1C20A

Solution structure of the dna-binding domain from the dead ringer protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAAFTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEAD RINGER PROTEIN
publication title Solution structure of the DNA binding domain from Dead ringer, a sequence-specific AT-rich interaction domain (ARID).
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1c20A00
5K4LA 1RYUA 2EQYA 2CXYA 2KK0A 2EH9A 1KKXA 2RQ5A 2JXJA 2LI6A 2OEHA 1C20A 1KQQA 2JRZA 2YQEA 1KN5A 2LM1A 4LJXA 5CEHA 1IG6A
chains in the Genus database with same CATH superfamily
5IIOA 3GILA 1QQ6A 3GV5B 5J0YA 1URJA 5ALWA 3IG5A 4PJ0U 3ICXA 5AKKA 2W7OA 4YD1A 4DSFA 1KKXA 5EWEA 1YT3A 3PX4A 2KIVA 4ELUA 3T79A 3UXOA 1ZXIA 1BGXT 4EBDA 4P4OA 4C80A 4US8A 3MGHA 5HR6A 3LWLA 5CEHA 1JUDA 1L5UA 4KLHA 5AHXA 4NV0A 2VKQA 1PVPA 3SV4A 4J9OA 4I27A 1VDVA 3F5EA 4IRDA 3KHRA 1CI4A 2H3FA 5AK5A 3TARA 2H5XA 2HHTA 4Y2JA 3C21A 4CF5A 1N63A 2UVRA 2ZUDA 2BCUA 1ZQVA 4KLEA 5F9LA 4J9QA 2JGAA 3MFIA 1SL0A 1NK0A 1COKA 2C2DA 2RQ5A 2FE9A 2JZBA 4GXKA 3MDAA 1H38A 1SV4A 3D2QA 2J6UA 2XCAA 4UB5A 2K8AA 8ICKA 1KN5A 1S10A 4LJXA 4IQVA 4YMOA 1IG6A 2QB1A 5J0XA 5KFWA 3PW4A 2BDUA 4O3RA 1AROP 5KG0A 1U4BA 2NRWA 5AK4A 4DQQA 3FM9A 5CB1A 2HOIA 1ZYQA 1VJ5A 5IIKA 3BQ1A 3S6JA 3WK8A 2ZTCA 1X66A 2BHNA 2EAOA 3M9MB 2IBKA 1Q3UA 9ICFA 9ICLA 2YMMA 4WJ3B 4KTQA 2AGOA 1BVSA 1F0MA 4I2JA 2I5HA 5J8YA 2RRDA 4ED1A 3Q8RB 1KFTA 4F4XA 3TI0A 5H2FU 4ED6A 2KG5A 2DQNB 3I1YA 1KFDA 4ED7A 4F3OA 3BS5A 5KNIA 4DLEA 1U48A 3ONNA 3QUTA 2K4IA 1VLBA 3BQTA 2V4QA 5AIAA 4DO9A 7ICMA 1ZQBA 4UAVA 4OD0A 2QARB 5J2IA 2ZIWB 3N7SC 3ZD8A 2DKXA 4MFFA 9ICIA 5CP2A 5KAFU 4ED8A 5IILA 1L3TA 5EE1A 1S0VA 5KFEA 5KG6A 1ZJNA 3LYSA 5J0RA 2YMLA 2RHFA 4DFPA 5KTQA 7ICLA 5CJ7A 1WYGA 1NK4A 4ECXA 5KG5A 2ZXIA 4KLSA 5AKGA 2VJ5A 2B0CA 2RP5A 1FO4A 5L1MA 2QKQA 4OJ5A 5DLGA 1T7PA 1ZQRA 2F8LA 5KFXA 1RM6C 4DL4A 1B0XA 4JK1A 1S77D 2ZJ8A 3HJEA 3NS1A 2IOHA 3KHLA 1ECWA 5AKJA 3H8MA 1XWLA 2KJ9A 1XO0A 1XSNA 1NK7A 1ZOLA 4RQMA 2NRZA 2ZUCA 3EPGA 2XY7A 3WU2U 1ZRMA 1D8YA 3NUQA 1TAUA 1HUZA 7ICVA 4OJOA 2KHQA 5AIBA 3RJKA 5GTIU 2C2EA 4NL9A 4MFAA 3Q8LA 2PI4A 2HBKA 4UAWA 1ZETA 4AP9A 2JH1A 3SYZA 2A1JB 2DBYA 4YR0A 1SB3C 2W3SA 2JEJA 3VCBA 3KOOA 2EZZA 7ICQA 3EWAA 1X40A 5DGAA 3WKCA 3RH6A 1WCLA 4ACOA 2JRZA 4UB1A 5AM1A 2R8GA 2ZUBA 4CF4A 3E2EA 4BDPA 1JI7A 1ZQLA 4YMNA 4DOAA 4KN4A 4QZHA 4YD2A 4F5QA 4O0IA 4I28A 9ICAA 3A0HU 4DF4A 3L5KA 5JTIA 1U49A 2FMSA 2EZYA 1S97A 4P4MA 3HRDD 3Q8PB 7ICIA 4PL2A 2KFNA 2WAQF 1B4FA 2CXYA 2AQ4A 3RB6A 2E3TA 2LBOA 4M2YA 4YG2A 1Z4NA 4I2HA 1T3QA 2K8BB 4QW9A 3PW5A 4R64A 9ICRA 4QWCA 1PZNA 4R8UA 2QARA 3V6HA 3E0FA 1F5SA 4FO6A 4F5PA 3EYZA 1NK8A 2FPKA 2ODGA 5DB9A 3K1ZA 3IN5A 1T94A 4OJPA 1NZPA 4AYBC 2PXIA 3TFSA 1U45A 2KMDA 1ZQCA 1DK3A 2G0AA 2DWQA 2BCQA 5KFRA 2XO7A 9ICUA 2G09A 4J9NA 3MGVA 4RPYA 3BZCA 2YMPA 3QNMA 4RUCA 7ICTA 3ZDEA 5AKXA 2W3RA 3GIKA 5C5JA 5ALLA 2OXOA 2W8KA 2P6RA 1RYRA 4RQ6A 4YN4A 4KMOB 1OUQA 3GIJA 3C2KA 4IRCA 3M6ZA 3THVA 4Q8FA 2YY6A 2QB0A 3JPNA 3LVWA 3PSPA 4K4HA 4XA5A 3PSFA 1NJWA 2HVIA 2XI9A 1Q8KA 1SZPA 5KFSA 1L7MA 3SAGA 5L1LA 4DF8A 1NZBA 5DQGA 2I6XA 2C2RA 1ED1A 2YTUA 5J0OA 8ICZA 5D46A 2AGPA 5ALVA 4O3OA 1JROA 2BPGA 3IV6A 5DG9A 2D3DA 5KFDA 2ZXHA 4I2AA 2A1JA 5KT4A 4I2CA 2Q4TA 8ICNA 2FMPA 2HBLA 2KOBA 1MQ2A 5K4LA 1UT8A 3OJUA 2WTFA 2W9MA 3JPQA 7ICSA 1ZQHA 4LVSA 3U26A 3RR8A 8ICGA 3TAQA 4BWJA 2IMWP 8ICIA 4M47A 3MC1A 2GLEA 3AM9A 3C29A 2F1IA 2NRVA 3AN1A 3RAXA 2AJQA 9ICTA 2KICA 4CNQA 5CR0A 1JX4A 4RT3A 3Q8QB 2XCPA 4NLGA 4F5RA 4ED2A 2LYBA 5ALHA 4TURA 4M9GA 2KVSA 2I1QA 4O9MA 2JZBB 3RJJA 4F71A 5J2HA 2QLTA 4Z6EA 4R66A 2F76X 2R8HA 4BJQA 3BQ7A 3T5LA 2LI6A 5J2DA 3LK9A 2D8CA 1K1SA 4BGDA 2F44A 1N62A 3GU3A 1WWUA 3NRZA 4PGXA 