3PX6A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (tautomer) in closed conformation
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px6A01
4RQ3A 4G1QA 1S1XA 1RT5A 4J9KA 1JLBA 4K4HA 3L3VA 1S6PA 3SV3A 2NUBA 1VSDA 4B9VA 2OZMA 4I7FA 5CZ2A 4UBCA 5D46A 4O5EA 3M8SA 4J9SA 2P6RA 1SL2A 3JPNA 1EXNA 2W9BB 3TANA 1ZBHA 3NH2A 3DOKA 2HNDA 2V4RA 2EX3A 2BPGA 1ASVA 3MXJA 1H38A 4R64A 4KFBA 3RJJA 2FMSA 4QZDA 4M04A 5J2KA 5CY4A 3T5HA 5IIJA 3KKSA 4I2FA 2E4LA 3AVHA 5T7BA 3PR4A 4ED7A 4HHTA 3AVCA 1S76D 5J2QA 4F4XA 1EKEA 2G8WA 3TFSA 2P51A 5DG7A 3AA5X 2Y1JA 3HW8A 3C95A 2VA8A 3V4IA 3LWLA 4DS4A 2G8FA 3ALYA 1NOZA 1ITGA 4OKJA 3O3HA 1WCLA 1QHTA 4CEDA 3L3UA 4LY7A 2QKKA 3V9SA 3RJHA 4E19A 1NJWA 3SPYA 1BL3A 5J2DA 1KTQA 4HCCA 2F8TA 3RB0A 4UAZA 1EX4A 1VSMA 4DL5A 3SI8A 1LW2A 1CXQA 1XHZA 3NTUA 3B6OA 5KFDA 4AHRA 2QXFA 4DQSA 1C1BA 4RT3A 4TUPA 4Z6EA 3VN5A 3AVNA 1EETA 1L3UA 1R0AA 3RB6A 3PV8A 5C5JA 4UAYA 4J9NA 2O4IA 3DRRA 4C8NA 1WSIA 2B4JA 3CYMA 4IRKA 4DQRA 4Q8EA 2ISPA 1J54A 1BPXA 2DFLA 3LK9A 2BR0A 1MSWD 3KLFA 2OZSA 9ICRA 5CJ7A 3HYFA 4FK0A 4ZHRA 4NM2A 4NLGA 2IA6A 1C6VA 4F92B 5CHGA 5J0TA 1L3SA 3V1RA 4I2DA 2MUTA 3FFIA 3EPIA 3K5LA 1ASUA 3F73A 4OKEA 4HUEA 4IRDA 4ECSA 5J2JA 4QZ8A 4DF4A 3AO4A 1DTTA 3LP3A 2AQ4A 1BPZA 7ICMA 4QW8A 4JUZA 1ZJMA 5SWMA 1T3NA 4OVLA 4QZAA 3HJFA 4I28A 4ZTFA 1VSFA 1ZQUA 4RPXA 1UT5A 3RMAA 3NCIA 2W8LA 1QE1A 4EP4A 3ZCMA 2P5OA 3TAGA 4J9QA 3ZSYA 4OGCA 4M9JA 2R7YA 4W5TA 3KHHA 4KLTA 4DOBA 3SJJA 4YMNA 2OYQA 2ATLA 4DG1A 3MEEA 3LPTA 4O5BA 4BXOA 2F96A 4YQWA 4DL3A 3ZT2A 3MXMA 3RJEA 3PMLA 8ICSA 3ISCA 4DO9A 1HJRA 2W9MA 4GXIA 3RRHA 4F2SA 3DLBA 2VG6A 2BCRA 4YVZA 1C7YA 4IG0A 1UAXA 2FPLA 4Z6DA 1VSIA 3WNGA 4B8CA 3NF9A 4H4OA 4FZYA 3RWUA 5J2NA 4FK2A 2XCAA 3O3FA 1A5XA 1LAWA 1NK7A 3V72A 4LZGA 3PX6A 4NXZA 9ICMA 2FPKA 1HYVA 2I5JA 3JPRA 8ICBA 2ASJA 1RZTA 2XC9A 3E01A 4F5NA 5DBAA 2PFNA 4ID1A 3FDSA 5KFOA 3PW2A 5DQIA 4CEZA 3K59A 3MFIA 2YKNA 4FM1A 3C94A 4KLSA 3D0PA 3MAQA 3SCXA 5KFPA 8ICEA 3TQ1A 4JRQA 1ZQXA 5F9LA 2AGOA 1X9WA 4AHTA 3ZDCA 3D45A 1CZBA 4O4GA 3OYIA 3SUNA 5KG6A 2P6UA 1SV5A 1L3TA 5BOLA 5C25A 3VQCA 4JV0A 5J0YA 1N5YA 4ELVA 5DGBA 1SKSA 3JPSA 4CJLA 1NJZA 1ZQLA 4RW9A 2BDPA 5DLGA 4EP5A 1ZQVA 2PYLA 3K5OA 5L1KA 5DDYA 1RT7A 1B92A 3OYCA 5IILA 2BKEA 4M3UA 3IS9A 3PNCA 2C28A 2W42A 4RUAA 4HYKA 4K4IA 1ZQMA 2XY8A 2YNFA 4LD0A 2MAXA 5HNKA 2KTQA 2XCPA 3SYZA 3KHGA 4ECQA 4OLAA 1Y97A 1C1AA 3HK2A 2UVUA 4P4OA 4O9MA 4O3SA 1CZ9A 2OWOA 3AVIA 2C2EA 3VQ8A 3PO4A 4BXOB 3M8QA 4L8RB 3NDKA 4J2EA 4CEEA 2XO7A 1MQ3A 1S6QA 3HVTA 3O4NA 3OJSA 4DL6A 5J0UA 2B6AA 4J9RA 1S97A 4Z6CA 4YNQA 3TAFA 3VA3A 5E41A 4GXJA 3U6FA 1A5WA 3OSPA 4BDPA 2IOCA 4KLMA 2BANA 3EPGA 1IXRA 2G8IA 2JEJA 4CK2A 3MDAA 4AHCA 4PGXA 1JIHA 1C0TA 1U48A 3H4BA 1T05A 3DLEA 3TABA 4M0AA 4TURA 4E7HA 4AH9A 4O3NA 1ZQIA 1U9LA 1D8LA 2LSNA 2FLPA 1TVRA 4CESA 4H4MA 3IHQB 2OPQA 3QEXA 2D0BA 3L2UA 3NGIA 5EWEA 3RR7A 2YNGA 3MABA 5KFQA 1RT4A 4R8UA 1IKYA 1BHLA 3ZT3A 4ECRA 2V9WA 3C23A 3AO2A 3QETA 1SKRA 4RQ1A 5IIOA 4E7JA 3ISNC 4I29A 4ELUA 1Q8IA 7ICSA 5J2CA 3VQBA 4OPKA 1SL0A 2YNIA 4E3SA 1NJYA 4BE1A 4DMNA 2FBTA 3DLRA 4YR3A 4ED6A 3O4QA 4ICLA 5CZ1A 4FO6A 3HM9A 3ETLA 4KO0A 7ICLA 1BQNA 1ZQEA 4B9LA 4RNOA 4I2EA 3NH1A 3Q8LA 4AILC 2X6NA 4BDYA 2M9NA 1X9MA 4ZH4A 2Q3SA 4DOAA 4QZCA 4OKKA 5KRTA 4HUFA 4QOZB 3IG1A 3KTQA 3N97B 2C2RA 4M3YA 5J2BA 3H8WA 1EP4A 4KHYA 5DB9A 1UWBA 3VQ6A 3NE6A 3NGDA 1ZQKA 4F93B 4IQWA 1NK8A 3OYBA 1IKVA 1XHXA 4EBCA 3OYLA 4J9OA 1S9GA 3RBDA 1T8EA 3ISDA 2BGWA 4QAGA 5L1IA 4I2QA 5I42A 2BCQA 3LZJA 4CEBA 1RDCA 1MC8A 3ZD8A 1KRPA 4CECA 5HRSA 3QEPA 8ICKA 4CJ3A 4CGGA 2Z1HA 4FLXA 5HLFA 1ZQTA 2J6TA 4M2YA 4B9SA 2D0CA 3ZSWA 3MR5A 5DBBA 1TK8A 3RB3A 3AU6A 3VQ4A 1BCOA 3TWHA 8ICYA 1U45A 3V81A 4YN4A 3GV7B 2F1HA 4JK1A 4FJGA 1JLFA 4FLWA 3P1GA 3HWTA 2YKMA 1WCNA 4RPYA 5J2AA 3RB4A 5CYMA 1KDHA 1X2IA 4RT2A 4NLKA 1TKZA 4NCGA 1QQCA 8ICLA 3LAKA 4FK4A 4Q0BA 4BDZA 1ZQFA 4R8UB 3K58A 1RYSA 4OJRA 2OPPA 3ZSOA 5D4BA 2IDOA 3QESA 2GV9A 1Z00B 2HHUA 4LH5A 4I2IA 4DFKA 2HVIA 4QWDA 1KFSA 2G8UA 5J0PA 4YMOA 4JS4A 3I8DA 2Y1IA 3PW4A 2JLEA 3V9ZA 3ZSRA 1YVUA 4CJFA 1LWEA 4FLVA 3LP1A 4NLZA 1HNVA 3PY8A 3PW7A 3C2MA 3RJFA 7ICJA 4UB2A 1Q9YA 1Z3EB 3GFKB 4PGYA 4JWNA 4JLHA 5HMLA 5DB8A 4CF1A 4CGHA 1VSKA 4FW1A 1QTMA 1UT8A 5KFTA 1BCMA 1WLJA 3C2LA 1TVAA 4ECXA 4W5NA 3OVNA 3GIIA 2FPMA 5DG8A 4IFYA 1FXXA 3VQDA 8ICRA 4MQ3A 4OLBA 5EWGA 5EWFA 2IC3A 8ICIA 4N47A 4Z4HA 1BPBA 4KLIA 1CUKA 2XRIA 3RJIA 4F4YA 3QEWA 5F9NA 3GIMA 5CA7A 3P5JA 4O3QA 3LZIA 5KFEA 1NK4A 2WOMA 3VQ7A 4RPZA 3PR5B 1Q9XA 2W8KA 4MFBA 4CHNA 3LDAA 1X9SA 4CE9A 9ICBA 1K1QA 1S1UA 5DQHA 4RW4A 3ASMA 4F3TA 1NK6A 4E7IA 4FLYA 3OY9A 4CJUA 5KT7A 7ICFA 1VSEA 4E89A 1RT3A 4QWEA 4YR0A 3GQCA 3NGZA 1XU4A 4FBUA 1S9EA 4CEAA 4KLDA 2FBVA 1K1SA 4CHPA 1S0OA 2RDIA 1D9DA 7ICKA 5BOMA 4AHVA 3O3GA 3M8RA 4FJLA 5IIIA 1GOCA 3SUQA 3C5GA 4MF8A 1B9DA 5J0RA 2PYJA 4FZXC 2BCVA 4Y1CA 3ZT1A 1RT2A 7ICHA 1QSLA 3CFRA 4FM2A 4O5CA 4RQ8A 3AV9A 4MEXA 3K2PA 2P1JA 3NGYA 4YP3A 4UB3A 3OYMA 1RILA 3TAMA 3G6VA 3SQ4A 1N6QA 3KLGA 4IQVA 2OPRA 3ZSQA 4DTJA 2IMWP 3RH4A 