3PX6A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (tautomer) in closed conformation
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px6A01
7ICQA 5HLFA 2MUTB 3A2FA 4GW6A 5L1IA 2YNGA 3JSMA 3WNFA 5HRSA 3SV4A 3AVKA 4DMNA 3M9NB 4OPJA 8ICJA 3HXMA 3AVHA 4FJ8A 5J0XA 3OYEA 5KGXA 4DTXA 3M8PA 4O0IA 4LH4A 5IIJA 3QE9Y 2PYLA 4NY8A 1TKZA 4KO0A 3TARA 4O3QA 4R64A 2ZJ5A 3NH0A 2BPFA 4OPKA 3T5JA 1YVUA 3C5GA 1C0MA 3KD5E 4N47A 3NTUA 3RH4A 4FYDA 4FCYA 3RR7A 3O4NA 2I9GA 3IS9A 1Q8IA 1ZJMA 1V9PA 5DQGA 4N5SA 2V9WA 1RDDA 1ZQTA 3MAQA 5D49A 1CZ9A 2F96A 9ICEA 1N5YA 3RRGA 2GUIA 1ZQGA 1S10A 5DB6A 4O44A 3OYJA 4CK3A 4F5OA 1A5XA 5J2PA 4XIUA 4QWBA 1XSPA 3OS2A 1J53A 3QERA 4M3WA 4E7KA 2YKMA 3VQ6A 7ICJA 1L3VA 2OPSA 4FM1A 4J9RA 4DTMA 3NF6A 1GOAA 1ZQWA 3RJFA 4EBDA 5CZ2A 1ZQHA 4ICLA 1IXRA 4JV1A 4J9OA 5D4BA 2XCPA 3C2KA 1FKOA 4CE9A 4QZEA 2JEJA 3LWLA 1NKCA 4RW9A 4KLLA 1SV5A 1SUQA 1BL3A 4O4GA 1KRPA 5DDYA 3ISNC 3S3OA 3AVGA 1BIUA 1FKPA 3MR6A 3ISCA 3P83D 9ICCA 1HJPA 5L1KA 3DLEA 5C25A 1ASWA 4F91B 4ECZA 4KLFA 3MDCA 2O4GA 4YMOA 2YKNA 3VQBA 1BI4A 3ZSVA 2IGIA 1C7YA 5HRRA 5KFQA 5KFWA 3BQ0A 4H4OA 1UT8A 4YNQA 1ZQCA 1JN3A 4RQ1A 4KLDA 2LYHA 4O3OA 4MFCA 1RBVA 3AA5X 2IHNA 4M9GA 4ED8A 1MQ3A 3L3UA 2M9NA 3HWTA 4K8ZA 1QSYA 5KFIA 4YXJA 4PHEA 1HNIA 3K59A 1XSNA 4YMMA 5EU7A 3NFAA 3T3FA 2WONA 5HBMA 3NH2A 4BGDA 4CJUA 3B6PA 3RH5A 2IHMA 1KFTA 3O3GA 3L2VA 4KV8A 4DL6A 3RTVA 4KITB 2HNZA 2ZD1A 3IAYA 4RPYA 4I9QA 1UWBA 3NF9A 5CHGA 1I39A 1Y97A 4I28A 4JLHA 3THVA 3KJVA 3HVRA 3WNEA 3F73A 4E7HA 4KLHA 4F5PA 3AU2A 4FLZA 3PVXA 3SYZA 4GC7A 4ID1A 2ATLA 1ZBUA 4QW9A 1TL1A 4K4HA 9ICXA 2FC0A 3RJIA 2C2RA 8ICCA 1U4BA 4CEFA 1GOCA 2BCRA 3RR8A 4FLVA 3OHAA 2I1QA 2WTFA 2DFFA 1ZQFA 1NKBA 4C8OA 7ICVA 5KT2A 2PYJA 3AVJA 1UAXA 5KFGA 4TQRA 4B9MA 1QS4A 3C95A 4FJXA 1K1QA 4B9UA 3NGZA 3RAXA 1BI4B 3M8SA 4YFUA 1ZQSA 4HUEA 2AGQA 1J54A 4NM2A 5J2MA 1KLNA 4KLJA 3P1GA 4XUSA 4RW6A 5J2KA 3SUPA 5J2BA 5FROA 3D45A 1ZQUA 2P51A 9ICUA 4Z4EA 4C8LA 3ZT4A 5KG0A 3GQCA 2RKIA 2IC3A 3FDSA 4Q0BA 5J0UA 5E41A 2ISOA 4NCBA 1XWLA 1KVAA 3F9KA 1ZQPA 2PXIA 4JS5A 3V4IA 2A1RA 1UA0A 2IBKA 4F2SA 1JXBA 4M41A 4PY5A 4BXOB 4DOBA 3UXNA 1HYZA 4CJTA 1RTJA 1BISA 3AVIA 1B22A 1IG9A 4CFBA 1NK8A 4CHYA 3QEVA 4O0JA 4CFCA 1DTTA 1BHLA 3C6UA 1T8EA 4RPZA 1NK7A 3OYFA 5JUMA 3LANA 4QZAA 4ZTJA 5L9XA 1CUKA 1BIZA 4CESA 1CXQA 4E7IA 1EX4A 2PFQA 3HPHA 1RXWA 1NK6A 1S9EA 4W5OA 3G6XA 3RH6A 4RUAA 2R8JA 2ZE2A 3SUOA 1D9DA 5J2QA 1WAFA 3RAQA 5C42A 4YR3A 4ED7A 1JLBA 3RBDA 5IIOA 4NLGA 8ICSA 7ICPA 5CY4A 3ZSZA 3LZIA 1ZQKA 4M3RA 3CFRA 1EP4A 2NRXA 4CHZA 1GOBA 2D0BA 4MEXA 4DSLA 3OYHA 3OYCA 2IOCA 5JS1A 3BQ2A 3RMDA 3UQ0A 1IKVA 3M9MB 4DFPA 1D9FA 1WLJA 2JZBB 2AQ0A 2BGWA 3NE6A 1C0UA 2PFPA 4F4WA 1ZQRA 1VRUA 1XHXA 3LK9A 3HP9A 4QZIA 4Z0UA 4KAZA 3QEAZ 2RDJA 5DDMA 4I2BA 1D8LA 4RQ6A 2MUTA 3VQ9A 3TAEA 3T1AA 4UB4A 2AJQA 2G8WA 1NOZA 4R65A 3DOKA 3G6YA 2NRTA 3TAMA 3U6FA 2HHQA 1B92A 4O3RA 3SCXA 3V6HA 4CJ5A 4B9LA 3L8BA 1ZBLA 5KFYA 2R8HA 2QKKA 1S9FA 4PHPA 5SWMA 2LSNA 5KFFA 5J2FA 4FJMA 4I2DA 3O4QA 2ASDA 5KG5A 3K75D 2VG7A 3ZD9A 8ICOA 5DK5A 3ZSQA 4J9NA 2PI5A 5CYMA 4W5QA 5KFVA 4P4PA 3SJJA 1N56A 1ZQVA 3E01A 3RJJA 5HHIA 1NOYA 2ZJAA 3OYIA 3PW5A 4RT3A 1NJXA 4BWJA 2D5RA 2FPKA 3OSPA 3IRXA 1RDAA 3QEBZ 2KN7A 2BPGA 2XO7A 4DL3A 3Q8RB 9ICVA 3C23A 2VG6A 2NRZA 1WN7A 1JL1A 4Q45A 5JS2A 1Y88A 3QLHA 4MEYA 3KLGA 4KHWA 1HYVA 4IRCA 4CEOA 2HHTA 2P6UA 4IFVA 1JKHA 4R63A 2UVRA 5EWFA 5KFUA 3V6DA 8ICGA 4FS1A 3PO5A 2ZTCA 1U48A 1A5WA 4CK2A 3NGIA 4EZ9A 1A76A 4AHTA 4CGDA 4KB1A 1ZBIA 1RTIA 3DOLA 1XU4A 2ITGA 3SI8A 1VSLA 1TFRA 9ICKA 3H08A 2G8VA 7ICOA 4IG3A 4DL2A 3BQ1A 3ALYA 4IKFA 3V72A 2P66A 3MR2A 3QEXA 2MAXA 1BPBA 4CK1A 3Q8SB 3QNOA 1QQCA 2FLPA 4RW7A 1NJYA 3NGDA 5IIKA 5L1JA 3OS0A 4I2QA 3ULDA 4UBBA 4CGHA 2RDIA 1VK0A 4BACA 5I3UA 1J5OA 4BDZA 1IM4A 1KVCA 3EPGA 1XHZA 3PW0A 3IG1A 2XY5A 3HM9A 4B3OA 3AO1A 4I7FA 3ZT3A 3MGHA 3PMLA 1W9HA 8ICPA 4E1NA 4E19A 4P4MA 3N4MB 2B5JA 4LVSA 1F21A 3N97B 1NK0A 4PPXA 4ZHRA 2HNDA 4XA5A 3GV8B 1UA1A 1X9MA 4F4ZA 4LSNA 4GC6A 1B43A 4O5BA 5BPCA 4FZZA 2QXFA 5HP4A 1WAJA 4GXJA 5IILA 1VSJA 4ZH4A 2XGPA 4UB5A 4DSFA 3QETA 4KTWA 2ZUDA 4BE0A 3KD1E 4YD2A 8ICUA 4QWDA 1S0OA 3PUFA 4Z4IA 4Z4HA 4KLQA 4Q43A 4BDYA 1C1AA 4IFYA 2BANA 4I2GA 1U9LA 5KG1A 4UQGA 5KFXA 3C2MA 4UB1A 4RQ3A 4NYFA 4YVZA 1HMVA 4IQTA 5DGAA 3AVNA 3IHQB 4QWEA 3NBPA 3GIMA 1ASUA 4IRKA 1XSLA 4IR1A 3BQTA 1Z25A 2BQ3A 1LW0A 1S1XA 2DY4A 3ZD8A 4PGXA 4NCAA 9ICWA 3SQ2A 5KT6A 2JLEA 2W8LA 1ZQOA 1TK8A 2D0CA 5J0WA 4EYHB 4FJ7A 4M3TA 3VQDA 2P5GA 3DLHA 3OYDA 3ITHA 1KVBA 4FS2A 3MECA 2A1SA 5T7BA 5I42A 4DEZA 3EPIA 5CJ7A 5J2GA 3VQ4A 3MEEA 4M6WB 5KFDA 1BPDA 5BOLA 4J2AA 4EBCA 5J2CA 4KLTA 4KHUA 4F3TA 3FFIA 4CIGA 3C6TA 3VN5A 5DB9A 4UAYA 2BR0A 4QWCA 3V9WA 4DQPA 2Q0ZX 4I2HA 1S97A 2BCSA 4ECQA 4JRQA 5CYQA 7ICMA 2Z1JA 5KFHA 3GV5B 4CJEA 4EBEA 5KT7A 2HHVA 4F4KA 1JLQA 5J0RA 4LY7A 5KT5A 1RT4A 3HT3A 1S1VA 2VWKA 4CF1A 1DOQA 3HX0A 5J2HA 4Z4FA 1ZQNA 3K57A 3ZSXA 4ID5A 3AVLA 1VSDA 4KLGA 4DLEA 4ECXA 4CHOA 3I0SA 2EHGA 2F1HA 2BKEA 4I2IA 3RWUA 4KTZA 1U04A 3KLHA 3Q8LA 4DSEA 