2HHVA

T:o6-methyl-guanine in the polymerase-2 basepair position
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*TP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhvA01
3HPHA 7ICSA 4TUQA 2PFPA 3P83D 3KKRA 4E0DA 7ICUA 5FDLA 5KG3A 2G8HA 3C6TA 3VQPA 1NK9A 2MUTB 3ETLA 4J9OA 1QLNA 1KFDA 3ZT0A 5KFKA 4O3QA 3H4BA 3DOLA 3SZ2A 5DB8A 1U04A 4RW7A 4KLEA 3LDSA 4CHOA 2OZSA 2A1SA 1ASVA 2VWJA 1J5OA 4EEYA 2BDPA 1IH7A 5CB1A 4C8KA 5KGXA 3VQ7A 3UQ2A 4Z0UA 3K75D 4F5OA 3AVNA 2VWKA 1SV5A 4FLZA 1BPBA 2UVWA 2DFFA 4R65A 4C8NA 5I42A 5D3GA 2VA3A 1KVBA 4IQWA 3UXOA 1UA1A 5CJ7A 3AVAA 3TAGA 3V6DA 4J9QA 4Z6DA 5DQHA 3RJKA 3VQ8A 4ZTJA 1ZQSA 3PR4A 1NK8A 3O3GA 4NY8A 5SZTA 3C2LA 3LWMA 4J9PA 4KTQA 3OYLA 3VN5A 4DFKA 2KZZA 1LAVA 4IDKA 5HMMA 4TURA 2F8TA 3RB0A 4KAZA 2NRXA 4CK3A 1WSIA 2W9BB 2FLLA 4HVJA 2ZUCA 1CZBA 1U49A 3K5LA 4C8OA 2R8GA 1RDDA 1ZBHA 3PVXA 3TANA 1QTMA 2NRVA 4EYIB 5CZ2A 1UT8A 4CIEA 2PZSA 4O5EA 2W9BA 2G8IA 2HHTA 3QESA 3KD1E 2BQUA 4RQ5A 1KLNA 4Q8FA 3ZT4A 3AO2A 2P6RA 3CYMA 3ZDEA 3EWAA 4HYKA 4OKJA 3LAMA 4F4ZA 3ULDA 4QZIA 4DS5A 1H38A 7ICFA 3DMJA 4CGIA 1TV6A 4DEZA 3AO5A 3MFHA 2HB5A 2RN2A 2RDJA 8ICJA 2XO7A 4M3TA 1VRTA 4CECA 3EZ5A 1JLQA 4CJKA 2ISOA 3C1ZA 3OS0A 4DL2A 2R8JA 5C5JA 5FROA 3O3HA 3OY9A 3GV5B 2GWSA 1JL1A 1FK9A 1RDCA 3V6JA 3AVIA 4DQIA 4LZGA 4OVLA 1ZQRA 1D8LA 1NKEA 1T8EA 4CEQA 1ZQXA 3QE9Y 4B9TA 2NRTA 4QAGA 4GC6A 1NJXA 2JEGA 2FBVA 4J9MA 4M47A 2IC3A 3M8RA 3JPQA 1I39A 4RQ8A 3AO3A 3DLHA 1C0TA 4DMNA 4HUFA 3MR3A 4F4WA 2HNDA 4DTXA 4DOBA 1JLFA 1AROP 4XUSA 4ZTFA 1BQMA 5HRPA 2A1JB 9ICFA 9ICIA 8ICWA 4FLUA 1JLAA 2DFLA 2E4LA 3OYJA 4K4IA 2ZTCA 1C0MA 3BQ2A 4ECWA 1ZQDA 4FZXC 8ICKA 2W9MA 1A76A 5J2PA 3RJGA 3JSMA 3RTVA 1IKVA 4J2BA 3K5MA 4IR1A 1WSEA 1Y88A 4DL4A 3H4DA 3ZD9A 4M6WA 1N56A 4CK2A 4O3RA 3THVA 2PFOA 3RH6A 2BPGA 4LSLA 4F2SA 4DTRA 4MFBA 4F93B 4I2FA 1RT2A 1O1WA 3HO1A 2J6SA 5KFQA 4ZHRA 4OPJA 5KFPA 4EP4A 8ICOA 3KLFA 5EOZA 9ICBA 3T5KA 2OPRA 9ICGA 1RDBA 4EZ9A 3MBYA 2B6AA 3HK2A 3UPQA 1LWEA 1C1BA 1I3AA 4GVMA 4RUCA 3HPOA 3LAKA 1GOBA 2YNIA 4BDZA 4CJTA 1Z3EB 1JXBA 4ELVA 1WSHA 3DLRA 1NJZA 1D9FA 2R8KA 4Z6CA 4R64A 3MEEA 4Q8EA 3Q8QB 4AHSA 4B9LA 4CF2A 2FMQA 3M8SA 3M8QA 4YG2A 4NLNA 3KK3A 4LVSA 3C21A 1HJPA 3P1GA 5J2IA 3EPGA 4ED3A 3LPTA 5J0WA 4FO6A 3WNGA 2ZE2A 5D4BA 5KFGA 1QHTA 1YT3A 2GV9A 3QIPA 3RJFA 5DLGA 2ITGA 4KKOA 5HRNA 1XWLA 4PPXA 4P4PA 5J2NA 1RXWA 4AHUA 1S10A 4CHPA 4O5CA 4I2AA 4CEZA 2OPPA 4CJUA 4M3RA 4IG3A 3DI6A 3MEGA 4KTWA 4B3OA 4FBUA 4FLYA 1ZJNA 4RT2A 4UBCA 1S0MA 5SWMA 4YN4A 5CA7A 4I2GA 3VQDA 5KG0A 5EWFA 4J9LA 1RT7A 4Z4IA 3VQBA 1HYZA 3V9WA 4IFYA 4FS1A 4QCLA 1VK0A 1C1AA 4MF8A 3HL8A 2NRWA 1TL1A 4E7JA 4M3YA 9ICKA 4OKEA 3PMLA 1HQUA 3TFSA 4DU4A 1WAFA 2BCQA 5DLFA 1UAXA 4QZBA 4J9KA 3O4NA 3GIKA 1JLEA 2BE2A 1TKXA 1ZQHA 5KG6A 9ICLA 1HRHA 4RQ1A 5CR0A 4CFCA 4H8KA 4ECSA 5L9XA 2W9CB 4DLEA 4RU9A 4KLJA 5HHIA 1RT3A 4YXMA 3C5FA 3SYZA 3TAEA 3I0RA 2C22A 4MF2A 1SZPA 4P4OA 3T5HA 1A5WA 1HUOA 9ICPA 1VSKA 1NK0A 3Q8LA 5BOLA 1ZQKA 3RR8A 5KFFA 1ZBLA 2JZBB 3ISCA 2ASJA 3NHGA 2HNZA 4ECTA 3V4IA 2EHGA 1L3TA 4R8UB 3WNFA 4DTJA 1IXRA 4TUSA 4PGXA 7ICJA 3ZSOA 4PQUA 3T3FA 4DQPA 4FJLA 4Z4FA 1WNSA 1EETA 4XQ8A 4M3WA 3PUFA 4F3OA 1VSJA 5IIOA 1VRUA 5KFWA 1NKCA 2D0BA 1CXUA 3V9ZA 4KFBA 4ID5A 1X2IA 5J0OA 4R8UA 3EW9A 3JPOA 3DRRA 2ZD1A 2PXIA 1Z26A 4AHTA 2ALZA 3UXPA 4Q45A 8ICUA 1S97A 1VSIA 4KLDA 4UB5A 4M45A 3QEIA 3MDAA 4M3UA 1BPEA 1TV9A 4HUGA 4RUAA 3RMDA 3H7IA 2RDIA 5F9NA 4CF8A 1SUQA 4NCBA 4PH5A 3JPRA 4M9JA 1F21A 5CP2A 2XCAA 1XSPA 4JUZA 1VSMA 4G1QA 1BI4A 2X74A 1BCMA 1QE1A 2P66A 1RBSA 5HLFA 1XI1A 2ZJ8A 1UOCA 3GIIA 2BPCA 3AVMA 4GXJA 3PY8A 4Z6FA 2HHXA 4F5PA 3QNNA 3ISDA 4CJVA 9ICQA 4AHVA 4CEDA 4KLLA 3ALYA 3GILA 4CF1A 4Z4CA 4CJ5A 5FRNA 1WCLA 3TAPA 1T03A 3RRGA 1KLMA 3SNNA 4HCCA 1REVA 5L1IA 2FBTA 3OS1A 4ECXA 3I8DA 5HP1A 2PI5A 1CEZA 3OHAA 3D0PA 1EP4A 2W8LA 4CFDA 3S9HA 1DTTA 4RZRA 1HUZA 1S6PA 2JGUA 4DG1A 4QZ8A 4RQ2A 2D0CA 2AGQA 4YMMA 4IRKA 4BACA 4QWBA 2KZMA 1CUKA 4I7FA 1DLOA 2X78A 3V6HA 4KREA 1MC8A 3LALA 1BIZA 1FXXA 1WN7A 8ICPA 3JPTA 2FLPA 4F4YA 3FDSA 4W5TA 1C6VA 1ASUA 5IINA 4TQRA 3VQ6A 4FLTA 4FZZA 1RTJA 4DL5A 2DTUA 1XSLA 4NM2A 1ZQUA 4B9NA 1J54A 9ICAA 4IQUA 1UA0A 3AO1A 4F8RA 4QZGA 1DGSA 2YV0X 4I9QA 4C8LA 1Q8IA 4EZ6A 2HNYA 3PNCA 4ECVA 3L2UA 3RJJA 5CYQA 3VQ9A 3S3MA 4JV2A 4MQ3A 2ATQA 4PA1A 4B9VA 3C2MA 4RPXA 9ICSA 2FBXA 3AVKA 4JLHA 3K5NA 4CJWA 4DTPA 4O3NA 3PW5A 3AA2A 1S5JA 2I1QA 5L1LA 1RBRA 4DSLA 3QETA 1C1CA 1UWBA 3KD5E 4N5SA 2XC9A 4P2HA 3NDKA 2KFNA 2R7YA 4FJ5A 2JEFA 2BHNA 4PHDA 3SQ4A 2BCVA 3TI0A 4EYHB 4QZEA 3VQ5A 2IGIA 1ITGA 2HHVA 4KHWA 4UB3A 2UVVA 3M9NB 1ZQMA 1NOMA 1T05A 2XCPA 4IRDA 2ASDA 4ECZA 3A2FA 4CK1A 3HT3A 4YR2A 4OJRA 3G6YA 1ZQLA 4BXOA 2NUBA 5JS1A 1L3VA 1VSFA 4E3SA 5CHGA 4KHNA 3IRXA 3ZT3A 3ZSWA 1RTDA 5J2QA 1NK7A 4O9MA 4B9MA 4KI4A 1EX4A 2C2DA 1BPZA 4FM1A 4KHUA 2BQ3A 4CIFA 3PW4A 2KZ3A 4B9SA 3TAQA 5J0TA 3M8PA 4DSFA 2JLEA 2BCUA 1U9LA 4MFAA 3LP0A 1Y97A 2IS3A 3NFAA 3P5JA 3RAQA 9ICNA 3DRSA 5J2BA 4QZAA 4KLHA 3L2RA 3C5GA 4KLIA 4EBCA 2D5RA 1GOCA 2EX3A 4CGHA 4E89A 2LYHA 4I2CA 4CGGA 