4B9VA

Structure of the high fidelity dna polymerase i with extending from an oxidative formamidopyrimidine-dg dna lesion -da basepair.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 210
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9vA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9vA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9vA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9vA01
4I9LA 4YMNA 4DL3A 1JLQA 4IQTA 4DSIA 4I28A 8ICOA 1ZETA 5J0PA 5HRPA 1S1TA 3IM1A 4JLHA 3HT3A 3GIIA 4KITB 5HHHA 4I2EA 4M2YA 4KLOA 4LY7A 3V7KA 4J9KA 1LB2B 5CZ1A 1S1XA 8ICWA 4XRHA 3VQBA 3O3FA 1C7YA 3GV5B 3KD5E 4O3RA 7ICQA 5E41A 4J9SA 9ICMA 3HPOA 5HLFA 3F73A 2W9BA 3PO5A 5F9NA 2D0BA 3THVA 4FK2A 4PQUA 2Y1JA 2WOMA 3LZIA 4W5TA 4JV1A 4M42A 4B9MA 4E7LA 5J0QA 4J9OA 1ZQXA 2HW3A 2BCQA 4FBUA 1JLGA 2EHGA 3RRGA 4DFJA 3NBPA 1HYZA 1IM4A 1N6QA 2ZUDA 5SWMA 2XY5A 4KKOA 4YR0A 3BQ2A 4IQWA 1WLJA 2XHBA 1QE1A 4O3PA 4RQ3A 1ZQMA 4JRPA 3NGDA 4UB4A 2A1JB 4FJGA 1DTTA 4G3IA 3AVBA 4F4XA 4CEFA 4QZEA 4FJLA 8ICBA 5J2FA 3NAEA 5KT6A 4Y1DA 4E1MA 1I39A 1S1VA 4I2GA 4DQQA 1XU4A 4YFKA 2FC0A 3C6TA 4CGJA 4H4OA 5J2GA 4LZGA 4YFUA 2DPJA 4KN7A 4P4PA 3L2QA 4B08A 5CB1A 8ICCA 9ICEA 1D8LA 5IILA 1XHZA 1RT6A 1ZQUA 4FM1A 4B3OA 2RN2A 1TKZA 1NK0A 4B9NA 3MDAA 1S9FA 4F2RA 1LW0A 2M9NA 1YTAA 5HROA 2BQRA 4NLKA 5CZ2A 4QZGA 2R8KA 4B9LA 2IA6A 3L2RA 8ICAA 1B43A 3TAEA 4R5PA 4CGDA 3ALYA 8ICKA 2FLLA 1CUKA 1ZYQA 2YNIA 4RQ0A 3EY1A 4FJ5A 3QLHA 9ICBA 2G8WA 4IFVA 3RMCA 4F5PA 5KFXA 4F8RA 2J6UA 1K1QA 1ZQWA 3FFIA 3LZJA 5KFGA 4QZDA 4GXJA 4YQWA 4ED3A 3JSMA 3RB0A 4FBTA 2ASDA 1BI4A 3SQ1A 1FXXA 5JS2A 4CF9A 1MQ2A 7ICHA 1X1PA 5J2PA 2FBVA 3V9UA 2Z1HA 3AUOA 4EEYA 4PA1A 4RUCA 4YN4A 4QZHA 3ZSWA 4FLWA 3VQDA 4YVZA 2MUTA 3DRRA 5DQGA 3NGZA 3VN5A 7ICUA 4HUEA 3FYHA 1S10A 4CFCA 2IDOA 1WCLA 9ICPA 3B6PA 2XCPA 1L3SA 3KLFA 3NE6A 4Q0BA 3L2UA 4KPYA 4CE9A 3AA2A 2HHVA 4CJUA 4Q43A 3ISDA 4QCLA 3TAGA 3ZSXA 5KFLA 1HJRA 7ICFA 2ZJAA 5C24A 4M3RA 4CF8A 3LPTA 4ELUA 1HQUA 1RBTA 5KFRA 1ZQJA 2YNFA 3L8BA 4NXZA 5HRNA 1ZBUA 4IQVA 2NRVA 3V9SA 5DB9A 4DS4A 3LDAA 4QZ8A 4CJQA 2G8FA 4TUPA 3PVXA 1D8YA 1HYVA 4M47A 2X74A 1W9HA 1JMSA 4L8RB 3DLGA 1J53A 2HHWA 3C5GA 3Q8LA 4FS1A 4O0IA 3PMNA 4F4KA 4Z0UA 3V6DA 3JPPA 3AVKA 3TAMA 3C21A 4B9TA 4C8MA 3HL8A 3SQ0A 5KG5A 2VA2A 3DRSA 4PPXA 3V7JA 1UAXA 5J0XA 4HHTA 4CJ3A 1C6VA 2BE2A 1FK9A 4CJTA 4BDPA 4CIEA 3LANA 5KFDA 2FPLA 4DF4A 5J0YA 1QSSA 4QWDA 4OKKA 1CEZA 1YT3A 4I7FA 1EXQA 1U4BA 3NGYA 1B9DA 2JEGA 1Z26A 3LP0A 4ECTA 2PYJA 4DFKA 4ZTJA 1B9FA 1RT7A 4W5OA 5DB7A 3V6KA 3OGUA 2FMSA 4ID1A 5J0RA 3KHRA 1ZQQA 4TSXA 4CIGA 3SV4A 5FDLA 5JUMA 3WNEA 1VRTA 4ELTA 2P5OA 3Q8PB 3PW5A 3M9NB 1S9GA 2DFEA 4PGQA 2AU0A 4FZXC 2JLEA 4XQ8A 4F5RA 1YTUA 5DG8A 3MGHA 4RW6A 4C8LA 3AVJA 1EXNA 3C6UA 3HVTA 3C1YA 5HMMA 3DLHA 4ELVA 1Q9XA 5DMRA 1TKXA 4OPJA 4AILC 3OS1A 4J2DA 3G10A 3GFKB 4OGCA 1ZQBA 2FBXA 3E2EA 1G15A 1TGOA 4DTRA 1JLEA 2FBYA 4KHYA 1X9MA 3EW9A 4CECA 5D49A 2HNZA 4I27A 4IFYA 1UA0A 5CHGA 3L3VA 4AHVA 3ZCMA 3N4MB 4R65A 4DSFA 4JUZA 4YMOA 5KT5A 5KFTA 3K5LA 3SUOA 5L1JA 4FJ9A 4Z4HA 2HNDA 3AA5X 4R66A 1LWFA 3GV8B 4CF0A 3NDKA 8ICIA 4CGIA 4Z4CA 3QEWA 4LSNA 2PFQA 2G8UA 4M3ZA 3T3FA 3JPQA 4RW7A 3SJJA 4O5CA 4KB1A 1A5VA 1JLBA 4Z4GA 4ED6A 4KLGA 3OYNA 1ZQLA 2DFHA 3RH6A 4FLTA 1NOMA 4TQSA 3V7LA 1UOCA 4CHQA 1S5JA 5KG3A 4MQ3A 5KFCA 8ICMA 1C1CA 1KEJA 2C2DA 3LP1A 4NM2A 1RBSA 2KFZA 5C25A 4E7HA 4TUSA 4DTUA 3SQ4A 3RBEA 3DLKA 5KG7A 4KI4A 3RB3A 1ZQCA 1C0UA 2F1HA 5KFVA 5J2IA 2UVWA 4O55A 2ZJ8A 1CXQA 4NYFA 2ETJA 1XSNA 4RPYA 4FJHA 3NGIA 4QWAA 2UVUA 3Q8QB 2A1RA 3OYEA 7ICRA 4XA5A 1RDBA 4M9NA 1DLOA 3ISNC 3KK3A 1S6PA 3DMJA 1TKDA 1CLQA 5DG7A 9ICTA 5EWEA 4KHUA 4BDZA 2VA8A 4CJWA 3GQCA 5J2DA 4QWEA 3HYFA 3RMBA 4EZ6A 3FDSA 2OPPA 3OYCA 1GOBA 3CM6A 2C22A 2KZMA 2FPMA 3A2FA 4F4ZA 3TABA 1TAQA 4NYNA 4K4IA 5KFZA 2RF2A 5BOLA 2UVRA 4F50A 4CEAA 4BXOB 5KFAA 3GIJA 5J0SA 4NLGA 4QW9A 4N56A 1T05A 1WSJA 2Q0ZX 4DSKA 3QERA 3ZSZA 1ZQKA 5J2NA 1NKBA 4FVMA 2ISPA 3M9MB 4ZTFA 3KHGA 4RNOA 4DTJA 4YXJA 1NJYA 1KFSA 3Q8SB 2QXFA 5F9LA 1RPLA 1KFDA 4O0JA 2ZJ5A 4ECVA 1WCNA 8ICTA 2JGUA 4CEEA 2ZE2A 4OLAA 2W9CA 3MGIA 2X78A 3NTUA 1D9DA 1XS9D 2OPQA 4J9LA 4FW2A 2ISOA 7ICKA 1RDDA 1WSGA 2VANA 4RQ2A 1VSDA 4RQ7A 4DFPA 3DRPA 4E3SA 5CA7A 4F3TA 4FLXA 5J2CA 4DU3A 3HP9A 4KO0A 4GXKA 5J2HA 4M0AA 1ZQIA 2C2EA 4KTZA 1KVAA 4Y1CA 3WNGA 2BCRA 3OY9A 3CFPA 7ICOA 4DWIA 2X6NA 4MEXA 1I3AA 5J2MA 3OHAA 3L2WA 4DQIA 3HWTA 3OYIA 2W9MA 4CFAA 3LP2A 2BR0A 3NHGA 3VQ6A 4KLUA 3SUQA 3S3NA 4NY8A 3AVLA 4I2CA 3BQ0A 4DLGA 4HYKA 2UVVA 1ZBFA 2W9BB 1HRHA 4EZ9A 3RJEA 4DO9A 3BGRA 4LVSA 2KQ2A 3I8DA 5DBCA 2IOCA 5DBBA 4KLJA 1TL3A 1ZQZA 4ECYA 1CZBA 1T03A 3MEEA 3ITHA 5EU7A 1BPYA 2HB5A 4MEYA 3V4IA 4DS5A 3MXJA 2BPCA 3ZT2A 1QQCA 4NCAA 3SQ2A 4KLDA 3ZDAA 3EPIA 3MR2A 3QO9A 4DTPA 4UAZA 7ICSA 3QEXA 1Z00B 4PHEA 2P66A 1RDAA 3Q8RB 4O3SA 4CCHA 2ITGA 3IS9A 3LWLA 2BDPA 1KLNA 4QAGA 3BJYA 4N47A 4F2SA 1ASVA 2R8IA 3GIKA 5KGXA 3MABA 2ZUBA 4IR9A 5DDYA 4DL6A 1JX4A 3QINA 3TAFA 1U48A 3SCXA 5KFEA 8ICNA 3DI6A 3MBYA 1BPDA 4OPKA 4DTNA 4F93B 4DEZA 1UA1A 5JS1A 1LAWA 2PXIA 