1WCLA 1WSJA 4B9SA 4NXZA 2G8UA 5DBAA 2KZZA 1TV6A 1RDBA 2RF2A 4M2YA 1TVAA 4QZ8A 4GMJB 3T19A 5TZVA 3Q8KA 3NCIA 1VSKA 4FK4A 5HHHA 1X9WA 2KZ3A 8ICZA 3GIJA 1RBRA 4AILC 9ICMA 1T4GA 2G8HA 1RT6A 7ICRA 5DQIA 9ICTA 4QZGA 4BDPA 4BE2A 2IMWP 3EZ5A 2OYQA 1UT5A 4FJKA 3VA3A 3KHRA 4PHDA 4DQSA 1J9AA 4J9LA 5KFOA 1MSWD 5KG2A 1WSGA 4ELVA 2G8KA 5CB1A 9ICFA 4ECVA 1ITGA 2W9BA 4CJ4A 1VSHA 4CHQA 4M9HA 3E2EA 3L3VA 2BHNA 2IS3A 3TAFA 4P2HA 3CQ8A 3EWAA 2DTUA 3T5KA 2E6LA 4DL5A 3V7JA 2C22A 4ELTA 4DFMA 3QESA 1KFDA 4E7LA 4CIEA 3SPYA 3ZT0A 2BDPA 4N41A 4KI4A 2J6UA 3T5HA 3C5FA 2RN2A 4J2DA 4QWAA 3KHGA 4J2EA 4CIFA 1RXVA 2P5OA 1SKRA 4RU9A 1B9DA 1KSPA 3HP6A 1S6QA 8ICIA 5EWEA 2P6RA 5KT4A 5KFKA 4Z6CA 2XY6A 3KIOA 4YD1A 4CJ3A 2R7YA 1Z26A 4OLAA 4JRPA 2E4LA 4Y1CA 3MGIA 4DU4A 1IKXA 3D0PA 2VWJA 1JLFA 4YQWA 3RJGA 8ICNA 5J2AA 3RJEA 3MXMA 5KFJA 4YR2A 2KFZA 3AA4A 4KN4A 5KTQA 4Q5VA 1FXXA 2Y1IA 4DFKA 4IDKA 4FLYA 4RUCA 1ZQXA 4QZFA 3V7KA 1BQMA 1HNVA 7ICNA 4LZDA 1RYSA 2XGQA 4C8KA 4ED3A 5F9NA 4EZ6A 4FO6A 1G15A 3LP2A 3AVMA 1T7PA 5EWGA 4RPXA 3AVCA 4W5TA 5DQHA 3OYLA 3VQPA 3LDAA 2Q3SA 4HYKA 1ZQYA 3GIKA 2XHBA 4CJPA 5IIMA 1NK5A 4PA1A 3HPOA 4KLOA 4W5NA 4HHTA 1TK5A 4ED1A 4OVLA 9ICHA 1XS9D 1RBUA 3PX6A 2X6SA 4CFDA 1RBSA 1COOA 2JGUA 3DM2A 5DGBA 5KFBA 1C0TA 3ASMA 4MQ3A 2OPPA 1TGOA 4CGJA 1EETA 4EYIB 4I2CA 4X5VA 3H4BA 4OKEA 3TI0A 2FMSA 3PY8A 2IAJA 4FM2A 1N6QA 4DL7A 4QZHA 1C1CA 2XRIA 2W9MA 4CEDA 3T5LA 4O5EA 3AV9A 4DTSA 4FXDA 2XC9A 3RMAA 2VANA 1NJZA 2VA2A 3BGRA 3LAKA 1YTUA 3L2WA 1SL0A 3ZSYA 4M0AA 3CFPA 2BQRA 7ICKA 4BE1A 2I5JA 2G8IA 1JLCA 4MF2A 5IINA 4ED0A 8ICWA 7ICEA 4ECYA 3I0RA 1JXLA 3LPTA 2PI4A 3V81A 3MFIA 3MEDA 3DRSA 4CJLA 3S9HA 1VSEA 1HQEA 3Q8MA 3KHHA 2HMIA 4IR9A 5DLGA 4GLXA 1WCNA 3CM6A 2EX3A 4M6WA 4M9JA 1A77A 2F1IA 4MFFA 4NM1A 3Q8PB 3GILA 2ASLA 5DB7A 5KGWA 3SZ2A 4CF2A 4KRFA 3NGYA 2NRVA 3KKRA 4CEQA 2DPJA 8ICYA 1JX4A 5J2IA 3GV7B 1BVSA 5FDLA 1VRTA 4I2PA 5L1LA 4AHVA 3VQAA 4DS5A 1N48A 9ICAA 4K4IA 4M9NA 4R8UA 3QZ7A 1KCFA 3SQ4A 1B9FA 1YTAA 1Q9XA 4Z4GA 3OYBA 4O9MA 1XI1A 4KLEA 4B9TA 4M47A 4J9KA 2QKBA 3OY9A 4DTJA 2D0AA 4I2EA 4DOAA 3LP0A 4UAWA 2HHSA 8ICVA 5J0QA 3ISBA 3V1QA 3V9XA 4HVJA 3V1OA 3P5JA 1JLAA 1L3TA 4DTRA 4OKKA 4HUFA 2FMPA 5HP1A 3JPSA 3SUQA 1HYSA 1LWEA 3CFOA 3SUNA 3RJHA 4M04A 5KFPA 1HUZA 8ICEA 3OYGA 1NOMA 3UPQA 4RQ5A 4E89A 2FBVA 3BJYA 1CLQA 3AU6A 3LP3A 4GXKA 7ICLA 1ZQDA 3DRPA 5C5JA 1U45A 2ZUCA 4FJHA 4I2AA 4B9NA 1FK9A 2Z1HA 8ICHA 2NRWA 3SPZA 3TR8A 4DO9A 4FJIA 4ED2A 3ZT1A 4LSLA 4EP4A 3HL8A 9ICRA 4NCGA 5J0TA 5DBBA 5EOZA 4TURA 3OJSA 4GXIA 1IKWA 1JIHA 3ETLA 4KLMA 3AA3A 4CECA 1RPLA 4B8AB 3G6VA 4O5CA 4IQUA 4DU1A 4BWMA 4ELUA 1JLGA 8ICAA 1CEZA 3PW7A 1RT1A 5KG4A 4DSJA 4NLKA 3H4DA 4FBUA 3EY1A 3TANA 4I29A 2W8KA 3MFHA 2F1JA 2YNHA 1QTMA 1MQ2A 1NK9A 3B0YA 2E6MA 1ZQAA 4R66A 2W9CB 4DSIA 1XO1A 4I27A 3OHBA 1QLNA 4O5KA 1JXEA 4IQVA 4PUOA 4NLNA 3C2LA 9ICOA 2GWSA 3G0ZA 1T03A 2FLLA 3HK2A 2R8IA 5J29A 2G8FA 1S1TA 4JV2A 1HPZA 1S77D 1X1PA 1ZQIA 4Q44A 1RZTA 3WNHA 2W9AA 3SI6A 3AO3A 3RMBA 3Q8QB 4FK2A 3IM1A 4RQ2A 2VA8A 2YNIA 3PW4A 2YHAA 1LB2B 7ICFA 1ZQQA 4J9PA 1ZYQA 4DL4A 5CA7A 2XY7A 3RBEA 3L2RA 2FLNA 1DLOA 2R8GA 2DPIA 4FJLA 3PR4A 1K6YA 1LAWA 1YT3A 3O3FA 8ICLA 4M3XA 3AUOA 2FBXA 3VA0A 4FZXC 2WOMA 4I2FA 2X74A 8ICQA 5DMRA 4FLXA 4XRHA 3QEWA 3S3NA 4PHAA 2C28A 3K5MA 3NF8A 3KLEA 4CFAA 7ICGA 3VQEA 3TWHA 5HNKA 2HHUA 2RPIA 2ISPA 4UB2A 3MXIA 2Z1IA 4RQ4A 3NHGA 3NAEA 4M9LA 4PGQA 4KHQA 3QO9A 2DFEA 3JPQA 3CG7A 4YXMA 3ISDA 1MC8A 4JWNA 4F93B 4CEZA 3K5OA 1X9SA 4O3SA 3ZDDA 1LWCA 3H8SA 5F9LA 2XY8A 4O3NA 2AGPA 1SKWA 3M9OB 4F92B 2KZMA 3LALA 5DBCA 5KFRA 1WNSA 5J2DA 1DTQA 5HRPA 1ZQBA 1S0MA 4J2BA 3K5LA 2ATQA 3C94A 4Z6EA 4LH5A 1ZQJA 4OGEA 3OJUA 1LWFA 4FW1A 3JPNA 3UXOA 3O3HA 4H4MA 3I8DA 2VG5A 1EKEA 1RT5A 2ZTDA 1RTDA 4I2JA 3ZSOA 4KLUA 3UIQA 5C24A 4CJSA 2F8SA 1KFSA 4CHNA 4NYNA 1UOCA 4QZDA 4FJGA 4CF9A 3OYAA 2HVIA 4IBNA 2V4RA 3H40A 4FJ9A 3ZDEA 2KQ2A 1A5VA 4FJ5A 4AHCA 3C1ZA 3OGUA 1ZBFA 5J2JA 4OLBA 3PV8A 3MEGA 1RDCA 3S3MA 5KFLA 2XCAA 4KHYA 4RNMA 3PNCA 3TAPA 4Z6FA 2HNYA 1KEJA 3SNNA 2H5XA 2O4IA 2DFLA 1KLMA 4OKJA 4JWMA 5J0YA 5KFMA 1L3UA 4M3YA 5KG6A 4HUGA 2ZTEA 3CYMA 4R8UB 5KRSA 4ECTA 1TAUA 4L8RB 5J0SA 1BPEA 3GDXA 3NDKA 4F4XA 3AVFA 1H38A 4TSXA 4CEEA 1ZQLA 4NLZA 4ECWA 3OSNA 1W0HA 1VSFA 4O3PA 4FZYA 4K8XA 3CM5A 1HUOA 1QSLA 5FRMA 1L3SA 3ZDCA 5DLFA 1WSHA 4AH9A 4CJKA 4KLSA 4LD0A 4DS4A 4E3SA 2FPMA 3EYZA 3GFKB 3RJKA 4CJWA 2BGGA 4FBTA 1TAQA 3DMJA 4YP3A 2V4QA 7ICIA 4JS4A 3TAQA 4FM0A 2P1JA 1S0NA 2J6TA 4IQWA 5KFSA 2JZBA 3AVBA 4E7JA 3KKSA 1RYRA 3DLKA 4CEAA 4DWIA 2X78A 3OYMA 2HHXA 7ICSA 1T05A 3LWMA 2W9BB 4C8MA 5J0PA 2DFHA 8ICMA 4IRDA 4Z4CA 4WE1A 3KTQA 3M8RA 5DB8A 9ICJA 3QEPA 1Z00A 3PW2A 2JEFA 3VQ8A 4ECSA 4DLGA 4CGFA 3HPGA 8ICFA 1VSIA 3C1YA 3BDPA 2FPLA 4F5NA 3TFSA 4RNNA 4Z6DA 2PFNA 2FBYA 1PZNA 1SZPA 3ZCMA 3RRHA 2JEGA 1TKXA 1D5AA 5DKWA 2ZUBA 2ASJA 4HCBA 4N76A 4YR0A 4AHRA 2UVUA 3MDAA 3V9UA 3ZDBA 2J6SA 4YFKA 3MXJA 1TKTA 3VQ5A 4RNOA 3K2PA 3KHLA 4I9LA 4P4OA 2FBTA 2GBZA 8ICTA 5CP2A 4ED6A 3AVAA 3PO4A 2OPRA 4FJNA 2A1JA 1BGXT 4RW8A 