4KX3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with thymidine monophosphate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Structure of murine cytosolic 5'-nucleotidase III complexed with thymidine monophosphate
rcsb
source organism Mus musculus
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4kx3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4kx3A01
1Z5GA 1S8OA 3MN1A 5AM5A 1ZRNA 4UARA 1Z4KA 2ZBEA 4PNHA 1IWOA 2WF7A 3E84A 4Y2YA 2CFRA 1J8DA 4NWIA 2Q4RA 3KOOA 5A3RA 2RARA 1RMQA 5AVYA 4C4SA 5AW2A 4XQ0A 2JARA 3DAOA 4EELA 5ALIA 5AI0A 1ZD3A 4YH1A 1Z4OA 3WK9A 3QU9A 3AR5A 5ALXA 3B8EA 2RAVA 5AKHA 1RQLA 2G08A 2YMQA 1RMYA 3FGOA 5ALMA 5ALDA 3A1EA 1VFPA 4OCZA 2R8EA 1YS9A 3PDWA 2HEGA 1KYTA 4E88A 3IRUA 3IJ5A 5AICA 2P69A 2P27A 4C4RA 2PR7A 2MSNA 4EENA 2O2XA 1RLTA 1XPJA 4EZEA 5AW6A 2C8KA 3NIWA 5ALPA 4AP9A 1Z4MA 3QLEA 1RDFA 4UU0A 2YJ5A 2B1QA 3NUQA 4IFTA 3CZ4A 2JAWA 3U26A 4EEKA 2I55A 2G06A 3B9BA 5T41A 3D6JA 5AVWA 3FZQA 4KNVA 3QU2A 5AM2A 2P11A 2HF2A 3WGUA 3QGMA 5AK6A 2PKEA 3ET5A 3SKYA 3U7GA 4RETA 1ZOLA 1T5SA 3L0CA 3OTQA 4DW8A 3WKDA 4Y2VA 3SMVA 3AR3A 3E8MA 1SWVA 4UAVA 4BX0A 1RLMA 2MU1A 5AI9A 1YDFA 1U7OA 1RC8A 1ZS9A 3AR6A 3SHQA 3NANA 3M1YA 3KZXA 4O8CA 1X42A 5AK3A 3QU4A 4RESA 2RB5A 4DWOA 3HLTA 5AVTA 3U7EB 2ZOSA 3TLMA 3UMGA 5ALUA 3N1UA 4G63A 3KD3A 3U13A 1U2SA 1PW5A 3AR7A 1O08A 5ALSA 4DFDA 4HYTA 5AW0A 3EPRA 3P96A 4YCNA 1TE2A 3ZI4A 5AM1A 4Y2SA 5AKLA 4MWOA 4H1WA 4AS3A 4Y2UA 5ALRA 5AESA 3L0YA 5AW5A 1JUDA 3VAYA 3L1UA 1S2OA 3UMBA 5AVZA 1RKUA 2FDRA 2B1RA 3L8GA 3BWVA 5FP0A 4F71A 1QH9A 5ALEA 3ZWDA 2OM6A 5AKEA 1QYIA 3WKBA 2HF7A 1EK1A 4B6JA 2ODAA 5AKZA 3ZUPA 3KBBA 2IA5A 5AM3A 4Y2RA 2CFTA 4UMVA 3NAMA 2WF5A 3QNMA 3MPOA 4I9GA 4EX6A 5AW7A 3W5CA 3QU5A 4OFZA 4AS2A 3U7FB 2IOFK 2R8XA 5A3SA 3OCVA 5AM4A 1U02A 1RRCA 4UM7A 1XVIA 2G1AA 3QUTA 4CNQA 2GFHA 1LTQA 4UAUA 5ALGA 4BNDB 4QJBA 4CF5A 1NRWA 3W5DA 3N28A 1ZD4A 3N8GA 2GO7A 1NNLA 3A1DA 2QLTA 3RFUA 4EX7A 2ZG6A 1SU4A 3E58A 5AVXA 1U2TA 5AI5A 3CNHA 3DV9A 2FPRA 4BEWA 2FUCA 2WF9A 4YCMA 5AW8A 2AUTA 4BX2A 1T5TA 4KX3A 4KN8A 2C9MA 1QQ7A 3WKCA 3ZX4A 2W4MA 2EAUA 3N07A 5AHXA 4FE3A 2B8JA 4NAVA 5AVRA 5AKJA 2HDOA 2AH5A 4JDPA 3I6BA 3SF0A 2FI1A 3GYGA 3BA6A 3QUCA 4Y2QA 3ZVMA 3A1CA 4FYPA 3AR2A 2NO4A 5AK5A 3A3YA 4C4TA 4MUMA 2PQ0A 4HGPA 5AKKA 3ZX5A 2OBBA 2B0CA 5ALTA 2VKQA 2EARA 3L5KA 5ALLA 3NRJA 1ZRMA 2YN4A 2I33A 1YNSA 3L7YA 3ZW7A 3B9RA 2B8EA 3AR8A 1WZCA 2ZBGA 4XPZA 2JAOA 3E81A 4HGNA 5ALZA 3MMZA 5ALKA 3SLRA 4QQFA 4BBJA 1ZD5A 4Y3UA 1Y8AA 1Z88A 2I34A 2IOFA 4Y2JA 5ALYA 2YMPA 5AKIA 1YJ5A 4YIKA 2DQSA 1LVHA 2B82A 4BNDA 3L8FA 4HGQA 4G9BA 4Y2TA 1L6RA 1CR6A 3WK6A 5ALJA 3ONNA 4Y2PA 4ZEVA 3SKXA 1ZJJA 1J97A 2C4NA 3ESQA 2YBDA 3L8HA 3UM9A 2HI0A 4XE5A 3WKAA 2I7DA 1QQ5A 4UASA 3KC2A 5AI4A 1K1EA 3W5AA 3FPBA 4UATA 2YJ4A 1L8LA 1RKVA 3I1YA 2HOQA 4UW9A 2HSZA 2ZXEA 4BX3A 5AVQA 1L7PA 5AKYA 3AR4A 2CN1A 2CFSA 4GXTA 4UU1A 4BYGA 1NF2A 5AKGA 4HAIA 5AKXA 3W5BA 5IT0A 3OCWA 2G80A 2HX1A 1RQNA 3J7TA 4KNWA 3PCTA 3QUQA 1N9KA 2HO4A 4NFLA 4L57A 3M9LA 4UMEA 2P9JA 3FM9A 4CF3A 1O03A 1F5SA 3FVVA 4YCLA 3U7HB 4OD0A 2GHQA 2IOHA 4CE6A 5IT4A 2G09A 5AW3A 2WF6A 5AIBA 2FPUA 2QYHA 3I28A 3QU7A 4I9FA 1MH9A 2YJ3A 3QX7A 1RMTA 5AVSA 1EK2A 3AR9A 3DDHA 3KDPA 5A3QA 3L8EA 5ALOA 2Q4TA 5AI6A 4UMFA 4F72A 3EWIA 5ALVA 2O9JA 4JB3A 3ESRA 1QQ6A 4YIHA 3ZTWA 3MC1A 2ZBFA 3EF1A 2WF8A 5ALHA 4KX5A 1RPZA 3PGVA 4ZEWA 2GMWA 2X4DA 1Z4PX 2FPSA 2YMLA 3L0BA 2YFYA 4FFDA 4NABA 4UMDA 2YMMA 5ALWA 5AVVA 4OHFA 4ZEXA 3WGVA 3WK8A 5AVUA 2C88A 1RKQA 2R8ZA 2FEAA 2OYCA 3NALA 3OCZA 5ALFA 2WFAA 3ZU6A 2R8YA 3R09A 1Z5UA 5ALNA 4Y2XA 2HHLA 1Q92A 1Q91A 1Z4NA 2WM8A 4NV0A 3PGLA 3QYPA 3WKEA 2YY6A 4J03A 5AK4A 3L1VA 2BDEA 2RBKA 3EF0A 1VJRA 5AW4A 2BDUA 3I76A 1YMQA 2D2VA 1RLOA 2NO5A 1TA0A 4BKMA 2G0AA 1U7PA 3F9RA 2FPWA 4KYTA 2G07A 3N5KA 4L6AA 3R4CA 3ZTYA 2C8LA 5AW9A 2WHEA 4DCCA 1XP5A 1WR8A 2BY4A 2IYEA 3FPSA 4L6CA 2OA0A 1CQZA 3NASA 4HGRA 2JGAA 3OPXA 5IS2A 2ZBDA 2W11A 1L8OA 2AMYA 5JJBA 1AQ6A 3ET4A 1FEZA 5AW1A 2FUEA 3S6JA 1WVIA 3ZWKA 1ZD2P 1Z4QA 3IB6A 3ZVNA 3ED5A 4J2TA 5AM0A 2Q5EA 1L7OA 3QXGA 2YJ6A 4GIBA 3WK7A 3HYCA 3UMCA 1N8NA 3RF6A 2FPXA 2W43A 3OCYA 1TJ4A 3OCXA 3R9KA 3DNPA 1TJ5A 5E0OA 4IG4A 5ALQA 3K1ZA 4YGYA 1WPGA 2B30A 2EATA 1TJ3A 2I6XA 2GHTA 3QUBA 5AI8A 1L7MA 1Z4JA 4BEVA 2AGVA 1L7NA 1Z4IA 1YV9A 1SWWA 2I54A 4UM5A 3WK4A 3U19A 1Z4LA 5AIAA 3ZVLA 4HGOA 2JAUA 2HCFA 4XOUA 1VJ5A 3SD7A 3WK5A 2NYVA 3OCUA 1T9ZA 4CF4A
chains in the Genus database with same CATH superfamily
