2HHVA

T:o6-methyl-guanine in the polymerase-2 basepair position
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*TP*G)-3'
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhvA01
3S3OA 1SKWA 4ED0A 2B4JA 1ZQHA 3ZSVA 4FJIA 4Z6FA 1SKSA 5EWFA 3QE9Y 3NF8A 1ZQXA 8ICWA 5D46A 4O55A 2JLEA 4O5CA 2P6UA 2HHXA 1KFDA 5DB8A 2HNZA 3QEWA 3SJJA 3Q8RB 3HSTB 2XGPA 2VA8A 4KTWA 4DTMA 4DLGA 2QXFA 3M9OB 3ZT3A 3ISNC 4CEAA 2P6RA 4FS2A 2IGIA 3L3VA 1S77D 4TQSA 1JLBA 2MUTA 2BPFA 3NH0A 4FLTA 5I3UA 4O4GA 3WNGA 3PW5A 5CWRA 4RZRA 4WE1A 5J2AA 1CZ9A 4FJGA 4TSXA 3HT3A 3LAKA 1HNIA 5DGAA 3CFPA 1TV6A 4NCGA 3CM5A 1VSKA 2MAXA 1MC8A 1S1XA 2W9MA 5KFFA 2BE2A 1XHZA 8ICIA 3GDXA 5KFWA 3BDPA 1ZQQA 2XY8A 3Q8QB 4LSLA 4KHYA 1ZQPA 4Q8EA 2HB5A 3ZSOA 1JXEA 3TABA 3RR7A 4EZ9A 3GIJA 3OYNA 4B9TA 3PX0A 2BPGA 1ZJNA 1S9EA 1ZQTA 2JEGA 3AVLA 4R65A 5HHIA 3DI6A 4ECVA 3HP9A 5KFSA 1ZQCA 4CIEA 3KTQA 3QEVA 3NBPA 1HJRA 2PZSA 3C2LA 2IC3A 2BCQA 9ICAA 5KFNA 4JV1A 4E19A 1XSNA 4W5TA 2DFLA 1RTDA 3C94A 1WNSA 1FXXA 4DMNA 2OWOA 1RCHA 4BWMA 4JWMA 1KVAA 4KHQA 3HW8A 1LAVA 1NJYA 3QESA 3UXPA 1WLJA 1T03A 1XO1A 3PR5B 4J9NA 2IBKA 3RH5A 4AHUA 4Z6EA 4E7IA 1TL1A 4NM1A 5J0SA 3UQ2A 3UIQA 1BL3A 5DGBA 4KLDA 1J5OA 2X6SA 4MFAA 3AO1A 1TVAA 1U04A 3BJYA 1U48A 4CE9A 2R8JA 1J53A 3L2UA 3EWAA 1C1BA 3OYFA 4ELVA 2ASJA 4J9RA 9ICEA 4NCAA 1UAXA 1Z25A 5BPCA 3OYLA 5KFLA 3KKSA 4I2PA 4F93B 5KFVA 2P66A 3VN5A 1KEJA 4M0AA 1RZTA 5CA7A 4HTUA 4MFFA 2RKIA 3HPGA 1HYSA 4FJXA 3PX6A 3NGYA 4YP3A 3THVA 3K57A 4KPYA 4TUQA 1YVUA 8ICEA 4ZTJA 1VSIA 2ALZA 1A5VA 4F3OA 5KFOA 4YXMA 2GUIA 1J9AA 4Q5VA 1BPZA 1RBUA 2EHGA 1VSHA 2IOCA 2O4IA 3GV5B 3PY8A 3VQBA 3A2FA 3AVAA 3B0YA 3K5LA 4KLOA 4LY7A 5J0WA 3RB4A 5D4BA 3KK2A 1YTAA 5J2JA 2C2DA 4M3WA 3MXMA 1L5UA 4MFCA 4B9VA 3ETLA 2D5RA 1RDAA 5J29A 5DBCA 4XUSA 4DL7A 3OGUA 4M3TA 4M2YA 2PI5A 4AH9A 1U9LA 3L2QA 5KG4A 3M8RA 4KN7A 4QWDA 7ICQA 4AHTA 3V81A 3KHHA 4QWAA 2C2EA 3M8PA 3KLGA 4E89A 4BDPA 1KLMA 3LPUA 4RW9A 5BOLA 9ICPA 9ICBA 4PHAA 5FRNA 3RJFA 2JEJA 5KG3A 2OZSA 4IQTA 3RBDA 3ZDCA 2W8LA 3GIIA 2KTQA 1XHXA 4QZHA 4RNMA 8ICUA 2ZTCA 5J1EA 4IR1A 1L3VA 4GLXA 7ICMA 1T4GA 5KFBA 3NH2A 2F1IA 2Y1JA 2I1QA 1S76D 3M9NB 4QAGA 4J2DA 3SQ2A 4M42A 5C25A 4FK0A 1SL2A 1ZBLA 2AQ0A 4RW6A 5CY4A 3F9KA 4CHQA 4YD1A 3SPYA 4TQRA 1QS4A 3NGZA 1S0VA 7ICVA 1S9FA 7ICKA 3JPRA 4ECSA 4F4ZA 4YMNA 1S97A 3NE6A 3L2RA 3S9HA 4O3PA 3RR8A 4N56A 3V6DA 3SQ0A 1DOQA 4R8UB 4Q43A 1D5AA 4DLEA 4I2DA 4RUCA 4BWJA 1BISA 3IRXA 4YR2A 4DSLA 3C2KA 4QZIA 3ZDDA 4ED7A 3I0SA 5DLFA 4FLUA 1X2IA 1ZJMA 4M9HA 3KK1A 3ISDA 1S10A 3AVIA 4JV2A 4E1NA 3M9MB 4J9KA 3JSMA 5KFIA 3KHLA 4DSEA 4RPXA 4RW7A 3AA4A 1NJWA 4FJ5A 3RRGA 2XCAA 4KN4A 1BPYA 7ICLA 1Z26A 4JWNA 3KLHA 3ZD9A 2XC9A 4RQ2A 5D49A 1F21A 3H8SA 4DOCA 1RTHA 2P1JA 2BCUA 3RJIA 1BCMA 8ICXA 4ECQA 2HVHA 2W9CA 3TAQA 3DRPA 2H5XA 3LAMA 4YG2A 1XSPA 9ICRA 1IO2A 2YNHA 4AHRA 3PW0A 4IKFA 3DLGA 5F9NA 4M3RA 4ECWA 3LP2A 3GV8B 2OZMA 4CEDA 4X5VA 3C6UA 1KRPA 3RWUA 3OS2A 3OHBA 3K58A 1T8EA 3I0RA 2ISPA 4RQ0A 3QEXA 1QHTA 1R0AA 5KT2A 3LALA 4IRCA 5KG5A 4QCLA 1IM4A 3VQ4A 3RMAA 4TUPA 1X9MA 2BCSA 5CJ7A 3P5JA 3TQ1A 1RDDA 4K4IA 4LZDA 1JXLA 1JKHA 3AVHA 4ED2A 4BDYA 3HVTA 4YFKA 4F5QA 3LK9A 1RBSA 3MBYA 1BPXA 2PXIA 3V1RA 1WSGA 4I2JA 4DSKA 3MGIA 3MEEA 2AGOA 4YCXA 1VSEA 2Z1JA 4QZ8A 3VQ8A 3KLEA 4ELTA 1S5JA 4IG0A 5L1IA 3CFOA 4E7KA 4BGDA 1W0HA 4K8ZA 3VA3A 5KFCA 3HPOA 3AVJA 1FKPA 5DKWA 2G8UA 2AJQA 1RT6A 3VQAA 1HQUA 1HYZA 3NHGA 4DL6A 1ZQGA 1KVBA 4CGIA 4F4WA 4FJMA 4CJPA 4N41A 5EU7A 4I7FA 5KFXA 1RPLA 2A1JA 4NYFA 5KT6A 1HUZA 5J0RA 4M47A 4PGYA 3PX4A 4JLHA 3TFSA 3VQ9A 4O5KA 1RBRA 4IBNA 1WSEA 4H8KA 4HCCA 9ICMA 3V7JA 4I27A 1ZQBA 2KFNA 1IG9A 3IAYA 3C5GA 2ATLA 4BXOB 2P5GA 1TAUA 5KFPA 4OVLA 3Q8MA 1RYSA 1WCLA 1IKVA 2DFEA 5KG2A 2VA3A 3OVNA 8ICFA 1BIUA 1ZBFA 1IKYA 1QTMA 3HXMA 1BHLA 3AU2A 1S1VA 1ZQJA 4FS1A 2XO7A 4DFKA 5HP1A 1V9PA 9ICVA 3CYMA 4CECA 4J9OA 9ICKA 1FKOA 3RH4A 2UVVA 4LZGA 5EOZA 2DPIA 4NLZA 3QEBZ 4HCBA 3C21A 1SUQA 2P51A 9ICCA 1NK6A 3QEPA 3AA3A 5KFRA 4O3QA 3EZ5A 5DDMA 4IFVA 3AVBA 1VRTA 3RJJA 4CEFA 4KLHA 1WSFA 5J2GA 4KHUA 7ICIA 1QSLA 4DTXA 7ICSA 5KTQA 4BDZA 3VQPA 4CFBA 3C5FA 4F2RA 3TR8A 4DQQA 1EETA 1Z3EB 1TK0A 1U47A 5DBAA 4N5SA 1A5XA 4MFBA 5J2BA 3AVNA 4E7LA 2FPKA 3NCIA 5J2FA 3OYCA 5KFGA 4NY8A 4I2FA 4CJ5A 2FBXA 3KKRA 4KLJA 4FJ8A 4IRDA 1D9FA 3H8WA 4HUFA 1UA1A 3SUQA 2KFZA 2FMQA 3DLHA 4IQVA 3S3MA 2YKNA 3LP1A 2ASLA 1BCOA 4RT3A 9ICIA 4J2EA 4MF8A 2C22A 4FZZA 3CG7A 3OS0A 3QIOA 4M3YA 1GOCA 5DB6A 2RPIA 3G0ZA 4B9MA 4KLFA 4I2GA 3LZJA 4IQUA 2W9AA 4M9NA 5IINA 4E3SA 3V9ZA 1VSJA 1NOMA 5C42A 4O3OA 1DGSA 4FK2A 1ZQYA 4YQWA 4DS5A 4DQIA 3SI6A 3OHAA 3EY1A 1S9GA 4EBCA 2JGUA 3U6FA 8ICLA 5F9LA 1VSMA 1L3UA 3TAPA 3ZDBA 5E41A 3VA0A 4UQGA 4XQ8A 5CZ2A 1NK4A 4CJUA 1HRHA 3LDAA 3EYZA 4CF2A 1C1CA 2YHBA 2ATQA 5DQGA 5CP2A 3V7LA 3G6XA 3V1OA 1WSIA 3QERA 4F5PA 3DM2A 3PO5A 1UT8A 4DQRA 5DB7A 2E6LA 5KG1A 2D0CA 4DL2A 4FK4A 2Q0ZX 2YNFA 3AA2A 1BPDA 1S1UA 2OPSA 2GV9A 2PY5A 5L1LA 2HHTA 4DSIA 3TANA 9ICOA 3F73A 1EXNA 4YR0A 4F4KA 3OS1A 3AVFA 1S0NA 1Z00B 4DQSA 1ZQKA 1ZBUA 4I28A 5DDYA 4UB3A 