1C20A

Solution structure of the dna-binding domain from the dead ringer protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAAFTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DEAD RINGER PROTEIN
publication title Solution structure of the DNA binding domain from Dead ringer, a sequence-specific AT-rich interaction domain (ARID).
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1c20A00
4LJXA 2LM1A 2JXJA 2CXYA 1KQQA 5CEHA 2EH9A 1IG6A 5K4LA 1RYUA 2RQ5A 2JRZA 2YQEA 1C20A 1KKXA 1KN5A 2KK0A 2EQYA 2OEHA 2LI6A
chains in the Genus database with same CATH superfamily
5KFZA 1NK6A 3OJUA 5JUMA 1FFVA 5KT4A 3QU7A 2NO4A 5KTQA 5AKKA 3LDAA 4IR9A 5EE3A 2F77X 4PHEA 5ALKA 4PGYA 8ICKA 2UVWA 3GQCA 1TKDA 4E0DA 1J2MA 5JTIA 3PZPA 3Q8MA 2G0AA 1S9FA 3L5KA 2G5HB 2WF7A 3HT3A 4A8EA 4TQRA 4RUCA 4RQ2A 4ECZA 3AUOA 4M9NA 5KFQA 4NJ8A 3N7PD 2D3DA 3KZIU 5J29A 3AM9A 5AK6A 4F93B 1XC9A 4MF2A 4RQ7A 2ZIXB 4BXOA 8ICQA 4P4PA 8ICCA 1PZNA 1UA1A 1S5LU 3OSPA 1ECWA 5KFHA 2OWOA 3EPIA 5AM5A 2QLTA 5KFSA 1ZQ1C 5KFLA 2UVVA 5KG1A 2EANA 5J2GA 1FO4A 3MGVA 4PZOA 5EOZA 1Z19A 4YD1A 5CEHA 2FPKA 4MFAA 4Y2UA 1ZQAA 2DBYA 2FDRA 3EUB2 4KLQA 4Z6CA 3QZ8A 3C28A 3EWAA 1A0PA 4EX7A 3T3FA 3SV4A 4YCXA 4P2HA 1CEZA 4P0PB 5E79U 5D4BA 4PGQA 3PSPA 1Q3UA 4YMOA 5G5HA 1Z4OA 3F2DA 1Z00B 8ICNA 1SZPA 2EAOA 4CF5A 4CF4A 2DKZA 1RYUA 4B9LA 4RT3A 1ZQGA 4F5QA 2Y1JA 2KFZA 9ICOA 4O3MA 2I6XA 3RAXA 3NUQA 2KTQA 3BS5B 2ATLA 3WKDA 4BWJA 2XCPA 4C8KA 1TV9A 1PK3A 3JPTA 2A19A 9ICHA 2QKQA 1AQ6A 1V85A 3IM1A 5K4LA 4IS7A 4KLIA 2JR5A 2R8IA 1LKYB 3AQFA 2C2DA 1WCNA 8ICLA 1N5WA 4DL4A 3SD7A 4F5RA 3RFAA 3N7SC 5ALDA 5CP2A 3MGHA 1ZQFA 3LVWA 1ZQLA 4FS2A 2HOQA 9ICRA 3VC8A 1KLNA 3MFHA 4DSKA 1RDFA 4GC6A 2NRTA 4DFPA 2BDPA 1ZRMA 1L3UA 1X2IA 1N63A 5KFUA 4OJ6A 4FBUA 3QNMA 5DQHA 5ALEA 2R8HA 4C8OA 1ZQNA 4QW9A 2ISOA 4ICAA 4RQ5A 2PMZF 1NK4A 3ZDAA 1KDHA 4DL5A 4UB1A 4NWIA 4DSJA 1S77D 1FFUA 2Y0SF 4F91B 2W8KA 2GLEA 8ICWA 2ZJ5A 5KFJA 4PHDA 1T7PA 1RXWA 3RB4A 1MN8A 2FJ6A 5BOLA 1L7OA 4I2BA 5J0SA 1Z00A 3PX4A 5J2EA 3GIIA 2MU2A 1L5UA 3IG5A 1F0MA 5KFKA 5DB7A 2W9AA 2P6RA 3PMLA 5KFTA 7ICTA 1ZJNA 2ODGA 1OW5A 2XGQA 2BZFA 4I28A 3BS5A 2KKPA 4C4TA 8ICMA 1DGJA 2EZYA 2A1JB 5GTHU 2A1AA 4TQSA 3RB6A 4ECTA 2HVIA 3CP8A 1Q46A 3OHBA 1Z1VA 3WU2U 4QZ8A 5J2CA 3GU3A 1LKYA 3FYHA 5TZVA 5AKIA 1ZQSA 8ICVA 8ICUA 2YQEA 2KZ3A 2KG5A 4JV1A 4F4WA 2KFNA 2ASLA 4DOCA 8ICXA 2Q4TA 4Y2PA 2Y9TA 1EXNA 3PW7A 3KZXA 8ICFA 4ECWA 4I29A 1DK3A 1NZPA 3TAPA 2BGWA 2IHMA 3PW4A 4IRDA 3H8WA 4QZEA 3SZ2A 1HUZA 4USAA 3M6ZA 4TURA 3PW0A 4YR3A 3T5KA 1A6SA 3C1ZA 2JEIA 3HWTA 1MQ3A 3RTVA 4Q8EA 3T5JA 1L7PA 3ZD9A 1Q8KA 4KLDA 5EWEA 2QB1A 1C20A 5AM4A 5ALZA 1VLBA 4DL3A 2RDIA 4C8MA 4RQ4A 2H3VA 3Q8SB 5B5EU 5KFRA 1A77A 2DF4B 3SAFA 5ALFA 2KJ8A 4F3OA 4DSEA 1SV0A 4GIBA 3MFIA 4MFCA 1PK1B 2EZXA 1FEZA 4M9JA 1ZQTA 2UVUA 3MDCA 4F2RA 2MA1A 3UMBA 4C4SA 3RJIA 4RPYA 4ED3A 5F9LA 5CHGA 4YMNA 1NZBA 5T14A 3NVVA 3RJEA 3SAHA 5DB9A 3H0MB 5AHXA 2H5XA 5IILA 4DQSA 4RQNA 2A1JA 4OJLA 3KTQA 9ICWA 5KFXA 1KN5A 5CWRA 1B43A 3KHHA 5KFAA 1OXJA 3BJYA 3ETLA 4DSLA 2PI4A 5KFPA 3KHLA 3NGDA 4DWIA 2LYAA 4RU9A 3E2EA 3OJSA 7ICFA 2HHQA 2HHSA 2V9WA 2E1EA 1JIHA 2YMQA 2V4RA 2E8PA 1WWUA 4Y2QA 3RJGA 5KT2A 5GTIU 1S0OA 4LJXA 1L7NA 3WK8A 3SAGA 2PFNA 5B66U 2F44A 2WAQF 5J0YA 4UBBA 4TUPA 2W03A 3UMGA 5ALXA 3BZCA 3M9NB 5ALWA 1X9XA 5ALIA 1RM6C 8ICIA 5DG8A 4I2FA 2AHOB 4QZ9A 1ZQIA 1RPLA 2OXOA 4GC7A 2YTUA 4BUGA 1XO1A 1UT5A 3RH4A 5D49A 4R65A 2VA8A 2HBJA 2HBKA 1MA7A 3B9JA 2HOFA 5ALOA 5KAFU 4G3IA 1RQNA 4JWNA 3C5GA 3QU2A 4I2EA 3BS7A 3EZ5A 4QZGA 2LYBA 3Q8QB 4Q8FA 4Q43A 1TAUA 4JMUA 1PK1A 1NOMA 1TK5A 5HMMA 2JXJA 8ICPA 4F4YA 4AP9A 4DS4A 4KLMA 4M47A 5J0TA 2W04A 4MEYA 2VIXA 3H8JA 2C22A 4B9SA 3NVYA 3Q8RB 2B0CA 5KL1B 5KAIU 