2N1RA

Nmr structure of the myristylated feline immunodeficiency virus matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
GNGASRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p15
publication title NMR structure of the myristylated feline immunodeficiency virus matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
molecule tags Viral protein
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2n1rA00
2HMXA 2NV3A 2H3IA 4JMUA 1UPHA 2K4EA 2H3FA 4IC9A 4ICAA 2H3VA 1HEKA 1HIWA 2H3ZA 1TAMA 1A6SA 2H3QA 2GOLA 2LYBA 2K4IA 1ED1A 1L6NA 2JMGA 2K4HA 2LYAA 1ECWA 2N1RA
chains in the Genus database with same CATH superfamily
3NS1A 4J9MA 4M0AA 9ICHA 7ICQA 4B9LA 4Y2UA 3GIJA 3R9KA 4YXJA 3KHRA 4IRDA 3CRXA 5EE1A 2JR5A 2GOLA 5HHIA 3NVWA 2FPLA 4NLGA 2OHFA 5AKYA 1ED1A 4ECTA 2K4HA 1NK5A 9ICLA 3MFIA 1U48A 2IMWP 2MA1A 3HT3A 2ZIWB 4DSLA 1S76D 3RH5A 4I2CA 2OYYA 2ZJ5A 1LKYA 1NJZA 4QZ8A 3ZI4A 1L7OA 3HJEA 2WF6A 3K1ZA 1HUZA 4IL6U 4RUAA 3UPQA 4NY8A 2R8IA 4EENA 1Q46A 4P4OA 3V72A 2ZXIA 3LWMA 4DFPA 1NKBA 2E1FA 4ED1A 4I2GA 4OJ6A 2A1JB 1X66A 4DSIA 1VLBA 2IHMA 4CNQA 1UCVA 1U4BA 4UASA 3E2EA 1BNPA 1A6SA 3GQCA 1ZQUA 2FPMA 2Y9UA 1C20A 4DL3A 1WCNA 2HSZA 4FE3A 4PL1A 3ZDAA 3HX0A 3RRHA 1BPXA 1QSLA 5KG5A 3ORYA 5AM1A 4I2FA 4RQ4A 2JH7A 3L4PA 2P6UA 5KFMA 3E58A 4O3SA 3RB3A 5EE3A 1FEZA 1NZBA 4UB1A 5DLGA 4KMOB 2ZUBA 2FPKA 5AI4A 2BDPA 3RBEA 4ZH4A 4J9OA 5AM2A 2FMQA 4KTQA 2ZIXB 4DQQA 4MFAA 4MFFA 1FFUA 3LYSA 1KL9A 4QZHA 1COKA 1AQ6A 4YQWA 4FZLA 1PUZA 1X9XA 4ED3A 2KFNA 1X6IA 1Z19A 9ICJA 8ICUA 2BR0A 4QWBA 3GU3A 3UMGA 5EWFA 3T79A 2CXYA 3LDAA 4J9KA 3PW0A 5L1MA 2K4EA 3Q8MA 5ALDA 4PJ0U 1SV4A 5AHXA 3ETLA 4O3QA 5AKZA 3Q8SB 4DL2A 4WJ3B 2W9MA 2HOIA 8ICCA 4R8UA 5KFBA 3KOOA 3AU2A 2PMZF 2CRXA 7ICPA 2ISOA 4U6PA 2RDJA 2W11A 1IM4A 1Y88A 2H3ZA 2RHFA 5KFSA 5KG3A 1URJA 2OCEA 4OCZA 4OJLA 3H8JA 4OJOA 4I2BA 8ICBA 4KLGA 2K8AA 4KLOA 4EZ6A 1ZD3A 4YXMA 2IHNA 4US9A 4F2SA 5ALYA 2VANA 3ZDDA 2ALZA 4IQWA 2HHVA 3K1RB 2RQ5A 1KFTA 1IG6A 2ZG6A 3BQTA 4ED0A 4G3IA 4DF4A 1FFVA 3PX4A 1MQ2A 4NLNA 4YP3A 1WCLA 4O5EA 5J29A 3ZD9A 3KKAC 3TACB 2BCUA 3UQ0A 3PW7A 2M0NA 4F4WA 3M8RA 1XO0A 3I76A 4F4KA 3BZKA 4JV2A 3M9OB 4ECWA 2XVTA 3T3FA 4C4RA 1VDVA 4KLMA 2K4IA 2C2EA 1L6NA 2LM4A 4ECSA 5AK3A 2VA2A 3N7RC 4QZBA 4F92B 5GTHU 4P0QA 3H4DA 2KJ9A 1RG6A 4GXJA 4BDPA 4GIBA 4KX3A 9ICAA 2KMDA 3QUCA 5J0SA 3FYHA 3U26A 4FZMA 1QH9A 1TAUA 1L3VA 2ODGA 8ICFA 4DQPA 2IA6A 1L8OA 2YB4A 5L1KA 1WYGA 4ZOHC 1KTQA 5KFTA 1NZPA 2WHEA 3G6XA 1H38A 1ZJNA 2H3VA 3LVWA 3KZIU 4LJXA 4QIWF 1D8BA 3H0LB 4KITB 2ASJA 5KAIU 4QZAA 4QWCA 3H7IA 5G5HA 3J81j 3MR6A 3ICXA 4DF8A 2LYAA 4JWMA 1QSSA 9ICXA 3QX7A 4IQUA 8ICSA 3IG5A 8ICZA 1RXWA 3JPOA 3PMLA 4RQ6A 4RQ5A 3KHLA 4C0ZA 2KEYA 3MGHA 1NJXA 4Y2TA 1ZQEA 8ICXA 5CA7A 3EYZA 1KN5A 1B4FA 1ZQJA 3ZD8A 4PHPA 3C1YA 3JPSA 4R65A 5KG6A 2HOQA 1ZQHA 5KL1B 4U7CA 2BPGA 2BCRA 4C4TA 8ICPA 1LVHA 3C5FA 4R66A 4BWJA 2E8OA 4YR3A 4J9PA 4Q43A 1Z00A 4O3NA 5DDMA 5F9NA 2W3RA 1BPZA 3BS5B 4Q45A 2HHXA 5JUMA 4TQRA 2OH2A 1SKSA 3Q8KA 1NOMA 2FMPA 1DGSA 5KFKA 4YVZA 4NM1A 5KT7A 4TUPA 4Y2SA 1QQ5A 4ELTA 1UT8A 4I27A 3O0FA 4ECUA 4F5PA 2WAQF 1PK1A 1ZQFA 3UMCA 5KG4A 3AQEA 2HHTA 3JPPA 5CWRA 1PZNA 1O08A 2W7PA 1CEZA 5KFVA 2BQRA 2EAOA 3H0RB 1ZQQA 4IQTA 2ZTDA 4EBDA 3QNMA 3T5LA 2W55A 4DS5A 2KV2A 4M9HA 2HHQA 4KLEA 2QB0A 4F4XA 3TADC 4NL9A 8ICVA 1C7YA 2M9NA 3M6KA 2KIVA 4DFJA 9ICNA 9ICCA 4RT3A 3NUQA 5IIOA 2FI1A 2W9BB 5IILA 4DL4A 4A8EA 1RZTA 5KG1A 1KDHA 4ECRA 4DQRA 4F72A 4RU9A 3V7JA 2KOBA 1ZXIA 1XSLA 4JMUA 5KFRA 4JUZA 2BKEA 2G06A 3OHBA 4UARA 4RQ8A 1XO1A 4UAVA 3PNCA 9ICRA 4UB5A 4DLGA 4ECXA 7ICSA 1O03A 2WB1C 2AU0A 1L8LA 4F3OA 3AQFA 2XGPA 3M9NB 4UB4A 4K4IA 2K8BB 3CW2C 3C2LA 1QSYA 9ICQA 1ZQOA 4PHAA 1Q3VA 5TZVA 2GWSA 1ZQMA 3NVZA 2WFAA 3TARA 3GV7B 4YMNA 1AROP 1L3TA 4M9LA 5D49A 4RUCA 8ICTA 4TUSA 1SIJA 4MEYA 4PZOA 3PV8A 7ICEA 4YD1A 4F5NA 3RTVA 5KT4A 2WF8A 2ZJ8A 2MRLA 8ICHA 2BPFA 2F76X 1L7PA 3SYZA 1SL2A 4E0DA 5AM0A 4NJ8A 2EANA 3IN5A 2KZ3A 4YD2A 3GV8B 4KLIA 2MUTB 1PVRA 4ELVA 3WKCA 2LM1A 5DBBA 2C2DA 4P4MA 2MU2A 3V6HA 3ZDBA 2GO7A 5AIAA 4BUGA 3C23A 2KTQA 2UVWA 2J6UA 7ICKA 2VA3A 3NRWA 1T8EA 4QZIA 9ICKA 1QCKA 3RJEA 2E8PA 2KSOB 2AHOB 5CJ7A 3MFHA 4DS4A 5C0YA 9ICWA 2AQ0A 4I2EA 5L9XA 1U49A 1S8OA 3KD3A 2QARA 2FMSA 3RAQA 