1C20A

Solution structure of the dna-binding domain from the dead ringer protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAAFTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DNA binding domain from Dead ringer, a sequence-specific AT-rich interaction domain (ARID).
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords DEAD RINGER PROTEIN
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1c20A00
2EH9A 4LJXA 2JXJA 1KKXA 2CXYA 1RYUA 2KK0A 2EQYA 2LM1A 5CEHA 5K4LA 2OEHA 1KN5A 2LI6A 2JRZA 1C20A 2RQ5A 1KQQA 1IG6A 2YQEA
chains in the Genus database with same CATH superfamily
4EBDA 5KT3A 5AIAA 1ZQGA 3HJEA 4C7ZA 2EZXA 3PX6A 3TFRA 1ZRMA 4R64A 2DBYA 2M0NA 2AGQA 4DEZA 4FS2A 1HJPA 5AKJA 2PI4A 4ED6A 5AKEA 4ECZA 2KZZA 9ICEA 4ICAA 1UT8A 3FYHA 3ZDEA 1BPYA 4RUAA 4I2IA 3NRZA 1UA0A 1A77A 1F44A 2PMZC 3H8JA 5KFJA 1CI4A 2RLTA 4ECWA 4DFPA 4QNLA 1ZQSA 1XSNA 4UASA 3WKDA 3M6ZA 2YMQA 3C29A 2WB1F 1HUZA 4KLLA 4CDGA 5AM3A 2E8NA 4MHVA 5J2KA 4BWJA 2UVVA 9ICQA 4GXJA 2IHNA 4F4YA 2JZBB 3Q8PB 3F5EA 1RYSA 2R8HA 2W3SA 1ZQAA 2F1JA 5KFVA 2G06A 4ECVA 4RQ6A 5KFHA 5IIIA 1T4GA 1B0XA 1ZQMA 1TVAA 2LHTA 2BKEA 5AM5A 4UB6U 3JPQA 3GV5B 2P6RA 3G6VA 3V7JA 5DQGA 8ICEA 1TAMA 1ZQRA 5ALDA 3ZI4A 3UPQA 5C0YA 4C4RA 4O0IA 3MR6A 3RB6A 2HHTA 5AKLA 3CRXA 2W9CB 3M6KA 2FLLA 1DK3A 2HHVA 3MBYA 4CE6A 2ZTDA 4DL6A 2BR0A 2EAOA 2RP5A 1L3UA 9ICJA 5AKIA 9ICGA 4J9LA 2BGWA 2PFOA 3PNCA 9ICBA 3EW9A 4JV0A 2XY7A 5KG5A 9ICVA 3C1ZA 3WKBA 3QZ8A 9ICLA 3IN5A 3KHRA 1SL1A 1NK9A 2XICA 4RNMA 4B9TA 3M9OB 1Q46A 1ZQCA 4DSJA 1X2IA 3PSPA 2WTFA 4IQUA 3GIMA 4XQ8A 5DDMA 2AQ0A 4UB4A 4F4KA 3NGDA 1S10A 3F53A 1XNSA 3ZDBA 3Q8LA 2XGQA 2V9WA 2KTQA 2IOHA 2OHFA 5KFLA 5KG1A 2MA1A 4O3NA 3PX0A 4PGYA 4KLDA 3V72A 2W9AA 2F8KA 4ED0A 4RZRA 3SYZA 2H5XA 2KKPA 2QARB 4O3MA 2KD1A 4Q8FA 3BDPA 1EXNA 2W03A 4J9NA 2KZ3A 9ICHA 3H40A 3F2DA 3ZDCA 2F1IA 1RQLA 2WB1C 4U6PA 3PVXA 4ECYA 3UXOA 4QZDA 1IV8A 2HMXA 3HRDD 4KLIA 3BQ2A 2E5SA 2KEYA 5C5JA 3C21A 4NY8A 1JUDA 4CF5A 1ED1A 5ALSA 1UCVA 4ECTA 4O3PA 5AM2A 5J2EA 4ECXA 4KTQA 5AK3A 4C4SA 2BZFA 3NS1A 3DV9A 2JRZA 4TUSA 1T8EA 3UMBA 4R66A 9ICIA 2JZBA 4EX6A 1PVPA 4IS7A 4BWMA 4I2HA 3BZCA 7ICTA 4X5VA 9ICUA 2OEHA 1UHUA 1L7NA 3PSIA 4GC6A 1NKEA 1SL2A 4TQSA 3Q8SB 4NLNA 2B0CA 5AI5A 2VJ5A 1RDFA 3ONNA 4DO9A 3QU7A 2E1EA 3B9JA 4DOCA 2W9BB 8ICUA 3JPNA 4JB3A 5ALXA 5EE1A 4M9NA 4QIWF 1ZQTA 2LYBA 2IHMA 2GOLA 3ED5A 3AQEA 5IIKA 4JWNA 2MRLA 3N7RC 2K60A 4ED7A 2ZUCA 4PL1A 4F2SA 5KAFU 4J9PA 2LYAA 2KP7A 3Q8RB 3RTVA 1S0VA 5CP2A 3L5KA 4Y2PA 3PMLA 1ZQPA 3H8SA 5AM4A 2IOFA 4DSKA 8ICFA 2JEIA 4MF8A 4KN4A 4O3SA 5KG0A 5D49A 3NVYA 1YT3A 2W7PA 2KICA 1U45A 3MC1A 3ZDDA 4KX3A 2BQUA 3QUBA 5KFCA 1NK5A 3GQCA 3LVWA 2HVHA 2EZYA 3TAQA 2KK0A 1K1SA 2KHQA 1X9SA 1JX4A 4RT2A 2H3QA 5DG9A 2KSOB 1KBUA 4DL7A 3HKZC 3WKAA 2VA3A 1V38A 2PFPA 4Y2XA 8ICZA 4O3QA 2WAQC 4M04A 4P4PA 4G9BA 2ZTCA 1VLBA 3LVVA 4M9GA 2PFNA 1KW4A 3ISDA 3MGIA 4F8RA 4QZCA 3OHBA 4IR1A 1S8OA 2OCEA 3O0FA 3TI0A 1RYRA 2ZIVA 4J9RA 3EYZA 2AU0A 1MQ3A 2D8CA 4EZ6A 2PI5A 2LMRA 3AL0B 3G6XA 4GLXA 2K8AA 2ZJ8A 3LK9A 3PX4A 1ZD3A 2F76X 4Y2YA 1ECWA 7ICQA 5AK5A 3QYPA 2ZUDA 4K4IA 2GO7A 1V85A 2E8MA 4KLOA 4EYHB 4P0PA 4M9JA 2PMZF 1IIPA 4J9KA 1ZQDA 5AK6A 2EQYA 3GV8B 1T7PA 8ICRA 5ALTA 4DQIA 8ICOA 1D9FA 2K4HA 4QZGA 2NRTA 3DDHA 1GO3F 4NL9C 3RB0A 4OJPA 1P7DA 2AJQA 2MAXA 2K4EA 4DL3A 5ALHA 1TKDA 3PY8A 5HMLA 3N28A 3MGHA 5G5GA 3V6HA 1L6NA 2QLTA 4NM1A 3PO5A 4JV2A 7ICRA 2NRWA 5KG2A 1SZPA 2LM1A 1RQNA 2WF8A 1JN3A 4QZAA 2XC9A 2KJ9A 1XO0A 2DUYA 4DSIA 4F5RA 3PW2A 1Z4NA 3ALRA 1FIQA 3BZKA 1S76D 4F2RA 4Z6DA 3RJKA 3QU4A 4KLUA 2KOBA 1N62A 3EPGA 5AM1A 2KIVA 3I28A 2ZIWB 5KG3A 4RNOA 1U49A 5ALYA 1ZETA 1NKBA 2GWSA 4RT3A 3JPRA 1VJ5A 1QSYA 2YTUA 4F71A 2ESEA 4KLHA 8ICTA 5KFPA 