3PX6A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (tautomer) in closed conformation
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px6A01
4WE1A 1ZQNA 2PYLA 1X2IA 4CEQA 1YVUA 3EY1A 3ZT1A 4MFBA 3SQ4A 5DB7A 4NXZA 3KTQA 4FLWA 2Z1JA 3PO4A 2YNGA 1TFRA 1C0TA 2R7YA 4CERA 2XO7A 4CHPA 4XQ8A 3TAMA 2JZBB 2YKNA 3AO1A 5J0RA 5DB6A 4F92B 4FM1A 8ICNA 3OVNA 4M47A 3QLHA 4DU4A 3C2KA 1XHZA 5KFHA 2F1HA 2OPSA 4DQIA 5K14A 3VQCA 5J2QA 5KFUA 4DLEA 4NLKA 2H5XA 1NKCA 3PX0A 2JLEA 4CHOA 2J6UA 5J2CA 1CEZA 4FYDA 3EW9A 3SUQA 2FPMA 3K5MA 4W5OA 3ZT4A 4F93B 5DGBA 4M3ZA 2PZSA 1NK5A 2RN2A 1N5YA 5HMMA 1S77D 3DYAA 5HRPA 1JN3A 3RB4A 3ORYA 1N56A 1ZQBA 5EOZA 1ZQYA 4Z6DA 3VQAA 4I2AA 5EWFA 3HP9A 3LPUA 3RB3A 1SL2A 3NE6A 2IC3A 4ID5A 3HW8A 2PFOA 2HHXA 1ZQQA 1RCHA 4PGXA 5J2GA 2M9NA 4Z6CA 3MFHA 2ZJAA 3RJGA 5L9XA 1EXQA 4KHUA 4I7FA 3T5JA 4P4OA 4E0DA 4DFPA 1REVA 3QNOA 3TAEA 4DSEA 1NJWA 2FBXA 2OPRA 4W5QA 3ISBA 3MDAA 2D0CA 3AVAA 1BPDA 3A2FA 5KG4A 3OYIA 3IAYA 2DPJA 2ZUBA 3HP6A 4NCAA 4RW8A 3TAPA 1UAXA 1CLQA 5CZ1A 2ETJA 1LB2B 2V9WA 4O3SA 2BKEA 4KLTA 4MQ3A 3NF9A 4IRCA 4YVZA 7ICVA 3M9OB 2I5JA 3QZ8A 4QOZB 3DOKA 1XHXA 3RMAA 1TK5A 1MQ2A 4ECSA 1HMVA 4CF0A 1LWCA 3GDXA 4DSFA 4IQUA 1JL1A 5E41A 3RJJA 2ATQA 3OYMA 9ICTA 1MSWD 3MXJA 2FMPA 4KTWA 2NRTA 4MF8A 2P5OA 4GXKA 3L8BA 4PH5A 1BPXA 3AVIA 5KT5A 4CIGA 2KN7A 4KLSA 2XY7A 4G1QA 2ZD1A 1TKTA 3GQCA 5TZVA 4K4GA 1NJYA 4HHTA 1JLBA 4NM1A 1WSEA 3KHLA 4B8CA 3LDAA 3C94A 3MXIA 3QERA 1HQUA 3DLRA 4AHCA 2P5GA 8ICOA 3VQ8A 9ICLA 4PHAA 3BQ0A 4CJSA 2Q3SA 3OGUA 4DS5A 3MGHA 3N4MB 1MU2A 1QSSA 4EP5A 4I9LA 3MEEA 1A76A 3LDSA 1VSMA 3OS0A 2ZUDA 5BPCA 1ZQAA 1EX4A 4DTOA 4CGHA 1RT5A 4BE2A 5KFWA 3EWAA 5DQGA 1J54A 4M9GA 4B9TA 7ICEA 3P5JA 4KKOA 3ISCA 1S9FA 1ZQLA 3AUOA 4GC7A 3SCXA 4ECYA 1SKSA 3C95A 1HUZA 1X1PA 4M9HA 2BCVA 2HHVA 7ICMA 2R8GA 2JZBA 3OYFA 4CJRA 3KLFA 1KVAA 3AV9A 1RXVA 4IBNA 2VG6A 3BJYA 3PMLA 4E1MA 5BOLA 3IHQB 4B3OA 8ICSA 4QZEA 3UPQA 1A77A 1BVSA 1WCNA 1IKWA 1S5JA 3KLGA 3V7KA 1YT3A 2JGUA 4TUPA 4EBDA 4KLMA 8ICHA 7ICTA 1LWFA 3PX4A 4CEOA 4OLAA 3D45A 5KFGA 3LAMA 4JWNA 4F8RA 1UA0A 1ZQSA 2A1RA 1ZQTA 2O4IA 3C5GA 2R8HA 4CEFA 1K6YA 1QLNA 2G8KA 4KHQA 4FW1A 5HMLA 1C7YA 4ED1A 4EEYA 3C1ZA 3DMJA 1J5OA 3KHHA 5KFYA 1BPZA 4LVSA 1JIHA 1B22A 1LAVA 1NKEA 1S6QA 4FM2A 2YNHA 2E4LA 1L5UA 1NK6A 1ZYQA 5KT6A 4YP3A 4GLXA 3RTVA 1SUQA 4RW6A 4UBCA 4CEEA 9ICOA 4CF1A 2E6LA 1BQNA 4IG3A 3OYCA 3HPHA 3FDSA 4OKEA 2R8JA 4M42A 4Y1DA 3K4GA 9ICAA 3ZSVA 3LZIA 3OY9A 4CEAA 3QEBZ 2RPIA 3JPOA 4KN4A 3LK9A 3K58A 4LSNA 5DG8A 4YFUA 1KDHA 1RBTA 9ICPA 5IIIA 1D9FA 4IDKA 2BPFA 1HPZA 1TKDA 4DL7A 1C1AA 1TGOA 2HNZA 1C1CA 1K1QA 5HHIA 1BI4B 1B9DA 2ZJ8A 4DSIA 4I2CA 3O3FA 4XUSA 2I9GA 3V6HA 5EWGA 2AQ4A 2JEIA 4ZTFA 4DL3A 1WNSA 3QEIA 3PW2A 2KFNA 3SZ2A 3D0PA 2C2RA 4CEBA 4IG0A 2KTQA 3MAQA 2XC9A 3OYLA 1KFDA 4YMMA 4FBTA 4BGDA 3H4DA 3VQ5A 5C5JA 1RBRA 4FJXA 4UAWA 4I2BA 1NJXA 2VA3A 3B6PA 4BE1A 4KI6A 3OYGA 3AVBA 4XIUA 5F9NA 4I27A 1Z25A 2G8FA 1TK8A 3KLIA 9ICUA 5DBAA 4NLZA 1ZQXA 3AVHA 4CFCA 2QK9A 5J2FA 2E6MA 5KFSA 5I3UA 1BI4A 2HMIA 4N47A 3U3YA 4FJJA 3NH0A 4F5PA 1RTHA 1IKXA 4BDPA 2ASJA 2PI5A 3OYJA 2F1IA 4ZHRA 2UVRA 4BXOA 2NUBA 3Q8LA 4F91B 9ICHA 3ZT2A 2G8VA 2W9CA 1GOAA 1L3SA 2BANA 4ECRA 2VANA 4FBUA 1T03A 2KZZA 9ICEA 2PYJA 4FS1A 3ASMA 5KFDA 4FK0A 1CZBA 3VA3A 4HUFA 3JPRA 4O3RA 4FVMA 4DTRA 1HQEA 3AVFA 3MGIA 5IINA 4R63A 4YR2A 1D8LA 4PA1A 1A5VA 5DGAA 5KFNA 1U47A 4CJKA 5KG1A 4CJ5A 3G6XA 2R8KA 4DF8A 4CFAA 3CG7A 5CYMA 2XY8A 3CFOA 3NF7A 5HP4A 1U9LA 2HHTA 1VSFA 3K75D 5L1LA 2Z1IA 4QZCA 3NDKA 2MUTA 1RZTA 3C5FA 1HYVA 3I0SA 3O3HA 5L1JA 2AGQA 4W5TA 1RBSA 5BOMA 2IAJA 5I42A 3Q8SB 3RJIA 1RT1A 9ICRA 3C2MA 4R5PA 4KLGA 9ICGA 1JLGA 3H7IA 3SQ2A 3VQ9A 4M45A 4PHEA 1RXWA 2IBKA 4NY8A 3V6DA 2VA8A 4O5KA 2P1JA 4ECTA 3VQPA 1S9GA 1WSFA 4CGIA 2DFLA 4RQ0A 4LSLA 2XHBA 4AILC 1N48A 5KFXA 2EHGA 1SKWA 1BCMA 4OKKA 3H40A 5HLFA 1JKHA 1AROP 4KLQA 7ICNA 3VQQA 5KFZA 2RKIA 3M8QA 1T4GA 4IQWA 4KAZA 3GFKB 4ED7A 1TK0A 1WCLA 4JRQA 4YMNA 4CF8A 1J9AA 1VSEA 4CK1A 1IKVA 2UVUA 3V7LA 1VSHA 2BGGA 4DSKA 2WOMA 4B08A 5KT7A 4O5CA 5J0PA 3V6KA 3RJEA 4CJUA 3VQ4A 1EKEA 4LY7A 2ISPA 1ZQMA 3RJFA 3KIOA 3KD5E 1BISA 2QKBA 4E19A 5CJ7A 1ITGA 3AA2A 1XS9D 1S6PA 3ZSQA 1JLEA 1WLJA 8ICKA 2LYHA 4OJRA 3QIPA 1XSNA 4DTXA 1S1WA 4DQPA 4QZ8A 1JXBA 5FROA 4F4WA 2RDJA 3TFSA 3DLBA 1TKZA 1MQ3A 3HT3A 4UAYA 1TV6A 2YKMA 4RT3A 3HPGA 3JYTA 4B9UA 8ICFA 5IIOA 2G8UA 4CGGA 4DTNA 5HP1A 4AHSA 4IFYA 5CP2A 4JS5A 3IM1A 5CY4A 5KFJA 1XSPA 4AHVA 1H38A 2NRZA 3BQ2A 4FCYA 3AO5A 3ZDBA 1JLQA 4DG1A 3VA0A 4HYKA 3PW5A 1ZQEA 2HHUA 5J0XA 3LANA 1RDAA 4J2DA 1SV5A 2W9CB 3PW0A 1GOCA 2FPKA 4EBEA 4M3RA 4FZZA 1C6VA 4RW7A 1FK9A 3NGYA 2IHNA 3M9MB 4E1NA 4PHPA 7ICSA 3LP3A 4BXOB 3SYZA 3LP0A 2G8IA 1KCFA 3Q8KA 3AVKA 4BWMA 4EZ9A 3GV7B 3S3NA 4QCLA 3EYZA 3KLHA 2A1JB 5JUMA 4QWBA 2HHSA 3O3GA 4GXIA 4FZYA 1ZQCA 3M8RA 2B21A 1DOQA 4F4YA 2KFZA 4DL2A 4QZ9A 4UB1A 1VRUA 1ASUA 2BHNA 3DOLA 4TUQA 5IILA 5F9LA 3ZDAA 3MR2A 2DY4A 4Q44A 2IDOA 4KITB 4QZDA 1RTJA 4I2IA 4UB3A 3HYFA 4RQ3A 3MDCA 5KGWA 3K5LA 2BE2A 3SUPA 4YFKA 4Z6EA 