5MFZA 3F0TA 4L4SA 5EEGA 2QP4A 3R74A 5KFSA 1TTPB 1VDZA 1JAIA 2HM7A 3UWMA 3C24A 1WYGA 4UAJA 4LJKA 4B3HA 3GVHA 1YHYA 4YRLA 4OHBA 2RK3A 3O47A 1VI5A 2QLMA 2IQIA 4KGXA 1V8ZA 4IXNA 3NDBB 2C22A 1DADA 4FOPA 4BX8A 1PUZA 3GPDG 4OREX 2GHIA 2MT9A 3R3ZA 1SCIA 3QKSA 3FCEA 1L7XA 4NBVA 3RJKA 4G1CA 3H5VA 4AYBC 3WIVA 3PUHA 3CYMA 4RPJA 3R5HA 3TBKA 2O8FA 2P9CA 3T5BA 3K3PA 3AMZA 4ZEMA 2GCGA 4TMZA 1R0XA 2EWWA 4S3MA 2I9GA 1HPLA 3WISA 3V7LA 1F0NA 3VVLA 1Q3KA 1VE7A 4K26A 4FYIA 3PVSA 3L18A 1AHPA 1E4YA 5LKAA 5AESA 2UKDA 4AZ0B 3OWHA 3NM6B 1RD4A 2ZJ3A 4CKEA 3CTMA 3L8GA 1E2EA 4CQNA 3CVUA 1QVAA 2CXRA 4PZPA 4DSJA 2F2TA 2BMDA 3UB3A 5K3SA 4JZYA 1Q95A 4UHJA 2QUJA 4LZAA 3JD4A 2DUNA 1TT7A 4RFLA 1WKCA 1GL7A 3CPHA 2DFVA 2Z4TA 4QJFB 1C50A 4N4AA 4J0EA 1GTMA 4W1QA 4OHVA 2XUJA 1CZOA 1IAVA 3KRTA 4DR6B 2CF6A 4GP7A 2BPFA 2ZXFA 3DVAA 4QWDA 5KFAA 5GZ3A 5HQ3A 2ZRGA 3TL6A 1E59A 3WADA 1QHYA 1EQAA 3KE9A 2N47A 3L8ZA 4UAGA 2ZB3A 4XOIA 5KTQA 4MZXA 2OFOA 2HTFA 4WY8A 1EGHA 2XZOA 2WHPB 3K09C 4CL3A 4F9GA 1F2TB 3TRKA 3TLBA 4I1VA 3W6ZA 4KQXA 5HS4A 3B13B 1HDCA 1PEYA 1L4BA 1DCFA 3U6KA 4ZEOA 3GQVA 4O5EA 1H4SA 4IVPA 1EG2A 2FEMA 5JNLA 1K1EA 4QL3A 7ICFA 3FNGA 4O2AF 1P2GA 1LDGA 3WWOA 5DT2A 1U7TA 3V2UA 3B1FA 2YZ2A 1VSTA 2A30A 4G07A 4ZTZB 4FN5A 4KV9A 3O9ZA 3EZLA 1D2HA 3LCCA 3EC2A 5ES3A 1PHPA 2ZTVA 3H2KA 4BLWA 1P80A 2CLOB 1EA5A 1H5QA 3TNYA 1MN8A 5DM0A 1ATZA 4H3VA 3BS5A 1UBLS 1YR6A 4WZBE 3UXPA 2JLQA 2HJHA 5I7SA 1RLJA 5IBCA 3AEUB 1Z28A 2YMLA 4HXYA 4Y98A 4CEHA 2PANA 1Y1SA 1GTVA 3ZU6A 3CUKA 2LW7A 4OB8A 5F9NA 4Y2XA 1M2VB 2CHVA 2I9KA 3FNBA 2C54A 2ZE8A 2D2VA 4RQNA 5C0YA 2YZ7A 3EXHA 2HFKA 3ZTYA 4U63A 4D56A 4PZDA 1LWOA 2ZSBA 5DLYA 1GN8A 3O73A 1RZTA 4NQZA 4A0GA 1OLOA 2AR9A 1RM4A 1YBFA 1UDWA 4BKRA 4ZI2A 8ICTA 2FE1A 4WKBA 1JDZA 1UJMA 2BCRA 3ZVNA 1GL6A 2VSOA 3CR7A 3O4HA 2W42A 5KQSA 1N2CE 2FJ6A 1P2SA 1FYDA 2W2MA 4Q16A 2PRYA 1J2JA 1FDSA 4JP2A 3FNHA 5LKRA 4QAQA 2W2QA 3OOHA 1WPRA 3HUEA 5DN6A 3VZSA 5A2GA 4XUCA 2ECFA 3MQ2A 3TG2A 4HAWA 1UKYA 4H7KA 1RAFA 2YCBA 1CEXA 4G5YA 3CW8X 5WRFA 1GAXA 4YWHA 3IDQA 3IXLA 1IPEA 1WXWA 3PUWA 3NG1A 3K70B 3DBRB 1PV1A 4TYPA 4YH1A 1DAFA 2ERYA 4CM7A 5AKHA 4FWBA 4KN9S 4JLMA 2I91A 3OU2A 2AC4A 4IXTA 2P68A 2FR8C 3DT6A 3TXYA 2WP0A 2IIPA 4TVKA 4GWGA 3H9CA 4GYYA 3RT1A 2DFKB 3O9MA 4YJ2F 2PWZA 1C8KA 2Z2IA 3NVAA 1LKYB 1NBHA 2CJFA 4IHQA 4JOCA 5GJBA 4IJMA 1L5RA 4NH0A 3D6JA 3AJAA 3E3OA 2C77A 4FFVA 2X9VA 3AM9A 3NTRA 3KKLA 2V7PA 4MCJA 3EOZA 4J16C 5I45A 1GUBA 2UYCA 1CJBA 1C7IA 1DXYA 3K9CA 1XD2A 4CM4B 4KOAA 4RL6A 1F7UA 4BOYA 2ZKLA 4W5WA 1DARA 1GNTA 4EW2A 2YTZA 2E3TA 2EKPA 1QCZA 3JPSA 2HLHA 4E2WA 4YCNA 4P32A 3H2GA 3KAJA 4Y2UA 1FTGA 2JRCA 1VGVA 3A4YA 4J9OA 4L5IA 3EIFA 1II8B 4J6EA 1LDBA 4GLFA 4ZVMA 3S5JA 3IJEB 3MWEB 1YSCA 5DTMA 5DULA 3N74A 1B8OA 4N1AA 2QX9A 2VZ0A 4KQ2A 3OLVA 3LA6A 4ZZ2A 3BWBA 1NKEA 5FEUA 4QJBA 4AICA 3Q2KA 3LVFO 1NXWA 4Q12A 2JLWA 3OZVA 3PNYA 1MTOA 1NQUA 5IAEA 2IEZA 2ZE5A 3E5NA 4NE9A 4D4HA 2FUCA 2C3YA 2PAFA 5HCIA 1V35A 3WRWA 1XNQB 3D9QX 4WX2B 3T9FA 5AHXA 1NUPA 2BFPA 1MIOA 2V0GA 3IDZA 4V3BA 3VVBA 3H5WA 3IBTA 2C28A 1MGPA 3DE7X 1EUDB 1AK1A 5AQ1A 3SIWA 1CUDA 3NOXA 4NAUA 2NVOA 5ALZA 2QUZA 9ICHA 4BVLA 3QPUA 1Y37A 2CXHA 4FFPA 3CRW1 1CEYA 3WYBA 3GEDA 3RNOA 4RZ2A 1MZVA 3F5EA 2PN1A 4Z51A 1PZHA 1CW2B 1SCAA 3IUJA 4G5RA 2F43A 3TZQA 4DA0A 4G1MB 1R4NB 5HA5A 4AN4A 4Q9DA 2JZNA 1Z0DA 4A03A 2KHVA 3HCCA 1CP3A 3KYCB 4HO1X 1EE1A 1PTKA 4ZXFA 4OSEA 3T7TA 5EJ7A 4O1IA 2BGMA 3BREA 2UDPA 2X5KO 5KFZA 1W1IA 1ECPA 3BDPA 4B8ZA 1YR8A 3LZCA 2QRZA 1NX9A 3RJ5A 4RPKA 4FGUA 3E0XA 3NM5A 4LWQA 3RBVA 2RHMA 2JW5A 1YVRA 1Q7CA 1X1SA 1KXZA 3OZRA 3O3OB 1I36A 1TJPB 5DASA 2AG5A 1K89A 1VFNA 3KDPA 4MSUA 3A28A 3UH0A 5LZ4A 1QSYA 5KHAA 1XZHA 3ENNA 4YR3A 1D09A 4IS2A 1B6RA 1YRQA 1PSZA 3P9KA 3R9XB 4YJ3F 3L0BA 5CPFA 4P5PA 1H8HD 3CEJA 1Y6JA 2ZREA 3EGEA 4HH3C 2HSWA 1JEOA 2RI6A 2CLMB 4B8WA 4YMOA 4PPNA 1V4BA 1HURA 2CLCX 3THWA 1B73A 5K0CA 1IJBA 4WNYA 3B6KA 3AHCA 4K6FA 1JMYA 1Z5PA 4L78A 4K9OA 1WIWA 4BN0A 2GARA 2ZBUA 4OSOA 4PHAA 1BQ3A 2XZDA 2YVKA 5D86A 5KKAA 1UOPA 1N6KA 4EGQA 2P3SA 4YFYA 2GRJA 3F8SA 3FDZA 2V7UA 2NO9A 3PICA 4RH1A 2EBHX 3CLSD 4MAFA 4PG8A 1TZMA 2YIJA 1JXQA 3C0KA 1HTTA 4HOYA 1Z4IA 3A58B 4ZHQF 3DE1X 2AXNA 2F9LA 1W47A 3L7DA 1J25A 5HHTA 4KZPA 1QM5A 1YI8A 3BMQB 4KPFC 4MCIA 4OHOA 4K28A 4TXHA 4A1FA 2K4HA 3K4GA 1Z4KA 5H81A 4W7IA 5CA1B 1V3QE 3ADCA 4RGVA 4XSHA 1W5SA 2ZI7A 2FR8A 2PRJA 3ICCA 3TLEA 1T9BA 3CLUC 3T54A 1DUVG 3DAOA 3HG7A 3DYVA 3I12A 2PGOA 4Q4HB 4G09A 4OFXA 5KOIA 2DC1A 2RGWA 1G7RA 2IJGX 1WU8A 3CY6A 4HSGA 4GOXA 4LJLA 4ALIA 3AWIA 1QC5B 1AQIA 4UBKA 2VJ5A 4W5OA 3L8CA 3L41A 3N05A 3ND5A 4P38A 4WQMA 1LLQA 5EQDA 4WNCA 2NO7A 2AXQA 3DDOA 1T5SA 1BQ4A 4EG5A 2WB1F 1GFWA 9ICGA 2W00A 1NONA 2W48A 3D7MA 3ODPA 2R751 3NHUA 3E9CA 4F86A 2XODA 2PL9A 3STVA 4P9NA 1QF7A 3QEKA 3H3JA 4BS9A 1PBTA 1M6VB 1NPYA 2H7CA 1P4RA 2B8WA 3H87A 4N40A 1KR2A 4JJZA 2EQ5A 4ZQGA 1MQSA 2AW5A 3UBMA 2Q8QA 4UEKA 4GOMD 1GDDA 2X8LA 4QRDA 5JATA 3ZUPA 2WUFA 4MMZB 4HCJA 3FYDA 3LAWA 3MGBA 4FO6A 3CZCA 3VBEA 2GBLC 1YZLA 3E05A 1ZINA 4PLHA 3UIEA 1SZJG 2ZS8A 3SS9X 3WRYA 3KUKA 3K8QA 2QJFA 1B8VA 2WU1A 3L1IA 3BGWA 2O2IA 2FSFA 4ZANA 3SE7A 3WBJA 3MJFA 5ILQA 5E6RB 1IBRA 3LCJA 1DHRA 5TPWB 4QGAA 3RDPA 4NTZA 3Q9NA 3TZ6A 3OBIA 4CLOA 1G1AA 4G4SO 2YXPX 1EHCA 4DREA 3ENZA 2VKQA 3L5KA 1T9GS 1V2GA 5JUMA 1WZCA 2GVDC 3FOBA 1VE9A 2PSJA 4RY9A 4GPIB 3RT7A 3ONVA 3SC2B 1GDTA 4P3PA 2KZ3A 4DIDA 1Y9AA 1ZHFA 3DLHA 3PG5A 3M89A 4QUDA 5KNBA 1YO6A 1JU3A 5EZQA 3LY7A 5JJCA 2HMWA 1M0EA 3NT2A 3TB6A 4INPA 1TF5A 4UD6A 4GXTA 4C6HA 4QJ3A 4P4OA 4MJLA 2XUZA 2E1FA 3M7IA 1ISHA 2QP9X 3DFMA 4CM9A 3KZNA 1DG1G 4JXXA 4AYBF 3NIBA 2XX3A 1XEAA 3KCQA 4KPUB 5FOTA 2BGJA 1BE8A 1VIYA 