2N1RA

Nmr structure of the myristylated feline immunodeficiency virus matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
GNGASRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Matrix protein p15
publication title NMR structure of the myristylated feline immunodeficiency virus matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2n1rA00
2NV3A 2H3FA 2LYBA 1ED1A 1UPHA 1HIWA 4IC9A 1A6SA 2LYAA 2K4HA 2H3ZA 1TAMA 2JMGA 2GOLA 1L6NA 1ECWA 2H3QA 2N1RA 2H3IA 2K4IA 4JMUA 2K4EA 2H3VA 2HMXA 1HEKA 4ICAA
chains in the Genus database with same CATH superfamily
3RBDA 4AYBC 9ICHA 9ICAA 2LYBA 5AKIA 2YB4A 5AI9A 3VCBA 1HIWA 5AK4A 1ZQWA 2PFOA 5BOMA 3HPOA 5KFSA 4I2BA 5AM2A 4EBDA 5HMMA 4P0PB 4M9LA 2ZG6A 1L7MA 1NKEA 3SZ2A 4LZGA 4DFPA 3OHAA 1KQQA 8ICLA 5ALMA 2W9AA 2LMRA 4ECWA 3SMVA 2M0NA 2DKZA 2PI5A 4LJXA 3DV9A 4XRHA 3AU6A 4KLTA 2WTFA 4C4SA 4U7CA 2ZJ5A 2W9MA 4PHDA 5ALZA 1JXLA 2HHQA 3T5KA 4OJLA 5HMLA 3IN5A 4DL7A 3OHBA 4EX7A 1TAUA 1SKRA 4Y2SA 4BWMA 5AI8A 4IQUA 4DS4A 4I29A 3C1YA 3WKBA 5KG5A 1T94A 7ICFA 1OXJA 4GXJA 4DQRA 1B4FA 4DSIA 1ZQNA 2G5IB 4F72A 1WUDA 2C2RA 4ECUA 2E8NA 1X9XA 5B5EU 4MF2A 4FBTA 2MU2A 2I5HA 3BQ7A 2KHQA 5ALDA 1S97A 4NL9A 3PSTA 3GV8B 3C23A 3C2KA 5ALRA 1X2IA 3G6YA 1X6IA 2KTQA 3ISBA 5BOLA 1XS9D 2H3VA 4NLCA 2FI1A 5KFJA 2I9GA 2YMPA 3PMLA 4JB3A 4J9LA 1A6SA 1DGJA 1UQVA 3PV8A 3BS5B 1NK6A 4DSFA 2OHFA 3L5KA 5KG6A 3EW9A 3V72A 5J8YA 1U9LA 3NRWA 4UAVA 2KV2A 1VDVA 1WG8A 2KVSA 2VIXA 5KG3A 4J9KA 3BQ1A 2VJ5A 2XCPA 3C21A 8ICQA 5AKZA 4ZOHC 4KN7A 2F8LA 5DQHA 4F4XA 4MFAA 3M8RA 2EZXA 3KHRA 5ALWA 5KAFU 2BKEA 3QNMA 3PW5A 2BHNA 5J0XA 4J9NA 4IR1A 5C5JA 9ICUA 1URJA 3PZPA 5KFYA 3C29A 2W3SA 3PW2A 4QZDA 2R8HA 1PVRA 3WK5A 2NRTA 1ZJNA 3B0XA 3RH5A 2LYAA 1L3VA 5J2KA 1K1QA 1SV0C 2JR5A 1L3UA 2DWQA 3QZ7A 1L8OA 4KLQA 3ZI4A 7ICPA 2BCUA 3DEEA 1J97A 2K4PA 4QZCA 3RRGA 4PL2A 3Q8KA 4IRDA 4J03A 3JPSA 4ECZA 4C8OA 4F2RA 4DSLA 3MABA 5J2JA 1ZD5A 3PMNA 2MUTA 3C2MA 2NRZA 3JPPA 4Q45A 4F92B 1Q46A 2YQEA 3NVZA 5GTHU 4HAIA 1D9FA 4KLUA 1BNOA 3TACB 4RNMA 2K4IA 1K5OA 4DQQA 1SKSA 3L4PA 1KW4A 5F9LA 2AGOA 1IIPA 1RYSA 5CJ7A 2MAXA 4PGXA 2V4QA 3MGHA 4DL3A 2Y0SF 8ICXA 2NO4A 2HCFA 5J2AA 2JEFA 4LZDA 4QIWF 1ZD4A 3C28A 3N7PD 2AXTU 4OCZA 1ZQRA 1RPLA 4DLGA 1DK2A 1RYRA 1HEKA 3V7LA 2NO5A 3NTUA 1WCLA 1L7NA 5AK6A 4IQTA 5KFHA 2EQYA 5KFPA 4JUZA 1RXVA 4CF5A 3LWMA 1X9WA 2HBMA 4QWDA 2AHOB 2MUTB 1N48A 4ECSA 2KG5A 2EZYA 3SAGA 5KT4A 2DGZA 3QUQA 3IM1A 1PK1A 4J9RA 4PZOA 1B22A 4M0AA 4KMUA 5KT6A 8ICCA 5DDYA 5ALJA 4NXZA 4YCXA 4Y2PA 5DBBA 3KTQA 3EPIA 2K4EA 1VJ5A 3SQIA 4BJQA 3MR2A 4NV0A 4RZRA 2ASDA 1SV4A 5KG0A 1SIJA 4US8A 1CI4A 2K4HA 4RUCA 2VJ4A 3SENA 5HHIA 3JPRA 4O3NA 4R66A 3ORYA 9ICSA 5EWGA 1S9FA 3NVWA 1PVQA 3BQ2A 5DB7A 1UT8A 4CF3A 4YVZA 2RDIA 2KIWA 2W54A 2W8KA 4CNQA 4B9NA 2P66A 2IMWP 8ICUA 3EZ5A 9ICWA 5KFZA 5CB1A 2HBKA 5F9NA 2ATLA 3AL0B 9ICQA 1SL0A 3FC4A 1PK1B 2KK0A 4PHEA 1NJXA 2FPKA 3HILA 4TQRA 2CN1A 5C0YA 3UQ0A 4YMNA 2G06A 4IQWA 2JEJA 3H8SA 7ICLA 2B6GA 3QYPA 4DCCA 2D3DA 4RT3A 4PGYA 4MF8A 4DQSA 2KVCA 3H0LB 3HW8A 1X66A 1ZQBA 2GO7A 4Z6FA 4BDPA 4LVSA 3CYMA 3KKAA 3HX0A 9ICJA 2KHVA 1NK8A 3K75D 2HI0A 4KLJA 5KT2A 2BQ3A 3AN1A 3T5JA 4AP9A 4PJ0U 2MSNA 3KHLA 2XIDA 1QQ5A 4TUPA 5JTIA 3NUQA 3AUOA 2RHFA 1L8LA 3AM9A 2J6SA 2A1JB 4Y2UA 4I28A 4TQSA 1EXNA 4UB3A 9ICLA 5ALLA 4QWBA 3IV6A 3FYHA 3OJUA 5AHXA 4BXOA 2QB0A 3QU5A 3QUBA 2Y0SC 1T4GA 2F1IA 4XA5A 2WB1F 4JK1A 1ZQMA 2E8PA 1ZD2P 3N4MB 2KSOA 5J0UA 1N60A 4UAZA 5ALUA 2C22A 9ICRA 4CCHA 1JN3A 7ICEA 3IRUA 3CW2C 2LM4A 3GIIA 7ICGA 1MC8A 3KD3A 2JGAA 2NV3A 5KL8B 4DOCA 1XO1A 5K4LA 1F0MA 1S0OA 2W9BA 2IHMA 3T79A 1ECWA 7ICKA 3HKZC 5AI0A 4RQ8A 4Y2RA 4EZ6A 1ZQEA 4P4PA 1NI3A 3SYZA 7ICQA 4NLZA 4JWNA 1SWWA 5IIJA 3QU9A 3MDAA 1DOQA 4C0ZA 5KFBA 4BXOB 4E0DA 5J29A 2QB0B 3UM9A 4ED1A 3DDHA 5IIMA 3UMBA 5AKXA 5H2FU 2KSOB 1N5WA 1HUOA 3A0BU 4UB6U 1NJZA 3H4DA 3WKAA 1S0VA 2RLTA 1UPHA 3LVWA 1ZRNA 3C1ZA 3I1YA 3RAQA 1NOMA 1S0NA 9ICPA 2H3ZA 1XU4A 2BZFA 3NGDA 9ICKA 2J6TA 2DPIA 1ZXIA 5AKGA 3V6JA 1V9PA 5FP0A 2KICA 2H3QA 3I76A 4EEKA 4JMUA 5L1MA 3CNHA 4IRCA 4KLGA 5DQGA 4M04A 5KT7A 1SKWA 3UXNA 4PHAA 4KLEA 3AQEA 1NJYA 2IA6A 1XC9A 4RQ1A 1ZYQA 4M9GA 3RB3A 2K8BB 4RQ3A 1KDHA 2KN7A 4UAYA 3GIKA 2FLNA 4ED0A 1ZJMA 1CEZA 2JZBA 2I6XA 3T3FA 2M9NA 