5J2QA 3IM1A 5EWEA 4DS4A 1KFSA 5KG6A 2HHVA 4CJVA 2XGQA 1HMVA 2PI4A 4QWCA 2NRTA 8ICHA 3DLBA 4TURA 3H4BA 5KGXA 3ZSYA 1LB2B 2E6MA 5K14A 4IDKA 3VQ6A 1K1SA 4QWBA 4ED8A 4O9MA 9ICJA 4CJKA 3IHQB 2A1RA 1B22A 2J6UA 4OGEA 4FLZA 2V4QA 1C0TA 1SKRA 4F3TA 1QSYA 1IH7A 5J2CA 2X6NA 4UBBA 3JYTA 8ICKA 5HRNA 4JK1A 4PY5A 3QZ8A 7ICUA 4F2SA 4F4YA 5FROA 1NJZA 3RAQA 1ZQZA 3Q8KA 4XIUA 1XWLA 5KT3A 2JEIA 4CHYA 5CHGA 5J0TA 1BI4A 1ASUA 4CIFA 2G8WA 3KLFA 1N6QA 4RG8A 2HVIA 4ECZA 4C8LA 3NFAA 5C24A 4FLYA 2BCRA 3CFRA 7ICGA 1VSFA 4RPZA 4OKKA 1RDCA 5J2PA 2J6SA 4FO6A 1JMSA 5CYQA 4ICLA 3RBEA 4ECUA 1WAJA 1ZQDA 4I2BA 4KHSA 4LH4A 4ECXA 3V6JA 5KFDA 1HJPA 4J9QA 2UVWA 3SUOA 4J9LA 1Q9XA 3RTVA 3AVKA 1JL2A 1EKEA 5KRSA 3RJHA 3MEGA 3PUFA 4UAYA 4DOAA 1MSWD 1Q8IA 3T5HA 1GOBA 2Z1GA 1YTUA 2JEFA 4DOBA 3QINA 2W8KA 1S6QA 3HYFA 4C8MA 1TL3A 4YVZA 1VK0A 4ED6A 3BQTA 3DLKA 4QZEA 5FDLA 2W9BA 4RW8A 3RRHA 1D8LA 3EPIA 2EX3A 2XY6A 3SNNA 2B21A 1JLQA 4O5EA 2PYLA 3NAEA 3S3NA 1NKBA 3ZSXA 4YMOA 2W9CB 3PMLA 4Z6DA 3RH6A 4UB5A 4PA1A 2ZJAA 2WONA 5SZTA 3HJFA 3EW9A 5IIOA 3H7IA 4HUEA 2DY4A 1T3NA 5J0OA 4M9GA 3V1QA 4DTPA 4FLVA 4CEOA 2HHQA 4LSNA 4AHSA 4I2QA 4ED3A 4DTSA 5HHHA 4HHTA 5J0PA 5IIIA 1LW0A 3AVCA 4KLSA 3SYZA 2AGPA 1JL1A 3NDKA 2F1JA 1NK8A 2ZD1A 2O4GA 3MABA 1XI1A 2BPCA 3RJGA 3ZSRA 4M6WB 3V9UA 1ZQNA 1IKWA 2FPMA 2VWJA 1KVCA 5HMMA 2YNGA 3OJUA 1IXRA 2HHWA 2JZBA 3SQ4A 3JPQA 3P1GA 5HRPA 2HHSA 4PHEA 1S1TA 3PW4A 1U45A 4FLXA 1QQCA 1LV5A 8ICPA 3SUPA 5HBMA 4M45A 3P83D 3PW7A 4NLGA 7ICFA 2PFNA 3HL8A 3ZSQA 2C28A 2G8KA 5J2IA 3DRSA 2R8KA 2BR0A 5KG0A 4B9LA 4QZCA 1PZNA 4I2EA 2BQ3A 3MECA 4O5BA 2IDOA 4OKJA 3V7KA 3TAEA 1VSLA 3O3GA 4OPKA 4EYIB 5CB1A 5KFJA 4CCHA 4ZHRA 5BOMA 5L1KA 4RNNA 4CEBA 3OYGA 3ZT0A 3H40A 3ZDAA 4FW2A 4B8AB 1ZQOA 4DTNA 4RQ1A 2FLNA 1CUKA 2NRXA 1EP4A 5J0XA 4BXOA 4Z4HA 4O0JA 2IAJA 4QZDA 3VQDA 1TK5A 1BGXT 1X1PA 4UB4A 3TAGA 4B3OA 2RDIA 1ZQLA 4KKOA 3H4DA 4EEYA 5L1JA 4FLWA 3Q8PB 3QEAZ 3GV7B 4E0DA 2D0BA 1Y97A 2R8GA 4TUSA 8ICSA 4W5RA 4Z4FA 3D45A 4GMJB 4CGHA 5EWGA 1W9HA 4L8RB 1C6VA 4R64A 3MR2A 3MXJA 5DG7A 2IA6A 4Z4IA 3IS9A 2VANA 1N5YA 4W5OA 1ZQIA 1AROP 4KITB 1RT7A 3KD1E 1QSSA 4OLAA 5L9XA 3SZ2A 7ICRA 4Z4GA 1TKDA 1RTIA 1DTQA 4CHOA 1L3SA 3DLEA 3OYAA 1REVA 4CGDA 5DLGA 1BPEA 4IQWA 3T19A 1UT5A 4OGCA 4QZGA 1LWEA 3B0XA 4M3XA 1Q9YA 5J0QA 3NGIA 1ZYQA 1HYVA 1A77A 2PYJA 1X9SA 3BQ1A 3PW2A 4IFYA 4KB1A 2FLLA 3AVGA 3K4GA 2PFOA 3V9XA 2IMWP 1C0MA 3MXIA 1ZQVA 4DSFA 4M3ZA 1ZQWA 3MAQA 4JUZA 1ZBHA 2MUTB 5JS1A 1XSLA 2XY7A 3PVXA 1LW2A 3RB0A 3DRRA 3KIOA 1CEZA 2G8FA 1KFTA 4EBEA 4LVSA 4EBDA 4P2HA 2NUBA 2VG6A 5J2NA 2R8HA 3AO4A 4E7JA 2BDPA 4F5RA 4CHNA 2PFPA 4Q8FA 4CFDA 2QK9A 1TV9A 3GILA 2BCVA 3DOKA 2R8IA 4DTOA 3ASMA 4QW8A 3RMBA 3E2EA 3AA5X 3LDSA 4CJEA 3C1YA 4P4MA 3MFHA 4AHCA 1N48A 5KI6A 4YN4A 4J2BA 3RAXA 5KFMA 3IG1A 2KQ2A 2BQRA 5J2HA 4Q45A 5CYMA 3G10A 4CGFA 4G3IA 3OYKA 4EZ6A 1ZBIA 2Z1HA 2HNYA 4KO0A 1KLNA 4DL3A 1S6PA 1SV5A 3CM6A 4CJ4A 7ICPA 4QWEA 4CESA 3L2WA 2QKKA 4O0IA 5DMRA 1TKXA 4FJHA 3UXNA 4CF0A 4LH5A 3ZT2A 5KFUA 1JLFA 4O44A 3PMNA 4M9LA 2OPPA 4G1QA 4XRHA 4JRQA 3T5KA 3UQ0A 2XHBA 1ZQSA 4GXKA 4QOZB 4Y1DA 3AU6A 9ICQA 4E7HA 2BHNA 3QZ7A 9ICHA 3ORYA 2GWSA 4JS4A 1HUOA 3FDSA 3NGDA 4KHWA 1HNVA 3UXOA 2DFHA 5D3GA 3VQQA 3JPOA 1NJXA 5KFYA 4IRKA 4B9NA 1JLCA 5KFAA 4CJLA 1Z00A 3ULDA 4FBUA 4YMMA 1JIHA 5KFHA 1KDHA 4YFUA 9ICGA 4OJRA 7ICNA 4ED1A 4KTZA 1KSPA 3C1ZA 3SCXA 4CF1A 5KFTA 4DL5A 4UAWA 2ETJA 3GFKB 4NXZA 3MR3A 1S0OA 3SV3A 5KRTA 1TK8A 3HPHA 3HM9A 4J2AA 2X78A 4W5NA 2FBYA 5C5JA 4OLBA 1WCNA 3K59A 1H38A 4DU3A 3WNFA 2W42A 4HUGA 3QEIA 3UPQA 3NF7A 3LWMA 4NLNA 4CF8A 4UB2A 1MU2A 1D8YA 5HP4A 3RB3A 3V6HA 3MR6A 4GC6A 2PFQA 2FBTA 4GXJA 4ELUA 4FW1A 3JPSA 4YR3A 3Q8LA 1NK5A 4CERA 1ITGA 2FC0A 2IS3A 4KAZA 4P4PA 4BACA 4KFBA 1CZBA 3RMDA 4DTJA 4DTRA 3V9WA 4KI6A 8ICGA 4KLQA 4QZ9A 2NRWA 1RT5A 8ICCA 3M8SA 4C8KA 4IG3A 3FYHA 4NLKA 3OSPA 2R7YA 5IIJA 4KLEA 4M9JA 4IR9A 5KT7A 2KN7A 2HNDA 1CLQA 5J2MA 4FZXC 2LYHA 2F96A 5KT5A 5J0UA 2ZTDA 3AUOA 2OPQA 3NTUA 4KV8A 4NM2A 2A1JB 3T5LA 8ICAA 1KTQA 4N47A 4CGGA 1TGOA 4C8NA 5T7BA 5DG9A 2I9GA 7ICJA 1TKTA 4FJNA 9ICSA 3O3FA 4LD0A 3OYIA 2LSNA 2RDJA 1BPBA 4CK1A 4RQ8A 4PHDA 4W5QA 7ICOA 4BE1A 4BE0A 3G6YA 4KLTA 4MQ3A 3HP6A 2IHMA 3D0PA 5JS2A 1TAQA 2D0AA 4DU4A 4DFPA 4K4GA 2W9BB 5J2KA 1O1WA 2YKMA 1WN7A 3PV8A 1SL0A 4CFCA 5SWMA 4FXDA 4B9SA 4ECRA 3NF9A 3GIMA 3BGRA 1A5WA 2B5JA 3PNCA 3T5JA 1BIZA 4CEEA 2NRZA 1ZQRA 4Y1CA 1UOCA 1VSDA 4GW6A 3VQEA 1U4BA 3N97B 2Q3SA 2BGGA 1B92A 3M8QA 4EP4A 2HHUA 3KJVA 3HO1A 1T05A 2ASDA 4UB1A 9ICXA 4P4OA 4DQPA 1I3AA 4CEZA 3RMCA 3H08A 3ZCMA 2KW4A 2ZQBA 1XS9D 1TVRA 1G15A 4MEYA 1NOYA 4J9PA 3OYMA 8ICMA 3RJEA 3RB6A 3TAFA 9ICLA 9ICUA 5J2EA 5CR0A 1RT2A 7ICTA 1C7YA 1B43A 2AQ4A 1CXUA 3EPGA 1RXVA 8ICQA 3C95A 1NKCA 3K5OA 4F5OA 4R63A 1JX4A 8ICBA 3ZSZA 3LPTA 5KT4A 3G6VA 2FLPA 1HPZA 4M3UA 3H8JA 1B9FA 4QZFA 3T3FA 4CEQA 4J9SA 4B08A 1B9DA 1NOZA 1NK9A 2WTFA 2OYQA 4CK3A 3AO3A 2VA2A 4CJQA 2V4RA 3AO5A 2KZZA 4FJ7A 3VQ7A 1BVSA 3O4NA 4M41A 3Q8SB 1L3TA 4FVMA 3SV4A 1GOAA 4CGJA 1S1WA 3ZT4A 4FZYA 2C2RA 4AHVA 8ICVA 