1C20A

Solution structure of the dna-binding domain from the dead ringer protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAAFTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEAD RINGER PROTEIN
publication title Solution structure of the DNA binding domain from Dead ringer, a sequence-specific AT-rich interaction domain (ARID).
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1c20A00
5K4LA 4LJXA 2OEHA 1RYUA 2YQEA 2CXYA 2EH9A 1C20A 1KQQA 5CEHA 1IG6A 2JXJA 1KN5A 2EQYA 2JRZA 1KKXA 2LI6A 2LM1A 2RQ5A 2KK0A
chains in the Genus database with same CATH superfamily
4F4KA 2HBJA 5J0OA 5TZVA 4RT2A 4DS5A 3AQEA 4PZNA 2FPMA 2M9NA 3JPOA 4DO9A 3F5EA 7ICQA 4PHPA 2V4RA 4OJOA 4I2AA 1TK5A 2VA8A 1ZQMA 3E2EA 1KQQA 4KMOB 2LHTA 3RTVA 9ICEA 1DK2A 2W43A 2DBYA 2W7OA 3KKAC 1T3QA 1X9MA 5ALJA 4J9MA 4UAVA 5AHXA 4F4XA 4ZH4A 3QEBZ 4QZCA 4X5VA 3MFIA 4ED7A 8ICNA 4DSJA 2XO7A 2F3NA 5ALSA 5DBCA 4DL7A 3HPOA 1A6SA 3D2SA 1L6NA 7ICLA 1ZXIA 4UARA 8ICIA 5AKEA 4KLGA 2MUTA 4MFFA 2ZXHA 4F91B 3MABA 1ZQGA 1EXNA 2IHNA 5KFDA 4I2JA 1T4GA 3U26A 2R8KA 4QJFB 1BPYA 5DG9A 1XC9A 1BVSA 1ZD4A 2ISOA 4EBCA 1S97A 4P2HA 1BNPA 1KL9A 3CYMA 5KNIA 3CP8A 3BQ1A 4EX7A 5KAIU 2LM4A 2ZTDA 3SAFA 4C8LA 1BPZA 2HHVA 2YX8A 1S5LU 4QZDA 3ZDEA 2G07A 5KG3A 3AU6A 1PK1B 3QYPA 4QZIA 3OHAA 4XA5A 4ECYA 5EWFA 4I2IA 1N48A 3WKCA 1AROP 1LKYB 4KTQA 1IV8A 1SB3C 2B6GA 4FZLA 4YR0A 1UA1A 3RH5A 3GILA 3ORYA 1N60A 1U45A 2R8HA 2KFNA 4QIWC 1F44A 1PVQA 1MN8A 9ICIA 5C5JA 5DLFA 3PW5A 2KVCA 2JZBA 4R64A 1KKXA 2LKYA 2WFAA 5DBBA 2KIVA 4DCCA 4RQ7A 4UB8U 1ZQRA 2V4QA 3SYZA 2NV3A 5EWEA 5KG6A 4IR9A 4PGYA 2PFNA 4KLHA 5J0PA 1VDVA 2F1JA 4HAIA 5AKJA 1ZQJA 5AM0A 3V7LA 1ZQFA 4MEYA 2RQ5A 1N56A 2VIXA 3M9MB 4ECWA 2J6TA 3K1RB 3PZPA 2LYBA 1ZQQA 2F44A 1TAQA 3MR3A 4RUAA 2QARA 3AMZA 3BQ0A 4TURA 2IOFA 4UBCA 4NL9C 5KFVA 3Q8PB 3N97B 4I2DA 5DB7A 7ICKA 4CGZA 5ALPA 4DSIA 2VA3A 4C4TA 4ACOA 5BPCA 1O03A 3CNHA 4NLGA 4EEKA 4I2CA 7ICRA 2LM1A 3PR4A 4Y2UA 2HOIA 4HYKA 2GH1A 2QLTA 5F9NA 5J2AA 2DUYA 4M9LA 7ICMA 1KEJA 2ZIVA 2F1IA 5CR0A 2XI9A 1NJZA 1KLNA 1V38A 1S76D 3V6HA 3H0RB 2KN7A 2G06A 2HHSA 5AK4A 2V9WA 4Q44A 3T5LA 1J97A 2WF8A 3JPSA 2NO4A 1VLBA 3BS7A 3QUBA 4J9RA 5FP0A 4KLTA 2KEYA 8ICUA 1PZNA 5ALQA 2ZUBA 5HMLA 5BOLA 4AYBF 1WUDA 2ZTCA 2L5YA 1UQVA 2I1QA 4Y2PA 4UB1A 5BOMA 3PSIA 5KFRA 2MUTB 5ALNA 4KLSA 4FE3A 3WK5A 3K4GA 2JH1A 3T5HA 3ICXA 1SXEA 3PSPA 1S0VA 4F2RA 4ED0A 2PFQA 4NLZA 3EUB2 2WHEA 4RQMA 4FS2A 5IIOA 1QSSA 4ECVA 1D8BA 2KE7A 1COKA 2HVIA 1BPDA 3OSPA 4M04A 2Y1IA 1Z1VA 2W9CA 2XY5A 1J2MA 3H40A 4TQRA 1MQ2A 2XGPA 3H4DA 1RQNA 2BPFA 1L3SA 1NK5A 5HHHA 3AQFA 3MDAA 4RNNA 2AH5A 3OTQA 3TADC 3QU9A 5KT7A 2QKQA 3UMGA 9ICHA 2YTUA 3NVWA 2HBKA 3TARA 3D2QA 3KTQA 2LBOA 2P66A 1N63A 2JZBB 4IQTA 2XVTA 2OCEA 3GV8B 5KFKA 3RBDA 2GWSA 4MF2A 4G9BA 4M47A 4KLFA 4OO1J 3NASA 1ZQZA 3BDPA 2AGPA 4BUGA 4F72A 3UXNA 5J0UA 2PMZF 5EE1A 2DL0A 4AP9A 2Y1JA 1HUZA 2YMQA 4KLDA 4PHEA 3C5FA 2DPJA 4KLLA 3ZD9A 8ICRA 1BPEA 3MGIA 8ICKA 1FFVA 3GIJA 3ALRA 2KSOA 3RRHA 4BDPA 2I5HA 4DL2A 5JUMA 3TQ1A 2QARB 4QW9A 3DDHA 5KL8B 4Q43A 1L7OA 5KFBA 4JK1A 3TANA 5DG7A 4Q8EA 3HT3A 2OXOA 4Z6DA 5J8YC 1FEZA 1RYUA 2FDRA 1S77D 2P6UA 4F8RA 4GLXA 2IHMA 2KNJA 1NK9A 3C2KA 3TFSA 4ED2A 3MR2A 5AK3A 1SL2A 2W9AA 5AM3A 2CN1A 2ZIVB 1QH9A 1ZQSA 4ECQA 4C7YA 4GC6A 4DLGA 1NJWA 4UB3A 1BPXA 4EBEA 1XSLA 2EH9A 5CB1A 5AKHA 1ZQOA 1UCVA 5J2CA 4KLQA 1KN5A 2JMGA 2HHTA 5KT2A 3Q8KA 4YQWA 3M9OB 2ZIUA 2KZZA 1Q46A 2K60A 4NY8A 4TUQA 1ZQCA 2HHUA 2MRLA 4M9NA 2P35A 3NGDA 4YCXA 3T79A 1JMSA 3RJJA 4J9LA 1DK3A 1MSWD 4Z6FA 4K4GA 4MEXA 3RJFA 1PK1A 2BR0A 1X6IA 2RRDA 3ZDBA 4QWBA 2H3VA 3PO5A 2FI1A 4ECZA 1RG6A 3KHLA 2W9BA 1XWLA 2RHFA 1V85A 1SZPA 5KFJA 4PH5A 1ZD5A 1LKYA 5CA7A 2NRWA 1IIPA 4J9SA 4F50A 1NKEA 