3UXOA 4ECXA 5J2FA 2FDRA 2RDJA 4P0PA 2ZIXA 1LV5A 3KZXA 5HR6A 3QU2A 2UVVA 3NRZA 4NM1A 1RYUA 1L7OA 5EE9A 1V97A 2W8LA 3RB0A 2R8KA 1SZPA 1N63A 3M9NB 2Q0ZX 1S5LU 4M47A 1K1SA 4FFDA 4YG2A 4TURA 2Y9TA 5KFTA 3RAXA 2IOHA 1KSPA 4QZHA 4R65A 4OJ6A 1AQ6A 4QZAA 2VA8A 2JEGA 3Q8PB 2HBLA 2B0CA 1ZETA 1Z4NA 1A0PA 5AIBA 3SAHA 5EWEA 1L3TA 4UBBA 4F2SA 1PUZA 1N2XA 2ZIVB 2K89A 5T14A 5KFGA 4Z6DA 1DK3A 4DL4A 5DGBA 1MQ3A 1MSWD 4NLKA 4U6PA 7ICMA 5AM3A 2DQNB 2W43A 2WB1C 4EBEA 2JZBB 7ICTA 5J0TA 5IILA 7ICJA 2RRDA 9ICBA 2ZIXB 3GV5B 2UVRA 4QJFB 1NZPA 4TUSA 2YMQA 2KJ9A 3PSIA 3HJEA 5J2BA 5CR0A 3TFSA 4OD0A 3TADA 2WF9A 2KFZA 3PX6A 4OO1J 1N61A 4Y2JA 3HWTA 3BS5A 1ED1A 1QLNA 5B66U 3MGVA 3C2LA 1ZQOA 2ZUCA 4Q8EA 1QCKA 5JRTA 3UPQA 4XQ8A 3N97B 2ZUDA 3EYZA 1FEZA 2YB1A 2OM6A 3MBYA 3SEIA 4K4IA 1SV0A 5L1LA 3GU3A 1HUZA 3QX7A 4FS1A 4KLLA 4WJ3B 1Z1BA 4KLSA 2FE9A 1T3NA 2D8CA 2F44A 1YZ7A 2JRZA 1TKDA 5CRXA 4G9BA 5KFUA 1T7PA 1KTQA 1U49A 4PZNA 4BX9C 1KFDA 4UARA 1VLBA 3PR5B 1F5SA 1MN8A 4UQGA 4J9SA 4EEYA 7ICIA 4RPYA 2I1QA 4F5OA 1QSLA 1RXWA 2HW3A 2IBKA 4KITB 1KRPA 3PY8A 4QWCA 1ZQPA 5AKHA 1RM6C 4Y2QA 3AMZA 1ZQSA 2J6UA 5AK3A 2LPEA 4K4HA 3H7IA 4F4WA 3E0FA 5L1IA 2BPFA 1IXRA 3BQTA 3FM9A 2BPCA 3RJFA 2PKEA 3F53A 4FE3A 2E1EA 2VA2A 4B6JA 2KFNA 3RTVA 2ZIUA 4K4GA 3UMCA 1JI7A 3RJEA 4P0QA 1KFSA 4ED2A 4O9MA 1TAMA 4F4ZA 1KLNA 4ECTA 5E79U 4O3OA 2BCQA 3WU2U 4DL6A 4MFCA 5DG8A 1T8EA 2F8KA 4KTQA 3D2QA 4UBCA 5J0RA 4GC7A 9ICGA 1U47A 4YMMA 3F5EA 3MGIA 3FAHA 4EENA 2XCAA 2UVWA 3SV4A 2HHTA 1ZQTA 2DPJA 2EZZA 3IG5A 3WK4A 4RQ6A 5F3XB 1TVAA 2HHSA 2PI4A 2KKVA 4UW9A 4UAUA 4RQ5A 4NL9C 2YMMA 1ZQJA 4RQ0A 5J0SA 3RJHA 4M2YA 4ED8A 3BJYA 2EANA 1BPZA 4I2EA 2ZIUB 5CEHA 2BGWA 1BPBA 1UA1A 2ZUBA 3U26A 4P0QB 1X40A 3LK9A 2K60A 4UB2A 2RQ5A 3ETRA 8ICRA 2AQ4A 1Z3EB 9ICTA 1NK5A 2C28A 3ZD9A 2IOFA 4C4RA 4F3OA 4KLMA 2ZXIA 5ALVA 1UT5A 5J8YC 1Y88A 4F5PA 3TQ1A 1ZOLA 1DGSA 3V6KA 2DF4B 3RB6A 5ALYA 4DFKA 4F8RA 4RPZA 1L7PA 1SXDA 4FZMA 3H4BA 1Z4OA 5AKJA 3TKAA 1TFRA 5KTQA 2F1JA 4DF8A 5JU5A 5KFLA 1XSNA 2PXIA 3HP6A 8ICVA 4ED6A 2XI9A 3PO5A 3WKCA 4USAA 2KD1A 3BZKA 4BGDA 3N28A 9ICEA 2YTUA 1UCVA 3QUCA 4Y2YA 4FBUA 4KX3A 5CHGA 7ICVA 4DEZA 1JXEA 4NY8A 3M6ZA 8ICTA 3MR6A 1LB2B 2LHTA 1L5UA 4US9A 1QH9A 1GO3F 5AKLA 7ICUA 3OSNA 1JUDA 2A1AA 3V7KA 5ALOA 1ZQHA 3GQCA 4ECVA 3G6VA 2ZXHA 2A1JA 4CGZA 4FO6A 3NASA 3IP4B 2HHVA 4OJ5A 5A0LA 1Z1VA 4M9HA 1V38A 2XICA 3ISCA 2K8AA 8ICIA 3LYSA 3A0HU 3WKEA 1J2MA 1U4BA 1NJWA 1PK3A 5KFDA 2G5HB 2HHWA 3RH6A 2K8CB 5ALTA 2JXJA 1D8LA 2W04A 4O3MA 3WK9A 2MA1A 8ICMA 2HHUA 3H8JA 2VA3A 5EE0A 3WK6A 1NK9A 1ZQKA 3ZDCA 2HHXA 2PMZF 3H8MA 2H3FA 4DFMA 5AI5A 3NVYA 3WK8A 4CF4A 5J0WA 3F2CA 4CE6A 5DG7A 4MEYA 3O0FA 4BWJA 3PSPA 1C7YA 3B9JA 5IIKA 9ICVA 4PPXA 2HBJA 2WF5A 4Y2TA 4R8UA 5G5HA 3SR6A 2W03A 2QB1A 4YFKA 3LWLA 4GLXA 2JEIA 4QIWC 2WF6A 3GZFA 3PX4A 3M9OB 2ZJAA 4MHVA 4ZH4A 2W11A 3ETLA 1BGXT 2Y1JA 1NK0A 1UHUA 5KFQA 1XWLA 3JPOA 1O08A 4UASA 3Q8QB 7ICHA 5DB6A 1ZRMA 2YMLA 3JPTA 1YZ6A 5KFIA 3PW0A 2OXOA 4OJOA 2A19A 5KG4A 5J2EA 2WF7A 4NM2A 4EBCA 1H38A 2F1HA 2ESEA 1TK0A 2FMSA 2ASLA 5KFAA 5AKYA 4QZ8A 4DSEA 5IIOA 5KNIA 1CRXA 4EX6A 3IG8A 4R8UB 2G09A 1NNLA 4P4MA 1BPXA 3OTQA 4DSJA 2ZJ8A 1BVSA 3ICXA 3Q8SB 1MQ2A 1S77D 1WCNA 5KL1B 1AROP 2XY6A 1SXEA 2FPLA 4F4YA 2ODGA 5ALNA 3N7RC 8ICPA 3RR7A 4QWAA 1X42A 1ZQ1C 9ICNA 1FO4A 5ALEA 2LYHA 1PVPA 2CPRA 1KKXA 4GC6A 1S10A 2KOBA 4C8MA 1SGGA 5ALFA 1BNPA 5HR7A 1ZQLA 5DB8A 5KFXA 3TAQA 5ALPA 3QU4A 4RU9A 2ZIVA 2EH9A 2FJ6A 4FZNA 4UATA 3R9KA 4M6WA 4KLHA 7ICOA 4Q44A 1M6YA 1ZQZA 1RDFA 5J2GA 2AQ0A 4O5KA 2VANA 2FLLA 3UMGA 3EUB2 5AIAA 2FMPA 2W9CA 2P6RA 5ALIA 3K4GA 1T3QA 2EAPA 3AU2A 4I2CA 1D9DA 2KMDA 5J0PA 5KFCA 5CA7A 1UA0A 2P6UA 2C2DA 1MA7A 3KZIU 3PO4A 3TARA 2R18A 5J2IA 3QEAZ 3ISDA 5TISU 2F76X 5AKKA 4P4OA 5DBCA 2H5XA 1TAQA 3E58A 2AU0A 4EELA 4O3PA 4JV1A 3JPNA 4JWMA 9ICFA 1X9SA 1P7DA 4B9VA 4DOAA 2UVUA 8ICGA 3RR8A 2HDOA 1CUKA 2F77X 4F71A 4M6WB 4ECYA 2ISPA 5AKEA 3BZCA 2JHDA 1KEJA 3Q8LA 4ELVA 3D2SA 3J81j 1N5XA 1DRGA 4DL2A 2R8GA 4IC9A 2E5SA 5KAIU 4BUGA 4I2AA 5DKWA 3PR4A 2W9CB 1Q8KA 1JALA 4C8NA 2GOLA 3F2BA 4B9SA 4YP3A 2GLEA 4IL6U 4DO9A 2P35A 5L1JA 1LKYA 2NRWA 2ZTEA 4RQMA 2XVTA 1QQ7A 1XO0A 3SV3A 3UXPA 4F93B 4DQIA 3OGUA 1ZQDA 1RQNA 5ALKA 3TANA 3RJJA 4QW9A 2F2AB 