4M0AA 4C8MA 3SMVA 4B9MA 4YQWA 4Q8EA 3RH5A 2XCAA 8ICJA 2EANA 5EE3A 5DB6A 5ALGA 4PGQA 4DL5A 3F2CA 4Y2UA 3AM9A 5DG7A 4ELVA 5J0QA 2YMMA 3DEEA 4RNNA 3KD3A 3KHGA 2HW3A 1TK0A 1KFTA 4DFJA 2OXOA 3M1YA 4US8A 4F92B 1TE2A 2DF4B 2NV3A 2NRXA 5BOMA 4LJXA 2FMSA 3OPXA 2E3TA 4QWCA 4PPXA 2JMGA 1U4BA 4JK1A 8ICQA 4O3RA 8ICGA 4ZOHC 1RXWA 1BPDA 1VDVA 1TAQA 4NL9A 2IOFK 3HPOA 1ZQNA 2Y1JA 3BS7A 7ICFA 1ZYQA 2W54A 1AROP 3L4PA 4R65A 2CRXA 4QZ9A 4JMUA 4C0ZA 4DFDA 4MF2A 5J0UA 4P0PB 4O9MA 9ICMA 2HBLA 1D8BA 3SAGA 3QU5A 2JHDA 1ZQIA 3ORYA 5DQIA 4IQWA 3K4GA 3SR6A 2QB0A 1QTMA 4B9LA 4IQTA 4DQQA 5KTQA 4FZLA 1DK2A 2Y1IA 1X6JA 1S0NA 2K4IA 3WKEA 4YD1A 3RJJA 4JUZA 5L1LA 3QX7A 2DGZA 3A0BU 2DL0A 4YMMA 3QEAZ 3M8RA 1KSPA 4O5CA 3MDCA 2EDUA 3TADC 4FBTA 2BCSA 5ALMA 3UQ2A 5IINA 2K8CB 1KRPA 4AP9A 4F4WA 1NJYA 1SWVA 2BHNA 3L3FX 1SXEA 8ICAA 3CW2C 2EAMA 7ICKA 1SGGA 4O5EA 2RDIA 2P6UA 3WK5A 2AQ4A 1LKYA 3GZFA 1TK5A 1N2XA 2DPJA 4PHAA 2W3RA 4XUSA 2F1HA 4I2GA 3F2BA 3WK9A 5ALFA 2FE9A 1K1QA 5ALPA 4QWAA 1ZQOA 3N4MB 2V4RA 1CUKA 3UMCA 5KFMA 5AK4A 3HX0A 2C28A 1OXJA 1N5XA 2H3IA 1PVQA 3TAPA 3IG5A 4JWMA 4FE3A 4U7CA 4NLZA 3IV6A 4QWEA 4I2CA 2A3VA 4DSEA 1Z1BA 2YQEA 2C2DA 4TQRA 3M8SA 3PSTA 3PSFA 2RHFA 4IRDA 3PR5B 1SZHA 7ICUA 1ZXIA 5G5HA 1X9XA 1RM6C 2Y0SC 5AIBA 4YR3A 4RPZA 4OO1J 2BCRA 5J2GA 3FM9A 3H7IA 4F4ZA 1NKCA 3V7LA 5KFTA 4YP3A 3S6JA 2OM6A 3HKZF 3SD7A 5HR7A 2V4QA 4Z6FA 4OJ6A 4RQ1A 4RUCA 4KLSA 5FP0A 2CXYA 1NJZA 4DCCA 3MGVA 2W9MA 3CNHA 4FO6A 2F44A 5J0XA 4F5PA 9ICFA 1ZQKA 2HSZA 4UAZA 5B66U 1ZQBA 1JI7A 3EPIA 2BDUA 3V6JA 5ALWA 8ICMA 4J9SA 4YR0A 1COKA 4C8NA 3QXGA 2ISPA 7ICVA 2R18A 2QB0B 1NK0A 2ALZA 4EZ9A 1Z4OA 3BQ0A 1S0OA 3OSPA 2W7OA 3RJGA 5KFRA 3KHHA 1MN8A 1L8LA 5IIMA 3TFSA 2H3VA 1LVHA 1SV0A 2MUTB 3E58A 2Q4TA 1WCLA 7ICNA 3PMNA 2Y0SF 3KHLA 5J2HA 2BPFA 1RG6A 5ALUA 1PZNA 1PVRA 3CP8A 1X6IA 4UARA 3GU3A 4O5KA 3Q8QB 7ICLA 2FMPA 1FEZA 5AHXA 5H2FU 5KFBA 3H0MB 2VIXA 1B22A 1OUQA 5KFAA 2FPKA 1C20A 4EELA 4IL6U 4PH5A 3TACB 4KMUA 1IXRA 2HHWA 2DFLA 5DKWA 5KG6A 2Z7JA 4DSFA 3ZD8A 4GC7A 4AYBC 1YZ7A 8ICWA 4USAA 4RQ7A 2AGOA 1Q3UA 3GDXA 2KJ5A 4QW9A 2I6XA 3ISCA 4F5NA 5IIOA 3JPPA 2HHSA 4Y2QA 5ALIA 1BNOA 5HHHA 4BDPA 1SIJA 4B6JA 4YR2A 1ZQJA 4UB2A 2KSOA 1JXLA 1RYUA 1N60A 5J8YC 4C4TA 1L5UA 3C28A 4CGZA 1U48A 4ED2A 2JXJA 3SENA 2ATLA 4YMOA 2HBJA 1Z00A 2G5IB 4K4GA 5D4BA 5CHGA 2W11A 4P4MA 1S9FA 1ZJMA 1SB3C 4DS4A 1TAUA 2I1QA 5CJ7A 4TURA 1QSSA 2BPGA 1HIWA 1ZQLA 3RRHA 5DLGA 4GXIA 4IRCA 2QB1A 4QZBA 3M7DA 4ED8A 1SV0C 5L9XA 1KEJA 2AXTU 3KZIU 3V6KA 1ZQZA 5J2DA 4DL2A 2UVRA 3C2LA 1ZQXA 3PV8A 5DBBA 1T3NA 5KFNA 2XO7A 3KZXA 4YCXA 2JEFA 5AM0A 8ICNA 5KAIU 2KFZA 7ICMA 1H38A 4I2AA 4BJQA 1MQ2A 5AKKA 4NJ8A 3C5GA 3SV4A 3AQFA 3B0XA 1XU4A 1T94A 1SWWA 3V7KA 1DXSA 3RR8A 5DGBA 2C2RA 4QZIA 2HOQA 2JGAA 3MABA 2J6UA 1DGJA 1SKSA 4ED1A 1Y88A 1MA7A 2FDRA 2F2AB 5KFGA 7ICGA 5A0LA 4YVZA 4M9HA 4ELUA 4GFJA 5JUMA 5ALEA 9ICRA 1KFSA 1L3TA 3GIIA 1KTQA 2ASJA 2J6TA 5IILA 4B9SA 3BQ1A 4I2JA 1ZQ1C 5DDYA 1IM4A 3OHAA 4DOAA 1U47A 5KG7A 2HVIA 4CNQA 3PZPA 4DSLA 5BPCA 3MR5A 3BJYA 4R63A 3JPTA 3LYSA 1SKRA 1Z19A 1QH9A 1S5LU 5F9LA 3C1YA 3OSNA 3GILA 3H4BA 4EBCA 2H3ZA 3TKAA 5ALOA 1NK8A 2KJ8A 3BQ7A 4I28A 4MFAA 3T79A 1LB2B 1ZQEA 2CN1A 2NO5A 4UAWA 1ZQQA 4JV1A 4NLBA 4M6WA 2FPLA 2NYVA 4ELTA 4YG2A 1ZJNA 2Y9TA 2HHUA 1D8LA 4RPXA 1WG8A 2F77X 1L7PA 3F5AA 2ZXIA 5KFUA 2HDOA 3H0LB 2KIWA 5ALVA 2XY5A 4HYKA 2BPCA 4F72A 2LBOA 5L1IA 3KKAC 1XSLA 1X40A 5GTIU 2O6KA 5J0YA 4UBCA 1LKYB 3E0FA 1NK4A 5CB1A 3UMGA 4C8KA 4EYIB 5AI9A 3QUQA 1JRPA 1N48A 2R8KA 2WF7A 5KFSA 1SV4A 2IBKA 2ASLA 2K8BB 3QUTA 4PZNA 4UAVA 3JPOA 2KVSA 2BCQA 1TV9A 1KKXA 1BVSA 2IMWP 4YXMA 2KMDA 1L7MA 5HMMA 3FC4A 1C7YA 2UVUA 2FPMA 5DBCA 5L1JA 1AQ6A 4RQ0A 1Z3EB 5J2JA 4K4HA 4F5OA 2Y9UA 3NVWA 5JTIA 