3QESA 2HHXA 4DQSA 1O1WA 1WAFA 2A1SA 5HRRA 4C8NA 2OPRA 3AVNA 4EBEA 4JS5A 3ETLA 4DTMA 3O3GA 5IIMA 4E89A 4C8OA 1W0HA 1C1BA 4Q8FA 3SUPA 3DLEA 3ZDBA 3ZDDA 1BQMA 4CEBA 3KKSA 3S3OA 4FJ8A 3H40A 1BISA 2B21A 3RH4A 3CM5A 2BQUA 1R0AA 3ZSQA 3ZT0A 2F1IA 4HUFA 3KLHA 3MXIA 4UB2A 3P1GA 5J2KA 1WSFA 3K4GA 5DQIA 4R64A 5J0WA 1NJWA 5J2JA 3PO4A 2XRIA 1K1SA 4M9LA 2IGIA 3RTVA 2WONA 3PV8A 4WE1A 3UIQA 3CYMA 4F5OA 4B9SA 3KJVA 3EZ5A 5KFSA 4EP5A 3MEGA 4HCBA 4PWDA 2KN7A 3UXOA 3QEPA 2C28A 3S3MA 2ZTCA 4UB1A 4ECXA 4KFBA 4I2PA 3VQ9A 1SUQA 1JKHA 1BPBA 3C23A 5KFIA 8ICPA 4CHNA 4QZBA 4P2HA 3QEBZ 3AV9A 3V1OA 4PY5A 1DGSA 4BACA 5D4BA 1S9EA 1GOAA 1WN7A 5EWFA 2QK9A 2GWSA 3RH5A 3AVIA 1RTHA 2JEFA 2FPKA 3KLGA 4KHNA 3JPOA 2F1JA 4CEOA 3HX0A 4AHRA 5KFPA 3VA0A 5L9XA 1J54A 5KG6A 1TKTA 4DSJA 4CFBA 4ED0A 3KLEA 1COOA 9ICNA 2I5JA 3M9OB 1TK5A 4F92B 1CZ9A 1ZBHA 3NF6A 3C94A 2G8HA 1NJXA 2B5JA 4DL2A 1U47A 1RYRA 1QLNA 3H08A 4YG2A 5KG2A 1QHTA 3ISCA 3NH1A 4MFFA 2YV0X 3VQEA 4DF8A 4YNQA 1T8EA 2FMPA 9ICJA 2HHUA 2OZMA 1TVAA 4DL7A 4RW4A 3GV7B 5EOZA 4I2IA 4ZH4A 3K75D 4FYDA 2PZSA 3VQ7A 4KLQA 3EPGA 3M8SA 2R8GA 4E0DA 4GLXA 2NRZA 4CJEA 4J9NA 4QW8A 4FK4A 4B9UA 3T19A 4CEQA 5IIKA 3OHBA 4M3UA 2OYQA 1RYSA 3OYLA 1UT8A 3RBDA 5HMLA 4FJMA 1A5WA 3K5NA 3HXMA 2ATLA 1XHXA 5CP2A 1TL1A 4QWBA 4YD1A 2ZTEA 3NFAA 3TFRA 1ZQNA 4I2QA 1JL2A 3GILA 3OSPA 4FJ7A 4FXDA 3V6HA 3MR6A 1VSIA 3OYKA 5J2BA 4FJNA 3OJUA 5KRSA 4DSEA 1Y97A 3CQ8A 4M9HA 1ZQYA 3JPSA 1EX4A 2HHSA 4KLHA 4IG3A 4I2FA 5EWGA 4PHPA 4JWNA 5I42A 3P5JA 2KZZA 4YP3A 1C0MA 4ED8A 4DG1A 1DOQA 4YCXA 5L1KA 3QEAZ 1TV9A 3PR5B 4B8CA 1Q8IA 1B92A 3VQQA 3JPNA 4DU1A 3SYZA 1RT5A 4FJIA 2BHNA 3ISBA 2R8JA 2R8HA 1RILA 4IG0A 4AHUA 3MDCA 5DGAA 3MR3A 3UPQA 1V9PA 3V9XA 2RPIA 3AO3A 1SV5A 4O5EA 2PI5A 1XSPA 3SNNA 5KFNA 2ATQA 4FLVA 1RBRA 3PNCA 3ZD8A 4F4YA 4Q8EA 8ICHA 3G6XA 4CHZA 1ZJMA 1RZTA 3AO4A 4PH5A 3E01A 2IBKA 4X5VA 3HK2A 4RNNA 3TAQA 3SI8A 2Z1GA 1ZQFA 4TURA 3PUFA 1HJPA 3B0YA 2IC3A 4CJVA 4ECZA 1XSLA 9ICRA 5HHIA 3K59A 4JV2A 3V1RA 3HJFA 1F21A 4Q5VA 4YD2A 3ZSRA 1SL2A 3AO1A 2XC9A 4F4WA 4W5QA 4RQ5A 3OJSA 4KLFA 2PYLA 1BQNA 4LSLA 1BPXA 2W42A 1TK0A 4FW1A 3HP6A 2NRTA 1MSWD 5D46A 4LH5A 3TI0A 8ICRA 1IKYA 2IHMA 2ZD1A 5KT2A 4E7IA 1ZQAA 2KW4A 5DLFA 3T5HA 1KCFA 3VQPA 3QIPA 4AHTA 3K2PA 5C42A 3N97B 1A76A 4DQPA 4OKEA 1LWCA 4RW8A 2F8SA 1KFTA 4NM1A 2ASJA 1RT3A 1NK6A 4KHSA 1K6YA 2GUIA 3RRHA 2NRXA 3HM9A 2MAXA 1XC9A 2XY8A 1BCOA 1JLFA 3JYTA 1WNSA 1N56A 4E19A 3V9WA 1ZJNA 5HP1A 4RU9A 9ICQA 3T5KA 1L5UA 4KV8A 1AROP 3KKRA 2PFPA 5KFHA 9ICGA 4O4GA 2ASLA 1B22A 4M3YA 3SI6A 9ICLA 1RTDA 3SPYA 3SUNA 1IO2A 2RDJA 3NCIA 5DB6A 4ECUA 3RJFA 1BVSA 3RJKA 3GIMA 4M3TA 1S0VA 4BDYA 1JN3A 5J29A 4C8KA 4RZRA 3G0ZA 9ICSA 2XCAA 2ALZA 3OS0A 1X2IA 3ZSOA 3IHQB 4GC6A 8ICSA 4ED1A 2XGPA 3PY8A 1BHLA 1HNVA 4IRCA 2KTQA 1JL1A 4AHCA 2ZUCA 3PW2A 3QZ7A 2AQ4A 4YXMA 5L1LA 3PX4A 2P1JA 3LALA 2PI4A 3WNHA 1SZPA 3MFIA 3ZDEA 1Q9YA 4M3WA 3S9HA 3RAQA 4M6WB 4FLZA 1HPZA 8ICLA 3OYHA 4KTQA 3QEVA 3KD1E 2DFLA 4TUQA 2VG5A 2Z1JA 3O4QA 7ICVA 3OYJA 4ICLA 4Q45A 3T5LA 7ICTA 4DSLA 4Z6DA 3QZ8A 4RT2A 1NOZA 1Z3EB 4FJXA 3ULDA 1Y88A 7ICNA 5CYQA 2P5GA 4FZYA 5HRSA 4BWJA 3TQ1A 4J9PA 1JXLA 4KI6A 2DTUA 2YHAA 1BL3A 4N76A 5IINA 1HNIA 4FJJA 3KTQA 3IG1A 1S0NA 5J2EA 2VWKA 4CHOA 4ECSA 2D5RA 5TZVA 5DQHA 4QWCA 4H4MA 3RR8A 1A77A 1U49A 2HMIA 3H8SA 4ED2A 1SKWA 4FLYA 2JZBB 1EKEA 4FS2A 3HVRA 3K5MA 3D45A 5FRNA 5KT3A 1HYSA 1RBUA 2GV9A 1H38A 8ICJA 5K14A 8ICFA 4K8XA 5D3GA 3AO5A 1S6QA 3QNNA 4CK3A 4I29A 1D5AA 5IIJA 1VSHA 3MEDA 4M9JA 1BI4B 1L3VA 1VSFA 3RJHA 5KT7A 1L3UA 9ICUA 4IRKA 1JLCA 3VQ5A 2J6SA 4BXOA 4O44A 1XI1A 5J2QA 1TK8A 4XUSA 4IRDA 1EP4A 3C1ZA 2W8KA 4OLBA 4IKFA 1TAUA 4P4MA 1X9SA 1JXBA 4GVMA 3OYBA 1KLMA 3C5FA 4CK2A 4RQ4A 2YKMA 4PGYA 4E7JA 3CG7A 1FKPA 2DY4A 2F8TA 4RUAA 4H8KA 5DDMA 1Z25A 4I2DA 3NF7A 1SL0A 3EWAA 4BE2A 3P83D 4KREA 3TWHA 3VQAA 3QETA 1RXVA 4PHAA 4UAWA 3C2MA 2I1QA 1HMVA 4F5NA 9ICWA 1RXWA 2I9GA 3H8JA 4CJLA 4QZIA 1GOCA 4CK1A 4KHQA 4FZZA 1NKCA 2JEIA 5DKWA 3AVHA 4O3OA 3M8RA 3KIOA 4PHDA 2GBZA 2RDIA 1ZBLA 3MR5A 5C5JA 4JWMA 1SKRA 9ICXA 4KMUA 4RPXA 3G6YA 1RTJA 4G1QA 2DFFA 4B9VA 2HNYA 1U9LA 4NLNA 5KRTA 4UBCA 2YHBA 4EP4A 2VA3A 8ICZA 4DL5A 4UQGA 4TQRA 4E1NA 5DG9A 4DOCA 2FBTA 2NUBA 4UB3A 2JEJA 4FLUA 4P4OA 4O5BA 1MC8A 3V1QA 4BGDA 4YMMA 1KTQA 1S76D 2JZBA 3TFSA 4K4HA 5KI6A 3HSTB 3K5OA 4CEZA 4KHWA 7ICGA 4B8AB 3Q8MA 3M8PA 8ICXA 1ASUA 2XGQA 3RJJA 1JIHA 4F5QA 5SZTA 1WSHA 4KLMA 1HQEA 1TV6A 2B6AA 3PW0A 4M41A 4J2AA 1UT5A 1N48A 8ICVA 2G8IA 1PZNA 1L3TA 4DQRA 2Z1IA 7ICIA 4UBBA 4QZAA 5T7BA 1QSLA 5HNKA 3U3GA 5HP4A 2RKIA 1MQ3A 4CESA 2FLNA 4CEDA 4HTUA 3B0XA 1ZQTA 4QZ9A 2D0CA 1U04A 1NK9A 2XY7A 4W5NA 4KAZA 2ZTDA 1ZQEA 1X9WA 2YKNA 3IRXA 3OS2A 4RQ6A 4Z4FA 2AGQA 4IR1A 4CGHA 4I2AA 2AJQA 2Q3SA 2IHNA 3AO2A 1KDHA 1IKWA 5FROA 2Y1IA 1ZQPA 1NKEA 1VK0A 4ZHRA 1LV5A 3RB4A 4UAYA 2WTFA 5KFFA 5L1IA 2BPGA 2W8LA 5BPCA 3PX0A 3AA4A 3OYAA 2P6UA 3B6OA 7ICMA 4DL4A 4DMNA 3DM2A 4KB0A 1RT2A 4IQUA 4F91B 4Q44A 5KFBA 3C2KA 2BGWA 5KFJA 4J2EA 5DK5A 3DYAA 3I0RA 2IAJA 2QKBA 4JK1A 7ICLA 4KLEA 1MU2A 2PFNA 5KFQA 4MF8A 4GXIA 3TR8A 1XWLA 