2NYVA 1ZQJA 5L1JA 1JIHA 2I9GA 2E8OA 2EZXA 5AKLA 4QZAA 2JEFA 2KZMA 2KSOB 1SKRA 2W7PA 3PO4A 4GXIA 1QSSA 5BOLA 3RBEA 3BS7A 5ALOA 3IDWA 4K4IA 2KVCA 7ICEA 3SR6A 5ALGA 1KSPA 4KLFA 2G08A 3RJEA 4QZEA 1ZQFA 1FIQA 3B9JA 1N60A 5AI9A 5KT2A 1N61A 2IOFA 1T4GA 4K4GA 4P4PA 3RRGA 1KFSA 1KL9A 1SZHA 2G07A 4O5KA 5KFPA 2FLLA 2F1HA 4YCXA 2W9CB 9ICWA 2CRXA 3RB4A 1RYSA 3EUB2 4UAYA 5D49A 2G5HB 4NLZA 1WCNA 3I28A 3B0YA 2YMQA 3AMZA 9ICXA 1L8LA 5KFUA 2FPLA 1C20A 5AI4A 4O3PA 4EYHB 4I2DA 3LWMA 3OTQA 4UB3A 5KFHA 4ED3A 3SI8A 2AGQA 3L4PA 2J6SA 3HWTA 2E5SA 1NNLA 3QZ8A 3QEAZ 3EZ5A 3PW7A 3Q8KA 1NKCA 4Y2XA 2L5YA 3WK7A 5AM4A 2IHMA 4XUSA 3AUOA 4TUSA 2NV3A 4IC9A 3C2LA 2XVTA 2JV3A 1QH9A 3NVYA 3KD3A 3AQEA 9ICKA 1BPYA 1RG6A 2YB4A 4I2EA 5AI0A 5KG4A 4PPXA 5KT3A 2E1EA 3RR7A 3MABA 5DDYA 5IIIA 1SL1A 8ICRA 4C8LA 3OSPA 4J9KA 1JALA 1SXDA 4B9VA 1MC8A 4LZGA 3PR5B 4J9PA 3UXPA 5AK6A 3RB0A 1ZD4A 3BDPA 4RQ4A 3N7RC 1RPLA 3SMVA 4DSLA 5J2CA 4O3MA 3N4MB 5ALNA 2W03A 2BGWA 4IR9A 5AKZA 1NKEA 3ISBA 4EEYA 4M9NA 2K4PA 4DFMA 4MEYA 2HMXA 3TADC 1B43A 8ICPA 3WKAA 1SWWA 3ZI4A 4EYIB 4F5NA 1P7DA 4NXZA 4KN7A 5AM5A 1ZQGA 2GOLA 4YR2A 9ICMA 3PO5A 5J0WA 1ZQAA 3TFRA 2AU0A 3FDSA 5JU5A 2OHFA 4F4WA 8ICXA 1NK6A 2HOFA 4IQTA 3UPQA 1LV5A 2KSOA 2KKVA 5AKIA 4FBUA 4FZLA 2RDIA 1QLNA 4NLCA 2OWOA 4RQ0A 1N2XA 4QZGA 2WAQC 4Y2RA 2WFAA 4ECVA 3UMCA 1ZQTA 5KAIU 3ED5A 5BOMA 1BPZA 8ICOA 4Y2YA 1TKDA 2YN4A 2G06A 2R18A 3M1YA 4J9SA 4DL5A 3WK4A 5J0PA 2BKEA 3PMLA 4F91B 3RF9A 1NJXA 2FLPA 3Q8MA 4NM2A 4QZFA 4I2IA 3JPSA 4KLGA 9ICPA 1O03A 4R65A 1D9FA 5HHIA 2W9CA 1MQ3A 2M0NA 3D2NA 3MR5A 4MHVA 5HMMA 1ZQSA 1XSLA 4RQNA 4R8UB 4F4KA 5L1IA 1L3SA 1A76A 2B21A 3BZKA 5DDMA 3NTUA 5DB6A 4RQ1A 1S0MA 3EW9A 2FDRA 4RU9A 1X2IA 8ICLA 4JB3A 3MR6A 5ALYA 2ZTEA 1L8OA 4QW8A 4IQUA 4J9LA 4GC6A 1KRPA 2Y9TA 5JUMA 4UARA 5KFQA 4ELVA 2K4EA 3C5FA 2HHQA 5DGBA 2W8LA 4PHAA 3GV7B 3C1ZA 2KD1A 4ICAA 2OM6A 4YQWA 3OJSA 2WHEA 3VC8A 3H7IA 4RQ2A 2XGQA 3GV8B 2PFNA 4ECTA 4Z6CA 2BQ3A 2W43A 1SIJA 1LB2B 1X9XA 1XC9A 4M9HA 3GZFA 9ICOA 5AKYA 2NRXA 1J97A 1WG8A 3F2DA 2LM4A 2QB0B 3FAHA 4DQSA 2UVUA 3IM1A 1L3UA 1ZQEA 4QZ8A 4NJ8A 5EE9A 3KHGA 2VA8A 5DBCA 1BPDA 2E8MA 2IHNA 3RRHA 4DQRA 2R8IA 1Y88A 4M0AA 3PSIA 1JRPA 4QZIA 2Q0ZX 9ICQA 1JXEA 1WUDA 2K4HA 4DSKA 3HX0A 3OPXA 1J2NA 2ZIXB 4US9A 3ZD9A 2RDJA 5AM3A 1BPBA 3GIMA 2KP7A 3AU2A 4DL2A 4F2RA 4QWAA 5C0YA 4QZCA 3GIIA 2B6GA 2BDPA 3NRWA 4OCZA 2C28A 4UB4A 3C28A 2PKEA 5HR7A 4JV0A 5HMLA 3Q8SB 3F2BA 1ZJMA 1CRXA 3JPRA 2ZJAA 5EE3A 3IG8A 4PGYA 5BPCA 1SKWA 4JWMA 2OEHA 7ICGA 2ZIVB 4C8KA 1UA0A 2HCFA 1LVHA 2EANA 3C2MA 3JPTA 2LHTA 2ATLA 5AICA 1PK1B 1O08A 3ETRA 4Q45A 2NRTA 1ZQKA 4I29A 1V9PA 3R9KA 2H3QA 2BCVA 3SD7A 1MSWD 3J81j 3PVXA 5KT7A 3UQ2A 8ICSA 4J9RA 4P0QB 1ZQNA 2XC9A 3OSNA 4JMUA 4IQWA 3QE9Y 1HEKA 3SEIA 5ALUA 2PMZC 7ICJA 2KNJA 4OJLA 3D6JA 3AL0B 8ICFA 4RNNA 3F53A 2J6TA 5ALDA 1WWVA 4C7YA 2JH7A 4BX9C 1QQ7A 4EX6A 4KLQA 2F1JA 4EZ6A 1TK0A 5ALTA 3QUQA 3H8SA 2WF5A 2LYAA 1QSLA 2HI0A 2KV2A 5AM0A 1ZRNA 3TQ1A 4I2BA 9ICNA 1DRGA 4EBEA 2DPIA 5KFCA 4C8OA 2HHXA 5ALZA 1PK3A 3H8JA 1S9FA 3K4GA 2OYYA 4CGZA 1PVRA 5IIMA 1TVAA 2NO5A 3SENA 2ISPA 4NY8A 3NASA 4DS5A 4KITB 1SV0C 3M8SA 7ICNA 2LPEA 4P0PA 8ICEA 3PR4A 4MEXA 2K89A 2VJ4A 1UQVA 4QZBA 1RXVA 7ICPA 4Y2TA 1QQ5A 1D8LA 5ALRA 5DB8A 3K75D 1OW5A 5B5EU 4PHPA 1B22A 3HKZF 4Q43A 3MDCA 2ZIXA 5EWGA 2BQRA 5A0LA 1JN3A 5B66U 5DKWA 4EX7A 2P35A 3N7PD 1SGGA 1HJPA 3KFUF 3N28A 5E79U 5KT5A 1QTMA 5GTHU 4HYKA 2AXTU 4QZDA 4M9LA 3V72A 3CRXA 4DQPA 4ED0A 1X9SA 1ZQZA 2AHOB 3T5HA 1Q46A 1ZQOA 2V9WA 1A77A 2ESEA 4FZNA 4KLIA 2E8NA 2KHVA 4QWEA 2ZIVA 2HHVA 5HNKA 1NJYA 4F2SA 4I2GA 5DQIA 3RJGA 1X6JA 3BQ2A 1PK1A 1BPXA 2PFQA 4KLMA 2ZTDA 1ZQWA 3FC4A 4M9JA 5J2JA 2W04A 2YB1A 3T5JA 2GWSA 4I2FA 2EDUA 2H3ZA 1FFVA 