2N1RA

Nmr structure of the myristylated feline immunodeficiency virus matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
GNGASRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the myristylated feline immunodeficiency virus matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
molecule tags Viral protein
molecule keywords Matrix protein p15
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2n1rA00
1TAMA 2H3ZA 1UPHA 1ECWA 2H3IA 4ICAA 4IC9A 2LYAA 2K4EA 2JMGA 2H3FA 2LYBA 2H3QA 2NV3A 4JMUA 2K4IA 1ED1A 1HEKA 1L6NA 2H3VA 2K4HA 2GOLA 1HIWA 1A6SA 2N1RA 2HMXA
chains in the Genus database with same CATH superfamily
4DL7A 1U49A 5KFIA 4XUSA 5ALIA 3IDWA 2KKVA 2DL0A 1JN3A 2RRDA 1X42A 3WU2U 4O5EA 1XO1A 5ALLA 4FZLA 4C4TA 5KFSA 4QZDA 8ICQA 3M7DA 1U48A 2KMDA 4JV2A 5AI6A 4RT2A 3JPNA 3RR7A 2ZXIA 2W55A 9ICNA 4Y2QA 1KN5A 4Y2TA 5G5HA 5HMMA 5KFFA 3BQ2A 5AKEA 1NK5A 4UB8U 5AKHA 1N63A 2AGPA 5HHHA 1DK2A 3TKAA 4QZCA 4G9BA 2WB1F 5L1JA 3RH6A 2EZXA 1SKRA 1LKYB 9ICAA 1ZQSA 3T5KA 1TAMA 1N60A 4TUQA 4F8RA 2YTUA 4QZBA 1ZQPA 4NLNA 3C5GA 5J8YC 4I2BA 4KLFA 2WAQC 2OM6A 4P0QA 2KIWA 2ZUBA 2XVTA 1TK8A 5IILA 4Z6FA 1KSPA 4C8OA 2I6XA 4DCCA 4M6WB 3H8MA 4CGZA 2PFNA 1NKBA 4OJPA 1Z4NA 4Y2VA 3C23A 3RJJA 5KFVA 1ZQTA 2JRZA 3ZDEA 3RJKA 2AHOB 1SV0C 1BVSA 4RPZA 1S8OA 5EE0A 3M8SA 3MC1A 3GZFA 8ICLA 9ICLA 1ZQBA 2NYVA 3UMCA 7ICSA 5ALDA 4DQSA 5AK6A 4PGYA 5IIOA 1KQQA 1DGSA 4QWAA 4KLJA 2BQUA 4B9MA 3IV6A 2MUTA 4NXZA 4DOCA 4Q43A 2HVHA 1AROP 4FBTA 3G6XA 1XS9D 1QQ6A 3MR3A 2F76X 4O3OA 4DL4A 2RLTA 5KL8B 4ECRA 1JIHA 1Z00B 4KLIA 1QSSA 2W3SA 2HOIA 5DLFA 1ZQZA 1XC9A 2G5IB 3SV4A 8ICGA 1FFUA 3LK9A 1UA0A 4RQMA 1BPYA 4KLEA 3L4PA 1XSNA 1UT5A 4RNMA 4QWDA 5J0SA 2I1QA 5EE1A 4BXOB 2XGPA 1TAQA 3SAFA 2ATLA 3HPOA 1K1QA 3GFKB 2KK0A 4KN4A 8ICHA 2QARB 2F1HA 3NGDA 2ASLA 1N56A 1V97A 1S97A 4OD0A 4O3QA 2LYHA 4F3OA 2FPKA 3SAHA 4MHVA 2JH7A 4MF2A 1KFTA 2WF7A 5KT3A 4F91B 5KFZA 1DOQA 2G08A 2V9WA 3ETLA 3QUTA 9ICRA 2W43A 4J9PA 4KLQA 3BZKA 7ICUA 3L5KA 3T5JA 3GV8B 3RTVA 5BOMA 4O9MA 3JPPA 2DPJA 3B9JA 1BPEA 1QLNA 2PFQA 1K5OA 1J2MA 3RRGA 2FE9A 3IN5A 1T3NA 5KFGA 4J9SA 1DXSA 1MQ2A 3LWLA 2OHFA 2W8KA 4JWMA 1YZ7A 2W9MA 4Q45A 2F44A 4EELA 5KFCA 4M9GA 1ZQYA 2KJ5A 1ZQJA 5J0UA 2BPGA 3PSIA 4C4RA 7ICRA 4FS1A 4DWIA 3UXPA 5KFRA 4RQ7A 3CNHA 4I27A 2R8JA 3L3FX 1ZQIA 1NJWA 5DB9A 3BQ0A 3SENA 4IQWA 1NK9A 3RJHA 1KDHA 3ISDA 4NM1A 2AGOA 4YQWA 3OJSA 4UAVA 3PR4A 2W9CB 2MUTB 4ZOHC 1KEJA 5DG8A 4PH5A 4QZEA 3RJIA 2C2DA 4I2JA 3HILA 4UB4A 1ZQGA 3PSPA 5AIBA 5J2CA 4R8UB 2C2EA 5AM4A 9ICHA 4DSJA 4EZ9A 1O08A 3PSFA 2YQEA 2VA2A 3LYSA 2CXYA 1N48A 1T3QA 3A0BU 4QZ9A 4DQRA 2F2AB 3NASA 4A8EA 3ED5A 1ZQAA 5CHGA 4ED2A 4DLGA 5HR6A 2ZTEA 4F2RA 5L1LA 3TQ1A 2UVVA 3HWTA 4M04A 4OO1J 2XCPA 4IL6U 3AMZA 1X9SA 1L7NA 5JU5A 4NLZA 1SWWA 2KP7A 2YMQA 3SAGA 2F1JA 5DB7A 3UPQA 4MFFA 2YMMA 2NRTA 1N62A 5DBBA 2HMXA 4YP3A 3V7JA 3SMVA 2BCUA 1BNOA 2KFZA 1SV4A 1KL9A 3E58A 5CR0A 7ICIA 1QQ7A 4TQRA 5DQGA 5AKKA 5AKIA 1M6YA 1N5XA 2ZIVB 2G5HB 5KG0A 2J6TA 1L6NA 4IS7A 2NRZA 1UCVA 1Q3UA 4P4OA 1ZRMA 3ONNA 3M8RA 4KMUA 2NRXA 2K4PA 5KG3A 5J2FA 1JALA 3MGIA 4PL2A 4QWEA 2YY6A 2KVSA 4Y2JA 5D49A 2KZ3A 4IQTA 4UAUA 5J0YA 5J0WA 3HP6A 2EAPA 3C5FA 3HX0A 2WTFA 2AJQA 2FPMA 4O3RA 1PVPA 1VJ5A 5HMLA 5KT4A 4TURA 5KFQA 1ZQQA 4F71A 5ALNA 4NY8A 3T3FA 2WF8A 3RB4A 2LPEA 1ZQFA 5TISU 2R8IA 5J2IA 1S0MA 3KHLA 4US9A 2KJ8A 4KLTA 4UAZA 1NJZA 4U6PA 4PHPA 1PZNA 3QEBZ 1OXJA 2F8LA 5JUMA 4DF8A 1H38A 2A19A 2HHVA 2GOLA 1SXDA 1S10A 5J0OA 2KICA 4DSKA 2HHXA 5KL1B 3Q8SB 2EZYA 2KZZA 4UQGA 2G0AA 4C7ZA 5ALEA 3CRXA 2YX8A 2BPFA 4GFJA 1RYRA 1QQ5A 3RJEA 5ALKA 5KFHA 2NRWA 1D8YA 1D8LA 1BPDA 4UW9A 2BQRA 2E8NA 3QUQA 3H8SA 3C2LA 3M9MB 4B9UA 4NV0A 3RB0A 5H2FU 1X9MA 1L8LA 2JEIA 3FAHA 1L7PA 4PGQA 4P0PB 3TFSA 1NNLA 9ICOA 1ZQHA 1WYGA 2RDJA 1BPBA 2L5YA 5AKZA 3DV9A 4O5KA 5AKGA 3MR6A 2K8CB 4BXOA 4ACOA 2Y1IA 1O03A 5AKJA 3SV3A 1RM6C 3O0FA 3RJGA 1U4BA 1HIWA 4CNQA 5J29A 2JHDA 9ICIA 4JWNA 3OPXA 3KBBA 3QU2A 2R18A 4EENA 3QU7A 3OSNA 4DFDA 2HHQA 5AICA 2CRXA 4ED1A 4KITB 2B6GA 3RB3A 2H3FA 2JZBA 3FC4A 2UVWA 1A76A 3RH5A 2H3VA 2VJ4A 4J9NA 1QH9A 4NJ8A 1X66A 3KHGA 4P4PA 2KZMA 3RAXA 1ZJNA 4NLGA 4DSFA 3PY8A 2IOFA 1B43A 3LDAA 2MAXA 4F2SA 4GC7A 2R8GA 1ZQNA 3PZPA 1N61A 3V7LA 3IP4B 1B4FA 4OJ5A 