4KX3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with thymidine monophosphate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
b'AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Structure of murine cytosolic 5'-nucleotidase III complexed with thymidine monophosphate
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4kx3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4kx3A01
3DNPA 4BNDA 2YMPA 2G07A 4CF5A 1L8LA 3F9RA 3OCVA 1L6RA 1KYTA 1T5SA 4UW9A 1JUDA 2FPXA 5ALDA 2G0AA 1RLMA 1N8NA 5AESA 5AM2A 3MN1A 3OCZA 5AVRA 5ALIA 5IT0A 1XP5A 5AW1A 1Q92A 4B6JA 2O2XA 3R9KA 3ZVMA 3OCUA 3ZI4A 2B8JA 2G08A 2AUTA 2YBDA 5AIBA 2B0CA 5ALGA 3NUQA 3ZU6A 2JAOA 3B9RA 3UMBA 2R8EA 2ZBEA 2YJ5A 3AR8A 1EK1A 5AVUA 3U7FB 1F5SA 4UATA 1QQ5A 3NALA 1NRWA 2GHQA 3L1UA 1L7PA 2R8YA 1QYIA 2VKQA 2O9JA 4OHFA 4KX3A 4F72A 3QGMA 1ZRMA 2C88A 3EF1A 3N8GA 2R8ZA 4BYGA 3GYGA 3I1YA 5JJBA 3ONNA 1NNLA 4HGNA 4KYTA 2G06A 1L7NA 1WPGA 5AVWA 3RFUA 3B8EA 4GXTA 3SLRA 4Y2QA 5FP0A 2YMLA 3B9BA 2HDOA 1O03A 1RQNA 3TLMA 4HYTA 3NRJA 2IOFK 5ALQA 3WK7A 2B1QA 3SKXA 2FDRA 1SWVA 1S2OA 1Z4LA 4I9FA 4DWOA 3ED5A 2BDEA 4XOUA 1MH9A 4Y2SA 4KN8A 4CF4A 5ALNA 2HEGA 4NAVA 2FPSA 4QQFA 2FUEA 4Y2XA 3L8FA 3HLTA 2HOQA 4G9BA 4L57A 4UMEA 5T41A 3WK4A 1Z4KA 4FYPA 3E81A 5AVYA 2X4DA 1ZJJA 3CZ4A 1LVHA 3WK9A 4BX0A 5A3RA 3QNMA 1TJ5A 2IA5A 3FPSA 5AKGA 4BEWA 2I34A 5AW3A 5AI6A 2P9JA 4J03A 1PW5A 3AR2A 2MU1A 2YJ3A 5AK5A 3QU4A 2NYVA 5AI5A 1QQ7A 2Q4RA 1X42A 4XE5A 3QYPA 5AVTA 3W5AA 2CFRA 5AKYA 1ZD3A 4BX3A 3IJ5A 3PCTA 2G80A 3RF6A 3EF0A 3KBBA 4CF3A 4EENA 1U7PA 4J2TA 3QU5A 3DAOA 4UU0A 2HSZA 2WM8A 3L0YA 2HF7A 3MC1A 1TJ3A 4RETA 1U2TA 4MWOA 2P69A 2Q4TA 4KNVA 4FE3A 5ALPA 3AR4A 3ET4A 4GIBA 4UAUA 1RKUA 4PNHA 3E8MA 3KD3A 3QUCA 3M9LA 1Z4NA 1Z4PX 4UARA 3KDPA 3UMCA 4YIKA 1ZRNA 2OBBA 1TE2A 3K1ZA 4C4RA 4YCLA 4IG4A 3BWVA 5ALHA 2RBKA 3L0CA 3DDHA 2PQ0A 4EELA 1J97A 2W4MA 1J8DA 2ZBFA 1U2SA 4YIHA 3QU2A 1RRCA 4KX5A 1SWWA 4HGRA 4XPZA 1RDFA 4ZEVA 5ALFA 4UM5A 1ZOLA 2ZOSA 4Y2JA 3ZW7A 5AIAA 3FVVA 5AM1A 3KZXA 1RKVA 4NV0A 3L8GA 1EK2A 2OM6A 5AKJA 5AHXA 2OA0A 3WKCA 1RMTA 1TJ4A 4YCNA 5AW0A 4HAIA 2HCFA 2IYEA 2C8KA 4YGYA 3ZWDA 2ODAA 5AKEA 1RLOA 1RMYA 3A1DA 2HHLA 4DCCA 4CE6A 1ZD5A 3ZVLA 2B82A 1U7OA 3QXGA 1VJRA 3QLEA 2BY4A 3BA6A 3KOOA 3L1VA 4QJBA 4ZEXA 1TA0A 1VJ5A 3W5CA 2I6XA 5AVSA 2PKEA 2FI1A 4MUMA 5AK4A 3ZWKA 3OCYA 5ALSA 2G1AA 4CNQA 5ALXA 3UM9A 1ZD4A 3A1EA 5ALKA 2HO4A 2FEAA 3WKAA 2NO4A 1QQ6A 3OPXA 4UAVA 2HI0A 5ALUA 4Y2RA 1YDFA 3ESQA 3NAMA 2FPWA 3U26A 3E58A 3FM9A 4O8CA 4ZEWA 4L6AA 4Y2TA 1XVIA 4HGPA 2ZBDA 1O08A 3N1UA 1L7MA 3PDWA 2I33A 2YMQA 5AK6A 2AGVA 1IWOA 2IOFA 1Z4MA 2WF6A 2EARA 5AICA 3U7EB 3AR3A 5ALWA 3EPRA 2QLTA 3CNHA 3OCXA 3WK5A 2OYCA 2WF8A 3L7YA 3PGVA 2WHEA 1ZD2P 4UM7A 4EX7A 3W5BA 3OTQA 3IB6A 1QH9A 2WFAA 5AW6A 5AKKA 2JGAA 2JAUA 4BEVA 2BDUA 2EATA 1WVIA 2B30A 1RQLA 2GFHA 4UMDA 3OCWA 5AVXA 2FPRA 2W11A 2C4NA 4UU1A 5AM5A 4AS3A 2YMMA 3AR5A 3ZUPA 5A3QA 3EWIA 5AM4A 2EAUA 3WGUA 2RB5A 3AR9A 5ALMA 3J7TA 2Q5EA 5ALLA 3I6BA 4NABA 5AI4A 4I9GA 3ESRA 3WKEA 2JARA 4EX6A 2CFTA 2P27A 4JDPA 4RESA 3VAYA 4BX2A 3ZTYA 2RARA 4C4SA 5IT4A 1N9KA 3A3YA 4BKMA 3N5KA 1CR6A 3MMZA 4OD0A 5AVVA 2WF5A 5AI8A 2MSNA 3R09A 4Y2YA 3U7GA 5AKZA 5ALJA 3WKDA 4C4TA 3FZQA 5AM3A 4UASA 1XPJA 2B1RA 5ALRA 3UMGA 3U7HB 1YMQA 2YFYA 4NFLA 4AP9A 3P96A 5ALZA 3I28A 1Z4IA 1WR8A 1Z4OA 1ZS9A 4EEKA 5AK3A 1Z5GA 2DQSA 1YV9A 3FGOA 3ZX4A 2JAWA 1L7OA 1YJ5A 3QU9A 3QUTA 3N07A 5IS2A 3PGLA 5AW9A 1T9ZA 3R4CA 5AW7A 3U19A 5ALEA 5ALTA 3DV9A 1YS9A 3MPOA 2GHTA 1RPZA 5AW2A 5AI9A 2RAVA 3I76A 2R8XA 1Z4JA 3D6JA 1RMQA 3SMVA 2P11A 1RC8A 5ALYA 4AS2A 4OCZA 5ALVA 2B8EA 3L8HA 3ET5A 3S6JA 2PR7A 1Z5UA 2CN1A 1AQ6A 5AKXA 3ZTWA 5AKHA 1U02A 5E0OA 3ZVNA 1RLTA 3SHQA 3IRUA 1LTQA 2AH5A 2WF9A 2AMYA 3W5DA 4Y2VA 5AM0A 3NASA 2GO7A 4Y2UA 2YY6A 4NWIA 3N28A 4L6CA 3WK8A 3AR6A 4BBJA 4F71A 2HX1A 1RKQA 4KNWA 2WF7A 3M1YA 3L0BA 5AKLA 4OFZA 3A1CA 4BNDB 5A3SA 4UMVA 3SF0A 3AR7A 2FUCA 5ALOA 2YN4A 4YH1A 3KC2A 2C8LA 1L8OA 2G09A 4H1WA 2QYHA 4FFDA 4JB3A 5AKIA 1VFPA 2YJ6A 4DW8A 1Y8AA 3QU7A 2GMWA 1T5TA 3NANA 2I55A 3WGVA 4DFDA 2ZG6A 3WK6A 3HYCA 4IFTA 2CFSA 3QX7A 3SKYA 5AW4A 3QUQA 1K1EA 4Y2PA 2HF2A 2NO5A 1NF2A 5AW5A 4EZEA 4G63A 1FEZA 4E88A 1Q91A 2I7DA 2FPUA 2I54A 1Z88A 2IOHA 5AW8A 1Z4QA 3ZX5A 5AVQA 3WKBA 1CQZA 1WZCA 4XQ0A 5AI0A 3U13A 2W43A 5AVZA 3FPBA 3QUBA 1SU4A 2C9MA 3NIWA 3SD7A 3E84A 2ZBGA 2ZXEA 4HGOA 2D2VA 2YJ4A 1YNSA 3L8EA 4Y3UA 4UMFA 4HGQA 4YCMA 1S8OA 3L5KA
chains in the Genus database with same CATH superfamily
