2HHVA

T:o6-methyl-guanine in the polymerase-2 basepair position
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*TP*G)-3'
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhvA01
5FRNA 3Q8PB 3A2FA 5J2HA 2YNIA 3HPHA 5DBAA 1HUZA 4M47A 2XGPA 3TFSA 5KT2A 4NM2A 3Q8RB 1A5VA 4O0IA 1S76D 3BQ0A 2IHNA 4KI6A 4ID1A 1O1WA 9ICCA 1WSFA 2LYHA 2E4LA 2G8FA 4UAWA 1ASWA 8ICIA 4HUGA 1EKEA 4CHNA 5J2CA 5FRMA 4PH5A 4J9QA 4EYIB 4Q8FA 2PXIA 3VQ6A 4H4MA 4FW2A 3ZCMA 1L3UA 3TQ1A 3NGZA 2P6RA 4JV0A 2Q0ZX 2ZJ5A 1S1WA 7ICKA 3HP9A 3OYLA 4UB2A 5DG7A 5DDYA 3OYEA 2VA2A 4DU4A 4XQ8A 4PGYA 4J9MA 4F4WA 3L8BA 4F5OA 2G8IA 1X1PA 4J9NA 5KFRA 4KTZA 2R8IA 2BHNA 3JPSA 4CJ4A 3HVTA 3SUQA 4QWAA 4BXOB 2W8KA 4RNOA 3CQ8A 1Y97A 4RPYA 3NFAA 3MABA 5CZ2A 1ZQMA 1YTUA 4NM1A 4K4IA 4PGQA 8ICHA 1VRUA 3ZDDA 4KLQA 4QZHA 2W8LA 3C6TA 1DTQA 4RW4A 1N48A 4EP5A 1KTQA 4DMNA 4P2HA 4M3YA 5C25A 2ZTEA 1TV9A 4J9PA 9ICNA 4FJHA 2H5XA 8ICXA 4ZHRA 3DOKA 2QXFA 4ECWA 4F8RA 4O44A 4CGGA 4ECUA 4OKEA 4G1QA 4E7IA 1RTHA 3ZSRA 4QZEA 1U48A 4M6WB 4M3RA 2F1HA 3DLRA 3QEIA 4PWDA 4CE9A 2GWSA 1TK8A 1ZQRA 4KTQA 3V1OA 3RH4A 7ICFA 1TKTA 1S77D 5C5JA 4K8XA 4FJXA 1XI1A 4W5OA 1L3VA 4J2BA 1HJPA 1T03A 4F4KA 1W0HA 2FMSA 3PMNA 9ICLA 1VSKA 3MXIA 3PW7A 4GVMA 1ZQTA 1GOBA 4NYNA 1RBSA 5J0PA 4Q5VA 3LAKA 3TAQA 2HHUA 4DOBA 2YKMA 4UB1A 3PO4A 4DSLA 1C6VA 1MC8A 5HRNA 1SZPA 3H4BA 2OZMA 3BDPA 4M0AA 2KFNA 3MGIA 4IRKA 3H8WA 4JRPA 2PI5A 1HYSA 3HXMA 4YFKA 3UQ0A 4KLGA 7ICOA 3GFKB 3SNNA 1FKPA 3PW0A 1SL2A 4M9GA 2AU0A 2D0BA 5IIKA 1IH7A 5E41A 8ICGA 4O3RA 1YVUA 3HO1A 2BKEA 3KHGA 4K4HA 3OYBA 4CGDA 3Q8MA 3N4MB 2BPGA 1TK0A 2YV0X 4ZTFA 4CHQA 1T7PA 3RB6A 3NGDA 2Z1GA 3P1GA 5J2EA 3I0SA 5T7BA 1TKDA 3V1QA 1C1CA 4IQTA 2HHWA 4DQSA 5J2PA 1GOCA 5KFAA 3V9UA 4JS5A 4DTXA 3SI6A 4GW6A 2C2DA 4CEZA 1BHLA 3FDSA 4HTUA 9ICQA 2Z1JA 4GXKA 3K5OA 5J2KA 3GQCA 3SV3A 3AO4A 2MUTA 8ICWA 5DKWA 3ZSWA 3JPPA 1C1BA 7ICLA 1A77A 4FYDA 4RQ6A 4EZ9A 1BCMA 2A1JA 5KFPA 3DLKA 2F1IA 1BVSA 2C2RA 2JGUA 3EW9A 3MBYA 1D9FA 4ECZA 1ZQDA 2ZTDA 3AVBA 3MR2A 2E6LA 3LK9A 4KHUA 1EXNA 4BXOA 7ICNA 2FBYA 2BGWA 1RT6A 4R63A 3TAMA 2JEIA 1L5UA 3ZSZA 3L2UA 1ZQAA 4M41A 7ICJA 2UVVA 4KI4A 1T05A 3ISNC 5KT3A 4AH9A 2OZSA 1U49A 1RTIA 4NLKA 4F2RA 1Z00A 3VQDA 4FLXA 3K2PA 1NK7A 9ICJA 3DM2A 2PFOA 1K1QA 2X6SA 4I28A 5IIOA 5CZ1A 3UXNA 4OLBA 4KN4A 2ETJA 2FPLA 5J1EA 4Z6DA 1RT4A 3SZ2A 8ICPA 4PY5A 3ZT4A 1LAVA 2AGQA 4N56A 1EP4A 4RU9A 4ZTJA 3O3HA 2IHMA 2GUIA 4I29A 1ZQNA 2B4JA 3PR4A 8ICEA 2XCPA 1S1XA 3DRPA 1S0NA 1Q8IA 3IG1A 1DTTA 4I2JA 1ZQXA 5HNKA 1KCFA 1ZJMA 1ZYQA 4DU3A 2KZ3A 2ZUBA 3NH2A 2D5RA 4AHSA 2BE2A 3K58A 2PFQA 3IAYA 3OY9A 4Q44A 1RDDA 2XGQA 4QWEA 4W5NA 4CEAA 4CEFA 4WE1A 1D5AA 5KFGA 3UIQA 3MFIA 4NY8A 7ICPA 4TSXA 1V9PA 4FLYA 4C8KA 4IR1A 4ECSA 3C5FA 4UB5A 3DLGA 2RKIA 1WSIA 5JUMA 1L3TA 4O5KA 3MEEA 4I7FA 4UAZA 4Z6EA 1KSPA 3MEDA 3NCIA 1CXUA 2IC3A 4AHRA 3M9MB 3CFOA 1BI4B 3AA5X 1RPLA 4E19A 3RAQA 3RB3A 5KTQA 1ZBIA 4NCBA 7ICGA 3HPOA 4DTRA 1ZBLA 4JUZA 2VWKA 5J2MA 2IAJA 4Z6FA 1S5JA 3RJIA 4FZZA 1J53A 1RCHA 1CZBA 4YVZA 3VQQA 3GV5B 3UXPA 4CF9A 4PQUA 4BE0A 4RT2A 4E7HA 4LSNA 4QCLA 1RTDA 4H4OA 3OYHA 1WAFA 5HRRA 5TZVA 4BE2A 3VA0A 4C8LA 2XHBA 4FJJA 1ZQFA 5J0UA 3T19A 4B9UA 3KLFA 1UWBA 3DLBA 4KRFA 5KGWA 1DGSA 1XWLA 1REVA 3OGUA 5DMRA 1N5YA 4NCGA 1A5WA 4N47A 4ED1A 3MR3A 3ORYA 2AQ4A 4O3SA 2NRTA 1WCLA 2ZTCA 2YNHA 3C94A 1ZQEA 5DB9A 4I27A 4DO9A 4F93B 3KKRA 4JK1A 8ICTA 3KJVA 2MUTB 3SQ0A 3KKSA 4TQSA 2JEFA 4KMUA 2BGGA 4DSKA 3QEBZ 3OYNA 1IKXA 3KK1A 2FMQA 9ICFA 4ECTA 3U6FA 2ISOA 4DS5A 5KRTA 5DB6A 4C8MA 3GDXA 8ICKA 1QE1A 2KTQA 7ICRA 4KLMA 3RMDA 1JLEA 5KG2A 4RPXA 1RZTA 2EHGA 3K57A 4RQ2A 4FS2A 4DL7A 2R8JA 3L2QA 4HUEA 2G8KA 2P5GA 4YFUA 1QTMA 3SQ2A 2ASDA 1B9DA 1CXQA 5I3UA 4KHYA 5KFFA 1HYZA 4DTPA 7ICQA 5KFBA 3M8QA 5KFJA 1SV5A 2G8VA 1HPZA 3OS2A 1ZQPA 4CJTA 4CJ3A 4J2DA 3LPTA 2GBZA 5KFCA 9ICIA 4I2QA 4CEEA 3AO3A 5EU7A 2FMPA 1NJZA 4E7JA 3D45A 4W5QA 3VQ4A 4IR9A 4CESA 5J0RA 4FJ7A 5CYQA 3NH0A 8ICJA 3QERA 3AO2A 4FJGA 2P51A 4KLJA 3H40A 3VQ5A 4FM2A 4O3QA 5HLFA 3KD5E 4CK1A 4QZIA 1VSIA 5BPCA 3CM6A 1RBTA 3MXMA 1NJXA 4LZGA 2P6UA 1W9HA 5IIJA 3TAGA 4PHAA 3G6YA 4IQVA 2Z1HA 3FYHA 4ED7A 3CM5A 3ZSQA 1NJWA 9ICKA 4RW8A 3V7JA 3WNGA 2OPRA 3T5JA 2A1JB 4J9SA 1SL0A 4Z4IA 2HMIA 4CFBA 4FLWA 5CYMA 3ISBA 2Y1IA 2HVIA 3O3GA 4HCCA 4J9KA 1NKBA 2HHSA 3NE6A 2UVUA 3K5LA 4FK0A 1N6QA 5L1IA 2D0CA 4FJ9A 1B92A 5KT5A 4CEQA 1ZQSA 3ZSOA 1NKCA 1NOYA 1RT2A 4ELTA 4DTOA 3N97B 5HROA 4Y1CA 3D0PA 4EBDA 1KFDA 3RRGA 7ICTA 3IHQB 3SI8A 1TV6A 5J2IA 3NGYA 4KLOA 1K1SA 1VSLA 3S3NA 4DL5A 1IO2A 3Q8SB 4O5EA 5BOMA 1KVAA 4O3NA 5D49A 2HNDA 4TUSA 2F96A 2XY7A 3AVKA 3WNFA 4F2SA 4CIFA 4QZ8A 1KVCA 5KFMA 3VQ9A 3K5NA 1L3SA 4UAYA 1BPZA 3C23A 1CZ9A 4Y1DA 2OPQA 4KLSA 1KEJA 2B5JA 4IKFA 5EWFA 4AHCA 4GC6A 1ZQJA 4CGFA 4B9MA 4W5RA 3O3FA 4RW6A 2A1SA 4EYHB 4UBBA 2BQRA 4N76A 5EOZA 4AHVA 9ICBA 1ASUA 4CJVA 4Z6CA 5KFHA 2HNZA 2PFNA 3BQ2A 2X78A 3HP6A 3SQ1A 1BGXT 3PNCA 9ICSA 4HCBA 2BCRA 5J0QA 3RJFA 3ZT1A 3OSNA 1WLJA 4I2FA 1BIZA 4BGDA 3P83D 4O3PA 3E2EA 3NF9A 3QNOA 4RQ1A 3M9OB 1ZQKA 4F4YA 4TUQA 3DLHA 2XRIA 