4KX3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with thymidine monophosphate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Structure of murine cytosolic 5'-nucleotidase III complexed with thymidine monophosphate
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4kx3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4kx3A01
1J97A 4UATA 2OA0A 1Z5GA 3U26A 5E0OA 3HYCA 3SMVA 5AESA 5AI8A 5ALHA 5ALLA 2HSZA 5AICA 4FFDA 1XVIA 2HX1A 3A1EA 2ZBEA 3WKBA 3ZWDA 1YDFA 3MPOA 4EZEA 2WF6A 3L0BA 1SU4A 4C4RA 2HF7A 3KZXA 4AP9A 4DFDA 4YIKA 3ZTYA 3AR3A 3KC2A 5ALXA 2FPSA 4XE5A 5ALEA 4OD0A 2FI1A 1L7MA 2WF8A 2EAUA 4G9BA 4IFTA 2JAUA 4GIBA 1NNLA 1XP5A 3OCWA 1Z4IA 3L0CA 3SHQA 3WK6A 2YY6A 3OCUA 3U19A 3QUQA 1RMTA 4E88A 5A3RA 2FPRA 2HHLA 5AK3A 4BEVA 5ALVA 4ZEVA 2OBBA 1F5SA 1AQ6A 4UM5A 1XPJA 2IA5A 2GMWA 5ALYA 4DW8A 1Z4NA 1RKVA 1QQ5A 1Z4LA 2YMQA 3IJ5A 3WK5A 1WPGA 4J03A 5IS2A 2NO5A 3EF1A 3UMBA 3WGUA 1RLOA 1RMQA 3QUCA 5AW5A 5AVVA 2YMPA 3ZVLA 3KD3A 1Z5UA 5ALFA 3MN1A 2GO7A 4MUMA 3E8MA 2GFHA 3BWVA 5IT4A 5AW0A 3OCVA 4KX3A 4HGNA 5T41A 2G06A 2W4MA 1MH9A 2CN1A 2RAVA 4OFZA 2ODAA 3L0YA 3QYPA 4I9FA 5AKHA 1TE2A 5AM0A 5ALWA 4CF3A 3PGVA 1CR6A 2HF2A 4C4SA 1Z88A 1RDFA 1QQ7A 2YJ5A 3I28A 4UMDA 1TA0A 3B9RA 4XPZA 4YGYA 5ALQA 1WZCA 4DCCA 2D2VA 1EK1A 4AS3A 1SWWA 5AVYA 5AM3A 3R09A 1JUDA 3ZX4A 1WVIA 4BX0A 2I55A 2ZBFA 4HGRA 5AKYA 4YCMA 2C8KA 1ZJJA 2VKQA 2I6XA 2DQSA 2R8XA 4HGPA 4UMEA 1RQNA 2G08A 5ALUA 3PCTA 1Z4OA 1ZOLA 5AVSA 3A3YA 5AVXA 4KNVA 3RF6A 2G09A 2EARA 1VFPA 4KNWA 1YJ5A 3IB6A 1Y8AA 5ALSA 2WF7A 3DDHA 5AK4A 5AKXA 4NV0A 1ZD2P 4UASA 1J8DA 3ZI4A 1RLMA 3M9LA 3U7HB 3CNHA 3AR5A 3L8EA 3WK4A 1ZD3A 3AR9A 1RQLA 1WR8A 1L6RA 1U2SA 1ZRMA 3EWIA 1ZD4A 3A1CA 1KYTA 2B30A 2IOFK 4UM7A 2FDRA 3SKXA 4EX6A 4YCNA 4ZEXA 3E84A 3OPXA 3NRJA 2IOHA 5ALRA 1ZD5A 2ZXEA 4O8CA 2IOFA 3AR4A 3ET5A 4EELA 5AVRA 4Y3UA 3RFUA 3W5BA 5AHXA 2RB5A 2MSNA 4J2TA 3U7GA 2MU1A 5AVTA 4MWOA 2FPXA 4L6CA 1NRWA 4QQFA 1N8NA 4UU1A 2WF5A 3U7EB 4UAUA 4JB3A 3NASA 1SWVA 2B8JA 4BNDB 3MMZA 2BDEA 3FPSA 3ONNA 5AI5A 2QYHA 1CQZA 4HAIA 4Y2XA 4RETA 5ALKA 4NABA 2NO4A 2FUCA 1YMQA 3ZX5A 4IG4A 4BNDA 5AKJA 3U13A 4L6AA 2AH5A 1YNSA 2YMLA 1L8OA 5AK5A 3SKYA 5AVUA 3K1ZA 4YCLA 3ZWKA 5FP0A 2FPUA 3L1UA 5ALDA 3UMCA 1O08A 2JAOA 3QU5A 1EK2A 2HCFA 2YJ6A 4L57A 5AKGA 2P9JA 3TLMA 3I6BA 4UARA 3DNPA 1RKQA 4XQ0A 4BBJA 5AVZA 3OTQA 3MC1A 5ALJA 5ALIA 4CE6A 4UMFA 3R9KA 2PQ0A 3I76A 2QLTA 2B82A 1VJ5A 3QU2A 4F71A 1U7OA 3D6JA 2B1QA 3QU7A 3W5DA 2RBKA 1X42A 5AM4A 2YBDA 3F9RA 1L7NA 3NIWA 3QUTA 2YMMA 3N07A 2ZOSA 3FPBA 3W5CA 4KX5A 2P11A 4NFLA 4ZEWA 5JJBA 1RPZA 2B8EA 5AW1A 3ZVMA 4YH1A 3WK9A 4EEKA 5AIBA 3E58A 2W11A 1ZRNA 2GHQA 1U02A 2R8ZA 2Q4TA 2Q4RA 4HYTA 5ALNA 3OCXA 2HEGA 5AKIA 2IYEA 5AVQA 1U7PA 5A3QA 1RRCA 2W43A 1S8OA 1VJRA 3FVVA 3UM9A 5AKKA 5AW4A 4B6JA 3KOOA 3E81A 3OCZA 5AKEA 2Q5EA 4UAVA 1Q92A 2RARA 1ZS9A 3N5KA 1Z4JA 1T9ZA 4G63A 4F72A 1K1EA 1YV9A 1Z4QA 2AGVA 2AUTA 3L7YA 1Q91A 3J7TA 3EF0A 1IWOA 3WKDA 2CFSA 3BA6A 4CF5A 3W5AA 3I1YA 5ALMA 1TJ4A 3IRUA 1O03A 2WFAA 1FEZA 4JDPA 2R8YA 2BDUA 4Y2YA 4Y2QA 1L7OA 3R4CA 5AI0A 3QNMA 3L5KA 2I7DA 3B8EA 3FM9A 3EPRA 3L8FA 3OCYA 3NALA 5AI9A 4BYGA 3U7FB 4UW9A 2C88A 1RKUA 3KBBA 2C9MA 3NANA 4HGOA 4Y2UA 4Y2VA 4FYPA 4BKMA 3QXGA 2NYVA 2AMYA 5AM5A 1L8LA 3M1YA 1NF2A 5AW2A 3N28A 5AW8A 5IT0A 3DV9A 1T5SA 2YJ3A 4NWIA 2P27A 3AR8A 3WKEA 1QQ6A 3WKCA 2G1AA 2B1RA 4NAVA 5AI6A 2O9JA 1RLTA 2FPWA 5ALPA 5ALOA 2BY4A 4Y2RA 1QYIA 5A3SA 4BEWA 1LVHA 5AW3A 3PGLA 3QU9A 4DWOA 2YFYA 3L1VA 4I9GA 3QGMA 4EENA 3SD7A 5AI4A 2FEAA 2YJ4A 3N8GA 2EATA 1YS9A 3N1UA 1TJ5A 1Z4KA 3ZUPA 2WF9A 2G07A 3AR7A 4YIHA 1S2OA 1TJ3A 2ZBGA 4Y2JA 5AVWA 3PDWA 1L7PA 4OHFA 4XOUA 2PR7A 3WGVA 1T5TA 1N9KA 2WM8A 4OCZA 4Y2TA 3SF0A 4Y2SA 2FUEA 3S6JA 4PNHA 3NUQA 1QH9A 3NAMA 4BX2A 5AW7A 3ZW7A 2HI0A 3ET4A 2OM6A 3WKAA 2YN4A 3QU4A 1Z4PX 3WK7A 4QJBA 1U2TA 5AK6A 4FE3A 2CFRA 5ALZA 3FGOA 4UU0A 3SLRA 3B9BA 4C4TA 3AR6A 3L8GA 4GXTA 3FZQA 3HLTA 1RC8A 3ESRA 3QLEA 5AW6A 2C8LA 1LTQA 3QUBA 2R8EA 2CFTA 2JARA 3ZU6A 2B0CA 2P69A 4Y2PA 2I33A 5ALTA 4HGQA 5AM1A 5AM2A 2JAWA 5AW9A 3QX7A 3KDPA 2ZBDA 3DAOA 3ESQA 2JGAA 2HO4A 2HDOA 3A1DA 2X4DA 4RESA 3WK8A 4H1WA 5ALGA 5AIAA 3P96A 4CNQA 4EX7A 5AKZA 4KN8A 3AR2A 4BX3A 2HOQA 2I54A 3ZTWA 3L8HA 3ZVNA 4AS2A 2O2XA 2OYCA 2G0AA 2C4NA 1Z4MA 4UMVA 2WHEA 1PW5A 3GYGA 3VAYA 3CZ4A 1RMYA 2I34A 2PKEA 2GHTA 4CF4A 5AKLA 4KYTA 3UMGA 2ZG6A 2G80A 3ED5A
chains in the Genus database with same CATH superfamily
