FM0A 7ICOA 4IKFA 4DTXA 1NOMA 1ZQNA 1HNIA 4CHOA 3ZDCA 2D0BA 1ZQVA 1L3SA 3NCIA 2RDIA 1HUZA 4LH4A 4O55A 4UQGA 1NK7A 4IQTA 5KG3A 1CZBA 3QIPA 1ZBIA 2JEGA 2ZD1A 4RW8A 3S3NA 4FLZA 3FYHA 5F9NA 3KHRA 1TK5A 1S0OA 3L2VA 4NLZA 4QWBA 3T1AA 5L1KA 3MBYA 2PYLA 3NDKA 1MC8A 5HHHA 8ICYA 1ZQGA 9ICQA 4KLLA 4M3TA 4YP3A 1BGXT 1NKCA 4FZZA 4I2PA 1BPBA 1JLEA 5J2HA 4AILC 4HTUA 4W5QA 3QINA 1FKOA 8ICAA 1JLCA 1JXEA 1ZQKA 1ZJNA 9ICGA 2BQRA 3PVXA 2R8IA 1CXQA 2KQ2A 3Q8QB 3SUNA 4CJQA 4IG3A 3L8BA 4FXDA 4DFMA 3K5LA 4M0AA 2R8HA 4DG1A 4KV8A 2R8KA 3C1ZA 4YXJA 1BIZA 2F1HA 4KLGA 3ETLA 4FJMA 4KHWA 5J2GA 2BGWA 4F3TA 4QZFA 2I1QA 2FMPA 4CJEA 1NJZA 3QEIA 4CESA 1HMVA 4C8OA 1XSPA 3TR8A 4KHUA 2HHSA 3JPSA 2G8UA 4MFBA 4LZDA 2MUTA 2XY8A 1NJYA 3EPIA 4JK1A 1DGSA 5HBMA 3FDSA 2FBTA 3V7JA 1TKXA 3MABA 2V4QA 1S1UA 4BE2A 4QZEA 2FC0A 3K5MA 3ISBA 4BE1A 1MQ2A 1CEZA 3QIOA 4AHVA 4CHQA 5FDLA 3K75D 3RJEA 2VG7A 4G1QA 3PX4A 3OYJA 4CEBA 4F5PA 4J2EA 2R7YA 5KFMA 2XC9A 3ZSWA 4FS2A 1EKEA 4KLQA 2DY4A 4Q0BA 4DFKA 3QNOA 2BQ3A 4DU4A 4EP4A 5J2MA 1TAQA 3MXJA 3RB4A 5DG7A 3C95A 3TAEA 2JEFA 4K8XA 5CZ1A 5EWEA 3TARA 4Z6DA 3GV7B 3RAXA 3JPNA 5CY4A 4FJHA 2B21A 3SUQA 4OPJA 7ICMA 4RQ7A 2PFNA 4I9QA 4MFAA 2W8LA 2W9BA 3AA5X 5C42A 4EP5A 1VSDA 3PW5A 3AVNA 4M42A 5IIOA 2B5JA 5CWRA 3AO3A 4DTNA 4RQ3A 4J2AA 2KW4A 1DTTA 4DQSA 4H4OA 3ZD8A 4FK2A 4ELTA 4DQPA 4CJTA 1BPDA 4ED8A 4K8ZA 1HQEA 8ICLA 8ICCA 1S6QA 2P5OA 3GV8B 1S5JA 1HJRA 2PI5A 4DTUA 1KVCA 4BDYA 3DYAA 4B9SA 4ECZA 2RKIA 3HP6A 3AO5A 4UB1A 1PZNA 4DQQA 2M9NA 1RT3A 2W8KA 1S0MA 8ICJA 4KTQA 4YVZA 3GDXA 1WCLA 4RW7A 4FJ7A 4FZXC 1N6QA 2W9CB 3SQ0A 4QAGA 3LDSA 3NAEA 4KO0A 3GIIA 3C21A 3L2QA 3OYBA 1RDDA 4EZ6A 1IKWA 4J9SA 3RR7A 4CF1A 3SQ4A 4I9LA 2G8IA 2BDPA 4CFBA 1SL2A 4XRHA 1ZJMA 3KLHA 4KLEA 4AH9A 3RJIA 5KFHA 1B9DA 5J2IA 4YNQA 4HUEA 3ZSRA 3MXIA 3JPTA 1S9EA 4ECRA 1RDBA 1FKPA 2X6SA 3TAMA 1QTMA 3C6TA 3KHGA 3VA3A 1NKEA 4IRCA 4ED2A 1DLOA 3GILA 2P6UA 3QLHA 1ZBFA 1IKYA 3DM2A 1Y88A 4XIUA 3ZSVA 3OYEA 4O9MA 3TAFA 1W9HA 4DQIA 4LZGA 1WSGA 3OYFA 1KFTA 3CM5A 3OYGA 1RT2A 4DLEA 4R65A 4QZGA 3VQ9A 3K2PA 2ZJ5A 8ICVA 4CEEA 4M2YA 4PWDA 3B0XA 2OPPA 1Z00B 3C1YA 1NK4A 1MQ3A 3ISNC 1X1PA 3EY1A 1D8YA 4LH5A 4HYKA 4PY5A 5HRSA 1XWLA 1JLBA 5KFGA 4JV1A 2OPRA 4TUPA 1WNSA 2VANA 2C28A 1XS9D 4E7KA 3KD1E 2HNYA 2NRXA 1LAVA 5D49A 4BXOB 2LSNA 4TUSA 3THVA 9ICAA 3DRPA 3HSTB 3L3UA 3SI8A 4CF0A 1U4BA 5J0OA 3NF8A 3O3HA 3GQCA 2BHNA 2YHAA 1KVAA 1TK8A 2XY6A 1RBTA 2DFEA 3V7LA 4NCAA 4M9LA 5DMRA 4OLAA 3HW8A 3ZSXA 4CJSA 3K5OA 4DL2A 3OY9A 4ELUA 9ICUA 1LAWA 5KG7A 1Z26A 3NH2A 3D45A 4I7FA 3HWTA 4C8KA 1QSYA 3OYAA 1IKXA 1X9WA 3JPPA 1K1SA 2D0AA 1Z25A 1NK5A 4M9JA 1KLMA 3S3OA 3MDAA 4KLSA 4YMNA 3ORYA 3ASMA 1NK9A 3MDCA 2KFZA 3NF9A 2G8FA 1S97A 4DF4A 1C1BA 1GOBA 3V9UA 1LW2A 4CJRA 3EWAA 2G8HA 2UVWA 3GIKA 4I2HA 2MAXA 1I3AA 1S1WA 2D5RA 3LZIA 3RH5A 4ZHRA 3RH6A 1ZQMA 3K57A 2BCSA 4YR0A 4RW9A 3HO1A 1KSPA 1HYSA 3H08A 4AHCA 4IRDA 4GMJB 4M04A 4Z4CA 4FM1A 4DTPA 8ICFA 4CJUA 4JWMA 4KTWA 3WNGA 4FK4A 4JLHA 5J2NA 4KTZA 1Y97A 2BGGA 4PUOA 1ZQDA 4TSXA 7ICKA 9ICCA 1S1VA 2C22A 4KN7A 3JSMA 1RBRA 2X74A 4Z4HA 4F4KA 2J6SA 3DOKA 1TKTA 2EHGA 5DKWA 4TQSA 1ZQIA 4CEDA 2W9AA 2WTFA 4J9QA 4QZIA 4YXMA 4B9MA 1VSLA 3NFAA 2ZTEA 3QETA 4BWJA 2Z1JA 9ICWA 2ZE2A 1KCFA 3T5KA 4CJVA 1JKHA 4GC7A 3SZ2A 3HJFA 4CF8A 9ICMA 3ZSQA 4GVMA 4P4OA 4CJ3A 1NKBA 4CFAA 3VQCA 1N56A 2VG6A 4FVMA 4R5PA 3UQ2A 3KHHA 3KD5E 1ZQXA 1SKSA 4Q44A 1L3TA 1T4GA 2PY5A 3C2LA 4B9LA 5J0QA 1TFRA 4MF8A 2XCAA 3MGHA 5KG5A 4CF9A 4CJPA 4Q5VA 4BWMA 5DBBA 4NXZA 1NJWA 1D9DA 4L8RB 4F4XA 4J9RA 1L3UA 5HLFA 1ASVA 2ITGA 3VQBA 2FPMA 1QSLA 5J2PA 4DL5A 4CEAA 1QE1A 9ICPA 4ECYA 4W5TA 3V6KA 4Z4FA 2YNIA 2BCVA 2OPSA 3NF6A 3H7IA 5KFTA 5KFCA 3KK2A 4ECWA 2F1JA 4OKKA 5J2QA 2B6AA 4KREA 4CEQA 3TWHA 4CK2A 2Z1HA 4PPXA 2GWSA 4O5EA 3V9WA 1ZETA 2JZBA 3UQ0A 3F73A 3SCXA 5HRNA 1T03A 4G3IA 3FFIA 3AVCA 1HRHA 9ICKA 1RTIA 1UT8A 3SYZA 1QQCA 1UOCA 3SQ2A 3OYLA 3AO4A 4UB5A 2G8KA 4KI6A 1TKZA 4CEZA 1VSIA 5HP1A 3H8WA 1ZQYA 4PGXA 4FJ5A 4QZAA 5KFZA 3ZT4A 4FW2A 4DFJA 3O4QA 1ZQHA 4PGYA 2GV9A 2FMSA 3EPGA 4R64A 2JGUA 4RW6A 4CCHA 5D46A 2PI4A 1WSJA 5KG2A 3ZDAA 5CR0A 1R0AA 1RT6A 4ED6A 5HMMA 