5DDMA 1DOQA 4CJ3A 3RMCA 3CFOA 3JPSA 1EXNA 2E6LA 3G6XA 1HPZA 2ZUBA 2BR0A 3VQCA 4CGDA 4FM2A 1MSWD 2ETJA 5DMRA 4PY5A 4YMNA 4E7KA 1COOA 4DSKA 4NLZA 4OLAA 3IM1A 2PY5A 2HHWA 3V7JA 3H08A 2BGWA 8ICCA 4JS4A 4R66A 4OKKA 4Z4GA 1XO1A 2UVUA 3OS2A 4YMOA 4M2YA 4FXDA 5EWGA 2KN7A 2Z1JA 3DRPA 2QKKA 3L8BA 4DQRA 2XGPA 4BE2A 4UBBA 4KITB 3QINA 3ISNC 4DTOA 5DKWA 4B8CA 3PX4A 1D8YA 3HJFA 5C42A 3UIQA 4FK2A 4H4MA 3SQ1A 2C28A 3V7KA 7ICNA 8ICAA 1S1VA 4FJJA 5J0YA 5T7BA 5DQIA 1CXQA 4CEOA 4IRCA 4QZDA 4M42A 1TGOA 3ZCMA 3OYAA 5D49A 4FJXA 4FJ7A 9ICXA 4FVMA 4YVZA 2HMIA 4DQQA 3SI8A 4GW6A 1TKZA 2B5JA 1IKYA 4PHPA 1QSLA 3PV8A 4IFVA 4KLGA 4YD2A 2ASLA 4CEEA 3B0XA 3GV8B 1IKXA 3AO4A 3H8WA 3GV7B 3MDCA 4RW4A 4CGFA 1ZQCA 3HPGA 4CJEA 2R8IA 4FJHA 2OYQA 1XU4A 3MGIA 3LWLA 4QWAA 1QQCA 4M6WB 1S1XA 4TUPA 4DLGA 4QZ9A 2RPIA 4CJQA 4LH4A 4E7LA 3OYKA 1KVAA 4C8MA 7ICVA 3RH4A 3H40A 1ZQZA 4FYDA 2DPJA 3V9XA 4FJIA 2IAJA 3KK1A 3MFIA 4AHRA 1RBTA 5KFAA 4JK1A 5CYMA 4CEFA 2KFZA 1KFTA 1MQ3A 1RT6A 4DS4A 5HRRA 1VSEA 4I29A 4PHEA 4CEBA 2OZMA 2DY4A 4DF4A 4FS2A 3V6KA 2C2RA 5J0UA 7ICRA 2XRIA 4YQWA 3NGYA 1BHLA 4PGQA 1ZQGA 1MQ2A 1B22A 4EP5A 4DSIA 4Q43A 3GDXA 5L1KA 3RWUA 5J2FA 2D0AA 3PO4A 3HYFA 1LW2A 3MGHA 8ICFA 4KPYA 3TABA 5J2CA 3VQ4A 5KFYA 4FJ9A 1B43A 4DFJA 5L1JA 1TVAA 4DO9A 1NKBA 1JXEA 3OVNA 2FPMA 5KT3A 5KT6A 3RRHA 4CFBA 5DBAA 5KFDA 1A77A 1ZQJA 3AA5X 3AVCA 1ZBUA 1LWFA 1SL2A 4Q44A 1HNVA 1ZQQA 4RQ7A 3NTUA 5KFUA 3TR8A 3Q8KA 4KHSA 3PW2A 3BJYA 4QZFA 4NYFA 4M9LA 8ICMA 1ZQBA 1J53A 1RNHA 3G10A 5J2JA 4UB1A 1NJYA 5IILA 1S0VA 2C2EA 3EPIA 4CJPA 3OYEA 4PHAA 3NE6A 4E1NA 3ZDBA 4CFAA 3SPYA 4Y1CA 7ICEA 3SUQA 4CHNA 3LK9A 1SKWA 3IAYA 3JPPA 4KV8A 3OYHA 1JL2A 1JIHA 4QWEA 4B8AB 3HVTA 1ZQYA 3EYZA 2Z1IA 4IQVA 1BQNA 4E7IA 3HWTA 4RQ0A 4J9RA 3N97B 1EXQA 4N47A 3GFKB 1ZQWA 4Z4HA 3LZIA 4JV1A 3G6VA 4KLFA 8ICSA 3OHBA 1Q9XA 1YTAA 3AV9A 8ICIA 4RW9A 1S77D 1JXLA 3VQAA 4ED6A 3NH2A 4B9UA 4I2PA 3E2EA 2B4JA 4PWDA 3KHLA 4KLTA 2ZQBA 3I0SA 4O3SA 8ICHA 4CF9A 3OSPA 2VG7A 4I27A 3DYAA 4W5OA 3HSTB 5KFIA 2DFEA 4DL6A 4DTNA 3L2VA 4F4XA 3KLIA 5KRSA 4DL7A 2RKIA 5IIJA 4BGDA 3RBEA 1D9DA 5DG7A 1ZQNA 4FJMA 1NOYA 1ZBFA 3QIOA 3MECA 3V1RA 5DDYA 1A5VA 3ZT1A 4RNOA 3FFIA 2Y1JA 4F4KA 1IG9A 5CY4A 9ICOA 2XGQA 3ZDCA 4EBDA 4M3ZA 4RNMA 7ICGA 1YVUA 5DB7A 5DQGA 3LPUA 1HJRA 2AQ0A 4QZHA 4NCAA 2V9WA 3AVFA 5KFSA 4KTZA 1BI4B 1XHXA 3OYIA 5DB9A 4R63A 1BCOA 8ICVA 3ITHA 4E7HA 3RJEA 4KB0A 1WCNA 4CHQA 8ICYA 3OYNA 5JUMA 3QLHA 3LANA 3ZSRA 4O0JA 5KG1A 3GIJA 2G8WA 2AJQA 1VSLA 2I5JA 4RQ6A 2M9NA 4Q0BA 2A1RA 3NBPA 3RJIA 3MXJA 3AA3A 5KFZA 1FKPA 1SL1A 3OYGA 3TWHA 4YR3A 4DU1A 4M41A 3L2QA 3CM6A 3BDPA 2KW4A 4FJKA 2R8HA 1ZQAA 1B9FA 7ICTA 1S9GA 8ICGA 9ICCA 1X9MA 1KRPA 4CGJA 4YCXA 2F1JA 4NYNA 2HHQA 7ICQA 4FK4A 5CZ1A 5J2DA 3K4GA 4O3OA 3DOKA 4PUOA 4DTUA 4M04A 4DSJA 3CQ8A 2PYLA 1DTQA 3ZSZA 1U48A 3QEBZ 1NK4A 4ID1A 2PYJA 3G0ZA 1ZQVA 4YP3A 4RQ4A 8ICTA 2O4IA 1S6QA 2P5GA 9ICHA 4IKFA 2MAXA 5KFJA 3F9KA 4DU3A 3SPZA 4CJFA 4LZDA 3RB3A 3KKSA 4K4HA 5TZVA 4I2HA 3JPNA 3F73A 2IBKA 4F2RA 5KFVA 2BCSA 1Z25A 3V1OA 3M9MB 5J0XA 5F9LA 4CF0A 2GBZA 3HX0A 2QXFA 1VSHA 4EBEA 4KRFA 2IHMA 1JLGA 3SQ0A 4GLXA 4UQGA 4ECRA 3AU6A 4DF8A 1SKRA 1KCFA 4TQSA 3OYMA 4NXZA 5KFMA 5IIIA 4J2EA 1JLCA 2ZJ5A 4ED0A 3QO9A 4UAWA 2AQ4A 2Q3SA 1QS4A 3WNHA 4OPKA 5KG4A 8ICRA 1ZJMA 5E41A 2P6UA 3L3VA 1G15A 9ICTA 4WE1A 1Z00B 5J2MA 5J29A 8ICXA 3V9UA 3NGDA 5KTQA 4JWNA 4HCBA 5KG2A 3V1QA 3QZ7A 1L3SA 4BXOB 4CEAA 4KLUA 2DFHA 4ECUA 1HMVA 1JN3A 3TFRA 1HQEA 2OA8A 1KTQA 2W8KA 4M0AA 4N56A 1Z00A 3ZSYA 3C2KA 3TAMA 2NRZA 1TK8A 3V72A 4N76A 3ZD8A 1TKDA 5KFOA 5KFHA 3NCIA 3SUNA 3PW7A 3MR6A 9ICVA 4FCYA 2XY5A 2QK9A 2HVIA 3C94A 4I2EA 2Q0ZX 2YKNA 2F8SA 2MUTA 3O4QA 4UB2A 3NF6A 4QOZB 4K4GA 4CE9A 4YD1A 4I2DA 2VANA 1KDHA 3KLGA 2ZUDA 5KT4A 4K8XA 2FMSA 4O3PA 4IBNA 3UXNA 1JX4A 4CJRA 3U3GA 4FK0A 3HP6A 3TARA 5J0PA 2YNGA 3MXMA 2BANA 5J0RA 2W42A 4KI6A 3OGUA 2BKEA 4M3XA 4UB4A 4N41A 2DPIA 4I28A 1EKEA 3DLGA 4ED2A 2Z1GA 3QEVA 3V7LA 4KN7A 2V4QA 5KFTA 5KT7A 1SL0A 3B6OA 3T5LA 3UQ0A 2Z1HA 3SJJA 4ECYA 4FBTA 4FLXA 4BE0A 4FJGA 3B6PA 4F92B 2E6MA 3VQQA 1RYRA 1WSGA 2H5XA 3KHGA 4KMUA 4JRPA 5DBBA 2YKMA 3OJUA 3CG7A 3D45A 1S1TA 3LZJA 2X6SA 4ED7A 2OWOA 1ZQEA 1B9DA 2FPKA 4O4GA 3LP2A 4CESA 3C23A 3PX6A 5KFXA 4BE1A 2IA6A 5IIMA 5HMLA 4J9NA 4MEYA 4BDPA 2P5OA 2UVRA 4YR0A 4RNNA 1U47A 3ORYA 3PMNA 7ICMA 1VSDA 4XIUA 5J0SA 3HW8A 1TK0A 3K58A 3IHQB 1LW0A 1KFSA 4G3IA 2XY7A 1RT5A 5J0QA 2ZTEA 2PFNA 5D46A 3OYBA 2IHNA 5DGAA 4DWIA 3LDAA 4F91B 1TK5A 4DFMA 2KTQA 4KN4A 4CERA 2X6NA 2YHBA 3H8SA 4O5BA 1GOAA 1JMSA 1T7PA 4L8RB 4O55A 1ZQIA 3NGZA 4ELTA 1BISA 4RW8A 5DG8A 4DOAA 3QNOA 1T4GA 3O3FA 4CJ4A 1ZQTA 4KLSA 3K57A 3CFRA 2FLNA 2G8FA 3SCXA 3NH0A 1K1SA 4W5NA 4DOCA 4KHQA 1J9AA 4JV0A 4E19A 4KO0A 2HVHA 3FYHA 1X1PA 3NF8A 4Z4EA 2G8KA 1WLJA 2OPQA 1U45A 3E01A 3VA3A 5K14A 2JEIA 4CHYA 3AA4A 5DGBA 9ICEA 4LY7A 1NOZA 4RG8A 4R5PA 3KIOA 3GQCA 2ZTDA 4MEXA 2A1JA 3AVJA 4FLVA 1MU2A 5KFLA 3MXIA 3DLKA 5KRTA 1RDAA 3JYTA 4BWJA 1LV5A 4BDYA 5DB6A 4FW1A 4J2AA 2ZJAA 3ISBA 4GXKA 2Y1IA 7ICOA 3Q8SB 2LSNA 3MR2A 3HM9A 