1I3AA 3V6JA 3K58A 1U47A 4KLIA 4W5RA 9ICSA 1RT7A 2NUBA 4CERA 4DTOA 4Q8FA 4DSKA 4KHSA 4QZCA 1ZETA 4H8KA 3HW8A 1RNHA 4PQUA 4F8RA 4C8NA 4O55A 3QIOA 4QAGA 1EXNA 2AGOA 5K14A 2OZSA 3OS1A 4TUQA 2C2DA 5KFTA 4QOZB 4K4GA 3RB4A 3QINA 3HJFA 1RCHA 3ZSWA 1WSEA 3MR3A 4YMNA 2B21A 5IIIA 4GVMA 3PR5B 4KMUA 3U3YA 3ZT2A 1WSIA 3WNGA 2BPCA 1S76D 3JPTA 5J2NA 4KPYA 4F5RA 2ZJ8A 4DF8A 1ZQMA 5KFAA 5DG9A 2UVWA 4M45A 4DU3A 3LP1A 4PGYA 3GIIA 5FRNA 4J9SA 3KK2A 1ZQEA 1HJRA 4XQ8A 5DG8A 2BQUA 1JLEA 1XC9A 2OWOA 4KFBA 4CJVA 1S1UA 4FLUA 3JPRA 4KTQA 4F5QA 1C6VA 9ICLA 1LV5A 5DG7A 2AU0A 1BPXA 3QIPA 1SKSA 1CXUA 7ICHA 3V6KA 5BOMA 4KI6A 5D46A 5HMLA 3PMNA 4E0DA 3OYKA 1X2IA 1Z3EB 1RT3A 4KKOA 4YN4A 3PX0A 4R5PA 8ICRA 3DLGA 3K4GA 1SL1A 1BPZA 4FLTA 4CJQA 2Y1JA 1NJWA 3QNNA 2PZSA 2PFOA 4DF4A 4G1QA 2BE2A 1U49A 1LW2A 4ECRA 3AO5A 1IH7A 5CWRA 3HYFA 5J1EA 2PY5A 2ALZA 3SV3A 5HROA 4HCCA 4DTPA 4PH5A 3KLFA 4DFJA 1O1WA 1JL2A 4CEBA 5J0OA 5KG7A 1RT2A 4DTNA 4KB0A 4J9MA 4DQIA 4JUZA 3ORYA 4F3OA 4QZBA 3H8WA 3FYHA 3RB0A 4RQ7A 1S9GA 3V7LA 3U3GA 4F2RA 2KW4A 2GV9A 4G3IA 1TVRA 3DLBA 4JV0A 3VQCA 2HB5A 1NKEA 4M3ZA 4UBCA 1BCMA 1QHTA 4DOCA 3HSTB 1EXQA 5KT3A 1LAVA 1WSFA 4J9QA 4CCHA 5SZTA 2BCVA 2HW3A 1TKDA 1Q9YA 4FK0A 4LZGA 4DQQA 2OA8A 1TL3A 2W42A 4M42A 4MF8A 2BCQA 2VA3A 4IG0A 1JMSA 4F4YA 4YCXA 1VSMA 4TQSA 5KFCA 3PX4A 4B9VA 4MFBA 4AHUA 3NF7A 5KFEA 4RG8A 4F50A 3KK3A 3LDSA 1TV9A 2FMQA 1KTQA 5CZ1A 3H8JA 3SQ0A 3UQ2A 4TUPA 3C21A 4N56A 4EEYA 3JYTA 3TABA 9ICPA 2F8TA 2B4JA 2Z1GA 3HVTA 3DYAA 1IO2A 3M8QA 1RTHA 5KI6A 4JK1A 1R0AA 1KDHA 4B08A 3K5NA 1RILA 3NH1A 1BCOA 5KG3A 4OJRA 4CF0A 4CJFA 4DQRA 3AO4A 2QK9A 4PWDA 1IKYA 4FJJA 4RT2A 2B6AA 3L2QA 3TAGA 5CR0A 2IA6A 3G10A 3B0XA 8ICKA 3AA2A 4EP5A 2OZMA 9ICQA 7ICUA 9ICNA 2C2EA 3LAMA 5HRNA 3VQ7A 4RQ0A 1K1SA 2OPQA 3QEIA 4ECUA 3TFRA 5J2EA 4CGIA 4FVMA 1ZBHA 3H7IA 1CZBA 3DLRA 3MABA 4HTUA 4OGCA 1REVA 3V9ZA 3V1RA 2ZQBA 3AO2A 9ICGA 4CF8A 2X6NA 1AROP 1D8YA 1TK0A 4CJRA 4E1MA 1ASVA 2YNFA 1RBTA 2JEIA 4TUSA 1T3NA 3ZSRA 3DRRA 4BXOA 3JPPA 2BCUA 1S0VA 5KFNA 4YG2A 3JPOA 3RB6A 4QCLA 9ICBA 4DTUA 1Z00B 1HRHA 2A1JB 4M3UA 3OVNA 4CGGA 4RZRA 3V9SA 3DI6A 1NK4A 2KFNA 3OYNA 4MFAA 3RMCA 3MR5A 7ICTA 3HO1A 4FLWA 3B6OA 4RW4A 1L5UA 3SQ1A 4KREA 1DGSA 4DG1A 1ZQZA 2HHWA 3UXPA 3LZJA 4QW8A 4KHNA 2YV0X 3TQ1A 1SL2A 4UB3A 3EW9A 4FW2A 5KRTA 2KTQA 3MBYA 4ZTFA 5HMMA 1S6PA 4CHPA 2AQ4A 1BQNA 5KFZA 3KK1A 2W9CA 1S5JA 2IDOA 1QSSA 1BPYA 1ZJNA 4QZ9A 1C1BA 2ETJA 3ZDAA 1HQUA 2YHBA 3VQQA 4B8CA 1S1WA 4AHSA 2UVVA 5D3GA 2HVHA 3L2UA 8ICXA 1QE1A 4Y1DA 4RQ8A 3QZ8A 2R8KA 3RB3A 1MU2A 3KLIA 9ICIA 4UAZA 3LPUA 4KN7A 4Q8EA 8ICBA
chains in the Genus database with same CATH superfamily
2KSOA 2GV1A 1R8HA 3A2FA 3CW2C 1KHVA 1NH8A 4GW6A 2YNGA 3OHRA 2YMMA 1K44A 4JI5F 2XIDA 1U24A 2HBRB 5IOLA 8ICJA 1ZPVA 1QQMA 5J0XA 4OI0A 3IMQJ 4LH4A 2OPPB 3QGHA 2V34A 1NXIA 3R2DJ 4X2BA 2EBGA 4KO0A 3PIPQ 3TARA 3TACB 1QAXA 5IT9U 1TL4A 3O3LA 1XUPO 2BJ3A 4LJXA 1YVUA 4WQ4C 5A2QY 5KAIU 3KD5E 1UVNA 2HOIA 4FCYA 2YNIB 2CA9A 2NLXA 1KQSM 5DQGA 4N5SA 4CTAA 3EUB2 2O8CB 1ZQTA 5D49A 3KOOA 5BRDA 1N5YA 3F5TA 4JI0F 4NOHA 1ZQGA 1QVGM 1FDDA 5B8HA 3KJVB 4DR2J 2QW9A 2QIFA 4IEIA 3GFXA 3ZZRA 1NHUA 4QBUA 2K7KA 4QWBA 3P39A 3VAFA 3WHIA 2AD9A 3EVOA 1EZZB 1CJVA 1GLLO 5GAGU 3UB5A 1SKUB 2HFVA 4BR2A 1GOAA 2D9PA 3PHTA 1ZQWA 1RYUA 4MYUA 2E2QA 6FDRA 5CZ2A 1MLAA 2ROEA 1UVKA 3A5NC 4JV1A 4MTPA 3MMBB 1Q3VA 5ALRA 2R2UA 1GLEG 2JEJA 2D7SA 3M1VA 3I28A 1SV5A 3QRQA 5AJ3F 2Y0SD 4O4GA 1KRPA 3ISNC 2NLWA 5DRKA 4ES2A 3BR8A 4RPFA 4A59A 9ICCA 1HJPA 1XMOF 1X4BA 3FR0A 3CULA 1VLOA 3VQBA 1XMBA 3ZSVA 2IGIA 1C7YA 2N4DA 3MWPA 5KFWA 2XMMA 3MEEB 2WB4A 5LT5A 3HD2A 2QMWA 4ANDA 3JSBA 5KQDA 4CLTA 5F1XA 4W4MA 4QQBA 2HYIB 2RSQA 4MFCA 4I2QB 4YXJA 4PHEA 1HNIA 3K59A 1RU2A 1Z1BA 3KVGA 5EU7A 4X62K 1FJGJ 5HBMA 1PBAA 4YB6A 4XDCA 2Z30B 3T1HF 3RH5A 2BKOA 3FSYA 4DL6A 4KITB 2P9IB 4FZMA 2VC1A 3A12A 1UWBA 3HHEA 2UYTA 4Y2XA 3NF9A 2NRRA 4BRIA 2MKSA 1L8LA 1T9XA 2O01C 5E5NA 1Y97A 2UUCK 3THVA 2H54B 4O4RA 3HVRA 3R9LA 3F73A 1FEZA 3M7VA 1QVFM 2E1PA 5IWAF 2OCEA 3BSNA 3POTB 4F5PA 4LF6F 3CDWA 4GC7A 4ID1A 2ATLA 2HGLA 2HSZA 2GVDB 4U7BA 1TL1A 4ZP9A 5AI5A 8ICCA 5T14A 1N4LA 4CIOA 4FLVA 2I1QA 3AH6A 3LO3A 2PYJA 1WOOA 1UAXA 3DKDA 1QS4A 1K1QA 3B54A 2R2TA 4P0PB 3M8SA 1C1BB 2DXDA 2QWLA 4A62A 4HUEA 2Q6BA 4DU8A 1FWKA 3KK1B 1IUJA 1N63A 1KLNA 1VQPS 2FVPA 1DFDA 3UFCX 5AQMA 1FRJA 1X5OA 1NM2A 3KLVA 4NLRA 2ZITA 3M30B 4NYOA 3D45A 3CIPA 1ZQUA 2OTLS 2CVIA 4BJQA 5KG0A 4MKAA 4DOZA 4OV1A 3FDSA 4Q0BA 1KHWA 3IGVA 2ISOA 4LIWA 3GPAA 4NCBA 2VFTA 2MXYA 5ALHA 2WVFA 5E3CA 4N8NA 3VESA 3TA0A 3O9TA 3QYPA 4DCPB 2WFBA 1G2EA 5K20B 3IP4B 5J1NA 2A10A 4JKFA 1SXEA 1M5OC 3E0FA 3I56N 2DNGA 1RTJA 5I9EB 2DR5A 1GLBG 2QWQA 3DFEA 4CFBA 2QA4G 1NK8A 4EU0A 2ZIUB 3M32B 3QEVA 3EX7B 4K4XA 4O0JA 2C3PA 1S1XB 3CETA 4CFCA 1DTTA 2V2ZA 1T8EA 4RPZA 2C1EB 3H2VE 5L9XA 4YY3K 4USAA 1IBCB 4JI1K 1S9EA 3G6XA 2XSJA 4RUAA 2R8JA 1RJJA 1D9DA 1HI0P 1TR0A 3KFUF 5J2QA 1N32J 4FOIA 4RX6A 5C42A 3RBDA 4NLGA 8ICSA 3EGNA 4PWUA 4RBTA 3ZSZA 2DBBA 1ZQKA 1FRKA 1NLVA 3IC1A 4CHZA 3U02A 