3PW2A 2XY6A 4RQ3A 1IV8A 5L1MA 4YMNA 5DKWA 4I2FA 2ZTCA 3THVA 3PVXA 2HBLA 3NRZA 3N97B 5KAIU 4YG2A 4PHDA 4MF8A 5KFJA 3NVWA 1AQ6A 2OH2A 3IG5A 2QLTA 2ZJAA 2EDUA 4C4SA 5J0PA 3MFIA 9ICUA 2YB4A 4QWCA 2FDRA 3PV8A 4DSEA 4Y2SA 3WK4A 1XSPA 3MFHA 2WF6A 4C8NA 1FIQA 1X9WA 5AHXA 4QWBA 4Q8FA 3D6JA 5ALYA 3DEEA 5AM1A 5J0RA 3PMLA 2YMLA 4OJOA 4R63A 3B0XA 2EQYA 3GIMA 3J81j 4ECWA 3Q8QB 4ELVA 5KFUA 4DF4A 3WKDA 3GIKA 4JK1A 1L7OA 4DOBA 2K8AA 2N1RA 5J0XA 4RU9A 1RZTA 8ICFA 3F2DA 5ALRA 1UPHA 2QB0A 5J0TA 3KD3A 8ICPA 4RQ4A 1JX4A 5J2HA 3KKAC 3EWAA 3TADA 2XY7A 1ZQ1C 2ZIXB 1KTQA 8ICVA 2MRLA 3PO5A 1F0MA 7ICQA 1ZD2P 2BGWA 4B9SA 4P4MA 3LVVA 5KT6A 2KNJA 3CP8A 8ICAA 3GIIA 2LM1A 4P0PA 4LZGA 4J9KA 3ZDBA 2RDIA 2BDPA 1RQNA 5BOLA 3JPRA 4DL6A 4EZ6A 3GILA 2Z7JA 1NK6A 3H0LB 3U26A 4UB2A 2CN1A 4ED6A 3K75D 4QNLA 4ZH4A 4USAA 8ICTA 2KSOB 2B0CA 4M9JA 4I2HA 5DB6A 4EEYA 2XIDA 3RB6A 5KFEA 4J9LA 2QARA 1BNPA 2H3QA 4BJQA 1T94A 5EE3A 2BPCA 1U9LA 4Y2PA 2Y1JA 2J6UA 1Y88A 3V72A 5AI0A 3R9KA 5KFOA 4MFAA 2DPIA 1D9DA 4ICAA 3E2EA 9ICCA 5ALMA 4RPYA 3ZI4A 4KMOB 8ICNA 2NO5A 5D46A 3PR5B 4M9HA 2DF4B 4JV1A 4KLDA 1JXEA 4MEXA 3PW4A 2ZIWB 4F50A 2IMWP 2PFOA 1ZQRA 5ALPA 2W54A 4J9OA 1NI3A 2JEGA 8ICMA 2HDOA 2K89A 5KT2A 1QCKA 5HR7A 1A6SA 4YR3A 4EBDA 2QKQA 4F5QA 4IRCA 2LMRA 1B0XA 1T7PA 1Z00A 2HOFA 3RR8A 2K4EA 1ZQWA 5JRTA 5J2KA 3PX0A 1ZQCA 3V6JA 2G06A 7ICTA 2DUYA 3UMGA 5AKYA 1FEZA 4NLBA 1TKDA 2W04A 3HKZC 3BQ1A 5CB1A 1BPZA 2OWOA 2KTQA 4DOAA 1QSYA 5AI8A 1MC8A 2J6SA 5DQIA 4QZGA 2ALZA 3SQIA 5KT7A 3MDCA 5KFNA 1WWVA 2W9CA 2C22A 8ICYA 4MFCA 3UQ2A 1F5SA 5CRXA 1IG6A 4EYIB 3T5LA 1L5UA 4BGDA 5DLGA 4NLKA 3UM9A 4NWIA 2D6FC 1S9FA 4Y2UA 3MGHA 3JPTA 1IM4A 4UATA 2I5HA 1A77A 1ZJMA 5IIMA 3TAQA 2ODGA 5F9LA 3B0YA 4DL5A 4EBEA 4QIWF 3E0FA 9ICTA 2ZIUA 1KFSA 2IBKA 2KOBA 5E79U 2WFAA 4UB5A 2OXOA 1UT8A 2ASDA 4GXJA 4IR9A 4M9NA 3BS7A 1ZXIA 3QZ7A 3G6VA 1Q3VA 1ZD5A 2VA3A 2ZIUB 2JR5A 4NLCA 2G09A 4DS4A 4Y2RA 2UVUA 4PGXA 3WK9A 4KX5A 4F72A 1L3TA 1F44A 2G07A 3K1ZA 3PX6A 4F93B 2HOQA 3WKAA 4R65A 2H3IA 2W9AA 3A0HU 3OJUA 3Q8KA 4DLEA 4YN4A 3M6KA 3QU9A 2P66A 2JH1A 4JMUA 1BPXA 4RUCA 3KFUF 4BUGA 2HBJA 5KFYA 4P0QB 2H3ZA 4M9LA 3HW8A 4IC9A 4YXMA 2XY5A 2BCQA 1CEZA 7ICHA 3QYPA 2HVIA 2A1JA 3BS5A 2HW3A 4EYHB 5ALSA 4ECYA 1HEKA 5EWFA 3MDAA 1RG6A 2A1JB 5AI4A 1CI4A 3D2NA 3C1YA 4C8MA 5BPCA 1NK7A 3H7IA 2AGQA 4UAWA 4RUAA 3UXNA 5J2BA 7ICKA 3QUBA 3NRWA 4OJLA 1KKXA 4KLHA 3HKZF 5ALVA 3AM9A 8ICSA 2DGZA 2H5XA 3CYMA 4UB3A 3OGUA 2BCRA 4P2HA 1JROA 4DL2A 5J2AA 3AQFA 4QIWC 1XU4A 1B22A 4M0AA 1X6IA 2E8PA 4M2YA 2MA1A 3F5EA 4UASA 4RZRA 3PW5A 4I29A 3D2QA 5TZVA 4I28A 2ZJ8A 3IG8A 2E8OA 4PJ0U 2BCVA 9ICKA 4ECTA 5CWRA 9ICEA 1YT3A 3NS1A 1NK8A 1T4GA 1X40A 5KFDA 5ALXA 3K4GA 1HUZA 4F92B 1SKSA 3IM1A 2AQ4A 4IRDA 1JI7A 3GV7B 1ZQUA 2AH5A 3M1YA 4F4WA 5KFBA 2A3VA 1IXRA 1XO0A 3PNCA 5DQHA 2M9NA 4F5OA 2M0NA 3WK5A 3DDHA 5DGBA 5J2JA 3PW0A 4NL9A 5T14A 4I2EA 5A0LA 4Z6DA 3M9OB 4FFDA 1S5LU 5IINA 3RFAA 5DBAA 4OJ6A 4B9LA 1RXVA 1BGXT 3OHAA 4CDGA 1WUDA 4GXIA 5J2GA 1Z1BA 2JV3A 3KZXA 2E3TA 1NZBA 3F2BA 3RH4A 3M9NB 3SI8A 3QUCA 1L3VA 5CA7A 5F3XB 3C28A 3EUB2 2PXIA 5EE9A 5ALWA 3ISBA 2HHWA 5J0QA 2OEHA 3WKEA 4HAIA 5ALZA 4QZIA 4PL1A 8ICOA 2VKQA 4FZMA 4QZAA 3WK7A 2O6KA 4I2CA 2Y9UA 3Q8MA 4QZFA 3V6HA 9ICGA 4UARA 4NL9C 3OSPA 4LZDA 5GTHU 3SR6A 1P7DA 4KX3A 2P35A 5DB8A 2PI4A 2PMZF 1CUKA 2XGQA 4UAYA 9ICJA 5CJ7A 3ORYA 4RQ0A 4X5VA 4YD2A 1SB3C 3PX4A 4KLLA 3C1ZA 3VC8A 4KLGA 2HHSA 4K4GA 4YD1A 4O3MA 5EOZA 3FDSA 3N7RC 2EZZA 7ICNA 3NVYA 4ECZA 1KBUA 4YXJA 4ELUA 8ICBA 3RBEA 1NZPA 3SZ2A 4QZHA 3GQCA 4B9TA 4UB6U 2W3RA 3ZDCA 5FP0A 2R8KA 4O5CA 1OW5A 3SEIA 2R8HA 5ALHA 3N4MB 9ICBA 1ZD3A 5JTIA 4ED8A 4R66A 1NK4A 4R64A 4DSLA 3TACB 4XRHA 4M6WA 2WF5A 4MEYA 2LKYA 4GC6A 1EXNA 3TARA 2NRVA 2E5SA 2KSOA 3MBYA 2RQ5A 4TQSA 5AM2A 4GIBA 4Q44A 3OHBA 4RPXA 4UBBA 3JPOA 2V4QA 2W9BB 1S0VA 4C80A 8ICCA 1RPLA 3WKBA 4US8A 2W9BA 4DSIA 4O3NA 4O0IA 7ICJA 1S77D 4F5PA 8ICKA 2EAMA 4DQQA 2BQ3A 2PI5A 2GH1A 2KHQA 2EAOA 5KFKA 3RBDA 3PO4A 7ICVA 5ALQA 2NO4A 1LKYA 9ICXA 1LVHA 5F9NA 4IQUA 5L1KA 2FLLA 4FO6A 1N2XA 1WWUA 1S76D 1PK3A 3RJFA 2F1IA 3ICXA 2LYAA 4J9QA 3GU3A 2IHMA 3TI0A 4EBCA 3Q8PB 4LVSA 1WCNA 1LV5A 1SZPA 5DBCA 5DG7A 7ICMA 4TUPA 4KLMA 4ECSA 2ZUDA 5J2EA 3ZDDA 3AEVA 1U45A 1FFVA 1X6JA 2Y0SC 3OTQA 