2NRTA 4R66A 3L5KA 3BQ7A 1H38A 1S0OA 3TFRA 1ZQXA 3RB4A 3C1YA 4C8NA 3Q8QB 3GZFA 8ICMA 3IDWA 2PFPA 1B0XA 3HKZC 4DFMA 9ICCA 3QEAZ 5ALLA 3A0BU 4QWAA 5AK5A 4I2FA 2W9CB 4EZ9A 4PPXA 2FJ6A 4UATA 5AM1A 4JV1A 5ALIA 3ZD8A 5DGAA 3TKAA 2H5XA 4IR1A 2E8PA 1ZQUA 3NRWA 1RDFA 5L1KA 2AQ4A 5J0SA 1ZQDA 2LMRA 1HUOA 3CW2C 3WKEA 2ZXIA 1O08A 1ZQYA 2XY6A 1L8LA 5KFZA 5J2FA 2QB1A 2KICA 5AI0A 4J9QA 2C2DA 4B9MA 4USAA 4B9NA 4F4YA 3OHBA 1RYSA 1F0MA 2K4HA 2OYYA 2JV3A 5G5HA 9ICRA 5AM5A 5J2HA 3GFKB 4AYBC 2Y0SF 7ICFA 4LVSA 1X9XA 1P7DA 2YB1A 1ZQTA 1Z3EB 2BDPA 3JPRA 4U7CA 3LDAA 4Y2VA 2K8BB 3UMCA 4PGXA 4RPXA 5G5GA 2JEGA 4YN4A 2HSZA 2EQYA 4J9PA 2ES6A 9ICPA 4Y2QA 4YG2A 9ICFA 5CRXA 3D6JA 2NO5A 1L3UA 3Q8SB 2KSOB 2A1JB 3T5KA 3K75D 3JPPA 5ALWA 2ASDA 4PZOA 3IV6A 1ED1A 4M6WA 4IRDA 2ZIWA 3PW7A 7ICNA 1SIJA 4Y2RA 5KFMA 2WTFA 2I9GA 8ICXA 1Z4NA 3HWTA 2BPCA 4KX3A 1SKWA 3SZ2A 1BPBA 3IP4B 2KJ9A 2NYVA 2BCQA 4YXMA 3NVYA 3SQIA 4NJ8A 4M9HA 1CUKA 8ICJA 1DXSA 4CNQA 3WKBA 1T3NA 3AEVA 2KIWA 4JMUA 2B0CA 3WK9A 4CF4A 1KFDA 2KOBA 4US9A 1AQ6A 3V72A 1S0MA 7ICEA 4LZDA 4RZRA 1XSPA 4F3OA 2WAQF 1U48A 1M6YA 3FDSA 3IM1A 4C7ZA 1HJPA 4DLEA 3PSTA 3VCBA 1NKCA 1TAMA 4IC9A 1NNLA 1KTQA 4YR2A 4ECXA 3NS1A 1IM4A 4MHVA 2HHQA 4P0PA 5J0QA 2D6FC 2ZIUB 5F3XB 2JXJA 1SWWA 3M7DA 2KK0A 4ECTA 5KFAA 3HX0A 1TVAA 2HDOA 2YQEA 8ICHA 1WWVA 5TISU 1L3VA 4GXKA 2K8AA 2YMMA 2MAXA 3FAHA 2W9BB 2RP5A 1X9SA 2K4IA 4RQ3A 4B9VA 3GQCA 1Y88A 2A3VA 5J0RA 3WKAA 3Q8MA 5KAFU 5AI8A 4PHAA 1JX4A 5ALGA 4RNMA 5E79U 5ALZA 2AHOB 1NOMA 3F53A 3F2DA 2ZUDA 4ELTA 5J29A 5AIAA 2Y9TA 4FO6A 3ONNA 8ICZA 1SWVA 1B22A 2W11A 3KFUF 1SV0A 4PGQA 2PI5A 2LYHA 4DFJA 3RF9A 5CJ7A 2XIDA 4NXZA 3KBBA 2E5SA 4US8A 3RJHA 4IQWA 7ICOA 1ZJMA 2WB1C 2EZXA 3N4MB 7ICJA 4OJ6A 2EZZA 4UB6U 1ZQHA 1T7PA 3OPXA 1K1QA 4CE6A 2BDUA 3SV3A 1NJXA 3C23A 2DKXA 3M8SA 2XCAA 5EE9A 9ICQA 2GO7A 2DQNB 3KKAA 3WK8A 3B0XA 2JEIA 2W7PA 2HVHA 2PI4A 4RT3A 2H3IA 3QUCA 4I2EA 4QZBA 4EX6A 3M8RA 1X6JA 1T94A 2HHXA 1U47A 5D49A 2RDIA 1TKDA 1V97A 4F92B 2H3ZA 3SAGA 1XO1A 5HMMA 3GIIA 2UVWA 4M6WB 4J9KA 2ZIWB 3H4BA 4KLOA 2BZFA 5JRTA 2KHVA 3WK6A 5DQIA 1RM6C 5ALOA 4OCZA 4JUZA 4FBUA 4TUSA 5KG7A 5IINA 2OH2A 5AKLA 3BZKA 4NM1A 5CWRA 3OJUA 2ASLA 4I2HA 2AJQA 4IQVA 4NWIA 4CRXA 1SZHA 5DQGA 5KT3A 4DFDA 2BCSA 4YVZA 1TAUA 2C28A 4CF5A 2QB0A 5J2DA 1ZYQA 1OUQA 8ICYA 5IIKA 5A0LA 5AKKA 4XQ8A 4QW8A 3F2BA 3KOOA 4P0PB 1SV4A 4I2GA 1L8OA 5KFNA 3I1YA 5AKGA 1IXRA 5DLGA 4EZ6A 1RQLA 3UQ0A 1U9LA 3ED5A 2FMQA 3MR5A 1ZD3A 2YY6A 3F2CA 1PVRA 4QWDA 4CDGA 4P4PA 2E8NA 1ZQVA 1QQ6A 4UB4A 3OGUA 1ZQPA 1FO4A 3ZDDA 3BZCA 3QX7A 3GU3A 4I2BA 2VJ4A 1RZTA 4WJ3B 2HBLA 4IL6U 1ZQKA 1ZJNA 2E1FA 3B0YA 2EANA 3C5GA 4P0QB 3H0MB 3BS5A 4DFKA 2BGWA 1SKSA 4NL9A 4ECSA 2BPGA 3H8MA 2EAMA 2P6RA 4UAWA 1Z19A 9ICUA 4P4OA 2OHFA 5AI6A 4XUSA 4UW9A 2PXIA 4J03A 5DGBA 3ETLA 4Y2SA 2JR5A 5EE3A 3TI0A 5J2EA 4QZEA 3I28A 2BQ3A 4DL3A 2A1JA 1DRGA 3LYSA 2W8KA 4IQUA 4DSFA 2LI6A 5KT5A 4DF8A 5HNKA 3ZI4A 2BQRA 5KFOA 2R8IA 2HCFA 2KG5A 3OSNA 3UXOA 5KFFA 5KTQA 2XY7A 1B4FA 1SL1A 5J0WA 5H2FU 5KFPA 4O3NA 4BWJA 2JEJA 4BXOB 4O3MA 1UT8A 4KLMA 3PW4A 1UT5A 2KMDA 2YB4A 3AUOA 3DEEA 1HIWA 4RNOA 1QSYA 4NLKA 5KFCA 9ICWA 3LK9A 2BHNA 3QZ7A 4NM2A 1ZRMA 1ZQBA 1D8LA 3RAQA 2PFOA 4JB3A 5AIBA 3ETRA 4J9OA 1ZD2P 4O9MA 3QXGA 3MR6A 5J2IA 2DGZA 3RR8A 3MBYA 4QIWF 5ALUA 1DGSA 4O3OA 1J2NA 4QZGA 4KN7A 3PVXA 1Q8KA 1FIQA 4DL6A 3QNMA 1Q3UA 3IG5A 3AN1A 2ZJ5A 2YMLA 5AK6A 2BCRA 1BGXT 1WCLA 1RYRA 2UVRA 4O3PA 3N7PD 4DSLA 1NZBA 2WF9A 2W54A 4MFAA 4DOAA 1NK0A 2Y9UA 4JWNA 4RUCA 1PK3A 2JEFA 4B9LA 3PMLA 2XGQA 5KFXA 2EAPA 1TFRA 1ECWA 5EOZA 4DOCA 2ESEA 2F8LA 3RJIA 1KFSA 4I29A 2KV2A 3NVZA 5L1IA 2FE9A 4Y2JA 5KG5A 3NTUA 3RJKA 9ICGA 2QB0B 2DF4B 1U49A 5KFEA 1S10A 1D8YA 7ICTA 2ZG6A 3RB0A 3TAPA 2R18A 