3PX6A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (tautomer) in closed conformation
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
579
structure length
579
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 204
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3px6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3px6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3px6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3px6A01
5KFPA 1ZQBA 2ATLA 3HXMA 4ELUA 2O4GA 1CZBA 4HYKA 3QNOA 1B43A 1U45A 4DEZA 3S3NA 3TAGA 4CECA 8ICRA 3EW9A 2C22A 3AVBA 4KO0A 2JZBA 2ZUCA 3SQ4A 2G8VA 3L2QA 4B3OA 2FBYA 2ZJ8A 1VSHA 3RRHA 3AA5X 3HP6A 4ELVA 4CEDA 5I3UA 1VK0A 3VQDA 5KRTA 1HRHA 4DSFA 5J0SA 1JMSA 3IG1A 1XI1A 3RBDA 4FBUA 2GV9A 1RT6A 9ICPA 3IRXA 2ETJA 1YT3A 1C1AA 1EETA 1NK0A 1BCMA 3AVNA 1IM4A 3LP1A 5KFQA 1HMVA 5HMMA 4AHSA 1Z00B 4CJ4A 3GV8B 3RJGA 1KFSA 1Z26A 5E41A 3V4IA 2XGPA 4Q0BA 5C24A 4UB3A 2BQ3A 3OYKA 2PFNA 1U04A 4KTZA 3F9KA 1XS9D 4KV8A 3V1RA 3SQ0A 1SL2A 3RMAA 2I1QA 4FK0A 1UA1A 2MAXA 2ZD1A 8ICVA 7ICRA 1ASWA 4ECXA 2FMPA 3VQ4A 1ZQYA 2XY5A 2XY8A 2ASJA 3VQ8A 4BWJA 4TQRA 4I2GA 1CLQA 2Q0ZX 4YD1A 3UIQA 3OHAA 4JS4A 2EHGA 3ZSYA 3EPIA 1KCFA 1ZBLA 4IKFA 2F1HA 4K8ZA 2P5OA 3PR4A 4M45A 2FPKA 2HHSA 4L8RB 1A5XA 1KEJA 1RYRA 2KFZA 4CJPA 4RQ5A 4CJSA 4CEZA 3DLRA 1BQNA 3AA4A 1HJRA 1SKWA 1JX4A 5KT6A 4FJXA 5FRNA 3NCIA 5KT7A 4KI6A 3GIMA 3QNNA 2C2RA 4M3XA 3RJIA 5CWRA 4F5PA 2AGPA 1ASVA 4Q43A 1JLBA 8ICTA 9ICSA 5CZ1A 4J2BA 3JPRA 2KTQA 4CF0A 3NBPA 1ZQNA 2B6AA 5KI6A 1B92A 3SCXA 4HUEA 5D4BA 1X9MA 1ITGA 1RPLA 5D46A 3TARA 3TR8A 3V7KA 5DLGA 3H7IA 4KN4A 1I39A 4BACA 1RCHA 3PVXA 3AO3A 4I2BA 3BGRA 1TK8A 1S9FA 4O0JA 8ICEA 4KLTA 3L2VA 4DTJA 7ICJA 1S1VA 5L9XA 5KGWA 2DFLA 2AU0A 3EZ5A 4ECQA 3RJEA 5FDLA 3C2KA 3OYLA 5HLFA 1BCOA 1NJZA 4B08A 4CE9A 1RT2A 4CIEA 4E19A 4BE1A 5KT3A 2D5RA 4QZGA 2Y1IA 4BE0A 4AHTA 1WSIA 1RBVA 3IS9A 1D8LA 4N47A 3V6DA 5D49A 5HRPA 3ZSRA 3JPSA 2XO7A 4XRHA 1HNIA 1Z25A 1XSPA 4QW9A 3PX6A 4CJQA 4YFUA 4RPYA 4QZEA 4FLXA 4RUCA 7ICLA 1TV9A 3PW7A 4B8AB 1U48A 3WNFA 2DPIA 3HO1A 2Z1JA 5CZ2A 3SUPA 3SJJA 4F5OA 4M6WA 2C2EA 2PYJA 4QZDA 4DO9A 2KZZA 5CA7A 1VSKA 3KIOA 4ED1A 4FCYA 4KLMA 1DOQA 5DGBA 1N6QA 4CJTA 8ICBA 4HCCA 2F8SA 4QZIA 7ICOA 4FYDA 1WSFA 5CYMA 2F96A 1XO1A 3ASMA 3AVMA 3LDSA 3M8SA 1KFTA 4NLGA 4I2FA 2HNDA 4I2HA 3SI6A 3OYMA 4MQ3A 2OYQA 1RBSA 4IG3A 5IIJA 2UVWA 4J2AA 8ICIA 3DLEA 4OGCA 4QWCA 1YTAA 4ZTFA 3QE9Y 5J0QA 3T19A 2NRXA 4PPXA 3RJFA 2JGUA 4AHRA 4QAGA 3DMJA 1NK4A 1D8YA 1BPZA 2A1JB 4YMMA 2G8KA 4CESA 3IAYA 7ICNA 2KZ3A 3U3GA 3KK2A 3HX0A 5KFZA 5EWEA 4O5EA 2BQUA 2OPQA 5CY4A 3H8JA 2IS3A 4Q8EA 3PUFA 2G8WA 1XU4A 4I2DA 1RBRA 5DDMA 4DQRA 5L1LA 2V9WA 1RNHA 2J6UA 5L1JA 2R8JA 2FC0A 2ZJ5A 4K4HA 1S9EA 2E6MA 1T05A 4DTPA 5KFWA 3ZT0A 2W8LA 3WNHA 3QESA 4FJLA 3KHRA 1WSGA 3LALA 4G1QA 1TKZA 4QZBA 3MXIA 5FRMA 3AVGA 4O3SA 3HM9A 4CHPA 4CHNA 3ZDEA 4W5QA 2W9MA 3CM5A 8ICJA 4FM1A 1L5UA 1S0NA 3HW8A 3N97B 1JLFA 5J2PA 1JL2A 4C8OA 2PI4A 2PY5A 4XQ8A 3PV8A 5J29A 4I2QA 4DSLA 3UPQA 1ZBUA 3GV7B 4QZ9A 2HHVA 1WNSA 4IFYA 2HNZA 4N76A 1RXVA 1KLMA 3AO5A 4CK3A 4M9HA 4AHUA 1CZ9A 4LY7A 4K4GA 1R0AA 2XY6A 2DFFA 3PNCA 5HNKA 4CHYA 2EX3A 2MUTB 1BPBA 1C7YA 3GILA 3MDCA 3C95A 3EWAA 5KFLA 2KZMA 3I8DA 5JS2A 1TK5A 1SKRA 3KK1A 2PI5A 3PO4A 4MEXA 3GV5B 4P4OA 4QWDA 3MR3A 5CR0A 4AHVA 2ZQBA 2PYLA 2OPPA 3ZCMA 3RR7A 1U9LA 4TQSA 3L3VA 1LWEA 1W0HA 1XSLA 1UAXA 5DG7A 1ZETA 4J9OA 4FLZA 4K4IA 4NCGA 4IQUA 5KFRA 4O5KA 3G10A 5DBAA 1RDDA 5HP1A 3RB6A 4O0IA 4F4WA 5J0XA 4CJWA 3QERA 3DLHA 4C8NA 4Z4CA 3ISBA 5IIIA 3FDSA 4RPXA 3DI6A 4PA1A 5J2NA 4KHUA 4UQGA 4ECUA 3RJJA 4X5VA 4IDKA 4Q5VA 1EX4A 4FW1A 5J0YA 9ICWA 1AROP 3O4QA 4H4MA 3PW5A 3TAEA 3VQ5A 4AH9A 4BXOA 1DGSA 3V1QA 3BDPA 1S6PA 1S0MA 4DQSA 2IHMA 4O44A 2UVVA 2OWOA 3F73A 4YD2A 4ICLA 3BQ0A 7ICVA 5SWMA 3AVKA 1NK9A 5HRSA 4J2DA 1RTHA 2AGQA 4ID1A 2QKKA 4EBDA 1QSYA 1T7PA 1BISA 5KFEA 4HCBA 4CJVA 3K57A 1K1SA 4DL3A 1J9AA 7ICUA 3RAQA 3NGZA 4QWAA 1ZQQA 4BWMA 2F1IA 4YR0A 3Q8MA 4UB1A 4RT3A 1WSHA 1B22A 1ZBHA 1NOZA 3V6HA 3NE6A 5HRRA 1HQUA 4GVMA 3CFPA 4Z0UA 1TVRA 3OYBA 3MR6A 4GLXA 3DOLA 3RBEA 3AU2A 4IQVA 3QZ8A 2P5GA 5J2FA 3ITHA 3ISCA 2BPCA 4DQPA 1XHZA 4ECRA 1ZYQA 3BQ1A 1JLAA 4HHTA 4QZHA 2LSNA 4M3ZA 4RQ8A 2NRVA 3MEDA 4DQIA 4FBTA 4OLAA 4CFCA 3ULDA 1S1TA 5KFCA 1BI4B 3H8WA 4BDZA 3LWLA 4BE2A 3A2FA 3MGHA 1MQ3A 2I9GA 1YTUA 1QHTA 1IG9A 4N5SA 3PY8A 2BCRA 4OKKA 3GIKA 3CM6A 2Y1JA 3LAKA 1ZQVA 5F9LA 1Q9XA 1ZQFA 3HT3A 9ICLA 4DSEA 4IRDA 3V9SA 2P6RA 3RTVA 4Y1DA 1XSNA 3Q8PB 4M9NA 3KKSA 3KLIA 1C0TA 3NF7A 3MDAA 3VA3A 3EYZA 3V6KA 1SKSA 4PGXA 1N56A 2PFPA 1U49A 3MEEA 3K2PA 4UAZA 4Q45A 4MFCA 1V9PA 2JLEA 3ZDDA 1ZQZA 4DOCA 3L8BA 4P4MA 4M2YA 3QEXA 4CJ5A 2AQ4A 8ICHA 1WLJA 8ICZA 3HYFA 3VQ6A 1J5OA 7ICMA 8ICNA 1TL1A 3RH4A 3G6VA 3K59A 3HK2A 5KFKA 4F4XA 2OZSA 1MQ2A 3E01A 3S9HA 2PFOA 4RZRA 4J9KA 4KITB 1DTTA 2ISPA 5KG6A 2BCUA 2I5JA 1G15A 3ZDCA 2RF2A 5J2IA 3PX0A 3NTUA 1NK5A 3Q8QB 1RTJA 4NYFA 4R65A 5J2AA 2DY4A 2ITGA 3SUQA 4M3WA 1KTQA 4OKJA 5HMLA 4M42A 4RPZA 3JPOA 1XC9A 7ICPA 1IKYA 4Z6CA 1HJPA 4HTUA 3K58A 2QK9A 4KLDA 