1T4GA 4I2BA 5J0TA 4O3NA 4O9MA 1S77D 2DPIA 5IIIA 4N5SA 3T1AA 4DOBA 5CWRA 2R7YA 2VG7A 1LAVA 2OA8A 4YR2A 4R63A 4HVJA 4EYIB 3I0SA 3ZSYA 4YR3A 3AVGA 3OYDA 2NRWA 3HW8A 4O5KA 4FO6A 3VQCA 3OYMA 4BE0A 3C95A 4IDKA 4OJRA 1N5YA 3IAYA 4MFAA 2BPFA 5DLGA 5CY4A 2A1JA 4I9QA 3ZD9A 2KZ3A 1IH7A 3OYGA 4AH9A 1T3NA 2OPSA 1TFRA 3NH0A 3K58A 4CF2A 1ZQVA 1D9FA 3MFHA 3SZ2A 3C2LA 2B4JA 4LZDA 3HPGA 3ZSVA 2KFNA 3PR4A 5FRMA 4RPZA 4J9RA 1VSEA 4MF2A 3OVNA 4I2JA 3KHHA 3V9ZA 1IKVA 1UWBA 4N41A 2BCUA 4KTWA 4EBDA 3LP3A 2FLPA 3D0PA 1JXEA 1WSIA 2O4GA 1RCHA 1VSKA 2BANA 1IG9A 8ICYA 3LWMA 2OWOA 9ICKA 4QZCA 5HBMA 3PMLA 4M04A 1SKSA 4JV0A 5KTQA 4KRFA 3ZT1A 1KRPA 3DLRA 4CHYA 4MFCA 5KGWA 3VQ8A 4KLTA 3U3YA 4E7KA 3QNOA 5I3UA 1NOYA 2C2RA 3HO1A 5J1EA 4LH4A 3KK2A 4F3OA 2VWJA 3H7IA 4I2HA 3BDPA 4CF1A 1RBVA 4CHPA 4CFDA 3LDSA 1EETA 4LD0A 2G8KA 2BKEA 5KG0A 1NJZA 3M8QA 1XO1A 5KFKA 1KVCA 1ZQOA 2F96A 2FMQA 3AU6A 4CJKA 1ITGA 3LAMA 9ICFA 8ICUA 2LSNA 3LAKA 3F9KA 3MXMA 3KK1A 2J6TA 3MECA 3ASMA 2BCVA 3H8WA 3TARA 1VSLA 2V9WA 4Z4IA 1DTQA 1C0TA 5DB8A 8ICGA 1NK5A 1BGXT 7ICPA 4FM0A 5KFOA 3SV3A 4KLSA 3BQTA 4J2BA 4NLZA 4K8ZA 3LK9A 4DTXA 4KN4A 5J2AA 2W9CB 3QEIA 1ZQSA 3TANA 2AGOA 2HVIA 4ECWA 4ECRA 9ICAA 1BPZA 1VSMA 1YVUA 2IS3A 4DTSA 4RG8A 4BE1A 3U6FA 4ECQA 5KFWA 4HCCA 3T5JA 1ZQGA 3OYFA 4CGGA 1IXRA 3KLIA 1A5XA 4RT3A 5KFUA 2ZQBA 4DU4A 2AQ0A 4DFMA 5KFYA 3RAXA 3O4NA 2VG6A 1JLAA 1S1WA 2D0AA 4NCBA 4EBCA 4O3QA 1QSYA 4M9GA 1BIUA 1S97A 4CJRA 4CGFA 4IBNA 3EYZA 4OKJA 1QTMA 3DLBA 3V6JA 3RMDA 3ZDCA 1BIZA 1C1AA 1S0MA 2HHTA 4R8UA 5DGBA 3PW4A 3ORYA 3SPZA 4OGEA 3RB6A 4FM2A 2X6SA 2E6LA 5CYMA 4CJSA 1BCMA 4ID5A 1ZQHA 3O3HA 2XY6A 3RR7A 4CJFA 4K4GA 1WSEA 5KG4A 3RJGA 7ICJA 3LPUA 3QE9Y 4J9QA 1RT4A 4Z6FA 3AVAA 4CIFA 8ICEA 9ICOA 9ICVA 1RT1A 1BPEA 3JPRA 3Q8KA 4RQ1A 4RNMA 5CR0A 1REVA 4UB5A 3DOLA 1S0OA 4ED7A 4Z6CA 2E4LA 4CJ5A 9ICHA 3K57A 1RDCA 4DTOA 4AHSA 2G8VA 1RNHA 5BOMA 1IKXA 4FK0A 4EYHB 4KLIA 4CJ4A 2P6RA 4GW6A 4JRQA 3AU2A 4RW9A 4GMJB 4KLLA 4PUOA 3V81A 3PX6A 1J5OA 2IMWP 4QOZB 5CJ7A 2QKKA 4M45A 1LW2A 4OVLA 4GC7A 3GDXA 1QS4A 4JS4A 2XO7A 4W5RA 3VA3A 4DOAA 3OSNA 3RMAA 3RJIA 1NK8A 1ZBIA 3L2VA 4Z4EA 4PGXA 9ICCA 4FJKA 3NF8A 4M3XA 2O4IA 3H4DA 3V72A 2W9AA 3AVCA 1RTIA 3JPTA 2LYHA 5IIOA 4CERA 3DOKA 8ICQA 1NK4A 5KG1A 5J0OA 2V4QA 3UQ0A 1S1UA 4QZFA 3CFOA 3L3UA 3G6VA 2E6MA 1U45A 1CXUA 1FKOA 4XIUA 3H4BA 4HUGA 2PY5A 2PFOA 2AGPA 4J9MA 5DBAA 4RQ8A 1NK7A 3QIOA 1HUZA 4R8UB 3PW7A 4Z6EA 1SL1A 2P51A 1KSPA 3BQ1A 4NCGA 2EX3A 3AVMA 5KT4A 2YNHA 4BWMA 3NH2A 1ZQDA 3UXNA 3CFRA 3ZT3A 2HHQA 2BCSA 1ZQRA 2BGGA 3RWUA 2OZSA 3UQ2A 3ZT4A 2HVHA 9ICIA 2BQ3A 3TAPA 4MFBA 4M6WA 1Z00A 2H5XA 1T7PA 2YNGA 3VQ4A 1ASWA 2V4RA 3WNFA 7ICEA 1VRUA 1J9AA 3AVFA 3AA3A 1VSJA 4DLEA 1WAJA 1TVRA 3UXPA 5J0UA 4CJPA 3MAQA 3HPHA 2MUTB 4FCYA 3KHLA 1KVBA 1HUOA 3NF9A 5KFMA 1LWEA
chains in the Genus database with same CATH superfamily
4I9LA 3EE3A 4CM2A 5J0PA 1ELOA 3WX8A 4M2YA 4V1Ak 4LY7A 3V7KA 1HBNB 1JJCB 2O8DB 1QD1A 4NLTA 1QH9A 1ZZFA 2G5HB 3OPXA 1FD8A 5KPZA 5E41A 3TUPA 3Q8UA 1KC8O 5HLFA 2W9BA 4BRHA 3THVA 2APOA 3MWBA 4FK2A 4M5IA 1CS4B 3KLEB 2Y1JA 2F65A 1HI8A 2MQLA 2AIRB 1KW4A 4OJLA 3QUQA 4QBUA 4LSLB 1CQNA 4DFJA 2L9DA 1JRPA 4JKBA 5CZXA 1A6LA 3ENAA 2VFTA 1B0XA 4ZMMA 4C80A 5J1PA 1ZRMA 2XHBA 3BQ2A 5HVGA 3C29A 3KBBA 2P9IB 1AXQA 1ZQMA 5HL7Q 3F0NA 2O8DA 4KGXB 4FJGA 3CJKB 5A8RB 2ZBCA 4CEFA 4F4XA 3L7UA 2PMHA 2R3VA 3I32A 1IN0A 2YH0A 4FJLA 2DGSA 4JI5F 4Y1DA 2WAQF 3GZ7A 2GELA 1N61A 2VG7B 4NRTA 1S1VA 3I5CA 4I2GA 3E9OA 4CZJA 1XU4A 3NRBA 2Y0BB 3IKMA 3MCNA 2NNWA 2VC0A 2X7IA 2PEBA 3QBXA 4USIA 2VF3A 4KB7A 3H0LB 4ZP9A 1WF0A 4FVUA 3WKCA 5J2GA 4H4OA 4YHHK 1TR0A 4YFUA 2HSEB 2A1AA 4IEIA 3RBZA 4B08A 4Q0BB 3BO2A 5MLCV 2VPWB 1ZQUA 2QJ3A 2OMOA 1GMWA 4FM1A 2VB6A 2BA9A 4B9NA 1GTHA 2UP1A 1QZ6A 1LW0A 4ISGA 1YTAA 3TUIC 3N7RC 1BQMB 2V50A 4LF7F 4QZGA 3BR8A 1CPZA 2R8KA 2VPYB 3O8MA 2WBMA 3L2RA 1P27B 1B43A 4JKHA 1BQXA 4R5PA 1RDFA 4CGDA 3ALYA 1CUKA 2NO5A 1ZYQA 2YNIA 1T94A 1R7IA 3RVCA 5BRHA 4DR1J 3QLHA 3VERA 9ICBA 4F5PA 2ZWPA 1K1QA 1IR2A 3FFIA 4QZDA 4ZCLA 4GXJA 4ED3A 1PYSB 3ZETB 5M2UA 4B3MK 1JLFB 4FBTA 2ASDA 2O8EB 2A0FB 5JS2A 1X1PA 1VQKS 2K06A 1ICEB 1K0VA 4IJAA 1SH3A 1AA1B 4RUCA 2XLKA 4YN4A 5AK4A 5LY3A 1FERA 1GX6A 4YVZA 4OI6A 1WHWA 5HAOA 1M1KT 5F8NA 3NGZA 3KJNB 2DGVA 2DEIA 4F4AA 1SI9A 3IXQA 3LA0A 2HBLA 2IDOA 1WCLA 3UDVA 3IDWA 1L3SA 4CLLA 1WEZA 1U6BA 3KLFA 4JKEA 2MJNA 4CJUA 3QJPA 4Q43A 5GAHI 4DV3F 2ZJAA 2LYAA 4LR9A 2Q79A 1IKVB 3M2UA 3UKRA 4ELUA 3A3OB 1F60B 2ABYA 1ZBUA 4UQTA 5M1OA 2N4DA 4OZ1A 3N5BA 5DDQC 5DB9A 4DS4A 1S5LU 4H54A 9ATCB 4CJQA 4M63C 3E58A 1X4AA 3G4SN 3CJ0A 1D8YA 2UXCF 2V67A 2P9LA 4PG4A 4BRKA 2W7AA 1JMSA 3VAMA 2G0JA 4M94A 3DLKB 2HHWA 5CYMB 1N60A 4FS1A 3NGTA 4KKOB 2BOAA 3OBWA 5ALDA 3O44A 4F4KA 2CQ1A 1SJ3P 1WOPA 2QLXA 3D1HA 4NLRA 5AM4A 4IO9Q 1ZRNA 5T41A 3LW5C 2WAQC 1OY9A 2CG4A 3TAMA 3ZZ0A 3H2VE 1NGBA 1MN9A 3WXIA 3O8WA 3KZIU 3DRSA 4BVPA 4WQ5A 2KIWA 3V7JA 4I2PB 1GLCG 1E4GT 5B7WA 4PG6A 2ZGYA 3PIOQ 1Q78A 1SV0C 1FK9A 4CJTA 4NL9A 2XLJA 1I94J 2FPLA 4X4PA 1DGJA 1QSSA 5AM0A 4OKKA 1YT3A 5FLXO 4DR3F 3SAGA 1Z26A 2PYJA 