2A1RA 1JL1A 4Z4GA 4DL4A 3A2FA 4F2RA 1ASWA 4LVSA 3LP2A 2DY4A 3Q8QB 3KHLA 4FLUA 3IM1A 2R8GA 1BPDA 4BE0A 4W5OA 1QSYA 5KFAA 3T19A 2DFHA 2EHGA 4FLTA 4M3TA 4DQIA 2E6MA 4FZZA 4M3WA 5KFVA 4DSLA 1LWCA 1RDDA 4CHYA 5KFCA 1XWLA 1BI4B 4I2GA 3TAQA 4LSLA 1REVA 3T5LA 5D3GA 4DL7A 2WONA 1DLOA 4J9PA 5KFBA 1KEJA 4GXKA 3L2VA 2G8HA 4ELTA 4ED0A 4DSKA 8ICJA 3OSNA 4OPJA 3QO9A 2LYHA 5KG7A 4DU3A 2ZJAA 7ICEA 4TQRA 2RPIA 4FXDA 3BDPA 1K6YA 4JWMA 1ZQGA 3GV8B 2A1JA 3ZDBA 4EBDA 3KD1E 2HW3A 1ZQZA 2BCSA 4N41A 5DBCA 3ZSXA 1YT3A 3RMDA 2XY5A 4CEQA 3V1QA 1JMSA 3RH5A 3UQ2A 3V1OA 4DSJA 5HBMA 3ZT0A 3CM5A 4R63A 1VSLA 1A76A 1WNSA 3C5FA 3QIPA 3OS2A 1RT1A 4KTQA 1TV9A 3DRSA 4DLEA 2BQ3A 3ZT4A 4EZ9A 9ICLA 3AO3A 4RW6A 3V7JA 2ZD1A 8ICZA 3ULDA 2IHMA 7ICQA 1ZQRA 3H8SA 3UQ0A 2VG5A 4KLQA 1JXEA 1T7PA 1ZJNA 3VQPA 8ICVA 4CJ4A 1W0HA 4B3OA 3DRPA 1FKPA 1RXWA 3K57A 4IR9A 4NY8A 3L2RA 4UQGA 3OYHA 3ITHA 3HXMA 4PHDA 3V9UA 9ICQA 1ZBLA 3QINA 4J2DA 3QZ7A 3AUOA 4KREA 7ICRA 5HRRA 3EZ5A 3NF7A 2AGPA 1MQ2A 3FYHA 4BE2A 4EYHB 2ZTDA 4RZRA 5HP1A 3HX0A 4RG8A 9ICIA 9ICXA 4RQ6A 1TKDA 4PWDA 1J5OA 3ISBA 4ED8A 2VA3A 1ZQHA 4Z6FA 1NJXA 3RRGA 4YXMA 2NRTA 3DLGA 2W9CA 4G3IA 3AA2A 4HCBA 2BE2A 4FW2A 4F8RA 4IFVA 5FRNA 3QNNA 1U04A 1HUOA 3B6PA 1KVCA 4M3XA 3OJUA 2FMPA 2MUTB 4ID5A 4IQTA 4DL2A 4DFMA 4BWJA 2PI5A 4IDKA 1TK5A 3QZ8A 2IBKA 2IHNA 2H5XA 2FLNA 4DTXA 4KHUA 1ZQQA 3ZDAA 5C24A 1DTQA 2A1JB 5J0OA 4PHPA 4FCYA 2BPFA 1N56A 1RBVA 4FJXA 2KFZA 1NK5A 4N76A 2ETJA 1LWFA 4DTOA 4TSXA 2KQ2A 4FYDA 2J6SA 4DQQA 4QWCA 2ASLA 2FLLA 2D5RA 3ZDEA 3JSMA 3DI6A 3MR3A 1HUZA 2HNZA 1NKBA 3G10A 2XY6A 1T03A 5KG5A 1LW0A 2VG7A 5DDMA 1ZETA 3HSTB 2PZSA 1ZQWA 5KGWA 4PH5A 1S1TA 4Q45A 4M6WA 4CJWA 4GC7A 2WTFA 3BJYA 2Z1JA 1DOQA 5KG0A 4YD1A 3KHRA 2ISOA 4F5PA 4DU4A 1ZBIA 2ZJ8A 1RTIA 4LH4A 4CEFA 3PVXA 3BGRA 4CJVA 4NLNA 5KT6A 4FS2A 3GIKA 4FJ5A 3QEBZ 2BQRA 3G6YA 2AJQA 2IGIA 1V9PA 3C1ZA 3RBEA 8ICXA 4M45A 5BPCA 2IS3A 1JLGA 1DGSA 1XC9A 4M41A 4ECWA 1J53A 5J2IA 7ICGA 4DF8A 3HVRA 3MR6A 4CCHA 1ZQSA 5KRSA 3SI6A 5KT4A 2FMQA 5JS1A 4RQ7A 3GV5B 3EY1A 1T4GA 2VA2A 1SL1A 1J9AA 3ZSZA 3Q8MA 4R66A 3LP0A 3AO1A 3MBYA 1HNIA 3GDXA 5HRPA 4CJRA 1KSPA 4FJNA 4MF2A 4DSFA 3HPHA 4WE1A 4K8XA 2DFEA 5CB1A 3LANA 3DOLA 4J9MA 5CYQA 4LSNA 5HROA 2R8IA 3JYTA 5KTQA 4CEOA 1JLAA 4YCXA 4CJSA 4KITB 4I2HA 3HP9A 4GMJB 1C1CA 1S0NA 3AVJA 4CGDA 4O5KA 4W5RA 3VQEA 4PUOA 4PY5A 1RBRA 3RJKA 5J2EA 1BIUA 3QEAZ 3T1AA 1TFRA 1I39A 3Q8SB 4MFFA 4DEZA 3AVFA 1ZBUA 1NKCA 2ZE2A 3AA3A 3QIOA 4R5PA 2HHSA 2ZTEA 5DKWA 4DOCA 1JXBA 3PUFA 3IAYA 2NRZA 4YR2A 1MU2A 8ICWA 2R8HA 3OGUA 4YFUA 4AHUA 3SQ2A 5KGXA 2UVVA 1NKEA 3RJGA 4I27A 4TUQA 2BQUA 2R8JA 4XIUA 5TZVA 2FBXA 1ZBFA 3EW9A 4ED1A 4CJQA 1S0VA 4KN4A 3SQ1A 2HHXA 9ICCA 1A5VA 1BGXT 3WNHA 3OYAA 5CR0A 4KN7A 9ICKA 4Z4FA 7ICNA 2W9BA 3NBPA 4DSIA 4UB1A 2XGQA 4KHQA 3TR8A 2OA8A 5KG4A 4I9QA 5DQGA 1S9FA 4I2PA 3VQ9A 3MDCA 2ZUDA 2ALZA 2VANA 4I2CA 3PW5A 4DWIA 4Y1DA 2BPCA 1XO1A 4CIGA 4F91B 4HVJA 3BQTA 4NYNA 3ZDDA 3SV4A 2B5JA 2YHBA 2Z1IA 4N5SA 3CM6A 4J9LA 3MEGA 3PMNA 9ICSA 2D0AA 4ECZA 4JS5A 4CERA 2R8KA 1SUQA 3OYJA 3KIOA 4KHNA 2PXIA 4Q5VA 1A77A 9ICGA 9ICTA 3L8BA 4CF8A 3HPOA 3DMJA 1B9FA 4KB1A 1TK0A 1JXLA 4B9TA 1UOCA 1WAFA 1S77D 5C42A 4NYFA 4FJJA 1ZQNA 4O55A 3N4MB 1FK9A 3T3FA 8ICAA 2GUIA 4B9MA 2UVRA 3OYFA 1BPEA 3OS0A 2OPSA 4M3RA 4CJTA 3IRXA 1FKOA 3B0XA 3KK1A 3KD5E 1RBSA 2PFPA 5KFWA 2E6LA 4PHEA 2HVHA 2KW4A 5KFIA 4YG2A 4RUCA 2ZQBA 2W9AA 4GW6A 2I1QA 3Q8RB 2VWKA 5KG1A 4P4PA 4BGDA 3Q8KA 3OYEA 3NF6A 2NRWA 3GIJA 1JLCA 5DB6A 2BGGA 5KFRA 2X78A 1CLQA 5FRMA 8ICMA 4DTNA 4FJ9A 5KFKA 4RQ0A 4RQ4A 3MR2A 1JL2A 1HQEA 3MEDA 1HYZA 4C8OA 2B21A 2ASDA 1ZQDA 4KLHA 4F5OA 1ZQCA 8ICFA 1RXVA 1YTUA 3UXPA 4P2HA 4KI6A 1Z25A 4CJKA 4GLXA 4FS1A 5JS2A 4DTPA 2PY5A 4FJ7A 3ZSVA 1TKXA 5J1EA 1RPLA 2GWSA 4M9HA 3S3MA 3OHBA 3C6UA 1SZPA 3MFHA 5L1LA 5CWRA 1RCHA 1KCFA 3H4DA 3RMBA 4CJPA 4GVMA 7ICIA 4E7KA 1XSPA 3JPQA 3H8JA 4E7LA 2PI4A 5KFZA 1RYRA 1O1WA 4R65A 1KFDA 4NCAA 3UPQA 2ZUCA 4H8KA 2HHQA 5J29A 8ICUA 5J0XA 4ZTJA 1ZQPA 4F5RA 3MGHA 1ZQBA 1IKXA 3SUPA 4EYIB 5FDLA 3OYNA 1GOAA 1VSHA 4O3PA 4RNMA 3PO5A 4CGFA 4CHOA 4HUGA 1IO2A 1KVBA 4E1MA 4CJ5A 1S5JA 8ICCA 4RU9A 1CEZA 3QERA 4KLEA 4OGEA 4EEYA 1GOBA 5EU7A 8ICPA 4XQ8A 5JUMA 1G15A 3G0ZA 1QSSA 3C21A 4KLLA 4DLGA 4FJKA 3PX4A 4J2BA 1X1PA 3TI0A 2G8VA 4K8ZA 3K4GA 3JPTA 4JRPA 2DFFA 1HMVA 9ICFA 3AVMA 4B9NA 4KLGA 3KKRA 3I0RA 5J2PA 1PZNA 1WAJA 1N48A 1QS4A 5HP4A 2YNHA 4QCLA 3L2WA 4FBTA 4DSEA 2HNYA 3TAEA 9ICUA 1IH7A 4O3RA 4I2JA 2NRXA 4M9LA 2A1SA 4C8MA 3S3NA 1U47A 4ECUA 5KFXA 5D49A 4UB4A 5KFHA 1UA1A 4DTRA 1Y88A 2AU0A 3LPUA 4FM0A 4J2AA 1KVAA 4DTMA 3QNOA 4QZGA 3HPGA 4KLOA 4YXJA 5DB7A 3OHAA 3HO1A 9ICAA 1RDAA 2JGUA 5KT3A 2F1IA 3L2QA 4B9UA 4E1NA 4FVMA 4TUSA 5KFFA 5J0SA 3T5KA 4KLFA 4EBEA 3NFAA 4CF0A 3EWAA 3LWMA 5KT2A 3H40A 4DFPA 4F4ZA 3M9NB 1JLQA 3AVBA 5FROA 2NRVA 5KFUA 7ICTA 5KG3A 4FJIA 9ICJA 5IIMA 2DPIA 2X6SA 4YMMA 4EZ6A 4TQSA 2XHBA 3AU2A 1XSNA 1ZQOA 9ICPA 4KHSA 4KB0A 3U3YA 2ZTCA 4PPXA 3HP6A 1XSLA 4Z4IA 4B08A 1ZYQA 1Z26A 4IBNA 3OYDA 3SPZA 1RTDA 3JPOA 3C1YA 1BPYA 1WSFA 