3BTOA 1XZLA 1SB8A 2CNLA 2FDCA 4M1SA 4KYUA 5ALLA 8ICJA 4UEOA 4IX1A 3N75A 1BJRE 4FR0A 3M0EA 5K0JA 5JLAA 3MVEA 4XE5A 2O6LA 1L7MA 1JJ7A 2EAUA 1KZ4A 2ZJ6A 2GAIA 4O02B 4A8PA 3C3CA 3K31A 2A5FA 3T7CA 3CJTA 4UM5A 2N42A 3E9DA 4YJ2B 4DIEA 5L9AA 3L0IB 2VQ3A 3VU9B 2ZRNA 4NDNE 2OO7A 4UM9B 2ZRLA 3NI2A 3FTEA 1B6GA 5KHAA 6LDHA 2W6CX 3O38A 4EARA 3NBFA 3LM8A 3HBFA 3JASB 3DWEX 4I3FA 2W4MA 1NMXA 2MSLA 2VJOA 4ESHA 2H8KA 1B73A 2WJ4A 5HKLA 2FMIA 2QRNA 5G3YA 1EZ4A 3IB3A 1R4ZA 5TPWA 2I3DA 4EB6B 4DR2B 5LA6A 2YL2A 3F73A 9ICLA 1FXWA 4F2DA 2XOXA 1QZZA 4FZRA 4EL5A 1M2VA 3TI0A 4K6FA 5FTLA 3OZSA 2P6PA 1CLUA 4RD0A 5CW1A 2BWJA 4DO9A 3DFUA 4U2EA 5AK4A 2B6GA 5IIOA 4IV8A 3BS5B 1Z2CA 2FZCA 5E2IA 2XYVA 3OCJA 3PUIA 4UUMA 5CX4A 3OE5A 3AJDA 3WIDA 3K32A 3QFHA 2W6QA 3A6DA 2WNHA 4EATA 3LPLA 1YRHA 1YA8A 3NT2A 1XAGA 4URVR 2NPFA 1CUAA 1GTMA 4F4XA 3T7AA 2UYGA 1T2FA 1SH7A 1F51E 5F1OA 3GLTA 3E2EA 2Q8NA 5JNWA 1NP7A 2J5BA 4LXUA 1EE9A 4LSZA 3B1KA 2QR3A 4FMDB 3TFQA 2OP0A 3OTIA 4KDEA 3CEPB 4MS3A 4V24A 3G6YA 4HK4A 2G6TA 3CZCA 3C24A 3WIOA 2NT4A 1KVQA 2VAPA 1FLNA 4UMFA 4KXMA 1L5SA 3ISBA 2CJPA 3BZCA 3B1WA 1PSDA 3V8PA 1T8EA 1ZO8A 2ZWIA 1AH2A 2QZZA 3HYNA 2W9XA 4IIXA 2HRBA 4HOYA 3MSCA 3H2YA 1OI4A 4HTAA 2EFCB 3VNVA 4JLVA 3DO6A 4L3WA 3IM1A 1U0NA 2OOKA 1OY1A 1CY0A 3LW8A 1PZHA 4QRHA 5KFVA 3IURA 4CF5A 2AKEA 4K9OA 1UEJA 1Q6YA 4JK3A 3O84A 5DDMA 1NK7A 3R4CA 4M0PA 3SX0A 2VDUE 1N0UA 5LKRA 4P33A 2JLWA 2OD2A 2K89A 1C1YA 3EULA 3CNOA 3VR5H 3G7SA 3WYEA 2JJYA 2ZTLA 2JC3A 4Y2RA 1QAOA 1U28A 3IPCA 4ZMSA 3H5NA 4RH1A 4U7CA 4J0IA 4YS6A 4N54A 4B0OA 1HE5A 1MVLA 4WBSA 1G8SA 5AWFC 2AOUA 4E11A 1GNLA 1ZW1A 4IRMA 2JIZA 5KT7A 4G5SA 1VSVA 4V39A 1GOTA 1G5HA 3HGMA 3JQ6A 3MABA 1J00A 4JLPA 3UXEA 4QO7A 2NSYA 2XZLA 4U7WA 1F3OA 3SAJA 5FFMA 2AEEA 4PGYA 3BPSA 2ZIWA 2ACKA 2J0SA 4RK6A 4IIVA 2VNHA 1PS9A 3SSMA 1FFDA 1XZHA 4QOGA 2O8VA 1LI7A 3K0EA 1KEWA 4KXUA 4D3DA 2IDMA 3IV7A 3LJKA 4JIMA 4D0SA 1KEPA 3GJXC 1OIWA 1Y9AA 2LCFA 5SY4A 1QFYA 1FFVA 2CYCA 1LD3A 2YHUA 4PXYA 1UDWA 1T4CA 5B6PA 3OHBA 3BXEA 1G42A 4WCFA 1I2MA 3AIOA 4C01A 4RK4A 1LW6E 3P0HA 2VPQA 1Q17A 1Y33E 3TI9A 4KLGA 2NU6A 4C7ZA 3IAM6 1ECGA 3RH4A 1DRWA 1I6MA 4LNHA 3CVXA 2VZEA 4JR2A 4QGAA 4C0KA 2MJLA 3Q7PA 4W63A 3WK5A 1G64A 4FFMA 2CNWA 3HEMA 1GQRA 2Q07A 1TA4A 4YLGA 2ZE5A 1COWA 3HUTA 5B3LA 2O2DA 2AK2A 3OFSA 2IWHA 4A5OA 4OEHA 2C7OA 3TBFA 1BN7A 4GZ3A 9ICRA 1V35A 3JR3A 1WB4A 3CIFA 4ZI7F 3CV3A 3KUCA 2Z2KA 1ZYUA 2ZSKA 1ZJ4A 1FTGA 3K6SA 3RO7A 1SMKA 2VP0A 3VOBA 3WDMA 5BQXA 1GGVA 1QWOA 4PRLA 5BSGA 4IL6U 5GM1A 1GG5A 4UHJA 2P2DA 5IKOA 4B3FX 1ADFA 5H5JA 1R5BA 5T57A 4YQEA 5JZMA 1IHOA 2R1VA 3JQDA 4OHCA 2NMVA 3OIYA 1CVRA 1EVJA 1P0MA 2ZI7A 3ELYA 3MD9A 4RLQA 4IGEA 5HZMA 4ITUA 2QGZA 3TUIC 2H48A 3CUWA 5H4HA 1S3SA 2VWPA 4HWPA 1I6WA 5HDBB 4EYIB 1P8JA 4ZIRA 1J33A 2EKPA 4REQA 1GZUA 4QWWA 4DCTA 3D43A 4GOJA 4RHCA 4D4JA 1RP1A 2FUCA 1GPKA 1TMGE 1CUUA 2EGUA 5HJ2A 4U9HS 2HADA 2PVSA 5F73A 3RU7A 2Y1EA 4GLJA 4NLCA 1IFXA 1RBYA 4WN9A 4AJ9A 1EDEA 2HQOA 1TUGA 1XZCA 3DTVA 2IYSA 3L3FX 1D2AA 4EBCA 2CF5A 1SC9A 2X5KO 2CXUA 2B82A 4WY8A 2A3NA 3JQFA 3KEQA 2P9GA 3W4IA 4R9NA 1L5GB 4LMAA 4CKXA 5KYXB 5FORA 4UAWA 1QO0A 5KFFA 3OHPA 5IXYA 4I55B 2FOLA 3FUCA 2O20A 3UHPA 5EERA 4YROA 4EZ6A 2LDBA 1VE5A 2JHGA 5KYVA 1LJLA 3TLBA 3DAPA 2CMHA 3F5EA 2ZUSA 3HXOA 3C39A 3FNEA 4RVGA 1VBKA 4AWBA 3LLMA 3NANA 1WCWA 3BCUA 5BSEA 4TKUB 3RTBA 4NWIA 3IILA 2NXNA 2VA8A 2E87A 8ICIA 4YP5A 1XZEA 3A1WA 2KJ8A 4X1IB 5AW3A 3EZ9A 1WNTA 2QRJA 5EUQB 4ASUD 1U0HC 4RTKA 4EI7A 3AM3A 1OE0A 2HJGA 2CYAA 3RI3A 1K8XB 1DKPA 3T79A 3OY7A 1SXPA 1YT5A 4JN6B 3JXEA 5JLJA 2IMWP 1T2NA 2V6GA 5AMXA 3WWCA 2PEYA 2PX6A 2AB0A 4IXWA 5LDGA 3EZGA 4M0EA 1KYXA 3MK31 1YZUA 2OC4A 4DQUA 4UPEA 1BGWA 2ZUDA 1QYDA 2VJBA 7YASA 3NYWA 3OPYA 1O94D 1BVSA 3FWNA 5KG0A 1ISFA 4IFIA 1DWUA 2EDCA 2Z4RA 1J8QA 3FPEA 2M6RA 4G4IA 1DBWA 4DM7A 2A4KA 4WDRA 2ENUA 2I6SA 1V43A 3L0ZA 4PWYA 3Q2IA 3TH5A 3D3NA 2Q49A 3I83A 3GYGA 4LJ6A 3MHPA 3H99A 3W06A 1TQ6A 1M0WA 4L07A 3L5OA 4ZPXA 3JARA 5KYWB 2AN9A 6PFKA 4KBYA 1DWOA 1X9SA 3URKA 1IBMB 4PSAA 1AT1A 5LFAA 5DX0A 1EGMB 3TLZA 1AMUA 4UCQA 4G41A 2GBFA 1UJNA 2C3UA 2PYDA 3NTUA 3JQPA 4M1YA 4MWDA 4ZAFA 2FP4B 4U63A 4UHKA 4KKVA 1FDRA 3GLKA 3THWA 1KU0A 4DDMA 3K0HA 5KG1A 1E18A 1U9IA 4CM3A 5K0FA 1W7AA 1EZZA 2D0DA 5IVHA 4BTEA 3WYNA 3OP1A 4X8HA 3Q8XB 1R5NA 3IJ5A 4ILEA 4XGNA 7AT1A 1ZQDA 1GARA 2WUWE 1RWOA 2WB4A 3EGIA 1X7YB 1SQSA 4LJ4A 5CPFA 5CFNA 4DOCA 1ZINA 2Z2JA 4K2AA 4G1UC 3WAKA 4QXOA 3QYPA 5FTMA 1QSLA 3PMNA 2B2XA 3DLPX 1VDZA 3PDIA 4OH1A 3KKPA 3MUOA 1VKHA 4CIDA 3WDLA 1XC7A 2FETA 4JQSA 4AFNA 2DFLA 2VPXA 5IC5A 2AMLA 3WRYC 2QXYA 5JE8A 4GRDA 2G09A 1XQ9A 1O6CA 5AYVA 4PANA 3HFSA 2WM9B 3NOXA 4XWKA 1C0EA 3LAWA 1NJ6A 5CDUA 1KYVA 1Z73A 4U2BA 3A1VA 4UD2A 4FFBA 4ISCA 1P18A 5FPPA 4BQRA 4FBUA 1Y7IA 1SKAA 1A5ZA 4CV2A 2WF5A 4QZFA 1U8AA 1T5IA 5BT8A 3M6LA 2W4QA 4Q15A 3B51X 1J2YA 4JZKA 1G6HA 3G0DA 3U7RA 4P38A 1VIAA 3TS1A 4QAQA 4P32A 4FX5A 2OCBA 4CMEC 1E2PA 5K3AA 4GKAA 5EPOA 2C2OA 4QYTA 2C0QA 5ALIA 2XY5A 5LA6B 2PGNA 3H0KA 1KDOA 1PR0A 2BKEA 4MJ3A 2XRZA 3BAZA 2CCKA 3NDJA 2ZCUA 1NVMB 1YCGA 1Z8DA 3D0OA 1MB3A 1XCPA 1SCJA 1M2VB 4QQNA 2PQMA 3RWOA 4GI2A 5EAIA 4E08A 5JARA 4OGWA 1DQRA 5K0BA 2OHGA 1WXQA 1L4BA 3ECCA 1Q92A 3MRSA 2QSYA 1JQ5A 5H68A 3DC2A 2JD2A 1V1JA 5BYJA 1ZGCA 4AJJA 4HDSA 2BI4A 4F8JA 2QTCA 1S9HA 3JPRA 2FQYA 3T3MB 2H29A 2PRKA 3C6YA 1Y4DE 3NLLA 4W1SA 1GYQA 2C28A 5B4UA 2IP4A 3GH3A 2CFIA 4YUYA 3HJAA 3P0RA 2Q3HA 1XWIA 1LC0A 4LBZA 1PT6A 5F4BA 1Y3AA 3GWZA 2Q3EA 3QE9Y 1GR1A 2VWGA 4LZLA 5C3UA 3FLEA 3L1VA 3MTBA 3F74A 5K0CA 1UJ6A 3A8TA 3QPWA 2G9RA 1ZGJA 1CZOA 1B6SA 3H42B 2VC2B 3RC2A 2ETVA 2ODBA 4Z6CA 5K4LA 5LQRA 1CS4C 5KG6A 1SGWA 3HK2A 2E6KA 2HBRA 3SZGA 4X8MA 3S2IA 4O1HA 1QH8A 