4KX3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with thymidine monophosphate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Structure of murine cytosolic 5'-nucleotidase III complexed with thymidine monophosphate
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4kx3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4kx3A01
3NIWA 4UMVA 1TJ5A 3U26A 5AVQA 3R9KA 1ZS9A 4C4SA 2PR7A 1RC8A 2ODAA 4OD0A 3UMCA 2HDOA 2QLTA 5AW6A 2YMQA 3FPBA 4YCMA 3CZ4A 4HGOA 2YBDA 3QUCA 3U13A 5AW1A 5E0OA 3EF0A 3B9BA 5AM3A 3VAYA 2YMPA 1WR8A 4EZEA 1CR6A 3KOOA 2C88A 3WK5A 4XE5A 5AW4A 1EK1A 2FPWA 5AVZA 4YGYA 4KX5A 3L7YA 5A3SA 3W5CA 4C4RA 4BBJA 1J8DA 2NO4A 4UMEA 3ED5A 2Q4RA 3ZWDA 3KD3A 1ZOLA 1F5SA 1RMYA 3AR8A 2YJ6A 2B0CA 3ONNA 2JARA 2G08A 1ZD4A 4XOUA 2I55A 3QGMA 3BA6A 1CQZA 3OPXA 2OYCA 3L1UA 4UASA 2WF8A 3PGLA 5AW2A 1IWOA 3AR6A 5FP0A 3NRJA 2C4NA 2OM6A 2X4DA 2RBKA 1YV9A 3KC2A 4BKMA 4CE6A 3IJ5A 1Z4QA 3ZI4A 2HX1A 3SMVA 3J7TA 1VFPA 5AKXA 4UAVA 1RKVA 4OHFA 2JAOA 1Z5GA 1YS9A 1MH9A 2YJ4A 3GYGA 4UARA 4UMDA 4UU0A 3ZVMA 2AUTA 4Y3UA 2D2VA 2NO5A 2OBBA 1KYTA 3E81A 1PW5A 3FZQA 3NUQA 3ZVNA 5AK5A 3D6JA 3IB6A 2G09A 4CF4A 3NALA 1L6RA 3MMZA 1QQ6A 1Z4OA 3ZWKA 3U7HB 2B8EA 4I9GA 1AQ6A 4Y2XA 5AVWA 4NWIA 3QU7A 3R4CA 4HYTA 1WPGA 2YMLA 5AM2A 1O08A 2G0AA 2GHQA 1QQ5A 1U2TA 2R8YA 2R8XA 3L8FA 5A3QA 3HLTA 3CNHA 3KBBA 4O8CA 3PCTA 3B8EA 4RESA 4HGQA 2W43A 2JGAA 2WF5A 1WZCA 3SKXA 5ALSA 5AI9A 3ET5A 2W11A 4KX3A 3EF1A 1K1EA 5ALOA 2R8ZA 3WK8A 4YCLA 3ZX5A 5AM1A 5AW8A 5JJBA 5ALQA 4BEVA 3WGVA 1L8LA 2FI1A 2R8EA 1T5TA 2Q5EA 2FPRA 3OCZA 4BEWA 1JUDA 1QH9A 4Y2JA 1Z88A 2FPUA 4G63A 2BDUA 3ZUPA 2FUCA 5AW7A 4DFDA 2FEAA 2BDEA 5AW3A 5ALIA 2PQ0A 4DW8A 4Y2TA 1FEZA 5AKHA 5T41A 2FPSA 5AKJA 3I6BA 3MPOA 1Y8AA 5ALRA 3TLMA 4KYTA 3E58A 3ESQA 5AESA 2G80A 1VJ5A 2GO7A 3FPSA 2RB5A 1ZRNA 4KNWA 4UM7A 3QNMA 4CF3A 3U7EB 2HF2A 1RLOA 2FPXA 4BX3A 4PNHA 3WK7A 4YH1A 3F9RA 3FM9A 3QUQA 2IA5A 5ALDA 4AS3A 1L7OA 1TA0A 4UM5A 2C9MA 1RKUA 4HGPA 3L0YA 4BNDA 1Z4LA 3K1ZA 5AI8A 5ALKA 2HCFA 3M9LA 1ZRMA 3AR3A 3BWVA 3HYCA 5AK6A 2B1QA 1YDFA 3I28A 4UU1A 2WHEA 2B8JA 2O2XA 1Z5UA 2MU1A 2HHLA 2YFYA 2P27A 2RARA 4EELA 1U7OA 1S8OA 1YNSA 1RRCA 4BX2A 2ZBGA 2ZOSA 2YMMA 2I7DA 3SKYA 4AP9A 5AVRA 4L57A 2O9JA 5AVYA 3WK9A 3ZTYA 3ZX4A 3DAOA 5ALTA 2P11A 3L8HA 4FYPA 1SWVA 2B82A 4UATA 1RLTA 4RETA 1RMQA 2WM8A 5AVTA 1U2SA 2DQSA 2WFAA 2YJ3A 5AKEA 3P96A 3L8EA 3DDHA 1VJRA 2GHTA 3MC1A 5AHXA 2YJ5A 2FUEA 3A1DA 1O03A 4Y2UA 1LTQA 1RQLA 1Z4NA 4Y2YA 5AK3A 5IS2A 4JB3A 1TJ3A 3WGUA 4B6JA 2GMWA 1QQ7A 4EEKA 5ALZA 3U19A 3A3YA 3NASA 1ZD3A 1ZD5A 1TE2A 4CF5A 3AR4A 4I9FA 1L8OA 2B1RA 3L0CA 1N8NA 2BY4A 4FE3A 2AMYA 1XP5A 3RFUA 3KZXA 5AI0A 1RLMA 1YMQA 2HSZA 4UMFA 2JAUA 3WKEA 4OFZA 3W5BA 4CNQA 2IOFK 4XPZA 3UM9A 4UW9A 2GFHA 1Z4MA 3SF0A 3N28A 5AK4A 2IOHA 3N1UA 5AVSA 1Z4JA 5AVXA 2IYEA 3UMGA 1LVHA 3AR2A 5AW5A 5AVVA 3SLRA 2CN1A 4J2TA 2JAWA 1J97A 4YCNA 4NV0A 2EARA 3OCXA 3A1EA 2HEGA 3U7FB 5ALVA 3WKDA 2ZXEA 4AS2A 2WF6A 4ZEXA 3QUTA 2YY6A 3AR9A 4Y2RA 3RF6A 3I1YA 1Z4PX 4Y2PA 4G9BA 4DWOA 4ZEWA 5IT4A 3DNPA 1X42A 2IOFA 3E8MA 4NABA 2HO4A 3B9RA 5ALPA 5ALXA 3OCVA 1Z4KA 1NRWA 3DV9A 3WKCA 1TJ4A 2EAUA 3OTQA 2CFSA 2P9JA 3SHQA 2NYVA 3M1YA 3L1VA 2QYHA 1RMTA 4UAUA 4HAIA 2HOQA 1Z4IA 3I76A 2W4MA 2ZBFA 3QU4A 3QXGA 2I34A 1T9ZA 4L6CA 4NFLA 4Y2SA 5ALFA 1S2OA 2I6XA 3AR7A 3EWIA 1SWWA 5ALNA 3QYPA 5AIBA 5A3RA 3E84A 3FGOA 1QYIA 4BYGA 2FDRA 4OCZA 3QU2A 2Q4TA 3IRUA 1U02A 4F72A 1YJ5A 3L5KA 4EENA 3EPRA 4YIKA 5AI5A 4KNVA 4DCCA 2RAVA 2AGVA 5AVUA 3N5KA 3OCWA 4C4TA 4EX7A 1Q92A 2CFTA 3PGVA 4MUMA 5ALEA 3W5AA 3QUBA 4IG4A 2WF9A 4L6AA 1NF2A 3WK4A 3QU9A 3OCYA 2B30A 4HGNA 4GIBA 4KN8A 5ALMA 5ALYA 2PKEA 1L7MA 2C8KA 3S6JA 3R09A 3SD7A 1ZD2P 4FFDA 5AW9A 2AH5A 1N9KA 2ZBEA 5AKZA 3UMBA 1RQNA 5AKGA 5AKLA 5AKKA 5ALUA 1Q91A 1RDFA 1ZJJA 4QJBA 4QQFA 5ALLA 1NNLA 3ZVLA 5AICA 3NANA 1L7PA 3OCUA 2YN4A 4H1WA 3NAMA 5AKYA 5ALJA 3AR5A 2MSNA 4J03A 2CFRA 1EK2A 2G1AA 5AI6A 2G06A 4XQ0A 1U7PA 4NAVA 5AKIA 3ZW7A 3WK6A 4MWOA 4BNDB 2I33A 5AM4A 2OA0A 1XPJA 3L0BA 3QU5A 1RKQA 3FVVA 3N8GA 4IFTA 4BX0A 1WVIA 1SU4A 5AM0A 3L8GA 1XVIA 5IT0A 4HGRA 1RPZA 5ALWA 4JDPA 4ZEVA 3ZTWA 2HF7A 3N07A 4Y2VA 2ZBDA 5ALHA 1L7NA 3QLEA 5ALGA 2P69A 3ESRA 2G07A 5AW0A 3A1CA 3W5DA 5AM5A 3U7GA 3ZU6A 2I54A 3WKAA 2C8LA 4F71A 2VKQA 3WKBA 4EX6A 2ZG6A 3PDWA 4YIHA 3MN1A 4GXTA 3ET4A 1T5SA 5AIAA 2EATA 4Y2QA 3QX7A 5AI4A 2WF7A 2HI0A 3KDPA 4E88A
chains in the Genus database with same CATH superfamily
