2HHVA

T:o6-methyl-guanine in the polymerase-2 basepair position
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*TP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhvA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhvA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhvA01
4RU9A 2KQ2A 4H8KA 4F3OA 4N76A 3ZSWA 2FPLA 3Q8MA 2BCRA 8ICCA 3C5FA 1EXNA 8ICKA 8ICOA 4FCYA 1D8LA 4GC6A 1RYRA 5DMRA 2OWOA 3DMJA 3Q8RB 2P5GA 4P4PA 2LSNA 1C1CA 3THVA 1GOCA 4W5TA 1XU4A 5CHGA 3K5LA 4TSXA 4PGYA 1QS4A 3NF9A 7ICRA 4B9MA 2A1RA 5F9LA 2HVHA 3U3GA 4K8ZA 4YXJA 1C1BA 2FLPA 2BHNA 4Z6CA 4QCLA 1ZQZA 1R0AA 4AHCA 4OLAA 2OPQA 1FXXA 1D9DA 1CZBA 3TAPA 2W9CA 1C0UA 1X9SA 2BCUA 3PNCA 3QESA 4X5VA 4DTPA 4AILC 4TQSA 3OSPA 4HVJA 4I9QA 4F5NA 4KTQA 4I2FA 1NJXA 4M9HA 5BPCA 8ICEA 1DTQA 5HMLA 1XSLA 4EBCA 4O4GA 4LZDA 3HP6A 4NCAA 3H8JA 4O9MA 2JEIA 1RT7A 3AVKA 9ICFA 1LB2B 8ICJA 3H4BA 2DPIA 1K1QA 3PMNA 2VA2A 1SL1A 1IKYA 1TGOA 3GQCA 4RPXA 4JV0A 3WNHA 2Z1IA 4RUCA 1S1VA 4NXZA 5HRNA 5KFTA 3K5MA 3V9WA 2FLLA 5IIOA 1KVBA 3DLGA 3Q8LA 1SL2A 4W5QA 4YG2A 1JXEA 1U47A 1VSMA 1YTUA 2DFFA 3CQ8A 3PW4A 2JLEA 3LP1A 1VSHA 1K1SA 1ZBIA 4BDYA 1ZQOA 4O55A 3V4IA 5KFXA 4UB1A 3AA3A 1T8EA 1BPBA 1RDDA 3RJJA 4W5OA 4MFCA 4UQGA 2HVIA 4E0DA 2FMQA 4HCBA 1S9EA 5J2GA 3ORYA 1LWEA 3HT3A 2DPJA 2NRWA 5IIIA 3AVIA 3OYDA 3V1QA 2QXFA 3EW9A 8ICHA 1HQEA 2ETJA 9ICLA 1X9MA 1ZQDA 1N6QA 4IQVA 3AVFA 4AHTA 4KLDA 5DB8A 3M9MB 4H4OA 3MR3A 3MDAA 3IG1A 5KT5A 1S77D 1MQ3A 3H40A 5J2AA 5C25A 1N5YA 4CJQA 2YNIA 3I0RA 4DSFA 3HWTA 4BWMA 2D0BA 4QZGA 3GDXA 4I2PA 1WAJA 4MFFA 4UB4A 4LY7A 2PY5A 4LD0A 4FJNA 3OHBA 4CECA 4KREA 4UB3A 1RTDA 4KLSA 2UVWA 4CHYA 2BDPA 1ZQCA 5J2EA 1RT2A 1EKEA 1TV6A 3DM2A 5KFRA 1RXVA 3MEDA 4C8KA 9ICXA 4NCBA 3JPTA 4Y1CA 5CWRA 3MFHA 4RQ4A 3MGHA 4KKOA 3ZSRA 4FJIA 4C8MA 9ICUA 1D5AA 5J0OA 2IA6A 1BIUA 4EP5A 3C94A 5J2CA 4FVMA 4GXJA 4JWNA 4QZFA 3UPQA 5KFGA 3L2UA 2ZUCA 4ECQA 4FJJA 3NF7A 5KT4A 3KLEA 1YVUA 3U6FA 3VQAA 3EY1A 4FS2A 5KFAA 4KLUA 5E41A 4YN4A 4H4MA 2IMWP 4NM2A 1CZ9A 2V9WA 1T7PA 2Y1JA 4BE2A 1H38A 4LH5A 1FKOA 1HYZA 4DS4A 3C1ZA 3MEEA 4O5BA 4RQ8A 5HRRA 4R5PA 5J2JA 4DOBA 4ECWA 2XCPA 2AGQA 4HUEA 3OYKA 3MXIA 5KFNA 3MBYA 4B8CA 4KLJA 2RF2A 3AUOA 4DFJA 3C2KA 4DTMA 4EYIB 2IAJA 4IBNA 1UAXA 4EZ6A 3L2QA 2OPSA 3KIOA 1Q9XA 4KRFA 1JLAA 4ZH4A 5KRTA 4CJLA 1QSSA 3TFRA 5KFBA 4F4XA 4K8XA 3VQ5A 2I1QA 4MQ3A 3SQ0A 2ISOA 4CFDA 4DTJA 2WOMA 2ZJAA 1ASUA 1ZQYA 1KLMA 4DQQA 1TVRA 1RDAA 3C21A 3H4DA 4I28A 3TAGA 4CIFA 3DRSA 1FKPA 4IRCA 3OYEA 3MEGA 2BPFA 2J6TA 1EXQA 3S3MA 4DF4A 1VSKA 3SPZA 3KD1E 5CY4A 1X9WA 1RILA 2YHBA 2HNYA 5J0QA 4FK0A 3V7JA 2BPGA 4QZAA 9ICKA 3OY9A 2VA3A 3S9HA 3K58A 3PR4A 3QETA 3OJSA 5HRPA 4QWAA 3AU2A 4G3IA 4E89A 1VRUA 3H8WA 3G6XA 4F5QA 3BQTA 3TAEA 2XO7A 1DGSA 4QWEA 4CHPA 1LWCA 1KFTA 4CJSA 4QZEA 3OYNA 4K4HA 4RQ2A 4CGGA 2A1JB 1BPEA 4DOCA 5J0UA 5J0TA 1CXQA 2BGGA 4Q0BA 3OYCA 3QEWA 5IILA 4FW1A 4CGFA 4RQ0A 1JL2A 1Z3EB 4IDKA 1SKRA 5DG9A 1BHLA 1SKWA 2XC9A 3MAQA 1B22A 4M6WB 1S97A 2VWKA 4TURA 4YVZA 2HMIA 5CP2A 4DTOA 3SNNA 1DOQA 3AVNA 1ZQBA 4ED3A 5KFDA 2AQ4A 1S1UA 4DQRA 3BQ1A 4QW9A 1WSFA 3NGZA 2EX3A 4Q45A 5J2HA 4PH5A 2EHGA 4KLIA 1QSLA 4NYFA 1JIHA 4KHNA 4FM1A 5KFYA 1I39A 5KGWA 4CIEA 2OZMA 3T5LA 2D0AA 4FJLA 4FBUA 5KFIA 2X78A 2V4RA 4BXOB 5KFVA 4RW8A 3PW5A 4IFVA 4KLGA 2IHMA 4DSLA 4BDPA 5KGXA 5KRSA 4I29A 8ICFA 4XIUA 3K2PA 3HPOA 4DS5A 3IAYA 3SYZA 2QK9A 4KTWA 4R64A 4XA5A 3KK3A 1BPDA 4KLHA 1HNIA 1CLQA 1C0TA 2NRVA 5J2IA 3UXOA 2Y1IA 4ID5A 1D9FA 1G15A 4KFBA 2DFEA 1HJPA 3HX0A 4O3SA 4CEAA 3HVRA 1B92A 2R8KA 3OYAA 1S1WA 2V4QA 2GUIA 5KFKA 3AO3A 2WTFA 3V1OA 5HHIA 3OYHA 4CJ3A 4E7LA 3QIOA 2C2DA 3OS0A 3V1RA 2ASDA 5KFZA 2W42A 1J9AA 2O4GA 2A1JA 3OHAA 4F5OA 4R63A 2FBTA 1ZQJA 4IG0A 3SQ2A 5C24A 3HPGA 2W9AA 1SZPA 3QO9A 2HNDA 2FMPA 4EYHB 1ZJNA 4Z4FA 4UAYA 3QLHA 4CCHA 3RJKA 3OYIA 5F9NA 4ICLA 5J2QA 3U3YA 3TI0A 3Q8PB 4HUFA 4DL5A 1TFRA 4M47A 4ECUA 3KHGA 4M6WA 5C5JA 1ZQRA 8ICGA 3AVHA 1WN7A 4KI4A 3BGRA 4Q8FA 2XHBA 5DB7A 4QWBA 3ETLA 1WSIA 2RDIA 1K6YA 2PFOA 4W5NA 5EOZA 3GV8B 4JS4A 1F21A 1COOA 8ICNA 3L2RA 3GIKA 2W8LA 2NRZA 3QEBZ 5KG0A 4KB0A 1VSIA 4BXOA 4Y1DA 3NCIA 4O3QA 2ZD1A 1TV9A 2RPIA 3O3GA 3VQPA 4M3RA 4KO0A 4DEZA 2M9NA 3K5OA 3V6KA 4NLNA 1NK8A 3LAMA 4I2CA 3OJUA 2NUBA 7ICMA 2VANA 1IO2A 5CB1A 3TFSA 4TUPA 3SCXA 4ELTA 3RMBA 4PHAA 4O44A 2PXIA 2RKIA 4RQ5A 1GOAA 2HHXA 4I2IA 3V9UA 5J2FA 4JWMA 1J53A 2B5JA 3MECA 5BOLA 3VQ9A 4HCCA 5J0WA 1UT5A 3AVGA 1T4GA 4FJXA 3LWLA 3PR5B 3C95A 2P66A 1TKDA 5J0PA 4DL2A 4CGDA 3PX0A 4J9OA 5J2DA 1JLFA 2H5XA 1BL3A 2X74A 1N56A 8ICAA 3LDSA 1ZETA 4CF2A 2FBYA 4XUSA 4YMMA 5J2MA 2HHQA 3V9XA 3PX6A 4ID1A 1YT3A 3HW8A 1ZBLA 4DU4A 1XO1A 4O3OA 3FDSA 2YV0X 4CEEA 4CJVA 4HYKA 2BQRA 1L3TA 3IS9A 4AHUA 2F8TA 5KT3A 1HUZA 4I27A 1UOCA 2BQUA 1UA0A 4QW8A 3ZDCA 3VQDA 4DL3A 3V9SA 8ICXA 1ZQIA 4DTRA 4CK1A 2JZBA 3NF6A 3G6VA 1QQCA 1BPXA 4P4OA 1KDHA 4DTXA 4OJRA 1X1PA 9ICWA 3M9NB 1MQ2A 4N41A 3QZ8A 4CJFA 4FS1A 2C22A 1TAUA 2BCQA 4I9LA 4OKJA 4ED6A 3B6PA 1U4BA 4ECRA 3NF8A 5HP1A 3ISCA 1RXWA 1LW2A 5J1EA 1NKEA 2BANA 3CM5A 1UA1A 2PFNA 2OPPA 2KZZA 3TAFA 