3PX6A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (tautomer) in closed conformation
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px6A01
4DLGA 4ECSA 4QZHA 2OZMA 7ICRA 5DB9A 1JLEA 4PGXA 3PW5A 3MEEA 4Z6DA 3MXJA 2ZQBA 4FJIA 3RBDA 4QZCA 3DYAA 1CZ9A 4MF8A 2P6UA 3BJYA 1XC9A 1ZQQA 2FLPA 2I9GA 5DG7A 4DU1A 3UIQA 1ASUA 4ID1A 5FROA 2BCQA 3Q8LA 2FPLA 3FFIA 4DS5A 2F1IA 3Q8PB 3EY1A 2MUTA 4G1QA 1FXXA 8ICKA 5HRNA 4OLAA 1V9PA 4UAYA 2FLNA 4DO9A 3M9MB 4YP3A 3AVBA 5KI6A 3T5JA 4IRCA 2PY5A 1GOAA 3RJKA 4H4MA 4DS4A 4DQSA 4RW6A 5CJ7A 4GMJB 3NE6A 4FYDA 4TQSA 2VANA 4FJJA 4KTWA 3DI6A 3KLFA 4KI6A 1NKCA 3F73A 1HUZA 9ICWA 1C6VA 1U04A 5KG2A 3S9HA 3NGZA 8ICGA 4F93B 3PY8A 4NLGA 2B6AA 4CFCA 3KHRA 1ZQAA 3UQ0A 4KB0A 4GXKA 1KDHA 4YFKA 2IHNA 3LP3A 2C2RA 3S3NA 3KLEA 2UVUA 3E01A 3ZT0A 4I2QA 4DOCA 3I0RA 4Z4CA 1BVSA 3AU6A 3MABA 3AVNA 3LDAA 7ICFA 2GBZA 4EZ6A 3OHAA 1S0VA 3NF9A 1Y88A 4F4WA 1EP4A 1A76A 1ZBHA 3PV8A 3LALA 3AUOA 5KT7A 4W5RA 1RXVA 4O3SA 4CCHA 4NLNA 1H38A 5KFAA 2BDPA 4O44A 3AO1A 4O0IA 4E7IA 4I7FA 4O9MA 3K4GA 2IS3A 3TI0A 4O4GA 2YKMA 4EYHB 4FJKA 1JLBA 2ATQA 5FRNA 4UB1A 4CJ3A 1EETA 2HNYA 1ASVA 5J29A 4ZTFA 4DLEA 3CFRA 4YCXA 3K57A 2J6SA 4YFUA 3N97B 5DDMA 4H4OA 4DG1A 2G8WA 3HVRA 3ZSWA 1C0MA 1CZBA 3AVLA 4Y1DA 5J2NA 4FS2A 4FJXA 2W9BA 3OYAA 1TL3A 9ICVA 5J2MA 1S6PA 4R8UA 3HXMA 3O3HA 3SQ0A 1L5UA 4KLGA 4KHNA 4DQPA 3ZD9A 3HWTA 1S6QA 4ELTA 4XIUA 4I2PA 2W9MA 2KQ2A 3V7JA 1ZQBA 1RBUA 5KFXA 3U6FA 9ICOA 3ZD8A 4RUAA 4TQRA 4CJ5A 2UVVA 3C1YA 4I2DA 4LY7A 1VSIA 4Z4FA 2DFEA 3MXMA 4TUPA 3RRHA 3HX0A 3OYHA 1VSMA 3HSTB 7ICHA 1G15A 4C8NA 4AHVA 2MAXA 3L2QA 3AVIA 1DTTA 1HUOA 2OPSA 3TARA 3PW7A 2GUIA 4O5BA 1SKSA 1WAFA 1WAJA 2HNDA 4UAZA 4DL6A 1LWEA 5DBCA 2XO7A 2I5JA 2IC3A 4CJRA 3UXOA 4OPJA 3K2PA 3G6YA 3AA5X 2ASJA 2FBTA 4TUSA 2J6UA 1S1UA 4QWDA 4QWAA 2W9CB 4CHOA 1ZQCA 5D4BA 1HYVA 1RT1A 4CECA 1JX4A 4DSEA 2XY7A 5KG6A 3NHGA 3ZCMA 1TKZA 4P4MA 5CHGA 5DGAA 3MDAA 2JEGA 3IAYA 4RQ0A 5KG0A 1UAXA 3EW9A 3HK2A 4RQ8A 4J9OA 3M9NB 1NK0A 4DSIA 2AGPA 4CHQA 3TAEA 1BPYA 3PO4A 1XHZA 4CJWA 4XRHA 3KLIA 4CGDA 1JLQA 1RDDA 4I2FA 4RW8A 2RN2A 2PFOA 1KFSA 4DF4A 5CYQA 4ED2A 1TFRA 3G0ZA 4PGQA 4CIGA 3VQBA 2ZE2A 2YNHA 4GC7A 4BE2A 2HHVA 4O5EA 9ICXA 1UA1A 3V72A 4CJSA 7ICUA 4KHQA 3AVFA 2NRVA 4KLSA 4KLQA 3NGIA 3CFPA 3OS0A 3U3GA 1Q9XA 4KLUA 2DPIA 3Q8SB 3SV3A 4IBNA 3ZSVA 1RBRA 1B9DA 4XUSA 3LP1A 5HNKA 4I29A 4KLEA 3MAQA 3T5LA 2QKKA 3MR5A 2XRIA 1ZQPA 4CJKA 2ZTCA 4J2BA 3TAPA 1Q8IA 4FXDA 4YNQA 3OYKA 2W42A 4FJNA 2ZD1A 4M3YA 3QEXA 4TURA 1VSHA 3H8SA 5KGXA 1T3NA 1QTMA 4I2HA 2VA8A 1X2IA 4YMOA 4ICLA 5DB6A 3K5NA 2PYLA 4MFBA 4QZGA 1C1CA 3DMJA 3T5KA 4HVJA 3HVTA 4GLXA 3ZSOA 4JS4A 2VA2A 4CJUA 1JLFA 4E1MA 4NM1A 4ZH4A 5J2JA 4NM2A 5E41A 1S5JA 3OJUA 3MR6A 4BDZA 9ICPA 4M3ZA 3TWHA 3PNCA 3Q8MA 5DDYA 3ISCA 1C0UA 3ZDBA 1W0HA 1S77D 4EZ9A 4CJPA 5KFSA 1ZQNA 4YVZA 1IM4A 4I27A 5D46A 3C5GA 4CK2A 4FZYA 2YKNA 2W8LA 2ZUCA 3ZSQA 3RJHA 4FO6A 4KN7A 4RQ3A 1ZQUA 4CK3A 5J0RA 4QWCA 3V6KA 4Q8FA 4CIFA 3L2RA 3DOKA 1DTQA 5BOMA 3EYZA 2E6LA 3S3MA 1RT3A 5T7BA 2XHBA 4Q43A 2W9CA 4F92B 4IR1A 4CF0A 2WTFA 1K6YA 3LPUA 3KTQA 3M9OB 4HUFA 1XWLA 4E7HA 5C5JA 3BQ0A 1MQ3A 3JPRA 4RW7A 4J9MA 2D5RA 3MEDA 1NKBA 4CJ4A 2HMIA 1YTUA 4KITB 2P6RA 1HRHA 2X78A 3B6PA 1HYZA 1S1XA 1ZQSA 1LW0A 3MR3A 3HM9A 9ICJA 3G10A 3H08A 4RG8A 3L8BA 2R8IA 1S0OA 1Q9YA 1A77A 2KW4A 5KFCA 4OGCA 4DTJA 2BKEA 1F21A 4ED7A 4YMNA 3H40A 4CK1A 3RAQA 1RILA 2FBVA 1O1WA 4FJ5A 2VG7A 4MEYA 4F4ZA 4BACA 4KHUA 3T19A 4E7LA 3A2FA 4F5PA 4F4KA 2JEFA 2FBXA 8ICZA 4QZDA 3ZDAA 3RRGA 3H4BA 4QZIA 1ASWA 1ZQYA 3G6VA 4KTQA 4J9QA 1JLGA 5KFUA 3Q8KA 4IQVA 1KVCA 1WN7A 5KFVA 4ECWA 2HVHA 2QKBA 3AO4A 3SUQA 3HJFA 4EP5A 1ZQHA 2YNIA 3AO2A 1S9EA 3AV9A 3RMCA 2G8KA 3NGDA 2R8KA 4AHCA 4FLYA 5EWGA 8ICLA 1L3SA 4LZGA 2FMQA 2O4GA 7ICMA 2A1RA 4FK0A 3LANA 4I2IA 1BPEA 2BCVA 1FK9A 2KFZA 1LAWA 3RB0A 1RT4A 1N5YA 1ZQZA 1TK0A 4QZBA 2VG5A 3EWAA 1QHTA 2PFPA 4GXIA 4YN4A 4HTUA 8ICJA 1T8EA 1U45A 2EHGA 4RQ7A 4ED3A 4KAZA 5CA7A 3SUNA 4FJHA 4ELUA 1RTHA 4DTUA 4DSLA 1C1BA 3ZT2A 4HHTA 9ICSA 4BDYA 1Y97A 5J2KA 4DOAA 5KT4A 5TZVA 3JSMA 3C94A 3V6HA 3E2EA 4PUOA 2FBYA 4J9NA 4Z6CA 1NK5A 5J2GA 1NOZA 3EPIA 3MXIA 3VQ8A 8ICMA 4I9LA 2ZJ5A 4CEQA 4FLZA 3GV7B 4IQUA 5F9NA 5L1LA 3C5FA 4TSXA 4DSJA 3MECA 4JV2A 5F9LA 5J0UA 1QSSA 1CUKA 4RT3A 1VK0A 4RT2A 4F2SA 4I2EA 1IKVA 3HPGA 3V9ZA 4FM1A 1SUQA 3AVHA 1TGOA 1QLNA 2V4RA 3KJVA 4DL2A 4F50A 2BGGA 3QESA 1X1PA 4B9NA 4FJGA 1A5VA 2PYJA 4OGEA 8ICAA 3AVMA 1S97A 2KZZA 2WONA 5D3GA 3LWMA 4PGYA 5J0WA 3OVNA 4R63A 1ZQVA 4CEFA 4GXJA 4HCCA 3LAMA 3TAGA 1ZQWA 4ID5A 3SCXA 3ZDEA 1CXUA 3H8WA 4RQ6A 4ECZA 5JS1A 2PFQA 9ICLA 2V9WA 3OS1A 1ZJNA 1UA0A 3ZT4A 4NXZA 3DLGA 4M3XA 3IRXA 5KFHA 4FVMA 1RTIA 1ZYQA 2JEIA 2KZMA 4CGJA 9ICUA 4CE9A 4BDPA 4QZ9A 2OYQA 3KHLA 3O4QA 3KK1A 3SQ1A 3GIKA 3OYMA 2C2EA 4M3WA 3L2VA 3UQ2A 4F5OA 4CEDA 4DFMA 8ICEA 5KRTA 2HHUA 3OYIA 4Q5VA 3DLEA 2OPQA 5C24A 4MFAA 5KFLA 4KLMA 4J2EA 2F1HA 1JXEA 4J2DA 4FZXC 1T7PA 4CFAA 4CIEA 2B5JA 2D0BA 4O3PA 2KZ3A 4F5QA 5DGBA 3OYNA 1XU4A 9ICTA 1B9FA 2YV0X 3PR5B 4NYNA 3NF6A 4J2AA 