4R8UA 5HHHA 4DTMA 4DLGA 1RBUA 2FBXA 3ZSOA 4ZTJA 1TFRA 1TAQA 1RXWA 5J2GA 4RNNA 1JIHA 1LW2A 1S6QA 2BR0A 1LAVA 4M3UA 3OHBA 3SQ2A 2W8KA 4KRFA 1QSSA 2KN7A 4RNMA 2B5JA 4KLHA 4DS5A 1NK6A 2HHTA 4OGEA 9ICEA 4KLFA 3PR5B 1SL1A 2HMIA 8ICUA 4F8RA 4E1NA 4DU3A 4QWBA 4ED0A 2ASLA 4YFKA 2YKNA 3C5GA 3V1OA 2R8HA 4LZDA 4CFBA 3V7JA 1C0UA 4DTRA 3AO4A 3VQCA 4YR2A 1S5JA 3BJYA 3LZJA 8ICMA 4HUFA 5KFSA 4Z4GA 9ICCA 2P6UA 4RU9A 2E4LA 4CF1A 4ZHRA 4QZ8A 1ZQCA 1HYZA 3PW0A 4Z6EA 4NY8A 3GQCA 4DG1A 5KFVA 4I29A 3T5JA 4RQ6A 4YXMA 2QKBA 5KRSA 3KHLA 3ETLA 2X78A 4IR9A 3DRRA 3KD1E 2HVHA 4FVMA 4FJ8A 1HYSA 1DTQA 3VQAA 4UB2A 4DL5A 4I28A 4CEOA 2DTUA 3UQ0A 1RDAA 4F3TA 4EZ6A 3HPOA 3DOKA 5J2QA 3M8PA 3FFIA 4KFBA 4CGGA 5C42A 3TI0A 5D3GA 3AA3A 1RYSA 4YP3A 4DOBA 3QO9A 4KTWA 2YV0X 5DKWA 1B9DA 4CJ3A 4AILC 2AQ0A 3JPTA 3THVA 4BDPA 4M3RA 4C8MA 3T5HA 3DLBA 4GW6A 1S1UA 3NGDA 3D45A 4O3NA 1EXQA 2BE2A 1S10A 4JK1A 1Z00A 9ICBA 3AVLA 5KTQA 5DGAA 2ZUBA 3MAQA 5DK5A 2HB5A 4NLKA 2YNGA 4O3QA 4CGHA 4B9TA 1VSFA 1RT5A 3C94A 1L3UA 4B9UA 3AVCA 1QTMA 4ECZA 2IBKA 4MFBA 5J2KA 3LP2A 1X2IA 2W42A 3AU6A 3O3GA 5CP2A 2FPLA 3ZD9A 4PGYA 3PW2A 9ICRA 4DFJA 1WAFA 4KHNA 1JXBA 3OYFA 3ZT4A 1ZBIA 1T8EA 4FK2A 1IKVA 4JWMA 4YR3A 4DOAA 4LD0A 4G3IA 2GBZA 4YMOA 5CYQA 5J2JA 3ZDAA 1BQMA 4QCLA 2C28A 1SUQA 4RUAA 4TURA 4Z4EA 5EOZA 4NYNA 4KB1A 2D0CA 4FLTA 1EP4A 3VQ7A 4RW4A 4FLYA 3MR5A 9ICQA 3IM1A 4BGDA 2HNYA 4F93B 4JRQA 4CCHA 4LSLA 1EKEA 4I2AA 3V9WA 4ED3A 8ICOA 3OYJA 2OA8A 4FLVA 5DLFA 4ECWA 3ZSQA 4ED8A 4KMUA 1O1WA 3MGIA 5EWGA 5J2EA 1RILA 1ZQWA 9ICOA 3M9OB 3C1ZA 3SI8A 4W5NA 4CHOA 3K75D 1WCLA 2ATQA 4M3TA 4DL2A 4UBBA 3Q8LA 5KFDA 2HHQA 2BHNA 1GOBA 3BQTA 3HJFA 1C6VA 3N4MB 1LWFA 1BGXT 2GWSA 2YNIA 1FK9A 3FYHA 4CEBA 2ZUDA 7ICQA 1MC8A 1S1XA 4FJNA 5KG4A 1RTIA 1ZQDA 3KLFA 4I9QA 3HPGA 1K6YA 5CHGA 2ZTCA 2W9BB 5CJ7A 4DL4A 3LAMA 3I0RA 1BVSA 4DSJA 3VQ9A 3OJUA 3IHQB 4MFAA 3H40A 4KLUA 2FMQA 4KLLA 2Q3SA 4PQUA 4KAZA 2PZSA 1RT3A 4R64A 4CGFA 2A1RA 3NFAA 1XWLA 4ED2A 5KGXA 3CG7A 4KHYA 4GXKA 4YQWA 3OYCA 1NKCA 4M9LA 3V81A 1PZNA 1HUOA 2NRWA 5DMRA 3C6TA 4PHEA 3SYZA 5KFAA 2LYHA 4FXDA 1S9GA 1CXQA 3MR2A 3KK3A 4CJEA 2NRTA 1NK8A 3JYTA 1KRPA 1ZQLA 3RJHA 1IH7A 5KG3A 4H8KA 3UXOA 5DG8A 5KFUA 4I2EA 2YNHA 4ID5A 2UVRA 3B0XA 4IBNA 5DBCA 8ICQA 4FJKA 4CGDA 4CJFA 4FJ5A 9ICUA 1ZQSA 2G8IA 2KFNA 2X74A 3NDKA 4M9GA 8ICFA 4B9MA 4MEYA 5KG2A 1ZQJA 1ZQIA 3RRGA 3NF6A 4TUPA 1UWBA 4ECTA 1ASUA 3U3YA 4PY5A 5J2DA 1XHXA 3LDAA 2XCPA 2ZTEA 4C8KA 3GDXA 4IR1A 2BPFA 3OYAA 1MSWD 1ZQMA 3VQQA 1WSJA 4JS5A 3C23A 3CFRA 1NJXA 2C2DA 1RT4A 5KFXA 5KFHA 5JUMA 4AHCA 2A1JA 2NRZA 9ICTA 5IIMA 5BOLA 2F1JA 4CJUA 4CK2A 4ZH4A 3P83D 2VA3A 4QOZB 5DQGA 2GUIA 4YVZA 4E89A 3O3HA 4I7FA 3OGUA 3LP3A 3SUNA 1TK0A 4KLIA 5KFGA 2JEFA 3V9ZA 3OSPA 5EWFA 3SPZA 3JPPA 3OSNA 1A5VA 2BCQA 1J54A 2IHNA 4KHWA 5HP4A 3GIIA 1J53A 3V9UA 2FLLA 3K4GA 4FJ9A 1LV5A 1U47A 2NUBA 2DPJA 4FO6A 1UOCA 1TKDA 1NJWA 5DB9A 5KFOA 1LB2B 4GC7A 2J6TA 4DF4A 2V4RA 3QEBZ 4XA5A 5L1KA 2R8IA 1CUKA 2BGWA 1ZQTA 4F2RA 2W9CB 4KLSA 3C6UA 2BCSA 1A5WA 3HSTB 4GXIA 3V7LA 1RBTA 1VSLA 4NM1A 3C2MA 3P1GA 1BPXA 1S77D 3RJKA 4F50A 5J0UA 1H38A 4UB5A 3LP0A 1ZQRA 4DSKA 1U4BA 5F9NA 2R7YA 4DU4A 2M9NA 3M9MB 4Q8FA 9ICJA 3AUOA 3PW4A 3BQ2A 4P2HA 4E3SA 3KKRA 3RWUA 1KSPA 4NXZA 4YNQA 2OPSA 2R8KA 4N41A 3SUOA 4ED7A 4FJ7A 1ZQKA 4Z4IA 3SV3A 2MUTA 5HHIA 1FKPA 2JZBB 3K5OA 3E2EA 4RW7A 4FJMA 1ZJNA 1KLNA 1JLQA 3Q8KA 2BQRA 4FLWA 9ICGA 4CIGA 1HYVA 4RQ3A 3SZ2A 4IFVA 2G8UA 3SV4A 4RT2A 3KTQA 3TANA 9ICNA 3KJVA 4QZCA 4KLGA 1IKXA 1FXXA 1BPYA 4FM2A 5KFFA 3HWTA 2H5XA 2KW4A 4RW6A 4CGJA 1UA0A 3QLHA 3LZIA 4I27A 1BL3A 3TWHA 3K5LA 4F4KA 1VRUA 2ZTDA 2YKMA 4JLHA 3EY1A 2IAJA 5TZVA 1CXUA 2HHUA 3EPGA 2HHXA 3UQ2A 3HP9A 1D5AA 4J9RA 4FJHA 2QXFA 4OLBA 5I42A 2ALZA 7ICHA 1TL3A 4M0AA 3Q8SB 3OYIA 4ELTA 5KFYA 3C5FA 5DQIA 3AVFA 3QINA 5CB1A 3L2UA 1T03A 3UXPA 1CEZA 9ICVA 3KHHA 1TGOA 2VG5A 2YHBA 3JPNA 1SV5A 3VQPA 4QZAA 4OPJA 3OYGA 4YXJA 4EBEA 5KG7A 2YHAA 3HPHA 4O5CA 4KLEA 4F92B 1L3VA 4GMJB 4HVJA 3OS2A 3OS0A 4RNOA 4UBCA 5DG9A 4KB0A 2P66A 2UVUA 3L2RA 2IA6A 3ISDA 5T7BA 4F2SA 4IQWA 1ZQOA 4KLOA 1LWCA 4DL6A 4Y1CA 1JLCA 1F21A 2PXIA 4KREA 3PO5A 4CHZA 1W9HA 3DRPA 4B9LA 3DM2A 3KLEA 1FKOA 3LANA 2JEJA 1Z3EB 1KFDA 5J0WA 8ICWA 5DDYA 1Y97A 3PMLA 2ASDA 4I2JA 4I2IA 1NK7A 3RMDA 3TAFA 4YMNA 1BI4A 2HVIA 2VANA 1QQCA 3C21A 5J0RA 5HRNA 2DFHA 1A76A 4LH5A 3WNEA 3OYNA 3NH0A 1Q9YA 3AA2A 2FMSA 3OVNA 4J9MA 4EEYA 3QETA 5KT2A 4ED6A 4J2EA 5J1EA 5JS1A 4ECSA 3MXJA 1WN7A 9ICHA 4W5RA 2WTFA 3T3FA 2DFEA 4PHDA 4ECYA 4W5TA 1SZPA 4CJKA 4FW2A 1JXEA 1K1QA 2VG6A 4M6WB 4F5RA 1ZQXA 2VA2A 4JRPA 3HVTA 3MXMA 3ZSZA 4O4GA 3VQBA 1IKWA 1BPDA 4DL7A 3K5NA 4FM0A 5KFTA 2F8TA 4OJRA 4CK1A 5SZTA 1JN3A 3QEWA 2FLNA 1QSLA 1C1CA 2XY7A 2IDOA 1HPZA 3DRSA 1BIUA 3AO2A 3ZSXA 4CEQA 4DSIA 1RTDA 1VSDA 5KT4A 1RDCA 3T1AA 5KG5A 4B8CA 2X6NA 2YNFA 5J2MA 4P4PA 3AVJA 3DYAA 4IG0A 3RB3A 4RQ1A 2VA8A 4PHAA 4FZYA 3MABA 7ICSA 1T4GA 3G6YA 4JWNA 3OYEA 4IRKA 4M41A 2IOCA 2IMWP 4O55A 2FBVA 2W9AA 4YG2A 4FS1A 1QLNA 1S0OA 2J6SA 4E0DA 5J0TA 1YVUA 3AO1A 1VSJA 8ICYA 8ICGA 3KD5E 4Z4HA 4DTOA 8ICCA 2IGIA 4TUSA 