5DLFA 2FLPA 4CF3A 3OGUA 2XICA 1XSLA 4RQ0A 2HBLA 2HVHA 2HHVA 1S0VA 1MC8A 5KFBA 3V72A 1KRPA 3PV8A 3OTQA 4KMOB 4MF8A 3C23A 7ICHA 1JN3A 2UVRA 1U9LA 2LPEA 2KK0A 3QE9Y 4YN4A 4C8LA 5L1KA 5CR0A 5FP0A 2K8AA 2Y0SC 2KOBA 9ICVA 1QQ5A 5DDYA 4IQTA 2W9CB 5KG5A 4QWDA 2WF9A 3IDWA 1XU4A 4KX5A 3I1YA 2YMMA 1NI3A 3ETRA 2KEYA 1KEJA 5HHIA 4BX9C 2PFPA 5D46A 1RZTA 1ZXIA 2ZG6A 4KMUA 4FO6A 4YQWA 3H0LB 8ICJA 5HMLA 1ZQYA 4UB6U 2XY6A 1URJA 4BGDA 2R8GA 4I27A 4DFDA 3WKCA 1RYRA 4DEZA 2ZUDA 3SV3A 2QARB 4NM2A 4QWAA 4B9MA 2ALZA 1NKBA 2BCSA 3WK4A 2ZXHA 4I2GA 1SIJA 2WF5A 3KBBA 3K1ZA 4EEKA 1QSLA 4CDGA 4O3RA 3F53A 4CCHA 2HCFA 2OYYA 5J2HA 5ALSA 1ZQJA 3A0HU 1KSPA 4DF4A 1A76A 4ED8A 2H3FA 4WJ3B 4O3OA 7ICRA 3RJFA 5J0RA 3NRWA 3NRZA 5AI9A 3HPOA 3MBYA 3T5HA 5AI0A 2NRZA 2RHFA 1N62A 4QZIA 8ICGA 3MC1A 4DFKA 2LMRA 3WKAA 3RAQA 5DB8A 3JPSA 3CW2C 2BPGA 4DOBA 1ZD4A 1NJXA 2CPRA 3LYSA 2YMLA 1D8LA 3PX0A 2ZIWB 5JU5A 1T94A 4UAZA 4J9OA 3RJHA 4I2DA 5ALRA 4DCCA 3QUCA 5AM1A 1ED1A 3HX0A 2EAPA 3MR3A 5F3XB 1YZ6A 3JPOA 2BQ3A 3UQ2A 3ZDBA 2NV3A 3PR5B 2AU0A 2HW3A 3O0FA 7ICVA 4QZHA 1BPDA 2W3SA 2W9CA 2BKEA 2OM6A 4XQ8A 4RNOA 2FI1A 3L4PA 4M9HA 1RQLA 3UM9A 1GO3F 4PL1A 4EZ9A 2MUTB 5L9XA 4B9VA 3JPNA 2WHEA 4JWMA 4ZH4A 4GLXA 5ALLA 4HYKA 5L1IA 4B9NA 4F5OA 1F5SA 4DLEA 4HAIA 3MGIA 3UXPA 5CRXA 2VA3A 1JUDA 5ALNA 2DPJA 4FE3A 3SMVA 1UQVA 2QARA 3M9OB 4ED6A 3IV6A 4QZFA 4RNNA 1HUOA 1SB3C 5J2KA 1JALA 4DL2A 4YVZA 2BQUA 4EENA 1KFSA 1VDVA 4RQ3A 3TADA 2WB1F 1KQQA 5KNIA 3RR8A 3ZDEA 2KIWA 4C7ZA 4CRXA 4Q44A 2J6TA 3D2QA 2C28A 5J8YA 5J2DA 1QQ7A 4NV0A 2I9GA 4OJOA 4ECYA 4LVSA 1KBUA 5J2AA 2P6UA 2KZMA 4ED1A 2DWQA 1N48A 5L1MA 2KE7A 4Y2YA 5KG4A 2VKQA 2O6KA 4KLEA 2DGZA 2AGQA 5ALTA 2ZXIA 1IG6A 4RQ6A 3PSIA 3TAQA 1S0NA 2WAQC 3SI8A 1NK9A 4QNLA 4F92B 5AIBA 4BWMA 2ZIWA 4ZOHC 3MDAA 1BPYA 8ICAA 4IQUA 2ZTEA 4FBTA 5J2FA 7ICIA 4UB2A 5DQIA 2RP5A 4R8UB 5IINA 3V7LA 3FAHA 2F1IA 5F9NA 4UAWA 4U7CA 2IA6A 1UT8A 4ECRA 2LKYA 3TQ1A 1BNPA 2KN7A 5ALYA 5EE9A 1F44A 4ECUA 1B0XA 2MUTA 5J2BA 2ZTCA 3IP4B 3NTUA 4RT2A 2AXTU 3QU9A 2JRZA 3QZ7A 1L6NA 2K60A 3TACB 1PUZA 1ZQBA 4Y2XA 3NASA 9ICBA 1X9SA 3N7RC 4FZNA 5L1LA 3WKBA 9ICNA 4BJQA 4K4GA 5KG2A 4CNQA 1DXSA 5KFDA 4FZLA 5AM0A 1TFRA 1SGGA 3TFRA 4GXJA 1TK8A 1ZJMA 1X42A 5DGAA 3KFUF 2VJ4A 5DBBA 5AI6A 1V9PA 4CE6A 4KLGA 2JHDA 4UASA 2WFAA 4QZCA 5J0OA 2W55A 3KOOA 2W11A 5IIJA 2W8LA 5DG9A 1NJYA 5AKLA 2H3QA 1ZQQA 1K1SA 1KFDA 2GH1A 3TADC 3PY8A 4KN4A 2JEFA 3H7IA 3QU4A 3S6JA 3GIKA 1PVPA 3GILA 2ZIUA 5IIIA 7ICSA 5KFGA 2ZIVB 3E58A 3PMNA 5ALHA 2K8CB 3F2CA 5J8YC 4UB8U 3QUQA 3IRUA 1SL0A 4P4MA 5J0PA 5KL8B 1X9WA 2VANA 7ICMA 4OD0A 4I2HA 4PHPA 1M6YA 5KFOA 4O5CA 3QYPA 4R8UA 3AMZA 2Q0ZX 3LWLA 1QLNA 4CGZA 4QZAA 3AEVA 3THVA 4ELVA 3UXOA 3FC4A 1QQ6A 2KJ9A 1WYGA 4LZDA 1U45A 2DKXA 1SXEA 1ZQCA 2WF8A 1IXRA 2FMSA 2BCVA 3QUTA 1ZOLA 3QU5A 4PJ0U 3U26A 1NK5A 4F8RA 5DBAA 1J2NA 1SV4A 2YN4A 2KHQA 1UPHA 4R64A 4UAYA 2W3RA 3M9MB 4QW8A 3SR6A 1KW4A 4QIWF 3RH5A 5AICA 4TUSA 5ALGA 2W54A 3AL0B 2BPCA 1NJWA 2NRWA 2FMQA 2RRDA 3DV9A 4US8A 3BQTA 4K4IA 4J9PA 2AJQA 4KLJA 3H8SA 4BDPA 1NNLA 4OCZA 2F2AB 4ECSA 2FLNA 4US9A 4GXIA 7ICQA 4ELUA 3PO4A 3K1RB 2NRVA 4I2CA 4IRKA 4YG2A 4IL6U 4IQVA 3T5LA 1D9FA 2JH7A 3G6YA 3HRDD 5L1JA 4O5KA 1N5XA 4RPXA 3PW5A 3WK6A 1HEKA 1KL9A 4F71A 3B0YA 1QTMA 7ICUA 3IN5A 2ZJ8A 4UBCA 2DPIA 2GO7A 2JEGA 2W9MA 2R8KA 4Y2JA 8ICYA 2DUYA 2KIVA 1DRGA 4UQGA 3K4GA 4DL6A 4O5EA 3GV7B 2ZIVA 2KVCA 2R8JA 1WUDA 1BNOA 4F4KA 5KG0A 2W43A 1BVSA 7ICNA 4QZBA 3LWMA 4IQWA 1ZQPA 3RJJA 4DQPA 2AGPA 3DDHA 4UB5A 4PH5A 4EYHB 5H2FU 2PI5A 3RRGA 2OEHA 3C2LA 2KSOB 2ASDA 4NLCA 4DF8A 4B9TA 3PVXA 5KFYA 2JMGA 3MR6A 2W7OA 3KHRA 2VJ5A 1ZQXA 3B0XA 3WKEA 2WB1C 3I28A 3JPQA 3SQIA 1PVQA 4Y2TA 3PSFA 2PKEA 2ES6A 4PHAA 4R66A 2K4HA 3UXNA 2HI0A 