3QU7A 4G3IA 4O0IA 2WAQF 5JUMA 2ASJA 3EWAA 4OJPA 1IV8A 3GIJA 3QEBZ 2G07A 1C20A 2W7OA 5ALSA 3ZDBA 4MFFA 3MFIA 3H40A 8ICJA 4PH5A 2G0AA 5AI4A 2HSZA 4QZEA 1NK7A 2HOIA 3K1RB 3QXGA 5L9XA 5TZVA 1JX4A 5KFEA 2AJQA 4DL5A 1TK5A 8ICOA 5AI6A 5ALXA 4J9MA 1YT3A 4RQ7A 2W7PA 1B0XA 3MR5A 1SWVA 2FLPA 1LKYB 3M6KA 5KFOA 2BQUA 4XUSA 4I2HA 4ECRA 4YXJA 3KFUF 3LVVA 3OPXA 4DS5A 2IHNA 2OWOA 4QNLA 5CWRA 1NZBA 4JV2A 5AM5A 5KG1A 2OYYA 3ZDAA 1JIHA 1A76A 2NRXA 4DFJA 4Q43A 3CP8A 1QSSA 4C80A 2Y9UA 4UAWA 3GDXA 2FMQA 1ZD3A 4CRXA 5KT5A 1KL9A 2RP5A 3HRDD 8ICHA 1ZQXA 2H3IA 2KZ3A 2L5YA 3GIMA 4O3QA 3RJKA 1XSLA 3N7SC 2EAOA 4J9OA 2QLTA 3TADC 4YQWA 3UQ2A 3S6JA 7ICSA 4ED7A 4DFDA 2KEYA 4DF4A 5KFVA 4QWEA 5KFKA 1SZHA 1B43A 4GXKA 4DLEA 4NLBA 3MC1A 3K1ZA 2ES6A 2BCSA 4DQPA 5J0OA 2OCEA 2D6FC 3RH4A 5KFFA 2DKXA 2QKQA 4C7ZA 4NWIA 2AGPA 2BCRA 3ED5A 2DL0A 8ICZA 1WWVA 5EE3A 4F5RA 3QE9Y 1SB3C 1J2NA 2XGQA 3L3FX 4RQ4A 3LDAA 2ISOA 4O3SA 3MDCA 5AICA 2YX8A 9ICOA 5KT3A 1RG6A 2XGPA 2WHEA 1OUQA 3AEVA 3QUTA 4KLOA 3NVVA 5BPCA 2YY6A 3GFKB 3F5AA 2E1FA 2OEHA 3H8WA 2JV3A 3HT3A 4GIBA 2Y1IA 5KG7A 5IIIA 3ALRA 2LI6A 1XNSA 8ICNA 5DB9A 2HOFA 2ALZA 1BPEA 1WYGA 3ZDDA 3M9MB 3IDWA 5EOZA 1D8BA 2HOQA 5AM1A 4YXMA 1F44A 4F91B 1TK8A 1RZTA 4FS2A 5GTIU 3TAPA 2WAQC 1ZQAA 3OJSA 4KX5A 4NLNA 4YN4A 2BDUA 4ED3A 3V7JA 5J0YA 4KLDA 2XY5A 2ZTDA 2GH1A 2ZTCA 2AH5A 1TV9A 4I2GA 4GXIA 4KMOB 2JMGA 3AQFA 4IQVA 3HKZF 2KE7A 4B9MA 4MEXA 5HP4A 1S8OA 4DOBA 2KIVA 3MR3A 2PFQA 2ZIWA 8ICBA 1TE2A 3RB4A 1FFVA 1X9MA 2KKPA 2HVIA 1OW5A 4I27A 5L1KA 1ZQCA 4O3RA 4RPXA 4NJ8A 4Y2XA 5DLFA 1KFTA 3T5LA 4Z6EA 5J2HA 4RNOA 2E8MA 2DBYA 2B21A 3FDSA 2PFPA 4DSKA 4R64A 4DWIA 5CP2A 3RJGA 5KFNA 5EE1A 2NRVA 1ZQIA 4KN4A 1SL2A 3PVXA 2KJ5A 3I28A 1ZQVA 5DG9A 2OH2A 4C8KA 8ICSA 8ICYA 1Q3UA 3C5FA 2ZIWB 5AK5A 2KZMA 3SD7A 2W55A 2PFNA 1S0MA 4M9NA 4ICAA 4EZ9A 3D6JA 4YD1A 4EYIB 7ICNA 3M7DA 5ALQA 2QARA 4Q8FA 5KFRA 5KFMA 4EYHB 3BDPA 5J0QA 4GFJA 1QQ6A 4HYKA 5D46A 1PZNA 4R63A 4RUAA 1XSPA 3RF9A 2XY7A 2N1RA 2FPMA 1KBUA 4FZLA 3PSFA 3TFRA 1FFUA 4YD2A 1COOA 2JH1A 2LBOA 2HMXA 4YR3A 3IHQB 5J2DA 4IRKA 4KLFA 3GV7B 4J9QA 1Q3VA 3RFAA 2XC9A 2BR0A 5AM4A 1SL1A 5AM0A 2LM1A 3SI8A 1Z19A 5G5GA 5DQIA 4F50A 2A3VA 3RRHA 7ICRA 1Z00A 1NKBA 1WWUA 5KG2A 4IS7A 1V85A 4UB5A 4AYBF 4O5CA 4ELTA 4ELUA 1IM4A 3KHGA 2CRXA 2XO7A 3T5HA 1U45A 1ZQQA 4F4KA 4C7YA 2V9WA 2QARB 1HJPA 2E8OA 2Q4TA 8ICKA 5HHHA 3BS7A 2EDUA 5D4BA 1D8YA 2G08A 2O6KA 2KZZA 1ZQFA 4YMOA 4F5NA 2KNJA 2KP7A 3ZD8A 3PW4A 1QTMA 4NLGA 1QSYA 1BPYA 3KHHA 3WKDA 4J9PA 1ZQYA 3WK7A 3M8SA 1NKCA 3VC8A 3E2EA 4RQ2A 2BQRA 1JRPA 3GILA 2NYVA 3KBBA 4ACOA 3ZDEA 4M9JA 3KKAC 4KLIA 5DDMA 1S76D 4TUQA 9ICXA 2R8IA 1Z00B 3F2DA 4QZGA 3EPGA 3TI0A 1JMSA 2JH7A 3H0RB 4I2JA 2F3NA 1X6JA 2C2EA 3Q8MA 4ECQA 1ZQUA 1FIQA 5ALGA 2BPGA 2VKQA 2BDPA 4I2DA 3G6XA 1ZQGA 2WFAA 2DFLA 4RNNA 3MFHA 3PX0A 4X5VA 2IOFK 4UB8U 8ICFA 2KJ8A 3H0MB 2EAMA 4QZ9A 1NK4A 1L3SA 2Z7JA 2W9BB 1A77A 4QZBA 3ONNA 4CDGA 2V4RA 5D49A 9ICIA 2R8JA 2MRLA 5ALHA 3BQ0A 1N62A 3RBEA 4A8EA 5EWFA 2LKYA 2W3RA 4C8LA 2BCVA 2AGQA 2DUYA 3PNCA 1COKA 2E3TA 1IG6A 3CRXA 4B9UA 3OSPA 3RJIA 4QW8A 9ICCA 3C5GA 4F5QA 5DLGA 4QZIA 3M1YA 5DBAA 4IR9A 1O03A 3KOOA 4PL1A 4YR0A 5DGAA 4JV0A 1BPDA 2PMZC 4Y2VA 4C4TA 3SAFA 1JROA 2GWSA 5HNKA 4I2IA 4B9TA 4RT2A 1LVHA 2WF8A 1L6NA 3THVA 4PHPA 8ICAA 3V6HA 8ICWA 4Z6CA 3Q8RB 4I2FA 1DXSA 9ICMA 8ICEA 1U48A 4PGQA 4RQNA 1N56A 4UB1A 4QZFA 5J2CA 3NS1A 4YR2A 3PW7A 3D2NA 5IINA 2YN4A 4B9LA 3B0YA 3QZ8A 1RQLA 3JPQA 2CXYA 5KFWA 1KN5A 2HVHA 4O5EA 4P2HA 4UB4A
chains in the Genus database with same CATH topology
4AYBC 2LYBA 2VKQA 2YB4A 2W7OA 3VCBA 1HIWA 2HBLA 2F8LA 1Q3VA 3RFAA 2KVCA 2ZIWA 1A0PA 2ZXHA 3SAHA 3H0LB 4NWIA 4CGZA 4C0ZA 2OXOA 4OJOA 4P0PB 2G0AA 2ZIUB 2ZG6A 3IP4B 2ZIVB 2K89A 1Z19A 5T14A 4OJ5A 2HBMA 2KJ8A 4P0QB 3CYMA 2KKPA 3H0MB 2HOIA 2Z7JA 4BX9C 2KHVA 5A0LA 1MA7A 2A3VA 3ONNA 4CDGA 3L3FX 2R18A 2MRLA 3SAGA 3SMVA 2M0NA 2DGZA 2F76X 1URJA 2ZXIA 2XICA 4A8EA 3PZPA 5CRXA 2LKYA 3C29A 4U6PA 2DQNB 2XIDA 2YX8A 4AYBF 1UPHA 4U7CA 1PVRA 2K8AA 2WB1C 3E0FA 3LVWA 1CRXA 1YT3A 3LYSA 3NUQA 1OUQA 2DF4B 2RHFA 2W7PA 2LYAA 2CRXA 3CRXA 2H3ZA 2RRDA 3IG8A 2G09A 3M6KA 2G5HB 4OJLA 1P7DA 3IN5A 3F5AA 2ZIXB 2E1FA 2K8CB 2W04A 3ICXA 4O3MA 4QJFB 3KFUF 2KICA 2H3QA 2F77X 2KJ9A 