2HVIA 4DQSA 5IIMA 4ZTJA 1MC8A 5J2DA 1D5AA 5J2AA 4FLZA 2IA6A 1VSJA 5DKWA 1WN7A 3OSPA 3H08A 3V9SA 3ZD9A 2JEGA 1Z26A 4J9OA 4M2YA 3TABA 4M3XA 2B6AA 3TI0A 2DFHA 3G10A 3JPQA 1BPBA 3MEDA 2YNIA 5CWRA 9ICQA 4AHRA 3RB6A 1NK7A 5DBBA 4IFVA 2NRWA 3E01A 4CGDA 1NK0A 3AVNA 4YNQA 4C8MA 4TSXA 1A5WA 1S0MA 3NF6A 7ICOA 4MFCA 1QQCA 4J2EA 3LP2A 3T3FA 4E7KA 1WSIA 3Q8QB 4ELUA 3C6UA 1B43A 1J53A 3L2WA 3HO1A 4MF2A 2FBYA 4B9VA 1UOCA 1S9EA 2QXFA 1RT3A 1ZQJA 2W9MA 3ISDA 4KLEA 1S76D 3I0RA 4LZDA 3E2EA 4AHTA 3RR8A 3VQBA 3ZSWA 1KVBA 3VQ6A 3RRHA 1Y97A 4Y1CA 4RPZA 5CYQA 1QS4A 3L3UA 3ULDA 3MABA 2F8TA 3LPTA 4LH5A 3DI6A 2Z1HA 4KO0A 1VSDA 1RT6A 8ICWA 3B0YA 7ICQA 4RQ2A 5DK5A 2KW4A 1D8YA 4HUGA 4J9PA 3GIMA 3NTUA 5J29A 4QWDA 2OZMA 3ZSYA 4E89A 1LWEA 3LALA 4KLLA 2BCSA 3HM9A 4IRKA 1LW2A 4JK1A 3HXMA 3AVCA 5DB8A 4J9NA 1ZBLA 4HCBA 7ICGA 4R65A 3SI6A 3MR5A 4FJ9A 4DQQA 2ZJ5A 1Y88A 1TAQA 5D46A 3LWMA 1FXXA 4F4XA 3QNNA 3NBPA 2F8SA 4XA5A 3LZJA 3OYAA 3GV5B 4C8KA 1KVCA 2X78A 1L3TA 4UB5A 4QZHA 3PR5B 4R64A 1JX4A 1RT4A 3V7JA 4LH4A 5KFRA 5D4BA 4YCXA 1VRTA 3NFAA 1T3NA 5DDMA 2HNYA 4EP4A 1VSIA 3N97B 1C0UA 2BQ3A 1RNHA 3UXPA 5SWMA 3RMBA 4J9QA 4I2QA 4E7HA 5J2IA 3KD1E 3OSNA 4CF9A 1HJPA 2Y1JA 3GILA 2ZE2A 4F5NA 5KFVA 1U49A 2ZTDA 4K8XA 5KG5A 3LAKA 1VK0A 2AGPA 4C8OA 3SUOA 3QEXA 3VQ7A 4PUOA 4Z4HA 5KT4A 1QHTA 3V9ZA 3KK3A 4CK2A 4R66A 4DL4A 3GIIA 5HHHA 4J9KA 1QSYA 4AH9A 5KRSA 3KKSA 4DOBA 3TANA 1B9FA 5KFIA 5KFFA 3QEPA 3O4QA 3BQ1A 4KLDA 5KFMA 4RU9A 2D5RA 4QAGA 4G3IA 4RNMA 5FRMA 1DTQA 4JUZA 1ZQUA 3KK1A 4O3PA 1RPLA 3AVJA 3K2PA 1QSLA 2V4RA 5L1IA 9ICKA 5J0TA 3SV4A 5DMRA 1JXLA 4KHYA 3SJJA 4B9NA 3HX0A 4O44A 2DPIA 3I8DA 9ICBA 4FJKA 1ZQPA 3B6OA 1TVAA 2KQ2A 3L3VA 3OYBA 3V1QA 2UVVA 4PY5A 3HPOA 4PHDA 3OHAA 5J2KA 3T5LA 2EX3A 4DTSA 4QWAA 3GIJA 5J2NA 2OYQA 4CF2A 4OGCA 1IXRA 3NF8A 4DMNA 1WSJA 3V1RA 4ZH4A 2VWJA 5FDLA 3ZDDA 4Z4EA 4CJFA 1S97A 5DG7A 3CYMA 1Q9YA 4M3UA 5J2BA 3AVGA 2QKKA 1X9WA 2HB5A 2DTUA 1BIUA 3DLHA 7ICJA 3CM5A 4KMUA 3RWUA 4OKJA 3JPSA 4DOAA 3HL8A 5DQIA 1DLOA 3DRSA 2Q0ZX 2FLNA 4O55A 3S3MA 1U4BA 3V6JA 1S1XA 4P2HA 1XU4A 7ICHA 3Q8RB 2C22A 4HUEA 1KTQA 2PFNA 1V9PA 4ED0A 5KG6A 3PX6A 2BR0A 1SL1A 1SL0A 4CE9A 5KFPA 3K5NA 1BIZA 3F73A 4KHSA 3NGZA 2UVWA 3V9WA 3HJFA 3EZ5A 4FS2A 4F5QA 4DU1A 5DLGA 2BCRA 1DTTA 4RQ5A 2OPQA 4KTZA 2A1SA 2C2DA 3ALYA 2XY5A 3S9HA 3DLEA 2ASDA 3L2RA 1ASWA 2PFPA 4R8UB 2D0BA 3FFIA 5KFKA 2XRIA 1KFTA 2ZTCA 2NRVA 5DG9A 1C0MA 1TKXA 3ZDCA 2DFFA 3CQ8A 1CUKA 1UA1A 1ZQRA 2O4GA 4RQ6A 4FJ7A 1RDBA 3OS2A 4IQVA 5C24A 5HBMA 3SPYA 8ICLA 1W9HA 3G6VA 1UT8A 4CHYA 3K59A 2NRXA 4CJPA 1HYZA 4KLUA 4RNNA 4PWDA 2C2EA 3QO9A 1C1BA 8ICAA 4O0IA 1COOA 1S10A 1T8EA 4CGJA 5DQHA 5J0YA 3SUNA 4Z4IA 2VG7A 4N41A 4W5NA 9ICNA 3ZSXA 4UB4A 4KB0A 2GWSA 2LSNA 5KFEA 4OPJA 3OYEA 1NJZA 9ICVA 4KTQA 1NOYA 2DFEA 8ICUA 4NCGA 1ZBIA 2BPCA 2F1JA 4M6WA 4ECQA 1ZQIA 1JLCA 4BDZA 4E3SA 2G8HA 4CECA 3DRPA 2B4JA 3V81A 1S1UA 4MFFA 3CFRA 2X6NA 5KG3A 3O4NA 5KG0A 1VSKA 4F3TA 5C42A 5T7BA 3EPGA 4J2AA 1HRHA 1LV5A 4L8RB 4QW9A 2AGOA 4B8AB 3UQ2A 3SNNA 3T1AA 5J2EA 3AO2A 2ASLA 2XCPA 3C2LA 5J2PA 5IIKA 5KFLA 4RW4A 3GV8B 4KHNA 4NLGA 8ICQA 2A1JA 3H4BA 4X5VA 5KI6A 3PNCA 8ICPA 1HYSA 3QEWA 4H4MA 4CFDA 5CZ2A 3HVRA 1BQMA 4QWEA 2FMSA 3WNGA 1U04A 3VQDA 2HNDA 1X9SA 2C28A 4OGEA 9ICJA 4UAZA 4EYHB 3AA4A 1X9MA 2AQ0A 2ZUCA 3JPPA 1O1WA 3SI8A 4I2PA 4M3TA 2HVHA 3PR4A 2GBZA 4J9RA 3IS9A 3RB0A 1RBVA 4KFBA 4TUSA 4FW2A 3ZSZA 3RJHA 3NH1A 4DOCA 4CIFA 5KFQA 3RAQA 1TV9A 1G15A 4DLGA 3AA5X 2HHQA 3OHBA 3MR3A 2KZMA 3P1GA 2V4QA 4YR0A 4O0JA 4O3OA 2BQUA 4I28A 1R0AA 2GUIA 2HW3A 4FJHA 4CCHA 4KB1A 3KHRA 4DFMA 4YN4A 2BQRA 1RT7A 3S3OA 2PXIA 4NM2A 4CJ4A 3QZ7A 4FK2A 1RDCA 4Q0BA 3QESA 7ICUA 4UB2A 2ITGA 4DL5A 2FMQA 1EP4A 3ZT0A 3OYKA 4RQ1A 1ZBHA 5IIJA 3PUFA 4YMOA 4HVJA 5KFAA 3F9KA 1S1TA 3HVTA 5J2JA 4C8LA 1FKPA 2G8WA 4Q8EA 4QZBA 1DGSA 2YV0X 5KT3A 2OWOA 1NK9A 4YXJA 1WSGA 4M0AA 4RZRA 5D3GA 3NHGA 3HWTA 4TQRA 3RBDA 5KFTA 4NYFA 2WONA 4KRFA 4Q43A 4EYIB 2FBTA 1IO2A 4DF4A 1L3VA 2P51A 1NOMA 4RQ4A 4RT2A 4JWMA 9ICCA 1UT5A 8ICEA 2D0AA 1ZBFA 4FK4A 3TARA 4M41A 2AU0A 4RPYA 1QTMA 4CIEA 1Q8IA 2VG5A 4PGYA 3MBYA 1JMSA 4O5EA 9ICMA 2OA8A 2XCAA 2XGPA 4RNOA 3V9UA 4QWCA 5HROA 4F4KA 4K4IA 1SZPA 5L1KA 4DFJA 3AU2A 1D9DA 4F5RA 2FLPA 4Z0UA 1NOZA 4IR9A 3TAGA 3PW4A 4KLOA 1S0OA 1S0VA 1Z00A 4F5OA 4ECZA 3V9XA 5J1EA 3DM2A 3V1OA 2P6RA 4F2RA 3NH2A 5D49A 3TR8A 4KLIA 4I2JA 3OJUA 1KLNA 2IOCA 5HRNA 2IS3A 3OJSA 4ED2A 8ICGA 4J9MA 3CFPA 4ID1A 3VQEA 4OPKA 3P83D 3MECA 5SZTA 4FJ5A 3UXOA 4FXDA 4FZXC 4Q45A 4O3NA 3RJKA 4BWJA 8ICBA 4YG2A 3HSTB 2IGIA 4OLBA 1HJRA 3RR7A 4FJNA 1HNVA 1I3AA 2PI4A 1YTAA 4KLFA 5CR0A 4O4GA 4RPXA 8ICXA 3G0ZA 4PGQA 3NAEA 4R8UA 4QZFA 1EXNA 4DSLA 2X6SA 4KREA 3B0XA 4DFKA 4I2FA 4H4OA 4B9MA 4DSJA 1ZJNA 2JEJA 4UQGA 8ICYA 4MEXA 3IG1A 5JS2A 4J2BA 1RTDA 4N5SA 2Z1GA 3LWLA 3TAFA 4ECXA 4J9LA 4ELVA 3QEVA 3G6YA 4ECWA 3OYHA 1RDDA 8ICMA 4CESA 1TVRA 2JEFA 3SPZA 3T5HA 3BQTA 4K8ZA 2W8LA 3WNFA 4O3QA 4O9MA 4IKFA 3DLGA 4YD2A 8ICTA 5HRSA 4LZGA 1PZNA 4I2DA 2X74A 4CFBA 2ZTEA 3SQ0A 1ASVA 4M6WB 4KV8A 3DLKA 4ED6A 4CJVA 