5DDMA 4RQ0A 1QTMA 9ICXA 3QU2A 2FPKA 3E58A 3TADA 5KT6A 5T14A 4M9JA 8ICCA 3KD3A 2KP7A 4ECRA 4F5OA 2IA6A 2EDUA 2XCPA 4GIBA 4QZAA 4C8MA 3C2MA 5AI5A 2AQ0A 5EWGA 2MSNA 3SENA 7ICUA 4YD2A 1L5UA 5C0YA 1PUZA 4PJ0U 5KFHA 1ZQNA 3RH4A 3WK4A 5AM2A 5HR7A 3SAHA 4BX9C 4CF3A 1ZQ1C 2WF6A 4C4SA 2FLNA 4LJXA 4EBDA 3QU7A 5L1MA 3UQ2A 5EE0A 2HOFA 2RLTA 1N5XA 4ELVA 4KLEA 3BJYA 3SMVA 4MFCA 3BS5B 1UA0A 3FYHA 3PX4A 1U4BA 3RJEA 1NKBA 8ICWA 4FBTA 5J8YA 3TACB 3KZXA 3RH6A 3QU4A 1PVPA 3LWLA 4QWEA 2I6XA 2Z7JA 2NRXA 5GTIU 8ICLA 1N5WA 1OXJA 1XU4A 3LVVA 1FFUA 2W8LA 4OD0A 1WG8A 4DOBA 3RRGA 4B9UA 1KBUA 5ALTA 3AM9A 2BCUA 4NLBA 2J6UA 1L7PA 2KKVA 1L3TA 3G6YA 3A0HU 5HHIA 2G5HB 3GV5B 2H3FA 2Q0ZX 2AGQA 4GXJA 3D2NA 3KZIU 3PY8A 5J0XA 2VKQA 4EELA 2YN4A 5KL1B 2BCVA 1SGGA 1NZPA 1A76A 4ED3A 4O3SA 1S8OA 4DQQA 3HP6A 2XICA 1S9FA 5IILA 4DQRA 3Q8LA 4DSKA 4IRKA 5B66U 3KHHA 4OJ5A 4F4ZA 1ZQEA 4ED8A 3C29A 4QNLA 4BGDA 5D4BA 4EYHB 3EZ5A 4O0IA 4GFJA 2ZIXA 5DDYA 1DGJA 1Q3VA 5ALKA 4R63A 4Y2XA 3UM9A 2NRZA 2AXTU 3PW2A 3NRZA 3NUQA 2KZMA 4ED1A 4M0AA 3R9KA 4FZMA 2W9MA 1TK0A 3SR6A 4G3IA 3EW9A 4RQ8A 1D9DA 4KITB 1N2XA 7ICSA 4B6JA 2PMZC 2O6KA 3EWAA 2C2RA 4BJQA 2DFLA 5DQHA 2ODGA 3AU2A 2R8GA 1QLNA 4F5NA 3EYZA 2ATLA 1QQ7A 1XSNA 1D9FA 2K4PA 5KG0A 4O3RA 1CEZA 3T5JA 1YZ7A 2UVVA 2FLLA 4E0DA 5DG8A 2KJ5A 5L1LA 1ZQLA 2C2EA 1COOA 4GXIA 4M9GA 5D46A 3PX0A 3MGHA 2A19A 5IIMA 3MDCA 1JI7A 1NK6A 2JHDA 1SKRA 2DPIA 2ZTEA 4P0QA 1X66A 1S0NA 5JU5A 9ICTA 3WK7A 1RPLA 5K4LA 4F2SA 2F2AB 3C1ZA 1QQ5A 4EYIB 2MA1A 9ICSA 2EZYA 4YMNA 4ICAA 3G6XA 3H7IA 4FZNA 4UASA 4DQSA 1IG6A 2OM6A 3RFAA 3HJEA 4YMOA 1ZETA 2W03A 4R8UA 2F1HA 2EAOA 3QUTA 5B5EU 8ICEA 8ICFA 1CRXA 5J2KA 1X2IA 1K1SA 1Z00A 4O5KA 2J6SA 4XRHA 5ALHA 2GOLA 5KFUA 1ZQIA 1C20A 1C7YA 1TK8A 5GTHU 4BXOA 7ICIA 8ICBA 1JXEA 2IOHA 3QU5A 4F5PA 4UB2A 5IIJA 4QZ8A 4JWMA 3DV9A 4RPYA 9ICAA 5ALEA 3V7JA 1A0PA 4QZHA 3GV7B 8ICQA 1X9WA 2FMSA 5J2GA 4F71A 5JTIA 4KLJA 2NRVA 3M6KA 4UAZA 1XNSA 1L7MA 3HKZF 1TV9A 4QWCA 1Z1BA 1JIHA 3H8SA 2GLEA 1B43A 1UPHA 4KLIA 2HI0A 3UPQA 3SV4A 5AKIA 2HHWA 3UXPA 2W55A 4O3QA 1LV5A 5KFSA 4EENA 4DWIA 3N28A 3LVWA 2KFZA 3WKDA 4C8KA 4JV0A 4TQSA 1HEKA 5J2BA 3V6JA 2E8OA 1NJYA 3ZDCA 2IOFK 2KZ3A 8ICTA 2G09A 7ICHA 2YMPA 4QZFA 4DF4A 3LWMA 8ICSA 5J2JA 3PR5B 2HOQA 3CRXA 2KTQA 2MU2A 3S6JA 1MA7A 4NV0A 5ALYA 5KFYA 3RB3A 1SL0A 3IHQB 2ZIXB 2KJ8A 3FM9A 1DOQA 4Q45A 9ICBA 1NK4A 4CCHA 5DB6A 1URJA 4Y2YA 1JALA 2Y0SC 1JUDA 3H8JA 5AI9A 3MC1A 2DKZA 5AKZA 1YT3A 4TUPA 2AGOA 4QZ9A 4YR3A 3RAXA 5CEHA 2FMPA 2W3SA 3WU2U 4DEZA 5ALDA 1MQ3A 4PHDA 2FLPA 5KFQA 4DQPA 2IMWP 4F93B 4A8EA 2AU0A 2VA2A 2JGAA 2F76X 5KFIA 3BQTA 5ALXA 1MC8A 3J81j 4DS4A 4PL1A 1KW4A 3NVVA 2IBKA 3SEIA 1GO3F 4RQ6A 5DB8A 3L4PA 2OEHA 7ICVA 2HMXA 1RXVA 1ZRNA 4KMUA 2G5IB 2CRXA 4C4RA 1ZOLA 4RQ4A 1T8EA 3M6ZA 2ISPA 1XO0A 2M0NA 3C2LA 4KN4A 1ZQAA 4K4HA 3RBEA 2HW3A 1NK7A 1JRPA 3RJGA 1WCNA 1QCKA 1LVHA 4DSEA 2F77X 1N62A 2VJ5A 4O5CA 2WAQC 5J0TA 1UHUA 5KFTA 5CP2A 3HILA 4R8UB 4NLCA 1KFTA 1KRPA 9ICLA 5AKXA 4U6PA 2H3QA 4F4WA 4DL4A 8ICGA 1Z00B 5L1JA 3QUQA 3K1ZA 2A1AA 9ICOA 4F5QA 2ZJ8A 1X40A 3V6KA 2E1EA 2N1RA 4I27A 3I76A 4UQGA 3N7RC 5KG1A 4FFDA 4PL2A 4KLUA 2FPLA 4OJPA 3GIMA 1RXWA 4C80A 2C22A 2XC9A 2F8KA 3UMBA 9ICJA 4J9NA 2RDJA 8ICOA 5DKWA 1F5SA 5KFGA 2ALZA 5AKYA 3PV8A 5KFLA 2K8CB 2R8JA 4I28A 9ICMA 3MGVA 2KKPA 2DWQA 2E3TA 3HRDD 1LB2B 4RQNA 4P4MA 2G08A 3HW8A 3EPIA 3SD7A 3IRUA 5ALVA 4YMMA 2E8MA 4KX5A 4NLNA 3ISCA 4RQ1A 1A77A 3MFHA 3C21A 3H0LB 9ICNA 1JXLA 5AM4A 2ZUCA 4YXJA 2WB1F 4IS7A 5AI4A 5KG2A 3RR7A 4DQIA 3EPGA 4RPZA 3L3FX 2JRZA 5ALFA 4JV2A 1WWUA 3RB6A 3TAQA 3T3FA 5J0YA 3C28A 4UBBA 2LPEA 1V9PA 3H8WA 1SXDA 3V7KA 2CXYA 7ICGA 3M9NB 3JPTA 2D8CA 4Z6EA 3Q8RB 2BQUA 4DL5A 4BWMA 4UAUA 8ICVA 2CPRA 2W3RA 4M2YA 1L7NA 