2FC0A 3CQ8A 3WNEA 3V9XA 1WSEA 1JKHA 4FJ8A 1TAQA 2V4QA 3K5NA 4DTUA 1WSGA 2AQ0A 5HHHA 4GC6A 4KMUA 1S0MA 4CHQA 3V6JA 5IINA 4QZFA 3JPPA 3QEIA 3MGIA 3S3OA 4M42A 3K75D 7ICOA 4YFKA 3HL8A 2AGQA 3LDSA 4UB5A 2KN7A 4CFBA 1BISA 1B43A 5EOZA 1JLEA 1TL3A 2F1JA 5DK5A 3SUOA 3SQ0A 2ZUBA 3NF8A 7ICPA 9ICVA 4QWAA 2G8KA 2BHNA 2JZBA 4ECVA 1D5AA 4ED2A 2JEIA 1NOYA 1CXUA 8ICHA 1D8YA 2JEGA 2YV0X 5KT5A 5KFJA 3U3GA 4CF2A 4UAWA 4MFCA 1VRTA 3MXIA 3QE9Y 3AVLA 2JEFA 3EYZA 4ECTA 1HPZA 4HTUA 4IR1A 2GBZA 4B8AB 5HMMA 2KZMA 3DLKA 3C6TA 3E2EA 5DG9A 3VQ5A 4FLZA 4Q44A 3NHGA 5J0QA 1TKTA 1RTHA 1RBUA 4PQUA 1EXQA 1YTAA 4KRFA 1TAUA 2P66A 4DU1A 4M3ZA 3V7KA 4K4GA 2ZJ5A 4CGJA 1TV6A 3B0YA 4QZ9A 4F50A 3QLHA 5L1JA 1C0MA 1KLMA 5DGAA 3KJVA 4AHSA 4DFJA 2RKIA 3I0SA 4ED3A 3M9OB 3RH6A 7ICUA 3UXNA 4F5QA 4FJMA 3LALA 2HB5A 4JV2A 4M47A 3AVAA 2UVWA 3NH0A 2YHAA 4KPYA 4E0DA 4DTSA 1L5UA 3M9MB 3BQ0A 3TARA 4PGQA 3SZ2A 4RQ2A 3OYKA 4F3OA 4Z4CA 3QEVA 3PW0A 1L3VA 4KLJA 3DM2A 9ICNA 1COOA 4YD2A 4CK1A 4NCBA 4CIFA 4Z0UA 3P83D 2XY7A 4BWMA 3SNNA 1KFTA 2HHWA 4NM1A 3AVKA 2ITGA 2DPJA 4IG3A 1AROP 1NOMA 1QLNA 3UIQA 3AVGA 4IQUA 4CJEA 4M9NA 4KHWA 1RDBA 2C2DA 3VA0A 1SKWA 1U49A 3KLEA 1VRUA 4IRCA 2W9CB 1RT6A 5KFNA 2P5GA 2PFOA 3PX0A 9ICOA 4RQ5A 1ZQYA 5K14A 2BCUA 1NK9A 5J2GA 2JZBB 3DYAA 3VQAA 3BQ2A 4CGIA 3OS1A 3K5MA 1W9HA 3CG7A 5DMRA 3TAPA 3CFPA 4I2AA 3G6XA 3V7LA 4C8LA 3KK2A 4F4WA 3LAMA 2C22A 4CF9A 4KAZA 2F8SA 5I3UA 2I9GA 5SZTA 5KFYA 2RDJA 4QZHA 4CFDA 9ICHA 4XRHA 2DTUA 1UA0A 4O0IA 2KZ3A 2QKBA 2HHVA 5HHIA 2XGPA 4C8KA 1S1VA 4W5QA 1Z00A 1BIZA 2HMIA 5J2HA 3RMCA 5CP2A 3H08A 3S9HA 4XUSA 3BQ1A 4X5VA 5KG2A 4QWBA 1WSJA 3Q8PB 2QK9A 4Q43A 4ECYA 3H7IA 1IKWA 4LZDA 4MEYA 4PA1A 1WN7A 2PFQA 2J6UA 4O44A 1S1WA 8ICTA 5IIKA 4BACA 4KTWA 1F21A 3RR8A 5KI6A 4M6WB 3THVA 4CIEA 1VSJA 3V6HA 3VQQA 1LV5A 1RBTA 2ATQA 3F9KA 4I2BA 8ICOA 4KI4A 1IG9A 4KV8A 4CK3A 1LAVA 3M8PA 8ICGA 3DLHA 3WNFA 4Z4EA 1HJPA 9ICEA 3KLHA 4CHZA 5J2MA 2Q0ZX 1RNHA 4KKOA 1BVSA 3C2KA 4DQPA 4QW9A 3ZD9A 4RW7A 5KFMA 5J2FA 2KFNA 3T5JA 1HRHA 3ORYA 1U4BA 2RF2A 1C0UA 3RAQA 4XA5A 4KTZA 4F4KA 4RW8A 4PHAA 4M9GA 1S10A 2FBYA 4RNNA 2Z1GA 4FJHA 4I9LA 3HT3A 8ICQA 1JN3A 4CFAA 3NAEA 4QZBA 4QZIA 2IAJA 1HQUA 1WSHA 3MECA 1IM4A 3RAXA 3V6KA 1RTJA 4P4MA 2HHTA 4IKFA 2KZZA 5KFGA 3CFOA 1BQMA 4KLUA 2VWJA 3KLIA 1TGOA 5J0WA 5KFSA 5KFLA 2RN2A 3OYGA 5HRNA 2X74A 1HYSA 1XI1A 4N56A 4O0JA 1I3AA 4O3OA 4QZEA 2O4GA 3AA4A 5DLFA 1NK0A 4UBBA 4MFAA 9ICWA 3V6DA 1D9FA 1VK0A 3RTVA 3KK3A 4CFCA 1JX4A 3TFRA 1LB2B 7ICVA 1BI4A 1ZQJA 5L9XA 4Q8FA 1TL1A 3AO5A 1KLNA 1XS9D 1ZQAA 3UXOA 3V9WA 3GILA 8ICNA 4DS5A 1B22A 4JV1A
chains in the Genus database with same CATH superfamily
2HBRB 2RB7A 3SLCA 1TUUA 3OTOK 3NRWA 4J9KA 1KDNA 1EWQA 2PA3A 1S1WB 3FCVA 5H9FK 2AV5A 2NREA 1Q8KA 2HSZA 4B1VA 3AGRA 2QG9B 3IR5B 3L7OA 4J9SA 2RQ5A 2W9BB 1EXNA 1HW8A 3NH2A 2HBJA 2Q43A 1XMQF 4I6MA 5IV3A 3DOKA 4KV8B 2E5LF 2Q97A 3M8PB 4LF9K 3ZZZA 2EX3A 4I2PB 1H38A 3RJJA 2YWKA 2QLFB 5CY4A 5ALSA 5IIJA 3KKSA 3J7YP 2E4LA 3AVHA 2B6GA 4RW7B 5F8GA 3OVAA 5D0EA 2E1EA 3TR5A 3IMXA 2WAQC 2VA8A 3LWLA 4UF4A 2G8FA 4M1KA 3TUZC 3E8OA 3HSJA 2OTJS 3ENHA 3FJ2A 3KWMA 2HBZB 4JV5K 4CEDA 4WFYA 3L3UA 5BN9A 5LXYA 3DMJB 5IM0A 1NJWA 1HQUB 3MECB 1KTQA 3N4QA 5AIAA 1EX4A 1VRQC 1S4EA 2BV3A 3OBIA 1OY8A 3IBWA 1YTYA 1ZS6A 3VENA 1N36K 1CXQA 1XHZA 3NTUA 4BJQA 3W5XA 2DGVA 5AK3A 5KFDA 3E9OA 5LJ5Y 3CCVS 2A18A 4BG8A 1VBZA 3HILA 2RHQB 4RT3A 4Z6EA 3O1BA 3T9NA 3RB6A 3S01A 5C5JA 2HCFA 1NUEA 3DRRA 4KHPJ 2OMLA 4PPDA 2KG1A 2UUAK 4Y2UA 3VQSA 5E2QA 4GVLA 2N1RA 1Z4NA 4K0KF 3FEZA 9ICRA 5CJ7A 1E6VA 1F5BA 1WI8A 4OLPA 4UT4A 2H3FA 4ZHRA 1SJRA 2HRYA 1C6VA 1FO1A 1TU0B 1WC3A 3V1RA 2UP1A 4FO0A 4ECSA 5J2JA 1RHJB 4QZ8A 3LP3A 2XI3A 4PG8A 1BPZA 1J2MA 4A8OA 3OUYA 3CT9A 3RG6A 4JUZA 1VI7A 5J1EB 3RFAA 4OVLA 4QZAA 4P71A 3HJFA 1U24A 2ZKTA 1CJTB 1LOUA 2QA4G 4M5JA 1WNEA 1DQ8A 3KK7A 3NGUA 4KBOA 1QE1A 3EWGA 1X6JA 2VKQA 5CCMA 2AHOB 2NZCA 5J1PA 3ZSYA 1NZPA 4PZOA 1SZHA 2IDEA 1WWHA 2E5SA 4CDGA 2NZ4A 3E9PA 2QL9B 3KHHA 5RUBA 4DOBA 2O8BB 1WF2A 1U1RA 1XJWB 3CJ2A 3MEEA 3LPTA 4O5BA 1RCXB 2ZXIA 5FPDA 1ED1A 3G87A 4YOEA 5FDLB 1FFWB 5LMUJ 3RJEA 1OQ3A 3UCUP 3AL0B 4GXIA 5L1MA 1UKUA 4IG0A 4KB7A 2W54A 4Z6DA 3CUNA 4JI0F 2WVCA 2NR0A 2DNLA 2XCAA 3O3FA 2G09A 1LXNA 3WXMB 4AYBC 3V72A 2XLKA 4CYUB 2HURA 3W9JA 1LFWA 1OY6A 1KW4A 2I5JA 2WSEC 5HSPA 3JPRA 4LSZB 3ZYYX 4K5SA 4ZPDA 1C1BB 1RZTA 5KOXA 3GE9A 3NVVA 4ZP9A 1FXDA 3MD1A 5FP0A 3TVYA 1HMVB 4J9UE 5LL6d 1U2CA 1OVQA 2YKNA 4JKAA 3A0IX 5ALPA 2BM0A 5J2PB 3MM5B 1V6HA 1Y11A 4PXCA 3TQ1A 5F9LA 2I7NA 2MGZA 3FZMA 4AHTA 1XR5A 2J0WA 2XWXA 4UQTA 3BM7A 3DWLA 4JI6F 3NY0A 1CZBA 2LU1A 1KQSM 2QL5B 4OZLA 4B1WB 1SV5A 3DLJA 5C25A 1Z1ZA 4GRSA 5J0YA 2DNGA 3CCRN 5DGBA 4OL8A 1NJZA 4ANEA 2EG2A 3OBWA 1ZQVA 5BRHA 2QM1A 3DDNA 3DFEA 7FDRA 4X4TA 1RT7A 1FEHA 3KMQA 4K4IA 4OX7A 1NSKL 5GAHU 3T9ZA 4LD0A 1W7WA 2MAXA 3SCLE 2KTQA 2ZNZA 4G6VB 2XCPA 1KC8O 4ECQA 3KG4A 4OLAA 5AKJA 1Y97A 3HK2A 1T9XA 2UVUA 4P4OA 4O9MA 1JRPA 3LYSA 4HHJA 2AP1A 3AVIA 2FJXA 2OI2A 3PO4A 3M8QA 4ER8A 5D8HB 1TYQA 3UPFA 5DM7L 2QA1A 