4LHYA 3NEAA 1JR4A 3SR4A 4ENSA 1XAJA 2ZPAA 5K3OA 3CVWA 1GO3F 1KJIA 4GQIA 5C53B 2OG1A 4MKHA 3LWMA 1GAWA 3RLFA 1UC9A 3SU8A 3IP4B 4J0EA 3JCZA 2C84A 5KFWA 1CR1A 5H0IA 4AQDA 3QX7A 5LDDC 4FQ8A 3ON5A 3F5MA 3V6LA 2RI1A 5FA5A 4ELUA 5IILA 4IDBA 2YYZA 8ABPA 1II8A 4EVRA 3EAGA 5HRAA 4GAEA 2YWXA 5ADUS 1CQXA 1UBFA 1OC4A 1AK2A 3DL2A 2QLLA 1P8AA 1G2OA 4EHHA 3WLKX 3H5OA 1XVIA 2DT5A 4DBZA 4CHGA 3DWGA 4YPVA 3OPMA 2QTAA 4MP3A 1I5RA 3CFYA 5C7OO 2ATIA 4MI3A 3ELDA 2AOUB 4MWSA 2A9RA 2NT3A 4M1QA 4HLNA 6GPBA 2MYPA 5A3RA 3GFSA 4OHBA 5JCXA 1ZGAA 4BP1A 2JDID 1WSBA 4JVLA 2XB6A 3QZ8A 2QVXX 1P2UA 2BF4A 3EGVA 4NBLA 2QX9A 4S2EA 1C4XA 7ICKA 2ZIWB 3RS7A 1A5BB 1T8UA 3RJTA 2QTVB 2DLCX 2V5VA 3JYHA 1IZ7A 4PVDA 3EXG2 4ZCIA 4EY8A 3D2SA 1XQXA 5DLGA 4Y0NA 4X7RA 1AHPA 2PFNA 1OIVA 4QXPA 3ADCA 4YMSA 4M36A 2V4RA 1G8GA 1OASA 2I67A 1Q1GA 1KYWA 3WFZA 3WLHA 4TYNA 4ZV4A 1DX6A 4ZVMA 1J1ZA 5KL8B 1LB2B 1T4CB 4JLBA 5ARCA 2IGBA 2QROA 4MCAA 4FZNA 2WU0A 3IPAA 1NOMA 4WCFB 1A98A 1U99A 1GGMA 1A2OA 1U2SA 2R7LA 4TXNA 5A5GA 3OTGA 5FUXA 1SHZA 1WBBA 2NU6B 2ZXEA 2GNOA 4C30A 3FW1A 5BXYA 2EJUA 1RI2A 4CTJA 1UT5A 1A9TA 3DJYA 4ZVOA 1XTVA 3WS7A 4HQ6A 1KI3A 4B33A 2YXBA 4C6HA 2D54A 4UBOA 5FO0A 3PFGA 1TW2A 3G5UA 3RUHA 3JQBC 3VZDA 1VLMA 3PXCX 1GNRA 3PHJA 2ESEA 3FOEC 1ETUA 1AJEA 1E32A 5DCWA 5EJ5A 4X45A 3GVPA 1YXMA 5DN6D 2YXDA 3UK6A 5EHQA 4X60A 1E5QA 3UWMA 2Q3MA 5CFRA 2K7ZA 1TKCA 3ND5A 3GFOA 4B3GA 3GN2A 4G09A 3ADOA 4FU0A 2OPBA 2Q4TA 1W5AA 2K7FA 3T7KA 2R1VB 1E2EA 3PPWA 4F3CA 4J0CA 2RARA 3VZPA 2X1VA 8ICKA 1SKYB 3UCXA 4QZBA 5I9NA 2O5EA 1CQIA 4ODIA 1O03A 4G5GA 4RLSA 1JA1A 3LBFA 2BGWA 3TEFA 3N6XA 3B8EA 1WCNA 4Z1MA 4ZIRB 4F4WA 4REQB 3ONVA 4DEZA 2NU8A 4LF9B 1G5TA 2O9JA 1D2CA 4PXAA 5C4MA 4G67A 5IAKA 1AKVA 1E2GA 3QWBA 1TX4B 4B4KA 5K3FA 5BNTA 4BCDA 1KMNA 7ICSA 4P3KA 3UFXB 4TV8B 3MGCA 3NH9A 3TZKA 3U80A 4WN9B 3DTVB 3OEEA 3HXQA 3HKEA 2OCXA 1HL7A 3PFNA 4YJFA 3GD7A 4I5FA 3FMPB 2HI0A 3RSSA 4GLOA 4UEJA 3MWEA 2E8OA 4D56A 1IBLB 1EM6A 2X1LA 5K8LA 4LIPD 1FPQA 3HC7A 1TT5A 4RMNA 2NV2B 1J8FA 1LLQA 2ZVQX 1MG0A 3HYSA 5J2AA 1MFZA 3L4PA 5K4AA 4TYWA 1ECPA 2KSOA 5HE9A 3AI7A 3OECA 3WRXA 1SXJC 2HDOA 4N0QA 2PIDA 3HRKA 1U3UA 3DQPA 3UHFA 4MYTA 3U48A 5LMCA 1RWPA 3COSA 4HDRA 2ZREA 4YRTA 3FTFA 2PKCA 2XCTB 1M1NA 4Z6EA 1NATA 2L69A 1D8LA 1ESNA 4YMHA 3KZIU 4IMIB 2YN2A 2XTMA 2OLKA 1Z2NX 1VG8A 4PLZA 4RQ3A 3AV3A 4M0KA 2OLEA 3THVA 1K27A 2EZZA 1EWRA 4YCBA 4NBUA 5BWOA 2V7BA 2HMXA 1NQVA 5TJHA 1ZQJA 1D9XA 3IVXA 3QLVC 3AHFA 1P2VA 3RNLA 5KI6A 4DW8A 1KI1A 1B3RA 4C08A 1NRJB 4KSCA 1JEOA 2RI0A 1Q8KA 3F71A 4JJIA 1AN0A 1RS0A 5ELXA 3PXBA 5HHHA 3HWX1 3BWVA 3OJEA 3K2QA 3ROPA 3ZXSA 5DLEA 3V6HA 1NBMA 3OPYB 3V5NA 4EG8A 1E2IA 3OICA 4CR8A 4F38A 4JGIA 4BE4A 4UNQA 4QEZA 4F3TA 1QP7A 4DF3A 1S2IA 3W78A 2PK3A 1WIWA 4D9BA 2WJHA 1HZZC 1JHMA 3ZX4A 4C4YA 3OZRA 4PAWA 4EABA 4B3TB 2VPZA 3KV3O 4ZHQA 2EKBA 2J48A 2ZIZA 4MP8A 4JVNA 2NUTB 2OTCA 3JARB 1EGQA 1SU8A 4UEWA 3UJNA 3AWDA 3AY6A 3ZCRA 4ARZA 2XNKA 1JZTA 2WINI 2X2OA 3T15A 4N9QA 1HUOA 4PW0A 4PAQA 2BFAA 5GGYA 1H23A 5IJAA 3EXFA 3RBAA 5L6MB 2J0QA 3KVRA 5TVKA 3THWB 4RW0A 2ZB7A 3L07A 3D1JA 4PSCA 1YS2X 3FFBA 1P44A 3IDOA 3WSTA 5I5EA 3H1GA 5JMOA 2IYLD 4AQ7A 5TS3A 3SP1A 2Q1YA 2VA3A 4BZQA 2FN3A 5U1PA 2Y27A 1LSUA 2NO4A 1QB8A 3OFJA 1DAPA 1ILWA 2EL7A 1Q50A 3URMA 3HVRA 4HNSA 1OXBB 4A8EA 621PA 3C29A 2WT8A 2RH9B 3DL0A 1DTSA 1II9A 1DMRA 1EFUA 4QATA 4OYYA 1BWPA 3PDIB 4ROSA 3FCUB 1XGKA 4N47A 3FBGA 4MHVA 1DAIA 1G18A 1DVRA 4FUQA 3V8NA 4MKRA 3C6ZA 5FOWA 3KZKA 1AURA 4CIWA 3M5DA 2CRXA 3MELA 2PUDA 1ZZEA 4RJIA 4INAA 4LZZA 3F1LA 1SUIA 4KO3S 2QRPA 3GLUA 3H1AA 2C4WA 3SZUA 1T8SA 1H3NA 2ZYWX 4US1R 1WHSA 4H4DA 4BFVA 3L7YA 3CX4A 1U2DA 3D6FA 4EJ0A 3BA6A 8ICHA 1QTRA 4FFBB 5K0ZA 4RE6A 3V80A 2H2HA 2PGLA 5KFQA 1V2HE 3GT4A 1PUJA 3KAKA 3QI7A 1UK9A 1P2TA 4AROA 3C5VA 2ZQYA 3HVJA 4OU4A 2OECA 3IHQB 5D6OA 1T24A 1AKWA 2MR6A 3RUCA 3P0EA 3QVGB 4BLRA 2HMTA 4EKIA 1KAQA 1ZM3A 1R74A 1TQHA 1PFGA 4HEHA 3I2YX 1YUBA 3FYCA 2ATXA 1OROA 4R81A 3WGVA 1P3JA 5F3WB 2PS1A 1N78A 1GT91 1X9XA 1BRMA 4QSHA 2VF4X 2IF2A 3KJIA 4AJ2A 3GPDG 4YAWA 1P9OA 3UKOA 2WKRA 5F77A 4YCXA 3BGIA 2R66A 3OCCA 3KVOA 4NJ8A 3H9QA 1UIMA 1EJ0A 3K9QO 3MA0A 1K6MA 4HGQA 2AE2A 1X1CA 1GFZA 2OUIA 4MHOA 2PUJA 4HDSB 2QRVB 2MSDB 4M88A 4CL8A 4R0NA 2BOVA 1A9OA 1S0UA 3FUXA 1R0BA 2RDJA 3RBXA 2J08A 4WNCA 1WZ2A 3OEYA 2FEMA 3OX3A 2A1JA 4I9UA 1WS6A 3W2TA 5JBIA 3U7JA 4B8YA 4TVSA 4EG5A 1A0OA 4FOLA 3AEQA 1HV8A 1PJAA 3N7TA 5GJCA 3OUUA 2F55A 4K9SA 1LRJA 1PD0A 3BRQA 2CFCA 5IF9A 5KFSA 2HBZA 4Q45A 4BMXA 4G1MB 1E79D 1DXYA 3WGIA 3EC1A 5TPZD 2I4NA 2GJ8A 1ZJYA 4ARUA 2ZPTX 2HHVA 4LYYA 1BG6A 3NHSA 2RGRA 5KMGB 5JQGA 4BLPA 3VKVA 1ACMA 3FJOA 3M1AA 4F9TA 2H65A 4OX9Y 5J0YA 3VHXA 1T1GA 3LT4A 1P1RA 4DWIA 2G17A 1OFVA 5IULC 1MEEA 3FWZA 1ZC4A 1XALA 2E3JA 2GGSA 5FBKA 1E96A 1M1UA 3RJ5A 3UGTA 5DW0A 3BWYA 4V38A 1F4VA 3LHFA 1NJ2A 1T8TA 2MRLA 3QE0A 3PX0A 4YHHB 2NGRA 5DTEA 3KFUF 3SI7A 1QC5A 3I01M 4NSNA 5H9WA 3Q9NA 5J2CA 3MINA 1BWRA 6Q21A 3NHJA 3UQZA 4DM4A 4BVJA 5A5DA 4R69A 2MMGA 4XX1A 2G82A 2FEPA 5T6MA 5COQA 2P5UA 4DL5A 2XHEA 4X61A 1F12A 4X71A 4A10A 