1U9LA

Structural basis for a nusa- protein n interaction
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
AHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the interaction of Escherichia coli NusA with protein N of phage lambda
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
molecule keywords Transcription elongation protein nusA
total genus 22
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u9lA00
1TAUA 4YXMA 5KFXA 4Z6DA 3OJUA 3MGIA 4DQQA 4IRDA 3C21A 2A1JB 3HWTA 4PHAA 4DSLA 9ICQA 4TUQA 3RBDA 4QZCA 5DG7A 2NRXA 9ICCA 2FLLA 3UXOA 4RQ8A 3RRGA 4LZDA 3GIMA 8ICWA 1XSNA 5J0PA 1ZJMA 5DG9A 2ISPA 1L3TA 4TQSA 4UB1A 3ZDDA 2W9BB 3TAQA 4TUPA 1KFSA 2FPMA 5J0RA 3EWAA 3GV7B 1AROP 4DSJA 7ICRA 4KMUA 2JZBA 2FMQA 5F9LA 2ZJ5A 3C5GA 3SZ2A 4F3OA 4C8MA 1X9SA 5C5JA 4PGQA 3M9NB 4I27A 2V4RA 2I9GA 1KTQA 2BHNA 4EEYA 4KLMA 1ZQWA 8ICLA 4EZ6A 4LVSA 1JMSA 1ZQZA 1SL0A 4KLQA 5KG0A 4DEZA 5J2DA 4J9OA 2C2EA 3TFRA 5HHHA 3ETLA 5DQIA 2JEFA 4M9JA 5KFVA 3EPGA 1ZQCA 5DB7A 2BKEA 4JUZA 7ICMA 2BCVA 5CR0A 4QWCA 3OHBA 3SV4A 4YG2A 3ZDEA 5L1KA 4I2GA 9ICMA 5J2AA 5CB1A 1NK6A 2Y1IA 3RJEA 5HNKA 1XO1A 4GLXA 1D8YA 4F92B 1QSYA 1S76D 4F4YA 4KLIA 4DFMA 4NY8A 5KFCA 3MFHA 2HHUA 5DB8A 5KFRA 4E0DA 4ED7A 4M9HA 9ICFA 5KG7A 1RZTA 8ICXA 5J0QA 4UB4A 2ASJA 2PFNA 5JUMA 1NJZA 1RPLA 4TURA 4FS2A 5KFDA 8ICOA 5J0UA 3T5JA 5EWEA 5J0TA 5IILA 1ZQJA 4DQIA 2ALZA 4KLOA 4F8RA 1U4BA 2XY7A 5IIMA 1U9LA 3B0YA 3RRHA 9ICLA 4B9NA 8ICYA 7ICPA 4ED2A 4RPZA 2ZTDA 5KFGA 4C8LA 5KFEA 1PZNA 4O5EA 5D46A 4GC6A 4JWMA 8ICSA 3GV5B 2VA8A 4DL5A 9ICVA 4ELTA 4R64A 2AGOA 4KLEA 3Q8PB 1TAQA 4O3NA 4NLKA 4J9SA 2JEIA 3C23A 5J0OA 1KSPA 1L3UA 4PHPA 2BCSA 4M9GA 3OHAA 3ISCA 1MQ3A 2C2DA 1N56A 2UVRA 5KT3A 2RDJA 5CWRA 3QE9Y 2HHSA 2XO7A 4DSIA 1DOQA 5EWGA 2W9BA 1ZQYA 2UVVA 3MGHA 1ZQIA 2PI5A 7ICNA 3C2KA 4YCXA 1IXRA 4F5OA 3PW2A 2C22A 1ZQXA 7ICGA 1NOMA 4RNMA 4YMOA 7ICLA 4KLLA 4YD1A 5KT4A 1XS9D 1ZQEA 4B9MA 4ZH4A 5DDMA 5IINA 3PO4A 3RJGA 2P66A 1T3NA 4ECQA 3M9OB 3GIKA 5BOMA 8ICCA 4O3OA 1CUKA 1NK4A 5J0SA 2M9NA 4YXJA 4RQ0A 4DL3A 2NRWA 9ICBA 1UA0A 4I2AA 4NM1A 4J9NA 3MDAA 2ZTEA 5D49A 3GQCA 1SL2A 4IRCA 2IHMA 4Q8FA 3MR5A 3TAPA 1L3VA 5KFAA 4P2HA 2AJQA 4YQWA 5DBCA 4UB5A 1QLNA 2XC9A 1C7YA 4F91B 4BDPA 2GWSA 3EZ5A 3HP6A 3M8SA 1XSPA 5DLGA 3AU6A 3MFIA 3QZ7A 3JPRA 2KZZA 3OJSA 3V72A 2Q0ZX 4O3PA 1X9MA 4EZ9A 4BWMA 4F5RA 1SKRA 1NK8A 1ZQFA 4ELUA 2AGPA 2R8JA 7ICUA 2RDIA 1BGXT 7ICVA 4C8KA 4YD2A 4R66A 3AUOA 1S77D 1TKDA 3V6JA 4ED8A 1SKWA 4F2RA 4DLEA 3PX6A 5DQHA 5DG8A 4JV2A 5J0XA 4DL6A 2W9CB 2FMSA 8ICRA 4GXIA 9ICNA 5KFKA 3JPOA 2HHTA 4DFJA 3PX4A 3TANA 4BXOA 9ICWA 4M9LA 1HJPA 3C1YA 1S97A 4Z6EA 5DBBA 3KHGA 3EPIA 4KLJA 4DLGA 3PR4A 1U49A 1Y88A 4F4ZA 4QZFA 3QZ8A 4M04A 3PW5A 3GIIA 1BPYA 5DDYA 4NXZA 4DO9A 3RH5A 1BPBA 4NLZA 1RXWA 3M8RA 1KDHA 5J2IA 3V6KA 5IIOA 3MR3A 2LYHA 2BR0A 2ASDA 3Q8RB 3HW8A 2W9CA 3V7KA 4B9VA 4M9NA 4UQGA 3PR5B 5J2CA 4DS5A 1NK9A 1U45A 3H4BA 2WTFA 4P4OA 2VA2A 2KFZA 2HVHA 3G6XA 2AU0A 2W9MA 2MAXA 3KHRA 4QWEA 1XWLA 4EYIB 5EOZA 1NK7A 3KHHA 4RQ3A 4QZ9A 2Y1JA 1S10A 8ICGA 4DOBA 2JEGA 9ICTA 2JEJA 1TK5A 4BXOB 4I2EA 1BPEA 2DFLA 3EYZA 1S0MA 5J2KA 4M6WA 8ICHA 2R8GA 3MR2A 4DSFA 1BVSA 4PH5A 4UBBA 4ECUA 2VA3A 4O5CA 4MEYA 4I2CA 3Q8MA 5KG6A 4F5QA 4J9QA 2PFQA 4DF8A 1Z00A 4XA5A 5L1JA 4KLUA 3IHQB 4Q45A 5KFJA 3C5FA 5DLFA 1T7PA 4B9LA 3E2EA 3C2LA 3RH6A 4LZGA 1NK0A 3GV8B 7ICKA 7ICSA 4F4WA 2KTQA 8ICVA 5D4BA 2ZUCA 3MBYA 3C1ZA 1N48A 4Q43A 2W8KA 2HHQA 5KFPA 8ICUA 2BPFA 5BPCA 3GFKB 3RTVA 4RQ5A 3KTQA 3ZDCA 7ICHA 4EBEA 2A1JA 4IRKA 4MFFA 5KFUA 4GC7A 5L1LA 2ZUBA 4J9PA 4I28A 4KN7A 1KRPA 4UAZA 4RNNA 3H4DA 4ECZA 9ICPA 3LDAA 1U48A 5CHGA 4RPYA 3MR6A 4O3QA 4UB3A 2DPIA 1HUZA 2MUTA 4YR2A 4J9MA 4YVZA 3V7JA 2HHXA 1JXEA 2VANA 4RUCA 2BPCA 8ICKA 2PI4A 1SZPA 3ISDA 4GXJA 2XY6A 3PW4A 5KFOA 3RJHA 2UVUA 4QZGA 1S0VA 8ICMA 2BCRA 3RR7A 2H5XA 3LWLA 5KG4A 1KFTA 5CP2A 3TI0A 3Q8LA 3BQ1A 4F50A 3PW0A 1NKBA 4NLNA 1Z3EB 1RYRA 3RJKA 5CJ7A 3OSPA 3V6HA 3H7IA 5F9NA 2IHNA 8ICNA 1QTMA 4F5NA 5HMLA 2ZUDA 4RQ2A 4QZHA 2JZBB 2ZTCA 1H38A 5KFWA 3BDPA 1X2IA 4Z6FA 5DQGA 3T5KA 5KFQA 1T4GA 4ED3A 2W9AA 8ICEA 1K1SA 1LV5A 8ICQA 4KTQA 2BCUA 3ZD9A 4ECRA 2R8KA 1XU4A 1UT8A 2V9WA 5DB9A 2ATLA 1TVAA 2ASLA 4B9SA 4DSKA 4KLFA 4FBUA 4HYKA 1ZQBA 4DF4A 3AU2A 4YR0A 2J6UA 3Q8KA 2HHVA 4FO6A 2NRTA 4NM2A 4P4PA 3RJIA 4ED6A 1NJYA 4QWDA 9ICHA 4I29A 1TK8A 1B43A 1UA1A 4B9TA 4M47A 7ICFA 5KFYA 4Q8EA 4F4XA 1MC8A 4K4IA 1D9DA 4R8UB 4I2BA 5DKWA 3PMNA 5IIKA 5KFBA 3ZDAA 5KG5A 5KFFA 2ZJAA 1ZQHA 1BPXA 3FDSA 1SKSA 2XY5A 2UVWA 4C8NA 4QZDA 1RYSA 3GDXA 2FLNA 2BDPA 9ICKA 2XGPA 8ICJA 3FYHA 4DOCA 1ZQSA 2PXIA 3RH4A 1JX4A 7ICTA 7ICOA 2DPJA 3PY8A 4X5VA 3RJJA 4FBTA 9ICAA 8ICAA 2AQ0A 2P6RA 4JWNA 4EBCA 4RNOA 4EBDA 1KLNA 5KFHA 8ICIA 4J9LA 3EW9A 2J6TA 4R8UA 4BGDA 4QWAA 3ISBA 3JPTA 4YFKA 4RT3A 1D8LA 4J9KA 3RB0A 5KFIA 4RZRA 5TZVA 4DQSA 3ORYA 1ZQQA 1MSWD 4XRHA 4RU9A 2NRVA 1ZQOA 2J6SA 3IM1A 4QWBA 4C8OA 4KLGA 5J2BA 4MFAA 5IIJA 3QEAZ 9ICSA 1EXNA 1XC9A 4P4MA 3T5LA 5J2EA 2HHWA 5DGBA 1ZETA 3PMLA 3GIJA 3K4GA 3SV3A 4F2SA 4KLSA 4QZBA 1ZQLA 9ICJA 4MFCA 5KG2A 5J2FA 2BQRA 1ZQMA 4F4KA 3KHLA 5DGAA 1NK5A 2IBKA 3RB4A 4IR9A 3MDCA 4O3RA 9ICXA 1QSLA 5KG1A 4NLGA 4DOAA 2I1QA 3G6YA 5KFZA 2HVIA 4RQ6A 3RB3A 