3DAWA 2JMGA 2XO7A 4WK3A 1Q86T 3HVTA 2HSTA 3W5YA 4Z37A 3ZZTA 3IBFB 1D8ZA 1S97A 1B64A 3TAFA 1LK5A 3CC4S 4GXJA 1H2VZ 3L3FX 3TZWA 1KVKA 1UP1A 1A5WA 3OSPA 2OD4A 4KLMA 4MMOA 2IOCA 4JI4K 3CDEA 2Q6CA 3VR1A 4DR7K 1FJEB 1IXRA 1NH8A 5ETOA 2ALYB 2JEJA 4Y2CA 3OLBA 2KJ8A 1YZ6A 2CIMA 3C19A 2KICA 5A0YA 2PE8A 4M0AA 4E7HA 3VV2B 3LDLA 4O3NA 1ZQIA 1IBMK 3GJSB 1SV0A 2KHQA 1U9LA 2BUPA 3DDHA 1FFVA 4F04B 4H5NA 1DEJA 4MK8A 1P90A 3Q2TC 1KHVA 4HH1A 1CBKA 3NGIA 4TY8B 3KFUF 3QJPA 3KMSA 2X3DA 1RT4A 4R8UA 3I4PA 3TADC 5KOWA 3GJQB 4IJAA 3C23A 1SKRA 1YK9A 4H54A 4EELA 4I29A 1KAYA 1M1KT 3VQBA 5AXKA 1FDNA 5BR8K 1SIJA 4OPKA 2NYHA 4BE1A 4DMNA 3JAMY 2ODGA 4PG7A 3P49B 4HH0A 3QLHB 5HQ8A 3H5SA 1H72C 5CZ1A 3HM9A 3W2VA 3ETLA 3I31A 4KO0A 1X4EA 7ICLA 1BQNA 3PSTA 3I0SB 1ZQEA 1R3NA 2FZKB 1ZXOA 4AILC 2V8GA 2DEJA 2D1KA 2KRBA 1UZDA 2AJ2A 2B9EA 4LF4K 4ZH4A 2QA4S 4QZCA 4OKKA 5KRTA 2F5GA 2C2RA 2DL0A 2ERRA 4DQ8A 1RWOB 2KVIA 1N5XA 2NUUG 4DV2F 1EP4A 2DGTA 1PAEX 3UD4P 2ZGYA 2F8MA 1FO4A 2QKQA 1WHYA 2R9LA 3QJLA 4FPBA 1MMNA 5BPNA 4DV4F 4FOIA 1SZ2A 4B3TJ 4EBCA 4OZ1A 3ISDA 5F1XA 4O3MA 5L1IA 4U6PA 4V19S 4WIIA 2DT9A 2ROEA 4CLFA 1XMOJ 1RDCA 1QAJA 4CECA 3EVMA 1GMUA 3T1YK 2L08A 3UD5A 4CJ3A 3OTOJ 2J6TA 4M2YA 3BPSP 4B9SA 2RDDA 3JAMO 3VQ4A 3V81A 3GV7B 2F1HA 1JUDA 1NDLA 4WCEL 1W25A 3P1GA 3HWTA 1ZM4A 3RB4A 1VBXA 4K8RA 1X2IA 4RT2A 4NLKA 3DXBA 4C23A 2VQEK 3ULEB 1N33F 4BRFA 2CUYA 4OX9F 3GTYX 3K5PA 8ICLA 5ETSA 4Q0BA 4FK4A 1E6YB 3H2VE 4LRCA 3UW1A 1QQMA 3LL3A 3PZPA 4L74A 4DPWA 2GV9A 4QNLA 3TUJC 2HVIA 3UDEA 1X4FA 2JLEA 3V9ZA 4YB7A 2GFFA 2PN6A 1P27B 1IKWB 2EZYA 4NLZA 3C2MA 2IIRA 4DV6J 2AYGA 4JWNA 1HKCA 5DB8A 1HWLA 2DY9A 4CF1A 3A3PB 2O5DA 2H3IA 1QTMA 1UT8A 5KFTA 1WLJA 3E51A 4ECXA 3OVNA 2I9SA 3HHLB 5JLFA 1N36J 4OLBA 4B6JA 1CULB 5EWFA 2IC3A 2CGLA 2YTUA 1BPBA 3MZIA 3EUB2 4DR5K 1QQ5A 2W8KA 2V8DA 1X9SA 4KKOB 2PEHA 1K1QA 1I3OB 4RW4A 1RADB 3GIRA 1JI7A 3R6GB 2HS4A 1NDKA 4F3TA 2UUAJ 4E7IA 4GKKJ 4FLYA 2DISA 2QLBB 4TN2A 5KT7A 5ALKA 2OEMA 4PG4A 1FX4A 1XR7A 1XU4A 4FBUA 4CHPA 2FBVA 3VEXA 2F8EX 4LIRA 4QIFA 1RXOB 1P9QC 1S0OA 7ICKA 1FWLA 1GXTA 1UMJA 4AHVA 3O3GA 2HBKA 4OZ0A 2DCLA 2QT7A 3RSEB 4IFEA 2YX6A 2BCVA 1T9VA 4Y1CA 5AQMA 2XB2D 4BRQA 4MEXA 3I56N 2P1JA 2IOFK 3C16A 2HZCA 2UUCJ 3TAMA 3SQ4A 4DTJA 5H9EJ 3RH4A 3KLIB 3TOQA 2A1RA 1V38A 5HR7A 4PWUA 2P9UA 1WD6A 3LO3A 3BGOP 4LVSA 2D3OR 1NGDA 2OUGA 2EKYA 1Y9OA 2DNNA 3J81U 3IM1A 5AQIA 1O0PA 3AM9A 4NZ0A 4LQ9A 2YQ0A 5B5EU 3T19A 5ALLA 3V6DB 3P4UB 3ETMA 4DSLA 2WTUA 2V2VA 5KFCA 3FZHA 4NO7A 2BRKA 4A4JA 1REVA 3EJMA 3T5LA 2CPFA 4DV0F 2DNKA 3EKSA 4GXKA 2G8HA 4ELTA 1HNVB 4ED0A 4G1QB 2FJVA 2AX0A 2GMJA 5F8NA 1A9NB 3H1VX 2IDLA 3I5AA 7ICEA 2VKRA 1S6PB 3MUMP 7FD1A 2FJEB 2DNYA 4I7FB 4X2BA 1M1HA 4WP8A 1ZQGA 1I94J 4BG9A 4DR4K 3ZDBA 4EBDA 3KD1E 3MM9A 4N41A 1YT3A 1PVRA 2E3TA 2XY5A 3JS9A 1UFKA 6FD1A 1JMSA 1Z2LA 4WU3A 5HBMA 3J7ZT 4CI6A 5AZJA 1H2UX 1S3XA 1Z19A 2LMIA 4Y0FA 1J5EK 2KXFA 3CF5Q 1UWAA 2HZAA 3DRSA 1TV9A 2HFNA 3AOBA 3CO0P 5F3TA 1S1UB 2QGFB 2BQ3A 1WORA 3ZT4A 3G82B 3V7JA 1XNQJ 5J2QB 4F0KA 1ZQRA 2P35A 2KHDA 2OH2A 1JJCB 1PKUA 1T7PA 2J76E 4N77A 4CO1A 3VQPA 4CJ4A 1VISA 2PFDA 1VC6A 1FKPA 1KONA 1VQON 1VQNN 3L2RA 4TYAA 1R6VA 2L9NA 2QV6A 1NSAA 9ICQA 3M7DA 5B08A 4G9ZA 4FWMA 4CDIA 1YVFA 1T9UA 5CHCB 1IXKA 5I4MA 1LCUA 1JCFA 2J7KA 2QB1A 4JBCA 5B0FA 1T11A 3EICA 3MMBB 4F67A 2ZM6J 4YUDA 5HQLA 5DDOC 2WSFC 1G1XA 4LFBJ 4BE2A 4J91A 4NYOA 2FHJA 2CVIA 1NI3A 2G07A 2VJVA 4B3RK 4PWDA 2BE9B 2PAVA 4ZVPB 1SH2A 4QYZJ 5MAOA 4Z6FA 1NJXA 4WFXA 3C6HA 2E1AA 4KH6A 4JB3A 2CRXA 2P9GA 3DLGA 1Q7LB 1NGHA 2JWLA 2YMMA 3KLFB 4K2XA 4YOVA 4BY9C 2E8OA 4FW2A 2M8DB 3DC2A 2F76X 4N8NA 2I6XA 5D3GB 4C11B 3NNCA 4LF5F 1PO6A 3FFIB 3CPWR 4IQTA 3TJAA 2YXLA 3RAMA 4DFMA 4NASA 1TK5A 3QZ8A 2IBKA 2WW4A 1HD1A 3BN4A 2H5XA 5CD4A 4BR0A 4KHUA 2GIRA 1VAZA 1ZQQA 2GH1A 3HM8A 1UPPA 1DTQA 3SBMA 3M2UA 4DHVA 4PHPA 2GGPB 1HBNB 3T6JA 1RWMB 2YPYA 3R9PA 4QZVB 2C2NA 2M3DA 1BC6A 4EHUA 5GTIU 1H7XA 2YHYA 2D5RA 3ZDEA 3PKMA 3DI6A 1HUZA 1T03A 3EO3A 1DAXA 5DDMA 3AB4B 3JSBA 4GMKA 4Q45A 1B4FA 2HIQA 4DZ6A 2RUGA 5KG0A 3NOGA 3SMSA 4QIWF 4WXWA 4NLSA 4FVCA 2FZGB 4DU4A 1X4AA 2P5VA 3FMBA 4NLNA 5KT6A 3DRPB 1XIQA 2MB0B 2YBVA 5GAEU 2BH1A 4FS2A 1NMDA 2VQFJ 5AJ3K 3HD2A 3FQLA 3H5YA 2A2CA 5AHXA 3G6YA 2AJQA 5ETMA 1PSDA 2Q1NA 3I76A 4ZP6A 4WP9A 4C80A 4H4OB 4M5HA 4LF1A 4I1TA 4NWIA 4M45A 3BZQA 1OSDA 1UW9A 3F9MA 1HA1A 2GJ2A 2P6TA 4U7BA 2E1CA 5E84A 4DF8A 4JYAF 2HRTA 3THWB 4CCHA 5CQGA 5KT4A 5HP1B 4GVEA 3PM9A 4CLTA 1SQKA 3EY1A 5AI6A 3H3OB 1SL1A 1J5OB 1GT8A 2KHVA 3ZO7A 4YOXA 2XLIA 3AO1A 1KBUA 2NXCA 4LF4J 5AFUA 1KSPA 4E1JA 4FJNA 4MF2A 5JVHQ 4K8XA 3MMVA 3QRQA 2ZBCA 5CB1A 4FYWB 4DI6A 1VQKS 3MWTA 1YRTA 1K44A 5CYQA 5AKLA 2R8IA 5HR6A 3W61A 1RFQA 5K8MA 1NDCA 4YCXA 2X1FA 4KITB 1XMQJ 5EE0A 2X51A 3NLCA 3AVJA 3MN9A 3M7VA 3VAFA 1X4CA 1YVNA 3EE3A 1YJTA 5AQPA 2CQ2A 4X62F 1MWQA 4P7TA 2HBQB 4GKJK 3Q8SB 2V7YA 4MFFA 4DEZA 3AQFA 3MM8A 4CJ7A 3AVFA 3LUYA 2MQPA 1FJ7A 3AA3A 3QIOA 4MH8A 3SIPB 1M5OC 4YR2A 4AQYK 2OLWA 2R8HA 4F02A 2K7JA 4HI1A 3SQ2A 1NKEA 3L7UA 4TUQA 1EKSA 2O8EA 