1X9WA 1RT1A 4DQQA 4O3RA 1NKEA 3NH1A 1TKXA 4DU1A 1IO2A 4EYIB 1JKHA 4O3PA 5IIKA 4XIUA 3TFRA 4CHQA 1UT8A 9ICAA 4DFPA 2R8GA 3ALYA 5J0OA 3S3OA 3HL8A 3ZT2A 2ZJAA 2FBTA 3OYDA 4RW9A 2BKEA 5J2CA 4E7LA 3OS1A 4C8LA 2JEIA 7ICFA 1NKBA 3TFSA 2VG7A 3Q8RB 4F4ZA 1ZQUA 1S97A 2WOMA 4KN7A 5DB8A 2ZE2A 3B6OA 1D9FA 3CYMA 1S0VA 4Z4FA 1BPEA 1C0MA 3SQ1A 1QE1A 4F91B 4CFDA 4PH5A 4LZGA 3ZD8A 4DFKA 8ICXA 3ZSWA 3T5LA 4OKEA 3VQEA 3TAQA 3KLGA 4CERA 4I9LA 4XUSA 2RDIA 1JL1A 1WSEA 3V72A 2RN2A 3ZDBA 4CF8A 3LPUA 2BCVA 1S76D 4NLNA 4K8XA 2D0BA 5HROA 3RMBA 3NH2A 1B9FA 3MBYA 3MECA 1SL0A 3B0YA 4FZXC 3TABA 4TSXA 4E7IA 3LK9A 1VSEA 3DLKA 2XHBA 4FZZA 2V4QA 2AJQA 3S3MA 3LPTA 4CIFA 3QEAZ 3G0ZA 1LW0A 5BPCA 1QS4A 3U6FA 3AVIA 3KHGA 1N48A 1WAJA 3NHGA 5KFNA 4FS2A 4Z6FA 1S1WA 1VRTA 3TQ1A 1TVAA 3RH5A 4CEFA 2RKIA 2A1SA 4RQ7A 4LSNA 2WONA 1KVAA 1IXRA 3UXNA 3AVHA 3V9XA 4O9MA 4KKOA 4LH4A 1REVA 4RW8A 4YN4A 4NM2A 1KVCA 3QIPA 5J0PA 1JXLA 4CJLA 4CF2A 2BGGA 4J9NA 4KHSA 1RDBA 4DTSA 3MFHA 5FROA 4R66A 1COOA 2XGQA 3QZ7A 4PWDA 2OPRA 4BXOB 3NAEA 1T3NA 2RPIA 5J2BA 3OJSA 4B9NA 1A77A 2RDJA 4MF8A 3VN5A 4GXJA 4PGQA 4MF2A 4M04A 1TKTA 1Y88A 2Z1GA 1N5YA 4JUZA 4E7KA 7ICTA 3H08A 1BHLA 9ICMA 4UB4A 4KPYA 4KHQA 3G6XA 4DLEA 8ICLA 4QZFA 1KDHA 1DLOA 4KLJA 4DWIA 1BIZA 4M3YA 3QIOA 3M8QA 1GOCA 9ICXA 7ICIA 3RB0A 5HBMA 1ZQPA 3SPYA 4UAYA 4CF9A 3O3FA 4KI4A 3MEGA 3H4DA 4PHPA 9ICIA 4YCXA 3B6PA 4NLZA 4WE1A 3SNNA 3C1YA 3AVAA 1X1PA 4J9LA 4DS4A 1D9DA 4PUOA 3RB4A 2VWJA 5IIOA 2Z1HA 1RZTA 4J9QA 2G8FA 4F5QA 3QEPA 4DMNA 5DB7A 2B21A 4DTXA 2OZMA 9ICFA 3NGYA 4OVLA 4O3OA 5BOMA 4NCBA 3NF9A 5K14A 3NGIA 7ICKA 5KT5A 2BDPA 5DQHA 2W9BA 3T5KA 3RMCA 2P1JA 4F4YA 3TAMA 3PX4A 3KLHA 5KG1A 4RQ4A 5KG0A 4RQ2A 7ICGA 1L3TA 4I2PA 3GFKB 5DBBA 3M9NB 4I2CA 2KQ2A 1ZBFA 1TAUA 4EP4A 4UAWA 2XC9A 5J2HA 1TV6A 5L1IA 4MFFA 4RG8A 3M8RA 4EZ9A 4CFAA 4JV1A 5DB6A 3H8SA 2XRIA 1ZQHA 1L3SA 4NCAA 4DFMA 4F5NA 1HNVA 4BDYA 3ZT1A 3ZT3A 4R5PA 5IINA 4IRCA 4O5BA 3LWMA 3CFOA 4CEEA 4KTQA 2FLPA 4LVSA 4J9PA 4TUQA 4JV2A 2VWKA 4N56A 3RAXA 2ISOA 4IQTA 2AGOA 3OY9A 3L2WA 4EBCA 2HHWA 4HUGA 1UT5A 2B4JA 3DLGA 3L3UA 5KFJA 8ICKA 3QEIA 1WCNA 3JPQA 3K5MA 3ZSVA 4QWEA 3OYHA 1X9SA 4EYHB 3V6JA 3HVRA 4CGIA 4KLQA 1VSMA 4M47A 1ZQEA 4F3OA 5KFIA 3AV9A 4R63A 3H4BA 3PMNA 5KFMA 1ZQAA 4DTNA 4GC6A 4B9VA 2IC3A 2JEGA 4J9SA 1JLGA 5C25A 4FLUA 2G8HA 1HQEA 2HW3A 2BANA 2P51A 4CEAA 3WNGA 2D0AA 4W5OA 1ZQGA 4E1MA 4RQ0A 4OPKA 4R8UB 3O4NA 8ICAA 5C5JA 4B9SA 3ISNC 4FJJA 4DTUA 2Z1IA 4ECVA 3JSMA 1RT7A 4FJIA 1EXNA 1GOAA 3MFIA 3C2LA 4JV0A 3VA0A 7ICEA 9ICKA 3TAPA 5IILA 2O4IA 3CQ8A 1JLEA 4E7JA 8ICPA 1KVBA 4QW8A 3RH6A 1HUZA 2FPMA 4FK4A 2W9CA 1VSIA 2BPGA 2PFQA 3NF8A 3D0PA 4FJGA 3QEVA 8ICSA 2E6LA 5KFBA 4M9JA 3P5JA 3I0SA 1NOMA 1LAWA 5EU7A 2X6SA 4Q44A 4H4OA 4DF8A 4E7HA 4CJRA 3GIJA 4EP5A 1NOYA 1MU2A 1ZJMA 3RR8A 1I3AA 4Z6DA 1C1BA 1Q8IA 2XCAA 3ORYA 1NJYA
chains in the Genus database with same CATH superfamily
3TVKA 2MQPA 2ATLA 2FY8A 4ELUA 2O4GA 1GXTA 2QFIA 1CZBA 2Q0UA 3QNOA 4BRMA 3BF4A 3A8IA 3QT7A 3UD4P 4ZDNA 3TAGA 1HNXF 3D7SB 3BZKA 1TYQB 3M8PB 4KFBB 2WSFC 4CJ7A 1FEHA 4CZEA 2CWXA 4CEDA 1K47A 3UR3C 1DRZA 1X0FA 4FF1A 1N36F 1S4EA 4P2XA 4DSFA 3DWLA 5J0SA 2FC8A 2OFHX 1XI1A 3RBDA 2GV9A 4IZ9A 1NK0A 1HLUA 2XYGB 5KFQA 2HZAA 3WDOA 1AQ6A 1IBLJ 1S72N 1Z00B 3MM5B 3GV8B 3SAGA 2PT0A 5HMXA 1Z26A 5HO4A 3ZNUA 3EL2A 4Q0BA 3Q7CA 1Y00A 2KXHA 4RBTA 1RLDA 1RZMA 2FHMA 5G0RA 3LP2B 4KTZA 5ALYA 4PXCA 3V1RA 1BNPA 5KPRA 2OI2A 2MAXA 2ZD1A 3VALA 1Q8KA 3HTVA 3ZXWA 1YLXA 5IQQA 1FDAA 2BJ8A 2XY5A 4TQRA 2Q0ZX 1W7AA 4YD1A 1A0OB 1HBUA 2OTJS 2MZRA 2VJ4A 4JS4A 2MLXA 2EHGA 1V97A 2GQ2A 2QSWA 4IKFA 5AKIA 5C2CA 4K8ZA 3PR4A 1Z4OA 1OKJA 2HHSA 1WOSA 4L8RB 2HWHA 1A5XA 5IQ6A 1RYRA 2KN4A 4C0OC 3KFWX 3RAMA 4J8FA 2JVOA 1FJ7A 3SCLE 4CI0B 1JX4A 5FRNA 4CZIA 2OO4A 5KT7A 2EFVA 3GIMA 3QNNA 3RJIA 3QGPA 2GX9A 2IM0A 3OXGA 2UUCF 1GT8A 5CZ1A 4J2BA 1TAMA 2KTQA 3QFHA 4CF0A 1ZQNA 2MQLA 2H48B 4YY3F 4GKKJ 1B92A 2AJ4A 1X9MA 5E84A 5D46A 2ZGYA 2AYMA 1BOTO 3TR8A 3V7KA 4LRDA 4FL9A 2OEHA 3KD3A 3VQSA 2ILZA 3ILJA 2WUSA 3P49B 2DK2A 2VOPA 4G1PA 4FWKA 1TK8A 2P6SA 1N5TA 1QM9A 2YNIB 1FFVA 1KHWA 2XI2A 3H5UA 1BWFO 1H0HB 3FBCA 1S1XB 3W5XA 1ACMB 2DITA 4C0ZA 2EC0A 3RJEA 5FDLA 4FOEA 1D09B 4ILLA 2CA9A 3DOMB 4DV3K 3B4DA 4OJGA 4CE9A 4CIEA 2WZ1A 5F41A 1U1PA 1RT3B 2GGPB 4F72A 1D8LA 1NAQA 3NP5A 2NREA 3A13A 3JPSA 3FSYA 1V4TA 3ZSRA 5EE1A 3GLJA 1XSPA 4QW9A 1TKZB 2B43A 2X1GA 2PE8A 3V81B 4B8AB 5IXUA 3CEDA 1VK3A 3C6TB 3PSTA 5JU5A 2LU2A 2VONA 3LDQA 2Z1JA 2E9RX 5CZ2A 2D74B 4A4JA 4OPHA 3SJJA 4M6WA 3N6MA 4FVUA 4WU2A 4GKJJ 3KK3B 4QZDA 4DO9A 3JYTB 2KZZA 1YK9A 5J1PA 4LF5K 1RHMB 3NMUA 2V2QA 2FGCA 3FC9A 3H6EA 2YNHB 4B1VA 4KLMA 5DGBA 4G9BA 3N9UC 5ALWA 2F8SA 4QZIA 5K8OA 5CYMA 3F5TA 4C8ZA 3VEWA 5GTIU 4NLGA 3A3OB 1Q1KA 2I0XA 5CYJA 1MMNA 4MQ3A 1VIXA 1K9MT 3NMAA 4JI4J 4Y65A 2K3KA 1ATNA 2GLEA 2P9KA 3G6ES 1YTAA 5EDWA 3QE9Y 4BRPA 3VAHA 5J0QA 5B66U 1IBLF 3RJFA 2JGUA 1T9XA 5HATA 4B3TF 2ZJPQ 2Y9TA 3ISND 2A1JB 3C8YA 4CESA 2CQPA 4Q2LA 4I7FB 2A3VA 3WX4A 2KT3A 5KFZA 2I38A 1E4GT 1FNXH 3CD0A 3FE1A 4M7YA 5EWEA 4O5EA 1VQMS 2BQUA 3LDNA 2ZJPL 