1KSPA 4B9TA 3VC8A 5HR6A 2G0AA 1CI4A 5KT4A 8ICAA 4MF8A 2PKEA 3AL0B 3QZ8A 4O5EA 2KHQA 5AICA 4FS1A 5DB9A 1ZQWA 1K5OA 3PO4A 2K89A 4B9SA 5L9XA 5CHGA 2KD1A 2Q4TA 2WF7A 5F9LA 3E0FA 4EEYA 2HBMA 4ZOHC 4Y2TA 1QSLA 4Z6CA 4ED6A 1OW5A 8ICPA 3GIKA 4UB5A 1NK8A 3OJSA 4YD1A 4GC7A 3O0FA 5ALRA 4RQ2A 3PX6A 4UAYA 3GDXA 3FC4A 1N61A 4C8OA 1TE2A 2BKEA 2W04A 4ELUA 7ICPA 3N7SC 3ISDA 1JROA 2D3DA 1Z4OA 1XS9D 4C0ZA 2UVUA 4RQ5A 3KHGA 3ISBA 2JH7A 9ICKA 2LYAA 1NI3A 3JPNA 4LZGA 2WF5A 4ECUA 5KG4A 3B9JA 5ALMA 2ASJA 2ZJAA 3IG8A 4Q8FA 4YP3A 1WYGA 1BNOA 3PW0A 3M1YA 4R65A 3THVA 4RU9A 1JN3A 4OJLA 3PSFA 4K4IA 1X42A 2K4EA 1YZ6A 3JPQA 2OWOA 5DBAA 3BQ2A 5IIIA 1SV0C 1VJ5A 2KVSA 3SI8A 9ICVA 4YFKA 2VANA 3QE9Y 2B21A 3KHRA 1KDHA 3PNCA 4DFPA 3G6VA 4F5RA 5HP4A 3F5AA 3IN5A 3PMNA 3ZDAA 5KFWA 4IRCA
chains in the Genus database with same CATH topology
5K4LA 4LJXA 2OEHA 1RYUA 2YQEA 2CXYA 2EH9A 1C20A 1KQQA 5CEHA 1IG6A 2JXJA 1KN5A 2EQYA 2JRZA 1KKXA 2LI6A 2LM1A 2RQ5A 2KK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K4L A;  4LJX A;  2OEH A;  1RYU A;  2YQE A;  2CXY A;  2EH9 A;  1C20 A;  1KQQ A;  5CEH A;  1IG6 A;  2JXJ A;  1KN5 A;  2EQY A;  2JRZ A;  1KKX A;  2LI6 A;  2LM1 A;  2RQ5 A;  2KK0 A; 
#chains in the Genus database with same CATH topology
 4F4K A;  2HBJ A;  5J0O A;  5TZV A;  4RT2 A;  4DS5 A;  3AQE A;  4PZN A;  2FPM A;  2M9N A;  3JPO A;  4DO9 A;  3F5E A;  7ICQ A;  4PHP A;  2V4R A;  4OJO A;  4I2A A;  1TK5 A;  2VA8 A;  1ZQM A;  3E2E A;  1KQQ A;  4KMO B;  2LHT A;  3RTV A;  9ICE A;  1DK2 A;  2W43 A;  2DBY A;  2W7O A;  3KKA C;  1T3Q A;  1X9M A;  5ALJ A;  4J9M A;  4UAV A;  5AHX A;  4F4X A;  4ZH4 A;  3QEB Z;  4QZC A;  4X5V A;  3MFI A;  4ED7 A;  8ICN A;  4DSJ A;  2XO7 A;  2F3N A;  5ALS A;  5DBC A;  4DL7 A;  3HPO A;  1A6S A;  3D2S A;  1L6N A;  7ICL A;  1ZXI A;  4UAR A;  8ICI A;  5AKE A;  4KLG A;  2MUT A;  4MFF A;  2ZXH A;  4F91 B;  3MAB A;  1ZQG A;  1EXN A;  2IHN A;  5KFD A;  4I2J A;  1T4G A;  3U26 A;  2R8K A;  4QJF B;  1BPY A;  5DG9 A;  1XC9 A;  1BVS A;  1ZD4 A;  2ISO A;  4EBC A;  1S97 A;  4P2H A;  1BNP A;  1KL9 A;  3CYM A;  5KNI A;  3CP8 A;  3BQ1 A;  4EX7 A;  5KAI U;  2LM4 A;  2ZTD A;  3SAF A;  4C8L A;  1BPZ A;  2HHV A;  2YX8 A;  1S5L U;  4QZD A;  3ZDE A;  2G07 A;  5KG3 A;  3AU6 A;  1PK1 B;  3QYP A;  4QZI A;  3OHA A;  4XA5 A;  4ECY A;  5EWF A;  4I2I A;  1N48 A;  3WKC A;  1ARO P;  1LKY B;  4KTQ A;  1IV8 A;  1SB3 C;  2B6G A;  4FZL A;  4YR0 A;  1UA1 A;  3RH5 A;  3GIL A;  3ORY A;  1N60 A;  1U45 A;  2R8H A;  2KFN A;  4QIW C;  1F44 A;  1PVQ A;  1MN8 A;  9ICI A;  5C5J A;  5DLF A;  3PW5 A;  2KVC A;  2JZB A;  4R64 A;  1KKX A;  2LKY A;  2WFA A;  5DBB A;  2KIV A;  4DCC A;  4RQ7 A;  4UB8 U;  1ZQR A;  2V4Q A;  3SYZ A;  2NV3 A;  5EWE A;  5KG6 A;  4IR9 A;  4PGY A;  2PFN A;  4KLH A;  5J0P A;  1VDV A;  2F1J A;  4HAI A;  5AKJ A;  1ZQJ A;  5AM0 A;  3V7L A;  1ZQF A;  4MEY A;  2RQ5 A;  1N56 A;  2VIX A;  3M9M B;  4ECW A;  2J6T A;  3K1R B;  3PZP A;  2LYB A;  1ZQQ A;  2F44 A;  1TAQ A;  3MR3 A;  4RUA A;  2QAR A;  3AMZ A;  3BQ0 A;  4TUR A;  2IOF A;  4UBC A;  4NL9 C;  5KFV A;  3Q8P B;  3N97 B;  4I2D A;  5DB7 A;  7ICK A;  4CGZ A;  5ALP A;  4DSI A;  2VA3 A;  4C4T A;  4ACO A;  5BPC A;  1O03 A;  3CNH A;  4NLG A;  4EEK A;  4I2C A;  7ICR A;  2LM1 A;  3PR4 A;  4Y2U A;  2HOI A;  4HYK A;  2GH1 A;  2QLT A;  5F9N A;  5J2A A;  2DUY A;  4M9L A;  7ICM A;  1KEJ A;  2ZIV A;  2F1I A;  5CR0 A;  2XI9 A;  1NJZ A;  1KLN A;  1V38 A;  1S76 D;  3V6H A;  3H0R B;  2KN7 A;  2G06 A;  2HHS A;  5AK4 A;  2V9W A;  4Q44 A;  3T5L A;  1J97 A;  2WF8 A;  3JPS A;  2NO4 A;  1VLB A;  3BS7 A;  3QUB A;  4J9R A;  5FP0 A;  4KLT A;  2KEY A;  8ICU A;  1PZN A;  5ALQ A;  2ZUB A;  5HML A;  5BOL