4XUSA 1VSHA 5DLFA 3V9XA 3G6VA 2ALZA 2XGPA 5C24A 5L1JA 3CQ8A 1KEJA 1ZQCA 1WSHA 1ZQOA 4CJWA 3K58A 3OYNA 3L3VA 4LSLA 3BJYA 3O3GA 3TI0A 3HVRA 5SWMA 3KKRA 3OS1A 4IQVA 3KK3A 9ICNA 1D5AA 5KFRA 3I0RA 4KB0A 2BPCA 4RQ1A 4RPXA 4DSFA 2IMWP 3OJUA 3RBDA 4LSNA 2P1JA 3VQ4A 3OYHA 5KFYA 3V1OA 4PHPA 3OHBA 1CUKA 1EXQA 5KFPA 4EBCA 5DBAA 4YQWA 3PY8A 1TL3A 1FK9A 4CGHA 4E7IA 2BPFA 3MXMA 3QEXA 2HNDA 3OSNA 5KFIA 1VK0A 4OGEA 2P51A 4YFUA 4QW9A 2V9WA 3H8JA 1C6VA 1TGOA 3DI6A 2V4RA 4CJ5A 4YMOA 3DLGA 1XSNA 4YMMA 3UIQA 5KRSA 5CP2A 3KIOA 3H8SA 3AA3A 3V9ZA 2IS3A 2PFQA 1VRTA 4EYIB 4DQRA 3PO5A 3LZJA 4QZHA 2XGQA 4DL7A 4HCBA 2O4GA 4I2DA 3V9SA 2R8JA 4AHUA 3AU2A 4CHPA 4K4GA 4FM2A 2JEIA 4OGCA 5C25A 2A1RA 2OWOA 1ZBHA 2Q0ZX 4BDZA 1EP4A 2FLNA 9ICLA 5J0UA 3QNNA 1U49A 3QERA 4F50A 4FLTA 2IC3A 4FCYA 5DLGA 4KLFA 3CM6A 3NGYA 2PZSA 1K1QA 1ZQQA 3AVIA 3B6OA 3ITHA 3ZCMA 4E1NA 1S0NA 2IGIA 2XO7A 5KFKA 1JLGA 4KN4A 3OSPA 5DB9A 1LW0A 4JV0A 1X9SA 3KLEA 4KLMA 5D4BA 5KFQA 4DS5A 3IAYA 8ICPA 2ISOA 1IO2A 4NLNA 2X6NA 3IM1A 2HHTA 4IQWA 2I9GA 4F93B 1IXRA 3SNNA 4I2JA 1BCMA 3SUOA 2BCRA 4Z0UA 1XHZA 4QZBA 2HVHA 1X2IA 2ZTCA 3C5FA 4R8UA 3H40A 4O3QA 4H8KA 3HXMA 4FJ8A 3RH4A 4E3SA 4CGJA 1MSWD 2BANA 4EBEA 2ISPA 5KFSA 3HPOA 5IILA 1H38A 9ICOA 2ZJ8A 1YT3A 5J2BA 5JS2A 2XY5A 2C2RA 4F3OA 1XSLA
chains in the Genus database with same CATH superfamily
1QJHA 2N7CA 5BRHA 3HLUA 3RWUA 1LWFA 3AJDA 3OS0A 1R6VA 2O8EB 5HP4A 4M9NA 3W2WA 3CQYA 3POTA 4UBCA 2NSBA 5LY3A 2A3ZA 1F21A 1RJJA 5H1SV 2VD3A 4LSZB 1FE0A 4H4OB 5M1FA 2HBYB 1Z4OA 1F3VA 2H48B 1U04A 1WSEA 5A8KB 3MGVA 2NSCA 3O8MA 4F7VA 2D4WA 4B3SF 3DRRA 4WBFA 3AQOA 4N7TA 2E5SA 2MU2A 5KPZA 1MU2B 3H2LA 1K0VA 3J7AN 2YWKA 1RQ0A 2GH1A 2R2RA 1TR0A 4DOBA 1W2BR 1NLVA 5G5GA 3QFWA 3IR7B 1RWNB 2OH2A 2E9ZA 3FFKB 4ZS6A 1WUDA 1Z2ZA 1SBRA 4UAZA 5ALEA 2E2NA 5A6WA 3M2VB 4JI1J 2O4IA 2KHQA 4O3SA 4F92B 4DV1F 3DGPA 3R8YA 3MAAA 1NOZA 4EZ9A 2ZE2B 4IRKA 3G8QA 3GCWP 5AI4A 3H90A 2WBRA 5KT4A 1K8KB 3F5AA 1Q78A 3S9HA 5FD1A 4UB2A 2DISA 2GHVC 1A7GE 2PXIA 3V6JA 4PKDB 4I67A 1B22A 5HBMB 4NCBA 4DR5F 3D1OA 2V67A 2F1IA 1S72S 1KVBA 3QT5A 3LL3A 4E7LA 4Z4EA 1RT5B 4RPZA 2E9RX 2A1SA 4ECUA 2OFHX 4CRJA 4JKFA 8ICWA 3NGDA 2LCWA 2Z57B 1RZTA 4FWPA 3F41A 1E4GT 3G82A 3MPDA 4DCCA 2HF3A 4GY2B 4I2IA 5F9LA 1C0MA 5GVQA 4F3QA 4ILGB 2CQBA 5HMLA 2A2DA 4QS9A 3O6WA 1RM6C 5J0TA 4GC6A 2ASDA 2KG0A 5C2FA 4ANEA 1S1WB 3IKMA 4B8AB 4RW8B 2V4JB 2ZUCA 2G06A 1TAMA 4OYOA 4CZCA 2ZIUA 1SJQA 1S48A 3AA2A 3RFAA 5IQ6A 3MM5B 2QM1A 2HFSA 2ZC4A 1RTZA 3M9MB 4I2PB 2FXUA 4RT3A 1WCNA 2LYAA 4AE5A 3UVJA 4GV9A 1PKUA 1UEVA 4DL4A 3IN5A 3VQ6A 1U2VB 4AP9A 4A57A 2A6AA 2KH9A 1S99A 1T03B 1IVZA 3E01B 3CG7A 3IS9A 4NLWA 3J7AP 2JLFA 3NE6A 1RUSA 2F8HA 4JS5A 1VQON 2KJ8A 1PK3A 1KFDA 3E2EA 1X4AA 4OHYA 3WXJA 1UA1A 4CFDA 1TUVA 4FO6A 4UARA 3VF6A 1S9GA 2YX8A 3KG1A 3AB2B 3NGRA 3KJVA 3P5JA 5F8IA 3NGZA 2HCFA 3GFXA 3OXGA 3NHGA 3UKUA 4OCZA 3VTIA 2VA2A 1DQ8A 3LA0A 2WZ1A 5IIKA 1J5EJ 2YHWA 2UV8A 3J7ZO 5IV4A 3C2KA 2JNJA 4DF8A 1R7IA 1NDKA 5C5JA 3W9HA 2B7BB 4K4HA 5L9NA 4KHPK 4YFKA 2XNQA 3V2UC 4IOXA 4Y6IA 2JH3A 4KHSA 1N33K 1DK3A 5L39A 2CJQA 4OKEA 4X2BA 2EZYA 1GMUA 4KB1A 4WJBA 1WF1A 2EQYA 2O8BB 3GJQB 3SPYA 1GOAA 4M9HA 5M1QA 3IV6A 2XHCA 4I2AA 3LP1A 3BSNA 1EAYC 1VIOA 4B1ZA 2KLAA 3K8VA 3I5CA 4C0BA 1HBUB 3FK4A 4NJ8A 2P66A 2ZXHA 4C4TA 1X40A 3FCHA 2V8PA 4DV2F 3FZLA 4DX8H 2MKCA 1I94K 2FPKA 2FB0A 3QFUA 1V9PA 2F4VF 1RGVA 3ELHA 3ENWA 1OW5A 5L8RC 4B3RJ 4ID1A 2KM8C 3O4WA 3U3YA 5C7PA 5T14A 4X4PA 2F4VJ 4CBUA 3VGUA 5H9FK 2AMCB 4F5RA 2BYCA 3EVOA 4AQYK 1XIQA 2KV2A 5A8RA 3DRRB 1NMNA 3LP2A 2QV6A 3UNGC 3VA0A 3M8QB 3EM1A 3C14B 4FNHA 4CLYA 3D0GE 4RNNA 5K14B 3U8XA 3UD3P 2IDOA 5KFUA 3GU3A 4OD0A 4I1TA 2VFUA 3FMBA 3R7BB 4CLUA 2Q6BA 1VR6A 2ZJPL 4BRAA 3ZT2A 2QT7A 3A3OB 1N33J 3DOMB 3D6FB 1JJHA 2NXUA 3ZI4A 1U24A 2IHMA 5KFNA 4I2QA 4R8UB 1LK7A 2IRXA 7ICJA 1M1GA 2DGVA 3WIUA 2KK0A 3PCOB 4U6PA 1KOOA 4OJPA 4C8LA 4Y2UA 1SH3A 2QWLA 1CS4A 1M5HA 3CCSN 1JCEA 2G2ZA 3D0PA 3RBXA 1U1RA 2FC9A 1HNWK 4ZVHA 4U7UK 1XHXA 1GXUA 3V1RA 2LM4A 4FYVB 4RBUA 2D3ZA 2O8DB 3VGSA 4PYDA 4OHVA 2L48A 3CJ4A 4KGMA 3TFRA 2LDIA 1MLAA 3DLKA 3PSFA 4RTFD 4E2FB 1UFKA 3CULA 