1U9LA

Structural basis for a nusa- protein n interaction
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
b'AHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation protein nusA
publication title Structural basis for the interaction of Escherichia coli NusA with protein N of phage lambda
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 22
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u9lA00
3RTVA 1ZQMA 4BXOB 2XY6A 4DS5A 3PO4A 1U48A 2UVVA 3ETLA 7ICMA 4DSEA 5KT6A 3C5FA 1KLNA 3LWMA 3PW7A 4ED8A 5CR0A 7ICIA 1NJZA 2KFNA 8ICMA 4YCXA 5J2CA 2RDIA 3E2EA 4I28A 2ZTEA 4O5KA 4DSJA 4I27A 4M9LA 4XQ8A 4RT2A 4K4GA 2ZUCA 4ECQA 2BR0A 4O5CA 2KTQA 2HHQA 7ICRA 1ZQLA 9ICSA 2P6UA 2MAXA 1RYRA 4QZCA 1XO1A 4UB3A 3MGHA 2XCAA 9ICLA 9ICOA 4LZDA 8ICNA 4MFCA 8ICUA 3V7LA 5DB7A 9ICPA 4XRHA 2Y1IA 4DL4A 2DPJA 4MF2A 5DLGA 1RZTA 1SKWA 1ZQJA 3H40A 5KFHA 7ICPA 1NJWA 4NLKA 3GV5B 4B9TA 5L1JA 3GDXA 1ZQIA 4YN4A 7ICFA 4F50A 2RDJA 3JPOA 3ZDDA 4NLZA 3TARA 2BPGA 4JV0A 4O3RA 4P4PA 3QEBZ 5KFNA 2BKEA 4Z6EA 3RJEA 1S0VA 8ICGA 2UVRA 4GXJA 2Y1JA 3G6VA 2AJQA 4YVZA 4J9SA 3LDAA 4P4OA 4P4MA 2AGQA 2J6SA 4NM1A 8ICFA 3RR8A 3V6JA 3TAPA 5KFUA 4UB2A 2W9CA 3EZ5A 3GQCA 5DGBA 2WTFA 3SZ2A 1XSPA 1RYSA 2UVWA 4KLHA 3RB4A 4UQGA 8ICTA 2XGQA 4M9GA 3V6KA 5KFMA 4GLXA 5KG3A 1L3VA 4JWMA 4KLUA 1NKBA 4PPXA 5DBCA 5IIJA 9ICAA 2KZ3A 4DO9A 3HT3A 4ECUA 1X9WA 1ZQPA 4RPZA 2W9BB 1ZQVA 4BXOA 2AQ0A 3G6XA 2BPFA 5KT3A 5DBAA 3QEAZ 4YMMA 4KLGA 4YMOA 4RT3A 5DB9A 2ASDA 4Q8EA 1SKSA 4FBTA 4PH5A 4DEZA 3TANA 8ICOA 4EBDA 2PXIA 1ZQWA 4ED7A 2C2EA 4F4WA 3RRGA 2HHTA 3TFSA 2HVHA 2HHSA 1S0OA 4DF4A 4DSIA 3SV3A 4C8LA 4YG2A 5J0OA 4NLGA 4NLNA 4UAYA 7ICUA 2HVIA 5DKWA 3RRHA 3V6HA 4RQ2A 3BDPA 4Z6FA 1TK0A 4EBEA 2JEFA 1B22A 9ICHA 4TQSA 4QZDA 4DFKA 4FBUA 8ICCA 2XGPA 5HMLA 5L1IA 4PHEA 3HP6A 3UQ2A 1H38A 1ZJMA 1B43A 1TKDA 4MEYA 4ECSA 4J9QA 5J2BA 1TV9A 8ICEA 9ICGA 5KT7A 2OWOA 1K1QA 1JXLA 3MFHA 4R64A 3B0XA 4DL6A 5J2JA 3Q8MA 1Y88A 1ZQNA 4QW9A 2NRVA 5CWRA 1XSNA 3T3FA 5J0PA 4TQRA 2IBKA 3EYZA 4C8NA 4TUSA 5F9LA 3JPNA 1MC8A 4IQVA 2XCPA 1SZPA 2NRXA 4B9NA 4UB4A 4BWMA 5KFSA 2DFLA 1L3TA 7ICJA 4RPXA 1C7YA 4ED0A 1SL0A 1ZYQA 1XWLA 3NTUA 3M9OB 5DGAA 3RBEA 2PI5A 4B9LA 2F1JA 4MFFA 4J9MA 4M47A 5KFVA 1RXWA 1WCNA 2FMPA 2H5XA 4M9NA 4O5EA 2W9BA 1COOA 2HHUA 4ED3A 3GV7B 2BHNA 5J0XA 4J9KA 2XY5A 2ZUDA 2JEIA 3BQ0A 3GV8B 1ZQSA 4QWEA 1PZNA 4QWBA 4ELUA 4QWCA 3HW8A 8ICQA 3PX6A 3V72A 3ZD9A 4XUSA 3HPOA 3BJYA 9ICQA 1ZQXA 1X9SA 3OSNA 4EYHB 4TUPA 4ECRA 2ASJA 4F92B 3C2MA 5L1LA 4DSKA 4YFKA 7ICQA 9ICVA 8ICSA 4I2GA 4BGDA 4F91B 1Z00A 2FMSA 3ZDCA 2VA3A 4Q44A 3MR2A 3RAXA 2BCSA 2VA2A 5KFKA 1ZQQA 4FO6A 2AGOA 2PFPA 1X2IA 2W8KA 5J0RA 4P2HA 4DQIA 9ICMA 4JV2A 4MEXA 3C1ZA 3MR3A 4Z6DA 3SV4A 8ICIA 3PX4A 4UAZA 4R65A 5DDMA 1A76A 3PW2A 1NK4A 1KFSA 4O3PA 1QSLA 2A1JA 2BCVA 4ECVA 5KFLA 1ZQRA 4RNNA 2BPCA 5KFEA 2KZMA 2BGWA 4I2FA 1TFRA 4O3QA 5KG7A 1BVSA 3JPRA 4CCHA 2ZUBA 2J6TA 5DQIA 4YD1A 5KFQA 5KFFA 2FPLA 5BOLA 4TURA 2C2RA 1BPXA 2IHNA 4JWNA 2VANA 9ICRA 2AU0A 7ICEA 4ECXA 7ICLA 4J9NA 4F4KA 3MR6A 1D8YA 3OJSA 1S10A 1TVAA 1JX4A 3RJJA 4DOAA 4KLDA 1QTMA 3OGUA 4KITB 2V4QA 4IRDA 4I2DA 3Q8LA 4R8UB 5J2EA 4ECZA 4DSLA 1QSSA 3MDAA 3B0YA 4QW8A 1JN3A 4F4XA 4F8RA 4O3OA 2ISOA 2C2DA 1DOQA 4Z6CA 9ICXA 1RPLA 1NKCA 5KFZA 3AUOA 2IHMA 4K4IA 9ICFA 8ICKA 3SI8A 1UT5A 1ZQTA 5IINA 5DG7A 2C28A 4MF8A 4RNOA 2ISPA 4IRKA 4YXMA 4JK1A 5TZVA 1L3UA 1BPEA 5EOZA 5IIKA 4C8MA 5DDYA 1KRPA 9ICEA 4O0IA 3T5KA 1TK5A 2V4RA 1L5UA 9ICJA 2M9NA 4RPYA 4B9MA 5L9XA 3BQ1A 3RH6A 5KT4A 1JIHA 5BOMA 4K4HA 4QZGA 3UPQA 1TAUA 2KN7A 2JEJA 5KG1A 1NKEA 5J2GA 5HMMA 4RQ7A 2P66A 4KLIA 4YP3A 1XS9D 3C2LA 4DWIA 2FPMA 2ZJ5A 1S0NA 5KG0A 5KT2A 1ZQYA 2KFZA 4RU9A 4F5NA 3MR5A 5DQHA 4QZAA 4GC6A 1KFTA 1S76D 1CEZA 7ICKA 5J0QA 1Z00B 1MQ3A 4F4YA 1ZQUA 4DQSA 2MUTB 3RB0A 4QZIA 9ICIA 3ORYA 4YXJA 1NOMA 5J29A 8ICHA 4RQ5A 4QZEA 5J2DA 3PX0A 4KTQA 5KG4A 4QZHA 3T5JA 4QZ8A 4J9PA 5KFBA 1NJYA 2ZTDA 1T7PA 4O9MA 5HHHA 2J6UA 4I29A 3HWTA 2A1JB 3PW4A 5J0SA 7ICOA 4DLGA 2PFOA 3Q8QB 4LZGA 1ZQKA 8ICAA 1RXVA 5EWFA 3Q8SB 4I2CA 4PHAA 2ZTCA 4R8UA 1L3SA 3JPPA 1D9FA 3JPQA 1U4BA 2FLNA 2R8KA 4ECTA 2IA6A 4C8OA 1S0MA 1T8EA 4QZ9A 2ZJAA 1HJPA 5KFJA 5CHGA 9ICCA 5KFCA 3GIKA 3EPIA 2NRWA 1DGSA 3UXPA 1NK5A 4ECWA 4I2IA 3PR4A 2PFQA 3ZDAA 4JV1A 3N97B 9ICWA 5KFOA 4UBBA 1T3NA 5CA7A 4DL2A 2R8JA 2F1HA 4RQ8A 3MBYA 4X5VA 3Q8PB 3H8WA 4F5PA 5CP2A 4KN7A 3C23A 3KHGA 5DG8A 1HUZA 5KFDA 3V7KA 2P6RA 4F5OA 3RJGA 4ELVA 2C22A 1XC9A 3FYHA 3MABA 3LK9A 5DB8A 3MGIA 4DL3A 3NGDA 1BPZA 9ICBA 4PGXA 4M6WB 3JPTA 3M8SA 4HYKA 4RQ1A 1NK8A 9ICNA 1XSLA 3SYZA 3TQ1A 4IQUA 4JUZA 3OHBA 8ICXA 4RQ3A 5CB1A 3M9NB 3RJHA 1NK6A 3GIMA 7ICTA 3ISCA 3PNCA 1NK9A 4LVSA 4DQRA 1WCLA 1T4GA 2XY7A 4XA5A 3TI0A 1N48A 4B9VA 4KLTA 2JZBA 5C5JA 5KFPA 4IR9A 1BGXT 2W9AA 3KHHA 3ZD8A 2BDPA 2GWSA 2MUTA 4IRCA 5J0TA 4DF8A 1ZETA 1ZQZA 2XC9A 4J9OA 5HP4A 5KFXA 2FPKA 2LYHA 3EW9A 1ZQCA 3GILA 5KFRA 4DS4A 2B21A 4DFJA 3ZDBA 4NY8A 1KTQA 4RQ6A 2W8LA 4DL7A 3M8RA 1UA1A 3PY8A 4I2HA 1XU4A 4RUAA 4EBCA 3KHLA 4Q8FA 4DOBA 3V7JA 3H8JA 1EXNA 1ZQDA 3EWAA 3UXOA 3AU6A 1MQ2A 1ZQEA 3N4MB 5HHIA 3G6YA 3LWLA 5DLFA 4ECYA 4DL5A 1D9DA 1KFDA 4EZ6A 3RBDA 3GFKB 2W9MA 4ED1A 4IQTA 3T5LA 2I1QA 4Q45A 3MFIA 4F93B 2FLLA 4ED6A 5DG9A 4UB5A 4E0DA 5KT5A 4YQWA 3PV8A 4KN4A 2HHXA 2I9GA 3TFRA 8ICWA 4FS2A 2NRZA 4DQQA 4J9RA 8ICRA 5F9NA 9ICUA 5J2HA 5KFWA 1ZJNA 2PI4A 1KSPA 1QLNA 5J0UA 1BPBA 3IHQB 3C5GA 2BQUA 3Q8RB 7ICHA 4PGYA 5KFGA 1SKRA 1S9FA 4TUQA 1S97A 5IILA 1BPDA 3OJUA 3K4GA 4B9SA 5KFIA 3HX0A 5EWEA 1UT8A 3H8SA 3RJIA 3KTQA 2KZZA 4M6WA 1ZQFA 5DB6A 4NM2A 3PW0A 3T5HA 4DQPA 4GC7A 5KG5A 2FMQA 3JPSA 2HW3A 4J9LA 4F2RA 4BWJA 1TAQA 2HHWA 4DSFA 3QZ8A 3RJFA 4KLJA 4GXKA 5KFTA 4PHPA 1ZQOA 5J0YA 4EYIB 4Q43A 5CJ7A 4QZFA 4DFPA 5IIOA 3QZ7A 7ICSA 3K75D 3ISBA 2R8IA 3RB6A 1S77D 4F2SA 1A77A 1LV5A 5BPCA 2BCQA 4IQWA 3KHRA 1LB2B 8ICVA 1KDHA 3H4DA 5IIIA 3IM1A 4QWDA 4ED2A 1X9MA 1V9PA 3AU2A 2BCUA 8ICYA 2JZBB 1QSYA 1N56A 4F5RA 3RH5A 5KTQA 3PO5A 3GIJA 4YMNA 5IIMA 4DFMA 3FDSA 4IR1A 5D49A 4UB1A 3PR5B 3H7IA 4RZRA 4M9HA 3THVA 3TAQA 5EWGA 1U49A 4F5QA 2ASLA 7ICVA 4PGQA 4I2BA 2ZJ8A 2BQ3A 3C2KA 4ZH4A 5J2KA 5L1KA 3RR7A 3OSPA 4RQ0A 3MDCA 3PW5A 4KLFA 8ICZA 2V9WA 5KG2A 4EZ9A 3BQ2A 3QE9Y 2VA8A 5J2IA 1HUOA 8ICJA 3C1YA 3PMNA 4UBCA 7ICNA 3UXNA 3C21A 1ZQAA 4YR2A 4C8KA 4KMUA 5DBBA 4RUCA 4GXIA 1Z3EB 4KLMA 5J2FA 3PVXA 4YR0A 3PMLA 1U45A 3RH4A 1NJXA 3H4BA 1K1SA 3UQ0A 1ZQGA 2ALZA 1D8LA 4RNMA 4KLEA 4NXZA 4UAWA 1U9LA 3BQTA 9ICTA 1ZQHA 4O3SA 4YD2A 2AQ4A 3OHAA 4F3OA 5KG6A 2DPIA 4EEYA 4G3IA 5JUMA 4R66A 2JEGA 2F1IA 3RJKA 2ATLA 1IM4A 5J0WA 4KLLA 1KEJA 5D46A 4MFAA 4KLQA 1U47A 5KFYA 4B9UA 3ZDEA 3ISDA 4R63A 1MSWD 3EPGA 4RQ4A 2IMWP 1ZQBA 1BPYA 2PFNA 3RB3A 4M2YA 4DLEA 2FLPA 1IXRA 4KLSA 2R8GA 3RAQA 8ICLA 5DQGA 4FS1A 2AGPA 1NK7A 4BDPA 4I2JA 8ICBA 5KFAA 5J2AA 4M04A 4YR3A 5D4BA 2W9CB 1NK0A 2HHVA 4I2EA 7ICGA 3GIIA 4F4ZA 2XO7A 2BCRA 4O3NA 2Q0ZX 4QWAA 1TK8A 2NRTA 5HNKA 3Q8KA 1AROP 4PHDA 2BQRA 4ELTA 4M9JA 1SL2A 1UA0A 9ICKA 1JXEA 4M0AA 8ICPA 2R8HA 4KLOA 1SL1A 2UVUA 3M9MB 1JMSA 1CUKA 4DOCA 4QZBA 4I2AA
chains in the Genus database with same CATH superfamily