5CVUA 1MA7A 1G17A 2KFNA 3HL4A 2AWNA 5JJIA 1WUHS 4RZ2A 3U31A 1RI5A 4I1YA 5BV7A 4P7FA 1XVAA 3MEQA 1T4GA 5DM4A 5TGTA 5A4JA 2ACKA 4JJ6A 4S04A 2BM8A 4BMOB 2QJTA 2RGYA 1MAVA 5A04A 1KFEB 3JCZA 1S02A 2BHRA 4LI0A 1NK0A 3CHYA 1JEEA 3IB3A 1O96A 5KI6A 5CNMA 1IXRC 3MD9A 3IBGA 3QVGA 2IYUA 1L4NA 2IUFA 3I45A 1V2HE 2ZT7A 1ULZA 3R3UA 2KMDA 4C4XA 3OHBA 1KIAA 3M4YA 4G5GA 3DFIA 1ZM2A 3GROA 3UWMA 5CGQB 2NU7B 4UTZA 1JIKA 2VPIA 3M6ZA 3FF4A 5EXEA 3NDJA 2FLVA 1VE3A 3A9UA 2PSHA 2G9NA 1LDMA 3A4YA 1DC3A 2CXOA 1VCNA 3HS3A 3VYTB 1Z18A 4HZIA 5H5JA 2HPVA 5HFAA 4N41A 5DEOA 4IXMA 1OX4B 2OPHA 3IHWA 2VJQA 3B52X 4WL0A 4BDSA 3NTQA 4LMPA 1A0PA 1NUPA 2Q6TA 3L3BA 1ZVMA 1M8FA 5FL7A 1NVEA 1QONA 3AJDA 1Z1VA 4W5QA 4Q0MA 5J0PA 3E7DA 1Z0SA 4OJLA 3RU9A 1C0EA 3L9XA 2AG0A 1BX3A 4UHBA 2C84A 5BW6B 2GN4A 3UJCA 2F67A 2GN8A 1U8YA 2WLTA 4Z86A 4G37A 4JV0A 1HDZA 1U5BB 4CE6A 1WCXA 3GJ0A 1GNVA 1OY1A 2QRPA 4L22A 1VPLA 3MJHA 3HJHA 1QO7A 3T9EA 3UMRA 3FETA 3RBXA 5CVDA 4IHJA 5GP1A 4K6OA 1BPYA 5JMWA 5JRZA 4Z9XA 3TEMA 5J0XA 3E5NA 4B8WA 3HCBA 2VDPB 1CZKA 3P2EA 1HTBA 1FLNA 3KXKA 3PDWA 2CE2X 3M49A 4JK3A 3RTAA 2DJ5A 3MTEA 3NTLA 3QIVA 4JMPA 1CT9A 1XYVA 2RDMA 1ZICA 4M98A 3OC6A 5CTAA 1FRQA 4YAIA 4KPUB 4Q3KA 4BVHA 2X3YA 1UBGA 1Z5OA 4MV9A 1JG4A 4WZAB 3HU1A 4JBXA 2GAIA 4YB8A 3WGUA 3K4HA 2FFRA 4G5OA 1FUUA 2VRBA 2DUJA 1UADA 1ZUD1 1WCYA 1SKUA 1G9SA 2I22A 4XM2A 4HFRA 1J90A 2W04A 5AI8A 5JVDB 4BLRA 2XVTA 5E6SB 4I1VA 5DCYA 1KU0A 3NMUF 4NU0A 3U7HB 5HIJA 4UTXA 3EGXA 3LOPA 4XTRA 4B45A 2VUSA 4CR8A 2JFHA 2QAJA 2HU8A 4MPRA 1C4OA 5D5PA 4JI3B 2OXTA 2VDNB 3AEXA 1U0OC 2R8RA 2M6KA 3OZFA 1TQ4A 2DUYA 5K8LA 1OGJA 2CVFA 1SHTX 3IRUA 2DT8A 3AJRA 3BREA 4F4WA 4LJAA 3EJ6A 4X20A 1ZIXA 2BHLA 3VSAA 5CXQA 1MJNA 4MI3A 4PYOA 3GHYA 1CTQA 2IHNA 2QTMA 4JQCA 3ODPA 4TS3A 2BSQA 4V0QA 3K9BA 2CMFA 2GCOA 3FCEA 3RANA 621PA 1JA0A 1AUPA 1K1EA 2IEBA 4FHFA 2QKQA 1V16A 3I61A 4YRAA 1KJYA 1JIXA 3AHGA 4ZPJA 2BZSA 1G6KA 1PX0A 1TYBE 3NIGB 1YNSA 4LC1A 3GEGA 1CEXA 4DWIA 3VCBA 1UFQA 2YMPA 5L3RA 2QVBA 4LOJA 1BDIA 2JGDA 4MO9A 4E2YA 4WLEA 3GGDA 2Y71A 4FYMA 2UYCA 1Y1RA 4ZAZA 3WMRA 1PR1A 2QG9A 3JQRA 3UWKA 4M1OA 3KFXA 2F9FA 2AR0A 5HZKA 3P26A 3Q2OA 1F5SA 1CUDA 2Q62A 4UNRA 4YJFA 1NY5A 3PC7A 1ZRMA 3A58B 4MVJI 2G36A 1IQRA 1XSLA 4J91A 4UD2A 4GBGA 3ZIDA 1U2DA 1KK0A 2EZ8A 4L9SA 5DULA 3I37X 1MBZA 4C7JA 3RRYA 1S2OA 3V6HA 5BWNA 3A9CA 5K3CA 3AFHA 4IXWA 1JSCA 4QLOA 3UAZA 4MINA 3BE8A 4CMCA 2HJHA 1JAHA 1UAAA 3BK7A 1Z4KA 1OQAA 4JMLA 2C9DA 2ZAYA 1KMCA 1DZIA 4UEJA 4DYHA 3TB6A 3KDAA 1UK7A 3G0DA 1UXIA 6REQB 4QBIA 4KB5A 2YW9A 1ZISA 2C95A 5EYPB 2D2IA 5CG1A 4P3NA 1CY0A 3HB7A 2FEPA 4CKCB 4W5RA 3R4VA 3VH4A 2D13A 1RWVA 2WICA 5CDFE 1P2VA 4JLKA 1LW7A 4CCAA 1QFSA 4CV1A 1GTRA 3SYTA 3MJEA 3OH8A 4BCDA 3HKEA 5L1JA 3DOJA 3IKLA 4WDRA 1C3EA 2WIFA 5C3MA 3PS9A 5CAEB 4R51A 4KJXA 2XTNA 1EKXA 4H7JA 4QIWF 1PJAA 1NMYA 2O2SA 1HX7A 1V35A 3DCIA 5KJCA 2AFIE 1NATA 1VI5A 1WMBA 5MN6A 1QC5B 2E6KA 4IXDA 4JASB 2OQIA 1OD6A 2MSDB 4TM8A 3WRYA 3EFHA 2WJHA 3A32A 3BXHA 4MQFA 2HTFA 5DVZA 4C7ZA 2V6FA 4OXQA 3NR2A 3PZPA 1TTHA 1XXHE 1RRFA 1ECCA 4NR0A 1ANKA 2P9YA 4DG9A 5JSFA 4LWQA 1JHUA 1Y48E 1XRLA 2CYBA 3BWBA 3LU1A 3ROZA 1PL6A 4ZAVA 4KLQA 4OKSA 5J1SB 1GPH1 2ZAMA 1NRJB 4Q8EA 4IDNA 4IKPA 3HCNA 3OJLA 2QGZA 4UNIA 2W2NA 3O1LA 2W6OA 4JL5A 5CXXA 4ZXPA 4U6NA 1HZZC 4JBWA 2QE7A 3N2KB 4H7PA 2EAMA 2C7GA 5E8JA 2EEPA 2I1WA 1DT3A 4IDFA 3N6XA 1J2JA 5F3RA 3U56A 1NYRA 5JS7A 1L3UA 3N2YA 2HQSA 4YMSA 4ZYVA 1WW3A 1Q95A 3JD3A 4KODA 4OLFA 3WJ1A 4BQQA 1PZFA 5KYUA 1R5BA 1VMDA 3EMBA 1EHYA 1Z82A 1K6JA 1QSGA 3ZIAA 4QUJA 5DRYA 1NYQA 1A95A 4IPTA 1R4NA 1DPFA 4HDSB 1MC8A 5IS2A 2FXVA 3T3NA 1K8YB 1AX9A 4Z7JA 2GTPA 1EK5A 1H0KA 4C30A 2K4MA 4ZCPA 4G23A 1PUIA 2QJFA 5MDHA 1JPVA 2ZKLA 3VI3B 3OICA 4KLUA 3G7UA 1QHSA 1UXJA 2OFFA 4W7SA 4YAJA 2DY1A 4X6XA 2V9ZA 3PFBA 2ZETA 1VE9A 3BN3A 3HB5X 4HO1X 4M9RA 1MAUA 1R9NA 1E8DA 4J4BA 1YVUA 1ZI9A 4RQBA 4FMDB 4UXHA 3UWSA 3VTFA 4B2IA 1NLUA 2ZM6B 3JYPA 2PKCA 4HBZA 5DN6A 2K8AA 4W4TA 4HXYA 3I34X 4F5WA 1OI4A 1T4CA 4HRAA 2CNBA 1I4TD 3FC4A 3WB0A 3KHSA 5H82A 2CXHA 2W90A 1GXSB 5GIPE 1KMHB 1Z47A 3R6WA 1A98A 3AF3A 4IIJB 3L82B 1YDHA 5BUCA 2QENA 3GK3A 2R2GA 4CN9A 2P6OA 5LWHA 1Y9DA 4QGBA 2HRQA 3CEHA 1H9AA 4JD5A 4WPGA 4G5SA 1YI8A 1A3CA 1PL8A 4DDUA 4DCOA 4YXJA 5K1ZA 2VC2B 4DQXA 1GRQA 2R5WA 4RVHA 4ED9A 3ZE0B 1CUFA 2AUTA 2BKAA 2F9LA 4KXVA 3IKJA 2F2TA 2D62A 1U3WA 4EJSB 1YKFA 2HA5A 2R6R1 1Q8KA 2C88A 5L40A 3VISA 3H2SA 2R1VA 4LYJA 5TE9A 1MB4A 4A8JB 1YIOA 1C1XB 1SAYA 5CA0B 2P91A 2DERA 2EJWA 3TIIA 3PYMA 1QMPA 4HNRA 4HAOA 4FW9A 1E61A 1LWNA 3EG9A 1C1DB 1NDUA 4P33A 1AZWA 3BUSA 1QB8A 1E0DA 4CL2A 1S89A 4D9GA 3K8QA 1NU8A 4EYOA 4P31A 4PC3A 5EJFA 1UFRA 3LXXA 5HPYB 4BECA 2MU1A 1JSXA 3L7AA 1QQ7A 4JZKA 1YZLA 3W5AA 4ECZA 3RYFA 2VA9A 4X8MA 4H7FA 3K70B 3KQKA 2EERA 3CF4G 1IY0A 4U7PB 5KC9A 5K6RA 2XTZA 3NBFA 2ZIVA 2B3TA 3SAFA 5HR5A 2ZXHA 5ADHA 4LAFA 1Z6GA 3UGQA 1J1IA 3EA4A 2A9JA 5AD1A 1OXSC 4BVKA 3Q15C 4MYSA 3K32A 3O73A 4P22A 3VR2D 3QG5A 5I4KA 3IELA 5LN1A 4K87A 5IAAA 2XRMA 3TSAA 3M81A 1ECPA 4UBMA 4DT1A 4CLDA 2WAQF 4J75A 3RC7A 2ZI9A 2ZSJA 2H9IA 2CZQA 4AJ9A 4L2IA 4CRWB 3M6VA 4ME6A 1PUZA 1UZNA 1O94C 1WOMA 1GRNA 3WO0A 2AGPA 4U7TB 2DHDA 3I5XA 5FDFA 1PO7A 3T95A 1TZBA 4MWZA 3RNOA 2C07A 4JJIA 4CJXA 4CTNA 2YFHA 5LMUB 3HH8A 1L7MA 2OXEA 1EVZA 1RLUA 4EPYA 5E7JA 3E4DA 5AICA 3PSHA 4EDHA 1XDWA 5B36A 3F4BA 1LQ2A 3NUZA 2L17A 2HA4A 4DF8A 4MLDA 5KTTA 1PYOA 3QVTA 4X8LA 2CLSA 2E7ZA 1PQWA 3UY4A 3FWPA 2EAUA 4P92A 3D59A 5DLEA 2GB4A 5E7MA 3MW8A 3BJYA 3LX5A 1CR0A 3TW8A 5LB4A 3A1WA 3AZOA 4W8HA 1I2ZA 2CVHA 4P38A 4YP5A 1NQVA 2O8EB 4YRIA 4NZMA 1GV0A 3QXXA 1QTIA 2PHZA 5KU7A 4LX8A 4DWJA 3ECAA 2H92A 1NJWA 3CNBA 