8ICSA 5ALKA 2G5HB 2VA2A 4DFKA 2GLEA 1MSWD 2RDJA 1NOMA 4RQ4A 5DLFA 7ICPA 3NRWA 3K1ZA 2NRZA 5AKXA 1N56A 3KFUF 5CRXA 4GXKA 4UAYA 2HCFA 4J9OA 2DQNB 1NJXA 2ZUBA 4F5QA 3QU9A 5F3XB 2ES6A 4QW8A 3H4DA 1ZQFA 5L1KA 4P2HA 5AKHA 4NLKA 4EX7A 2LI6A 4B9UA 2WAQF 5KT7A 3VC8A 2XCPA 2L5YA 4I27A 8ICHA 5HR6A 1BGXT 1K5OA 3RB4A 1ZRNA 2WF6A 5J8YA 2HOFA 2W55A 2UVWA 4XA5A 1O03A 7ICHA 2K89A 5J0WA 3A0HU 2YB4A 1F0MA 2B21A 4I2BA 1COOA 4UB3A 4YXJA 2JV3A 8ICBA 3GIKA 2I5HA 4PHPA 5KFDA 4F91B 8ICCA 3RBEA 3TARA 4KLGA 5KFWA 1TK8A 4LZDA 2R8GA 1WCNA 3UXNA 1J2MA 3UXPA 2W04A 2ZIXA 1T3QA 3NVVA 4RQ8A 4RPYA 1CEZA 1A6SA 3M9MB 2KFNA 7ICSA 5ALJA 3OJUA 4OD0A 2FI1A 5KFOA 1UQVA 3H0RB 1X66A 4Y2VA 2JR5A 3FAHA 4C8OA 1TFRA 3D2QA 4EEYA 4KLTA 1KQQA 4BX9C 4OJLA 2AGPA 3QE9Y 1XWLA 5EE0A 3T5LA 2OH2A 9ICAA 5KT2A 5J0OA 1ZQYA 4ACOA 3HILA 3MFHA 3AU2A 2KV2A 1U9LA 9ICOA 1JXEA 1N63A 2M9NA 4DWIA 4ECRA 9ICCA 4LVSA 5ALNA 2VANA 3H8MA 4C8LA 2I9GA 4Q44A 3AU6A 1S0MA 1YZ6A 3D2NA 1F5SA 3RRGA 4M6WB 3T5KA 5K4LA 4KMOB 4OCZA 1XO1A 5F9NA 2A19A 1PK1B 9ICNA 4Z6CA 2HBKA 4CF4A 1NZPA 4EEKA 1FFVA 4I2DA 4IC9A 5KFZA 3WU2U 8ICVA 3IHQB 2KNJA 3QU2A 1WYGA 5E79U 4QZHA 4FZNA 4UB8U 4DOBA 1DGSA 1JALA 5AKYA 1D8YA 5CWRA 2DWQA 4DLGA 2ZIWA 4ECSA 2MSNA 2FLNA 8ICPA 1QQ6A 5HNKA 3QZ7A 3KBBA 1CRXA 4J9QA 2P35A 5KT6A 1KDHA 2BDPA 4NWIA 7ICOA 2K4PA 3RJFA 3AN1A 2BQRA 2EAPA 2G0AA 4CCHA 1XS9D 1QCKA 2YX8A 3QEBZ 3SAFA 4UAUA 3N7PD 5DQHA 9ICXA 4UQGA 1BPXA 3THVA 4WJ3B 2YY6A 5KFEA 5AICA 4F93B 3ISBA 4A8EA 1PK1A 1KL9A 3RJIA 4C80A 2WFAA 1J2NA 3WK8A 5ALLA 3QUCA 1KFDA 4QZEA 2AH5A 2R8JA 4UW9A 2LPEA 2CPRA 4I29A 4PL2A 4PJ0U 4MFFA 2JH7A 3RF9A 2ZIUB 3MFIA 3IP4B 1BPBA 2ZJAA 4Y2SA 5CR0A 3RH6A 3WK4A 4E0DA 2PKEA 4RQNA 3WK6A 4R8UB 1BPZA 3RJHA 4NLGA 3PW7A 3NASA 2VJ4A 4YD2A 2KE7A 1B43A 5HP4A 1JROA 3EUB2 1N61A 3HT3A 8ICKA 3SI8A 1QQ5A 5EWGA 4KLMA 2ASDA 4G3IA 4ECUA 4Y2RA 4C7YA 1A76A 2XIDA 5J2FA 4Z6EA 4DS5A 3ZD9A 2VA8A 1MC8A 2XY6A 2ZG6A 3C2MA 4KX5A 5AI4A 1PK3A 1WUDA 4YMNA 2Q0ZX 3SV3A 2NRVA 4F4XA 2D3DA 3ETRA 3Q8MA 2OWOA 4DF4A 5J0SA 2KKVA 1ZQWA 3UM9A 5KT5A 3PW5A 2ZIXB 3OTQA 4QJFB 4ED3A 2ZIVB 5DB7A 2HBMA 1NZBA 5JU5A 4DFMA 2YB1A 4AYBF 5CA7A 2RRDA 3NUQA 1L3SA 5KG4A 2W9CA 4Q45A 7ICJA 1QQ7A 5J29A 3ZDAA 4KLJA 3NVZA 2KHVA 5T14A 3G6YA 3RB3A 1O08A 3AUOA 2JEGA 4R8UA 4HAIA 4UBBA 5AI6A 2C2EA 3IG8A 5KL8B 3SQIA 8ICYA 3T5JA 1JIHA 1KN5A 4NXZA 5J0RA 3JPSA 5KFQA 5GTHU 2A1JB 2G08A 5DGAA 3I76A 2PXIA 4I2EA 4BXOB 3C23A 5J2AA 4UATA 4LZGA 1L7OA 4KLFA 3WKCA 4Y2JA 2LM4A 4GIBA 3SEIA 4I2FA 1J97A 1SL0A 3T5HA 2B6GA 4MEYA 3D2SA 5JRTA 5EE9A 5BOLA 3U26A 2EH9A 2YMLA 4NV0A 5TZVA 5DB9A 2R8IA 3BS5B 3H8WA 3B0YA 4QZ8A 1KLNA 3LDAA 4KLEA 3PO4A 4TUQA 1X42A 1OW5A 4MEXA 4RU9A 3TANA 3E2EA 2NO4A 1ZD4A 4EBEA 2AHOB 5J0TA 4O3OA 2JH1A 5CEHA 2DPIA 4KN7A 2MU2A 2F8LA 1Z1VA 3BS5A 3OGUA 1NK6A 2D6FC 1RXVA 4NLCA 2WHEA 5J0PA 9ICKA 5AI0A 4DLEA 3FDSA 3AEVA 4YFKA 3VCBA 1NJWA 9ICSA 5L1MA 5AKZA 5KFIA 3RAXA 3RAQA 3GV7B 5HHIA 1SKWA 3MR3A 5IIJA 5DG8A 3C2KA 2VKQA 3K75D 4FBUA 4KLQA 4ECQA 1LV5A 1N5WA 3RH4A 2W43A 3PW0A 4M2YA 4IR9A 9ICTA 1BNPA 1SXDA 4Y2TA 3HP6A 2XGPA 4IRKA 5J2BA 3GIJA 4FFDA 2ZJ5A 2P66A 3KTQA 2QKQA 2A1AA 5J2CA 4UB5A 2BCUA 5KFKA 3PR4A 4XRHA 2BQ3A 4DQRA 2RQ5A 5AI8A 2C22A 1RPLA 1QLNA 1DOQA 4DF8A 3BQTA 1JMSA 2WF5A 3SZ2A 3TADA 5KNIA 2ODGA 1BPEA 2XI9A 4DQPA 2W9BA 2H3FA 3QNMA 4RQMA 2HHXA 2YMPA 3WK7A 1A0PA 1V97A 1ZD2P 4KITB 2YN4A 2F3NA 3AMZA 1IG6A 3RJEA 8ICLA 2ISOA 2KG5A 2W8KA 4FZMA 4ZH4A 8ICIA 2DKZA 3IM1A 1URJA 2FLPA 2FMQA 4QWDA 2GH1A 4P4OA 3MR2A 1V9PA 2ZIUA 2HI0A 3T3FA 4DL4A 2G09A 1Q3VA 5ALRA 4PHEA 3KOOA 1WWUA 1ZOLA 4TUPA 1XC9A 5KFFA 3J81j 1WWVA 1X9MA 1X9WA 1QSLA 9ICWA 4BXOA 1UPHA 4QIWC 3HWTA 3GFKB 3NTUA 4DQSA 3ETLA 2A1JA 7ICEA 1L8OA 3N97B 3N7SC 2FJ6A 4CF3A 4QZFA 