3QINA 5DLFA 3KKRA 1ZQDA 7ICPA 3ZT3A 4FLYA 3JSMA 5KGXA 2VWKA 4TQSA 4FJLA 3C23A 4FJIA 4I29A 7ICLA 3ZSOA 1B92A 3TAQA 4JV2A 4N56A 4DTPA 5J2MA 8ICCA 3SV3A 1WAFA 3L2QA 4QZGA 2IMWP 1RTIA 1SKRA 3BGRA 4M3WA 4DTUA 1KEJA 3AVLA 3RH4A 4FO6A 4FLUA 1NKBA 3EPIA 3C1YA 4JLHA 3AA3A 3RMCA 4KLJA 3PV8A 1N6QA 1WAJA 4RQ8A 5CA7A 1U48A 2J6SA 1ZJMA 3FYHA 5J0WA 4BDYA 1ZQKA 1NK8A 4HTUA 2W8KA 4FJMA 3ETLA 5KRTA 3GIKA 4M9NA 5KG2A 2WTFA 4CEZA 1U45A 1TAUA 3TQ1A 1BPYA 4I2EA 3NGIA 4O5BA 5C25A 1IH7A 8ICZA 2XY6A 3MR6A 3RH5A 5HRRA 3LP1A 4RQ7A 4NCBA 1UWBA 3AU6A 4CK3A 7ICFA 4I2GA 1RBUA 1CZ9A 3WNEA 4BE0A 4JV0A 2YHAA 2ATLA 2ZQBA 4F3OA 4FLVA 4Z4CA 2ISOA 2KZ3A 2P6UA 4RUAA 2FPLA 3PW7A 1W0HA 1JXEA 2F96A 3V4IA 3H8SA 4I9QA 1ZQWA 1A5XA 3T5KA 5KTQA 3L2VA 3ZDEA 4DU3A 4DWIA 1XSLA 2OZSA 4Q8FA 4CHZA 1K1SA 3HK2A 4JRPA 4CHQA 3U6FA 1ZQZA 2BCUA 3OYNA 5EWEA 3QETA 7ICIA 1LAWA 1GOBA 1Z00B 4W5RA 2BPGA 2GV9A 3JPTA 3OS1A 9ICXA 4KI4A 4CJQA 4M3YA 2P66A 3CM6A 1KSPA 4KPYA 4CGFA 7ICKA 4YR3A 1BHLA 3KLEA 4DL6A 4P4PA 1ZQGA 3ISNC 4K4HA 4QZAA 4IQTA 5DDYA 1IKYA 3PY8A 1IG9A 3KHGA 4H8KA 4DTJA 4KHWA 2PFQA 2AJQA 5EU7A 3UQ0A 1T7PA 4IRDA 4CEDA 3C21A 1ZQOA 3WNHA 4LD0A 4N76A 1NK4A 3ZD8A 3C6TA 4M9JA 1EETA 4QZIA 4ECUA 5J2HA 1BL3A 5HNKA 5KFCA 1RYSA 4YD1A 4F4ZA 4XRHA 4F2SA 5DBCA 8ICRA 1QE1A 4CHNA 4GC6A 3Q8MA 4B9SA 5CHGA 4DS4A 4I2HA 4CJLA 1YTUA 4UBBA 1Q9XA 3U3GA 3K57A 1BGXT 1BPEA 2W9AA 1F21A 3THVA 3MXMA 4P4MA 4FJ8A 1XO1A 4FJGA 2MAXA 2BGWA 3RAXA 2W42A 1ZQVA 4C8NA 4Z4GA 5J0QA 4Z4FA 1S1VA 4EBCA 4AHUA 5J0OA 2FLLA 2RF2A 4F50A 4EZ6A 5KFOA 3KK2A 4YXMA 4ED3A 4CJTA 4KLHA 4FM0A 5KFBA 3T19A 3V72A 3AO4A 4GMJB 2HHWA 4ELTA 2XGQA 3RMDA 3PMNA 4CJWA 3TFRA 1XI1A 9ICSA 2RDIA 8ICIA 4B9LA 1HUOA 7ICRA 4DEZA 4YQWA 2IHMA 1Z3EB 1JL2A 4RG8A 9ICFA 2YHBA 3SQ1A 3H8JA 3NGDA 4PQUA 3UXNA 3PVXA 3OYDA 1ZQFA 5FRNA 4BACA 4OVLA 4DQRA 8ICVA 4DTMA 4M04A 4FLTA 3MEGA 1LW0A 4CJEA 1I39A 1ZETA 1TL3A 4GXJA 4RUCA 4GVMA 4Z6FA 4QW8A 2B5JA 5KG7A 1BCOA 1VSLA 3QE9Y 1T05A 3RRGA 1ZBUA 3KJVA 3UIQA 1CXQA 4JV1A 4IR1A 3NCIA 3QEAZ 2OPPA 2J6TA 1L3UA 4TURA 3RBEA 4HCCA 3Q8PB 4CJ3A 4MFAA 5JS1A 4ECVA 9ICWA 4NYNA 2Y1IA 1KRPA 2BCQA 1XC9A 3H8WA 3QIOA 1HNIA 3DRRA 3MFIA 4ICLA 3BDPA 4FLXA 2BDPA 8ICJA 1RILA 4KN7A 1WSHA 1FKOA 3VN5A 4MEYA 5DB9A 4JS4A 2ALZA 1KLMA 3TWHA 2FBVA 2R8IA 5J0SA 4M9LA 4E7JA 1S0NA 3M9NB 9ICIA 3M8SA 2W9BA 3ZCMA 4DO9A 3ITHA 5KT2A 5CB1A 3RH6A 3M8PA 2FC0A 4Q5VA 2MUTB 3L2UA 4E7LA 1JLAA 1TL1A 4GW6A 3ZSRA 3IRXA 3K5OA 3AVMA 3AO3A 3PO5A 4J9SA 3JPNA 2VA2A 2YNFA 1RT2A 4ED8A 4E7IA 1IM4A 2I1QA 1KFSA 5J0UA 4NLNA 1CXUA 1XWLA 4RW9A 2W9BB 1RYRA 4PPXA 2PY5A 1ZQHA 1JLFA
chains in the Genus database with same CATH superfamily
2OKQA 2PYLA 3Q24A 2J9DE 3C29A 4O3MA 1ZAVA 5DB7A 3AAQA 1W2BR 1JCGA 1KD1T 3PO4A 3JQKA 5AQHA 5TKWA 1V5IB 5JJBA 2CZ4A 2F3NA 4WK3A 2YKNA 1GLEG 4F92B 1IG6A 4FM1A 8ICNA 3OVNA 4CO0A 2EAMA 3C19A 3C2KA 3T79A 1XHZA 1FIQA 2OPSA 5K14A 3VQCA 5IM0A 4NXNF 5KFUA 4DLEA 1K47A 4RCHA 2H5XA 2CJQA 3PX0A 1S99A 3QATA 5C15A 2J6UA 5J2CA 5BYRA 4X4NA 2U2FA 3DMJB 3EW9A 2M8HA 4XTTA 3M3ZA 3QDKA 4NLQA 5AM3A 3K5MA 3JSBA 4PWDB 2Y0BB 1E6VB 3IG5A 3ZZYA 2KMDA 1S77D 3BDEA 5B09A 4O4GB 5HRPA 1JN3A 1N56A 4CP5A 3W8PA 4AP9A 3BB5A 3CW2C 3VQAA 1WKJA 2NYHA 3HHNB 5EWFA 3LGMA 3N6MA 1JK9B 1WG4A 3RB3A 4KQZA 2HHXA 2UV8A 4CLSA 5BJRA 5E2QA 2CPEA 2UUCJ 2R42A 2KT5A 4OYWA 1HQ2A 5L9XA 4KHUA 2MQQA 4KBIA 1HWLA 4P73A 3W61A 3QNOA 3TAEA 1G6BA 2PA8D 3ISBA 1HNZK 2E7WA 3NL0A 3WKDA 1BPDA 3O6QA 5AKXA 4ZLNA 3A2FA 1IBKF 1RA7A 3IAYA 3P8BB 2IA0A 4W90B 1CLQA 1FXRA 2ETJA 5M2PA 3D1OA 4O3SA 4CLYA 4DX7A 4GRSA 2HBJA 3M1FA 2HURA 2M3DA 4OX8A 4YVZA 2VPYB 4ZDNA 4P74A 4TY8B 1UEVA 1OY8A 1V4SA 4DV0K 2CQ1A 1FX4A 4ECSA 3KZXA 2E5LK 1IBLF 4CF0A 1LWCA 4ZA1A 3RJJA 3FK4A 2DUYA 3G8QA 1MSWD 3WT0A 2HIYA 3MECB 4KTWA 2NRTA 4FF2A 1B3TA 4OX9J 3N7PD 2BXJA 3L8BA 4C7ZA 4QS8A 4FZLA 3AVIA 1CULA 5KT5A 2YQEA 1VQ6N 4KLSA 2IDEA 2XY7A 3OL7A 2KKHA 4HHTA 1X9JA 4B8CA 2O8DB 3C94A 3QRPA 3I4PA 2V5HG 1YHQS 4AHCA 4YN3B 4WE1B 1FF2A 2WBNA 3U8XA 1HI1A 3CMEN 4DS5A 4U6PA 1BG3A 2PMZC 1S48A 1P8ZA 1A9NB 1EZZB 4UOHA 4YB6A 5AI8A 3DRPB 4LF6F 1Y11A 3ZX0A 1ELOA 3LDSA 4K8RA 4XPCA 4ZVTB 5BN8A 5BPCA 2VQFJ 4B17A 2ZZMA 3DJCA 5GAEP 1RT5A 5K9FA 2HHHF 3V2UC 5KFWA 2VKRA 3RW6A 1J54A 4B9TA 2GGPB 4KKOA 5C42B 4PJ0U 4L6V3 2JH3A 5B0FA 1UVLA 1VQ7N 1TVRB 1TE2A 2GO8A 1SKSA 3NGSA 5AJ3K 5HVFA 5J1NA 4MK8A 3K9KA 2BA9A 1ED1A 1GK8A 2RHQB 1RT4B 3KLFA 3H45C 3LL3A 4FOIA 4K4UA 3WUHA 3LUYA 1APSA 3PMLA 1T03B 4WXOA 3IHQB 4QJFB 4QZEA 1T05B 4EELA 4DUZK 5BR8K 1IKWA 2KOBA 2AEMA 2VICA 2LM1A 3VZIA 4B3TF 5ALDA 1A6LA 4KLMA 8ICHA 1LWFA 5ETMA 3D45A 9RUBA 3HI0A 4P9SA 2P2CB 1UA0A 3THYA 2A1RA 1ZQTA 2G06A 2P9IA 1VHXA 2R8HA 1V3RA 5IS2A 2H3FA 3QMLA 4FW1A 3SR6A 4EEYA 3C1ZA 3O9TA 3HHDA 4JI0K 1BPZA 4MAKA 1JIHA 1LAVA 3DLEB 4CD3A 2YNHA 2ZDOA 3THXA 2BZFA 1IJFB 5LT5A 3PFEA 1OUQA 4MIAA 5KT6A 4YP3A 4GLXA 5CYQB 1BUXA 2FHJD 3CC7S 4AQYJ 1SUQA 2G0IA 4X4TA 9ICOA 4CF1A 3QBCA 3W2VB 1JLFB 5I4MA 3EX7B 2QXLA 2QL5B 1S7IA 3F2KA 2XMWA 4CEAA 4DR6J 1S79A 2PFUA 4LSNA 4BHQA 4I67A 4YFUA 9ICPA 3H2VE 2FHJA 