4KX3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with thymidine monophosphate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of murine cytosolic 5'-nucleotidase III complexed with thymidine monophosphate
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Cytosolic 5'-nucleotidase 3
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4kx3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4kx3A01
3BWVA 1TJ5A 3WK7A 1WPGA 4EELA 1Z4LA 3M9LA 2R8XA 1TJ4A 2GHQA 3R9KA 2B8EA 3S6JA 3U26A 3PCTA 1RMTA 3WKCA 1RLMA 2QYHA 5AW1A 5AM3A 3L8FA 5AK5A 5AI6A 3AR4A 2YMMA 2EAUA 4UMVA 4BEWA 2I6XA 1ZRMA 3ZWDA 3WK9A 4ZEXA 1IWOA 5AW4A 2NYVA 3L8HA 4Y2QA 4FE3A 5AKKA 2MU1A 4Y2SA 2CFSA 1EK2A 3N07A 4G63A 3BA6A 5AIAA 1RRCA 1Z88A 4XOUA 3L0BA 4CF4A 1T9ZA 3AR3A 4H1WA 2FPUA 5AKHA 3MC1A 2NO5A 1RC8A 1Z4PX 5ALGA 2FUEA 3MMZA 2G07A 5AVVA 5ALKA 3RFUA 1ZJJA 1ZRNA 4BX3A 1WZCA 1L7OA 2B82A 3OCYA 3NAMA 5AW5A 3N8GA 2MSNA 2FPRA 1YNSA 2CN1A 1TE2A 3R4CA 4UAUA 3N1UA 4YH1A 2X4DA 2ZOSA 1O08A 3WGVA 2EATA 3ZVNA 3ZW7A 4Y2YA 2OM6A 2IOFK 4C4RA 2AH5A 2WF9A 1RLOA 2HF2A 1QQ7A 2FPSA 2YMQA 2P9JA 1ZD5A 2RARA 2YMLA 2GFHA 2I54A 3QUCA 2G08A 1QYIA 2B1RA 2I34A 2C8KA 1SWVA 2C88A 4NV0A 4AS2A 5ALWA 3A1CA 4ZEWA 5AKIA 2ZBFA 2FI1A 2VKQA 4HGPA 3OCZA 1VJ5A 5AKGA 3KD3A 1RDFA 5AM5A 5AVWA 3FGOA 3FVVA 2NO4A 1RQLA 3CNHA 3OTQA 3WK8A 2IOHA 3F9RA 3AR5A 1QH9A 4BNDB 4EEKA 3KDPA 4QQFA 3W5DA 1SU4A 4HGOA 5AIBA 4MWOA 4Y2JA 1T5SA 4EX7A 1Q92A 1RKUA 3UMGA 3NALA 5IT4A 3ESRA 4BYGA 2HF7A 1Z5UA 1XVIA 3N5KA 5IT0A 1RKQA 5E0OA 3SF0A 1QQ5A 3QLEA 5ALIA 3ZX4A 1L7NA 5AHXA 4DW8A 3WKDA 2P69A 3L1UA 5AVYA 1CQZA 3U19A 1YS9A 5IS2A 4L57A 1SWWA 2RAVA 2YY6A 4I9FA 5AW7A 1Z4OA 2YJ6A 3ZU6A 2W11A 3ED5A 3I6BA 2OA0A 5AESA 2JAWA 5ALPA 2DQSA 3SHQA 4ZEVA 1J8DA 4BBJA 2WF8A 3M1YA 4GXTA 2ZXEA 3QU2A 4NFLA 4FYPA 2R8ZA 4YCNA 2I7DA 3W5CA 3HYCA 4F72A 3QUTA 4EZEA 1N8NA 3B9RA 1RMQA 3SKYA 2R8EA 5ALHA 3U7HB 2FDRA 5AKYA 3I28A 4MUMA 2YMPA 4UAVA 3WK5A 1YDFA 3P96A 2W4MA 3NASA 3QU7A 3L8GA 4UMFA 3TLMA 2ZBEA 5T41A 3E81A 2WF7A 5AKXA 3SMVA 3W5AA 5AK4A 4XE5A 4UW9A 3CZ4A 2FUCA 5AW3A 3U7GA 3U7FB 3OCWA 3QYPA 2CFTA 5AI5A 3QU5A 2P27A 5ALTA 2G0AA 1PW5A 4BNDA 3WKAA 4UU1A 3QXGA 5ALSA 3PDWA 5JJBA 2C8LA 4BX2A 1RQNA 4C4SA 2W43A 4J2TA 2WHEA 4HGQA 4Y2VA 4EENA 4F71A 1RKVA 3QNMA 1J97A 3FPSA 5AVSA 2BDUA 2IA5A 3ZVLA 2ZG6A 4XPZA 1EK1A 1KYTA 2CFRA 4JB3A 2FEAA 2PR7A 2WM8A 4NAVA 2PKEA 4I9GA 4Y2UA 1WR8A 3J7TA 2YBDA 3OCUA 3IB6A 1Z4MA 4BKMA 2JARA 1U2TA 3MN1A 3A1DA 1NNLA 5ALFA 5ALOA 2AMYA 4UU0A 4O8CA 3B9BA 4DCCA 4XQ0A 3OPXA 5AM1A 2AUTA 5AVXA 2RB5A 5AVUA 1Q91A 2JAOA 1Z4NA 2G1AA 1TJ3A 1YJ5A 1Z4IA 4L6AA 2C9MA 3NRJA 1AQ6A 5AKJA 4CF3A 3EPRA 1ZD3A 1X42A 1CR6A 4BEVA 3E8MA 3WK6A 5A3QA 5A3SA 2B8JA 1T5TA 1VFPA 3HLTA 2Q4TA 5ALNA 1ZOLA 4G9BA 2OYCA 3L0CA 1WVIA 1RMYA 1ZS9A 1L8LA 2JAUA 4KNWA 1TA0A 4HGRA 3K1ZA 5ALRA 2WFAA 3IJ5A 3VAYA 3B8EA 3ET4A 5AK6A 5A3RA 2ZBGA 2EARA 4RESA 4Y2TA 4UARA 5ALLA 5AICA 2G80A 2B30A 2R8YA 4HGNA 3L1VA 2RBKA 4UMDA 2JGAA 1L7PA 3W5BA 2BDEA 2YFYA 3N28A 5AI9A 3WKEA 2I33A 1LTQA 4AS3A 3I1YA 4HAIA 4AP9A 5ALYA 3FZQA 3QUBA 3PGLA 4DWOA 4J03A 4IFTA 3SKXA 3QUQA 3L8EA 3ZI4A 2IOFA 3UMCA 3DV9A 5ALXA 5AM2A 3WK4A 5AI8A 2P11A 2QLTA 2ZBDA 4NWIA 3AR7A 1Z5GA 2Q5EA 3E84A 5AW0A 4UM5A 4OCZA 3DNPA 2WF6A 1K1EA 4KYTA 4YGYA 2GMWA 1L8OA 4FFDA 2O2XA 4Y2RA 3EF1A 1N9KA 5ALQA 1Y8AA 2PQ0A 3L0YA 2AGVA 2BY4A 4CF5A 5AI4A 3ZTYA 5AKLA 3SLRA 2HEGA 4NABA 4JDPA 3UM9A 3AR2A 3DAOA 5AM4A 3WKBA 3NUQA 4OHFA 2HSZA 3I76A 2Q4RA 3OCXA 4C4TA 4L6CA 2HCFA 4EX6A 3U13A 4YCMA 2YJ5A 5AW9A 1NF2A 2O9JA 3QGMA 3KZXA 1XPJA 1RLTA 5ALUA 4CNQA 4B6JA 5AW8A 3SD7A 1L6RA 1U7PA 1Z4JA 1XP5A 4YCLA 3ZX5A 5ALJA 4DFDA 3L7YA 4PNHA 3ESQA 2G09A 5FP0A 3ET5A 3ZWKA 4RETA 1U02A 1NRWA 3PGVA 2C4NA 4Y3UA 2B1QA 4YIHA 4YIKA 2HOQA 3KC2A 1Z4QA 1Z4KA 3OCVA 3QU4A 4IG4A 4HYTA 5ALMA 3IRUA 3UMBA 3EWIA 4QJBA 4BX0A 1ZD4A 2G06A 1O03A 1U2SA 3QX7A 3KOOA 4OD0A 4KNVA 3MPOA 3NIWA 2FPWA 2GHTA 3AR6A 1U7OA 4UASA 3ZVMA 5AM0A 5AVTA 4UATA 3ZUPA 2HI0A 2GO7A 1YMQA 2HO4A 2ODAA 3RF6A 2WF5A 3KBBA 1QQ6A 1VJRA 2OBBA 3ONNA 3AR8A 5ALVA 2YJ4A 5AKEA 2YJ3A 3QU9A 5ALEA 1MH9A 5AKZA 2IYEA 4KX3A 2I55A 2FPXA 5AVQA 5AVZA 4GIBA 1YV9A 4KX5A 3D6JA 5AW2A 4UMEA 2HDOA 3FPBA 3EF0A 3DDHA 3GYGA 5AK3A 3WGUA 2HX1A 1FEZA 1L7MA 5ALZA 3U7EB 1S8OA 1ZD2P 3NANA 4OFZA 5AW6A 4Y2PA 3L5KA 4Y2XA 2D2VA 3AR9A 4UM7A 2YN4A 3R09A 1LVHA 1S2OA 1RPZA 1F5SA 3FM9A 3ZTWA 3A1EA 2B0CA 3A3YA 4CE6A 1JUDA 5AVRA 4E88A 5AI0A 3E58A 5ALDA 4KN8A 2HHLA
chains in the Genus database with same CATH superfamily