4JI7K 2MYFA 5AM3A 2LYVA 3HK2A 3DLEA 3B8AX 2OZSA 1GLJO 4LF9J 1EKSA 3RSEA 2GIFA 3BY5A 4MT1A 1FVQA 3TFSA 3ZTPA 3VQQA 4M1KA 1UL3A 2IMOA 4AFFA 5JICA 3CE8A 4WF9L 4KMUA 1ZQAA 2DYAA 2DKZA 1QSSA 5ETSA 2ZIVA 2V69A 2BPGA 2G2OA 4PXEA 3R5JB 4LD0A 3FCVA 2GLEA 5GAEI 3B6PA 2RQMA 3DLGB 2MQOA 1P6TA 1B43A 4AT1B 5J8YA 1ECWA 4MDBA 3RSEB 3TA0A 3DLRA 5LSOA 4PG6A 4JYAF 5GIOA 2CFXA 2KYXA 1MWZA 1S1TA 2HBZB 5KAIU 4TY8A 3H2UB 2YHBA 2XBPA 5IOLA 4RUCA 3ISZA 1HIYA 1NSQA 3SDEB 1VQNN 4JK8A 1VLYA 4C3KA 2W40A 3F2CA 1TV9A 3R5AA 1SC4B 4RPFA 3W60A 1X0PA 2H3VA 5AQTA 1B7FA 3IGNA 2GEMA 2VZ9A 4UZBA 1O13A 3ET6A 4AHTA 4B3OA 3MMJA 4F2SA 2KZMA 2C2OB 2C2ZB 1I51B 4LF9F 2FVCA 4ED1A 3GZ7A 1NM1A 4Q2LA 1YJVA 2WAQD 5GTHU 2WB1F 1UWBA 1BI4B 3MFHA 2BVZA 5A2QO 4IQXA 2E5JA 1IR2A 3PHEA 5LMUK 4ILRA 5AQHA 4PGQA 4CJ4A 1WAFA 1NMEB 2AJQA 3HHNB 4RW6B 1VQKS 3F9KA 3LWMA 4B3TF 2FQQB 1TKDA 2I5JA 2F96A 2QA4N 1S0VA 1XMQF 7FDRA 3VQ5A 4ZLJA 3QYPA 2HYIB 3PUFA 2EG1A 2FDRA 4GXKA 4K43A 2QB0B 7ICNA 2CQ2A 1U9LA 1YITN 3AA4A 4OO1J 1RWOB 5H9FJ 3MEDA 4HDHA 5BPLA 1NSKL 3CD6S 3LP2B 3VEZA 2B5JB 2E29A 2HIQA 2DKOB 8RUCA 3SEOA 5FROA 1HNZK 2JRZA 3SCIE 4ES1A 1BPZA 3NAIA 4OI6A 1HUOA 4A8YA 3BQ7A 3AU6A 3NMRA 3CCQN 5ALWA 5I42B 1UZDA 3WQTA 2KNJA 3ZZPA 2FC8A 1KQFB 4HDGA 5J2MB 1COOA 2LQ8A 3DLBA 4NASA 2WUSA 2XHBA 2YMLA 4E19A 5CRXA 4DLGA 4CGFA 2LU2A 3LVVA 4DEZA 4TQRA 2VPZB 2VIXA 1F0MA 3ZD9A 1PUZA 1FRMA 1ZQLA 1GH8A 2EAMA 3M1FA 3EZWA 3AJ1A 5A0YA 2X1AA 1A5XA 4IR9A 2Z4PA 1Y11A 1NEEA 2PE8A 5FDLB 1KN5A 4DTSA 2FVQA 1HARA 1LWEB 1DRZA 2VFRA 1YRUA 1KHWA 4ZVPB 1WOSA 3VEVA 5JU5A 3C8YA 3AVFA 3BS7A 2ZIWA 1UVJA 9ICVA 2DK2A 2YJFA 1IKVB 4DV6K 2CH6A 1RDAA 2KVIA 4X65K 5CXTA 2DTUA 3U1NA 1UVKA 2IOCA 4QYRA 4DUTA 2H54B 2UVUA 1O5JA 4WFBL 5EE9A 2XSJA 4FF3A 1JKHB 4ED0A 3CCTA 3CDEA 4FJNA 3NH1A 1S6PB 4UAYA 4K42A 2Q43A 2OMLA 3ZC4A 3OJSA 4TY9A 4Y2KA 4ZOSA 1HNVB 1VBYA 1JX4A 1RGIA 5CZ2A 5A2QU 3NGTA 4HVJA 4CHZA 2E5LF 2DBBA 1FNMA 2PYJA 1QVFM 1HBOB 1NOYA 2QA2A 4FF2A 4KHPJ 2ZITA 3M9NB 3DXSX 4BUGA 3IRXB 2WW8A 1F9EB 3CIPA 5KRTA 2EFPA 2WAQC 3ZDBA 4J9OA 3U1LA 1WBBA 1FKOB 2FJWA 1Q9YA 3EXYA 2AQ4A 9ICEA 1MROA 4O4GB 4BROA 4U67Q 4UB3A 3UKRA 1JRPA 4ECVA 2G8VA 4FXVA 4CW7B 2UUBK 5LSRA 4NM2A 4WFAL 3NCRA 2CPHA 5EGYA 3VQSA 4JRQA 4RNOA 1WKLA 5HAOA 2R7TA 1JLGB 1YVUA 4PA1A 5L1LA 1NSAA 3A2FA 3D66A 5EVZA 4NOHA 4KLUA 3MCAB 2ZM6F 4FWSA 1F5AA 2B9WA 4OI1A 2P9NB 1BQMA 3HHDA 1NCLA 1KC8O 5AFUH 4DR4F 3BREA 2KN7A 4B1WB 5JLFA 1BI4A 4LQ3A 4FZNA 4CTAB 1BNPA 3CDAA 3JAMO 4N76A 4F2RA 1Z2LA 2RRNA 3W2VB 1RCXB 4KAIA 2HOFA 3RMCA 3JYTB 2CYYA 2KMDA 3CCJS 1K8KA 4RBTA 2NZCA 1YHQS 5HNKA 3G6YA 3UDEA 2VQFF 3EW9A 4QZ8A 3D0HE 3HD2A 3WIVA 2OKQA 9ICSA 5FPMA 5B0CA 1RT2B 3MAAB 1RAGB 3ILOA 2I7NA 5U47A 5AI0A 3RJHA 3NWGA 4M5DB 3BGRB 3W9IA 4FLUA 4QW8A 4GLXA 2DFHA 3WQPA 1W7WA 2HHQA 4B1XB 3UI3A 3VETA 3R5DA 3PEJA 4QR2A 5LL6d 1SAZA 3KWMA 1OIAA 2JFKA 3OL7A 1AUDA 2IHR1 3HKWA 4LRFA 3ULDA 4WXWA 4DV6F 2B4VA 2ZDPA 4U67L 1B99A 1WG5A 4B1UB 1S77D 2LQ9A 4C2MA 3VQAA 1PJ6A 4L75A 2ROEA 4Y00A 2YB1A 1BPEA 1X42A 1J5EF 1HPZB 3KOOA 3CJSA 2U2FA 4ID5A 1K9MT 3GG4A 1X6JA 2AYMA 3M9OB 2VH7A 5CYMB 1T05A 1IR0A 4Q45A 2LLZA 2YKMA 4CIEA 3O5BA 1RU2A 4NXNK 5KT6A 3OGUA 4ZTFA 4UY85 4HHUA 2PAVA 1L7MA 5JUMA 1NDCA 4FSVA 1W0HA 4MO4A 1CS4B 4KAZA 2F7TA 2V94A 4LBPA 3OV7A 2IYIA 1S76D 1BUPA 4KHRA 5J2CA 3RJJA 4CO5A 4CZLA 2ZJRL 5ALNA 2ZNZA 5C0YA 1NNEA 4U7UD 2LYHA 3NVMA 2MRLA 4HAIA 1VCTA 1KVJA 2E44A 5DS7A 3TUPA 3QU4A 3PIPQ 1U1KA 4OZNA 2VONA 1L8LA 4RW4A 4UTGA 4H4MA 5BOMA 2YNGA 2YNIB 5ALFA 2Q36A 5JS1A 2J0XA 3CCQS 1IIPA 3CFRA 3CCEN 5J2PB 1ZRNA 3RJGA 1NH8A 1ITPA 1J53A 2AXTU 3VQDA 3CCJN 3QIDA 3NVWA 2HVZA 1RAJA 2E1YA 5MLCV 5AXKA 1REVA 2P9EA 1R89A 4UW9A 3GFKB 4CLSA 4QIWD 1FJGJ 2V63A 2VPWB 4F8RA 1TUGB 4E1MA 1BG3A 1TKXB 4NXNJ 4K4IA 4I28A 2YNFB 4RQ0A 3BQ1A 4YDUA 2BZ2A 1BL3A 2EBGA 2I5HA 2A1JA 2DVIA 4RQ4A 4UAUA 3TUZC 2BX6A 4N8OA 1ZS6A 4O3OA 3AARA 5AHXA 3BO2A 1Q8LA 4KY3A 3N4PA 4B9TA 2G1DA 5LMUF 5AKZA 1Z4UA 2IRYA 3MR5A 2YJEA 1U2RA 1BQNA 2LKZA 1QTNB 4MDAA 5CJ7A 2RQ4A 3PIOL 2KSOB 3SAFA 2V8HA 3TJ8A 1NSPA 2EWHA 2CGLA 3CCZA 1OY6A 3JS9A 3D3BJ 5AKXA 2JWLA 4DR2K 1UJ4A 4C8MA 4ZPBA 1M1KT 