5EOZA 2I5HA 3RH4A 5F9LA 4YMMA 1ZQGA 3ED5A 4UQGA 1MQ3A 1S0VA 4KN7A 1SL0A 2NRXA 1ZQDA 2UVVA 5C5JA 5J0PA 5AICA 1QQ7A 3MR3A 2EQYA 3N7PD 4EZ9A 4M2YA 4NXZA 4JB3A 2HHSA 5ALZA 1TVAA 5DDYA 3F2BA 2C2RA 3C2MA 5FP0A 3MBYA 7ICNA 1T3QA 4RNNA 5ALOA 3SENA 2K60A 1SB3C 2YN4A 2KVSA 4CGZA 4RPYA 8ICIA 5KL8B 4GLXA 5DQIA 4KLJA 2W54A 3EW9A 1NK9A 3OGUA 9ICPA 3OSPA 4C8KA 2E5SA 3SAHA 5J0QA 2NO4A 3GIIA 2PXIA 2EH9A 7ICGA 1GO3F 4EBEA 8ICGA 1BNOA 4NL9C 3SV3A 5AKEA 2EZZA 2AGPA 4B9MA 3PSPA 3H0MB 5GTIU 1QQ6A 1LKYB 2XI9A 1ZQVA 3RJFA 4NLCA 5ALVA 3OJSA 2YB1A 2W03A 4R63A 4KLUA 4BGDA 3NGDA 4FBUA 1JUDA 2A1AA 2DPIA 2QKQA 4B9TA 1KBUA 3K75D 4CF5A 5HHHA 1ZQCA 5KT5A 1D8YA 2HVHA 1MA7A 4GXKA 2OWOA 3M7DA 1JX4A 3ZDCA 1T4GA 3QE9Y 2HDOA 1N5XA 3GZFA 2C28A 4DFDA 1B0XA 3PSTA 3NTUA 5ALJA 2JEGA 1T7PA 1SV0C 1NNLA 1NJYA 1TKDA 3WKDA 4YFKA 1MN8A 2ZIVA 1HIWA 5B66U 3SZ2A 4ECYA 4F5QA 3WK8A 2YY6A 3BDPA 3RF9A 5J2KA 4Q8EA 2AGQA 2G08A 2IOHA 2KNJA 4ECZA 2BQ3A 4F2RA 1MSWD 4C4SA 8ICMA 5ALTA 4F91B 4MHVA 5AKHA 2RRDA 9ICFA 4O3PA 4BXOA 2VKQA 1CUKA 5KFUA 2BDUA 1ZQLA 4RQNA 2F3NA 1DGJA 2BCQA 1COOA 1J2NA 4AYBC 1IIPA 4IS7A 3GDXA 2KG5A 3RJHA 3IG8A 8ICRA 2P66A 4DWIA 2KE7A 4NLZA 1Q3UA 1PK3A 3QU5A 5ALIA 5BOMA 5AI5A 4PHEA 2JZBA 5AM5A 3BQ0A 3C2KA 3I1YA 4QZCA 5DB8A 4UAWA 4KLQA 2W8LA 2NRTA 2KJ5A 2XY7A 1KSPA 1DRGA 1ZQKA 2HMXA 2JRZA 3AUOA 4DSJA 4F5OA 1UHUA 3BS7A 1K5OA 4QZ9A 3B9JA 4EX7A 1ZD2P 4F71A 3Q8PB 4R8UB 4IRKA 4CRXA 1ZQYA 4M9JA 3HPOA 3RRGA 2F8KA 3D2QA 5KFGA 2KZMA 7ICHA 3MDAA 4R64A 4Z6FA 1X6JA 3S6JA 1IXRA 2XC9A 1QTMA 2AJQA 4DL7A 2D6FC 4OO1J 1DXSA 3AMZA 2RDIA 2VJ5A 3QU2A 1KQQA 5KNIA 4O9MA 1U9LA 3QEBZ 4F50A 4O3MA 5KFXA 3T5KA 4MF2A 3G6VA 4DQSA 5J2FA 5KFAA 4TURA 2HBJA 4FBTA 3UXOA 5ALHA 4F4YA 3TKAA 2G5IB 2YX8A 1JALA 3JPTA 5T14A 2PKEA 1S0OA 4J9NA 1X9WA 1N62A 5DLFA 5ALLA 2W8KA 1XSPA 3IM1A 2DWQA 1ZYQA 1ZD5A 4Y2PA 2XY6A 4Q8FA 1B43A 1RDFA 2JEFA 2Y0SC 4TUQA 2ZUDA 3QUQA 5ALNA 4UB8U 3OHAA 2V9WA 3RB6A 1T94A 5L1IA 4PL2A 5A0LA 4ED6A 2V4QA 4P0QB 3ONNA 5H2FU 1MC8A 3IDWA 2NRZA 4QZGA 2UVRA 3MR2A 2R8KA 5HR7A 3GV5B 5EWGA 1ZQNA 2K8CB 5J8YA 4F8RA 2WB1F 1JXLA 2DL0A 4PGQA 4ED7A 1N63A 1A76A 2R18A 4QZFA 2E3TA 5J0RA 4MFCA 1UA0A 7ICIA 2ATLA 5KFWA 5AI8A 4RQ3A 5L1JA 1J97A 4M9NA 1BPDA 3HW8A 2Z7JA 2F8LA 4IRCA 3EPGA 4O5KA 5DB9A 1XC9A 5J2EA 1HUOA 5J2BA 2KVCA 3UQ2A 3TQ1A 5DGBA 8ICQA 5J2DA 4ACOA 2R8HA 4M6WA 2P35A 3WK9A 3QUBA 5CRXA 2KK0A 5AM4A 2J6TA 8ICKA 1ZRMA 4F5RA 2BHNA 2YQEA 3QZ7A 2ES6A 2QB1A 3LWLA 4GXIA 3MC1A 5KFDA 5KFCA 1A77A 4XQ8A 2XO7A 1ZQAA 5CR0A 4J9QA 1HEKA 2GLEA 4ED8A 3SD7A 2W9AA 8ICAA 1BVSA 3F2DA 2DGZA 1NK0A 2LYBA 3BZCA 2PI5A 1P7DA 7ICJA 5CEHA 2ZIUA 8ICOA 3A0HU 5AIBA 3RH6A 2PFPA 2BQUA 5ALFA 4GC6A 4DL5A 2FLLA 1L3SA 4Y2YA 1NK7A 1V85A 3SEIA 3OJUA 2R8JA 3AL0B 3UXNA 4BWMA 4DL6A 5E79U 3JPRA 3CP8A 3SI8A 2HBMA 3AN1A 1KFDA 2L5YA 5J0XA 3FM9A 3B0YA 3A0BU 3PX0A 3EPIA 2WF5A 4O3OA 2IOFA 3C28A 4JV0A 2DQNB 2F1JA 3PY8A 8ICYA 2QB0B 1KEJA 3GILA 4F4ZA 1DK3A 2HI0A 4Y2JA 2OXOA 3RJIA 3EWAA 1ZETA 2A19A 1S77D 1SKRA 7ICOA 4NLBA 5J2JA 3TAPA 2DUYA 1SKWA 5BPCA 1Q8KA 3WKBA 1Z4NA 3WK5A 2NYVA 2B0CA 1L7MA 1N5WA 4KLSA 5DB7A 5EE9A 3C29A 2W9CA 5D4BA 2WTFA 5IIIA 5ALUA 5CB1A 5AK4A 2PFQA 1EXNA 4QW8A 5KT3A 3V7LA 3MGVA 3IHQB 3SR6A 5DBAA 1N60A 5L1LA 2K89A 4C8OA 3HKZC 2V4RA 1ZD4A 3H8SA 1OXJA 4P0PA 4XA5A 1N56A 3WK4A 2D3DA 4CF3A 1F44A 2LHTA 3QU4A 5HMLA 3SAGA 4UW9A 2ASLA 3IV6A 4DOAA 5KFZA 5BOLA 5J8YC 1V38A 4O3RA 4TQSA 3PVXA 2J6SA 5J2IA 4CDGA 4FO6A 5TISU 1ZQSA 3QU7A 4IR1A 2ZUCA 4O0IA 3PSFA 1S0NA 3GIKA 3KHHA 5HP4A 4PGYA 3DEEA 3MGIA 2W3SA 5ALWA 3IP4B 2DF4B 2JMGA 2KJ8A 1RQNA 2F77X 2HCFA 4LZGA 2R8GA 2ZTEA 1KKXA 2AXTU 4AYBF 3KFUF 3GFKB 5KFEA 1NKEA 5AKGA 5K4LA 3RB4A 5KFLA 4LVSA 1HJPA 2Y1IA 5KG0A 2IBKA 1S5LU 2EAPA 2KKVA 9ICMA 4ELUA 3NRZA 4CF4A 5ALEA 2N1RA 4NV0A 2KD1A 4M9GA 1TK8A 5AI6A 2QARB 2JEIA 4DOBA 4CE6A 3JPQA 2HVIA 4DSKA 1WWVA 1A0PA 2F1HA 4M47A 4KN4A 4Y2XA 1ZRNA 2K4PA 3N28A 3LK9A 2RP5A 2H5XA 2HBKA 2Y1JA 7ICRA 1SXEA 5AK6A 3PSIA 3SMVA 4QJFB 1Z4OA 1TK0A 2EAMA 2CPRA 2LI6A 2ISPA 2ZIWA 3KKAA 2BCSA 4HAIA 2Y9TA 4BJQA 2IOFK 3CYMA 4Z6EA 2XCPA 4BX9C 2NO5A 3T5JA 4UAZA 2B6GA 1KFSA 1K1SA 3L5KA 4RQ7A 4UBBA 1RYSA 3HWTA 1T3NA 7ICUA 5JRTA 2I1QA 4IQVA 4UAYA 1NJWA 9ICEA 1IV8A 3F5EA 5AKIA 5J2AA 2A1JA 2C22A 5DB6A 1SWVA 5KFFA 