3NGIA 3ZDDA 1BIUA 4UAYA 1PZNA 4K8ZA 1FKOA 1T3NA 3K59A 3BGRA 2J6TA 5IIKA 3IG1A 5J2GA 3AU2A 5KFCA 5FRMA 4RT3A 1XS9D 1R0AA 3T5JA 4KLMA 1RBVA 3VQEA 1XHZA 2KQ2A 4FJ8A 4RPYA 2WTFA 3NF7A 4CIGA 3AUOA 1N5YA 3V81A 3QEAZ 4AILC 3HVRA 4P4MA 2VG5A 1XSNA 3ZSXA 1RT1A 2IOCA 3K5OA 1TVRA 3V9SA 5HBMA 3Q8RB 1HNIA 1QSSA 4F5RA 4GMJB 4I2JA 2YHAA 3TQ1A 7ICLA 1YTUA 2ISPA 4OGCA 4GXIA 4RPZA 2AU0A 3MAQA 4CCHA 3ZT2A 5HRSA 2G8VA 3SUOA 4B08A 4I2QA 2WOMA 3MEDA 4W5QA 3RB6A 2FC0A 4YNQA 3RR7A 3RBDA 3KJVA 4ICLA 4IQTA 2AGOA 3WNEA 7ICPA 1TAUA 3OYDA 3BQ0A 4NLKA 4Z6EA 3H8JA 4I2IA 4I9LA 5KFNA 3DM2A 2BCRA 2V4RA 4CHZA 2WONA 4F3TA 3B0YA 2W9AA 5J2AA 5J2HA 9ICWA 4HTUA 3RH5A 8ICEA 1KVCA 4YFKA 1K1QA 4LD0A 4KB1A 1JKHA 3L3UA 1IM4A 3SV4A 7ICHA 3QEWA 4XRHA 1LB2B 4DQSA 2PFQA 4ED8A 3AVLA 9ICRA 3BQ1A 2F1IA 1TFRA 3KHHA 4OLBA 1NK5A 5KT5A 5DG9A 2YNFA 2IDOA 4Y1DA 4M9GA 2ATLA 3C95A 3RMBA 3SI6A 4LSNA 2GUIA 1LWCA 3KK2A 1W9HA 1ZETA 4O44A 2HHSA 5HP4A 5C24A 4E1MA 2VA2A 1ZBIA 4JRQA 5DBCA 1N6QA 3GIMA 5KFEA 1L5UA 2VA8A 1L3UA 4DSEA 4FZYA 2XHBA 4ED1A 4GC7A 1IO2A 3SQ2A 4F50A 7ICIA 3N4MB 3S3OA 3RB4A 1NK6A 4IR9A 3BQTA 5DK5A 4DTSA 3DLBA 3RMAA 4KHYA 4HUEA 8ICNA 1RTHA 4TSXA 1BPXA 1BVSA 2BQRA 3C1YA 1TKTA 5KFBA 1V9PA 3OSNA 3KLHA 5J1EA 1RILA 2F1HA 1S9EA 5J2EA 3QERA 2W9CA 2VG6A 1S0OA 3SV3A 4IG0A 3OJSA 5KG7A 3LP1A 5BOMA 4CJSA 3U6FA 4QWDA 2JEJA 5C25A 9ICUA 1RBUA 1S0NA 5EU7A 4JWMA 1UT5A 1CZ9A 1BGXT 3C6UA 3QEPA 2PI4A 2JZBA 4PGYA 4FLWA 4ZH4A 3AVHA 8ICQA 3Q8PB 2BGGA 4AHCA 7ICKA 2G8UA 3RAXA 4NCGA 4QW8A 8ICBA 4F5QA 1RXVA 1W0HA 1S1UA 1A5XA 3KTQA 1S1WA 1RPLA 5HHHA 2HW3A 1WSFA 2P1JA 3AVBA 2IMWP 2HHUA 1CLQA 1KSPA 1U4BA 4CJLA 4DTMA 4QZCA 3OYFA 4JS5A 3NH1A 4FM0A 2J6UA 1BPDA 3NF9A 1SKSA 4J9SA 3DLEA 2I9GA 1D5AA 3NAEA 4NLGA 2BPFA 3PR5B 5BPCA 1BL3A 1X9SA 1WAJA 8ICLA 1S9FA 4I2BA 4MFFA 1JLBA 1X9WA 3ZSQA 3QEXA 5HNKA 4M9NA 1S76D 3RJHA 4QWCA 1N48A 4BWMA 2QKBA 2P51A 1Q9YA 3QZ8A 5J2KA 3PO5A 2B21A 3LP3A 4KLOA 5KT2A 4QW9A 1RTIA 4ECQA 3MR5A 3OYCA 1BPYA 2XY8A 4RQ3A 3KHRA 1RZTA 1K6YA 1RT4A 1ZYQA 4X5VA 3T1AA 5HROA 3M9OB 1RYSA 3L2WA 4UAZA 5EWEA 3PX0A 2FPLA 8ICZA 2OPSA 4AH9A 3T19A 3CFPA 4O5KA 4LH5A 4DFPA 3ZSVA 5JS2A 1RCHA 4OGEA 1ZQFA 2FMPA 3U3YA 2O4GA 3CM5A 3S3NA 5KI6A 1ASWA 1C0UA 2AGPA 3ASMA 4Q5VA 2XY6A 3K2PA 2F96A 2YNHA 3IS9A 9ICMA 5KFRA 3MABA 3PW0A 4YXJA 3HXMA 3HP9A 1XC9A 1C7YA 4KLQA 4O0IA 4FJNA 4FW2A 4M9HA 3KLEA 1TL3A 1NJWA 1B92A 1KEJA 1QSYA 4XA5A 4RW6A 2RF2A 4H4OA 1WSJA 5CWRA 4DL3A 1ZQPA 9ICJA 1ZQOA 4MFCA 1TAQA 3ZDAA 1IKWA 5I3UA 1HYVA 4YFUA 4ELUA 4J2DA 5KGWA 5KG5A 3SUPA 1HYSA 3TAFA 3VA0A 3AVGA 3Q8MA 4NM1A 2FBYA 4F5NA 4W5RA 1LAWA 4HHTA 3EY1A
chains in the Genus database with same CATH superfamily
4BRFA 2RLTA 2C3UA 2QWLA 2PFPA 4BVPA 1PG5B 1DBDA 4JAXA 2Q31A 3UPFA 3ZT0A 3AXMA 5KFKA 4O3QA 2NR0A 2HIYA 2JHDA 5DB8A 3KLGB 1WELA 1X4DA 4FXVA 5HQ8A 3C15B 4CHOA 5D3GB 3NNCA 1IH7A 1W7AA 2P35A 5KGXA 1S5ZA 5E3CA 2Y8WA 3UQ2A 3K75D 1XUPO 4FLZA 2UVWA 2DFFA 4R65A 3C15A 2OTJS 5D3GA 1KVBA 5IT9O 2E5SA 3PRDA 3GE9A 1UA1A 3TAGA 3D67A 4ITSA 5DQHA 1PSDA 3WXKA 1NK8A 1X5PA 3UDEA 4NY8A 3C2LA 3DOMB 2DKOB 2DNOA 1QAYA 1F5CA 3C2PA 1LAVA 1SH0A 1U2RA 4XAKA 3WK5A 3W8GA 1HL6A 1YRXA 3A8EA 1ZA2B 2NRXA 4CK3A 1WSIA 4KAZA 2W9BB 4HVJA 2Z2LA 1CZBA 3K5LA 3B4DA 1RDDA 1ZBHA 1BE4A 3U9ZA 3ENAA 4K5SA 1FD2A 3EGZA 2W9BA 1BC6A 2G8IA 3OPKA 4PRFA 2HLTA 1KLNA 4WFXA 3KZXA 4ZN3A 3CYMA 3ZDEA 1MMDA 2XI2A 1Q86O 4HYKA 3HHLB 4I4BA 2P9EA 2M0NA 1F3FA 2HOIA 4F4ZA 3ULDA 3PG9A 4QZIA 1H38A 3MCOA 3H59A 5A8WB 1N36F 7ICFA 2KRRA 1OPZA 4YY3J 4RJVA 4P0QB 2CJYB 1P27B 3MFHA 1FK9B 8ICJA 4M3TA 1VRTA 2KFYA 5A8WA 1JLQA 3HSGA 4CD1A 4ZA1A 2F8HA 4A8OA 3H0PA 4NRUA 3WZ0A 2ISOA 4P0QA 1OIAA 3LDNA 5D77A 2CPRA 2R8JA 5FROA 3GV5B 1FK9A 1Q3UA 1RWXB 1VQ8N 4DQIA 4OVLA 1ZQRA 4KHMA 1T8EA 2YXLA 1GLBG 1ZQXA 3H2LA 4CM0A 1RG6A 1VI7A 2OPQB 2NRTA 3OR2B 4QAGA 1HR0K 2ZJPL 2KL8A 5LXYA 2WVCA 2JEGA 2FBVA 3JPQA 5AR0A 4OYIA 4DKWA 4RQ8A 4MIWA 1EIYB 1NGCA 1R89A 3HJEA 4DMNA 4KGKA 3MR3A 1A9NB 4DTXA 3FZBA 2J0WA 3IC1A 4OQJA 1QUPA 5HVFA 2K60A 5AQQA 5J2PB 9ICIA 1ZA1B 1PYOB 2RS2A 2W03A 4NXNF 1C0MA 4ECWA 2HBLA 2IY5B 4B6JA 2DGTA 5B5EU 5DZ6A 4O8KA 4OPHA 5J2PA 1XIQA 1J2MA 4B1VA 1T9WA 2YH1A 1NHVA 1WSEA 5BRFA 2WW8A 3LUYA 2K4HA 3R3LA 4ZHRB 3V81B 2F44A 2CVEA 1VQ8S 2BJ1A 2VG5B 3PEJA 3DXMB 1VOMA 1N60A 3CJQA 2ZIWB 2ASOA 4OLPA 2QWRA 1O1WA 3HO1A 2J6SA 1N5TA 4ZHRA 4JKDA 3QAUA 1FX4A 3DXMA 8ICOA 2XM3A 2YX7A 2ZM6F 2ZIWA 4M63C 3O5TB 9ICBA 3O9QA 3HK2A 4DV2J 1FX2A 2CPYA 2J8AA 3A8KA 1I3AA 3GB0A 4OHXA 3LAKA 1RHUB 5AJ3F 3EL2A 1S22A 2PE8A 4LFBJ 1WSHA 1HUXA 2ZOGA 1NJZA 3CF5L 4Z6CA 4A8YA 1N33J 2BV3A 4ZP7A 1U0HB 1HLUA 3QYYA 5J2NB 5BRHA 3E9PA 3QFPA 3HBTA 3ISND 2YKAA 5J0WA 2GMHA 3WNGA 3W5XA 1YT3A 2ESEA 4J91A 4LF9J 4PPXA 1IBKF 3D6TB 5J2NA 1RXWA 1NBWA 3KK2B 3G82A 1WG1A 7FD1A 2EFVA 3N4QA 4K8RA 4O44B 2MZSA 4IG3A 4KTWA 4DX6A 4X84A 4FBUA 1ZJNA 4FLYA 4DV4J 4U7BA 3D0IE 4I2GA 1PC5A 1HX1A 4QIWC 4M5KA 4Z4IA 2KK0A 3VQBA 4CDGA 1HQUB 2E8MA 4QCLA 3ZZPA 4MF8A 3AJDA 1U1RA 4ZCKA 1W7WA 2HMPA 5AQOA 3MMCB 4ZJQA 5BN8A 5BR8F 5H9FK 2JH1A 2ZFHA 2ZKTA 1VK3A 