3TECE 3UV7A 1WSBA 1XHFA 2XMPA 1KK3A 3FNFA 1GG5A 2C04A 5FO1A 5HKKA 1JQDA 1WWVA 3CNEA 2C7PA 3SHQA 3ESZA 2AH5A 3V6LA 4MEAA 5JQGF 3FWKA 2ASEA 3QPUA 1NZPA 1UPFA 1MJHA 3T3PB 5FNVF 4RXTA 3M1YA 1T8RA 4E5UA 3PIRA 1TM2A 2RCNA 3NIDB 4LDJA 5K0FA 3KKEA 3RSOA 2WT9A 4KO2S 3GLHA 4OJTA 4DDHA 4EYKA 1XZ8A 4IX9A 5BYJA 1U3UA 4DJ5X 5JYEA 4WFIA 2EBFX 8ADHA 1JMVA 4GC6A 5DBCA 4HLUC 2WVHA 3JALA 1WCLA 1C3JA 1LDNA 1XD9A 3VBCA 4YLGA 4ZT4A 4KQHA 2VYQA 4UMFA 1YASA 1N1DA 4YJ3A 3O3MB 4BN0A 1WBBA 3V9PA 2ECPA 4RZSA 4N39A 1RWPA 1O57A 2OSVA 4TLBA 3NKVA 2D74A 5G0WA 4PYNA 5JROA 1UP7A 5A0FA 1W46A 4AKHA 1O6GA 1PJ3A 1NJ8A 5FLEX 3OCZA 4YP1A 4IIGA 1XP5A 4R1OA 1U1IA 5LU8A 2XNSA 1R27A 3RRXA 3I04M 1IV8A 1FSZA 4DLAA 1M67A 1XO0A 1NQXA 3SQLA 3BSYA 2A57A 2P30A 1W35A 3GIWA 4LF7B 4FO6A 4MQ6A 2AXQA 2W70A 3GRYA 5IBPA 4C0SA 4EKEA 4DLWA 1Z9BA 5KINB 5LOVB 5FTKA 4XEHA 3HRIA 2COUA 4IY1A 1LPNA 4B9UA 4BJ3A 4EPVA 3IODA 4O59O 4FYPA 1OFGA 1GL7A 2OESA 3GZJA 5I9NA 4ZT5A 4ZI2A 3HUEA 2I34A 1PVOA 4P86A 3PUKA 4YAUA 2BSAA 5J2DA 4KZKA 1FJXA 2ZI6A 4H3HB 2C2BA 5CM8B 2Y68A 2PK3A 2ZSEA 3FFAA 1GL6A 3SXPA 3FJ1A 5T14A 4OU5A 2BFNA 1U0SY 1J0DA 4GMDA 1JG3A 3THYB 3IRVA 1DIBA 5KYYA 1FTWA 4YAWA 4UZEA 1MT3A 1XLUA 3Q87B 1U2SA 5KREA 3I09A 2D1RA 2YICA 4Q9HA 3WB2A 1K98A 5CNKA 1LEHA 2H7CA 3B1VA 4W9MC 1GNQA 4KAAA 5K5EA 4F3OA 1DJNA 4N0EA 2VBCA 3ME5A 3VO1A 5EXDA 1KH3A 1VJRA 2IZ6A 3TS1A 5H3LA 3L1VA 1VJ5A 2M98A 1W88A 2NO4A 5ALUA 1GSAA 2E37A 3UC5A 5ARBA 2H5IA 4OO3A 3DBOB 3TR5A 1AN9A 1CBUA 1JIUA 4CMAA 2AZXA 4HDMB 1WXFA 4ETIA 4F12A 1NC3A 4C3UA 4J9PA 3ZCPA 4ZTZB 4C0XA 1BVRA 2OP0A 3ES9A 2AYYA 3B9PA 1LA2A 2YWCA 3OMWA 3GRUA 5A3QA 4MICA 2LP4Y 3CLUC 4YLEA 4N12A 3VTAA 1M1NB 5AVVA 5DH9A 4RQ0A 4GOXA 4R6XA 1I32A 4E09A 3MGCA 3CBGA 2VDWB 2IRWA 2ZJ8A 4C8NA 2C82A 4ENPA 2YV4A 4R1TA 2WYOA 2XA1A 5FOWA 3OHAA 1SPXA 3N2NA 4MTLA 3ZX4A 2E5LB 1JAZA 2VKTA 1E2KA 2IZZA 4KU4A 4HNUA 4R2JA 1W59A 4IGEA 4F5PA 4XSGA 2I1QA 4F9TA 4UVDA 5FOSA 1G38A 4V0KA 2YXEA 2J7PD 1C7EA 4Z9BA 2I29A 4MW6A 2JLXA 3T1QA 2D5IA 3I04A 1DC5A 3Q3GE 4KMOA 4D4MA 1W5EA 4CU5A 3N28A 4IQFA 5A3VA 3FUVA 5GZ6A 4Q9AA 4F6CA 4MF2A 1DXYA 1SHLA 4C07A 1PR3A 5E4TA 2NZYA 3NANA 4CL8A 2KJ8A 1SEVA 4RXUA 1DK3A 4PF1A 2V6IA 3ST7A 5I47A 3DMHA 2O5RA 3SS7X 1CLUA 3AM5A 2FWJA 5ARDA 1RLIA 2VNHA 1SXIA 2G88A 5DISB 2O0LA 4BP1A 3GPBA 2R8KA 4NE7A 3EB9A 5LP6A 1G7SA 2OHFA 2NSLA 5B4TA 2YJNA 3E2EA 2ORIA 1S2MA 1PL0A 4EARA 1MF7A 2Q0XA 1EP3B 5CB4B 2PX5A 3WI7A 5HKBA 2F3TA 5FHRA 5B3AA 3FDSA 1MFZA 3VNUA 1FDWA 4QQ8A 1VRWA 1I7QB 3FNBA 1XF9A 2HOFA 3RVKA 4COOA 5K8JB 3Q1KA 4YRJA 4O2RA 1T7PA 4UE6A 4U1RA 3ZW9A 1KZ4A 1G5IA 2GNAA 4ZVMA 4BNKA 1UQTA 1NAIA 5KPDA 3V5NA 2JLCA 3V55A 2EJCA 3W8RA 3PE6A 4MR9A 1UBEA 4NULA 3FTEA 3O92A 2IODA 1X14A 2LGJA 3ED5A 4EHBA 4Y2SA 5JTIA 2C2ZA 1AQNA 3HYSA 5KNBH 3NHKA 2P9GA 3ZCTA 4YEDA 4F84A 4N0QA 1EDDA 5A6SB 4DIUA 1EE2A 2RHMA 1OI2A 4KQ9A 4NZ9A 4J4HA 1VM6A 2J6IA 3GEBA 3T4PA 4D0RA 2C7QA 3U3OA 1D8BA 3COVA 5IKXA 4IQVA 2E8MA 1UPUA 1NJ5A 3LF2A 3M6UA 5GV8A 3PE4A 2V96A 2KWIA 1ZN8A 1U2DC 7ICVA 2VHYA 3JQ7B 1F2UB 2QT9A 3CP8A 2O6HA 1ST2A 2VQDA 2DJIA 1YS4A 2MR6A 5FOVA 4RQ1A 2FCAA 1KE2A 1YRQA 4F2RA 1KY2A 4L4ZA 3B0XA 4CG0A 4CW7A 3QSGA 4RVDA 4Y2JA 3FZEA 1VYTA 3C6XA 2QVGA 3G6VA 4OLAA 3C3WA 1ZQDA 3S29A 3ICEA 1AQJA 5DSZA 2X58A 9ICJA 3ETNA 4CMIB 3PFGA 1G8GA 5I4IA 1XTZA 3CEJA 3WDKA 3U16A 1U7OA 3IULA 1K6MA 2ZR7A 4MUMA 4H16A 3KCNA 2HCTA 2NO7A 4K4HA 2IGBA 3UXNA 2PU5A 1KNXA 3DMGA 1A2OA 5DM60 3KTDA 3O8DA 3WWEA 5KVAA 3U3DA 3TJRA 2JEGA 1U9CA 2GUWA 1ZOIA 3JQGB 3G2NA 3ANLA 5LQKA 3HK2A 4H27A 3ZH2A 4JLDA 5CEEA 5EIWA 4EY7A 1J2RA 2OBYA 3BZWA 2I3ZA 3V7WA 4ALMA 2QTWB 5ELMA 3OPYB 1KZYC 1L8XA 4MQ4A 4H1TA 1YZ3A 4KQKA 3DPUA 4HB2A 5JASA 4C4SA 2MSCB 1AUQA 4DL9A 4TYYA 3G0CA 4ED2A 2XIJA 1ZN9A 4RE5A 5FI5A 5DF1A 3W7AA 4UQGA 4BFCA 4NYJQ 3RBEA 5I9IA 2V6GA 1JN3A 1I5RA 4DGSA 5K03A 2KBEA 2GVDC 4L28A 3OF3A 3F2DA 5DXFA 4EGAA 4KC0A 4M53A 3RCBA 1R74A 3SMVA 3A2LA 2JLQA 2SKDA 2QXTA 4F3KA 2A0XA 3TUJC 4R8LA 4X71A 5HRCA 1Q2XA 2FWAA 5EJ8A 5D01A 1E60A 4EBEA 4HQKA 2IU3A 4NTZA 4NJMB 4OYLA 1QKJA 2R47A 2ZYDA 4W5HA 5LR6A 4XVCA 3BQ0A 4XWWA 2P6PA 1X8JA 4LOIA 1VA5A 1OH8A 4YH1A 3S2SA 4UJ5A 1IN4A 4FFDA 4HEQA 2H3VA 4QZEA 3IAS1 2PSJA 1PUXA 3DZGA 3A2MA 3ANNA 1H0SA 3CRZA 1SU8A 3I5AA 2P3LA 4FKZA 2VPZA 2FCRA 1QG0A 2KOBA 3U62A 8ICXA 3DAGA 3W5HA 2PS3A 1U3TA 2HY7A 1WDKA 4FFVA 3OT1B 4CTMA 3C70A 1V6AA 4AZ3B 4JGBA 5EL0A 2JFFA 2C7RA 2ZVJA 5AM2A 1R10A 2F00A 2PMBA 3DNMA 3R5FA 2YVLA 3ZDRA 2AMVA 2IPAB 2B8JA 2Y67A 5ALGA 2FSPA 3UK7A 1QH8A 3G68A 2R96A 1FF9A 2HEIA 3SY8A 3LXRA 2UV8A 3N75A 1L5RA 4PG7A 1U3FA 3NXSA 2X0RA 1Z5NA 1KOLA 1OX6A 4DMKA 5KS2A 4IVQA 3Q3HA 2K4EA 2FKAA 3DVRX 1TXGA 4N5IX 3PD0A 4HZUB 3B9BA 4MP6A 3GLHE 4ER5A 3RBAA 3DTVB 4IICA 1JTEA 1E6WA 2G5HB 1PZXA 1CY4A 3OEWA 1NNUA 3HUDA 3DBLB 2O59A 2BDEA 2R7KA 2H1LA 4DPMA 1VG1A 3DZJA 2P41A 3HP4A 3G02A 4C0ZA 8ICKA 3H0EA 3MJTA 4YCSA 3R5TA 4MCIA 3AV0B 3WO1A 3WLAA 3IVRA 5F7OA 3A6KA 2BEWA 1P44A 1HK7A 3KVOA 2ZATA 2E18A 1KDOA 1L5UA 3LPMA 4OK6A 1P77A 3MOGA 3IJ5A 3HWWA 4TV8F 3WQBA 3RHTA 2ATEA 1T4DA 1XD2A 5H0IA 2RK6A 2WMYA 4LE0A 4PIPA 1Z0DA 