2HHVA

T:o6-methyl-guanine in the polymerase-2 basepair position
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*TP*G)-3'
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhvA01
3DLRA 4R65A 3ZDAA 1ZQJA 3ZT4A 3GV5B 4QZEA 3F73A 4FK4A 5KFEA 2BPGA 4CCHA 1COOA 2IMWP 4UB4A 3KK3A 4YG2A 2NRXA 1K1SA 3C5GA 5KFJA 2IC3A 4OPJA 3NF6A 1G15A 4QW8A 3OYDA 5CY4A 3JPQA 3RJIA 2W8KA 3RH4A 4QZGA 3K58A 2P66A 2XGQA 4W5OA 4LH5A 2PFNA 4HVJA 4IQUA 3IM1A 3V7JA 4KHWA 2V4RA 5KG1A 4Z6EA 2KTQA 5HHIA 4BDZA 3SZ2A 3LWLA 3TAFA 1DLOA 3PX4A 4KN7A 1LB2B 4KO0A 1EX4A 3VQ4A 2VANA 3RB4A 4J2BA 3EPGA 1C6VA 1KLMA 1D9DA 4I2GA 2KN7A 3MFHA 1C1CA 3PUFA 4RPXA 1BQMA 1U48A 1L3UA 3V4IA 1SZPA 1RBVA 4Q0BA 4PQUA 5KT2A 1ZQEA 2VG5A 4DWIA 4KLHA 1N5YA 5DG8A 4DTRA 1BCMA 5DBAA 4DSIA 3MECA 4EBCA 4RG8A 4CEZA 5KI6A 1ASWA 1Z00B 3P83D 4CE9A 3T3FA 3ZT1A 4FJ7A 4KLIA 1JN3A 4RQ6A 3NF9A 4O9MA 3HT3A 4UAZA 4RNNA 4F5NA 3MEEA 4FLTA 4F3OA 5KFPA 3HVRA 4DQQA 4ECXA 3CM5A 4M42A 3GV8B 4E7KA 1KFTA 5HLFA 2OWOA 7ICPA 4CJUA 2IAJA 3HO1A 4B9NA 7ICGA 4F4ZA 3QEIA 1VSEA 9ICGA 1ZBLA 3ALYA 3AVBA 4MFAA 1HYVA 4DL3A 5CZ1A 4O44A 4NLGA 7ICIA 7ICVA 3AU6A 1U9LA 1S1XA 3RR8A 3RAQA 4CIEA 3PW7A 4K4GA 3VQPA 3OY9A 1BIUA 4RQ1A 5KG5A 3PMNA 3L2VA 4DU3A 2UVWA 4KLJA 4C8OA 2A1JA 4FCYA 4G3IA 2HNYA 2BKEA 5DG9A 4UB3A 7ICMA 4F4XA 4NYFA 4RT2A 4J9KA 1ZBFA 4FBTA 5J2IA 4WE1A 1NOYA 3C95A 4M3WA 1S0VA 3TWHA 1ASVA 1GOCA 4F4YA 1VSJA 1KSPA 3AVIA 2NRVA 2NRZA 1NK6A 4UAYA 2BGWA 3P1GA 3C23A 4GW6A 3T1AA 3DLBA 3OYNA 2ASLA 3NE6A 1N6QA 1S9GA 4M9HA 3F9KA 3GQCA 4HHTA 3FYHA 1ZYQA 8ICQA 3KTQA 4Q5VA 3G6VA 1H38A 4YR3A 3TQ1A 1B92A 3OYMA 4YFKA 5L1JA 3SCXA 2FLLA 1XI1A 2BCSA 3ULDA 4RW6A 4CGDA 3UXPA 3NTUA 4P4OA 4DFJA 1RXWA 2KZ3A 4F8RA 3EYZA 1NJYA 5CJ7A 3ZSVA 3RJHA 4RW8A 3QERA 4CEFA 4DQSA 4CJTA 2F96A 3K5NA 3CFRA 2PZSA 2FLPA 4I7FA 3RH6A 4KLTA 3EPIA 1SKWA 1JX4A 5KFLA 3PW2A 2PI5A 5CR0A 4DU4A 4HTUA 2W9CA 1ZQCA 4KLGA 4PA1A 4UQGA 2AU0A 2J6UA 9ICMA 4YMOA 2YKMA 3KLFA 3ZT0A 3SQ0A 1IKVA 2HNZA 3OHAA 4FJGA 1EXQA 4I2DA 1QS4A 4QWBA 3DRRA 3AA4A 2HNDA 4CJVA 1ZQYA 2RDJA 4M0AA 2BPCA 3SQ2A 4QZIA 4IRDA 5KFHA 1NK4A 2AJQA 2RDIA 4LH4A 1VSHA 1KFSA 4I2FA 4O5BA 4KB1A 5DQIA 4EYIB 1JLAA 4FM2A 2YNGA 4KV8A 3VQEA 4YXJA 5EWEA 3AVHA 4XRHA 2ZQBA 3IS9A 3KHHA 4B9VA 3L2WA 3NDKA 4FLYA 1ZQGA 4CHYA 2F1IA 1BPXA 3MR3A 2HVIA 5DKWA 4Z4HA 8ICBA 4J2EA 2O4IA 4K4IA 1RTHA 4AHRA 4F2SA 4GC7A 5DG7A 4KHNA 4DSKA 4F5OA 2ZTCA 3JPNA 3C21A 1X9WA 4AH9A 2PI4A 2NRWA 1S76D 1VRTA 4GMJB 3O4QA 2Z1HA 1A5XA 5HROA 4ID5A 4CFAA 1MQ3A 1D9FA 2QK9A 1K1QA 2OZMA 1UA0A 2JZBA 1SL2A 3PX6A 3QZ7A 9ICFA 3LAMA 4CFCA 3DLEA 5J0YA 3K2PA 4DQPA 1IKYA 4IFVA 2BANA 3IRXA 5KFQA 3OHBA 4CFDA 4RQ5A 3TFRA 2J6TA 1SKRA 4EEYA 1JMSA 1ITGA 1ZQSA 3ITHA 3RMCA 1RZTA 1IG9A 1NKBA 3IAYA 2C28A 7ICRA 3H4DA 4DS4A 1BI4B 1YT3A 1HRHA 2RPIA 4IBNA 2FBXA 4RW9A 4M3XA 1U47A 3HPOA 5J0QA 2ETJA 2BCQA 5KFFA 4FW1A 1ZQWA 3MDAA 4YMNA 4G1QA 3V9ZA 3QNNA 1A5VA 1EP4A 1ZQKA 3NCIA 2DFFA 3AO5A 2VA2A 3D45A 4QWAA 8ICJA 3VQ8A 5HMLA 2G8WA 3NGIA 3KHGA 1RDBA 4KI4A 2BQRA 4M6WB 4NCAA 9ICTA 1NK8A 4RQ8A 5KT3A 3BGRA 3LP2A 4J9MA 3TI0A 4I2QA 3TAQA 2BQ3A 1CZBA 2P1JA 5I3UA 1EXNA 3Q8PB 3ZSRA 4MFFA 2P51A 3L8BA 4P4MA 3V1QA 2PYJA 1ZQQA 1FKOA 3LZIA 3V6JA 4J9LA 1NK7A 4R8UB 4TUQA 4TUSA 3THVA 3TABA 4IQTA 2F1HA 4JS4A 3ISNC 4BE2A 1UT8A 4IR1A 1EKEA 2IA6A 4HCCA 9ICRA 2HW3A 4KHQA 4MFBA 4KLFA 3S3MA 8ICXA 2HHQA 4I9QA 3M9NB 3AA2A 4DFMA 1UA1A 5KFNA 2OPRA 4ECRA 3U6FA 1KFDA 4CHPA 2YNIA 1S10A 4PGXA 4FS1A 3KLHA 3DLGA 5KFKA 3KHLA 3TR8A 4K4HA 9ICLA 1WAFA 3L3VA 3H8SA 8ICGA 5KT6A 4LZGA 4EBDA 4O5CA 3AVMA 4P4PA 3OVNA 1RXVA 7ICSA 4N5SA 1HQUA 4JWMA 2WOMA 5HP1A 4NLKA 1YVUA 1IKXA 4MEYA 2HMIA 5T7BA 1DOQA 4OKEA 1DTQA 4DTJA 1NJWA 1ZBIA 3GDXA 4GVMA 5J2GA 4PHDA 1BL3A 2DPJA 5CHGA 4EP4A 4DF4A 2Q0ZX 5IIMA 2IBKA 4E7IA 4NM2A 1Y88A 4PHEA 4DTUA 1RT1A 9ICCA 1ZQNA 2XC9A 5EWGA 4GLXA 5J0UA 4CIFA 3U3YA 3AVAA 1R0AA 3NFAA 3Q8LA 3QEAZ 4B9MA 5I42A 3AVJA 4YR0A 4RT3A 9ICNA 1V9PA 4M41A 4ZTFA 4N56A 2KFNA 1LWCA 3B0XA 4H8KA 3SJJA 9ICSA 4E89A 1XSNA 1S0NA 3L2QA 3PO4A 4CGHA 4Q8FA 8ICCA 2BHNA 3OYAA 2UVVA 3TAGA 1BPBA 1FKPA 1QQCA 7ICNA 1B22A 1RYSA 4O4GA 2YNFA 1J53A 3ZSWA 2G8FA 3IHQB 3MXJA 2XY6A 3RB0A 4Z0UA 3C2LA 4KLLA 4FJNA 2XY5A 1TK8A 2G8IA 2O4GA 3HP6A 3M8PA 3WNFA 4IR9A 4CGGA 4QZHA 4J2AA 3H8WA 4QZAA 1TK0A 4PHAA 4DQRA 3RBEA 3ISDA 7ICHA 4RPYA 4O3PA 4Z4FA 4ECUA 4HYKA 3RJGA 4FBUA 5DB7A 3SUQA 4OKKA 4PPXA 4FJKA 3QINA 5CZ2A 3UXOA 1X2IA 3DYAA 1S6PA 4NLZA 4F2RA 1TKZA 4Z6DA 5J29A 1RNHA 4RUCA 3FFIA 4Z4GA 1ZJMA 5J0SA 3QNOA 4CJ5A 3AVFA 4DFKA 3MR2A 2FC0A 2I5JA 4O3SA 1BPDA 4F93B 3AO1A 5KFGA 2IHMA 2LYHA 1ZQPA 4F4KA 5DBBA 2JLEA 3QE9Y 2R7YA 3H7IA 3HJFA 4F5RA 1BI4A 3V9WA 3PW0A 1BPZA 4O3OA 5IIJA 3QIPA 4RW7A 4NY8A 4DL5A 4BXOB 2FPMA 4KLUA 4Z6CA 1WAJA 1U49A 9ICBA 4CERA 4CHNA 4QW9A 4RQ0A 8ICAA 3PX0A 4FJJA 4FLUA 4JV2A 5IIIA 2Y1IA 4RW4A 4JUZA 3GFKB 3AU2A 1W9HA 5CWRA 7ICKA 4Z6FA 4YNQA 3RBDA 8ICZA 4DTMA 4CGFA 3EW9A 3AA5X 3MEDA 1S77D 2JEGA 3ZD9A 3ZDDA 2G8UA 1ZJNA 4KREA 1MSWD 4ELTA 5HHHA 1S1TA 1QSYA 4E7JA 4JWNA 8ICSA 4ZHRA 1QSSA 4C8NA 4M3ZA 5F9LA 