2N1RA

Nmr structure of the myristylated feline immunodeficiency virus matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
GNGASRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the myristylated feline immunodeficiency virus matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
molecule tags Viral protein
molecule keywords Matrix protein p15
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2n1rA00
1L6NA 2K4HA 1HEKA 2H3ZA 4JMUA 2HMXA 2H3IA 2H3QA 1HIWA 1A6SA 1TAMA 2K4IA 1ECWA 2H3FA 2NV3A 4IC9A 2K4EA 2JMGA 2LYBA 2GOLA 2H3VA 1ED1A 2N1RA 1UPHA 2LYAA 4ICAA
chains in the Genus database with same CATH superfamily
3NGDA 2PI4A 2KVSA 1SKSA 1FIQA 2OH2A 4RQ1A 5J2CA 1S97A 5HP4A 5DBCA 1KDHA 2JEJA 1FEZA 3KFUF 4A8EA 5AK3A 3WKCA 4F91B 3WKDA 1LVHA 2KIVA 3R9KA 4OJ5A 3KKAA 3F5AA 3MGVA 4IR9A 1IV8A 3QZ8A 2W8LA 4KTQA 1OUQA 1KEJA 3FYHA 4M9HA 5J8YA 1Q8KA 4Y2PA 2W8KA 9ICCA 7ICPA 1SKRA 4US8A 1NK9A 3BS5A 1ZQRA 3ISCA 9ICVA 2HHXA 5HMLA 1XWLA 2R8HA 3MDAA 4BGDA 1WCNA 2XIDA 3U26A 4GIBA 1BPZA 3RJHA 4ZOHC 1NI3A 1TE2A 2H3ZA 3M8SA 4UAWA 8ICFA 5AM5A 4Y2YA 5BOMA 4QWEA 5HR6A 4YXMA 3AU2A 5KAFU 1J2NA 2XY6A 2DPJA 4IQTA 1PK1A 2F44A 3K75D 4Z6EA 2BCUA 3MR2A 2ZUDA 3ED5A 2FLLA 3GV5B 1XSNA 4NJ8A 8ICOA 2IOFA 5KG3A 3QUCA 4I28A 2PMZC 5ALTA 1XO1A 1X6JA 3NASA 1PK3A 5KT3A 3C5FA 1TVAA 5AKGA 4KITB 5A0LA 4ED1A 4YG2A 4NV0A 2MSNA 3MFHA 1SZPA 5ALLA 4UB4A 4JV1A 3KHLA 1CEZA 2FMQA 1URJA 3JPTA 5AK5A 1RG6A 4RU9A 2MRLA 4DLGA 5KFNA 3NUQA 5DB8A 3PW7A 1JRPA 2AU0A 3RR7A 4PGXA 3JPRA 3KD3A 4MHVA 5KT6A 1UHUA 2EAMA 2LHTA 1Q3UA 2W11A 3GV8B 4Y2QA 2M9NA 4BXOB 2XGPA 1RYUA 4DCCA 4F71A 9ICTA 2CXYA 2XICA 3F5EA 1RQNA 4K4HA 4O5KA 3M9OB 5AI0A 5AKLA 3PSPA 3I28A 1JIHA 2W3SA 3ZDCA 2LM1A 2JEFA 2OHFA 2LYAA 1PVPA 3UQ2A 1SWVA 4KN7A 2W9MA 1MN8A 4DFJA 2EDUA 3PW2A 3F2DA 3SEIA 3PW5A 2LYBA 3H4BA 4KX5A 1NKBA 1S77D 4B9TA 4J9QA 3SZ2A 5AKKA 3PW4A 1L6NA 1M6YA 2W9CB 1HIWA 2BPGA 2WHEA 5B5EU 3KTQA 2UVVA 1X9XA 3M1YA 1WUDA 2FPMA 5AM0A 4PPXA 4DS4A 9ICOA 4IRDA 1TAQA 3UXPA 2KJ9A 1OXJA 3T5KA 1PVRA 2BDUA 4Y2RA 9ICAA 1V9PA 2Q4TA 5KNIA 5EE9A 1U47A 1MC8A 1QQ6A 3BDPA 5AK6A 2RLTA 2NRZA 1T3NA 2QB0B 2ZTDA 1X9SA 1BPEA 4F5QA 1SGGA 2AXTU 4RZRA 2XGQA 1NJZA 2Y9TA 5DQGA 1Y88A 4YVZA 1V97A 4JV2A 2HBKA 1SIJA 1BPYA 4MF2A 3GDXA 2ZIUB 4ED3A 3RF9A 5KT7A 2F8LA 9ICQA 2FE9A 2FLNA 2PFNA 2AGQA 2FPLA 3EPGA 2OM6A 1H38A 2C2EA 4DSIA 4TUPA 4NLZA 3HILA 1PUZA 4UAUA 4UB8U 4EX6A 3HPOA 4HYKA 3SAFA 2B6GA 3T5HA 1KFDA 2EANA 4J9KA 2JEIA 5KG5A 5KAIU 2Y1IA 5AK4A 4M2YA 1JUDA 5ALIA 1NK4A 4Z6FA 4ED7A 2C2DA 1EXNA 4QZGA 7ICTA 5L1LA 7ICGA 1A76A 4EYHB 1Z19A 1D9DA 3QUBA 2YTUA 3TADA 5DDYA 1Z4NA 4R8UB 1S5LU 5CB1A 4EZ9A 8ICBA 1L8LA 1QH9A 1B0XA 3AN1A 3K4GA 1L5UA 5GTIU 1AROP 4KLTA 1A77A 3AUOA 1NNLA 2HOQA 3Q8PB 1NOMA 1ED1A 2R8IA 2KG5A 4C8KA 9ICLA 5KFHA 1X9MA 3LDAA 3JPQA 2H5XA 4U7CA 4IQWA 3NRZA 4YR2A 1D8YA 5C0YA 1X42A 4BJQA 3PX0A 4RQ3A 1B4FA 3I76A 2FMSA 4JK1A 4TUQA 4I2AA 3M9MB 3RH6A 3EUB2 3RH5A 4F2RA 3PSFA 2E8PA 9ICRA 5KFCA 4MFCA 4QWAA 2KKVA 3PO5A 1JX4A 4C0ZA 4YQWA 2JH7A 3BS5B 1SXDA 2J6SA 2NRVA 2H3FA 2HBLA 2ZG6A 5DLFA 2DBYA 1KLNA 2KSOA 3CW2C 4F4KA 3PV8A 4GFJA 1IIPA 1ZQYA 2JV3A 2W7PA 2LPEA 4DQIA 1ZQUA 2VJ5A 2D6FC 4IQUA 3ISDA 4DL4A 2VA8A 2R8JA 5KFFA 3BZCA 2LYHA 2MUTB 5EOZA 2MU2A 3TANA 2PFOA 3B0XA 3H8WA 4EEYA 3BQTA 3QU7A 4PZOA 2G5IB 1CUKA 2QARA 5KL8B 2QARB 5KG2A 1S0VA 5BPCA 4RQMA 1X2IA 1SZHA 5KFOA 4C8NA 1PK1B 1SL0A 4P0PA 3B9JA 3TFSA 1D9FA 3H0RB 5CRXA 1C20A 2WAQC 4NXZA 1WG8A 1ZJNA 1KQQA 2LBOA 3WK5A 2K4IA 2F1JA 4DF4A 3IDWA 2BQRA 1QSYA 3LWLA 2D3DA 3HW8A 8ICTA 3E0FA 5L1MA 5DQIA 5AKZA 2BCQA 8ICLA 1ZQWA 4FS2A 2W9BA 4IRKA 2E3TA 2G08A 2NRWA 1U49A 2WB1F 9ICUA 5J0TA 4Y2TA 3F2BA 4RPXA 3HKZF 3NVZA 5AI5A 3MFIA 3AQEA 5D4BA 4RPZA 1N5WA 1JMSA 3GU3A 3Q8KA 3AU6A 3AMZA 4C4TA 1RM6C 2G07A 1IG6A 1ZQ1C 4DL6A 3TFRA 2C2RA 3WK7A 3QU4A 3LK9A 4NL9C 2PMZF 1ZXIA 2XVTA 5HR7A 1S76D 2Q0ZX 3UMGA 3RB3A 5JRTA 4J9NA 4YP3A 3MGHA 2KZMA 5J0RA 4TUSA 2I5HA 1QSSA 2C28A 4YXJA 2RP5A 5ALSA 2ODGA 5ALFA 1LKYB 2ASLA 2ZIXB 5KFPA 2F76X 2EQYA 1L3UA 4ED6A 2R18A 4DSLA 4O5CA 8ICZA 4Y2SA 2YMMA 3G6VA 4F8RA 4NL9A 3ZDEA 4EBEA 4KMUA 1ECWA 2ES6A 4Q43A 5F9LA 5KG1A 5J2DA 3FDSA 2W9AA 4CE6A 1ZQQA 2AJQA 2ASDA 4PHDA 3HP6A 2IBKA 5KT2A 1Z1BA 1T7PA 4I2CA 5J0UA 2OWOA 