1U9LA

Structural basis for a nusa- protein n interaction
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
AHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Transcription elongation protein nusA
publication title Structural basis for the interaction of Escherichia coli NusA with protein N of phage lambda
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u9lA00
1CEZA 3ZDCA 3RAXA 4B9MA 4F4WA 4DL7A 3HW8A 2AJQA 5DBBA 2BCUA 8ICJA 3M9MB 2C2DA 9ICIA 1L3SA 5KG1A 2I1QA 4J9RA 2BQ3A 4M9GA 5DBAA 3PW5A 5D4BA 4IQWA 4DSKA 5KFKA 5L1JA 3TARA 4FS2A 4F2RA 8ICPA 7ICOA 4M47A 1EXNA 3TAPA 3K75D 3JPTA 4ECZA 4EZ9A 3RJKA 1BGXT 5HMMA 1L3UA 4F4YA 4JK1A 4F93B 4ECXA 4DLGA 3PR4A 3SI8A 5J2AA 2DFLA 2NRWA 9ICMA 2A1JB 2JZBB 2ALZA 2W8KA 1B22A 1KRPA 4BWMA 1NJXA 2PFPA 4RQ1A 3UQ0A 9ICSA 1ZQYA 1SL2A 4ECQA 2FMPA 4EEYA 1XSLA 5BOMA 2J6SA 5KFOA 4M04A 9ICTA 2ZJ5A 5J0WA 2Q0ZX 8ICGA 1ZQGA 3V7KA 9ICPA 4R8UB 4IR1A 4F2SA 9ICRA 4YXJA 1HJPA 1TK5A 1WCNA 4ED8A 2JEFA 5KFQA 5EWEA 4DFPA 3PY8A 5KFFA 4YR2A 3E2EA 5HNKA 1MQ3A 5KG7A 4F5QA 1ZQPA 8ICHA 2GWSA 5KFCA 4O3SA 5KFZA 3GIMA 4KITB 3TFRA 2AQ4A 3ZD9A 3Q8LA 3TQ1A 3MDAA 4BWJA 2HVHA 3N97B 4RNOA 4CCHA 4RNMA 4KMUA 5HHIA 1XU4A 2A1JA 3MABA 5KFYA 4EYIB 1KLNA 4RQ0A 5KFAA 1ZQTA 2BQUA 3JPPA 4PHDA 2W9BA 3TI0A 4RNNA 2IBKA 2BKEA 3C2KA 4F4ZA 4QWEA 3RB4A 7ICTA 1ZQJA 1U9LA 1V9PA 2MUTB 2W9CB 3RBDA 1U48A 4B9NA 3V72A 3PW4A 4B9SA 8ICUA 7ICUA 3H40A 3EW9A 2BCRA 4DF8A 7ICGA 4KLHA 8ICAA 5KFGA 4J9NA 4KLGA 3C23A 4LZGA 2AU0A 5L1KA 5KT5A 2XCPA 4EYHB 5IINA 3HT3A 4M9HA 1KTQA 5DQGA 9ICKA 3MDCA 5J2BA 1U4BA 1KFDA 1XSNA 2IHMA 5J0PA 3HX0A 4DFJA 3BDPA 1NK9A 3KTQA 4RPZA 4IRKA 2V4RA 3GIKA 1L3VA 4KLMA 4Q8EA 8ICLA 2FPLA 3IM1A 4XQ8A 2PI5A 4K4GA 7ICJA 3PR5B 4ECTA 4LVSA 9ICBA 4DQPA 5J29A 2C22A 3ISBA 3K4GA 4F3OA 1QTMA 5CR0A 1A77A 5BOLA 2C2RA 3M8SA 1NJWA 5DB7A 2ASJA 9ICXA 2MUTA 2FLPA 4ED1A 2UVRA 1BPBA 5J0YA 4DOCA 3IHQB 3GIJA 4F5PA 4ED7A 4GXIA 4NLZA 3GV8B 2UVVA 4BDPA 8ICIA 1NJYA 4YCXA 4QWCA 2RDJA 5KFRA 1U45A 4F8RA 4I27A 3C5GA 1SL0A 1BPZA 1ZQWA 3OHAA 3PX4A 4I29A 2W9AA 3AU2A 4YMMA 3HP6A 1ZYQA 5KFMA 5DDMA 4J9QA 1JXLA 1RYSA 4ECRA 3RJJA 4F92B 3RRGA 5J2JA 4R65A 3EPGA 1NJZA 5KFHA 1MQ2A 3ORYA 3NTUA 2KZ3A 2HHSA 4DLEA 3V7JA 3T5JA 2WTFA 4LZDA 1ZQEA 2KTQA 2KFNA 4DEZA 3OSPA 4IR9A 2ZUBA 5TZVA 1SKRA 9ICWA 9ICAA 1NK4A 1NKEA 3HPOA 3BQ1A 4MF2A 3C2LA 3V6KA 2R8GA 8ICKA 4M9LA 2VA3A 3BQ2A 2VANA 5KG5A 3B0YA 3V6HA 8ICTA 9ICCA 3GV7B 8ICVA 1S0MA 3EZ5A 3ISDA 5D49A 3LWLA 2BCVA 3M8RA 2LYHA 3SYZA 4KN7A 4UAZA 4ELTA 9ICFA 5F9NA 5DLFA 3RJIA 4DFMA 5KFVA 9ICVA 4ELVA 1KDHA 1D8YA 3JPSA 3RJFA 3C1ZA 3H8SA 3PNCA 2ZJAA 1X9WA 1S0OA 2P6RA 4I2JA 5KFJA 4DL5A 4KLDA 1T4GA 1T8EA 1XC9A 1TK8A 1ZQQA 4JUZA 2FMQA 4Z6FA 4TQSA 7ICKA 3MBYA 4ED2A 5DG9A 4UAWA 2F1JA 2B21A 1UA0A 1ZJMA 2I9GA 2V9WA 5DQIA 4J9LA 4J9MA 1TFRA 3UXOA 4F5OA 3PX6A 1X9MA 2NRVA 5J0QA 4UQGA 3RBEA 3Q8KA 4I2CA 3PO4A 4I2EA 4X5VA 5CB1A 5DB6A 4P4PA 4GXKA 4DQSA 4DQQA 1SZPA 4I2FA 4QZ8A 5KTQA 2HHTA 1D8LA 2W9BB 4O5EA 4DWIA 3Q8SB 5IIKA 3ISCA 4NM1A 3SV4A 2HHVA 1IM4A 3RRHA 4M9JA 4P4MA 4MFCA 8ICXA 2BGWA 3RB0A 2ZTDA 2MAXA 4YMNA 5CJ7A 4TURA 4F50A 4IRDA 1ZQIA 4M2YA 4PGQA 5CA7A 4QZIA 4PGXA 4BGDA 4P2HA 4RPYA 4GC7A 1SKSA 3ZDBA 1S97A 4KLIA 4BXOB 4QW8A 5KT2A 2XCAA 4M0AA 8ICNA 2JEIA 9ICOA 7ICQA 4B9LA 2PXIA 4PH5A 9ICQA 1QSLA 2OWOA 2PI4A 4FO6A 1S0VA 2BCSA 4DSIA 2ZTCA 3UPQA 8ICOA 4Q43A 3KHRA 4DS5A 9ICEA 2P66A 1BPDA 1ZQFA 5DDYA 5J2EA 5J0TA 5KFXA 3TANA 4M6WB 4O0IA 3EWAA 5HMLA 2ZTEA 3BJYA 3ETLA 3H4BA 4DQIA 4J9OA 2ASLA 1S0NA 1C7YA 1NOMA 7ICMA 2W8LA 4R66A 4DQRA 1K1SA 4RQ4A 4J9KA 3BQTA 1S10A 1NK0A 7ICSA 5KG4A 3MFHA 4PGYA 3AUOA 4I28A 5J0OA 3MGIA 4KLOA 8ICQA 2AQ0A 4YQWA 5KG0A 4UAYA 3OSNA 1HUZA 4EBDA 4BXOA 2XGPA 2KFZA 5KG6A 5DG8A 2HHXA 4ECWA 5J2GA 4TUQA 4B9TA 1Z00A 4RT3A 4Z6DA 3B0XA 4JWNA 2Y1IA 4DL4A 4M9NA 2ZJ8A 4QZHA 4UB1A 2M9NA 2ATLA 4YMOA 1LV5A 5DG7A 1D9FA 3JPNA 3GIIA 3MFIA 4M6WA 2C2EA 3EPIA 5DLGA 1QSSA 2H5XA 4KLTA 1XWLA 1NKCA 5EWFA 3N4MB 1X2IA 4O3PA 4RQ2A 4O3OA 3TFSA 3GFKB 1TAQA 3JPQA 1ZQAA 3PO5A 2BDPA 7ICHA 1NK5A 4YN4A 5KT4A 4YD2A 5EOZA 1L3TA 2F1IA 4QZFA 4IQTA 4MEXA 7ICVA 1DOQA 5CWRA 1ZJNA 5J0RA 4GXJA 3RJHA 4B9VA 4RPXA 4RZRA 3KHLA 2XY5A 4MF8A 3QE9Y 3G6YA 2BR0A 1ZQUA 1ZQCA 1UT8A 5J0UA 3RTVA 5J2KA 4DS4A 5F9LA 3UXPA 5HHHA 3G6XA 3Q8MA 3RR7A 3MR5A 2IMWP 4ZH4A 5KT3A 1KFTA 1S9FA 8ICCA 5D46A 3H8WA 1RZTA 4NLKA 4DSJA 1S76D 1QLNA 4UB4A 4UB2A 5C5JA 1L5UA 4YFKA 4EZ6A 1JX4A 5KFWA 7ICRA 3V7LA 4YVZA 4TUPA 5DGBA 3EYZA 4KLSA 4JV0A 2IA6A 4KLJA 1BPXA 4F4KA 9ICGA 5CHGA 4ED0A 4QW9A 2XC9A 3QEAZ 4KLQA 1MSWD 1NK6A 5KT6A 2FLNA 3RJGA 4UB3A 7ICNA 4DSFA 5J0XA 2VA2A 3QZ8A 3ZDEA 3RH5A 4DL6A 4KTQA 4KLLA 3PW2A 2FMSA 2ZUCA 2BCQA 3C21A 8ICSA 1N56A 3RB6A 2ASDA 2FLLA 4JV1A 2HVIA 4DL3A 2BPCA 5J2DA 5J2IA 4I2HA 3FYHA 1NK8A 2F1HA 3JPRA 3H8JA 4GC6A 3PX0A 9ICHA 9ICUA 2FPMA 1JIHA 1ZQNA 4QZDA 2AGOA 2RDIA 1K1QA 1ZQXA 5L1IA 3ZDAA 5J2CA 4TQRA 1KFSA 2R8KA 1QSYA 8ICMA 2NRZA 3RH4A 3PVXA 5KG2A 1X9SA 4QWDA 4FBTA 4GLXA 4RT2A 4NM2A 3ZDDA 5EWGA 4EBEA 4DFKA 4YXMA 3RAQA 5DB8A 3RR8A 2AGPA 3GDXA 1ZQZA 4O5CA 1NKBA 4UB5A 1U49A 4J9SA 1RXVA 4O3NA 4O9MA 2KZMA 3RH6A 5L1LA 1ZQMA 8ICWA 4DSEA 3NGDA 2VA8A 4ECYA 4NLGA 2ISPA 4YR0A 4B9UA 4MFAA 4DL2A 1D9DA 4I2AA 4XUSA 3BQ0A 3OJUA 4YG2A 5IIMA 3JPOA 3M9NB 4UBCA 4C8NA 4YD1A 4MEYA 2BQRA 3C2MA 9ICLA 1ZQLA 5KT7A 2BPFA 1RYRA 1LB2B 4Q8FA 3T3FA 4FS1A 1ZQBA 4JV2A 8ICRA 4O3QA 1COOA 2XGQA 3PMLA 5DGAA 2PFQA 4F91B 1Z00B 5KFNA 4R63A 1BVSA 3QZ7A 2BPGA 4K4HA 2HHUA 2XO7A 4ELUA 4PHPA 4C8KA 4J9PA 1DGSA 5KFDA 5KFEA 5IIJA 4QZ9A 4G3IA 1S77D 9ICJA 5KFUA 5BPCA 4PHEA 2UVWA 2KN7A 4QZCA 5KFPA 4F5NA 4KLFA 4PPXA 3RB3A 4ED3A 3TAQA 4E0DA 4IRCA 1B43A 3MGHA 5HP4A 2NRTA 3SZ2A 1ZQVA 3H7IA 4EBCA 4RQ6A 1NK7A 4XRHA 1XO1A 4Z6EA 1KEJA 4C8MA 2C28A 1ZQRA 3FDSA 2W9MA 4XA5A 1UA1A 4IQUA 5KFBA 1KSPA 1PZNA 1SKWA 4DO9A 2HW3A 4ECUA 2JZBA 1JMSA 4QWBA 7ICPA 4I2BA 3GV5B 3QEBZ 2FPKA 2HHQA 3UQ2A 1SL1A 2KZZA 1BPYA 2XY7A 4NXZA 8ICEA 1Z3EB 4RUCA 1N48A 4F4XA 1ZQSA 4RQ5A 7ICLA 3SV3A 2DPIA 2JEGA 2R8HA 1JXEA 4YR3A 5IIIA 1H38A 1A76A 5DKWA 4Z6CA 4YP3A 8ICFA 4R8UA 3THVA 4O5KA 2ZUDA 4KLEA 2IHNA 2NRXA 3LDAA 4R64A 4ECSA 2XY6A 1ZQOA 5L9XA 1JN3A 3T5KA 3C1YA 4ECVA 3PMNA 1RPLA 5JUMA 1T7PA 3T5HA 1AROP 7ICFA 2Y1JA 4DSLA 1TV9A 5CP2A 3RJEA 4Q44A 3T5LA 1XS9D 2PFOA 1ZQKA 4I2DA 4KN4A 5IILA 5DBCA 2V4QA 2UVUA 4RQ7A 1TK0A 3ZD8A 1ZQHA 4C8LA 9ICNA 3AU6A 2HHWA 3KHHA 1BPEA 2PFNA 4QZGA 5KFTA 3UXNA 3OGUA 4RQ3A 1IXRA 4QZAA 4DOAA 7ICIA 4K4IA 4QZEA 4UBBA 3V6JA 5KFLA 2W9CA 3Q8RB 3G6VA 4QWAA 1ZQDA 5KG3A 3M9OB 8ICBA 4DOBA 3KHGA 3HWTA 4FBUA 4NY8A 2BHNA 3C5FA 4I2GA 2P6UA 3LK9A 4O3RA 4ED6A 2AGQA 1U47A 1RXWA 3MR2A 7ICEA 1CUKA 3OJSA 2J6TA 1WCLA 4RQ8A 3OHBA 4IQVA 4QZBA 3H4DA 3MR6A 3GILA 1TVAA 4NLNA 3LWMA 4Q45A 1XSPA 4MFFA 4RUAA 4HYKA 3Q8PB 3PW7A 1T3NA 5J2HA 4KLUA 8ICZA 5IIOA 8ICYA 1MC8A 4DF4A 1ZETA 5J0SA 4TUSA 4C8OA 4I2IA 2J6UA 4JWMA 4RU9A 1TAUA 4F5RA 1Y88A 3PW0A 4P4OA 5KFIA 3MR3A 3Q8QB 1TKDA 3PV8A 4PHAA 5KFSA 2ISOA 1HUOA 2JEJA 2DPJA 2R8IA 5DQHA 5J2FA 5DB9A 2R8JA 1UT5A 3GQCA
chains in the Genus database with same CATH superfamily