1LAVA 4DSIA 4QWCA 5JS1A 5KG2A 3SI8A 2BCVA 8ICZA 2YNFA 4FK2A 4KLTA 2X6NA 2KZMA 4ECYA 4O3PA 1KVCA 2HHTA 5KFHA 2P5OA 3LAKA 3KHLA 3BJYA 3VQ7A 1VK0A 3EPIA 3RJIA 1RCHA 4CEDA 1I3AA 3LDAA 1S0OA 5DDYA 4Z6EA 3B0YA 1RYSA 8ICUA 3OYLA 2F1HA 2ASLA 3UXPA 3LP3A 4YR3A 4QZCA 2XCAA 1WAFA 3HM9A 2ISPA 1U04A 5DQHA 4LSNA 5FROA 2I9GA 1ZBFA 1TVAA 3HSTB 3HJFA 4IRKA 4FLVA 1CEZA 4N56A 3RBEA 4DF8A 4DU3A 1LAWA 4LVSA 2ASJA 2FBVA 4F2SA 3RMAA 3IM1A 4MEXA 3V81A 1JLGA 3E01A 3WNEA 4KHQA 5HNKA 4KLFA 4DFKA 4Q5VA 3ZDBA 3SI6A 1L3SA 3AVLA 5DLGA 3VQQA 4KHUA 1JX4A 3V7LA 1HRHA 1QE1A 3RJEA 1KLNA 3N4MB 1JLQA 4IFYA 2Z1GA 7ICIA 2OPRA 7ICSA 2D5RA 3FFIA 1GOBA 8ICTA 4UAZA 4NY8A 1NK4A 1S10A 1NOYA 3M9OB 1T05A 4C8LA 1WLJA 8ICVA 2XY6A 4CE9A 2IC3A 3KHRA 3MGIA 2PFPA 3PUFA 3VA0A 2G8HA 4CEFA 1RBUA 2J6SA 4CJKA 4QZ9A 4HHTA 4I2QA 4O0IA 4F4WA 5KG4A 5DB6A 4RNMA 4TUQA 3JPOA 3M8RA 4OGCA 2ZUBA 3UQ2A 3RMDA 3KK2A 4P4MA 4DO9A 3SUOA 3MXMA 3HVTA 3OYFA 1RTJA 5J0YA 4R66A 3BQ2A 5KFLA 9ICPA 4ED7A 2LYHA 1U49A 3QEPA 5HMMA 3L3VA 1NK5A 3ZD8A 5CR0A 3QEAZ 2YNHA 2ATQA 5KTQA 2JGUA 1RT3A 3OYMA 3ZT0A 2F1JA 3BQ0A 3P5JA 1VSJA 4IRDA 4Q44A 3P1GA 3OYGA 3GFKB 2GBZA 1DTTA 4FJMA 1U9LA 1NK9A 4O5EA 3RB4A 4CJWA 3D45A 2O4IA 3TABA 2ZTCA 1TK5A 3V7KA 3EZ5A 4PWDA 1BPYA 2IBKA 7ICQA 4YR0A 3QINA 3DLKA 4CFCA 4CJEA 4ED1A 4M9GA 4FYDA 4GXKA 1REVA 1SKSA 1O1WA 5KFWA 4O0JA 5DBCA 3KHHA 5EWEA 4TUSA 4YCXA 3LK9A 1KFSA 5CA7A 3QIPA 1V9PA 2R8HA 3NGYA 3KKSA 5KT2A 1JN3A 2DFHA 1SV5A 2G8WA 3GIJA 1RZTA 4Q8EA 4ECSA 5KG1A 1XHXA 2P1JA 4KV8A 3HXMA 3Q8QB 3RJHA 5C42A 3E2EA 7ICLA 8ICBA 4E19A 3T3FA 2JEFA 4IG3A 1ZQTA 4XRHA 3H8SA 4OKKA 1WSEA 3JPNA 4JK1A 4J2BA 1VSLA 5D4BA 4TQRA 3HYFA 2PI5A 1ZQVA 4BGDA 4J9SA 3S3OA 2Z1JA 2KFNA 2UVUA 5L1LA 5L1IA 3PW2A 1ZQWA 5KFCA 1RNHA 4FK4A 4J9LA 1ITGA 4KLEA 1JKHA 9ICTA 3TANA 4BE0A 3ITHA 3VA3A 3NTUA 1YTAA 2ATLA 7ICOA 7ICHA 3DRRA 3LWMA 2C2RA 3B6OA 4N47A 4CK2A 1XSPA 2Q0ZX 1ZQEA 4FM2A 4FBTA 3VN5A 7ICEA 3ZSVA 3O4NA 2VG6A 4GW6A 1Y97A 4DSEA 4Q43A 3CFOA 3JPPA 1RBTA 2ZUDA 1U48A 4M3WA 3HK2A 9ICGA 4O3NA 1UT8A 8ICYA 2E4LA 1RBRA 2VWJA 4F4KA 5FRMA 4B9TA 4F8RA 5EU7A 4IR9A 1TK8A 4NYNA 4FJKA 1S6PA 1S5JA 3KLFA 5L1KA 3AO2A 5D3GA 7ICNA 1RT1A 2XRIA 4NLGA 1KEJA 4FJGA 3ZDAA 2FPMA 4F5RA 1BGXT 7ICFA 4JS5A 3QE9Y 3Q8KA 3MR6A 3RH6A 4J2AA 2BPCA 3LZJA 3T5KA 4J9NA 2HHWA 1VSDA 1QLNA 5J2BA 4BACA 4F3TA 3F9KA 2ZTEA 3HO1A 2W9BB 5IIKA 4Z4GA 4OKEA 1RDBA 5HROA 3CFPA 4LH4A 3CM6A 4QZIA 1KVAA 2QKBA 4JUZA 7ICUA 3PX4A 4Z4CA 4PPXA 3VQBA 2FBXA 5CZ2A 3ZSQA 4QOZB 1AROP 1ZJMA 3GIMA 3G6YA 4RQ6A 4FW2A 4CEZA 3ZSOA 2XGQA 3NDKA 5J29A 3DOLA 3KKRA 3VQCA 4KB1A 3QEVA 1ZYQA 2PFQA 3NGIA 4ELUA 4IQTA 3RB6A 1QHTA 1ZQNA 2HHUA 2E6LA 3MABA 4DSKA 2BKEA 3HP9A 2IS3A 3JPQA 5J0XA 4RT3A 4YD2A 3NE6A 9ICCA 5DB9A 4DFMA 3OYBA 4NM1A 1RT5A 4FLTA 5DG7A 1BI4A 4E1NA 2C28A 5FDLA 3OYJA 3DI6A 4JV1A 3KJVA 2BCSA 5HP4A 1UWBA 9ICEA 3T5JA 1BIZA 2JZBB 1NK0A 3ISBA 4L8RB 4BWJA 2YKMA 3WNFA 3AA4A 1RBSA 1JXLA 1IM4A 1Q8IA 9ICNA 3G0ZA 4RG8A 3PO4A 3EYZA 4QAGA 1WNSA 2R8JA 2JEJA 1B9DA 4DTSA 4FJ9A 2UVRA 9ICAA 4UBBA 3RAXA 4E1MA 3ASMA 4MFBA 2I5JA 4K4GA 4MEYA 4R8UA 1S76D 2RDJA 2G8UA 7ICGA 4O3RA 3KLIA 2OZSA 1ASVA 4B9UA 2P6UA 4CJRA 3L2VA 3AO1A 2R7YA 3C6UA 5DG8A 4FJ8A 4RW4A 4I2EA 7ICJA 2UVVA 5L9XA 4FO6A 1TKXA 5J0SA 2BGWA 2YNGA 2W9BA 4M9LA 4J9MA 4CHOA 2BE2A 3ZD9A 5KG7A 4QZDA 8ICLA 5D46A 1ZQHA 1C1AA 1DLOA 4ECTA 5J2PA 4DG1A 3QEXA 3H7IA 4PUOA 3RJFA 4YQWA 2G8VA 3NH0A 3KLGA 3V9ZA 1BCOA 2G8KA 4EBEA 4C8OA 3LPTA 5DLFA 1CUKA 3DLRA 4RNOA 4BDZA 5T7BA 1BVSA 2R8GA 3RR7A 4M42A 4AH9A 2R8IA 3AVCA 2ZQBA 3TR8A 3NH2A 5J0RA 4O5KA 2G8FA 2F96A 1W9HA 1A77A 4GVMA 4JLHA 4KTZA 1S9GA 4I2DA 3PW7A 1CXUA 1S0MA 5KT6A 1L3UA 4M9JA 4JRPA 3SPYA 1IKXA 1NOMA 4GC7A 3JSMA 2VG5A 4RW9A 1Z26A 3TWHA 5HBMA 2AU0A 2YHAA 2QKKA 4RQ3A 5KFQA 5KG6A 3RAQA 4M3ZA 2P51A 3IHQB 1EP4A 9ICMA 1IXRA 4IKFA 1VRTA 1Y88A 4YMNA 2P6RA 2A1SA 4CERA 3RMCA 1QTMA 1L3VA 3HPHA 1TKZA 9ICQA 1BISA 3P83D 3PO5A 3WNGA 4W5RA 4QZBA 2KTQA 1ZQAA 2KZ3A 4F50A 4FZZA 2RN2A 3ZSYA 4O5CA 4CF9A 3KLHA 3GV5B 4PHEA 4CHNA 5IIJA 2NRXA 2IDOA 5CZ1A 1NK6A 4ED0A 2Z1HA 4KMUA 3ZSZA 4JV2A 1J54A 3T5HA 1ZBUA 2XGPA 4EBDA 1TAQA 2DY4A 3L3UA 3RJGA 4KITB 3NH1A 4J9PA 3GV7B 1XSNA 1HYSA 3FYHA 4RZRA 4C8NA 4QZ8A 3C6TA 2MUTB 3RB0A 2IOCA 3C23A 4HUGA 4DL6A 1KFDA 4J9QA 5FRNA 3ZSXA 4KI6A 8ICWA 2Q3SA 3EPGA 1JLEA 3Q8SB 5KFEA 4KAZA 4RT2A 4F5PA 3RR8A 1HNVA 3C5GA 3ZT1A 1T03A 3VQ6A 2XY8A 2GWSA 7ICVA 3T1AA 2ZJ5A 2HB5A 3RWUA 3TAQA 3RTVA 4FLXA 4CEQA 5JS2A 4PGQA 3V6JA 3O3HA 4IQUA 5DQIA 4GXIA 2PI4A 3T19A 4CGHA 4DSJA 3QZ7A 1WCLA 4DQIA 9ICIA 3L8BA 4B9VA 3VQ8A 1X2IA 4M0AA 3ALYA 3DOKA 2BR0A 5KFMA 3RH5A 1C6VA 4YP3A 1EETA 5KG5A 2ZE2A 1C7YA 5IINA 4AHSA 4B9NA 3RRHA 1S9FA 1XHZA 3CFRA 1XC9A 2HW3A 4UB2A 3PMLA 4RPYA 2HHVA 3KD5E 4F92B 4DWIA 4ED2A 5EWFA 4AHRA 3SV4A 4M2YA 4KLQA 3AVJA 2FC0A 2FLNA 3M8SA 5DDMA 5J2KA 8ICIA 1MSWD 3LP0A 2VG7A 3ZDDA 4CHZA 3QNOA 3SUQA 3RRGA 3K4GA 8ICRA 8ICQA 1RT4A 1SUQA 2X6SA 1IG9A 4KHYA 4KLMA 1RTHA 2PZSA 5DBAA 3SQ4A 1NKBA 1IKVA 4UB5A 3UQ0A 4KN4A 4CIGA 2J6UA 3RB3A 2XY5A 4DMNA 4ZTFA 4CJ5A 4RPZA 3OS1A 4OGEA 4FLWA 