A;  4AYB F;  1WUD A;  2ZTC A;  2L5Y A;  1UQV A;  2I1Q A;  4Y2P A;  4UB1 A;  5BOM A;  3PSI A;  5KFR A;  2MUT B;  5ALN A;  4KLS A;  4FE3 A;  3WK5 A;  3K4G A;  2JH1 A;  3T5H A;  3ICX A;  1SXE A;  3PSP A;  1S0V A;  4F2R A;  4ED0 A;  2PFQ A;  4NLZ A;  3EUB 2;  2WHE A;  4RQM A;  4FS2 A;  5IIO A;  1QSS A;  4ECV A;  1D8B A;  2KE7 A;  1COK A;  2HVI A;  1BPD A;  3OSP A;  4M04 A;  2Y1I A;  1Z1V A;  2W9C A;  2XY5 A;  1J2M A;  3H40 A;  4TQR A;  1MQ2 A;  2XGP A;  3H4D A;  1RQN A;  2BPF A;  1L3S A;  1NK5 A;  5HHH A;  3AQF A;  3MDA A;  4RNN A;  2AH5 A;  3OTQ A;  3TAD C;  3QU9 A;  5KT7 A;  2QKQ A;  3UMG A;  9ICH A;  2YTU A;  3NVW A;  2HBK A;  3TAR A;  3D2Q A;  3KTQ A;  2LBO A;  2P66 A;  1N63 A;  2JZB B;  4IQT A;  2XVT A;  2OCE A;  3GV8 B;  5KFK A;  3RBD A;  2GWS A;  4MF2 A;  4G9B A;  4M47 A;  4KLF A;  4OO1 J;  3NAS A;  1ZQZ A;  3BDP A;  2AGP A;  4BUG A;  4F72 A;  3UXN A;  5J0U A;  2PMZ F;  5EE1 A;  2DL0 A;  4AP9 A;  2Y1J A;  1HUZ A;  2YMQ A;  4KLD A;  4PHE A;  3C5F A;  2DPJ A;  4KLL A;  3ZD9 A;  8ICR A;  1BPE A;  3MGI A;  8ICK A;  1FFV A;  3GIJ A;  3ALR A;  2KSO A;  3RRH A;  4BDP A;  2I5H A;  4DL2 A;  5JUM A;  3TQ1 A;  2QAR B;  4QW9 A;  3DDH A;  5KL8 B;  4Q43 A;  1L7O A;  5KFB A;  4JK1 A;  3TAN A;  5DG7 A;  4Q8E A;  3HT3 A;  2OXO A;  4Z6D A;  5J8Y C;  1FEZ A;  1RYU A;  2FDR A;  1S77 D;  2P6U A;  4F8R A;  4GLX A;  2IHM A;  2KNJ A;  1NK9 A;  3C2K A;  3TFS A;  4ED2 A;  3MR2 A;  5AK3 A;  1SL2 A;  2W9A A;  5AM3 A;  2CN1 A;  2ZIV B;  1QH9 A;  1ZQS A;  4ECQ A;  4C7Y A;  4GC6 A;  4DLG A;  1NJW A;  4UB3 A;  1BPX A;  4EBE A;  1XSL A;  2EH9 A;  5CB1 A;  5AKH A;  1ZQO A;  1UCV A;  5J2C A;  4KLQ A;  1KN5 A;  2JMG A;  2HHT A;  5KT2 A;  3Q8K A;  4YQW A;  3M9O B;  2ZIU A;  2KZZ A;  1Q46 A;  2K60 A;  4NY8 A;  4TUQ A;  1ZQC A;  2HHU A;  2MRL A;  4M9N A;  2P35 A;  3NGD A;  4YCX A;  3T79 A;  1JMS A;  3RJJ A;  4J9L A;  1DK3 A;  1MSW D;  4Z6F A;  4K4G A;  4MEX A;  3RJF A;  1PK1 A;  2BR0 A;  1X6I A;  2RRD A;  3ZDB A;  4QWB A;  2H3V A;  3PO5 A;  2FI1 A;  4ECZ A;  1RG6 A;  3KHL A;  2W9B A;  1XWL A;  2RHF A;  1V85 A;  1SZP A;  5KFJ A;  4PH5 A;  1ZD5 A;  1LKY A;  5CA7 A;  2NRW A;  1IIP A;  4J9S A;  4F50 A;  1NKE A;  2NRT A;  4R66 A;  3L5K A;  3BQ7 A;  1H38 A;  1S0O A;  3TFR A;  1ZQX A;  3RB4 A;  3C1Y A;  4C8N A;  3Q8Q B;  3GZF A;  8ICM A;  3IDW A;  2PFP A;  1B0X A;  3HKZ C;  4DFM A;  9ICC A;  3QEA Z;  5ALL A;  3A0B U;  4QWA A;  5AK5 A;  4I2F A;  2W9C B;  4EZ9 A;  4PPX A;  2FJ6 A;  4UAT A;  5AM1 A;  4JV1 A;  5ALI A;  3ZD8 A;  5DGA A;  3TKA A;  2H5X A;  4IR1 A;  2E8P A;  1ZQU A;  3NRW A;  1RDF A;  5L1K A;  2AQ4 A;  5J0S A;  1ZQD A;  2LMR A;  1HUO A;  3CW2 C;  3WKE A;  2ZXI A;  1O08 A;  1ZQY A;  2XY6 A;  1L8L A;  5KFZ A;  5J2F A;  2QB1 A;  2KIC A;  5AI0 A;  4J9Q A;  2C2D A;  4B9M A;  4USA A;  4B9N A;  4F4Y A;  3OHB A;  1RYS A;  1F0M A;  2K4H A;  2OYY A;  2JV3 A;  5G5H A;  9ICR A;  5AM5 A;  5J2H A;  3GFK B;  4AYB C;  2Y0S F;  7ICF A;  4LVS A;  1X9X A;  1P7D A;  2YB1 A;  1ZQT A;  1Z3E B;  2BDP A;  3JPR A;  4U7C A;  3LDA A;  4Y2V A;  2K8B B;  3UMC A;  4PGX A;  4RPX A;  5G5G A;  2JEG A;  4YN4 A;  2HSZ A;  2EQY A;  4J9P A;  2ES6 A;  9ICP A;  4Y2Q A;  4YG2 A;  9ICF A;  5CRX A;  3D6J A;  2NO5 A;  1L3U A;  3Q8S B;  2KSO B;  2A1J B;  3T5K A;  3K75 D;  3JPP A;  5ALW A;  2ASD A;  4PZO A;  3IV6 A;  1ED1 A;  4M6W A;  4IRD A;  2ZIW A;  3PW7 A;  7ICN A;  1SIJ A;  4Y2R A;  5KFM A;  2WTF A;  2I9G A;  8ICX A;  1Z4N A;  3HWT A;  2BPC A;  4KX3 A;  1SKW A;  3SZ2 A;  1BPB A;  3IP4 B;  2KJ9 A;  2NYV A;  2BCQ A;  4YXM A;  3NVY A;  3SQI A;  4NJ8 A;  4M9H A;  1CUK A;  8ICJ A;  1DXS A;  4CNQ A;  3WKB A;  1T3N A;  3AEV A;  2KIW A;  4JMU