3QKSA 5G0VA 1C4WA 3K4GA 4ATNA 3BGDA 4OJYA 2BKAA 1BPYA 2WB4A 3KXDA 4W1SA 4NFSA 3BYZA 2IKSA 3LX5A 5A9SA 4PYKA 5KSPA 1NU6A 1H2ZA 3KSDO 3TX6A 3S6JA 1P0QA 1HTWA 3IR7A 2C9BA 3RUIA 3S2GA 4AJEA 5IM4A 3T15A 4B9SA 2F44A 1NNI1 3CZQA 1N6PA 3L8FA 1LK7A 3PDUA 5L40A 3LCRA 5DMXA 5TT1A 4RTLA 1FE8A 2CLHB 2DQNB 1UA1A 4YYZA 1XTTA 5KNCH 2IVFA 3T1NA 5AHOA 3KCQA 3FWKA 4LSMA 2X5OA 1ZQFA 5F73A 1QG4A 1G17A 5AW4A 1OKKD 4C1BA 5JOQA 2YZKA 3PFNA 4G5RA 3KZOA 4BPRA 1CYDA 2G8NA 1XXLA 3AQIA 2R7AA 2Q5IA 1IWBB 1YBFA 2E4ZA 2FSSA 3GFRA 3M70A 4PRKA 2OO5A 1DWPA 4ND6A 1CY8A 2Y0CA 4W5NA 4RNMA 3TLAA 1Z88A 3HCPA 3ERCA 4XR4A 1T5IA 3MB5A 3L0BA 3ZZTA 2IY8A 4BLUA 4BZZA 2ZT7A 1X39A 4KO8A 4KFSA 4CT4B 5C7LO 2CSXA 1NX6A 2FDXA 3Q8QB 5EJ9A 1Z4PX 3OJCA 4LYEA 2NSLA 4F5NA 8ADHA 3U1BA 2VYFA 2MYTA 2QUKA 3MMZA 1Q21A 1KDHA 3EBOA 5C7YA 3RR8A 1NY6A 2JFUA 1IJFA 2SICE 4LKRA 4NY1A 4JR0A 3MTAA 4X8HA 4LCJA 4CGYA 2Q6OA 3I2YX 2P9EA 3WXBA 4A0SA 2AN9A 3KS9A 3SHFA 4B4UA 3JPRA 1Z0UA 2RAFA 1B6GA 2JEGA 2VJMB 4OATA 3C28A 4RVOA 5FUXA 3PW4A 4PG7A 2AVNA 2NU7A 2V96A 3K0SA 4E11A 1BVHA 3E2MA 3VRHA 5J4YA 1OROA 4CM7A 5GM1A 2CHUA 4L15A 4KR6A 2QN7A 3QVJA 3G8YA 2P0AA 2FG7C 4RFVA 2OORC 1MABB 3BWCA 3MGHA 3O93A 4BTLA 1N2BA 4XYMA 4CLHA 5C7OO 621PA 2C0QA 3BWEA 1I9CA 1P44A 2WF9A 4RMJA 3UJPA 5DH9A 1LCIA 2IHJA 3KPJA 4KEAA 4X3PA 3ZUGA 4E5VA 1BWQA 5CVTA 5JTUA 2QRMA 3RABA 1YZ3A 3KOWA 1YK0A 4J8PA 5E95A 4BFZA 1K1QA 1GYQA 3NEYA 4CEHB 1A4RA 2XV1A 1EXVA 4ZVKA 2H9YA 4C7OB 5H5JA 3V6JA 3HKZF 4XA8A 2YL2A 1G3IA 1Q11A 1SKBA 5ALWA 2XWSA 3NNSA 1G19A 1BFDA 2PR2A 1S2MA 3NR2A 2ASVA 1TK8A 2WVGA 2D5BA 1V9CA 1H5UA 1NGSA 3JPSA 1RPTA 5E6UB 2W6JD 2G0NA 2GRUA 3BN3A 3NG1A 4KAAA 5DCLA 3SFTA 5FBVB 1KZGB 9ICHA 3HBJA 3OOJA 2J5RA 2YQ5A 3QNWA 4C05A 4D57A 3OEHD 1E9AA 2ZRQA 4O2AA 5CHGA 3THOA 4ARBA 4ZCRA 3BSYA 3R3HA 5JSHA 4R84A 4WGFA 1B8UA 3BIFA 2Z58A 1JH9A 1CUYA 1QHHB 2QG9A 1XQ6A 1GTJ1 3P19A 4D3FA 4TM8A 4U6QA 3JYOA 4KLFA 1K92A 1RWVA 3E9RA 4D3DA 1KVQA 3BFKA 3ND8A 1N2ZA 4BIMA 1EXWA 1FQOA 4D9KA 2HZBA 1S4QA 4PYQA 3L04A 2FFRA 4HB3A 2FWIA 4B3HA 4Y0AA 2NUAA 2WJGA 2XGQA 5LP6F 1ECPA 4HXYA 2R84A 3ND5A 3CEJA 2PJRA 3C3WA 3ZR4B 1Z5UA 1RPLA 3LT1A 2H4XA 5CB6A 1X9MA 2X1VA 3Q1KA 1INLA 4MPRA 2JKZA 3LDFA 1C9NA 3HPRA 1E1NA 2D2FA 2AQ8A 5TB5A 3HA3A 2ADMA 3T1VA 3Q1LA 2P69A 2ZRMA 2BM8A 4OJNA 4EH1A 4KODA 3EBLA 3U19A 3KQUA 1IPFA 2DC1A 2JDIA 1P1HA 1FYFA 2REQB 3PR3A 1MABA 2WB1C 4N7RA 1WZNA 1V5GA 3ORFA 1M2WA 1E18A 3RANA 3T5LA 5KFLA 1N4DA 3KJQA 3KU4A 1RE0A 4TL7A 2A30A 3AEKA 4FMCB 2WWRA 2COUA 3PVXA 1FMCA 1HORA 1OD6A 3GW8A 4R1LA 4BFUA 2JAWA 3Q98A 1AC5A 2PZ8A 3ONEA 3AEQA 4XVQA 3SHQA 1JBQA 4X66B 4FR0A 1R3DA 2QAGB 3ILVA 3SR3A 4Q9JA 3AF5A 1QH8B 4D8XA 4FOPA 2CL7X 3PHHA 2BUBA 5DQHA 4P08A 3RS2A 5BV7A 5J3JA 1XDUA 4LDNA 2O8CB 1X9WA 1RWKA 3PRJA 1COWA 3BJEA 2VA8A 3CHYA 3I2HA 3NB0A 4NFYA 3W2TA 4II3A 4D3XA 4D98A 4DCSA 4EJSA 4NI5A 1L7QA 4XD7D 3F6EX 2HHUA 2H3FA 4WRRA 3QUTA 1LQ2A 4PS0A 4PXYA 3V4VB 1JBEA 4NEHB 3WB2A 5C37A 4DR2B 2D1RA 5ILGA 3JWIA 3KQWA 2LHTA 1RMQA 5EQTA 5DBBA 5B37A 2QW0X 1KYQA 2P9GA 4ESVA 5JSFA 5IDVA 4JIGA 2JFZA 1JG4A 2X1HA 3QMPA 2YMPA 2VXCA 2EW2A 2XNSA 3MTBA 1OW5A 2QMUA 4U7DA 4JBNA 5KOHB 4OHCA 2K8BB 1SKYE 4PZNA 1AA6A 3NJ4A 2RMKA 2R6AA 4HYYA 4N7BA 4GE3A 3FVRA 4PO9A 5DBHX 5T41A 2OK7A 4AN1A 1E1RA 3VNSA 1E3EA 1J23A 4E12A 4UB6U 1ZIOA 3LUGA 3DZ8A 3V42A 3TUZC 5EINA 1YK1A 5AK4A 3IFSA 1TRKA 3TANA 4EKEA 3H6KA 2AOUA 1LBHA 3SQXA 4UUPA 4EA6A 3ZZ1A 4URXR 3GDHA 2CFTA 1NXTA 1ACJA 3PEVA 2P27A 1GQYA 5LZ5A 1OXTA 4HPXB 5K99A 3X1MA 4HEA1 3C1ZA 1U28A 2CHQA 1O3YA 3E6AA 4BNDA 4FU0A 3ECAA 3C8MA 3TKAA 1OI2A 2VHXA 3F90A 2CLMB 3P9CA 4HB0A 1G5IA 1YU9A 3B6IA 1HE5A 3PDWA 4TTAA 1M6HA 2OQVA 3ENZA 1Y6QA 1ZWLA 4RW0A 2JEJA 3DBOB 1AZSC 1V8OA 3PPXA 4O5CA 1ODIA 2RB4A 3FB4A 4V38A 2VZEA 4QBKA 4ZO6A 5ED0A 4ZT6A 2V3VA 5HK8A 2ZCVA 5LA6B 3GRZA 4WXEA 2WG0A 3PQFA 3RJFA 2ZTHA 1K5HA 2GVNA 4PCUA 4UEKA 4XUEA 4O3RA 1FQKA 1AK9A 1BH2A 1U8XX 1YKFA 2VHQA 1MQ2A 2RQ5A 4CHGA 1G8JA 2BDUA 1RXVA 3PX0A 1DG1G 1KFJB 2CD7A 2EEPA 1GPKA 3WGHA 2A9OA 4IDEA 1IL0A 4UBNA 2PFOA 2ERYA 2BE7A 1ZM4A 4ESHA 3DP7A 2IV3A 3LU1A 1NK9A 3J7TA 4YJ2A 3ODPA 4PYOA 2C4VA 4X8LA 2ZSDA 4HEHA 2OHOA 3WWEA 4C7BA 4US2R 5IKEA 4AW9A 2H2IA 3LKBA 2J67A 3QG5A 4IGEA 1RRKA 3UXNA 3O1IC 2I1VB 3B9BA 3GJ4A 5KOYA 2HRQA 1EUCB 3IOMA 3ESAA 4YRDA 4LF7B 4DVGA 1KQQA 1K4MA 4ZVOA 1NQAO 3CRRA 4L6AA 9GPBA 3KKZA 1EJ2A 2B8TA 3HR4A 4RANA 2FZEA 3GX1A 1UJ5A 1FP4B 4UULA 1IBRA 1X1CA 1NBWB 2DFKB 3RRFA 1VRVA 2PV7A 4C14A 1S0OA 4KPYA 2EIHA 1QYCA 4IQWA 4EHDA 1DJQA 3CURA 4JB0A 3TSAA 4GX5A 1Z8FA 4FOOA 3KPVA 4Q02A 3VC3A 2N46A 1YDHA 2BFOA 4GXQA 5KYGA 1DJOA 2ZS8A 1L8LA 3UXHA 1B2LA 1VPVA 1ICEA 4F4HA 4J0HA 4B3JA 4XIJA 1TPYA 3RE1A 1FNBA 3E3OA 4JOCA 3RUPA 3VAYA 1Y3FE 3DEHA 4LXXA 4LXUA 5EIWA 1J99A 1H0SA 1R6XA 2X5NA 4ED3A 1DLJA 1OUQA 1EDDA 2X9NA 3BMCB 1CSEE 1FNMA 1Q84A 2REQA 2W6OA 4CMCA 5ES4B 5AICA 4OL0A 5HMLA 2BOVA 4MPPA 9ICGA 3DM9B 4Q3EA 5CPFA 3FMFA 4BO4A 2PT5A 3VPGA 3IBTA 2IYSA 3OLYA 4YNBA 5LBIA 3PI7A 1YR9A 3UANA 3G79A 4DCOA 4ZVTA 3ZU4A 3U3DA 1O95D 5HSGA 3RASA 1EP1B 1KJWA 1KYZA 1MTOA 2DZDA 2VRWA 2FP4A 1GQOA 3LA8A 4LIPD 4TLCA 2PM8A 2WYWA 2Q6IA 4IJUA 2FX3A 3K5HA 4FGSA 4I2VA 1Z3EB 2JLXA 2O8CA 1LTQA 2W2MA 2AE1A 3QEMA 3H6GA 3Q7EA 1GSAA 4J9LA 2HU2A 5CVEA 4TZ0A 3RYHB 4AMUA 1J6UA 1P7DA 1RWXA 3WHIA 1XVUA 1YUNA 3PGLA 1VMKA 3RG2A 5HGXA 4ZVUA 3ZK7A 1A9PA 2JJYA 4FBGA 3R7LA 1ABBA 4OP2A 1LI7A 1QJ4A 3K73O 1NMQA 1E1YA 1W4RA 3WK4A 1I7NA 4CTJA 1M8JA 2WPDD 3FB1A 3SPXA 4CCAA 5LXTB 2NWQA 3FLAA 3OZ7A 4M0FA 2YYSA 3DE7X 3LGXA 4WACA 3L6RA 2JAHA 3DMPA 5BW8A 2YXNA 2H0AA 4YREA 1TL7C 3R0ZA 5DN6A 2ILVA 3SFZA 2RP5A 3W0LB 2GCGA 2J0VA 4BVEA 3FUCA 4LHSA 4HT3B 