1T5BA 3CTMA 3UAGA 3LQFA 4XWTA 2P41A 4B9AA 4IDOA 3CM0A 5D5PA 3TARA 4ARAA 3KX2A 2DFKB 3NFRA 3JS5A 1E2HA 4F6RA 3H16A 4C4AA 4EHJA 4IR7A 2ZS8A 2C3OA 2DQNB 1SEVA 5HJEA 2VSOA 5AKGA 1UEIA 1ZK2A 2DG2A 1CRQA 5GZ1A 4NYMR 1GRVA 3NM6B 1GAQA 5K45A 1SVLA 2PN1A 2HMVA 3KT6A 4IIUA 1FSZA 1PG0A 3F7MA 1TLFA 3PPIA 2VBCA 4OI1A 2X0FA 3Q1LA 4ZQGA 4HNHA 1VJCA 1FVOA 3ZKWA 2QYSA 2W6PA 1ZRNA 2VHUA 5CNMA 3U9TA 2GEBA 1EHYA 5I4KA 4QWBA 2P4HX 4UB1A 3LHSA 5ABPA 1BCRA 3GNLA 3KVYA 4QTYA 1KBQA 1Q7TA 2Z6QA 5F3RA 4HAZA 2RGBA 3UHOA 4V0QA 3S0JA 1OX5A 4JL8A 1MC8A 3ZH9B 9ICCA 1YV9A 1T94A 2FP3A 1MMFB 3HO8A 4KXFB 3ZLJA 3LXUX 1PZMA 2O8CB 3G6WA 4IGFA 1HYGA 4BO9A 1OH5A 3M2TA 4PC7A 5T3YA 3VFDA 2FZEA 3ODGA 5TMPA 1KEKA 4FN4A 3HJUA 2H85A 1DEKA 1PL7A 1RKUA 2BFMA 4ABTA 2ISOA 1N62A 1NF2A 5KO2A 2AXNA 2B78A 1U2RA 2HK8A 6ADHA 4Z3DA 4K9DA 1JYSA 1J0EA 3BKXA 1GFIA 5DP1A 2FN4A 4GPBA 4KE8A 3BRCA 1QG0A 2WSYB 5LU8A 1N2EA 1G66A 3WXMA 2C4UA 3PLRA 3PNLA 5ESXA 4MQFA 2ODGA 2EATA 2R6ZA 5CA1A 1OBVA 5KFPA 2GJ4A 3GILA 1W75A 3I9LA 1DRJA 4ZVRA 2OORC 3IVCA 4EPWA 5FOTA 4QJIA 2GM5A 4YAOA 1JA0A 4ZU3A 3U7QA 2F9FA 1XEWY 2GPYA 3NKLA 1Z4PX 4CUKA 3B89A 3TO5A 8OHMA 4IRCA 2Z98A 4L74A 3RTDA 2ASDA 1JKMA 2WD7A 2QZ4A 1K6EA 2RJNA 1B0PA 1XVAA 2HK6A 1XZFA 1D1QA 2RGUA 1OB2A 3AEVA 1ZMXA 2VJMA 4G4JA 4PX3A 5AM2A 2YJTD 1YR2A 2HDWA 3EGXA 3VYRB 4YMOA 2IA6A 3LBHA 2FV8A 1NTOA 5JAMA 3GN1A 4LMRA 3LT1A 3OMXA 1DPGA 3FROA 3GFPA 4TMFA 1T5HX 2WJJA 2RGNC 4ROTA 1QPGA 1RI5A 4LJ7A 5T4EA 3FOBA 2Q6KA 3P20A 2NU8B 3FFAA 1E6UA 3AQ4A 4GLFA 3WI7A 4UUBA 3UAOA 4QHTA 4DEXA 3NPAA 3ZGNA 1GL6A 5K3FB 1OZAA 3VXKA 5EMJA 4QT0A 3K9CA 721PA 1AKRA 5JBNA 3UB4A 3B70A 1MAWA 1A8IA 5EMLA 2DLNA 3HKEB 1WMEA 3VTZA 3O8CA 2CDBA 2ZAYA 5CW2A 5FULA 1KHTA 2JCYA 5AJVB 5DYNA 3BAFA 1SG6A 1Y6RA 3VSEA 1H9CA 1V8OA 1EFRD 3GDFA 2JGJA 5KTMA 3QPCA 3MWEB 2EBUA 2UZ0A 3K4HA 3ICOA 5JYDA 5K0SA 8ICRA 1HQDA 3AW8A 1K7SN 2KB0A 4H7EA 1TT5B 2W6JD 4OP3A 1MH9A 2DPXA 1C8BA 2CNBA 1GNSA 1LDYA 1U2QA 1V0JA 1Z25A 5AKHA 1LDMA 4S3MA 3F2VA 4OLFA 2R5FA 4WGFA 4XPIA 4QODA 2OK8A 2KSOB 4L5YA 5MN5A 3KB1A 4IC9A 3CVYA 4ACOA 1TD1A 3U1TA 2VBIA 1X1EA 3T1TA 4BUJA 1GZ5A 4HDRB 1WVIA 3KR0A 4LQCA 5TQVA 3EZ2A 1M8FA 1N2OA 3V1YA 1M1NB 1NMQA 3GZ4A 2PE5A 5E4YA 3A31A 1H2RS 1MX9A 1W5TA 1PQWA 3W4KA 5INTA 1IYZA 4O59O 2ZIUA 5ALSA 4QA9A 1M2JA 5EWLA 7ICTA 1V16B 2YXLA 4B80A 3BRWA 4GUAA 1L4KA 3PKJA 1RQLA 1LZKA 2R18A 3GEPA 3NPMA 4DA0A 4K6HA 4KXQA 4R1OA 3LF2A 4MV0A 4ZXPA 4BJHB 5JXGA 1RXIA 3W7VA 1DHTA 2DPJA 1MB9A 2J6UA 3VSDA 2C4KA 3O5AA 3GRZA 3F7NA 1HH4A 2GO1A 2I66A 1ACLA 3NORA 2O2SA 1COZA 4NJMA 5J43A 4HB2A 4GX5A 4Q3LA 1SKYE 1GPMA 3KQYA 3WLSA 3TL2A 2ZYHA 5IEBA 3D2NA 2HHHB 1RWBA 1C7QA 2X0IA 3FDSA 1T8YA 3BG5A 3P4YA 4D97A 1V1RA 4UB4A 4YNBA 4I2IA 4RORA 1UC8A 4CG0A 4G0PA 2C1XA 1HRKA 3VR6D 1SOMA 3LQQA 4ZQEA 4RA6A 4JOCA 4NM2A 4ZHQB 4MA0A 3V2UA 3QPBA 4UZEA 4A2WA 4M8SA 4P2GA 4BVLA 4Q1VA 1TK2A 1W19A 1S6YA 4AY3A 2Q5EA 4ARZB 2C4MA 3DEEA 3W6ZA 1N34B 5G40A 3CH4B 3E8XA 1AN9A 3P45A 3ZNQA 5JMTA 1P75A 5H83A 2NACA 1H8HA 3C15C 3WRVA 1TYCA 2WWWA 5HKKD 2PD6A 2J6CA 4N03A 1S7GA 2BONA 4E5NA 3B12A 1U0BB 2OFOA 1P0IA 1QV6A 1TZJA 5DBEX 1YIOA 3OZIA 4AN0A 4XUSA 1U3FA 3HNOA 5ALOA 2BY4A 2DPIA 3REQA 4A1OA 4D99A 4WBNF 3A3OA 3GJ3A 3HBAA 3P52A 5EOZA 2B4QA 5GMOA 4FR2A 1YA4A 3MRTA 1Z7WA 2EJVA 1V45E 2BL4A 4QQRA 1V5WA 1NVTA 2GBGA 2IYAA 2W2QA 3L8DA 3IOYA 3ZDZB 1QO7A 3NAMA 5CYOA 1C7IA 2JFHA 4KQMA 4UAYA 4D3ZA 3QU4A 1I4LD 3NXKA 3ADKA 3ETDA 1G63A 3SAHA 2X1MA 2CJXA 2BMWA 4ZZ3A 4BMYA 4RAQA 4AT1A 1RYSA 1C4KA 1WHSB 2GQ0A 2I3AA 3CGWA 3W2IA 4KZPA 1MEOA 3U0VA 4B35A 3RIEA 2ZIVA 3HCDA 2PWBA 3R8CA 4RJJA 1ODCA 2A9FA 4HDCA 1GAJA 3MJRA 1PFVA 1KSGA 1SUBA 4B6QA 3I9KA 1P7YA 1VRVA 1YB5A 2Y0SF 1OWNA 4NZNA 2YN0A 4JSRA 1HXHA 4QLOA 1QFJA 2OYCA 4M7WA 4IKOA 1VECA 3EH1A 2MUTA 9ICHA 4ZQCB 1ZUWA 5KINB 2VHCA 1I1HA 1SVWA 4I1PA 3CYMA 4RULA 1YAHA 3EC2A 1NAHA 3RH0A 5DHTA 5JYEA 3MQ2A 1S01A 3P97A 1MFPA 4MWCA 4BWFB 1ICIA 1RM5A 1JBQA 5A9RA 2R86A 2VHXA 1UT8A 2D4AA 2D13A 3QUQA 3B2NA 4PZEA 4R71A 2CNDA 4ZEVA 1O96B 1T4DA 1KI4A 3T9CA 4ZODA 2PNFA 4RF3A 3OZ7A 4V0NA 2NO5A 4UQOA 1CRPA 1FRVA 4YDQA 5IJZA 2C82A 5CG1A 3M2PA 1FX0A 4QZGA 1ST3A 1WCIA 2C7GA 4TV9A 2PMFA 2WSSA 2JVIA 1VKNA 1N61A 5U4QA 2BR0A 1RLIA 3PWKA 2ODAA 3EYZA 4I2DA 3GY0A 1TEHA 3H2IA 4H9GA 5G53C 5LB2A 3G6XA 1JXAA 4DTCA 1ZK0A 3WJ7A 4EJSC 1YI0A 3QY0A 4XPZA 1NVVR 3OOYA 3BQ7A 1W30A 2HZBA 4MA5A 1LLDA 3W5VA 2HJSA 4XWAA 2XB4A 3CONA 5ILGA 3WYAA 3C3PA 4LF5B 4OG2A 3F8TA 5EWJB 1ZK1A 3RIHA 4BAGA 4Y7DA 3HU5A 1B1AA 2R8HA 2HCRA 4CM4A 4BKOA 4QM6A 2Q3LA 3IA2A 2YV4A 3CMCO 4KQJA 1DWQA 2CLEB 3AEQB 3R3HA 1Q0QA 2NP6A 2IU6A 4YG2A 3NRCA 3ETHA 2QTRA 4RPZA 5B7PA 3EY9A 2G5CA 3A2MA 1J1IA 3JVDA 2ZJ2A 4DV6B 1W4RA 3LPDA 3FTPA 2V7UA 3ETCA 4AICA 2BCVA 3ZWYA 4G1BA 2VXYA 3ITNA 1UQRA 5BVGA 5AOVA 4IIJA 1RWVA 4Q1FA 4IG4A 5AKJA 4QEDA 1UZMA 3HXLA 5FBZA 2W6IA 3SQXA 2QI9F 4UQLA 1EX6A 1JT2A 4JYCA 5JQGB 1CJTC 3N7AA 4XI9A 4DA6A 4CLHA 1BNOA 4B6GA 1WF6A 1NU6A 3VHXB 3WBJA 2PS9A 2Y0CA 1LH0A 4ZU6X 5TIIA 3ZXYA 3QU7A 1LBIA 1WKVA 1QIDA 2IYWA 2QW8A 4YJDA 2P78A 3OJUA 4LS3A 5JOQA 3DLHA 4LBYA 3OJFA 