2HHVA

T:o6-methyl-guanine in the polymerase-2 basepair position
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
b'KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*TP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhvA01
4RNMA 3LK9A 5SWMA 3T5JA 3RB4A 2E4LA 4Q5VA 3C95A 1A5XA 1K1SA 1T4GA 4HHTA 2C22A 3AVGA 4L8RB 1LWFA 4OGCA 7ICJA 4FS2A 4HUEA 1S9FA 1YT3A 1WSJA 3OHBA 2E6MA 1S0VA 8ICZA 4QCLA 4RQ8A 4DU1A 1UT5A 1X9WA 3K5NA 1ZBLA 5DKWA 4F92B 2DPJA 1ZYQA 3VQ5A 1QLNA 4CJTA 2KTQA 3AVNA 4E7IA 4YXJA 1CEZA 4RQ3A 2FBYA 3H4BA 3LPTA 1MQ3A 5BOMA 1DGSA 3PR4A 3IG1A 3GIKA 4GC7A 9ICKA 4PH5A 4KLSA 1N48A 5J29A 3RR7A 1MSWD 3M9NB 4J9PA 7ICLA 2G8FA 3L3UA 1SL1A 5CZ2A 3AV9A 3MFHA 4EYHB 4M6WB 1TVRA 4IQUA 4E89A 1ZBFA 4YMOA 4FS1A 1BPXA 5KG3A 4CHNA 4QWBA 8ICEA 4XQ8A 1ZQPA 1SUQA 1IO2A 3JPPA 3VQPA 1ZQQA 3EY1A 4Z6CA 1JL2A 3H7IA 5HMMA 4P2HA 3KIOA 4KRFA 1IKWA 3HXMA 4QOZB 3B6OA 1S77D 2FBVA 3QEXA 1X1PA 4M2YA 4Q43A 4PWDA 4GW6A 8ICHA 4ECTA 1RZTA 4MF8A 3HPHA 3PW4A 4FLUA 4YR3A 5J2AA 2J6SA 1WSIA 5F9LA 4NLZA 4YVZA 3HM9A 4H4MA 5KFYA 4ECQA 2HVHA 7ICUA 4CJQA 7ICEA 1TKXA 5D4BA 5DQIA 4CJ4A 2Y1IA 4R8UB 4RU9A 2XY5A 1GOCA 1RT3A 3V1OA 4CHOA 1TKTA 7ICIA 3T3FA 4KN4A 4CF8A 4DWIA 4Q8EA 3ZT0A 1F21A 4KPYA 4DSJA 3ALYA 2YNGA 4OKJA 3V1RA 3SJJA 2GBZA 2FBXA 5L9XA 4YFUA 3ZSRA 4MFAA 3AO2A 4H8KA 5CZ1A 2P1JA 2LYHA 4OGEA 4J9KA 1ZQWA 3ZSYA 3QIOA 3AO3A 4KITB 4CIFA 4KMUA 7ICFA 1JN3A 1B92A 4CFCA 1Q9YA 5KT6A 4DTMA 4F5RA 3KLGA 4F4KA 3KD5E 3QE9Y 3KK2A 1TKZA 5CY4A 3MGHA 3HVRA 4PUOA 5L1KA 3UXPA 1HJPA 2PY5A 1W0HA 1RBUA 1SV5A 3SPZA 4FJJA 2PYLA 4RG8A 4FJ9A 2ZUBA 4DTJA 2W9CA 2DFLA 8ICAA 4KHQA 1C0MA 4ZTJA 3O4QA 5T7BA 4CHYA 2DFFA 4NLKA 3HT3A 3AU6A 3K75D 1H38A 4FW1A 5J2FA 4JRPA 4J9OA 8ICFA 1RCHA 3SCXA 3JPOA 3MGIA 1A76A 1QSLA 3AVCA 1UA1A 2Q3SA 3C2MA 1X9SA 3SYZA 1ZQGA 4JUZA 2AGQA 4M6WA 4DTXA 4K8ZA 3B0YA 5L1LA 4I2BA 2YKNA 7ICMA 4PA1A 3ISNC 4J2BA 2PXIA 4OLAA 4DQRA 3T19A 1BVSA 3NDKA 4K8XA 1GOBA 3V7JA 2F8SA 3VQBA 1U49A 4DOCA 3KKRA 2IC3A 1WCNA 2VWJA 2KQ2A 4NLNA 3QEPA 3S3NA 3D45A 2BPFA 4P4OA 2HHWA 4B8AB 4DLEA 2O4IA 4J9MA 5KFVA 5F9NA 4F2RA 4R65A 4KAZA 3AA2A 2D5RA 3H8JA 1EX4A 4CF0A 5DG8A 2G8VA 3UQ2A 3G6YA 1SKRA 5JUMA 3K4GA 3OHAA 4I28A 4CE9A 5DG7A 2IAJA 2WOMA 4OLBA 3HL8A 1KTQA 3ZT3A 4XA5A 3IAYA 3M9OB 2UVRA 8ICSA 4GXJA 4KTQA 3EPGA 9ICJA 1U04A 4CJ3A 2YV0X 1BISA 3O3FA 1T7PA 1UA0A 3N97B 2FLPA 3KK1A 3PMNA 3OYKA 3RAXA 4O5BA 4DQSA 2R8IA 4F4YA 2W42A 5IIIA 4Q8FA 1S6PA 5JS2A 4FZYA 2OPPA 4IDKA 2NRVA 3AU2A 5CYQA 1S1WA 5J2NA 4JS4A 4FM0A 1V9PA 9ICUA 2ISOA 4CEOA 4CECA 2JZBB 4B9LA 1JLFA 5HP1A 3C21A 3AVAA 1BCMA 2NRWA 4F5NA 7ICVA 2X74A 3V1QA 3VQ4A 1MU2A 1VSFA 3TAGA 4AHVA 1LV5A 4TQRA 1BPZA 1LW0A 1JKHA 4C8LA 2J6UA 5KFUA 4I7FA 3TFRA 1JLCA 3K5LA 3VQEA 4ED0A 3OYNA 4DTPA 4DFMA 1HUOA 2AQ4A 3JSMA 1RTIA 3ISCA 3LP1A 3ZD8A 1TVAA 3AA4A 4BE1A 4RQ2A 1IM4A 4B9TA 3MR6A 4YNQA 1VSMA 4HYKA 4RQ4A 1L3VA 4RT3A 1WAFA 4FK0A 5DBCA 2VA8A 4NY8A 3G0ZA 3LZIA 3OJSA 4FXDA 1TL1A 9ICXA 1QS4A 4J2DA 4PHEA 4ZTFA 4DS5A 5KFBA 4LZGA 2P6RA 1ZQAA 4I9QA 4Z6FA 4MEXA 4HUGA 2X6NA 3V6KA 2WTFA 3KLEA 3AVFA 1ZQXA 4CJUA 4FBTA 5HMLA 2P51A 2DPIA 1BQNA 1WN7A 9ICVA 4CGIA 1O1WA 3S9HA 3RBDA 4GLXA 3V6DA 2ETJA 3EPIA 3LP2A 3GQCA 4ELVA 3PW5A 4LVSA 4CJVA 1KFTA 2HHTA 3ZDCA 1XO1A 4KLLA 4CJLA 5KFEA 2ZQBA 4IR9A 1RXVA 4BXOB 4YR2A 4BE2A 4GXIA 4FK4A 4C8NA 9ICSA 3MEGA 3DLEA 2MUTB 9ICWA 1XHZA 3T5LA 4FK2A 3C2LA 4ECSA 2ATLA 1ZQSA 4EBDA 2M9NA 4DU3A 4E1MA 3RJIA 2PFOA 4O5CA 1NK9A 2HB5A 2FC0A 2F8TA 2OA8A 4JWMA 3JPTA 2ZTDA 4Y1CA 2AQ0A 4M3WA 1J9AA 5KFKA 3OYBA 3PV8A 1DLOA 3V7KA 1S0NA 5J2EA 2FPKA 3OYFA 4F4ZA 4DOAA 5KFNA 2BANA 3VA3A 3L2VA 4YQWA 1JXBA 3QZ8A 4BE0A 3T1AA 2DFEA 1NK4A 1KFDA 1L3SA 1IKXA 4RZRA 4LSLA 5FROA 4MQ3A 1S1VA 2VG7A 2JZBA 2BQRA 1KVCA 1RBTA 4RW4A 4UAWA 1RDBA 3DLBA 4C8OA 1C0TA 4I2CA 3P83D 5IINA 2BGWA 1XS9D 4R63A 3RJKA 4BDZA 3BGRA 3QNOA 3C23A 1HJRA 4Z4HA 3F9KA 9ICNA 3NGIA 4J9RA 2FLNA 1XSNA 5J2IA 1EXNA 3V81A 3NBPA 3TAQA 3JPRA 4NLGA 3WNFA 4DSEA 3G10A 2IDOA 5CB1A 1Z3EB 2ALZA 1KCFA 5KFPA 3M9MB 2D0CA 4O3SA 3GV5B 4FZXC 2DFHA 2KFZA 4Q0BA 1MC8A 5J0PA 5KFWA 4CEQA 4YMMA 4JS5A 1ASUA 2OWOA 4CGFA 3I0RA 3JPNA 3ZDDA 4J9LA 3EWAA 5KRTA 4E7KA 3HPOA 2R7YA 2BE2A 4UB2A 2X78A 3H08A 4J2EA 3B6PA 4FJ8A 5K14A 4I2EA 2ITGA 4PGYA 5J2BA 4GXKA 4KLOA 3C5FA 4JLHA 2IHNA 4CJWA 1ZBUA 5J2QA 1JXLA 5KI6A 4HTUA 4DL7A 4DLGA 3CYMA 1LB2B 4CIGA 4FJ5A 3RMCA 3ZSZA 4PHAA 4Q45A 4DU4A 3L3VA 1JLQA 1ASWA 4KLIA 4AHUA 4CEAA 1BPBA 5DBBA 3OYGA 1HYVA 4WE1A 1HRHA 2JLEA 1BI4A 1UWBA 1Z00A 3KLFA 2VG5A 4AILC 1A5WA 1BPEA 3AVHA 3SQ1A 5DGBA 4CESA 2ZJAA 3RJGA 3Q8QB 2KW4A 4BDYA 5HHIA 2XY6A 4NCBA 4ED1A 2RPIA 5C5JA 4FVMA 3PMLA 1JX4A 2HNDA 4CGGA 2HHUA 3A2FA 4O3OA 2G8UA 1XHXA 1BGXT 2IS3A 1N6QA 1JLAA 4KTWA 4CF1A 3MEDA 4TSXA 1NK7A 3DRRA 4F5PA 3M8PA 4E19A 3KD1E 2ASDA 3RH4A 5C42A 5KG4A 2XY8A 1NOMA 1U45A 3TARA 2ZTEA 2UVUA 8ICKA 1J53A 2ATQA 4XIUA 3BQ0A 1I3AA 2A1RA 4YXMA 1N5YA 4KKOA 3SUQA 3RB6A 4KHNA 1D8LA 3HVTA 3I8DA 4KHWA 3MDCA 1CZBA 2YNHA 3ZT1A 3QESA 1KVAA 5KG6A 2AU0A 3NTUA 2E6LA 3HK2A 1SKWA 1VRTA 4KLTA 3K5OA 3L2QA 1WSEA 