3GFHA 2VKZG 1MWMA 1TKDA 1C1AA 4A8WA 4G1IA 4KX5A 1H7WA 2WF7A 1C1CA 3MX2A 1Y7PA 4JHDB 3HDSA 1B9DA 4OI3A 4I2CA 4NLDA 1WKKA 2YWHA 3O3FA 2LDIA 2D0OA 4LIWA 4F3MA 2E7XA 2CG8A 2HK2A 4ZPCA 4ISGA 1HBUB 2R7UA 2MY8A 5LXRA 5D3GB 3GR1A 3QEIA 3AT1B 1L7NA 3SZ2A 4ZMMA 2AJ1A 5GAGP 4OJ5A 1K44A 2K8GA 1QZ6A 4USHA 3DRSB 4CLUA 5AK4A 3M1VB 4ISFA 3VQ5A 2HQIA 3FGVA 1OY6A 4QYRA 2HCFA 4KI6A 1VQ9S 5F9NA 2G8FA 1H3DA 1S49A 2IDLA 4KH5A 2XB2D 2BJ7A 5DBAA 4NLZA 4X65F 5HQMA 4H4KC 2GAHC 1PK3A 3WK8A 5I3UA 2EXUA 4N47A 1RB0A 3D28A 1RTHA 2P9SA 4US8A 4ZHRA 2ZE2B 3CMAS 3EKSA 2W25A 1H98A 3E01B 3Q8LA 2G8VA 4UB6U 3MCSA 3EUNA 4FBUA 2KZZA 3CB4A 9ICEA 3NXZA 2C3OA 5F3TA 1VIOA 3ASMA 4NE9C 3HVAA 4G9ZA 4YY3F 4FK0A 4GKJK 4HUFA 1CQMA 1CJVB 5IINA 4R63A 4FL9A 1DT9A 1S1TB 1P9QC 5DGAA 5KFNA 4WWSA 1WNEA 4CJ5A 3G6XA 2R8KA 2ZVIA 2Q0UA 3FBEA 3DWLA 1HKAA 1JJ4A 3B78A 5ADXA 1U9LA 1RLDA 1VSFA 3ICLA 4P0PA 4A8FA 2GEMA 5ALPA 2EWHA 4X4VA 1HYVA 4KH6A 2ZOFA 4CI0B 4A5BA 3OTDA 2FJDB 2W24A 3HKZC 3D6HB 2YWGA 3TJ9A 2DR8A 2LA4A 1OSCA 3LYSA 2FVCA 3THYB 4FZNA 4KLGA 2B9WA 2ROPA 1JLGA 3H7IA 2R7VA 4M45A 1VIXA 5L8RC 4C11A 5ALEA 3EMTA 2LM4A 2CQ2A 4GKKK 1S9GA 4M5DA 1RWMB 1WSFA 4CGIA 2DFLA 2XHBA 1PC5A 3CD7A 2ZD1B 4N77A 2J76E 5HLFA 3HF5A 1ZA2B 4KLQA 7ICNA 5KFZA 1RJJA 1W2IA 2L9DA 3K8WA 4ED7A 3BO2A 2VFVA 2NUUG 4JRQA 3SMPA 4JI5F 1Q86O 4K2JA 1IKVA 3V7LA 3L3CA 3UR3C 2FVSA 4CLFA 2WOMA 4B08A 5AIBA 3LM9A 4AYBF 1H6KX 2I6XA 3RJEA 4CJUA 2CN1A 1MU2B 2DCUB 4OYMA 1YG0A 3LDNA 2ES6A 3CDBA 1HBMA 3KUEA 5LL6d 3HHLC 1H73A 4PKHA 1LQ9A 5CJ7A 3ZSQA 3R5AA 3UMGA 1WUDA 5JU5A 8ICKA 4L3QA 5EX3A 2LYHA 5D4LA 2G13A 2K4PA 2VL1A 1RT6B 4F4WA 5E3PA 1PYTA 3J8AA 5IIOA 1G3OA 3FMWA 4BRPA 3MCOA 1P90A 4DTNA 3PRDA 2JWNA 1T3OA 1SPBP 1AZSA 2O66A 1KBRA 2IC3B 4MKYA 5CY4A 2A19A 1VBKA 2VU5A 5ELZA 1RWKB 3DGVA 4JKAA 3BQ2A 2WVDA 5HVHA 4FCYA 4FWLA 4W4MA 3AMZA 4K4VA 4J2DA 3PW0A 4MO4A 2JZ5A 4FZZA 2CQCA 4KHPF 3NGYA 2BJ9A 5L9NA 3Q83A 2CWKA 1KQQA 3HZEA 4PABA 3M9MB 2B5JB 4JD2B 7ICSA 1HBOA 3KLVA 3LP0A 2G8IA 3Q8KA 2VFTA 3VAKA 4FP9A 4BWMA 3LGNA 2NSBA 3O5TB 2J5AA 1RBOB 3NGKA 4KPCA 4JOUA 1VHIA 1QY7A 1UPMB 5FPEA 5AI9A 1UEUA 4Y3CA 2E1PA 2MKHA 2JLFA 4GXIA 1YVFA 2EKYA 3F2BA 1S22A 2YX1A 4F4YA 2K2PA 3EDQB 4UB1A 1TUVA 1Z2LA 3H1QA 3FGUA 2VG5B 4AXIA 1QUPA 3ULEA 4TUQA 5IILA 3MI7X 1Q8LA 4DZDA 3E9PA 4FKYA 3MR2A 2QWOA 2VZ9A 3RW7A 2OD6A 3RAMA 2DY4A 5ALXA 4I4BA 2BM1A 4CF3A 4KITB 2WF6A 1YX2A 4LFBF 3WIUA 4PL7A 5AKKA 4UB3A 5BXIA 2ZZTA 4IDHA 3K5LA 5AQVA 2QJ3A 5IC6B 1S59A 5A8RA 4I6WA 3HT0A 1PIEA 3MPWA 4L3KA 3U1NA 2RDDA 1RWXB 3VAIA 1U1OA 1S4FA 1VSJA 2K4HA 1N5WA 1HD1A 2LQ8A 4CLKA 3V9SA 4C0OC 4DU8A 2DITA 3EZUA 4ED4A 1WORA 4J9OA 5E26A 3J7AP 2W03A 1K9MT 4B1VA 3UD5A 2KFYA 2DFHA 5AQYA 3G10A 3MEDA 2YNIA 5CWRA 3ENOA 2IPOB 2CPJA 2WVBA 5DBBA 4IFVA 1SC1B 1C4AA 1NK0A 1PBUA 4YNQA 3HHLD 1IR1A 1NDLA 4B3RK 1V4TA 1X4CA 1WSIA 3Q8QB 4KH4A 2DHXA 1B43A 1Q53A 2MSNA 4P6QA 3R5CA 4IQXA 2H5IB 2JH1A 2VIXA 5LMNJ 2E9ZA 4B9VA 5ALRA 3C15B 4GV9A 5KPTA 2OUGA 5KAFU 1VQYA 4YS2A 4H0TB 1IWGA 1RT3A 1HW9A 2B6AB 1LWFB 2W9MA 3ENAA 1C4CA 4NZ6A 5CYMB 3WEEB 2HGLA 1O08A 3E2EA 3MOZA 3WKAA 3ZSWA 2DBYA 3FZ2A 4WYWA 1GNKA 1KVIA 2ZWPA 4Y1CA 1S57A 3MABA 2F8TA 3CD5A 1X31C 3ENBA 1KAXA 2YNGB 4G1QB 3N4WA 1V9OA 1UVIA 4NZ7A 2KW4A 4J9PA 3GIMA 3NTUA 2X1FA 3T1YK 2OZMA 1UJ6A 3ZSYA 2ZJQL 1RKJA 2OFGX 4PAAA 2K60A 2KIWA 4IRKA 1LW2A 3ONQA 4DPOA 1ZBLA 1MROA 7ICGA 2FSJA 4DQQA 4LF4F 1Y88A 4DV4K 3QU4A 5D46A 4Y00A 3QNNA 3NBPA 4CQ1A 5HAOA 1FDBA 3GV5B 4DX6A 5DJBA 4C8KA 1WD6A 1KVCA 4X64K 2CAJA 2P9LA 4Y0WA 5LJVA 3MWTA 4LR8A 3PR5B 3BN4A 1UQVA 3CRXA 1LFPA 5KFRA 3EO3A 1EETB 1BY9A 4YCXA 1U2FA 1N32K 2VBWA 4LF1A 2RJZA 3CETA 1U0HB 4UB8U 1WWHA 4DV5K 2E9TA 3CQYA 2BQ3A 1RNHA 5EUHA 1M5PC 4UTGA 2CGJA 2YHYA 3RMBA 1F2GA 4JKDA 2JXJA 5J2IA 4B3MK 3VZHA 1XMQJ 3HJEA 1HJPA 2FZKB 2Y1JA 3KJFB 2ZE2A 4DV1K 1PO6A 5KFVA 4TU7A 3BS7A 3KWMA 4K8XA 1OYDA 3LAKA 2R7TA 5HMYA 4YY3K 2N3LA 2KM8B 1VK0A 3BGFA 1TL7B 2NXUA 1AYEA 4DPYA 2NR0A 3ZEUB 4CK2A 2W7OA 4YB7A 4JKHA 3BUZB 2LMRA 3MPDA 5DETA 3UFCX 3ET6A 1Z19A 4DOBA 2XBPA 2RHFA 1B9FA 3ISND 3UQSA 3UO0A 5KFFA 3O4QA 4RU9A 2D5RA 4QAGA 1DTQA 4IEIA 1KWMA 1Q8KA 3QU2A 4DX8H 1QSLA 2DF4B 3H20A 4UZCA 5DMRA 3KKAC 3AAPA 4B9NA 3TA2A 2G0AA 4CRJA 3ONNA 4YOXA 4MKAA 1TL4A 5B7WA 3P39A 3B6OA 1TVAA 2KQ2A 2ZH8A 2OCEA 3L3VA 3OYBA 1EJ7L 3T69A 3V1QA 1GLDG 2ZIVA 3OXFA 4PG4A 4DV3J 4PHDA 3T5LA 2GVZA 2MQLA 1S9GB 4QWAA 2XSFA 2OYQA 4OGCA 3D3BJ 4DCPB 5C2FA 2V8GA 4DMNA 3KLHB 4J37A 4EX7A 2QSWA 4OMFG 1WSJA 4ZH4A 1BA1A 3OL6A 4UY8T 3D0GE 4KT0C 1DQAA 4Z4EA 5AQIA 3D6JA 2GJFA 1Z6RA 5DG7A 3CYMA 1Q9YA 1N0VC 2O6KA 1RWNB 2CPZA 3AVGA 1N34J 1KKHA 1RI7A 4GKJJ 2HB5A 1BIUA 4O5FA 1V3SA 3DLHA 5L38A 7ICJA 3LW5C 2GIQA 3CM5A 1Q5YA 2F4VF 2CUYA 2QA4G 3TSUA 1DGJA 3RWUA 2MMYA 1M5VC 4DHYA 2VIHA 2P9UA 1WOOA 4DR2K 1NPRA 4O55A 4GFJA 2V7YA 3S3MA 1XU4A 2K7JA 3Q8RB 1TU0B 4H5TA 4LF9J 3TTCA 3VGMA 4ED0A 1U1RA 2AD9A 2BR0A 1SL1A 4M63C 4CE9A 4QU6A 3K5NA 4ES2A 4PKGA 2W4CA 3T1YJ 2KD1A 1U6ZA 1ZD4A 1RAEB 2VJUA 4DR7J 3ZX2A 4FS2A 2B4OA 2ZNZA 3VF6A 2UXCF 2VQEJ 3R8YA 4DU1A 5DLGA 