5FPNA 2ZG6A 4NY8A 2M8HA 1CSJA 2XWYA 1N62A 3AVJA 1WC0A 3KK3B 1YK9A 1XERA 4M63C 4FJ9A 3BBCA 3CJ9A 3TABA 3VGMA 4QWAA 2UXCK 2MUTB 5GTIU 4PH5A 2VWBA 1VQMN 4FM0A 1ATSA 7ICOA 4IKFA 1KD1O 1GLFO 1NOMA 3GJTB 2AX0A 3OTOK 3HVTB 4K5RA 2D0BA 4Y2XA 4F0MA 3OT9A 1ZQVA 5K4LA 5GAEP 1BQMB 3R6GB 5KQDA 5CCMA 3KK7A 4LH4A 4IG3B 1GLBG 1VGYA 1NGAA 2P35A 1S22A 4DR6F 2F5GA 2AHOB 2R42A 2J76E 1HI8A 1OVQA 3IS9B 3EGWB 1NZBA 4CRXA 2CDRB 5L1KA 1WOQA 1F1BB 3DNCA 3DHWC 4LF4F 2OIHA 3HTVA 2QYGA 3T1YJ 5IC4B 9ICQA 2YTUA 4ICLB 2V2QA 4DV0J 1IBKK 3O80A 4I2PA 3VAIA 4HTUA 3MM5A 4W5QA 4FPBA 8ICAA 1RKIA 2FHMA 3ILJA 9ICGA 3HILA 4L73A 2BQRA 4P0PB 3Q8QB 4LJXA 3SUNA 4CJQA 3A8JA 3VEYA 1X9JA 3K5LA 4M0AA 3P4UB 2BW2A 2O66A 4OJ1A 4KV8A 1VQ7S 4YXJA 4ZJOA 4LVNP 1NGEA 4AQYJ 4DR4J 4MMOA 4ZVQB 4CLFA 4IFYB 4KGVB 2HQCA 5ALXA 2KKHA 4CJEA 1NJZA 1YDLA 4CESA 1HMVA 3THXA 3OBIA 3JPSA 5JVGQ 5TKWA 2QFIA 2F4FA 1G6BA 1RWPB 4UQTA 1FX4A 1XSLA 3EPIA 1N34K 4BC9A 1HL6A 4NI2A 4JBCA 3V7JA 2KIVA 3MABA 2V4QA 1CJVA 1S1UA 4PR6A 2ZF5O 3ISBA 2YPYA 2CGKA 3QIOA 1P27B 4CHQA 5FDLA 2KRRA 3D1QA 2M8DB 3G2XA 1CJTB 4G1QA 1BY9A 2HS4A 4B3MF 3EE8A 4DPYA 3KG0A 2R7YA 3MN6A 5KFMA 4A2BA 1H2TZ 4FWNA 1QUPA 2YTCA 1EKEA 2R3VA 3SMZA 3TADA 2ZH9A 2IIHA 2Z30B 4JI7J 4KLQA 2DY4A 1ZTTA 2KFYA 2VQFJ 1BWVA 4USVA 4IH6A 4QS8A 5J2MA 2JEFA 1T6DA 4Z6DA 4D3HA 2DHSA 3GV7B 3RAXA 3TZYA 3TACB 3L3FX 3BF1A 7ICMA 5AIAA 4HH0A 1PJ5A 3IBPA 1KWMA 2Y9HA 2B5JA 1VQ8N 1YLXA 3AO3A 2KHCA 2B9EA 3RAMA 2I6WA 3D4JA 4WYLA 4UOCA 4RQ3A 2Z8QA 2KW4A 4J2AA 1D8ZA 3I9V9 4YOTA 4QIGA 4JV5K 3MXHP 4OL8A 2R7SA 3CDWA 2W01A 4PQAA 2HBQB 3AXMA 5AQLA 4LF4J 4K8ZA 8ICLA 1QUVA 1S6QA 2P5OA 1M5PC 3K89A 4DB3A 1SC3B 2MEWA 2PI5A 2QLWA 4A61A 1XEZA 3AGKA 3GL1A 3IO1A 2RKIA 2DEJA 4DQQA 3IDHA 2M9NA 1HD0A 1RT3A 1N36K 2FHJA 2FF6A 1R31A 4DZ6A 4FWKA 1S0MA 4Y2VA 4QZVB 4YVZA 1WCLA 1EP4B 4RW7A 2XZTB 1Q46A 1S12A 4FZXC 4O0NA 4QS7A 1SV0A 2KB2A 3IR6B 1MWMA 2VV5A 3P96A 4LR9A 3C21A 3OYBA 2NXCA 1RDDA 1WBDA 2MA1A 2XQCA 4EZ6A 1F5SA 1FO4A 2CDQA 1EIYB 3BSCA 1PK1B 1IKWA 1WNEA 4ICAA 4J9SA 3SQ4A 4I9LA 4CFBA 4XRHA 2KO1A 5J2IA 2BH1A 4YNQA 4HUEA 4W90B 1RABB 5E3AA 4ES3A 2X6SA 3C6TA 2ZM6J 4B9QA 3DN9A 4B02A 1DLOA 3GILA 2P6UA 4C1NI 4TY8B 3VWSA 3CMAN 1ZH5A 4BRGA 3NMUA 1WEYA 2DCLA 1JLBB 1S5LU 4R25A 4B3TJ 3CM5A 1TUWA 1CLFA 4DLEA 4LBHA 5AZJB 3BSAA 5ADXH 4M2YA 3BH7B 8AT1B 2LHTA 4PWDA 4USUA 2ZJQL 5TKYA 2XYPB 3EUB2 4EIAA 1Z00B 4BRIA 4X66F 1P9YA 3C1YA 1MQ3A 2JL9A 4JKGB 2JV3A 2KJVA 1MN7A 3ADAC 4NLSA 2E8MA 3M8ZA 4JI5K 4LSLB 4JV1A 4TUPA 1WNSA 3VAFA 5IM0B 4BXOB 4QIFA 1MMNA 3CDBA 1SQGA 9ICAA 4KRWA 4M5JA 2LEPA 1F5BA 3UR0A 3EICA 2HSZA 4CF0A 1U4BA 3FBBA 3TX8A 1DARA 1XUPO 3GQCA 4ZLNA 4YOEA 2ZKUA 2AP6A 3Q22A 1V4SA 2O1PA 2JR5A 4EU0A 5DDQC 1XNRJ 4KGXB 2DFEA 1JLAB 5DMRA 4URGA 2O5DA 2XMKA 4C4WA 5C2GA 2G0JA 3K5OA 2HF4A 4O44B 2HPUA 1E3MA 9ICUA 3CERA 3BKTA 1Z26A 2LMRA 1AB8A 4J9VA 4I7FA 2HGNA 3NL0A 4C8KA 2BJ3A 1X9WA 2D0AA 4AXIA 2UP1A 3PKMA 3ORYA 3UN2A 2D9PA 1NK9A 3GLJA 4BC5A 4PXCA 2BJ7A 1S97A 4HACB 3IRUA 4DF4A 3N7RC 2HVEA 1GOBA 1SV0C 4R0JA 2G8HA 4I56A 2Q2RA 2MAXA 1L7OA 3FZBA 3I56N 2UXCJ 3QWUA 2VKZG 3MM6A 1B0XA 1TKZB 3H08A 4M04A 2FHJD 3M2UA 4WK1A 1TZ0A 3KFWX 4FM1A 3KKFA 2LEBA 3LYSA 3VAGA 3ZX2A 3ZZRA 2MXYA 2A42A 4USAA 4DCOB 1TELA 2FHKA 2DGOA 2XTJP 2BGGA 4BRFA 1ZQDA 2YPZA 4TSXA 2OM6A 4HKQA 3JSMA 3L95X 3IM9A 4G1IA 4K4TA 1DY3A 3M5RA 5F2RA 2U1AA 3RGIA 1LWCB 3DOKA 1V97A 2EHGA 5DKWA 4R5PB 4USJC 1YQHA 2OLWA 4A4JA 2WTFA 2QSWA 4L76A 3HKZF 3NFAA 4FN5A 3VGKA 5DZ7A 9ICWA 2CPDA 1DRGA 1KQGB 2LQ5A 1RDWX 2M3DA 2VQEF 2D41A 3SZ2A 2HI0A 1NHVA 9ICMA 4GVMA 3V81B 3ATVA 2DCUB 1NKBA 3CJ8A 5B5EU 1RHKB 2APOA 4JI2J 3UQ2A 3KD5E 1QQNA 1VQYA 4USIA 1NPKA 2CXEA 1N54B 3D6TB 4GVBA 2RS2A 1SIZA 3C2LA 4B9LA 5J0QA 2FJAB 4CD3A 2K06A 4CF9A 3W8PA 4CM2A 2N4CA 5EHHA 1A9NB 3Q24A 5HSPA 1VC5A 2DBYA 5CD4H 4DR7F 3DHXA 4U7BA 5M1PA 1JNZB 1PBAA 3CJ0A 3VQBA 2FPMA 1QSLA 4IKAA 3CCVS 3KJVB 4JI6F 4CEAA 1W25A 4ECYA 2DNMA 2DRBA 3TOQA 4C97A 1M6YA 3OTDA 3EE9A 3ILIA 4US9A 3AL0B 2YNIA 4JHDB 5BREA 4Z7CA 5KFTA 4ER8A 4NEZA 1WDTA 1K9MO 4OKKA 2NO4A 4UOGA 3JQKA 3JAMY 1BE4A 3VV2B 3JSMB 2GWSA 3UQ0A 2NLXA 1TL5A 1X5SA 3F73A 4LIWA 