3RTVA 1ZQMA 7ICMA 5H2FU 3PW7A 2K8BB 8ICMA 2W54A 2F2AB 2ZTEA 4O5KA 4O5CA 4I27A 4XQ8A 4K4GA 3NRWA 2ZUCA 4B6JA 9ICSA 5ALOA 3QYPA 1RYRA 2E1FA 2FI1A 4LZDA 2W43A 4MFCA 8ICUA 5B66U 4MF2A 3N28A 1RZTA 1SKWA 2GH1A 1ZQJA 7ICPA 3GV5B 3GDXA 5AI6A 5FP0A 4F50A 3UMGA 2BPGA 5J8YC 2G09A 4P4PA 1S0VA 2BKEA 5AK5A 2UVRA 4GXJA 2QB0B 5ALWA 3LDAA 4P4MA 4NM1A 2EZYA 5KFUA 5DGBA 4G9BA 3RB4A 3V6KA 1NKBA 4AP9A 5IIJA 3WKEA 1Z1BA 4ECUA 5DBAA 2ASDA 4RT3A 4Q8EA 1JROA 1ZQWA 1IV8A 4F4WA 3RRGA 3TFSA 1S0OA 3SV3A 1ZRNA 4RQ2A 3WKAA 1CRXA 5AI5A 4EBEA 1PVRA 4JB3A 1BNPA 4PHEA 4ECSA 1VDVA 3Q8MA 4QW9A 4TQRA 4C8NA 1X9XA 5KFSA 2F8KA 4Y2RA 1ZYQA 4MFFA 2E1EA 2H5XA 3DDHA 2HHUA 2BHNA 5J0XA 2ZUDA 2XI9A 3BQ0A 4UAUA 1X42A 4QWBA 4ELUA 2K4PA 2EDUA 3HW8A 8ICQA 2W3RA 4XUSA 1ZQXA 2DBYA 4F92B 1QQ5A 4YFKA 9ICVA 8ICSA 1V97A 4BGDA 1Z00A 1ECWA 2VA2A 5KFKA 2PFPA 2A3VA 4OCZA 4MEXA 8ICIA 2K4IA 1KFSA 2YQEA 4ECVA 2VKQA 4RNNA 5KFEA 2BGWA 4I2FA 5ALSA 1BVSA 2RQ5A 2DWQA 4YD1A 5GTHU 1N2XA 5BOLA 9ICRA 1L8LA 1S10A 4KLDA 3OGUA 4P0PB 2G08A 5AI9A 2DF4B 5AKIA 5J2EA 1L7MA 3MDAA 4O3OA 4KX5A 1UT5A 5DG7A 2EAOA 4RNOA 5AI8A 3NVWA 1L3UA 4Y2VA 3IG5A 5IIKA 4C8MA 5DDYA 2VJ5A 9ICEA 1T94A 2B6GA 4RPYA 5KNIA 1JIHA 2CPRA 4K4HA 4QNLA 4QZGA 3UPQA 2KN7A 3I28A 1NKEA 1SGGA 4RQ7A 1XS9D 2Y9TA 1ZQYA 5ALJA 3MR5A 1CEZA 1Z00B 1ZQUA 3RB0A 3ORYA 4RQ5A 3CYMA 4QZEA 3CRXA 3QU9A 5HHHA 4P0QA 2LMRA 5EE0A 1QQ6A 7ICOA 1ZD2P 4DLGA 4LZGA 3Q8QB 3Q8SB 1DXSA 2I6XA 3JPPA 1U4BA 1JRPA 4C8OA 1T8EA 1PK1A 1HJPA 9ICCA 3EPIA 4KMOB 3N97B 3PSIA 3QUCA 5CA7A 3H8WA 3F2CA 1M6YA 3C23A 2HSZA 5KFDA 2B0CA 5EE1A 4F5OA 1XC9A 3FYHA 2DUYA 2BZFA 1RYUA 3JPTA 3M8SA 1D8BA 5B5EU 2GO7A 1UPHA 4JUZA 2QARA 3RJHA 3M9NB 3LVWA 2W55A 5ALLA 3ISCA 1NK9A 5ALRA 2XY7A 4KLTA 3TI0A 5KFPA 1BGXT 2W9AA 3KHHA 3ZD8A 1ZQ1C 1WG8A 2MUTA 5J0TA 4DF8A 1ZETA 5HP4A 5KFXA 2FPKA 1SB3C 2B21A 4DFJA 4NY8A 4DL7A 3M8RA 1UA1A 4I2HA 5AKLA 2FDRA 1XU4A 3KHLA 3SAHA 2AHOB 3H8MA 1EXNA 1ZRMA 3EWAA 1MQ2A 3L4PA 2F3NA 4FZMA 1D9DA 4J03A 1OXJA 2W9MA 2D8CA 3S6JA 4P0QB 4ED6A 3QU2A 5AHXA 3N7PD 3A0HU 1CI4A 1GO3F 5KT5A 4YQWA 4KN4A 2I9GA 2K60A 5F9NA 5J2HA 1PK1B 3NUQA 5G5GA 3C5GA 3IHQB 4MHVA 1KL9A 2HBKA 3BS5A 4TUQA 1VJ5A 1BPDA 3OJUA 1UT8A 2KZZA 5AM2A 5KAFU 3PW0A 4J9LA 5ALFA 4DSFA 3RJFA 2D6FC 2EZZA 4IS7A 3K75D 3QUBA 1S77D 4WJ3B 1LV5A 5BPCA 2BCQA 3KHRA 3IM1A 4QWDA 1J2MA 3VC8A 1V9PA 2HDOA 1SWWA 4IR1A 1RDFA 5L1MA 3H7IA 4RZRA 3TKAA 3TAQA 3THVA 1U49A 2ASLA 2E8MA 5L1KA 1B0XA 3PW5A 8ICZA 2QB1A 4EZ9A 4EEKA 1YZ7A 3C1YA 4US9A 3UXNA 2EQYA 2KHVA 2ZIWB 1Z3EB 3E58A 2KEYA 1J2NA 5DBBA 5J2FA 2YMPA 2ZIUA 3UQ0A 9ICTA 1ZQHA 1JALA 4F3OA 4G3IA 4R66A 1IM4A 5J0WA 1B4FA 4KLQA 5ALUA 2PMZF 3ZDEA 3NRZA 3EPGA 4OJPA 4DLEA 1F0MA 4BDPA 4EX7A 5D4BA 2W9CB 4I2EA 3GIIA 2BCRA 2Q0ZX 5HNKA 3Q8KA 4ELTA 1UHUA 2BQRA 1JI7A 1JXEA 4FZLA 2UVUA 3M9MB 5CRXA 3BS7A 4DS5A 2MRLA 3MC1A 1L7NA 7ICIA 2K89A 2KMDA 3E0FA 4YCXA 4DSJA 1XNSA 2JXJA 1ZQLA 4QZCA 2EAPA 4UB3A 2JRZA 3MGHA 2ES6A 9ICPA 3VCBA 4OJLA 4DL4A 4PZOA 1NJWA 2BDUA 4B9TA 1L7PA 2RDJA 4JV0A 2CN1A 1BNOA 5KFNA 4Z6EA 2Y1JA 4YVZA 4J9SA 2AGQA 3TAPA 4UB2A 1PUZA 2KNJA 3EZ5A 3SZ2A 1XSPA 4DCCA 1RYSA 2UVWA 3M6KA 2XGQA 4M9GA 3TADC 4KLUA 2M0NA 4CE6A 2KP7A 4DO9A 2JHDA 4CNQA 3AM9A 4RPZA 3GU3A 2W9BB 2RLTA 1ZQVA 3G6XA 5KT3A 4YMMA 3PZPA 3M1YA 4JMUA 4FBTA 4DEZA 5ALXA 5ALIA 4EBDA 1L7OA 1O03A 2DKXA 2YX8A 2KVCA 2LM1A 5AM3A 4YG2A 5J0OA 4BUGA 4NLNA 4UAYA 7ICUA 2E8PA 3V6HA 1Z4NA 4TQSA 4QZDA 2YB1A 4PZNA 5L1IA 1ZJMA 9ICGA 3QUQA 5KT7A 3FAHA 4R64A 2QB0A 4NL9C 1WWVA 3EYZA 4TUSA 1MC8A 2KIWA 4CF5A 4UB4A 1L3TA 1UQVA 3ZI4A 3RBEA 2WHEA 4J9MA 5KFVA 1RXWA 4M9NA 2PMZC 4J9KA 2XY5A 5JU5A 3GV8B 4OJ5A 4IL6U 4QWEA 5ALGA 1PZNA 2W3SA 4U6PA 4QWCA 3N7RC 3ZD9A 3HPOA 9ICQA 5F3XB 3BJYA 2RHFA 2YY6A 3OSNA 1X9SA 4TUPA 2ASJA 3C2MA 5L1LA 2VA3A 5ALEA 2BCSA 4RQNA 4FO6A 2AGOA 4NLCA 4P2HA 4DQIA 2H3FA 5K4LA 3MR3A 3NVVA 4R65A 2NO4A 1QSLA 5KFLA 3QXGA 2BPCA 1TFRA 2ZUBA 5G5HA 4TURA 5KFFA 4NJ8A 4JWNA 2AU0A 3AMZA 4ECXA 3OJSA 4DOAA 3IDWA 4KITB 4UB6U 4I2DA 5EE9A 4US8A 4R8UB 4ECZA 4UW9A 9ICXA 4ACOA 1NKCA 3WK5A 3AUOA 2IHMA 2EH9A 1NZPA 1FFVA 4MF8A 3T79A 2ISPA 4JK1A 5TZVA 1BPEA 3B9JA 5EOZA 1N60A 1KRPA 4O0IA 1L5UA 2V4RA 2M9NA 3BQ1A 1UCVA 2G5HB 2I5HA 5J2GA 1TAMA 4C0ZA 4DWIA 2FPMA 2ZJ5A 5KG0A 4RU9A 3KD3A 3QUTA 3WU2U 4QZIA 9ICIA 5J29A 5AI4A 3A0BU 4OJ6A 3PX0A 4KTQA 5KG4A 4QZHA 3T5JA 1T7PA 5KFBA 2VJ4A 2ZTDA 3AEVA 4U7CA 4I29A 3TACB 3HWTA 3PW4A 5J0SA 2PFOA 4P0PA 1NNLA 2PKEA 1Z4OA 4ECTA 2ZJAA 4CGZA 2XIDA 5KFCA 1NK5A 4ECWA 4JV1A 3ICXA 9ICWA 4UBBA 3MBYA 4KN7A 3KHGA 5DG8A 2OHFA 2WB1F 3V7KA 3RJGA 2C22A 3MABA 1BPZA 5DB8A 3MGIA 3NGDA 1TE2A 1DGJA 2AH5A 5ALNA 1NK8A 5AKJA 3SYZA 3TQ1A 3OHBA 1Q3VA 7ICTA 3PNCA 2KZMA 1T4GA 1YT3A 4B9VA 5C5JA 3C29A 2BDPA 2KE7A 4J9OA 5AM1A 3EW9A 2WF9A 3ZDBA 1KTQA 3PY8A 2W8LA 4Q8FA 2JH7A 3IV6A 4DOBA 1SXDA 3QU4A 1ZQDA 3UXOA 3I76A 5HHIA 3G6YA 4DL5A 4EZ6A 4OJOA 4GIBA 4IQTA 2FLLA 5DG9A 3O0FA 1NI3A 2HHXA 3TFRA 4EX6A 4FS2A 2NRZA 3L3FX 4DQQA 2K8AA 5KFWA 2Z7JA 5ALHA 4EELA 2G5IB 2W03A 7ICHA 4PGYA 5IILA 5KFIA 3RJIA 1ZQFA 4NM2A 3OTQA 2K4EA 4GC7A 5KG5A 1URJA 2HHWA 5KFTA 1MA7A 4Q43A 5CJ7A 4QZFA 3QZ7A 1IIPA 1C20A 3ISBA 1S8OA 2KG5A 3F5AA 2F44A 1X9MA 1LKYA 5AKZA 1QSYA 2W11A 3BZKA 5HR7A 3FDSA 5EWGA 4F5QA 5HR6A 3C2KA 4ZH4A 4RQ0A 3MDCA 4KLFA 1HUOA 2VA8A 3K1RB 8ICJA 4C7YA 2HOQA 3UMBA 4C8KA 4RQMA 4C7ZA 4YR0A 1U45A 2A1AA 1RG6A 1K1SA 5AKHA 5T14A 1RQLA 1U9LA 3OHAA 1ED1A 2DL0A 2JEGA 2FE9A 2JGAA 2MSNA 4B9UA 5AKEA 4FFDA 2PFNA 5AM4A 1IXRA 4KLSA 3RAQA 4FS1A 8ICBA 5KFAA 2YMMA 3ED5A 2HI0A 4F4ZA 1DK2A 2WB1C 1TK8A 4UATA 1FO4A 1V85A 1UA0A 4Y2YA 3QNMA 1LKYB 2W7PA 1JMSA 1CUKA 4DOCA 3SQIA 2GOLA 4AYBF 1Q46A 4I2AA 4BXOB 3PO4A 2KKVA 2UVVA 3ETLA 4DSEA 3C5FA 4F71A 3LWMA 4ED8A 5CR0A 2KFNA 2ZIWA 1ZXIA 4M9LA 2Y9UA 4RT2A 1WWUA 2NYVA 3N7SC 4UASA 2XCAA 9ICOA 8ICNA 5DB7A 2Y1IA 2DPJA 5KFHA 3F2BA 5L1JA 3DEEA 4YN4A 7ICFA 3JPOA 4EENA 3ZDDA 1RM6C 4O3RA 4Y2TA 3QEBZ 4PL1A 8ICGA 2WF6A 2NV3A 4P4OA 8ICFA 3RR8A 3V6JA 2W9CA 1N5WA 3GQCA 2CXYA 2WTFA 4KLHA 1VLBA 2MA1A 4UQGA 8ICTA 2H3IA 3UMCA 1L3VA 3PSFA 4JWMA 4PPXA 2Q4TA 3HT3A 1ZQPA 4C4SA 5KAIU 2F77X 2BPFA 4ZOHC 5AIAA 1J97A 4KLGA 4YMOA 5DB9A 8ICOA 1SKSA 2PXIA 4ED7A 2C2EA 1IG6A 2HHTA 2HVHA 2HHSA 4DF4A 4DSIA 2WF5A 4C8LA 4NLGA 4CF4A 5DKWA 3BDPA 2KJ5A 4Z6FA 1TK0A 2JEFA 1B22A 3CW2C 3IN5A 4BJQA 1ZD5A 3KKAC 4DFKA 4FBUA 8ICCA 2Y0SF 3HP6A 1Z1VA 1TKDA 1B43A 4UARA 5ALKA 1SV4A 4FZNA 4J9QA 5J2BA 8ICEA 2W04A 2LYBA 1K1QA 3F5EA 3J81j 3MFHA 4DL6A 1Y88A 4NLBA 1ZQNA 2NRVA 1XSNA 2IBKA 2ZXHA 3JPNA 3CP8A 2EAMA 4B9NA 3WK6A 1KQQA 2DFLA 7ICJA 1SL0A 2IOFA 3NTUA 1SV0C 5DGAA 4B9LA 4UAVA 3PSTA 2ZIXA 2W9BA 1COOA 3SR6A 3CNHA 4ED3A 2JEIA 2ODGA 2H3VA 2KD1A 2AXTU 3V72A 3QU5A 4EYHB 2E3TA 3H0MB 3KOOA 4DSKA 2F8LA 4CRXA 4I2GA 4DFDA 4Q44A 3MR2A 1DRGA 3TADA 1X2IA 5J0RA 9ICMA 3C1ZA 3M7DA 3RF9A 3SV4A 4AYBC 1FEZA 4UAZA 3PX4A 1NK4A 1A76A 3AL0B 4O3PA 2A1JA 2BCVA 1ZQRA 4O3QA 3JPRA 5KG7A 4CCHA 2ZIVB 2J6TA 5DQIA 5KFQA 2VANA 5AICA 1X66A 3KZIU 7ICLA 4F4KA 3MR6A 1D8YA 1TVAA 2V4QA 3EUB2 2OCEA 1QSSA 3K1ZA 1JN3A 4F4XA 2C2DA 1DOQA 4Z6CA 5KFZA 1SWVA 8ICKA 3SI8A 1ZQTA 3HKZF 5IINA 3H0LB 4O3MA 2ESEA 4YXMA 3F53A 2WAQF 2ZIXB 3T5KA 3SENA 3D2QA 5KT4A 5BOMA 4OD0A 4BX9C 1TAUA 2O6KA 4KLIA 4YP3A 3C2LA 2K8CB 1S0NA 2KFZA 3U26A 4F5NA 1L6NA 4GC6A 4QZAA 1KFTA 1S76D 4F4YA 2P35A 4DQSA 1OW5A 2WFAA 2KICA 4YXJA 1NOMA 3IG8A 3NVZA 3SEIA 4F72A 4OO1J 9ICUA 4J9PA 1NJYA 2J6UA 3D2NA 1QCKA 5ALDA 2A1JB 5CEHA 1QQ7A 8ICAA 4R8UA 2ZTCA 3WK4A 2FLNA 2IA6A 2KHQA 5KFJA 2KJ8A 5CHGA 2KOBA 2Y0SC 4I2IA 3PR4A 1ZD4A 5AK6A 5KFOA 1T3NA 3SAGA 4X5VA 3MGVA 5CP2A 1HUZA 3HJEA 4ELVA 1N63A 3FM9A 2H3QA 2H3ZA 4DL3A 2JH1A 9ICBA 4PGXA 4M6WB 5J8YA 1XSLA 5ALZA 4RQ3A 3GIMA 2CRXA 4LVSA 1KKXA 4DQRA 1WCLA 1N48A 2JZBA 3WK7A 3DV9A 2GWSA 5ALPA 1ZQZA 4C4RA 2XC9A 2DQNB 2LYHA 1ZQCA 3GILA 3AQEA 3ETRA 5KFRA 4DS4A 4RQ6A 1S5LU 4RUAA 4EBCA 1P7DA 4A8EA 2WF7A 1A6SA 1HIWA 3N4MB 1KFDA 1RQNA 2I1QA 4Q45A 3KBBA 4UB5A 4E0DA 1OUQA 2PI4A 1KSPA 2BQUA 3Q8RB 5KFGA 1S97A 3AN1A 4B9SA 3KTQA 3HX0A 3IP4B 5EWEA 1ZD3A 1N61A 3T5HA 5AIBA 2FMQA 1Q8KA 3JPSA 5AKGA 4F2RA 2E5SA 1TAQA 1ZQOA 5AK3A 4EYIB 4DFPA 3HKZC 1A77A 3D2SA 1WUDA 4IQWA 8ICVA 2ZG6A 5IIIA 2GLEA 2JZBB 2WAQC 1N56A 1FFUA 2KKPA 3RH5A 2G07A 2HMXA 3GIJA 4YMNA 5IIMA 4DFMA 5D49A 4PGQA 4I2BA 2ZJ8A 2BQ3A 3OSPA 5KG2A 3BQ2A 3QE9Y 2LI6A 3PMNA 7ICNA 3C21A 2YN4A 1XO0A 1ZQAA 4YR2A 4KLMA 4KMUA 2W7OA 3PMLA 1NJXA 3RH4A 1F5SA 4KLEA 3BQTA 2AQ4A 2DPIA 1HEKA 3RJKA 4KLLA 3R9KA 1KEJA 5D46A 4MFAA 1NZBA 2K4HA 1U47A 3ISDA 4RQ4A 2IMWP 1ZQBA 