1DTTA 3E51A 4KTZA 2FJAB 2C2DA 3O0FA 1BDGA 2XY5A 3S9HA 3TAMB 3PJWA 2L9WA 4WP9A 1DGKN 3PCOB 3OVBA 1ASWA 5K8MA 3HZGA 5DG9A 1TYQA 1TKXA 2L5YA 3CQ8A 2H3IA 4C2MA 3D6MB 5AR0A 1ZQRA 4RQ6A 4FJ7A 1RDBA 4IQVA 2K4EA 8ICLA 1MN8A 2M70A 3SXLA 2NRXA 2ZBIA 2ZFHA 1RTZA 1IBCB 4EO6A 1T8EA 1M1GA 2E5HA 2GHVC 2VG7A 4KGVB 4A61A 3HKWA 5EOYA 2HRTA 1R3NA 1R8PA 4UB4A 2MKCA 3C65A 3ZSXA 2X1GA 1M90O 3IV6A 1KAZA 5KFEA 4OPJA 2X3DA 2XHCA 1GQEA 4LF4K 5EE3A 2DFEA 8ICUA 4NCGA 1ZBIA 2BPCA 3U26A 1JQGA 3CJQA 2GUPA 2QZ8A 2F1JA 4M6WA 3VF4A 2VV5A 2E1MC 1JLCA 2IM0A 4BDZA 2QT7A 1W2BM 1RFQA 3A5MC 2G8HA 4CECA 3DRPA 1S1UA 3FAHA 5KG3A 4PUOB 2X6NA 5KG0A 2DNPA 1VSKA 1FKOB 3I4HX 3G82B 5T7BA 1YJUA 2PFDA 5HL7L 4L8RB 3AD8C 4LJXA 1NMNA 2JFKA 2FUG9 1U1PA 3SNNA 3M8PB 2HS4A 4WFAQ 3T1AA 2A42A 4KKOB 5ALTA 3VQSA 3C2LA 3ZTQA 1EQ0A 3GV8B 4KHNA 4NLGA 2OGUA 2A1JA 4FF1A 4X5VA 5KI6A 3ENQA 3QEWA 5D0RA 2J0XA 2WF9A 3IC1A 2CQIA 1KNZA 4CFDA 3GG4A 3H46O 2DGZA 4IH5A 3O08A 3CIPA 4QWEA 2MHNA 1Q81T 3WU2U 2UUBF 9ICJA 4UAZA 1RBLA 3P3DA 4M3TA 2RSQA 3PR4A 4U67Q 1GTEA 1CG2A 5H1SV 4J9RA 3DGPB 3RB0A 5HL7Q 1B0VA 1BQXA 4CF5A 5GAEU 2GVZB 4FW2A 4DOCA 1OKJA 3DKDA 5KFQA 1VQ8S 3HLUA 1WG8A 3AA5X 3ZLJA 4LRFA 1O51A 2AIRB 4WP8A 2CQ0A 3L5KA 4DUZF 4O0JA 2IY5B 4JNEA 3BN7A 2CVEA 4I28A 3L7UA 5AFUA 3QICA 2HW3A 4FJHA 4CCHA 2V63A 3KHRA 3VWSA 1KOOA 3OV7A 1NGJA 4H4KA 4H0YB 2E88A 3OL9A 2PXIA 4NM2A 2W40A 3QZ7A 2V4JB 4FK2A 3IFRA 4DPWA 4Q0BA 1FFSB 3EN9A 3QESA 1OIAA 3MMAA 4HR2A 4G9BA 2FXUA 2GIFA 4NYPA 1GLJO 2D4WA 2JLGA 4RQ1A 5IIJA 3GG1A 5D6GA 4JI0J 3AAWB 2DRAA 3K0JA 3W9HA 4CDGA 4NLOA 3L6QA 1VR6A 3TUJC 3K89A 2DRDA 1DGSA 3I0RB 2YV0X 2OWOA 1QVFR 1TUUA 1Z1BA 4M0AA 2QEXN 5D3GA 3HWTA 4FWOA 4OYXA 2O8CB 2WONA 2ZEJA 2QWRA 4Y0FA 2H5JB 2P51A 3ATUA 2O8EA 5DO2A 5AKJA 4XAKA 3DM2B 2P9NA 8ICEA 3VF0B 4JBCA 1WELA 3NCPA 3FFIB 3ENVA 3FKBA 5CA5A 2QLFB 4EHUA 1Q8IA 3WKEA 2IM3A 1M5HA 4O5EA 2BOAA 1DURA 1ZM4A 1TUWA 3UMCA 2IBOA 5HROA 4F4KA 4K4IA 2LYVA 1Q7YO 3NVMA 4DFJA 2W2OP 4X64J 3W2WB 4JI6K 1D9DA 3TAGA 1NOZA 3PW4A 1GXUA 2V69A 1S0VA 1Z00A 1XJWB 2VDIA 2VWBA 4CYUA 3JXUA 4ECZA 2MB0B 5G0RA 3DDIA 1HLUA 4F2RA 3OPKA 1YHQN 2B4PA 2EFQA 3CT9A 2HGMA 1RP5A 4I2JA 3MMCB 4FPAA 2IOCA 1RGIA 1EIYB 2UXDK 4OL8A 1DBDA 8ICGA 3M2UB 4QS7A 4OPKA 1T9XA 4Y28C 1FVQA 5DM6Q 4MLHA 4Q45A 1QQ5A 1Q7YT 1SB3C 2YKPA 1FO4A 4CF4A 4A8MP 4NI2A 8ICBA 4YG2A 4X65K 3HSTB 2IGIA 1DRZA 3M2RB 2R18A 5AKGA 1NPPA 3Q2SC 4DV7J 2QSFA 4FJNA 1I3AA 2ADCA 4OX9F 4KLFA 5CR0A 2ODGA 3OR1B 8ICXA 4PGQA 2BUNA 4R8UA 5B08A 1EXNA 1VISA 5IZHA 4DSLA 4JI6J 2X6SA 4KREA 1ITPA 2IVNA 5J2PB 4DFKA 2ZWOA 1XNQF 2HWTA 4H4OA 1ZJNA 1LCUA 1DJ0A 4HHUA 3LO3A 8ICYA 5ALMA 4J2BA 1RTDA 2ZGZA 4N5SA 4ICLB 3G86A 1VQLS 2ZH6A 2OYYA 3G6YA 2D6FC 5IT9Y 1DQ9A 2D7SA 2V7ZA 1TVRA 1LOTB 3IGVA 2JEFA 4FOEA 1SIZA 1H72C 1R6YA 3DFEA 4LT6A 2W8LA 3UW1A 2CJXB 3DHXA 1P7DA 3DLGA 3OTEA 3R27A 4K25A 4LZGA 2FHKA 1PZNA 3LOUA 2ABYA 5F8GA 2ZTEA 2WHEA 2KDOA 1YJNN 3I28A 4JI7F 3WXJA 4KV8A 1KVJA 3HMJG 3D2EA 1Z4UA 2LXUA 4FLYA 4OJHA 3MD1A 2PA3A 3JAMO 3ZC4A 2DR7A 2XS2A 4C48A 3TAQA 2WSCC 3S1TA 1WAFA 3L2QA 3MMVA 2E1RA 3M6KA 4X66K 2JVOA 3RH4A 4H0PA 2BJDA 4NA3A 4DR2F 1D4XA 3WXLA 3J81j 4DR4K 4RR5A 4JLHA 1TKTB 3AA3A 3RMCA 4ZP6A 3FBBA 4BRQA 4URQU 2RU9A 1VQLN 1RYUA 3D66A 1U48A 2UU9K 4A62A 1ZJMA 4RW9B 5AHXA 4NXNJ 2IVFB 2KJ8A 3NS1A 1MMNA 2J9EA 2VF3A 1NLVA 3D6RA 1U45A 4K4YA 4I2EA 1ATNA 5C25A 1D1UA 4O5BA 3M2VB 1DTTB 3KK7A 3IG8A 4H5NA 3LP1A 2EQYA 4KH1B 2Y9TA 5ALVA 3AU6A 4BRNA 4CK3A 2BRKA 4C0BA 2L41A 1RBUA 4JV0A 2O8EB 2ATLA 4RLEA 1N32J 4F3OA 1OS5A 2GQCA 1TP7A 1FRLA 2APOA 3AQOA 2HEKA 4FSVA 3HHLB 4RUAA 3O6WA 3CMQA 3SSSA 3CC2S 1JXEA 4CTAA 4I9QA 2KVIA 4LBIA 5GMEA 3ZZUA 3T5KA 5KTQA 3QT5A 4BY9C 4DQ8A 1EKRA 2WSFC 3IS9B 3LP0B 2VC1A 1IVZA 4I68A 4BR0A 4BRFA 4WF9Q 2OZSA 2EWSA 1WHXA 2ZOMA 2MGZA 1GLLO 4CHQA 7FDRA 3M6XA 3WKBA 2H4WB 3KFUF 1Z00B 1GMWA 2M2BA 4I6YA 1TR0A 5DDQC 3PSFA 2X7IA 2D41A 2VFUA 4CJQA 4NMLA 1KSPA 4JKFA 4USIA 1SJ4P 2LHTA 3KZIU 1ZTTA 3P4UB 4DL0C 1SXEA 4DDFA 4OPHA 1BHLA 2OFHX 2UU9F 2OPRB 3GMGA 3AH6A 2Z58B 1GAOA 1Q46A 3FEZA 4P4PA 3ISNC 4K4HA 1L3KA 4QZAA 4IQTA 5AQMA 3EGWB 4PCQA 4BR9A 2EFVA 1FT8A 1Z2ZA 1MWYA 5D4PA 3K1ZA 1F44A 2EG1A 2ZDPA 2AJQA 1T7PA 2HZCA 3C21A 3DRXA 3R7SB 2ZZNA 4F3QA 5AQWA 1SJRA 2QYGA 1F1BB 3PYDA 2MZRA 4UOCA 4YD1A 4F2SA 1FKPB 3M8WA 1QE1A 1NU4A 1OH6A 4CJLA 3BH6B 1YTUA 4UBBA 3AOAA 1FRKA 3A5LC 1BGXT 1F21A 1IG8A 3THVA 2MKIA 3PEJA 4B3MJ 1RTDB 4P4MA 4CZGA 1U1MA 2MAXA 3V81B 3DOKB 1ZQVA 4C8NA 3HRGA 4GV6A 2F65A 3EZOA 4F50A 2Q1NA 4EZ6A 4IG3B 2BJ1A 3TUZC 4QYZJ 3KK2A 4YXMA 1VOMA 4ED3A 3W7BA 4KLHA 4FM0A 1VDVA 5KFBA 3V72A 1PJ6A 1RTIB 2HHWA 4CZLA 4OI1A 2XZWA 4KGMA 1N5SA 3NNCA 1HUOA 3QPIA 4YQWA 5IM0B 3SAGA 1JL2A 3A13A 2RHSB 4ITSA 4C7QA 4OHVA 9ICFA 2DKXA 1HNIB 3DRRB 4ZLLA 4PQUA 3OYDA 4M8LA 1VDHA 4OVLA 4DQRA 2E1AA 4HTIA 5ITHA 2AW0A 2ZUAA 1Q4RA 1PYSB 1TQLA 5D8HB 1FA0A 1JLGB 1P9YA 1TL3A 4GXJA 4HKQA 4K4ZA 1N33K 2KVCA 2D3UA 2F1FA 3BPSP 4AFFA 2E1FA 1VC6A 1Q1KA 1BCOA 2GHPA 3UIQA 4AQYF 3AFGA 3LGHA 2OPPA 2J6TA 2QWNA 2C2ZB 2MZSA 3OUYB 1WJ9A 2HOFA 1ZZNA 