4RTJA 1T5BA 3IV7A 4E3ZA 1AS2A 3O3NB 3ZCUA 2TMGA 2VNJA 4MV7A 3E7PA 4Y6SA 1OBVA 1S1MA 2WTEA 4N8SA 4RD1A 2HHVA 1GQQA 1XZIA 4IRUB 2C78A 1REQA 3QJYA 5DN9A 3TJRA 5JAZA 3H5IA 5EP4A 1BCSA 3RQSA 1P80A 3ZHXA 4FWTA 4YRRA 4EOGA 4HDKB 4CGZA 4OYYA 3TFQA 4F4ZA 3ZIAA 4TKUA 3AR2A 2JGIA 2HJRA 1G7TA 4IDPA 2Q29A 3OOWA 2PS0A 1WZUA 2Y1OA 2ODGA 1MQAA 3LV8A 3CVYA 2HHTA 2D5CA 2DWCA 5DNUA 5KT3A 2Q4RA 2ATVA 5C4MA 5IHXA 1WD5A 4ZT4A 1G3QA 3AVTA 2QF7A 2RLTA 3P9NA 3GDOA 1ESMA 4D0RA 5EJMA 2IPAB 2W8ZA 4DE5A 2G5GX 3D1JA 4QW9A 4DG9A 1V71A 1NF3A 3ROMA 2VTEA 1E6EA 5AW8A 3OZUA 3DKPA 4B9UA 3E7FA 3OJOA 2H3IA 5BSEA 2XB2A 2RI0A 3GFQA 3JZDA 4YBZA 3ED1A 1W25A 4YAUA 3DAFA 4NH0A 5FFFA 5J2UB 4E5NA 4QUAA 2X42A 1RJGA 4HOYA 4IGKA 3RS0A 1KZYC 2EF1A 1QSSA 5IM5A 5D3QA 5G4KA 5JU6A 1EXDA 2DWPA 2AEFA 3ESQA 4WKCA 9ICIA 1GITA 3TFOA 1OXVA 1MF7A 3CB4A 3EGCA 4IV5A 4UHCA 2J3JA 3OE7A 3PGVA 4ZVLA 5K1ZA 1WCNA 1IVNA 2GAOA 4YO7A 4RGVA 3FTDA 5AJYA 4EG5A 3PD0A 1ZQWA 4IIUA 3ZDZB 5NULA 4F8EA 3FCUB 1QU3A 5F1YA 5M29A 2QZSA 1I4LD 4JYPA 8ICGA 2I8AA 4QICA 3HJFA 1KDRA 2PUBA 3M33A 1P5FA 3CRMA 3SHWA 3O8CA 3PB3A 4K8OA 4U2EA 1FMLA 5G1PA 4UHBA 3B12A 4CI0B 4YMOA 1DKPA 1N9GA 2X3FA 2G7ZA 1DK3A 2PY6A 4XYLA 7ICGA 3PCXA 2WHYA 4RH1A 3C1YA 3DXXA 4ZANA 4QNMA 4L5IA 4NONA 3OY2A 1DCFA 3W8RA 1T2UA 3MGKA 4RA6B 3C1AA 2GO7A 1IQUA 2VRCA 3PRYA 4R98A 5DCUA 2AA3A 3KE9A 3L49A 1XOIA 4GECA 3OM8A 5HM6A 3VJRA 4XR9A 2PKRA 1Z6PA 3QXXA 5HJ5A 4YXFA 3SV3A 1KH1A 2YHAA 1NR5A 1TAGA 3IYLW 1YFKA 2IGTA 3AR8A 4P38A 4KU4A 5B7PA 3CVXA 1XV5A 1KDYA 4Q82A 1JNXX 4EHHA 2LVBA 3OEEA 3T7CA 1KC1A 4HFRA 2IIBA 1BXRA 3WYNA 1MVOA 4FFNA 3WLTA 5A0LA 1G1MA 3HB7A 4KX3A 4V0QA 3U31A 4XLTA 2ZTCA 1UDAA 3LBYA 3O4RA 2FCRA 4C89A 1L5NA 5F2KA 3FWHA 4K6HA 4IMIB 4KQFA 1YBVA 2X6TA 2QW1A 4PV7A 5FI3A 4DV6B 2VAWA 4FUTA 2FRXA 2HDOA 1ORTA 1SULA 2J3MA 2WMDA 3ANSA 5AK3A 3LT0A 4Y8VA 3SU8A 3TMAA 2DRIA 3EC1A 3T7IA 4N76A 3STUA 3SYRA 3I8SA 3U0VA 2DTDA 2WJPA 5AK0A 5JCJA 5LZ4A 1RBQA 2HF9A 4B6SA 1I6MA 5T57A 3OICA 6NULA 3GDFA 1JHPA 2IBMA 3H75A 4AT1A 3T5PA 4BY9E 2CSUA 3S27A 3OAAD 1DDIA 1N8SA 3H7AA 5LD2B 3HDYA 2J0UB 4E5PA 4DBVO 2VT2A 5IXJA 2BGWA 1G4AE 1XC9A 1UBUS 4AI6A 4FIZA 2ACEA 3T06B 2HMWA 2QVBA 4NL9A 4H18A 5KYYB 2UXDB 1D3AA 4BCDA 4QIWF 2XMZA 5EZ5A 1NKBA 2XJ4A 4MWDA 3RYHA 4DQUA 1IHDA 2FSIA 4TTQA 4EELA 4C8KA 2VSFA 5C51B 3HFSA 1N36B 2A0KA 5AJTA 1AB6A 2DH6A 1ZQSA 4ND4A 1QWSA 3H9UA 4EO7A 1NW8A 1L7RA 4D0NA 1QE0A 1PQ4A 2J3LA 3GI1A 4QECA 1Z26A 1RWBA 5H83A 4BJ6A 1EBUA 1YC5A 4I55A 1H9BA 5DRTA 4EI9A 1U1EA 3EIQA 4B47A 5AM3A 1M83A 6REQB 1G9XA 1NOIA 1WV1A 1YBMA 2P2LA 2R68A 4DNXA 3DVAA 3CR7A 3ORYA 1CB0A 1XRSB 4IGFA 2PK3A 1NQTA 3W9SA 4BEWA 1C80A 3R9IA 2ZXUA 3FCAA 5FLXA 2R48A 1WCYA 1LV5A 3BMNA 3CKYA 1P4HA 4I1OA 4MOWA 3UCFA 1B2RA 4DIOA 2D1FA 4BJQA 5B6JA 4DA4A 1SVIA 1HQYE 4Y2QA 1KW4A 1M2KA 1DCTA 3RRBA 2BISA 2PLWA 2W9AA 2CFSA 3E9ZA 4IDQA 2O1EA 2O5EA 2YNMA 3V2GA 4UFOA 3FLBA 4OLAA 4NL4H 1VA4A 3DD5A 3LH5A 4KDEA 2XB8A 4WK2B 1YQUA 2DHDA 3K0AA 4P0PA 1QCYA 4LW8A 4IYJA 4DAOA 4ZO7A 1AKVA 4BTVA 1NW9B 4OP1A 5KMGA 3CVOA 3GZ4A 4HHEA 2OWOA 1SEVA 2GPWA 5K05A 1M76A 3ELYA 3T5TA 2WTBA 2V7PA 3UPUA 2VA3A 1LVGA 1P3JA 3R7WB 4TYWA 2EJBA 4PZDA 1NRIA 2ZT5A 4N5IX 1QIGA 2J08A 1M2OB 2W03A 1WZCA 2HZ7A 2UZ3A 2GH1A 3F53A 3M3DA 2CF5A 4A8JB 4P93A 3N2IA 4NX2A 2PMDA 2QTTA 3MJEA 1JAHA 2QRLA 1F4LA 3FF1A 1UAYA 1CQPA 1KEWA 1TCAA 2Q5HA 3FLEA 4FE4A 2F62A 3ROGA 3V3KA 5JARA 4KNYA 2A9PA 2JH7A 2B8WA 3G1TA 2ZUUA 3BFXA 2EATA 3O82A 5ULLA 5B4UA 1NAHA 3OZXA 1WJGA 1IYZA 1PJBA 2AYZA 2JFQA 3ID6C 3OQMA 4MGHA 2Q41A 3TAPA 4JI6B 3RB3A 1YS7A 2HREA 3KYCA 5B66U 1V11A 2OM2A 4RNCA 4ARSA 3ZVKA 4HP8A 1PSZA 1UIMA 4BNWA 2B1RA 5JAOA 3WNQA 1PJ8A 2MAXA 4MVYA 4FDUA 3JPOA 3NORA 3UQYS 4X54A 3BQ1A 3PWZA 4H6WA 4ZEWA 2F1IA 2XY4A 4WMLA 1VGRA 1GKUB 1NOMA 5DVZA 3A37A 1RRFA 2F4NA 2X2OA 1JLHA 2CLEB 3EJWA 3FX2A 3LQFA 4JU8A 4PSCA 3ONVA 4QGHA 4UPVA 1BRMA 2PNJA 3L7KA 3WLIA 3K1TA 4CIYA 4RDCA 3M2PA 1ML3A 4MZDA 1SOMA 3IX7A 1J7KA 1QS0B 1OILA 2WM3A 4F06A 3QJ5A 3UF0A 2H29A 3AEKB 3OIUA 1P7CA 2H7CA 5KFIA 3EZ7A 4R2LA 2Y05A 3TZKA 1DQSA 2A0WA 4GPZA 2RGEA 2DT5A 2NSHA 3DEJA 4PZOA 3H16A 2WKPA 4DQVA 5HTOA 3EHDA 4O4HA 2KG5A 2PUAA 2Z8YM 4CM9D 3W9BA 4UREA 1CJMA 2ZI9A 4RADA 3O74A 3CF6R 3PHBE 4DLXA 5H3LA 4JT2A 4C6TA 2IXEA 2QL6A 2X77A 4LMRA 4O3SA 1P9RA 3FZGA 3ESRA 2YCLA 1EFRD 1ZVVA 2IHTA 4TVOA 5IK2A 3GLIB 1E3TA 3ANLA 5CW1A 1BDHA 1M2OA 1N6IA 3LBNA 3OBIA 2PWBA 4HH3C 2E8NA 4LJ4A 4RHXA 1AKYA 1VKOA 3UH1A 3WLQA 4HDCA 4YRMA 4JWNA 5IDQA 1E92A 2IHNA 1TCUA 2JKVA 4F6RA 3V6HA 1E0AA 1KL7A 1C14A 1EFPB 4AJJA 2WWTA 4FC6A 2QN8A 4A26A 3VR6D 1D8YA 4K40A 5AW7A 1E2PA 4I66A 2O3RA 1GR0A 4TV8F 5KU1A 1P45A 1P2FA 2QRZA 3K4QA 5AESA 5BWNA 4BX0A 3G5LA 3OZGA 3X1YA 3RBDA 3I9FA 2Z04A 4PZYA 1ZQOA 2PVCA 2VHCA 5I9LA 5JJ5A 4JFRA 1GG9A 1S3GA 2HCRA 1CEQA 1PR4A 2PGOA 4QOEA 4RHFA 4IIJA 2BQ3A 3UK0A 3Q3IA 4KE8A 1P9WA 3SSNA 3ZGLA 1PBNA 1K7CA 4N5NA 3SJUA 4J43A 3AHIA 3QU2A 2DWOA 4FSDA 5J1TB 2CNWD 3UFBA 2O0MA 4PQRA 5DI3B 3U61B 3LPMA 2J7PA 2O57A 4IRXA 2HK8A 2I3AA 5ANRB 4EPWA 2VQ3A 3GV8B 1D4FA 5A2GA 1S2GA 1ZICA 3W34A 4B4WA 1O2DA 1A0PA 4C8OA 