4GKJK 1GEHA 1HQUA 1PBUA 3TNVA 4F4AA 5B0GA 2K8CB 2QLWA 1MN8A 2Y8YA 1I94K 3MMCA 3SIPB 2NYHA 4O4RA 1UAXA 4ED5A 1W2IA 2BE2A 2AYGA 4RUBA 1HRHA 1N5QA 2K8AA 5CR0A 4LFCJ 2F9DA 3G71N 1LNQA 1J27A 5AQSA 4IG0B 1VHXA 3KOOA 3I0RA 2Z2YB 3K7RA 1A5WA 1SZPA 2CNLB 1HUOA 1VSKA 1KC8T 2F4FA 3UDLA 1ZQKA 2JZBB 1UFKA 3ISCA 1VRUB 2HNZA 4ECTA 4KFBB 5HN0A 4DCCA 4DTJA 1IXRA 4TUSA 4KGXB 3MI7X 3NOGA 4Z4FA 2J0SD 3W9HA 3VWSA 1XK8A 3GJRB 2ASYA 4XQ8A 1WACA 1VRUA 4B3TJ 1N32F 4KFBA 2FC9A 4GKKF 2PXIA 1LFWA 2ZH5A 3M4XA 3UXPA 3KNAA 4NEZA 2MU2A 4M45A 2HZVA 3F0NA 1HWUA 3QEIA 1NRKA 4M3UA 3BO2A 1BPEA 2OGUA 2DXFA 4ILJA 1PGZA 1M5SA 1TU0B 3G71S 3CXCM 3CJAA 4NCBA 4B17A 1URRA 1M5VC 3JPRA 3TP2A 5CP2A 3Q83A 4KH4A 1VSMA 2X74A 3P31A 1NBEB 2J9EA 4ZVHA 4LVOP 2KHOA 3PY8A 4I0WA 1RTIB 3AGKA 3QNNA 3ISDA 4NA1A 4CEDA 3GILA 3H1VX 5LJ3Y 5EOYA 3TAPA 4KB7A 1U2CA 2E9RX 2ZGYA 1Q0NA 1AZSB 3BS9A 2FGOA 4CLTA 3J81U 3ID8A 2LQ5A 3M1YA 4NLVA 1JJ2M 3IGNA 4FPIA 5H1SQ 2W8LA 4CFDA 5FPNA 2RT3A 2LKYA 3H5SA 4C4SA 1FVQA 4DCPB 1DLOB 1RKIA 3J80Y 2D3DA 8ATCB 4JI6J 4FZVA 2JDJA 3TOQA 2XNRA 4YMMA 4J9VA 4LF8J 5B0AA 2V2ZA 1CJKB 1HBOA 1R31A 1SIZA 3MX5A 4DV5K 1DLOA 1M1KT 1RGIA 5A76A 3TZXA 1TL3B 2H3QA 8ICPA 4FWMA 1WC6A 4PYAA 3UMCA 3BSCA 2R7SA 1C6VA 1ASUA 1X4CA 3GIRA 5GAGU 5DRKA 4TQRA 1NXIA 2G2ZA 1VC6A 4NLXA 1RTJA 1S12A 4NM2A 4B9NA 1UFWA 1RHJB 3BP8A 3AO1A 3RJMB 2OEMA 1SZHA 5LMNF 3J7AN 4ECVA 1DRGA 5JLHA 4NEYA 4B9VA 2FBXA 3AVKA 2OFHX 2POKA 2L9NA 3KWGA 4OV6A 4PL1A 1S5JA 2FQQB 4C4TA 5HQMA 2I1QA 2YWFA 1VYAA 1C1CA 1UWBA 2MPUA 3AQPA 1IJFB 3CF5Q 3UMGA 1HLWA 3W63A 3THTA 1J2NA 2JRZA 3VQ5A 4DX8H 2ZEJA 1F5SA 2EFQA 4ZLLA 4IFEA 2VIXA 4BQLA 2UVVA 3HHDA 5LSRA 1NOMA 1ZAVA 2XCPA 2RS8A 4CT8A 4ZIVA 1T05A 3CJCA 4HHJA 4BR0A 4OJRA 4NMLA 5J2QB 5M2PA 4X65K 1NMEB 5IFMA 1IBMF 2VV5A 5JS1A 5CHGA 3NEKA 2L3MA 1SCJB 3U1NA 5IXUA 1YJ9N 1G99A 3EMTA 5J2QA 1NK7A 3M32B 2Q3PA 4IDKB 2C2DA 1BPZA 2WFBA 4FM1A 3VPZA 3PW4A 2KZ3A 1Q86T 2P9GA 3M8PA 4DSFA 3SCIE 3Q8UA 4PKHA 4G1IA 2WSFC 1U9LA 4MFAA 3QBCA 2IS3A 2MSNA 3QSYB 1U1PA 1GX6A 9ICNA 1X4BA 3C5GA 1T11A 1U1NA 4EBCA 2ZC3A 3BBCA 3I56N 1GOCA 2B4UA 2EX3A 3IR7B 3W66A 4PXEA 1NZ8A 3O4WA 4GFJA 4A5BA 1VJ5A 1EKRA 4UZBA 3CFOA 2V7YA 4NXMF 2XLKA 1TTHB 2DGWA 3PNIA 4K4TA 3VQCA 3OW2R 4CGDA 2ETJA 5HQLA 4LRCA 1XNSA 2IFXA 4YMNA 1X3MA 3U26A 5HMZA 4DSKA 3GYGA 2QWOA 5JVHL 1Z4OA 4OLAA 3E9OA 3V7JA 3LM2A 1GMUA 8ICCA 4JS4A 4R66A 4QR2A 1YAGA 3KJFB 3NGSA 4Z4GA 2N1RA 1JNRB 3B6BA 2FE9A 4ZPWR 4FXDA 1YJ9S 4H4MB 2K8BB 2I6WA 3D2NA 3UCGA 4BE2A 3QINA 3ISNC 4XDCA 3PX4A 2IYIA 2V2KA 3N0VA 4EMDA 3AODA 5C42A 4FK2A 3SMZA 4H4MA 4PAAA 1QQ6A 4LF7J 2V63A 2CZ4A 2GQCA 3W9JA 1T94A 4DV6J 3V7KA 4EO6A 3N01A 3K0JA 3I56S 2AEJA 1SQGA 1DZ5A 5IC6B 4BRCA 2F1FA 1C0TB 1WOPA 4C0BA 4FJ7A 4CO0A 4EHTA 2HMIA 3SI8A 3ZC4A 4DU7A 1LKYB 4PHPA 1QSLA 3PV8A 4IFVA 4YD2A 1JLAB 2FHOB 4ICAA 4X62J 2E8OA 3GV8B 1UPHA 1FO1A 1V3ZA 3MDCA 5AQUA 3UKUB 4RW4A 2F40A 3KFWX 1LKYA 2UUCK 5IC4B 4YDDB 4FJHA 3GFYA 4F0MA 3W61A 1NHUA 2KNJA 1ZC6A 2FXUA 4QWAA 1WC5A 1AFJA 2VPZB 4M6WB 1Q7LB 2F4VJ 2RPIA 2IAJB 4CJQA 4LH4A 4LF5K 2VHGA 3D6MB 2EWHA 4HTIA 1KVAA 3RH4A 2MRLA 5K4LA 2ZIVB 5AK5A 2Q43A 1VLYA 3RSEB 1X4EA 3V9XA 2IAJA 4ZVRB 2V69A 5KFAA 4LMZA 4L3NA 2M4MA 4JK1A 1RAOA 4LIRA 3D2EB 3EUB2 4A4JA 2YI1A 3L4IA 1QVFM 4UY8O 5F8NA 1VSEA 4R0JA 1LWEB 1C1BB 2M8HA 3MCPA 2KLAA 2B9EA 4DF4A 5BPLA 3D2EA 4U95A 4FF3A 5J0UA 4HACA 3H2UB 3IMQJ 4H0TB 3M6VA 4FF1A 2OCEA 2EANA 1BHLA 2CAJA 4DSIA 3MEEB 1SJ1A 1HIYA 2D0AA 4QR1A 2RHQB 4R0EA 4DR3F 2RILA 1LW2A 1B70B 5IT9Y 1NSQA 5J2CA 4B3RJ 1WTBA 3VQ4A 3JAMU 1PYTA 2CGLA 2DNGA 3I9V9 2M5YA 1V5VA 4XEIA 2FVQA 3ET6B 3CJ8A 1WEXA 1JXEA 1M6YA 1KVIA 1U24A 2CKWA 2V4JA 2FPMA 1NHKL 5TKWA 4BC3A 1XMOK 2E2NA 5KT6A 2LKZA 1ZPVA 5DBAA 5KFDA 4B3OB 4NI2A 2NREA 1VQPN 1URNA 1SL2A 4Y2YA 1FFSB 3N7RC 2CADA 4F3MA 5JICA 5KFUA 3UD3P 2E1CA 3SQOP 4KHSA 3EGVA 4KJIA 2E20A 5ALKA 2AMCB 2QWNA 3RG6A 2EC2A 1RNHA 5IWAF 3HVAA 3BGUA 4AL7A 3TKAA 1ZD5A 5GADU 5EVZA 1TL1B 4PHAA 4C7QA 2FJVA 2OSQA 2X7IA 1F9FA 4RBUA 7ICEA 1IBLJ 4F7VA 2CIMA 1SKWA 3IAYA 3JPPA 1FEHA 1Y5NB 4CLFA 3O08A 1ZQYA 3HKZC 4Y2UA 1JLEB 1CQNA 5HVHA 4OJLA 4RQ0A 4J9RA 3MUVP 4G9BA 1ZQWA 2QA2A 3LZIA 3G6VA 4KLFA 4IS7A 1YTAA 3AV9A 4QOTA 3MX2A 5ALRA 1KN5A 3VQAA 1VQPS 4B9UA 3KD3A 2B4JA 1NU4A 3K17A 3C0BA 3KHLA 4KLTA 3D9BA 5F8MA 2G2OA 2VG7A 3DYAA 3LPYA 2DFEA 2RH3A 4O0NA 4KR0B 5KRSA 3OVBA 5LY3A 3GYXB 3BF4A 4ZLPA 5AKKA 5E3AA 2HBKA 3DRRB 3FBFA 1ZBFA 5MLCV 5DDYA 3SFUA 2WSCC 3ZT1A 4RNOA 4F4KA 1O03A 1IG9A 3CVKA 5JVHQ 1KTVA 4PL7A 9ICOA 1S72N 1WF2A 3CHWA 4EO8A 3TEGA 2M70A 2XS5A 1G6BA 2DH8A 3M5RA 3HFKA 4PXDA 3VGKA 3VAFA 2BM1A 1G7CB 1VS3A 4QZHA 3KLVA 3KJNB 1QDUB 1V4TA 5AI5A 3QU2A 4KTZA 1BI4B 2O8DB 3T1YJ 3D0HE 1COKA 1ZAXA 4E7HA 1QE1B 5IOLA 2IOFK 4UUXA 2QA4G 4CF3A 3QMQA 2YWGA 3ZX2A 1SQEA 1WJ9A 3S6JA 2O8DA 4C8ZA 3EE8A 1KLMB 4MDAA 3SMPA 1T3VA 1IV8A 3FQKA 2A1RA 2RU9A 2ZBQA 4S0MA 1SQKA 2LFVA 1CSJA 2G0AA 1CJUA 2A3ZA 3GJQB 4DU1A 3L2QA 4MLHA 1S6PB 2KW4A 3BH7B 1ICEB 1S72S 4RTFD 2LA6A 7ICTA 3S8SA 4I68A 2UUTA 2DNNA 1DTQB 3H90A 1SWWA 1KRPA 4W92B 1VMBA 2FC8A 