1C20A

Solution structure of the dna-binding domain from the dead ringer protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAAFTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEAD RINGER PROTEIN
publication title Solution structure of the DNA binding domain from Dead ringer, a sequence-specific AT-rich interaction domain (ARID).
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1c20A00
5K4LA 2CXYA 1IG6A 1RYUA 5CEHA 1KKXA 1KQQA 2RQ5A 1C20A 2EQYA 2JRZA 1KN5A 2JXJA 2KK0A 4LJXA 2EH9A 2YQEA 2LM1A 2LI6A 2OEHA
chains in the Genus database with same CATH superfamily
1JROA 4DLEA 4IRCA 1OXJA 4I2AA 3GQCA 3ISBA 1O03A 5J8YA 1BPEA 3BQ7A 2KJ9A 5DB6A 1KRPA 5AK5A 3ZDDA 1BGXT 2BQUA 2DPIA 4F4KA 4GC7A 4RNNA 2C28A 1ZOLA 1T3NA 3CRXA 3OTQA 1A0PA 3QXGA 2VIXA 4E0DA 1V38A 4J9MA 1ZQGA 4DLGA 1URJA 2B21A 3F2DA 3UXPA 4UW9A 7ICTA 3ALRA 5AKIA 3IN5A 4ELVA 2HW3A 2LMRA 4YR3A 7ICOA 2ZTEA 4MF2A 2H3IA 5KT3A 1H38A 4KTQA 1RZTA 3EW9A 4GXJA 3VC8A 1QLNA 3DDHA 1TFRA 5KFYA 3EPGA 2M0NA 3PZPA 2K89A 5DG7A 3OJUA 5IIMA 1ZD5A 4KX5A 3M7DA 2E3TA 4ACOA 4TQRA 4ECZA 2BDUA 3PW4A 1ZQMA 5IILA 3B9JA 5KFGA 3HKZF 4MEXA 1TK8A 4O3RA 2ESEA 3PSPA 3EYZA 3A0BU 5HMLA 2ZTDA 2WAQC 4XA5A 3GV8B 2DKZA 5EE9A 3O0FA 4QZIA 2EZYA 5ALPA 5DDMA 2BKEA 4IRDA 4J9RA 4KLGA 4DOBA 4B9TA 3JPQA 1TAQA 4DFDA 7ICVA 4R8UB 5ALWA 5J2JA 4C80A 2PXIA 2PI5A 4DL4A 5J2HA 4J9OA 2ZXHA 4IR9A 4QZCA 4R66A 1JUDA 2KIVA 2CPRA 3LK9A 2Y1IA 3JPOA 7ICJA 2AU0A 2YX8A 2ODGA 5J8YC 5HP4A 3HT3A 2ZXIA 8ICPA 4XRHA 5AKHA 3QEBZ 4UBCA 4IQUA 5AI5A 2J6TA 1UT5A 4ED1A 2JEFA 2HOIA 4U7CA 2HBJA 3QU2A 2BCVA 4YR2A 1KN5A 5AI9A 1BPDA 2HMXA 3L5KA 5ALYA 1ZQAA 1KSPA 4B9VA 4Q8FA 2QB0B 4ED8A 4NL9A 3F2BA 3FM9A 1SV4A 1PK1A 4RQMA 1PVQA 4ECXA 4IS7A 5ALXA 2H3VA 5AM3A 5AKXA 4CF4A 4LVSA 3G6XA 2HDOA 3AQFA 5ALIA 4UAYA 5TISU 2OH2A 1SXEA 4J03A 2FDRA 5KFSA 2Y0SF 1MC8A 4F5NA 2FJ6A 1N2XA 4JV2A 3V7KA 5L9XA 3F2CA 4J9SA 4UASA 1L3VA 3QUTA 3OJSA 8ICVA 2XIDA 9ICBA 4PHAA 2BQRA 4DL7A 1YZ7A 5ALQA 2K60A 2E8PA 5H2FU 3NUQA 8ICWA 9ICVA 2F8LA 2KHVA 5ALJA 1VLBA 4C7YA 5ALEA 1TAMA 2NO4A 9ICUA 1MA7A 1ZQUA 1ZD2P 2QLTA 2BPFA 3GIMA 2G07A 2V9WA 1QQ5A 2LYHA 1X6IA 4C4TA 4P0PB 3N7SC 2EAOA 4P4OA 2C22A 1S8OA 4RQ6A 2F1JA 5KFXA 3I1YA 1T3QA 3B0YA 1X9WA 4EZ6A 2YY6A 1QH9A 4IL6U 3T3FA 4DSLA 4OJPA 5DB8A 1YZ6A 1OW5A 3Q8PB 1SGGA 4JV0A 2KTQA 3SMVA 5J29A 1XWLA 1WWVA 8ICCA 2EDUA 1UCVA 4I2EA 3RJGA 1WYGA 3TAQA 5AKKA 3TACB 2ZJAA 3MDCA 2QKQA 4BWMA 5DGAA 5ALRA 5DQIA 1COOA 1X40A 4C7ZA 1D8YA 2BQ3A 2ISPA 1Q46A 3M6ZA 3PSIA 5KFTA 4NM2A 3NVYA 2JGAA 4RUCA 5J0TA 4NL9C 5KFRA 2F2AB 3PSFA 3RBEA 2KOBA 3TFRA 3M9NB 1IV8A 5DB7A 4DQRA 5CHGA 2WF9A 1F0MA 2ZIXA 1U47A 2BCUA 2UVWA 3D6JA 1S5LU 1KQQA 1A77A 3C5FA 1Z19A 3PMNA 4RPZA 4JUZA 1SWVA 1Z00A 3GIKA 3D2NA 5AK3A 5ALDA 3PW5A 2BPGA 8ICNA 2ZUBA 4YMMA 5K4LA 2KFZA 3SQIA 4YN4A 1Q8KA 5TZVA 3S6JA 2F77X 3BZKA 3MGIA 2KKPA 5KFAA 3UPQA 2OYYA 2H3QA 8ICEA 8ICIA 2ASDA 4PGQA 2R8HA 3JPTA 3GIJA 4K4GA 4FZMA 2RDIA 5ALZA 3RJEA 4ELTA 4DFMA 4DOAA 5ALVA 4LZGA 4B9LA 8ICJA 3WKBA 1JIHA 2G09A 3ZDBA 3IHQB 4GLXA 2EANA 5JTIA 4J9PA 5ALKA 5KL1B 4JB3A 4YR0A 5C0YA 3OSNA 4J9KA 4QZFA 1NK0A 3CYMA 2DF4B 1SZPA 4R64A 1XNSA 7ICPA 4M0AA 4KLDA 3IV6A 2AGPA 2ZIWB 3R9KA 3WK5A 4F5QA 2P6UA 1CI4A 3SYZA 2UVVA 2NV3A 4YFKA 2PFQA 3WU2U 1DGSA 3WK4A 4LJXA 4YCXA 1UHUA 3ZD8A 3KKAC 3RR8A 3OHBA 2IOFA 1ZJNA 2W43A 1FFUA 2JZBA 2W3SA 3TKAA 1BNPA 9ICCA 1J2MA 9ICNA 1JRPA 3BQTA 1SXDA 2I6XA 3WK7A 2XC9A 3H0RB 4KLUA 4Y2UA 2W8LA 1UA1A 3QX7A 4KLOA 2DKXA 4M9JA 2G0AA 3CP8A 4I29A 3PW0A 3SAHA 1N62A 4J9NA 1T4GA 3UXNA 4QIWC 3ISDA 1ED1A 4KLSA 4OJLA 4Y2RA 2DBYA 4UB3A 5CR0A 4CNQA 1RG6A 4BUGA 1XSLA 2KE7A 5AI0A 5HHIA 2IOFK 3Q8MA 5AKZA 2HOFA 3AU6A 3TANA 3PX0A 1C7YA 5AM4A 2BCRA 3PNCA 1KEJA 5EE0A 1PVRA 