4DO9A 3QE9Y 4F4XA 8ICZA 2QB0B 2JMGA 2LYBA 3MABA 4C7YA 3QZ8A 1V85A 5IIIA 8ICIA 3MR2A 1SL0A 1UHUA 1XSLA 1SWVA 3HT3A 1KFDA 3RRHA 2ZIWA 4KN7A 1SL2A 2DFLA 2FLPA 3ETRA 5AK3A 3N7PD 4PHAA 5ALFA 3BDPA 1SL1A 2W03A 4BDPA 2ISPA 5DG9A 1DRGA 2FPLA 4KLUA 4C0ZA 3QXGA 3LVWA 1SGGA 2AXTU 4UB1A 3ALRA 4B9VA 4EX7A 1MSWD 3S6JA 4FE3A 2QB1A 3NUQA 1SZHA 2Y0SF 4HYKA 4BWJA 4DFPA 1MN8A 1ZOLA 2IA6A 3QNMA 3GIJA 2W11A 3EW9A 3MR5A 2ZUCA 2C2RA 2DQNB 5DGAA 1S0OA 2CPRA 1FO4A 5ALJA 2K4HA 4KLOA 5HNKA 5J8YA 3UXOA 2F77X 1J2NA 1IIPA 2KEYA 3I76A 1ZQMA 4JB3A 4DQIA 4FBUA 3IRUA 4YFKA 4E0DA 1L7MA 1Q8KA 1X2IA 1ZQXA 4RNNA 1SV0A 4FS2A 5C0YA 3KHHA 4ECVA 2BZFA 2Y9TA 4IQVA 2VJ5A 3H8WA 1XNSA 7ICLA 1URJA 5L1IA 5KTQA 3AUOA 2VA8A 2Q0ZX 5KG7A 4YCXA 2JEFA 5C5JA 3BS5B 4CCHA 2FJ6A 4QZ8A 3PSTA 3M6ZA 5AK5A 3NVZA 2ZJ5A 5B66U 3F5AA 4DS5A 1NK0A 4B9NA 1MQ3A 1TVAA 2D8CA 1ZRNA 3C2KA 4CF5A 4RQNA 1TK5A 7ICEA 5DDYA 1MA7A 1YZ6A 2B21A 1NKCA 1QTMA 4Z6EA 5G5GA 1T8EA 2FMPA 3MGVA 3ZD8A 1RYSA 2DKXA 2ISOA 1ZQDA 1C20A 4TUSA 1LB2B 3UMBA 4DEZA 2UVRA 5GTIU 4ECXA 3V7KA 3SD7A 3WK6A 4G3IA 2WB1C 1UQVA 3PW7A 2ASJA 5KAFU 1JMSA 3IHQB 1A0PA 8ICRA 4ELTA 1ZQLA 3KHRA 2F3NA 4U7CA 4F4KA 3AQEA 5AK4A 1U47A 7ICPA 2KHVA 3H4BA 1PVQA 4ECUA 2BR0A 2FMQA 4DQPA 4IR1A 4KTQA 2E1FA 1SKWA 1RYUA 3TAPA 3BJYA 2KN7A 1PK1B 4I2AA 3I28A 5AIAA 4RQ5A 3TANA 4Q8EA 4JUZA 1HJPA 5KG4A 1C7YA 1QSLA 2RHFA 3UQ0A 3EZ5A 2IOFK 2OYYA 4DFJA 2BDUA 2JEJA 2FMSA 3Q8RB 2JXJA 3LWMA 3AL0B 4M47A 1JUDA 1UA1A 5AM0A 5IIKA 4C8KA 1L3UA 5KG2A 2WF9A 3SYZA 3EPIA 3BQ7A 4Y2YA 2HHUA 4NM2A 1NOMA 1TFRA 2VANA 3AN1A 1TE2A 4KLSA 2HBKA 5D4BA 3EPGA 1WG8A 5KG1A 1N5WA 3KOOA 8ICUA 2HI0A 2GO7A 3C29A 2HSZA 1RDFA 2YN4A 1L8OA 5DDMA 1ZYQA 9ICSA 2AQ0A 4BX9C 4RQ6A 9ICQA 1KW4A 5AM5A 2PMZC 1ECWA 1ZQVA 4YMOA 4F4ZA 2PKEA 2P6RA 2EH9A 5ALUA 4PZNA 4QW9A 9ICVA 8ICXA 5KFLA 4CF3A 1D8BA 3ZD9A 5AI9A 1ZD4A 9ICMA 2HBMA 4WJ3B 2KKPA 9ICWA 5CP2A 1PVRA 5EWGA 4O3PA 4FZNA 4ED7A 2W7OA 3Q8LA 3TADC 3ZDAA 2D3DA 1X9XA 5HP4A 1VLBA 3AU2A 1RXWA 2FI1A 4J9RA 2MU2A 3H4DA 2ZTDA 4Z6CA 1PUZA 3N7SC 4F5RA 2Q4TA 3C2MA 3F2CA 2YMPA 3KZIU 4I2GA 4O3SA 2AU0A 2ZG6A 3NVVA 4F5NA 5AI5A 4ED3A 3RF9A 2DWQA 1ZQEA 7ICOA 5ALTA 2F8KA 3QEAZ 2C28A 3FM9A 4I2IA 4AYBC 2I9GA 4DL3A 5ALOA 2NV3A 1TV9A 5EWEA 4EEKA 2ZXHA 2FLNA 5AKLA 1JXLA 2KG5A 1NKEA 1V9PA 2WHEA 3T79A 4DFMA 3F53A 2V4RA 1KRPA 1VDVA 2W7PA 1NJYA 3WK8A 1ED1A 2GLEA 3WKCA 4J9MA 2KFNA 2KVCA 1OUQA 4K4HA 1GO3F 1RQLA 2MSNA 3GDXA 3H40A 2KE7A 4ECQA 3AU6A 2RP5A 1Z1VA 4IRKA 2ZIXA 4PZOA 4I2DA 5B5EU 2XI9A 1Z19A 4R8UA 4CF4A 2ZIVA 1DGJA 2BCSA 3QU5A 1TAUA 4QJFB 3CW2C 2XCAA 1S0NA 2IHNA 4QW8A 3KTQA 4RNOA 3ISCA 2K60A 2YB1A 1KLNA 3JPSA 4RQ2A 9ICFA 2W8LA 5AM3A 2PFPA 3FYHA 5L9XA 2WAQF 3VCBA 4CRXA 1L3SA 5KFXA 3V6KA 1CRXA 5KNIA 1WCLA 4LJXA 3BQTA 3T5HA 4J03A 5ALGA 4RQ1A 1ZETA 2K4IA 5KFMA 9ICPA 5KT5A 2P6UA 4AYBF 2LBOA 2XO7A 3PMNA 4UBCA 5KFTA 7ICGA 3I1YA 2OCEA 2KD1A 2JZBB 1SIJA 1V38A 4JV0A 3H0RB 3C21A 3EYZA 1PK1A 8ICJA 2A1AA 1TK0A 3H0MB 1J97A 3H8JA 4PPXA 3K1RB 2DBYA 8ICEA 2BKEA 4YMMA 3JPQA 5KG6A 3D2SA 3QX7A 5KFPA 2KIVA 1ZQOA 4BWMA 1XWLA 1DK3A 2XC9A 2IOHA 2EANA 2ES6A 4OCZA 4AP9A 3TFRA 2HCFA 3NTUA 5K4LA 3QU4A 2DKZA 2E1EA 3BZCA 2HHTA 2KJ9A 4EX6A 1Q46A 2E8MA 7ICFA 1NJXA 3GV5B 4YR0A 4C8LA 1JRPA 2LHTA 2VIXA 3HRDD 4YR2A 1SXEA 2ESEA 2JGAA 4RQ8A 2LI6A 1ZQKA 2LM4A 4YVZA 1Z3EB 5AKXA 1HUOA 4RT3A 5HHIA 2XICA 3G6YA 4XA5A 3N28A 4F4YA 5KG5A 5KFWA 4K4IA 2KV2A 2K8BB 4CE6A 4DFKA 1D9FA 3HJEA 8ICWA 1COOA 5KFAA 1K1SA 5CEHA 3KKAA 4PHEA 4B6JA 2BHNA 5J2DA 4GLXA 4ED0A 1Z4OA 3RAQA 4Y2XA 5IIJA 4XQ8A 4GXKA 2GWSA 1COKA
chains in the Genus database with same CATH topology
3C28A 2KJ5A 4P0PB 3DEEA 3SMVA 3F5AA 3N7PD 2W03A 4OJOA 4ICAA 3PSIA 3T79A 1DRGA 2KD1A 2HBKA 3NRWA 4OJLA 2KKVA 3F53A 4C0ZA 3H0RB 3HKZF 1Q3UA 2K8CB 2F76X 2W7PA 2RRDA 4ACOA 1MA7A 2DGZA 3CYMA 4KMOB 4QIWF 3E0FA 1ED1A 3C29A 2ZIUA 2ZIVB 3LVWA 2G5HB 4FZLA 3ALRA 1L6NA 3H0MB 2KOBA 3AQFA 3O0FA 2DF4B 2KVCA 1HIWA 4FE3A 5KL8B 3NUQA 2JHDA 2K8AA 2VKQA 1SZHA 3ONNA 4FZMA 2N1RA 3M7DA 4PL1A 3MGVA 1OUQA 3OPXA 2Y0SF 4BX9C 3L3FX 2R18A 2OXOA 3F2DA 2ZXIA 2PMZC 2ZIWB 1UPHA 1ECWA 1GO3F 2MA1A 3F5EA 3D2SA 4PL2A 2HOIA 2GH1A 2KHQA 1P7DA 2G5IB 2CRXA 3D2QA 4KX3A 1D8BA 2RP5A 2PMZF 1Q3VA 2DQNB 3IG8A 2ZIXA 2H3FA 2ZIUB 2K89A 4NLCA 2WB1C 