1C20A

Solution structure of the dna-binding domain from the dead ringer protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAAFTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DNA binding domain from Dead ringer, a sequence-specific AT-rich interaction domain (ARID).
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords DEAD RINGER PROTEIN
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1c20A00
4LJXA 2LM1A 1KQQA 2OEHA 2KK0A 5CEHA 2JRZA 1KN5A 1KKXA 2RQ5A 1IG6A 2JXJA 1C20A 2LI6A 5K4LA 1RYUA 2CXYA 2EQYA 2EH9A 2YQEA
chains in the Genus database with same CATH superfamily
1QCKA 4NM2A 3F2BA 1TVAA 1C7YA 3A0BU 4P2HA 5IIOA 2KIWA 2AGQA 1BPZA 5J0QA 1NK6A 1NK0A 3V6KA 5J2JA 3NVYA 4YXJA 5ALMA 4U6PA 3KKAC 2XVTA 3V7KA 3WKBA 2F1HA 4PHDA 1J2MA 4DQSA 3F2DA 5DB7A 2JZBB 3PSPA 2MA1A 9ICRA 2FMPA 1SXEA 4PL2A 5F9LA 2KSOB 2K8AA 4I2JA 5AKGA 9ICBA 1J97A 1N61A 3IRUA 4B9LA 1D8BA 3RJHA 4A8EA 1RQNA 1HEKA 2BQUA 1D9FA 4P4MA 2RDJA 2FJ6A 1L3TA 1XSLA 4Q8FA 1QH9A 1NKBA 3L3FX 4DF4A 1HUZA 5KG1A 3KZIU 7ICQA 1NJXA 2R8JA 3RB0A 5F9NA 2HSZA 4QIWC 5B66U 4IQVA 3GFKB 4KLFA 3PX0A 2OWOA 4QZEA 1T4GA 5J0TA 2Y1JA 5AKJA 4DOAA 4FZNA 3SEIA 3C5GA 2ES6A 9ICFA 3C2LA 4YQWA 2JEGA 1NJWA 5ALSA 2NRTA 5J2EA 4CDGA 1N5XA 9ICKA 4F5OA 1VLBA 5L1JA 4PHPA 1TE2A 4F5NA 4GFJA 2RQ5A 3IDWA 1DOQA 3Q8QB 2GO7A 1QSLA 5KFJA 1ZYQA 5DQGA 8ICUA 4DSJA 3VCBA 3CNHA 3C29A 3BZCA 4NV0A 5AKEA 4NLZA 2BHNA 2PMZF 1H38A 5CJ7A 1SZHA 4KITB 3QUTA 2KFNA 5L9XA 3HJEA 4BXOB 4O3OA 4JV2A 4YXMA 4MEXA 9ICCA 4RQ2A 4BWMA 4QWAA 4M0AA 2R18A 2YN4A 4FFDA 3ZDDA 2JEFA 1PVRA 1SV0C 1ZQUA 4ED8A 2R8KA 2IBKA 2B6GA 3B0YA 1F44A 3TAQA 3KHRA 9ICJA 4OJOA 1ZQIA 4M9NA 2HBLA 3ZDAA 4ELTA 4JV0A 1X9MA 4I2BA 1SV4A 4P4OA 3GV8B 4MHVA 1X42A 2DWQA 2ZIVB 2YY6A 2NO5A 4P0QB 4FBUA 3D2NA 4YVZA 5KAFU 5BOMA 3TANA 4RUAA 4O3SA 2ZJAA 2K8BB 2YB1A 8ICAA 1V97A 5AM5A 2A1AA 1M6YA 2Z7JA 5EE1A 1BPEA 5AM1A 1WWUA 4QZBA 4ED3A 5KG5A 1HUOA 5DG7A 1S0MA 5DG8A 8ICYA 5L1LA 1RYSA 1PVQA 4FS1A 2QKQA 4XA5A 4YR3A 3IM1A 1CI4A 5KT7A 1EXNA 3NRWA 2FMQA 2KICA 2LPEA 1KFTA 5KFYA 5ALNA 2HVHA 4QZAA 2WF8A 5AI6A 3EPGA 4ECTA 5DG9A 4UATA 1DRGA 4RQ7A 2ZIXA 1BNPA 3PSIA 4IQTA 5J8YA 2ZIVA 4C8MA 5DGAA 2JZBA 1PK1B 3NGDA 3LVVA 3ZI4A 8ICNA 3RBEA 2FPMA 3V72A 1NZBA 2XGQA 4PJ0U 3AQEA 5JU5A 2W43A 1KQQA 7ICIA 3QZ8A 3SR6A 2IMWP 3IHQB 3PO4A 1KEJA 3SYZA 2MUTB 2WB1F 1A6SA 1URJA 5KT3A 5KL1B 1Z00A 2KHQA 3SQIA 2KIVA 4TQRA 1DK3A 4EEYA 4KLHA 2DL0A 4DCCA 1MQ2A 2JV3A 1JN3A 2NYVA 3SMVA 3H7IA 2KZ3A 2H3FA 3G6XA 2ALZA 2V4RA 2WHEA 3TQ1A 2ZIUB 8ICJA 1B4FA 1X9XA 2G5HB 2E1EA 3JPRA 4EELA 8ICEA 4ECZA 5CHGA 2PFPA 3RJFA 1KRPA 2E8MA 3QE9Y 4FE3A 1K1QA 3FYHA 1K5OA 4C4TA 4RQ6A 4M9JA 5ALXA 4J9NA 2KG5A 4B9UA 1XNSA 2MUTA 7ICRA 4B9TA 1PK1A 1KBUA 3EW9A 4IRDA 1U48A 5EWFA 4C7ZA 4ECVA 5AM4A 3T5HA 3JPOA 2ZUDA 3RB3A 4TUPA 1A76A 4RQ4A 5KFWA 3AUOA 4B9SA 1IV8A 4QWEA 4RQ8A 3DEEA 4MFFA 2ZXIA 5CB1A 4FZMA 1V38A 5ALFA 5KFPA 3QEBZ 2OXOA 2W9CB 2XGPA 4OJ5A 3QU2A 1NZPA 2KE7A 5KFAA 2CXYA 4J9SA 3H8MA 1JMSA 2OYYA 1SWWA 5H2FU 4M9HA 3RH6A 5AK4A 1TV9A 4RQ0A 4KLQA 1SV0A 1ZQSA 2PI4A 3JPPA 5AHXA 1T8EA 1X6IA 1DK2A 3NS1A 5KFOA 1SGGA 4OD0A 2KTQA 1L7OA 4RNMA 4Y2VA 1J2NA 2W55A 2CRXA 4HAIA 5ALUA 2A19A 1PUZA 2F2AB 8ICRA 3RH5A 2RRDA 4Y2JA 3PSTA 2QB0B 2HOIA 2W9CA 2EDUA 2JH7A 8ICCA 4C4RA 8ICIA 4F2SA 5J2BA 5IIMA 4PZNA 5AKYA 4DF8A 4AYBC 4F4ZA 2RLTA 4UAUA 3K75D 2IOHA 4QIWF 2V4QA 8ICOA 1XO1A 2Y1IA 2ATLA 3C21A 4UB5A 7ICJA 4PH5A 5KG7A 1ECWA 9ICQA 3AL0B 5KFHA 2H3QA 2HDOA 2P6RA 2WAQC 3KOOA 1NI3A 1X40A 1DXSA 4QZHA 1NK5A 3NTUA 2UVVA 3KHGA 2IHNA 1UQVA 4DSIA 5AI9A 2PI5A 3AQFA 2F77X 2JH1A 2DFLA 2KKVA 4EX7A 3KBBA 4QZFA 4F2RA 3H8WA 1U49A 9ICHA 1XU4A 1NK8A 2DKZA 4NWIA 3OJUA 1HIWA 4KLEA 4QWCA 5AKKA 3QUBA 4BDPA 2QB0A 4O5KA 