5J1SB 2A35A 5JRJA 3VHXA 3UAXA 3GJZA 2HAEA 2WV7A 4AY4A 3SXUB 4Z5XA 2Q5IA 1FJ2A 4QUEA 4PYQA 3TCKA 1COKA 1R0KA 1WD7A 2C2RA 1W25A 3PKZA 4RFSA 2Y1OA 2NX2A 1OWMA 2O2YA 4EA6A 3U9LA 4ZYWA 3OKAA 5JRTA 3BWDD 2ZLBA 3DOUA 4IOKA 4GBMA 1EXNA 5FDFA 4RAQA 2XI4A 1UBJS 4IDEA 2P35A 3T52A 4WCDA 2VJNA 4BKMA 1XV5A 1NZBA 2BHNA 4QU8A 1Y6QA 5DNDA 5D84A 3I2GA 3VR4A 1K2VN 1H6DA 5FPTA 1C0PA 3GNSA 1SVIA 3GIWA 1E2FA 4MQFB 2P6MA 3SS7X 3JWEA 4TLEA 2FRVA 2EDAA 2SICE 3QF4B 2OBYA 2A94A 1K27A 5BW6B 2ACVA 4YAFA 3OCYA 3NC1C 3DNPA 4Q00A 5G02A 2HBJA 3TM4A 5FJIA 4FP9A 3RJIA 1S0MA 1YV9A 3T7CA 3VX3A 5KYNA 3KZVA 1UMCB 2H07A 1IQPA 3F49S 3WWDA 5AIAA 5EQFA 3MILA 5AJWA 5DBIA 1UA1A 5J0PA 3GLRA 2X0DA 4LZOA 2DP4E 2Q3FA 5A3VA 1J9EA 1QK3A 4ZVNA 4OAQA 1YHNA 3IALA 4G4SP 4RGQA 5FLKA 5HVNA 1E1QD 4FEGA 2G5HB 5JZ9A 3NTLA 3L4KA 2C2BA 4BMCA 4OBEA 3S2ZA 2JI7A 3T3IA 4DSOA 1ICEA 4IHKA 2Q6IA 1RNLA 3WHLA 3B3FA 4KRFA 8ICYA 2R2AA 1WNFA 3BKWA 3CZ5A 2JZBA 4RD4A 1DWPA 1NOIA 2H65A 1H1LB 4L5BA 5DYNA 2YW9A 3KPJA 4ZTUB 3ORSA 1KDPA 3PBKA 4JI5B 3S99A 4XCVA 2V1UA 4BASA 4V38A 3OWOA 2CDAA 1YE5A 5B3JC 2JHPA 4PLTA 1D8LA 1DQYA 4OA5A 3DFKA 7GPBA 2BEUA 2YY5A 1R0LA 3TX2A 4MWGA 3DMNA 1R4MB 2Q0HA 1TAUA 4ND3A 3G5TA 4GOOD 4CMIB 3I2HA 5EKTA 4AKEA 3DOEA 5LZ9A 1MDFA 4K9NA 2VH1A 3WP0A 3A6PC 5IKPA 2FDRA 1PWXA 5HE8A 3U31A 3CTPA 3AV3A 1PR9A 3BYZA 3WS7A 1G55A 1KOGA 2GJ9A 3QU5A 1P8JA 2M9NA 1KVTA 3H4DA 3TSYA 4MMYB 4FYMA 5MGBA 4M1QA 3KQNA 1RXUA 1DEOA 1XKXA 1U2TA 3EH1A 2VAMA 2WJIA 3ANSA 1R3DA 4IDQA 3L0SA 4URWR 5E1DA 2B21A 3P9YA 1G3UA 3UO8B 2HY7A 1NK0A 1WBDA 4URYR 1ZNZA 1TZCA 1RRFA 3BRWA 2ATVA 1PZNA 1UK9A 3FYUC 1JHPA 3ZLVA 3BCSA 1NG1A 2AJBA 4A1OA 1DKRA 2IY8A 1LSOA 5JCPA 2PEYA 4PZAA 3A8TA 4JP3A 2Z04A 2IOFA 2SKCA 3DTVD 4ER6A 1IWPB 2PUTA 2VAWA 5HOEA 4MO2A 1TIPA 4RMJA 3G0CA 4RMNA 4ZYZA 1OFHA 3JQBC 4EEZA 4ARBA 2QMYA 2XCUA 1DBPA 3BTVA 2QOEA 3AWDA 4RUKA 3LWMA 1FFHA 5EA2A 1O97D 3TQCA 3NM4A 2XJ9A 2OMKA 1HT1E 3TX6A 4E5YA 3AUUA 1SKAA 2DPJA 2WSMA 2ASVA 5A62A 3IIJA 1JS1X 5FWNA 3VNUA 1UODA 2ZWPA 2QE6A 3EEOA 5DV9A 2NWQA 2DH5A 1PW7A 4TQRA 3QZ8A 2O05A 2C9OA 3QELA 5JZOA 4Z2AA 4M8IA 4Y1EA 2WF8A 3ZCPA 5TC4A 4OYYA 3TKYA 4H4DA 4J49A 4NKRA 5IG2A 2KNJA 4U7WA 1L5NA 4RQAA 4RGYA 1QIHA 1JJIA 3HB0A 2R8ZA 3D2SA 2H48A 3E9YA 3QQ5A 1MBZA 4U3JA 5EHZA 3K4PA 4MYCA 4WZBB 3TCNA 3ZCVA 4K0RA 5HE9A 2GD2A 4ACOA 2VP0A 3TYXA 1YBAA 3D5TA 1IZYA 1U7PA 2VS1A 2V6JA 4ZT6A 2ONYA 5EOVA 4FCVA 2ZDQA 2Y05A 5D46A 4QZVA 3FCAA 1FNDA 4I4TF 4LF5B 1UT6A 1EX7A 4PHDA 2CVOA 3B1JA 3EXEA 2UUBB 4ZMBA 4JKOA 1G8AA 2XEXA 1P9LA 1N1EA 3UHJA 5TE9A 2QL5A 4WKNA 4UDXX 3B5JA 1KAMA 3ITKA 4MI6A 4DZZA 2AGVA 4GW3A 3UPTA 3OIDA 1DO8A 1KMNA 3D4LA 2HQOA 1BHQ1 1N2CB 1PQPA 1UP6A 3KHRA 4RZSA 1XAHA 5EMHA 5IFLA 3PFWO 3O4IA 2QENA 2JD1A 2Q4RA 3Q3VA 3FGPA 2G8NA 3MELA 5BV0A 1BDBA 1TTQB 3GRRA 2L2QA 4YQZA 3ZK7A 1EUQA 4DL6A 3EEIA 2P75A 4F5NA 2IA6A 5DB9A 1CB7A 3AJEA 2VA9A 3BQTA 3RTBA 4DXHA 3LFTA 1Z62A 1T25A 2O0KA 3AG6A 1QCCA 4XWGA 3SDSA 1F06A 3H0CA 2FOLA 2WTNA 4YRJA 3PR1A 4MKRA 1XL0A 2WJAA 2BEWA 3I3OA 3Q72A 3QVGB 2C42A 1XEWY 2ZTCA 4CEJB 1UZNA 3KS9A 4Q0MA 3MB8A 2VRBA 1IPHA 2XKBA 3IYLW 4A0HA 3VYSB 2ZWVA 4RA9A 1I10A 4LF8B 4ME6A 3OKFA 1J06A 1RAAA 1RC8A 2ZAIA 3AR6A 3T38A 5CVEA 3UW3A 1QMGA 1MXHA 4O2AB 2NRTA 2FQ1A 4O0IA 5BORA 3C3XA 2CNLA 3IPXA 3QX3A 4HLUA 2IHYA 3S2UA 4MXDA 3WWYA 5BR7A 4ZO7A 1NZPA 3GW8A 4MQEA 5F1YA 4ICAA 4OQPA 1XJ0A 4B3IA 4AJLA 2RONA 2OXOA 2OC4A 4U0JA 3DUFA 5AM3A 3UANA 1Z2OX 3DDUA 3MJSA 4NEGA 3PT9A 3W2GA 4UM7A 3IHTA 5A5GA 2C2ZA 3MERA 4Y30A 5DMXA 2BFDA 1FPMA 4GP9A 1U9LA 4PYIA 1W30A 4PYKA 2KTQA 3HO6A 2FPRA 1QANA 1AIPA 2ZT5A 1YVUA 5KYXB 3ASVA 5AVRA 1P4HA 3MJHA 2IEYA 2ZRJA 3F5DA 3BA6A 4BV8A 1KEJA 1Q6ZA 3A1CA 2R6FA 3AR2A 1M3SA 3TR5A 1UOOA 2GPYA 4Z1MD 3VPHA 1ZQBA 2SNIE 3JQRA 2R8KA 2ZYGA 2CB0A 5GINE 3NJRA 1N0WA 2A8YA 5JC8A 1YJ5A 2YX8A 3C70A 4QYIA 1R27A 2YQ4A 2C4NA 1X7ZA 5JJKA 4Q05A 4EUNA 1KP3A 2WVHA 1Z06A 1XKQA 1IB6A 3M9MB 4LYYA 5I8ZA 3A7EA 9ICUA 3BCUA 3V4VB 5EKXA 3NV9A 1LBEA 1UWCA 4M9RA 5SZKB 5FHRA 4UEOA 4M47A 1T2DA 3C4QA 4HDNB 3WNCA 3BMCB 3ZUGA 3UXMA 3ZD8A 4RD2A 4X41A 1P2TA 3KEOA 5JPDA 3OMLA 3ZIAD 3IBFA 1HO3A 3CCCA 3LJKA 2A4KA 1XYYA 4JB3A 1VL2A 2FMXA 3K2QA 2ZB8A 4D41A 3HDVA 5FCDA 3RVPA 1Z4PX 2GN6A 1AOXA 1M0SA 4DBVO 4H7DA 2ZIXB 1JTEA 2HXSA 3FC4A 2R8OA 2KQUA 1XTRA 4YJ2B 3VO1A 2MAXA 3DEYX 1N2SA 4MRPA 1NXQA 3MAJA 2BDEA 1NW5A 4LNUB 3RB4A 4HRAA 3AP1A 4RF5A 2HDNB 1PT7A 2Z2ZA 1GG5A 5K8CA 4BFUA 4RVSA 4HWSA 4RA6A 3OPXA 1E99A 3IG8A 4EGAA 1ZSVA 2AUMA 5HCNA 5GJCA 3OLYA 4FS3A 2I1LA 2YHAA 4ZZ3A 1O89A 1JQ5A 1X6VA 2RCNA 3AF5A 4D9HA 3OZWA 4RF2A 4Z99A 1ICIA 4I1SA 4KTTE 5KFNA 4H18A 4KUHA 4QXOA 1SZDA 4EGJA 4UM5A 4EGCB 4NJOA 3L6BA 2B1IA 3ZVLA 1NN3A 2E1EA 2PLRA 5F98A 4MGHA 2X22A 2C7OA 1E9AA 3SD7A 1RQ2A 2X8JA 7MDHA 1BW9B 5CDFA 2P5SA 1ULTA 1IEWA 4PNHA 3NS1A 5AUOB 5DK4A 4FOLA 2FPLA 1DWQA 1B16A 4KDRA 4NJEB 2VWGA 2MR5A 1RYEA 3K0AA 3TK1A 3JQAB 1K8QA 5CA1F 4JYZA 1MRZA 4YLGA 5HILA 4KWCA 3T99A 1CBUA 2HO5A 3HN2A 3RH5A 2RQ5A 3PDUA 2ENUA 4HDKB 3ANTA 1V5EA 4JI7B 1KEPA 4JBWA 3OQNA 2Q4DA 3STYA 4ID3A 5K03A 3HWWA 3B2EA 5CDUA 1M83A 2IHZA 3QPVA 