2HHVA

T:o6-methyl-guanine in the polymerase-2 basepair position
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*TP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhvA01
5KT2A 2FMSA 1WCNA 1RBSA 1F21A 3VQ5A 1BPXA 4FW1A 4KMUA 2FLLA 2ETJA 4K8XA 1LWFA 4FJ8A 5KT5A 4CEEA 4AHTA 4CHZA 2BHNA 3C94A 3AA5X 4R64A 4MFBA 5J2CA 1A5VA 4CGGA 2MAXA 4DSJA 1WCLA 1VRTA 2PY5A 1U48A 4JRPA 3O4QA 3VN5A 2ZTDA 2P6UA 4PHPA 1WLJA 3Q8MA 3Q8LA 5L1JA 4FJ7A 5CA7A 5DKWA 2KW4A 3KKRA 1S5JA 3MXIA 2C2RA 3P1GA 1SKSA 3AO5A 4ED8A 4K4GA 1C0TA 4B9SA 3KHLA 2BKEA 5D49A 2QKKA 4EBEA 1XI1A 4CFDA 4DQIA 3ZSYA 5KFAA 4KTQA 2F8SA 4DTRA 1EP4A 2ZE2A 4ICLA 4AHUA 3HW8A 2V9WA 1HNVA 4RUCA 4MF8A 4DL2A 1RCHA 4FJ5A 4AHCA 5J0YA 5IINA 2AJQA 3UXOA 1K1SA 4KKOA 4FBUA 1QSSA 3S9HA 4I2EA 7ICUA 2XO7A 4RZRA 3AA3A 2FPMA 2PXIA 5CP2A 5F9NA 4O0IA 5DB9A 5DGBA 2H5XA 4NCGA 4BDPA 1DLOA 3MECA 4DOAA 3KLEA 4KLLA 1QLNA 3MAQA 4MF2A 2FLPA 4PUOA 1X1PA 1B9DA 4FVMA 2JEIA 5KFCA 5IIOA 4O55A 4I2HA 1GOAA 3JPPA 4DQPA 2FMQA 1CXQA 3RB4A 1JX4A 1T4GA 4E0DA 4I2FA 2P5GA 3LALA 4F5QA 4EYHB 4YP3A 3UXPA 3PR5B 4B9VA 4NCBA 1Z00A 1ZQMA 4KHYA 2W9MA 2C2EA 3DRSA 2LYHA 2C2DA 1T8EA 1PZNA 4M04A 2A1RA 3PR4A 4QWDA 1BCOA 3QESA 3Q8KA 2KQ2A 1HPZA 3RMAA 4RG8A 1KFDA 1S77D 3ZT1A 4QW8A 4Z4CA 5C24A 3BQ1A 3NFAA 2W9AA 4QWCA 4XA5A 3ZSWA 8ICBA 1ZQZA 3C6TA 4QAGA 3PV8A 1MQ2A 4FLVA 4QZDA 4CGHA 3V7LA 3H8WA 5KT3A 4KLOA 4BXOA 3QEIA 5EWEA 3SNNA 4PWDA 4ID5A 2VWKA 4DU1A 4Z4GA 3ISCA 1WN7A 4KPYA 1JXEA 2HHVA 5D3GA 3MR6A 4DQSA 3VQCA 3AV9A 1ZQNA 3OYGA 2M9NA 2XC9A 3VQBA 2VG6A 3VQ8A 1SKWA 4O44A 3PW4A 4QWBA 5DB8A 4MFFA 1JLFA 2Z1JA 5KG1A 4NLKA 2XY6A 3DM2A 3K2PA 3S3NA 1ZJNA 4DL7A 2V4QA 2JEGA 4DTSA 3OYEA 3OYFA 7ICVA 4UAYA 2V4RA 1ZQOA 4I2GA 4B08A 3CYMA 4ED1A 3HYFA 3NBPA 3PW2A 1DOQA 4Q0BA 3V7JA 5IIJA 2A1JB 4DFJA 4C8NA 2HMIA 7ICQA 5EU7A 4G3IA 4QCLA 1LWCA 1Y97A 3K58A 5CB1A 5DDMA 3EYZA 4CJQA 3BQ2A 3BQ0A 3ZD9A 3AU2A 3MXMA 1RT3A 3C21A 4DFMA 3RR7A 3LDAA 4DLEA 4FS2A 7ICHA 2C28A 4DTJA 2O4IA 3QINA 2BQ3A 3PMLA 1TL1A 2Y1JA 1HQUA 4FXDA 4CEOA 3F73A 4KI6A 4M3XA 4LZGA 4DU4A 2VWJA 3NH2A 3WNHA 4KHWA 4FLYA 3KLHA 4W5OA 4RPXA 8ICWA 2BANA 3V9XA 4CJLA 4F2SA 4PY5A 1RBTA 3V9SA 4N56A 3T5LA 4BDYA 3RRGA 3HXMA 2G8WA 3G6VA 2EHGA 3DLEA 4Q44A 3EW9A 1ZQHA 3NHGA 2JEFA 3SQ4A 4XIUA 3PUFA 1KFSA 1ZQWA 1BPDA 4RW9A 3K57A 4RQ1A 3OYIA 3GQCA 4W5QA 8ICVA 8ICGA 4PGYA 4LH5A 4CF0A 4ECUA 1NK5A 3OYHA 1NK9A 2YKNA 4QZ8A 3ZDDA 3O3HA 2NRVA 3QZ8A 1C7YA 3OS1A 5CJ7A 3L2QA 4DLGA 1Z25A 4M9JA 1D9DA 3DRRA 4MFCA 4PHAA 4M3WA 5JUMA 1ZQBA 2I9GA 3TAEA 5J0XA 3NF8A 3T19A 2DFEA 1JLAA 5CR0A 5L1LA 1QHTA 4P4PA 4IQWA 4J2EA 2UVUA 5KFMA 2R8KA 3QETA 3MFIA 4M45A 4K4HA 3CFOA 1TV9A 2HB5A 1N6QA 1KCFA 4E7HA 2YKMA 4OPKA 1MC8A 1C6VA 3KLFA 3AO1A 3JPOA 4KITB 4PH5A 3SQ2A 3MR2A 5KG0A 3MR3A 4R65A 4J2BA 3IRXA 1RYRA 2JEJA 3RJHA 1C1CA 4WE1A 4CJVA 4IKFA 4F5OA 3IHQB 5I42A 1HUZA 4M9GA 3LP1A 3DMJA 2J6UA 4CIFA 3C1ZA 3QEBZ 9ICLA 1YT3A 1C1BA 4F4WA 2AGPA 9ICHA 3QNOA 4CHOA 1CZ9A 4NM2A 3MGHA 1ZBHA 1XS9D 4XQ8A 4IRDA 2HHUA 4IG0A 1ZQXA 1S0MA 2OZMA 3G6YA 1U04A 2F1HA 2IMWP 1A76A 4FM0A 2Z1HA 1VSDA 3DOLA 2I1QA 1VSJA 3PVXA 1JLGA 4F91B 4ECWA 4LSLA 9ICRA 4DL5A 4OKEA 3I8DA 3AO4A 3FYHA 4ZTFA 3JPRA 3TABA 1RPLA 2PYJA 2PFNA 3UXNA 1ZQTA 4F4KA 4CHPA 4E1MA 2P6RA 3ITHA 3WNFA 3C23A 1XSLA 3TAPA 3GIJA 2GBZA 4X5VA 4KLDA 4NLZA 3QIOA 2KZ3A 4CJ4A 5KFOA 5CZ2A 4ZTJA 4E7LA 5L9XA 3ETLA 4YXJA 4RNMA 4I29A 2AGQA 9ICAA 1W0HA 1WSIA 1NKEA 4DEZA 5J2HA 4DTOA 3Q8QB 5J0UA 2X6NA 4NYFA 4HTUA 4I9QA 4F8RA 3V6DA 3O4NA 2HW3A 3NAEA 4DG1A 4YD2A 2JLEA 2ZTCA 4KFBA 4M9HA 4NYNA 2ASJA 8ICYA 3SJJA 4DSFA 5DBAA 3TAQA 2YNIA 4KLIA 1T7PA 4RW8A 3ZT0A 3K5NA 5J2AA 1L3VA 5KFTA 3VQPA 4CK1A 4OJRA 3LZIA 3I0RA 5KFWA 8ICZA 1D9FA 5KFRA 5KFDA 4QZEA 5KT7A 2FLNA 5KG2A 3T3FA 3RRHA 1KSPA 4F5RA 4ELTA 1A77A 4FLUA 3RAQA 3SI8A 3L8BA 3V6HA 4J2AA 3WNEA 3AA4A 3DLKA 3PO5A 4DTUA 4PPXA 1LW2A 3KKSA 1LV5A 4UB2A 2FMPA 1SL0A 3HM9A 4QZGA 4O5KA 3T5KA 1RBRA 3H4DA 4I2JA 3AA2A 1A5XA 3MEGA 3IG1A 3MGIA 4I2PA 7ICLA 1BCMA 1UT8A 1ITGA 1S1XA 1RXVA 5J29A 1L3UA 4N47A 2HNDA 1ASVA 4Z4FA 3V72A 2OPQA 1RZTA 4ZHRA 3ULDA 4YQWA 4E7KA 4CF8A 2RKIA 3LAKA 2Z1IA 2ZTEA 1UA0A 1V9PA 4OGCA 3NH1A 4I2DA 1KDHA 1W9HA 4RQ4A 2HHSA 1TAUA 2QK9A 4HCCA 3ISBA 3SYZA 1NJXA 4HUEA 2W9BB 1TK8A 4K8ZA 1S1TA 3M9NB 1BISA 1QSLA 5KFEA 5FROA 2OA8A 4CJ3A 1ZQKA 3O3FA 1RILA 1TK5A 5BOMA 1U9LA 4QWEA 1DGSA 4XUSA 5J0PA 3ORYA 8ICSA 3EY1A 3OYJA 4UB3A 1RT5A 3LWLA 1BL3A 7ICGA 2KZMA 3LWMA 4IDKA 3VQDA 4TQSA 1U47A 4DF4A 1Z3EB 1S1WA 3DLBA 4UAZA 4CK2A 2R7YA 4F4ZA 3RJIA 1S6PA 4G1QA 2R8JA 4IQTA 1X9MA 4IRKA 3V1OA 3C1YA 2VA8A 5KFZA 2X6SA 1NKBA 3MBYA 3BGRA 3KK3A 3RJJA 2YNGA 4CFAA 4KB1A 7ICNA 4AHVA 2HVIA 4H4MA 2PFOA 4O9MA 2RN2A 4MEXA 2ZD1A 4DOBA 1T05A 4LD0A 3OYCA 4YG2A 4CE9A 3KJVA 1VSKA 1EXNA 4JS4A 3SV4A 3ZSVA 4F50A 4C8OA 3AVBA 5CHGA 2F8TA 4F4YA 4LH4A 2IOCA 2BCRA 5DG8A 2BPFA 4DU3A 4ECTA 2ZQBA 1TKXA 3F9KA 5SZTA 5DG7A 4DSKA 2X78A 1X2IA 3PW7A 4CFBA 1RYSA 1JIHA 4E19A 4ED7A 5E41A 3MEDA 2XCPA 4KTZA 3EPIA 9ICGA 2ISOA 1VSMA 1HMVA 1B9FA 3NDKA 1B43A 1Y88A 1A5WA 5HRRA 2RPIA 1RBVA 