4KX3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with thymidine monophosphate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of murine cytosolic 5'-nucleotidase III complexed with thymidine monophosphate
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Cytosolic 5'-nucleotidase 3
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4kx3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4kx3A01
3FPSA 4EENA 1RLMA 5AICA 1FEZA 1U7OA 2PR7A 2WF8A 3A1DA 5ALSA 5ALPA 3QX7A 2B1RA 1TJ4A 4YCNA 3PGLA 4BEWA 3QU9A 4KNWA 5ALJA 3WK6A 2FPUA 5AIBA 3W5BA 2AUTA 3NIWA 1RMQA 2MSNA 2R8XA 4I9FA 3OPXA 3AR5A 5AW9A 4F71A 2ZBDA 1YV9A 3HLTA 5AK4A 3U7HB 5A3SA 3N8GA 4XQ0A 3ZX4A 3WGVA 1VFPA 2ZG6A 1EK1A 4NAVA 4Y2VA 5AKHA 5AW5A 3B8EA 5AHXA 2BDUA 2B82A 2EATA 4DCCA 2HX1A 3DV9A 3L5KA 2IOFK 3W5CA 4BYGA 4KN8A 5ALKA 3M1YA 4NWIA 4UW9A 1Z4LA 3QXGA 4KX5A 1WZCA 3AR2A 2G09A 2FUEA 3N5KA 3AR8A 4UMVA 1WR8A 5ALUA 2YMLA 3WK4A 3P96A 3WGUA 5AI5A 2I6XA 4CF5A 3EF1A 5ALYA 3MPOA 3QU2A 1J97A 3QU5A 3R4CA 2HSZA 1Z4MA 2OM6A 3I76A 5ALIA 1QYIA 3NASA 5AI6A 3N07A 2RAVA 3ZVMA 2GO7A 4FYPA 2C9MA 1K1EA 2Q4TA 3I28A 3R9KA 4C4SA 4UAUA 2HF7A 4AS3A 2Q5EA 2RBKA 3QUBA 4HGPA 4Y2PA 1YS9A 1RKUA 4HGRA 4OD0A 3WK7A 1RMYA 5AW4A 1X42A 3L8GA 1Z4JA 3AR9A 1O03A 4Y2JA 3OCVA 1XVIA 2WHEA 4Y2XA 3E8MA 5AK6A 3SHQA 3RF6A 2RARA 4Y2RA 3DDHA 4G9BA 4UAVA 1QQ7A 1RDFA 2G06A 2CFTA 4EEKA 5AM0A 4Y2YA 2YJ3A 3A1CA 3U13A 5AW8A 3K1ZA 3U7GA 4GXTA 2I33A 3KD3A 3EWIA 1S2OA 4B6JA 1MH9A 5AW6A 2IOHA 1YJ5A 4UU1A 1CR6A 3ZVNA 1AQ6A 3ZTWA 1L7PA 4UMEA 4CF3A 3W5DA 3FM9A 1PW5A 1T9ZA 2C4NA 3ZI4A 3FGOA 1N9KA 2Q4RA 3WKBA 5AW2A 1Y8AA 1F5SA 2HO4A 4YIKA 5AK3A 1Z4OA 3UMCA 4ZEVA 4UM5A 5ALDA 4YGYA 5E0OA 4E88A 2FDRA 1TJ3A 2IYEA 3I1YA 2FPWA 5AESA 4UU0A 4BNDB 5ALHA 1YNSA 2O2XA 5ALXA 2YJ6A 3AR6A 2WF6A 4JDPA 2P9JA 4UASA 3KOOA 1IWOA 2OA0A 4GIBA 2JAWA 1N8NA 3ONNA 3L8EA 5AKXA 5AI9A 3WK9A 2NO4A 4J03A 2VKQA 1Z4QA 4UARA 4YH1A 2G80A 5ALQA 3RFUA 3QU7A 5AKGA 3PCTA 2HDOA 3DNPA 3SMVA 5AKYA 4CE6A 3I6BA 3ED5A 3U7FB 4YIHA 2YJ5A 2I7DA 4BEVA 1YDFA 4UMDA 1LVHA 1SWVA 2GHTA 2HOQA 2P27A 1QH9A 3B9BA 3B9RA 3ESRA 3AR4A 4BX0A 5AK5A 2YMQA 4NV0A 2B0CA 3F9RA 3VAYA 3ZU6A 3ZWKA 2JGAA 1O08A 4EZEA 4BX3A 4UM7A 2G0AA 1TA0A 5T41A 5AVQA 4I9GA 5A3QA 1LTQA 1S8OA 3U7EB 5AM2A 4DFDA 4Y3UA 4OFZA 1ZS9A 2W4MA 2CN1A 2FPSA 2CFSA 5AVSA 2GMWA 2EARA 3WKEA 1Q92A 4XOUA 3MMZA 2EAUA 5AVTA 3D6JA 4CF4A 2B30A 2W11A 1SU4A 2FUCA 2R8ZA 3FVVA 3L0YA 3A3YA 4MUMA 3QYPA 3WK5A 3U19A 1RRCA 4C4TA 2CFRA 1U2SA 5IT4A 1U7PA 2W43A 1WVIA 3SLRA 2FPRA 2HEGA 3ET5A 1U02A 3QUQA 5ALFA 5AW7A 4HYTA 3ESQA 2BY4A 3EF0A 3WKCA 5AM1A 2AGVA 5AM5A 1QQ5A 1Z4NA 2BDEA 3IB6A 2YBDA 4ZEWA 3KC2A 3CNHA 1ZD5A 4EX7A 3SD7A 3PGVA 4CNQA 1SWWA 2OBBA 3EPRA 3IRUA 5AI8A 1J8DA 5ALWA 5AVWA 2PQ0A 2YMPA 5IT0A 2YFYA 1Z4PX 5AKLA 1L7NA 2HCFA 5AVVA 1TJ5A 4NFLA 2G08A 1ZD2P 1NF2A 1ZD3A 3CZ4A 3QUTA 2HI0A 2ODAA 3L1UA 1ZD4A 5ALEA 1ZRMA 3A1EA 3L8HA 3OTQA 4O8CA 4OCZA 3IJ5A 2G07A 5AM4A 4QQFA 4HGOA 3ZVLA 5AKJA 2OYCA 3QU4A 2B1QA 3N1UA 3SKXA 4AP9A 1T5TA 3NAMA 2R8YA 1JUDA 5AI0A 2GFHA 4Y2SA 2G1AA 3E58A 2AH5A 3QNMA 3OCZA 3KDPA 3HYCA 4HGNA 4F72A 3QUCA 3SF0A 1KYTA 5ALNA 3FPBA 4BBJA 2AMYA 4J2TA 4RESA 3BWVA 2QYHA 5AW0A 2C88A 4XE5A 3DAOA 4H1WA 3ZX5A 4L6AA 3QLEA 2D2VA 1VJ5A 2GHQA 3L0CA 3N28A 5IS2A 4DWOA 4EX6A 1RMTA 1L6RA 3ZTYA 2P69A 2WM8A 4FE3A 2RB5A 3WKAA 2X4DA 4Y2TA 3WKDA 3ZUPA 1L8LA 3AR3A 3OCWA 2WF9A 2IA5A 4PNHA 3ET4A 5AW3A 5ALGA 4C4RA 2B8EA 1Z4IA 2WFAA 3M9LA 1QQ6A 3KZXA 5AIAA 1CQZA 2FI1A 2IOFA 4HGQA 2WF7A 3U26A 2WF5A 1NRWA 3WK8A 4UMFA 3UM9A 3E84A 4OHFA 3E81A 1YMQA 4BKMA 2I55A 2MU1A 4L6CA 1ZRNA 4BX2A 4YCLA 1RLTA 5AVUA 3NRJA 4EELA 3UMGA 1Z4KA 3R09A 3ZW7A 5AVZA 4FFDA 3OCXA 1Z5UA 2P11A 5AKEA 2JARA 2YJ4A 3FZQA 3KBBA 3OCUA 2O9JA 4JB3A 4QJBA 2QLTA 1EK2A 2C8KA 3L0BA 5ALLA 5ALOA 5AW1A 2NO5A 4MWOA 4HAIA 2ZXEA 3NANA 1Q91A 1XP5A 4XPZA 5AI4A 1RQLA 5AVXA 2JAOA 3W5AA 1VJRA 1XPJA 2NYVA 4NABA 1Z88A 3ZWDA 4IG4A 2JAUA 1T5SA 1U2TA 2PKEA 3QGMA 5JJBA 4KNVA 1RKVA 4AS2A 2R8EA 5AKKA 2ZBFA 3S6JA 2YY6A 1L7OA 3BA6A 5ALVA 1RQNA 4KYTA 4ZEXA 3J7TA 2C8LA 2ZBGA 5ALTA 3GYGA 3MN1A 2I34A 1L8OA 2I54A 3NALA 1RC8A 4UATA 2ZBEA 4L57A 3NUQA 4RETA 3OCYA 5ALRA 1NNLA 3L7YA 4DW8A 2FEAA 3L1VA 3L8FA 5AKZA 5AKIA 1ZOLA 5AVYA 2HF2A 5ALMA 4Y2UA 1RKQA 3MC1A 2HHLA 4Y2QA 2DQSA 3UMBA 2FPXA 2ZOSA 4BNDA 4IFTA 1TE2A 1WPGA 1ZJJA 2YN4A 4YCMA 5AM3A 2B8JA 4KX3A 5A3RA 4G63A 1Z5GA 1L7MA 1RPZA 3AR7A 5ALZA 1RLOA 3TLMA 5FP0A 3PDWA 3SKYA 5AVRA 2YMMA
chains in the Genus database with same CATH superfamily