5CRXA 3LCMA 2ZPUA 1P7CA 3PWZA 3HCAA 3OEEA 3EDRA 4QE3A 2C5SA 2HSJA 2J9FA 4YD2A 4AL4A 4LHVA 1EVIA 2B9EA 3ZEIA 3OJFA 3JU3A 5LQAA 3EVAA 3DWIA 3IJRA 4TVBA 3SSAA 4ECXA 5C1BA 3PEEA 1HL7A 1OI4A 3TWOA 1Y82A 3RS8A 3RSLA 4BFTA 2VPIA 1CQXA 4FE4A 2HH9A 5FWAA 2GUWA 3LUBA 4BATA 4FNMA 3P9ZA 1FOEB 3OPYA 4QFCA 1Y81A 5K0SA 4Y1GA 2Z8YA 3GHHA 3QKSB 5H59A 4JMPA 2WWHA 4JX9A 3NT5A 1C81A 4JUZA 4YQWA 1GQQA 4Z6KA 1NV9A 2IA5A 1Y4SA 1VMAA 4LVOA 2A1UA 1KTVA 2O8FB 2BM1A 2R3SA 3H2JA 3M83A 1TXGA 3IUNA 1DMSA 3GXBA 4YJ3B 3CF4G 1A5ZA 4MV7A 3IKTA 1AQUA 1Q1EA 2VWHA 5CVJA 3UH1A 2I3ZA 3EQ2A 1Z8NA 4ITVA 4AWAA 3VTAA 3ESCA 2X8AA 4FLEA 3EQ8A 5DB7A 4OXQA 2J6IA 4DABA 4LK2A 4HGZA 1TQ2A 4R98A 2W70A 1SKUA 4HZUB 4FHDA 1YNSA 4UCQA 1U8TA 3U60B 4GE3A 3T9DA 4EABA 2QRVB 4XR4A 5TGTA 1D5CA 4E46A 4N82A 4KVZA 1Y7PA 1K6JA 4OOFA 3WK6A 4AWBA 3IT3A 1JFLA 2J5XA 4G89A 4ZHSA 1QNFA 2C9BA 3G82C 2GFQA 4M7RA 1SC4A 2QE7D 3N86A 4G4GA 1GUZA 4KITB 2OQIA 2DWQA 2XRYA 2DY1A 5C7IO 4GUDA 2Q4OA 5HQ3B 4EWLA 5HRCA 1RW4A 5CNMA 3H83A 3WZMA 3F6EX 2O8CA 3GRZA 4HFMA 3CUSA 8ICVA 1TYEB 1F8UA 3DQQA 1DNPA 1DUSA 2DVMA 4ECZA 1O95A 2A9VA 5C1IA 2YNMC 1R0BA 3WA7A 1DT3A 4EZ6A 3RPEA 3OD1A 2BCVA 2ES4A 3P2EA 1B6GA 4OAOA 1R0ZA 2XD4A 1OFTA 2RIPA 2GF0A 1JROA 3ABSB 3P5SA 2HJ9A 2A9FA 4H7PA 3V8VA 4BNIA 3I01A 3EF1A 4OI0A 5TISU 3PGVA 3PX3A 2O2SA 5BNTA 2G1UA 1QDEA 3UMJA 1M8GA 2FXVA 3E8SA 4UHDA 3H8WA 3QWBA 1P5RA 3ESAA 1H2XA 5B12A 1MH1A 3GL9A 4OMDA 1RQXA 3AY6A 2C0PA 1LC0A 2GEJA 1Z6TA 4C1BA 4QD3A 1KHHA 3C5GA 1X92A 2K4IA 3LY5A 3DR3A 4YWJA 4K2AA 5JJBA 2OC9A 1JIXA 1LZLA 3BS5B 2WFLA 2GBPA 1M7HA 5K9ZA 4LXYA 4OLBA 4ZI3A 3O8CA 4J0FA 3FUVA 4O0LA 3O7WA 1RTTA 3ZNPA 2FWAA 5CFRA 1JU4A 4BEVA 1QP4A 4FW8A 2HK6A 4O4IF 3DWFA 4FHFA 4C2UA 4NDAA 5JNSA 3U19A 2ZUWA 3KOWA 4RD1A 3EXHB 4KG7A 4I7EA 5IILA 5JD4A 4YMVA 1LNQA 3AY3A 2XPCA 2H08A 4JLBA 4ETWA 3TNJA 3C6XA 4TRRA 4HPWA 4G5HA 1Z4OA 1SXPA 3UCFA 2NRXA 3IR7A 4AG5A 4LDQA 3B1ZA 1ZA2A 1QIJA 4B75A 3F9CA 3TL2A 3WHKA 2G72A 1U7ZA 1VLVA 1KTIA 4LSWA 2A59A 1IXYA 5KBYA 1PFWA 3MTQA 2GEFA 4ZU1X 1SZPA 1ENPA 3WLIA 1BVYF 1RPJA 1ANKA 1ZJWA 4F3RA 2VTBB 3GGPA 2HSGA 1R8QA 5IXJA 1V8OA 1RLMA 2DOKA 2ISCA 3OFVA 1RHKA 2XOEA 2NUTB 3CWQA 4O4JA 2H3QA 3FPLA 2CY0A 4E15A 4J9RA 3KT0A 4ND7A 1L1FA 4O33A 3QMWA 1TE2A 2O7SA 5KFFA 4UBOA 5JD3A 1R6VA 2Y93A 4E09A 5THKA 1R9JA 3NIDB 2FZKA 3DMRA 4I5FA 1YB5A 2GNPA 3LUKA 5FOSA 2ZSEA 2GCNA 5JYEA 4MUKA 4W9RA 3K0CA 2Z4RA 1J90A 2VN8A 1VP9A 3O2SB 1ZY2A 2DCMA 4AAYA 5LQRA 4MB2A 4BU0A 1DQNA 3HXQA 3LKDA 1LTQA 3PDIB 2VAXA 4DXAA 4PBRA 5K0EA 1GT6A 8ICPA 5CEJA 1ZI9A 4UAYA 3IE0A 3E7DA 1DRJA 1VOTA 2WJYA 4S1VA 1ZVKA 3MWDB 4C8NA 4FQ7A 4KX3A 1RKXA 1ODJA 4Y9DA 4X60A 2IK8A 1Y7HA 3FRJA 1QFZA 1P9WA 2GEDA 2JKYA 4QAJA 1CUCA 4QZGA 4LWZA 5MDHA 4EUFA 4HJRA 2P9EA 1OWNA 5G0VA 3FJOA 4J0DA 5E9QA 2NP7A 4JA2A 2BFNA 1HMPA 1YUMA 3A6ZA 2WJ3A 4PHEA 4XRHA 1SKSA 2PT7A 4YT4A 1J4AA 4ANFA 2YMPA 4JYMA 3ICOA 1OYYA 3D6TB 2IZ0A 4QQKA 1QQ5A 4ELVA 5GM1A 3IQZA 2YNMA 1ABBA 2NYRA 3MJTA 1TM2A 1I6WA 5JAQA 1DG3A 1N0UA 2RGXA 3H42B 3HMKA 2CGEA 1EA7A 2EFCB 3BILA 3ZE7A 4RHXA 3VU0A 4RTLA 3RABA 2KW5A 4YUZA 4N6OA 5IX8A 3PV0A 1RQNA 1X70A 1YUNA 4M55A 4QOFA 1QIMA 3UEOA 4RQTA 1OXKB 1MHPA 3LW8A 3VZBA 3A4LA 1XNGA 4CDMA 1U47A 3GRFA 4CE6A 5B1SA 2Q6KA 2JGDA 4P7KA 8ICZA 2Z09A 1T1SA 2J9GA 3EVCA 1CUKA 3E22B 4PRYA 1CVLA 3M6AA 4MR9B 1P6XA 2G5CA 2H3ZA 4AKSA 1D2CA 4XPIA 2JS7A 3PQ3A 4X24A 3VUFA 4K8OA 3AP3A 1FFYA 1SU6A 1PVQA 2FP4A 3M4YA 4D79A 3GPBA 5IBRA 5AVUA 3KU4A 1Z16A 6LDHA 3KL4A 4TZ0A 5LMZA 3ACDA 3MMPA 4GXKA 1ML4A 5LYJA 2P2YA 2BGRA 1YU6A 2AD5A 2DLCX 2P67A 3LH5A 3LBAA 3FTQA 4BLSA 3BA1A 5J0TA 5HQJA 4QU0A 4IDPA 1VL5A 4RZQA 4R2MA 3GFQA 1DCKA 4OHMA 1L8OA 4E5DA 1C9JA 2GEVA 3OJCA 1ZH8A 5TX7A 1LA2A 1SNYA 4TL9A 1XALA 3I37X 2L18A 3C3YA 3K9WA 1N5MA 3R6LA 2RHHA 5FOVA 3TNLA 1J8VA 3VMFA 3FLMA 3HP1A 1P4SA 4U7DA 5EIFA 2LXNA 2HJWA 1XLWA 2X3YA 1G4HA 1TMGE 1DLJA 1XK6A 4E2FA 4G0WA 3II6X 3KYJB 4PSCA 2JJ1D 5ARCA 4OQNA 3ENKA 4IJ6A 2JCBA 4P92A 4RIEA 4UNQA 4MPTA 2RIRA 3AC0A 1RHMA 3FDZB 4GSKA 2H8KA 1A4RA 3Q15C 2CXOA 4YAEA 1NVXQ 2J7PD 1RQLA 4RH0A 4K9QA 5CDFE 5KTKA 2QG9A 1L4UA 3NU1A 1QRRA 1PSWA 4ZK2A 5C53B 2VLIA 1WVMA 3BBPA 4YAOA 4UBMA 1TYZA 4GOKA 5M2QA 2WT8A 4L27A 5HG0A 2D59A 2FFHA 3JYOA 3M8SA 4HSEA 4Y0VA 2BM9A 1IEXA 1LJLA 2D2XA 4LHEA 3U16A 4BVAA 2P9YA 2BBSA 2AR7A 5FO1A 4Q19A 3G0OA 4F6CA 5BV8A 4D98A 3MTDA 2VI5A 3HSSA 4LBVA 4B74A 3HHEA 3LQFA 2IHKA 2R6ZA 4DFDA 3D7RA 1U7DA 3EPRA 2W2OA 4Q21A 4X6LA 2P4EA 4LFBB 4RVOA 2FEXA 3L4PA 3WBKA 4W5NA 4JNKA 3TW8A 2K8CB 3ED1A 3DB2A 1OILA 4JJEA 2JHDA 3OSPA 4FFBA 2JJMA 3JVDA 1TQ6A 1FNMA 2R96A 4R3UC 4XZ3A 2SECE 2HBMA 2A58A 2JB9A 1IATA 2F9FA 5JAOA 4M76B 3EDOA 2FFJA 4FDAA 1FFXB 3SX2A 2O5RA 2VQSA 2G1AA 2VUSA 1ZK1A 4RNMA 2WK1A 5BP7A 3W34A 1UT8A 3EAQA 4JJ6A 4WZAE 1Z6AA 5AVXA 1UXKA 5TV2A 2AUTA 1GCGA 4HAZA 6PFKA 2V7TA 3C85A 1NBME 4MCHA 1L3UA 4U39A 2F55A 5AK5A 4IL6U 1J2EA 1ZQ1A 2QG6A 4TZTA 8ICJA 3G2IA 3I05A 3KZKA 1XHFA 4I4TB 4RELA 1LNSA 3PNVA 2XY5A 3WFIA 1M10A 1FMJA 2ZIUA 5KTRA 4M8NE 2WMOB 3H40A 9ICBA 5JVDF 2R87A 2NSLA 1ZQQA 2NLOA 4BC0A 3TUJC 1WVGA 3SJZA 1RVV1 