2PSFA 4PIVA 4ZOLA 3SG0A 3OBBA 2F67A 2XTAA 1O5TA 4ZKDA 4DQIA 5AW1A 3NH9A 5AM3A 4JB8A 1EWRA 2GYUA 5SYNA 1UOQA 3O74A 4BASA 5B1HA 3N3BC 2CMKA 1QOPB 1I4DD 3L7YA 4TUYA 1BWPA 1TI7A 4EECA 3BSWA 5FPYA 3AUXA 2HFKA 1H94A 2HMSA 4MIKA 2QB1A 2VSQA 5TEVA 5JEDA 2EKQA 1QQAA 1I3LA 1ZNYA 3P9NA 3ZD7A 4W6QA 3ENNA 1RPTA 5AKXA 4BN4A 4UARA 3PXXA 5BQOA 1VLJA 2CPRA 3ZG6A 2J85A 1RYNA 3ROPA 4ECZA 7ICKA 2ACVA 2DUUA 4X8LA 1UP7A 2AZ4A 4AJ4A 3DJYA 4U6QA 3LGXA 1E3MA 1LPSA 1WD7A 4ED8A 2QX4A 4GZMA 5BPCA 5AW8A 4DHEA 3L6CA 3ELYA 5CTJA 2CMFA 3CEHA 1Z2CA 3X1YA 4FR5A 1P7ZA 1I13A 1EXMA 1FFBA 4GBJA 2HSGA 4PHAA 1H6AA 2A1TR 4KOAA 4Y2TA 1VMEA 1F6DA 2MSWA 8ICTA 5FOTA 4FWBA 5LP6A 2K2QB 3LTNC 4RNMA 2XNDA 4FMCF 3GFPA 2W48A 2NXJA 2QRLA 1A8PA 1OA0A 1RSZA 3MGHA 2V4UA 3JWPA 2WHPB 3VSBA 5ES4B 2BFMA 1YDFA 2FFJA 4YXFA 4M0MA 4ZIRB 1K66A 2C4KA 1V37A 3BGWA 2A7QA 2JAHA 1UBTS 5LOVF 2O8CB 3UQ0A 5B6JA 2QD3A 1ADJA 3VU9B 1GPWB 5GV8A 4DQ0A 2NOAA 3LCCA 4RACA 2C94A 4XIGS 2I4NA 3LVRE 3RU7A 3IR5A 4UAZA 3CJRA 3AG6A 1TK8A 5A4JA 1YKGA 1QHIA 4KO4S 4K6MA 3ENZA 4W8GA 1F5NA 4N0QA 3S99A 4DBLC 4DSIA 3HQ4O 1T9CA 4EKDA 5CRXA 2IXEA 3IG5A 3DMTA 3LQRA 1HOTA 1N2JA 3VSCA 5HF5A 4X45A 3TAPA 4LJKA 4HH3C 1DVRA 1C0IA 2XNKA 3FOEC 2CXQA 1ISPA 3BJRA 1ZN2A 3C5EA 1QHHB 4A8JB 2FRXA 2XR1A 4KRXA 4DLWA 3BCHA 1CQPA 3DNPA 3G9ZA 1RHUA 4DOCA 1NM5A 4NYJR 3HXPA 4UHCA 1VHLA 2AEFA 3OQJA 3H18A 1TPZA 2VXYA 3S2YA 4G0NA 1R27A 5DHAA 3W4JA 5JEEA 3UIEA 4RLSA 5K6TA 2VP0A 3OZGA 1S0NA 1PZEA 1RXCA 3W6OA 3E9QA 5LLSA 4E1BA 3GEBA 2ZRJA 1Z8HA 2PZLA 2R2AA 1QU3A 1NBEA 3GVCA 1RKBA 2YWFA 5A4FS 4ANFA 4DUPA 1OH7A 3TOSA 4MOWA 2J6IA 2J3MA 1LPOA 4HWGA 2H4WA 4US9A 1PT9A 2XVZA 1I2AA 1FDVA 3GJQA 1D8AA 5AFSA 2AI3A 5CXUA 3AL0C 2CBXA 3MA0A 4C8OA 1IHYA 1ZN7A 4UTXA 1IYZA 5JRZA 3PWSA 2ASVA 2GO1A 3G0OA 5CFZA 1PJ2A 1AK2A 1ZQ9A 2YC4C 1OZAA 4F9FA 1NVKA 2RP5A 4A92A 3HCFA 3W8RA 1A88A 5EJ4A 1ECLA 3ZC3A 4V39A 3C3MA 8ICNA 1ZAKA 4B48A 4WW0A 1BDJA 2C2OA 3WZLA 4OAOA 2H51A 1PG2A 3EDMA 1K4YA 1LDNA 3ANSA 4UTRA 1SA0B 4W5OA 2C28A 3K0KA 4TV9F 1ONSA 3HSKA 3N8IA 5HNKA 3C8UA 2ZANA 3EVEA 1YZNA 3IB3A 4KP7A 3KOOA 3IQEA 3LXRA 1QF7A 3H5NA 5IAJA 3B78A 4HNRA 4QJIA 3A25A 3L9WA 4Y6QA 2JARA 5BOVA 4C7MA 2H92A 2P77A 4DLPA 4PLVA 5HIMA 3ZJYA 1DRJA 5DCWA 3SI8A 4QBFA 3FFAA 1LY1A 5BR4A 3J7TA 4TN5A 2VNKA 3MUFA 1ZSNA 5L1LA 1WA5A 3H1BA 2W9MA 4KLMA 4X8OA 5L3VA 3H83A 2GJ9A 3ZWKA 3GJZA 1L5QA 5GV7A 1Y9EA 3GELA 1KE1A 3TTUA 3P9QA 2FSFA 4NEHB 4R1MA 3EA4A 1EPUA 3DE2X 5EWFA 3HILA 1WHTA 1U5BA 2BM1A 1E1MA 3SHWA 1W36B 4X6UA 4QLBA 2CLMB 5DLYA 1BH6A 3LY8A 1XMOB 4KIWA 1DDIA 5JNRA 4U2BA 1ESMA 1T7PA 1CIJA 2IX3A 2PFQA 1LQTA 8ICOA 1L7OA 1IHPA 3VPBA 2D0IA 1QR2A 1WBBA 2QI9C 2FV8A 4RELA 2H31A 3BWVA 4M2LA 3K15A 1XTTA 2QUJA 3U1BA 4O5EA 4P38A 5DLQC 1DKOA 3RC7A 2YYZA 4G1UC 3UWKA 1XD2B 4QFBA 3WIDA 3SR3A 4PU0A 4PJ0U 4PX5A 2D5AA 2XIDA 1S01A 3EODA 1ZP6A 6ABPA 4XI9A 4GVLA 5KX5B 3MJ4A 1K4KA 2O8DB 4RD4A 1R6XA 1H6BA 1DLIA 2ZS7A 3RVOA 4MI1A 1U2GA 4J0FA 3LSTA 3QE3A 5KQSA 3RT1A 5FUYA 3T3OA 1HQDA 2GESA 2KV2A 4TTTS 3U19A 2BHNA 5C35A 3TQSA 4ZI7A 3IILA 3RVQA 1N5JA 3BBPA 2UXBB 1P45A 4FDAA 3HEAA 3GIMA 4JXZA 3R7AA 1BMFA 1LUAA 5IHPA 4AJJA 2MUTA 2GT1A 5DWQA 4BN0A 3EH1A 5AO9A 1OR8A 4NDZA 3ONEA 3GCWA 4PAWA 5TJ9A 1XCPA 1R8XA 1KIAA 4XSGA 3M9OB 1ELOA 4TTIA 2Z09A 2IWRA 5FV7A 4EJ6A 2O5CA 2JIQA 3R6DA 5HKKA 3OE7D 2FW6A 4J9UE 1EQAA 4L9WA 3FB1A 4US2R 4UUPA 3W2IA 3L1VA 3R3XA 2CUKA 4AM8A 5J2UF 3B0YA 4XYEA 5KYWA 3H40A 5HGJA 4DFKA 1XZGA 3E5MA 5CDFE 3QU2A 5J0QA 1CR2A 3CV3A 3D8TA 4Y8VA 4R71A 5A2QA 3ZK8A 1XKLA 4XQ8A 1YR9A 2E1EA 2LCQA 4LXUA 2O3TA 2V55B 3KZMA 3V1TC 2IS4A 1BDHA 4YROA 1H2BA 5CB4B 1D9XA 4AMBA 4NYJQ 4DV6B 1WMEA 5J2TA 1K7EB 2ZUSA 2AOUA 3PUKA 2R8PA 3BZWA 1APBA 1V1JA 2V4ZA 2QQ5A 2QMEA 2XDYA 1USKA 1KGDA 3TWOA 4P22A 3D81A 2OVBA 5PNTA 3N05A 1E77A 2XHEA 2UYCA 1S0VA 4KG7A 2AEEA 1Z2PX 3BK1A 2IGTA 3MJRA 4W1SA 3EOAI 3M34A 7ICHA 4B4WA 2VP4A 3TBFA 3FSRA 2P4SA 1V8ZA 4K5QA 4V24A 5JD3A 3CLTC 2POCA 4NPCA 3EZXA 1FTNA 3IXLA 4CIAA 4WKPA 1EUCB 3R0VA 2HA7A 2H63A 1X1AA 2Q50A 5GJVC 1IZ0A 2NVOA 4I1SA 4OQNA 1Q0UA 2OZLA 2JGNA 3CR7A 3I5MA 1HMPA 5ENDA 4ZCQA 5EUQB 1RJDA 5I9MA 1IXSB 3BD7A 4V3BA 3BL6A 1BZYA 4KVZA 2I65A 3RNOA 1GRRA 4JUAA 1TTPB 3G6VA 3IJPA 3ZZ0A 2MIIA 4DZTA 1H2EA 3BA6A 4WLVA 2O0HA 2IU6A 1B3RA 1JILA 4IXMA 1NQTA 4HNAB 5H81A 4OI1A 1IBCA 1M34A 1NJ1A 4MI9A 3ZHXA 4B46A 2VJAA 3S55A 3IT2A 3LU1A 3NALA 2NZWA 3UAGA 5F1OA 4OGWA 3C3KA 1R9JA 4NEGA 4NESA 1VQ1A 4KDFA 3L7JA 4YECA 4NOMA 1ZY2A 3GDOA 2R48A 4OXIA 2W11A 3V8VA 3UCFA 2DQ4A 2JGKA 4ZZ3A 3HDGA 5F52A 4YAFA 2J33A 1Z88A 4H4EA 2QTMA 3NYRA 5ES3A 3F5MA 1JHQA 3LT5A 3FPFA 1KKXA 3QNMA 4LYAA 4OBEA 1DKNA 3O0TA 3MMNA 4LFCB 1PU2A 5BW8A 2WU3A 3U56A 2H8GA 1FDWA 1ZH8A 3C24A 3PDIA 2OGTA 2JLQA 2IYFA 3HY4A 5ERXA 1EE9A 3C2MA 4ED9A 3UMSA 1K6JA 3C15C 1TYZA 3FE2A 3SVLA 4E2ZA 4BNGA 5J2EA 3BXXA 2VHWA 5IDWA 4ENPA 3OJCA 4XSHA 4IQGA 3BWCA 3W7VA 5C1OA 2R7KA 1GFSA 4IIJF 3AOEC 2EFCB 1M0WA 2UVWA 2VTBB 4M0AA 1RQLA 2XRMA 1PF7E 4EG5A 3K4HA 3L6DA 3K70C 3SV4A 5THQA 2C2KA 1KTQA 1JQJC 2I87A 5FT9A 1ZQAA 5JTIA 4A27A 2X0NA 4BECA 3MABA 4BC0A 1UPAA 3SSAA 4YRPA 3HY3A 5HQ3A 3K8OE 3P5SA 2BFWA 2EP7A 3CLHA 5C8DA 1U80A 1YBFA 2IHNA 3QVOA 4PW0A 1OLUA 5F5XA 3F5FA 4TWIA 3NTUA 2WG1A 4O3MA 5EZYA 4TLBA 1Q16A 2JEGA 3B20A 4NOLA 4K1XA 5ALVA 5T8KA 2JNWA 1R7RA 2Y2UA 1NOIA 3SYNA 3TZQA 4G9BA 1NJ6A 3RRNA 1AZTA 1ZYUA 2GBLA 3PNPA 5BYAA 3AQEA 2ETXA 4G0MA 3PW4A 5F9LA 1KYVA 3KTAA 1ZQRA 1M8FA 3M6VA 2YNMA 1N56A 4UAUA 3UG6A 1XAIA 1LZLA 2CVOA 1AKTA 1G7CA 4MUJA 2QZJA 3RJ9A 2VQDA 2C9BA 2HNBA 1UBGA 3RB4A 3RFXA 3TW0A 4M8IA 5KHLB 3KETA 3PFIA 3RJEA 1IAVA 1KOGA 5JPCA 1G0OA 1XNQB 2YV3A 5KT6A 2AN9A 1G5IA 2IE8A 4CN8A 3KQTA 2XMRA 3WGYA 5AKKA 3ZLJA 4I29A 3TOVA 3DDWA 3HLYA 