4FJLA 4ZH4A 2OA8A 7ICHA 1LWFA 3O3HA 1FK9A 4F8RA 4QZBA 2VG5A 3BQ2A 5CZ1A 1X9WA 3GQCA 1JLEA 1NK0A 3NF6A 3WNHA 4NCBA 4AILC 9ICWA 1JLAA 5HMLA 3OYHA 5HLFA 4KTQA 4O3NA 2ZJ8A 3SQ1A 4FJ9A 4CFAA 1ZQFA 3KLIA 4KREA 3JPNA 1XU4A 1JLGA 3V4IA 2HW3A 4EP5A 3E01A 5J2DA 4JS5A 1EXQA 3AO2A 5TZVA 4ECTA 3MR5A 1IKXA 2X74A 4RNOA 2IHNA 1MQ3A 4YXJA 3BQ0A 1LWCA 4PGXA 3B6OA 3OY9A 2G8HA 8ICJA 2F1HA 4CHPA 1SL1A 5KGWA 4KB0A 2KZ3A 4UAZA 5DB9A 2BKEA 4MF2A 1RT4A 1UWBA 4GC7A 4CJSA 5KG7A 4PHPA 2UVUA 2FMSA 4I2CA 1QE1A 4DTUA 1TKZA 1ZQUA 2J6TA 4B8CA 4DO9A 4PGQA 3V9SA 4FM2A 2F8TA 1JN3A 1YT3A 4R5PA 3ZD8A 4M04A 3U3YA 2FBVA 1RYRA 2A1SA 3K75D 2KZMA 2BQUA 4KLLA 3GIKA 3DOLA 4PPXA 7ICEA 2VWKA 4RQ4A 3WNEA 2AGQA 3HK2A 3VQCA 3AV9A 1QLNA 8ICTA 1RTJA 5DK5A 4CHZA 4DU1A 1I39A 4E1MA 4JV0A 4GVMA 3QLHA 3QETA 4CJ3A 1HQEA 3OYJA 2WOMA 3HX0A 4DL4A 3C2MA 8ICNA 3OYDA 4FBTA 2NRVA 1RT3A 5KFEA 4F92B 3DYAA 4I2IA 4B9UA 4Z6CA 1J54A 4CIGA 4OPJA 3QNOA 1S0MA 5FRMA 3LZIA 3CQ8A 1ASVA 4CK2A 4ZTFA 5DQHA 3K2PA 4F91B 4CJWA 1EX4A 4QW9A 4UBCA 2BGWA 1K6YA 1NKEA 4Q44A 3JPPA 1BI4B 4RQ7A 5DG8A 3SPZA 4DG1A 4Z0UA 2Z1IA 5IIKA 5KFKA 2G8IA 5J0YA 2RN2A 2AU0A 1UA0A 1VRUA 2B6AA 4CF9A 3TWHA 2QKBA 2ITGA 3L3UA 5IILA 5DBBA 3HWTA 1U49A 3LP3A 1BQNA 4FM0A 3B6PA 2XRIA 2DPJA 4O3RA 4DFJA 4GXIA 3AVMA 4PH5A 5JUMA 3TI0A 1RT1A 5HNKA 3L8BA 9ICNA 3ZSWA 4RQ6A 4I29A 3C23A 2XY5A 3K5MA 2FPLA 3ALYA 3KHRA 1SZPA 1RNHA 4KI4A 1RBTA 4ECYA 4NYNA 8ICRA 5HROA 4PUOA 3MDAA 2ISOA 4KLMA 4RW4A 3L2VA 3V72A 4HYKA 4I9QA 8ICOA 4XA5A 3N4MB 3QIPA 4MEXA 3QO9A 3LANA 2BANA 1N56A 3MDCA 2XCPA 3ZDEA 1WSJA 4KLIA 2ZE2A 2M9NA 1LAWA 2YHAA 4FM1A 4RQ5A 4R8UA 4DEZA 4FJJA 3QNNA 4ID1A 2HMIA 2Y1IA 4FYDA 5IIMA 5HRRA 3PO4A 3KK3A 5I42A 4K4HA 1WSHA 4DSJA 5HRSA 3SI8A 1D9DA 1BQMA 1CXQA 4FJKA 4KLUA 3ISCA 4H4MA 3U3GA 1TFRA 2UVRA 4F50A 4HVJA 4Q0BA 3DMJA 4I9LA 4J9MA 3JPTA 4CJTA 2YNIA 1ZETA 4M6WA 4PQUA 4PWDA 3ITHA 1JXBA 1RILA 4FCYA 2I5JA 1C0UA 2JZBB 3SUNA 4KLGA 3TAMA 2F8SA 9ICTA 1ZQEA 4YNQA 3ZT1A 3C6TA 2ZUBA 5KFZA 3MFIA 4ID5A 8ICYA 3RJKA 3TFRA 3HVRA 2OPRA 4RUAA 1K1QA 1RDBA 8ICZA 2DTUA 4EYHB 4F5NA 4JRPA 3ISBA 3FFIA 2YV0X 3OYBA 4QZAA 1Y88A 3KD5E 1T7PA 4R66A 1C1AA 3DLRA 3OSNA 2DFFA 1RXWA 4RU9A 3KHGA 1COOA 1DLOA 3TARA 1ZQAA 1WAFA 4Z4CA 2ZJ5A 1KCFA 3MEDA 2E4LA 3LP0A 4CJRA 3OJSA 1A76A 4N76A 4I2AA 3NH1A 4O3SA 4RPYA 1RBVA 2G8VA 4K8XA 2GBZA 4H4OA 4DF8A 4KRFA 4KHNA 4RQ3A 4Z4EA 3PR4A 2VG7A 2ZTEA 2RF2A 4CJFA 2ZUDA 3T1AA 3OYEA 4I2HA 3K5NA 4DF4A 2P5OA 1ZQMA 3I8DA 1ASWA 1NK7A 4C8OA 5DQIA 1MQ2A 4RT2A 4BE2A 4DFMA 1XC9A 3VQ5A 4F4XA 4KMUA 3O4QA 2V9WA 1DTTA 3MGHA 2FMPA 5KFQA 2ZUCA 4YD2A 3LWLA 9ICFA 4DWIA 3V6KA 4OKEA
chains in the Genus database with same CATH superfamily
1Z05A 2NYVA 1B0TA 4IO9Q 1SKSA 1VQ9N 4EUVA 5D46A 2JLEA 3MMJA 2QGFB 1G6BA 2P6UA 1RT2B 4UARA 5LY3A 2LQJA 3D54A 3SQGB 1D1UA 3C28A 1REVB 2Z30B 4JNEA 3I55N 2GAHC 1MWKA 3NMAA 3M2VA 1GFWB 4ZVEA 1FA0A 4DLGA 3L9ZA 1P9YA 3C19A 2HOFA 2HPUA 2YN4A 3D2EA 3M9OB 2VIXA 4CEAA 1Q16B 1XO0A 3D6TB 1JLBA 2OH2A 3KG4A 4J8FA 1MWMA 5I3UA 3O9RA 4JAXA 5ALWA 3EN9A 1X5SA 2N7YA 2RRNA 3RGIA 2CPEA 3CFPA 3M6VA 4LF8J 1Q82T 3EEQA 4DV6F 2BW2A 1FRHA 4GVBA 3A8JA 3DCAA 1YI2S 4YB5A 2KKPA 3GDXA 5KFWA 1NGIA 1CULA 2XY8A 3Q8QB 4LSLA 4LF5K 1ZD2P 3CXCM 3ZNJ1 4OHVA 4Q8EA 4C4WA 1OWXA 3BBBA 1ZZNA 3GIJA 1IWGA 4I6WA 3E66A 1O0PA 4B9TA 4RCHA 3FZFA 5KAFU 4K8RA 1U2VB 4FWLA 1RAIB 1ZJNA 1ZQTA 4R65A 1N62A 4MK9A 3TOQA 3DI6A 3VEVA 2CZ4A 1RWUA 2H3VA 5GAEU 1SV5B 3HP9A 2O8BA 1GXUA 3MM6A 3M1VA 9ICAA 5KFNA 1R8AA 4W5TA 3NY0A 1RTDA 3C94A 1WNSA 2E8MA 1RU2A 3J81Y 5IT9O 1XTZA 2ZFHA 4ZLLA 1X4FA 4ES3A 2D3DA 3E9LA 1KVAA 1J5EJ 4WF9Q 4KHQA 1A9NB 5CZVA 2ASPA 2UUAJ 3D0HE 4CO2A 2VBZA 1LAVA 1ZTWA 3QJLA 3NWGA 1S59A 1T03A 4NO7A 5EY4A 3MMCB 2ZJRQ 4NB4A 2IVFB 3QUQA 2ZC4A 4C0HA 3KKAA 5A76A 5HVHA 3CJ7A 4E7IA 1TL1A 4LR8A 4CZLA 3VEZA 5AK6A 4KLDA 3A5LC 1M6YA 2SXLA 2WCXA 3BJYA 1U48A 4FYYB 2W7PA 4RUBA 2C2MB 3VAJA 1YJNN 1C1BA 1CQMA 3OYFA 1SV0C 4ELVA 1JLCB 3FMWA 3QYYA 3VOVA 1G99A 4MKYA 3VF6A 5HR7A 1SCJB 9ICEA 1WC4A 1RZMA 1Z25A 3I76A 3HZ6A 2ZM6K 1QD1A 1IV8A 5KFLA 3KKSA 3Q24A 3CJKA 2R4FA 2P66A 3HSDA 2R7WA 1N4LA 4M0AA 5AIAA 3RF9A 2FHKA 3MF5A 4WWSA 1HYSA 4C0ZA 3D66A 3OXFA 3CT9A 4TUQA 4KPYA 2J76E 1YVUA 3OPKA 5GAHP 2NR0A 2GIRA 4F3OA 1PJ5A 2MTLA 2Z8QA 1RBUA 2PMZF 4FN5A 3F0NA 1A0OB 2IOCA 5H1SV 3GV5B 1UVIA 3G8QA 4TXSA 1IN0A 1CSJA 5AQXA 4DB3A 3O5BA 5ALQA 4OHZA 3LDPA 4LY7A 3KK2A 5D4BA 5J2JA 5F1XA 3PKYA 2BABA 3CJRA 4MFCA 4B9VA 3CULA 1Z2ZA 4LF6F 1MROA 2VYPA 4M2YA 3L6QA 3DRRB 3W8PA 4BRGA 1NHVA 2E1RA 3L2QA 1SH2A 3IWXA 2OEJA 4CBWA 1MW7A 3R5CA 1X5TA 3D2NA 1RT5B 2N3LA 4USIA 3M8PA 4BDPA 3CERA 4RW9A 5BOLA 2B7BB 2KRRA 5KG3A 2CYYA 4IQTA 3W62A 3GIIA 1XHXA 1EWRA 2HRYA 2HQDA 1PVPA 1XC3A 4BHQA 3VGLA 2DNPA 3NS1A 2HIYA 4CLFA 4PKDB 4Y28C 2W2PP 3OA9A 2ZTCA 5J1EA 4O8UA 1L3VA 2RAQA 3CJ5A 1XIQA 3SCKE 2F40A 1WYGA 3KUEA 4J2DA 1AFJA 1SL2A 5GAEP 4RW6A 1NDLA 3F9KA 4CHQA 3SPYA 1RHRB 3NRZA 4YMEA 3CCVS 2DKZA 4ECSA 2YKMB 5F8JA 3JTPA 5K20B 4DPXA 4LF4K 4U67L 4YMNA 1QM9A 3NE6A 1RHUB 1ATSA 2OPPB 4KGKA 2FJBB 4FZMA 3AA8A 3SQ0A 