3JPPA 4I2DA 2MUTB 1S0NA 4O5KA 4K4HA 4F5PA 7ICQA 5KTQA 1NKEA 8ICBA 2R8IA 4QZEA 2F1JA 4MF8A 3THVA 5KT6A 4YMNA 9ICUA 5J0WA 4Z6CA 2ISOA 2R8HA 3N97B 4CCHA 5J29A 4ELVA 9ICGA 2ZJ8A 4RUAA 3UPQA 3UQ0A 4I2IA 4JK1A 4XUSA 1L3SA 1WCNA 2FLPA 5IIIA 2W8LA 4I2JA 3PX0A 4RQ7A 3T5HA 2AQ4A 1ZQAA 5L1IA 5KFNA 3N4MB 4UB2A 1BPDA 1ZQKA 4KLDA 3K75D 5KT2A 3Q8SB 4KITB 4DWIA 9ICEA 1DGSA 4BWJA 4RQ4A 4IQWA 3RB6A 1ZQDA 1ZQTA 7ICIA 4EYHB 3BJYA 3ZD8A 1HUOA 2BGWA 9ICOA 8ICFA 4ECSA 4DFPA 4YP3A 3JPNA 5J2HA 4DQRA 3LK9A 1K1QA 1JN3A 1KFDA 1WCLA 4RQ1A 4UAWA 4QW9A 5HHIA 4IQVA 8ICZA 4QW8A 3H40A 2PFPA 2KZ3A 2B21A 3H8SA 3HPOA 9ICIA 1MQ2A 1ZQVA 2KZMA 4ECYA 4QZIA 3QEBZ 1ZQPA 1COOA 2KN7A 2NRZA 2XCAA 3RBEA 4PHDA 1A77A 5J2JA 3BQTA 5J2GA 4YN4A 2AGQA 2BQ3A 1TV9A 3PW7A 1NJWA 4IQTA 3RR8A 2IMWP 4B9UA 3PVXA 1CEZA 3UXPA 1ZQGA 4M2YA 4M0AA 1X9WA 3JPQA 4KLHA 1IM4A 5KFSA 4F93B 4DL2A 7ICJA 4JV1A 5HP4A 4IQUA 2IA6A 3Q8QB 4YMMA 5BOLA 4O0IA 3JPSA 3BQ0A 4DL7A 3UXNA 5J0YA 1D9FA 5EWFA 4JV0A 4FS1A 8ICPA 2V4QA 4IR1A 4GXKA 3PNCA 1ZYQA 4DL4A 1XSLA 4UBCA 3SI8A 3TQ1A 2P6UA 3RAQA 1QSSA 5KFLA 3C2MA 1UT5A 4DS4A 3TARA 3NGDA 1A76A 2HW3A 4QZ8A 1JXLA 2BCQA 1V9PA 3B0XA 3GILA 1Z00B 4ECVA 3RAXA 2C28A 4PPXA 8ICTA 3BQ2A 3UQ2A 4R63A 4RPXA 2C2RA 3OGUA 4ED0A 3MABA 4M6WB 3TFSA 2BQUA 4KLTA 4ECWA 2F1HA 4YR3A 3PO5A 4G3IA 2XGQA 3T3FA 1SL1A 2FPLA 2XCPA 3H8WA 5DB6A 4I2HA 2BPGA 1ZQUA 3V7LA 1U47A 1S9FA 3LWMA 4ECTA 1NKCA 1ZQRA 1S0OA 1KEJA 5L9XA 1RXVA 1ZJNA 3HX0A 1JIHA 5KT5A 5KG3A 4PGYA 5DBAA 4ECXA 5HMMA 3ZDBA 4MF2A 2F1IA 5KT7A 4DQPA 1B22A 4O3SA 4O9MA 4XQ8A 3M9MB 4J9RA 4PHEA 2FMPA 4TQRA 4DFKA 5CA7A 1NJXA 4MEXA 4I2FA 3SYZA 3PV8A 4R65A 4Q44A 3H8JA 1TK0A 3HT3A 3NTUA 4K4GA 1TFRA 2FPKA 1ZQNA 4KN4A 1T8EA 2KFNA 5KFTA 4PGXA 4DSEA 7ICEA 9ICRA 4TUSA 1LB2B 1BPZA 3G6VA 3RJFA 4ED1A 4UAYA 1L5UA 2PFOA 2OWOA 4RT2A 5KFMA 4QZAA 3OSNA
chains in the Genus database with same CATH superfamily
1TAUA 3TACB 4Z6DA 3MGIA 1WUDA 2K8AA 3HWTA 4PHAA 2VKQA 3FC4A 5DG7A 5AKIA 3UXOA 4USAA 8ICWA 1XSNA 1L3TA 4UB1A 3H0MB 4TUPA 5J0RA 4F72A 4DSJA 5ALHA 1X9SA 4Y2VA 1KTQA 1Q46A 3FM9A 1SL0A 4KLQA 5KG0A 5HHHA 2JHDA 5KFVA 4JUZA 1PVRA 2W3RA 1Z19A 5J2AA 4Y2SA 3PZPA 5EE9A 2LBOA 3RJEA 1LKYA 5HNKA 2D8CA 2H3IA 1YZ7A 1S76D 4F4YA 2O6KA 5DB8A 4E0DA 5KG7A 8ICXA 2Y0SF 5J0QA 2MSNA 1FO4A 1NJZA 8ICOA 5EWEA 1SV0C 1SWVA 3RRHA 8ICYA 4ED2A 4C8LA 5KFEA 5D46A 4JWMA 5AM2A 2VIXA 4UB6U 3K1ZA 4ELTA 1TAQA 2DKXA 4J9SA 2JEIA 5J0OA 3OHAA 2UVRA 1PK1A 2WF9A 5ALUA 3GZFA 2RDJA 3QE9Y 5AI4A 2HHSA 2XO7A 1ZQIA 2PI5A 1B0XA 5AI8A 2PMZF 4YCXA 1IXRA 4F5OA 1ZQXA 7ICGA 1RDFA 7ICLA 4YD1A 5KT4A 3PSPA 4ZH4A 5IINA 3RJGA 3H8MA 5BOMA 1CUKA 2M9NA 4RQ0A 9ICBA 1WG8A 5ALFA 4I2AA 2ZTEA 4PL2A 4Q8FA 3MR5A 2G5IB 2AJQA 2XC9A 3ICXA 5F3XB 1XSPA 1ZD4A 3WK9A 4KX3A 1F44A 1NK8A 1ZQFA 3I28A 1BGXT 2G0AA 4YD2A 4R66A 1S77D 1TKDA 3M7DA 4F2RA 5DQHA 2FMSA 2XICA 1S97A 1U49A 2LMRA 5AKKA 4BUGA 4QZFA 1SV0A 4NJ8A 3GIIA 2OHFA 3RH5A 1RXWA 5J2IA 2K4HA 3SR6A 2B6GA 2EH9A 2WTFA 4PZNA 2HDOA 3G6XA 2W9MA 8ICGA 1PK3A 1NK7A 3IN5A 9ICTA 2E8MA 1TK5A 3EYZA 3DDHA 4M6WA 4UBBA 5KNIA 4MEYA 5KG6A 4J9QA 1Z00A 3IHQB 1T7PA 4B9LA 2PMZC 3WK4A 2A3VA 1K5OA 2ZUCA 2ZIVB 3DEEA 4RQ5A 3ZDCA 7ICHA 2A1JA 4MFFA 5KFUA 2ZUBA 4UAUA 3LDAA 4UB3A 2DPIA 4J9MA 4CNQA 3V7JA 1ZD5A 1SZPA 4GXJA 5KFOA 3RJHA 4QZGA 2H3ZA 2H5XA 2K8CB 3LWLA 2MU2A 5CP2A 2NYVA 4NLNA 3RF9A 1RYRA 1T3QA 5CJ7A 4RQMA 2W04A 2ZUDA 4QZHA 1PVQA 3F53A 2Y0SC 1MN8A 3T5KA 3KZXA 5AI9A 5KFQA 2W9AA 1K1SA 5AM1A 2HBKA 5DB9A 4FBUA 4U7CA 3I76A 2J6UA 3HILA 5ALOA 4P4PA 1V38A 3RJIA 4ED6A 1NJYA 1N5XA 3D2SA 4IS7A 4M47A 1MC8A 4K4IA 4I2BA 5DKWA 2YMQA 2ZJAA 5ALRA 3FDSA 2CPRA 5AI6A 1X6JA 4C8NA 3ETRA 3QU4A 2PXIA 7ICOA 4DFDA 3RJJA 1O08A 2AQ0A 3OPXA 2P6RA 4EBCA 4EBDA 1KLNA 3EW9A 2J6TA 4R8UA 3ISBA 4J9KA 1D8LA 5TZVA 3ORYA 4JB3A 4XRHA 1ECWA 2A1AA 4KLGA 2H3FA 5IIJA 3BQ7A 4OJOA 4P4MA 2L5YA 2HHWA 3PMLA 3GIJA 3SV3A 3AN1A 4KLSA 4QZBA 1ZQLA 4MFCA 5AI0A 5KG2A 1ZQMA 4F4KA 1NK5A 2D6FC 1J2NA 4U6PA 5KG1A 2ZG6A 2HVIA 3JPPA 4I2DA 4C4SA 2GH1A 8ICBA 2IOHA 2F1JA 2LM4A 4Z6CA 3HKZF 2F77X 4ELVA 3UPQA 4I2IA 1L3SA 1WCNA 2W8LA 3PX0A 2HOFA 4RQ7A 1BPDA 2JMGA 2YB4A 1ZQKA 3Q8SB 9ICEA 3RB6A 1ZQTA 2W3SA 8ICFA 2DL0A 1COKA 1KFDA 4RQ1A 5FP0A 8ICZA 4QW8A 3H8SA 3KBBA 1MQ2A 1BNOA 4Y2UA 3RBEA 4NY8A 5J2JA 1TV9A 4YN4A 2BQ3A 3PW7A 4IQTA 5ALYA 3PVXA 1JALA 2HOQA 1X9WA 4M2YA 4JV1A 2Z7JA 5ALNA 3BQ0A 2KEYA 2KV2A 4IR1A 4C0ZA 3PNCA 1S8OA 4UBCA 1RG6A 3SI8A 2P6UA 3C2MA 3TARA 3QUBA 2F76X 2BCQA 3QNMA 2DF4B 2C28A 1N60A 2HI0A 4R63A 4RPXA 3TFSA 3B9JA 5AKXA 4ECWA 2F1HA 3PO5A 3H0RB 3T3FA 2XCPA 3H8WA 3IDWA 2BZFA 1S9FA 3LWMA 2WAQC 1NKCA 2FJ6A 3HX0A 1NZPA 2CN1A 2YQEA 4PGYA 4MF2A 2F1IA 1JUDA 5GTHU 4O3SA 3M9MB 4J9RA 1NJXA 4DCCA 4I2FA 2KKVA 3NTUA 3SAHA 4K4GA 4KN4A 1T8EA 1N62A 7ICEA 4TUSA 1BPZA 3VCBA 3RJFA 2ZIWA 1Z4OA 4UAYA 2OWOA 2A1JB 9ICQA 2NRXA 2FLLA 3KKAA 2F2AB 5J0PA 5DG9A 1QQ6A 3ZDDA 1V97A 1PVPA 1CRXA 2FPMA 3GV7B 1AROP 2BDUA 1M6YA 2JZBA 2XI9A 4KMUA 3SZ2A 4F3OA 4C8MA 4EEYA 5ALWA 1ZQWA 5C0YA 2DKZA 4J9OA 3TFRA 2F8LA 4C4TA 5DQIA 4M9JA 1TE2A 2BCVA 5CR0A 3SEIA 4I2GA 3ZDEA 5L1KA 5CB1A 2Y1IA 1XO1A 4GLXA 1QSYA 5KFCA 2W55A 3F2CA 1LVHA 3SAGA 5AM3A 4CE6A 2A19A 4FS2A 3T5JA 2XY7A 4RQNA 1B4FA 2CRXA 2YMPA 7ICPA 4RPZA 2XVTA 