4RQ3A 2HHQA 5DBAA 4P0QA 1FO4A 5EWFA 2LKYA 4FS1A 2WF9A 1HEKA 1ZD5A 4BUGA 1M6YA 3EWAA 1PUZA 1FFUA 4IQVA 5B5EU 2BCVA 3PW4A 4YN4A 3ICXA 3MDAA 2OYYA 3RBDA 2LYHA 4UB1A 1ZQUA 5KFYA 1L3VA 4RQ2A 7ICIA 4OJOA 3UQ0A 1NK7A 2EZZA 3IDWA 4J03A 3RFAA 2KVCA 3OJSA 1UT5A 3EZ5A 1DRGA 2HOIA 4NM2A 1Q8KA 4RQ5A 2N1RA 4PHDA 1RZTA 1S97A 2PFQA 2G07A 4F3OA 5AKGA 4MFCA 2J6SA 3LWLA 4PGXA 1ZQHA 3KKAA 4OJ5A 3K1RB 5TISU 3SAHA 3HW8A 2JEJA 4F50A 4EENA 8ICXA 3R9KA 1UA1A 2E8PA 4BGDA 4CRXA 4M9LA 9ICPA 3D6JA 3C5FA 4Q43A 5KFXA 5KT4A 4B9NA 1ZQVA 2W8LA 2E1FA 4P0QB 3RR7A 3M9NB 1XSPA 5EOZA 5EWEA 4M47A 4B9VA 2MUTA 4US9A 3I1YA 2KN7A 3IRUA 5DB8A 1B4FA 4QWBA 5ALZA 5D46A 2IA6A 4J9MA 5ALQA 5J2IA 2DKXA 2XVTA 1NI3A 1D9DA 1NNLA 2QARA 2ZXHA 1HUOA 3TQ1A 3Q8KA 2ZTEA 2E8OA 1Z00B 4PZOA 1S77D 5KL1B 3CYMA 3LWMA 2KZMA
chains in the Genus database with same CATH topology
2EH9A 4LJXA 2JXJA 1KKXA 2CXYA 1RYUA 2KK0A 2EQYA 2LM1A 5CEHA 5K4LA 2OEHA 1KN5A 2LI6A 2JRZA 1C20A 2RQ5A 1KQQA 1IG6A 2YQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EH9 A;  4LJX A;  2JXJ A;  1KKX A;  2CXY A;  1RYU A;  2KK0 A;  2EQY A;  2LM1 A;  5CEH A;  5K4L A;  2OEH A;  1KN5 A;  2LI6 A;  2JRZ A;  1C20 A;  2RQ5 A;  1KQQ A;  1IG6 A;  2YQE A; 
#chains in the Genus database with same CATH topology
 4EBD A;  5KT3 A;  5AIA A;  1ZQG A;  3HJE A;  4C7Z A;  2EZX A;  3PX6 A;  3TFR A;  1ZRM A;  4R64 A;  2DBY A;  2M0N A;  2AGQ A;  4DEZ A;  4FS2 A;  1HJP A;  5AKJ A;  2PI4 A;  4ED6 A;  5AKE A;  4ECZ A;  2KZZ A;  9ICE A;  4ICA A;  1UT8 A;  3FYH A;  3ZDE A;  1BPY A;  4RUA A;  4I2I A;  3NRZ A;  1UA0 A;  1A77 A;  1F44 A;  2PMZ C;  3H8J A;  5KFJ A;  1CI4 A;  2RLT A;  4ECW A;  4DFP A;  4QNL A;  1ZQS A;  1XSN A;  4UAS A;  3WKD A;  3M6Z A;  2YMQ A;  3C29 A;  2WB1 F;  1HUZ A;  4KLL A;  4CDG A;  5AM3 A;  2E8N A;  4MHV A;  5J2K A;  4BWJ A;  2UVV A;  9ICQ A;  4GXJ A;  2IHN A;  4F4Y A;  2JZB B;  3Q8P B;  3F5E A;  1RYS A;  2R8H A;  2W3S A;  1ZQA A;  2F1J A;  5KFV A;  2G06 A;  4ECV A;  4RQ6 A;  5KFH A;  5III A;  1T4G A;  1B0X A;  1ZQM A;  1TVA A;  2LHT A;  2BKE A;  5AM5 A;  4UB6 U;  3JPQ A;  3GV5 B;  2P6R A;  3G6V A;  3V7J A;  5DQG A;  8ICE A;  1TAM A;  1ZQR A;  5ALD A;  3ZI4 A;  3UPQ A;  5C0Y A;  4C4R A;  4O0I A;  3MR6 A;  3RB6 A;  2HHT A;  5AKL A;  3CRX A;  2W9C B;  3M6K A;  2FLL A;  1DK3 A;  2HHV A;  3MBY A;  4CE6 A;  2ZTD A;  4DL6 A;  2BR0 A;  2EAO A;  2RP5 A;  1L3U A;  9ICJ A;  5AKI A;  9ICG A;  4J9L A;  2BGW A;  2PFO A;  3PNC A;  9ICB A;  3EW9 A;  4JV0 A;  2XY7 A;  5KG5 A;  9ICV A;  3C1Z A;  3WKB A;  3QZ8 A;  9ICL A;  3IN5 A;  3KHR A;  1SL1 A;  1NK9 A;  2XIC A;  4RNM A;  4B9T A;  3M9O B;  1Q46 A;  1ZQC A;  4DSJ A;  1X2I A;  3PSP A;  2WTF A;  4IQU A;  3GIM A;  4XQ8 A;  5DDM A;  2AQ0 A;  4UB4 A;  4F4K A;  3NGD A;  1S10 A;  3F53 A;  1XNS A;  3ZDB A;  3Q8L A;  2XGQ A;  2V9W A;  2KTQ A;  2IOH A;  2OHF A;  5KFL A;  5KG1 A;  2MA1 A;  4O3N A;  3PX0 A;  4PGY A;  4KLD A;  3V72 A;  2W9A A;  2F8K A;  4ED0 A;  4RZR A;  3SYZ A;  2H5X A;  2KKP A;  2QAR B;  4O3M A;  2KD1 A;  4Q8F A;  3BDP A;  1EXN A;  2W03 A;  4J9N A;  2KZ3 A;  9ICH A;  3H40 A;  3F2D A;  3ZDC A;  2F1I A;  1RQL A;  2WB1 C;  4U6P A;  3PVX A;  4ECY A;  3UXO A;  4QZD A;  1IV8 A;  2HMX A;  3HRD D;  4KLI A;  3BQ2 A;  2E5S A;  2KEY A;  5C5J A;  3C21 A;  4NY8 A;  1JUD A;  4CF5 A;  1ED1 A;  5ALS A;  1UCV A;  4ECT A;  4O3P A;  5AM2 A;  5J2E A;  4ECX A;  4KTQ A;  5AK3 A;  4C4S A;  2BZF A;  3NS1 A;  3DV9 A;  2JRZ A;  4TUS A;  1T8E A;  3UMB A;  4R66 A;  9ICI A;  2JZB A;  4EX6 A;  1PVP A;  4IS7 A;  4BWM A;  4I2H A;  3BZC A;  7ICT A;  4X5V A;  9ICU A;  2OEH A;  1UHU A;  1L7N A;  3PSI A;  4GC6 A;  1NKE A;  1SL2 A;  4TQS A;  3Q8S B;  4NLN A;  2B0C