4FPIA 3SMSA 2AX0A 3QXGA 2YQEA 1NGJA 2WTUA 1TZ0A 2IOCA 5JS1A 1UETA 4FWSA 3G2XA 3M8YA 1E6VA 5FLXU 3M9MB 1QCKA 1VQPN 4YB1P 4DFPA 4PXEA 2F8KA 2HWHA 2JZBB 3DLEB 3CJ5A 3IWXA 3HF5A 4H5WA 2PFPA 3QPIA 1VRUA 3TUPA 1N36J 3LK9A 2Y1RI 3H59A 2UXDJ 4X4TA 4QZIA 2R9LA 3HP9A 2RDJA 4G1IA 4I2BA 3U4LA 3TAEA 4NLQA 3MD1A 3T1AA 3G6YA 4FXVA 2X51A 4O3RA 4U95A 5ALNA 4TY9A 2VC0A 4CLLA 5HMWA 4CJ5A 2BDUA 3RF9A 3KNAA 2QKKA 5FPDA 4A8SA 2HHHF 3QFUA 4JI8K 2E8PA 1F60B 5J2FA 1WD6A 3ZEUB 3Q2SC 3Q7BA 2CDQA 3CJTA 3CJ4A 1HUXA 2VG7A 3M30A 1HKAA 4FYVB 2BABA 4ZPBA 3LP0B 3QX7A 2BRKA 4W5QA 2IFXA 3HTVA 5ALQA 1ZQVA 4WF9Q 1RCOB 1NNDA 3GCXP 4B3RJ 2EFNA 4GMKA 2QARA 2WHEA 3LVWA 1VBYA 2B3TB 4A48A 3OSPA 4NWIA 2CXYA 2CVEA 3I6PA 1RDAA 3KG4A 3D2WA 3QEBZ 1KVKA 2J7KA 3KJFB 3Q8RB 3MCAB 2NRZA 5D78A 3SSQA 3AAPA 2BKNA 4FWKA 5CCMA 5JS2A 1TKTB 3B4MA 4KAIA 1UVLA 1H74A 1JXVA 4MEYA 3C14A 4CD1A 2BJ1A 1FIQA 3TSQA 4BR7A 4MKBA 5LMUJ 3JAMO 2P6UA 2DHAA 3FGVA 3M8QB 5EWFA 5KFUA 3V6DA 2OH2A 1REVB 1IV0A 5CHIA 3NL0A 2RHKA 4R0EA 4JI0J 3UKRA 2YKQA 3NGIA 1A76A 1J2VA 1ZAWA 3VGMA 2Y9TA 4AHTA 4CI6A 1ZBIA 1S5ZA 3TTFA 3D3BJ 1VSLA 1TFRA 9ICKA 5A0LA 4MK8A 3LDPA 3W5XA 3NGTA 1WUDA 3E58A 4IKFA 3QEXA 4Y3CA 3I31A 1UJ5A 4NYPA 1QQCA 3NGDA 3OA9A 4A8QA 4C4TA 4I2QA 4GKKK 4CGHA 1WJ9A 3PDNA 4Y0WA 2LM4A 4LBHA 3A4TA 1VK0A 4JI7J 3TA2A 4H4MB 2HBKA 2D3OR 4DUYJ 3PW0A 4ZLPA 3VF4A 1AFIA 3AO1A 1TFWA 3L3FX 4UATA 3ZT3A 4GV3A 3PMLA 4CLYA 4E19A 3N4MB 4AQYF 3BZQA 2B5JA 5GMDA 2RH3A 3N97B 1NK0A 4ZHRA 4G9ZA 1X9MA 2Q2RA 4GC6A 2V7YA 1X4EA 4FZZA 2QXFA 1SJ3P 2CPFA 4GXJA 4A61A 1HI1A 3CJ3A 4IYQA 4ISGA 3TPQA 4UB8U 1YUWA 3KD1E 3ZZTA 1KW4A 4IFEA 1J6ZA 4G65A 4Z4HA 4KLQA 1U8WA 2Q31A 2H5EA 4UOCA 4BDYA 2GTDA 3QAUA 3L7OA 3SXLA 2MZ1A 4H03B 3CDUA 4UB1A 2W55A 5AKIA 4RQ3A 1FVQA 2BM0A 4RBUA 4NYFA 1K8AO 2UXDK 4FL9A 4QWEA 3EDRB 4LSLB 1ASUA 3SBTA 1TVRB 1LW0A 2KRRA 2ZBRA 3ZZYA 3AY0A 2DGOA 4UQTA 1FRLA 2OFGX 2IBOA 4A8EA 2P9KA 1HBUB 1NCLA 3WQTA 2QLJB 4HTJA 1EO1A 4IQXA 1LKYA 2A1SA 3O1WA 5AICA 3MUTP 2ZKUA 5AKGA 2E5LF 4YOUA 4KX5A 1B64A 5F41A 2KT2A 1S6UA 3UPFA 4J2AA 3G4SS 3ISND 5D77A 1ZM3A 4EBCA 4KLTA 2OSRA 5BXIA 4AP9A 1DQ9A 4OZJA 2BTFA 4B1YB 3C6TA 3VN5A 3AMZA 1DGKN 2EG2A 2I7PA 2DNOA 2BR0A 2ZWPA 1X4GA 4NLTA 4DQPA 2FGOA 1TE2A 3RJMB 5LOQA 3G71S 4A5BA 3CJAA 2QEXS 2A5XA 5CYQA 2OIHA 2Z1JA 4CJEA 3SMPA 5HQ8A 2VIXA 4D3HA 1JLQA 5J0RA 3JQKA 3KMSA 1U1MA 3H1QA 4LY7A 1IIPA 1RT4A 1R7IA 1YJWS 3HT3A 2VWKA 5KPTA 1RBOB 4JYAF 2ZH4A 1M90T 4DV3K 1DOQA 1YBTA 4CNQA 3HI9A 1ZQNA 7FDRA 3R5CA 3I87A 2J0XA 3W5YA 4ID5A 3AVLA 2PFDA 4DLEA 1I51B 4KIAA 4PKGA 4ECXA 3D0IE 3ZI4A 3EXCX 2F1HA 4I2IA 1U04A 5DZ6A 3AQOA 2HMIB 1UHUA 2KZZA 2IRUA 3PFEA 1H7XA 2RF2A 2IM0A 4UAUA 1S48A 3T19A 1V38A 2JH7A 3OXFA 4C7QA 2XMJA 1V4TA 2IOFA 9ICMA 3W8PA 4QZGA 5C10A 2IMWP 3EZ5A 2OYQA 3OVAA 4P9SA 5GAEU 2K8CB 4QU7A 4FJKA 3A0BU 3GU3A 3KHRA 1OQ6A 4DQSA 5IV3A 1VC0A 4BGAA 3SLCA 2QZ8A 1GXUA 1MSWD 4IH5A 2OLWA 4DV6J 4ELVA 1Q95G 3TTCA 2E7VA 1SZ2A 2CJYB 3GFZA 1ZRNA 3N4WA 2W9BA 3G4SN 4CJ4A 2WAQC 2DGQA 4UOHA 1DK2A 5CYQB 3CC2S 2IS3A 2N3LA 4P2HA 3H42A 5JVGQ 3M1YA 3EWAA 1SV4A 5AM5A 3ELHA 4ELTA 3EE3A 2DKOB 4ANEA 7FD1A 3SPYA 3ZT0A 4KI4A 1JCEA 1NBEB 3KHGA 4J2EA 5BYSA 1B7YB 2YWKA 5HN0A 2WF7A 3A5MC 2VPYB 5IFMA 3MAAB 1KQSR 4LF6K 3TJ9A 1S6QA 8ICIA 3LUYA 4C11A 3O9RA 1UEKA 3KK2B 5KT4A 2QLFB 3R5GA 1GQEA 3GZ7A 4UB6U 3KIOA 4NE9C 5AQFA 1SCJB 1HQUB 1OH6A 2DIVA 1U2RA 2BVZA 2VJVA 1YSJA 3QSIA 4AE5A 5AKXA 1PVRA 4DR1F 1IKXA 2A6AA 1JLFA 1W25A 3RJGA 2M70A 1VQKS 2V69A 3MXMA 2HRUA 5KFJA 3AA4A 4MDAA 4KN4A 4Y34A 2A3ZA 1UVIA 3H5YA 3BSCA 4IDKA 4FLYA 2UUWA 3UMBA 2EW9A 4WFYA 4QZFA 1BQMA 1HNVA 3HILA 4LZDA 7ICNA 1MA7A 2V9KA 4IOBA 2UZAA 1G15A 3LP2A 3AVMA 1PYOB 2VQFK 5EWGA 5FPNA 5HSPA 4W5TA 1EQMA 3TJAA 3GWCA 4LFBF 3CDAA 4K8RA 2Q3SA 1ZQYA 4LSZB 5AXNA 3GIKA 2XHBA 4PA1A 2Q79A 4DX5A 4HHTA 4CLSA 1QD1A 4CLPA 4F0MA 9ICHA 1XNQF 1RBUA 1RBSA 2PO4A 4DR7J 1IVZA 3M32A 1C0TA 3ASMA 4IS7A 1DTTB 4EYIB 4I2CA 4X5VA 4MH8A 1JCGA 3KWGA 3TI0A 2FMSA 4FM2A 5E79U 1N5YB 4DX6A 4L3QA 2DXEA 1YI2S 2E29A 3HHKA 1C1CA 5LSLA 4H0TB 2R4FA 3M6UA 3T5LA 4CEDA 3H5SA 1UPHA 4YOYA 3J7YU 4DTSA 2ZWHA 3DHXA 4PXDA 5BPMA 2XC9A 1IBLK 4GRSA 4LF4K 2VANA 1NJZA 3O0FA 1SL0A 3CFPA 1Q16B 3TR5A 4BE1A 2HZCA 1NH7A 2G8IA 2YN4A 2GHPA 4I6MB 4Q0BB 5LJWA 5IINA 7ICEA 2MKKA 2HBQB 4JYAJ 3I0RA 1UL3A 4K0KJ 1F44A 2PI4A 4PL1A 3MFIA 4WYBA 5MAOA 4CJLA 4ZPCA 3OW2M 1IXKA 4FFDA 1HQEA 1NDLA 4ILJA 1T3QA 2EZYA 2E5LJ 4DV6F 4JK7A 5DJBA 1HIWA 1WCNA 1EB0A 1U6FA 3CB4A 5HVHA 4M6WA 4M9JA 4MFFA 4NM1A 3Q8PB 4P0PA 2VV5A 2PFFB 2ASLA 3OQ2A 1R8AA 5FPMA 3GG1A 4CF2A 3NGYA 2CPIA 2QYGA 3KKRA 3JXUA 3IS9B 4CEQA 2DPJA 8ICYA 5EY4A 1JX4A 3F2DA 4LQ9A 3W65A 4BR5A 4IO8A 3GE1A 2XI9A 1NWKA 4I2PA 1WWUA 1FRIA 3VQAA 3AB4B 5HP1B 3SEOA 5F2RA 4QIWF 2GVDA 4M9NA 3QZ7A 4BBYA 2ZBQA 1NSQA 2HFNA 1TFYA 1NUEA 1P9QC 1B9FA 5AQHA 4Z4GA 2MLZA 2WUSA 3HZ6A 2VICA 1YITS 1WOSA 4B9TA 3S8SA 3GBTA 3V6DB 4C9DA 2QKBA 2D3O1 2E66A 2D0AA 1IG8A 4UAWA 2E1MC 2HHSA 1PO6A 4LIRA 5J0QA 3ISBA 2ZBCA 4H5VA 1FNMA 3WKBA 2J76E 3M6KA 3V1OA 1L3TA 3R1LA 4HUFA 2FMPA 2XS5A 