2M98A 4UM8B 4K6KA 3NBUA 2VNSA 3KE9A 2VF2A 3SSAA 2PUCA 1T36A 3PU6A 2ZI7A 4MJ7A 4LJKA 2EHDA 5HR7A 4YV1A 3OVMA 2IVZA 2QN7A 1PUXA 2WVGA 3HB9A 1YU9A 4IOKA 1M0WA 3HEBA 3AM3A 3K70C 4WN9A 2IZ1A 1QANA 4X6XA 1WM1A 3RJZA 1XRNA 4ED7A 4GX1A 1C3OB 1CLUA 1F8UA 1IWPB 3E22B 4FGZA 4L9SA 2YFKA 5JZSA 5KOHB 2IXEA 4LQCA 1D5CA 3LYHA 4CMAA 4BDPA 3HLTA 2VT2A 4OI2A 2YB1A 1T91A 5B58C 3N74A 3ZX4A 2ZIVA 5G4LA 1ADJA 4UTOA 1HEYA 1XPUA 3L41A 1AUXA 4HMPA 1FDUA 2QZJA 1O77A 5JXJA 1W1UA 1W0KD 2J8ZA 2XOEA 4M2YA 2MAXA 3GDOA 3K0EA 4WD3A 1A8UA 4MR7A 2DQNB 3Q4GA 1H3NA 1P44A 2BGRA 1KL7A 1XRMA 1N2JA 3I0ZA 4G5FA 3ZHYA 1G6Q1 1U94A 2P1DA 3EXFA 3HUFA 4QOEA 3AR8A 3KSUA 4BO4A 2W9BA 2X2EA 2P4QA 2IC5A 5KOHA 2FPLA 3CZMA 2RH5A 3KQTA 5IBPA 1BDIA 3IT0A 1DJOA 3EF1A 3T7SA 3JWGA 4MV7A 4IZIA 4DLTA 2OILA 1ENYA 1QS0B 1MF7A 2NXNA 5CDSA 2WB1F 4NM2A 1OHHD 4L5IA 2QQFA 1NDHA 5B7GA 2CMHA 3T0GA 3PHJA 1SHLA 3PI6A 3DEHA 3X1YA 4C4OA 1PZFA 3C98A 4QZ9A 1KH2A 3DBRA 4FMDF 2QR5A 1C8VB 1P7VA 3G88A 3AY6A 4KLNA 5KAMA 4HNAA 3R7NA 3SM9A 1WUIS 1X6VA 2QIOA 3JYQA 4OLHA 4YFYA 1ATZA 3R9KA 1DI0A 3ONVA 4V3CA 1BHJA 2QV7A 5D3QA 3JRWA 4UAUA 1MQ3A 3U49A 2KJ8A 4TTAA 4BLQA 2IS1A 3SXUB 3SC6A 2ODEA 3DS8A 2CLFB 1KIFA 5BSEA 3MLAA 5J8YC 5KVSA 4LMBA 3U4QA 1QONA 4H0CA 3TM5A 1D1TA 2GXSA 2Q2OA 3E53A 3HRKA 3I64A 4HWRA 4JLPA 4L4UA 2Q2NA 3PNMA 3WNCA 5IZ4A 1MD9A 4ESOA 4Q7MB 5EPUA 4YMHA 2RD2A 4YR2A 1SZJG 1WVMA 2H3HA 3UJ3X 4WERA 2AOXA 3IMEA 2ZI4A 4E5SA 3E0FA 1JG4A 1DAOA 4DF4A 4Q3KA 4DQKA 4TTQA 5DTJA 3I23A 2GX6A 2SCUB 3MINB 1ICEA 1RZ3A 1XAHA 2IE8A 2IU3A 4Q1DA 3UKOA 4KLDA 1D4FA 1YE5A 3BS7A 1E5DA 1DARA 2EANA 4OHUA 1RTTA 3TRFA 2PE5A 5B58T 1OLOA 1N2GA 1XQ6A 1HYEA 2EWVA 3BJMA 5AHRA 1WV0A 1WETA 4JBGA 2G06A 4MVJD 1NJ1A 3TTUA 3EVTA 4JVOA 3UJAA 2B94A 4R8RA 2H00A 3WJ7A 2WOOA 4RHTA 2YJ3A 4G56A 2H4ZA 4D45A 4HVLA 4A9AA 2ZIUA 4Y9RA 3ZCRA 1U0LA 2DUUA 3ZNNA 4Z53A 3AQ4A 1QK3A 3JQAD 3F73A 4MCJA 4Q9NA 3NXKA 1ZQOA 3HDVA 3FUUA 1USUA 3ND9A 1I1OA 2OZPA 3N7RC 1T2DA 2ZTSA 2HLNA 2AFIE 3GWZA 4FYVA 2EX4A 1P9WA 3IDZA 3KM0A 5GGXA 1YT3A 5D5HA 4UE3S 1PO7A 3B36A 3MYYA 5SV2A 5LKAA 1QB8A 4UMEA 4CF3A 4ZIRA 5DWDA 3QX9A 1A3CA 1HFWA 1NRJB 4MI1A 2GOLA 3MS2A 3QLUA 1EXMA 5BOVA 4E11A 4LOKA 3CJQA 1J0XO 2QRHA 1BGVA 1AGXA 1RM3A 1M2KA 5H1YA 2CEKA 3V34A 3B9PA 1Y8AA 5K3OA 1AV6A 3IEUA 3BTUA 3FB4A 1CS4C 4ZXPA 2WD9A 2F2AB 4PZZA 4RMGA 4HEA1 4NBTA 1SVIA 3GRPA 2MUTB 5ULLA 3OKAA 4YWJA 4GC6A 4YR9A 2CLKB 5CB6A 3D3EA 1XUOA 4RE5A 1DC6A 4BXOA 1Z34A 1E2MA 2VZ8A 1M2GA 3VU3A 1E3SA 3DMGA 1Y42X 1V39A 5EFZA 3RHTA 2R66A 3B48A 5FUVA 2R8GA 3ORHA 2JK0A 1MW8X 1RAEA 3NCHA 4HDMB 2FAXA 2V9CA 4EM6A 2WF6A 5EOZA 2PU7A 3IP6A 1AXRA 3QJYA 3I9NA 3L18A 4DV0B 2CHVA 4EFLA 2H3QA 4FZLA 3GVPA 5CXQA 1P0MA 5IAAA 3Q11A 2CLIB 4PR0A 3ONNA 3SMQA 2BEWB 2CLDX 5KFGA 4OLBA 4J03A 1GAEO 2B1GA 4IXDA 4MQLA 4PGAA 1ISHA 3TRKA 1VRVA 4E7PA 2CB0A 2DM6A 3D3KA 4ZGWA 5KOJB 3RI3A 2C84A 1Z7BA 4G36A 1FXWF 4XGRA 3H8MA 5T6MA 4RQ6A 2O8VA 3ZEIA 1ZI9A 1F7UA 1NF8A 4HXFB 4JMPA 4KMOA 2VA8A 3IV6A 1RP1A 2HLHA 4KSBA 2GDZA 4ODIA 4NF2A 2WMDA 2HSJA 1SXQA 5FTNA 1DZIA 1EZ1A 2ON6A 3GLFA 2W6ZA 3TIXB 3N2KB 3FN4A 1WCV1 5CXUA 3SE0A 3STWA 4TMFA 4A2WA 1YIAA 1SG6A 4IJ5A 4N7RA 4WWHA 1CV2A 2OB2A 1PYOA 4YJ3F 2LDBA 4AN1A 4YO7A 1RBMA 1M0SA 4K6HA 5DP1A 2P27A 3CH4B 2R4UA 4NPAA 2R5NA 3SJCA 3FNBA 4B46A 5KO2A 4WCFA 2AKAB 1UPTA 1OYYA 1T5HX 3V7JA 1PK1A 1OFUX 2PGAA 4BLWA 3DVSX 2I9GA 4OB6A 1QTMA 1YR2A 4O4HA 2FFQA 3E8XA 4GPAA 2B0CA 4ZOLB 3CE6A 4PL2A 3DXYA 2QVCA 3VC2A 4LDAA 4ZJPA 4X5OA 4OQPA 4PPYA 5EWJA 1LC0A 2HZ7A 1ZN9A 4BWMA 4EGAA 5K20A 2N46A 3GLFB 3PC6A 1CUHA 3K70D 1N2CE 2JBHA 4R0NA 1LY1A 2IQIA 4M0DA 1SQ6A 1FSGA 3QLUC 2YH2A 1W5TA 1CZNA 3I32A 1FCJA 4P58A 1SV0C 1UCFA 1CU1A 3OE1A 3EVNA 4K9QA 4TVBA 2D2EA 1QPBA 1EUCA 2UVWA 1JTVA 2P3QA 3KZMA 4O1IA 2QF7A 4RZUA 4XOUA 5FWYB 3D7RA 4ZYWA 2VUTA 3OE5A 3BWCA 1G59A 3IMKA 3L06A 1GPH1 5FFNA 2VXYA 1YMUA 4ED1A 4QG3A 4MWEA 5P8WA 4H7PA 5KNCD 4U9HS 1LK0A 2POQX 1CXZA 1TZCA 4EKGA 3H8SA 2ZWIA 4M54A 2OY0A 4IJUA 5FWNA 2QTMA 1KDZA 4YREA 3RIGA 1HLGA 4EI8A 1NLMA 3UUFA 1G20E 4TOIA 5HHIA 2CVZA 1KARA 2OENG 2ZTCA 2WDPA 1U1CA 4MTLA 4RJ2A 1SH7A 1ZIDA 4RNCA 5EZYB 1JPVA 1Q12A 4DQQA 1GA4A 3VU0A 2KKVA 1PQUA 2OAQ1 5JWOA 4V0MA 4G5GA 1CIJA 2I4IA 2QLJA 5EE3A 3G85A 1AZTA 3GBVA 3K0AB 4MWTA 1KZYC 2W5UA 2ZBPA 1RYDA 4ERNA 4JP3A 1R1DA 1X3LA 3QYAA 4KR3A 4C2AA 3E9ZA 5I6DA 2FZVA 2HIAA 1U99A 1AROP 2JFWA 3O2QB 2ACKA 2Z2KA 4MH0R 4OQXA 1DX6A 4AWAA 4J0JA 4BTEA 3EQ8A 3WLMA 1WRBA 2WIJA 2EDUA 4PLWA 5DM0A 2R62A 2EVWX 5JNLA 5MFPA 2BCEA 1VIDA 2HHXA 4BPBA 2QX8A 1Y9ZA 3O1IC 1S01A 5J0PA 3A8TA 3LQQA 1RWKA 2MINB 2HBJA 5H81A 2ZJ5A 5AI8A 1J8DA 4MAAA 2HA2A 3FDXA 2NZWA 5J1TB 4B2IA 3IE2A 3U48A 4BC1A 1IPHA 5EJ4A 5KFHA 1QX3A 1U6JA 1F1JA 3RAEC 4IF6A 1QHHB 3LWZA 3GRUA 3BSSA 3UHOA 3VNRA 3INTA 5CVTA 1BMFD 3A6FA 3PFIA 4WOKA 5IUKC 3NBYC 2CDCA 3FHJA 1P3DA 2NXCA 4S3MA 4B40A 5PNTA 1EE2A 1UBLS 4RL4A 1DLJA 1EEXB 2WE7A 3R6TA 3W8NA 2HI0A 2C0CA 3O0DA 1T2FA 2QL9A 2Z5LA 1YMVA 4C8MA 3HCCA 5DIZA 4DUYB 4HQLA 1WZ2A 4IHKA 3OTQA 1K7SN 1E9BA 4KBFA 3M6LA 3GDGA 3LBNA 5IH7A 2J0EA 3FFTA 4MHSA 3Q3CA 3VYSB 1XQVA 2QW0X 5JVDA 1ORWA 2RC5A 3SEIA 2W8LA 3AIIA 3D2AA 2G76A 3QVGB 4O5EA 1OFGA 3QU4A 1OGIA 4P36A 3M83A 4Y1RB 5IKOA 4F3CA 4KXFB 1JR3E 3BJIC 1YB2A 1XDGA 1NZJA 2SKDA 3R5SA 2PMZF 5LYJF 5ILOA 3NT4A 5KG4A 1DCTA 1WCNA 1ODCA 5C37A 4EY8A 4ZVRA 3KTDA 4O2BB 1QLJA 3PHHA 1Z0AA 2DKXA 3DBHB 3X1JA 4NOMA 4OJYA 2K5UA 2ODPA 4IIDA 1CQJA 2BHRA 3KJFA 2RI6A 4HGNA 4KYIB 4II3A 3L4KA 5IFLA 1RJWA 5ALNA 1CJKC 2IU4A 3ZI0A 1RW4A 2AMYA 2XC9A 3MLEA 3TWOA 4U7GA 4OGFA 2HK8A 1DRKA 3GA7A 4PSCA 4YCXA 5TVKA 4D8WA 4Z1MD 5DN6D 3U7JA 2JKVA 3I05A 2C61A 1Z73A 4YP5A 5HMLA 5L1MA 