4QWCA 4KX3A 2MUTA 2HHUA 3GILA 4DF8A 2WF6A 2V9WA 2W03A 4IQVA 4I2DA 3IV6A 2BHNA 2NO4A 5IIKA 3OJSA 2E8MA 3EZ5A 3IRUA 2A1JB 1T8EA 4QNLA 2YX8A 4BWJA 1SKWA 1TV9A 1SV4A 4J9OA 7ICFA 4K4IA 2I1QA 1ZQSA 3C5GA 8ICHA 2FPKA 2GLEA 2KFNA 4DQRA 4YMOA 5J2IA 3PZPA 2VKQA 3SAHA 1XC9A 3M6KA 5B66U 4RUCA 5L9XA 2D8CA 3NRWA 2HHSA 3SQIA 7ICEA 1ZD4A 4I29A 5AICA 4DSJA 1U45A 1T4GA 4B9LA 1X6IA 2OCEA 4QZ9A 2ZIWA 5AHXA 4JWMA 2YMQA 4USAA 3QXGA 4O5EA 4Y2JA 9ICHA 1K1QA 2XO7A 4BDPA 1LV5A 3WKAA 9ICMA 2KHVA 2WB1C 8ICKA 1ZD5A 5E79U 3JPOA 4QZIA 2ISOA 3ETLA 4AYBF 3TAPA 3UXNA 4I2GA 3H7IA 2K8BB 4UW9A 2KKPA 4I2HA 2IOFK 4F5PA 2HCFA 5H2FU 2KIWA 5DB6A 3QUTA 4J03A 4PHEA 2V4QA 3GIMA 2IHNA 1NZPA 1CI4A 2RRDA 3CP8A 3AEVA 3QYPA 3GIIA 3H0MB 2I6XA 4FE3A 4RQNA 3RB4A 4FS1A 1RDFA 4ECTA 2FDRA 1B22A 4QJFB 4QZAA 5ALUA 3V7JA 4JB3A 1NK7A 1KBUA 5AKJA 3RRHA 2YB4A 1ZQFA 2K89A 4TURA 2HHVA 1ZQVA 2EZXA 1UT8A 2NYVA 4C7ZA 2AGOA 2O6KA 4Q8FA 5DKWA 4RQ0A 1UQVA 2F1IA 3OHAA 3JPPA 4F72A 2QKQA 3OPXA 4NM1A 5J2FA 3S6JA 4J9RA 2H3IA 2K8AA 2E8OA 1KKXA 4R66A 2EAOA 3PVXA 1BGXT 2ZUBA 4RQ5A 2RDIA 4F50A 1JN3A 2BPFA 3TAQA 2HHTA 4FFDA 4ELUA 2KN7A 4PH5A 1IXRA 4I2IA 3RBEA 4JMUA 3M7DA 2ZIVA 3IG8A 5ALEA 2XY7A 4DFMA 1SV0A 7ICUA 4R8UA 2HBMA 4R63A 4QZBA 2UVWA 3SENA 3N4MB 3L5KA 2HVHA 2F8KA 4FBTA 4CCHA 5ALRA 1Z3EB 4EBDA 5KFAA 3E58A 5BOLA 2ZIWB 3GIJA 4PJ0U 1ZQDA 1COOA 3PSIA 2H3QA 1COKA 4YD1A 4PL1A 1SV0C 3LWMA 1JI7A 1NK6A 1L3VA 4AYBC 4RNNA 5DG8A 2G5HB 8ICVA 2XY5A 5T14A 3B0YA 2HI0A 4DL2A 2YMLA 2W43A 5J0QA 4CF3A 4CF5A 2OYYA 4R64A 1A0PA 3F53A 4US9A 2G06A 4BX9C 2A1JA 3UQ0A 8ICJA 5IINA 4YCXA 3RJKA 4XRHA 3WKEA 1QSLA 4DWIA 3GIKA 4B9MA 4ECQA 2JEGA 3V6JA 3ICXA 5FP0A 4P4MA 3MR3A 2LKYA 4RQ8A 3OJUA 3RJFA 2GO7A 4KLMA 1RYSA 3PNCA 3ETRA 4DFPA 2BDPA 1ZQZA 4J9SA 1DOQA 7ICRA 8ICMA 4LJXA 3ISBA 4UB6U 3QZ7A 5J0YA 3H8MA 2IMWP 8ICRA 3BJYA 4M9JA 3UXOA 7ICVA 4J9MA 3RH4A 4PL2A 4KLDA 2XCPA 1WCLA 2LI6A 2WAQF 2ZXHA 4C8OA 2PFQA 3H4DA 2NV3A 2LMRA 5HHIA 3SYZA 4UQGA 2FMPA 1N63A 1ZQAA 7ICKA 2J6TA 2AHOB 4UBBA 4QW9A 1QLNA 4GC7A 5AI9A 5TISU 5F9NA 2E1FA 3WK9A 4Y2VA 4PGQA 1VLBA 1TK5A 1ZD3A 1XO0A 4LVSA 4M0AA 3HRDD 4JWNA 4Y2XA 2KE7A 2F77X 2YQEA 4UB3A 4DOAA 2DKXA 3T79A 4Y2UA 5IIJA 3GZFA 1XS9D 5GTHU 7ICJA 4QZDA 1ZQEA 4QZFA 3K1ZA 3TQ1A 4I27A 4QIWF 3SD7A 4E0DA 4Z6CA 2BQ3A 1NJYA 1QCKA 3BQ0A 4RPYA 3N7PD 2OEHA 1PVQA 7ICNA 5DQHA 3WKBA 4TQSA 4DQPA 5J29A 2ASJA 2BQUA 4NM2A 4F5RA 5DB9A 2PKEA 2Y9UA 5KFLA 5ALZA 3MR6A 3BQ2A 4YN4A 1RPLA 1DGSA 5AM1A 4P0PB 4QW8A 4RNOA 4B6JA 2C22A 1ZQTA 3AQFA 4PHAA 9ICXA 8ICGA 7ICOA 4Q8EA 3OTQA 2JMGA 5DLGA 5AI4A 5CP2A 1UT5A 4OCZA 4F4XA 1SL1A 2BCSA 1V38A 1SWWA 5JUMA 3D2QA 5L1IA 3FC4A 3ZD8A 2LM4A 4LZDA 5JTIA 1N61A 1F44A 4FBUA 3TI0A 2K4PA 3T5LA 1N2XA 2JZBB 4XA5A 4F5NA 3RB6A 1ZJMA 3UM9A 8ICIA 4UASA 4YD2A 2W54A 3Q8RB 2KZ3A 2V4RA 5ALGA 3V6KA 2KICA 9ICKA 3PMLA 2VJ4A 2VA2A 4EX7A 4KLLA 3NVWA 5KFUA 2HHWA 1HEKA 3HT3A 2EZZA 3HWTA 5ALVA 1ZETA 2KV2A 5ALMA 5KFDA 3ZD9A 4G9BA 3QE9Y 2IA6A 2JR5A 5CWRA 5J0PA 3Q8SB 5IILA 4EENA 4QWDA 9ICFA 1DK2A 3THVA 3D2NA 1HUZA 4UBCA 4QZ8A 9ICSA 3QEAZ 3ALRA 3MC1A 2AGPA 2PI5A 4CF4A 3MDCA 1D8LA 1S8OA 4IC9A 4O9MA 4PHPA 1BPDA 4M6WB 2P66A 1ZQMA 1V85A 4ELTA 5G5GA 3EYZA 3L3FX 4UB5A 1XU4A 3RAQA 4DL5A 3QU2A 1RXWA 5J2GA 1N5XA 2AQ0A 5ALJA 2GH1A 1S9FA 4NWIA 1Z1VA 5J2KA 2F3NA 1N48A 4DSFA 2YB1A 4UATA 1HUOA 2L5YA 4NLNA 2GOLA 4DSKA 1KTQA 4KLOA 9ICPA 2FI1A 1BNPA 2B21A 3RJEA 1T94A 4J9PA 3OSPA 4DLEA 3QU5A 3F2CA 2RDJA 9ICGA 2JGAA 3A0HU 1VJ5A 5KFSA 3CNHA 2BCVA 2NRXA 4RQ7A 5L1JA 1MSWD 1SXEA 4O3MA 4M9LA 2R8KA 2NRTA 2Y1JA 5KT4A 3N7RC 4EBCA 4X5VA 3UPQA 5DGAA 3RBDA 1N60A 1CRXA 5AM2A 4QZHA 1HJPA 2HOIA 3MGIA 7ICIA 3CRXA 3KBBA 1L7MA 3M9NB 4YR3A 4DS5A 1RXVA 1ZQGA 3OGUA 3KHGA 4C4SA 1OW5A 1D8BA 8ICAA 2IHMA 2FLPA 2WF8A 4F4WA 5F3XB 1JALA 5J0WA 4ECUA 2YY6A 3C2KA 2KK0A 2ZJ8A 3PMNA 1X9WA 1F5SA 3C23A 2FJ6A 2KZZA 5EE3A 3Q8QB 1S0NA 3PO4A 5ALNA 2A19A 1BPBA 4M04A 4J9LA 5KFTA 2KOBA 4GXKA 4YMNA 2ATLA 2XCAA 4ECRA 4EZ6A 3RRGA 3KZXA 3VCBA 4OD0A 3C28A 4KMOB 5IIMA 2ZIVB 1NK5A 3SI8A 2E5SA 3H8JA 4XQ8A 4QZEA 2PFPA 2WFAA 5D49A 3C2LA 3K1RB 3N7SC 7ICHA 1DGJA 2N1RA 4O3PA 4ICAA 2UVRA 4ED2A 4DSEA 3G6XA 1T3QA 3IM1A 4P0QB 4MF8A 4M6WA 5HHHA 3TADC 3HJEA 1ZQOA 1U48A 4O3SA 5DBBA 4C8LA 3PW0A 2CRXA 4WJ3B 4CNQA 3IN5A 2EAPA 