2FBXA 3MTKA 3EW9A 4MIWA 4IYQA 3HHLC 1N34F 1OW5A 1RWPB 1A5VA 3O9UA 4Y28C 3WNHA 4X64F 4ICAA 3OL9A 3NG8A 3SSRA 9ICKA 4U67L 4Z4FA 7ICNA 3NBPA 4DSIA 3UKUA 5K8OA 5EX5A 3WKAA 2OA8A 1NGIA 4KH5A 2OEKA 5KG4A 1NSPA 1TQLA 1B7FA 2Z2MA 2OTLN 5GVQA 3NVKA 2B6AB 1WKKA 3JXOA 4K59A 3NS6A 4BR7A 3A8KA 3FGUA 1WEXA 2V2ZA 1IBKK 3AODA 4HVJA 2DGZA 3BO4A 3Q8YA 4K0KJ 2QLJB 1UVIA 2YHBA 2BRLA 3O8MA 2DHGA 4B1UB 2AYMA 2D3UA 4TLQA 9ICSA 1AUSL 4ECZA 4JS5A 3CC7N 5HL7Q 4CERA 2G0AA 3KIOA 2FB0A 2GX8A 4Q5VA 3AJ1A 9ICTA 3LP0B 2CQCA 1TELA 3LF0A 1VQ8N 2E1MC 3OXFA 2Q0RA 4KB1A 3T1HK 4QS8A 4OHWA 2OPQB 2R7XA 3GR1A 3BBFA 4XTTA 4B9TA 1UOCA 1WAFA 3MPWA 1V5VA 4A46A 5JICA 4FJJA 1MWKA 2YNGB 2KT5A 4CH1A 1Q78A 1IKYB 1S4FA 4Y6IA 2OHDA 4ETXA 4PKGA 2BXJA 3ATUA 3CDAA 2GUIA 1WBDA 3OS0A 4ZVQB 1YKWA 4IUFA 2VKZG 3IRXA 1FKOA 1IBLK 2YNIB 7AT1B 4IZ9A 2FC9A 2F65A 1G6BA 5CE3A 2ZFHA 5KFIA 4YG2A 3W3DA 4Y2PA 3SD7A 1EJ7L 2VD3A 4NLYA 2I1QA 1NGAA 5KG1A 4FYXB 2RP5A 3OYEA 2R2UA 5DB6A 3TA2A 1CLQA 4WFZA 5FRMA 3KHYA 1WOPA 4LF6K 1SH3A 3MEDA 3EKUA 4USUA 1FTRA 4C8OA 1C0FA 1ZQDA 3SAGA 4F5OA 4NYPA 4JI0J 5J8YA 4RNHA 2JRZA 5F8MA 4CZFA 1UWBB 4NLWA 1QZ5A 4DR3F 5JS2A 4DTPA 2PY5A 1RPLA 2GWSA 2WRMA 1U25A 3S3MA 3C6UA 1SZPA 3MFHA 5AM1A 5L1LA 1KR4A 4R0EA 1U2VA 3BKFA 3RMBA 2XEXA 4MDBA 7ICIA 5GMEA 3PXGa 1GLBG 3W64A 4J8FA 1YBTA 3UI3A 3UPQA 3UDCA 4Z2XA 2O8CA 4JI6J 4ZTJA 2R7TA 2CPJA 1PJ6A 4F5RA 2YB4A 1P1TA 3MGHA 1ZQBA 4GFJA 1IKXA 2H3EB 4TLRA 3SUPA 2A6OA 4GVBA 3OYNA 4X66K 4UTGA 3O1LA 1VSHA 2EI5A 4KGXB 4CHOA 2GW8A 4XPEA 4HUGA 1RACB 1Y5LB 3M6WA 1DJ0A 4CJ5A 8ICCA 2IIHA 1CEZA 4OGEA 4U8VA 1GOBA 2OGUA 4XQ8A 5JUMA 1J5EJ 1LQ9A 2IHR1 3T7ZA 3AQOA 3PIOQ 2WF8A 4KLLA 2F1FA 5GMKa 2KSOA 4BX9C 3R9LA 4P75A 5KAKA 1LKZA 3ZEUB 2YKQA 1FNMA 5C2GA 1FE0A 3LPEA 2K60A 1RA6A 4ZVTB 3JPTA 4JI3K 3IP4B 4CF5A 1OH5A 3AVMA 2HSEB 1CS4B 1LWEB 2P8IA 4Y2TA 4JK9A 1VS3A 4K7QA 1PZNA 4DCOB 1WAJA 1N48A 5A6WA 3I87A 4BC3A 2P6SA 5A8KB 2FUG9 3NGTA 1S5LU 4QCLA 2XIDA 3L2WA 2HNYA 9ICUA 1IH7A 2A3ZA 4I2JA 2GS8A 2G0JA 5AQLA 5ETLA 4CGZA 1U47A 2B9WA 4K4ZA 3OL8A 5KFXA 1UPHA 4KHMA 1IM6A 4MJKA 1IWGA 3R5GA 5KFHA 2NXEA 4JD2B 4ISGA 3LPUA 4FM0A 6FDRA 2V8PA 1X5OA 1KVAA 4J2AA 3VAGA 3ENBA 4DTMA 2D3DA 3MHYA 4KLOA 1DQ9A 2WOMB 2XSJB 4YHHK 1D3WA 2FJ6A 1NGBA 4LC9B 2F1IA 1U0SA 3VGKA 4MHVA 3K7RA 3THTA 4IOAQ 4HACA 1JJ2M 4B3MF 4BRLA 3NL0A 3EWAA 4PYDA 5AI0A 3H40A 2Y0SC 1JLQA 5FROA 1JCGA 4NLTA 4CWBA 2NRVA 1OVYA 2WAQD 3W3SA 1XR6A 2L48A 1RWVB 5EGYA 2DNOA 2X6SA 4EZ6A 2EXUA 3MI7X 9ICPA 4P52A 4KHSA 4KB0A 4DCPB 4PPXA 3HBTA 1ZQ1C 2KMDA 2ZBQA 1ATSA 3KDNA 4K25A 1ZYQA 5A2QY 4IBNA 2P9KB 4JI2K 1X4HA 4W90B 3ZZOA 1Q4RA 2KD1A 4HT7A 3WNEA 3ZNUA 1WSEA 2EK6A 1U1OA 3BY5A 2FC8A 5HHHA 1RJJA 4KMUA 2AX1A 3K0JA 1K9MT 3MM7B 4P0PB 3BBCA 2DXFA 1P1LA 2YWEA 3EZUA 3R5AA 5ALJA 1RU2A 3OXLA 2D8CA 2HHHF 3HL8A 2KN7A 3Q86A 5FIIA 1BUXA 2NYIA 1HARA 2LQJA 4CFBA 5A8RB 5EOZA 4IQXA 4WP3A 3EUNA 3VEYA 4JKEA 7ICPA 5B66U 1T6DA 4QWAA 4FSVA 4ECVA 3VF2A 4ZK7M 1FVSA 2WONB 1DLOB 3M8WA 3U3GA 3AT1B 4DV2J 2ZJPL 3MXIA 4UARA 1RI7A 2HOEA 2JEFA 4ALZA 4ECTA 5AJ3J 5ALVA 3P31A 2BKNA 4IEIA 5HMMA 4P73A 3N6MA 4DV4J 3C6TA 3E2EA 2DJWA 4EHTA 4Q44A 2E9TA 4BVOA 4YDXA 3ZTPA 2CFXA 1RBUA 3CO9A 4RU2A 4KRFA 1GK8A 4M3ZA 2MMYA 4C0BA 1KAXA 5A2QO 1NEEA 4NLBA 4CGJA 1YJNN 4UB8U 3KKAA 4F50A 3VGMA 1RT1B 1EHWA 4Q2LA 2DEIA 2VBWA 2E8AA 2ZD1B 5DGAA 3U02A 1N8RT 3KJVA 4ES2A 4DFJA 5ALIA 1U6BA 2LPEA 4P72A 3TA0A 4ED3A 1RSCA 2ZIXA 3M9OB 1X40A 1RLDA 1M90T 3W8GA 1KD1O 4F5QA 4FJMA 1FF2A 4ZVEA 3G4SN 1JJ2R 1AFIA 2EANA 1HNZK 3ZTOA 2M88A 2DVIA 4E0DA 4B3OB 3O6WA 2UUBF 1HHSA 3MPVA 3AXMA 5IFMA 4OX9J 1AT1B 3OYKA 3DM2A 5LMNK 3SQOP 2CPHA 3CCRS 1AYEA 1RTDB 5GADP 2DKZA 4PG6A 5D77A 1JKHB 2GVDA 1XNRK 1XERA 2M7SA 3WKEA 2BJDA 4YMEA 3JTOA 2HHWA 1XO0A 4NM1A 3JSRA 3A5LC 1IJFB 1T95A 4OX8A 1QQNA 4IQUA 4I64A 4CJEA 1HKGA 2EEYA 2Y9UA 3VA0A 1TL3B 3CIZA 2H5EA 2PFOA 4OD0A 5B0EA 3B54A 5CH7B 4ZVOB 3U4LA 2L9DA 2BE2B 1ZQYA 5K14A 3I55N 1HBOA 3UE5A 3DYAA 4WBFA 2VZ9A 2R7WA 1YXQA 1Y0HA 2ZDOA 4O5FA 4R25A 4ID5B 1VBYA 5LT5A 3TADA 4BCAA 1UJ4A 1K8KA 1UCVA 3KK2A 2CH6A 2JVRA 4CF9A 3AEVA 4C3MA 1FJGF 3NCRA 3IWLA 2GTDA 2I9GA 3VOVA 4QZHA 1FEZA 4XRHA 2V51B 3SR6A 4O0IA 2HHVA 1U6FA 4RWXA 3UWTA 4NL5A 1Z00A 1TKTB 3GE1A 3GR0A 5J2HA 4XUSA 4PQUB 3CMAN 2DR8A 4CLSA 4A8MP 3BR8A 1SXEA 3FR0A 2JNJA 3MOZA 1K8AO 1KN5A 4LJMA 3BEXA 4MEYA 2HQIA 2VPZB 4LFCF 2PFQA 1LW0B 4O44A 4BC4A 5B0CA 4M94A 1S1WA 2NLXA 5IIKA 4BACA 4M6WB 1VSJA 3JTPA 1OH8A 2J7WA 1SC4B 2DH8A 4W92B 1RBTA 2IRXA 3BDEA 2WUSA 2ATQA 4URGA 1RTIB 4I2BA 5F8HA 4KV8A 3N4PA 2K06A 3M8PA 5C2CA 3MX5A 3POTA 4KH4A 3S1TA 1T6CA 3BREA 2H54B 2KV2A 1HJPA 4CHZA 3GLJA 3UE2A 3B6BA 2R3VA 3DCAA 1RNHA 5CRXA 3DRXA 3AA9A 3CJ4A 2YX4A 2A5XA 4RW7A 3QWUA 1JLGB 1UVMA 4DV7F 4UOGA 1HRHA 2A40A 2JDJA 3BSCA 1C0GA 1N32F 3AJ2A 3DGVA 2ILZA 3THPA 3UR0A 4DV0J 3HJVA 3RAQA 5FLXU 3GWCA 3WBZA 2Q0UA 1CJVB 4NOHA 4CTAA 4M9GA 4WYLA 2Y1LB 1Q82T 4PL1A 4ZITA 2Z1GA 1JN3A 2B3TB 3NAEA 4QZIA 1TL7A 3D6JA 1HQUA 2DRBA 2MA1A 3MECA 2FTRA 4C6AA 4WE1B 3N7RC 4DV3F 4IKFA 2KZZA 4LSNB 5D0RA 5HROB 5KFGA 