3RJGA 4CERA 1CZBA 3AVJA 1ZQFA 4QZHA 4B8CA 3AVFA 3RH4A 4OVLA 4HUGA 5KFNA 2AU0A 2G8KA 3NF6A 3QERA 1NK6A 2XY5A 4Z6DA 3CG7A 4CFCA 4IFVA 4CECA 3AO2A 5KG6A 1CUKA 4CGDA 4CIEA 4AILC 4NM1A 1RT6A 2A1JA 2XGPA 3NGIA 2DFFA 2FBXA 5HRNA 4NY8A 1ZBIA 3KTQA 4TURA 2DFLA 4UBCA 3LPTA 4DMNA 1G15A 2Q0ZX 4ID1A 3NH0A 4JK1A 4GXJA 7ICSA 4CEDA 5KGWA 1ZQVA 2YHAA 2GWSA 4YFUA 1JLEA 5KG4A 4FK2A 4J9QA 5L1KA 2ZUCA 9ICJA 3TWHA 2ASLA 5KFSA 5C42A 4BE0A 4FYDA 2ASDA 2B5JA 2E4LA 1QQCA 3NGYA 5HRSA 4RT3A 4YMMA 1KVAA 3ZSOA 2IS3A 3NE6A 4ELVA 5HMMA 5KT6A 1J53A 3EZ5A 4M2YA 3DOKA 4KN4A 4DTNA 4R5PA 5J2GA 4CEQA 1UOCA 1QE1A 9ICWA 2W8LA 4FZZA 3V7KA 4DOCA 3U3GA 4YR0A 1XSPA 1ZQAA 4DSLA 5KFXA 2X74A 4YMOA 1FK9A 3AVNA 9ICPA 1BPYA 3PY8A 1JLBA 4H4OA 2J6TA 4M6WA 1NJWA 4OKKA 2IAJA 2BPCA 5DDYA 3CQ8A 4O0JA 5HROA 1H38A 1ZQIA 1ZQUA 2RDJA 3P83D 4F5PA 1YVUA 4F2RA 8ICHA 5CY4A 4Z4HA 3V9WA 3ZCMA 1RNHA 1NJYA 5KI6A 4FLZA 4BACA 3AVMA 3AVLA 5HP1A 8ICNA 3IM1A 3SUNA 1ZBLA 4MFAA 1TK0A 5C25A 4IG3A 3K5OA 1UT5A 1L3TA 4YCXA 4M0AA 1RTDA 4R8UA 2UVWA 3DLGA 3OVNA 4E7IA 3KD5E 1HNIA 3PW0A 4IFYA 3EWAA 1TFRA 3K5LA 4O3NA 4UAWA 2DFHA 1J54A 3UIQA 4B9MA 4DL3A 1TV6A 1R0AA 7ICEA 3LP3A 4GW6A 3IAYA 1Q8IA 2BCQA 3ZSQA 4CJTA 5J2JA 4EZ9A 4I7FA 4KLMA 5KG5A 3GV7B 3VQ4A 1N5YA 4QZAA 1N48A 1NKCA 4RW6A 3RJFA 1BPZA 1EETA 1COOA 4RUAA 3QEAZ 1IKVA 3GDXA 4PA1A 2HHQA 2PFQA 3T1AA 3LPUA 4R66A 9ICCA 4CCHA 4RQ6A 4M6WB 4BGDA 4KLJA 2IC3A 2YV0X 1I39A 1C1AA 2P1JA 3ALYA 4JV1A 1K6YA 3RMBA 3RJKA 1NK7A 1XSNA 4EEYA 3OJSA 2WOMA 2Y1IA 4TSXA 5K14A 4CJSA 3HP9A 1AROP 1ASUA 1KVCA 3OHBA 1TGOA 3QNNA 4YMNA 2R8GA 3VA0A 4F3OA 3T5HA 2YHBA 4QWAA 9ICIA 9ICEA 5KFIA 4J9SA 1QS4A 3OHAA 5J0TA 3DLRA 2AQ0A 5KRSA 4BWMA 1IM4A 1BGXT 3SCXA 3GV5B 2ZJ8A 1WSHA 3GIMA 2G8UA 4RQ2A 4E1NA 4N76A 4M3RA 4QZ9A 4R8UB 5J2QA 2KFZA 1JKHA 5KFYA 4CJEA 3CM5A 4TUSA 2AQ4A 4FJ9A 4RPYA 3TQ1A 3OYMA 5FRMA 3L3VA 4FJJA 4DF8A 2XY7A 2XCAA 3BJYA 3B6OA 3LP0A 9ICNA 1U4BA 4ED6A 2HHXA 2QXFA 4IBNA 2W9CA 1BIZA 3Q8RB 4ECXA 5DBCA 4RQ7A 8ICLA 4NCAA 3ZDCA 1WAJA 5KGXA 3TAGA 4FM1A 4Z6FA 4PGQA 2W8KA 3TFRA 4ELUA 3ZDBA 3AVIA 4J9RA 1J5OA 4FJMA 4Q8FA 3L2VA 2W42A 3VQ9A 4RT2A 4YVZA 1KRPA 3M8PA 4O3OA 4FJNA 3NF7A 5EWFA 3MABA 4ED2A 2E6MA 4EP5A 4CJKA 1U49A 1S0VA 3DLHA 4J2DA 3MDCA 5KT4A 1VSIA 3JPQA 5J2MA 2J6SA 4GMJB 3OSPA 3LANA 2JZBB 4RNOA 2BGWA 4RQ3A 1WSGA 3PNCA 3HP6A 2PYLA 3S3OA 3OYDA 4FLTA 5DMRA 8ICMA 3LAMA 2PZSA 4YXMA 4B8AB 1D8LA 3DI6A 1ZBUA 3QE9Y 4UB4A 1ZQYA 3L3UA 1RT2A 4CEFA 3UQ2A 1TKTA 4RW4A 3KLGA 4I28A 3B0YA 9ICSA 2DTUA 1T3NA 4JLHA 4CEBA 1LAVA 4F4XA 8ICAA 4B9UA 1VSEA 1WSFA 2QKBA 3HL8A 4GLXA 5C5JA 4MQ3A 4ECSA 4J9PA 4Y1DA 5HBMA 5CYMA 3C2KA 1I3AA 3SUOA 5HMLA 1TKDA 3LK9A 4M9NA 4BWJA 2W9BA 2W9CB 4Q43A 4ZH4A 4O3QA 9ICVA 2RDIA 4DFKA 3AVHA 4FJXA 4DTMA 2DPJA 1HJPA 4CGJA 3MXJA 3RJEA 1D5AA 2D0CA 3Q8SB 3GIIA 1KEJA 3VQAA 4KAZA 1XU4A 4KLUA 4F3TA 2UVRA 1S9EA 1S6QA 5IIKA 5HHIA 3RB0A 2I5JA 4C8MA 4I2BA 4C8KA 4MEYA 4CJRA 5CYQA 2NRZA 1JL2A 2B21A 2OPPA 4M47A 4TQRA 4FBTA 4CHQA 4FZXC 3M9MB 3K75D 1VSHA 4FK0A 1CXUA 5TZVA 3KIOA 3ZSRA 1LWEA 4FM2A 4AH9A 5J2PA 3PX0A 3C6UA 2VG5A 1N56A 3NGDA 4JS5A 8ICUA 5JS2A 1FKOA 3PW5A 9ICQA 1HYVA 1MSWD 1SV5A 2ZJ5A 1DTQA 4FLWA 4KN7A 3V6JA 5J0OA 2BPGA 4ECYA 3NCIA 1S0NA 1WSEA 3RMCA 1ZQEA 3V4IA 3OY9A 3C2MA 3KLIA 4M3ZA 3HT3A 4OPJA 4RU9A 1JL1A 3L2WA 3D45A 7ICJA 1O1WA 3K59A 4P4OA 4Z6EA 4EBCA 5KTQA 5J2BA 4CGIA 1KFTA 5D4BA 5KFKA 4KO0A 3PX6A 3PO4A 4DSEA 5J0WA 1JXLA 4DQRA 3CM6A 2G8HA 4DTXA 7ICMA 1KTQA 3KD1E 4CF2A 4M3YA 3BQTA 3LDSA 4EYIB 4CK3A 4OKJA 5KFJA 5DLGA 5J2IA 1NK8A 1WSJA 1GOCA 3V1RA 2ZUBA 4KREA 9ICFA 1HRHA 5KG7A 3V1QA 1CEZA 3QEPA 5EWGA 3RWUA 1VSLA 2E6LA 4CJFA 4M3UA 8ICTA 3G6XA 4CJWA 5DG9A 3HVRA 4QZFA 1NOMA 2G8IA 3N4MB 1JXBA 2XHBA 3JPSA 4ED0A 1VSFA 4B9NA 3U3YA 4KLSA 4M41A 5KFGA 4J9OA 1CLQA 4LZDA 4ECRA 3C95A 1ZQGA 4IR9A 3SQ0A 5KFLA 3AVGA 5IIMA 1ASWA 4ECVA 3RMDA 1BPBA 3O3GA 2AGOA 3GIKA 3V6KA 4YD1A 1BVSA 3OS2A 2A1SA 1RT4A 9ICUA 3VA3A 1RT1A 1ZJMA 3KK1A 1L5UA 3ISDA 2F96A 1LAWA 2IHMA 8ICXA 4LVSA 1XWLA 1MQ3A 9ICBA 1NJZA 4ECQA 4LSNA 1Z26A 3AVAA 8ICIA 4JV2A 3OYKA 3M8QA 3TARA 3RH5A 2WTFA 2B6AA 1U45A 3JPNA 1RTIA 3K4GA 2PI4A 4I2CA 5CWRA 4IQUA 3MDAA 2OPRA 5J1EA 2XGQA 2MUTB 4W5NA 4RQ0A 1GOBA 2BQRA 3ZT4A 4FLXA 5DQIA 1TVRA 3HVTA 4OLBA 5CZ1A 3QO9A 3VQ6A 3C5GA 4HHTA 1XO1A 5SWMA 5T7BA 3KK2A 3AVCA 1IKYA 4L8RB 4ECZA 4FK4A 4Y1CA 4KRFA 1DTTA 4FJKA 4FO6A 5EOZA 5DQHA 4BDZA 3OYBA 8ICEA 4KHUA 3RTVA 5BPCA 3C5FA 8ICRA 1RXWA 2KZZA 2GUIA 1MU2A 4CESA 1ZQRA 3AU6A 4B9TA 8ICFA 1TKZA 4KLGA 4QZCA 4QZIA 2IDOA 2YNFA 4KHQA 2R8IA 3H40A 5J0RA 1REVA 5HHHA 4P2HA 8ICOA 3KHGA 3IS9A 1ZYQA 3K5MA 2FC0A 2HHWA 2NRWA 4CF9A 5DBBA 4UB5A 8ICCA 3QLHA 2VG7A 4Z0UA 4OGEA 3OYNA 4FJHA 3V81A 3PMNA 8ICQA 3B6PA 3H8JA 2WONA 3EPGA 4KLHA 3OS0A 3M8SA 4KLEA 2R8HA 4AHSA 4BE2A 3GV8B 4Z4IA 1ZQCA 3FFIA 2G8VA 3MEEA 3T5JA 8ICPA 2D0BA 2DPIA 4PGXA 3VQ7A 2ISPA 4JWNA 2PFPA 2NUBA 4K4IA 3V9ZA 4EZ6A 2JGUA 3UPQA 4GC6A 3E01A 4GXKA 2BGGA 3NF9A 3TFSA 7ICOA 1HQEA 3OYAA 1SZPA 4RQ5A 3BDPA 3ZSZA 4UBBA 3JPTA 4J9KA 2KN7A 3ZSXA 3G0ZA 3C2LA 1SKRA 3KHHA 4KV8A 