1UQVA 4ED0A 5EWFA 3Q8QB 2PI4A 7ICUA 3E2EA 5KG1A 5DDYA 3NVWA 4C8KA 2D6FC 1X6JA 1HUOA 1JXEA 2HHWA 1QSLA 4ECSA 4OJOA 4RQ1A 2KK0A 1N60A 4TUPA 7ICHA 3SAFA 3MFHA 3QU5A 4ECUA 4BGDA 9ICOA 4UAWA 4YMNA 4NXZA 2ZIUB 3OHAA 3C2LA 3RAQA 1SB3C 4OJ6A 4R8UA 3LWMA 4KLJA 1NNLA 1CUKA 4I2IA 2IHNA 1KFDA 2NRVA 1V85A 3UXOA 2KICA 2WF7A 3GU3A 2KMDA 1DRGA 4O3NA 4F5RA 4QJFB 3TFSA 1X42A 2WHEA 2FLNA 3BJYA 4IR1A 1K1SA 3N28A 5IIKA 1ECWA 1XO1A 4FFDA 4GIBA 4K4IA 4PPXA 4PJ0U 3IG5A 2A1JB 4Y2SA 4RPXA 4Z6DA 1ZQEA 2NRWA 2ISOA 2XY7A 1TK5A 4M2YA 1NK4A 4B9MA 4OD0A 3T79A 1O08A 3C23A 2QB0A 4MF8A 1RQLA 2OXOA 3RR7A 4J9LA 5J0RA 3AM9A 4QW8A 2YQEA 2ASJA 3H8SA 5AKEA 8ICMA 5EWGA 5BOMA 3RB3A 1KFTA 4F4ZA 2AGOA 2H3FA 2I9GA 2AXTU 5CA7A 3M8RA 2JRZA 3UMBA 3RRHA 2JZBB 2KIWA 1S97A 1LKYB 4EENA 1ZQHA 3C2MA 3IM1A 2VANA 4EZ9A 1SZHA 2CXYA 3MR3A 5AKYA 7ICIA 1NK8A 1CRXA 3MR2A 2XGQA 3RTVA 5D49A 5KFQA 2PMZF 3Q8SB 3RB6A 3U26A 1L7OA 1JMSA 4B6JA 1ZQZA 4CF5A 4US8A 2LPEA 4ED7A 4DS5A 8ICUA 4DF8A 2WTFA 1PK3A 1N56A 1TE2A 1S0MA 1X66A 4UAZA 3Q8LA 4A8EA 3M8SA 4P0PA 2K4EA 2W9MA 3UMCA 2K8BB 2OWOA 2C2RA 1KLNA 1ZQJA 2XVTA 3PSTA 5J2GA 3H4DA 4NWIA 1ZQTA 2M9NA 2YMLA 3WKEA 4F92B 8ICYA 4F3OA 3TARA 3KZXA 1MSWD 3ETLA 3ISCA 1DXSA 1S77D 7ICMA 3FYHA 2CN1A 3IRUA 1HIWA 1VJ5A 1NJXA 5AM5A 1C20A 5EWEA 3BDPA 3A0HU 2B0CA 3CNHA 5DBCA 4PGXA 2KG5A 3BQ0A 2KFNA 3G6YA 4MHVA 4QWCA 9ICGA 5KFJA 4ECQA 2MUTB 4F50A 4FS2A 4EBCA 1ZQQA 3WK6A 1TV9A 3JPSA 2AQ0A 2N1RA 4GFJA 5KT2A 5DKWA 1Z4OA 4Q44A 1P7DA 4R65A 4M9HA 3KHLA 3C1YA 3EWAA 2KJ5A 3F5AA 4NLBA 5CJ7A 2XO7A 3Q8KA 4RQ5A 1IG6A 4QWEA 1V97A 3GFKB 3I28A 4DL5A 1ZQPA 2JMGA 3HW8A 2DQNB 2WB1C 4DEZA 2JEGA 3BZCA 4EX7A 4DSKA 3MABA 4M04A 4TQSA 3D2SA 1ZQWA 4JWNA 2FI1A 5GTHU 1K1QA 2QARB 5ALMA 4DSEA 3BQ2A 4DWIA 2YMMA 4DFKA 4I2HA 2NRZA 2Y1JA 4RUAA 1N48A 4UBBA 1SV0A 8ICXA 2JXJA 4F93B 2MRLA 4RQ8A 1ZRNA 2ZJ5A 2XICA 2E1EA 2PFPA 2ZUDA 2XGPA 2UVUA 3UMGA 4KLIA 4RNOA 3TI0A 1S76D 2Q4TA 3NASA 5G5HA 5KFHA 2OCEA 4C8NA 4AYBC 2BPCA 4CE6A 1RXWA 2G08A 5AIBA 2ZIWA 2KSOB 2PKEA 3SENA 5J0QA 5AI4A 4I27A 3DV9A 3SR6A 5FP0A 5KT6A 2GH1A 4DCCA 5AI6A 2R8IA 2YB1A 1ZQ1C 5ALGA 1OUQA 1F5SA 5KNIA 4LZDA 7ICSA 3RJFA 3DEEA 5KT7A 5ALNA 4QZEA 2FPLA 2KJ8A 8ICAA 1D9DA 1SWWA 5IIIA 2CRXA 2LBOA 4G9BA 1UPHA 1XS9D 1XO0A 4F2RA 2IMWP 4DF4A 1WCLA 3V6HA 4CF3A 1NI3A 2ZTCA 2A19A 2HI0A 2BGWA 2P6RA 1A76A 2F1HA 1JALA 3FAHA 1L5UA 4Z6CA 5KT5A 4ED3A 1ZQBA 4O3SA 2B6GA 1LV5A 1DK2A 2OEHA 4C4RA 4EYHB 2FMSA 2E8OA 4RPYA 8ICFA 4JK1A 3HKZC 3F5EA 4DL6A 4QNLA 4RT3A 4G3IA 2NRXA 2C2DA 4QZGA 1AROP 1ZQOA 2ZIUA 4I2CA 1NJYA 8ICZA 2KVCA 1RXVA 1QQ6A 4EELA 1TVAA 3LVWA 4PZNA 5D46A 5J2DA 2JH1A 8ICKA 2AH5A 4KLTA 2Y9TA 2Z7JA 2RHFA 5KG7A 3THVA 1XC9A 4I2JA 2AJQA 4FBTA 2G5HB 1HEKA 2ZIVB 1L8OA 2W55A 2ZG6A 4KLFA 4DO9A 3C28A 3ZI4A 3AQEA 4ECWA 5AIAA 1ZRMA 5AHXA 2HHTA 1COKA 3C1ZA 3PVXA 2KVSA 5KG5A 3M6KA 4DQQA 2W9AA 2A1JA 4O3MA 3RH5A 1ZQVA 1NKBA 4ZH4A 5AKLA 4RQ3A 3BS5B 3I76A 3PY8A 2FPKA 3QU7A 3ZD9A 2ALZA 2R8GA 5DQGA 4KMUA 3KD3A 4I2BA 1S0NA 5KG4A 4FE3A 3HRDD 1X9MA 1L7PA 1MQ2A 2AGQA 3RAXA 5KFEA 2E1FA 2JV3A 2JHDA 5KFOA 3MFIA 2PFOA 1DK3A 3IG8A 2J6SA 3M9MB 2NO5A 2KZZA 1J2NA 1JI7A 3H40A 1Y88A 3QUCA 4PZOA 5KG6A 5T14A 4P2HA 1BVSA 5D4BA 4FZNA 3NGDA 2RDJA 4KN4A 4KLMA 1B22A 5L1JA 4UQGA 3C5GA 4US9A 9ICFA 3V72A 4QWDA 4I28A 5L1LA 2Y0SC 1LKYA 3H8WA 3LWLA 5DG9A 5JUMA 2W9BA 2VA3A 4BDPA 1ZQFA 5CP2A 2L5YA 4C8MA 2V4RA 2A3VA 1N5WA 1TAUA 4BX9C 3RJIA 2E8NA 4KX3A 1HUZA 2XCPA 5F9NA 4PGYA 3KTQA 2DWQA 3RB0A 4NLCA 3HX0A 4PHPA 3GILA 1Z3EB 5HHHA 4EBDA 2FE9A 4HAIA 4KITB 1ZQDA 4YP3A 2NRTA 1IM4A 1L6NA 1PUZA 1NK9A 2A1AA 2WAQF 5KFUA 2D8CA 5IINA 2AQ4A 2FMPA 8ICSA 1QSSA 3NVVA 1KKXA 1IXRA 2KV2A 3SEIA 5KFVA 3PO5A 1Q3VA 1B4FA 4PHDA 4MEYA 2KHQA 4DSIA 4O3OA 1TK0A 4MFCA 