A;  5AI5 A;  2VJ5 A;  1RDF A;  3ONN A;  4DO9 A;  3QU7 A;  2E1E A;  3B9J A;  4DOC A;  2W9B B;  8ICU A;  3JPN A;  4JB3 A;  5ALX A;  5EE1 A;  4M9N A;  4QIW F;  1ZQT A;  2LYB A;  2IHM A;  2GOL A;  3ED5 A;  3AQE A;  5IIK A;  4JWN A;  2MRL A;  3N7R C;  2K60 A;  4ED7 A;  2ZUC A;  4PL1 A;  4F2S A;  5KAF U;  4J9P A;  2LYA A;  2KP7 A;  3Q8R B;  3RTV A;  1S0V A;  5CP2 A;  3L5K A;  4Y2P A;  3PML A;  1ZQP A;  3H8S A;  5AM4 A;  2IOF A;  4DSK A;  8ICF A;  2JEI A;  4MF8 A;  4KN4 A;  4O3S A;  5KG0 A;  5D49 A;  3NVY A;  1YT3 A;  2W7P A;  2KIC A;  1U45 A;  3MC1 A;  3ZDD A;  4KX3 A;  2BQU A;  3QUB A;  5KFC A;  1NK5 A;  3GQC A;  3LVW A;  2HVH A;  2EZY A;  3TAQ A;  2KK0 A;  1K1S A;  2KHQ A;  1X9S A;  1JX4 A;  4RT2 A;  2H3Q A;  5DG9 A;  2KSO B;  1KBU A;  4DL7 A;  3HKZ C;  3WKA A;  2VA3 A;  1V38 A;  2PFP A;  4Y2X A;  8ICZ A;  4O3Q A;  2WAQ C;  4M04 A;  4P4P A;  4G9B A;  2ZTC A;  1VLB A;  3LVV A;  4M9G A;  2PFN A;  1KW4 A;  3ISD A;  3MGI A;  4F8R A;  4QZC A;  3OHB A;  4IR1 A;  1S8O A;  2OCE A;  3O0F A;  3TI0 A;  1RYR A;  2ZIV A;  4J9R A;  3EYZ A;  2AU0 A;  1MQ3 A;  2D8C A;  4EZ6 A;  2PI5 A;  2LMR A;  3AL0 B;  3G6X A;  4GLX A;  2K8A A;  2ZJ8 A;  3LK9 A;  3PX4 A;  1ZD3 A;  2F76 X;  4Y2Y A;  1ECW A;  7ICQ A;  5AK5 A;  3QYP A;  2ZUD A;  4K4I A;  2GO7 A;  1V85 A;  2E8M A;  4KLO A;  4EYH B;  4P0P A;  4M9J A;  2PMZ F;  1IIP A;  4J9K A;  1ZQD A;  5AK6 A;  2EQY A;  3GV8 B;  1T7P A;  8ICR A;  5ALT A;  4DQI A;  8ICO A;  1D9F A;  2K4H A;  4QZG A;  2NRT A;  3DDH A;  1GO3 F;  4NL9 C;  3RB0 A;  4OJP A;  1P7D A;  2AJQ A;  2MAX A;  2K4E A;  4DL3 A;  5ALH A;  1TKD A;  3PY8 A;  5HML A;  3N28 A;  3MGH A;  5G5G A;  3V6H A;  1L6N A;  2QLT A;  4NM1 A;  3PO5 A;  4JV2 A;  7ICR A;  2NRW A;  5KG2 A;  1SZP A;  2LM1 A;  1RQN A;  2WF8 A;  1JN3 A;  4QZA A;  2XC9 A;  2KJ9 A;  1XO0 A;  2DUY A;  4DSI A;  4F5R A;  3PW2 A;  1Z4N A;  3ALR A;  1FIQ A;  3BZK A;  1S76 D;  4F2R A;  4Z6D A;  3RJK A;  3QU4 A;  4KLU A;  2KOB A;  1N62 A;  3EPG A;  5AM1 A;  2KIV A;  3I28 A;  2ZIW B;  5KG3 A;  4RNO A;  1U49 A;  5ALY A;  1ZET A;  1NKB A;  2GWS A;  4RT3 A;  3JPR A;  1VJ5 A;  1QSY A;  2YTU A;  4F71 A;  2ESE A;  4KLH A;  8ICT A;  5KFP A;  4M0A A;  4C8M A;  3SMV A;  4B9M A;  4YQW A;  4Q8E A;  3RH5 A;  2XCA A;  8ICJ A;  2EAN A;  5EE3 A;  5DB6 A;  5ALG A;  4PGQ A;  4DL5 A;  3F2C A;  4Y2U A;  3AM9 A;  5DG7 A;  4ELV A;  5J0Q A;  2YMM A;  3DEE A;  4RNN A;  3KD3 A;  3KHG A;  2HW3 A;  1TK0 A;  1KFT A;  4DFJ A;  2OXO A;  3M1Y A;  4US8 A;  4F92 B;  1TE2 A;  2DF4 B;  2NV3 A;  2NRX A;  5BOM A;  4LJX A;  2FMS A;  3OPX A;  2E3T A;  4QWC A;  4PPX A;  2JMG A;  1U4B A;  4JK1 A;  8ICQ A;  4O3R A;  8ICG A;  4ZOH C;  1RXW A;  1BPD A;  1VDV A;  1TAQ A;  4NL9 A;  2IOF K;  3HPO A;  1ZQN A;  2Y1J A;  3BS7 A;  7ICF A;  1ZYQ A;  2W54 A;  1ARO P;  3L4P A;  4R65 A;  2CRX A;  4QZ9 A;  4JMU A;  4C0Z A;  4DFD A;  4MF2 A;  5J0U A;  4P0P B;  4O9M A;  9ICM A;  2HBL A;  1D8B A;  3SAG A;  3QU5 A;  2JHD A;  1ZQI A;  3ORY A;  5DQI A;  4IQW A;  3K4G A;  3SR6 A;  2QB0 A;  1QTM A;  4B9L A;  4IQT A;  4DQQ A;  5KTQ A;  4FZL A;  1DK2 A;  2Y1I A;  1X6J A;  1S0N A;  2K4I A;  3WKE A;  4YD1 A;  3RJJ A;  4JUZ A;  5L1L A;  3QX7 A;  2DGZ A;  3A0B U;  2DL0 A;  4YMM A;  3QEA Z;  3M8R A;  1KSP A;  4O5C A;  3MDC A;  2EDU A;  3TAD C;  4FBT A;  2BCS A;  5ALM A;  3UQ2 A;  5IIN A;  2K8C B;  1KRP A;  4AP9 A;  4F4W A;  1NJY A;  1SWV A;  2BHN A;  3L3F X;  1SXE A;  8ICA A;  3CW2 C;  2EAM A;  7ICK A;  1SGG A;  4O5E A;  2RDI A;  2P6U A;  3WK5 A;  2AQ4 A;  1LKY A;  3GZF A;  1TK5 A;  1N2X A;  2DPJ A;  4PHA A;  2W3R A;  4XUS A;  2F1H A;  4I2G A;  3F2B A;  3WK9 A;  5ALF A;  2FE9 A;  1K1Q A;  5ALP A;  4QWA A;  