1JU9A 4ZJZA 6Q21A 1S1CA 3CNNA 4LDZA 4ONEA 5L3RA 3X3HA 1YB2A 3PIIA 4AJIA 4FFPA 5K3OA 4FD3A 1QGUA 4B3RB 1R10A 2RIPA 2V03A 2FDRA 1A76A 1US8B 2PL3A 5MFPA 4UTPA 3V8NA 1IG3A 4EPTA 1MQ9A 2XPCA 4UEOA 2O8DA 3TL6A 4TMKA 1A71A 1F17A 3EHEA 4OMDA 2HHSA 2ODEA 5IJ0B 4M47A 4DB2A 2NP7A 4BBZA 4MDHA 1JI0A 3TI9A 5K8IA 3AQ4A 3AF2A 1E1DA 5C80A 4TWRA 1XF1A 5DB4A 3FRJA 3SMQA 3P4UA 5TPWB 3W5AA 4AY3A 4O3FA 4MLPA 4B79A 5ADUS 2KB0A 2OEPA 5ADHA 1UFKA 2X13A 1W85B 2RHJA 4LX8A 4TLLB 8ICBA 2PLRA 1CUGA 2ONJA 4OAOA 3URKA 1J1IA 5D87A 2BFCA 4EWLA 5E2IA 3RIEA 3DR5A 2P67A 2QX9A 3PFIA 1YUMA 5E0KB 2OMKA 1L5QA 2ZIZA 5LXTA 3JASB 5JPDA 3ISTA 2E55A 3CYFA 2W8BA 1OXJA 2VHVA 4PAGA 3H4TA 5BYJA 4N12A 5KTTA 1DBQA 4EAAA 5FH9A 3TADC 4P7KA 4U2BA 4E5SA 4U2GA 2IYZA 1R00A 1K86A 2KVCA 1WDTA 2F17A 1LJ8A 3DG9A 1WULS 3RTCA 4BX2A 2WIKA 1FU4A 5KTYA 3KSAC 7ICEA 5H4GA 2WNSA 5KQRA 3V4ZA 3EW9A 1TU4A 1P1FA 4K9DA 3NTVA 5B5EU 1VL2A 4CMBA 1RYZA 1E2HA 4R1TA 2WJVA 4L85A 4DVJA 1EWYA 3FHCB 3ZVLA 2ZG6A 1OAAA 5ICSA 3H8SA 4ZC8A 1AY0A 2G3YA 3KSBC 4JB3A 1DUVG 4Z99A 3UQ0A 1PUIA 1A7JA 4RQ4A 2NU9A 3L7DA 3PYMA 1NW4A 2GTHA 4L27A 4R41A 4RA9B 5DLPA 3FTFA 4O3PA 2UYQA 2HMSA 2VG8A 3KUCA 4INJA 1LFAA 3TLCA 5H68A 4DL3A 1Z7GA 1TVKB 1Z4MA 4MFCA 2GAIA 2W2OA 3EXIB 1Y4AE 3IAHA 3JQRA 3MN1A 4OQ4A 4WY5A 4N9QA 3T4EA 4B31A 4D97A 1O8BA 3JD3A 2ZVDA 5AVJA 1YZVA 2AFRA 3M0EA 2WZBA 3WIEA 4A92A 2NPIA 3ZHYA 3IUNA 4JBXA 2FX2A 3UMSA 3PW0A 3V1KA 3FFTA 3PSHA 1E1CB 5F5XA 1P75A 4NLKA 3PW5A 2X1LA 2Y9MB 3ISJA 5J2TA 1P5RA 3V7UA 1E69A 1KGSA 3BL6A 1TUEA 4MW4A 4NXNB 4TM7A 1MA7A 2BFWA 2JHCA 3HKEB 4LTMA 3RAFC 1ZUWA 1DTEA 3LLMA 3NRJA 2VJPA 4LE0A 3MLEA 4RE6A 2HRCA 1SUAA 4PL1A 3JQ6A 1Y9DA 3LQKA 2GGSA 1SUCA 1UC8A 1VFPA 2QTWB 1K6JA 3DCYA 3NTOA 2F67A 3HLTA 1DV1A 2GI4A 4DYDA 1H1TA 5HMMA 3SAJA 3STHA 1X1QA 4R8UB 2D7CA 5CM2Z 5ARDA 3QVUA 4TRMA 3D4LA 1KFBB 5BYBA 3C16C 1N61A 1I10A 3ACBA 2JAUA 5DTIA 5I9BA 3ZJUA 1NXXA 3ILYA 4GL4A 2BEWA 2WFAA 2I80A 3S2EA 2D2IA 3Q9SA 1JSXA 4DFMA 1XF9A 1U65A 3TFWA 3UWOA 4BNMA 8ICXA 4EJMA 1L5ZA 1R4AA 3L7CA 1VL8A 2BYTA 1GNQA 4B84A 3V7LA 2MWMA 4K86A 4MI9A 3HB5X 1QFXA 4LZNA 2HWUA 4IIYA 5GWXA 4INAA 3F74A 1ZN7A 3THXA 1H65A 1SC4A 4HFJA 3LAWA 1PKEA 4ECZA 1N56A 1P77A 2Z83A 2FFJA 3V7KA 3EBPA 2Q6LA 2RGNC 1Y8QB 1T13A 2OCIA 3RI3A 4PZUA 2MMGA 2VYVA 4CR8A 3RRMA 3ZZUA 1PU2A 2RCNA 3CX8A 5GGYA 3VV2A 3WKEA 2VHTA 1UBRS 4LWPA 1OU4A 2PBLA 5TQJA 1XNHA 4YWJA 2EBFX 4JP8A 2ZYGA 5THKA 3S2IA 3TTUA 4B76A 5E7QA 2JGJA 4LHZA 1B0XA 4NJMB 1JQAA 1HYHA 2DHQA 2RBEA 2V54A 3W8DA 4Q8FA 4RELA 4KBGA 1BPDA 1E1CA 4N5DA 1H2YA 3KOXA 3PCRB 2IOFA 3SX4A 2Y68A 4QTUB 3M49A 4M76B 5JQGA 4P9NA 1U63A 5J4LA 1ZVMA 2J6BA 5EOVA 2G1UA 4RMGA 1KJYA 2LBPA 1S0VA 2ZSUA 2JR5A 1T3ZA 2X4LA 3AR7A 3HU2A 4KR9A 5AW0A 4C8NA 3WGGA 1Q19A 2XITA 5FOXA 1NW6A 5J2IA 4YJ3A 4DAEA 1TTHA 2XDQB 4H0CA 2VTVA 4ALIA 3V5NA 5L7WA 4G56A 3NV7A 4HN9A 3L8MA 1IBKB 4Q1EA 1WSWA 5J2UA 2E48A 2YS6A 2IZOA 3I12A 3E1KA 1OFUA 2JMGA 3JQDA 4GSLA 4HI0E 2RCYA 5CDSA 4DKJA 4F9GA 1YZ7A 3MUOA 3DDCA 1LX6A 1OB5A 3Q8KA 2KMLA 2VP9A 1SN7A 2AFHB 5A7HA 4BRSA 1T9AA 1UUFA 3ENQA 3FR7A 4JYAB 4NOKA 4FNAA 3OOYA 2J5KA 4OUDA 2YVKA 3R7WA 3NAQA 2HSZA 3HM2A 3HJUA 3MWLA 2Q5QA 3TAHA 3T3HA 4A2CA 3VKHA 1ULUA 3SYLA 3A2NA 1LPMA 1YIAA 4OQYA 4QUBA 3DMFA 4FMCF 4X91A 1Q83A 5BOSA 2BONA 3KHTA 3B89A 1U7WA 3LL4A 3NVVA 1NVDA 2IHZA 3DOUA 4JCOA 5CJ2A 2GBIA 4P4LA 4DM3A 4MYDA 121PA 2ACWA 3L8DA 2WAAA 2RJNA 4BATA 3I5MA 1U3TA 3VPCA 3W2FA 3OZSA 1HH4A 2O2GA 1AMUA 1MVLA 3A4MA 1AK1A 5LQNA 3NHSA 1TEXA 1U7PA 4JNCA 2ID4A 2VR1A 5JDIC 2VP0A 1M2NA 1OYOA 1ND6A 3BGOS 3NJ8A 2YV2A 2WZDA 2Z7JA 3L1KA 4B17A 2C2YA 4KJZA 5ITVA 3NC0C 4R16A 4IICA 1WBBA 3RYIA 1QONA 3AHFA 2V6IA 4OAQA 2FWBA 1JHUA 4LV5B 4P22A 4PNHA 3GAFA 4ZVVA 4OG2A 1P2UA 5HTKA 3F2BA 1PT5A 4M55A 1V1MA 4FT4A 4YIHA 1OLXB 4DNFA 3FMGA 3V7YA 5CDFE 2QTGA 1EEXB 1M6VA 3MWDB 2ZVJA 7ICMA 4GWGA 4BMCA 3JYNA 2GHRA 3I9OA 1B4DA 4J1TA 4WESA 5HF9A 3BDVA 3RJMA 1JG2A 4M1OA 4EMTA 1A4XA 2PZEA 1X87A 3EIEA 1KY4A 1OBOA 2FXIA 1E89A 4O2AB 5TQVA 3TPZA 1NLMA 4MUGA 1Z5WA 1JLMA 2ZSJA 2VCEA 4FVTA 2CDRA 5DXJA 5KG3A 4E5DA 4EJ0A 1YH3A 2H1HA 1YI0A 4GRAA 2CVFA 1Y4UA 4HUQB 3AEUB 4KNVA 3PJRA 1BSVA 1NWCA 1SHUX 2B4YA 5DYYA 3QITA 4PL2A 4JBLA 4HLCA 1U8EA 5EEHA 3R0XA 2YFQA 3F4LA 4RF5A 3UXYA 1YB7A 1OGYA 4J16C 5IEJA 3AR6A 4KQGA 3Q8LA 3HNPA 4ACBA 1FYVA 3EGOA 5A4DA 4NKRA 3MAAC 3KX2A 3KXKA 5IIIA 4RBNA 2H17A 2IBTA 1P91A 4DV2B 1C9DB 4KAJA 3I0ZA 1U94A 2E3JA 4IZ6A 2RH4A 3PPVA 2ZUDA 5E6RB 2C95A 4B9NA 4OGKA 3DLTA 3EFEA 4O4HF 5BSUA 6LDHA 5IAKA 1S10A 1L3SA 2P1ZA 3EZ2A 4BFSA 3DC7A 4D4IA 3MILA 1QHXA 2OZLA 5HJ2A 3ZK9A 3IEVA 1MO2A 3QU9A 1YB4A 1USWA 1G20E 3BRCA 2JIRA 4P3YA 2XI9A 4UB5A 4HLNA 3ZE8A 4V2UA 1IXRA 2FPXA 5AVZA 4XUSA 2BP7A 2Q6KA 2AG5A 2O19A 4HYKA 3AHCA 4ZVSA 4IHQA 4UMEA 521PA 2Q8PA 4RZ2A 4CN8A 3FPBA 3MTEA 1KORA 2B4RO 3WLPA 1ZQCA 5CT9A 3PJGA 3EXHA 1JXEA 3KNZA 4D92A 3U3MA 2DQKA 2D62A 2VSNA 5E7IA 2I65A 1RACA 1P8JA 1NL3A 2BCRA 2QAGA 1OW3B 2JL1A 2CXOA 1TD1A 3OF3A 4YK7A 4U2DA 1FF9A 2H2WA 4LN1A 2DQYA 3AF1A 1KY5A 1DBPA 3PI6A 1XLVA 1JB9A 2YVAA 4YN3A 3TXYA 5JD4A 4OIMA 2OB1A 5JRJA 5D86A 4DEZA 