4KR9A 1KQNA 1XL1A 4XWKA 3GRVA 5IKEA 1XSNA 2K8BB 3ZKWB 4NYJR 3LHDA 5T14A 3EPJA 3CRQA 4CLOB 1E64A 1V6CA 3P52A 4LY0A 4PX2A 1XDUA 3K05A 5DLFA 4GMKA 1WEKA 1Z0FA 4L9SA 4KQFA 1JA0A 2VH5R 1LDMA 2QUHA 1KFBB 2HMYB 2CL7X 4UTPA 3AESB 4DFKA 1ULZA 1MCZA 3UV3A 1VE5A 2BELA 1VIMA 5IJXA 4CQMA 1LF5A 3ZTWA 3EXAA 4LOJA 4FB4A 5DXAA 1DCTA 1EMDA 3GRUA 4DGSA 1MPXA 4ZEXA 2PU5A 3GZFA 1S9HA 2PZ8A 3NHAA 3WGJA 1TGYA 4FC7A 1X6JA 2F77X 1C7FA 1Q8KA 1O87A 2VQEB 4B4KA 1OTYA 10MHA 2IHNA 1XZNA 3ZZTA 3EPKA 1DLIA 4BGEA 2DGZA 4KK3A 1ZN9A 2G88A 1DL5A 3GFPA 4D6PA 2HBRA 3MT8A 3WI7A 1I4EB 2JIDA 4AMZA 3E3NA 4N6GA 3ISVA 9ICNA 4IWYA 2X7XA 4DUGD 4RFSB 3IIIA 4P36A 1P18A 1N48A 4HBGA 4CQLA 4L76A 2A0XA 3WSTA 1XNJA 2NTYC 4U2DA 1L4KA 2R44A 3IDWA 1VIVA 4XDZA 2UZ3A 1T0HB 1NBOA 4YT8A 1T35A 3FFAA 1E94E 3C5WP 4OSPA 5F5XA 5EE1A 1LSUA 5JAUA 3OM9A 2ZBEA 1VCMA 2HF8A 3THYA 2XQIA 5H83A 1GL9B 2MMGA 3ADKA 4WDRA 4B09A 5FYDA 3ZZ0A 1F2DA 5CT4A 5FUVA 4QW9A 1G5IA 5B4UA 1TOAA 1VLHA 4BNFA 2D0DA 2TMYA 4JELA 3ZYZA 1EQUA 4UJ3A 4DPKA 2VPTA 1PNOA 2BFCA 1RLTA 4MYSA 1TDJA 1RPAA 1HFJA 3HPQA 3WRYC 1P3Y1 3U4HA 3CM0A 1YZ7A 2IWHA 3O4VA 1JV2B 2NSHA 1GFSA 5J2DA 3ZYCA 13PKA 5TPZD 1A8SA 2V54A 2GSWA 2BFEB 3RWMB 3OM8A 1MAHA 3KJFA 3W4IA 3W2FA 1A8HA 3V7JA 3GDFA 1IN7A 4RCZA 3HFGA 4K3VA 4KFSA 4BV2A 2ZOSA 2O2CA 3EPGA 3V4PB 2F1OA 3OSZA 4NU8X 3P96A 5LMCA 1C9MA 2V5AA 3UJHA 4PC3A 2OHVA 4H1WA 4EY5A 3PW7A 1VE6A 2HU5A 1JAZA 2AZMA 1MABB 5IIKA 1HIWA 5LYJF 3A26A 2PUVA 3HXOA 3AK4A 3H2IA 3IHQB 5F52A 1OV4A 3OZBA 4WGFA 2YUIA 2VSQA 1VL1A 1TM1E 1T9GR 4ACBA 4GYWA 1ODIA 3HBJA 2Z7JA 1Z75A 1X7XB 3K5PA 5GVRA 4M1OA 4O25A 5JEDA 1RQ7A 9ICWA 5C8DA 2O7NA 4QDKA 3MT0A 2GDJA 4PV7A 4G86A 1AK2A 4M9UA 2HF9A 2OP0A 4PZCA 5IC6A 2BH9A 3NRCA 3WYAA 1F6WA 4NLGA 4F3CA 4MUMA 2I8AA 4U02A 3O2QB 3TW6A 4KR6A 4U6PA 3UG7A 1HFEL 2DPGA 4EYOA 2CSUA 5AKIA 2QTNA 7ICHA 1GZDA 2DQSA 3WJ2A 2ASJA 4DIUA 2QTRA 3MWYW 4HH0A 4IWNA 3RUEA 1OA0A 2J3DA 3BF8A 3BIXA 3W5AA 3R3YA 1SG9A 2GN8A 4ARUA 3R41A 4E13A 2D0OB 4Z49A 2G0NA 3NV7A 1T5OA 1J42A 1ZCBA 3EULA 4B6EA 2Q6TA 4BXOA 4EARA 2NOAA 5KIAA 3PKJA 4Q3CA 4KAXA 3DDNA 1PS8A 5CRIA 3GZNA 3EZFA 2J3IA 3HN6A 2PPVA 4BIIA 5LVAA 3D8NA 4PONA 5A4JA 1JAHA 2ZSIA 4LDRA 3UV6A 4B3JA 1T0JB 4P0QA 2X4DA 2EKDA 3Q85A 2PT9A 4UPVA 4NYIQ 1HC7A 4AQYB 3FDFA 1T9HA 2ISOA 3IESA 1IY8A 4A7PA 2UVWA 3O8LA 1L5KA 2VK1A 3CZMA 2ZANA 1UPBA 4QDJA 2RBKA 2P5UA 4G0ZA 2OCYC 1JE1A 9ICVA 2P3QA 3EEQA 4MGZR 3QXHA 2NU9A 1ID1A 3DNFA 2OA0A 1OX6A 3FOFC 2I3AA 2J0SA 4TKVB 3CE6A 1VHWA 1U2PA 2COUA 4EKEA 3E8XA 1C8VB 1JZTA 4RIHA 4NPHA 2W2NA 5BOSA 4KTQA 1LRKA 1XAGA 4IFIA 3RF6A 4PO3X 4XLZA 4HAOA 5CJ7A 3C3BA 2B30A 2Q9UA 3GUHA 2H4XA 4N5DA 4BJ5A 4R51A 1X80A 4I1OA 3T3HA 1DINA 4Q7EA 3UNXA 2FFBA 5IJ9B 1JP7A 1ZPDA 3CNQS 1SHKA 2YIVX 3SC4A 2DX7A 3I2IA 4S2EA 2AQ4A 2GOYA 1EVLA 3LTNC 4QICA 3O3NB 3H0KA 2H1VA 2CB9A 4YFVA 1X2EA 3EXEB 4WSOA 2KMDA 2AF3C 3QVVA 3H04A 1FFEA 2PG3A 1APBA 1WUKS 4BLQA 2PR7A 1XPJA 3ZOKA 2BKLA 4WK0B 4IXWA 5K8VA 1NW6A 1WRBA 2VO1A 1DI0A 3SHOA 1XSEA 1H5NA 4DNXA 3PHIA 3NPMA 4F2WA 3WGUA 1JB1A 4JEIA 4MV5A 2BFMA 1U0EA 1NI3A 1JBQA 2EX1A 4Z0HO 5AI9A 2WWWA 2J6BA 4BCBA 3NANA 4HFNA 1A0OA 2PUHA 4D5GA 4CKXA 2BPOA 5J2HA 4WN3A 3N8NA 9ICEA 2GF2A 3GRKA 4AJ9A 3VPSA 1QIDA 2IF0A 3AUSA 1SBTA 4TWZA 1RE0A 4HLDA 2G83A 2J46A 3O8DA 1F0PA 3FTDA 1CJSA 4IGEA 2CMKA 2J09A 4UMVA 2IITA 3KXIA 3QKRA 1UDXA 2WJ4A 3BTUA 4W8HA 3CQ9A 2XMCA 4RT3A 2GLTA 4NBSA 1S0VA 1ODFA 3SAJA 2KYRA 1M1NA 1JVSA 2ZATA 1I6KA 4D3ZA 4PL2A 2JIZA 4YGXB 3K0FA 4N65A 3VR5A 4X1IA 2W6CX 3RR8A 1U0LA 4KWIA 1XPUA 3CZ9A 5ITWA 4MQEB 2CJWB 1LSJA 2EANA 4WADA 3T1QA 2HPHA 3OZ7A 1GHTA 4JMUA 4L16A 3IFSA 1XZMA 5LN1A 4LY3A 4OGLA 1ZZGA 3JPNA 2YVUA 1D2AA 3HA5A 3E61A 1IBKB 4GNKA 1TUEA 2PD4A 4P5EA 3Q2OA 2A5GA 1Y63A 1PU2A 4LYDA 2Y0PA 4Q5IA 3LQKA 2OT3B 4CRXA 4CIXA 3FYUB 4HX2A 4JS0A 4F1JA 1P0QA 1L7DA 1HEYA 3WLMA 1I2BA 1MGOA 3FRIA 4O4IB 3CW2A 1WXEA 2OM2A 1AQJA 4IJWA 2ZQ5A 1FVHA 2BN4A 2ID7A 3PEUA 3NTXA 4BWMA 3FZGA 5L4NA 4QGFA 2OGTA 5KVCA 3AVPA 3NXSA 5FR2A 4RO0A 3CGGA 4MEYA 4EBCA 4HDRA 3ZHBA 3K0SA 1EG7A 3ZW8A 4LWPA 2BT4A 3DONA 1VGQA 4EZ9A 4IFBA 1ZHOA 1YE3A 3EWIA 2R47A 4DV4B 3BXOA 3PQEA 2XLBA 3M6KA 1QKIA 1PFYA 4G1UC 2VJAA 3C41J 1QPGA 3TFOA 2DYKA 4LXIA 2PMEA 4X1YA 4YQYA 4GXJA 1VE3A 1A77A 1XTTA 4YG2A 3LI2A 5G0SA 5BN3B 4CTNA 2QNIA 5B6JA 4M1WA 3H2SA 2PKXA 4ZVPA 1N5LA 3DWEX 4JR2A 1LV7A 2ZTSA 3DEJA 1GDHA 2XGSA 5LUBA 4Z1OA 3HU1A 5CP8A 2X9GA 3WNQA 5HIMA 2VK4A 2NZWA 2ANBA 2IUYA 1RXYA 4EW1A 4JT8A 5J2BA 2R4UA 4MS3A 1Z2NX 4C0ZA 1GV1A 3FMVA 4M0DA 1J0XO 4P3KA 4R6XA 3G6KA 3T15A 1QZZA 4B6SA 1KZ6A 5KUTA 5EWFA 4DC1A 2F6RA 4AZTA 4RZRA 1ITZA 2CUTA 1ULBA 4HLUC 3KQVA 1A98A 3IB3A 2AU0A 3ANLA 1H0RA 2RARA 4O29A 1O77A 4QYTA 2XR1A 4AZVA 1ZAKA 4Z4FA 2FKAA 1J0EA 4FYHA 3TAPA 2ODGA 4EW6A 1OBOA 2YR0A 3S2GA 3VDQA 3KQTA 5ALDA 3INRA 3E1SA 3UMSA 2YKGA 3HR7A 1T3ZA 4BP9A 5KQMA 3SZLA 4YV7A 2IYTA 3K70D 3W04A 4RY0A 2FLWA 1MJHA 4RTKA 1O94A 2AQHA 5TR9A 4OBWA 2X8JB 4FHGA 4OBBA 2E4WA 1A9TA 1LJ8A 2XUGA 2I6TA 3L4JA 2WWFA 3QPCA 4N6NA 1B0UA 3ZE6A 4YD1A 5GVSA 3BS4A 3RB6A 1RQRA 3GOQA 4MLCA 5HRAA 5TQ0A 1YRLA 1VXRA 5LZ8A 