5GTIU 1KTQA 4DQSA 4YD2A 3QZ8A 4RQ0A 4BWJA 7ICEA 1RYRA 1D8BA 1T8EA 4NLKA 3QE9Y 3FDSA 3RB4A 4EBEA 1SKWA 2MUTA 2J6UA 2YMPA 5L1MA 1Z1BA 1KDHA 3N97B 3RJJA 1WWUA 4EEKA 2RRDA 4J9QA 4KMOB 1NKCA 1L3SA 3C21A 2ZJ8A 2BZFA 3HILA 3MR6A 1QSYA 1FIQA 3ONNA 5ALFA 2W9CB 1BPYA 4Y2TA 5AM2A 2HHQA 9ICEA 3MR5A 8ICTA 2XY6A 4B9NA 5BOLA 3RH4A 3LYSA 4ED6A 1N61A 1B0XA 4NV0A 5AK4A 3QUBA 1U9LA 1U4BA 2LYAA 5CRXA 9ICWA 1Z1VA 2E8MA 2VKQA 2HOQA 3PW2A 3PV8A 5J2IA 3N7PD 4ECRA 4C0ZA 1SL2A 5KFLA 3V7JA 1UA0A 5F9LA 2QARA 4ICAA 4RU9A 3KHRA 4CGZA 4UB8U 4Z6FA 3PX4A 1SKRA 2JEJA 4YG2A 1DGJA 4NM1A 3UQ0A 3SV3A 4BXOA 5EOZA 1U48A 4XQ8A 2E5SA 2EQYA 5DQHA 8ICHA 4P0QA 5ALUA 2G06A 3ZDEA 4FBUA 5J2FA 1ZQYA 2W9BB 3MGVA 3AL0B 3OSPA 2F3NA 2WF6A 2W7PA 4IC9A 1JXLA 3SV4A 2ES6A 4B9SA 1L3TA 1BPZA 1EXNA 2C2EA 2F1IA 2KSOA 5HMMA 4YMOA 3JPPA 4Y2QA 5J2EA 2FPMA 7ICFA 4O9MA 3K75D 1IIPA 5AICA 1XSPA 4NLNA 2FLLA 4BJQA 2KEYA 1SIJA 4FS1A 3L3FX 2P35A 2P66A 1KFSA 3GV7B 3QZ7A 5KG0A 5JU5A 2GO7A 4RQ4A 3MBYA 2HSZA 4Q45A 1JX4A 3D2QA 1F44A 4UATA 2RP5A 4IQTA 9ICSA 5J0YA 3ED5A 3GZFA 3HPOA 3EUB2 4M6WA 1FO4A 3ZDAA 5KFFA 1MN8A 4UB1A 4HYKA 2FMQA 5HNKA 3UM9A 2W8KA 4DS4A 1U49A 2PFNA 2KKVA 3GDXA 4NJ8A 4M47A 2V4QA 1KW4A 4OJ5A 3VCBA 9ICXA 2YN4A 4DOCA 1BPBA 7ICNA 3IDWA 1ZQCA 5L1KA 1V9PA 1RYUA 2HVIA 3K1RB 3MGHA 2VJ5A 4DQPA 2ZUCA 4YXJA 4RNMA 3SAGA 2OHFA 2KZ3A 5G5GA 4M9GA 5ALLA 3KHGA 4YQWA 3H4BA 8ICOA 3MDAA 2GWSA 3RBDA 2HVHA 2LI6A 4UB4A 1B43A 4OCZA 2K8CB 4CCHA 2K4HA 5KG3A 2F76X 5E79U 2JEIA 2I5HA 4KN7A 3WK8A 2HHSA 4IRKA 4QZ9A 4X5VA 3KHHA 4DSJA 3AN1A 4KLLA 5BPCA 4TUQA 1JN3A 5KFNA 2VA2A 3BS7A 2WFAA 3RJHA 3F53A 4QZBA 2ZIVA 2H3ZA 3KBBA 5KFIA 2HHUA 2RQ5A 4ECYA 3H8MA 4DFJA 9ICKA 4C8LA 5AM1A 3WKDA 2DGZA 1K5OA 4BXOB 1PVPA 4KLEA 1ZYQA 2RLTA 3SD7A 4U6PA 2G5IB 4USAA 2JH7A 4I2FA 3AMZA 5HR6A 4P0QB 4FZLA 1S0VA 1J97A 3C2KA 3BS5A 1QQ7A 4UB2A 3RFAA 9ICTA 4K4HA 2DPJA 2OM6A 4RZRA 4F4WA 4M9LA 3CW2C 2F8KA 2IA6A 1NJZA 4I2DA 3M9OB 2R8JA 2FLPA 4WJ3B 1ZD3A 4UARA 5DG8A 9ICIA 5KFKA 4RT2A 3QNMA 1ZJMA 2BHNA 8ICQA 1ZQNA 4C8OA 3K4GA 3WKCA 4QZHA 2LKYA 4GXIA 4TURA 1NK5A 3QU9A 2F44A 5ALSA 4QIWF 1PZNA 1UT8A 1XU4A 2K4PA 4TUSA 4QZAA 1RDFA 2UVRA 5J0SA 1SL0A 1RPLA 2WF5A 5KFPA 2KZMA 3RH6A 5J2KA 5HR7A 5EE1A 5EE3A 5CB1A 3QYPA 2LHTA 3OGUA 4GC6A 2MA1A 5DLGA 7ICKA 2W04A 1CEZA 3PO4A 4M6WB 4P4PA 4RQNA 2MSNA 2K4IA 4M9NA 5J2AA 2PMZC 3ZDCA 3ETRA 3QUQA 4JWMA 2YB4A 3QEAZ 1NK6A 5B5EU 3BQ1A 4Y2XA 1WCNA 3E58A 5ALTA 2IBKA 2EZZA 1U45A 4YVZA 4CRXA 3KFUF 5DGBA 3H0MB 5L1IA 1N5XA 4UAVA 4XUSA 9ICAA 5KAFU 9ICJA 4ZOHC 3J81j 1ZQKA 4Y2YA 2IOHA 3KKAA 1GO3F 3HWTA 9ICRA 1SV0C 5DBBA 5C5JA 1T94A 2W3RA 3ORYA 1BNOA 4ECTA 5DBAA 2W03A 5KFBA 5J2BA 1NZBA 5DLFA 4F5OA 2EAPA 1N63A 1NKEA 4AP9A 4QWAA 4IQWA 2HHVA 1FFVA 7ICLA 5ALHA 1AQ6A 1KL9A 4O0IA 5A0LA 1DOQA 2KD1A 4PHEA 1XSNA 1ZQLA 4EX6A 4CDGA 2HHXA 3JPRA 2W9CA 1BPXA 2DL0A 3V6JA 1MQ3A 4O5KA 2W11A 4F4YA 4PL2A 4P4MA 9ICMA 4NLGA 1RQNA 2QB1A 3ICXA 4RQ2A 4YXMA 3NVZA 4RQ7A 2R18A 1RYSA 1Q3UA 5J0OA 3H8JA 1PK1B 3RF9A 3FC4A 4F2SA 1ZQRA 5J0WA 2HBMA 1NOMA 5JRTA 2BDPA 3IP4B 4Z6EA 4F4XA 3HP6A 4DL2A 1X2IA 1RM6C 5KFWA 5J0XA 4IQVA 3T5LA 3H7IA 3L4PA 3N7RC 3MC1A 2K8AA 3PMLA 1HJPA 4UAUA 3C29A 3TADA 2EH9A 5J2CA 5DB9A 5KAIU 3EZ5A 3HJEA 3N4MB 5AKGA 1X9XA 4F72A 3NS1A 1QCKA 4GXKA 5KFDA 4YD1A 3GIIA 1LVHA 3QU4A 5ALOA 5J0PA 2JR5A 1ZETA 4F71A 1L3UA 2W7OA 1D9FA 4DQIA 3PR5B 3H0LB 4QZDA 9ICQA 3UQ2A 4OO1J 3AUOA 4O3QA 3T5HA 1ZQXA 3LVVA 1KBUA 1ZQIA 2D3DA 4Y2VA 1ZXIA 1SL1A 9ICLA 7ICQA 3G6VA 2BR0A 2XY5A 3M1YA 2WF8A 2ATLA 1QTMA 2IHMA 2HBLA 2AHOB 8ICBA 7ICGA 2KN7A 2EZXA 4DSFA 4B9UA 5IIJA 1S9FA 1LB2B 3OPXA 5F3XB 5AI8A 4C4SA 1NZPA 3WKAA 3GV5B 3SZ2A 3SI8A 8ICLA 2YTUA 2DFLA 4PL1A 1NK7A 3WK9A 1FEZA 4O5CA 5KT4A 3AEVA 1T7PA 4DFPA 1L7MA 5AKJA 