4RQ4A 5KFZA 4CJLA 1K1SA 3QEBZ 1NOYA 4O3OA 1JXLA 1S1VA 4RNNA 5KFDA 4YQWA 1WSEA 3H8JA 2VG6A 3ISBA 5KFPA 2NUBA 4UBCA 3VQAA 3QEPA 7ICIA 4CJVA 4E1NA 5J2QA 3RMAA 4EYIB 2JEJA 3I8DA 2A1JB 5IIOA 4Q8EA 1XI1A 5EWFA 2BQUA 1Z3EB 3NCIA 1LWCA 1LB2B 1WSGA 3DRSA 5KFYA 4NY8A 2ATLA 4DFKA 4RUCA 4TUQA 4B9SA 5KG5A 4L8RB 1RYRA 9ICRA 4DTRA 1RTJA 3C2LA 5HP1A 3RWUA 4CGFA 8ICSA 4QZ8A 8ICOA 4CF9A 5JS2A 2RF2A 3T5HA 1RNHA 5J2EA 3UPQA 5J2BA 4J9RA 4KLLA 2ISOA 1S9FA 3JYTA 5L1KA 1D9DA 3HYFA 4FJMA 4OKEA 4NCGA 4UB5A 7ICKA 2XY5A 4KMUA 3Q8QB 3KLHA 1TK5A 4Z4IA 1RDCA 4RW9A 1UT8A 4AILC 2ZTEA 5HROA 5I3UA 4EBEA 3RH4A 3LZIA 1TKDA 5DG9A 2RDIA 2IA6A 4K4IA 4M9HA 4RQ5A 1EXQA 4FLUA 2O4IA 5J2AA 4O3RA 4JRPA 4M45A 2AGQA 1B43A 4C8LA 1EXNA 1HJRA 1GOCA 1RBVA 3PW4A 3TFRA 4Q44A 4CEOA 5DLGA 3MGIA 4F8RA 3L2WA 4E3SA 3ZSXA 1YTAA 4KB1A 4GC6A 1ZQKA 2NRZA 4PY5A 4I2JA 9ICAA 4IQWA 3MBYA 3CYMA 1YVUA 1RXWA 4KLFA 3DLKA 3RB4A 3VQEA 4O3NA 4KFBA 4ECQA 3QNNA 5CZ1A 1XSPA 1ZQFA 4KHWA 7ICNA 4NLKA 1S9GA 2Z1GA 3DLHA 3LAKA 1ZQEA 1VSKA 4YR3A 3KK3A 3B0XA 2BPFA 5CB1A 1R0AA 4K4GA 5KTQA 2G8FA 4KLDA 1WSFA 5CR0A 1NKEA 2J6TA 1HQUA 1JIHA 4MFCA 2HNZA 4KHSA 4KLJA 1SL1A 1ITGA 4Z6FA 5DG8A 3PX4A 4Z4GA 1ZETA 3ETLA 1QQCA 4F5NA 4CEBA 3DOLA 4M3UA 2Z1IA 3K5MA 1BPZA 4Z4HA 2C28A 3OS2A 2EX3A 1TV6A 1SL2A 3UXNA 4F4XA 4OPKA 4FS1A 3IS9A 1KFDA 4CJFA 4N76A 1HNIA 4CJEA 4FLWA 4OLBA 2FMPA 8ICPA 4X5VA 3PR4A 3OYLA 3LPTA 4K4HA 4DQQA 2XY8A 1CEZA 4DTNA 1XSNA 1WCNA 3GIJA 2YHBA 5CY4A 4KTZA 4DU4A 4ZHRA 5KG1A 1HPZA 4FLVA 1KLMA 3VQPA 2R7YA 1RPLA 1Z26A 2BR0A 3CG7A 2DFLA 4DL7A 1VSEA 4ED8A 4KV8A 3H4DA 1HNVA 4KREA 4DTSA 3GV8B 1BPXA 3ISDA 5KFWA 4CHYA 2ASDA 2PZSA 3AVGA 3BGRA 2QXFA 1YT3A 3QLHA 3RH5A 4CFBA 2A1JA 2ZJAA 1U9LA 4FLXA 5C42A 4XA5A 3UXPA 4DTMA 3HP9A 2PI4A 1ZBUA 3AVCA 4UB2A 3PW2A 1K1QA 4R65A 4B9UA 1UOCA 2X6NA 5IINA 5IIMA 4B9MA 1QS4A 2A1SA 3QEWA 3C6UA 2UVRA 3SV4A 5DLFA 5DK5A 3OYBA 4BWJA 5D49A 4QZEA 5KFOA 1S1WA 4B9VA 2ZUDA 2X74A 2YNFA 1U4BA 2IBKA 2BANA 3QEIA 3KD5E 4MEXA 3RAXA 3SZ2A 4KLOA 2FPKA 1NJWA 1VRTA 2FLLA 4NYFA 4N47A 4R64A 4NLZA 3QIOA 2V4QA 1XSLA 2JZBB 1JN3A 4GVMA 3FYHA 1MU2A 8ICYA 4E19A 3V9WA 3ZT3A 2RPIA 3V7KA 5KRSA 9ICKA 1BL3A 4QZFA 4BGDA 4MQ3A 3F9KA 4P4PA 4ELVA 3RMDA 2VA3A 4W5OA 3GV5B 2IOCA 5J0YA 4FW2A 4FM0A 1T05A 4KRFA 9ICCA 1JLCA 2HHSA 3SQ2A 4DF8A 1L3UA 1DLOA 3VQDA 3LZJA 3AA2A 4IG0A 3PX6A 2NRXA 5CZ2A 3NH2A 4C8MA 2ASLA 4FBUA 4Y1CA 4CGIA 2IHMA 3RJGA 2Q3SA 3HO1A 4AHRA 1TL1A 3WNEA 3TQ1A 4FW1A 3K59A 4HYKA 4QZAA 3PO5A 4JWMA 4BE1A 8ICRA 4DFPA 1NK8A 3C23A 2RDJA 1UT5A 4YD2A 1ZQTA 4BWMA 2OPPA 4R5PA 3C2KA 4F5RA 3NF8A 3OYEA 1LV5A 3KD1E 4KO0A 3SYZA 3AA4A 4JV1A 4OVLA 3ZSZA 5KFFA 2D0CA 4FJLA 1SZPA 3ZDCA 2FC0A 3KK2A 8ICBA 1TKXA 4I2BA 2HW3A 1BQNA 2XGQA 1ZQXA 4M42A 2DY4A 1W9HA 3ZSRA 1J5OA 4LZDA 1X9SA 4IQTA 4W5NA 2XCPA 8ICVA 5KT6A 3AVKA 1CLQA 4O3QA 3RJJA 2FMSA 4DTOA 3GFKB 4N5SA 1U49A 9ICHA 1BIUA 1TK8A 4HUEA 5KFGA 3RJFA 2ZTDA 3LWLA 3KIOA 2I1QA 1S10A 3QE9Y 4JS5A 2AGOA 5J0PA 1NK4A 2VWJA 7ICEA 4IDKA 4EBCA 2OPRA 2BHNA 1JL2A 1RBTA 5K14A 1JXBA 3HP6A 1VSFA 4M04A 3PUFA 4G3IA 4B3OA 1KVBA 4JK1A 3P1GA 1QE1A 4J9PA 3SI6A 5J0XA 5KG3A 1ZJMA 4CF1A 4EP4A 4I2CA 2Y1JA 8ICNA 4YR2A 1ZQLA 1SL0A 4QWBA 4O55A 5KFIA 3PMNA 4KN4A 1IKXA 4W5TA 4M3RA 1SKWA 4ED1A 2JZBA 8ICCA 1WCLA 1TVAA 5HHHA 3V9XA 3U3YA 4B8CA 4QW9A 5J2PA 3ORYA 3IM1A 4M9NA 3RH6A 2RKIA 3VQCA 9ICGA 1U48A 3HW8A 4EBDA 5J2FA 3TANA 4B8AB 4RPZA 1RT7A 1XHXA 1Z25A 2P1JA 3DM2A 4KLTA 2GWSA 4KI4A 1N6QA 3GIIA 2G8IA 4BXOB 7ICLA 3O4NA 2F8TA 2OA8A 5JUMA 2WOMA 3JPNA 4YD1A 3WNFA 4LSLA 8ICQA 4Z6EA 2AJQA 5DQHA 3AU2A 1JMSA 3V7LA 4ECTA 2IAJA 3O3GA 5DBAA 3EPGA 2X6SA 1HMVA 5KG7A 3B0YA 4O5CA 2R8JA 3V1QA 5FRMA 8ICUA 1S1TA 3DLRA 5IIIA 4QWEA 5J2CA 3JPQA 4M0AA 2YNGA 5FDLA 4PWDA 3RMBA 4AHTA 1RZTA 3OYGA 4ZTJA 3VA0A 1J54A 3L2UA 1N48A 3SUPA 4RU9A 1B22A 3QERA 1TKTA 2P51A 3IG1A 3MEGA 1DGSA 3CM6A 2E4LA 3NFAA 1LAVA 4YMMA 3JPOA 1KRPA 2YHAA 4IFYA 1QSYA 4QW8A 4J9LA 4KKOA 1NJZA 4ECXA 3CM5A 2E6MA 2JGUA 4UB3A 1RDAA 1Z00B 3OYDA 3N4MB 3BQ2A 5J1EA 3TABA 3Q8RB 3ASMA 4F2RA 1WSIA 4Z4EA 2BQ3A 3KLGA 4N56A 7ICQA 1FKPA 1NJYA 5CYMA 3BDPA 3NDKA 5L1JA 2LYHA 1KLNA 3JPSA 3RR7A 5KFNA 1WNSA 3VQ9A 1DOQA 5KFQA 3V1OA 3WNGA 2R8GA 4P2HA 4IKFA 5J0TA 2AQ0A 4M9LA 4QAGA 3TAMA 4IRDA 2KTQA 4WE1A 4H8KA 5HRPA 4PQUA 3SNNA 3OHBA 5HMMA 2KFNA 3AVJA 2G8HA 1JKHA 4DL4A 3L3VA 4QOZB 1JLAA 4E7JA 1A5WA 3DRRA 4M9GA 1BI4B 1PZNA 4W5QA 3GQCA 4RPXA 3SI8A 4CHPA 1C1AA 4FJ8A 7ICSA 2Z1HA 3RJEA 1TAUA 3V9UA 4JV0A 5J0QA 4F4YA 2OWOA 1IKWA 1KCFA 2NRWA 5BOLA 4AHSA 1COOA 3VQ6A 4XQ8A 9ICBA 5EOZA 3VQ4A 2HHWA 3AA3A 2DTUA 4OKKA 1I3AA 5J2DA 3OJSA 5EU7A 3OY9A 4M3TA 3H7IA 1J53A 1NK6A 1BISA 1VSJA 4F3OA 2ALZA 5DB8A 5HBMA 1RT2A 4LH5A 2BGWA 1I39A 5KGWA 2QK9A 9ICIA 9ICQA 5I42A 4YXMA 3QZ8A 1UWBA 3LP2A 3NBPA 1D8YA 4BXOA 4N41A 1U47A 4F91B 4CJTA 2ETJA 4AHUA 3TR8A 1IXRA 1KEJA 4M6WB 3KKRA 1WSHA 1EKEA 5CWRA 4DSKA 1RTDA 3GILA 5J2HA 3HL8A 1MQ2A 1KVAA 4CGHA 4PHEA 5EWEA 3NH1A 7ICPA 3KHHA 3K75D 3VQ5A 3D0PA 4O0JA 2ISPA 3M8SA 3TAFA 4E0DA 2AU0A 3RB6A 2IGIA 5L1IA 4YXJA 4FK4A 3QIPA 1JL1A 