4ZTJA 3A4TA 1B9FA 3PHTA 2EFNA 2EFOA 1HI0P 3ALRA 3LM2A 3O6WA 4G65A 4Y2IA 1ZQQA 5GTHU 1NAQA 3VMFB 1VRTA 4ELTA 2LEPA 2P5OA 3R97A 1T9UA 4UY8T 2M8HA 3M9NB 3U1NA 1RCOB 2JNJA 4IOCL 1EWRA 1ULRA 4RW6A 4C8LA 4OI4A 4DJBA 3AVJA 2ZUGA 2VBZA 3C6UA 3NVWA 3F5AA 3PFEA 1Q9XA 4KE5A 5DMRA 4OPJA 3FQLA 4AILC 2P6TA 3D2SA 3EZOA 1WI6A 3ILIA 4QIFA 1ZQBA 2ZJPL 4US8A 4Y2RA 4JI1K 1JLEA 2FBYA 4KHYA 3EW9A 3VEWA 2N4CA 3QU7A 2GFFA 5U47A 5CHGA 1WTBA 3TA0A 3ZCMA 2K8AA 4YMOA 5KT5A 5L1JA 4OJ3A 1YJUA 3WK4A 3J80O 3DM2B 3AA5X 4ZN1A 4BS2A 2XZTB 2WF5A 4CF0A 8ICIA 1GMUA 2ZNZA 4C9DA 3FLCO 2HAIA 3E1YA 2F76X 4MLHA 5GADP 4TY8B 4K5RA 3KHYA 5DJBA 3SJJA 4O5CA 1FJGK 3QGIA 3LGMA 2J0QD 2V7ZA 1YI2N 2ZVSA 2DFHA 3HD2A 3CEDA 1YVNA 3M32B 3HDSA 5H9EJ 5J1NA 4LF1A 8ICMA 3CDAA 2NXUA 1TAMA 3H45C 4ZDNA 2G09A 3NG8A 1U0HB 5AI9A 1D8ZA 5KG7A 1B7FA 4KI4A 1ZQCA 4JI8F 4ER8A 3A3PB 5J2IA 3PJXA 4GFJA 4K25A 4ZVGA 2AXTU 2OFGX 2ETJA 1F44A 1BC6A 1VC6A 4FJHA 2QZ8A 3ICLA 1CI4A 2F4VF 4QWAA 2UVUA 2WSEC 4FZVA 1I3OB 2Y8YA 3OPKA 2XMJA 4ED5A 3MXHP 7ICRA 2KL8A 2CWKA 1LKYB 5CYQB 1F2HA 4NEYA 3CJSA 3AJDA 3PRVA 3H59A 3ISNC 5T7LB 2LA6A 1VJWA 2NXNA 2WVCA 1VQYA 1N6QB 5DG7A 1WWVA 2NO4A 1V4SA 3P96A 1VBKA 2R7RA 4LRDA 1G4CA 4BR9A 4WTYA 4BDZA 2QYGA 3PNIA 3MAHA 4ZOHC 3GMGA 3NCPA 4WYLA 4TYBA 2CQBA 5B0DA 5EE1A 1N8RO 3N6MA 2KZMA 5GAHU 2FPMA 4UF4A 3TX8A 2RD5C 2YQ1A 3UW1A 4LF9F 4NYNA 5F0WA 4K4IA 4W4MA 2FSNA 1F0MA 1VQSA 3CT9A 3LQVA 3JXUA 1HJOA 3CXCR 4BXOB 5BPMA 1B99A 4F7VA 3GIJA 5J0SA 5B0BA 4QW9A 4AM7A 1KVJA 4N56A 1T3QA 2I6WA 1Q81T 4C3LA 1PG5B 1FWLA 4JI5K 3LH2S 3UO0A 1HUXA 2ZH8A 3DOMB 4YXJA 1KFSA 2WVEA 2L48A 3Q8SB 1FHTA 4CH0S 4EAHD 4ZITA 4ECVA 1WCNA 2DGWA 1VLYA 3OL8A 3PSTA 2W9CA 3MGIA 2X78A 3NTUA 2UUCF 3CCSN 4C7ZA 1XS9D 2OPQA 4MIAA 2EFQA 3WHIA 4B1UB 4DUZK 4FW2A 3WKBA 1RDDA 2VANA 3H2LA 4DFPA 3DRPA 1EQ0A 4E3SA 4UZBA 2I8EA 5HN0A 3GIRA 2EZZA 3CERA 1X4GA 3HP9A 3ZYYX 2VJ4A 1ZQIA 2WVDA 5AKJA 3HJEA 1NWKA 3KK2B 2BCRA 3AOCA 7ICOA 3DDHA 4MEXA 2QB1A 2ZG6A 3L2WA 3T9NA 1VCTA 2W9MA 5ALWA 3H0PA 1BWVA 3HHLD 2O67A 1UVMA 3VQ6A 4CNYA 3I76A 3PM9A 2C2KB 4OZ0A 3BQ0A 2ZD1B 2WK4A 2I5JB 4Y2AA 3FMWA 1XR5A 3UWTA 1ZBFA 2BKNA 4MHVA 3ELHA 2HRUA 4IC9A 3ETMA 4A8SA 3BGRA 4DV7J 3BPSP 3MM9B 1OIAA 3JAMY 4X64J 1T3VA 2JH3A 4H0XB 5C24B 5A2QO 3CC7N 3O1WA 5DBCA 1RM6C 1VDVA 1BLUA 2IOCA 1NSPA 2IM0A 4KLJA 4C7QA 1ZQZA 1HR0F 2ZVIA 1CZBA 1T03A 3MEEA 3J8AA 2LA4A 3ITHA 5EU7A 3AB4B 1SC1B 3MXJA 1QQ5A 1WUUA 2KXFA 5BRFA 4IXCA 2COLA 2ZJRL 4YB5A 3V81B 1URJA 2CH6A 3QO9A 1S12A 3E9LA 3S01A 2FYXA 2YKQA 1MMDA 4U96A 4PHEA 2P66A 4O3SA 1KLNA 4ZN3A 4DR4J 4EENA 3BJYA 3ENQA 2KKPA 5ALTA 3GIKA 3WKDA 3NWGA 4X4NA 2XHCA 3L7PA 5KGXA 2ZZTA 4IR9A 5JLFA 4DL6A 1Y4ZB 2XQCA 1JX4A 4DR2F 5HLFB 5E2QA 1Q8BA 4IG3B 3CCMN 2D4WA 4OPKA 5LXRA 1WKKA 4F93B 3GG1A 2DITA 3D7EO 2HK3A 4RBTA 2YVSA 3FZLA 1U25A 3EXYA 2YX7A 4M5DB 4IKAA 3DU6A 1BE4A 5HRRA 4C8NA 2N1RA 2G13A 1PVRA 2MQ8A 1V38A 4Y2XA 3SUPA 3F2BA 3ZDBA 1ZH5A 4X66F 1RAJA 2XICA 4ZVEA 4DX8H 3CJBA 3Q8YA 5AQLA 4DI6A 3WXMB 1HD0A 4FJ8A 3MX2A 2Y0SF 3RH4A 4ZPVR 2DUYA 4HUFA 2HBQB 3HLUA 3KLHA 2IRXA 1Y11A 3E51A 3N4PA 2V2KA 5J2KA 1KHWA 4R25A 2YN4A 1X6JA 5J2JA 3ATUA 1T9WA 2XRIA 3ZX3A 4WYWA 4X84A 3MMBB 3C6TB 4WJBA 2H5EA 2DGUA 2D41A 4DR6F 4YMEA 3OTOK 1ATSA 1SWWA 3DCAA 3EKSA 3I28A 5KFSA 3MEGA 1UHUA 1LW0B 1D1UA 3S3MA 2ZITA 4YHHF 4LR8A 3ET6B 1B0TA 5EX0A 4YDDB 2O8FB 4OJPA 1FEZA 1W2BR 3MF5A 1BPBA 3NLCA 4CLTA 2CAJA 3EGZA 3QEBZ 4IDKB 5AQNA 3AV9A 2UXCJ 4PY5A 4F9OA 1DGSA 3M8QB 5AFUA 2GJFA 1R8AA 2KMDA 3MM5B 3Q24A 3VAFA 4KHNA 1IBLJ 2GIFA 3N0VA 3GLJA 4DSJA 3M6ZA 2E5JA 2YKPA 3O9QA 5HMWA 4C0BA 3OFEA 3SMPA 4TY8A 4QS9A 1TK5A 3UMGA 1CZ9A 4MO4A 1RDRA 4X62F 4J37A 2G8HA 3S8SA 4MLEA 2B5JA 3GFYA 1KL9A 4DL2A 3C65A 2IVMA 3NNAA 3BP8A 1HIWA 4TNOA 2KJ8A 1KTVA 4L76A 5JVGL 3L4QA 2KDOA 4MFFA 5AQGA 2DH7A 2VG5B 2UV8A 3HZ6A 2Q36A 2FMPA 2GHWA 9ICJA 5A8KB 2OZMA 3DXKA 1ZC6A 4JI1J 4IEEA 3ZZOA 1PSDA 4I2IA 2JH7A 5A8WA 2MHEA 1R31A 3BV8A 4KLQA 1KNZA 3ZZYA 2R8GA 3T69A 3NCRA 2AJ4A 3LGNA 3MPDA 1EJ7L 4JOUA 2WZ1A 4J9NA 4L75A 4B9UA 3T19A 4CEQA 3OHBA 4JI2J 2OYQA 1RYSA 3OQ2A 3OYLA 5J8YA 3WC2A 3RBDA 3D68A 1IQTA 1DARA 1S4FA 1TUVA 2ATLA 2DY1A 3NFAA 1ZQNA 2MKYA 2WCXA 3F2KA 3GILA 9RUBA 1IKYB 2DD8S 4JI4J 1D4XA 3KVGA 4FXDA 3V6HA 2JC0A 2K2PA 1VSIA 2Y0SC 3OYKA 1QVFM 2FZGB 1EHWA 5EUHA 3QJJA 3CQ8A 1T11A 5EXWA 3JPSA 5HO4A 2HHSA 3M8ZA 3DAWA 2FHKA 4FOIA 4LF6K 1DOQA 2AJ1A 4YCXA 1TV9A 3PR5B 1NGIA 4R0EA 1OYEA 1B92A 3P31A 2WC9A 5C42B 2HQGA 1C4CA 2PMZC 4DU1A 3CSKA 4FJIA 2CRXA 5AJ3F 3C7NA 2R8HA 1RILA 3MDCA 2W6KA 1MROA 2HMPA 3UPQA 3V9XA 2OELA 1JLBB 2GHVC 2YB1A 3D66A 4O5EA 4DPOA 1F6TA 3FEYB 2PD1A 5KFNA 1YAGA 2ATQA 4FLVA 1RBRA 3PNCA 1IBMJ 3G6XA 4CHZA 1RZTA 3FC9A 3CJ4A 3VGKA 1IKWB 2I6XA 4K4SA 3HK2A 4X5VA 2DKZA 2JDJA 4DV1J 2JZ5A 1SJFA 3CETA 2YKNB 2Z1GA 2V2ZA 4TURA 2D3OR 1HJPA 3PUFA 1HA1A 2QN6B 3UN5A 5JTIA 1YRXA 5HHIA 2B4OA 4K7QA 5KL1B 5C7PA 4FPBA 3HJFA 2FC8A 1NZPA 3ZSRA 2ILZA 4DV1K 3POTA 4RO0A 2BJ7A 2LEAA 1Q8LA 1BPXA 2EK6A 2WONB 4GIBA 2H9ZA 2EAMA 3QX7A 1EB0A 1RAOA 3SQOP 1RA7A 2YNGB 2VOPA 2IHMA 2ZD1A 4MH8A 3T6BA 4P73A 2UUCJ 3DXMA 1MROB 