2G09A 1ZQ1C 2XI9A 2ZIXB 2HBMA 4WJ3B 2WB1F 2KKPA 2CPRA 1YT3A 1Z19A 2MRLA 1PVRA 1A0PA 2H3VA 2K4HA 2E1EA 4FZNA 2VJ4A 1PVPA 5HR7A 2KJ9A 2ZIVA 1A6SA 3VC8A 2W7OA 3SAFA 4U7CA 3AQEA 3LVVA 4KX5A 1F44A 2G07A 2KHVA 2KNJA 3K1ZA 1TAMA 2F77X 2KEYA 1IIPA 3CP8A 4QJFB 1PVQA 2HOQA 4O3MA 3N7RC 2H3IA 2HOFA 3PSPA 3ICXA 1KBUA 2LYAA 3PZPA 2E1FA 2LHTA 2WAQC 2K4EA 2OM6A 4P0QA 2KIWA 3IP4B 2KJ8A 2XVTA 2VIXA 3GU3A 3M6KA 3SAHA 4U6PA 3N7SC 2JH7A 2YB1A 4OJ5A 2Q4TA 5T14A 2A3VA 2G06A 2JH1A 3PSFA 1XO0A 3LYSA 4JMUA 4NLBA 3F2CA 2F8LA 2W04A 2JGAA 4CGZA 3HKZC 2F2AB 4P0PA 3KFUF 4A8EA 4BUGA 4OJPA 2GOLA 2M0NA 2Z7JA 2KICA 2RHFA 2ZG6A 2G08A 2HBJA 3H0LB 5C0YA 5HR6A 2CN1A 4P0QB 5KL1B 3RF9A 4QNLA 2OYYA 2H3ZA 2BDUA 2G0AA 2WAQF 4QIWC 2HBLA 2Y0SC 2XICA 2YX8A 3VCBA 5A0LA 4GFJA 3CRXA 4CRXA 3SQIA 1CRXA 4IC9A 3AL0B 3RFAA 2VJ5A 4OJ6A 4AYBC 4OO1J 2KV2A 2OH2A 1XNSA 2K8BB 2JMGA 3GZFA 3IG5A 4CDGA 2XIDA 1WUDA 5CRXA 1URJA 2LYBA 2YB4A 2H3QA 2NV3A 1T94A 2K4IA 4BJQA 3IN5A 1Z1BA 2LKYA 3SAGA 1HEKA 4NV0A 4NWIA 3KZXA 1NZBA 2D6FC 2E5SA 2ZXHA 3F2BA 3D2NA 3PSTA 3M6ZA 4AYBF 2ZIWA 2LBOA 2HMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAM A;  2H3Z A;  1UPH A;  1ECW A;  2H3I A;  4ICA A;  4IC9 A;  2LYA A;  2K4E A;  2JMG A;  2H3F A;  2LYB A;  2H3Q A;  2NV3 A;  4JMU A;  2K4I A;  1ED1 A;  1HEK A;  1L6N A;  2H3V A;  2K4H A;  2GOL A;  1HIW A;  1A6S A;  2N1R A;  2HMX A; 
#chains in the Genus database with same CATH topology
 4DL7 A;  1U49 A;  5KFI A;  4XUS A;  5ALI A;  3IDW A;  2KKV A;  2DL0 A;  1JN3 A;  2RRD A;  1X42 A;  3WU2 U;  4O5E A;  1XO1 A;  5ALL A;  4FZL A;  4C4T A;  5KFS A;  4QZD A;  8ICQ A;  3M7D A;  1U48 A;  2KMD A;  4JV2 A;  5AI6 A;  4RT2 A;  3JPN A;  3RR7 A;  2ZXI A;  2W55 A;  9ICN A;  4Y2Q A;  1KN5 A;  4Y2T A;  5G5H A;  5HMM A;  5KFF A;  3BQ2 A;  5AKE A;  1NK5 A;  4UB8 U;  5AKH A;  1N63 A;  2AGP A;  5HHH A;  1DK2 A;  3TKA A;  4QZC A;  4G9B A;  2WB1 F;  5L1J A;  3RH6 A;  2EZX A;  1SKR A;  1LKY B;  9ICA A;  1ZQS A;  3T5K A;  1TAM A;  1N60 A;  4TUQ A;  4F8R A;  2YTU A;  4QZB A;  1ZQP A;  4NLN A;  3C5G A;  5J8Y C;  4I2B A;  4KLF A;  2WAQ C;  2OM6 A;  4P0Q A;  2KIW A;  2ZUB A;  2XVT A;  1TK8 A;  5IIL A;  4Z6F A;  1KSP A;  4C8O A;  2I6X A;  4DCC A;  4M6W B;  3H8M A;  4CGZ A;  2PFN A;  1NKB A;  4OJP A;  1Z4N A;  4Y2V A;  3C23 A;  3RJJ A;  5KFV A;  1ZQT A;  2JRZ A;  3ZDE A;  3RJK A;  2AHO B;  1SV0 C;  1BVS A;  4RPZ A;  1S8O A;  5EE0 A;  3M8S A;  3MC1 A;  3GZF A;  8ICL A;  9ICL A;  1ZQB A;  2NYV A;  3UMC A;  7ICS A;  5ALD A;  4DQS A;  5AK6 A;  4PGY A;  5IIO A;  1KQQ A;  1DGS A;  4QWA A;  4KLJ A;  2BQU A;  4B9M A;  3IV6 A;  2MUT A;  4NXZ A;  4DOC A;  4Q43 A;  2HVH A;  1ARO P;  4FBT A;  3G6X A;  1XS9 D;  1QQ6 A;  3MR3 A;  2F76 X;  4O3O A;  4DL4 A;  2RLT A;  5KL8 B;  4ECR A;  1JIH A;  1Z00 B;  4KLI A;  1QSS A;  2W3S A;  2HOI A;  5DLF A;  1ZQZ A;  1XC9 A;  2G5I B;  3SV4 A;  8ICG A;  1FFU A;  3LK9 A;  1UA0 A;  4RQM A;  1BPY A;  4KLE A;  3L4P A;  1XSN A;  1UT5 A;  4RNM A;  4QWD A;  5J0S A;  2I1Q A;  5EE1 A;  4BXO B;  2XGP A;  1TAQ A;  3SAF A;  2ATL A;  3HPO A;  1K1Q A;  3GFK B;  2KK0 A;  4KN4 A;  8ICH A;  2QAR B;  2F1H A;  3NGD A;  2ASL A;  1N56 A;  1V97 A;  1S97 A;  4OD0 A;  4O3Q A;  2LYH A;  4F3O A;  2FPK A;  3SAH A;  4MHV A;  2JH7 A;  4MF2 A;  1KFT A;  2WF7 A;  5KT3 A;  4F91 B;  5KFZ A;  1DOQ A;  2G08 A;  2V9W A;  3ETL A;  3QUT A;  9ICR A;  2W43 A;  4J9P A;  4KLQ A;  3BZK A;  7ICU A;  3L5K A;  3T5J A;  3GV8 B;  3RTV A;  5BOM A;  4O9M A;  3JPP A;  2DPJ A;  3B9J A;  1BPE A;  1QLN A;  2PFQ A;  1K5O A;  1J2M A;  3RRG A;  2FE9 A;  3IN5 A;  1T3N A;  5KFG A;  4J9S A;  1DXS A;  1MQ2 A;  3LWL A;  2OHF A;  2W8K A;  4JWM A;  1YZ7 A;  2W9M A;  4Q45 A;  2F44 A;  4EEL A;  5KFC A;  4M9G A;  1ZQY A;  2KJ5 A;  1ZQJ A;  5J0U A;  2BPG A;  3PSI A;  4C4R A;  7ICR A;  4FS1 A;  4DWI A;  3UXP A;  5KFR A;  4RQ7 A;  3CNH A;  4I27 A;  2R8J A;  3L3F X;  1ZQI A;  1NJW A;  5DB9 A;  3BQ0 A;  3SEN A;  4IQW A;  1NK9 A;  3RJH A;  1KDH A;  3ISD A;  4NM1 A;  2AGO A;  4YQW A;  3OJS A;  4UAV A;  3PR4 A;  2W9C B;  2MUT B;  4ZOH C;  1KEJ A;  5DG8 A;  4PH5 A;  4QZE A;  3RJI A;  2C2D A;  4I2J A;  3HIL A;  4UB4 A;  1ZQG A;  3PSP A;  5AIB A;  5J2C A;  4R8U B;  