3QEWA 1JMSA 4N5SA 3DYAA 4Q0BA 1RT1A 3VQ8A 5KFEA 1RYSA 1JLGA 1G15A 4AHUA 1JXLA 1TL1A 4CK3A 4ECQA 4KLUA 3OS1A 3HVRA 3OYJA 9ICWA 3H8JA 5KFLA 3EPIA 2B21A 4OJRA 4DQPA 4E89A 7ICUA 4HUFA 4CJPA 4PHPA 4DS4A 8ICBA 4FJIA 2J6SA 4YNQA 4FZXC 2R8KA 4RNMA 1RDAA 4KHNA 4F91B 4DTSA 4DFKA 3LP1A 4DSEA 2HVHA 1AROP 4IDKA 4FS1A 4EBEA 3QLHA 1FXXA 5IINA 4DQIA 4F5RA 4NLZA 1TAUA 3V9SA 3M8SA 4FK2A 1BISA 4KAZA 3G10A 8ICRA 2M9NA 4RT3A 2VG7A 5CHGA 4I2PA 1WN7A 4NLNA 4MFCA 4ECYA 1XSNA 3AVIA 3G6XA 3RJEA 3C1ZA 3V9WA 4BACA 2WONA 4IBNA 3C2KA 3AVHA 4CJEA 4M42A 4CHYA 4CEBA 1R0AA 4JWNA 3AVGA 5DB7A 4BWMA 4O5BA 1JXEA 4Q45A 1NK0A 2XY5A 2I9GA 3GILA 2BCVA 4B9LA 1EXQA 1H38A 3MGHA 1IKWA 4DF4A 4OPJA 3LP3A 2DPJA 3TAPA 5CY4A 4CEDA 2ZUCA 4FCYA 2PYJA 1ZQQA 1X2IA 4P4MA 1QLNA 4KLTA 4YXJA 5DG8A 1QQCA 1NOMA 3DRSA 4LH5A 3H4DA 4CF1A 4FZYA 3HYFA 2ZE2A 4E0DA 1RT3A 2RDJA 2FPMA 3AVLA 4M6WA 3LWLA 3VN5A 4CJKA 4ECXA 2HW3A 4MFAA 3KLHA 1DOQA 5J2GA 4KPYA 1VSDA 4HVJA 3MR6A 3ZDEA 4YN4A 5D4BA 3QEXA 1RT7A 1S0OA 4PA1A 5KFSA 5EWEA 4F4ZA 3V6JA 4KN7A 2JZBB 1EX4A 4KTWA 3NTUA 4PHEA 3RB4A 5HHHA 3LDAA 3JPOA 2DPIA 4JWMA 1RYRA 8ICMA 4XUSA 1VSMA 3SUOA 4CIGA 4ED2A 2BR0A 4KKOA 2IA6A 1HRHA 1KFSA 3QNNA 3KHRA 1S0MA 8ICVA 3VA3A 2ALZA 3HM9A 5HBMA 5IIIA 4TUPA 1ZBUA 5J0XA 5IILA 4O5CA 3LAMA 2KN7A 4LVSA 2ZD1A 1XO1A 2XCAA 3UPQA 1JKHA 4KHWA 3U3GA 4M2YA 3OHAA 3P5JA 5D46A 3V7LA 5KG3A 2P66A 2YKNA 3PUFA 4KFBA 5J0TA 5CJ7A 1BPXA 8ICSA 1XS9D 2EX3A 2E6MA 4E1MA 3PW2A 3C1YA 4YQWA 1RBVA 4B08A 3T5HA 2VWJA 2V9WA 4KLDA 4TURA 3NF8A 5KG5A 1X9WA 1RTJA 4CF2A 4DFPA 4FJMA 3ZT2A 4CECA 1ZQVA 4X5VA 5DLFA 3OYKA 2IGIA 4KLLA 4G3IA 4DTJA 2DY4A 3SPYA 1ZQYA 1UT5A 1CEZA 4YR3A 1Q9XA 2RF2A 4M3TA 3DOLA 4W5TA 4ED8A 2NRZA 1VSHA 4C8NA 4DL2A 9ICAA 2NRVA 1S6QA 4B8AB 1JLFA 3L3VA 2OA8A 5CR0A 3AA4A 4QWBA 3TI0A 3G6VA 2BQ3A 2AGOA 2BCQA 1TVAA 4M3XA 3M8PA 4B9VA 3AA3A 4DTNA 1B43A 5HHIA 4RZRA 1FK9A 3F9KA 3RR7A 3QO9A 4QW9A 1D8LA 4QZ9A 2O4GA 3I8DA 2PZSA 4KHSA 2C2EA 2P1JA 5DQHA 3HX0A 3SJJA 4RW7A 4LY7A 3V4IA 2DTUA 1UA1A 3SUNA 4RNNA 1MQ3A 3NDKA 4IQUA 3ASMA 3T3FA 1TAQA 3Q8LA 5KFYA 5F9NA 4H8KA 4QZAA 3PX4A 4F4XA 3C6UA 4LZDA 2RDIA 4HYKA 4DWIA 3JPRA 3LWMA 4KLFA 3KIOA 1LV5A 1HUOA 1D8YA 1KRPA 1XHXA 4OKJA 3KHHA 4BWJA 1S6PA 2I1QA 3ETLA 4QWDA 3HSTB 3GIIA 4ID5A 4M3ZA 1IKVA 1ZQIA 4FJ8A 5DLGA 4KLIA 4CIEA 3TFRA 9ICGA 4Z4CA 3HL8A 3RJHA 4PPXA 1NK6A 3IS9A 1C7YA 2VG5A 1RBUA 2R8GA 4CJFA 4M45A 4I2DA 4J9OA 1ZQHA 3V6KA 5KG0A 4CJWA 4M04A 4M3WA 3QEAZ 2ASLA 4Z4FA 1WSEA 1EETA 1HMVA 2W9MA 7ICEA 4F3TA 3GV7B 4O0JA 4NXZA 3AUOA 4ELVA 4B9TA 5L1KA 2YNGA 3LPUA 4CERA 5EWGA 1KLMA 3ITHA 4KHQA 3EWAA 5L1JA 5SZTA 2BANA 3AO5A 5DG9A 5KG7A 4M9JA 1Z26A 4I2GA 1WAJA 1XHZA 3OYFA 2FC0A 4DQQA 4DG1A 2GV9A 1ZQUA 3RBDA 1S1VA 2B6AA 3TARA 4GXIA 4QZGA 2DFHA 3ISDA 3RBEA 4ED0A 3AVMA 1IKYA 3NF7A 2KZZA 3V72A 2PYLA 4J2AA 8ICCA 2YHAA 4FK4A 3OYGA 1WSHA 4RPZA 1BPEA 3RR8A 4CFAA 3AVFA 4ZH4A 4KITB 1HNIA 2ZJ8A 1MU2A 4Z4HA 1ZQCA 1JN3A 4KV8A 3LALA 2ZUDA 4FM1A 5J0WA 3SUPA 3DMJA 4EZ6A 1IXRA 5DGAA 4YG2A 4CJSA 2QK9A 2DFLA 2BPFA 1HNVA 3K4GA 2ZQBA 1COOA 1C1AA 3OYIA 5DQGA 3F73A 5FROA 3V7KA 2VA8A 4IFVA 2YNFA 1WSJA 3TR8A 1HQUA 3CYMA 2QKBA 4UB4A 4F3OA 5KT6A 3L2WA 5HMMA 3QEPA 1NK8A 3VQBA 3OJSA 2JEGA 5HRSA 1QSSA 3IM1A 5KT4A 3DLEA 3MAQA 1ASVA 3OYDA 1ZJNA 3JPTA 4M9HA 4DQRA 3SYZA 3HK2A 4DTUA 4JS4A 9ICUA 4CF8A 3B6OA 3OVNA 5KFUA 4DL3A 1LWEA 4JLHA 4BDZA 2I5JA 3KTQA 3QEVA 3OYAA 1NOZA 3NGIA 1BL3A 1B22A 2XY6A 4FLZA 3QZ8A 5FDLA 3GIMA 1DLOA 2FBTA 4FLTA 5DBBA 2NRXA 2XC9A 4I2HA 9ICVA 4AHTA 5J0YA 5J2JA 3G0ZA 5HP4A 4CJRA 2UVRA 3DI6A 3RAXA 3KD1E 3T5LA 3LP2A 4PUOA 3ZT0A 3T1AA 3ZDBA 3MEGA 4IFYA 4BDPA 4CGIA 4E7KA 3ZT3A 5KFVA 4XA5A 3LZIA 4R64A 4E1NA 9ICTA 5KFZA 3WNEA 2G8UA 4MF2A 2NRWA 3PO5A 1ZQZA 3LZJA 4EEYA 4OGCA 4XIUA 3TWHA 3ZSVA 5KFQA 3AO1A 2LSNA 1BPYA 3HWTA 3B0XA 4RQ3A 3PW4A 4R65A 3MR5A 2G8WA 3RB0A 2JLEA 2RN2A 2HHXA 3NAEA 4PHDA 8ICUA 3SQ4A 4IQWA 4CEOA 5J0SA 1S9GA 2C28A 3KK2A 8ICQA 9ICPA 5IIMA 1LB2B 4O9MA 3QETA 5BOLA 1NKEA 5KFOA 1RDCA 4AILC 4YMNA 2IDOA 1TL3A 1JL1A 5KFXA 3AU6A 3RH5A 4UB3A 3RMAA 4GMJB 1T4GA 5SWMA 1BCOA 3THVA 5CB1A 4DF8A 4MEYA 2ATQA 3TANA 2KZMA 5HMLA 3AVNA 4ED6A 5DDMA 4NYFA 3PMLA 3NHGA 4B9SA 1TK5A 3AU2A 5KG6A 4E7LA 4CJ5A 5KI6A 3MECA 4CGHA 4I2BA 2HHQA 3RRHA 3ZSXA 3CFRA 4UQGA 3K5MA 1XC9A 8ICZA 4FJNA 4DU1A 4IG0A 2OWOA 1LWFA 3V81A 3KLGA 4L8RB 3RJKA 2NUBA 1TKXA 8ICOA 3ZD9A 1JIHA 1JX4A 2XO7A 4DLEA 3CFPA 2MAXA 3O4QA 4CJUA 4DFJA 5C42A 4RQ5A 1C0UA 3TABA 4JRQA 4ELUA 2O4IA 1A5XA 3OYCA 5J2AA 3PX0A 3S9HA 4YXMA 1ZQOA 1KDHA 5CP2A 1JLAA 7ICVA 4FXDA 3KHLA 3L2RA 2G8HA 3GIKA 3CG7A 1KFTA 5J2NA 2VA3A 1UA0A 5KGXA 5J2DA 3LP0A 2FLPA 4MEXA 2VG6A 5C24A 8ICNA 3Q8QB 5DQIA 4EBCA 3PV8A 1ZQBA 4HHTA 2W9CB 2KQ2A 3JYTA 3ULDA 3U3YA 3HW8A 1SKRA 3PVXA 5KFKA 7ICIA 4EP4A 4DFMA 4FBUA 8ICYA 5JS1A 3KK3A 4LSLA 3TAEA 3HPGA 4M3UA 1QSYA 4R66A 4GLXA 2VANA 1F21A 4J9LA 1JLBA 1XU4A 4RG8A 2Q3SA 1S9EA 9ICOA 2PY5A 3K75D 1RILA 4DSJA 1QHTA 1NJYA 2J6UA 3IRXA 4CF0A 5I42A 3NBPA 4N41A 3EYZA 3L3UA 3RH6A 4FJLA 2F8SA 4Z4GA 1WNSA 2FLNA 3QZ7A 1Q9YA 8ICAA 1QSLA 1RXWA 