3QU2A 2MAXA 3WK5A 3I76A 4ZH4A 3RBDA 5KFBA 4IRKA 4IS7A 3RTVA 2BQUA 1J2MA 5ALSA 4P0QA 1TE2A 1N56A 5KT6A 2XGPA 3BQ0A 1XS9D 4ELTA 3NGDA 4Y2SA 3CNHA 8ICQA 1Z3EB 5G5GA 3M9NB 8ICUA 2ISOA 1ZQDA 3IHQB 5KFVA 4CRXA 3H4BA 4ECRA 2MA1A 2PMZF 4FS2A 3H40A 9ICEA 4Z6DA 1V38A 3UMGA 4J9MA 3RJHA 5F9NA 5J0UA 1RQLA 1CEZA 2HW3A 1T3NA 2F8KA 2OCEA 3GQCA 2F3NA 3KZIU 4KX3A 4JV2A 1X9WA 1COOA 1RQNA 5HHHA 1BNOA 4NLNA 4EZ9A 2DGZA 2FLNA 1S8OA 3H0RB 4Q44A 4DFJA 4EBCA 4QNLA 2HVHA 2E1FA 1PVQA 1N48A 2KFZA 3ETLA 5KL8B 2GH1A 2A1AA 2LM1A 4RPXA 3SAHA 4GFJA 4UBCA 3G6VA 2WF7A 3SZ2A 3G6XA 1XSPA 4ECUA 1V97A 4DOCA 4B9TA 1NK9A 2EAPA 1X6IA 4IL6U 2AH5A 5ALIA 5AKHA 1NK5A 1X42A 2VA3A 3QU7A 1UT5A 1L3VA 3TACB 3PV8A 3HILA 2DPJA 4YP3A 5KFZA 1KLNA 3CW2C 4YXMA 4C4TA 4U7CA 4UBBA 2KTQA 3T3FA 3KZXA 2HOQA 3UXNA 2E8PA 4M04A 7ICOA 3NVZA 2MUTB 3WK6A 3RAQA 4DFDA 5KFIA 4CF3A 5ALFA 1KW4A 4NL9C 4CCHA 5DBAA 2JR5A 1QSYA 2A3VA 4NM1A 3G6YA 5D4BA 4JWNA 2VIXA 2DF4B 2Z7JA 2KZ3A 9ICBA 2GO7A 2XY6A 5ALMA 2PI5A 2CN1A 3CYMA 4F93B 7ICFA 1RXWA 5AI5A 2ZG6A 2XIDA 3JPPA 4F50A 3AU6A 2ASLA 4RUAA 4UB8U 4Q8EA 3MR2A 4UQGA 4DL3A 4C4SA 2ES6A 4F5OA 4CDGA 1XO1A 1Z1VA 5KFGA 3ZDAA 4B9NA 5KFMA 3WKDA 1OXJA 4YFKA 3RB3A 1RDFA 4NLBA 4JV1A 4EEKA 2W9AA 4QIWC 3QUCA 3ORYA 3C1YA 8ICCA 2Y1IA 2HBJA 4M6WB 4ECQA 4BXOB 4DLGA 3KKAC 5DQHA 1S5LU 3H8WA 5J2AA 1SXEA 2FI1A 4RNOA 1F44A 2N1RA 2FPMA 5KL1B 8ICJA 5KFFA 3E58A 3O0FA 1FFUA 4B9LA 4QJFB 4RNMA 1S0NA 1M6YA 4KLUA 4A8EA 3TANA 2WF6A 4ECSA 5EWFA 5J0QA 8ICBA 2BR0A 4B9MA 3QU4A 4FE3A 4NLKA 2WF9A 4FBTA 2YX8A 1N5WA 2DL0A 4FZMA 4Y2QA 3MBYA 2KK0A 4UB6U 4QWBA 1ZD5A 4U6PA 2FMQA 9ICCA 4DSIA 1L7PA 2KE7A 1TK5A 1ZQIA 2ZIUA 3QU9A 2KJ8A 5TISU 2VA2A 1SKSA 1D9DA 5CHGA 3GFKB 4GXJA 3F5AA 3QZ7A 1TAMA 3B0XA 3M6KA 1A0PA 2Y1JA 8ICYA 2Y0SF 3ZDDA 4F92B 8ICAA 1MN8A 1RZTA 5KFLA 2KIWA 1U47A 3HPOA 2A19A 4FFDA 4C7ZA 1BNPA 4C8MA 4XRHA 1IXRA 2OH2A 1C7YA 5J2FA 1GO3F 2LYHA 3ISCA 2MUTA 1ZQYA 2DUYA 1NI3A 4F4ZA 2M9NA 2WF8A 2WB1F 3HKZC 3PNCA 3UMBA 1UPHA 4PHEA 4P0PB 3LVVA 5KG3A 2AQ0A 2LKYA 4RQ3A 1PUZA 4YXJA 1Z1BA 5J0SA 1AQ6A 4C0ZA 7ICKA 3UQ0A 5HP4A 9ICJA 2ASDA 5DG8A 3PZPA 1JXLA 4ZOHC 9ICSA 3HP6A 9ICHA 2DKZA 5J0TA 5ALQA 5KG1A 3KHHA 3EPIA 4RZRA 1JMSA 1L6NA 1KQQA 1YZ7A 4B9SA 4DEZA 4PH5A 2BZFA 4TQSA 4UW9A 5ALXA 2MRLA 3V7KA 4QWDA 1K5OA 2F2AB 4ECZA 2PFPA 2XY5A 4UASA 2JXJA 4LZDA 4PHDA 4RQ5A 4B9UA 4JUZA 4KX5A 1T8EA 4OO1J 4M6WA 4BXOA 3DDHA 3OHAA 4DFKA 5J2EA 2W9BB 4B6JA 4DQIA 4FS1A 1V85A 2HHWA 4BUGA 3TAPA 1CUKA 4QIWF 4R63A 3ZDCA 2RLTA 2ZJ5A 3QX7A 1DOQA 3NVVA 3M9OB 3L3FX 5KG2A 1DGJA 3V7LA 4O3SA 3UM9A 1LKYB 1Q3VA 2JHDA 1NOMA 3PW2A 4RT2A 3PMNA 3RH5A 1N5XA 2HBMA 3TADA 3C23A 3D2SA 1IIPA 1X9MA 4GLXA 2HDOA 3GDXA 1IM4A 4RQ7A 3RH4A 9ICVA 2KJ5A 2BPFA 4KLJA 1ZQ1C 3A0BU 3HT3A 2K60A 3KKAA 3AQFA 3QXGA 4EELA 4XQ8A 2JMGA 3OGUA 4DS4A 2HHSA 2IOFK 2O6KA 3CP8A 4TQRA 5KFJA 5J29A 2EH9A 4TUPA 1S0OA 3QYPA 1XU4A 4QZ9A 3IP4B 2W54A 3PSTA 1DGSA 1L7OA 3V7JA 4RPZA 8ICVA 1NJZA 2ZIWA 5KFTA 3C5GA 5DBBA 3H4DA 4KLDA 4DL7A 1DXSA 4PL1A 5KFAA 3QU5A 3SQIA 4KLLA 7ICHA 1A6SA 7ICRA 2R8KA 4C8NA 4X5VA 4MF2A 2V4RA 4YMMA 4IR1A 9ICGA 5CA7A 4TUQA 7ICUA 1HIWA 2KN7A 2HSZA 2P6UA 5CRXA 3F2CA 1HUOA 3SAFA 1S76D 5ALPA 1ZQUA 3QUBA 2R8JA 5IINA 1XNSA 3M8RA 2Y9UA 1Z00B 1ZD2P 4E0DA 2ALZA 2BPCA 3V6JA 4BWMA 2H3VA 4PZOA 4YR3A 5F3XB 3SV3A 1K1QA 3ISDA 2UVWA 5FP0A 4PGQA 1UHUA 5KFKA 4UB2A 2UVVA 3OHBA 8ICTA 2BCRA 2W55A 2F77X 4RQ8A 2MSNA 1FEZA 2LMRA 4G3IA 4O5EA 4UAUA 1KBUA 1ZQMA 3QEBZ 3PW0A 3DEEA 1D8BA 5AI6A 2NO4A 5J2BA 4DWIA 4USAA 5ALEA 5EE0A 4MFCA 2MU2A 1IV8A 2ASJA 3WK9A 4C4RA 3FYHA 3KTQA 1RYUA 2KZZA 5AK3A 5AI8A 2G5IB 2W9BA 4O5CA 4ECWA 3TKAA 4KLOA 3PY8A 2P66A 4YVZA 5EOZA 4DOBA 2KEYA 3N97B 4O3NA 1KEJA 3T5KA 5TZVA 4DSEA 5DLFA 2K8CB 1UCVA 3WKBA 1LKYA 