2BCRA 5AK5A 2HMXA 1BPZA 1HJPA 4C8NA 5HP4A 3TANA 1TAMA 4QWBA 2E5SA 4F5PA 5BPCA 3BQ7A 2YMPA 1KTQA 1RG6A 4DOAA 1YZ7A 2CXYA 2J6SA 2EH9A 4PL2A 2P66A 8ICRA 3H4BA 4FFDA 3RJKA 4M2YA 3SENA 4Y2SA 2C2RA 2HHWA 4ELTA 4F72A 1NKCA 3GV8B 5AIAA 2ASJA 8ICTA 3Q8LA 3C2MA 2ESEA 4X5VA 2E8OA 2RDJA 4MEXA 2M0NA 1ZRNA 2PMZC 1T3NA 2KZZA 2MAXA 4FZMA 4KTQA 1CUKA 2YB1A 5JRTA 3ZDCA 2HOIA 1HIWA 3TFSA 3WK7A 2M9NA 3PX6A 3QEBZ 5AKXA 4QWCA 2E8NA 3I76A 2W7PA 4OJ5A 3H8MA 2PXIA 4NLNA 4AYBF 5CA7A 4O3QA 2P35A 5KFVA 2LI6A 4YP3A 5J0UA 3HW8A 5DQGA 9ICQA 4NLKA 4J9LA 5C5JA 4JV2A 1BPBA 1IM4A 2ZTDA 4F4ZA 3M1YA 1ZQMA 4NL9A 3KHGA 5HR6A 5DDMA 3RB0A 5IIKA 2G5IB 3RH6A 3HJEA 4OJPA 3N4MB 2BPFA 4RPZA 2KICA 4YD2A 5IIMA 9ICXA 2OHFA 5AKZA 3VCBA 4XUSA 1TAQA 3BDPA 1IV8A 3K75D 4NLGA 3BQ2A 4KITB 2JH1A 1J97A 2D8CA 2KP7A 1ZQKA 5KG6A 4IR1A 2KSOA 2DFLA 4DFMA 7ICKA 2AQ0A 5HR7A 5EE1A 3HKZF 4KN7A 4F50A 5AK3A 3G6XA 5ALVA 3GDXA 2ZUBA 3ALRA 5EWFA 4F5NA 1K1QA 5DKWA 1NJZA 3ISBA 4YMMA 5IIOA 1N61A 4NLZA 2F3NA 5J2IA 1BPEA 2LM4A 3ONNA 5AK4A 1X9MA 4M9GA 4KX3A 5BOMA 2G06A 2N1RA 3G6VA 2F1JA 3KD3A 1L3VA 2K89A 4NXZA 2RLTA 3C2KA 5DBCA 4UB3A 7ICEA 9ICKA 5AKYA 1WWVA 2OCEA 2BCQA 1T4GA 5AM2A 2JGAA 3AU6A 2F76X 5KFIA 4DSIA 1ZQWA 4JUZA 1XO0A 3NVZA 1TVAA 3ISDA 3SYZA 3AN1A 2FPMA 1NK0A 1JX4A 3C29A 4UARA 2QB0B 1N56A 1O08A 4J9NA 2HHTA 2FE9A 1FIQA 3IHQB 4OO1J 1ZYQA 5KG3A 4IRCA 2NRXA 3HP6A 3JPRA 1X6JA 9ICPA 3M6KA 3HILA 2KV2A 3QXGA 2ZUCA 5KT3A 4R63A 4KLHA 3QX7A 4UW9A 8ICOA 2JEJA 4QIWC 1Z4NA 3ORYA 3QEAZ 2W9BB 2FPLA 5J0XA 8ICEA 4KLTA 4NM1A 2F1HA 4YFKA 1SWWA 1KFTA 1JI7A 4ED0A 1BPXA 5EWGA 9ICAA 4ECVA 3CYMA 4Y2VA 2IOFA 4RQMA 3RRHA 2Y1IA 3GIJA 4RQ8A 1NK8A 3UPQA 4YR0A 4NL9C 3BQ1A 4DL7A 1ZQOA 2Z7JA 5KT5A 4ECQA 9ICMA 1L3TA 5AKJA 1T8EA 4J9QA 3CNHA 4FS1A 2LHTA 2NO5A 1ZD2P 1QSYA 9ICUA 2JV3A 4DQIA 1U49A 2KHVA 1JROA 4F2SA 1AROP 1PVRA 2AGOA 4JV0A 3KKAC 2ZIUB 3PR4A 3MR5A 2XI9A 4B9UA 4C7YA 2IOHA 5EE0A 1H38A 1DOQA 5CJ7A 4PGXA 2ZIXA 1S0MA 2XIDA 3DEEA 2ISPA 4O3PA 2G08A 2YX8A 2YY6A 4ACOA 5HHHA 4J9RA 5KFFA 4YXMA 3GZFA 1N2XA 3AQEA 2J6UA 2C2EA 1D8YA 3TI0A 3ED5A 1Z3EB 4F4XA 3MR2A 2IBKA 3SEIA 3UMCA 9ICFA 2V4QA 1Q3VA 2QB0A 2ZJAA 3ZD8A 3EW9A 4O0IA 1XS9D 2IMWP 4P0PA 4DO9A 1QSSA 1ZQHA 4I2IA 2DQNB 1COKA 3WK9A 5HNKA 4PPXA 7ICGA 5AI4A 2HBMA 1B22A 4KLSA 3T79A 4B6JA 4DS5A 1JXLA 2W9BA 4NY8A 2WF6A 2LBOA 3RF9A 3M8SA 1MSWD 1XSPA 2K8BB 5KFNA 5KFEA 1VJ5A 1WCLA 5C0YA 1XNSA 9ICLA 1U48A 3H4DA 1X6IA 3EPGA 3TARA 3RBEA 4EELA 5J2JA 4C0ZA 5AKGA 4C4RA 1D8BA 2IOFK 1Z1BA 7ICPA 3AU2A 3TKAA 3LVVA 3M8RA 4DSFA 2EZZA 5ALJA 1UA0A 2GWSA 3H0RB 1SKWA 4AYBC 3F2BA 4KLOA 4I2AA 2IHNA 3C1YA 1SXDA 9ICJA 1SKRA 3PO5A 1DGSA 3FDSA 1NKEA 2NYVA 3D2NA 2F8LA 2H3ZA 2CRXA 2XCAA 3GFKB 3ZDDA 1OUQA 2G09A 4K4HA 3V6JA 1DK2A 1S8OA 3PSTA 4O9MA 4P4OA 3V7KA 1ZETA 2JZBB 1UCVA 1IIPA 2I1QA 8ICZA 5AKHA 4EBCA 1L8OA 4O3NA 2B21A 3N28A 1X40A 3A0BU 4MHVA 1MQ2A 7ICLA 4UATA 1TE2A 4ED2A 3OHAA 4Q45A 1B4FA 2BHNA 1P7DA 5TISU 4DFJA 2WTFA 1D9DA 3E0FA 2GOLA 3J81j 4QZDA 3NS1A 3JPPA 4M6WB 3RBDA 5KT6A 1UHUA 1ZQUA 2CN1A 2KMDA 4QWEA 3HKZC 5CB1A 2KD1A 2K4IA 5AI5A 2LYHA 3WK5A 5KFWA 4DQRA 3D2SA 2FLLA 3N97B 1SZHA 1XWLA 4O3SA 2DL0A 4Z6EA 5J0QA 2XGPA 5KFMA 1S10A 1ZQRA 5AM3A 2KJ5A 2D6FC 1SWVA 4XRHA 2K4PA 3L3FX 2MSNA 4EBEA 2AQ4A 2BCUA 4EBDA 4UB4A 3QUBA 4EEYA 1L3SA 3RB3A 3BQ0A 4YXJA 3V6HA 4Y2RA 1SL1A 4PZNA 5AKEA 2I5HA 4RUAA 1ZQVA 8ICHA 5ALUA 1L8LA 4Z6FA 4UAUA 3RR7A 1SKSA 1V97A 2BR0A 1U4BA 4XA5A 3F5AA 1L7MA 2E1FA 3D6JA 1C7YA 3R9KA 2H3IA 4M0AA 1JMSA 3BZKA 3OSNA 7ICJA 2R18A 1XSNA 2HDOA 3V6KA 5KFCA 1LVHA 3NVWA 2XY5A 4C80A 4P0QB 3UQ0A 9ICGA 4MFFA 2YB4A 3C5FA 4M9LA 4LZGA 2BQRA 1WG8A 4J9MA 3GV5B 3OPXA 2HHUA 2E3TA 5A0LA 3ICXA 1ZD3A 2JZBA 3FM9A 2EDUA 1RYSA 2B6GA 1RXVA 2XC9A 5DGBA 3C21A 1T3QA 