5J8YA 4GC6A 3F5AA 1A6SA 4KLEA 2AGOA 1XO0A 1KSPA 1HEKA 2BCSA 3ISCA 2C2DA 3L5KA 3PSFA 5CWRA 1MA7A 1DXSA 5EWGA 1L7OA 2UVVA 1DGJA 3DV9A 4RNMA 3C28A 4KLLA 1JRPA 3N28A 4CDGA 4B9MA 5AICA 2P66A 1T3NA 2B0CA 4ECQA 3WKCA 3GIKA 5E79U 1UA0A 2Y9TA 4NWIA 5KFAA 1QLNA 5AK3A 1C7YA 4F91B 4BDPA 2GWSA 2GOLA 5DLGA 3AU6A 1YT3A 3OJSA 2G06A 2Q0ZX 4O3PA 3WK5A 1X9MA 4BWMA 7ICUA 2AGPA 1Q3VA 1X9XA 7ICVA 4C8KA 4NV0A 4Y2RA 4ED8A 3PX6A 4Y2TA 2ZXHA 5DG8A 4JV2A 4DL6A 9ICNA 8ICRA 4GXIA 2HHTA 3JPOA 3PX4A 3TANA 4BXOA 2HOIA 4M9LA 3C1YA 4Z6EA 5DBBA 3KHGA 2HCFA 4EX7A 3PR4A 1SXEA 3QZ8A 1BPYA 5DDYA 2VJ5A 1L8LA 4B6JA 3M8RA 2LYHA 3Q8RB 2W9CA 3V7KA 4M9NA 4DS5A 1NK9A 2E8NA 2KFZA 1ZOLA 4QWEA 3VC8A 3NRZA 3CW2C 4C7YA 4QZ9A 2KSOB 2QARA 4I2EA 4BXOB 4NLCA 1F0MA 8ICHA 2R8GA 2YY6A 3BS7A 4ECUA 4I2CA 4F5QA 2PFQA 4DF8A 4XA5A 5L1JA 3C5FA 2W7PA 3E2EA 3A0HU 3C2LA 3RH6A 1V85A 4F4WA 2K89A 2LHTA 3MBYA 5D4BA 4Q43A 3WKAA 5KFPA 1ZD3A 4IRKA 5L1LA 2W11A 4WJ3B 3H4DA 3E58A 2Q4TA 2E3TA 4YR2A 4YVZA 1JXEA 2VANA 3NASA 3IG8A 2BCRA 3F5EA 3RR7A 5KG4A 1KFTA 1WWUA 1NKBA 4F50A 3PW0A 1IG6A 3RJKA 3OSPA 8ICNA 5F9NA 2F3NA 1N5WA 5AIAA 2I6XA 2WHEA 1H38A 4PZOA 5AI5A 4OJLA 4Z6FA 2KD1A 3ZD9A 3ONNA 4B9SA 2N1RA 2RRDA 2HHVA 2NRTA 4NM2A 4QWDA 3QYPA 4AP9A 4I29A 5KFYA 4UB8U 4Q8EA 4F4XA 5IIKA 3ZDAA 5KG5A 1RM6C 1BPXA 1RYSA 3GDXA 2BDPA 9ICKA 3BS5B 3FYHA 4DOCA 3RH4A 4FBTA 4P0QB 8ICAA 4JWNA 3EUB2 2KIVA 5AKEA 2ZXIA 3JPTA 4RT3A 2G07A 4Y2PA 3KD3A 4RU9A 1ZXIA 2JRZA 3M6KA 4MFAA 1EXNA 2OM6A 2WF5A 3K4GA 4F2SA 3BS5A 2EANA 4EENA 5ALVA 3S6JA 2BQRA 3UMGA 3KHLA 5DGAA 3RB4A 4IR9A 1A0PA 5ALPA 3MDCA 4O3RA 1QSLA 4DOAA 2I1QA 2FE9A 2EZYA 2MUTB 1S0NA 3K1RB 5ALEA 7ICQA 5KT6A 3H0LB 4YMNA 3NS1A 1CI4A 5J29A 2ZJ8A 5T14A 4OJPA 2FLPA 3T5HA 2WB1C 1SIJA 5KFNA 1Q8KA 1OUQA 5KT2A 4DWIA 1ZQDA 1HUOA 2BGWA 4YP3A 1KQQA 2MRLA 5HHIA 2PFPA 2ZIWB 2B21A 1ZQVA 4QZIA 2EAOA 3QEBZ 2XCAA 2EDUA 5AKGA 2QARB 1NJWA 3BQTA 3F2DA 3SQIA 1CEZA 3UXPA 3AMZA 1ZRMA 2RP5A 3PSIA 3KZIU 4DL7A 5AM4A 3UXNA 5J0YA 1Q3UA 2ZIXB 5ALLA 4JV0A 2HSZA 4GXKA 2LYAA 1ZYQA 4DL4A 1XSLA 3RAQA 1O03A 1QSSA 2YN4A 5KFLA 1UT5A 3N7PD 4DS4A 1KL9A 2KKPA 8ICTA 3RAXA 2G5HB 3UQ2A 3WKEA 4M6WB 4YR3A 2RQ5A 2HBJA 2E1FA 3I1YA 5DB6A 3QUCA 2P35A 1S0OA 5L9XA 1RXVA 1JIHA 5KT5A 5HMMA 3SAFA 4DQPA 4XQ8A 4DFKA 1ED1A 5CA7A 4MEXA 2KK0A 1ZQNA 2KHQA 2KFNA 2YMMA 9ICRA 4QZAA 5AKLA 3OSNA 2CXYA 1RQNA 3WU2U 3C21A 5KAIU 4TUQA 3RBDA 4QZCA 4C7ZA 1SB3C 4RQ8A 3RRGA 1ZJMA 3WK7A 2LM1A 3TAQA 2QKQA 3BZKA 3EWAA 2JH1A 2LI6A 5F9LA 3C5GA 4PGQA 3M9NB 5L1MA 2I9GA 3FAHA 4Y2JA 8ICLA 4EZ6A 1JMSA 3IG5A 5ALKA 1ZQZA 4DEZA 5J2DA 2C2EA 2JEFA 2K4EA 3EPGA 1ZQCA 2ZIUB 5DB7A 4FZLA 7ICMA 3OHBA 5ALQA 9ICMA 1S5LU 2NV3A 2E1EA 3SENA 5JTIA 5AKHA 4F92B 4CGZA 4CF3A 4KLIA 3MFHA 2HHUA 1SXDA 1VLBA 5KFRA 4M9HA 9ICFA 1RZTA 4UB4A 2ASJA 2PFNA 2OXOA 2OCEA 4AYBC 1RPLA 5KFDA 3D2QA 5J0UA 1ZQJA 5ALIA 5ALXA 4DQIA 2ALZA 4KLOA 4F8RA 5IIMA 1U9LA 1DRGA 4B9NA 1PZNA 5AM5A 3SMVA 3HJEA 1C20A 2H3VA 3Q8PB 4O3NA 4NLKA 5GTIU 2WF7A 4PHPA 2LKYA 4M9GA 2AH5A 3D6JA 1MQ3A 2W9BA 3MGHA 3MGVA 7ICNA 3C2KA 2C22A 1Z1BA 4PL1A 1NOMA 2I5HA 1N61A 1XS9D 1ZQEA 3PO4A 1QQ5A 3M9OB 4MHVA 4O3OA 4EEKA 5J0SA 2NRWA 2OEHA 3MC1A 4NM1A 1SL2A 3GQCA 1X40A 1L3VA 1KN5A 4P2HA 4Y2QA 4UB5A 2LYBA 4IC9A 1FFVA 3HP6A 3M1YA 3D2NA 3MFIA 5AK5A 3JPRA 1N2XA 3V72A 4EZ9A 2F8KA 2H3QA 4F5RA 2R8JA 4QIWC 2HMXA 3AUOA 3V6JA 1SKWA 2KHVA 5J0XA 1L7MA 4QIWF 1L7PA 5KFKA 2AXTU 4EELA 3RFAA 5G5GA 2F44A 4KLJA 1Y88A 4CRXA 3PW5A 4FE3A 4DO9A 3KKAC 1BPBA 5AIBA 3LVVA 1KDHA 3WKBA 5EE1A 3V6KA 5IIOA 2ASDA 5KL8B 5ALJA 3HW8A 3T79A 4UQGA 3PR5B 3H4BA 4P4OA 2HVHA 2AU0A 2MAXA 2ZIXA 1XWLA 4EYIB 2M0NA 2Y1JA 3A0BU 1BPEA 5J2KA 4DSFA 3MR2A 4KX5A 4KLUA 4Q45A 5DLFA 5CRXA 2LPEA 4LZGA 7ICSA 8ICVA 2KOBA 2HHQA 3GFKB 3KTQA 3IRUA 4EBEA 3AM9A 4J9PA 4I28A 4KN7A 1KRPA 3TKAA 9ICPA 2G08A 5CHGA 4RPYA 3MR6A 1U48A 1FEZA 1HUZA 3CYMA 4RUCA 2BPCA 2WF6A 8ICKA 2PI4A 3TADC 3ISDA 3PW4A 2XY6A 8ICMA 3BQ1A 1Z3EB 4AYBF 5HMLA 3QU5A 2JZBB 5KFWA 1X2IA 1T94A 3UMBA 5A0LA 1LV5A 2W7OA 8ICQA 3AQEA 2BCUA 1BNPA 1UT8A 2ATLA 1TVAA 2ASLA 4KLFA 4DF4A 3AU2A 3QU2A 4FFDA 4FO6A 4OJ5A 3QXGA 1TK8A 7ICFA 5HR6A 2JXJA 3KFUF 5JU5A 4R8UB 3PMNA 5KFBA 3SD7A 4OO1J 2XY5A 2E8PA 2UVWA 4QZDA 4CF5A 8ICJA 4FZNA 7ICTA 2DPJA 4X5VA 8ICIA 3M6ZA 4IL6U 4J9LA 4OCZA 1NNLA 3N7RC 4DQSA 4RZRA 1ZQQA 3NVYA 1ZQOA 2NRVA 3GU3A 4QWBA 1SWWA 5AKZA 5ALGA 5J2BA 2EZZA 3QEAZ 3T5LA 5DGBA 1ZETA 4UARA 5EE3A 1LKYB 3HRDD 5J2FA 4ACOA 1SV4A 4NLGA 4RQ6A 2W03A 4UAVA 3QUQA 4F5PA 2FDRA 5KTQA 2R8IA 4MF8A 3THVA 1QH9A 4ICAA 1SZHA 5J0WA 2ISOA 2R8HA 3N97B 4CCHA 3CRXA 2DWQA 4RUAA 3UQ0A 4JK1A 1JI7A 5IIIA 4I2JA 1IV8A 3NRWA 1ZQAA 1NI3A 1TAMA 4Y2YA 2ESEA 2YTUA 4KLDA 4J03A 4IQWA 9ICOA 2QLTA 3ZD8A 4ECSA 4DFPA 5ALMA 3JPNA 4DQRA 1JN3A 1WCLA 3HPOA 9ICIA 2EAPA 4ECYA 1COOA 4PHDA 1A77A 5J2GA 4OD0A 3RR8A 5TISU 3JPQA 1IM4A 4F93B 7ICJA 5HP4A 4IQUA 2IA6A 1RYUA 5BOLA 1D9FA 5EWFA 4FS1A 2V4QA 2EZXA 2ODGA 3TQ1A 3NGDA 1A76A 2HW3A 4QZ8A 5AKJA 1JXLA 3B0XA 3GILA 1GO3F 2WB1F 4ED0A 3MABA 4C80A 2BQUA 4US9A 4KLTA 4UASA 4G3IA 1KBUA 2GO7A 4PJ0U 1L7NA 2NO4A 1SL1A 1UPHA 4I2HA 2BPGA 1ZQUA 3V7LA 1U47A 1L8OA 4ECTA 1KEJA 2GLEA 3QU9A 1ZJNA 3ALRA 5DBAA 5KT7A 1B22A 4O9MA 5KAFU 2FMPA 4TQRA 2MA1A 3SYZA 2WFAA 2QB0A 3PV8A 