1QRDA 2QTVB 1UKAA 2AMJA 2QTAA 1IHYA 4Z9AA 1OJ7A 4HUQB 2P75A 3FRIA 3CX7A 2JGFA 2AXEA 5LZ4A 2WPDD 3G6XA 2XAAA 5ALFA 2WPNA 4HWRA 2JHPA 5AJVB 1F8UA 1PAUA 3ZBTA 2A4KA 4IJ5A 4L78A 4NV3A 4M7PA 4B73A 1X13A 3N59A 4PM4A 4CHGA 3C3YA 3M34A 4KRFA 2FW8A 1NVKA 2Z1NA 1M1YE 2PWAA 1TEZA 1A69A 1DJOA 4ONEA 3CZRA 5EE5B 2W3SA 1JEYA 3OFVA 3S55A 4YHHB 1OV4A 4O02B 4ZQGA 3NRCA 2YRFA 4C6RA 3G6KA 3RWBA 1CKEA 2EIHA 3D2BA 3PMLA 1KYQA 3G2QA 3SC3A 2VF7A 2AN9A 4LPSA 4BZZA 4NM2A 3NFRA 2QB1A 2XKAA 1J1ZA 1L4KA 1I24A 5JYDA 1JQJC 3JWPA 3CLVA 1CJTC 2F59A 1UJ4A 3TNFA 3K9HA 3LYSA 1E1RD 4HRYA 5JH7F 1N5JA 3BFVA 2FPRA 2AC7A 1YFZA 2O1WA 1HT0A 4Q1EA 4S1TA 3RB6A 1Z6ZA 1L7QA 4YJ2B 3CVUA 3BJRA 5IXJA 4DFMA 4FOPA 7MHTA 5LBIA 4AO8A 4OQYA 2P6RA 5DLGA 1CJMA 2AB0A 2NT4A 3ZVKA 3F3MA 3ZGVA 1DQNA 4FS8A 2ZTDA 2LD4A 5EHQA 1PZGA 4RCYA 4EEKA 1UK6A 3IL2A 2Z3ZA 1Z5GA 4DCJA 5CDFA 5BSHA 3H6HA 4X65B 5E0KB 2BJWA 2ISCA 1NMXA 4CCSA 1YFJA 1FFBA 4L3OA 3FFWA 4MV4A 3EWSA 3GG2A 1E6KA 1W76A 5LXTB 4UBCA 4HYKA 3PW0A 4OXIA 3SR3A 3ALRA 2QRLA 2FXIA 1DWOA 2JJQA 3JPSA 2FRXA 4GQAA 1V8ZA 3NASA 2VP2A 1NZBA 4P0QB 1H4TA 5BT8A 5KHOC 1GZ4A 1KEKA 2AFIA 4DS4A 2HSDA 1M34E 2ILVA 2I2AA 2WSMA 1SHKA 4WN9A 1E32A 1IHXA 3LLUA 3GY0A 2WAYA 1OV6A 3FPJA 5BWOA 2KLHA 1A71A 1XXHA 2BCQA 3EXHA 1IM4A 1SXJE 4V2IA 2W43A 2GZ1A 2YHIA 2JFGA 2QEQA 2AJ8A 1I10A 3TRDA 3ETEA 2BFOA 2B1IA 2K87A 2C2OA 5KCMA 3N97B 2JXJA 2G0AA 1DC7A 1DC4A 2DWPA 5B7GA 1KL9A 1LDGA 4FQ7A 4AJ1A 1KJ9A 3QPAA 3UAXA 1PJ4A 2Q6LA 3NUQA 1OIWA 3AUUA 4YP7A 3TRJA 2W7OA 2WWIA 3P2JA 3CH6A 4WTOA 2VBGA 3NETA 2GJ4A 4FUQA 4NAHA 1JLHA 3V7UA 1JF8A 3T5LA 4L3WA 4A8PA 3FPGA 1YF3A 1S6YA 4FHEA 4JBNA 2Q8NA 1CSEE 1V9SA 3SDSA 2NAPA 3ZHYA 3MCZA 2OCEA 4IQ8A 5HM8A 5FB3A 5JNWA 1EEHA 2PY6A 1OUQA 1QRRA 1L7BA 1DRJA 3EGOA 1CB7A 2R4QA 3GEPA 1CE8A 2HLPA 1WTCA 4PYKA 4YI3A 5IIKA 3PCTA 4YCDA 3TKLA 1AH2A 1VJCA 5BN4B 1DO0A 1ZW1A 4JL8A 4ENWA 1ZQMA 3BIOA 5FAKA 4ZCSA 4Y6GB 1NVVQ 5IVDA 3M2TA 4B83A 1QLNA 2QMZA 1U7DA 2BTEA 2J0UA 4AUKA 1HOTA 4X66B 3DAHA 1GD1O 3CURA 2WQ6A 1W19A 1NHGA 4ZI3A 1IHPA 2BFCB 2EG9A 4K0KB 4ZOEA 3TADA 4Z54A 3WE7A 5AIAA 1DBPA 4YR7A 1WL8A 5EWLA 2LE0A 2YW2A 3MMNA 4HPXB 2JIBA 1WQ1R 4R7TA 3ZHQA 2JLZA 5J4HA 4F4JA 3QPVA 1Q1AA 3AM4A 1CJBA 4RV4A 3QX3A 2BMVA 1IXSB 1A76A 4KQFA 1T35A 4URFA 3FHCB 4WBNA 1ATZA 4MUHA 2VPQA 2GETA 3QV2A 4DF3A 1W34A 2AJTA 3NWJA 2QORA 4EVQA 4M7RA 5HIIA 4JI0B 2XNKA 1P1KA 3TFQA 3FNQA 2JK0A 3P19A 4C89A 2PT9A 4S35A 2W6JD 1SCUB 4WXEA 1JQ3A 1QGED 4LYGA 1GCOA 2JDID 2VJPA 4WV3A 4BMVA 4RYDA 2X8BA 3FDZA 1N6IA 1EK0A 5E1DA 5DTQA 1LKZA 2IYXA 3V8QA 2ZRHA 1ZQYA 3G2LA 3GFRA 1K7CA 2WF5A 1GZSA 1ZJ4A 1OWLA 1B43A 3WBBA 2FQQA 3MYRA 2Y2VA 2IF0A 1VBNA 3OQJA 4C22A 1P60A 4OV6B 3LX6A 5BWLA 1X94A 4E15A 3AU2A 1ZJ5A 1DE0A 2EDUA 3T0FA 4IJMA 3LT5A 3LH5A 4RF5A 1NX9A 5AI9A 2BGGA 4CPDA 2XMDA 2V1XA 4KMSA 4HNTA 5EESA 5KT4A 4KK4A 1P5ZB 3H84A 1P8JA 4FSXA 1UMBB 3OURA 4N3GA 3STYA 2OMEA 3Q88A 4D4JA 3JVVA 1G5RA 2V54A 2B69A 2E6UX 4OM8A 1IIRA 1X7YA 5D6NA 2M1ZA 3BD8A 4GU5A 3P4XA 2C77A 1BWSA 2AK3A 3QKWA 4NLZA 2H57A 3O6VA 3RU2A 4WESB 5L3QA 3ZBPA 4BO4A 4CDRA 4QO8A 1DRGA 1I3OA 3DBIA 4O1HA 5EC8A 4LQ4A 2AQ4A 4LEIA 2WTFA 1Y5NA 2WU0A 3HEAA 2Z4RA 3AI2A 2VYVD 2QDXA 4MI1A 3BQ2A 1MGOA 5KFPA 2FZWA 3P0JA 4JX9A 3F9RA 5J23A 3EHEA 4R1QA 2R18A 4XASA 3CH5A 1T9AA 1H3FA 3WGKA 2YV2A 2AHOA 1OUMA 4X9XA 1DKLA 4WOJA 1ADCA 2VJ5A 1SZCA 1CUCA 1IRIA 1RXVA 2DUMA 1KEPA 2OC4A 4BXOB 4E2WA 1DGQA 2HRRA 2WMDA 2FPGA 2GDJA 4WXYB 4HX2A 2KLBA 1O7JA 4KLAA 2GPYA 3PRYA 3E22A 5FP0A 2ZROA 3M6IA 2JW5A 4DA6A 4GOLD 5K01A 3P0RA 4HBGA 3KR2A 4F5YA 1KBUA 4Z49A 2I4RA 1QIIA 4ZT3A 1KZ1A 4E30A 3F2CA 1Q7RA 3SC2B 3PB3A 1E89A 3M0EA 5AJHA 4Q93A 4D98A 2OGZA 1H5NA 1JMKC 5IYZF 3X2FA 3URMA 4XLZA 4US9A 5DM70 2FHSA 2AN1A 1TJ5A 3NT5A 4R9UC 4Z7QB 3SQXA 2YN0A 2AF3C 4HT3B 1JKMA 2R00A 2QXUA 3HRKA 2YJ3A 3U3RA 3AHHA 1YQQA 2H1HA 1AMOA 2RB4A 3LHIA 4P9NA 4NLCA 1PV4A 4TYPA 2R1UA 1T8WA 5HJEA 2BM1A 1ULUA 3AZQA 2JRLA 2A5GA 4RJ2A 1EBFA 1OC2A 2BSXA 4V0NA 3I2YX 1NYLA 3KPVA 1KL7A 2OEHA 2LRHA 3CV3A 1NP6A 2ZT5A 5DB4A 4I2EA 4NIMA 4GQIA 2FX5A 3B6KA 4HWTA 4TLAA 1AIPA 4RM2A 4YAFA 5JCZA 3O26A 3SFVA 1RRPA 4JP8A 1HO3A 3BGIA 4RPXA 3LYLA 1P7CA 4P4LA 3EUWA 4AP5A 4G5HA 3AI3A 2C4TA 4KGXA 1ZFNA 1G7RA 3K9CA 3QBVA 2BISA 3ZNOA 3GWZA 3NP7A 4CLEA 1FVHA 2BJHA 1TCVA 3RJTA 3LOQA 4CFYA 5JCJA 4ILKA 2WFLA 2FPWA 1HI9A 4A36A 4L0QA 4MAMA 1QVAA 4I0WB 2NU6B 1U9LA 4F5QA 3KE9A 2IOFA 3ITDA 4F91B 5ALWA 5KWSA 1XVLA 2FMQA 3W79A 3IFSA 5JD3A 3EFEA 4GD3Q 4J6FA 4M0KA 4GP9A 1SHZA 2PKQP 4FSHA 1R5OA 4UMDA 5D3ZA 2C4NA 2O3RA 2J5XA 1G4AE 4E5YA 2VCHA 2A5FA 4B17A 4TUSA 4MUFA 4KLIA 2ZIXA 2UVPA 3JD2A 2IEIA 3S44A 4KIJA 4LUCA 4O4IF 4AMBA 3C2QA 3KYDA 5E7IA 1MC1A 4OMDA 1ZW6A 4CV2A 4NCHA 4AP9A 1AKYA 3L2OB 2L5YA 3MCUA 3UHOA 3ZZ1A 3Q9UA 4F3NA 3AQEA 1PLJA 5F3WB 2VWQA 4DLKA 4PSCA 5L6MB 4EY6A 2IEZA 4ZI7A 2H48A 2ZSBA 3LGSA 2BC9A 2O57A 4NP6A 1GEGA 3GGJA 2FN7A 1TYAE 4PLVA 4Z0HO 1AV6A 4LSGA 3ONEA 3UJAA 2HIGA 1X86B 3A10A 4PICA 2PJRA 4CCHA 1TVKB 2JRCA 1E9SA 2GCPA 4M46A 1Q17A 3ZY5A 1WCIB 1CDOA 4AMVA 5BNIA 4TROA 2FEMA 1PR6A 4BNTA 2YYAA 1PG2A 3PKZA 4L8WB 1WF6A 