4YG2A 1S0MA 3P5JA 4CF8A 3PX0A 3NF7A 4CESA 3DRPA 1KTQA 8ICIA 3TAQA 4CHNA 2FPMA 2B4JA 4BE0A 4IG3A 5KT2A 7ICJA 5SWMA 1T4GA 1ZBLA 1BPDA 1BQMA 1RCHA 3P83D 4DSFA 5IILA 3OYCA 2OZSA 4RNOA 3C6TA 9ICFA 1IG9A 5KFJA 2XGPA 2W8KA 1Z00A 1IH7A 2Q0ZX 2XY6A 3HT3A 4DOBA 3GIMA 9ICEA 1VSDA 4AH9A 3C2MA 2ZJ8A 3RTVA 4MF2A 3VA3A 4O5KA 1C0TA 3ZSYA 8ICXA 5IIKA 3HPHA 4RPYA 1IKYA 2HB5A 3G6XA 4OJRA 3SPZA 3L3UA 3QO9A 1HJPA 3OYFA 5HMLA 1RDBA 4DQRA 4M2YA 5HRSA 2HHQA 2NRTA 3V6JA 4Q0BA 5BPCA 4Q45A 4DMNA 4IRKA 1SV5A 3MGHA 4RW4A 5KG4A 2DPJA 2XCAA 2BPGA 4I28A 1J9AA 3OSPA 3QEVA 3RR8A 3NTUA 1A5XA 2Y1IA 1BI4A 4NCAA 1X9MA 3KHGA 4FZZA 4DEZA 2BQRA 4ECRA 2PI5A 4DTXA 2GV9A 4J9SA 1VRUA 2P66A 1RT5A 3I0SA 5C25A 4ED6A 5J0OA 1C7YA 3C1ZA 3K5LA 4LSNA 3NH0A 2BPCA 4YR0A 1BPBA 5KFTA 3WNHA 1ZQMA 3MR2A 5DB7A 1ZQOA 2HHXA 4CFDA 1X9WA 4DWIA 1TV9A 2P5OA 4DL3A 4K8ZA 2H5XA 5KT3A 4DL5A 2M9NA 4LVSA 3V6DA 1NOMA 2R8HA 3K58A 3VN5A 1NJXA 4DQIA 5KFKA 1WLJA 4ED0A 4M6WA 3V9SA 4RNMA 3V4IA 4CGGA 2JLEA 4RQ1A 5DBBA 3RJIA 3PW0A 3QZ7A 1QSLA 3LP0A 1KFTA 3EZ5A 4K8XA 4IFVA 1S76D 2DFFA 5DMRA 4Z0UA 4FM2A 2HHTA 5HRRA 8ICWA 1AROP 3LDSA 3AO3A 3M8RA 1TAQA 5IIJA 3CFOA 2ZUBA 3T3FA 4B9LA 4CF2A 1D9FA 1RYSA 2Z1JA 1ZQJA 3C21A 4JUZA 3C95A 4DFJA 4QCLA 3JPPA 3QEAZ 1L3TA 4C8OA 1HQEA 2HVIA 3BQTA 1FKOA 4C8KA 5KFBA 1ZQDA 3K5OA 1REVA 5DKWA 3IHQB 1NK9A 4MFFA 8ICHA 1XO1A 9ICNA 3HPOA 4LD0A 3PVXA 4DU3A 4KHYA 3B6OA 9ICMA 1SKRA 3SJJA 4E89A 4M47A 3ULDA 3ZDDA 7ICVA 4JWNA 4B08A 4I9QA 3SPYA 4KLHA 1N56A 2IMWP 3MFHA 2MUTB 5L9XA 3M8PA 4PHAA 5CP2A 8ICFA 1XS9D 3VQ7A 2UVWA 3BQ1A 4HUGA 3TFSA 5KT5A 3ALYA 4CEEA 2BE2A 1BHLA 1D8LA 5HP4A 4CJQA 1TVRA 5HHIA 3GDXA 5KFRA 4IR9A 3M8QA 3SQ4A 4M41A 3MDCA 4CHZA 3ZT1A 2LSNA 4R66A 5SZTA 1ZQIA 1BGXT 1BIZA 1VSLA 3V81A 4ECUA 1EX4A 4PA1A 2D0AA 4UB4A 4CEAA 1ZBIA 4PHDA 4ECVA 4NCBA 4I2GA 8ICTA 3AO5A 2KN7A 4UAWA 2W9AA 2BCUA 1KSPA 1LWFA 4M9JA 1D5AA 4FJ7A 3S3OA 3PMLA 2PXIA 2C2DA 2XC9A 2B21A 2ITGA 4LH4A 3T1AA 3QINA 4UBBA 1NK7A 2DFHA 1T03A 1GOBA 1S0NA 4F3TA 1ZQGA 4GW6A 3DLBA 4PPXA 2BCRA 5KFEA 4I2AA 4FK2A 4CERA 5J2IA 3QETA 5J0SA 3NAEA 1RT6A 3OGUA 1MC8A 4ECYA 4KPYA 4FLTA 3THVA 1ZQRA 1CXQA 2VWKA 4FJ9A 4J9KA 4UQGA 7ICGA 5DQGA 3D45A 4OKJA 3CQ8A 1LW2A 4KLIA 1BCOA 2P5GA 3OSNA 3QNOA 7ICTA 4DTPA 4CEZA 4HCBA 3LK9A 5HLFA 3FDSA 4JLHA 4P4OA 2G8VA 2F8SA 4JRQA 2IDOA 3AVAA 1IO2A 1BCMA 1WSJA 3O3FA 2BCSA 3OYJA 3JPTA 4PHPA 5KFMA 4RQ2A 3VQQA 2G8UA 1MSWD 5DQIA 2F96A 4B9TA 2W9BB 1RBSA 3MFIA 2AQ4A 4R8UB 3KKSA 3ITHA 3NGYA 3RBEA 1HYSA 1L3VA 4FBTA 2PFNA 3SUOA 3ISNC 7ICOA 4FCYA 2C22A 1ZBFA 4EEYA 1B92A 4RZRA 3RB3A 4PH5A 4E7KA 2F1JA 3V1RA
chains in the Genus database with same CATH superfamily
2XWXA 1XQSC 4DLGA 4ECSA 2OZMA 4J5OA 2BJ7A 4NV0A 3KOAA 4FJIA 2O8FA 4ZVGA 1KC8T 1H72C 2OAUA 2VF3A 1CZ9A 4UY8O 5CYJA 4K4UA 3C29A 4AM7A 4ID1A 2RUGA 3E1YA 3MAAA 3MEKA 1NJIO 2BCQA 5A0YA 1DTTB 2FPLA 1OXJA 2F1IA 3EY1A 2HNDB 3H2VE 4G1QA 5HRNA 4IC9A 5FIIA 2IC3B 4UAYA 1HLWA 1GQEA 2C2NA 4AUKA 4YP3A 5LXYA 1LKYA 3IR6B 5GMEA 4JV5K 2BOPA 4GMJB 5AKEA 4U7CA 5EVZA 3GOIA 3DI6A 2BZ2A 5B09A 1NKCA 2EC0A 4DR6K 1HUZA 4H0OA 4JI4K 3S9HA 4KY3A 2HBZB 3MCNA 2UUBF 2HIQA 1T94A 3OTDA 2DHGA 2EEYA 3PY8A 1XNQF 1FCAA 2GA7A 2B6AA 3O1LA 3KHRA 3QQCD 1H1VA 4KB0A 3KLIB 4W4MA 2IHNA 3KLEA 3LVVA 4QIGA 3C14A 2O6KA 4RW8B 3ZT0A 4I2QA 4DOCA 3I0RA 2M5YA 4X4QA 2ZJPQ 1S99A 5CYQB 2CA9A 5EDWA 5KAIU 3TZZA 4LFCF 3HHLC 5D6GA 2GBZA 4JI8K 2ZE2B 2YY6A 3JSYA 1W97L 4OHVA 3WXMB 2VGNA 2AYGA 2B4UA 2ROPA 5B7WA 3W62A 3QX7A 5EX0A 1UVLA 4NMLA 1UJ4A 1E4FT 3DXMB 3OVBA 1HD0A 4ISFA 3TTCA 1H38A 1MMLA 2BDPA 4DX6A 4LF7J 3LP1B 4IH6A 5ETTA 3K4GA 2IS3A 1NZ8A 3TI0A 2MQQA 4KX5A 2MKYA 2DNYA 2HLUA 2YKMA 1J5EK 1XC3A 1VQKN 1WUUA 2F2AB 2HNYA 3R1HA 2AYEA 2IVNA 4L74A 4JI6F 4ZTFA 1NPRA 2RS2A 2UU9K 4K25A 2MU2A 4NA1A 3VF4A 3N97B 5AM3A 5DDMA 2P9KA 2QIFA 4WXOA 1VISA 5AQPA 2KO1A 1C0MA 3FC9A 1RWMB 2JL9A 5HJYA 3UN5A 4KBIA 2QWOA 2W9BA 9ICVA 2NUHA 4N8NA 4OX6A 1C1CB 2VYPA 4KHNA 5C7PA 3ZD9A 3NXZA 2I0XA 1J2VA 2PC6A 3SMVA 2G5HB 2JH3A 2RQMA 4ELTA 4XIUA 4I2PA 2EFOA 2UXDK 1ZQBA 3C7NB 1RBUA 2LYBA 5KFXA 4AL7A 3SMSA 3U6FA 4NXMJ 4TQRA 3ONQA 4NLWA 1N62A 4QR2A 3C1YA 4I2DA 2F40A 2LYVA 2NXJA 5D15A 4LY7A 4DMZA 2DFEA 4U7BA 2QC3A 5CQGA 1C0UB 4ZJLA 1VQMS 3RRHA 4A8KA 2JOQA 3J7YI 1TP7A 1G15A 2HSTA 2CZVC 1M5OC 2W7PA 1DTTA 2KLAA 1SBRA 4LMZA 4O5BA 1SKSA 2FHJA 2E88A 4OJ3A 1S72N 2IIRA 3NVVA 1WAFA 4FOEA 3UDLA 2HNDA 4YHHF 2UV8A 2KT5A 3RZAA 4DCCA 5DBCA 1D1UA 2IC3A 3UXOA 5BRHA 2CQ2A 3QGGA 3G6YA 3AA5X 2ASJA 4LJXA 1DTQB 2XMVA 4QWAA 1ZZFA 4RJVA 4CECA 1HYVA 2J9DE 2C42A 2YHWA 2XY7A 2I6WA 4H0TB 2LECA 2DH8A 4P4MA 5CHGA 4ACOA 1BNOA 2IJFA 3KMQA 4PG8A 1WHXA 4DSIA 2CJKA 4JEPA 2AGPA 4CJWA 1U1NA 3KLIA 2G1HA 4CGDA 3HHLD 1RDDA 2BKPA 1VQOS 4RW8A 1FDDA 3KZIU 4DF4A 2CZ4A 5CYQA 3TWZA 2RP5A 3IGVA 3MDFA 4JOUA 1X9JA 1P1TA 4PGQA 2QYCA 2ZE2A 1UPHA 1FD2A 3NVYA 3BS9A 9ICXA 5M1FA 3U27A 7ICUA 1IV8A 1KQSR 3TEGA 5G5GA 2O1PA 2MZSA 1K44A 3NGIA 4DV6K 3OS0A 3DXMA 5LSOA 2KIVA 1YRTA 4UATA 3Q8SB 4ZPTR 3FZ2A 5KPRA 4P7VA 3UO0A 3ZSVA 1RBRA 5IS2A 4LIRA 2DKXA 3IRWP 1KBRA 