3C5GA 1ZQRA 3VQCA 4PGQA 4YFKA 3V6HA 4DSFA 3OJUA 4YCXA 3RRHA 3VQDA 2KFNA 5KFRA 3QO9A 3OS1A 4UAYA 4RW9A 3OGUA 4N41A 2C2DA 3OYIA 4B9MA 4TUPA 3G6XA 1T8EA 2AGPA 3SI6A 1Z26A 2BPCA 4F50A 2ZE2A 3ZSWA 1RNHA 2QKBA 1BPYA 3Q8RB 2W9BB 2HW3A 1S0MA 1B22A 2Q0ZX 4CERA 1UT8A 8ICXA 4QZFA 4O5KA 1IXRA 4C8MA 1YTAA 4NCAA 7ICNA 4DSKA 1KVBA 4ICLA 1KFSA 3TABA 3DOKA 1WCLA 9ICHA 8ICQA 4Z0UA 4FLTA 1RDAA 3OYCA 2O4GA 2R8HA 3ZDBA 4I2AA 1NJZA 1TK0A 3DM2A 1B9DA 3NF9A 1LAWA 2GV9A 2BR0A 2AGOA 4QWAA 3RJJA 4F3TA 1VRUA 1Z25A 2D0BA 8ICIA 3S3OA 5KFAA 2MAXA 4QZ8A 4KLEA 1Q9XA 4I2IA 4CF9A 2HHXA 3RRGA 5EOZA 3RTVA 3M8QA 1NJWA 3TI0A 4B9NA 4FLZA 3OSNA 1N56A 3WNGA 1FKOA 4AHCA 4LSNA 1ZQDA 5KFMA 4I29A 8ICJA 4TUQA 3ZDAA 3HP9A 1K1QA 1U4BA 4DEZA 2BDPA 3V6JA 5I3UA 4O0JA 4DTOA 2BPGA 4YMNA 4F8RA 4F93B 1ZJNA 1HNIA 4PQUA 3OY9A 3UPQA 3TANA 4FLVA 8ICLA 5HHHA 1IKVA 4CFDA 4QWEA 3GDXA 2HVIA 8ICGA 4H4OA 2FPMA 4QZEA 4ECXA 3NCIA 2BHNA 2PFQA 4E7JA 3ZD9A 5KG5A 4E0DA 4KLMA 2GUIA 4HUFA 2RDJA 5KT5A 3CFPA 4DO9A 1ZQOA 1C1AA 3RMBA 7ICPA 3AA5X 5DB7A 4DG1A 4J9NA 5KT4A 2F96A 2RDIA 4I2JA 2XY7A 2XO7A 2DY4A 5D49A 3AO5A 4O3PA 4K4GA 5CWRA 3VQ6A 2R8JA 5C24A 4FJMA 1S10A 2KZMA 4FCYA 4KB1A 4ECZA 4I2HA 3L8BA 4CK1A 3S3MA 1ZJMA 5FDLA 2VA3A 4M42A 1WSHA 4R66A 5FRNA 3IM1A 3K59A 1KLMA 3HPGA 2QK9A 4I2QA 4CJEA 3OYHA 2OZMA 3QLHA 1EP4A 5BOLA 3TAEA 5D46A 3WNHA 3V7LA 1TAUA 1NJXA 5EWEA 3M8SA 1RYSA 3HWTA 4HCCA 4KFBA 4CFAA 4KTZA 5J0RA 1VSKA 4Z4IA 5KT3A 5J2KA 3SPYA 2W9BA 4RPYA 4R8UA 3T5HA 3L2UA 4OKEA 3RB3A 4IBNA 5KFGA 1NKCA 5HP4A 3DMJA 4AHTA 4R5PA 3DLGA 3M8RA 1TV9A 4F4WA 4IR1A 1S76D 3ITHA 5BPCA 4NM2A 3O4NA 2G8HA 4J2AA 5CP2A 1ZQFA 5KTQA 4FLXA 2I1QA 1RT4A 1LW2A 2JGUA 3GILA 7ICHA 7ICOA 2LSNA 4FM1A 3AVKA 3P1GA 3UXNA 3ZT4A 1RBRA 8ICOA 4M9GA 5CHGA 3WNEA 4N56A 4TQSA 8ICBA 5J0OA 1HYZA 4M04A 1BCOA 3LDAA 2A1JB 3GIJA 4DQQA 4Z6DA 2VWKA 4DTRA 3AVBA 5J2PA 3QERA 3RH5A 4RW8A 3UQ0A 4QW8A 4Z4GA 2IBKA 2UVWA 3E01A 2F1JA 3QIPA 8ICMA 3LWMA 8ICRA 1WAJA 4I27A 1RT6A 1D8YA 1EETA 1RT5A 3OYEA 4CEFA 9ICBA 4CJFA 2EX3A 2ZUCA 4M9HA 4RNNA 3SUOA 4I2FA 4ECRA 4O3NA 3H40A 3KHLA 5KGWA 1ZQLA 4FO6A 3EW9A 2OPRA 3TWHA 2FLLA 4I2PA 4M3UA 2NRTA 5KFDA 4KHSA 1TAQA 2FMSA 3NF7A 1X9MA 4QAGA 4GC6A 4F5OA 1S0OA 5J0UA 4RW7A 4TURA 4CGJA 3EZ5A 2FPLA 4MF2A 1X2IA 4EZ9A 2XC9A 3AVJA 1ZQIA 3Q8KA 5KT2A 3QEBZ 4E3SA 1ZQBA 3PW7A 4FJKA 5EWFA 4O55A 2QKKA 4KLFA 4EYIB 1A77A 4JV2A 1C1BA 1TFRA 1DOQA 4FJXA 2G8WA 4JRQA 4YG2A 9ICRA 1TK5A 3VQQA 3I0SA 1HQUA 3KHGA 2ASJA 1RT2A 3LP0A 3VN5A 3NH1A 1XWLA 3C2KA 4ID1A 9ICMA 4O5EA 3HSTB 5J0SA 4AHRA 4CIEA 2BCVA 3FFIA 2XCPA 4RPZA 1TL3A 5KFCA 3OYJA 3CG7A 9ICCA 1CXUA 4UB4A 1Y88A 2HMIA 5KGXA 5HBMA 4I2DA 4YR0A 2HHVA 3DLHA 3DRSA 2W9MA 5KG2A 3UIQA 5DQGA 3N4MB 1NOZA 4M3YA 5KG1A 4K4IA 9ICOA 1RILA 1NJYA 4B8CA 4K4HA 1J5OA 4QZ9A 5KFOA 4CJ5A 3RMDA 2Z1GA 2H5XA 1JMSA 4LZDA 2Z1IA 9ICQA 1D5AA 2R8GA 4B9VA 2IA6A 5SZTA 4JV0A 3PUFA 3RAQA 2HNYA 3VQ7A 4KLGA 2OZSA 3K57A 1SL0A 1S1TA 2A1JA 4F2SA 5DQHA 5CJ7A 1JLGA 3DI6A 1NK6A 1RDDA 3IS9A 4QZBA 4DL5A 5DLFA 1QSSA 3RR8A 4FJIA 3VA0A 4IG0A 4DTUA 4O3QA 4RUAA 1GOAA 1S97A 1ITGA 1ZQNA 3AO1A 8ICCA 4P4PA 3O3HA 4LH5A 1UAXA 4YD1A 2A1SA 4DS4A 4DQIA 3RB0A 1NOYA 3Q8MA 4DFKA 2JEGA 8ICUA 4UBCA 2F1IA 5KFFA 3BQTA 3MABA 1JL1A 2YHBA 3CQ8A 4FLYA 3ETLA 2VG6A 4CK2A 4RQ7A 3ZDEA 3NGDA 2B21A 1BL3A 4CK3A 3NH0A 4IG3A 3MR3A 3KLHA 3VQ9A 3ISBA 1VK0A 3KJVA 8ICWA 1A5VA 1S9GA 5DLGA 3QEWA 1TV6A 8ICTA 2HNZA 3C94A 4ED8A 4RUCA 1LWCA 1HUZA 5J2CA 2I9GA 3OYLA 3V9XA 4W5TA 3V9SA 5J0YA 4N47A 1QSYA 4I9LA 1EKEA 3NAEA 4RT2A 4QZAA 4O3RA 7ICSA 3CFRA 5DDYA 4Y1DA 1ZBIA 3OYAA 5J2MA 4B9SA 3G6VA 4E7HA 3TFSA 4OVLA 4PHDA 2V4RA 7ICQA 2KZ3A 4BXOA 4IQTA 2FMQA 3KHRA 2Y1JA 4ECVA 4QZDA 3DRPA 2AJQA 1RBSA 3OVNA 4FJLA 4ZHRA 4M9NA 2MUTA 3V9WA 1VSDA 1G15A 4M0AA 2RN2A 4YP3A 4OJRA 2HHQA 3C6TA 1JIHA 9ICEA 4ELUA 1ASVA 7ICKA 4DOBA 3OYMA 4TUSA 4HCBA 2P5OA 4LH4A 4BWJA 5KFHA 3JPSA 3BJYA 5J2GA 2IGIA 4IQVA 3KTQA 7ICRA 4J9SA 5CA7A 4NCGA 4DL6A 5KG7A 3ZSOA 2FMPA 5KT7A 4FBUA 2V9WA 3PX0A 3HO1A 4RW6A 5HLFA 3ZCMA 4MFFA 3SV3A 4N5SA 1L3TA 3LWLA 3GV8B 3ISDA 4KREA 5HRSA 1HYSA 2FBTA 4QWCA 2QXFA 1D9DA 2ZTCA 1RXWA 1T3NA 3AVMA 2BQ3A 8ICNA 1Q8IA 4W5OA 3TAPA 5DBAA 2W9CB 2X6SA 1D9FA 4MFBA 1TK8A 3T5KA 2NUBA 3SI8A 3LAKA 4QZGA 5EWGA 1COOA 4RNOA 4B9UA 3RJFA 1J54A 4NYFA 4CHZA 3PNCA 5IIMA 3FYHA 3SQ2A 4AHSA 4KN7A 2ZJ5A 9ICFA 4Z4CA 4BACA 4M47A 4DFPA 1B43A 4F3OA 1YTUA 3QZ7A 2HHSA 1ZQEA 4CJSA 4IRKA 3V4IA 1HMVA 5IIJA 4B08A 3ZSVA 3TR8A 8ICVA 1CXQA 1XI1A 4FJ7A 1ZQJA 2OPSA 4Q44A 4M45A 5L1IA 4LY7A 4CEBA 4DSLA 1U9LA 1C7YA 5KFQA 2ISPA 1ZQZA 2VANA 3FDSA 3D0PA 1VSJA 5J0XA 4CEEA 1W9HA 1RTDA 4DQPA 2BCRA 3CFOA 1I39A 2F1HA 4FZZA 1LAVA 3HJFA 3GIMA 3GFKB 4IRCA 3MBYA 3VQAA 3MXJA 4NXZA 5TZVA 2YHAA 4ECUA 2VA2A 4KLQA 1S1XA 5HRPA 3HW8A 4ED7A 2EHGA 3BQ2A 2OYQA 4HVJA 4KO0A 4CGDA 3NH2A 5J2DA 5DGAA 3AVIA 4E1NA 4DF8A 3PW2A 3K5MA 2P6UA 3BQ1A 2YNIA 4PY5A 4M3ZA 4W5NA 4M3TA 5IIKA 3V72A 3ZSXA 5IIOA 2XGPA 3P5JA 4DMNA 1ZQCA 2Z1HA 3CM6A 3NF8A 1RBVA 2YKMA 3HP6A 3SQ4A 3U6FA 4ID5A 3LDSA 1AROP 4MEYA 3PVXA 5J2HA 4KI4A 4I2GA 4KI6A 2PZSA 