2C2E A;  5AM4 A;  9ICH A;  4DSJ A;  4EZ9 A;  1O08 A;  3PSF A;  2YQE A;  2VA2 A;  3LYS A;  2CXY A;  1N48 A;  1T3Q A;  3A0B U;  4QZ9 A;  4DQR A;  2F2A B;  3NAS A;  4A8E A;  3ED5 A;  1ZQA A;  5CHG A;  4ED2 A;  4DLG A;  5HR6 A;  2ZTE A;  4F2R A;  5L1L A;  3TQ1 A;  2UVV A;  3HWT A;  4M04 A;  4OO1 J;  2XCP A;  4IL6 U;  3AMZ A;  1X9S A;  1L7N A;  5JU5 A;  4NLZ A;  1SWW A;  2KP7 A;  2YMQ A;  3SAG A;  2F1J A;  5DB7 A;  3UPQ A;  4MFF A;  2YMM A;  2NRT A;  1N62 A;  5DBB A;  2HMX A;  4YP3 A;  3V7J A;  3SMV A;  2BCU A;  1BNO A;  2KFZ A;  1SV4 A;  1KL9 A;  3E58 A;  5CR0 A;  7ICI A;  1QQ7 A;  4TQR A;  5DQG A;  5AKK A;  5AKI A;  1M6Y A;  1N5X A;  2ZIV B;  2G5H B;  5KG0 A;  2J6T A;  1L6N A;  4IS7 A;  2NRZ A;  1UCV A;  1Q3U A;  4P4O A;  1ZRM A;  3ONN A;  3M8R A;  4KMU A;  2NRX A;  2K4P A;  5KG3 A;  5J2F A;  1JAL A;  3MGI A;  4PL2 A;  4QWE A;  2YY6 A;  2KVS A;  4Y2J A;  5D49 A;  2KZ3 A;  4IQT A;  4UAU A;  5J0Y A;  5J0W A;  3HP6 A;  2EAP A;  3C5F A;  3HX0 A;  2WTF A;  2AJQ A;  2FPM A;  4O3R A;  1PVP A;  1VJ5 A;  5HML A;  5KT4 A;  4TUR A;  5KFQ A;  1ZQQ A;  4F71 A;  5ALN A;  4NY8 A;  3T3F A;  2WF8 A;  3RB4 A;  2LPE A;  1ZQF A;  5TIS U;  2R8I A;  5J2I A;  1S0M A;  3KHL A;  4US9 A;  2KJ8 A;  4KLT A;  4UAZ A;  1NJZ A;  4U6P A;  4PHP A;  1PZN A;  3QEB Z;  1OXJ A;  2F8L A;  5JUM A;  4DF8 A;  1H38 A;  2A19 A;  2HHV A;  2GOL A;  1SXD A;  1S10 A;  5J0O A;  2KIC A;  4DSK A;  2HHX A;  5KL1 B;  3Q8S B;  2EZY A;  2KZZ A;  4UQG A;  2G0A A;  4C7Z A;  5ALE A;  3CRX A;  2YX8 A;  2BPF A;  4GFJ A;  1RYR A;  1QQ5 A;  3RJE A;  5ALK A;  5KFH A;  2NRW A;  1D8Y A;  1D8L A;  1BPD A;  4UW9 A;  2BQR A;  2E8N A;  3QUQ A;  3H8S A;  3C2L A;  3M9M B;  4B9U A;  4NV0 A;  3RB0 A;  5H2F U;  1X9M A;  1L8L A;  2JEI A;  3FAH A;  1L7P A;  4PGQ A;  4P0P B;  3TFS A;  1NNL A;  9ICO A;  1ZQH A;  1WYG A;  2RDJ A;  1BPB A;  2L5Y A;  5AKZ A;  3DV9 A;  4O5K A;  5AKG A;  3MR6 A;  2K8C B;  4BXO A;  4ACO A;  2Y1I A;  1O03 A;  5AKJ A;  3SV3 A;  1RM6 C;  3O0F A;  3RJG A;  1U4B A;  1HIW A;  4CNQ A;  5J29 A;  2JHD A;  9ICI A;  4JWN A;  3OPX A;  3KBB A;  3QU2 A;  2R18 A;  4EEN A;  3QU7 A;  3OSN A;  4DFD A;  2HHQ A;  5AIC A;  2CRX A;  4ED1 A;  4KIT B;  2B6G A;  3RB3 A;  2H3F A;  2JZB A;  3FC4 A;  2UVW A;  1A76 A;  3RH5 A;  2H3V A;  2VJ4 A;  4J9N A;  1QH9 A;  4NJ8 A;  1X66 A;  3KHG A;  4P4P A;  2KZM A;  3RAX A;  1ZJN A;  4NLG A;  4DSF A;  3PY8 A;  2IOF A;  1B43 A;  3LDA A;  2MAX A;  4F2S A;  4GC7 A;  2R8G A;  1ZQN A;  3PZP A;  1N61 A;  3V7L A;  3IP4 B;  1B4F A;  4OJ5 A;  3PW2 A;  2XY6 A;  4RQ3 A;  1IV8 A;  5L1M A;  4YMN A;  5DKW A;  4I2F A;  2ZTC A;  3THV A;  3PVX A;  2HBL A;  3NRZ A;  3N97 B;  5KAI U;  4YG2 A;  4PHD A;  4MF8 A;  5KFJ A;  3NVW A;  1AQ6 A;  2OH2 A;  3IG5 A;  2QLT A;  2ZJA A;  2EDU A;  4C4S A;  5J0P A;  3MFI A;  9ICU A;  2YB4 A;  4QWC A;  2FDR A;  3PV8 A;  4DSE A;  4Y2S A;  3WK4 A;  1XSP A;  3MFH A;  2WF6 A;  4C8N A;  1FIQ A;  1X9W A;  5AHX A;  4QWB A;  4Q8F A;  3D6J A;  5ALY A;  3DEE A;  5AM1 A;  5J0R A;  3PML A;  2YML A;  4OJO A;  4R63 A;  3B0X A;  2EQY A;  3GIM A;  3J81 j;  4ECW A;  3Q8Q B;  4ELV A;  5KFU A;  4DF4 A;  3WKD A;  3GIK A;  4JK1 A;  1L7O A;  4DOB A;  2K8A A;  2N1R A;  5J0X A;  4RU9 A;  1RZT A;  8ICF A;  3F2D A;  5ALR A;  1UPH A;  2QB0 A;  5J0T A;  3KD3 A;  8ICP A;  4RQ4 A;  1JX4 A;  5J2H A;  3KKA C;  3EWA A;  3TAD A;  2XY7 A;  1ZQ1 C;  2ZIX B;  1KTQ A;  8ICV A;  2MRL A;  3PO5 A;  1F0M A;  7ICQ A;  1ZD2 P;  2BGW A;  4B9S A;  4P4M A;  3LVV A;  5KT6 A;  2KNJ A;  3CP8 A;  8ICA A;  3GII A;  2LM1 A;  4P0P A;  4LZG A;  4J9K A;  3ZDB A;  2RDI A;  2BDP A;  1RQN A;  5BOL A;  3JPR A;  4DL6 A;  4EZ6 A;  3GIL A;  2Z7J A;  1NK6 A;  3H0L B;  3U26 A;  4UB2 A;  2CN1 A;  4ED6 A;  3K75 D;  4QNL A;  4ZH4 A;  4USA A;  8ICT A;  2KSO B;  2B0C A;  4M9J A;  4I2H A;  5DB6 A;  4EEY A;  2XID A;  3RB6 A;  5KFE A;  4J9L A;  2QAR A;  1BNP A;  2H3Q A;  4BJQ A;  1T94 A;  5EE3 A;  2BPC A;  1U9L A;  4Y2P A;  2Y1J A;  2J6U A;  1Y88 A;  3V72 A;  5AI0 A;  3R9K A;  5KFO A;  4MFA A;  2DPI A;  1D9D A;  4ICA A;  3E2E A;  9ICC A;  5ALM A;  4RPY A;  3ZI4 A;  4KMO B;  8ICN A;  2NO5 A;  5D46 A;  3PR5 B;  4M9H A;  2DF4 B;  4JV1 A;  4KLD