3UM9A 1UJ4A 4IZ9A 1LCUA 4P2FA 1NGFA 5KFPA 3EZUA 3NOCA 3WK4A 3OYGA 2AV5A 3MEKA 3EE8A 1UTAA 2B6AB 2E8AA 1S72S 4E89A 1CLQA 3QJPA 7ICLA 2VJUA 5B08A 4AM6A 2DCLA 4JKDA 4F36A 2AXTU 4G1QB 4DN9A 1JQGA 4U67Q 3MMAB 3S7RA 3WDOA 4ZPVR 3SPZA 2EPIA 3TR8A 4OZ3A 2KVSA 3R3TA 3LM9A 3L6QA 4DKWA 1O8BA 9ICRA 2DNQA 4LFAJ 1GLCG 2FJ6A 2VL1A 4YY3J 2XTJP 4JAXA 3PYFA 4TURA 2DT9A 1JIHA 3ETLA 1S1UB 5ALXA 2L48A 3CNQP 4LR9A 4GKJF 2KIWA 3PW7A 1RT1A 4CO2A 3H4DA 4FBUA 3EY1A 2W8KA 2LVWA 2Q97A 1X5PA 4LREA 4M5HA 4OMFG 2EFGA 1RLDA 4NLPA 2R7SA 1QZ6A 2HKEA 1C1CB 2DNMA 1X4CA 1YJ7A 2VB6A 4K4WA 2OM6A 1ZQAA 3QRRA 1G4CA 2W9CB 2KLAA 1XO1A 1IR0A 1JXEA 2YKAA 3OR1B 3OL8A 9ICOA 3M4XA 1IR1A 3FBEA 2VOPA 2GWSA 1WSRA 2FLLA 1EARA 2R8IA 1SV0C 1S1TA 2OEKA 2RQKA 1S77D 4RL1A 3T69A 2K06A 1ZA2B 4Y2YA 3AXKA 2ZGZA 4C98A 4WFNQ 2QWNA 4CO0A 2BEFA 3AO3A 3PZPA 3N28A 2RRBA 5IWAK 2DISA 2HHPA 2L5YA 2YNIA 3PW4A 2YHAA 1WHWA 4N8OA 3F2CA 4CM2A 2XY7A 1EJ7L 1YX2A 3RBEA 3L2RA 1ZD4A 3IR6B 3RGIA 2QL9B 3DDKA 2VDIA 3O3FA 8ICLA 3VA0A 3CCLS 1N5TA 3CPEA 2Z7JA 2WOMA 3GSIA 3VCDA 3PKYA 2X74A 3O9QA 4TNOA 2HZAA 4JI7F 4XRHA 3VZHA 1MWKA 4PL2A 4NXMK 3S3NA 1XIQA 2A0FB 2M4MA 3CT9A 2W04A 1X4AA 1CULB 4LF5K 2RPIA 2ISPA 3V4IB 3I33A 3I0SB 5AHXA 4UB2A 1SUQB 4Y2IA 4ILMA 3EEQA 3ULHA 1SIZA 3NHGA 2AH5A 2IRXA 3WQUA 4PGQA 3A0HU 2B7CB 3QO9A 2I8EA 3UE5A 3ISDA 4CEZA 1X9SA 1MG7A 1LWCA 2DNNA 3H8SA 5EE1A 3F56A 3KKAA 2UU9K 3KUEA 3Q8VA 4QIWD 1Z4UA 2F8LA 4OX7A 3BGFA 3VGSA 4U7CA 4P7VA 2HK2A 4JV5J 5EX0A 2OMLA 5J2DA 1X0FA 3K9KA 4MT1A 2Y0SC 4J2BA 1G1XA 3IG1B 1ZQJA 4LH5A 4OGEA 3OJUA 1HEKA 4FW1A 2E88A 4H4MA 1CS4B 4UAVA 3IXQA 4DR6F 2FF6A 2E2PA 5I42B 4I2JA 3ZSOA 3AQEA 5C24A 1CPZA 1KFSA 3IMXA 3MAAA 4AXIA 4QZDA 3CGIA 4FJGA 3OYAA 4P73A 4X84A 3ZZPA 1YLXA 3ZYYX 4AYBD 3MHYA 3ZDEA 2KQ2A 1X8DA 4OQJA 2XMTA 3C1ZA 3OGUA 5B09A 5J2JA 1DBDA 1F1BB 4JI2F 3PV8A 2XHWA 3VENA 4FE3A 2C2OB 2F2AB 3QWUA 2DKZA 1JJ2M 2O4IA 2DK2A 1S6OA 2QYCA 5HVGA 2KIVA 2EZXA 2AYMA 4JWMA 5KFMA 1FDAA 2KJ8A 2PGCA 3L7PA 3ENOA 2ZTEA 5K8MA 4R8UB 1P8GA 4ECTA 1RT2B 4JHDB 4US9A 4ZVTB 1PIEA 2AYEA 4F4XA 3AVFA 1H38A 1SXDA 4TSXA 3MPVA 1ZQLA 4N7TA 2KYXA 3T1YF 4K8XA 3FEZA 4DX8H 2FD2A 4CJKA 1B70B 1KP6A 5GTHU 4KLSA 4LD0A 2XO6A 1GLJO 3QUCA 2R7WA 2BGGA 2EZZA 2QJ3A 5BN9A 1TAQA 2Z2YB 2CN1A 3CIZA 2V4QA 1HIYA 1S0NA 1FW6A 2J6TA 5LL6d 4FWLA 1J5EK 2JZBA 4E7JA 3KKSA 1RYRA 3DLKA 4CEAA 3KG1A 1NI3A 5HLFB 2YJEA 3VPZA 3LWMA 4JI2J 1KN6A 4Z4CA 3KTQA 1R6VA 2JVOA 2XLKA 4QYZK 5DDQC 3SFGA 2D0OA 3QEPA 5AKEA 4Z2XA 4DUYK 4ECSA 2HGNA 4CGFA 3MTKA 4O5FA 2FPLA 1JLQB 3TFSA 3HLUA 1JLAB 4RNNA 5E84A 4ZJOA 2FBYA 2GJ2A 4KR0B 2X1GA 4DR3K 1TKZB 1YJWN 3RRHA 1D5AA 4Y28C 5DKWA 2AEJA 1U02A 4N76A 3PCOB 4AHRA 2UVUA 1XJWB 5LJ5Y 2V8GA 2HOQA 4ZN1A 3V9UA 1ZM4A 3SCJE 1NSPA 4DR5J 1YI2N 4JV5F 2J6SA 1RBLA 3LDNA 4A2BA 4WXOA 2H5JB 4RNOA 3K2PA 3KHLA 3AN1A 3PO4A 4HVZA 2L9DA 1I3AA 3CERA 1VQ9N 4KLIA 9ICSA 1EKSA 4WKRA 3ULEB 4DTOA 4CO1A 2CPRA 4JNEA 4KGZB 2CIMA 4F8RA 4DR4F 4C8NA 3MM7B 4LJMA 4TYAA 4NLBA 1HNVB 1GXLA 2OD4A 2OZSA 5H1SV 2UXCK 4QOZB 1WHXA 4LC9B 5HQLA 2NUUG 4PUOB 2A2DA 1RCHA 2EAPA 1WSEA 1H72C 2ILZA 4B3TK 1YVFA 3OR2A 2QFIA 3U3YA 2F9JA 1U2VA 1HWIA 2BPCA 1HR0K 3HOSA 4F0HA 1Z4OA 4K50A 2X1BA 3EVMA 2YNHB 4I1TA 4KPYA 4ZPTR 4FDFA 5ALLA 2W24A 2ZJ8A 4DF8A 2LQBA 2NXJA 1X4FA 2VD3A 2MZSA 4QZVB 4USIA 1N88A 2KOBA 2CPYA 3GCWP 3DHWC 3VEZA 2KM8C 1X5TA 4TN2A 2OWOA 2KYZA 1S1UA 5C2DA 1PBUA 3GJQB 4AUKA 1G7CB 3THYA 4H5NA 3DXMB 5M1QA 4RBVA 4DR2F 1SKSA 2A1BA 3K8VA 3V6KA 3EO3A 2DNHA 3CQXA 3TUIC 4WXWA 4YN4A 4LF1A 8ICRA 3DLGA 5K14B 3VWSA 4RW4B 4DPUA 1WWVA 4DF4A 2HAIA 4M5IA 1U49A 1LW2A 2YI1A 2FJXA 4ILHA 1T6CA 2K4PA 4K4SA 2PY5A 3SV3A 3SSRA 5HROA 1P9YA 4CZCA 3F5EA 5AQZA 1H73A 3R6GB 1Y00A 2OPRB 2P6SA 2JLGA 3BKUA 5AQRA 4CEBA 5J0OA 1HWKA 1RT2A 4KH4A 1HNXK 3H25A 4J9MA 2H1YA 3DRRB 1YIJS 2NR0A 5D4LA 4OJ5A 4WCEL 3TZWA 4ZLJA 3FYHA 2E7XA 4RQ7A 1QHAA 3HKZC 3U3GA 3RG6A 2KW4A 5JTIA 1NMEB 4NX9A 4DPWA 2HFUA 3VQCA 3RAMA 5AJ3J 1NKEA 3D6HB 3DRSB 1QHTA 3OL7A 3Q7CA 1S57A 4QJFB 5AIAA 2GX8A 4HTIA 1Q9YA 1UAWA 2YQ0A 4CWBA 5GTIU 2MQOA 1H6KX 3BS5A 2V8HA 1H2TZ 4C97A 2G0AA 4TU9A 4XAKA 3MWTA 3IFEA 1JMSA 5F8HA 4LF5F 1PUZA 5C24B 1QQ6A 2ACYA 2RMLA 4TQSA 4CLUA 4MFBA 2ZC4A 4PXBA 1ULRA 4CGZA 1TV9A 2FMQA 3BGUA 1KTQA 3OR2B 1LQ9A 3H8JA 2UXBF 3UQ2A 3TABA 3C21A 4EEYA 1N32K 2OI2A 4EAHD 1QDUB 2Z1GA 4ZPAA 8AT1B 3JSMB 1RTHA 3HSZA 4JK1A 4O3MA 4IEEA 1WUAA 1S9GB 3J7YI 3M8WA 2P9UA 2AHOB 3HT0A 4B08A 1LOTB 3ZEUA 4OPHA 3HJVA 2ZJPL 1RILA 3BBCA 3G71N 1PCAA 2ZIXA 1DRZA 1KTVA 4CJFA 3VALA 5AI9A 3BGOP 4HT7A 4PWDA 2QK9A 1IKYA 4FJJA 3L2QA 5CR0A 4KGVB 4U96A 1LKYB 3AA2A 5AQIA 4EP5A 2OZMA 2QA4S 3MMJA 1FERA 9ICNA 4Y65A 3LAMA 5HRNA 3JAMY 1K1SA 3MM8A 4C0HA 2PEBA 2H9ZA 2MJUA 1D0EA 3CE8A 4CGIA 2G2OA 3LA0A 2NXUA 1FFVA 5GMKa 2JH1A 1PK1A 3MABA 2HHHK 2HWIA 3V9ZA 2F3JA 3AO2A 1L7PA 2EH9A 2M8HA 1AROP 1D8YA 3LGHA 2YNFA 1HD1A 4R79A 1TAMA 1J2NA 4BXOA 2V5HG 2M0GB 2LYBA 1BC6A 3HJEA 4JI4K 4YG2A 4R25A 1X4DA 2GAGC 4KH0B 1VI7A 3RRKA 1FTCA 2O1PA 1Y9OA 5E0OA 4U7UD 1BWVA 1MWZA 3T9ZA 4RZRA 2ZXIA 1AW0A 4ACOA 3DI6A 