2XMUA 3HM8A 4JI7F 1IWGA 1U1NA 3TTCA 3IO1A 3THWA 1YJ7A 4DV4K 3QIPA 5HR7A 1FRHA 1IBLK 2XWXA 2KEYA 3K2PA 3N97B 3O5BA 4OLPA 3D67A 3R1LA 3MDFA 3FBFA 4FZLA 3O9UA 2OP5A 4FL9A 1VQOS 4MKAA 1HBOA 3RW7A 4BREA 2DT9A 4MIWA 1NK6A 1Q3UA 1FO1A 4OZNA 5DO2A 1K6YA 2YKMB 2NRXA 4WIQA 2MAXA 2FY8A 1BUXA 3QUCA 2XSFA 4DR5K 3ULEA 4CT9A 4HDHA 2GAHC 3PSIA 3K1RB 1N56A 2VYPA 1KOHA 2OHFA 1TKXB 2PE8A 4ZLNA 3KKRA 4O4GA 4M3YA 2KJ5A 4LF8J 2ZIUB 3QRRA 4XK8C 5DB6A 5C15A 3NCIA 5D0RA 2YJFA 3DDKA 3NGUA 1WG1A 3U4LA 3GIMA 3UQSA 1S0VA 2BVZA 3QUBA 1WDDA 3AOBA 4DZDA 2XCAA 5IT9U 1TYQA 5KAIU 3ZSOA 4AE5A 3SCJE 3W8PA 3CQXA 4GC6A 4ED1A 4WQ4A 2W04A 3P39A 4AL5A 1HNVA 4JI4F 3FSIA 1BOTO 3IBWA 1KXPA 2FY1A 2ZUCA 2XYPB 4F02A 4DFDA 3MMCB 2P1JA 3WNHA 4H0YB 4HLBA 3RAQA 4M6WB 1HNZJ 2W4PA 2F8EX 4NXNJ 4FZMA 3IN5A 3WXLA 2Q1NA 4QNLA 1NLKL 3KD1E 3R5BA 3EUNA 2YKOA 2VG5A 2Z1JA 5L9NA 1VQ4S 3O4QA 4QIWD 1Y7PA 2VV5A 3GBTA 3CDEA 4DSLA 4Z6DA 1BHNA 1LW2B 1Z3EB 3ULDA 1Y88A 4PZVA 4UB6U 1U2FA 2P5GA 5HVHA 2HQFA 3TQ1A 3WK6A 4O8KA 3X3UA 3M6GA 3UDEA 2DTUA 2DNOA 3AA9A 4N76A 1CLFA 3MMVA 1AZSB 4FJJA 3DXBA 2HFSA 1SXDA 3N01A 2VWKA 3LP2B 3CP8A 5TZVA 5DQHA 2G08A 3FSXA 4M5MA 3H90A 4RU2A 2IJRA 1U49A 4UZCA 4FXWA 1R59O 2Z8QA 3PSPA 4DPTA 4FLYA 1WC1A 3K5MA 1XNRJ 3CC2S 4GNIA 4P2MA 4W90B 4DV3J 5HJYA 2KKVA 4ZVRB 3HSCA 3AGKA 1OYDA 8ICJA 5K14A 3KLIB 2BRLA 1VDHA 2IAJB 1J2MA 4WIIA 1NM2A 4CF3A 2N3LA 3SDEA 4I29A 1O03A 1QAIA 4KR0B 3AQPA 2HRTA 5A0YB 1L3VA 5KT7A 3HKZD 4F25A 1JLCA 2VC1A 2LI6A 2MMYA 4O44A 1KQSM 3R6LB 4XUSA 4EHTA 4OLBA 5FDLB 4DR7K 3DGPB 3ILOA 2DNKA 5BN8A 5KNIA 4OO1J 5CZVA 3BS9A 4RQ4A 4Z2XA 2OCEA 3H2UB 1P90A 5F8MA 4H8KA 2RRBA 1IUJA 4GO5X 4JBCA 4BE2A 3UD3P 2FJEB 3QFPA 1B4FA 1RXVA 1FRMA 3C2MA 4EEKA 2XMWA 1SGGA 2GEMA 2QXLA 1CG2A 3H8JA 3J7AN 4F3QA 2GVDA 4X2BA 3OTQA 4DCPB 1FXLA 1VQPN 1NKCA 5B09A 3U26A 3KIOA 2VCPA 2NLWA 2RDIA 1FFSB 4DV6F 4YOVA 4DUYF 2J9DA 9ICXA 4RPXA 1JLGB 1ZXOA 5AQHA 1U9LA 1HBUA 3VAHA 2OM6A 1NSKL 4NB4A 5F2RA 5ETNA 5KRTA 5GAGU 2GMHA 5HROB 3W9IA 3VF6A 1OH7A 1HWIA 1WG5A 4UQGA 4E1NA 4FP9A 5LMUK 5ELZA 4FLUA 3DRSB 4JHDB 3ID6A 3V1QA 4PXCA 2ZC3A 1P1LA 1KTQA 3ETRA 3QGPA 5D4OA 4CW7B 4NYPA 5AFUH 1O0PA 3K89A 5KI6A 4W98A 3Q8VA 2JX2A 3ZZZA 4CLZA 5HATA 1N36K 2LQJA 3M8PA 8ICXA 1S9EB 1ASUA 3NBPB 1JIHA 5GINA 1Q4RA 3M4XA 4C23A 3VEXA 2ZIVA 1LEOA 5AXLA 4KO0B 3KXDA 1UT5A 5DDOC 4PXEA 3R6MA 2G8IA 2P9LB 4P0QB 1JKHB 1WKLA 2KM8B 2LYBA 7ICIA 1OQ6A 3AD8C 4UBBA 1RHRB 4WU3A 4NI2B 3BM7A 1QQ6A 4Y2CA 2GQCA 5T7BA 1QSLA 5HP4A 1VHFA 3ZX2A 2BH1A 3CMEN 2FLNA 5EX3A 1CJTA 4CEDA 1ZQTA 2D0CA 1U04A 2XY7A 2IYIA 1X9WA 2YKNA 4RQ6A 2AGQA 4O5FA 6FDRA 3KMQA 2AJQA 3DGVA 1U8WA 1C1CB 2YWGA 1TP7A 2Q0RA 4DV6J 5AXKA 2A3JA 4H0VB 3SCKE 2K3IA 4FWQA 1FX4A 3JTNA 4UAYA 1CJKA 2CQIA 4GY2B 4HTJA 2WTFA 3SIPB 3CI5A 2QTDA 1VRTB 5LJVA 2RF2B 4DHVA 3ONNA 1RAIB 2BBEA 1P6TA 2IVNA 3H1VX 3RGIA 7ICMA 4OYMA 4KX3A 4DUZJ 3SBGA 2FPHX 4IQUA 2ZBRA 4F91B 3HHLA 3C2KA 4JI6F 5KFJA 1K0TA 1Q7LB 3UD5A 2ZM6F 1F5CA 7ICLA 3DDNA 1ATRA 1XWLA 2RAQA 2GZOA 1T4GA 4I2BA 4CNQA 3MWTA 4OYPA 1MDUB 5ALHA 4J8FA 5CWRA 4KT0C 4HACB 4XAKA 2VG7A 2O1PA 4CT8A 4FYXB 4C98A 4YR2A 4R63A 4A61A 2VODA 4F67A 1Y00A 4DL0C 4FO6A 3OYMA 2X1GA 1ATNA 2GVZB 5E3AA 2J0XA 2XTJP 2YNHB 3A5OC 2B5JB 2MKCA 2DR9A 4MFAA 5C12A 2A1JA 3OTDA 1X5TA 1RWMB 4H5VA 1T3NA 4CF2A 3D3BJ 3HD1A 3SZ2A 3BS5B 1NB2A 3O0FA 1LFWA 3C16A 1GLBG 1VQON 4LZDA 3SMVA 2JHEA 4PKHA 2GCFA 4D3GA 2KVIA 3KZBA 4I2JA 2M52A 2M8DB 3PTWA 4C97A 1UWBA 1BXNA 3J80Y 3UKUA 3D0PA 3CPWR 1WSIA 2O4GA 2P9NA 3OUYB 3LWMA 9ICKA 3CRXA 4ZVFA 2DNPA 4PKDB 5AQSA 2CQHA 1GXUA 2Z30B 3IBFB 1R0CB 3G82A 2W55A 2HKEA 4AUKA 4CHYA 3MN6A 3KYLA 5MLCQ 2AH5A 5KGWA 2PFFB 3DRRB 2DPNA 4E7KA 1PUZA 4CIOA 4LH4A 1VK3A 3E01B 1N32J 2VWJA 3NMUA 3OHRA 3A1YG 3PCOB 2IOFA 2RKIB 3HVWA 3M8QA 1XO1A 1RAFB 1ITPA 1NI3A 3O9SA 2KYZA 2OPQB 1NGHA 1JJ2M 3LAKA 3F9KA 3R5AA 3MECA 1X4EA 5C10A 3DOLB 3ASMA 4BC4A 4F04B 3BZQA 1NNLA 2E8AA 4Z4IA 1C0TA 5K8PA 2LYVA 3VPZA 4E1JA 2QEXN 5KFOA 2PKEA 4WXWA 4KH1B 4J2BA 4NLZA 2VQEJ 2MSTA 4K8ZA 3LK9A 4PPDA 4CQ1A 5J2AA 3NXZA 5ALRA 1B7YB 4U8VA 1PK1B 1OW5A 1SXEA 1VSMA 3M6XA 1JB0C 1PK3A 2P8IA 5IWAF 1YVUA 1SJ1A 3MD1A 4RG8A 4BE1A 4ECQA 2RHSB 5KFWA 3DOMA 5DM7L 4X65F 1OH8A 3FQKA 5AT1B 1C1BB 4NLWA 2I38A 2ILYA 3KLIA 3R5DA 1N32K 4L74A 2Z2YB 3B6BA 4DFMA 1L3KA 5KFYA 4I6MB 3HHKA 1SC6A 3Q2TC 3RF9A 2D0AA 3P8BB 5B5EU 1N5XA 3CNQP 1HNXF 4M9GA 3BO3A 1S97A 4MKVA 4CGFA 4KHPJ 2QKQA 2XI2A 2NQPA 5MAOA 1RDUA 3ZDCA 3D6HB 4R8UA 2LQBA 3ORYA 3DHXA 2FC9A 4JKDA 2E6LA 3BSCA 4CZIA 2UUAF 4JKAA 4NLDA 4CJSA 4CDGA 1BCMA 1ZQHA 3CMES 2XY6A 2XS7A 4G1PA 4CJFA 4K4GA 1T03B 1YF5L 7ICJA 4YN3B 4B3SK 4J9QA 3AVAA 5A6PA 4RNMA 4NLQA 1F0XA 4OX9K 4ED7A 2QWLA 1QAYA 3GU3A 3AT1B 3K57A 4DTOA 1K73O 4AHSA 2G8VA 4LJXA 1IKXA 1X66A 4UAUA 1V4TA 3DRPB 2XS2A 3B8HA 3DHWC 4PUOA 2MZRA 5ETVA 2F4VJ 3FKBA 3PIPQ 8ATCB 3A8YA 3NS6A 1KBUA 4LF4F 3FGUA 4M45A 3T6JA 4GC7A 5JJBA 1S48A 1NGFA 2MLYA 2DNZA 4W5RA 3OSNA 2A42A 1UEKA 1QCKA 2FZCB 1WC0A 3NS7B 4FJKA 1VQLN 3NF8A 1IV8A 3OVSA 1TMJA 3VAIA 3OFHA 3SFUA 1N36J 2W9AA 1X7VA 3IR5B 4WYBA 3FR0A 1EQMA 1N5SA 2FHOB 3CJAA 3OVBA 