A;  1JXE A;  4MEX A;  3PW4 A;  2ZIW B;  4F50 A;  2IMW P;  2PFO A;  1ZQR A;  5ALP A;  2W54 A;  4J9O A;  1NI3 A;  2JEG A;  8ICM A;  2HDO A;  2K89 A;  5KT2 A;  1QCK A;  5HR7 A;  1A6S A;  4YR3 A;  4EBD A;  2QKQ A;  4F5Q A;  4IRC A;  2LMR A;  1B0X A;  1T7P A;  1Z00 A;  2HOF A;  3RR8 A;  2K4E A;  1ZQW A;  5JRT A;  5J2K A;  3PX0 A;  1ZQC A;  3V6J A;  2G06 A;  7ICT A;  2DUY A;  3UMG A;  5AKY A;  1FEZ A;  4NLB A;  1TKD A;  2W04 A;  3HKZ C;  3BQ1 A;  5CB1 A;  1BPZ A;  2OWO A;  2KTQ A;  4DOA A;  1QSY A;  5AI8 A;  1MC8 A;  2J6S A;  5DQI A;  4QZG A;  2ALZ A;  3SQI A;  5KT7 A;  3MDC A;  5KFN A;  1WWV A;  2W9C A;  2C22 A;  8ICY A;  4MFC A;  3UQ2 A;  1F5S A;  5CRX A;  1IG6 A;  4EYI B;  3T5L A;  1L5U A;  4BGD A;  5DLG A;  4NLK A;  3UM9 A;  4NWI A;  2D6F C;  1S9F A;  4Y2U A;  3MGH A;  3JPT A;  1IM4 A;  4UAT A;  2I5H A;  1A77 A;  1ZJM A;  5IIM A;  3TAQ A;  2ODG A;  5F9L A;  3B0Y A;  4DL5 A;  4EBE A;  4QIW F;  3E0F A;  9ICT A;  2ZIU A;  1KFS A;  2IBK A;  2KOB A;  5E79 U;  2WFA A;  4UB5 A;  2OXO A;  1UT8 A;  2ASD A;  4GXJ A;  4IR9 A;  4M9N A;  3BS7 A;  1ZXI A;  3QZ7 A;  3G6V A;  1Q3V A;  1ZD5 A;  2VA3 A;  2ZIU B;  2JR5 A;  4NLC A;  2G09 A;  4DS4 A;  4Y2R A;  2UVU A;  4PGX A;  3WK9 A;  4KX5 A;  4F72 A;  1L3T A;  1F44 A;  2G07 A;  3K1Z A;  3PX6 A;  4F93 B;  2HOQ A;  3WKA A;  4R65 A;  2H3I A;  2W9A A;  3A0H U;  3OJU A;  3Q8K A;  4DLE A;  4YN4 A;  3M6K A;  3QU9 A;  2P66 A;  2JH1 A;  4JMU A;  1BPX A;  4RUC A;  3KFU F;  4BUG A;  2HBJ A;  5KFY A;  4P0Q B;  2H3Z A;  4M9L A;  3HW8 A;  4IC9 A;  4YXM A;  2XY5 A;  2BCQ A;  1CEZ A;  7ICH A;  3QYP A;  2HVI A;  2A1J A;  3BS5 A;  2HW3 A;  4EYH B;  5ALS A;  4ECY A;  1HEK A;  5EWF A;  3MDA A;  1RG6 A;  2A1J B;  5AI4 A;  1CI4 A;  3D2N A;  3C1Y A;  4C8M A;  5BPC A;  1NK7 A;  3H7I A;  2AGQ A;  4UAW A;  4RUA A;  3UXN A;  5J2B A;  7ICK A;  3QUB A;  3NRW A;  4OJL A;  1KKX A;  4KLH A;  3HKZ F;  5ALV A;  3AM9 A;  8ICS A;  2DGZ A;  2H5X A;  3CYM A;  4UB3 A;  3OGU A;  2BCR A;  4P2H A;  1JRO A;  4DL2 A;  5J2A A;  3AQF A;  4QIW C;  1XU4 A;  1B22 A;  4M0A A;  1X6I A;  2E8P A;  4M2Y A;  2MA1 A;  3F5E A;  4UAS A;  4RZR A;  3PW5 A;  4I29 A;  3D2Q A;  5TZV A;  4I28 A;  2ZJ8 A;  3IG8 A;  2E8O A;  4PJ0 U;  2BCV A;  9ICK A;  4ECT A;  5CWR A;  9ICE A;  1YT3 A;  3NS1 A;  1NK8 A;  1T4G A;  1X40 A;  5KFD A;  5ALX A;  3K4G A;  1HUZ A;  4F92 B;  1SKS A;  3IM1 A;  2AQ4 A;  4IRD A;  1JI7 A;  3GV7 B;  1ZQU A;  2AH5 A;  3M1Y A;  4F4W A;  5KFB A;  2A3V A;  1IXR A;  1XO0 A;  3PNC A;  5DQH A;  2M9N A;  4F5O A;  2M0N A;  3WK5 A;  3DDH A;  5DGB A;  5J2J A;  3PW0 A;  4NL9 A;  5T14 A;  4I2E A;  5A0L A;  4Z6D A;  3M9O B;  4FFD A;  1S5L U;  5IIN A;  3RFA A;  5DBA A;  4OJ6 A;  4B9L A;  1RXV A;  1BGX T;  3OHA A;  4CDG A;  1WUD A;  4GXI A;  5J2G A;  1Z1B A;  2JV3 A;  3KZX A;  2E3T A;  1NZB A;  3F2B A;  3RH4 A;  3M9N B;  3SI8 A;  3QUC A;  1L3V A;  5CA7 A;  5F3X B;  3C28 A;  3EUB 2;  2PXI A;  5EE9 A;  5ALW A;  3ISB A;  2HHW A;  5J0Q A;  2OEH A;  3WKE A;  4HAI A;  5ALZ A;  4QZI A;  4PL1 A;  8ICO A;  2VKQ A;  4FZM A;  4QZA A;  3WK7 A;  2O6K A;  4I2C A;  2Y9U A;  3Q8M A;  4QZF A;  3V6H A;  9ICG A;  4UAR A;  4NL9 C;  3OSP A;  4LZD A;  5GTH U;  3SR6 A;  1P7D A;  4KX3 A;  2P35 A;  5DB8 A;  2PI4 A;  2PMZ F;  1CUK A;  2XGQ A;  4UAY A;  9ICJ A;  5CJ7 A;  3ORY A;  4RQ0 A;  4X5V A;  4YD2 A;  1SB3 C;  3PX4 A;  4KLL A;  3C1Z A;  3VC8 A;  4KLG A;  2HHS A;  4K4G A;  4YD1 A;  4O3M A;  5EOZ A;  3FDS A;  3N7R C;  2EZZ A;  7ICN A;  3NVY A;  4ECZ A;  1KBU A;  4YXJ A;  4ELU A;  8ICB A;  3RBE A;  1NZP A;  3SZ2 A;  4QZH A;  3GQC A;  4B9T A;  4UB6 U;  2W3R A;  3ZDC A;  5FP0 A;  2R8K A;  4O5C A;  1OW5 A;  3SEI A;  2R8H A;  5ALH A;  3N4M B;  9ICB A;  1ZD3 A;  5JTI A;  4ED8 A;  4R66 A;  1NK4 A;  4R64 A;  4DSL A;  3TAC B;  4XRH A;  4M6W A;  2WF5 A;  4MEY A;  2LKY A;  4GC6 A;  1EXN A;  3TAR A;  2NRV A;  2E5S A;  2KSO A;  3MBY A;  2RQ5 A;  4TQS A;  5AM2 A;  4GIB A;  4Q44 A;  3OHB A;  4RPX A;  4UBB A;  3JPO A;  2V4Q A;  2W9B B;  1S0V A;  4C80 A;  8ICC A;  1RPL A;  3WKB A;  4US8 A;  2W9B A;  4DSI A;  4O3N A;  4O0I A;  7ICJ A;  1S77 D;  4F5P A;  8ICK A;  2EAM A;  4DQQ A;  2BQ3 A;  2PI5 A;  2GH1 A;  2KHQ A;  2EAO