2WIAA 1TO6A 2ZJ6A 2D8AA 1YFLA 2V7UA 4HYYA 3CV3A 4XUGB 4K4GA 4EZIA 4BB6A 5KG3A 1H6AA 2W6QA 4C7VA 2D2VA 2AI1A 5JSHA 3TZ6A 4J0QA 4IQWA 3G7NA 3IH5A 3DEEA 3MFIA 2C9DA 2E82A 3M4XA 1XS9D 4Z51A 4DWOA 1G8HA 3O0TA 4DCSA 5HKAA 2OFWA 3D3QA 3IKJA 3DBHA 2VRCA 3BQ9A 4ETMA 2OZVA 2C2DA 2FGKA 2PLAA 4PXAA 4QZEA 1EFRA 5KYYB 1FNSA 4FYMA 4JLJA 4G3XA 2F00A 4ZT5A 1NNI1 3OCJA 4CYMA 1TNDA 9ICCA 5HYVA 3WU2U 1W5AA 1DDGA 1KPIA 4G8DA 1NTRA 4M47A 1G3IA 4C07A 5J3JA 5F9LA 2QR2A 2G5PA 4LJ4A 1U3TA 2Q5LA 3BE5A 4ME6A 4TMYA 1I0IA 2ZIVB 2Y6VA 3MT7A 2Z8XA 3OE4A 5GM2A 4UTPA 4CLOB 4I5FA 4PZOA 5BQPA 4FYHA 3NYQA 3BXGA 5I9BA 4CIDA 5JDIC 1VYUA 4IP0A 4RZIA 4J2HA 2GBLC 1G5FA 1G4AE 1AUPA 1IV8A 1Z15A 2OFXA 2Y1LA 2HMSA 4MVJP 3TK1A 2QPTA 4GGOA 3AF1A 5DQGA 4ITUA 5TNXA 2YXDA 3B3QA 4OHFA 3LO5A 1DIBA 4ZOEA 2ERCA 2CV0A 4GUAA 2UYOA 1PR1A 1KTVA 1PWHA 4QZ8A 1ZJMA 4UCWA 4N0DA 3EXEB 3O47A 5T7BA 3BH6A 2Z2JA 1S0OA 1XELA 1VKZA 2YQZA 3DTNA 3FCSB 1HXHA 1OXMA 4N82A 2QOEA 2VWHA 5AMXA 2JFYA 5C34B 2NADA 3WSVA 5L7TA 2P5YA 2CF6A 2OZLA 2VPYA 3GLVA 3H83A 4TUYB 5FWXB 3KUUA 2VNJA 3RRNA 1O6CA 2JH7A 2IX9A 3H17A 4MUIA 2CXPA 2UXCB 1DTWA 5GONB 1C3XA 3UTDA 2A94A 3BG5A 4DQDA 4AO8A 4DUGA 6NULA 5A0VA 3R3XA 5K3SA 3IG8A 3MGVA 1BE8A 1I4OA 4FT4A 5FUWA 5KOYA 1QC5B 5FLEX 3DDZX 2R44A 4C8OA 3NOXA 4HAIA 4OBWA 1KI6A 5JFGA 2VHQA 4RVDA 3HB5X 2V5AA 4URZR 3UY4A 4O5CA 1CETA 4XPZA 3VNUA 3FOZA 2X5OA 5EKUA 5E6SA 1R74A 1DDIA 3ORQA 3OFND 1K6XA 1TIPA 3DWFA 3W5AA 5J2BA 1BC5A 4FDLA 1J99A 1NATA 4JNKA 5DF1A 1T5SA 5DCUA 3V6LA 1O97D 1NVGA 3L1JA 2JI7A 1V5IA 4IQ8A 3TUJC 1ZRHA 2ZBFA 3X2EA 3CYMA 5KVAA 3PFWO 4IDNA 3QMMA 3J81A 2QLLA 1RQNA 2WU3A 1LJLA 3DEYX 4OPMA 1KFCB 1C4OA 4L85A 3SBDA 5L3ZA 3TRHA 3WGJA 1OYOA 3MABA 4DJFC 5JAHA 1CY2A 2JH1A 2I34A 2GAJA 4O9MA 2XRMA 3OX4A 4H6PA 3HU3A 1Q0TA 3DMHA 4EYKA 2E4VA 2R65A 3OCCA 5T8KA 3UTCA 1DWOA 4CU5A 2Q3FA 2GYUA 2C29D 4AF7A 1UIRA 1XKTA 2DUYA 4AX8A 2XITA 1IEWA 1HG0A 3FOBA 2C2RA 1M2VB 8ICIA 5F9NA 2HRCA 2NQ2C 1ORVA 1Z82A 2ZYWX 3O4IA 4DR3B 2XZDA 4JI4B 4CCHA 4HAZA 4V38A 3NMUF 4OGWA 1BVHA 2Q9CA 5DNWA 5J5VA 4F3YA 4RQ8A 2DF4B 3TTYA 4BVKA 4DOMA 4EITA 1LXCA 2YYYA 4L0QA 4P7FA 3TQTA 3LCCA 3LM8A 5DLPA 3L02A 1SL1A 1V5FA 2P3SA 2ZAIA 3D6NB 3GBSA 3OC6A 2DLDA 3PDIB 4YONB 4I2IA 3EZLA 3H9QA 5B7NA 1ZP6A 3I1FA 8ICGA 3F2IA 2K2QB 2Q1XA 3OZAA 2NRVA 2C2MA 2CNNA 3HKZF 4AUMA 2YVKA 4PL1A 5KFNA 1WW2A 2ILTA 4GG1A 1ZQGA 4JI1B 1U8CB 2CWWA 4RIHA 4J9SA 4A3SA 1GG2A 4BFCA 3OX2A 3RD5A 1B0ZA 2D0PB 4E08A 4MV1A 4OUKX 2X1HA 2WP0A 4A0RA 2WTUA 3MMNA 3N39C 3NBMA 2K60A 2FN7A 2IUTA 2O1EA 2NUPB 3FPSA 4QIHA 1R4MA 1SC3A 1RJGA 2ZVDA 3Q7TA 4IUDS 4MICA 2EKZA 4YI5A 3T3NA 4OHPA 1RZRD 5ENDA 5FBKA 1F1BA 5B36A 4J9VA 5E7JA 4DEZA 4D9BA 1Y3HA 4TYPA 3UC9A 5L3VA 3SX4A 3IUJA 1WU8A 4MS4A 1TJ4A 2I3GA 2PPLA 3D54D 3VV3A 1KH3A 4GVXA 2KSOB 4JI2B 1XIVA 4MUYA 1G5IA 3AKEA 5ALJA 5F9MA 2Z2YA 2FPUA 4FNOA 5DGCA 3IBCA 4DLSA 4DL2A 1KYVA 2UYYA 3SFZA 5IUJC 4DHWA 1KDPA 3BHIA 5JCPA 4B3TB 5LP6C 3HXOA 1T3TA 2IFTA 3HYTA 3F7TA 1K8RA 5A3SA 3U37A 4LY9A 4KXXA 1KR2A 3EEQA 3PDUA 2QJWA 3ZWNA 2RK3A 5GVRA 3ONWA 5FBRB 2I1VB 3QA9A 2EZTA 5ARDA 5A3VA 2WHXA 1S0NA 2GPYA 4N4AA 5CB4F 3PXDA 5FUQA 1UBKS 3KQUA 3ROEA 5ER6A 4V0OA 4EVSA 2FTKE 3B6JA 3C0KA 2UV8A 3IQFA 1SCJA 2UZIR 3COSA 3IT2A 1L4EA 2W6JD 3JSAA 4IJVA 2ZCVA 4JEIA 4EGFA 5LBTA 2HDNB 3WK4A 3AUYA 3ZWXA 4U2CA 1NE2A 1UXOA 1X14A 2VTBB 1THTA 4H6WA 3ROXA 2NUTB 4UM9B 3RBXA 3UMVA 5TISU 2QSZA 4EHBA 3TZEA 2UDPA 2XZTA 4UREA 3RC7A 3V6HA 5M7EA 4MKZA 1FW6A 1N9GA 3A1WA 1XJ5A 5FNZA 3RRHA 1OLXA 1Z07A 2QTFA 1DUSA 3LL4A 2QPLA 4H7KA 1F2TB 3PZBA 2IZ7A 4AICA 3DNFA 2ZK7A 3TIVA 5F76A 4E0BA 1BE1A 4MVJI 3I2HA 4RIGA 1P2FA 1K1EA 1DEKA 4QIWC 2RBEA 1L5SA 5JALA 4DV1B 2G40A 2XT6A 5TEWA 4FCWA 3TQ1A 5J0TA 3NRBA 2PH5A 4RQ2A 4NBWA 4ID3A 2B0JA 2DPXA 5AK0A 521PA 2VDOB 4B2YA 1GIAA 5L1LA 3N05A 2ZJ2A 1QZXA 4RZHA 1V8FA 4OYHA 2GN2A 4DMKA 4NCAA 4B76A 3L8GA 4X45A 2LTAA 1O03A 4DG8A 3LQKA 4FB5A 1EQUA 4LCBA 3WMWA 3CNBA 4IV0A 3ICWA 4ZQEA 5D3MA 4IIBA 3VCBA 2XKJE 1LV5A 1WXWA 2ACEA 4HAVA 2E8MA 4NDAA 4FWBA 5LDGA 3V1TC 5CHGA 1E8DA 3P9IA 3U39A 3WOHA 2A0XA 5DBFA 1PWXA 3SZLA 4TV8F 3T7IA 2VBGA 4EFMA 2JS7A 2HJHA 4OJ6A 1NT2A 1K92A 2HLDD 1U7HA 5CW1A 4DWJA 1YE8A 4LC9A 3AEUB 5KFYA 4R98A 2ZTEA 4EEYA 5KFMA 2BDPA 1G17A 1UQTA 5CP2A 2LYBA 2XTZA 3PQEA 5CX4A 2QA5A 2H2FA 5D5QA 4Z49A 1SXJB 1XZNA 4GLFA 1DAPA 4EVIA 5JZMA 3S70A 1CZRA 5A5DA 3OFKA 5ADWA 2VSYA 3DO6A 3E61A 3DCIA 2F3PA 3HFGA 5P21A 5BN4A 4U2BA 5AXCA 1GGJA 1PF7E 3HXKA 3DEJA 4LZAA 1RHQA 3WBFA 4ENRA 2ZU0C 2X41A 4KLSA 1V43A 4YLGA 1RI2A 1JJVA 4H7HA 2JEGA 2BEUB 3H9EO 4XVQA 3RUPA 4B35A 2RJOA 3FMIA 1GADO 4RF3A 4B3RB 1XC7A 2OHOA 2ZP1A 2BUCA 1EINA 4LRYA 1QCDA 2ISCA 4DQRA 3EUB2 2Q4RA 2XDQA 3A14A 3BC1A 4RNMA 3OSZA 4YRSA 1EXVA 1V48A 2ATLA 1L1QA 2BBTA 3G2OA 4M8LA 2HGSA 2AXEA 1Q50A 4YIKA 3UMCA 2KPOA 3IUQA 1TK8A 1M1NA 1U2DA 2CXXA 2OQ2A 3K16A 3PL1A 4RVFA 3RVPA 3SJUA 4FW8A 4PIVA 3AEKB 5KFIA 3RSLA 3SS8A 3I1YA 4Y98A 2JI9A 5F52A 1N7HA 4L0CA 3NC4A 5IBRA 1U2PA 2VIIA 2J6BA 5JE8A 3W2TA 4DCMA 4NJOA 4HG2A 3RREA 3ITKA 2IZ5A 3Q0IA 1KRWA 2W48A 5E79U 2O1SA 1CVIA 2J0VA 3NDBB 2YC2C 