3PYEA 5ALEA 3N7SC 1RAGB 2A3VA 2KFNA 3QT6A 3MR5A 4FLWA 1TQLA 3B6OA 4KREA 4FF2A 1DGSA 3H3OB 1ZQZA 2KVQE 1AUDA 1X6IA 3OV7A 4FPRA 2YV0X 1HBOB 2ZIUA 3D28A 1IJFB 1S49A 2YB4A 4FW2A 4DFDA 2KTQA 1IWGA 5KRTA 4ZTFA 2FJAB 4Y2RA 2YJFA 5AKZA 3CJ0A 4B3MK 2DBYA 2W9CA 3SCLE 1S5JA 2IDOA 1BPYA 1X7VA 4QZ9A 3ENBA 2ETJA 2WB1C 5D4NA 4CD3A 3VQQA 2JJ4D 2MRLA 3P5BP 4AHSA 2QLXA 3SAFA 3I82A 4Y1DA 4X4OA 1VFJA 3QUTA 3QZ8A 4UF4A 3IM9A 2FB0A 4UAZA 2FI1A 2CQ0A 3M2RB 3PSFA 2BM1A 4Q8EA 2CYYA 7ICQA 1RBAA 2DUYA 2HG4A 5L1IA 1XEZA 4URGA 3JSMA 1I5OB 1Q7LB 2YWEA 3AVKA 3M9NB 4OPJA 3UD4P 3EZWA 4DPOA 4NL5A 4O44B 2WB1D 5AK3A 4B1XB 2KXHA 3JSRA 4NA1A 3QE9Y 4YOEA 2WF8A 1HBMB 4BR0A 3VCBA 4NY8A 2KV2A 2YWGA 2GO8A 2ZNZA 5K5MA 5KNIA 2BPFA 4KGKA 4OPKA 3K1ZA 3C5GA 2Z56B 4N47A 3NTUA 4Y0FA 5HO4A 1ZRMA 3RR7A 3PJ9A 2NS1B 3O4NA 3IS9A 2YX1A 1Q8IA 1Z2ZA 4FWMA 2CNKB 4BHQA 5ETVA 4WP3A 2PE8A 2V9WA 2NXCA 3BR9A 4TVAB 4BY9C 4TXSA 2NZTA 3CMAN 3UDEA 1OXJA 2H4YB 9ICEA 3RRGA 3W2WB 5M1KA 1SH2A 5DB6A 4O44A 3NOGA 2AJFE 1A5XA 1M90O 4H4OB 1RAJA 1LEOA 3OT9A 2HVDA 1AZSB 2YH1A 5A6WA 4HHUA 2R7VA 1XSPA 2ZGYA 2LXUA 1HNZF 4E7KA 1YJNN 2MQQA 3CF5L 2P9IA 1B0VA 4Y2MA 7ICJA 1L3VA 2OPSA 4WU2A 4M5DA 5D4OA 1YJ9N 1WI6A 4MO5A 2DY1A 1EX8A 4J9RA 2FYXA 2OPQB 3CJKA 4DTMA 1WF0A 5SUHA 1HNXF 4DV1F 2ZOMA 1WG1A 4RW9B 4ICLA 1IXRA 5D4BA 4EWTA 2XCPA 2CXEA 3C2KA 3MECB 3ADAC 4QZEA 1NKCA 4KLLA 4OYIA 3FZLA 4OI2A 2PSZA 5ETSA 1N2XA 5DDYA 4EUVA 4KY3A 2Y9UA 5AE2A 1UJ6A 5L46A 1BIUA 1ACMB 1FKPA 4ED5A 3ISCA 2V6AA 3P83D 3CJRA 1IKWB 4NLWA 2YX8A 5AQPA 4NLUA 3DLEA 5F3ZA 1VQ4N 3IG5A 4NO7A 3VERA 4YMOA 3I4PA 1HQEB 3D6RA 5H9FK 5CABA 4C0OC 3A3PB 1BI4A 5KFQA 1KS2A 1K73O 4TY8B 2HIQA 2G9OA 3BKFA 1UT8A 3CD5A 4TLRA 1VQNN 4MLHA 2EDUA 1MWQA 2OAUA 4YNQA 2AP6A 2WW4A 5JVHL 4YDUA 2IHNA 1MQ3A 3CF5Q 2AT1B 2JFDA 2M9NA 4K8ZA 2EFQA 2J0SD 1XSNA 4WFAQ 4YMMA 2RB7A 3NFAA 3TUZC 2JC0A 3QQCD 4KRWA 4XTTA 1DJ0A 3UO0A 3B6PA 4OX8A 5JICA 1FRXA 1KFTA 2DJWA 2JLFA 3RTVA 2ZD1A 3IAYA 4RPYA 5ALZA 4I9QA 3CCES 1LWFB 4U8VA 4QJVA 1URNA 1KLMB 2FJBB 5H9EK 3KJVA 1Q82O 1CVJA 1K47A 4PR6A 3MEGB 3BPDA 1UZHA 1L8OA 4DR3J 4FLZA 3LDLA 3BO4A 1PAEX 4O23A 3SYZA 3MOJB 1A0PA 2IVYA 1RWWB 4K4HA 3FNNA 1WOPA 5IT0A 1XQSC 3A8EA 2DHXA 3W3SA 1U4BA 1GOCA 5ALWA 3EVWA 4C8OA 1NKBA 1NB2A 4YDDB 7ICVA 5D8HB 5KT2A 4L73A 5KFGA 1Q86T 5TKWA 2YHWA 2W2NP 4B9UA 1BI4B 5IXUA 3OUYB 2ZM6F 3KDOA 1L6NA 3AEVA 2ADBA 2KNJA 3TVKA 2C3UA 2I2YA 4PG4A 4KLJA 1Q8BA 3MWBA 1KKXA 2NXNA 2YQ1A 3MX2A 4RW6A 3BH7B 2SXLA 1ZZFA 1FKPB 2RRDA 3QIPB 3GR1A 4I67A 4C8LA 1V3ZA 2RKIA 2YX4A 1D8BA 3OL9A 2KDOA 4OPAA 4H0PA 5JXSA 1HNWF 2BKPA 3VVUA 3THXB 2XMKA 4OJLA 2EVZA 3PSPA 1MMNA 1KVAA 2DO4A 4AL7A 1M1KO 3F9KA 1YTYA 2ZVSA 3ENWA 2QSFA 1REGX 3R7BB 4F2SA 3MPDA 2XM3A 1JXBA 2B8PA 3UKUB 2DNZA 4PY5A 3WX4A 5L8RC 4F3MA 2M5YA 2QARB 4Y00A 4YN3B 3NASA 3AVIA 1IG9A 3UNYA 2QA1A 2I7NA 1VJQA 1DY3A 3HHLC 2QV6A 1S3XA 3C6UA 5B0BA 3LANA 4QZAA 4ZTJA 3AD8C 3K8WA 1K5OA 1EX4A 2PFQA 3DGPA 2B51A 1VRTB 2QX0A 3D0HE 5K8NA 4W5OA 3LPEA 5AXKA 2RU3A 2ZE2A 4DZ6A 3PRBA 3CCWA 3THXA 3RAQA 4ED7A 1YRTA 3GJSB 1IN0A 4LBIA 5AQSA 5CD4H 3CFRA 1V3RA 3QMLA 4CBXA 1T11A 4DSLA 2IJFA 3OYHA 4H4KA 1U6ZA 3BQ2A 1F9FA 3JTOA 5A0YB 4PCQA 2VKQA 2Z58B 3NE6A 2EWHA 3BSOA 3U8XA 1SIWB 3M05A 1U26A 1WC5A 2E8MA 4FWOA 4KAZA 3QEAZ 1Z19A 1D8LA 2DR8A 5JLHA 1JJ4A 4FZNA 1SV5B 2PA8D 1F5AA 4UB4A 3ZNUA 4R65A 1WTBA 5ADZA 1J5OB 1S99A 4O4GB 3C3LA 3U6FA 3QRPA 1B92A 3MMBA 3V6HA 3D4JA 3TEGA 2VCPA 4CE6A 2PC6A 4K5RA 1X4HA 3IAS9 1S9FA 2B56A 5SWMA 3EGZA 4FJMA 2YKPA 2POKA 2LXIA 1N36K 4HACB 4ISFA 4ZVQB 5DK5A 4J9NA 3DV9A 3ZTQA 1QVGR 1Y5LB 3PG9A 1E6VB 1KWMA 1GXTA 1PK1B 3D2EA 3H5UA 4P4PA 3TVYA 3SJJA 4KB7A 3E01A 2K3IA 2HBLA 2EK6A 2ZJAA 2IM2A 4RT3A 4BWJA 2D5RA 2FPKA 1IJEB 4U8YA 3IRXA 1JLBB 3PEJA 2W43A 1JK9B 4J03A 3W9IA 4DL3A 3UN5A 3C0BA 4JKGA 5HAOA 2VG6A 1P27B 2XSJB 4ZVPB 5AK5A 2CQ4A 1UVJA 2ZIWB 3KLGA 4KHWA 3C16A 2HRYA 1H1VA 4F04B 3MM6A 2ZDPA 1RG6A 4R63A 2UVRA 8ICGA 5EE0A 4FS1A 3CCMS 2UXDF 3PRDA 1N36F 1C0TB 4M5JA 2K8GA 2NSCA 2OHDA 3UDCA 1TUVA 1U25A 4CK2A 4B3OB 5ALOA 4DU7A 3BPSP 3CCQN 4EZ9A 1O5JA 3OR1A 3J7Z5 2VQFF 4CGDA 2WVCA 4LRAA 2ITGA 3SI8A 4KYZA 4DCOB 3CCJN 7ICOA 4IG3A 3NMRA 6AT1B 4DL2A 4WKYA 2V2KA 3ALYA 3V72A 2P66A 1MU2B 3KLIB 1XNQK 3R6LB 3W0LA 2E9TA 3Q8SB 2B4VA 3QNOA 3LOUA 1NJYA 5L1JA 3OS0A 1YQHA 2P35A 4K2JA 5AXLA 4BACA 1NNLA 5CHCB 3WX8A 5JU5A 1J5OA 4BDZA 2JMGA 1KVCA 2O66A 2W7OA 5A8KA 1LK5A 5FJ4A 2R42A 3OTEA 2ZM6J 4J90A 2XY5A 3RFAA 3D2FB 5F3XB 3MPUB 8ICPA 4WWSA 1TYQB 4E1NA 4ICAA 1F21A 2F7VA 3IWNC 4PPXA 1F3VA 3FFIB 1EQ0A 4XA5A 4LSNA 3M7DA 2E5GA 1OY6A 4DDFA 5DS7A 1DK3A 1SC6A 3C7NA 1P1LA 4NLOA 4UB5A 4KTWA 2CQ3A 2ZUDA 3GIRA 4DPTA 4E98A 4ER8A 3JS6A 4DR7F 3EGWB 8ICUA 1WACA 1S0OA 2MZTA 4DV2K 1RWXB 5HROB 4QIWC 1R27B 3ENHA 3O08A 1C1AA 2BANA 1IBLF 1YJVA 4LF4F 3C65A 3W2VA 2PA3A 4UQGA 5KFXA 4HHJA 3H46O 3C2MA 2RVJA 3CSKA 2B9WA 2OP5A 4YVZA 4OL8A 6FD1A 2AYGA 3ZX2A 1SH0A 5HMZA 4LF9K 1XR6A 4X66K 5EVZA 1PJ6A 3ETMA 1QQOA 1Z25A 3AAWB 2RS8A 1RA7A 3UD5A 4K2XA 5KT6A 1T9TA 3NG8A 2JLEA 2W8LA 1TK8A 2D0CA 1HMVB 3GJTB 