A;  2B0C A;  3WK9 A;  4CF4 A;  1KFD A;  2KOB A;  4US9 A;  1AQ6 A;  3V72 A;  1S0M A;  7ICE A;  4LZD A;  4RZR A;  1XSP A;  4F3O A;  2WAQ F;  1U48 A;  1M6Y A;  3FDS A;  3IM1 A;  4C7Z A;  1HJP A;  4DLE A;  3PST A;  3VCB A;  1NKC A;  1TAM A;  4IC9 A;  1NNL A;  1KTQ A;  4YR2 A;  4ECX A;  3NS1 A;  1IM4 A;  4MHV A;  2HHQ A;  4P0P A;  5J0Q A;  2D6F C;  2ZIU B;  5F3X B;  2JXJ A;  1SWW A;  3M7D A;  2KK0 A;  4ECT A;  5KFA A;  3HX0 A;  1TVA A;  2HDO A;  2YQE A;  8ICH A;  1WWV A;  5TIS U;  1L3V A;  4GXK A;  2K8A A;  2YMM A;  2MAX A;  3FAH A;  2W9B B;  2RP5 A;  1X9S A;  2K4I A;  4RQ3 A;  4B9V A;  3GQC A;  1Y88 A;  2A3V A;  5J0R A;  3WKA A;  3Q8M A;  5KAF U;  5AI8 A;  4PHA A;  1JX4 A;  5ALG A;  4RNM A;  5E79 U;  5ALZ A;  2AHO B;  1NOM A;  3F53 A;  3F2D A;  2ZUD A;  4ELT A;  5J29 A;  5AIA A;  2Y9T A;  4FO6 A;  3ONN A;  8ICZ A;  1SWV A;  1B22 A;  2W11 A;  3KFU F;  1SV0 A;  4PGQ A;  2PI5 A;  2LYH A;  4DFJ A;  3RF9 A;  5CJ7 A;  2XID A;  4NXZ A;  3KBB A;  2E5S A;  4US8 A;  3RJH A;  4IQW A;  7ICO A;  1ZJM A;  2WB1 C;  2EZX A;  3N4M B;  7ICJ A;  4OJ6 A;  2EZZ A;  4UB6 U;  1ZQH A;  1T7P A;  3OPX A;  1K1Q A;  4CE6 A;  2BDU A;  3SV3 A;  1NJX A;  3C23 A;  2DKX A;  3M8S A;  2XCA A;  5EE9 A;  9ICQ A;  2GO7 A;  2DQN B;  3KKA A;  3WK8 A;  3B0X A;  2JEI A;  2W7P A;  2HVH A;  2PI4 A;  4RT3 A;  2H3I A;  3QUC A;  4I2E A;  4QZB A;  4EX6 A;  3M8R A;  1X6J A;  1T94 A;  2HHX A;  1U47 A;  5D49 A;  2RDI A;  1TKD A;  1V97 A;  4F92 B;  2H3Z A;  3SAG A;  1XO1 A;  5HMM A;  3GII A;  2UVW A;  4M6W B;  4J9K A;  2ZIW B;  3H4B A;  4KLO A;  2BZF A;  5JRT A;  2KHV A;  3WK6 A;  5DQI A;  1RM6 C;  5ALO A;  4OCZ A;  4JUZ A;  4FBU A;  4TUS A;  5KG7 A;  5IIN A;  2OH2 A;  5AKL A;  3BZK A;  4NM1 A;  5CWR A;  3OJU A;  2ASL A;  4I2H A;  2AJQ A;  4IQV A;  4NWI A;  4CRX A;  1SZH A;  5DQG A;  5KT3 A;  4DFD A;  2BCS A;  4YVZ A;  1TAU A;  2C28 A;  4CF5 A;  2QB0 A;  5J2D A;  1ZYQ A;  1OUQ A;  8ICY A;  5IIK A;  5A0L A;  5AKK A;  4XQ8 A;  4QW8 A;  3F2B A;  3KOO A;  4P0P B;  1SV4 A;  4I2G A;  1L8O A;  5KFN A;  3I1Y A;  5AKG A;  1IXR A;  5DLG A;  4EZ6 A;  1RQL A;  3UQ0 A;  1U9L A;  3ED5 A;  2FMQ A;  3MR5 A;  1ZD3 A;  2YY6 A;  3F2C A;  1PVR A;  4QWD A;  4CDG A;  4P4P A;  2E8N A;  1ZQV A;  1QQ6 A;  4UB4 A;  3OGU A;  1ZQP A;  1FO4 A;  3ZDD A;  3BZC A;  3QX7 A;  3GU3 A;  4I2B A;  2VJ4 A;  1RZT A;  4WJ3 B;  2HBL A;  4IL6 U;  1ZQK A;  1ZJN A;  2E1F A;  3B0Y A;  2EAN A;  3C5G A;  4P0Q B;  3H0M B;  3BS5 A;  4DFK A;  2BGW A;  1SKS A;  4NL9 A;  4ECS A;  2BPG A;  3H8M A;  2EAM A;  2P6R A;  4UAW A;  1Z19 A;  9ICU A;  4P4O A;  2OHF A;  5AI6 A;  4XUS A;  4UW9 A;  2PXI A;  4J03 A;  5DGB A;  3ETL A;  4Y2S A;  2JR5 A;  5EE3 A;  3TI0 A;  5J2E A;  4QZE A;  3I28 A;  2BQ3 A;  4DL3 A;  2A1J A;  1DRG A;  3LYS A;  2W8K A;  4IQU A;  4DSF A;  2LI6 A;  5KT5 A;  4DF8 A;  5HNK A;  3ZI4 A;  2BQR A;  5KFO A;  2R8I A;  2HCF A;  2KG5 A;  3OSN A;  3UXO A;  5KFF A;  5KTQ A;  2XY7 A;  1B4F A;  1SL1 A;  5J0W A;  5H2F U;  5KFP A;  4O3N A;  4BWJ A;  2JEJ A;  4BXO B;  4O3M A;  1UT8 A;  4KLM A;  3PW4 A;  1UT5 A;  2KMD A;  2YB4 A;  3AUO A;  3DEE A;  1HIW A;  4RNO A;  1QSY A;  4NLK A;  5KFC A;  9ICW A;  3LK9 A;  2BHN A;  3QZ7 A;  4NM2 A;  1ZRM A;  1ZQB A;  1D8L A;  3RAQ A;  2PFO A;  4JB3 A;  5AIB A;  3ETR A;  4J9O A;  1ZD2 P;  4O9M A;  3QXG A;  3MR6 A;  5J2I A;  2DGZ A;  3RR8 A;  3MBY A;  4QIW F;  5ALU A;  1DGS A;  4O3O A;  1J2N A;  4QZG A;  4KN7 A;  3PVX A;  1Q8K A;  1FIQ A;  4DL6 A;  3QNM A;  1Q3U A;  3IG5 A;  3AN1 A;  2ZJ5 A;  2YML A;  5AK6 A;  2BCR A;  1BGX T;  1WCL A;  1RYR A;  2UVR A;  4O3P A;  3N7P D;  4DSL A;  1NZB A;  2WF9 A;  2W54 A;  4MFA A;  4DOA A;  1NK0 A;  2Y9U A;  