5DB7A 1KDHA 1ZQXA 4CE6A 5ALJA 4F72A 4G9BA 4GC7A 4DL6A 4KLTA 5CWRA 4Z6FA 4P2HA 4F4YA 4ECYA 3KBBA 5IIJA 4J03A 4F8RA 2YQEA 2HHUA 4PZNA 2VANA 4OJ6A 5J8YC 4MF8A 4EENA 2JEIA 4O3QA 5G5HA 3RJFA 3BJYA 2KKPA 2BCSA 1SWVA 1TFRA 2D6FC 3NVWA 3LDAA 1UA1A 3RFAA 1SL2A 1DK2A 1TK8A 2C22A 2FJ6A 4Y2UA 5KG7A 4KMUA 1MA7A 5T14A 4Y2VA 1L7NA 3JPOA 1YZ6A 5DG7A 3PX0A 3WKEA 5AM2A 2XICA 2PFOA 1BPEA 4DSJA 4UATA 1U9LA 4UAZA 3ALRA 5JRTA 1Z19A 3V6KA 4GIBA 1EXNA 2Y0SC 2ZIUB 4AYBF 4DCCA 5L1KA 3HW8A 1Z00A 1ZD3A 5ALKA 1QCKA 4HAIA 3BS5B 8ICWA 2DFLA 2H3IA 3ZDBA 5L9XA 3IRUA 2CPRA 3RJIA 1TAQA 5KFYA 8ICHA 3AEVA 3H0MB 5J2KA 2EQYA 1NKBA 1Z4OA 5KFOA 2W11A 5J2GA 3K1RB 2JEGA 2EAMA 3H0LB 4NWIA 2IA6A 1TV9A 2WB1C 3M7DA 3MR3A 3PX6A 1ZQPA 5KFNA 3MFHA 8ICMA 4Y2PA 1ZQQA 3DV9A 3MGIA 5AKEA 1SV0A 1KTQA
chains in the Genus database with same CATH topology
5K4LA 1RYUA 2EQYA 2CXYA 2KK0A 2EH9A 1KKXA 2RQ5A 2JXJA 2LI6A 2OEHA 1C20A 1KQQA 2JRZA 2YQEA 1KN5A 2LM1A 4LJXA 5CEHA 1IG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K4L A;  1RYU A;  2EQY A;  2CXY A;  2KK0 A;  2EH9 A;  1KKX A;  2RQ5 A;  2JXJ A;  2LI6 A;  2OEH A;  1C20 A;  1KQQ A;  2JRZ A;  2YQE A;  1KN5 A;  2LM1 A;  4LJX A;  5CEH A;  1IG6 A; 
#chains in the Genus database with same CATH topology
 5IIO A;  3GIL A;  1QQ6 A;  3GV5 B;  5J0Y A;  1URJ A;  5ALW A;  3IG5 A;  4PJ0 U;  3ICX A;  5AKK A;  2W7O A;  4YD1 A;  4DSF A;  1KKX A;  5EWE A;  1YT3 A;  3PX4 A;  2KIV A;  4ELU A;  3T79 A;  3UXO A;  1ZXI A;  1BGX T;  4EBD A;  4P4O A;  4C80 A;  4US8 A;  3MGH A;  5HR6 A;  3LWL A;  5CEH A;  1JUD A;  1L5U A;  4KLH A;  5AHX A;  4NV0 A;  2VKQ A;  1PVP A;  3SV4 A;  4J9O A;  4I27 A;  1VDV A;  3F5E A;  4IRD A;  3KHR A;  1CI4 A;  2H3F A;  5AK5 A;  3TAR A;  2H5X A;  2HHT A;  4Y2J A;  3C21 A;  4CF5 A;  1N63 A;  2UVR A;  2ZUD A;  2BCU A;  1ZQV A;  4KLE A;  5F9L A;  4J9Q A;  2JGA A;  3MFI A;  1SL0 A;  1NK0 A;  1COK A;  2C2D A;  2RQ5 A;  2FE9 A;  2JZB A;  4GXK A;  3MDA A;  1H38 A;  1SV4 A;  3D2Q A;  2J6U A;  2XCA A;  4UB5 A;  2K8A A;  8ICK A;  1KN5 A;  1S10 A;  4LJX A;  4IQV A;  4YMO A;  1IG6 A;  2QB1 A;  5J0X A;  5KFW A;  3PW4 A;  2BDU A;  4O3R A;  1ARO P;  5KG0 A;  1U4B A;  2NRW A;  5AK4 A;  4DQQ A;  3FM9 A;  5CB1 A;  2HOI A;  1ZYQ A;  1VJ5 A;  5IIK A;  3BQ1 A;  3S6J A;  3WK8 A;  2ZTC A;  1X66 A;  2BHN A;  2EAO A;  3M9M B;  2IBK A;  1Q3U A;  9ICF A;  9ICL A;  2YMM A;  4WJ3 B;  4KTQ A;  2AGO A;  1BVS A;  1F0M A;  4I2J A;  2I5H A;  5J8Y A;  2RRD A;  4ED1 A;  3Q8R B;  1KFT A;  4F4X A;  3TI0 A;  5H2F U;  4ED6 A;  2KG5 A;  2DQN B;  3I1Y A;  1KFD A;  4ED7 A;  4F3O A;  3BS5 A;  5KNI A;  4DLE A;  1U48 A;  3ONN A;  3QUT A;  2K4I A;  1VLB A;  3BQT A;  2V4Q A;  5AIA A;  4DO9 A;  7ICM A;  1ZQB A;  4UAV A;  4OD0 A;  2QAR B;  5J2I A;  2ZIW B;  3N7S C;  3ZD8 A;  2DKX A;  4MFF A;  9ICI A;  5CP2 A;  5KAF U;  4ED8 A;  5IIL A;  1L3T A;  5EE1 A;  1S0V A;  5KFE A;  5KG6 A;  1ZJN A;  3LYS A;  5J0R A;  2YML A;  2RHF A;  4DFP A;  5KTQ A;  7ICL A;  5CJ7 A;  1WYG A;  1NK4 A;  4ECX A;  5KG5 A;  2ZXI A;  4KLS A;  5AKG A;  2VJ5 A;  2B0C A;  2RP5 A;  1FO4 A;  5L1M A;  2QKQ A;  4OJ5 A;  5DLG A;  1T7P A;  1ZQR A;  2F8L A;  5KFX A;  1RM6 C;  4DL4 A;  1B0X A;  4JK1 A;  1S77 D;  2ZJ8 A;  3HJE A;  3NS1 A;  2IOH A;  3KHL A;  1ECW A;  5AKJ A;  3H8M A;  1XWL A;  2KJ9 A;  1XO0 A;  1XSN A;  1NK7 A;  1ZOL A;  4RQM A;  2NRZ A;  2ZUC A;  3EPG A;  2XY7 A;  3WU2 U;  1ZRM A;  1D8Y A;  3NUQ A;  1TAU A;  1HUZ A;  7ICV A;  4OJO A;  2KHQ A;  5AIB A;  3RJK A;  5GTI U;  2C2E A;  4NL9 A;  4MFA A;  3Q8L A;  2PI4 A;  2HBK A;  4UAW A;  1ZET A;  4AP9 A;  2JH1 A;  3SYZ A;  2A1J B;  2DBY A;  4YR0 A;  1SB3 C;  2W3S A;  2JEJ A;  3VCB A;  3KOO A;  2EZZ A;  7ICQ A;  3EWA A;  1X40 A;  5DGA A;  3WKC A;  3RH6 A;  1WCL A;  4ACO A;  2JRZ A;  4UB1 A;  5AM1 A;  2R8G A;  2ZUB A;  4CF4 A;  3E2E A;  4BDP A;  1JI7 A;  1ZQL A;  4YMN A;  4DOA A;  4KN4 A;  4QZH A;  4YD2 A;  4F5Q A;  4O0I A;  4I28 A;  9ICA A;  3A0H U;  4DF4 A;  3L5K A;  5JTI A;  1U49 A;  2FMS A;  2EZY A;  1S97 A;  4P4M A;  3HRD D;  3Q8P B;  7ICI A;  4PL2 A;  2KFN A;  2WAQ F;  1B4F A;  2CXY A;  2AQ4 A;  3RB6 A;  2E3T A;  2LBO A;  4M2Y A;  4YG2 A;  1Z4N A;  4I2H A;  1T3Q A;  2K8B B;  4QW9 A;  3PW5 A;  4R64 A;  9ICR A;  4QWC A;  1PZN A;  4R8U A;  2QAR A;  3V6H A;  3E0F A;  1F5S A;  4FO6 A;  4F5P A;  3EYZ A;  1NK8 A;  2FPK A;  2ODG A;  5DB9 A;  3K1Z A;  3IN5 A;  1T94 A;  4OJP A;  1NZP A;  4AYB C;  2PXI A;  3TFS A;  1U45 A;  2KMD A;  1ZQC A;  1DK3 A;  2G0A A;  2DWQ A;  2BCQ A;  5KFR A;  2XO7 A;  9ICU A;  2G09 A;  4J9N A;  3MGV A;  4RPY A;  3BZC A;  2YMP A;  3QNM A;  4RUC A;  7ICT A;  3ZDE A;  5AKX A;  2W3R A;  3GIK A;  5C5J A;  5ALL A;  2OXO A;  2W8K A;  2P6R A;  1RYR A;  4RQ6 A;  4YN4 A;  4KMO B;  1OUQ A;  3GIJ A;  3C2K A;  4IRC A;  3M6Z A;  3THV A;  4Q8F A;  2YY6 A;  2QB0 A;  3JPN A;  3LVW A;  3PSP A;  4K4H A;  4XA5 A;  3PSF A;  1NJW A;  2HVI A;  2XI9 A;  1Q8K A;  1SZP A;  5KFS A;  1L7M A;  3SAG A;  5L1L A;  4DF8 A;  1NZB A;  5DQG A;  2I6X A;  2C2R A;  1ED1 A;  2YTU A;  5J0O A;  8ICZ A;  5D46 A;  2AGP A;  5ALV A;  4O3O A;  1JRO A;  2BPG A;  3IV6 A;  5DG9 A;  2D3D A;  5KFD A;  2ZXH A;  4I2A A;  2A1J A;  5KT4 A;  4I2C A;  2Q4T A;  8ICN A;  2FMP A;  2HBL A;  2KOB A;  1MQ2 A;  5K4L A;  1UT8 A;  3OJU A;  2WTF A;  2W9M A;  3JPQ A;  7ICS A;  1ZQH A;  4LVS A;  3U26 A;  3RR8 A;  8ICG A;  3TAQ A;  4BWJ A;  2IMW P;  8ICI A;  4M47 A;  3MC1 A;  2GLE A;  3AM9 A;  3C29 A;  2F1I A;  2NRV A;  3AN1 A;  3RAX A;  2AJQ A;  9ICT A;  2KIC A;  4CNQ A;  5CR0 A;  1JX4 A;  4RT3 A;  3Q8Q B;  2XCP A;  4NLG A;  4F5R A;  4ED2 A;  2LYB A;  5ALH A;  4TUR A;  4M9G A;  2KVS A;  2I1Q A;  4O9M A;  2JZB B;  3RJJ A;  4F71 A;  5J2H A;  2QLT A;  4Z6E A;  4R66 A;  2F76 X;  2R8H A;  4BJQ A;  3BQ7 A;  3T5L A;  2LI6 A;  5J2D A;  3LK9 A;  2D8C A;  1K1S A;  4BGD A;  2F44 A;  1N62 A;  3GU3 A;  1WWU A;  3NRZ A;  4PGX A;  2NYV A;  1ZQJ A;  5L1J A;  1JIH A;  2I9G A;  2E8O A;  2EZX A;  5AKL A;  4QZA A;  2JEF A;  2KZM A;  2KSO B;  1SKR A;  2W7P A;  3PO4 A;  4GXI A;  1QSS A;  5BOL A;  3RBE A;  3BS7 A;  5ALO A;  3IDW A;  4K4I A;  2KVC A;  7ICE A;  3SR6 A;  5ALG A;  1KSP A;  4KLF A;  2G08 A;  3RJE A;  4QZE A;  1ZQF A;  1FIQ A;  3B9J A;  1N60 A;  5AI9 A;  5KT2 A;  1N61 A;  2IOF A;  1T4G A;  4K4G A;  4P4P A;  3RRG A;  1KFS A;  1KL9 A;  1SZH A;  2G07 A;  4O5K A;  5KFP A;  2FLL A;  2F1H A;  4YCX A;  2W9C B;  9ICW A;  2CRX A;  3RB4 A;  1RYS A;  3EUB 2;  4UAY A;  5D49 A;  2G5H B;  4NLZ A;  1WCN A;  3I28 A;  3B0Y A;  2YMQ A;  3AMZ A;  9ICX A;  1L8L A;  5KFU A;  2FPL A;  1C20 A;  5AI4 A;  4O3P A;  4EYH B;  4I2D A;  3LWM A;  3OTQ A;  4UB3 A;  5KFH A;  4ED3 A;  3SI8 A;  2AGQ A;  3L4P A;  2J6S A;  3HWT A;  2E5S A;  1NNL A;  3QZ8 A;  3QEA Z;  3EZ5 A;  3PW7 A;  3Q8K A;  1NKC A;  4Y2X A;  2L5Y A;  3WK7 A;  5AM4 A;  2IHM A;  4XUS A;  3AUO A;  4TUS A;  2NV3 A;  4IC9 A;  3C2L A;  2XVT A;  2JV3 A;  1QH9 A;  3NVY A;  3KD3 A;  3AQE A;  9ICK A;  1BPY A;  1RG6 A;  2YB4 A;  4I2E A;  5AI0 A;  5KG4 A;  4PPX A;  5KT3 A;  2E1E A;  3RR7 A;  3MAB A;  5DDY A;  5III A;  1SL1 A;  8ICR A;  4C8L A;  3OSP A;  4J9K A;  1JAL A;  1SXD A;  4B9V A;  1MC8 A;  4LZG A;  3PR5 B;  4J9P A;  3UXP A;  5AK6 A;  3RB0 A;  1ZD4 A;  3BDP A;  4RQ4 A;  3N7R C;  1RPL A;  3SMV A;  4DSL A;  5J2C A;  4O3M A;  3N4M B;  5ALN A;  2W03 A;  2BGW A;  4IR9 A;  5AKZ A;  1NKE A;  3ISB