7ICVA 2B8NA 3OY7A 2ONCA 3TW0A 3FYHA 3OM1A 3LBIA 3LUPA 3NRCA 4OA8A 2DH6A 2C2EA 3VR0A 4F4ZA 2XHEA 2HOIA 4XTCS 1VB3A 4IQFA 4BQSA 4JB2A 4OSEA 5MN5A 3T99A 5TZVA 1BXRB 3OSUA 3RJMA 3VR4H 5E38A 1P2UA 4QEKA 2BTQB 1TXGA 3GLHB 4ZJUA 2POCA 3EIQA 4QNMA 1JTEA 4WBXC 3FIJA 3OESA 4UBMA 1CY4A 1YASA 1RPNA 2D2XA 5ITVA 2JGDA 1WCLA 3D8TA 3KP1A 1F3OA 4YCBA 5DCLA 1VHWA 3T3PB 4HPJB 2ZXFA 1E9EA 1SBQA 1B0UA 3GMSA 3JTEA 3VRHA 3EF3A 3CG0A 3THXB 2FSVA 2EQYA 3SQDA 3VDQA 2C7PA 1PVQA 1FU8A 2L2QA 2GBIA 2V65A 4IHJA 1ZYUA 5KL1B 4P35A 4LQDA 3QTTA 5IEJA 1PR6A 1S3FA 3CC8A 4KVGA 5JRZA 3Q8LA 3QWBA 4G26A 4MKIA 4F5NA 4IAOA 4UMDA 4Q8FA 2QSJA 1CB7A 3KDSE 3ETGA 4TMXA 3B9RA 2WQZA 1B0AA 5JO0A 2AGOA 3K9NA 2XDQB 1GZDA 3RAXA 1YR8A 3M5CA 4OHXA 2ZT8A 3UHFA 5DISB 1U0EA 3IDWA 1CQJB 3E5MA 3IPAA 1HLPA 3WGKA 1YCDA 1T3QA 1JN3A 1SKUA 1ULSA 2IEAA 3D8BA 3E9EA 4WXPA 5T41A 2QZ9A 2WM3A 3F4BA 2I2BA 1U3UA 5G2OA 3UF0A 4UQOA 3F8TA 4RABA 3GJRA 2XBLA 1B6SA 2DFPA 1X9WA 4W99A 2AJCA 3AZPA 1XDSA 2HPAA 1F17A 2ZYRA 4JSYA 1UWLA 4TKMA 2E1EA 8ICOA 1Z68A 2ZUTA 3WLOA 1JJIA 4Z4QA 2G67A 2YRWA 1BE6A 4NS4A 5HIIA 1P19A 3WKEA 2Y0SC 2VNIA 5FLYA 2KLBA 1ISSA 1JJBA 4BB0A 2HHSA 2AYXA 3X43A 2IBSA 5EXEA 3OQ1A 4JOCA 2XUOA 4TM7A 4Y1EA 2DCMA 5D6NA 3D8HA 1GOTA 2RJ3A 4XJVA 3T4XA 4D26A 2BE9A 4TURA 2Q1YA 4NEQA 5K3AA 3LWNA 3DT8A 2E5LB 3DL7A 4D46A 2OCBA 3Q72A 4JLAA 3L0YA 3RFTA 3FLEA 2FKAA 3CGGA 4OHCA 3F7OA 3RR2A 1RQGA 3N0TA 2HBKA 1T9HA 3HYNA 3PB3A 4PLGA 4OMDA 4R68A 6Q21A 4ON9A 3QVKA 4V0RA 3DBVO 4XUCA 2BTEA 3RS5A 1SCKA 1O9BA 1IN8A 1BMDA 1JF8A 2ERYA 4HB4A 3RRMA 4BZXA 5I4CA 2O8CA 2E5WA 2J3IA 2ODQA 2PX3A 4TKLA 1OILA 4CM3A 1XZIA 2QX9A 4S1WA 4HDNB 3MGGA 3N2YA 4HN4B 3G8YA 3ESQA 4HHEA 3A2NA 4I1UA 3FSJX 1QFJA 5CLIA 4ND2A 5KG7A 1DKRA 1MRSA 2NM0A 4YQFA 2UUPA 2RSLA 3F46A 3EGWA 4FR2A 4OP1A 1B73A 1XEFA 2OFFA 4DTIA 3IR6A 2R8BA 4UBLA 1YDWA 4FGJA 4L02A 3WTCA 2O8FA 1SKYB 5HFJA 4ZGBA 1YUBA 5MDHA 3OQ6A 2HM7A 4REMA 7ICSA 4RJJA 4CKBA 1WUJS 4FMPA 4CT0A 1AZSC 3K9BA 3ADDA 3KHRA 1PNTA 2GF2A 3EFEA 3KJHA 2W55A 4LNHA 4MZXA 4PV7A 4WACA 3RG8A 5HE9A 4CV0A 4WLFA 3I9V1 4ES6A 4TUQA 4K6OA 3L7IA 3UAXA 2WPDA 1Y8ZA 2H85A 2BBSA 3KT0A 4RF2A 4U7TB 3T5LA 3FVRA 3NBQA 4F21A 4UQLA 5JSUA 2DTEA 4KMSA 1FDTA 1Y5RA 2OBFA 3HJUA 5HIJA 1WCIB 4JT9A 1IAQA 1B6TA 2B5OA 4I6GA 3DP7A 3HV0A 4XWAA 4GYJA 3WRXC 1ISIA 1CJMA 1Q74A 3FZNA 4NFLA 5A0TA 3P71T 3K5IA 4PYNA 2BF4A 5EFOA 3CZ4A 4K6FA 4RT2A 4RU1A 3GN2A 4OAQA 1EFCA 1NV9A 3L1UA 4IH9A 4JOQA 3IVXA 3DE1X 2PKXA 2K6GA 2IWRA 1QV7A 2C4VA 4HZIA 4I66A 2KEYA 4DC1A 2LM4A 4C7YA 2I2XB 2V6BA 2ZYDA 1CS0A 4OYRA 1LPNA 2P66A 4WN3A 2NO7A 1E1KA 4HGOA 4KMRA 5K1ZA 4R9NA 2PXHA 2ZWOA 2Z5GA 2O5VA 1ZNYA 3ANXA 3DHEA 2QLMA 3H18A 3PI7A 3VVLA 4C0AC 4CQMB 3LCVB 3HRDD 4HNTA 2J7KA 2ZROA 3QEKA 1GRNA 4MFCA 3UJ8A 4D8YA 3CXUA 3C3AA 3NTUA 1ULTA 3W04A 5CNIA 3HSYA 3K8OE 2B83A 3OPVA 3OPYA 4AKGA 2GTHA 3GAFA 3ZQ4A 3UGQA 1DJMA 3HJCA 4PX3A 1BVYF 3LVBA 4F97A 3IP8A 3KS9A 2C57A 1NC3A 4KUGA 5ELMA 2PBLA 3RBAA 2WYWA 4EB6B 4RTSA 1IAVA 4LDZA 1MB0A 3ZJYA 1KZ9A 4LIPD 2M2IA 1N57A 3ILVA 2ZUWA 3T1VA 1YBAA 1MA0A 3GPBA 4MX8A 4Q9IA 3H6KA 3P0HA 4YASA 1JG2A 1G5QA 3PXXA 4JT2A 4OY3A 3DZJA 1WTCA 3L9XA 1UBTS 4NDNE 1JNYA 2GTIA 3PEFA 2W3RA 2PH3A 4LZGA 1U8FO 1YA4A 2W04A 1VJ5A 7ICKA 1TKCA 2X14A 3FMPB 4O29A 3NETA 3TIFA 5KIAA 1MC1A 4LXXA 3N8KA 3NH9A 2QP9X 3NGDA 4UCQA 4EX6A 1DQPA 2Z8YA 3E3LA 3ZY2A 3UHPA 3K72B 1VGVA 2P65A 3AONB 4Q6BA 4KMOB 5ESRA 2WYUA 1LI4A 4AU1A 2VDRB 1P9LA 5K3FA 4QZCA 1RM5A 1RU3A 1KBQA 1U45A 1L4HA 1QYDA 3K6JA 3C1OA 3SYZA 1GGNA 3LYSA 2MWMA 2O4UX 3DOFA 1KQFA 2OGZA 3FE2A 3I9JA 1DBVO 1S0UA 1JI0A 3DLBA 1HTBA 4R1OA 2C92A 3HCPA 3ZNOA 1JSRA 3TTWA 4KIJA 5EUMA 5JPIA 4C4RA 4JWKA 1IL0A 5K8LA 3OTOB 2I4LA 1D4AA 2CKMA 3UAWA 2J4DA 2OWOA 5B5EU 2P91A 1RJDA 1GUYA 1I01A 4EB8A 3MIZA 1O87A 1EFUA 1GYRA 3QBEA 2CJWA 2VTVA 3QWFA 1JMVA 3M34A 4JHXA 1TZKA 3FPHA 3H84A 1MB2A 1ZCZA 3D1VA 4PSKA 4Z3DA 3ZHBA 2GZ3A 5JSZB 4MKGA 3HCAA 4RHXA 3M3DA 3THXA 3N4MB 1YKFA 1ZXXA 4YP9A 5TY0A 2WG0A 3G5LA 5DT2A 2WD7B 3OT1B 4W8HA 1KDOA 3O9ZA 4ZHQB 2VCYA 3DEKA 3TX6A 4EHLA 2QMUA 2ZJFA 1R66A 2FW1A 3M2TA 3MJRA 3C5GA 1EP2B 1X6IA 3TNJA 3UJBA 1RLTA 2Q9AA 4IIEA 4NEGA 3ZV6A 2XTJA 3WB1A 4DCOA 4P4PA 1B1CA 4LOIA 4Z9BA 1IB0A 3FTQA 3X1ZA 3VKFA 3NEAA 4HQFA 1IM8A 1E62A 2W2TA 5DLYA 5E6SB 3MWDA 1LDNA 1O4WA 2JH3A 5DDMA 4IJ6A 4NBSA 4KO4S 4FKMA 3CPJB 2P78A 1GZUA 3HR7A 2C96A 3W79A 1NP3A 5F9FA 4KWIA 1E3WA 5TXGA 3NS1A 4JB3A 4UQGA 3UMYA 1R6TA 2G7ZA 1TF7A 4YT8A 1I7PA 1MT3A 2FMUA 1PZNA 3RWBA 1AHIA 4B81A 2WBLC 5K05A 1T5IA 2L42A 4NMXB 5BN3A 1DC4A 4QIWF 4GVPA 9ICUA 1FJHA 2A5FA 5ILGA 1XQXA 3KXIA 2JPDA 4X91A 3F5AA 5HJEA 1KQOA 1KKXA 4FGLA 1ZH8A 2JFQA 3GG9A 4WK6A 1Q3TA 2Y1XA 1UK9A 2Z3WA 3PX3A 4NCKA 1P7YA 2WUEA 3U4CA 4Z0NA 4ZYTA 1CZHA 1G8AA 4UB3A 1QWSA 1XU4A 1YFKA 2Q99A 4PICA 4RVGA 4WZAB 1XNGA 5E1MA 2AXNA 3GIDA 3SEFA 3UUEA 1VBMA 2NVBA 3ONDA 4E15A 1G291 2C9ZA 3U3XA 1IY0A 3L6DA 4FDVA 1T0IA 5E4JA 5J2TF 4CKXA 1XKLA 3S6JA 2QZPA 5ALVA 4JUIA 2XMDA 2OP1A 1LRLA 4MMYB 3QX3A 1TD1A 2BEUA 1A7JA 1UANA 2ZBGA 2KHQA 4BIMA 4F06A 3MUOA 4INAA 5FIUA 1BPYA 3ITNA 4BNNA 3IPRA 2W7TA 4H60A 2QUZA 3VPSA 3NUQA 1C30B 4YQWA 1UBHS 4HZUA 3HN7A 3HU2A 4S2UA 4DKXA 3CJTA 1E98A 1GNPA 4KYVA 4A6XA 2ZAOA 1HH4A 2DEUA 5HJ5A 2H59A 3AP2A 3RJGA 4OP2A 4CVNA 3F8SA 4JI7B 1AUVA 4P86A 3N97B 1YIOA 3GG2A 3RHFA 5E9JA 3GLFE 1Z0UA 4FYXA 3JYPA 4XR4A 2JGLA 2HMUA 1IB6A 1UZUA 2OBNA 1X8XA 2QTAA 2R8IA 3BS5A 2DQSA 4GOXA 2BGJA 1XO1A 2FWJA 4DLKA 1NULA 4ZOHC 2FPXA 3LECA 3AP3A 3PUZA 3VDRA 2GPBA 1WPGA 3RK4A 2WJAA 3GJTA 4D8XA 2ECQA 3AEUA 2AQHA 3CRQA 3NIFB 4CHGA 2V97A 1CUDA 3RARA 5AUNB 1ESMA 5DGXA 1Z37A 2QQEA 3IE1A 2J41A 4FFWA 4ZAYA 3DLHA 2NQTA 5U1PA 3O1LA 3H4IA 5F12A 5ITZB 1MA7A 3SC3A 1KY2A 2RHBA 3WQBA 1Q0RA 3QNWA 3VAAA 5BUCA 3SF8B 4TMTA 5K8VA 3OG9A 3H0RB 4Q1FA 2RI0A 1RM6C 2ZTDA 3PDWA 3NGXA 4BO3A 1PK9A 1E5TA 2F1KA 3O1HB 1BHO1 1DBIA 1JECA 1D5WA 2XMRA 1U8ZA 3L7KA 1TM1E 3QENA 4REQB 1FBTA 3QX8A 1TQ8A 3IUSA 3D7KA 3RHZA 1DQYA 2YY5A 3FGNA 4PBSA 3SOPA 2XAUA 2YQ4A 4YJGA 4HRYA 2GN0A 3HA7A 4LE0A 3VJMA 1ZQ9A 2H7CA 2WSIA 2Z4SA 3W4KA 5TGTA 4J4BA 1HTTA 4WFIA 2B1RA 3C3CA 2B2CA 3GJ6A 3LT1A 4PINA 1SCAA 2HQBA 1SU8A 2LIPA 1NIPA 3CLRD 1Y1TA 3E8SA 3K2EA 4KNWA 5I7HA 3ZHCA 1N3BA 1KI8A 4ZCIA 4PGHA 2F76X 2RRDA 4DFPA 1M7BA 2FX2A 7ICEA 1N7GA 2MSEB 2QNRA 3ABZA 1XCLA 4IQUA 2MSNA 1KK0A 1KOFA 3EH1A 1OZGA 1HBJA 1HUQA 1RJEA 1XSLA 4FN5A 4I81A 2QM0A 4DL6A 3CLUD 4Y6QA 4MF2A 4Y1FA 3RVSA 3M9OB 5CVEA 3SIXA 4MW5A 4AL4A 5EMMA 3WGVA 1RVV1 2Q1TA 2FVXA 2VO1A 2ZQYA 4TGLA 1DXHA 2FFJA 4NLLA 1QHSA 3ZE2B 5KNCH 3CVUA 3F6CA 1TPYA 1PVPA 4QZIA 3GLIB 5DBHX 4ZRMA 1CULC 2IOQA 1RAIA 2GAFA 2SBTA 3PR1A 4OQ4A 4ZV9A 5KMGB 3HL0A 3SP1A 3IEKA 3V4VB 4D79A 1UOQA 3MQ2A 2H1HA 1LFAA 2DT8A 2ZXHA 1T7PA 3HB0A 1B42A 3ICOA 5DB9A 3ZJTA 1MXFA 4AMUA 5KQSA 4CV3A 2PNFA 1B14A 3H1EA 4E12A 4DXHA 5EVCA 2G9ZA 2W9XA 4Q1CA 2CW5A 1ZXIA 2XMQA 2QAGC 2HBYA 5JCZA 2XQFA 2JGFA 3OQMA 3CVWA 2I6XA 1IDN1 3KKKA 1N92A 1U6IA 4A0SA 2IYYA 4MV8A 1EDZA 2F3UA 2G5IB 3C7TA 4AF6A 1AM4D 2LHTA 2O3JA 4US2R 3CRXA 1XTRA 4UM9D 3NDPA 3NEJA 2HSZA 3ZIDA 1IVYA 4C3UA 1K3FA 1D2HA 4G09A 4PHCA 1V9LA 2HQ1A 3D4NA 2WJWA 4AVYA 2GO7A 2QDXA 4KE8A 5CFPA 5I47A 3CKLA 1EVEA 4HEA6 2YTUA 4L8YA 5KG1A 5BN4B 3RH4A 4DR2B 1NZPA 3HVIA 4GKVA 2Z56A 2AN5A 2FW0A 3SU8A 2NW6A 2CXQA 4ZTBA 5KNBD 1C2TA 3AI2A 5JDCA 1TVCA 5HJ7A 4AG5A 2CT8A 1DO0A 1JFFA 2WSBA 1ONSA 2AG6A 3PFFA 1BDHA 1KSFX 3EARA 3K0BA 4TN5A 2QLNA 1FXWA 3GF4A 1ARZA 4YQYA 2JZBA 2GI4A 1MQ9A 1YHNA 1GAQA 4YUZA 1WB5A 1ZJ5A 3ZXYA 1QLHA 5KTTA 3GCWA 2OYSA 5T3YA 5B2EA 1M5TA 2FOXA 3SNKA 3GROA 4J6FA 4LQLA 4TQSA 2K2WA 3RF6A 3Q8RB 1VKJA 2LPEA 1Q6YA 4N76A 2WKQA 2Q6KA 1VIMA 1L2TA 3KAJA 4IL5A 3LF1A 3TJMA 1B43A 1PUIA 3Q7PA 4PS1A 2FWNA 1MB9A 1UA1A 3HABA 1QTQA 3T12A 2VXCA 3IP4B 5HQTA 3QKSA 4F3KA 4UVIA 2C2KA 1V6SA 1SXJD 2ZJAA 4RT3A 1NMSA 3GZJA 4KWHA 8ICCA 2BFFA 4G0NA 5THXA 2KLHA 2BKEA 3WBBA 3Q6IA 4E1BA 5FWYA 1M5RA 4YRTA 5CD9A 4QNRA 4LZDA 1SRQA 2C77A 4XKJA 2VXBA 1XWLA 1X80B 2H31A 1T0PA 3PGA1 4KRFA 3KQNA 5GONF 4B7UA 2CK3A 2FN8A 4NU5A 4WTOA 4UU1A 3LC7O 3ISBA 4J0GA 2CHGA 3B60A 3BA1A 4PPGA 4BO6A 3ZVNA 1Z63A 2BMDA 2GUWA 4CIWA 4NU8X 3F67A 2E8NA 3W5DA 4RFLA 1L7EA 4MVJF 3G9XA 1P7WA 1XU7A 4KPUA 1EFRD 4RDIA 4X85A 1KP9A 1ZVVA 3VHRA 1E9CA 4WLEA 3I9MA 1FLAA 4HXYA 4KOEC 1E66A 3VYWA 1P72A 1A8HA 1WAMA 4U7CA 4A26A 3OMLA 5KKNB 4D1YA 3C3KA 3P0RA 2H1IA 4NZOA 3LPDA 1A7AA 3QBJA 4C0WA 1N78A 4IXNA 4W7IA 3KVVA 3NJ4A 1UMDB 4MS1A 2AU0A 2IZOA 4OMCA 3T8YA 3WLIA 4DCVA 4DZTA 2F9FA 3VKGA 1Z12A 2FPWA 7AT1A 2FHSA 3BDIA 5JU5A 1FDSA 5FA6A 1H5UA 4EF6A 2YV4A 4DB2A 5NLLA 1HYQA 1C1DA 2AC4A 1BIFA 4C1NA 2BGUA 3ZCVA 5KSOA 3I61A 4K9PA 2JAPA 4MLZA 1I94B 5CIWA 3WMXA 1RKXA 2P9JA 1A7UA 2IZ0A 1IPEA 4C9BA 1W25A 2QW8A 1JXQA 1FA9A 4U39A 3PPVA 2FHPA 5LA6F 1Q77A 1UDRA 2I9PA 2JAWA 3GGJA 3NM6B 3ORFA 4IRXA 2GUGA 1SCNE 3GCGA 4DCUA 3EXHC 4CL0A 5FF9A 2AX4A 3F1KA 4YECA 5LVAA 1R4ZA 3QM1A 2AZTA 2BUBA 3H5WA 3B13B 1MNQA 4G4JA 5EE9A 5FO0A 4DQUA 1LTKA 1E7YA 3KLPX 4S1OA 2A86A 3FBTA 4ECVA 5C4GB 3UQZA 1AX9A 1DQNA 5EMJA 4CCAA 2J3KA 3DEIA 4KDRA 5REQA 3E5HA 1F7VA 1PT8A 3P97A 3I6BA 4JOSA 4QXOA 1T9KA 2H4HA 2YR0A 5KTNA 1H8EA 1NKVA 5EN4A 1KZHA 1PFKA 1T9GS 1WMFA 2FOLA 1S3SA 2R9VA 1VDZA 4NYMQ 4DEXA 4BQIA 2WSMA 1KK1A 3U7FB 3IUEA 3KE8A 1GGEA 2H2DA 1LVHA 1R88A 1YA8A 3JQAB 2HW3A 3IE0A 4RKYA 5CT9A 4DFJA 3RLFA 3BZCA 1BXZA 2QRVB 1KETA 2WW8A 3K1AA 4GZLA 2G72A 4O4JA 3ZWPA 3ZKWB 2W54A 2B5WA 3B7PA 4GYKA 1PGQA 4R7GA 2O8FB 3FFBA 1WHTB 1T4GA 3ZW9A 3ILXA 3LHIA 4GLXA 3I01A 4K9LA 4M0CA 3WLNA 4NV1A 1Q3KA 5EJIA 4EYGA 5KBYA 1DPFA 4OSOA 1DAFA 1A4IA 2XYQA 2YW2A 4UM7A 3WGZA 5CDHA 2KMDA 3N2EA 1ATIA 2V6FA 4QKQA 1O5IA 3PSAA 1L3CA 1JGTA 2D7CA 2KSQA 3P2MA 5JCOA 2YWEA 1NVMB 3AGPA 4R71A 1EZZA 3C3WA 3KQYA 2JGMA 4JBYA 3LRTA 4DF3A 1EWYA 1UOPA 3SAFA 1JE1A 2QWXA 5EA2A 3DCJA 4PFKA 3MT0A 4PVCA 2PRSA 4YPOA 5BMVB 2GJ8A 2FSGA 2XRYA 2YWGA 3COPA 1YB4A 5ERGB 3HFJA 1CUKA 2GMWA 5FUYA 3OM8A 4B3XA 1TD9A 3ILYA 3P9YA 1RRVA 3TXAA 4NZNA 3ZGOA 1QUEA 4LTNA 4WSOA 4PN7A 5JARA 3MIIA 4MVJM 1JSZA 4HAOA 5J43A 5E6RB 3TD9A 3ZV5A 2WT8A 2EGHA 4BU1A 4F1WA 1K9SA 1KNXA 4M9ZA 8ICKA 2FG5A 1NURA 4FU0A 2FETA 7GPBA 4R1MA 4D3SA 3A3YA 1O2DA 2IY7A 4UB1A 3IN5A 2WYHA 4MUMA 4EWLA 1RTKA 2O20A 5BWCA 1XK7A 