2I1QA 3NTUA 2LM1A 1WG8A 2LYBA 4NLZA 5KG2A 4MFAA 1L7NA 1D8LA 3PX6A 3KZIU 8ICGA 4QZ8A 5AK6A 4EEYA 1S10A 1VDVA 9ICHA 4ED2A 4KLQA 1NJWA 5B66U 3NRZA 2ZIXB 3T5KA 2GOLA 4MFFA 3TAPA 2BCSA 2MAXA 2XCAA 2R8KA 4Q43A 2WB1F 1Z00B 2Y9UA 4NY8A 5CWRA 4JV1A 3V7LA 3TQ1A 2DUYA 4QW9A 5KL8B 3JPNA 2VA8A 2BCQA 3TADC 2Q0ZX 2KNJA 4F5PA 4JMUA 5J0UA 3T5JA 2ASLA 4O5EA 5KTQA 5AM0A 5KFZA 1Z4NA 4I2GA 3RJKA 7ICRA 4F91B 2YMQA 4QWBA 2MU2A 2LM4A 1TKDA 2HCFA 1L8LA 4ECVA 3Q8RB 3RRGA 4KLHA 4FO6A 4Y2JA 4PH5A 3NRWA 1S0OA 5CEHA 9ICPA 3B0XA 4UB5A 5KFMA 3PR4A 2KP7A 8ICRA 4DL3A 3EPIA 2O6KA 3KOOA 3AU2A 3K1ZA 4R63A 1M6YA 4F8RA 3LDAA 4O3PA 1SKSA 4ELUA 4AYBF 1WUDA 4UB6U 5KFCA 2XI9A 4EYIB 4Q8EA 2HBKA 3E0FA 1ZD4A 1YT3A 1ZQSA 2EAMA 5IIOA 2H5XA 1A6SA 2W54A 4Y2PA 3PW7A 2GLEA 2NYVA 2VJ4A 3V6KA 1X9SA
chains in the Genus database with same CATH topology
5K4LA 2CXYA 1IG6A 1RYUA 5CEHA 1KKXA 1KQQA 2RQ5A 1C20A 2EQYA 2JRZA 1KN5A 2JXJA 2KK0A 4LJXA 2EH9A 2YQEA 2LM1A 2LI6A 2OEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K4L A;  2CXY A;  1IG6 A;  1RYU A;  5CEH A;  1KKX A;  1KQQ A;  2RQ5 A;  1C20 A;  2EQY A;  2JRZ A;  1KN5 A;  2JXJ A;  2KK0 A;  4LJX A;  2EH9 A;  2YQE A;  2LM1 A;  2LI6 A;  2OEH A; 
#chains in the Genus database with same CATH topology
 1JRO A;  4DLE A;  4IRC A;  1OXJ A;  4I2A A;  3GQC A;  3ISB A;  1O03 A;  5J8Y A;  1BPE A;  3BQ7 A;  2KJ9 A;  5DB6 A;  1KRP A;  5AK5 A;  3ZDD A;  1BGX T;  2BQU A;  2DPI A;  4F4K A;  4GC7 A;  4RNN A;  2C28 A;  1ZOL A;  1T3N A;  3CRX A;  3OTQ A;  1A0P A;  3QXG A;  2VIX A;  4E0D A;  1V38 A;  4J9M A;  1ZQG A;  4DLG A;  1URJ A;  2B21 A;  3F2D A;  3UXP A;  4UW9 A;  7ICT A;  3ALR A;  5AKI A;  3IN5 A;  4ELV A;  2HW3 A;  2LMR A;  4YR3 A;  7ICO A;  2ZTE A;  4MF2 A;  2H3I A;  5KT3 A;  1H38 A;  4KTQ A;  1RZT A;  3EW9 A;  4GXJ A;  3VC8 A;  1QLN A;  3DDH A;  1TFR A;  5KFY A;  3EPG A;  2M0N A;  3PZP A;  2K89 A;  5DG7 A;  3OJU A;  5IIM A;  1ZD5 A;  4KX5 A;  3M7D A;  2E3T A;  4ACO A;  4TQR A;  4ECZ A;  2BDU A;  3PW4 A;  1ZQM A;  5IIL A;  3B9J A;  5KFG A;  3HKZ F;  4MEX A;  1TK8 A;  4O3R A;  2ESE A;  3PSP A;  3EYZ A;  3A0B U;  5HML A;  2ZTD A;  2WAQ C;  4XA5 A;  3GV8 B;  2DKZ A;  5EE9 A;  3O0F A;  4QZI A;  2EZY A;  5ALP A;  5DDM A;  2BKE A;  4IRD A;  4J9R A;  4KLG A;  4DOB A;  4B9T A;  3JPQ A;  1TAQ A;  4DFD A;  7ICV A;  4R8U B;  5ALW A;  5J2J A;  4C80 A;  2PXI A;  2PI5 A;  4DL4 A;  5J2H A;  4J9O A;  2ZXH A;  4IR9 A;  4QZC A;  4R66 A;  1JUD A;  2KIV A;  2CPR A;  3LK9 A;  2Y1I A;  3JPO A;  7ICJ A;  2AU0 A;  2YX8 A;  2ODG A;  5J8Y C;  5HP4 A;  3HT3 A;  2ZXI A;  8ICP A;  4XRH A;  5AKH A;  3QEB Z;  4UBC A;  4IQU A;  5AI5 A;  2J6T A;  1UT5 A;  4ED1 A;  2JEF A;  2HOI A;  4U7C A;  2HBJ A;  3QU2 A;  2BCV A;  4YR2 A;  1KN5 A;  5AI9 A;  1BPD A;  2HMX A;  3L5K A;  5ALY A;  1ZQA A;  1KSP A;  4B9V A;  4Q8F A;  2QB0 B;  4ED8 A;  4NL9 A;  3F2B A;  3FM9 A;  1SV4 A;  1PK1 A;  4RQM A;  1PVQ A;  4ECX A;  4IS7 A;  5ALX A;  2H3V A;  5AM3 A;  5AKX A;  4CF4 A;  4LVS A;  3G6X A;  2HDO A;  3AQF A;  5ALI A;  4UAY A;  5TIS U;  2OH2 A;  1SXE A;  4J03 A;  2FDR A;  5KFS A;  2Y0S F;  1MC8 A;  4F5N A;  2FJ6 A;  1N2X A;  4JV2 A;  3V7K A;  5L9X A;  3F2C A;  4J9S A;  4UAS A;  1L3V A;  3QUT A;  3OJS A;  8ICV A;  2XID A;  9ICB A;  4PHA A;  2BQR A;  4DL7 A;  1YZ7 A;  5ALQ A;  2K60 A;  2E8P A;  5H2F U;  3NUQ A;  8ICW A;  9ICV A;  2F8L A;  2KHV A;  5ALJ A;  1VLB A;  4C7Y A;  5ALE A;  1TAM A;  2NO4 A;  9ICU A;  1MA7 A;  1ZQU A;  1ZD2 P;  2QLT A;  2BPF A;  3GIM A;  2G07 A;  2V9W A;  1QQ5 A;  2LYH A;  1X6I A;  4C4T A;  4P0P B;  3N7S C;  2EAO A;  4P4O A;  2C22 A;  1S8O A;  4RQ6 A;  2F1J A;  5KFX A;  3I1Y A;  1T3Q A;  3B0Y A;  1X9W A;  4EZ6 