A;  4EEY A;  4M9N A;  2K4P A;  4DFM A;  4MEY A;  2HMX A;  3TAD C;  1B43 A;  8ICP A;  3WKA A;  1SWW A;  3ZI4 A;  4EYI B;  4F5N A;  1P7D A;  4NXZ A;  4KN7 A;  5AM5 A;  1ZQG A;  2GOL A;  4YR2 A;  9ICM A;  3PO5 A;  5J0W A;  1ZQA A;  3TFR A;  2AU0 A;  3FDS A;  5JU5 A;  2OHF A;  4F4W A;  8ICX A;  1NK6 A;  2HOF A;  4IQT A;  3UPQ A;  1LV5 A;  2KSO A;  2KKV A;  5AKI A;  4FBU A;  4FZL A;  2RDI A;  1QLN A;  4NLC A;  2OWO A;  4RQ0 A;  1N2X A;  4QZG A;  2WAQ C;  4Y2R A;  2WFA A;  4ECV A;  3UMC A;  1ZQT A;  5KAI U;  3ED5 A;  5BOM A;  1BPZ A;  8ICO A;  4Y2Y A;  1TKD A;  2YN4 A;  2G06 A;  2R18 A;  3M1Y A;  4J9S A;  4DL5 A;  3WK4 A;  5J0P A;  2BKE A;  3PML A;  4F91 B;  3RF9 A;  1NJX A;  2FLP A;  3Q8M A;  4NM2 A;  4QZF A;  4I2I A;  3JPS A;  4KLG A;  9ICP A;  1O03 A;  4R65 A;  1D9F A;  5HHI A;  2W9C A;  1MQ3 A;  2M0N A;  3D2N A;  3MR5 A;  4MHV A;  5HMM A;  1ZQS A;  1XSL A;  4RQN A;  4R8U B;  4F4K A;  5L1I A;  1L3S A;  1A76 A;  2B21 A;  3BZK A;  5DDM A;  3NTU A;  5DB6 A;  4RQ1 A;  1S0M A;  3EW9 A;  2FDR A;  4RU9 A;  1X2I A;  8ICL A;  4JB3 A;  3MR6 A;  5ALY A;  2ZTE A;  1L8O A;  4QW8 A;  4IQU A;  4J9L A;  4GC6 A;  1KRP A;  2Y9T A;  5JUM A;  4UAR A;  5KFQ A;  4ELV A;  2K4E A;  3C5F A;  2HHQ A;  5DGB A;  2W8L A;  4PHA A;  3GV7 B;  3C1Z A;  2KD1 A;  4ICA A;  2OM6 A;  4YQW A;  3OJS A;  2WHE A;  3VC8 A;  3H7I A;  4RQ2 A;  2XGQ A;  3GV8 B;  2PFN A;  4ECT A;  4Z6C A;  2BQ3 A;  2W43 A;  1SIJ A;  1LB2 B;  1X9X A;  1XC9 A;  4M9H A;  3GZF A;  9ICO A;  5AKY A;  2NRX A;  1J97 A;  1WG8 A;  3F2D A;  2LM4 A;  2QB0 B;  3FAH A;  4DQS A;  2UVU A;  3IM1 A;  1L3U A;  1ZQE A;  4QZ8 A;  4NJ8 A;  5EE9 A;  3KHG A;  2VA8 A;  5DBC A;  1BPD A;  2E8M A;  2IHN A;  3RRH A;  4DQR A;  2R8I A;  1Y88 A;  4M0A A;  3PSI A;  1JRP A;  4QZI A;  2Q0Z X;  9ICQ A;  1JXE A;  1WUD A;  2K4H A;  4DSK A;  3HX0 A;  3OPX A;  1J2N A;  2ZIX B;  4US9 A;  3ZD9 A;  2RDJ A;  5AM3 A;  1BPB A;  3GIM A;  2KP7 A;  3AU2 A;  4DL2 A;  4F2R A;  4QWA A;  5C0Y A;  4QZC A;  3GII A;  2B6G A;  2BDP A;  3NRW A;  4OCZ A;  2C28 A;  4UB4 A;  3C28 A;  2PKE A;  5HR7 A;  4JV0 A;  5HML A;  3Q8S B;  3F2B A;  1ZJM A;  1CRX A;  3JPR A;  2ZJA A;  5EE3 A;  3IG8 A;  4PGY A;  5BPC A;  1SKW A;  4JWM A;  2OEH A;  7ICG A;  2ZIV B;  4C8K A;  1UA0 A;  2HCF A;  1LVH A;  2EAN A;  3C2M A;  3JPT A;  2LHT A;  2ATL A;  5AIC A;  1PK1 B;  1O08 A;  3ETR A;  4Q45 A;  2NRT A;  1ZQK A;  4I29 A;  1V9P A;  3R9K A;  2H3Q A;  2BCV A;  3SD7 A;  1MSW D;  3J81 j;  3PVX A;  5KT7 A;  3UQ2 A;  8ICS A;  4J9R A;  4P0Q B;  1ZQN A;  2XC9 A;  3OSN A;  4JMU A;  4IQW A;  3QE9 Y;  1HEK A;  3SEI A;  5ALU A;  2PMZ C;  7ICJ A;  2KNJ A;  4OJL A;  3D6J A;  3AL0 B;  8ICF A;  4RNN A;  3F53 A;  2J6T A;  5ALD A;  1WWV A;  4C7Y A;  2JH7 A;  4BX9 C;  1QQ7 A;  4EX6 A;  4KLQ A;  2F1J A;  4EZ6 A;  1TK0 A;  5ALT A;  3QUQ A;  3H8S A;  2WF5 A;  2LYA A;  1QSL A;  2HI0 A;  2KV2 A;  5AM0 A;  1ZRN A;  3TQ1 A;  4I2B A;  9ICN A;  1DRG A;  4EBE A;  2DPI A;  5KFC A;  4C8O A;  2HHX A;  5ALZ A;  1PK3 A;  3H8J A;  1S9F A;  3K4G A;  2OYY A;  4CGZ A;  1PVR A;  5IIM A;  1TVA A;  2NO5 A;  3SEN A;  2ISP A;  4NY8 A;  3NAS A;  4DS5 A;  4KIT B;  1SV0 C;  3M8S A;  7ICN A;  2LPE A;  4P0P A;  8ICE A;  3PR4 A;  4MEX A;  2K89 A;  2VJ4 A;  1UQV A;  4QZB A;  1RXV A;  7ICP A;  4Y2T A;  1QQ5 A;  1D8L A;  5ALR A;  5DB8 A;  3K75 D;  1OW5 A;  5B5E U;  4PHP A;  1B22 A;  3HKZ F;  4Q43 A;  3MDC A;  2ZIX A;  5EWG A;  2BQR A;  5A0L A;  1JN3 A;  5B66 U;  5DKW A;  4EX7 A;  2P35 A;  3N7P D;  1SGG A;  1HJP A;  3KFU F;  3N28 A;  5E79 U;  5KT5 A;  1QTM A;  5GTH U;  4HYK A;  2AXT U;  4QZD A;  4M9L A;  3V72 A;  3CRX A;  4DQP A;  4ED0 A;  1X9S A;  1ZQZ A;  2AHO B;  