1N60A 3AN1A 3ZDCA 3RAXA 4B9MA 4DL7A 1YZ7A 2BCUA 5EE3A 3M9MB 2C2DA 1L3SA 3F53A 4J9RA 3PW5A 4F2RA 3TARA 4F72A 3RFAA 5HR7A 2LBOA 4MHVA 3B9JA 3PR4A 1VDVA 3AEVA 2DFLA 2ALZA 4B6JA 4RQ1A 4ECQA 1T3QA 4CF4A 1FIQA 2ZJ5A 5KNIA 2Y0SF 3V7KA 4R8UB 9ICRA 3N7PD 1WCNA 5KFQA 3IG5A 2RLTA 2KK0A 4F5QA 2E8OA 4KITB 3TQ1A 3N97B 4PZNA 4RNMA 1C20A 3F5EA 3IDWA 3KD3A 5HHIA 3MABA 2A1JA 1KLNA 5KFYA 4RQ0A 2BQUA 4FZLA 3TI0A 1N61A 4RNNA 4F4ZA 3S6JA 1DGJA 2MUTB 3WK9A 1U48A 5AK4A 3PW4A 4J03A 2B0CA 2BCRA 4DF8A 5AI5A 7ICGA 2A3VA 2Y9TA 3K1ZA 3R9KA 4M9HA 2H3QA 2KNJA 5B66U 3HX0A 3BDPA 4KLMA 4RPZA 4IRKA 4Q8EA 2HBKA 3WKDA 4XQ8A 7ICJA 3WK8A 1SWWA 2KV2A 2Z7JA 3QNMA 1ZD3A 1Q3UA 5J29A 3ISBA 5K4LA 1BPBA 4ED7A 3F2DA 4NLZA 1KKXA 2RDJA 1U45A 2AHOB 3TACB 2W9AA 2E8PA 3NVWA 2CXYA 4F92B 1NJZA 4FZNA 3ORYA 3NTUA 2KZ3A 4DLEA 4DEZA 3OSPA 5TZVA 2HOIA 1SWVA 2LHTA 3BQ2A 2GH1A 5KG5A 2HMXA 3V6HA 8ICTA 8ICVA 2K8CB 3EZ5A 3ISDA 3LWLA 2BCVA 5AI6A 3F2BA 3SYZA 9ICVA 1KDHA 4UAUA 3H8SA 3PNCA 2ZJAA 4I2JA 1T4GA 4JUZA 4TQSA 1ECWA 2I9GA 1ZJMA 2BDUA 4J9MA 3PX6A 3IN5A 4UQGA 4I2CA 4GXKA 4DQSA 1X6JA 1FEZA 1F5SA 2WB1F 2DUYA 3F5AA 4P0QA 2F76X 3RRHA 4BJQA 3WKEA 2BGWA 2MAXA 4YMNA 5CJ7A 4M2YA 4FE3A 1ZQIA 5CA7A 1B0XA 4PGXA 1S97A 4BXOB 2F77X 2D3DA 2YMLA 9ICOA 4PH5A 3KOOA 3KHRA 2ZG6A 1QQ6A 3IG8A 2KHVA 2P66A 2F8LA 5ALDA 4AP9A 5KFXA 2KVCA 2XVTA 3BJYA 1RDFA 1NOMA 1K1SA 3BQTA 7ICSA 2JXJA 4PGYA 3MGIA 4KLOA 3SEIA 4EBDA 2W54A 3I76A 5KG6A 1N5XA 2HHXA 5J2GA 3QUBA 4JWNA 3TADA 2ZJ8A 2M9NA 3N7SC 1LV5A 5AKXA 4U6PA 2ESEA 3EPIA 5DLGA 2KP7A 3WKCA 3WU2U 4RQ2A 3GFKB 1JALA 1NK5A 4YN4A 1XO0A 2LMRA 3WK6A 4EENA 3KKAC 4GXJA 2BR0A 4MF8A 1ZQUA 1ZQCA 1UT8A 3RTVA 4DS4A 3G6XA 3GU3A 2IMWP 1KFTA 5KT3A 1S9FA 8ICCA 4NLKA 1S76D 5AKIA 4UB4A 1KN5A 3QU7A 3BQ7A 4YFKA 1JX4A 1TE2A 4KLJA 2PMZF 2OEHA 4F4KA 9ICGA 4ED0A 4QW9A 2XC9A 3QEAZ 7ICNA 4UB3A 4DSFA 4A8EA 3QZ8A 2VA2A 4DL6A 4KTQA 2H3ZA 2FMSA 2KKPA 8ICSA 4UASA 3T79A 2FLLA 2HVIA 5J2DA 5J2IA 2F1HA 3PSFA 4GC6A 3NRZA 9ICUA 1K1QA 5L1IA 1N63A 3N28A 5AKLA 5ALLA 5KL8B 2KEYA 3QUQA 4PJ0U 1U49A 3RH6A 2EAPA 2FE9A 5L1LA 2RRDA 8ICWA 4DSEA 3PSTA 1S8OA 4YR0A 2KOBA 4I2AA 5JTIA 4YG2A 5IIMA 1L7PA 3DDHA 5KT7A 3T3FA 4JV2A 2JH7A 3UMCA 1SGGA 4OJLA 2OYYA 5ALKA 5AM5A 4F91B 1Z00B 2HHUA 2BPGA 4ACOA 4ELUA 5KFDA 1HIWA 2KN7A 5KFPA 4PPXA 3RB3A 3LYSA 3TAQA 2NRTA 2FI1A 3H7IA 4EBCA 4RQ6A 1NK7A 4XRHA 1Z4NA 3FDSA 4IQUA 1V85A 2JZBA 1JMSA 2VJ4A 2HHQA 3UQ2A 1SL1A 2YB1A 2FJ6A 4F4XA 4RQ5A 7ICLA 2JV3A 1J2NA 1A76A 8ICFA 2F2AB 4YP3A 1P7DA 3RF9A 2W55A 3LDAA 5AHXA 4ECSA 5L9XA 2KJ5A 3T5KA 3PMNA 3O0FA 1PVPA 4QIWC 2W43A 3T5LA 5GTHU 9ICNA 2NO5A 1TK0A 3D2SA 3KHHA 2PFNA 2YMQA 1DK2A 3UXNA 2EH9A 2W9CA 3Q8RB 3G6VA 2ZIUB 1ZQDA 1UCVA 5KG3A 4FBUA 5AK5A 2BHNA 3LK9A 4ED6A 5JU5A 1ZD2P 3OHBA 4IQVA 3H4DA 1X9XA 3MR6A 4CE6A 1COKA 4Q45A 1XSPA 4RUAA 5AM4A 3Q8PB 1PK1A 3PW7A 2WAQF 4DF4A 2GO7A 2J6UA 2JHDA 4RU9A 1NZBA 1Y88A 5ALUA 2MRLA 5KFIA 3Q8QB 2ISOA 2JEJA 5DQHA 2I1QA 5DB9A 1UT5A 3GQCA 8ICYA 5AKGA 1WG8A 3NVVA 4PL2A 1Z1VA 3L3FX 5D4BA 4DSKA 3NASA 8ICPA 4FS2A 3H0RB 1EXNA 2R18A 5HMMA 1L3UA 4ECXA 9ICMA 5J2AA 2EANA 2A1JB 3KZXA 4NWIA 1B22A 3AM9A 2JR5A 3AQFA 9ICSA 2HCFA 1SL2A 5AI0A 2FMPA 5BOMA 2G06A 5J0WA 1ZQGA 9ICPA 4F2SA 1CRXA 2IOFA 1TK5A 4ED8A 3PY8A 4DFPA 2QB0A 2L5YA 5HNKA 3AQEA 5TISU 3UMGA 5ALTA 4RNOA 1YT3A 4KMUA 2H3FA 3SAFA 1ZQTA 3NVZA 4QNLA 4PHDA 2W9BA 2BKEA 2W7OA 1ZQJA 4O3MA 1DXSA 3RBDA 2HSZA 3V72A 4B9SA 7ICUA 3H40A 4J9NA 4LZGA 1ZOLA 3LVWA 2LM4A 5J0PA 2Y0SC 3KTQA 2V4RA 3GZFA 8ICLA 3IM1A 2PI5A 4K4GA 3OTQA 3PR5B 4BX9C 3C28A 2C22A 2YMPA 1SV0A 1QTMA 5G5GA 4Y2YA 5CR0A 3M8SA 1NJWA 5GTIU 2ASJA 2FLPA 4ED1A 2DWQA 4GXIA 4BDPA 3BS5B 4QWCA 4NL9C 1SL0A 1KW4A 3AU2A 5DDMA 1RYSA 1WYGA 3RRGA 5KFHA 5AK6A 9ICWA 9ICAA 2E8NA 5KAIU 3C2LA 3NS1A 8ICKA 4M9LA 9ICCA 1SXDA 1S0MA 3M8RA 9ICFA 5F9NA 3QUTA 4DFMA 5KFVA 4ELVA 1D8YA 3JPSA 3RJFA 1X9WA 1S0OA 4DL5A 1TK8A 4Z6FA 7ICKA 5DG9A 4UAWA 2V9WA 2E1FA 4C0ZA 4J9LA 2NRVA 5J0QA 3VC8A 1ZRMA 4I2EA 4DQQA 4I2FA 2GOLA 4DWIA 5IIKA 3ISCA 4PZOA 1IM4A 4P4MA 4MFCA 2ZTDA 4F50A 2YX8A 4P2HA 4RPYA 4KLIA 4Y2PA 4QW8A 5KT2A 2XCAA 4B9LA 2OWOA 8ICOA 4FO6A 1J2MA 2DF4B 3LVVA 2H3VA 4US9A 3BZCA 4GFJA 3TANA 1QH9A 4USAA 2K8AA 2ZTEA 4J9OA 1S0NA 7ICMA 2DKXA 1S10A 5KG4A 3MFHA 3AUOA 2AQ0A 5KG0A 2WB1C 4UAYA 1RM6C 3D2NA 5EE9A 4ECWA 4TUQA 4WJ3B 4Z6DA 3E58A 2H3IA 4Y2QA 2ATLA 2KSOB 3JPNA 3GIIA 2YMMA 1F0MA 4M6WA 2C2EA 2OXOA 1XWLA 2HOQA 1NKCA 1ZQAA 4O3PA 4O3OA 2ZXHA 1L3TA 2D8CA 5EOZA 2F1IA 4QZFA 3D2QA 4B9VA 5CWRA 3RJHA 3KHLA 5J2KA 3NVYA 5F9LA 1SB3C 2ES6A 4US8A 2DBYA 2EAMA 5KFWA 4KLSA 1T94A 3H0MB 3QU4A 2FLNA 1BNPA 2KKVA 2IOFK 5J0XA 5AKEA 5KL1B 2KD1A 5HR6A 3OPXA 1OXJA 1N56A 3RB6A 2ASDA 4F71A 2BPCA 3FYHA 2K60A 3H8JA 2ZIXA 4QZDA 2AGOA 3ZDAA 4TQRA 1JRPA 1QSYA 2NRZA 3RH4A 1X9SA 4QWDA 4GLXA 2G09A 4RT2A 5AM3A 2DGZA 4FZMA 4EBEA 4UB5A 1D8BA 1RXVA 3I28A 3A0HU 1ED1A 3CW2C 4O3NA 1QQ5A 1ZQMA 4U7CA 3FC4A 2P35A 2W7PA 5AIAA 4DL2A 2HBMA 3JPOA 3M9NB 4UBCA 4C8NA 1RQLA 1HEKA 2PMZC 3SMVA 3C2MA 1L8OA 4Y2XA 5EE1A 8ICRA 2XGQA 2PFQA 3BS7A 5KFNA 1Q46A 4R63A 4K4HA 1L6NA 2XO7A 4J9PA 4IS7A 5KFEA 4G3IA 1S77D 5KFUA 5HP4A 3MGHA 3SZ2A 2E1EA 4OJOA 1XO1A 1KEJA 2W9MA 1UA1A 3NRWA 1SKWA 4QWBA 5ALQA 3WKAA 3GV5B 3QEBZ 2FPKA 4I2BA 4NXZA 8ICEA 1ZQSA 3SV3A 5ALMA 2JEGA 2R8HA 1JXEA 4R8UA 4O5KA 2ZUDA 1FFVA 2DL0A 4KLEA 2K4IA 3KKAA 2NRXA 3PSPA 1GO3F 2FDRA 2O6KA 3T5HA 4AYBF 3HKZF 4JMUA 3RJEA 2LYAA 5A0LA 4I2DA 2UVUA 1ZQHA 2W11A 3AU6A 2K4EA 1BPEA 4QZGA 1PK1B 2CN1A 3ZI4A 3NUQA 3MGVA 4KX3A 4QZEA 3V6JA 3SD7A 4QWAA 1VLBA 3WKBA 3M9OB 8ICBA 3KHGA 2KE7A 3HWTA 5ALNA 4OJPA 2WHEA 2AGQA 4RQNA 2MU2A 1RXWA 3MR2A 7ICEA 4LJXA 1CUKA 3GILA 1TVAA 4NLNA 1ZD4A 3LWMA 5ALZA 5C0YA 4HYKA 3SR6A 1T3NA 5J2HA 8ICZA 1IIPA 2K8BB 1NNLA 2CPRA 5J0SA 4CRXA 3PW0A 4OJ6A 1TKDA 5ALRA 4PHAA 5KFSA 5IINA 1CEZA 3IP4B 4F4WA 2AJQA 2K4HA 1SV4A 9ICIA 2BQ3A 2QB0B 3DV9A 5AKHA 1ZXIA 2JH1A 7ICOA 3TAPA 2EZYA 1L7OA 3I1YA 3JPTA 4EZ9A 1N5WA 1BGXT 3SI8A 4DLGA 1JROA 5AM2A 2NRWA 3K1RB 1NJXA 4BUGA 4NJ8A 4EEYA 2J6SA 2JGAA 9ICTA 2WAQC 4YXJA 2JEFA 5KFFA 3E2EA 4C80A 5J8YC 5KG7A 8ICHA 5KFCA 4O3SA 5KFZA 1FO4A 3GIMA 3ZD9A 4BWJA 4P0PA 1XU4A 3QU5A 3VCBA 5KFAA 3QX7A 3JPPA 2ZIWB 4QWEA 7ICTA 5ALPA 1U9LA 2AH5A 8ICUA 2EZZA 1M6YA 3EW9A 2EQYA 1TAMA 2YY6A 4KLHA 4KLGA 3C23A 5AIBA 2AU0A 5L1KA 2XCPA 4UW9A 3HT3A 2W04A 3MDCA 2IHMA 1U4BA 3CP8A 1L3VA 2FPLA 3IRUA 1URJA 2I5HA 9ICBA 4DQPA 1LKYB 5DB7A 4NLBA 5ALSA 5J0YA 3D6JA 3IHQB 4F5PA 5AI9A 3GV8B 2UVVA 3CNHA 1LVHA 1NJYA 4YCXA 5KFRA 1BPZA 3OHAA 3HP6A 1ZYQA 1JXLA 4R65A 2HHSA 2HBJA 3V7JA 1ZQEA 4LZDA 2KFNA 2ZUBA 1Z19A 1SKRA 4Y2UA 5G5HA 3BQ1A 3V6KA 2B6GA 1N62A 1KQQA 3MC1A 3B0YA 2W3SA 1OUQA 4KN7A 5ALVA 4UAZA 4ELTA 5DLFA 1A6SA 2KHQA 3C1ZA 3N7RC 3SAGA 5KFJA 5AM0A 4KLDA 1T8EA 1XC9A 4ED2A 2F1JA 1F44A 1UA0A 5DQIA 3C29A 2OCEA 4F5OA 1X9MA 3RBEA 4CGZA 2QLTA 4X5VA 1L7NA 5DB6A 1SZPA 1V97A 2KJ8A 4QZ8A 5KTQA 2HHTA 1D8LA 3L5KA 2OH2A 2WF8A 4NM1A 3SV4A 2HHVA 3H0LB 4M9JA 4UARA 2WFAA 8ICXA 5CEHA 4TURA 4IRDA 1QQ7A 4IC9A 4QZIA 4BGDA 1ZD5A 4GC7A 1AQ6A 2JMGA 2KJ9A 4M0AA 7ICQA 2PXIA 9ICQA 4DSIA 2ZTCA 4Q43A 4DS5A 1NZPA 1UPHA 5DDYA 5J0TA 4QJFB 4Y2VA 4M6WB 4O0IA 4KMOB 3EWAA 3ETLA 3H4BA 2ASLA 1C7YA 3SAHA 4DQRA 5H2FU 4RQ4A 3QUCA 5J0OA 2ZIVA 4YQWA 1Q8KA 3OSNA 1Z1BA 1HUZA 2XGPA 2KFZA 1L8LA 1XNSA 4CF5A 2W03A 1Z00A 4NL9A 2LPEA 4QZHA 4YMOA 5DG7A 2RP5A 5AICA 4PL1A 1OW5A 2KVSA 1Z4OA 1PVQA 3N4MB 1X2IA 2K89A 3PO5A 5AK3A 2BDPA 4OJ5A 4UB8U 1ZJNA 5J0RA 4RPXA 4RZRA 3UM9A 3G6YA 2G5HB 5J0UA 2HBLA 5D46A 2YB4A 4EZ6A 7ICRA 3V7LA 5DGBA 5ALEA 2IA6A 1BPXA 4KLQA 5KT6A 1L7MA 2G08A 3QXGA 3ZDEA 3RH5A 4P0QB 4JB3A 4I2HA 5L1MA 3PZPA 9ICHA 3JPRA 3PX0A 3M6KA 2FPMA 1ZQNA 5J2CA 2R8KA 2ZIUA 3PVXA 2KMDA 2WF6A 4NM2A 4C4TA 5EWGA 4DFKA 4YXMA 5DB8A 3GDXA 4J9SA 2KZMA 4ECYA 1D9DA 3BQ0A 2F8KA 2BQRA 4YD1A 9ICLA 1ZQLA 1BNOA 1RYRA 4Q8FA 4O3QA 1COOA 5DGAA 5JRTA 3SENA 1WUDA 4PHPA 2QARA 4EX6A 5IIJA 2HOFA 9ICJA 4PHEA 5BPCA 4QZCA 4KLFA 4ED3A 5B5EU 2YTUA 4E0DA 4IRCA 1B43A 1ZQVA 2MSNA 2KG5A 4Z6EA 2Q4TA 3F2CA 1ZQRA 2I6XA 4XA5A 5KFBA 1KSPA 2PKEA 2HW3A 2OHFA 2WF5A 2KZZA 1BPYA 5T14A 1KBUA 1Z3EB 2ZXIA 1N48A 2DPIA 5CRXA 4YR3A 1H38A 4Z6CA 4EX7A 3THVA 5ALYA 3M7DA 1ZQOA 3AMZA 2Y9UA 1JN3A 3C1YA 1ZRNA 4ECVA 5AI4A 1RPLA 1T7PA 1AROP 2Y1JA 4DSLA 5CP2A 2VJ5A 4Q44A 2XI9A 1XS9D 1ZQKA 5FP0A 5ALGA 4RQ7A 4C8LA 1IXRA 4DOAA 7ICIA 4K4IA 5KFLA 5AKZA 1FFUA 4NY8A 3C5FA 2KIWA 4I2GA 1U47A 2E8MA 3U26A 1PUZA 5AM1A 2J6TA 4RQ8A 3M6ZA 4NV0A 3IV6A 4G9BA 5IIOA 1MC8A 2LM1A 4TUSA 4C8OA 4I2IA 1WWVA 4AYBC 3HKZC 4F5RA 3UMBA 3MR3A 3A0BU 3BS5A 3KFUF 