1HKGA 3FQLA 2N3OA 1R6VA 3K4GA 2AJFE 3UNGC 2Y9HA 1HNXF 3CQ8A 2VCPA 1SH3A 2OAUA 1S6QB 1DTQA 2I7NA 2PMZF 3MD1A 1FRIA 1U48A 2A42A 1TAMA 2PYJA 3G0ZA 1ZQVA 4C23A 1Q7YT 1HD0A 2I0XA 1S6QA 2P5GA 5BN9A 4IKFA 4QU7A 3DDKA 2XULA 2G1DA 3RB3A 2ZH9A 3KKSA 3R6MA 2PFUA 5TZVA 4BC9A 2G5HB 1HNWF 4FYWB 2IBKA 4F2RA 2VGNA 5AQVA 2OHFA 3WC2A 5HMWA 3M9MB 1QJHA 3O3LA 2E2PA 2WB4A 3VC8A 4EBEA 3QIDA 3VGTA 1SC1B 2MHNA 1YZ6A 4ECRA 1HA1A 3DNCA 4QS9A 3OYMA 3ZX3A 4NXNK 2GVZB 1Q8KA 4NXZA 3MMAA 1JLCA 4ED0A 2JX2A 3D6JA 4WYWA 2AQ4A 2NXCA 3WNHA 4UW2A 3AAQA 8ICRA 5E41A 2GVZA 3BGFA 4PXBA 3L3VA 1G15A 2VB6A 2G0JA 2C2KB 2FLOA 1A6LA 5J2MA 1XMBA 1GLDG 5J1PA 1RAJA 5LJVA 2H65B 3V9UA 2HOFA 3NP5A 3NNAA 3V1QA 2CQ2A 4USHA 4KLUA 1R8AA 4ECUA 1KTQA 4BRQA 2W8KA 4N56A 4OX6A 3OT9A 4Y0FA 2ZHBA 3QRRA 4C1NK 3C2KA 2AX0A 2O67A 1NUEA 4N76A 5KFOA 3N7PD 2CPZA 3MR6A 1Q46A 3UVJB 2XY5A 2HVIA 3I9ZA 3C94A 2VJ5A 1MWZA 3CJBA 3ZNUA 4YY3K 3PKMA 2EAPA 3DXBA 1A0OB 1ZM2A 2J0QD 2F8SA 3LP0B 3MOZA 3LDPA 2HF3A 4UB2A 3UVJA 4QPXA 4DMZA 2MZQA 3PXGa 2RAQA 4WCEL 2ZUDA 4CF5A 3J7ZO 1S8OA 3E8OA 3B54A 2VDHA 2DHXA 4ENOA 2AEFA 2VIHA 3UXNA 2CJKA 2YNGA 2W42A 4IOXA 4KI6A 4M3XA 3PRBA 4N41A 4V1Ak 2XSJA 5ETRA 3GU3A 4ED2A 2E2QA 2Z1GA 4HL9A 4KN7A 4FOEA 4MYTA 3FR0A 3B6OA 1IBKK 5SUHA 1UVJA 5LSOA 3MAHA 2Z1HA 2YKMB 4DN9A 1S1TB 4FLXA 1V97A 2UV8G 2R7TA 3DRPB 4BE0A 3E1YA 3B6PA 2ZM6J 3GZFA 1RE1B 2WAQD 2QB0A 2PO4A 5BYSA 2H5XA 1TELA 2YKMA 3D1OA 3H46O 2OSRA 1S1TA 5LMUK 3GCXP 2C2MB 2OWOA 3OLAA 4AQYF 2HG4A 2J7WA 3C23A 1IWAA 3O1WA 1N0VC 2IA6A 5IIMA 3TACB 4WJBA 3VMFB 5AJ3J 2UVRA 2LA4A 3LPEA 3FCVA 3ICXA 2ZZMA 3ENQA 4X4NA 1WDTA 4XIUA 4GO7X 1PVPA 3QGPA 1TKZB 1LW0A 1VQNN 1WB9A 5H9EK 2ZTEA 5KPZA 5D46A 3FBBA 1NLVA 5C0YA 1SB3C 3QUCA 4P52A 4F91B 3QFHA 4KN4A 1UTAA 4CLZA 2X6NA 3H8SA 3VVTA 2AJ1A 3SENA 4B3MF 1JMSA 3J7YP 2RRDA 2HBQB 4CBWA 4L6V3 5JMVA 2B4OA 4DV2K 4DOAA 4JI2K 2IDLA 1MA9B 1T4GA 4FWPA 5GAGI 4YHHF 4UY8T 4QIWF 3WKEA 3K57A 5K14B 2R9LA 4JI8F 3SCXA 4X64F 1GMWD 4DOCA 2MMYA 1FNXH 4I64A 4E19A 3J81O 3A8IA 4KO0A 2HVHA 2ZIUB 2G8KA 1X4AA 1WLJA 5K14A 2JEIA 4CHYA 1SC6A 3Q7CA 3B8HA 4UASA 3JSBA 3W65A 5DGBA 2DRDA 4LY7A 1ZD4A 4J9UE 1F9EB 1RTZA 2ZIUA 2VC0A 2Y0BB 8RUCA 1FKOB 2EFGA 4TU9A 1VQNS 2A1JA 2J9DE 2DNQA 2NZ4A 3MXIA 4CZGA 4BDYA 3JYTA 4LF9K 1VQLN 4DV7J 4FW1A 4GXKA 7ICOA 2BUNA 3MR2A 3HM9A 3D0GE 4UAYA 4DCHA 1FKOA 1T3NA 3CJKA 1TR0A 2CPIA 1RB0A 4WZMA 1T3QA 3NVZA 2RQMA 2YKPA 4DV4K 4RT3A 3ZZZA 1XS9D 2MZJA 4BR4A 1RBVA 3VQEA 3PLAA 2W6LA 3WBZA 1T9TA 2K4PA 1N5YA 1TVRB 4OZ1A 4DV0K 1PJ7A 2RHFA 3QEAZ 4AILC 3KNGA 2GELA 1XSNA 3OXGA 4CVNE 4LJMA 4JK9A 1KOHA 3H5XA 3MDFA 3ZSXA 2QLJB 3AOBA 1WG5A 2FY1A 2KVQE 1TVRA 2HKEA 1SH2A 1K47A 1MW7A 5HBMA 4X66J 4F71A 4IO9Q 2KIWA 2W04A 5HL7L 2YHAA 3MEDB 7ICLA 3LF0A 4CLUA 3AH6A 5D78A 2KIVA 4ICLB 1H7WA 2VFSA 1N32J 4EX7A 2HQFA 4B08A 4GKKJ 2OMOA 4FO0A 2GVDA 3MEDA 1TZ0A 4W5QA 2FC0A 1O13A 3RR7A 3BPSP 1VQLS 3ID6A 3GCWP 4ICLA 4JI4F 2HYIB 4IQTA 2JVOA 2FDRA 3WNEA 7ICPA 4LFCK 2GJFA 4HT5A 3U4LA 1JKHB 5IM0B 4MMOA 3WIVA 3OTCA 1REGX 5K5MA 3HOSA 4HT7A 4I2IA 4I9LA 3DM2A 3ETOA 1XNRF 2BCRA 4P73A 2WONA 4F3TA 1HBNB 4N8NA 3DLJA 3UKRB 5J2HA 1RDRA 1SBRA 4KB1A 1JKHA 4AD6A 5IM0A 2VPWB 4IH7A 5CD4H 3WKAA 7ICHA 3NWRA 1BWFO 4DJBA 3QEWA 4LSNB 2ZNZA 1UKUA 5KOWA 1HBNA 1LB2B 4DQSA 4ED8A 2B9WA 3EVWA 9ICRA 2MXYA 4NL9A 3KHHA 4JI5F 5KT5A 4B3TK 1NSKL 1SI9A 2WBMA 2DH9A 4Y1DA 5AQNA 3RMBA 1FW6A 4LSNA 2R2RA 1Z4NA 1W9HA 5EXWA 5BPNA 2NZCA 2H9ZA 3WK9A 3GONA 3HHNB 2HHSA 5AI8A 3CCSN 5HP4A 1NPKA 2IM0A 5ADXH 1YJWN 2YB1A 4J03A 1C0FA 4E1MA 2EW9A 5GMEA 3I0SB 1ZBIA 3OXLA 2IVFB 5KFEA 3C6AA 1L5UA 1KXPA 1NWKA 1Q16B 3VCBA 3IM9A 2CVIA 3OL7A 2W40A 4NLUA 2XHBA 4ED1A 3O9TA 1CRXA 4F50A 3IP0A 2LU1A 2ZDOA 3MECB 2AIRB 1EWQA 2JLFA 4ZCLA 4CBXA 1NK6A 4DTSA 2E5LF 3D6RA 1WSVA 2DY1A 4HUEA 8ICNA 3UN3A 1D3WA 1LEOA 4CJ7A 3R7BB 3C1YA 3WUHA 5KFBA 3BBBA 2XZWA 4I1TA 3EGNA 3OSNA 5J1EA 2QG9B 3T79A 2LMRA 3NCQA 3QERA 1H2TZ 1S0OA 2DNPA 1YGYA 2WMMA 4W4MA 5LMNJ 4CJSA 3ZTOA 2VFVA 2JLGA 1Z6RA 4B1UB 3U6FA 5AQWA 1NH8A 2KP7A 1YJWS 9ICUA 3ITHB 2OKQA 2EC0A 4PQAA 5DZ7A 2QKQA 2F9WA 2BGGA 4FVCA 1B7FA 5CCLA 4K7QA 3U8XA 2N7CA 1AA1B 2DIVA 4F5QA 2I5JB 3I5AA 3HRDD 3P45B 3FZMA 3MPWA 2DNLA 1A5XA 1S1WA 1FKPB 4NASA 3KG4A 1DY3A 2HSTA 3DLEB 3AVBA 2IMWP 2HHUA 1CLQA 3T1HF 1X4HA 5HOOA 1UEVA 1R8CA 4QZCA 2IRXA 3C46A 3JTOA 3PSFA 3DLEA 1NGFA 4ZMMA 1RDUA 4Y2RA 4A47A 4I69A 3DOKB 4PUOB 2BPFA 1IBMJ 5ALUA 3QNMA 2HLUA 5FPEA 4NLCA 3QU7A 2IOFA 3QRQA 8ICLA 2QRRA 2WC9A 2EFOA 1RAGB 3CNQP 3ZSQA 5HNKA 1S76D 3RJHA 2CJBA 2QKBA 5DDOC 1Q9YA 3VR1A 3PO5A 3IBWA 3N6LA 3P8BB 3LP3A 4DQ8A 2J7UA 4DN0A 2VKZG 3SCKE 3OYCA 2ZIXB 4RQ3A 1RT4A 1K6YA 3TEHB 5HROA 3M6GA 3L2WA 1N34K 3QGIA 3PX0A 1QAJA 2UU9F 8ICZA 4AP9A 2RB7A 2MKSA 4GVLA 4O5KA 5CRXA 4DPUA 1FE4A 3TUIC 3KKFA 4U96A 5GADI 1P9YA 2O4GA 3CM5A 1DT9A 3GP9A 5KI6A 3ASMA 3KLEB 4TXSA 3K2PA 2J8SA 4Z2XA 3POTB 4WP8A 9ICMA 5KFRA 4RW6B 2QARA 4WKYA 2O1PA 4YXJA 4H4OB 2IJRA 2KKPA 4OX8A 4MK8A 3HXMA 4E2FB 1T6CA 4I6YA 4MYUA 4FW2A 1B0TA 3ZLJA 3DCAA 3KLEA 1NJWA 4JYAJ 3POTA 4XA5A 4RW6A 1WUAA 2HOEA 