4RQ2A 5L1KA 7ICSA 4NLGA 3V6HA 1KFTA 2MA1A 1Q3VA 4KLEA 1N56A 2KVCA 2KJ8A 4F92B 1KSPA 4IRCA 1NK8A 2A1AA 2J6UA 4RNMA 4XUSA 8ICXA 8ICPA 2K8CB 1MQ3A 2F1HA 4PZNA 3E2EA 4B9VA 4F2SA 4F4ZA 5TZVA 4RQ6A 3MABA 4RT2A 2IOHA 4ECVA 1J97A 1WYGA 8ICEA 4PGYA 8ICSA 1BPXA 1K5OA 3BQ7A 1NKCA 3DDHA 5KFMA 3KKAC 1WWVA 3HX0A 2CPRA 2H3VA 2P6UA 4MEYA 5JU5A 2KFZA 2KMDA 2PXIA 3NS1A 4FZNA 1DRGA 2DPIA 5J8YC 5G5HA 3KZIU 3WK6A 3BQ1A 5C5JA 5KFZA 1L3TA 3RJIA 4MFFA 2VANA 4YMMA 1Z00A 1ZQIA 3AM9A 1MA7A 1AQ6A 3ZDDA 1FFUA 1F0MA 3EWAA 4ZH4A 4QIWC 4P4PA 2P35A 3TKAA 2HW3A 4LZGA 2RQ5A 9ICBA 2WF9A 3TACB 3BZKA 4B9NA 5J2JA 1L3SA 3BS7A 1PZNA 2KP7A 4RT3A 1ZQCA 4DFDA 9ICIA 4UAYA 1TAUA 4ACOA 3FM9A 5J0OA 2BZFA 4MEXA 1C7YA 2ZUCA 3VC8A 3C2MA 3MR5A 8ICWA 1ZD2P 2DKZA 5KFYA 2K60A 3ONNA 1ZOLA 3QNMA 2HDOA 2WTFA 4FZMA 1ZQXA 1FFVA 3I1YA 2WF7A 2KD1A 2KSOB 1NZBA 3O0FA 3T3FA 2E1EA 2BGWA 4BXOA 3KHHA 5HMMA 4Q45A 4U6PA 4EEKA 1UPHA 1KN5A 3CYMA 2K4HA 8ICCA 2ZTEA 3NVYA 1XNSA 3GQCA 5CR0A 2MAXA 5ALHA 4QWBA 2OXOA 5KFGA 2BKEA 2E8NA 4GXIA 3RR8A 5ALWA 3H8SA 4KLHA 1S0MA 5ALKA 5KFWA 5DDMA 1U9LA 3RJGA 9ICNA 4K4GA 3OHBA 1J2MA 4ECXA 4FO6A 3HKZC 5AIAA 3KHRA 3SV4A 5CA7A 4O3OA 3RAXA 4BWMA 4M47A 4KLIA 4ED8A 1XSLA 1LB2B 4C7YA 5DG9A 7ICLA 3GFKB 1UA0A 2RHFA 1L7NA 3RTVA 5ALPA 3LVVA 5AM4A 5EE1A 1O03A 3D6JA 5J2EA 5J0SA 5J0XA 3FAHA 1ZQLA 1JXEA 3V72A 1K1SA 1TKDA 3C1YA 4I2FA 4NLBA 5J2AA 3JPSA 4OJ6A 5D46A 1GO3F 5KFQA 1BVSA 9ICJA 3QEBZ 5AKEA 3AL0B 4UAVA 4GLXA 4KN4A 1ZRNA 2ISPA 4DL3A 5HNKA 1SB3C 5KG0A 4IL6U 2HMXA 1NJXA 4KLFA 4ECWA 2KHQA 2W9BB 2KTQA 3LYSA 3ZDAA 1KW4A 2ZXIA 1X40A 4ECZA 4DOCA 4P4OA 5KFBA 1Z4OA 1N62A 2VIXA 3EPIA 3T5JA 2WF5A 3J81j 5CHGA 2YN4A 4F93B 3C29A 4KLJA 4OO1J 1DK3A 1YZ7A 3KOOA 4DQQA 4RUAA 4UARA 4O3NA 5DGBA 4YR0A 2KNJA 2A3VA 2R8GA 3PSTA 4NLCA 1Q46A 5KFRA 2JHDA 1YT3A 2HSZA 4DFKA 4DQSA 2DF4B 3UMCA 2HOFA 2JRZA 5AI6A 1Z00B 4JV0A 5AIBA 7ICMA 2YMPA 5EWGA 1MQ2A 4QZCA 1DXSA 4O3QA 2B0CA 5EE0A 2DUYA 2EZYA 3A0BU 4DEZA 5KG7A 3QX7A 3PR5B 3SV3A 5J2BA 4CGZA 2F2AB 4I2JA 2BPCA 3LVWA 4G3IA 5IIOA 5DG7A 3Q8MA 4DL7A 2ALZA 2GWSA 2DGZA 8ICQA 5ALXA 3JPNA 4NLKA 4MFAA 2BR0A 1ZQJA 1SL2A 1ZQNA 5IIIA 4UB2A 1U4BA 5ALOA 3RJJA 2ZTCA 5KFEA 5J2HA 4B9UA 1QQ7A 4DOBA 3NTUA 5ALDA 1IM4A 2HBJA 2ZJ5A 1L7PA 4I2EA 5AKHA 1VDVA 1ZRMA 4Z6DA 3SMVA 1FO4A 4UAZA 3H40A 2ZIUA 4BUGA 3PY8A 3WU2U 5KL1B 5CJ7A 3IP4B 4C80A 4KLGA 2W7OA 4NY8A 1KRPA 3N28A 2G09A 2CN1A 3Q8LA 3SR6A 4AP9A 2Y0SC 5KFKA 2QB0A 1KFSA 1X66A 1JROA 1NK0A 4P0QA 1UA1A 3C1ZA 4Q44A 3DV9A 1NJWA 1S10A 4P2HA 1TFRA 1ZYQA 4TQRA 1XSPA 9ICEA 4IS7A 1QQ5A 3IG5A 4HAIA 2HHQA 5KFXA 3C21A 5AKIA 2JXJA 4GXJA 4RQ4A 1P7DA 1L8OA 1BNOA 5AKYA 4C4RA 2QB1A 1ZQHA 4O3RA 2XC9A 2NO5A 4B9SA 3MBYA 8ICYA 1YZ6A 3L4PA 2DWQA 2W9CA 3V7LA 2ZJAA 3ZI4A 4EYIB 5KFIA 3OSNA 3M8RA 9ICWA 2KEYA 3G6YA 4YFKA 2HVIA 7ICQA 2Z7JA 2VA3A 8ICUA 3IHQB 4C8MA 2DL0A 4UB1A 4M9NA 1A6SA 3N97B 1ZQPA 1KL9A 4FZLA 4IR1A 2UVUA 3ORYA 3WK4A 1B43A 4EELA 3PX6A 3RB0A 2G0AA 4JUZA 1ZQBA 1TK0A 4CDGA 3UMBA 4DO9A 4KLSA 2AQ4A 3EW9A 5KG6A 5DBAA 2ESEA 2M0NA 1L7OA 3PX4A 3DEEA 3D2SA 4ELVA 4F3OA 4F4YA 1S0OA 4I2BA 3ZDBA 4ED0A 2KJ5A 3RFAA 3WK8A 1JXLA 5KFJA 5AI8A 4OJPA 3M6ZA 3H0LB 3PR4A 4GC6A 3GV7B 1UCVA 3QUQA 5KT5A 5KG4A 2DFLA 1TAMA 5K4LA 2BCRA 3SAGA 2JZBA 2K4EA 2W55A 2I9GA 4ECYA 5EWEA 2Y0SF 5AKXA 5CEHA 4M9GA 4OJOA 5EWFA 4ECSA 4CRXA 1RQLA 3V7KA 5DB7A 8ICNA 2W3RA 2DQNB 5KTQA 3QU9A 1TK8A 2W04A 1WWUA 4KLUA 4R65A 1O08A 3TARA 1RZTA 1RYRA 1ZQKA 4O0IA 2JH1A 4OJLA 5AM3A 1QTMA 5ALYA 4F5OA 4KLQA 1NKEA 2AH5A 2QLTA 1LKYA 5ALQA 2XI9A 5KFVA 2EH9A 2P6RA 3NVVA 2ZIXA
chains in the Genus database with same CATH topology
3LVWA 2MRLA 3H0RB 1Z1BA 5CRXA 2ZIWB 3NUQA 3F2CA 4P0QB 2Z7JA 2WAQC 4NLBA 4U7CA 2JGAA 3PSIA 2DGZA 2E1FA 2H3QA 2RRDA 3CP8A 4KX3A 4ACOA 2LBOA 1F44A 1A6SA 4OJ6A 4PL1A 2K4IA 2OH2A 4FZLA 2W03A 5C0YA 3H0MB 3VC8A 2CRXA 4FE3A 4BJQA 4WJ3B 1GO3F 3IN5A 1XO0A 4O3MA 3KFUF 4A8EA 2G0AA 2LHTA 2HBKA 3E0FA 3N7RC 2MA1A 2ZIUB 3ONNA 4AYBC 4QJFB 1Q3UA 2F77X 3RF9A 3PSFA 2F8LA 2KICA 2G5HB 1Q3VA 2KVCA 1KBUA 3AL0B 2VJ4A 4FZMA 4CDGA 2KJ8A 4OJ5A 5T14A 1CRXA 3F5AA 2YB4A 4QNLA 3T79A 2YX8A 3MGVA 2K89A 1HEKA 2OM6A 2KKVA 2KD1A 4C0ZA 2HBJA 2HMXA 2G08A 2JH7A 2KV2A 2M0NA 2WB1F 2XICA 3GZFA 3F5EA 1OUQA 2HOIA 2KHQA 3CRXA 1NZBA 3DEEA 3LYSA 