2MKHA 1DOQA 3G71S 2V2VA 5HK4A 1BA0A 4I2DA 1VQMN 3OXGA 1WORA 1BISA 4YR2A 3SJHA 3C2KA 1VAZA 3M8QB 4ZCLA 5ALPA 4BRNA 2V7YA 4B3SJ 4M9HA 1DK3A 4JP8A 3ISDA 1S10A 4E1NA 2J7WA 3QRRA 3JSMA 3KHLA 2EH9A 2K4HA 4RPXA 4DSEA 2XG8A 3AA4A 1NJWA 4FJ5A 2XCAA 3M2UB 4JI0F 4NL9C 3ZD9A 2CQ1A 2JV3A 4X65F 2XC9A 2HWTA 4A62A 1F21A 1Q86T 2ZWOA 1RTHA 2P1JA 4PQUB 1R31A 7FD1A 1W25A 1SC3B 4ECQA 3TAQA 3DRPA 5AZIB 3PKMA 4RR5A 3HKZD 4YG2A 2L48A 1IO2A 4AHRA 3TSPA 4FSVA 3SEOA 2BYCA 2F3JA 3M8WA 4AFFA 3DLGA 2RSQA 3BN7A 5L1MA 1YZ6A 3WUHA 4ECWA 3LP2A 4OJGA 4B1XB 2BKPA 3HI9A 1F44A 2FJEB 1KRPA 3RWUA 3J7AN 1K44A 3VQTA 3H5SA 5C7PA 2LLZA 4WKYA 2F9JA 1WF1A 1QHTA 2EZYA 5KT2A 3LALA 2QL7B 2EK1A 3IRWP 1R8BA 1M90T 4LZDA 4AP9A 3ETRA 3CCQS 4DR2J 3WXIA 2H54B 5AM2A 3T69A 7AT1B 3LK9A 3MBYA 3WC0A 1WSGA 4DSKA 4ZPCA 2Z1JA 3O08A 1NJIO 4E7KA 1QVFM 5GTIU 2DWQA 3VA3A 3HPOA 1YIJN 2IPOB 4UAVA 1FKPA 3WX4A 5DDRC 2PSZA 4CO0A 4WK1A 2P9CA 3I5AA 2Q36A 4N41A 1RPLA 1ZBSA 3NMRA 5EE0A 4X64J 4NYFA 5KT6A 1HUZA 3THWB 3H20A 4NRTA 3JQMA 1FX2A 1RBRA 4IBNA 9ICMA 4QIGA 3CRXA 4I27A 4C98A 3IAYA 1EP4B 2FC8A 5H9EJ 4YDDB 3DKDA 3JS9A 1RYSA 3FKBA 1WCLA 2GO8A 1ZBFA 1Z4OA 2H9ZA 3TVZA 4M94A 1QTMA 3HXMA 3AU2A 3DRYA 1RKJA 4FS1A 4FWQA 2ZNZA 3OVSA 4DFKA 4JI8J 4MLEA 2W1BA 4DCJB 2WF8A 2QYCA 1HR0F 3MMAB 2C3PA 4P2SA 7FDRA 3SBGA 1EAYC 1O5JA 4HCBA 3C21A 1SUQA 3KOAA 4I6MA 2LU1A 4X64K 3TX8A 5CCLA 4Y2UA 4KLHA 5J2GA 4KHUA 4C4TA 4DTXA 1X66A 5J1NA 1WSRA 2IMOA 4I67A 2NZ4A 4F2RA 4ZN1A 2BTFA 1S6OA 1YI2N 3GTYX 1Z3EB 4N5SA 2GVDA 1K8KB 1H2VZ 5AXNA 3D9BA 1NEEA 2FPHX 4HWIA 1Q46A 3GR1A 4GY2B 3RSEB 4QYRA 1EO1A 2DGVA 2YB1A 1ZH5A 4IFYB 2FPKA 4CZGA 3AXKA 4K0KF 1GQEA 4CJ5A 4FJ8A 3VF0B 2E8AA 5AQHA 4HUFA 1UA1A 4ZN3A 4CNZA 5BYSA 1D0EA 3DLHA 1HNZJ 2VPYB 5BRDA 2UV8A 3EE3A 4DG1B 2WTUA 1FNMA 1N5QA 4ER8A 3R2DJ 4J2EA 3SLCA 2IC3B 3CG7A 2DD8S 3HTVA 1KAZA 1GOCA 1X60A 2JMGA 1QY7A 2Z7JA 3I5CA 4KLFA 2YWEA 1VQ8N 4IQUA 2W9AA 2R18A 5IINA 3IM8A 2PT0A 2MSNA 1QUVA 1XMQJ 1VSJA 3N6LA 2AEJA 1IBCB 4O3OA 2VGMA 4MKBA 5AQIA 2F63A 1IM6A 4PUOB 3KLIB 4ID8A 4OHWA 1JJ2R 3VA0A 2GQCA 4I1TA 1J6ZA 4JI6F 1RWNB 2VV5A 3EYZA 4FZLA 2YHBA 3MD1A 5K8MA 4MIWA 2BZFA 3EDQB 5IM0A 3MURP 3G6XA 1WSIA 2AEMA 4LF8K 2Q6CA 3EGWB 2N3OA 3PO5A 4DV4J 1SIWB 5DB7A 2E6LA 2AD9A 2VCPA 5LXYA 1NZPA 2K4PA 2V69A 4U67Q 5JXSA 5D77A 2Q0ZX 1NM1A 3LDOA 1GMWA 4CP5A 2R9LA 4V19X 3HI0A 2K7JA 4FVUA 1S1UA 1KHWA 4W90B 2GV9A 5E84A 2KG0A 2KICA 3KK3B 2HHTA 2B4PA 3CETA 3KBBA 5E33A 3GL1A 4TU7A 2RVJA 3AVFA 1ZQKA 2DXDA 3KK2B 2CJBA 4KRWA 4I28A 2QA4N 1UFWA 1RDUA 3QU2A 3CNQP 5ETOA 4CJVA 2I5JB 1C0UB 4M5GA 2DVIA 1APSA 2VQEF 3DLBA 5KGXA 3E3XA 3ZSYA 3BS9A 1LB2B 4IKAA 4YB7A 3ZZOA 4JI3J 4RWTA 5SUHA 4CJKA 3HSZA 4NA1A 2J6UA 4DR3F 3DYAB 3GU0A 2V4QA 2CZVC 4DPOA 5IV3A 1IIPA 1C0TA 1XMOF 1N32F 3AB2B 1UAWA 3M6GA 1IH7A 2X6NA 1U1RA 2FJ6A 2ILZA 5E5NA 5HRNA 2B4OA 7ICUA 4F2SA 2I5HA 4F4YA 1F3FA 1XERA 4CZIA 2HG4A 5B0EA 2XMUA 3U1LA 3J81j 2VFVA 3ZZTA 1M1HA 5K9FA 5LMUF 5CHIA 4P0QA 4DMZA 1KOHA 5JTIA 2G8WA 5L8RC 1M1KT 2FHMA 2DXEA 3D2SA 4RG8A 3QRQA 4A5BA 1RDRA 1JI7A 3NFAA 2CQIA 3BUZB 4JI2J 1VQKS 2BCRA 2NNWA 7ICGA 3GYXB 3D3CJ 1RDCA 3OQ2A 4M8LA 1T9TA 2F5GA 2JC1A 4ICLA 2HZVA 4ECUA 1WAJA 3V6DB 4I2BA 3V6JA 3BKUA 4KC5A 2YQ1A 4J9QA 3MMBB 3VHQA 4FWRA 1Q9XA 4Y6IA 3UN5A 3RTVA 3AVKA 2OCEA 4WP8A 4X4PA 5KRSA 3MEGA 3DDIA 3A5MC 1HBOA 4XPEA 4PR6A 3H2VE 4Y2RA 2QO3A 2VBWA 4OLOA 4YB6A 4RW4B 2E8NA 4B3MF 3VC8A 1H74A 4B3TJ 1ZXOA 3POTA 3CMEN 4QZEA 3RRHA 3EPIA 2AJFE 2EX3A 1WWHA 3GDQA 3SNNA 2B21A 1JLQA 3QBXA 3R6GB 2C2ZB 3LUYA 3S3NA 4FYXB 1Z1VA 2YHWA 2W9CB 3PMLA 2VBXA 4U8YA 4Z6DA 5AKGA 2VJUA 4UATA 3BEGB 3HVWA 3QGHA 2GUPA 3AD9C 1VMBA 1FTCA 3EW9A 2J5AA 4CLYA 3M6UA 3ZZPA 4FOIA 5AKIA 3CB4A 2I6WA 3JAMY 4I2QA 4F36A 5HHHA 5J0PA 3AVCA 4KLSA 1QAXA 2AGPA 1JL1A 2Y8WA 3NDKA 4BRPA 1RWWB 1NK8A 2ZD1A 3MABA 4QPTA 3RJGA 4M6WB 1VLBA 3V9UA 4F72A 3U7JA 2F4FA 1IKWA 2DNHA 2QWLA 3G71N 2HHWA 5HQMA 1M5OC 3JPQA 2DT9A 3A0BU 3OW2M 3PW4A 1QQCA 3J8AA 2F44A 1RAJA 4M45A 2D3ZA 4K5SA 2HQIA 3SFGA 4DV1J 2IYGA 2K3KA 2C28A 3DI6B 3ISZA 5B0FA 3M1VB 2EW9A 3TJ8A 3MCOA 5ETNA 1VBZA 3BS5A 4OPKA 3Q23A 2ZUGA 3LP0B 1GK8A 4ZHRA 4WZQA 2G13A 4CEBA 2LPEA 2DNYA 4MK7A 2F8HA 1I94K 2I7NA 4FW2A 3DDNA 4BRAA 2QL5B 4DTNA 4USKA 3CJBA 4RQ1A 1JLEB 2NSBA 1KTVA 4QZDA 3VQDA 1X1PA 4UB4A 2RF2B 3QB0A 4LF8F 1FIQA 2KU7A 3QSYB 2A2CA 3GV7B 4E0DA 4AYBD 4DX8H 4TUSA 2JSXA 2AT1B 4Z4FA 3D45A 4GMJB 3ZI4A 4NLYA 2G4BA 1NJIT 3UCGA 2MQMA 2DNZA 4I2PB 3K9JA 1MWZA 2UXDJ 4ZVTB 1GLBG 3C8YA 5ALVA 4B1VA 4Z4IA 3IS9A 1N5YA 5A6PA 4USMA 1EIYB 1VRTB 1AROP 1RT7A 3KD1E 4LF9K 5AJ3K 4OLAA 4UAUA 4GKKK 3SZ2A 2QWQA 4CIOA 1CJUA 4P2FA 3IBCB 4CHOA 3KJFB 2WC9A 3R1LA 5D0RA 3ZO7A 2FSNA 3GJQB 1NI3A 4HTJA 3T19A 4OGCA 1LWEA 3ENHA 2XMKA 4MFBB 4RKUC 5J0QA 3QGGA 1JCGA 2AKWB 2HOIA 3NL0A 1N33F 3AHPA 1YXQA 5LMNK 2FLLA 1GLFO 4DSFA 1ZQWA 4JUZA 1ZBHA 2MUTB 4U7CA 1K8AT 5JS1A 1LWXA 3CCMS 2VIHA 3KIOA 3DRRA 4I4BA 1XR5A 1CEZA 1QVFR 2J0QD 2YCHA 4EBDA 2VQFJ 3VEWA 2NUBA 2R8HA 1YRUA 5GAHU 1BC6A 2BACA 2PFPA 3M8PB 3CCEN 2QK9A 3LM9A 2QA2A 3BGFA 4IO8A 1B70B 1GLLO 2P8IA 