4H4OA 4B3SK 4DL3A 5F8IA 9ICJA 4MFCA 1F1BB 5HL7Q 1HYVA 4ELUA 4J2DA 3SUPA 4P2FA 3AD9C 3TAFA 3JB9k 3VEOA 5CQGA 3O0FA 1S6OA 1PK3A 3DU5A 3J7ZT 4PZOA 1U6ZA 4FSVA 1NM1A 1ZM9A 3WHIA 4K4UA 2HFUA 2VQEF 2DNZA 4JKGB 3P83D 3K9JA 2EFNA 4E0DA 2E1EA 1HWLA 2ROGA 7ICUA 5LJ5Y 2G8HA 3VQPA 3ETLA 4U7UK 3C3LA 1QLNA 2BZ2A 2OM6A 2L41A 3UW1A 4OYZA 2JVRA 2KM8C 3OW2M 1BU6O 2CPHA 4JKGA 1KS2A 3JQJA 4QIEA 1IVZA 1SV5B 3NGUA 4RW7A 3LDSA 1HARA 2EXUA 2NUHA 1ASVA 1KQSR 1FWKA 5CB1A 1XR6A 4OZ5A 4Z0UA 3V6DB 3AVNA 1CZAN 1SV5A 2VWKA 4NMXA 1H1VA 1G3OA 1UMJA 2E1RA 3VAHA 4P2XA 3UXOA 3ENHA 1N5XA 4X4RA 3AVAA 3V6DA 4CTAA 2UXCF 4ZTJA 3O3GA 1FERA 5A8RB 3LWMA 2AV5A 3VN5A 4KBOA 1KOOA 4DFKA 2KZZA 1BNPA 1PUZA 4TURA 1KEKA 2IMOA 2QTDA 1NSPA 2W25A 2BJDA 4FZMA 3JSRA 2VF3A 3HTVA 2FLLA 2ZUCA 4AXIA 4WQ5A 3LP2B 4ILRA 2KXNB 2R8GA 2CJ9A 4QR0A 4NL9C 3TANA 2B43A 2CN1A 1QTMA 4EYIB 1WWUA 1F3VA 1FVSA 2PZSA 2B3TB 4BC4A 1KAXA 6FDRA 3KD1E 3NVMA 4RQ5A 2EG1A 5M1PA 3AO2A 3TA2A 4M5NA 3EWAA 4OKJA 3O44A 4DR3J 1I1GA 4O3MA 4ZJLA 3OFEA 5ALZA 3LAMA 1PCAA 1U02A 4DS5A 3BR9A 3AT1B 4FWNA 1WHXA 3DMJA 5ETNA 1TV6A 4DEZA 2VDIA 3AO5A 2ADCA 2HB5A 2WW4A 5I3PA 4DCJB 2D1CA 4CECA 1F0MA 4KBIA 3C1ZA 2P9UA 2LM4A 1X40A 3TW0A 5C5JA 3EGWB 3JQKA 2OANA 3AVIA 4XDDA 1ROFA 4LZGA 2V67A 1GAOA 1NKEA 3DXKB 3R5BA 5H2FU 3QE9Y 2NRRA 4B1XB 2MQLA 1DAXA 4B9TA 1WNEA 2R7RA 1JLFB 1BQMB 4DPYA 4AYBC 1O51A 1DQ8A 3VGMA 4F4WA 5M1QA 4LF1A 1JLFA 4RR5A 1YHQN 2D1KA 1BQMA 2FF6A 2FJ6A 1WC4A 4DUZF 4JI7F 2O8EB 9ICFA 2MTLA 2A2CA 4FYVB 5GINA 2CDRB 2E4LA 3PIOL 1X5SA 3LM9A 3BQ2A 3NMAA 2W9MA 2JH3A 2O8EA 1S3XA 1YJRA 3RJGA 4DV1J 3JSMA 3RTVA 1RU1A 1VHIA 4OZJA 4J2BA 1R0AB 4IR1A 2PDAA 1OJ4A 3S6EA 2PFDA 4ES1A 4U8YA 2DR8A 3LDOA 3ZD9A 4CNYA 1N56A 5DETA 2QTWA 5B0BA 4ZS6A 4O3RA 2R18A 4F93B 3BV8A 4M5DB 4BRIA 2B6AB 5GAEI 4PPZA 4OPJA 4M8LA 4TKTA 1Y5IB 3F44A 5F2RA 2A5XA 1FJGJ 2NXJA 2FHKA 5EOZA 2VPYB 4DV3K 1YK9A 2B6AA 3X3UA 3RZAA 5GAHU 1YHQS 3UPQA 1RJJA 2LHTA 3HLUA 2KH9A 1N61A 4TYBA 3KJVB 4GVMA 4RUCA 2QFIA 4K59A 4BDZA 4CJTA 2CG4A 4EI2A 2AZ1A 2N7YA 2BW7A 4ELVA 2R42A 3O1LA 4DR1J 3DLRA 1NJIO 2X51A 5AQJA 4QYRA 3Q8QB 4LF2A 4AHSA 2GIQA 3RF9A 5KQDA 2FMQA 2YWEA 1MWYA 3M8SA 5F8GA 3QIPB 2A18A 1Q79A 4PR6A 2O8FA 3KK3A 3PSIA 4LVSA 3RRKA 3C21A 1X7VA 5KNIA 3OTDA 5J2IA 4ED3A 5A6WA 3LPTA 5C2GA 2ZE2A 3TUPA 2GV9A 3QIPA 4EWTA 1J2VA 2ITGA 3FMWA 3FEZA 3CCUN 1S10A 1ECWA 2QL9B 4CHPA 3S01A 1LWCB 2FUG9 4BRAA 2U2FA 4O5CA 4I2AA 4CEZA 1R7IA 2EQYA 2OPPA 4CJUA 1JROA 5C10A 3DI6A 3IBFB 4HI1A 4RT2A 4UBCA 4YN4A 5D4PA 2VONA 4WFNL 3TQEA 5CA7A 3K89A 3VQDA 3DXSX 4J9LA 1NZBA 3L7UA 4F3QA 2PFFB 4H5WA 1HYZA 2Z2MA 1YWXA 1S48A 2MKIA 2XTJP 4FS1A 1VK0A 4C3KA 3KJQB 1SKUB 4E7JA 2DGZA 3T1YK 1YUWA 9ICKA 4OKEA 3NG8A 3PMLA 4OMFG 3AQOA 2FVPA 5G0RA 2KRBA 2CXEA 1I51B 1HHTP 3FSIA 3G6EN 4FKYA 5FD1A 5DLFA 3QX7A 1WWVA 2D9PA 1RTHB 4U6PA 4J9KA 2WUSA 4U8VA 3GIKA 4QNLA 4ZPCA 4OJHA 5KG6A 9ICLA 1KWMA 2PC6A 2GX8A 1H72C 1G2EA 1M1GA 2XWXA 3CCUS 4CFCA 3EN9A 4H8KA 3CDAA 3NCPA 2W9CB 4DLEA 2GGPA 4KLJA 2QLXA 2VOPA 3SYZA 3TAEA 2C22A 4MF2A 3N28A 3CPWR 4WTOB 1HR0F 5KFFA 3CPEA 2W41A 2ASJA 3NHGA 3ATVA 4ID5B 2EHGA 3NAHA 4OI6A 3WNFA 3HI9A 2FHJD 4PQUA 1NB7A 3D4JA 3VENA 4DQPA 3NGKA 5E0OA 4FJLA 5F3XB 2PT0A 3GYNA 4M3WA 2XB2D 1VSJA 5IIOA 1NKCA 2D0BA 2AP1A 3V9ZA 5CCMA 4ID5A 2UYTA 1X2IA 2E2OA 1IXKA 4RO0A 3PJ9A 2ZD1A 1Z26A 3K1ZA 1H2VZ 4JV5J 4KGMA 3CJ1A 4Q45A 2H3VA 1LXNA 1S97A 3WT0A 1VSIA 1JK9B 1SUQB 3EKSA 2VU5A 3VEXA 2KD1A 3MDAA 2OXOA 2G0IA 1AXQA 2ZJRL 4OYAA 4Y2SA 5D4OA 3FKBA 3D2FA 3C7NA 4RUAA 1Q81O 3RMDA 3MMJA 1SUQA 5IQQA 1SVDA 4OZ0A 4CZLA 1PVRA 3M1VB 4BRDA 1QQMA 4DU8A 1JLBB 1R43A 1XSPA 2BRLA 4ANEA 1VIXA 3UI3A 4K0KK 1S49A 5JMNA 2LCWA 5HLFA 2P66A 5ALOA 3QJJA 1Z1VA 1CG2A 3M1VA 1NMNA 3GIIA 2BPCA 3AVMA 3DKDA 1QUVA 2FVCA 4YB6A 1WG8A 4UAVA 4CJ5A 1DTTB 1REVA 5L1IA 3O8WA 2B9XA 3I8DA 4ECXA 5HP1A 2YTUA 1VBYA 1FD8A 3SDEB 2VQFJ 1RAEB 3KUGA 4NE9C 4WWSA 4CM2A 3WEEA 1DTTA 4LR9A 4USWA 3EX7B 4XH5A 2VODA 5I4MA 3SDEA 2HAFA 2YNHB 4QWBA 3I76A 1MNEA 4KSEB 4X4UA 1Z1BA 5J8YA 4KREA 4K50A 1VISA 2K4IA 3MMBB 1SJ4P 4YHHK 4JB8B 4IEEA 3JPTA 2FJEB 4C4WA 3H5UA 2V2VA 2V8DA 3S7RA 1MMNA 1GH8A 3MMBA 4AQYJ 5L9NA 3VQ6A 3JSYA 1IR1A 2DTUA 1XSLA 3TVYA 9ICAA 4IQUA 4OFZA 4LIWA 3NMUA 3KG0A 4QZGA 1DGSA 2YV0X 4I9QA 4C8LA 4NV0A 4PA1A 3C2MA 4RPXA 3JTNA 1X9JA 4ANCA 4DTPA 4O3NA 1RWVB 4M5GA 2MQOA 2LYAA 1OMSA 3C6TB 1NI3A 3KD5E 3H8MA 5GADP 2WF7A 2XC9A 4GKJF 3BGLA 3MCNA 3NDKA 4CO3A 1D8BA 2JEFA 3SCLE 2UUBK 3ZNJ1 3SQ4A 4NLYA 2BCVA 3TI0A 4EYHB 4QZEA 1H98A 3R2CJ 1F6TA 2IGIA 1J5OB 4UOFA 4ZP6A 1MN9A 2KSOB 5DM7L 1HBMB 2R4FA 2HHVA 3IAS9 3GU0A 4UB3A 4ZPDA 4K2XA 3M9NB 4IRDA 4ECZA 3P39A 5G5GA 3HT3A 4JI8J 1M90T 4X64J 3KUEA 1ZQLA 3CMEN 3T41A 2ITMA 2KSOA 1YJTA 2GHWA 1N5VA 2RHKA 1HBMA 3HILA 2NUBA 4BX9C 1H3DA 1U2VA 4KMOB 1VIOA 1N2XA 1U6BA 1VRQC 2HGMA 4WFNQ 4OI4A 1GLCG 3ZSWA 3W3SA 3IR5B 4O9MA 4KI4A 1EX4A 1VJQA 3IR6B 2OTLN 2E1MC 2OI2A 1ZM3A 5AM5A 4FWSA 5B0EA 2VBZA 3DDNA 2WCXA 1BOTO 2YKOA 3NFAA 4X4VA 4A8WA 2HS4A 3DRSA 3R2DJ 1J5EJ 2FHMA 2FI1A 2P9LB 2LYHA 3HJVA 4Q2LA 5DDMA 1C2PA 1EJ7L 