A;  2YY6 A;  1QH9 A;  4IL6 U;  3T3F A;  4DSL A;  4OJP A;  5DB8 A;  1YZ6 A;  1OW5 A;  3Q8P B;  1SGG A;  4JV0 A;  2KTQ A;  3SMV A;  5J29 A;  1XWL A;  1WWV A;  8ICC A;  2EDU A;  1UCV A;  4I2E A;  3RJG A;  1WYG A;  3TAQ A;  5AKK A;  3TAC B;  2ZJA A;  3MDC A;  2QKQ A;  4BWM A;  5DGA A;  5ALR A;  5DQI A;  1COO A;  1X40 A;  4C7Z A;  1D8Y A;  2BQ3 A;  2ISP A;  1Q46 A;  3M6Z A;  3PSI A;  5KFT A;  4NM2 A;  3NVY A;  2JGA A;  4RUC A;  5J0T A;  4NL9 C;  5KFR A;  2F2A B;  3PSF A;  3RBE A;  2KOB A;  3TFR A;  3M9N B;  1IV8 A;  5DB7 A;  4DQR A;  5CHG A;  2WF9 A;  1F0M A;  2ZIX A;  1U47 A;  2BCU A;  2UVW A;  3D6J A;  1S5L U;  1KQQ A;  1A77 A;  3C5F A;  1Z19 A;  3PMN A;  4RPZ A;  4JUZ A;  1SWV A;  1Z00 A;  3GIK A;  3D2N A;  5AK3 A;  5ALD A;  3PW5 A;  2BPG A;  8ICN A;  2ZUB A;  4YMM A;  5K4L A;  2KFZ A;  3SQI A;  4YN4 A;  1Q8K A;  5TZV A;  3S6J A;  2F77 X;  3BZK A;  3MGI A;  2KKP A;  5KFA A;  3UPQ A;  2OYY A;  2H3Q A;  8ICE A;  8ICI A;  2ASD A;  4PGQ A;  2R8H A;  3JPT A;  3GIJ A;  4K4G A;  4FZM A;  2RDI A;  5ALZ A;  3RJE A;  4ELT A;  4DFM A;  4DOA A;  5ALV A;  4LZG A;  4B9L A;  8ICJ A;  3WKB A;  1JIH A;  2G09 A;  3ZDB A;  3IHQ B;  4GLX A;  2EAN A;  5JTI A;  4J9P A;  5ALK A;  5KL1 B;  4JB3 A;  4YR0 A;  5C0Y A;  3OSN A;  4J9K A;  4QZF A;  1NK0 A;  3CYM A;  2DF4 B;  1SZP A;  4R64 A;  1XNS A;  7ICP A;  4M0A A;  4KLD A;  3IV6 A;  2AGP A;  2ZIW B;  3R9K A;  3WK5 A;  4F5Q A;  2P6U A;  1CI4 A;  3SYZ A;  2UVV A;  2NV3 A;  4YFK A;  2PFQ A;  3WU2 U;  1DGS A;  3WK4 A;  4LJX A;  4YCX A;  1UHU A;  3ZD8 A;  3KKA C;  3RR8 A;  3OHB A;  2IOF A;  1ZJN A;  2W43 A;  1FFU A;  2JZB A;  2W3S A;  3TKA A;  1BNP A;  9ICC A;  1J2M A;  9ICN A;  1JRP A;  3BQT A;  1SXD A;  2I6X A;  3WK7 A;  2XC9 A;  3H0R B;  4KLU A;  4Y2U A;  2W8L A;  1UA1 A;  3QX7 A;  4KLO A;  2DKX A;  4M9J A;  2G0A A;  3CP8 A;  4I29 A;  3PW0 A;  3SAH A;  1N62 A;  4J9N A;  1T4G A;  3UXN A;  4QIW C;  3ISD A;  1ED1 A;  4KLS A;  4OJL A;  4Y2R A;  2DBY A;  4UB3 A;  5CR0 A;  4CNQ A;  1RG6 A;  4BUG A;  1XSL A;  2KE7 A;  5AI0 A;  5HHI A;  2IOF K;  3Q8M A;  5AKZ A;  2HOF A;  3AU6 A;  3TAN A;  3PX0 A;  1C7Y A;  5AM4 A;  2BCR A;  3PNC A;  1KEJ A;  5EE0 A;  1PVR A;  1UQV A;  4ED0 A;  5EWF A;  3Q8Q B;  2PI4 A;  7ICU A;  3E2E A;  5KG1 A;  5DDY A;  3NVW A;  4C8K A;  2D6F C;  1X6J A;  1HUO A;  1JXE A;  2HHW A;  1QSL A;  4ECS A;  4OJO A;  4RQ1 A;  2KK0 A;  1N60 A;  4TUP A;  7ICH A;  3SAF A;  3MFH A;  3QU5 A;  4ECU A;  4BGD A;  9ICO A;  4UAW A;  4YMN A;  4NXZ A;  2ZIU B;  3OHA A;  3C2L A;  3RAQ A;  1SB3 C;  4OJ6 A;  4R8U A;  3LWM A;  4KLJ A;  1NNL A;  1CUK A;  4I2I A;  2IHN A;  1KFD A;  2NRV A;  1V85 A;  3UXO A;  2KIC A;  2WF7 A;  3GU3 A;  2KMD A;  1DRG A;  4O3N A;  4F5R A;  4QJF B;  3TFS A;  1X42 A;  2WHE A;  2FLN A;  3BJY A;  4IR1 A;  1K1S A;  3N28 A;  5IIK A;  1ECW A;  1XO1 A;  4FFD A;  4GIB A;  4K4I A;  4PPX A;  4PJ0 U;  3IG5 A;  2A1J B;  4Y2S A;  4RPX A;  4Z6D A;  1ZQE A;  2NRW A;  2ISO A;  2XY7 A;  1TK5 A;  4M2Y A;  1NK4 A;  4B9M A;  4OD0 A;  3T79 A;  1O08 A;  3C23 A;  2QB0 A;  4MF8 A;  1RQL A;  2OXO A;  3RR7 A;  4J9L A;  5J0R A;  3AM9 A;  4QW8 A;  2YQE A;  2ASJ A;  3H8S A;  5AKE A;  8ICM A;  5EWG A;  5BOM A;  3RB3 A;  1KFT A;  4F4Z A;  2AGO A;  2H3F A;  2I9G A;  2AXT U;  5CA7 A;  3M8R A;  2JRZ A;  3UMB A;  3RRH A;  2JZB B;  2KIW A;  1S97 A;  1LKY B;  4EEN A;  1ZQH A;  3C2M A;  3IM1 A;  2VAN A;  4EZ9 A;  1SZH A;  2CXY A;  3MR3 A;  5AKY A;  7ICI A;  1NK8 A;  1CRX A;  3MR2 A;  2XGQ A;  3RTV A;  5D49 A;  5KFQ A;  2PMZ F;  3Q8S B;  3RB6 A;  3U26 A;  1L7O A;  1JMS A;  4B6J A;  1ZQZ A;  4CF5 A;  4US8 A;  2LPE A;  4ED7 A;  4DS5 A;  8ICU A;  4DF8 A;  2WTF A;  1PK3 