1ZQFA 3WKDA 3DDHA 1QSSA 3PNCA 1ZQAA 2LYHA 3DV9A 4TQSA 2WF6A 4F4XA 2ASLA 4KX3A 4PGYA 4IRKA 1XWLA 3WK8A 5L1IA 2I9GA 2ZIWB 4KMOB 2W3SA 9ICNA 2LM4A 2BCUA 1MN8A 1N5WA 4R63A 2KMDA 3ISDA 2WTFA 1RYUA 3N97B 2DUYA 8ICGA 2BPCA 1LV5A 1NNLA 2KV2A 4K4HA 1N60A 5EE9A 4Y2XA 4UB3A 5ALVA 2KVCA 4BX9C 5KFLA 4IR1A 3J81j 1FIQA 3WU2U 4DS5A 4K4GA 3MFHA 2C2RA 4NLGA 1ZD2P 1ZQPA 3TFSA 4GXKA 2KSOA 4IQUA 5KFFA 8ICZA 4X5VA 2Y0SC 5AM2A 5JRTA 3SENA 4RNNA 3WK7A 2P35A 3LYSA 1VDVA 1N2XA 3Q8MA 3TKAA 7ICNA 1S10A 1ZQNA 5EWGA 3RAQA 1ZQQA 3MR2A 4F71A 4YD2A 2O6KA 4OCZA 3KZXA 5AIAA 2KD1A 5KFSA 1UT5A 4F3OA 1Z1VA 2AQ4A 4TURA 1DGJA 5ALIA 3CP8A 5KFTA 1WCLA 3F53A 4XRHA 2A1JB 2KN7A 4ACOA 2EZZA 3C23A 4K4IA 4EZ6A 2FDRA 2VKQA 1U4BA 2QLTA 2BKEA 5IIIA 1UT8A 5EOZA 4O5EA 9ICEA 2BZFA 4I2CA 4R8UA 4DL4A 4DS4A 5EWEA 3MR5A 4DFJA 3RRHA 2YB4A 2D3DA 4RT3A 5J8YC 4IS7A 1FEZA 1SL1A 7ICOA 2OCEA 3HPOA 2G5IB 3SZ2A 4CE6A 3M1YA 4B9NA 3O0FA 3OGUA 5KL8B 4B6JA 1XO0A 2JRZA 1ZQBA 1FO4A 1UHUA 3GIJA 3EZ5A 3M8RA 4DLEA 2XCAA 1SL2A 3MC1A 3NVVA 3WK6A 4EENA 5HNKA 3M8SA 3HX0A 4M9LA 2NV3A 3LWMA 1ZQEA 4KLOA 3BS5A 2MRLA 1JIHA 2BGWA 4J9RA 1BGXT 2FE9A 4DSKA 4FBTA 5C0YA 1FFVA 2ODGA 2XY7A 2ZIXB 5DKWA 4KLDA 4RQ1A 3RJJA 2F44A 3H0RB 2CPRA 1TK5A 4QZ9A 5ALDA 3ETLA 1TKDA 2A1JA 2G07A 1UA0A 4IC9A 5J2FA 3OSNA 1KTQA 3JPQA 4EBDA 2WF5A 2UVWA 3OPXA 3C5FA 3PW4A 2ZIWA 5CR0A 4P0PA 1ZQYA 4KLSA 2DPIA 4O3QA 3ALRA 7ICHA 4QWBA 2HBJA 1L7PA 2FPKA 2RP5A 9ICVA 9ICPA 4OJ6A 5DB9A 4USAA 3TAPA 4R8UB 4YP3A 1P7DA 3CYMA 4QW9A 1Q3VA 5AKLA 1IIPA 1SKRA 5EE0A 5AIBA 3ZD8A 4CNQA 1QQ6A 3H8JA 5JUMA 2LYBA 2NRWA 2ZUCA 1B22A 2W54A 4R66A 3T5KA 5KG0A 9ICAA 2K4PA 1KSPA 1HJPA 5CRXA 1SIJA 2F8LA 2PFNA 1XSNA 1BVSA 4DFDA 4PGXA 4DQIA 3MR3A 4I2HA 1JROA 8ICMA 5J2GA 4GXJA 4IRCA 3QEAZ 3SV4A 4O9MA 2EAOA 2ISOA 3N7PD 2HVIA 4EEKA 4PL1A 3ISCA 2R8IA 2FLNA 4O3PA 4IL6U 2PFOA 2HHXA 2QARB 2JXJA 5DDYA 3FAHA 3PY8A 4F72A 4M9GA 3BQTA 2KVSA 1Q46A 4PHAA 2WAQF 3PW7A 4Y2SA 2K4IA 5BOLA 1ZQHA 1KDHA 3LVWA 3H0LB 2C28A 3RH4A 1SKSA 2ZTDA 2EAMA 3PVXA 2BQRA 1IG6A 4UAWA 5J0XA 4BGDA 4US9A 3ZDCA 4NLBA 2LBOA 4CF3A 1S0VA 2P6UA 4US8A 4ECSA 2FI1A 4YD1A 8ICSA 5KG3A 4CRXA 4J9LA 4DL2A 3GIIA 2HW3A 4J9PA 4I2GA 5J29A 3FDSA 1Z4NA 4NJ8A 2BPFA 2KK0A 4EBEA 1T7PA 1ZQRA 4GC7A 2D6FC 3E0FA 2I6XA 3T5JA 3RF9A 1LKYA 4M2YA 2QARA 2XCPA 4YCXA 1S9FA 5DLGA 5DLFA 3M9MB 2DBYA 1S97A 3BQ2A 4M47A 2DQNB 4PGQA 2HCFA 3KD3A 3R9KA 3PR4A 5KTQA 3UMCA 3UQ2A 7ICSA 4I2FA 3AU6A 5AKHA 3UM9A 4EZ9A 2F1JA 2YX8A 4Q45A 2W8KA 2Y9TA 4Z6CA 4QNLA 1KFDA 3PW2A 4MFAA 3LK9A 3GV7B 3BZKA 1ZD3A 3FM9A 2DKXA 4GC6A 4ECXA 1QQ5A 2BCVA 2C2EA 1UPHA 1ZQ1C 3ETRA 5HP4A 1GO3F 5ALWA 4J9MA 3Q8LA 4UB4A 3OSPA 5AI4A 3SAHA 1BNOA 2KJ5A 2E5SA 4U7CA 3AN1A 5DB8A 4ZH4A 1RDFA 2ZTEA 5KFIA 1ZD5A 5AKZA 5ALGA 1NJYA 3KKAA 2HHWA 4DL7A 4JMUA 4J9KA 1V9PA 2EANA 3PZPA 1SB3C 1L3SA 2W9BB 2ASJA 3SI8A 2FLPA 4JWNA 2JEJA 7ICGA 3EYZA 1A0PA 2ZG6A 2FLLA 4QWDA 3KHHA 2AGOA 4ECQA 4QJFB 3D6JA 1WWVA 3SAGA 1ZQWA 4IR9A 5G5GA 2KOBA 2MAXA 4C0ZA 2YMLA 2J6TA 2BCSA 2OH2A 1KW4A 2W03A 4FZLA 2OHFA 2E8PA 4UBBA 3RRGA 1X9SA 2C22A 2PMZC 2Y0SF 1ZQXA 2HHSA 3ZD9A 3Q8PB 3M6ZA 2KFZA 4UQGA 3GDXA 5E79U 7ICPA 2AU0A 2M0NA 3UXNA 4RZRA 3BQ1A 4RQMA 3V6HA 4I2DA 2YTUA 5F3XB 5DDMA 8ICHA 4EYHB 4OJPA 5AICA 1S0NA 5AM0A 1COOA 1Q8KA 4YFKA 4YR2A 2P66A 1UCVA 1WCNA 4G9BA 3LDAA 2KHVA 1V85A 1LB2B 4LZDA 3K1ZA 2XI9A 4G3IA 1XS9D 2NO4A 4DL6A 4F93B 1D9DA 3NVZA 3PSFA 3OHBA 9ICMA 3VC8A 4DEZA 3C2KA 2BCRA 3QXGA 5ALKA 3HW8A 5KFKA 4YMOA 4LJXA 3N7RC 5ALLA 8ICBA 5CWRA 8ICXA 4DQRA 1X9WA 3MGVA 1CRXA 4F4KA 8ICPA 4DQQA 2XO7A 5T14A 4ELUA 4O3MA 4UB1A 3M9OB 2G06A 2PKEA 1ZQGA 5DGBA 5KG2A 4YG2A 2KJ8A 3WKAA 3ISBA 1ZQTA 2IHMA 2FPLA 2K89A 1ZQKA 3PO5A 1N63A 5ALQA 5KFBA 1NK9A 4DSEA 2GH1A 2ZIUA 2KP7A 2ZJ5A 