4HCCA 3Q8PB 2JRSA 3I33A 1FD2A 1HNVB 1HPMA 9ICWA 1O6XA 1KRPA 5TKYA 2W2NP 4NLYA 4JI2F 3RJMB 3H8WA 4DN9A 2YMLA 4EEKA 2DGQA 4KH0B 2BDPA 1RILA 1WSHA 4RQNA 4MEYA 3KUGA 4F0KA 4JS4A 3CMAN 4QPTA 1X4GA 3TWHA 1K8KA 2FLOA 4ZVGA 1LKYB 2BKNA 1AUDA 3M8SA 2W9BA 4CT8A 3FEYB 2FDNA 3ITHA 2RQ4A 1TUGB 1KOHA 3SCLE 4DR1J 5KT2A 2UUBK 1WHYA 1RHRB 3CC4N 1GLBG 3CF5L 1F6TA 4JI8F 2GTDA 2MUTB 3L2UA 3TX0A 1TL1A 3ZSRA 4QNLA 1QJHA 3D9BA 4K50A 3S6JA 4IFYB 2XVTA 2YNHB 4C23A 4Y2JA 3B4MA 4DG1B 1LVHA 4NLNA 3TO8A 2W04A 3CJRA 3TX8A 2GQQA 1KL9A 4IWVA 3SFGA 1ZQHA 2PY5A 2MRLA 4JKGA 4WE1A 3D67A 2EK6A 3UDCA 4CEQA 4IJNA 3HSGA 1MG7A 4WIIA 4DV5J 2LA6A 4MFBA 4M94A 3H3NO 4NXZA 3DDKA 3FSYA 1XTZA 1ZPWX 3SLCA 5AFUH 4FLWA 1X6JA 1RGVA 3LP2B 1TFRA 1C0TA 4B1XB 4CERA 1E6YA 3OBIA 4HI2A 3PIOQ 2YCHA 4BBYA 2NZCA 2JZBB 4J90A 3QBWA 1HARA 1PAEX 4OI4A 3IDWA 3NAIA 2QMWA 2E1ZA 3W65A 4DCJB 1S7HA 2F1HA 3VMFB 4JI1F 4DQIA 3OT9A 5HR6A 3OFHA 1I6JA 4NLKA 2QYCA 4B1YB 1NKCA 1DTQB 2H9ZA 4KHRA 3AEVA 3OLAA 5AZIB 4QIWF 1UKUA 1PUZA 1HR0F 1KN6A 1C20A 1Y5IB 1OSDA 3B6BA 2XULA 4B1WB 1MN7A 3MM6A 2ZBRA 3WX8A 2PZSA 1NK5A 1N5YA 2RN2A 2E1YA 5AKHA 4X66J 3SBGA 4GVBA 2N7YA 4DR1K 3JTNA 1R31A 3HP9A 3LPUA 3D5MA 3QUBA 1AFJA 3UD3P 3VEYA 2EH9A 3FLCO 3LQVA 4KV8B 3HTVA 1RHUB 1ZQQA 4LF7F 3MCPA 1RCHA 5J2GA 2VASA 3VAMA 2KHDA 1FVSA 4RW6B 4IEEA 2P9SB 3FMBA 3T5JA 4P4OA 3FC9A 4RUBA 4C4WA 1SV5B 2QX0A 4Z94A 5AQPA 5AKIA 1RXOB 5ETOA 2W4DA 5KG4A 5KQ8A 3Q8UA 4DR5F 3D3CJ 3KBBA 2XYGB 2ZUBA 5K8OA 4CH0S 1N34F 1UAXA 3UR0A 1WSVA 1QQNA 2V9WA 1AZSB 4KHPK 1OWXA 4PRFA 1ZA1B 2FC9A 5L46A 3RUBL 7ICVA 3M9OB 2I5JA 1VK3A 3DLLQ 3DU5A 1TK5A 1MQ2A 1A0PA 4WP3A 1F0MA 3H90A 1JL1A 5E41A 2RH3A 1JI7A 5D4OA 3MXJA 3QYYA 4IO9Q 1I94F 2A40A 4MF8A 1RHKB 1U0SA 2P5OA 4GXKA 2JOQA 2DHHA 2VPZB 3LDPA 2KJWA 4NLWA 3CXCR 5CHIA 3TPQA 1HKBA 4XDDA 5GAHI 1RWUA 5CD4A 5ADXH 1T6DA 3GQCA 3S01A 3SD7A 1NJYA 4YY3J 3RFAA 3FZFA 3KHLA 2JC1A 5JRTA 3MM8B 2F2AB 4DN0A 3ZTOA 3QERA 3WKCA 4OO1J 2JMGA 3VQ8A 3WHIA 3BQ0A 4PHAA 3KZBA 2Q3SA 3OGUA 4NL9A 3MGHA 3N4MB 1X0PA 4ILGB 2KHVA 3A12A 2OEJA 3M2VA 2MJUA 2P6TA 1A76A 1Q16B 1VSMA 3BS5A 3H8MA 2E5GA 3CD6S 3BGUA 1SI9A 1ZQAA 1JLEB 4KX3A 3TACB 2WVEA 5AKEA 2ZWHA 4GMKA 1S1WB 5DDPC 3CCVS 5AQNA 5T14A 3ZI4A 1S9FA 2GX8A 2H5EA 2Z2LA 3OLBA 3MAAA 2WAQC 1HUZA 2HHVA 2R8GA 2JZBA 5BRDA 3OYFA 2O67A 1KVAA 3HX9A 3AV9A 3QUTA 1RXVA 3H0RB 4IBNA 3M6VA 2A18A 2XMAA 3PTWA 2GHWA 3I5AA 4DV4J 2VD3A 4E1MA 5BOLA 1K0VA 4HL9A 4B3OA 4QIVA 8ICSA 4CLTA 1IV0A 5B0BA 2ZKUA 1E6YB 1A77A 1WCNA 1NJIO 5F8HA 3QU9A 1YT3A 3JTOA 3PHEA 4RX6A 1T3VA 5F2RA 9ATCB 3VTIA 3I9V9 2GFFA 2JGUA 6FDRA 4EBDA 7ICTA 5D78A 2UXDJ 3PX4A 4CEOA 5KFGA 3C7NB 4F8RA 2GJ2A 1NHKL 5FPNA 3QT6A 2O4IA 3C5GA 4CEFA 5AT1B 2YVSA 1XC3A 5HMLA 1C7YA 2EBEA 4Q7AA 5E3AA 3DI6B 4HH0A 5KFYA 3ZEUA 3J7YP 3UN2A 4OJPA 4LVSA 1B22A 3MUMP 1EB0A 4C1NK 5KQDA 4BS2A 1RDRA 3BYPA 2AF6A 2E4LA 1L5UA 3GYNA 2MU2A 4U96A 1ZYQA 4C0ZA 3EGNA 3EICA 4CLPA 3RTVA 4QR0A 2G0CA 4HWIA 1S9EB 2PMWA 4ZCMA 4CEEA 4U7UK 2OH2A 4M5DB 3GR0A 2R8JA 4F0MA 2V4JA 3K4GA 9ICAA 2Y8WA 3ZSVA 3MMJA 2ZBPA 3EEQA 3JPOA 4BC5A 3LK9A 3EJMA 4HH1A 2YQ1A 3K58A 3CJ8A 2KYZA 4QIFA 4UUWA 5IIIA 1U09A 1D9FA 5GMKa 2BPFA 2OHFA 5LMNF 1HPZA 4WCEL 2CQHA 2HNZA 2YX6A 3D54A 2NPIA 1X60A 4UASA 2VQFK 2UUBJ 4OFZA 4LFCF 2Y1LB 3GJTB 4JI7J 3W0LA 1UVKA 1XR6A 2JEIA 4NB4A 2ESEA 3PW2A 1VRTB 2MZ1A 3R1HA 4IG0A 2KTQA 1XUPO 1SGGA 3AA8A 4ZP7A 1UW4A 4IKAA 4I64A 3MK6A 1KFDA 4YB5A 1HI0P 3E9LA 2DKZA 3NWRA 4JK8A 4C4RA 3BH7B 4I2QB 2VA3A 3B6PA 4BE1A 2ADBA 1HHSA 1B0XA 3K1RB 3I5BA 2A1BA 2XMJA 5ALKA 4OLPA 4XIUA 4I27A 2B0CA 1TK8A 5A2QO 1Q95G 1RUSA 2FHMA 5HQ8A 2XLKA 3KLIA 3QBXA 2OTJN 5AXMA 4CFCA 4ZIWA 2K89A 4BC7A 3N4QA 2FPHX 1VQMN 3QT8A 3MM8A 1XR5A 1X3MA 3RG6A 3U3YA 2G1HA 4FJJA 3NH0A 2YNIB 2E2QA 4H54A 3IM9A 1R6VA 2KP7A 1ZM3A 2CPYA 4HLBA 3ZT2A 2W9CA 5DDRC 1P1TA 4ECRA 4NLSA 3M32A 4WTOB 5AM0A 2EFGA 4TN2A 3GB0A 2HQFA 2DGXA 4KO0B 2D3DA 4IO8A 5D0HA 1HQEA 2GVDA 1R8AA 4WKYA 2CRLA 2MKJA 4YR2A 4JI3F 3C15A 1D8LA 3IM8A 1U47A 3TEGA 4CJKA 3W60A 2WK4A 4CFAA 5CYMA 5GVQA 1VRQC 2B9YA 3CFOA 4ZHRB 3T1HJ 3K75D 1M0SA 2MKKA 2XYPB 3NDKA 2A10A 1D9AA 2MUTA 1RZTA 4U95A 4HDHA 5HO4A 1BWFO 2KRRA 1I1GA 2R7XA 2AGQA 1IQZA 4W5TA 2CDQA 1RBSA 2KLAA 3ZZRA 5EX5A 5I42A 4NLPA 1RQLA 1CBKA 2HBQB 2HSTA 4IO1A 1RXWA 4P71A 4B3TK 3I1YA 5E7OB 2W54A 2GH1A 3NMRA 2BRLA 1KVKA 1QDUB 4ECTA 2P1JA 1RACB 2K3IA 4RQ0A 4AILC 1N48A 5KFXA 2EHGA 4USAA 1KHVA 4P0PB 5AE3A 1LOUA 3TZYA 1JKHA 5EE0A 1AROP 3DXMB 3TTDA 1RAIB 3VQQA 4ZLPA 3M8QA 4KRWA 1EKSA 2V67A 2DIVA 5CZVA 3GFKB 1B64A 1RAAB 1L7MA 2WF8A 2ZIWA 3UKRA 1TK0A 1RWOB 5DDOC 3W9JA 4CF8A 1YJ7A 1WEYA 4LF5F 1PG5B 2YTCA 4M95A 3UNYA 1VSHA 2BGGA 5AK6A 4KY3A 5BR8J 4O5CA 2VDHA 4HT7A 4LY7A 2ISPA 2KO1A 3KIOA 5ALJA 4E19A 3QAUA 4C11B 4BC2A 3BV8A 3FM9A 1XS9D 1S6PA 2M88A 2LFVA 4AL5A 5AJ3J 2LMIA 4I6MA 4OJRA 3CTRA 1WI8A 1BLUA 1VAZA 3CCUS 1XSNA 1YBTA 3BBFA 4DQPA 2RQKA 1UETA 2MDAA 3TFSA 2KSOB 1CRXA 1LNQA 2N1RA 2J9CA 1TFWA 1TKZA 1TV6A 4KR0B 4RT3A 3HPGA 2C2KB 1UFKA 3D0IE 4ED5A 4MT1A 8ICFA 1HNWJ 3TVZA 3GP9A 4CGGA 5K4LA 2Y3YA 