3DEEA 2MA1A 3LVVA 3PSIA 2Q4TA 4FZMA 4PL1A 5KL1B 3F53A 4JMUA 3ALRA 4FE3A 2E1EA 2K4EA 2G08A 1XNSA 3OPXA 1T94A 4PL2A 2HOFA 3SQIA 4BJQA 3N7RC 4QNLA 2JHDA 2PMZC 4NV0A 1NZBA 2ZIUA 4OO1J 2G5IB 2PMZF 3SAFA 2H3FA 2KNJA 1WUDA 3D2SA 1ED1A 2Y0SC 4P0QA 1D8BA 2HOQA 3F2CA 1ZQ1C 1DRGA 2OYYA 2KJ5A 4IC9A 2E5SA 2WB1F 1F44A 2KHQA 2K4HA 3AQEA 2XI9A 3CP8A 4BUGA 1TAMA 2VJ4A 3MGVA 1PVPA 2CPRA 2K8BB 3O0FA 3PSPA 2KD1A 3PSTA 2OH2A 2KOBA 4CRXA 2GOLA 1L6NA 2RP5A 5C0YA 2WAQC 3VC8A 3F2BA 1Q3UA 2H3IA 2ZIWB 2K4IA 3D2QA 1PVQA 5HR7A 4KX5A 2H3VA 2HBJA 2YB1A 2OM6A 4NLCA 1IIPA 4ICAA 4KX3A 4ACOA 3N7SC 2KIWA 2XVTA 2W03A 2JGAA 3GU3A 2NV3A 2ZIXA 3M7DA 5KL8B 4P0PA 3F5EA 2ZIVA 3M6ZA 1XO0A 2BDUA 3KZXA 5HR6A 4FZNA 2Y0SF 4WJ3B 1A6SA 2HBKA 3AL0B 1Z1BA 4GFJA 2GH1A 3IG5A 2KEYA 3D2NA 3F2DA 2LHTA 3T79A 4QIWC 4KMOB 2JMGA 3GZFA 4QIWF 3RF9A 1SZHA 1ECWA 1GO3F 2F2AB 2JH7A 2N1RA 3H0RB 2CN1A 2KKVA 3NRWA 2KV2A 3C28A 4NLBA 3N7PD 2WAQF 4FZLA 3PSFA 3K1ZA 3HKZC 3AQFA 3HKZF 2JH1A 2G06A 2VIXA 2LBOA 4OJPA 1KBUA 2HMXA 1HEKA 2D6FC 2VJ5A 2G07A 4OJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NV3 A;  2H3F A;  2LYB A;  1ED1 A;  1UPH A;  1HIW A;  4IC9 A;  1A6S A;  2LYA A;  2K4H A;  2H3Z A;  1TAM A;  2JMG A;  2GOL A;  1L6N A;  1ECW A;  2H3Q A;  2N1R A;  2H3I A;  2K4I A;  4JMU A;  2K4E A;  2H3V A;  2HMX A;  1HEK A;  4ICA A; 
#chains in the Genus database with same CATH topology
 3RBD A;  4AYB C;  9ICH A;  9ICA A;  2LYB A;  5AKI A;  2YB4 A;  5AI9 A;  3VCB A;  1HIW A;  5AK4 A;  1ZQW A;  2PFO A;  5BOM A;  3HPO A;  5KFS A;  4I2B A;  5AM2 A;  4EBD A;  5HMM A;  4P0P B;  4M9L A;  2ZG6 A;  1L7M A;  1NKE A;  3SZ2 A;  4LZG A;  4DFP A;  3OHA A;  1KQQ A;  8ICL A;  5ALM A;  2W9A A;  2LMR A;  4ECW A;  3SMV A;  2M0N A;  2DKZ A;  2PI5 A;  4LJX A;  3DV9 A;  4XRH A;  3AU6 A;  4KLT A;  2WTF A;  4C4S A;  4U7C A;  2ZJ5 A;  2W9M A;  4PHD A;  5ALZ A;  1JXL A;  2HHQ A;  3T5K A;  4OJL A;  5HML A;  3IN5 A;  4DL7 A;  3OHB A;  4EX7 A;  1TAU A;  1SKR A;  4Y2S A;  4BWM A;  5AI8 A;  4IQU A;  4DS4 A;  4I29 A;  3C1Y A;  3WKB A;  5KG5 A;  1T94 A;  7ICF A;  1OXJ A;  4GXJ A;  4DQR A;  1B4F A;  4DSI A;  1ZQN A;  2G5I B;  4F72 A;  1WUD A;  2C2R A;  4ECU A;  2E8N A;  1X9X A;  5B5E U;  4MF2 A;  4FBT A;  2MU2 A;  2I5H A;  3BQ7 A;  2KHQ A;  5ALD A;  1S97 A;  4NL9 A;  3PST A;  3GV8 B;  3C23 A;  3C2K A;  5ALR A;  1X2I A;  3G6Y A;  1X6I A;  2KTQ A;  3ISB A;  5BOL A;  1XS9 D;  2H3V A;  4NLC A;  2FI1 A;  5KFJ A;  2I9G A;  2YMP A;  3PML A;  4JB3 A;  4J9L A;  1A6S A;  1DGJ A;  1UQV A;  3PV8 A;  3BS5 B;  1NK6 A;  4DSF A;  2OHF A;  3L5K A;  5KG6 A;  3EW9 A;  3V72 A;  5J8Y A;  1U9L A;  3NRW A;  4UAV A;  2KV2 A;  1VDV A;  1WG8 A;  2KVS A;  2VIX A;  5KG3 A;  4J9K A;  3BQ1 A;  2VJ5 A;  2XCP A;  3C21 A;  8ICQ A;  5AKZ A;  4ZOH C;  4KN7 A;  2F8L A;  5DQH A;  4F4X A;  4MFA A;  3M8R A;  2EZX A;  3KHR A;  5ALW A;  5KAF U;  2BKE A;  3QNM A;  3PW5 A;  2BHN A;  5J0X A;  4J9N A;  4IR1 A;  5C5J A;  9ICU A;  1URJ A;  3PZP A;  5KFY A;  3C29 A;  2W3S A;  3PW2 A;  4QZD A;  2R8H A;  1PVR A;  3WK5 A;  2NRT A;  1ZJN A;  3B0X A;  3RH5 A;  2LYA A;  1L3V A;  5J2K A;  1K1Q A;  1SV0 C;  2JR5 A;  1L3U A;  2DWQ A;  3QZ7 A;  1L8O A;  4KLQ A;  3ZI4 A;  7ICP A;  2BCU A;  3DEE A;  1J97 A;  2K4P A;  4QZC A;  3RRG A;  4PL2 A;  3Q8K A;  4IRD A;  4J03 A;  3JPS A;  4ECZ A;  4C8O A;  4F2R A;  4DSL A;  3MAB A;  5J2J A;  1ZD5 A;  3PMN A;  2MUT A;  3C2M A;  2NRZ A;  3JPP A;  4Q45 A;  4F92 B;  1Q46 A;  2YQE A;  3NVZ A;  5GTH U;  4HAI A;  1D9F A;  4KLU A;  1BNO A;  3TAC B;  4RNM A;  2K4I A;  1K5O A;  4DQQ A;  1SKS A;  3L4P A;  1KW4 A;  5F9L A;  2AGO A;  1IIP A;  1RYS A;  5CJ7 A;  2MAX A;  4PGX A;  2V4Q A;  3MGH A;  4DL3 A;  2Y0S F;  8ICX A;  2NO4 A;  2HCF A;  5J2A A;  2JEF A;  4LZD A;  4QIW F;  1ZD4 A;  3C28 A;  3N7P D;  2AXT U;  4OCZ A;  1ZQR A;  1RPL A;  4DLG A;  1DK2 A;  1RYR A;  1HEK A;  3V7L A;  2NO5 A;  3NTU A;  1WCL A;  1L7N A;  5AK6 A;  4IQT A;  5KFH A;  2EQY A;  5KFP A;  4JUZ A;  1RXV A;  4CF5 A;  3LWM A;  1X9W A;  2HBM A;  4QWD A;  2AHO B;  2MUT B;  1N48 A;  4ECS A;  2KG5 A;  2EZY A;  3SAG A;  5KT4 A;  2DGZ A;  3QUQ A;  3IM1 A;  1PK1 A;  4J9R A;  4PZO A;  1B22 A;  4M0A A;  4KMU A;  5KT6 