4XRRA 1CQWA 2UZ0A 4PO9A 4MA5A 5H3LA 3OZSA 4FWTA 5FL7A 3VYVA 5LA6A 2XT0A 4PM4A 1LFDB 1L3CA 3REQA 2FW6A 2OFWA 5JD6A 4O5OA 3VR4H 4LRQA 5AWFC 2PM8A 2WPDD 4GLBA 3QBEA 3VPGA 2J9FB 1B22A 5A5VA 4A26A 1BIFA 5TARA 4HH1A 4JQSA 4GT1A 3VH4A 4AKTA 3VNVA 1N0IA 3QUTA 3PL5A 3RM3A 3TVYA 3QG1A 3BQNB 2XMBA 4BQFA 5ABPA 4IX9A 3MHTA 3UHOA 1Z5NA 2WIJA 3TGPA 2Q45A 5CJJA 3CEAA 2W4MA 3L04A 3KWLA 1JQAA 3EUWA 3H11A 3UAZA 3FFTA 4WZAB 4BZZA 4WLNA 4U2KA 4UNSA 3RASA 1THGA 1M2JA 3FNRA 5BY2A 4LDAA 2DF8A 4WCFA 4EUHA 3V6HA 1G8SA 1JMSA 3FUXA 2W8BB 1TZJA 2H3FA 3FHTA 3M5CA 1E5TA 4IIGA 1X7YA 1DC7A 2RJNA 3SKXA 1RT9A 4EPXA 2PD6A 4Y1RA 1ZYQA 5CB0A 1OBVA 1A69A 5TGZA 4BTVA 4MLPA 5E3HA 1GN9A 1NVGA 3DOHA 6ADHA 1SHJA 4CM8B 2E87A 3SKVA 5AVQA 2ZRNA 3T94A 1OFUA 4MWTA 5LD2C 4TUYA 3FOWA 3Q5EA 4J1NA 1S0UA 3RC7A 2ZT7A 1LD3A 2QG4A 3HJTA 4EITA 1MOZA 4C8KA 3EOBI 3LNCA 1H6BA 4JV1A 1C1HA 3FM9A 3UQ0A 2R1TA 2XRMA 1OZAA 4FPXA 2PUFA 2WF6A 2WU3A 1M8PA 2BWJA 2V65A 1T15A 1X1TA 3C98A 1AC5A 2UAGA 4BGVA 2X9LA 5DXJA 3CP8A 1L3IA 4PGAA 4URVR 1UJCA 2FMSA 4I5IA 1KDTA 3NRWA 2AQIA 4D9IA 3OQVA 2UUPA 3PX0A 3A4VA 2O8CB 5JJIA 2OSVA 1U3WA 3ME5A 2PLFA 1YRAA 3AM1A 2CXSA 1E3EA 2ET6A 2DUYA 2D1TA 5BXQC 4FWIB 3FYTA 4RDCA 1DZIA 3UB4A 2YWJA 4DL3A 4OLFA 4DJTA 1ZN7A 3SDZA 3A1SA 3CZRA 3DL4A 2O8BA 3LRTA 1O57A 1T3SA 1J7KA 5KG0A 1QTRA 2Q2WA 4IUYA 4RHEA 4V0LA 2R8PA 2L69A 3BD6A 1ZITA 2PYDA 3IQFA 1N56A 4MS4A 1CFJA 4ALJA 3R9KA 1C1DA 1AH2A 3K1RB 3U56A 2P3OA 3QG5A 3TTTA 4IQTA 3DDSA 3CUVA 4DCTA 3UW1A 2DUMA 3N2NA 1ZR4A 4Q9NA 2OV4A 5KTSA 5JS2A 1Z4LA 4BTEA 2GZMA 4DF4A 4QW8A 3TVTA 3WL3A 4Z4GA 2ADFA 4P0TA 1ST3A 3KEQA 2RHGB 2FMFA 3PS9A 1Z3IX 3AMVA 4QTYA 3L0OA 1XMOB 5HPYB 3THRA 2BTQB 4M6WB 1WB4A 1G59A 2QM0A 3MJEA 3BIWA 5CDGA 2JEYA 3GCXA 4LRSB 4B5LA 1RMYA 4E94A 2BCEA 3LBYA 1NATA 1ZH2A 1ZCJA 4PGGA 5CA0A 4KXQA 5J0WA 2IPLA 1D03A 3PUVA 4OP3A 2YQ5A 1JQLB 4BBZA 1XRMA 1XPRA 3ZCRA 2VEDA 4KLJA 2A9OA 2P77A 3NR2A 4XA8A 4MB6A 1MAAA 1RADA 2BRUA 2PKEA 1GPUA 4ZO9A 1SU8A 3LFHA 1P91A 3PGMA 4ZRDA 1W76A 1CJVC 4XFDA 5JVDB 1K3UB 3ACBA 1WZUA 3NMUF 1V5FA 1DBIA 1T3TA 2MU1A 2ZM6B 2H17A 3ZHRA 3ZDEA 1SO8A 2DBQA 1NJ1A 8ICLA 2Q8NA 1AT1A 2WWXA 4XIIA 4FS1A 2RB5A 4EKIA 1TUBA 1U98A 1YB7A 3NAGA 2QN9A 3DXYA 1VA5A 2X5NA 5E8RA 4IDNA 3O1JC 1K2WA 1SU7A 1Y4DE 1V71A 1SG6A 2P9GA 3O21A 1UFKA 3IKVA 3ZV6A 9ICOA 3OVMA 2UUOA 4DF8A 4HG2A 5EP2A 2VVTA 5BW8A 3IC5A 1FQWA 5E7IA 2HPVA 4IIEA 1G5TA 2R6AA 1C9DB 4IMIB 1AXGA 5J2UA 2CL5A 2UVRA 1DAEA 1QH1A 1O95C 5BRAA 2OORA 4XX1A 1J23A 3DOJA 1P8AA 3TOSA 1G63A 3EFBA 1T10A 3IBCA 1CF2O 4KN4A 1AK9A 2VSXA 1N6NA 5HM8A 4L3WA 3KSRA 1L3VA 1DOZA 2RGDA 3GIKA 5IIIA 1SCBA 4ZZIA 4C76A 4BFVA 1FFWA 3HO1A 4LBYA 3C21A 1W59A 2RH4A 3AR8A 1RYYA 2VNAA 4XEHA 5DZSA 2PE5A 1K4MA 3O6VA 3ESDA 3GFTA 3EQ9A 4XB1A 1M5UA 1SV0A 2HZ7A 5KL1B 5IAJA 4FZ5A 4I2FA 1QP0A 3D6UA 1DXHA 3WIUA 1WUYA 1J2TA 3TACB 2Z1NA 2WHQA 3RJMA 5ICEA 4XB2A 4BNTA 2WIKA 3WP1B 4Q4AA 4YFKA 5L51A 5K6RA 4OO1J 3EZ5A 1SOAA 2NTNA 4NEHB 2J87A 2DG2A 2Y1KA 4NG5A 2I4RA 4RQ5A 1CPYA 3TRDA 5FIUA 4Q4DA 2NXCA 3U7HB 2NZXA 1V41E 1AKNA 4ZVSA 2NT3A 3ZWCA 1CYDA 4D9GA 5AOBA 1NPDA 1NVBA 3QX7A 2YBEA 2K60A 1DX4A 3FKSD 2JEJA 4KN6A 4B47A 3PI6A 3ZH2A 4FZJA 5CLIA 3JRWA 3NORA 2HMVA 4ZJPA 4OQYA 4PHCA 5HDQA 4Z4CA 4IDOA 1T6NA 2R6GA 1JHMA 3BX1A 3TDNA 3DQZA 1SPBS 4DT1A 5BR1A 4LQ4A 4HKTA 3DFIA 5KYKA 4WJZA 2BDUA 4XUGB 1FMFA 1Z0IA 2JFWA 3EAGA 4S12A 3RVRA 4LC0A 4RM3A 1QYRA 4PGXA 4LYFA 1U4NA 4A73A 2YXNA 5DT9A 1HQDA 3EVEA 3PHHA 1IU9A 1VPVA 4U2EA 4LS3A 3R5KA 2WWRA 4K03A 1JLKA 2H2AA 1P5FA 4V0NA 1F4LA 2JCGA 2Y68A 1KQQA 1EQ2A 1NXOA 3DD5A 2HIHA 1JIHA 2AV6A 1WXIA 3A3KA 3KK0A 2QMUA 3CRZA 4PINA 3VJLA 1BXRA 1PJ8A 2LD4A 1W88A 2W6MA 4KW7A 5LYJB 4TMYA 5ER9A 2ZJ8A 5DGXA 1NNEA 1RP7A 3H86A 3BTOA 3B6IA 3KT8A 1YVDA 5GMOA 1GG2A 4A6EA 2H3VA 4GKVA 4DOAA 1E32A 4BLUA 5AVYA 2P4QA 3R0VA 3T4EA 1JSXA 3BH6A 3E35A 5L6LB 4WKGA 5L1KA 2HV9A 4EGFA 1YBVA 3TJMA 4IICA 4LVNA 3UKOA 4YXWD 3K0CC 4MDHA 3AM4A 4ZIRA 3LLVA 2DF4B 3EZGA 1K8YB 2H57A 4CLRA 3I2JA 1ZQOA 3QKTA 4D99A 2QN8A 4CKEB 3HCDA 5HUHA 1F9AA 4F4CA 2FUKA 4DLPA 1PZMA 3AHEA 3P71T 4QNMA 2WV9A 4J3NA 4GI3A 4Q9IA 3MF4A 3D43A 3HJRA 1RXIA 4Y67A 2VRCD 4BCDA 4DARA 3FOCA 1X3LA 1Z8HA 4D4LA 3HXLA 4INOA 3S4YA 4R81A 2Y4NA 2OTCA 3DE3X 2JF0A 3DVAB 2VZ9A 2R25B 1GNLA 1V1RA 4D57A 1I4WA 1CTQA 2F7SA 3ILVA 4GVLA 3CA8A 3O1IC 4J2HA 2VDQB 3L1JA 2IXBA 4Z9XA 4GSYA 4IVRA 1G3IA 4MRSA 1ZIYA 2O1WA 4R1NA 3K1JA 3D2QA 1M2GA 1OIXA 1XCBA 2WKPA 3OLZA 4CI9A 2W98A 4NJ8A 4C30A 1UFRA 3RVSA 3WSVA 5DE3A 3U7QA 4DQLA 1C7QA 1UEXC 3MTGA 4A0SA 4JGGA 2NADA 4EX7A 3MD0A 4GBJA 4HAXA 4PHFA 4QYMA 2IHBA 2OILA 5L4LA 1SUFA 4W63A 2C9MA 4HLCA 4Z0PA 3DOIA 5ICSA 4J7CA 4O4HA 1VJTA 1AZSC 3QUCA 5FBWB 2IEDA 4ARZA 5D5HA 1MA3A 3ES9A 4WZZA 5CK4A 1GQYA 5ULLA 2ZRHA 2QL6A 3RB0A 2MSDB 4H7EA 2CT8A 1UXOA 4ZI7A 4BB5A 1N5KA 1DAHA 2XNHA 1G16A 4QO7A 3H5RA 3AU6A 1A7UA 2B82A 5EPEA 4QLBA 4TZKA 1OZGA 2F3NA 4LQLA 5B30A 2QTCA 5AI4A 2VDLB 5AO9A 3A9UA 1CRXA 4IV0A 1YQWA 2I8LA 4CEHB 3O2JA 4ZCTA 2D5AA 3PVXA 1MC1A 3MXOA 4EHJA 1NXTA 2HK7A 3RG2A 4RXUA 3JYPA 2QARA 4CR8A 2GAAA 3A27A 3N6XA 5KTMA 1NM5A 