1Q3HA 3TCXB 3NT4A 4P5EA 2NVWA 4D0LB 2W7OA 4ZMRA 7REQA 2SICE 2HH9A 2ONCA 3NWPA 1OFGA 1QC5B 4EJFA 1CEZA 3MINB 4UZSA 1Z4QA 3NVZA 2AUTA 1KGSA 2F7SA 1PQ4A 4B3CA 3EASA 3TB4A 2NUPA 5JZ9A 5FBWB 5JAUA 2ERCA 3S44A 3STUA 1OUQA 3GGPA 3G0HA 4HNAA 2A92A 4YALA 4CMKA 3R7SA 3Q3CA 1HYQA 3OVMA 3T7JA 3KBBA 1DLIA 3QIAA 5AHRA 3AILA 1YFJA 3GLIA 1ZQ1A 2O1XA 1U49A 2ZUEA 5A3SA 3TNFA 3T5AA 1Y37A 3IP8A 4D9KA 1XVUA 3EB9A 2A0XA 5D1HA 1QMGA 2A3VA 1YS9A 3O4RA 1FOEB 1XSNA 1JSXA 1Y81A 3KYDA 1DI0A 2LRHA 3KB2A 1PNVA 4ID3A 4LTNA 5IAEA 2W4IA 3PXUA 3UXOA 4BQEA 4LK3A 3ZKWB 3DVRX 3FIJA 1YB4A 3C8ZA 1YZVA 4DSFA 2H5LA 3P1JA 4RKWA 1KY4A 3E7DA 1RAAA 1B0ZA 4XVHA 3AR6A 4IHAA 1P31A 4I81A 1BCRB 3TW8A 3HPRA 4QUHA 1Q0SA 1QTQA 2PWAA 5DBHX 3WLFA 4R2LA 4K28A 4I5EA 1Y3DE 3TIFA 3C3KA 2NTNA 4LDRA 1TDJA 2X22A 2AOVA 2QDKA 5DDIP 3ZVNA 3UAVA 1Z4MA 1JPNA 4X44A 4G26A 4JBIA 3CCBA 2WQ6A 2GHTA 4WL0A 3S8MA 1YVEI 4ZU1X 4KVZA 4INZA 3USCS 5A6VA 4PZAA 3HLKA 3NAGA 4QZEA 1LEHA 4F5NA 2NIPA 4MQFB 5LQMA 2AS0A 3KJNA 1J0AA 3V4SA 2J85A 4RQAA 5CA1B 3T06B 4GBMA 1K2WA 1VIMA 1HUQA 3BXHA 1LKZA 4KFUA 4E2WA 2HSDA 3RC9A 2NRWA 3NBQA 4ZVVA 1FTQA 3U7QB 1ZITA 1W88A 4B45A 3N87A 1SG0A 4FSDA 3GUUA 4QOJA 2DGDA 2B69A 2TS1A 5EJEA 3TMAA 5A4IS 4RJLA 4QBTA 4K3VA 1I2AA 3IUPA 3L0YA 1POXA 5M04A 2VNKA 2VJMB 7ADHA 1ZU5A 4QRIA 3EGXB 2HBQA 2FPMA 2EAOA 1WW3A 4CEIA 5DM60 4EF5A 1QE5A 3QVKA 4YCMA 4H6PA 1Q46A 4M9GA 1U7XA 1PFUA 4OFWA 2Y0EA 1LSSA 1A4UA 1JFRA 3DF9A 2QL7A 3IB6A 3Q2KA 2IYZA 3UYLA 3GDOA 3GK3A 3MTJA 4QBKA 2GX6A 3IQGX 2W2KA 1V7CA 4FCTA 4BC1A 3BGDA 2LVBA 2QUHA 2H2FA 2ZCJA 5JYCA 3I3SR 3ZE6A 4WFQA 2GN6A 4TRNA 3MB8A 1TEVA 3EIOA 1PLLA 1QB7A 3J7AC 1ZNXA 2R96A 4EMUA 5I9IA 3QZUA 2EVWX 4Z0PA 2B3DA 4DWVA 1YRLA 2FW8A 4EJ2A 4UVHA 2AYXA 4YRIA 3OAAD 2JEZA 4KXYA 4HAVA 1L5KA 1R9MA 1LSOA 2WTNA 1MTOA 4Q9KA 3BMOA 4X3PA 5KX5F 4AWXA 3SLGA 4IF6A 3ZNPA 3KZCA 2WV9A 4XPIB 4J9RA 1FLAA 1TT7A 3JSAA 1XG5A 4RGQA 4C8OA 3ZV3A 3LH5A 3VUFA 3WIEA 2HIAA 4QBFA 1G5RA 1D1TA 4LUCA 3A0BU 1ZMOA 1X87A 4IXTA 1V85A 3FYDA 3NH6A 4JMUA 2V9PA 2NRZA 2JR5A 4K26A 1W93A 1EGAA 2OOSA 1NV9A 5A3QA 2XXAA 2F90A 9ICSA 1YUNA 3N59A 4CLXA 1KYYA 2ZIUB 3OC6A 4DMRA 1PGPA 1AUVA 5EWLB 1H8ED 4MPPA 3O4IA 4TS4A 3MGIA 3K2BA 5C46F 3HO1A 1O57A 5JS7A 1B2LA 2F77X 5ECDA 1UANA 4NOMA 1GTRA 3NC1C 2B4YA 4OJLA 2Q6VA 2OXTA 3KXDA 4O4JA 3EXIB 3QKIA 3D3WA 4KACA 3A25A 1YRBA 3UMRA 1JU4A 3IQZA 4QDJA 6AT1A 1S3IA 4IQ0A 4UREA 1WV1A 2RHRA 4IQWA 1LV7A 1NVFA 4YXFA 1QJ4A 2V6IA 3DUFA 4EGSA 5CVEA 4WKGA 1IE3A 2I2FA 4NJMB 4DWWA 3PNSA 1R0YA 4QC2A 1IG6A 1E1LA 2YH2A 5IUNC 4IJMA 1L5FA 1K4MA 3P9ZA 3Q6IA 4L7VA 1Y4UA 2W37A 4OSOA 2HW8A 5HSGA 3M49A 4RCVA 3RJMA 1S2OA 1V1RB 4EHNA 4KAXA 3O92A 3LHKA 4BU1A 4LVNA 3D8HA 4XYEA 2PTHA 2XC9A 8ICBA 3RHFA 1RBZA 1FFUA 2J9FB 4RA6B 3AFNA 3ZZMA 1L4LA 4AI6A 4DL2A 1B2RA 1WP4A 4MCHA 4L02A 1SY7A 4JROA 3SQNA 4TUSA 2XDYA 3PF8A 1L5RA 1Q1NA 2BBWA 4ZGGA 5AW6A 1EVIA 1AV6A 1FBNA 3SBXA 4A15A 3LUJA 1BPYA 2H6EA 2DEUA 4PPNA 2Z5FA 3C87A 5A4AA 4Q4DA 2B0JA 1ODJA 4O3OA 3STYA 3AW9A 4GQAA 2C2HA 3CNEA 3MR2A 5C31A 4GE0A 5JXHA 5KSPA 4J6FA 5JROA 2H52A 1RQNA 5GQSA 3WL8A 3QVTA 1MABA 2IZ6A 5ECWA 4E7PA 3WKBA 3L0BA 2ADMA 2W55A 1QIHA 3OO1A 4P35A 2Z9BA 1BVRA 4G9BA 2VQFB 3GRCA 5JTUA 5KQSA 3U19A 4BVFA 1EB8A 2ZUVA 4CKEA 4HFJA 1XPJA 4CETA 1NLZA 1TA9A 5IVPA 4EWLA 2VDNB 2AXEA 5KTYA 2IOQA 4DV5B 4JJ7A 3V7UA 1RYHA 4G0QA 2YMPA 4RY2A 2QUBA 2C78A 2GXSA 3B85A 2GFQA 3KR9A 3SICE 1KL7A 1KRXA 2OCLA 4DCGA 4CM8A 4X65B 5F5NA 3EZLA 4GVLA 2GPAA 2EH9A 5TPWB 3L9XA 3RB3A 2P79A 3JPQA 2ZIVB 1L0BA 4L4YA 3HI6A 2VJ5A 2GNPA 2YWHA 3STVA 1NBWB 1NDQA 4XEHA 2Z8YM 1OFHA 4TT3D 1S02A 2MUTB 1X8KA 5BNZA 3Q3VA 3KHHA 3DEIA 1NBME 3T7IA 5DXJA 3TDKA 1YJ5A 3HRDD 5JH7F 2OO5A 1NJGA 3OQPA 3WGQA 4R51A 1XKTA 4E21A 2DKZA 1DCKA 2AR7A 3BTSA 2BFFA 4H2DA 4IJ5A 4XVQA 2Y1XA 3AQIA 2YIMA 1H38A 5LWQA 1R6AA 4JR1A 3CVUA 5K4GA 4H4CA 2N1BA 3BXFA 3K8OE 1HDCA 5FI3A 4B5KA 3I62A 1QANA 4O4HF 1KU6A 1MO4A 3KAPA 4URXR 4QYIA 1KVRA 4IR1A 2QT0A 1QLWA 4MS3B 3NQ41 1FX0B 1ZQPA 1WCIB 3DLIA 4TV9B 1L9XA 2YMLA 2G1UA 3TI7A 1DP4A 4QWCA 4JUDX 4YCAA 5AVOA 1ZIPA 2JGRA 4UB8U 2XTZA 4EEYA 1ZKMA 1K97A 4M0UA 1PEYA 3NIWA 3TTYA 2F1OA 2CUZA 3D8UA 1UOQA 3B82A 4UCWA 3A28A 4DQ0A 5EEHA 5F52A 1JS1X 3R6LA 4JYZA 1UZNA 2HIHA 5JALA 2X3FA 3DGFC 3GJYA 4CM4B 2GEDA 5AJYA 3HR4A 4IDFA 4LYHA 2IYVA 5KFGA 4Z4IA 4ETMA 5J0UA 4N3BA 4TWZA 1T29A 3MJCA 3B1XA 5BV2P 4JHXA 5E2AA 4FCVA 5DLFA 1G4AE 4LISA 5K03A 1NBOA 2C9MA 4G5YA 3H4DA 5EQTA 1V48A 3DFZA 4Y98A 1W6RA 4AKIA 2VK2A 1ZR2A 1TB4A 5BVGB 3IBTA 4I7EA 2NVUA 2QGFA 4IIJB 4CODB 1T36A 2R85A 2XWBF 3L93A 3DAGA 4J29A 4BFCA 2ZUFA 5H3LA 1OWOA 1D1SA 4EHKA 4P7FA 3GV0A 3E18A 1HGXA 1ZC3A 3FCOA 3HN2A 2HMAA 2ECKA 2C1EA 2KJ9A 2F9LA 2HT1A 3A1SA 3PC7A 1EDDA 3ZWOA 3MS2A 4LF6B 1JWAB 3L6BA 2V9WA 2QLNA 2NQTA 1AQUA 2JA1A 4PHCA 4ZDIA 2IEYA 2A30A 2AI1A 2FTKE 4MWEA 7REQB 3GVXA 5DB4A 3RPEA 1SULA 3GUVA 4JLSA 1GLGA 3RAPR 2QZJA 2BJHA 3QMMA 5J5VA 1Q1AA 1Y7TA 3ALRA 3RYIA 1JT9A 2NUPB 1Z7GA 1ENYA 4TTTS 1UBKS 1A76A 4IFEA 4LI0A 4WRRA 1Z0UA 3EEBA 3C2KA 2AHOA 1LLFA 2ZSHA 1XZMA 4OSPA 4F3OA 4S12A 4RPXA 4YRAA 5JEEA 4J1TA 