A;  1N56 A;  1TE2 A;  1S0M A;  1X66 A;  4UAZ A;  3Q8L A;  4A8E A;  3M8S A;  4P0P A;  2K4E A;  2W9M A;  3UMC A;  2K8B B;  2OWO A;  2C2R A;  1KLN A;  1ZQJ A;  2XVT A;  3PST A;  5J2G A;  3H4D A;  4NWI A;  1ZQT A;  2M9N A;  2YML A;  3WKE A;  4F92 B;  8ICY A;  4F3O A;  3TAR A;  3KZX A;  1MSW D;  3ETL A;  3ISC A;  1DXS A;  1S77 D;  7ICM A;  3FYH A;  2CN1 A;  3IRU A;  1HIW A;  1VJ5 A;  1NJX A;  5AM5 A;  1C20 A;  5EWE A;  3BDP A;  3A0H U;  2B0C A;  3CNH A;  5DBC A;  4PGX A;  2KG5 A;  3BQ0 A;  2KFN A;  3G6Y A;  4MHV A;  4QWC A;  9ICG A;  5KFJ A;  4ECQ A;  2MUT B;  4F50 A;  4FS2 A;  4EBC A;  1ZQQ A;  3WK6 A;  1TV9 A;  3JPS A;  2AQ0 A;  2N1R A;  4GFJ A;  5KT2 A;  5DKW A;  1Z4O A;  4Q44 A;  1P7D A;  4R65 A;  4M9H A;  3KHL A;  3C1Y A;  3EWA A;  2KJ5 A;  3F5A A;  4NLB A;  5CJ7 A;  2XO7 A;  3Q8K A;  4RQ5 A;  1IG6 A;  4QWE A;  1V97 A;  3GFK B;  3I28 A;  4DL5 A;  1ZQP A;  2JMG A;  3HW8 A;  2DQN B;  2WB1 C;  4DEZ A;  2JEG A;  3BZC A;  4EX7 A;  4DSK A;  3MAB A;  4M04 A;  4TQS A;  3D2S A;  1ZQW A;  4JWN A;  2FI1 A;  5GTH U;  1K1Q A;  2QAR B;  5ALM A;  4DSE A;  3BQ2 A;  4DWI A;  2YMM A;  4DFK A;  4I2H A;  2NRZ A;  2Y1J A;  4RUA A;  1N48 A;  4UBB A;  1SV0 A;  8ICX A;  2JXJ A;  4F93 B;  2MRL A;  4RQ8 A;  1ZRN A;  2ZJ5 A;  2XIC A;  2E1E A;  2PFP A;  2ZUD A;  2XGP A;  2UVU A;  3UMG A;  4KLI A;  4RNO A;  3TI0 A;  1S76 D;  2Q4T A;  3NAS A;  5G5H A;  5KFH A;  2OCE A;  4C8N A;  4AYB C;  2BPC A;  4CE6 A;  1RXW A;  2G08 A;  5AIB A;  2ZIW A;  2KSO B;  2PKE A;  3SEN A;  5J0Q A;  5AI4 A;  4I27 A;  3DV9 A;  3SR6 A;  5FP0 A;  5KT6 A;  2GH1 A;  4DCC A;  5AI6 A;  2R8I A;  2YB1 A;  1ZQ1 C;  5ALG A;  1OUQ A;  1F5S A;  5KNI A;  4LZD A;  7ICS A;  3RJF A;  3DEE A;  5KT7 A;  5ALN A;  4QZE A;  2FPL A;  2KJ8 A;  8ICA A;  1D9D A;  1SWW A;  5III A;  2CRX A;  2LBO A;  4G9B A;  1UPH A;  1XS9 D;  1XO0 A;  4F2R A;  2IMW P;  4DF4 A;  1WCL A;  3V6H A;  4CF3 A;  1NI3 A;  2ZTC A;  2A19 A;  2HI0 A;  2BGW A;  2P6R A;  1A76 A;  2F1H A;  1JAL A;  3FAH A;  1L5U A;  4Z6C A;  5KT5 A;  4ED3 A;  1ZQB A;  4O3S A;  2B6G A;  1LV5 A;  1DK2 A;  2OEH A;  4C4R A;  4EYH B;  2FMS A;  2E8O A;  4RPY A;  8ICF A;  4JK1 A;  3HKZ C;  3F5E A;  4DL6 A;  4QNL A;  4RT3 A;  4G3I A;  2NRX A;  2C2D A;  4QZG A;  1ARO P;  1ZQO A;  2ZIU A;  4I2C A;  1NJY A;  8ICZ A;  2KVC A;  1RXV A;  1QQ6 A;  4EEL A;  1TVA A;  3LVW A;  4PZN A;  5D46 A;  5J2D A;  2JH1 A;  8ICK A;  2AH5 A;  4KLT A;  2Y9T A;  2Z7J A;  2RHF A;  5KG7 A;  3THV A;  1XC9 A;  4I2J A;  2AJQ A;  4FBT A;  2G5H B;  1HEK A;  2ZIV B;  1L8O A;  2W55 A;  2ZG6 A;  4KLF A;  4DO9 A;  3C28 A;  3ZI4 A;  3AQE A;  4ECW A;  5AIA A;  1ZRM A;  5AHX A;  2HHT A;  1COK A;  3C1Z A;  3PVX A;  2KVS A;  5KG5 A;  3M6K A;  4DQQ A;  2W9A A;  2A1J A;  4O3M A;  3RH5 A;  1ZQV A;  1NKB A;  4ZH4 A;  5AKL A;  4RQ3 A;  3BS5 B;  3I76 A;  3PY8 A;  2FPK A;  3QU7 A;  3ZD9 A;  2ALZ A;  2R8G A;  5DQG A;  4KMU A;  3KD3 A;  4I2B A;  1S0N A;  5KG4 A;  4FE3 A;  3HRD D;  1X9M A;  1L7P A;  1MQ2 A;  2AGQ A;  3RAX A;  5KFE A;  2E1F A;  2JV3 A;  2JHD A;  5KFO A;  3MFI A;  2PFO A;  1DK3 A;  3IG8 A;  2J6S A;  3M9M B;  2NO5 A;  2KZZ A;  1J2N A;  1JI7 A;  3H40 A;  1Y88 A;  3QUC A;  4PZO A;  5KG6 A;  5T14 A;  4P2H A;  1BVS A;  5D4B A;  4FZN A;  3NGD A;  2RDJ A;  4KN4 A;  4KLM A;  1B22 A;  5L1J A;  4UQG A;  3C5G A;  4US9 A;  9ICF A;  3V72 A;  4QWD A;  4I28 A;  5L1L A;  2Y0S C;  1LKY A;  3H8W A;  3LWL A;  5DG9 A;  5JUM A;  2W9B A;  2VA3 A;  4BDP A;  1ZQF A;  5CP2 A;  2L5Y A;  4C8M A;  2V4R A;  2A3V A;  1N5W A;  1TAU A;  4BX9 C;  3RJI A;  2E8N A;  4KX3 A;  1HUZ A;  2XCP A;  5F9N A;  4PGY A;  3KTQ A;  2DWQ A;  3RB0 A;  4NLC A;  3HX0 A;  4PHP A;  3GIL A;  