4M2YA 2R8GA 3HRDD 2JV3A 5J2AA 2A19A 3QX7A 1T3QA 4M04A 5AK4A 4YR3A 1KBUA 2HBMA 5AKYA 3I1YA 4O3NA 1AROP 3NS1A 4PHDA 2OH2A 2DKZA 9ICKA 5E79U 4M0AA 2R8HA 3SAFA 4CF3A 1Z19A 2YMLA 4C80A 4QZBA 1Q3UA 5ALYA 2XY6A 1U48A 4KX3A 1YZ6A 5KT6A 1KLNA 1NJZA 5GTIU 2OM6A 4PL2A 1F44A 5J2CA 2RDIA 1KN5A 3E2EA 4I28A 3GZFA 8ICWA 4ECQA 2BR0A 2KTQA 2HHQA 2EZXA 7ICRA 2P6UA 1ZOLA 2G0AA 2MAXA 1XO1A 1SIJA 9ICLA 5C0YA 3V7LA 4XRHA 2MU2A 2XICA 5DLGA 3H40A 4NLKA 3ALRA 1ZQIA 3H0RB 3WKBA 4NLZA 3TARA 1PVPA 3RJEA 3KZXA 3G6VA 2AJQA 2J6SA 5KFMA 4GLXA 5KG3A 5DBCA 4FE3A 1MN8A 9ICAA 2KZ3A 1X9WA 1KW4A 1PVQA 1X40A 4BXOA 1O08A 2AQ0A 2WF8A 2KVSA 3QEAZ 2KK0A 4PH5A 3TANA 1X6IA 3M6ZA 5ALQA 1A0PA 3SMVA 2HVIA 3RRHA 2E8OA 5TISU 5JRTA 9ICHA 4NWIA 1WYGA 2XGPA 5HMLA 3UQ2A 1H38A 2LYAA 4MEYA 3WK8A 5A0LA 1TV9A 2OWOA 2QLTA 1JXLA 4NV0A 3B0XA 5J2JA 2FJ6A 5CWRA 3T3FA 5J0PA 4IC9A 5F9LA 2KSOA 4IQVA 2XCPA 1SZPA 2NRXA 4BWMA 4RPXA 1C7YA 4ED0A 1XWLA 3M9OB 2PI5A 2IOFK 2F1JA 4M47A 5AM0A 1WCNA 2FMPA 4O5EA 3D6JA 1L8OA 3GV7B 2YMQA 1ZQSA 1SXEA 3PX6A 5AKKA 2L5YA 4ECRA 1N5XA 7ICQA 5ALMA 4Y2SA 4F91B 2FMSA 3ZDCA 2KJ9A 1JUDA 3RAXA 1ZQQA 4Y2JA 5ALTA 2W8KA 2QKQA 3SD7A 4JV2A 4Z6DA 5DDMA 2IOHA 3PW2A 2YB4A 2IHNA 2FPLA 2C2RA 1BPXA 3PSPA 7ICEA 4J9NA 1JX4A 3RJJA 1QTMA 4IRDA 3Q8LA 2HBJA 4DSLA 2NO5A 1X6JA 3B0YA 4QW8A 2JMGA 4F8RA 2ISOA 2KSOB 1RPLA 3KFUF 4K4IA 9ICFA 3KKAA 2C28A 2HCFA 3C28A 4IRKA 3WK9A 1TK5A 9ICJA 4Y2QA 4B9MA 5L9XA 3RH6A 5AM5A 2JEJA 3AQFA 5KG1A 5HMMA 2P66A 2QARB 5KT2A 3WKCA 1SV0A 4QIWF 5DQHA 7ICKA 5J0QA 1MQ3A 2MUTB 2ZIVA 8ICHA 5J2DA 2XVTA 4QZ8A 4O9MA 2EANA 5ALVA 3F2DA 3WKDA 1ZQKA 1RXVA 5EWFA 4I2CA 4PHAA 1L3SA 2LHTA 1D9FA 3JPQA 2R8KA 1S0MA 4QZ9A 2LKYA 3GIKA 3UXPA 2NRWA 1DGSA 2PFQA 3ZDAA 2HOFA 1COKA 4ICAA 4DL2A 2R8JA 2F1HA 4RQ8A 3Q8PB 4F5PA 3NVYA 2P6RA 3BS5B 3LK9A 4C4TA 4HYKA 4RQ1A 9ICNA 2LBOA 4IQUA 8ICXA 5CB1A 1NK6A 1DK3A 3LVVA 4XA5A 3RFAA 4IR9A 5KL1B 4IRCA 1FIQA 5AI0A 4PJ0U 4UB8U 1QH9A 5KL8B 3H8JA 3V7JA 3AU6A 1ZQEA 5DLFA 3LWLA 4ECYA 3RBDA 3GFKB 4ED1A 3T5LA 3MFIA 4F93B 3UM9A 2RRDA 4Y2PA 3PV8A 2LPEA 3OPXA 2LM4A 8ICRA 4J9RA 2ZIUB 1ZJNA 1QLNA 2OYYA 5J0UA 1BPBA 2R18A 1SKRA 2G06A 1S9FA 1AQ6A 2F76X 3BZCA 1SZHA 2E8NA 3K4GA 3H8SA 2D3DA 4LJXA 4M6WA 4Y2XA 1N62A 2OEHA 5DB6A 2HOIA 4DQPA 4QJFB 2HBLA 2HW3A 4BWJA 3QZ8A 4NL9A 4KLJA 4GXKA 3HILA 4PHPA 5J0YA 5IIOA 3LYSA 7ICSA 2R8IA 3RB6A 4F2SA 1LB2B 3ONNA 1KDHA 3H4DA 4ED2A 2BCUA 3AU2A 8ICYA 4GFJA 2OXOA 4F5RA 2RP5A 5KTQA 3PO5A 4UB1A 3PR5B 3BQ7A 4M9HA 2YTUA 7ICVA 5J2KA 3RR7A 2JR5A 2V9WA 5J2IA 4USAA 1LVHA 4UBCA 4QIWC 4RUCA 4GXIA 3PVXA 5JTIA 3H4BA 3FC4A 3IRUA 1ZQGA 2ALZA 1D8LA 4RNMA 4NXZA 4UAWA 4Y2UA 4CDGA 3QU7A 4O3SA 2KIVA 4YD2A 5KG6A 2VIXA 4EEYA 5JUMA 2F1IA 2ATLA 1PK3A 3NASA 5KFYA 4R63A 5EE3A 1MSWD 2KV2A 1V38A 1BPYA 3RB3A 1K5OA 2FLPA 8ICLA 5DQGA 2AGPA 1NK7A 4I2JA 2N1RA 2DGZA 2ZXIA 5AKXA 1NK0A 2HHVA 7ICGA 2XO7A 4QWAA 2NRTA 4M9JA 1SL2A 8ICPA 4KLOA 1SL1A 4HAIA 3L5KA
chains in the Genus database with same CATH topology
3RTVA 1ZQMA 4BXOB 2XY6A 4DS5A 3PO4A 1U48A 2UVVA 3ETLA 7ICMA 4DSEA 5KT6A 3C5FA 1KLNA 3LWMA 3PW7A 4ED8A 5CR0A 7ICIA 1NJZA 2KFNA 8ICMA 4YCXA 5J2CA 2RDIA 3E2EA 4I28A 2ZTEA 4O5KA 4DSJA 4I27A 4M9LA 4XQ8A 4RT2A 4K4GA 2ZUCA 4ECQA 2BR0A 4O5CA 2KTQA 2HHQA 7ICRA 1ZQLA 9ICSA 2P6UA 2MAXA 1RYRA 4QZCA 1XO1A 4UB3A 3MGHA 2XCAA 9ICLA 9ICOA 4LZDA 8ICNA 4MFCA 8ICUA 3V7LA 5DB7A 9ICPA 4XRHA 2Y1IA 4DL4A 2DPJA 4MF2A 5DLGA 1RZTA 1SKWA 1ZQJA 3H40A 5KFHA 7ICPA 1NJWA 4NLKA 3GV5B 4B9TA 5L1JA 3GDXA 1ZQIA 4YN4A 7ICFA 4F50A 2RDJA 3JPOA 3ZDDA 4NLZA 3TARA 2BPGA 4JV0A 4O3RA 4P4PA 3QEBZ 5KFNA 2BKEA 4Z6EA 3RJEA 1S0VA 8ICGA 2UVRA 4GXJA 2Y1JA 3G6VA 2AJQA 4YVZA 4J9SA 3LDAA 4P4OA 4P4MA 2AGQA 2J6SA 4NM1A 8ICFA 3RR8A 3V6JA 3TAPA 5KFUA 4UB2A 2W9CA 3EZ5A 3GQCA 5DGBA 2WTFA 3SZ2A 1XSPA 1RYSA 2UVWA 4KLHA 3RB4A 4UQGA 8ICTA 2XGQA 4M9GA 3V6KA 5KFMA 4GLXA 5KG3A 1L3VA 4JWMA 4KLUA 1NKBA 4PPXA 5DBCA 5IIJA 9ICAA 2KZ3A 4DO9A 3HT3A 4ECUA 1X9WA 1ZQPA 4RPZA 2W9BB 1ZQVA 4BXOA 2AQ0A 3G6XA 2BPFA 5KT3A 5DBAA 3QEAZ 4YMMA 4KLGA 4YMOA 4RT3A 5DB9A 2ASDA 4Q8EA 1SKSA 4FBTA 4PH5A 4DEZA 3TANA 8ICOA 4EBDA 2PXIA 1ZQWA 4ED7A 2C2EA 4F4WA 3RRGA 2HHTA 3TFSA 2HVHA 2HHSA 1S0OA 4DF4A 4DSIA 3SV3A 4C8LA 4YG2A 5J0OA 4NLGA 4NLNA 4UAYA 7ICUA 2HVIA 5DKWA 3RRHA 3V6HA 4RQ2A 3BDPA 4Z6FA 1TK0A 4EBEA 2JEFA 1B22A 9ICHA 4TQSA 4QZDA 4DFKA 4FBUA 8ICCA 2XGPA 5HMLA 5L1IA 4PHEA 3HP6A 3UQ2A 1H38A 1ZJMA 1B43A 1TKDA 4MEYA 4ECSA 4J9QA 5J2BA 1TV9A 8ICEA 9ICGA 5KT7A 2OWOA 1K1QA 1JXLA 3MFHA 4R64A 3B0XA 4DL6A 5J2JA 3Q8MA 1Y88A 1ZQNA 4QW9A 2NRVA 5CWRA 1XSNA 3T3FA 5J0PA 4TQRA 2IBKA 3EYZA 4C8NA 4TUSA 5F9LA 3JPNA 1MC8A 4IQVA 2XCPA 1SZPA 2NRXA 4B9NA 4UB4A 4BWMA 5KFSA 2DFLA 1L3TA 7ICJA 4RPXA 1C7YA 4ED0A 1SL0A 1ZYQA 1XWLA 3NTUA 3M9OB 5DGAA 3RBEA 2PI5A 4B9LA 2F1JA 4MFFA 4J9MA 4M47A 5KFVA 1RXWA 1WCNA 2FMPA 2H5XA 4M9NA 4O5EA 2W9BA 1COOA 2HHUA 4ED3A 3GV7B 2BHNA 5J0XA 4J9KA 2XY5A 2ZUDA 2JEIA 3BQ0A 3GV8B 1ZQSA 4QWEA 1PZNA 4QWBA 4ELUA 4QWCA 3HW8A 8ICQA 3PX6A 3V72A 3ZD9A 4XUSA 3HPOA 3BJYA 9ICQA 1ZQXA 1X9SA 3OSNA 4EYHB 4TUPA 4ECRA 2ASJA 4F92B 3C2MA 5L1LA 4DSKA 4YFKA 7ICQA 9ICVA 8ICSA 4I2GA 4BGDA 4F91B 1Z00A 2FMSA 3ZDCA 2VA3A 4Q44A 3MR2A 3RAXA 2BCSA 2VA2A 5KFKA 1ZQQA 4FO6A 2AGOA 2PFPA 1X2IA 2W8KA 5J0RA 4P2HA 4DQIA 9ICMA 4JV2A 4MEXA 3C1ZA 3MR3A 4Z6DA 3SV4A 8ICIA 3PX4A 4UAZA 4R65A 5DDMA 1A76A 3PW2A 1NK4A 1KFSA 4O3PA 1QSLA 2A1JA 2BCVA 4ECVA 5KFLA 1ZQRA 4RNNA 2BPCA 5KFEA 2KZMA 2BGWA 4I2FA 1TFRA 4O3QA 5KG7A 1BVSA 3JPRA 4CCHA 2ZUBA 2J6TA 5DQIA 4YD1A 5KFQA 5KFFA 2FPLA 5BOLA 4TURA 2C2RA 1BPXA 2IHNA 4JWNA 2VANA 9ICRA 2AU0A 7ICEA 4ECXA 7ICLA 4J9NA 4F4KA 3MR6A 1D8YA 3OJSA 1S10A 1TVAA 1JX4A 3RJJA 4DOAA 4KLDA 1QTMA 3OGUA 4KITB 2V4QA 4IRDA 4I2DA 3Q8LA 4R8UB 5J2EA 4ECZA 4DSLA 1QSSA 3MDAA 3B0YA 4QW8A 1JN3A 4F4XA 4F8RA 4O3OA 2ISOA 2C2DA 1DOQA 4Z6CA 9ICXA 1RPLA 1NKCA 5KFZA 3AUOA 2IHMA 4K4IA 9ICFA 8ICKA 3SI8A 1UT5A 1ZQTA 5IINA 5DG7A 2C28A 4MF8A 4RNOA 2ISPA 4IRKA 4YXMA 4JK1A 5TZVA 1L3UA 1BPEA 5EOZA 5IIKA 4C8MA 5DDYA 1KRPA 9ICEA 4O0IA 3T5KA 1TK5A 2V4RA 1L5UA 9ICJA 2M9NA 4RPYA 4B9MA 5L9XA 3BQ1A 3RH6A 5KT4A 1JIHA 5BOMA 4K4HA 4QZGA 3UPQA 1TAUA 2KN7A 2JEJA 5KG1A 1NKEA 5J2GA 5HMMA 4RQ7A 2P66A 4KLIA 4YP3A 1XS9D 3C2LA 4DWIA 2FPMA 2ZJ5A 1S0NA 5KG0A 5KT2A 1ZQYA 2KFZA 4RU9A 4F5NA 3MR5A 5DQHA 4QZAA 4GC6A 1KFTA 1S76D 1CEZA 7ICKA 5J0QA 1Z00B 1MQ3A 4F4YA 1ZQUA 4DQSA 2MUTB 3RB0A 4QZIA 9ICIA 3ORYA 4YXJA 1NOMA 5J29A 8ICHA 4RQ5A 4QZEA 5J2DA 3PX0A 4KTQA 5KG4A 4QZHA 3T5JA 4QZ8A 4J9PA 5KFBA 1NJYA 2ZTDA 1T7PA 4O9MA 5HHHA 2J6UA 4I29A 3HWTA 2A1JB 3PW4A 5J0SA 7ICOA 4DLGA 2PFOA 3Q8QB 4LZGA 1ZQKA 8ICAA 1RXVA 5EWFA 3Q8SB 4I2CA 4PHAA 2ZTCA 4R8UA 1L3SA 3JPPA 1D9FA 3JPQA 1U4BA 2FLNA 2R8KA 4ECTA 2IA6A 4C8OA 1S0MA 1T8EA 4QZ9A 2ZJAA 1HJPA 5KFJA 5CHGA 9ICCA 5KFCA 3GIKA 3EPIA 2NRWA 1DGSA 3UXPA 1NK5A 4ECWA 4I2IA 3PR4A 2PFQA 3ZDAA 4JV1A 3N97B 9ICWA 5KFOA 4UBBA 1T3NA 5CA7A 4DL2A 2R8JA 2F1HA 4RQ8A 3MBYA 4X5VA 3Q8PB 3H8WA 4F5PA 5CP2A 4KN7A 3C23A 3KHGA 5DG8A 1HUZA 5KFDA 3V7KA 2P6RA 4F5OA 3RJGA 4ELVA 2C22A 1XC9A 3FYHA 3MABA 3LK9A 5DB8A 3MGIA 4DL3A 3NGDA 1BPZA 9ICBA 4PGXA 4M6WB 3JPTA 3M8SA 4HYKA 4RQ1A 1NK8A 9ICNA 1XSLA 3SYZA 3TQ1A 4IQUA 4JUZA 3OHBA 8ICXA 4RQ3A 5CB1A 3M9NB 3RJHA 1NK6A 3GIMA 7ICTA 3ISCA 3PNCA 1NK9A 4LVSA 4DQRA 1WCLA 1T4GA 2XY7A 4XA5A 3TI0A 1N48A 4B9VA 4KLTA 2JZBA 5C5JA 5KFPA 4IR9A 1BGXT 2W9AA 3KHHA 3ZD8A 2BDPA 2GWSA 2MUTA 4IRCA 5J0TA 4DF8A 1ZETA 1ZQZA 2XC9A 4J9OA 5HP4A 5KFXA 2FPKA 2LYHA 3EW9A 1ZQCA 3GILA 5KFRA 4DS4A 2B21A 4DFJA 3ZDBA 4NY8A 1KTQA 4RQ6A 2W8LA 4DL7A 3M8RA 1UA1A 3PY8A 4I2HA 1XU4A 4RUAA 4EBCA 3KHLA 4Q8FA 4DOBA 3V7JA 3H8JA 1EXNA 1ZQDA 3EWAA 3UXOA 3AU6A 1MQ2A 1ZQEA 3N4MB 5HHIA 3G6YA 3LWLA 5DLFA 4ECYA 4DL5A 1D9DA 1KFDA 4EZ6A 3RBDA 3GFKB 2W9MA 4ED1A 4IQTA 3T5LA 2I1QA 4Q45A 3MFIA 4F93B 2FLLA 4ED6A 5DG9A 4UB5A 4E0DA 5KT5A 