2EQYA 1LV5A 9ICEA 4EX6A 1N60A 4RZRA 5DB6A 5DG7A 1ZQZA 4ED7A 9ICIA 3Q8PB 4JK1A 2K4EA 7ICOA 4QJFB 1S76D 1LB2B 5G5GA 2MRLA 5DLGA 4I2JA 4ECXA 2AH5A 1QH9A 4M6WA 9ICCA 4NLBA 1X66A 1KKXA 1COOA 4RNMA 1Y88A 3F5EA 4KLLA 1U47A 2LM1A 5ALPA 4YR2A 2VA2A 3MABA 2PFOA 1SL2A 4EZ6A 4EYIB 1ZQEA 2KKVA 3IG8A 2F8KA 4G9BA 2Y9UA 2XO7A 4BXOB 3H40A 4J9KA 4DQQA 1SV0C 4KLFA 1NK7A 2EAMA 1QCKA 2HSZA 9ICSA 4GXKA 3M7DA 4M04A 1CI4A 5KG7A 5ALQA 5KT7A 2RQ5A 8ICSA 3LK9A 1JXEA 4TUQA 2A3VA 1K5OA 1S97A 3GIMA 8ICBA 2E8MA 3PNCA 4GFJA 4Z6DA 5J0WA 5AI8A 4JB3A 2PFQA 4RQ1A 3Q8KA 3EYZA 1CRXA 2HHXA 2BDUA 4UAVA 2G07A 1YT3A 4P0QA 3ISCA 4DLGA 4KLUA 3V7JA 9ICTA 1ZQDA 2XVTA 3CRXA 2L5YA 3ZI4A 2KVSA 4J03A 1O03A 2XY7A 2FMPA 5ALMA 4J9SA 2KNJA 1TK0A 1V38A 4IC9A 1BGXT 1ZD5A 4U6PA 1JRPA 3KKAA 2OH2A 3PW2A
chains in the Genus database with same CATH topology
4LJXA 2LM1A 2JXJA 2CXYA 1KQQA 5CEHA 2EH9A 1IG6A 5K4LA 1RYUA 2RQ5A 2JRZA 2YQEA 1C20A 1KKXA 1KN5A 2KK0A 2EQYA 2OEHA 2LI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJX A;  2LM1 A;  2JXJ A;  2CXY A;  1KQQ A;  5CEH A;  2EH9 A;  1IG6 A;  5K4L A;  1RYU A;  2RQ5 A;  2JRZ A;  2YQE A;  1C20 A;  1KKX A;  1KN5 A;  2KK0 A;  2EQY A;  2OEH A;  2LI6 A; 
#chains in the Genus database with same CATH topology
 5KFZ A;  1NK6 A;  3OJU A;  5JUM A;  1FFV A;  5KT4 A;  3QU7 A;  2NO4 A;  5KTQ A;  5AKK A;  3LDA A;  4IR9 A;  5EE3 A;  2F77 X;  4PHE A;  5ALK A;  4PGY A;  8ICK A;  2UVW A;  3GQC A;  1TKD A;  4E0D A;  1J2M A;  5JTI A;  3PZP A;  3Q8M A;  2G0A A;  1S9F A;  3L5K A;  2G5H B;  2WF7 A;  3HT3 A;  4A8E A;  4TQR A;  4RUC A;  4RQ2 A;  4ECZ A;  3AUO A;  4M9N A;  5KFQ A;  4NJ8 A;  3N7P D;  2D3D A;  3KZI U;  5J29 A;  3AM9 A;  5AK6 A;  4F93 B;  1XC9 A;  4MF2 A;  4RQ7 A;  2ZIX B;  4BXO A;  8ICQ A;  4P4P A;  8ICC A;  1PZN A;  1UA1 A;  1S5L U;  3OSP A;  1ECW A;  5KFH A;  2OWO A;  3EPI A;  5AM5 A;  2QLT A;  5KFS A;  1ZQ1 C;  5KFL A;  2UVV A;  5KG1 A;  2EAN A;  5J2G A;  1FO4 A;  3MGV A;  4PZO A;  5EOZ A;  1Z19 A;  4YD1 A;  5CEH A;  2FPK A;  4MFA A;  4Y2U A;  1ZQA A;  2DBY A;  2FDR A;  3EUB 2;  4KLQ A;  4Z6C A;  3QZ8 A;  3C28 A;  3EWA A;  1A0P A;  4EX7 A;  3T3F A;  3SV4 A;  4YCX A;  4P2H A;  1CEZ A;  4P0P B;  5E79 U;  5D4B A;  4PGQ A;  3PSP A;  1Q3U A;  4YMO A;  5G5H A;  1Z4O A;  3F2D A;  1Z00 B;  8ICN A;  1SZP A;  2EAO A;  4CF5 A;  4CF4 A;  2DKZ A;  1RYU A;  4B9L A;  4RT3 A;  1ZQG A;  4F5Q A;  2Y1J A;  2KFZ A;  9ICO A;  4O3M A;  2I6X A;  3RAX A;  3NUQ A;  2KTQ A;  3BS5 B;  2ATL A;  3WKD A;  4BWJ A;  2XCP A;  4C8K A;  1TV9 A;  1PK3 A;  3JPT A;  2A19 A;  9ICH A;  2QKQ A;  1AQ6 A;  1V85 A;  3IM1 A;  5K4L A;  4IS7 A;  4KLI A;  2JR5 A;  2R8I A;  1LKY B;  3AQF A;  2C2D A;  1WCN A;  8ICL A;  1N5W A;  4DL4 A;  3SD7 A;  4F5R A;  3RFA A;  3N7S C;  5ALD A;  5CP2 A;  3MGH A;  1ZQF A;  3LVW A;  1ZQL A;  4FS2 A;  2HOQ A;  9ICR A;  3VC8 A;  1KLN A;  3MFH A;  4DSK A;  1RDF A;  4GC6 A;  2NRT A;  4DFP A;  2BDP A;  1ZRM A;  1L3U A;  1X2I A;  1N63 A;  5KFU A;  4OJ6 A;  4FBU A;  3QNM A;  5DQH A;  5ALE A;  2R8H A;  4C8O A;  1ZQN A;  4QW9 A;  2ISO A;  4ICA A;  4RQ5 A;  2PMZ F;  1NK4 A;  3ZDA A;  1KDH A;  4DL5 A;  4UB1 A;  4NWI A;  4DSJ A;  1S77 D;  1FFU A;  2Y0S F;  4F91 B;  2W8K A;  2GLE A;  8ICW A;  2ZJ5 A;  5KFJ A;  4PHD A;  1T7P A;  1RXW A;  3RB4 A;  1MN8 A;  2FJ6 A;  5BOL A;  1L7O A;  4I2B A;  5J0S A;  1Z00 A;  3PX4 A;  5J2E A;  3GII A;  2MU2 A;  1L5U A;  3IG5 A;  1F0M A;  5KFK A;  5DB7 A;  2W9A A;  2P6R A;  3PML A;  5KFT A;  7ICT A;  1ZJN A;  2ODG A;  1OW5 A;  2XGQ A;  2BZF A;  4I28 A;  3BS5 A;  2KKP A;  4C4T A;  8ICM A;  1DGJ A;  2EZY A;  2A1J B;  5GTH U;  2A1A A;  4TQS A;  3RB6 A;  4ECT A;  2HVI A;  3CP8 A;  1Q46 