1W73A 4X93A 4XGIA 2C84A 3F3KA 3C2KA 3T3FA 2GEJA 4Y9SA 5AKYA 1RS0A 2ANCA 3IBTA 3ISDA 5CDHA 4UE6A 1FVXA 3O7WA 4KFRA 3KUDA 4FKZA 2PZKA 3OFNA 2QUIA 4KQEA 2K4EA 2XNDD 3DZJA 1ZNZA 2XPCA 5KS2A 2J7KA 1TGYA 3TUJC 2BJVA 3VNVA 4CM3A 3A1NA 5B7NA 3WNDA 1QO7A 3Q3VA 3C8DA 2JH7A 1IZ8A 1UZAA 5ITZA 4B79A 2FRVA 1VGVA 4RUAA 1JFRA 3L0DA 4DLEA 2FN9A 4MQMA 4QOHA 5ESDA 2OH2A 4WBNB 1AQJA 1HE3A 3C5VA 3GLHA 2OGUA 2VJPA 5F7JA 5EJFA 4NBKA 4DY4A 2WJPA 4XYMA 3G68A 1XAHA 1KFDA 3RAJA 3E53A 3VNQA 4KSCA 3AONB 1SEPA 1OU4A 5J0RA 4IEFB 4GXIA 1NDHA 1RYEA 2GAFA 5GP1A 5JS8A 1XPUA 1F8GA 3NRJA 4LC9A 3AVVA 3NOXA 2OM6A 3FSJX 1BXRA 3IURA 4ZYUA 3D2SA 2AFHB 3LHIA 4LPKA 2NPOA 4KFCA 4HMQA 2W9AA 3D1JA 2NU9B 1WB5A 3OQMA 3U7IA 2ZWOA 5FOVA 3A58B 5J29A 3GGGA 5ESWA 3KKMA 3VZRA 2Z08A 3OOWA 2FLNA 4AN1A 1WXQA 1QPGA 2W6CX 4PZZA 1NR5A 5I7FA 2VQ3A 3LUAA 1GKIA 3A9CA 3OPVA 1S02A 2QYSA 1X9HA 4ZAVA 4M9HA 1R9MA 4L5AA 5JH7A 3NNSA 1CX9B 5IZCA 2B20A 5AI9A 2IP2A 3HR7A 1ODJA 4XB6B 5B3AA 2AFHE 4A4DA 4GWLA 3ZJUA 3IEVA 2X8JA 3P0FA 3T79A 3L0PA 1Z5NA 3IQXA 3TSZA 4XAQA 3PSPA 1L4NA 5FPQA 3B1FA 2HWWA 5FQOA 4NK5A 4U5XA 3HVKA 2YV1A 1SXQA 5CX1A 3HJHA 3GH1A 2R00C 2VXOA 1CHNA 2BFNA 1U8AA 4D98A 5BMOA 1ZQEA 4G5YA 4U1RA 4Q18A 1OXUA 1JS1X 3V8BA 3OJOA 2JCXA 2ZB8A 2AFIA 4TKLA 3LYAA 1V26A 4MKGA 3S2EA 3ESYA 3TR5A 3FYUA 2C5FA 5L9AA 5B1IA 2OYRA 3HDJA 4F1JA 2DT8A 1W47A 1YDEA 3QWAA 2QD2A 7GPBA 1MQ9A 3QW2A 5GONB 3G59A 2VP6A 3PFFA 1NQAO 5ADHA 2WMNB 1H3EA 2ZS9A 1QP7A 3KB8A 3JS5A 2DERA 4OSOA 4MK4A 3PRKE 1X6JA 5JSHA 4KK3A 5K3FA 1K75A 1KF0A 3BMOB 4MRVA 2P3LA 3MJDA 2VNSA 4IV0A 4NZNA 1GNRA 2O1EA 4MQFA 3OM0A 4FCCA 4M49A 4M38A 3S2ZA 3N7AA 2FMHA 4NQZA 3SZ2A 3U49A 2PUFA 1CUSA 1JRPA 5KFJA 4O4JF 4Y6PA 1EA7A 2D7JA 5AYVA 1GPH1 2HT1A 1V1MA 1ZVQA 1KRHA 5GZ3A 4J8PA 2HU5A 1WQ1R 5DYNA 5BN5A 2O2CA 3ZQUA 4DQXA 1P7VA 2QD1A 3B6MA 3H2YA 6PFKA 1TPYA 3COVA 4MW5A 3NM4A 3F6PA 1ULAA 1ARZA 1OYYA 4ZVNA 3GHYA 2NO1A 1W2WB 3CH4B 4MAFA 2CL7X 1RJGA 1UMCB 4RH3A 2XQVA 4WNAB 4DQQA 5I45A 2IF2A 4JBGA 5B6PA 3CCBA 3MYYA 2QK4A 4G4SP 4YT4A 3WNZA 3LVBA 4XM0A 2IXTA 1F6BA 3VV3A 3B0XA 2ZIGA 3GZTB 3G6YA 1LSOA 4MCJA 4H60A 4O3OA 3CE6A 4DF4A 1PEAA 4YR9A 3VDRA 5ETJA 2X23A 3G2LA 4YJ2B 4LZJA 3Q6IA 1F0PA 2UVQA 4LSMA 3QVWA 5A6SA 1ZUHA 3CLUD 3PGXA 3SEIA 3GLRA 4LDZA 4EY3A 4BJQA 1TM5E 2QEQA 1NBWB 3UOGA 5KFNA 1TLTA 5DBIA 1D2CA 2FF7A 2AHRA 4AYBC 1FU4A 3BF8A 3R9XB 4FFBA 1G8GA 3EXIA 2GZ2A 3KTDA 2Z1NA 2YFHA 3FDXA 1JE0A 5HGXA 4GXTA 3C29A 1XQ6A 3K30A 4BJ6A 1PS9A 2VDWA 4R8RA 5KOJB 3NZEA 2PYIA 4CHTA 4LBWA 4G23A 4XDYA 3NV9A 4EHBA 2GZ1A 5HIIA 2NYAA 3N76A 1ZJ5A 2XMDA 2HHJA 2CSUA 1KYIA 1A72A 2X5NA 1U1IA 2KS6A 4QUJA 3OQPA 2XBUA 4ZVPA 2Z5LA 3KEGA 1KEJA 3NH6A 3ED5A 4DVJA 4XH9B 5KG3A 5E38A 3PD1A 2Q41A 1TVKB 2HPHA 3ROMA 2FPGB 2GI4A 3ADKA 3LYUA 2WHQA 4ZMBA 2DP4E 3EK2A 4OHBA 3I0MA 3G0IA 1K97A 2B9VA 3B82A 3NHWA 4EY6A 2CFOA 2QRNA 3DCYA 2KYRA 3FAZA 4HTFA 4MCHA 4NL4H 2DQKA 1ZGCA 4LYDA 2G04A 3HEMA 2IEAA 1WF3A 5E1MA 4QRDA 4RANA 3VZDA 4GE3A 4E2YA 1KBOA 4GC6A 3LOPA 5HKKD 3VKGA 4OF4A 2JLYA 4DJTA 4OL0A 3QTLA 3JQFA 4HI0E 2ZE8A 2ES4A 3MCZA 2CDRA 4ZJYA 1H2HA 4ZQCB 1NKBA 3EG5A 4CLEA 1GR0A 4E4RA 4DW8A 2XVTA 3H1AA 4EBEA 2I8LA 3ZGVA 2OV2A 4KLUA 2OHJA 4J07A 1ZH2A 4EGAA 3H9JA 3RJMA 3T3HA 4Q1DA 3GZNA 3MWDA 4OTZA 2RHFA 2BGTA 4M0FA 5FUBA 5HDBB 1KO7A 3BD9A 2O2XA 1O96B 4IO1A 4DJDC 1X8JA 2R1VA 5GOZA 3ILXA 2DY0A 4ETIA 1Z5WA 2AOVA 2BF7A 1X86B 1DEAA 1T6ZA 5AUOB 1KAOA 4Y9DA 4RV5A 2QTZA 3VI3B 4F92B 3GEIA 4U7JA 1TKCA 4UVHA 4C6SA 4HDAA 4ZMSA 3E8SA 3OPMA 1J1IA 1BNPA 2QMZA 1DB3A 4PCLA 4E22A 1ZG3A 2Q2QA 1SOMA 4UHEA 3A6HA 1GRCA 2M1ZA 3DZIA 4LVUA 3LK9A 1VKOA 5E2IA 1JKMA 1MBZA 2JH1A 3IPRA 4FB4A 2GILA 3B1JA 1EXVA 2VJMB 1HJPA 3DLIA 2QGNA 3L0SA 1OUQA 3UMGA 1Q0PA 5J9FA 4EYGA 4YRFA 1I1HA 2AQ8A 2CXYA 3GXOA 4P7BA 1CFZA 1WQ4A 1GTJ1 4DJAA 1E9VA 3GJ7A 4D9CA 4WCVA 2QQEA 4KUEA 5JVDA 2DFLA 3ESZA 2KSOB 4CIXA 5KFOA 3E4CA 1G6OA 3THYA 5BVHA 4LNHA 1ZJNA 4YRLA 1KETA 1Z0IA 3FSEA 4WKNA 4R9SA 3GJSA 3QKRA 1IN6A 4G2NA 4B9VA 1I0LA 4POAA 2GN0A 4CQMB 3JVUA 4FZJA 3MILA 2Z98A 3M6XA 5DYTA 3VKVA 3K2EA 2Y9PB 1NG9A 1PL6A 4EENA 3F4KA 3F53A 4C4TA 1J00A 2GLUA 4RIGA 1SEVA 1CQIA 1P4JA 3RFCA 1PJZA 4AP5A 3ZHVA 3HUTA 3NHAA 2C03A 1K9SA 2AUNA 2VJQA 3U5TA 3Q8XB 4TWZA 4MWCA 5EHZA 2MOKA 1J23A 1P19A 1KSPA 4YRQA 5L1JA 4TYMA 3QQ5A 4ZI3A 1PSWA 2REOA 2CFRA 4OH7A 2EZZA 1TKDA 3JQAB 3A26A 3C3YA 3ONWA 2CJWB 1U2DC 3M9NB 1TKBA 1X74A 3SC3A 1RIIA 1XZBA 4IICA 5IARA 4C6HA 4HDKB 3M2TA 4KQWA 2Y4OA 2RGDA 3P4UA 5B7QA 2E2WA 1GRNA 3ZDXB 4OO1J 2A92A 3TLJA 3OX1A 3PI6A 9ICFA 1XU4A 5KYYB 4KRFA 3D3KA 2OP0A 2AX3A 1KJQA 3SX4A 4D3SA 3DF9A 1PK7A 2WE7A 3T5BA 3NTLA 3IBSA 3FPBA 1G63A 2B92A 1VSQA 3RV4A 1E4OA 7ICSA 4JIMA 1K1SA 2G25A 1F5SA 2RCNA 4X95A 5FNVF 4YRKA 5B5SA 2W2KA 1NKSA 3HKBB 1MOSA 1AK9A 5CRIA 5LSAA 1KR2A 2FG6C 1U0SY 1XOIA 1TTHA 4GSYA 2V9CA 2JV3A 3LMKA 5KQRA 2V4QA 2AJLI 2XUQA 1GGEA 3OHMA 3ZVNA 3IB6A 2H1OA 4MA5A 1FYWA 5EXTA 1CJCA 1G8KA 2R8HA 4JX8A 2OV1A 4FOPA 5FB3A 3H5WA 5AHRA 4KNYA 2FW7A 2R8YA 2Q6VA 4ZQEA 3RBAA 1JDVA 4S1OA 4TXLA 4D0GA 1LSUA 4XIFA 5KTTA 3WFZA 3NCHA 2M32A 3I6MA 2WKWA 