4GV6A 2KB2A 2WK4A 1Q82T 2DTJA 3N5BA 1XU4A 4I2DA 1RBRA 2P6TA 4HH0A 1ZM3A 2FZCB 1RNHA 2J6UA 5L1JA 2FC0A 1LK7A 1VC5A 4DTPA 3UKUB 3ZT0A 2W8LA 2DGSA 3QESA 4FJLA 2YHYA 1WSGA 4G1QA 3D28A 2OCEA 4QZBA 4C0BA 2DGQA 3AVGA 1KNZA 3KJFB 5LXRA 4GVBA 4M8LA 2XSJB 2HBQB 3VENA 1PYTA 1RISA 2F9TA 1N33K 3CCZA 5J2PA 2QV6A 1P6TA 3G2XA 2PY5A 2GMJA 2XWYA 5J29A 3OHRA 2DH9A 4GKKF 3EKUA 1VI7A 1ZBUA 3L7UA 1D8BA 1WNSA 4IFYA 2HNZA 4N76A 4NRUA 4ILMA 3AO5A 4A47A 4CK3A 4AHUA 1CZ9A 4DV1J 2XY6A 1HKCA 4RU2A 2PEBA 4JYAK 4CHYA 2KYZA 2VYPA 2MUTB 3PDNA 2ZZMA 3MCAB 3GJSB 1FKPB 4H03B 3GILA 2KZMA 3I8DA 1TELA 2KDOA 4C6AA 1TK5A 1AA1B 1SKRA 3KK1A 2PI5A 4MEXA 4LRAA 4A61A 1G4CA 3ZCMA 3KMSA 4I6MA 2L48A 2WAQD 4JK7A 2QWPA 1T9WA 1T94A 3KJVB 2LFVA 1S3XA 5DG7A 5AKJA 4TY8A 2W2MP 5DBAA 3MK6A 3QQCD 5DM6Q 2MKYA 5HP1A 1OVQA 1H74A 1R8HA 1CC8A 5J0XA 5J2NA 1NZBA 4X5VA 1X5TA 1QJHA 3C16B 3O4QA 4GKJF 3ZNJ1 1NSAA 5DM6L 3WK9A 5AKZA 4BXOA 1TL7B 2KNJA 1DY3A 2RE2A 3I4PA 2E1CA 5T41A 1AUSL 1W2BM 4C7ZA 1F44A 2OWOA 5I42B 4YD2A 1OS5A 4H0TB 1TL4A 2EFPA 2O5DA 3JB9k 7ICVA 3AVKA 2ES6A 2XULA 4JI1K 2AYEA 4KJIA 1V3RA 4CLSA 1PGZA 4OI4A 4I64A 1SV5B 4CIOA 1W26A 4EBDA 4ID1A 4TN2A 2C3YA 7ICUA 1LCUA 1YITN 2F3NA 3S1TA 1SV4A 2IYIA 3M7DA 2CGJA 2LM4A 5IOLA 2B0GA 2A2CA 5E3RA 1ZBHA 1SKUB 3D4JA 4DZDA 4EX7A 2PD1A 3D66A 3CFPA 2LXFA 2F63A 2QMUB 4EUVA 1LWCB 4CW7B 1PK1A 1JLCB 4L74A 4GLXA 7FD1A 2ZIUA 1QD1A 3DOLA 1H2TZ 3V4MA 4UTGA 4DX7A 5G5GA 3DRPB 5F8HA 3IG5A 1MWQA 1XHZA 4ECRA 1FKOB 4UW9A 4U96A 3NVVA 3ED5A 2BYCA 2IVYA 2BEFA 2R3VA 1VQ5S 4M3ZA 1CJTA 5HI7A 4FBTA 1N0VC 1IJFB 1GLJO 1C4CA 4BDZA 4FWMA 2XWXA 2CH5A 5IWAJ 3LWLA 5LJVA 1GLFO 1GLDG 4G65A 4WTYA 1MQ3A 1RAEB 3THYA 2VFSA 2BJEA 1RWVB 3GIKA 3CM6A 1HQ2A 3CNHA 5BYRA 2LI6A 2FI1A 5F9LA 1ZQFA 1XJWB 1R31A 2LMIA 9ICLA 2R7XA 4DSEA 2AKWB 5J1EB 2DCUB 2D1CA 2HBKA 3GFZA 3EKSA 1PJ7A 4DU8A 3Q8PB 2BM0A 2FE9A 4CH7A 2HBRB 1B7YB 5A0YA 2W04A 3VA3A 2CQBA 1MN7A 4A8KA 3CHWA 2EZXA 3MEEA 2VG6B 4Q45A 3ZDDA 4DOCA 3HVTB 4ZP6A 3L8BA 1IKWB 4Y2CA 2YH0A 1U1OA 1B99A 1YKWA 4DR4F 5LJ5Y 3M6VA 3CULA 1XNSA 1OO0B 3K59A 2HQFA 5KFKA 3DAWA 2F77X 3DRSB 4URGA 2V50A 2KXNB 5KG6A 2YNFB 1G99A 1RDRA 2Y1LB 2LKZA 1G15A 3ZDCA 2XMJA 2ZBQA 3NTUA 1NK5A 1RTJA 5L38A 2PMWA 2DY4A 1KTQA 1C0FA 3KJQB 1VHIA 2E2NA 4OKJA 3JPOA 4QIEA 1XC9A 4CF4A 1HJPA 3K58A 2QK9A 1EQMA 4OI1A 3AOCA 5AK5A 3ZSOA 1RTZA 3CDAA 3TZWA 4DR1F 4JI2K 3IA0A 2F4VJ 1LW2A 4MIWA 3EJMA 3ID6A 2DF4B 1U2RA 1FFWB 5DDPC 9ICEA 3OUYA 2CUYA 2VPZB 4P7TA 5I4MA 4DU3A 5BR8K 4RW9B 2Q6BA 2YKNA 4DPXA 2R8HA 1G7CB 3KG0A 1N5QA 2PIIA 1C0UA 4R0EA 2RS2A 4MK9A 3UCUP 8ICMA 4HUFA 2G06A 1JK9B 3P31A 1ZPWX 2P6UA 1KVJA 2E4LA 2ZUGA 4ZHRA 1NU4A 3PW0A 3GQCA 2HURA 4I29A 3T5JA 3AB2B 2UXBJ 1NLKL 3O80A 2IVOA 3W3DA 4IR9A 4HT5A 1IR1A 3N5FA 3KD1E 3US5A 4C4SA 2RHQB 3FQKA 4CO2A 4UB2A 3UQ0A 4NLBA 3KYLA 3ATUA 5A8WB 2VUGA 2YXLA 3M8PA 4KFBA 4HHUA 4U7UD 1HKAA 3AA3A 2QB0B 4DOBA 4EO6A 1HWJA 1B9DA 5DJBA 4CJ3A 2RHKA 3JPTA 3THVA 4BDPA 3OLAA 1XK8A 2MYFA 3H2UB 2L9DA 1JCEA 1OSDA 2W2QP 3HI9A 2CXYA 1U1NA 1HEKA 3J81U 3RVCA 3EEQA 3JSYA 3D45A 3WXLA 4O3NA 3RW6A 2W01A 1S10A 4CVNE 1Z00A 9ICBA 3MM5A 2XO6A 3AVLA 2QWMA 1G1XA 3DDHA 3GE1A 1YUWA 3MAQA 2HKEA 4NLKA 2YJFA 4NWIA 3GR1A 1HR0J 5BYQA 4B9UA 2E8NA 3AVCA 4EEKA 1QTMA 3LP2A 3UQSA 3IRUA 4JI8F 3QU7A 4LSNB 2GQQA 3UMBA 5CAAA 2WONB 3O3GA 3PEJA 1KQFB 3ZD9A 2AJ2A 4DV2F 4PGYA 2KVCA 3DLJA 1REVB 3R6GB 2IDEA 2Z4PA 3SMSA 1NH8A 2W40A 4ZN3A 3IM8A 1T8EA 3BH7B 1WDDA 4K4UA 4DOAA 4K4VA 3GJQB 4FP9A 2FVPA 5DM7Q 4KH1B 2RRDA 4MKYA 4PWDB 2OPRB 4GNIA 2R7VA 5EOZA 3F53A 2MQMA 4M5LA 4FLYA 3MR5A 2CGLA 4BGDA 3R5GA 3GMGA 2ZH7A 3IM9A 1VHFA 4P7VA 1HHSA 2R42A 3ZEUB 3D6TB 5BPNA 1BWVA 1FRKA 5DM7L 4CCHA 1YI2N 3V9WA 3N6NA 3OYJA 5I3PA 2DGXA 5DLFA 1MN9A 3WXJA 3GR0A 3P6YC 2HYIB 1IBMK 3ZSQA 2WBMA 3LGNA 4KMUA 3VAFA 4F4AA 4QIFA 1RILA 1ZRMA 1SAZA 4P52A 1X3MA 3SI8A 4BHQA 2H3QA 1WCLA 2VICA 4B02A 4USMA 4QYZJ 1TMJA 5AQYA 3A8EA 4RX6A 4YHHK 3FKBA 4IXCA 1C6VA 4US8A 2F1FA 4OLOA 3G25A 2YNIA 1YTYA 2E5HA 3R1LA 5H9EK 1S1XA 2CVIA 1IBKJ 5KG4A 2J4RA 1ZQDA 3MAAB 5GADP 2ZHBA 1PYOB 3DOMA 3H5XA 4BS2A 3SFUA 2WRMA 2ADBA 2BM1A 3VQ9A 4B1WB 2DRBA 2JWNA 3MUMP 2J5AA 2GEMA 4BC4A 1N5SA 2DNHA 1LOUA 1V5IB 1XBWA 4MFAA 2FMQA 4J91A 4P2FA 1RT3A 2GGPA 5AKEA 4R64A 2A1RA 5AI9A 3WIVA 2HI0A 3NFAA 1TV6B 4ED2A 4AYBC 4GXKA 3E0FA 2MXYA 2E66A 4FDFA 3KG1A 4RWWA 5LL6Z 1NKCA 3V81A 1NHUA 2RJZA 3C6TA 1HNVB 4ZKAA 2F2AB 4P0QB 4O5FA 3CC2S 3TVZA 1OXJA 3KK3A 5ETQA 1HD0A 2NRTA 1NK8A 3JYTA 1ZQLA 3RJHA 1UTAA 4I2EA 1Q7LB 2YNHA 3B0XA 5DBCA 3K0JA 2I6WA 4ZPWR 3CD7A 3CDBA 5JVGQ 1JRPA 5HL7Q 3Q22A 1Z1VA 9ICUA 4H5VA 1TFWA 1HI1A 5EX0A 3FJ2A 3KZXA 2K1RB 1MWZA 1FE0A 3BDEA 4B9MA 1RAOA 1WC4A 1WHXA 3M6WA 4JI3K 5J2DA 2OEKA 5JVGL 3LDAA 4C8KA 2VBZA 2DY1A 5HL7L 2ODGA 2BPFA 3EMTA 1GEHA 2Z0GA 3VQQA 3M6KA 2ZC4A 1WSJA 4JS5A 3C23A 5H9FJ 3CFRA 3KMQA 5C25B 1RFQA 2AX0A 2A1JA 5IIMA 1KQQA 4PQAA 5AXLA 1TR0A 2VA3A 4QOZB 1HR0F 2B8PA 5DQGA 5AQNA 2GUIA 2RQCA 4I7FA 3MWBA 2MKKA 1TK0A 4KLIA 1F5BA 3OSPA 2ZUAA 5EWFA 5F0UA 3QUBA 3JPPA 4KRWA 2UXCK 4BR5A 4Y2KA 2BCQA 2IHNA 1BO5O 4KHWA 5HP4A 4DV3F 3GIIA 1J53A 3PHTA 