3GO4A 2CSXA 3T5MA 1UHUA 1AMNA 3ZWNA 1ZISA 4QYWA 1JXLA 3ZPXA 4PN3A 4JBHA 2E48A 1COWA 2DFDA 4ILEA 1DS6A 4JLAA 1J09A 2C5HA 5JXJA 3VMMA 3JQ7A 3FHJA 4PN7A 3MOSA 4B6OA 1PF7E 3SZOA 1EWYA 2WZCA 3BL6A 3G0IA 1ZQKA 1FO4A 3A9WA 1N2IA 2OMEA 2Z08A 4NOKA 1I3CA 2Y67A 4NFSA 4OGWA 2C7PA 3NHFA 4R9VA 4R0NA 2XCPA 1KPIA 2V6GA 3PWKA 3AW9A 5EMNA 1YL5A 5G3YA 4DM3A 3AO0B 4F4WA 3C8UA 5LLSA 2FWNA 4JLOA 1JWAB 1EWKA 5KFJA 1IXZA 3VOSA 4NL9C 1PLKA 3JR7A 2R6CA 2W83A 2J3JA 4MFAA 1O9HA 4YT5A 2KE7A 1AY0A 2P9ZA 2XGMA 5E0OA 1Y9EA 2CJXA 1LQUA 1E96A 4O6VA 1L7NA 1CCWA 1SKRA 1JLRA 2FN7A 4E2YA 5JT1A 4L74A 4I19A 4DANA 3DKKA 4DSUA 1SXHA 1R1DA 3C5VA 3ZY6A 5K4GA 4QOIA 3U62A 2HGSA 3TOVA 3HDQA 1J8DA 2I4MA 5CFLA 5J29A 3TE6A 3GELA 4I2HA 3KQQA 2AXTU 4ZCIA 1XD2B 5TT1A 5H1YA 2RDMA 1XYVA 4U8HA 5IAOA 2GWHA 1JECA 3NBAA 1DPFA 4YMHA 2F8LA 2IYYA 4GQBA 2QW8A 2WJVA 2FLVA 4HBZA 2VSNA 1Z4MA 1YI1A 2R68A 2JJQA 4CR6A 3JVEA 1IHPA 5EIBC 1DC8A 2XE6A 2YYZA 3PCRB 2Z6UA 3FB4A 1KK0A 3F7OA 2GPNA 2YCLA 4IR9A 2HJGA 2W7TA 4DLWA 2B5OA 1QBKC 2HBLA 2HLPA 1IG6A 2GM4A 4NZMA 4M0PA 1ZQ1C 3V4SA 4L02A 3C48A 5CNIA 5CAEA 3IXQA 4MK4A 1EUYA 1W36C 4FUTA 4YUAA 3D1VA 2GNAA 1MIOB 3R7LA 3QVKA 4BU1A 3WGTA 1C9YA 3LOPA 1WUHS 3P2KA 5I5EA 3LSTA 2C1ZA 2ZAGA 2WU0A 5KG2A 2IF2A 5HGJA 5AM4A 3RRMA 3SQXA 4RQ8A 2QEQA 1JDBB 1CJTC 1N3BA 3VC8A 3KJIA 3C5HA 3PW2A 2BP7A 1XCMA 1HUZA 2R00C 3N58A 2R1VA 3KFUF 2F43B 1KMIY 3FSRA 3TANA 2I6FA 2HK8A 4KMMA 2QB5A 2UUAB 3GT4A 3H9UA 4JBYA 5EUBA 4KFRA 7ICIA 3AUTA 2FZLA 3TG8A 2IEAA 4MYRA 5ELLA 1TKDA 1NY6A 4M7WA 4QHYA 1EI9A 3ROEA 4D74A 4AJNA 2EBFX 2Q41A 3FB1A 3W8DA 3LYLA 4DPLA 2VC2B 4CCSA 2OLJA 2HI0A 3R3UA 3IDSA 4I4LA 4DAOA 3VH1A 4FU0A 1KKUA 2G28A 3DCYA 3U7JA 1E8MA 3AIKA 4BYGA 2V7GA 3VR2A 2CZGA 2GPWA 1BYUA 2XGPA 4B85A 2HHVA 1OC2A 4WFIA 4K5QA 1DBSA 4KU4A 2MHCA 1OF1A 4M0CA 3THWB 1WF6A 3H1EA 2M6LA 1UXGA 3QNWA 3OM1A 3WV4A 1GZ6A 4E5MA 4DR1B 3ZHYA 5CFQA 3Q10A 2O2DA 3AJ9A 4NP6A 1CEQA 2D2IA 3WDMA 3PUKA 3SEFA 1FBTA 1ACMA 1NVVR 1L4NA 3ESRA 1YD7A 2ILTA 4CM3A 1FDTA 3GA0A 4C07A 4A8PA 1EK6A 2YFYA 2NSJA 2ZXHA 2LGJA 2GD1O 1U65A 1GPH1 4AUNA 3BXHA 1USVA 2HLDA 4BXOB 2PEZA 2Y77A 3AUXA 4KACA 4URHA 3R0ZA 2NO5A 1YKFA 4NL9A 4RQUA 2EFJA 5DI9A 1HH4A 5DGIA 4LQCA 2JDID 4YY3B 3LQ2A 3VJMA 1G5QA 3I9OA 5EE0A 3IKMB 4QZEA 4CV3A 3VV3A 1MEJA 1MG0A 3KUCA 5KFYA 2CK3A 4P0QB 3R5SA 3SR6A 4YJHA 3TAXA 5E1BA 3OOSA 1NSFA 4YJGA 5LZ2A 4R31A 4F12A 3C3PA 1OT3A 1G18A 2XCTB 4YAUA 4P84A 4RNCA 3T9AA 3OHSX 1OX5A 1BRTA 2CXPA 5JMWA 1CJKC 5E4YA 3IMKA 1JDBC 4DDWA 7ICGA 2VTEA 1AGRA 3KB8A 4H2DA 4MVWA 3V6KA 1KK1A 5LC1A 1YT3A 1T91A 3COZA 3MTIA 3O92A 2ZYIA 4XGIA 1DKMA 3FDJA 3MLBA 5KS2A 1QORA 1ZMXA 5KG5A 1M2WA 2M6SA 1BPEA 2QU7A 1KRHA 1BCSA 3V1KA 5H7XA 5JNVA 3F47A 2O7QA 2P1ZA 1WHSA 5CGQB 3PDWA 2MINA 2W2LA 1E5DA 4B8YA 5KU7A 2ILVA 3VTFA 2V4RA 1GKYA 3AONB 4F3OA 4AP9A 1X80B 4M60A 3JQAD 4UQOA 2IYQA 1OAKA 1WXQA 2GZAA 3ZR4B 5JRZA 1BGXT 1X9IA 2I22A 4PR0A 1IHYA 2D0IA 3AVUA 4UJ5A 1VLMA 3CH4B 4L5JA 4MDYA 1O5TA 1SUBA 3JYNA 1IONA 1EBFA 3QKIA 2A0YA 2N0SA 1OXSC 1ZG3A 2BBTA 1HTWA 4K9LA 3J81A 5KYUA 4XFKA 2PX8A 1CWUA 4GU5A 5LP6A 4HYQA 2XT6A 2HA6A 2NUPA 1QO7A 4OKNA 4DLAA 5KT6A 2X6RA 2Z3ZA 3K1YA 4M0EA 4E6EA 3VPFA 4F1KA 5K5EA 3AQEA 1VLLA 4RCVA 2R00A 3DPIA 1OGYA 1E9SA 3T1VA 2UYGA 4RZUA 4KQ1A 3M6IA 4DPMA 2GJ4A 4M9GA 3GMDA 4MUJA 4OU5A 4OMFG 3IUMA 4UAUA 1WTCA 3N3AC 2YDYA 4FQ8A 3RFUA 3QVMA 1FLNA 3W6NA 3B70A 3NHKA 2XTMA 4C7VA 2JFGA 2IH2A 1YDHA 4O4JF 1KH3A 2BDPA 4JLJA 5IEBA 3RYHA 3VKUA 4Q39A 5DO9A 2OAQ1 4L8VA 3P97A 1TC1A 1C0IA 3FG9A 3OZUA 4CG3A 4JLPA 1UC5B 3WIDA 3VHXB 1EZZA 4AUMA 3QKRB 4WBSA 3NKVA 1RJGA 2QUAA 2IUFA 5KWIA 1Q46A 1NP6A 1M1NB 4NIMA 3EXG2 5CVDA 3RIXA 4ND4A 4DHWA 1CD5A 1HI9A 5LCXA 1E66A 1G98A 4BLVA 3K0FB 4KIWA 3WB2A 4DCUA 4RBNA 1SBCA 3QLTA 4UAZA 2NU7A 4HADA 3O0FA 5CX4A 2VPZA 2XUHA 4AY3A 5FTNA 2FLNA 2EFHB 3L7BA 4LTMA 1J8FA 3C1YA 2ZVJA 2ZCUA 2NO6A 2PH3A 2HO4A 2JCXA 4CPDA 3AGQA 2D5BA 4KBYA 1UBUS 8ICRA 2GTIA 2V3WA 2D2FA 1FP1D 3K35A 3G3EA 1QR2A 4A10A 4LZGA 2J4FA 1DX6A 3OIGA 4NEQA 5H16A 4YV0A 4DDVA 2XYRA 2X42A 2GCPA 4YRQA 5FD8A 2R62A 3HE3A 5SYAA 3IPCA 1PYOA 4X97A 1MNAA 3BFPA 1S2IA 3JQEA 4DUYB 3ADPA 3QEJA 1VDVA 1RKQA 5JAHA 2H4FA 1E9CA 3PXGA 3ZDRA 4GR4A 4UUBA 2C03A 4QTZA 4H35A 4BUCA 2VHXA 2FSHA 4F2HA 1EAMA 3DOOA 4KLGA 5EAIA 2B4YA 1U94A 8ICEA 4KUGA 3ESXA 1JRLA 2ZYSA 4P82A 4JVLA 1A5AB 4V3CA 1SN7A 2C9YA 3I34X 1DOQA 3HN7A 4I2BA 1U0BB 4DEVA 4DADA 2I3DA 5IBPA 2I71A 3Q7IA 3QXGA 3DYBA 4G8DA 4PFKA 5CT5A 1QSLA 5EN4A 1DAGA 5F35A 4KIUA 4E5PA 3HPOA 2Z1MA 1ACLA 4X1YB 2O6HA 3IMEA 1SIWA 3PQ5A 5M7EA 3TLXA 2JZBB 1E0DA 5M04A 3HI6A 4BO0A 3NOVA 1G4UR 5IF9A 3OCUA 7MHTA 1NHWA 2YHBA 5I5GA 5GZ1A 4JYPA 1PKXA 1JBEA 4FYWA 1EK0A 4TTAA 4TWJA 2WY2D 2PWPA 1QE3A 2XTJA 3DOFA 1JIVA 1I9GA 4NMXB 4BO5A 2EZUA 5CM2Z 4NI5A 4MCAA 3UT0A 4NBUA 4J9NA 2BEUB 1RJ9A 2HRCA 3A1EA 3BH0A 3G2MA 1S02A 4MW9A 2VR1A 2VEOA 3RSFA 2A1JA 1SC6A 2IX9A 3BSFA 4MRRA 4ZAWA 3QE2A 3RWBA 1WWKA 4CFSA 2W4IA 4RCYA 4C4ZA 1D9FA 3DVSX 3ZZUA 1OR8A 1SCNE 1N0HA 4UCXA 5AM2A 4PYOA 2HUPA 3L0CA 4WEQA 4E0BA 1Q3VA 5CT6A 4MRVA 4RMHA 5KNCA 4JL8A 4BN4A 5LUAA 