3AUOA 1EX4A 4J9MA 2B4JA 4RNNA 4E89A 4DTPA 3TR8A 1UWBA 1S1VA 1Q9YA 5KFBA 4CIGA 5J0SA 4CHYA 5DB6A 1YTAA 2Q3SA 1LW0A 4EP4A 3OJUA 1ZBFA 3AVKA 1JLCA 3GILA 5HRPA 3VQQA 4CF1A 3NTUA 1Z00B 3QEWA 2HVHA 3Q8PB 5FRNA 4KLTA 4BE1A 4UQGA 1JLQA 4DFPA 4KHSA 2VA2A 2NRXA 2NRTA 2HNZA 1BQMA 3CFRA 3JYTA 2BCUA 1ZQQA 4EBDA 1TVAA 1QSYA 2BQUA 3RH6A 3I0SA 1SL2A 3RAXA 3ZT3A 4M3TA 5IILA 1TL3A 4DL4A 1S10A 1S97A 2IHNA 3ZDAA 4CJUA 4BXOB 3SPYA 1ZETA 5KG3A 2KTQA 3OGUA 1L3SA 1C0UA 5KFUA 5DGAA 9ICMA 3TANA 2FBVA 3H7IA 1QTMA 2XRIA 5J2FA 3QEXA 4DO9A 3QZ7A 4YR2A 4DWIA 3H4BA 1RTJA 1JN3A 4YR3A 2ZJAA 7ICKA 8ICJA 4F92B 4ED3A 4I27A 1D8YA 3OSNA 1HUOA 3DRPA 1JMSA 4B3OA 4F5NA 2BE2A 3HPHA 2HNYA 2JZBA 4FW2A 3AO3A 3ASMA 5J0QA 5HLFA 3D0PA 3DYAA 3M8RA 1BQNA 4F93B 2IA6A 4KB0A 2BR0A 1KVBA 1YTUA 1BHLA 4FS1A 4Q8EA 3TAFA 4QOZB 4DQQA 2YNHA 2ITGA 3SUPA 1FKPA 2OWOA 4GC7A 3RR8A 2OPSA 4NLGA 1NOYA 2BCSA 1VK0A 5D46A 5DLFA 2ZUDA 5L1IA 1Q9XA 1SL1A 4O3PA 4IR1A 2XY8A 5KFPA 4FZYA 4DS4A 4O5EA 2FBYA 4Z6CA 5I3UA 2FBTA 4TUQA 4M9LA 4IRCA 1RT7A 3VQEA 1KLNA 4W5RA 1IKWA 2DY4A 4W5TA 3HSTB 3L2RA 2KFNA 5JS1A 4I2QA 1WNSA 1EKEA 4GVMA 1TAQA 4QW9A 4HCBA 4CEAA 5KFQA 1ZQJA 5KFVA 1ZQSA 1WAFA 3M9OB 4DL6A 3PX4A 2HHTA 1X9WA 3QEVA 3U6FA 3SQ1A 4Z4EA 4CJPA 2VA3A 4NLNA 4O3RA 4OLAA 2ALZA 2P5OA 1HYSA 3ZD8A 2P66A 1S76D 3TAMA 2OYQA 4N41A 1EXQA 4KTWA 4M42A 4YN4A 1S1UA 4RQ8A 3SPZA 9ICXA 3TI0A 3CFPA 3ZDEA 2OZSA 2FPLA 3QIPA 3HJFA 1IG9A 1KLMA 1LB2B 7ICTA 1ZQPA 2D5RA 2BDPA 5DK5A 3GFKB 5J2EA 3SZ2A 3N97B 3LP2A 1UAXA 4NXZA 4O3SA 2F1IA 2UVVA 1S0OA 1BI4A 1X9SA 2IBKA 5BOLA 1B92A 2P51A 5J2NA 1RTHA 1IO2A 4FCYA 1XC9A 4HUFA 3E2EA 1C0MA 4DSIA 1ZQLA 1RBUA 3WNGA 4Q5VA 3JSMA 4N5SA 4R63A 4KI4A 1BIUA 3P5JA 1K1QA 5KFHA 2BCVA 3SV3A 1S9FA 4CJ5A 3RB6A 4P4MA 4O5BA 4JWMA 4JUZA 4CGFA 1XHXA 3FDSA 4B9LA 1FXXA 3THVA 3L2UA 4HYKA 2D0AA 4Q45A 4FJIA 4JRQA 3H08A 3HK2A 2O4GA 5KRTA 1ZQDA 7ICPA 2VANA 2F1JA 4O4GA 9ICKA 1T03A 5J2KA 4I2AA 4YNQA 4RW7A 9ICTA 4CEZA 3OYLA 3ZT2A 3HPOA 3LZJA 3MR5A 1HJRA 2GV9A 4UB1A 4TUPA 3SUQA 4AHRA 2ATLA 1IH7A 3HWTA 2C22A 5DQGA 2LSNA 3G10A 3HX0A 1HYZA 2PI5A 5KFFA 4KLFA 9ICOA 2G8FA 1RDCA 4KLQA 4RPZA 4XRHA 3ISNC 5FDLA 4E3SA 3UQ0A 1BI4B 4KHNA 1BPEA 4E7JA 1XHZA 3RBEA 4JV0A 1IKXA 3RB3A 4LY7A 3KHRA 2FPKA 4DS5A 2RF2A 7ICFA 1S9GA 4PHEA 4CHNA 4I9LA 3SI6A 5F9LA 4HVJA 2Z1GA 5IIIA 2IGIA 4PQUA 4H8KA 1IXRA 3B0XA 1NK4A 1RDBA 3V9UA 3HPGA 5J2DA 4I2IA 3NGZA 1B22A 3S3MA 4C8LA 7ICIA 1UA1A 1RDDA 4J9NA 2MUTA 4QZBA 1VRUA 5DB7A 3HO1A 1J9AA 1NOZA 4IQVA 3RBDA 4PHDA 2ATQA 4YFKA 5HP4A 4FJGA 4GXIA 4O5CA 4FJLA 7ICRA 3A2FA 3MFHA 4J9LA 1RDAA 8ICKA 1SUQA 5HNKA 1NK0A 3H8SA 2EX3A
chains in the Genus database with same CATH superfamily
1WCNA 3ETRA 3SQGA 2BE7D 1BQXA 4KMUA 3CC2S 2WFBA 2FLLA 2ETJA 3IWXA 4K8XA 1FJGF 2QTDA 4HT7A 2HGNA 4R64A 4MFBA 5IOLA 4CGGA 1GQEA 2QSWA 4B1WB 3OHRA 1U8SA 4JRPA 3FCHA 3VN5A 1WLJA 4NEYA 4DV4F 4BRFA 4C1NI 3PYEA 2FSJA 5THWA 5L1JA 2XI9A 4OJ6A 1TL5A 3TRGA 4FJ7A 2ADBA 5ALIA 3AOCA 4A8OA 4ED8A 3JTPA 4K4ZA 2MU2A 3KHLA 2DR6A 3N6MA 4S0MA 3QMLA 4FVCA 1FWPA 1R8PA 4EBEA 2IM3A 1XI1A 2JH7A 3ZSYA 1N5SA 3HW8A 1U09A 4RUCA 4FJ5A 4AHCA 1WC0A 5J0YA 3UXOA 1K1SA 4KKOA 1MMDA 3H0PA 4ES1A 2FY1A 2VDHA 4I2EA 2KKVA 3ALRA 1X6IA 3CW2C 4PYDA 5HR6A 3RBXA 1WKJA 4O0IA 1CJKA 2P9SB 2E8AA 3CERA 5HMXA 3KLEA 3ELHA 3FVYA 2HZAA 2GIFA 3MAQA 4NXNJ 1NAQA 1E3MA 1XTZA 5JLFA 4H5TA 3KJFB 2W6LA 4MO4A 4O55A 1QVFR 4U7UD 3IR5B 1NNDA 2FMQA 2HLUA 2IDLA 4WZQA 3PLAA 3F53A 3O6WA 1YIJN 2HGLA 4RQMA 2N3OA 2EZXA 4DV4K 4F5QA 4MFBB 4IDKB 3ZO7A 4B9VA 3P39A 3PACA 1WELA 2XI2A 1E4GT 1ZQMA 1U6FA 2VKQA 3IUCA 1T8EA 3CRXA 3EZUA 3ZTPA 2HSEB 2A1RA 3QESA 1BCOA 3IGNA 5F8MA 3LTOA 2JHEA 3NY0A 3ZT1A 5C24A 3BQ1A 1W7WA 3OXGA 1ZM3A 1H72C 4X62F 5LXYA 3PV8A 3HULA 4EGLA 1Q18A 3FMBA 3H8WA 2CNNB 3BSAA 4KLOA 5HI7A 2PMZD 1JUDA 1OSCA 2VWKA 4IH7A 5EHHA 2OHFA 3CCUS 2IPOB 3BH6B 4TU9A 2HHVA 4A5BA 3LQVA 4KAIA 2CA9A 3W61A 1W26A 3FEYB 4PG8A 2HOIA 3GZ7A 3D6MB 1ZQNA 3OYGA 1CC7A 1CJKB 1RHUB 2VG6A 3BKTA 2AMCB 1WDDA 4U8YA 3KLEB 5DB8A 4P10A 1X0FA 3GFXA 5KG1A 2XY6A 3MMAB 3CCVS 3K2PA 3VMFB 4DL7A 2V4QA 2JEGA 2E8OA 4YOEA 3ZZTA 3HILA 7ICVA 2E7WA 3S01A 1TUGB 1ZQOA 3BKUA 4I2GA 3CYMA 1APSA 1RDRA 4ED1A 3HYFA 2DR8A 3TJ9A 4WFXA 3IR7B 6FD1A 1P90A 1L7PA 3V7JA 1WWVA 1RT6B 1D3WA 5CH7B 2HQFA 5AM3A 1LWCA 3WK8A 2H3QA 3O9TA 3ZX3A 3EYZA 3CCLN 4CJQA 4JKGA 5HN0A 4JI0F 4BRHA 2LU2A 2NZCA 2D9OA 1RT3A 1QZ6A 1XC3A 3CEDA 3PYGA 2C28A 2HYIB 3K9JA 5AI6A 2BQ3A 4YDUA 4JAXA 4US9A 4BC4A 2DL0A 4A8SA 1TL1A 2A2DA 2Y1JA 3I56S 4BC3A 2D41A 4U95A 3EKUA 3AJDA 1HQUA 1UP1A 3BEGB 5C42B 5EDWA 4CEOA 1RAOA 2B5JB 2ZJQL 3UN5A 4P2FA 4FLYA 2ZIXB 4RPXA 2QX0A 3ENQA 2WTUA 1Y7PA 4NL9A 1HKCA 1B7YB 1RBTA 3OTEA 4FZNA 1HL6A 3RRGA 2PEBA 1N5XA 2FHKA 3H0LB 1Q53A 2VG6B 3CCQN 4Q44A 3FZLA 2FJVA 1ZQHA 4EUVA 4M63A 3W63A 4CTAB 3NHGA 1TL7A 1XMBA 1N34F 3SQ4A 4ZN1A 4YHHJ 2YH0A 3HLUA 1C2PA 4NX9A 1BPDA 2ZGZA 4CZLA 2V7ZA 2OTLN 3MD3A 8ICGA 1N5VA 1ZS6A 4LH5A 2ZIVB 3OL9A 3W66A 2YKNA 5C15A 1H74A 4FWOA 1C7YA 4OLPA 3OV7A 2MJNA 3H5SA 4OZ5A 4USJC 3H25A 3OVBA 4JI0K 3R9KA 2HWTA 5JUMA 