3HSDA 2YBVA 5F0WA 5EE9A 3VQDA 2WF6A 1NZ8A 3J80U 3DLHA 5C12A 3ITHA 1T3VA 5AM3A 4GO7X 5CAAA 3TZXA 3OTQA 3M6ZA 1EHWA 5T7BA 5I42A 4HDGA 5GVQA 3ZO7A 4DEZA 2DHSA 5AE3A 3E9PA 3DOKB 5J2GA 1KDNA 4LQ3A 4Y2JA 3SDEB 1BD6A 3VQ4A 4BS2A 4M6WB 1CJKA 5BOLA 4K25A 1CQMA 3UMCA 1UCVA 4PRFA 4KHUA 4P71A 3FFIA 4CIGA 4JI7K 3LVVA 2JHDA 2EFOA 3RZAA 3AFGA 4QWCA 1WC0A 4Z7YA 3W61A 1Y3KA 3VGVA 3C66A 3J7ZT 2BCSA 4ECQA 4JRQA 5KFHA 1ZOTA 5LJVA 4F4KA 2Y9HA 4NPOA 5IQQA 4RWXA 3FAHA 5F8IA 1GH8A 1JMTA 4LFCJ 1FEEA 2V67A 5CD4A 2YKOA 3U1LA 1N8RO 4CYUA 4UTGA 2RAQA 2M2BA 1DZ5A 5LSOA 4HTLA 3HX0A 5J2HA 5M2RA 4Z4FA 1S9EB 4GO5X 3NMAA 2RKIB 1NSAA 2DH7A 4JI4F 4KLGA 1AT1B 4DCHA 3I0SA 4ILGB 2LEAA 1T3OA 1WSJA 4PWWA 2CJKA 3WIVA 4B9SA 3J8AA 3Q89A 1TV6A 1HNXJ 2WCXA 3MDQA 4JEPA 2ZEJA 4A8YA 2HLTA 2AIRB 4M2YA 2GJIA 2EFVA 1TVAA 1B0XA 2GEMA 4OZ2A 2IVNA 5BR9A 3GIJA 1MDUB 1RBRA 3A3NB 3MCPA 3ED5A 5DQIA 9ICTA 2ZIWA 3KLGB 1CJUB 3UQSA 4LF6J 4RUHA 4L76A 1UT5A 3JTNA 1PYSB 3VA3A 4I69A 3ULEA 5KFOA 2VWBA 5E3AA 4K43A 1VQ6S 1WSGA 4ZJQA 1HJOA 5CB1A 2RD5C 1ITGA 1OS5A 5IT9Y 4CHQA 2LP4A 4M9HA 3E2EA 4Y2PA 2KKVA 3BF4A 4JI6J 5A2QU 2FJDB 2HNYB 2BMBA 2E6LA 5DM6L 1VC6A 2C22A 1KFDA 2CDRB 1Z1VA 5F8MA 1RABB 2BDPA 5LSRA 2CQIA 2F5GA 4USMA 3C5FA 3ZLJA 4DV7F 5KL8B 4J2DA 1ILYA 4QWAA 2MLYA 5LMNF 3EN9A 1YWXA 2CPDA 1GMUA 1OUQA 1SKRA 2K7JA 4NRTA 5ITHA 1N62A 4J8FA 4BQZA 4FXWA 2P6RA 4C1NI 4DR7K 1PVPA 3IBWA 4NMXA 4XH5A 3DCAA 3MZIA 4G1PA 3MGIA 3R5BA 3D0PA 3R9KA 2ZM6K 2VWJA 4USUA 4RQMA 4V19J 1N5QA 2WW8A 3P8BB 2VBZA 2KHOA 2LQ5A 3QU5A 4OYXA 1FXXA 5AI4A 4DFKA 2VFRA 1C4CA 1BA0A 1UZDA 3PKMA 3V7KA 3CC7S 1SQGA 2LYAA 1RYSA 4ED3A 5F9NA 3TEHB 3CPWR 2FDRA 3MCMA 3NCPA 1J5EJ 2ZHBA 5DQHA 3MGVA 2O6KA 3WU2U 3HHNB 3OYLA 1JI7A 3WK5A 5IIMA 1NK5A 2WAQD 4KLOA 3D7SB 4ZCKA 5GAHU 3LF0A 4C80A 1XS9D 2KT3A 2XG8A 4UT4A 2FHMA 2QGFB 4UUWA 4F26A 2JGUA 4OX9K 2W03A 3MMCA 3D2SA 1RWPB 2DGVA 1TGOA 4CGJA 3FZFA 1EETA 1RT3B 1X40A 1OYDA 3H4BA 5C25B 2V63A 4C3MA 2IYGA 4WTOB 2MYFA 3DRXA 1FKAF 2VPWB 2XRIA 2DGUA 2W9MA 4WZQA 1WOQA 3BBBA 4X62F 2D1KA 3VEYA 2ZJQQ 2Q4TA 1N52B 1XK8A 3HVAA 3LAKA 2DNYA 1YTUA 1AUSL 4MJKA 4X66J 1D9AA 1VQLS 1B0TA 2HMXA 3HZEA 2F4VK 3NP5A 3J81Y 3E1YA 2OTLN 1JJHA 2CZ9A 4MF2A 8ICWA 1A9NB 4ECYA 1YJNS 4YDUC 3MEDA 3NXZA 4NLSA 1RKJA 1VSEA 1HBOA 3Q8MA 3KHHA 3FMWA 4Y2KA 4OX9F 2CPJA 4GLXA 4PXCA 2EX3A 1GEHA 1A77A 1EP4B 2BUNA 3P38A 1NNEA 2ZUAA 5DB7A 5BYQA 2I5HA 4X65F 5KGWA 4KRFA 3AOBA 2WAQF 1O03A 3DDHA 3T9NA 5LMUF 1BVSA 1ZTTA 1VS3A 1WNEA 4DS5A 3UMGA 9ICAA 3A8JA 2BE2B 1RTIB 3G8TA 5I3PA 5C15A 1GX6A 1RQLA 1Q9XA 3AOCA 1YTAA 1KEKA 1NO8A 5GIOA 1T03B 4KLEA 2HFZA 4NV0A 2YWFA 1VQ8N 4M47A 3OY9A 3D6FB 4DTJA 1ITPA 5BRFA 4DMZA 8ICVA 3OBIA 3TX0A 1HA1A 4DV4F 3R2CJ 4CZLA 3OXLA 1NGEA 3P5JA 4ZN3A 4OKKA 2CPZA 4MAKA 1ZH5A 3JPSA 2MKJA 3FQKA 1FF2A 1ZTWA 3SUQA 4MYTA 5AQKA 1LWEA 1VQYA 5C42B 4J37A 2HMPA 4M04A 4OX6A 2K4IA 2VG6B 2RRAA 1LNQA 2OJ3A 3NUQA 1NOMA 3UPQA 3AU6A 3LP3A 2VG5B 3NCQA 1ZQDA 1U1NA 3AD9C 5C5JA 2E9RX 4OCZA 2ZUCA 4WYLA 3LL3A 4FJHA 3QWPA 4B9NA 2EFPA 2Z1HA 8ICHA 2NRWA 1S6PB 2CRXA 3HSCA 5CR4A 2EXUA 5LJ3Y 2DH8A 4DO9A 3O8WA 2KH9A 4MHVA 3ZT1A 4LSLA 4EP4A 4NCGA 3KUGA 3U27A 2FZCB 1F2HA 1XQIA 1HKGA 3AQPA 4MFBB 5A6PA 1KONA 2ITMA 4IQUA 3BO2A 3RW6A 5FLXY 4ELUA 3HD1A 1CEZA 3IP0A 4PG7A 4I29A 2Q0UA 2F1JA 1RDRA 3DOMB 3CUNA 3KUHA 1O08A 2GS8A 1MQ2A 1RA6A 2ZH1A 2IDEA 3ZXWA 3KOAA 4IXCA 1QLNA 5J1PA 1WBBA 3C2LA 3MN7A 2W11A 2AEFA 2IVMA 3G86A 1R8CA 3BREA 5LMUK 3MMCB 3DRPB 1X1PA 2FY1A 2DF4B 2HDOA 4G6VB 4A8MP 4BC2A 3BO3A 2C2KB 1KR4A 4ID8A 4FK2A 3IM1A 3ZZOA 4GNIA 2ZNYA 7ICFA 1ZQQA 1ZYQA 3C6AA 2HQIA 1WSVA 4NZ7A 1DLOA 2DPIA 1J27A 4FJLA 3D67A 4M3XA 3AUOA 4MK9A 4NEYA 8RUCA 4LVNP 2E1FA 3J7ZO 3IFRA 4OZLA 2HFOA 1V6HA 4RW6B 2W1BA 4JI6K 3MMVA 4FLXA 1RAAB 5KOWA 2UUBK 4DPYA 3QEWA 2YMQA 4MKVA 2KE7A 4IOCQ 4IO9L 4BC5A 3CP8A 3DXKA 4EELA 3C14B 4I2PB 5ETLA 2KHCA 4OJ1A 4DV0J 1VQ6N 3QGGA 2UU9F 4K4ZA 5B0GA 3MXIA 3H20A 2QWPA 5AJ3K 1A6SA 1GLFO 4KHQA 1VYAA 4WE1B 2A42A 4K59A 3CG7A 1Q81T 1RT4B 4F93B 3K5OA 4CF5A 2QLTA 1T05B 1X42A 1IM6A 5K8PA 3MM5B 1HNWK 4OZ1A 4O3NA 3OTBA 1IR2A 5B0EA 2AGPA 2AJ2A 1SJ1A 4K4TA 3L0QA 3CJ2A 4NCGB 4F92B 3G87A 4CH7A 5AM2A 5DBCA 1KN5A 1Q18A 3J80O 1DTQA 1NDCA 3K89A 3WXIA 3C94A 2H3GX 1NZAA 3T79A 3JPNA 3MM6B 4CDGA 3UXOA 1RHJB 2VG5A 4PEOA 4PKDB 2E1AA 2LEBA 4KLUA 3UIQA 1IBMJ 1OH8A 4USKA 4AL5A 1Q8KA 2PAVA 2DPNA 1XERA 5CH7B 2DEIA 1VQSA 3K17A 2V4RA 3H40A 4RW8B 1S12A 1RQ0A 3IRXB 1RT5B 4P74A 2KG0A 4LF8J 4KO0B 2VQEK 4AHCA 1ZBFA 1FJGF 3QATA 1JJ2R 4OLBA 3KLEB 3MEGA 5ALIA 4CZMA 2K4HA 2XCAA 4KHYA 4RNMA 3M6WA 3DAWA 2BXJA 4Z6FA 4OZNA 2HNYA 1KEJA 5LMNK 3SNNA 2WOMB 4C3KA 2AWZA 5KPRA 1L3UA 2DR7A 1RHQB 5KG6A 1COKA 5EGYA 2NZCA 3CMES 2EC2A 1Y7PA 2G13A 4Z94A 3N7PD 1WTFA 5KRSA 2XSFA 3HHLD 3NAIA 2QLWA 3GDXA 4DB3A 4OHVA 2E5JA 2XYGB 4CEEA 4NLZA 2XZDB 4EGLA 3OPXA 1VCTA 3B9JA 1UEVA 4C2MA 4K5SA 2RLTA 4PHTX 2R3VA 3VAMA 1DURA 2G0CA 2FPMA 3GFKB 3CCZA 4WJ3B 4FBTA 1XN9A 2QE5A 1N0UA 5KFSA 2QG9B 2YKNB 4RUBA 1Y4ZB 4JBCA 2X78A 3OYMA 1Q3UA 2GCFA 2HHXA 5EHHA 3FKBA 2LYVA 2HS4A 1K8KA 