5A0LA 4DWIA 4LVSA 4RPZA 1B43A 3HT3A 3SD7A 3MFIA 5ALTA 4P4PA 3U26A 1TK8A 5DBAA 2G08A 3RJKA 5ALJA 1TFRA 1KL9A 1S76D 3Q8KA 4ELVA 5HR7A 5DBBA 1MSWD 2EZYA 3OTQA 1Q3UA 5KFCA 4LZGA 1WYGA 5KG4A 2LM1A 1S5LU 4Q8EA 5J2CA 2K4EA 1K1SA 3H8SA 4PZOA 1S77D 3PMLA 2YMMA 1L7MA 2LKYA 3PW5A 1BPYA 4I27A 3ORYA 4RT2A 1MQ3A 4KLGA 3NUQA 2KJ9A 4F50A 4F4YA 4UBCA 4QZIA 4RPXA 2BQ3A 5ALEA 4Q43A 5D4BA 2BR0A 4GLXA 4O0IA 3TARA 1AQ6A 2MSNA 4Y2RA 3RB4A 1JI7A 2HHUA 2VIXA 1PK3A 2V9WA 2I1QA 1U9LA 4UW9A 4Z6DA 5G5HA 4RNOA 4PHEA 2PFQA 2KEYA 3RFAA 2ZXHA 1OUQA 2W7PA 2VJ4A 2VANA 2IOFK 3THVA 4B9VA 1SKWA 1ZRMA 3RJGA 3MGHA 3M9NB 2BPGA 1A77A 3BQ7A 3SV3A 4C8NA 1OW5A 5GTHU 5D46A 4JWMA 3RAXA 7ICVA 2L5YA 5KFGA 2KKPA 3V7JA 1SL0A 4KX5A 4TUSA 4F4WA 5KFNA 3PV8A 4F92B 2XY5A 5CP2A 1JX4A 4ED6A 2LHTA 4JB3A 3V6JA 3F2CA 2DGZA 3RJIA 2QB1A 7ICFA 4UB8U 5KFMA 2W8LA 2W9AA 3TADA 3TACB 9ICWA 4C8KA 2ESEA 2N1RA 4BWJA 1T3QA 1Z00B 5HMMA 4C4SA 4ECRA 5K4LA 4Z6FA 4C8OA 2IA6A 5KFUA 3AMZA 1L3VA 4AYBF 3JPTA 2LI6A 8ICLA 4J9QA 4BUGA 1JXLA 1XC9A 1TAMA 1DGSA 4O3RA 1LKYB 3HKZC 7ICKA 2A3VA 2ASDA 1ZQOA 5HHIA 3HWTA 3QNMA 1FFUA 3GU3A 5TISU 5AK3A 3UQ0A 2F76X 4DL5A 3E58A 5KT4A 3RJEA 2IOFA 3HP6A 4DL3A 4Y2TA 1L3UA 4KN4A 1COKA 2HBKA 5J0OA 3QUCA 5ALZA 2HMXA 3F5AA 2W9MA 3JPSA 5ALHA 4C7YA 3QYPA 3HRDD 5KT6A 4YN4A 1UA1A 2UVUA 2WB1C 2F1IA 3AM9A 2WFAA 2E8NA 2HI0A 2Q0ZX 2J6UA 3UMGA 3TI0A 2AQ0A 4UAVA 3IN5A 5EE3A 1WG8A 5IIJA 2JEIA 1D8LA 2RHFA 2Q4TA 5FP0A 4MF2A 3NRZA 4O3NA 2G09A 4NXZA 1IXRA 4DFKA 2VA2A 1NOMA 4NLNA 9ICSA 3G6YA 3A0HU 4UB2A 4KLJA 5KAIU 9ICXA 3H0MB 1ZJMA 4O5CA 2M9NA 5CEHA 1B0XA 3TADC 5J0PA 2R8HA 2EQYA 5AI8A 4P0PB 4DLGA 2HHQA 4CGZA 2AHOB 5KFDA 1ZQLA 3FC4A 4UAZA 4KN7A 1TAUA 4CF4A 3N7SC 4BXOA 5AI5A 1ZQCA 4QZGA 4JUZA 3LWLA 1F5SA 3UMBA 5B5EU 9ICUA 1QQ7A 1S8OA 2W11A 4RPYA 5J0RA 3GZFA 2JGAA 4CF5A 4XUSA 4EYIB 3T3FA 2ZUBA 5GTIU 3ZDBA 4Y2QA 1ZRNA 1YZ6A 5J2IA 2KNJA 4RQ3A 1N62A 1RXVA 1RG6A 5AK5A 2OEHA 9ICOA 3PR5B 1IM4A 2BDPA 5KFRA 1O08A 5AM3A 4I29A 5IINA 2G0AA 2EZXA 3ONNA 3GQCA 5KG6A 5ALRA 5KFXA 3C2MA 4UARA 5DQIA 1KFSA 3V7LA 2Y9UA 4F91B 1D8YA 5AK6A 9ICGA 4I2IA 5HR6A 5ALYA 2VJ5A 1L8OA 4NLKA 4F5QA 4YR0A 2K8CB 2YQEA 5KFZA 9ICLA 4KTQA 2UVRA 1RYRA 1BPXA 1YT3A 1ED1A 3H4BA 3B0XA 1JUDA 2DF4B 1L7NA 8ICVA 1PZNA 1BPBA 4R64A 1ZQVA 2MU2A 4I28A 2W04A 4ICAA 3C1YA 1ZJNA 1OXJA 2LYAA 2VA8A 1RZTA 1RPLA 4MF8A 4F8RA 3K1RB 4WJ3B 5DB6A 3AU2A 5ALPA 4YMNA 4DFPA 2W7OA 3EWAA 4RQ5A 3B9JA 5KFQA 4ZOHC 5J2KA 1YZ7A 3JPNA 2D8CA 3Q8RB 2KZMA 3MDCA 1Z19A 3CRXA 3I76A 3M7DA 2WF7A 4ED1A 5KT5A 4ED2A 8ICTA 3OHAA 5AI0A 8ICWA 2HHVA 4KLMA 4DSLA 2HOQA 3F5EA 2JR5A 1SXDA 1JXEA 4QW8A 5J2HA 4DQPA 3EUB2 2BDUA 3Q8SB 4FS2A 3HKZF 1NKCA 5C5JA 4P0QA 1Z3EB 4I2AA 1ZQZA 1ZOLA 1T94A 4C80A 2HBMA 4RUCA 4KLIA 1ZETA 3KHLA 3WKCA 4ECUA 2JMGA 2OM6A 4KMUA 5KFEA 3ED5A 4Q44A 4MFCA 2XIDA 2WF9A 4KLLA 3MBYA 4QZDA 3H4DA 4DOCA 3PX6A 4ED0A 5AKIA 3QU4A 1QTMA 3ZDEA 5J2DA 4MEYA 2W3RA 3QU5A 3G6VA 2NRXA 5DBCA 4Y2YA 4CCHA 2B21A 2KZZA 3L5KA 7ICUA 2ZJ8A 3BJYA 4DO9A 5HHHA 3RR8A 1NJZA 1ZD4A 1JRPA 5J2AA 3KTQA 4DSFA 3K4GA 5DQHA 1U47A 4KLUA 2W9BA 3UPQA 4EBCA 1TAQA 3PX4A 2VA3A 3BDPA 4ED7A 1Z1BA 3D2QA 1LVHA 3D2SA 2XY6A 4J9OA 3QX7A 2AGPA 2I5HA 5KT2A 5AKXA 2LMRA 4J03A 4HYKA 2GOLA 4M04A 1XSPA 1NKEA 8ICFA 3UXPA 3C28A 3KFUF 3I1YA 2RDIA 7ICMA 3PW0A 2B0CA 8ICQA 2BCQA 2XICA 4KLTA 3MABA 4Y2PA 4B9MA 1SZPA 4JV1A 4BJQA 4IQWA 1NK7A 1MC8A 1L5UA 3S6JA 3GV5B 2H3VA 4RQNA 1WUDA 1VJ5A 3I28A 1O03A 3WK5A 2F3NA 4PPXA 3PMNA 1Z4OA 1ZQMA 3AEVA 3SAFA 2R8GA 2AXTU 4QZCA 3IG5A 1SWVA 3IV6A 3WK4A 1RXWA 1F0MA 5HMLA 4JK1A 3QZ7A 7ICLA 5KNIA 3L4PA 4DOBA 3T79A 5TZVA 4F5PA 2K60A 1BPDA 4Y2UA 9ICTA 5D49A 4EX6A 5L1MA 4C8LA 3GIMA 8ICKA 3WKEA 4RU9A 4ECWA 4NL9C 5ALOA 1Y88A 5BPCA 2J6SA 1ZXIA 2ISPA 1JALA 