2AJ1A 2D0OA 1NWKA 2I9GA 2UV8A 1Y11A 1V6HA 2G4BA 3T19A 3KUHA 1KD1T 3SCLE 4IQWA 3MFIA 4GVLA 1FTCA 2E9TA 2JX2A 2WHOA 4URSA 5B0BA 4ZJLA 3CFOA 4M45A 1N6QA 1A0OB 2AX0A 4Q2LA 2OCEA 1C6VA 1X66A 3KLFA 1TL1B 3JPOA 3I96A 2D1KA 2DJWA 2HRTA 1Q86O 3VOVA 2HWIA 2CZVC 3ZXWA 1Y0HA 4CZJA 3U27A 3MR2A 4K4XA 3IRXA 1SC4B 4WP8A 4EO8A 4K0KF 1UVIA 1C1CA 1N33F 4YY3F 2LBOA 5I42A 3M2VA 1HUZA 5AXLA 3LP1A 2J6UA 3IO1A 3GMGA 4K7QA 3R8YA 1RISA 2QT7A 4CIFA 1YG0A 2A40A 4BRPA 4I7FB 1N34K 4JI4J 3E66A 2ZHAA 2KRBA 1LEOA 4PKHA 5G4DA 4NM2A 2LDIA 2A6OA 2XS2A 4C8ZA 4FFDA 4CLZA 5KPZA 1TL7B 3SDEB 3OXFA 4O8KA 3R1LA 2WF8A 2WSCC 1X0PA 2XHWA 3MXHP 2F1HA 4CF5A 4PJ0U 1FD2A 4F26A 4Y2TA 2L5YA 2A6MA 4ZTFA 4JEPA 3TABA 1OH7A 4NLSA 5GADP 4JMUA 2PFNA 3UXNA 4U6PA 2WB4A 3GOIA 4CHPA 5C0YA 3UD5A 2QLTA 3T41A 4BR7A 1TYQB 1NDCA 1NSPA 4ICAA 4HHUA 5AE1A 5HQLA 4CF4A 2EWHA 2M88A 5KAIU 5KL8B 3NRWA 2KZ3A 4CJ4A 5KFOA 3PG9A 4K0KK 1N33K 5IXUA 4YY3K 1OY6A 5L9XA 1NDPA 2H3EB 3WXJA 1W0HA 3KLFB 4DTOA 3F41A 2X6NA 4U96A 3GYGA 3JQJA 3ULHA 3V6DA 3O4NA 1HNZJ 4DG1A 2JLEA 1M6YA 2HBMA 4I6MB 1VQ9S 2JGAA 8ICYA 2XO6A 4NLBA 3KG4A 2YQ1A 2YNIA 4RW8A 4OYXA 4RWTA 1FNXH 4ZVEA 5AQWA 3VQPA 4CK1A 3LZIA 3WZ0A 5KFWA 2W55A 8ICZA 2Z56B 4LF8F 5KFRA 3TZXA 1F5BA 2AYBA 4ED4A 2J7KA 1SGGA 1Q5YA 3T3FA 1A77A 5E3QA 3C8YA 1YJUA 3V6HA 5AZIA 4JK9A 5GADI 3GCWP 4DTUA 2AJ4A 4ZPCA 5GMDA 2OKQA 1S7IA 1M0SA 4MIWA 2ZNZA 4QZGA 3MX2A 5AQYA 1RDWX 3PM9A 2LHTA 4TKTA 5A2QY 4I2JA 1CS4A 5JXSA 1PYOB 3DI6B 3MEGA 4C3KA 5GAHP 1NLKL 3FZ2A 3MGIA 2GS8A 3MD1A 2DNQA 4MKYA 7ICLA 2D4WA 1BCMA 2J5AA 1S1XA 1TKTB 3UWTA 5J29A 4RW4B 2G1DA 2ADCA 3E8OA 2HNDA 3W8GA 3V72A 2BRLA 1RZTA 1QVFM 2H3VA 3ULDA 1FXRA 4I56A 2WVDA 4ILLA 3BGOP 2D74B 1UA0A 4DN9A 2LA6A 3EXYA 5CYMB 2KHDA 4JI7J 4HCCA 1V97A 3OBIA 1QQ6A 1TK8A 1QH9A 1JJCB 3CJ2A 4RU2A 1VQNN 3GL1A 3TQEA 4MHVA 1ZQKA 3FZBA 4JI2J 3Q7BA 5BOMA 1VQLS 3EVMA 1U9LA 3OFFA 1WSVA 2OELA 4WTOB 2GV1A 4OJ3A 3EY1A 3OYJA 4DV1K 4H54A 4EFHA 2JVRA 1RAGB 4U7UK 1PK1B 1BL3A 2KZMA 1WEYA 1ZXIA 3PIPL 3VQDA 4TQSA 4K41A 3QSYB 5F8JA 2HK2A 1S1WA 5F1XA 3RJIA 1L7OA 3G8SA 2ZF5O 4IQTA 3FCVA 5KFZA 1Y9OA 3PHTA 2ZC3A 1NKBA 2VPYB 2V2KA 2FF6A 2ROGA 3I55S 3KK3A 3BO2A 4MLHA 2FVCA 3CD7A 1XERA 4AHVA 3AAPA 1CS4B 1U1LA 4KH0B 4O9MA 2FLOA 2UUAF 1VBKA 3ZZOA 1S1XB 2NRRA 2ZM6K 4DV0F 3THYA 3KD3A 2DTJA 1NM1A 3SV4A 2QRRA 1KWMA 3C14A 5CHGA 3AODA 4LH4A 1FJ7A 2IIRA 2QA4N 3B8HA 1N36K 2P35A 3AQFA 2ZZMA 1P8ZA 2V8GA 1X7VA 2BM1A 3CCEN 3F9KA 1VMBA 1SC3B 3GSIA 1X2IA 5AK4A 1RYSA 1SC6A 1JIHA 4KHRA 5E41A 5T7LA 3FZHA 3EPIA 4F36A 1VSMA 5ALKA 2I0XA 1Y88A 2E3TA 1H3DA 3H3NO 1RQNA 3RJGA 1BUPA 2O8CB 3IGVA 3UN3A 1LWXA 1VQ6N 2XY5A 4Z6DA 3CG7A 2M7SA 1IR0A 3AO2A 1FERA 1CUKA 3EE3A 2FVQA 3G82A 4UUWA 1PBUA 4CLLA 5K4LA 2K4IA 1RHKB 1VI7A 5AQTA 1I94K 2DFFA 3RSEB 3D54A 5DZ6A 3QFUA 2FBXA 2PFDA 4NY8A 3CC4N 5AKHA 4TURA 3FQLA 4M94A 4LF2A 2FSNA 3MZIA 1S5ZA 4DV0K 1M5HA 2DNYA 2UUCF 4BGBA 2BJEA 2W2OP 7ICSA 3LF0A 4C0HA 2UUTA 5KG4A 4FK2A 5BRHA 3LDPA 4FYDA 5JLHA 2WFAA 2KVQE 3W7BA 3MMVA 2M5YA 1JNZB 4X65F 3LPYA 1Q79A 1KVAA 3BGUA 5BYRA 3F56A 5HMMA 2FJEB 1VQOS 3EZ5A 2CQBA 1RABB 3DOKA 2FDRA 5HJYA 2V6AA 3KZXA 4BQZA 3GBTA 3D7EO 3WHIA 3HKZD 1LQ9A 1WORA 1RTIB 4Y28C 5T7LB 3U3GA 4YR0A 3N28A 1K44A 4DSLA 5KFXA 2X74A 4YMOA 4QJVA 9ICPA 2FC9A 1J2VA 4FPIA 1BPYA 4C1NK 2CPXA 3UMCA 2APOA 5A6PA 1HIWA 2UXCK 2IAJA 1PAUB 3CQYA 3H0RB 2XS5A 3EE9A 4O0JA 2F77X 5HVFA 4DR2F 1WBBA 1JJ4A 4PL1A 1ZQIA 4F04B 1ZQUA 4RL1A 3P83D 1FFGB 4FN5A 4OX7A 2YMPA 3MDFA 2HBQB 5CY4A 3B82A 2VD3A 3ZCMA 3H2LA 1NJYA 2G06A 4ZP9A 3AVLA 5LJ5Y 2E5GA 1QUVA 5EXWA 1D8ZA 1R6YA 1Z1VA 4R25A 3D2NA 4MFAA 1VIXA 1B4FA 2NUUG 2YNFB 4IG3A 2EQYA 4X65K 5B0CA 4E98A 3TSQA 2DGOA 4BCAA 4BRQA 4DDFA 3FZFA 3IS9B 1FXDA 3KWIA 4IFYA 1TFRA 1VC0A 2O66A 3TADC 5AQQA 1J54A 1CVJA 3LP3A 4H4KC 5GAEI 4KX3A 4CJTA 3DOKB 1X5OA 4KLMA 2HS4A 3THXB 4C0OC 3RJFA 2ACYA 1SV0A 3C2PA 4A62A 1IKVA 2Y1LB 3GDXA 3H6EA 3P3DA 2PFQA 2JRSA 1YJVA 3LPUA 4R66A 5BN8A 3F2BA 2UP1A 5ETNA 4DR2K 1SAZA 4WFBL 1AYEA 5LOQA 3M8YA 4CD3A 1I39A 1LXJA 2IAJB 1VS3A 2P1JA 1K6YA 1YVNA 1NK7A 1XSNA 1B0PA 2CRLA 3ET6A 2WOMA 2Y1IA 5DETA 1V4TA 1HBUB 1Z2ZA 1DJ0A 2AA4A 2K8BB 3HP9A 3TJ8A 1TGOA 2DT9A 3QNNA 1FDNA 2YWEA 4L6V3 3KDNA 4ZOHC 3CT9A 3QRRA 4KV8B 1Y3JA 3BDEA 3HFZB 9ICEA 1QQ7A 3FMWA 2MLXA 1NGIA 3CJ7A 3OHAA 3D4JA 3DLRA 4BWMA 1D0EA 2HQCA 2W11A 3AOAA 1BGXT 2ZJ8A 5GMEA 2MY8A 3N5BA 4M3RA 3EEQA 5J2QA 1K5OA 1SWVA 5KFYA 4IFYB 2FY8A 4U67Q 3JYTB 1RA7A 3ONQA 2BW7A 4FJ9A 1S6OA 3M32A 1ZPVA 4DCCA 2KNJA 3PRDA 3SCIE 3B6OA 4JD2A 3NVWA 2E5HA 3DCAA 3LP0A 4LFAK 1U4BA 4LVNP 4LJXA 4LQ3A 5F0UA 1HHQA 4UY85 1DXSA 3CJBA 4PKIA 2DNNA 1KQFB 5KGXA 5H1SQ 3TFRA 4PGQA 1UPMB 3AJ1A 4ELUA 3ZDBA 1NH7A 1V9OA 2ZBQA 5ALJA 1J5OA 2XZDB 3JS9A 1RLDA 4Q8FA 3R5CA 4BJQA 4RT2A 1KRPA 3M8PA 4FJNA 1DBDA 1ATNA 2ZH2A 4ED2A 4EP5A 1M1KT 4BRIA 4J2DA 1GLAG 5KT4A 4QIGA 2DBYA 1UHUA 4B3OB 1VSIA 5J2MA 2J6SA 2BE2B 2WOMB 4X4VA 2F4VJ 4RNOA 2BGWA 4RQ3A 1YBAA 1WG1A 2K3IA 2H4YB 4A4JA 1BQNB 3I87A 1QQ5A 3CD6S 3OYDA 5M1KA 1F6TA 2J9EA 5DMRA 1BNPA 2XNQA 2XI3A 3DGPA 3LAMA 2PZSA 3WC2A 