2LYHA 4CO1A 4ED4A 3NNCA 1X3NA 3HOTA 3IMQJ 1GFWB 1VQPS 1F9FA 3JSBA 1ZM3A 2EC2A 2K8CB 3G6VA 2AEJA 1U45A 1FW6A 1MN8A 2KKHA 1FJ7A 5ALPA 5AZJA 1FNMA 4FF1A 3CIZA 2KOBA 4HUGA 2DQNB 3KKFA 3G4SS 4TYAA 2HLTA 2KVCA 4Y0WA 2AGPA 4PQUB 4RQ8A 3QIOA 1HUZA 4NLVA 3PW7A 1BG3A 4MMOA 1SL1A 1IVZA 3BS5A 4CZHA 1H2VZ 3JS9A 4LSZB 1ZM9A 2R2SA 4UY8O 2AP6A 3MMAA 2QWMA 3EE9A 2XWYA 5D77A 1RACB 1KAYA 3IR6B 1IJJA 1AW0A 4E2FB 1A0OB 1ZQDA 1GLAG 4KX5A 3UXNA 2MY8A 3IFRA 3L0QA 3SAHA 3UNYA 4U67Q 1Y5LB 5JVHQ 3IA0A 3RWUA 3PJWA 3ZT4A 4QR1A 9ICIA 3D0GE 3PIOL 1YGYA 4M6WA 4HKQA 1TZ0A 2LVWA 4USJC 4ZVSB 3SK3A 5ALVA 3D2QA 4DLEA 2D3DA 3SQGA 2B0CA 1TVRA 3HPHA 2MUTB 1MW7A 4A4JA 5AQVA 2LQ8A 1LWEA 3K4GA 2G0IA 2DB1A 2V7YA 4DL3A 1QVFR 4OX7A 4IQTA 4I28A 1RWXB 1LOTB 1IBKJ 4OCZA 1Q82O 4HHHA 1S1TA 3ILLA 4JLHA 4B3RJ 4I2EA 4ID8A 2KJWA 3GZFA 4J9KA 5E3PA 5CZ1A 3L6QA 5HL7L 5M2PA 1C7YA 3GV5B 5D4LA 1FVSA 4J9SA 9ICMA 1EARA 2J9CA 4TU9A 5F9NA 4EU0A 4H4MB 5LMUJ 5AKGA 3M7DA 1E6YA 1WI8A 3LZIA 1IWAA 3UKUB 5ETSA 1CSJA 4WFNL 4B9MA 1S6PB 1MWQA 1N32F 1LK7A 2ZH3A 1NU0A 2OHDA 2VFRA 3C8YA 3WQUA 3THXB 2BCQA 3M05A 2ZEJA 3MWPA 3VGSA 4BX9C 2AJ0A 3TNVA 4I4BA 4P0PA 2N7CA 1IM4A 4P71A 1Q7YO 1N6QA 4LF9K 5SWMA 2XY5A 2K60A 2M2BA 4ZVPB 3VGMA 2BXJA 1QE1A 4KGKA 5CYJA 4JRPA 3K7RA 4UB4A 2A1JB 3OR1A 1DTTA 1FE0A 1FF2A 2FD2A 1HMVB 4B9QA 2MYFA 3TTDA 5ETKA 3GE9A 4TKTA 3FGVA 2PEHA 4E1MA 2FJ6A 3CB4A 4JI7K 8RUCA 1D9AA 1ZZNA 2LDIA 3CTRA 3C15B 4DQQA 1PIEA 4KPCA 4HH0A 1HWUA 1XMOJ 3H25A 4NMXA 4ACOA 3GSDA 1U26A 3MN9A 1GAOA 2FHJD 5H1SV 2F9WA 1KEKA 4MO5A 1Y3KA 4KN7A 3QBCA 8ICCA 9ICEA 5IILA 2W3RA 4Y2TA 1VC5A 1RT6A 2D6FC 2LDYA 4PXDA 4B3OA 2RN2A 1NK0A 1UKUA 3MDAA 3O80A 5AM5A 1VQ8N 4F2RA 2M9NA 2E5HA 3ILJA 2IJNA 4ZPAA 5HROA 2GQQA 3TTFA 4GKKJ 1YJWS 2VQEF 1RLCL 2WMMA 2ITMA 2FLLA 2KXNB 2PFUA 4QU6A 1UAWA 2D69A 4NCGB 1Q82T 5AK5A 5KFXA 4F8RA 3U1MA 3EEQA 1GMVA 4WZQA 3N79A 2ZH1A 2R7OA 1TELA 3JSMA 3OFGA 1FNXH 2VZ9A 1BI4A 1S5ZA 3SQ1A 1FVQA 1FXXA 4CF9A 7ICHA 1JK9B 1OVQA 2FBVA 2ZUAA 3V9UA 1TUYA 3R5GA 4PA1A 2VHGA 3UFCX 2IVOA 2O6KA 4AQYJ 2CG8A 3VAGA 3VQDA 2DR5A 3HULA 3VN5A 7ICUA 4MAKA 2QSFA 3C28A 9ICPA 2Z7JA 2F3JA 4BQLA 4MFBB 3L2UA 3ENOA 4DV5J 4WK3A 4KPYA 3L3CA 3PRBA 3CJTA 5CD4A 2HHVA 3KUGA 1S57A 4M63A 2I5HA 3ISDA 2VU5A 1QZ5A 3GFZA 3KWGA 2DIVA 2W1BA 1RAGB 5F8JA 1HJRA 7ICFA 2RH3A 1TU0B 5C24A 1N5WA 5B0GA 1SIWB 3LPTA 3ZEUB 1HQUA 5KFRA 3HMJG 1ZQJA 2YNFA 5HRNA 5F8GA 2NRVA 1JI7A 2W2NP 5D3GB 3AN1A 4UOCA 3H6EA 3C14A 1AYEA 2G8FA 4X4TA 3NUQA 3FCHA 3D28A 1HYVA 4M47A 4AQYK 2X74A 1W9HA 4RNHA 4LF5J 1WEXA 3R2DJ 4L8RB 3FMBA 3DLGA 2G1DA 2N7YA 3Q8LA 3MM6B 4BC9A 2XMVA 2GX8A 3QAUA 1VMBA 2W6LA 2Q2RA 1U1QA 1SPBP 2F7VA 1EO1A 4ANCA 3AVKA 1WWUA 2H3ZA 1QAXA 1PC4A 3VTIA 3D6JA 3KLHB 3WEEB 2FZKB 1UTAA 3CQYA 2B6GA 2CJXB 4DR7J 4J9VA 1UPMB 1S72N 2HCFA 3M5RA 1Q16B 5LM7E 2BE2A 1WF2A 1TL7A 3CJ9A 1V5IB 2A6MA 2BJ3A 2G2ZA 2Z57B 4GV6A 4DF4A 2VBXA 4NYZA 5AXMA 1GQEA 3EN9A 1CC8A 1EXQA 2IDLA 3W2WB 4WQ5C 2UXCK 3OGUA 4ID1A 4JK7A 1A7GE 5J0RA 3CXCM 4TSXA 4DR3J 5JUMA 3CD0A 1YQHA 2AYBA 4YOWA 1BDGA 2CJKA 2QL9B 4K5SA 2AU0A 3K8VA 4USMA 2GV1A 3CD5A 3CJQA 4DX7A 1XMOK 4YOTA 1X6IA 5BXIA 4Y2PA 3D54A 3HVTA 2E1ZA 3DLHA 4ELVA 2G06A 1TKXA 3R7NB 3MM7A 2FBXA 4DTRA 1TGOA 2FJWA 4DB3A 3WC0A 3K0JA 4CECA 1DTTB 1H98A 3O2IA 4OJ6A 2LMIA 2LQ5A 4DR6K 3M1VA 2MZSA 3L3VA 2AJFE 3N4MB 4DSFA 1SQKA 2GA7A 5KFTA 5E3QA 3SUOA 1SXLA 2XULA 2V2VA 4JYAF 2WB1D 1IIPA 2HNDA 2CNKB 1BO5O 2AJ2A 3S41A 1S8OA 1LWFA 2KI2A 3M1FA 1FI4A 4Z4CA 2JXJA 2G8UA 1X5OA 4WXOA 5TKYA 5AQZA 3NVYA 4A48A 4DV5K 5K20B 2KRRA 1M5PC 4KB1A 1K9MO 1FRXA 1ZXIA 4B3OB 2HZCA 4K43A 3SSQA 4TLQA 1ZQLA 4UW2A 4YUDA 4TQSA 4CHQA 1RSCA 5DS7A 1RTZA 3H3OB 5ADZA 4B3RK 4L3KA 5BJRA 4AF1A 2VDIA 3Q7CA 4E7HA 3AEVA 1HYSB 4DTUA 3SQ4A 3HKWA 4LREA 2UXDK 3A8KA 1HARA 3Q0AA 4CE6A 2F1HA 4O55A 1TL5A 1XSNA 5AKIA 3R3TA 4RPYA 2KP7A 2R7WA 5CXTA 3NGIA 1WSRA 2NYVA 3I6PA 2HQIA 3P6YC 4M9NA 5F8LA 2EBGA 3V4IB 2OYYA 3B8AX 1SUQB 2NUUG 1S6PA 4LF4J 1CLQA 4H4KC 4FE3A 1DHMA 4OZJA 3HYFA 1S99A 4DPXA 2OPSB 3TQEA 2OPPA 4WE1B 3OYCA 1TFYA 2NPIA 2E9TA 3TABA 2F8LA 2K8GA 2KSOA 4LF8F 4F50A 1VI7A 4RUHA 4YDUC 2FVSA 4M5GA 2QSWA 2K8BB 1X5PA 4ZP6A 4NLGA 4EFAC 1T05A 1WSJA 2Q0ZX 3LP0B 4LFCK 3WK9A 4DSKA 2W2PP 1S7IA 2A41A 5J2NA 4BHQA 3TEGA 1NKBA 2JRSA 4OHYA 2GX9A 3LDQA 4FVMA 1H2UX 3M9MB 3BYRA 4Y34A 4HI2A 4DTJA 3K9KA 2V0NA 3QJLA 2YHYA 3TO8A 5F9LA 1RPLA 3M3ZA 4OIXA 4O0JA 4J9UE 2ZJ5A 4QYZJ 2QA4S 3I5BA 1FWKA 4CZCA 1AUSL 2JGUA 3I31A 2ZE2A 2LXUA 1QUPA 1NGAA 1D9DA 3UE2A 3SEOA 1Q8KA 3QQCD 2NYIA 2FJVA 2ISOA 1RAAB 3NCQA 3CC4N 4RQ2A 4LQ9A 1DRZA 1VSDA 6AT1B 1Q18A 4QPTA 3ICXA 5IWAJ 1FEEA 4FLXA 5HQMA 3MPYA 4DU3A 4M0AA 3CMAN 5ETLA 5KOWA 2KJ9A 3UI3A 1ZA2B 1BY9A 3WNGA 5K8MA 2M70A 2XBPA 1HEKA 4KHMA 2HBZB 1AFIA 3EDRB 5EHHA 4PZNA 2CJQA 1SVDA 1BU6O 2QT7A 4C0ZA 4KLUA 3AVLA 3UVJB 2DH9A 1EAYC 4DLGA 4A8FA 4HYKA 2UVVA 3QYPA 2BANB 4RW7B 3MCMA 3ADAC 3M8PB 2FF6A 2W9BB 3BN4A 4ZOSA 1HRHA 5DRKA 2NZCA 3AM9A 2IC3B 4K4YA 1WC6A 4ZVTB 2W11A 2CPZA 2ACMA 2LECA 1TUGB 2KQ2A 1TL3A 3VESA 4IOAQ 4FPAA 3GU0A 2YPZA 5AQXA 1BPYA 3OBYA 1VHIA 4HEA9 2ZIXA 1T02A 3UR3C 