1NK6A 2BPCA 1XU4A 3WK7A 2NRVA 1Z1VA 9ICVA 3V7KA 2VJ4A 3TANA 3ISCA 4OJPA 1XNSA 5DBCA 1RQLA 3HRDD 2XIDA 2PFNA 5KFPA 2FE9A 3ALRA 4LZDA 5KG2A 3M8SA 1YZ6A 8ICEA 1ZQXA 1FIQA 5AK5A 2FLNA 4C8LA 4DQIA 5J2HA 3TI0A 3OSNA 3NVVA 4JWNA 2W7OA 4J9LA 2PFOA 1NKCA 7ICFA 1BPYA 2ZIVB 2ZIXA 2W04A 2Y0SF 4DSFA 2A3VA 3M9MB 7ICVA 5DGAA 4I2IA 1PVPA 2G0AA 1TAMA 3BQ1A 4RPXA 9ICOA 4FZNA 2BCVA 2F1IA 4ECVA 2Q4TA 2G09A 4RNOA 4Z6CA 3PW4A 4BXOB 1SZPA 1S0MA 4YR0A 8ICJA 3DV9A 4UATA 4QWEA 5KFIA 5AKKA 1SGGA 2AGOA 2JHDA 2E1EA 4C7YA 1KRPA 3T5HA 4UAUA 7ICLA 4YMOA 3KBBA 3EZ5A 2VA8A 2HOFA 3PMNA 5AKXA 2KHVA 3QEAZ 4YN4A 2DKXA 1Z3EB 5J0WA 2JZBB 1NK4A 3PO5A 1ZOLA 7ICMA 1ZQRA 5ALXA 1JRPA 4EYIB 4B9NA 5AI9A 5DG7A 3BQ2A 1V97A 4RQ0A 4F93B 1WUDA 2ZXHA 3LVVA 4KLLA 3N7SC 3D2NA 5KTQA 2YMQA 4RZRA 4PPXA 4YCXA 4KMUA 4K4GA 3L3FX 3KZXA 1J2MA 4O5CA 1SWWA 1JIHA 4EX6A 4Q44A 4I2JA 3SQIA 2HW3A 5AM3A 2F44A 9ICIA 5KT2A 4I2HA 4Y2QA 4RPZA 4FS2A 3RB0A 2W43A 4RNMA 2G07A 4UB3A 4NWIA 4UB6U 5G5GA 3UMBA 5HMMA 3TADA 3WK6A 3ETRA 1UT5A 2KIWA 4AP9A 2JEJA 4P2HA 4YG2A 3AEVA 4I28A 4QWDA 4J9RA 2PI4A 5J2CA 5IIKA 3ZDEA 1N61A 1QLNA 5DG9A 1XS9D 2FJ6A 5ALGA 2YTUA 2YMMA 3EUB2 4DSEA 4B6JA 4DOCA 1JROA 4M04A 1SL1A 4C80A 1ZQWA 2ESEA 5F3XB 3FAHA 5JU5A 3QYPA 4J9SA 1F5SA 1JMSA 3AU6A 4DLEA 5ALKA 1YZ7A 4QWAA 1BPBA 3H4BA 3TAQA 4J03A 4OD0A 1BPEA 4KLFA 3DDHA 1Z1BA 3WKAA 5D46A 1ZQPA 2XCAA 1X42A 5J0YA 2BZFA 2ZTCA 3M1YA 2JGAA 4ECQA 1JI7A 1KW4A 4NLKA 5DQGA 2ZJAA 1SZHA 1VJ5A 4DFKA 3ISBA 7ICTA 1X40A 3QXGA 4EEKA 5KFOA 3G6YA 2MAXA 5KAFU 3UXPA 3N4MB 2NRWA 1X2IA 4Y2VA 4KLTA 2KP7A 5J0OA 2YMLA 1ZJMA 3E0FA 4I2DA 4KLDA 2O6KA 2LKYA 2LBOA 3GIMA 2UVUA 9ICSA 3TFRA 2RLTA 3KHGA 5J0UA 3D2SA 9ICGA 3PZPA 5AKLA 2FDRA 1UPHA 1ZQBA 5HR6A 4MF8A 1N2XA 3N97B 4OJ5A 4FS1A 2E8NA 3HKZF 4G9BA 3PW5A 4UB2A 5J2GA 3K4GA 2AH5A 2PMZC 4GC7A 9ICTA 1RXVA 4PH5A 3OTQA 4RT2A 3QZ8A 2HHWA 2DFLA 4DFMA 2KFZA 2QLTA 3C21A 4KX5A 3C5GA 5ALSA 2KICA 2KN7A 4NM2A 4M6WB 3RJJA 4RQ1A 3BS5A 4I2AA 3RAXA 1ZQIA 1SXDA 2LPEA 3F5AA 4RQMA 2EDUA 1Z00B 1WG8A 4C7ZA 1RM6C 1RPLA 5EE0A 4FFDA 3VC8A 4C8MA 3IRUA 3F2CA 1DK2A 1L7NA 1D9DA 3AM9A 4XUSA 4ICAA 3D6JA 5KFYA 1NK8A 1YT3A 3FC4A 1ZQTA 3NVYA 5ALQA 1PK1B 3RR8A 3PR5B 5B5EU 2ZIUB 1KLNA 1OW5A 3VCBA 2HBLA 5KG7A 4UBCA 5JTIA 3Q8QB 2JXJA 5KFHA 2WF7A 2HHUA 1L5UA 8ICNA 3FDSA 4HYKA 3WU2U 4I29A 3OPXA 2W9BA 1WWUA 1TV9A 2XY5A 1XSNA 4MEXA 4GFJA 1F0MA 1ZQ1C 4CCHA 3V6KA 2KHQA 1TK5A 2H3IA 3I28A 9ICUA 4EBCA 3TFSA 2LYHA 3QUTA 5ALRA 5DKWA 2MSNA 3BJYA 5DG8A 4QZEA 1FO4A 2XGQA 4RQ2A 1DOQA 2I9GA 5IINA 2B21A 3CNHA 3KTQA 5IIMA 3PW2A 4JV1A 3H8MA 1X9SA 2EZXA 4EELA 4USAA 1OUQA 1JXEA 4DEZA 1LB2B 1UQVA 4QIWC 1TE2A 4US8A 4DO9A 5HNKA 1V9PA 1NI3A 3M6ZA 3HP6A 4X5VA 2AQ4A 1SV0A 5KT6A 2JV3A 1XWLA 2OEHA 3PX6A 4PZNA 1D9FA 1L3UA 3RJGA 1CRXA 2E8MA 2W9CB 1CI4A 3ISDA 2ASDA 5KFQA 8ICWA 4IR9A 3PO4A 2KKPA 2WF9A 5DQHA 2DPJA 1U47A 4PGXA 4Y2RA 1U45A 2FLPA 5AI0A 4B9SA 3RBDA 4JK1A 3F53A 1LV5A 5CHGA 1B22A 3H8WA 3PR4A 2GH1A 1UA1A 4KLHA 2EZYA 4P0PB 2MUTA 3HILA 4IC9A 3Q8LA 2KZZA 2OM6A 3C1ZA 4Z6DA 3RJKA 2JH1A 3SV4A 2D8CA 3RFAA 1PVQA 1RYRA 5CP2A 2H3QA 5ALMA 5ALPA 2CN1A 8ICLA 1X9MA 3MR5A 4K4HA 1ECWA 3MABA 4QZDA 1RYUA 1BGXT 1M6YA 4PHDA 3Q8RB 9ICBA 2KSOA 1D8LA 1N48A 2WAQC 4B9VA 1S9FA 5IIJA 2XICA 2BGWA 1S10A 2DBYA 5EWEA 2I6XA 4C8NA 2YMPA 4B9UA 1S97A 3NASA 5J0TA 4P4PA 3RR7A 2P6RA 4QNLA 5KFJA 1JN3A 3UM9A 4XRHA 2F2AB 4YR2A 1K1QA 2NV3A 3H40A 1ZQZA 5KFNA 2Q0ZX 3SAFA 2H3FA 4QW9A 1TAQA 3QU9A 2G5HB 3BQ7A 2VIXA 3B0XA 4DCCA 1TFRA 3MDCA 5AKJA 2DKZA 4EEYA 3THVA 3WKEA 4ED2A 3JPNA 4EYHB 3V6JA 2LMRA
chains in the Genus database with same CATH topology
2K8CB 3D2QA 4JMUA 3CP8A 3PSTA 2WB1F 3VC8A 2HBMA 2ZIXB 4CDGA 3F2CA 2HOFA 2G06A 2KHVA 2KKPA 3LYSA 2R18A 1Z1BA 2M0NA 5C0YA 4FZLA 4ICAA 1XO0A 3CRXA 2HOQA 3F5EA 3PSFA 2JGAA 2ZIVA 5KL1B 1HIWA 4U7CA 3C28A 2XVTA 1Z19A 1YT3A 3DEEA 2DQNB 2D6FC 3F53A 4OO1J 1WUDA 1SZHA 2GOLA 2WB1C 2VJ5A 2ZXHA 3LVVA 3GU3A 3IP4B 2DF4B 2K4IA 3AQFA 1ED1A 1L6NA 2JMGA 3RF9A 2K4HA 2KJ8A 2OXOA 2F77X 2ZIUB 3D2NA 3N7SC 2Z7JA 3T79A 2F8LA 2GH1A 2MA1A 3VCBA 2HBLA 2ZIWB 2K8BB 2VJ4A 3N7RC 2G08A 2KNJA 3N7PD 4AYBF 2K4EA 4O3MA 4P0PB 3KFUF 2OYYA 3L3FX 1Q3VA 3KZXA 4OJPA 4IC9A 4NLBA 1XNSA 2RRDA 2XIDA 2OM6A 2OH2A 2KVCA 2VKQA 4P0QA 2JH1A 2KJ9A 3ALRA 