4YQWA 3PV8A 4KN4A 2HHXA 2I9GA 3TFRA 8ICWA 4FS2A 2NRZA 4DQQA 4J9RA 8ICRA 5F9NA 9ICUA 5J2HA 5KFWA 1ZJNA 2PI4A 1KSPA 1QLNA 5J0UA 1BPBA 3IHQB 3C5GA 2BQUA 3Q8RB 7ICHA 4PGYA 5KFGA 1SKRA 1S9FA 4TUQA 1S97A 5IILA 1BPDA 3OJUA 3K4GA 4B9SA 5KFIA 3HX0A 5EWEA 1UT8A 3H8SA 3RJIA 3KTQA 2KZZA 4M6WA 1ZQFA 5DB6A 4NM2A 3PW0A 3T5HA 4DQPA 4GC7A 5KG5A 2FMQA 3JPSA 2HW3A 4J9LA 4F2RA 4BWJA 1TAQA 2HHWA 4DSFA 3QZ8A 3RJFA 4KLJA 4GXKA 5KFTA 4PHPA 1ZQOA 5J0YA 4EYIB 4Q43A 5CJ7A 4QZFA 4DFPA 5IIOA 3QZ7A 7ICSA 3K75D 3ISBA 2R8IA 3RB6A 1S77D 4F2SA 1A77A 1LV5A 5BPCA 2BCQA 4IQWA 3KHRA 1LB2B 8ICVA 1KDHA 3H4DA 5IIIA 3IM1A 4QWDA 4ED2A 1X9MA 1V9PA 3AU2A 2BCUA 8ICYA 2JZBB 1QSYA 1N56A 4F5RA 3RH5A 5KTQA 3PO5A 3GIJA 4YMNA 5IIMA 4DFMA 3FDSA 4IR1A 5D49A 4UB1A 3PR5B 3H7IA 4RZRA 4M9HA 3THVA 3TAQA 5EWGA 1U49A 4F5QA 2ASLA 7ICVA 4PGQA 4I2BA 2ZJ8A 2BQ3A 3C2KA 4ZH4A 5J2KA 5L1KA 3RR7A 3OSPA 4RQ0A 3MDCA 3PW5A 4KLFA 8ICZA 2V9WA 5KG2A 4EZ9A 3BQ2A 3QE9Y 2VA8A 5J2IA 1HUOA 8ICJA 3C1YA 3PMNA 4UBCA 7ICNA 3UXNA 3C21A 1ZQAA 4YR2A 4C8KA 4KMUA 5DBBA 4RUCA 4GXIA 1Z3EB 4KLMA 5J2FA 3PVXA 4YR0A 3PMLA 1U45A 3RH4A 1NJXA 3H4BA 1K1SA 3UQ0A 1ZQGA 2ALZA 1D8LA 4RNMA 4KLEA 4NXZA 4UAWA 1U9LA 3BQTA 9ICTA 1ZQHA 4O3SA 4YD2A 2AQ4A 3OHAA 4F3OA 5KG6A 2DPIA 4EEYA 4G3IA 5JUMA 4R66A 2JEGA 2F1IA 3RJKA 2ATLA 1IM4A 5J0WA 4KLLA 1KEJA 5D46A 4MFAA 4KLQA 1U47A 5KFYA 4B9UA 3ZDEA 3ISDA 4R63A 1MSWD 3EPGA 4RQ4A 2IMWP 1ZQBA 1BPYA 2PFNA 3RB3A 4M2YA 4DLEA 2FLPA 1IXRA 4KLSA 2R8GA 3RAQA 8ICLA 5DQGA 4FS1A 2AGPA 1NK7A 4BDPA 4I2JA 8ICBA 5KFAA 5J2AA 4M04A 4YR3A 5D4BA 2W9CB 1NK0A 2HHVA 4I2EA 7ICGA 3GIIA 4F4ZA 2XO7A 2BCRA 4O3NA 2Q0ZX 4QWAA 1TK8A 2NRTA 5HNKA 3Q8KA 1AROP 4PHDA 2BQRA 4ELTA 4M9JA 1SL2A 1UA0A 9ICKA 1JXEA 4M0AA 8ICPA 2R8HA 4KLOA 1SL1A 2UVUA 3M9MB 1JMSA 1CUKA 4DOCA 4QZBA 4I2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTV A;  1ZQM A;  4BXO B;  2XY6 A;  4DS5 A;  3PO4 A;  1U48 A;  2UVV A;  3ETL A;  7ICM A;  4DSE A;  5KT6 A;  3C5F A;  1KLN A;  3LWM A;  3PW7 A;  4ED8 A;  5CR0 A;  7ICI A;  1NJZ A;  2KFN A;  8ICM A;  4YCX A;  5J2C A;  2RDI A;  3E2E A;  4I28 A;  2ZTE A;  4O5K A;  4DSJ A;  4I27 A;  4M9L A;  4XQ8 A;  4RT2 A;  4K4G A;  2ZUC A;  4ECQ A;  2BR0 A;  4O5C A;  2KTQ A;  2HHQ A;  7ICR A;  1ZQL A;  9ICS A;  2P6U A;  2MAX A;  1RYR A;  4QZC A;  1XO1 A;  4UB3 A;  3MGH A;  2XCA A;  9ICL A;  9ICO A;  4LZD A;  8ICN A;  4MFC A;  8ICU A;  3V7L A;  5DB7 A;  9ICP A;  4XRH A;  2Y1I A;  4DL4 A;  2DPJ A;  4MF2 A;  5DLG A;  1RZT A;  1SKW A;  1ZQJ A;  3H40 A;  5KFH A;  7ICP A;  1NJW A;  4NLK A;  3GV5 B;  4B9T A;  5L1J A;  3GDX A;  1ZQI A;  4YN4 A;  7ICF A;  4F50 A;  2RDJ A;  3JPO A;  3ZDD A;  4NLZ A;  3TAR A;  2BPG A;  4JV0 A;  4O3R A;  4P4P A;  3QEB Z;  5KFN A;  2BKE A;  4Z6E A;  3RJE A;  1S0V A;  8ICG A;  2UVR A;  4GXJ A;  2Y1J A;  3G6V A;  2AJQ A;  4YVZ A;  4J9S A;  3LDA A;  4P4O A;  4P4M A;  2AGQ A;  2J6S A;  4NM1 A;  8ICF A;  3RR8 A;  3V6J A;  3TAP A;  5KFU A;  4UB2 A;  2W9C A;  3EZ5 A;  3GQC A;  5DGB A;  2WTF A;  3SZ2 A;  1XSP A;  1RYS A;  2UVW A;  4KLH A;  3RB4 A;  4UQG A;  8ICT A;  2XGQ A;  4M9G A;  3V6K A;  5KFM A;  4GLX A;  5KG3 A;  1L3V A;  4JWM A;  4KLU A;  1NKB A;  4PPX A;  5DBC A;  5IIJ A;  9ICA A;  2KZ3 A;  4DO9 A;  3HT3 A;  4ECU A;  1X9W A;  1ZQP A;  4RPZ A;  2W9B B;  1ZQV A;  4BXO A;  2AQ0 A;  3G6X A;  2BPF A;  5KT3 A;  5DBA A;  3QEA Z;  4YMM A;  4KLG A;  4YMO A;  4RT3 A;  5DB9 A;  2ASD A;  4Q8E A;  1SKS A;  4FBT A;  4PH5 A;  4DEZ A;  3TAN A;  8ICO A;  4EBD A;  2PXI A;  1ZQW A;  4ED7 A;  2C2E A;  4F4W A;  3RRG A;  2HHT A;  3TFS A;  2HVH A;  2HHS A;  1S0O A;  4DF4 A;  4DSI A;  3SV3 A;  4C8L A;  4YG2 A;  5J0O A;  4NLG A;  4NLN A;  4UAY A;  7ICU A;  2HVI A;  5DKW A;  3RRH A;  3V6H A;  4RQ2 A;  3BDP A;  4Z6F A;  1TK0 A;  4EBE A;  2JEF A;  1B22 A;  9ICH A;  4TQS A;  4QZD A;  4DFK A;  4FBU A;  8ICC A;  2XGP A;  5HML A;  5L1I A;  4PHE A;  3HP6 A;  3UQ2 A;  1H38 A;  1ZJM A;  1B43 A;  1TKD A;  4MEY A;  4ECS A;  4J9Q A;  5J2B A;  1TV9 A;  8ICE A;  9ICG A;  5KT7 A;  2OWO A;  1K1Q A;  1JXL A;  3MFH A;  4R64 A;  3B0X A;  4DL6 A;  5J2J A;  3Q8M A;  1Y88 A;  1ZQN A;  4QW9 A;  2NRV A;  5CWR A;  1XSN A;  3T3F A;  5J0P A;  4TQR A;  2IBK A;  3EYZ A;  4C8N A;  4TUS A;  5F9L A;  3JPN A;  1MC8 A;  4IQV A;  2XCP A;  1SZP A;  2NRX A;  4B9N A;  4UB4 A;  4BWM A;  5KFS A;  2DFL A;  1L3T A;  7ICJ A;  4RPX A;  1C7Y A;  4ED0 A;  1SL0 A;  1ZYQ A;  1XWL A;  3NTU A;  3M9O B;  5DGA A;  3RBE A;  2PI5 A;  4B9L A;  2F1J A;  4MFF A;  4J9M A;  4M47 A;  5KFV A;  1RXW A;  1WCN A;  2FMP A;  2H5X A;  4M9N A;  4O5E A;  2W9B A;  1COO A;  2HHU A;  4ED3 A;  3GV7 B;  2BHN A;  5J0X A;  4J9K A;  2XY5 A;  2ZUD A;  2JEI A;  3BQ0 A;  3GV8 B;  1ZQS A;  4QWE A;  1PZN A;  4QWB A;  4ELU A;  4QWC A;  3HW8 A;  8ICQ A;  3PX6 A;  3V72 A;  3ZD9 A;  4XUS A;  3HPO A;  3BJY A;  9ICQ A;  1ZQX A;  1X9S A;  3OSN A;  4EYH B;  4TUP A;  4ECR A;  2ASJ A;  4F92 B;  3C2M A;  5L1L A;  4DSK A;  4YFK A;  7ICQ A;  9ICV A;  8ICS A;  4I2G A;  4BGD A;  4F91 B;  1Z00 A;  2FMS A;  3ZDC A;  2VA3 A;  4Q44 A;  3MR2 A;  3RAX A;  2BCS A;  2VA2 A;  5KFK A;  1ZQQ A;  4FO6 A;  2AGO A;  2PFP A;  1X2I A;  2W8K A;  5J0R A;  4P2H A;  4DQI A;  9ICM A;  4JV2 A;  4MEX A;  3C1Z A;  3MR3 A;  4Z6D A;  3SV4 A;  8ICI A;  3PX4 A;  4UAZ A;  4R65 A;  5DDM A;  1A76 A;  3PW2 A;  1NK4 A;  1KFS A;  4O3P A;  1QSL A;  2A1J A;  2BCV A;  4ECV A;  5KFL A;  1ZQR A;  4RNN A;  2BPC A;  5KFE A;  2KZM A;  2BGW A;  4I2F A;  1TFR A;  4O3Q A;  5KG7 A;  1BVS A;  3JPR A;  4CCH A;  2ZUB A;  2J6T A;  5DQI A;  4YD1 A;  5KFQ A;  5KFF A;  2FPL A;  5BOL A;  4TUR A;  2C2R A;  1BPX A;  2IHN A;  4JWN A;  2VAN A;  9ICR A;  2AU0 A;  7ICE A;  4ECX A;  7ICL A;  4J9N A;  4F4K A;  3MR6 A;  1D8Y A;  3OJS A;  1S10 A;  1TVA A;  1JX4 A;  3RJJ A;  4DOA A;  4KLD A;  1QTM A;  3OGU A;  4KIT B;  2V4Q A;  4IRD A;  4I2D A;  3Q8L A;  4R8U B;  5J2E A;  4ECZ A;  4DSL A;  1QSS A;  3MDA A;  3B0Y A;  4QW8 A;  1JN3 A;  4F4X A;  4F8R A;  4O3O A;  2ISO A;  2C2D A;  1DOQ A;  4Z6C A;  9ICX A;  1RPL A;  1NKC A;  5KFZ A;  3AUO A;  2IHM A;  4K4I A;  9ICF A;  8ICK A;  3SI8 A;  1UT5 A;  1ZQT A;  5IIN A;  5DG7 A;  2C28 A;  4MF8 A;  4RNO A;  2ISP A;  4IRK A;  4YXM A;  4JK1 A;  5TZV A;  1L3U A;  1BPE A;  5EOZ A;  5IIK A;  4C8M A;  5DDY A;  1KRP A;  9ICE A;  4O0I A;  3T5K A;  1TK5 A;  2V4R A;  1L5U A;  9ICJ A;  2M9N A;  4RPY A;  4B9M A;  5L9X A;  3BQ1 A;  3RH6 A;  5KT4 A;  1JIH A;  5BOM A;  4K4H A;  4QZG A;  3UPQ A;  1TAU A;  2KN7 A;  2JEJ A;  5KG1 A;  1NKE A;  5J2G A;  5HMM A;  4RQ7 A;  2P66 A;  4KLI A;  4YP3 A;  1XS9 D;  3C2L A;  4DWI A;  2FPM A;  2ZJ5 A;  1S0N A;  5KG0 A;  5KT2 A;  1ZQY A;  2KFZ A;  4RU9 A;  4F5N A;  3MR5 A;  5DQH A;  4QZA A;  4GC6 A;  1KFT A;  1S76 D;  1CEZ A;  7ICK A;  5J0Q A;  1Z00 B;  1MQ3 A;  4F4Y A;  1ZQU A;  4DQS A;  2MUT B;  3RB0 A;  4QZI A;  9ICI A;  3ORY A;  4YXJ A;  1NOM A;  5J29 A;  8ICH A;  4RQ5 A;  4QZE A;  5J2D A;  3PX0 A;  4KTQ A;  5KG4 A;  4QZH A;  3T5J A;  4QZ8 A;  4J9P A;  5KFB A;  1NJY A;  2ZTD A;  1T7P A;  4O9M A;  5HHH A;  2J6U A;  4I29 A;  3HWT A;  2A1J B;  3PW4 A;  5J0S A;  7ICO A;  4DLG A;  2PFO A;  3Q8Q B;  4LZG A;  1ZQK A;  8ICA A;  1RXV A;  5EWF A;  3Q8S B;  4I2C A;  4PHA A;  2ZTC A;  4R8U A;  1L3S A;  3JPP A;  1D9F A;  3JPQ A;  1U4B A;  2FLN A;  2R8K A;  4ECT A;  2IA6 A;  4C8O A;  1S0M A;  1T8E A;  4QZ9 A;  2ZJA A;  1HJP A;  5KFJ A;  5CHG A;  9ICC A;  5KFC A;  3GIK A;  3EPI A;  2NRW A;  1DGS A;  3UXP A;  1NK5 A;  4ECW A;  4I2I A;  3PR4 A;  2PFQ A;  3ZDA A;  4JV1 A;  3N97 B;  9ICW A;  5KFO A;  4UBB A;  1T3N A;  5CA7 A;  4DL2 A;  2R8J A;  2F1H A;  4RQ8 A;  3MBY A;  4X5V A;  3Q8P B;  3H8W A;  4F5P A;  5CP2 A;  4KN7 A;  3C23 A;  3KHG A;  