4Y9UA 1H1TA 9ABPA 3HZZA 4B6FA 1ZISA 4KQKA 2QGNA 2V7QA 4ED6A 4IR1A 2LKDA 3HN2A 4RYDA 1UK7A 5HDQA 1GTG1 5JNTA 1ZUNA 2VJKA 3H1PA 2RBGA 4IIFA 4X1YB 5GAJA 1AKWA 5H82A 3BZUA 2Z57A 4F4UA 3L5OA 4FMDB 1NVVQ 3UBMA 4A2CA 1DZ3A 3GNQA 4QW9A 2G8LA 3SC2A 2Q0XA 1QBGA 2EBHX 5A5EA 4LFBB 3K4PA 4K03A 4YAJA 3ND6A 4TSFD 3LVRE 4FIZA 4BKQA 5K8TA 4LJSA 4PYJA 3C2MA 3UUWA 2EKQA 1XRPA 2I6FA 2IHUA 1CHNA 3IB6A 4ZEWA 4V0QA 1UQVA 4OJLA 5EXSA 4JBHA 1UMBA 4P93A 5DTEA 3GFGA 2Y76A 4IMPA 1YGPA 5AYVA 5EKDA 5LSAA 3RT9A 3W3AD 5A04A 3C41J 3H13A 4PQFA 3AIMA 1QHHA 2AOWA 5I9NA 4IFBA 3N8DA 3QEBZ 2PX5A 3NOQA 3ABSB 3G1TA 4CKYA 4F84A 3V1UA 2W0MA 1XTKA 2PH7A 3HZRA 4LRWA 4BZZA 2AKEA 1B8UA 2YZ2A 4DBLE 3GV8B 2CNKA 1QFXA 3BXOA 3EXFB 3FDZA 3QVXA 4LPSA 4URFA 1O6ZA 2QAGB 2CC2A 1FFWA 1Z7GA 4J7CA 1NVUQ 3WGQA 5IN5A 4DJAA 5A7FA 2DGZA 1UBJS 4EA9A 1MW9X 2ZIFA 3RBVA 4F8YA 1UFQA 2OXIA 5ED4A 3PTZA 1NBMA 4C4YA 2WTAA 3BS4A 2JIPA 2VCEA 3IDFA 4H16A 4IJQA 3GEIA 4DDWA 3DT6A 1EI9A 1AMUA 2ADMA 3IJ5A 5IN4A 4AJ9A 3GRKA 5H02A 3GB9A 2PWBA 4Q4DA 4F0JA 1FFUA 3I92A 1M1ZA 4X66B 3BFXA 3VHLB 3H8JA 4F04A 3ZVLA 1VCMA 4C0XA 4JUFA 5E6UA 1U1EA 1F44A 2BN4A 4COKA 2KHVA 1IQ0A 1WA5A 2ZRJA 2UYCA 3SQLA 2HZBA 3F3KA 3KLNA 4N5LA 1M76A 2EAOA 2VRNA 3PVCA 4TTSA 3DBLB 3WL4A 4HXGA 1Z56C 1EGVB 3GFRA 3RHSA 4B7AA 4AZTA 1JUDA 1DPGA 1FLDA 1BDBA 2AUMA 3D3WB 3E35A 4FFLA 2CJWB 4ZMBA 4QXQA 3IFSA 3QNMA 4DL7A 1K5GA 1ZJ6A 2E4ZA 1E9VA 2DETA 2YXLA 4RQ1A 1ODTC 1E3LA 2H4YA 2ZIEA 4NNJA 4HSEA 1J8VA 1CEXA 1K89A 3F3SA 1R10A 1OXTA 1U1GA 2OSVA 1PQPA 1GL3A 3EFHA 1NQUA 1TQDA 4L08A 1GQSA 2ZUBA 1M2JA 1UAGA 4RU9A 4EBCA 1VDVA 4FLFA 4GL4A 3EA5A 5FI3A 1K0UA 1ZSYA 5KL8B 3CRNA 4J9MA 4OH1A 1YI8A 1V16A 4DNOA 3HCDA 4NKRA 4RKQA 1AKUA 1JILA 2EW8A 3KB8A 3RJHA 1FTYA 1JT9A 1KZ6A 2JGRA 2NO6A 4LKRA 3NAZA 1QOZA 1YIDA 5BP7A 2PBRA 2GVZC 3RWOA 1K7FB 4UBKA 1Z62A 3AKYA 1Z36A 4AUNA 3HA5A 4CCSA 3WKAA 1C9DB 1RYFA 2O0KA 2VF8A 1C2YA 3ETHA 5JVDB 1SBTA 2PXCA 2WF9A 2GJ9A 3D4PA 1DX4A 1Y4DE 1EX9A 3FKSA 4DA7A 5BVHA 4HC4A 2PX6A 1NUPA 5ALGA 2D8MA 1C9KA 5DNAA 4OI0A 1G5HA 1M34E 2X9VA 4JX8A 2K8BB 1P62B 1SD1A 3HUUA 3UT0A 5L7YA 4XPIB 5E7IA 3SJBA 4UB2A 3I34X 5HRCA 1ORIA 2R00A 1RXSA 3W6OA 3B52X 4QVGA 3IPCA 2R84A 3CTPA 2INGX 1TL7C 2O07A 4BKMA 5DK4A 4KN6A 4AQYB 1E59A 2BSAA 1SXDA 1RJFA 4A2PA 1ZOPA 3PC8C 3KOUA 3SIPA 4BLPA 4CLDA 4PG8A 1I1HA 1G2IA 4GZ6A 2A4KA 3RTAA 3AQIA 4JL6A 1RLUA 2HIGA 3LF2A 4IRMA 1AQIA 1DT3A 2FZCA 1QB7A 4X6UA 1YCGA 3GGOA 2OHFA 3UH1A 2HO5A 3TACB 1U3VA 2OOSA 2P6NA 1A9OA 1MZVA 4I5IA 2VH5R 2P11A 3HKCB 4D0RA 2P2ZA 3FZQA 1EXNA 2BDTA 3OCUA 4H18A 4E5YA 3FWYA 5I5EA 1PW7A 8AT1A 1TAUA 5JWHA 4UNQA 5ECYA 2KFZA 1PWYE 1X7WA 3NQ41 5ALLA 4UBBA 3ON5A 4J4HA 2AI2A 4BVHA 4JN6B 4D5GA 1G1AA 4TLEA 3SFTA 5AW1A 3OZBA 4MV6A 2A3RA 3M33A 4RPYA 3VC3A 4JLWA 1MX9A 2VL7A 1TAMA 2V4RA 1NYQA 3AVVA 1WLYA 3X3HA 5G02A 3KAKA 3KVOA 3BEDA 5KKAA 1PHRA 1SN7A 1WXGA 1YI1A 1JA1A 3OHMA 4G85A 4UHCA 5B6PA 3NFYA 2HHUA 2C5BA 1E18A 2ZRMA 4YHBA 5EYPB 2GZMA 1R2QA 2OR3A 2YZGA 4MLPA 1JHPA 4YFKA 2QD4A 3SJ7A 4IIXA 4ECTA 1H2RS 1SZDA 2BELA 4Q82A 4U6NA 4W5JA 4D4LA 3P4UA 1C81A 3DEFA 3NR2A 4LCEA 3K6SA 4LVCA 3OIVA 5K4LA 1R6UA 4B5KA 4UUQA 5C80A 4TLBA 3W9UA 8ICXA 2VUUA 3LDHA 2PYIA 1T25A 1XNHA 4W82A 1L7BA 1GN8A 1E2GA 2X9LA 3LOQA 1JVNA 1JEAA 4UEWA 4JJGA 3W3AH 4M76B 4CT5A 3KQSA 1ZLXA 4H7DA 2O8CB 2ANBA 4JQZA 1USVA 5B53A 1QQBA 3M6FA 3JVIA 2ISSD 1QGOA 4AWBA 1MOSA 4JJ4A 4MR9A 2QE7A 1JG6A 3IPLA 1YB6A 1NK6A 1COWA 1N6KA 2DKZA 5KFDA 2A0WA 2HF2A 2PFQA 4I29A 3C2QA 1F6WA 1TAQA 4I4TA 2A78A 5IASA 4M1ZA 3ES9A 2C99A 1FBNA 3E7PA 2O59A 3HR8A 3QZUA 3E15A 1A4XA 1R8JA 3V4OA 2BLLA 4DMLA 5LCXA 2Z58A 2CMGA 3U80A 1OSNA 1XOIA 1QKIA 4RHYA 4IGEA 4MJ3A 1VJ0A 4KXQA 1TEVA 4URVR 4KPYA 3BERA 4PXYA 1ZR2A 5EIAA 2GRJA 4RK6A 9ICLA 5JH7F 4X3OA 2P6OA 2RDIA 1QAQA 1JQEA 4K05A 5JJIA 2KG5A 5CYGA 3G1WA 4OAOA 5L4NA 1CUAA 1MVLA 3AR7A 3K9QO 4NNPA 4ZK6A 1WVGA 2QTWB 4S04A 4PCLA 4ZHQA 4ZXFA 5IXYA 4G1VA 3DC7A 1X2BA 3A0HU 2EZUA 1C7JA 2R1VB 3H19A 3OQHA 5KJCA 2HHQA 2ZE6A 3Q3VA 3JYNA 3NS7A 3EUEA 3QSGA 1SCUA 2WTXA 4IFEA 3AETA 1FUIA 1MO6A 3NTXA 1KE1A 2A1JB 4B79A 3WLTA 4ARZB 3F6YA 4Z9XA 2BL4A 2ZS8A 5JBNA 3WWCA 1KGSA 1UP4A 3PCRB 4JIMA 2VRCD 4MUHA 5FOSA 4V3BA 3MJCA 4CFSA 2I5HA 3R4VA 4EL0A 3FH0A 3QW4B 1USWA 1V11A 3OC0A 4IG4A 3LT5A 2LIVA 1FQOA 5U4QA 5B1DA 4HNAB 4PC3A 2A1TR 5KYWA 1GFWA 4KKVA 4OB7A 3W5BA 3KIPA 4RH3A 4Q43A 2FPIA 1OWPA 4PE5B 1F4LA 1AS3A 2B1JA 1V1MA 1QOPB 4LXYA 5CX1B 5FEMA 2CY0A 3T5GA 3NI2A 3REGA 2F8MA 2YIJA 1WYGA 2C82A 7YASA 1CUFA 4KWEA 1SB3C 5JJCA 5L95A 4M9NA 2IPNA 5D8DA 3DBLA 1EWQA 4GBMA 2HSWA 3CUUA 4XLZA 4MAFA 4D9MA 1Z6PA 3BSWA 3CN7A 3S29A 4DCCA 1ZBQA 2BM0A 3STXA 5BPFA 1MMFB 4PXSA 4W5TA 2GJKA 1EFTA 4XFKA 3GJSA 2X76A 4REOA 4C0JA 1OX4A 1PFVA 2J45A 2D13A 1HMYA 4D43A 9GPBA 2RQ5A 5KVVA 5F4BA 4KXNA 5K3CA 2O19A 2JIMA 3H3XA 5C5DA 2JFOA 1XI2A 4TV9F 4W6QA 4YMMA 4OHYA 4DPKA 3AV3A 1P91A 2XKBA 3MPOA 1ZL0A 3KHGA 3ZIUA 2C5SA 1QMGA 1Z38A 2XRFA 3FTDA 5JMPA 1G18A 3OEED 2RGNC 4JCCA 4WZZA 4KRGA 4B3CA 1U4SA 2A5DA 4M0EA 4OQYA 3A2LA 4X1IB 1Y1RA 3LRPA 3OURA 4CEHB 2DQ4A 2H3ZA 2VUHB 2Z30A 3EQ9A 3MRVA 