3JSMA 5BPCA 1F21A 4PGQA 1QTMA 4UBBA 2PFOA 3ETLA 3MGIA 4CJRA 1XS9D 4O5KA 4FO6A 3FDSA 5HRSA 1BVSA 2ZJ8A 3RH5A 7ICFA 5KFWA 4TQSA 4CJPA 4DSFA 1ZBUA 5DMRA 2KW4A 4CEDA 4RQ4A 3DOKA 3LANA 1IXRA 7ICEA 1VSIA 4DMNA 1NK5A 4F92B 3SYZA 1WSJA 3S3NA 5EWFA 2ZJ5A 4CESA 1TFRA 4KKOA 4CJFA 3PMLA 5L9XA 3BDPA 4XIUA 4DTPA 2V9WA 4N76A 4ED3A 3TAMA 2JEFA 1A77A 2V4QA 4YCXA 4ECYA 4YXMA 1MQ2A 5L1LA 1RT6A 4I2HA 3ZDCA 3PV8A 3OGUA 8ICIA 1S1WA 3A2FA 1ZQBA 2BCRA 1NK9A 1KVCA 3TAPA 1CXQA 1LAVA 3K5MA 5J2DA 4B9SA 3AA3A 2DPIA 2FLNA 1SUQA 4B8CA 4TSXA 2JZBB 2PFQA 5E41A 3QEXA 3U3GA 5J2BA 4FLWA 4JK1A 3UQ0A 5SWMA 4BE1A 3GIKA 4NLNA 3NGZA 5EOZA 2HB5A 2G8VA 4P2HA 4KB0A 2FBTA 2YHBA 4W5TA 4KTWA 5C25A 1BQNA 1JL2A 7ICOA 3Q8QB 1Z00A 2PYLA 3LP3A 4JRQA 2QKKA 1I39A 3NH0A 2D0AA 3SPYA 4I2JA 4HUFA 5KT5A 2IS3A 2XHBA 1S97A 3LWMA 1REVA 3KK2A 2HHVA 3H8JA 1Q9XA 1N48A 1QHTA 5J0RA 4M04A 4JLHA 4BXOA 5IINA 3GIMA 1DTTA 3VQ5A 2VWJA 1TV9A 4IG3A 4QWDA 1CLQA 3V7LA 4CHQA 4M45A 3NH1A 3N97B 3VQBA 2XRIA 3PW5A 4ED6A 2BCUA 1RILA 1UWBA 4BGDA 3K5OA 1JL1A 3QO9A 4OLAA 4RU9A 4IQWA 5KFRA 1W0HA 4HUGA 2Z1JA 1Q9YA 2G8HA 2D0CA 5KT7A 5J2KA 3V81A 4DTXA 1TKXA 3PW4A 1VSLA 5KFUA 2JEIA 3HVTA 1TL1A 4DO9A 1XHXA 3DRSA 4CJWA 3EY1A 3MEGA 4RNMA 2XCPA 3VQDA 5DLFA 4ECVA 4R63A 3GIIA 1S9EA 4DLGA 1ZBHA 1YTUA 1A5WA 4DLEA 4GXJA 1NJZA 1VSKA 4LD0A 2C22A 3RR7A 4IRKA 5BOLA 4R5PA 1D5AA 2VA8A 3K75D 3ZSOA 4CGIA 2HHSA 2YV0X 2ZD1A 4FYDA 3PR4A 5J2QA 1CEZA 2PY5A 4JV1A 3HWTA 4R8UA 8ICPA 1L3TA 3H40A 4CEBA 2W9BB 4QOZB 2ASDA 3RJEA 5KFMA 3IG1A 9ICPA 5DDMA 1QLNA 3C94A 5DK5A 3MGHA 4F91B 4DSEA 4B9UA 4RZRA 3MDCA 3G6XA 2KFZA 5HRRA 3K57A 3OSPA 5KFTA 5TZVA 5DB8A 1Z26A 3NAEA 3KLEA 3CFPA 1RBRA 2MUTB 4CF2A 4CJQA 1C0UA 4FM1A 5JS1A 4KLEA 3I0RA 3V9SA 2GV9A 3T5KA 2QKBA 8ICFA 2OPPA 1HNIA 1D8YA 2XGPA 2OYQA 5HNKA 4AHSA 3C2KA 1S0MA 1JXBA 5IIKA 4Y1CA 4FJXA 1ZQOA 2QXFA 3VQ7A 3AVKA 2BR0A 3V7KA 3UQ2A 2KZMA 3QEBZ 3KJVA 1C0TA 4MQ3A 1JLCA 1BPEA 1RTDA 4AHCA 4KTQA 1JLGA 4M2YA 1LWEA 4MFCA 3DRPA 4CEAA 4FZYA 4ECZA 3QESA 4QZ9A 1TVAA 4KAZA 2EHGA 1TL3A 3MFIA 3MR6A 3OYEA 4Q43A 1ZETA 4YN4A 1JLFA 1IKWA 4PWDA 5KGWA 5EU7A 2IOCA 1HUOA 5C24A 4ICLA 3OYBA 2R8HA 2NRTA 3K5LA 3M8RA 3S3OA 1ZQFA 3VQ9A 4ECQA 3TAEA 2X74A 4DL7A 1B9DA 1VK0A 5SZTA 2DY4A 1ZQIA 5KG3A 4KLMA 4KHYA 1RT3A 2D0BA 2I1QA 3KLIA 3BJYA 1KDHA 4YR2A 5CB1A 4F3TA 2FMQA 1ZQAA 1WCNA 3AO4A 4J9OA 3RJKA 3V1OA 3MABA 3GIJA 9ICOA 2LSNA 1J9AA 1CXUA 2HVHA 3VQQA 4ELVA 4RQ3A 5KFVA 2FMSA 1WSIA 4FZXC 4KLOA 4JV0A 4M6WA 3MXMA 1KEJA 5FROA 4PUOA 1RT2A 3SI6A 1JLEA 3RB3A 1Q8IA 3DLKA 3V9XA 1LAWA 4XUSA 2KQ2A 2RN2A 1NK0A 3PVXA 4FW2A 4TURA 4FJIA 4CJKA 1U04A 3ZT3A 1ZQMA 3RMDA 3SQ1A 3V6HA 9ICJA 5DB9A 4N41A 2Z1GA 4DOCA 5DQHA 1KLNA 2P6UA 4QZBA 4R64A 5L1KA 5DBCA 1A76A 3RTVA 1S1UA 3SUNA 4LSLA 4PHPA 1XU4A 4XQ8A 1GOBA 3ORYA 2W9CB 5HMMA 4PH5A 2X78A 1RPLA 3V9UA 2HHTA 4I2PA 5D49A 8ICLA 4DOAA 5D4BA 3DOLA 4E7HA 1L5UA 5IIOA 5DQGA 1KRPA 3QLHA 1XO1A 2ZTDA 3TARA 4M9NA 5J2CA 5F9NA 3OYLA 1HJPA 3VN5A 2C2EA 2RF2A 1SL1A 2KZZA 4ED8A 1TKDA 3JPOA 3NHGA 4HCBA 1BGXT 4CF9A 3HM9A 2PXIA 2DFLA 3RMAA 1RDAA 4XA5A 2UVRA 5J2JA 1BIZA 3T5HA 2FBVA 1PZNA 4UAWA 3AV9A 3EZ5A 2AGQA 3OSNA 1LW2A 4MEXA 4M9LA 4OJRA 1HNVA 3MAQA 1HPZA 3T5JA 1AROP 3NGYA 4EZ6A 7ICQA 3AVNA 5KFCA 4C8LA 2XY8A 3AO2A 5J0OA 3M8SA 3HP9A 5J0PA 1NKCA 1SL0A 1XSLA 4F4WA 4ZTJA 3S9HA 2AQ4A 3C2MA 3C6UA 4BACA 4GXKA 4QZ8A 2IGIA 5J2NA 1L3SA 2NUBA 2WONA 8ICKA 3H08A 1BCOA 2R8JA 1VSFA 3VQ6A 7ICTA 5KFIA 3VA0A 3ISCA 2E4LA 4B9TA 4CK2A 4CK1A 1EETA 1UAXA 1WLJA 4UBCA 2J6SA 2BDPA 4B3OA 4FJLA 4M47A 3RMBA 4H4MA 1GOAA 4MF2A 4IG0A 1BHLA 4QZCA 3GILA 5BOMA 4FS2A 2P5GA 3G10A 4QAGA 4LZDA 3KLGA 1VRUA 4Z4EA 4C8KA 3QZ8A 1JLBA 3RAXA 1CZ9A 1S9FA 3V72A 4NXZA 4M3TA 3LK9A 1RDDA 3OYJA 2AGOA 2VA3A 4HUEA 4J9NA 5KTQA 3WNHA 1Z3EB 3OJSA 2A1SA 1SKSA 4KLQA 4JRPA 4EYHB 4ED1A 4O0JA 1T8EA 5KFDA 4B9LA 3OJUA 4OKJA 4FXDA 3MXIA 4E7LA 2R8GA 4AHVA 2I9GA 4FJ8A 4FZZA 3NF7A 3KD5E 2ZUCA 2XCAA 3SUOA 5JUMA 1NKEA 3AVCA 9ICKA 3NBPA 4FM0A 2FPLA 3SI8A 3T19A 3RJFA 4I9LA 1JKHA 1HYSA 4IDKA 5DLGA 4NCGA 3G0ZA 4BDYA 5FDLA 3M8QA 1YTAA 3AUOA 1ZQVA 4PGYA 1X9SA 2W8LA 7ICUA 9ICXA 1TAUA 3B6PA 3LPUA 3OYGA 3NGDA 1T4GA 4DU1A 5CP2A 4I27A 4CJ3A 3KD1E 9ICWA 4IFYA 4ED0A 3LZJA 3LP1A 4FLZA 2OZSA 4BWMA 5HRPA 4C8MA 1RBTA 4FLVA 5KT4A 1HQEA 4F50A 1B9FA 1KVBA 3PY8A 4CEEA 3AVGA 1XSPA 1RT4A 8ICTA 3PNCA 4ELUA 5J2PA 4W5NA 2B6AA 5J2AA 1TV6A 1J54A 2XY7A 4ZH4A 5KGXA 4O55A 3LAKA 4LY7A 3Q8MA 4UB5A 2YHAA 7ICLA 1IO2A 4DG1A 4QCLA 5DB6A 4J2DA 3LPTA 4UB2A 3MBYA 3PR5B 4J9SA 3OYKA 1TVRA 3Q8SB 4Y1DA 1S6QA 2ISPA 3T5LA 5J2MA 4EBEA 8ICEA 4X5VA 9ICIA 1S5JA 4EZ9A 1ZQUA 5L1IA 4O3NA 3SV3A 1ZQLA 3B6OA 1WNSA 4R66A 1VSMA 3SPZA 3DI6A 3GV7B 3OYCA 1C1AA 2Q3SA 2Y1JA 3JPPA 3SQ4A 1RTIA 3H4BA 3PO5A 4YD2A 3P5JA 3SV4A 5C5JA 1HYZA 8ICOA 3KKRA 4O3QA 2OPSA 4EP5A 4K8ZA 1QSLA 3E01A 3DM2A 1Z25A 3OYIA 2HHWA 5KFXA 1HMVA 4M3RA 4ED2A 2X6SA 9ICQA 4CEQA 3UIQA 8ICNA 3CG7A 4OGCA 4J9PA 1TK5A 3RRGA 3RRHA 1WSHA 2JEJA 5KG6A 2FPKA 2GUIA 3C1YA 4DTSA 1C0MA 3RWUA 2MUTA 5D3GA 2VG6A 2ATQA 3C5FA 2G8KA 2GBZA 1TKTA 9ICEA 1UOCA 