A;  3OHB A;  1Z1V A;  3WU2 U;  4QZ8 A;  5J2C A;  3GU3 A;  1LKY A;  3FYH A;  5TZV A;  5AKI A;  1ZQS A;  8ICV A;  8ICU A;  2YQE A;  2KZ3 A;  2KG5 A;  4JV1 A;  4F4W A;  2KFN A;  2ASL A;  4DOC A;  8ICX A;  2Q4T A;  4Y2P A;  2Y9T A;  1EXN A;  3PW7 A;  3KZX A;  8ICF A;  4ECW A;  4I29 A;  1DK3 A;  1NZP A;  3TAP A;  2BGW A;  2IHM A;  3PW4 A;  4IRD A;  3H8W A;  4QZE A;  3SZ2 A;  1HUZ A;  4USA A;  3M6Z A;  4TUR A;  3PW0 A;  4YR3 A;  3T5K A;  1A6S A;  3C1Z A;  2JEI A;  3HWT A;  1MQ3 A;  3RTV A;  4Q8E A;  3T5J A;  1L7P A;  3ZD9 A;  1Q8K A;  4KLD A;  5EWE A;  2QB1 A;  1C20 A;  5AM4 A;  5ALZ A;  1VLB A;  4DL3 A;  2RDI A;  4C8M A;  4RQ4 A;  2H3V A;  3Q8S B;  5B5E U;  5KFR A;  1A77 A;  2DF4 B;  3SAF A;  5ALF A;  2KJ8 A;  4F3O A;  4DSE A;  1SV0 A;  4GIB A;  3MFI A;  4MFC A;  1PK1 B;  2EZX A;  1FEZ A;  4M9J A;  1ZQT A;  2UVU A;  3MDC A;  4F2R A;  2MA1 A;  3UMB A;  4C4S A;  3RJI A;  4RPY A;  4ED3 A;  5F9L A;  5CHG A;  4YMN A;  1NZB A;  5T14 A;  3NVV A;  3RJE A;  3SAH A;  5DB9 A;  3H0M B;  5AHX A;  2H5X A;  5IIL A;  4DQS A;  4RQN A;  2A1J A;  4OJL A;  3KTQ A;  9ICW A;  5KFX A;  1KN5 A;  5CWR A;  1B43 A;  3KHH A;  5KFA A;  1OXJ A;  3BJY A;  3ETL A;  4DSL A;  2PI4 A;  5KFP A;  3KHL A;  3NGD A;  4DWI A;  2LYA A;  4RU9 A;  3E2E A;  3OJS A;  7ICF A;  2HHQ A;  2HHS A;  2V9W A;  2E1E A;  1JIH A;  2YMQ A;  2V4R A;  2E8P A;  1WWU A;  4Y2Q A;  3RJG A;  5KT2 A;  5GTI U;  1S0O A;  4LJX A;  1L7N A;  3WK8 A;  3SAG A;  2PFN A;  5B66 U;  2F44 A;  2WAQ F;  5J0Y A;  4UBB A;  4TUP A;  2W03 A;  3UMG A;  5ALX A;  3BZC A;  3M9N B;  5ALW A;  1X9X A;  5ALI A;  1RM6 C;  8ICI A;  5DG8 A;  4I2F A;  2AHO B;  4QZ9 A;  1ZQI A;  1RPL A;  2OXO A;  4GC7 A;  2YTU A;  4BUG A;  1XO1 A;  1UT5 A;  3RH4 A;  5D49 A;  4R65 A;  2VA8 A;  2HBJ A;  2HBK A;  1MA7 A;  3B9J A;  2HOF A;  5ALO A;  5KAF U;  4G3I A;  1RQN A;  4JWN A;  3C5G A;  3QU2 A;  4I2E A;  3BS7 A;  3EZ5 A;  4QZG A;  2LYB A;  3Q8Q B;  4Q8F A;  4Q43 A;  1TAU A;  4JMU A;  1PK1 A;  1NOM A;  1TK5 A;  5HMM A;  2JXJ A;  8ICP A;  4F4Y A;  4AP9 A;  4DS4 A;  4KLM A;  4M47 A;  5J0T A;  2W04 A;  4MEY A;  2VIX A;  3H8J A;  2C22 A;  4B9S A;  3NVY A;  3Q8R B;  2B0C A;  5KL1 B;  5KAI U;  5DLF A;  2FLP A;  4CF3 A;  3OGU A;  2XIC A;  1XSL A;  4RQ0 A;  2HBL A;  2HVH A;  2HHV A;  1S0V A;  1MC8 A;  5KFB A;  3V72 A;  1KRP A;  3PV8 A;  3OTQ A;  4KMO B;  4MF8 A;  3C23 A;  7ICH A;  1JN3 A;  2UVR A;  1U9L A;  2LPE A;  2KK0 A;  3QE9 Y;  4YN4 A;  4C8L A;  5L1K A;  5CR0 A;  5FP0 A;  2K8A A;  2Y0S C;  2KOB A;  9ICV A;  1QQ5 A;  5DDY A;  4IQT A;  2W9C B;  5KG5 A;  4QWD A;  2WF9 A;  3IDW A;  1XU4 A;  4KX5 A;  3I1Y A;  2YMM A;  1NI3 A;  3ETR A;  2KEY A;  1KEJ A;  5HHI A;  4BX9 C;  2PFP A;  5D46 A;  1RZT A;  1ZXI A;  2ZG6 A;  4KMU A;  4FO6 A;  4YQW A;  3H0L B;  8ICJ A;  5HML A;  1ZQY A;  4UB6 U;  2XY6 A;  1URJ A;  4BGD A;  2R8G A;  4I27 A;  4DFD A;  3WKC A;  1RYR A;  4DEZ A;  2ZUD A;  3SV3 A;  2QAR B;  4NM2 A;  4QWA A;  4B9M A;  2ALZ A;  1NKB A;  2BCS A;  3WK4 A;  2ZXH A;  4I2G A;  1SIJ A;  2WF5 A;  3KBB A;  3K1Z A;  4EEK A;  1QSL A;  4CDG A;  4O3R A;  3F53 A;  4CCH A;  2HCF A;  2OYY A;  5J2H A;  5ALS A;  1ZQJ A;  3A0H U;  1KSP A;  4DF4 A;  1A76 A;  4ED8 A;  2H3F A;  4WJ3 B;  4O3O A;  7ICR A;  3RJF A;  5J0R A;  3NRW A;  3NRZ A;  5AI9 A;  3HPO A;  3MBY A;  3T5H A;  5AI0 A;  2NRZ A;  2RHF A;  1N62 A;  4QZI A;  8ICG A;  3MC1 A;  4DFK A;  2LMR A;  3WKA A;  3RAQ A;  5DB8 A;  3JPS A;  3CW2 C;  2BPG A;  4DOB A;  1ZD4 A;  1NJX A;  2CPR A;  3LYS A;  2YML A;  1D8L A;  3PX0 A;  2ZIW B;  5JU5 A;  1T94 A;  4UAZ A;  4J9O A;  3RJH A;  4I2D A;  5ALR A;  4DCC A;  3QUC A;  5AM1 A;  1ED1 A;  3HX0 A;  2EAP A;  3MR3 