1MWQA 3R3TA 4ACOA 5GAGU 4CH1A 4ZDNA 2WVEA 3K89A 3GJTB 4DXLA 2KQ2A 5J2HA 4DR5J 5J1EB 4PKIA 1PJ7A 3ET6A 1S9EB 2VJ5A 1F3VA 3OYKA 2ZITA 2XB2D 4EZ6A 2YKPA 4DL3A 5DDPC 1S6PA 3CM6A 2RQCA 4FF3A 3SAFA 4QWEA 2OO4A 2F3NA 4RW6B 2YX8A 1R0BG 3L2WA 2D41A 2E2NA 1TKXA 2KVIA 2ZGYA 1IVZA 2B0GA 4X62J 1JLFA 4M9LA 2OPPA 4US8A 4JRQA 2Q43A 4A46A 2N7CA 3BYRA 2RQMA 2XHBA 3UI3A 1IJJA 4EELA 4Y1DA 2AJ2A 4EX6A 2HI0A 1T9UA 4A2AA 4B3RK 3RU0A 1DQ8A 5AXKA 1WC1A 5GINA 2KB2A 2HMXA 1TFYA 5IOLA 1FKAF 1NJXA 4XDCA 3M2UA 2E2QA 5A8RA 4X4QA 1URRA 1HQ2A 2H3GX 2X3DA 1RP5A 3ULDA 4FBUA 4YMMA 2LI6A 5KFHA 4YFUA 4X66F 1SQFA 3U4LA 4FPBA 4Z37A 4OJRA 7ICNA 4X62K 3SCXA 4CF1A 1VQSA 3I56N 5KFTA 1QQ5A 4HACA 1NGAA 2HLTA 1ZM9A 2ADCA 1UL3A 4OV1A 3D7SB 3OVAA 4I6YA 1F9EB 1UVKA 2KIWA 3SMZA 2DHGA 5ALGA 2LEPA 3HPHA 1YAGA 2MZJA 5EX0A 5EE1A 1WCNA 3K59A 3IG5A 1BQMB 3QDKA 4EWTA 3NF7A 1KHVA 4C11A 4ZVGA 1KW4A 3UKRA 3LWMA 1MU2A 5E0OA 3RB3A 4GC6A 1U24A 5DM6Q 4ELUA 1U1PA 3RUBL 3UDVA 1CZAN 3G9CA 2KD1A 3Q8LA 4CERA 1PO6A 2FC0A 4P4PA 2G07A 1UCVA 1YITS 4HH1A 1SIZA 4P6QA 4K4UA 4LFCJ 3P49B 2RDDA 4DZDA 4LFAJ 4KLQA 1N0VC 2PO4A 4U8VA 2ZOGA 2HBQB 2O8EA 3VGKA 2XSJA 2A41A 4L72B 3MM7B 4IR9A 2DGTA 4USUA 2KN7A 2HNDA 1NNDA 2BUNA 4CF3A 2RUGA 4FZXC 3OTDA 2RU3A 1N54B 1VQ4S 2KKZA 1VFJA 5KOXA 4DV3J 2BKNA 2P9SB 3NTUA 5AQFA 4DV7K 1YRXA 4C8NA 2GQ2A 3S01A 2I7PA 1NGBA 3CJ0A 9ICSA 4QS8A 3O3FA 1NWKA 4LD0A 1MN8A 3BP8A 2H51B 1HWIA 3TZZA 4BE1A 3G6YA 2VC0A 3HP6A 2IHMA 1IXKA 3D0PA 2DGUA 4DFPA 2CXYA 2W9BB 1K5OA 1O1WA 2FYXA 3UNYA 4FXDA 2FVSA 4ECRA 4BR7A 4V1Ak 3NF9A 1A5WA 4B9QA 1BIZA 4CEEA 2PA3A 4JYAJ 4LFBJ 2NRZA 3G82B 1YLXA 2XS7A 4CTAA 1VSDA 1L7NA 4GW6A 2KH9A 3M8QA 5H9FK 2O6KA 3AOAA 2IA0A 1HD1A 1RWPB 3HO1A 3KJQB 3AQFA 3OLBA 2ASDA 9ICXA 3PTWA 3CPWM 4CEZA 3ZCMA 1RACB 1NPRA 3CMAN 1RABB 4HTLA 1HWUA 1T9YA 1HHTP 2MKKA 3CJQA 4J9PA 3Q8VA 8ICMA 4IEEA 3RB6A 2XYHB 3OYMA 9ICLA 2KI2A 4CRXA 5J2EA 1PYSB 1RT2A 1NSAA 2IJNA 5A0YB 1T6DA 4UASA 1CXUA 3PIOL 2B8QA 3K9KA 3C95A 1NKCA 2HSZA 3K5OA 2DCUB 4NV0A 4PZNA 5KT4A 4M3UA 5HBMB 5DRKA 4M5DA 3H7HB 2QWMA 1NOZA 4ZPDA 1COKA 3EZUA 4RBUA 5IZHA 4PG4A 4C1NK 2C3MA 1R0AB 4CZEA 1XBWA 2XHCA 3MDFA 3DEEA 2KZZA 1F5BA 1NRKA 4C1NI 3MM9B 4M41A 1HNIB 4OZLA 5H1SQ 1TR0A 3KHYA 3J7ZT 3SV4A 5DDOC 1S1WA 3ZT4A 1HWLA 1X5OA 4K7QA 1I51B 4ZK7M 4FZYA 2PMWA 2DF4B 4GVBB 4H5TA 2EG2A 2ZH7A 4ENOA 5LSLA 1F2GA 4DUZK 4F8RA 2MQNA 3W63A 2DK2A 2VG5A 2YQ3A 2YWGA 1FXLA 2KKHA 3T6BA 1X9WA 3GQCA 3HF5A 2FJVA 1CVJA 3WNHA 1Q81T 1QDUB 3CDEA 3R6LB 2VODA 2OKQA 3OYHA 4GIBA 3SQ1A 4FJ9A 2H3IA 2ZWPA 5IWAJ 2HFSA 1ZQFA 3GE1A 1RLCL 1QZ5A 1SJ3P 3TEGA 1XU4A 3R9PA 1JLGA 2XWXA 3J81U 2O8BB 2HW3A 3R97A 1DAXA 1HQUB 1GLAG 3VGVA 2ROPA 3BY5A 1RA7A 1EXQA 1FEHA 3O9UA 1P27B 3FQLA 2E5LF 2W11A 1UEUA 2AMCB 3BQ0A 4JI5F 1FJ7A 1FFGB 2P9LA 8ICJA 1VDVA 2F1HA 3P5BP 4BGAA 4QNLA 2BUPA 2KZ3A 2X7IA 3HD2A 3VGSA 4KB0A 2ESEA 4LREA 2OEKA 1IBLK 3BEXA 3WK9A 5LMNF 4OHYA 1QQMA 1RT4A 1PK1A 2H65B 3H0RB 1L3KA 1VQMS 3T41A 1S7IA 2AW0A 1S1VB 3E8OA 3TVKA 3AM9A 2FI1A 3EO3A 1QQ7A 3SCIE 1T94A 1N61A 2XMWA 4PGQA 4FM2A 3WK8A 3U3YA 1LCUA 2ROGA 1U0HA 3M6ZA 2BQUA 5F8LA 3GIKA 4NOHA 7ICEA 2VWKA 3RJMB 2W43A 4OI0A 2CWXA 1QLNA 8ICTA 4DU1A 4EFHA 2V8PA 3TA1A 2CPRA 1S7HA 2EVZA 3TA2A 2A2DA 4CBUA 3QETA 1R27B 4DPUA 2NXUA 4F26A 3OYJA 3HX0A 2L08A 4FBTA 2NRVA 4F92B 4WYBA 2CKWA 4CIGA 4FKYA 1BLUA 3BQ7A 3FBFA 5FRMA 4ZTFA 4CK2A 4XTTA 4CJWA 5ETMA 1H98A 4FZNA 4E1JA 1CS4A 4K50A 2BGWA 4EAHD 1JQGA 3OR1A 2ZC3A 2FZGB 2KKVA 4JK8A 1ULRA 1N36J 4CZJA 4RQ7A 1QQNA 2YKNB 4C7QA 3EL2A 3BO3A 1KQFB 3JSBA 1IUJA 2YX1A 5LSRA 1BOTO 5IIKA 2Z1IA 4MYTA 2I1RA 2RN2A 1VRUA 2GJ2A 1W7AA 1QHAA 2IJFA 2ITGA 5IILA 2Y1LB 2QN6B 2ALYB 4JKDA 1FDDA 3B6PA 5BXIA 1ZA2B 2DPJA 1TUGB 1RT1A 1LNQA 3IR5B 3DOMA 2L9WA 5JLHA 5CQGA 4L73A 9ICNA 2CVIA 3G25A 2AYGA 5LJ5Y 4I29A 3K5MA 2Y9UA 5ITHA 3B4MA 4LF5F 4OL8A 1JNZB 1X4EA 4HEA9 3EDRB 4NYNA 3WIUA 1WG8A 3EMTA 1X6JA 4C80A 1FEZA 4OX9K 2DNLA 1GX6A 5D3GB 3UM9A 4Y2KA 3RYLA 4E8UA 5AXMA 3THYB 1PIEA 4DR6F 4XEIA 4I9QA 2UXDF 4KGZB 1YJWN 4XA5A 4KHRA 4K4TA 2GELA 2XBPA 3HULA 3LDNA 5EE3A 2ZGZA 3MDCA 4HLBA 2DJWA 3NGKA 2BRLA 5LOQA 4BRCA 2HBYB 3IRXB 4FNIA 3DHWC 1ZRNA 3CO0P 4RQNA 2W7OA 2GVZB 4BQZA 1F5AA 4FYDA 3ALRA 3PSIA 1PVRA 3DXMA 5K4LA 2IYIA 2DR7A 5HRRA 3H5UA 3KK3A 5IQQA 5IT9U 1P7DA 2OEMA 4FF4A 1K73O 4ZLNA 1YVFA 4YN3B 4DX7A 1WSHA 5HRSA 3CUNA 1D9DA 1MWYA 3UD4P 4FJKA 4DR4J 4H4MA 1TFRA 2UVRA 3DMJA 1M90O 4I9LA 4F7VA 3JPTA 1GLDG 4CJTA 1TU0B 5J2QB 1MA7A 1U7LA 1HBMA 4AE5A 3R6MA 1JXBA 4YUDA 2JWKA 1SZ2A 1GLEG 3FLCO 4IOXA 1S1TB 5KFZA 4DV4K 2NO4A 1HNZK 4ID5A 3HVRA 3TFRA 2OPRA 4RUAA 1S49A 1RDBA 2KV2A 8ICZA 1NZBA 5H9FJ 3MEKA 4PXDA 3I5BA 2VASA 2JLFA 2YV0X 3MAHA 1C0TB 1T95A 2HNDB 5GADI 2CNKB 3DLRA 1A0PA 3C14B 2DFFA 4P9SA 1DLOA 1COOA 4NLUA 5EVZA 3CHWA 1WF2A 4JKGB 2ZJ5A 1KCFA 4LFCF 2E4LA 3LP0A 4BR2A 4PXEA 3OJSA 2CJAA 2WAQD 1WOQA 3NH1A 3FEXB 3I82A 5FPMA 2BMBA 4J9UE 5IXUA 2QC3A 2JXJA 3W2VB 4KRFA 1CC8A 2PKEA 3T7ZA 2ZTEA 1Q18A 2RF2A 4CJFA 2F7VA 2CPDA 3N7SC 2POKA 1W97L 4QS9A 1SQGA 3WQTA 3K5NA 4CD3A 1YDLA 1ASWA 1C0FA 4HHJA 