1ZQIA 1MVNA 4M7WA 3FCCA 3SY8A 5HQ3B 2BFBA 2GLTA 4HWPA 4GS5A 2XNDD 1CUGA 3H0EA 4OXIA 3IVAA 3KYDA 4WFJA 4C78A 4ZA2A 2G04A 5FFMA 1P2SA 4N01A 1N77A 1NX6A 1UC4B 2MSLA 3D3NA 3VR3D 2G9UA 3E7FA 5CM9C 3INYA 3QUBA 4RV5A 3RRFA 3L6BA 1A6SA 3C4JA 3MNFA 3TVTA 4YD2A 1T0UA 2C9OA 2YVUA 3OMXA 4X1KA 3ROGA 2RHFA 2ORYA 3WK7A 4WLNA 4CEJB 1RWVA 4YCDA 4I5DA 4HNHA 4G97A 4RPHA 2DUNA 4WW0A 1Y7PA 3PQFA 3EW9A 1QIDA 3AF4A 3WGMA 4UTRA 1CDDA 2WHEA 2BFBB 3MAGA 3P9QA 3COWA 4I50A 5ISMA 4OHMA 3TQIA 1ZK0A 3TR5A 1OIVA 2FN9A 2XUPA 2Q4DA 4XQ9A 3CBGA 1NVEA 1RIIA 2VUSA 1MC8A 2PLRA 2SCUA 4WLUA 2XOKA 4DREA 3GFTA 5HK9A 5HSGA 3TGPA 1ZICA 2OO7A 1SKYE 4M8KA 1LPMA 1UODA 2CFCA 4HLNA 1QU3A 4LBZA 5C0YA 1EJ2A 5FBQB 4CUJA 3PMNA 3WICA 2BKUA 5C5EA 1LBTA 1QH8B 1Z6YA 2KYRA 4G4IA 2XVAA 4PSAA 1MAUA 3PW4A 3JAKB 3O7WA 3RPEA 4Z7OB 1I7QB 1XCPA 4P4MA 1XTUA 3PNSA 1PYGA 1AT1A 1J2MA 5DLGA 2I33A 4WX2B 1VMEA 2HU2A 3AN1A 2XR1A 3ANNA 2PZJA 4QWMA 4X8HA 1NMEA 4AD8A 1FUUA 5KU1A 5E6RA 2VF5X 3DOHA 2C1EA 2QB0A 3C4QA 3NHPA 4Q47A 1UPUA 4Q21A 5AW6A 2QYOA 7ICGA 3LFHA 2GD6A 4QXPA 5LOVB 4M21A 1TLLA 4MCIA 3INGA 4HS9A 5TR9A 4I8IA 1SVMA 1BZYA 3PWSA 2OCXA 4M1QA 4TQUS 2W7PA 4U4AA 5DBIA 5C7LO 4G0WA 2GPNA 3PLNA 4NG4A 1M1XB 4U0JA 3GNTA 5HTKA 1ILEA 1L7VC 5B6JA 4N54A 1NQ5A 4DNXA 1Q1AA 4QT0A 3TRIA 4B31A 4IS7A 1BWSA 1O89A 3KKAA 2CZGA 3WKBA 4I2FA 4LZWA 4UVGA 3TG2A 2AEJA 2DFVA 5KYWB 4ZZ0A 2OEHA 1ZQDA 1R5OA 4QEDA 3EPIA 3GMIA 4YRKA 1MABB 4X71A 1OXJA 3JAWB 3JPYA 1BEZA 1D6SA 3QKWA 2C5AA 1F9AA 3JQBA 4GW3A 5K3FB 2JIDA 4DCNA 5A4AA 3HDHA 1IIPA 3REQB 2OP0A 4TLAA 4L8LA 5FNVB 4QM6A 3BE6A 1QO7A 3H1AA 2VOJA 1FPQA 3SYTA 4F6RA 1EEHA 4ZU3A 4C88A 4G5XA 1OI3A 4N41A 4Z4FA 1V8OA 4PHFA 1BQ4A 1PTKA 2QU7A 4OBEA 1SR8A 2PJDA 1K5OA 2DQKA 2XNHA 1CIPA 3AR6A 3OFVA 1LJ8A 4IWYA 2DY1A 4LYEA 4P7JA 4F4HA 4RTJA 2WILA 3G23A 2J6SA 3K2BA 3MRTA 4P9NA 2A1UA 4YRLA 3FZEA 4HEQA 1PGNA 3HXTA 3LHDA 3WFJA 4B47A 3MGBA 4EGQA 1WEKA 3P52A 2WM9B 2IHVA 3LI2A 4PZ9A 2XUIA 1FDIA 4NJEB 4O0MA 2H7XA 5DLQC 1GCAA 3VKUA 3WC4A 3C6KA 3ELBA 3P9KA 3NOVA 2QJFA 3D81A 3UV3A 2N42A 1ZGJA 4L9WA 5H83A 3TNYA 3ICPA 1XEXA 5J2IA 3M3PA 3F7MA 3IULA 2ZRQA 3MGAA 4IHQA 2CSXA 3TRJA 1U0FA 5CA7A 5KFSA 3UWMA 5IG2A 2H1SA 1UEJA 2VJMB 1W44A 3QPBA 1R50A 5AXAA 4A1OA 1AUQA 2ZJ1A 3OY2A 2Y1DA 2QV0A 1D9ZA 2QJRA 4H17A 2YWDA 1YJQA 4YR3A 1M9NA 2P40A 3B9BA 4ELUA 3QOYA 4ARAA 3GLGE 1EWTA 1FTWA 1ZWLA 3CVVA 1S2IA 3I6YA 2BMFA 3CISA 2BFDB 3MILA 4H1HA 2WB2A 2I7CA 1IQPA 3R1IA 4YD1A 4JB8A 5KG2A 1SM4A 4E70A 3QJGA 2K8AA 5CB4A 1K08A 1O57A 3HPRA 3LPCA 2N3ZA 2XEDA 1ZQYA 1OW5A 2W03A 3VBCA 4MS1B 1GAJA 5CHEA 2QYTA 1PZHA 4OMUA 3SDBA 1REQA 3IB3A 4KQIA 4NAHA 4DFDA 1AKEA 4LEIA 1F2DA 2GKSA 4DIDA 2W4MA 1RRKA 4G6ZA 3AHJA 1J24A 2W2KB 3EWNA 1FRZA 4DLUA 4OFBA 3UT6A 5F3XB 1K27A 1N2XA 1E1RA 1OXSC 1P73A 4D44A 1HE2A 4Z3KA 1RLJA 3ADCA 1PP4A 5EE5B 3WAJA 1DNPA 4KLGA 4DADA 5IVPA 4KPUB 4KQGA 1IBLB 1VSUA 4MROA 1NN1A 4F2RA 1M6YA 3KSMA 4H35A 1KSPA 1ECWA 4P3YA 4XDZA 1AKMA 5KHAA 4KQ2A 5J2JA 2ST1A 1X80A 1U0TA 2EL9A 2YV2A 1E9RA 3AY0A 1L5UA 1SUFA 3H2ZA 3QG1A 4EZBA 3R3ZA 3EISA 2P62A 2NSHA 3DF9A 4NQZA 5E4TA 2GAIA 4PYMA 3HKEA 4JLUA 3SAHA 2D6FA 3HGMA 4DIKA 4PNPA 1RRCA 1KZGB 5LM3A 4J9QA 2AZXA 2C8VA 1H05A 3NTVA 3AB8A 5FWDA 1WVIA 1ZNQO 3KTOA 4JVLA 4MEBA 1VSBA 3JQ9A 4MQBA 4OFXA 3ET5A 4DHEA 2CNDA 2O5CA 2PK3A 4LX0A 2ODGA 4M89A 3GP8A 4B33A 3GRCA 4I55B 3Q8KA 5KYUB 4PHPA 4DSJA 3T3FA 3KZNA 5LMUB 1CIVA 4M88A 3KNZA 3C74A 2CLEB 1N3YA 1RAAA 1YVDA 3K1JA 3KEFA 3PL5A 1N60A 5FPHA 2D1YA 5HHHA 2J3JA 3A58B 1IEQA 3E23A 3JQCA 1JDTA 5E3JA 1AKTA 4WJZA 2ZJBA 2BM1A 2AFIA 4N6GA 4ER7A 4ZVKA 1V4VA 1H3FA 2DWOA 2OUIA 4K8OA 4LC1A 5SZIA 3EPRA 4DF8A 3ZXSA 3MJDA 5JAPA 9LDTA 5TB5A 1R8SA 1CNFA 3LQ4A 1W2WB 3BF7A 1UOOA 3RV4A 3BZKA 1LVUA 4JT8A 3IO5A 5ALWA 3PZRA 5EWLA 3ZEAA 1V95A 3ZH2A 1R0ZA 2IUEA 2X5NA 2Y1JA 1ZNZA 2HRZA 3PG5A 1IMJA 1FMLA 3AWDA 3KHKA 4R5MA 3VU8A 1V37A 4Q4AB 2FQXA 3KO8A 3QKRB 4NENB 1LTHR 4A4DA 4ZGGA 4M0PA 1CEYA 4LK2A 2HW8A 1QC5A 4KREA 4M8SA 4TKZA 3UNXA 1NDUA 2HCFA 4L4XA 4D92A 5J4KA 1A5TA 1GUFA 1UDCA 2AFHE 1NF2A 2F48A 4TLLB 2JRCA 2Q5JA 4G25A 3M2PA 1LWOA 2FQ1A 1P1JA 4IEFB 3ZCTA 1IOWA 4ASUA 4JHLA 2H92A 4QD3A 4L3OA 1WB9A 4KLIA 4UDNA 2PLNA 3IX7A 4YHHB 3QVWA 2BEWA 2Q1SA 1FS6A 4BO1A 3R6LA 5DLDA 3K0FB 3ZVKA 2EOAA 2H4FA 5GP1A 4Z6EA 1CUIA 3UB3A 3W77A 4AJ2A 4EHAA 1QG4A 2JA1A 4LDQA 1SNYA 4P3XA 2DOKA 5FADA 1U8TA 3PRKE 4G8CA 2N1MA 3VR6H 3IQWA 2VOEA 2WUWE 3R3YA 4G67A 1KQGA 3VZBA 4ABTA 5K0CA 1P1BA 1V1RA 3DV0A 3PUVA 2CDRA 3SKXA 2Q4BA 2YWHA 3AB3A 4C04A 1T3LA 2HK7A 4FFVA 1CDEA 1YONA 3NAMA 4DV2B 2RGDA 5AI0A 4C20A 4DLBA 2QUIA 2R4TA 3OQBA 4RAQA 1P1HA 1P6QA 4ZO6A 2P9QA 5J59A 5JROA 2HWXA 3N2GA 5B2FA 4C80A 1UM9B 3OPYI 3CY6A 4PYOA 5BN1A 1E2UA 3OQPA 4X65B 2ZQ5A 5IVHA 1VLLA 1NP6A 2CLCX 1Z19A 5CK5A 3P2KA 1Q3UA 3H86A 4AROA 3OHBA 3PR5B 4I8XA 4ITVA 4TQRA 4KGDA 2ZIXA 2Z9DA 4FFOA 4OUDA 2NAFA 1XQWA 1N8SA 1US8A 1ESCA 1DQSA 3L4BA 3IYLW 3K9GA 4HUJA 1GLVA 4Q18A 3V4PB 1VHJA 3U3OA 4EGCB 5EJ6A 1ZNWA 1UDAA 3U61B 3PW2A 2OH2A 1E0KA 1G9TA 4QYSA 2CK3D 3DULA 5JAZA 3OJSA 3MPUA 1CR0A 4MGEA 4UFOA 3KHLA 1L6RA 4XGKA 2QEQA 2O05A 5ARBA 