2R8IA 2R8JA 2RHFA 1X6IA 4C7ZA 1KL9A 3HW8A 4OO1J 5DBBA 8ICJA 3BZKA 5KG1A 5ALFA 4M9GA 5DBAA 4IQWA 1A0PA 2LYBA 5KFKA 5L1JA 2RQ5A 4M47A 3TKAA 3K75D 4ECZA 4RQMA 3RJKA 3DEEA 4F4YA 4JK1A 4F93B 3WK5A 4P0PB 1N2XA 2JZBB 2W8KA 1KRPA 4BWMA 2PFPA 3UQ0A 1ZQYA 1IV8A 1JI7A 1XSLA 2EAOA 5AI8A 5KFOA 4M04A 2Q0ZX 2YN4A 8ICGA 4IR1A 4DFDA 1PK3A 1HJPA 1JUDA 5EWEA 4YR2A 1WWUA 1MQ3A 2HI0A 1ZQPA 2GWSA 1UQVA 4UATA 3TFRA 2AQ4A 3Q8LA 3MDAA 2HVHA 5ALJA 4CCHA 4EYIB 2IBKA 5AKKA 3C2KA 3RB4A 1V9PA 2ODGA 2W9CB 4B9NA 3FAHA 3HILA 1CI4A 2NO4A 8ICAA 5KFGA 5KT5A 4EYHB 5ALOA 1KTQA 5DQGA 9ICKA 2JRZA 5J2BA 1KFDA 1XSNA 4DFJA 1NK9A 3GIKA 4FFDA 4C7YA 1J97A 4ECTA 4LVSA 4F3OA 3K4GA 2G0AA 2XICA 1A77A 5BOLA 2C2RA 3ICXA 3SQIA 9ICXA 2MUTA 2DKZA 2UVRA 2LKYA 4DOCA 3GIJA 3TADC 8ICIA 4F8RA 4I27A 3C5GA 1ZQWA 4DCCA 3PX4A 4I29A 1Q3VA 4YMMA 5KFMA 2VKQA 1RYUA 4J9QA 2F3NA 4ECRA 3RJJA 5J2JA 3EPGA 1MQ2A 1IG6A 3T5JA 2WTFA 2KTQA 4IR9A 1NK4A 1NKEA 2KSOA 3HPOA 4MF2A 2R8GA 2VA3A 2VANA 1PVRA 3GV7B 3CRXA 1DK3A 2E3TA 5D49A 4Y2TA 1B4FA 2LYHA 3RJIA 3QU9A 2D6FC 5EE0A 4Y2SA 2P6RA 2F44A 2FMQA 1ZQQA 1X66A 3MBYA 4C4RA 3EUB2 2B21A 5AKYA 2W3RA 5F3XB 1TFRA 2N1RA 3UXOA 3Q8KA 3PO4A 5CB1A 4P4PA 2LI6A 4CDGA 2W9BB 5J8YA 4O5EA 3Q8SB 4HAIA 3RB0A 4PGQA 2ZIVB 2A1AA 2OM6A 1SKSA 3ZDBA 3PSIA 2KIVA 2QKQA 8ICNA 2JEIA 1QSLA 2PI4A 1S0VA 2BCSA 3UPQA 1NI3A 4Y2RA 9ICEA 1BPDA 1ZQFA 5J2EA 5HMLA 3H8MA 4DQIA 2W8LA 4R66A 4C4SA 1NK0A 5E79U 4J9KA 3CYMA 2KICA 1SZHA 4I28A 8ICQA 3AL0B 2G07A 4BXOA 1VJ5A 2NV3A 5DG8A 4B9TA 4RT3A 3B0XA 2Y1IA 4DL4A 3ALRA 4ZOHC 4M9NA 4UB1A 1D9FA 1YZ6A 3MFIA 1QSSA 2H5XA 4KLTA 5EWFA 1ZQ1C 3TFSA 1TAQA 3JPQA 7ICHA 5KT4A 4YD2A 4IQTA 4MEXA 7ICVA 1DOQA 5ALHA 3ETRA 3QE9Y 2XY5A 3QU2A 2WF7A 3UXPA 3L4PA 5HHHA 3Q8MA 3RR7A 3KBBA 4UAVA 4EELA 3MR5A 4ZH4A 2HDOA 2YQEA 2WF9A 3H8WA 1RZTA 4DSJA 1QLNA 2E5SA 5ALIA 5C5JA 4UB2A 1L5UA 2EZXA 4TUPA 4YVZA 3FM9A 3EYZA 4JV0A 4ICAA 5CHGA 1MSWD 1NK6A 3RJGA 2A19A 1O08A 3PW2A 4KLLA 2ZUCA 1MN8A 3C21A 2BCQA 4JV1A 4DL3A 2VIXA 1NK8A 1JIHA 3ONNA 2BZFA 2RDIA 1ZQXA 1KFSA 8ICMA 5KG2A 4FBTA 2QB1A 3ZDDA 3RAQA 3RR8A 2AGPA 1ZQZA 4O5CA 2QARB 1NKBA 4O9MA 2M0NA 3NGDA 2VA8A 4NLGA 2ISPA 1SIJA 4B9UA 4MFAA 4XUSA 3OJUA 3E0FA 1UHUA 1QCKA 2EDUA 2AXTU 4MEYA 2BPFA 1LB2B 4FS1A 1ZQBA 4IL6U 3WK7A 3PMLA 3QZ7A 1BVSA 4OCZA 4QIWF 4C8KA 1K5OA 1DGSA 1V38A 4EEKA 4CF3A 4QZ9A 1MA7A 2UVWA 4F5NA 5ALXA 4C8MA 2C28A 3KZIU 4UB6U 3J81j 1PZNA 4DO9A 4ECUA 2GLEA 7ICPA 2XY7A 1RG6A 4RUCA 1O03A 3M1YA 1SXEA 5IIIA 3HRDD 5DKWA 3HJEA 2IHNA 4R64A 2XY6A 4OD0A 1X42A 1S5LU 5AKJA 2G5IB 2DQNB 5JUMA 7ICFA 2XIDA 1TV9A 2PFOA 4KN4A 5IILA 5DBCA 2V4QA 1X40A 3ZD8A 2HHWA 5KFTA 3ED5A 3OGUA 2ZIWA 4RQ3A 4QZAA 2ZIXB 4UBBA 2IOHA 3QYPA 4DOBA 1DRGA 4CNQA 2P6UA 2MA1A 1SV0C 4O3RA 4GIBA 4KX5A 4NLCA 2CRXA 1RQNA 5KAFU 4Y2JA 3OJSA 1WCLA 4QZBA 2NYVA 4MFFA 1LKYA 4KLUA 1ZETA 2K4PA 5ALWA 4JWMA 1TAUA 4P4OA 3PV8A 1HUOA 3WK4A 2DPJA 5J2FA
chains in the Genus database with same CATH topology
1CEZA 3ZDCA 3RAXA 4B9MA 4F4WA 4DL7A 3HW8A 2AJQA 5DBBA 2BCUA 8ICJA 3M9MB 2C2DA 9ICIA 1L3SA 5KG1A 2I1QA 4J9RA 2BQ3A 4M9GA 5DBAA 3PW5A 5D4BA 4IQWA 4DSKA 5KFKA 5L1JA 3TARA 4FS2A 4F2RA 8ICPA 7ICOA 4M47A 1EXNA 3TAPA 3K75D 3JPTA 4ECZA 4EZ9A 3RJKA 1BGXT 5HMMA 1L3UA 4F4YA 4JK1A 4F93B 4ECXA 4DLGA 3PR4A 3SI8A 5J2AA 2DFLA 2NRWA 9ICMA 2A1JB 2JZBB 2ALZA 2W8KA 1B22A 1KRPA 4BWMA 1NJXA 2PFPA 4RQ1A 3UQ0A 9ICSA 1ZQYA 1SL2A 4ECQA 2FMPA 4EEYA 1XSLA 5BOMA 2J6SA 5KFOA 4M04A 9ICTA 2ZJ5A 5J0WA 2Q0ZX 8ICGA 1ZQGA 3V7KA 9ICPA 4R8UB 4IR1A 4F2SA 9ICRA 4YXJA 1HJPA 1TK5A 1WCNA 4ED8A 2JEFA 5KFQA 5EWEA 4DFPA 3PY8A 5KFFA 4YR2A 3E2EA 5HNKA 1MQ3A 5KG7A 4F5QA 1ZQPA 8ICHA 2GWSA 5KFCA 4O3SA 5KFZA 3GIMA 4KITB 3TFRA 2AQ4A 3ZD9A 3Q8LA 3TQ1A 3MDAA 4BWJA 2HVHA 3N97B 4RNOA 4CCHA 4RNMA 4KMUA 5HHIA 1XU4A 2A1JA 3MABA 5KFYA 4EYIB 1KLNA 4RQ0A 5KFAA 1ZQTA 2BQUA 3JPPA 4PHDA 2W9BA 3TI0A 4RNNA 2IBKA 2BKEA 3C2KA 4F4ZA 4QWEA 3RB4A 7ICTA 1ZQJA 1U9LA 1V9PA 2MUTB 2W9CB 3RBDA 1U48A 4B9NA 3V72A 3PW4A 4B9SA 8ICUA 7ICUA 3H40A 3EW9A 2BCRA 4DF8A 7ICGA 4KLHA 8ICAA 5KFGA 4J9NA 4KLGA 3C23A 4LZGA 2AU0A 5L1KA 5KT5A 2XCPA 4EYHB 5IINA 3HT3A 4M9HA 1KTQA 5DQGA 9ICKA 3MDCA 5J2BA 1U4BA 1KFDA 1XSNA 2IHMA 5J0PA 3HX0A 4DFJA 3BDPA 1NK9A 3KTQA 4RPZA 4IRKA 2V4RA 3GIKA 1L3VA 4KLMA 4Q8EA 8ICLA 2FPLA 3IM1A 4XQ8A 2PI5A 4K4GA 7ICJA 3PR5B 4ECTA 4LVSA 9ICBA 4DQPA 5J29A 2C22A 3ISBA 3K4GA 4F3OA 1QTMA 5CR0A 1A77A 5BOLA 2C2RA 3M8SA 1NJWA 5DB7A 2ASJA 9ICXA 2MUTA 2FLPA 4ED1A 2UVRA 1BPBA 5J0YA 4DOCA 3IHQB 3GIJA 4F5PA 4ED7A 4GXIA 4NLZA 3GV8B 2UVVA 4BDPA 8ICIA 1NJYA 4YCXA 4QWCA 2RDJA 5KFRA 1U45A 4F8RA 4I27A 3C5GA 1SL0A 1BPZA 1ZQWA 3OHAA 3PX4A 4I29A 2W9AA 3AU2A 4YMMA 3HP6A 1ZYQA 5KFMA 5DDMA 4J9QA 1JXLA 1RYSA 4ECRA 3RJJA 4F92B 3RRGA 5J2JA 4R65A 3EPGA 1NJZA 5KFHA 1MQ2A 3ORYA 3NTUA 2KZ3A 2HHSA 4DLEA 3V7JA 3T5JA 2WTFA 4LZDA 1ZQEA 2KTQA 2KFNA 4DEZA 3OSPA 4IR9A 2ZUBA 5TZVA 1SKRA 9ICWA 9ICAA 1NK4A 1NKEA 3HPOA 3BQ1A 4MF2A 3C2LA 3V6KA 2R8GA 8ICKA 4M9LA 2VA3A 3BQ2A 2VANA 5KG5A 3B0YA 3V6HA 8ICTA 9ICCA 3GV7B 8ICVA 1S0MA 3EZ5A 3ISDA 5D49A 3LWLA 2BCVA 3M8RA 2LYHA 3SYZA 4KN7A 4UAZA 4ELTA 9ICFA 5F9NA 5DLFA 3RJIA 4DFMA 5KFVA 9ICVA 4ELVA 1KDHA 1D8YA 3JPSA 3RJFA 3C1ZA 3H8SA 3PNCA 2ZJAA 1X9WA 1S0OA 2P6RA 4I2JA 5KFJA 4DL5A 4KLDA 1T4GA 1T8EA 1XC9A 1TK8A 1ZQQA 4JUZA 2FMQA 4Z6FA 4TQSA 7ICKA 3MBYA 4ED2A 5DG9A 4UAWA 2F1JA 2B21A 1UA0A 1ZJMA 2I9GA 2V9WA 5DQIA 4J9LA 4J9MA 1TFRA 3UXOA 4F5OA 3PX6A 1X9MA 2NRVA 5J0QA 4UQGA 3RBEA 3Q8KA 4I2CA 3PO4A 4I2EA 4X5VA 5CB1A 5DB6A 4P4PA 4GXKA 4DQSA 4DQQA 1SZPA 4I2FA 4QZ8A 5KTQA 2HHTA 1D8LA 2W9BB 4O5EA 4DWIA 3Q8SB 5IIKA 3ISCA 4NM1A 3SV4A 2HHVA 1IM4A 3RRHA 4M9JA 4P4MA 4MFCA 8ICXA 2BGWA 3RB0A 2ZTDA 2MAXA 4YMNA 5CJ7A 4TURA 4F50A 4IRDA 1ZQIA 4M2YA 4PGQA 5CA7A 4QZIA 4PGXA 4BGDA 4P2HA 4RPYA 4GC7A 1SKSA 3ZDBA 1S97A 4KLIA 4BXOB 4QW8A 5KT2A 2XCAA 4M0AA 8ICNA 2JEIA 9ICOA 7ICQA 4B9LA 2PXIA 4PH5A 9ICQA 1QSLA 2OWOA 2PI4A 4FO6A 1S0VA 2BCSA 4DSIA 2ZTCA 3UPQA 8ICOA 4Q43A 3KHRA 4DS5A 9ICEA 2P66A 1BPDA 1ZQFA 5DDYA 5J2EA 5J0TA 5KFXA 3TANA 4M6WB 4O0IA 3EWAA 5HMLA 2ZTEA 3BJYA 3ETLA 3H4BA 4DQIA 4J9OA 2ASLA 1S0NA 1C7YA 1NOMA 7ICMA 2W8LA 4R66A 4DQRA 1K1SA 4RQ4A 4J9KA 3BQTA 1S10A 1NK0A 7ICSA 5KG4A 3MFHA 4PGYA 3AUOA 4I28A 5J0OA 3MGIA 4KLOA 8ICQA 2AQ0A 4YQWA 5KG0A 4UAYA 3OSNA 1HUZA 4EBDA 4BXOA 2XGPA 2KFZA 5KG6A 5DG8A 2HHXA 4ECWA 5J2GA 4TUQA 4B9TA 1Z00A 4RT3A 4Z6DA 3B0XA 4JWNA 2Y1IA 4DL4A 4M9NA 2ZJ8A 4QZHA 4UB1A 2M9NA 2ATLA 4YMOA 1LV5A 5DG7A 1D9FA 3JPNA 3GIIA 3MFIA 4M6WA 2C2EA 3EPIA 5DLGA 1QSSA 2H5XA 4KLTA 1XWLA 1NKCA 5EWFA 3N4MB 1X2IA 4O3PA 4RQ2A 4O3OA 3TFSA 3GFKB 1TAQA 3JPQA 1ZQAA 3PO5A 2BDPA 7ICHA 1NK5A 4YN4A 5KT4A 4YD2A 5EOZA 1L3TA 2F1IA 4QZFA 4IQTA 4MEXA 7ICVA 1DOQA 5CWRA 1ZJNA 5J0RA 4GXJA 3RJHA 4B9VA 4RPXA 4RZRA 3KHLA 2XY5A 4MF8A 3QE9Y 3G6YA 2BR0A 1ZQUA 1ZQCA 1UT8A 5J0UA 3RTVA 5J2KA 4DS4A 5F9LA 3UXPA 5HHHA 3G6XA 3Q8MA 3RR7A 3MR5A 2IMWP 4ZH4A 5KT3A 1KFTA 1S9FA 8ICCA 5D46A 3H8WA 1RZTA 4NLKA 4DSJA 1S76D 1QLNA 4UB4A 4UB2A 5C5JA 1L5UA 4YFKA 4EZ6A 1JX4A 5KFWA 7ICRA 3V7LA 4YVZA 4TUPA 5DGBA 3EYZA 4KLSA 4JV0A 2IA6A 4KLJA 1BPXA 4F4KA 9ICGA 5CHGA 4ED0A 4QW9A 2XC9A 3QEAZ 4KLQA 1MSWD 1NK6A 5KT6A 2FLNA 3RJGA 4UB3A 7ICNA 4DSFA 5J0XA 2VA2A 3QZ8A 3ZDEA 3RH5A 4DL6A 4KTQA 4KLLA 3PW2A 2FMSA 2ZUCA 2BCQA 3C21A 8ICSA 1N56A 3RB6A 2ASDA 2FLLA 4JV1A 2HVIA 4DL3A 2BPCA 5J2DA 5J2IA 4I2HA 3FYHA 1NK8A 2F1HA 3JPRA 3H8JA 4GC6A 3PX0A 9ICHA 9ICUA 2FPMA 1JIHA 1ZQNA 4QZDA 2AGOA 2RDIA 1K1QA 1ZQXA 5L1IA 3ZDAA 5J2CA 4TQRA 1KFSA 2R8KA 1QSYA 8ICMA 2NRZA 3RH4A 3PVXA 5KG2A 1X9SA 4QWDA 4FBTA 4GLXA 4RT2A 4NM2A 3ZDDA 5EWGA 4EBEA 4DFKA 4YXMA 3RAQA 5DB8A 3RR8A 2AGPA 3GDXA 1ZQZA 4O5CA 1NKBA 4UB5A 1U49A 4J9SA 1RXVA 4O3NA 4O9MA 2KZMA 3RH6A 5L1LA 1ZQMA 8ICWA 4DSEA 3NGDA 2VA8A 4ECYA 4NLGA 2ISPA 4YR0A 4B9UA 4MFAA 4DL2A 1D9DA 4I2AA 4XUSA 3BQ0A 3OJUA 