9ICUA 1RT7A 1MC8A 4DL2A 2C2RA 8ICHA 1RTJA 2OA8A 2F8SA 3BQTA 4FK2A 1XHZA 1TGOA 4W5RA 1Y97A 4J9QA 3ZSZA 4CF8A 3HXMA 2W9AA 4M9JA 3C6TA 3D0PA 4FJMA 4FLXA 4DSLA 4CHZA 5KFOA 2W9BA 1JXLA 1B43A 4IKFA 3V6DA 3LDAA 2ZUBA 4IQVA 5J2HA 4DEZA 3RJJA 4AHTA 4QWCA 5C42A 3EWAA 1N56A 5KG0A 3VQAA 5KFYA 2ZJAA 3I0SA 3OYHA 4PY5A 1HUZA 1WN7A 2F1JA 3LALA 4OVLA 4OGEA 3N4MB 3VQCA 4RPZA 2D5RA 3JPTA 2DFHA 5DDYA 1SV5A 3SUPA 3L2UA 5KFSA 5HRNA 2ITGA 4YFUA 4YQWA 3ZCMA 1KCFA 2W9MA 1JIHA 5KRTA 2YKNA 4FJHA 4RNOA 2DTUA 4NM1A 4DSJA 1X1PA 4E1MA 3QETA 4M3YA 4CHOA 3AO3A 1RT5A 3E2EA 3KK1A 1ASUA 3QIOA 3ZT2A 3TFSA 3OS0A 2BCVA 2BPFA 1O1WA 5KFAA 3KIOA 3ZDEA 4H4OA 1WSEA 2C2DA 4M3UA 4ECTA 7ICJA 1WCLA 4KI6A 3JYTA 1ZQHA 4BE0A 5KG4A 4Q8EA 3QEPA 8ICUA 4RQ7A 8ICVA 9ICHA 2MAXA 4KLDA 4B8AB 4KTZA 2DFEA 2EX3A 5FRNA 4UB1A 1T3NA 1T03A 1KTQA 3V1RA 4BWJA 3CM6A 2P6RA 5CYQA 2VWKA 4CFBA 2WTFA 1S1VA 1BPYA 4I28A 4W5QA 4NCBA 4JS5A 4CJEA 4I2AA 1D8LA 4GC6A 3HPHA 4QZFA 4DS5A 4I2BA 3DLHA 1WSFA 1RDCA 3ZDBA 4BDPA 3HYFA 3V6KA 4I29A 1ZQXA 4YMMA 2FBYA 3TANA 4Q44A 2BE2A 5JS2A 3WNEA 4I2EA 1QE1A 3OS2A 2BQUA 2IDOA 1KVAA 5KG2A 5FRMA 4L8RB 1RYRA 9ICVA 3Q8RB 3LP0A 4OLBA 1RBUA 4CK3A 3LDSA 1RCHA 1XC9A 4KRFA 2Z1IA 2FMPA 4DTOA 3HK2A 2RKIA 3CYMA 3UXNA 4Q45A 3ZSYA 4KHSA 3M9OB 4CF1A 4KPYA 4ID1A 2R8IA 4ECSA 5J0TA 4KMUA 4Z4IA 4DOBA 4K8XA 4DF8A 4KHUA 4KFBA 4YVZA 4LVSA 1FXXA 1T7PA 4CJLA 1LWFA 2AGPA 1S0OA 2F8TA 1IM4A 3O3FA 2E6MA 2ISOA 4CJSA 5DGBA 4KITB 3K59A 4DTNA 1ZQZA 3JPRA 5J0XA 4N47A 3C1ZA 3L3UA 2P5OA 3Q8KA 1JXEA 4CF0A 3QEWA 3G6YA 1X9MA 5K14A 1IH7A 1ZQDA 3NF8A 4DFPA 4AILC 4M9GA 2UVUA 2JGUA 5HP4A 1FK9A 1LV5A 4I2IA 2ZUDA 2ZTEA 1K6YA 1MU2A 3WNGA 5J2EA 1XWLA 2ZE2A 5CA7A 4CIGA 4F5PA 2PFPA 4CECA 4Z4CA 9ICAA 4AHUA 1CUKA 4FJ5A 2ATLA 4FK0A 4IRCA 1RBSA 2OPQA 3HSTB 2AQ0A 2B4JA 1NOZA 4RUAA 3HPGA 4YP3A 4CEOA 5HBMA 1U4BA 3ZD8A 5D46A 1T05A 3HL8A 4CJ4A 2HHXA 1C7YA 3JPSA 4O3RA 3SNNA 4KLSA 2R8KA 4FVMA 3QEVA 4MF8A 3HX0A 1J5OA 3BQ2A 4OPKA 8ICWA 1TAQA 4FJ9A 1LW0A 3DMJA 2H5XA 1L3VA 5CYMA 5DGAA 2GWSA 4E19A 4QZDA 3AVLA 3O3GA 5KRSA 2YNHA 2VG7A 2BGGA 2B5JA 2A1JB 3B0YA 4E0DA 3M9MB 3KHRA 1U45A 8ICYA 5J0WA 4QWEA 2XO7A 3NH2A 4DQIA 2ALZA 3HW8A 1NJXA 3K4GA 1ZQTA 4ECWA 2M9NA 4F5QA 3UPQA 4TUPA 4ED7A 3CQ8A 5KG7A 8ICRA 4LSNA 3O4NA 1WSGA 3O3HA 2B21A 3RB6A 4I2CA 5J1EA 4TQRA 1HJRA 4DL4A 3ISBA 4NYNA 4DL6A 5KFZA 1ZQRA 1UT5A 1NOMA 3ZSXA 5J2FA 3OS1A 3KKSA 5IILA 2IHNA 1C1BA 2A1RA 1JLQA 4GXIA 1DGSA 3ZSQA 3BQ1A 4O0IA 4E3SA 3CFOA 2X6NA 3BQ0A 4J9RA 4KN4A 2HHUA 4E1NA 8ICMA 5KFBA 1BISA 2E6LA 3ASMA 1VSDA 3VA3A 2ASJA 3L2RA 4O5EA 1I3AA 3MR5A 3OYFA 4RQ2A 4B08A 2W42A 4CGJA 4YD1A 3I8DA
chains in the Genus database with same CATH superfamily
3IM8A 1HFEL 4IH7A 4EFHA 5DM7Q 3DLRA 3J81j 2DCUB 4FF4A 3ICLA 2E5LF 3HI0A 3MDQA 2IMWP 1FO1A 3LP1B 2NRXA 3NNAA 4DPOA 3KLVA 5KFJA 2IC3A 4OI0A 2FF3B 2WRMA 2YQ3A 4ZMMA 2MB0B 3OYDA 1KP6A 2F65A 2A3ZA 3U02A 2DGQA 2GTDA 2P66A 3VVUA 5J1PA 3OFHA 4DR2J 4HVJA 1NDLA 2D0OA 4JI5J 1YI2N 3FEZA 4IQUA 3V7JA 4Y2YA 3MGJA 4NI2A 3IA0A 1SB6A 3SZ2A 3SQGB 1S48A 1DLOA 1FRXA 4ZS6A 1Q86T 2P9PB 1Z6RA 4P0PA 2X3DA 4FVCA 2VGMA 3I56S 3EPGA 3QMLA 1KC8T 2GVZA 1KLMA 3MPVA 1SV5B 4FPBA 5E0OA 1C1CA 2OEHA 2HWHA 2GEMA 4XEIA 1DAXA 2UV8A 4DV7K 3AQFA 3HKZD 1U48A 3V4IA 4IXCA 4OJPA 4Q7AA 4WFNQ 4Q0BA 2R7XA 1ZQEA 2VG5A 4DWIA 3H1VX 3VEZA 4FNIA 3DJCA 4M63A 4FYYB 3K1ZA 1WTBA 4RG8A 4W90B 2DNHA 4Y0WA 2RD5C 5I4MA 2D3OR 1HWKA 3P83D 2YNFB 4CE9A 4ZIWA 1SB3C 1L7OA 4KGVB 5L1MA 4L72B 3VGTA 4DU7A 3K5PA 2W4PA 2QC3A 3HT3A 4FLTA 3KG1A 2OD6A 2OFHX 4KHMA 4LFCJ 4YOXA 1RWXB 3EGVA 4M42A 4MK9A 2B0GA 1KFTA 3E51A 3L09A 4AYBC 5ALJA 2OWOA 3QGPA 1FKAF 4DV5K 1FWKA 1IWAA 2NSBA 1V5IB 3CPWR 4D3HA 2ZIWB 2EG1A 5EUHA 1L7PA 2QM1A 5TISU 4G65A 1ZBLA 1WOQA 3HOTA 3KJVB 3MMAB 3QU7A 4LFBK 1JALA 1T9VA 4WU2A 4FWMA 3BBFA 1F3FA 2HEKA 3VQPA 3OY9A 1K8KA 3M6KA 2V2KA 1Q7YT 2P9CA 3CCLN 2P8IA 3F2DA 4JK9A 2KK0A 3T6JA 2BJ1A 5LMUJ 2E5JA 2JFKA 1T44A 4DU3A 2WHEA 2KM8B 2NPFA 2C2NA 5ETKA 3CC7N 4ATNA 4NYFA 4FBTA 2IA0A 5HI7A 4DR7J 1PVPA 3MM7A 4WE1A 3OV7A 1O6XA 4LT6A 5L39A 4F4YA 2GS8A 4GMKA 1N5QA 2R4FA 2NRVA 3R5DA 2DCLA 3CJ8A 3BDEA 3P1GA 4NXMK 3QUTA 2FC9A 2LYBA 5M1PA 4NLWA 1J6ZA 4CLTA 1NMEB 4X66F 1S9GA 4DZDA 3F9KA 3D0GE 4B17A 1SS6A 2FZKB 2OPQB 3TQ1A 5C25B 1FESA 2J4RA 1ZBSA 2KYXA 1LK7A 4F9OA 2CUYA 4TNOA 4BR0A 3KLGB 4DR1K 2FLLA 4WFZA 3E0FA 2IVOA 2MZTA 2KZ3A 5I3UB 4F8RA 3EYZA 3L4BC 1NJYA 2ZXHA 3LL3A 3RJHA 3RVCA 1SC6A 3NWRA 4BQZA 4CJTA 2F96A 3CFRA 1Z1VA 2I8EA 3WC0A 4EX6A 3PW2A 4BRFA 2PI5A 2DKXA 2BKPA 1IQZA 4HTUA 3BUZB 1M5HA 3J7Z5 2YX6A 2MQPA 2AU0A 2JRZA 3VGUA 5D6GA 2R2UA 2WONB 2YKMA 3ZZRA 3NGTA 4KH0B 3SQ0A 2KXNB 1EXQA 3G4SN 3ENOA 1D1UA 3BV8A 3QGGA 3H6EA 1Q8LA 3NRWA 1QAXA 3KWMA 1QQNA 3TQEA 2HNDA 4CJVA 2MKJA 2ZM6F 2Z4PA 2ZF5O 1N34J 3MWPA 3CRXA 4HDGA 3BS5B 5TKWA 4IRDA 2CKWA 1CQNA 4WF9L 2G07A 5JVGL 1GAOA 3NGRA 1IR2A 2VJ5A 4I2FA 4O5BA 1VQLN 2MQLA 2CQ0A 4FM2A 1FDAA 4KV8A 3IAS9 2QTWA 3IS9A 2YX7A 3KHHA 3L2WA 3BH6B 1BPXA 3MR3A 5DKWA 1Q5YA 4WP3A 5IOLA 3H8MA 3IO1A 2FSNA 1SV0C 2DISA 3EUB2 4DSKA 3KXDA 4CZGA 2ZTCA 