A;  8ICC A;  5DDY A;  5ALJ A;  4NXZ A;  4YCX A;  4Y2P A;  5DBB A;  3KTQ A;  3EPI A;  2K4E A;  1VJ5 A;  3SQI A;  4BJQ A;  3MR2 A;  4NV0 A;  4RZR A;  2ASD A;  1SV4 A;  5KG0 A;  1SIJ A;  4US8 A;  1CI4 A;  2K4H A;  4RUC A;  2VJ4 A;  3SEN A;  5HHI A;  3JPR A;  4O3N A;  4R66 A;  3ORY A;  9ICS A;  5EWG A;  1S9F A;  3NVW A;  1PVQ A;  3BQ2 A;  5DB7 A;  1UT8 A;  4CF3 A;  4YVZ A;  2RDI A;  2KIW A;  2W54 A;  2W8K A;  4CNQ A;  4B9N A;  2P66 A;  2IMW P;  8ICU A;  3EZ5 A;  9ICW A;  5KFZ A;  5CB1 A;  2HBK A;  5F9N A;  2ATL A;  3AL0 B;  9ICQ A;  1SL0 A;  3FC4 A;  1PK1 B;  2KK0 A;  4PHE A;  1NJX A;  2FPK A;  3HIL A;  4TQR A;  2CN1 A;  5C0Y A;  3UQ0 A;  4YMN A;  2G06 A;  4IQW A;  2JEJ A;  3H8S A;  7ICL A;  2B6G A;  3QYP A;  4DCC A;  2D3D A;  4RT3 A;  4PGY A;  4MF8 A;  4DQS A;  2KVC A;  3H0L B;  3HW8 A;  1X66 A;  1ZQB A;  2GO7 A;  4Z6F A;  4BDP A;  4LVS A;  3CYM A;  3KKA A;  3HX0 A;  9ICJ A;  2KHV A;  1NK8 A;  3K75 D;  2HI0 A;  4KLJ A;  5KT2 A;  2BQ3 A;  3AN1 A;  3T5J A;  4AP9 A;  4PJ0 U;  2MSN A;  3KHL A;  2XID A;  1QQ5 A;  4TUP A;  5JTI A;  3NUQ A;  3AUO A;  2RHF A;  1L8L A;  3AM9 A;  2J6S A;  2A1J B;  4Y2U A;  4I28 A;  4TQS A;  1EXN A;  4UB3 A;  9ICL A;  5ALL A;  4QWB A;  3IV6 A;  3FYH A;  3OJU A;  5AHX A;  4BXO A;  2QB0 A;  3QU5 A;  3QUB A;  2Y0S C;  1T4G A;  2F1I A;  4XA5 A;  2WB1 F;  4JK1 A;  1ZQM A;  2E8P A;  1ZD2 P;  3N4M B;  2KSO A;  5J0U A;  1N60 A;  4UAZ A;  5ALU A;  2C22 A;  9ICR A;  4CCH A;  1JN3 A;  7ICE A;  3IRU A;  3CW2 C;  2LM4 A;  3GII A;  7ICG A;  1MC8 A;  3KD3 A;  2JGA A;  2NV3 A;  5KL8 B;  4DOC A;  1XO1 A;  5K4L A;  1F0M A;  1S0O A;  2W9B A;  2IHM A;  3T79 A;  1ECW A;  7ICK A;  3HKZ C;  5AI0 A;  4RQ8 A;  4Y2R A;  4EZ6 A;  1ZQE A;  4P4P A;  1NI3 A;  3SYZ A;  7ICQ A;  4NLZ A;  4JWN A;  1SWW A;  5IIJ A;  3QU9 A;  3MDA A;  1DOQ A;  4C0Z A;  5KFB A;  4BXO B;  4E0D A;  5J29 A;  2QB0 B;  3UM9 A;  4ED1 A;  3DDH A;  5IIM A;  3UMB A;  5AKX A;  5H2F U;  2KSO B;  1N5W A;  1HUO A;  3A0B U;  4UB6 U;  1NJZ A;  3H4D A;  3WKA A;  1S0V A;  2RLT A;  1UPH A;  3LVW A;  1ZRN A;  3C1Z A;  3I1Y A;  3RAQ A;  1NOM A;  1S0N A;  9ICP A;  2H3Z A;  1XU4 A;  2BZF A;  3NGD A;  9ICK A;  2J6T A;  2DPI A;  1ZXI A;  5AKG A;  3V6J A;  1V9P A;  5FP0 A;  2KIC A;  2H3Q A;  3I76 A;  4EEK A;  4JMU A;  5L1M A;  3CNH A;  4IRC A;  4KLG A;  5DQG A;  4M04 A;  5KT7 A;  1SKW A;  3UXN A;  4PHA A;  4KLE A;  3AQE A;  1NJY A;  2IA6 A;  1XC9 A;  4RQ1 A;  1ZYQ A;  4M9G A;  3RB3 A;  2K8B B;  4RQ3 A;  1KDH A;  2KN7 A;  4UAY A;  3GIK A;  2FLN A;  4ED0 A;  1ZJM A;  1CEZ A;  2JZB A;  2I6X A;  3T3F A;  2M9N A;  3UXO A;  4ECX A;  5J2F A;  2FDR A;  2RDJ A;  4P0P A;  2ZIX A;  1LV5 A;  3KZX A;  5HR6 A;  3QU2 A;  2UVV A;  3NRZ A;  4NM1 A;  1RYU A;  1L7O A;  5EE9 A;  1V97 A;  2W8L A;  3RB0 A;  2R8K A;  1SZP A;  1N63 A;  3M9N B;  2Q0Z X;  1S5L U;  4M47 A;  1K1S A;  4FFD A;  4YG2 A;  4TUR A;  2Y9T A;  5KFT A;  3RAX A;  2IOH A;  1KSP A;  4QZH A;  4R65 A;  4OJ6 A;  1AQ6 A;  4QZA A;  2VA8 A;  2JEG A;  3Q8P B;  2HBL A;  2B0C A;  1ZET A;  1Z4N A;  1A0P A;  5AIB A;  3SAH A;  5EWE A;  1L3T A;  4UBB A;  4F2S A;  1PUZ A;  1N2X A;  2ZIV B;  2K89 A;  5T14 A;  5KFG A;  4Z6D A;  1DK3 A;  4DL4 A;  5DGB A;  1MQ3 A;  1MSW D;  4NLK A;  4U6P A;  7ICM A;  5AM3 A;  2DQN B;  2W43 A;  2WB1 C;  4EBE A;  2JZB B;  7ICT A;  5J0T A;  5IIL A;  7ICJ A;  2RRD A;  9ICB A;  2ZIX B;  3GV5 B;  2UVR A;  4QJF B;  1NZP A;  4TUS A;  2YMQ A;  2KJ9 A;  3PSI A;  3HJE A;  5J2B A;  5CR0 A;  3TFS A;  4OD0 A;  3TAD A;  2WF9 A;  2KFZ A;  3PX6 A;  4OO1 J;  1N61 A;  4Y2J A;  3HWT A;  3BS5 A;  1ED1 A;  1QLN A;  5B66 U;  3MGV A;  3C2L A;  1ZQO A;  2ZUC A;  4Q8E A;  1QCK A;  5JRT A;  3UPQ A;  4XQ8 A;  3N97 B;  2ZUD A;  3EYZ A;  1FEZ A;  2YB1 A;  2OM6 A;  3MBY A;  3SEI A;  4K4I A;  1SV0 A;  5L1L A;  3GU3 A;  1HUZ A;  3QX7 A;  4FS1 A;  4KLL A;  4WJ3 B;  1Z1B A;  4KLS A;  2FE9 A;  1T3N A;  2D8C A;  2F44 A;  1YZ7 A;  2JRZ A;  1TKD A;  5CRX A;  4G9B A;  5KFU A;  1T7P A;  1KTQ A;  1U49 A;  4PZN A;  4BX9 C;  1KFD A;  4UAR A;  1VLB A;  3PR5 B;  1F5S A;  1MN8 A;  4UQG A;  4J9S A;  4EEY A;  7ICI A;  4RPY A;  2I1Q A;  4F5O A;  1QSL A;  1RXW A;  2HW3 A;  2IBK A;  4KIT