3NS6A 1N0UA 1XC9A 4FZVA 2LECA 5AKLA 1H72C 2YJFA 1DTTA 3MGHA 2FMPA 2ZIUB 2YX6A 5KFQA 4OX9F 2ZUCA 9ICFA 4YOVA 3IG8A 4FDFA 3GP9A 4JI3K 1SKWA 4ED0A 2LYAA 2QIFA 1ZQHA 3RBXA 4GKJF 5IT9Y 3IS9B 5EWFA 1LOTB 8ICWA 2M0NA 3W7BA 3CXCR 4K4ZA 4WK3A 3CIMA 3EE9A 3VAGA 3O8MA 5DM7L 2ILYA 1T3QA 1TELA 2AJ0A 3EE8A 4Y2VA 1KFDA 2OEHA 3QEWA 3BYPA 3CCLS 4QZVB 2RE2A 4A2BA 2K4IA 2VA8A 1Y9OA 4DTMA 4Y2YA 4WQ4C 5U47A 1RQNA 4BRQA 4MMOA 2JVOA 5L46A 2CPFA 3TKAA 3K7RA 2IRXA 1VS3A 2CXEA 4QR2A 4BC9A 3L3VA 2HURA 4QIFA 5LL6d 2VKQA 2WB1C 2BPFA 4FLTA 3C3LA 1Z6RA 3WNGA 5CWRA 2F9TA 4RZRA 4WE1A 1ZAWA 3H6EA 5M1NA 5J2AA 3G2XA 5DGAA 1HBUB 1WUUA 5J2NB 3Q8YA 4I69A 1RLDA 1FRMA 4NCGA 2FDNA 4MJKA 1UW4A 2ZBIA 4JBCA 1MC8A 4MKVA 2W9MA 4C3KA 2ZJRL 4FF2A 1ZQQA 4NXNF 2FLOA 4OO1J 3M2RB 3ZSOA 4M5LA 3TTCA 3OYNA 4OQJA 5HJXA 3PX0A 5HLFB 3EM1A 4P71A 4DPYA 2R7XA 1P9QC 2M52A 3CCRN 1CJKB 3Q83A 4CQ1A 3R7NB 8ATCB 3L4IA 1ZQCA 2JFKA 5B7WA 3KTQA 4KY3A 3NBPA 5LSOA 3C2LA 2IC3A 3ENQA 1U6BA 3RW6A 4JV1A 4LQ3A 2DO4A 1U1KA 1J2MA 4P73A 2DFLA 2K1RA 5E79U 1FXXA 4BWMA 4WQ5A 2GC8A 2VFTA 1OKJA 1LWCB 3TZWA 3ZEUA 4ZJLA 1S6UA 1Z4NA 2N82B 3HW8A 1NJYA 3AJ2A 5I4MA 4NI2A 2MZTA 5JRTA 1XO1A 1JJHA 3A13A 3PR5B 4J9NA 3RH5A 3FCVA 3QJJA 4AHUA 1PK1B 1V3RA 4NM1A 4TVAB 5AQKA 4H0XB 1OYDA 1TVAA 1U04A 4H0VB 2R8JA 4EHUA 1J53A 3EWAA 3QATA 4WIIA 4M63A 1KR4A 4R5PB 2ASJA 3KG0A 2GGPB 1KQSR 3CCZA 4FPRA 4H0OA 3OYLA 4FNHA 4IO1A 4I2PA 4F93B 5KFVA 1TL7B 3LW5C 4UOCA 1JXVA 1KEJA 4MFFA 1X3NA 3IAS9 3HPGA 2W2QP 3PX6A 4YP3A 3THVA 3CO9A 5AQGA 4NXMK 4B1WB 1S5LU 2ALZA 1S1UB 2IFXA 1OQ6A 1X0PA 4F3QA 4AL5A 2GHVC 5KFOA 3DXKA 1J9AA 4Q5VA 4YORA 1VSHA 3KZIU 1GEHA 1FO4A 1X4BA 3HJEA 3A2FA 3AVAA 2JHEA 2WVFA 4RLEA 3CNHA 3LL3A 1N34J 2MSTA 2D3O1 2A10A 2F9DA 1OPIA 1M5HA 3MXMA 2EANA 5AQSA 4ZPTR 3MPVA 2XM3A 1L5UA 3Q89A 1U2CA 3RBZA 2D5RA 5J29A 2LXIA 4XUSA 1FDAA 4KH0B 5G0RB 3OGUA 4M3TA 4CYUB 2HRUA 1T0TV 1U9LA 2HGNA 1U0SA 3QPIA 5KG4A 3M8RA 2C3YA 3MN7A 4TU8A 4PYDA 4OZNA 1VQYA 4QIWD 3BN4A 1RQ0A 2DGQA 2G0AA 3C46A 4QWAA 4M63C 2RHQB 3KLGA 4E89A 3FK4A 5CABA 4GKJJ 4PHAA 1OYEA 1QUPA 2R7UA 4WZMA 3RJFA 2JEJA 2DGSA 3ZDCA 2D1KA 2KTQA 2FUG9 1W2BR 4IOBA 4OI1A 1YK9A 3B82A 4CZKA 1PVQA 1UETA 1Q8BA 3OTOJ 5CYMB 2XIDA 4DV7F 4GLXA 2ZIWA 2GEMA 5ETVA 1NPKA 2Y1JA 3M9NB 2OFHX 4DKWA 2DNMA 2RS8A 2HCFA 1S22A 4YD1A 2UV8G 2V9KA 3R5GA 7ICVA 1TKXB 1S9FA 1VOMA 7ICKA 5EHHA 1HKBA 3M8YA 4OJLA 1S97A 2XI3A 3TZXA 3V6DA 1R0CB 4R8UB 5HVFA 4LUBA 5ALEA 2PGCA 4NEZA 3QUBA 4RUCA 3IRXA 4F25A 3D2WA 6AT1B 4OCZA 4QZIA 3ZDDA 4FLUA 5DLFA 3TUZC 1UEVA 1J2NA 3KJVB 1ZJMA 2WSEC 3EUB2 3KK1A 1T05B 3AVIA 4WTYA 2HHHK 4JV2A 2AIRB 3M9MB 4J9KA 4K42A 2E2PA 1WWUA 4PXCA 4ZPAA 4U9RA 3KOOA 3WQUA 4KN4A 1Z26A 3DGPA 2DGZA 2GQQA 4B3TF 5B0DA 2JC0A 3OL6A 3H8SA 4DOCA 2CQ0A 5CH7B 3RJIA 1Q5YA 5EGYA 2ZHAA 3AA9A 4ISEA 4WIQA 2YWFA 2OD4A 2W9CA 2J9CA 2ZBRA 4HACB 1YJ9S 3UD3P 4YY3F 3TAMB 3H46O 3TZYA 3BPDA 1VLYA 3D68A 2BX6A 1L7OA 1SJ4P 3KKAC 2J8SA 3GV8B 1RAHB 5ADXA 2OZMA 1G7CB 4KBIA 4X5VA 1NDPA 3OHBA 2MZQA 2M3DA 1K0VA 3K58A 1T8EA 3L7UA 2ISPA 4RQ0A 5ALYA 3JB9k 4X4UA 1C4CA 1IM4A 1WUDA 4TUPA 1TTHB 5E3CA 2KYZA 2R7OA 1RGIA 3SSRA 1S1WB 2CGLA 3ILLA 1JKHA 3D2QA 4ZOHC 5DETA 4XO0A 3BSAA 2AZ1A 3UDEA 2FVPA 3AVHA 1RUSA 1TP7A 5BYRA 4WQ4A 4BDYA 3HVTA 4YFKA 4X66J 4CI6A 4F5QA 5B08A 1RBSA 5AK3A 2MXYA 2ATCB 2JHDA 2GTDA 1ED1A 3MGIA 3MEEA 2AGOA 2R7RA 4GV3A 4QZ8A 2KM8B 3VQ8A 4IG0A 5ALTA 1R59O 5L1IA 4X4NA 3CFOA 2KN4A 2UUCJ 1W0HA 4K8ZA 2DHSA 5BREA 2BW7A 5DKWA 2G8UA 2YWHA 4WTOB 3GMGA 3A5OC 4QR1A 2P9PA 3O4WA 4OZ1A 4CGIA 1KVBA 2UUCF 4CJPA 2BJ1A 4TY8A 2AP1A 1XEZA 3FGVA 3EGZA 4I7FA 4C4RA 4QS7A 3ULEA 5J0RA 4JLHA 1X4AA 4O8KA 3VQ9A 2HZAA 2DXFA 1ITPA 4H8KA 3CC4N 3OV7A 3V7JA 3J7YU 4K4WA 1ZQBA 2B3TB 2W24A 4C9DA 3C5GA 2B9XA 2P5GA 1GO3F 5KFPA 4BG8A 1O6XA 1FFWB 1DT9A 2F4VF 1IKVA 2DFEA 5KG2A 2R42A 3OVNA 4WBFA 4JYAF 4LFBF 4IFEA 3CGIA 4M5MA 2ASOA 1SAZA 1BHLA 1TKZB 2XO7A 3N9UC 2Q97A 1HNXF 3FBCA 3M4XA 4BBYA 1D09B 3CYMA 3GE9A 1T9XA 1FKOA 3B8HA 1BHNA 3VV2B 2HHHF 4PZOA 2W4DA 4FWMA 5JVGL 4NLZA 3VEOA 1HJOA 1LXNA 2UUTA 4LT6A 9ICCA 3QEPA 1VBKA 4JYAK 4LFBK 5DDMA 2V4JA 4ZP6A 3AVBA 1VRTA 4JI0K 2E1FA 4CEFA 2ZH3A 4H5NA 4DI6A 7ICIA 1CJUB 1QSLA 1R8PA 7ICSA 1B4SA 3GR0A 4BRKA 4DQ8A 4CE6A 5KTQA 1E6VA 3TADA 3B4DA 2XLIA 1EETA 1TK0A 5DBAA 3H5YA 4MFBA 5L39A 5J2BA 3B78A 3NGRA 3VR1A 4QOTA 1OO0B 3L95X 1FRXA 4E7LA 4BY9C 1J5EF 3UQSA 1WI8A 1X9JA 2KL8A 2XMTA 1B64A 4OJ3A 1DQAA 5ALIA 3VMFB 2LDIA 4IQVA 3CC2S 3LP1A 2AYBA 1N63A 3UDCA 2C22A 4OD0A 4CZCA 3NOCA 1VQ5N 2MQQA 4G9BA 2UUBK 4M3YA 4LRBA 4PJ0U 2E44A 1X7VA 3W9JA 2GX9A 3TYTA 4H0TB 3CQXA 2CG8A 1GX5A 1NOMA 4LRAA 3GCWP 5C42A 2H3EB 3VPZA 1JLAB 3KXDA 4PL2A 3JAMU 2G5HB 2HS4A 3O1BA 4IWVA 2QW9A 1R8HA 3DN9A 8ICLA 1WBDA 5F9LA 2K89A 3TAPA 5E41A 2ZIXB 2FSJA 1NK4A 1HRHA 3LDAA 3DRXA 2EEYA 4AQYJ 5DQGA 4J37A 2HSTA 4OX8A 1NBEB 3NGSA 3QERA 3DM2A 1VCTA 1KKXA 2EAPA 2UYTA 2F77X 1RHKB 1NH8A 3PNIA 2HFOA 1RWVB 2V2KA 1CJVA 1LXJA 3W5YA 2KOBA 5D0GA 1HYSB 4RNHA 1KXPA 1WC6A 2XLJA 4D3GA 3NVKA 2OPSA 1NPPA 3C16A 3WDOA 2MQOA 3FR0A 5L1LA 5I42B 3WQPA 5HN0A 