2Y8WA 2PI4A 2RF2B 3H3NO 1LXJA 2BV3A 4GMJB 1QCKA 2GJ2A 4P2XA 2MYFA 1A5XA 5HROA 4ID5A 3N6MA 1XC3A 1K1QA 2JZBA 3DC2A 3LAMA 3K2PA 2O8EA 4I69A 4DQPA 3GIRA 1Q7LB 4CFDA 2YNGB 2BJ8A 2CG4A 2K06A 3T41A 1VYAA 1LWCB 5BPMA 3PRDA 1FJ7A 1UETA 4MTPA 2HVZA 3EDQB 4QR2A 1ITGA 2CRXA 3ITHA 1KVIA 2E2NA 5MLCQ 3PKYA 5GADI 1FTRA 4USHA 4YY3F 1V97A 3H4DA 3BS5A 1WACA 1Z1ZA 4YDUC 4H5NA 1YT3A 4CLPA 2FTRA 2FBXA 1CRXA 4C0BA 4QS9A 3HPOA 5J0QA 2BCQA 3BF4A 4ZCKA 2RQ4A 1Q82O 4G1QA 1TFWA 2RUGA 2HZVA 2MKSA 1ITPA 2DFFA 1K73O 1X4DA 3AO5A 1BUPA 4NWIA 2CADA 1TYQB 3W3SA 3D45A 4QWAA 2OFGX 3R1HA 3NVMA 2G8WA 3NGIA 1RDBA 2PO4A 4UB6U 2WVCA 3AOBA 1KC8O 2CQGA 1NK8A 4RQ8A 4OYZA 4O44B 2DO4A 3BGRA 2BQ3A 3KDNA 4X65F 3QDKA 3HHLD 3AXMA 3J81O 3L8BA 5HVGA 3QUCA 1PC4A 1ZQQA 3D1OA 1OVQA 5AM1A 3QIDA 3V6JA 4KX3A 4M5KA 4DMZA 2H3VA 1NK7A 2XS2A 2F1HA 4B3SK 1EKEA 5K8OA 2HW3A 1NSPA 3S3MA 4BGAA 1NNLA 4RW4B 4XDCA 3M9NB 2CPJA 4DFMA 3CDWA 3Q83A 2HS0A 4R79A 1VQKS 3W3DA 3KHLA 2Q6BA 4K4HA 2XZDB 1U8WA 4YN3B 3K0JA 1WAFA 1JNRB 4P4PA 4KPCA 3JB9k 3D2QA 7ICSA 4N5SA 2WOMA 4DHYA 1YVUA 4TYBA 4MEYA 2Z2YB 5T7BA 3AXKA 1HA1A 2CRLA 1DLOB 4URSA 1DTQA 5AKKA 4DTJA 2CZ9A 1ZBIA 3GDXA 2WAQD 4FXVA 4M5DB 3R27A 4GVMA 3WK9A 1J2VA 1BL3A 2DPJA 4CNYA 1E6VB 2FY8A 1JNZB 4DF4A 3I6PA 1URNA 1G4CA 4CZJA 4E7IA 3F2BA 5ITHA 2ZJPQ 3UO0A 3DYAB 1U25A 3A3OB 4DV3J 1TMMA 2XC9A 1QY7A 5J0UA 5KQ8A 3U3YA 3HULA 3NFAA 4OMFG 5ETVA 5D4LA 1OH6A 4NWBA 3R2CJ 5I42A 3MK6A 3SEIA 1XIQA 4U95A 2IVYA 2YQ0A 4ZTFA 2KFNA 5FJ4A 3B0XA 2HMPA 4H8KA 1QVFR 4N77A 4E89A 3L2QA 4CGHA 4WXOA 1FKPA 2QLWA 5JVHL 7ICNA 2XLJA 4UW2A 1PAUB 3QGIA 4DR4J 3D2EB 4WQ4C 3DEEA 2YNFA 1J53A 3ZSWA 2G8FA 1DRGA 2AHOB 2BJ7A 2ZNZA 2EC0A 2MA1A 3F2CA 2DNPA 3RB0A 5J2QB 2QL5B 2VV5A 2XY5A 3E1YA 2C2OB 2HWTA 3CCVN 3HP6A 4JI3J 3T1YF 3M8PA 4WU3A 3U8XA 4IR9A 2NPIA 5RUBA 1VK3A 1X60A 5A2QU 4QZHA 5ALXA 4C7ZA 1TK0A 4OPHA 4RU2A 4K2XA 3ISDA 4RLEA 7ICHA 4WF9Q 4Z4FA 4HYKA 2IRYA 2AXTU 3O5TB 4FWPA 4FJKA 3GYNA 4OPAA 3DYAA 2L3MA 1S6PA 3KDOA 4A8FA 3LDOA 1HD0A 2ZIUA 1GLEG 1ZAVA 2MZQA 4FZVA 1NGCA 3HZGA 4Z4GA 4CJ5A 2HSZA 2IOFK 3AVFA 4DFKA 4BRAA 1FNOA 4O3SA 3U1NA 2IYGA 3KG0A 4A46A 1DFDA 2LYHA 2V5HG 4C2MA 5AQJA 4OV1A 3H7IA 5AK4A 1NGDA 1BPZA 1LW0B 2VGNA 4DL5A 1APSA 4USVA 3POTB 3LF0A 4C7YA 1U49A 9ICBA 4CHNA 4QW9A 2B7BB 2QXLA 4BHQA 4USUA 3PX0A 4WWSA 4K25A 4OZNA 3TUJC 3Q7BA 5IWAJ 3AFGA 4FLUA 4JV2A 1H2VZ 2Y1IA 5KOWA 1NH7A 3KNAA 3OR1A 4RW4A 5AKGA 3MMCA 3AU2A 3VF0B 5CWRA 4Z6FA 4K7QA 3CCSN 1X5TA 3RBDA 8ICZA 4Z7CA 4O23A 2DXEA 2CGKA 1Q79A 3ISND 3MEDA 4LJXA 4RQNA 2LU2A 5A76A 5B5EU 1ZJNA 2OHDA 4Y2VA 1W7AA 4WIQA 1KN6A 1RWKB 3OLAA 2KSOB 5HHHA 1S1TA 2VPZB 2QIFA 3L5KA 1NPKA 4ZHRA 1QSSA 2IJRA 4M3ZA 1N88A 3I4HX 3JSMA 3KMQA 1AZSB 1RAIB 2PFOA 4HT5A 2J7WA 2DY9A 3FDSA 2GO8A 1BVSA 2ZJ8A 3RH5A 7ICFA 1YQHA 1R6VA 4TU7A 2L41A 1ED1A 4TXSA 4TQSA 2E1YA 2AMCB 2KW4A 1H0HB 4RQ4A 5THWA 5J2NB 1XNRK 3MM7B 3AY9A 2CGJA 1QZ6A 1T9TA 4KKOB 1MROB 5ALOA 2XMJA 2WHOA 2GVDB 1IXRA 2PMWA 2C42A 4PL8A 7ICEA 3OVAA 3CIMA 1Q53A 1VOMA 2RRDA 2PSZA 3LO3A 2CQ2A 5AQPA 4LF5K 3CCQN 2NR0A 1BWVA 4YOVA 1XN9A 2ZIVB 4WIIA 1TFRA 2F4VJ 4CJFA 2UUCF 4XIUA 2HNZB 4N76A 2D1CA 4ED3A 3CF5L 2JEFA 1A77A 3NCQA 4OJ1A 2WVEA 4ECYA 1O13A 3GR0A 3I96A 1LW2B 1XMOJ 4I2HA 1YWXA 3N5BA 1JJ2M 8ICIA 3PEHA 1W25A 3A2FA 1D3WA 1R0CB 4PXDA 1ZQBA 5ALRA 2BCRA 2PMZF 1DEJA 3I56N 3RAMA 4I6YA 1M5KC 2FLNA 2XMKA 2V7ZA 3WXMB 4OX8A 1Q86O 1PK3A 5H2FU 1FF2A 4FLWA 2WC9A 1X4HA 3GIKA 4NEYA 1RA7A 1KOHA 5K8NA 4ZHRB 3P31A 4TY9A 2G8VA 1NM2A 4WKRA 3I28A 2RP5A 3CCEN 4WP9A 1AXQA 2BDUA 5F8LA 2P9SB 3NASA 5ALMA 4W5TA 1BQNA 1NGFA 3Q8QB 1GXLA 2JWLA 3LW5C 3ENAA 4FKYA 1I39A 1TELA 2L5YA 4F3MA 3SPYA 5AJ3J 3U27A 2YH1A 3NVKA 3LWMA 2CPIA 4CI6A 3EXCX 2O8FB 1Q9XA 2CQ4A 3WQUA 1WC5A 3AQPA 5J0RA 4M04A 1RQ0A 3C16A 5J8YA 4JLHA 4MIWA 3LPEA 1GFWB 2FY1A 4P0QA 2LEAA 5AQZA 1NDKA 3VQ5A 2YWEA 3UKUA 1B0TA 1RG6A 3A8IA 3V7LA 2YI1A 4CHQA 1M1KO 2H65B 4ED6A 4MT1A 4OI3A 2VICA 3K5OA 3O2IA 3QO9A 3KOAA 4OLAA 2RAQA 5F3TA 2F5GA 4IQWA 4ZPBA 5HK4A 3TA2A 2V0NA 1CJVA 3ATUA 2DKZA 4FOIA 1TUUA 3E66A 3PW4A 2WB1D 4KHPF 1HX1A 2P9EA 2F7TA 4CJWA 2OTJS 3HJVA 4FF1A 5FPDA 1HBNA 2Y0BB 3VQDA 3LDQA 3FE1A 3SIPB 4OIXA 2Y9UA 4DN0A 2KO1A 1A5WA 3SENA 3BH7B 2W43A 4ZP9A 5BOLA 3UPFA 1D5AA 2XSFA 1S57A 1Z2LA 1DGKN 2HHSA 2YV0X 4UY8O 1NDPA 1ZM3A 5HQ8A 5BREA 2PY5A 5FD1A 1NHVA 2A2DA 3R5JB 4CM0A 5AZIA 3MCSA 8ICPA 1N33J 4B1XB 4CEBA 1LKYA 4QOZB 4B6JA 3RJEA 1NGIA 3AQEA 4QIVA 5KFMA 2KIVA 2F8HA 3IG1A 4JD2A 9ICPA 2E44A 2VFTA 2GLEA 1LWEB 2KN4A 2J0WA 3MGHA 2ZVIA 4F91B 2E7XA 2CPDA 3JYTB 4DSEA 5D0RA 1WUDA 1JJCB 3UCUP 3MDCA 2LDYA 2KFZA 2A19A 2I7PA 5HRRA 3OSPA 1Z26A 2YWKA 3IRWP 2ASMA 3NAEA 1QAJA 2GVZB 4JN4A 3TP2A 3W1YC 4CF2A 2I5JB 4A2AA 1H6KX 3I0RA 3D2FA 1S72N 1RXOB 2FVRA 3KK7A 3T5KA 4F0HA 5AM4A 3AB4B 2QMWA 1HNIA 4A59A 3UR3C 2XGPA 5I3PA 1UZHA 3C2KA 4B3MK 1JXBA 5IIKA 5LXYA 3AAQA 2GELA 2MKKA 2WBRA 3ZZOA 5M1FA 3DMJB 4MQ3A 2CGLA 2RHKA 3NS5A 5IS2A 4CEAA 2ZBCA 2DGTA 3WC2A 1TVAA 4RX6A 1RUSA 4JI7K 3N7RC 4ZPWR 3VESA 1EB0A 2MQQA 5ALQA 5EU7A 5CCMA 2IOCA 4K4TA 4B1WB 5GINA 1YRUA 