1JLAB 4KJIA 2NLWA 1SQFA 2GO9A 4PHTX 5KFSA 4Z7CA 5KFLA 5AZIB 1WYGA 1C1CB 3OYGA 3LTOA 4K2JA 3OR2A 1U1LA 5HRNA 1LWXA 1XI1A 2IVFB 2FF3B 4PUOB 1M5PC 3CCUN 3RU0A 4YB6A 3D2FA 3PFEA 3EGZA 3CCZA 1I3AA 3WC0A 2EW9A 1JXVA 3QUQA 4CFCA 3TFRA 4IO1A 1LB2B 2Y8WA 4NLVA 2DR9A 4U7UD 4TXSA 7ICVA 1BI4A 5AQZA 2KKZA 4Q8FA 1TL1A 1KLNA 4JKDA 4R5PB 3KYLA 3V9WA 3UXOA 4DKWA 2GHVC 2QWNA 4CM2A 1M0SA 4A62A 1DURA 4BRGA 4ZIVA 4RQ3A 1S1XA 1JLBA 2CDRB 4K4HA 3R3TA 1VSDA 3QSIA 1QH9A 3GPAA 4UBCA 2J7UA 5E3CA 4UOCA 1MROB 2P6RA 1SL2A 1K0TA 1QAXA 1ZBHA 2O66A 3R6MA 1RAAB 1WUUA 4YN3B 4A57A 1CJTA 1HNXK 2AZ3A 4DPUA 4JOUA 2BPGA 4MKBA 3MXJA 2V94A 4Y2YA 4CZIA 3EGNA 5J2KA 3PIPL 3T5HA 4HDGA 2NNWA 3W0LA 2QC3A 5T7BA 3ONNA 4KX5A 2E1ZA 2MKSA 2H3ZA 2P51A 3C95A 2QSWA 5E3RA 2Z2ZA 1C0UB 3M1VB 4ZVUB 3U1LA 2VC0A 1RHQB 3RJMB 4LIWA 1SUQB 1IWAA 4LF5J 4RW8B 2IM1A 3DLLL 3IDHA 3ILIA 3OQ2A 3UDLA 1MN9A 1FFGB 1WCLA 2FE9A 5EE3A 1QHTA 4JKBA 4FKYA 2C3MA 3M6ZA 1JQGA 4EX7A 2CPRA 3V9SA 4E19A 1VQ6S 2N4DA 3CJ5A 5ALWA 1QCKA 4RWWA 1YHQS 5KAFU 1CVJA 3GG0A 1VSMA 2YY6A 2V4JA 3SI8A 4YHHJ 3DGPA 2AWZA 3SQGA 4OJ1A 1SKUB 5IXUA 1FK9B 3SSQA 1HKAA 3MAHA 4OYAA 4AHRA 2QXFA 1KP6A 4X65F 1S72S 3A8IA 2MY7A 2CXYA 5AT1B 2E8MA 1C1BA 2W6KA 5ETQA 1R0AA 1TZ0A 2OPSB 2KH9A 3PV8A 3TU5A 2E5JA 4J9NA 2PIIA 2ZH2A 1SIZA 2UXBF 4IRKA 3TZYA 5ALQA 1O8BA 2H1YA 1BPXA 2JXJA 3R5BA 4BRNA 3LK9A 2Y0BB 2OZSA 3ENAA 3I56S 5AQKA 5ALZA 4FK0A 4NM2A 3MN6A 5LJVA 2GWJA 5CHGA 1JCEA 1YZ7A 2J0SD 3J80Y 4H03B 1YQHA 3EPIA 2VIHA 3MR7A 2YKOA 3K5LA 1ASUA 2VFTA 2ZH9A 4HUEA 1X8DA 4IWVA 4NPOA 3VEWA 4DHYA 2B0CA 4FN5A 1IIPA 4ZN3A 1G4CA 4DF4A 4C3LA 5HN0A 3WEEA 5AKIA 3L9ZA 1ZJMA 5SWMA 1TKXB 3RBZA 4P0QB 1T3NA 4JYAJ 1VSFA 4L76A 4QR2A 3KBBA 3CD6N 5AQSA 5LSOA 3RMAA 1UT5A 4KFBB 4AP9A 2KEYA 3FZBA 1UVLA 2GLEA 3F53A 4OGCA 2ZIVB 2OMOA 4W5TA 2IJNA 3MEKA 5DETA 1WDDA 3SJJA 4YMNA 2OYQA 4WFNQ 3OFGA 4PKIA 1N5TA 3GJRB 1R89A 3V2UC 1NMEB 2HWIA 2KO1A 5KAIU 2WHOA 5ALMA 4OYOA 4WFAL 1Q81O 3RZAA 4M5LA 4DR1F 1HJRA 1N5SA 3F2CA 4OHZA 2MTLA 3RRHA 1W2BM 2HPUA 3CETA 2DNQA 3IV6A 3OTDA 3NF9A 2F2AB 4C4SA 2UXDF 3RWUA 5J2NA 5BJRA 3J80O 1LAWA 1NK7A 4NXZA 2YX1A 1YBUA 1RU1A 4ANDA 2K8AA 3D54A 2ASJA 3QRRA 2XC9A 1I1GA 3E01A 2WSCC 5DBAA 3MM6A 2MQQA 2PFNA 2P9LA 4ID1A 3FDSA 4AE5A 2IRUA 1F9HA 4CEZA 4J5OA 1HNZJ 3AD7C 2GUPA 2KLAA 4WQ4C 4BQLA 3KVGA 3SCXA 1M6YA 5KFPA 1VQOS 2UXCF 3OR1B 1VQNS 4X64J 2YNHB 2ZF5O 2W03A 3O5BA 1FI4A 5LMNJ 3CCTA 2E2OA 2E1FA 2F9JA 3TJ9A 3R2DJ 3SUNA 2BM1A 4P2XA 3R3LA 1WC5A 4ZVRB 2CQBA 1LEOA 2QL7B 3VMFB 1MA7A 1OPZA 2MDAA 3QFPA 4DCCA 4CJLA 5DLGA 3PKYA 4OQJA 1JJHA 4Y2IA 5DDYA 3NCQA 1B92A 3MN7A 2BKEA 4M3UA 2C28A 1OYEA 5LY3A 2F8LA 3CC4N 2CA9A 4CZHA 3CJ9A 3MCSA 5AQNA 3O1WA 3KLVA 3UDVA 1VGYA 3KHGA 2M9KA 2A42A 1NJIT 3F41A 1CZ9A 4WTYA 3W60A 3LGNA 4FF1A 2C2EA 3M2RA 3VQ8A 4BXOB 4L8RB 2P9PB 1WSRA 1U7LA 4CEEA 4PXDA 1S6QA 3O4NA 1VQMS 1FCAA 2Q3PA 2P9NA 5J0UA 4KE5A 5IQQA 3NS7B 4OJLA 3TEGA 1IN0A 3U6FA 3OTCA 1WC1A 3MPDA 2ACYA 4BDPA 1W2BR 2F8KA 2LYBA 3EPGA 5IC4B 1H3DA 4AL7A 1VHFA 5JU5A 3D2SA 4CK2A 2Z30B 1LK7A 1C0TA 3ZFVA 1T05A 3TABA 3KZIU 4TURA 2AYEA 2NQPA 3ZI4A 2BJ9A 3QICA 4OJHA 4GV3A 3LM9A 1TVRA 2YH1A 4CESA 4H4MA 1N5WA 3IHQB 1VRTB 2CGJA 2EZXA 4NXMK 1HPZB 3ULEA 3QT7A 4ZCLA 4O8KA 2RIJA 2RUSA 5KL8B 2VODA 1BHLA 3ZT3A 1HWIA 4JI1F 2QA4N 1HNWK 2GO8A 1DHMA 2XZDB 2F3JA 3M6XA 1FXRA 1ZRMA 4RQ1A 5IIOA 4DB3A 2DR6A 3ISNC 4ELUA 1RTHB 3K2YA 4DUYF 3OVBA 1Q8IA 1YDLA 3AD8C 7ICSA 1SXLA 5J2CA 5DM6Q 4CD3A 2ZVSA 3C15B 1XQIA 1UL3A 5JLHA 2FBTA 4UOHA 3FZKA 4RW9B 4CBWA 1KLMB 4ICLA 1RUSA 4C9DA 3H0MB 3MURP 4FO6A 4DV1K 3Q7CA 4A5AA 1DFDA 3NRZA 4RTFD 3AH6A 4RNOA 2UV8A 1UJ6A 3FGVA 1WEYA 4PWWA 3NH1A 3Q8LA 5LSRA 2F8HA 4L73A 4LF7K 3DXMA 2Q3SA 2QMUB 3EM1A 4HUFA 3M6KA 3IG1A 2MSNA 2LKZA 3KTQA 2XG8A 4M3YA 5J2BA 2DIVA 2KI2A 4HHHA 4OPHA 5DB9A 3A8EA 2OEHA 2BVZA 2P9IA 5B8HA 4OIXA 3VQ6A 3NE6A 2NO5A 3DOMB 2GAHC 1XHXA 3VC8A 3BSNA 1F5AA 1ZPWX 4QAGA 1K0VA 4JKGA 1Q79A 4I2QA 2DF4B 1X5TA 4RCHA 4FF4A 2BCQA 3LZJA 5L39A 1MC8A 3ZD8A 1G7CB 3M4XA 4KGVB 3A4TA 8ICKA 2XNRA 5EE1A 2BZFA 3PYDA 1RCOB 3U1NA 2D0OA 2K4PA 4FLXA 1XNSA 2JWNA 3KLEB 3DRYA 1RT6B 2LA4A 2D0CA 3WXJA 5DBBA 3NWGA 4L3QA 1BCOA 1U45A 5C2DA 1JLFA 1TE2A 3HMJG 4FLWA 2F9TA 5ALUA 3GFYA 4CZEA 2O8DA 4RPYA 4A48A 2KT2A 2OTLS 4JHDB 1OS5A 5AK5A 1EX8A 4NCGA 4UUXA 4OI0A 3OL7A 1NU0A 5I3UB 3LAKA 4BDZA 1ZQFA 3K58A 3ETRA 4YORA 2COLA 2E5IA 4OV6A 2YVSA 2IDOA 3R7NB 4YY3K 5LXRA 2HHUA 4LH5A 2HMIB 5K5MA 1KFSA 2G8UA 3PW4A 3CC7S 3GG1A 3ZSRA 3TW0A 5C7PA 1YVUA 2LQBA 4R79A 3CIMA 4CJFA 2PGCA 2GVZB 1HNVA 4H0PA 3PY8A 5AQUA 3THXB 3PW7A 3RJFA 3W7BA 3NVZA 4FYVB 4PGYA 2WF7A 2J8AA 2ASPA 3O4WA 1YLXA 1VOMA 2RJZA 2FVCA 2FY8A 3HHLD 3VQDA 5M1QA 3WK9A 2QJ3A 3A1YG 4N47A 4Z4HA 1MWYA 3P5JA 4RPZA 3KLHB 1NNEA 3PR5B 3EZOA 2HHHJ 1Q9XA 4CHNA 5KL1B 3IFRA 1S1UA 3ASMA 3K9KA 1IKVB 1VSEA 4NRTA 4YR0A 1S9EA 1K1SA 2J9DE 2AIRB 3PHTA 5A6PA 1D9DA 2V5HG 5BOMA 3M8RA 4FJLA 3F5AA 2XMTA 1GOCA 5AFUH 5HQMA 4C7QA 4CO2A 5B0BA 4FZXC 1S48A 5A0LA 3CFRA 4FM2A 1DRGA 4HT5A 3K2PA 1VK8A 3NMRA 3O3LA 2CQPA 5KQ8A 2ZWPA 1RILA 1EQ0A 