1B3TA 4IQXA 3E8OA 2HVEA 4DR7F 3BSAA 2NUBA 4BVOA 4AQYJ 4FO6A 2CNLB 3SCJE 4KBOA 5AE2A 3UKUA 1TKDA 1NJWA 3CQXA 4FPAA 2W11A 5KFOA 4WIQA 1XR7A 3K8WA 4C98A 2V4RA 2JXJA 3QEBZ 3M6UA 4XA5A 4M63C 5L1KA 5MAOA 2VASA 2BGWA 1ZQTA 3ZC4A 1WG4A 3OFHA 3UDEA 1NJIT 4NLPA 5RUBA 2BCSA 1SC3B 1VISA 2FZGB 2XSJA 3V7LA 1VSLA 3P1GA 4JI5K 1S77D 4CLPA 1RBLA 4B3MF 1Q78A 2FGOA 2RQ5A 1ZQRA 3HBTA 4DSKA 3U9ZA 5ETLA 4KMOB 1Q79A 2M9NA 2LYVA 1C1BB 2ZH1A 4LF1A 1K73O 4OYIA 2DNZA 3KKRA 1WWHA 1KSPA 4YNQA 3ALRA 2R8KA 2MQOA 2NZCA 3FAHA 5A8KB 3WBZA 4ENOA 3A5LC 2XBPA 3ULHA 3C28A 1FNOA 2MUTA 1S59A 1QH9A 4DOZA 4IJAA 2FDRA 1XMQJ 1FKPA 4KO0B 1WNEA 3R7BB 4FJMA 1ZJNA 4JV5J 2E9TA 3B6BA 5D0HA 5I3UB 4PAAA 1RWUA 3Q24A 3D2WA 4CIGA 4GV3A 4LFCJ 4PPDA 2KIWA 5CE3A 4ZCKA 4YOUA 3UNYA 3OFFA 3R6LB 3IG1B 4WWSA 2MQNA 1RT6B 2WFBA 1FE4A 1UETA 2HS4A 1IN0A 3KJVA 3LP1B 2YTUA 1ZOTA 2Q1LA 1HMVB 4QZCA 4KLGA 1FXXA 3RU0A 1YJUA 4RLEA 2ZM6K 2HMXA 2VC0A 1NPPA 4F0KA 5C24B 2BZ2A 2M2BA 2DR8A 5EX3A 2LYAA 5AKLA 4OZ5A 3LZIA 4RWTA 4I27A 3IP4B 4TU9A 4NI2B 1EQYA 3C16A 4QR2A 4FYWB 3HHKA 4CT8A 5EN1A 3HP9A 1FKAF 2GIRA 5F2RA 3B8HA 5F8GA 4OLBA 5I42A 7ICHA 1OQ6A 4P71A 4G1IA 5D78A 2ZVIA 2LA6A 3C5FA 2DNGA 4AP9A 3LYSA 5CB1A 3AJDA 3L2UA 2L9WA 5LXYA 4JN4A 1N33F 3JPNA 5A76A 1SV5A 3PRBA 5KAIU 4LF2A 2OSQA 3DDNA 4YXJA 1RSCA 2YHAA 4FZLA 3TZXA 5HSPA 1BQNB 2EANA 5CHIA 1L3VA 4HVJA 3OS2A 1L8LA 3G71S 5AI6A 4UBCA 2VQEK 5J2MB 2ZKUA 4F2SA 2MDAA 4NMLA 3ENBA 4KLOA 1LWCA 3WKAA 1R3NA 4Y1CA 3L4IA 5AQUA 1JLCA 5BRHA 4DUZJ 2B6AB 4JKCA 4LIWA 1ITPA 2JRZA 5ALXA 1NB7A 2XMUA 4CHZA 1AB8A 1WEXA 3DRPA 4FNIA 1FKOA 1X5OA 4OX9K 4CNZA 2HHHJ 3IAM9 1KFDA 5J0WA 8ICWA 4M7XA 3SJHA 3O1BA 4ZPVR 4BQZA 1RWKB 5A2QU 1VQ8N 4I2JA 2GV1A 4WF9Q 3PSPA 5A2QY 1F9HA 4YMNA 2VANA 4B6JA 5J0RA 5HRNA 2D6FC 4OYZA 4H0VB 4W90B 3AY0A 2J76E 3OPXA 3WNEA 3DJCA 4WF9L 4C1NI 5JVHQ 2KVIA 3AA2A 4A2BA 2OAUA 2MRLA 2H5JB 2DO0A 4ED6A 2CPJA 1REGX 4J2EA 5J1EA 2D4WA 2DXDA 3H98A 1A6LA 1YAGA 9ICHA 2DGZA 4WTOB 2DFEA 4W5TA 1Q16B 2DGUA 5JVHL 5C2FA 2EFGA 3I33A 4F3MA 4CJKA 2WMMA 3VEOA 5GMEA 2NO5A 3AQFA 2VG6A 4F5RA 3I28A 1DQ9A 3HVTA 2CJXB 3ZSZA 3MXMA 4JI1F 2OJ3A 3KNAA 1IKWA 1NCLA 2E7XA 2GA7A 1J2NA 4CK1A 1XUPO 4DR2K 5SZTA 1AXQA 4BRCA 1NHVA 3A3NB 2XY7A 2LXUA 3DRSA 1BIUA 1KBUA 4CZCA 3TJAA 1KN6A 2B9YA 2HNDB 1RP5A 2YNFA 4NEZA 4A62A 7ICSA 2N3LA 2M0NA 1KL9A 4A57A 4CO5A 3GJRB 2ASOA 3SMPA 4ZOHC 1ZZFA 4L6V3 4CZFA 3OYEA 3J81O 1OSCA 3GWCA 2FBVA 1Q53A 5GADU 4E0DA 1KBRA 3CW2C 3AO1A 3IN5A 4IFEA 4LF7K 2CJYB 8ICCA 3OLBA 2HGLA 4UOFA 1UPHA 3Q8UA 3H3NO 3NH1A 2DR6A 1IO2A 4EYIB 1MDUB 1SCJB 4UUWA 1TUUA 3A3PB 1HJOA 3QPIA 5LMNF 1ZXIA 1UT8A 2R8GA 3BO4A 1B64A 1T05B 2B6GA 4RW9A 3CD6S 5M1FA 4E7LA 4K0KK 2JEIA 1M5PC 4XK8C 3TFSA 2YHWA 4F4ZA 4EMDA 3RZAA 5DB8A 2FVSA 1TTHB 2RNEA 4X4OA 3CYMA 3F0NA 1S0VA 2QGFB 1BPEA 3MDQA 4FE3A 3QMLA 3SQ1A 1HHTP 5BR9A 3TR5A 3EXYA 3W9IA 2LA4A 1QHAA 2V8PA 8ICXA 3K9JA 2F8EX 5FPMA 3QT6A 4OKEA 5SUHA 1D3WA 1ZA2B 3BBCA 3JSRA 2ZIVB 3GL1A 4BRIA 2RDIA 3AQEA 5ALKA 5A8WA 1KQKA 2UV8A 4YN3B 2QB0A 4CF8A 5IT9O 1S76D 4NLNA 4NXNK 2UUBJ 2FLOA 4K8XA 4FYYB 2GZOA 3ISZA 1B9FA 3FCHA 4ZJQA 1D1UA 1QVFR 3R3TA 2IMOA 5M2RA 2HVDA 2HWIA 3W66A 4OZ0A 3I5CA 2H3ZA 3LK9A 1VSEA 3CCJS 2XHBA 4U8VA 3HHLD 4LFAF 3LPTA 4ANCA 3KWIA 3FZFA 5HQMA 3VGUA 2QO3A 3KKAC 2OPPB 3R5AA 4ZVQB 2FHOB 4H0YB 3U02A 2NZTA 4CF3A 4OX8A 3D0GE 1TVAA 4CH0S 3RH5A 3R5DA 4QOTA 1NGFA 1SZHA 3OVBA 2PN6A 2XM3A 4LSNA 2LPEA 2WONA 1DBDA 1KVAA 5DZ6A 2KKHA 3J7ZT 3L3FX 4O9MA 4KE5A 2Y8YA 2IVNA 1REVA 3GSIA 5FPNA 3I9V9 1BLUA 3DI6B 4USTA 5FLXU 1XMOJ 4C7QA 1JXLA 4CF2A 3E3XA 6FDRA 5ALSA 2DGTA 5FLXY 2YWGA 3M7VA 1HBMB 3EGWB 2OPRA 4PWDA 3NAEA 5M1QA 3QXGA 3SD7A 1S6PB 2RPIA 3OJSA 1A77A 1RQLA 1L7MA 3NS6A 2GMHA 4JUZA 4IS7A 1IQTA 1M1KO 4ES2A 4JI6K 3ZEUA 1UCVA 4C1NK 1BHLA 5ETPA 9ICMA 4CO1A 1Y5NB 4OV6A 3UWTA 4QU6A 4NL5A 4KLJA 3KKFA 2W6KA 1G3OA 3I82A 4M3YA 1UFKA 4O0NA 1BA0A 4DPWA 9ICXA 4LF6J 1W7WA 3CWJA 2R7QA 1GMWD 4X66K 3F56A 1ZQPA 2G2ZA 5EY4A 4CF9A 3CTRA 3HLUA 2X1BA 4FN5A 4PHPA 1RAGB 3C1YA 2M8HA 3AVAA 3KBBA 4CZLA 4NYZA 1FTRA 2VWJA 5IIOA 4F0HA 2G07A 2OZMA 4PZVA 4O3OA 3MAAA 1JLAB 1FFGB 3NNAA 3WQUA 3NF9A 3U1NA 1DEJA 2P9PB 2ZG6A 3MEDB 3RMCA 2MLZA 3PX4A 2J7UA 2XHCA 1VCTA 3W63A 2VQFK 3GFKB 1FERA 5B0DA 3M9NB 3MEKA 1SH0A 4UAWA 5J2HA 1TV6A 5L1IA 2ZWOA 2WHEA 4RG8A 3M8RA 3SQGB 3I56N 3O8MA 1XNQK 3QWPA 3S01A 1ZQHA 3OTEA 4DFMA 1S49A 5AM3A 5CCMA 1FO4A 1HNVA 3W2VB 1A0PA 1ZS6A 4D3HA 5AZIB 4P0QA 2AP1A 2W41A 4MKBA 4O5BA 3QU9A 3CFOA 2RS8A 3HJEA 1S99A 2FZKB 4TUQA 4JV2A 3KVGA 4N56A 5ITHA 3OY9A 2HHWA 4CZJA 4JKBA 2O8FB 2BJ1A 3R6MA 2YX7A 3OQ2A 4DCOB 2O1PA 2QWOA 2K1RA 2CJKA 4Y0WA 3JPQA 2YB4A 1FWPA 4WP3A 1N32K 3CJ0A 2CXEA 4DR5J 5AHXA 5AM5A 3AV9A 5F3XB 4R63A 2YWKA 3KWMA 1Q7YT 4C8YA 1WOQA 3T1YJ 4JP8A 2W55A 4B9VA 2I5JB 2HRTA 3TX8A 1NDPA 4J9SA 5C25A 2HW3A 2RF2B 1YIJN 1U25A 4KGVB 3WNGA 5ALFA 4E1MA 1NDCA 4RQ0A 2C3UA 4PCQA 4IEIA 5CCLA 4NLDA 4OPKA 4F67A 2YMLA 4R8UB 1WC5A 2YQEA 2PFUA 3MD3A 3C2LA 5LOQA 1XMOF 3VA0A 1X4BA 3UMGA 3TAPA 5IILA 4WQ4A 1YJTA 2XMTA 4DV6K 2YWHA 3NY0A 1S6QB 4KAIA 2KKVA 8ICPA 2B5JB 2V51B 2OH2A 2OGUA 