4YG2A 5IIMA 3JPOA 3M9NB 4UBCA 4C8NA 4YD1A 4MEYA 2BQRA 3C2MA 9ICLA 1ZQLA 5KT7A 2BPFA 1RYRA 1LB2B 4Q8FA 3T3FA 4FS1A 1ZQBA 4JV2A 8ICRA 4O3QA 1COOA 2XGQA 3PMLA 5DGAA 2PFQA 4F91B 1Z00B 5KFNA 4R63A 1BVSA 3QZ7A 2BPGA 4K4HA 2HHUA 2XO7A 4ELUA 4PHPA 4C8KA 4J9PA 1DGSA 5KFDA 5KFEA 5IIJA 4QZ9A 4G3IA 1S77D 9ICJA 5KFUA 5BPCA 4PHEA 2UVWA 2KN7A 4QZCA 5KFPA 4F5NA 4KLFA 4PPXA 3RB3A 4ED3A 3TAQA 4E0DA 4IRCA 1B43A 3MGHA 5HP4A 2NRTA 3SZ2A 1ZQVA 3H7IA 4EBCA 4RQ6A 1NK7A 4XRHA 1XO1A 4Z6EA 1KEJA 4C8MA 2C28A 1ZQRA 3FDSA 2W9MA 4XA5A 1UA1A 4IQUA 5KFBA 1KSPA 1PZNA 1SKWA 4DO9A 2HW3A 4ECUA 2JZBA 1JMSA 4QWBA 7ICPA 4I2BA 3GV5B 3QEBZ 2FPKA 2HHQA 3UQ2A 1SL1A 2KZZA 1BPYA 2XY7A 4NXZA 8ICEA 1Z3EB 4RUCA 1N48A 4F4XA 1ZQSA 4RQ5A 7ICLA 3SV3A 2DPIA 2JEGA 2R8HA 1JXEA 4YR3A 5IIIA 1H38A 1A76A 5DKWA 4Z6CA 4YP3A 8ICFA 4R8UA 3THVA 4O5KA 2ZUDA 4KLEA 2IHNA 2NRXA 3LDAA 4R64A 4ECSA 2XY6A 1ZQOA 5L9XA 1JN3A 3T5KA 3C1YA 4ECVA 3PMNA 1RPLA 5JUMA 1T7PA 3T5HA 1AROP 7ICFA 2Y1JA 4DSLA 1TV9A 5CP2A 3RJEA 4Q44A 3T5LA 1XS9D 2PFOA 1ZQKA 4I2DA 4KN4A 5IILA 5DBCA 2V4QA 2UVUA 4RQ7A 1TK0A 3ZD8A 1ZQHA 4C8LA 9ICNA 3AU6A 2HHWA 3KHHA 1BPEA 2PFNA 4QZGA 5KFTA 3UXNA 3OGUA 4RQ3A 1IXRA 4QZAA 4DOAA 7ICIA 4K4IA 4QZEA 4UBBA 3V6JA 5KFLA 2W9CA 3Q8RB 3G6VA 4QWAA 1ZQDA 5KG3A 3M9OB 8ICBA 4DOBA 3KHGA 3HWTA 4FBUA 4NY8A 2BHNA 3C5FA 4I2GA 2P6UA 3LK9A 4O3RA 4ED6A 2AGQA 1U47A 1RXWA 3MR2A 7ICEA 1CUKA 3OJSA 2J6TA 1WCLA 4RQ8A 3OHBA 4IQVA 4QZBA 3H4DA 3MR6A 3GILA 1TVAA 4NLNA 3LWMA 4Q45A 1XSPA 4MFFA 4RUAA 4HYKA 3Q8PB 3PW7A 1T3NA 5J2HA 4KLUA 8ICZA 5IIOA 8ICYA 1MC8A 4DF4A 1ZETA 5J0SA 4TUSA 4C8OA 4I2IA 2J6UA 4JWMA 4RU9A 1TAUA 4F5RA 1Y88A 3PW0A 4P4OA 5KFIA 3MR3A 3Q8QB 1TKDA 3PV8A 4PHAA 5KFSA 2ISOA 1HUOA 2JEJA 2DPJA 2R8IA 5DQHA 5J2FA 5DB9A 2R8JA 1UT5A 3GQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEZ A;  3ZDC A;  3RAX A;  4B9M A;  4F4W A;  4DL7 A;  3HW8 A;  2AJQ A;  5DBB A;  2BCU A;  8ICJ A;  3M9M B;  2C2D A;  9ICI A;  1L3S A;  5KG1 A;  2I1Q A;  4J9R A;  2BQ3 A;  4M9G A;  5DBA A;  3PW5 A;  5D4B A;  4IQW A;  4DSK A;  5KFK A;  5L1J A;  3TAR A;  4FS2 A;  4F2R A;  8ICP A;  7ICO A;  4M47 A;  1EXN A;  3TAP A;  3K75 D;  3JPT A;  4ECZ A;  4EZ9 A;  3RJK A;  1BGX T;  5HMM A;  1L3U A;  4F4Y A;  4JK1 A;  4F93 B;  4ECX A;  4DLG A;  3PR4 A;  3SI8 A;  5J2A A;  2DFL A;  2NRW A;  9ICM A;  2A1J B;  2JZB B;  2ALZ A;  2W8K A;  1B22 A;  1KRP A;  4BWM A;  1NJX A;  2PFP A;  4RQ1 A;  3UQ0 A;  9ICS A;  1ZQY A;  1SL2 A;  4ECQ A;  2FMP A;  4EEY A;  1XSL A;  5BOM A;  2J6S A;  5KFO A;  4M04 A;  9ICT A;  2ZJ5 A;  5J0W A;  2Q0Z X;  8ICG A;  1ZQG A;  3V7K A;  9ICP A;  4R8U B;  4IR1 A;  4F2S A;  9ICR A;  4YXJ A;  1HJP A;  1TK5 A;  1WCN A;  4ED8 A;  2JEF A;  5KFQ A;  5EWE A;  4DFP A;  3PY8 A;  5KFF A;  4YR2 A;  3E2E A;  5HNK A;  1MQ3 A;  5KG7 A;  4F5Q A;  1ZQP A;  8ICH A;  2GWS A;  5KFC A;  4O3S A;  5KFZ A;  3GIM A;  4KIT B;  3TFR A;  2AQ4 A;  3ZD9 A;  3Q8L A;  3TQ1 A;  3MDA A;  4BWJ A;  2HVH A;  3N97 B;  4RNO A;  4CCH A;  4RNM A;  4KMU A;  5HHI A;  1XU4 A;  2A1J A;  3MAB A;  5KFY A;  4EYI B;  1KLN A;  4RQ0 A;  5KFA A;  1ZQT A;  2BQU A;  3JPP A;  4PHD A;  2W9B A;  3TI0 A;  4RNN A;  2IBK A;  2BKE A;  3C2K A;  4F4Z A;  4QWE A;  3RB4 A;  7ICT A;  1ZQJ A;  1U9L A;  1V9P A;  2MUT B;  2W9C B;  3RBD A;  1U48 A;  4B9N A;  3V72 A;  3PW4 A;  4B9S A;  8ICU A;  7ICU A;  3H40 A;  3EW9 A;  2BCR A;  4DF8 A;  7ICG A;  4KLH A;  8ICA A;  5KFG A;  4J9N A;  4KLG A;  3C23 A;  4LZG A;  2AU0 A;  5L1K A;  5KT5 A;  2XCP A;  4EYH B;  5IIN A;  3HT3 A;  4M9H A;  1KTQ A;  5DQG A;  9ICK A;  3MDC A;  5J2B A;  1U4B A;  1KFD A;  1XSN A;  2IHM A;  5J0P A;  3HX0 A;  4DFJ A;  3BDP A;  1NK9 A;  3KTQ A;  4RPZ A;  4IRK A;  2V4R A;  3GIK A;  1L3V A;  4KLM A;  4Q8E A;  8ICL A;  2FPL A;  3IM1 A;  4XQ8 A;  2PI5 A;  4K4G A;  7ICJ A;  3PR5 B;  4ECT A;  4LVS A;  9ICB A;  4DQP A;  5J29 A;  2C22 A;  3ISB A;  3K4G A;  4F3O A;  1QTM A;  5CR0 A;  1A77 A;  5BOL A;  2C2R A;  3M8S A;  1NJW A;  5DB7 A;  2ASJ A;  9ICX A;  2MUT A;  2FLP A;  4ED1 A;  2UVR A;  1BPB A;  5J0Y A;  4DOC A;  3IHQ B;  3GIJ A;  4F5P A;  4ED7 A;  4GXI A;  4NLZ A;  3GV8 B;  2UVV A;  4BDP A;  8ICI A;  1NJY A;  4YCX A;  4QWC A;  2RDJ A;  5KFR A;  1U45 A;  4F8R A;  4I27 A;  3C5G A;  1SL0 A;  1BPZ A;  1ZQW A;  3OHA A;  3PX4 A;  4I29 A;  2W9A A;  3AU2 A;  4YMM A;  3HP6 A;  1ZYQ A;  5KFM A;  5DDM A;  4J9Q A;  1JXL A;  1RYS A;  4ECR A;  3RJJ A;  4F92 B;  3RRG A;  5J2J A;  4R65 A;  3EPG A;  1NJZ A;  5KFH A;  1MQ2 A;  3ORY A;  3NTU A;  2KZ3 A;  2HHS A;  4DLE A;  3V7J A;  3T5J A;  2WTF A;  4LZD A;  1ZQE A;  2KTQ A;  2KFN A;  4DEZ A;  3OSP A;  4IR9 A;  2ZUB A;  5TZV A;  1SKR A;  9ICW A;  9ICA A;  1NK4 A;  1NKE A;  3HPO A;  3BQ1 A;  4MF2 A;  3C2L A;  3V6K A;  2R8G A;  8ICK A;  4M9L A;  2VA3 A;  3BQ2 A;  2VAN A;  5KG5 A;  3B0Y A;  3V6H A;  8ICT A;  9ICC A;  3GV7 B;  8ICV A;  1S0M A;  3EZ5 A;  3ISD A;  5D49 A;  3LWL A;  2BCV A;  3M8R A;  2LYH A;  3SYZ A;  4KN7 A;  4UAZ A;  4ELT A;  9ICF A;  5F9N A;  5DLF A;  3RJI A;  4DFM A;  5KFV A;  9ICV A;  4ELV A;  1KDH A;  1D8Y A;  3JPS A;  3RJF A;  3C1Z A;  3H8S A;  3PNC A;  2ZJA A;  1X9W A;  1S0O A;  2P6R A;  4I2J A;  5KFJ A;  4DL5 A;  4KLD A;  1T4G A;  1T8E A;  1XC9 A;  1TK8 A;  1ZQQ A;  4JUZ A;  2FMQ A;  4Z6F A;  4TQS A;  7ICK A;  3MBY A;  4ED2 A;  5DG9 A;  4UAW A;  2F1J A;  2B21 A;  1UA0 A;  1ZJM A;  2I9G A;  2V9W A;  5DQI A;  4J9L A;  4J9M A;  1TFR A;  3UXO A;  4F5O A;  3PX6 A;  1X9M A;  2NRV A;  5J0Q A;  4UQG A;  3RBE A;  3Q8K A;  4I2C A;  3PO4 A;  4I2E A;  4X5V A;  5CB1 A;  5DB6 A;  4P4P A;  4GXK A;  4DQS A;  4DQQ A;  1SZP A;  4I2F A;  4QZ8 A;  5KTQ A;  2HHT A;  1D8L A;  2W9B B;  4O5E A;  4DWI A;  3Q8S B;  5IIK A;  3ISC A;  4NM1 A;  3SV4 A;  2HHV A;  1IM4 A;  3RRH A;  4M9J A;  4P4M A;  4MFC A;  8ICX A;  2BGW A;  3RB0 A;  2ZTD A;  2MAX A;  4YMN A;  5CJ7 A;  4TUR A;  4F50 A;  4IRD A;  1ZQI A;  4M2Y A;  4PGQ A;  5CA7 A;  4QZI A;  4PGX A;  4BGD A;  4P2H A;  4RPY A;  4GC7 A;  1SKS A;  3ZDB A;  1S97 A;  4KLI A;  4BXO B;  4QW8 A;  5KT2 A;  2XCA A;  4M0A A;  8ICN A;  2JEI A;  9ICO A;  7ICQ A;  4B9L A;  2PXI A;  4PH5 A;  9ICQ A;  1QSL A;  2OWO A;  2PI4 A;  4FO6 A;  1S0V A;  2BCS A;  4DSI A;  2ZTC A;  3UPQ A;  8ICO A;  4Q43 A;  3KHR A;  4DS5 A;  9ICE A;  2P66 A;  1BPD A;  1ZQF A;  5DDY A;  5J2E A;  5J0T A;  5KFX A;  3TAN A;  4M6W B;  4O0I A;  3EWA A;  5HML A;  2ZTE A;  3BJY A;  3ETL A;  3H4B A;  4DQI A;  4J9O A;  2ASL A;  1S0N A;  1C7Y A;  1NOM A;  7ICM A;  2W8L A;  4R66 A;  4DQR A;  1K1S A;  4RQ4 A;  4J9K A;  3BQT A;  1S10 A;  1NK0 A;  7ICS A;  5KG4 A;  3MFH A;  4PGY A;  3AUO A;  4I28 A;  5J0O A;  3MGI A;  4KLO A;  8ICQ A;  2AQ0 A;  4YQW A;  5KG0 A;  4UAY A;  3OSN A;  1HUZ A;  4EBD A;  4BXO A;  2XGP A;  2KFZ A;  5KG6 A;  5DG8 A;  2HHX A;  4ECW A;  5J2G A;  4TUQ A;  4B9T A;  1Z00 A;  4RT3 A;  4Z6D A;  3B0X A;  4JWN A;  2Y1I A;  4DL4 A;  4M9N A;  2ZJ8 A;  4QZH A;  4UB1 A;  2M9N A;  2ATL A;  4YMO A;  1LV5 A;  5DG7 A;  1D9F A;  3JPN A;  3GII A;  3MFI A;  4M6W A;  2C2E A;  3EPI A;  5DLG A;  1QSS A;  2H5X A;  4KLT A;  1XWL A;  1NKC A;  5EWF A;  3N4M B;  1X2I A;  4O3P A;  4RQ2 A;  4O3O A;  3TFS A;  3GFK B;  1TAQ A;  3JPQ A;  1ZQA A;  3PO5 A;  2BDP A;  7ICH A;  1NK5 A;  4YN4 A;  5KT4 A;  4YD2 A;  5EOZ A;  1L3T A;  2F1I A;  4QZF A;  4IQT A;  4MEX A;  7ICV A;  1DOQ A;  5CWR A;  1ZJN A;  5J0R A;  4GXJ A;  3RJH A;  4B9V A;  4RPX A;  4RZR A;  3KHL A;  2XY5 A;  4MF8 A;  3QE9 Y;  3G6Y A;  2BR0 A;  1ZQU A;  1ZQC A;  1UT8 A;  5J0U A;  3RTV A;  5J2K A;  4DS4 A;  5F9L A;  3UXP A;  5HHH A;  3G6X A;  3Q8M A;  3RR7 A;  3MR5 A;  2IMW P;  4ZH4 A;  5KT3 A;  1KFT A;  1S9F A;  8ICC A;  5D46 A;  3H8W A;  1RZT A;  4NLK A;  4DSJ A;  1S76 