A;  5KFK A;  3RBD A;  3PO4 A;  7ICV A;  5ALQ A;  2NO4 A;  1LKY A;  9ICX A;  1LVH A;  5F9N A;  4IQU A;  5L1K A;  2FLL A;  4FO6 A;  1N2X A;  1WWU A;  1S76 D;  1PK3 A;  3RJF A;  2F1I A;  3ICX A;  2LYA A;  4J9Q A;  3GU3 A;  2IHM A;  3TI0 A;  4EBC A;  3Q8P B;  4LVS A;  1WCN A;  1LV5 A;  1SZP A;  5DBC A;  5DG7 A;  7ICM A;  4TUP A;  4KLM A;  4ECS A;  2ZUD A;  5J2E A;  3ZDD A;  3AEV A;  1U45 A;  1FFV A;  1X6J A;  2Y0S C;  3OTQ A;  4DO9 A;  3QE9 Y;  4F4X A;  8ICZ A;  2QB0 B;  2JMG A;  2LYB A;  3MAB A;  4C7Y A;  3QZ8 A;  1V85 A;  5III A;  8ICI A;  3MR2 A;  1SL0 A;  1UHU A;  1XSL A;  1SWV A;  3HT3 A;  1KFD A;  3RRH A;  2ZIW A;  4KN7 A;  1SL2 A;  2DFL A;  2FLP A;  3ETR A;  5AK3 A;  3N7P D;  4PHA A;  5ALF A;  3BDP A;  1SL1 A;  2W03 A;  4BDP A;  2ISP A;  5DG9 A;  1DRG A;  2FPL A;  4KLU A;  4C0Z A;  3QXG A;  3LVW A;  1SGG A;  2AXT U;  4UB1 A;  3ALR A;  4B9V A;  4EX7 A;  1MSW D;  3S6J A;  4FE3 A;  2QB1 A;  3NUQ A;  1SZH A;  2Y0S F;  4HYK A;  4BWJ A;  4DFP A;  1MN8 A;  1ZOL A;  2IA6 A;  3QNM A;  3GIJ A;  2W11 A;  3EW9 A;  3MR5 A;  2ZUC A;  2C2R A;  2DQN B;  5DGA A;  1S0O A;  2CPR A;  1FO4 A;  5ALJ A;  2K4H A;  4KLO A;  5HNK A;  5J8Y A;  3UXO A;  2F77 X;  1J2N A;  1IIP A;  2KEY A;  3I76 A;  1ZQM A;  4JB3 A;  4DQI A;  4FBU A;  3IRU A;  4YFK A;  4E0D A;  1L7M A;  1Q8K A;  1X2I A;  1ZQX A;  4RNN A;  1SV0 A;  4FS2 A;  5C0Y A;  3KHH A;  4ECV A;  2BZF A;  2Y9T A;  4IQV A;  2VJ5 A;  3H8W A;  1XNS A;  7ICL A;  1URJ A;  5L1I A;  5KTQ A;  3AUO A;  2VA8 A;  2Q0Z X;  5KG7 A;  4YCX A;  2JEF A;  5C5J A;  3BS5 B;  4CCH A;  2FJ6 A;  4QZ8 A;  3PST A;  3M6Z A;  5AK5 A;  3NVZ A;  2ZJ5 A;  5B66 U;  3F5A A;  4DS5 A;  1NK0 A;  4B9N A;  1MQ3 A;  1TVA A;  2D8C A;  1ZRN A;  3C2K A;  4CF5 A;  4RQN A;  1TK5 A;  7ICE A;  5DDY A;  1MA7 A;  1YZ6 A;  2B21 A;  1NKC A;  1QTM A;  4Z6E A;  5G5G A;  1T8E A;  2FMP A;  3MGV A;  3ZD8 A;  1RYS A;  2DKX A;  2ISO A;  1ZQD A;  1C20 A;  4TUS A;  1LB2 B;  3UMB A;  4DEZ A;  2UVR A;  5GTI U;  4ECX A;  3V7K A;  3SD7 A;  3WK6 A;  4G3I A;  2WB1 C;  1UQV A;  3PW7 A;  2ASJ A;  5KAF U;  1JMS A;  3IHQ B;  1A0P A;  8ICR A;  4ELT A;  1ZQL A;  3KHR A;  2F3N A;  4U7C A;  4F4K A;  3AQE A;  5AK4 A;  1U47 A;  7ICP A;  2KHV A;  3H4B A;  1PVQ A;  4ECU A;  2BR0 A;  2FMQ A;  4DQP A;  4IR1 A;  4KTQ A;  2E1F A;  1SKW A;  1RYU A;  3TAP A;  3BJY A;  2KN7 A;  1PK1 B;  4I2A A;  3I28 A;  5AIA A;  4RQ5 A;  3TAN A;  4Q8E A;  4JUZ A;  1HJP A;  5KG4 A;  1C7Y A;  1QSL A;  2RHF A;  3UQ0 A;  3EZ5 A;  2IOF K;  2OYY A;  4DFJ A;  2BDU A;  2JEJ A;  2FMS A;  3Q8R B;  2JXJ A;  3LWM A;  3AL0 B;  4M47 A;  1JUD A;  1UA1 A;  5AM0 A;  5IIK A;  4C8K A;  1L3U A;  5KG2 A;  2WF9 A;  3SYZ A;  3EPI A;  3BQ7 A;  4Y2Y A;  2HHU A;  4NM2 A;  1NOM A;  1TFR A;  2VAN A;  3AN1 A;  1TE2 A;  4KLS A;  2HBK A;  5D4B A;  3EPG A;  1WG8 A;  5KG1 A;  1N5W A;  3KOO A;  8ICU A;  2HI0 A;  2GO7 A;  3C29 A;  2HSZ A;  1RDF A;  2YN4 A;  1L8O A;  5DDM A;  1ZYQ A;  9ICS A;  2AQ0 A;  4BX9 C;  4RQ6 A;  9ICQ A;  1KW4 A;  5AM5 A;  2PMZ C;  1ECW A;  1ZQV A;  4YMO A;  4F4Z A;  2PKE A;  2P6R A;  2EH9 A;  5ALU A;  4PZN A;  4QW9 A;  9ICV A;  8ICX A;  5KFL A;  4CF3 A;  1D8B A;  3ZD9 A;  5AI9 A;  1ZD4 A;  9ICM A;  2HBM A;  4WJ3 B;  2KKP A;  9ICW A;  5CP2 A;  1PVR A;  5EWG A;  4O3P A;  4FZN A;  4ED7 A;  2W7O A;  3Q8L A;  3TAD C;  3ZDA A;  2D3D A;  1X9X A;  5HP4 A;  1VLB A;  3AU2 A;  1RXW A;  2FI1 A;  4J9R A;  2MU2 A;  3H4D A;  2ZTD A;  4Z6C A;  1PUZ A;  3N7S C;  4F5R A;  2Q4T A;  3C2M A;  3F2C A;  2YMP A;  3KZI U;  4I2G A;  4O3S A;  2AU0 A;  2ZG6 A;  3NVV A;  4F5N A;  5AI5 A;  4ED3 A;  3RF9 A;  2DWQ A;  1ZQE A;  7ICO A;  5ALT A;  2F8K A;  3QEA Z;  2C28 A;  3FM9 A;  4I2I A;  4AYB C;  2I9G A;  4DL3 A;  5ALO A;  2NV3 A;  1TV9 A;  5EWE A;  4EEK A;  2ZXH A;  2FLN A;  5AKL A;  1JXL A;  2KG5 A;  1NKE A;  1V9P A;  2WHE A;  3T79 A;  4DFM A;  3F53 A;  2V4R A;  1KRP A;  1VDV A;  2W7P A;  1NJY A;  3WK8 A;  1ED1 A;  2GLE A;  3WKC A;  4J9M A;  2KFN A;  2KVC A;  1OUQ A;  4K4H A;  1GO3 F;  1RQL A;  2MSN A;  3GDX A;  3H40 A;  2KE7 A;  4ECQ A;  3AU6 A;  2RP5 A;  1Z1V A;  4IRK A;  2ZIX A;  4PZO A;  4I2D A;  5B5E U;  2XI9 A;  1Z19 A;  4R8U A;  4CF4 A;  2ZIV A;  