3LP1A 4KLEA 2FD2A 1NJIT 5DM7Q 3T5LA 1SI9A 3GB0A 3J7YU 2C2OB 2XRIA 1WG5A 3Q2SC 3C46A 2ZTCA 1Q8IA 2W42A 1EARA 2P2CB 3IFRA 2W55A 4UAUA 2KHDA 2R7OA 1RYUA 2J0XA 2WF5A 5GIOA 1WORA 2ZIXB 1NSQA 3AB4B 1T3NA 3A3NB 4IOAQ 2DNHA 2AF6A 4DJBA 1NGGA 2KG1A 4ETXA 2L9WA 2ZJQQ 5FLXY 2XB2D 1XN9A 3TPQA 4YMOA 5DB6A 1TQLA 4JI5K 2I7PA 4DR7F 1LW2B 3K5NA 1FRKA 1C1CA 4QPXA 4HVJA 2HK3A 3G6EN 4JS4A 2YWWA 3CXCR 2ZC3A 4X62F 5ALXA 3C7NA 1NGEA 1SZ2A 3OJUA 3E9LA 3OXLA 3JAMY 4M3ZA 3KNAA 3Q8MA 1X8DA 1C0UA 1LCUA 3ZDBA 1W0HA 4OI3A 3Q8UA 2RHSB 2Q6CA 3JSMB 3OFFA 3UKRB 1RU2A 1N61A 2Q36A 2BDUA 2R7VA 2QKQA 4RQ3A 1CJTB 2MJUA 4M5LA 2DXFA 2KU7A 1P1LA 4F02A 2X1BA 4QWCA 1NGCA 1HIYA 4AL5A 3LUYA 4M5KA 3ADAC 1DTQA 4C7ZA 4IO9Q 3S3MA 1ATNA 3MF5A 1SUQB 4CT9A 5LMUJ 5HR6A 3CO0P 3M4XA 4IR1A 5K5MA 1TR0A 4DV7J 5TISU 2WTFA 4CF0A 4ILHA 3HSJA 5D4OA 3KTQA 1YJRA 4HUFA 4URQU 1L7OA 3CCTA 4BR9A 3PRDA 2WONB 2XNRA 4JK7A 2H65B 2P9EA 2D5RA 5J1PA 2ZWHA 4ES2A 3MCOA 4JB3A 2V2VA 4KITB 3CIPA 4FWSA 2DNKA 1ZQSA 3MR3A 4QIWC 1BDGA 4B3RK 1S59A 1SB3C 9ICJA 3R7SB 3H08A 5E26A 2MXYA 4C7YA 5IQ6A 4PL2A 2HFNA 4JKFA 2ZH4A 3IR7B 4ED7A 4EELA 2YBVA 4EU0A 1RILA 1SJ3P 1T9WA 3BQ7A 3H2UB 4DV5K 2KN4A 4DR3J 3QXGA 4PJ0U 2VODA 3KKAC 2XYHB 4MEYA 5I4MA 4DR5J 4KHUA 8ICZA 4CO5A 3H4BA 1NI3A 3IR5B 3A4TA 1KVCA 4DR1K 1JB0C 4L3NA 5A0LA 3AO4A 1FRLA 4ICAA 3DWLA 2IOHA 3RMCA 4LF9F 1KN5A 1VAZA 4FLYA 2X1FA 4IOCQ 3GWCA 1L3SA 3CC4N 1D09B 3N0VA 2ZIXA 1B4FA 3HBTA 2DNRA 3DCAA 3D3BJ 4FWPA 1VQNS 2R4FA 3DLLL 4LREA 3LANA 2H3VA 2MB0B 4M63C 1BPEA 2KFZA 3IRUA 3IP0A 2VG6B 1LAWA 3RB0A 1TK0A 4QZBA 4RLEA 1FJGK 1S6UA 3OL9A 1R0CB 2Z7JA 4HTUA 1DFDA 8ICJA 1LWCB 4YY3F 5D0GA 3AH6A 3H0LB 2MKSA 2MRLA 3EEQA 2W41A 2GQCA 1HKBA 2YB4A 3ZT2A 4M95A 1N5XA 1Z1ZA 4QS8A 3J81O 1QQNA 3JSMA 3AOBA 2J76E 3C94A 2LVWA 3E2EA 4XDCA 2N1RA 4CO4A 3UKRA 1NUEA 2FVCA 1PC4A 5J2GA 3KZBA 3J81U 3KVGA 1CJTA 4CNYA 2ZXIA 4CNZA 5AQIA 4I9LA 5ADXA 2QMUB 3TOQA 3GV7B 5L1LA 3KLHB 8RUCA 4NMXA 5J0UA 3CP8A 2MSNA 4RT2A 1EQMA 3BYRA 3HPGA 2MLXA 4FM1A 3V9ZA 1SUQA 5A6PA 1D3WA 3IA0A 4ZJOA 5K8OA 1NSKL 1VYAA 4FYWB 4FJGA 4X65J 1NH7A 2V8HA 5ETOA 3AVMA 2WONA 3ZTSA 1JK9B 4YOTA 1A0OB 4QIWD 3MHYA 3MX5A 2J9CA 1UETA 3LAMA 4FKYA 4CF4A 3O3LA 4IEIA 3CEDA 5ALZA 1Q78A 1C2PA 2E1AA 3SCXA 4RQ6A 4ECZA 2PFQA 1FNMA 4KFBB 2B9YA 3I5BA 1ZJNA 3FMBA 3ZT4A 3ZZOA 3EM1A 2PO4A 3OVSA 4X84A 3RGIA 1S9GB 3ZZUA 1FRMA 4M3XA 5J1NA 4GV6A 2UP1A 4RKUC 3TADC 5KFHA 3MUVP 1ZYQA 1X5PA 4CGJA 2MZTA 1R0AB 4AQYK 2HOQA 3VEVA 2W6KA 2OYQA 3KHLA 3FAHA 3H8MA 1RISA 3GZFA 3SQ1A 4PYDA 4A8SA 3WT0A 2C2EA 1RBAA 3TSUA 3ULEB 3DOLB 1SWVA 4EO6A 2FF3B 4CEDA 2C2KB 5GTHU 2GFFA 1JCGA 3R5AA 4J90A 4KGMA 1JXEA 1K5OA 3CCRS 3E66A 2VC0A 1T7PA 2JLFA 2NZTA 5AQNA 4QS7A 1UEKA 3LGNA 4LF4J 3SD7A 4F5QA 2KZ3A 5DGBA 2DPNA 3PR5B 1RABB 1KLMB 1DJ0A 3W8PA 2NRRA 2OP5A 4RNNA 2VG6A 5KFPA 2JMGA 3MCMA 2H9ZA 3BH6B 3B8AX 5EWFA 5C42B 2BQUA 3T1YK 3EKSA 4FVCA 1LWCA 5BYRA 4QNLA 1ZM4A 3RU0A 2A19A 4TUQA 3UKUB 3A12A 3HKZF 1D8ZA 4C80A 3WKDA 3C6UB 4XTTA 3UDVA 4JYAK 1S1WB 1R6YA 3EDQB 1O03A 2BANB 3TW0A 1HBOB 4DV4K 1S22A 4J9RA 1VQ5S 2ISOA 3I9V9 2R7WA 3QU5A 2UUAK 3Q8QB 4DOZA 1WOPA 3KLHA 2Z8QA 4Z4IA 1NPKA 4ZLNA 4AILC 2ZTEA 1MU2B 2PMHA 3RH4A 3LZIA 1TKDA 2ATCB 3OPKA 1RWNB 3ATUA 4JI0J 2ODGA 1H2TZ 1ZQ1C 2IYIA 1U1OA 4JRPA 1Q7LB 4C8LA 1GOCA 3POTB 3IUCA 4Q44A 4CEOA 4FN5A 3AARA 3L2WA 4E3SA 3ZSXA 4Y2IA 2XI3A 2F65A 5IV3A 3VGKA 1V3SA 2ZDPA 2NRZA 4PY5A 1U1MA 2F4VK 3WEEA 5AIAA 2RRAA 3MBYA 1VK3A 4KLFA 1DLOB 4O3NA 4KFBA 4ECQA 3VC8A 5CZ1A 2HQGA 1XSPA 1ZQFA 3CCLS 7ICNA 1WWVA 1S9GA 2B3TB 3H59A 3DLHA 4DXLA 4ZPWR 1UFLA 4C8ZA 5CB1A 1R0AA 2LQ5A 1YSJA 2ZOFA 4ZCKA 3OL7A 2JXJA 2J6TA 4RW7B 3O9QA 1U24A 4WFAQ 4CF3A 5AT1B 4KHSA 1SL1A 2M52A 1M0SA 3BF4A 1N33K 1ZETA 1RWPB 4I69A 4CEBA 3ULEA 3DOLA 2C1EB 2NQPA 2Z1IA 4M3UA 1LW0B 1BPZA 3TVZA 2VKRA 3FEXB 1N54B 5JXSA 1LKZA 1SL2A 1PAEX 2ZH9A 1MN8A 3MDQA 2ROEA 3CWJA 4N76A 4CJFA 1AUDA 4FLWA 4LQ9A 1QZ5A 4PG5A 2F4FA 2H51B 3JXUA 1CPZA 1B99A 4OL8A 3LPTA 1X3MA 4ES3A 1BD6A 2GIQA 3MPYA 1IBLF 2CRXA 1S5ZA 1J5OB 4DU4A 3NCPA 5KG1A 4ZHRA 3FZHA 3AQEA 1KLMA 1Z26A 1RBLA 1UFKA 2XMAA 4GKJJ 3M2UB 4ED8A 4DTSA 2XI2A 3O5BA 2PDAA 3Q89A 3W65A 2BA9A 3MMBB 2PZSA 3AVGA 9RUBA 4O8KA 3RH5A 2ZJAA 5C42A 4XA5A 2PFDA 4YB7A 1G6BA 3UXPA 4DTMA 3IG5A 4WCEL 1Q3UA 4K0KK 2PI4A 1ZD3A 4CD3A 4KGKA 4OX9K 3AVCA 3IWXA 1NLVA 4UB2A 1K8KB 3L7PA 3UKUA 1UOCA 5KOWA 3VVUA 1QUPA 3KKFA 4DPTA 2GC8A 3FGUA 3SQGB 3C6UA 5ALYA 2E5HA 3QEWA 4BWJA 3MR7A 3R5DA 1RGIA 5KFOA 4CRJA 5IQQA 1S1WA 2VGMA 1I94J 2BANA 4U8YA 1HBOA 3QEIA 2HBJA 4ZCLA 2P35A 2ZFHA 3NS6A 4QJVA 4NLZA 3GDQA 2HBQB 4J9VA 2V52B 3QIOA 2G08A 1XMOJ 1QVGM 1X4BA 3FYHA 1MU2A 1VQLS 2GELA 1Z4NA 5J2PB 4QIEA 3JQKA 3V7KA 2A2DA 2W11A 2RRNA 2B9WA 2RE2A 1RT7B 4MQ3A 4PG4A 1HIWA 4P4PA 2OI2A 2C3YA 3POTA 2XEXA 1T9VA 3C15B 2VC1A 3M6WA 2VA3A 2YY3A 4JI1J 3GV5B 5L1MA 1OY8A 1Q53A 4LSLB 3T6JA 4FNIA 2PSZA 5GMDA 4BQLA 2LM1A 4PZNA 4OMFG 2HHSA 3SQIA 2E44A 2D74B 1BHNA 1DLOA 2QA4S 2FYXA 1HMVB 2Q3PA 4U9RA 4KHRA 4ZCMA 4LF8J 1DAXA 1Y00A 2VWBA 5KL1B 3N4WA 4N7TA 4PWDB 2ASLA 3NH2A 4CGIA 