3HOTA 3SCXA 3J7YU 1T03A 1REGX 2UXBK 4C7YA 3PSTA 2MLYA 3HHEA 4K4UA 4LRDA 1QQCA 1IWAA 1UOCA 4ZCKA 2RHKA 2PMHA 1IQZA 3OYLA 2HBLA 3H0PA 1FRHA 1UPPA 1TKZA 2ZWOA 4RKUC 4IOCL 2Z2ZA 4PGXA 4FJ5A 5KFZA 2AWZA 4NLBA 2Y1RI 4Y2SA 7AT1B 1J2MA 3O4QA 1ZQHA 1NGFA 3QO9B 4GO7X 4LFAJ 1YI2S 1AT1B 1KBRA 2PFFB 5D46A 2BXJA 5DM7L 1WSJA 2DIUA 4NLXA 1N61A 5KG2A 5CR0A 3NNHA 5AZIB 1RXOB 3HCXA 1OMSA 3I4PA 3CIMA 2P9GA 2CQCA 2JH1A 2XGPA 4UW2A 4DPTA 5L1JA 1OY9A 2AKWB 5J1PA 1VQ9S 1ZBSA 2I6XA 2Z56B 3ZNUA 5LJWA 1PAUB 2ROGA 3K58A 2ZHOA 4Y2IA 4LSLA 3M7DA 4B1VA 1GLAG 4BRHA 2CAJA 4CQ1A 2NYIA 4M5KA 4KMOB 2NR0A 2BABA 1B0PA 5LJVA 4HT7A 9ICNA 3THTA 1D5AA 3M30B 3WT0A 1VQ6S 4ZDNA 2JFDA 3RVCA 4RPXA 3ZYYX 2IMWP 3S01A 4CO2A 2HFZA 3RBDA 4PKHA 3DRXA 3OYHA 5KFYA 3V1OA 4PHPA 1RAAB 1LXNA 2MSTA 2FYXA 5BRDA 2QJ3A 5C2DA 1BLUA 3VAMA 1KP6A 3PY8A 3U4LA 1FK9A 4RWTA 1Q81O 2BPFA 3MXMA 3QEXA 3OSNA 1DTQB 1VK0A 4OGEA 2ZBRA 1NGCA 2P51A 4YFUA 1YRTA 3S6JA 3H8JA 4G9BA 1TGOA 2EEYA 4Y34A 3J81O 2D9OA 3BZQA 4KPCA 4LSNB 5KRSA 3C6TB 2Q6CA 3HI9A 5CP2A 5RUBA 3H8SA 3V9ZA 1J97A 2PFQA 3D2QA 3HRDD 3LZJA 4CE6A 1S6OA 4IJAA 4JI5F 4DL7A 3J80Y 2CJYB 3PFOA 2GJ2A 2KD1A 4CNQA 2R8JA 4FM2A 2YVSA 4K4GA 2IM2A 2JEIA 3TP2A 2A1RA 1UVLA 4BC2A 3I82A 3O9QA 1VJWA 1EARA 2FJDB 4ETZA 4BDZA 3NXZA 1EP4A 4DCJB 1J5OB 2UXDF 3QERA 3ONNA 3R1HA 1WHYA 1U26A 4FCYA 1WG1A 3VZHA 4KLFA 3C6HA 4FWLA 2A2CA 2NXEA 2B4UA 3U02A 2FD2A 3EEQA 1R8CA 2GGPA 3IBCB 3WKCA 1SWVA 3PNIA 1PK1A 2KRBA 2DJWA 2IGIA 5E5NA 3CI5A 1JLGA 4J8FA 3FNNA 1WORA 3DLLQ 5K9FA 1LW0A 1PYSB 2NYHA 5D4BA 4KGZB 4JI5J 4DV1K 3IAYA 4X65F 3DRYA 2I38A 4RW7B 4DV4F 4IQWA 2ASYA 2I9GA 2W4PA 4LF6K 1BCMA 2YWFA 4PABA 5DM6Q 4NLPA 1WOPA 2HVHA 1X2IA 2ZTCA 3I56S 1RT3B 1B0VA 3H40A 4H8KA 2N3LA 4ZCMA 4FJ8A 5BR8K 3H25A 4JEPA 4CGJA 3B6BA 2ZJ8A 2CPEA 3L6QA 1YT3A 5J2BA 1GQEA 1EHWA 3W5YA 5DG7A 2XY5A 2C2RA 1NWKA 3C15B 2KXNB 2BJEA 1ZM9A 5A2QY 3VTHA 1NGIA 2D74B 1HBOA 3CD7A 1WTBA 1U1PA 3RW7A 1N32K 4XH1A 1UT5A 2ZGYA 4FZYA 1RLCL 3CCSS 1S49A 5DQGA 2ZJAA 1LKZA 4QWEA 3H8MA 4P2HA 3F2DA 9ICTA 3CUNA 3PX0A 3FGVA 3TKAA 4RNMA 4J9LA 4M9GA 1WN7A 2CQ1A 2X3DA 4QR0A 4DR6J 3BO3A 3VEWA 5KT2A 1TK0A 1KS2A 4KLIA 2XZWA 3H6EA 4DOCA 3FBFA 1BDGA 4FOEA 1IBKJ 7ICHA 2E9TA 1NJXA 3BGOP 4Y2QA 3N6MA 3J80U 1JLFA 1U45A 3TEHB 7ICUA 2E2OA 1BUXA 4KLDA 3I87A 2UVRA 4DS4A 1BPYA 4X4QA 2J0WA 1JIHA 1S59A 1KHVA 3IXQA 4OKJA 1MNEA 2DFFA 7ICTA 2GTDA 2MDAA 3ZT1A 1SKWA 3TVKA 5IWAF 4LFCK 4OI2A 1C20A 1IM4A 2K2PA 4ZKAA 3P3DA 2HFOA 1S79A 2E6LA 3SMVA 3K2YA 3C19A 1JJ2M 3QFHA 3Q7CA 1QAIA 1UZHA 1CJTA 3M8SA 2B3TB 2BOAA 1NZPA 5I3UA 5JVHQ 3OYKA 4JD2A 1G4CA 1QD1A 3SPZA 2ASLA 1ZQTA 1TMMA 1YBAA 4JI6K 3TAPA 1NGDA 4QIWC 3TAGA 1SKRA 3EYZA 2F77X 1VHXA 4BBYA 5IT9Y 5LJ5Y 1VBXA 4ZP9A 2WF6A 4OYMA 4FWQA 5D3GA 1E6YA 2V0NA 1ZC6A 3DLHA 3M32A 3FEYB 3H98A 4IWVA 2OA8A 1R0BG 4EFAC 2EANA 4CF2A 3NGUA 2HIYA 4CEOA 3PSPA 2H1YA 1U09A 3ZSYA 5IXUA 1GAOA 1ZQFA 4M3UA 5J2EA 4IEEA 1FIQA 4NYFA 3MOZA 5CYJA 2RS8A 4DV2J 4R0EA 8ICQA 3N5BA 1DQAA 1N8RT 4Z4GA 2IFXA 4RZRA 3KK1A 2HFVA 4PQUB 1TL1B 2ZD1B 2MQNA 2C2MB 3TZZA 5J0SA 3CPWM 3AUOA 1UEUA 1EKRA 2VGMA 1ZQ1C 3O1WA 3M7VA 1SV5B 3DXKB 3MI7X 3M1VA 3OHAA 3UXOA 1M1KO 2W43A 1AZSA 3NVYA 5KFVA 7ICIA 3GB0A 1PSDA 4RUAA 4OX8A 5ETKA 1AYEA 2R7OA 1X31C 4CZJA 8ICZA 4F4ZA 3MFIA 4ZA1A 3L7PA 1RHRB 2QL9B 5BRFA 3NLCA 4DV4K 3CETA 1LXJA 3HHLC 3P49B 4CIGA 4WU2A 1DHMA 2HWTA 3KK2B 4C98A 1S4EA 1FWLA 3PXGa 4A8OA 4CERA 3C5GA 2HBKA 3QU2A 3K5PA 3JSBA 2ZWHA 4TVAB 1N5YA 2Q66A 2HFNA 2KSOA 1B9FA 4CO1A 3KUEA 4A5AA 1HJPA 3MM7B 3SI6A 4CHNA 3PJWA 4KLHA 3KLGA 3THWB 3UXNA 4LF6J 2OSRA 2NUUG 5AQOA 3IBWA 9ICJA 4BR4A 1QM9A 4NLUA 1C0UA 2HSTA 3OLBA 3TANA 2BR0A 3C6UA 1I39A 3MDFA 4CEFA 2P6TA 2D0CA 3FC4A 3S6EA 1VAZA 1WUUA 5ALHA 2KYZA 3CRXA 1C1AA 1SUQB 1NI3A 5GAGP 5J0WA 2YH0A 1VQNS 3BS5B 3AODA 3UDVA 3MZIA 2Y0SD 4P52A 2K8GA 4DL3A 4LFBF 2UUWA 4JKAA 1AA1B 2MJUA 3CJ5A 3SXLA 4BVPA 2F65A 2YNFA 2F1FA 1QZ5A 1SQKA 1OH6A 2GV1A 5DBCA 1TYQA 2A6MA 2DHHA 4NXMK 1T9XA 3N4MB 3ZZUA 4I2CA 3WK4A 4CJKA 3T19A 2R7WA 3S3MA 4EBDA 1FDBA 3RF9A 3MD3A 2WOMA 3IG1A 1Q9XA 1SZPA 2ASPA 2MZ1A 2DPIA 3NASA 4M5LA 4UOHA 2LQJA 1RTHA 5E33A 4BX9C 4ECSA 4JWNA 