4JWN A;  4RUC A;  1PK3 A;  2JEF A;  4B9L A;  3PML A;  2XGQ A;  5KFX A;  2EAP A;  1TFR A;  1ECW A;  5EOZ A;  4DOC A;  2ESE A;  2F8L A;  3RJI A;  1KFS A;  4I29 A;  2KV2 A;  3NVZ A;  5L1I A;  2FE9 A;  4Y2J A;  5KG5 A;  3NTU A;  3RJK A;  9ICG A;  2QB0 B;  2DF4 B;  1U49 A;  5KFE A;  1S10 A;  1D8Y A;  7ICT A;  2ZG6 A;  3RB0 A;  3TAP A;  2R18 A;  5DDM A;  4RQ0 A;  1QTM A;  9ICX A;  3QU2 A;  2FPK A;  3E58 A;  3TAD A;  5KT6 A;  5T14 A;  4M9J A;  8ICC A;  3KD3 A;  2KP7 A;  4ECR A;  4F5O A;  2IA6 A;  2EDU A;  2XCP A;  4GIB A;  4QZA A;  4C8M A;  3C2M A;  5AI5 A;  2AQ0 A;  5EWG A;  2MSN A;  3SEN A;  7ICU A;  4YD2 A;  1L5U A;  5C0Y A;  1PUZ A;  4PJ0 U;  5KFH A;  1ZQN A;  3RH4 A;  3WK4 A;  5AM2 A;  5HR7 A;  3SAH A;  4BX9 C;  4CF3 A;  1ZQ1 C;  2WF6 A;  4C4S A;  2FLN A;  4LJX A;  4EBD A;  3QU7 A;  5L1M A;  3UQ2 A;  5EE0 A;  2HOF A;  2RLT A;  1N5X A;  4ELV A;  4KLE A;  3BJY A;  3SMV A;  4MFC A;  3BS5 B;  1UA0 A;  3FYH A;  3PX4 A;  1U4B A;  3RJE A;  1NKB A;  8ICW A;  4FBT A;  5J8Y A;  3TAC B;  3KZX A;  3RH6 A;  3QU4 A;  1PVP A;  3LWL A;  4QWE A;  2I6X A;  2Z7J A;  2NRX A;  5GTI U;  8ICL A;  1N5W A;  1OXJ A;  1XU4 A;  3LVV A;  1FFU A;  2W8L A;  4OD0 A;  1WG8 A;  4DOB A;  3RRG A;  4B9U A;  1KBU A;  5ALT A;  3AM9 A;  2BCU A;  4NLB A;  2J6U A;  1L7P A;  2KKV A;  1L3T A;  3G6Y A;  3A0H U;  5HHI A;  2G5H B;  3GV5 B;  2H3F A;  2Q0Z X;  2AGQ A;  4GXJ A;  3D2N A;  3KZI U;  3PY8 A;  5J0X A;  2VKQ A;  4EEL A;  2YN4 A;  5KL1 B;  2BCV A;  1SGG A;  1NZP A;  1A76 A;  4ED3 A;  4O3S A;  1S8O A;  4DQQ A;  3HP6 A;  2XIC A;  1S9F A;  5IIL A;  4DQR A;  3Q8L A;  4DSK A;  4IRK A;  5B66 U;  3KHH A;  4OJ5 A;  4F4Z A;  1ZQE A;  4ED8 A;  3C29 A;  4QNL A;  4BGD A;  5D4B A;  4EYH B;  3EZ5 A;  4O0I A;  4GFJ A;  2ZIX A;  5DDY A;  1DGJ A;  1Q3V A;  5ALK A;  4R63 A;  4Y2X A;  3UM9 A;  2NRZ A;  2AXT U;  3PW2 A;  3NRZ A;  3NUQ A;  2KZM A;  4ED1 A;  4M0A A;  3R9K A;  4FZM A;  2W9M A;  1TK0 A;  3SR6 A;  4G3I A;  3EW9 A;  4RQ8 A;  1D9D A;  4KIT B;  1N2X A;  7ICS A;  4B6J A;  2PMZ C;  2O6K A;  3EWA A;  2C2R A;  4BJQ A;  2DFL A;  5DQH A;  2ODG A;  3AU2 A;  2R8G A;  1QLN A;  4F5N A;  3EYZ A;  2ATL A;  1QQ7 A;  1XSN A;  1D9F A;  2K4P A;  5KG0 A;  4O3R A;  1CEZ A;  3T5J A;  1YZ7 A;  2UVV A;  2FLL A;  4E0D A;  5DG8 A;  2KJ5 A;  5L1L A;  1ZQL A;  2C2E A;  1COO A;  4GXI A;  4M9G A;  5D46 A;  3PX0 A;  3MGH A;  2A19 A;  5IIM A;  3MDC A;  1JI7 A;  1NK6 A;  2JHD A;  1SKR A;  2DPI A;  2ZTE A;  4P0Q A;  1X66 A;  1S0N A;  5JU5 A;  9ICT A;  3WK7 A;  1RPL A;  5K4L A;  4F2S A;  2F2A B;  3C1Z A;  1QQ5 A;  4EYI B;  2MA1 A;  9ICS A;  2EZY A;  4YMN A;  4ICA A;  3G6X A;  3H7I A;  4FZN A;  4UAS A;  4DQS A;  1IG6 A;  2OM6 A;  3RFA A;  3HJE A;  4YMO A;  1ZET A;  2W03 A;  4R8U A;  2F1H A;  2EAO A;  3QUT A;  5B5E U;  8ICE A;  8ICF A;  1CRX A;  5J2K A;  1X2I A;  1K1S A;  1Z00 A;  4O5K A;  2J6S A;  4XRH A;  5ALH A;  2GOL A;  5KFU A;  1ZQI A;  1C20 A;  1C7Y A;  1TK8 A;  5GTH U;  4BXO A;  7ICI A;  8ICB A;  1JXE A;  2IOH A;  3QU5 A;  4F5P A;  4UB2 A;  5IIJ A;  4QZ8 A;  4JWM A;  3DV9 A;  4RPY A;  9ICA A;  5ALE A;  3V7J A;  1A0P A;  4QZH A;  3GV7 B;  8ICQ A;  1X9W A;  2FMS A;  5J2G A;  4F71 A;  5JTI A;  4KLJ A;  2NRV A;  3M6K A;  4UAZ A;  1XNS A;  1L7M A;  3HKZ F;  1TV9 A;  4QWC A;  1Z1B A;  1JIH A;  3H8S A;  2GLE A;  1B43 A;  1UPH A;  4KLI A;  2HI0 A;  3UPQ A;  3SV4 A;  5AKI A;  2HHW A;  3UXP A;  2W55 A;  4O3Q A;  1LV5 A;  5KFS A;  4EEN A;  4DWI A;  3N28 A;  3LVW A;  2KFZ A;  3WKD A;  4C8K A;  4JV0 A;  4TQS A;  1HEK A;  5J2B A;  3V6J A;  2E8O A;  1NJY A;  3ZDC A;  2IOF K;  2KZ3 A;  8ICT A;  2G09 A;  7ICH A;  2YMP A;  4QZF A;  4DF4 A;  3LWM A;  8ICS A;  5J2J