2EQYA 4R65A 1HIWA 1TFRA 2FPKA 3CNHA 5AK4A 1LB2B 3G6VA 1J2MA 1L5UA 2PFOA 2YMLA 2WF8A 4YXMA 5KFXA 3OJUA 4DQQA 5B5EU 4IRDA 4DSLA 1KW4A 9ICCA 3LYSA 4LZDA 3GIMA 3F2BA 2ISPA 2K4IA 3QUTA 4BX9C 5HR7A 2IOFK 4TQSA 2W9BB 1QCKA 2QB0B 1KFSA 3WK8A 4ZOHC 1QQ7A 7ICRA 1F5SA 2FMQA 2ZJ5A 3C29A 5C5JA 5KL1B 4I27A 2V4RA 2BHNA 3U26A 4KLMA 1ZRNA 4LVSA 1FIQA 3WK6A 2R18A 3ETLA 2RHFA 3TADA 4US8A 2BKEA 2AHOB 2OH2A 4QWCA 3SV4A 4YG2A 3O0FA 1NK6A 1P7DA 3CP8A 2ZIVA 1D8YA 4DFMA 2DBYA 4ED7A 1AQ6A 2YB1A 5JUMA 4TURA 4F71A 5J0TA 2HBMA 5IILA 1U4BA 3NVVA 3B0YA 9ICLA 2ZTDA 4FZMA 5KFGA 4O5EA 8ICSA 3GV5B 2VA8A 4DL5A 9ICVA 4R64A 2K8BB 1JROA 5AHXA 3C23A 1L3UA 3IV6A 5ALDA 1N56A 2HBLA 5KT3A 4DSIA 1DOQA 5AK6A 4QNLA 1ZQYA 4NLBA 3L3FX 3PW2A 1YZ6A 4YMOA 1UQVA 5DDMA 3NUQA 2E8OA 8ICCA 1NK4A 2ES6A 2G09A 3LVWA 4YXJA 4DL3A 3IP4B 2FI1A 1XNSA 4J9NA 3MDAA 5D49A 4IRCA 2IHMA 3TAPA 4YQWA 5DBCA 1ZD2P 3EZ5A 3M8SA 2KICA 3QZ7A 2IOFA 2KZZA 2KNJA 4NL9C 2KSOA 1SKRA 4ELUA 2RDIA 5G5HA 5AKYA 4DLEA 2W9CB 4DFJA 9ICWA 1HJPA 2KJ9A 3KOOA 3EPIA 4DLGA 4F4ZA 4M04A 2KVSA 4NXZA 3R9KA 4NLZA 1X42A 3MR3A 2BR0A 4B9VA 2ZIUA 1X6IA 1DK3A 5J2CA 1U45A 2VA2A 1X66A 3KHRA 2KP7A 3J81j 5EOZA 3KHHA 4RQ3A 1S10A 2E5SA 4BJQA 4DOBA 2JEGA 1KKXA 2Y9UA 2JEJA 3ZI4A 2VJ4A 2DFLA 1S0MA 3NVZA 2VA3A 1BVSA 4PH5A 4O5CA 2YX8A 4G9BA 3Q8MA 3QU7A 1DK2A 5KFJA 1NK0A 3GV8B 7ICKA 2KTQA 1N48A 3C1ZA 2W8KA 8ICUA 2BPFA 5BPCA 3L4PA 3RTVA 4GC7A 4UAZA 4RNNA 4ECZA 4P0PA 4O3QA 2MUTA 2HHXA 2UVUA 1S0VA 2K60A 1ZQ1C 3TI0A 3Q8LA 3V6HA 3H7IA 4NL9A 2IHNA 1QTMA 2W54A 4F5NA 4RQ2A 2ZTCA 3BDPA 5DQGA 4P0QA 4C4RA 1T4GA 4ED3A 8ICEA 4KTQA 2KIWA 4ECRA 2R8KA 3AL0B 1XU4A 2V9WA 1WYGA 4DSKA 4HYKA 1ZQBA 1SGGA 4YR0A 3Q8KA 9ICHA 1B43A 1UA1A 4B9TA 4Y2XA 1L6NA 1Z1VA 3UMCA 5B66U 1D9DA 3WKDA 1UCVA 1FFUA 1ZQHA 5KFFA 1SKSA 1J97A 2JV3A 2FLNA 4QJFB 2XGPA 1ZQSA 1PUZA 1JX4A 2DQNB 3PY8A 9ICAA 4UW9A 4KMOB 1Z4NA 4RNOA 4HAIA 5KFHA 5CEHA 4BGDA 4QWAA 4YFKA 2JR5A 5ALTA 5KFIA 3RB0A 1MSWD 5EE0A 3UM9A 2J6SA 3BZCA 3IM1A 4C8OA 4OJ6A 9ICSA 1XC9A 5AM0A 5J2EA 5ALZA 9ICJA 4P0PB 2IBKA 9ICXA 2QB1A 3G6YA 5KFZA 3RB3A 3NVWA 1OW5A 4O5KA 4K4HA 1NKEA 4QZEA 9ICUA 4O3MA 2WAQF 2JGAA 4XUSA 2KJ5A 2AQ4A 2KJ8A 5L1IA 3N4MB 4UB2A 3K75D 4KITB 1DGSA 4BWJA 4RQ4A 7ICIA 4EYHB 3BJYA 1WWVA 2RLTA 1URJA 2DUYA 5J2HA 4UATA 1NZBA 2EAMA 3LK9A 1K1QA 1PK1B 4QW9A 4UAWA 4IQVA 3H40A 4A8EA 2KZ3A 5K4LA 2KZMA 3N7SC 2DGZA 3PSTA 1ZQPA 2KN7A 2NRZA 2AGQA 2IMWP 4B9UA 2W43A 5J8YC 1ZQGA 4KLHA 4M0AA 5KFSA 4DL2A 1N63A 3Q8QB 4YMMA 4O0IA 4LJXA 3JPSA 2XIDA 8ICPA 3AQFA 1RQLA 3AEVA 2JH7A 2D3DA 3OTQA 1V9PA 4ECVA 1Z00B 4JMUA 4CF4A 4PPXA 3BQ2A 2C2RA 3OGUA 3ED5A 5H2FU 2OYYA 3QX7A 4EX6A 1VJ5A 2XGQA 2FPLA 1UHUA 2KE7A 1VDVA 3HKZC 1ZQRA 1D8BA 5KG3A 2KVCA 4ECXA 3ZDBA 5ALSA 2KG5A 4PHEA 2K4PA 2NO5A 1OXJA 4Q44A 1IIPA 2PKEA 3H8JA 3HT3A 1TK0A 2KMDA 5KFTA 4PGXA 4DSEA 4GIBA 4ED1A 4RT2A 3E0FA 5JRTA 5KFMA 4GFJA 9ICGA
chains in the Genus database with same CATH topology
1TAUA 4YXMA 5KFXA 4Z6DA 3OJUA 3MGIA 4DQQA 4IRDA 3C21A 2A1JB 3HWTA 4PHAA 4DSLA 9ICQA 4TUQA 3RBDA 4QZCA 5DG7A 2NRXA 9ICCA 2FLLA 3UXOA 4RQ8A 3RRGA 4LZDA 3GIMA 8ICWA 1XSNA 5J0PA 1ZJMA 5DG9A 2ISPA 1L3TA 4TQSA 4UB1A 3ZDDA 2W9BB 3TAQA 4TUPA 1KFSA 2FPMA 5J0RA 3EWAA 3GV7B 1AROP 4DSJA 7ICRA 4KMUA 2JZBA 2FMQA 5F9LA 2ZJ5A 3C5GA 3SZ2A 4F3OA 4C8MA 1X9SA 5C5JA 4PGQA 3M9NB 4I27A 2V4RA 2I9GA 1KTQA 2BHNA 4EEYA 4KLMA 1ZQWA 8ICLA 4EZ6A 4LVSA 1JMSA 1ZQZA 1SL0A 4KLQA 5KG0A 4DEZA 5J2DA 4J9OA 2C2EA 3TFRA 5HHHA 3ETLA 5DQIA 2JEFA 4M9JA 5KFVA 3EPGA 1ZQCA 5DB7A 2BKEA 4JUZA 7ICMA 2BCVA 5CR0A 4QWCA 3OHBA 3SV4A 4YG2A 3ZDEA 5L1KA 4I2GA 9ICMA 5J2AA 5CB1A 1NK6A 2Y1IA 3RJEA 5HNKA 1XO1A 4GLXA 1D8YA 4F92B 1QSYA 1S76D 4F4YA 4KLIA 4DFMA 4NY8A 5KFCA 3MFHA 2HHUA 5DB8A 5KFRA 4E0DA 4ED7A 4M9HA 9ICFA 5KG7A 1RZTA 8ICXA 5J0QA 4UB4A 2ASJA 2PFNA 5JUMA 1NJZA 1RPLA 4TURA 4FS2A 5KFDA 8ICOA 5J0UA 3T5JA 5EWEA 5J0TA 5IILA 1ZQJA 4DQIA 2ALZA 4KLOA 4F8RA 1U4BA 2XY7A 5IIMA 1U9LA 3B0YA 3RRHA 9ICLA 4B9NA 8ICYA 7ICPA 4ED2A 4RPZA 2ZTDA 5KFGA 4C8LA 5KFEA 1PZNA 4O5EA 5D46A 4GC6A 4JWMA 8ICSA 3GV5B 2VA8A 4DL5A 9ICVA 4ELTA 4R64A 2AGOA 4KLEA 3Q8PB 1TAQA 4O3NA 4NLKA 4J9SA 2JEIA 3C23A 5J0OA 1KSPA 1L3UA 4PHPA 2BCSA 4M9GA 3OHAA 3ISCA 1MQ3A 2C2DA 1N56A 2UVRA 5KT3A 2RDJA 5CWRA 3QE9Y 2HHSA 2XO7A 4DSIA 1DOQA 5EWGA 2W9BA 1ZQYA 2UVVA 3MGHA 1ZQIA 2PI5A 7ICNA 3C2KA 4YCXA 1IXRA 4F5OA 3PW2A 2C22A 1ZQXA 7ICGA 1NOMA 4RNMA 4YMOA 7ICLA 4KLLA 4YD1A 5KT4A 1XS9D 1ZQEA 4B9MA 4ZH4A 5DDMA 5IINA 3PO4A 3RJGA 2P66A 1T3NA 4ECQA 3M9OB 3GIKA 5BOMA 8ICCA 4O3OA 1CUKA 1NK4A 5J0SA 2M9NA 4YXJA 4RQ0A 4DL3A 2NRWA 9ICBA 1UA0A 4I2AA 4NM1A 4J9NA 3MDAA 2ZTEA 5D49A 3GQCA 1SL2A 4IRCA 2IHMA 4Q8FA 3MR5A 3TAPA 1L3VA 5KFAA 4P2HA 2AJQA 4YQWA 5DBCA 4UB5A 1QLNA 2XC9A 1C7YA 4F91B 4BDPA 2GWSA 3EZ5A 3HP6A 3M8SA 1XSPA 5DLGA 3AU6A 3MFIA 3QZ7A 3JPRA 2KZZA 3OJSA 3V72A 2Q0ZX 4O3PA 1X9MA 4EZ9A 4BWMA 4F5RA 1SKRA 1NK8A 1ZQFA 4ELUA 2AGPA 2R8JA 7ICUA 2RDIA 1BGXT 7ICVA 4C8KA 4YD2A 4R66A 3AUOA 1S77D 1TKDA 3V6JA 4ED8A 1SKWA 4F2RA 4DLEA 3PX6A 5DQHA 5DG8A 4JV2A 5J0XA 4DL6A 2W9CB 2FMSA 8ICRA 4GXIA 9ICNA 5KFKA 3JPOA 2HHTA 4DFJA 3PX4A 3TANA 4BXOA 9ICWA 4M9LA 1HJPA 3C1YA 1S97A 4Z6EA 5DBBA 3KHGA 3EPIA 4KLJA 4DLGA 3PR4A 1U49A 1Y88A 4F4ZA 4QZFA 3QZ8A 