1FDTA 1RZUA 4Y7CA 2WHPB 4Q1AA 4BFLA 4H4EA 3SXJA 3AEYA 5TS2A 1GGMA 1C3OA 1G41A 4BQOA 1CR1A 4J8PA 3QFRA 2DPLA 3JQFA 2O3QA 4XGQA 3E9CA 3H8WA 4FEGA 3EC1A 4EHIA 4YHBA 1FEZA 1L4FA 5F2EA 1V1MA 3ZGXA 2NRWA 1BH2A 1SBHA 4QVKA 1N77A 4QJ4A 1YJQA 5JAZA 1U1DA 2O3SA 2SCUA 2AQ0A 5EJAA 2XO7A 2Q8PA 4DMCA 4RJJA 3PPWA 3UQZA 1F4VA 4RAQA 5IAEA 3ZY3A 2FG7C 4OQEA 1BKSB 4MRNA 5IIJA 5F1KA 5BY2A 3EN0A 3EGVA 3PGJA 4FM9A 3FD8A 2D1QA 4CI9A 1P3DA 1SPBS 2NUTB 2GZAA 1POWA 1U11A 3KPYA 4DNFA 2W9MA 1J00A 3KCQA 4QYTA 4C20A 2HL6A 4OJ6A 4QUHA 3JRXA 4PAOA 1EU1A 3WAJA 4QZIA 1XJQA 2B1QA 1B14A 3PI7A 3DT6A 1SKSA 3TTXA 3DKKA 1B1CA 5DI3B 3HM2A 3CUSA 5BN1A 1DXSA 3UH0A 4O4JA 1RXIA 2ZTMA 5KFSA 5MHTA 1COOA 1KOJA 2VSNA 4E5NA 1SD1A 1T3ZA 3PRKE 5LKAA 5BPFA 4US0R 4YO7A 4RKEA 1YK0A 4QTTB 2AV6A 3BMQB 3CZAA 5BV8A 4LKRA 1N0VC 1XMXA 2CY0A 2E4XA 1Q14A 3PSFA 1I4LD 1TTPB 4QDJA 4CG2A 1Y8QA 4NY8A 5TMBA 1UMDB 5LFAA 2MMCA 3GEEA 4JC5A 2ZJBA 2OBBA 4FONA 2UVQA 1XEWY 4KVFA 3PFFA 3S7ZA 3AKYA 4XQGA 3R24A 2W00A 1H3EA 5DP2A 221PA 2EKBA 3VNAA 2UXDB 3RR2A 1XTBA 4JSYA 4KTQA 1GCGA 1KN5A 4DC1A 3EXAA 4PAMA 1IMJA 1DLIA 2IYEA 4FIZA 2QVZX 4DQUA 2JVIA 4P4UA 4RQ7A 3L7BA 4KACA 4ZGGA 3JQ9A 3MRXA 3I5MA 2FGJA 2ZJ6A 3UFBA 1W0KA 4H7EA 4BMXA 4YDSA 1P81A 1SVMA 3R5KA 4ZH4A 5CR9A 3OVMA 3M7DA 1J9EA 1O08A 2YDXA 4O2AA 1A9PA 4EB6B 2SBTA 4FW8A 3FAZA 3FLMA 2B94A 2FSUA 1N2XA 1BRTA 4P3XA 3WJAA 1IB0A 1H38A 1K8XB 3SZMA 1BFUA 4ELTA 3EUB2 3RUEA 1YVPA 5LLSA 3CB4A 1HZJA 3ZDEA 1Z7YA 3R0XA 3O4VA 2BDUA 2R1TB 2NU9A 5GMOA 4WJZA 4ZZ3A 2O54A 3ENKA 2V0NA 4QWEA 4Y6QA 5AOAA 4MYUA 3RUAA 2WA2A 4KCGA 2GKOA 4LGCA 4GMHA 4KLRA 1X70A 2D5AA 4ROTA 2J67A 4TWAA 1TYDE 4KMRA 4BX2A 5D3KA 2ONZA 3HADA 3KPWA 5FA8A 1SZHA 4AQYB 1J0XO 2GD0A 3O75A 7ICPA 2VL7A 1AB5A 3AVQA 3KFVA 3SR6A 2K2QB 1OXBB 1G0NA 4XIFA 2NYAA 3MZ0A 3BCHA 4TSFA 3BE6A 3HR4A 4L4SA 4QGSA 4QBHA 3R8FA 3GDGA 2GHTA 3H0MB 4ZEMA 1P1CA 3PUYA 1I7SB 1ZK0A 4ND7A 5AKXA 1VKOA 1FVFA 4QDOA 4NWIA 3ZY6A 3ZXYA 4CL3A 4URUR 3TUZC 4RT2A 2Q3JA 2DBRA 3GL9A 1KDYA 3NPAA 4DMGA 1QZXA 1UHUA 4NENA 4Y0AA 4LDNA 4S3MA 4MXDA 2WJWA 1E98A 2Z56A 5CA7A 2XSZA 3HYCA 2JG3A 1ZC3A 3WOHA 1UA0A 4B3JA 4G63A 2MDTA 4DOCA 4RKRA 2HO5A 4YMMA 1A9RA 1GCIA 1ORHA 4QWCA 1WZCA 4M1YA 4QHYA 2XPCA 4L0CA 2UUAB 5BWBA 2CWDA 1KQPA 2O5CA 1JUDA 4YROA 4LHYA 2QX4A 2FZ5A 1U0BB 5CT4A 2KX7A 4MF8A 2VF2A 2D4AA 1Q92A 2Z4SA 1HYGA 2BI7A 5IBQA 4L95C 3PYLA 3RTVA 5FOQA 4HYYA 3G2OA 3NGXA 3A31A 4OQZA 2RGEA 4DV7B 2NUPB 3NHUA 2PVPA 1JZQA 2ZXFA 5JAIA 1KDRA 1R2QA 2H2IA 2OMKA 4ZYUA 1H23A 1L1FA 2PZMA 4PYMA 4II2A 2ATXA 3EXHC 5AWFC 2P5SA 5B30A 2H7XA 1HLDA 4S0XA 4X8HA 3THWA 4N0DA 3FBTA 1A7KA 4Y9TA 2KS6A 4RDHA 3MRSA 2P3OA 2H0QA 5FTNA 3T5PA 4RZUA 1M2WA 2VXCA 3OETA 3CKKA 4QFBA 3FAHA 5BV2P 3HZZA 5AVYA 1V1RA 4TKUB 3OQOA 7ICLA 4PGAA 2IA5A 1WP4A 4MGYR 1NBOA 1B22A 4KXNA 2ZBQA 1YQGA 2E0IA 3CZCA 1NA5A 2VHXA 3V32A 5REQB 1RXWA 2GCNA 4OQXA 3RSSA 3MR6A 3GLUA 1EDZA 1I01A 2BCEA 4MLCA 3EEQA 3CC8A 1K75A 1V4BA 1WXXA 4NYMQ 3DLIA 1BU8A 4I4IA 3PVXA 4EY4A 1ADBA 2XUHA 4JK1A 1A8HA 3M9LA 1T34A 2SHKA 1WWKA 3KUKA 4L51A 4E4RA 3I8XA 1YC5A 1R0KA 3Q85A 2R5FA 4X7BA 1PJ8A 2MJLA 1A2KC 4MQEA 4HAXA 1FY2A 3GEMA 2XNJA 2Y1XA 4EJMA 4D80A 1VIMA 1SZJG 2X22A 3AV3A 1IWBB 1KAGA 5ILOA 3TOZA 4IH4A 5C5DA 3X44A 3PTLA 4GP6A 3GLQA 1L4GA 2NP7A 2G1KA 4JQYA 2PUEA 4DL5A 2D00A 5DYGA 1KO5A 1AUXA 3W2EA 2JAXA 3NDPA 1RCUA 1YQTA 4GRIA 2AZTA 1FPQA 4TZKA 2O3TA 4JYZA 2IK8A 2EKQA 4ZOLF 4QT0A 1WVGA 1IJEA 1KOGA 1ZP6A 5E38A 3TADC 1KI4A 1S5LU 3V8NA 1X8XA 3N53A 4R71A 2VHWA 3GJYA 1ZVVA 1GUDA 3RJKA 2WOOA 2NTEA 1T9HA 4OQFA 1ZO8A 2NSYA 2GGSA 1GY8A 5JY1A 2RB5A 4JUAA 4DV6B 4BV8A 1GSIA 2HHHB 4QA9A 2JAHA 3ICQB 3PCRB 1KZGB 5K45A 1QMGA 3QKSA 3H1GA 1WULS 2VDKB 4Y8VA 4DR6B 4G2TA 4RX1A 1BFDA 3VU9A 4I2JA 2IEAA 4JUFA 3LUCA 3FZQA 1NZJA 5JTTA 2MYTA 4MUBA 3OTIA 4DJEC 1PR9A 4QRDA 4NU8X 4K3VA 5B6IA 2BJVA 2K2WA 9ICMA 4M8IA 2AGQA 4ABYA 4PXSA 5D3MB 1ETUA 1I51A 1VI2A 5LZ5A 2IDKA 3ABIA 3S6JA 1ORTA 1PQYA 3NLLA 4IXNA 2PJDA 5KL8B 1G8FA 5ABPA 4X3OA 3D43A 1DG9A 3VOTA 3JW8A 2VLIA 3WIDA 4LPKA 2OXRA 1DFGA 3J7AC 3R6DA 2PFSA 4KGDA 3SQNA 2C8LA 1M1YA 1B6GA 4N7JA 1PDWA 5FJIA 1Z6YA 3FPAA 4IRCA 5IU6A 1JS1X 5IFKA 1UIRA 2IOHA 5HF8A 2GCEA 2CZGA 4FDMA 3DW1X 2QUJA 1PVVA 4QD3A 3AHJA 2P4UA 2IP4A 4ERNA 1ZM7A 4QBGB 3B1ZA 4LV5B 5CLIA 1WSAA 3HJAA 3W9SA 3P9QA 5CA1F 1YBMA 2LYHA 1N2JA 3EG5A 4RSMA 5DM2A 4EP1A 5JJCA 4P8RA 3FWYA 1CUEA 2HFJA 4EI9A 4KV9A 3ZU6A 1FVOA 3M33A 3CS3A 2HA3A 4YP9A 4PC2A 3OQ1A 4DDTA 1G8HA 3T38A 3SVTA 4KR9A 2AOTB 1L4MA 3SOZA 1ZVJA 3MT9A 1TKAA 3KUXA 4A0GA 1ODSA 5HYVA 3J80A 4R9NA 2IYNA 3F6PA 2VBIA 4DREA 2Z04A 3CW2A 3RFUA 2OAGA 1VIYA 3WHIA 1Z0UA 4U9IS 4BVLA 2KM1A 2BTQB 1JEQA 4DQRA 4KLSA 4PZ9A 1HC7A 1P72A 3HJEA 2VJMA 1SK9A 3BVPA 1AF4A 1QYRA 4G9BA 1D4AA 3RS4A 5FR2A 1N6HA 4ARSA 2WUEA 3ZI0A 3PEVA 3ZN2A 1WZUA 4C8MA 5LQDA 1FK8A 5FWYA 2OAEA 1S2IA 2QROA 3LW8A 1A5ZA 5KYTA 4KN7A 2E4YA 3GC6A 1RWWA 3QU4A 2HYIC 3RUDA 1T2CA 2OOKA 1ZD3A 1B6TA 2PCLA 1U3VA 3DSRA 1HLPA 2R8BA 1U7PA 3MTBA 5DW0A 5CNJA 3HFRA 4MEXA 3G6WA 1PWEA 4Q37A 3TVYA 1M34A 4Q16A 3HY6A 1RQ2A 1HGXA 3K31A 1PN3A 2VYNA 1JT9A 2W6NA 