B;  1KRP A;  3PY8 A;  4QWC A;  1ZQP A;  5AKH A;  1RM6 C;  4Y2Q A;  3AMZ A;  1ZQS A;  2J6U A;  5AK3 A;  2LPE A;  4K4H A;  3H7I A;  4F4W A;  3E0F A;  5L1I A;  2BPF A;  1IXR A;  3BQT A;  3FM9 A;  2BPC A;  3RJF A;  2PKE A;  3F53 A;  4FE3 A;  2E1E A;  2VA2 A;  4B6J A;  2KFN A;  3RTV A;  2ZIU A;  4K4G A;  3UMC A;  1JI7 A;  3RJE A;  4P0Q A;  1KFS A;  4ED2 A;  4O9M A;  1TAM A;  4F4Z A;  1KLN A;  4ECT A;  5E79 U;  4O3O A;  2BCQ A;  3WU2 U;  4DL6 A;  4MFC A;  5DG8 A;  1T8E A;  2F8K A;  4KTQ A;  3D2Q A;  4UBC A;  5J0R A;  4GC7 A;  9ICG A;  1U47 A;  4YMM A;  3F5E A;  3MGI A;  3FAH A;  4EEN A;  2XCA A;  2UVW A;  3SV4 A;  2HHT A;  1ZQT A;  2DPJ A;  2EZZ A;  3IG5 A;  3WK4 A;  4RQ6 A;  5F3X B;  1TVA A;  2HHS A;  2PI4 A;  2KKV A;  4UW9 A;  4UAU A;  4RQ5 A;  4NL9 C;  2YMM A;  1ZQJ A;  4RQ0 A;  5J0S A;  3RJH A;  4M2Y A;  4ED8 A;  3BJY A;  2EAN A;  1BPZ A;  4I2E A;  2ZIU B;  5CEH A;  2BGW A;  1BPB A;  1UA1 A;  2ZUB A;  3U26 A;  4P0Q B;  1X40 A;  3LK9 A;  2K60 A;  4UB2 A;  2RQ5 A;  3ETR A;  8ICR A;  2AQ4 A;  1Z3E B;  9ICT A;  1NK5 A;  2C28 A;  3ZD9 A;  2IOF A;  4C4R A;  4F3O A;  4KLM A;  2ZXI A;  5ALV A;  1UT5 A;  5J8Y C;  1Y88 A;  4F5P A;  3TQ1 A;  1ZOL A;  1DGS A;  3V6K A;  2DF4 B;  3RB6 A;  5ALY A;  4DFK A;  4F8R A;  4RPZ A;  1L7P A;  1SXD A;  4FZM A;  3H4B A;  1Z4O A;  5AKJ A;  3TKA A;  1TFR A;  5KTQ A;  2F1J A;  4DF8 A;  5JU5 A;  5KFL A;  1XSN A;  2PXI A;  3HP6 A;  8ICV A;  4ED6 A;  2XI9 A;  3PO5 A;  3WKC A;  4USA A;  2KD1 A;  3BZK A;  4BGD A;  3N28 A;  9ICE A;  2YTU A;  1UCV A;  3QUC A;  4Y2Y A;  4FBU A;  4KX3 A;  5CHG A;  7ICV A;  4DEZ A;  1JXE A;  4NY8 A;  3M6Z A;  8ICT A;  3MR6 A;  1LB2 B;  2LHT A;  1L5U A;  4US9 A;  1QH9 A;  1GO3 F;  5AKL A;  7ICU A;  3OSN A;  1JUD A;  2A1A A;  3V7K A;  5ALO A;  1ZQH A;  3GQC A;  4ECV A;  3G6V A;  2ZXH A;  2A1J A;  4CGZ A;  4FO6 A;  3NAS A;  3IP4 B;  2HHV A;  4OJ5 A;  5A0L A;  1Z1V A;  4M9H A;  1V38 A;  2XIC A;  3ISC A;  2K8A A;  8ICI A;  3LYS A;  3A0H U;  3WKE A;  1J2M A;  1U4B A;  1NJW A;  1PK3 A;  5KFD A;  2G5H B;  2HHW A;  3RH6 A;  2K8C B;  5ALT A;  2JXJ A;  1D8L A;  2W04 A;  4O3M A;  3WK9 A;  2MA1 A;  8ICM A;  2HHU A;  3H8J A;  2VA3 A;  5EE0 A;  3WK6 A;  1NK9 A;  1ZQK A;  3ZDC A;  2HHX A;  2PMZ F;  3H8M A;  2H3F A;  4DFM A;  5AI5 A;  3NVY A;  3WK8 A;  4CF4 A;  5J0W A;  3F2C A;  4CE6 A;  5DG7 A;  4MEY A;  3O0F A;  4BWJ A;  3PSP A;  1C7Y A;  3B9J A;  5IIK A;  9ICV A;  4PPX A;  2HBJ A;  2WF5 A;  4Y2T A;  4R8U A;  5G5H A;  3SR6 A;  2W03 A;  2QB1 A;  4YFK A;  3LWL A;  4GLX A;  2JEI A;  4QIW C;  2WF6 A;  3GZF A;  3PX4 A;  3M9O B;  2ZJA A;  4MHV A;  4ZH4 A;  2W11 A;  3ETL A;  1BGX T;  2Y1J A;  1NK0 A;  1UHU A;  5KFQ A;  1XWL A;  3JPO A;  1O08 A;  4UAS A;  3Q8Q B;  7ICH A;  5DB6 A;  1ZRM A;  2YML A;  3JPT A;  1YZ6 A;  5KFI A;  3PW0 A;  2OXO A;  4OJO A;  2A19 A;  5KG4 A;  5J2E A;  2WF7 A;  4NM2 A;  4EBC A;  1H38 A;  2F1H A;  2ESE A;  1TK0 A;  2FMS A;  2ASL A;  5KFA A;  5AKY A;  4QZ8 A;  4DSE A;  5IIO A;  5KNI A;  1CRX A;  4EX6 A;  3IG8 A;  4R8U B;  2G09 A;  1NNL A;  4P4M A;  1BPX A;  3OTQ A;  4DSJ A;  2ZJ8 A;  1BVS A;  3ICX A;  3Q8S B;  1MQ2 A;  1S77 D;  1WCN A;  5KL1 B;  1ARO P;  2XY6 A;  1SXE A;  2FPL A;  4F4Y A;  2ODG A;  5ALN A;  3N7R C;  8ICP A;  3RR7 A;  4QWA A;  1X42 A;  1ZQ1 C;  9ICN A;  1FO4 A;  5ALE A;  2LYH A;  1PVP A;  2CPR A;  1KKX A;  4GC6 A;  1S10 A;  2KOB A;  4C8M A;  1SGG A;  5ALF A;  1BNP A;  5HR7 A;  1ZQL A;  5DB8 A;  5KFX A;  3TAQ A;  5ALP A;  3QU4 A;  4RU9 A;  2ZIV A;  2EH9 A;  2FJ6 A;  4FZN A;  4UAT A;  3R9K A;  4M6W A;  4KLH A;  7ICO A;  4Q44 A;  1M6Y A;  1ZQZ A;  1RDF A;  5J2G A;  2AQ0 A;  4O5K A;  2VAN A;  2FLL A;  3UMG A;  3EUB 2;  5AIA A;  2FMP A;  2W9C A;  2P6R A;  5ALI A;  3K4G A;  1T3Q A;  2EAP A;  3AU2 A;  4I2C A;  1D9D A;  2KMD A;  5J0P A;  5KFC A;  5CA7 A;  1UA0 A;  2P6U A;  2C2D A;  1MA7 A;  3KZI U;  3PO4 A;  3TAR A;  2R18 A;  5J2I A;  3QEA Z;  3ISD A;  5TIS U;  2F76 X;  5AKK A;  4P4O A;  5DBC A;  2H5X A;  1TAQ A;  3E58 A;  2AU0 A;  4EEL A;  4O3P A;  4JV1 A;  3JPN A;  4JWM A;  9ICF A;  1X9S A;  1P7D A;  4B9V A;  4DOA A;  2UVU A;  8ICG A;  3RR8 A;  2HDO A;  1CUK A;  2F77 X;  4F71 A;  