4HWIA 1QQCA 5HJXA 3UN2A 3ZDAA 4F72A 1P8ZA 4CWBA 3R1HA 3QEXA 2HS4A 4RWTA 3RG6A 1RDAA 2W2OP 5KAKA 2ITGA 3FAHA 2HRYA 3CIPA 5HP1B 1K9MT 3T7ZA 2UXDJ 3AXKA 4ICLB 2F3NA 1X0PA 3SENA 2ZUBA 4BRNA 3QINA 1HWKA 2RQMA 1KQKA 3PYGA 3SCXA 4Y2MA 2MLZA 4CP5A 1EP4B 4DTNA 2GNKA 4DEZA 2DBBA 1VR6A 4ANDA 4AQYF 1FRIA 1PJ5A 4EBEA 1Z1VA 5AZJB 2LKZA 1W0HA 2C1EB 3WKEA 4Q8FA 4NZ0A 1BQMA 1HHTP 2QARB 1NNDA 2GJ2A 5ALJA 1SC3B 4JAXA 3CM5A 1R0AA 1RTDB 3G82B 3CCRN 1RADB 5B0CA 4DV2J 2EQYA 3CCZA 1U2VB 3P1GA 5LSRA 2NYHA 3CJ7A 3BF4A 3ENVA 4O44B 1NJWA 2IM2A 3VQTA 2E2OA 2Y3YA 1X4HA 4XDCA 3M7VA 1GLDG 3CYMA 4F5OA 1PGZA 2MY7A 3IS9B 3UDCA 1YRTA 4I6WA 3FCVA 4EP5A 3GONA 4HCBA 1BA0A 1L6NA 2CADA 2E3TA 3OTOJ 3UXOA 4LVOP 2HHHJ 2C28A 4KFBA 2JFKA 4M5KA 2BM0A 3ZXWA 1RB0A 3R2CJ 4ZCMA 4NL9C 3EXCX 3R8EA 2F63A 1TQLA 1VQ6N 4QZBA 4ZIVA 4P2HA 4N8OA 1RT1B 3MUVP 2I2YA 3V1OA 2JVRA 4BACA 3DNCA 5D4BA 1WN7A 3BKUA 3CUNA 3K5PA 4OYZA 2MLXA 3UDLA 4AYBC 2JEFA 3G8SA 1DJ0A 2FPKA 2IM1A 1CULA 4URSA 2V6AA 3G96A 3KLGA 1YJNS 4CEOA 1FX2A 1UP1A 2WSCC 4AHRA 2JGAA 5D6GA 2DVIA 5L9XA 1J54A 3ETOA 2VPZB 2HIQA 1VBZA 9ICNA 3PHEA 2CPEA 4ILHA 1NBWA 4YHHJ 4OLOA 1S1XB 5LMNF 1KD1T 3P4UB 1G6BA 3H08A 2XZDB 1VQ8S 4UOHA 2V34A 4MK9A 3ISCA 1KR4A 4USUA 3O9RA 3NH1A 2YV0X 3BGLA 5ALLA 2R4FA 1HKGA 4DF8A 1T8EA 1U09A 3I56S 2CQ3A 2D74B 2HHUA 4DUZF 2ASPA 2J8SA 4OYOA 1GK8A 5GAEU 4RW4A 5EOZA 3K75D 4QS7A 3D0IE 3VQ7A 5LL6d 1B4SA 2NSCA 3MK6A 3HKZF 2NRZA 2MQNA 2DHXA 4CJEA 4QW8A 2A18A 4I67A 1XMOF 4A62A 3H0RB 3I82A 1M90O 4KGZB 4ETXA 2WW4A 3KWIA 1R6YA 4BC3A 2NXEA 5AQTA 1A5WA 1XHXA 4QWBA 2QMUB 2ROGA 3DXSX 1U7LA 2B43A 4FPIA 4FJ7A 3HFVA 1RT7B 5IT9O 5LL6Z 4ZP8A 5GADI 3OJUA 4DSEA 1W2IA 2MKKA 1V3ZA 3IBPA 3KNAA 3R9KA 1Z6RA 1VQNN 4KLHA 4IG3A 5AQKA 4I2FA 3L95X 4ES2A 3TA2A 4PHPA 4HT5A 4YP3A 1B0PA 1C0MA 1FK9B 4DG1A 2KRBA 5L1KA 3QEAZ 3NGSA 4ALZA 5KPRA 2KO1A 4NZ6A 4PG8A 3MN7A 1Q8IA 4B8CA 3VQQA 2NCKL 1UVKA 3JPNA 1WELA 4E8UA 4C11B 3SYZA 5AJ3K 2BHNA 3Q2SC 1NUEA 1FIQA 4NLYA 2R8JA 2G1HA 3RUBL 3UE5A 4A2BA 3MR3A 2RPIA 2Y1RI 4CO0A 2B9WA 1N34J 3UVJA 2G4BA 2XSJB 4NXMK 3ZD8A 1WSVA 2F9DA 4PH5A 3ET6A 1JJ4A 5FP0A 5K4LA 5C25B 4KGMA 3EO3A 3MZIA 1GLLO 4PWDB 4JI1F 2IOFK 3ZZTA 4RNNA 2WSFC 4IG0B 1H72C 5C2GA 2HBKA 2V8DA 3B0YA 2CJAA 3DJCA 2IC3A 5AQOA 4ID5B 2OEKA 4WFXA 1HNIB 3OXFA 3CE8A 3CPEA 1NPRA 4PYAA 5AE3A 1RXOB 4RWWA 1OXJA 3OA9A 3N5FA 2LXIA 4CLYA 2E7WA 4K41A 4QR0A 4CTAB 4WK1A 3AY0A 5H9FJ 4Q5VA 3VCBA 4XDDA 1LWEB 3IDHA 3AO1A 3OR2A 4H0PA 4KLFA 1S1VB 2PYLA 4LSLA 5GAEP 4NLUA 1LWXA 1YJ9N 4C4SA 2NRTA 1MSWD 5ITHA 2E1PA 3WU2U 2Y9UA 4E7IA 4YB6A 4BUGA 3W5YA 2QE5A 5AQPA 2QFIA 5M2RA 5D8HB 1Q95G 3AARA 1IG6A 3I0RB 2ZZNA 4YORA 1N34K 5EVZA 3T5HA 5AZIB 1KCFA 5TISU 2O8FA 2PIIA 1HW9A 1S1WB 2ZOGA 1VLBA 4DQPA 1SJQA 2DR8A 1AFJA 3IWXA 4L3QA 4O8UA 2OANA 2ZIUA 2XMKA 4RW8A 3W5XA 4FYVB 3KZXA 3BBBA 2FJAB 2HOEA 5IV4A 4LBPA 4KHSA 2GUIA 3RRHA 2ZM6K 3TRGA 1XC9A 2XY8A 4HH1A 1X5SA 4PPZA 2V68A 1BCOA 3JYTA 1WNSA 4E19A 5HP1A 4RU9A 2E1YA 3CC2N 5H1SQ 2AYEA 4WQ4C 3AD9C 1AROP 2GO8A 1S22A 1SJ4P 2ASLA 3B4DA 2QL7B 3SI6A 2EAPA 4X65K 9ICLA 1RTDA 4RW8B 2JR5A 2RDJA 1I5OB 2VICA 3RJKA 3F2CA 3FBCA 2HQCA 2P9UA 1IR1A 4M3TA 3AA8A 3EJMA 1JN3A 2CZ9A 3MDQA 2LU2A 4RZRA 3SDEB 2ALZA 3OS0A 1XQSC 3DV9A 1VQNS 2WFBA 3D9BA 2XGPA 2BJ8A 4JI2F 1JCEA 1NCLA 2KTQA 3F9MA 3QZ7A 4U7UK 3OXLA 1NGEA 3CD6N 5L1LA 4MYTA 3QU4A 2PI4A 2K1RB 3DGPA 4GVLA 4DV4J 2WF8A 3S9HA 3W2VB 8ICLA 5D78A 3UNGC 3QPIA 3PIPL 3OYHA 4KTQA 3D6MB 4TUQA 4RQNA 3W62A 1WD6A 4JNEA 1ZQ1C 3UD4P 1GMWD 2QYCA 3SD7A 3D0HE 3AMZA 1FNOA 4FJXA 2BUNA 7ICNA 4WPAA 3HF5A 4FZYA 4O3MA 4J9PA 3NNHA 4JI7J 1WC3A 2B9EA 4Y2SA 1GLJO 3KKAA 4KMOB 1MMLA 4XPEA 3WDOA 1XNQF 2ZXHA 3OTEA 1LK5A 1VJQA 3DKDA 3IG1A 4EMDA 2CKWA 4ECSA 1KOOA 4P2SA 2D7SA 2HMXA 4QWCA 4A59A 4OI2A 3TA1A 4TU7A 1IBLF 2KN4A 2K7JA 2UUAK 1PBUA 1NB7A 3HVRA 2GVDB 3FZMA 2NSBA 3O9TA 4DR1K 1U24A 1T3OA 2B8QA 3TP2A 1HYSA 1RBUA 3WQPA 1FRJA 1H38A 2E5IA 5BR8J 3FFKB 5D3GA 3AO5A 4DR2K 2ZDPA 1S6QA 2IVFB 4PL1A 3QNNA 1DQ9A 1HNWF 3CWJA 3KJVB 2QA1A 4UY85 5IIJA 1RWUA 4JP8A 2MKJA 3MEDA 4M9JA 1QQ7A 2HVDA 2O8EA 2C3MA 2I0XA 1VSFA 9ICUA 3BSNA 1NMDA 4YB7A 3VQ5A 2J6SA 1XI1A 5HSPA 5BPLA 3QGHA 2W8KA 1VQ6S 4AD6A 2HSZA 1TAUA 2R9LA 4P4MA 4NLSA 5AKLA 1JXBA 4GVMA 3SBMA 2VUGA 3C5FA 4HT7A 3ZNJ1 4MYUA 2YKMA 4PGYA 2E7XA 1FKPA 2RU3A 2DY4A 2IRYA 3CDUA 3HCXA 5DDMA 1Z25A 1S6QB 3NF7A 2QWPA 1QUVA 3EWAA 2BJ1A 4KREA 2W54A 1TKZB 1IXKA 2WVBA 2ROPA 4GV3A 4F5NA 1RXWA 3I4HX 2I9GA 1S6UA 3EGNA 3T1YF 3K8WA 3O4WA 3PFOA 2O66A 4JB3A 1FKPB 3EGWB 3M8RA 4YY3J 2EC0A 2F7TA 2CJYB 4ILJA 1XMQF 3MR5A 3TKAA 5C5JA 3N4WA 3CF5L 5LSOA 2JC1A 3W1YC 1M5KC 1RTJA 4KMUA 2HFNA 2DFFA 3BGRB 1WTFA 4QYZK 3VETA 4UBCA 4BRCA 2YHBA 3M8YA 2VBWA 4Z7CA 2VA3A 2ZH4A 4TQRA 2RUGA 2HGMA 5IM0B 2L41A 2FBTA 4UB3A 4O5BA 5HMYA 2ESEA 2VONA 4K4HA 5AKEA 3CPWM 4KHWA 4B8AB 4QJVA 4PUOB 2A5XA 1M90T 4J7CA 1NMNA 2MKIA 1SIZA 4FFDA 4KLMA 2E8PA 1ZS6A 4BRIA 1TV6A 2B6AA 2HZVA 2ASOA 4J2AA 1N48A 2L9WA 8ICVA 2P9IA 4P9SA 1PZNA 2Z1IA 3H5YA 1SV5B 4PKIA 2UUBJ 1WG4A 2VQFF 2VH7A 2J7KA 4HL9A 2CIMA 1AQ6A 1MQ3A 3BSOA 4CESA 3B0XA 5IV3A 5HR6A 4NLXA 