2DY1A 2D4WA 1EXNA 3MCSA 4H54A 3PRDA 4YR0A 5A8RB 4F4KA 3OS1A 3UKUB 1S0NA 1Z00B 4DQSA 1TAMA 1IV0A 5DDYA 2YNIB 3IM1A 4LR9A 2ZJPL 1KFSA 2HHVA 1MROB 2PI4A 1TL4A 3QNMA 2K06A 2CDQA 2ZBCA 3IR6B 2E6MA 4DV2J 5K14A 3VQ6A 2O3DA 1K1SA 3CC7N 4DV5F 4FWNA 2J9DA 1N34F 1L6NA 3THXA 2OPRB 3M30A 3LGMA 4CLLA 3IHQB 3W1YC 4OGEA 4MIAA 1MMNA 4C11B 4F3TA 3IUCA 1NBWA 1VHXA 5J2CA 3C14A 3JYTA 4JK1A 1HEKA 2EZXA 3MEDB 4LC9B 3QZ8A 2FZCB 2UXCK 1P8ZA 5DO2A 3SDEA 1JK9B 2XZTB 1PYTA 1BE4A 4XIUA 1XWLA 2WW8A 2JEIA 4CHYA 4FVCA 1RSCA 5CHGA 3BZQA 2XTJP 2NREA 1WOSA 1ASUA 4PQAA 4NXNK 4TYAA 1GTEA 5C25B 3P45B 2QLTA 2P9GA 4MHVA 3N6MA 4FLYA 4WYWA 1L7MA 1VSFA 5J2PA 2J6SA 4FO6A 1JMSA 3EJMA 3I28A 1ZQDA 2XMVA 4ECXA 1GTHA 2OANA 3W3DA 1LOUA 1U09A 2UVWA 4YOWA 4J9LA 2OPQB 1K47A 1JL2A 3RJHA 1YQHA 4CI0B 4PABA 5LMNJ 2Y8YA 2W54A 5GAEI 2MKCA 3L5KA 2JEFA 2CQHA 1RKIA 2EPIA 2FXUA 1S6QA 3BF4A 3HYFA 1TL3A 1VDHA 2DHXA 3ELHA 2FD2A 1OH7A 4ZVSB 5F0UA 4RW8A 3HRGA 3OR2A 5ETSA 2PYLA 1NKBA 1B7FA 4YMOA 1KP6A 2E9TA 5D4LA 3RH6A 4CTAB 4PA1A 3NASA 5D6GA 2GVZA 1VRQC 5JJBA 5IIOA 1HLUA 3H7IA 4HUEA 4Y2CA 2DY4A 1T3NA 1NAQA 4M9GA 3N4QA 2W41A 4G6VB 2HHQA 2IOHA 3H0PA 4Q7AA 5I3UB 1LW0A 5E7OB 2BZ2A 3R3LA 2MZSA 4JEPA 3R7SB 4CF5A 4LF7K 1QVGM 2OP5A 4WE1B 4DV0J 4A8EA 3Q86A 4DUYK 2W2OP 2BPCA 4EFAC 5BR8J 3FFKB 3ZSRA 4KHPK 3AEVA 4P52A 5HMMA 2YNGA 1N33K 1IXRA 2EC2A 4QIWF 1ECWA 1L8LA 2E8OA 5L9NA 3MTJA 1ZPVA 2BJ7A 3C6TB 4A57A 5AQTA 3SUPA 5HBMA 4A8SA 3T6JA 7ICFA 3WXJA 2PFNA 3HL8A 3ZSQA 5AIBA 4LMZA 1AFIA 4U7UD 3ED5A 4YDXA 2FZKB 3FFIB 5KG0A 3QAEA 1EX8A 4DCPB 4QZCA 3CI5A 3OW2R 2O8DB 3MM6B 3QX7A 4O5BA 3CWJA 4KMOB 3CEDA 1FX4A 3K8VA 1WHXA 3VZIA 2XMMA 2GH1A 3MPWA 3THWA 4RU2A 1SXDA 4KH6A 4BRFA 4UY85 2LA4A 2NRXA 5DZ7A 1S99A 4Z4HA 2IAJA 3MGJA 3DU5A 5ETQA 2FJAB 3O5TB 2KXHA 1FCAA 1IKVB 2M4MA 3F2BA 1WKLA 3PHTA 1F5CA 2O8CB 1P6TA 5F2RA 1FTRA 3SSQA 2IIRA 1P8GA 3FM9A 3ZETA 3QUTA 3D6FB 3Q8PB 2C2OB 3KMQA 1Y97A 1JWWA 3O9QA 3K2YA 5G5HA 8ICSA 3SMVA 5MLCV 2EFQA 2ZH9A 1REGX 5EXWA 2CG4A 2MZRA 4R64A 3MR2A 1SUQB 3D1QA 4ZPWR 3CF5L 3MXJA 4ILMA 2RKIB 1VQ8S 3VEXA 2KT5A 4KITB 1QSSA 2IM1A 5L9XA 3A12A 5AM5A 4Z4GA 4DR1J 1RTIA 1RISA 5D8HB 4BVOA 1DTQA 5A8WA 2Z2MA 3T79A 4C23A 3DLEA 3OYAA 3SQGA 2EFGA 1REVA 2JWLA 4BRHA 1BPEA 2FC9A 4ERDA 1Q3UA 4IQWA 1UT5A 3I32A 2ZF5O 4M3XA 1EETB 3IDWA 1SI9A 2JL9A 2ADBA 1K8KA 3NGIA 1DRGA 4X64F 1ZYQA 1ZQ1C 5ETPA 3D2EB 2V0NA 1TZ0A 1U0HB 1HYVA 3L4QA 4IFYA 4K43A 5AI6A 3K4GA 2PFOA 2IMWP 2CNLB 3R5DA 1X4HA 4KE5A 1C0MA 4M3ZA 4OZ2A 3MAQA 1XSLA 2XY7A 3MPDA 2G8FA 3F5AA 3TX0A 2H3FA 3C2PA 4YHHF 4LVSA 1NNLA 3LP1B 3ONQA 1HL6A 5LT5A 2A42A 3WK6A 1G2EA 5DS7A 4CFDA 1V9OA 2YKQA 2BCVA 4AXJA 1S4FA 1RT3B 3DOKA 3ASMA 3D0IE 1WB9A 4OZ5A 1HLWA 2K8GA 4UZCA 1NMNA 4DN9A 2HDOA 4AD6A 3RG6A 4YN4A 3RAXA 5KFMA 2DNQA 2FDRA 2WVDA 2YX4A 2HVDA 4Q45A 3OR1B 4AXIA 3G10A 3VGTA 2FVCA 4I56A 3H98A 1ZBIA 2WUSA 5LXRA 1O13A 2FGOA 1KLNA 2CNOB 2OD6A 3NVYA 2Q1LA 4BGBA 4CJ4A 1OMSA 2YWWA 1HWJA 2W40A 1RTDB 1DKGD 3N28A 1BQNB 1E6YB 4LH5A 4A61A 3IRUA 4A59A 4OHXA 3N0VA 2DH8A 4DOZA 3PJXA 5AQVA 4XRHA 2C2KB 1TUWA 4OPAA 4GXKA 2ZG6A 4QOZB 2W3RA 3S41A 3D2FB 3AU6A 9ICQA 4E7HA 1HNWK 1YJNS 3ORYA 2GWSA 3QSIA 2XNRA 4KYZA 1HUOA 3NGDA 2V8VA 1RCOB 4KHWA 5M1PA 5D3GA 4A8OA 2DFHA 4QYZJ 2IM2A 5ALZA 2H5IB 4F3MA 4WU2A 5I3PA 4IRKA 5D4PA 4AYBF 4B9NA 2O01C 3L3FX 3GJSB 4TNOA 3CJCA 4BC2A 4F0MA 1B99A 1YITN 2ZE2B 4UUWA 2ZXIA 4PRFA 1WKKA 2X51A 2FHJD 2KSOB 5KQ8A 4UAWA 1SJRA 2ACYA 2ETJA 3J7YP 4JI4K 1T3OA 1U26A 3GFKB 4NXZA 3ZX3A 1Q7YO 3LP2B 2H1YA 3P4IA 4K4YA 2QLBB 1HNXK 3SV3A 1X4DA 4J2AA 2X78A 4W5NA 5KQDA 4EO6A 2W4PA 1VC6A 5AR0A 1Y00A 3A3OB 3C15B 1H38A 4DU3A 5ADZA 2ZBPA 2W42A 4HUGA 2HOQA 3QEIA 5J1PA 2VDHA 3DNCA 4J91A 5ALNA 4CF8A 2R2RA 1D8YA 2PFUA 3ENVA 3MR6A 2PFQA 2FBTA 2V2ZA 4GXJA 4FXVA 1Q1KA 3N5FA 2E66A 1NK5A 4CW7B 4KAZA 2HS3A 4Z94A 1IBKF 2MLXA 5AE3A 5B66U 2Q1NA 4YHHK 4KFBA 3RMDA 1RADB 1URNA 3V9WA 4KI6A 1N6QB 4QZ9A 2NRWA 3M8SA 2A1AA 3GIRA 4IG3A 4NLKA 2P9NB 4USAA 3CDBA 3N4WA 2O8FB 4KLEA 4M9JA 2XO6A 5KT7A 5J2MA 2LYHA 2F96A 5KT5A 1ZRMA 5J0UA 2GHPA 2WBMA 5HVGA 4JKGA 2DL0A 1R7IA 2M0GB 2OLWA 2LXFA 2A1JB 2QARA 3BGUA 4CGGA 1KVJA 2ZKUA 1PC4A 5DG9A 5AHXA 3C29A 2BVZA 4FJNA 1MNEA 3KKFA 1SC1B 4IL6U 3VF4A 5BR8F 4L75A 2HF3A 1TMJA 2CPXA 3AJDA 2RDJA 4RQ8A 4PHDA 1I5OB 4BE0A 4RBVA 3V4MA 4KLTA 1M5PC 1T44A 1TAQA 4KT0C 2C2NA 2Y9TA 2M70A 4RW8B 2HFVA 2HGLA 4CZMA 1UEKA 5SWMA 4B9SA 4NEYA 1IBMJ 3EZWA 3GIMA 2JJ4D 3QQCD 3UMCA 3SQIA 1EZZB 4BC7A 3SIPB 1HX1A 1BD6A 1OSCA 1J2VA 3TEHB 3VQEA 1U4BA 3AT1B 3ULHA 3N97B 3MMAA 1B92A 1GT8A 4OMFG 4CT8A 4EP4A 2QG9B 2HHUA 2NXEA 1MG7A 1T05A 4P4OA 3I31A 1SPBP 2J0XA 4NLDA 3W9IA 4CLWA 4WFYA 1VK3A 1TVRA 1Y5NB 3UCZP 1G15A 2IJRA 3NG8A 5JVGQ 1NOYA 2A18A 1AA1B 5B09A 4CD1A 2OUGA 2D0PA 4JB3A 2DEJA 7ICTA 4PEOA 4NL5A 2GZOA 2UUAF 2L3MA 4R63A 5ALMA 3SBTA 3LPTA 2DRDA 2Q6BA 2KE7A 5BR8K 2FLPA 4B3RJ 2ZHBA 4J9SA 1B9DA 4ZP9A 1HNWJ 3UPFA 4P74A 1NK9A 2P2CB 1SQKA 3C7NA 3QUCA 3QBCA 2OYQA 4LF6K 3AO3A 2VA2A 2FB0A 4UOGA 4FJ7A 4Y2AA 3HD1A 1VJ5A 3Q8SB 1HBUA 3HKZF 4FVMA 2W01A 2WF9A 5AI4A 2XI2A 2F8EX 