4DUTA 2M8HA 5G0RB 2R7UA 1GXUA 5EE0A 3GJSB 5CCMA 3EKSA 5KQ8A 2WBRA 3P38A 1F1BB 3DDIA 1BWEA 4C3MA 2JV3A 4B9UA 4QU7A 1VSEA 2QKBA 2QB0A 4GLXA 3AD9C 1X4CA 2I38A 5C5JA 2N4DA 4I1TA 3A12A 4ECSA 4ZVQB 3H1VX 1UFWA 4AYBD 4KHPF 3LP0B 5GAEU 3ZZ0A 2OH2A 2HFSA 3HOTA 2K8GA 3VEWA 2W9BA 2WF7A 3DXKA 4RPFA 4MAKA 3R9LA 4FPBA 9ICVA 1R0CB 2FDNA 2ZOFA 3IV6A 3O9RA 3OT9A 4XK8C 1HJPA 3RJEA 5B0AA 2D0CA 3GIIA 1KEJA 2I6WA 4ZP8A 2MQNA 3M8PB 3C15A 4CLPA 2D3ZA 3IM8A 1YWXA 1V38A 4B3SJ 3ZTOA 2KHCA 4C8MA 5IFMA 5J2MB 1VBXA 5KQDA 2KKZA 5CYQA 2NRZA 2QWLA 1VQ7N 4WFBQ 1IBKF 4M47A 3M9MB 1HR0F 3K75D 4ENOA 1VSHA 3KIOA 4CZCA 2KSOA 2QV6A 4AH9A 2BJ1A 1DK3A 5H1SV 3IG5A 1MSWD 2DNMA 5HMWA 5ALYA 3HHLA 4KN7A 3V6JA 5J0OA 1RTHB 2ZIWA 4ECYA 4DR6J 2C2KB 4HTIA 2DXDA 4A8QA 4WPAA 1U2VA 4KHPK 1VHFA 1ZQEA 4B6JA 4DR4J 3HM8A 3NLCA 3C2MA 3KLIA 4M3ZA 2BEFA 2QB0B 4OPHA 4TY9A 4RU9A 3KNAA 2CZ9A 3D45A 2NXEA 4QYZK 2VONA 4PKGA 2AIRB 4CGIA 1KFTA 3FGUA 4KO0A 2FE9A 3PX6A 5L1MA 1NGAA 1JXLA 3DXKB 2GMHA 2RIJA 3CCZA 1GFWB 2E5LF 1KTQA 2MGZA 3IP0A 3L3FX 4EYIB 2JWNA 5M2PA 1OVYA 3AAQA 4OKJA 3HZEA 5DLGA 5J2IA 1NK8A 4GKJF 2QKQA 3QYYA 3IBFB 1PCAA 2AZ3A 3N6LA 1HR0K 5LMUF 3CJTA 4C11B 4M3UA 2ALYB 4NMLA 4DV3F 4K4WA 3G6XA 4ZVPB 2R7VA 4TNOA 1YHQS 2DWQA 4H4KA 1RFQA 2KSOB 2J0WA 3N4MB 4WFZA 2NYIA 1TU0B 2VQEF 3JPSA 1QCKA 4BVPA 4LFCF 4J9OA 4I6WA 4B3TK 3I6PA 1Q46A 2LP4A 4P52A 1ZQGA 3HX9A 4UAVA 1T9WA 1YLXA 1YDLA 1XNRJ 1HBNA 2V34A 3HHLB 4ECVA 3N7SC 1BPBA 4IO9Q 5EOYA 3O3GA 3DDHA 2AGOA 1BVSA 3WKCA 1SJ3P 1S9GB 1TZ0A 1RT1A 1ZJMA 4XAKA 3KK1A 3Q23A 1L5UA 3ISDA 1LAWA 2DHSA 3SBMA 2VFTA 1ACMB 3GWCA 2MZJA 4PL8A 1Z26A 2E5LK 8ICIA 4JV2A 4KO0B 3FFKB 3OA9A 2PI4A 4GKJK 5CWRA 4K8RA 1VRUB 4W5NA 1GOBA 3OBYA 4I6AA 5D4LA 5A8KB 4OLBA 3HVTA 3DHWC 3SFGA 2D8CA 4WBFA 1XO1A 2HQ3A 4KQZA 5T7BA 4WQ5C 1HHTP 4O8UA 5LMNF 4FJKA 2KKPA 1R3NA 4BDZA 2UUBK 2GO9A 4KHUA 1ZRNA 4IJAA 8ICRA 3PKYA 1RXWA 2MTLA 4CESA 4IOCL 1DQAA 4FZMA 1LWFB 8ICFA 1CG2A 2BOPA 1TKZA 1CQNA 2KJWA 1PAEX 2KK0A 5HHHA 2V4JA 5AFUA 4P2HA 3WU2U 2FC0A 1ZOLA 2NRWA 2BKOA 3KOAA 2W3SA 2DNHA 1R43A 3R5BA 3WDOA 2QFIA 1KAYA 2JLFA 3CCWA 2Q79A 3MM5B 2R8HA 2N3LA 1LFWA 4FDFA 4P7TA 2I7NA 4Z4IA 4LT6A 2O1PA 2QZ8A 3FFIA 2G8VA 3CMES 5KPRA 4JKCA 4PGXA 1HNVB 4KJIA 4QIFA 2PFPA 2VUGA 4DV7J 4OX6A 2FGOA 4EZ6A 5LMNK 2XMVA 4EX6A 2F8HA 1CJTA 3TFSA 3OYAA 1VQSA 2XLIA 3SQOP 4RQ5A 3AN1A 1SCJB 3ZSZA 5DM6L 4J9KA 2FTRA 3QT7A 4PUOB 3C2LA 3JXOA 4CBXA 3HMJG 2GFFA 1EX4A 4J9MA 4OHYA 4RNNA 5M1FA 4E89A 4DTPA 1K8AT 2HOEA 4BR2A 5KFBA 1LKYA 4CIGA 1NMDA 1RB0A 2Q3SA 4IFEA 2DK2A 2NLWA 4NE9C 1XMQJ 3G6EN 2NNWA 4EP4A 1N63A 1JLCA 4WIQA 2GVDA 2W24A 5CHIA 2V4JB 3KFWX 3MM6A 4RUHA 4UQGA 2NRXA 5LSOA 1BQMA 3U9DA 3CFRA 1FFSB 4KGZB 2Z2ZA 2KVCA 1ZQQA 2F3NA 1TVAA 2B0CA 4DV2J 2HBKA 5E33A 2JZ5A 3SMZA 2XIDA 3POTB 1N32J 5AQRA 3MOJB 3JAMY 4DL4A 1S10A 3ZDAA 3DDNA 3SPYA 3FFIB 1CLFA 1ZETA 3C6HA 5KFUA 2IMOA 4TU8A 1RG6A 9ICMA 4K5SA 2OFHX 2FBVA 3R7SB 1ZZNA 5J2FA 1HNXF 1RM6C 1QAXA 4DUYK 4DWIA 3H4BA 4LIWA 1RTJA 5AFUH 4ANDA 2HS3A 3ZNJ1 7ICKA 1RE1B 2KM8C 1CJTB 1ESVA 5AI9A 4ED3A 5IT9O 2HBYB 4GV9A 1UCVA 3UO0A 2I8EA 4F5NA 4LF5F 2JZBA 4FW2A 5J0QA 3O9UA 5HLFA 1HKAA 3D0PA 2E5JA 1WKKA 3M8RA 2CQ4A 2DH8A 3CDBA 2BR0A 3DM2B 4NI2A 1BHLA 4Q8EA 3MMCA 1VLYA 1KVBA 4DQQA 4P6QA 2AYEA 3FRZA 5AQJA 2KE7A 2EAOA 4ZS6A 4K5RA 4CZKA 1FKPA 4NLGA 3R1XA 4LQ9A 4YB7A 2LXFA 2HIQA 3DNCA 3W5ZA 1Q9XA 4HLBA 1FEZA 4DCPB 2XY8A 5KFPA 2P6SA 3AT1B 2FBYA 2V8VA 4Z6CA 3F9MA 1F0XA 4UOFA 1Q78A 4TUQA 1RT7A 3B8AX 2OAUA 2DIVA 1NNLA 2GQ2A 3I31A 2DCUB 2DY4A 4MYUA 4NYOA 4GY2B 3L2RA 2KFNA 1YJWN 5JS1A 4Y2VA 2JH1A 1HNXK 1FX4A 3WKAA 1Q4RA 1WUUA 2R2SA 2Q1NA 1FTRA 2DBBA 5KFQA 1ZQJA 3M6GA 1FXLA 5AJ3F 3M9OB 4DL6A 4LC9B 2HHTA 3QEVA 2BANB 3U6FA 2ZWPA 1XQSC 1IR1A 3MOZA 4NLNA 4NXNK 5AI0A 4BRDA 2DCLA 3ZD8A 1S76D 4QIVA 5I3PA 2QARA 1HJOA 5KOXA 2GLEA 1A9NB 2WCXA 4PR6A 2F9JA 3FC9A 5IM0B 2DYAA 3DOMB 3TEGA 4FO0A 2CJAA 2JL9A 3CFPA 5HLFB 4DB3A 3C16A 2OSQA 3HJFA 1IG9A 2KVIA 2Q6CA 3H5YA 4RW9B 4NI2B 2HHHF 1FJGJ 2BDPA 3F5AA 4J8FA 3SSRA 1VQPN 5AM0A 3N97B 1FKPB 3LP2A 3OUYA 2IJRA 4NO7A 1K8AO 3FC4A 5J2NA 3FRYA 4FF2A 3VAFA 4FCYA 3DWLA 5AM1A 4DV4J 4M5KA 2D6FC 3JSMA 1O8BA 3SAHA 4GVBA 2RS8A 2WBNA 5ALNA 3P5JA 5AK6A 2EH9A 4OD0A 4LUBA 3A3PB 2DEIA 2A3ZA 4CJ5A 5AJ3K 4DPWA 1B0VA 4F3MA 3QX7A 1RAEB 1FXXA 4YDDB 5AQPA 3THVA 3MWPA 4JRQA 3VGLA 4Y2XA 2KXHA 4QU6A 2KHVA 1QHAA 5KRTA 1ZQDA 4NWBA 3EJMA 1VLOA 3TUPA 2HFUA 3TP2A 4O4GA 3DMJB 3QBXA 3BM7A 3M6WA 3S8SA 3F44A 5HOOA 1T03A 1FA0A 2GO7A 5J2KA 4YUDA 2O5DA 3CCTA 4NL5A 1C1BB 9ICTA 1KQKA 3BZCA 5HAOA 3UNYA 1KVKA 3D67A 3M2UB 1KL9A 1NGCA 4E8UA 3B6BA 1UTAA 5DQGA 1ZD3A 2RHKA 4OJLA 3HX0A 3R8EA 1MWQA 1HYZA 3OR2B 4YOWA 2K7KA 1OIAA 3T6JA 4Z7YA 1SI9A 4KLQA 4XRHA 3ISNC 4E3SA 1SQFA 4Y0FA 2AJFE 3AJ2A 1BPEA 2JNJA 3BR9A 5J2NB 1KP6A 5BYSA 3RB3A 1VQYA 7ICFA 1GNKA 1NGDA 2V9KA 3EZWA 5HL7L 3CVKA 4X62J 3JSMB 4CHNA 2CYYA 1GLEG 3M8WA 4HVJA 1SC1B 5IIIA 2PAVA 3SK3A 3P45B 2R9LA 3B0XA 4RNFA 2L3MA 2DO4A 4I2IA 2H3ZA 3KKAA 5HMYA 3NGZA 3WEEA 3O1WA 4C8LA 7ICIA 1UA1A 2B8PA 4J9NA 2MUTA 3SSQA 3MWTA 2VIHA 