3T5H A;  1Q46 A;  1ZQO A;  2V9W A;  1A77 A;  2ESE A;  4FZN A;  4KLI A;  2E8N A;  2KHV A;  4QWE A;  2ZIV A;  2HHV A;  5HNK A;  1NJY A;  4F2S A;  4I2G A;  5DQI A;  3RJG A;  1X6J A;  3BQ2 A;  1PK1 A;  1BPX A;  2PFQ A;  4KLM A;  2ZTD A;  1ZQW A;  3FC4 A;  4M9J A;  5J2J A;  2W04 A;  2YB1 A;  3T5J A;  2GWS A;  4I2F A;  2EDU A;  2H3Z A;  1FFV A;  3QU2 A;  2MAX A;  3WK5 A;  3I76 A;  4ZH4 A;  3RBD A;  5KFB A;  4IRK A;  4IS7 A;  3RTV A;  2BQU A;  1J2M A;  5ALS A;  4P0Q A;  1TE2 A;  1N56 A;  5KT6 A;  2XGP A;  3BQ0 A;  1XS9 D;  4ELT A;  3NGD A;  4Y2S A;  3CNH A;  8ICQ A;  1Z3E B;  5G5G A;  3M9N B;  8ICU A;  2ISO A;  1ZQD A;  3IHQ B;  5KFV A;  4CRX A;  3H4B A;  4ECR A;  2MA1 A;  2PMZ F;  4FS2 A;  3H40 A;  9ICE A;  4Z6D A;  1V38 A;  3UMG A;  4J9M A;  3RJH A;  5F9N A;  5J0U A;  1RQL A;  1CEZ A;  2HW3 A;  1T3N A;  2F8K A;  2OCE A;  3GQC A;  2F3N A;  3KZI U;  4KX3 A;  4JV2 A;  1X9W A;  1COO A;  1RQN A;  5HHH A;  1BNO A;  4NLN A;  4EZ9 A;  2DGZ A;  2FLN A;  1S8O A;  3H0R B;  4Q44 A;  4DFJ A;  4EBC A;  4QNL A;  2HVH A;  2E1F A;  1PVQ A;  1N48 A;  2KFZ A;  3ETL A;  5KL8 B;  2GH1 A;  2A1A A;  2LM1 A;  4RPX A;  3SAH A;  4GFJ A;  4UBC A;  3G6V A;  2WF7 A;  3SZ2 A;  3G6X A;  1XSP A;  4ECU A;  1V97 A;  4DOC A;  4B9T A;  1NK9 A;  2EAP A;  1X6I A;  4IL6 U;  2AH5 A;  5ALI A;  5AKH A;  1NK5 A;  1X42 A;  2VA3 A;  3QU7 A;  1UT5 A;  1L3V A;  3TAC B;  3PV8 A;  3HIL A;  2DPJ A;  4YP3 A;  5KFZ A;  1KLN A;  3CW2 C;  4YXM A;  4C4T A;  4U7C A;  4UBB A;  2KTQ A;  3T3F A;  3KZX A;  2HOQ A;  3UXN A;  2E8P A;  4M04 A;  7ICO A;  3NVZ A;  2MUT B;  3WK6 A;  3RAQ A;  4DFD A;  5KFI A;  4CF3 A;  5ALF A;  1KW4 A;  4NL9 C;  4CCH A;  5DBA A;  2JR5 A;  1QSY A;  2A3V A;  4NM1 A;  3G6Y A;  5D4B A;  4JWN A;  2VIX A;  2DF4 B;  2Z7J A;  2KZ3 A;  9ICB A;  2GO7 A;  2XY6 A;  5ALM A;  2PI5 A;  2CN1 A;  3CYM A;  4F93 B;  7ICF A;  1RXW A;  5AI5 A;  2ZG6 A;  2XID A;  3JPP A;  4F50 A;  3AU6 A;  2ASL A;  4RUA A;  4UB8 U;  4Q8E A;  3MR2 A;  4UQG A;  4DL3 A;  4C4S A;  2ES6 A;  4F5O A;  4CDG A;  1XO1 A;  1Z1V A;  5KFG A;  3ZDA A;  4B9N A;  5KFM A;  3WKD A;  1OXJ A;  4YFK A;  3RB3 A;  1RDF A;  4NLB A;  4JV1 A;  4EEK A;  2W9A A;  4QIW C;  3QUC A;  3ORY A;  3C1Y A;  8ICC A;  2Y1I A;  2HBJ A;  4M6W B;  4ECQ A;  4BXO B;  4DLG A;  3KKA C;  5DQH A;  1S5L U;  3H8W A;  5J2A A;  1SXE A;  2FI1 A;  4RNO A;  1F44 A;  2N1R A;  2FPM A;  5KL1 B;  8ICJ A;  5KFF A;  3E58 A;  3O0F A;  1FFU A;  4B9L A;  4QJF B;  4RNM A;  1S0N A;  1M6Y A;  4KLU A;  4A8E A;  3TAN A;  2WF6 A;  4ECS A;  5EWF A;  5J0Q A;  8ICB A;  2BR0 A;  4B9M A;  3QU4 A;  4FE3 A;  4NLK A;  2WF9 A;  4FBT A;  2YX8 A;  1N5W A;  2DL0 A;  4FZM A;  4Y2Q A;  3MBY A;  2KK0 A;  4UB6 U;  4QWB A;  1ZD5 A;  4U6P A;  2FMQ A;  9ICC A;  4DSI A;  1L7P A;  2KE7 A;  1TK5 A;  1ZQI A;  2ZIU A;  3QU9 A;  2KJ8 A;  5TIS U;  2VA2 A;  1SKS A;  1D9D A;  5CHG A;  3GFK B;  4GXJ A;  3F5A A;  3QZ7 A;  1TAM A;  3B0X A;  3M6K A;  1A0P A;  2Y1J A;  8ICY A;  2Y0S F;  3ZDD A;  4F92 B;  8ICA A;  1MN8 A;  1RZT A;  5KFL A;  2KIW A;  1U47 A;  3HPO A;  2A19 A;  4FFD A;  4C7Z A;  1BNP A;  4C8M A;  4XRH A;  1IXR A;  2OH2 A;  1C7Y A;  5J2F A;  1GO3 F;  2LYH A;  3ISC A;  2MUT A;  1ZQY A;  2DUY A;  1NI3 A;  4F4Z A;  2M9N A;  2WF8 A;  2WB1 F;  3HKZ C;  3PNC A;  3UMB A;  1UPH A;  4PHE A;  4P0P B;  3LVV A;  5KG3 A;  2AQ0 A;  2LKY A;  4RQ3 A;  1PUZ A;  4YXJ A;  1Z1B A;  5J0S A;  1AQ6 A;  4C0Z A;  7ICK A;  3UQ0 A;  5HP4 A;  9ICJ A;  2ASD A;  5DG8 A;  3PZP A;  1JXL A;  4ZOH C;  9ICS A;  3HP6 A;  9ICH A;  2DKZ A;  5J0T A;  5ALQ A;  5KG1 A;  3KHH A;  3EPI A;  4RZR A;  1JMS A;  1L6N A;  1KQQ A;  1YZ7 A;  4B9S A;  4DEZ A;  4PH5 A;  2BZF A;  4TQS