2ZJAA 4BDYA 3S3OA 2W9CA 8ICFA 3M8RA 5CA7A 5J2QA 4RUCA 1ITGA 4F92B 4DOCA 4O55A 3BGRA 5KFTA 4C8OA 3QINA 3H7IA 2IBKA 3ZSYA 1NK4A 4PGXA 1MQ2A 3RMBA 3TAFA 5F9LA 4B3OA 4I9QA 4O4GA 4RQ7A 3RMCA 4IG3A 3RTVA 1TGOA 2RPIA 4Z0UA 2ISPA 7ICHA 3AVCA 3NF6A 4QAGA 1ZQGA 4YD2A 3MXJA 3UQ2A 5KFIA 4YMMA 2BCUA 4DSFA 1S1UA 2KW4A 1U4BA 1XSPA 3GIJA 1VRTA 4FM0A 1U9LA 2FBXA 4FLUA 1HJRA 4CJLA 4M9LA 4GXJA 1J54A 1MSWD 4R5PA 2FBVA 4F5PA 3I0RA 5JS2A 4DOAA 4B9NA 4TQRA 2ASJA 4YD1A 1JLCA 1B9FA 3SCXA 1WCNA 3OJUA 3C2LA 1SUQA 1VSFA 4KLHA 1UAXA 4KO0A 2R7YA 4Z4EA 2R8HA 2HHVA 1ZQLA 2V4RA 3AVJA 4RW9A 1LAWA 3OSPA 3QESA 3PW5A 2PFPA 9ICRA 3C21A 5J2FA 4J9RA 2HHTA 2V4QA 1RDBA 4DTMA 3MFHA 3T5KA 2W9AA 2Z1IA 3VQEA 3MDAA 2KFZA 5KG1A 4KB1A 3RJGA 9ICMA 3H08A 1BQNA 5L9XA 3ZDAA 3V6HA 4ICLA 3L2VA 3PY8A 3EPGA 4FO6A 4CJQA 3HJFA 2F1JA 2UVWA 3LANA 3PX6A 1J5OA 4O3OA 5J29A 9ICXA 1RXVA 1RT5A 3AA2A 4FLVA 2HB5A 5J2BA 4CHOA 1RBRA 3E01A 9ICEA 1BPDA 5KG4A 3RWUA 1X9MA 5J0OA 4P4OA 1TVRA 2AGPA 3EY1A 5DBCA 1TKZA 5KFWA 1RNHA 1XSLA 2DFEA 4I2AA 4CCHA 4FVMA 1C0MA 3PR5B 4OVLA 4KREA 3H8SA 1S1TA 4F5NA 4YR2A 2BCSA 3OHBA 2ATLA 2BQUA 3M9NB 2QKKA 1BPBA 2X6NA 4RQ0A 4KLEA 1S0VA 4OPKA 4I9LA 1NK5A 1LWCA 8ICLA 5DB8A 7ICMA 2A1RA 4FJKA 4FJ5A 2BPCA 4JV1A 3S3MA 2W9BB 3HT3A 4MQ3A 2BDPA 1WSGA 4MFFA 1GOAA 5K14A 4CFCA 1LW0A 4QZBA 9ICHA 2IS3A 4GC7A 1JLQA 3LDSA 4I2IA 2Y1JA 1VSEA 4BE1A 1VSJA 3JPQA 4OLAA 1PZNA 3JPNA 1BIUA 1I3AA 4E3SA 4NLGA 1Z3EB 4OKKA 1S97A 2IOCA 4QOZB 3V9ZA 5L1LA 1K6YA 3C5GA 3ZD8A 2PI4A 2FPKA 3BQTA 4CFDA 1BQMA 3SV4A 4NCAA 2OPSA 4UBCA 1UOCA 4DEZA 1U47A 4QZCA 3OS0A 1S10A 2YHBA 3QIOA 3V6DA 4QWCA 4FBTA 3B6PA 2D0AA 4YP3A 4J2EA 3UXOA 1FKOA 4KB0A 1U45A 1J9AA 2HNYA 2WOMA 4CHZA 1HYVA 3ALYA 2W9BA 4P4PA 1YTAA 4DL6A 4CGJA 4ECVA 1ZQWA 3OYMA 3AVAA 1X9SA 5HP1A 3EZ5A 4MF8A 4IRDA 4RQ4A 4RQ8A 1CLQA 1T3NA 5KRSA 1NK9A 3GV8B 1JXBA 1D9DA 3ZDCA 3V1RA 4FW1A 2FLLA 3VQPA 5DK5A 4QZDA 5DGBA 1N56A 3VQCA 3VQ7A 4CK2A 5CWRA 4DLGA 2P5OA 1ZBFA 2OYQA 4QW8A 1TFRA 5D3GA 1CUKA 3DRRA 3O4NA 4K4GA 4I2CA 4B8CA 1I39A 1Z00B 1JL2A 1Y88A 3RJJA 4F5QA 1HQEA 2F8TA 3B0YA 3C95A 1SKWA 3BJYA 3AV9A 2DFFA 4MFBA 4R8UB 3KLEA 1SKSA 7ICSA 2XY8A 3MDCA 3ISCA 4Q8EA 3QIPA 4I2EA 1VK0A 2IMWP 5KFDA 2ITGA 4DL4A 2JEJA 1IG9A 3BQ1A 3V9XA 1QS4A 4JV2A 3QE9Y 3VQAA 1A76A 3K59A 2C22A 3Q8KA 3WNHA 1UT8A 2AJQA 4K8ZA 4LD0A 4DSIA 4IRCA 4Q43A 2AQ0A 2OPPA 2JZBA 1LW2A 1ZETA 1KLNA 4YMOA 4QZFA 4F50A 2J6TA 3C2MA 1YT3A 2W42A 3KLIA 3FFIA 4CHPA 1S9FA 1C0TA 1Z25A 5KT7A 1SL1A 4LH4A 3SPZA 4YCXA 4R8UA 4XRHA 4ECRA 4OGEA 2WTFA 3JSMA 1IM4A 5KFNA 1U04A 4M9NA 3NH1A 4ED3A 1BI4A 5HRPA 1ZBHA 1KVBA 2X74A 4RUAA 1T8EA 4YR0A
chains in the Genus database with same CATH superfamily
3Q8PB 1WHXA 5E84A 3CDWA 2HFNA 1HBOB 4M47A 1WBBA 4EMDA 3ICLA 4WFBL 1HI8A 4NM2A 2YJEA 1FERA 4LF8J 1H98A 2BYCA 2EFNA 1YKWA 1O1WA 4FOEA 3ENOA 3C6TB 5BYSA 2KJ8A 2N4CA 2G8FA 4UAWA 1ASWA 3D2WA 1EKEA 3O6WA 1Q86T 2QGFB 3F44A 5G0RA 2J0SD 2DXFA 2PIIA 3PFEA 3GCXP 3PTWA 4K0KF 3OXLA 4C0OC 4NX9A 3W5ZA 3CIZA 1S1WA 1TYQA 5DDYA 4XQ8A 4PGYA 4J9MA 3T1YF 2G8IA 4US9A 1X1PA 1J5EJ 4J9NA 5KFRA 3KUGA 2BHNA 2MSNA 2H3FA 1UW4A 3HRGA 4AM7A 4CJ4A 2F4VF 2W8KA 2X3DA 1XNQJ 3QMLA 4CLTA 1Y97A 2LFVA 1RWNB 1IKXB 3M1VB 5BXIA 5CZ2A 1NB7A 3NMAA 2HRTA 3KKFA 2QI2A 4OMFG 5C12A 3AQPA 4B3TF 2ZNZA 4AL7A 1VRUA 3A13A 4ZPWR 5CR4A 4KLQA 2BEFA 2W8LA 3C6TA 4RW4A 1KTQA 4DMNA 3QLHB 5C25B 4M3YA 1YTYA 3BKTA 5J1NA 5IT4A 9ICNA 1VHIA 3HKWA 2H5XA 8ICXA 4LF4F 4ZHRA 3SXLA 4FJHA 3CD6N 3QGIA 3D6RA 3K7RA 3J7ZO 4A8FA 2BA9A 1H73A 2O6KA 2MZTA 4F8RA 4I56A 4O44A 4P7TA 3D2FB 4CGGA 3D2FA 1IN0A 1PVQA 3U1MA 2O8DB 2BACA 3G8QA 3Q8UA 5DZ6A 3MCNA 3ZSRA 3NP5A 4UTGA 4C11A 5HP1B 2DHXA 2HS3A 1D9AA 3H1QA 2Q1NA 2VB6A 4M6WB 3PXGa 3W0LA 2BJEA 2OKQA 4HHHA 3ETOA 5IV3A 3QEIA 2B9WA 1M1KT 4F67A 1ZQRA 4LIRA 4WQ4C 3RH4A 2RJZA 5E5NA 7ICFA 1S77D 2UXCF 1HW8A 4WTOB 1RKJA 1OH5A 2X1GA 2ZXIA 3UKRB 3N6MA 3AXMA 4A2BA 3FEZA 2H9ZA 4XH1A 5A76A 1VSKA 2X7IA 1GOBA 2CGJA 1RBSA 2XI9A 2R4FA 5J0PA 3GU3A 3LAKA 4H5RA 1Y4ZB 4I4BA 2Q36A 1GEHA 2HHUA 3GZ7A 3TU5A 2HBZB 3KZIU 2YX6A 4FPRA 2MKJA 1YJTA 1C6VA 4HAIA 3H4BA 1IG6A 2DITA 2NXNA 4Y2YA 4MKYA 3H8WA 3VGKA 3DRPB 2W3RA 3G6ES 5AZIB 1HYSA 3TADC 3HXMA 4YFKA 4LF8F 3TX0A 3UQ0A 4KLGA 7ICOA 2W6LA 3EX7B 1Z4NA 4YHHJ 1EZZB 1SL2A 2ZH6A 1VQPN 2D0BA 5IIKA 1IH7A 4K7QA 1CS4B 4O3RA 2AW0A 1YVUA 5J1EB 3HULA 2FHOB 2BKEA 2RHSB 3KHGA 1RGVA 1CC7A 2I8EA 1F1BB 5EY4A 1M5OC 1R0CB 2HNDB 3N4MB 2BPGA 3HX9A 4L75A 3BGOP 3RB6A 4TLQA 3I0SA 5T7BA 1TKDA 3R9KA 1C1CA 3NEKA 1P90A 3ZZZA 3KFWX 2XG8A 5AQZA 4CZMA 3A3NB 3MDFA 4GW6A 4XH5A 2G06A 2CPIA 2F65A 2ZEJA 1N36K 2IYGA 2D3OR 2D0PA 1LWXA 3UR3C 5AQFA 2UUCK 4QS7A 4K42A 3H90A 2CVEA 3VEXA 8ICWA 2OTLN 4C4WA 2ZBPA 3NMRA 2ZGZA 1KAYA 5AQXA 3JPPA 2VD3A 3OL6A 4FYDA 2ZWHA 1SI9A 3QATA 2A1JA 5KFPA 1CJTA 2CQIA 3KG4A 1DAXA 2DXEA 2C3OA 2C2RA 1ZM4A 2IBOA 2JGUA 3MBYA 3IG1B 2AJ0A 2DGZA 3LK9A 2ZIXA 1LWFB 5F8HA 2BGWA 2HZCA 2RRNA 5GVQA 2ADCA 4LQ3A 2JEIA 1L5UA 1GLJO 3GMGA 4M41A 1C1CB 5KT3A 4AH9A 1IBKK 3O9QA 1R0AB 2KXHA 1S59A 1VQPS 3VQDA 1KQSM 1SV0C 4AQYF 3K2PA 4YS2A 