5KG0A 1PZNA 2JEIA 1KLNA 3QEIA 4Z6EA 4ZH4A 1XSLA 3F73A 4GVMA 2V4QA 1NK8A 1ZQYA 1TGOA 2XRIA 4DF4A 1VSIA 2JEFA 1CLQA 4QZIA 2C28A 5DDMA 5E41A 3TAFA 2C2RA 3Q8PB 1T05A 5HRNA 5KFLA 4KLUA 1QQCA 3NGZA 5KFZA 3MFIA 3QEAZ 4JK1A 4XRHA 3BDPA 4PPXA 3AO4A 4RQ6A 2B6AA 1NKBA 2GWSA 1ZBHA 3NF6A 5KFSA 3MXIA 1SL2A 1JLBA 3NGYA 3EYZA 1QHTA 4F91B 4QWDA 1VSLA 8ICYA 2B4JA 4CGHA 3LALA 5J0QA 2P66A 1DTTA 4KLHA 3OS0A 1DTQA 4F5QA 1REVA 3ASMA 4F4XA 3H8SA 5DB9A 2BCUA 4KLDA 3PO4A 4M9LA 5DK5A 4QZCA 2RF2A 4YN4A 4ECYA 3RJEA 3MAQA 1MQ2A 5DMRA 4EP4A 3V9UA 3MDAA 3KKSA 4LD0A 2IHMA 2XHBA 3V9ZA 4UB3A 3LANA 3ZT2A 4IRDA 4M3RA 4BGDA 3SZ2A 3MR5A 1C1CA 2BKEA 3RJHA 3UXOA 3SQ0A 5J1EA 1EXQA 5KFJA 1S6QA 5FRMA 2ZUDA 1NK0A 7ICTA 2UVVA 1JLEA 4M3XA 4NM1A 2W9AA 2R8KA 4O0IA 4M41A 2PI4A 2W8KA 5I42A 4QZHA 3C1YA 4DTNA 5DB6A 3SUPA 3B0XA 4RQ1A 1L5UA 3ORYA 7ICGA 1FK9A 3GV7B 4EZ6A 3QINA 4OPKA 4AH9A 1CUKA 1BIUA 3K58A 4FJHA 4UBBA 4DTSA 4FYDA 5KFXA 5IILA 3PY8A 1HPZA 1YVUA 1ZETA 1C0UA 1S9EA 2G8IA 1SKSA 4CJRA 1QTMA 4O44A 4UAZA 4EP5A 4CHPA 2J6TA 3C6UA 4IKFA 3DOLA 4KV8A 4FJNA 3QNNA 3MR2A 1XC9A 1K6YA 4DL3A 1R0AA 4W5QA 4DFJA 4G1QA 1KSPA 1BPDA 2ASLA 1ZQUA 1BHLA 5KFTA 1CZ9A 5J2JA 9ICAA 1IH7A 5CYMA 2BCSA 2ZD1A 4JV1A 3RH6A 2B5JA 1HNVA 2PFNA 3L2WA 1L3UA 2PYJA 4IQWA 4IFVA 4N76A 3AUOA 4YD2A 5KFIA 1ZQTA 5C25A 3NHGA 2PI5A 3KLIA 4CHQA 4DSIA 3SV4A 4X5VA 4G3IA 1U47A 1KEJA 3RMAA 1IKYA 4CFBA 3OS2A 3E2EA 3DLKA 3KK3A 4DL4A 2ZJ8A 3ZSQA 1RPLA 2RKIA 1UOCA 4OPJA 5CR0A 3SNNA 5HRRA 3RWUA 3AA3A 3MECA 1ZQVA 5HNKA 3VQ8A 9ICPA 2PFPA 3LP3A 4GMJB 4XUSA 3U3YA 2DTUA 4FW2A 3H8WA 9ICLA 4ED3A 1WLJA 2G8KA 3KHHA 3DLRA 3PX4A 3C1ZA 1BIZA 1VSEA 1BQMA 8ICPA 4FLWA 1BI4B 1Z00B 2XGQA 3PR5B 3THVA 1VSHA 1Y97A 5D3GA 4FM2A 3JYTA 4ELTA 1XSPA 4E7LA 4UB1A 5EU7A 1B9FA 4R64A 4ECWA 4QW9A 1RT7A 3HX0A 1QE1A 2BCQA 2OPQA 4CCHA 1WSFA 3PW0A 4ED2A 4C8KA 3ULDA 1U48A 4O9MA 1TKDA 3AVLA 4M9JA 1XU4A 2BGGA 4CEDA 9ICIA 3LPUA 3RBEA 5DG9A 4KB0A 1C6VA 3DYAA 4RPXA 1KRPA 5HROA 3JPQA 2P5GA 1ZQKA 4O4GA 4KHUA 5L1JA 3OSPA 3O3GA 3Q8SB 1RTJA 3H4DA 1ZQMA 4CF2A 4J9QA 3L2RA 4BDPA 4NYNA 3Q8LA 4CJKA 4PGXA 2KZZA 4KHYA 4B3OA 2C2EA 3LZJA 2JEJA 3MXMA 3QEVA 3MEEA 2I5JA 4P4MA 5J0WA 3NE6A 4PHPA 4ED6A 1WSGA 4Z4FA 2XCAA 4EBEA 2NRZA 3OYDA 5DB8A 1S1UA 3QETA 4CJPA 1JXEA 3LAMA 4EBCA 2D0AA 3HYFA 4OKKA 3NFAA 3SUNA 1RTHA 3IHQB 5J0TA 4FJGA 9ICTA 2Z1JA 3TQ1A 4EEYA 4CEZA 9ICGA 3U3GA 2YNFA 2NRXA 4RQ5A 4BWMA 4W5RA 1T03A 4Z4EA 1FXXA 1KDHA 2WONA 1S5JA 3IRXA 1ZQHA 2W8LA 1LWEA 3TAMA 4UQGA 4RQ0A 4UB5A 1FKPA 1RDCA 1IG9A 2KN7A 3PO5A 2IMWP 5JS1A 3K2PA 1NKEA 4IFYA 1NK5A 4DL2A 3CM5A 4KLJA 3PX6A 2IOCA 5KRSA 4JWNA 1SZPA 2BQUA 1RYRA 1RT1A 3GIIA 4MFCA 1HQEA 1WNSA
chains in the Genus database with same CATH superfamily
4RNMA 4P0PA 4Y2MA 2FHJA 4K4UA 2E4LA 4G9ZA 3O0FA 5ALTA 2AV5A 3L95X 4ZJLA 1K1SA 4PABA 2G09A 4HHTA 3RBXA 4C4SA 2KVCA 4WFAL 4L8RB 3D7EO 2P9IA 4OI2A 2E6MA 1S0VA 4H5VA 1ZQ1C 3TVZA 5EHHA 1QZ5A 1Q95G 1PGZA 3LM2A 1UT5A 1X9WA 1H7WA 4AL6A 5DKWA 2M7SA 5BJRA 1IJEB 2DPJA 4PWWA 1NJIT 2UXCJ 2UUAJ 1FRHA 3UCGA 2MGZB 2F1FA 3AVNA 5ALPA 4E7IA 1CEZA 1MMDA 3H4BA 1MQ3A 1DGSA 3PR4A 2PIIA 3C16A 3GIKA 5A0YB 4USKA 2NREA 2RAQA 1XBWA 4PH5A 1HD1A 2YH0A 4KLSA 2XLKA 5AI5A 3M3ZA 1RAFB 2CWXA 4H4OB 3Q7CA 2G8FA 2BM1A 4X4PA 2M8HA 5CZ2A 1S99A 3MFHA 2DH9A 1TVRA 1FVSA 3GJTB 2YX4A 1ZBFA 4YMOA 4F3QA 1W7WA 4FS1A 3H8MA 3G6ES 1HNXJ 8ICEA 2IYGA 3DXKA 3U1MA 1MWQA 3PJWA 1L7PA 2W3RA 5LMUK 3H7IA 4P2HA 2UV8A 4RL1A 5M1QA 4DV5F 1IKWA 2O8DA 2WF6A 5C24B 3LO3A 2KG0A 2AZ3A 3CJRA 4K4TA 4M2YA 2E2OA 2VGMA 3I6PA 2WUSA 2YQ0A 2O01C 1W2BR 1RZTA 1SJ3P 3HPHA 1AFIA 2E88A 1VQSA 3TZXA 1YITN 5EE3A 2D7SA 4F71A 5KFYA 2A6OA 2E8AA 2BZFA 7ICEA 2R7VA 1NJIO 5DQIA 5K8PA 3ENHA 2ZVIA 2Y1IA 5GAEU 3ISZA 4R8UB 1NU0A 4JYAK 4TLRA 5HVHA 3MDQA 7ICIA 4KN4A 3GR0A 1U2FA 4Q8EA 1E3MA 6FDRA 2LYVA 2YTCA 4M95A 2MTLA 2I2YA 1Z2ZA 4DSJA 5CYQB 1OYEA 5L9XA 4YFUA 4OJLA 2LBOA 4ZCKA 4FOIA 2EI5A 3ZSYA 3EE8A 1WB9A 4KITB 4CDIA 2NYVA 7ICFA 4FWNA 2F77X 1R43A 5J2PB 2DJWA 2CQ4A 3KLGA 4F4KA 3KD5E 1TKZA 5CY4A 3HVRA 4PUOA 3EGZA 4HDHA 1HJPA 2P9LB 2F63A 5BR8J 4OZ0A 3QIPB 3UDCA 3A0IX 1S57A 4PG4A 4OYMA 1N36J 4RG8A 3CCQN 1EETB 2IVYA 1COKA 2DFLA 1NBWA 4PG7A 1YBUA 4NLKA 1K8KA 2Z7JA 1H38A 5IQ6A 4WKRA 3IR7B 3MM7B 4FW1A 5KL1B 4JRPA 4QOTA 3SR6A 5DDQC 3NP5A 3IWNC 1YI2N 1M0SA 3BP8A 2FVSA 2RQ5A 1N34J 1Y0HA 2K4EA 1X4DA 5AK4A 2ZXIA 3B0YA 5MLCQ 3M1YA 3N7RC 7ICMA 1QUPA 2KHOA 4J2BA 5D8HB 4DQRA 3NDKA 3HI9A 4BC3A 2ZIXA 1SJQA 3G8TA 2IC3A 5MLCV 4P71A 4YDDB 1Z2LA 2CQ2A 3FQLA 5AQMA 4J9MA 5KFVA 3QUBA 5F9NA 4R0JA 5ALXA 5L39A 2B9WA 2D5RA 1EB0A 4P73A 3I8BA 4FZLA 4CF0A 1RE1B 4PZNA 1U1PA 3AARA 5FLXO 4I28A 4CE9A 4OZ3A 1VQ5S 2IRYA 4MAKA 1NGHA 5E3QA 4XA5A 1J97A 3IAYA 3M9OB 2UVRA 3HOSA 3EPGA 5ALDA 3OFGA 2QARB 1T7PA 3UR3C 4JI1F 2XIDA 2A3ZA 4U7UD 2HI0A 4DQSA 2LXUA 2ZHAA 3MAAA 2OEHA 2W4CA 1N0UA 3H5UA 2NRVA 2EPIA 4LSLB 1S1WA 2D1KA 4JS4A 1V9PA 2VH7A 3VZIA 5EX0A 1JLFA 4B9LA 3MCOA 4CECA 3R3LA 3CC2S 3AVAA 2NRWA 2V8DA 3M6WA 1X40A 4YN3B 4F5NA 2NXCA 3G9CA 3NNHA 3EE9A 3R1XA 1I94K 3FMWA 4QS9A 3U02A 3Q8VA 1VSFA 3TAGA 