2IHMA 3RJGA 1F5CA 1AQ6A 1FE4A 2WFAA 4BG9A 3HO1A 3D6JA 5AI8A 4AHRA 3WNEA 1R31A 2LCWA 1MMNA 3AB2B 2B9XA 2GHWA 4IH7A 2DHAA 4C1NK 4LF7F 2MKKA 2YQ0A 4FYXB 4BE1A 3HILA 2G13A 4DFPA 5ETMA 1UT5A 4YD2A 4L3QA 1OMSA 4OZ5A 1YUWA 1EO1A 4MDAA 3BGOP 1EWRA 1ROFA 3HLUA 1LV5A 1MA9B 4AE5A 3KD1E 1O51A 2V7YA 3SYZA 3MWPA 3D4JA 1ILYA 4CZFA 4USWA 1OVYA 1Y5IB 1H74A 3CIZA 2NO4A 2W2OP 4DCJB 2OD6A 4B3SK 4Y2QA 3D2SA 3F2KA 3THXB 1J5OA 2CGLA 1U2FA 2ERRA 5KT6A 3AVKA 2BTFA 3M2UA 2BKNA 3D68A 1QQ6A 3FK4A 2OMLA 4WU2A 4WE1B 4HUEA 2VQEJ 4NXMF 2YWGA 3KIOA 2GHPA 1RAAB 4ZVPB 1XR7A 4NLQA 2O3DA 2V0NA 5J0PA 3CO9A 2VWJA 3FCVA 1FNXH 4EBCA 3ZEUB 1JL2A 1K8KA 1JLAB 3HP6A 1H0HB 4BROA 4M04A 1RWUA 2G0CA 3O5TB 3DNCA 3SQGA 2KFYA 3PEJA 3BBBA 1YBUA 1DRGA 1Q79A 2VBWA 5DZ6A 3PRVA 2IA0A 5J0XA 1DRZA 3WK5A 3NRWA 1ZJMA 1UTAA 3SSRA 2NSCA 4CF1A 1R8BA 2QL7B 4I2CA 2Y1JA 2GVDB 2HKEA 4Y3CA 2FI1A 4YS2A 2W7OA 1LK5A 5AK6A 3FZMA 4KN4A 3EGNA 4HI1A 2HYIB 1QQ5A 8ICCA 1WCLA 2YPZA 4RL1A 4B8CA 5J2PA 3ORYA 4IL6U 2BJ1A 1WF2A 3RH6A 3MMVA 3A3OB 9ICGA 2CG8A 2YTUA 3VAGA 3QU7A 4FPIA 2V68A 1RT7A 2ZJRL 3QICA 3C15A 4Y2KA 2G8IA 5BYSA 3MM8B 7ICLA 3EXYA 2CNLB 1RTZA 2OA8A 5A2QU 4NA2A 3PKYA 4LSLA 2DKZA 5IC6B 2UXCJ 4Z6EA 1VMBA 4Y2CA 1T9XA 3UD4P 2X6SA 1RTDB 1HMVA 1RAEB 3BSAA 8ICUA 5IIIA 4QWEA 5J2CA 3JPQA 1YJ9S 4PWDA 1HKGA 2JZ5A 2XSFA 5ETPA 2UXBF 2FZGB 1H6KX 3EX7B 3DRPB 2EQYA 1V9OA 4ZJQA 2MZ1A 2ASMA 3NGSA 5LL6Z 2F3NA 1BQMB 4A2BA 2YHAA 1QSYA 2ZUAA 2EG1A 3C6TB 4FF2A 4WF9Q 3CM5A 1A0PA 4LBPA 4UW9A 1Z00B 3N4MB 3BQ2A 2QSFA 1MG7A 1NEEA 3IC1A 2O66A 5GAHP 4RQNA 3THXA 2ZF5O 4UOCA 1C0TB 1BMQB 3BDPA 1D0EA 5L1JA 3JPSA 5KFNA 2BJEA 3ZFVA 1IKYB 3DN9A 4KAIA 1WNSA 3MN5A 3OTBA 5IWAK 4LF6K 4G1PA 5M1NA 5KFQA 4P2HA 3G86A 1QD1A 1RE1B 2LEBA 4WE1A 3IBFB 4H8KA 5HRPA 5AM5A 1RHUB 3M8ZA 2KFNA 3QRPA 5B08A 3P38A 5AI0A 3ZEUA 2LQBA 2LXIA 3ZX0A 1JLAA 4NE9C 1BI4B 3ZYYX 3THWB 1PZNA 5HQMA 1X4EA 3ZNJ1 3A5OC 3QB0A 3FUYA 1KVKA 2G09A 2CJYB 4CHPA 1UJ6A 2HOEA 1SPBP 7ICSA 3FVYA 1OH5A 3RJEA 1TAUA 2FJBB 2YH0A 4JV0A 2B56A 2CRLA 4DV2K 5DDQC 5C25B 4F4YA 2OWOA 2GVDA 3D54A 3CJTA 2HZCA 4JKBA 1UCNA 3VQ4A 2HHWA 1IBMJ 2DTUA 5LMUF 5AM0A 1SQFA 1I3AA 5EU7A 4K4WA 2F44A 3NVZA 2W7AA 5F8NA 5H9FJ 2QWQA 1RHMB 5KGWA 2D41A 3CCSS 3NY0A 4AFFA 4MMOA 4YOXA 2YNFB 4WYBA 5F8LA 3MM8A 3VGTA 4DR2K 4CJTA 1KEJA 2RRBA 4PWWA 1RTDA 2E7VA 3S6JA 3NG8A 5AQGA 1KVAA 2JNJA 1EIYB 4DR3F 3K75D 3VQ5A 4O0JA 2WHOA 4YDUC 3R27A 4IFVB 3RB6A 4DR5F 4LR7A 4QYZJ 5AQYA 4YG2A 3BKFA 1GMWA 2P8IA 3DRPA 2KNJA 2KH9A 2EAOA 2Z2ZA 3TAQA 2B4JA 3IWLA 1JLCB 1M5PC 1T4GA 1ZBLA 1BQMA 3EKUA 3P83D 2HG4A 1UPPA 1JI7A 3AQPA 3R97A 2E8PA 5U47A 3AHPA 3C6TA 4P2XA 3T1HK 1IG9A 1R8PA 2EFNA 1X42A 2W8KA 1Z00A 3CCES 2XY6A 1R43A 1JNRB 4AH9A 1JUDA 4DZ6A 2VHGA 1REVB 1HWJA 1RHKB 4U95A 3RTVA 5AQQA 4Y2MA 4FDFA 3BN4A 1C20A 1C0TA 1NDPA 3IP4B 4RPYA 1IKYA 2EVZA 3JSRA 4GV3A 3H0PA 4USVA 3F41A 5AQMA 4A8XA 1N33J 3WZ0A 3SPZA 2L3MA 1HJPA 3OYFA 5T14A 1HA1A 3PHEA 3ZZPA 3V6JA 5DZ7A 3QBXA 3HRGA 3MPDA 3BBCA 5HK4A 3MGHA 1OKJA 1N32J 3VQTA 3WK9A 2EFQA 4GO7X 1BI4A 1O8BA 3THWA 1XEZA 4JI2J 1XR5A 2Q66A 4LFAK 1PBUA 2I2YA 4EEKA 1LOTB 2CDQA 4DTXA 2RNEA 3H0RB 3FZLA 3H46O 5C25A 5FP0A 4ZPCA 3HHLB 1HPMA 3C1ZA 2HFUA 3AJDA 2XG8A 2HGNA 4GY2B 4FXVA 3FGVA 3K2YA 4MKVA 2HGLA 3PTWA 1LWFB 3MR2A 1VC0A 3JS6A 5KQ8A 4CJ7A 4X65F 2FLOA 1EZZB 4CFDA 1X9WA 2VBZA 1TV9A 2P5OA 4DL3A 1MMDA 2F3JA 2HK2A 3Q86A 5L9NA 4WTYA 2R8HA 2B8PA 1U0HB 1SJ1A 4DUTA 1FTRA 4CD1A 1ZD2P 2WVBA 3VN5A 5LM7E 4NWIA 2JVOA 2BM0A 4DQIA 5KFKA 1AW0A 3J7ZO 4ED0A 3EE9A 1OH8A 2WBNA 2CFXA 4MO4A 1OPZA 4URSA 5CCMA 5DBBA 3VQSA 3GL1A 3MD3A 1IQZA 3R5CA 4Y2SA 1YBAA 2K89A 1NMDA 4IFVA 2DNOA 1S76D 4Z0UA 5JVGQ 2HHTA 4ZLPA 4BC9A 2K06A 2QI2A 1VLYA 4G9ZA 1PBAA 3LDSA 2JC1A 3AQOA 2Y0SF 4FF3A 1TAQA 3W8GA 1L8LA 1LVHA 1NGBA 3CFOA 1UEUA 4WJ3B 1Q81O 1BWFO 3I28A 2IVFB 1HYSB 1IQTA 5KPTA 1D9FA 3BN7A 2XVTA 3CT9A 2VIXA 3D2WA 3WU2U 3OUYB 3E51A 3JPPA 4LF4F 1W2BM 5JICA 4RWWA 4V1Ak 4C8KA 5KFBA 3K5OA 5GAHI 1REVA 5C0YA 3MEEB 1RP5A 8ICHA 2EBEA 1UW9A 5HVFA 5D0RA 3H7HB 4IOAL 3PVXA 4QPTA 3DYAB 4MIWA 3W2WB 4K4VA 2E1PA 9ICMA 1U1KA 1EKRA 1FI4A 3QUTA 3OHRA 4LR8A 3ZDDA 3I96A 4BC4A 2WAQF 3CW2C 1PJ5A 5AZIB 4NASA 5LL6d 3A0BU 3SPYA 3CJAA 1EB0A 2VOPA 3ZTOA 5L9XA 2BW7A 5LY3A 1XS9D 3I55S 2I38A 1KP6A 4NL9C 5CH7B 1T0TV 2WW4A 3PJ9A 3ALYA 5AKHA 1KAXA 2ZGZA 5KFRA 4H4MB 3SQ4A 1CC7A 2H3GX 5C15A 4NLSA 4FPBA 1NLKL 2CQ4A 3L3CA 2K60A 4M41A 1SQKA 3O9UA 4R66A 2MY8A 2E5LJ 1WSVA 3V81A 1BIZA 1VSLA 3WBZA 4ECUA 1EX4A 4UB4A 4DCPB 3HHLA 1TFWA 3ETMA 4CH7A 1ZBIA 5ALQA 3ZLJA 4I2GA 4LF5K 8ICTA 2Z0GA 4USMA 1I6JA 5HL7Q 2DR9A 1X4FA 4FXWA 3WQPA 4DV1K 2BCUA 1KSPA 3WKAA 1LWFA 4JI0F 5LXRA 4M9JA 3E01B 3EXCX 4DL0C 3L7UA 4OLPA 1F9EB 3UCGA 1WC0A 3QJLA 3K9JA 2VFRA 3OW2M 2HBRB 2Y1RI 5AKJA 3D0HE 4UBBA 2DFHA 3R2DJ 5E2QA 2DGSA 1EP4B 2DRBA 1W26A 4LFBK 4GNIA 2XNQA 1U0HA 2GOLA 5DO2A 1NHUA 4USTA 4HI2A 3QETA 3TRGA 3GPAA 1MC8A 2LP4A 5BRFA 2ILZA 3THVA 2ZKUA 3N6NA 1CXQA 4NLVA 5DQGA 1DQ9A 3VAFA 4I7FB 1RB0A 2LQ9A 1S4EA 2I1RA 2GJ2A 4NLYA 3QNOA 2QEXN 3E9PA 1FO1A 1JLBB 6FDRA 4DTPA 