4E7IA 2VA8A 4CGJA 2KFZA 1KCFA 1PZNA 1T3NA 3MDCA 3C2LA 4YD1A 4CF8A 4YFUA 9ICOA 3ZT4A 2B21A 4E7KA 1XWLA 1BQNA 2FMSA 4IQWA 4KN7A 1NOZA 8ICMA 8ICPA 2JEGA 4PGXA 3MFIA 4B8AB 1C0MA 5SWMA 4EEYA 4KHSA 5SZTA 3MR2A 4WE1A 2XY7A 3DLHA 4OPJA 2MUTA 3I0SA 2ZTDA 4GLXA 1S0VA 2AGOA 3UXNA 4FJHA 4FZXC 3JPRA 3AVAA 3S3NA 3UIQA 1TL3A 1MU2A 1BCMA 4EP4A 1KRPA 1JMSA 4DLEA 4F91B 1ASWA 2W9MA 4CJTA 2PYLA 5KFPA 4GMJB 4NCGA 3D0PA 4FLYA 3H08A 3PVXA 4ZHRA 1JL1A 4MF8A 4B08A 4PHDA 2DTUA 1NJWA 5DK5A 4FM0A 3MR5A 2OA8A 4CJPA 2ITGA 1Z00B 3LZIA 2IGIA 1TK0A 1XS9D 1JLBA 4PA1A 4B9SA 1Z25A 5KFFA 4Z6DA 4RUAA 4AHVA 4I2AA 3AO5A 5KT7A 3B0XA 2AQ0A 4G1QA 4RQ7A 4B9LA 4M04A 1WSHA 4CESA 4DTUA 3K57A 5EWGA 2ALZA 5BOMA 5DBBA 4DL4A 3SV3A 2GV9A 4NLZA 4XQ8A 5KFSA 2AGPA 4QZHA 3ZDEA 1J5OA 3EWAA 4ZTJA 9ICVA 3AU6A 2HHSA 1WSJA 4F4ZA 4FXDA 4DLGA 4E7HA 4M3XA 4YR2A 2D0CA 5CJ7A 3IRXA 1B9FA 4J2EA 5TZVA 3DLBA 1HMVA 4Z4IA 3GIIA 3VQ4A 5DKWA 4ED8A 1IH7A 4M45A 2F8SA 3KTQA 3QNNA 5JUMA 1KSPA 3NHGA 4KHWA 3N97B 7ICPA 1JXBA 4DQSA 1A5VA 3AVBA 1ZQUA 3PW0A 4CFAA 4MFAA 4K4IA 2E6MA 3SUNA 4FLZA 4Z4HA 4ECZA 8ICSA 3M8PA 1U45A 3SJJA 4CF1A 3C1YA 4M3YA 1BI4B 3JYTA 2KW4A 1FK9A 2B4JA 3QERA 1S6QA 4DFPA 5CYMA 3BDPA 1BQMA 1TL1A 2YKNA 3RBDA 5KFOA 3F73A 4DU1A 1D8YA 3SZ2A 4ELVA 3OGUA 3HL8A 1EX4A 4RW7A 1LW0A 2BQ3A 2C2EA 1ZQQA 3ISNC 4CGIA 1NJYA 4IR1A 3AV9A 9ICBA 3OSNA 1S0NA 4J2DA 4YXMA 1A76A 4YMOA 2KN7A 7ICKA 1B43A 5HHHA 4RNNA 4DL7A 1S1TA 1Z00A 2WONA 2W8KA 1ZQMA 3ULDA 4JRQA 4CF0A 3RH4A 1S1XA 3V6HA 3AO4A 1TKTA 4I2GA 4CEOA 4UBCA 4ECVA 2FPKA 3V6DA 4I2JA 5CYQA 1XI1A 3O4QA 4KLLA 3KK1A 4B3OA 4R8UB 1ZQPA 4F2RA 4I2HA 3ZCMA 5DQGA 1Q9YA 1LWFA 4CEBA 3OS2A 9ICSA 1MC8A 4CJUA 3GILA 3CG7A 1NK7A 1HUOA 1JLCA 1ZQKA 2PYJA 1SL0A 9ICHA 4EZ9A 4OPKA 5KI6A 4FZYA 4NLKA 1NJZA 3PY8A 3V72A 2B6AA 4FJ7A 4YFKA 3C2MA 1RDCA 4OVLA 1HQUA 3ZT3A 1BPZA 3LANA 4P2HA 1WSGA 3TQ1A 3DRPA 3TAMA 3ZT2A 3AVMA 2MAXA 4OLBA 4PHPA 1QSYA 3NFAA 4ECXA 4DQPA 1N48A 2NRTA 4KLOA 2IHNA 3LALA 4FJ5A 1WCNA 4M41A 7ICTA 1RBVA 4J9RA 3VQEA 1W0HA 1VSEA 2DFLA 4M3TA 3A2FA 2G8IA 3NAEA 3TARA 3G10A 1HPZA 9ICJA 3AA2A 4I2BA 1RPLA 4N5SA 4BE1A 1VSFA 1LV5A 5I3UA 4E7JA 5K14A 4Z0UA 5DGAA 4RQ1A 4MF2A 2W9CB 4CFBA 4F93B 3MXJA 5KG3A 3K5NA 4CJ4A 5DGBA 1A5XA 5D49A 4HTUA 3O3FA 1HYVA 4PY5A 1HJRA 3SQ1A 3L2WA 3PV8A 3SUPA 5IIMA 9ICRA 2ZJ8A 3K75D 2F1IA 1ZQFA 4UAWA 3M8QA 3NGDA 3JPSA 1RT6A 4M3UA 5KFUA 1IKWA 3LP2A 5I42A 4M9NA 4CHQA 3ISDA 2AJQA 3CYMA 1ZQXA 1ZQSA 4I7FA 4QWDA 3DLEA 2HNZA 4FLUA 4LZGA 4Z4EA 4Z6FA 3DYAA 1ZQGA 4DTNA 4F4YA 4RW6A 2OYQA 5L1JA 4YNQA 4DOAA 4CK3A 1ZBHA 5KFJA 3NBPA 4R65A 4LSLA 5HRSA 1RTIA 3I8DA 1ZQLA 5HLFA 3QEIA 4J9KA 3LPUA 3AA5X 4E3SA 3OVNA 4PQUA 1L5UA 4KPYA 1KTQA 3K59A 5J2NA 1NKCA 1A5WA
chains in the Genus database with same CATH superfamily
4RU9A 1FRXA 4ZVRB 2KV2A 3A3NB 4H8KA 2ZH8A 4JI3K 4N76A 5HK4A 4YMEA 8ICCA 2E1AA 5LJ3Y 8ICKA 4N8OA 2DGVA 8ICOA 4ETXA 2E8OA 2LXIA 5KPZA 3WDOA 2CFXA 3AFGA 4QIGA 2OWOA 4P4PA 5AK6A 1RDFA 2Y8WA 1SV0A 1DXSA 2VBXA 2AJ1A 3R8YA 5CHGA 3K5LA 3NF9A 1D1UA 3CE8A 4QYRA 3MPYA 4MO5A 4W92B 3LP0B 2FTRA 2IVPA 5LL6Z 1S6UA 1ZQZA 4AHCA 5J1PA 2PEHA 2WSEC 2C2KB 4C7YA 5A0YB 3OR2A 1RTHB 4AQYJ 1LNQA 2EKYA 2MQQA 1RXOB 2BCUA 4KHMA 1U24A 5GMEA 1YHQS 2OI2A 3MTJA 2J9CA 3M2VA 1RKJA 3NCRA 1CLFA 4B3TJ 2MQOA 1S7IA 2KB2A 5J8YA 2KT2A 4LF9J 3LVVA 4ZLPA 4HVJA 3U7JA 4F5NA 3A8IA 3C6AA 4P9SA 1V3SA 4CRXA 1NJXA 5HI7A 5BPCA 3SEOA 4E1JA 1DTQA 1XSLA 4DCCA 5ALXA 3RBZA 2XBPA 4X4NA 1HNWK 2BDUA 2JEIA 1RT7A 4C23A 9ICFA 1LB2B 2P9LB 4V1Ak 3T1YF 2KEYA 5AKGA 4PKIA 2DPIA 3PMNA 2VA2A 1TGOA 3GQCA 4JV0A 3WNHA 3JTNA 1S1VA 1TL3B 1N36J 5AK3A 2JV3A 3V9WA 1CBKA 4CP5A 5LSOA 1FO4A 1KVBA 3DLGA 1VISA 1SL2A 1HPMA 4W5QA 5L46A 1JXEA 2GHPA 1U47A 1VSMA 3W5ZA 3I28A 2DO4A 2HRUA 3C65A 4PL1A 2CJXB 2QW9A 3LP1A 4OJPA 3TWZA 1VSHA 3QATA 2ZNYA 1ZQOA 3OLBA 1NGIA 1JLBB 2FSJA 3DLLQ 1WWUA 3V4IA 3R2CJ 5KFXA 1CULB 4JP8A 2P9SA 3AA3A 1BPBA 3A5NC 2HBQB 4W5OA 3P5TL 4MFCA 2Z8QA 5GIOA 4G1QB 2FMQA 4HCBA 2QV6A 5AQMA 2APOA 1FXRA 2IAJB 3OYDA 1HQEA 2ETJA 3X3UA 4IQVA 1LK5A 3GONA 3SFGA 3P31A 3IDHA 2CPFA 3M9MB 2E9TA 3A8EA 1CC8A 3MDAA 2PMZD 5AKIA 5A0YA 4OJ3A 4PEOA 1MQ3A 2K3KA 5J2AA 4HHJA 4USKA 1KLMB 3EKSA 5AQYA 4DR1F 1X5PA 4I2PA 5ALZA 5EHHA 2BA9A 3BGOP 3C16A 3OL8A 4MFFA 3IFRA 4UB4A 1T9WA 2E8AA 3NVMA 1X4EA 2PY5A 4FJNA 5ALWA 4EAHD 4UB3A 2HQ3A 4WTYA 2UVWA 1NLKL 3VOVA 2QL9B 1ZQCA 2QX0A 3R5GA 2HYIB 5KFRA 3D0GE 3TADC 3WC2A 2JDJA 2KH9A 2GIRA 2UXCK 9ICXA 3M8PB 4NCBA 2ZOFA 2P9LA 3MFHA 4RQ4A 3MGHA 4FJIA 9ICUA 4H0XB 2C3UA 2ITMA 3SAHA 1BIUA 2EK1A 4IL6U 3R5AA 2E1MC 4OI1A 3MM9B 1VQSA 2AD9A 1EWRA 1SH0A 2R7WA 3CJ5A 2ZUCA 2ODGA 2B7CB 2F76X 4RW7B 1LW0B 5IT9U 4C8YA 3U6FA 1HHTP 2Y0SC 3RVCA 3KG0A 2I7PA 5KFAA 3BBFA 3W66A 3MTKA 4H4MA 4J91A 1OY8A 2Q1NA 2V9WA 1NBEB 5HATA 1VQ9N 4IDKB 1SXDA 2Y1JA 1VIXA 2DITA 1WUAA 1H38A 3R9KA 3UMCA 4DS4A 3EX7B 3OUYB 3O4WA 1CULA 4R5PA 3NS7B 3EZWA 5J2JA 3H42A 5F1XA 3MXIA 4AQYF 4KLJA 5JICA 4HT7A 3AUOA 4DFJA 4RO0A 3IG5A 4LFAJ 1LWFB 4EK2A 4KMOB 3FSXA 2IAJA 2DNHA 2IBOA 3DOMB 3K9JA 2HF4A 5IZHA 3KIOA 4KRFA 4B3SF 3ZZTA 4TU9A 3EMTA 