3OW2R 1WOOA 2NRHA 2CRLA 4ZVTB 1SQKA 2E20A 4FK4A 2HMIB 3D0PA 2E1RA 8ICSA 3IWXA 2E6LA 5BPMA 1FWKA 1NOMA 3H0RB 3NOGA 3KOAA 3BSNA 2X6SA 1HIWA 4AXJA 1X4DA 2ZFHA 2ESEA 4Q44A 2ATCB 5AJ3J 2CG4A 2D1KA 3SXLA 3WK7A 2KOBA 4KHPJ 3PG9A 2QB1A 2OLWA 1NOYA 4DG1B 1ZJMA 4Z6DA 2RRNA 1HARA 1C1BA 2N1RA 2RRBA 5KFPA 2IOFK 3CP8A 1O03A 4LIRA 2H3GX 4HWIA 5A8KA 1NGAA 1WEYA 4JI3F 3S3NA 1WC6A 8ICRA 3DOKB 2C22A 2BKPA 3H5SA 4KO0A 5IM0B 3ENQA 3AVBA 2D7SA 2FBYA 3PIOQ 1X9XA 3AA5X 3HP6A 5I3UA 2W1BA 2QIFA 3CJ8A 5LM7E 3VQDA 5KRTA 2DQNB 4USWA 1GXUA 3IG1A 1RT6A 9ICPA 3BS7A 2ETJA 4BBYA 1S1UB 3FQLA 4URQU 3LP1A 1IM4A 2AYBA 3AVNA 1RQ0A 3MPDA 4K4TA 3PIOL 1HMVA 5HMMA 2YVSA 5AQTA 1JB0C 2YX8A 2UXCF 4XEIA 1VS3A 5HVFA 1TUGB 4F0MA 1VC0A 2YNGB 3L5KA 5C24A 1FESA 4UY8T 3TACB 3OYKA 1U04A 4P6QA 4NI2A 3SQ0A 2BABA 2QMXA 2I1QA 1J6ZA 1RADB 3P39A 2KVSA 7ICRA 3S41A 1HW9A 1YHQN 2FMPA 4OZLA 2HK2A 4YDUC 3SBGA 3NS5A 3VQ8A 2GQCA 1U1KA 2O8CB 4CH1A 3OHAA 1Y64A 1X42A 2E8OA 1Y9OA 2XS2A 3DN9A 2FSJA 2MY8A 2VBYA 4LVOP 3L4QA 2F1HA 2P5OA 1I6JA 4PYDA 2B4UA 1TE2A 3W62A 2H3IA 3CB4A 1N5WA 4RQ5A 4CEZA 2EKNA 3DLRA 3LQVA 1BQNA 1SB6A 4X4RA 5KT6A 4LF8J 4JHDB 3J7YP 3PJ9A 4KI6A 4IUFA 3P4IA 3QT8A 2C2RA 2DKOB 5CWRA 3CIPA 1ASVA 8ICTA 1YWXA 3TTFA 2CQHA 4P9SA 2VJVA 1JNRB 1KONA 1HNZJ 3K1ZA 3ETMA 3GYGA 2B6AA 5KI6A 2VHGA 5D4BA 4LF4J 2IHR1 3TARA 1T11A 2WC9A 2HMPA 4ZITA 1WG8A 4DCCA 2LHTA 1I39A 3M6ZA 3GPAA 3AO3A 1CLFA 3RBXA 4PG5A 2QEXN 1S9FA 4KLTA 3L2VA 2OMLA 2JFDA 4YB5A 2CQ0A 1Z05A 3BP8A 5KGWA 2C2MB 2DFLA 4USAA 3MMCB 1B0VA 3EZ5A 3OYLA 1BCOA 3I0RB 1NGBA 4B08A 1RT2A 4LBPA 2HRUA 4BE1A 5KT3A 2D5RA 4BE0A 1ZTWA 4PQUB 3ZTSA 3ZZYA 1WSIA 1O08A 4H0PA 4DCPB 1RM6C 5D49A 4V19S 4C97A 4CJQA 4RPYA 4ZVPB 1IG6A 4QZEA 2B51A 5IT4A 4RUCA 4KHPF 1TV9A 2OFGX 2LYBA 3WNFA 2DPIA 1RWNB 5KPTA 1S9GB 1KHVA 2C2EA 2KIVA 1HW8A 3GCWP 1VSKA 3HHEA 2F44A 1F0XA 3W5YA 4YOWA 5CABA 8ICBA 2FSKA 1FXDA 4L76A 1SV0A 4A8EA 1SC6A 1WSFA 1Q86O 1KC8O 2IIRA 5ETVA 1GNKA 1KFTA 4I2FA 2DNQA 2HNDA 3GYXB 4I56A 3SI6A 3H90A 3NGKA 5EE0A 1O8BA 1VFJA 1RBSA 1Z19A 5GIOA 4NLUA 4JI7J 4QWCA 1WC0A 2GCFA 2JRSA 2QLJB 2LDIA 4NA1A 2NUHA 4RNHA 3T19A 3NWRA 4AHRA 2UU9F 3O4WA 1RT4B 4HHJA 5E3CA 3FK4A 2HDOA 1JXVA 4ZP7A 2G8KA 2N82B 3VHQA 2MQQA 3CCVN 3HCXA 4B3SJ 2LXIA 5AE1A 3M2VB 3J8AA 3IMXA 3HX0A 4X84A 1WUDA 4Y2UA 5C2DA 4JKAA 5J8YA 3OFEA 5L9NA 2IS3A 3PUFA 2QA4N 1NO8A 5DDMA 2QWRA 3NVZA 5FLXO 5L1LA 3RUBL 3ADAC 2V9WA 1NDKA 1VQ9N 2ZJ5A 2IM2A 3M1YA 4C0HA 1T05A 3TKAA 1R8PA 2D9OA 2FJDB 3EN9A 4ZK7M 3L7OA 1WTBA 2EAMA 5FRMA 1X6JA 3HM9A 4YEAA 3Q23A 3AHPA 3ZDEA 3CIZA 2YQ0A 3A8YA 4TYBA 3LVVA 4HACB 1R27B 4C3KA 2IOHA 1S0NA 3OXLA 1FRMA 3HW8A 3N97B 1J27A 3LP0B 1JL2A 4DR2F 3OTOK 1Z2ZA 3CCLS 3IWNC 2ZIVA 3HM8A 1U2VB 4X4VA 4PPZA 3UPQA 1NGCA 2MLYA 4QZ9A 2HHVA 4A8WA 3TVYA 3X1LB 1RXVA 3G86A 4PXEA 3TUJC 5ALIA 2OPSB 4K59A 2P9NB 3GIRA 4K4YA 2A1BA 2OXOA 3CCMS 1C7YA 1VR6A 3CGIA 1HNXK 3NASA 1RGVA 3W9HA 1RHQB 3TU5A 1WF2A 1JWWA 2MY7A 2LKYA 4CNYA 5CR0A 2FYXA 1N36K 2OPPA 2O01C 4OZJA 1U9LA 4TQSA 3M4XA 4LF7F 3L3VA 1VJQA 4IFVB 3O0FA 3FSIA 3NVMA 1UAXA 1P8ZA 2W24A 3SFGA 4NA3A 2RD5C 1ZETA 4J9OA 1LKYB 4Y2YA 1F3FA 4K4IA 4RWXA 1DQAA 4NXMK 4DV0J 1DT9A 5LY3A 2JH7A 2DKZA 4LRBA 3R2CJ 4RW6B 4O0IA 1R59O 1E3MA 3DI6A 4PA1A 2ZJRQ 4ED5A 1KAYA 3RJJA 2P8IA 1QZ6A 1VRUB 2YKMB 2OEMA 1K8AT 1HBMA 1AROP 4QS9A 4K0KF 3PW5A 1KP6A 3TAEA 3D3CJ 1ED1A 1S6PA 2BJDA 4OZ1A 4RL1A 4IWVA 2ZJRL 1S0MA 2GS8A 2UVVA 3DKDA 3F73A 3VAGA 2CGKA 1NZAA 1R7IA 4Y3CA 3IKMA 1NK9A 4LVNP 5L8RC 4FWRA 4J2DA 2V8VA 4BR4A 5KOWA 1QSYA 1OVYA 4PG4A 3K57A 3CC7S 4Y2TA 2EG2A 2QW9A 3RAQA 1B7FA 4QWAA 3PJWA 4JI7F 1ZQQA 5AFUA 2M88A 4BWMA 3U7JA 3FCVA 8RUCA 1KR4A 4RT3A 2YY6A 1N34F 3NE6A 4GVMA 3BM7A 4Z0UA 3BYPA 3ZTQA 5CZVA 4OI3A 3MR6A 1RXOB 3F2CA 3K9KA 3AA9A 4B3SF 3AB4B 1B0PA 4YY3K 2A40A 3QZ8A 4MK8A 2Q1NA 5IZHA 4DUYK 3OR2B 2MEWA 2WSCC 3PEHA 2BPCA 3KLEB 2E5JA 4TLQA 4NLSA 1JLAA 3VVUA 2M7SA 1NXIA 2LSNA 3EVMA 2P9PA 3MEDA 5D4OA 4X62J 3ULDA 2K8AA 2NSBA 1BI4B 5D15A 3H8WA 3HD2A 3RW7A 2BKOA 1RDWX 1V4SA 3E9PA 1E6VB 5AFUH 1ECWA 3A2FA 3EDQB 1Q81T 4BRKA 3PY8A 3SQGA 2BCRA 5DDOC 4Y2AA 1RUSA 4URSA 2VJ5A 2Y1JA 1IBCB 1JMTA 3LAKA 1EARA 3CMAN 3W2VA 5FP0A 3ENWA 3VF0B 2PFDA 5AZIA 2I5HA 1YVFA 4YOEA 3V9SA 4M9NA 2B4VA 3JQJA 2RVJA 4RR5A 4H4KA 2JSXA 3ZZUA 2RDDA 3V6KA 1SKSA 2B3TB 2BRKA 4JOUA 3NWGA 2ZWHA 1N56A 3FNNA 2E44A 2JX2A 4UAZA 4JI6F 1V9PA 3J7YU 2JLEA 3MCNA 5GAGI 4GVEA 4LF9K 2HEKA 2R2SA 2O8FA 4P4MA 2QLXA 4O4GB 4CJ5A 2MKSA 2CNOB 2AQ4A 1W2BR 8ICHA 1WLJA 3ULEB 3BV8A 3HYFA 3VQ6A 3HFVA 8ICNA 3HK2A 3ILOA 1U0HB 1ZTTA 2OZSA 3TUIC 1HPZB 4NEYA 3S9HA 4J9UE 4RZRA 1RTDB 4KITB 2COLA 4KY3A 4WQ5A 3HSJA 3RG6A 1L7PA 1QQNA 5HR7A 2I5JA 2UXDJ 4JNEA 1OPZA 3PYDA 3ETRA 4DQ8A 2RF2A 3PX0A 1CQMA 6AT1B 3Q8QB 1MA9B 1N8RO 2ITGA 3DHWC 1FW6A 4M42A 2P9GA 1ZPVA 3CJSA 1IBLK 1NRKA 3LH2S 4ZPBA 1TL5A 1YHQS 1VQOS 4R8UA 3MAHA 1QTNB 3DRXA 1VDHA 1PJ6A 4KX5A 2OM6A 4BROA 2FBXA 5AQMA 1YJWS 3R8EA 5J2GA 2AHOB 2N7YA 3TSPA 3BB5A 2DXEA 1S6QA 1JKHB 3UVJB 3AARA 2N3OA 4M3UA 1QSSA 2KN7A 4RNMA 1Z1ZA 2B5JA 4KLHA 4DS5A 1T9VA 4J5OA 2R18A 4ZCLA 2UUAJ 4OGEA 4AD6A 3T69A 2W7PA 