2E7VA 2MKCA 1HNZK 4GRSA 3OV7A 5KAIU 1HPZA 4A5AA 2P9LA 4FM2A 1NEEA 2ZHOA 4PY5A 3SBTA 2X1AA 3CMES 4NLZA 4OX9J 4Y2PA 4E98A 2HHWA 3ZEUB 1Q8BA 4DPWA 3QMLA 4OKKA 1X5TA 2OD6A 3A0IX 6AT1B 3OS2A 4OJOA 3DHWC 3FJ2A 1PJ6A 2Q6BA 1V3RA 2YWWA 3L8BA 4Y2QA 3FRZA 1YX2A 3ZEUA 4KITB 2OTLS 2V9KA 2HDOA 4DTOA 3FAHA 1S1VB 2RRAA 4DV7K 4BQZA 3OBWA 1X66A 4TLQA 5A0LA 5AXLA 1HIWA 2YB4A 4EFAC 5AQLA 1Y9OA 3FEYB 4JI4J 5C2CA 1S1VA 4FJJA 3D1HA 1EARA 2LYVA 2HWIA 5DQIA 5RUBA 2GX9A 5HJYA 5E84A 1CXQA 2IC3B 2KJWA 3FM9A 3H1QA 1XNRJ 4QZDA 1YIJN 4M42A 3ZCMA 5AQIA 1GXUA 2HNDB 3OYAA 3UO0A 1FRMA 4ZVUB 4YVZA 2FJAB 4PL8A 4DQQA 4M5JA 2IJFA 4DV5F 1BMQB 2E5LK 2ZJRQ 1IKYA 4FWOA 1Z1ZA 4X66K 2MYFA 4CLYA 2ZUAA 3HI0A 3JAMY 2CWXA 4JI5J 4KX3A 4CGFA 5AE3A 3TYTA 5ADZA 3HPGA 5ETPA 2VZ9A 4IJNA 3MGIA 4N8OA 1QQCA 1HHQA 2AW0A 1UEUA 4ZCMA 2NZTA 4QZ9A 2KG5A 3TVKA 3FUYA 2JWLA 7ICVA 1V9OA 3QNWB 3BEGB 1QY7A 1L8OA 3D6FB 1RT6B 4CLPA 2Q1NA 3AMZA 3OA9A 1RQLA 1NU0A 2DGQA 3BB5A 1CULA 1YIJS 4RX6A 1OKJA 2H5IB 5IV3A 1MQ3A 3MM8A 4M5MA 1RT6A 2OJ3A 2XS2A 3AA9A 3CCMS 4Y2JA 4FWKA 3M2UA 4I29A 4PHEA 4X4OA 4CEBA 1RHQB 2DY4A 4EAHD 2ZBCA 2B51A 4K42A 5CD4A 1UVLA 2P9CA 1GLEG 7ICRA 1RWUA 3SR6A 4YQWA 1KQFB 1ZQGA 3NL0A 2OLWA 3L6QA 3BSOA 1D4XA 4MIBA 1HJOA 5L1KA 5KL1B 1NB2A 4LF4J 5GVQA 2V2QA 3RWUA 2AYBA 4JMUA 4QYZJ 3HYFA 1TL7B 4X65F 1FTCA 3MGHA 8ICFA 2CZ9A 4KPYA 2NV3A 3TABA 3WKDA 3MAAA 2AKWB 3UCUP 4IC9A 4KKOB 4OYOA 1VQON 1B64A 4NYOA 5AM2A 1OYEA 3LVVA 4DO9A 3OTOF 1HNVB 3OVNA 1GTEA 1NLKL 3BF3A 4FXWA 5J8YC 1A77A 3MEGB 3AVCA 1ZBUA 1L8LA 4X4QA 1YJNN 2F8MA 1HNVA 1ZQQA 3PW2A 4G9ZA 3BJYA 4QZFA 4M9LA 3T1HJ 3WIUA 3OTQA 2FZGB 1J53A 5JLFA 1KHWA 1XERA 5ALNA 5A6PA 1RWNB 1U8WA 1N4LA 4Y2IA 1NJYA 5KPTA 3CDWA 1ZTWA 2P9IA 5IILA 1S0VA 3I6PA 5M1KA 2QYCA 3NXZA 2I7PA 5GIPA 4I6WA 5ALWA 4Y2XA 1RA6A 4YORA 4CFAA 3SPYA 3CIPA 4Y1CA 2E29A 3SUQA 4CHNA 4IQXA 3TZYA 2QMUB 1GXLA 2EDUA 1K0VA 4E8UA 2KEYA 4QWEA 1O5JA 3BS5B 3HVTA 5E2QA 2Z1IA 3D28A 3KMQA 1YQHA 4RW9B 2I6XA 4ETXA 1BD6A 4NYPA 3OBYA 2Q1LA 2PA8D 3M6UA 3MN6A 4N47A 2JHEA 3GFKB 4QS8A 1RLDA 3BS5A 4ZVSB 4Z4HA 3KBBA 2DGXA 4NZ6A 8ICSA 2V8HA 4LT6A 1Q9XA 4RW9A 3U1MA 2R7WA 1I6JA 1OH6A 2UU9J 2EI5A 2F77X 4ZKAA 1YJNS 2CPXA 3H20A 4PWDA 3WQUA 4WZQA 2RKIB 3SMSA 4O3SA 4DI6A 2DITA 3OSPA 3V4IB 2XSFA 3MZIA 3HSTB 3PSPA 2G07A 4DTNA 3FFIB 4DL7A 2HSEB 2RKIA 1SPBP 1EETB 1CBKA 1Q81T 2VICA 1D9DA 4YDUC 5AKGA 1ZQNA 5DDQC 3H45C 5DDPC 3CE8A 4FJMA 3QIOA 1V5IB 2C42A 4JN4A 3V1RA 2K3KA 5FJ4A 1A5VA 3FFIA 2AWZA 3I8BA 4KRWA 3CC4N 5HVGA 2UUCF 2XGQA 1M5PC 3W9IA 1FHTA 5DQGA 3ZETB 2QGFB 4AE5A 3RVCA 3GR1A 3CJ7A 4AL5A 2LMIA 1IN0A 3AAWB 4LF5F 4CDIA 4KH1B 2W2QP 4NCAA 5AT1B 2KJVA 5KFSA 3UM9A 2EK1A 1XHXA 2G9OA 2ES6A 1I5OB 2VQEJ 3RJEA 3M6WA 1WCNA 4CHQA 2O8BB 3CJ5A 4FWQA 4WYBA 4KX5A 2FB0A 3ZSRA 4O0JA 2G8WA 3A3OB 4OJ3A 2UUAK 2AJQA 2UXDK 2RE2A 3DGVA 2FDNA 2BXJA 2W4DA 3OR1A 3BS7A 1OS5A 4UB8U 5GAHI 2UUWA 3NBPA 4JYAK 2AJ0A 2ZBPA 2C1EB 4CBUA 3QYPA 3E0FA 5ALHA 1URJA 5KFZA 3AA3A 1SL1A 2C3MA 3TWHA 1EP4B 2BA9A 3NNHA 2CH6A 2V52B 2VFUA 3WU2U 3CC4S 1HI1A 1BHNA 4FJKA 3U27A 4USMA 4DG1B 4DCOB 1ZQAA 2NO4A 4FPBA 3C19A 8ICGA 1YLXA 3LVWA 4CGJA 3F2CA 1IG6A 2F1JA 3MEKA 2A2DA 3R27A 5T7LA 1XEZA 2WRMA 4DR6J 4I7FB 3SSSA 4O3OA 4DTUA 4CLSA 2V5HG 3W2WA 2CNOB 2UXCJ 1UVIA 3ZSZA 4QIWD 4OZ2A 1DARA 1SAZA 1NK4A 4YP3A 3VGLA 4RQ4A 1PC4A 4DPXA 4I6MB 4DR7K 8ICTA 2CQBA 1XMOF 9ICHA 2B7CB 2MAXA 1IQTA 3EJMA 1KAYA 3ILLA 3E3XA 3IBCB 2YQ1A 2GIFA 4PKGA 3QFUA 4K4HA 3IFRA 3CIMA 3DAWA 1N63A 3GSDA 1ELOA 4I6MA 4I6AA 4ANDA 4GMKA 3C28A 3VEWA 2ZXIA 3C65A 5CYQB 1Z25A 2JR5A 3V1OA 1CJVB 4TNOA 2YN4A 3G25A 5AKXA 4KRFA 2KVCA 4GLXA 4CNZA 1M5KC 2ZWPA 2B4VA 1SKRA 3BSNA 1KQSM 3B4MA 4BG9A 4J2EA 3R3TA 5AKYA 3GBTA 1X5OA 1YVNA 5KG4A 4DR5F 5THWA 3THYA 2R2SA 3ENWA 2GQ2A 2RMLA 5CZVA 2P9PB 2AYEA 8ICXA 3TU5A 2H3FA 1U1LA 4L3QA 4JWNA 3CJTA 1K73O 4BXOB 2WVBA 1U1QA 1WDDA 2DFHA 5ETLA 3TFRA 1VC0A 4AYBF 3F5EA 1GXTA 2P9PA 3MM5B 3TAMA 1RTDB 2EAMA 2E9TA 3KDNA 1K0TA 3TPQA 5KFHA 3N5FA 5CAAA 5BPMA 3UNYA 4MDBA 9ICVA 4LRBA 1RKJA 3ULEB 3RAMA 3VEYA 4FNHA 4TY8B 4I2EA 3MM5A 2W1BA 2GO9A 1X0FA 4JI7J 4BCAA 3L3CA 5ALEA 3B82A 1RACB 1RAFB 2V8VA 1HBUB 2DIUA 2XWYA 4H54A 1UVKA 4I2DA 2BANB 3WXJA 2BE9B 2VANA 1KDHA 3KLGA 3ZFVA 5LM7E 4X4TA 2FMSA 2XYPB 4UUWA 2A41A 4IBNA 2Z0GA 1JX4A 2DO4A 3CIZA 3U3GA 3AHPA 5J0PA 1HBUA 2BANA 3TSUA 1CJTB 2DPIA 2OD4A 3D6HB 2V8PA 2WB1F 3G86A 5KFTA 1TMMA 1SL0A 1RBAA 2CQ3A 2PMZC 4HKQA 3UD4P 3SJJA 5D15A 4ECYA 5HI7A 2DT9A 3DOMA 3FBEA 4CQ1A 4F92B 3FLCO 3RFAA 1RYRA 1SZ2A 3PDNA 3OJUA 4QJVA 4B02A 3D45A 3DLLL 2QB1A 2QV6A 2X6SA 3TADA 2QI2A 3TTFA 1ZQEA 2FPKA 3GDQA 4CESA 3PX6A 1T02A 4DV1K 4DHVA 1N52B 2RUGA 4J9NA 4UARA 4FFDA 1YSJA 1U47A 2E5IA 3AA8A 3QRPA 3NRWA 1MWMA 3PMNA 1HKAA 4PKDB 4CLKA 3LDLA 3HW8A 3K58A 3HHLA 3Q8VA 4G3IA 2A6AA 5LOQA 3PEHA 2IHNA 1F44A 4DWIA 4ACOA 4LR7A 4K4VA 3ZZUA 2QXLA 2QL5B 4CW7B 2FVRA 2LQBA 5A2QO 1T7PA 2KB2A 1ZQIA 2VBYA 2MQQA 4FF2A 4ELTA 1W26A 1HW8A 1GMVA 4C0ZA 3UE2A 1IJJA 4Y2MA 3CFRA 3DEEA 5EE3A 3NH0A 2GJ2A 4FE3A 4FP9A 4JV0A 1DJ0A 2YX1A 4DR1K 2G5IB 2OPQA 3J81j 