3O0FA 2K8CB 3F2BA 2H3FA 3K1ZA 3SMVA 3SAFA 3HKZF 2ZXIA 2E1EA 2HBLA 2ZG6A 3AQEA 3PSPA 2OYYA 4QIWF 2ZIUA 2VIXA 3GU3A 1D8BA 1A0PA 2KJ5A 3F53A 3RFAA 2G07A 4BUGA 2G06A 2VKQA 3SAHA 3PZPA 4BX9C 1ZQ1C 5KL1B 3M6KA 3D2NA 2XIDA 3IP4B 4OJPA 4U6PA 4GFJA 3M6ZA 1UPHA 2LYAA 3H0LB 1IIPA 1PVPA 3N7PD 3C29A 3OPXA 4OO1J 2W7PA 3NRWA 2W7OA 2PMZF 3CYMA 2G09A 2K4HA 3SQIA 2CN1A 1PVQA 2H3ZA 2XVTA 2Y0SC 5HR7A 3ALRA 1XNSA 3ICXA 2D6FC 2H3IA 2VJ5A 2K8AA 5HR6A 1TAMA 2LKYA 2OXOA 2KNJA 4P0QA 2A3VA 2ZIWA 3SAGA 3PSTA 2K4EA 4IC9A 3F2DA 1Z19A 2LYBA 2RP5A 2CPRA 2H3VA 2KOBA 2Y0SF 3IG5A 4NLCA 4KX5A 3D2QA 4FZNA 3L3FX 4OJOA 1DRGA 2JHDA 2ZIXB 3D2SA 2F76X 1YT3A 4CRXA 4P0PB 2KHVA 2PMZC 2WB1C 3HKZC 1L6NA 2R18A 2G5IB 3KZXA 2DQNB 3VCBA 2DF4B 4AYBF 2W04A 4PL2A 4KMOB 3C28A 2ZIVB 4JMUA 1P7DA 2HOFA 2WAQF 1HIWA 2ZXHA 3M7DA 2ZIVA 3IG8A 3AQFA 5A0LA 2E5SA 2GH1A 2K8BB 1MA7A 2JH1A 4NWIA 2KKPA 4NV0A 1ECWA 4OJLA 1WUDA 2NV3A 2YB1A 4QIWC 5KL8B 2HOQA 2RHFA 2JMGA 2HBMA 2GOLA 2KIWA 2KJ9A 3LVVA 1ED1A 2BDUA 1PVRA 2XI9A 1SZHA 4CGZA 3N7SC 2F2AB 2KEYA 2Q4TA 1URJA 4P0PA 2N1RA 1T94A 2ZIXA 4ICAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6N A;  2K4H A;  1HEK A;  2H3Z A;  4JMU A;  2HMX A;  2H3I A;  2H3Q A;  1HIW A;  1A6S A;  1TAM A;  2K4I A;  1ECW A;  2H3F A;  2NV3 A;  4IC9 A;  2K4E A;  2JMG A;  2LYB A;  2GOL A;  2H3V A;  1ED1 A;  2N1R A;  1UPH A;  2LYA A;  4ICA A; 
#chains in the Genus database with same CATH topology
 3NGD A;  2PI4 A;  2KVS A;  1SKS A;  1FIQ A;  2OH2 A;  4RQ1 A;  5J2C A;  1S97 A;  5HP4 A;  5DBC A;  1KDH A;  2JEJ A;  1FEZ A;  3KFU F;  4A8E A;  5AK3 A;  3WKC A;  4F91 B;  3WKD A;  1LVH A;  2KIV A;  3R9K A;  4OJ5 A;  3KKA A;  3F5A A;  3MGV A;  4IR9 A;  1IV8 A;  3QZ8 A;  2W8L A;  4KTQ A;  1OUQ A;  1KEJ A;  3FYH A;  4M9H A;  5J8Y A;  1Q8K A;  4Y2P A;  2W8K A;  9ICC A;  7ICP A;  1SKR A;  4US8 A;  1NK9 A;  3BS5 A;  1ZQR A;  3ISC A;  9ICV A;  2HHX A;  5HML A;  1XWL A;  2R8H A;  3MDA A;  4BGD A;  1WCN A;  2XID A;  3U26 A;  4GIB A;  1BPZ A;  3RJH A;  4ZOH C;  1NI3 A;  1TE2 A;  2H3Z A;  3M8S A;  4UAW A;  8ICF A;  5AM5 A;  4Y2Y A;  5BOM A;  4QWE A;  5HR6 A;  4YXM A;  3AU2 A;  5KAF U;  1J2N A;  2XY6 A;  2DPJ A;  4IQT A;  1PK1 A;  2F44 A;  3K75 D;  4Z6E A;  2BCU A;  3MR2 A;  2ZUD A;  3ED5 A;  2FLL A;  3GV5 B;  1XSN A;  4NJ8 A;  8ICO A;  2IOF A;  5KG3 A;  3QUC A;  4I28 A;  2PMZ C;  5ALT A;  1XO1 A;  1X6J A;  3NAS A;  1PK3 A;  5KT3 A;  3C5F A;  1TVA A;  5AKG A;  4KIT B;  5A0L A;  4ED1 A;  4YG2 A;  4NV0 A;  2MSN A;  3MFH A;  1SZP A;  5ALL A;  4UB4 A;  4JV1 A;  3KHL A;  1CEZ A;  2FMQ A;  1URJ A;  3JPT A;  5AK5 A;  1RG6 A;  4RU9 A;  2MRL A;  4DLG A;  5KFN A;  3NUQ A;  5DB8 A;  3PW7 A;  1JRP A;  2AU0 A;  3RR7 A;  4PGX A;  3JPR A;  3KD3 A;  4MHV A;  5KT6 A;  1UHU A;  2EAM A;  2LHT A;  1Q3U A;  2W11 A;  3GV8 B;  4Y2Q A;  2M9N A;  4BXO B;  2XGP A;  1RYU A;  4DCC A;  4F71 A;  9ICT A;  2CXY A;  2XIC A;  3F5E A;  1RQN A;  4K4H A;  4O5K A;  3M9O B;  5AI0 A;  5AKL A;  3PSP A;  3I28 A;  1JIH A;  2W3S A;  3ZDC A;  2LM1 A;  2JEF A;  2OHF A;  2LYA A;  1PVP A;  3UQ2 A;  1SWV A;  4KN7 A;  2W9M A;  1MN8 A;  4DFJ A;  2EDU A;  3PW2 A;  3F2D A;  3SEI A;  3PW5 A;  2LYB A;  3H4B A;  4KX5 A;  1NKB A;  1S77 D;  4B9T A;  4J9Q A;  3SZ2 A;  5AKK A;  3PW4 A;  1L6N A;  1M6Y A;  2W9C B;  1HIW A;  2BPG A;  2WHE A;  5B5E U;  3KTQ A;  2UVV A;  1X9X A;  3M1Y A;  1WUD A;  2FPM A;  5AM0 A;  4PPX A;  4DS4 A;  9ICO A;  4IRD A;  1TAQ A;  3UXP A;  2KJ9 A;  1OXJ A;  3T5K A;  1PVR A;  2BDU A;  4Y2R A;  9ICA A;  1V9P A;  2Q4T A;  5KNI A;  5EE9 A;  1U47 A;  1MC8 A;  1QQ6 A;  3BDP A;  5AK6 A;  2RLT A;  2NRZ A;  1T3N A;  2QB0 B;  2ZTD A;  1X9S A;  1BPE A;  4F5Q A;  1SGG A;  2AXT U;  4RZR A;  2XGQ A;  1NJZ A;  2Y9T A;  5DQG A;  1Y88 A;  4YVZ A;  1V97 A;  4JV2 A;  2HBK A;  1SIJ A;  1BPY A;  4MF2 A;  3GDX A;  2ZIU B;  4ED3 A;  3RF9 A;  5KT7 A;  2F8L A;  9ICQ A;  2FE9 A;  2FLN A;  2PFN A;  2AGQ A;  2FPL A;  3EPG A;  2OM6 A;  1H38 A;  2C2E A;  4DSI A;  4TUP A;  4NLZ A;  3HIL A;  1PUZ A;  4UAU A;  4UB8 U;  4EX6 A;  3HPO A;  4HYK A;  3SAF A;  2B6G A;  3T5H A;  1KFD A;  2EAN A;  4J9K A;  2JEI A;  5KG5 A;  5KAI U;  2Y1I A;  5AK4 A;  4M2Y A;  1JUD A;  5ALI A;  1NK4 A;  