1ZQO A;  3N4M B;  2V4R A;  1CUK A;  3UMC A;  5KFM A;  5AK4 A;  3HX0 A;  2C28 A;  1OXJ A;  1N5X A;  2H3I A;  1PVQ A;  3TAP A;  3IG5 A;  4JWM A;  4FE3 A;  4U7C A;  4NLZ A;  3IV6 A;  4QWE A;  4I2C A;  2A3V A;  4DSE A;  1Z1B A;  2YQE A;  2C2D A;  4TQR A;  3M8S A;  3PST A;  3PSF A;  2RHF A;  4IRD A;  3PR5 B;  1SZH A;  7ICU A;  1ZXI A;  5G5H A;  1X9X A;  1RM6 C;  2Y0S C;  5AIB A;  4YR3 A;  4RPZ A;  4OO1 J;  2BCR A;  5J2G A;  3FM9 A;  3H7I A;  4F4Z A;  1NKC A;  3V7L A;  5KFT A;  4YP3 A;  3S6J A;  2OM6 A;  3HKZ F;  3SD7 A;  5HR7 A;  2V4Q A;  4Z6F A;  4OJ6 A;  4RQ1 A;  4RUC A;  4KLS A;  5FP0 A;  2CXY A;  1NJZ A;  4DCC A;  3MGV A;  2W9M A;  3CNH A;  4FO6 A;  2F44 A;  5J0X A;  4F5P A;  9ICF A;  1ZQK A;  2HSZ A;  4UAZ A;  5B66 U;  1ZQB A;  1JI7 A;  3EPI A;  2BDU A;  3V6J A;  5ALW A;  8ICM A;  4J9S A;  4YR0 A;  1COK A;  4C8N A;  3QXG A;  2ISP A;  7ICV A;  2R18 A;  2QB0 B;  1NK0 A;  2ALZ A;  4EZ9 A;  1Z4O A;  3BQ0 A;  1S0O A;  3OSP A;  2W7O A;  3RJG A;  5KFR A;  3KHH A;  1MN8 A;  1L8L A;  5IIM A;  3TFS A;  2H3V A;  1LVH A;  1SV0 A;  2MUT B;  3E58 A;  2Q4T A;  1WCL A;  7ICN A;  3PMN A;  2Y0S F;  3KHL A;  5J2H A;  2BPF A;  1RG6 A;  5ALU A;  1PZN A;  1PVR A;  3CP8 A;  1X6I A;  4UAR A;  3GU3 A;  4O5K A;  3Q8Q B;  7ICL A;  2FMP A;  1FEZ A;  5AHX A;  5H2F U;  5KFB A;  3H0M B;  2VIX A;  1B22 A;  1OUQ A;  5KFA A;  2FPK A;  1C20 A;  4EEL A;  4IL6 U;  4PH5 A;  3TAC B;  4KMU A;  1IXR A;  2HHW A;  2DFL A;  5DKW A;  5KG6 A;  2Z7J A;  4DSF A;  3ZD8 A;  4GC7 A;  4AYB C;  1YZ7 A;  8ICW A;  4USA A;  4RQ7 A;  2AGO A;  1Q3U A;  3GDX A;  2KJ5 A;  4QW9 A;  2I6X A;  3ISC A;  4F5N A;  5IIO A;  3JPP A;  2HHS A;  4Y2Q A;  5ALI A;  1BNO A;  5HHH A;  4BDP A;  1SIJ A;  4B6J A;  4YR2 A;  1ZQJ A;  4UB2 A;  2KSO A;  1JXL A;  1RYU A;  1N60 A;  5J8Y C;  4C4T A;  1L5U A;  3C28 A;  4CGZ A;  1U48 A;  4ED2 A;  2JXJ A;  3SEN A;  2ATL A;  4YMO A;  2HBJ A;  1Z00 A;  2G5I B;  4K4G A;  5D4B A;  5CHG A;  2W11 A;  4P4M A;  1S9F A;  1ZJM A;  1SB3 C;  4DS4 A;  1TAU A;  2I1Q A;  5CJ7 A;  4TUR A;  1QSS A;  2BPG A;  1HIW A;  1ZQL A;  3RRH A;  5DLG A;  4GXI A;  4IRC A;  2QB1 A;  4QZB A;  3M7D A;  4ED8 A;  1SV0 C;  5L9X A;  1KEJ A;  2AXT U;  3KZI U;  3V6K A;  1ZQZ A;  5J2D A;  4DL2 A;  2UVR A;  3C2L A;  1ZQX A;  3PV8 A;  5DBB A;  1T3N A;  5KFN A;  2XO7 A;  3KZX A;  4YCX A;  2JEF A;  5AM0 A;  8ICN A;  5KAI U;  2KFZ A;  7ICM A;  1H38 A;  4I2A A;  4BJQ A;  1MQ2 A;  5AKK A;  4NJ8 A;  3C5G A;  3SV4 A;  3AQF A;  3B0X A;  1XU4 A;  1T94 A;  1SWW A;  3V7K A;  1DXS A;  3RR8 A;  5DGB A;  2C2R A;  4QZI A;  2HOQ A;  2JGA A;  3MAB A;  2J6U A;  1DGJ A;  1SKS A;  4ED1 A;  1Y88 A;  1MA7 A;  2FDR A;  2F2A B;  5KFG A;  7ICG A;  5A0L A;  4YVZ A;  4M9H A;  4ELU A;  4GFJ A;  5JUM A;  5ALE A;  9ICR A;  1KFS A;  1L3T A;  3GII A;  1KTQ A;  2ASJ A;  2J6T A;  5IIL A;  4B9S A;  3BQ1 A;  4I2J A;  1ZQ1 C;  5DDY A;  1IM4 A;  3OHA A;  4DOA A;  1U47 A;  5KG7 A;  2HVI A;  4CNQ A;  3PZP A;  4DSL A;  5BPC A;  3MR5 A;  3BJY A;  4R63 A;  3JPT A;  3LYS A;  1SKR A;  1Z19 A;  1QH9 A;  1S5L U;  5F9L A;  3C1Y A;  3OSN A;  3GIL A;  3H4B A;  4EBC A;  2H3Z A;  3TKA A;  5ALO A;  1NK8 A;  2KJ8 A;  3BQ7 A;  4I28 A;  4MFA A;  3T79 A;  1LB2 B;  1ZQE A;  2CN1 A;  2NO5 A;  4UAW A;  1ZQQ A;  4JV1 A;  4NLB A;  4M6W A;  2FPL A;  2NYV A;  4ELT A;  4YG2 A;  1ZJN A;  2Y9T A;  2HHU A;  1D8L A;  4RPX A;  1WG8 A;  2F77 X;  1L7P A;  3F5A A;  2ZXI A;  5KFU A;  2HDO A;  3H0L B;  2KIW A;  5ALV A;  2XY5 A;  4HYK A;  2BPC A;  4F72 A;  2LBO A;  5L1I A;  3KKA C;  1XSL A;  1X40 A;  5GTI U;  2O6K A;  5J0Y A;  4UBC A;  1LKY B;  3E0F A;  1NK4 A;  5CB1 A;  3UMG A;  4C8K A;  4EYI B;  5AI9 A;  3QUQ A;  1JRP