2KG1A 3UDCA 3O08A 5KRTA 1QSSA 4PG7A 5M1FA 4LF9F 4K8XA 3VQ5A 2I1QA 1XMBA 4A2BA 2B6AB 2BJEA 4RW8B 3PCOB 4P7TA 1YGYA 1KLMA 2IIHA 2OANA 4LF4K 2YPYA 1VBXA 3NRBA 2KVSA 4Z7CA 3TAGA 1FKPA 4IRCA 5LXRA 1JJHA 1OVYA 1H73A 5E0OA 3OFFA 2J6TA 3OFGA 2PMWA 1W25A 2RMLA 1C0TB 2V8HA 5A8RB 2WW4A 5CY4A 2R18A 1HNZF 4UW2A 4IO9L 4LFBJ 2QIFA 2YHBA 1Y5IB 1NPKA 1ZPWX 2HNYA 5F0UA 2V67A 2WVBA 4FK0A 3E66A 4KFBB 4UOFA 1SC3B 2XI3A 4QZAA 1ZBTA 3P96A 1NH7A 3MMJA 3K7RA 1NPRA 2BKPA 3OJSA 4QWAA 4HACA 3UI3A 1N63A 4BC9A 1HPZB 3G6XA 4NXMJ 3HFVA 3IDWA 2ESEA 3TAEA 2Y9TA 4QWEA 1KVIA 2RQ5A 1KFTA 4CYUB 4RWTA 1IJJA 4JMUA 4RQ2A 2DRDA 2QO3A 5C12A 3QDKA 1AFIA 2F4VJ 4A2AA 5AJ3F 5J0TA 2WF9A 2CUYA 1B0XA 2CH5A 2AV5A 3R5CA 4KSEB 3OYCA 5IILA 1GLJO 4FW1A 4CGFA 4RQ0A 4P73A 1G4CA 4M5DB 4ICLB 3J7YU 4KHRA 2E9RX 1Z3EB 4IDKA 3M2UB 5EY4A 1SKWA 3EXYA 3OUYA 2XC9A 4M6WB 1HJOA 5M1PA 1UWAA 4OHWA 5CP2A 3SNNA 1C4CA 1HIYA 3BGRB 3AVNA 5CCMA 3KJNB 3BQ1A 4QW9A 1WSFA 1WOPA 3NGZA 2VF3A 3E9OA 1U1LA 2X1GA 1ELOA 4UUXA 4NYFA 2BKNA 4CIEA 2OZMA 2HKEA 1FFWB 4FJLA 2UXBF 4KQZA 4RW8A 5KFVA 4NLUA 4B3MK 2P9GA 4ZCKA 3VAIA 2CYYA 2PA3A 2RT3A 3MPVA 2IHMA 5KGXA 4I29A 1U1KA 1TUUA 3MN7A 2CQBA 2I7NA 2VJ5A 1C0GA 3SYZA 2PMZF 2NS1B 4PL7A 3OTOK 3KK3A 5BR8K 3LPEA 1HNIA 3ONQA 3DMJB 1C0TA 2AX1A 2GVDA 1MNEA 2NRVA 5J2IA 2DH8A 3M4XA 4O44B 2Y1IA 1FRKA 4HWIA 2Z58B 1PYSB 2NSCA 2HFSA 2UUTA 5KOWA 3K0JA 1B3TA 1G15A 4KFBA 4ZVGA 4PG4A 2A5XA 1HJPA 2B5JB 3MECB 1B92A 1QCKA 4LUBA 4BC3A 3S6EA 2KHOA 3G82B 3WEEB 1VC6A 5HHIA 4OJLA 3QQCD 2PFFB 2E8MA 2CGKA 3N4PA 1U8WA 1MMDA 3OHAA 2NLXA 3SQ2A 3QNWB 4JV5J 3M2RB 2W9AA 1SZPA 4YHHJ 1YIJN 1RP5A 2FMPA 1K73O 5E3RA 4UAYA 3G87A 3QLHA 3DXMA 3KNGA 1OSCA 3OYIA 4TU7A 4FL9A 4ICLA 4LF5K 5J2QA 3M8YA 3TI0A 2LFVA 4UAVA 4HUFA 1O8BA 4DL5A 1TFRA 4M47A 2XMVA 1Z19A 2V8DA 4M6WA 1D09B 2HBYB 3US5A 2ZOMA 4WFBL 4KI4A 2VWBA 4X62F 2LU2A 1JK9B 3IRWP 2EFGA 3BGRA 4JB3A 2BZ2A 1QAYA 4ZVQB 2MLYA 2FIUA 3W1YC 2Y1LB 1X5OA 4RJVA 2NZ4A 3CJSA 2RDIA 3G9CA 2PFOA 2D7SA 5HP1B 4DPTA 2O01C 3H2UB 3D2WA 1F21A 4JKHA 2NRZA 4RBVA 3HJEA 1Q7LB 1FDBA 2Q0UA 4I68A 4NE9C 1S7HA 1WUUA 4O3QA 2I0XA 1GTHA 1TV9A 3LUYA 1S8OA 3CQYA 4WKYA 4OYIA 2DHGA 5CB1A 4TUPA 4NXMF 3H0RB 4LF7K 3RMBA 3HHDA 4O44A 2RKIA 2M88A 3KWMA 3W3SA 2EZYA 3WU2U 1I51B 9ATCB 4WQ5A 2ZM6K 1JXVA 2HZVA 2B5JA 4DV3F 3MECA 5BOLA 4MAKA 3VQ9A 1X31C 4ES3A 4HCCA 4DR2J 3NUQA 5J0WA 3G82A 3PIPL 1QQMA 3WEEA 3BH7B 3C95A 2HRYA 4LFCK 1TUVA 2RRDA 1BL3A 3NL0A 2X74A 3LDSA 2IIRA 3O8MA 1ZETA 3FEZA 3FKBA 4ILLA 5DETA 4YB1P 2FBYA 4XUSA 1NZBA 2IM3A 2I2YA 3DXSX 1JLGB 4UZBA 3M2RA 4K2JA 2AZ1A 2HQIA 2K1RB 3EVOA 1ZM2A 1RABB 1OO0B 5MLCQ 4K4WA 4MDAA 1ZBLA 2XS5A 1T0TV 3P4IA 4O3OA 4QIWD 3RBXA 4HYKA 2BQRA 2YH0A 4JI5J 3KHYA 3IS9A 1EO1A 2YH1A 2F8TA 4I27A 1BUPA 5KL8B 4QW8A 3H5SA 2WFAA 3VQDA 1PVQA 1AW0A 4JI7K 1ZQIA 3L3CA 4OJHA 4CO1A 2OCEA 3G96A 4QIFA 2BABA 2K4HA 3CC7S 2CQIA 2NXEA 3I6PA 1U1NA 3GE9A 1X1PA 3M9NB 1DQ8A 3CMAS 2K3IA 2KYXA 5D78A 2UUWA 4HL9A 1MA9B 4ED6A 1NNLA 2ZH3A 4Y2SA 4P52A 3B6PA 5HP1A 3ISCA 1NKEA 5IWAF 5K8OA 3R2DJ 5A2QU 1NDPA 2CAJA 4LRFA 3R1LA 3UD4P 1RAAB 3ZZRA 1YI2N 4I2QB 3BR9A 3E9LA 4LIRA 3VEWA 2OPPA 3TAFA 4XPEA 2B9EA 2X51A 4Y34A 3HCXA 5JS1A 4KX5A 1V4TA 1D0EA 1XMOJ 4CO3A 2BCVA 1RG6A 1S4FA 2X6NA 2XZWA 4O3PA 1IBKK 2GX8A 3KHLA 3BJYA 1FKOB 1VK0A 2HWTA 4YOUA 2UV8A 3OTDA 5DDYA 1RYSA 8ICUA 3BF1A 1URNA 3MI7X 4IZ9A 3GCXP 2XCAA 4M63A 1M5SA 3R9LA 2ZBRA 3ENAA 1WC5A 3CDBA 2V63A 2MZTA 4KGXB 3J7YI 2CPEA 3SMVA 3H1VX 4K43A 1XUPO 4CQ1A 2H5IB 5ALNA 3MMBB 2L9WA 1U2RA 3TRGA 4N56A 3R1HA 3PRDA 4DUZF 1LAWA 3DLKB 1P9YA 2FBVA 2VIXA 3RMAA 4MEXA 1R8BA 3FCVA 1JLGA 4JI4K 3E01A 3WNEA 3RJMB 5HNKA 2K1RA 2P8IA 4NL9A 3OV7A 4LF6J 1M1HA 3AVLA 2MYFA 2F7VA 3FVYA 4KHUA 2YWFA 3X1LB 2BW7A 1CQMA 3FR0A 1X42A 2Z1GA 4A8WA 7ICIA 2UZAA 2HFZA 4Y2UA 3DDKA 2XMKA 5HSPA 1GOBA 4FWSA 3CO9A 1F1BB 2JLGA 2CZ4A 4USAA 3KFUF 1EZZB 1NOYA 3HHNB 1T05A 2KIVA 1WLJA 3AARA 1RA6A 1MWMA 5HMWA 4X65J 1WSVA 2FHMA 3MGIA 3PUFA 4QIEA 2QKQA 2F63A 4QU6A 1RBUA 3QU7A 2CRXA 4BGBA 4QZ9A 4I2QA 4F4WA 4AE5A 3KXDA 4B3RK 4TUQA 1CJTB 3M8RA 4OX9J 5G5GA 1H2VZ 4I67A 5IT0A 3RMDA 2FJDB 2DGUA 3D5MA 3QRRA 3DRRB 5FD1A 3PLAA 3B9JA 1YRUA 3LO3A 4DR2F 3TQEA 1NZPA 9ICPA 3N01A 1R27B 1OH5A 3L3VA 3ZD8A 2HMIB 5CR0A 3QEAZ 1XIQA 2WVEA 2DXFA 2VL1A 4MO4A 3J8AA 3DNCA 4CF3A 1VSJA 4Y28C 4X4TA 3OBWA 4DV4K 1K9MO 4AXIA 1SPBP 2GBZA 3SSRA 2V52B 4O5EA 4U7UK 1KAXA 1R31A 1MN7A 1J5EF 5JVGQ 2ZTCA 2ZXIA 4LRBA 5D3GB 4ETZA 1VAZA 2XULA 4DV1J 2FGOA 2K8AA 3BYPA 3QINA 3DLKA 4GV6A 4CJEA 4ED1A 3HFZB 5AICA 3GE1A 3M1YA 4KH5A 5DBCA 2FC9A 4YCXA 5EUHA 1N5QA 2R8HA 2WBMA 2GX9A 2PAVA 5KG1A 4GY2B 4KV8A 3RJHA 2K7JA 2YQEA 7ICLA 1AT1B 3VALA 2CVEA 3B6BA 3T3FA 2OEJA 2QL5B 4JI6F 3S01A 4C7ZA 4DV2J 1IR1A 1UZDA 2KKHA 2MSTA 4IOAQ 4PZOA 1XMOF 5K8NA 4OI4A 4JK1A 1UVIA 4J2BA 2DR8A 4TQRA 5FJ4A 2PI5A 1IBMF 4BGDA 3IKMA 2NSBA 4L75A 2A42A 3S3OA 5ALJA 4DPOA 2WB1C 2E7VA 5KFCA 2HMPA 1ITGA 9ICTA 3TANA 3QO9B 1CJTA 4FXVA 3HHLD 4MJKA 5BREA 5I3QA 2UUAF 2FJAB 3VA3A 3NTUA 1YTAA 5AE2A 4JI8J 1HKBA 3DI6B 7ICOA 3DRRA 1X6JA 1FJEB 5AIAA 4P71A 1Z6RA 4CK2A 