3P3DA 1SL1A 2HMIA 1IKVB 2M52A 3SR6A 4ED0A 2ASLA 4YFKA 3V1OA 3C5GA 4QYRA 2KKZA 4CFBA 4CWBA 3VQCA 4YR2A 2HOEA 5HAOA 3BPSP 1LK5A 4C9DA 5KFSA 4Z4GA 9ICCA 1RHKB 4RU9A 4BRHA 4QZ8A 4BRLA 4J03A 1WF1A 2ZC3A 4V1Ak 4DG1A 5KFVA 1LQ9A 4YXMA 2RU3A 4Y2SA 2HQIA 3DXMB 3ETLA 2XSFA 2X78A 2AW0A 4KYZA 4LR8A 2HVHA 4X4QA 2M4MA 2QEXS 3VQAA 2LEAA 1N32F 2OTJN 4I28A 2E1AA 4PG8A 4GKKK 4TVAB 4EZ6A 3DOKA 4ZVFA 5IM0A 5BJRA 3TI0A 2AEFA 5CXTA 5JJBA 2DT9A 4AILC 3MECB 4X62F 4M3RA 3OR1B 3WKCA 1BQXA 4GW6A 1S1UA 2ZJQQ 1M5VC 1EXQA 3R97A 5AM4A 4OFZA 5KTQA 4ZCIA 5DGAA 3C19A 2HAIA 5DK5A 4GVLA 4M5NA 2YNGA 1RQNA 4O3QA 4P2SA 4ISEA 2ZJQL 1X2IA 1XR6A 1RWMB 2W42A 1TZ0A 2VZ9A 5CP2A 2FPLA 2M3DA 5DETA 2FVCA 4DKWA 3NUQA 4KKOB 1Q46A 5ALJA 2O8CA 1WAFA 3CSKA 4KHNA 3N4PA 2A0FB 3QIPB 5B0GA 3OYFA 1X4FA 3ZT4A 1ZBIA 3CXCM 2LU1A 3T1HJ 4JWMA 4YR3A 4B1ZA 4JK9A 4YMOA 1I1GA 1J5EJ 3PJXA 5J2JA 4PWUA 4GKJK 3MUTP 2NXCA 4RUAA 2XI3A 1RKJA 4USVA 4A48A 5L46A 3P8BB 2K8GA 3QMQA 2VGNA 1S12A 3NCPA 2JJ4D 1N5YB 1TKTB 2UUWA 1Y4ZB 3UCGA 3NVWA 4JHDA 1EKEA 3JS9A 3W3SA 1LXJA 2VFRA 1QQ5A 4FLVA 2UXDF 2DNPA 3AXMA 4JI4K 2KL8A 4ED8A 1PG5B 1IBMJ 3MGIA 4K2JA 5J2EA 3CE8A 3M9OB 3PACA 2DHXA 1XO0A 2AIRB 3MEGB 5JLHA 3L6QA 2EAOA 4P72A 1VBYA 3GSDA 1QUVA 4UBBA 1GOBA 5KFDA 4BC5A 5LSLA 3C15B 1IJJA 3BQ7A 5AK6A 3N4MB 4E8UA 5GIPA 1VQ9S 3FYHA 2Y0BB 4CEBA 3HVAA 3W5ZA 3Q7BA 1MC8A 5K20B 4MLHA 1ZRNA 2AXTU 2FC9A 5HMZA 4FJNA 1WBDA 5B08A 3MMCA 2UUTA 2VPXB 3HPGA 3KZBA 4K41A 5CHGA 2ZTCA 5CJ7A 2VKZG 3T9ZA 3I0RA 1BVSA 2UUAF 4XTTA 3TAMB 3OJUA 4K5SA 2AD9A 2ZBIA 3LUYA 5CH7B 4PQUA 2Q3SA 4KLLA 4I2PB 4KAZA 4U9RA 5AT1B 2PZSA 3G6EN 3JAMO 4CGFA 4A8XA 4M5JA 4Z7CA 1KQSM 5KGXA 1ICEB 3CG7A 4KHYA 4S0MA 1ZOLA 2E88A 3BF1A 4M9LA 4P0PB 2BOPA 2L08A 3KZIU 5DZ7A 4OZ2A 1HUOA 3HRDD 3H1QA 5DMRA 5AKYA 4PHEA 5KFAA 4CF5A 2C2ZB 1S9GA 2O3DA 4JKDA 5G4DA 2LLZA 1VQMN 3NVYA 1T9UA 5E33A 4WKRA 5KG3A 4H8KA 3UXOA 4M5IA 2UVRA 8ICQA 4Z37A 3C14B 2Y9HA 1VLOA 2BACA 5AQGA 4CGDA 2V94A 3QJPA 4FJ5A 3SSRA 2WF5A 5AIAA 3DLGB 2X74A 3NDKA 4DV1K 3WU2U 4M9GA 5JMNA 8ICFA 2O6KA 1SJQA 2OD4A 5KG2A 2DGWA 2QA2A 4CRJA 1N60A 1ZQIA 5KQ8A 2LMRA 2RT3A 2K7KA 3NF6A 3FZ2A 2VKQA 3U3YA 2XCPA 1Z6RA 3LW5C 1CVJA 2KHOA 3OYAA 1Q3VA 4NZ6A 1C20A 1NJXA 2C2DA 1RT4A 2RAQA 5KFXA 5KFHA 9ICTA 1SXLA 1X7VA 4FPIA 3FEYB 1NM2A 2ZOMA 4YVZA 3M2VA 3SUNA 2D3ZA 3PM9A 2EFQA 5KFGA 2EH9A 3SPZA 3DGVA 2KD1A 1N5XA 1KAXA 1KWMA 4I1TA 2KI2A 3JSMB 5GAHI 1M5SA 3S6JA 2U2FA 5ALDA 3ZZ0A 1I3OB 3OW2M 2F76X 2POKA 1LV5A 3T1HF 3BGUA 3Q2SC 4XAKA 2A3JA 2HPUA 1FNMA 2H5IB 1JLEB 5DB9A 4ISGA 4EHTA 1LB2B 2J6TA 2D41A 1Q5VA 2HFVA 3EGZA 4MIBA 3QYPA 1JALA 1EO1A 3HSTB 4HACA 2P2CB 3D2EB 4MMOA 2NS1B 3MOZA 2K8BB 1MA7A 3I0SB 1RBTA 3C2MA 4BR7A 4JI5J 4H4OB 3LP0A 5DDRC 3MHYA 2Q2RA 4PG6A 2K4IA 1O6XA 1U2VA 1U4BA 2R7YA 1EKRA 4A46A 3TEHB 1IR0A 1H2VZ 3HHLB 4WQ4C 4BRGA 9ICJA 3AUOA 2HQDA 2XB2D 2ZHAA 4P2HA 1IJEB 5AI0A 3SCKE 2QXLA 2OPSA 4Y34A 3SUOA 4ED7A 2P9NA 4FJ7A 4WP9A 1ZBSA 2E2QA 3SV3A 3SDEB 2XLKA 1RDFA 2G0AA 2IM3A 1NBWA 1CULB 2VV5A 1YSJA 5ALPA 1M1HA 3TSQA 2BQRA 4WYWA 4FLWA 9ICGA 4CI6A 2VB6A 1HYVA 1SXDA 1U8WA 1DK2A 3SZ2A 4UAVA 4HI1A 2CPYA 2AP6A 3G82B 4C3LA 4BREA 4IFVA 3MCMA 3LGHA 4C4RA 3IRXB 4FKXA 3KTQA 1CC7A 1EETB 2CPEA 2IA0A 3UKRB 1NB2A 3J7A1 5IWAK 1LKYA 3G4SS 2VOOA 1DHMA 1YF5L 2JVRA 3HWTA 1WB9A 3C65A 3BBBA 2H5XA 2ZM6J 5AM1A 2KG1A 2KW4A 3V4IB 2HAFA 2X51A 4RW6A 2OUGA 5HVGA 4KGZB 1Z4UA 3WK6A 4KR0B 1BL3A 3K5LA 4KV8B 2E1EA 1VRUA 4IH6A 2YKMA 1JQGA 4KGKA 4JLHA 2MHEA 2NRRA 3O9QA 1GFWB 1CXUA 5C7PA 3NNCA 1VQ5N 3R8YA 4J9VA 4FJHA 2QXFA 2ALZA 4M0AA 3TEGA 4IQMA 4ELTA 4NX9A 1CEZA 1NGIA 2ALYB 3KHHA 4UOCA 3QX7A 3HKZC 2YHBA 5M1OA 4QZAA 1WHWA 3OTOF 3D6HB 3OYGA 3TNVA 1BA1A 2RHFA 4NASA 3HPHA 4O5CA 4KLEA 4RNOA 2DIVA 1UVNA 3GU3A 2R2RA 2VJUA 2P66A 2FB0A 4K4ZA 1YJ7A 4DV4J 1RBAA 3HVWA 3ISDA 3HSCA 1SJ4P 1PUZA 3LPEA 4DPTA 5AKXA 3TSUA 2GHWA 1EWQA 3M6GA 4DL6A 1KKHA 2MQ8A 1RABB 2PXIA 3OR2A 2C1EB 3KLEA 3WK4A 2BJ3A 2JEJA 2ZH4A 6FD1A 4OX9J 1Z3EB 3G8QA 3CF5Q 4ID8A 5DDYA 3VF4A 3BGRB 3CJBA 1LKZA 3PMLA 2V63A 1MMDA 3BGLA 4IOBA 1VQ6S 4I2IA 1EX8A 5D6GA 2F4VK 1BI4A 2BE7D 1E6VA 5HLFB 2GHPA 4GMKA 4Q7AA 4NXMF 3D2FB 3FZLA 3CF5L 3WX8A 1TUVA 3OYNA 4DR3J 1Q9YA 3OVNA 4NV0A 2VF3A 4J9MA 2GOLA 1DARA 5JS1A 1U1LA 1NSPA 2ZDPA 1NHKL 5FPDA 4W5RA 1AT1B 4PHDA 2Z2LA 4RBUA 3RGIA 1U1MA 2Z7JA 1U7LA 3R9PA 2XNQA 3FCWA 1ZQXA 2B7BB 4FZVA 2UXBK 4OHYA 4O4GA 2K4PA 4H0OA 3VQBA 2DWQA 4CNQA 1BPDA 2A2DA 1CRXA 3K5NA 3ULEA 4WBFA 1DQ8A 1HX1A 2CQ2A 3UFCX 1JN3A 1N6QB 3FR0A 1U0HA 3HSDA 1MWMA 1QSLA 1HPZA 1M90T 3N01A 4AUKA 1RTDA 5KT4A 4LFBJ 3CCUS 3ZZOA 2U1AA 2NO4A 2HF3A 4P4PA 2V67A 2XIDA 2Y0SC 3RB3A 2XMMA 2VA8A 4PHAA 2CPRA 2KMDA 4JD2B 4IG3B 3G6YA 4HAIA 4FXVA 4NLOA 3W1YC 3DLEB 3H0LB 4DUYF 4M41A 1D4XA 2IOCA 2IMWP 2R7WA 1JJ2M 4DR6J 2FDNA 2FJVA 1VAZA 4YG2A 3DMJB 2IPOB 1S0OA 1HA1A 3B78A 3QATA 3ILLA 3KG4A 1NZ8A 4MH8A 4J90A 4CZKA 1HR0K 4Y2QA 3FRZA 2OYYA 3KK2B 4ZN1A 4WIIA 1MG7A 1U02A 4O3RA 4UAUA 5JXSA 4NRTA 2VFUA 2AV5A 4BR0A 1YVNA 1JKHA 3UVJA 2XHWA 5IIKA 4XIUA 1WEZA 3H25A 4XDCA 2MZ1A 2M70A 1N62A 3M05A 3UN3A 3ALYA 5AQZA 1GX6A 4DR7K 2E8AA 