D;  1QLN A;  4UB4 A;  4UB2 A;  5C5J A;  1L5U A;  4YFK A;  4EZ6 A;  1JX4 A;  5KFW A;  7ICR A;  3V7L A;  4YVZ A;  4TUP A;  5DGB A;  3EYZ A;  4KLS A;  4JV0 A;  2IA6 A;  4KLJ A;  1BPX A;  4F4K A;  9ICG A;  5CHG A;  4ED0 A;  4QW9 A;  2XC9 A;  3QEA Z;  4KLQ A;  1MSW D;  1NK6 A;  5KT6 A;  2FLN A;  3RJG A;  4UB3 A;  7ICN A;  4DSF A;  5J0X A;  2VA2 A;  3QZ8 A;  3ZDE A;  3RH5 A;  4DL6 A;  4KTQ A;  4KLL A;  3PW2 A;  2FMS A;  2ZUC A;  2BCQ A;  3C21 A;  8ICS A;  1N56 A;  3RB6 A;  2ASD A;  2FLL A;  4JV1 A;  2HVI A;  4DL3 A;  2BPC A;  5J2D A;  5J2I A;  4I2H A;  3FYH A;  1NK8 A;  2F1H A;  3JPR A;  3H8J A;  4GC6 A;  3PX0 A;  9ICH A;  9ICU A;  2FPM A;  1JIH A;  1ZQN A;  4QZD A;  2AGO A;  2RDI A;  1K1Q A;  1ZQX A;  5L1I A;  3ZDA A;  5J2C A;  4TQR A;  1KFS A;  2R8K A;  1QSY A;  8ICM A;  2NRZ A;  3RH4 A;  3PVX A;  5KG2 A;  1X9S A;  4QWD A;  4FBT A;  4GLX A;  4RT2 A;  4NM2 A;  3ZDD A;  5EWG A;  4EBE A;  4DFK A;  4YXM A;  3RAQ A;  5DB8 A;  3RR8 A;  2AGP A;  3GDX A;  1ZQZ A;  4O5C A;  1NKB A;  4UB5 A;  1U49 A;  4J9S A;  1RXV A;  4O3N A;  4O9M A;  2KZM A;  3RH6 A;  5L1L A;  1ZQM A;  8ICW A;  4DSE A;  3NGD A;  2VA8 A;  4ECY A;  4NLG A;  2ISP A;  4YR0 A;  4B9U A;  4MFA A;  4DL2 A;  1D9D A;  4I2A A;  4XUS A;  3BQ0 A;  3OJU A;  4YG2 A;  5IIM A;  3JPO A;  3M9N B;  4UBC A;  4C8N A;  4YD1 A;  4MEY A;  2BQR A;  3C2M A;  9ICL A;  1ZQL A;  5KT7 A;  2BPF A;  1RYR A;  1LB2 B;  4Q8F A;  3T3F A;  4FS1 A;  1ZQB A;  4JV2 A;  8ICR A;  4O3Q A;  1COO A;  2XGQ A;  3PML A;  5DGA A;  2PFQ A;  4F91 B;  1Z00 B;  5KFN A;  4R63 A;  1BVS A;  3QZ7 A;  2BPG A;  4K4H A;  2HHU A;  2XO7 A;  4ELU A;  4PHP A;  4C8K A;  4J9P A;  1DGS A;  5KFD A;  5KFE A;  5IIJ A;  4QZ9 A;  4G3I A;  1S77 D;  9ICJ A;  5KFU A;  5BPC A;  4PHE A;  2UVW A;  2KN7 A;  4QZC A;  5KFP A;  4F5N A;  4KLF A;  4PPX A;  3RB3 A;  4ED3 A;  3TAQ A;  4E0D A;  4IRC A;  1B43 A;  3MGH A;  5HP4 A;  2NRT A;  3SZ2 A;  1ZQV A;  3H7I A;  4EBC A;  4RQ6 A;  1NK7 A;  4XRH A;  1XO1 A;  4Z6E A;  1KEJ A;  4C8M A;  2C28 A;  1ZQR A;  3FDS A;  2W9M A;  4XA5 A;  1UA1 A;  4IQU A;  5KFB A;  1KSP A;  1PZN A;  1SKW A;  4DO9 A;  2HW3 A;  4ECU A;  2JZB A;  1JMS A;  4QWB A;  7ICP A;  4I2B A;  3GV5 B;  3QEB Z;  2FPK A;  2HHQ A;  3UQ2 A;  1SL1 A;  2KZZ A;  1BPY A;  2XY7 A;  4NXZ A;  8ICE A;  1Z3E B;  4RUC A;  1N48 A;  4F4X A;  1ZQS A;  4RQ5 A;  7ICL A;  3SV3 A;  2DPI A;  2JEG A;  2R8H A;  1JXE A;  4YR3 A;  5III A;  1H38 A;  1A76 A;  5DKW A;  4Z6C A;  4YP3 A;  8ICF A;  4R8U A;  3THV A;  4O5K A;  2ZUD A;  4KLE A;  2IHN A;  2NRX A;  3LDA A;  4R64 A;  4ECS A;  2XY6 A;  1ZQO A;  5L9X A;  1JN3 A;  3T5K A;  3C1Y A;  4ECV A;  3PMN A;  1RPL A;  5JUM A;  1T7P A;  3T5H A;  1ARO P;  7ICF A;  2Y1J A;  4DSL A;  1TV9 A;  5CP2 A;  3RJE A;  4Q44 A;  3T5L A;  1XS9 D;  2PFO A;  1ZQK A;  4I2D A;  4KN4 A;  5IIL A;  5DBC A;  2V4Q A;  2UVU A;  4RQ7 A;  1TK0 A;  3ZD8 A;  1ZQH A;  4C8L A;  9ICN A;  3AU6 A;  2HHW A;  3KHH A;  1BPE A;  2PFN A;  4QZG A;  5KFT A;  3UXN A;  3OGU A;  4RQ3 A;  1IXR A;  4QZA A;  4DOA A;  7ICI A;  4K4I A;  4QZE A;  4UBB A;  3V6J A;  5KFL A;  2W9C A;  3Q8R B;  3G6V A;  4QWA A;  1ZQD A;  5KG3 A;  3M9O B;  8ICB A;  4DOB A;  3KHG A;  3HWT A;  4FBU A;  4NY8 A;  2BHN A;  3C5F A;  4I2G A;  2P6U A;  3LK9 A;  4O3R A;  4ED6 A;  2AGQ A;  1U47 A;  1RXW A;  3MR2 A;  7ICE A;  1CUK A;  3OJS A;  2J6T A;  1WCL A;  4RQ8 A;  3OHB A;  4IQV A;  4QZB A;  3H4D A;  3MR6 A;  3GIL A;  1TVA A;  4NLN A;  3LWM A;  4Q45 A;  1XSP A;  4MFF A;  4RUA A;  4HYK A;  3Q8P B;  3PW7 A;  1T3N A;  5J2H A;  4KLU A;  8ICZ A;  5IIO A;  8ICY A;  1MC8 A;  4DF4 A;  1ZET A;  5J0S A;  4TUS A;  4C8O A;  4I2I A;  2J6U A;  4JWM A;  4RU9 A;  1TAU A;  4F5R A;  1Y88 A;  3PW0 A;  4P4O A;  5KFI A;  3MR3 A;  3Q8Q B;  1TKD A;  3PV8 A;  4PHA A;  5KFS A;  2ISO A;  1HUO A;  2JEJ A;  2DPJ A;  2R8I A;  5DQH A;  5J2F A;  5DB9 A;  2R8J A;  1UT5 A;  3GQC A; 
#chains in the Genus database with same CATH topology
 1N60 A;  3AN1 A;  3ZDC A;  3RAX A;  4B9M A;  4DL7 A;  1YZ7 A;  2BCU A;  5EE3 A;  3M9M B;  2C2D A;  1L3S A;  3F53 A;  4J9R A;  3PW5 A;  4F2R A;  3TAR A;  4F72 A;  3RFA A;  5HR7 A;  2LBO A;  4MHV A;  3B9J A;  3PR4 A;  1VDV A;  3AEV A;  2DFL A;  2ALZ A;  4B6J A;  4RQ1 A;  4ECQ A;  1T3Q A;  4CF4 A;  1FIQ A;  2ZJ5 A;  5KNI A;  2Y0S F;  3V7K A;  4R8U B;  9ICR A;  3N7P D;  1WCN A;  5KFQ A;  3IG5 A;  2RLT A;  2KK0 A;  4F5Q A;  2E8O A;  4KIT B;  3TQ1 A;  3N97 B;  4PZN A;  4RNM A;  1C20 A;  3F5E A;  3IDW A;  3KD3 A;  5HHI A;  3MAB A;  2A1J A;  1KLN A;  5KFY A;  4RQ0 A;  2BQU A;  4FZL A;  3TI0 A;  1N61 A;  4RNN A;  4F4Z A;  3S6J A;  1DGJ A;  2MUT B;  3WK9 A;  1U48 A;  5AK4 A;  3PW4 A;  4J03 A;  2B0C A;  2BCR A;  4DF8 A;  5AI5 A;  7ICG A;  2A3V A;  2Y9T A;  3K1Z A;  3R9K A;  4M9H A;  2H3Q A;  2KNJ A;  5B66 U;  3HX0 A;  3BDP A;  4KLM A;  4RPZ A;  4IRK A;  4Q8E A;  2HBK A;  3WKD A;  4XQ8 A;  7ICJ A;  3WK8 A;  1SWW A;  2KV2 A;  2Z7J A;  3QNM A;  1ZD3 A;  1Q3U A;  5J29 A;  3ISB A;  5K4L A;  1BPB A;  4ED7 A;  3F2D A;  4NLZ A;  1KKX A;  2RDJ A;  1U45 A;  2AHO B;  3TAC B;  2W9A A;  2E8P A;  3NVW A;  2CXY A;  4F92 B;  1NJZ A;  4FZN A;  3ORY A;  3NTU A;  2KZ3 A;  4DLE A;  4DEZ A;  3OSP A;  5TZV A;  2HOI A;  1SWV A;  2LHT A;  3BQ2 A;  2GH1 A;  5KG5 A;  2HMX A;  3V6H A;  8ICT A;  8ICV A;  2K8C B;  3EZ5 A;  3ISD A;  3LWL A;  2BCV A;  5AI6 A;  3F2B A;  3SYZ A;  9ICV A;  1KDH A;  4UAU A;  3H8S A;  3PNC A;  2ZJA A;  4I2J A;  1T4G A;  4JUZ A;  4TQS A;  1ECW A;  2I9G A;  1ZJM A;  2BDU A;  4J9M A;  3PX6 A;  3IN5 A;  4UQG A;  4I2C A;  4GXK A;  4DQS A;  1X6J A;  1FEZ A;  1F5S A;  2WB1 F;  2DUY A;  3F5A A;  4P0Q A;  2F76 X;  3RRH A;  4BJQ A;  3WKE A;  2BGW A;  2MAX A;  4YMN A;  5CJ7 A;  4M2Y A;  4FE3 A;  1ZQI A;  5CA7 A;  1B0X A;  4PGX A;  1S97 A;  4BXO B;  2F77 X;  2D3D A;  2YML A;  9ICO A;  4PH5 A;  3KOO A;  3KHR A;  2ZG6 A;  1QQ6 A;  3IG8 A;  2KHV A;  2P66 A;  2F8L A;  5ALD A;  4AP9 A;  5KFX A;  2KVC A;  2XVT A;  3BJY A;  1RDF A;  1NOM A;  1K1S A;  3BQT A;  7ICS A;  2JXJ A;  4PGY A;  3MGI A;  4KLO A;  3SEI A;  4EBD A;  2W54 A;  3I76 A;  5KG6 A;  1N5X A;  2HHX A;  5J2G A;  3QUB A;  4JWN A;  3TAD A;  2ZJ8 A;  2M9N A;  3N7S C;  1LV5 A;  5AKX A;  4U6P A;  2ESE A;  3EPI A;  5DLG A;  2KP7 A;  3WKC A;  3WU2 U;  4RQ2 A;  3GFK B;  1JAL A;  1NK5 A;  4YN4 A;  1XO0 A;  2LMR A;  3WK6 A;  4EEN A;  3KKA C;  4GXJ A;  2BR0 A;  4MF8 A;  1ZQU A;  1ZQC A;  1UT8 A;  3RTV A;  4DS4 A;  3G6X A;  3GU3 A;  2IMW P;  1KFT A;  5KT3 A;  1S9F A;  8ICC A;  4NLK A;  1S76 D;  5AKI A;  4UB4 A;  1KN5 A;  3QU7 A;  3BQ7 A;  4YFK A;  1JX4 A;  1TE2 A;  4KLJ A;  2PMZ F;  2OEH A;  4F4K A;  9ICG A;  4ED0 A;  4QW9 A;  2XC9 A;  3QEA Z;  7ICN A;  4UB3 A;  4DSF A;  4A8E A;  3QZ8 A;  2VA2 A;  4DL6 A;  4KTQ A;  2H3Z A;  2FMS A;  2KKP A;  8ICS A;  4UAS A;  3T79 A;  2FLL A;  2HVI A;  5J2D A;  5J2I A;  2F1H A;  3PSF A;  4GC6 A;  3NRZ A;  9ICU A;  1K1Q A;  5L1I A;  1N63 A;  3N28 A;  5AKL A;  5ALL A;  5KL8 B;  2KEY A;  3QUQ A;  4PJ0 U;  1U49 A;  3RH6 A;  2EAP A;  2FE9 A;  5L1L A;  2RRD A;  8ICW A;  4DSE A;  3PST A;  1S8O A;  4YR0 A;  2KOB A;  4I2A A;  5JTI A;  4YG2 A;  5IIM A;  1L7P A;  3DDH A;  5KT7 A;  3T3F A;  4JV2 A;  2JH7 A;  3UMC A;  1SGG A;  4OJL A;  2OYY A;  5ALK A;  5AM5 A;  4F91 B;  1Z00 B;  2HHU A;  2BPG A;  4ACO A;  4ELU A;  5KFD A;  1HIW A;  2KN7 A;  5KFP A;  4PPX A;  3RB3 A;  3LYS A;  3TAQ A;  2NRT A;  2FI1 A;  3H7I A;  4EBC A;  4RQ6 A;  1NK7 A;  4XRH A;  1Z4N A;  3FDS A;  4IQU A;  1V85 A;  2JZB A;  1JMS A;  2VJ4 A;  2HHQ A;  3UQ2 A;  1SL1 A;  2YB1 A;  2FJ6 A;  4F4X A;  4RQ5 A;  7ICL A;  2JV3 A;  1J2N A;  1A76 A;  8ICF A;  2F2A B;  4YP3 A;  1P7D A;  3RF9 A;  2W55 