1ZQEA 4MDBA 1M1GA 3JXOA 2D9OA 2YKMB 4U6PA 1U48A 1XQIA 2QA2A 2DNPA 3N6NA 2VQEF 8ICYA 1LK7A 2VUGA 2LDIA 3UDEA 4F4KA 3F56A 2EG1A 1TK8A 2FE9A 1HKAA 4FJKA 1M90T 1FD8A 3NVWA 5D3GA 1RT1A 2XRIA 4FJGA 2PD1A 3IFEA 2R2UA 4X4PA 2FPMA 4WF9Q 1BGXT 3CDUA 4C7QA 4JS5A 1GMVA 1WB9A 3Q8KA 2BPCA 3ENVA 3LZJA 1I1GA 1RCOB 3PRBA 4YDUA 1UTAA 2DB1A 3Q86A 3C6UB 1S22A 4LF8J 5GMKa 1SC6A 2FZCB 2ZH6A 5TISU 5H2FU 1KQKA 5DDRC 1RDBA 2IJRA 1DLOB 4X65F 3CFPA 2FF6A 2BUNA 3W61A 1IVZA 2QKBA 4EELA 3EEQA 3CD0A 1UEVA 4ZS6A 3C14B 2H3EB 3G6YA 4CEZA 3NDKA 4TY8B 1P1LA 1NU4A 4ZPWR 2QLJB 1ZYQA 2PN6A 1PK3A 5LMNK 2PFQA 3BGUA 3NGIA 4ELUA 3RB6A 2RE2A 5AQHA 3H98A 1DY3A 4OX8A 5ALIA 1ZQNA 2HHUA 2P5VA 3VF6A 2E6LA 2QEXN 1EIYB 5C15A 2BKEA 3HP9A 3FC9A 3JPQA 5J0XA 5A8KB 1ZRMA 5DB9A 3ZTQA 3JSMB 1G3OA 3UKRB 5DG7A 3CNHA 2C28A 3R97A 3DI6A 2KVIA 4CE6A 3LDQA 5KAFU 5F0WA 5HP4A 5LMUJ 2ZDOA 4IXCA 1NK0A 2GTDA 2J0SD 2YKMA 3H25A 1B4SA 2XLJA 1W2BM 1RBSA 3TW0A 3M1VB 3WK4A 1Q8IA 4RG8A 3QGGA 3PO4A 4CD1A 2A41A 5B5EU 1LFWA 4JK7A 1GTEA 3P39A 4KB7A 1E3MA 2F77X 1YRXA 4B1WB 3ASMA 4HHUA 1JWWA 1KQSR 1R8AA 2CQDA 4BVPA 2AMCB 4R8UA 3TVYA 1RHUB 2KRRA 1S76D 2VC0A 3KLIA 1VLBA 4B9UA 3C6UA 1URRA 1CJKB 1EKRA 5D15A 1A0PA 3SMPA 3NOCA 5L9XA 3OPKA 1SC1B 2EH9A 4M9LA 5F8GA 3D66A 4QZDA 3EVWA 4M94A 3C66A 1DLOA 3ONNA 1RKIA 5THWA 2CZ9A 3TTFA 1N8RT 3TUPA 4NWBA 3RJFA 5JJBA 2I1RA 3NS6A 1NM2A 3DOKB 3CXCR 3V9ZA 1BCOA 1ZD3A 3C14A 3J80Y 4ZJQA 5HMYA 4RNOA 4LSNB 5EX5A 2HRTA 4NMLA 5FLXU 2R8GA 4JYAJ 1A6SA 4U67Q 2MQ8A 1SIJA 2EDUA 2EI5A 3TZWA 1Y0HA 3IGNA 5J0RA 4EX7A 4J8FA 3ED5A 3UN3A 3PIOQ 4JLHA 1A77A 3VEYA 1FIQA 4FVCA 2WVDA 4P10A 3PW7A 5F8IA 5F0XA 5KT6A 3AT1B 2V2KA 3KVGA 3SPYA 2VQFK 4Z94A 4BR2A 4IOCQ 1YUWA 2GWJA 3JSMA 1YJNN 2VG5A 2AU0A 3UKRA 1UJ4A 2DKZA 5EXWA 3PRVA 1RT4B 5B8HA 3ZO7A 1EP4A 1HBNB 1IXRA 1QE1B 5IT9O 4IKFA 2N7CA 3M6KA 1Y88A 3IR5B 2ZH7A 1JLQB 4F3QA 1IKVB 4K2XA 3RMCA 3QBWA 5B0GA 3P83D 4W5RA 1IG8A 2HG4A 4FZZA 1SAZA 4CF9A 3G71N 3BBBA 1REGX 4CHNA 3HBTA 1Y4ZB 2BW2A 2CQ3A 1S79A 5KQ8A 3H2VE 1H0HB 4ZCLA 1OVQA 4AYBD 4LF8F 1F60B 2DY4A 4DPXA 4WJBA 2MKCA 2RHSB 4C8NA 1N34F 4CRJA 3NWRA 2JHEA 1VQNN 4OLPA 3H5YA 3C23A 2OIHA 4NJ8A 4J9QA 4NASA 3KK2B 1Y5LB 3QFPA 3I31A 2Q3SA 4A57A 3N0VA 1CJKA 1MU2B 5KFEA 4FYYB 4NYZA 4RT2A 1XO0A 1IXKA 4C0BA 4C80A 3C5GA 1QQ7A 3VGSA 4NCGB 3O1BA 4HEA9 2ZG6A 1V38A 3V6JA 4X84A 3O3HA 1RT3B 3ILIA 1X4FA 5I3PA 2QMWA 5AQFA 1YF5L 1B4FA 9ICIA 3L8BA 3ALYA 3THXB 3DOKA 5KFMA 2ZZNA 1C6VA 1EETA 2KI2A 5CZXA 4X66K 3E51A 4B9NA 4G9ZA 3BS5A 4CBWA 3P3DA 2KVQE 4H0PA 2Z2YB 4UB2A 3PMLA 4Y0FA 4ED2A 1W2BR 4AHRA 4M2YA 4W98A 3TZZA 3AVJA 3TYTA 1NHVA 5DDMA 5J2KA 5MAOA 8ICIA 2FGCA 3ZDDA 4LR9A 2FJWA 3E1YA 3ZFVA 3GG0A 1RT4A 1SV5B 3Q0AA 1YG0A 1RAFB 2A10A 2BM1A 3D1QA 2LPEA 1NKBA 1IKVA 5F3TA 3Q8UA 4ZPCA 4FZMA 1N5TA 1TUWA 3IRXB 4QU7A 4ZTFA 3SQIA 2BYCA 3CDWA 4FLWA 1WC1A 3UKUB 1N36K 3MDCA 4CF8A 4OYAA 2B21A 4DZ6A 2L3MA 4E7KA 3ETMA 1VDHA 4C9DA 1HNXJ 2YB4A 5ITHA 2BTFA 3BEGB 3O80A 4IJAA 3HD2A 2FMSA 4EU0A 4OJ5A 1H2UX 3W2VB 1GT8A 3M5RA 4B8AB 4M5NA 2CZVC 2P9EA 4EEYA 2XY7A 4OPJA 1WHWA 2EVZA 2AGOA 4FJHA 4FPAA 3JYTB 3UW1A 3LGMA 5CYMB 3CTRA 3HFKA 4OYZA 3BKFA 2FB0A 3OTQA 1MU2A 3I5BA 3TJ8A 3A8JA 3CCUN 4F91B 4USMA 1U6BA 4GMJB 4NCGA 3D0PA 3TA2A 2VIHA 2FSKA 4HDHA 5EE3A 2NQPA 3C2PA 2Q0RA 4MF8A 4K4UA 4PHDA 3DXBA 5DS7A 4WK3A 2UUCK 4USHA 5F3XB 4FM0A 4KPCA 3THXA 3FCWA 4ZJLA 1BC6A 2H3GX 1TK0A 2JR5A 2A6MA 4HI2A 1S1XB 4ZVSB 2XHCA 1NHKL 4FF4A 2EFVA 3UDVA 1U25A 3WQTA 2XI9A 3AO5A 3CI5A 4RQ7A 3QU5A 3ENOA 4B3OB 2QB0B 2HQDA 5F8JA 4DTUA 1XNQK 3CJ1A 4DL4A 2KXNB 4ANCA 2X1FA 3FM9A 4DR5J 3NVYA 4DU7A 1TL4A 2FVQA 2V0NA 1AUSL 4ZTJA 2BE9B 2IRUA 2WUSA 2HHSA 3MOJB 4FZLA 2MTLA 4NLYA 1UVKA 3E9PA 5H1SQ 4P2MA 3TAMB 5CJ7A 3B82A 3IRXA 1U09A 4J2EA 4LF1A 4YOYA 1FVSA 1WDDA 2ZOGA 3DLBA 1K8KB 3ZTPA 1PYTA 3CWJA 2RD5C 3GIIA 2XS7A 2L5YA 4ED8A 3KTQA 1YIJS 2MKJA 3UKUA 2WF5A 2J7KA 3QNNA 1WUDA 3OL9A 4E8UA 1KSPA 1PG5B 2E2OA 4PWWA 3NHGA 5KL1B 3AVBA 4IQXA 1B0TA 3PW0A 4CFAA 3W2VA 4DUYK 4K4IA 2E6MA 4NRTA 4Z4HA 4OZ1A 4CF1A 3C1YA 4M3YA 3JYTA 1BI4B 4DFPA 5CYMA 4F0KA 2AWZA 1HBUB 5K14B 3KJVB 1H1VA 3AGKA 4DU1A 3LDNA 3ULEA 1YAGA 1MMNA 3C46A 2WAQC 4IQMA 1PAEX 4A8SA 4LFAK 1H7XA 3SAGA 2C2EA 1ZQQA 4J37A 3KMSA 1XQSC 4K4XA 4IR1A 2F9TA 3DWLA 5A6WA 1U26A 4EMDA 2DIUA 2PT0A 1BWFO 3K8VA 7ICKA 1B43A 5HHHA 4IOBA 4BG8A 3ULDA 4JRQA 3M8QB 1S1XA 2JLFA 4C0HA 4XO0A 1IKWB 1QQOA 2M70A 3V6DA 2DNRA 4TNOA 1S5LU 1XI1A 4BRHA 2I5JB 4B3OA 3MGVA 2CQ4A 4I2HA 3ZCMA 3J7AP 5DQGA 2A3JA 3U1NA 4KH4A 2WF7A 3CPWR 4CEBA 2DGSA 9ICSA 2IVFB 4CJUA 4IFEA 3G8SA 3GILA 3KKAA 3CG7A 4WP9A 3IN5A 3NBPB 3BO3A 1SL0A 1RTIB 5AZJB 5HLFB 4PG8A 2ASOA 2A6AA 3PY8A 2ZVSA 3V72A 3SIPB 3C2MA 1RDCA 4PQUB 3CDAA 2ZIUA 2ADCA 3MHYA 2RUGA 1BPZA 5LL6d 1WHVA 5M1NA 3TAMA 5ALOA 1JQGA 3ZT2A 4V19X 2F1FA 3HX9A 4OLBA 1H74A 4KLOA 4YB7A 2NRTA 5ETNA 1C1CB 3BS9A 5B7WA 3GJRB 1WCNA 1B7YB 4FJ5A 4Y2XA 1M5HA 4J9RA 2Y3YA 4IH6A 1S9GB 4A59A 2CWXA 4YY3K 4M3TA 2ZIXB 3A2FA 3W5XA 3KG4A 3P4UB 4JI3J 3AA2A 1SXLA 2V2VA 4N5SA 1GXUA 4USJC 1BDGA 3QU9A 2CG8A 5AM5A 1UEKA 4H0OA 1HBUA 1Q5VA 3PYDA 