3G6VA 4HTLA 2OPRA 5IZHA 5LL6Z 2E20A 9RUBA 4Z4GA 3N01A 1GXLA 3MMBA 3A2FA 1ASWA 1HYSB 2DY4A 1V85A 3D2EB 3Q8QB 1FEEA 2R8GA 1BPDA 1TTHB 3D1HA 1QSYA 4FLTA 2EHGA 4DPYA 3SJHA 3KK3B 2E6MA 4M3WA 4PL2A 2QTWA 1RDFA 3FE1A 4CHYA 3N5FA 3FM9A 5E0OA 5LM7E 1K47A 3C7NA 5MLCQ 5M1PA 2ROPA 5ALDA 2UUBJ 1FRXA 5D3GA 4C11A 3L0QA 1WF0A 4IH7A 1ZTTA 4J9PA 4PG5A 4CP5A 8ICJA 3DKDA 2X3GA 5BN8A 3QO9A 5IV4A 5KG7A 1YUWA 3BDPA 3WQPA 2EC0A 2BJ1A 4RBUA 3CNHA 1HR0K 3O9SA 5DBCA 5CCLA 3RMDA 4QIGA 4CEQA 1R27B 4WK1A 1QVFR 1WDTA 4A5BA 1PAUB 4DSJA 3ZT0A 4QIVA 4TY9A 4R63A 3TVKA 1U2RA 1RGIA 3ICXA 5B0GA 4P6QA 1BLUA 3QIPA 3HJEA 1XN9A 3SEOA 2RILA 3AO3A 1RHUB 2G2YA 1WTBA 2EFQA 2KIVA 3UQ0A 2XI2A 3TTDA 4NMXA 1SCJB 1ITPA 4LR7A 1Q86O 1YJ9S 8ICVA 1YBAA 1ELOA 3LA0A 3DRPA 4CO0A 1RXWA 3K57A 4IR9A 4NY8A 4JKHA 4MO5A 1FJGJ 4EENA 3OYHA 4PHDA 3PACA 3V9UA 4NLCA 3U1MA 3RGIA 3MCNA 3KOAA 1VHIA 2WAQF 3AUOA 4KREA 3SK3A 4NLDA 5HRRA 3QBXA 4OFZA 1MQ2A 3VAIA 5ELZA 3THWA 1GMWA 2DNRA 2ZTDA 3CJSA 5HP1A 3HX0A 4LFCJ 4BRMA 1YI2S 3EGWB 1LFPA 1J5OA 3ISBA 3DRRB 3FUYA 2DNPA 2KYZA 5ETVA 5A76A 2DXDA 3RRGA 4YXMA 2VJUA 3VAHA 1VIOA 2J5AA 1UTAA 2KXNB 4KY3A 1QUPA 2G4BA 3PDNA 2FZCB 3NGKA 4ZHRB 2MEWA 4IFVA 1FIQA 5MLCV 1KVCA 4CRXA 1M1KO 5AE2A 3OJUA 2FMPA 3L4PA 2PI5A 1RBOB 4IDKA 4FWRA 3GG4A 5GAGI 3ZDAA 5HMWA 4DV7J 4WQ5A 4FWKA 2A1JB 5K8PA 4FCYA 5LMUK 1N32J 3GFXA 1RBVA 2DRDA 1RABB 1NK5A 2HFVA 1GH8A 5BYQA 2FF6A 2CQIA 1RM6C 4EUVA 3SENA 1W2IA 4FYDA 2J6SA 4DQQA 4QWCA 5KQDA 1QE1B 4BC9A 4NV0A 3MR3A 1EWRA 3AN1A 5JVGQ 2XHWA 4K4WA 2GZOA 1DK3A 1NKBA 2Y0SD 3RYLA 2XY6A 5KG5A 1ZETA 3ZTRA 2F63A 5KGWA 4AFFA 3NMAA 5AK6A 2D6FC 2YKAA 5AQGA 2LMRA 3BJYA 2HRUA 3QJJA 4B17A 2Z1JA 1S49A 3LQVA 4NXMJ 2VG5B 1FXLA 3BH7B 3AD9C 1Z05A 3R5JB 2ZJ8A 4LH4A 3BGRA 2BJ3A 2F7VA 1M5KC 3IBPA 4K50A 4PQAA 4KT0C 1IR1A 2DHAA 5LJWA 2CRLA 1VQKN 4C2MA 2AW0A 4BVPA 1FNXH 4IG0B 4UATA 3E58A 4LRAA 2A6MA 1M5VC 1LOTB 3RBEA 1Y10A 5HJYA 1K5OA 2WB1C 1YJNS 3CCWA 1IR2A 1Q8LA 4LFAK 3PLAA 3R7SB 1XC9A 4NJ8A 1LXJA 1T44A 2LYVA 5HMXA 2IJRA 3C14A 4ZIWA 7ICGA 3MPYA 5AM3A 3HVRA 2I5JB 2HQGA 1YJ7A 3QBCA 2FMQA 2QYCA 3CMQA 1T4GA 2VA2A 2LQ5A 3G4SS 1J9AA 3ZSZA 3Q8MA 3LP0A 3MBYA 5IWAF 4CJRA 4DSFA 3N79A 2CJAA 3HPHA 2YTCA 4WF9L 3UM9A 2OO4A 3H46O 4YS2A 3EN9A 4PCQA 3DEEA 2CPYA 2M70A 1S0NA 2XYGB 1SV5B 2XYPB 4O5KA 2A3VA 2YI1A 4W5RA 1RBRA 1BIUA 2QXLA 1I39A 5EE9A 4JEPA 2C2MB 5EUHA 4L6V3 1R59O 1O5JA 3QWPA 4X4SA 2K3IA 2HMPA 3TX8A 2HYIB 4CLYA 5ITHA 1NKCA 3IXQA 1RT7B 4USMA 5AQHA 3PUFA 3HSCA 3CC2S 8ICWA 3JSMB 2YWFA 3MUTP 4MDAA 3I55S 2UVVA 1VMBA 3VPZA 4DPOA 5AXLA 2R8JA 2P2CB 2EVZA 1AQ6A 4A61A 3EXYA 1ZBFA 3TVZA 1S0VA 2HHXA 1RQNA 1BGXT 2KVSA 3M8QB 2ZJRQ 4LUBA 1TYQB 1NGGA 3OPKA 4X65J 1UEUA 2CZ4A 1NGFA 1FVQA 3O9QA 1FTCA 3TR8A 3HVTB 2ESEA 1HI1A 2Z58B 3SMPA 4ZCMA 5HATA 3D67A 2UXBJ 3CMAS 4I2CA 4Y1DA 4DWIA 2BPCA 4CIGA 3BQTA 2B5JA 1BQXA 5DJBA 2Z1IA 4J9LA 2AEMA 1VLBA 1VDVA 3MEGA 2W2NP 4KH1B 2K4EA 1UVJA 3BO3A 4YEAA 3OYJA 4K43A 4KHNA 3A12A 2PXIA 4CE6A 3Q2SC 5HAOA 2VH7A 2CQ4A 3G96A 3MMCA 2QFIA 2WBRA 3T69A 3HPOA 3FBCA 4CQ1A 1PYOB 2QA2A 2AJ1A 4QJFB 2HF3A 1TK0A 4I68A 5KNIA 2ASYA 5C42A 3IBCB 1RWKB 1RT4B 2XHCA 2P9CA 4AM7A 2G0IA 3SBGA 3D68A 2GMHA 3BPDA 4Y00A 4BC7A 4B9MA 3SCJE 4ZJLA 4DR6F 4WPAA 2YWGA 4HVZA 1NPPA 3B0XA 5IT9Y 1RBSA 2PFPA 1CS4A 5KFWA 2E6LA 4C97A 1L7OA 5LSLA 4B3TK 4LR8A 2FXUA 4IEEA 4RUCA 1U0HA 2E5GA 4GW6A 2KB2A 4DUTA 5F41A 2XS2A 2VWKA 4KO0B 2QO3A 1XTZA 3Q8KA 1BQNB 1XMOK 1YSJA 3NF6A 5HJXA 3NS1A 4DR1J 2HWHA 2LXUA 2X78A 2RRDA 4FJ9A 3J7ZO 3US5A 1HJOA 3C8YA 3SDEB 3JTNA 2HIYA 3DDKA 1ZQCA 1RXVA 2XSJA 3F2KA 1EP4B 3IFEA 4KI6A 2IJFA 3CCUS 1Z25A 4CJKA 3JAMU 3R1LA 4FS1A 4FJ7A 2HS0A 4M9HA 2VBZA 3OHBA 4DUZF 2O8FA 1RCHA 3PEJA 1R8PA 2JLFA 1KCFA 1NGEA 3H4DA 4CJPA 4GVMA 2HVEA 3D0HE 3OL6A 3H8JA 4E7LA 2PI4A 1O1WA 5ALGA 2UXCJ 2ZUGA 4H8KA 3SAFA 1VLYA 2DO0A 2BOAA 8ICUA 2QI2A 2VV5A 5IT4A 4FWOA 3D2NA 1KWMA 2NXUA 1CJUB 4JI8F 3BGLA 5IT9O 4KQZA 3BF1A 1BA1A 2P9KA 4V19X 3ID8A 3V81B 2CPEA 1B3TA 1HR0J 4DV6K 3I5BA 4TKTA 4M5NA 4CGFA 1RHRB 4KGKA 4IC9A 5M1FA 2W24A 1GXUA 4RU9A 2CDQA 4E98A 4FPAA 2EPIA 4Q0BB 5AICA 8ICPA 3IC1A 3FLCO 1A0PA 2E29A 2MKYA 2ZIUA 1QSSA 3C21A 1ZZNA 3F2DA 1N5VA 4JI5F 4FJKA 3PX4A 1X1PA 3TI0A 3J7Z5 2WF9A 4JRPA 3KK1B 3EE8A 2RQMA 1ATNA 4GKKK 4XDDA 3DDIA 3ICLA 2BJEA 1IVZA 5HP4A 3R1XA 3W2WA 3BN7A 4H5RA 4FBTA 2KVQE 2HAIA 3WHIA 4O3RA 3SCIE 2C2KB 4DR2F 4ECUA 3GYNA 4ZVHA 1RKJA 1J2VA 3MC1A 5G5HA 4P10A 4UB4A 1EKRA 1H1VA 2IC3B 1HI8A 3U27A 3KG1A 2G0CA 4QZGA 3V5RA 1N0VC 4YXJA 2WK4A 5DB7A 2E5HA 2UUCK 3OHAA 5E33A 4FDFA 3EL2A 5H9EK 4Z7YA 4PEOA 1CJKA 5AQRA 4E1NA 4TUSA 4OZ2A 1NG9A 3PRVA 4RW4B 1Y4ZB 4CF0A 3MCMA 3LWMA 4A8YA 2V7ZA 4DFPA 1HWUA 1ZM3A 5CEHA 4DDFA 3NMUA 1DARA 1MMDA 1TP7A 2UU9F 5KFUA 7ICTA 1RHMB 2XO6A 5T7LA 3LOUA 1QTNB 3QSYB 4NLUA 2DKXA 2ZH8A 2ZH6A 2LQ8A 3AU2A 1XSNA 1JWWA 2QMWA 3U3YA 4GO7X 3HP6A 5I3QA 4ZJQA 2ZHAA 4Z4IA 2CJYB 3OYDA 3C16B 3SPZA 3TAMB 1RTDA 3JPOA 3NUQA 2HS3A 1WSFA 2FC0A 1SQGA 1RWUA 3J7A1 4JKFA 2P9UB 1JKHA 1QD1A 4ANCA 2V4QA 4DTUA 1WSGA 4WZQA 4GC6A 3I6PA 3CD6S 1I94K 3KJNB 