1XN9A 4MF2A 1T44A 3AV9A 4FJIA 4M6WA 3GIMA 3B0YA 5FIIA 3MMBB 5L1IA 7ICLA 2RE1A 1BA0A 3ZSOA 1Q53A 2O6KA 1NBWA 3GZFA 2FVRA 1TFYA 3HI0A 4X62J 4FL9A 4CF4A 2DNRA 1ZQPA 4MFFA 2MHNA 2VODA 2A5XA 5HMZA 4EEYA 1H74A 2ZJRQ 3K17A 3FRZA 3VN5A 1KQSR 4BC4A 3OW2R 2VQEJ 4OIXA 1RTDB 3U26A 4EENA 4Z37A 3OL8A 3PW4A 3HF5A 1NAQA 2MQLA 5D15A 3NNCA 4YY3F 4USWA 4M41A 5KI6A 1MW7A 4OX9F 1BXNA 4CE9A 5AK5A 4YOUA 5ETVA 3M4XA 3LK9A 2W2NP 4KITB 4DR3J 1KD1T 4HH1A 4K8RA 1RTHB 3R3LA 1OJ4A 5E2QA 2Y9TA 3T1YK 5J2KA 4ECXA 4TUQA 2XLJA 3QEBZ 1JLAA 4QU6A 3KOAA 2P5GA 5KG4A 2IA0A 1VRTB 2GNKA 4IG0A 2BJDA 1QHTA 1XNQJ 2MY8A 3H4DA 1ZZFA 4MJKA 3FQKA 2I0XA 3JPRA 1NGJA 3M8YA 4GXJA 2HWHA 8ICOA 4RUHA 3DRPB 2HAIA 2FJVA 5J0PA 4ECTA 3DI6B 5J2FA 3MMAB 3VQ7A 1SJFA 1HNWJ 3ZSZA 2FVPA 2X1BA 4ZVRB 1R3NA 2ZOFA 1BMQB 4Z6EA 3LP1B 1ZM2A 1HNXK 4EMDA 3PW2A 3G86A 3JAMU 1OXJA 5KFWA 2CPXA 3O08A 2XMVA 5AQPA 4ZP7A 2V68A 1XC9A 4DV6J 2RU9A 5CYQA 9ATCB 3SSRA 2NQPA 2ERRA 3LPUA 3LAMA 5F3XB 1FXLA 3CCLS 1FTRA 4K4YA 1GMWA 3Q8LA 3C46A 5JTIA 3D6JA 4LF9K 4XH5A 4W5OA 3WC2A 2BJ8A 4WE1B 2FLOA 2QLXA 3DOLA 1Z4NA 1YJWN 4F4AA 4AXJA 5GAEU 2W3RA 2HNDB 3TTCA 4J9UE 3MX2A 4MFBB 3QUTA 3E8OA 3HHLA 2EH9A 1TL3B 3HSGA 4U7CA 4O3NA 4NWIA 1UMJA 2VU5A 4OV1A 4C1NK 2ETJA 2KJ9A 2NRWA 3AGRA 2W04A 4Y2TA 2ZH5A 1ZQEA 2LA6A 2VKQA 5IT9O 1ZBLA 4IS7A 2QTDA 4IH5A 2QLJB 4IXCA 3JYTA 2HVIA 1TVRA 3QSIA 1GFWB 4NLKA 4P71A 3Q8SB 3RB0A 2Z1GA 4M7XA 3SBTA 4MHVA 2QXFA 3C6AA 3P83D 2F9DA 1T3QA 4OYXA 5CA7A 4FJXA 4MK7A 4O0IA 5E79U 3UVJB 2W03A 3TAQA 1RDCA 5L1MA 1CJUA 1D4XA 3CPWR 2CNNB 1A5WA 1EQMA 4NYZA 1SV5A 4B08A 3DXKA 5DQIA 4X4NA 5AT1B 3L2UA 2BQUA 1RYRA 3CXCR 4MFCA 4IDKA 5J2QB 4KQZA 3KHLA 4WXOA 2KXFA 3B4DA 1H7XA 4PXDA 1ZQSA 3QMQA 2LVWA 1X0FA 1CVJA 5HP1B 4CJFA 3C28A 1TV6B 2OMOA 3P38A 1UHUA 3LQVA 3HM8A 3N0VA 4K59A 3Q83A 4FPRA 3OPKA 4XQ8A 4MN4C 1NK0A 1NHKL 3PRDA 4P9SA 1OY8A 4F04B 3OYIA 1HBNA 1FFVA 4JK9A 1XR5A 2B9YA 2FZKB 3UE2A 3HJVA 4WCEL 1S4FA 1RT4B 1QS4A 4Y2AA 4DDFA 4I6YA 4KI4A 1NK6A 3T5JA 1COKA 4NRTA 4OV6A 2BRLA 4CYUA 2Y1IA 1RG6A 4IR1A 2DKXA 2D0OA 4NYOA 2K8BB 5BPNA 2YXLA 3QZ7A 1H7WA 2QA1A 4DV4J 3CIZA 1KN6A 1RT4A 1YBUA 4ZPAA 1ZBTA 2ZNYA 2UUBF 2GA7A 1X3NA 1RCHA 4Y2RA 2FY1A 3MWPA 3CD5A 3MAHA 4O4RA 2YH1A 4H0YB 5I42A 3L2RA 5F8LA 3D2EB 3KXDA 5AE2A 1HBNB 3UXPA 1WHXA 4Y1DA 2NRTA 1N36F 2ZDOA 5ETNA 5C2CA 2CJXB 2FIUA 2XMUA 4DR1K 5GAHI 4IFYA 3PW7A 1X5TA 1RBVA 1PVPA 3PV8A 1T11A 1RI7A 3BDPA 2Z2MA 4OI3A 4YS2A 4MIBA 7ICEA 1HQ2A 4KV8B 4N47A 4W92B 1WLJA 1RILA 2NRVA 4C0HA 1YGYA 2F8KA 4NXMF 4YDXA 3AEVA 4P4MA 4O5FA 5L46A 1N4LA 2YHYA 4QCLA 8ICTA 1TL4A 1VQ8S 1C1BB 1BVSA 1DGJA 4B3MK 5J2NB 1IBMK 3KD3A 1TFWA 2A41A 5KT3A 4R66A 2Q3SA 4OPAA 5H2FU 2XICA 4A5BA 3X1LB 3E0FA 5AQWA 1XI1A 2QB0A 1FD2A 2KT2A 3LF0A 4YD1A 1GX6A 2P6RA 1GT8A 1IR1A 2EW9A 3EX7B 4M5HA 2BJ9A 2V2VA 3T1YF 1AUSL 5ALJA 3EGVA 4DOAA 3U3GA 3EE3A 1U1NA 2G2YA 3AVLA 1LW2B 7ICPA 4HR2A 4E7HA 3F44A 5J2DA 1RNHA 4FS1A 3BZCA 1KLMB 2KI2A 3MOJB 1M0SA 1HYZA 4PHAA 1SL1A 2JEJA 2KFNA 2HQGA 1FNOA 1SPBP 3LDQA 1P1LA 3F2BA 3DOLB 2OTJS 2GWJA 4DO9A 4WE1A 3VQ8A 2XI2A 3ULEA 2R2UA 4K4XA 1LWXA 2HRTA 2P2CB 1YJUA 2HQFA 3Q8MA 2F8MA 2BRKA 4ZVUB 3KYLA 2H65B 1ZBUA 4CT8A 2Y0SC 2ZBCA 3KTQA 4FJGA 4DL6A 3KWIA 4PZNA 4ZPWR 1VQOS 3LVWA 4OZLA 2EKNA 2R9LA 4N8NA 3WU2U 1Y64A 2RHSB 2KL8A 2MJNA 3DM2B 4JI0J 4FZVA 2FBXA 5AI5A 1SV4A 3SQ1A 3RBEA 4MIWA 4JYAJ 4X4OA 1R0CB 3NUQA 3MR2A 1SGGA 2ZIVB 1G15A 3E9PA 3MEEB 5AM0A 3M30A 3VAJA 5HMXA 4H4KC 3CCMN 5ALQA 3QDKA 3CF5Q 4JRPA 3MR6A 3HHLD 4USHA 4YHHK 4KLJA 3KBBA 1YTYA 4DSIA 3O9TA 1Q5VA 2DH7A 3I8BA 5ETPA 1VC0A 4HUFA 3AO1A 4GKJJ 1N6QB 2HOIA 4IQUA 3SJHA 2VJ5A 3ENBA 2WONA 3V72A 3MPWA 3N28A 1BQXA 2HMPA 1L6NA 4JMUA 3TRGA 4KFBA 2EXUA 1SH2A 3RRKA 2PN6A 1N8RO 3TPQA 3V4MA 4P72A 2IBKA 1NUEA 1Q82T 1X4HA 4FO0A 5LMUJ 3RTVA 3AVKA 5AQSA 5KL8B 4QPXA 1ZAWA 1NJIO 3QJPA 7ICQA 3C14A 1HPMA 2K3KA 1VQ4N 1ZQBA 2AU0A 4NLYA 4JI4J 2DITA 5J8YC 2AEMA 3IWXA 2PA8D 3WNFA 3BBBA 3BPSP 1I6JA 3TWZA 5D0HA 4DSJA 5JJBA 1T95A 2W9BB 1NM2A 3RMAA 2BV3A 2KZZA 4ZJLA 2GAGC 1HPZA 4PRFA 1XNRK 5DG8A 3KFUF 1KEKA 1PC5A 3ILLA 2GUPA 3A4TA 1KQSM 1BO5O 3K5NA 1WD6A 2QL5B 5K14A 4I2GA 4J37A 4P0QA 