2XF8A 2K4PA 3K8QA 4IUYA 3IUSA 3GLIB 2P8SA 3G7NA 1H3FA 4ZJUA 1QORA 2RRDA 4AF8A 2CV1A 2AOTA 4TUYF 4HPWA 4RFSA 1S2NA 4QNMA 4Q03A 2PSDA 2FFQA 1BWQA 2B4AA 1XZBA 1H0RA 4OXRA 2RCNA 3NT5A 3KYDB 2XKBA 1OFUX 4AMZA 1DFHA 3M6WA 4WN3A 4YC7A 3IEKA 4W99A 3F5AA 4E2XA 2Z56A 3GDWA 3CMMA 4MWZA 1S3FA 4MYDA 2HEIA 3GO4A 2WU4A 3JYLA 3OTWA 4PZCA 3TQCA 3LKVA 3D7LA 4I1VA 2DFTA 1VC2A 2V45A 3T3EA 3F6BX 2XUZA 2H2WA 2OQVA 2WWRA 1PFYA 2R5WA 2BGUA 3TW8B 1HY3A 4IY1A 1NXPA 4AU1A 2AR0A 4M1WA 2BCJQ 3IIMA 1YL6A 3K6SB 4U2CA 5A0LA 3RQIA 4ALKA 3R7LA 5IC4A 1XCLA 4PFJA 4JBNA 3ORFA 2XRMA 5TRTA 2I1VB 3AY0A 2O7NA 3NVMB 4A0QA 3ZZ0A 4P5PA 1AVTA 5JO9A 1PUZA 4R65A 4RD6A 5B3KA 1J99A 4A6DA 4ZYLA 3GIJA 1JU3A 1VFPA 4EY5A 4L22A 4BXOA 4A82A 2E37A 4NK5A 5FLKA 5DCUA 3Q3JB 3IAXA 1EFKA 4AWAA 3C1TA 4NXZA 1T0BA 4ZCLA 2WB1C 4Q7EA 4UBNA 3LYAA 3L7CA 4WKBA 2O59A 1QNLA 2ODNA 1ED1A 3G49A 2D7DA 4BC0A 1GADO 3L6RA 4MVJI 3LGSA 4CIVA 2WHQA 3N2NA 3F6PA 3CS3A 3O7MA 1W88B 2OL4A 3CJQA 1QJCA 3ZX5A 3I64A 1KERA 4PYOA 1H0KA 1R0CA 2BM9A 2C61A 2DMRA 3AO0B 7ICLA 3WYCA 3S29A 2WG0A 2TMDA 4JENA 1NKEA 2JS7A 4JYAB 2PZJA 4F5QA 4MPJA 4RL6A 1JAHA 1KPHA 3M89A 1GKUB 2WUGA 4G8BA 4P7BA 2Z5LA 1KJWA 1I4OA 4E0DA 1RRMA 2YBDA 3ZJ4A 2CKMA 1CVIA 1JQAA 2NQ2C 4GXRA 3IQEA 5M5BA 4HPXB 4ZI7A 3C97A 5G1NA 1WUYA 4RENA 4D9MA 4B4DA 1XD9A 1HKHA 3DTNA 4GQBA 2Q1TA 1S8OA 3QSYA 1N2CA 2JFUA 2I6TA 2GETA 3REFA 4YP3A 1DB3A 1YI8A 2C7BA 3TX2A 3U3MA 2WJ6A 4C1BA 4QECA 1W85A 4Q1AA 3S2FA 2Y0BA 1E2DA 3V48A 4REMA 3ICWA 3ROTA 2GK7A 3SY8A 5K4HA 3G0BA 3VKGA 3Q8QB 3M8RA 3KYJB 3R6WA 4XIJA 5BSUA 3R9XA 1DIGA 4Z7QB 2G9NA 4HWTA 1IPFA 4A0RA 3G2LA 1HE8B 1I94B 1F06A 4O5EA 5CHGA 5K8TA 1ZJMA 4FZ5A 2DUYA 2QWXA 2YTUA 3FWYA 5CX1A 1OZGA 1K98A 3OG9A 4KLEA 2FFRA 1HDRA 4OFXA 4AN4A 2PLAA 3T5HA 1C9EA 1W4CA 1K3UB 1C1DA 1RQGA 1BNPA 3QX8A 4RK0A 2COEA 3V4OA 5JWOA 2ZANA 2VT2A 2QB1A 2ORYA 5KFKA 3RF9A 2NLOA 1QYWA 4RSMA 2BZ1A 4KQKA 2G88A 3AI3A 4R9UC 1U3CA 2J3HA 4F8YA 4W7IA 3A6EA 4YR7A 4LRUA 1RACA 4TLAA 4WTOA 3GRUA 5KWVA 1V25A 3W79A 3D6VA 2ZRQA 3RBDA 1TVMA 2W04A 3BK7A 1U1DA 1NFRA 5DBBA 3OLWA 3SZRA 4RQ5A 4O4JB 3DCIA 2PG3A 5C1BA 4DFPA 1XRJA 1TJNA 1NG1A 1O95C 4UMVA 3WYBA 2MDTA 3D3KA 3PEFA 3LC7O 2WKPA 1PU2A 4V0LA 2LD4A 2FAXA 1AKEA 2NSHA 4POOA 1XEXA 4BFLA 3DHNA 2BMFA 3I9FA 3P2OA 1N2BA 3ZE7A 2JAUA 1AK1A 3TVDA 2ALJA 1SBQA 2O0HA 2WYOA 1QZ3A 3BIJA 1QHEA 4UBLA 5CPBA 3EDOA 4N4AA 3FDZA 4KR6A 3TLGA 1FMLA 2I2AA 2V6FA 5B7NA 1TEZA 3VA7A 5GY7A 3PFKA 4BZZA 2MMCA 3H8JA 3KTOA 3TADC 2OCKA 3C1ZA 5T41A 1QHNA 5CT8A 3BF8A 4Q9NA 2GZRA 4EDFA 4H60A 3JPWA 1T3QA 3H2KA 3L8ZA 4JSYA 5F2EA 3ZHOA 3SVLA 4DXDA 1IONA 1X9GA 1ZNWA 3RRGA 3QNWA 1T2DA 4GPEA 1NR1A 5FUYA 1JPVA 3G8AA 3HE3A 3WXBA 4G56A 3GXBA 2NTEA 3M6XA 3VR6H 1E3EA 2W9CA 3AC0A 1MC5A 5FR2A 3RF6A 5AHWA 5D8DA 5DHAA 1MABB 5F35A 4CKZA 4HRAA 4BJ1A 3AI1A 4QW8A 1ZQCA 4HQLA 1QXSA 2QQFA 4GH5A 1WKBA 3QKSA 2GHRA 4RH3A 1T3GA 3QBJA 5A5FA 3T7DA 3LYLA 3P32A 3UJ7A 4CKEB 2OD9A 3F6CA 4H1TA 3NHKA 1VHTA 4Q02A 4KAAA 1Y9EA 4M7OA 1A7JA 7ICMA 3UT5A 5B58C 4HYKA 2IHYA 4KW7A 1LGYA 3AUXA 1BDHA 3KM0A 5ALDA 2IXBA 4CDNA 4CM8B 2HSJA 4GU5A 4JJGA 5IT9A 3PT5A 3MWJA 2Z3VA 4NHOA 5JD5A 1TF5A 1FQOA 3U3ZA 1ZHFA 3RV3A 3HABA 1IUKA 3PD0A 2WJAA 4KPFC 3W5CA 3AIKA 3RVSA 2AZ4A 1R8XA 2OXEA 3PNCA 1X8XA 4L78A 1DOHA 1ESEA 4HYTA 4YAGA 4F96A 3NOQA 2X0RA 1XDDA 2Y93A 1QHHA 2VIIA 4UNNA 3WICA 2BEVA 2A78A 2UVQA 2HL6A 4WOPA 1KVSA 4DLAA 2BFFB 4Q3DA 1GJRA 2A5LA 1CPYA 2EBFX 3UJ6A 1HFWA 4LMBA 1QV7A 1RYMA 1POWA 2FLNA 1PVVA 4ZARA 1RZRA 3R3XA 1S8FA 3N28A 2FG6C 4XLTA 4QYIB 3AR8A 4HUJA 2FSFA 3GEHA 1AUXA 2OV1A 2JJ1A 3F6EX 1ORRA 4V0OA 2GRUA 4KWHA 3TR6A 4G07A 1OMOA 4PLGA 4JI3B 4DQSA 4X0EA 5C8DA 1Y80A 1SA0A 3TL3A 3B3QA 3QMPA 5HKOA 3D6AA 2A6PA 3F5DA 3DCNA 3WYFA 1T4GA 4DF8A 5FYQA 1NJ8A 3K4PA 3SF0A 2V0CA 1OILA 1FZQA 1A9XA 3R41A 4B84A 1QH8B 5DVZA 2CVPA 3TM4A 2JBAA 4YRDA 4LDAA 2ERYA 3PI7A 1KORA 3P9QA 4N0EA 2OHFA 1SU6A 3NC0C 4U7GA 1XT6A 2VH1A 3EXEA 4RSHA 1HE1C 3OZEA 4RQ1A 4PH5A 5CP2A 2BUCA 1RG6A 4EIWA 4X7MA 1XDUA 4DJJA 4E31A 3Q72A 1S5PA 1II8B 1HMYA 3QXCA 1C7RA 3ZC3A 3EIWA 1ISSA 3OQIA 3N5CA 2HOQA 2NXWA 2ZBUA 1JHAA 1ZI6A 2KLBA 4W9MC 2RHMA 1GQ2A 3NG1A 1IN6A 1ZH8A 3GRPA 3AOEA 2H2DA 4C7BA 1SVNA 1J97A 3CXUA 4HH1A 2IITA 2NVUB 1GRQA 2QTZA 1T2CA 4DL6A 3OMLA 2CLLB 1R16A 2UZIR 1VMIA 3CR3C 4W7HA 3JQ8A 1BFKA 2IXTA 2QHXA 4YXWD 2FI1A 1JXQA 2QD2A 4KQHA 3NRZA 2AL7A 3U3XA 3DZIA 1V7QA 2P4EA 4FGWA 1L5UA 1N6NA 1VTKA 2AYYA 1OCEA 1U8CB 1LV8A 4LY3A 4M8NE 5BQOA 4ZO4A 3G8BA 2HM7A 3NBKA 3AF1A 5CVUA 2IXFA 1T1IA 1G21A 2W9AA 4CM1A 2ZT7A 3KUDA 1JEDA 3G6VA 3ERCA 1EINA 5ARDA 1IZYA 2KD1A 1U9ZA 3TLKA 4WERA 3AU6A 3ZE2B 2C00A 2ODWA 3RYIB 4OBBA 4DBLE 4ZOLF 3EBOA 2JNWA 4M9HA 2VR1A 2ZSEA 1MP0A 4BU0A 2ZE6A 1ZIYA 4B7UA 2VHEA 1Y1SA 2BZFA 2AHOB 1XRPA 1VYTA 1HURA 3LA6A 3KOZA 5LD2B 2WMOB 3TTVA 5DMXA 4LV8B 3IVMA 4CFYA 5J5AA 3HFGA 3DBVO 3KEGA 1VCHA 4RFSB 1LLUA 1F0PA 3L8EA 2Z5VA 2WWXA 3GA5A 3DDUA 4YMTA 4CCHA 2OZVA 1CE8A 4IXMA 4CL2A 2W2XA 3VO1A 3MMNA 3UGQA 4P4PA 1VYUA 4DGQA 5I7OA 1QZTA 1J39A 2DKFA 3QFCA 1IQPA 5EXEA 5J0PA 4BRUA 2JEOA 5F7JA 4WKNA 2OY0A 3I2GA 4CM9D 