3BQ0A 2E8OA 3N28A 3M6KA 3GIKA 4F5RA 3MDAA 1X6JA 4ECYA 3RBDA 4GIBA 3IG8A 3T5LA 1U45A 1ZQDA 1CUKA 2XC9A 1C20A 3GILA 3HILA 5J0UA 5KFVA 1ZQJA 2GLEA 1KKXA 2K4HA 3NASA 2FMSA 5CA7A 5IILA 2ZTCA 4OJLA 1RQLA 1RM6C 3OJSA 3RTVA 3E2EA 4GXIA 2NRVA 5JTIA 4Z6EA 4UB6U 4I2EA 4UASA 4M6WA 4OO1J 4NL9A 3UXOA 5J0YA 2E3TA 3WK9A 2E1FA 1AROP 5L1KA 2H3ZA 3MGIA 1KLNA 2EH9A 4XQ8A 4NLCA 7ICTA 3RB6A 2HHTA 3ICXA 2HOFA 4R65A 2EAPA 4TUQA 1L6NA 1TK0A 2YMPA 3QU9A 4UAYA 1PVPA 3BS7A 3TFRA 1T3NA 4DFMA 1X2IA 1S0OA 2DPJA 1NK4A 3MR6A 2JHDA 5J0WA 2C2DA 1KN5A 2H5XA 3QUQA 4NY8A 1L8LA 2GWSA 3EPIA 4FO6A 3N4MB 1QLNA 3CW2C 3NVWA 3BS5B 1N56A 4YMMA 4NM1A 4M6WB 3IP4B 5J0SA 2AJQA 1X66A 3H40A 1QSYA 1MA7A 7ICEA 2PXIA 2YMQA 4QZ8A 2AH5A 1N48A 2CN1A 2NRZA 4AP9A 3QU7A 5IIKA 3C1ZA 3RR7A 2H3IA 1CEZA 9ICIA 2F8KA 4E0DA
chains in the Genus database with same CATH topology
4LJXA 2LM1A 1KQQA 2OEHA 2KK0A 5CEHA 2JRZA 1KN5A 1KKXA 2RQ5A 1IG6A 2JXJA 1C20A 2LI6A 5K4LA 1RYUA 2CXYA 2EQYA 2EH9A 2YQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJX A;  2LM1 A;  1KQQ A;  2OEH A;  2KK0 A;  5CEH A;  2JRZ A;  1KN5 A;  1KKX A;  2RQ5 A;  1IG6 A;  2JXJ A;  1C20 A;  2LI6 A;  5K4L A;  1RYU A;  2CXY A;  2EQY A;  2EH9 A;  2YQE A; 
#chains in the Genus database with same CATH topology
 1QCK A;  4NM2 A;  3F2B A;  1TVA A;  1C7Y A;  3A0B U;  4P2H A;  5IIO A;  2KIW A;  2AGQ A;  1BPZ A;  5J0Q A;  1NK6 A;  1NK0 A;  3V6K A;  5J2J A;  3NVY A;  4YXJ A;  5ALM A;  4U6P A;  3KKA C;  2XVT A;  3V7K A;  3WKB A;  2F1H A;  4PHD A;  1J2M A;  4DQS A;  3F2D A;  5DB7 A;  2JZB B;  3PSP A;  2MA1 A;  9ICR A;  2FMP A;  1SXE A;  4PL2 A;  5F9L A;  2KSO B;  2K8A A;  4I2J A;  5AKG A;  9ICB A;  1J97 A;  1N61 A;  3IRU A;  4B9L A;  1D8B A;  3RJH A;  4A8E A;  1RQN A;  1HEK A;  2BQU A;  1D9F A;  4P4M A;  2RDJ A;  2FJ6 A;  1L3T A;  1XSL A;  4Q8F A;  1QH9 A;  1NKB A;  3L3F X;  4DF4 A;  1HUZ A;  5KG1 A;  3KZI U;  7ICQ A;  1NJX A;  2R8J A;  3RB0 A;  5F9N A;  2HSZ A;  4QIW C;  5B66 U;  4IQV A;  3GFK B;  4KLF A;  3PX0 A;  2OWO A;  4QZE A;  1T4G A;  5J0T A;  2Y1J A;  5AKJ A;  4DOA A;  4FZN A;  3SEI A;  3C5G A;  2ES6 A;  9ICF A;  3C2L A;  4YQW A;  2JEG A;  1NJW A;  5ALS A;  2NRT A;  5J2E A;  4CDG A;  1N5X A;  9ICK A;  4F5O A;  1VLB A;  5L1J A;  4PHP A;  1TE2 A;  4F5N A;  4GFJ A;  2RQ5 A;  3IDW A;  1DOQ A;  3Q8Q B;  2GO7 A;  1QSL A;  5KFJ A;  1ZYQ A;  5DQG A;  8ICU A;  4DSJ A;  3VCB A;  3CNH A;  3C29 A;  3BZC A;  4NV0 A;  5AKE A;  4NLZ A;  2BHN A;  2PMZ F;  1H38 A;  5CJ7 A;  1SZH A;  4KIT B;  3QUT A;  2KFN A;  5L9X A;  3HJE A;  4BXO B;  4O3O A;  4JV2 A;  4YXM A;  4MEX A;  9ICC A;  4RQ2 A;  4BWM A;  4QWA A;  4M0A A;  2R18 A;  2YN4 A;  4FFD A;  3ZDD A;  2JEF A;  1PVR A;  1SV0 C;  1ZQU A;  4ED8 A;  2R8K A;  2IBK A;  2B6G A;  3B0Y A;  1F44 A;  3TAQ A;  3KHR A;  9ICJ A;  4OJO A;  1ZQI A;  4M9N A;  2HBL A;  3ZDA A;  4ELT A;  4JV0 A;  1X9M A;  4I2B A;  1SV4 A;  4P4O A;  3GV8 B;  4MHV A;  1X42 A;  2DWQ A;  2ZIV B;  2YY6 A;  2NO5 A;  4P0Q B;  4FBU A;  3D2N A;  4YVZ A;  5KAF U;  5BOM A;  3TAN A;  4RUA A;  4O3S A;  2ZJA A;  2K8B B;  2YB1 A;  8ICA A;  1V97 A;  5AM5 A;  2A1A A;  1M6Y A;  2Z7J A;  5EE1 A;  1BPE A;  5AM1 A;  1WWU A;  4QZB A;  4ED3 A;  5KG5 A;  1HUO A;  5DG7 A;  1S0M A;  5DG8 A;  8ICY A;  5L1L A;  1RYS A;  1PVQ A;  4FS1 A;  2QKQ A;  4XA5 A;  4YR3 A;  3IM1 A;  1CI4 A;  5KT7 A;  1EXN A;  3NRW A;  2FMQ A;  2KIC A;  2LPE A;  1KFT A;  5KFY A;  5ALN A;  2HVH A;  4QZA A;  2WF8 A;  5AI6 A;  3EPG A;  4ECT A;  5DG9 A;  4UAT A;  1DRG A;  4RQ7 A;  2ZIX A;  1BNP A;  3PSI A;  4IQT A;  5J8Y A;  2ZIV A;  4C8M A;  5DGA A;  2JZB A;  1PK1 B;  3NGD A;  3LVV A;  3ZI4 A;  8ICN A;  3RBE A;  2FPM A;  3V72 A;  1NZB