2BDUA 3F2BA 2HBJA 3SQIA 3OPXA 3RFAA 4ACOA 1PVQA 4KX3A 3K1ZA 2H3QA 3E0FA 2G5IB 2KKVA 2YX8A 2LKYA 4FZMA 5CRXA 2CN1A 4GFJA 1IIPA 3O0FA 2LBOA 4AYBC 5T14A 2WAQF 3AL0B 2HOIA 4WJ3B 1ZQ1C 2ZXIA 1ECWA 3D2SA 2KHQA 2N1RA 2YB4A 3AQEA 2W7OA 3PZPA 4NV0A 3IG8A 2H3IA 3C29A 4CGZA 2E1FA 1UPHA 2G07A 2KD1A 5KL8B 4NWIA 2W7PA 2PMZF 4OJ6A 2KIWA 2CRXA 2MRLA 2ZIVB 5HR6A 3H0RB 1Q3UA 2ZIXA 2W04A 2Y0SF 2E5SA 3SAHA 2A3VA 2F76X 2WAQC 4OJ5A 2H3VA 3LVWA 4U6PA 1HEKA 4QIWF 2XICA 1PVPA 1D8BA 3H0LB 3HKZF 1A0PA 2G0AA 2H3ZA 1TAMA 2KV2A 2RHFA 1A6SA 4FZNA 1GO3F 3MGVA 3F2DA 2DGZA 1URJA 1OUQA 2PMZC 2KJ5A 2LYBA 2Q4TA 3IN5A 2RP5A 4OJLA 2HBKA 4OJOA 4QNLA 1P7DA 2G09A 2Y0SC 3ICXA 2LYAA 2F2AB 3PSIA 1DRGA 3PSPA 3H0MB 2HMXA 2K8AA 2NV3A 2K89A 3SMVA 2XI9A 4QJFB 4QIWC 1PVRA 1T94A 3M6KA 4FE3A 2ZIUA 4PL1A 4PL2A 3HKZC 5A0LA 3IG5A 2CPRA 4KX5A 4NLCA 4P0QB 2YB1A 3SAFA 2H3FA 3ONNA 2ZIWA 2W03A 3M6ZA 3NUQA 2KICA 2JH7A 4P0PA 4BUGA 4BJQA 2G5HB 4A8EA 1KBUA 2VIXA 1F44A 3CYMA 2LHTA 3SAGA 4BX9C 3F5AA 1MA7A 2ZG6A 2JHDA 1NZBA 3M7DA 1CRXA 4C0ZA 4CRXA 2KEYA 2E1EA 3NRWA 5HR7A 4KMOB 3GZFA 2KOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMX A;  2NV3 A;  2H3I A;  4JMU A;  1UPH A;  2K4E A;  2H3F A;  4IC9 A;  4ICA A;  2H3V A;  1HEK A;  1HIW A;  2H3Z A;  1TAM A;  1A6S A;  2H3Q A;  2GOL A;  2LYB A;  2K4I A;  1ED1 A;  1L6N A;  2JMG A;  2K4H A;  2LYA A;  1ECW A;  2N1R A; 
#chains in the Genus database with same CATH topology
 3NS1 A;  4J9M A;  4M0A A;  9ICH A;  7ICQ A;  4B9L A;  4Y2U A;  3GIJ A;  3R9K A;  4YXJ A;  3KHR A;  4IRD A;  3CRX A;  5EE1 A;  2JR5 A;  2GOL A;  5HHI A;  3NVW A;  2FPL A;  4NLG A;  2OHF A;  5AKY A;  1ED1 A;  4ECT A;  2K4H A;  1NK5 A;  9ICL A;  3MFI A;  1U48 A;  2IMW P;  2MA1 A;  3HT3 A;  2ZIW B;  4DSL A;  1S76 D;  3RH5 A;  4I2C A;  2OYY A;  2ZJ5 A;  1LKY A;  1NJZ A;  4QZ8 A;  3ZI4 A;  1L7O A;  3HJE A;  2WF6 A;  3K1Z A;  1HUZ A;  4IL6 U;  4RUA A;  3UPQ A;  4NY8 A;  2R8I A;  4EEN A;  1Q46 A;  4P4O A;  3V72 A;  2ZXI A;  3LWM A;  4DFP A;  1NKB A;  2E1F A;  4ED1 A;  4I2G A;  4OJ6 A;  2A1J B;  1X66 A;  4DSI A;  1VLB A;  2IHM A;  4CNQ A;  1UCV A;  1U4B A;  4UAS A;  3E2E A;  1BNP A;  1A6S A;  3GQC A;  1ZQU A;  2FPM A;  2Y9U A;  1C20 A;  4DL3 A;  1WCN A;  2HSZ A;  4FE3 A;  4PL1 A;  3ZDA A;  3HX0 A;  3RRH A;  1BPX A;  1QSL A;  5KG5 A;  3ORY A;  5AM1 A;  4I2F A;  4RQ4 A;  2JH7 A;  3L4P A;  2P6U A;  5KFM A;  3E58 A;  4O3S A;  3RB3 A;  5EE3 A;  1FEZ A;  1NZB A;  4UB1 A;  5DLG A;  4KMO B;  2ZUB A;  2FPK A;  5AI4 A;  2BDP A;  3RBE A;  4ZH4 A;  4J9O A;  5AM2 A;  2FMQ A;  4KTQ A;  2ZIX B;  4DQQ A;  4MFA A;  4MFF A;  1FFU A;  3LYS A;  1KL9 A;  4QZH A;  1COK A;  1AQ6 A;  4YQW A;  4FZL A;  1PUZ A;  1X9X A;  4ED3 A;  2KFN A;  1X6I A;  1Z19 A;  9ICJ A;  8ICU A;  2BR0 A;  4QWB A;  3GU3 A;  3UMG A;  5EWF A;  3T79 A;  2CXY A;  3LDA A;  4J9K A;  3PW0 A;  5L1M A;  2K4E A;  3Q8M A;  5ALD A;  4PJ0 U;  1SV4 A;  5AHX A;  3ETL A;  4O3Q A;  5AKZ A;  3Q8S B;  4DL2 A;  4WJ3 B;  2W9M A;  2HOI A;  8ICC A;  4R8U A;  5KFB A;  3KOO A;  3AU2 A;  2PMZ F;  2CRX A;  7ICP A;  2ISO A;  4U6P A;  2RDJ A;  2W11 A;  1IM4 A;  1Y88 A;  2H3Z A;  2RHF A;  5KFS A;  5KG3 A;  1URJ A;  2OCE A;  4OCZ A;  4OJL A;  3H8J A;  4OJO A;  4I2B A;  8ICB A;  4KLG A;  2K8A A;  4KLO A;  4EZ6 A;  1ZD3 A;  4YXM A;  2IHN A;  4US9 A;  4F2S A;  5ALY A;  2VAN A;  3ZDD A;  2ALZ A;  4IQW A;  2HHV A;  3K1R B;  2RQ5 A;  1KFT A;  1IG6 A;  2ZG6 A;  3BQT A;  4ED0 A;  4G3I A;  4DF4 A;  1FFV A;  3PX4 A;  1MQ2 A;  4NLN A;  4YP3 A;  1WCL A;  4O5E A;  5J29 A;  3ZD9 A;  3KKA C;  3TAC B;  2BCU A;  3UQ0 A;  3PW7 A;  2M0N A;  4F4W A;  3M8R A;  1XO0 A;  3I76 A;  4F4K A;  3BZK A;  4JV2 A;  3M9O B;  4ECW A;  2XVT A;  3T3F A;  4C4R A;  1VDV A;  4KLM A;  2K4I A;  2C2E A;  1L6N A;  2LM4 A;  4ECS A;  5AK3 A;  2VA2 A;  3N7R C;  4QZB A;  4F92 B;  5GTH U;  4P0Q A;  3H4D A;  2KJ9 A;  1RG6 A;  4GXJ A;  4BDP A;  4GIB A;  4KX3 A;  9ICA A;  2KMD A;  3QUC A;  5J0S A;  3FYH A;  3U26 A;  4FZM A;  1QH9 A;  1TAU A;  1L3V A;  2ODG A;  8ICF A;  4DQP A;  2IA6 A;  1L8O A;  2YB4 A;  5L1K A;  1WYG A;  4ZOH C;  1KTQ A;  5KFT A;  1NZP A;  2WHE A;  3G6X A;  1H38 A;  1ZJN A;  2H3V A;  3LVW A;  3KZI U;  4LJX A;  4QIW F;  