3FIUA 3V1KA 3F9IA 4Z5XA 4U39A 2VP4A 3U40A 2OB2A 4G4SO 1UFRA 4N8SA 3K1ZA 1KEZA 4P86A 4Q82A 3DHYA 4R8SA 3LBYA 2OEPA 3DB1A 1MR3F 3IMFA 3GPIA 1I2ZA 3ADPA 3W8FA 5BWLA 4Q43A 3T5PA 1HYHA 4OQFA 5GAJA 9ICOA 1BYIA 4IDQA 2XYGA 4KR0A 5H70A 3LPMA 2VL7A 3EQ8A 1FK8A 2I71A 4U2KA 2KMDA 3Q3HA 5KSZA 3T4UA 4CBVA 2E7ZA 4ZYUA 2CZGA 5AQ1A 3PLAE 1FXSA 4D8UA 3LHDA 1OGJA 4RABA 1L7XA 1Z4JA 4XW2A 4RY8A 5BP7A 1CQIB 3U9LA 3BDVA 3JYOA 1UFOA 2AR9A 3ZYCA 4PPGA 2JFPA 3K09A 2F2TA 4GMGA 2J5QA 3PNOA 5FBRB 1WYGA 1C1XA 4BNIA 4ED1A 1E7YA 2C9CA 4NF2A 4K46A 2MCFA 5DIZA 2IBKA 1RYFA 1RWMA 2CK3D 4DQVA 4Y6SA 4GRIA 5J2UA 1J56A 4LXXA 1CZUA 5L4NA 4P4SA 4NH0A 4B4WA 1XUOA 4YJFB 5FUMA 1UPFA 4KXNA 5EVJA 2GZ1A 3E5HA 4YIHA 3GEIA 2IIBA 5FTNA 1AK9A 3PL5A 5K01A 1JAYA 1TLLA 2ET6A 3RVDA 3NUQA 1VG1A 4YREA 2XNDD 3GLIE 2B83A 4TX1A 4ZI7B 3F3MA 1BPDA 3RFCA 4A6PA 1U1EA 5TQ0A 2IVZA 5CD1A 1C7EA 2CNNA 3ZG6A 1R8JA 1BKSB 2FUKA 4UM9D 3RSGA 1N2CB 4XD2A 5F2OA 3I04M 4K86A 1QH1A 2FQXA 1PR9A 4BV2A 1NYQA 3UQ2A 1W85B 4F86A 3GJZA 3GJ5A 4ZVQA 5A62A 3P96A 2WM3A 3TKAA 2FVYA 3OUZA 4BVKA 5KKCA 4QFMA 1GDHA 1J70A 3K5IA 3R9XB 1RYNA 2IU0A 4B3DA 5KNBA 2B6HA 3X1XA 5ITZA 3ILXA 2G77B 2AJLI 4KMRA 4MZXA 3AKYA 4RD3A 7GPBA 4ZOHC 3KS9A 5CX1B 1XIVA 5HF5A 3MCVA 2VYVD 3A1NA 4UB6U 4ZJZA 3FOZA 1U3VA 3W5SA 1PHRA 3K1JA 2W0MA 3A9VA 4CQMA 1P0CA 1MIHA 5IFLA 1W87A 1OU0A 1XFDA 5ENDA 1NNSA 4EYKA 4LI3X 2PD3A 1NK6A 4GC7A 2GRJA 2Y92A 5HFJA 3EF1A 4YMVA 1EKXA 4HJRA 3FF4A 2C0PA 4P4NA 5HIIA 4OQEA 5C1DA 1VG9B 5KNCA 3OZXA 5JANA 2MT9A 2AXQA 2VIXA 3AI2A 3KPVA 3SYLA 2J6SA 1PX0A 3SIWA 1IWPB 3U4IA 3BULA 1I13A 4ZALA 1XB2A 4EF4A 3MSXA 1GG8A 3L82B 4PCUA 2C0CA 5HPYB 3BX1A 4RVHA 4UCFA 3PCTA 4B5LA 2PH5A 1QBGA 3VJLA 2PUFA 3UUEA 3KYCA 5EJ4A 3VC7A 2BRUC 5B7QA 2G9VA 3TUZC 1XEXB 3EXFB 3AB8A 5IC6A 3I6ZA 3LS2A 1NW4A 3O2QB 1QHSA 3M34A 2YINC 3KQKA 4W5RA 2V98A 1JTEA 1E1RA 2NNWB 3DB2A 2EIHA 1DPFA 5KG2A 1J2EA 2XGMA 2W8ZA 2VRNA 1NV8A 3FDZB 3B5JA 3TLGB 1E3WA 4NE9A 5JQWA 1CFJA 4IHKA 4PSKA 4DS3A 5DI3A 2ZDHA 4QRDA 1N9ZA 1F17A 3N7PD 4KH0A 3QWHA 1N6LA 3HADA 2B4TO 2OFPA 1KJYA 2LNDA 1W47A 2RBGA 1AHNA 2ZTDA 4W4TA 4OK3A 1DOZA 4QGHA 1UEXC 3R6DA 4QO8A 4ZDWA 4FHEA 2D4HA 4ZCSA 1DBRA 5EN4A 2JZOA 4FQ7A 3RTCA 2QDXA 3BL6A 2WWFA 4EFDA 3DAFA 2AWOA 1ZUD1 4RCYA 1G2IA 3CKYA 3SX4A 1KRWA 2PO5A 2V7XA 4J0GA 3HL0A 5IK2D 5KTOA 1X1RA 1NMSA 4KQFA 2W9CB 1Z5PA 4PIPA 1P19A 4YPFA 3DZCA 1SQGA 1WXFA 4L75A 1VL2A 3HUUA 4WUVA 2PYIA 1H4TA 4XVRA 3S4YA 2CZQA 4NPAA 1EVYA 1Z6TA 5I7AA 3EF0A 3QKSB 4QNNA 3T3IA 5C32A 1Y3HA 3HYTA 1GZSA 1FEZA 2VSXA 1CUHA 1Q12A 1RTTA 2PUHA 1Y8ZA 3L8FA 2HZ7A 2AFHA 4C2UA 2VT6A 3I9V1 3UPDA 4YMWA 3QXGA 1P7WA 2A58A 4M7PA 4LPSA 3OU2A 4V2UA 3KXIA 2R84A 3UT5B 1U8EA 5DW3A 4GGOA 1UBRS 2IXGA 3ULKA 2PL5A 4ZDJA 1GPJA 2BMJA 1RR6A 4YJKA 2YJ4A 3ASUA 1MT3A 4BFTA 1WU8A 1AROP 3INYA 2IS4A 3AR7A 3NIGB 3BZUA 2PX3A 3IEPA 4Q9DA 3CLTD 1ADYA 4QUIA 2DFDA 2IZOA 4QREA 1V4NA 5TMDA 3MFIA 5KOHA 1GTSA 3KPYA 4JHLA 2WT4A 4BRWA 1QHHB 2G67A 3O1JC 2BEVB 4WMLA 1BX1A 2D5BA 3E4CA 1S76D 5EPEA 5BMVF 3WLPA 2IU4A 3UIEA 3SNKA 2FXIA 1L3IA 1ZMBA 2PSSA 1X3SA 2H1SA 2RHWA 4BB0A 2A1JB 1GQYA 5JNVA 3EK2A 3VR3D 9ICBA 4YYZA 4I6EA 1HFEL 3HB1A 2FPKA 3M9OB 1KAOA 1IXZA 3E7XA 2R48A 5IIJA 2GTHA 5EMMA 4DR3B 1X80A 5THQA 3EXAA 3KP1A 5KDOA 3M5CA 5J4YA 1GCIA 1SA0B 4WCVA 4GPZA 1CJUC 3MMSA 5JAIA 1INLA 3ME5A 4QBGB 2D1QA 3MOIA 4DARA 4DLEA 3M4XA 1A9XB 4G2TA 1ZSNA 1Z4LA 5KFNA 1YZ7A 2GLTA 2JFNA 2HBJA 2D74A 4GPIB 1CF4A 4LXTA 2Z1NA 3FOAA 4M89A 1L5VA 4G6ZA 4MVCA 3KQWA 4JT9A 2PFOA 1S7CA 2XX3A 1UK7A 4ZOCA 1JDBB 1I7SB 4YV1A 3BS7A 4NJEA 4TKMA 4DSZA 3S2EA 5SZIA 1VI2A 3FPJA 2P0AA 2FPIA 1ZXIA 1JDZA 3V8QA 4HGRA 3PXDA 5LIRA 3HCRA 4C3ZA 3KQLA 4OHXA 2VOJA 3M5PA 1U0EA 3L4KA 2NV6A 2XV1A 2R60A 1F6WA 4V1CI 3JQ8B 4I50F 1N8SA 1ZRMA 3FTCA 4F9FA 1ZD4A 3B3AA 1NYRA 2WUVA 4XCQA 2I4OA 3C3WA 1RPLA 2D7JA 3T3FA 5HR7A 3SC4A 3U7GA 2ZRAA 2A9JA 1ZD8A 3TQSA 3HM9A 1X1BA 4N48A 2YYYA 4OXIA 2QF7A 4F6RB 1R6VA 1SWVA 3AXSA 2LDXA 2WUEA 1NJFA 1KSHA 5I9SA 1YMQA 3KV1A 1R4AA 1G21B 1Y1PA 2QM0A 3IP1A 4O4LF 3KYIB 1ZEMA 3FKSA 3O90A 1JI3A 3HFRA 2I9PA 4W5NA 4XQ0A 4HLDA 4Y9SA 2HOIA 2VAXA 2VDQB 3HXTA 1DG1G 2ZU0C 3GRKA 4NCAA 4KLCA 1E7WA 3BXPA 3MTGA 1KRHA 4AZVA 5EQDA 2IUSA 3W9SA 4JXZA 3OH8A 3D4LA 2YZGA 4YMNA 5CLGA 3UV3A 1T9ZA 3ORSA 4EG0A 4ED0A 5JSFA 1MCZA 5I47A 2VHTA 5K6TA 3CKKA 5KEIA 1CE8B 3U6KA 2CFSA 2YQ4A 3I8SA 4HBZA 1JMVA 4MMYB 4OIMA 1L5QA 4MUAA 1DXOA 3D31A 4Y2UA 1NTRA 2IEBA 2R8KA 5FEUA 5DCYA 2OHVA 4ECXA 3MWGA 1GDDA 4LHWA 2Q2NA 1K8QA 1Z6QA 1T0JB 5COBA 3BXXA 3GIIA 1JG4A 4G84A 4O5OA 3CX6A 3WWZA 2Q0XA 3BC1A 4WZZA 3LY8A 4FINA 4FWIB 5F7ZA 4D82A 1YZLA 1N9KA 4F97A 5EZQA 3NS1A 2AKYA 3VUEA 2FUEA 3D2AA 4N12A 1L7EA 3ICVA 3FOWA 1IC6A 1N5KA 2PZEA 3BB4A 1NW3A 3FF1A 1U1GA 2WD7B 2G5PA 4C4PA 3LBNA 4X6XA 4EG7A 3UUFA 3TL6A 4V02A 4EA8A 1WXWA 4O1MA 1IPHA 3AF3A 2P40A 4DXHA 5G4LA 3PQDA 3UXPA 5KTNA 2UDPA 4XGIA 2YZ7A 2JAWA 1SCQA 4PYQA 4X92A 1DUSA 5HIKA 4EITA 3SBOA 2M6SA 1B14A 2HUPA 4GMHA 3NFYA 2AN3A 4ICIA 4I4TF 2B8TA 3HCCA 3V1MA 3C1AA 3KPJA 2X9VA 4KTVE 2WI8A 4LYDA 3RSLA 2RSLA 2OMKA 2ZBQA 4FSXA 4S0ZA 1IB0A 1GG2A 