2YPYA 9ICJA 1K1QA 4MMOA 2KKVA 5GIPA 4I28A 2CXEA 2XHWA 5IIOA 2AP6A 2EDUA 1U1QA 5CZ1A 3UXNA 2QLWA 1MROB 4KN4A 2ETJA 2FPLA 5J1EA 4DR6F 4JI0J 1VQNS 3LQVA 4NE9C 1U1OA 2J9CA 1YDLA 2YNFB 4RU9A 2BE7D 1TUYA 1E6VB 2GUIA 4YORA 2NXCA 1ZQNA 2ZBQA 4PPZA 3BP8A 3IRXB 2CADA 3DRPA 3TKAA 3IG1A 1DTTA 2H3VA 5F0XA 2VDIA 1PYTA 4DU3A 4YDUA 2QFIA 1HR0F 1TU0B 3K58A 3IAYA 5ALXA 2WW4A 2F7TA 3MR7A 5H9EK 4Z7YA 5IV4A 1IVZA 4TSXA 4FLYA 2ZWPA 3DXMA 4C8KA 3PRBA 2KOBA 2D4WA 2WSEC 2HAIA 1WSIA 2XZTB 4CIOA 2BJDA 3ENHA 4UOHA 1PK1A 3P4UB 4I7FA 2GX9A 2I7PA 1ZPVA 4Z6EA 5DM7Q 1KSPA 3FAHA 1CXUA 4FYYB 4RCHA 3OHRA 4UATA 3L4IA 4AHRA 4MIBA 5E26A 2L41A 2D41A 3HD1A 5EE3A 2QT7A 3NY0A 3RAQA 4A5BA 2GA7A 4WFNL 5AZJA 1IXKA 2LEBA 1NHVA 7ICGA 1RWXB 1ATRA 3WUHA 5BRDA 2DGOA 4RW9B 4QU6A 4JUZA 5J2MA 1GLBG 4O44B 3PSIA 5ADZA 1S5JA 5HL7Q 3H0LB 2BJ8A 3TVKA 5EOYA 2B7CB 3ZC4A 1G2EA 2V51B 4A48A 4PQUA 5C7PA 5EE1A 2HYIB 4RT2A 4ZVUB 1XQIA 2JH3A 4FSVA 3OYHA 4B3RJ 5TZVA 5B8HA 1UFLA 2CPJA 5ALOA 2JSXA 5J0UA 4U7BA 2ZIXB 2B6AB 4NLOA 1R8PA 1UWBB 5ETTA 3KLFA 3DLBA 3OGUA 1DZ5A 1Y5LB 2BUNA 5HAOA 1B0TA 4NCGA 4HDHA 1A5WA 1NHKL 5C24B 4N47A 1IR1A 3ORYA 3K5PA 2AQ4A 4O3SA 2NRTA 3C94A 5AQGA 5DB9A 4CH1A 5EE0A 5BREA 5FPEA 1AZSB 1JB0C 3R8EA 4FE3A 3SQ0A 1V5VA 3JTNA 3KKSA 2GVZA 4WCEQ 2JEFA 4OO1J 2HQGA 3WHIA 5T14A 4LF5K 9ICFA 2A2DA 4DHYA 2IM0A 2ISOA 2M4MA 3NWRA 1QE1A 2KTQA 5L1MA 4UOFA 5IQQA 4FYWB 2VICA 3RMDA 3M1FA 4Q7AA 4RPXA 4KKOB 3K57A 4HUEA 4DL7A 2R8JA 2VH7A 4AXIA 2G8KA 2FYXA 3GLJA 1SB6A 1N88A 1T9WA 2AYBA 1H1VA 1SJQA 4OYMA 1QAJA 4Y2CA 3AH6A 3CD0A 4DTPA 4MYTA 5B09A 2BJ3A 5KFJA 2YI1A 1DFDA 2ZHAA 1SV5A 4M7XA 4CJ3A 3UDVA 5GTHU 1SQGA 2K3IA 2LKYA 2FMPA 2UXBF 1NGCA 5F1XA 1CSJA 4E7JA 2J5AA 4PYAA 4LRBA 4IR9A 4OYAA 4ES1A 5J0RA 1HBUB 2V5HG 3KUEA 2AJFE 5AI4A 3H5UA 2E1ZA 5B66U 1BOTO 3ED5A 2NREA 1NJXA 4M5MA 1W9HA 3W3DA 4WJ3B 2QLTA 3PHTA 2VASA 1SJFA 2WSFC 5IIJA 3TAGA 4PHAA 4IL6U 3D6TB 3PJWA 2Q43A 2OJ3A 3NOCA 3UDLA 4CO5A 2ALYB 2E88A 2BOAA 4QIWC 4LF6K 1EWRA 4FP9A 1UPMB 4RW8A 3TEGA 3T5JA 3R2CJ 4J90A 4Z4IA 4W92B 2MXYA 4KGMA 5M1FA 3TJAA 3DDIA 2ZGYA 1LKYB 4XK8C 1H3DA 3O3GA 3HVWA 2K06A 5ALYA 2DISA 1UVIA 1CPZA 1N60A 1ZZNA 4EFAC 2HHSA 3NE6A 1S8OA 2UVUA 3J7YP 4AL5A 4FJ9A 5KT5A 3QT7A 4TKTA 4DTOA 1Q81T 2UYTA 1OUQA 5HROA 4CLLA 2QWMA 2A6AA 7ICTA 3IHQB 3SI8A 1TV6A 2F9TA 4YOUA 5J2IA 5I9EB 2MKYA 4IOCQ 5D15A 4FKXA 2Z30B 1IO2A 3Q8SB 5EVZA 3HHLB 5BOMA 1Q3UA 4O3NA 3ETMA 1EARA 4NO7A 3KZBA 3AVKA 1Y3KA 3SSRA 5DM6L 4F2SA 4CIFA 3D2NA 1HBOA 1OH6A 2ZOFA 3QIPB 4KC5A 3WXMB 1MA7A 1SZHA 4KLSA 4LVNP 4IKFA 3BZKA 5EWFA 2QSFA 1CJUB 2AYMA 4CGFA 4GFJA 3OUYA 5HANA 4UBBA 2VQFF 5IZHA 1JALA 2BQRA 9ICBA 4H0XB 3R1LA 1LXNA 2LDYA 4BRCA 2EKNA 3N4PA 5AQIA 3FZLA 1S1VB 3PNCA 3N7RC 2RH3A 1TL3B 3LO3A 4CO2A 4HCBA 2BCRA 1HBMB 4LJMA 5J0QA 3T1HK 1GXLA 5DJBA 1BIZA 3LPEA 4JKAA 2FZCB 4O3PA 1XBWA 1XR5A 3EGVA 3E2EA 1X0FA 2GLEA 3M9OB 1ZQKA 5HJYA 5MAOA 4ILGB 1WG1A 1NM1A 5C2DA 2W7AA 1WC4A 4Y2AA 2JRSA 3HVRA 4B3MF 1HI1A 4X84A 3EPIA 2B21A 4OJRA 4C7YA 2B56A 2BMBA 4DQPA 7ICUA 4HUFA 2M7SA 1YIJN 1MWZA 4LUBA 2XO6A 2JVOA 3CJKB 8ICBA 2JRZA 4YNQA 1OQ3A 1WUDA 2WHOA 3ZZYA 4TYAA 4KHNA 1D4XA 4HT5A 3LP1A 2DR5A 2YKQA 1QQOA 2MKHA 3PYGA 2HVHA 1RBLA 2O1PA 4EUVA 4USUA 4FS1A 4EBEA 5D77A 1FXXA 5DDQC 4IO9L 2IIRA 4F5RA 4L72B 2KXFA 1P1LA 3KXDA 3R1HA 3V9SA 4IG3B 1P27B 3M8SA 5AKGA 4KAZA 4RNHA 3AB4B 3G10A 2M9NA 4C48A 2QA2A 1MG7A 3N7SC 1HPZB 1LFPA 4ZS6A 3V9WA 4BACA 2JGAA 3C2PA 3JS6A 4CJEA 4M42A 1GQEA 1N32F 4CHYA 1RDWX 4CEBA 4DBQA 3DN9A 4BWMA 4A8EA 3JAMO 2I9GA 4JOUA 4Y28C 4B9LA 3G8TA 2AJ2A 2IJRA 3UCZP 3QB0A 4DF4A 4OPJA 2XS2A 3LP3A 2DPJA 3SFUA 3QJLA 4BC7A 3AOCA 4WZQA 1X2IA 2BOPA 2CPDA 4KLTA 3DGVA 2E44A 3DRSA 3W9IA 4NLWA 4U8VA 2LECA 2HMXA 2RE1A 4NMXA 3A0HU 4B3MJ 1SQKA 3CF5Q 1RT3A 3BBCA 1F2HA 3R6MA 3CC4S 1HWLA 2RE2A 3VGSA 4M6WA 3LWLA 4CJKA 1R8AA 4PKDB 4HI1A 4ZVRB 2GGPB 3QFUA 2RDDA 4KPYA 2DWQA 3KLIB 2APOA 1LCUA 3ZDEA 4YN4A 4I2QB 1RT7A 2CPFA 1S0OA 5KFSA 4BC2A 4F4ZA 4C1NK 3TWZA 4QNLA 3IKMA 4KN7A 4RBVA 2HGNA 2JZBB 3B8HA 3MCOA 2K4HA 4QIWD 2QM1A 2CDRB 1CJVA 4PWWA 3LDAA 5CEHA 3QRPA 2ASOA 5M1OA 2FHKA 8ICMA 4AYBD 1M1KO 3PYFA 3F2KA 4NLVA 1KFSA 3OTEA 3IMXA 1YHQN 4ISGA 3QPIA 2AKWB 5F8IA 3HRDD 5HBMA 4K0KJ 4BRMA 2VJ4A 2HOIA 9RUBA 3CC4N 4B1YB 2KN7A 1R89A 2FHJD 3FK4A 4P9SA 2DGVA 3UPQA 5JLHA 2LPEA 4H5TA 3V7LA 3MHYA 3R7NB 3SFGA 5ALKA 5CJ7A 1K8KB 1SKUB 3R27A 2UUBJ 4E1MA 2VWJA 1FFVA 1MWQA 3NF8A 2C3UA 4ED5A 2HQ3A 4YOTA 4K8RA 2G1HA 3UMBA 1WELA 5ETPA 4ILMA 3W66A 1AW0A 4B3TJ 3US5A 5AR0A 3B4DA 1TTHB 2D9OA 4G3IA 1ZQYA 4Y0FA 1UT5A 1CEZA 2YNGB 4M3TA 3CRXA 3DOLA 2R7TA 4W5TA 1RUSA 3D0IE 5E3AA 3GPAA 5HBMB 2CWKA 2XWXA 4I2PB 3JQJA 1JLFA 3KHYA 2DBYA 4DV2F 2VJ5A 5F8JA 1GMWA 3M8PB 2BCQA 1TVAA 1UETA 4NL5A 3I4PA 1B43A 2QL9B 4RZRA 2FGCA 5MLCV 2E8OA 3LVVA 3CO9A 3F9KA 1PJ7A 4QW9A 1F60B 1OPIA 1D8LA 2MQLA 2FF3B 3SJJA 2GEMA 1VIOA 3CTRA 4EIAA 3V4IA 2J0XA 1D09B 4Z2XA 2NLXA 5IOLA 4RNNA 3NDKA 2RQKA 3CCRS 3M3ZA 5F9NA 2GVZB 4ID8A 5AQMA 4OYIA 2OFHX 4OX7A 3C6UB 2DNOA 4CWBA 3OW2R 2RDIA 3CJQA 4LF6F 3R6GB 2Q6CA 3TP2A 3LWMA 3QWUA 