2YNMD 3PYLA 4KPUB 2VP5A 3MG9A 4JV0A 2HBMA 3C1ZA 4FDVA 3CWQA 1DRWA 1L7EA 4X1YA 3HCWA 5IAKA 3RJKA 1VRWA 3I9V6 5GADl 1BE6A 5J2GA 1RLOA 3THVA 2YIJA 3NONA 3HUEA 3PXUA 4M4SA 4W8OA 1E1QD 2YYYA 1KYWA 2FF5A 4QWBA 4D9GA 2Y05A 4GX5A 1JLHA 2FGJA 1NQUA 2FWNA 3Q5GA 4XASA 2XB6A 1FSPA 3O8BA 5J2JA 2RARA 5AR1A 2HKIA 4FS8A 3DOJA 4AP9A 1KZYC 3DKKA 1U7TA 3FWNA 3AETA 1JXQA 5EP1A 5JWRA 3P5BA 1KMMA 3BL8A 5AJXA 1Z47A 3DBOB 1LU9A 3OPYB 2VF7A 4R6WA 4PGMA 1NV8A 3CY6A 3I12A 3UGKA 2EKPA 2CBGA 2BH9A 1E2KA 3ICWA 3B1KA 3WYAA 5BWNA 1QYRA 1XR3A 3I6ZA 1XWLA 3SP1A 2P9HA 3N28A 3IPAA 1GITA 4JWKA 3GBVA 4MW4A 1E1YA 2Q4BA 4Q9DA 6REQB 3E4DA 5ADWA 1L1RA 1AV7A 1ACLA 4LHZA 1S2NA 2VATA 1YHZA 3S27A 4B7UA 2RGWA 4UZFA 4YALA 3AR9A 4NR0A 3GH3A 4MO2A 3K9NA 4UEQA 1AH2A 4NLNA 4JQCA 1FYXA 2NYRA 1YR8A 1EINA 4K9QA 2JLCA 1SC6A 1HURA 1DU4A 2FMFA 3URKA 3ZZTA 1MRZA 3M4ZA 2IEZA 3BG5A 2FZVA 5AXCA 3C28A 2BE7A 2AXPA 1P4GA 1KO8A 2O2YA 1AUOA 2YXNA 1N7IA 2NTJA 5EJ7A 3EPRA 2VHJA 5LUAA 2A1JB 4O2BA 1GCIA 1E5TA 5CEJA 5CX4A 2JD2A 2CYAA 2VHYA 4B6SA 4FFDA 4XX0B 3WMFA 3HACA 1ZQZA 2QG6A 4D4MA 1PHRA 1I7QB 5HJEA 2ZIVA 2HPVA 3PJDA 1DUSA 5ESRA 3OO1A 3IHQB 2R11A 2J7PD 3VPHA 2V8OA 4YV1A 2FOLA 1ZCAA 5JRTA 1RZ3A 4HH1A 2NACA 3BTUA 5K6AC 1NMQA 3HBJA 2QF7A 1IAQA 4KODA 3DD1A 1UXOA 1H2FA 3U62A 1PK1B 4GL2A 2W4QA 4GOOD 2RRDA 2CE2X 4HX9A 1G6KA 5F3RA 2P69A 1H22A 3MCTA 5GJBA 4F7WA 1JT2A 4DLAA 4MPRA 3QFSA 3FNIA 4M1QA 4PGQA 2JEIA 3KZOA 1RW4A 2OAQ1 3KDPA 4GF5A 2W3RA 2QP3A 1TVEA 5AXBA 4AUNA 4OD0A 1M10A 1OTXA 2W70A 2YBDA 2BGWA 3QPCA 4Y9RA 3LRXA 5EHGA 3LX5A 3BE4A 5AW4A 2FSGA 4WZZA 2VWGA 1A9XB 2E6UX 4A6EA 2Z5VA 1SPBS 4YQFA 3T9BA 5AJTA 3OIDA 1GV0A 5I4KA 3BBLA 2FJUA 1OT3A 2Y6UA 3BQNB 2I4RA 4QHSA 5CLJA 5K6RA 1KU6A 4I28A 4RJIA 4MO9A 3PY8A 3LUJA 3UQYS 3R24A 3GNLA 1JI3A 421PA 2I8CA 3FKSA 4MUIA 3QTTA 2QP9X 4IIVA 1G3UA 1S8FA 1UKAA 1XTVA 3QLUC 5JS7A 5CGQB 3CUSA 16PKA 3I2YX 1XVLA 2AKAB 3OURA 3D6VA 1ESZA 5B30A 4DIUA 2J32A 2OPHA 4LXQA 2L18A 3L4SO 3GN1A 1QMGA 3BZKA 3K73O 8AT1A 4D4JA 2FEPA 2ZRKA 4DQDA 4IDHA 3ZCPA 3F5EA 1ZUNA 2DBVO 3UXYA 3GUYA 2B6GA 3QA3E 4HL6A 5ER9A 2FTKE 4IX9A 3EF3A 3Q7RA 2GK4A 5AI8A 4J0JA 3VR4H 1PQYA 4TYNA 3GO4A 2IIVA 2WPNA 3DAHA 2C2MA 4M9XA 3L1KA 1TMYA 2V8BA 3DHVA 5K0BA 1OHHD 1N0HA 3IAM6 4TT3D 1DIBA 1XZPA 3S1LA 5IVDA 4GYWA 3EG9A 4CFYA 2O2GA 1N9ZA 2XCSB 2E3JA 1P44A 2O6LA 1ECBA 1K7YA 3O3CA 3D02A 4EUEA 2IVFA 3R3JA 5GJWC 1WNTA 1VRVA 3OQVA 5AXDA 2XAAA 2HHXA 3AEQB 1O0BA 2EX0A 3OZTA 1YZYA 5FYQA 3N2LA 5IBCA 1PUJA 1V2HE 2RC5A 3CONA 1S77D 2B7LA 3OIUA 2NWQA 1NE2A 3JR7A 1WZUA 3GYBA 3EPGA 1ULZA 3JZFA 1X7ZA 4URUR 3U60B 3THXA 4RAQA 3IAAA 4HDCA 1E2UA 3QUTA 3CKLA 4FLFA 4R2HA 3D2AA 2F64A 5FBRB 3LUKA 1OXJA 1GU1A 4DWOA 3O03A 1R12A 2GTHA 2QY9A 3L7AA 1NVAA 4P2GA 4UXJA 5BNTA 1EKXA 1U0BB 1HM5A 2VQSA 5CCBA 3FJ1A 4ZQFA 4QM7A 4JY7A 3ZV6A 2YJTD 2QYHA 5BNZA 5LNK6 3NTOA 4BNUA 1XZ8A 3I5UA 2KJ8A 4DGSA 1RJEA 3LPLA 2XWJI 4O4LB 1T1JA 3X1MA 1ZNWA 2VUHB 5AP9A 2RI1A 3W2TA 3PEVA 3QMPA 4XJXA 2E8PA 2LDXA 4HQKA 4Y6GB 1V8PA 3GROA 2Q0HA 3TG8A 4V1CB 4C06A 5G0SA 1HE1C 3PEYA 1PVDA 3GVXA 3RR7A 2PHZA 1NSYA 1L5WA 1KW4A 4QGFA 4HAOA 1G6HA 2K4IA 3GRFA 4M46A 1Q3UA 3U4DA 2WAOA 3PEUA 2X2PA 3HB5X 3RAQA 3ILHA 2XJ9A 5D1HA 3K35A 3O8DA 3ITNA 1KY2A 1CUEA 1R8SA 2VK1A 3TZKA 3ZHCA 2V6JA 4PYNA 4MNTA 3PC6A 3GIIA 1E63A 1XJCA 4TTRA 5ALHA 4NBRA 4H08A 4IINA 4PRKA 1E69A 3VO1A 1P2SA 1N5LA 1TL7C 3DP9A 2NU7A 3TM4A 2CDNA 3E2EA 1MW9X 1GZHB 1RXIA 1MUUA 1P75A 2XIJA 2PZFA 5CDSA 2H6EA 4M60A 3NGMA 2GB4A 4F4FA 4REMA 3LQYA 5LBTA 5T14A 3G23A 1U0HC 2NV6A 2CXNA 3URMA 3O26A 1JQLB 3OTGA 4RD0A 3U48A 4PZ0A 4KLEA 3AB3A 3NC0C 1IG0A 4RSRA 2NRXA 5GIPE 4P0PB 3ZKAA 1U3UA 4DJJA 1PQ4A 2CLDX 4F2RA 2ODPA 2XGJA 3JQBC 1V41E 2XTJA 1NJXA 3NPAA 2P2ZA 2J9FB 2WZQA 5YASA 4M6WA 1T4CB 3RT9A 2P35A 3WJ2A 1E7YA 3V8MA 2OV3A 1Y4DE 4HYQA 4PGGA 2WFZA 2B6HA 3DBLB 2GJAA 2GK3A 1L6RA 2PUVA 1IQUA 4JZKA 1GPLA 2GVDC 1CRZA 1JDZA 2WB4A 1YI1A 1P1JA 2ZCVA 2ZYRA 1KQFA 3AKCA 2J6UA 3QP9A 3GV5B 2IL1A 3TTYA 3GLUA 4NULA 3KL4A 4JT4A 4OQFA 5LDGA 3I23A 5FI1B 4MKZA 3RTDA 3RIEA 3H4BA 2J5KA 3IKLA 2HXSA 1X9IA 2X3UA 4IRXA 4PQYA 1RBMA 4YN3A 5EIAA 3T38A 2Q5JA 3E8XA 4GNRA 3CZRA 5LZ5A 3W77A 1FP2A 4N9WA 4J1TC 4TN1A 3Q9SA 4BQPA 1Z6TA 4UUOA 3N2KA 1VKJA 2VHTA 5CNIA 4CMIA 1Q1NA 1YA4A 3JZMA 2WOOA 4MW6A 1Y4UA 4HN4B 2H1LA 2QWXA 1Z45A 4IOKA 4DLNA 5A62A 1UPFA 3JVDA 3HM2A 3PUZA 4PVCA 3SZ3A 5CLQA 3AUTA 2IITA 4LVOA 5KUTA 4XFKA 5JXJA 3MCAA 4HUQA 4PAMA 5CR9A 3G1UA 5GZ1A 1IZ7A 2ZOSA 3N2GA 2EP8A 2PKCA 4TMVA 1XSNA 1JBQA 5ALTA 4DDUA 1YRLA 1R5NA 8ATCA 4RQAA 4XPIA 3KTFA 1USWA 4PONA 4RQ2A 4RKWA 2IPNA 5E4FA 3AQIA 3T4UA 2WWXA 4Q5IA 4U2CA 3KYBA 1F2TA 5TF0A 3SC6A 1L5LA 4DAEA 3GQBB 1KEKA 1FQKA 2W2QA 2PAAA 1MENA 3RREA 4F5DA 5D5HA 1ND6A 3GAFA 4PY2A 3SLGA 3UCXA 3IALA 4O1IA 3F74A 4TMFA 3A1FA 3QPBA 2WWHA 2ZTSA 3BWDD 1EDEA 4FHEA 3L7IA 2GNAA 4P98A 2NPFA 1EWYA 4ACAA 4E09A 2QL6A 4ZTUB 1BN7A 2ZXUA 1N61A 2YVUA 1L5HA 4J2OA 3AB8A 1MXHA 3GJXC 4IXTA 1TAHA 1FVFA 2KD1A 1MQAA 1AKRA 3GK3A 1SXHA 2M2IA 4PPFA 5LP6C 1ZJ6A 2VN8A 3OT1A 2P6OA 3K9LA 5IT5A 1TZMA 2ORVA 4N5DA 5D51S 3UMFA 1F12A 2PVSA 