1HUXA 2G4BA 4I0WA 3IDWA 2XZTB 1FVQA 3LK9A 2SXLA 2AWZA 1ZS6A 1BOTO 4P4OA 2D6FC 1VQ6N 4DV3K 1BCMA 1SXLA 3JPTA 3DDHA 5KFMA 3M7VA 2M7SA 3VQQA 5J2NB 2H54B 3EGVA 2F96A 4B9TA 4BRPA 2AP6A 2KJ9A 3MAHA 5JTIA 1HYSA 1L3VA 3NS7B 1PYOB 3SUOA 2QJ3A 3KWIA 2HFOA 4OJ5A 2IY5B 1S6QB 3K8VA 2XMKA 3OUYA 3RB3A 4E7KA 4NOHA 2Q1NA 3CETA 2RUSA 2FHJD 1OQ3A 5DB9A 4PGXA 4X4OA 3MEEA 1IUJA 4Z6DA 3MXJA 3W66A 4WZMA 2ZQBA 3BPDA 2BYCA 4GKKK 1UL3A 1Q8LA 4GKJF 4F7VA 4QZCA 3DYAA 1EJ7L 3ZTPA 3W2WA 4DDFA 1PILA 4C3MA 2P6UA 2H5EA 5HI7A 2FLPA 5LJ5Y 5DG7A 4B1ZA 4Y2RA 1WI8A 5ALTA 5FROA 5AZIA 2VCPA 3OTCA 4X4SA 2GLEA 3C19A 1SH0A 4NLCA 3PZPA 3O1BA 1GMVA 1FXXA 8ICKA 4HEA9 2MSTA 4BRMA 3J7ZT 3M9MB 1YZ6A 5KI6A 1S1UB 4V19S 2GIFA 2KRRA 1GOAA 3RJKA 4H4MA 1P9YA 1I94F 5CJ7A 4FYDA 3TZYA 1YJVA 1TKZB 1U1RA 3F73A 1C6VA 1U04A 4JI5F 5KG2A 3SLCA 8ICGA 4F93B 2C3UA 4PKHA 5ALJA 5A6WA 4CFCA 3UQ0A 2XMUA 4YFKA 2CQHA 3LP3A 3OTOK 2J7KA 3E01A 3RJMB 2XZDB 1BVSA 2JDJA 3KBBA 3MABA 3AVNA 3LDAA 1YJTA 2OGUA 2RS8A 4ILLA 1NO8A 1N5VA 4EZ6A 2KMDA 3NF9A 1Y88A 2CGKA 1EP4A 4CH1A 4CBWA 1A76A 3AOAA 3TJ9A 4QIVA 4IDHA 5GIPA 3RFAA 4H0YB 5L38A 3ICLA 5E3CA 1R89A 1ZBHA 3PV8A 4NLDA 1TL4A 2WF7A 1RXVA 3WC2A 4NLNA 5A8RB 5IT0A 4LF8F 2KP7A 3AO1A 4DU8A 2H3ZA 4I7FA 2LM4A 1SQEA 2NO5A 3HVAA 3EJMA 4K7QA 4L73A 1Q8KA 1JLBA 4Y2XA 5FRNA 2D1KA 2VJUA 1FW6A 2PIIA 4P0PB 2KYXA 1ASVA 1MNEA 2UUWA 1XNRK 4P2MA 3H5YA 5AJ3K 2ZD1B 5EY4A 3J7A1 1X7VA 4Z2XA 4LIWA 3K57A 2VL1A 3NS1A 4DUZJ 2WB1D 3GG4A 3HVRA 4RWTA 1HI0P 5J2NA 4FS2A 3WDOA 4E98A 1IBKK 3SMPA 4OZ2A 2Q0UA 2JV3A 3O3HA 3QSYB 3DMJB 1VQPN 3HVTB 3BKTA 3CJ0A 2Z56B 1S6QA 2W9MA 3CI5A 4DR4K 3V7JA 2NLXA 2O8EB 5E3RA 9ICOA 2FGOA 4YOYA 3SAFA 5GADU 1WHVA 4BLGA 4FFDA 2KVSA 3MXMA 3BP8A 4NWBA 3OYHA 2ESEA 5KQDA 2R2TA 4PEOA 3PSTA 2OANA 1WF1A 4CLFA 3S6EA 1HKAA 4C8NA 4AHVA 2YKNB 4MK9A 3HI0A 2VQEF 3TARA 2MKCA 1JROA 2UUTA 3PW7A 7FDRA 4DR1F 2HHPA 1TUWA 5IOLA 3HKZC 4TLRA 4UAZA 4DL6A 1NSPA 2DGUA 5ALGA 1HD1A 3DOKB 2FBTA 4A2AA 1RT3B 1S1UA 2W9CB 1TU0B 4W92B 1JX4A 4OYMA 4P74A 5KG6A 3I9ZA 4U7UD 1FXLA 3ZCMA 1TKZA 3KFUF 5DGAA 3IAYA 2K4IA 3O1WA 2KJ5A 1UAXA 4C4TA 3A0HU 4RQ8A 1RWWB 1NK0A 4DN0A 5IFMA 1UZDA 4BRFA 2EZYA 1GTEA 1FJGF 2R3VA 5BRDA 4CHQA 2ZZMA 3K0JA 1XHZA 2PE8A 2LI6A 5A8WB 1RDWX 3SCKE 4DI6A 3THPA 1NZPA 1NGHA 2NXNA 1KEKA 3KKAA 3BF3A 1RDUA 5HATA 2QW9A 3W0LA 4OHXA 4ED2A 1HBMB 4WYWA 2C2MB 3DDKA 5ETLA 4CIGA 3EWGA 4GC7A 1S6OA 3WX4A 3CJBA 3QUQA 4O5EA 3V72A 4ZOSA 4KHQA 1VQ9S 2UXCF 3MK6A 2NRVA 3L9ZA 2XS5A 4KLQA 3UNYA 4G1IA 4B3TJ 3U3GA 4KLUA 2QB1A 3SEOA 4IBNA 5A8RA 2V8GA 4HWIA 4B1YB 1KD1O 3GFZA 1B9DA 2VJ4A 5HNKA 3KWMA 2EI5A 1KHVA 4I29A 3K1RB 1OY9A 1ZQPA 1FEHA 4M63A 3UR3C 2YNIB 3IGNA 5BR8K 2HS4A 4P0PA 4CJKA 2ZNZA 3TAPA 1GEHA 4FXDA 3OYKA 2ZD1A 4XO0A 3IN5A 4M3YA 4WFAL 1VSHA 2HF3A 3Q0AA 5AKXA 5D4LA 1MDUB 2VPXB 3KG4A 4I2HA 3UD3P 1QH9A 3PLAA 2ZEJA 1X2IA 1XTZA 5GAGP 1XK8A 3VTHA 3HJEA 3CE8A 1I5OB 1NBWA 3DMJA 3T5KA 1GTHA 3HVTA 4GLXA 4WFNQ 1ZM3A 3CCWA 2IDLA 4M8LA 2VA2A 1SXEA 1OIAA 4ZH4A 3H6EA 2GMLA 7FD1A 2O8EA 2QL9B 3MR6A 1XNQJ 4BDZA 3J80O 2PT0A 2B4PA 2YKPA 5DDYA 1NBEB 3R8EA 4I1TA 4EZ9A 4CJPA 4X64K 3J80U 4YVZA 1IM4A 3M6ZA 1YG0A 2KYZA 1X6IA 2OSQA 3S41A 1UP1A 2DGWA 2YKNA 2GO9A 3RJHA 1FRJA 4KN7A 1ZQUA 4K2XA 3KDNA 4NLXA 5J0RA 3QGHA 3DOKA 3G2XA 3AAPA 2E6LA 2GQ2A 1RT3A 4NRTA 4TY8B 2OH2A 4Q43A 2CIMA 2W9CA 3KJVB 1HNWK 1K6YA 3LPUA 2ZGYA 2OM6A 2C2ZB 3AN1A 3EVOA 5ALRA 4E7HA 3W9JA 1HNZJ 5C5JA 3BQ0A 3O6QA 4ENOA 3JPRA 2RQ5A 3HRDD 3MN9A 1IBMF 4JHDB 3TADA 2LXFA 2E2QA 2CZ9A 3PNIA 1HRHA 2X78A 4ID5B 3B6PA 3N4QA 4JKGB 5A8WA 5GINA 3DV9A 1MA7A 2K3KA 1Q82T 2VPWB 1JJ4A 2B9EA 4ZIWA 3BEGB 2W4DA 1YJNN 2R8IA 3IKMA 2IRUA 1Q9YA 5KFCA 4DTJA 1HBMA 2CNNB 3DLGB 3IRXB 4YMNA 3H40A 4CK1A 1S48A 2WSCC 4JYAF 3FBCA 3M6UA 2HI0A 3T6BA 3CDBA 2E7WA 2GAGC 2V4JB 1QQ7A 4FJ5A 3SMZA 2NYHA 3KK1B 3TUIC 1KBUA 4BACA 2WVCA 1F60B 3R6MA 4ANCA 4XH1A 3VF2A 2JEFA 2ADBA 4KRWA 4QZDA 2UUAF 4BR7A 2QX0A 4F9OA 2DNQA 1ASWA 3FSIA 1ZQYA 1R7IA 1WJ9A 3CVKA 4IQVA 1Z2LA 2YHYA 4FWMA 3DLEB 2OPQB 3TJAA 3HTVA 2VH7A 2HVHA 4R0JA 5C24B 1WBDA 2QKBA 3TA1A 3SSSA 3HJFA 5ALHA 4EP5A 1UPMB 4XK8C 1GX6A 2YNIA 3AV9A 4FPRA 1X4HA 1Q1KA 4TN2A 2G8KA 2G5IB 4J37A 4P10A 4B3MK 2B5JB 4KJIA 2ZM6J 1WKKA 4JI7K 1S72S 2O4GA 1Q5YA 7ICMA 2FY1A 4FWOA 3D2EA 3LM2A 3JTPA 3CJ3A 1S1VB 2H3QA 3MPVA 2GMJA 1N34K 3GYXB 1T6DA 2G1DA 2A5XA 3OA9A 3BR8A 5K8PA 5D77A 2CJBA 2M70A 5J2QB 4EK2A 3AOCA 4ETZA 4GXIA 1QAIA 5ALDA 1VGYA 3THTA 1ZPWX 5JLFA 1U45A 1WC1A 4M5IA 4KAZA 1XNSA 3F44A 2WRMA 3OQ2A 3SENA 4MYTA 4YB5A 4DSLA 1F0MA 1F5SA 2HOFA 4H5TA 3RRKA 5J2KA 1N33F 3CJ9A 5KT4A 5TZVA 1HW9A 2BABA 1B4SA 3CCUS 4U67L 5LMNJ 1ZRMA 4Z6CA 5K8NA 2L08A 4KPCA 3SCIE 3G8TA 4RCHA 4DPOA 4DQ8A 4C4RA 1Z1VA 3MXIA 5HSPA 1N32F 4NCGB 2ZJ5A 3PM9A 3DFEA 4CEQA 4TSXA 4IQUA 1J2MA 4NPOA 4RW9B 5K20B 4JI2F 5HROB 4TY8A 1KD1T 4CLSA 1X5OA 3TZXA 1DT9A 3KJVA 1TGOA 2V4RA 1X1PA 3BS5B 4K4YA 1A5VA 1T9UA 2PYJA 2WF8A 1S97A 3I4HX 2XO6A 3B4DA 4JHDA 1ZQVA 1DHMA 2Z57B 3BB5A 1ZOLA 1HR0J 1ZQWA 3PSFA 2I5JB 4ID5A 4JKGA 2Y0BB 3HD2A 5AE1A 3ZDEA 1CXUA 3P3DA 5JVHL 