1CJTA 1UJ6A 2XZDB 4AL6A 1BMQB 3D6HB 3JAMO 3R1HA 3O3HA 2FHJA 3BO4A 4QZBA 4KPCA 4LSLB 3BQ2A 4UF4A 4DV6J 1Z19A 1NK0A 2MDAA 3FEZA 3VERA 4AILC 4PG5A 2E1AA 1F60B 1ZM3A 1JLAA 3PYEA 4FPAA 4KTQA 4O3NA 4LJMA 2J0SD 4ZIVA 4OYBA 1SIJA 4KREA 2WMMA 3MWPA 2QB0B 2BRKA 1AUDA 3V4IA 5JU5A 2WSCC 3W5XA 5GAGI 1PAEX 4USVA 4ED5A 4LR7A 1TQLA 4ZPBA 5AKJA 4ECTA 1IKXA 2NRRA 3M32A 3OPXA 3H45C 2V67A 3F2DA 4RNOA 1YVNA 4J7CA 5GADP 4DHYA 4YXJA 1LWCA 4PGXA 2WB4A 4NWIA 3ZTOA 4DPTA 2G8HA 2LMRA 3QMLA 4CHPA 1SJ1A 1GMVA 3R5JB 2BKEA 1DK2A 1NDKA 2JH7A 2PEBA 2RH3A 2AEFA 1NMDA 2OPSB 3C16B 2VJ4A 4PHPA 1DQ9A 5M2RA 4DTUA 3M6KA 4MIBA 3I87A 1TKZA 1WEXA 4B8CA 3I4PA 4DR7F 4W98A 3V9SA 3U26A 2GJFA 2V2QA 2F8TA 2RIJA 1PBAA 3F5TA 2AHOB 1U02A 4NLRA 2FBVA 1RYRA 4RQMA 2HHHJ 2A1SA 2PFDA 4PWUA 4KLLA 4TLQA 5AJ3F 3NS5A 4CLUA 2YMQA 4WP3A 3HK2A 3AV9A 1V38A 3ZC4A 4JI8F 2HRTA 1XNQF 3UR0A 1DURA 3AQPA 4WFAL 2FVRA 2I9SA 4URQU 2N4DA 4ISGA 3LYSA 3W0LA 3P39A 2A5XA 4HTIA 3C2MA 3ILOA 4BROA 1YJVA 3DYAA 3BV8A 4R25A 4B9UA 4Z6CA 2ASMA 3QNOA 1S0MA 1XMOJ 2IVPA 3LZIA 2DGWA 3GPAA 4OFZA 5AKZA 2UU9F 4CO4A 4CLSA 4UBCA 4RPFA 4IOAQ 3OTOK 3H3OB 2G2OA 4F4AA 3NCPA 2CGJA 4NYOA 3LO3A 4X65K 1T9VA 3D4JA 1HI0P 3D6RA 2WHEA 4CYUA 3U9ZA 3WT0A 1FNXH 1NO8A 1BI4B 4F67A 2JR5A 3ETMA 1I94J 4Z0UA 2DCLA 2HYIB 1UW9A 4BREA 1V6HA 2G8IA 5J0YA 3X1LB 2AU0A 1M1GA 2BXJA 3RAMA 3H5XA 2P6SA 2HQCA 3L3UA 4RW9B 1U49A 3LP3A 4FM0A 4X2BA 2XRIA 1PILA 3AVMA 1QH9A 4PH5A 3W65A 5JUMA 1AT1B 2BKOA 3L8BA 4QBUA 3HFZB 3ZSWA 3HHDA 3HX9A 3C23A 4BVPA 3Q2SC 4NLPA 1SZPA 5AM3A 2CDRB 1RNHA 2ZZMA 3QU7A 3JTOA 3WKBA 3AY0A 3E1YA 2LA6A 4LRDA 4EHTA 3PSPA 1HBOB 4BC5A 4DV6K 4TN2A 4F9OA 1H3DA 3N4PA 3T1YF 4RW4A 4WKRA 3GFYA 4HYKA 3BZCA 2ZH6A 2K8AA 4CWBA 3N4MB 2Z0GA 3U02A 2OMOA 3OL8A 1Y0HA 3P31A 3LANA 3NXZA 2MMYA 2BANA 4UW2A 4JMUA 1JLQB 4DL0C 2M9NA 2YHAA 4FM1A 3M5RA 2BJ9A 4RQ5A 2B9EA 3KUHA 2VDIA 3R8YA 4DEZA 1N60A 5ALFA 2BOAA 2CIMA 4UB8U 2HMIA 4KIAA 2DR6A 3TACB 1MDUB 2MZ1A 1EHWA 2E1YA 2QA4S 4NLCA 2ZH8A 1CXQA 3ISCA 4HVJA 3KLHB 4F50A 3UKUA 1N33J 1D8BA 4Q0BA 2ZZTA 3F53A 3VWSA 2KT3A 5K8NA 2YNIA 1MA9B 1ZETA 3PYFA 4M6WA 1H0HB 4NLWA 3ITHA 3SQOP 3QRPA 2BM1A 5DZ6A 2PIIA 4DR3K 3UW1A 4FCYA 4B3MK 1C0UA 3SUNA 2KXNB 1BY9A 1FRKA 4GO7X 3TAMA 9ICTA 1HNZF 2EBGA 3DLGB 1ZC6A 4YNQA 3ZT1A 3C6TA 2GIFA 4EIAA 4IQXA 4K4SA 4AM6A 3M6WA 1EQYA 2CJXB 3RJKA 3B8AX 2L9NA 5JMVA 2DTUA 2O8EB 2E1MC 4NXMF 4F5NA 4A8YA 4JKCA 2UUWA 2OXOA 4LBIA 3OYBA 2DNRA 2AYMA 1NZAA 2Y0SD 5F8GA 1T7PA 4A8QA 4R66A 1PK3A 5F8MA 1RXWA 4RU9A 1HWKA 4QPXA 4KH1B 4Z4CA 3MEDA 4DV5K 2XQCA 3RVCA 3BS5B 1V3ZA 2M8DB 4IC9A 2VH7A 4ZP8A 4CJRA 2NUUG 2V94A 4DR3J 4N76A 3HVTB 1VQ7S 1VQ6S 2YXLA 4IXCA 4G9ZA 2J9DE 4K8XA 2GBZA 3EX7B 4KHNA 3O44A 4LIRA 4DV0K 3M05A 5F3ZA 2UXCJ 2V63A 2VQEJ 3T1AA 2ES6A 4DF4A 3UD5A 2P5OA 3SSSA 5KPTA 4C8OA 4JI3F 1KD1O 4RT2A 1NCLA 1VQPS 3TRGA 4BE2A 3G82A 4ZVHA 3TSQA 4KMUA 5HANA 3CCTA 1YTYA 3T1YK 2V9WA 2QWRA 1FESA 4PL8A 1KEKA 4YD2A 5AZJB 3CMES 3SAHA 1BU6O 3EGVA 4Z7CA 4DUYF 2B4JA 2QSFA 1EKRA 4FJIA 3H1VX 3QE9Y 3HDSA 1RT7B 3POTB 4O55A 2HF4A 1IR2A 5FDLB 4QIVA 3NAHA 3W5ZA 1IKYB 1X6IA 1DTQB 5A8WB 2P9KA 2CJQA 1RI7A 5DB8A 2HNZA 3I1YA 3SBMA 5HP1B 3SJJA 1IWAA 1ZTTA 3Q8RB 3HSTB 2XGPA 4KTWA 2V34A 4F0KA 1WDTA 3MUMP 3SMSA 5B8HA 3GOIA 2BE9B 4MH8A 1ICEB 4J9VA 3ZT3A 3WU2U 2E8PA 4FS2A 2IGIA 2YI1A 4I6MB 3P5TL 4TQSA 3QGPA 2MUTA 4M7YA 4CNQA 3PW5A 2UUBF 2L41A 4FJGA 4TSXA 5T7LB 3JSRA 4JKEA 3HKWA 3DHXA 3MM5B 1N34K 1M1KO 1YSJA 1NM2A 3CM5A 1T9WA 4UB6U 2MAXA 1VSKA 3HHKA 5KFFA 3ICLA 2Z4PA 2E5JA 1XHZA 5TKYA 3BDPA 1YJRA 5ALKA 2CQ4A 2CVEA 4KHYA 2NLXA 2RUSA 1ZQPA 3SCJE 2HB5A 1U2RA 3LQVA 3TABA 3FVYA 5EOYA 3IG1B 5KNIA 2O5DA 1ZXIA 3ICXA 1FEEA 3HKZC 2UP1A 1S9EA 2JEGA 5RUBA 3KDNA 2H3QA 4ZVPB 4BX9C 2GJIA 4ECVA 3JTNA 2DHHA 3PG9A 1FRJA 3AJ1A 1ZA1B 2QLXA 4CM2A 1KC8O 1HJRA 2LBOA 2BCQA 2OIHA 4E19A 1RDFA 1XSNA 3OTQA 4NA2A 1X0FA 3P96A 3UR3C 2DR8A 3ATUA 2ABYA 4ZVOB 5E3RA 3N5BA 2OWOA 1B0XA 1HBNB 2OTJN 4JWMA 1BXNA 3ZNUA 3DV9A 3G6ES 4NXNJ 1RK8A 1U6ZA 1OW5A 5B5EU 3GSDA 1OQ3A 1XMOK 2JNJA 5GVQA 1DGKN 2IBKA 5J0SA 3UQ2A 2HFUA 3UIQA 1BL3A 1J5OA 4OYOA 2XNQA 2X6SA 4C0BA 4MFAA 3UN3A 4OV6A 1VIXA 2HK3A 1YWXA 6FDRA 3SK3A 1FVQA 4OYMA 3KWIA 2MQ8A 4NCAA 5BPCA 4X4SA 4LFCK 4C3LA 1HARA 2QWOA 2KSOA 5GTHU 3VN5A 5CA7A 1CJVB 2XYPB 4B6JA 2APOA 4FPIA 1Q7LB 3NGYA 2MPUA 3K57A 2CH6A 4J5OA 8ICEA 4ZTJA 2P9EA 1A5VA 1C20A 1WEZA 2GUIA 5AQRA 3AB4B 2EHGA 2WFBA 4YOUA 1MN7A 4A8KA 3PY8A 2XMAA 1YRTA 3B0YA 3K5LA 2WSFC 5J0WA 3RB4A 1MU2B 4CDIA 4OX9J 4DV5J 1R3NA 2C2DA 1FJGK 4K0KK 3D7EO 3ETLA 4FWKA 3W8GA 4ES2A 1WD6A 3O0FA 3GONA 1UVNA 2R2SA 2GWKA 3I8BA 5AM4A 4PG6A 1CBKA 1FW6A 4KFBB 3DXBA 2QB1A 3HVAA 4AH9A 1KQGB 1LKYB 2AWZA 3GZ7A 4KN7A 4QWDA 1KKHA 2B6AB 3V81A 3M30B 1U1MA 4AHTA 3KHHA 2C2EA 3CCES 3DOKB 1YBAA 2KHDA 1Y11A 5FRNA 1FJGF 4KGVB 4DBQA 4JI8K 1FE4A 3RBDA 2VFSA 2W8LA 4OI2A 1SC6A 3ZYYX 4AYBC 3BM7A 1QVGR 9ATCB 2GO7A 3Q0AA 3O9TA 4D3HA 1PBUA 1VQNS 1OH8A 1XMQF 4DR4K 3K0SA 2DIUA 5HR6A 3ET6B 1T4GA 5KFBA 3NH2A 2FHOB 2F1IA 3D6MB 2I1QA 4QAGA 3A5NC 1XR6A 2B56A 3SQ2A 4M42A 5C25A 1ZD3A