A;  3LDA A;  5AHX A;  4ECS A;  5L9X A;  2KJ5 A;  3T5K A;  3PMN A;  3O0F A;  1PVP A;  4QIW C;  2W43 A;  3T5L A;  5GTH U;  9ICN A;  2NO5 A;  1TK0 A;  3D2S A;  3KHH A;  2PFN A;  2YMQ A;  1DK2 A;  3UXN A;  2EH9 A;  2W9C A;  3Q8R B;  3G6V A;  2ZIU B;  1ZQD A;  1UCV A;  5KG3 A;  4FBU A;  5AK5 A;  2BHN A;  3LK9 A;  4ED6 A;  5JU5 A;  1ZD2 P;  3OHB A;  4IQV A;  3H4D A;  1X9X A;  3MR6 A;  4CE6 A;  1COK A;  4Q45 A;  1XSP A;  4RUA A;  5AM4 A;  3Q8P B;  1PK1 A;  3PW7 A;  2WAQ F;  4DF4 A;  2GO7 A;  2J6U A;  2JHD A;  4RU9 A;  1NZB A;  1Y88 A;  5ALU A;  2MRL A;  5KFI A;  3Q8Q B;  2ISO A;  2JEJ A;  5DQH A;  2I1Q A;  5DB9 A;  1UT5 A;  3GQC A;  8ICY A;  5AKG A;  1WG8 A;  3NVV A;  4PL2 A;  1Z1V A;  3L3F X;  5D4B A;  4DSK A;  3NAS A;  8ICP A;  4FS2 A;  3H0R B;  1EXN A;  2R18 A;  5HMM A;  1L3U A;  4ECX A;  9ICM A;  5J2A A;  2EAN A;  2A1J B;  3KZX A;  4NWI A;  1B22 A;  3AM9 A;  2JR5 A;  3AQF A;  9ICS A;  2HCF A;  1SL2 A;  5AI0 A;  2FMP A;  5BOM A;  2G06 A;  5J0W A;  1ZQG A;  9ICP A;  4F2S A;  1CRX A;  2IOF A;  1TK5 A;  4ED8 A;  3PY8 A;  4DFP A;  2QB0 A;  2L5Y A;  5HNK A;  3AQE A;  5TIS U;  3UMG A;  5ALT A;  4RNO A;  1YT3 A;  4KMU A;  2H3F A;  3SAF A;  1ZQT A;  3NVZ A;  4QNL A;  4PHD A;  2W9B A;  2BKE A;  2W7O A;  1ZQJ A;  4O3M A;  1DXS A;  3RBD A;  2HSZ A;  3V72 A;  4B9S A;  7ICU A;  3H40 A;  4J9N A;  4LZG A;  1ZOL A;  3LVW A;  2LM4 A;  5J0P A;  2Y0S C;  3KTQ A;  2V4R A;  3GZF A;  8ICL A;  3IM1 A;  2PI5 A;  4K4G A;  3OTQ A;  3PR5 B;  4BX9 C;  3C28 A;  2C22 A;  2YMP A;  1SV0 A;  1QTM A;  5G5G A;  4Y2Y A;  5CR0 A;  3M8S A;  1NJW A;  5GTI U;  2ASJ A;  2FLP A;  4ED1 A;  2DWQ A;  4GXI A;  4BDP A;  3BS5 B;  4QWC A;  4NL9 C;  1SL0 A;  1KW4 A;  3AU2 A;  5DDM A;  1RYS A;  1WYG A;  3RRG A;  5KFH A;  5AK6 A;  9ICW A;  9ICA A;  2E8N A;  5KAI U;  3C2L A;  3NS1 A;  8ICK A;  4M9L A;  9ICC A;  1SXD A;  1S0M A;  3M8R A;  9ICF A;  5F9N A;  3QUT A;  4DFM A;  5KFV A;  4ELV A;  1D8Y A;  3JPS A;  3RJF A;  1X9W A;  1S0O A;  4DL5 A;  1TK8 A;  4Z6F A;  7ICK A;  5DG9 A;  4UAW A;  2V9W A;  2E1F A;  4C0Z A;  4J9L A;  2NRV A;  5J0Q A;  3VC8 A;  1ZRM A;  4I2E A;  4DQQ A;  4I2F A;  2GOL A;  4DWI A;  5IIK A;  3ISC A;  4PZO A;  1IM4 A;  4P4M A;  4MFC A;  2ZTD A;  4F50 A;  2YX8 A;  4P2H A;  4RPY A;  4KLI A;  4Y2P A;  4QW8 A;  5KT2 A;  2XCA A;  4B9L A;  2OWO A;  8ICO A;  4FO6 A;  1J2M A;  2DF4 B;  3LVV A;  2H3V A;  4US9 A;  3BZC A;  4GFJ A;  3TAN A;  1QH9 A;  4USA A;  2K8A A;  2ZTE A;  4J9O A;  1S0N A;  7ICM A;  2DKX A;  1S10 A;  5KG4 A;  3MFH A;  3AUO A;  2AQ0 A;  5KG0 A;  2WB1 C;  4UAY A;  1RM6 C;  3D2N A;  5EE9 A;  4ECW A;  4TUQ A;  4WJ3 B;  4Z6D A;  3E58 A;  2H3I A;  4Y2Q A;  2ATL A;  2KSO B;  3JPN A;  3GII A;  2YMM A;  1F0M A;  4M6W A;  2C2E A;  2OXO A;  1XWL A;  2HOQ A;  1NKC A;  1ZQA A;  4O3P A;  4O3O A;  2ZXH A;  1L3T A;  2D8C A;  5EOZ A;  2F1I A;  4QZF A;  3D2Q A;  4B9V A;  5CWR A;  3RJH A;  3KHL A;  5J2K A;  3NVY A;  5F9L A;  1SB3 C;  2ES6 A;  4US8 A;  2DBY A;  2EAM A;  5KFW A;  4KLS A;  1T94 A;  3H0M B;  3QU4 A;  2FLN A;  1BNP A;  2KKV A;  2IOF K;  5J0X A;  5AKE A;  5KL1 B;  2KD1 A;  5HR6 A;  3OPX A;  1OXJ A;  1N56 A;  3RB6 A;  2ASD A;  4F71 A;  2BPC A;  3FYH A;  2K60 A;  3H8J A;  2ZIX A;  4QZD A;  2AGO A;  3ZDA A;  4TQR A;  1JRP A;  1QSY A;  2NRZ A;  3RH4 A;  1X9S A;  4QWD A;  4GLX A;  2G09 A;  4RT2 A;  5AM3 A;  2DGZ A;  4FZM A;  4EBE A;  4UB5 A;  1D8B A;  1RXV A;  3I28 A;  3A0H U;  1ED1 A;  3CW2 C;  4O3N A;  1QQ5 A;  1ZQM A;  4U7C A;  3FC4 A;  2P35 A;  2W7P A;  5AIA A;  4DL2 A;  2HBM A;  3JPO A;  3M9N B;  4UBC A;  4C8N A;  1RQL A;  1HEK A;  2PMZ C;  3SMV A;  3C2M A;  1L8O A;  4Y2X A;  5EE1 A;  8ICR A;  2XGQ A;  2PFQ A;  3BS7 A;  5KFN A;  1Q46 A;  4R63 A;  4K4H A;  1L6N A;  2XO7 A;  4J9P A;  4IS7 A;  5KFE A;  4G3I A;  1S77 D;  5KFU A;  5HP4 A;  3MGH A;  3SZ2 A;  2E1E A;  4OJO A;  1XO1 A;  1KEJ A;  2W9M A;  1UA1 A;  3NRW A;  1SKW A;  4QWB A;  5ALQ A;  3WKA A;  3GV5 B;  3QEB Z;  2FPK A;  4I2B A;  4NXZ A;  8ICE A;  1ZQS A;  3SV3 A;  5ALM A;  2JEG A;  2R8H A;  1JXE A;  4R8U A;  4O5K A;  2ZUD A;  1FFV A;  2DL0 A;  4KLE A;  2K4I A;  3KKA A;  2NRX A;  3PSP A;  1GO3 F;  2FDR A;  2O6K A;  3T5H A;  4AYB F;  3HKZ F;  4JMU A;  3RJE A;  2LYA A;  5A0L A;  4I2D A;  2UVU A;  1ZQH A;  2W11 A;  3AU6 A;  2K4E A;  1BPE A;  4QZG A;  1PK1 B;  2CN1 A;  3ZI4 A;  3NUQ A;  3MGV A;  4KX3 A;  4QZE A;  3V6J A;  3SD7 A;  4QWA A;  1VLB A;  3WKB A;  3M9O B;  8ICB A;  3KHG A;  2KE7 A;  3HWT A;  5ALN A;  4OJP A;  2WHE A;  2AGQ A;  4RQN A;  2MU2 A;  1RXW A;  3MR2 A;  7ICE A;  4LJX A;  1CUK A;  3GIL A;  1TVA A;  4NLN A;  1ZD4 A;  3LWM A;  5ALZ A;  5C0Y A;  4HYK A;  3SR6 A;  1T3N A;  5J2H A;  8ICZ A;  1IIP A;  2K8B B;  1NNL A;  2CPR A;  5J0S A;  4CRX A;  3PW0 A;  4OJ6 A;  1TKD A;  5ALR A;  4PHA A;  5KFS A;  5IIN A;  1CEZ A;  3IP4 B;  4F4W A;  2AJQ A;  2K4H A;  1SV4 A;  9ICI A;  2BQ3 A;  2QB0 B;  3DV9 A;  5AKH A;  1ZXI A;  2JH1 A;  7ICO A;  3TAP A;  2EZY A;  1L7O A;  3I1Y A;  3JPT A;  4EZ9 A;  1N5W A;  1BGX T;  3SI8 A;  4DLG A;  1JRO A;  5AM2 A;  2NRW A;  3K1R B;  1NJX A;  4BUG A;  4NJ8 A;  4EEY A;  2J6S A;  2JGA A;  9ICT A;  2WAQ C;  4YXJ A;  2JEF A;  5KFF A;  3E2E A;  4C80 A;  5J8Y C;  5KG7 A;  8ICH A;  5KFC A;  4O3S A;  5KFZ A;  1FO4 A;  3GIM A;  3ZD9 A;  4BWJ A;  4P0P A;  1XU4 A;  3QU5 A;  3VCB A;  5KFA A;  3QX7 A;  3JPP A;  2ZIW B;  4QWE A;  7ICT A;  5ALP A;  1U9L A;  2AH5 A;  8ICU A;  2EZZ A;  1M6Y A;  3EW9 A;  2EQY A;  1TAM A;  2YY6 A;  4KLH A;  4KLG A;  3C23 A;  5AIB A;  2AU0 A;  5L1K A;  2XCP A;  4UW9 A;  3HT3 A;  2W04 A;  3MDC A;  2IHM A;  1U4B A;  3CP8 A;  1L3V A;  2FPL A;  3IRU A;  1URJ A;  2I5H A;  9ICB A;  4DQP A;  1LKY B;  5DB7 A;  4NLB A;  5ALS A;  5J0Y A;  3D6J A;  3IHQ B;  4F5P A;  5AI9 A;  3GV8 B;  2UVV A;  3CNH A;  1LVH A;  1NJY A;  4YCX A;  5KFR A;  1BPZ A;  3OHA A;  3HP6 A;  1ZYQ A;  1JXL A;  4R65 A;  2HHS A;  2HBJ A;  3V7J A;  1ZQE A;  4LZD A;  2KFN A;  2ZUB A;  1Z19 A;  1SKR A;  4Y2U A;  5G5H A;  3BQ1 A;  3V6K A;  2B6G A;  1N62 A;  1KQQ A;  3MC1 A;  3B0Y A;  2W3S A;  1OUQ A;  4KN7 A;  5ALV A;  4UAZ A;  4ELT A;  5DLF A;  1A6S A;  2KHQ A;  3C1Z A;  3N7R C;  3SAG A;  5KFJ A;  5AM0 A;  4KLD A;  1T8E A;  1XC9 A;  4ED2 A;  2F1J A;  1F44 A;  1UA0 A;  5DQI A;  3C29 A;  2OCE A;  4F5O A;  1X9M A;  3RBE A;  4CGZ A;  2QLT A;  4X5V A;  1L7N A;  5DB6 A;  1SZP A;  1V97 A;  2KJ8 A;  4QZ8 A;  5KTQ A;  2HHT A;  1D8L A;  3L5K A;  2OH2 A;  2WF8 A;  4NM1 A;  3SV4 A;  2HHV A;  3H0L B;  4M9J A;  4UAR A;  2WFA A;  8ICX A;  5CEH A;  4TUR A;  4IRD A;  1QQ7 A;  4IC9 A;  4QZI A;  4BGD A;  1ZD5 A;  4GC7 A;  1AQ6 A;  2JMG A;  2KJ9 A;  4M0A A;  7ICQ A;  2PXI A;  9ICQ A;  4DSI A;  2ZTC A;  4Q43 A;  4DS5 A;  1NZP A;  1UPH A;  5DDY A;  5J0T A;  4QJF B;  4Y2V A;  4M6W B;  4O0I A;  4KMO B;  3EWA A;  3ETL A;  3H4B A;  2ASL A;  1C7Y A;  3SAH A;  4DQR A;  5H2F U;  4RQ4 A;  3QUC A;  5J0O A;  2ZIV A;  4YQW A;  1Q8K A;  3OSN A;  1Z1B A;  1HUZ A;  2XGP A;  2KFZ A;  1L8L A;  1XNS A;  4CF5 A;  2W03 A;  1Z00 A;  4NL9 A;  2LPE A;  4QZH A;  4YMO A;  5DG7 A;  2RP5 A;  5AIC A;  4PL1 A;  1OW5 A;  2KVS A;  1Z4O A;  1PVQ A;  3N4M B;  1X2I A;  2K89 A;  3PO5 A;  5AK3 A;  2BDP A;  4OJ5 A;  4UB8 U;  1ZJN A;  5J0R A;  4RPX A;  4RZR A;  3UM9 A;  3G6Y A;  2G5H B;  5J0U A;  2HBL A;  5D46 A;  2YB4 A;  4EZ6 A;  7ICR A;  3V7L A;  5DGB A;  5ALE A;  2IA6 A;  1BPX A;  4KLQ A;  5KT6 A;  1L7M A;  2G08 A;  3QXG A;  3ZDE A;  3RH5 A;  4P0Q B;  4JB3 A;  4I2H A;  5L1M A;  3PZP A;  9ICH A;  3JPR A;  3PX0 A;  3M6K A;  2FPM A;  1ZQN A;  5J2C A;  2R8K A;  2ZIU A;  3PVX A;  2KMD A;  2WF6 A;  4NM2 A;  4C4T A;  5EWG A;  4DFK A;  4YXM A;  5DB8 A;  3GDX A;  