1ORHA 4YCSA 1LV8A 5DB6A 4FYHA 2C2DA 4FZVA 1JUDA 3PT5A 4O2BA 3HKCB 3MINB 5LLTA 3UC9A 3QPVA 1DZ3A 4KRFA 3NHMA 4IDGA 4RY8A 4X65B 2K2QB 2P78A 2ODBA 1V7PC 2CNLA 3C5VA 5FNZA 2P9CA 5ESXA 1XTJA 2VDRB 3LOPA 3BE6A 3GVXA 2UVPA 2H57A 2X1MA 2Q45A 3GRPA 1ZNXA 2P5YA 4HADA 3GEPA 4W6ZA 2O8EA 3GGPA 3B52X 4QBTA 2FUG1 5CDTA 1RC1A 5TMEA 1QUEA 4MYCA 3ROFA 3R41A 1M2VB 2P8JA 3LO8A 5JC8A 5JH7F 1QIDA 4YMIA 3E1SA 5KTKA 1OH8A 4EY7A 2X8JB 4JJ6A 5LIRA 4U63A 3VZDA 2X7HA 1NN3A 4UUMA 4LI0A 2R44A 3K6JA 2QY6A 4ZCSA 1G21E 1AZLA 1C29B 4DXHA 1EA7A 2PZAA 1QHHA 3EEFA 4R9RA 4KQIA 1LJUA 3JAKB 4JJKA 4JX8A 3ZWDA 5KO2A 3CLTC 2A2ZA 1KKXA 1YS4A 4ECYA 1C8VB 1U1FA 1RPJA 4RDIA 4EG6A 4F1WA 3N7UA 4UVGA 5FBZA 3E53A 5F9NA 2LD4A 3N07A 4M8NE 4YTEA 4P81A 4EW3A 3EDRA 2ZR0A 2OGTA 3KXIA 4G4GA 4O63O 5TEWA 3TE7A 4D43A 1KEPA 2HA6A 5BR8B 4NY8A 3I61A 3IP5A 2V0GA 3T52A 1PYDA 3A6PC 1TK5A 4B8ZA 2NPOA 3BIOA 2FQYA 2OHJA 5DT2A 4EARA 2UXBB 4L0CA 4I2HA 1X7GA 4EP1A 4UBBA 1DAIA 2HYIC 1FLVA 2OQIA 4ZI7A 4DV5B 1Z1VA 1UWCA 3B53X 4QEZA 4ED8A 2XVMA 3SN6A 2NZ2A 3OCYA 1H4SA 2P6RA 1X7XB 3N8GA 4X60A 3NJRA 1YNSA 3MEQA 1JR4A 3O8OB 3B0YA 4DSEA 5JEDA 4MHSA 3R6GA 2FVYA 3UFXB 3ZV7A 4UAUA 1DIHA 3F8SA 3SYZA 4EMSA 4YEDA 2SKEA 1WYGA 1DPGA 3KYIB 1ZH0A 4IRMA 8ICOA 3BQ0A 2M6RA 2OG1A 2ZJ7A 3AFGA 3KQOA 2CLLB 2QBYA 1LVUA 1LZLA 3DHNA 1Z29A 4C2BA 1Y3BE 2QR2A 1B74A 3UT6A 4H60A 4IR1A 1C2TA 3IT2A 3H0LB 1ZH4A 4ECTA 3NYIA 5TJ9A 1PEDA 3DVLA 3B6KA 4OQZA 4Q7LA 1N75A 3IOEA 5B4VA 1ZD5A 1HURA 1DSSG 3I1FA 3I2JA 3MWEA 2FQXA 4OHVA 4RF2A 5BVGB 2ZR9A 3ITEA 4MS3A 1SU6A 2GPNA 2K6GA 3CM0A 1W48A 2NZ8A 1OAOA 1NKVA 2Q0HA 5EE1A 3OF2A 4XD7A 2JFVA 4JJAA 2X8JA 3ZH9B 1JX6A 1H22A 1TKAA 2CB0A 3HG7A 2PUEA 4BP8A 2ISOA 2KX7A 4OM8A 2QJRA 3OCZA 4NSNA 1VJ5A 2E7ZA 4ND7A 1HUOA 4ZYTA 3TSWA 2H2DA 2WTXA 1T2CA 5JU5A 2ORED 2GD6A 4IG9A 3ZGOA 4WKNA 3MQ2A 1GPDG 2ZE5A 3I5AA 3P5BA 3ITNA 3CVVA 1VIMA 1XN1A 2ZBVA 4KYVA 3CX7A 1KAEA 3I4CA 3S68A 4PH5A 1GP2A 3AR5A 1N4AA 4QZVA 8ICTA 1AG9A 1JHQA 1KZ4A 1NONA 1PI3A 2WV9A 3X2EA 5JNVA 4KHPB 1E9CA 5AIBA 1SU4A 5L1MA 4K9LA 2Y67A 1NKCA 3ILHA 4H77A 4YRCA 1I5OA 5IYZF 3NTLA 1BVUA 1YQXA 3AI1A 4LAFA 4P4GA 1Q92A 3I2KA 3UMGA 2DP4E 3KE8A 3LHSA 4PWZA 2HRDA 3CISA 1QBKC 4D6XA 3FOFC 3TADA 2RK6A 4G01B 1TADA 3IV9A 5JZVA 2GTIA 2HRBA 3X1WA 1CJUC 1RI2A 4S0XA 3P9IA 5IIMA 2F77X 3GJ5A 1IN1A 3MPUA 3L0ZA 4A03A 1HV8A 5FXMA 3ZLBA 3PLRA 1CQZA 1OFIA 1ZN9A 2PUJA 4MQ6A 1W5FA 2ZGVA 3TM4A 2ALZA 2GZDA 2BTQB 4O08A 3U9LA 4E51A 2BCGY 1W93A 3PWSA 4NJEB 2C5SA 1TEHA 4FGUA 2W6QA 2PFNA 1AH2A 3MS7A 4AZSA 4W6QA 4F56A 5TS3A 1FPMA 9ICLA 1W6UA 3KYBA 2I6FA 3OKCA 4FFOA 1FFDA 1L3IA 3WQQA 4V0ME 4J49A 4AKTA 3W3ZB 5JUWA 3AY3A 4OBBA 4ZFNA 3RTAA 3ES9A 3FYHA 2J4CA 1KTVA 1WMAA 3P9XA 1KI1A 1KOJA 4KN4A 1ISFA 1L0BA 2RHOA 5JAIA 2OXRA 2QN1A 3RIXA 2ZYSA 4TT8A 3QWIA 1PRYA 1VQ1A 5EKTA 3SC2B 4EGCB 1O1YA 3ZGXA 3KFUF 2HLDD 3PNSA 4M9SA 3BQ9A 1U2RA 2A86A 3FCXA 4WXRA 4DBLC 4Z6KA 4A0RA 3W5CA 1UBTS 1WHSB 4YHHB 3GC6A 4OMUA 3WJ1A 4FXPA 4IDCA 4ZODA 1HMYA 3B9RA 4P0TA 1RZ3A 3STVA 3DOFA 3T9FA 2OV2A 4DIBA 1AHHA 3DV0A 4E70A 1NP3A 3SFVA 1G8MA 3ZDEA 1DOHA 1V11B 2CL0X 4O3MA 5EIFA 1SH7A 2FWRA 4ZEOA 2JJQA 1EGVB 4JL8A 4QLOA 1JV2B 5IC4A 1EINA 3VNBA 2QUJA 1P5HA 1ESDA 2VP4A 4FHZA 3WGZA 2DKOA 1MQ3A 2EGUA 5B2ZA 1WMEA 2ZSHA 1AQYA 1G9TA 3IM1A 1B1AA 2H0QA 2H1RA 2YWEA 2H65A 1UM8A 2ZANA 3IMEA 3L8GA 3Q7TA 1LC0A 4Q9IA 4LOIA 6YASA 5FWDA 5BN5A 2FZ5A 2QE6A 3KT0A 5JI3E 2AIRA 3D3EA 4GSYA 1QNLA 1Y0BA 2BH2A 1ZK0A 2DBVO 4E1AA 4RMIA 1E5DA 2BFFA 1KJ9A 4PJ0U 3JWJA 2GXUA 2ZJ2A 2WKQA 3RH0A 1QC5B 2W3RA 1YKGA 4O3QA 4DFKA 3OCWA 3IKMB 3IKTA 3FTEA 5AD1A 4MUYA 5JJKA 2QTZA 5DU2A 1YAHA 2NAFA 2POCA 3W6OA 3ICQB 2FOIA 2AR7A 1PW5A 3RK4A 1NBIA 1D2CA 3NPMA 4EYGA 3SZGA 4EHKA 3KR9A 2IUSA 1H2AS 3TEFA 2HR1A 3HBNA 2OUKA 3H1TA 1DC5A 2V8BA 3I30X 1F8UA 1HRKA 4GS5A 4KAXA 1N2EA 2AOWA 3DDZX 3WQBA 3VISA 3U4IA 1AO3A 3SIWA 3UK6A 3WLHA 2OXIA 3PVSA 3FNIA 4ED1A 3VZRA 2ICAA 4KLUA 2PKCA 5L4LA 1PSDA 5C1DA 1IZZA 2Y71A 3F7MA 1QTMA 1ZESA 2P2ZA 2PFKA 1UFVA 2QX6A 2AFHA 2IEAA 1RFGE 2PSEA 2PZKA 2XWBF 2Z56A 3A6KA 3FY4A 3Q7RA 5EC8A 4YUWA 2AJQA 1IEWA 3RJ9A 1NLUA 2AJBA 5EWMA 1ORIA 3THYA 1KO1A 1VP9A 2LV8A 2Q46A 5KC8A 3D5TA 1YXMA 1S96A 5KFPA 1R6AA 1E0DA 2C9OA 4K9OA 5DLFA 4IZHA 4YAWA 4C7JA 4NBVA 1KGDA 5HX7A 1QCKA 2H51A 3AUUA 3WC4A 5K9ZA 2DERA 2R7MA 4ZT5A 2EX0A 3FOZA 2O07A 1GDTA 3RFVA 1W47A 3PKJA 2Q2QA 3ER6A 5ISMA 3N7TA 1BDMA 1KAOA 5IAGA 4UPEA 1Z19A 4XARA 1HDGO 3ER9A 1OH6A 5J0UA 1T8EA 2V5UA 4J0DA 3FIJA 2E89A 2EKZA 1GOTA 4O8CA 3WI7A 5A4FS 2QPOA 2ZWOA 4JYBA 2OPHA 4EJSC 4GKKB 1C8BA 1SCIA 1U1CA 2PPLA 1CDEA 2MIIA 2RC6A 3JRNA 4FOTA 3RVSA 1UL1X 2CYCA 2XD4A 4LMPA 3VPAA 4EVQA 1CQJA 3WGKA 6CHYA 2X0KA 3AONB 1E2IA 3MMNA 4QDTA 3A36A 1W1WA 3C6BA 3W9UA 3BS5A 1ZQ1A 5IFKA 1J2EA 5J0XA 1Y4SA 4L3OA 4LC0A 3E5HA 1KO8A 3C7TA 4M49A 4OXNA 4ECVA 4O5OA 1Y8QA 1CUBA 2HQBA 3AX6A 1TCCA 4DQSA 3RIHA 2AR0A 1XAIA 2HADA 1EAMA 4OUKX 1FK8A 3K31A 4WZAB 2Z0MA 3Q7QA 1P60A 4WLNA 3JALA 1XVLA 3G17A 4IXWA 4DLPA 1M6YA 3CW9A 5AXAA 3NHBA 3D8RA 2JHGA 4PFSA 5DNAA 2O7RA 4J7CA 2ZI6A 4LZWA 4PHCA 1EVIA 4PSUA 2E1RA 4QXPA 4MYSA 1MQSA 