5K14A 5DGAA 4RQ1A 3L95X 2W9CB 4CFBA 1DURA 5L9NA 3MXJA 1ATSA 3TR5A 1B70B 5AQIA 2ZH4A 3HM8A 4A46A 2MQLA 3GDQA 4FKXA 1F2HA 3O3FA 4CNQA 4BR0A 4ZVUB 3KLHB 4OHZA 2Y9UA 2WAQD 3TP2A 1FKAF 1YI2S 2W7OA 3CMQA 4NLQA 1S5ZA 2IM0A 5ELZA 2ZJ8A 4Y2IA 1ZQFA 4GKJF 2JGAA 3M8QA 1VQKS 1RT6A 4M3UA 3Q7BA 1IKWA 3LP2A 5I42A 4M9NA 1VGYA 4EIAA 4I7FA 5D0HA 4K50A 5HQ8A 4DB3A 4PG5A 4LZGA 2LEPA 2MZQA 4JI1F 3O1WA 3U1MA 3AB4B 1UPMB 3K89A 2D6FC 4F4YA 5HQLA 1FRLA 4DOAA 1WKLA 4R0JA 3NBPA 4AP9A 1RTIA 1ZQLA 5AQSA 5HLFA 2IOFK 3QEIA 3DU5A 2MQMA 1OH7A 4E3SA 4PQUA 4FWMA 2YHYA 3E8OA 4PHTX 1OJ4A 2RRAA 2BKOA 2KQ2A 4G6VB 1HNWJ 1S4EA 2B8QA 3C5FA 2ZE2B 4CLSA 4FCYA 2MJUA 1RYRA 5DMRA 2R2TA 3PHTA 5AKLA 2P5GA 4Y00A 1C1CA 1IQZA 1GOCA 2OELA 4JV5K 2UU9J 4W5TA 4YHHK 3AODA 1XU4A 3VAHA 1JROA 3W64A 1QS4A 1YITS 7ICRA 3CJKB 3BSOA 4B9MA 2A1RA 2HVHA 2VICA 2BJ7A 2RP5A 4YXJA 2ZIXA 2IVNA 4GKKK 5BXIA 3WHIA 3I96A 2FLPA 2YY6A 2BHNA 4Z6CA 4NYPA 2AYEA 2E1CA 4QCLA 3KDNA 4W90B 4PRFA 3IG1B 3ILLA 2XQCA 1FFVA 1N5YB 2YNIB 1ZD5A 2W9CA 4EGLA 5ALKA 2MEWA 3UQSA 4CWBA 2HBZB 3PNCA 1GLDG 2XWYA 2FC8A 3I55N 3BKTA 5A6PA 2A0FB 3VETA 1F3VA 2D74B 2XNRA 3UWTA 5AI9A 3OSPA 3VENA 4I9QA 2N3LA 3FMWA 3LDPA 4I2FA 4OJOA 4C4WA 2R7OA 5C2GA 1Q8LA 5LM7E 2R7RA 1ZA1B 2W2QP 3D0IE 1VHXA 2GO7A 4QPTA 4EBCA 4WE1B 5BRFA 3ZTRA 2W43A 4NCAA 3VAJA 3FMBA 1PC4A 1UEUA 5EDWA 3TJ9A 3NNCA 3H4BA 2QWRA 1K1QA 1IKYA 1EX8A 2DHSA 4RUCA 5IC4B 3L3FX 5HRNA 2HWIA 3ZX2A 2FLLA 1Q46A 2Z0GA 5GMDA 3NMAA 3Q8LA 2O66A 4YG2A 3KDOA 1QTNB 4Y2RA 4ZHRB 1D8BA 2RIJA 3H0MB 1YTUA 3CF5L 4Y2QA 2YPZA 3CQ8A 1TYQB 2XI2A 1PJ7A 2VV5A 4DR4F 2IJFA 1ZBIA 2ZKTA 4BDYA 4PCQA 1RA7A 2YQ3A 3AOBA 3NXZA 3RJJA 3VVUA 4UQGA 2HVIA 2GCFA 3GYGA 4IOXA 4BRMA 4E0DA 5LJVA 5D4PA 5J2GA 3ORYA 3TUZC 3HT3A 3A12A 3CJKA 4NA3A 3AVIA 3V1QA 8ICHA 2QWMA 1RAIB 5E33A 3AVFA 1RWPB 4KLDA 5HJXA 4BJQA 2H48B 3IG1A 3OFHA 2WTUA 3THWB 4USUA 1S72N 5C25A 3POTB 1N5YA 2YNIA 3HWTA 4BWMA 3D1OA 4BRCA 1VR6A 1UCVA 3Q7CA 1C4AA 1UKUA 2EKNA 3IXQA 1YJRA 1WAJA 5B0FA 3DRSB 3VGKA 3UD5A 1IV0A 3GPAA 3OVAA 1HWLA 3QSYB 2EWSA 4DR7F 3MEGB 4J90A 2CXEA 2E9ZA 2OMOA 4Y3CA 4IEIA 4CHYA 1R0CB 4WXWA 5IC6B 1EKEA 1VIOA 1VJ5A 3J7ZT 2HFVA 3ZZ0A 3VCDA 4LF4J 4R25A 2YWHA 1TL7B 3AHPA 1N5VA 3MEDA 5JRTA 4C8KA 3CJCA 3C3LA 1FK9B 2AJFE 1HNWF 2D8CA 2PEBA 3BEXA 2YX7A 1O13A 3MPUB 3UPQA 5HVFA 2DWQA 4WFNL 4ANDA 3L2UA 1QZ5A 2YMQA 2F65A 3F0NA 4ECQA 1FDDA 5H9FJ 4FJJA 1T02A 2W2NP 1Q5YA 3KLEA 4Q0BB 3CD7A 5K20B 3VQAA 3NVKA 1HW9A 4Z37A 1HHQA 3EY1A 2VPYB 1T9XA 4BVOA 3QNMA 4KLUA 4YN4A 1X9XA 1T7PA 4BE2A 1YBTA 1Y3JA 1HYZA 5FIIA 1N5SA 4FWOA 2V69A 5HRRA 2W3SA 3MMAA 5BRHA 4F71A 1WNEA 3KNAA 5AQXA 3R6GB 2XCPA 4CZKA 4HUEA 4C3KA 3H8YA 3OYKA 5KFNA 1L7NA 3MBYA 3A5OC 1SQEA 4OI3A 2ZUAA 3C2KA 4RPFA 4DTMA 2B9YA 4EYIB 4LF6K 2R3VA 2GHVC 1UAXA 4EZ6A 1FFUA 4IBNA 4BR5A 3AJ2A 3VF0B 2HF3A 4K25A 3P8BB 3D3BJ 2E5LF 3D2NA 1LXNA 1JLAA 4ZH4A 5E3AA 4F4AA 2BMBA 4CJLA 3TFRA 4IH5A 5AT1B 4F4XA 5ALFA 3CCMN 3LGNA 3EICA 4CFDA 3POTA 4EI2A 3D28A 4IO1A 2QLXA 2DRBA 4EEKA 5ALEA 3MM8B 3DRPB 1VBYA 1M5OC 3DRSA 4LBIA 2X1BA 2QEXS 3MEGA 3MD1A 3S3MA 2QA4N 2PKEA 2DR7A 1Q82O 2DIVA 4U8YA 4M63C 4NPOA 4DJBA 3MUVP 3A0IX 3L4IA 4ID5B 1GH8A 2FDNA 2OFHX 2ACMA 4OX9K 3V7JA 4B3MJ 5A0LA 2VA3A 3S1TA 3HKZC 1TL7A 1S1WB 3L09A 3AU2A 4C3MA 1TP7A 3H8WA 4F5QA 2JH1A 4GV9A 3VQSA 2XO7A 4XH1A 2A2CA 2UXCF 4CHPA 3OTOJ 1LWCA 5AZIA 3SBTA 4CJSA 4QZEA 4H4KC 5BR8J 1VFJA 2IM1A 6AT1B 4CGGA 2W2PP 2A1JB 1IJFB 1BPEA 3WK9A 5C2FA 3GFYA 2VJUA 1JNRB 2AJ4A 1X0PA 3O2IA 4X4OA 1TFYA 1N62A 4Q0BA 3QEWA 2LMIA 3VR1A 4UARA 3SMSA 1S57A 2Q1LA 4DV1K 1U2VB 3MAQA 3AMZA 2RSQA 1B22A 1OW5A 4FDFA 3CW2C 5AXMA 4TURA 3AAQA 3DXKA 1FRJA 5ETVA 5FPMA 1NJIT 4DTOA 1KW4A 4USVA 4IJNA 4NB4A 4PKGA 1DOQA 3ZX0A 3ZLJA 2LXFA 2AQ4A 4DQRA 2EX3A 4Q45A 4PH5A 2YWGA 3U26A 4KLIA 2NXCA 2OH2A 4LF5J 1ECWA 4ZP7A 3O9UA 4CLZA 5KFYA 1LKYB 2D0AA 4BQZA 1QUPA 4HLBA 5HQMA 2ZBPA 2V4RA 4R0EA 3EXCX 3OHRA 3P49B 4DSLA 2V7YA 8ICFA 1HR0J 4KO0B 2XIDA 3LW5C 3HPOA 4DS5A 5HL7Q 1N2XA 3CD5A 3MM6B 3IAYA 1B0PA 2COLA 3CJ3A 1B64A 2QK9A 5F8LA 4ZPDA 1FWLA 5CR4A 1BPDA 2E2NA 2KRBA 1YJNS 2DXDA 1WHYA 5JVHL 3UXOA 3ZTOA 2OLWA 4ID5A 2OP5A 2VASA 1EAYC 2DFEA 3FC4A 4O3SA 3HVRA 2ZITA 4M5MA 1M5VC 1RHRB 1S1WA 3ATVA 4JI8K 2OEKA 3AD9C 4QS8A 2MA1A 1Q82T 3MF5A 1R0AB 3OYHA 4E7LA 3ALRA 3OS0A 1WKKA 3NLCA 2ASDA 4LF7J 1T9TA 1WG1A 2GO8A 2A1JA 4F5OA 3QGPA 4IG0A 5C24A 3HPGA 3U1LA 1NDCA 4JAXA 2FD2A 4ZPAA 1ZJNA 5U47A 2ZM6J 2W6LA 5T14A 2LDYA 4BC2A 2BJ3A 5AXNA 2E5HA 3CJQA 4OJGA 2KL8A 4PXEA 1ZQ1C 1VQNS 1RHMB 2MZ1A 3BB5A 3VF2A 1U2VA 1HIWA 2G5IB 4UATA 3E3XA 8ICGA 3DCAA 3RW7A 1WN7A 2ACYA 2WK4A 2P9KB 2U2FA 4Q8FA 4LRAA 2HHPA 3AA8A 5H1SV 3MR7A 4TN2A 1LW2B 4M7XA 2LMRA 1F9HA 2P9PB 8ICNA 1LOUA 2FVCA 3MAHA 2ZZMA 4JI7J 4UB6U 4WFZA 4Y1DA 4CH0S 3IC1A 3W65A 2A19A 3CCWA 2ZD1A 3NASA 4BR9A 4KO0A 3LAMA 3MM6A 1KBRA 3PFEA 2NUBA 1FO1A 2VANA 3TFSA 4QR0A 3SCXA 5FP0A 3QMQA 3SQGB 5BR8F 5E2QA 4RQ5A 4CLPA 5AQGA 2OSQA 2XEXA 3V9UA 4JWMA 2VKQA 2P9CA 4U7CA 2D3UA 1UT5A 1N6QB 1Z1ZA 4CZCA 4FJXA 3PR5B 1EB0A 1WF1A 3O9QA 5LMUK 1OY6A 1N56A 4GO5X 4A5BA 4DV5K 1VQ7N 