4Z6F A;  4ED7 A;  2C2D A;  1EXN A;  4QZG A;  7ICT A;  5L1L A;  7ICG A;  1A76 A;  4EYH B;  1Z19 A;  1D9D A;  3QUB A;  2YTU A;  3TAD A;  5DDY A;  1Z4N A;  4R8U B;  1S5L U;  5CB1 A;  4EZ9 A;  8ICB A;  1L8L A;  1QH9 A;  1B0X A;  3AN1 A;  3K4G A;  1L5U A;  5GTI U;  1ARO P;  4KLT A;  1A77 A;  3AUO A;  1NNL A;  2HOQ A;  3Q8P B;  1NOM A;  1ED1 A;  2R8I A;  2KG5 A;  4C8K A;  9ICL A;  5KFH A;  1X9M A;  3LDA A;  3JPQ A;  2H5X A;  4U7C A;  4IQW A;  3NRZ A;  4YR2 A;  1D8Y A;  5C0Y A;  1X42 A;  4BJQ A;  3PX0 A;  4RQ3 A;  1B4F A;  3I76 A;  2FMS A;  4JK1 A;  4TUQ A;  4I2A A;  3M9M B;  3RH6 A;  3EUB 2;  3RH5 A;  4F2R A;  3PSF A;  2E8P A;  9ICR A;  5KFC A;  4MFC A;  4QWA A;  2KKV A;  3PO5 A;  1JX4 A;  4C0Z A;  4YQW A;  2JH7 A;  3BS5 B;  1SXD A;  2J6S A;  2NRV A;  2H3F A;  2HBL A;  2ZG6 A;  5DLF A;  2DBY A;  1KLN A;  2KSO A;  3CW2 C;  4F4K A;  3PV8 A;  4GFJ A;  1IIP A;  1ZQY A;  2JV3 A;  2W7P A;  2LPE A;  4DQI A;  1ZQU A;  2VJ5 A;  2D6F C;  4IQU A;  3ISD A;  4DL4 A;  2VA8 A;  2R8J A;  5KFF A;  3BZC A;  2LYH A;  2MUT B;  5EOZ A;  2MU2 A;  3TAN A;  2PFO A;  3B0X A;  3H8W A;  4EEY A;  3BQT A;  3QU7 A;  4PZO A;  2G5I B;  1CUK A;  2QAR A;  5KL8 B;  2QAR B;  5KG2 A;  1S0V A;  5BPC A;  4RQM A;  1X2I A;  1SZH A;  5KFO A;  4C8N A;  1PK1 B;  1SL0 A;  4P0P A;  3B9J A;  3TFS A;  1D9F A;  3H0R B;  5CRX A;  1C20 A;  2WAQ C;  4NXZ A;  1WG8 A;  1ZJN A;  1KQQ A;  2LBO A;  3WK5 A;  2K4I A;  2F1J A;  4DF4 A;  3IDW A;  2BQR A;  1QSY A;  3LWL A;  2D3D A;  3HW8 A;  8ICT A;  3E0F A;  5L1M A;  5DQI A;  5AKZ A;  2BCQ A;  8ICL A;  1ZQW A;  4FS2 A;  2W9B A;  4IRK A;  2E3T A;  2G08 A;  2NRW A;  1U49 A;  2WB1 F;  9ICU A;  5J0T A;  4Y2T A;  3F2B A;  4RPX A;  3HKZ F;  3NVZ A;  5AI5 A;  3MFI A;  3AQE A;  5D4B A;  4RPZ A;  1N5W A;  1JMS A;  3GU3 A;  3Q8K A;  3AU6 A;  3AMZ A;  4C4T A;  1RM6 C;  2G07 A;  1IG6 A;  1ZQ1 C;  4DL6 A;  3TFR A;  2C2R A;  3WK7 A;  3QU4 A;  3LK9 A;  4NL9 C;  2PMZ F;  1ZXI A;  2XVT A;  5HR7 A;  1S76 D;  2Q0Z X;  3UMG A;  3RB3 A;  5JRT A;  4J9N A;  4YP3 A;  3MGH A;  2KZM A;  5J0R A;  4TUS A;  2I5H A;  1QSS A;  2C28 A;  4YXJ A;  2RP5 A;  5ALS A;  2ODG A;  5ALF A;  1LKY B;  2ASL A;  2ZIX B;  5KFP A;  2F76 X;  2EQY A;  1L3U A;  4ED6 A;  2R18 A;  4DSL A;  4O5C A;  8ICZ A;  4Y2S A;  2YMM A;  3G6V A;  4F8R A;  4NL9 A;  3ZDE A;  4EBE A;  4KMU A;  1ECW A;  2ES6 A;  4Q43 A;  5F9L A;  5KG1 A;  5J2D A;  3FDS A;  2W9A A;  4CE6 A;  1ZQQ A;  2AJQ A;  2ASD A;  4PHD A;  3HP6 A;  2IBK A;  5KT2 A;  1Z1B A;  1T7P A;  4I2C A;  5J0U A;  2OWO A;  4QWC A;  4KX3 A;  2MUT A;  2HHU A;  3GIL A;  4DF8 A;  2WF6 A;  2V9W A;  2W03 A;  4IQV A;  4I2D A;  3IV6 A;  2BHN A;  2NO4 A;  5IIK A;  3OJS A;  2E8M A;  3EZ5 A;  3IRU A;  2A1J B;  1T8E A;  4QNL A;  2YX8 A;  4BWJ A;  1SKW A;  1TV9 A;  1SV4 A;  4J9O A;  7ICF A;  4K4I A;  2I1Q A;  1ZQS A;  3C5G A;  8ICH A;  2FPK A;  2GLE A;  2KFN A;  4DQR A;  4YMO A;  5J2I A;  3PZP A;  2VKQ A;  3SAH A;  1XC9 A;  3M6K A;  5B66 U;  4RUC A;  5L9X A;  2D8C A;  3NRW A;  2HHS A;  3SQI A;  7ICE A;  1ZD4 A;  4I29 A;  5AIC A;  4DSJ A;  1U45 A;  1T4G A;  4B9L A;  1X6I A;  2OCE A;  4QZ9 A;  2ZIW A;  5AHX A;  4JWM A;  2YMQ A;  4USA A;  3QXG A;  4O5E A;  4Y2J A;  9ICH A;  1K1Q A;  2XO7 A;  4BDP A;  1LV5 A;  3WKA A;  9ICM A;  2KHV A;  2WB1 C;  8ICK A;  1ZD5 A;  5E79 U;  3JPO A;  4QZI A;  2ISO A;  3ETL A;  4AYB F;  3TAP A;  3UXN A;  4I2G A;  3H7I A;  2K8B B;  4UW9 A;  2KKP A;  4I2H A;  2IOF K;  4F5P A;  2HCF A;  5H2F U;  2KIW A;  5DB6 A;  3QUT A;  4J03 A;  4PHE A;  2V4Q A;  3GIM A;  2IHN A;  1NZP A;  1CI4 A;  2RRD A;  3CP8 A;  3AEV A;  3QYP A;  3GII A;  3H0M B;  2I6X A;  4FE3 A;  4RQN A;  3RB4 A;  4FS1 A;  1RDF A;  4ECT A;  2FDR A;  1B22 A;  4QJF B;  4QZA A;  5ALU A;  3V7J A;  4JB3 A;  1NK7 A;  1KBU A;  5AKJ A;  3RRH A;  2YB4 A;  1ZQF A;  2K89 A;  4TUR A;  2HHV A;  1ZQV A;  2EZX A;  1UT8 A;  2NYV A;  4C7Z A;  2AGO A;  2O6K A;  4Q8F A;  5DKW A;  4RQ0 A;  1UQV A;  2F1I A;  3OHA A;  3JPP A;  4F72 A;  2QKQ A;  3OPX A;  4NM1 A;  5J2F A;  3S6J A;  4J9R A;  2H3I A;  2K8A A;  2E8O A;  1KKX A;  4R66 A;  2EAO A;  3PVX A;  1BGX T;  2ZUB A;  4RQ5 A;  2RDI A;  4F50 A;  1JN3 A;  2BPF A;  3TAQ A;  2HHT