1T05A 4QU6A 2HPUA 3QUQA 2DFHA 1Q5YA 4IRDA 2D3UA 1YK9A 4WE1A 5AFUH 2LKYA 3M8RA 2RQMA 3SCKE 4KFBB 2CQBA 2BBEA 5DB8A 1U09A 1S6QB 1Z00A 5B66U 3ID6A 3PW2A 4DLGA 1RAHB 8ICFA 4NASA 3EE9A 4X65K 1D1UA 1ELOA 2P9LA 1JNRB 1RQNA 1BHNA 1UPPA 2OHFA 4Z6DA 2Q1NA 4K7QA 4B3TF 5ADXA 3DXKB 5J2PB 1HPZB 1ZS6A 2A18A 4XEIA 2KMDA 2ASJA 1U0SA 1XMOJ 2MQNA 4YHHJ 1Q86O 5HJYA 3DM2B 2MB0B 4EEKA 4LFCK 3VAGA 3EZOA 2FBTA 3CIMA 2HWTA 4ED6A 2VIHA 3G25A 4BGBA 4ES3A 3VF2A 2LEPA 5AXMA 5C7PA 4U67L 1U47A 1RT7A 2NUBA 4CERA 2XNRA 4Q8FA 1VQ7N 1W7AA 4QS8A 4KHSA 3CJ9A 4H8KA 3QAEA 3HW8A 1RNHA 2IIHA 4BUGA 2O8EB 3O9UA 5AKKA 2F63A 4BREA 4B3RK 4QAGA 3OS1A 4TUQA 4KGMA 4NLXA 4K4GA 3AB2B 3RB4A 3QINA 2WBMA 3HJFA 2FC9A 5IIIA 2ZJRQ 4GVMA 2BH1A 3DXMA 2YMPA 1BOTO 1PC4A 2MQPA 1FEHA 4L3NA 5GAGP 3JPTA 4QNLA 5J2NA 2I9SA 2P9EA 5DG9A 4FYXB 4ANCA 4CRJA 2B9XA 1VHFA 5B7WA 1FKOB 4DUZJ 3WBZA 3NKYA 3F5AA 2PMZC 2V2VA 1HJRA 3DNCA 2F4VJ 4GY2B 2ZOGA 2UUCJ 3L5KA 2GOLA 1XC9A 2HVZA 3HKZF 5LY3A 1KBUA 2F9TA 2R7UA 3JPRA 2ROPA 4KTQA 2GNKA 1Q1KA 4LMZA 2GW8A 3H0RB 2D1CA 4OV6A 1CXUA 7ICHA 2MEWA 5BOMA 3B4DA 4E0DA 2ZVIA 1EIYB 2ZH6A 3OYKA 4KKOA 1VQON 3FCHA 3RSEA 1HKBA 1XMOK 1XNRF 2Y1JA 1NJWA 4Y2UA 5DETA 2PFOA 1WEXA 1V3SA 2BE9B 3V5RA 2MLXA 2ALZA 4OI1A 4HCCA 3TU5A 4BC3A 3J81O 2CQGA 3NVMA 1S4EA 4AYBC 4PYDA 4HAIA 4CZIA 3LDOA 2J5AA 2QB1A 3A0IX 1VISA 3Q24A 4KB0A 4DQIA 4JUZA 3ORYA 4F3OA 4BQLA 4LBPA 2ZBIA 3SAGA 3RB0A 1FWLA 2GV9A 1BNPA 4UOFA 3NGKA 4G3IA 3L9ZA 1OQ3A 5LL6Z 3D54A 3AHPA 4UBCA 3R5AA 3JSYA 3W9HA 3DLJA 2OXOA 1EXQA 2HQGA 4CLZA 3M2VB 1WSFA 4CCHA 2FQQB 2BCVA 2K1RB 1TKDA 2V50A 1OW5A 4FK0A 4H0XB 4X4VA 1GT8A 2W42A 3Q83A 3FSXA 2GAHC 1V5VA 2VA3A 1Q78A 4IG0A 4A57A 2VHGA 2F44A 3VEVA 3THPA 1OJ4A 4MIAA 2ZOFA 3T6BA 1WC6A 1T9WA 5KFCA 3PX4A 4CT8A 3ZTRA 3KHYA 3LDSA 1ATRA 1HBNA 2LU1A 1DKGD 3SQ0A 4TUPA 2RRNA 5T7LB 3AXMA 3UCGA 4FVCA 5F8LA 3DYAA 1IO2A 3IV6A 3A5LC 1FRMA 2XI3A 2OTJS 3AL0B 2YMLA 3NH1A 4NWBA 5BR8F 2JZ5A 2UV8G 2F76X 1GX5A 4JKBA 3IBPA 1XBWA 2FTRA 2UUBJ 5HOOA 2HGMA 4RT2A 1YRXA 2B6AA 2MMYA 5ETOA 1KVIA 3B0XA 4DV1K 8ICKA 4JK8A 3HFZB 2YY3A 7ICUA 3WUHA 3VQ7A 4RQ0A 2ACMA 2OPQA 4IJNA 5K8OA 3SAHA 3QEIA 1N33J 4I6WA 4FVMA 1ZBHA 1VK3A 4LT6A 5AI8A 4HTUA 1Z4NA 4P10A 3OTOJ 3V1RA 2ZQBA 2U1AA 4EK2A 1RBTA 4OJ3A 4TUSA 4KV8B 4JI8J 1T3NA 1YGYA 2B8QA 5DM6Q 4S0MA 1RACB 2BCUA 1HHQA 4ITSA 5B0CA 1S0VA 4OD0A 3RB6A 2LM1A 4DTUA 2XMWA 4NEZA 2BJ7A 2IM1A 2ZBPA 2CQDA 1Q5VA 3BSAA 1R8BA 3LYSA 4ZOHC 3MM9B 1R43A 5KL1B 3SQOP 2GMJA 5HATA 3MDFA 4DR1J 4GV6A 7ICTA 4RW4A 2J7UA 2UV8A 1U2VB 1T6DA 4DG1A 5F8GA 2XULA 2HHWA 3UXPA 3S6EA 4LFCF 3TQ1A 1KOHA 1SL2A 4UB3A 5CRXA 3V81B 3O80A 4BVOA 4ZVFA 2ZZMA 4CHPA 4GVBA 3BN7A 4LF8K 1BQNA 5KFZA 4K0KK 1HBNB 2XI2A 4WU3A 1QSSA 1ZJNA 2G5IB 1NMNA 2B4PA 4X4QA 4DV2F 2BE7D 1IQTA 2UVVA 1WC1A 5D3GA 4FWPA 3L2UA 4ZJLA 4RQ8A 2W01A 4LR7A 3RB3A 3KLIA 1MU2A 9ICIA 2HOFA 2D9OA 1BU6O 3LPUA 2D8CA 3SQIA 2LU2A 2HSTA 4M63C 4OYBA 5ALDA 1RP5A 2MUTB 5BYRA 1RFQA 5FPEA 1RT6B 2XICA 1F9HA 1C0UB 5HRSA 1RCXB 3AODA 4DMNA 4CO3A 3HXMA 3AVHA 4FJ8A 4NI2B 2LQ8A 4CF3A 1JB0C 3SK3A 1RHRB 2FJWA 5KGXA 4DTXA 3M8PA 4O0IA 3TVZA 5IIJA 4C23A 2WVBA 1RWKB 8ATCB 2PMZD 3IGNA 1FD2A 1TKZA 3TADA 2AEMA 2MKCA 2HFSA 2ALYB 4O3QA 4R64A 4CDIA 3B8AX 2GMLA 3CO0P 1YJRA 4PQUB 3QLHB 3NH0A 2YXLA 3FZHA 3T5JA 3J7A1 1C0MA 2Y0SF 5A8WA 3RH4A 1D8ZA 4FYDA 2C2ZB 2I9GA 2MKHA 1ZJMA 5D0RA 1RAEB 1BMQB 5I3QA 3N9UC 1UW9A 4WK1A 1NJIO 4QR2A 1CZ9A 3PM9A 2O5DA 4FKXA 2GUIA 2A19A 1S10A 4Q2LA 4F5OA 3F0NA 2B5JB 5MLCQ 4JKEA 4I6AA 2W2QP 4DUZK 4XIUA 2VBXA 3OS2A 2J4RA 3QERA 4M3WA 4LVOP 4M95A 2FXUA 1RAOA 2F8EX 1O13A 5GAEP 5HL7L 4FM1A 1VMBA 4Y6IA 1J97A 1L7OA 3RJFA 5BR8J 5ALPA 4P0QB 4C48A 4G9BA 3NEKA 1TL5A 1FKOA 1Q7YO 4CE9A 2MY8A 4RW9A 3WXMB 3CCVN 2HZVA 3S3OA 3NVVA 3QU9A 2GELA 4GVBB 3DOLB 4PL8A 2W4CA 2B0GA 5KAFU 4EHTA 3W62A 5C25A 4DV5K 1ASWA 3CHWA 4URSA 2O4GA 3L09A 4OJGA 3N7RC 1RE1B 1AZSA 5HRRA 3QFHA 3THWB 4ZITA 4DV0K 5DO2A 5ALUA 4H4OA 5HMYA 4TU8A 4X64F 5B0DA 3NVYA 4B3SJ 3L3CA 3KZXA 4CJ7A 1JROA 4RQ1A 4C7ZA 1PKUA 3GE9A 4C11B 4QIEA 3AA5X 4OI6A 4M9GA 3SD7A 4ED8A 2JWNA 4UZBA 2E2OA 3HWTA 1FDBA 2FVCA 5KFIA 2QKQA 2CH5A 3UE2A 2WONA 2O8FB 1HPMA 3OFEA 3NH2A 5DDOC 4BGDA 1RKIA 2KRBA 1WEYA 2OD6A 5B5EU 3P49B 4B3MJ 4YS2A 3L2VA 4KV8A 4DR1K 3I4HX 4AXJA 1F0XA 2YTCA 2E8OA 2AJ1A 1CZAN 2WB1F 4I28A 3MAHA 4CNYA 1N5SA 3WNEA 5E3RA 4HH1A 2ZKTA 3A3OB 4NXMF 3LH2S 4IO9Q 3Q8YA 4KLHA 3AU2A 1K73T 3E66A 2W40A 4CLKA 2EC0A 4IL6U 1JNZB 3WC0A 1ZBUA 2QA2A 3IBCB 1YKWA 1NGBA 4C4RA 1XR7A 1M6YA 4CEFA 2V4JA 2BCRA 2NZ4A 2IDLA 3RR8A 3LTOA 3OHAA 3VAIA 2WTFA 3VV2B 2DFFA 2RHFA 1ZQFA 1IWAA 1KXPA 2ZH8A 4CZEA 3N5BA 1V5IB 2IOHA 2LMRA 3CCUS 2G2ZA 4AQYJ 2CGLA 1RTDB 2J9EA 1NGGA 4TQRA 1UVMA 5ALVA 3C95A 4FJXA 3UCUP 3H6EA 1PK3A 4O8KA 4LSNB 4K41A 2L9WA 4YFUA 2HEKA 1NU0A 4DN0A 3D68A 4F25A 2WMMA 4NM2A 3CEDA 5J2MA 1SQFA 4IH6A 1MNEA 3PJWA 1ROFA 3P1GA 4FZVA 4AD6A 2F8MA 5J2KA 3QT7A 3SUPA 5J2BA 1KC8T 2VOOA 3DMJB 1HW9A 3RVCA 5L39A 4DV7K 2XZTB 1QH9A 2CPHA 3AD7C 5AQWA 1X5SA 5GMEA 5IZHA 1LWCB 5J0UA 2ASYA 5E41A 2DNKA 3EKSA 3FZMA 4UOGA