4J9S A;  2KZM A;  4ECY A;  1D9D A;  3BQ0 A;  2F8K A;  2BQR A;  4YD1 A;  9ICL A;  1ZQL A;  1BNO A;  1RYR A;  4Q8F A;  4O3Q A;  1COO A;  5DGA A;  5JRT A;  3SEN A;  1WUD A;  4PHP A;  2QAR A;  4EX6 A;  5IIJ A;  2HOF A;  9ICJ A;  4PHE A;  5BPC A;  4QZC A;  4KLF A;  4ED3 A;  5B5E U;  2YTU A;  4E0D A;  4IRC A;  1B43 A;  1ZQV A;  2MSN A;  2KG5 A;  4Z6E A;  2Q4T A;  3F2C A;  1ZQR A;  2I6X A;  4XA5 A;  5KFB A;  1KSP A;  2PKE A;  2HW3 A;  2OHF A;  2WF5 A;  2KZZ A;  1BPY A;  5T14 A;  1KBU A;  1Z3E B;  2ZXI A;  1N48 A;  2DPI A;  5CRX A;  4YR3 A;  1H38 A;  4Z6C A;  4EX7 A;  3THV A;  5ALY A;  3M7D A;  1ZQO A;  3AMZ A;  2Y9U A;  1JN3 A;  3C1Y A;  1ZRN A;  4ECV A;  5AI4 A;  1RPL A;  1T7P A;  1ARO P;  2Y1J A;  4DSL A;  5CP2 A;  2VJ5 A;  4Q44 A;  2XI9 A;  1XS9 D;  1ZQK A;  5FP0 A;  5ALG A;  4RQ7 A;  4C8L A;  1IXR A;  4DOA A;  7ICI A;  4K4I A;  5KFL A;  5AKZ A;  1FFU A;  4NY8 A;  3C5F A;  2KIW A;  4I2G A;  1U47 A;  2E8M A;  3U26 A;  1PUZ A;  5AM1 A;  2J6T A;  4RQ8 A;  3M6Z A;  4NV0 A;  3IV6 A;  4G9B A;  5IIO A;  1MC8 A;  2LM1 A;  4TUS A;  4C8O A;  4I2I A;  1WWV A;  4AYB C;  3HKZ C;  4F5R A;  3UMB A;  3MR3 A;  3A0B U;  3BS5 A;  3KFU F;  2R8I A;  2R8J A;  2RHF A;  1X6I A;  4C7Z A;  1KL9 A;  3HW8 A;  4OO1 J;  5DBB A;  8ICJ A;  3BZK A;  5KG1 A;  5ALF A;  4M9G A;  5DBA A;  4IQW A;  1A0P A;  2LYB A;  5KFK A;  5L1J A;  2RQ5 A;  4M47 A;  3TKA A;  3K75 D;  4ECZ A;  4RQM A;  3RJK A;  3DEE A;  4F4Y A;  4JK1 A;  4F93 B;  3WK5 A;  4P0P B;  1N2X A;  2JZB B;  2W8K A;  1KRP A;  4BWM A;  2PFP A;  3UQ0 A;  1ZQY A;  1IV8 A;  1JI7 A;  1XSL A;  2EAO A;  5AI8 A;  5KFO A;  4M04 A;  2Q0Z X;  2YN4 A;  8ICG A;  4IR1 A;  4DFD A;  1PK3 A;  1HJP A;  1JUD A;  5EWE A;  4YR2 A;  1WWU A;  1MQ3 A;  2HI0 A;  1ZQP A;  2GWS A;  1UQV A;  4UAT A;  3TFR A;  2AQ4 A;  3Q8L A;  3MDA A;  2HVH A;  5ALJ A;  4CCH A;  4EYI B;  2IBK A;  5AKK A;  3C2K A;  3RB4 A;  1V9P A;  2ODG A;  2W9C B;  4B9N A;  3FAH A;  3HIL A;  1CI4 A;  2NO4 A;  8ICA A;  5KFG A;  5KT5 A;  4EYH B;  5ALO A;  1KTQ A;  5DQG A;  9ICK A;  2JRZ A;  5J2B A;  1KFD A;  1XSN A;  4DFJ A;  1NK9 A;  3GIK A;  4FFD A;  4C7Y A;  1J97 A;  4ECT A;  4LVS A;  4F3O A;  3K4G A;  2G0A A;  2XIC A;  1A77 A;  5BOL A;  2C2R A;  3ICX A;  3SQI A;  9ICX A;  2MUT A;  2DKZ A;  2UVR A;  2LKY A;  4DOC A;  3GIJ A;  3TAD C;  8ICI A;  4F8R A;  4I27 A;  3C5G A;  1ZQW A;  4DCC A;  3PX4 A;  4I29 A;  1Q3V A;  4YMM A;  5KFM A;  2VKQ A;  1RYU A;  4J9Q A;  2F3N A;  4ECR A;  3RJJ A;  5J2J A;  3EPG A;  1MQ2 A;  1IG6 A;  3T5J A;  2WTF A;  2KTQ A;  4IR9 A;  1NK4 A;  1NKE A;  2KSO A;  3HPO A;  4MF2 A;  2R8G A;  2VA3 A;  2VAN A;  1PVR A;  3GV7 B;  3CRX A;  1DK3 A;  2E3T A;  5D49 A;  4Y2T A;  1B4F A;  2LYH A;  3RJI A;  3QU9 A;  2D6F C;  5EE0 A;  4Y2S A;  2P6R A;  2F44 A;  2FMQ A;  1ZQQ A;  1X66 A;  3MBY A;  4C4R A;  3EUB 2;  2B21 A;  5AKY A;  2W3R A;  5F3X B;  1TFR A;  2N1R A;  3UXO A;  3Q8K A;  3PO4 A;  5CB1 A;  4P4P A;  2LI6 A;  4CDG A;  2W9B B;  5J8Y A;  4O5E A;  3Q8S B;  4HAI A;  3RB0 A;  4PGQ A;  2ZIV B;  2A1A A;  2OM6 A;  1SKS A;  3ZDB A;  3PSI A;  2KIV A;  2QKQ A;  8ICN A;  2JEI A;  1QSL A;  2PI4 A;  1S0V A;  2BCS A;  3UPQ A;  1NI3 A;  4Y2R A;  9ICE A;  1BPD A;  1ZQF A;  5J2E A;  5HML A;  3H8M A;  4DQI A;  2W8L A;  4R66 A;  4C4S A;  1NK0 A;  5E79 U;  4J9K A;  3CYM A;  2KIC A;  1SZH A;  4I28 A;  8ICQ A;  3AL0 B;  2G07 A;  4BXO A;  1VJ5 A;  2NV3 A;  5DG8 A;  4B9T A;  4RT3 A;  3B0X A;  2Y1I A;  4DL4 A;  3ALR A;  4ZOH C;  4M9N A;  4UB1 A;  1D9F A;  1YZ6 A;  3MFI A;  1QSS A;  2H5X A;  4KLT A;  5EWF A;  1ZQ1 C;  3TFS A;  1TAQ A;  3JPQ A;  7ICH A;  5KT4 A;  4YD2 A;  4IQT A;  4MEX A;  7ICV A;  1DOQ A;  5ALH A;  3ETR A;  3QE9 Y;  2XY5 A;  3QU2 A;  2WF7 A;  3UXP A;  3L4P A;  5HHH A;  3Q8M A;  3RR7 A;  3KBB A;  4UAV A;  4EEL A;  3MR5 A;  4ZH4 A;  2HDO A;  2YQE A;  2WF9 A;  3H8W A;  1RZT A;  4DSJ A;  1QLN A;  2E5S A;  5ALI A;  5C5J A;  4UB2 A;  1L5U A;  2EZX A;  4TUP A;  4YVZ A;  3FM9 A;  3EYZ A;  4JV0 A;  4ICA A;  5CHG A;  1MSW D;  1NK6 A;  3RJG A;  2A19 A;  1O08 A;  3PW2 A;  4KLL A;  2ZUC A;  1MN8 A;  3C21 A;  2BCQ A;  4JV1 A;  4DL3 A;  2VIX A;  1NK8 A;  1JIH A;  3ONN A;  2BZF A;  2RDI A;  1ZQX A;  1KFS A;  8ICM A;  5KG2 A;  4FBT A;  2QB1 A;  3ZDD A;  3RAQ A;  3RR8 A;  2AGP A;  1ZQZ A;  4O5C A;  2QAR B;  1NKB A;  4O9M A;  2M0N A;  3NGD A;  2VA8 A;  4NLG A;  2ISP A;  1SIJ A;  4B9U A;  4MFA A;  4XUS A;  3OJU A;  3E0F A;  1UHU A;  1QCK A;  2EDU A;  2AXT U;  4MEY A;  2BPF A;  1LB2 B;  4FS1 A;  1ZQB A;  4IL6 U;  3WK7 A;  3PML A;  3QZ7 A;  1BVS A;  4OCZ A;  4QIW F;  4C8K A;  1K5O A;  1DGS A;  1V38 A;  4EEK A;  4CF3 A;  4QZ9 A;  1MA7 A;  2UVW A;  4F5N A;  5ALX A;  4C8M A;  2C28 A;  3KZI U;  4UB6 U;  3J81 j;  1PZN A;  4DO9 A;  4ECU A;  2GLE A;  7ICP A;  2XY7 A;  1RG6 A;  4RUC A;  1O03 A;  3M1Y A;  1SXE A;  5III A;  3HRD D;  5DKW A;  3HJE A;  2IHN A;  4R64 A;  2XY6 A;  4OD0 A;  1X42 A;  1S5L U;  5AKJ A;  2G5I B;  2DQN B;  5JUM A;  7ICF A;  2XID A;  1TV9 A;  2PFO A;  4KN4 A;  5IIL A;  5DBC A;  2V4Q A;  1X40 A;  3ZD8 A;  2HHW A;  5KFT A;  3ED5 A;  3OGU A;  2ZIW A;  4RQ3 A;  4QZA A;  2ZIX B;  4UBB A;  2IOH A;  3QYP A;  4DOB A;  1DRG A;  4CNQ A;  2P6U A;  2MA1 A;  1SV0 C;  4O3R A;  4GIB A;  4KX5 A;  4NLC A;  2CRX A;  1RQN A;  5KAF U;  4Y2J A;  3OJS A;  1WCL A;  4QZB A;  2NYV A;  4MFF A;  1LKY A;  4KLU A;  1ZET A;  2K4P A;  5ALW A;  4JWM A;  1TAU A;  4P4O A;  3PV8 A;  1HUO A;  3WK4 A;  2DPJ A;  5J2F A; 
#chains in the Genus database with same CATH homology
 1CEZ A;  3ZDC A;  3RAX A;  4B9M A;  4F4W A;  4DL7 A;  3HW8 A;  2AJQ A;  5DBB A;  2BCU A;  8ICJ A;  3M9M B;  2C2D A;  9ICI A;  1L3S A;  5KG1 A;  2I1Q A;  4J9R A;  2BQ3 A;  4M9G A;  5DBA A;  3PW5 A;  5D4B A;  4IQW A;  4DSK A;  5KFK A;  5L1J A;  3TAR A;  4FS2 A;  4F2R A;  8ICP A;  7ICO A;  4M47 A;  1EXN A;  3TAP A;  3K75 D;  3JPT A;  4ECZ A;  4EZ9 A;  3RJK A;  1BGX T;  5HMM A;  1L3U A;  4F4Y A;  4JK1 A;  4F93 B;  4ECX A;  4DLG A;  3PR4 A;  3SI8 A;  5J2A A;  2DFL A;  2NRW A;  9ICM A;  2A1J B;  2JZB B;  2ALZ A;  2W8K A;  1B22 A;  1KRP A;  4BWM A;  1NJX A;  2PFP A;  4RQ1 A;  3UQ0 A;  9ICS A;  1ZQY A;  1SL2 A;  4ECQ A;  2FMP A;  4EEY A;  1XSL A;  5BOM A;  2J6S A;  5KFO A;  4M04 A;  9ICT A;  2ZJ5 A;  5J0W A;  2Q0Z X;  8ICG A;  1ZQG A;  3V7K A;  9ICP A;  4R8U B;  4IR1 A;  4F2S A;  9ICR A;  4YXJ A;  1HJP A;  1TK5 A;  1WCN A;  4ED8 A;  2JEF A;  5KFQ A;  5EWE A;  4DFP A;  3PY8 A;  5KFF A;  4YR2 A;  3E2E A;  5HNK A;  1MQ3 A;  5KG7 A;  4F5Q A;  1ZQP A;  8ICH A;  2GWS A;  5KFC A;  4O3S A;  5KFZ A;  3GIM A;  4KIT B;  3TFR A;  2AQ4 A;  3ZD9 A;  3Q8L A;  3TQ1 A;  3MDA A;  4BWJ A;  2HVH A;  3N97 B;  4RNO A;  4CCH A;  4RNM A;  4KMU A;  5HHI A;  1XU4 A;  2A1J A;  3MAB A;  5KFY A;  4EYI B;  1KLN A;  4RQ0 A;  5KFA A;  1ZQT A;  2BQU A;  3JPP A;  4PHD A;  2W9B A;  3TI0 A;  4RNN A;  2IBK A;  2BKE A;  3C2K A;  4F4Z A;  4QWE A;  3RB4 A;  7ICT A;  1ZQJ A;  1U9L A;  1V9P A;  2MUT B;  2W9C B;  3RBD A;  1U48 A;  4B9N A;  3V72 A;  3PW4 A;  4B9S A;  8ICU A;  7ICU A;  3H40 A;  3EW9 A;  2BCR A;  4DF8 A;  7ICG A;  4KLH A;  8ICA A;  5KFG A;  4J9N A;  4KLG A;  3C23 A;  4LZG A;  2AU0 A;  5L1K A;  5KT5 A;  2XCP A;  4EYH B;  5IIN A;  3HT3 A;  4M9H A;  1KTQ A;  5DQG A;  9ICK A;  3MDC A;  5J2B A;  1U4B A;  1KFD A;  1XSN A;  2IHM A;  5J0P A;  3HX0 A;  4DFJ A;  3BDP A;  1NK9 A;  3KTQ A;  4RPZ A;  4IRK A;  2V4R A;  3GIK A;  1L3V A;  4KLM A;  4Q8E A;  8ICL A;  2FPL A;  3IM1 A;  4XQ8 A;  2PI5 A;  4K4G A;  7ICJ A;  3PR5 B;  4ECT A;  4LVS A;  9ICB A;  4DQP A;  5J29 A;  2C22 A;  3ISB A;  3K4G A;  4F3O A;  1QTM A;  5CR0 A;  1A77 A;  5BOL A;  2C2R A;  3M8S A;  1NJW A;  5DB7 A;  