1TL7B 1YBAA 2PA3A 2BOAA 2IJNA 4PG4A 4DXLA 5EE1A 1ZTTA 3EXYA 4C1NI 2VBZA 4ECQA 3KVGA 1N5WA 4CM2A 4A8EA 3BN7A 5HATA 3MN5A 3QRRA 1VCTA 1ZQIA 2Q2RA 4KLMA 1RT3A 1PVRA 3GE1A 1BU6O 2KLAA 1X5SA 4PZOA 4RWXA 4F3TA 5AQKA 1ZQAA 1KR4A 1WCNA 3GJQB 2VQEJ 3V2UC 2DR8A 3U9DA 4LF6K 2ZJQQ 9ICOA 4RO0A 2P9LA 2H5JB 4JI3K 1ZXIA 1OSDA 1R0AB 1CXUA 3PSTA 2JVOA 3NOGA 5KFVA 2FMSA 5SUHA 4BRGA 4YHHF 4JV0A 3HSJA 1U8SA 4OHYA 5FROA 2GQQA 3G86A 2QEXN 3WK8A 1H7XA 5EVZA 1JLEA 3VAHA 4EAHD 1Q8IA 3W7BA 4ISEA 4B3RK 2RN2A 4FW2A 3O6WA 1WWHA 4K59A 4CJKA 5FDLB 1ZQMA 2E66A 2XSJA 3CD0A 3T6BA 3QFHA 1RFQA 2I6XA 1JUDA 2DRBA 2E5LJ 3QPIA 5DB9A 4DOCA 2ADBA 2W2MP 1RGVA 4R64A 1DTTB 3W5XA 3J7YI 5DBCA 2Y3YA 4LSLA 2ZZMA 4XQ8A 1UWAA 3CD6N 1NJIO 2F9DA 3HHKA 3BY5A 3SMSA 3CNQP 3V9UA 4CF4A 1ZPVA 3HVAA 3UKRA 1HI1A 1UVMA 2KXFA 5CCLA 4P9SA 1R8CA 5D4BA 2PEHA 3CULA 1GLFO 1PYTA 5HVHA 3O3LA 4V19J 5DQGA 1XO1A 3IWLA 5J2CA 1HL6A 2E2QA 1HJPA 3VN5A 4CLUA 2P9IB 4QIEA 1IBMF 1Q95G 4ED8A 4EELA 3NHGA 2F8EX 3GZ7A 2EK1A 1N6QB 4CF9A 2PXIA 3R5GA 4IFYB 3E9OA 2IFXA 2H54B 4TU8A 3T5HA 2VFSA 2FBVA 2QA2A 1VQ4N 2F4FA 4UAWA 3CXCR 4ZVHA 3TZXA 2AGQA 2M8DB 4ZPVR 5FLXU 3MAHA 4M9LA 4OJRA 4K0KF 2AV5A 2WB1F 3B4DA 3T5JA 3QIPB 1NG9A 1AROP 4Y2XA 5HANA 4RNHA 2KJVA 2JGAA 5KPZA 2W41A 2OUGA 5E33A 2E3TA 5J0OA 2L9NA 5LMNJ 4PG5A 1YITN 2QL9B 4JI4K 4CLLA 3KJQB 3UD5A 4UY85 3LTOA 3CJ1A 1IUJA 3C2MA 3MM6B 4BACA 4GXKA 2YHXA 3H08A 2R8JA 1VSFA 4FO0A 2KT3A 3VA0A 3ISCA 4B9TA 2UXBJ 4UBCA 2J6SA 4P10A 3P39A 3I8BA 2RVJA 1NGAA 3FQKA 4CNQA 4M47A 1NGHA 3TR5A 2HS4A 4OV6A 1EARA 1RBLA 1GOAA 4MF2A 1RE1B 4IG0A 1BHLA 3GILA 4FS2A 3ZX0A 2M52A 3M2VB 3G10A 3R2DJ 4Z4EA 4C8KA 1EAYC 3QZ8A 3V72A 2EW9A 1Q4RA 5K4LA 2CWXA 3GR1A 1RDDA 1VQMN 3MPDA 2RE2A 5KTQA 3PDNA 1GLAG 5DM6L 5IC4B 2IPOB 5EE3A 1IJJA 2ZOMA 2KV2A 2XIDA 1MLAA 2K3IA 1HWIA 3KMSA 3W5YA 4B3TF 4QOTA 5BRFA 3W2VB 5KFDA 3OJUA 1K9MO 1DK2A 1T3VA 4IC9A 4FXDA 3MXIA 3MXHP 5HN0A 2PMZC 4ZN3A 1GMWD 3A13A 4KAIA 2XYPB 3P4UB 4M5JA 4DCHA 3SUOA 5JUMA 3M05A 3AVCA 2RMLA 4DV2K 3ULHA 2JC1A 3NBPA 3THTA 2FPLA 1S5LU 1IBKK 3DRRB 1RT1B 3RJFA 1IBLK 4F7VA 2GCFA 2XO6A 4NCGA 3KK1B 3G0ZA 4BDYA 5FDLA 3M8QA 2OANA 2E8NA 4P71A 1K0VA 2V68A 5KL8B 1X9SA 1KKXA 4I6AA 2DKOB 2C2MB 1X4CA 4K2JA 3LPUA 1T4GA 4IWVA 1PJ7A 4BRCA 2HSTA 5J1NA 2A1BA 2P9KA 1IJFB 4CJ3A 2QB1A 9ICWA 3LZJA 5AI8A 2OZSA 4V1Ak 4BWMA 5HRPA 4C8MA 4CRJA 4UQTA 2XI3A 3IFEA 1B9FA 3TUZC 4CEEA 2HMXA 3PCOB 2O3DA 2E5LK 1XSPA 3FZKA 4OZ5A 3I5AA 4UF4A 5ETQA 2G5IB 2XY7A 4ZH4A 5ALEA 5AKYA 4ANEA 5K5MA 4NMLA 4Y2JA 3AGRA 5DB6A 4J2DA 3LPTA 2VFRA 3MBYA 4HAIA 3QU2A 4RBTA 4MLHA 1FKPB 3OYKA 4FNHA 2FUG9 3NWGA 3QFPA 3V6DB 4Y1DA 1TV6B 3T5LA 4XH4A 4EBEA 2KD1A 2ACMA 4P2FA 2D9PA 2WFBA 3THWB 2F9JA 1ZQLA 4OHXA 3NGUA 4ETXA 4C0ZA 3THYB 1IBLJ 3SPZA 4Q2MA 4DV1K 2GC8A 4LF7J 3OYCA 2WB1C 2Q3SA 2Y1JA 3JPPA 1C1CB 1NUEA 3K17A 4JI3F 4P72A 3OW2R 3PO5A 2K3KA 3SFGA 1HYZA 3C6AA 1ZXOA 1O08A 4DX5A 3S8SA 2V9KA 2XBPA 2YBVA 2Z0GA 9ICQA 3UIQA 3RRHA 4Y34A 1WSHA 2GUIA 2FVQA 3NS7B 1JROA 2N4DA 4WJBA 4CJ7A 3LM9A 4DTSA 5JMVA 3RBXA 3VQSA 5D3GA 3B9JA 3DI6B 1J97A 2ATQA 3C5FA 2V8PA 2DT9A 1RTJA 1NBWA 4ETZA 1CQMA 4M5NA 1VQ8S 1DJ0A 2K89A 1SGGA 1N36J 4GFJA 1B0XA 4OJGA 2W9AA 3W9IA 3D0PA 3IG1B 2V34A 2A18A 1V3RA 1M6YA 3QU5A 1BG3A 2LFVA 2W9BA 2XULA 1B43A 2EWSA 3V6DA 3LDAA 2ZUBA 3IFRA 2KH9A 1FRIA 4WFAL 3HT0A 2B9YA 2GFFA 4LQ3A 2FPHX 4RR5A 3EWAA 3A0IX 1N56A 3VQAA 1VQ7S 5KFYA 2ZJAA 3I0SA 1VQ7N 1Z4NA 4PWDB 1WN7A 4A5BA 4OZ0A 2R7OA 3P3DA 3CETA 4OJHA 4OYAA 4EEKA 2IYIA 3JPTA 3C14B 5M1QA 3V4MA 5DDYA 3SUPA 3CCQS 3L2UA 2GGPA 5HRNA 1HBMB 2ITGA 1D09B 2CPRA 3P8BB 3AJ2A 1PBUA 1QVGM 1KCFA 2QWMA 4E8UA 1YHQN 3D6TB 4CRXA 5DDOC 3B6BA 4RNOA 1VQNS 2EFVA 3D9BA 3H46O 3ID6A 4E1MA 5GADU 3NNHA 1WWUA 3EO3A 3KK1A 3EE3A 2WF8A 4JI6F 1ASUA 1SH0A 1MWMA 3OS0A 1O1WA 2KRRA 1WSEA 4WFBL 2ZEJA 4NL9A 2FGCA 4ECTA 3HX9A 7ICJA 4KI6A 4G1IA 1ZQHA 5AXNA 2QARB 5KG4A 4Q8EA 2FVCA 4ZVPB 3UKUB 8ICUA 3TJ9A 5IT9Y 8ICVA 4I4BA 4K4XA 5FPEA 5IXUA 3M30B 3NCPA 3TKAA 2AJ4A 1MWQA 1BA0A 3ZETB 4LQ9A 1KTQA 3UQSA 3IDWA 1X6JA 3V1RA 4BWJA 5CYQA 4CFBA 3SAGA 1BWEA 4MFBB 4W5QA 5AQVA 2FB0A 1JJ4A 4BC3A 4JS5A 3ADAC 1HBOB 3AM9A 1F6TA 5GAGU 4DR3K 4FWSA 2XI9A 3HPHA 2MQNA 4OX7A 2D7SA 1Y10A 5AR0A 3F53A 4M8LA 3SD7A 3V6KA 3CDBA 4JKBA 4BC7A 4LIWA 3ONNA 3GJSB 3MM8A 3NKYA 3IBCB 2BE2A 2CPEA 3AEVA 2CVIA 4DUZF 1QE1A 2IDOA 1RAHB 1RTHB 5FRMA 1MW7A 1RYRA 2CPFA 3ULEA 3VTIA 4BX9C 2VH7A 2A6AA 4P74A 1BE4A 3WU2U 3K89A 1N62A 2FMPA 3HK2A 4DTOA 5AQIA 5DETA 1VQ8N 3CYMA 4Q45A 3TUIC 2QB0B 3UI3A 1U6FA 3T1YK 4KHSA 3VGMA 1PO6A 1HNWJ 3RU0A 4WJ3B 4HHUA 4DPWA 4ZA1A 2CJBA 3AB2B 2HGNA 2FLOA 1BC6A 2PA8D 2Z57B 4K8XA 1JKHB 2F3JA 2LQJA 2H51B 5LY3A 5BR9A 2AGPA 3H90A 1SIWB 4CD1A 3WX4A 1FXRA 5DGBA 4RTFD 2QYGA 4NXMF 4ILLA 5F8JA 2L48A 3DXKA 3NNCA 3AOCA 3JPRA 4JKDA 4N47A 3A5OC 1FJCA 3Q8KA 2PMZD 1JXEA 4CF0A 3G6YA 5K14A 4C8ZA 2CYYA 2XNRA 1RHMB 3SDEA 1NPPA 1WF2A 4NLQA 2QFIA 2HHHJ 2YHWA 2ZE2A 2EKYA 3ZEUB 3R8YA 4CH1A 1HUXA 4CIGA 4BUGA 4F5PA 3M8PB 2YQEA 2AH5A 1WORA 4AFFA 3N4QA 2PFPA 2ZGZA 4Z4CA 4U6PA 5AFUH 5KPTA 1W7WA 4AHUA 