1UHUA 3DE5X 3EEFA 2ZULA 1N92A 3DT9A 3A27A 1RTTA 1T9HA 1R0ZA 5AVUA 2OL4A 3L6OO 3SFVA 2JJ8A 2ZJ8A 3M5WA 3RUEA 3ZHSA 2F43A 2R4TA 2DH5A 1U31A 3VTFA 3FBWA 3GLIB 2D4HA 4ZDWA 2WUGA 3ZGLA 3GWGA 1QGUB 3WS7A 5I9LA 3WLIA 1PGNA 4FFLA 2HJSA 2DWOA 3GLGA 9ICEA 4IWYA 1ISRA 4EO4A 1UIMA 4J7XA 3FJYA 4DCTA 4NAVA 2H7CA 2E48A 3MRTA 4I5EA 3PW7A 3OTHA 3CURA 4LC1A 4AW9A 4JWTA 3ZKWB 3T41A 3AM5A 2C5BA 2O1WA 4YTEA 1MGPA 1TJNA 5IIJA 3DMTC 3ZLBA 1M9NA 2X77A 1JPVA 2HHCA 4V0ME 4QT0A 1QZUA 4F4IA 3GLIE 5KOYA 2LGJA 3RUDA 3W7AA 3EGIA 4ED2A 3Q0IA 4BO3A 4ON9A 2XMCA 2BQUA 2Z4TA 5J4YA 2TMGA 2OY0A 4C4OA 1I2CA 3OECA 3GUHA 4HZUA 4ECYA 2HLNA 2YMQA 3EWAA 3T7KA 5JDCA 1O97D 2D0OB 4G5XA 2WHXA 4N0PA 1LJLA 3V7LA 3OQHA 4ND4A 4E51A 2WMYA 3DPSA 1WULS 1Q1EA 4PRYA 3CSDA 2EWVA 1MG0A 2XCLA 5IG2A 3KR0A 1GGHA 4XOUA 3UBMA 3AH8A 3AP2A 3NHLA 5LIPA 4KE9A 3CF2A 1RZRA 3OLXA 3FR8A 2WV9A 3BDPA 4RM3A 2HB6A 2Y9UA 1Z35A 3RLIA 1N1GA 2VWHA 2XT6A 1VBFA 2XD4A 3KYDB 2WVAA 4Z9AA 1VIYA 2G17A 4HQNA 2AR0A 1XJ0A 4TUPA 4RKRA 3TCXB 4QYIB 4D41A 3UK2A 1N34B 3BTVA 4KIFA 4MQ5A 4H7PA 2V7GA 2PH1A 2FW0A 4B82A 1D07A 1NIJA 2B98A 3VDMA 4NBVA 1SELA 1SGGA 1J7JA 1LPMA 1NR1A 4I50B 4LDAA 1XB2A 1D2RA 2RBEA 4Z4GA 1C29B 2A9QA 3K9HA 3QRWA 1ZD9A 4Y2JA 5AHKA 1RYMA 2PXIA 5BV8A 2NSDA 2FR0A 1WU8A 1KAEA 2YW2A 4DT1A 4EUFA 1XYVA 3ISJA 5CGZA 5EIHA 1HTTA 4I14A 2KW5A 3ZDBA 2IIQA 1V9LA 3NVYA 1KRXA 3CEMA 4KO3S 1XCMA 4RO0A 4J9PA 3LPAA 2HHSA 4ZCTA 1U9IA 1IN4A 1YHYA 2W2LD 3IKJA 1KK0A 3S2UA 3A9WA 5HWSA 2Y9MB 5CT5A 3V3TA 5L3QB 4CHGA 4EB6A 1CUBA 4A5OA 3EFBA 4YHBA 1C30A 1O9GA 4LQ4A 4DYDA 4JEIA 2A4MA 3LY5A 4BVHA 4RQNA 3OBIA 1BHSA 2Q0QA 1R4NB 4BNYA 4UQGA 1Z06A 5IH7A 4X20A 5BY2A 1XRSB 2QHXA 3SHOA 3SV3A 5BW4A 1LLQA 3SF0A 1L5GB 5M2QA 4IZ6A 4BPRA 1UJ2A 2ZJFA 1M8KA 1Z4JA 2OD2A 5AVVA 1GPJA 4RUCA 1P5JA 1UBNA 1JQBA 3IDSA 2BMVA 2J5XA 2I9KA 3M8SA 3UXPA 3O7MA 4A6XA 4Q3DA 4Y2PA 1KY3A 2H57A 3EIUA 3CPHA 5EGSA 4ZRDA 5LDDC 2DKZA 3MEQA 4KQHA 4H1VA 1YGPA 2GKGA 4L08A 2J0QA 1GT6A 3CLUC 3DF7A 1TM7E 3KJFA 1GYRA 4EUNA 3LG2A 4J9OA 1HDOA 1CR0A 4TMKA 3K6SA 1BIFA 4JI8B 1OZGA 4EEXA 3SFTA 3IQHX 1YRWA 4OXQA 4O4IB 3FKSD 4RFSA 4OCZA 1OWLA 3ZS9A 1GUAA 1KYYA 2K7FA 5FUQA 2RJNA 3OT5A 1YJCA 3O1LA 3BYZA 4WY2A 2PL9A 1WUIS 5DM4A 3RADC 2DGZA 5ALYA 3MYRA 2JI8A 3EIQA 3FPHA 3OQ6A 4DKJA 5ABPA 1DADA 1ID8A 1XDGA 5ALUA 1WVGA 1YNOA 1ISHA 3DL0A 2VQEB 2XYQA 3VJRA 7REQA 1B1AA 2Y1CA 1CDDA 1U2GC 1CRQA 1J2JA 1E2HA 4CR6A 3EIOA 3S8MA 3BMQA 4HEQA 2ZUEA 2B69A 5D6OA 4OQXA 1MP0A 1BVSA 2ZT5A 1M2OB 2V7XA 4R7TA 3V2HA 2SKEA 2PUAA 1TCCA 2CLSA 3A3PA 2EZTA 2X4IA 4F3CA 3IAFA 1RI3A 3TNDA 2UUPA 4JSRA 5HFNA 3C2LA 4UU8A 5EY5B 5PGMA 2Y68A 2G70A 2A67A 3V72A 1LB2B 4HNHA 4DL9A 4FSHA 4MV0A 2QDKA 1AOXA 2C4HA 3UJCA 2EW2A 3CBGA 1ZXBA 3QY9A 1VL6A 2BGRA 1BGVA 2O23A 4H6WA 3W5CA 4FCVA 6YASA 1WWVA 2AZMA 2FLKA 3SM9A 4ZPXA 4O2LA 4OA5A 4YRRA 3EISA 2ZR8A 1BGXT 4QBKA 1ANKA 3JAMA 2R8BA 4EO7A 4GW3A 2EJCA 4DQRA 1QYDA 4V0LA 3LCRA 4MAMA 1RABA 1NFFA 2QM0A 1BNOA 1QIFA 4J2HA 3H87A 2V4RA 2F44A 1ZONA 2PUHA 2Q1WA 3SYZA 3WDLA 3JYNA 3R5SA 1MIOB 3PFBA 1K1EA 2VJNA 1C1XA 2DFNA 4IMJB 3N74A 1JW9B 2VDRB 1T5TA 1Z33A 4S1VA 5DBOA 1IG3A 3WLSA 4UOEA 4P3YA 4BDSA 3Q3JB 5K0LA 2AX4A 4WXPA 3E15A 4BOYA 3PJRA 3WGKA 5KVQA 1JFVA 2ALZA 2VNAA 3VKUA 1WQ3A 1ZNQO 1QS0A 2EQ5A 1SL1A 2H0RA 3CM0A 1JHVA 3X43A 3O9ZA 3KZIU 5TQ2A 3U9TA 3N59A 4YDRA 5BSVA 3ICOA 3TPCA 1S1CA 2ZI7A 1X0XA 3L8HA 4HS9A 1PR9A 2XX3A 1IEXA 3IEIA 3AC0A 1Z73A 3M9WA 5LLDA 3QOXA 1FFCA 1N6PA 1FJGB 5DF1A 1E1QA 3DMRA 4MYCA 3JQPA 4MUNA 1TVAA 5INTA 3USZA 3R2JA 3KQOA 2HNAA 4KBYA 4Y6OA 2BZFA 1Y5MA 1S0MA 4MVJP 3NXSA 5D46A 1BPBA 3K6RA 4PZUA 1XPRA 1WG8A 4L4YA 1FRFS 4G3XA 1XZDA 1E9DA 2AQIA 3WKEA 5HK9A 1FPMA 2EBWA 1FBTA 4WNIA 1C7YA 4HEA6 1M6VB 3T3DA 2C82A 3TDNA 4U6NA 4L3WA 4NDNE 4ZEXA 4FC6A 4O2AB 4JV1A 4ZEWA 2GSWA 2UZ1B 4OX9Y 2H2AA 1LNZA 2ESRA 1V5FA 3QZ7A 4ZZ2A 3UJAA 4NM2A 5FHQA 3H13A 2ONJA 3FBTA 3NKVA 3CUYA 1NP7A 3O2SB 1M0SA 5F3DA 1T3NA 2W8LA 3EWIA 3Q8SB 3QEMB 4RD6A 2V74B 2OG2A 4OHMA 4DLKA 4G1MB 3UT0A 2J6HA 5DHUA 1UC9A 3PW0A 4JV5B 1U3TA 1G66A 1TT5B 1YONA 2GXQA 4XDZA 1DQPA 2P2LA 3B6EA 1A8UA 2ZSDA 5JS1A 1MJGM 3BJIC 4BE9A 2V7WA 2A19A 2CLIB 5FL7A 2XEXA 5CK4A 3H8MA 2ZYWX 4UNIA 2PSDA 1WCXA 3UGTA 3NT4A 5J2BA 3O82A 4CBVA 2WQ7A 4OVKA 2ZDGA 1T4GA 1JEJA 4HDRB 4EITA 5IDXA 3H9UA 5ALWA 5C8YF 4TWBA 2R6FA 1QX3A 3MXTA 1C9JA 3AFOA 4WY5A 4TVBA 2VHCA 3FFXA 2H4JA 3EVFA 2OR3A 3WA6A 3KSMA 3CVYA 1MJNA 2C2RA 2J7PA 3LA6A 1VL2A 3LGAA 4RADA 1P3DA 3AGPA 4WFJA 5T8KC 5FCDA 2GJ4A 4G0PA 4QYSA 3FTNA 2X6TA 1ZS9A 1R0SA 5SY4A 1S8NA 5HBGA 5CMLA 2VDUE 2GBLC 4CL2A 3NWPA 1Q0QA 3C6XA 1IM4A 1Y8QA 2FSPA 3WLFA 3NORA 4E70A 2B35A 4FD3A 3EVCA 1UBUS 5FO1A 4BNWA 4MRMB 4CM9D 5AK0A 1AMNA 2YNMC 1XHFA 1A69A 2C8JA 3QWFA 5FWYB 1ZQDA 2FX3A 3GEPA 1CIPA 3A4LA 1ZD4A 2I7VA 1W48A 2VZ0A 4YDSA 3UVEA 2RGBA 3EEQA 4IRKA 2HHTA 4RQ1A 1WUKS 3VR5D 5LDHA 2JZOA 1FSZA 4DY6A 1BXZA 2IUEA 4EG7A 3UGQA 1VE9A 3V4PB 3ZCTA 3LYHA 1XAJA 2JFYA 1ZM3A 1A3CA 4BMPB 2LCFA 5CLHA 3RHZA 1NK8A 1M0TA 1FZQA 2IV2X 3CKKA 1TFUA 3LH5A 1UP6A 4BHTA 3DMPA 1CKEA 4AKHA 4XFJA 3WTBA 2AHOB 4BV9A 1CSEE 3CF4A 