4M04A 3PW5A 3GIIA 1BPYA 5DDYA 4NXZA 4DO9A 3RH5A 1BPBA 4NLZA 1RXWA 3M8RA 1KDHA 5J2IA 3V6KA 5IIOA 3MR3A 2LYHA 2BR0A 2ASDA 3Q8RB 3HW8A 2W9CA 3V7KA 4B9VA 4M9NA 4UQGA 3PR5B 5J2CA 4DS5A 1NK9A 1U45A 3H4BA 2WTFA 4P4OA 2VA2A 2KFZA 2HVHA 3G6XA 2AU0A 2W9MA 2MAXA 3KHRA 4QWEA 1XWLA 4EYIB 5EOZA 1NK7A 3KHHA 4RQ3A 4QZ9A 2Y1JA 1S10A 8ICGA 4DOBA 2JEGA 9ICTA 2JEJA 1TK5A 4BXOB 4I2EA 1BPEA 2DFLA 3EYZA 1S0MA 5J2KA 4M6WA 8ICHA 2R8GA 3MR2A 4DSFA 1BVSA 4PH5A 4UBBA 4ECUA 2VA3A 4O5CA 4MEYA 4I2CA 3Q8MA 5KG6A 4F5QA 4J9QA 2PFQA 4DF8A 1Z00A 4XA5A 5L1JA 4KLUA 3IHQB 4Q45A 5KFJA 3C5FA 5DLFA 1T7PA 4B9LA 3E2EA 3C2LA 3RH6A 4LZGA 1NK0A 3GV8B 7ICKA 7ICSA 4F4WA 2KTQA 8ICVA 5D4BA 2ZUCA 3MBYA 3C1ZA 1N48A 4Q43A 2W8KA 2HHQA 5KFPA 8ICUA 2BPFA 5BPCA 3GFKB 3RTVA 4RQ5A 3KTQA 3ZDCA 7ICHA 4EBEA 2A1JA 4IRKA 4MFFA 5KFUA 4GC7A 5L1LA 2ZUBA 4J9PA 4I28A 4KN7A 1KRPA 4UAZA 4RNNA 3H4DA 4ECZA 9ICPA 3LDAA 1U48A 5CHGA 4RPYA 3MR6A 4O3QA 4UB3A 2DPIA 1HUZA 2MUTA 4YR2A 4J9MA 4YVZA 3V7JA 2HHXA 1JXEA 2VANA 4RUCA 2BPCA 8ICKA 2PI4A 1SZPA 3ISDA 4GXJA 2XY6A 3PW4A 5KFOA 3RJHA 2UVUA 4QZGA 1S0VA 8ICMA 2BCRA 3RR7A 2H5XA 3LWLA 5KG4A 1KFTA 5CP2A 3TI0A 3Q8LA 3BQ1A 4F50A 3PW0A 1NKBA 4NLNA 1Z3EB 1RYRA 3RJKA 5CJ7A 3OSPA 3V6HA 3H7IA 5F9NA 2IHNA 8ICNA 1QTMA 4F5NA 5HMLA 2ZUDA 4RQ2A 4QZHA 2JZBB 2ZTCA 1H38A 5KFWA 3BDPA 1X2IA 4Z6FA 5DQGA 3T5KA 5KFQA 1T4GA 4ED3A 2W9AA 8ICEA 1K1SA 1LV5A 8ICQA 4KTQA 2BCUA 3ZD9A 4ECRA 2R8KA 1XU4A 1UT8A 2V9WA 5DB9A 2ATLA 1TVAA 2ASLA 4B9SA 4DSKA 4KLFA 4FBUA 4HYKA 1ZQBA 4DF4A 3AU2A 4YR0A 2J6UA 3Q8KA 2HHVA 4FO6A 2NRTA 4NM2A 4P4PA 3RJIA 4ED6A 1NJYA 4QWDA 9ICHA 4I29A 1TK8A 1B43A 1UA1A 4B9TA 4M47A 7ICFA 5KFYA 4Q8EA 4F4XA 1MC8A 4K4IA 1D9DA 4R8UB 4I2BA 5DKWA 3PMNA 5IIKA 5KFBA 3ZDAA 5KG5A 5KFFA 2ZJAA 1ZQHA 1BPXA 3FDSA 1SKSA 2XY5A 2UVWA 4C8NA 4QZDA 1RYSA 3GDXA 2FLNA 2BDPA 9ICKA 2XGPA 8ICJA 3FYHA 4DOCA 1ZQSA 2PXIA 3RH4A 1JX4A 7ICTA 7ICOA 2DPJA 3PY8A 4X5VA 3RJJA 4FBTA 9ICAA 8ICAA 2AQ0A 2P6RA 4JWNA 4EBCA 4RNOA 4EBDA 1KLNA 5KFHA 8ICIA 4J9LA 3EW9A 2J6TA 4R8UA 4BGDA 4QWAA 3ISBA 3JPTA 4YFKA 4RT3A 1D8LA 4J9KA 3RB0A 5KFIA 4RZRA 5TZVA 4DQSA 3ORYA 1ZQQA 1MSWD 4XRHA 4RU9A 2NRVA 1ZQOA 2J6SA 3IM1A 4QWBA 4C8OA 4KLGA 5J2BA 4MFAA 5IIJA 3QEAZ 9ICSA 1EXNA 1XC9A 4P4MA 3T5LA 5J2EA 2HHWA 5DGBA 1ZETA 3PMLA 3GIJA 3K4GA 3SV3A 4F2SA 4KLSA 4QZBA 1ZQLA 9ICJA 4MFCA 5KG2A 5J2FA 2BQRA 1ZQMA 4F4KA 3KHLA 5DGAA 1NK5A 2IBKA 3RB4A 4IR9A 3MDCA 4O3RA 9ICXA 1QSLA 5KG1A 4NLGA 4DOAA 2I1QA 3G6YA 5KFZA 2HVIA 4RQ6A 3RB3A 3JPPA 4I2DA 2MUTB 1S0NA 4O5KA 4K4HA 4F5PA 7ICQA 5KTQA 1NKEA 8ICBA 2R8IA 4QZEA 2F1JA 4MF8A 3THVA 5KT6A 4YMNA 9ICUA 5J0WA 4Z6CA 2ISOA 2R8HA 3N97B 4CCHA 5J29A 4ELVA 9ICGA 2ZJ8A 4RUAA 3UPQA 3UQ0A 4I2IA 4JK1A 4XUSA 1L3SA 1WCNA 2FLPA 5IIIA 2W8LA 4I2JA 3PX0A 4RQ7A 3T5HA 2AQ4A 1ZQAA 5L1IA 5KFNA 3N4MB 4UB2A 1BPDA 1ZQKA 4KLDA 3K75D 5KT2A 3Q8SB 4KITB 4DWIA 9ICEA 1DGSA 4BWJA 4RQ4A 4IQWA 3RB6A 1ZQDA 1ZQTA 7ICIA 4EYHB 3BJYA 3ZD8A 1HUOA 2BGWA 9ICOA 8ICFA 4ECSA 4DFPA 4YP3A 3JPNA 5J2HA 4DQRA 3LK9A 1K1QA 1JN3A 1KFDA 1WCLA 4RQ1A 4UAWA 4QW9A 5HHIA 4IQVA 8ICZA 4QW8A 3H40A 2PFPA 2KZ3A 2B21A 3H8SA 3HPOA 9ICIA 1MQ2A 1ZQVA 2KZMA 4ECYA 4QZIA 3QEBZ 1ZQPA 1COOA 2KN7A 2NRZA 2XCAA 3RBEA 4PHDA 1A77A 5J2JA 3BQTA 5J2GA 4YN4A 2AGQA 2BQ3A 1TV9A 3PW7A 1NJWA 4IQTA 3RR8A 2IMWP 4B9UA 3PVXA 1CEZA 3UXPA 1ZQGA 4M2YA 4M0AA 1X9WA 3JPQA 4KLHA 1IM4A 5KFSA 4F93B 4DL2A 7ICJA 4JV1A 5HP4A 4IQUA 2IA6A 3Q8QB 4YMMA 5BOLA 4O0IA 3JPSA 3BQ0A 4DL7A 3UXNA 5J0YA 1D9FA 5EWFA 4JV0A 4FS1A 8ICPA 2V4QA 4IR1A 4GXKA 3PNCA 1ZYQA 4DL4A 1XSLA 4UBCA 3SI8A 3TQ1A 2P6UA 3RAQA 1QSSA 5KFLA 3C2MA 1UT5A 4DS4A 3TARA 3NGDA 1A76A 2HW3A 4QZ8A 1JXLA 2BCQA 1V9PA 3B0XA 3GILA 1Z00B 4ECVA 3RAXA 2C28A 4PPXA 8ICTA 3BQ2A 3UQ2A 4R63A 4RPXA 2C2RA 3OGUA 4ED0A 3MABA 4M6WB 3TFSA 2BQUA 4KLTA 4ECWA 2F1HA 4YR3A 3PO5A 4G3IA 2XGQA 3T3FA 1SL1A 2FPLA 2XCPA 3H8WA 5DB6A 4I2HA 2BPGA 1ZQUA 3V7LA 1U47A 1S9FA 3LWMA 4ECTA 1NKCA 1ZQRA 1S0OA 1KEJA 5L9XA 1RXVA 1ZJNA 3HX0A 1JIHA 5KT5A 5KG3A 4PGYA 5DBAA 4ECXA 5HMMA 3ZDBA 4MF2A 2F1IA 5KT7A 4DQPA 1B22A 4O3SA 4O9MA 4XQ8A 3M9MB 4J9RA 4PHEA 2FMPA 4TQRA 4DFKA 5CA7A 1NJXA 4MEXA 4I2FA 3SYZA 3PV8A 4R65A 4Q44A 3H8JA 1TK0A 3HT3A 3NTUA 4K4GA 1TFRA 2FPKA 1ZQNA 4KN4A 1T8EA 2KFNA 5KFTA 4PGXA 4DSEA 7ICEA 9ICRA 4TUSA 1LB2B 1BPZA 3G6VA 3RJFA 4ED1A 4UAYA 1L5UA 2PFOA 2OWOA 4RT2A 5KFMA 4QZAA 3OSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAU A;  4YXM A;  5KFX A;  4Z6D A;  3OJU A;  3MGI A;  4DQQ A;  4IRD A;  3C21 A;  2A1J B;  3HWT A;  4PHA A;  4DSL A;  9ICQ A;  4TUQ A;  3RBD A;  4QZC A;  5DG7 A;  2NRX A;  9ICC A;  2FLL A;  3UXO A;  4RQ8 A;  3RRG A;  4LZD A;  3GIM A;  8ICW A;  1XSN A;  5J0P A;  1ZJM A;  5DG9 A;  2ISP A;  1L3T A;  4TQS A;  4UB1 A;  3ZDD A;  2W9B B;  3TAQ A;  4TUP A;  1KFS A;  2FPM A;  5J0R A;  3EWA A;  3GV7 B;  1ARO P;  4DSJ A;  7ICR A;  4KMU A;  2JZB A;  2FMQ A;  5F9L A;  2ZJ5 A;  3C5G A;  3SZ2 A;  4F3O A;  4C8M A;  1X9S A;  5C5J A;  4PGQ A;  3M9N B;  4I27 A;  2V4R A;  2I9G A;  1KTQ A;  2BHN A;  4EEY A;  4KLM A;  1ZQW A;  8ICL A;  4EZ6 A;  4LVS A;  1JMS A;  1ZQZ A;  1SL0 A;  4KLQ A;  5KG0 A;  4DEZ A;  5J2D A;  4J9O A;  2C2E A;  3TFR A;  5HHH A;  3ETL A;  5DQI A;  2JEF A;  4M9J A;  