3CF5L 5DB7A 1SVDA 2XQCA 4IQVA 1GLLO 4PHDA 3W1YC 4MK8A 3GU0A 1NBEB 4FJGA 1H1VA 4F0MA 2CVIA 3TZWA 3AY0A 3ZETB 2R7OA 4DJBA 1FE4A 1SUQA 1PO6A 3MMBB 1ZOTA 1NK0A 4PHTX 2FMSA 4AXJA 1RBSA 2FC8A 1ICEB 1F21A 3CIPA 5LSLA 3VQ5A 4FPRA 5AKJA 4H5RA 3ZX2A 4ZN3A 1JCGA 4AHTA 2GH1A 4NZ0A 4YN3B 4OZ1A 3C94A 2HPUA 3GYNA 2FXUA 4X64F 2PY5A 2K1RB 1U48A 2EK1A 2KFYA 4HTLA 1BDGA 2I7PA 3H2UB 1N54B 3SJHA 5D4OA 3KJQB 3RVCA 4DCHA 3DXMA 3Q8MA 2BM0A 3J7A1 2QLWA 4ZA1A 3MN6A 1VQ5S 5CA7A 1AXQA 4NA1A 3ZEUA 1YI2N 2C2RA 2C1EB 4JI0J 1LOTB 1SKSA 4Y3CA 4FWNA 3AO5A 4FXWA 4K4GA 1C0TA 4MK7A 4B9SA 4A47A 3CIMA 4WKYA 3TWZA 1VBYA 3IG1B 4BG9A 4DQIA 3G4SS 1F2HA 3LGNA 8ATCB 3WK6A 5HANA 4AHUA 3IR6B 5FLXO 2CUYA 4MF8A 1S4FA 4FKXA 4DL2A 2OPQB 3VPZA 2AJQA 4FBUA 2RKIB 1P8GA 1BWVA 2K89A 1YAGA 2B0GA 3KBBA 1YJ9N 7ICUA 2XO7A 4RZRA 4H0TB 2FPMA 2PXIA 3LPEA 3QGIA 1ZTTA 5DB9A 2R2UA 5DGBA 4NCGA 4BDPA 3O80A 2LM1A 4KH4A 4DOAA 1S1TB 1SUQB 4KLLA 1T9UA 3NVVA 1GH8A 5K8PA 3QJPA 4ZCLA 4CRJA 2DNZA 4DXLA 4K43A 2C3MA 1N34J 2JEIA 3QUBA 1AUDA 3CDWA 3LO3A 1C20A 1GOAA 3JPPA 4DQPA 1HBMA 2WBMA 5AE3A 4X64K 1P9QC 3RB4A 5A8RA 2IVFB 4I2FA 2M0NA 4ZK7M 2P5GA 3LALA 2XICA 4EYHB 2HAIA 1X31C 3PR5B 3WK5A 2MZRA 3IRUA 3K89A 1M5VC 2C2EA 2C2DA 2B6GA 1OJ4A 4M04A 4K42A 1NU0A 1Y5LB 3PR4A 4QWDA 3Q8KA 4EWTA 2HDOA 3RMAA 3WC0A 4RG8A 1S77D 3N4QA 1SJRA 3DXMB 2WW8A 8ICBA 3A1YG 3D1HA 1MQ2A 2QYGA 4CGHA 3V7LA 3UE5A 3T79A 4BC9A 1QUPA 4H4MB 1HNZK 1SQEA 4BXOA 3MUMP 3QEIA 1T05B 4M5DA 3MPWA 5EWEA 2WHEA 4C0BA 5HL7Q 4PWDA 2CPRA 1SXEA 2GQCA 3CDEA 3SMVA 1Y64A 4CIOA 4Z4GA 3A5MC 4K0KJ 5ALSA 1N33J 4YY3J 1YBUA 1GTEA 4X4PA 4IYQA 1IQZA 3VQCA 3V5RA 3CETA 3CC7S 4C7ZA 1EKRA 4X4QA 3D0GE 2XC9A 1PKUA 4NCGB 1SKWA 4O44A 2FVPA 3PW4A 4FZVA 2EFGA 4QWBA 2Z1JA 1NRKA 4KR0B 3A3NB 2DGSA 4NLKA 2F2AB 2RSQA 1GK8A 1KR4A 4JYAF 1HBMB 2V4RA 2P9GA 4M5MA 4IFVB 1YF5L 5B5EU 4G65A 5J8YA 3N4WA 1U2RA 4Q0BA 2QFJA 4C8NA 2HMIA 4USAA 4G3IA 4QCLA 3O44A 1M5PC 5EU7A 3VF6A 3K58A 3JAMU 3NWRA 2W2NP 4UF4A 2RQ5A 2ZH4A 3O9SA 5IQ6A 2OEKA 1BA0A 3UB5A 3RR7A 4EFAC 5KAFU 4DLEA 4FS2A 2G2ZA 3W5YA 4WFAL 3D6RA 3PMLA 3GYXB 3BSOA 2VF3A 6AT1B 1F9HA 1VQMN 3IBPA 3F5TA 3LW5C 3F73A 5IV3A 5IV4A 4KI6A 4PWDB 2VWJA 1YITN 3JQKA 4MKAA 1DY3A 3VEXA 5H2FU 2ZFHA 4ILMA 1KC8T 3FAHA 4CJLA 3PJ9A 2VWBA 1Y10A 3MM7B 3ID6A 4I64A 3VENA 2CQ0A 3UMGA 4N56A 1QE1B 1R0BG 2G8WA 2HF3A 4H0PA 4JI8F 3MPDA 4JYAK 3FSYA 2KL8A 1UVJA 2IVNA 3L7OA 2XZTB 4LF8J 2HHPA 2LYAA 1KFSA 4OMFG 3W2WB 1HUXA 4H4OB 1T6CA 3KWMA 1UAWA 3GQCA 2QWPA 4CF0A 4BR0A 2BJDA 1BXNA 4ECUA 2E8MA 5L8RC 1WOOA 1NK9A 5HROB 3OTQA 4HTJA 1FE0A 2NRVA 3OS1A 1HX1A 4HI2A 1Z25A 3ED5A 4M9JA 1D9DA 1VQKS 4NLQA 2WRMA 5L38A 3FK4A 4ISFA 1ZQBA 1PJ5A 2GHPA 3GPAA 5J0XA 4Y2UA 1AA1B 2DFEA 4DV6F 2WB1F 1URNA 3UI3A 4P4PA 1RWVB 3P4UB 1KQSR 5KFMA 5IS2A 1VISA 2BMBA 4K4HA 3B4MA 4P9SA 1TV9A 2HB5A 4E7HA 2LMRA 2B4PA 5JU5A 1RACB 1MC8A 2ERRA 3MPVA 4KITB 4PH5A 1VQ4N 5EN1A 2V0NA 4R65A 2DR5A 4J2BA 5E79U 3O8WA 2JEJA 1RAIB 4WF9Q 4IKFA 3IHQB 1WHYA 4B1YB 1UWAA 2QEXS 1NB2A 4JI8K 3MAHA 4YOUA 2DNPA 2H51B 1FW6A 3U7JA 9ICLA 2OIHA 2AGPA 1M90T 5IT9U 4CHOA 1LFPA 1CZ9A 2LCWA 1WTBA 1RAFB 3D2FA 3FBFA 1ZBHA 2HFNA 1R31A 1XS9D 4XQ8A 4UQTA 2HHUA 1RJJA 1ZQXA 5AQNA 2CAJA 4MIBA 3FBBA 4OYAA 1N61A 3MX5A 1A76A 3HKWA 2OTJN 1JLGA 4ECWA 1YJTA 4DL5A 2GW8A 3MF5A 2PD1A 1BOTO 3AO4A 4KE5A 1UETA 2U2FA 4JBCA 1GLJO 4JHDB 1Y5IB 1O08A 3FQKA 3QGHA 1RWNB 5AQFA 3JPRA 2RE2A 3E9OA 1KTVA 1Z4OA 1JRPA 4CLFA 2Q0UA 4HH0A 2JVOA 3QT6A 3WNFA 3C23A 3TAPA 2VFVA 4NASA 2GBZA 2F1FA 2VBXA 3SLCA 1SWWA 2CQCA 1TL4A 4C2MA 2VZ9A 3R6LB 2UUAJ 3TVYA 4G1IA 4E7LA 2X7IA 4I29A 3HHLD 4DV0J 3CJ8A 3SCJE 3Q8QB 5J0UA 1RWPB 3LDNA 3NAEA 4ZKAA 2H9ZA 2ZTCA 4RBUA 2WUSA 2P5VA 4M9HA 4NYNA 3MTKA 3E58A 2XMAA 1MG7A 4CT8A 4DSFA 2G0JA 4CO0A 1Z05A 4G1PA 4KLIA 3TPQA 5J2AA 1L3VA 5AQLA 1FRKA 1LKZA 2C2ZB 3H5UA 1ZM2A 3I0RA 3D2FB 3HT0A 2VQFF 1E6VA 2MY7A 2NQPA 1NMNA 5KT7A 4NPOA 2HQIA 4Z37A 1PYSB 4ELTA 1S5LU 2IM2A 1IUJA 3L8BA 1B7FA 3BO4A 4DX8H 5A0YB 5CABA 4QJFB 3C19A 4NA2A 3LYSA 1WC6A 1LW2A 2RAQA 2FMPA 3HM9A 5JVGL 2MJUA 2C3YA 2F9DA 3W8PA 2GZOA 4USVA 2YTUA 3H4DA 2KG0A 3AA2A 2UUCJ 1A5XA 2BRKA 2MQLA 4Y0WA 1T3QA 4I2PA 3GSDA 1UT8A 4KT0C 3QJLA 1ITGA 3LM2A 1ATRA 3FEXB 2NXCA 2ZJRQ 3KLGB 2XHCA 4DPXA 3G71N 4M5HA 4QR0A 2Z7JA 4X65J 2KD1A 1MN9A 4E7KA 3P8BB 4XEIA 3LAKA 4WP9A 1WC5A 3PTWA 4K2XA 1V9PA 1RK8A 4OGCA 2B7CB 2PMWA 5HBMB 1Q8LA 1YJNS 4RQ4A 1RADB 2HHSA 2VQFK 3ISBA 1NJXA 3Q8UA 1BISA 2XWYA 5BPLA 1QSLA 5FROA 3V4MA 4ZPDA 2PT0A 2EC0A 4DKWA 4I67A 5F8LA 3E3XA 2AV5A 1MMNA 5B8HA 4QWEA 1M90O 2F7TA 5LJVA 8ICSA 4UB3A 1RT5A 3K5PA 4L74A 1HKBA 5AQUA 3D6TB 2ZZNA 4JV5F 4A2BA 3UDLA 3LWMA 1WC3A 4DR2J 1EZZB 2RE1A 2AJ0A 2GJFA 7FD1A 3HSGA 1S6PA 2MKKA 1LW2B 4K50A 1ZD4A 1ZPWX 2R8JA 1Z1ZA 3UR0A 1NSKL 2BUNA 4AP9A 4EEKA 1N4LA 1LWEB 5J2PB 3MBYA 3BGRA 3H0MB 3BZQA 4KB1A 4FZLA 1FKOB 2YB4A 1QVGR 2Q1LA 3A8IA 3BV8A 2K4EA 3VQTA 1C0GA 1KQQA 2VPWB 2ZD1A 2GIQA 4DOBA 1OO0B 4YG2A 3QPIA 4CE9A 2MKIA 4AFFA 3KJVA 1YGYA 2G1HA 2F8TA 2K06A 2IOCA 3AB2B 3NUQA 2BYCA 3VAGA 4WWSA 5K8OA 2VYPA 4DU3A 2Q31A 3DDKA 1GAOA 