3L95X 2FSJA 4JMUA 3DLGA 1LQ9A 3IRXA 3KK3B 1U25A 2NXCA 3KJFB 5AICA 1RTIA 4LUBA 2QTDA 2JEIA 3V4MA 4F25A 2V4JA 2HBYB 3O4QA 3M6VA 1HQUB 2HNZB 1TL5A 3KK1A 2ZOMA 2Y8WA 3QFWA 1CULB 3VTIA 3L2VA 4F5OA 4DFMA 2HWIA 5KRTA 4JKHA 1W2IA 2DO0A 4Q5VA 4DUYK 1UVKA 3ZZRA 3DLEA 2OPQA 4ZCIA 5C24A 3MD1A 5KFLA 4KLMA 4X4PA 1HNIB 3LGHA 2F1HA 4PKDB 4BVPA 1M90O 1UW4A 2AEFA 4J2DA 4CFAA 3GG0A 1N0UA 2B5JA 5FPEA 2CJXB 4CVNE 1XU4A 5K9FA 1B9FA 1HPZB 5M1OA 3BV8A 3SXLA 1K1SA 1C4AA 1S1VA 5K8MA 4W90B 3LDQA 2KJVA 5GAGI 5KFDA 4YQWA 1WSEA 2NUBA 3VQAA 4NI2B 2LMRA 4YDDB 4E1NA 5J2QA 3RMAA 3I8DA 2A1JB 3O9RA 4PG6A 1DURA 4CO1A 3KZXA 4NY8A 2ATLA 1FWLA 1DBDA 2J0QD 1X4CA 1QUVA 2MDAA 4DTRA 1SAZA 2DGQA 5AFUH 5ALKA 3WXLA 2NZ4A 1ESVA 4ZP9A 4URGA 4FWNA 4CF9A 5JS2A 1Q86O 1R59O 3G8SA 1RNHA 2QYGA 2EANA 1U6FA 2GZOA 4KGVB 1V4SA 4CZHA 3HSCA 2XLIA 4PPDA 1S9FA 3C3LA 4PXCA 4OKEA 4NCGA 4DPYA 4CLKA 3MUTP 4A62A 3ATVA 5AM4A 4RW9A 1RDCA 3OLBA 5HROA 3OTEA 2QRRA 5BYQA 2IMOA 3OFGA 4K4IA 4RQ5A 2E5LF 3BS5A 1OQ6A 4FLUA 4FZMA 1U7LA 1B43A 3G4SS 1EXNA 2VKQA 1HJRA 2HFZA 1OS5A 4ZA1A 1K73O 5AQFA 2CUYA 1FF2A 4F8RA 2ZG6A 1XMQK 4KB1A 1YTAA 1T05B 1ZQKA 4I2JA 5F8MA 2E1FA 1QZ6A 3CYMA 2KK0A 3PYFA 4F26A 1U1LA 1YVUA 5CABA 3ILIA 3KG1A 3CC4S 2LXUA 4KHWA 1R0BG 2Z1GA 3MPUB 2CADA 4ZPBA 1ZQEA 1UVNA 3KK3A 2FJWA 1S79A 3QT5A 2AJFE 4JK8A 1JWWA 2BPFA 1T3QA 1FDNA 1ZOTA 4YB6A 5KTQA 2G8FA 3NVMA 5CR0A 1NKEA 4OYBA 1WSFA 1JIHA 1HQUA 2HNZA 1APSA 4KLJA 1S4FA 1CULA 4OI0A 5DG8A 2YMPA 5IXUA 4WFBL 1YAGA 1M6YA 5AQJA 5BN9A 3F2BA 3H20A 2OFGX 3K5MA 5HJXA 1PK3A 3I87A 4R5PB 1NCLA 2BH1A 4C0BA 2EX3A 5LOQA 2CQCA 4FZLA 4OPKA 1KFDA 4MYUA 1HNIA 8ICPA 1NNDA 4A61A 3PR4A 1FNOA 1TKXB 3L6QA 2VQFK 2EPIA 1U1QA 3I1YA 2P9SB 2YHBA 2K1RB 5CY4A 1S57A 2HOIA 1HPZA 2DH9A 4F36A 2PBDA 2BR0A 1NGFA 4CZLA 1VSEA 1ZH5A 4ZP7A 5I3QA 2R7UA 5KFWA 4NI2A 3ET6B 4CFBA 2A1JA 1CQMA 1U9LA 6FD1A 4NA3A 3ZC4A 3C8YA 4IDKB 5BR9A 1RQ0A 2ZVIA 5K14B 4B9UA 2FF6A 3WKEA 3G71S 4DKWA 2A3VA 2QLXA 4B9MA 2VJ5A 2A1SA 1S8OA 3SV4A 2UVRA 3OYBA 4AYBD 3LDNA 2KT3A 2E1MC 5E7OB 4C6AA 1Q16B 2FJAB 3BZCA 2ZUDA 1WB9A 2L41A 1UMJA 2UUBK 2IBKA 2P5VA 5DDRC 5B0DA 2PFUA 4BC2A 2FLLA 4NYFA 4YOVA 4AXIA 4MIAA 2FIUA 2K4EA 1IKXB 2V4QA 2M2BA 3Q7BA 1G7CB 4E19A 3ELHA 2CG4A 1KDNA 3SAHA 4LFCK 9ICKA 1BL3A 1VBKA 3HULA 4DV0J 5HOOA 3K7RA 3F9KA 1NM2A 4LVNP 3DM2B 1ATRA 4ELVA 3RMDA 1N6QB 4P75A 3BGUA 4CI0B 4CLUA 4UUWA 1DXSA 4FW2A 2VDIA 3WK6A 1T05A 4KRFA 4HVZA 1CVJA 2E2OA 9ICCA 3CHWA 2RHKA 3SQ2A 4UOHA 1ICEB 1CSJA 5H9EJ 3GSIA 3PX6A 3WK7A 4G9BA 3I5AA 1YIJN 2CNOB 4Y1CA 4FBUA 3W64A 4A57A 1V4TA 4JI6K 3GTYX 4ERDA 3EGZA 1VOMA 2AZ3A 2RRDA 3K59A 1OO0B 4QZAA 4ILGB 3PO5A 4JWMA 5ETRA 3O6WA 1TKTB 8ICRA 3NOCA 2P9IB 3IG1B 3MEGB 2IVYA 2RDJA 1L3KA 3UFCX 4QOTA 4R5PA 4F5RA 2UUCJ 2DNNA 4I6AA 1Q86T 1K9MT 3I4PA 2YJFA 3OPXA 4BS2A 3AA4A 3ZSZA 5LSRA 1E6VB 5MLCQ 4F71A 2FC0A 5JMVA 4NYZA 1WTFA 1TKXA 1OWXA 4DUZF 4FF4A 2P9CA 2V94A 2Y0SC 4WJBA 1VBXA 3BBFA 2P9SA 2K1RA 2QLWA 1GAOA 5CYMB 2ZWPA 2IM2A 2L48A 3HF5A 3RAMA 4K41A 1CLQA 3RJJA 4I6YA 3MC1A 3GFKB 1K8AT 1U49A 9ICHA 2RAQA 4QYRA 3ET6A 1TK8A 1X9XA 1O13A 4A8YA 3WXKA 3K5PA 4YHHK 4PQUB 1B7YB 2ZTDA 3LWLA 3QIDA 1JQGA 2FJ6A 1S10A 1QVGR 2RHQB 4BRCA 1NK4A 1Y4ZB 3AD9C 4IDKA 1N60A 2BHNA 4ALZA 5K14A 3W5ZA 2WAQC 1N0VC 4N77A 3PUFA 1AFJA 2YHXA 3PIOL 4F3MA 3NGKA 4J9PA 1G1XA 4DPXA 2WZ1A 4CI6A 8ICNA 1P6TA 1ZQLA 2MPUA 4DU7A 3SSQA 4QWBA 4QBUA 1PCAA 3CCVS 1IKXA 3I6PA 4W5TA 1VC6A 2IHR1 2Q31A 1TVAA 4IO1A 3V9XA 2AT1B 5EE9A 1RT2B 4QW9A 3HT0A 3VWSA 5F1XA 3IMQJ 4F3QA 3B9JA 5HP1B 2FTRA 3IM1A 1U48A 5I42B 4EBDA 3TANA 2FXUA 1XHXA 1Z25A 3DM2A 2ZH1A 1IJJA 1U2RA 3HJVA 1N6QA 3GIIA 1R6VA 1O6XA 5JUMA 2Q6BA 3JPNA 4YD1A 4YDUA 5AQWA 4KHPJ 2XLJA 5DQHA 3AU2A 2XZWA 3O3GA 4ZS6A 3EPGA 1CJKB 4O5CA 2R8JA 3MM6B 4CIOA 1QAJA 3V1QA 2X1GA 2ZHOA 4M0AA 3NASA 3M1YA 1RZTA 3OYGA 5ITHA 3ETOA 5DM6L 4B3TF 1KONA 3QIPB 2YPYA 3D3CJ 1J54A 3WXIA 1BG3A 2KJ8A 1WC3A 3SBTA 2ZZTA 2BOAA 1TKTA 3WHIA 2P9IA 3IG1A 3MEGA 3QUBA 3R7BB 4DR7K 2E4LA 2NREA 5HO4A 4YMMA 3LM9A 1N2XA 2QA2A 4JP8A 5ETKA 4OI4A 1G99A 2JGUA 4X62K 3E0FA 1RDAA 1E6VA 1JJCB 3CF5L 3GSDA 1FVSA 2NUUG 1KN6A 5MAOA 2NR0A 3TABA 4UZBA 3Q8RB 2DO4A 3ASMA 3VAMA 4Z4EA 3ZZTA 4N56A 3HFKA 4ZVEA 7ICQA 3P4IA 1BWEA 2CQDA 5CYMA 3N7PD 1ZZNA 1GXUA 4B1UB 3AFGA 2LYHA 2Q4TA 2A3ZA 1AYEA 1FX4A 1DOQA 1BA0A 5J0TA 4FP9A 2WBMA 2AQ0A 3AY0A 1NAQA 1RKIA 4PQUA 3SNNA 4Q2LA 3OHBA 2WAQD 3H90A 3AVJA 3QGPA 4KX3A 3THYB 3HZGA 4DL4A 2JR5A 2XWYA 4QOZB 4IYQA 4EHTA 2W54A 4E7JA 5GVQA 3C65A 1A5WA 3M32A 4YUDA 4W5QA 4V19X 3QFUA 3SI8A 4YDXA 2IPOB 3GONA 3CUNA 3F2DA 2B51A 2E8OA 3TSPA 4EFAC 2ZUGA 1VRUB 2I7NA 1GT8A 3I0SB 4BRKA 2NRWA 3GYNA 3MXHP 4AHSA 2DUYA 3CMES 2VONA 3GJSB 1HWKA 2R7XA 1S12A 5EOZA 4WWSA 5EE1A 2FSNA 3AA3A 4PXDA 3CDWA 4HACB 3OY9A 4BRNA 4M3TA 3H7IA 1J53A 5DB8A 2J9DA 3GLJA 1RT2A 2B43A 1GXLA 4U96A 2I5HA 2BGWA 4CZJA 1HNZF 1SWWA 2G2ZA 1VQSA 1I39A 2QWLA 9ICIA 1PC5A 5I42A 1L6NA 4YXMA 3TA2A 2HIYA 1NM1A 4IOXA 2AX1A 2EFGA 2MZQA 2GS8A 4NXNJ 3NUQA 2A0FB 3QSIA 1D9AA 4NEYA 5AQSA 1FRHA 3AQFA 1TTHB 2MQMA 1SB6A 1FDBA 3CD5A 