5KFV A;  3EPG A;  1ZQC A;  5DB7 A;  2BKE A;  4JUZ A;  7ICM A;  2BCV A;  5CR0 A;  4QWC A;  3OHB A;  3SV4 A;  4YG2 A;  3ZDE A;  5L1K A;  4I2G A;  9ICM A;  5J2A A;  5CB1 A;  1NK6 A;  2Y1I A;  3RJE A;  5HNK A;  1XO1 A;  4GLX A;  1D8Y A;  4F92 B;  1QSY A;  1S76 D;  4F4Y A;  4KLI A;  4DFM A;  4NY8 A;  5KFC A;  3MFH A;  2HHU A;  5DB8 A;  5KFR A;  4E0D A;  4ED7 A;  4M9H A;  9ICF A;  5KG7 A;  1RZT A;  8ICX A;  5J0Q A;  4UB4 A;  2ASJ A;  2PFN A;  5JUM A;  1NJZ A;  1RPL A;  4TUR A;  4FS2 A;  5KFD A;  8ICO A;  5J0U A;  3T5J A;  5EWE A;  5J0T A;  5IIL A;  1ZQJ A;  4DQI A;  2ALZ A;  4KLO A;  4F8R A;  1U4B A;  2XY7 A;  5IIM A;  1U9L A;  3B0Y A;  3RRH A;  9ICL A;  4B9N A;  8ICY A;  7ICP A;  4ED2 A;  4RPZ A;  2ZTD A;  5KFG A;  4C8L A;  5KFE A;  1PZN A;  4O5E A;  5D46 A;  4GC6 A;  4JWM A;  8ICS A;  3GV5 B;  2VA8 A;  4DL5 A;  9ICV A;  4ELT A;  4R64 A;  2AGO A;  4KLE A;  3Q8P B;  1TAQ A;  4O3N A;  4NLK A;  4J9S A;  2JEI A;  3C23 A;  5J0O A;  1KSP A;  1L3U A;  4PHP A;  2BCS A;  4M9G A;  3OHA A;  3ISC A;  1MQ3 A;  2C2D A;  1N56 A;  2UVR A;  5KT3 A;  2RDJ A;  5CWR A;  3QE9 Y;  2HHS A;  2XO7 A;  4DSI A;  1DOQ A;  5EWG A;  2W9B A;  1ZQY A;  2UVV A;  3MGH A;  1ZQI A;  2PI5 A;  7ICN A;  3C2K A;  4YCX A;  1IXR A;  4F5O A;  3PW2 A;  2C22 A;  1ZQX A;  7ICG A;  1NOM A;  4RNM A;  4YMO A;  7ICL A;  4KLL A;  4YD1 A;  5KT4 A;  1XS9 D;  1ZQE A;  4B9M A;  4ZH4 A;  5DDM A;  5IIN A;  3PO4 A;  3RJG A;  2P66 A;  1T3N A;  4ECQ A;  3M9O B;  3GIK A;  5BOM A;  8ICC A;  4O3O A;  1CUK A;  1NK4 A;  5J0S A;  2M9N A;  4YXJ A;  4RQ0 A;  4DL3 A;  2NRW A;  9ICB A;  1UA0 A;  4I2A A;  4NM1 A;  4J9N A;  3MDA A;  2ZTE A;  5D49 A;  3GQC A;  1SL2 A;  4IRC A;  2IHM A;  4Q8F A;  3MR5 A;  3TAP A;  1L3V A;  5KFA A;  4P2H A;  2AJQ A;  4YQW A;  5DBC A;  4UB5 A;  1QLN A;  2XC9 A;  1C7Y A;  4F91 B;  4BDP A;  2GWS A;  3EZ5 A;  3HP6 A;  3M8S A;  1XSP A;  5DLG A;  3AU6 A;  3MFI A;  3QZ7 A;  3JPR A;  2KZZ A;  3OJS A;  3V72 A;  2Q0Z X;  4O3P A;  1X9M A;  4EZ9 A;  4BWM A;  4F5R A;  1SKR A;  1NK8 A;  1ZQF A;  4ELU A;  2AGP A;  2R8J A;  7ICU A;  2RDI A;  1BGX T;  7ICV A;  4C8K A;  4YD2 A;  4R66 A;  3AUO A;  1S77 D;  1TKD A;  3V6J A;  4ED8 A;  1SKW A;  4F2R A;  4DLE A;  3PX6 A;  5DQH A;  5DG8 A;  4JV2 A;  5J0X A;  4DL6 A;  2W9C B;  2FMS A;  8ICR A;  4GXI A;  9ICN A;  5KFK A;  3JPO A;  2HHT A;  4DFJ A;  3PX4 A;  3TAN A;  4BXO A;  9ICW A;  4M9L A;  1HJP A;  3C1Y A;  1S97 A;  4Z6E A;  5DBB A;  3KHG A;  3EPI A;  4KLJ A;  4DLG A;  3PR4 A;  1U49 A;  1Y88 A;  4F4Z A;  4QZF A;  3QZ8 A;  4M04 A;  3PW5 A;  3GII A;  1BPY A;  5DDY A;  4NXZ A;  4DO9 A;  3RH5 A;  1BPB A;  4NLZ A;  1RXW A;  3M8R A;  1KDH A;  5J2I A;  3V6K A;  5IIO A;  3MR3 A;  2LYH A;  2BR0 A;  2ASD A;  3Q8R B;  3HW8 A;  2W9C A;  3V7K A;  4B9V A;  4M9N A;  4UQG A;  3PR5 B;  5J2C A;  4DS5 A;  1NK9 A;  1U45 A;  3H4B A;  2WTF A;  4P4O A;  2VA2 A;  2KFZ A;  2HVH A;  3G6X A;  2AU0 A;  2W9M A;  2MAX A;  3KHR A;  4QWE A;  1XWL A;  4EYI B;  5EOZ A;  1NK7 A;  3KHH A;  4RQ3 A;  4QZ9 A;  2Y1J A;  1S10 A;  8ICG A;  4DOB A;  2JEG A;  9ICT A;  2JEJ A;  1TK5 A;  4BXO B;  4I2E A;  1BPE A;  2DFL A;  3EYZ A;  1S0M A;  5J2K A;  4M6W A;  8ICH A;  2R8G A;  3MR2 A;  4DSF A;  1BVS A;  4PH5 A;  4UBB A;  4ECU A;  2VA3 A;  4O5C A;  4MEY A;  4I2C A;  3Q8M A;  5KG6 A;  4F5Q A;  4J9Q A;  2PFQ A;  4DF8 A;  1Z00 A;  4XA5 A;  5L1J A;  4KLU A;  3IHQ B;  4Q45 A;  5KFJ A;  3C5F A;  5DLF A;  1T7P A;  4B9L A;  3E2E A;  3C2L A;  3RH6 A;  4LZG A;  1NK0 A;  3GV8 B;  7ICK A;  7ICS A;  4F4W A;  2KTQ A;  8ICV A;  5D4B A;  2ZUC A;  3MBY A;  3C1Z A;  1N48 A;  4Q43 A;  2W8K A;  2HHQ A;  5KFP A;  8ICU A;  2BPF A;  5BPC A;  3GFK B;  3RTV A;  4RQ5 A;  3KTQ A;  3ZDC A;  7ICH A;  4EBE A;  2A1J A;  4IRK A;  4MFF A;  5KFU A;  4GC7 A;  5L1L A;  2ZUB A;  4J9P A;  4I28 A;  4KN7 A;  1KRP A;  4UAZ A;  4RNN A;  3H4D A;  4ECZ A;  9ICP A;  3LDA A;  1U48 A;  5CHG A;  4RPY A;  3MR6 A;  4O3Q A;  4UB3 A;  2DPI A;  1HUZ A;  2MUT A;  4YR2 A;  4J9M A;  4YVZ A;  3V7J A;  2HHX A;  1JXE A;  2VAN A;  4RUC A;  2BPC A;  8ICK A;  2PI4 A;  1SZP A;  3ISD A;  4GXJ A;  2XY6 A;  3PW4 A;  5KFO A;  3RJH A;  2UVU A;  4QZG A;  1S0V A;  8ICM A;  2BCR A;  3RR7 A;  2H5X A;  3LWL A;  5KG4 A;  1KFT A;  5CP2 A;  3TI0 A;  3Q8L A;  3BQ1 A;  4F50 A;  3PW0 A;  1NKB A;  4NLN A;  1Z3E B;  1RYR A;  3RJK A;  5CJ7 A;  3OSP A;  3V6H A;  3H7I A;  5F9N A;  2IHN A;  8ICN A;  1QTM A;  4F5N A;  5HML A;  2ZUD A;  4RQ2 A;  4QZH A;  2JZB B;  2ZTC A;  1H38 A;  5KFW A;  3BDP A;  1X2I A;  4Z6F A;  5DQG A;  3T5K A;  5KFQ A;  1T4G A;  4ED3 A;  2W9A A;  8ICE A;  1K1S A;  1LV5 A;  8ICQ A;  4KTQ A;  2BCU A;  3ZD9 A;  4ECR A;  2R8K A;  1XU4 A;  1UT8 A;  2V9W A;  5DB9 A;  2ATL A;  1TVA A;  2ASL A;  4B9S A;  4DSK A;  4KLF A;  4FBU A;  4HYK A;  1ZQB A;  4DF4 A;  3AU2 A;  4YR0 A;  2J6U A;  3Q8K A;  2HHV A;  4FO6 A;  2NRT A;  4NM2 A;  4P4P A;  3RJI A;  4ED6 A;  1NJY A;  4QWD A;  9ICH A;  4I29 A;  1TK8 A;  1B43 A;  1UA1 A;  4B9T A;  4M47 A;  7ICF A;  5KFY A;  4Q8E A;  4F4X A;  1MC8 A;  4K4I A;  1D9D A;  4R8U B;  4I2B A;  5DKW A;  3PMN A;  5IIK A;  5KFB A;  3ZDA A;  5KG5 A;  