A;  1N48 A;  2R8K A;  2WF7 A;  5KFS A;  1SV4 A;  2IBK A;  2ASL A;  2K8B B;  3QUT A;  4PZN A;  4UAV A;  3JPO A;  2KVS A;  2BCQ A;  1TV9 A;  1KKX A;  1BVS A;  2IMW P;  4YXM A;  2KMD A;  1L7M A;  5HMM A;  3FC4 A;  1C7Y A;  2UVU A;  2FPM A;  5DBC A;  5L1J A;  1AQ6 A;  4RQ0 A;  1Z3E B;  5J2J A;  4K4H A;  4F5O A;  2Y9U A;  3NVW A;  5JTI A;  8ICS A;  5ALK A;  2G5H B;  2VA2 A;  4DFK A;  2GLE A;  1MSW D;  2RDJ A;  1NOM A;  4RQ4 A;  5DLF A;  7ICP A;  3NRW A;  3K1Z A;  2NRZ A;  5AKX A;  1N56 A;  3KFU F;  5CRX A;  4GXK A;  4UAY A;  2HCF A;  4J9O A;  2DQN B;  1NJX A;  2ZUB A;  4F5Q A;  3QU9 A;  5F3X B;  2ES6 A;  4QW8 A;  3H4D A;  1ZQF A;  5L1K A;  4P2H A;  5AKH A;  4NLK A;  4EX7 A;  2LI6 A;  4B9U A;  2WAQ F;  5KT7 A;  3VC8 A;  2XCP A;  2L5Y A;  4I27 A;  8ICH A;  5HR6 A;  1BGX T;  1K5O A;  3RB4 A;  1ZRN A;  2WF6 A;  5J8Y A;  2HOF A;  2W55 A;  2UVW A;  4XA5 A;  1O03 A;  7ICH A;  2K89 A;  5J0W A;  3A0H U;  2YB4 A;  1F0M A;  2B21 A;  4I2B A;  1COO A;  4UB3 A;  4YXJ A;  2JV3 A;  8ICB A;  3GIK A;  2I5H A;  4PHP A;  5KFD A;  4F91 B;  8ICC A;  3RBE A;  3TAR A;  4KLG A;  5KFW A;  1TK8 A;  4LZD A;  2R8G A;  1WCN A;  3UXN A;  1J2M A;  3UXP A;  2W04 A;  2ZIX A;  1T3Q A;  3NVV A;  4RQ8 A;  4RPY A;  1CEZ A;  1A6S A;  3M9M B;  2KFN A;  7ICS A;  5ALJ A;  3OJU A;  4OD0 A;  2FI1 A;  5KFO A;  1UQV A;  3H0R B;  1X66 A;  4Y2V A;  2JR5 A;  3FAH A;  4C8O A;  1TFR A;  3D2Q A;  4EEY A;  4KLT A;  1KQQ A;  4BX9 C;  4OJL A;  2AGP A;  3QE9 Y;  1XWL A;  5EE0 A;  3T5L A;  2OH2 A;  9ICA A;  5KT2 A;  5J0O A;  1ZQY A;  4ACO A;  3HIL A;  3MFH A;  3AU2 A;  2KV2 A;  1U9L A;  9ICO A;  1JXE A;  1N63 A;  2M9N A;  4DWI A;  4ECR A;  9ICC A;  4LVS A;  5ALN A;  2VAN A;  3H8M A;  4C8L A;  2I9G A;  4Q44 A;  3AU6 A;  1S0M A;  1YZ6 A;  3D2N A;  1F5S A;  3RRG A;  4M6W B;  3T5K A;  5K4L A;  4KMO B;  4OCZ A;  1XO1 A;  5F9N A;  2A19 A;  1PK1 B;  9ICN A;  4Z6C A;  2HBK A;  4CF4 A;  1NZP A;  4EEK A;  1FFV A;  4I2D A;  4IC9 A;  5KFZ A;  3WU2 U;  8ICV A;  3IHQ B;  2KNJ A;  3QU2 A;  1WYG A;  5E79 U;  4QZH A;  4FZN A;  4UB8 U;  4DOB A;  1DGS A;  1JAL A;  5AKY A;  1D8Y A;  5CWR A;  2DWQ A;  4DLG A;  2ZIW A;  4ECS A;  2MSN A;  2FLN A;  8ICP A;  1QQ6 A;  5HNK A;  3QZ7 A;  3KBB A;  1CRX A;  4J9Q A;  2P35 A;  5KT6 A;  1KDH A;  2BDP A;  4NWI A;  7ICO A;  2K4P A;  3RJF A;  3AN1 A;  2BQR A;  2EAP A;  2G0A A;  4CCH A;  1XS9 D;  1QCK A;  2YX8 A;  3QEB Z;  3SAF A;  4UAU A;  3N7P D;  5DQH A;  9ICX A;  4UQG A;  1BPX A;  3THV A;  4WJ3 B;  2YY6 A;  5KFE A;  5AIC A;  4F93 B;  3ISB A;  4A8E A;  1PK1 A;  1KL9 A;  3RJI A;  4C80 A;  2WFA A;  1J2N A;  3WK8 A;  5ALL A;  3QUC A;  1KFD A;  4QZE A;  2AH5 A;  2R8J A;  4UW9 A;  2LPE A;  2CPR A;  4I29 A;  4PL2 A;  4PJ0 U;  4MFF A;  2JH7 A;  3RF9 A;  2ZIU B;  3MFI A;  3IP4 B;  1BPB A;  2ZJA A;  4Y2S A;  5CR0 A;  3RH6 A;  3WK4 A;  4E0D A;  2PKE A;  4RQN A;  3WK6 A;  4R8U B;  1BPZ A;  3RJH A;  4NLG A;  3PW7 A;  3NAS A;  2VJ4 A;  4YD2 A;  2KE7 A;  1B43 A;  5HP4 A;  1JRO A;  3EUB 2;  1N61 A;  3HT3 A;  8ICK A;  3SI8 A;  1QQ5 A;  5EWG A;  4KLM A;  2ASD A;  4G3I A;  4ECU A;  4Y2R A;  4C7Y A;  1A76 A;  2XID A;  5J2F A;  4Z6E A;  4DS5 A;  3ZD9 A;  2VA8 A;  1MC8 A;  2XY6 A;  2ZG6 A;  3C2M A;  4KX5 A;  5AI4 A;  1PK3 A;  1WUD A;  4YMN A;  2Q0Z X;  3SV3 A;  2NRV A;  4F4X A;  2D3D A;  3ETR A;  3Q8M A;  2OWO A;  4DF4 A;  5J0S A;  2KKV A;  1ZQW A;  3UM9 A;  5KT5 A;  3PW5 A;  2ZIX B;  3OTQ A;  4QJF B;  4ED3 A;  2ZIV B;  5DB7 A;  2HBM A;  1NZB A;  5JU5 A;  4DFM A;  2YB1 A;  4AYB F;  5CA7 A;  2RRD A;  3NUQ A;  1L3S A;  5KG4 A;  2W9C A;  4Q45 A;  7ICJ A;  1QQ7 A;  5J29 A;  3ZDA A;  4KLJ A;  3NVZ A;  2KHV A;  5T14 A;  3G6Y A;  3RB3 A;  