4M6W B;  4ECY A;  2ISP A;  5AKE A;  3BZC A;  2JHD A;  1KEJ A;  3Q8L A;  4ELV A;  3D2S A;  3J81 j;  1N5X A;  1DRG A;  4DL2 A;  2R8G A;  4IC9 A;  2E5S A;  5KAI U;  4BUG A;  4I2A A;  5DKW A;  3PR4 A;  2W9C B;  1Q8K A;  1JAL A;  4C8N A;  2GOL A;  3F2B A;  4B9S A;  4YP3 A;  2GLE A;  4IL6 U;  4DO9 A;  2P35 A;  5L1J A;  1LKY A;  2NRW A;  2ZTE A;  4RQM A;  2XVT A;  1QQ7 A;  1XO0 A;  3SV3 A;  3UXP A;  4F93 B;  4DQI A;  3OGU A;  1ZQD A;  1RQN A;  5ALK A;  3TAN A;  3RJJ A;  4QW9 A;  2F2A B;  3QU7 A;  4G3I A;  4O0I A;  2WAQ F;  5JUM A;  2ASJ A;  3EWA A;  4OJP A;  1IV8 A;  3GIJ A;  3QEB Z;  2G07 A;  1C20 A;  2W7O A;  5ALS A;  3ZDB A;  4MFF A;  3MFI A;  3H40 A;  8ICJ A;  4PH5 A;  2G0A A;  5AI4 A;  2HSZ A;  4QZE A;  1NK7 A;  2HOI A;  3K1R B;  3QXG A;  5L9X A;  5TZV A;  1JX4 A;  5KFE A;  2AJQ A;  4DL5 A;  1TK5 A;  8ICO A;  5AI6 A;  5ALX A;  4J9M A;  1YT3 A;  4RQ7 A;  2W7P A;  1B0X A;  3MR5 A;  1SWV A;  2FLP A;  1LKY B;  3M6K A;  5KFO A;  2BQU A;  4XUS A;  4I2H A;  4ECR A;  4YXJ A;  3KFU F;  3LVV A;  3OPX A;  4DS5 A;  2IHN A;  2OWO A;  4QNL A;  5CWR A;  1NZB A;  4JV2 A;  5AM5 A;  5KG1 A;  2OYY A;  3ZDA A;  1JIH A;  1A76 A;  2NRX A;  4DFJ A;  4Q43 A;  3CP8 A;  1QSS A;  4C80 A;  2Y9U A;  4UAW A;  3GDX A;  2FMQ A;  1ZD3 A;  4CRX A;  5KT5 A;  1KL9 A;  2RP5 A;  3HRD D;  8ICH A;  1ZQX A;  2H3I A;  2KZ3 A;  2L5Y A;  3GIM A;  4O3Q A;  3RJK A;  1XSL A;  3N7S C;  2EAO A;  4J9O A;  2QLT A;  3TAD C;  4YQW A;  3UQ2 A;  3S6J A;  7ICS A;  4ED7 A;  4DFD A;  2KEY A;  4DF4 A;  5KFV A;  4QWE A;  5KFK A;  1SZH A;  1B43 A;  4GXK A;  4DLE A;  4NLB A;  3MC1 A;  3K1Z A;  2ES6 A;  2BCS A;  4DQP A;  5J0O A;  2OCE A;  2D6F C;  3RH4 A;  5KFF A;  2DKX A;  2QKQ A;  4C7Z A;  4NWI A;  2AGP A;  2BCR A;  3ED5 A;  2DL0 A;  8ICZ A;  1WWV A;  5EE3 A;  4F5R A;  3QE9 Y;  1SB3 C;  1J2N A;  2XGQ A;  3L3F X;  4RQ4 A;  3LDA A;  2ISO A;  4O3S A;  3MDC A;  5AIC A;  2YX8 A;  9ICO A;  5KT3 A;  1RG6 A;  2XGP A;  2WHE A;  1OUQ A;  3AEV A;  3QUT A;  4KLO A;  3NVV A;  5BPC A;  2YY6 A;  3GFK B;  3F5A A;  2E1F A;  2OEH A;  3H8W A;  2JV3 A;  3HT3 A;  4GIB A;  2Y1I A;  5KG7 A;  5III A;  3ALR A;  2LI6 A;  1XNS A;  8ICN A;  5DB9 A;  2HOF A;  2ALZ A;  1BPE A;  1WYG A;  3ZDD A;  3M9M B;  3IDW A;  5EOZ A;  1D8B A;  2HOQ A;  5AM1 A;  4YXM A;  1F44 A;  4F91 B;  1TK8 A;  1RZT A;  4FS2 A;  5GTI U;  3TAP A;  2WAQ C;  1ZQA A;  3OJS A;  4KX5 A;  4NLN A;  4YN4 A;  2BDU A;  4ED3 A;  3V7J A;  5J0Y A;  4KLD A;  2XY5 A;  2ZTD A;  2GH1 A;  2ZTC A;  2AH5 A;  1TV9 A;  4I2G A;  4GXI A;  4KMO B;  2JMG A;  3AQF A;  4IQV A;  3HKZ F;  2KE7 A;  4B9M A;  4MEX A;  5HP4 A;  1S8O A;  4DOB A;  2KIV A;  3MR3 A;  2PFQ A;  2ZIW A;  8ICB A;  1TE2 A;  3RB4 A;  1FFV A;  1X9M A;  2KKP A;  2HVI A;  1OW5 A;  4I27 A;  5L1K A;  1ZQC A;  4O3R A;  4RPX A;  4NJ8 A;  4Y2X A;  5DLF A;  1KFT A;  3T5L A;  4Z6E A;  5J2H A;  4RNO A;  2E8M A;  2DBY A;  2B21 A;  3FDS A;  2PFP A;  4DSK A;  4R64 A;  4DWI A;  5CP2 A;  3RJG A;  5KFN A;  5EE1 A;  2NRV A;  1ZQI A;  4KN4 A;  1SL2 A;  3PVX A;  2KJ5 A;  3I28 A;  1ZQV A;  5DG9 A;  2OH2 A;  4C8K A;  8ICS A;  8ICY A;  1Q3U A;  3C5F A;  2ZIW B;  5AK5 A;  2KZM A;  3SD7 A;  2W55 A;  2PFN A;  1S0M A;  4M9N A;  4ICA A;  4EZ9 A;  3D6J A;  4YD1 A;  4EYI B;  7ICN A;  3M7D A;  5ALQ A;  2QAR A;  4Q8F A;  5KFR A;  5KFM A;  4EYH B;  3BDP A;  5J0Q A;  4GFJ A;  1QQ6 A;  4HYK A;  5D46 A;  1PZN A;  4R63 A;  4RUA A;  1XSP A;  3RF9 A;  2XY7 A;  2N1R A;  2FPM A;  1KBU A;  4FZL A;  3PSF A;  3TFR A;  1FFU A;  4YD2 A;  1COO A;  2JH1 A;  2LBO A;  2HMX A;  4YR3 A;  3IHQ B;  5J2D A;  4IRK A;  4KLF A;  3GV7 B;  4J9Q A;  1Q3V A;  3RFA A;  2XC9 A;  2BR0 A;  5AM4 A;  1SL1 A;  5AM0 A;  2LM1 A;  3SI8 A;  1Z19 A;  5G5G A;  5DQI A;  4F50 A;  2A3V A;  3RRH A;  7ICR A;  1Z00 A;  1NKB A;  1WWU A;  5KG2 A;  4IS7 A;  1V85 A;  4UB5 A;  4AYB F;  4O5C A;  4ELT A;  4ELU A;  1IM4 A;  3KHG A;  2CRX A;  2XO7 A;  3T5H A;  1U45 A;  1ZQQ A;  4F4K A;  4C7Y A;  2V9W A;  2QAR B;  1HJP A;  2E8O A;  2Q4T A;  8ICK A;  5HHH A;  3BS7 A;  2EDU A;  5D4B A;  1D8Y A;  2G08 A;  2O6K A;  2KZZ A;  1ZQF A;  4YMO A;  4F5N A;  2KNJ A;  2KP7 A;  3ZD8 A;  3PW4 A;  1QTM A;  4NLG A;  1QSY A;  