1NBWA 1RAIB 2QYGA 3CVKA 3MGIA 3S3OA 1DKGD 2JFKA 3B82A 4FNIA 1T3QA 3HX9A 7ICOA 4YFKA 1FT8A 2B0GA 2LFVA 4Q7AA 4NXNK 5AIBA 5T41A 2VGMA 4OX6A 2QFJA 1Q1KA 1BISA 3HHDA 1TL3A 3NAHA 2Q6BA 3CCMN 1VQ5S 5GADI 5CA5A 2G8KA 1PK1A 1REVB 2JEIA 2EAPA 1D8YA 1XNQK 2YV0X 4DCJB 3H2LA 4GO5X 4PKHA 4CF2A 1FE4A 2GNKA 4IR1A 4EI2A 4JI7F 1WWUA 3CF5L 3VQ5A 4FLZA 3SXLA 4ATNA 5J0QA 2MHNA 3ALRA 1TKTA 1NM1A 3KG0A 4LFAJ 1R0CB 4PQUA 1BDGA 1X42A 5HBMB 2P66A 3F2BA 2D69A 4Z94A 2Y1RI 4M5KA 3VAKA 3LDNA 4QZ9A 5D15A 2ZWOA 3MCPA 3DRSB 5L1JA 5ALRA 5ETNA 4KHPF 2ZM6K 3ZZUA 4H5WA 4LFBK 3A0HU 4JK8A 3JQKA 1IJEB 1S6UA 3BGUA 1F2GA 3MTJA 3PSIA 1HHTP 7ICUA 1ZD5A 4OJ5A 3ZETA 3LALA 4QYZK 2HB5A 1VJQA 4JV2A 4M47A 4DCHA 2W6LA 2PKEA 3HHEA 1FKPB 4F71A 4PGQA 3E3XA 3MCAB 2UZAA 3H0RB 2A1AA 3QEVA 1L3VA 4BHQA 2VONA 9ICNA 2K2PA 2KJ9A 4NCBA 4CIFA 3SCKE 2VASA 4F7VA 4Z0UA 2HEKA 4A2BA 3P83D 2XY7A 4BWMA 1KFTA 1WOSA 3BB5A 1RGVA 1CJVA 3PJWA 3AQPA 4PWDB 3C2PA 1UCNA 3K0SA 3PNIA 3H6EA 1QLNA 4Y2XA 3R27A 3UIQA 3AVGA 1DQAA 2Q66A 1J2NA 1RDBA 2C2DA 4RNFA 3UMGA 1WEZA 3DLGB 3QAUA 2ZIWA 3QPIA 1VRUA 2CG8A 1SV0C 2AT1B 4WXOA 3PX0A 3UQSA 9ICOA 4RQ5A 2BKOA 2NS1B 1XK8A 2G08A 5J2GA 4CGIA 4LF8K 3K5MA 1W9HA 4UASA 3TAPA 1A7GE 4X4VA 3DXSX 3CFPA 3OFEA 3V7LA 1B4SA 2R7QA 4F4WA 3LAMA 2C22A 4KAZA 2VIXA 4F0HA 1KVIA 2BKPA 5SZTA 4CFDA 9ICHA 2DTUA 3DLKB 1UA0A 2KZ3A 1DTQB 2GHPA 3M2UB 5HHIA 3A0BU 2LEBA 1S1VA 2VQFK 5DZ7A 1BIZA 1NO8A 1LKYA 2AA4A 4LR9A 2G1DA 2IVPA 2MZ1A 2MZTA 1PILA 5L46A 4K42A 3DI6B 2MZRA 1QQOA 4BBYA 1KKXA 4IO8A 2CADA 1T03B 3C0BA 3FBBA 4IL6U 4RR5A 2CG4A 2CKWA 1AA1B 2JR5A 4YOWA 2V0NA 4RX6A 2YMPA 3QYYA 2R18A 2OSRA 2BE7D 5ADXA 1MROA 5K9FA 3QUCA 3BQ7A 4CVNE 3GB0A 1KQGB 8ICGA 5ALTA 3WNFA 4UB6U 1GLAG 4A8XA 3CJ3A 1XMQK 2E5LK 2IM0A 4O4RA 3C2KA 3U9ZA 4DQPA 1CLFA 2W4DA 3DV9A 4QW9A 3ZD9A 2DR5A 5J2FA 2KFNA 3Q83A 3ORYA 3PYEA 2RF2A 4OO1J 1C0UA 5JVHL 3CD0A 1C4AA 1V4SA 2HFSA 2Z8QA 4KTZA 4RW8A 2HQCA 4PHAA 1S10A 2G2OA 5EDWA 4FJHA 5GIPA 4I9LA 1AZSA 4QZBA 1FRLA 2IAJA 3QGHA 3TJ8A 1IM4A 4HKQA 3DU6A 5E7OB 4FKXA 1RTJA 3KZBA 4P4MA 3A13A 2GHWA 2DNMA 1S79A 3CFOA 4BR4A 4KLUA 4FP9A 3HHNB 4US9A 2MQOA 1S5ZA 5J0WA 2E7WA 1YITS 2RN2A 2FJBB 2X1GA 2X74A 1SJ3P 1Y3JA 4DV5F 4O0JA 1P8ZA 1WUAA 2PD1A 4QZEA 2QN6B 2O4GA 2QEXN 3ISND 2XMUA 3G8SA 2MLYA 3MMAA 2BJ8A 2KN4A 1MA9B 4MFAA 4C1NI 3IMQJ 2H48B 4CNQA 2POKA 1ZQJA 3AO5A 5F8LA 1NB7A 5BPMA 4RPFA 1XS9D 1ZQAA 3GILA 2M52A 8ICNA 1UEVA 4K0KK 1TFYA 3AGKA 4LRBA 3D5MA 5B09A 2WBMA 1ZXIA 2QB0A 1RT5A 2CQ1A 2OXOA 4XDCA 2NUBA 3SV3A 1URNA 4B9VA 4NX9A 5CZ2A 4FNHA 5D46A 4O5EA 1VC0A 3M8SA 2LVWA 3HSDA 4UZCA 3J8AA 2IVYA 3Q23A 3JPNA 3TANA 4B3SF 3IGVA 5JMVA 1VQ6N 4OI1A 3FCHA 1YHQN 1L7MA 3HFVA 2V4RA 4QPTA 1ASVA 4R64A 4KFBA 2ZG6A 5HL7L 3FRYA 4M04A 2E44A 2XWYA 2ZOGA 2V63A 3L4IA 2R2SA 4ED7A 1S72N 4HHTA 3AVCA 1EKEA 4NLXA 2G8WA 3TFSA 1R8BA 2Y1JA 3V4IA 4EWTA 2RHKA 4IOCL 3ALYA 3I96A 3HRDD 3D6RA 4WFBQ 1CQNA 3VAJA 3WKCA 3FCWA 3ZZRA 1RAJA 3VGUA 3EXCX 3O3HA 2HG4A 3R8EA 2J8SA 3A5MC 1KEKA 1K9MO 5JTIA 3TPQA 1TMMA 3ET6A 3SPYA 2KJ5A 5J2DA 2R7OA 3K89A 4HCCA 2F8TA 3RB0A 1ZM2A 2E8PA 5L9NA 3B4DA 2SXLA 4DL5A 1LW2A 1WOOA 2OFHX 4OJ3A 3ZX0A 1A6SA 1BQMB 3PJXA 2BACA 1XEZA 3B6OA 1FWPA 5B0AA 4JI0K 4DQSA 4WWSA 1ZBTA 3OTBA 4TUPA 1L3UA 2DGXA 1H74A 3M30A 2JZ5A 3R6LB 2O4IA 2BZ2A 1FKOB 2HVDA 2KFYA 1WSIA 4DQRA 1HKBA 2F4VF 4BREA 2ISPA 2N4CA 1FX2A 1DT9A 3OR1A 4H5TA 5B7WA 2ABYA 1MSWD 2OM6A 1U1NA 3HYFA 1VJWA 4BRIA 2C2ZB 3CPWM 4ZJOA 3OTOF 3D6TB 1TUVA 3UFCX 3D7EO 1TMJA 1X0PA 2IA6A 2MXYA 5J0TA 1L3SA 3NXZA 4I2DA 3GL1A 2MUTA 3BEGB 2MZQA 1OWXA 3MEDB 4JI6K 4OKEA 4HDHA 5THWA 4D3GA 4IRDA 3OW2M 4ZMMA 2WFAA 5DRKA 3IM9A 1NPKA 2EK1A 3AO4A 1DTTA 3UB5A 2AQ4A 7ICMA 4JAXA 4QW8A 1N8RO 2XLJA 4LF9F 3NEKA 4CZJA 3VEOA 3C6UB 2OFGX 1M90O 3DN9A 3D6HB 4NXNJ 1U2VB 3U9DA 2HNDB 2GMLA 1SAZA 1ZQUA 4RPXA 4M63C 5L8RC 2JSXA 2F9DA 3OT9A 3ZCMA 2P5OA 2VPYB 2Y8YA 3TAGA 3OD2A 4J9QA 2JHDA 3VTIA 2PT0A 3VWSA 4RUBA 3EGVA 4N8OA 2ADBA 4KLTA 4QU7A 2KG0A 2LQ9A 4JV5F 3MGVA 2O8CB 3NVYA 2ZHOA 2ATLA 1U26A 3CJKA 4DG1A 1NLKL 4BXOA 2F96A 1UHUA 4NL9A 3WKDA 4CO3A 4GVBB 2L5YA 1D9AA 3WK5A 3PIOL 2W3SA 1HBMB 3ISCA 3PFOA 1N36F 2CNLB 3VETA 4E8UA 4F2SA 3DLBA 2VG6A 2BCRA 1UAXA 2FPLA 4MAKA 4M5GA 2JC1A 3H25A 4U95A 1VSIA 3WNGA 3BS5A 4FK2A 1A5XA 4LZGA 3PX6A 3EVOA 1MWZA 9ICMA 1TL5A 3CEDA 2BTFA 3H5XA 8ICBA 1HD0A 2UUAF 3G2XA 2ASOA 1EETB 4OZJA 2C42A 4QR1A 2NO4A 5KFOA 3PW2A 2ZH3A 2WB4A 5M1NA 2CZ9A 4FM1A 3C94A 3D0PA 3MOJB 8ICEA 2VICA 1ZQXA 1X9WA 1SV4A 2O01C 5E3QA 3ZDCA 1JK9B 2HNYB 2OJ3A 1F2HA 2N3LA 3NGRA 1UW4A 3D45A 3BP8A 1KAZA 2MKIA 4FXWA 4NMLA 1QHAA 3Q7BA 4O4GA 2M5YA 4IOAL 2P6UA 1GLCG 4ISFA 1SGGA 2A2DA 2JGAA 2QZ8A 3QGPA 5F3XB 3CI5A 1MWMA 3C15A 3VQCA 2Y3YA 4JV0A 5JJBA 1N5YA 3LVWA 4ELVA 4TNOA 4USHA 3N4WA 3IG8A 1SKSA 1K73T 1ZQLA 2FQQB 4RW9A 3OW2R 1VQMN 2PYLA 4HACB 2CJBA 5L1KA 1F3FA 1DZ5A 4C4WA 3MD3A 4O8UA 3DXKA 2DD8S 1CC8A 5LJ3Y 3IS9A 3PNCA 4PYAA 2IVOA 2YCHA 3VGSA 2W42A 2QRRA 4HYKA 3KOOA 1ZQMA 2OSQA 2Z4PA 3O5TB 1NCLA 3CCJN 2C3PA 4B1YB 2YNFA 2JJ4D 2I2YA 1VQ7N 2FDNA 1SI9A 3R1HA 2VFSA 1HFEL