1JWWA 2Q97A 4E19A 3MEDA 3UPFA 2FZCB 3VERA 9ICGA 1HMVA 2KXFA 1B9FA 3NDKA 2BV3A 2ZDOA 1S79A 3T1YF 4JV5K 3NNCA 2I2YA 1RBVA 3MMJA 3C7NA 4B8CA 1ZQFA 1K73T 1TP7A 2BJ7A 1SH0A 4DR7F 2G8KA 1QTNB 1RT5B 1G4CA 1NK6A 4WTYA 4BRGA 4LVOP 4LFBF 1W2BR 4A57A 2ZH9A 4RX6A 4CIEA 5KL1B 4AILC 4RBVA 2A1JA 3NGIA 5FIIA 3ZNUA 1L7NA 3FZMA 1HD1A 5DM7L 1SPBP 5HRNA 1KAXA 3DAWA 1FD8A 1NPRA 5D0EA 4UBCA 1E6YA 3LPTA 2Q0ZX 4ZLNA 3NH0A 4ZVGA 1XMOF 4EENA 4DX6A 4JN4A 2LEPA 4KPCA 2GWSA 5AHXA 5JVGQ 1JLEA 4B02A 1YKWA 2Y0BB 2ZD1B 5L1KA 2ZUCA 1E4FT 3BF1A 2ASLA 4BE0A 4OV1A 1OPZA 2RH3A 1PVRA 2E4LA 1OH5A 2KVSA 5AKLA 3I33A 4YMMA 1UVKA 3ZSOA 1Q3VA 4CW7B 4ELVA 3NE6A 3H98A 1ZH5A 3HDSA 2EG2A 2ZIUA 4M2YA 3E0FA 2AXTU 2VV5A 4DTNA 4R5PA 5J2GA 1UOCA 3QT5A 4R0JA 9ICWA 2CPZA 4O23A 2E2PA 1XSPA 2J7WA 1KW4A 4DR7K 2ZH3A 1FK9A 1HMVB 2OPRB 1Y00A 4N8OA 1VQ8S 4C4TA 3H45C 1JLBA 2DHHA 1U6BA 4M6WA 1MROA 2BKNA 4YB5A 3I9ZA 5GAGI 4IQMA 4M1KA 1JROA 5DDYA 3Q89A 1KQSM 2CQ2A 3CQ8A 3FR0A 1VLBA 3VZIA 3TX0A 2NLXA 2IRUA 1DTTB 5ETMA 3BGFA 3BBCA 2RDJA 2AD9A 1YVUA 3NMAA 5ALUA 3CJ1A 3WXKA 4Z4HA 1ROFA 3D2EA 2CNLB 3QRQA 3K9KA 2BJ9A 4NXMF 3R5AA 1RZMA 5HP1A 3KYLA 3HI0A 3IM1A 1V5VA 3DRYA 2C2MB 3ILOA 4DR6K 4ES2A 1E6YB 3N7RC 2Q43A 2QJ3A 5C25A 3K5OA 2GMJA 1UT5A 1PC5A 1NGJA 1NBWA 4DR4K 4YCXA 4M0AA 3HZ6A 1RTDA 3O8MA 3J81O 3CDUA 1GLCG 3DLGA 3TA0A 4E7IA 3KD5E 5C2DA 3EWAA 4ZVHA 1UJ5A 4UAWA 3B78A 2YVSA 3LL3A 4QIWC 1SXLA 1BU6O 3V81B 4DL3A 1TV6A 1R0AA 1FKAF 1RU2A 2CPEA 2BABA 2WONB 2BCQA 1NPKA 5J2JA 4QPXA 2JC0A 4KHPJ 4EZ9A 1XR6A 5JMVA 1X4BA 2DY9A 2OGUA 3SBGA 1P7DA 4QZAA 1N48A 3CWJA 3K7RA 3RBZA 5D4NA 1EETA 3VALA 4RUAA 4ZCIA 2JR5A 4PA1A 1FK9B 4ISEA 2ZKTA 2E20A 4CCHA 1RP5A 4FWPA 3E01B 4M6WB 1MROB 1YUWA 3ZTQA 2BACA 1IIPA 1XNQF 3SD7A 2PDAA 3RMBA 2CNOB 4WYWA 4OI2A 4HH1A 2BZ2A 1ASUA 3OHBA 4UATA 2VICA 1EO1A 1SB3C 5ADXA 1IBKJ 4U7CA 1CI4A 4QWAA 1HR0J 3D2EB 9ICIA 1D8BA 2CQGA 3SENA 5KFIA 1UWBB 2KYZA 2W7AA 1SZ2A 5J0TA 3M1VA 2MQ8A 1OXJA 5HP1B 3SQIA 3D6FB 1RBLA 3R2CJ 4X4RA 4W90B 2E1PA 2KYXA 5C25B 3GIMA 4FNHA 3HTVA 4KMOB 2G8UA 4E1NA 1RTDB 3IFRA 2KFZA 4UW9A 5DM7Q 2P8IA 2QLBB 3WXMB 1SH2A 1FJCA 2RRDA 1PVQA 2OEHA 2VL1A 4IOAQ 4RPYA 5U47A 4EIAA 2J9DE 2XY7A 4FJJA 1TV6B 2HK3A 3AMZA 4OO1J 3I0SB 4PEOA 4IJNA 2HHXA 2QXFA 1SV4A 1TQLA 3VGSA 4WK1A 5ALVA 2C3UA 1PG5B 3Q8RB 2QXLA 1H98A 5DBCA 3L5KA 2HCFA 2L9WA 1ATSA 2E5LJ 4OJHA 2KT2A 4J9RA 4KBOA 3L2VA 3CI5A 3O6QA 4YVZA 4W98A 4B3RF 4GKJJ 2CPYA 5EWFA 3MABA 2ZG6A 5GAGU 2E6MA 4CJKA 1U49A 1X6JA 3DLHA 3ZI4A 3MDCA 2MKJA 5LMUJ 1PBAA 1AZSA 3OSPA 3W3SA 1U1KA 3MWBA 4DV3J 5C7PA 3QAEA 3FM9A 2QMUB 2E5SA 3CCJS 1JXVA 4CO2A 3HP6A 2VJUA 8ICMA 3EICA 2VQEJ 1CULB 2G5HB 4LFCJ 5AZJB 1X4GA 5K20B 1DKGD 4UB4A 1ZQYA 4NLXA 3PIOQ 2KHQA 1RT2A 4F7VA 2DUYA 1T3VA 1Z4NA 1Y3KA 1XIQA 4C0ZA 3UQ2A 4M95A 2BH1A 3BBBA 5H9EK 9ICSA 2DTUA 1T3NA 4JLHA 4HT5A 4CEBA 3L95X 4F4XA 3VWSA 8ICAA 2ZJPL 2DKOB 2KOBA 4WYBA 2YCHA 2RNEA 3D0HE 3C2KA 1DRZA 1OY9A 3J8AA 4M9NA 4BWJA 4H5NA 1HA1A 4X84A 1BC6A 5ADZA 4ZH4A 4O3QA 2RDIA 4FP9A 2B4OA 2DPJA 1U1NA 2FJ6A 2XMJA 3PRBA 2DR7A 4F9OA 2IVPA 4B1UB 2E1FA 5FPMA 3BS9A 3K0SA 3Q86A 1XU4A 4USUA 1QVGM 3K8WA 1WSRA 4CLUA 3C66A 1GT8A 2B9EA 1S9EA 3AFGA 1S6QA 3QMQA 2R7QA 5ALRA 2I5JA 2NSBA 5LMNJ 3DHXA 4C8KA 4MMOA 2B21A 1Q16B 1VJWA 3UM9A 2OPPA 4TQRA 3MM8A 3WIUA 4CH7A 1YBTA 4O5FA 1KNZA 4FK0A 3DN9A 2W7PA 1RWUA 2JFDA 2WVEA 3PX0A 3QUTA 2RB7A 4XH1A 3C6UA 2UU9F 2VG5A 3NGDA 4JS5A 8ICUA 3VGUA 3ETOA 3CPEA 3PW5A 1SV5A 2ZJ5A 1DTQA 1I1GA 2EKNA 5E2QA 4ILHA 1I6JA 3GG4A 1WEZA 3NCPA 1N32K 1RA6A 3GIRA 3ENOA 2GHWA 2F65A 2YX4A 3V4IA 4RWXA 3BS5B 4LF9F 3MGJA 1WEXA 3HT3A 4OPJA 3CJ9A 1SJQA 3HVWA 1O1WA 3K59A 3TOQA 1RUSA 2LEBA 2O8DA 1W2BM 1EQYA 2KH9A 4B17A 1HW9A 4JI4F 3PO4A 2AX1A 4DSEA 2IVOA 1RHQB 2HKEA 2P9NB 2YB1A 4DTXA 3UCGA 1LK7A 4FF1A 3UE2A 3N5FA 1CJUB 2DR9A 2LKYA 3M2RA 1UJ6A 4CK3A 3KZIU 3V1RA 4CBUA 3VEVA 3ZC4A 5ALMA 5KG7A 4BRMA 1CEZA 1YIJS 3QEPA 4TY8A 1X3NA 4RW7B 1WC1A 1VSLA 3DRXA 3EE8A 4CJFA 2OP5A 1IQTA 2WVCA 4ZIWA 4BR9A 8ICTA 5ALTA 2UU9K 3UDCA 4JOUA 5DG9A 3HVRA 2HURA 2WSEC 2ZH5A 3W0LA 1VOMA 1U6ZA 2FGCA 4PWUA 2XBPA 2G8IA 3C28A 3WQPA 3QYPA 1SJFA 2XHBA 4XH4A 1KDNA 2RILA 3U3YA 4KLSA 4CO5A 5KFGA 4M41A 2MQQA 3WXLA 3SQ0A 3FKBA 1SV5B 2QL9B 5IIMA 5AKXA 1UPPA 4OI6A 1X4DA 1IKXB 1T3OA 4JP8A 2A1SA 2QC3A 3OBWA 4N8NA 4NLUA 4MO5A 4NLOA 3V4IB 4BC7A 8ICXA 4LVSA 9ICBA 3M4XA 4PQUB 1YVFA 1NJZA 1KOHA 4LSNA 3CXCM 3AVAA 3J80Y 3M8QA 3RH5A 2GCFA 5HSPA 4P0QA 2WTFA 2NXJA 1EB0A 1WOPA 4YB6A 4IQUA 5J1EA 4CNYA 1HNXJ 4K4VA 2BQRA 4CYUB 5I9EB 3VQ6A 3W9HA 4PABA 3QGPA 3R3TA 2HOFA 4CZEA 2JSXA 4P74A 5SWMA 1IKYA 4EO6A 4P0PA 3I28A 4ECZA 4KRFA 1DQ8A 2YWFA 1FJGK 5EOZA 3OPKA 4LF5J 5DQHA 1HNWF 3OYBA 2EI5A 4CLWA 3SQGB 5B0DA 1XN9A 4C9DA 2Z2MA 2GUIA 1MU2A 4USTA 3AU6A 3EUNA 4JB8B 3CCLS 3MUTP 4CZGA 3H40A 1REVA 5E3AA 2ZVIA 1ZYQA 1JQGA 2HHWA 2PIIA 2XSFA 3NS1A 4OGEA 1R8AA 3OYNA 4FJHA 1Q86T 3B6PA 4BRAA 1RCOB 1S6UA 2RU3A 3KK7A 4AHSA 2GQQA 3GV8B 1YXQA 4ZLJA 1ZQCA 2LDYA 4LSNB 1T95A 2Y3YA 4P0QB 1HIYA 3NOCA 3CCQS 4GKKF 5AJ3J 2NUBA 4KKOB 3BYRA 3D1OA 4J37A 2ZBCA 5HQ8A 