5DG8 A;  1HUZ A;  5KFD A;  3V7K A;  2P6R A;  4F5O A;  3RJG A;  4ELV A;  2C22 A;  1XC9 A;  3FYH A;  3MAB A;  3LK9 A;  5DB8 A;  3MGI A;  4DL3 A;  3NGD A;  1BPZ A;  9ICB A;  4PGX A;  4M6W B;  3JPT A;  3M8S A;  4HYK A;  4RQ1 A;  1NK8 A;  9ICN A;  1XSL A;  3SYZ A;  3TQ1 A;  4IQU A;  4JUZ A;  3OHB A;  8ICX A;  4RQ3 A;  5CB1 A;  3M9N B;  3RJH A;  1NK6 A;  3GIM A;  7ICT A;  3ISC A;  3PNC A;  1NK9 A;  4LVS A;  4DQR A;  1WCL A;  1T4G A;  2XY7 A;  4XA5 A;  3TI0 A;  1N48 A;  4B9V A;  4KLT A;  2JZB A;  5C5J A;  5KFP A;  4IR9 A;  1BGX T;  2W9A A;  3KHH A;  3ZD8 A;  2BDP A;  2GWS A;  2MUT A;  4IRC A;  5J0T A;  4DF8 A;  1ZET A;  1ZQZ A;  2XC9 A;  4J9O A;  5HP4 A;  5KFX A;  2FPK A;  2LYH A;  3EW9 A;  1ZQC A;  3GIL A;  5KFR A;  4DS4 A;  2B21 A;  4DFJ A;  3ZDB A;  4NY8 A;  1KTQ A;  4RQ6 A;  2W8L A;  4DL7 A;  3M8R A;  1UA1 A;  3PY8 A;  4I2H A;  1XU4 A;  4RUA A;  4EBC A;  3KHL A;  4Q8F A;  4DOB A;  3V7J A;  3H8J A;  1EXN A;  1ZQD A;  3EWA A;  3UXO A;  3AU6 A;  1MQ2 A;  1ZQE A;  3N4M B;  5HHI A;  3G6Y A;  3LWL A;  5DLF A;  4ECY A;  4DL5 A;  1D9D A;  1KFD A;  4EZ6 A;  3RBD A;  3GFK B;  2W9M A;  4ED1 A;  4IQT A;  3T5L A;  2I1Q A;  4Q45 A;  3MFI A;  4F93 B;  2FLL A;  4ED6 A;  5DG9 A;  4UB5 A;  4E0D A;  5KT5 A;  4YQW A;  3PV8 A;  4KN4 A;  2HHX A;  2I9G A;  3TFR A;  8ICW A;  4FS2 A;  2NRZ A;  4DQQ A;  4J9R A;  8ICR A;  5F9N A;  9ICU A;  5J2H A;  5KFW A;  1ZJN A;  2PI4 A;  1KSP A;  1QLN A;  5J0U A;  1BPB A;  3IHQ B;  3C5G A;  2BQU A;  3Q8R B;  7ICH A;  4PGY A;  5KFG A;  1SKR A;  1S9F A;  4TUQ A;  1S97 A;  5IIL A;  1BPD A;  3OJU A;  3K4G A;  4B9S A;  5KFI A;  3HX0 A;  5EWE A;  1UT8 A;  3H8S A;  3RJI A;  3KTQ A;  2KZZ A;  4M6W A;  1ZQF A;  5DB6 A;  4NM2 A;  3PW0 A;  3T5H A;  4DQP A;  4GC7 A;  5KG5 A;  2FMQ A;  3JPS A;  2HW3 A;  4J9L A;  4F2R A;  4BWJ A;  1TAQ A;  2HHW A;  4DSF A;  3QZ8 A;  3RJF A;  4KLJ A;  4GXK A;  5KFT A;  4PHP A;  1ZQO A;  5J0Y A;  4EYI B;  4Q43 A;  5CJ7 A;  4QZF A;  4DFP A;  5IIO A;  3QZ7 A;  7ICS A;  3K75 D;  3ISB A;  2R8I A;  3RB6 A;  1S77 D;  4F2S A;  1A77 A;  1LV5 A;  5BPC A;  2BCQ A;  4IQW A;  3KHR A;  1LB2 B;  8ICV A;  1KDH A;  3H4D A;  5III A;  3IM1 A;  4QWD A;  4ED2 A;  1X9M A;  1V9P A;  3AU2 A;  2BCU A;  8ICY A;  2JZB B;  1QSY A;  1N56 A;  4F5R A;  3RH5 A;  5KTQ A;  3PO5 A;  3GIJ A;  4YMN A;  5IIM A;  4DFM A;  3FDS A;  4IR1 A;  5D49 A;  4UB1 A;  3PR5 B;  3H7I A;  4RZR A;  4M9H A;  3THV A;  3TAQ A;  5EWG A;  1U49 A;  4F5Q A;  2ASL A;  7ICV A;  4PGQ A;  4I2B A;  2ZJ8 A;  2BQ3 A;  3C2K A;  4ZH4 A;  5J2K A;  5L1K A;  3RR7 A;  3OSP A;  4RQ0 A;  3MDC A;  3PW5 A;  4KLF A;  8ICZ A;  2V9W A;  5KG2 A;  4EZ9 A;  3BQ2 A;  3QE9 Y;  2VA8 A;  5J2I A;  1HUO A;  8ICJ A;  3C1Y A;  3PMN A;  4UBC A;  7ICN A;  3UXN A;  3C21 A;  1ZQA A;  4YR2 A;  4C8K A;  4KMU A;  5DBB A;  4RUC A;  4GXI A;  1Z3E B;  4KLM A;  5J2F A;  3PVX A;  4YR0 A;  3PML A;  1U45 A;  3RH4 A;  1NJX A;  3H4B A;  1K1S A;  3UQ0 A;  1ZQG A;  2ALZ A;  1D8L A;  4RNM A;  4KLE A;  4NXZ A;  4UAW A;  1U9L A;  3BQT A;  9ICT A;  1ZQH A;  4O3S A;  4YD2 A;  2AQ4 A;  3OHA A;  4F3O A;  5KG6 A;  2DPI A;  4EEY A;  4G3I A;  5JUM A;  4R66 A;  2JEG A;  2F1I A;  3RJK A;  2ATL A;  1IM4 A;  5J0W A;  4KLL A;  1KEJ A;  5D46 A;  4MFA A;  4KLQ A;  1U47 A;  5KFY A;  4B9U A;  3ZDE A;  3ISD A;  4R63 A;  1MSW D;  3EPG A;  4RQ4 A;  2IMW P;  1ZQB A;  1BPY A;  2PFN A;  3RB3 A;  4M2Y A;  4DLE A;  2FLP A;  1IXR A;  4KLS A;  2R8G A;  3RAQ A;  8ICL A;  5DQG A;  4FS1 A;  2AGP A;  1NK7 A;  4BDP A;  4I2J A;  8ICB A;  5KFA A;  5J2A A;  4M04 A;  4YR3 A;  5D4B A;  2W9C B;  1NK0 A;  2HHV A;  4I2E A;  7ICG A;  3GII A;  4F4Z A;  2XO7 A;  2BCR A;  4O3N A;  2Q0Z X;  4QWA A;  1TK8 A;  2NRT A;  5HNK A;  3Q8K A;  1ARO P;  4PHD A;  2BQR A;  4ELT A;  4M9J A;  1SL2 A;  1UA0 A;  9ICK A;  1JXE A;  4M0A A;  8ICP A;  2R8H A;  4KLO A;  1SL1 A;  2UVU A;  3M9M B;  1JMS A;  1CUK A;  4DOC A;  4QZB A;  4I2A A; 
#chains in the Genus database with same CATH topology
 3RTV A;  1ZQM A;  7ICM A;  5H2F U;  3PW7 A;  2K8B B;  8ICM A;  2W54 A;  2F2A B;  2ZTE A;  4O5K A;  4O5C A;  4I27 A;  4XQ8 A;  4K4G A;  3NRW A;  2ZUC A;  4B6J A;  9ICS A;  5ALO A;  3QYP A;  1RYR A;  2E1F A;  2FI1 A;  4LZD A;  2W43 A;  4MFC A;  8ICU A;  5B66 U;  4MF2 A;  3N28 A;  1RZT A;  1SKW A;  2GH1 A;  1ZQJ A;  7ICP A;  3GV5 B;  3GDX A;  5AI6 A;  5FP0 A;  4F50 A;  3UMG A;  2BPG A;  5J8Y C;  2G09 A;  4P4P A;  1S0V A;  2BKE A;  5AK5 A;  2UVR A;  4GXJ A;  2QB0 B;  5ALW A;  3LDA A;  4P4M A;  4NM1 A;  2EZY A;  5KFU A;  5DGB A;  4G9B A;  3RB4 A;  3V6K A;  1NKB A;  4AP9 A;  5IIJ A;  3WKE A;  1Z1B A;  4ECU A;  5DBA A;  2ASD A;  4RT3 A;  4Q8E A;  1JRO A;  1ZQW A;  1IV8 A;  4F4W A;  3RRG A;  3TFS A;  1S0O A;  3SV3 A;  1ZRN A;  4RQ2 A;  3WKA A;  1CRX A;  5AI5 A;  4EBE A;  1PVR A;  4JB3 A;  1BNP A;  4PHE A;  4ECS A;  1VDV A;  3Q8M A;  4QW9 A;  4TQR A;  4C8N A;  1X9X A;  5KFS A;  2F8K A;  4Y2R A;  1ZYQ A;  4MFF A;  2E1E A;  2H5X A;  3DDH A;  2HHU A;  2BHN A;  5J0X A;  2ZUD A;  2XI9 A;  3BQ0 A;  4UAU A;  1X42 A;  4QWB A;  4ELU A;  2K4P A;  2EDU A;  3HW8 A;  8ICQ A;  2W3R A;  4XUS A;  1ZQX A;  2DBY A;  4F92 B;  1QQ5 A;  4YFK A;  9ICV A;  8ICS A;  1V97 A;  4BGD A;  1Z00 A;  1ECW A;  2VA2 A;  5KFK A;  2PFP A;  2A3V A;  4OCZ A;  4MEX A;  8ICI A;  2K4I A;  1KFS A;  2YQE A;  4ECV A;  2VKQ A;  4RNN A;  5KFE A;  2BGW A;  4I2F A;  5ALS A;  1BVS A;  2RQ5 A;  2DWQ A;  4YD1 A;  5GTH U;  1N2X A;  5BOL A;  9ICR A;  1L8L A;  1S10 A;  4KLD A;  3OGU A;  4P0P B;  2G08 A;  5AI9 A;  2DF4 B;  5AKI A;  5J2E A;  1L7M A;  3MDA A;  4O3O A;  4KX5 A;  1UT5 A;  5DG7 A;  2EAO A;  4RNO A;  5AI8 A;  3NVW A;  1L3U A;  4Y2V A;  3IG5 A;  5IIK A;  4C8M A;  5DDY A;  2VJ5 A;  9ICE A;  1T94 A;  2B6G A;  4RPY A;  5KNI A;  1JIH A;  2CPR A;  4K4H A;  4QNL A;  4QZG A;  3UPQ A;  2KN7 A;  3I28 A;  1NKE A;  1SGG A;  4RQ7 A;  1XS9 D;  2Y9T A;  1ZQY A;  5ALJ A;  3MR5 A;  1CEZ A;  1Z00 B;  1ZQU A;  3RB0 A;  3ORY A;  4RQ5 A;  3CYM A;  4QZE A;  3CRX A;  3QU9 A;  5HHH A;  4P0Q A;  2LMR A;  5EE0 A;  1QQ6 A;  7ICO A;  1ZD2 P;  4DLG A;  4LZG A;  3Q8Q B;  3Q8S B;  1DXS A;  2I6X A;  3JPP A;  1U4B A;  1JRP A;  4C8O A;  1T8E A;  1PK1 A;  1HJP A;  9ICC A;  3EPI A;  4KMO B;  3N97 B;  3PSI A;  3QUC A;  5CA7 A;  3H8W A;  3F2C A;  1M6Y A;  3C23 A;  2HSZ A;  5KFD A;  2B0C A;  5EE1 A;  4F5O A;  1XC9 A;  3FYH A;  2DUY A;  2BZF A;  1RYU A;  3JPT A;  3M8S A;  1D8B A;  5B5E U;  2GO7 A;  1UPH A;  4JUZ A;  2QAR A;  3RJH A;  3M9N B;  3LVW A;  2W55 A;  5ALL A;  3ISC A;  1NK9 A;  5ALR A;  2XY7 A;  4KLT A;  3TI0 A;  5KFP A;  1BGX T;  2W9A A;  3KHH A;  3ZD8 A;  1ZQ1 C;  1WG8 A;  2MUT A;  5J0T A;  4DF8 A;  1ZET A;  5HP4 A;  5KFX A;  2FPK A;  1SB3 C;  2B21 A;  4DFJ A;  4NY8 A;  4DL7 A;  3M8R A;  1UA1 A;  4I2H A;  5AKL A;  2FDR A;  1XU4 A;  3KHL A;  3SAH A;  2AHO B;  3H8M A;  1EXN A;  1ZRM A;  3EWA A;  1MQ2 A;  3L4P A;  2F3N A;  4FZM A;  1D9D A;  4J03 A;  1OXJ A;  2W9M A;  2D8C A;  3S6J A;  4P0Q B;  4ED6 A;  3QU2 A;  5AHX A;  3N7P D;  3A0H U;  1CI4 A;  1GO3 F;  5KT5 A;  4YQW A;  4KN4 A;  2I9G A;  2K60 A;  5F9N A;  5J2H A;  1PK1 B;  3NUQ A;  5G5G A;  3C5G A;  3IHQ B;  4MHV A;  1KL9 A;  2HBK A;  3BS5 A;  4TUQ A;  1VJ5 A;  1BPD A;  3OJU A;  1UT8 A;  2KZZ A;  5AM2 A;  5KAF U;  3PW0 A;  4J9L A;  5ALF A;  4DSF A;  3RJF A;  2D6F C;  2EZZ A;  4IS7 A;  3K75 D;  3QUB A;  1S77 D;  4WJ3 B;  1LV5 A;  5BPC A;  2BCQ A;  3KHR A;  3IM1 A;  4QWD A;  1J2M A;  3VC8 A;  1V9P A;  2HDO A;  1SWW A;  4IR1 A;  1RDF A;  5L1M A;  3H7I A;  4RZR A;  3TKA A;  3TAQ A;  3THV A;  1U49 A;  2ASL A;  2E8M A;  5L1K A;  1B0X A;  3PW5 A;  8ICZ A;  2QB1 A;  4EZ9 A;  4EEK A;  1YZ7 A;  3C1Y A;  4US9 A;  3UXN A;  