A;  4FFD A;  4ELU A;  2KN7 A;  4PH5 A;  1IXR A;  4I2I A;  3RBE A;  4JMU A;  3M7D A;  2ZIV A;  3IG8 A;  5ALE A;  2XY7 A;  4DFM A;  1SV0 A;  7ICU A;  4R8U A;  2HBM A;  4R63 A;  4QZB A;  2UVW A;  3SEN A;  3N4M B;  3L5K A;  2HVH A;  2F8K A;  4FBT A;  4CCH A;  5ALR A;  1Z3E B;  4EBD A;  5KFA A;  3E58 A;  5BOL A;  2ZIW B;  3GIJ A;  4PJ0 U;  1ZQD A;  1COO A;  3PSI A;  2H3Q A;  1COK A;  4YD1 A;  4PL1 A;  1SV0 C;  3LWM A;  1JI7 A;  1NK6 A;  1L3V A;  4AYB C;  4RNN A;  5DG8 A;  2G5H B;  8ICV A;  2XY5 A;  5T14 A;  3B0Y A;  2HI0 A;  4DL2 A;  2YML A;  2W43 A;  5J0Q A;  4CF3 A;  4CF5 A;  2OYY A;  4R64 A;  1A0P A;  3F53 A;  4US9 A;  2G06 A;  4BX9 C;  2A1J A;  3UQ0 A;  8ICJ A;  5IIN A;  4YCX A;  3RJK A;  4XRH A;  3WKE A;  1QSL A;  4DWI A;  3GIK A;  4B9M A;  4ECQ A;  2JEG A;  3V6J A;  3ICX A;  5FP0 A;  4P4M A;  3MR3 A;  2LKY A;  4RQ8 A;  3OJU A;  3RJF A;  2GO7 A;  4KLM A;  1RYS A;  3PNC A;  3ETR A;  4DFP A;  2BDP A;  1ZQZ A;  4J9S A;  1DOQ A;  7ICR A;  8ICM A;  4LJX A;  3ISB A;  4UB6 U;  3QZ7 A;  5J0Y A;  3H8M A;  2IMW P;  8ICR A;  3BJY A;  4M9J A;  3UXO A;  7ICV A;  4J9M A;  3RH4 A;  4PL2 A;  4KLD A;  2XCP A;  1WCL A;  2LI6 A;  2WAQ F;  2ZXH A;  4C8O A;  2PFQ A;  3H4D A;  2NV3 A;  2LMR A;  5HHI A;  3SYZ A;  4UQG A;  2FMP A;  1N63 A;  1ZQA A;  7ICK A;  2J6T A;  2AHO B;  4UBB A;  4QW9 A;  1QLN A;  4GC7 A;  5AI9 A;  5TIS U;  5F9N A;  2E1F A;  3WK9 A;  4Y2V A;  4PGQ A;  1VLB A;  1TK5 A;  1ZD3 A;  1XO0 A;  4LVS A;  4M0A A;  3HRD D;  4JWN A;  4Y2X A;  2KE7 A;  2F77 X;  2YQE A;  4UB3 A;  4DOA A;  2DKX A;  3T79 A;  4Y2U A;  5IIJ A;  3GZF A;  1XS9 D;  5GTH U;  7ICJ A;  4QZD A;  1ZQE A;  4QZF A;  3K1Z A;  3TQ1 A;  4I27 A;  4QIW F;  3SD7 A;  4E0D A;  4Z6C A;  2BQ3 A;  1NJY A;  1QCK A;  3BQ0 A;  4RPY A;  3N7P D;  2OEH A;  1PVQ A;  7ICN A;  5DQH A;  3WKB A;  4TQS A;  4DQP A;  5J29 A;  2ASJ A;  2BQU A;  4NM2 A;  4F5R A;  5DB9 A;  2PKE A;  2Y9U A;  5KFL A;  5ALZ A;  3MR6 A;  3BQ2 A;  4YN4 A;  1RPL A;  1DGS A;  5AM1 A;  4P0P B;  4QW8 A;  4RNO A;  4B6J A;  2C22 A;  1ZQT A;  3AQF A;  4PHA A;  9ICX A;  8ICG A;  7ICO A;  4Q8E A;  3OTQ A;  2JMG A;  5DLG A;  5AI4 A;  5CP2 A;  1UT5 A;  4OCZ A;  4F4X A;  1SL1 A;  2BCS A;  1V38 A;  1SWW A;  5JUM A;  3D2Q A;  5L1I A;  3FC4 A;  3ZD8 A;  2LM4 A;  4LZD A;  5JTI A;  1N61 A;  1F44 A;  4FBU A;  3TI0 A;  2K4P A;  3T5L A;  1N2X A;  2JZB B;  4XA5 A;  4F5N A;  3RB6 A;  1ZJM A;  3UM9 A;  8ICI A;  4UAS A;  4YD2 A;  2W54 A;  3Q8R B;  2KZ3 A;  2V4R A;  5ALG A;  3V6K A;  2KIC A;  9ICK A;  3PML A;  2VJ4 A;  2VA2 A;  4EX7 A;  4KLL A;  3NVW A;  5KFU A;  2HHW A;  1HEK A;  3HT3 A;  2EZZ A;  3HWT A;  5ALV A;  1ZET A;  2KV2 A;  5ALM A;  5KFD A;  3ZD9 A;  4G9B A;  3QE9 Y;  2IA6 A;  2JR5 A;  5CWR A;  5J0P A;  3Q8S B;  5IIL A;  4EEN A;  4QWD A;  9ICF A;  1DK2 A;  3THV A;  3D2N A;  1HUZ A;  4UBC A;  4QZ8 A;  9ICS A;  3QEA Z;  3ALR A;  3MC1 A;  2AGP A;  2PI5 A;  4CF4 A;  3MDC A;  1D8L A;  1S8O A;  4IC9 A;  4O9M A;  4PHP A;  1BPD A;  4M6W B;  2P66 A;  1ZQM A;  1V85 A;  4ELT A;  5G5G A;  3EYZ A;  3L3F X;  4UB5 A;  1XU4 A;  3RAQ A;  4DL5 A;  3QU2 A;  1RXW A;  5J2G A;  1N5X A;  2AQ0 A;  5ALJ A;  2GH1 A;  1S9F A;  4NWI A;  1Z1V A;  5J2K A;  2F3N A;  1N48 A;  4DSF A;  2YB1 A;  4UAT A;  1HUO A;  2L5Y A;  4NLN A;  2GOL A;  4DSK A;  1KTQ A;  4KLO A;  9ICP A;  2FI1 A;  1BNP A;  2B21 A;  3RJE A;  1T94 A;  4J9P A;  3OSP A;  4DLE A;  3QU5 A;  3F2C A;  2RDJ A;  9ICG A;  2JGA A;  3A0H U;  1VJ5 A;  5KFS A;  3CNH A;  2BCV A;  2NRX A;  4RQ7 A;  5L1J A;  1MSW D;  1SXE A;  4O3M A;  4M9L A;  2R8K A;  2NRT A;  2Y1J A;  5KT4 A;  3N7R C;  4EBC A;  4X5V A;  3UPQ A;  5DGA A;  3RBD A;  1N60 A;  1CRX A;  5AM2 A;  4QZH A;  1HJP A;  2HOI A;  3MGI A;  7ICI A;  3CRX A;  3KBB A;  1L7M A;  3M9N B;  4YR3 A;  4DS5 A;  1RXV A;  1ZQG A;  3OGU A;  3KHG A;  4C4S A;  1OW5 A;  1D8B A;  8ICA A;  2IHM A;  2FLP A;  2WF8 A;  4F4W A;  5F3X B;  1JAL A;  5J0W A;  4ECU A;  2YY6 A;  3C2K A;  2KK0 A;  2ZJ8 A;  3PMN A;  1X9W A;  1F5S A;  3C23 A;  2FJ6 A;  2KZZ A;  5EE3 A;  3Q8Q B;  1S0N A;  3PO4 A;  5ALN A;  2A19 A;  1BPB A;  4M04 A;  4J9L A;  5KFT A;  2KOB A;  4GXK A;  4YMN A;  2ATL A;  2XCA A;  4ECR A;  4EZ6 A;  3RRG