3AY3A 2VAWA 4FE3A 1E9DA 3NVDA 5E9QA 3VKWA 2EAPA 2GWSA 2J9GA 3AEKA 3I2YX 4NBVA 4NRDA 1PFYA 2GD1O 3V7NA 4QQNA 2AQ8A 4LMPA 1AJEA 3O83A 1A71A 4KR9A 3NGLA 1CQXA 2R8JA 5HXAA 2FR8C 2VDVE 5E7MA 5HKLA 5TQ0B 1Y6RA 2WIGA 3T5MA 3AU9A 1GV0A 1TQ2A 1LWNA 4HSGA 2WZBA 3OF5A 4LJ6A 5G0WA 1X3SA 5DI3A 2X4GA 1O4VA 1Q0PA 1MH1A 1PJ3A 2OCAA 3TL6A 1M2NA 4RZ2A 2X5XA 3VSCA 2BGGA 4A36A 1K3UB 1NRWA 2RK6A 4DVJA 2O8EB 5AVKA 2P0EA 6ADHA 4R8VA 4MKXA 3WGOA 4RPXA 5BNWA 1I3CA 1UINA 3GK3A 3WE7A 5T14A 4MIKA 5F73A 4XJTA 3E81A 2I55A 1XE3A 3HGTA 1G1MA 2OHXA 3W78A 5FJIA 2UYQA 3F6RA 3GRFA 5JRDS 1RYZA 2HU8A 4GX0A 1P7ZA 4OL0A 4WI1A 3OOYA 4DMUB 5B5SA 1JAYA 4NU6A 2P9EA 1T6BY 3LLMA 4N03A 3STUA 3UQ0A 1BMTA 1CF2O 1SUEA 1RABA 2HK9A 2SKEA 2ZJOA 3IP9A 4FNAA 3WYEA 3LXXA 3LO8A 4CTJA 3ICEA 1NQOA 1C50A 1J39A 4BX9C 1KEUA 4FSHA 4NMWA 4NLKA 5JEEA 5JTUA 2JEJA 1UXKA 4LV5B 2YXEA 3RQSA 2QBYA 2ZJ8A 1WSBA 2HXSA 3RAPR 2HHCA 2Z6UA 4R9RA 3FPFA 3SXPA 3KSBC 3NORA 3L0BA 4OHRA 3A9RA 1Z18A 2DJIA 1QSYA 5EIEA 4YP7A 3CEJA 1NKTA 5A9RA 4QU9A 1CRQA 4RADA 5DCWA 1FIUA 1FYXA 3H2SA 2HIHA 1KQNA 2KHZA 3CLSC 1BS2A 4P4OA 3EQZA 4NU0A 3W3ZB 5GINE 1XYYA 1N5XA 4Q3AA 1BPEA 1BTOA 1JI3A 2ZU6A 1YZQA 1ZQTA 3A25A 2JIRA 3AGQA 1KHHA 1N5OX 3G49A 4KNVA 5A4IS 1LRJA 3MUEA 1PBNA 1T2UA 5JG7A 5TT0A 4BMVA 3AUTA 1UXGA 4WBNF 1DKMA 1RYRA 1NXPA 4PQRA 4MIYA 1AO3A 3DA8A 3DKKA 4QJ5A 1ZK1A 4WNYA 4TX1A 3E2MA 3CT6A 4FHCA 4BP1A 4BN5A 2E49A 5D00A 3MTQA 3VOSA 5GIOE 3GYGA 2BMJA 2ONZA 1UPFA 2PANA 2QQ0A 1F2TA 4RUKA 1L7AA 4GM1A 2Q0SA 2H3EA 4ZTUB 3QJ5A 3VH3A 1SUSA 1AN9A 3IM1A 5J2DA 1PEKE 2LR0A 3HHEA 3HBNA 4HY3A 1DHTA 2IV2X 4RKWA 3MCZA 1COKA 4MKRA 2MYTA 2NUAA 4RQBA 3M8RA 1ZQAA 4P80A 1TRHA 2FEAA 3JATA 1EP3B 3L1VA 2OMKA 4KLZA 1FNMA 3E22A 2VT3A 3IT3A 3UPQA 1GR1A 2JCGA 4RMJA 4NYIQ 5ALMA 3AESB 4KQJA 4Y2QA 4BATA 1LGYA 1Q2UA 4C76A 3MBYA 4NBUA 2IYFA 9ICMA 1JLRA 2IOYA 5ESXA 2G9QA 3YASA 1HE5A 1KF0A 2VHJA 3KKPA 2F44A 5CDGA 2QSUA 1KEVA 3MEQA 4L5YA 2PRIA 8GPBA 3BH7A 3CPSA 3DB1A 2C9CA 1FFAA 2OGWA 2B7CA 3EIHA 3HPQA 1GEGA 4DMMA 1Z5NA 1XXHB 2OO5C 4LSWA 1IUKA 1C7QA 5DHUA 1T6XA 5JCOC 4BPRA 5J9FA 1FYWA 4EJ2A 2ZI5A 1GM5A 1VCHA 4Z8XA 1YDGA 1TVKB 4ZCPA 1KKUA 1VHDA 3Q8PB 2KICA 2Y05A 1LPBB 5EXPA 1CY1A 4DSLA 1LS6A 2FMFA 4YPFA 1F2VA 4HWSA 2Y1CA 3RNOA 4BNXA 2A0UA 5KTRA 1G3RA 1JZQA 1RP7A 1A0PA 1BD4A 2Q2VA 2XA9A 2WF8A 2GF0A 3GJ3A 2V3CC 2VIXA 4MS4B 3G5MA 1M6VA 2NPOA 3MA0A 1ECCA 3ROZA 2J85A 3B0XA 1CLEA 5I3ZA 4EG1A 3H2KA 1IZ0A 1H2AS 3A36A 4BEWA 2CHQA 5BV8A 2RMKA 4R2LA 1ED1A 1A4UA 3BIWA 4JVMA 3EGVA 1Y3FE 4AYXA 4FKZA 2HA3A 2QN8A 1RMQA 3P45A 4I9FA 1PZEA 3I3OA 3QHAA 5JMTA 2AJBA 5JYDA 3TIIA 2CD7A 4QLBA 4TTRA 3HY6A 5DOVA 2X5JO 1U5CA 1Y89A 2C2WA 2XYVA 3RVNA 5LZ2A 1JWBB 1BPZA 1YDEA 3P9ZA 4R6XA 1J1ZA 1Z17A 4UUNA 2WAQC 4CCWA 3B2NA 4GSLA 4NL9A 4Y2VA 1G63A 2IYAA 3CF4G 1IVNA 3W6ZA 2E37A 1ZNXA 3ESAA 2VN8A 1XLWA 3A6GA 4H4DA 1NTOA 1M6HA 1W0CA 2W2NA 5FAKA 4UB6U 5EP2A 1QM5A 4KQHA 1P1CA 3K1TA 4HFNA 3LDGA 4MVJE 1XTSA 1TRKA 2LGJA 2X19A 4ZRDA 5B7PA 5INTA 3HKBB 3PXBA 5JU6A 4LFAB 4JYPA 4LHYA 1DOAA 3V7KA 1U8AA 1VXRA 2PSSA 3C6XA 2EKBA 2VJ4A 5EZ5A 1J97A 4W1PA 3ASZA 5EKSA 5FR1A 1WUKS 1FU7A 3G0GA 2OKCA 2QS9A 4RH0A 5L1JA 2FSUA 1PLJA 4JP8A 3AOEC 1USIA 5CK4A 3KHUA 3ZV7A 4F7DA 5LNK1 5I45A 3NASA 3NBFA 5AI6A 2R1TB 5LYJA 1JBKA 2NTEA 3OQOA 1GGMA 2ZITA 3PJFA 5CPFA 2XNKA 1RXIA 4CI9A 2HA4A 1J5PA 1V3TA 3M4YA 1ZQEA 2PX4A 3THVA 3V8EA 4B09A 4CMKA 4DV3B 2VTBA 2ZSEA 3L7JA 5JVDF 1QPGA 1XNJA 3HN6A 4ND7A 3CLRC 1V38A 9ATCA 3V9AA 4DIMA 4Y2PA 4ND8B 1RKUA 4QOFA 3WIBA 4EEZA 5FL7A 5K0JA 1S1CA 1YB7A 4PG4A 2B78A 3FJ1A 3NXSA 1KJQA 4ZT7A 2EFCB 2FP4A 5PGMA 1ODSA 5DXFA 1AKYA 3L3BA 1KZ1A 2A67A 3NONA 2G5HB 2FZ5A 5GOZA 1AG9A 4FR0A 3U3JA 3EVGA 1X7ZA 2VPWA 2OQRA 2Y66A 3C6QA 4RZ3A 5AOCA 1KQQA 1R8QA 4CIVA 5CA1F 4JYZA 3PRHA 2Z43A 4JR2A 4BASA 1YQUA 2XB9A 3H4TA 4D3FA 4PCUA 1YVPA 421PA 3WLHA 4W9NC 5LBUA 5I7FA 3OUTA 2MCFA 4EEKA 3HVRA 1LS1A 2VP3A 3A6PC 4G1MB 1BPBA 4XJSA 2IT1A 3OFSA 4J1QA 4MQMA 7ICUA 4KLAA 1GTMA 2JH8A 2OVBA 2QHXA 3GL9A 4ECQA 2ORVA 5KQPA 3FKJA 4PS0A 3FWNA 3U13A 1ZJNA 3UW1A 4NE7A 5AW8A 1PL7A 2COEA 2ZRCA 4M1EA 1ZMRA 4EJ0A 4ELTA 5J29A 3ROKA 1AB6A 2JRZA 1Y4SA 2I99A 2XY4A 4GGPA 1Y7IA 1WZIA 5TQJA 4Z6FA 1M74A 2W6MA 1VJ1A 1XWFA 2ZEJA 3ZN2A 5DNDA 2IEYA 2CPRA 3FOAA 5CDFE 1H38A 2EZ4A 3RYHA 2K89A 1FW8A 5BSTA 1OLUA 2C4NA 2ONYA 4FD2A 5FORA 2J6IA 2RGCA 4YRBA 3AEVA 4GNKA 4KPGA 4QQRA 4YUWA 5LQSA 1SVWA 3NG1A 1GTZA 3O84A 4X94A 1KDVA 4OU5A 5LP6A 4RV9A 2DPIA 1M8PA 4ZEVA 3ZY4A 2HMAA 3GNLA 2O8EA 1D2NA 5KYYA 1GYQA 1E1MA 1XZLA 1U7DA 4B3JA 4WFQA 4QTXA 4LHVA 3WWDA 4QU8A 4E46A 3N8IA 1V16B 4Z4EA 3EZ5A 3O94A 3IHQB 3AM5A 2DERA 1L3SA 3ADKA 1T8SA 2JLBA 4YT2A 1E6MA 1T13A 1KEJA 1KO4A 3EGXA 3PT9A 5KFEA 1E0JA 3ZGVA 1YNSA 5ALXA 4C0HA 1X8LA 4DE5A 1L1FA 3M6KA 3HADA 4KLQA 2BMEA 1OVMA 2OK8A 3BD8A 1JE0A 3VX3A 1SKWA 1HQDA 4NHOA 2OA0A 3T06B 1ZOIA 3UIEA 4F5WA 4ZKDA 5HOEA 1F4VA 4HEHA 4HBGA 4YMUA 3MCWA 3E7WA 4I4LA 3L8EA 4EG8A 4ZCRA 1YUMA 1PVVA 2BC9A 1A5BB 2PY6A 3AEYA 4UJ5A 3NPMA 3MW8A 2A1AA 1B0PA 4LUCA 3HEAA 5FPTA 5FPQA 4CM7A 2XZLA 3C15C 4QXAA 5CA0A 4KDFA 5L7WA 2BCUA 5ENZA