4DX7A 3W2VA 2DGXA 4BWJA 4QWDA 2E2PA 4BR5A 2NPFA 1VBYA 2HFSA 4FWKA 4ZVPB 4Y2XA 3GG4A 3ID8A 4KFBB 5DLGA 3T1YJ 2WF8A 1BUPA 1H0HB 4OHXA 4JNEA 3EMTA 2R7OA 3NLCA 4WP3A 3O5TB 4PPXA 5HOOA 3VGVA 3VWSA 4GVBB 1RBUA 1N5WA 3P38A 3BBFA 5CD4H 2KSOA 3BPSP 4M45A 4I2DA 3CO0P 3EGWB 1RE1B 2ASLA 2CPXA 7ICEA 5B0GA 4NXZA 2BKNA 4WTYA 2XLIA 2MKSA 1SQFA 1PYOB 2H5JB 3GIRA 3EJMA 5ETMA 4DZ6A 3ITHA 4PWUA 4KHQA 3L95X 3M7VA 3AO5A 2JR5A 4QPTA 2F1FA 2IVYA 1Z26A 2R3VA 4I2GA 1XHZA 2K2PA 3VGLA 4DG1A 2GV9A 4HWIA 1F9EB 3TARA 3NS5A 2K8AA 1NGHA 3ALRA 5HQMA 2DH9A 1SPBP 2Z58B 2A2CA 3D0HE 1FE0A 1IKYA 3NF7A 1QVFM 3V72A 1WC5A 1HD0A 2RKIB 2XSJA 8ICCA 1O13A 2IVNA 4LBHA 1XUPO 2OM6A 1HNIA 1UVLA 3M2RB 1WI6A 2ZJ8A 3CF5L 4NB4A 4Z4HA 4Y6IA 3D2EB 3LALA 1Q82O 2DB1A 2DNHA 4BQZA 4FM1A 5J0WA 3CJSA 3NVWA 2GWKA 1ZA1B 2HVEA 1N32J 1Y00A 3BPDA 3BO3A 1FWKA 3W62A 1G1XA 2BPFA 1HNVA 4BJQA 2KKHA 1COOA 3RVCA 3OTOJ 4EHTA 2AYEA 4IFVA 4DCPB 2YNFA 2VGMA 1FJGK 4CLKA 5B7WA 3IG8A 2KT2A 4F3OA 5KT6A 4MYUA 2Q97A 2O8EB 1RHJB 1NK8A 3VQBA 1W97L 3DU5A 3OJSA 3VGTA 3ILLA 3L7UA 2CGKA 8AT1B 4FKYA 5AI8A 1CJKA 1Y7PA 1WKLA 2B8QA 2QIFA 3N6NA 3QEVA 3PEHA 2B5JB 3G71S 3NGIA 2XY6A 1FKPB 1ZM2A 2B4UA 1S1UB 4K2JA 4FWNA 3NOGA 1DLOA 3QUCA 4FLTA 3T1YK 1DJ0A 2XC9A 1K8AT 2DGQA 5GADP 3E58A 4PZNA 4UAVA 3G0ZA 3O9RA 4TU7A 2DRAA 1HIWA 1U24A 3DI6A 5CYQB 4DV7J 2XYHB 3T5LA 2FTRA 2CIMA 5KNIA 4BDPA 5K8PA 4XA5A 2ZFHA 1RTDB 4R64A 1LWEB 3GR1A 4MF2A 4RBUA 3BBBA 4NLQA 3L09A 4U67Q 3G2XA 2DHHA 1CG2A 1S5LU 4JI1K 2VUGA 1RAHB 5B0FA 4DV3J 4GKJK 1BPYA 3AL0B 2DTJA 4C8ZA 5K8MA 2DHAA 2ZBCA 4MO5A 4PHDA 4Y2QA 4IQWA 4CEOA 5J0SA 2C28A 8ICQA 2L9DA 4BR7A 1FJGF 1RDCA 4YMNA 1RT7B 1TL3A 1X6IA 5KFXA 1MN8A 1J27A 3CCLN 1NAQA 3OTBA 3O8MA 3V2UC 5AKEA 1BCOA 3THVA 3KG1A 5JVGQ 2QWRA 4MEYA 1GMWD 1RAAB 3HFZB 3MM8A 4BC5A 3TANA 3ZFVA 5HMLA 4ED6A 5AQPA 3NHGA 4B9SA 2ZKUA 5LY3A 4OX9K 3AU2A 1S79A 5KG6A 1KOOA 3N28A 4JI6K 4E7LA 3JXOA 2Y3YA 4JKFA 3K5MA 1CJKB 3AHPA 2WW8A 1S48A 2O8CB 1YQHA 5K5MA 1Q8LA 2LDIA 2UUCJ 5F0UA 2KHCA 2KJVA 3FSXA 1SXEA 3J7YI 1VDHA 4KX3A 1JROA 4JYAJ 2XO7A 4DLEA 1WC0A 3CFPA 1HR0K 4P52A 3O4QA 4H0TB 2JXJA 3BYRA 2W03A 3AARA 1YI2N 5JJBA 2QXLA 4FPIA 4DFJA 4RQ5A 4IH6A 3ULHA 5HVFA 3FFIB 2P9LB 1C0UA 2WVFA 2O4IA 3M6XA 1A5XA 2RF2B 1U1MA 5ETSA 4A8SA 1OY8A 3PACA 4ZKAA 5CP2A 3MM9B 4URSA 3TZWA 3KHLA 1QY7A 3L2RA 3GIKA 1SVDA 1OJ4A 3LP0A 3NGKA 2FLPA 3NXZA 1UZDA 2BV3A 5JXSA 3ULEA 4MEXA 3WZ0A 8ICNA 1KDNA 2NXJA 2AMCB 1EQ0A 5B0AA 2DGSA 3JYTA 3QAUA 2VBWA 2HNZB 3CJ9A 5AT1B 3MOJB 2GX8A 7ICIA 4DI6A 4DG1B 3UD4P 4EP4A 4FBUA 8ICYA 1IJJA 3OTDA 5BRFA 1M1HA 3KK3A 1NGEA 3QFHA 3CE8A 4M3UA 2Q4TA 2JVRA 2MSSA 3UD3P 3WK7A 3R3TA 3VF4A 1QQMA 4ES2A 1Q4RA 2W43A 2GQ2A 2O01C 4J9LA 1JLBA 4WFZA 4OJ1A 4ZVQB 2FZKB 1TE2A 1X4CA 3DRYA 3K89A 3QT8A 3NGSA 5TKYA 4OZLA 2UUTA 2RNEA 4UUWA 2EFPA 3DXSX 4N41A 3EYZA 2J4RA 2F8SA 3FCWA 3EUNA 4PHTX 4Z4GA 4KGVB 1CVJA 1WWHA 4IDKB 1QSLA 2ZJAA 4XDDA 2ZH4A 2W9CA 1QDUB 1FI4A 3M6UA 4RUCA 1HJOA 1O6XA 2IVFB 4F92B 1LQ9A 4DOCA 2B43A 2HQCA 2AIRB 4X65F 2MQMA 2Q79A 2LXIA 3E0FA 3G4SN 3QINA 3BKFA 5E0OA 5AJ3F 4PGXA 3TAFA 3EUB2 1ILYA 2WRMA 4NZ6A 2HMIB 3RMCA 3C7NA 3RTVA 5E3CA 1TGOA 3AVCA 3R5CA 1UPPA 4JYAK 1NM2A 2LYAA 3BEGB 4ZP7A 3VEZA 3DYAB 4O5FA 4Y2VA 1XSPA 2W3SA 3GIJA 1YJUA 4EAHD 3VC8A 2VKZG 1IKWB 4X4QA 1MN7A 4GXJA 5LSLA 4LSNB 4R5PA 5ALPA 3BR9A 3NAIA 3DLKB 4DOAA 2DR8A 3B82A 2BTFA 2ASJA 2CG8A 2E29A 2YQ1A 3HLUA 4Y2SA 1TKXB 1JLCA 1B9FA 3QBWA 1XNRJ 2WONB 3OA9A 4CF5A 4KO0A 1T11A 2XSFA 4JKGB 3SMVA 4U96A 1EKRA 3AVJA 1J97A 3T9ZA 2OSQA 1LKYA 2PSZA 4K41A 3TVZA 2CVIA 2LU2A 4FF4A 2DHGA 3BREA 2HHTA 4GY2B 2CQHA 5BRHA 5T7LA 3A5LC 1IWAA 2ZKTA 2P9PB 4PL8A 4TU8A 4LR8A 4KB1A 4LC9B 9ICMA 3MAAB 5L9XA 2G9OA 4XEIA 3V6HA 3N9UC 2RP5A 2ZIVB 4DR2F 3EPGA 4FO6A 2R2UA 1KNZA 4GV9A 2HK2A 1Q7YO 1S57A 3KLEB 9ICXA 1RXVA 1RT5A 2HB5A 5J2BA 3K9KA 5FPNA 1KD1T 1UVJA 4PQAA 1BO5O 4EWTA 1BPDA 2JH1A 3RWUA 4PXEA 1YZ6A 2QJ3A 5LL6Z 4FWOA 1JJCB 4I2AA 1VQKS 4FNIA 4CCHA 4FVMA 3OL7A 3M05A 1S6UA 3KNAA 4WKYA 2IVPA 3L6QA 1QHAA 2CQ0A 3WIUA 4DR4F 4DV1J 3BH6B 2DCLA 1FJGJ 2H65B 3KK7A 1U6BA 3CQXA 2WB1C 5AM2A 1YF5L 4I7FB 8ICLA 5DB8A 2M8HA 2A1RA 4FJKA 1DBDA 4YOWA 4AE5A 2HS0A 3DHXA 4MQ3A 4MFFA 5HO4A 4CFCA 1URRA 1VQ5N 3J7ZT 1HA1A 1FE4A 9ICHA 4O0NA 4GC7A 4DR5K 5K9FA 1OVQA 1FRIA 3LGNA 5IQ6A 4P0QA 2Y1JA 1I1GA 1VSEA 1UL3A 3JPQA 2FB0A 3FQKA 3QGHA 3VCDA 4OLAA 1PZNA 3JPNA 1TAMA 1KKHA 1BIUA 2MQQA 1I3AA 3D1OA 3KKAA 1S97A 3WX8A 3U1NA 3AOAA 3CSKA 5L1LA 1X4BA 3CJ5A 2PI4A 2NYHA 2FPKA 1FTRA 4A57A 5FIIA 4NCAA 2KHQA 3CCMN 4ZVSB 1FRHA 5AQQA 1UOCA 5J8YC 2ZD1B 1FRMA 5ETQA 1QUVA 2CQDA 4ED4A 3QIOA 1VOMA 4QWCA 4FBTA 1V9OA 3CCSS 2OP5A 1SIJA 2QTWA 2DR9A 4DUZJ 2FDNA 1U45A 1J9AA 2J76E 4FPBA 4IC9A 2D9PA 2DGTA 2W9BA 1WOOA 1GFWB 3ID6A 1Z4UA 2KT5A 4CLZA 5ALTA 4JI6J 4KO0B 5AZJB 3HHLA 3IAM9 4KMOB 3PFOA 1Q86O 4YY3J 2D0OA 1X9SA 2MDAA 3EZ5A 3FR0A 4MF8A 4KGXB 1NG9A 2YB1A 1T3NA 2DQNB 4IKAA 1NK9A 3GV8B 1UJ5A 1XN9A 3U1LA 1SJ4P 2FSNA 4EO8A 2E3TA 3BH7B 3V1RA 2FLLA 1S6PB 3N4QA 1B0PA 5LMUJ 1N56A 3VENA 3O9TA 5ETNA 2OYQA 1F5CA 1TFRA 3CULA 3DRRA 