1D8B A;  3H0L B;  4KIT B;  2ASJ A;  5KAI U;  4QZA A;  4QWC A;  3H7I A;  5G5H A;  3J81 j;  3MR6 A;  3ICX A;  4DF8 A;  2LYA A;  4JWM A;  1QSS A;  9ICX A;  3QX7 A;  4IQU A;  8ICS A;  3IG5 A;  8ICZ A;  1RXW A;  3JPO A;  3PML A;  4RQ6 A;  4RQ5 A;  3KHL A;  4C0Z A;  2KEY A;  3MGH A;  1NJX A;  4Y2T A;  1ZQE A;  8ICX A;  5CA7 A;  3EYZ A;  1KN5 A;  1B4F A;  1ZQJ A;  3ZD8 A;  4PHP A;  3C1Y A;  3JPS A;  4R65 A;  5KG6 A;  2HOQ A;  1ZQH A;  5KL1 B;  4U7C A;  2BPG A;  2BCR A;  4C4T A;  8ICP A;  1LVH A;  3C5F A;  4R66 A;  4BWJ A;  2E8O A;  4YR3 A;  4J9P A;  4Q43 A;  1Z00 A;  4O3N A;  5DDM A;  5F9N A;  2W3R A;  1BPZ A;  3BS5 B;  4Q45 A;  2HHX A;  5JUM A;  4TQR A;  2OH2 A;  1SKS A;  3Q8K A;  1NOM A;  2FMP A;  1DGS A;  5KFK A;  4YVZ A;  4NM1 A;  5KT7 A;  4TUP A;  4Y2S A;  1QQ5 A;  4ELT A;  1UT8 A;  4I27 A;  3O0F A;  4ECU A;  4F5P A;  2WAQ F;  1PK1 A;  1ZQF A;  3UMC A;  5KG4 A;  3AQE A;  2HHT A;  3JPP A;  5CWR A;  1PZN A;  1O08 A;  2W7P A;  1CEZ A;  5KFV A;  2BQR A;  2EAO A;  3H0R B;  1ZQQ A;  4IQT A;  2ZTD A;  4EBD A;  3QNM A;  3T5L A;  2W55 A;  4DS5 A;  2KV2 A;  4M9H A;  2HHQ A;  4KLE A;  2QB0 A;  4F4X A;  3TAD C;  4NL9 A;  8ICV A;  1C7Y A;  2M9N A;  3M6K A;  2KIV A;  4DFJ A;  9ICN A;  9ICC A;  4RT3 A;  3NUQ A;  5IIO A;  2FI1 A;  2W9B B;  5IIL A;  4DL4 A;  4A8E A;  1RZT A;  5KG1 A;  1KDH A;  4ECR A;  4DQR A;  4F72 A;  4RU9 A;  3V7J A;  2KOB A;  1ZXI A;  1XSL A;  4JMU A;  5KFR A;  4JUZ A;  2BKE A;  2G06 A;  3OHB A;  4UAR A;  4RQ8 A;  1XO1 A;  4UAV A;  3PNC A;  9ICR A;  4UB5 A;  4DLG A;  4ECX A;  7ICS A;  1O03 A;  2WB1 C;  2AU0 A;  1L8L A;  4F3O A;  3AQF A;  2XGP A;  3M9N B;  4UB4 A;  4K4I A;  2K8B B;  3CW2 C;  3C2L A;  1QSY A;  9ICQ A;  1ZQO A;  4PHA A;  1Q3V A;  5TZV A;  2GWS A;  1ZQM A;  3NVZ A;  2WFA A;  3TAR A;  3GV7 B;  4YMN A;  1ARO P;  1L3T A;  4M9L A;  5D49 A;  4RUC A;  8ICT A;  4TUS A;  1SIJ A;  4MEY A;  4PZO A;  3PV8 A;  7ICE A;  4YD1 A;  4F5N A;  3RTV A;  5KT4 A;  2WF8 A;  2ZJ8 A;  2MRL A;  8ICH A;  2BPF A;  2F76 X;  1L7P A;  3SYZ A;  1SL2 A;  4E0D A;  5AM0 A;  4NJ8 A;  2EAN A;  3IN5 A;  2KZ3 A;  4YD2 A;  3GV8 B;  4KLI A;  2MUT B;  1PVR A;  4ELV A;  3WKC A;  2LM1 A;  5DBB A;  2C2D A;  4P4M A;  2MU2 A;  3V6H A;  3ZDB A;  2GO7 A;  5AIA A;  4BUG A;  3C23 A;  2KTQ A;  2UVW A;  2J6U A;  7ICK A;  2VA3 A;  3NRW A;  1T8E A;  4QZI A;  9ICK A;  1QCK A;  3RJE A;  2E8P A;  2KSO B;  2AHO B;  5CJ7 A;  3MFH A;  4DS4 A;  5C0Y A;  9ICW A;  2AQ0 A;  4I2E A;  5L9X A;  1U49 A;  1S8O A;  3KD3 A;  2QAR A;  2FMS A;  3RAQ A;  5EOZ A;  2I5H A;  3RH4 A;  5F9L A;  4YMM A;  1ZQG A;  3ED5 A;  4UQG A;  1MQ3 A;  1S0V A;  4KN7 A;  1SL0 A;  2NRX A;  1ZQD A;  2UVV A;  5C5J A;  5J0P A;  5AIC A;  1QQ7 A;  3MR3 A;  2EQY A;  3N7P D;  4EZ9 A;  4M2Y A;  4NXZ A;  4JB3 A;  2HHS A;  5ALZ A;  1TVA A;  5DDY A;  3F2B A;  2C2R A;  3C2M A;  5FP0 A;  3MBY A;  7ICN A;  1T3Q A;  4RNN A;  5ALO A;  3SEN A;  2K60 A;  1SB3 C;  2YN4 A;  2KVS A;  4CGZ A;  4RPY A;  8ICI A;  5KL8 B;  4GLX A;  5DQI A;  4KLJ A;  2W54 A;  3EW9 A;  1NK9 A;  3OGU A;  9ICP A;  3OSP A;  4C8K A;  2E5S A;  3SAH A;  5J0Q A;  2NO4 A;  3GII A;  2PXI A;  2EH9 A;  7ICG A;  1GO3 F;  4EBE A;  8ICG A;  1BNO A;  4NL9 C;  3SV3 A;  5AKE A;  2EZZ A;  2AGP A;  4B9M A;  3PSP A;  3H0M B;  5GTI U;  1QQ6 A;  1LKY B;  2XI9 A;  1ZQV A;  3RJF A;  4NLC A;  5ALV A;  3OJS A;  2YB1 A;  2W03 A;  4R63 A;  4KLU A;  4BGD A;  3NGD A;  4FBU A;  1JUD A;  2A1A A;  2DPI A;  2QKQ A;  4B9T A;  1KBU A;  3K75 D;  4CF5 A;  5HHH A;  1ZQC A;  5KT5 A;  1D8Y A;  2HVH A;  1MA7 A;  4GXK A;  2OWO A;  3M7D A;  1JX4 A;  3ZDC A;  1T4G A;  3QE9 Y;  2HDO A;  1N5X A;  3GZF A;  2C28 A;  4DFD A;  1B0X A;  3PST A;  3NTU A;  5ALJ A;  2JEG A;  1T7P A;  1SV0 C;  1NNL A;  1NJY A;  1TKD A;  3WKD A;  4YFK A;  1MN8 A;  2ZIV A;  1HIW A;  5B66 U;  3SZ2 A;  4ECY A;  4F5Q A;  3WK8 A;  2YY6 A;  3BDP A;  3RF9 A;  5J2K A;  4Q8E A;  2AGQ A;  2G08 A;  2IOH A;  2KNJ A;  4ECZ A;  2BQ3 A;  4F2R A;  1MSW D;  4C4S A;  8ICM A;  5ALT A;  4F91 B;  4MHV A;  5AKH A;  2RRD A;  9ICF A;  4O3P A;  4BXO A;  2VKQ A;  1CUK A;  5KFU A;  2BDU A;  1ZQL A;  4RQN A;  2F3N A;  1DGJ A;  2BCQ A;  1COO A;  1J2N A;  4AYB C;  1IIP