3HL8A 1OH6A 2FBTA 4Z94A 2BKEA 3D6FB 3SQIA 5MLCV 3LO3A 2NSCA 2JH1A 3Q8RB 2KSOB 4KN7A 4OCZA 2KHDA 4AE5A 9RUBA 3B6OA 2EDUA 1W25A 2KVQE 3ZX0A 4OIXA 4USHA 3HD1A 4J37A 1C0MA 4LF9F 1VQPS 1GO3F 1M0SA 3ZD8A 4DFKA 2WF6A 3DXMA 2QTDA 1DLOB 4B3MK 3BEXA 3VQEA 5BRDA 4BX9C 3EICA 2QSFA 4I2QB 5ETSA 2E5GA 2G09A 1FJGJ 1JL1A 3AGKA 1WSEA 3LF0A 2RN2A 3ZDBA 1SIJA 3E1YA 1F6TA 4QYZK 4C11B 3D2NA 4NXNJ 3FBFA 2AJ0A 2HCFA 3NH2A 2C3OA 1WI6A 3EE9A 3MBYA 3MECA 1SL0A 5M1PA 3MM6B 3B0YA 2F8MA 2W03A 3OR1A 2VH7A 1V3SA 4TSXA 1NZPA 4C23A 3EXCX 2AWZA 4DV7J 2WB1F 4O8KA 3IO1A 1IBKK 2V4QA 2AJQA 3S3MA 3OL7A 4P2MA 4M5MA 1H6KX 1YJRA 1VIOA 3GDQA 3MN6A 3H7HB 2F9JA 3AVIA 1LWEB 5KFNA 4U95A 4Z6FA 3SMVA 2DNLA 3TQ1A 1JCGA 3T7ZA 1ROFA 1CS4B 4CEFA 4HKQA 2A1SA 4RQ7A 1RHUB 4RQNA 3ICLA 2BJ9A 2M5YA 4NCGB 1C2PA 1RB0A 3V9XA 3VGTA 1FEEA 3AQOA 4IO1A 4KKOA 4ZLPA 1HL6A 1R8BA 1U6FA 1H72C 4KH4A 2QI2A 3QIPA 4NM2A 5KNIA 3DNCA 3NXZA 3FSXA 2YX6A 1N54B 4NYOA 1V3ZA 4IDKB 3TW0A 2E1YA 2I7NA 2ZOGA 3MFHA 4H4MB 2I7PA 4R66A 2XGQA 2K60A 5C0YA 2CIMA 1WC3A 2X3GA 2O66A 3TA2A 5AQHA 3CO0P 3OV7A 5HJYA 4MF8A 3VN5A 5HJXA 4O44B 3DV9A 4M04A 4MF2A 1TKTA 1N5YA 2Z1GA 3C6AA 4PZOA 3FFKB 3BPDA 2E8MA 1RCOB 4KPYA 4LFBF 3KWGA 2HQ3A 4JI0J 4QZFA 5LJ3Y 1OQ3A 1KDHA 3I5AA 1NMDA 5AQXA 2KRBA 3QIOA 1GOCA 1SVDA 1CG2A 2V2KA 4M5HA 3O9SA 2KJVA 3RB0A 4X66J 3CC2N 2KXFA 3NGSA 2IDLA 5H9FK 3MEGA 1DRGA 3VVTA 1LEOA 2AH5A 9ICIA 4YCXA 4MT1A 2P9UB 4LQ9A 3SNNA 2DL0A 1HWKA 4J9LA 4DS4A 3K5PA 1D9DA 3C15A 2Z1HA 1Q8LA 2E7WA 2YY3A 2HZCA 1L3KA 2B21A 4DTXA 9ICFA 3AJ2A 4PZNA 1UAWA 1V9OA 3H3OB 2LEPA 3NGIA 4BQLA 3W0LA 2E5LJ 2P1JA 3TAMA 3ENHA 4HDHA 3R2DJ 4RQ4A 4OHXA 3U26A 2BMBA 2V34A 5BN9A 4RQ2A 1YG0A 4I2PA 2VQFJ 4AQYK 1FD8A 1PBAA 3B4MA 1ZBFA 1TAUA 2XC9A 2ROGA 1VLBA 4MFFA 3AN1A 4EZ9A 2BXJA 1ZXOA 4JV1A 2GVZB 4MK7A 2C2NA 3C66A 3MGVA 1E6YB 2HFNA 2XRIA 1XNQJ 4P0PA 4F5NA 4HT7A 4L73A 1YRXA 1BUPA 2VGMA 3EZWA 2CWKA 4BDYA 3ZT1A 3MX2A 3ZT3A 4YB7A 1R6YA 4F3QA 4CEEA 3KLIB 1C0TB 1R6VA 4LVSA 4J9PA 1SWWA 2HQGA 2VFTA 2FHJD 2ZKTA 2ISOA 2W2PP 3C14A 2VD3A 3CCQS 3L2WA 3U1LA 3JS6A 1FJGF 4R25A 3G8SA 4HUGA 2B4JA 3CPWR 3IAS9 5CHCB 3DLGA 3D6MB 3AT1B 8ICKA 4QWEA 1TL1B 4JI4F 2GW8A 3HKZF 1X9SA 1ZQ1C 3V6JA 2W2NP 2EEYA 4USUA 4MKAA 4USIA 4KIAA 4DV7F 3VF2A 4JV5K 2A41A 1DTTB 1RYUA 1ZQAA 4PRFA 3MCPA 4FOIA 4DTNA 2Q3PA 2GIFA 4A8OA 4LFCK 5ALEA 2G8HA 4H4KC 1XN9A 2Q43A 4NLQA 3DEEA 4FF4A 1UVKA 3HI0A 1FXLA 3MWPA 1JUDA 1S57A 3M30A 2L41A 4O3MA 1IKYB 1UPMB 1X5SA 2KH9A 4NZ7A 1BDGA 1UEVA 3O4NA 5C5JA 5CRXA 3ISNC 4EGLA 1QAJA 2Z1IA 3BGFA 3A4TA 3JSMA 4CZMA 2XG8A 3DXSX 1EXNA 1GOAA 3MFIA 1M5OC 4I67A 3FUYA 4TY9A 2W43A 3N79A 5IS2A 4DV6J 3O3LA 4DDFA 2HBJA 3QGIA 3OD2A 1JLEA 1Q5YA 5LMNK 3K17A 3PYEA 3WXMB 3NGUA 3HF5A 3W65A 4OJ1A 2N7CA 3F9MA 3NF8A 4DB3A 2PGCA 2KHQA 3S6EA 3D2EA 3D1HA 3P5JA 3I0SA 5EU7A 4NE9C 5IFMA 4H4OA 2J0SD 2MSTA 4DCJB 1XERA 3N7PD 1VQ4S 2QZ8A 1RWWB 1DGJA 3KLVA 3UI3A 2FQQB 2VKRA 3GIJA 4PJ0U 3HHLA 2HF4A 5ALVA 3EE8A 1Q8IA 4L3NA 2XCAA 3PFOA 3R7SB 2A10A 2OIHA 1RCXB 2KP7A 4DV1F 3HXMA 3F2KA 4HDGA 2GFFA 3DRRB 1HYSB 3UPFA 1DTQB 4DEZA 4DUZK 3SDEA 4CECA 2G8VA 1CULA 1HUXA 2ZJ8A 1VSHA 2G1DA 2VC1A 3SSQA 3QGHA 2ZIWB 3QYYA 2K06A 2HHHK 4JKEA 3HSZA 2Y0SF 3WT0A 3G82A 5KOXA 4FWQA 3IRXA 3SLCA 1YT3A 1EETA 1BCMA 2H54B 3G71N 1U24A 3UKRA 4MHVA 4LFAK 4AHSA 2K3IA 4CJ4A 3I32A 4KH6A 1HNWJ 2IY5B 3H45C 5E41A 2WAQC 3CUNA 1IV0A 3V4IA 2XGPA 2NYIA 5GAEU 5JICA 1RT5B 4UB3A 2BQ3A 4MFBB 3MTKA 3BKTA 3F9KA 1NI3A 1I94J 3SMZA 4KV8A 4X65J 2DHHA 1SL2A 1BHNA 3RMAA 4FK0A 1UA1A 2ZITA 4B3RJ 1BUXA 2V6AA 3BO2A 2EFOA 2MZTA 2P9EA 4PXDA 2XY8A 2ASJA 4BWJA 3QFWA 3VGKA 4OJOA 2MGZB 5HMYA 4CLWA 3V2UC 1GMWA 1RU1A 1KCFA 5CYQB 1BQMB 1GK8A 4M45A 2A6OA 2FPKA 1KEJA 4ZIWA 4PL8A 4RW4B 4CJSA 3ET6B 3VGVA 2QLWA 4XPEA 5EGYA 3AA4A 1HJRA 2WB1D 1X66A 4LSLB 3NCIA 4P73A 1NGEA 2XVTA 2ASPA 5LMUJ 5AQVA 4M3XA 1ZAVA 4DJBA 4F5PA 3CCWA 2CQGA 2AGPA 3SBTA 5D4PA 1T3QA 2B7CB 3HULA 3FM9A 3L4BC 3H1VX 4NLVA 1TYQA 3SCXA 1ITGA 1RPLA 2K4HA 4CM2A 2IRYA 4KN4A 2ZF5O 4OQJA 4AL7A 1OH7A 4BACA 1RCHA 4I2BA 1UW9A 2FF3B 3BGRA 3VESA 4O0JA 1LWFB 4DBQA 8ICEA 3IBFB 2ACYA 3AOBA 7ICJA 2IIHA 4AL6A 2HFSA 3AQPA 1N4LA 5L9XA 5IWAF 3LDLA 3KLFB 4ECQA 3C2KA 4Y2IA 5HLFA 3OBWA 2VWBA 3D2FA 1NJZA 2PMZC 5IV3A 3FZHA 4K8RA 4B1XB 1Y3JA 3CCSS 2LQBA 4B1UB 1RBVA 1DAXA 3TO8A 4RTFD 2CJ9A 4NMXA 2KJ8A 1X4AA 2CQDA 3PX6A 4ZVSB 5H1SQ 2HBYB 1URJA 7ICLA 2EZYA 2HOIA 1YXQA 1U48A 3PKMA 2HG4A 3HO1A 3IXQA 3OTQA 3SUPA 5E3PA 1FA0A 2BBEA 4ZPDA 4LRCA 3M1FA 3KXDA 1WOPA 3VEXA 2XMAA 2P5VA 1KAZA 4ZA1A 3KIOA 3A0IX 4NLCA 4ED1A 4FCYA 2B4OA 4ID5B 1N6QA 1PCAA 4CJTA 3Q8YA 5B8HA 2G08A 4AL5A 4FYDA 1V5VA 3AVMA 3CD6N 2LBOA 1KTVA 3AJ1A 2HBZB 2WCXA 4I2HA 1Y10A 3THPA 2UUBK 3QSYB 2FUG9 3OBYA 2VBXA 1ZD2P 3CJAA 3NRWA 2RIJA 3JSBA 4K7QA 1UWBB 4JD2A 4MJKA 4IG3A 2YTCA 2Q97A 3DLEA 3I9ZA 4ZTFA 2IVMA 1PIEA 1F2HA 2IFXA 2JL9A 2NRXA 2RMLA 1XR5A 4DV5J 1HNWF 3DMJA 1K0TA 1NK4A 3DXBA 1BPZA 3D6JA 3IG8A 4QR0A 1APSA 5D0EA 2CDRB 4YMMA 2GO8A 2KICA 3QJJA 1WKLA 7ICNA 4GO5X 3U3GA 2E2PA 2ACMA 3KK2A 2F4VF 1I94F 4DX6A 3BKFA 4I4BA 4B3RF 2L3MA 1VHXA 2EI5A 3H8JA 1UQVA 1CQNA