1U9IC 4RV9A 3T5DA 3GOHA 1QG0A 4LKOA 1HYHA 3BE8A 3H8SA 1Y1QA 4M87A 3V4LA 1P6QA 3WSWA 1I0LA 1TO2E 3BF7A 4GMHA 1KJ9A 5DXFA 5G5GA 3TPZA 3OOJA 1F6DA 5AXBA 2BHRA 4B81A 3KKPA 5KINB 4OFZA 2QVLA 1SZHA 2YN0A 4TL7A 2WAOA 3CW2C 1MEEA 1PJQA 1ZQSA 2WD9A 3VU9A 3V9AA 3PQCA 4BEBA 1KR5A 1QHXA 4RD6A 4F11A 1YMUA 3UAOA 4DDTA 1W2HA 1M7BA 3FHOA 1CB0A 3U3JA 3UXYA 4DMRA 2XDYA 5DHQA 4IDCA 4WA7A 4ZVOA 1YS4A 4PANA 4EF6A 1P19A 2NO4A 3U7RA 2P7IA 4MYHA 1U9YA 1PRYA 4WI1A 4DLBA 5ECGC 2X6TA 4ZQIA 3JPQA 2NSYA 5JCJD 1L5OA 3B6MA 3I6YA 2WU8A 1IJKA 3GI1A 3IP9A 2IW3A 4X44A 4DDKA 1LPAB 2YWBA 2NVWA 4QWAA 3QELB 1AS0A 2ENWA 2LWIA 5REQA 4MFCA 2JCSA 3NVKI 1KO5A 3SJCA 2X4IA 2I2AA 3TQSA 4DEYA 3FNFA 2QK4A 3U3ZA 2XI9A 2RC5A 1JI0A 2LDBA 3DZ8A 1W19A 3OWXA 1RC0A 1BMFA 3V1MA 4U3JB 3R9IA 2KJQA 4P8RA 1Z2AA 2I87A 3BWEA 3PCTA 3QE9Y 1H2FA 1J39A 2RJ3A 3KT3A 2ZJAA 4MPRA 3EDMA 5KX5A 2QB1A 5HFNA 1XQXA 1N2BA 2IS2A 4DR2B 2NV2B 1UEIA 4Z9BA 1GPJA 1P7WA 5UKDA 4EMUA 3G6YA 3TINA 1N34B 2O9JA 3PIIA 3RTEA 2CDNA 4PZEA 4CIBA 3SQLA 4UULA 1P81A 2YYYA 3H1BA 2JBHA 2YZNA 2E4XA 3I39X 3MGCA 2FMIA 2C88A 2YASA 4TUYB 3QEOA 1OXVA 1N5IA 2P2DA 4LTNA 4YRNA 4N0MA 3CC8A 4R1LA 3CRVA 1FUIA 5JJ5A 1YGPA 5LDHA 2WU4A 3WRXA 3AFHA 4ZPJA 1KEUA 4B82A 2R1TB 2IXEA 1BHSA 3DT8A 1AV7A 5KI6A 3TZCA 1FUKA 2B6NA 1JR3A 2XT9A 4R8MA 4XQCA 3INTA 3N2KA 1ZW1A 4QFDA 3S2IA 3UJ7A 2D4HA 4CIAA 1R16A 3K8ZA 3ED5A 1Q1AA 4MWSA 3L8MA 1T6YA 4FZLA 1S1MA 1J0CA 2P9BA 3HYCA 1XKLA 1O94C 1ZQLA 4LMRA 3E2PA 2EDCA 5JADA 2XAUA 2ZRFA 4HFRA 5DU2A 2Q5OA 2OXFA 3DE2X 4DQQA 1UK7A 1Q0QA 3RG8A 1LH0A 4KXUA 1DKOA 4CUJA 1AQNA 4H1TA 1QGOA 2BEWB 1P45A 3OEHD 1S8OA 3ZLBA 3DHYA 2G7ZA 3JQDA 3NGMA 3MR3A 2I7CA 3TIGA 5IVPA 3UK6A 2WINI 2XOXA 4MUHA 1GUDA 3OPMA 5HHIA 3C2MA 3OQHA 4RA9B 2O8BB 1DGQA 4I4NA 5EC8A 1ULHA 2B2CA 3AH8A 2GN2A 5EKDA 1U1GA 3JW8A 1F4VA 3IRVA 4LZNA 1C3EA 2XQKA 1CY8A 3PY8A 1ZL2A 4H59A 4DSKA 1GGMA 3HDTA 5AICA 2XVAA 5B3KA 1Y89A 2ZYHA 4NCJA 3V7FA 3NUZA 9LDBA 1D5WA 5FLXA 2W2VA 4YONB 5JARA 5I7RA 5E4JA 5KVVA 5C34B 1BWPA 2PH5A 2XDWA 1BD4A 4C29A 4M0LA 1U9IA 3BULA 3K6KA 4KNVA 3VOAA 3DUFB 4EZIA 1W2WB 1RI1A 1VJCA 2ZDHA 5CXUA 5AJUA 2SBTA 2B3DA 1TTTA 4XD2A 4OH7A 1O6FA 1P5HA 3QEMA 4JU8A 2A3VA 1F7VA 4R1OA 3SHQA 3VSDA 1NXSA 2PIAA 1DOHA 4R8SA 1JIQA 2BFDB 1W6RA 3PC7A 4KCGA 1MC8A 3ZWWA 4UVEA 3OICA 4II7A 1GZHB 4HYEA 4LDZA 1Q17A 4WCFC 3QE4A 2EAOA 2IXTA 5M34A 4HN9A 2Y4OA 3LDUA 1FZTA 1QCDA 2FOXA 5L45A 2XECA 2IL1A 4KSYA 2H2WA 2NZ8A 4CCYA 1FCJA 1CHNA 1HKHA 4RS3A 4C4AA 2YZMA 2RG7A 4QZCA 1TX4B 4UBBA 4DYHA 1RQPA 1KDVA 3NHMA 4QJIA 3T95A 1GNPA 2V96A 3N59A 1PEDA 4KEAA 3WLLA 4AFNA 2TYSB 4PGYA 4RJIA 4QYIB 2JIOA 3Q8MA 4Q3BA 3HZZA 3LQRA 3TIXB 4EY3A 2XNSA 1X7ZB 4TUSA 2I29A 3V1UA 2WWTA 4OJKA 1E7WA 1XZ8A 4WPGA 2PWAA 3EFOA 3V33A 2EBWA 4LRWA 1WV1A 2WD8A 4URFA 1YTLA 3P4XA 4IV8A 1SH7A 1ZU5A 1PWYE 2QGNA 4HPJB 1R8XA 1TYCA 4C9BA 2ZYRA 3FZEA 4IF4A 2ZBGA 1KBOA 2EYQA 1DBQA 2B35A 1TM7E 3I9JA 2PBFA 5GADl 2IDJA 4Q8FA 5ALYA 4YVZA 1DC3A 3NJ4A 3VNAA 5J2EA 3NJ8A 5ELMA 3K5HA 3WE7A 4RPZA 1ZQWA 5F2NA 1ZNXA 5GQSA 4QXMA 3OUZA 3B52X 1FUYB 2ZUVA 4I2AA 3M6FA 3V7UA 4QWWA 3V8PA 3CHYA 2W90A 1WDKA 5EG5A 5KFQA 5FWDA 3KP1A 1N7JA 4OXRA 4KLUA 3DZDA 1ZC3A 5EVJA 1NYRA 4IEEA 4DG5A 3PX6A 1TZ2A 3VR3A 2ECKA 1Y3CE 1YA6A 3HJFA 4RANA 4RA6B 5LD2B 3WYGA 3CRNA 4D0SA 3F96A 5KNBH 5AI6A 4JJGA 2G7MC 5EWMA 2XYVA 1GPWB 4RQ6A 1WCYA 3DBVO 4DQ0A 1BPXA 2BMAA 2E4UA 4ZCLA 1CJCA 2LV8A 4F5OA 3AQ4A 2A9RA 3HBFA 1HOTA 1W94A 2OYCA 3PJDA 1KVSA 3V4FA 5CA7A 4RQ0A 1HE4A 1OBHA 3EC1A 4HD8A 1XKTA 4EMTA 2WICA 1L7RA 3SYLA 2YZGA 2P6UA 4R71A 2BMWA 4UEWA 4CV0A 3EFEA 3J81k 2BKUA 3I1JA 3ORYA 3D8HA 2KN7A 1V7ZA 4EATA 4J91A 4FC6A 4LCJA 3VR5H 3K0AB 1L5MA 2QN2A 4CV1A 2PSHA 3P9SA 1GLNA 4YMSA 3MJRA 4FS8A 5DQGA 2EERA 1CYEA 1IOWA 4V0RA 4S35A 2BRUC 2P2NA 2XA9A 4C7XA 5J2TA 5B2ZA 4FEYA 1I9CA 3O26A 4F4FA 3KLMX 5J9FA 4B5KA 1WQ4A 4QASA 5JI3E 1FQOA 2HBZA 3I9KA 4QJ4A 4WUTA 4K1XA 2QQFA 4QECA 3PQ7A 5LFAA 5CIYA 5KT3A 5HIIA 4Y2YA 2YOFA 1KSFX 2K4MA 5A3RA 3AVVA 3QVTA 2AN1A 5IU6A 3SE0A 2QKYA 1AUXA 4LY6A 2C58A 1CQJA 2VKTA 1RZVA 4A91A 2AVDA 1QOPB 3DDZX 4ES6A 3MWGA 2BW0A 1NFQA 5JAMA 1P72A 5HKOA 2E5WA 3SLGA 3NVZA 2YB1A 3IJ5A 4FE7A 3S2FA 4PC6A 3OPYB 4D3DA 1OXJA 3FDIA 2OSBA 1IULA 1GPNA 5T5QA 3GGGA 4FMDF 4IFTA 4BFXA 2OORC 2HRBA 2D2EA 4AG6A 2JBWA 3LPLA 3AVTA 2KKVA 1VHJA 1ZICA 4RETA 1QG2A 5H70A 2A1UB 2EVWX 3KHTA 1JFVA 3CWZA 3QTLA 3P9QA 3P27A 1HY3A 3CLUD 3TR6A 4OKSA 1UZUA 3E27A 5AK3A 3ECSA 3U49A 3KR0A 3TD6A 1SBIA 4LFCB 5B1EA 5PGMA 2QSZA 4QUIA 5J2FA 2PFOA 3FGNA 3GYBA 3A6GA 3X2EA 1H6AA 1S2OA 1SV0C 4ABTA 5JSYA 3WLEA 3UJCA 3HJBA 4KMSA 4IL5A 1K5PA 1BE6A 3R5TA 4TQSA 2H51A 5FTKA 1RC1A 2DPIA 2PUDA 3MBOA 3WL4A 5EL0A 4E03A 1MX1A 4E2XA 5ADHA 1E8DA 2J4CA 5JTIA 4MA4A 1SD1A 3CXRA 1NSYA 1NMYA 5IVHA 2HT1A 3H13A 4EB8A 3ZWXA 2X6QA 4O02B 2FY8A 3SSMA 1TFUA 5CDTA 2Q3JA 3L0PA 4Q7MB 3RC9A 4MF2A 2A92A 4F2RA 4KLNA 2H8GA 2D8MA 3AGPA 3R44A 4C05A 3ZX4A 2GN4A 5LQUA 4EKGA 5I4IA 4FFWA 2PJRA 1VMDA 4P5DA 3RUDA 3I6BA 1QVWA 2JHGA 4FZ3A 5F21A 3NO4A 5AMXA 1W0KA 4UB2A 1EFCA 3NHJA 3KTAA 1X74A 1PX2A 4RACA 5TJHA 4TL8A 4PIPA 4OTZA 3VOBA