5KFF A;  2ZJA A;  1ZQH A;  1BPX A;  3FDS A;  1SKS A;  2XY5 A;  2UVW A;  4C8N A;  4QZD A;  1RYS A;  3GDX A;  2FLN A;  2BDP A;  9ICK A;  2XGP A;  8ICJ A;  3FYH A;  4DOC A;  1ZQS A;  2PXI A;  3RH4 A;  1JX4 A;  7ICT A;  7ICO A;  2DPJ A;  3PY8 A;  4X5V A;  3RJJ A;  4FBT A;  9ICA A;  8ICA A;  2AQ0 A;  2P6R A;  4JWN A;  4EBC A;  4RNO A;  4EBD A;  1KLN A;  5KFH A;  8ICI A;  4J9L A;  3EW9 A;  2J6T A;  4R8U A;  4BGD A;  4QWA A;  3ISB A;  3JPT A;  4YFK A;  4RT3 A;  1D8L A;  4J9K A;  3RB0 A;  5KFI A;  4RZR A;  5TZV A;  4DQS A;  3ORY A;  1ZQQ A;  1MSW D;  4XRH A;  4RU9 A;  2NRV A;  1ZQO A;  2J6S A;  3IM1 A;  4QWB A;  4C8O A;  4KLG A;  5J2B A;  4MFA A;  5IIJ A;  3QEA Z;  9ICS A;  1EXN A;  1XC9 A;  4P4M A;  3T5L A;  5J2E A;  2HHW A;  5DGB A;  1ZET A;  3PML A;  3GIJ A;  3K4G A;  3SV3 A;  4F2S A;  4KLS A;  4QZB A;  1ZQL A;  9ICJ A;  4MFC A;  5KG2 A;  5J2F A;  2BQR A;  1ZQM A;  4F4K A;  3KHL A;  5DGA A;  1NK5 A;  2IBK A;  3RB4 A;  4IR9 A;  3MDC A;  4O3R A;  9ICX A;  1QSL A;  5KG1 A;  4NLG A;  4DOA A;  2I1Q A;  3G6Y A;  5KFZ A;  2HVI A;  4RQ6 A;  3RB3 A;  3JPP A;  4I2D A;  2MUT B;  1S0N A;  4O5K A;  4K4H A;  4F5P A;  7ICQ A;  5KTQ A;  1NKE A;  8ICB A;  2R8I A;  4QZE A;  2F1J A;  4MF8 A;  3THV A;  5KT6 A;  4YMN A;  9ICU A;  5J0W A;  4Z6C A;  2ISO A;  2R8H A;  3N97 B;  4CCH A;  5J29 A;  4ELV A;  9ICG A;  2ZJ8 A;  4RUA A;  3UPQ A;  3UQ0 A;  4I2I A;  4JK1 A;  4XUS A;  1L3S A;  1WCN A;  2FLP A;  5III A;  2W8L A;  4I2J A;  3PX0 A;  4RQ7 A;  3T5H A;  2AQ4 A;  1ZQA A;  5L1I A;  5KFN A;  3N4M B;  4UB2 A;  1BPD A;  1ZQK A;  4KLD A;  3K75 D;  5KT2 A;  3Q8S B;  4KIT B;  4DWI A;  9ICE A;  1DGS A;  4BWJ A;  4RQ4 A;  4IQW A;  3RB6 A;  1ZQD A;  1ZQT A;  7ICI A;  4EYH B;  3BJY A;  3ZD8 A;  1HUO A;  2BGW A;  9ICO A;  8ICF A;  4ECS A;  4DFP A;  4YP3 A;  3JPN A;  5J2H A;  4DQR A;  3LK9 A;  1K1Q A;  1JN3 A;  1KFD A;  1WCL A;  4RQ1 A;  4UAW A;  4QW9 A;  5HHI A;  4IQV A;  8ICZ A;  4QW8 A;  3H40 A;  2PFP A;  2KZ3 A;  2B21 A;  3H8S A;  3HPO A;  9ICI A;  1MQ2 A;  1ZQV A;  2KZM A;  4ECY A;  4QZI A;  3QEB Z;  1ZQP A;  1COO A;  2KN7 A;  2NRZ A;  2XCA A;  3RBE A;  4PHD A;  1A77 A;  5J2J A;  3BQT A;  5J2G A;  4YN4 A;  2AGQ A;  2BQ3 A;  1TV9 A;  3PW7 A;  1NJW A;  4IQT A;  3RR8 A;  2IMW P;  4B9U A;  3PVX A;  1CEZ A;  3UXP A;  1ZQG A;  4M2Y A;  4M0A A;  1X9W A;  3JPQ A;  4KLH A;  1IM4 A;  5KFS A;  4F93 B;  4DL2 A;  7ICJ A;  4JV1 A;  5HP4 A;  4IQU A;  2IA6 A;  3Q8Q B;  4YMM A;  5BOL A;  4O0I A;  3JPS A;  3BQ0 A;  4DL7 A;  3UXN A;  5J0Y A;  1D9F A;  5EWF A;  4JV0 A;  4FS1 A;  8ICP A;  2V4Q A;  4IR1 A;  4GXK A;  3PNC A;  1ZYQ A;  4DL4 A;  1XSL A;  4UBC A;  3SI8 A;  3TQ1 A;  2P6U A;  3RAQ A;  1QSS A;  5KFL A;  3C2M A;  1UT5 A;  4DS4 A;  3TAR A;  3NGD A;  1A76 A;  2HW3 A;  4QZ8 A;  1JXL A;  2BCQ A;  1V9P A;  3B0X A;  3GIL A;  1Z00 B;  4ECV A;  3RAX A;  2C28 A;  4PPX A;  8ICT A;  3BQ2 A;  3UQ2 A;  4R63 A;  4RPX A;  2C2R A;  3OGU A;  4ED0 A;  3MAB A;  4M6W B;  3TFS A;  2BQU A;  4KLT A;  4ECW A;  2F1H A;  4YR3 A;  3PO5 A;  4G3I A;  2XGQ A;  3T3F A;  1SL1 A;  2FPL A;  2XCP A;  3H8W A;  5DB6 A;  4I2H A;  2BPG A;  1ZQU A;  3V7L A;  1U47 A;  1S9F A;  3LWM A;  4ECT A;  1NKC A;  1ZQR A;  1S0O A;  1KEJ A;  5L9X A;  1RXV A;  1ZJN A;  3HX0 A;  1JIH A;  5KT5 A;  5KG3 A;  4PGY A;  5DBA A;  4ECX A;  5HMM A;  3ZDB A;  4MF2 A;  2F1I A;  5KT7 A;  4DQP A;  1B22 A;  4O3S A;  4O9M A;  4XQ8 A;  3M9M B;  4J9R A;  4PHE A;  2FMP A;  4TQR A;  4DFK A;  5CA7 A;  1NJX A;  4MEX A;  4I2F A;  3SYZ A;  3PV8 A;  4R65 A;  4Q44 A;  3H8J A;  1TK0 A;  3HT3 A;  3NTU A;  4K4G A;  1TFR A;  2FPK A;  1ZQN A;  4KN4 A;  1T8E A;  2KFN A;  5KFT A;  4PGX A;  4DSE A;  7ICE A;  9ICR A;  4TUS A;  1LB2 B;  1BPZ A;  3G6V A;  3RJF A;  4ED1 A;  4UAY A;  1L5U A;  2PFO A;  2OWO A;  4RT2 A;  5KFM A;  4QZA A;  3OSN A; 
#chains in the Genus database with same CATH topology
 1TAU A;  3TAC B;  4Z6D A;  3MGI A;  1WUD A;  2K8A A;  3HWT A;  4PHA A;  2VKQ A;  3FC4 A;  5DG7 A;  5AKI A;  3UXO A;  4USA A;  8ICW A;  1XSN A;  1L3T A;  4UB1 A;  3H0M B;  4TUP A;  5J0R A;  4F72 A;  4DSJ A;  5ALH A;  1X9S A;  4Y2V A;  1KTQ A;  1Q46 A;  3FM9 A;  1SL0 A;  4KLQ A;  5KG0 A;  5HHH A;  2JHD A;  5KFV A;  4JUZ A;  1PVR A;  2W3R A;  1Z19 A;  5J2A A;  4Y2S A;  3PZP A;  5EE9 A;  2LBO A;  3RJE A;  1LKY A;  5HNK A;  2D8C A;  2H3I A;  1YZ7 A;  1S76 D;  4F4Y A;  2O6K A;  5DB8 A;  4E0D A;  5KG7 A;  8ICX A;  2Y0S F;  5J0Q A;  2MSN A;  1FO4 A;  1NJZ A;  8ICO A;  5EWE A;  1SV0 C;  1SWV A;  3RRH A;  8ICY A;  4ED2 A;  4C8L A;  5KFE A;  5D46 A;  4JWM A;  5AM2 A;  2VIX A;  4UB6 U;  3K1Z A;  4ELT A;  1TAQ A;  2DKX A;  4J9S A;  2JEI A;  5J0O A;  3OHA A;  2UVR A;  1PK1 A;  2WF9 A;  5ALU A;  3GZF A;  2RDJ A;  3QE9 Y;  5AI4 A;  2HHS A;  2XO7 A;  1ZQI A;  2PI5 A;  1B0X A;  5AI8 A;  2PMZ F;  4YCX A;  1IXR A;  4F5O A;  1ZQX A;  7ICG A;  1RDF A;  7ICL A;  4YD1 A;  5KT4 A;  3PSP A;  4ZH4 A;  5IIN A;  3RJG A;  3H8M A;  5BOM A;  1CUK A;  2M9N A;  4RQ0 A;  9ICB A;  1WG8 A;  5ALF A;  4I2A A;  2ZTE A;  4PL2 A;  4Q8F A;  3MR5 A;  2G5I B;  2AJQ A;  2XC9 A;  3ICX A;  5F3X B;  1XSP A;  1ZD4 A;  3WK9 A;  