1DGJ A;  2BCS A;  3QU5 A;  1TAU A;  4QJF B;  3CW2 C;  2XCA A;  1S0N A;  2IHN A;  4QW8 A;  3KTQ A;  4RNO A;  3ISC A;  2K60 A;  2YB1 A;  1KLN A;  3JPS A;  4RQ2 A;  9ICF A;  2W8L A;  5AM3 A;  2PFP A;  3FYH A;  5L9X A;  2WAQ F;  3VCB A;  4CRX A;  1L3S A;  5KFX A;  3V6K A;  1CRX A;  5KNI A;  1WCL A;  4LJX A;  3BQT A;  3T5H A;  4J03 A;  5ALG A;  4RQ1 A;  1ZET A;  2K4I A;  5KFM A;  9ICP A;  5KT5 A;  2P6U A;  4AYB F;  2LBO A;  2XO7 A;  3PMN A;  4UBC A;  5KFT A;  7ICG A;  3I1Y A;  2OCE A;  2KD1 A;  2JZB B;  1SIJ A;  1V38 A;  4JV0 A;  3H0R B;  3C21 A;  3EYZ A;  1PK1 A;  8ICJ A;  2A1A A;  1TK0 A;  3H0M B;  1J97 A;  3H8J A;  4PPX A;  3K1R B;  2DBY A;  8ICE A;  2BKE A;  4YMM A;  3JPQ A;  5KG6 A;  3D2S A;  3QX7 A;  5KFP A;  2KIV A;  1ZQO A;  4BWM A;  1XWL A;  1DK3 A;  2XC9 A;  2IOH A;  2EAN A;  2ES6 A;  4OCZ A;  4AP9 A;  3TFR A;  2HCF A;  3NTU A;  5K4L A;  3QU4 A;  2DKZ A;  2E1E A;  3BZC A;  2HHT A;  2KJ9 A;  4EX6 A;  1Q46 A;  2E8M A;  7ICF A;  1NJX A;  3GV5 B;  4YR0 A;  4C8L A;  1JRP A;  2LHT A;  2VIX A;  3HRD D;  4YR2 A;  1SXE A;  2ESE A;  2JGA A;  4RQ8 A;  2LI6 A;  1ZQK A;  2LM4 A;  4YVZ A;  1Z3E B;  5AKX A;  1HUO A;  4RT3 A;  5HHI A;  2XIC A;  3G6Y A;  4XA5 A;  3N28 A;  4F4Y A;  5KG5 A;  5KFW A;  4K4I A;  2KV2 A;  2K8B B;  4CE6 A;  4DFK A;  1D9F A;  3HJE A;  8ICW A;  1COO A;  5KFA A;  1K1S A;  5CEH A;  3KKA A;  4PHE A;  4B6J A;  2BHN A;  5J2D A;  4GLX A;  4ED0 A;  1Z4O A;  3RAQ A;  4Y2X A;  5IIJ A;  4XQ8 A;  4GXK A;  2GWS A;  1COK A; 
#chains in the Genus database with same CATH homology
 3C28 A;  2KJ5 A;  4P0P B;  3DEE A;  3SMV A;  3F5A A;  3N7P D;  2W03 A;  4OJO A;  4ICA A;  3PSI A;  3T79 A;  1DRG A;  2KD1 A;  2HBK A;  3NRW A;  4OJL A;  2KKV A;  3F53 A;  4C0Z A;  3H0R B;  3HKZ F;  1Q3U A;  2K8C B;  2F76 X;  2W7P A;  2RRD A;  4ACO A;  1MA7 A;  2DGZ A;  3CYM A;  4KMO B;  4QIW F;  3E0F A;  1ED1 A;  3C29 A;  2ZIU A;  2ZIV B;  3LVW A;  2G5H B;  4FZL A;  3ALR A;  1L6N A;  3H0M B;  2KOB A;  3AQF A;  3O0F A;  2DF4 B;  2KVC A;  1HIW A;  4FE3 A;  5KL8 B;  3NUQ A;  2JHD A;  2K8A A;  2VKQ A;  1SZH A;  3ONN A;  4FZM A;  2N1R A;  3M7D A;  4PL1 A;  3MGV A;  1OUQ A;  3OPX A;  2Y0S F;  4BX9 C;  3L3F X;  2R18 A;  2OXO A;  3F2D A;  2ZXI A;  2PMZ C;  2ZIW B;  1UPH A;  1ECW A;  1GO3 F;  2MA1 A;  3F5E A;  3D2S A;  4PL2 A;  2HOI A;  2GH1 A;  2KHQ A;  1P7D A;  2G5I B;  2CRX A;  3D2Q A;  4KX3 A;  1D8B A;  2RP5 A;  2PMZ F;  1Q3V A;  2DQN B;  3IG8 A;  2ZIX A;  2H3F A;  2ZIU B;  2K89 A;  4NLC A;  2WB1 C;  2G09 A;  1ZQ1 C;  2XI9 A;  2ZIX B;  2HBM A;  4WJ3 B;  2WB1 F;  2KKP A;  2CPR A;  1YT3 A;  1Z19 A;  2MRL A;  1PVR A;  1A0P A;  2H3V A;  2K4H A;  2E1E A;  4FZN A;  2VJ4 A;  1PVP A;  5HR7 A;  2KJ9 A;  2ZIV A;  1A6S A;  3VC8 A;  2W7O A;  3SAF A;  4U7C A;  3AQE A;  3LVV A;  4KX5 A;  1F44 A;  2G07 A;  2KHV A;  2KNJ A;  3K1Z A;  1TAM A;  2F77 X;  2KEY A;  1IIP A;  3CP8 A;  4QJF B;  1PVQ A;  2HOQ A;  4O3M A;  3N7R C;  2H3I A;  2HOF A;  3PSP A;  3ICX A;  1KBU A;  2LYA A;  3PZP A;  2E1F A;  2LHT A;  2WAQ C;  2K4E A;  2OM6 A;  4P0Q A;  2KIW A;  3IP4 B;  2KJ8 A;  2XVT A;  2VIX A;  3GU3 A;  3M6K A;  3SAH A;  4U6P A;  3N7S C;  2JH7 A;  2YB1 A;  4OJ5 A;  2Q4T A;  5T14 A;  2A3V A;  2G06 A;  2JH1 A;  3PSF A;  1XO0 A;  3LYS A;  4JMU A;  4NLB A;  3F2C A;  2F8L A;  2W04 A;  2JGA A;  4CGZ A;  3HKZ C;  2F2A B;  4P0P A;  3KFU F;  4A8E A;  4BUG A;  4OJP A;  2GOL A;  2M0N A;  2Z7J A;  2KIC A;  2RHF A;  2ZG6 A;  2G08 A;  2HBJ A;  3H0L B;  5C0Y A;  5HR6 A;  2CN1 A;  4P0Q B;  5KL1 B;  3RF9 A;  4QNL A;  2OYY A;  2H3Z A;  2BDU A;  2G0A A;  2WAQ F;  4QIW C;  2HBL A;  2Y0S C;  2XIC A;  2YX8 A;  3VCB A;  5A0L A;  4GFJ A;  3CRX A;  4CRX A;  3SQI A;  1CRX A;  4IC9 A;  3AL0 B;  3RFA A;  2VJ5 A;  4OJ6 A;  4AYB C;  4OO1 J;  2KV2 A;  2OH2 A;  1XNS A;  2K8B B;  2JMG A;  3GZF A;  3IG5 A;  4CDG A;  2XID A;  1WUD A;  5CRX A;  1URJ A;  2LYB A;  2YB4 A;  2H3Q A;  2NV3 A;  1T94 A;  2K4I A;  4BJQ A;  3IN5 A;  1Z1B A;  2LKY A;  3SAG A;  1HEK A;  4NV0 A;  4NWI A;  3KZX A;  1NZB A;  2D6F C;  2E5S A;  2ZXH A;  3F2B A;  3D2N A;  3PST A;  3M6Z A;  4AYB F;  2ZIW A;  2LBO A;  2HMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...