2EQY A;  2KHV A;  2ZIW B;  1Z3E B;  3E58 A;  2KEY A;  1J2N A;  5DBB A;  5J2F A;  2YMP A;  2ZIU A;  3UQ0 A;  9ICT A;  1ZQH A;  1JAL A;  4F3O A;  4G3I A;  4R66 A;  1IM4 A;  5J0W A;  1B4F A;  4KLQ A;  5ALU A;  2PMZ F;  3ZDE A;  3NRZ A;  3EPG A;  4OJP A;  4DLE A;  1F0M A;  4BDP A;  4EX7 A;  5D4B A;  2W9C B;  4I2E A;  3GII A;  2BCR A;  2Q0Z X;  5HNK A;  3Q8K A;  4ELT A;  1UHU A;  2BQR A;  1JI7 A;  1JXE A;  4FZL A;  2UVU A;  3M9M B;  5CRX A;  3BS7 A;  4DS5 A;  2MRL A;  3MC1 A;  1L7N A;  7ICI A;  2K89 A;  2KMD A;  3E0F A;  4YCX A;  4DSJ A;  1XNS A;  2JXJ A;  1ZQL A;  4QZC A;  2EAP A;  4UB3 A;  2JRZ A;  3MGH A;  2ES6 A;  9ICP A;  3VCB A;  4OJL A;  4DL4 A;  4PZO A;  1NJW A;  2BDU A;  4B9T A;  1L7P A;  2RDJ A;  4JV0 A;  2CN1 A;  1BNO A;  5KFN A;  4Z6E A;  2Y1J A;  4YVZ A;  4J9S A;  2AGQ A;  3TAP A;  4UB2 A;  1PUZ A;  2KNJ A;  3EZ5 A;  3SZ2 A;  1XSP A;  4DCC A;  1RYS A;  2UVW A;  3M6K A;  2XGQ A;  4M9G A;  3TAD C;  4KLU A;  2M0N A;  4CE6 A;  2KP7 A;  4DO9 A;  2JHD A;  4CNQ A;  3AM9 A;  4RPZ A;  3GU3 A;  2W9B B;  2RLT A;  1ZQV A;  3G6X A;  5KT3 A;  4YMM A;  3PZP A;  3M1Y A;  4JMU A;  4FBT A;  4DEZ A;  5ALX A;  5ALI A;  4EBD A;  1L7O A;  1O03 A;  2DKX A;  2YX8 A;  2KVC A;  2LM1 A;  5AM3 A;  4YG2 A;  5J0O A;  4BUG A;  4NLN A;  4UAY A;  7ICU A;  2E8P A;  3V6H A;  1Z4N A;  4TQS A;  4QZD A;  2YB1 A;  4PZN A;  5L1I A;  1ZJM A;  9ICG A;  3QUQ A;  5KT7 A;  3FAH A;  4R64 A;  2QB0 A;  4NL9 C;  1WWV A;  3EYZ A;  4TUS A;  1MC8 A;  2KIW A;  4CF5 A;  4UB4 A;  1L3T A;  1UQV A;  3ZI4 A;  3RBE A;  2WHE A;  4J9M A;  5KFV A;  1RXW A;  4M9N A;  2PMZ C;  4J9K A;  2XY5 A;  5JU5 A;  3GV8 B;  4OJ5 A;  4IL6 U;  4QWE A;  5ALG A;  1PZN A;  2W3S A;  4U6P A;  4QWC A;  3N7R C;  3ZD9 A;  3HPO A;  9ICQ A;  5F3X B;  3BJY A;  2RHF A;  2YY6 A;  3OSN A;  1X9S A;  4TUP A;  2ASJ A;  3C2M A;  5L1L A;  2VA3 A;  5ALE A;  2BCS A;  4RQN A;  4FO6 A;  2AGO A;  4NLC A;  4P2H A;  4DQI A;  2H3F A;  5K4L A;  3MR3 A;  3NVV A;  4R65 A;  2NO4 A;  1QSL A;  5KFL A;  3QXG A;  2BPC A;  1TFR A;  2ZUB A;  5G5H A;  4TUR A;  5KFF A;  4NJ8 A;  4JWN A;  2AU0 A;  3AMZ A;  4ECX A;  3OJS A;  4DOA A;  3IDW A;  4KIT B;  4UB6 U;  4I2D A;  5EE9 A;  4US8 A;  4R8U B;  4ECZ A;  4UW9 A;  9ICX A;  4ACO A;  1NKC A;  3WK5 A;  3AUO A;  2IHM A;  2EH9 A;  1NZP A;  1FFV A;  4MF8 A;  3T79 A;  2ISP A;  4JK1 A;  5TZV A;  1BPE A;  3B9J A;  5EOZ A;  1N60 A;  1KRP A;  4O0I A;  1L5U A;  2V4R A;  2M9N A;  3BQ1 A;  1UCV A;  2G5H B;  2I5H A;  5J2G A;  1TAM A;  4C0Z A;  4DWI A;  2FPM A;  2ZJ5 A;  5KG0 A;  4RU9 A;  3KD3 A;  3QUT A;  3WU2 U;  4QZI A;  9ICI A;  5J29 A;  5AI4 A;  3A0B U;  4OJ6 A;  3PX0 A;  4KTQ A;  5KG4 A;  4QZH A;  3T5J A;  1T7P A;  5KFB A;  2VJ4 A;  2ZTD A;  3AEV A;  4U7C A;  4I29 A;  3TAC B;  3HWT A;  3PW4 A;  5J0S A;  2PFO A;  4P0P A;  1NNL A;  2PKE A;  1Z4O A;  4ECT A;  2ZJA A;  4CGZ A;  2XID A;  5KFC A;  1NK5 A;  4ECW A;  4JV1 A;  3ICX A;  9ICW A;  4UBB A;  3MBY A;  4KN7 A;  3KHG A;  5DG8 A;  2OHF A;  2WB1 F;  3V7K A;  3RJG A;  2C22 A;  3MAB A;  1BPZ A;  5DB8 A;  3MGI A;  3NGD A;  1TE2 A;  1DGJ A;  2AH5 A;  5ALN A;  1NK8 A;  5AKJ A;  3SYZ A;  3TQ1 A;  3OHB A;  1Q3V A;  7ICT A;  3PNC A;  2KZM A;  1T4G A;  1YT3 A;  4B9V A;  5C5J A;  3C29 A;  2BDP A;  2KE7 A;  4J9O A;  5AM1 A;  3EW9 A;  2WF9 A;  3ZDB A;  1KTQ A;  3PY8 A;  2W8L A;  4Q8F A;  2JH7 A;  3IV6 A;  4DOB A;  1SXD A;  3QU4 A;  1ZQD A;  3UXO A;  3I76 A;  5HHI A;  3G6Y A;  4DL5 A;  4EZ6 A;  4OJO A;  4GIB A;  4IQT A;  2FLL A;  5DG9 A;  3O0F A;  1NI3 A;  2HHX A;  3TFR A;  4EX6 A;  4FS2 A;  2NRZ A;  3L3F X;  4DQQ A;  2K8A A;  5KFW A;  2Z7J A;  5ALH A;  4EEL A;  2G5I B;  2W03 A;  7ICH A;  4PGY A;  5IIL A;  5KFI A;  3RJI A;  1ZQF A;  4NM2 A;  3OTQ A;  2K4E A;  4GC7 A;  5KG5 A;  1URJ A;  2HHW A;  5KFT A;  1MA7 A;  4Q43 A;  5CJ7 A;  4QZF A;  3QZ7 A;  1IIP A;  1C20 A;  3ISB A;  1S8O A;  2KG5 A;  3F5A A;  2F44 A;  1X9M A;  1LKY A;  5AKZ A;  1QSY A;  2W11 A;  3BZK A;  5HR7 A;  3FDS A;  5EWG A;  4F5Q A;  5HR6 A;  3C2K A;  4ZH4 A;  4RQ0 A;  3MDC A;  4KLF A;  1HUO A;  2VA8 A;  3K1R B;  8ICJ A;  4C7Y A;  2HOQ A;  3UMB A;  4C8K A;  4RQM A;  4C7Z A;  4YR0 A;  1U45 A;  2A1A A;  1RG6 A;  1K1S A;  5AKH A;  5T14 A;  1RQL A;  1U9L A;  3OHA A;  1ED1 A;  2DL0 A;  2JEG A;  2FE9 A;  2JGA A;  2MSN A;  4B9U A;  5AKE A;  4FFD A;  2PFN A;  5AM4 A;  1IXR A;  4KLS A;  3RAQ A;  4FS1 A;  8ICB A;  5KFA A;  2YMM A;  3ED5 A;  2HI0 A;  4F4Z A;  1DK2 A;  2WB1 C;  1TK8 A;  4UAT A;  1FO4 A;  1V85 A;  1UA0 A;  4Y2Y A;  3QNM A;  1LKY B;  2W7P A;  1JMS A;  1CUK A;  4DOC A;  3SQI A;  2GOL A;  4AYB F;  1Q46 A;  4I2A A;  4BXO B;  3PO4 A;  2KKV A;  2UVV A;  3ETL A;  4DSE A;  3C5F A;  4F71 A;  3LWM A;  4ED8 A;  5CR0 A;  2KFN A;  2ZIW A;  1ZXI A;  4M9L A;  2Y9U A;  4RT2 A;  1WWU A;  2NYV A;  3N7S C;  4UAS A;  2XCA A;  9ICO A;  8ICN A;  5DB7 A;  2Y1I A;  2DPJ A;  5KFH A;  3F2B A;  5L1J A;  3DEE A;  4YN4 A;  7ICF A;  3JPO A;  4EEN A;  3ZDD A;  1RM6 C;  4O3R A;  4Y2T A;  3QEB Z;  4PL1 A;  8ICG A;  2WF6 A;  2NV3 A;  4P4O A;  8ICF A;  3RR8 A;  3V6J A;  2W9C A;  1N5W A;  3GQC A;  2CXY A;  2WTF A;  4KLH A;  1VLB A;  2MA1 A;  4UQG A;  8ICT A;  2H3I A;  3UMC A;  1L3V A;  3PSF A;  4JWM A;  4PPX A;  2Q4T A;  3HT3 A;  1ZQP A;  4C4S A;  5KAI U;  2F77 X;  2BPF A;  4ZOH C;  5AIA A;  1J97 A;  4KLG A;  4YMO A;  5DB9 A;  8ICO A;  1SKS A;  2PXI A;  4ED7 A;  2C2E A;  1IG6 A;  2HHT A;  2HVH A;  2HHS A;  4DF4 A;  4DSI A;  2WF5 A;  4C8L A;  4NLG A;  4CF4 A;  5DKW A;  3BDP A;  2KJ5 A;  4Z6F A;  1TK0 A;  2JEF A;  1B22 A;  3CW2 C;  3IN5 A;  4BJQ A;  1ZD5 A;  3KKA C;  4DFK A;  4FBU A;  8ICC A;  2Y0S F;  3HP6 A;  1Z1V A;  1TKD A;  1B43 A;  4UAR A;  5ALK A;  1SV4 A;  4FZN A;  4J9Q A;  5J2B A;  8ICE A;  2W04 A;  2LYB A;  1K1Q A;  3F5E A;  3J81 j;  3MFH A;  4DL6 A;  1Y88 A;  4NLB A;  1ZQN A;  2NRV A;  1XSN A;  2IBK A;  2ZXH A;  3JPN A;  3CP8 A;  2EAM A;  4B9N A;  3WK6 A;  1KQQ A;  2DFL A;  7ICJ A;  1SL0 A;  2IOF A;  3NTU A;  1SV0 C;  5DGA A;  4B9L A;  4UAV A;  3PST A;  2ZIX A;  2W9B A;  1COO A;  3SR6 A;  3CNH A;  4ED3 A;  2JEI A;  2ODG A;  2H3V A;  2KD1 A;  2AXT U;  3V72 A;  3QU5 A;  4EYH B;  2E3T A;  3H0M B;  3KOO A;  4DSK A;  2F8L A;  4CRX A;  4I2G A;  4DFD A;  4Q44 A;  3MR2 A;  1DRG A;  3TAD A;  1X2I A;  5J0R A;  9ICM A;  3C1Z A;  3M7D A;  3RF9 A;  3SV4 A;  4AYB C;  1FEZ A;  4UAZ A;  3PX4 A;  1NK4 A;  1A76 A;  3AL0 B;  4O3P A;  2A1J A;  2BCV A;  1ZQR A;  4O3Q A;  3JPR A;  5KG7 A;  4CCH A;  2ZIV B;  2J6T A;  5DQI A;  5KFQ A;  2VAN A;  5AIC A;  1X66 A;  3KZI U;  7ICL A;  4F4K A;  3MR6 A;  1D8Y A;  1TVA A;  2V4Q A;  3EUB 2;  2OCE A;  1QSS A;  3K1Z A;  1JN3 A;  4F4X A;  2C2D A;  1DOQ A;  4Z6C A;  5KFZ A;  1SWV A;  8ICK A;  3SI8 A;  1ZQT A;  3HKZ F;  5IIN A;  3H0L B;  4O3M A;  2ESE A;  4YXM A;  3F53 A;  2WAQ F;  2ZIX B;  3T5K A;  3SEN A;  3D2Q A;  5KT4 A;  5BOM A;  4OD0 A;  4BX9 C;  1TAU A;  2O6K A;  4KLI A;  4YP3 A;  3C2L A;  2K8C B;  1S0N A;  2KFZ A;  3U26 A;  4F5N A;  1L6N A;  4GC6 A;  4QZA A;  1KFT A;  1S76 D;  4F4Y A;  2P35 A;  4DQS A;  1OW5 A;  2WFA A;  2KIC A;  4YXJ A;  1NOM A;  3IG8 A;  3NVZ A;  3SEI A;  4F72 A;  4OO1 J;  9ICU A;  4J9P A;  1NJY A;  2J6U A;  3D2N A;  1QCK A;  5ALD A;  2A1J B;  5CEH A;  1QQ7 A;  8ICA A;  4R8U A;  2ZTC A;  3WK4 A;  2FLN A;  2IA6 A;  2KHQ A;  5KFJ A;  2KJ8 A;  5CHG A;  2KOB A;  2Y0S C;  4I2I A;  3PR4 A;  1ZD4 A;  5AK6 A;  5KFO A;  1T3N A;  3SAG A;  4X5V A;  3MGV A;  5CP2 A;  1HUZ A;  3HJE A;  4ELV A;  1N63 A;  3FM9 A;  2H3Q A;  2H3Z A;  4DL3 A;  2JH1 A;  9ICB A;  4PGX A;  4M6W B;  5J8Y A;  1XSL A;  5ALZ A;  4RQ3 A;  3GIM A;  2CRX A;  4LVS A;  1KKX A;  4DQR A;  1WCL A;  1N48 A;  2JZB A;  3WK7 A;  