3KK1B 1U45A 3OR2A 3I28A 4F67A 4MTPA 4B1WB 2H3GX 3BR8A 1VHFA 1NOZA 2D4WA 4RG8A 4EX6A 3VTIA 3KIOA 3GQCA 2K4EA 2KKHA 2Z2ZA 3VF2A 1N88A 4D3GA 2P9NB 3FVYA 2YMQA 4FLVA 3OVSA 3PJXA 4CLLA 2ZJAA 1WF0A 1U0SA 2DR7A 2X3GA 1RAAB 2GEMA 3NGIA 2ZVIA 1BIUA 1TFYA 4K8ZA 2PMHA 3CO9A 4IJAA 3ICLA 2Q4TA 5IIKA 4LF6K 2PA3A 1RISA 5FRMA 4HTJA 2RE1A 4RQMA 3T5JA 1K9MO 4J90A 3PTWA 3RGIA 4FJ8A 2WTFA 2G06A 3V81A 2CYYA 3OXFA 2VG5A 4OJ6A 4BHQA 3AAPA 2F9TA 2JFKA 1ZQ1C 2HBMA 1VQKN 3OQ2A 1S79A 4WJ3B 2ZZNA 3V9SA 2MKJA 3NAIA 3Q8RB 2BEFA 2HWHA 4PG6A 5ALMA 4GMJB 2ROPA 5FPMA 3WQTA 5IT0A 3KZBA 4YY3F 1YTUA 2MLYA 3GFXA 2GMJA 2E88A 3WXIA 3SEIA 4CCHA 3ZT2A 2E44A 2G8VA 2EK6A 2O6KA 4L72B 2A3VA 2CZVC 3LW5C 3TR5A 4BGBA 1UAWA 3RB6A 2JJ4D 1RHKB 3N79A 3VQTA 3RBDA 2QL7B 1L6NA 2MHEA 3KDOA 4JI0K 2AGOA 2WVEA 4ILHA 2YVSA 4C11B 3CRXA 1TAUA 2MLZA 3OYDA 2HRYA 4NLKA 4YMEA 3IDHA 4HLBA 4Z6EA 3H8JA 4N7TA 4OJPA 4Y2CA 2LEPA 4CHZA 2V4RA 2HFNA 3B0YA 4NWBA 2HHHK 5J2AA 2IIRA 2KYZA 3RH5A 8ICEA 1F5BA 4FZNA 1KVCA 2IPOB 4H0XB 1K1QA 2W3RA 3IDWA 3MUMP 1N62A 2QFJA 3L3UA 1M5HA 5F0XA 1U0HA 3L95X 5D4LA 2H1YA 2ZJQL 3AVLA 2ZOMA 2R2UA 1VQKS 2F1IA 1TFRA 1BQNB 2VJVA 4F26A 3CPWM 2D8CA 3Q86A 1OXJA 5C24B 2NXNA 4AM6A 3EE3A 3KK2A 4KIAA 5LMUF 3VZHA 4JV5K 4A8XA 4O44A 3GG0A 4LVNP 1Q53A 5C24A 4ZOSA 2VA2A 1L7MA 4BR5A 4LFAK 2RHSB 1Q18A 2GA7A 2LP4A 9ATCB 3O6QA 2LDYA 4NLBA 3BUZB 3ENVA 3QB0A 3CJ3A 4LRFA 4ZP9A 3T9ZA 3DFEA 1Y11A 3KLIB 5IQ6A 2ALYB 2KJ5A 3GPAA 2XZDB 1Y5LB 4GC7A 4C97A 7ICIA 5DO2A 5F1XA 4H0OA 3N4MB 2IHR1 1R0CB 3CEDA 4KQZA 1XTZA 1RWPB 2XHCA 4IR9A 1NGHA 4YUDA 3BO4A 1ZTTA 1ILYA 3O1BA 1BPXA 2NNWA 1BVSA 3NS6A 4K5RA 4DV2F 1XMQK 4JI2F 1RILA 5LXRA 4PZVA 4BR7A 2K2PA 3QU4A 2VQFK 2BM0A 3SV3A 4IL6U 1EZZB 2GFFA 3M6KA 4IG0A 3F56A 3HULA 4LFBF 3L4BC 2E1ZA 1IM6A 2L08A 1S0NA 3R9KA 4YOEA 3DGPB 3I31A 2JZBA 3ZZRA 4FLWA 3AVHA 8ICQA 4AHCA 1UJ4A 5H9FJ 4GKJJ 8ICBA 2XYGB 2I2YA 3DGPA 1QHAA 4LF9F 1I94J 2EKNA 2HFOA 2CPFA 3VERA 1RPLA 2EAOA 3R5DA 2P1JA 2IDEA 3NS5A 3FZLA 2J9DA 2YQEA 3OLBA 4GVBB 1JALA 4CJLA 1ESVA 4DTMA 5GTHU 3OYFA 1S9GB 4LR8A 3EZWA 4DV4F 4MKVA 2JH7A 1FFWB 1WOQA 1BPDA 3TADC 5CABA 3NF9A 1XNQJ 5ETQA 1QZ5A 1NNDA 3SQGB 2LM1A 2PEHA 4DV0F 3PR5B 4CIOA 1A6SA 3FZ2A 2BJ9A 5DM6L 3CCRN 2DKXA 2LEAA 1WAJA 3H5YA 2ZJPQ 4I2BA 5AK6A 5ALYA 2BDUA 2DR5A 3VAIA 4PG7A 3R5CA 2DNKA 3QZ8A 5J2KA 3HHLC 1WHYA 2OPSB 5KT2A 1FRLA 1RTIA 6FD1A 2XY8A 1ZYQA 4X5VA 2WVDA 3ULHA 4QJFB 2A10A 1AZSA 3NMRA 4ZLNA 5GAHP 2FPLA 2LYBA 2W7OA 1WBDA 2OPSA 3MGVA 4LFCF 4AH9A 3T19A 4IDHA 4AT1B 4UOGA 4PABA 3CP8A 3HKZD 4OGEA 1ZQFA 2LQJA 1FJCA 3U3YA 2FSNA 2FY8A 3B8AX 1X6IA 3IUCA 1YTYA 1DK2A 1RQNA 3S3NA 2AGPA 3FMBA 4BR2A 4J37A 1K73T 1CJKA 2GIRA 2CNNB 2EZZA 4PPDA 2QM1A 3MABA 1BWVA 1EHWA 3QO9B 4DR2J 3CCRS 4RL1A 1C7YA 4WBFA 1DURA 5I3UB 1TL3A 1KEJA 4B3TF 1QSYA 1HYSB 5CWRA 2B56A 1ZQPA 1E6YB 2P9SB 3M7VA 1RI7A 4NLQA 3C14B 1LK7A 1J5EK 3I5BA 2YPZA 4P74A 4CH1A 5I3UA 4YFUA 4K25A 5KGWA 1HQEB 1HYSA 4HI2A 1Q7YO 3D1QA 4NM1A 1NZAA 2KT5A 5EN1A 1U8SA 1LAWA 3C14A 4OX7A 4QQBA 4HHTA 3HPHA 3N4PA 4TUQA 2DBYA 3KKRA 2KU7A 4I56A 4DPTA 4OX9K 2AA4A 2DB1A 1FRHA 2MUTB 3OFGA 4ISFA 5AFUH 3IGVA 1JRPA 2GW8A 3OD2A 3SZ2A 5M1OA 1U04A 4C48A 4KLEA 1CI4A 4CE6A 5I42B 4BC7A 2VWJA 4EEYA 2QSWA 3PYDA 2ZBRA 3IM8A 3R1LA 3MD3A 3IFEA 5HMYA 3VQ7A 2ZJQQ 1FIQA 3R1HA 2GO8A 4F5OA 1TUYA 1NGAA 2D0PA 3WDOA 5AXNA 4C8NA 4L73A 5I42A 3DLGB 4PG4A 3I1YA 5JTIA 4ZDNA 3JQMA 3WX8A 1TUVA 4P6QA 4J9QA 3W8PA 4NRTA 3OTOK 1PJ5A 4LC9B 2IVPA 3PR4A 2AJ2A 3N6MA 5SZTA 4J9PA 3OYLA 1QQNA 5F8JA 3M32A 2XHWA 4IDKA 4BRMA 5HMMA 1Z05A 3G4SN 5B09A 4RCHA 4IUFA 1TYQB 1KD1O 1YRTA 4U9RA 2UP1A 2YJEA 5KL8B 3U7JA 3ATUA 1TYQA 1UT8A 4O5EA 1Y4ZB 3SQIA 5ETOA 3QESA 1UCNA 1RK8A 4Q8FA 3ZT4A 2P6RA 4NLRA 1OQ3A 2LLZA 5ALXA 5B7WA 3N5BA 1YBTA 1RT5B 4J5OA 1O08A 2L9DA 4QS7A 3I4HX 2NXEA 1X9XA 4CGIA 2IBOA 5ALLA 4LRAA 3CJ9A 4H0YB 2V51B 2NQPA 2QLBB 4RNHA 4PL2A 4CO2A 2RDJA 2XNQA 2XO7A 1FNMA 3EZ5A 4C7ZA 3J7Z5 1VQ4N 1ATRA 1GLJO 3LO3A 2WBRA 4DL2A 3G4SS 5K8NA 3O3HA 3LGMA 2GWSA 3TJ9A 1HWKA 2EFPA 1LK5A 5GMDA 4DR4J 1D8LA 1QM9A 3EICA 1N34F 3M8WA 3UR0A 2BYCA 3IRUA 1RCOB 1JXVA 5L8RC 4K4WA 4LF4K 3E01B 4B9QA 1NJXA 2Q79A 4J9MA 4OYXA 3A3PB 1I39A 3UN5A 3KWMA 3DLHA 4WP3A 3C16B 4MO4A 1C0TA 1WI6A 1K9MT 4DOBA 2XMKA 3BKFA 4XUSA 5HRPA 1MU2B 2WK4A 3V2UC 1EO1A 2OEKA 8ICWA 4FLUA 4IOBA 1JLAA 1IKVB 2F8KA 2Z57B 5M2UA 2AYMA 3OYJA 4K4IA 1VDVA 5DM6Q 3UKUA 4FZXC 1Y0HA 2FIUA 2CWKA 3CCVN 4B3SF 4C0OC 1IKVA 4JI3J 4C0HA 4ETZA 3K5MA 2GJIA 1VQ4S 4MK7A 1Y88A 3HHEA 4HHUA 4DL4A 2EPIA 4EU0A 3H25A 4M6WA 1Y64A 5MLCQ 4MK9A 3HZGA 2PFOA 1ZD2P 2BPGA 2GHPA 3KLFB 2ZIVA 4DTRA 3RSEA 2G1HA 5KFQA 2P6SA 1HNIB 1IJEB 1FDDA 1D9AA 1FFVA 3BM7A 1IWGA 3THXB 2KVSA 3KLFA 3QU5A 3T5KA 2KICA 9ICGA 3FNNA 1RDBA 3HDSA 2PKEA 4EZ9A 3MBYA 3OFHA 4DUYK 3D3CJ 4OI2A 2V8GA 3CD5A 1SWVA 3FCHA 1LWEA 1C1BA 1U1KA 3THXA 3BSAA 3ED5A 4DBQA 4WIQA 2UUCJ 3HPOA 3UQSA 1GOBA 2FZCB 3EEQA 5JVGL 3M8QB 1JXBA 1PILA 1D9FA 3CCVS 1JB0C 2R8KA 1FWLA 2X3DA 4R64A 3MEEA 4Q8EA 2IM3A 3TZWA 4EENA 4P0PB 4B9LA 2WF9A 2MJUA 1ZBSA 3NOCA 3M8QA 2Q0RA 4YG2A 4NLNA