2FPGA 4CMEC 3IT1A 4RD3A 5FFNA 4JUZA 1JWAB 1U81A 3O38A 4DIDA 4DSUA 5AK6A 2Z6UA 1HG1A 5KHAA 9ICBA 2YB4A 2PDAA 1Q0SA 1QTIA 1FJHA 3CCBA 1VE7A 4XQ8A 5TF4A 5A5EA 1XTVA 1LBIA 3OUTA 2B30A 1RP1A 2VAPA 3C3DA 4DCTA 4HGNA 1M75A 2GK7A 3WIVA 1DUSA 1Q1NA 3VO1A 3O9VA 3QW4B 2CYBA 1N77A 1VYTA 1PZFA 3N6VA 4ZTZB 5EG5A 5A2QA 1XNRB 5KEIA 1ZKMA 4L72A 2A5DA 1XXHB 1MDFA 1FFUA 3QELB 4C07A 5IIOA 2BF7A 3AETA 3V9PA 3LUPA 4UTRA 2WJ4A 4MVJM 2CL5A 3LC7O 4FJ1A 4CLRA 3WR5A 1BXZA 4QAQA 2E49A 2MSWA 3T7EA 1XCPA 2UAGA 2QQFA 3WJ2A 2NV0A 1OGJA 2ZRNA 3UMCA 4LGYA 4YQYA 1RADA 3RUDA 2AHOB 3R3YA 1YDMA 1P39A 4Q3NA 3ZNOA 2UVVA 1Z5GA 5JADA 4ZQFA 4HTFA 4UM5A 2DSNA 2IWHA 1WXEA 2BMFA 4XGKA 4Y67A 4HS9A 2DF4B 4U3JB 4Q12A 4YGYA 4CCSA 4RQAA 2SCUA 3OLWA 1KXZA 5K8JB 1REQB 2VP2A 3ORHA 4WINA 3WS7A 1WQ1R 2VYCA 3Q8RB 3DO6A 4JBYA 3NM6B 1YR7A 3D1VA 3PXAA 3RVLA 1QOPB 1T9KA 2OLKA 4KLIA 3H87A 4DS4A 5DI3A 1Y8AA 1BZYA 5IABA 1ZH2A 1NJ8A 4DMLA 2WEKA 4E21A 5KKNB 4EZ9A 4PXSA 2QEQA 4DL4A 2ECFA 1P2BA 2XB9A 2NADA 3IT0A 2BBTA 2W9XA 2CJWA 3T5MA 4BO6A 4C0AC 1RC0A 1URPA 3MJRA 4NXZA 4QPNA 1T36B 4V3CA 4N3NA 5BOVA 4Q9LA 1B6TA 4LV6A 4H7FA 2BD0A 4YCBA 4XX1A 5TISU 5TQ2B 5I7OA 1UPXA 3QSGA 1YQEA 2D3DA 1XWWA 1X3SA 1KI3A 2HWKA 2NT3A 4TQ9A 3RIYA 2UV8A 2BGGA 2VHEA 4MP6A 1ULBA 2O4UX 1SXHA 1ZL2A 2XQVA 2HH9A 4UDXX 1ZH8A 5K3CA 3UB4A 1KFSA 3DAYA 3GHYA 5LDHA 4RY9A 3UA4A 2COKA 1R0XA 3PWKA 4J90A 4KE9A 2DPLA 3BDAA 3JY6A 1O94C 5DGIA 4S05A 1W5EA 3LFUA 4G37A 2I0FA 3H5RA 5E4FA 5FL7D 2DPIA 3CIOA 2Z95A 2PTGA 4XCVA 3PA6A 4ETIA 5CB8A 1SURA 1RRVA 4DS3A 5DX0A 2FE9A 3IERA 3Q8SB 1GN8A 4OLFA 1BQ4A 5KSZA 4F5QA 7ICTA 1AQIA 2QLBA 2B6GA 3VI3B 4BAGA 1D6MA 4E4TA 5LYYA 4D8TA 3UMBA 2A57A 2AWOA 3F5DA 4B73A 4KVAA 3HMKA 2COEA 1JYFA 4HDMB 5JV5A 5IEBA 2GA8A 3ESDA 4D1YA 4UOQA 2PX4A 3VR4A 3SE7A 3PEYA 5EWFA 3PR2B 4WBNB 1YJQA 3BCRA 3GL9A 3JQBA 2RHLA 4H6PA 4HXFB 4G65A 4MR8A 1O9BA 4X1OA 3CH6A 4RK5A 4ZAYA 5IJ9A 4KLTA 4KFRA 3D0RA 4W8GA 3SSMA 3THWB 4JI5B 4EKGA 4QKQA 1AN9A 4HX9A 1EFKA 1KPGA 1SR8A 3JZAA 3P20A 4A73A 1JKIA 3AXSA 1DTWA 1O9GA 2QKYA 1N6HA 1U3FA 2H5JA 4FYJA 2V59A 3TLJA 3VMFA 4CODB 3ZGVA 5ILOA 1TYAE 4DLZA 3SZ2A 1YZKA 2F3NA 2VOJA 2BJVA 3G5TA 3PJDA 3OHSX 3A2KA 3JQFA 3DZBA 1CUAA 2Y0SC 3M9NB 3KG2A 3UNXA 3BE5A 1HLDA 2FMTA 5ETJA 1CZNA 4IXMA 3PKIA 4YVZA 1RKXA 3PJEA 4F04A 1VLMA 4P83A 4RPXA 1M6WA 5D2CA 4JT4A 2FMUA 5M04A 5JWOA 1KWKA 1XRPA 3CE6A 4NRDA 2ZI4A 3RKUA 2BAGA 3PSAA 2XCAA 1FUIA 1X1DA 1KBOA 2YINC 4B8YA 4UTVA 1VRWA 5DDMA 2KFZA 2H59A 5L1JA 1LLFA 3FHTA 4C7XA 2M32A 3RSSA 5LNK6 3BB3A 1NBEA 5C8YB 5IUJC 3PXUA 5KFFA 4FBMA 2YTZA 3DDHA 4C8MA 2BGLA 2O3QA 1MJGM 1Y1PA 4R5HA 1U1IA 4RABA 4DBLE 1UOPA 4C4XA 4H7HA 1ODJA 3B9JA 2Y1WA 2ZSAA 2IJGX 3L1IA 3P0RA 3RLFA 5DG8A 4ZZIA 2BLNA 1XD9A 5KYYA 4OTZA 4DV7B 3ER8A 1QHSA 2VJCA 2XCUA 2GO1A 4D9JA 2FSGA 3MMXA 2ZUFA 4QZCA 4TUYB 4ZVPA 3V1YA 1HEYA 1DHRA 4ZH4A 1H0RA 1DMSA 1L2TA 3AGPA 3DXZA 3MWGA 4RKWA 4AXXA 3LKVA 1FXSA 2WPDA 5KL8B 1EG7A 1GU0A 2IYXA 5FF9A 2PG3A 4ZI5A 2BEWB 2O1XA 2PEYA 3BWVA 3FTQA 4ZOAA 3RR2A 3U81A 3CONA 5K0CA 1YRHA 2MINA 3I34X 3MJ4A 2V97A 3MMPA 2VPTA 5U4XA 4QZ9A 2O54A 1Z4LA 2QVZX 1QF9A 1JAXA 2E18A 4WXMA 4CCYB 3W4IA 3FN4A 4GRIA 2GHQA 2FMKA 2YDYA 3AZPA 3PNMA 4NF2A 3T0IA 5FPKA 1YZNA 1GKYA 1M8FA 5KFRA 4KL8S 3VX3A 2FN3A 4HVCA 4OU4A 4R2WA 2XJ9A 4I2NA 4DM4A 4DDWA 1F44A 1UBJS 3T95A 1HPLA 3KO8A 5TPWA 5C35A 1FJ2A 1QHEA 4EHBA 1B22A 2DY1A 2HDWA 4F8YA 3VOBA 2EAUA 3Q3CA 1NUQA 3TF5A 3ESZA 4DCMA 1GNRA 1P7ZA 1VCMA 1ZIXA 2GD2A 1K6EA 2XEDA 4HEQA 1QVWA 4LZZA 4ZQIA 3ZHOA 4B7AA 5BP7A 1E8NA 2GN1A 2VXYA 5ITSA 2KKVA 2H18A 2NO9A 2Z3ZA 3H05A 3H4IA 2IV7A 1CR4A 5BURA 5I7EA 3HR8A 4YR0A 4RZIA 4G63A 1T24A 2G17A 4CIXA 5IMSA 2CC2A 3AM5A 2KMDA 1BNPA 1GRQA 4AO7A 1PP4A 2GKOA 3GJ6A 5DM60 4CU5A 1V5WA 4F86A 4L78A 2I7TA 4D0GA 4O29A 3B9QA 2Y1XA 4EVIA 3D3WA 4X84A 2OSVA 4K9QA 4A8JA 2GILA 2P2DA 4GOJA 2PL9A 4CF7A 4FYVA 5HILA 1YZ6A 1OFTA 2BRUA 2BGRA 4EBBA 3OQNA 1N2JA 3AB3A 1SC3A 4TUPA 2QRPA 4ZRNA 3GLGA 5FA8A 2O50A 3JSAA 1J0EA 2X6RA 3K7EA 2Z1NA 4KTTE 2NZUG 3J80A 3V55A 5FBWB 2XQKA 3OSPA 1SIUA 2ZRIA 2ZYHA 3MOGA 3SG0A 4OQMA 4CQLA 3VR6H 1J33A 1S8AA 3K1RB 1QMGA 1LDEA 1QZUA 3N39C 3U5TA 3CGWA 2KZMA 2CLKB 5KFGA 3ICWA 4M8IA 4AY4A 1II9A 2RHHA 4Y2GA 4GLJA 1TKBA 1ZONA 2O0HA 2QU8A 3DFZA 3PZRA 4KQXA 3IPXA 2PSSA 3AIMA 2YMLA 4GF5A 5BYKA 4PZLA 5JBIA 5LZ2A 4N39A 4CIAA 3KWMA 5A0TA 1OCEA 2BGNA 2BVNA 3H9JA 1IM4A 4HAUA 5KAPA 4EUHA 4JJ4A 5JJIA 3FZEA 1NR1A 3VI4B 3HY4A 2ZBFA 4ALMA 1EGQA 1YQQA 2W4IA 4WNYA 2Y2VA 1XL0A 4FM9A 2YRFA 2G6BA 3EVGA 3OE5A 3AKZA 1AM4D 2B4AA 4ZU3A 4C88A 5JCOC 5MF6A 4ND2A 4P5EA 3OO1A 2IH5A 2NVWA 5B1HA 1X40A 1UP6A 1ZLXA 5IJAA 5AVWA 3RFTA 4ZTUB 2V7UA 4BJHB 4I2GA 2OGZA 1SKRA 1IHUA 1CZLA 1OR8A 3GA7A 4FDVA 4MX8A 3FVVA 4Z0HO 1QNFA 2O0JA 3B1KA 1M1NB 2YQZA 3NBUA 4PX2A 4A5OA 3U6KA 3GCZA 3WY9A 1S9HA 1CF9A 4RQ2A 2QSZA 3AU8A 3E5RA 1GL9B 1DO8A 3MWYW 4E5MA 2P1DA 3MB8A 3PQ5A 4HGOA 4J76A 4ON9A 2HUPA 3T8YA 2DPJA 1G66A 2B1JA 2VS1A 2Q07A 2HNAA 5DOVA 3W4KA 4DIMA 3ZG6A 5HKOA 2FOXA 1G20A 1EFVA 2P2CA 1VL0A 1VXOA 5T4HA 4KR3A 1J7JA 4BWFB 3FSGD 4BQIA 1TVMA 2G40A 2H63A 5IT4A 4RSRA 