A;  3KZX A;  3VCB A;  4OD0 A;  3C28 A;  4KMO B;  5IIM A;  2ZIV B;  1NK5 A;  3SI8 A;  2E5S A;  3H8J A;  4XQ8 A;  4QZE A;  2PFP A;  2WFA A;  5D49 A;  3C2L A;  3K1R B;  3N7S C;  7ICH A;  1DGJ A;  2N1R A;  4O3P A;  4ICA A;  2UVR A;  4ED2 A;  4DSE A;  3G6X A;  1T3Q A;  3IM1 A;  4P0Q B;  4MF8 A;  4M6W A;  5HHH A;  3TAD C;  3HJE A;  1ZQO A;  1U48 A;  4O3S A;  5DBB A;  4C8L A;  3PW0 A;  2CRX A;  4WJ3 B;  4CNQ A;  3IN5 A;  2EAP A;  4RQ2 A;  5L1K A;  7ICS A;  4NLG A;  3V6H A;  1KFT A;  2MA1 A;  1Q3V A;  4KLE A;  1N56 A;  2KVC A;  2KJ8 A;  4F92 B;  1KSP A;  4IRC A;  1NK8 A;  2A1A A;  2J6U A;  4RNM A;  4XUS A;  8ICX A;  8ICP A;  2K8C B;  1MQ3 A;  2F1H A;  4PZN A;  3E2E A;  4B9V A;  4F2S A;  4F4Z A;  5TZV A;  4RQ6 A;  3MAB A;  4RT2 A;  2IOH A;  4ECV A;  1J97 A;  1WYG A;  8ICE A;  4PGY A;  8ICS A;  1BPX A;  1K5O A;  3BQ7 A;  1NKC A;  3DDH A;  5KFM A;  3KKA C;  1WWV A;  3HX0 A;  2CPR A;  2H3V A;  2P6U A;  4MEY A;  5JU5 A;  2KFZ A;  2KMD A;  2PXI A;  3NS1 A;  4FZN A;  1DRG A;  2DPI A;  5J8Y C;  5G5H A;  3KZI U;  3WK6 A;  3BQ1 A;  5C5J A;  5KFZ A;  1L3T A;  3RJI A;  4MFF A;  2VAN A;  4YMM A;  1Z00 A;  1ZQI A;  3AM9 A;  1MA7 A;  1AQ6 A;  3ZDD A;  1FFU A;  1F0M A;  3EWA A;  4ZH4 A;  4QIW C;  4P4P A;  2P35 A;  3TKA A;  2HW3 A;  4LZG A;  2RQ5 A;  9ICB A;  2WF9 A;  3TAC B;  3BZK A;  4B9N A;  5J2J A;  1L3S A;  3BS7 A;  1PZN A;  2KP7 A;  4RT3 A;  1ZQC A;  4DFD A;  9ICI A;  4UAY A;  1TAU A;  4ACO A;  3FM9 A;  5J0O A;  2BZF A;  4MEX A;  1C7Y A;  2ZUC A;  3VC8 A;  3C2M A;  3MR5 A;  8ICW A;  1ZD2 P;  2DKZ A;  5KFY A;  2K60 A;  3ONN A;  1ZOL A;  3QNM A;  2HDO A;  2WTF A;  4FZM A;  1ZQX A;  1FFV A;  3I1Y A;  2WF7 A;  2KD1 A;  2KSO B;  1NZB A;  3O0F A;  3T3F A;  2E1E A;  2BGW A;  4BXO A;  3KHH A;  5HMM A;  4Q45 A;  4U6P A;  4EEK A;  1UPH A;  1KN5 A;  3CYM A;  2K4H A;  8ICC A;  2ZTE A;  3NVY A;  1XNS A;  3GQC A;  5CR0 A;  2MAX A;  5ALH A;  4QWB A;  2OXO A;  5KFG A;  2BKE A;  2E8N A;  4GXI A;  3RR8 A;  5ALW A;  3H8S A;  4KLH A;  1S0M A;  5ALK A;  5KFW A;  5DDM A;  1U9L A;  3RJG A;  9ICN A;  4K4G A;  3OHB A;  1J2M A;  4ECX A;  4FO6 A;  3HKZ C;  5AIA A;  3KHR A;  3SV4 A;  5CA7 A;  4O3O A;  3RAX A;  4BWM A;  4M47 A;  4KLI A;  4ED8 A;  1XSL A;  1LB2 B;  4C7Y A;  5DG9 A;  7ICL A;  3GFK B;  1UA0 A;  2RHF A;  1L7N A;  3RTV A;  5ALP A;  3LVV A;  5AM4 A;  5EE1 A;  1O03 A;  3D6J A;  5J2E A;  5J0S A;  5J0X A;  3FAH A;  1ZQL A;  1JXE A;  3V72 A;  1K1S A;  1TKD A;  3C1Y A;  4I2F A;  4NLB A;  5J2A A;  3JPS A;  4OJ6 A;  5D46 A;  1GO3 F;  5KFQ A;  1BVS A;  9ICJ A;  3QEB Z;  5AKE A;  3AL0 B;  4UAV A;  4GLX A;  4KN4 A;  1ZRN A;  2ISP A;  4DL3 A;  5HNK A;  1SB3 C;  5KG0 A;  4IL6 U;  2HMX A;  1NJX A;  4KLF A;  4ECW A;  2KHQ A;  2W9B B;  2KTQ A;  3LYS A;  3ZDA A;  1KW4 A;  2ZXI A;  1X40 A;  4ECZ A;  4DOC A;  4P4O A;  5KFB A;  1Z4O A;  1N62 A;  2VIX A;  3EPI A;  3T5J A;  2WF5 A;  3J81 j;  5CHG A;  2YN4 A;  4F93 B;  3C29 A;  4KLJ A;  4OO1 J;  1DK3 A;  1YZ7 A;  3KOO A;  4DQQ A;  4RUA A;  4UAR A;  4O3N A;  5DGB A;  4YR0 A;  2KNJ A;  2A3V A;  2R8G A;  3PST A;  4NLC A;  1Q46 A;  5KFR A;  2JHD A;  1YT3 A;  2HSZ A;  4DFK A;  4DQS A;  2DF4 B;  3UMC A;  2HOF A;  2JRZ A;  5AI6 A;  1Z00 B;  4JV0 A;  5AIB A;  7ICM A;  2YMP A;  5EWG A;  1MQ2 A;  4QZC A;  1DXS A;  4O3Q A;  2B0C A;  5EE0 A;  2DUY A;  2EZY A;  3A0B U;  4DEZ A;  5KG7 A;  3QX7 A;  3PR5 B;  3SV3 A;  5J2B A;  4CGZ A;  2F2A B;  4I2J A;  2BPC A;  3LVW A;  4G3I A;  5IIO A;  5DG7 A;  3Q8M A;  4DL7 A;  2ALZ A;  2GWS A;  2DGZ A;  8ICQ A;  5ALX A;  3JPN A;  4NLK A;  4MFA A;  2BR0 A;  1ZQJ A;  1SL2 A;  1ZQN A;  5III A;  4UB2 A;  1U4B A;  5ALO A;  3RJJ A;  2ZTC A;  5KFE A;  5J2H A;  4B9U A;  1QQ7 A;  4DOB A;  3NTU A;  5ALD A;  1IM4 A;  2HBJ A;  2ZJ5 A;  1L7P A;  4I2E A;  5AKH A;  1VDV A;  1ZRM A;  4Z6D A;  3SMV A;  1FO4 A;  4UAZ A;  3H40 A;  2ZIU A;  4BUG A;  3PY8 A;  3WU2 U;  5KL1 B;  5CJ7 A;  3IP4 B;  4C80 A;  4KLG A;  2W7O A;  4NY8 A;  1KRP A;  3N28 A;  2G09 A;  2CN1 A;  3Q8L A;  3SR6 A;  4AP9 A;  2Y0S C;  5KFK A;  2QB0 A;  1KFS A;  1X66 A;  1JRO A;  1NK0 A;  4P0Q A;  1UA1 A;  3C1Z A;  4Q44 A;  3DV9 A;  1NJW A;  1S10 A;  4P2H A;  1TFR A;  1ZYQ A;  4TQR A;  