A;  4IS7 A;  3GDX A;  2KG5 A;  3RJH A;  3IG8 A;  8ICR A;  2P66 A;  4DWI A;  2KE7 A;  4NLZ A;  1Q3U A;  1PK3 A;  3QU5 A;  5ALI A;  5BOM A;  5AI5 A;  4PHE A;  2JZB A;  5AM5 A;  3BQ0 A;  3C2K A;  3I1Y A;  4QZC A;  5DB8 A;  4UAW A;  4KLQ A;  2W8L A;  2NRT A;  2KJ5 A;  2XY7 A;  1KSP A;  1DRG A;  1ZQK A;  2HMX A;  2JRZ A;  3AUO A;  4DSJ A;  4F5O A;  1UHU A;  3BS7 A;  1K5O A;  4QZ9 A;  3B9J A;  4EX7 A;  1ZD2 P;  4F71 A;  3Q8P B;  4R8U B;  4IRK A;  4CRX A;  1ZQY A;  4M9J A;  3HPO A;  3RRG A;  2F8K A;  3D2Q A;  5KFG A;  2KZM A;  7ICH A;  3MDA A;  4R64 A;  4Z6F A;  1X6J A;  3S6J A;  1IXR A;  2XC9 A;  1QTM A;  2AJQ A;  4DL7 A;  2D6F C;  4OO1 J;  1DXS A;  3AMZ A;  2RDI A;  2VJ5 A;  3QU2 A;  1KQQ A;  5KNI A;  4O9M A;  1U9L A;  3QEB Z;  4F50 A;  4O3M A;  5KFX A;  3T5K A;  4MF2 A;  3G6V A;  4DQS A;  5J2F A;  5KFA A;  4TUR A;  2HBJ A;  4FBT A;  3UXO A;  5ALH A;  4F4Y A;  3TKA A;  2G5I B;  2YX8 A;  1JAL A;  3JPT A;  5T14 A;  2PKE A;  1S0O A;  4J9N A;  1X9W A;  1N62 A;  5DLF A;  5ALL A;  2W8K A;  1XSP A;  3IM1 A;  2DWQ A;  1ZYQ A;  1ZD5 A;  4Y2P A;  2XY6 A;  4Q8F A;  1B43 A;  1RDF A;  2JEF A;  2Y0S C;  4TUQ A;  2ZUD A;  3QUQ A;  5ALN A;  4UB8 U;  3OHA A;  2V9W A;  3RB6 A;  1T94 A;  5L1I A;  4PL2 A;  5A0L A;  4ED6 A;  2V4Q A;  4P0Q B;  3ONN A;  5H2F U;  1MC8 A;  3IDW A;  2NRZ A;  4QZG A;  2UVR A;  3MR2 A;  2R8K A;  5HR7 A;  3GV5 B;  5EWG A;  1ZQN A;  2K8C B;  5J8Y A;  4F8R A;  2WB1 F;  1JXL A;  2DL0 A;  4PGQ A;  4ED7 A;  1N63 A;  1A76 A;  2R18 A;  4QZF A;  2E3T A;  5J0R A;  4MFC A;  1UA0 A;  7ICI A;  2ATL A;  5KFW A;  5AI8 A;  4RQ3 A;  5L1J A;  1J97 A;  4M9N A;  1BPD A;  3HW8 A;  2Z7J A;  2F8L A;  4IRC A;  3EPG A;  4O5K A;  5DB9 A;  1XC9 A;  5J2E A;  1HUO A;  5J2B A;  2KVC A;  3UQ2 A;  3TQ1 A;  5DGB A;  8ICQ A;  5J2D A;  4ACO A;  2R8H A;  4M6W A;  2P35 A;  3WK9 A;  3QUB A;  5CRX A;  2KK0 A;  5AM4 A;  2J6T A;  8ICK A;  1ZRM A;  4F5R A;  2BHN A;  2YQE A;  3QZ7 A;  2ES6 A;  2QB1 A;  3LWL A;  4GXI A;  3MC1 A;  5KFD A;  5KFC A;  1A77 A;  4XQ8 A;  2XO7 A;  1ZQA A;  5CR0 A;  4J9Q A;  1HEK A;  2GLE A;  4ED8 A;  3SD7 A;  2W9A A;  8ICA A;  1BVS A;  3F2D A;  2DGZ A;  1NK0 A;  2LYB A;  3BZC A;  2PI5 A;  1P7D A;  7ICJ A;  5CEH A;  2ZIU A;  8ICO A;  3A0H U;  5AIB A;  3RH6 A;  2PFP A;  2BQU A;  5ALF A;  4GC6 A;  4DL5 A;  2FLL A;  1L3S A;  4Y2Y A;  1NK7 A;  1V85 A;  3SEI A;  3OJU A;  2R8J A;  3AL0 B;  3UXN A;  4BWM A;  4DL6 A;  5E79 U;  3JPR A;  3CP8 A;  3SI8 A;  2HBM A;  3AN1 A;  1KFD A;  2L5Y A;  5J0X A;  3FM9 A;  3B0Y A;  3A0B U;  3PX0 A;  3EPI A;  2WF5 A;  4O3O A;  2IOF A;  3C28 A;  4JV0 A;  2DQN B;  2F1J A;  3PY8 A;  8ICY A;  2QB0 B;  1KEJ A;  3GIL A;  4F4Z A;  1DK3 A;  2HI0 A;  4Y2J A;  2OXO A;  3RJI A;  3EWA A;  1ZET A;  2A19 A;  1S77 D;  1SKR A;  7ICO A;  4NLB A;  5J2J A;  3TAP A;  2DUY A;  1SKW A;  5BPC A;  1Q8K A;  3WKB A;  1Z4N A;  3WK5 A;  2NYV A;  2B0C A;  1L7M A;  1N5W A;  4KLS A;  5DB7 A;  5EE9 A;  3C29 A;  2W9C A;  5D4B A;  2WTF A;  5III A;  5ALU A;  5CB1 A;  5AK4 A;  2PFQ A;  1EXN A;  4QW8 A;  5KT3 A;  3V7L A;  3MGV A;  3IHQ B;  3SR6 A;  5DBA A;  1N60 A;  5L1L A;  2K89 A;  4C8O A;  3HKZ C;  2V4R A;  1ZD4 A;  3H8S A;  1OXJ A;  4P0P A;  4XA5 A;  1N56 A;  3WK4 A;  2D3D A;  4CF3 A;  1F44 A;  2LHT A;  3QU4 A;  5HML A;  3SAG A;  4UW9 A;  2ASL A;  3IV6 A;  4DOA A;  5KFZ A;  5BOL A;  5J8Y C;  1V38 A;  4O3R A;  4TQS A;  3PVX A;  2J6S A;  5J2I A;  4CDG A;  4FO6 A;  5TIS U;  1ZQS A;  3QU7 A;  4IR1 A;  2ZUC A;  4O0I A;  3PSF A;  1S0N A;  3GIK A;  3KHH A;  5HP4 A;  4PGY A;  3DEE A;  3MGI A;  2W3S A;  5ALW A;  3IP4 B;  2DF4 B;  2JMG A;  2KJ8 A;  1RQN A;  2F77 X;  2HCF A;  4LZG A;  2R8G A;  2ZTE A;  1KKX A;  2AXT U;  4AYB F;  3KFU F;  3GFK B;  5KFE A;  1NKE A;  5AKG A;  5K4L A;  3RB4 A;  5KFL A;  4LVS A;  1HJP A;  2Y1I A;  5KG0 A;  2IBK A;  1S5L U;  2EAP A;  2KKV A;  9ICM A;  4ELU A;  3NRZ A;  4CF4 A;  5ALE A;  2N1R A;  4NV0 A;  2KD1 A;  4M9G A;  1TK8 A;  5AI6 A;  2QAR B;  2JEI A;  4DOB A;  4CE6 A;  3JPQ A;  2HVI A;  4DSK A;  1WWV A;  1A0P A;  2F1H A;  4M47 A;  4KN4 A;  4Y2X A;  1ZRN A;  2K4P A;  3N28 A;  3LK9 A;  2RP5 A;  2H5X A;  2HBK A;  2Y1J A;  7ICR A;  1SXE A;  5AK6 A;  3PSI