3DV9 A;  2GWS A;  5ALP A;  1ZQZ A;  4C4R A;  2XC9 A;  2DQN B;  2LYH A;  1ZQC A;  3GIL A;  3AQE A;  3ETR A;  5KFR A;  4DS4 A;  4RQ6 A;  1S5L U;  4RUA A;  4EBC A;  1P7D A;  4A8E A;  2WF7 A;  1A6S A;  1HIW A;  3N4M B;  1KFD A;  1RQN A;  2I1Q A;  4Q45 A;  3KBB A;  4UB5 A;  4E0D A;  1OUQ A;  2PI4 A;  1KSP A;  2BQU A;  3Q8R B;  5KFG A;  1S97 A;  3AN1 A;  4B9S A;  3KTQ A;  3HX0 A;  3IP4 B;  5EWE A;  1ZD3 A;  1N61 A;  3T5H A;  5AIB A;  2FMQ A;  1Q8K A;  3JPS A;  5AKG A;  4F2R A;  2E5S A;  1TAQ A;  1ZQO A;  5AK3 A;  4EYI B;  4DFP A;  3HKZ C;  1A77 A;  3D2S A;  1WUD A;  4IQW A;  8ICV A;  2ZG6 A;  5III A;  2GLE A;  2JZB B;  2WAQ C;  1N56 A;  1FFU A;  2KKP A;  3RH5 A;  2G07 A;  2HMX A;  3GIJ A;  4YMN A;  5IIM A;  4DFM A;  5D49 A;  4PGQ A;  4I2B A;  2ZJ8 A;  2BQ3 A;  3OSP A;  5KG2 A;  3BQ2 A;  3QE9 Y;  2LI6 A;  3PMN A;  7ICN A;  3C21 A;  2YN4 A;  1XO0 A;  1ZQA A;  4YR2 A;  4KLM A;  4KMU A;  2W7O A;  3PML A;  1NJX A;  3RH4 A;  1F5S A;  4KLE A;  3BQT A;  2AQ4 A;  2DPI A;  1HEK A;  3RJK A;  4KLL A;  3R9K A;  1KEJ A;  5D46 A;  4MFA A;  1NZB A;  2K4H A;  1U47 A;  3ISD A;  4RQ4 A;  2IMW P;  1ZQB A;  4M2Y A;  2R8G A;  3HRD D;  2JV3 A;  5J2A A;  2A19 A;  3QX7 A;  1T3Q A;  4M04 A;  5AK4 A;  4YR3 A;  1KBU A;  2HBM A;  5AKY A;  3I1Y A;  4O3N A;  1ARO P;  3NS1 A;  4PHD A;  2OH2 A;  2DKZ A;  9ICK A;  5E79 U;  4M0A A;  2R8H A;  3SAF A;  4CF3 A;  1Z19 A;  2YML A;  4C80 A;  4QZB A;  1Q3U A;  5ALY A;  2XY6 A;  1U48 A;  4KX3 A;  1YZ6 A;  5KT6 A;  1KLN A;  1NJZ A;  5GTI U;  2OM6 A;  4PL2 A;  1F44 A;  5J2C A;  2RDI A;  1KN5 A;  3E2E A;  4I28 A;  3GZF A;  8ICW A;  4ECQ A;  2BR0 A;  2KTQ A;  2HHQ A;  2EZX A;  7ICR A;  2P6U A;  1ZOL A;  2G0A A;  2MAX A;  1XO1 A;  1SIJ A;  9ICL A;  5C0Y A;  3V7L A;  4XRH A;  2MU2 A;  2XIC A;  5DLG A;  3H40 A;  4NLK A;  3ALR A;  1ZQI A;  3H0R B;  3WKB A;  4NLZ A;  3TAR A;  1PVP A;  3RJE A;  3KZX A;  3G6V A;  2AJQ A;  2J6S A;  5KFM A;  4GLX A;  5KG3 A;  5DBC A;  4FE3 A;  1MN8 A;  9ICA A;  2KZ3 A;  1X9W A;  1KW4 A;  1PVQ A;  1X40 A;  4BXO A;  1O08 A;  2AQ0 A;  2WF8 A;  2KVS A;  3QEA Z;  2KK0 A;  4PH5 A;  3TAN A;  1X6I A;  3M6Z A;  5ALQ A;  1A0P A;  3SMV A;  2HVI A;  3RRH A;  2E8O A;  5TIS U;  5JRT A;  9ICH A;  4NWI A;  1WYG A;  2XGP A;  5HML A;  3UQ2 A;  1H38 A;  2LYA A;  4MEY A;  3WK8 A;  5A0L A;  1TV9 A;  2OWO A;  2QLT A;  1JXL A;  4NV0 A;  3B0X A;  5J2J A;  2FJ6 A;  5CWR A;  3T3F A;  5J0P A;  4IC9 A;  5F9L A;  2KSO A;  4IQV A;  2XCP A;  1SZP A;  2NRX A;  4BWM A;  4RPX A;  1C7Y A;  4ED0 A;  1XWL A;  3M9O B;  2PI5 A;  2IOF K;  2F1J A;  4M47 A;  5AM0 A;  1WCN A;  2FMP A;  4O5E A;  3D6J A;  1L8O A;  3GV7 B;  2YMQ A;  1ZQS A;  1SXE A;  3PX6 A;  5AKK A;  2L5Y A;  4ECR A;  1N5X A;  7ICQ A;  5ALM A;  4Y2S A;  4F91 B;  2FMS A;  3ZDC A;  2KJ9 A;  1JUD A;  3RAX A;  1ZQQ A;  4Y2J A;  5ALT A;  2W8K A;  2QKQ A;  3SD7 A;  4JV2 A;  4Z6D A;  5DDM A;  2IOH A;  3PW2 A;  2YB4 A;  2IHN A;  2FPL A;  2C2R A;  1BPX A;  3PSP A;  7ICE A;  4J9N A;  1JX4 A;  3RJJ A;  1QTM A;  4IRD A;  3Q8L A;  2HBJ A;  4DSL A;  2NO5 A;  1X6J A;  3B0Y A;  4QW8 A;  2JMG A;  4F8R A;  2ISO A;  2KSO B;  1RPL A;  3KFU F;  4K4I A;  9ICF A;  3KKA A;  2C28 A;  2HCF A;  3C28 A;  4IRK A;  3WK9 A;  1TK5 A;  9ICJ A;  4Y2Q A;  4B9M A;  5L9X A;  3RH6 A;  5AM5 A;  2JEJ A;  3AQF A;  5KG1 A;  5HMM A;  2P66 A;  2QAR B;  5KT2 A;  3WKC A;  1SV0 A;  4QIW F;  5DQH A;  7ICK A;  5J0Q A;  1MQ3 A;  2MUT B;  2ZIV A;  8ICH A;  5J2D A;  2XVT A;  4QZ8 A;  4O9M A;  2EAN A;  5ALV A;  3F2D A;  3WKD A;  1ZQK A;  1RXV A;  5EWF A;  4I2C A;  4PHA A;  1L3S A;  2LHT A;  1D9F A;  3JPQ A;  2R8K A;  1S0M A;  4QZ9 A;  2LKY A;  3GIK A;  3UXP A;  2NRW A;  1DGS A;  2PFQ A;  3ZDA A;  2HOF A;  1COK A;  4ICA A;  4DL2 A;  2R8J A;  2F1H A;  4RQ8 A;  3Q8P B;  4F5P A;  3NVY A;  2P6R A;  3BS5 B;  3LK9 A;  4C4T A;  4HYK A;  4RQ1 A;  9ICN A;  2LBO A;  4IQU A;  8ICX A;  5CB1 A;  1NK6 A;  1DK3 A;  3LVV A;  4XA5 A;  3RFA A;  4IR9 A;  5KL1 B;  4IRC A;  1FIQ A;  5AI0 A;  4PJ0 U;  4UB8 U;  1QH9 A;  5KL8 B;  3H8J A;  3V7J A;  3AU6 A;  1ZQE A;  5DLF A;  3LWL A;  4ECY A;  3RBD A;  3GFK B;  4ED1 A;  3T5L A;  3MFI A;  4F93 B;  3UM9 A;  2RRD A;  4Y2P A;  3PV8 A;  2LPE A;  3OPX A;  2LM4 A;  8ICR A;  4J9R A;  2ZIU B;  1ZJN A;  1QLN A;  2OYY A;  5J0U A;  1BPB A;  2R18 A;  1SKR A;  2G06 A;  1S9F A;  1AQ6 A;  2F76 X;  3BZC A;  1SZH A;  2E8N A;  3K4G A;  3H8S A;  2D3D A;  4LJX A;  4M6W A;  4Y2X A;  1N62 A;  2OEH A;  5DB6 A;  2HOI A;  4DQP A;  4QJF B;  2HBL A;  2HW3 A;  4BWJ A;  3QZ8 A;  4NL9 A;  4KLJ A;  4GXK A;  3HIL A;  4PHP A;  5J0Y A;  5IIO A;  3LYS A;  7ICS A;  2R8I A;  3RB6 A;  4F2S A;  1LB2 B;  3ONN A;  1KDH A;  3H4D A;  4ED2 A;  2BCU A;  3AU2 A;  8ICY A;  4GFJ A;  2OXO A;  4F5R A;  2RP5 A;  5KTQ A;  3PO5 A;  4UB1 A;  3PR5 B;  3BQ7 A;  4M9H A;  2YTU A;  7ICV A;  5J2K A;  3RR7 A;  2JR5 A;  2V9W A;  5J2I A;  4USA A;  1LVH A;  4UBC A;  4QIW C;  4RUC A;  4GXI A;  3PVX A;  5JTI A;  3H4B A;  3FC4 A;  3IRU A;  1ZQG A;  2ALZ A;  1D8L A;  4RNM A;  4NXZ A;  4UAW A;  4Y2U A;  4CDG A;  3QU7 A;  4O3S A;  2KIV A;  4YD2 A;  5KG6 A;  2VIX A;  4EEY A;  5JUM A;  2F1I A;  2ATL A;  1PK3 A;  3NAS A;  5KFY A;  4R63 A;  5EE3 A;  1MSW D;  2KV2 A;  1V38 A;  1BPY A;  3RB3 A;  1K5O A;  2FLP A;  8ICL A;  5DQG A;  2AGP A;  1NK7 A;  4I2J A;  2N1R A;  2DGZ A;  2ZXI A;  5AKX A;  1NK0 A;  2HHV A;  7ICG A;  2XO7 A;  4QWA A;  2NRT A;  4M9J A;  1SL2 A;  8ICP A;  4KLO A;  1SL1 A;  4HAI A;  3L5K A; 
#chains in the Genus database with same CATH homology
 3RTV A;  1ZQM A;  4BXO B;  2XY6 A;  4DS5 A;  3PO4 A;  1U48 A;  2UVV A;  3ETL A;  7ICM A;  4DSE A;  5KT6 A;  3C5F A;  1KLN A;  3LWM A;  3PW7 A;  4ED8 A;  5CR0 A;  7ICI A;  1NJZ A;  2KFN A;  8ICM A;  4YCX A;  5J2C A;  2RDI A;  3E2E A;  4I28 A;  2ZTE A;  4O5K A;  4DSJ A;  4I27 A;  4M9L A;  4XQ8 A;  4RT2 A;  4K4G A;  2ZUC A;  4ECQ A;  2BR0 A;  4O5C A;  2KTQ A;  2HHQ A;  7ICR A;  1ZQL A;  9ICS A;  2P6U A;  2MAX A;  1RYR A;  4QZC A;  1XO1 A;  4UB3 A;  3MGH A;  2XCA A;  9ICL A;  9ICO A;  4LZD A;  8ICN A;  4MFC A;  8ICU A;  3V7L A;  5DB7 A;  9ICP A;  4XRH A;  2Y1I A;  4DL4 A;  2DPJ A;  4MF2 A;  5DLG A;  1RZT A;  1SKW A;  1ZQJ A;  3H40 A;  5KFH A;  7ICP A;  1NJW A;  4NLK A;  3GV5 B;  4B9T A;  5L1J A;  3GDX A;  1ZQI A;  4YN4 A;  7ICF A;  4F50 A;  2RDJ A;  3JPO A;  3ZDD A;  4NLZ A;  3TAR A;  2BPG A;  4JV0 A;  4O3R A;  4P4P A;  3QEB Z;  5KFN A;  2BKE A;  4Z6E A;  3RJE A;  1S0V A;  8ICG A;  2UVR A;  4GXJ A;  2Y1J A;  3G6V A;  2AJQ A;  4YVZ A;  4J9S A;  3LDA A;  4P4O A;  4P4M A;  2AGQ A;  2J6S A;  4NM1 A;  8ICF A;  3RR8 A;  3V6J A;  3TAP A;  5KFU A;  4UB2 A;  2W9C A;  3EZ5 A;  3GQC A;  5DGB A;  2WTF A;  3SZ2 A;  1XSP A;  1RYS A;  2UVW A;  4KLH A;  3RB4 A;  4UQG A;  8ICT A;  2XGQ A;  4M9G A;  3V6K A;  5KFM A;  4GLX A;  5KG3 A;  1L3V A;  4JWM A;  4KLU A;  1NKB A;  4PPX A;  5DBC A;  5IIJ A;  9ICA A;  2KZ3 A;  4DO9 A;  3HT3 A;  4ECU A;  1X9W A;  1ZQP A;  4RPZ A;  2W9B B;  1ZQV A;  4BXO A;  2AQ0 A;  3G6X A;  2BPF A;  5KT3 A;  5DBA A;  3QEA Z;  4YMM A;  4KLG A;  4YMO A;  4RT3 A;  5DB9 A;  2ASD A;  4Q8E A;  1SKS A;  4FBT A;  4PH5 A;  4DEZ A;  3TAN A;  8ICO A;  4EBD A;  2PXI A;  1ZQW A;  4ED7 A;  2C2E A;  4F4W A;  3RRG A;  2HHT A;  3TFS A;  2HVH A;  2HHS A;  1S0O A;  4DF4 A;  4DSI A;  3SV3 A;  4C8L A;  4YG2 A;  5J0O A;  4NLG A;  4NLN A;  4UAY A;  7ICU A;  2HVI A;  5DKW A;  3RRH A;  3V6H A;  4RQ2 A;  3BDP A;  4Z6F A;  1TK0 A;  4EBE A;  2JEF A;  1B22 A;  9ICH A;  4TQS A;  4QZD A;  4DFK A;  4FBU A;  8ICC A;  2XGP A;  5HML A;  5L1I A;  4PHE A;  3HP6 A;  3UQ2 A;  1H38 A;  1ZJM A;  1B43 A;  1TKD A;  4MEY A;  4ECS A;  4J9Q A;  5J2B A;  1TV9 A;  8ICE