4DMZA 3QEVA 1S7HA 1HJOA 3KJQB 1TL7B 4OPKA 3C0BA 3GWCA 3HFKA 5FRMA 3J7ZT 1SUQA 3BGFA 5J1EB 4LY7A 4ZVSB 1HBMA 4LF8F 5C42B 4AHSA 4FDFA 5LJ3Y 2VA3A 2Y8WA 4WIQA 4QZ9A 4E7JA 2V8DA 3CCMS 2UXCF 3FLCO 4UAVA 4H5RA 3NVKA 4M5DA 4F9OA 4P2XA 3VR1A 1G2EA 2NPFA 3CT9A 2G8WA 3R7NB 2VA8A 3QSYB 4HCCA 4CGGA 4YD2A 2PMZF 3A12A 2K4EA 4WJ3B 1HR0K 1WSFA 3V7KA 4ZPVR 5KG0A 3RJFA 3SD7A 4ZVGA 3IWLA 2AGPA 1N5YB 2BMBA 3H1QA 2BACA 3LPTA 1HWLA 4CLZA 2R4FA 4FLYA 2ZUAA 4FYWB 3QGPA 4FVCA 4JKBA 2PFOA 4O5KA 1F6TA 2QYCA 4HEA9 2KP7A 1WAJA 1VC6A 3HX9A 4QOZB 1S1XA 1N5TA 5E7OB 4DTXA 2YQ1A 2EDUA 1O0PA 4BRNA 3SAGA 3WUHA 4NLDA 1HNIA 1T9UA 3MM9B 4A8WA 2CJKA 1JK9B 8ATCB 2D8CA 4CNZA 1AZSB 2XNRA 5CA5A 1L3SA 1IBMF 2IOFA 2CXYA 2Q79A 4H0XB 2C2KB 3ZZOA 4EX6A 4RW9B 3UCUP 1HUZA 4MLHA 4UQGA 3QQCD 5B0FA 4A48A 1NK7A 4IQTA 2V8GA 2MKYA 3ZTSA 5KOWA 4RNFA 5A6PA 4YOXA 2QLTA 4HI1A 2JEGA 2ZD1A 4FLZA 1U2FA 4O8KA 3PACA 3M6UA 1ZPWX 4L72B 2K1RB 2AV5A 3TSQA 1RA6A 3T1AA 2CNKB 4CP5A 1U2VA 1YF5L 4LT6A 3U27A 4M8LA 2PYLA 3NDKA 5HHHA 8ICYA 3G6EN 1ZQGA 4KLLA 1UPMB 4YP3A 1NKCA 2DNPA 1HR0J 2DR7A 1MROB 5ALVA 4AILC 5AQRA 4K4ZA 3FVYA 1FKOA 1FFGB 2K60A 1S6UA 5A8WB 2ZIUB 4BVOA 1ZJNA 5DM7Q 2VB6A 5E3QA 2DRAA 3PHTA 1IJJA 3L8BA 2A19A 2ABYA 4YOWA 4N77A 1VIXA 4FXDA 3AOBA 1ZOLA 2KKPA 1D3WA 3OTCA 5GIPA 4JI1K 3C1ZA 1BIZA 3G82B 4DV3F 4KLGA 3ETLA 4XPEA 4UOFA 1VQ7N 4ED4A 1QCKA 2BGWA 1V6HA 2FMPA 5CEHA 1IBCB 3QEIA 2KHOA 4C8OA 1GO3F 3A5MC 3HHLB 5CH7B 3TYTA 4PL1A 4LZDA 1NJYA 3SMPA 1DGSA 5HBMA 4GV6A 1RWVB 3QICA 4LFAK 3F9MA 4EGLA 2GJFA 3K5MA 2MZJA 5HJYA 5IZHA 1MQ2A 1H2UX 1JLFB 3K75D 3KUHA 2VG7A 1AW0A 3ZTQA 4F5PA 1U25A 2K4IA 4J2EA 1TQLA 4YN3B 5K8PA 5C10A 1QQ6A 1T3OA 1EQ0A 3CJCA 4FZLA 2CPZA 4Q0BA 4DFKA 4AL7A 5AJ3K 4CWBA 2BQ3A 1XQSC 2GFFA 4EP4A 3CJ3A 2KVSA 4B3TK 3MXJA 3RB4A 3C95A 3TAEA 4K8XA 5EWEA 1QDUB 3GPAA 3TARA 2IVYA 4X64F 3JPNA 2CWXA 2R7RA 4FJHA 1B4SA 2B21A 1S1VB 2PFNA 2YX6A 1IV8A 2WB4A 2W9BA 3AA5X 4WQ5A 5C42A 4PKGA 2YKPA 3C3LA 4M42A 4IFVB 5CWRA 1RQNA 4DTNA 2ZBPA 4YORA 5A8KA 4H4OA 3FBCA 3TQEA 4FK2A 1WEXA 3UO0A 1RADB 4JI0F 4RJVA 4KBOA 1JXVA 3O9UA 5AQGA 3PSIA 3POTB 2O8EA 8ICCA 1TE2A 4JYAK 3J80O 3ITHB 5HOOA 2WVFA 4DTUA 5AI6A 5GAHP 3LTOA 5F8NA 2GGPB 2XLIA 4B9SA 4ECZA 3HP6A 1PZNA 4WF9Q 1ROFA 5LMNF 5H9EK 2DO0A 5GAGU 4EI2A 3AM9A 1R27B 3R5GA 2MQ8A 4FJ7A 1N6QA 2MGZB 5AKIA 3NAEA 4IOAQ 1DEJA 2P9CA 4B3OB 1W2BM 2AX1A 3NG8A 3VGTA 1ZA1B 4IQMA 1J2VA 4LF8K 3NP5A 3RR7A 3M6WA 5GMKa 2G8IA 2YX1A 4NE9C 4KLEA 3RJIA 2ZZTA 5KFHA 4ILLA 3RUBL 3UDCA 3JPTA 1S9EA 4OJLA 4MKBA 1WTFA 2HEKA 4B3RK 1Q18A 1QTMA 4BR2A 3W64A 1NKEA 1RAHB 1T9WA 4QNLA 3SQGB 1HNWF 1HNXF 1H3DA 3SSQA 3QLHA 1HNZF 2B43A 4Y0FA 2FJ6A 2HMXA 1T9YA 3OYEA 3TAFA 3PM9A 4DQIA 2DQNB 4LZGA 1YHQN 3AA9A 3OYGA 2D3O1 4GIBA 3LDLA 5ETTA 2I2YA 3KMQA 3TTFA 2FY8A 3K2PA 2ZJ5A 3HZEA 8ICVA 1U0HA 1Q3VA 4I69A 4DZDA 5AQKA 2ACMA 1WACA 2MY7A 3MCSA 3OTOJ 5I9EB 1Q82O 2QIFA 3EDRB 4HYKA 1VFJA 3THYB 1SIJA 2VUGA 1ATNA 3KWGA 4E7KA 2NRXA 2ZH8A 1SQEA 4ZP6A 5D49A 3MM7A 3JXOA 2LSNA 4TUSA 2FPHX 2H5EA 4Y2CA 3T1HJ 5A0LA 2ATCB 1FX2A 5ALTA 2DF4B 3C16A 3NF8A 2O8DA 3QU5A 1FNXH 2E7WA 4M95A 2B8PA 4IYQA 4FOIA 2QL7B 3LH2S 2GS8A 1P90A 2HHHJ 4OLAA 2OCEA 3OY9A 2H3QA 2HK3A 2UUBJ 1LAWA 5KG7A 3NH2A 2HSEB 1VI7A 2CH5A 3D45A 3VF0B 1QSYA 2DXFA 1ZA2B 1Z25A 4M5MA 1KLMA 1XMBA 1OQ6A 2J0SD 2H4WB 3R5CA 3ASMA 3W9JA 5E26A 3MDCA 1NPPA 2KFZA 4MKAA 2VDIA 1T6CA 3T6JA 4RBVA 1RWWB 4AL5A 3M1VB 1C1BA 3DOMA 2X3GA 3V9UA 4WWSA 5DETA 4CJRA 1V5IB 1BWEA 2OEJA 2DY9A 5HQ8A 2UVWA 1Y3KA 5DDPC 4YY3J 3D2WA 3G6ES 2CGJA 2HAFA 3L09A 2CPFA 2CQGA 1X4DA 2HQDA 1I3AA 4F71A 3LZIA 3IDWA 4NA3A 3K57A 2BCSA 1KAXA 4YR0A 4OHWA 1HYSA 2DNQA 2OPQB 2VQEK 1X9XA 4CT9A 4EWTA 4CZFA 4Z4CA 4DTPA 1A6SA 2N4DA 1YJ9S 1V85A 2GQCA 3PYGA 1OO0B 4FKXA 4FK4A 4C6AA 2KOBA 1Y97A 4PUOA 5IWAJ 3D1HA 1F0XA 5D3GB 2B6AB 4FWRA 4OHZA 1SKUB 3QATA 4DKWA 4X62K 4KX5A 4JI4K 4GVBB 3H45C 3VALA 4Z4HA 4F4KA 1SJ1A 2MHEA 1TKTA 2FHOB 2RU3A 4BC3A 4CEDA 2AT1B 4DX6A 1FXRA 4J9QA 2DR8A 4P2MA 1D09B 4NPOA 3QETA 1N34J 4PCQA 2IY5B 3CJKA 1KCFA 1UQVA 5EX5A 3T5KA 1X4BA 2W2MP 3DLLL 4GC7A 2PEBA 3D68A 3HJFA 5I3QA 4OYZA 3D2EA 4XDDA 3FZMA 1N56A 2VG6A 4R5PA 