1LV5A 2ACYA 1LW0A 3AD9C 2J6UA 3PACA 4I7FA 3R2DJ 5C2FA 3FBEA 4MIWA 2R7TA 1WDTA 4OLPA 3OYNA 4DFMA 1UJ6A 4J91A 4C23A 1Q5VA 2AX0A 3ISCA 3NVYA 5LXRA 5AE3A 5HR6A 1TVAA 4BE1A 4RQ2A 3MR6A 3ZTRA 1B99A 1UVKA 4F04B 5F8LA 2VHGA 3SBGA 5CHIA 2WF5A 2GAHC 4Q0BB 2LQ5A 3J80Y 3IN5A 4FK0A 2DR9A 1FNXH 3G0ZA 4EX6A 2ZBRA 2KMDA 1WG5A 2MQ8A 1TL1A 9ICXA 1QS4A 2G08A 2NQPA 4JNEA 2R2SA 3OTOJ 2NYIA 3FCHA 4LZGA 5ETVA 4I9QA 1HARA 4MEXA 1J5EK 2I7NA 3V6KA 3PYDA 4R0EA 2WTFA 2VFSA 3CCEN 1H2UX 1TZ0A 2OI2A 2IJFA 5HMLA 2P51A 3GJRB 3QU4A 4CGIA 3EICA 3S9HA 1T9YA 3HLUA 1VISA 3TYTA 3LP2A 5E26A 3GQCA 4ELVA 4I6AA 1KFTA 2EK6A 1XO1A 4KLLA 3W2WB 1UPPA 4CJLA 4DR5K 1WORA 5AE2A 4OO1J 2ZQBA 4BXOB 4FK4A 4ICLB 1N0VC 1WHVA 4LF9F 1S6UA 1RI7A 2IVOA 9ICSA 3DLEA 5AQSA 3TJ9A 3C2LA 4ECSA 4I1TA 2G0IA 1ZQSA 1REGX 5E3CA 4DU3A 3TR5A 2NPIA 1SJFA 1X3NA 5HL7L 2F8TA 1IG8A 3JPTA 2ZTDA 2BYCA 2EFQA 1AW0A 4Y2PA 3OYBA 3PV8A 1FWKA 5ALJA 2VC0A 3PIPQ 3NVMA 4F4ZA 4DOAA 2QIFA 5KFNA 1RHRB 4X65F 4YQWA 1JXBA 3QZ8A 3WKBA 2DFEA 1VQOS 1FFVA 3O8WA 1IKXA 2KL8A 1F9FA 1MN8A 3K89A 4MQ3A 3N6NA 3QFWA 4WP9A 1KVCA 3N4QA 5BPNA 4RW4A 4UAWA 1RDBA 4L72B 2ZF5O 2E9TA 4RU2A 3L4IA 4GFJA 4MN4C 2BGWA 1N54B 3WK5A 1XQIA 4WFAQ 1OPIA 2K3IA 1XS9D 3TOQA 3MM8A 1S8OA 5H9FK 3ATUA 4BC9A 2AW0A 1IQZA 2WHOA 4Z4HA 2E2PA 9ICNA 5ETKA 2DGQA 3HHLA 1UP1A 2YX7A 1Z1ZA 2EWSA 5AM4A 1EXNA 3NBPA 3WNFA 3P49B 4DSEA 1MDUB 5CB1A 2ALZA 3C15B 5KFPA 3VHQA 2DFHA 3SFGA 5AI8A 1V4TA 4KSEB 1ZM9A 5T41A 2DGWA 4IQMA 4CEQA 3NG8A 3OV7A 2A2DA 4F67A 3QBWA 1ASUA 2OWOA 4TKTA 1P90A 4CGFA 3I0RA 3CPWM 3TJAA 2NSBA 1FFWB 4GV6A 4XH5A 5KRTA 3O9SA 4UB2A 3H08A 3B6PA 4E98A 1HR0J 5K14A 1L7OA 4KLOA 2AYMA 2IIHA 4ETXA 2DR6A 4GVBA 3MOZA 2E5LK 2JWLA 2Q0UA 1K47A 2VYPA 1OS5A 3TJ8A 4HTUA 4DLGA 4TYBA 3NVWA 4CIGA 1ELOA 3ZSZA 3ZZZA 1E6YB 4O4RA 4E2FB 4PHAA 4DR1J 4LFCF 4DCHA 2HF4A 2IFXA 1KAZA 2H4WB 1MA9B 5BXIA 1ASWA 4KLIA 4GKKK 1EQ0A 3OYGA 5EUHA 2JLEA 4JI8J 2QRRA 3KLFA 2VG5A 5ALOA 2JMGA 4AILC 1FEHA 3WXKA 4QU7A 2O6KA 2V9KA 4JKGA 3CIPA 3OBWA 4QIEA 2KW4A 3VGMA 1KBUA 3TRGA 3FZ2A 4NCBA 3W63A 4F25A 5JMNA 4ED1A 5C5JA 3A8JA 3HHLC 3VAJA 2HHUA 2V0NA 2VBWA 4BVPA 2LPEA 1BGXT 2IS3A 3MMBA 5F8MA 1VMBA 5F8HA 2ZH2A 5L9NA 2ASOA 4TSXA 1H1VA 4ID5B 5F8IA 5KOWA 3RH4A 1P9QC 3OR2A 2MKJA 2J8SA 4PQAA 4BRQA 2HZVA 4QJVA 2CJQA 3HD2A 5GAGP 4KH5A 4Q2LA 3SCKE 1J53A 4BLGA 3CJ5A 4CLWA 1I3AA 2GMHA 3CCRN 4P6QA 3EZWA 5CD4H 1N5YA 3SUQA 4URSA 2ZC4A 4HT7A 3MDCA 1FFSB 4OHWA 3RG6A 4YY3F 4FKXA 1W25A 4K4XA 4IZ9A 5J1NA 3QMQA 2JV3A 5D4NA 1GXLA 2VD3A 4ZPWR 2HFSA 1U6FA 4LR8A 3IWXA 3TX8A 4K8RA 5LMUF 6FD1A 4JAXA 2PAVA 2A0FB 5HMWA 2X3GA 3CJ7A 3L2QA 4CZKA 2KXHA 4YFKA 1OH7A 3V6HA 1YJNN 3KVGA 3M2UB 3QNWB 3ENVA 5KFRA 2B7CB 2RHKA 4DV1J 3OS1A 3I1YA 4D3GA 4Y34A 3ZETA 1OYDA 2C2DA 2L3MA 1VQYA 1T8EA 3SI6A 1U2VA 2VJVA 3ZSWA 4YB5A 3PEJA 3DV9A 5LL6d 2RU3A 2DGSA 4KFBB 5B08A 3Q8RB 4WYLA 2OSRA 2HHHJ 3Q22A 4DL0C 3GCXP 2HW3A 1B22A 3C7NA 3UN5A 2Q0ZX 4JYAF 4CERA 1UT8A 3ZZYA 1FEEA 3ZLJA 1HBOB 2EH9A 7ICNA 5A6PA 3WDOA 1Q0NA 1KVBA 1KFSA 1DHMA 3DOKA 1WCLA 3D7SB 5A6WA 3HSZA 1QAIA 2XS2A 1RDUA 4BR4A 2R7QA 1GXTA 1F3FA 4Z0UA 3CCUS 4FLTA 3FGVA 3F2KA 3DM2A 3NF9A 2CPHA 3M30A 3ZZTA 2GV9A 4OJ3A 3BB5A 1U0SA 1UFWA 2DNHA 2QWPA 1FO4A 4QWAA 3RJJA 3I56S 4F3TA 1VRUA 1KOOA 1Z25A 1BUPA 2ZDPA 3UKUA 1OSDA 4KBIA 1N32K 2XMAA 1Q9XA 3K8WA 2VC1A 3RRGA 4B3TJ 5EOZA 3M8QA 1AFJA 1NJWA 3TI0A 2HQFA 4FLZA 4LFBJ 1RWPB 2E5JA 5IS2A 5DDRC 2DRBA 2E29A 3CJ4A 2GFFA 3CCJN 1ZQDA 4TN2A 1FRKA 4I29A 4TUQA 3HP9A 4PZVA 1LFPA 1HPZB 1SCJB 3E1YA 2BDPA 3A8IA 4DFDA 4EI2A 2CKWA 2BPGA 2GX9A 3VF6A 1LK7A 4F93B 4A8EA 3VF2A 3HZGA 2YWKA 2V7ZA 3DOLB 1F5CA 2ZWOA 1KN6A 4MDBA 2VDHA 2ES6A 3DEEA 1IKVA 4A2AA 3GDXA 2BJ1A 2WF9A 4G1QB 4AYBC 1QDUB 3O4WA 5C12A 4QZEA 4ZPBA 4B3MJ 2XLIA 3CCLN 2BHNA 2FY8A 2PFQA 4E7JA 2D3OR 3CFPA 4DCJB 3RMBA 1T9XA 5DB7A 4DG1A 3WXMB 5KT4A 3F0NA 3IC1A 2F96A 3EVOA 2RDIA 3DNCA 3CO0P 2XY7A 4HR2A 2DY4A 1HQ2A 3A0HU 3VQ6A 4LF4K 2F7TA 2OAUA 2W25A 1HKAA 4OCZA 3JSRA 2NLXA 1Y9OA 4FCYA 3AAQA 4A8QA 3RSEB 3D6HB 4JN4A 3HOTA 2K1RB 2KYXA 3VOVA 4R66A 1VLBA 2LXFA 2XB2D 5LMNK 3IFEA 3FZBA 4KX5A 1NH7A 4JKHA 1U1KA 5HQ8A 4CJEA 2OZMA 3TAEA 2M52A 3V7LA 1TAUA 1X42A 1HNZK 1TL3B 1JMTA 2LMRA 2GVDA 4LJXA 4CFAA 4FSVA 4J5OA 5KT3A 2W9BA 1Q46A 4I67A 1N33J 3T5HA 4Y2VA 3K9KA 4IBNA 3DRSB 5KFGA 1QAYA 3HI0A 2LXIA 5I4MA 4F4WA 3KD3A 3BGOP 4A2BA 2JFDA 1UZHA 3ITHA 1TYQB 2Z2ZA 4J2AA 5KTQA 5AQFA 3D9BA 3FC9A 1RT4A 4ZP8A 2GOLA 3GILA 4I56A 2LSNA 2D0PA 2AJ4A 3MM5B 1HNWK 3P1GA 1I94F 4B3SF 1RBRA 3LF0A 3QBXA 2W03A 2KG1A 3WNEA 2PDAA 4N56A 2H3GX 4TQSA 5J0OA 5IXUA 2K7KA 2YY6A 1KAXA 1VIXA 2F8KA 2FXUA 3HT0A 3GIJA 2F4VJ 4I6MB 4DQQA 2D41A 2VWKA 1JLGB 4MKBA 5HL7Q 4QIVA 3RH5A 4RW8A 4Z4GA 2UVWA 3E01A 8ICMA 1LOTB 3QAUA 3MMJA 1RTJB 2HK2A 2HWIA 4I27A 1RT6A 1RT5A 3ZTQA 1FVQA 1HLWA 5CH7B 3BSNA 1WI6A 4ISFA 2N4CA 4M9HA 4FNIA 2OD4A 1PJ7A 1KONA 4Y2YA 2X1AA 1F60B 3UN3A 4MK7A 2YMMA 3QU9A 4O8KA 1RYUA 2OPRA 2ZJPL 5KPZA 3W61A 3TWHA 4I2PA 3IBFB 2BRKA 4H5TA 1D09B 1O13A 4KHSA 4DV4K 1V85A 2RIJA 3THWB 2FMSA 1C4AA 1Y11A 2ZH3A 1J5EF 1HBUA 4WCEL 1RTHB 