3TAPA 4IMJB 3RBZA 2CVZA 5ICCA 3OC0A 1SXJA 3TXXA 3LCMA 2GJAA 3GPCA 4A26A 3KJIA 3H5OA 4BBPA 4EG7A 5LLDA 4IRMA 5FUMA 2VJOA 3GA0A 3W6ZA 2R00C 2EKZA 2ATLA 5B37A 1XJCA 1ULTA 4G6ZA 3ORHA 3PHCA 4F4DA 4FIDA 1YDEA 3EF3A 2DFVA 4AUEA 4DRXA 1HL3A 4L27A 1GUAA 2DLNA 2X6QA 2JLWA 1J22A 3OWOA 3T9BA 3O2SB 4YUVA 4A6PA 4JUCA 3FUXA 1WUDA 3ITKA 4UDYX 2W93A 5D7BA 1E3JA 3Q4GA 1F4PA 3VX4A 3OZBA 2W55A 4C2UA 1IZ8A 4RD3A 2X40A 4ED8A 2BAGA 2QSYA 1PK7A 3N8KA 1P74A 2C78A 4BVEA 2H4WA 4Q7LA 1X80B 3IVAA 1AVTA 1HV8A 1CY6A 1J39A 1UR5A 2QN3A 4GRAA 1R16A 3VOSA 2QDKA 2MWMA 4Q3NA 5HIMA 1Z74A 4LZNA 2A67A 2ZCVA 3DT9A 2ZQZA 4LNUA 4MQMA 3JQDA 1VIAA 5D85A 3DE6X 3VOBA 1MOSA 1WZ2A 3R4CA 2R7AA 1H1LB 3W78A 1BW9A 1TKBA 4AJOA 3BEDA 4FZLA 1LX7A 1CZUA 3HB9A 2ZANA 3O84A 1RPJA 5G1PA 3ZVNA 4LY6A 4LJKA 2YHAA 4EKDA 4XUDA 1G5FA 1OXMA 3H9QA 1OT5A 4G0UA 2KKVA 4WKGA 3SBOA 2FUCA 2FN4A 5C8VA 4NYIR 1ACLA 4M1MA 3ETCA 4RTRA 4N6OA 2O50A 3BXZA 3ON5A 5KX5F 1YKSA 3MCTA 4NLLA 1B26A 5KCZA 2FPMA 3T99A 5E3JA 3PUHA 1BDBA 5JSYA 5DMHA 1SKWA 1ZCZA 3IP8A 3ORQA 4JQOA 4RTLA 3VA7A 4WK4B 4TUQA 1M2KA 3QPDA 3RVMA 3FTFA 3FVQA 3PR2B 3W6UA 3RC3A 3VHXA 4WXPA 4RTNA 4PLYA 1L9XA 1GLVA 4D57A 1KBQA 4UB1A 3EH2A 2CF5A 3EIXA 1POXA 4MHSA 4QDKA 3EARA 2GPSA 2W6PA 3ROEA 3JQFC 2P2ZA 1DV2A 2D8MA 2GAJA 5AXDA 3ZOKA 2FLKA 1Z0IA 2FF5A 3JSXA 3CMCO 3B8EA 4DZZA 1R0SA 4OX9Y 4OJQA 2XUQA 3ESDA 1KY3A 4RIIA 3TW0A 3I4FA 1SB9A 3KR0A 4OHKA 4M0MA 2WILA 3F8WA 1OB2A 9ICEA 2P4HX 5LYJF 2JEOA 3HT3A 3D7LA 5SICE 2ZR8A 1IVSA 2ZIAA 4BMNA 3KKPA 4LSWA 4BMZA 5I3CA 4OGKA 2JJ1A 4A0FA 6NULA 3F98A 4CFSA 1VPDA 4MKHA 5HGJA 2G1UA 4HSGA 4ISBA 2WU4A 4OUDA 1O87A 4IFIA 1JWLA 1R64A 4RV5A 1LTHR 4DQDA 5BN3B 2ZYAA 3HY4A 4GZ3A 2W2KA 4WADA 2OV2A 3VTZA 4KTVE 3WRYC 4P1ZA 4UARA 1PKXA 1ECWA 3L0DA 1ZGZA 1OX5A 2IU6A 3RWOA 7ICKA 4WXMA 3KEOA 4KLNA 3K72B 4CWAA 1NJFA 7ICRA 2ON6A 3E3AA 1J2MA 4XDYA 1QE5A 1P0MA 3HXKA 4CLOB 4NL9A 4Z1MD 3EQZA 3U1TA 3WMXA 4MV8A 2HK9A 2KIWA 1ACMA 3LUHA 3RAEC 2PX4A 4E46A 2I6XA 1U04A 2QIOA 3P9IA 2JD0A 2DTEA 3VH1A 3EY4A 4EVIA 3NTVA 1HG1A 4B0OA 1V96A 4MW5A 5ICEA 3ND9A 3OSNA 4IIXA 1E58A 4G1EB 1ZNXA 1NKBA 2J5BA 4J49A 4K0RA 4DQPA 3LCJA 3NGMA 3HCCA 4GS5A 3Q3VA 4HNSA 3FZNA 4K9RA 2WHXA 3WWZA 4GLBA 2ZUDA 5KPJA 2G9VA 3KOZA 2FWNA 3CPJB 3WV5A 5TPWB 2CNLA 4MARA 3ZE1B 1HDIA 1JXAA 2HU2A 3G17A 4RESA 3JQ9C 2H11A 3A9RA 3EFOA 3KYIB 1JKIA 5C8YA 3ELDA 5A7HA 3NBXX 4OI1A 521PA 1QU3A 4TKVB 2W83A 4GF5A 1TM1E 3OE5A 4IGKA 4EJ6A 1H6AA 2HRCA 7ICTA 5BSGA 3R6TA 1TTQB 1QP7A 3DW3X 4N8EA 2WKSA 1E9DA 2YZ7A 2JA1A 4AKSA 4YUYA 2P11A 3T5CA 2VUTA 1X2IA 1TF2A 4XAQA 1SUPA 4CM4A 3DD1A 1QIGA 2E5SA 1HKUA 3EEYA 4Q48A 1KI3A 1EH5A 5KAFU 1VRVA 3P94A 2AZMA 4LHXA 4UMVA 3TCXB 5ALOA 2XQGA 2B4YA 1W8DA 1PJSA 5C35A 4WFJA 1ZX1A 3INNA 3L0OA 3LQQA 4C4PA 3ZWPA 3TE6A 4D9MA 4EZEA 2VP5A 3GNTA 1FFDA 4LQCA 4U6QA 1EM8B 1VJDA 1IM5A 3NH9A 1JXOA 5J5AA 3JQBA 4O3MA 3WLFA 4J6EA 1PNTA 5JQGB 3ZZTA 3QG1A 1WETA 1VECA 4QEKA 1XWIA 821PA 5FNVB 4BYMA 3ESAA 1L8LA 4GOND 3UATA 3EIHA 1WU8A 3TLBA 3B5JA 5EKTA 1UUFA 3T41A 2Y8EA 5CH3A 3IPAA 4PCAA 4HAYA 4D42A 1P4HA 5BW4A 1Y37A 1NL3A 1KP2A 1X1SA 4RF2A 3F78A 2B21A 3M8RA 2IHKA 4TZ6A 2E87A 3BGOS 3COPA 1YBAA 1HNWB 3D8TA 5EZ6B 4KLDA 5A5DA 4WZBA 3GA5A 5JSZB 3KSUA 4HVLA 3UG7A 4OXYA 5L9XA 2JATA 1T43A 3RVLA 2AOUA 4XFKA 3PSIA 4YRSA 3LHDA 3LA6A 2HJRA 1Z2PX 1XDGA 1DMSA 2RH8A 3ZUGA 1OR8A 1UWLA 5EKUA 3IX7A 2FMTA 2I62A 1W36C 4NXMB 1SUWA 2BFFA 1YFLA 4OREX 3LLMA 3TI7A 1RD4A 2Z30A 4A15A 3EAQA 3G1TA 2HWUA 4DLEA 2R4TA 4RGVA 4MFAA 1RABA 4AYBC 3N39C 1QQBA 1KYZA 3HJGA 2DPIA 3ANSA 4CKEB 1F9EA 4JEUA 4XARA 4EA9A 1II0A 1MB3A 3HDVA 3ZWCA 3C45A 4EF6A 1QK3A 2VA2A 1JHDA 2HF7A 1FUEA 4DBVO 2PMDA 1W47A 5JXIA 2JZBB 4QJIA 3TX6A 2NZ2A 3HBJA 4D9KA 1NJ2A 4IF4A 3T3HA 5DGTA 4N5HX 3A26A 1TMYA 1PJLA 3L4JA 2VQEB 3EVGA 3HG7A 1T8PA 2D5CA 3GMTA 3QU2A 3Q8LA 3DKIA 4U7FA 3RM3A 5DBAA 4FKBA 1KAOA 3GRFA 1X74A 4UBKA 2XYPA 3BRQA 2A59A 2P5TB 3KAJA 5EOVA 3ZLUA 1XCPA 3J81j 2BM9A 5BYKA 1Z35A 4GKAA 3RYTC 1E8NA 4Y6RA 3SEQA 4BNGA 3D6VA 1XZBA 3OSPA 1QJ4A 3EXG2 1BS2A 3G49A 2JH7A 5TARA 3SF8B 1LWOA 3DKPA 4UAVA 4WA7A 2WIDA 4TWBA 4IJQA 2ZRGA 1TCUA 3CLHA 1K0FA 4ZEWA 1YZNA 1ADGA 1NSTA 2M0NA 4EQ6A 3FTQA 1FJGB 4CM9D 1MD9A 5C8ZA 1RJWA 1MW8X 1M75A 1Z8FA 1ZL2A 3TD6A 3PW7A 1RP1A 2J9FB 2ZSFA 3L7YA 4F2WA 2H1OA 1SHJA 3GLKA 2AVNA 4NBLA 2KJ9A 2JI9A 5TMPA 4TXHA 2XXBA 3HWSA 3IDFA 5CT9A 2I1VB 2W11A 4LXXA 1JQLB 2G5TA 2P8SA 4PWZA 3J7TA 5KNBD 3CPHA 4G1CA 3GDOA 2W6CX 1OBFO 5KDOA 4RV9A 3PGA1 4RTSA 1KO1A 2RARA 4J43A 2ZDGA 1IN8A 2HQBA 1BTOA 2QN7A 4GMFA 2MSNA 4UE2A 4D5GA 4JVNA 3FTDA 4QWMA 3RT1A 4AMZA 1RRVA 3L8YA 2YQZA 1XGKA 2XCAA 3QMWA 1VXRA 2W9AA 4KSCA 3GV5B 2Q0ZX 3RVJA 3T1VA 4DUPA 3DZHA 1AE1A 4AY4A 2I5HA 3VDRA 5I7VA 2RAVA 2P3QA 1ZIDA 4H17A 1N5WA 4B32A 1Q0HA 1AK9A 3KX2A 1ZCAA 3NJ4A 4PGMA 1A9ZA 4BWVA 2I9PA 2XA2A 2FVXA 3HLKA 3OOYA 4F71A 5DMXA 4I1RA 2PMFA 5K99A 3TEFA 3BH0A 4HEHA 4D4HA 1CNEA 1RM5A 5IHXA 1ORWA 4OKIA 1JH8A 3H8MA 1OFIA 9ICLA 1N0WA 1ZZGA 5E6RB 2IITA 4ICIA 4WN3A 5I7FA 3SI8A 3RB3A 2PMWB 4KO8A 1T36B 2REXB 3ONVA 1I9GA 4E31A 4USAA 4NZYA 4X61A 4BKUA 4IUDS 4YVFA 1WIWA 