3X3UA 3TSQA 2K60A 3SR6A 4FWKA 2GW8A 2B4JA 3ETRA 4BG9A 2LKZA 1R8BA 2FIUA 1OY9A 3Q22A 4YP3A 1H1VA 2WF9A 3NAHA 2YPYA 3PRVA 3GG4A 4CJ4A 4PQUB 2HHXA 5AQGA 5AKIA 2HLUA 2LA4A 4KIAA 2V50A 1GLCG 3G82B 3KD3A 3G8QA 5AKZA 2Z56B 3WIVA 3J80U 2N1RA 4DV3F 2WF7A 2MQMA 3ID8A 1LW0A 4U8YA 1MMNA 4U8VA 4MDAA 5DGAA 3QU9A 4C1NK 4E19A 4QZDA 3O3GA 2A1AA 4OI2A 4NXNF 1U6BA 4GKJK 3IC1A 3M4XA 3VAMA 2OCEA 1QD1A 3O80A 4RJVA 4PKIA 2LKYA 2JNJA 4QWEA 1GTEA 2G2ZA 2UXDK 2RLTA 2ALZA 1UPMB 3R7NB 1VQ6N 4F5QA 4OYWA 1ZD2P 3HHDA 4URQU 4DUZJ 3MMAA 4A8XA 2HLTA 3FGUA 3CC4N 1IKXB 3FMBA 5J1EA 3PIPQ 1M5SA 4BRMA 1HNZJ 2DK2A 2HQDA 4JP8A 5A2QY 4LRAA 1G7CB 3OS1A 2AIRB 1DT9A 1UMJA 2R7TA 4LRBA 3SK3A 1C1BA 2J7UA 4F0MA 4BROA 5LM7E 4FPAA 4OYOA 1SC4B 2F1FA 4A8WA 1IVZA 3R6MA 1WEXA 5KFBA 4X4TA 1OW5A 1FJEB 2RT3A 2ASJA 3L2RA 3O1LA 1I3AA 4UOGA 5C24B 1IG6A 2W42A 4MJKA 4CGJA 4TVAB 2F9WA 4MK8A 5CAAA 1NNDA 3TWZA 1AQ6A 5DDRC 1YXQA 4HHHA 1ZQJA 3ZT4A 4LF9K 4CCHA 1COOA 3MMVA 4UB4A 4PXBA 1YJRA 4YDXA 4JI0J 4OO1J 1CULB 2H3QA 3IKMA 1D8ZA 3G71N 5BR8J 4OPJA 3NF6A 1TKTB 2WF5A 1I6JA 4K5RA 5CY4A 2XMMA 5MAOA 1U7LA 2AEMA 5K8PA 4EI2A 5AI5A 3QBWA 2XGQA 5JU5A 1N32J 1X9JA 3VERA 2BZFA 2DGUA 2V4RA 2OTLN 3GFZA 5HHIA 4BDZA 3LWLA 3EM1A 3TAFA 2IMOA 3AJDA 1VQ5N 2OPSB 4YY3J 5F0UA 2IC3B 5CD4A 4J2BA 3CMAN 5ALKA 2W4CA 2BBEA 4I2GA 3ENHA 3OXLA 1XK8A 1U1KA 3FQLA 3PUFA 4RPXA 2IOFA 2LXUA 4ERDA 3THWA 4EX7A 3HHEA 1SZPA 1GX6A 1RBVA 2L08A 2YXLA 2KRBA 4DDFA 4UAVA 2BRKA 2D6FC 4KLHA 4AYBD 2P5VA 5AE1A 3D54A 5DG8A 4DTRA 2O01C 4DSIA 4DR2F 1WSRA 1A6LA 3O1BA 3VEVA 2FF6A 4CEZA 5KI6A 4ZVQB 4OJLA 3ZT1A 4DCPB 4RQ6A 3NF9A 3BREA 3MEEA 4F5NA 4PG6A 2YN4A 3HVRA 2ZH7A 1XMBA 3CM5A 2VHGA 1IKWB 3S01A 1KD1O 7ICPA 4CJUA 2IAJA 2X7IA 3C15A 4B9NA 3NY0A 1SV4A 4F4ZA 3QEIA 3ALYA 3CCJN 4O44A 4AL5A 1CJKB 4BRLA 4F04B 2JSXA 7ICIA 2PKEA 3O9QA 4H4KA 3LPYA 2LECA 1KQSR 3RR8A 2X1BA 4PL7A 2UUBJ 1XR5A 4QYRA 3UN3A 2F76X 1E6VA 4S0MA 3WKDA 2OPPB 1X4GA 1IN0A 1N5XA 4JI7J 5ADXA 3L2VA 1DKGD 2EXUA 3ZC4A 2UVWA 3SJHA 1FEEA 4G3IA 3CF5Q 2CNNB 2BKEA 2DGZA 4FPRA 2AF6A 4RT2A 4J9KA 3R5CA 3MX5A 3ZTRA 1NOYA 2GWJA 3QNWB 4M3WA 3TWHA 3N7PD 3UCGA 1GOCA 3QQCD 2QZ8A 4CZIA 1VSJA 2OXOA 2ZZTA 3T7ZA 4IYQA 3JAMU 3AVIA 4I6MA 1RDWX 3LP0B 4UAYA 3C23A 4GW6A 3T1AA 3DLBA 4M7XA 4CQ1A 3J7AP 1OY6A 3OXGA 3ILLA 2LP4A 2NYHA 4LIRA 4HHTA 1ZYQA 2CQPA 2QMUB 4NL5A 2UUAJ 1H38A 4YR3A 2Y1RI 3QXGA 4IH6A 4DOZA 3SCIE 1B92A 2B6AB 1MWYA 2Q0RA 3VF6A 1LFWA 3SCXA 1F5CA 1RM6C 2RUSA 3MI7X 3GU0A 4USAA 2VZ9A 4RW6A 4CGDA 2EZYA 3QICA 4DFJA 3OPXA 3CMEN 5CZXA 3H20A 3QERA 1N2XA 3MEGB 4DQSA 4FOEA 2K4PA 2PZSA 1R31A 4Y2QA 5KFLA 5B0GA 2KKZA 4DU4A 2RNEA 1MWZA 2CA9A 2I1RA 4C11A 3H5UA 2X51A 4NEZA 1QDUB 1U6ZA 3Q89A 1R8HA 3ZT0A 2W55A 2HNZA 2JH3A 2ROPA 1PG5B 1QS4A 1NB7A 3QRPA 2WW4A 3R6GB 1XERA 4Y6IA 3AA4A 3A12A 4UASA 2LXIA 4DUYJ 2BPCA 4IOCL 3HFVA 3GDQA 1UAWA 1NK4A 4PRFA 2VOOA 4H5WA 1KQQA 1X3NA 1IV0A 4B1UB 1EZZB 3PEJA 1VSHA 4QIFA 4YOUA 2UXBF 5ALTA 4KB1A 5DQIA 4EYIB 1JLAA 2YNGA 2ZH9A 1WKJA 3W66A 3S1TA 3DDNA 3AVHA 1FRKA 3BSAA 3KZIU 2XMVA 1UCNA 2QWQA 3QU4A 4CHYA 1PK1A 3ULEB 2DGOA 2L9WA 2HVIA 4Y2UA 1EWQA 8ICBA 3NRZA 4K4IA 3JSMB 5AKHA 3MD3A 3S7RA 4KHNA 4F5OA 2X1GA 3O6QA 4XDDA 4EENA 4F25A 3IN5A 3VAFA 2DNLA 5D8HB 4BC5A 2Z2LA 1VRUB 3O4QA 2Z1HA 1T9WA 2W7PA 2NO5A 2XLIA 4HI1A 2K4HA 1MQ3A 1FE4A 5ETPA 2OZMA 2E5GA 5LSLA 1CSJA 3KKAA 1IKYA 2BANA 3IRXA 1FI4A 4KV8B 1YVNA 3TFRA 2J6TA 1SKRA 2IDLA 4H5VA 4AQYF 4EEYA 1AW0A 1TL3B 3CSKA 1RBOB 4BS2A 2C3OA 4DR6J 4QU7A 1IG9A 2UUCK 2C3YA 7AT1B 2ZDPA 2D3UA 4DS4A 4PXEA 2QX0A 1HRHA 3DV9A 3ATVA 2CG8A 4M3XA 1U47A 2C3PA 2QSWA 2ETJA 3DOMA 4FW1A 1GXUA 1ZQWA 2VQEK 2Y0SD 2BOPA 4JI4J 3QNNA 4JYAJ 4NLVA 4K4YA 3I55N 4JOUA 3NCIA 1GNKA 3VALA 4XO0A 1D9AA 1TKZB 3KHGA 4KI4A 4FE3A 5D4NA 4C3MA 8AT1B 4LFAF 3R5BA 3UCZP 4FZNA 5G5GA 1X4AA 3LP2A 2DIUA 1UQVA 1KXPA 3UB5A 2FJBB 2P1JA 2J9CA 5I3UA 3IG5A 2J5AA 1LOTB 4DUZK 4H4KC 6FD1A 4JKGB 4P4MA 3V1QA 3OTQA 2PYJA 1I94F 2OTLS 3JAMY 3D2NA 1VBZA 4R8UB 3MM9A 1RA6A 1J5EJ 5LXRA 3THVA 4IQTA 3AA8A 1BNPA 4IOCQ 2R2RA 9ICRA 1XNRJ 1S99A 4KHQA 3J7AN 8ICXA 1HLWA 1RAAB 5AXLA 1VJQA 2FVSA 1XNQF 4PABA 2OPRA 3J8AA 2RHFA 3U6FA 4ZLPA 2OSQA 3OTBA 2YNIA 3O1WA 1JB0C 1KD1T 3I5CA 3DLGA 4JKHA 5KNIA 4Y2IA 2PEBA 3H8SA 5KT6A 2NNWA 4EBDA 4IL6U 4O5CA 4I2QB 1REGX 1HQUA 4JWMA 1NSKL 4BR5A 4ES3A 1DOQA 4F4AA 3QFWA 4HL9A 3E3XA 3ENQA 4OKEA 1X0PA 1NJWA 2P9UB 4KHPK 4DV0K 2Q4TA 5CHGA 2KIWA 1URJA 5IT9O 1V85A 3FCWA 5AJ3K 3I9ZA 5IIMA 3HZEA 3W2WB 4CH0S 1RT1A 9ICCA 1VQ9S 1XO0A 3PYDA 2HZAA 3NBPB 4GLXA 2HQFA 3D2WA 4CIFA 2B6GA 1CS4B 3Q8LA 4DCCA 1MWKA 3CCSS 3WDOA 4K4SA 3ZTQA 4V19S 1SBRA 1WNEA 4B9MA 3ZNJ1 3AVJA 3LA0A 4C0HA 4RT3A 9ICNA 1V9PA 3UNYA 5B0BA 1NU0A 1G1XA 3SJJA 1V4SA 9ICSA 3V5RA 2EZXA 3BGOP 3PO4A 5LJ3Y 1T05B 3L95X 4Q8FA 3OYAA 2UVVA 3FNNA 2M9KA 4O4GA 3O8MA 3N0VA 1TVRB 2NZCA 3DLJA 4NZ6A 3NUQA 4CNZA 3QYPA 4UUWA 4CLZA 1X4BA 5LOQA 2G8IA 1FFGB 2O4GA 3OTOJ 2VG5B 3OW2M 3B8AX 3B82A 4P7VA 1C1BB 4PHAA 4DQRA 1PILA 1RWUA 1I51B 3IAM9 2A42A 3QMQA 4L3NA 2QKQA 4OX6A 5DB7A 1YAGA 3QINA 5CZ2A 3H25A 9ATCB 1Y0HA 3UXOA 