3SSSA 4RW7A 4TURA 1L8OA 4CGJA 4MF2A 1R0CB 3NLCA 1EZZB 2XC9A 2HBYB 4WBFA 4QNLA 2DITA 2AEFA 3I5AA 5KPTA 5EWFA 3MC1A 2QKKA 4KLFA 2KV2A 1A77A 2JZ5A 1E6VA 4K4VA 1C1BA 1ZA2B 4DR5F 9ICRA 4DCCA 2L48A 4GKJK 4OI1A 3I76A 2ASJA 1S12A 3DGPB 4LT6A 1IJFB 1RT2A 3NH1A 2HOQA 1XWLA 2EBGA 1PCAA 2WBRA 3C2KA 2QFIA 4O5EA 1IBMK 1LXNA 2BCVA 2DNYA 1UCNA 3TKAA 5KFCA 3NY0A 2ASPA 4UB4A 5KGXA 4MLEA 4DBQA 4CP5A 5AQWA 2FD2A 4F0HA 4CZMA 3CD6N 4TNOA 2FQQB 5EE0A 4D3HA 9ICOA 2GX8A 2XWYA 4B8CA 1N5TA 2GHWA 2R2RA 5KFOA 3UDLA 1RFQA 2Z1GA 2I8EA 2DYAA 2PA8D 3VTIA 1D5AA 2R8GA 3I31A 2IA6A 2ZJRL 3B8AX 1FNMA 4CZEA 4LIWA 1XUPO 2H3EB 2MEWA 4H5RA 5GTHU 2PGCA 2IBOA 1SL0A 4PPZA 5D0RA 1S1TA 2A1JA 5DQHA 5CJ7A 2Y9HA 4K59A 1NK6A 4OYIA 2Q36A 2XSFA 2QWLA 2QSFA 1QSSA 5DLFA 4DR4J 3VA0A 4LBHA 4IL6U 1S97A 1NAQA 2H9ZA 1UAWA 1ZQNA 3NOGA 2VQEJ 4H0TB 4HHJA 1UAXA 2A1SA 1LEOA 4DS4A 4DQIA 2DGUA 2P5VA 1YRUA 3Q8MA 4BR0A 2JEGA 3BREA 2QI2A 1YKWA 2A41A 1GH8A 3WC2A 4B3RJ 3THXB 2VG6A 4M5DA 2M4MA 4RBTA 4CK2A 3ZDEA 3K1RB 3NNCA 1BL3A 3C2PA 3NH0A 4IG3A 3CCSN 3MR3A 3ENAA 1V6HA 3KJVA 3D2NA 4FPIA 3IBCB 5DLGA 3QEWA 3U1NA 3SEOA 4PWDB 4DMZA 1G4CA 2O66A 4JV5K 2E5LF 3OYLA 3V9XA 4W5TA 3KZBA 3V9SA 1QSYA 1WG1A 2CRLA 3CWJA 4QZAA 3SSRA 3VQTA 1HW9A 4ZA1A 4Y1DA 1X5OA 2CFXA 2PMWA 1T9VA 4E7HA 2XQCA 4OVLA 2A10A 1TKXB 2BJ7A 2ZM6K 4C0BA 1U6BA 2QW9A 3G2XA 2Q79A 2AJQA 1RT3B 4FJLA 3P8BB 1P9YA 4M9NA 1NMDA 1TMMA 4FZNA 5AQXA 1UKUA 4NL5A 3L7UA 3C6TA 1JIHA 3TTCA 4DN9A 3VAMA 7ICKA 2YNIB 1ASVA 4DOBA 1D1UA 5KQDA 2Q1NA 2DO4A 2DQNB 3IXQA 1QJHA 2PSZA 4NCGA 5G0RB 1Q79A 2FIUA 1VQ4N 1VLOA 5H2FU 4FBUA 3HO1A 2N3OA 2K8AA 2ZJQL 3VC8A 2J76E 2RRAA 4MK9A 4N5SA 1NPKA 4C11A 4C4WA 2W2NP 4LF5J 3X1LB 1DARA 1SV5B 2ZTCA 1T3NA 4TY9A 2A42A 1IG6A 8ICNA 3WIUA 3H5XA 1X5TA 2JHDA 1B7YB 4W5OA 3KKAA 2HGLA 3D6TB 4PRFA 2AP1A 1D9FA 4Y0WA 1CPZA 2CPFA 1DGJA 2Z2LA 3CCMN 2SXLA 1COOA 4RNOA 3RJFA 2DY1A 5LM7E 3WQPA 1KQKA 2HFOA 5IIMA 4OX9K 3T9NA 1ATRA 3KZXA 3MMAA 3SQ2A 4OX7A 1SXLA 4Y28C 2W2MP 3PG9A 2YX8A 3AAPA 1RG6A 4DFPA 1YTUA 3MD3A 3ZFVA 1JLBB 4OJHA 2NUHA 1YITS 5IIJA 4P7TA 3CDEA 4B08A 3TR8A 4EENA 4PZOA 1SC3B 4FJ7A 2W2QP 2J9DA 5M2RA 2P9GA 1F5BA 4DSLA 5CABA 5T7LA 2KKPA 2CAJA 2VANA 2E1YA 5J0XA 4CEEA 4PL7A 2BCRA 3I33A 3CC4N 5JU5A 1Z1VA 2LEPA 5F41A 2IAJB 3QJLA 2F1HA 4KY3A 5HVGA 4UASA 3GIMA 1TP7A 3VQAA 4BX9C 1MN9A 3A4TA 4NXZA 4A5AA 4ECUA 1KVKA 3I82A 3ENBA 3UMBA 3CO9A 4UZCA 3KK1B 4ANDA 2EHGA 1LKYB 2ESEA 3H46O 5CYJA 4A8FA 2QTDA 4QJFB 1VC6A 2BJDA 3KKAC 3NH2A 3CMAS 1Q3UA 2VJUA 2QYGA 5DGAA 4DUZK 1JNZB 1FFGB 3US5A 2KEYA 1WWVA 5AZIB 3ETMA 2CQ0A 5BYSA 1N32F 4J9UE 5HP1B 3V72A 2ZUGA 3B4DA 3ONNA 3TW0A 4M5IA 3JAMO 3P5JA 4DMNA 4P7VA 1S59A 2PD1A 3WUHA 2EANA 3M2RB 5I3QA 2PO4A 2XLJA 5J2HA 4KI4A 2CUYA 2V7YA 1KLNA 1QY7A 3H0RB 1TL5A 3F73A 4MK8A 1BDGA 2UUBJ 2AP6A 3W3SA 4GVMA 3LP1B 2P9UB 2D74B 2BKNA 1NK8A 4NLPA 1ZQYA 1HWUA 3H2LA 4K50A 1V38A 4DF4A 2D69A 1CLQA 2LQ9A 3GG0A 2WF8A 2C28A 2CH5A 5C7PA 3S6JA 1QTNB 1SB6A 3PLAA 3TAFA 2MZJA 3Q8PB 1T05A 2KKVA 4N8NA 2B5JB 1QQCA 3WEEA 3MFIA 1YJ9S 3M7VA 1SWWA 1VCTA 3W2VB 2GIQA 4LF4F 2HIQA 2D4WA 4CT8A 3BO2A 3AODA 3BKFA 3CVKA 5H9EJ 2XMVA 3I55N 1CULB 3KLEB 2WVBA 4UQTA 5CR4A 3EMTA 2AJFE 1QHTA 2BKOA 5L8RC 3IM8A 4USMA 4PCQA 2ZVSA 1EJ7L 3ZZPA 3DLKB 3ADAC 4J9VA 3V6DB 2ZJPQ 3ETOA 1DTTA 3OS0A 2FHJD 1SQKA 2K4IA 3D2WA 2W7OA 3LA0A 4WCEQ 1HNZF 3BGLA 2BCUA 2OHDA 3MHYA 3OW2R 2XNRA 5DK5A 4ECYA 2C2NA 1KR4A 3MTKA 3DRXA 3VV2B 2KXFA 3W0LA 1AQ6A 3SD7A 2F4FA 3V9UA 1H2VZ 2IVPA 1K9MT 5BR9A 3M6ZA 2XHBA 4DR2K 4L6V3 4WFBL 1CJKB 3EUNA 5DM6Q 4M3RA 4DV5J 3SZ2A 2OJ3A 2K8BB 2X1GA 1C1CA 2BKEA 2ABYA 3UXOA 3M6GA 1G1XA 5AQQA 4P0QA 5KFJA 4RQNA 2IRXA 3SAGA 4LFAJ 2ZUDA 2VQFF 1OWXA 2UVVA 3WX8A 2GA7A 2MZQA 2HLTA 1VQMN 3P31A 1OY8A 1PAEX 4B17A 4NMXA 2BANB 4OYWA 2QYCA 3C1YA 2FC9A 4RQ1A 1L5UA 1RZMA 1APSA 4MYUA 1FK9A 3C28A 4EZ6A 1ATNA 1CUKA 1XMOK 5AICA 3MGVA 4TY8B 4Z7CA 5A8WB 3BS9A 1VBZA 2KKHA 2PT0A 2P9SA 1NH8A 4JI2K 4OJ6A 5GAHP 1C0UA 1S9EA 1Q8LA 2VKRA 2A6AA 1VGYA 1SKSA 4BROA 2RE2A 2NR0A 3MEEB 3O6WA 4KV8A 2ZJRQ 2K2PA 2V4JB 3SQIA 1ZZFA 1QQNA 2WBMA 2MSTA 1ZQUA 4C3KA 2ZH4A 2D1CA 2KSOB 4DV4F 1BHLA 2VOPA 5HQLA 2Y0SF 2XI2A 3H7HB 1OSCA 1K9MO 2MKHA 4P52A 2ZOFA 3DLJA 3ZTPA 4RNHA 1GMWD 3ULHA 2ZD1A 1XMQK 5EN1A 1IBKK 5LY3A 2PYJA 3ENWA 1WJ9A 1FRLA 3FRZA 2G0AA 4IFVA 4N76A 3AUOA 1PYOB 3J7YU 1D8ZA 1LWEB 2FJXA 4CBUA 2PI5A 1LWXA 3CMQA 2V52B 4CHQA 4DSIA 2KRBA 2J0SD 4H0XB 1U47A 1KEJA 1SV4A 4GKJF 1BU6O 4LF8K 1IKYA 3OFHA 2VPYB 4IFYB 3E2EA 8AT1B 3KK3A 4DL4A 2ZJ8A 2V2QA 5EX3A 1RPLA 2RKIA 1G99A 3HVAA 1IBMF 3VEOA 2R2TA 1GTHA 3RWUA 3NMUA 1JK9B 1HQEB 2RILA 3UKRA 4XUSA 2DTUA 3CJBA 4FW2A 3EL2A 1JLQB 2M5YA 5IT9Y 3FKBA 5JRTA 2E7WA 1BQMA 4FLWA 2XGQA 4WXWA 1KTVA 3PR5B 4GO7X 2BJ9A 3M2VB 5HSPA 1SXEA 2E1PA 2HOEA 2Y0SC 4IO9L 1SC6A 3TTDA 3BSCA 1XSPA 2P9IB 5A76A 1S3XA 4EFAC 5EU7A 4K7QA 4QW9A 2A1AA 3HX0A 2OMLA 1B4SA 3KG0A 2FJBB 2WF7A 4A61A 3KWMA 2F65A 2W7AA 1N6QB 1JLAB 2QG9B 4O9MA 3RGIA 3V2UC 1TKDA 3AVLA 2HOIA 2CADA 2DGTA 2BGGA 4CEDA 1FDNA 3H42A 1BWEA 5AJ3F 3LPUA 4A8OA 3IAM9 3UFCX 1C6VA 2CH6A 3BF1A 2LQBA 