1DNPA 4LSZA 3WTCA 4U0KA 1P1IA 1PG5A 1B23P 1Y81A 1T8WA 4RK6A 2SHKA 1UPCA 2V4UA 4TUQA 3NRCA 4BDSA 1II0A 2P9BA 4DJEC 5CD9A 3DLAA 3SBEA 1BJTA 2BF4A 3PEFA 1Z5NA 5FI1B 1NXSA 1L7NA 4ER5A 1GGFA 2HRRA 3T5BA 1MQ8B 2C3UA 3L1UA 2JD1A 4WXPA 2MSDB 1C1XA 2JW5A 3BQMB 4RXMA 3TRDA 3WFZA 1A8UA 4UBMA 3P2MA 4GMKA 3NWPA 5CG2A 1B00A 4CIDA 2P9HA 2DJIA 2UZ1B 1JHXA 1HI9A 3L92A 2VCYA 3I01M 2R60A 3BSWA 4HZGA 1E3SA 1T3HA 1SUPA 1Y1TA 4QYIB 3VNUA 2VFAA 2Q3LA 5FLKA 3VJLA 4PONA 2P66A 5D3ZA 1QO7A 5JR3A 3Q3HA 1L3UA 4BX9C 3VAZA 3LY8A 4QA9A 2JLCA 3TG8A 2QOEA 4NBKA 3KSUA 4EG3A 3MGBA 1CEYA 1T6YA 5FQOA 3TMKA 2BFFB 3AKDA 1TYCA 2FG5A 1DIOB 3IVRA 2BP7B 3BL5A 3HYRA 3CW2A 3PNQA 5G1OA 3SZOA 3D2QA 1BS9A 1TQHA 4UNNA 3TSZA 3X1JA 2J3EA 1ODLA 2W6IA 3QQPA 4LRWA 2EANA 4F72A 4KWTA 5FHRA 3ZE2B 3A6JA 2FW8A 3QOWA 2X0EA 4AZVA 1G291 4BP3A 2WUVA 3E4CA 2I2DA 4IIDA 3G2OA 4KE6A 4TN1A 4IQTA 4KWCA 4P35A 3AYZB 1G21A 2HEIA 3GUUA 3B8HA 1Z6GA 4RT2A 1LKYA 4HL6A 3ZXIA 4W99A 1AK2A 3QQ5A 4OLJA 3IDAA 3W04A 4OBEA 4DABA 5JWHA 3EPKA 1E20A 3V32A 1C3XA 1KMNA 3QIVA 3VR5D 3IPYA 2J31A 2P1RA 4Z0TA 1JL3A 5KCZA 3OCJA 2FMIA 1Z35A 4TT3D 5L3SB 4NICA 2QN2A 2XTAA 1Z63A 3QX8A 3DUFA 3T41A 1SV4A 1L1EA 2MSLA 3X1KA 4B3GA 2BGUA 3WSVA 2WUFA 2B98A 1P0PA 2IF2A 4FFLA 4HWGA 3LVBA 2JJ2A 3WMXA 1SVWA 3JQFC 4C30A 3EY9A 4Q43A 4FC7A 1U1GA 3PNBA 2J6HA 1OT3A 2NYAA 2VDOB 1GD1O 1S2NA 3D3WB 4INOA 3HJTA 3A32A 1V7QA 3BTUA 1G8AA 3CX4A 4RVHA 1XQWA 3GLHE 3IT3A 5HFNA 5T8KC 3WYDA 3K75D 3AFOA 3DUWA 1NMXA 3GT0A 4GPTA 3E8SA 1TYEB 4EGQA 2C31A 3FH0A 4L07A 1PX2A 4JKOA 5TGTA 2O7SA 2ISPA 1NV8A 1V41E 2V3WA 3BTOA 4OI2A 4D4KA 2I67A 2OSBA 4B35A 3HJEA 3AEVA 1PK9A 1VKNA 1OBFO 1VLQA 2WWIA 2X14A 4EF4A 4GXJA 3F9CA 4CJXA 2BMEA 4BDPA 2AN5A 4YMLA 2C5BA 1XVAA 1O89A 2IDKA 4EVSA 1WUIS 4FFBB 1RKVA 1XLTC 4L02A 5D5QA 2GNOA 3RRNA 4KTQA 3FGZA 4MV5A 4RA9A 3I04M 4O1IA 3PMNA 4LDRA 2H1FA 4MLCA 5HBRA 3JATB 4XRRA 3LOQA 1VSUA 1XDWA 4LHXA 2BCUA 1JKJB 4OI4A 2FPPB 2RGDA 2J09A 2PXHA 5TVGA 1V3UA 3NEPX 3ZW9A 4BMVA 1YR6A 3SNHA 2AYYA 4L6IA 5TQ2A 3G2JA 4KO2S 4BV3A 3OEED 3O73A 3B1ZA 5FOUA 3VYWA 3IKJA 2BSQA 1LKYB 1UMBB 3RFCA 1P1RA 3C1OA 4AN4A 1KYVA 3EPLA 1Q15A 1BWSA 1ZINA 1GPBA 5ICEA 2JJ8A 4DCCA 3QV2A 1BHSA 1JLKA 3AK4A 3QVLA 4D5GA 3MM4A 1IZYA 2XODA 2AUTA 3EFOB 3W6UA 3CO0S 3CKKA 4DOAA 1ZK3A 5M34A 1LSSA 2OAQ1 2ZYTX 4Q0MA 1A4IA 4R1MA 5DBIA 5EUBA 5BXYA 1FZQA 2CK3D 1TAHA 3BMOA 1W1UA 3KM0A 4DSOA 4NYIR 5AJWA 3LPLA 4IQUA 3CG4A 5DK4A 1VSTA 1FUYB 4DHWA 4MJXA 5IH7A 2ORYA 4YQFA 4G0NA 4MS3B 1X42A 1W5SA 1WPXA 2RBGA 2X40A 5GTDA 1DJNA 2DTEA 1UK8A 4LGVA 3O83A 4BB9A 2BGTA 5TT0A 1KI9A 1KXJA 1NQOA 4D4JA 3SYNA 6PFKA 3A6LA 3MJCA 5K0ZA 1JHMA 2CNNA 2JGDB 3KT6A 4G9BA 1F0YA 4DA6A 4ER3A 1U0RA 7ICPA 1QO0A 2PI5A 1KTQA 5HUJA 4K6OA 2QW8A 2YN2A 4XOIA 4GI5A 3ZQ4A 1C4XA 2G5HB 4HGRA 1C8KA 1PGOA 1UPAA 5DSXA 1YZTA 5EN4A 5ARCA 4B09A 4YAIA 4W5OA 2P91A 3JQ8A 4OXQA 1Z17A 3RYFA 4YAKA 5A3RA 4B6GA 2PSJA 4DLUA 4L7VA 1NVWQ 1R6DA 1H66A 4ILKA 4CMIB 3HXQA 4D8UA 4XPIA 2JZBB 4OB7A 2VHJA 4OGLA 3RK0A 4JK1A 1KZ6A 5AMXA 5DM70 4ZVNA 4EY6A 1O8CA 3W8FA 2EYUA 2GUWA 1E3LA 3H17A 3H2HA 4MZXA 5LZ7A 2NZYA 2BDEA 2G76A 3MUNA 1ODTC 5DTRA 4F4FA 2XF8A 4CDRA 3KKAA 1Q2UA 3K0CC 4J1NA 2I33A 5CX1B 3U2QA 2F48A 3AY6A 4MLZA 4X8MA 8ICFA 2HMYB 5EHIA 3UMJA 3OFJA 4R01A 4XXHA 1M1ZA 2MA1A 4AP9A 2FZKA 4ZOBA 3Q88A 4RFSA 3L2OB 4N8EA 2CJWB 4RZUA 2XLCA 3HZZA 4WESB 2A5FA 5E9WA 5FBRB 3N2YA 4DUGA 3V1NA 4DSTA 2AT1A 5J5VA 2ZRDA 4DMMA 2CDAA 2Y0DA 3OQIA 3HVHA 2W9BB 2ATCA 1MPXA 3QX3A 3EXFA 4GLLA 2K2WA 4ZZ3A 5I6DA 5DFAA 4JUAA 4IZIA 2C5GA 1I2BA 3WWZA 1WA5A 1XA4A 1YO6A 1RG6A 1MPTA 4R2KA 5F7XA 5LMUB 3I2GA 2VCHA 4CMJA 1DXSA 2UUOA 3E0QA 3A26A 2WF6A 2CMGA 4QDJA 4F6LA 4MQEA 2GCPA 2E8PA 1RWNA 1G6HA 9ICVA 2WJAA 4FEAA 4IQ4A 4WK6A 2NP6A 5JYCA 4EW6A 2IZ1A 1LF5A 4R2XA 1XZBA 3D1LA 1QPZA 2WQ6A 9ICEA 3QKIA 4TQGA 1AV6A 3V4PB 4DTIA 1YVPA 3OUUA 4XIIA 3AM1A 4EQZA 1OX5A 2XIDA 4MVWA 4X6YA 3CLUD 4OQXA 1OH5A 3AVYA 3V6LA 2R97A 3RNOA 1Z8HA 5KQLA 4YMHA 1FFCA 2VJAA 3CUUA 3U3ZA 4Q1BA 1LW7A 1E8DA 1N5IA 2CVPA 3LA6A 3QPCA 1YBAA 3L4JA 4TMZA 3H5LA 4JDPA 5JLAA 5GMOA 3JQ8B 4MQ5A 3KKQA 4K9NA 4BJ5A 3GLFA 4QM6A 1E9VA 2J1LA 3QBDA 3TQTA 5IVKA 4EHFA 1C3LA 3QI7A 1P17A 5CK5A 5HCUA 1RYDA 5CA0F 3L82B 2HCFA 1SEPA 3D4PA 3FJOA 3SS8A 3U13A 5KYKA 2HBLA 5F9HA 1N7IA 1NK0A 1D2GA 2RGGA 3STYA 2C54A 5TS2A 1GWNA 1I3CA 1NF2A 3QGMA 4PHHA 1K8QA 1ZCJA 1ZJ4A 3P2KA 1SL1A 3DWEX 5EVJA 4M2YA 5LDGA 3EW7A 3R7DA 3EARA 3ZE6A 3ZY5A 2GZRA 4DR1B 3OZEA 3GF4A 2A3RA 1MH1A 3ESYA 4JGGA 1R16A 3LO5A 1SUFA 4YDQA 4JQZA 4DMUB 3KFXA 1PJCA 2VLBA 2QXTA 3QVXA 4YRFA 4RTNA 2JEFA 5DB9A 4FFBA 4JOQA 4RXTA 3JTMA 1Z6YA 2Z2YA 1IQRA 2J3DA 1YB1A 3PD1A 4GO1A 4PFKA 3UV7A 3O4HA 4JENA 3L7YA 3A9SA 1VB5A 2ZJOA 5F5LA 3ET5A 4FZRA 3KKPA 1D5WA 2DUWA 5BWLA 3TARA 2V9WA 3TBHA 1JQ5A 1C1DB 3AESB 3B3FA 2WJHA 4MB6A 2ZJ3A 4BO3A 4LYGA 4EA8A 2GF0A 3INTA 1DX6A 1PEYA 3M9WA 1ZRHA 4Q9AA 4U4AA 5J9FA 6ABPA 1H6CA 3REFA 3TCNA 1VE5A 2VZ8A 2W2KA 4XFJA 2VNKA 1ZNQO 5C46F 2FW1A 1RLUA 4QHTA 1N2GA 1RLJA 2I7XA 4A2PA 3WYFA 5BN3A 2NQ8A 3FWPA 3RVJA 5I8PA 2DFVA 4CEIB 1U4SA 1VM6A 1XXHA 4YR2A 4C3OB 4DSZA 1GPWB 