4DR1K 1Q53A 4YDUC 4B1YB 3J81O 3ID6A 2HQFA 1VQ6N 2F9DA 1T9VA 3VVTA 3MDQA 3KJFB 2N7YA 2EK6A 1PVRA 4ZVFA 4K4YA 3QRQA 3WUHA 1Z2ZA 4ENOA 3G8QA 4LBPA 3H5UA 2BQUA 3WT0A 4IFYB 3BS7A 4DL3A 4LF5F 4DTRA 2JZBA 3AQOA 3NF6A 3FFIB 1QQCA 2KMDA 3J80O 1E4GT 1X9JA 2GELA 1FFSB 4P4OA 4JI4J 1KC8T 4LQ9A 5AI8A 4K7QA 1T9UA 1OPZA 1QQ5A 4N41A 4AL6A 1HX1A 4CJFA 2VHGA 1TAUA 4WFAL 4OKJA 1O08A 5C2CA 2KHQA 1RXWA 1LW2A 4WPAA 4BRFA 2P9PA 1NPPA 1YZ7A 2PFNA 4QS7A 4I4BA 5C0YA 3D4JA 2KHDA 2QMXA 5KG2A 1H7WA 8ICZA 2KKVA 2O8DB 4JYAK 4YUDA 2GOLA 1KVCA 2QZ8A 2P5OA 3LAKA 2P35A 1FX4A 3R6MA 4NLPA 1SJ3P 5HOOA 3ZZZA 3EPIA 3RW6A 2YX6A 5BRDA 2G0CA 1S0OA 4Z6EA 2F1HA 2ASLA 1ILYA 4RTFD 3WX4A 3EGVA 3UXPA 4NXNK 4LF7F 4YR3A 4B3RJ 2RS2A 2R4FA 2GMLA 3HM9A 5SUHA 2FJVA 1WAFA 2UV8G 2O5DA 3L9ZA 2ISPA 2QLBB 3LGHA 3C29A 2EC2A 1T6DA 1TU0B 2MY8A 3SDEB 1EQ0A 3TU5A 3MURP 2ZM6F 4BS2A 2EAMA 4IRKA 4PQAA 4UOHA 2Q2RA 4DF8A 1APSA 4LFCF 4DU3A 1UPHA 3AQEA 2FHJA 2W2OP 3DDHA 2W7PA 2RDDA 2UUBJ 4B1VA 3ET6B 2H5EA 4CTAA 2WB1F 4F0MA 5LSRA 1ESVA 1K0VA 1T6CA 4DV4J 3EDRB 4GVEA 4JNEA 3HSCA 1MG7A 4L73A 1HNZK 2XVTA 3HRGA 2YQ0A 2EZXA 1XR6A 1KLNA 4DU8A 4PXCA 4IFYA 4O8KA 3M32B 1OQ3A 1JJ2R 4OO1J 1FT8A 3R9PA 2GJ2A 3FFIA 1FW6A 3LDLA 5DZ6A 3QU4A 3KOAA 2DEIA 8ICTA 3H0LB 4ALZA 3MCOA 3L4QA 5J1NA 1NK4A 2XTJP 3M9OB 2YMLA 4YDDB 3D2EA 5D0RA 1Q4RA 4P0PB 2IY5B 2XY6A 2OHFA 2BBEA 3KHRA 4GRSA 2YTCA 5AJ3K 4P74A 2G8HA 4YOTA 4CJKA 4DR6J 4O0IA 3CIMA 2ZJQL 3JPOA 1LKZA 2QTWA 3EN9A 2B51A 2ZBIA 2IMOA 4P4MA 4DO9A 2QWPA 5JTIA 1WC3A 2QE5A 3HVTA 1RTJA 1H3DA 4R66A 5ETRA 2DKXA 2W40A 1Z4UA 4MH8A 3MEKA 1U49A 3QEPA 5HMMA 2WBNA 2ZJRQ 1E6VB 3C8YA 1IBKF 2FSNA 2ZEJA 1L3KA 4OX6A 3OYMA 4ZK7M 2VJVA 3ZT0A 2F1JA 3KFWX 2B4OA 2C2MB 5A76A 1S1UB 4Q44A 4HI1A 4XH4A 3GFKB 2KIWA 4FJMA 1NK9A 2E20A 3RB4A 4QS9A 4CJWA 2ZH2A 2C42A 3TABA 1GFWB 3L5KA 2OUGA 1T44A 2UP1A 2AJ0A 3Q22A 2UXBK 1WTBA 2MKIA 2YHWA 4CFCA 4M9GA 1HBOB 3UPFA 1N5WA 2FJBB 4B9QA 2FJXA 1ZM9A 3LPYA 4ZOHC 3VGVA 4CZEA 4JI4F 1KFSA 3QIPA 3UR3C 1FX2A 4PL8A 1N32K 5KT2A 1JN3A 3O44A 2KM8B 2RVJA 2FHKA 2VKZG 3MAAB 1VBZA 3TPQA 4Q8EA 4ECSA 1XHXA 4CLWA 5HROB 1FEZA 1GLBG 1KS2A 3T7ZA 3Q8QB 3NCPA 1WD6A 3M32A 5CE3A 3E2EA 4E19A 2JEFA 4IG3A 1CJUB 3G6EN 2R7UA 4FOEA 2ERRA 4OKKA 2FZKB 3JPNA 1VSLA 5D4BA 3D1HA 4P0PA 3HYFA 1CPZA 2UVUA 5L1IA 3PW2A 1GLCG 1OS5A 1ZQWA 4FK4A 1JKHA 2HNDB 2QYCA 3M8ZA 3O6WA 4F3MA 1RT5B 1N0UA 5FDLB 2P9NA 2H3VA 4MIWA 7ICHA 2FPHX 2C2RA 2F8KA 4N47A 2P9IB 1WOSA 3W9HA 1XSPA 2Q0ZX 3WIUA 2N82B 4FM2A 2O1PA 4LC9B 3NS1A 5LMNJ 2I38A 3AOCA 4Q7AA 3VZHA 1E6VA 2RNEA 3JPPA 1TFWA 2E4LA 1RBRA 3AY9A 1ATNA 2VBYA 4F8RA 2MSSA 4NMXA 3F5TA 5EU7A 4IR9A 3RU0A 2YVSA 4NYNA 3GJSB 3I82A 4WYWA 2QARB 3ZDAA 4MFBB 2OO4A 2P6SA 5K8PA 2RRNA 3RH6A 2XMJA 1HBOA 2CPYA 2WCXA 2XMMA 2XZDB 3DGVA 1IUJA 3CCJN 3CHWA 5E3CA 3DRXA 4F3TA 2KG5A 3CUNA 2ZTEA 3HO1A 3FSIA 3T1HJ 5IIKA 3AQFA 3MAAA 1RGVA 3H7HB 5HROA 1DGJA 1O5JA 3SJHA 1NHUA 1CJUA 2LCWA 4RUBA 1AROP 1WJ9A 4WYBA 3GIMA 2CQCA 3I9ZA 3I4PA 2Y9HA 4H54A 4KX3A 3DOLA 5AKKA 4P2XA 4KB1A 2GGPB 3QAEA 3QEVA 1SC4B 4RBUA 4CIOA 4ILJA 2GA7A 1JLFB 2XMTA 1CZAN 3QSIA 2UXDK 4ZPVR 1YJWN 2D1KA 3QFUA 2DH9A 3EKUA 1OXJA 2YWEA 1BWVA 3OYBA 1RT5A 1K44A 4FLTA 2WRMA 2LQ8A 2WHEA 3P6YC 1ZD4A 4NLWA 5FDLA 3D6RA 2H3IA 1FESA 2P9IA 1DK2A 3KUEA 3THYB 2NXJA 5CQGA 2KXHA 1TKZB 2O3DA 2W01A 4FN5A 3AA4A 1VI7A 5CH7B 1RWKB 2GAGC 3D6JA 2MMYA 4B17A 2HS4A 2QTDA 2VQFJ 3G0ZA 2SXLA 1RAJA 2R8JA 2XYHB 5L1MA 2JFKA 1ZBSA 4DTSA 4P2FA 3W63A 4UBBA 2JWNA 5J1EB 3KYLA 3EE9A 5CZVA 1FJGF 3MC1A 4MFBA 4TLQA 4C97A 2GVZB 4K4GA 3C6TB 4MEYA 3LTOA 2ZWOA 3BM7A 4V19J 4O3RA 3L4BC 1ASVA 4CH7A 1UVLA 2P6UA 3VTHA 3AO1A 2M8DB 3CJRA 1EWQA 7ICJA 5EGYA 5D4OA 3A8KA 2QLFB 4YORA 1SJFA 2YNGA 4I6MB 4J9MA 4CHOA 1PAUB 3HTVA 1C1AA 2HIQA 4ECTA 2B6GA 3QEXA 3W7BA 4PUOA 4FVUA 1S72S 4F02A 4X4QA 2HFUA 4C8OA 5DLFA 1CUKA 1XEZA 1QZ6A 3DLRA 4BDZA 1BVSA 4M42A 5AKYA 2F7TA 3FFKB 3R7SB 2GGPA 3EE3A 4ZVOB 3JAMU 4WP3A 3CCQN 3OFEA 5HMXA 1W9HA 2F96A 4KTZA 1BY9A 1GMUA 3AAPA 3BYRA 3KWGA 1CXUA 1S0MA 3V81B 4M9JA 3EZOA 2EBGA 1URJA 3RUBL 3GSIA 4ZPTR 2PMZC 1HWUA 4DPYA 2VG7B 4RBTA 3A13A 4LJMA 4EUVA 3TWHA 2ZIWB 3BO4A 2YHAA 5KAKA 4JI2K 3O1LA 3BKUA 4RQ3A 1U8SA 4X66J 5AQRA 2E1YA 3IHQB 4M7YA 1RWOB 2P6RA 3MM5B 3THYA 2VFTA 3D6FB 4PL2A 3WK7A 1QTMA 1RI7A 1TKZA 1FWKA 4WZMA 2DD8S 2LYBA 3OL6A 3U9DA 2KTQA 3UCZP 3HVWA 4IO9Q 3DN9A 5B66U 2KM8C 3GV5B 2HPUA 2VDHA 4BRAA 5CZ1A 1VYAA 1NK6A 4ED0A 4KMUA 1VQLN 2HBLA 4JV2A 2KP7A 1BE4A 3MMVA 3VEVA 9RUBA 4DFDA 3IR6B 4YOXA 2XGPA 4EBDA 2Q43A 1UHUA 2QM1A 2IM2A 3NH1A 2CJAA 3GV7B 5D6GA 3BGFA 4RZRA 2YQ1A 1SJRA 2HGMA 3C6TA 2BOAA 4UAUA 5AQUA 3UVJB 2QA4G 3WZ0A 2H5JB 4UW9A 3F9MA 4FPRA 4KI6A 3CCRS 5AE3A 1A7GE 2LM4A 2W25A 3Q8SB 2DQNB 4F5PA 3RR8A 2F3NA 2UU9K 1T03A 2KJVA 2KKZA 3CERA 4I6MA 3T1AA 3RTVA 2E2QA 4CEQA 4PGQA 3D6MB 3R1XA 4IQUA 5DQIA 4GXIA 4DI6A 3T19A 2ZFHA 3BZQA 7AT1B 3QZ7A 5B08A 3H46O 3CCMS 3VQ8A 2ABYA 3VV2B 2R9LA 3U02A 5KG5A 2RH3A 1UFKA 3RRHA 3CDEA 5DM7L 1ZA2B 1Q8BA 3CFRA 1XC9A 3VTIA 3KD5E 4F92B 4X4UA 5EWFA 2QA4S 4WCEL 2IDEA 2KICA 3M8SA 1SWVA 1RU1A 3OXLA 1X4CA 