5HROA 1ZAWA 3D1OA 2YPZA 4KAIA 2F8LA 4KHUA 3KUGA 4AUKA 4CF2A 1YX2A 3L2RA 1R0BG 2CPJA 4KHYA 2C2EA 3LZJA 2VDIA 4RTFD 2JEJA 2MQNA 4HDGA 2DBYA 3DXKB 2XCAA 4EBEA 3CEDA 3OYDA 1GLEG 2Z0GA 2GH1A 3QETA 2O8DB 4CJPA 4NLBA 1Q8BA 4UTGA 3NUQA 4BRGA 2EWHA 1JXEA 2NO5A 3RRKA 2HG4A 5DZ7A 3IHQB 3JQMA 4HT5A 2C3OA 9ICTA 3JXUA 1BXNA 4JV5F 4H4KC 4HACB 5LJ5Y 2NRXA 4Z4EA 1NCLA 1FXXA 1KDHA 1VQ9N 2W8LA 1UFLA 1Y5NB 4YB6A 3TAMA 4OV1A 1AUDA 1FESA 4UQGA 1RDRA 2RB7A 4UB5A 3AN1A 1XNRK 1IG9A 3TNVA 2IMWP 3K2PA 2ZM6F 1DK3A 1RUSA 1NK5A 4H0PA 5G5HA 3PX6A 3LH2S 5KRSA 4JWNA 1VQNN 5C15A 1TUWA 1RYRA 1RT1A 2KVQE 1PO6A 3WK7A 3AM9A 3R9LA 1WNSA 3MD1A 7FDRA 1Y5LB 1H0HB 1ULRA 5HMXA 1NNDA 2WAQF 2QX0A 3C95A 1NHKL 2QLTA 4B9QA 1HD0A 4OGCA 1TR0A 2MY8A 3B8HA 4KPCA 2B4PA 3W62A 5F3TA 1ZM2A 1WSJA 1BA1A 5K20B 3KJQB 2MQLA 2JX2A 1WWUA 4MKVA 2F44A 3KLGB 1CJVA 2GGPB 1TKZB 4UOHA 1SC1B 4PUOB 3W3DA 2IVNA 1UTAA 1ZD5A 2H1YA 1VHXA 3U8XA 3VQ5A 3D1HA 5CQGA 4LSNB 3WK4A 5LSLA 3JQKA 4LF9J 5ALKA 3HFVA 5H1SV 1KQSR 2FBYA 3LPTA 3CDWA 5I3UB 3PFEA 1XIQA 5FLXU 1K8KB 1L7NA 2H3VA 4BRPA 1N48A 2PFUA 5J29A 3RR7A 4NO7A 4OZLA 3NEKA 3P39A 4C98A 4JKFA 4KYZA 3OTCA 3S6EA 2EG1A 1WSRA 2J7KA 1SL1A 4ZLJA 1YJNS 3WHIA 4EYHB 3MGJA 4FWOA 2WAQC 2J9EA 3BEXA 4CLFA 4IQUA 2QLFB 2YKQA 1F3VA 1BPXA 2KICA 2DHHA 5KG3A 2W01A 1ZQPA 3WU2U 5ALLA 1LOUA 1FE4A 3VQPA 1ZQQA 2ZIXB 2CQHA 3KIOA 2IC3B 3CSKA 5JMVA 1JJ2R 4IS7A 2KE7A 4DR7K 3GU3A 2FSJA 1WWHA 4I0WA 3PKMA 2QWMA 2YHXA 2F9JA 2P9NB 1ZD3A 2XMJA 1VYAA 3UD4P 4NRUA 1KLMB 3PW4A 2CDRB 4FXWA 2YKPA 3BR8A 4PL1A 3QLHB 4X62J 1CS4A 3K0JA 1ZM4A 3HM9A 4YVZA 4CLTA 4H4MA 2HVHA 1Q4RA 5IC4B 1NM1A 5D4BA 4IOAQ 2ACMA 4ID8A 1C2PA 1HW8A 2O5DA 1GOCA 2UXBK 4CD3A 1NEEA 4OX8A 1TKTA 3HJEA 3T3FA 3BN7A 4CF8A 4ILLA 4DUZF 2J0WA 3ZT0A 4IJNA 4NASA 2YNGA 2E2QA 4OQJA 4OKJA 3V1RA 1KBRA 1W97L 2FBXA 3OT9A 2KNJA 2P35A 2P1JA 3CCJS 2VICA 3A12A 2E1CA 1JWWA 1YSJA 2QLWA 4DCPB 1ZQWA 5B09A 2Q0RA 3QIOA 3ILIA 4CIFA 4KMUA 5GADP 1JN3A 4CFCA 1Q9YA 4O3MA 5KT6A 4DTMA 4F5RA 3BS7A 3HHLD 3ZNJ1 3L0QA 2CG8A 2Y3YA 3CDAA 1RQNA 5L1KA 3UVJA 4YHHK 4M5HA 3MN6A 1RBUA 1YJ7A 3SPZA 3B78A 3QYPA 2EFGA 2PYLA 3CCLS 3HKZF 3FEYB 2HQ3A 2IJRA 4WFXA 3IRUA 5D4LA 2X51A 2D0OA 4DTJA 8ICAA 4JI3K 3EXYA 2JNJA 4KHQA 3AMZA 3WKAA 1D8BA 3J80O 2DFFA 3HT3A 3AU6A 1MNEA 4WZMA 2ITMA 4PL2A 2P9PA 1VHIA 4EEKA 3FLCO 4BR9A 3CP8A 1TL1B 2ZIVA 3SCXA 3JPOA 1A76A 2F2AB 2VKZG 3C2MA 1X9SA 4IH7A 1TFWA 4M6WA 4JI5F 2YHYA 2HFVA 4I2BA 3HF5A 2G1HA 4PA1A 1OIAA 3ISNC 3DFEA 2ROGA 4K43A 2OFHX 3HSJA 4DOCA 1WOOA 2V69A 1TTHB 1FD2A 2ASYA 2ADCA 5F0XA 2KDOA 4AL7A 3DOMA 3H2VE 2BPFA 2FZKB 3VAKA 2NZ4A 2K8GA 4F2RA 4E8UA 2RQMA 1Q78A 4NLUA 4CZGA 3LW5C 4NWBA 3AJ2A 3T1YF 2J7WA 2WBNA 4DX7A 3HKZC 1XJWB 3LP0B 4BRLA 5B0CA 1PBUA 4GV9A 5AE1A 3DLEB 3K4GA 1EARA 5DG7A 1WKKA 4AXJA 1FNOA 3D6FB 4DR2F 1KTQA 5LMUJ 4A5BA 3FFIB 2HVEA 8ICSA 1S4EA 3EGNA 1U04A 1RP5A 2BA9A 4IO8A 3OTQA 3H1VX 3O1BA 3OYKA 3RAXA 5ETNA 1ZH5A 3OBYA 3KHYA 1ZPVA 2R8IA 4F4YA 4IO1A 1S6PA 1N61A 1JNRB 4UY8T 1IKXB 4CZFA 4AL5A 1VAZA 4FPAA 4A8SA 1FI4A 3HM8A 4CEOA 3D2EA 5CEHA 1UVIA 5B0EA 1ZTTA 7ICVA 3V1QA 9ATCB 2DNGA 1GTEA 2ZZMA 2DHSA 4JYAJ 2BW7A 1BPZA 2WCXA 3MM8B 3GL1A 1C4CA 2MU2A 4JI2F 1SAZA 3TFRA 2BJ8A 1BWVA 4ED0A 1IUJA 3VETA 4A8MP 4IG0B 4DTPA 3JSMA 4LF6F 1BA0A 3CRXA 1Q86T 1MN7A 5HJXA 4B9TA 2GS8A 4ZDNA 5GINA 1L3VA 4RT3A 3H98A 1WAFA 4M5JA 4H0VB 4X66K 4NY8A 3ELHA 1FD8A 2KFYA 2IA0A 4FXDA 4J2DA 4ZTFA 4AYBD 5HMZA 1FRIA 1TUGB 1L6NA 3LPYA 2D9PA 3B54A 1D3WA 3BPDA 1KQGB 2ALYB 1ZQAA 1W2BM 4UOCA 2KH9A 1O0PA 1VS3A 2HNZB 5K14B 2L41A 1YBAA 4CJUA 4FBTA 4GVBB 2DPIA 1BQNA 4UY8O 4LF8F 5KNIA 1FRXA 4I4BA 1WOSA 2EAMA 1GXUA 5DM7Q 3JQJA 1RK8A 3EPIA 1FE0A 3PW5A 3CDBA 4LRCA 5IFMA 3D54A 4NLXA 3T1HF 2MJNA 1KWMA 2BM0A 2QZ8A 5KFEA 1URJA 1ZA1B 1RXVA 4BE2A 4CM2A 3B82A 3ZO7A 3DRPB 4YOTA 1WC5A 2WB1C 3MEGA 2DUYA 2VG5B 2AF6A 3KLFB 3CF5Q 3P6YC 1XHZA 2F76X 2MQOA 1XQSC 4JKGB 2XI9A 2CQDA 4E1MA 3U1LA 3V5RA 2PFOA 1NK9A 2IOFK 1F0MA 1Q86O 4KHRA 4QBUA 2OA8A 3D4JA 3MURP 2OEMA 2BE7D 4M3WA 3A3OB 5KFKA 3V7KA 1S0NA 2HWHA 5J2EA 2V94A 3OYFA 4ZCLA 3MUMP 3ZX0A 3N7PD 3MMBB 1KQFB 3T1AA 2FGCA 1NK4A 1R6VA 2EFPA 2B6GA 1VI7A 4PXEA 4RW6B 1HBMA 1YXQA 4FWPA 3F2BA 2VG7A 4BBYA 2FE9A 5JICA 4QS8A 4C4TA 1RBTA 4P72A 3PRBA 2KVSA 4C8OA 1C0TA 4JK9A 4I2CA 3P83D 4OZNA 2LCWA 2OSQA 1N5YB 3PSPA 1Q1KA 4JK8A 4ER8A 4TXSA 2ZHBA 3H45C 3TZYA 4JKDA 3VMFB 4OI0A 4BDZA 3BF4A 3QNOA 1QAXA 3PYGA 4BUGA 2IDLA 3QXGA 3F9KA 3QJPA 4NA2A 4IH6A 3SQGB 1RA6A 4ZLPA 1OKJA 2FLNA 3V81A 3CCSS 3PJ9A 3TAQA 3JPRA 1QVFR 1AZSA 3E51A 1Z3EB 1I94J 2XSJB 2D0CA 4O3SA 3K2YA 5KAFU 5T14A 1Y3JA 5J0PA 4Y2QA 2QWNA 5KFWA 4YMMA 4JS5A 3JPNA 3V4IB 5GIPA 4J9LA 3EWAA 2WHEA 4E7KA 3HPOA 2BE2A 3CGIA 2X78A 4FWMA 4WFYA 5L38A 2DH8A 4ZCMA 3GOIA 4I2EA 2ITGA 4PGYA 4GXKA 2IY5B 1XNRF 1N88A 3C5FA 2J4RA 3VR1A 2CRXA 2IHNA 2DNMA 4F4AA 5J2QA 1RTDB 3VEYA 5KI6A 4F72A 3UMCA 3AQEA 4FJ5A 3HCXA 3RMCA 1XO0A 4TVAB 3HRDD 1P7DA 3DOKB 1AXQA 2BACA 2P9EA 4EU0A 1VR6A 3CETA 3L3VA 4EX7A 4DR6K 3N6LA 2QMUB 1J5EJ 3VEZA 1HYVA 3UPFA 2YB4A 2CZ9A 1RDFA 1HRHA 3DWLA 4NLWA 1BI4A 1UWBA 