A;  2XGQ A;  4PJ0 U;  3AQE A;  5JU5 A;  2W43 A;  1KQQ A;  7ICI A;  3QZ8 A;  3SR6 A;  2IMW P;  3IHQ B;  3PO4 A;  1KEJ A;  3SYZ A;  2MUT B;  2WB1 F;  1A6S A;  1URJ A;  5KT3 A;  5KL1 B;  1Z00 A;  2KHQ A;  3SQI A;  2KIV A;  4TQR A;  1DK3 A;  4EEY A;  4KLH A;  2DL0 A;  4DCC A;  1MQ2 A;  2JV3 A;  1JN3 A;  2NYV A;  3SMV A;  3H7I A;  2KZ3 A;  2H3F A;  3G6X A;  2ALZ A;  2V4R A;  2WHE A;  3TQ1 A;  2ZIU B;  8ICJ A;  1B4F A;  1X9X A;  2G5H B;  2E1E A;  3JPR A;  4EEL A;  8ICE A;  4ECZ A;  5CHG A;  2PFP A;  3RJF A;  1KRP A;  2E8M A;  3QE9 Y;  4FE3 A;  1K1Q A;  3FYH A;  1K5O A;  4C4T A;  4RQ6 A;  4M9J A;  5ALX A;  4J9N A;  2KG5 A;  4B9U A;  1XNS A;  2MUT A;  7ICR A;  4B9T A;  1PK1 A;  1KBU A;  3EW9 A;  4IRD A;  1U48 A;  5EWF A;  4C7Z A;  4ECV A;  5AM4 A;  3T5H A;  3JPO A;  2ZUD A;  3RB3 A;  4TUP A;  1A76 A;  4RQ4 A;  5KFW A;  3AUO A;  4B9S A;  1IV8 A;  4QWE A;  4RQ8 A;  3DEE A;  4MFF A;  2ZXI A;  5CB1 A;  4FZM A;  1V38 A;  5ALF A;  5KFP A;  3QEB Z;  2OXO A;  2W9C B;  2XGP A;  4OJ5 A;  3QU2 A;  1NZP A;  2KE7 A;  5KFA A;  2CXY A;  4J9S A;  3H8M A;  1JMS A;  2OYY A;  1SWW A;  5H2F U;  4M9H A;  3RH6 A;  5AK4 A;  1TV9 A;  4RQ0 A;  4KLQ A;  1SV0 A;  1ZQS A;  2PI4 A;  3JPP A;  5AHX A;  1T8E A;  1X6I A;  1DK2 A;  3NS1 A;  5KFO A;  1SGG A;  4OD0 A;  2KTQ A;  1L7O A;  4RNM A;  4Y2V A;  1J2N A;  2W55 A;  2CRX A;  4HAI A;  5ALU A;  2A19 A;  1PUZ A;  2F2A B;  8ICR A;  3RH5 A;  2RRD A;  4Y2J A;  3PST A;  2QB0 B;  2HOI A;  2W9C A;  2EDU A;  2JH7 A;  8ICC A;  4C4R A;  8ICI A;  4F2S A;  5J2B A;  5IIM A;  4PZN A;  5AKY A;  4DF8 A;  4AYB C;  4F4Z A;  2RLT A;  4UAU A;  3K75 D;  2IOH A;  4QIW F;  2V4Q A;  8ICO A;  1XO1 A;  2Y1I A;  2ATL A;  3C21 A;  4UB5 A;  7ICJ A;  4PH5 A;  5KG7 A;  1ECW A;  9ICQ A;  3AL0 B;  5KFH A;  2H3Q A;  2HDO A;  2P6R A;  2WAQ C;  3KOO A;  1NI3 A;  1X40 A;  1DXS A;  4QZH A;  1NK5 A;  3NTU A;  2UVV A;  3KHG A;  2IHN A;  1UQV A;  4DSI A;  5AI9 A;  2PI5 A;  3AQF A;  2F77 X;  2JH1 A;  2DFL A;  2KKV A;  4EX7 A;  3KBB A;  4QZF A;  4F2R A;  3H8W A;  1U49 A;  9ICH A;  1XU4 A;  1NK8 A;  2DKZ A;  4NWI A;  3OJU A;  1HIW A;  4KLE A;  4QWC A;  5AKK A;  3QUB A;  4BDP A;  2QB0 A;  4O5K A;  1ZQF A;  3WKD A;  3DDH A;  1QSS A;  3PNC A;  1ZQA A;  2LYH A;  3DV9 A;  4TQS A;  2WF6 A;  4F4X A;  2ASL A;  4KX3 A;  4PGY A;  4IRK A;  1XWL A;  3WK8 A;  5L1I A;  2I9G A;  2ZIW B;  4KMO B;  2W3S A;  9ICN A;  2LM4 A;  2BCU A;  1MN8 A;  1N5W A;  4R63 A;  2KMD A;  3ISD A;  2WTF A;  1RYU A;  3N97 B;  2DUY A;  8ICG A;  2BPC A;  1LV5 A;  1NNL A;  2KV2 A;  4K4H A;  1N60 A;  5EE9 A;  4Y2X A;  4UB3 A;  5ALV A;  2KVC A;  4BX9 C;  5KFL A;  4IR1 A;  3J81 j;  1FIQ A;  3WU2 U;  4DS5 A;  4K4G A;  3MFH A;  2C2R A;  4NLG A;  1ZD2 P;  1ZQP A;  3TFS A;  4GXK A;  2KSO A;  4IQU A;  5KFF A;  8ICZ A;  4X5V A;  2Y0S C;  5AM2 A;  5JRT A;  3SEN A;  4RNN A;  3WK7 A;  2P35 A;  3LYS A;  1VDV A;  1N2X A;  3Q8M A;  3TKA A;  7ICN A;  1S10 A;  1ZQN A;  5EWG A;  3RAQ A;  1ZQQ A;  3MR2 A;  4F71 A;  4YD2 A;  2O6K A;  4OCZ A;  3KZX A;  5AIA A;  2KD1 A;  5KFS A;  1UT5 A;  4F3O A;  1Z1V A;  2AQ4 A;  4TUR A;  1DGJ A;  5ALI A;  3CP8 A;  5KFT A;  1WCL A;  3F53 A;  4XRH A;  2A1J B;  2KN7 A;  4ACO A;  2EZZ A;  3C23 A;  4K4I A;  4EZ6 A;  2FDR A;  2VKQ A;  1U4B A;  2QLT A;  2BKE A;  5III A;  1UT8 A;  5EOZ A;  4O5E A;  9ICE A;  2BZF A;  4I2C A;  4R8U A;  4DL4 A;  4DS4 A;  5EWE A;  3MR5 A;  4DFJ A;  3RRH A;  2YB4 A;  2D3D A;  4RT3 A;  5J8Y C;  4IS7 A;  1FEZ A;  1SL1 A;  7ICO A;  2OCE A;  3HPO A;  2G5I B;  3SZ2 A;  4CE6 A;  3M1Y A;  4B9N A;  3O0F A;  3OGU A;  5KL8 B;  4B6J A;  1XO0 A;  2JRZ A;  1ZQB A;  1FO4 A;  1UHU A;  3GIJ A;  3EZ5 A;  3M8R A;  4DLE A;  