A;  4UW9 A;  5ALX A;  2MRL A;  3V7K A;  4QWD A;  1K5O A;  2F2A B;  4ECZ A;  2PFP A;  2XY5 A;  4UAS A;  2JXJ A;  4LZD A;  4PHD A;  4RQ5 A;  4B9U A;  4JUZ A;  4KX5 A;  1T8E A;  4OO1 J;  4M6W A;  4BXO A;  3DDH A;  3OHA A;  4DFK A;  5J2E A;  2W9B B;  4B6J A;  4DQI A;  4FS1 A;  1V85 A;  2HHW A;  4BUG A;  3TAP A;  1CUK A;  4QIW F;  4R63 A;  3ZDC A;  2RLT A;  2ZJ5 A;  3QX7 A;  1DOQ A;  3NVV A;  3M9O B;  3L3F X;  5KG2 A;  1DGJ A;  3V7L A;  4O3S A;  3UM9 A;  1LKY B;  1Q3V A;  2JHD A;  1NOM A;  3PW2 A;  4RT2 A;  3PMN A;  3RH5 A;  1N5X A;  2HBM A;  3TAD A;  3C23 A;  3D2S A;  1IIP A;  1X9M A;  4GLX A;  2HDO A;  3GDX A;  1IM4 A;  4RQ7 A;  3RH4 A;  9ICV A;  2KJ5 A;  2BPF A;  4KLJ A;  1ZQ1 C;  3A0B U;  3HT3 A;  2K60 A;  3KKA A;  3AQF A;  3QXG A;  4EEL A;  4XQ8 A;  2JMG A;  3OGU A;  4DS4 A;  2HHS A;  2IOF K;  2O6K A;  3CP8 A;  4TQR A;  5KFJ A;  5J29 A;  2EH9 A;  4TUP A;  1S0O A;  3QYP A;  1XU4 A;  4QZ9 A;  3IP4 B;  2W54 A;  3PST A;  1DGS A;  1L7O A;  3V7J A;  4RPZ A;  8ICV A;  1NJZ A;  2ZIW A;  5KFT A;  3C5G A;  5DBB A;  3H4D A;  4KLD A;  4DL7 A;  1DXS A;  4PL1 A;  5KFA A;  3QU5 A;  3SQI A;  4KLL A;  7ICH A;  1A6S A;  7ICR A;  2R8K A;  4C8N A;  4X5V A;  4MF2 A;  2V4R A;  4YMM A;  4IR1 A;  9ICG A;  5CA7 A;  4TUQ A;  7ICU A;  1HIW A;  2KN7 A;  2HSZ A;  2P6U A;  5CRX A;  3F2C A;  1HUO A;  3SAF A;  1S76 D;  5ALP A;  1ZQU A;  3QUB A;  2R8J A;  5IIN A;  1XNS A;  3M8R A;  2Y9U A;  1Z00 B;  1ZD2 P;  4E0D A;  2ALZ A;  2BPC A;  3V6J A;  4BWM A;  2H3V A;  4PZO A;  4YR3 A;  5F3X B;  3SV3 A;  1K1Q A;  3ISD A;  2UVW A;  5FP0 A;  4PGQ A;  1UHU A;  5KFK A;  4UB2 A;  2UVV A;  3OHB A;  8ICT A;  2BCR A;  2W55 A;  2F77 X;  4RQ8 A;  2MSN A;  1FEZ A;  2LMR A;  4G3I A;  4O5E A;  4UAU A;  1KBU A;  1ZQM A;  3QEB Z;  3PW0 A;  3DEE A;  1D8B A;  5AI6 A;  2NO4 A;  5J2B A;  4DWI A;  4USA A;  5ALE A;  5EE0 A;  4MFC A;  2MU2 A;  1IV8 A;  2ASJ A;  3WK9 A;  4C4R A;  3FYH A;  3KTQ A;  1RYU A;  2KZZ A;  5AK3 A;  5AI8 A;  2G5I B;  2W9B A;  4O5C A;  4ECW A;  3TKA A;  4KLO A;  3PY8 A;  2P66 A;  4YVZ A;  5EOZ A;  4DOB A;  2KEY A;  3N97 B;  4O3N A;  1KEJ A;  3T5K A;  5TZV A;  4DSE A;  5DLF A;  2K8C B;  1UCV A;  3WKB A;  1LKY A;  5DB7 A;  1KDH A;  1ZQX A;  4CE6 A;  5ALJ A;  4F72 A;  4G9B A;  4GC7 A;  4DL6 A;  4KLT A;  5CWR A;  4Z6F A;  4P2H A;  4F4Y A;  4ECY A;  3KBB A;  5IIJ A;  4J03 A;  4F8R A;  2YQE A;  2HHU A;  4PZN A;  2VAN A;  4OJ6 A;  5J8Y C;  4MF8 A;  4EEN A;  2JEI A;  4O3Q A;  5G5H A;  3RJF A;  3BJY A;  2KKP A;  2BCS A;  1SWV A;  1TFR A;  2D6F C;  3NVW A;  3LDA A;  1UA1 A;  3RFA A;  1SL2 A;  1DK2 A;  1TK8 A;  2C22 A;  2FJ6 A;  4Y2U A;  5KG7 A;  4KMU A;  1MA7 A;  5T14 A;  4Y2V A;  1L7N A;  3JPO A;  1YZ6 A;  5DG7 A;  3PX0 A;  3WKE A;  5AM2 A;  2XIC A;  2PFO A;  1BPE A;  4DSJ A;  4UAT A;  1U9L A;  4UAZ A;  3ALR A;  5JRT A;  1Z19 A;  3V6K A;  4GIB A;  1EXN A;  2Y0S C;  2ZIU B;  4AYB F;  4DCC A;  5L1K A;  3HW8 A;  1Z00 A;  1ZD3 A;  5ALK A;  1QCK A;  4HAI A;  3BS5 B;  8ICW A;  2DFL A;  2H3I A;  3ZDB A;  5L9X A;  3IRU A;  2CPR A;  3RJI A;  1TAQ A;  5KFY A;  8ICH A;  3AEV A;  3H0M B;  5J2K A;  2EQY A;  1NKB A;  1Z4O A;  5KFO A;  2W11 A;  5J2G A;  3K1R B;  2JEG A;  2EAM A;  3H0L B;  4NWI A;  2IA6 A;  1TV9 A;  2WB1 C;  3M7D A;  3MR3 A;  3PX6 A;  1ZQP A;  5KFN A;  3MFH A;  8ICM A;  4Y2P A;  1ZQQ A;  3DV9 A;  3MGI A;  5AKE A;  1SV0 A;  1KTQ A; 
#chains in the Genus database with same CATH homology
 5K4L A;  1RYU A;  2EQY A;  2CXY A;  2KK0 A;  2EH9 A;  1KKX A;  2RQ5 A;  2JXJ A;  2LI6 A;  2OEH A;  1C20 A;  1KQQ A;  2JRZ A;  2YQE A;  1KN5 A;  2LM1 A;  4LJX A;  5CEH A;  1IG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...