1Z00A 2DKXA 1Z4OA 2G13A 1RBOB 1WKJA 3SQ1A 2ZJAA 4IOBA 2VF3A 1YTYA 3UWTA 3Q8QB 1WF2A 2FVRA 1R59O 2XY6A 2EC0A 2RPIA 3TUPA 1QD1A 4HL9A 3HSCA 2YI1A 4XAKA 4DR5J 3QDKA 1Q82T 1XHXA 1J27A 4QPTA 4KX3A 2B3TB 2Z2MA 4UUWA 2XMWA 2HGNA 1IXKA 3M8PA 3MWBA 3DAWA 1BMQB 4FP9A 1Y5IB 2XY8A 1U45A 2HAFA 8ICKA 3WIVA 3SIPB 3BQ0A 1V4SA 1KXPA 4YXMA 1IKVB 1X60A 4KKOA 4JP8A 1U1NA 2E9ZA 3BS5B 2E1RA 1D8LA 2UUCK 3HVTA 2FF6A 1CZBA 2AA4A 3DU5A 1DQAA 3MI7X 4M5NA 4H0OA 3Q86A 2UZAA 1KVAA 2IRUA 2AU0A 2MPUA 4LREA 4P10A 2MRLA 3HK2A 1FWLA 2AT1B 2VJ4A 1M5SA 5BN9A 2W24A 3MX5A 1ZQRA 2D3UA 2FZGB 3VCDA 2LLZA 2JR5A 3OJUA 4DR7F 4BC2A 1VQ6N 5FPDA 3RRHA 2HIYA 5H9FJ 2KFNA 2E20A 3UM9A 5M2PA 3SCIE 3DXSX 4UAYA 5LJWA 4LF7F 4M7YA 2CJYB 3CC4S 1VC0A 1A0PA 4NYZA 1NGFA 4PXDA 3G6XA 3RBZA 2QKQA 2AGPA 1DRGA 1UL3A 2BPCA 2I1RA 4Y0FA 2OTJS 2WFBA 1Q82O 5D4PA 1PYTA 4PEOA 2QKBA 3LUYA 2R7RA 1IR2A 2GV1A 2GVDB 4PKDB 2W9BB 4OZ5A 3H8YA 3BZCA 4KB7A 4X4SA 8ICXA 2O8FB 1WDDA 2UXBF 4QZFA 1T9WA 4I6WA 4ICLA 4K2XA 5ALYA 2V5HG 2JLFA 4B1UB 4YEAA 3WKCA 3EDRB 1RT4B 3SDEB 2O4GA 4FNHA 3DHXA 5BREA 4I2AA 1NJZA 1B9DA 1LAWA 5AM0A 2O8BB 2E5LJ 2BR0A 2AGOA 5A0LA 2C3UA 5JVHL 3AOBA 2D0BA 8ICIA 4JKAA 3S3OA 2R7OA 5K5MA 3GE9A 2HWTA 4KLEA 4I2IA 2QLBB 3PIOL 2DGXA 4RW8B 3ZI4A 1FKOA 4YHHF 2OTLN 2OM6A 3GB0A 3AEVA 3NCPA 4GKKJ 2ZBCA 8ICJA 3VQSA 2HBZB 1B3TA 3O2IA 1RT5B 2OIHA 2O8CA 3CMES 4DTOA 2KJ9A 5A0YA 4YMNA 4F8RA 4A8YA 3C6UB 1ZJNA 4PQUA 3UPQA 4FLVA 2HAIA 1KEKA 2RJZA 4DPWA 1UJ5A 2GC8A 8ICGA 4H4OA 1CI4A 2FPMA 3GYNA 2Q31A 4I2PB 4Y2JA 1Q7LB 4C1NI 5KG5A 4E0DA 3FEXB 4NXMK 4RNFA 4HUFA 5KT5A 5IM0A 1HBUB 1C1AA 4DV6K 7ICPA 4RW7B 5CYMB 4ZVSB 4YOUA 2XO7A 5GAGU 5CZXA 2E1EA 4K4GA 3Q23A 2R8JA 3FVYA 5C24A 4FJMA 2R2UA 1XEZA 4ATNA 2VASA 2H3ZA 3CPWR 4A4JA 2KZMA 3DDIA 5E5NA 3CPEA 2OGUA 2V2VA 4ECZA 1E6VB 5FDLA 3AHPA 2VA3A 4M42A 1N52B 3KKFA 5FRNA 3FNNA 1RT2B 1ZXOA 3D0IE 2QK9A 3FRYA 4CRJA 4I2QA 4CLLA 3OYHA 1RCOB 5BOLA 3H2UB 2LM1A 3MECB 4JKEA 5EWEA 3M8SA 1RYSA 4HCCA 4Z4IA 3GJSB 2DXFA 3JS9A 3SPYA 1WHWA 4Y6IA 1E4FT 4R8UA 2QMWA 1WC4A 1HKBA 4US8A 2DIUA 1VQMS 1F5SA 5HP4A 3BEGB 4R5PA 3M8RA 3V4MA 3JYTB 1S76D 4K0KK 1ZQFA 3DXBA 1WC0A 4FLXA 1Q53A 3CQXA 4JI1K 1WKLA 7ICOA 1NB7A 4ES1A 2CNOB 2YJFA 3AVKA 3WXIA 2BRLA 4FO0A 3ZT4A 3O9TA 2B4VA 4M9GA 5CHGA 1LCUA 1IM6A 2C3MA 4HH1A 1GLFO 1S1TB 2A1JB 1TL7B 4Z6DA 4DTRA 1RLDA 3AVBA 2EG2A 5J2PA 1TUYA 1X8DA 4DR3F 4X64K 1T9TA 3C66A 2QA2A 3MAHA 2P9LA 3OXLA 2IBKA 2PKEA 4V19X 2F1JA 1QM9A 3QIPA 1RGIA 3LWMA 2DL0A 3ZZOA 3TSUA 1GMVA 1D8YA 1EETA 2DRDA 2ZFHA 2RH3A 4B3OB 3OYEA 3KFUF 4CEFA 4CYUA 5AXLA 4OYZA 2EX3A 2I5JB 4X66F 3MM7A 1K44A 1N32J 3ZXWA 2VG6B 4M5DB 4ECRA 4O3NA 3H40A 3KHLA 1SKUB 2DWQA 4F02A 1ZQLA 4FO6A 3EW9A 3NRBA 4XDDA 2G0CA 3OTEA 3M1VB 5D0GA 3M6XA 4GC6A 3UD5A 1NB2A 1YJWS 2HBKA 2PEBA 1XNQJ 2QL7B 1ZQIA 4BC5A 2YNFB 3Q8KA 1ZQBA 3PW7A 3TVYA 3IKMA 4FL9A 2J9CA 3GZ7A 3THYB 2G0JA 3PZPA 2IOFA 1X4EA 4JK7A 4FF4A 1TFRA 1DOQA 5AK6A 3G4SN 2G8WA 4JRQA 3NGKA 4M5MA 4KMOB 5LSOA 3VQQA 3I0SA 3BR9A 2UXCF 3VN5A 3J81Y 2QMXA 1VBYA 9ICMA 3GMGA 4URGA 5E2QA 4RR5A 2ZEJA 3U9ZA 2XCPA 4LF4J 4RPZA 2QO3A 2HMPA 4I2DA 5AQNA 5E3PA 1CJTB 5A8RB 3Q8UA 3DLHA 2PMHA 1S22A 2W41A 5KG1A 4K4IA 1RILA 5LMNJ 4MT1A 2F8MA 4Q7AA 4HTJA 1J5OA 4WF9Q 1HNXF 1HHSA 3NVVA 1HNZJ 1FDAA 3OLAA 3RAQA 2JFKA 2EZXA 3E9OA 1HUXA 2DNNA 2JOQA 1V3RA 1PUZA 3K57A 1U0HB 3SBMA 4NYPA 4J37A 1M6YA 1VDHA 2QA4N 2OH2A 2E3TA 2BE9B 5AM5A 1NDCA 4RBUA 2CQCA 4OHXA 3KZIU 2EKYA 3U9DA 3FSIA 8ICCA 3AO1A 3MMAB 1HNWJ 2A40A 1PG5B 1YWXA 5F2RA 1T94A 2BUPA 1NOYA 4DFKA 1YRTA 3L4BC 2MKIA 8ICUA 1Z19A 5GMEA 4UBCA 2F1IA 4OZ1A 2YHBA 3CQ8A 3ETLA 4RQ7A 1SUQB 2XULA 3BBBA 2B21A 3MMCA 3HBTA 4CK3A 4KIAA 3IBPA 5EE1A 4F26A 4IJAA 8ICWA 3JAMU 3JB9k 2CPYA 1TV6A 1SQEA 1K73T 1O5JA 3C94A 4ED8A 4RUCA 4CLZA 1LWCA 2I9GA 4ED5A 5AQPA 4RBVA 5J0YA 4N47A 4HWIA 3FR0A 3EDQB 3LVVA 2OELA 4PKIA 1EKEA 2FVCA 3NAEA 1YJTA 2RP5A 2E8MA 4XH1A 5DDYA 3OYAA 4NZ6A 4B9SA 3TFSA 2NXJA 4PHDA 4DV4J 4BXOA 4CZIA 3UO0A 2E1FA 2D9OA 2DK2A 1X3MA 4M94A 2Y1RI 4QZDA 4U9RA 4LVOP 1RLCL 5IQQA 3BGUA 4M0AA 2RN2A 4OJRA 4LFCK 1M1HA 4U7BA 2ZZNA 1HBNB 5G5GA 9ICEA 4ELUA 4CH0S 2KT2A 1X7VA 5ELZA 2P5OA 5GTIU 1FJGK 1KVIA 2HDOA 4CO0A 4YMEA 3TTFA 4GKJJ 7ICRA 2Y0SD 3FCVA 1RM6C 4DL6A 5KG7A 2V2KA 4BRKA 5D77A 2Y0BB 2FMPA 4CM0A 4NI2B 2V9WA 3IGVA 3UCUP 2R7UA 2H54B 1IBMJ 5HLFA 3SV3A 4I69A 2GHVC 2RD5C 3MCSA 3QB0A 3KK2B 1HIYA 3AJDA 3LWLA 3GV8B 4KREA 2DHAA 2MHEA 3A13A 4QWCA 1J6ZA 2QXFA 1K73O 1RXWA 3N5BA 2IIRA 3AVMA 1Q8IA 5JVHQ 2KB2A 2R9LA 1BQXA 1ROFA 4OJ5A 5DBAA 2XEXA 2UUCF 2W9CB 1WTFA 1UVLA 2M0NA 3ID6A 3PIOQ 2PBDA 1K0TA 4B9UA 4K5RA 3PNCA 4CO1A 3J7A1 3DDNA 2GHPA 2B43A 3FYHA 1MROB 1UVJA 3C15A 2HK3A 2O8EB 4QR2A 4BACA 2E8NA 3CE8A 1RKJA 4M47A 1WG4A 4YY3K 4WQ4A 1NSKL 1B43A 1WOQA 4XO0A 3OLBA 2B7BB 1N33K 4C7YA 1FWPA 1NO8A 2YKNB 2CNNB 3D6JA 1ZQEA 1G7CB 3W8GA 3Q24A 3ZNUA 1HMVA 3AOAA 1U8WA 3S7RA 4QS7A 3CJQA 3CQYA 1GK8A 2COLA 1XR5A 2FB0A 1T0TV 3TZWA 4U95A 4Y65A 1GT8A 3FM9A 1U9LA 2G2ZA 2MLXA 4MLHA 1O03A 3D0PA 2BJEA 3MZIA 1GMWA 4O8UA 3AD7C 2ZKTA 4FYVB 1I39A 3DC2A 2WOMB 1E6YA 4C2MA 