A;  3SMV A;  4QJF B;  1Z4O A;  1TK0 A;  2EAM A;  2CPR A;  2LI6 A;  2ISP A;  2ZIW A;  3KKA A;  2BCS A;  4HAI A;  2Y9T A;  4BJQ A;  2IOF K;  3CYM A;  4Z6E A;  2XCP A;  4BX9 C;  2NO5 A;  3T5J A;  4UAZ A;  2B6G A;  1KFS A;  1K1S A;  3L5K A;  4RQ7 A;  4UBB A;  1RYS A;  3HWT A;  1T3N A;  7ICU A;  5JRT A;  2I1Q A;  4IQV A;  4UAY A;  1NJW A;  9ICE A;  1IV8 A;  3F5E A;  5AKI A;  5J2A A;  2A1J A;  2C22 A;  5DB6 A;  1SWV A;  5KFF A;  1NK6 A;  2BPC A;  1XU4 A;  3WK7 A;  2NRV A;  1Z1V A;  9ICV A;  3V7K A;  2VJ4 A;  3TAN A;  3ISC A;  4OJP A;  1XNS A;  5DBC A;  1RQL A;  3HRD D;  2XID A;  2PFN A;  5KFP A;  2FE9 A;  3ALR A;  4LZD A;  5KG2 A;  3M8S A;  1YZ6 A;  8ICE A;  1ZQX A;  1FIQ A;  5AK5 A;  2FLN A;  4C8L A;  4DQI A;  5J2H A;  3TI0 A;  3OSN A;  3NVV A;  4JWN A;  2W7O A;  4J9L A;  2PFO A;  1NKC A;  7ICF A;  1BPY A;  2ZIV B;  2ZIX A;  2W04 A;  2Y0S F;  4DSF A;  2A3V A;  3M9M B;  7ICV A;  5DGA A;  4I2I A;  1PVP A;  2G0A A;  1TAM A;  3BQ1 A;  4RPX A;  9ICO A;  4FZN A;  2BCV A;  2F1I A;  4ECV A;  2Q4T A;  2G09 A;  4RNO A;  4Z6C A;  3PW4 A;  4BXO B;  1SZP A;  1S0M A;  4YR0 A;  8ICJ A;  3DV9 A;  4UAT A;  4QWE A;  5KFI A;  5AKK A;  1SGG A;  2AGO A;  2JHD A;  2E1E A;  4C7Y A;  1KRP A;  3T5H A;  4UAU A;  7ICL A;  4YMO A;  3KBB A;  3EZ5 A;  2VA8 A;  2HOF A;  3PMN A;  5AKX A;  2KHV A;  3QEA Z;  4YN4 A;  2DKX A;  1Z3E B;  5J0W A;  2JZB B;  1NK4 A;  3PO5 A;  1ZOL A;  7ICM A;  1ZQR A;  5ALX A;  1JRP A;  4EYI B;  4B9N A;  5AI9 A;  5DG7 A;  3BQ2 A;  1V97 A;  4RQ0 A;  4F93 B;  1WUD A;  2ZXH A;  3LVV A;  4KLL A;  3N7S C;  3D2N A;  5KTQ A;  2YMQ A;  4RZR A;  4PPX A;  4YCX A;  4KMU A;  4K4G A;  3L3F X;  3KZX A;  1J2M A;  4O5C A;  1SWW A;  1JIH A;  4EX6 A;  4Q44 A;  4I2J A;  3SQI A;  2HW3 A;  5AM3 A;  2F44 A;  9ICI A;  5KT2 A;  4I2H A;  4Y2Q A;  4RPZ A;  4FS2 A;  3RB0 A;  2W43 A;  4RNM A;  2G07 A;  4UB3 A;  4NWI A;  4UB6 U;  5G5G A;  3UMB A;  5HMM A;  3TAD A;  3WK6 A;  3ETR A;  1UT5 A;  2KIW A;  4AP9 A;  2JEJ A;  4P2H A;  4YG2 A;  3AEV A;  4I28 A;  4QWD A;  4J9R A;  2PI4 A;  5J2C A;  5IIK A;  3ZDE A;  1N61 A;  1QLN A;  5DG9 A;  1XS9 D;  2FJ6 A;  5ALG A;  2YTU A;  2YMM A;  3EUB 2;  4DSE A;  4B6J A;  4DOC A;  1JRO A;  4M04 A;  1SL1 A;  4C80 A;  1ZQW A;  2ESE A;  5F3X B;  3FAH A;  5JU5 A;  3QYP A;  4J9S A;  1F5S A;  1JMS A;  3AU6 A;  4DLE A;  5ALK A;  1YZ7 A;  4QWA A;  1BPB A;  3H4B A;  3TAQ A;  4J03 A;  4OD0 A;  1BPE A;  4KLF A;  3DDH A;  1Z1B A;  3WKA A;  5D46 A;  1ZQP A;  2XCA A;  1X42 A;  5J0Y A;  2BZF A;  2ZTC A;  3M1Y A;  2JGA A;  4ECQ A;  1JI7 A;  1KW4 A;  4NLK A;  5DQG A;  2ZJA A;  1SZH A;  1VJ5 A;  4DFK A;  3ISB A;  7ICT A;  1X40 A;  3QXG A;  4EEK A;  5KFO A;  3G6Y A;  2MAX A;  5KAF U;  3UXP A;  3N4M B;  2NRW A;  1X2I A;  4Y2V A;  4KLT A;  2KP7 A;  5J0O A;  2YML A;  1ZJM A;  3E0F A;  4I2D A;  4KLD A;  2O6K A;  2LKY A;  2LBO A;  3GIM A;  2UVU A;  9ICS A;  3TFR A;  2RLT A;  3KHG A;  5J0U A;  3D2S A;  9ICG A;  3PZP A;  5AKL A;  2FDR A;  1UPH A;  1ZQB A;  5HR6 A;  4MF8 A;  1N2X A;  3N97 B;  4OJ5 A;  4FS1 A;  2E8N A;  3HKZ F;  4G9B A;  3PW5 A;  4UB2 A;  5J2G A;  3K4G A;  2AH5 A;  2PMZ C;  4GC7 A;  9ICT A;  1RXV A;  4PH5 A;  3OTQ A;  4RT2 A;  3QZ8 A;  2HHW A;  2DFL A;  4DFM A;  2KFZ A;  2QLT A;  3C21 A;  4KX5 A;  3C5G A;  5ALS A;  2KIC A;  2KN7 A;  4NM2 A;  4M6W B;  3RJJ A;  4RQ1 A;  3BS5 A;  4I2A A;  3RAX A;  1ZQI A;  1SXD A;  2LPE A;  3F5A A;  4RQM A;  2EDU A;  1Z00 B;  1WG8 A;  4C7Z A;  1RM6 C;  1RPL A;  5EE0 A;  4FFD A;  3VC8 A;  4C8M A;  3IRU A;  3F2C A;  1DK2 A;  1L7N A;  1D9D A;  3AM9 A;  4XUS A;  4ICA A;  3D6J A;  5KFY A;  1NK8 A;  1YT3 A;  3FC4 A;  1ZQT A;  3NVY A;  5ALQ A;  1PK1 B;  3RR8 A;  3PR5 B;  5B5E U;  2ZIU B;  1KLN A;  1OW5 A;  3VCB A;  2HBL A;  5KG7 A;  4UBC A;  5JTI A;  3Q8Q B;  2JXJ A;  5KFH A;  2WF7 A;  2HHU A;  1L5U A;  8ICN A;  3FDS A;  4HYK A;  3WU2 U;  4I29 A;  3OPX A;  2W9B A;  1WWU A;  1TV9 A;  2XY5 A;  1XSN A;  4MEX A;  4GFJ A;  1F0M A;  1ZQ1 C;  4CCH A;  3V6K A;  2KHQ A;  1TK5 A;  2H3I A;  3I28 A;  9ICU A;  4EBC A;  3TFS A;  2LYH A;  3QUT A;  5ALR A;  5DKW A;  2MSN A;  3BJY A;  5DG8 A;  4QZE A;  1FO4 A;  2XGQ A;  4RQ2 A;  1DOQ A;  2I9G A;  5IIN A;  