A;  5F3X B;  1YZ6 A;  3JPO A;  2BQ3 A;  3UQ2 A;  3ZDB A;  2NV3 A;  3PR5 B;  2AU0 A;  2HW3 A;  3O0F A;  7ICV A;  4QZH A;  1BPD A;  2W3S A;  2W9C A;  2BKE A;  2OM6 A;  4XQ8 A;  4RNO A;  2FI1 A;  3L4P A;  4M9H A;  1RQL A;  3UM9 A;  1GO3 F;  4PL1 A;  4EZ9 A;  2MUT B;  5L9X A;  4B9V A;  3JPN A;  2WHE A;  4JWM A;  4ZH4 A;  4GLX A;  5ALL A;  4HYK A;  5L1I A;  4B9N A;  4F5O A;  1F5S A;  4DLE A;  4HAI A;  3MGI A;  3UXP A;  5CRX A;  2VA3 A;  1JUD A;  5ALN A;  2DPJ A;  4FE3 A;  3SMV A;  1UQV A;  2QAR A;  3M9O B;  4ED6 A;  3IV6 A;  4QZF A;  4RNN A;  1HUO A;  1SB3 C;  5J2K A;  1JAL A;  4DL2 A;  4YVZ A;  2BQU A;  4EEN A;  1KFS A;  1VDV A;  4RQ3 A;  3TAD A;  2WB1 F;  1KQQ A;  5KNI A;  3RR8 A;  3ZDE A;  2KIW A;  4C7Z A;  4CRX A;  4Q44 A;  2J6T A;  3D2Q A;  2C28 A;  5J8Y A;  5J2D A;  1QQ7 A;  4NV0 A;  2I9G A;  4OJO A;  4ECY A;  4LVS A;  1KBU A;  5J2A A;  2P6U A;  2KZM A;  4ED1 A;  2DWQ A;  1N48 A;  5L1M A;  2KE7 A;  4Y2Y A;  5KG4 A;  2VKQ A;  2O6K A;  4KLE A;  2DGZ A;  2AGQ A;  5ALT A;  2ZXI A;  1IG6 A;  4RQ6 A;  3PSI A;  3TAQ A;  1S0N A;  2WAQ C;  3SI8 A;  1NK9 A;  4QNL A;  4F92 B;  5AIB A;  4BWM A;  2ZIW A;  4ZOH C;  3MDA A;  1BPY A;  8ICA A;  4IQU A;  2ZTE A;  4FBT A;  5J2F A;  7ICI A;  4UB2 A;  5DQI A;  2RP5 A;  4R8U B;  5IIN A;  3V7L A;  3FAH A;  2F1I A;  5F9N A;  4UAW A;  4U7C A;  2IA6 A;  1UT8 A;  4ECR A;  2LKY A;  3TQ1 A;  1BNP A;  2KN7 A;  5ALY A;  5EE9 A;  1F44 A;  4ECU A;  1B0X A;  2MUT A;  5J2B A;  2ZTC A;  3IP4 B;  3NTU A;  4RT2 A;  2AXT U;  3QU9 A;  2JRZ A;  3QZ7 A;  1L6N A;  2K60 A;  3TAC B;  1PUZ A;  1ZQB A;  4Y2X A;  3NAS A;  9ICB A;  1X9S A;  3N7R C;  4FZN A;  5L1L A;  3WKB A;  9ICN A;  4BJQ A;  4K4G A;  5KG2 A;  4CNQ A;  1DXS A;  5KFD A;  4FZL A;  5AM0 A;  1TFR A;  1SGG A;  3TFR A;  4GXJ A;  1TK8 A;  1ZJM A;  1X42 A;  5DGA A;  3KFU F;  2VJ4 A;  5DBB A;  5AI6 A;  1V9P A;  4CE6 A;  4KLG A;  2JHD A;  4UAS A;  2WFA A;  4QZC A;  5J0O A;  2W55 A;  3KOO A;  2W11 A;  5IIJ A;  2W8L A;  5DG9 A;  1NJY A;  5AKL A;  2H3Q A;  1ZQQ A;  1K1S A;  1KFD A;  2GH1 A;  3TAD C;  3PY8 A;  4KN4 A;  2JEF A;  3H7I A;  3QU4 A;  3S6J A;  3GIK A;  1PVP A;  3GIL A;  2ZIU A;  5III A;  7ICS A;  5KFG A;  2ZIV B;  3E58 A;  3PMN A;  5ALH A;  2K8C B;  3F2C A;  5J8Y C;  4UB8 U;  3QUQ A;  3IRU A;  1SL0 A;  4P4M A;  5J0P A;  5KL8 B;  1X9W A;  2VAN A;  7ICM A;  4OD0 A;  4I2H A;  4PHP A;  1M6Y A;  5KFO A;  4O5C A;  3QYP A;  4R8U A;  3AMZ A;  2Q0Z X;  3LWL A;  1QLN A;  4CGZ A;  4QZA A;  3AEV A;  3THV A;  4ELV A;  3UXO A;  3FC4 A;  1QQ6 A;  2KJ9 A;  1WYG A;  4LZD A;  1U45 A;  2DKX A;  1SXE A;  1ZQC A;  2WF8 A;  1IXR A;  2FMS A;  2BCV A;  3QUT A;  1ZOL A;  3QU5 A;  4PJ0 U;  3U26 A;  1NK5 A;  4F8R A;  5DBA A;  1J2N A;  1SV4 A;  2YN4 A;  2KHQ A;  1UPH A;  4R64 A;  4UAY A;  2W3R A;  3M9M B;  4QW8 A;  3SR6 A;  1KW4 A;  4QIW F;  3RH5 A;  5AIC A;  4TUS A;  5ALG A;  2W54 A;  3AL0 B;  2BPC A;  1NJW A;  2NRW A;  2FMQ A;  2RRD A;  3DV9 A;  4US8 A;  3BQT A;  4K4I A;  4J9P A;  2AJQ A;  4KLJ A;  3H8S A;  4BDP A;  1NNL A;  4OCZ A;  2F2A B;  4ECS A;  2FLN A;  4US9 A;  4GXI A;  7ICQ A;  4ELU A;  3PO4 A;  3K1R B;  2NRV A;  4I2C A;  4IRK A;  4YG2 A;  4IL6 U;  4IQV A;  3T5L A;  1D9F A;  2JH7 A;  3G6Y A;  3HRD D;  5L1J A;  4O5K A;  1N5X A;  4RPX A;  3PW5 A;  3WK6 A;  1HEK A;  1KL9 A;  4F71 A;  3B0Y A;  1QTM A;  7ICU A;  3IN5 A;  2ZJ8 A;  4UBC A;  2DPI A;  2GO7 A;  2JEG A;  2W9M A;  2R8K A;  4Y2J A;  8ICY A;  2DUY A;  2KIV A;  1DRG A;  4UQG A;  3K4G A;  4DL6 A;  4O5E A;  3GV7 B;  2ZIV A;  2KVC A;  2R8J A;  1WUD A;  1BNO A;  4F4K A;  5KG0 A;  2W43 A;  1BVS A;  7ICN A;  4QZB A;  3LWM A;  4IQW A;  1ZQP A;  3RJJ A;  4DQP A;  2AGP A;  