4LBPA 3MXJA 4W90B 5BN8A 4DB3A 1VFJA 1URNA 3CJCA 2MKKA 1LFWA 5HRPA 3H25A 3HW8A 4IDHA 3FEZA 2E7VA 1FRMA 4L3KA 1X4HA 2JC0A 4JV5J 3P3DA 3UN2A 4HVJA 4CGDA 4N7TA 3IBWA 4DF8A 3O08A 4IDKB 3K5MA 2P6UA 3BQ1A 5A2QY 4M3ZA 4MTPA 3J81j 5J2NB 3OQ2A 4W5NA 1M1GA 1FK9B 3H0MB 3G82A 4DV3K 4USVA 3GSDA 1ZQCA 3CM6A 2ZM6J 2HQGA 4X4NA 3NF8A 1MU2B 2KJVA 4IOCL 1RBVA 4QU6A 3HP6A 3SQ4A 3LDOA 4WQ4C 3U6FA 4ID5A 3QX7A 4MEYA 3PVXA 3QT6A 1RAIB 2DO0A 4X2BA 1JLCB 1ZBTA 4ZPDA 1YIJS 1PZNA 2JEIA 1X31C 2OANA 5AKIA 4KV8B 2PC6A 3WQTA 5KQ8A 1TQLA 4DI6A 2V4QA 2UUWA 1DZ5A 2KYZA 1TGOA 3VCBA 2XRIA 3OR1B 4BC4A 1PJ6A 3KDOA 5BRHA 2Q2RA 3O5BA 5DDMA 5E41A 1NMNA 4NXMF 3O9RA 4DV6F 5KFLA 1NSPA 2DNRA 1RDWX 3QEAZ 4QYZK 3IDHA 2Q6BA 3BDPA 3AO4A 4UT4A 2WAQD 1NKBA 3CD7A 3NF6A 5KFSA 5C0YA 2RUSA 1HI8A 3R1LA 3M2UA 4RO0A 2FUG9 1YZ7A 2HS3A 2OD6A 3EYZA 3S1TA 2GVZB 3M32B 4F0KA 2FTRA 3EN9A 4QWDA 1VSLA 2VWBA 5BRDA 1U7LA 5J0QA 3BO3A 2X7IA 3C8YA 1DTQA 3FK4A 3HFZB 4C0ZA 4OX9J 2YXLA 1FF2A 2JGAA 3H8SA 4CQ1A 4ENOA 1S48A 5JTIA 4LRFA 4L75A 1DQ9A 4YN4A 3MAQA 5IT9O 1GLAG 1RISA 2MY7A 2YN4A 1MQ2A 1VJWA 1D9AA 1BQMB 3D66A 3KKSA 1WHXA 2UUTA 4LD0A 3IR5B 4CGZA 3HD1A 1Q18A 3V9ZA 4FWLA 4K4ZA 2VU5A 3LANA 3IMQJ 4BGDA 4K0KF 3SQ0A 5J1EA 1EXQA 1QQOA 2KO1A 1NK0A 2AD9A 2CDQA 4MHVA 4NM1A 1JALA 4GNIA 3C65A 2E1AA 3F44A 3QRQA 1XR7A 2CNLB 1L7MA 2XG8A 5I42A 5AQOA 4QZHA 2CPRA 3LTOA 4DTNA 1A9NB 1WG8A 4A48A 4C6AA 3W9HA 3FFKB 5ALFA 4YOYA 7ICGA 2VGNA 3GV7B 4X64F 3QINA 4OPKA 2KP7A 3VAGA 4GVLA 3B9JA 1GLDG 2W2OP 4B3SK 1BIUA 4ZOSA 1R3NA 2BXJA 3CC2N 4FJHA 4FYDA 3HKWA 1OH8A 5KFXA 5IILA 1HR0F 3QU5A 1HPZA 2GELA 3BGRB 2F9DA 2NNWA 1ZETA 1WEXA 3R6LB 2CPIA 4DUZJ 4UAZA 1XK8A 4CI0B 1T6DA 2DPNA 3I9V9 5JVGQ 4IKFA 3QGPA 1VHFA 2WSEC 3DOLA 4AM7A 4DL3A 3CD0A 5E3RA 2H5IB 3BQ7A 4G1QA 1I3OB 1KSPA 3S01A 2ASLA 4DR1F 2JC1A 3GU0A 3MPYA 4ZVFA 1SB3C 3TACB 5J2JA 3PXGa 4MYTA 3L7PA 2QA4G 1UVMA 2QB0B 4NLCA 4KR0B 4IQWA 5A8KB 2MZSA 2W7PA 2ZUAA 3D28A 1KD1T 3W5XA 1LVHA 3NHGA 3ISND 3MX2A 3RSEA 3MOJB 1ZTWA 1TU0B 2FJ6A 4FFDA 4IQXA 3RMAA 2QJ3A 4Z94A 3SMSA 3ZSQA 4H5NA 2EZYA 3SNNA 1RT1B 3GFXA 4HHHA 3LP3A 4PG6A 3QU2A 3H8WA 4BC7A 2G8KA 3HKZD 3NCQA 4ZP9A 3DLRA 1FCAA 4PKHA 1PIEA 4WE1B 1BIZA 4ZPAA 4G6VB 2W40A 3MPDA 5AK5A 3OD2A 2WW4A 5D3GA 5ALNA 4ILJA 4OV6A 1O8BA 2Y9TA 4CBXA 5AFUA 1VQLS 3R5AA 1B9FA 4R64A 1RT7A 1PKUA 1TFYA 2HEKA 2HNDB 3CI5A 1ZAXA 3OL7A 3J7Z5 4FWRA 2E7XA 1SBRA 4C8KA 3E9LA 2Q3PA 3MEDB 2OMOA 1UHUA 3DRRB 4I6MA 3O5TB 2X1FA 3T79A 2AWZA 1VQON 4GMKA 5U47A 4DR2J 3AT1B 3IP4B 4UB8U 1KKHA 9ICIA 3PHTA 3JS6A 4KB0A 4KHPK 1KD1O 3R7BB 2EFOA 2P5GA 1ZQKA 1DJ0A 4C9DA 5L1JA 5F3ZA 3Q8SB 1RTJA 4ZN3A 3EZOA 4AT1B 4J9QA 4BDPA 1NZBA 2G1DA 4NYNA 3Q8LA 4CJKA 1MWKA 2LQ8A 2HHHF 5AM3A 2YNHB 3NNAA 3QEVA 1KNZA 4QR0A 2BOAA 3U27A 5J0WA 2XHWA 2ZIUA 4YORA 4Z4FA 1VRTB 2B51A 4ILHA 3RF9A 3NS7B 2NRZA 1X5PA 5DB8A 2E5IA 3I32A 4WWSA 1XMOJ 3KWIA 3GPAA 1KAYA 3D1QA 3LAMA 2D0AA 3HYFA 4LMZA 3THWA 4OKKA 2KHCA 3K8VA 3NFAA 1FX2A 1RTHA 1WBBA 4JI2J 2VV5A 4Y2TA 2Z1JA 3CJKB 1WOPA 3QO9B 5C2GA 5GAHU 5TKYA 5LJVA 4U7CA 3U3GA 4RQ5A 1WF1A 2PFDA 4X4TA 3OW2M 4B02A 4C97A 2PE8A 3SMZA 2ZE2B 4K41A 3R6MA 1N63A 4CRXA 2LHTA 4U8VA 1T02A 2BOPA 2FSNA 5JS1A 4M5GA 1HFEL 5HO4A 1VK3A 3J80U 4KLJA 4M5LA 1XMQJ 2I7PA 1SZPA 1IBKJ 4OIXA 2KVIA 2EZZA 3P4UB 2M3DA 2HSTA 3RB4A 2FJEB 4Q5VA 2WB1D 1FJGF 2EQYA 3DHWC 5AQGA 1T4GA 2C22A 2DIVA 4WIIA 4LF8J 3QIDA 2VPWB 3QGGA 2P9KA 1PJ5A 4HUEA 1S9FA 1YT3A 3OHBA 1PK1B 1MWYA 4Z37A 2HPUA 4CDGA 3BPSP 3WK6A 4RQ8A 1ITPA 2FHMA 1RWWB 1Z6RA 2D3DA 2JDJA 3R7NB 3RVCA 3UVJB 4F92B 1ZYQA 3CCVS 2Z58B 3DN9A 1SGGA 2XNQA 5HQMA 4DHYA 2POKA 2DNPA 2CQIA 2K89A 1ZS6A 1HNIB 9ICKA 2FVQA 3MWTA 1T9UA 4Y2RA 3R6GB 1EKRA 4IOCQ 1HI1A 4J9PA 2FJAB 3EZUA 5ALGA 2F7VA 3VGVA 1X0FA 2FJVA 1VQ6S 3QUQA 5ETMA 4M6WB 2F9TA 1RWMB 5AKLA 1N33F 3NWGA 1AA1B 3THXA 2HGMA 4QWBA 3DCAA 5J1PA 2G06A 2IM1A 2V6AA 3JPPA 2N3LA 4Z6CA 2PEHA 1JL2A 4KRFA 1P27B 3HXMA 2V8GA 3B6OA 2FBVA 3QEXA 1X1PA 2CXYA 2W11A 1GX5A 4PWDA 4OJOA 2AYEA 4QIWF 2B8PA 3D6MB 3IG8A 2KRRA 8ICHA 4ECTA 2HQDA 4AF1A 1FO1A 3IUCA 4DPTA 4UAVA 4ED4A 4FLUA 1NM2A 2F4VF 1WSIA 1VQPN 2YX1A 5F9LA 3M6UA 4NLZA 3D0GE 4DV2K 2OYYA 2XHCA 7ICUA 2GWJA 4CJQA 4P75A 1T95A 1TKXA 3TA0A 2FHKA 1HL6A 3FC4A 4RU9A 2XY5A 1RT3A 3KK7A 3V1OA 2A18A 4CHOA 2MSSA 3AY9A 2M9KA 1OUQA 3DMJB 3DLGB 4ILMA 3MUVP 4DWIA 2JH7A 1IR1A 2HSZA 2XBPA 3T6JA 4WTYA 4KPYA 1F21A 3MK6A 2AJ1A 5AIAA 4ZJOA 3VAFA 1LW2B 4BRMA 4A47A 3ZSRA 3CCUN 1XNRJ 5CZ1A 2ZH7A 2DNKA 4DV3F 3PRDA 2LYHA 4OGEA 3HFKA 5CAAA 5G0RA 1T44A 3K5PA 3GFHA 3AO3A 3CJ1A 4FZMA 3MM6A 4HHUA 4CF5A 4QIWC 4OYOA 1B92A 3BY5A 2ZH1A 3N5FA 3I56N 2I0XA 2Z8QA 4K4YA 4I68A 3L4PA 1WUUA 3NGUA 3GSIA 1BC6A 1SV5A 3U7JA 4NJ8A 4CTAA 2CGKA 3CCZA 1FIQA 2FZCB 4QZVB 1C0MA 3O4QA 4CHYA 2NXUA 5K4LA 3K75D 4J9OA 1RCHA 1QSLA 3AVCA 1YHQN 1UA1A 1KC8T 2QFJA 5FJ4A 3OL8A 2MYFA 2P8IA 1KL9A 1TL4A 4DTXA 1T6CA 4K8ZA 2QLXA 3FBCA 1X9JA 2DRAA 3UB5A 1S72S 4OLAA 4WJBA 1RHJB 3T19A 1BVSA 3WK8A 4WFNL 1VK8A 2KT3A 2F8SA 1U49A 3THPA 2RS2A 3A1YG 1WCNA 2VWJA 2XYHB 2KQ2A 4NLNA 3QEPA 5KPRA 1X5SA 2HHWA 3BF3A 4JI7K