1CZAN 4K4GA 1AUSL 2GIRA 1Z00B 3E3XA 1JL2A 3D9BA 3RJJA 3HHKA 2ODGA 1HQEA 2VWBA 5AQWA 4BG8A 3U26A 1HHQA 5AKIA 3KLEA 5A0YA 4NXMF 1SKSA 3J81O 2AP1A 3MDCA 2L5YA 4Q8EA 4AUKA 3OL8A 2HG4A 4I2EA 1VK0A 4NXNK 2IMWP 4K4VA 5KFDA 3J80U 4R25A 3BQ1A 4C97A 3IS9B 2G5HB 2QLXA 4BRAA 1UT8A 1D3WA 4Q43A 4PZOA 4JI2F 2JZBA 4V19S 4KJIA 1Q18A 4YMOA 4QZFA 2F3JA 3SK3A 3ZTPA 5IWAJ 3V81B 1Z19A 1PUZA 1IIPA 1QH9A 3KLIA 4CO4A 1C0TA 1Z25A 4M63C 3SMSA 1FD8A 2A3ZA 1RA6A 2FJXA 4OGEA 2DKOB 1VQ4S 3HSCA 5J8YA 2E8AA 1V3SA 5KFNA 1R6VA 3P4IA 4ANDA 4CD3A 3D3BJ 3WU2U 5AIBA 3CCSN 5HRPA 1ZBHA 1KVBA 3CDEA 1K9MT 1CJUA 2XMWA 3A2FA 3KLGB 1XERA 4ZJQA 5DBAA 2UUBK 3TFSA 1BA1A 2VFRA 4U6PA 1A5VA 5SUHA 3IGNA 5AFUA 4M63A 3BQ0A 4KI6A 1JXVA 3BS5B 1TELA 2Y0SD 2R7UA 4KV8B 4PXDA 4WZMA 2W2OP 2X1FA 3FCHA 8ICIA 2R18A 4HUGA 4RJVA 4CHNA 2OLWA 5FRMA 3CW2C 2KP7A 1VAZA 4EYIB 3PSPA 4OYOA 1XMQK 2XLJA 2AEJA 2OEJA 2KFYA 3CCTA 4DV4F 4NL9A 3GJRB 4A8MP 5LM7E 4ERDA 2R9LA 1C0UB 4YDUC 4UB2A 3OYEA 2VIXA 4DR6K 4F4WA 3L8BA 2A3VA 1I94K 4KTZA 3HFVA 3JPSA 3HVTA 4G1IA 4P74A 3SUQA 4WXWA 5AKKA 3U4LA 1N5XA 3ZEUB 1TYQB 2XMMA 2A5XA 5ALZA 5IWAF 2GZOA 3H3OB 2KXNB 1MMLA 4NM1A 3VZIA 2Q1LA 4NLRA 1LK5A 4DV0K 3FBEA 3J7Z5 4LFAK 5AK6A 4QZHA 1DTQA 2E9ZA 2P9IA 3HOTA 4TU9A 5ETRA 1OH7A 2Z4PA 2H54B 2ZTEA 2ZHBA 1JJHA 4NXNJ 1JQGA 3IGVA 3AY9A 4U8YA 2QXFA 1VBXA 2VQFK 4WU3A 1K8AO 4B02A 3OLAA 1RGIA 4ECUA 1YZ7A 3KMSA 1RTHA 3GFYA 4P0QB 1KLMB 1JCEA 2OANA 4RWXA 2EH9A 4BQLA 2F1HA 5ALWA 2GWSA 4NOHA 3V1OA 2D69A 4DR7K 1TKTA 2PC6A 1OY9A 4K8XA 4Y2MA 1LKZA 1L3VA 4W5OA 1HJPA 3AXKA 4BG9A 4UQTA 9ICLA 1ZM9A 3D4JA 3CGIA 4DV4K 1EAYC 3HI0A 1ZQTA 5LOQA 2P5VA 3VAKA 4JHDA 3M5RA 4BY9C 4Q5VA 4LT6A 2DJWA 5ALDA 5AFUH 4M5LA 3J81Y 2YKMA 2FPHX 1R3NA 3PO4A 4DSLA 3BGLA 3C65A 2UUAK 1MC8A 4H54A 2OZMA 3QUTA 5F41A 5E3RA 2KFNA 4JRPA 1FW6A 2PI5A 2VJVA 3HHLD 2MZ1A 2BJ7A 3JB9k 3M2VB 2VQEK 4ZOSA 3DLGB 3SNNA 1FKPA 5TKWA 5I3PA 3PW0A 3OW2M 2AU0A 2K7JA 4U7UK 2UXDJ 3H6EA 4M7YA 2EZYA 1RYUA 2NUUG 1P8ZA 8ICGA 1XTZA 1V6HA 4DV3K 4UY85 4M5IA 3CI5A 1DRZA 2DNLA 2YY6A 5GAEU 3Q8MA 3ENWA 3H2UB 1NGBA 1TK0A 2YV0X 4B1WB 3AAPA 2OD6A 3OTOK 1NDPA 4IQTA 1A9NB 4DQSA 2BBEA 3PEJA 3MEKA 1MNEA 4JS5A 1HNVB 4DTXA 4Q2LA 4B3SJ 2F4VJ 5BR8F 3I33A 3ZI4A 4CEZA 5HROB 3FDSA 2P9CA 9ICQA 1RK8A 4B3SF 2Z1JA 2GCFA 4UZCA 3CCRN 3HF5A 1FKOB 1HMVB 4CO0A 2CJQA 3GQCA 1IBKJ 3SV3A 1SB3C 3AO4A 2YX8A 1NMNA 2E8NA 3R9PA 1QQ7A 2ZC3A 4RQ6A 2O67A 2NS1B 1UAWA 5AI6A 2F1IA 3MGJA 2EWSA 2GO8A 1NMEB 1UJ6A 1BVSA 2GO9A 3QUBA 1OKJA 1YVNA 1ZQDA 3EXCX 3MR2A 2C1EB 3AA8A 2E6LA 2ZBIA 4KHUA 4C0ZA 4BXOA 7AT1B 3SQGB 2LA6A 1ATNA 5GTIU 1R7IA 4LMZA 3ZSZA 2N1RA 3PJ9A 2UVVA 4ZVFA 2KVSA 4KI4A 3ISNC 1U49A 2GFFA 4B6JA 3AGKA 2DYAA 3CPEA 4NLKA 5AI0A 1F5BA 1VQ7N 1OVYA 3MPVA 1QQNA 1QE1B 3KNGA 1FIQA 4H0PA 1T94A 2BE2B 1LW0B 2X6SA 2ZHOA 2W2QP 2QE5A 1FX2A 2QB1A 3I87A 3UB5A 2H51B 1KHWA 3H7HB 3UN2A 1NSPA 4H0YB 4CNZA 5IS2A 4JKEA 3GWCA 3ZT4A 3HHNB 1T6CA 1LAVA 1EP4A 1RBAA 2PFUA 1SCJB 4JK7A 1NNEA 2E7VA 3K0SA 1X4HA 4USWA 4CJ7A 3O2IA 4K2XA 1S0NA 1Q8IA 1FHTA 3R8YA 2HHHF 5JRTA 2CG4A 2AEMA 4MK8A 3HHLC 2UXBJ 5GINA 2D5RA 3MECB 1CBKA 4AHSA 1TL7B 3OUYB 3OY9A 3IFRA 2V2KA 5KAFU 4QWEA 3OFFA 3SCLE 2J0WA 4CEFA 4ZCIA 1D5AA 4E8UA 4NY8A 7ICPA 4CH7A 4USKA 4IR1A 1U1LA 2QA4G 2RKIA 1N0VC 1PVPA 4UOCA 4NV0A 3TA1A 2YX1A 2UUAJ 3LW5C 4JKDA 3ZNUA 1XNRK 1RABB 1VQNN 1LWCB 4DV2J 4JI5K 4C6AA 4JV5F 3C14A 1UMJA 2QWQA 2M0NA 2BZFA 3NBPB 4ZPCA 1XNQK 5KTQA 3AOBA 3TTCA 1CULA 2HURA 1UQVA 1IQTA 4WFXA 2NXEA 2DO0A 1X5SA 2VWKA 5H1SV 4Z6FA 4HHUA 2GMJA 1WKKA 1CZBA 3PSFA 2E5GA 3VQQA 3IXQA 3M6GA 4CF9A 4BE0A 4E7HA 2L48A 2O66A 4QCLA 1F0XA 3O3LA 2WB1F 1WAFA 3MWPA 3K9JA 4BE2A 1HNZJ 4C23A 3HILA 3ZZUA 1L7OA 2DH7A 3NASA 2XHBA 4FZNA 3A3OB 1REGX 3T19A 4WXOA 4Z37A 4ZCMA 2XZWA 3DC2A 3Q86A 1UWBA 2VKRA 4KRFA 1DGSA 1XWLA 1REVA 4LRAA 2J0QD 5D4OA 4ED1A 4QIGA 3B9JA 4ZA1A 3WBZA 4DV6F 3QNWB 2ZTCA 1RAOA 2YNHA 3D67A 3M2RA 5AIAA 4A8QA 3KKRA 3DXMB 4DCJB 2ZH9A 1HBUA 2XTJP 2MUTB 2PN6A 2QMXA 3TNVA 3RW7A 4DSKA 1T02A 3OYNA 1GO3F 2M3DA 4DV3F 1EQMA 3I28A 2FMQA 2VODA 4ECTA 3U6FA 3POTB 5HQ8A 2ZG6A 1U2RA 1GT8A 5KRTA 3O4WA 2QFJA 6FD1A 3DXKA 3BDEA 3KZXA 4A8WA 2YTUA 4DR5F 1OW5A 2DGUA 1RZTA 2EHGA 3L2QA 3N01A 4AM6A 3SQ2A 1CXQA 5I3UA 4R79A 4P72A 2KJ5A 2CPEA 7ICQA 2BUPA 3R3LA 3QFPA 1WOQA 1XC3A 1QQ5A 3IR7B 2UXCJ 4CF4A 4I2QA 2ZIUB 1B0XA 1U1NA 3D45A 4DR7J 5CCMA 1AZSA 5CYQA 3CC2S 2LXUA 1JWWA 4DCHA 3M6WA 4FJGA 2P51A 4LSLB 2GMHA 4OL8A 5B0CA 4CK1A 3Q7BA 5BPCA 2FVCA 3CM6A 5HI7A 2FJVA 4MLEA 5BN9A 2P6UA 1KWMA 1LEOA 2WC9A 2YHYA 1Z4OA 3W2WB 5D78A 1X42A 3FYHA 4FL9A 4ED7A 4I69A 4B3MK 1NJWA 2B3TB 3V7JA 4B9QA 2OPRA 2A1JB 2WAQC 4J9SA 1K5OA 2JL9A 3DGPB 2KVIA 2F40A 2ZJPL 2W7PA 5BYQA 4FLWA 4ZPTR 2OEHA 3ISBA 2Y1IA 1WD6A 4M5HA 4OZ2A 4J9KA 1KQGB 5KQ8A 1YHQS 1NKBA 3HSJA 4J5OA 4EX6A 4KGKA 2PGCA 1B92A 2FIUA 4BHQA 2RVJA 1ZQSA 4C8YA 1NKCA 1TZ0A 2YWFA 2P9SA 2BW2A 3CC2N 4HKQA 2XB2D 3WKCA 4EBDA 4NXMK 3C66A 5G0RB 3RRGA 3ISZA 5FP0A 2OELA 2XNRA 2EG2A 5AQLA 4DPYA 1IKVB 2V50A 4K43A 2VPXB 3ONNA 2G2ZA 3PSTA 2RSQA 2ES6A 2ILZA 3UD5A 5AKJA 2F8HA 