1XSP A;  9ICE A;  4IS7 A;  1QQ5 A;  3IG5 A;  4HAI A;  2HHQ A;  5KFX A;  3C21 A;  5AKI A;  2JXJ A;  4GXJ A;  4RQ4 A;  1P7D A;  1L8O A;  1BNO A;  5AKY A;  4C4R A;  2QB1 A;  1ZQH A;  4O3R A;  2XC9 A;  2NO5 A;  4B9S A;  3MBY A;  8ICY A;  1YZ6 A;  3L4P A;  2DWQ A;  2W9C A;  3V7L A;  2ZJA A;  3ZI4 A;  4EYI B;  5KFI A;  3OSN A;  3M8R A;  9ICW A;  2KEY A;  3G6Y A;  4YFK A;  2HVI A;  7ICQ A;  2Z7J A;  2VA3 A;  8ICU A;  3IHQ B;  4C8M A;  2DL0 A;  4UB1 A;  4M9N A;  1A6S A;  3N97 B;  1ZQP A;  1KL9 A;  4FZL A;  4IR1 A;  2UVU A;  3ORY A;  3WK4 A;  1B43 A;  4EEL A;  3PX6 A;  3RB0 A;  2G0A A;  4JUZ A;  1ZQB A;  1TK0 A;  4CDG A;  3UMB A;  4DO9 A;  4KLS A;  2AQ4 A;  3EW9 A;  5KG6 A;  5DBA A;  2ESE A;  2M0N A;  1L7O A;  3PX4 A;  3DEE A;  3D2S A;  4ELV A;  4F3O A;  4F4Y A;  1S0O A;  4I2B A;  3ZDB A;  4ED0 A;  2KJ5 A;  3RFA A;  3WK8 A;  1JXL A;  5KFJ A;  5AI8 A;  4OJP A;  3M6Z A;  3H0L B;  3PR4 A;  4GC6 A;  3GV7 B;  1UCV A;  3QUQ A;  5KT5 A;  5KG4 A;  2DFL A;  1TAM A;  5K4L A;  2BCR A;  3SAG A;  2JZB A;  2K4E A;  2W55 A;  2I9G A;  4ECY A;  5EWE A;  2Y0S F;  5AKX A;  5CEH A;  4M9G A;  4OJO A;  5EWF A;  4ECS A;  4CRX A;  1RQL A;  3V7K A;  5DB7 A;  8ICN A;  2W3R A;  2DQN B;  5KTQ A;  3QU9 A;  1TK8 A;  2W04 A;  1WWU A;  4KLU A;  4R65 A;  1O08 A;  3TAR A;  1RZT A;  1RYR A;  1ZQK A;  4O0I A;  2JH1 A;  4OJL A;  5AM3 A;  1QTM A;  5ALY A;  4F5O A;  4KLQ A;  1NKE A;  2AH5 A;  2QLT A;  1LKY A;  5ALQ A;  2XI9 A;  5KFV A;  2EH9 A;  2P6R A;  3NVV A;  2ZIX A; 
#chains in the Genus database with same CATH homology
 3LVW A;  2MRL A;  3H0R B;  1Z1B A;  5CRX A;  2ZIW B;  3NUQ A;  3F2C A;  4P0Q B;  2Z7J A;  2WAQ C;  4NLB A;  4U7C A;  2JGA A;  3PSI A;  2DGZ A;  2E1F A;  2H3Q A;  2RRD A;  3CP8 A;  4KX3 A;  4ACO A;  2LBO A;  1F44 A;  1A6S A;  4OJ6 A;  4PL1 A;  2K4I A;  2OH2 A;  4FZL A;  2W03 A;  5C0Y A;  3H0M B;  3VC8 A;  2CRX A;  4FE3 A;  4BJQ A;  4WJ3 B;  1GO3 F;  3IN5 A;  1XO0 A;  4O3M A;  3KFU F;  4A8E A;  2G0A A;  2LHT A;  2HBK A;  3E0F A;  3N7R C;  2MA1 A;  2ZIU B;  3ONN A;  4AYB C;  4QJF B;  1Q3U A;  2F77 X;  3RF9 A;  3PSF A;  2F8L A;  2KIC A;  2G5H B;  1Q3V A;  2KVC A;  1KBU A;  3AL0 B;  2VJ4 A;  4FZM A;  4CDG A;  2KJ8 A;  4OJ5 A;  5T14 A;  1CRX A;  3F5A A;  2YB4 A;  4QNL A;  3T79 A;  2YX8 A;  3MGV A;  2K89 A;  1HEK A;  2OM6 A;  2KKV A;  2KD1 A;  4C0Z A;  2HBJ A;  2HMX A;  2G08 A;  2JH7 A;  2KV2 A;  2M0N A;  2WB1 F;  2XIC A;  3GZF A;  3F5E A;  1OUQ A;  2HOI A;  2KHQ A;  3CRX A;  1NZB A;  3DEE A;  3LYS A;  3O0F A;  2K8C B;  3F2B A;  2H3F A;  3K1Z A;  3SMV A;  3SAF A;  3HKZ F;  2ZXI A;  2E1E A;  2HBL A;  2ZG6 A;  3AQE A;  3PSP A;  2OYY A;  4QIW F;  2ZIU A;  2VIX A;  3GU3 A;  1D8B A;  1A0P A;  2KJ5 A;  3F53 A;  3RFA A;  2G07 A;  4BUG A;  2G06 A;  2VKQ A;  3SAH A;  3PZP A;  4BX9 C;  1ZQ1 C;  5KL1 B;  3M6K A;  3D2N A;  2XID A;  3IP4 B;  4OJP A;  4U6P A;  4GFJ A;  3M6Z A;  1UPH A;  2LYA A;  3H0L B;  1IIP A;  1PVP A;  3N7P D;  3C29 A;  3OPX A;  4OO1 J;  2W7P A;  3NRW A;  2W7O A;  2PMZ F;  3CYM A;  2G09 A;  2K4H A;  3SQI A;  2CN1 A;  1PVQ A;  2H3Z A;  2XVT A;  2Y0S C;  5HR7 A;  3ALR A;  1XNS A;  3ICX A;  2D6F C;  2H3I A;  2VJ5 A;  2K8A A;  5HR6 A;  1TAM A;  2LKY A;  2OXO A;  2KNJ A;  4P0Q A;  2A3V A;  2ZIW A;  3SAG A;  3PST A;  2K4E A;  4IC9 A;  3F2D A;  1Z19 A;  2LYB A;  2RP5 A;  2CPR A;  2H3V A;  2KOB A;  2Y0S F;  3IG5 A;  4NLC A;  4KX5 A;  3D2Q A;  4FZN A;  3L3F X;  4OJO A;  1DRG A;  2JHD A;  2ZIX B;  3D2S A;  2F76 X;  1YT3 A;  4CRX A;  4P0P B;  2KHV A;  2PMZ C;  2WB1 C;  3HKZ C;  1L6N A;  2R18 A;  2G5I B;  3KZX A;  2DQN B;  3VCB A;  2DF4 B;  4AYB F;  2W04 A;  4PL2 A;  4KMO B;  3C28 A;  2ZIV B;  4JMU A;  1P7D A;  2HOF A;  2WAQ F;  1HIW A;  2ZXH A;  3M7D A;  2ZIV A;  3IG8 A;  3AQF A;  5A0L A;  2E5S A;  2GH1 A;  2K8B B;  1MA7 A;  2JH1 A;  4NWI A;  2KKP A;  4NV0 A;  1ECW A;  4OJL A;  1WUD A;  2NV3 A;  2YB1 A;  4QIW C;  5KL8 B;  2HOQ A;  2RHF A;  2JMG A;  2HBM A;  2GOL A;  2KIW A;  2KJ9 A;  3LVV A;  1ED1 A;  2BDU A;  1PVR A;  2XI9 A;  1SZH A;  4CGZ A;  3N7S C;  2F2A B;  2KEY A;  2Q4T A;  1URJ A;  4P0P A;  2N1R A;  1T94 A;  2ZIX A;  4ICA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...