3CUVA 4KEAA 3UG6A 1WKVA 4X62B 1LRJA 5CXUA 1Y4ZA 3U49A 1Y6QA 4JELA 3N0WA 3IPCA 5DX0A 2QV0A 3HFSA 3OZUA 4EY8A 1Y8CA 3HY3A 3ND5A 1NXWA 4RJLA 4EHNA 2RGNA 1OA0A 4OH7A 4QPJC 4DCUA 1OROA 5D4BA 4DSZA 1T9DA 9ICUA 3HC7A 2WV9A 2VSXA 3L4BA 1YOVB 2R8EA 4RVCA 4ZK2A 1FDSA 1EDEA 3G8CA 3D2NA 4XXHA 1QYIA 2IYVA 4E07A 4ALJA 4C88A 5GV7A 3ZY4A 2Y92A 3ZJVA 3UO8B 3DE3X 1NSFA 1CRPA 4ENSA 5J2AA 4F5RA 4M9HA 3LXMA 3WGZA 5CLGA 1Z08A 3PF9A 2J3DA 4PRYA 1E1QD 4TL9A 4QRHA 1QHXA 2HEGA 4ACBA 1QAOA 4I14A 1UXKA 3N7PD 3UMSA 1FTGA 1RYNA 3WWOA 3I6IA 3ASVA 1X1RA 1COKA 1IK6A 3U44A 2JIZA 3QV1A 5DNYB 4PGFA 3ZOZA 4W6QA 2C1XA 1J24A 2O7VA 1UJNA 1G18A 4HD8A 1PK1B 3E0QA 1GGKA 1YOBA 2VTVA 2XXJA 4L50A 2CVQA 2HSZA 2ONCA 1VDVA 3CW2C 3GFFA 1IQPA 1P4AA 3FWHA 1H2HA 1VJGA 1T24A 3C4JA 1M5TA 4EYHB 2OCKA 3KAQA 3SEZA 1FLVA 5KX5B 4WZ6A 3V1YA 4X64B 3GJ7A 4UUOA 4JXKA 3REFA 5J0UA 3I3OA 3PC3A 5J2HA 1TQDA 2HBKA 3RS8A 5IJXA 4NV0A 3ACCA 2VTBB 3KVRA 3M5DA 4HNHA 5G5GA 2WQ7A 4NOMA 1UKYA 5I8PA 2GLXA 1KTQA 5KYWA 4UFOA 5K8UA 1Z7EA 1YR7A 2B82A 2IXTA 2PUHA 4QJBA 4PV7A 4TV9F 3G59A 1MZVA 4RACA 2HSGA 2RHRA 1G8KA 3ED1A 2QUKA 3P2IA 2DPJA 1NI3A 1T0JB 2FFQA 4I3HA 4V0ME 3RR7A 2G72A 1IEVA 5AK6A 2PZFA 1TVMA 1PGPA 5BMVA 2FE1A 2QRHA 3DL4A 1SURA 5JISA 1SXJC 2RRDA 5JR3A 5J2TA 1JG6A 1NUTA 4QZHA 1CS0B 3IUEA 3RC9A 4F6RA 4M04A 5KT7A 2P40A 3O8BA 4NKRA 4NI5A 3AN1A 3MK31 5JRTA 4G0VA 3I9OA 1L5MA 3ORYA 3R44A 1QWSA 2CLDX 1D6JA 2IW1A 2O2CA 5ALLA 3OEHA 4OMCA 4BC0A 4M1SA 3CYMA 4G24A 3VYVA 2CFTA 4EA8A 2VSOA 1X0XA 2J1LA 5JMTA 4DLNA 3ER9A 1J2UA 4HN9A 4FFSA 5C8DA 3K0FB 3RIYA 5GOZA 4D7AA 1YUNA 3OIDA 3M83A 2W8LA 4Q01A 4ZA2A 4WCFA 4FDUA 2V55B 3AY6A 5ECYA 2OFPA 2DPXA 4BX8A 3TZLA 4GRDA 2J9XB 1U7TA 3QPWA 2C5GA 4J7UA 3GLFA 1BN6A 4Z4QA 3OX3A 4QXMA 1E2FA 4PQGA 3BWCA 2PZ8A 3GN2A 5FJJA 1ZSVA 3C3AA 3TB4A 4D26A 1R4MA 3EW9A 1QH0A 2CJXA 2EZTA 3P9SA 1R3UA 2A8YA 5BV1A 1AKRA 1UBSB 1FFXA 5LP6C 3FPCA 4IIBA 1NK8A 1KFCB 4PPXA 4HWSA 1NJGA 3H1TA 2IHYA 2KSQA 3ICCA 2YFKA 5EUCA 5DNCA 3PXBA 3N9IA 2XUJA 4YALA 5B4VA 2H85A 3P9RA 3BIWA 1UZLA 1CD5A 3LFUA 3GIMA 4KQMA 2AE2A 1NPDA 1XQ9A 4HDRB 3RIGA 1RWMA 1Y81A 2PBFA 1NWHA 2IXGA 5G1NA 3E0FA 3PX0A 4F2DA 1KXZA 1P7PA 2GD2A 2O20A 2H8GA 1CUZA 1GAQA 2BZ1A 4WIAA 5HUJA 2JA2A 2PS9A 1Y1PA 4Y9SA 2ZDQA 3QEMA 3AU6A 1FP2A 1BGVA 5ETJA 3BAZA 3DO8A 4EIWA 1XRQA 1TYEB 5C31A 4MRMB 4Y98A 4B6SA 2P4SA 3T6KA 1G9XA 3EGEA 4NH0A 4M9QA 4J9RA 3LPNA 4XFJA 3NEJA 3VFDA 4KPYA 3PUZA 3T4XA 3AX6A 3WADA 2YMLA 1FXSA 4WASA 1IG0A 2C9ZA 3TQTA 1X40A 5H81A 2Z6AA 5JU6A 4U7WA 4ZALA 3S40A 1CUVA 4BO2A 1HEUA 5DLYA 4KLJA 4FD2A 4F3RA 1SG0A 2QMQA 3N8IA 1U47A 5E4FA 4IDQA 1UPBA 1YRBA 2Z5LA 3AC0A 1X7DA 3AVXA 3IHQB 4A10A 1OVMA 2Q46A 3Q8WA 4WVFA 5FAXA 3UK1A 4P82A 3WLRA 3FSGD 3I53A 2W7PA 1D1PA 3AZPA 1E20A 3OA2A 3G0OA 2Q4TA 3PIDA 1KJQA 1NKSA 1CFZA 4M38A 4G07A 4BTEA 2P9BA 1UPXA 1A1VA 2WB1C 4WZBE 3VZRA 4CN8A 4ZYLA 4K05A 1JWAB 2V65A 3WL7A 2HQ1A 4R3WA 3RJGA 3PNBA 3U0VA 1KRPA 4NCBA 2J6UA 3ABOB 3LCVB 1KBZA 3GGGA 4EBCA 1H9BA 4TV8B 2GHIA 3P2KA 5L3SB 1QE3A 2AOVA 4XIYA 1QIFA 4P4TA 1OH5A 4ZVUA 1ZINA 5ITZB 2PSFA 4EI7A 4U3JA 4DJJA 3C5WP 3I23A 1K2VN 4LG1A 4AG5A 2IYFA 4GH5A 4CEHA 4EKYA 1BIFA 3WWPA 1E0SA 3TAUA 4J0IA 3IPXA 1E9CA 4UDOA 1FFHA 4JXJA 4Z9FA 4I2FA 3G2KA 1FTQA 1ML3A 1SO8A 4ARAA 3AR3A 2ET6A 3OCXA 1RI3A 4EA7A 1FRVA 3OIVA 5KTPA 4E5PA 1AC5A 2ZCUA 4N9WA 3RKRA 1A96A 1AHIA 3OZEA 2OSBA 4KK3A 3P9KA 4BV3A 3MBKA 2JCXA 3A4MA 4HAWA 2CCJA 5L4LA 4YP6A 4NL9C 1Z0AA 3M1AA 1RQPA 3I62A 3F6RA 2QYTA 3I6BA 1ICIA 1LSOA 5FPQA 4CM8A 3WQHA 1XZLA 5DB6A 1ZH2A 2B9VA 3T15A 3OM1A 3IP9A 4HGYA 2C5LA 4BWYA 3FUWA 3JVUA 1MIOB 3WMFA 2B8TA 3ZD8A 4PFSA 3IVCA 2NT3A 4M9CA 5H7XA 1WEHA 4KH1A 2H3EA 3MOSA 1QNFA 2HA0A 4KV7A 1DADA 2BMWA 5JH7B 3BJIC 4ZVNA 1NK6A 2MCFA 1OILA 1YSCA 1YI0A 1DXHA 5EXTA 1XVTA 2GNOA 4Y7DA 3LG2A 3O94A 2R7LA 2H7YA 1J4AA 1KYVA 1WXHA 3RR8A 1VFNA 3BHNA 2P35A 3R6GA 4QYWA 2YY6A 1FYXA 1F44A 2QIPA 2P8JA 3IQZA 1TW3A 3FA2A 1B0XA 2PX2A 3KP1A 1NM5A 2FMPA 2FF7A 8ICGA 2HOIA 1Q1EA 2QLJA 1FP6A 2P4QA 5C18A 5AKIA 3HP7A 3VYUB 4E5DA 3SIPA 3GGOA 1V8DA 5KSYA 5FWXB 1V3TA 3CF4A 3ZU4A 4AJ2A 4P84A 1MHPA 4O33A 4K8RB 2PX3A 3BXOA 3HVJA 3NU1A 5J2GA 1INLA 5CLFA 3NOOA 1K4YA 3OEED 3TRFA 3BDVA 1OU0A 3K9LA 4F3TA 1N8NA 2YNMA 1AM4D 3HWRA 4PAQA 3ZKWA 3C3MA 5DO9A 1LC0A 4PC1A 5TQ2A 3GDFA 1TIKA 3K05A 4UPVA 5IUKC 3GAMA 3H6GA 1GZDA 5J3JA 2ZVQX 3T3EA 2QP4A 1TDJA 4AJJA 1MJ5A 5C34B 1DQZA 5E6UB 5JJBA 2HJWA 1G2QA 5A02A 3X0DA 3D0QA 3O2QB 1Y7LA 3AVWA 3JQBC 2W48A 2C5EA 2E21A 5JAPA 1JP7A 3KLNA 1VHDA 4DQ0A 3MINB 4ZRDA 3EUAA 3MMXA 4GWKA 3I39X 1F1BA 5IDVA 1UIMA 3R74A 4XI9A 1A50B 3H9UA 4FGJA 4OTZA 3B0YA 8ICZA 2F1IA 4FT2A 4FOSA 4R54A 4Z6DA 5AKYA 2AI1A 2XMCA 2PMEA 4S1OA 1Y98A 1RYHA 2PGAA 4MMXB 3A6LA 1RJ9A 3BKXA 2W2TA 1I0LA 2PVSA 3NATA 4UAWA 1UC9A 1ECLA 4HQ0A 3PNCA 3CRMA 4HH0A 2ZP1A 4Q3LA 2WHRA 4G1FA 2B7BA 1Z45A 3ML1A 1ISIA 4RL4A 3ZV5A 1Z06A 5LQMA 1Z7BA 3AUJB 2CF6A 4BQFA 3JARA 1T6XA 4FB5A 3L8GA 5A4MS 4BFUA 3B12A 3H5WA 1YRLA 1II8A 3D1LA 3NVKI 4Q4HB 5H16A 2D3TA 1E79A 1Y5LA 1W93A 3AVUA 1KJ8A 2WSSD 4CI0B 2W3RA 1TUIA 3BMCA 1YQXA 1FFEA 1V6SA 2EGGA 1L5HB 