3IXQA 4IS7A 3BSCA 3KKRA 3BR9A 1CJKA 1WSHA 1VQ4S 2VFTA 4RO0A 3GILA 2DK2A 1MQ2A 3MM6A 3L5KA 1RDFA 4LF9K 3N28A 3D0PA 1FXDA 4RPFA 2AD9A 3AJ1A 2IGIA 3FNNA 4FK4A 3QIPA 1UVIA 1R3NA 1NXIA 4CF8A 3P5JA 1PUZA 4CESA 8ICIA 4K2JA 4HHJA 2R2UA 4J03A 5SWMA 2AEJA 4H0VB 5IT9O 2A1BA 2DCUB 4MLEA 2YH1A 2VJVA 1TE2A 3UE2A 3C66A 1GXTA 2A40A 3BUZB 4YY3K 1FFWB 5IT9U 4I56A 2ZM6F 1B64A 2Q0ZX 3HT3A 4DOBA 1Q8BA 4IOBA 2AXTU 4Y2VA 3C2MA 3M2VB 3A8YA 3M05A 2CVIA 4LJMA 4ZOHC 4OZNA 3HPHA 2DT9A 4NL9A 5AQVA 1J2NA 2D3UA 4NB4A 1TMJA 4CM2A 4PHTX 4DQRA 1H7XA 4M2YA 2HHQA 2G0IA 1FESA 2E2PA 2O67A 2VICA 2LLZA 4Q45A 3UE5A 4U7UK 3CCUN 3M2RB 3THYA 5EE0A 2XS2A 1HX1A 2XCAA 4I28A 3GR1A 3OSPA 2BE2B 4BVOA 2KOBA 3NTUA 2Y3YA 2YKAA 3QFHA 3M8QB 3H98A 5LMNF 1RA6A 1YRUA 3ZO7A 2BQRA 4ECRA 1T6CA 4PWUA 3EVMA 3KNGA 3VZIA 3PIPL 1RAFB 4J9SA 1VIOA 1VRUA 2P66A 1RKJA 3I0SA 3HOTA 4P72A 4P73A 3QFPA 2UXBJ 4KHMA 3K5LA 3PFOA 2VU5A 2FZKB 3LQVA 4UY8T 2EK1A 3R6GB 3R3TA 4HACA 3ENVA 1BPBA 3CJ8A 2QE5A 5ETNA 5DB7A 1ZQOA 4YMEA 5I3PA 3O8MA 4DWIA 2DL0A 3KOOA 1VBYA 1C0FA 4TKTA 1T03B 1HNXK 1D8BA 1YZ7A 3CJRA 2E7XA 3D67A 4DL5A 2CPJA 2OFHX 1HR0F 5AQXA 4CH0S 3U9ZA 4IXCA 1NJXA 5HMXA 2J0SD 2HPUA 1WLJA 3AA8A 2A10A 1WACA 4NYOA 3PG9A 2EDUA 3HM8A 2JLEA 4HR2A 4RQ1A 2J4RA 3RJIA 2HBKA 1TYQB 2VV5A 3QZ7A 2VKZG 3MZIA 3M1VB 4K8XA 5DMRA 2DFFA 4FM2A 2JGAA 3PACA 4CLWA 5HRRA 1K0VA 1L7PA 2L9NA 3N79A 3T41A 1SZHA 1Y64A 2DEJA 5IIJA 4JI3J 1X6JA 3P8BB 3WIVA 2GO8A 1OSCA 3WKCA 2BV3A 3UNGC 2G07A 2AZ1A 2H5IB 4CLZA 4CF2A 4YOEA 1RYSA 2YWFA 4FPAA 2FJXA 2QWMA 5E79U 2WB4A 2DNLA 4DFJA 1NDCA 2K2PA 1C4CA 3PEHA 3QEAZ 1L3TA 4YB1P 2HDOA 2HVIA 3J81Y 2DVIA 5EN1A 1N5QA 2HQIA 4XAKA 1AFIA 1JLEB 3H8YA 3M2VA 3IHQB 3X3UA 1NMNA 4HH0A 3IBPA 3OR1B 1JJ2M 3B6OA 2BRLA 3DLLQ 1S49A 2WC9A 3SJJA 5F0XA 1SC3B 3E3XA 1NWKA 7ICVA 4OI6A 4KLHA 3PFEA 2Z30B 1LNQA 2IMWP 2DBBA 4PHAA 4AM6A 1N88A 2R7QA 1ZD4A 1KOHA 2P9UB 2R9LA 3M2RA 1YQHA 5M2PA 4HUGA 2CQIA 5KT5A 3KLGB 2BE2A 1SIWB 1D8LA 5HP4A 2EKNA 1BHLA 1SIZA 2GV1A 3N6LA 1H7WA 4IR9A 4ID8A 3M8QA 4RW6B 2CGJA 3I5CA 4EENA 4GVBB 2YWKA 3I8BA 3MDCA 3UM9A 4I68A 4CHZA 3AXMA 2LSNA 3BS7A 4J9UE 3Q2TC 1BGXT 4CEAA 4LVOP 1Q4RA 4WQ5C 2JJ4D 4NEZA 2HHHJ 1NGDA 3NVWA 2FDRA 5F0WA 2BUNA 3ULHA 4FO0A 3OVAA 2KN7A 1JKHB 3G4SN 2N7CA 2C3PA 4ILJA 1RAOA 2CDRB 1GLJO 2C2DA 4HT5A 2P6SA 2ITGA 1RAGB 3SFGA 1QTNB 3HFVA 2CPZA 1X40A 1T03A 1S0NA 1ZQGA 3BO3A 4A8WA 1B0PA 4F04B 5B0EA 5AK4A 4PPXA 1RWKB 1KTVA 2G2OA 2BCRA 1JCFA 1OUQA 2ZH6A 5DETA 2OTLN 2AV5A 3R9PA 5L39A 3GIRA 2VWKA 1QAXA 4O44B 4X4NA 7ICGA 3CQ8A 3D45A 3QU9A 3UDCA 4KC5A 1LW2A 3AL0B 4O4GB 4XDDA 3UI3A 5CD4H 4OPHA 2KB2A 2P5GA 3OSNA 3FZBA 1W25A 1TYQA 4ZKAA 7ICTA 3TX8A 3M1VA 1P8GA 4PL8A 4BG8A 1GO3F 2F8SA 1HLUA 2IDOA 3AVAA 1IBLK 3EZOA 1IO2A 1FE0A 3BSNA 2WVEA 4ITSA 4H4OB 2O8CB 2BCSA 1X4AA 1SQGA 4RQ2A 2G8UA 4OLOA 5DQIA 4LF1A 4CRXA 3GYGA 4ER8A 1TL3B 1RBSA 5J2MB 3KKSA 3NGYA 2ZNYA 3TUZC 2QN6B 3ENQA 2XS7A 1N36J 4NX9A 3F56A 3I32A 3D9BA 4RZRA 5MLCV 2F1JA 1IN0A 3V1RA 1QCKA 4K4TA 4PZOA 1PSDA 3Q22A 4QZHA 1JLEA 3PW5A 3OR1A 4LRBA 5C2GA 3VR1A 1ULRA 3EZWA 4K4ZA 1XC9A 1PVPA 1ZQQA 2DXEA 2NV3A 4F0HA 1WDDA 1CS4B 3KWGA 3Q8LA 1K47A 2OPSB 3GP9A 3J8AA 5KNIA 3NKYA 3G71N 4OJHA 1F44A 2CPDA 3IO1A 1IIPA 3QMQA 1UAWA 2HS0A 1QY7A 2ZBRA 4OLAA 2ZBIA 3H5UA 1SVDA 4KYZA 2ZIWB 4IRCA 3FZKA 2JHEA 2PY5A 4A5AA 2DD8S 4B1XB 1SV0A 4DQSA 4RW6A 4ZVOB 3NE6A 2G9OA 1VLBA 4GVBA 2QWNA 4FJJA 4O4RA 4KTWA 1GLBG 4JV5J 3D2QA 9ICWA 1HI1A 5TKYA 1NNLA 1HJOA 4K4SA 1FFVA 1YDLA 4DR6J 2M4MA 4NLGA 4JI4J 2RU3A 3RYLA 1ZQAA 3TR5A 2HQFA 4GXKA 1JLQB 4NYPA 1N5SA 3S3NA 5F8JA 4Z4CA 5C12A 4FVUA 2DY1A 4DV0F 4JAXA 3O9TA 4K43A 5BPLA 4IWVA 5ETSA 1S0VA 2YNHB 2M3DA 3MWBA 2VBXA 1HKCA 3CRXA 5ADZA 4ISEA 1YXQA 3R7NB 3LA0A 3UQSA 2HS3A 4LF7K 4JI8J 1T95A 5DDOC 3LALA 2LYAA 3DXKB 5G4DA 3AUOA 4W5RA 4C4WA 2PGCA 4O44A 4O0IA 4US8A 2N82B 4O4GA 3QPIA 2AIRB 3FSYA 3IDHA 3FZFA 1SCJB 4UB1A 3QBCA 5CE3A 4CWBA 1J5EJ 5J29A 4DLEA 1GMUA 2EAMA 2HFVA 4YCXA 2QT7A 3CDAA 3TUJC 2J6SA 2PAVA 4YFUA 4OX8A 4H4OA 2O8CA 1VJQA 1RM6C 3ZSWA 1HEKA 1CZBA 4Y1DA 2UUCF 2UU9J 4BY9C 4FJXA 4LF2A 2V9KA 1TL3A 2WFBA 5J2MA 4IQMA 3HXMA 3P5TL 3SQ0A 1L5UA 3CC2N 4DQPA 5E3AA 2F8MA 5F3TA 4BHQA 8AT1B 3HWTA 3Q7CA 3UDEA 4NXMK 3LP0B 3J7AP 3NEKA 5FPMA 3EUNA 3I76A 3ZD8A 4RUAA 4CZGA 4MDBA 4CJ5A 3ZX3A 3IBWA 2EFPA 4ZPDA 4W98A 1VSIA 3F5EA 2UXDJ 4WXWA 3HX0A 1VSMA 2E1ZA 2AP1A 3HSTB 7ICHA 3IM8A 4BQZA 1HHQA 1RWXB 1CS4A 4ZIVA 1H2UX 3AVIA 4RUBA 5G5HA 4ZP6A 2OPSA 4DPWA 2GUIA 3CNHA 2JC0A 3ETRA 4EWTA 1WAJA 1TUGB 3CCQN 4WK3A 3MGJA 1VDHA 4WCEQ 2RB7A 4Y2UA 1YJ7A 2KIWA 4OYWA 2IM0A 3FRZA 4TUSA 2KXHA 2ZIWA 4IKAA 4MT1A 5KPZA 2J6UA 4LRAA 1WEYA 1N8RO 4G6VB 3HSDA 1FA0A 3KK7A 1ZQCA 1AZSB 3H2LA 2AA4A 3HHEA 5D4BA 4DSEA 4OIXA 2Z2MA 3NHGA 3R2CJ 3LOUA 1ATSA 4ILRA 3CCVN 2F8KA 2AJ4A 4TYBA 1XIQA 3VAJA 3QJJA 2RMLA 3MDAA 2JEGA 4RQ0A 3M8YA 5KG0A 3DAWA 4J9OA 2QEXS 1GK8A 3MEDB 3K0SA 2HMIB 1BPYA 3PO4A 2DY9A 5K4LA 1S1XB 5G0RB 1JLQA 2XMTA 3C6AA 2OELA 2QA1A 4I2FA 1PJ7A 4MH8A 3QT8A 1VQ6S 2YI1A 4WIIA 2BM1A 2V67A 3EE8A 1HHSA 4IFEA 3VQBA 4OV6A 2YNHA