1PV2A 1P0FA 1Y3AA 3EOZA 3COPA 3N87A 1JHYA 2GFQA 3QVGA 2Q4DA 5HG0A 5TARA 3ROZA 3JD2A 1MHTA 1T8YA 4RTRA 1U8YA 4HDRA 4BNZA 3BMOB 1J0CA 4M8LA 4RPHA 3DTVA 4YRSA 1V5EA 4KQMA 4Z9AA 1N1MA 5KFAA 3BIJA 4YJ3F 1SXJD 3T1YB 4X5OA 2QN3A 4HZUA 3UYLA 3GP3A 4LTNA 5J4KA 1XDBA 3DMTC 1W4BA 1ZU5A 2HO4A 3BHJA 3KV1A 2W9CB 2CE7A 2CNBA 2WF5A 2M1XA 3QM1A 4WCFB 1LB1B 4MRMB 2FSVC 4BNUA 1JPNA 4DARA 2Z5FA 2JCYA 4N0MA 4FX2A 3RRXA 4AUEA 2Y8EA 3KQNA 1LFDB 2FZVA 3CB2A 3FTNA 4UEJA 5E9AA 4PTLA 3PUVA 5DJ5A 5ALEA 3FAKA 3PWTA 4NBLA 5KU7A 2O8FA 4P4OA 1JGTA 2A1TR 3HHEA 4I27A 4LRQA 3VXKA 3EXHB 2CBGA 1JX4A 4KRXA 3ZWAA 2GCNA 3DOCA 4KLAA 3HCEA 2BM9A 4UBJA 2X3YA 3RVQA 1V0JA 4PLWA 4MYTA 1JG1A 1X7HA 2IK8A 5CDGA 2YZNA 4AKHA 1UEIA 4PRLA 1TW2A 4N6GA 4BMZA 3SZRA 4Z4FA 3IIIA 2R1UA 5JG7A 3V00A 2WQZA 4M6WA 1EP3B 3IQHX 5KFXA 1HOTA 3L6UA 4KQWA 2R6GA 3H8JA 3CWZA 5G1NA 4EY3A 4Y2PA 3NAGA 4PF1A 3WLLA 5LQKA 1XQXA 2P90A 3JYHA 3GLTA 1ES9A 2ODNA 4XGRA 3HU1A 3X44A 4RPYA 1EESA 2OFFA 3CZMA 4XJSA 1A8SA 3IBYA 1H2EA 4WNAA 2E5WA 5EY5B 4GR4A 2ZZNA 2LBOA 1S76D 1XIVA 2OHHA 2NUPA 3CY6A 5H81A 3WNCA 3MZ0A 3IHLA 1LSJA 1CHDA 1H2BA 2IYFA 1N5LA 2VWPA 3AW8A 3K8ZA 3MCVA 4J0CA 2FLLA 4ZU1X 1TJ5A 1Y88A 1WPGA 1NJ6A 4GC9A 2GWHA 1IHPA 5KCMA 3IQGX 2PA3A 4AKSA 3OJWA 4MPJA 4XLLA 5C34B 1ZA1A 1RXIA 3EXG2 4LYDA 1E2QA 4IWXA 2AMLA 4NG4A 3FOCA 4PLTA 1DPFA 2NRZA 2OKCA 2WZCA 1HC7A 1D9XA 3JWPA 4JJIA 3E05A 4XYGA 1T3NA 1O77A 1MW9X 4FONA 4LOLA 4DA8A 4Z4IA 2AUNA 3OY7A 4JVMA 4O4IA 1IY0A 2QL5A 2ZU0C 5A62A 5DIZA 1VDVA 2ARKA 4XSGA 2IC5A 2AQ4A 2OQ2A 4MK4A 1FTQA 3L3FX 4HDNB 4BV2A 4EGFA 2A9VA 1C3OA 3PXXA 4XDYA 2P9TA 1ZNYA 3VSAA 5F98A 3ISVA 5ESRA 1JG6A 3HVJA 3K9FC 4QZIA 4ACAA 3G6YA 3UUEA 3E7XA 1SV0A 4ZEXA 3SP1A 4AJOA 2CKMA 1IPEA 2PI4A 3P4XA 2FRDC 3UOWA 3ZE9A 1D2MA 3PK0A 1UF9A 2M1ZA 4Z1MA 4YI3A 3VNAA 3CSSA 3RBAA 5L1IA 1QCDA 1G5PA 3KYDB 2E5LB 2EQBA 1JG3A 1O4VA 1AMNA 1LLUA 1T9GS 3USZA 1OUMA 2DKXA 1Q44A 2CLDX 2FLKA 4DIFA 3EN0A 3SJ7A 4N54A 1S0UA 4KPUA 1J06A 3TR0A 4M3NA 4JH0A 4B9TA 4N40A 3HA7A 3LXUX 3RD5A 3BF7A 3OZFA 1UKBA 1BGWA 4IZOA 4KH0A 2EKDA 5D1NA 3E2PA 4JHLA 4QE3A 4U3JA 4CYMA 4EYOA 1WDWB 4UB4A 4F5YA 4US0R 1W85A 3M89A 4JBHA 4MO9A 4XSVA 1UWLA 2B82A 4OF4A 2C1EA 3GDXA 1KNQA 1ZM3A 3FYUA 3PZBA 5FV7A 3ENKA 2QAIA 2IHBA 2ZQ5A 4MEBA 3VU8A 4BX9A 3OZAA 4LJ8A 4YBRA 4FO6A 2M9MA 2NV2B 4OJ6A 2HCBA 1ISIA 1NXOA 3N1UA 4LVNA 1S4MA 4BPBA 1QP4A 3UGQA 3H5NA 2XCQA 4RMHA 1F8XA 3U44A 1FVXA 2OG2A 4NBWA 1Y1KE 1E1QD 1SXJB 2J48A 1YDWA 4FI3F 1K89A 1GEGA 5AH0A 1ADCA 1ATIA 1G63A 4HVLA 1HSZA 1GEEA 1B93A 1KIMA 2OLEA 2X15A 3HSKA 4WXHA 4UB2A 3VZQA 3ZD7A 4WFJA 1JR2A 2AZTA 4G0UA 1QSYA 1KJZA 1QP8A 2OK8A 3EGIA 5D51S 2D3WA 3SSOA 3LL7A 3ZWVA 4ZDJA 1EGMB 3R75A 2PZFA 1WVMA 4G8CA 2IYOA 1NP6A 2LUOA 2WHQA 3E22B 3RADC 2ZXIA 2A3VA 3ELUA 2FI1A 2VKQA 2W6PA 3OZDA 3LF1A 5EI5A 3VDQA 1KF0A 5GV8A 3UW3A 3BBPA 4A6DA 4X1IA 1IBCA 2ORWA 1D4AA 1KO7A 2YJZA 1B0PA 4K7JA 4K2AA 4NEGA 4PLHA 3TQSA 1BHQ1 3C8HA 3VTFA 3W2HA 4CM4A 4XJVA 4FZLA 1SUSA 2X7JA 3QLVC 2VT3A 3OTQA 2GWSA 3C6YA 1MAUA 1TVKA 3IEPA 1WKCA 4S1TA 4WDRA 1TIPA 2WSMA 3WGJA 4JEIA 4KLGA 5FI5A 4JS0A 4YJGA 4HD8A 1ZJNA 2NW6A 4BLSA 2P75A 3B1JA 2H3QA 2C94A 3K9NA 1TGYA 2LNDA 3GJ8A 2ZIAA 4G0XA 4TWZA 4E5KA 2PVSA 4HO1X 5DBCA 2AMJA 4O5AA 5CU7A 4EKDA 4H6VA 5JS6A 4FYIA 4PLCA 1RI5A 2IELA 1BO6A 1YQ9A 4LGMA 1NTRA 1XVIA 2J59A 3IQXA 3ZWOA 1KH3A 4JC8A 1P7YA 8ICPA 4LZGA 1NYLA 1Z0ZA 3GRKA 4NE9A 2QT0A 3GPCA 1NG9A 1RJWA 1JR3D 4Z6DA 3SJCA 3LIIA 4HNRA 3CNEA 3EULA 1ZD8A 3A70A 3VZPA 2W6ZA 3SCZA 2QT1A 3UJHA 1U3UA 4PGXA 1PQUA 1A2QA 5KFOA 1YS9A 4KPGA 1KLNA 3B20A 1GN9A 3T9DA 2A0FA 2VH5R 3KFLA 4JL5A 4B40A 3ST7A 3N70A 1M7GA 1SQGA 3ZCPA 2WFLA 5GP1A 5G40A 4QVKA 1SOUA 5BRAA 5GV7A 3A4LA 3ZD9A 4CHTA 1KZ7B 4KK4A 3HYLA 2LGJA 3UCEA 1XWFA 1XRQA 3KPYA 1QIKA 4R9NA 3U3XA 3WQSB 2TSYB 5E3HA 2XH8A 2JIQA 2AF4C 3NBQA 4MEJA 4MJ3A 4WBSA 1FUEA 2A19A 4PAMA 3TLXA 5BSWA 1V8DA 2P4SA 2WOJA 3NVYA 4GXTA 2WT4A 1ZI8A 4QYXA 2D1YA 3Q6IA 1Y6RA 3M2TA 4TVKA 3DVAB 2FLPA 4RORA 3TCXB 1T3GA 2HSDA 3W5VA 4DG8A 2OP0A 4Q48A 3EC2A 1BEUB 1M1UA 3IOCA 3LCUA 4LZOA 4MARA 1PIWA 1QH0A 2B9EA 4BWGA 1VHQA 4CR7A 4PBSA 4F5EA 1B3BA 2VF5X 5YASA 1KAQA 5KFQA 4B9AA 4BQOA 5I7UA 2Z57A 4EGJA 4YAFA 4F45A 4RVNA 4ZZ0A 2ZQYA 4IIBA 4RAOA 5LKRA 1LLQA 2WYIA 1CP3A 3EZLA 1AKEA 4Q37A 4UAVA 1X8KA 4KQ6A 4TX1A 4Z3KA 3AKEA 1BS2A 1PZGA 2HLHA 2W48A 4YJGB 3ZHQA 3L18A 2HWWA 2HXYA 4IV0A 4ZQBA 2R62A 3KVVA 3O8RA 2C59A 4O2AF 3PF8A 2B7CA 1I36A 4KG7A 3RVRA 4NZPA 1I2AA 1FNNA 1H6DA 1Z18A 3G2LA 4CT0A 1GGKA 4BMPB 3E81A 4PGAA 3AUOA 2CEKA 1QH1B 5IBPA 1WP9A 3AM4A 1SVSA 4ITRC 1JAZA 1IE3A 1PHRA 1P2GA 1Y89A 2QNRA 4Z3DA 3MCTA 2I6TA 2FUCA 2SNIE 2R8JA 2GAJA 3GQVA 3PVZA 4CCYA 4ECQA 2F3UA 3Q9NA 1KSJA 1BYIA 2FG6C 2VBIA 2WICA 4EQ6B 1T3SA 2DVMA 5LYJA 3V2UA 4DF8A 4TQRA 1L7AA 1NVVQ 5EAIA 3LCMA 5DM2A 4IQVA 2P5SA 5KFMA 3C23A 1RYUA 4LOAA 4HAZA 4MKXA 3LPAA 4NOJA 4UM9B 2G0AA 1CU1A 1GUBA 3LY9A 4QZGA 4MQBA 4F4KA 4DT1B 3JD4A 4F9FA 5SYAA 3F3MA 2G71A 2IZ5A 2F2TA 2OYRA 3FCEA 3C1UA 3LD9A 1ID1A 3GEGA 3ITKA 2I5HA 1KQNA 1Y3DE 2NVOA 2Y66A 4X6LA 1IONA 1PNTA 4UOZA 4FD2A 2ZIWB 3Q40A 3U9TA