2ASJ A;  9ICX A;  2MUT A;  2FLP A;  4ED1 A;  2UVR A;  1BPB A;  5J0Y A;  4DOC A;  3IHQ B;  3GIJ A;  4F5P A;  4ED7 A;  4GXI A;  4NLZ A;  3GV8 B;  2UVV A;  4BDP A;  8ICI A;  1NJY A;  4YCX A;  4QWC A;  2RDJ A;  5KFR A;  1U45 A;  4F8R A;  4I27 A;  3C5G A;  1SL0 A;  1BPZ A;  1ZQW A;  3OHA A;  3PX4 A;  4I29 A;  2W9A A;  3AU2 A;  4YMM A;  3HP6 A;  1ZYQ A;  5KFM A;  5DDM A;  4J9Q A;  1JXL A;  1RYS A;  4ECR A;  3RJJ A;  4F92 B;  3RRG A;  5J2J A;  4R65 A;  3EPG A;  1NJZ A;  5KFH A;  1MQ2 A;  3ORY A;  3NTU A;  2KZ3 A;  2HHS A;  4DLE A;  3V7J A;  3T5J A;  2WTF A;  4LZD A;  1ZQE A;  2KTQ A;  2KFN A;  4DEZ A;  3OSP A;  4IR9 A;  2ZUB A;  5TZV A;  1SKR A;  9ICW A;  9ICA A;  1NK4 A;  1NKE A;  3HPO A;  3BQ1 A;  4MF2 A;  3C2L A;  3V6K A;  2R8G A;  8ICK A;  4M9L A;  2VA3 A;  3BQ2 A;  2VAN A;  5KG5 A;  3B0Y A;  3V6H A;  8ICT A;  9ICC A;  3GV7 B;  8ICV A;  1S0M A;  3EZ5 A;  3ISD A;  5D49 A;  3LWL A;  2BCV A;  3M8R A;  2LYH A;  3SYZ A;  4KN7 A;  4UAZ A;  4ELT A;  9ICF A;  5F9N A;  5DLF A;  3RJI A;  4DFM A;  5KFV A;  9ICV A;  4ELV A;  1KDH A;  1D8Y A;  3JPS A;  3RJF A;  3C1Z A;  3H8S A;  3PNC A;  2ZJA A;  1X9W A;  1S0O A;  2P6R A;  4I2J A;  5KFJ A;  4DL5 A;  4KLD A;  1T4G A;  1T8E A;  1XC9 A;  1TK8 A;  1ZQQ A;  4JUZ A;  2FMQ A;  4Z6F A;  4TQS A;  7ICK A;  3MBY A;  4ED2 A;  5DG9 A;  4UAW A;  2F1J A;  2B21 A;  1UA0 A;  1ZJM A;  2I9G A;  2V9W A;  5DQI A;  4J9L A;  4J9M A;  1TFR A;  3UXO A;  4F5O A;  3PX6 A;  1X9M A;  2NRV A;  5J0Q A;  4UQG A;  3RBE A;  3Q8K A;  4I2C A;  3PO4 A;  4I2E A;  4X5V A;  5CB1 A;  5DB6 A;  4P4P A;  4GXK A;  4DQS A;  4DQQ A;  1SZP A;  4I2F A;  4QZ8 A;  5KTQ A;  2HHT A;  1D8L A;  2W9B B;  4O5E A;  4DWI A;  3Q8S B;  5IIK A;  3ISC A;  4NM1 A;  3SV4 A;  2HHV A;  1IM4 A;  3RRH A;  4M9J A;  4P4M A;  4MFC A;  8ICX A;  2BGW A;  3RB0 A;  2ZTD A;  2MAX A;  4YMN A;  5CJ7 A;  4TUR A;  4F50 A;  4IRD A;  1ZQI A;  4M2Y A;  4PGQ A;  5CA7 A;  4QZI A;  4PGX A;  4BGD A;  4P2H A;  4RPY A;  4GC7 A;  1SKS A;  3ZDB A;  1S97 A;  4KLI A;  4BXO B;  4QW8 A;  5KT2 A;  2XCA A;  4M0A A;  8ICN A;  2JEI A;  9ICO A;  7ICQ A;  4B9L A;  2PXI A;  4PH5 A;  9ICQ A;  1QSL A;  2OWO A;  2PI4 A;  4FO6 A;  1S0V A;  2BCS A;  4DSI A;  2ZTC A;  3UPQ A;  8ICO A;  4Q43 A;  3KHR A;  4DS5 A;  9ICE A;  2P66 A;  1BPD A;  1ZQF A;  5DDY A;  5J2E A;  5J0T A;  5KFX A;  3TAN A;  4M6W B;  4O0I A;  3EWA A;  5HML A;  2ZTE A;  3BJY A;  3ETL A;  3H4B A;  4DQI A;  4J9O A;  2ASL A;  1S0N A;  1C7Y A;  1NOM A;  7ICM A;  2W8L A;  4R66 A;  4DQR A;  1K1S A;  4RQ4 A;  4J9K A;  3BQT A;  1S10 A;  1NK0 A;  7ICS A;  5KG4 A;  3MFH A;  4PGY A;  3AUO A;  4I28 A;  5J0O A;  3MGI A;  4KLO A;  8ICQ A;  2AQ0 A;  4YQW A;  5KG0 A;  4UAY A;  3OSN A;  1HUZ A;  4EBD A;  4BXO A;  2XGP A;  2KFZ A;  5KG6 A;  5DG8 A;  2HHX A;  4ECW A;  5J2G A;  4TUQ A;  4B9T A;  1Z00 A;  4RT3 A;  4Z6D A;  3B0X A;  4JWN A;  2Y1I A;  4DL4 A;  4M9N A;  2ZJ8 A;  4QZH A;  4UB1 A;  2M9N A;  2ATL A;  4YMO A;  1LV5 A;  5DG7 A;  1D9F A;  3JPN A;  3GII A;  3MFI A;  4M6W A;  2C2E A;  3EPI A;  5DLG A;  1QSS A;  2H5X A;  4KLT A;  1XWL A;  1NKC A;  5EWF A;  3N4M B;  1X2I A;  4O3P A;  4RQ2 A;  4O3O A;  3TFS A;  3GFK B;  1TAQ A;  3JPQ A;  1ZQA A;  3PO5 A;  2BDP A;  7ICH A;  1NK5 A;  4YN4 A;  5KT4 A;  4YD2 A;  5EOZ A;  1L3T A;  2F1I A;  4QZF A;  4IQT A;  4MEX A;  7ICV A;  1DOQ A;  5CWR A;  1ZJN A;  5J0R A;  4GXJ A;  3RJH A;  4B9V A;  4RPX A;  4RZR A;  3KHL A;  2XY5 A;  4MF8 A;  3QE9 Y;  3G6Y A;  2BR0 A;  1ZQU A;  1ZQC A;  1UT8 A;  5J0U A;  3RTV A;  5J2K A;  4DS4 A;  5F9L A;  3UXP A;  5HHH A;  3G6X A;  3Q8M A;  3RR7 A;  3MR5 A;  2IMW P;  4ZH4 A;  5KT3 A;  1KFT A;  1S9F A;  8ICC A;  5D46 A;  3H8W A;  1RZT A;  4NLK A;  4DSJ A;  1S76 D;  1QLN A;  4UB4 A;  4UB2 A;  5C5J A;  1L5U A;  4YFK A;  4EZ6 A;  1JX4 A;  5KFW A;  7ICR A;  3V7L A;  4YVZ A;  4TUP A;  5DGB A;  3EYZ A;  4KLS A;  4JV0 A;  2IA6 A;  4KLJ A;  1BPX A;  4F4K A;  9ICG A;  5CHG A;  4ED0 A;  4QW9 A;  2XC9 A;  3QEA Z;  4KLQ A;  1MSW D;  1NK6 A;  5KT6 A;  2FLN A;  3RJG A;  4UB3 A;  7ICN A;  4DSF A;  5J0X A;  2VA2 A;  3QZ8 A;  3ZDE A;  3RH5 A;  4DL6 A;  4KTQ A;  4KLL A;  3PW2 A;  2FMS A;  2ZUC A;  2BCQ A;  3C21 A;  8ICS A;  1N56 A;  3RB6 A;  2ASD A;  2FLL A;  4JV1 A;  2HVI A;  4DL3 A;  2BPC A;  5J2D A;  5J2I A;  4I2H A;  3FYH A;  1NK8 A;  2F1H A;  3JPR A;  3H8J A;  4GC6 A;  3PX0 A;  9ICH A;  9ICU A;  2FPM A;  1JIH A;  1ZQN A;  4QZD A;  2AGO A;  2RDI A;  1K1Q A;  1ZQX A;  5L1I A;  3ZDA A;  5J2C A;  4TQR A;  1KFS A;  2R8K A;  1QSY A;  8ICM A;  2NRZ A;  3RH4 A;  3PVX A;  5KG2 A;  1X9S A;  4QWD A;  4FBT A;  4GLX A;  4RT2 A;  4NM2 A;  3ZDD A;  5EWG A;  4EBE A;  4DFK A;  4YXM A;  3RAQ A;  5DB8 A;  3RR8 A;  2AGP A;  3GDX A;  1ZQZ A;  4O5C A;  1NKB A;  4UB5 A;  1U49 A;  4J9S A;  1RXV A;  4O3N A;  4O9M A;  2KZM A;  3RH6 A;  5L1L A;  1ZQM A;  8ICW A;  4DSE A;  3NGD A;  2VA8 A;  4ECY A;  4NLG A;  2ISP A;  4YR0 A;  4B9U A;  4MFA A;  4DL2 A;  1D9D A;  4I2A A;  4XUS A;  3BQ0 A;  3OJU A;  4YG2 A;  5IIM A;  3JPO A;  3M9N B;  4UBC A;  4C8N A;  4YD1 A;  4MEY A;  2BQR A;  3C2M A;  9ICL A;  1ZQL A;  5KT7 A;  2BPF A;  1RYR A;  1LB2 B;  4Q8F A;  3T3F A;  4FS1 A;  1ZQB A;  4JV2 A;  8ICR A;  4O3Q A;  1COO A;  2XGQ A;  3PML A;  5DGA A;  2PFQ A;  4F91 B;  1Z00 B;  5KFN A;  4R63 A;  1BVS A;  3QZ7 A;  2BPG A;  4K4H A;  2HHU A;  2XO7 A;  4ELU A;  4PHP A;  4C8K A;  4J9P A;  1DGS A;  5KFD A;  5KFE A;  5IIJ A;  4QZ9 A;  4G3I A;  1S77 D;  9ICJ A;  5KFU A;  5BPC A;  4PHE A;  2UVW A;  2KN7 A;  4QZC A;  5KFP A;  4F5N A;  4KLF A;  4PPX A;  3RB3 A;  4ED3 A;  3TAQ A;  4E0D A;  4IRC A;  1B43 A;  3MGH A;  5HP4 A;  2NRT A;  3SZ2 A;  1ZQV A;  3H7I A;  4EBC A;  4RQ6 A;  1NK7 A;  4XRH A;  1XO1 A;  4Z6E A;  1KEJ A;  4C8M A;  2C28 A;  1ZQR A;  3FDS A;  2W9M A;  4XA5 A;  1UA1 A;  4IQU A;  5KFB A;  1KSP A;  1PZN A;  1SKW A;  4DO9 A;  2HW3 A;  4ECU A;  2JZB A;  1JMS A;  4QWB A;  7ICP A;  4I2B A;  3GV5 B;  3QEB Z;  2FPK A;  2HHQ A;  3UQ2 A;  1SL1 A;  2KZZ A;  1BPY A;  2XY7 A;  4NXZ A;  8ICE A;  1Z3E B;  4RUC A;  1N48 A;  4F4X A;  1ZQS A;  4RQ5 A;  7ICL A;  3SV3 A;  2DPI A;  2JEG A;  2R8H A;  1JXE A;  4YR3 A;  5III A;  1H38 A;  1A76 A;  5DKW A;  4Z6C A;  4YP3 A;  8ICF A;  4R8U A;  3THV A;  4O5K A;  2ZUD A;  4KLE A;  2IHN A;  2NRX A;  3LDA A;  4R64 A;  4ECS A;  2XY6 A;  1ZQO A;  5L9X A;  1JN3 A;  3T5K A;  3C1Y A;  4ECV A;  3PMN A;  1RPL A;  5JUM A;  1T7P A;  3T5H A;  1ARO P;  7ICF A;  2Y1J A;  4DSL A;  1TV9 A;  5CP2 A;  3RJE A;  4Q44 A;  3T5L A;  1XS9 D;  2PFO A;  1ZQK A;  4I2D A;  4KN4 A;  5IIL A;  5DBC A;  2V4Q A;  2UVU A;  4RQ7 A;  1TK0 A;  3ZD8 A;  1ZQH A;  4C8L A;  9ICN A;  3AU6 A;  2HHW A;  3KHH A;  1BPE A;  2PFN A;  4QZG A;  5KFT A;  3UXN A;  3OGU A;  4RQ3 A;  1IXR A;  4QZA A;  4DOA A;  7ICI A;  4K4I A;  4QZE A;  4UBB A;  3V6J A;  5KFL A;  2W9C A;  3Q8R B;  3G6V A;  4QWA A;  1ZQD A;  5KG3 A;  3M9O B;  8ICB A;  4DOB A;  3KHG A;  3HWT A;  4FBU A;  4NY8 A;  2BHN A;  3C5F A;  4I2G A;  2P6U A;  3LK9 A;  4O3R A;  4ED6 A;  2AGQ A;  1U47 A;  1RXW A;  3MR2 A;  7ICE A;  1CUK A;  3OJS A;  2J6T A;  1WCL A;  4RQ8 A;  3OHB A;  4IQV A;  4QZB A;  3H4D A;  3MR6 A;  3GIL A;  1TVA A;  4NLN A;  3LWM A;  4Q45 A;  1XSP A;  4MFF A;  4RUA A;  4HYK A;  3Q8P B;  3PW7 A;  1T3N A;  5J2H A;  4KLU A;  8ICZ A;  5IIO A;  8ICY A;  1MC8 A;  4DF4 A;  1ZET A;  5J0S A;  4TUS A;  4C8O A;  4I2I A;  2J6U A;  4JWM A;  4RU9 A;  1TAU A;  4F5R A;  1Y88 A;  3PW0 A;  4P4O A;  5KFI A;  3MR3 A;  3Q8Q B;  1TKD A;  3PV8 A;  4PHA A;  5KFS A;  2ISO A;  1HUO A;  2JEJ A;  2DPJ A;  2R8I A;  5DQH A;  5J2F A;  5DB9 A;  2R8J A;  1UT5 A;  3GQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...