A;  3PR5 B;  2HOQ A;  3CRX A;  2KTQ A;  2MU2 A;  3S6J A;  1MA7 A;  4NV0 A;  5ALY A;  5KFY A;  3RB3 A;  1SL0 A;  3IHQ B;  2ZIX B;  2KJ8 A;  3FM9 A;  1DOQ A;  4Q45 A;  9ICB A;  1NK4 A;  4CCH A;  5DB6 A;  1URJ A;  4Y2Y A;  1JAL A;  2Y0S C;  1JUD A;  3H8J A;  5AI9 A;  3MC1 A;  2DKZ A;  5AKZ A;  1YT3 A;  4TUP A;  2AGO A;  4QZ9 A;  4YR3 A;  3RAX A;  5CEH A;  2FMP A;  2W3S A;  3WU2 U;  4DEZ A;  5ALD A;  1MQ3 A;  4PHD A;  2FLP A;  5KFQ A;  4DQP A;  2IMW P;  4F93 B;  4A8E A;  2AU0 A;  2VA2 A;  2JGA A;  2F76 X;  5KFI A;  3BQT A;  5ALX A;  1MC8 A;  3J81 j;  4DS4 A;  4PL1 A;  1KW4 A;  3NVV A;  2IBK A;  3SEI A;  1GO3 F;  4RQ6 A;  5DB8 A;  3L4P A;  2OEH A;  7ICV A;  2HMX A;  1RXV A;  1ZRN A;  4KMU A;  2G5I B;  2CRX A;  4C4R A;  1ZOL A;  4RQ4 A;  1T8E A;  3M6Z A;  2ISP A;  1XO0 A;  2M0N A;  3C2L A;  4KN4 A;  1ZQA A;  4K4H A;  3RBE A;  2HW3 A;  1NK7 A;  1JRP A;  3RJG A;  1WCN A;  1QCK A;  1LVH A;  4DSE A;  2F77 X;  1N62 A;  2VJ5 A;  4O5C A;  2WAQ C;  5J0T A;  1UHU A;  5KFT A;  5CP2 A;  3HIL A;  4R8U B;  4NLC A;  1KFT A;  1KRP A;  9ICL A;  5AKX A;  4U6P A;  2H3Q A;  4F4W A;  4DL4 A;  8ICG A;  1Z00 B;  5L1J A;  3QUQ A;  3K1Z A;  2A1A A;  9ICO A;  4F5Q A;  2ZJ8 A;  1X40 A;  3V6K A;  2E1E A;  2N1R A;  4I27 A;  3I76 A;  4UQG A;  3N7R C;  5KG1 A;  4FFD A;  4PL2 A;  4KLU A;  2FPL A;  4OJP A;  3GIM A;  1RXW A;  4C80 A;  2C22 A;  2XC9 A;  2F8K A;  3UMB A;  9ICJ A;  4J9N A;  2RDJ A;  8ICO A;  5DKW A;  1F5S A;  5KFG A;  2ALZ A;  5AKY A;  3PV8 A;  5KFL A;  2K8C B;  2R8J A;  4I28 A;  9ICM A;  3MGV A;  2KKP A;  2DWQ A;  2E3T A;  3HRD D;  1LB2 B;  4RQN A;  4P4M A;  2G08 A;  3HW8 A;  3EPI A;  3SD7 A;  3IRU A;  5ALV A;  4YMM A;  2E8M A;  4KX5 A;  4NLN A;  3ISC A;  4RQ1 A;  1A77 A;  3MFH A;  3C21 A;  3H0L B;  9ICN A;  1JXL A;  5AM4 A;  2ZUC A;  4YXJ A;  2WB1 F;  4IS7 A;  5AI4 A;  5KG2 A;  3RR7 A;  4DQI A;  3EPG A;  4RPZ A;  3L3F X;  2JRZ A;  5ALF A;  4JV2 A;  1WWU A;  3RB6 A;  3TAQ A;  3T3F A;  5J0Y A;  3C28 A;  4UBB A;  2LPE A;  1V9P A;  3H8W A;  1SXD A;  3V7K A;  2CXY A;  7ICG A;  3M9N B;  3JPT A;  2D8C A;  4Z6E A;  3Q8R B;  2BQU A;  4DL5 A;  4BWM A;  4UAU A;  8ICV A;  2CPR A;  2W3R A;  4M2Y A;  1L7N A;  1KSP A;  4B9T A;  3VC8 A;  5HR6 A;  2G0A A;  1CI4 A;  5KT4 A;  8ICA A;  4MF8 A;  2PKE A;  3AL0 B;  3QZ8 A;  4O5E A;  2KHQ A;  5AIC A;  4FS1 A;  5DB9 A;  1ZQW A;  1K5O A;  3PO4 A;  2K89 A;  4B9S A;  5L9X A;  5CHG A;  2KD1 A;  2Q4T A;  2WF7 A;  5F9L A;  3E0F A;  4EEY A;  2HBM A;  4ZOH C;  4Y2T A;  1QSL A;  4Z6C A;  4ED6 A;  1OW5 A;  8ICP A;  3GIK A;  4UB5 A;  1NK8 A;  3OJS A;  4YD1 A;  4GC7 A;  3O0F A;  5ALR A;  4RQ2 A;  3PX6 A;  4UAY A;  3GDX A;  3FC4 A;  1N61 A;  4C8O A;  1TE2 A;  2BKE A;  2W04 A;  4ELU A;  7ICP A;  3N7S C;  3ISD A;  1JRO A;  2D3D A;  1Z4O A;  1XS9 D;  4C0Z A;  2UVU A;  4RQ5 A;  3KHG A;  3ISB A;  2JH7 A;  9ICK A;  2LYA A;  1NI3 A;  3JPN A;  4LZG A;  2WF5 A;  4ECU A;  5KG4 A;  3B9J A;  5ALM A;  2ASJ A;  2ZJA A;  3IG8 A;  4Q8F A;  4YP3 A;  1WYG A;  1BNO A;  3PW0 A;  3M1Y A;  4R65 A;  3THV A;  4RU9 A;  1JN3 A;  4OJL A;  3PSF A;  4K4I A;  1X42 A;  2K4E A;  1YZ6 A;  3JPQ A;  2OWO A;  5DBA A;  3BQ2 A;  5III A;  1SV0 C;  1VJ5 A;  2KVS A;  3SI8 A;  9ICV A;  4YFK A;  2VAN A;  3QE9 Y;  2B21 A;  3KHR A;  1KDH A;  3PNC A;  4DFP A;  3G6V A;  4F5R A;  5HP4 A;  3F5A A;  3IN5 A;  3PMN A;  3ZDA A;  5KFW A;  4IRC A; 
#chains in the Genus database with same CATH homology
 5K4L A;  4LJX A;  2OEH A;  1RYU A;  2YQE A;  2CXY A;  2EH9 A;  1C20 A;  1KQQ A;  5CEH A;  1IG6 A;  2JXJ A;  1KN5 A;  2EQY A;  2JRZ A;  1KKX A;  2LI6 A;  2LM1 A;  2RQ5 A;  2KK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...