2XCA A;  1SL2 A;  3MC1 A;  3NVV A;  3WK6 A;  4EEN A;  5HNK A;  3M8S A;  3HX0 A;  4M9L A;  2NV3 A;  3LWM A;  1ZQE A;  4KLO A;  3BS5 A;  2MRL A;  1JIH A;  2BGW A;  4J9R A;  1BGX T;  2FE9 A;  4DSK A;  4FBT A;  5C0Y A;  1FFV A;  2ODG A;  2XY7 A;  2ZIX B;  5DKW A;  4KLD A;  4RQ1 A;  3RJJ A;  2F44 A;  3H0R B;  2CPR A;  1TK5 A;  4QZ9 A;  5ALD A;  3ETL A;  1TKD A;  2A1J A;  2G07 A;  1UA0 A;  4IC9 A;  5J2F A;  3OSN A;  1KTQ A;  3JPQ A;  4EBD A;  2WF5 A;  2UVW A;  3OPX A;  3C5F A;  3PW4 A;  2ZIW A;  5CR0 A;  4P0P A;  1ZQY A;  4KLS A;  2DPI A;  4O3Q A;  3ALR A;  7ICH A;  4QWB A;  2HBJ A;  1L7P A;  2FPK A;  2RP5 A;  9ICV A;  9ICP A;  4OJ6 A;  5DB9 A;  4USA A;  3TAP A;  4R8U B;  4YP3 A;  1P7D A;  3CYM A;  4QW9 A;  1Q3V A;  5AKL A;  1IIP A;  1SKR A;  5EE0 A;  5AIB A;  3ZD8 A;  4CNQ A;  1QQ6 A;  3H8J A;  5JUM A;  2LYB A;  2NRW A;  2ZUC A;  1B22 A;  2W54 A;  4R66 A;  3T5K A;  5KG0 A;  9ICA A;  2K4P A;  1KSP A;  1HJP A;  5CRX A;  1SIJ A;  2F8L A;  2PFN A;  1XSN A;  1BVS A;  4DFD A;  4PGX A;  4DQI A;  3MR3 A;  4I2H A;  1JRO A;  8ICM A;  5J2G A;  4GXJ A;  4IRC A;  3QEA Z;  3SV4 A;  4O9M A;  2EAO A;  2ISO A;  3N7P D;  2HVI A;  4EEK A;  4PL1 A;  3ISC A;  2R8I A;  2FLN A;  4O3P A;  4IL6 U;  2PFO A;  2HHX A;  2QAR B;  2JXJ A;  5DDY A;  3FAH A;  3PY8 A;  4F72 A;  4M9G A;  3BQT A;  2KVS A;  1Q46 A;  4PHA A;  2WAQ F;  3PW7 A;  4Y2S A;  2K4I A;  5BOL A;  1ZQH A;  1KDH A;  3LVW A;  3H0L B;  2C28 A;  3RH4 A;  1SKS A;  2ZTD A;  2EAM A;  3PVX A;  2BQR A;  1IG6 A;  4UAW A;  5J0X A;  4BGD A;  4US9 A;  3ZDC A;  4NLB A;  2LBO A;  4CF3 A;  1S0V A;  2P6U A;  4US8 A;  4ECS A;  2FI1 A;  4YD1 A;  8ICS A;  5KG3 A;  4CRX A;  4J9L A;  4DL2 A;  3GII A;  2HW3 A;  4J9P A;  4I2G A;  5J29 A;  3FDS A;  1Z4N A;  4NJ8 A;  2BPF A;  2KK0 A;  4EBE A;  1T7P A;  1ZQR A;  4GC7 A;  2D6F C;  3E0F A;  2I6X A;  3T5J A;  3RF9 A;  1LKY A;  4M2Y A;  2QAR A;  2XCP A;  4YCX A;  1S9F A;  5DLG A;  5DLF A;  3M9M B;  2DBY A;  1S97 A;  3BQ2 A;  4M47 A;  2DQN B;  4PGQ A;  2HCF A;  3KD3 A;  3R9K A;  3PR4 A;  5KTQ A;  3UMC A;  3UQ2 A;  7ICS A;  4I2F A;  3AU6 A;  5AKH A;  3UM9 A;  4EZ9 A;  2F1J A;  2YX8 A;  4Q45 A;  2W8K A;  2Y9T A;  4Z6C A;  4QNL A;  1KFD A;  3PW2 A;  4MFA A;  3LK9 A;  3GV7 B;  3BZK A;  1ZD3 A;  3FM9 A;  2DKX A;  4GC6 A;  4ECX A;  1QQ5 A;  2BCV A;  2C2E A;  1UPH A;  1ZQ1 C;  3ETR A;  5HP4 A;  1GO3 F;  5ALW A;  4J9M A;  3Q8L A;  4UB4 A;  3OSP A;  5AI4 A;  3SAH A;  1BNO A;  2KJ5 A;  2E5S A;  4U7C A;  3AN1 A;  5DB8 A;  4ZH4 A;  1RDF A;  2ZTE A;  5KFI A;  1ZD5 A;  5AKZ A;  5ALG A;  1NJY A;  3KKA A;  2HHW A;  4DL7 A;  4JMU A;  4J9K A;  1V9P A;  2EAN A;  3PZP A;  1SB3 C;  1L3S A;  2W9B B;  2ASJ A;  3SI8 A;  2FLP A;  4JWN A;  2JEJ A;  7ICG A;  3EYZ A;  1A0P A;  2ZG6 A;  2FLL A;  4QWD A;  3KHH A;  2AGO A;  4ECQ A;  4QJF B;  3D6J A;  1WWV A;  3SAG A;  1ZQW A;  4IR9 A;  5G5G A;  2KOB A;  2MAX A;  4C0Z A;  2YML A;  2J6T A;  2BCS A;  2OH2 A;  1KW4 A;  2W03 A;  4FZL A;  2OHF A;  2E8P A;  4UBB A;  3RRG A;  1X9S A;  2C22 A;  2PMZ C;  2Y0S F;  1ZQX A;  2HHS A;  3ZD9 A;  3Q8P B;  3M6Z A;  2KFZ A;  4UQG A;  3GDX A;  5E79 U;  7ICP A;  2AU0 A;  2M0N A;  3UXN A;  4RZR A;  3BQ1 A;  4RQM A;  3V6H A;  4I2D A;  2YTU A;  5F3X B;  5DDM A;  8ICH A;  4EYH B;  4OJP A;  5AIC A;  1S0N A;  5AM0 A;  1COO A;  1Q8K A;  4YFK A;  4YR2 A;  2P66 A;  1UCV A;  1WCN A;  4G9B A;  3LDA A;  2KHV A;  1V85 A;  1LB2 B;  4LZD A;  3K1Z A;  2XI9 A;  4G3I A;  1XS9 D;  2NO4 A;  4DL6 A;  4F93 B;  1D9D A;  3NVZ A;  3PSF A;  3OHB A;  9ICM A;  3VC8 A;  4DEZ A;  3C2K A;  2BCR A;  3QXG A;  5ALK A;  3HW8 A;  5KFK A;  4YMO A;  4LJX A;  3N7R C;  5ALL A;  8ICB A;  5CWR A;  8ICX A;  4DQR