1BPY A;  3KHH A;  3WKD A;  4J9P A;  1ZQY A;  3WK7 A;  3M8S A;  1NKC A;  3VC8 A;  3E2E A;  4RQ2 A;  2BQR A;  1JRP A;  3GIL A;  2NYV A;  3KBB A;  4ACO A;  3ZDE A;  4M9J A;  3KKA C;  4KLI A;  5DDM A;  1S76 D;  4TUQ A;  9ICX A;  2R8I A;  1Z00 B;  3F2D A;  4QZG A;  3EPG A;  3TI0 A;  1JMS A;  2JH7 A;  3H0R B;  4I2J A;  2F3N A;  1X6J A;  2C2E A;  3Q8M A;  4ECQ A;  1ZQU A;  1FIQ A;  5ALG A;  2BPG A;  2VKQ A;  2BDP A;  4I2D A;  3G6X A;  1ZQG A;  2WFA A;  2DFL A;  4RNN A;  3MFH A;  3PX0 A;  4X5V A;  2IOF K;  4UB8 U;  8ICF A;  2KJ8 A;  3H0M B;  2EAM A;  4QZ9 A;  1NK4 A;  1L3S A;  2Z7J A;  2W9B B;  1A77 A;  4QZB A;  3ONN A;  4CDG A;  2V4R A;  5D49 A;  9ICI A;  2R8J A;  2MRL A;  5ALH A;  3BQ0 A;  1N62 A;  3RBE A;  4A8E A;  5EWF A;  2LKY A;  2W3R A;  4C8L A;  2BCV A;  2AGQ A;  2DUY A;  3PNC A;  1COK A;  2E3T A;  1IG6 A;  3CRX A;  4B9U A;  3OSP A;  3RJI A;  4QW8 A;  9ICC A;  3C5G A;  4F5Q A;  5DLG A;  4QZI A;  3M1Y A;  5DBA A;  4IR9 A;  1O03 A;  3KOO A;  4PL1 A;  4YR0 A;  5DGA A;  4JV0 A;  1BPD A;  2PMZ C;  4Y2V A;  4C4T A;  3SAF A;  1JRO A;  2GWS A;  5HNK A;  4I2I A;  4B9T A;  4RT2 A;  1LVH A;  2WF8 A;  1L6N A;  3THV A;  4PHP A;  8ICA A;  3V6H A;  8ICW A;  4Z6C A;  3Q8R B;  4I2F A;  1DXS A;  9ICM A;  8ICE A;  1U48 A;  4PGQ A;  4RQN A;  1N56 A;  4UB1 A;  4QZF A;  5J2C A;  3NS1 A;  4YR2 A;  3PW7 A;  3D2N A;  5IIN A;  2YN4 A;  4B9L A;  3B0Y A;  3QZ8 A;  1RQL A;  3JPQ A;  2CXY A;  5KFW A;  1KN5 A;  2HVH A;  4O5E A;  4P2H A;  4UB4 A; 
#chains in the Genus database with same CATH homology
 4AYB C;  2LYB A;  2VKQ A;  2YB4 A;  2W7O A;  3VCB A;  1HIW A;  2HBL A;  2F8L A;  1Q3V A;  3RFA A;  2KVC A;  2ZIW A;  1A0P A;  2ZXH A;  3SAH A;  3H0L B;  4NWI A;  4CGZ A;  4C0Z A;  2OXO A;  4OJO A;  4P0P B;  2G0A A;  2ZIU B;  2ZG6 A;  3IP4 B;  2ZIV B;  2K89 A;  1Z19 A;  5T14 A;  4OJ5 A;  2HBM A;  2KJ8 A;  4P0Q B;  3CYM A;  2KKP A;  3H0M B;  2HOI A;  2Z7J A;  4BX9 C;  2KHV A;  5A0L A;  1MA7 A;  2A3V A;  3ONN A;  4CDG A;  3L3F X;  2R18 A;  2MRL A;  3SAG A;  3SMV A;  2M0N A;  2DGZ A;  2F76 X;  1URJ A;  2ZXI A;  2XIC A;  4A8E A;  3PZP A;  5CRX A;  2LKY A;  3C29 A;  4U6P A;  2DQN B;  2XID A;  2YX8 A;  4AYB F;  1UPH A;  4U7C A;  1PVR A;  2K8A A;  2WB1 C;  3E0F A;  3LVW A;  1CRX A;  1YT3 A;  3LYS A;  3NUQ A;  1OUQ A;  2DF4 B;  2RHF A;  2W7P A;  2LYA A;  2CRX A;  3CRX A;  2H3Z A;  2RRD A;  3IG8 A;  2G09 A;  3M6K A;  2G5H B;  4OJL A;  1P7D A;  3IN5 A;  3F5A A;  2ZIX B;  2E1F A;  2K8C B;  2W04 A;  3ICX A;  4O3M A;  4QJF B;  3KFU F;  2KIC A;  2H3Q A;  2F77 X;  2KJ9 A;  3DEE A;  2MA1 A;  3LVV A;  3PSI A;  2Q4T A;  4FZM A;  4PL1 A;  5KL1 B;  3F53 A;  4JMU A;  3ALR A;  4FE3 A;  2E1E A;  2K4E A;  2G08 A;  1XNS A;  3OPX A;  1T94 A;  4PL2 A;  2HOF A;  3SQI A;  4BJQ A;  3N7R C;  4QNL A;  2JHD A;  2PMZ C;  4NV0 A;  1NZB A;  2ZIU A;  4OO1 J;  2G5I B;  2PMZ F;  3SAF A;  2H3F A;  2KNJ A;  1WUD A;  3D2S A;  1ED1 A;  2Y0S C;  4P0Q A;  1D8B A;  2HOQ A;  3F2C A;  1ZQ1 C;  1DRG A;  2OYY A;  2KJ5 A;  4IC9 A;  2E5S A;  2WB1 F;  1F44 A;  2KHQ A;  2K4H A;  3AQE A;  2XI9 A;  3CP8 A;  4BUG A;  1TAM A;  2VJ4 A;  3MGV A;  1PVP A;  2CPR A;  2K8B B;  3O0F A;  3PSP A;  2KD1 A;  3PST A;  2OH2 A;  2KOB A;  4CRX A;  2GOL A;  1L6N A;  2RP5 A;  5C0Y A;  2WAQ C;  3VC8 A;  3F2B A;  1Q3U A;  2H3I A;  2ZIW B;  2K4I A;  3D2Q A;  1PVQ A;  5HR7 A;  4KX5 A;  2H3V A;  2HBJ A;  2YB1 A;  2OM6 A;  4NLC A;  1IIP A;  4ICA A;  4KX3 A;  4ACO A;  3N7S C;  2KIW A;  2XVT A;  2W03 A;  2JGA A;  3GU3 A;  2NV3 A;  2ZIX A;  3M7D A;  5KL8 B;  4P0P A;  3F5E A;  2ZIV A;  3M6Z A;  1XO0 A;  2BDU A;  3KZX A;  5HR6 A;  4FZN A;  2Y0S F;  4WJ3 B;  1A6S A;  2HBK A;  3AL0 B;  1Z1B A;  4GFJ A;  2GH1 A;  3IG5 A;  2KEY A;  3D2N A;  3F2D A;  2LHT A;  3T79 A;  4QIW C;  4KMO B;  2JMG A;  3GZF A;  4QIW F;  3RF9 A;  1SZH A;  1ECW A;  1GO3 F;  2F2A B;  2JH7 A;  2N1R A;  3H0R B;  2CN1 A;  2KKV A;  3NRW A;  2KV2 A;  3C28 A;  4NLB A;  3N7P D;  2WAQ F;  4FZL A;  3PSF A;  3K1Z A;  3HKZ C;  3AQF A;  3HKZ F;  2JH1 A;  2G06 A;  2VIX A;  2LBO A;  4OJP A;  1KBU A;  2HMX A;  1HEK A;  2D6F C;  2VJ5 A;  2G07 A;  4OJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...