3WGOA 2M98A 4QW8A 1PHPA 3G7UA 2ZCUA 3D6TB 2R751 2GJ8A 4CEIA 2ZXFA 4N7BA 5EHNA 3GFQA 3MR5A 3LCJA 4W7SA 3AJRA 4RPCA 4IIHA 3TLMA 2X5KO 4X84A 1I4OA 3JATB 4B43A 2LKDA 3V97A 1SHLA 4DYHA 3L93A 3WK7A 1J49A 5K8VA 3V00A 5TMEA 4FOSA 1K7CA 5LQRA 2QAIA 1L7AA 3G8CA 3CCFA 1NLUA 4H7IA 3EAQA 3TKAA 3IPXA 2O50A 2DUNA 3MWEB 4DL6A 5GM2A 2KE5A 1E8MA 5KFYA 2XH8A 4NCXA 4DRXB 1Q46A 4PO1A 3WBFA 3ZNOA 5L1MA 4CTOA 4ZVLA 1BMDA 4WXEA 3NRZA 4DANA 3PR5B 1RWBA 5DBGA 1KJWA 2OOKA 1F48A 5JYEA 3PSAA 3HG7A 1ZLXA 3OO0A 5IS2A 4FO6A 3HO1A 2CDCA 4A6DA 2H9IA 4BB5A 3PI7A 4DQLA 3HB7A 2G9VA 4E5NA 1TW2A 5DI3A 1MABA 4QXPA 4FHCA 1IN7A 4OHUA 2YICA 2L2QA 4DHWA 3P2YA 1OHHA 4TT3A 1M1UA 2ZLBA 4F4WA 5E3HA 4PSCA 3FTQA 3DDCA 2RHRA 2CVPA 5IZCC 2VWPA 4TQUS 5EEGA 4QZ9A 3NVZA 2BM9A 5EKSA 1O5OA 4KN7A 2PYDA 5K0JA 4RQ7A 1UA0A 5KINB 3GFGA 3ZE0B 3BCSA 3UATA 3I8OA 1JXAA 5HW0A 3WX0A 3NI2A 4YJHA 1RZRD 2NRVA 2YXPX 3K0CA 1M2GA 3BRCA 4WY8A 5CLLA 8ICJA 4J16A 1E62A 4M22A 5D7BA 1SVLA 3H9CA 1GZ7A 2X0FA 3K0AA 3GJ6A 5M29A 1C9DB 1S2MA 1Z38A 5CXSA 3DOOA 4FDTA 2PSHA 4D9FA 4L6AA 4TQGA 4E11A 1VPWA 3LL4A 3PIIA 3FYUC 1KIFA 2BEWA 5BN3B 2AYYA 5CA1F 5K45A 3E2PA 1NSTA 1N9KA 2WB1F 1ZW1A 4B3MB 1SZPA 5FFMA 2X41A 5DNWA 4RWEA 1NNLA 1MQ8B 3IAS6 1EFLA 3KXPA 1II9A 3NAMA 3EQ8A 1Y88A 2GBGA 2HW8A 3HKCB 4QX6A 1NBMD 3GNQA 3TVTA 1GKKA 3CSUA 1ABFA 2YOHA 1LQUA 5LKAA 3GRZA 4XJVA 5TEWA 2H00A 1BDIA 5HRUA 2OXTA 1UM9A 4X24A 1OFVA 1E5QA 2H2DA 3OSZA 1A9OA 1L8QA 3W2EA 1RXYA 3VUFA 3R5XA 1Q2XA 4MDEA 4MXDA 2IHJA 2QORA 4C6TA 5BSKA 3IP5A 3DDZX 3QUAA 2XE8A 1PL0A 1PN3A 2F1HA 4RV4A 1CS0B 1AJEA 3OWOA 4PX3A 4ZYWA 3M6UA 4UAYA 2NP7A 3ER8A 4R3NA 4DDKA 3BJYA 1PV4A 4C3ZA 3RCBA 4Z0HO 4D5GA 1S2DA 3YASA 4JX9A 3RRJA 2B8WA 2R6AA 3V4VB 2QN2A 5CIQA 2Q6TA 2PGAA 2PNFA 3Q3CA 4BP3A 1BS1A 1FA9A 3AR8A 3PC4A 4W5QA 2RHTA 4AC9A 2AMJA 1NBHA 5BVGB 3QK7A 2P9BA 7ADHA 2QRKA 2VFAA 5AUPB 1FFDA 3UO8B 4FBUA 3E81A 2HK9A 3GW8A 3PHIA 1P0CA 3A04A 2QLNA 1DIOB 4I9GA 3QSYA 3QF4A 1FU8A 1Q0SA 2IBTA 1YZ3A 1WOMA 1KJYA 3ZHQA 2ZDQA 2ZWMA 3C8HA 3MHPA 4NHOA 4BUCA 2WG0A 4FONA 4PC3A 2J3JA 1T2VA 2WYIA 4QDJA 3OX2A 3IODA 2CNNA 1CS4C 1Q83A 1RWWA 3NHKA 1JQAA 3O4IA 3REFA 5DMHA 1YU6A 2ZIWB 2H2IA 4X85A 2I5HA 3Q41A 5AW3A 3PLNA 3JQ8B 2RHBA 3LQKA 3PW2A 2CVZA 2QL9A 2P62A 4A2WA 2LYBA 1DJPA 4WKOA 3BXEA 4B3TB 4CF3A 2BUCA 4R8SA 2FQWA 3LZ6A 2I4MA 3VC1A 4Q0MA 2QVXX 1A8QA 5I9TA 3ZOZA 1Q3KA 2LI6A 3DE4X 3OF2A 1ZRMA 3UWPA 1IXRA 4FUTA 3SQOA 4OQQA 4UAGA 4XEUA 4PYJA 2ORWA 3DKVA 3CN7A 3QOFA 5KFRA 4KC0A 3IHKA 4YAIA 1QRSA 4EHJA 2QLJA 3OTIA 5DISB 2FYTA 3TLAA 4IEEA 2A1TS 3CNBA 1MJ5A 2YJ3A 5DEIA 3OKPA 5U4QA 1NBAA 3T3GA 2ZE7A 4AFNA 3H84A 1ADGA 1BXGA 5DQGA 3Q5DA 2QVYX 2AXQA 1ZQSA 1ED1A 1DC5A 1QWSA 4I5GA 3BK7A 5DTRA 1GSAA 1S76D 5CG2A 2OFOA 1HETA 3WIOA 2XICA 5K20A 4B85A 3PVSA 3K6JA 1FX0B 1RQ7A 4WLOA 1GFWA 1N2GA 1SH7A 2OO5C 2A58A 4IY1A 2PH3A 5LL6P 1D2GA 2AMVA 3V7YA 1ISJA 3ZI0A 1L3SA 3OCXA 5LQSA 2HLHA 2KVCA 1ESNA 4MVJD 4BV8A 3FPJA 4EHIA 2C3YA 2NXCA 5D85A 3JQFC 1J5EB 4C05A 1DBVO 5H16A 3HADA 5KFVA 1X42A 1ONPA 4X1OA 1A5AB 1OX4A 3W8NA 4UNQA 1T13A 9LDTA 1NRWA 3F1KA 2UZAA 4CLOB 2JEZA 1ILEA 1KBZA 3L7CA 4HFMA 4GKBA 1M2VA 3FRJA 3VGJA 3IGFA 4PQEA 3ABSB 1MVNA 4XVCA 1A77A 3ILSA 3CTPA 3P2EA 3BCUA 4DCCA 3I4LA 3E2MA 3LQ1A 3PCRB 4N5LA 1TLFA 3OUUA 4MUMA 4CL3A 1SUBA 3QVTA 1V45E 4UHDA 5EWLA 2MR6A 3O21A 5HIKA 4I1IA 1CEEA 4ZOAA 3L18A 4P83A 2NZ2A 1X0VA 4HGZA 5F12A 1F2UA 1Q14A 5ALJA 3UJ9A 2BF4A 2IHYA 4J03A 1OILA 1SUEA 1TTTA 5AVOA 1UXIA 1ECWA 1QIEA 3A1SA 4BLSA 5E9JA 5IJWA 2WUWE 1JQ3A 2JKYA 1SU4A 2FMTA 2NU8A 2JFQA 5IMSA 2EZYA 2ZXHA 121PA 5HE8A 3SJUA 3VR3A 4M0PA 4OHXA 3OF3A 1IIPA 4MGYR 2CMDA 1ZQFA 4IUBS 3CLVA 4Q1VA 1SVIA 3D5EA 2AG0A 3IQIX 4FW8A 3REQA 1TJ5A 3MDCA 2EZ4A 4NMWA 4ETNA 5DE3A 1FMCA 2QMYA 2G5CA 2QW8A 5DLPA 7ICVA 4DCPA 3BQ0A 3WL6A 3DZ8A 1P1RA 2J6TA 4GVXA 2C88A 3WK5A 1UDBA 3LDUA 5AVZA 3ZWYA 5K0EA 1RJ9A 4ESEA 3TQHA 2GN6A 1FU7A 3BB3A 2MYTA 4ZV7A 4XRHA 1LDYA 1QH8B 1L5FA 3PICA 2HQSA 1ZIDA 2WLTA 3OA0A 1GN8A 2OQ2A 4BMYA 5MDHA 1KKUA 4RY2A 3JZAA 4K9LA 3RYHA 4AZ3B 4P4SA 2MWMA 5IN5A 2GBIA 1NJ2A 3ZLVA 4AO7A 3GCDA 5K09A 4BU1A 3MMZA 1QQ6A 1QWOA 3UJHA 3G7NA 4QWEA 2KQUA 3LDGA 1TYEB 3ORRA 3KL2A 1BSVA 1YVDA 4CKBA 3TI0A 3SQDA 1SG0A 3SJCA 3BIJA 4CIVA 1EB8A 2NN3C 1L6NA 2C7BA 4F3YA 1V9PA 3I1JA 5EXPA 2Z4SA 3ZVKA 2VL7A 1QFYA 4L8WB 1L3VA 1SHZA 2HW3A 2OK7A 3LF2A 3LOQA 4ZALA 2EBUA 1NSFA 5AJWA 1EUZA 4BKQA 3U7EB 4GXNA 1G2QA 4MX8A 3KBOA 4H1UA 4HFNA 2EDUA 1PL8A 4MLZA 4AK9A 3B6JA 5P21A 4KDEA 3L40A 3R77A 2Y71A 2PX0A 4NZYA 4A3SA 3E0XA 3OFKA 3RRBA 2SKCA 2HHLA 4RY9A 4KQMA 4JXKA 2R2GA 3DHNA 4RZ2A 5FL7D 2ZBGA 3E22A 3JRWA 4YJ3B 1EVEA 2WQZA 3CGGA 2ATCA 4IKPA 4PQFA 5BNWA 4QICA 3FD8A 1IK4A 1M83A 4W5HA 4L3VA 4NHEA 3BMNA 3VPAA 1GZ6A 3RS0A 3K9FC 4YUYA 4XCQA 4ZYVA 4I1OA 2R7MA 4GLFA 1DC3A 4YJGA 4ZAGA 3U3OA 3WI7A 2W2LA 3CRNA 2DLNA 2I78A 1DT5A 1HL7A 4RZUA 1CZRA 1IY8A 5BUQA 2IPMA 4A7PA 3PQ6A 2ZROA 1KEUA 3IAUA 1JKJA 1FNDA 3LFUA 3N1UA 3G8YA 4EHFA 1LWOA 4Y1RA 2I3GA 5ILGA 4B3IA 3ALRA 2QI9F 3WZ2A 5IJ0A 3V2UA 2H29A 4B3RB 3AZQA 3D8BA 4D5EA 3SE7A 3DVQX 3IQWA 2A3RA 4NC9A 4M0UA 