5CA5A 1X31C 3VQ9A 4Y3CA 3K5NA 1BPZA 4OIXA 1ZC6A 3C23A 2OPQA 2LM1A 2K1RA 1RHQB 4RNFA 4AHCA 1YGYA 4X4VA 4UW2A 5AKYA 1N5QA 3MN7A 4DUZK 2ROGA 5IT0A 4B1XB 4B9MA 3SBGA 4RW6A 2A1SA 4EYHB 3ZXWA 4CBUA 3IA0A 2OTLS 2Z2LA 5D4PA 5LXYA 1U1KA 2FVPA 2CJKA 3G82A 3DKDA 2X78A 3HP6A 4W4MA 3SQ1A 1BGXT 3RUBL 3SSSA 2LEPA 4DN0A 3WKAA 2Z56B 3RJFA 1DQAA 3RBZA 2KM8B 4OX9F 3NF9A 3QNOA 4A59A 1QZ5A 1N36F 4TUQA 2EEYA 2XRIA 2CXYA 4OV1A 1JMSA 4F26A 1WC1A 4OI3A 5ELZA 5KFEA 5E7OB 2ZUGA 1XMOK 1ZTWA 4CK3A 1Q79A 3IBCB 1NGGA 4GKKJ 3H8JA 3K1ZA 1VQ6S 3ZX2A 2VPYB 3I1YA 1KBRA 1K73O 4P71A 2MJNA 1RU1A 4CJPA 4PHPA 4DV1K 3HOSA 2WHEA 4FZXC 3FGUA 2KNJA 4RNMA 1RDAA 2MLXA 2NRRA 1E3MA 3U9ZA 4DTSA 2O8EA 2XI3A 4DFKA 3PYEA 4DSEA 1YUWA 4RUBA 3THWA 1RAJA 2EQYA 5ALNA 4ETZA 3OBYA 3AD9C 2IOHA 3H2VE 5B0BA 4MFBB 4BGBA 1UTAA 2OEKA 3BZQA 1Y3JA 4NA2A 1SS6A 8ICRA 4J9VA 4AYBC 5CHGA 4LR7A 2VQFJ 1Y11A 1BDGA 1YWXA 3CJ1A 4NLNA 3G6XA 4ETXA 3MM7A 1B7YB 4NL9C 4OJOA 2WONA 1SUQB 1HKCA 3C2KA 2YVSA 1Q5VA 4JWNA 3AVGA 4M1KA 5DB7A 1GLFO 2HKEA 4Q45A 4MIWA 3T41A 4FZLA 2CGLA 3SCIE 1NI3A 3MGHA 1P8GA 1NNLA 5DDRC 5I4MA 3TAPA 1UEVA 3CJ2A 1DT9A 3A8EA 2EC0A 1ZQQA 4P4MA 1QLNA 5DG8A 2YKPA 1QQCA 1GLEG 3H4DA 5FLXY 2RUSA 4FZYA 2O8CA 1CC8A 1YJWN 3SQIA 1FDAA 5H2FU 2UXDF 3JQMA 2FPMA 2CNLB 2HF4A 4CP5A 3MMBA 1VQMN 4WFAL 1U8WA 2D74B 4OI2A 2HW3A 1U2VB 4JI8K 1VSDA 1ZBSA 4G9BA 4HVJA 4YUDA 1VRTB 3FUYA 5HMZA 3QEXA 4ICLB 4PA1A 2P9EA 5EWEA 2HAFA 2C2ZB 3NGTA 1LW2B 2QB0B 1APSA 2Q2RA 3SAFA 1N5TA 4PG6A 4WBFA 5LMUK 1C2PA 3NTUA 1WORA 4ZVHA 2F5GA 4JWMA 4YOVA 3SJHA 4XUSA 4X66J 1M5KC 3CEDA 2C2NA 4KKOA 1BNOA 2VQEF 3OPXA 1VJ5A 1RKIA 3VA3A 2ALZA 3P5BP 5M2UA 3VEYA 1ZBUA 1BY9A 1KKXA 2KI2A 4O5CA 3M8QB 1S22A 1OQ6A 2KMDA 2QA4S 4DN9A 5AHXA 3W63A 2XCAA 1NCLA 1JKHA 1J5OB 3OHAA 2OHFA 2KICA 4A46A 2YKNA 3U8XA 1XS9D 2HS4A 1S12A 2CZ4A 3H46O 2EX3A 3GONA 4B08A 1RBVA 1OYEA 4X62F 2V9WA 4KLDA 2YKMB 1HW9A 3VAGA 4ZCKA 2FF6A 3ZT2A 4GKKK 1FD2A 1LK7A 1Q8KA 5ALUA 3J8AA 5DLFA 2G08A 2W24A 3CDUA 1C20A 2E5IA 2CKWA 4DUZF 2UU9F 4DTJA 2DY4A 3R5GA 2M5YA 3C8YA 5H9EJ 2NRHA 4C4SA 4JI4F 5FD1A 2NRZA 5EN1A 1VQON 1VSHA 3A0BU 1PILA 3PLAA 1R59O 2OUGA 2Y1RI 4ANEA 1VMBA 3KJQB 3JSBA 1U6FA 2ZC4A 4KHPK 2AGOA 3JAMU 2M9KA 4ILHA 2K4EA 2BRKA 4B9VA 4ZPBA 3AA3A 1XNQF 4WF9Q 3MTKA 1S6QB 1GMVA 1NDLA 4DR1F 3B8AX 4J7CA 3QO9A 2PZSA 2HNYB 5C2FA 2C3PA 2P1JA 3HX0A 2DTUA 1KAZA 1UA1A 3SUNA 4BRIA 1MQ3A 1FVQA 1S9EB 2R7QA 4F0HA 4F72A 3ASMA 3NG8A 3T3FA 3JSRA 3CMEN 1TAQA 2FVRA 4JD2B 4UF4A 4DFDA 3NNCA 3W2VB 3D2EA 3MMBB 5A0YB 3LH2S 1X60A 4PG4A 3PX4A 2MKIA 1J2VA 3C6UA 2W01A 1WUAA 4PG7A 3A5MC 4KLFA 1LV5A 4HLBA 3DI6B 3CCJS 1XHXA 3BSAA 1S6PA 3ETLA 3M30B 3HSTB 2FDRA 4ID5A 3CJ8A 4M3ZA 1IKVA 1ZQIA 3I76A 5LMNF 4FF3A 4ZK7M 3UCUP 5HVHA 4KLIA 4I1TA 3CCES 2OCEA 3BKUA 4Z4CA 1MDUB 4X66F 4F25A 5LT5A 3NRZA 2R8GA 3JSMB 3BUZB 4CJFA 5AM4A 4F71A 2HHHK 4KR0B 4CJWA 4M04A 4NPOA 4JI5J 3IBFB 5JVHQ 1EETA 2GAGC 4B1UB 3GV7B 2DH8A 4M5NA 3SBMA 3AUOA 2F8KA 2D8CA 2QLJB 2YNGA 2PFFB 3F5TA 2W25A 5U47A 5KOXA 4CI6A 5L1JA 5SZTA 5DG9A 1FVSA 3VV2B 2KO1A 4M9JA 1FESA 2LVWA 2FC0A 1ZQUA 2B6AA 3R97A 4GXIA 2H48B 2V7YA 4QZGA 3CETA 1ULRA 4ED0A 1CJTB 4WK1A 2Y8YA 2PYLA 4FK4A 2YHAA 3CNQP 3OYGA 1X5PA 1WSHA 2YKAA 3RR8A 4LVOP 3AVFA 4KITB 1FFSB 3O0FA 4AQYJ 3ILJA 1ZQCA 1JN3A 4KV8A 2DNPA 4RBTA 1ZAXA 3PKYA 3TAMB 2EFVA 4PR6A 4C3KA 3DMJA 3MX5A 3M8ZA 4EZ6A 1TMJA 1IXRA 5DGAA 2YWGA 3K2YA 1GXTA 2OXOA 1KVKA 4DUTA 2MQ8A 3V7KA 3AAWB 3N4WA 3TR8A 3CYMA 1HQUA 2WF6A 1NXIA 1CJVB 4UB4A 1QAYA 4YN3B 4PG8A 3IMQJ 1OO0B 1FFUA 2ZIWB 2CJ9A 2JEGA 5HRSA 3E9LA 3IM1A 1KS2A 4DV7K 3MAQA 1NZBA 2WF7A 3PM9A 4ACOA 4FFDA 4M9HA 2J9DA 4OYPA 3MUVP 3G96A 4DQRA 4DTUA 3O80A 4X65J 9ICUA 3SAHA 3B6OA 5KFUA 2EZXA 3G8SA 1Q81O 4BDZA 2HK3A 3THXA 1T9XA 5ALHA 4RKUC 4B3RF 5ALSA 2F8MA 1BL3A 1BWVA 2AJ1A 4FLZA 2FJDB 4PL2A 1I6JA 3GIMA 5D0GA 5DBBA 4CZEA 2H3EB 1KR4A 3BB5A 9ICVA 3HKZD 4AHTA 2RS2A 5J0YA 5J2JA 3TSPA 2YWWA 5HP4A 2UVRA 3KK2B 1HX1A 3CCVS 4DX5A 2HFOA 4CNYA 2GH1A 1F3FA 4CGIA 2HOEA 4E7KA 5KFVA 3WQTA 3G4SS 2PBDA 3T9NA 3FJ2A 3LZIA 4E1NA 5KFZA 3LPYA 2NRWA 3QXGA 3UN5A 4EEYA 2HVDA 4OGCA 3TWHA 5KFQA 4QR1A 3FZKA 3QU2A 4R65A 3C29A 3MMCA 2G8WA 1FO1A 2UXDK 1QVGR 2KJWA 2AHOB 3RB0A 2SXLA 1KOHA 3K8WA 2JWKA 8ICUA 3SQ4A 3EEQA 2IM3A 3OFEA 4WQ4A 5AQSA 3ZZ0A 3CP8A 2CNKB 3CCMS 3SLCA 1H2TZ 2COLA 3AU6A 2V67A 2VFSA 4CE6A 2A42A 4H5VA 2GELA 3RH5A 5IC4B 3RMAA 4GMJB 2YKNB 2J7UA 5CB1A 4DF8A 5DS7A 1JMTA 4HEA9 3UNGC 5GADU 5DDMA 1N52B 4FYVB 3PIPL 4YMEA 3L7PA 4K50A 5KI6A 3MECA 4CGHA 3ZETA 3MMAB 4B17A 1TL1B 2BDUA 3H1VX 2F9WA 3ZSXA 1PC5A 1T95A 3FKBA 4UQGA 1T9TA 3D1QA 1XC9A 1ELOA 4QIVA 2OWOA 1LWFA 3KLGA 1OIAA 2QARB 3HFKA 3ZTQA 4K4UA 8ICOA 5IT9O 2AX1A 2CZVC 2MAXA 4X64K 5EHHA 4IO8A 2V6AA 1NWKA 5RUBA 5C42A 1SXLA 2XBPA 4JRQA 1YJ9S 4ELUA 2ZH2A 3W65A 2V69A 4G6VB 2K89A 3PX0A 3S9HA 5CYMB 1DQ8A 3GBTA 5AM3A 3MUMP 1JLAA 1URJA 4GKKF 4IUFA 4F02A 2MEWA 2VA3A 1UA0A 4XAKA 4CBWA 4NYOA 5J2DA 2HCFA 3OFHA 3IO1A 1HQ2A 2VG6A 1SAZA 3Q8QB 4EBCA 1ZQBA 4YEAA 2V2VA 3JYTB 2C42A 2KQ2A 2IIHA 4BRHA 1PK3A 2VU5A 3U3YA 2ZH8A 3PVXA 1N33F 