2BCRA 2CUKA 1HYBA 4MRVA 4FE4A 1IN1A 3PPXA 3DGFC 1QORA 2G1AA 3NAZA 4AN0A 3T34A 4IEEA 2BMFA 2E8OA 1FL9A 1TEHA 4RQUA 3EPLA 3ZQ4A 2ZSAA 2J3HA 1VLZA 5F2NA 3I83A 1Q11A 3UPDA 3SM9A 5KVQA 3EXFB 3DBRB 4NEGA 4DDVA 4YWJA 3T3FA 1C80A 3KHUA 2DPGA 1CJUC 1KHTA 1ZD2P 5KC8A 1YJCA 3QBDA 4FFOA 3C85A 2HW8A 4E4YA 2WHQA 1QTNA 2XVXA 4BTVA 1YE8A 4RC9A 4RF3A 4WDQA 2Y99A 1E5TA 1SBNE 1JFFA 4QUIA 4GOMD 3KK0A 3EUFA 2Q5EA 3FJOA 4JBLA 1GNTA 4F50A 3JZFA 3KQTA 1DB3A 1O6CA 3U3ZA 1KQNA 4O3OA 3SMQA 1HLGA 1TECE 4RA9A 1QFYA 1ONSA 3RF9A 3JPPA 5EKXA 4G8BA 2X8AA 2CXYA 2BEKA 3NOQA 5AM3A 1GG8A 4UASA 4DOBA 5E2BA 2GVNA 1FU8A 2NOAA 1AROP 3AVPA 2XD9A 1YRYE 3N07A 2PH5A 3QXHA 1LS6A 2ZUSA 4JGGA 1Z19A 2NUAB 1NKEA 1XPOA 3INGA 3USCS 3L02A 5KAPA 3B3AA 4TKLA 4PPYA 3R7WA 5K0NA 4JI8B 1ZKMA 1XLWA 5HK9A 4AJPA 1FSSA 5AJWA 4RQNA 1V2GA 2AN4A 1BFKA 4YQYA 1GO3F 1RLTA 2PCJA 3MHPA 1C7IA 2EP7A 5HDQA 3V46A 2BFDA 1OF1A 4LF9B 1WY5A 3A4LA 2IV7A 1SV0A 2Y66A 3DHNA 5K0TA 4MP3A 1UOOA 3IT2A 2ETVA 3W2GA 2CSUA 4N5NA 2G09A 1IE3A 2X5KO 4OL9A 9GPBA 4X7PA 4AICA 4ZHQA 3PHJA 3KWJA 2WKPA 1TK9A 1MG0A 2WTMA 3ZEIA 4GFJA 3PQ7A 4Q7EA 3LO8A 4XR9A 3LYHA 4NQZA 1M8PA 1H22A 4ZPXA 1DELA 3LKZA 4GPZA 4EBBA 1FSPA 4DLUA 1JDBC 4NRDA 4G25A 4OHWA 4GYWA 3AETB 1ZRHA 3Q6IA 4IJ6A 1N0IA 5TIIA 4FN5A 1TLLA 4ND2A 3GLFE 1FDIA 1XZMA 4HDKA 3L6UA 2E55A 2XUIA 4RQ8A 4CT4B 1BXKA 2JCGA 4JUIA 1AT1A 5KQMA 1FYDA 1OLSA 4O4HA 1H0RA 1TVEA 4IOJA 3MF4A 1Z2EA 3RODA 1SC6A 4XH9B 3DPSA 4U0JA 2R6JA 4X5OA 3PTZA 2O5EA 2CLKB 1XFAA 4WLNA 1KI7A 1ZGCA 5CEJA 3CWZA 4LC0A 3CJTA 5LP1A 10MHA 1J25A 3PXXA 1J42A 5HNKA 3CR3C 4QC2A 4NJ8A 2IIVA 1FP4B 4I9FA 2JLYA 4RPLA 1VG9B 2MOKA 4WLFA 4AX4A 3O8OB 3U5ZB 2QR2A 4MSUA 2DSTA 4FDVA 2RGNC 1FX1A 1XO1A 5DIFA 3DZKA 3HVRA 2Q1XA 4YQWA 1SGGA 3L4BC 1SCIA 4LJ4A 1JI3A 4KP7A 1W9MA 3AH8A 1G5TA 2I67A 1WAMA 1H5UA 1MAWA 4J2TA 3QVJA 4GT1A 3SPXA 3ZY2A 2QSUA 3K2BA 4Q6BA 1ZY2A 1J2EA 3VPCA 1AMUA 1CEEA 5EPOA 3KD3A 2OUKA 3N86A 2IE8A 5IYZB 2V7QD 1VPWA 4XFDA 4H3KB 4MCHA 3PVCA 4WSOA 1OGYA 5TEVA 5KMGB 1EXNA 1RWOA 1W0JA 1ZOLA 4IJVA 4XX0A 4PZCA 3B9QA 4TX1A 4PLZA 1X1AA 2CL6X 1L7AA 2KI5A 4EUSA 1Y9EA 3HE3A 3IP1A 2ZZKA 4Q45A 1TZ2A 3V3KA 5CDSA 1RMYA 1IHUA 5EKDA 2OGTA 1OKKD 1P4SA 1NIPA 4AM8A 1A6SA 3MT8A 2PZGA 5ALXA 3RU7A 4YMOA 2PMKA 3V3TA 5DHRA 4H1UA 1E3IA 3LC0A 1ST3A 1O5OA 3FM9A 4B8ZA 1SRRA 2G5GX 2YXDA 2G4VA 4JLSA 3PR4A 4OHYA 3TTTA 2I33A 2PGLA 1Z4MA 3T7SA 2FN8A 4N7BA 4GLFA 2FP3A 4F5DA 4NBVA 3PSPA 2ZUCA 1P4JA 3CLTD 4C2TA 5LQSA 3H5LA 2QW0X 1UM9A 3AL0B 1PE0A 5JYCA 4GXKA 2QP9X 1JLLB 3L49A 4JOSA 1GZ5A 4UCQA 4MR8B 3A06A 4FK8A 1RQRA 1LRLA 2B2XA 1XR3A 2VDMB 5E1MA 3R3SA 3UT5B 4NXZA 1MMFB 1SOWA 5AUNB 2Y77A 1MPTA 2FLWA 3RBDA 3QM1A 4RNCA 3GQBA 2QL5A 5C80A 3L18A 4PS1A 4PC6A 4MWDA 2PUBA 1L7OA 3VJLA 4S0ZA 1SQSA 3EXG1 2WJ3A 4J0KA 4YMGA 1EFPB 3QOWA 4B34A 3P9CA 1DRWA 3EAGA 1SC4A 1JI0A 3TTUA 5C7IO 2DKZA 1J1UA 4O4IB 4ZV7A 3BEOA 4WGFA 2B5OA 1NW7A 3LDFA 1YMUA 3E5MA 3LP6A 1BX1A 2JFXA 1G8MA 1R0CA 3A1CA 2PT5A 4NNOA 3IYLW 4YVZA 3SR0A 3IBCA 3RUHA 1XEXB 5AUPB 1VMIA 2P9EA 5FPSA 3PEWA 1JMYA 2XCUA 2Y9UA 2ZS7A 1JHOA 4WCFC 2OB2A 2QM7A 2FPUA 4WI1A 4QE3A 3LWDA 5G41A 1HIWA 1G6HA 1M74A 2GLEA 4MVJF 1NKVA 3HKCA 2JLRA 1RBMA 4YAEA 1S01A 3L8EA 2EQ5A 3N0VA 3L4EA 5DX1A 1L6RA 1ZH4A 3R0ZA 1MNAA 3CLRC 3VPDA 5HIAA 4B6EA 1EGVB 1NF9A 3P52A 2MA1A 1N4DA 1U94A 5A1TA 2PQ6A 2O2ZA 3KV1A 4PL2A 2Q8QA 4BB6A 4Y0NA 3TLGB 4ER6A 2CNWD 4HP8A 3LK7A 3IE0A 4NOKA 4NCXA 3CW8X 2Z58A 4KYTA 3R41A 1F8XA 1IQUA 3F2IA 1HOXA 3SP1A 3K2QA 2IOFK 1HORA 4QOSA 3H19A 4RHXA 1GDDA 1A2BA 1GDTA 1BOFA 1H2ZA 2FJPA 4H2DA 1G7TA 3RTCA 4TVOA 1RWQA 4GWLA 3AOGA 1H2YA 4G4GA 3EEFA 2PTHA 3TDNA 2D06A 1W7AA 5SV2A 1IUNA 1JBEA 3B7GA 3S2EA 2X0EA 3A0RB 4D6PA 1LB1B 4D3FA 2D6FA 5FQNA 4JI7B 4KWCA 2CV2A 1E7MA 3R3ZA 3TPCA 1EESA 4A03A 3FYUB 5CCEA 2AXPA 1I4EB 4DJDC 5JATA 4KNVA 1JFVA 3C8HA 1XZQA 3SYMA 1XBTA 5CT6A 5IK2D 4BUJA 4V1CB 4G84A 2QJWA 1T1JA 4IOKA 4COKA 1KI9A 5K4LA 1HTTA 1GR0A 3GIDA 1I2AA 4LZPA 1TM5E 2QOEA 3O0TA 1SHUX 3NYWA 1XKTA 1G64A 3D6AA 4DB4A 4KIFA 3OY7A 4X1YA 1ZEMA 4QZCA 2OB1A 4HAIA 3PUXA 3GOQA 1Z34A 5DW3A 5CLLA 3F5FA 3EYZA 2OHHA 4P4SA 5FPPA 3KHHA 1DT5A 2Q1TA 5KFKA 4KXFB 1M10A 5KG2A 5AK4A 1I80A 1RI4A 3P0FA 3A05A 2I8AA 3C98A 2P0AA 2CLCX 3AU9A 3RSCA 4QYIB 4D44A 4C0BA 3PHIA 4EMTA 4UCXA 2EYUA 2W2PA 1LJUA 3JAKB 5HS4A 5G4KB 4EW6A 2YMQA 1F6BA 5C3UA 4I08A 2FLNA 3PEEA 5HCIA 4R81A 1GR1A 3DBHB 4OB6A 3IN5A 3ENQA 4BEVA 2CT8A 2Z2KA 4IDBA 4M3NA 4LY0A 1UINA 4FFLA 3T7TA 1E3WB 1XMIA 4B87A 3T7AA 4Y67A 4ZT7A 4RL6A 1GZVA 3X1XA 2BFAA 4EUEA 2FNAA 5KFAA 4M0AA 4HN4B 3KQYA 1VL2A 4J9VA 1JFTA 3LKBA 1CUGA 5IARA 1NGSA 1ESNA 1XXLA 5F1PA 5JSHA 1KO8A 3PICA 4FI3C 2PH1A 2C2DA 1I6KA 4FR2A 1AZSC 2GN6A 3PF8A 5IFLA 2QU8A 5L7TA 1DAPA 5BPCA 2EAPA 5EGSA 1UPTA 2WD7A 2MMGA 3VV2A 2A9KA 1WUIS 2KZ3A 3LT0A 1U5CA 4DJAA 4J16A 1Q5PA 3IBSA 1YRWA 4M1ZA 4TL7A 4YMWA 1B0PA 3C1UA 3EPHA 3V1UA 2GBCA 1T9GR 4AX8A 3ZHTA 1JEAA 1BOOA 3AYXB 4A16A 4A6XA 3EVAA 3VSBA 4DCMA 4WQMA 1JPUA 4TRRA 4MIOA 2XDQA 4YN3A 3IQGX 4V0MA 3BXEA 2BT4A 4MS3B 3HCRA 4Q05A 2XDYA 3DHEA 1VB3A 3AM3A 5CEFA 3UA4A 4LGVA 1Q2UA 1G6OA 1GUZA