3DDH A;  4UB5 A;  4PH5 A;  4EYH B;  5H2F U;  2PI5 A;  3RRG A;  2OEH A;  3C2L A;  2KSO B;  2ASD A;  4NLC A;  4DF8 A;  4B9T A;  3PVX A;  5KFY A;  2JMG A;  3MR6 A;  2W7O A;  3KHR A;  2VJ5 A;  1ZQX A;  3B0X A;  3WKE A;  2WB1 C;  3I28 A;  3JPQ A;  3SQI A;  1PVQ A;  4Y2T A;  3PSF A;  2PKE A;  2ES6 A;  4PHA A;  4R66 A;  2K4H A;  3UXN A;  2HI0 A;  2BCR A;  5AK5 A;  2HMX A;  1BPZ A;  1HJP A;  4C8N A;  5HP4 A;  3TAN A;  1TAM A;  4QWB A;  2E5S A;  4F5P A;  5BPC A;  3BQ7 A;  2YMP A;  1KTQ A;  1RG6 A;  4DOA A;  1YZ7 A;  2CXY A;  2J6S A;  2EH9 A;  4PL2 A;  2P66 A;  8ICR A;  3H4B A;  4FFD A;  3RJK A;  4M2Y A;  3SEN A;  4Y2S A;  2C2R A;  2HHW A;  4ELT A;  4F72 A;  1NKC A;  3GV8 B;  5AIA A;  2ASJ A;  8ICT A;  3Q8L A;  3C2M A;  2ESE A;  4X5V A;  2E8O A;  2RDJ A;  4MEX A;  2M0N A;  1ZRN A;  2PMZ C;  1T3N A;  2KZZ A;  2MAX A;  4FZM A;  4KTQ A;  1CUK A;  2YB1 A;  5JRT A;  3ZDC A;  2HOI A;  1HIW A;  3TFS A;  3WK7 A;  2M9N A;  3PX6 A;  3QEB Z;  5AKX A;  4QWC A;  2E8N A;  3I76 A;  2W7P A;  4OJ5 A;  3H8M A;  2PXI A;  4NLN A;  4AYB F;  5CA7 A;  4O3Q A;  2P35 A;  5KFV A;  2LI6 A;  4YP3 A;  5J0U A;  3HW8 A;  5DQG A;  9ICQ A;  4NLK A;  4J9L A;  5C5J A;  4JV2 A;  1BPB A;  1IM4 A;  2ZTD A;  4F4Z A;  3M1Y A;  1ZQM A;  4NL9 A;  3KHG A;  5HR6 A;  5DDM A;  3RB0 A;  5IIK A;  2G5I B;  3RH6 A;  3HJE A;  4OJP A;  3N4M B;  2BPF A;  4RPZ A;  2KIC A;  4YD2 A;  5IIM A;  9ICX A;  2OHF A;  5AKZ A;  3VCB A;  4XUS A;  1TAQ A;  3BDP A;  1IV8 A;  3K75 D;  4NLG A;  3BQ2 A;  4KIT B;  2JH1 A;  1J97 A;  2D8C A;  2KP7 A;  1ZQK A;  5KG6 A;  4IR1 A;  2KSO A;  2DFL A;  4DFM A;  7ICK A;  2AQ0 A;  5HR7 A;  5EE1 A;  3HKZ F;  4KN7 A;  4F50 A;  5AK3 A;  3G6X A;  5ALV A;  3GDX A;  2ZUB A;  3ALR A;  5EWF A;  4F5N A;  1K1Q A;  5DKW A;  1NJZ A;  3ISB A;  4YMM A;  5IIO A;  1N61 A;  4NLZ A;  2F3N A;  5J2I A;  1BPE A;  2LM4 A;  3ONN A;  5AK4 A;  1X9M A;  4M9G A;  4KX3 A;  5BOM A;  2G06 A;  2N1R A;  3G6V A;  2F1J A;  3KD3 A;  1L3V A;  2K89 A;  4NXZ A;  2RLT A;  3C2K A;  5DBC A;  4UB3 A;  7ICE A;  9ICK A;  5AKY A;  1WWV A;  2OCE A;  2BCQ A;  1T4G A;  5AM2 A;  2JGA A;  3AU6 A;  2F76 X;  5KFI A;  4DSI A;  1ZQW A;  4JUZ A;  1XO0 A;  3NVZ A;  1TVA A;  3ISD A;  3SYZ A;  3AN1 A;  2FPM A;  1NK0 A;  1JX4 A;  3C29 A;  4UAR A;  2QB0 B;  1N56 A;  1O08 A;  4J9N A;  2HHT A;  2FE9 A;  1FIQ A;  3IHQ B;  4OO1 J;  1ZYQ A;  5KG3 A;  4IRC A;  2NRX A;  3HP6 A;  3JPR A;  1X6J A;  9ICP A;  3M6K A;  3HIL A;  2KV2 A;  3QXG A;  2ZUC A;  5KT3 A;  4R63 A;  4KLH A;  3QX7 A;  4UW9 A;  8ICO A;  2JEJ A;  4QIW C;  1Z4N A;  3ORY A;  3QEA Z;  2W9B B;  2FPL A;  5J0X A;  8ICE A;  4KLT A;  4NM1 A;  2F1H A;  4YFK A;  1SWW A;  1KFT A;  1JI7 A;  4ED0 A;  1BPX A;  5EWG A;  9ICA A;  4ECV A;  3CYM A;  4Y2V A;  2IOF A;  4RQM A;  3RRH A;  2Y1I A;  3GIJ A;  4RQ8 A;  1NK8 A;  3UPQ A;  4YR0 A;  4NL9 C;  3BQ1 A;  4DL7 A;  1ZQO A;  2Z7J A;  5KT5 A;  4ECQ A;  9ICM A;  1L3T A;  5AKJ A;  1T8E A;  4J9Q A;  3CNH A;  4FS1 A;  2LHT A;  2NO5 A;  1ZD2 P;  1QSY A;  9ICU A;  2JV3 A;  4DQI A;  1U49 A;  2KHV A;  1JRO A;  4F2S A;  1ARO P;  1PVR A;  2AGO A;  4JV0 A;  3KKA C;  2ZIU B;  3PR4 A;  3MR5 A;  2XI9 A;  4B9U A;  4C7Y A;  2IOH A;  5EE0 A;  1H38 A;  1DOQ A;  5CJ7 A;  4PGX A;  2ZIX A;  1S0M A;  2XID A;  3DEE A;  2ISP A;  4O3P A;  2G08 A;  2YX8 A;  2YY6 A;  4ACO A;  5HHH A;  4J9R A;  5KFF A;  4YXM A;  3GZF A;  1N2X A;  3AQE A;  2J6U A;  2C2E A;  1D8Y A;  3TI0 A;  3ED5 A;  1Z3E B;  4F4X A;  3MR2 A;  2IBK A;  3SEI A;  3UMC A;  9ICF A;  2V4Q A;  1Q3V A;  2QB0 A;  2ZJA A;  3ZD8 A;  3EW9 A;  4O0I A;  1XS9 D;  2IMW P;  4P0P A;  4DO9 A;  1QSS A;  1ZQH A;  4I2I A;  2DQN B;  1COK A;  3WK9 A;  5HNK A;  4PPX