5BYBA 3HXKA 5F5NA 5T4HA 4TLMB 2QVBA 1L3UA 2N42A 1DBQA 4K86A 4F2SA 3ZDZB 1VCIA 1BD3A 3TJZA 3HKEB 4K8OA 2ODGA 2JD1A 2PD6A 4KXVA 1SHJA 3FIJA 4JJ8A 4LV8B 4NMXB 2Q9UA 5CVTA 1MCZA 3B7GA 5IFKA 2Q4TA 3UNXA 1ZR2A 1JE1A 3OUTA 3H1PA 1MKYA 1QPBA 4KLZA 3HPRA 2J08A 3W79A 3PS9A 3KJGA 4CTNA 2BFEB 3JVEA 3PNLA 1YO6A 4PCVA 1GNVA 2B8TA 2P3SA 2HIGA 4ALLA 5IJXA 1O97C 1SZDA 1Q1GA 3G17A 4FHFA 5FLYA 4QASA 2O8FA 1Z74A 2QVCA 4B8WA 4O3NA 4REQA 1QANA 4YPOA 4WUTA 4R0MA 1BCSA 5AMXA 3QXXA 1PJTA 1U1DA 5J0YA 1T1RA 1XTIA 2A1UB 3CRVA 2BFPA 3NVDA 1TYCA 3WFJA 4RNDB 1RR6A 2ZJ1A 3KJZA 3QWHA 1BE1A 4OHZA 4BO9A 2FZWA 3CT4A 4PF1A 3QX7A 2AE2A 1TUEA 4DSLA 1A1VA 1X8XA 3NBYC 3T7DA 3FF4A 4P3NA 4DC1A 1K89A 3WGMA 3PW5A 2VJDA 2RFLA 1KQ3A 4IHJA 1CJBA 2WMDA 4DXDA 2AW3A 4LDJA 1S7CA 2KFZA 4NLCA 1I7LA 2YYAA 5I7AA 2WYWA 1YGYA 4GDFA 1ZW6A 3KFUF 3GLKA 3H3XA 5JADA 2CJPA 4LI0A 1IWOA 1XE3A 4B0OA 4UUMA 4CE6A 4D9HA 1Q0RA 4XJTA 1KMNA 4GLXA 2P9ZA 4C4YA 2OBBA 4WCFA 2ICAA 2XHZA 3H11A 1S10A 1I4WA 2OLJA 2VHEA 5KTRA 4EKEA 2ZBQA 4HVAA 1OYOA 2B8EA 4J3JA 1KAMA 4TKVA 2YOGA 2I2WA 4DYVA 3O4RA 4AJHA 4IRCA 4BE4A 1FDSA 5M34A 1BHQ1 5HF8A 1DG9A 4C0JA 3SDBA 1VKHA 3U40A 1XMQB 4QHTA 3DV0B 1JHOA 5CH3A 2I2FA 2CNBA 1T4DA 4N40A 4Q93A 2FZLA 3PYMA 3PDHA 2FDXA 4BBPA 2H5XA 3CJTA 2UV8A 4PPYA 4XVUA 1E7QA 5EMMA 1NVVR 2ZRPA 4C7ZA 4WOBA 1DRGA 1G38A 1Q6YA 3DBHB 3DKPA 5DHFA 1M1NB 1XX6A 2CGEA 3WO1A 1D6MA 1WXDA 1PDVA 1Z4LA 3OESA 3ZGYA 1WMFA 4Q4DA 3CVJA 2AF3C 2ID4A 2J30A 2ZKLA 1KS9A 1LLUA 5JRDS 4I55A 3O91A 4Q39A 1UBHS 3KQYA 1CERA 2OOSA 3ZBUA 1Z13A 1NDUA 1N57A 2VCYA 1WY7A 2PUTA 5IVKA 1V11A 3ITDA 1IJKA 5LQKA 1E2IA 3GDXA 1JKIA 4DR5B 1QF9A 1E7MA 2QJRA 4RA9B 4N03A 1OAAA 2PMCA 3RK0A 3RYCB 5IRCD 4Q9LA 1QCYA 4IUYA 5DXFA 1L7QA 1WPXA 3R76A 3DE7X 5FPHA 2FA9A 3MQ4A 4GFDA 5KI6A 1RJFA 4QBGB 4L9SA 4PC1A 5CH5A 1KDPA 3CEJA 3G5UA 3I39X 4ZO7A 3LYLA 3R5HA 1K8RA 1YUNA 4O59O 3MR2A 2FG5A 1E0AA 3A4TA 5CA0B 5IBQA 4CETA 2AT1A 2JAWA 5KKCA 1DJOA 1GQQA 1D9DA 1U04A 2R6DA 4EK9A 1A7KA 1KY5A 4Y2RA 2AKYA 2OCIA 4C88A 2WUDA 4IIEA 2XMZA 4WD3A 1PK8A 5SZKB 4B3HA 1OV4A 2WLSA 1C7ZA 5A05A 4B4KA 4F56A 2J3DA 2XDQB 2O8BA 2FN7A 1K8QA 4PG7A 2ZBFA 2FKNA 3B60A 3NIBA 5ECYA 2GNOA 1MAHA 1SB9A 3RR8A 4R16A 4RMGA 5CLGA 3OCWA 4OQDA 2WP0A 1T4MA 3ABRB 3NKFA 3D8HA 3HU3A 2FSHA 4GRDA 3IV6A 4M98A 2OHGA 4BZQA 4EMBA 1V3QE 4CMKA 5LD2C 3IKTA 2XKJE 3GLSA 4DCNA 3NLLA 2IY8A 3EZ5A 4FDUA 2UZIR 1C8LA 4LHVA 2G06A 5D3MB 4RVOA 1NATA 4OJOA 5EJ8A 4HDNB 2RI6A 1X1TA 1MR3F 4G09A 4E03A 3G9UA 1U9YA 3TS1A 1G8HA 1AUPA 5BORA 2ZJAA 1QOZA 4EGFA 3ZNQA 4UNRA 3HS3A 1E2GA 4IV5A 2WDZA 2BW0A 2DPJA 5L1IA 4OGLA 4EYIB 3OEYA 1JMKC 3E70C 4WSOA 4CIYA 5KAMA 4II3A 4YG2A 5DM0A 4LYJA 3HUUA 1DTWA 3JQ9A 4JT9A 5DH9A 4E5DA 4GC9A 1UBRS 1WUTA 4G1FA 1UAAA 3DE6X 3QX8A 1W4CA 1I3OA 2Y27A 3WAJA 2XVYA 2IHUA 5EJEA 3IHTA 2B2NA 4MARA 3EUWA 2FPWA 2OXEA 2FAXA 4M0CA 4YRDA 2ZTCA 2ZR0A 4Q3OA 4LF8B 2ZB4A 4IS3A 2KVSA 5FPTA 2Q5IA 4MJ7A 3WHKA 2NX2A 1V7CA 1N0WA 2QKQA 1D1PA 1BS2A 4IDFA 1KN5A 1VFPA 3QHPA 2JAOA 4BWYA 3C14C 5BW5A 4EPVA 4CM9A 2AL7A 3KHHA 5IC5A 4OXXA 2A0FA 1EXDA 3KM0A 5D5PA 2VPZA 1ZH0A 2YCBA 1MB9A 1MO5A 4IGEA 2FMXA 4DEYA 2PAFA 3DR3A 3ZIDA 1DX6A 4C0HA 4LS3A 1WMSA 2G5PA 5LJLA 2YFKA 4KH1A 3VR5A 2JJ2A 2J0SA 1TYAE 3W8FA 2ZTLA 3B2EA 5I8WA 3ND5A 2AF4C 3AY7A 3TTWA 2Z9BA 1SVWA 4E0BA 3P19A 2VXCA 4BJ3A 1Y7TA 1IBLB 3ZEIA 1VJ5A 4N49A 3LK7A 5KYXB 3CLKA 2JJQA 3M4JA 3C6KA 3CZQA 4QPZA 4LOHA 4OBXA 1IFXA 4UM5A 2BKVA 1LF0A 4LRXA 2LYAA 1OC2A 1AG9A 3IBFA 3I28A 2VYCA 1FF9A 2D59A 5IK2D 3F98A 4CG1A 3F67A 3N4MB 4PIMA 3QPUA 4QXOA 1UK6A 4BP1A 3ODGA 4GYYA 3D6HA 2RI0A 4MHTA 1NVVQ 3L6UA 3I6IA 1T24A 2VT6A 1A96A 5JS2A 2NTNA 1TMOA 2UVDA 1F7UA 1ZCFA 1WDWB 4DSAA 2P75A 3VR3D 2D62A 3H16A 2FSUA 1KI2A 4J76A 1PZFA 1IWPB 4KLIA 2N46A 3OJXA 3REOA 3TW8A 2JBHA 3A1WA 2C3UA 3DYVA 4FWTA 4IR1A 1YMQA 2GFIA 1YQDA 4GLBA 4QE3A 5AOBA 1WWKA 4ED7A 3THWA 3KWFA 3GEEA 1XCBA 1P2TA 1SIWA 1YQXA 3B8HA 3DTYA 3W05A 1NGSA 4B87A 3L7NA 1YVUA 2YYSA 2PX8A 3VOAA 2IOYA 3C21A 2D54A 1B6TA 3HKZC 3HH8A 5B12A 4MKFA 3Q8RB 1LLFA 2B5WA 3HJNA 1YI8A 1FNBA 5E6SA 1NM5C 2CXSA 4WERA 2DETA 1R5OA 4JT2A 4QJ3A 3ZY4A 4NF2A 3VI4B 1LDMA 4PSVA 1FUIA 3AF1A 1YUMA 2Q5FA 3HWWA 4UXHA 5IM4A 4XYBA 2PU7A 4C0BA 1Z0JA 4OFXA 4S2EA 3ND6A 4ZYTA 3S6JA 1COWD 2APJA 5FULA 4B31A 1EUQA 2LUOA 5KNDA 2PA0A 3V1KA 2ZAGA 4RENA 2WTBA 1P1KA 4V0KA 1L6IA 4ER3A 1J5PA 1PGQA 4IJ5A 4O5OA 1VXRA 4S3MA 1Y0BA 2XVAA 3G5MA 1QX4A 5E4YA 4HQLA 4LCEA 2JGDA 4E5SA 1KQNA 1ZGZA 2PO7A 2E9SA 5KT3A 2VBCA 1XA0A 3KT6A 2K60A 8ICLA 4RZIA 3K92A 4IFEA 1YS4A 2D1SA 2L5YA 2VUUA 5H7XA 2CL6X 2VNJA 3Q7EA 2Q07A 5JWOA 2EAMA 3NJRA 3ZU6A 2DBZA 3AWDA 3U4QB 2LXNA 3MJFA 1K08A 2QTFA 2J9ZB 4ZCIA 2W55A 1MN6A 4LF4B 1NBMA 3H05A 3CF6R 1M3SA 1Q7GA 4QZHA 3PFNA 1LBSA 2W4IA 3AF2A 4YCMA 3NC1C 4NBSA 5EXEA 2H7YA 4IH9A 3Q0TA 3KRTA 1LK7A 1CE8B 2X7XA 2IZ6A 4QTYA 2ZBVA 1CEZA 4RA6A 1ZKDA 5JQGF 4MI3A 5LYJF 4G4SO 1MZVA 5DHQA 5CYOA 4NJMA 3E3OA 3D3WA 1VCNA 2PTGA 3F73A 4F5EA 1KFEB 2DULA 4OYRA 4UREA 4MPJA 7ICJA 4BNJA 1YFZA 2X15A 2ZIAA 2VI5A 1WHSA 3FDZB 3DEYX 1L3BA 2ORIA 3G0GA 4GICA 2R6R1 3JSXA 5AT1A 3EQZA 