2BE9B 3KHYA 2AJ2A 3MHYA 2ZH8A 2W04A 1HQEA 1HNWK 2OTLS 1ELOA 3NGUA 4QNLA 2GEMA 2K2PA 2G2YA 3B54A 3FJ2A 1IKYB 1O51A 4P0PB 3R97A 3I32A 1UVNA 2KN7A 1HKGA 2KEYA 1WHVA 2RUSA 2GX9A 2GTDA 4IH5A 2HBZB 5ETVA 4RJVA 3CCSN 3TR8A 3KXDA 4OCZA 3IRWP 5B0EA 4CHYA 3CD0A 4WXOA 1LW0A 1ZTWA 2RMLA 1JCEA 4X2BA 3OJUA 2YHWA 4CF1A 4X62K 2JXJA 3QEWA 4OX9F 4UB8U 3HI9A 1JLQA 1IG8A 2VA2A 4KHSA 4ZIVA 2NRTA 2HNZA 1HHSA 4DPYA 2B4UA 2MMYA 4LSZB 2QI2A 5C24B 2EXUA 2JWKA 3O4WA 4JKBA 3NAHA 5CHCB 4RTFD 1VIOA 4B9QA 2QN6B 2WB1C 5IC4B 7FDRA 3ZT3A 4GKKK 2CZ4A 3BYPA 4CJUA 4NYPA 2VPZB 1L3SA 1C0UA 4FOIA 4H03B 5DGAA 2LXUA 3TANA 1QTMA 1K8KA 4PZOA 2VGMA 2MQOA 2J76E 4KB7A 4YR2A 1N8RO 2CPHA 2ZJAA 4HHHA 8ICJA 3NRZA 5C10A 2G0IA 2ASPA 4MT1A 1D8YA 3MTJA 1HUOA 3DRPA 4PPDA 2XSJA 2AZ1A 3C65A 2HNYA 5SUHA 4PG7A 1PYTA 3NMRA 3MURP 1RHRB 2CQHA 3OTBA 3DYAA 5EE3A 3FCWA 1IWAA 4Y2RA 1YTUA 4LR9A 4FS1A 2YNHA 4OX9K 1TUUA 4FE3A 3QU9A 2ITGA 3SUPA 2OWOA 2OPSA 4KH6A 2BCSA 5D46A 1F44A 3IMQJ 4PZNA 1CSJA 2ZUDA 4A46A 5D4PA 5A0LA 2QWMA 4O3PA 1IVZA 4IQXA 4IR1A 2HQDA 1NHUA 1JLQB 3J81U 3G25A 4NZ7A 4DS4A 1LWCB 2PC6A 5ETPA 1H7XA 4IRCA 4NV0A 4JKGB 1JB0C 4WIIA 1IKWA 3PJWA 1RT3B 4EHTA 2O8EA 4I2QA 1OMSA 1EIYB 1A7GE 3LVWA 4GVMA 3VGKA 4QW9A 1HQUB 4HCBA 4CEAA 2F7VA 2XS7A 3IKMA 5KFVA 4OHWA 2LKZA 3SQ1A 4J03A 3L4PA 2VA3A 4O3RA 4MLEA 2A0FB 5IC6B 2ALZA 1HYSA 2CQPA 2P5OA 1WF1A 1VHXA 2P66A 2ZVSA 4GV3A 3F2KA 1NGEA 4WCEL 3DRPB 4M42A 2L08A 4YN4A 2CQ1A 2K4HA 3EMTA 2Z58B 4PKDB 2OZSA 2Q6BA 3QIPA 2FHJA 3DYAB 1KLMA 1LB2B 4GNIA 3GONA 4JI5F 3KJNB 2MZTA 5A2QO 2YKNB 3H3OB 3OTOF 3I82A 2EAMA 4X64J 1BI4A 1X9SA 3J81j 4NLPA 2Z0GA 3HF5A 3EO3A 2EG1A 2POKA 1RTZA 1RQ0A 2F40A 1J6ZA 3T69A 1C0MA 1BLUA 4RWWA 1TUVA 4WU2A 3NS6A 1ZRMA 2IJFA 2CDQA 2VFSA 5F0XA 4XO0A 1K1QA 3LVVA 1CZAN 3G96A 4P4MA 1N6QB 2EW9A 2F8LA 2X1BA 3HD1A 4O5BA 2RQCA 1RU1A 2RRNA 1Q7YO 2NSCA 4IC9A 3L2UA 2D0AA 2YKPA 4CE6A 3IRXB 1VQNS 3U26A 1IBMF 1C1CB 2O4GA 3GJQB 2F8MA 4BREA 5I42B 2GJIA 3QU5A 3M2VB 3VAIA 2XMMA 3LP1B 2F1JA 5E5NA 4NLYA 4AF1A 2ZJQQ 3CJKA 4HEA9 3OYLA 3ZT2A 4P2SA 3HPOA 3OL6A 3MR5A 1HJRA 2GV9A 4JI5K 1MMLA 4UB1A 3T6BA 2VU5A 2ATLA 3FNNA 5IWAF 5DDRC 1LOUA 3EN9A 2C22A 2MKYA 4FPAA 3OTOK 3VGVA 1VCTA 2PFUA 3E9LA 2EBGA 4KLFA 9ICOA 1M5KC 4RPZA 4CM0A 5FDLA 3DJCA 3U9ZA 3U1MA 4ED5A 1BI4B 2EK6A 3SMSA 4KHNA 4E7JA 3M6ZA 5EUHA 4LBHA 1XHZA 4MDBA 3K0JA 4DS5A 2RF2A 3UFCX 1U0HA 4F72A 3JSYA 4ZCKA 4PHEA 1F5CA 3NGKA 3TU5A 1PC4A 5F9LA 3MCMA 2Z1GA 2QA4S 1S12A 5GVQA 4H8KA 4UZBA 1GLDG 4IKAA 5C2GA 3Q22A 3CCES 1IBMK 2VDIA 2E2OA 1NK4A 4JI1F 3DLLL 1KBUA 1J97A 1WF0A 1B22A 1IG6A 3N7PD 1GMWA 5GIOA 4PYAA 3OL7A 5EVZA 1RDDA 3D6JA 3UKUA 3V6DB 3KWGA 3RBDA 3MAAA 4OZNA 4YFKA 4DG1B 5AKIA 5HP4A 3MEKA 4NLRA 4LF8K 3A0BU 7ICRA 1VQ6S 2YNIB 1F60B 4RW8B 5J1NA 3NNHA 2XG8A 2ODGA 4BR5A 3Q83A 3PHEA 1BPXA 2EFQA 4FW1A 1X60A 4CLKA 5AXMA 4JYAJ 4CEEA 1TMMA 1K0VA 2KT3A 4CHZA 3CC4S 4RQNA 4WCEQ 1NZ8A 1C4CA 3AA5X 1A5VA 5AZIB 3NCQA 2MAXA 3EXCX 4DSJA 1WCLA 1VRTA 5FDLB 2HVDA 4Y2MA 2P6UA 4PHPA 2HBRB 3X1LB 2MLYA 1AUSL 3Q8LA 4OYBA 4GO7X 2RF2B 2B43A 2Q4TA 3QWPA 2CGKA 3M7VA 1GO3F 4JI1K 3N0VA 3P1GA 1ITPA 2NO4A 2QE5A 3LDOA 5HR7A 4BBYA 3MEGB 2BKEA 5D49A 1UL3A 1T6DA 2QKKA 2ZZTA 3AH6A 4CFDA 1FIQA 4OYMA 5KFAA 4KTQA 4DTRA 1EP4A 2ZE2A 4ICLA 2IVMA 2HNDB 2V9WA 3K2YA 1G99A 4LF4F 2WF9A 1RCHA 3EL2A 3WKBA 5IINA 5CD4A 5AXNA 4B1ZA 3OR1A 3QFHA 2R2TA 1OVQA 1QQMA 4N7TA 2YY3A 5AQVA 4LF7F 3AA3A 5CP2A 3CJ3A 5E3RA 1HLUA 2P9KA 2H5XA 1ZXOA 3MECA 5FPDA 1QLNA 5B0GA 4JI8J 2FLPA 1FFWB 4QR2A 4N77A 1AB8A 1X1PA 3IN5A 2C3PA 3OVSA 2AW0A 2WAQF 1B9DA 4FVMA 2ACMA 3TVKA 5KFCA 5BREA 1KONA 4AL7A 3T1HF 4R79A 4I2HA 9ATCB 2R3VA 3UN2A 1JX4A 2HAFA 1T4GA 4E0DA 2GWJA 2AHOB 2LMIA 1I3OB 3OLBA 1S72N 2H3FA 4NCBA 1Z00A 1S1WB 2WMMA 4KHYA 2BUPA 3DRSA 2NPFA 2H65B 2A2CA 3AD8C 1HPZA 3ILIA 1KFDA 2EFNA 1IJJA 3WQUA 3NFAA 2UUAK 3CUNA 2W9AA 4QWCA 4XA5A 4WFYA 2P9PA 3KK3B 3R7BB 4DV6J 4KGKA 2DNOA 4FLVA 2UXBF 4LF4K 1GTHA 5KT3A 4JI3F 2R7RA 2H5JB 1HPMA 4RCHA 5AQGA 3CMAN 1M1GA 1COKA 3SNNA 3THYB 2ZE2B 4ID5A 3KKFA 3PYDA 4LF7K 1UCNA 3Q2TC 1DEJA 3LM9A 4DU1A 3C14B 1DRGA 5ETOA 3ISCA 4KPYA 3OFGA 5A6WA 3TA2A 5D3GA 2QW9A 1DT9A 2HEKA 4DR1F 3MR6A 4DQSA 1WOQA 1S99A 3D28A 4AYBC 2EWSA 3QFPA 4CI6A 5GAEP 3CCRN 3ONNA 5HMZA 3I5CA 2YX7A 2CADA 3MCOA 2MA1A 3T1HK 2F44A 2YKQA 2IBOA 3RJMB 2EC2A 5AIBA 4P73A 2GWKA 3TZYA 4MFFA 1JLFA 4XDCA 2CQ3A 4UT4A 3S3NA 3WX8A 4A8KA 2F8EX 1ZJNA 4V19X 1BMQB 2J8AA 3H1QA 1Z19A 3MN5A 3OYFA 1SZHA 4UAYA 4ZVOB 3THWA 4YB1P 3BSCA 3M3ZA 4B08A 4ETXA 5HO4A 5CD4H 3G82B 3NBPA 1MWYA 3U1NA 2YQEA 4HL9A 3I5AA 1NHVA 3DRSB 5EE9A 2EBEA 2UUCK 1CJVA 2UXBK 1ZZFA 3W5XA 1Y97A 5CB1A 5AQOA 4OLOA 3PIPQ 4ZMMA 2WC9A 4Z2XA 4JI3K 4L76A 3BQ2A 3BQ0A 3R6MA 4EELA 3ZD9A 3MXMA 3C21A 5JMNA 4LF6F 3LDAA 1M1HA 4F0HA 4OJPA 3M7DA 2O8BA 4D3HA 2O4IA 3QINA 3CB4A 4OQJA 1HBOA 3ZZZA 9RUBA 3TUIC 4USMA 4FXDA 4DR1K 2MQPA 4M3XA 4LZGA 2C42A 4FYVB 1OUQA 2CNKB 3PSIA 4ID5B 3WNHA 2E9ZA 2E5IA 8ICWA 2GMLA 5D3GB 1WNEA 3NG8A 4PY5A 4DX5A 3V9SA 2HFVA 3T5LA 4BDYA 5D0HA 4TVAB 2Y0SD 2XM3A 4LMZA 5B7WA 5L9NA 2HF4A 1KS2A