A;  7ICG A;  5AI4 A;  2HBM A;  1B22 A;  4KLS A;  3T79 A;  4B6J A;  4DS5 A;  1JXL A;  2W9B A;  4NY8 A;  2WF6 A;  2LBO A;  3RF9 A;  3M8S A;  1MSW D;  1XSP A;  2K8B B;  5KFN A;  5KFE A;  1VJ5 A;  1WCL A;  5C0Y A;  1XNS A;  9ICL A;  1U48 A;  3H4D A;  1X6I A;  3EPG A;  3TAR A;  3RBE A;  4EEL A;  5J2J A;  4C0Z A;  5AKG A;  4C4R A;  1D8B A;  2IOF K;  1Z1B A;  7ICP A;  3AU2 A;  3TKA A;  3LVV A;  3M8R A;  4DSF A;  2EZZ A;  5ALJ A;  1UA0 A;  2GWS A;  3H0R B;  1SKW A;  4AYB C;  3F2B A;  4KLO A;  4I2A A;  2IHN A;  3C1Y A;  1SXD A;  9ICJ A;  1SKR A;  3PO5 A;  1DGS A;  3FDS A;  1NKE A;  2NYV A;  3D2N A;  2F8L A;  2H3Z A;  2CRX A;  2XCA A;  3GFK B;  3ZDD A;  1OUQ A;  2G09 A;  4K4H A;  3V6J A;  1DK2 A;  1S8O A;  3PST A;  4O9M A;  4P4O A;  3V7K A;  1ZET A;  2JZB B;  1UCV A;  1IIP A;  2I1Q A;  8ICZ A;  5AKH A;  4EBC A;  1L8O A;  4O3N A;  2B21 A;  3N28 A;  1X40 A;  3A0B U;  4MHV A;  1MQ2 A;  7ICL A;  4UAT A;  1TE2 A;  4ED2 A;  3OHA A;  4Q45 A;  1B4F A;  2BHN A;  1P7D A;  5TIS U;  4DFJ A;  2WTF A;  1D9D A;  3E0F A;  2GOL A;  3J81 j;  4QZD A;  3NS1 A;  3JPP A;  4M6W B;  3RBD A;  5KT6 A;  1UHU A;  1ZQU A;  2CN1 A;  2KMD A;  4QWE A;  3HKZ C;  5CB1 A;  2KD1 A;  2K4I A;  5AI5 A;  2LYH A;  3WK5 A;  5KFW A;  4DQR A;  3D2S A;  2FLL A;  3N97 B;  1SZH A;  1XWL A;  4O3S A;  2DL0 A;  4Z6E A;  5J0Q A;  2XGP A;  5KFM A;  1S10 A;  1ZQR A;  5AM3 A;  2KJ5 A;  2D6F C;  1SWV A;  4XRH A;  2K4P A;  3L3F X;  2MSN A;  4EBE A;  2AQ4 A;  2BCU A;  4EBD A;  4UB4 A;  3QUB A;  4EEY A;  1L3S A;  3RB3 A;  3BQ0 A;  4YXJ A;  3V6H A;  4Y2R A;  1SL1 A;  4PZN A;  5AKE A;  2I5H A;  4RUA A;  1ZQV A;  8ICH A;  5ALU A;  1L8L A;  4Z6F A;  4UAU A;  3RR7 A;  1SKS A;  1V97 A;  2BR0 A;  1U4B A;  4XA5 A;  3F5A A;  1L7M A;  2E1F A;  3D6J A;  1C7Y A;  3R9K A;  2H3I A;  4M0A A;  1JMS A;  3BZK A;  3OSN A;  7ICJ A;  2R18 A;  1XSN A;  2HDO A;  3V6K A;  5KFC A;  1LVH A;  3NVW A;  2XY5 A;  4C80 A;  4P0Q B;  3UQ0 A;  9ICG A;  4MFF A;  2YB4 A;  3C5F A;  4M9L A;  4LZG A;  2BQR A;  1WG8 A;  4J9M A;  3GV5 B;  3OPX A;  2HHU A;  2E3T A;  5A0L A;  3ICX A;  1ZD3 A;  2JZB A;  3FM9 A;  2EDU A;  1RYS A;  2B6G A;  1RXV A;  2XC9 A;  5DGB A;  3C21 A;  1T3Q A;  2EQY A;  1LV5 A;  9ICE A;  4EX6 A;  1N60 A;  4RZR A;  5DB6 A;  5DG7 A;  1ZQZ A;  4ED7 A;  9ICI A;  3Q8P B;  4JK1 A;  2K4E A;  7ICO A;  4QJF B;  1S76 D;  1LB2 B;  5G5G A;  2MRL A;  5DLG A;  4I2J A;  4ECX A;  2AH5 A;  1QH9 A;  4M6W A;  9ICC A;  4NLB A;  1X66 A;  1KKX A;  1COO A;  4RNM A;  1Y88 A;  3F5E A;  4KLL A;  1U47 A;  2LM1 A;  5ALP A;  4YR2 A;  2VA2 A;  3MAB A;  2PFO A;  1SL2 A;  4EZ6 A;  4EYI B;  1ZQE A;  2KKV A;  3IG8 A;  2F8K A;  4G9B A;  2Y9U A;  2XO7 A;  4BXO B;  3H40 A;  4J9K A;  4DQQ A;  1SV0 C;  4KLF A;  1NK7 A;  2EAM A;  1QCK A;  2HSZ A;  9ICS A;  4GXK A;  3M7D A;  4M04 A;  1CI4 A;  5KG7 A;  5ALQ A;  5KT7 A;  2RQ5 A;  8ICS A;  3LK9 A;  1JXE A;  4TUQ A;  2A3V A;  1K5O A;  1S97 A;  3GIM A;  8ICB A;  2E8M A;  3PNC A;  4GFJ A;  4Z6D A;  5J0W A;  5AI8 A;  4JB3 A;  2PFQ A;  4RQ1 A;  3Q8K A;  3EYZ A;  1CRX A;  2HHX A;  2BDU A;  4UAV A;  2G07 A;  1YT3 A;  4P0Q A;  3ISC A;  4DLG A;  4KLU A;  3V7J A;  9ICT A;  1ZQD A;  2XVT A;  3CRX A;  2L5Y A;  3ZI4 A;  2KVS A;  4J03 A;  1O03 A;  2XY7 A;  2FMP A;  5ALM A;  4J9S A;  2KNJ A;  1TK0 A;  1V38 A;  4IC9 A;  1BGX T;  1ZD5 A;  4U6P A;  1JRP A;  3KKA A;  2OH2 A;  3PW2 A; 
#chains in the Genus database with same CATH homology
 4LJX A;  2LM1 A;  2JXJ A;  2CXY A;  1KQQ A;  5CEH A;  2EH9 A;  1IG6 A;  5K4L A;  1RYU A;  2RQ5 A;  2JRZ A;  2YQE A;  1C20 A;  1KKX A;  1KN5 A;  2KK0 A;  2EQY A;  2OEH A;  2LI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...