3TG8A 2JCVA 5J2UB 4NCHA 1BIFA 2GBIA 1K7YA 3CT4A 3WK6A 1JQ3A 4PLTA 4M8KA 4RZRA 4BNXA 3WRWA 3H5AA 2F6RA 4GXJA 3C5FA 4KLIA 2IYQA 1ZGGA 5BSFA 2AMVA 4MGZR 1KMCA 4I1OA 3K5PA 5CRIA 5TQ0B 2MINA 3WG9A 3U4AA 4F21A 2CB9A 5KFEA 4LFAB 1FS4A 4UE2A 3WJ1A 3RJHA 1Z1BA 1QH1B 5KFDA 4PLHA 1UKZA 2BV3A 3FCEA 4FBGA 3CQ9A 4MI9A 2HCTA 4LJLA 4DS5A 2BGKA 4KE7A 2EW8A 4JU8A 4M1MA 1U2ZA 3D9QX 5KVVA 3SENA 5ERYA 3LQRA 3OOJA 3DEJA 1VP9A 1GNTA 2O8EA 4L3OA 3WLLA 5ITZB 2ZE7A 1ZK4A 5J9FA 3WHLA 1N4AA 1ZIOA 1OKKA 1ZD1A 2PX5A 5BR4A 3U37A 4RZ2A 2GN8A 2QB5A 2Q1XA 4X3CA 3A9WA 1XRNA 4FBMA 3ZY2A 1EXVA 5DK4A 4CQMB 3AP3A 3H2SA 4X97A 4KMOA 2B9EA 2OUKA 4H77A 3JQAA 2JRLA 3FAHA 5AVKA 2Y9PB 1Z38A 5EIBD 5HCIA 4RNOA 4NYIQ 4RZSA 3GXOA 1P2BA 3JD0A 3H4TA 5JS2A 4DMUB 2BBTA 2UV8A 5AJTA 1CF9A 3LWZA 2C98A 4QFBA 2EDAA 4ALLA 5EMKA 4WOKA 3ZE9A 4TM8A 2YR0A 1DJPA 3KHKA 4BEJA 2E8NA 2Q5QA 5CXUA 3DZKA 2CDAA 3E48A 3CC8A 2ZSIA 1H2BA 4Y0VA 2Z2ZA 1G8KA 1MA3A 4QBHA 4BBJA 3D5EA 5IEJA 2GESA 3M6FA 3UJHA 2JATA 1WMBA 3HWSA 2ZJFA 5IYZF 5C5CA 4R1QA 2YMMA 5JR3A 3X1KA 2W22A 3LP5A 1M2EA 3S8EA 4ZANA 4HDQB 2O2JA 4NCIA 4R40A 1HEYA 5IVDA 4DT1A 2V4ZA 3DA8A 3KYCB 2DU8A 1JB1A 3CRW1 2WPDA 3LI2A 4QBIA 4EG3A 3EPHA 4ND5A 1T9BA 1M8KA 2CLOB 4J49A 3GR6A 4F7WA 1EBBA 2I4TA 3E22A 3B53X 4G5QA 1YR8A 3LT2A 4INJA 2HUNA 9ICEA 3K70C 4RC9A 4PBSA 2YNMC 3K0CC 4C0XA 4UXJA 3QNMA 1P7PA 1M5UA 4F5OA 4C7MA 4BKMA 1ZXXA 2CZCA 1ECFA 4IILA 3REQB 1N2CE 3FJ1A 2QYTA 5CM2Z 2Y67A 4KOAA 3JR7A 5FWXA 4PLCA 3IV9A 5G4KA 1E4YA 1GGJA 4B09A 1W4LA 4JVMA 3D81A 2GD0A 3V8MA 1VB5A 3EFBA 1JJAA 4IW3B 4WXEA 2JIZD 2JW5A 1T9HA 2GRAA 2W2LA 3R6GA 2HRDA 2WYHA 4PGAA 3WVNA 5E95A 5BSWA 3SS9X 3ZGXA 2OEHA 3SLRA 3PNQA 2XUGA 3KHTA 3O03A 3ID6C 3IOEA 5HF9A 3MCAA 3OE1A 5T4HA 4W5JA 3GBSA 3CRXA 3ASVA 3PUZA 1RZ3A 4D57A 3UG6A 4MV9A 5BYAA 2POQX 1BN6A 4QHSA 4OHYA 4BX3A 4HDMA 4ABYA 4CHTA 5DEIA 2AFHB 5JC1A 2ZWMA 1P6XA 3DW1X 5DK6A 2PKWA 4M9UA 4BJ3A 1V96A 4JB2A 4CG1A 2Y68A 2J0UA 4AK9A 1WQ3A 5ALHA 1XZQA 4ZJYA 3NP9A 3LPNA 3LGAA 3DPUA 1O97C 2CLSA 1Y5RA 3KO8A 1NU8A 3R3YA 7ICJA 4WBNA 2PUTA 5ETJA 3CLSD 3HN7A 4KREA 4MLCA 1DAHA 2F00A 3R4VA 3ZGVA 3ELWA 4NY8A 3VDRA 3ICXA 3BA1A 1SUCA 1CZHA 5I45A 5IDYA 4OMCA 1KWGA 2R7AA 5EA2A 2IV2X 1WD7A 3FVRA 2SKCA 1UKBA 2QLFA 5KOHB 2CNWD 4YDRA 3RFFA 4Q48A 5J0WA 1ILEA 5E3JA 1J22A 3EAFA 1COWD 5KT6A 2FOXA 3D4BA 5ALWA 1VE3A 3G23A 2N75A 1G5QA 3EX7C 2F62A 4FHZA 2CMFA 3R1IA 3IG5A 2ZSDA 4D0GA 3LC2O 4WA7A 2R62A 1Q5PA 2W8LA 3BE5A 2P9CA 3KFLA 4UVIA 2GA9A 1E1CA 2IJGX 4B6FA 3UMMA 3VR0A 2AGOA 5ALUA 1XYGA 3KD2A 3OUTA 3ACBA 1Y5LA 1GA4A 3VQTA 4Z9XA 4JCOA 4UQPA 3M81A 3DE0X 3RAQA 2BISA 3L7BA 3WK4A 1U3WA 2OAGA 4J3NA 3TVYA 4OQQA 2BGTA 2IZ7A 1XTTA 2ISQA 3VSAA 3MJSA 1D2NA 2X5XA 4X62B 4GHWA 2B61A 2PEZA 2HHXA 4NFSA 3U7EB 4GS5A 4C7KA 4DZRA 3W7AA 3ZS9A 2C4TA 3AM5A 3AKDA 2RG1A 5IM5A 2VP5A 1A5AB 1NP6A 4HXYA 2AFIA 2X7XA 2VANA 2BQUA 2QP4A 1K0FA 3CX3A 5DGTA 2QJOA 1FCJA 1WVMA 1R4MA 5J2FA 4BNKA 3UICA 4B9UA 4IQGA 5KTTA 2AYZA 3V6MA 1OT5A 2XOKD 3DTVD 4NJEB 2G5HB 3I39X 3F9RA 2JH9A 4C88A 2FPIB 3LWLA 4RQ0A 1KJQA 2AQHA 1QG4A 2JAQA 3B6IA 4EPYA 3V2IA 3TD2A 4GDMA 3U16A 4V0KA 3FVVA 2GKGA 3KOOA 2E5WA 1QO0D 2ZXFA 3IXQA 3THSA 3VYUB 3PD1A 4CXMA 4NRDA 2PMKA 2Z2XA 1XWLA 1SCIA 4HNAB 2HLDA 4JCCA 4G24A 2WJGA 5KFJA 2C58A 2D5AA 4CR6A 5JCJA 1T7PA 2PUCA 1L8LA 2ZYSA 1E9DA 1N2JA 4GF5A 4HQRA 5HGXA 4US9A 3B6JA 2DB3A 3VBEA 4YJGA 4KQ6A 4BEWA 2L82A 2F76X 3QGMA 4Q4HA 4NARA 4MYUA 1E5TA 1XAIA 4RDCA 4NQZA 2I6FA 2QQEA 4KN5A 5FWDA 4D6YA 1OPRA 3SYRA 2KK0A 2H5JA 3P94A 3TCNA 1ZSYA 2E85A 1GTL1 1HI9A 1CJVC 2WFLA 2JFOA 3OD5A 2RK3A 2UXDB 4USAA 3A2KA 1OQAA 2QN9A 4PZ9A 4KRFA 1ZM4A 1RQRA 2DZDA 1CBUA 1DKLA 3KJQA 3HYRA 1NZPA 2R2AA 4I19A 3ROXA 4OA8A 5C7YA 5JPDA 4N5DA 3ILSA 3KU4A 5CLQA 2OGZA 2WG2A 3WP0A 4M3NA 3D8TA 4PXSA 4LK2A 2GLEA 2OBNA 4GR4A 5DLPA 1PI3A 3QTTA 2GUGA 2ZRPA 3TQ1A 3O9VA 4RSGA 3PJDA 1I1QB 4KGZA 1UBEA 4AJIA 1ZQBA 4K05A 4QUGA 3ETEA 1KBZA 3DMTC 2FRXA 2ZRMA 2C9ZA 4F4KA 2AXPA 1NWHA 1DRGA 1C50A 4BFUA 3OJWA 4W9NA 1BXGA 4FWBA 2AJBA 4H27A 4EG1A 3NJ8A 3AR3A 1ADGA 4X91A 5JS1A 2ANBA 2Y1JA 1WY5A 2IE8A 4MKIA 3DEZA 1BE1A 4YCJA 1Z37A 2IHMA 3CW2C 3DEYX 3NHLA 4FJ0A 1VMEA 1XMQB 1ZN2A 3Q9SA 3WA6A 1RMQA 5JD4A 4GBED 2PUGA 2BHTA 1M6HA 2I3ZA 2X40A 5C80A 5B12A 3PSIA 2EZXA 3ANSA 2JAHA 4TTSA 1E9CA 1V26A 3KHUA 1E4OA 3R3WA 3UK1A 1OT3A 3J81A 4CEIB 4ZZIA 4RXMA 2I4LA 4YR9A 2FK7A 2EAPA 4Y30A 5C1OA 2MWMA 3ACCA 4M0MA 1L5ZA 1YOBA 3LZ6A 2ZAMA 4G0ZA 5T14A 5JECA 2NSJA 1RTKA 5CJPA 1KR5A 5IVKA 2Q41A 1G21E 2QJTA 5KS2A 2C5GA 4KIUA 3ZCVA 3GLFA 3LYUA 1M1YA 4R1LA 3ZYZA 2WU3A 2ESRA 3MGGA 4OK5A 3F4BA 1CI4A 2W2KB 3AUAA 2Q6LA 1J0XO 4HLQB 3EYWA 4LOIA 2DRIA 3LHIA 2NZWA 4LXIA 3VO9A 5H1YA 5HOQA 9ABPA 3T38A 2XHZA 3V9PA 4RDXA 5ESWA 4YCSA 2IOHA 2Z2IA 3GLQA 2ZSBA 3NUZA 3O1LA 1C14A 4DDVA 5DV9A 5L6LB 2C2RA 2FQ1A 3LLSA 1P5ZB 1ZISA 2OAP1 2MINB 3PV0A 1XLTA 3BMOB 1F8GA 4H6WA 2H5XA 5KU1A 3BFJA 5JADA 1SIOA 4ZT3A 5AVUA 4TWJA 2QN8A 3AQEA 1LBHA 2O50A 2PWYA 4IAOA 3ISCA 2RHDA 2E9SA 3MMPA 5EXXA 1WMSA 4QZ9A 3WQQA 2UUBB 3B5EA 3MZ0A 3FPFA 2O3TA 5ADHA 3FI0A 1FRQA 1JFVA 1CETA 2WKWA 1JG3A