1YJTA 2OMOA 5AICA 5ETSA 3TEGA 2QG9B 4WTOB 4USIA 2AEFA 1DZ5A 1TUYA 4NLZA 4F2RA 2EFPA 4JI1F 3FFIA 3MCOA 3SBTA 5J0SA 2FC8A 2IVFB 1UWBB 2DHSA 3C29A 2RILA 2G9OA 4DU8A 3MR2A 3CGIA 4BRHA 3N5FA 4RL1A 1WD6A 2W2NP 4DR6K 4U67L 4F4KA 5ETTA 1ZQPA 5DBBA 2JLEA 2R7YA 3H0MB 1OS5A 4F5RA 2W11A 3ZZYA 3PW0A 2ZKUA 4YOYA 4O3OA 3QIPA 4C98A 4OYPA 1FFWB 1TMJA 2XS7A 2G2YA 4PG7A 4KH1B 2BANB 3KLHB 1OKJA 1W2BR 4CO4A 4FJJA 2ASPA 1QQ6A 4OJ3A 4WPAA 2JHDA 4CGFA 4J8FA 4OYXA 1PYSB 3ZD9A 3O9SA 3NS6A 1MSWD 4QJFB 3M2VA 3CHWA 1J27A 2W54A 3H98A 8ICSA 4C8NA 4KYZA 3G96A 3QUQA 3L3FX 4PGQA 4DZ6A 1MU2B 2V8VA 2WVFA 2A2CA 3MGIA 2E9TA 1WUUA 4OD0A 4JB3A 3WEEA 4NLBA 2AP1A 4CJPA 4DSFA 2YTUA 3CJTA 5DMRA 4CEDA 3JAMO 2QWNA 3VHQA 2UXDF 2LBOA 3RRKA 1P1TA 1U0HB 2DY1A 1BMQB 4OFZA 4QPTA 1JCFA 2DIVA 1F1BB 3PKMA 1S5ZA 3M8QB 3SSSA 3IXQA 5C2CA 4F92B 1WSJA 2YNHB 2ZJ5A 4YB5A 4C9DA 1KDNA 3CUNA 4CESA 1FW6A 4Y2AA 4H0OA 3KLFB 4KKOA 1TL5A 3PMLA 3BDPA 2IIHA 4PXCA 5JXSA 3TAMA 3FFIB 3EJMA 4YHHJ 4HTLA 2N4CA 2K7JA 4YXMA 2ZJRQ 2HBKA 3GLJA 3MAAB 3PV8A 3OGUA 1S1WA 2FI1A 1KVCA 3TAPA 3CCMS 4LF8K 3W2VA 2VQEF 5J2DA 3AA3A 2DPIA 4X62F 1SUQA 4B8CA 3QJJA 1FT8A 4JK1A 3UQ0A 5SWMA 5AFUA 4H03B 4BE1A 2HQGA 5AQYA 4NRUA 4CO5A 3EE8A 2WTUA 2GMHA 5C2GA 3KLIB 4FN5A 5AM5A 5C25A 2V2QA 1JL2A 3C3LA 7ICOA 3HILA 2O67A 2W01A 4MKAA 4DUTA 4JRQA 4GVBA 3NH0A 1FNMA 2D0AA 1SJQA 2VFUA 5HVFA 2R3VA 3W9HA 2MSSA 2VJ4A 1M5OC 3H5XA 3DGVA 5B66U 1KNZA 4HLBA 4IJNA 1L7NA 3H0PA 1V5VA 1DTTA 1SIZA 5F41A 5BR8F 2W3SA 2ALYB 3M8ZA 5DO2A 4IG3A 4M5MA 4IQXA 1HD1A 5GIOA 3TADC 3VQBA 2XRIA 4PR6A 4WFNL 5E26A 1RILA 1UWBA 2JVRA 4BGDA 1RAOA 2GHWA 4RU9A 2QEXS 5KFRA 4JEPA 4HUGA 2CPYA 1Q9YA 2G8HA 3AQOA 2KVIA 2J9DE 1DQ9A 2KHDA 4ZVEA 1FRMA 4X66K 4NLXA 1ZD4A 2YKNB 4PKDB 4DTXA 5F3XB 2CXEA 2HFVA 3F9MA 4WQ5A 2FJEB 2VYPA 1TL1A 1OPZA 4DO9A 1XHXA 1EX8A 3DRSA 3Q23A 2AX0A 3FBFA 2FHOB 2K8BB 3OBYA 2JL9A 2IAJB 2LLZA 1S9EA 1KW4A 2DGXA 1S8OA 4JD2B 4GXJA 2KB2A 3WQPA 2IRUA 3UWTA 4LD0A 3TU5A 4J9VA 3A8KA 1UVJA 4C4WA 2W7OA 4ZLNA 2VA8A 3M6XA 3K75D 5CHCB 4EHTA 2XG8A 2ZD1A 3JTNA 3TSPA 3PR4A 1H3DA 3D68A 1VQPN 2YWWA 4JV1A 2YWGA 3HWTA 1PJ6A 1FRHA 3F56A 3Q7CA 2W9BB 2ACYA 3JXUA 4CLWA 5ALNA 2OI2A 4CH7A 4FWLA 4BRPA 3PYEA 3KG4A 4Q0BB 4Y2TA 4ZIVA 3C94A 1X9XA 4JI7F 5AE3A 4IFEA 3A0HU 3QNMA 1KAXA 3G6XA 3T1HJ 2HBZB 3ZO7A 5DB8A 3KLEA 3CFPA 1TL1B 1YTYA 5D3GB 5AM2A 2UXBK 3G6EN 5JS1A 3MHYA 4KLEA 3V9SA 4MMOA 3VQTA 4ES1A 8ICFA 3UMBA 2HDOA 3I55S 5A8WA 1GLDG 1KWMA 1U1MA 2GIRA 5HNKA 2J0QD 2B7CB 5A8WB 2IBOA 3G4SS 1ATNA 3ELHA 1A6SA 4A8MP 3NP5A 3V7KA 3C2PA 2KJ5A 2V94A 3T1YJ 1TUVA 3U4LA 1RWMB 2EFGA 1LWEA 3VAJA 4M2YA 4MFCA 3GCWP 1SXDA 4KJIA 5HJYA 4ECZA 3DLGB 3QESA 3GFHA 4GKKJ 1TL3A 2FDNA 2HAIA 1M90O 1ZM4A 3D4JA 1IWGA 4WQ4A 1LKYB 3Q86A 3BGLA 1FEHA 1OY8A 4MO5A 1S6QB 3G2XA 2LMIA 3S6JA 4O8UA 4AL6A 3HSGA 1DY3A 4DL7A 1U1LA 4DV1F 2UU9K 2CZ4A 3NS1A 1B9DA 3IMXA 3VGLA 5SZTA 2DY4A 2MKYA 5KG3A 1UVLA 2I1QA 3KLIA 5IM0B 3W64A 4OHZA 4C48A 1H73A 2J9EA 3A5LC 2UUTA 1Y00A 3MCPA 5C12A 4DHVA 3HTVA 5E3CA 1N8RO 3AO4A 3RJKA 1RT7B 3V1OA 4Y2RA 1RKIA 4K50A 4R0EA 1WG1A 1FFUA 1J9AA 3W8GA 4YB7A 4KGXB 4ELVA 3VQQA 3LDLA 4JYAK 3EZWA 3QJLA 3CPWM 1DRZA 4M6WA 3MXMA 4LSNB 3T1HK 4PZNA 2MGZA 2Z58B 4OJ5A 1UEUA 5GTIU 4FWOA 1RBAA 1HKGA 3GJTB 3DLKA 3CCLS 3PVXA 2HOIA 1NHKL 3ZT3A 2DRDA 3RMDA 3RW7A 2FHJD 3V6HA 4ED4A 4N41A 4Y2MA 5HP1B 4BGBA 1SJRA 4GY2B 5L1KA 3R1XA 4USTA 4QJVA 2W9CB 4PH5A 1NSQA 1O03A 3OL8A 6AT1B 3D6MB 2HHTA 5D49A 2YMQA 2RH3A 4QYZJ 4X64F 3B8HA 4ALZA 3M6GA 3MM5A 1L5UA 3R5AA 1KRPA 4F26A 3GOIA 2IRXA 2ZTDA 1TUGB 1LQ9A 4M9NA 2ZD1B 3JSBA 4B02A 2GJFA 2QA4G 5ADXH 2Z7JA 2C2EA 1B0PA 4HH0A 4LUBA 2H4WB 4J7CA 1RGIA 1H2TZ 3NRBA 3TTCA 3FZMA 1Q3UA 1AFJA 2E29A 4H54A 3ILOA 2D4WA 3LP2B 1RDAA 1OIAA 2B4VA 5J2JA 5K14B 3IR5B 1KVKA 1YJ9S 4Y0FA 1RYUA 1LW2A 2E1MC 3CDUA 1PBAA 1VBYA 1KTVA 5AXMA 4JV5F 3CJ2A 3MN9A 3MAQA 2WUSA 2E9RX 4GNIA 1U2FA 1NZPA 1DURA 1CJVB 1MMLA 1K47A 2AW0A 4AXJA 3CXCM 2V8DA 4EZ6A 3PFEA 2P6TA 3QO9B 4MYTA 5BPLA 4IDKB 2NUUG 3D7SB 2HFNA 3HP9A 5J0PA 4C3LA 1IBMJ 1SL0A 1ESVA 1HPZB 3S9HA 2VC0A 4QZ8A 1SQEA 5J2NA 2BX6A 3RSEA 5AXKA 3D7EO 5KFIA 1RWOB 4A47A 3PIPL 3NEKA 1OWXA 2EKNA 4G6VB 1WKKA 2O8FA 4FJLA 3WEEB 5LSOA 3DLEB 1NRKA 3OL7A 1N36F 4OX9K 5BOMA 3FUYA 2E7WA 2P5GA 2G1DA 4B1ZA 2MZ1A 5LSRA 3KLGA 1VRUA 1S9FA 3CO0P 3JQKA 2ITMA 2D8CA 1BOTO 3KFWX 4BR2A 4MYUA 2RQ5A 4IOXA 4WZQA 1G2EA 2IDEA 4J9NA 1R6YA 5M2PA 2VB6A 3CT9A 2WVBA 4E1JA 3D2EA 1SUQB 1SKSA 3PHTA 4RBUA 2DGWA 2AJ0A 1VISA 3C6TB 4B9LA 1B4FA 2ZIXB 1E4FT 5F8IA 2WZ1A 5F8HA 1SH2A 4QQBA 1L7MA 4AHVA 2I9GA 4FWNA 3GU3A 4DV7F 1S1UB 4FJ8A 5AIBA 3NF7A 4DCOB 5AJ3F 2DWQA 4BC9A 3KD5E 2ZHBA 4RQMA 2SXLA 3OHRA 9ICKA 2WSCC 4GIBA 1U24A 5D4PA 4OI4A 1AB8A 3T19A 3WIUA 2NQPA 5GIPA 1QQ5A 3GYXB 1HYSA 4I9LA 4ZVOB 2MDAA 2V7YA 5DLGA 2QWOA 4Z2XA 1JI7A 3HD1A 2KT2A 1K8KB 5GMKa 4PUOB 1ZQVA 4FWQA 4UTGA 2W8LA 1EKSA 3KUGA 3L3CA 2M5YA 3OYGA 4XPEA 4XH1A 5CP2A 4LF9J 2UUBK 4I27A 1RABB 2HFZA 3C14A 3LYSA 2V2VA 2BUNA 2DHXA 1CULA 1AZSA 3KZXA 4TLQA 2JH1A 2H3IA 1RBTA 1YK9A 3BQ7A 1VIOA 5KT4A 1HQEA 1J2MA 4F50A 1KVBA 