3LP0A 2UUCJ 2VG7A 2HMXA 3QYPA 2HOQA 2HS3A 2ZIWA 3PNIA 2VQFF 1TMJA 4RNHA 2ALYB 8ICRA 1Z4NA 3OT9A 3NVZA 1IG9A 4Y2MA 4DDFA 1RTHA 2FLOA 2P9UB 5DBAA 4PJ0U 3SQ4A 1RSCA 4UB5A 4KN4A 1NMDA 1GAOA 2ROPA 1XNQJ 1YJVA 3RB3A 3I4HX 4BRGA 2XY5A 4DMNA 4CJ5A 1HMVB 4OGEA 3KKFA 4PXBA 4QZVB 4CGJA 5AHXA 1ZS6A 3ZX3A 3RYLA 2F9WA 1QVFM 1NBWA 3H5XA 9ICOA 1XNRJ 2X3GA 4IQWA 2Z2MA 8ICPA 4B02A 4K4TA 5AI4A 1Q8KA 4AM6A 4CZHA 5SWMA 5SZTA 2J76E 1R43A 3O6QA 2FI1A 2ZTDA 2O6KA 5AKJA 1MLAA 1WHXA 1S6QB 2YCHA 1KHWA 2RHKA 1C0FA 1Z2LA 3KLVA 1TL3A 4HH0A 1X4HA 4QNLA 1KRPA 2YKQA 1BCMA 3MZIA 3IV6A 3NAIA 2W4PA 1ASWA 3IBCB 1V3RA 4L3KA 2PYLA 1QDUB 3TNVA 1X5SA 1WOOA 2VQEK 2Z56B 2IVYA 5GADP 1GNKA 3PVXA 1JL1A 4DUYJ 1NNDA 3SFUA 4GO7X 4O23A 2Y1RI 2H54B 2OA8A 3WBZA 4WFBQ 2ITGA 3WKBA 4QJFB 2LA4A 2OD6A 1XS9D 1JLBA 2YN4A 5ETOA 4Y65A 2B8PA 2RAQA 1RTZA 3T41A 1WYGA 4X66F 4RUAA 2WB4A 5KT7A 4G1QA 4B9LA 4M04A 1WSHA 3M6XA 2VONA 5BOMA 5AKEA 2HK2A 3VF4A 1WELA 3W8GA 3L7OA 4LT6A 2AGPA 4QZHA 3ZDEA 5HVGA 4B3TF 4IS7A 1GEHA 3NEKA 9ICVA 2YKOA 4XK8C 1WSJA 3CJ8A 1FI4A 1T9YA 1WG5A 2WSFC 4ILRA 1FFGB 4CNZA 4FXDA 2JWLA 2W4DA 4E7HA 2Q36A 4YR2A 2D0CA 4ISEA 3I33A 3SEIA 3VGTA 2E3TA 2LHTA 1HMVA 3FJ2A 1IH7A 3HZ6A 4NOHA 4M8LA 1LFPA 3QWPA 1P8ZA 1G99A 1GK8A 4YEAA 5IV4A 3N97B 4CZGA 2RQCA 3PIPQ 1N36F 2AT1B 5H9FK 4DQSA 1A5VA 1N4LA 3SUNA 2ZVIA 1UETA 4FLZA 2MRLA 4ECZA 3NMRA 3M8PA 3SJJA 4CLFA 2MSNA 2ZUGA 1QM9A 4ZIWA 4BRDA 3QERA 1S6QA 1U1RA 4L3NA 2AEJA 3QU2A 1B7FA 1Q78A 2Q6CA 3MM9A 1WI8A 1UWBB 1SWWA 3F53A 1MA7A 4RW7A 1LW0A 3W8PA 3WKCA 3ISNC 3W0LA 2VZ9A 1X6IA 1NJYA 1RZMA 4YY3J 9ICBA 3AV9A 1IJEB 4ES1A 1QD1A 4LQ3A 4RNNA 4DL7A 2NXNA 2HAFA 2W8KA 3GYNA 4KH0B 4DR3K 4ZN1A 4CEOA 4UBCA 5GAGP 2FPKA 5ETKA 2CKWA 4I2JA 4NEZA 1KL9A 4UUWA 5AXLA 3Q23A 2K4EA 3FZFA 3O4QA 1ACMB 4K5SA 4E2FB 2HNZB 3AQPA 1ZQPA 4F2RA 4WP8A 1Q9YA 1LWFA 3DYAB 4WQ4C 3T9NA 1MMLA 3OS2A 2GC8A 3DOMA 4CI6A 2HVZA 1X8DA 1FXDA 3DDIA 5A2QY 4RW4B 5C10A 4WYLA 4Z7YA 4CJ7A 1SH2A 1JJCB 4LSLB 4OPKA 1Y10A 3ZETB 2B6AA 4YFKA 3ATUA 5AQVA 3TSQA 4ZVEA 3ZT3A 5J2NB 3JS6A 3LANA 4P2HA 3SAFA 1WSGA 3F41A 3CJ7A 2DR9A 4CBXA 1M1KT 3KLGB 1VQ7S 3AY0A 2E8PA 3P5BP 2Q97A 3I8BA 2CG4A 2MAXA 4RQMA 1TE2A 1HKCA 4GNIA 4ECXA 4DQPA 1N48A 2EQYA 5A8RA 4H03B 2IHNA 1T94A 4M41A 4I0WA 3ETRA 7ICTA 4DCOB 1VK8A 3VQEA 4B6JA 4LR8A 4OYXA 1SZ2A 4YOEA 3C7NB 1EKSA 1W0HA 1VSEA 3WK5A 3IMQJ 1IKXB 1HD1A 1DFDA 1C1BB 2G8IA 3G10A 1HPZA 3GJQB 5HBMB 4I2BA 2OPQB 3UCGA 4BE1A 1VSFA 1RDRA 1H6KX 4CYUA 1LV5A 4E7JA 2V2ZA 2GV1A 3BPSP 2IA0A 4QIWC 4R79A 4HTUA 2D41A 4UY8T 4KBOA 1KD1O 3THPA 2KNJA 2GIQA 1J2NA 4P6QA 1HJRA 3SQ1A 3EJMA 2QRRA 4LFAF 4GKKJ 4M5DA 3SUPA 1W26A 2JC1A 9ICRA 5F3ZA 2Q4TA 3ISND 3ILJA 3K75D 1Q81T 3M2UA 2F1IA 4UAWA 2BJDA 3BDEA 2ILYA 3JPSA 4GMKA 4WK1A 4CHQA 3CYMA 3ISDA 2AJQA 2A1AA 2ZZTA 4QWDA 2J7WA 3GFHA 2HNZA 1HR0K 1YZ6A 1N54B 4JEPA 3IWXA 2E1PA 1RGIA 3GU0A 3DYAA 5GAHP 2H65B 5HJYA 3CMES 4DTNA 3LVWA 1VQ8N 1V5IB 5L1JA 4YNQA 4PKDB 3VPZA 2VOPA 1ZBHA 4R65A 3NGSA 2CQGA 3IO1A 4LSLA 5HRSA 4GVBB 3CVKA 3OVNA 4LFBF 3NKYA 1ZXIA 2QI2A 1F2GA 5JXSA 3MPDA 5J2NA 3NH2A 3NP5A 4GV3A 1ZTTA 4HVZA 1RLCL 3A0BU 1EXNA 3D2SA 2N3OA 3I87A 3MN6A 4GC6A 4HTJA 4BBYA 3DMJA 3C19A 2C3YA 2CQPA 2AEMA 4OIXA 2R42A 3THVA 2O67A 1KEKA 4BRLA 3OBIA 1S9EB 2OMLA 2CNKB 2F4VF 5BYSA 3QFWA 2JH7A 1FERA 3U3GA 4K8ZA 1C1BA 1BA1A 1LOTB 4DHVA 4YY3F 1Q3VA 3QGHA 1QHAA 4OLAA 4H4OB 1XMQJ 2OPQA 3GIRA 1D9DA 1MN9A 1I3OB 1FDNA 4BREA 3I0RB 4NLSA 2V4JB 1I94K 5ALUA 3EGZA 4BRIA 2EWHA 4JI0J 1ZTWA 4JKDA 5AKXA 4O0NA 4K4VA 3QESA 1KQQA 4AILC 3VEOA 4TQSA 2G0IA 3UO0A 1NXIA 1VQ5N 3NGTA 1OH8A 4NLOA 4KTQA 2IHR1 3VCBA 2VBWA 8ICEA 3DM2B 5EN1A 5FPNA 4MKYA 2KHCA 1BD6A 1KD1T 3JS9A 2ASYA 5AQTA 1V4SA 2NRRA 5CYJA 3HP6A 4O9MA 5BYQA 3W60A 5F8NA 3QT6A 4KKOB 1C20A 4OZJA 1SL1A 1ZPVA 3FLCO 2LKZA 3L6QA 3F2DA 3HKWA 3MWTA 1FNOA 2E88A 4GVBA 3HULA 1IWGA 5IIOA 3BZKA 2FUG9 4FP9A 4KGZB 1Z05A 3IBPA 2ZHOA 3GTYX 2H3FA 3PW4A 3EO3A 1S48A 3A5LC 2AHOB 3G25A 2FJ6A 4MN4C 3J7A1 4FSVA 4DX5A 3U27A 1PIEA 4UB1A 4F36A 2WW8A 1NMEB 4QQBA 4YOVA 1Y00A 1S9EA 3PSIA 1OQ6A 1L8OA 3KZIU 3GJTB 4DCHA 1VLYA 1WEYA 2WBRA 5CAAA 4FKYA 4JV5F 3VEXA 2NRWA 5IIIA 4YHHF 4AUKA 1ROFA 3RGIA 2FF3B 4OZNA 3HLUA 3GU3A 9ICLA 2CPDA 2OPSB 1ZQDA 1WC0A 3CC4N 3HKZF 4KT0C 3U8XA 1SXEA 4H4OA 3G6ES 3J81j 3MR3A 1CG2A 2QL7B 5KT5A 2MJNA 1S77D 4C98A 2VD3A 4K4SA 3H40A 4CJQA 3I0RA 2V4JA 1Z1BA 2MLXA 3AA9A 2D0BA 3M1FA 4URQU 4X4SA 3Q2TC 4KGMA 3HI0A 1IN0A 2KSOB 3CD6N 4LY7A 1IM6A 4MKAA 4IUFA 4JKGB 1SQKA 1WF2A 2RJZA 4KLSA 4ISFA 2LA6A 3V4MA 2BDPA 5M1KA 5J2EA 5B0BA 3DM2A 2B0CA 1RXVA 1M5KC 2YKAA 3LF0A 1UVMA 1RISA 1RU2A 3M05A 1NGEA 2DRAA 3PSFA 2BJ9A 3JPTA 1VRUB 1NGFA 3CB4A 4Y1CA 2QB1A 5CWRA 3I9V9 4KKOA 1Y5NB 3IBWA 5J0OA 1FTRA 1U1MA 4EP5A 3C94A 5J2CA 3FBEA 3CCSN 3CC7N 4CO5A 1P27B 3HHLC 4PYAA 3PM9A 1DARA 2QFJA 2B0GA 2D69A 3NF7A 3CMAN 3J7AN 2B4VA 5AQJA 1FVQA 1YVUA 2YWWA 5TKYA 4NI2B 4FS2A 4CNYA 5E41A 4D3HA 1YLXA 1S1TB 2AIRB 4LH5A 4BROA 1FKOA 2WONB 3SK3A 1KTVA 4EENA 4O5BA 1M90O 1YWXA 2FDRA 1JUDA 2UUBK 1YVFA 5D0GA 1QAXA 1NGCA 4BRKA 2ASMA 2Z30B 1RQ0A 3L2QA 4S0MA 2OPSA