A;  9ICG A;  5KT7 A;  2OWO A;  1K1Q A;  1JXL A;  3MFH A;  4R64 A;  3B0X A;  4DL6 A;  5J2J A;  3Q8M A;  1Y88 A;  1ZQN A;  4QW9 A;  2NRV A;  5CWR A;  1XSN A;  3T3F A;  5J0P A;  4TQR A;  2IBK A;  3EYZ A;  4C8N A;  4TUS A;  5F9L A;  3JPN A;  1MC8 A;  4IQV A;  2XCP A;  1SZP A;  2NRX A;  4B9N A;  4UB4 A;  4BWM A;  5KFS A;  2DFL A;  1L3T A;  7ICJ A;  4RPX A;  1C7Y A;  4ED0 A;  1SL0 A;  1ZYQ A;  1XWL A;  3NTU A;  3M9O B;  5DGA A;  3RBE A;  2PI5 A;  4B9L A;  2F1J A;  4MFF A;  4J9M A;  4M47 A;  5KFV A;  1RXW A;  1WCN A;  2FMP A;  2H5X A;  4M9N A;  4O5E A;  2W9B A;  1COO A;  2HHU A;  4ED3 A;  3GV7 B;  2BHN A;  5J0X A;  4J9K A;  2XY5 A;  2ZUD A;  2JEI A;  3BQ0 A;  3GV8 B;  1ZQS A;  4QWE A;  1PZN A;  4QWB A;  4ELU A;  4QWC A;  3HW8 A;  8ICQ A;  3PX6 A;  3V72 A;  3ZD9 A;  4XUS A;  3HPO A;  3BJY A;  9ICQ A;  1ZQX A;  1X9S A;  3OSN A;  4EYH B;  4TUP A;  4ECR A;  2ASJ A;  4F92 B;  3C2M A;  5L1L A;  4DSK A;  4YFK A;  7ICQ A;  9ICV A;  8ICS A;  4I2G A;  4BGD A;  4F91 B;  1Z00 A;  2FMS A;  3ZDC A;  2VA3 A;  4Q44 A;  3MR2 A;  3RAX A;  2BCS A;  2VA2 A;  5KFK A;  1ZQQ A;  4FO6 A;  2AGO A;  2PFP A;  1X2I A;  2W8K A;  5J0R A;  4P2H A;  4DQI A;  9ICM A;  4JV2 A;  4MEX A;  3C1Z A;  3MR3 A;  4Z6D A;  3SV4 A;  8ICI A;  3PX4 A;  4UAZ A;  4R65 A;  5DDM A;  1A76 A;  3PW2 A;  1NK4 A;  1KFS A;  4O3P A;  1QSL A;  2A1J A;  2BCV A;  4ECV A;  5KFL A;  1ZQR A;  4RNN A;  2BPC A;  5KFE A;  2KZM A;  2BGW A;  4I2F A;  1TFR A;  4O3Q A;  5KG7 A;  1BVS A;  3JPR A;  4CCH A;  2ZUB A;  2J6T A;  5DQI A;  4YD1 A;  5KFQ A;  5KFF A;  2FPL A;  5BOL A;  4TUR A;  2C2R A;  1BPX A;  2IHN A;  4JWN A;  2VAN A;  9ICR A;  2AU0 A;  7ICE A;  4ECX A;  7ICL A;  4J9N A;  4F4K A;  3MR6 A;  1D8Y A;  3OJS A;  1S10 A;  1TVA A;  1JX4 A;  3RJJ A;  4DOA A;  4KLD A;  1QTM A;  3OGU A;  4KIT B;  2V4Q A;  4IRD A;  4I2D A;  3Q8L A;  4R8U B;  5J2E A;  4ECZ A;  4DSL A;  1QSS A;  3MDA A;  3B0Y A;  4QW8 A;  1JN3 A;  4F4X A;  4F8R A;  4O3O A;  2ISO A;  2C2D A;  1DOQ A;  4Z6C A;  9ICX A;  1RPL A;  1NKC A;  5KFZ A;  3AUO A;  2IHM A;  4K4I A;  9ICF A;  8ICK A;  3SI8 A;  1UT5 A;  1ZQT A;  5IIN A;  5DG7 A;  2C28 A;  4MF8 A;  4RNO A;  2ISP A;  4IRK A;  4YXM A;  4JK1 A;  5TZV A;  1L3U A;  1BPE A;  5EOZ A;  5IIK A;  4C8M A;  5DDY A;  1KRP A;  9ICE A;  4O0I A;  3T5K A;  1TK5 A;  2V4R A;  1L5U A;  9ICJ A;  2M9N A;  4RPY A;  4B9M A;  5L9X A;  3BQ1 A;  3RH6 A;  5KT4 A;  1JIH A;  5BOM A;  4K4H A;  4QZG A;  3UPQ A;  1TAU A;  2KN7 A;  2JEJ A;  5KG1 A;  1NKE A;  5J2G A;  5HMM A;  4RQ7 A;  2P66 A;  4KLI A;  4YP3 A;  1XS9 D;  3C2L A;  4DWI A;  2FPM A;  2ZJ5 A;  1S0N A;  5KG0 A;  5KT2 A;  1ZQY A;  2KFZ A;  4RU9 A;  4F5N A;  3MR5 A;  5DQH A;  4QZA A;  4GC6 A;  1KFT A;  1S76 D;  1CEZ A;  7ICK A;  5J0Q A;  1Z00 B;  1MQ3 A;  4F4Y A;  1ZQU A;  4DQS A;  2MUT B;  3RB0 A;  4QZI A;  9ICI A;  3ORY A;  4YXJ A;  1NOM A;  5J29 A;  8ICH A;  4RQ5 A;  4QZE A;  5J2D A;  3PX0 A;  4KTQ A;  5KG4 A;  4QZH A;  3T5J A;  4QZ8 A;  4J9P A;  5KFB A;  1NJY A;  2ZTD A;  1T7P A;  4O9M A;  5HHH A;  2J6U A;  4I29 A;  3HWT A;  2A1J B;  3PW4 A;  5J0S A;  7ICO A;  4DLG A;  2PFO A;  3Q8Q B;  4LZG A;  1ZQK A;  8ICA A;  1RXV A;  5EWF A;  3Q8S B;  4I2C A;  4PHA A;  2ZTC A;  4R8U A;  1L3S A;  3JPP A;  1D9F A;  3JPQ A;  1U4B A;  2FLN A;  2R8K A;  4ECT A;  2IA6 A;  4C8O A;  1S0M A;  1T8E A;  4QZ9 A;  2ZJA A;  1HJP A;  5KFJ A;  5CHG A;  9ICC A;  5KFC A;  3GIK A;  3EPI A;  2NRW A;  1DGS A;  3UXP A;  1NK5 A;  4ECW A;  4I2I A;  3PR4 A;  2PFQ A;  3ZDA A;  4JV1 A;  3N97 B;  9ICW A;  5KFO A;  4UBB A;  1T3N A;  5CA7 A;  4DL2 A;  2R8J A;  2F1H A;  4RQ8 A;  3MBY A;  4X5V A;  3Q8P B;  3H8W A;  4F5P A;  5CP2 A;  4KN7 A;  3C23 A;  3KHG A;  5DG8 A;  1HUZ A;  5KFD A;  3V7K A;  2P6R A;  4F5O A;  3RJG A;  4ELV A;  2C22 A;  1XC9 A;  3FYH A;  3MAB A;  3LK9 A;  5DB8 A;  3MGI A;  4DL3 A;  3NGD A;  1BPZ A;  9ICB A;  4PGX A;  4M6W B;  3JPT A;  3M8S A;  4HYK A;  4RQ1 A;  1NK8 A;  9ICN A;  1XSL A;  3SYZ A;  3TQ1 A;  4IQU A;  4JUZ A;  3OHB A;  8ICX A;  4RQ3 A;  5CB1 A;  3M9N B;  3RJH A;  1NK6 A;  3GIM A;  7ICT A;  3ISC A;  3PNC A;  1NK9 A;  4LVS A;  4DQR A;  1WCL A;  1T4G A;  2XY7 A;  4XA5 A;  3TI0 A;  1N48 A;  4B9V A;  4KLT A;  2JZB A;  5C5J A;  5KFP A;  4IR9 A;  1BGX T;  2W9A A;  3KHH A;  3ZD8 A;  2BDP A;  2GWS A;  2MUT A;  4IRC A;  5J0T A;  4DF8 A;  1ZET A;  1ZQZ A;  2XC9 A;  4J9O A;  5HP4 A;  5KFX A;  2FPK A;  2LYH A;  3EW9 A;  1ZQC A;  3GIL A;  5KFR A;  4DS4 A;  2B21 A;  4DFJ A;  3ZDB A;  4NY8 A;  1KTQ A;  4RQ6 A;  2W8L A;  4DL7 A;  3M8R A;  1UA1 A;  3PY8 A;  4I2H A;  1XU4 A;  4RUA A;  4EBC A;  3KHL A;  4Q8F A;  4DOB A;  3V7J A;  3H8J A;  1EXN A;  1ZQD A;  3EWA A;  3UXO A;  3AU6 A;  1MQ2 A;  1ZQE A;  3N4M B;  5HHI A;  3G6Y A;  3LWL A;  5DLF A;  4ECY A;  4DL5 A;  1D9D A;  1KFD A;  4EZ6 A;  3RBD A;  3GFK B;  2W9M A;  4ED1 A;  4IQT A;  3T5L A;  2I1Q A;  4Q45 A;  3MFI A;  4F93 B;  2FLL A;  4ED6 A;  5DG9 A;  4UB5 A;  4E0D A;  5KT5 A;  4YQW A;  3PV8 A;  4KN4 A;  2HHX A;  2I9G A;  3TFR A;  8ICW A;  4FS2 A;  2NRZ A;  4DQQ A;  4J9R A;  8ICR A;  5F9N A;  9ICU A;  5J2H A;  5KFW A;  1ZJN A;  2PI4 A;  1KSP A;  1QLN A;  5J0U A;  1BPB A;  3IHQ B;  3C5G A;  2BQU A;  3Q8R B;  7ICH A;  4PGY A;  5KFG A;  1SKR A;  1S9F A;  4TUQ A;  1S97 A;  5IIL A;  1BPD A;  3OJU A;  3K4G A;  4B9S A;  5KFI A;  3HX0 A;  5EWE A;  1UT8 A;  3H8S A;  3RJI A;  3KTQ A;  2KZZ A;  4M6W A;  1ZQF A;  5DB6 A;  4NM2 A;  3PW0 A;  3T5H A;  4DQP A;  4GC7 A;  5KG5 A;  2FMQ A;  3JPS A;  2HW3 A;  4J9L A;  4F2R A;  4BWJ A;  1TAQ A;  2HHW A;  4DSF A;  3QZ8 A;  3RJF A;  4KLJ A;  4GXK A;  5KFT A;  4PHP A;  1ZQO A;  5J0Y A;  4EYI B;  4Q43 A;  5CJ7 A;  4QZF A;  4DFP A;  5IIO A;  3QZ7 A;  7ICS A;  3K75 D;  3ISB A;  2R8I A;  3RB6 A;  1S77 D;  4F2S A;  1A77 A;  1LV5 A;  5BPC A;  2BCQ A;  4IQW A;  3KHR A;  1LB2 B;  8ICV A;  1KDH A;  3H4D A;  5III A;  3IM1 A;  4QWD A;  4ED2 A;  1X9M A;  1V9P A;  3AU2 A;  2BCU A;  8ICY A;  2JZB B;  1QSY A;  1N56 A;  4F5R A;  3RH5 A;  5KTQ A;  3PO5 A;  3GIJ A;  4YMN A;  5IIM A;  4DFM A;  3FDS A;  4IR1 A;  5D49 A;  4UB1 A;  3PR5 B;  3H7I A;  4RZR A;  4M9H A;  3THV A;  3TAQ A;  5EWG A;  1U49 A;  4F5Q A;  2ASL A;  7ICV A;  4PGQ A;  4I2B A;  2ZJ8 A;  2BQ3 A;  3C2K A;  4ZH4 A;  5J2K A;  5L1K A;  3RR7 A;  3OSP A;  4RQ0 A;  3MDC A;  3PW5 A;  4KLF A;  8ICZ A;  2V9W A;  5KG2 A;  4EZ9 A;  3BQ2 A;  3QE9 Y;  2VA8 A;  5J2I A;  1HUO A;  8ICJ A;  3C1Y A;  3PMN A;  4UBC A;  7ICN A;  3UXN A;  3C21 A;  1ZQA A;  4YR2 A;  4C8K A;  4KMU A;  5DBB A;  4RUC A;  4GXI A;  1Z3E B;  4KLM A;  5J2F A;  3PVX A;  4YR0 A;  3PML A;  1U45 A;  3RH4 A;  1NJX A;  3H4B A;  1K1S A;  3UQ0 A;  1ZQG A;  2ALZ A;  1D8L A;  4RNM A;  4KLE A;  4NXZ A;  4UAW A;  1U9L A;  3BQT A;  9ICT A;  1ZQH A;  4O3S A;  4YD2 A;  2AQ4 A;  3OHA A;  4F3O A;  5KG6 A;  2DPI A;  4EEY A;  4G3I A;  5JUM A;  4R66 A;  2JEG A;  2F1I A;  3RJK A;  2ATL A;  1IM4 A;  5J0W A;  4KLL A;  1KEJ A;  5D46 A;  4MFA A;  4KLQ A;  1U47 A;  5KFY A;  4B9U A;  3ZDE A;  3ISD A;  4R63 A;  1MSW D;  3EPG A;  4RQ4 A;  2IMW P;  1ZQB A;  1BPY A;  2PFN A;  3RB3 A;  4M2Y A;  4DLE A;  2FLP A;  1IXR A;  4KLS A;  2R8G A;  3RAQ A;  8ICL A;  5DQG A;  4FS1 A;  2AGP A;  1NK7 A;  4BDP A;  4I2J A;  8ICB A;  5KFA A;  5J2A A;  4M04 A;  4YR3 A;  5D4B A;  2W9C B;  1NK0 A;  2HHV A;  4I2E A;  7ICG A;  3GII A;  4F4Z A;  2XO7 A;  2BCR A;  4O3N A;  2Q0Z X;  4QWA A;  1TK8 A;  2NRT A;  5HNK A;  3Q8K A;  1ARO P;  4PHD A;  2BQR A;  4ELT A;  4M9J A;  1SL2 A;  1UA0 A;  9ICK A;  1JXE A;  4M0A A;  8ICP A;  2R8H A;  4KLO A;  1SL1 A;  2UVU A;  3M9M B;  1JMS A;  1CUK A;  4DOC A;  4QZB A;  4I2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...