3OFHA 3SEIA 3UNYA 1QVFR 2NNWA 4CD1A 1OSCA 1WSVA 2V7YA 2J9CA 1JI7A 1EZZB 2Q1LA 3NVZA 3L4QA 2XCAA 1Y5NB 4Q5VA 2K7JA 4CJPA 1PC4A 5DBBA 4CZKA 1NJWA 1D9DA 2ZH2A 1EX8A 3H46O 1TU0B 4DJBA 4B6JA 1ASVA 2PD1A 1JALA 5J2PA 4DL5A 1VDVA 9ICPA 1RK8A 5M2PA 2CPJA 3Q89A 1L7NA 2J9DA 1Q4RA 3GYGA 2K8CB 4RNHA 2VASA 4PXBA 2DHAA 3PIOQ 4DPUA 3NF6A 4ZHRB 2J9DE 4H4MB 2WFBA 1ELOA 2QB1A 3GE1A 3H20A 1OVYA 3VMFB 5J2QA 3T41A 4PWWA 4KREA 4CK2A 4LVOP 4FF1A 1FWPA 4J03A 1WI6A 5A8WA 2JZBA 2BANB 5HRNA 4G3IA 1VOMA 3FFIA 4HACA 3AVCA 2DNOA 2K4PA 3OBYA 2ZEJA 2ZFHA 1KC8T 3I5BA 4AD6A 3SYZA 2H5IB 3FMWA 4ATNA 4CZMA 2J5AA 4FE3A 1QVGR 2G8KA 5HP1A 2M0GB 2HBJA 2JSXA 3KLEB 1LW0B 4PGYA 3OQ2A 3EPGA 3EMTA 2F9WA 4UUXA 1MA9B 1VHIA 2XO6A 1FTCA 3TVZA 3ZDAA 4GV3A 2ZXIA 5AQVA 2E5IA 3M8PB 4XUSA 1UW9A 5ALUA 5DLFA 4QR1A 3DLJA 4BQZA 1HKGA 2HS3A 2B7CB 1ZD3A 4LF5J 5F3TA 1HNIB 5C24A 4WKRA 1GMVA 5B0AA 2F63A 4CJWA 1RWUA 2HNYB 1WG4A 3OYNA 1R8BA 3L3VA 4MYTA 2FDNA 3TI0A 3QPIA 3KKRA 3OS1A 4IQVA 4A62A 2KXHA 2O8CA 5KFRA 5F0UA 4BC7A 2BPCA 2WRMA 3OPXA 2MZSA 3J7YP 3OJUA 1LFWA 2W54A 4LSNA 2P1JA 4YY3K 1VK3A 5D4NA 1CUKA 1EXQA 5KFPA 5DBAA 3I31A 1TL3A 3R2DJ 4CGHA 3BN4A 5IV3A 3NOCA 1R8HA 1B3TA 2HNDA 2COLA 2RH3A 3KNAA 1C6VA 2KT5A 4JV5F 3HRGA 3DI6A 4DR6K 1IJEB 3G4SN 3MD1A 4YMOA 4IO1A 3L9ZA 4FZMA 1SXDA 4YMMA 4WQ5C 2XEXA 4CZEA 3UIQA 4DR5K 3I96A 2W25A 4BY9C 4I4BA 4WU3A 2IVMA 2ADBA 1YJNN 2O8CB 2HRYA 3H42A 2ROPA 2G1HA 1Z6RA 1HBMB 3US5A 1IKWB 2XGQA 2O4GA 1FRLA 2EFVA 2D3DA 1K5OA 4I2DA 4UT4A 2KJ5A 2OWOA 1ZBHA 2P9KB 2HZVA 1I94F 9ICLA 5J0UA 4AYBC 2VKRA 1YWXA 1HEKA 4CBXA 4ZPDA 2LXFA 2GO7A 2CQHA 2ZGZA 3CM6A 5LOQA 1XBWA 2XS5A 1FT8A 4FVUA 1IXKA 2OFGX 1PAEX 2E1FA 3AVIA 2G09A 1BWFO 3K9JA 4KN4A 5DB9A 1X9SA 3OUYB 3KLEA 4DU7A 4CO4A 3A5NC 3WK9A 1XMOK 2OJ3A 8ICPA 5EX3A 2Q3PA 4LF2A 2X6NA 3IAM9 2WTUA 3IM1A 2P8IA 4HTLA 4BR7A 4F93B 1IXRA 4C7QA 3MMCB 2QE5A 2AP1A 2YY3A 1N5QA 4WTOB 4O3QA 3HXMA 4C48A 2G5IB 3SENA 1B70B 1MSWD 2BANA 5LMNJ 3DU6A 9ICOA 4F3OA 2RE2A 1YJ9N 5DK5A 1WYGA 2D3OR 2RPIA 3QRRA 1VJQA 3EGZA 1U1MA 3A3NB 4X66J 3LO3A 5AR0A 5EWGA 1HKAA 3QU7A 1C1CA 2GO9A 2RILA 3MR7A 5GADU 1HNVA 1IG8A 2JWKA 1KFSA 2QWRA 1KAZA 3AOCA 5DM6L 1M1HA 3OVAA 5GADI 3R1XA 3IG1B 2CKWA 2XSJB 3ID6A 3PRVA 3UQSA 4YN4A 1EETA 3JTPA 3IMXA 1YXQA 3MEEA 1FRJA 3W1YC 3R27A 4M63A 2VOPA 3RG6A 1P7DA 2BE2B 3GDQA 2I7PA 2Q97A 1VK8A 4LRBA 4F0KA 4R79A 3ALRA 4PKIA 4B8CA 3KLIA 3GJSB 3OHRA 3F53A 2AGQA 1VSEA 1SB3C 1RHQB 3BS5A 4NYNA 3TJ9A 2MZRA 3ZZYA 2ZH4A 4ZH4A 3WC0A 3CWJA 2H5XA 3GJRB 5AQMA 3TNVA 3CMAS 1FDAA 3AD8C 3C6UB 1RBUA 2JX2A 1URNA 4F67A 1A0OB 3EL2A 4BQLA 3IAS9 1NH7A 5HRRA 3M6XA 1VQMS 1FKAF 8ICBA 5CQGA 2VGNA 3NF7A 4CIFA 3PR4A 3TADC 2BKEA 4WFYA 4M47A 1R8AA 2DHGA 3NS1A 3E9LA 1JLEB 3QE9Y 4R63A 2YB4A 5CZXA 1H1VA 2CZ9A 3CCUS 1BIUA 1JMSA 4FW1A 2DGUA 4E8UA 2H3EB 1GOCA 5F1XA 4DXLA 3WZ0A 4DU3A 4URSA 4DG1B 4K0KJ 1HYSB 3QYYA 2UXBJ 4KX3A 2F2AB 2F3NA 2E5GA 2W42A 3OYCA 1PGZA 2I5JB 5AXMA 1WSIA 2P9IB 4NCGA 2AZ1A 3GFYA 2MQPA 2FLLA 3I0SA 5IIJA 3KK1B 4DSLA 4M3RA 2LKYA 5EE1A 2CNOB 4KHQA 1ED1A 4Y65A 2E7VA 3ZEUB 3MURP 3ENAA 4DR1F 2YWWA 3AB4B 4M5NA 4BACA 3NCQA 5BPCA 1UWBB 5HN0A 3JTNA 2FLPA 3MTKA 2R7XA 3TO8A 2JZ5A 3GYNA 4I7FB 3HZ6A 2HZAA 2DB1A 2FJEB 1KVIA 3ISND 1D8LA 1RWXB 3KZBA 5AE3A 1VQ5N 4FYDA 3DCAA 4PQUA 2KJWA 5HJXA 1VS3A 1Q7LB 5IIIA 3CC4N 4C80A 3UD5A 2MQQA 3OFFA 2E8AA 1K6YA 2HLTA 3BUZB 1L3KA 2VFTA 3L4BC 2XIDA 5KG6A 4LF5F 2CIMA 3QGGA 4MTPA 4QZCA 3HSJA 4O0JA 4DV7K 3ETMA 3D0IE 2ZBQA 4A8QA 3HP9A 4BXOA 5KFLA 1UWAA 2HWIA 1U47A 1Y5IB 3L5KA 4LFAF 5AKKA 3RU0A 3MCPA 4JI6J 1ZQZA 3UWTA 4LF1A 3WKDA 5ITHA 1VJ5A 1CBKA 1FJGF 5B0BA 2CVIA 2E8NA 2HHWA 8ICEA 3HPGA 4I64A 3N79A 2PO4A 2L9DA 3NRBA 5BN8A 3TA1A 3WK7A 1CJKB 2QWNA 3N4WA 2ZIXA 4NB4A 3SQIA 4LVSA 2XHWA 5AFUA 1F5CA 3QUBA 5DJBA 2L08A 4CYUB 1V3ZA 2EAPA 4H5TA 1JXBA 1T3VA 3MECA 1NMDA 2YNHA 4L3QA 3G71N 3VC8A 4J9MA 3G0ZA 1RT7B 3UM9A 2PKEA 5EUHA 3N6NA 3W65A 2KM8B 4DFDA 2W2QP 4YUDA 2W7PA 3VQEA 5FPEA 1RDFA 4LBIA 1HLWA 5E3RA 3E58A 5G0RA 4CI0B 3SQGA 3H8YA 4JNEA 4EFHA 3RB6A 3K59A 7ICFA 5IS2A 4MEXA 4IOAL 5GMDA 1CULB 3LDNA 1XK8A 2XCPA 3KJNB 4G1PA 4CH1A 3D6RA 2E1MC 3I4HX 1YVNA 5SZTA