1O08 A;  3AUO A;  2JEG A;  4R8U A;  4HAI A;  4UBB A;  5AI6 A;  2C2E A;  3IG8 A;  5KL8 B;  3SQI A;  8ICY A;  3T5J A;  1JIH A;  1KN5 A;  4NXZ A;  5J0R A;  3JPS A;  5KFQ A;  5GTH U;  2A1J B;  2G08 A;  5DGA A;  3I76 A;  2PXI A;  4I2E A;  4BXO B;  3C23 A;  5J2A A;  4UAT A;  4LZG A;  1L7O A;  4KLF A;  3WKC A;  4Y2J A;  2LM4 A;  4GIB A;  3SEI A;  4I2F A;  1J97 A;  1SL0 A;  3T5H A;  2B6G A;  4MEY A;  3D2S A;  5JRT A;  5EE9 A;  5BOL A;  3U26 A;  2EH9 A;  2YML A;  4NV0 A;  5TZV A;  5DB9 A;  2R8I A;  3BS5 B;  3H8W A;  3B0Y A;  4QZ8 A;  1KLN A;  3LDA A;  4KLE A;  3PO4 A;  4TUQ A;  1X42 A;  1OW5 A;  4MEX A;  4RU9 A;  3TAN A;  3E2E A;  2NO4 A;  1ZD4 A;  4EBE A;  2AHO B;  5J0T A;  4O3O A;  2JH1 A;  5CEH A;  2DPI A;  4KN7 A;  2MU2 A;  2F8L A;  1Z1V A;  3BS5 A;  3OGU A;  1NK6 A;  2D6F C;  1RXV A;  4NLC A;  2WHE A;  5J0P A;  9ICK A;  5AI0 A;  4DLE A;  3FDS A;  3AEV A;  4YFK A;  3VCB A;  1NJW A;  9ICS A;  5L1M A;  5AKZ A;  5KFI A;  3RAX A;  3RAQ A;  3GV7 B;  5HHI A;  1SKW A;  3MR3 A;  5IIJ A;  5DG8 A;  3C2K A;  2VKQ A;  3K75 D;  4FBU A;  4KLQ A;  4ECQ A;  1LV5 A;  1N5W A;  3RH4 A;  2W43 A;  3PW0 A;  4M2Y A;  4IR9 A;  9ICT A;  1BNP A;  1SXD A;  4Y2T A;  3HP6 A;  2XGP A;  4IRK A;  5J2B A;  3GIJ A;  4FFD A;  2ZJ5 A;  2P66 A;  3KTQ A;  2QKQ A;  2A1A A;  5J2C A;  4UB5 A;  2BCU A;  5KFK A;  3PR4 A;  4XRH A;  2BQ3 A;  4DQR A;  2RQ5 A;  5AI8 A;  2C22 A;  1RPL A;  1QLN A;  1DOQ A;  4DF8 A;  3BQT A;  1JMS A;  2WF5 A;  3SZ2 A;  3TAD A;  5KNI A;  2ODG A;  1BPE A;  2XI9 A;  4DQP A;  2W9B A;  2H3F A;  3QNM A;  4RQM A;  2HHX A;  2YMP A;  3WK7 A;  1A0P A;  1V97 A;  1ZD2 P;  4KIT B;  2YN4 A;  2F3N A;  3AMZ A;  1IG6 A;  3RJE A;  8ICL A;  2ISO A;  2KG5 A;  2W8K A;  4FZM A;  4ZH4 A;  8ICI A;  2DKZ A;  3IM1 A;  1URJ A;  2FLP A;  2FMQ A;  4QWD A;  2GH1 A;  4P4O A;  3MR2 A;  1V9P A;  2ZIU A;  2HI0 A;  3T3F A;  4DL4 A;  2G09 A;  1Q3V A;  5ALR A;  4PHE A;  3KOO A;  1WWU A;  1ZOL A;  4TUP A;  1XC9 A;  5KFF A;  3J81 j;  1WWV A;  1X9M A;  1X9W A;  1QSL A;  9ICW A;  4BXO A;  1UPH A;  4QIW C;  3HWT A;  3GFK B;  3NTU A;  4DQS A;  3ETL A;  2A1J A;  7ICE A;  1L8O A;  3N97 B;  3N7S C;  2FJ6 A;  4CF3 A;  4QZF A;  4RQ3 A;  2HHQ A;  5DBA A;  4P0Q A;  1FO4 A;  5EWF A;  2LKY A;  4FS1 A;  2WF9 A;  1HEK A;  1ZD5 A;  4BUG A;  1M6Y A;  3EWA A;  1PUZ A;  1FFU A;  4IQV A;  5B5E U;  2BCV A;  3PW4 A;  4YN4 A;  3ICX A;  3MDA A;  2OYY A;  3RBD A;  2LYH A;  4UB1 A;  1ZQU A;  5KFY A;  1L3V A;  4RQ2 A;  7ICI A;  4OJO A;  3UQ0 A;  1NK7 A;  2EZZ A;  3IDW A;  4J03 A;  3RFA A;  2KVC A;  3OJS A;  1UT5 A;  3EZ5 A;  1DRG A;  2HOI A;  4NM2 A;  1Q8K A;  4RQ5 A;  2N1R A;  4PHD A;  1RZT A;  1S97 A;  2PFQ A;  2G07 A;  4F3O A;  5AKG A;  4MFC A;  2J6S A;  3LWL A;  4PGX A;  1ZQH A;  3KKA A;  4OJ5 A;  3K1R B;  5TIS U;  3SAH A;  3HW8 A;  2JEJ A;  4F50 A;  4EEN A;  8ICX A;  3R9K A;  1UA1 A;  2E8P A;  4BGD A;  4CRX A;  4M9L A;  9ICP A;  3D6J A;  3C5F A;  4Q43 A;  5KFX A;  5KT4 A;  4B9N A;  1ZQV A;  2W8L A;  2E1F A;  4P0Q B;  3RR7 A;  3M9N B;  1XSP A;  5EOZ A;  5EWE A;  4M47 A;  4B9V A;  2MUT A;  4US9 A;  3I1Y A;  2KN7 A;  3IRU A;  5DB8 A;  1B4F A;  4QWB A;  5ALZ A;  5D46 A;  2IA6 A;  4J9M A;  5ALQ A;  5J2I A;  2DKX A;  2XVT A;  1NI3 A;  1D9D A;  1NNL A;  2QAR A;  2ZXH A;  1HUO A;  3TQ1 A;  3Q8K A;  2ZTE A;  2E8O A;  1Z00 B;  4PZO A;  1S77 D;  5KL1 B;  3CYM A;  3LWM A;  2KZM A; 
#chains in the Genus database with same CATH homology
 2EH9 A;  4LJX A;  2JXJ A;  1KKX A;  2CXY A;  1RYU A;  2KK0 A;  2EQY A;  2LM1 A;  5CEH A;  5K4L A;  2OEH A;  1KN5 A;  2LI6 A;  2JRZ A;  1C20 A;  2RQ5 A;  1KQQ A;  1IG6 A;  2YQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...