1DCTA 4AYBF 4QYTA 2PWBA 1JKXA 5K99A 5BUCA 4PLGA 4BN5A 4LDPA 1IUOA 1TM3E 4JOQA 3ROZA 3COSA 4UHHA 3LI2A 2JRCA 2X1HA 4WLNA 3OCZA 2BMWA 1U99A 4ZHQA 3ER6A 4BDTA 5F98A 3QLTA 1HSZA 4IQVA 1ZESA 4AP6A 5JAOA 3QJYA 1Y4AE 4QXMA 1ZEJA 2BCUA 1EDDA 1W0KD 1HYBA 3BSYA 2PD4A 2HSEA 5HK8A 4OJ6A 1QLHA 1IEVA 3W06A 5THXA 2JI7A 3A1VA 1HRDA 5JDCC 3DMGA 2ZT6A 1BDMA 4EELA 5DGAA 4J0CA 3TGWA 4IGFA 4LJAA 2ADFA 4BVBA 4QIHA 3FMIA 4UTNA 2WWFA 2ZSIA 2X1MA 3OSUA 3WGTA 3EEIA 1Z15A 3LF1A 5M7EA 2MYNA 1RI4A 1OFHA 1W76A 4NIMA 4BGEA 1CIVA 4F60A 3IMEA 5AUNB 2QDXA 3B3FA 4AMYA 1VCHA 4C7XA 2ZIXA 4MVXA 1NMYA 4MITA 2PL1A 1N8NA 1YJQA 4BNZA 1NZBA 3GCXA 5HG0A 2QPTA 3ZXSA 3ECCA 3E61A 1TQHA 1QUFA 4B3BA 4Q4AB 4LSGA 2QLMA 5BYJA 3OQIB 1SXIA 5C1IA 1DIHA 2BFFA 2G3YA 4FN4A 1G17A 1BPEA 1VJ1A 1TOAA 5FRDA 3LWMA 2QRHA 3EBPA 2DAPA 1BE0A 4BEJA 2GBCA 4AZVA 3NEYA 3AVPA 1GNSA 1OFGA 4GP9A 2ZRFA 1EFUA 2ERCA 1E1CB 5EJ9A 4IZIA 4NYMQ 2O0LA 2AN4A 1Z5ZA 2X3FA 4Q3CA 1XVAA 4X1KB 2C2ZA 1EDZA 2I6XA 5KSYA 3IM1A 1ID1A 2HJRA 4R51A 4MVJA 5J58A 1JPJA 2V7TA 3WICA 2I2AA 3PV0A 1NJYA 4BQNA 2Y6VA 1U9IC 3C6ZA 3U7QB 4KAXA 2JLVA 2GPJA 2XCUA 2I3ZA 3GGCA 1E6CA 3LS2A 4GMFA 4FTWA 5JXGA 1W96A 4GVPA 5F2KA 3HB0A 3UAXA 1NNI1 3UMBA 2C9OA 3R7DA 2B37A 1JSZA 1JYFA 5DNVA 3PT5A 4D9EA 2VUIB 3FNGA 3WC4A 1RIFA 2EAPA 1S97A 2QB0A 3FPCA 1I8TA 1H05A 2WV7A 4Q4HB 3ETGA 1YACA 1TC1A 2MU2A 1VIVA 5DI9A 4OQMA 4YAUA 1NKTA 2R68A 4RT2A 1UC8A 4LY9A 5DBHX 3AOGA 4IOMA 4BO0A 1W30A 2IDMA 3GMIA 4KR3A 2MT9A 3OFJA 4BGUA 2W93A 3GOHA 3A4YA 2DVMA 1PNQA 1UBOS 2LBOA 1LQ2A 1C41A 4KPGA 4ALJA 2V5VA 3VGPA 2X9NA 1E8DA 1MJHA 1M66A 2Y0CA 4MWTA 3HXQA 5A02A 1D2EA 5L8VA 3UW3A 3VAZA 2PLNA 3FWZA 3PU6A 3PPIA 1QZZA 3OSNA 4L7VA 5EZ6B 4ID9A 2WVHA 1E8NA 4BX9A 1L4YA 4CLHA 1KTVA 2NRTA 5ECDA 2OGSA 3LOUA 2XZTA 2F4VB 2W00A 1DMRA 3UN1A 4U6PA 1SOVA 2ZATA 3DJFA 3DEJA 1E96A 1CUIA 4NU5A 1H4SA 1MH9A 4KU4A 2B94A 4JLOA 1DOQA 4U9IS 3ZGXA 3R4CA 5BOSB 4ZOCA 1XFAA 3CNHA 2ATVA 4V02A 2GA9A 5KFMA 2UVRA 4FYIA 1NW7A 2PFSA 1XTBA 4KMRA 1GIAA 4QODA 5JJBA 1FK8A 2NIPA 2H4ZA 3EPHA 4Z0NA 2FPMA 3RFVA 1V4NA 1A9SA 1WB6A 1M67A 2O52A 3C6MA 2ISOA 4FNGA 4LWQA 2FWJA 3NTXA 4ENWA 2IELA 4YAJA 3S28A 1L7RA 4MCIA 4B80A 5JD5A 2NXNA 3QEAZ 3SHFA 4AECA 4XUSA 1QB8A 4ZCSA 2WHEA 3H6KA 1DRUA 4KFSA 3MXOA 5BQFA 1YIAA 1X1CA 4ZVTA 1KOFA 5FFNA 1ZU5A 3PZRA 4QWDA 1XI2A 3UXNA 1P61B 5LVAA 2XUKA 3G3EA 4N7JA 1AD2A 4N4AA 3DZDA 1B8OA 3A1DA 1EDBA 4C3VA 3P2KA 4F4UA 4DMUB 3GHHA 4UCFA 4UU7A 2WAQC 5CVCA 1SK8A 3A70A 1SOUA 2G5GX 5A2GA 3P45A 2ODEA 2A5GA 4BUGA 5IC4A 4J9SA 1D5WA 3V5NA 4FS3A 2VSFA 1X40A 1NNUA 5SZJA 5SV2A 3PA6A 4DIDA 3JYPA 3BMCA 3MFYA 1QIHA 1YR2A 1XTRA 3MS4A 5ADVA 5D6NA 1X92A 1ADYA 2X86A 4MQUA 5HEKA 5KFKA 4BZWA 1JU3A 4B0PA 3VNSA 3K0HA 1GGVA 1NI4A 3F6EX 2VAPA 4GLOA 2XJ4A 4JMUA 1BKDR 3K31A 4HADA 5TF4A 1JXMA 3L6RA 4IC9A 1GZVA 5DCYA 1BPZA 5C5CA 1YCGA 2Z58A 4D0LB 3DSRA 1HFJA 5FWXA 3HY6A 4ZAXA 2P65A 5J3JA 5LXTA 4I6JA 3SE0A 1KQGA 5DNYB 3AEVA 1K6MA 4Y6SA 3C5GA 1RZTA 3AV0B 3VA7A 2J6CA 1DHTA 2HMAA 5CDUA 2ZYTX 1HTBA 4XCXA 1UQVA 4B3XA 4EPWA 4CNBA 1U1FA 4K46A 1ENOA 2C7RA 4GIBA 4QYMA 3TLYA 3OI7A 3M9XA 2XUPA 4P9NA 4MFAA 1ADCA 4C4PA 5CDGA 3EGEA 2JJ2D 1R50A 2I5PO 3IBYA 1NVGA 5EWMA 5B4TA 2FZEA 1G55A 2I1VB 2OGWA 2VDPB 2SNIE 3BWBA 1HSOA 4BRSA 2B1JA 3NOOA 2VQ6A 1PJAA 3PNQA 4WK6A 5B2EA 2JJMA 3TACB 1SVUA 4YONB 2MR5A 1KORA 2PEZA 1AQNA 2WIBA 1STOA 4F8JA 4M9CA 2YR0A 4LFAB 3G2QA 5A04A 2ECPA 4DIOA 1P74A 1C1YA 4I4TB 2EIHA 1KR5A 1DGJA 2ZYIA 1TM1E 3QXCA 4U5QA 1WB4A 3B6KA 5CDYA 1JDBC 2NUTA 3N8KA 2PMKA 1T8TA 4B09A 3EHEA 2V7PA 3ACCA 2Z56A 2RKOA 4RIFA 1YULA 4ZP1A 4C8LA 2CVQA 5EG5A 1YZUA 1ZH6A 2FWBA 1PGPA 2PJRA 1A95A 4ZVVA 5B3LA 2AN1A 3CIOA 5HP4A 4BLVA 1UK7A 4W99A 3GRVA 1G16A 2X8LA 1C1DA 2ZSJA 5DDYA 3MD0A 4AJKA 5JAPA 4Y3UA 4FFOA 3NUQA 1Y8RB 4QL3A 3DOFA 1G21B 1T0IA 3RC8A 8ICEA 4LJ9A 2Z2YA 3QU7A 2XQJA 4UNPA 1QQ5A 1QZXA 4INAA 1L4BA 4LWOA 1ACMA 2O4UX 2R97A 4ZXFA 1Q3VA 1ZJWA 2BR3A 2X0JA 4LGMA 5HZHA 3MWLA 4FYHA 1W88A 3IS3A 4UPEA 2O7VA 5JCJD 3LJKA 5HF6A 1DAMA 1RZUA 3KU1A 5FR2A 1M2EA 3HWTA 2MINB 3LCVB 2Z30A 4I7EA 3GFKB 1CETA 3DGFC 3WGLA 4RPZA 2QN7A 4OJPA 4PR3A 4LZNA 1ODFA 4HAYA 1G21E 4FYVA 1Q12A 1KL9A 2DYKA 1JEQA 1IIBA 3U6BA 5IIKA 2YDYA 5JT1A 1EESA 1SVSA 2VAMA 3F8TA 2CRXA 2EGUA 3I9JA 4R9UC 1QFJA 2HMXA 3BK2A 4EUSA 2JH9A 4ZGGA 2Y93A 1QO0A 3DQQA 4AB1A 4EABA 5DB4A 3SS9X 5KNDD 3B3JA 2I9PA 4TL7A 5JPIA 3CKYA 3NHMA 3T9AA 4U00A 4FNMA 1BGWA 1QRAA 5HS4A 1K2WA 4P36A 3I5XA 1RYYA 3SR4A 3RAPR 1NUQA 1P4AA 2XXBA 4NXZA 3D43A 3JQEA 1GQYA 3IHWA 3DUWA 1E9CA 2XGMA 2XMGA 4C43A 3ZBTA 4B9SA 1XQ9A 2P68A 5K0SA 3H8VA 4OKNA 2ONKA 3AK4A 3E7DA 1NPTO 2XXAA 4KI0A 9ICBA 1L5RA 8ICUA 3IDWA 1XP5A 3ZZ1A 3O1JC 2LWIA 2ZT7A 1NHWA 3R75A 1P31A 1TCVA 3LC2O 1XWIA 1R4MA 1AY0A 1VG1A 4UPDA 2HEGA 5AQ1A 4D2IA 3RKRA 2NU6B 3GJ4A 1RYDA 1ESEA 9ICLA 1DAHA 4HB4A 4CPDA 3HI6A 3C16C 1OT5A 5CT8A 5DYGA 1E2FA 2TYSB 4N6NA 3H0CA 4ZQGA 2Q29A 2IYRA 1T1SA 4LHYA 5I9SA 2B2CA 4KDRA 4INOA 1RCFA 2NV3A 1AA6A 1N2CA 3IA7A 2WKQA 3L6EA 4RKYA 4I5DA 1UOOA 1P1HA 4EUKA 3F6RA 1AQLA 4CMCA 3RDPA 2LTAA 2B5VA 3E23A 5JSYA 3GDWA 3PNKA 4COKA