3PY8A 3CIPA 3AVGA 1BA1A 1RT4A 8ICTA 5C42B 4WYBA 1ZA1B 2ZH8A 3KUHA 4W5NA 2B6AA 2LU1A 3C28A 7ICLA 4DG1A 1IO2A 2DNKA 3ENBA 4BCAA 2KFYA 1D0EA 3C6HA 4DG1B 4CBWA 1TVRA 5D77A 3Q8SB 3FKBA 4DQ8A 4ICLB 1U2VA 4IOAQ 4BC2A 2B9XA 2HRYA 3LGMA 4J03A 4DV3K 5J2MA 8ICEA 3V4IB 9ICIA 4Z37A 3NMAA 4O3NA 5KAFU 4O8KA 1KKHA 3T69A 4OYIA 4XPCA 3DI6A 3O4WA 1OH5A 1C0TB 1V9OA 1A0OB 3SQ4A 3FVYA 5E2QA 1RTIA 2ZOGA 2EVZA 4O3QA 3C19A 4EP5A 1G6BA 2O8DA 3DM2A 3OYIA 3PJXA 4EO6A 5AQNA 2ZUAA 2HHWA 5KFXA 1HMVA 2G0JA 4M3RA 4ED2A 4CEQA 5B0EA 1BWFO 8ICNA 3CG7A 4KH5A 1TK5A 2CDRB 2W25A 4OQJA 5IWAF 2DITA 5KG6A 2FPKA 2LDIA 4OHWA 2E1PA 4X4RA 4QIGA 4MHVA 1DTQB 2KJ9A 4DR2K 2YPZA 4LFCF 4WQ5C 1HQUB 2BE7D 2F8SA 3BQTA 2CDQA 1TGOA 1YJWN 1T6DA 1URRA 4RWTA 2IVPA 1T02A 2CNLB 3SFUA 3MOZA 4M9JA 3ZZ0A 3KK2B 3C6TA 2O8EB 4FJMA 1FFVA 4BRNA 1XNSA 5G0RA 1W2IA 3TTFA 2F8LA 4IKFA 4DV7J 3NMRA 2KP7A 3BO3A 2JXJA 4K5SA 4O4GB 3RJJA 2WBNA 1T0TV 2FXUA 3QX7A 2D74B 5C42A 3OR2B 4OX9J 1F5SA 3CDAA 2Q1NA 1Q81O 2XLKA 3MC1A 4JKGA 1PK1B 5ALLA 3T9NA 2DFHA 2OGUA 3R9LA 5KFSA 1GO3F 1TKXB 8ATCB 1TYQA 5ALUA 1P9YA 3ZCMA 1JIHA 5KRTA 5F8GA 2PFDA 4ILMA 3HMJG 1C0GA 1EP4B 1UEKA 2NXJA 5CZVA 1NLVA 4BLGA 4UZCA 2HBLA 5AQHA 1IR0A 4LF7F 1HWJA 4M3YA 2ES6A 3AO3A 4PEOA 4CF3A 2GO9A 3QIOA 3TFSA 2BCVA 3T79A 4QPXA 5KFAA 1N4LA 3KIOA 2O8CA 2ZWHA 3SMPA 1VIXA 3H2LA 2QA4N 4BE0A 2EI5A 3QEPA 4RQ7A 4MKVA 9ICHA 3TO8A 4K4VA 4OJ6A 5JICA 2F4VK 3MPYA 2EX3A 2NSCA 2ZHOA 5FRNA 1H2UX 1T3NA 5H1SQ 1B4SA 4NOHA 1EKRA 2XMUA 2LPEA 5HROB 2NS1B 2VWKA 3CDEA 4RW6B 4NCBA 1VRTB 2ILZA 1F5AA 1FX4A 1H98A 2VUGA 3F41A 4C4RA 2KHCA 1D8LA 4QZFA 4DS5A 3Q8VA 1Z4UA 2WW8A 2HBQB 2U2FA 4I6WA 1K9MT 3RJMB 3ZDBA 1UFKA 1SXLA 1ZQXA 1SWWA 2FBYA 1WHXA 1S9GB 4E2FB 3TANA 5M1NA 4I2EA 1KVAA 3QBXA 3LP0A 2JV3A 4CK3A 5HMZA 3LDSA 4FSVA 2IOHA 4KRFA 3OA9A 2NCKL 1JWWA 1UW9A 3V81B 4PKGA 3GFYA 4ISFA 2KHVA 1CJTA 1YBUA 2JJ4D 2P9NB 4L6V3 1ILYA 4CF1A 2R8IA 2O8CB 4ER8A 4KMUA 1NH8A 2RU3A 3LM2A 3H2UB 1XR6A 1PGZA 4KHUA 4IDHA 4KFBA 3W60A 4YVZA 1F3VA 1FXXA 1T7PA 5B0DA 1K44A 2E6MA 2VQFK 1GLLO 1U2CA 2GVDA 4DTNA 1ZQZA 1X7VA 2XHWA 4QIWC 1OXJA 3SLCA 3L3UA 2P5OA 3QEWA 2LQBA 4ZN1A 1IH7A 3NF8A 4DFPA 4EMDA 4AILC 2RKIB 4I67A 2GGPB 1SCJB 3ONQA 4CI0B 4B3RJ 3VGSA 5HP4A 1LV5A 5DDQC 2ZXIA 2BE2B 2ZTEA 5GTHU 3L7UA 1K6YA 3FFKB 2DH7A 5L46A 4MH8A 3M2RA 3P96A 5BYSA 1WOOA 1LVHA 4YMEA 3ICXA 4ZCMA 2XWYA 2FHMA 2DR5A 3CQXA 4B3RF 2W4DA 3SBGA 2DNZA 2CNOB 1CUKA 2HBYB 4FJ5A 1Q46A 2CXYA 2W2OP 2OPQA 4ZOSA 2M4MA 3HSTB 2GQCA 3SEOA 3DU5A 5GAEI 4RUAA 1T9YA 3ZD8A 1QZ5A 4JAXA 3R9KA 3OTEA 2A3JA 3JPSA 4TKTA 2IIRA 1NZBA 3SNNA 3B54A 4RW7B 2Z8QA 3GFXA 3QEVA 3HX0A 4L3KA 4URGA 2VBYA 1VQ5S 4LFAK 4PJ0U 3FCHA 1L3VA 2VC1A 2CQIA 2GWSA 5AKJA 1TUWA 4DCJB 2DD8S 3QGHA 1DQAA 2VG7A 3MMBA 3UMGA 2FDRA 4FF2A 3M32A 4OZ2A 3KHRA 3A3PB 1T94A 4H5TA 8ICYA 3TRGA 3NH2A 3CCRN 4QU6A 2QT7A 3LH2S 4P73A 3DM2B 1ZQTA 4ECWA 4CZKA 2M9NA 4ZK7M 5KG7A 2FJAB 3O4NA 1WSGA 1P27B 4B3SF 2B21A 2KKHA 2DPNA 3GP9A 2D69A 2ATCB 2HF4A 4CT8A 3CC7S 1PYOB 2QWPA 3C7NB 2HFSA 2R7UA 1ZRNA 4DL4A 3DXBA 3MCAB 4NZ0A 1TE2A 2K4EA 4DL6A 5AI6A 3CWJA 1LOUA 1UT5A 5IWAK 3VF2A 4AP9A 5J2FA 3KKSA 4CZEA 2ZITA 1VHIA 2IHNA 4GXIA 3I31A 3QJPA 3ZSQA 3BR9A 1VQYA 5J2MB 4ED5A 4E3SA 4J9RA 4DUYK 4ZLJA 4E1NA 4Z7YA 4NB4A 3ZTOA 2P6SA 4X4NA 3MZIA 8ICMA 3KOOA 3DRYA 1J5EF 1NBEB 1BISA 3O5BA 3EEQA 1VQPS 3VA3A 1N32K 2WVDA 4O5EA 4PCQA 4RQ2A 4YD1A 1EO1A 4FDFA 2AJFE 1HHSA 1B3TA 2M0GB 1YZ6A 2F9TA 1V4TA 3SAFA 4QZEA 3AH6A 2ZG6A 3F73A 3GL1A 4FK4A 5KFEA 3J80O 4MKYA 2XVTA 1HIWA 3NL0A 3TPQA 3H2VE 3KK3A 4AE5A 1MN9A 2D1KA 1GLJO 2PMHA 1K1SA 3C5GA 1NMNA 1G15A 3JPQA 4QIWD 5A8KB 2W8KA 2OMLA 3IBFB 3RH4A 2ASYA 3G6ES 5BYQA 3BPDA 4NZ7A 2YJFA 3P38A 4W5OA 1NO8A 2YX1A 2PAVA 1HIYA 3PSIA 3IM1A 3IWNC 4KHWA 5KG1A 4Z6EA 2KTQA 3ZTPA 2QRRA 3D66A 4P75A 2J76E 2Q66A 2DXFA 4KO0A 3JSYA 5B7WA 1EX4A 1H7WA 4QIWF 2VANA 2MLXA 2NXEA 3CMES 4BRKA 4FFDA 4EUVA 5A0YA 3THYA 4L74A 5GAEU 1D4XA 2KN7A 1E6YA 3MFHA 1R7IA 1FERA 4K41A 2B4PA 1VLBA 1BQMA 1L3UA 3SQIA 4HVZA 3DFEA 3BGFA 2R7RA 4JI6J 5HR6A 4PQUA 4LFBF 5IM0A 2Z30B 4ZVRB 2NYIA 3DXMA 1BCMA 2FJ6A 2YHYA 5DBAA 1Z4OA 3HHLB 2FJDB 4KGKA 1ASWA 1Z00B 2UUAK 2GWKA 3CI5A 2UUCJ 4Y2PA 2F4VF 4NLSA 5A6PA 1JN3A 4O9MA 4UAZA 3HZ6A 4JV5K 5KFPA 4DQQA 4ECXA 1VQ6S 3SXLA 4E7KA 4QBUA 4Y65A 1RT4B 1AYEA 4HEA9 4JHDB 2F7VA 3HO1A 2CQCA 3AD7C 1SJ4P 3VPZA 2MKIA 2QN6B 2QA1A 7ICGA 4A5AA 1T3OA 3SDEB 4CLYA 4MDBA 1VSEA 9ICGA 2DNGA 4MFAA 1HYVA 4DL3A 5CZ1A 3ZXWA 4WKYA 1U1RA 1S12A 3OUYA 4BQLA 3BS7A 3BM7A 1U9LA 7FD1A 1S1XA 3RAQA 4CIEA 5JTIA 4K4GA 3RSEB 3A8YA 1BIUA 4RQ1A 5KG5A 1RHUB 1MG7A 5H9EJ 3PMNA 3OLBA 2C1EB 1K8AT 4IEEA 2Y0SC 4Y00A 3M6WA 4KLJA 3GPAA 4OZLA 5CYMB 4NLPA 2A1JA 4OI1A 3H5YA 4FCYA 1RI7A 2UXCJ 2I9SA 5M2RA 2N82B 5DG9A 4UB3A 7ICMA 2M88A 3SBMA 4CE6A 4USMA 1WDTA 5BN8A 5J2IA 4US9A 1T11A 2KG0A 4KMOB 2HFOA 1RZMA 1ZAXA 2G1HA 1ASVA 2Q79A 3IP0A 4NLTA 2AEJA 5GAGP 2JX2A 5AKLA 3D5MA 2Q31A 3QB0A 4MIAA 2FD2A 1KSPA 4AL7A 4LF4K 1ZD5A 1L8LA 1GMVA 2NRZA 1FXDA 3CJSA 2BGWA 5F0XA 4K0KJ 1REVB 2HFUA 2KNJA 2ASLA 3MN7A 3WXLA 1BQNB 5A0LA