A;  1X9W A;  3MGV A;  1CRX A;  4F4K A;  8ICP A;  4DQQ A;  2XO7 A;  5T14 A;  4ELU A;  4O3M A;  4UB1 A;  3M9O B;  2G06 A;  2PKE A;  1ZQG A;  5DGB A;  5KG2 A;  4YG2 A;  2KJ8 A;  3WKA A;  3ISB A;  1ZQT A;  2IHM A;  2FPL A;  2K89 A;  1ZQK A;  3PO5 A;  1N63 A;  5ALQ A;  5KFB A;  1NK9 A;  4DSE A;  2GH1 A;  2ZIU A;  2KP7 A;  2ZJ5 A;  5A0L A;  4DWI A;  4LVS A;  4RPZ A;  1B43 A;  3HT3 A;  3SD7 A;  3MFI A;  5ALT A;  4P4P A;  3U26 A;  1TK8 A;  5DBA A;  2G08 A;  3RJK A;  5ALJ A;  1TFR A;  1KL9 A;  1S76 D;  3Q8K A;  4ELV A;  5HR7 A;  5DBB A;  1MSW D;  2EZY A;  3OTQ A;  1Q3U A;  5KFC A;  4LZG A;  1WYG A;  5KG4 A;  2LM1 A;  1S5L U;  4Q8E A;  5J2C A;  2K4E A;  1K1S A;  3H8S A;  4PZO A;  1S77 D;  3PML A;  2YMM A;  1L7M A;  2LKY A;  3PW5 A;  1BPY A;  4I27 A;  3ORY A;  4RT2 A;  1MQ3 A;  4KLG A;  3NUQ A;  2KJ9 A;  4F50 A;  4F4Y A;  4UBC A;  4QZI A;  4RPX A;  2BQ3 A;  5ALE A;  4Q43 A;  5D4B A;  2BR0 A;  4GLX A;  4O0I A;  3TAR A;  1AQ6 A;  2MSN A;  4Y2R A;  3RB4 A;  1JI7 A;  2HHU A;  2VIX A;  1PK3 A;  2V9W A;  2I1Q A;  1U9L A;  4UW9 A;  4Z6D A;  5G5H A;  4RNO A;  4PHE A;  2PFQ A;  2KEY A;  3RFA A;  2ZXH A;  1OUQ A;  2W7P A;  2VJ4 A;  2VAN A;  2IOF K;  3THV A;  4B9V A;  1SKW A;  1ZRM A;  3RJG A;  3MGH A;  3M9N B;  2BPG A;  1A77 A;  3BQ7 A;  3SV3 A;  4C8N A;  1OW5 A;  5GTH U;  5D46 A;  4JWM A;  3RAX A;  7ICV A;  2L5Y A;  5KFG A;  2KKP A;  3V7J A;  1SL0 A;  4KX5 A;  4TUS A;  4F4W A;  5KFN A;  3PV8 A;  4F92 B;  2XY5 A;  5CP2 A;  1JX4 A;  4ED6 A;  2LHT A;  4JB3 A;  3V6J A;  3F2C A;  2DGZ A;  3RJI A;  2QB1 A;  7ICF A;  4UB8 U;  5KFM A;  2W8L A;  2W9A A;  3TAD A;  3TAC B;  9ICW A;  4C8K A;  2ESE A;  2N1R A;  4BWJ A;  1T3Q A;  1Z00 B;  5HMM A;  4C4S A;  4ECR A;  5K4L A;  4Z6F A;  4C8O A;  2IA6 A;  5KFU A;  3AMZ A;  1L3V A;  4AYB F;  3JPT A;  2LI6 A;  8ICL A;  4J9Q A;  4BUG A;  1JXL A;  1XC9 A;  1TAM A;  1DGS A;  4O3R A;  1LKY B;  3HKZ C;  7ICK A;  2A3V A;  2ASD A;  1ZQO A;  5HHI A;  3HWT A;  3QNM A;  1FFU A;  3GU3 A;  5TIS U;  5AK3 A;  3UQ0 A;  2F76 X;  4DL5 A;  3E58 A;  5KT4 A;  3RJE A;  2IOF A;  3HP6 A;  4DL3 A;  4Y2T A;  1L3U A;  4KN4 A;  1COK A;  2HBK A;  5J0O A;  3QUC A;  5ALZ A;  2HMX A;  3F5A A;  2W9M A;  3JPS A;  5ALH A;  4C7Y A;  3QYP A;  3HRD D;  5KT6 A;  4YN4 A;  1UA1 A;  2UVU A;  2WB1 C;  2F1I A;  3AM9 A;  2WFA A;  2E8N A;  2HI0 A;  2Q0Z X;  2J6U A;  3UMG A;  3TI0 A;  2AQ0 A;  4UAV A;  3IN5 A;  5EE3 A;  1WG8 A;  5IIJ A;  2JEI A;  1D8L A;  2RHF A;  2Q4T A;  5FP0 A;  4MF2 A;  3NRZ A;  4O3N A;  2G09 A;  4NXZ A;  1IXR A;  4DFK A;  2VA2 A;  1NOM A;  4NLN A;  9ICS A;  3G6Y A;  3A0H U;  4UB2 A;  4KLJ A;  5KAI U;  9ICX A;  3H0M B;  1ZJM A;  4O5C A;  2M9N A;  5CEH A;  1B0X A;  3TAD C;  5J0P A;  2R8H A;  2EQY A;  5AI8 A;  4P0P B;  4DLG A;  2HHQ A;  4CGZ A;  2AHO B;  5KFD A;  1ZQL A;  3FC4 A;  4UAZ A;  4KN7 A;  1TAU A;  4CF4 A;  3N7S C;  4BXO A;  5AI5 A;  1ZQC A;  4QZG A;  4JUZ A;  3LWL A;  1F5S A;  3UMB A;  5B5E U;  9ICU A;  1QQ7 A;  1S8O A;  2W11 A;  4RPY A;  5J0R A;  3GZF A;  2JGA A;  4CF5 A;  4XUS A;  4EYI B;  3T3F A;  2ZUB A;  5GTI U;  3ZDB A;  4Y2Q A;  1ZRN A;  1YZ6 A;  5J2I A;  2KNJ A;  4RQ3 A;  1N62 A;  1RXV A;  1RG6 A;  5AK5 A;  2OEH A;  9ICO A;  3PR5 B;  1IM4 A;  2BDP A;  5KFR A;  1O08 A;  5AM3 A;  4I29 A;  5IIN A;  2G0A A;  2EZX A;  3ONN A;  3GQC A;  5KG6 A;  5ALR A;  5KFX A;  3C2M A;  4UAR A;  5DQI A;  1KFS A;  3V7L A;  2Y9U A;  4F91 B;  1D8Y A;  5AK6 A;  9ICG A;  4I2I A;  5HR6 A;  5ALY A;  2VJ5 A;  1L8O A;  4NLK A;  4F5Q A;  4YR0 A;  2K8C B;  2YQE A;  5KFZ A;  9ICL A;  4KTQ A;  2UVR A;  1RYR A;  1BPX A;  1YT3 A;  1ED1 A;  3H4B A;  3B0X A;  1JUD A;  2DF4 B;  1L7N A;  8ICV A;  1PZN A;  