1N36F 3VGUA 4P2FA 5ALHA 3H8YA 1XSPA 2DR6A 2NRZA 2M5YA 2RUGA 3W63A 4HYKA 3AXMA 1UW9A 3VCBA 1NRKA 1COKA 5AQKA 3IBPA 5A76A 1F5BA 2ALYB 2FPKA 3SQGA 4EBEA 4M3RA 4RW7A 1FK9A 4PG8A 2W2MP 1FNXH 1RTJB 5HMXA 3AQFA 1CJUB 2D1CA 3ENHA 2HFVA 3PXGa 4E1NA 4FXWA 5M2RA 3LP3A 4NCGB 1RHQB 2QLJB 1FRMA 5CAAA 1KCFA 2E5IA 1OJ4A 3HULA 3QAEA 3CC4S 2BW7A 2IOFK 4EZ9A 1F2HA 1ZS6A 1NZPA 2E9RX 3EYZA 3GSDA 4JI8J 2MZJA 4HEA9 4CLLA 2E20A 2JGAA 1OW5A 2HHSA 1BE4A 2UUCK 2B21A 1DOQA 1SUQB 4DL2A 3M32B 3DOMB 1VRUA 2FYXA 4W92B 3I32A 4ZVRB 2DH7A 4GO5X 3MCAB 2YX4A 4NWBA 5B0CA 2LLZA 5DS7A 4OJLA 1HW8A 2P5VA 1RTJA 4I2IA 4K7QA 1SQFA 5M1QA 1FEHA 5KGWA 3FZHA 2NV3A 2BE2A 4ZVFA 2OSQA 5IIMA 3DDNA 1HNWF 2ZJPQ 2JSXA 3KYLA 3IRXB 5J2DA 1T3QA 5J2AA 3SDEA 1BO5O 2IA6A 1SH0A 4CBXA 3IAM9 1I3OB 2EC2A 3ZD9A 2CXEA 4LJMA 4M2YA 1FJGF 1VBXA 2CNOB 4DZ6A 3JQMA 1BPBA 1IKXB 2V52B 3RGIA 2ZIWB 3UKRB 4AHRA 2HOQA 1NK7A 4WCEQ 2IRYA 4ZVPB 3F0NA 2ZC4A 3VPZA 5E5NA 4FYYB 3CVKA 4BGBA 2HFSA 4C8MA 4CZCA 4DR3F 3I31A 1S0MA 3NF6A 2UP1A 7ICOA 4MFCA 1QQCA 2LP4A 3LP2A 1BOTO 5B0DA 1C0TB 3T3FA 4DB3A 1VK8A 5C10A 3M7DA 3PYGA 3L2WA 1IBKJ 2RIJA 1Q7LB 2KYXA 4MF2A 2QTWA 1FE4A 2YH0A 1WDTA 1U8WA 1UOCA 1TL5A 1S9EA 2QXFA 1ZQJA 4JK7A 2ZF5O 4OIXA 2JR5A 2IOFA 2OI2A 3I0RA 2LYBA 5AZIA 5JTIA 2VBZA 2WFBA 2F9DA 3VEXA 3RRHA 4ILRA 4RPZA 1CJTA 1QS4A 4GKJF 1RAOA 1DEJA 3DI6A 3C66A 5AQFA 3W8GA 1P1LA 2H1YA 5GINA 3DRYA 3J80O 2V8VA 2P35A 2QA2A 1PBAA 1XQIA 3PJ9A 3PKYA 5AQOA 3CJ5A 3IUCA 1XNQJ 4IH7A 4AUKA 3HXMA 5DB8A 2OPSB 5K14B 4A8QA 3F9MA 4HCBA 3O4WA 2XNQA 3SI6A 1YRXA 1JJCB 1NSAA 3MR5A 4JI4K 1VJ5A 1TAQA 3LWMA 1R0BG 2F8SA 3Q89A 4A8YA 4LSNB 2I2YA 1J2NA 5FJ4A 4EGLA 1ESVA 4WFAL 4QZHA 1VLYA 3SQGB 4R64A 1SCJB 3IBFB 1NZAA 3UN3A 5D4BA 3NFAA 3BS9A 2HNYA 4EP4A 3E1YA 1VSIA 2KHCA 5I3QA 3VGLA 4GO7X 3ILOA 4USWA 3M2UA 3AN1A 4FYVB 4DV5F 3HKZF 2BOPA 4YHHK 2YMQA 1S1UB 4WQ5A 2WOMB 1Y10A 3HHLA 3MOJB 3MMBA 3GILA 3B54A 3FVYA 2GLEA 1JALA 1UL3A 2ZM6J 2HHHJ 3MPVA 1U49A 2DH8A 1PYOB 3CDUA 4ZCKA 3SUOA 2QM1A 4F26A 2Z8QA 2IYGA 4Z4HA 3N9UC 1JRPA 2H51B 4YOWA 2XSJA 3TADC 2BE2B 2J0SD 4R66A 1XEZA 5LJ5Y 1M1HA 5HHHA 1QSYA 2WB1D 5KRSA 5IWAK 1YF5L 4PG6A 3TANA 1PILA 1ULRA 2CIMA 5A0LA 3PZPA 2CNNB 1U25A 2V68A 1R8CA 4OV1A 5AM1A 5KFMA 4A59A 5FRMA 2PBDA 3UNGC 1ZQUA 5HVGA 4Y2IA 1QAYA 2PKEA 1RAHB 3D7SB 3DGPA 3CQXA 5L1IA 3ETOA 4KHYA 2V2KA 3HX0A 2OSRA 2CG4A 5LJWA 1DZ5A 1ZOLA 2AHOB 3CJ9A 2ASYA 6AT1B 3GLJA 2K1RA 1MW7A 1BA0A 3HPOA 2EX3A 4KFBB 3OW2M 5ETKA 4CF2A 3NF8A 3C28A 5ALQA 4YB1P 2VWJA 2V50A 1X4BA 4ACOA 4BRIA 4M3UA 3L3FX 4DV6J 1F9FA 3AM9A 2DY1A 2DTUA 3WQTA 2GCFA 1O5JA 4K4SA 1X4EA 4LF5K 5ETNA 3WZ0A 3JPSA 4DOAA 4LRBA 5DQIA 1DLOA 4M5MA 3MWPA 1YJVA 4J91A 1RQ0A 3VAHA 1EQYA 2W55A 3R5JB 1U4BA 2DNNA 4I56A 1YJ9S 1WTFA 3KHYA 2XWXA 4X4OA 3UDEA 1KTQA 2CGLA 1V9PA 1UJ4A 4U67L 3PYEA 5KG6A 3PX6A 5KFPA 5EN1A 3Q86A 4WXWA 2JHDA 4DX5A 4PKDB 1QCKA 1ZBTA 4ANDA 4DR7K 5F41A 3NGZA 1W26A 2HHHK 2GIRA 1VJQA 2G5IB 4A46A 4F5QA 1N4LA 4JEPA 3U27A 5G5GA 2QW9A 2BCRA 3FZLA 2OPQA 3CJCA 2KNJA 2HRYA 4MKVA 2CNLB 4LFAK 2QN6B 4NYZA 4ATNA 2BX6A 3ALYA 1A6SA 3DLEA 3QFUA 1Y3JA 2BM0A 3WXMB 3M1YA 4PYAA 4R8UB 3LDLA 3FFIA 2MEWA 3C14B 3HI9A 2ZTCA 2NRVA 3L09A 1MNEA 1HMVB 1FO1A 4NXMK 4CTAB 1YJRA 1UA1A 2HQDA 2O4GA 3KD3A 2ZUGA 2R7WA 2P9UB 1AQ6A 2BANB 1PVRA 3SPYA 3P96A 2YKMB 5LMUJ 3QJJA 4CHYA 4C7YA 3MCNA 1GMVA 5F0WA 1B4FA 4YUDA 3QO9A 4USUA 2UUWA 4O0IA 4CGJA 1S10A 1R8HA 1NZ8A 1SH3A 1UVMA 4B3RJ 2KKVA 9ICNA 3LF0A 5AZJB 5BPNA 4H4MB 2HQ3A 2GWSA 2ZXIA 3QWPA 4UF4A 2KU7A 4KTQA 3BBCA 3DXKB 1IJJA 4ZPBA 1SC3B 3F5TA 1CQNA 1ZQIA 2P9GA 4B3RF 3D2EB 4Y2QA 5H1SQ 4O8KA 4EIAA 1B99A 3WK6A 1YLXA 3F53A 1OPZA 1DARA 3JXOA 3FR0A 4A8EA 1HRHA 3THPA 1LV5A 1T0TV 2C3YA 4PXCA 3CJBA 4N7TA 3UQ2A 1Z4OA 2KI2A 2DHSA 5J2EA 4MJKA 3W5ZA 3HFKA 2XCPA 4OYBA 2ZG6A 2IHR1 5J2PA 2COLA 3GU3A 2EI5A 3KNAA 3ISZA 4RW4A 2XTJP 3RVCA 3CIZA 1KW4A 2F8HA 4OHWA 3KJQB 4RJVA 1M90T 4V19X 2LECA 1DK2A 1BQMA 2FMSA 3VQDA 2HNDA 1X9SA 4Y2AA 2C28A 2UXCJ 1KR4A 2V2VA 1SJ1A 1DRGA 4ES1A 2HZVA 2ZUCA 2LU1A 4BREA 2HVHA 3OR2B 3GOIA 3WXKA 2F4VK 2DY9A 1RBVA 4KFBA 4TUSA 3NH1A 2QB1A 4LF9F 1SV0C 4I1TA 4GKKF 2CJ9A 4NEYA 4CIOA 3QIPB 2CFXA 2HHQA 3JAMY 2AZ1A 2XWYA 3MR3A 2K4IA 1O8BA 4JN4A 5IOLA 2BQUA 2OTLS 4KB1A 3PACA 1U0HA 4DFMA 1TUYA 3BZKA 1NMDA 2DR5A 3MCMA 4WFZA 3N0VA 3O1BA 3UCZP 5AXLA 1RWPB 4UB2A 1GT8A 2ITGA 5AQTA 4BRHA 2Z30B 1E4GT 3DU6A 1ZBHA 1CJVA 3KJNB 4GKKJ 4YMOA 4HVJA 2EAOA 3GBTA 3VALA 5KFAA 1S1TA 4C1NI 1DAXA 2AKWB 3HVTA 3CJ2A 2ASOA 2G8WA 5JMNA 1N5YB 4OZ5A 4YXJA 3CF5Q 1IBMF 3GG0A 3CSKA 2B0GA 3MM9B 3CCZA 2VBYA 3NHGA 4TQRA 3CJ3A 4FF4A 5ETRA 5KFTA 4NYFA 4KRFA 4EYIB 1SC6A 1F9HA 3T6JA 2C3UA 3BO4A 4DF4A 1G2EA 1NZBA 1L3VA 1NOMA 4RQ4A 3JSYA 1Q8BA 2DNYA 1T11A 4Y2MA 2ZOGA 1VQNS 3D2FA 2IJRA 2F76X 6FD1A 2HFZA 3A3OB 1WF1A 3O9UA 3CCSN 3QGIA 3MBYA 3WEEA 2YNFB 4L72B 5L39A 2R2TA 4XH1A 9ICMA 2OA8A 4BRCA 3THTA 3F56A 4DBQA 4ZCIA 2DL0A 1X4FA 4K4XA 1SC4B 1CJTB 4ILMA 2UV8G 3AU2A 3E3XA 1S0OA 3IMQJ 5KPZA 3BZQA 1PJ5A 4LFBJ 3DM2A 2HS3A 5D49A 1MMLA 3TR8A 4NLCA 1J2VA 2EPIA 1NNEA 4KLIA 1IR2A 