1Z3E B;  5HHH A;  4EBD A;  2FE9 A;  4HAI A;  4KIT B;  1ZQD A;  4YP3 A;  2NRT A;  1IM4 A;  1L6N A;  1PUZ A;  1NK9 A;  2A1A A;  2WAQ F;  5KFU A;  2D8C A;  5IIN A;  2AQ4 A;  2FMP A;  8ICS A;  1QSS A;  3NVV A;  1KKX A;  1IXR A;  2KV2 A;  3SEI A;  5KFV A;  3PO5 A;  1Q3V A;  1B4F A;  4PHD A;  4MEY A;  2KHQ A;  4DSI A;  4O3O A;  1TK0 A;  4MFC A;  5GTI U;  1KTQ A;  4DQS A;  4YD2 A;  3QZ8 A;  4RQ0 A;  4BWJ A;  7ICE A;  1RYR A;  1D8B A;  1T8E A;  4NLK A;  3QE9 Y;  3FDS A;  3RB4 A;  4EBE A;  1SKW A;  2MUT A;  2J6U A;  2YMP A;  5L1M A;  1Z1B A;  1KDH A;  3N97 B;  3RJJ A;  1WWU A;  4EEK A;  2RRD A;  4J9Q A;  4KMO B;  1NKC A;  1L3S A;  3C21 A;  2ZJ8 A;  2BZF A;  3HIL A;  3MR6 A;  1QSY A;  1FIQ A;  3ONN A;  5ALF A;  2W9C B;  1BPY A;  4Y2T A;  5AM2 A;  2HHQ A;  9ICE A;  3MR5 A;  8ICT A;  2XY6 A;  4B9N A;  5BOL A;  3RH4 A;  3LYS A;  4ED6 A;  1N61 A;  1B0X A;  4NV0 A;  5AK4 A;  3QUB A;  1U9L A;  1U4B A;  2LYA A;  5CRX A;  9ICW A;  1Z1V A;  2E8M A;  2VKQ A;  2HOQ A;  3PW2 A;  3PV8 A;  5J2I A;  3N7P D;  4ECR A;  4C0Z A;  1SL2 A;  5KFL A;  3V7J A;  1UA0 A;  5F9L A;  2QAR A;  4ICA A;  4RU9 A;  3KHR A;  4CGZ A;  4UB8 U;  4Z6F A;  3PX4 A;  1SKR A;  2JEJ A;  4YG2 A;  1DGJ A;  4NM1 A;  3UQ0 A;  3SV3 A;  4BXO A;  5EOZ A;  1U48 A;  4XQ8 A;  2E5S A;  2EQY A;  5DQH A;  8ICH A;  4P0Q A;  5ALU A;  2G06 A;  3ZDE A;  4FBU A;  5J2F A;  1ZQY A;  2W9B B;  3MGV A;  3AL0 B;  3OSP A;  2F3N A;  2WF6 A;  2W7P A;  4IC9 A;  1JXL A;  3SV4 A;  2ES6 A;  4B9S A;  1L3T A;  1BPZ A;  1EXN A;  2C2E A;  2F1I A;  2KSO A;  5HMM A;  4YMO A;  3JPP A;  4Y2Q A;  5J2E A;  2FPM A;  7ICF A;  4O9M A;  3K75 D;  1IIP A;  5AIC A;  1XSP A;  4NLN A;  2FLL A;  4BJQ A;  2KEY A;  1SIJ A;  4FS1 A;  3L3F X;  2P35 A;  2P66 A;  1KFS A;  3GV7 B;  3QZ7 A;  5KG0 A;  5JU5 A;  2GO7 A;  4RQ4 A;  3MBY A;  2HSZ A;  4Q45 A;  1JX4 A;  3D2Q A;  1F44 A;  4UAT A;  2RP5 A;  4IQT A;  9ICS A;  5J0Y A;  3ED5 A;  3GZF A;  3HPO A;  3EUB 2;  4M6W A;  1FO4 A;  3ZDA A;  5KFF A;  1MN8 A;  4UB1 A;  4HYK A;  2FMQ A;  5HNK A;  3UM9 A;  2W8K A;  4DS4 A;  1U49 A;  2PFN A;  2KKV A;  3GDX A;  4NJ8 A;  4M47 A;  2V4Q A;  1KW4 A;  4OJ5 A;  3VCB A;  9ICX A;  2YN4 A;  4DOC A;  1BPB A;  7ICN A;  3IDW A;  1ZQC A;  5L1K A;  1V9P A;  1RYU A;  2HVI A;  3K1R B;  3MGH A;  2VJ5 A;  4DQP A;  2ZUC A;  4YXJ A;  4RNM A;  3SAG A;  2OHF A;  2KZ3 A;  5G5G A;  4M9G A;  5ALL A;  3KHG A;  4YQW A;  3H4B A;  8ICO A;  3MDA A;  2GWS A;  3RBD A;  2HVH A;  2LI6 A;  4UB4 A;  1B43 A;  4OCZ A;  2K8C B;  4CCH A;  2K4H A;  5KG3 A;  2F76 X;  5E79 U;  2JEI A;  2I5H A;  4KN7 A;  3WK8 A;  2HHS A;  4IRK A;  4QZ9 A;  4X5V A;  3KHH A;  4DSJ A;  3AN1 A;  4KLL A;  5BPC A;  4TUQ A;  1JN3 A;  5KFN A;  2VA2 A;  3BS7 A;  2WFA A;  3RJH A;  3F53 A;  4QZB A;  2ZIV A;  2H3Z A;  3KBB A;  5KFI A;  2HHU A;  2RQ5 A;  4ECY A;  3H8M A;  4DFJ A;  9ICK A;  4C8L A;  5AM1 A;  3WKD A;  2DGZ A;  1K5O A;  4BXO B;  1PVP A;  4KLE A;  1ZYQ A;  2RLT A;  3SD7 A;  4U6P A;  2G5I B;  4USA A;  2JH7 A;  4I2F A;  3AMZ A;  5HR6 A;  4P0Q B;  4FZL A;  1S0V A;  1J97 A;  3C2K A;  3BS5 A;  1QQ7 A;  4UB2 A;  3RFA A;  9ICT A;  4K4H A;  2DPJ A;  2OM6 A;  4RZR A;  4F4W A;  4M9L A;  3CW2 C;  2F8K A;  2IA6 A;  1NJZ A;  4I2D A;  3M9O B;  2R8J A;  2FLP A;  4WJ3 B;  1ZD3 A;  4UAR A;  5DG8 A;  9ICI A;  5KFK A;  4RT2 A;  3QNM A;  1ZJM A;  2BHN A;  8ICQ A;  1ZQN A;  4C8O A;  3K4G A;  3WKC A;  4QZH A;  2LKY A;  4GXI A;  4TUR A;  1NK5 A;  3QU9 A;  2F44 A;  5ALS A;  4QIW F;  1PZN A;  1UT8 A;  1XU4 A;  2K4P A;  4TUS A;  4QZA A;  1RDF A;  2UVR A;  5J0S A;  1SL0 A;  1RPL A;  2WF5 A;  5KFP A;  2KZM A;  3RH6 A;  5J2K A;  5HR7 A;  5EE1 A;  5EE3 A;  5CB1 A;  3QYP A;  2LHT