4BRDA 5I9EB 4GRSA 1X9XA 4UT4A 1U2CA 5FIIA 4Z4FA 4IR1A 2MQMA 3AO2A 4DX5A 2Y1IA 1ZQPA 3LOUA 4B1VA 1M1KO 2YWHA 3VENA 4WZMA 3VEYA 1U1PA 3GE1A 2E1FA 2W4DA 2WF9A 3RB4A 3SQIA 1NPPA 5GMKa 1T9YA 1JLEB 1J97A 2C3UA 1ZA1B 5AM2A 2BPGA 4KGVB 2UV8G 5ALEA 3OYAA 5ALQA 2NZ4A 2JLGA 4B17A 3B6OA 4PCQA 2M9KA 4BRAA 5HMXA 3MCSA 3DM2A 3LVVA 4KB0A 1RT2A 1P9YA 2MQOA 1S1TB 2VGMA 4FWNA 4Q44A 2MKHA 4KAIA 1FJGJ 4J2EA 3DYAA 3ED5A 2IAJA 5BPNA 4Y2YA 2OPRB 5KFQA 2GWKA 5FLXU 5IWAK 4ENOA 5J0TA 4O9MA 1NHKL 2DJWA 4IH7A 4N5SA 2E5LJ 2RILA 2R7YA 3A0HU 1V9OA 1Z4UA 4H0TB 4EYIB 3I0SA 2YX6A 4YR3A 2KFYA 3AVGA 3VQCA 2HBJA 4HI1A 3VGUA 2QA4N 1WB9A 1LKZA 4DU8A 2FJDB 2BPFA 5DLGA 2OKQA 5CY4A 2X3DA 1S49A 4I9QA 3DXKB 3ZD9A 5ADXA 1SZHA 2W41A 4AH9A 2OPSA 2QA4G 1TFRA 3ZZPA 3K58A 4YOXA 2CNNB 3NL0A 1D9FA 1F5AA 5J2NB 1RLDA 5FPDA 2QMWA 4QZVB 4BC2A 3SCIE 2F4VK 5LMNK 2KFNA 3PR4A 3TVKA 4DV7K 2HLUA 5FRMA 4J9RA 4MF2A 3KHHA 2DYAA 4U7UD 2BV3A 1IKVA 3M2UB 4LR7A 3UKRB 1R0BG 1N4LA 1OUQA 2GWJA 3GR0A 3LP3A 2FLPA 4DV0J 3FBEA 3UM9A 1JXEA 4TLRA 2CZ4A 1RCHA 3W65A 5HBMA 4M04A 1ACMB 3HFKA 5KTQA 1RTIB 4LSNB 4KRFA 3OT9A 3AD7C 2JRZA 1U1OA 3DLRA 4MFCA 4M5JA 3VQ8A 1PAEX 3HO1A 3DDIA 3KK2A 2XLIA 2P9SB 4B3TF 1RBVA 4CHPA 4CFDA 4CJ7A 1WUAA 5ALKA 4DOZA 2NRRA 2ASYA 4U6PA 2EK1A 1VQKN 3BYPA 3I8BA 4LFBF 2R7VA 2F96A 4CZGA 1NDCA 4CJKA 2WFAA 9ICFA 4NJ8A 2LSNA 2AKWB 3MPWA 2ZWOA 2J6TA 4LF6F 4U8YA 3Q22A 1VQLS 4UARA 2H4WB 3I33A 2YWEA 4NA3A 5CAAA 1BGXT 3C2PA 4FM0A 4TN2A 3VOVA 2KG1A 2G0CA 1S6OA 4MT1A 1KQSR 3VGTA 3QEIA 3IP4B 4ECWA 1BPZA 3W66A 2BM1A 4P10A 3RFAA 3U6FA 4HCCA 1ZQGA 1M5SA 2JSXA 3OYFA 3NASA 1Q5VA 4WCEQ 2YQEA 4RT3A 4S0MA 1I51B 3GTYX 2EZXA 1SV0A 1Z4NA 1NNEA 3NY0A 4IS7A 2VG6A 1JLAA 4A5BA 1KBRA 4KSEB 3TJ8A 2DHHA 2DO4A 1OO0B 2MDAA 1DQAA 1QSYA 5EDWA 4IBNA 3EYZA 4OKJA 3T1HK 4N8NA 4OYWA 1C1AA 2HHTA 4C1NI 1RHJB 2FLOA 4OHWA 3PW4A 2HYIB 2CYYA 4DZ6A 4FM2A 4Y2VA 5D0EA 5FPMA 2R7UA 4CZKA 3G8QA 5BN9A 3RR7A 1W7AA 2O8BA 1UZDA 2DNQA 1OPIA 3PDNA 3RJGA 3QE9Y 2EKYA 3WT0A 1VIXA 2CRLA 4Z6FA 2B51A 9ICVA 2ZXIA 2ZZMA 2HQDA 4IOBA 5ETTA 1RHKB 4GV9A 4UB5A 2AYMA 1Y5IB 1XK8A 2YWWA 2QWOA 4Y2KA 3TZWA 4OV1A 3KOAA 4JRQA 4BCAA 3CCVN 4RW9A 2CN1A 2G2YA 2LFVA 4P7TA 3PACA 4GMJB 2IMWP 2Q43A 3VEZA 3CF5Q 4QOZB 5DETA 5CJ7A 1UZHA 3CCSS 3I1YA 4NXMF 3AFGA 4UUWA 4C6AA 1PVPA 4UATA 2V5HG 3MHYA 1GNKA 1CC7A 2PMZD 3QICA 4B3MF 2QEXS 2H51B 3GDXA 5G0RA 1QS4A 3VA3A 4DOAA 1U2RA 5LXYA 3P4IA 5A8RA 3CJKA 3L2VA 2DGXA 4Z4EA 4PGXA 9ICCA 5K8NA 4F0HA 4M3XA 3AJ2A 1KD1O 3H4DA 2XNRA 2E66A 3LVWA 4AYBF 4B02A 2RE2A 2BUPA 2MQQA 3NAHA 1DEJA 4CF5A 2XMTA 3K1ZA 8ICQA 2HNDB 1NK4A 4PWWA 5KG1A 2H65B 3A5MC 3I0SB 1S1UA 2R7SA 4QZFA 3CFOA 5HI7A 2RQKA 4O4GB 4FYYB 1RGVA 1CXUA 3IMXA 2EWHA 2MRLA 1O51A 4XIUA 2BACA 3H4BA 5J8YC 4CNZA 4A8YA 5DBAA 4O23A 1F9EB 4IUFA 2JL9A 4BY9C 1U1LA 1VGYA 4JV5F 3FFIB 3EWGA 3TYTA 3CMQA 3AVMA 4NO7A 1N5QA 1PYOB 5KT4A 2YNHA 4WF9L 3NH2A 2HGNA 4WJ3B 1FT8A 4UTGA 4R5PB 1RAHB 4QIEA 1FKOB 2BGGA 3UQ2A 4AXJA 3H5UA 2AEMA 1LKYA 1Z00A 1U0SA 4OX8A 1N52B 3WNFA 3ZTSA 4PL7A 1VRUA 3CCES 5KQDA 2OTJN 4KBIA 5J0UA 2PDAA 3FEZA 1NMEB 3M6KA 1HUOA 5F41A 3CCQS 4CI6A 4QIWF 1OSCA 2U2FA 5G5GA 1I6JA 4YMNA 5IQQA 3N9UC 3BS7A 8ICOA 1ZETA 1S1UB 3IM1A 4H4OB 5AKKA 2KNJA 4KITB 4KLOA 4JI3F 2IVPA 4I6YA 5D4NA 2ZH6A 1S1XA 4XRHA 3O3FA 4O3RA 4BGBA 1UJ4A 1N0VC 3F73A 3PO5A 2D0BA 4TXSA 3TZYA 2M88A 4LFBK 4DR5J 2NXJA 4NA1A 4W5TA 3W9HA 4E7LA 5J0QA 4J9OA 4CM0A 1ZQXA 1WOQA 4BGAA 3D5MA 2B56A 4FBUA 2EHGA 3RRGA 4U95A 1RCXB 1V97A 1QQOA 3EUB2 2QL5B 3LGHA 4F71A 2R2RA 4PYDA 4AXIA 1WWHA 2ZUDA 4FVCA 2GGPB 4YR0A 4IQWA 3A5NC 1KN6A 1EQYA 4B1YB 3BF1A 1DFDA 4JHDA 4G3IA 1L7OA 1PILA 4OYBA 4KFBB 4QZEA 5LJ5Y 1HLWA 2OXOA 3D7SB 1G1XA 3MAAA 8ICBA 5J2FA 3NAEA 2UZAA 3HSGA 3MCPA 3VGLA 3THPA 2OUGA 4X4QA 2ZJRQ 2Q0UA 3RSEA 1UL3A 4NV0A 5H9FK 4YFKA 2FC0A 5B0FA 4EFHA 2F9JA 1YWXA 1N33K 3H5XA 1FWPA 4LZGA 5DM7Q 4WF9Q 2E8MA 1MMNA 2CQ0A 4CDIA 2OEMA 2DPJA 2RDDA 1JLQB 1VQ9N 4JKGA 4NXMJ 2CXYA 3L2QA 1ZTWA 5CB1A 1D8LA 2R7QA 1XHZA 1YVFA 1RA6A 3T1YK 3J7A1 2FVRA 2YMLA 1RQNA 3AQEA 4UOGA 1VAZA 4NA2A 2KK0A 1WDTA 1SQEA 4DR1F 5CZ2A 1E3MA 1YBUA 4B9LA 2IA6A 1N63A 3L5KA 3ULHA 8ICAA 2RMLA 3FRYA 2P5VA 2J5AA 1C20A 5IFMA 1PKUA 4RQ0A 1MG7A 4OHZA 2G8WA 4IFVA 1SZ2A 2J6UA 1ZQWA 1UEUA 3WBZA 2MZTA 4MKBA 1TUUA 5KFGA 3PYEA 4YQWA 3U7JA 3A0IX 3RB0A 2DY9A 1NH8A 4OJHA 3QFUA 1SWVA 4HTIA 4IOAL 2P35A 1KAXA 4OJGA 1OKJA 3AUOA 1EETB 3O08A 2MPUA 2FQQB 1RT3B 4QZHA 3LO3A 3ZSWA 1RU1A 4RL1A 5THWA 2MUTA 1FA0A 5I3UB 5DQGA 2LP4A 1YJ9S 5A76A 2V8VA 3KUEA 2G9OA 4HUEA 1UCVA 2IBOA 2WHEA 2DR7A 2NRHA 1WACA 3R6GB 2EZYA 2UU9J 1ESVA 2XCPA 2WHOA 4Q0BA 4RJVA 2E1MC 4CE9A 2RQ4A 1WBDA 3VF4A 4QCLA 5AKHA 1VISA 2P2CB 3NS5A 3ZSXA 2F1FA 3QT7A 1XNRF 5E3CA 4DN9A 1MA7A 4M3RA 1NXIA 2JOQA 2AX1A 1DLOB 1RBTA 3PXGa 2DHAA 1MWMA 3L8BA 4NXZA 1H2TZ 3CULA 2GHPA 3QNMA 2CPYA 3CCUS 3CJ2A 3LDAA 2D8CA 4US9A 2KLAA 5LJWA 1HNVB 4TUPA 3TSQA 3PVXA 1RQ0A 1K8AO 2NUHA 2FDRA 4GVBA 2XZWA 1RBOB 3C5GA 3B78A 3PMNA 1KN5A 1VLOA 4B3MJ 2ZIWA 2Z58B 3JPPA 3ZTRA 4B9TA 4DUYJ 1UFLA 2ATCB 3HL8A 5GAGI 3U8XA 2V8HA 4PPXA 1WOSA 4C4TA 5G5HA 3ISND 4GVEA