4JI3J 4MK7A 5HRNA 2IS3A 1T9WA 3AJ2A 3VQEA 1NB7A 2X1BA 3I55N 3G4SN 3P83D 3MECA 2P9NB 1UZDA 3MAHA 5SZTA 5GADU 3BQ7A 3UXOA 4FJ5A 4RBUA 4FZXC 1FRJA 2J7UA 4BWJA 1OH7A 4PL1A 2R7OA 4L74A 1KP6A 2AJFE 1HJRA 3D2WA 2E5SA 1RA6A 3G0ZA 1I94J 2FJEB 2QGFB 3IAS9 4PXEA 1KD1O 3E8OA 2QI2A 4DR6K 1X5PA 4B9MA 2QLXA 2JEJA 3O5BA 3IG1A 4DV0J 2XMMA 3FRYA 3AY9A 3LWLA 2BJ3A 2DISA 5H9EK 3GYGA 4ECXA 4J9LA 1S1VB 2Z2ZA 3QEVA 4ECWA 3KOOA 1RDDA 2BH1A 4LR9A 2W2PP 3SPZA 3L7OA 4K8ZA 1NXIA 2A6AA 4URSA 4O9MA 4IKFA 3C6TB 8ICTA 5HRSA 3B4DA 3TRGA 2ZH2A 5AM2A 4B3OB 1YJWS 3IKMA 2JC0A 1HBOB 5AI5A 1X6IA 4A47A 3DLKA 2HSEB 4ED6A 1BUPA 2GWJA 3AARA 1SWWA 3QINA 5DLFA 3Q8VA 3CPWM 1ZQDA 7ICPA 3ZT3A 4FJLA 4OCZA 2CQPA 1WF2A 7ICLA 1B92A 4JV2A 4RBTA 3SV3A 2IMWP 1RTIA 1SKRA 3EXYA 2NREA 1NBWA 4Y2UA 2ZH3A 3FJ2A 1KEJA 2KHQA 2UUAF 3MZIA 3NRWA 1KC8O 2G08A 3JSRA 3SCKE 4FLUA 2P9PA 1FJGJ 1HNWK 3LTOA 3PV8A 1U8SA 1MWZA 2R7RA 2D9PA 4PZVA 1WAJA 4USVA 2F7TA 1X4DA 5F8MA 2J6SA 2QC3A 1K73O 3QUQA 1H2VZ 2KG0A 4BDYA 4EAHD 2MSSA 2W8KA 4HACB 1ATSA 5BYSA 3VCDA 1FJ7A 3IMXA 3NS5A 4FPBA 5KRTA 3GIKA 4AXJA 5KG2A 2WTFA 2AEJA 4HTJA 3NGIA 2RT3A 1GMUA 3BR8A 4I2PB 3TJAA 2CNKB 2Q36A 2E44A 2E8AA 3ZNJ1 2V2QA 4NCBA 4OQJA 4YDDB 1SAZA 5E3RA 7ICFA 4I2GA 2E5LF 2DWQA 1WKLA 4BE0A 2ZKTA 1K5OA 2EW9A 3ZTSA 4USJC 4Z4CA 1T44A 3C16A 5CHCB 2QFIA 2EZYA 2UXDF 4QZVB 3IFEA 4IOXA 1FXDA 4D3GA 4IS7A 2E2PA 2EFPA 1HX1A 1ZAXA 3VQTA 1A5XA 2W6LA 5G0RB 3I6PA 4DU3A 2J8SA 1NNLA 4DWIA 1XSLA 2HBZB 5KL1B 2HK3A 1K1SA 3NS7B 1RAFB 3HK2A 1U6FA 3QQCD 4GNIA 1YRTA 2Q6CA 4JI6F 4A57A 5DM6L 3U6FA 2BCUA 4RL1A 5EWEA 2IAJB 3P38A 4W5RA 4CJ7A 2BPGA 3G2XA 4F04B 2GV9A 3JPTA 2FJBB 5G4DA 1LK7A 2FDRA 9ICXA 3H5UA 4F4AA 1QVGR 3R1XA 4HTLA 3CM6A 2ILZA 4Z2XA 2J9DA 1NMEB 3NMUA 4DR1F 1RM6C 1HJOA 3R6GB 2MJNA 1J5EK 7ICKA 4YR3A 2LKYA 3EKUA 3KDNA 1GH8A 5LMUK 1ZQGA 2DGTA 1WWVA 2FQQB 2EZXA 2PFQA 1BMQB 3UQ0A 1KDNA 2IRUA 4M5IA 1ZQOA 3WNHA 2UXBJ 2E5LJ 2DXDA 1FKAF 3G71N 2FJWA 1EETA 3RZAA 4ECUA 2Z2MA 1BL3A 2FVQA 5KFCA 1RYSA 3CCEN 4X65J 8ICRA 4RUHA 1F60B 3ZETB 4QBUA 4GC6A 4ZN3A 3RF9A 4B9SA 4DS4A 1J97A 3BP8A 3U3GA 3MUTP 2MZQA 3J7ZT 5KOWA 4M5JA 3R2CJ 3JB9k 4FJGA 1QVFM 3QLHB 1FCAA 3OPXA 3K17A 2BGWA 4OYOA 3RAXA 5J0QA 2HS0A 1S1VA 3S6EA 4EBCA 4AHUA 4BR4A 5J0OA 5C2DA 4CO1A 5J2QB 1V5VA 3IBCB 5ADZA 5IQ6A 4WFBQ 2M4MA 3WK4A 3FUYA 2LQ5A 1LW0B 2W01A 3N6LA 3AO4A 3B8AX 1QAXA 4CJWA 4AE5A 3TFRA 3VVTA 2C3PA 3BEGB 2POKA 1ZBSA 3UWTA 2RNEA 2Z0GA 7ICRA 3FCHA 4DEZA 4U7CA 2EDUA 2ACMA 3GJRB 3AODA 2B8QA 5DZ7A 3NAHA 4DV2J 3NGDA 3UXNA 4JHDA 2OEMA 1ZQFA 4BACA 8ICVA 2DBBA 4M04A 4FLTA 3BKFA 4CJEA 4GVLA 1YAGA 2FE9A 2QA1A 2XICA 4LVNP 2I1RA 3OBWA 4BR7A 3RBXA 5HOOA 1VJWA 2GWKA 3MURP 4LF7J 4JV5K 3QE9Y 3B9JA 5HLFB 1YXQA 1V85A 4EX6A 5AXNA 3NCIA 4KGKA 3DAWA 2M0NA 4IOAQ 1BC6A 4CJ3A 4MFAA 5JS1A 4UW2A 4ECVA 2E1CA 5T7LB 2Y1IA 1U2RA 2WHOA 2ZHBA 4QR1A 1R27B 2ZJRL 1KQSR 4DV3F 3QIOA 1HNIA 3DRRA 4ICLA 1T9UA 3OA9A 3BDPA 1IQTA 3SSQA 4XPEA 2N4DA 3QU7A 2WC9A 5DB9A 2E8NA 1FFVA 2NO4A 3BO3A 1TL3B 1QHAA 2KSOA 2AJ4A 4E7JA 3OFFA 9ICIA 3M9NB 2QWQA 3SEOA 3RH6A 2K8AA 2LEAA 3TR5A 2E5JA 2YQ3A 3C3LA 1UEKA 4Q5VA 2XMUA 3H0LB 4E7LA 4F7VA 4OYIA 1KC8T 4MK9A 3D1QA 3MMBB 4NLXA 4NO7A 3JPNA 2VA2A 2DO4A 2WF5A 4PYDA 4ED8A 5ALOA 2I1QA 3NRZA 3AD7C 2LQBA 3A1YG 3MM7A 2OAUA 1WC0A 1U1KA 2W9BB 1RYRA 2RHKA 1SVDA 1JLFA 2XNRA 3CCVN 3DLLL 1X2IA 3CE8A 2SXLA 1YVUA 2E8OA 2HLTA 3EY1A 3ZT1A 1FXLA 5IWAF 5CH7B 3R9KA 2FGOA 1UPPA 2Z1JA 2YNGA 4ILLA 2XO7A 1X40A 4CHPA 1BWVA 2VBXA 3M1VA 2E66A 4ZVUB 1X5OA 2G09A 3QT7A 1U1NA 1TKXB 2D3O1 3KLGB 3SK3A 1FDAA 3IWLA 1NSKL 3H3OB 4CHOA 1WOPA 4KE5A 2Y0SD 3DOMA 1VRUB 1DKGD 1UWAA 2Z2YB 2HWHA 4NZ0A 3SUQA 2FPMA 4W5OA 5MLCQ 3ULEB 4F93B 3V4IB 2W3RA 2VPWB 4M3ZA 2F9WA 3DYAA 3J80U 1FJEB 4QS9A 1RDFA 4DR3K 4BRMA 2AJ0A 1ZQBA 5EOZA 1ZQYA 1Q86T 2VQEF 4I2AA 2DNLA 3H1VX 1SIWB 4HHHA 1SL2A 2I8EA 3NE6A 1PKUA 3TKAA 1ICEB 1S6QB 4ID5A 5E3CA 1WOSA 3HW8A 1W7WA 3W5YA 2NZ4A 1XQSC 4C3LA 3MEKA 1LWXA 2YWWA 2M9NA 1FX2A 2MXYA 3MFHA 2XS5A 1NGBA 1NG9A 3NGUA 3RJGA 2PN6A 1UZHA 3IN5A 4JB8B 4E0DA 4DFPA 1REVA 3VAGA 4YOUA 5LY3A 1RQNA 1RKIA 2FBXA 4W5QA 3MDAA 4X4UA 3P5TL 2WZ1A 2HI0A 4G1PA 3OYIA 5EX0A 2DPJA 3J81U 3VC8A 4N8NA 1NGIA 4LSZB 5F3XB 2QLWA 3HP6A 4NCAA 4RW8A 3MM6B 3TAPA 3UCGA 4WF9L 5CZ1A 2GX9A 1LB2B 3A4TA 2LPEA 1ZOTA 2WBMA 5GADP 4KLTA 4P2SA 4MQ3A 1HNZJ 4IRCA 3QZ8A 5IV4A 3HCXA 1V97A 3QUCA 3J7A1 1HMVA 3EGVA 3OW2R 2BUPA 3GDXA 4DSFA 2Y8YA 2ATQA 1H1VA 3OYMA 3D1HA 3CJ7A 3R8EA 2FMPA 1HR0J 5HMZA 2W4PA 4C80A 4PH5A 3ZTRA 1BPXA 1VC5A 2EFNA 4MKBA 2KN4A 3CJTA 4ISEA 4CIGA 3LPYA 4G1QA 1TKTA 2QA4N 5TZVA 5T41A 3W64A 4K4GA 5AKZA 1JLBA 4BR5A 1C0GA 4NM1A 1WSEA 3ELHA 2RQ5A 3LDAA 4K4WA 3MXIA 2YJFA 1HQUA 2M7SA 2P5GA 4LREA 5HJYA 4RW8B 2CZVC 2LKZA 1QQ7A 4NPOA 3J7Z5 2UXBF 1MU2A 5IWAJ 4I9LA 3M8QB 2LEPA 1WHVA 3OS0A 2ZUDA 1VQ9N 1SBRA 1EX4A 4DTOA 5BR9A 3VGKA 4LFAJ 1IKVB 1RISA 4BE2A 2I7PA 2YY6A 3EWAA 5DQGA 4M9GA 1MMDA 2NRRA 2NZTA 3P5JA 3ISCA 3ICXA 3OVAA 3AUOA 4GC7A 1WBDA 3CI5A 1PK1A 3FZMA 3C95A 5A0YB 4B3SK 2E3TA 3FNNA 1PCAA 4DPUA 2BCVA 1SXLA 4JB3A 1IUJA