A;  3OGU A;  4GC6 A;  2MA1 A;  5DLG A;  7ICK A;  2W04 A;  1CEZ A;  3PO4 A;  4M6W B;  4P4P A;  4RQN A;  2MSN A;  2K4I A;  4M9N A;  5J2A A;  2PMZ C;  3ZDC A;  3ETR A;  3QUQ A;  4JWM A;  2YB4 A;  3QEA Z;  1NK6 A;  5B5E U;  3BQ1 A;  4Y2X A;  1WCN A;  3E58 A;  5ALT A;  2IBK A;  2EZZ A;  1U45 A;  4YVZ A;  4CRX A;  3KFU F;  5DGB A;  3H0M B;  5L1I A;  1N5X A;  4UAV A;  4XUS A;  9ICA A;  5KAF U;  9ICJ A;  4ZOH C;  3J81 j;  1ZQK A;  4Y2Y A;  2IOH A;  3KKA A;  1GO3 F;  3HWT A;  9ICR A;  1SV0 C;  5DBB A;  5C5J A;  1T94 A;  2W3R A;  3ORY A;  1BNO A;  4ECT A;  5DBA A;  2W03 A;  5KFB A;  5J2B A;  1NZB A;  5DLF A;  4F5O A;  2EAP A;  1N63 A;  1NKE A;  4AP9 A;  4QWA A;  4IQW A;  2HHV A;  1FFV A;  7ICL A;  5ALH A;  1AQ6 A;  1KL9 A;  4O0I A;  5A0L A;  1DOQ A;  2KD1 A;  4PHE A;  1XSN A;  1ZQL A;  4EX6 A;  4CDG A;  2HHX A;  3JPR A;  2W9C A;  1BPX A;  2DL0 A;  3V6J A;  1MQ3 A;  4O5K A;  2W11 A;  4F4Y A;  4PL2 A;  4P4M A;  9ICM A;  4NLG A;  1RQN A;  2QB1 A;  3ICX A;  4RQ2 A;  4YXM A;  3NVZ A;  4RQ7 A;  2R18 A;  1RYS A;  1Q3U A;  5J0O A;  3H8J A;  1PK1 B;  3RF9 A;  3FC4 A;  4F2S A;  1ZQR A;  5J0W A;  2HBM A;  1NOM A;  5JRT A;  2BDP A;  3IP4 B;  4Z6E A;  4F4X A;  3HP6 A;  4DL2 A;  1X2I A;  1RM6 C;  5KFW A;  5J0X A;  4IQV A;  3T5L A;  3H7I A;  3L4P A;  3N7R C;  3MC1 A;  2K8A A;  3PML A;  1HJP A;  4UAU A;  3C29 A;  3TAD A;  2EH9 A;  5J2C A;  5DB9 A;  5KAI U;  3EZ5 A;  3HJE A;  3N4M B;  5AKG A;  1X9X A;  4F72 A;  3NS1 A;  1QCK A;  4GXK A;  5KFD A;  4YD1 A;  3GII A;  1LVH A;  3QU4 A;  5ALO A;  5J0P A;  2JR5 A;  1ZET A;  4F71 A;  1L3U A;  2W7O A;  1D9F A;  4DQI A;  3PR5 B;  3H0L B;  4QZD A;  9ICQ A;  3UQ2 A;  4OO1 J;  3AUO A;  4O3Q A;  3T5H A;  1ZQX A;  3LVV A;  1KBU A;  1ZQI A;  2D3D A;  4Y2V A;  1ZXI A;  1SL1 A;  9ICL A;  7ICQ A;  3G6V A;  2BR0 A;  2XY5 A;  3M1Y A;  2WF8 A;  2ATL A;  1QTM A;  2IHM A;  2HBL A;  2AHO B;  8ICB A;  7ICG A;  2KN7 A;  2EZX A;  4DSF A;  4B9U A;  5IIJ A;  1S9F A;  1LB2 B;  3OPX A;  5F3X B;  5AI8 A;  4C4S A;  1NZP A;  3WKA A;  3GV5 B;  3SZ2 A;  3SI8 A;  8ICL A;  2YTU A;  2DFL A;  4PL1 A;  1NK7 A;  3WK9 A;  1FEZ A;  4O5C A;  5KT4 A;  3AEV A;  1T7P A;  4DFP A;  1L7M A;  5AKJ A;  2I1Q A;  3NTU A;  2LM1 A;  1WG8 A;  2LYB A;  4NLZ A;  5KG2 A;  4MFA A;  1L7N A;  1D8L A;  3PX6 A;  3KZI U;  8ICG A;  4QZ8 A;  5AK6 A;  4EEY A;  1S10 A;  1VDV A;  9ICH A;  4ED2 A;  4KLQ A;  1NJW A;  5B66 U;  3NRZ A;  2ZIX B;  3T5K A;  2GOL A;  4MFF A;  3TAP A;  2BCS A;  2MAX A;  2XCA A;  2R8K A;  4Q43 A;  2WB1 F;  1Z00 B;  2Y9U A;  4NY8 A;  5CWR A;  4JV1 A;  3V7L A;  3TQ1 A;  2DUY A;  4QW9 A;  5KL8 B;  3JPN A;  2VA8 A;  2BCQ A;  3TAD C;  2Q0Z X;  2KNJ A;  4F5P A;  4JMU A;  5J0U A;  3T5J A;  2ASL A;  4O5E A;  5KTQ A;  5AM0 A;  5KFZ A;  1Z4N A;  4I2G A;  3RJK A;  7ICR A;  4F91 B;  2YMQ A;  4QWB A;  2MU2 A;  2LM4 A;  1TKD A;  2HCF A;  1L8L A;  4ECV A;  3Q8R B;  3RRG A;  4KLH A;  4FO6 A;  4Y2J A;  4PH5 A;  3NRW A;  1S0O A;  5CEH A;  9ICP A;  3B0X A;  4UB5 A;  5KFM A;  3PR4 A;  2KP7 A;  8ICR A;  4DL3 A;  3EPI A;  2O6K A;  3KOO A;  3AU2 A;  3K1Z A;  4R63 A;  1M6Y A;  4F8R A;  3LDA A;  4O3P A;  1SKS A;  4ELU A;  4AYB F;  1WUD A;  4UB6 U;  5KFC A;  2XI9 A;  4EYI B;  4Q8E A;  2HBK A;  3E0F A;  1ZD4 A;  1YT3 A;  1ZQS A;  2EAM A;  5IIO A;  2H5X A;  1A6S A;  2W54 A;  4Y2P A;  3PW7 A;  2GLE A;  2NYV A;  2VJ4 A;  3V6K A;  1X9S A; 
#chains in the Genus database with same CATH homology
 5K4L A;  2CXY A;  1IG6 A;  1RYU A;  5CEH A;  1KKX A;  1KQQ A;  2RQ5 A;  1C20 A;  2EQY A;  2JRZ A;  1KN5 A;  2JXJ A;  2KK0 A;  4LJX A;  2EH9 A;  2YQE A;  2LM1 A;  2LI6 A;  2OEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...