1BPB A;  4R64 A;  1ZQV A;  2MU2 A;  4I28 A;  2W04 A;  4ICA A;  3C1Y A;  1ZJN A;  1OXJ A;  2LYA A;  2VA8 A;  1RZT A;  1RPL A;  4MF8 A;  4F8R A;  3K1R B;  4WJ3 B;  5DB6 A;  3AU2 A;  5ALP A;  4YMN A;  4DFP A;  2W7O A;  3EWA A;  4RQ5 A;  3B9J A;  5KFQ A;  4ZOH C;  5J2K A;  1YZ7 A;  3JPN A;  2D8C A;  3Q8R B;  2KZM A;  3MDC A;  1Z19 A;  3CRX A;  3I76 A;  3M7D A;  2WF7 A;  4ED1 A;  5KT5 A;  4ED2 A;  8ICT A;  3OHA A;  5AI0 A;  8ICW A;  2HHV A;  4KLM A;  4DSL A;  2HOQ A;  3F5E A;  2JR5 A;  1SXD A;  1JXE A;  4QW8 A;  5J2H A;  4DQP A;  3EUB 2;  2BDU A;  3Q8S B;  4FS2 A;  3HKZ F;  1NKC A;  5C5J A;  4P0Q A;  1Z3E B;  4I2A A;  1ZQZ A;  1ZOL A;  1T94 A;  4C80 A;  2HBM A;  4RUC A;  4KLI A;  1ZET A;  3KHL A;  3WKC A;  4ECU A;  2JMG A;  2OM6 A;  4KMU A;  5KFE A;  3ED5 A;  4Q44 A;  4MFC A;  2XID A;  2WF9 A;  4KLL A;  3MBY A;  4QZD A;  3H4D A;  4DOC A;  3PX6 A;  4ED0 A;  5AKI A;  3QU4 A;  1QTM A;  3ZDE A;  5J2D A;  4MEY A;  2W3R A;  3QU5 A;  3G6V A;  2NRX A;  5DBC A;  4Y2Y A;  4CCH A;  2B21 A;  2KZZ A;  3L5K A;  7ICU A;  2ZJ8 A;  3BJY A;  4DO9 A;  5HHH A;  3RR8 A;  1NJZ A;  1ZD4 A;  1JRP A;  5J2A A;  3KTQ A;  4DSF A;  3K4G A;  5DQH A;  1U47 A;  4KLU A;  2W9B A;  3UPQ A;  4EBC A;  1TAQ A;  3PX4 A;  2VA3 A;  3BDP A;  4ED7 A;  1Z1B A;  3D2Q A;  1LVH A;  3D2S A;  2XY6 A;  4J9O A;  3QX7 A;  2AGP A;  2I5H A;  5KT2 A;  5AKX A;  2LMR A;  4J03 A;  4HYK A;  2GOL A;  4M04 A;  1XSP A;  1NKE A;  8ICF A;  3UXP A;  3C28 A;  3KFU F;  3I1Y A;  2RDI A;  7ICM A;  3PW0 A;  2B0C A;  8ICQ A;  2BCQ A;  2XIC A;  4KLT A;  3MAB A;  4Y2P A;  4B9M A;  1SZP A;  4JV1 A;  4BJQ A;  4IQW A;  1NK7 A;  1MC8 A;  1L5U A;  3S6J A;  3GV5 B;  2H3V A;  4RQN A;  1WUD A;  1VJ5 A;  3I28 A;  1O03 A;  3WK5 A;  2F3N A;  4PPX A;  3PMN A;  1Z4O A;  1ZQM A;  3AEV A;  3SAF A;  2R8G A;  2AXT U;  4QZC A;  3IG5 A;  1SWV A;  3IV6 A;  3WK4 A;  1RXW A;  1F0M A;  5HML A;  4JK1 A;  3QZ7 A;  7ICL A;  5KNI A;  3L4P A;  4DOB A;  3T79 A;  5TZV A;  4F5P A;  2K60 A;  1BPD A;  4Y2U A;  9ICT A;  5D49 A;  4EX6 A;  5L1M A;  4C8L A;  3GIM A;  8ICK A;  3WKE A;  4RU9 A;  4ECW A;  4NL9 C;  5ALO A;  1Y88 A;  5BPC A;  2J6S A;  1ZXI A;  2ISP A;  1JAL A;  3BQ0 A;  2E8O A;  3N28 A;  3M6K A;  3GIK A;  4F5R A;  3MDA A;  1X6J A;  4ECY A;  3RBD A;  4GIB A;  3IG8 A;  3T5L A;  1U45 A;  1ZQD A;  1CUK A;  2XC9 A;  1C20 A;  3GIL A;  3HIL A;  5J0U A;  5KFV A;  1ZQJ A;  2GLE A;  1KKX A;  2K4H A;  3NAS A;  2FMS A;  5CA7 A;  5IIL A;  2ZTC A;  4OJL A;  1RQL A;  1RM6 C;  3OJS A;  3RTV A;  3E2E A;  4GXI A;  2NRV A;  5JTI A;  4Z6E A;  4UB6 U;  4I2E A;  4UAS A;  4M6W A;  4OO1 J;  4NL9 A;  3UXO A;  5J0Y A;  2E3T A;  3WK9 A;  2E1F A;  1ARO P;  5L1K A;  2H3Z A;  3MGI A;  1KLN A;  2EH9 A;  4XQ8 A;  4NLC A;  7ICT A;  3RB6 A;  2HHT A;  3ICX A;  2HOF A;  4R65 A;  2EAP A;  4TUQ A;  1L6N A;  1TK0 A;  2YMP A;  3QU9 A;  4UAY A;  1PVP A;  3BS7 A;  3TFR A;  1T3N A;  4DFM A;  1X2I A;  1S0O A;  2DPJ A;  1NK4 A;  3MR6 A;  2JHD A;  5J0W A;  2C2D A;  1KN5 A;  2H5X A;  3QUQ A;  4NY8 A;  1L8L A;  2GWS A;  3EPI A;  4FO6 A;  3N4M B;  1QLN A;  3CW2 C;  3NVW A;  3BS5 B;  1N56 A;  4YMM A;  4NM1 A;  4M6W B;  3IP4 B;  5J0S A;  2AJQ A;  1X66 A;  3H40 A;  1QSY A;  1MA7 A;  7ICE A;  2PXI A;  2YMQ A;  4QZ8 A;  2AH5 A;  1N48 A;  2CN1 A;  2NRZ A;  4AP9 A;  3QU7 A;  5IIK A;  3C1Z A;  3RR7 A;  2H3I A;  1CEZ A;  9ICI A;  2F8K A;  4E0D A; 
#chains in the Genus database with same CATH homology
 4LJX A;  2LM1 A;  1KQQ A;  2OEH A;  2KK0 A;  5CEH A;  2JRZ A;  1KN5 A;  1KKX A;  2RQ5 A;  1IG6 A;  2JXJ A;  1C20 A;  2LI6 A;  5K4L A;  1RYU A;  2CXY A;  2EQY A;  2EH9 A;  2YQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...