2GQQA 4DFMA 3WX4A 1SXDA 4Y2KA 1WG8A 2W04A 3HPGA 1BLUA 1P7DA 3THYB 3MM6B 4H4OB 4GLXA 1VBZA 4CYUB 1FKAF 3EVMA 1N62A 3IP4B 2W55A 2Q3SA 2WAQF 4OI0A 2MHEA 4DR1K 1RILA 1E6VA 2XULA 1QHTA 3DLLL 2J6UA 4PABA 4UB8U 2DY9A 4KH0B 3NGUA 4CF0A 3P8BB 3NBPA 3TJ9A 4R5PB 2CPZA 1GH8A 4FJLA 2YWKA 4JKCA 3ZX0A 2D6FC 3PNIA 2LKZA 3QZ7A 4X64F 8ICAA 3KJNB 5AJ3K 1RXWA 3FC4A 3CPWM 3BR8A 4BDYA 3CB4A 4PL7A 2U2FA 4O55A 4RPFA 5KFTA 2FJEB 1RWWB 5GADI 3AQOA 5LJ3Y 2B6GA 1NK4A 1EQYA 4FXWA 4RQ7A 1SBRA 4FZVA 1JLQB 2G1DA 1TL7A 4IG3A 2RPIA 4Z0UA 1NNDA 3NF6A 1ZQGA 3VEOA 2E5HA 2RS8A 4CGZA 2WVBA 2I7NA 4LFCF 1U4BA 3AJ1A 2FBXA 4FLUA 2KB2A 1T9YA 4OV6A 3KLVA 1HJRA 4CJLA 2RQCA 1J54A 3VAJA 5IWAK 4OI4A 2FBVA 4F5PA 5K8OA 2BANB 1IV8A 3I0RA 5JS2A 3KDOA 3S6JA 4IOBA 4B9NA 1XMOJ 4LFAF 3OJUA 1SUQA 4ISEA 1T9UA 4NLUA 3CJCA 2R8HA 1TVRB 3JQKA 1YK9A 4C0BA 1NO8A 5C0YA 4KE5A 3CDAA 2HQDA 4JEPA 2IAJB 9ICRA 3C21A 2ZBRA 4DR3F 2K3KA 4EFHA 4J9RA 4IFYB 1RTIB 2V4QA 5KL8B 5E33A 2MKKA 4DTMA 1WEXA 3MFHA 3T5KA 2Z1IA 2EBGA 2MRLA 3VQEA 1VQ6N 2KFZA 4FWRA 1VRQC 1B7FA 3RJGA 3SSQA 2ZF5O 2DNKA 1I3OB 4H5NA 4FN5A 3VGUA 4QPXA 4CJQA 3HJFA 2F1JA 2OIHA 3W8GA 2UVWA 1DLOB 3LANA 3PX6A 2B4PA 1OS5A 4O3OA 2G5IB 2VFTA 2UP1A 3WDOA 1ATSA 3D66A 3OR2B 2F9JA 9ICEA 1F6TA 4BCAA 3AMZA 5J0OA 4P4OA 4WCEL 3RSEB 3KKAC 1TKZA 4IS7A 4BRKA 1RNHA 3CD5A 1OSDA 4OVLA 3D7SB 2LHTA 4IJAA 3GR0A 3GE9A 4F5NA 1FO4A 1F9HA 1G99A 4JYAF 3OHBA 1NZPA 3M9NB 2N4DA 1JLEB 2M8DB 4RQ0A 4IOXA 4HT7A 4GV6A 2A19A 1SIWB 3UKRA 1S49A 4OPKA 1PG5B 3MEEB 4HTLA 1WSRA 4JKGA 4CI0B 3KWIA 3ONQA 1HNXK 4F36A 3QNMA 2BPCA 3NVVA 3L5KA 2W4DA 2FVSA 4MJKA 1GOAA 5K14A 4QZBA 4WU2A 2IS3A 1HNIB 4OYXA 1Q78A 3EVWA 1NBWA 4BRFA 3MM6A 4OD0A 2XMTA 2I9SA 3GCWP 3ZTOA 2UXBK 1VC0A 2P2CB 3AQEA 1D8BA 3GL1A 3NMUA 1A0OB 1WG4A 1YJNS 2IOCA 1RTJB 2ZE2B 3MX2A 4RL1A 2O3DA 4NCGB 4QIEA 5BPLA 4CFDA 1BQMA 4OHVA 3G71N 2IM2A 2KIWA 2BZ2A 1H72C 3GTYX 3TRGA 2NCKL 3BV8A 4UBCA 1FRJA 1TV6B 2VV5A 1KXPA 3VEVA 2LI6A 1O8BA 3EGNA 3D2SA 2YHBA 5EX0A 5IM0A 1YBUA 2ZJRL 4B3OB 4TYBA 3UXOA 2ZJPQ 1VLOA 4KY3A 1MMNA 2HNYA 2WOMA 4CHZA 3TUZC 1HYVA 5HMYA 3ALYA 3VPZA 2JOQA 4P4PA 3MGVA 4JI0F 3TR5A 1YTAA 2LCWA 2DPNA 5AKXA 4DV5J 3NCPA 4BR9A 2WCXA 1N63A 1GMUA 3CCEN 1YJRA 4PKGA 2HSZA 4RQ8A 5KRSA 4G1QB 3TYTA 4CDIA 3G9CA 2GJFA 5DK5A 3QU7A 1X3MA 4QZDA 1AYEA 5DGBA 5LSOA 2G4BA 5CWRA 4DLGA 2P5OA 2P9PA 1ZBFA 4EX7A 4YB6A 3AEVA 3C15A 1HIYA 2DRBA 3O4NA 1I39A 1VC5A 2XMUA 2NR0A 1Y88A 4NXNF 5C2CA 3BJYA 3AM9A 1LFWA 4JK9A 1RP5A 2OGUA 1NJIT 3NVKA 3AV9A 3I32A 2DFFA 4MFBA 1Q1KA 4OYWA 7ICSA 2XY8A 2DBBA 4AL6A 2WZ1A 4KIAA 2F2AB 3ISCA 4IEIA 2ZIUA 1DGKN 3MCAB 3QT6A 2JEJA 1IG9A 2HDOA 1OWXA 1A76A 3Q8KA 3WNHA 2AJQA 4K8ZA 3X3UA 2AQ0A 2OPPA 3MF5A 4W98A 3J80O 3QQCD 2UU9J 1YT3A 2XVTA 2W42A 2H3GX 4HVZA 3D6HB 1ZM3A 2RHFA 3FFIA 2MB0B 4CHPA 5IXUA 4USVA 5KT7A 1HWUA 3SPZA 2WF5A 4YCXA 1M6YA 1RHKB 3IWXA 2NYVA 4OJHA 1U04A 1X4DA 3MCPA 4M9NA 1M90T 1KVIA 1UEUA 4ED3A 3NH1A 1VR6A 1BI4A 3VZHA 3TTFA 4RUAA 3L4QA 1FRXA 4QJFB 2NZCA 3C46A 2QWNA 3HSDA 5J2HA 5AM5A 2ZWOA 4L3NA 2QN6B 3FE1A 3Q8RB 4JKHA 3CIPA 4LF7K 4XTTA 2YX4A 2ZM6J 4BC4A 5LXRA 2YNIB 1Z1ZA 2LYHA 2A1BA 3LGHA 3MPUB 4NLPA 4BREA 2EAOA 1WACA 1R0BG 3THYA 2YWEA 5J2CA 2XEXA 3PIOQ 4KRWA 4WIQA 4PH5A 4KH5A 3BY5A 3EZUA 3TUJC 4Q8FA 1ZAVA 3CJTA 2PXIA 4Y2RA 3VQ6A 1QJHA 1S5ZA 4J37A 3DRXA 4FW2A 3WXJA 2C3MA 1L3UA 3TQ1A 3NGZA 2P6RA 4JV0A 4LF5F 2Q0ZX 3FLCO 1HKAA 1HQUB 7ICKA 3HP9A 5AICA 3OYLA 4GRSA 1I94F 3HJEA 1KL9A 4OHZA 2P8IA 2N3LA 1NMDA 5BPMA 1RXOB 2DEJA 1Z2LA 2ACYA 4QWAA 4BXOB 3HJVA 1GTEA 1UEKA 3EN9A 4RNOA 4BUGA 3MABA 1YTUA 4UB6U 1C4AA 2PD1A 2W2MP 2YQEA 4XH4A 2VFVA 4WYBA 5C42B 2KE7A 4WKRA 4X66K 1N48A 3C6HA 3BM7A 4BROA 5C25A 4LF4J 3DOKA 2F7VA 1U09A 2MPUA 4RUHA 4ECWA 1SIZA 4Y34A 3E9PA 1YRTA 1KHVA 1X4GA 3OBIA 5M1NA 4OZ3A 3HBTA 2H3QA 4G1QA 4E7IA 3VESA 3NNAA 2YH1A 3C0BA 4X62J 2E8MA 3L3FX 1UCNA 4ZVGA 1U48A 3CCUS 1NU0A 4M3RA 1M5PC 2EK1A 4PWDA 1N36J 3CJ4A 4KGZB 4LREA 4FJXA 4P75A 2ZJRQ 1XI1A 4J2BA 1T03A 3SDEA 2LXFA 5E3QA 1W0HA 2E5LJ 3C19A 3KOAA 2KVCA 3PW7A 4GVMA 4PKIA 1OY6A 4NYNA 2VPWB 1FXDA 2A18A 3P3DA 4F04B 1FNXH 4DOBA 1X0PA 1TMMA 2F63A 1P9YA 4UB1A 4BC9A 5HRNA 2HVZA 1SZPA 1ICEB 4M0AA 5LSRA 3MGIA 1HPMA 4IG0B 3POTA 2CUYA 4ZMMA 5CD4A 3L4PA 1TUUA 5L8RC 2KDOA 4KBOA 3GB0A 2D3UA 2W54A 7FD1A 1WB9A 3F2BA 1S72S 3O1WA 5C2GA 3GG1A 4WQ5A 1VRUB 3B6BA 2MA1A 1WOPA 2V8PA 2L9WA 4I6MA 1Q8BA 4C3MA 2A0FB 4CGDA 1REVB 2LU1A 4Z7CA 2B9YA 5IC6B 5KPZA 2Z1GA 3VALA 3P1GA 1WF0A 2QL5B 2HSEB 1HUXA 3V1QA 4ZPVR 2HHWA 3LDQA 3M8WA 2IHR1 2HLUA 3W5YA 1F3VA 3SI6A 4NWBA 1IJFB 2I5HA 4NLDA 2C2DA 1BHLA 2JMGA 4YOEA 4HTUA 1O08A 1X66A 3KK1B 1FXLA 3K5OA 4PXCA 1VQMS 1A6LA 4DZDA 2KJ9A 3DCAA 4Y0WA 3ZSWA 2RQ4A 1FEHA 1C1BA 4YY3F 3SMZA 4JI3J 4QYRA 2H5IB 3DLKA 3MMJA 1RJJA 1PVRA 4CLYA 1D9FA 4Y2IA 4ECZA 3GSIA 2ZTDA 1NGDA 3THWB 1EXNA 5K4LA 3U7JA 4WPAA 7ICNA 3CCWA 2FBYA 2OYYA 4R63A 3TAMA 5ALVA 4IDHA 5T41A 2ZJQL 1ZQAA 2WF9A 1T05A 4KHMA 2D1CA 3M6KA 4DPUA 1NH8A 2OZSA 1RTIA 2J7WA 4OYBA 5HR7A 2DGWA 4F2RA 4FLXA 4RU2A 4B3RK 3NVYA 3NCQA 2PFOA 3MMCB 4PCQA 1ACMB 1WHWA