2B21 A;  3CNH A;  3KTQ A;  5IIM A;  3PW2 A;  4JV1 A;  3H8M A;  1X9S A;  2EZX A;  4EEL A;  4USA A;  1OUQ A;  1JXE A;  4DEZ A;  1LB2 B;  1UQV A;  4QIW C;  1TE2 A;  4US8 A;  4DO9 A;  5HNK A;  1V9P A;  1NI3 A;  3M6Z A;  3HP6 A;  4X5V A;  2AQ4 A;  1SV0 A;  5KT6 A;  2JV3 A;  1XWL A;  2OEH A;  3PX6 A;  4PZN A;  1D9F A;  1L3U A;  3RJG A;  1CRX A;  2E8M A;  2W9C B;  1CI4 A;  3ISD A;  2ASD A;  5KFQ A;  8ICW A;  4IR9 A;  3PO4 A;  2KKP A;  2WF9 A;  5DQH A;  2DPJ A;  1U47 A;  4PGX A;  4Y2R A;  1U45 A;  2FLP A;  5AI0 A;  4B9S A;  3RBD A;  4JK1 A;  3F53 A;  1LV5 A;  5CHG A;  1B22 A;  3H8W A;  3PR4 A;  2GH1 A;  1UA1 A;  4KLH A;  2EZY A;  4P0P B;  2MUT A;  3HIL A;  4IC9 A;  3Q8L A;  2KZZ A;  2OM6 A;  3C1Z A;  4Z6D A;  3RJK A;  2JH1 A;  3SV4 A;  2D8C A;  3RFA A;  1PVQ A;  1RYR A;  5CP2 A;  2H3Q A;  5ALM A;  5ALP A;  2CN1 A;  8ICL A;  1X9M A;  3MR5 A;  4K4H A;  1ECW A;  3MAB A;  4QZD A;  1RYU A;  1BGX T;  1M6Y A;  4PHD A;  3Q8R B;  9ICB A;  2KSO A;  1D8L A;  1N48 A;  2WAQ C;  4B9V A;  1S9F A;  5IIJ A;  2XIC A;  2BGW A;  1S10 A;  2DBY A;  5EWE A;  2I6X A;  4C8N A;  2YMP A;  4B9U A;  1S97 A;  3NAS A;  5J0T A;  4P4P A;  3RR7 A;  2P6R A;  4QNL A;  5KFJ A;  1JN3 A;  3UM9 A;  4XRH A;  2F2A B;  4YR2 A;  1K1Q A;  2NV3 A;  3H40 A;  1ZQZ A;  5KFN A;  2Q0Z X;  3SAF A;  2H3F A;  4QW9 A;  1TAQ A;  3QU9 A;  2G5H B;  3BQ7 A;  2VIX A;  3B0X A;  4DCC A;  1TFR A;  3MDC A;  5AKJ A;  2DKZ A;  4EEY A;  3THV A;  3WKE A;  4ED2 A;  3JPN A;  4EYH B;  3V6J A;  2LMR A; 
#chains in the Genus database with same CATH homology
 2K8C B;  3D2Q A;  4JMU A;  3CP8 A;  3PST A;  2WB1 F;  3VC8 A;  2HBM A;  2ZIX B;  4CDG A;  3F2C A;  2HOF A;  2G06 A;  2KHV A;  2KKP A;  3LYS A;  2R18 A;  1Z1B A;  2M0N A;  5C0Y A;  4FZL A;  4ICA A;  1XO0 A;  3CRX A;  2HOQ A;  3F5E A;  3PSF A;  2JGA A;  2ZIV A;  5KL1 B;  1HIW A;  4U7C A;  3C28 A;  2XVT A;  1Z19 A;  1YT3 A;  3DEE A;  2DQN B;  2D6F C;  3F53 A;  4OO1 J;  1WUD A;  1SZH A;  2GOL A;  2WB1 C;  2VJ5 A;  2ZXH A;  3LVV A;  3GU3 A;  3IP4 B;  2DF4 B;  2K4I A;  3AQF A;  1ED1 A;  1L6N A;  2JMG A;  3RF9 A;  2K4H A;  2KJ8 A;  2OXO A;  2F77 X;  2ZIU B;  3D2N A;  3N7S C;  2Z7J A;  3T79 A;  2F8L A;  2GH1 A;  2MA1 A;  3VCB A;  2HBL A;  2ZIW B;  2K8B B;  2VJ4 A;  3N7R C;  2G08 A;  2KNJ A;  3N7P D;  4AYB F;  2K4E A;  4O3M A;  4P0P B;  3KFU F;  2OYY A;  3L3F X;  1Q3V A;  3KZX A;  4OJP A;  4IC9 A;  4NLB A;  1XNS A;  2RRD A;  2XID A;  2OM6 A;  2OH2 A;  2KVC A;  2VKQ A;  4P0Q A;  2JH1 A;  2KJ9 A;  3ALR A;  2BDU A;  3F2B A;  2HBJ A;  3SQI A;  3OPX A;  3RFA A;  4ACO A;  1PVQ A;  4KX3 A;  3K1Z A;  2H3Q A;  3E0F A;  2G5I B;  2KKV A;  2YX8 A;  2LKY A;  4FZM A;  5CRX A;  2CN1 A;  4GFJ A;  1IIP A;  3O0F A;  2LBO A;  4AYB C;  5T14 A;  2WAQ F;  3AL0 B;  2HOI A;  4WJ3 B;  1ZQ1 C;  2ZXI A;  1ECW A;  3D2S A;  2KHQ A;  2N1R A;  2YB4 A;  3AQE A;  2W7O A;  3PZP A;  4NV0 A;  3IG8 A;  2H3I A;  3C29 A;  4CGZ A;  2E1F A;  1UPH A;  2G07 A;  2KD1 A;  5KL8 B;  4NWI A;  2W7P A;  2PMZ F;  4OJ6 A;  2KIW A;  2CRX A;  2MRL A;  2ZIV B;  5HR6 A;  3H0R B;  1Q3U A;  2ZIX A;  2W04 A;  2Y0S F;  2E5S A;  3SAH A;  2A3V A;  2F76 X;  2WAQ C;  4OJ5 A;  2H3V A;  3LVW A;  4U6P A;  1HEK A;  4QIW F;  2XIC A;  1PVP A;  1D8B A;  3H0L B;  3HKZ F;  1A0P A;  2G0A A;  2H3Z A;  1TAM A;  2KV2 A;  2RHF A;  1A6S A;  4FZN A;  1GO3 F;  3MGV A;  3F2D A;  2DGZ A;  1URJ A;  1OUQ A;  2PMZ C;  2KJ5 A;  2LYB A;  2Q4T A;  3IN5 A;  2RP5 A;  4OJL A;  2HBK A;  4OJO A;  4QNL A;  1P7D A;  2G09 A;  2Y0S C;  3ICX A;  2LYA A;  2F2A B;  3PSI A;  1DRG A;  3PSP A;  3H0M B;  2HMX A;  2K8A A;  2NV3 A;  2K89 A;  3SMV A;  2XI9 A;  4QJF B;  4QIW C;  1PVR A;  1T94 A;  3M6K A;  4FE3 A;  2ZIU A;  4PL1 A;  4PL2 A;  3HKZ C;  5A0L A;  3IG5 A;  2CPR A;  4KX5 A;  4NLC A;  4P0Q B;  2YB1 A;  3SAF A;  2H3F A;  3ONN A;  2ZIW A;  2W03 A;  3M6Z A;  3NUQ A;  2KIC A;  2JH7 A;  4P0P A;  4BUG A;  4BJQ A;  2G5H B;  4A8E A;  1KBU A;  2VIX A;  1F44 A;  3CYM A;  2LHT A;  3SAG A;  4BX9 C;  3F5A A;  1MA7 A;  2ZG6 A;  2JHD A;  1NZB A;  3M7D A;  1CRX A;  4C0Z A;  4CRX A;  2KEY A;  2E1E A;  3NRW A;  5HR7 A;  4KMO B;  3GZF A;  2KOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...