4KX3 A;  1F44 A;  1NK8 A;  1ZQF A;  3I28 A;  1BGX T;  2G0A A;  4YD2 A;  4R66 A;  1S77 D;  1TKD A;  3M7D A;  4F2R A;  5DQH A;  2FMS A;  2XIC A;  1S97 A;  1U49 A;  2LMR A;  5AKK A;  4BUG A;  4QZF A;  1SV0 A;  4NJ8 A;  3GII A;  2OHF A;  3RH5 A;  1RXW A;  5J2I A;  2K4H A;  3SR6 A;  2B6G A;  2EH9 A;  2WTF A;  4PZN A;  2HDO A;  3G6X A;  2W9M A;  8ICG A;  1PK3 A;  1NK7 A;  3IN5 A;  9ICT A;  2E8M A;  1TK5 A;  3EYZ A;  3DDH A;  4M6W A;  4UBB A;  5KNI A;  4MEY A;  5KG6 A;  4J9Q A;  1Z00 A;  3IHQ B;  1T7P A;  4B9L A;  2PMZ C;  3WK4 A;  2A3V A;  1K5O A;  2ZUC A;  2ZIV B;  3DEE A;  4RQ5 A;  3ZDC A;  7ICH A;  2A1J A;  4MFF A;  5KFU A;  2ZUB A;  4UAU A;  3LDA A;  4UB3 A;  2DPI A;  4J9M A;  4CNQ A;  3V7J A;  1ZD5 A;  1SZP A;  4GXJ A;  5KFO A;  3RJH A;  4QZG A;  2H3Z A;  2H5X A;  2K8C B;  3LWL A;  2MU2 A;  5CP2 A;  2NYV A;  4NLN A;  3RF9 A;  1RYR A;  1T3Q A;  5CJ7 A;  4RQM A;  2W04 A;  2ZUD A;  4QZH A;  1PVQ A;  3F53 A;  2Y0S C;  1MN8 A;  3T5K A;  3KZX A;  5AI9 A;  5KFQ A;  2W9A A;  1K1S A;  5AM1 A;  2HBK A;  5DB9 A;  4FBU A;  4U7C A;  3I76 A;  2J6U A;  3HIL A;  5ALO A;  4P4P A;  1V38 A;  3RJI A;  4ED6 A;  1NJY A;  1N5X A;  3D2S A;  4IS7 A;  4M47 A;  1MC8 A;  4K4I A;  4I2B A;  5DKW A;  2YMQ A;  2ZJA A;  5ALR A;  3FDS A;  2CPR A;  5AI6 A;  1X6J A;  4C8N A;  3ETR A;  3QU4 A;  2PXI A;  7ICO A;  4DFD A;  3RJJ A;  1O08 A;  2AQ0 A;  3OPX A;  2P6R A;  4EBC A;  4EBD A;  1KLN A;  3EW9 A;  2J6T A;  4R8U A;  3ISB A;  4J9K A;  1D8L A;  5TZV A;  3ORY A;  4JB3 A;  4XRH A;  1ECW A;  2A1A A;  4KLG A;  2H3F A;  5IIJ A;  3BQ7 A;  4OJO A;  4P4M A;  2L5Y A;  2HHW A;  3PML A;  3GIJ A;  3SV3 A;  3AN1 A;  4KLS A;  4QZB A;  1ZQL A;  4MFC A;  5AI0 A;  5KG2 A;  1ZQM A;  4F4K A;  1NK5 A;  2D6F C;  1J2N A;  4U6P A;  5KG1 A;  2ZG6 A;  2HVI A;  3JPP A;  4I2D A;  4C4S A;  2GH1 A;  8ICB A;  2IOH A;  2F1J A;  2LM4 A;  4Z6C A;  3HKZ F;  2F77 X;  4ELV A;  3UPQ A;  4I2I A;  1L3S A;  1WCN A;  2W8L A;  3PX0 A;  2HOF A;  4RQ7 A;  1BPD A;  2JMG A;  2YB4 A;  1ZQK A;  3Q8S B;  9ICE A;  3RB6 A;  1ZQT A;  2W3S A;  8ICF A;  2DL0 A;  1COK A;  1KFD A;  4RQ1 A;  5FP0 A;  8ICZ A;  4QW8 A;  3H8S A;  3KBB A;  1MQ2 A;  1BNO A;  4Y2U A;  3RBE A;  4NY8 A;  5J2J A;  1TV9 A;  4YN4 A;  2BQ3 A;  3PW7 A;  4IQT A;  5ALY A;  3PVX A;  1JAL A;  2HOQ A;  1X9W A;  4M2Y A;  4JV1 A;  2Z7J A;  5ALN A;  3BQ0 A;  2KEY A;  2KV2 A;  4IR1 A;  4C0Z A;  3PNC A;  1S8O A;  4UBC A;  1RG6 A;  3SI8 A;  2P6U A;  3C2M A;  3TAR A;  3QUB A;  2F76 X;  2BCQ A;  3QNM A;  2DF4 B;  2C28 A;  1N60 A;  2HI0 A;  4R63 A;  4RPX A;  3TFS A;  3B9J A;  5AKX A;  4ECW A;  2F1H A;  3PO5 A;  3H0R B;  3T3F A;  2XCP A;  3H8W A;  3IDW A;  2BZF A;  1S9F A;  3LWM A;  2WAQ C;  1NKC A;  2FJ6 A;  3HX0 A;  1NZP A;  2CN1 A;  2YQE A;  4PGY A;  4MF2 A;  2F1I A;  1JUD A;  5GTH U;  4O3S A;  3M9M B;  4J9R A;  1NJX A;  4DCC A;  4I2F A;  2KKV A;  3NTU A;  3SAH A;  4K4G A;  4KN4 A;  1T8E A;  1N62 A;  7ICE A;  4TUS A;  1BPZ A;  3VCB A;  3RJF A;  2ZIW A;  1Z4O A;  4UAY A;  2OWO A;  2A1J B;  9ICQ A;  2NRX A;  2FLL A;  3KKA A;  2F2A B;  5J0P A;  5DG9 A;  1QQ6 A;  3ZDD A;  1V97 A;  1PVP A;  1CRX A;  2FPM A;  3GV7 B;  1ARO P;  2BDU A;  1M6Y A;  2JZB A;  2XI9 A;  4KMU A;  3SZ2 A;  4F3O A;  4C8M A;  4EEY A;  5ALW A;  1ZQW A;  5C0Y A;  2DKZ A;  4J9O A;  3TFR A;  2F8L A;  4C4T A;  5DQI A;  4M9J A;  1TE2 A;  2BCV A;  5CR0 A;  3SEI A;  4I2G A;  3ZDE A;  5L1K A;  5CB1 A;  2Y1I A;  1XO1 A;  4GLX A;  1QSY A;  5KFC A;  2W55 A;  3F2C A;  1LVH A;  3SAG A;  5AM3 A;  4CE6 A;  2A19 A;  4FS2 A;  3T5J A;  2XY7 A;  4RQN A;  1B4F A;  2CRX A;  2YMP A;  7ICP A;  4RPZ A;  2XVT A;  5J8Y A;  4GC6 A;  3F5A A;  1A6S A;  4KLE A;  2AGO A;  1XO0 A;  1KSP A;  1HEK A;  2BCS A;  3ISC A;  2C2D A;  3L5K A;  3PSF A;  5CWR A;  1MA7 A;  1DXS A;  5EWG A;  1L7O A;  2UVV A;  1DGJ A;  3DV9 A;  4RNM A;  3C28 A;  4KLL A;  1JRP A;  3N28 A;  4CDG A;  4B9M A;  5AIC A;  2P66 A;  1T3N A;  2B0C A;  4ECQ A;  3WKC A;  3GIK A;  5E79 U;  1UA0 A;  2Y9T A;  4NWI A;  5KFA A;  1QLN A;  5AK3 A;  1C7Y A;  4F91 B;  4BDP A;  2GWS A;  2GOL A;  5DLG A;  3AU6 A;  1YT3 A;  3OJS A;  2G06 A;  2Q0Z X;  4O3P A;  3WK5 A;  1X9M A;  4BWM A;  7ICU A;  2AGP A;  1Q3V A;  1X9X A;  7ICV A;  4C8K A;  4NV0 A;  4Y2R A;  4ED8 A;  3PX6 A;  4Y2T A;  2ZXH A;  5DG8 A;  4JV2 A;  4DL6 A;  9ICN A;  8ICR A;  4GXI A;  2HHT A;  3JPO A;  3PX4 A;  3TAN A;  4BXO A;  2HOI A;  4M9L A;  3C1Y A;  4Z6E A;  5DBB A;  3KHG A;  2HCF A;  4EX7 A;  3PR4 A;  1SXE A;  3QZ8 A;  1BPY A;  5DDY A;  2VJ5 A;  1L8L A;  4B6J A;  3M8R A;  2LYH A;  3Q8R B;  2W9C A;  3V7K A;  4M9N A;  4DS5 A;  1NK9 A;  2E8N A;  2KFZ A;  1ZOL A;  4QWE A;  3VC8 A;  3NRZ A;  3CW2 C;  4C7Y A;  4QZ9 A;  2KSO B;  2QAR A;  4I2E A;  4BXO B;  4NLC A;  1F0M A;  8ICH A;  2R8G A;  2YY6 A;  3BS7 A;  4ECU A;  4I2C A;  4F5Q A;  2PFQ A;  4DF8 A;  4XA5 A;  5L1J A;  3C5F A;  2W7P A;  3E2E A;  3A0H U;  3C2L A;  3RH6 A;  1V85 A;  4F4W A;  2K89 A;  2LHT A;  3MBY A;  5D4B A;  4Q43 A;  3WKA A;  5KFP A;  1ZD3 A;  4IRK A;  5L1L A;  2W11 A;  4WJ3 B;  3H4D A;  3E58 A;  2Q4T A;  2E3T A;  4YR2 A;  4YVZ A;  1JXE A;  2VAN A;  3NAS A;  3IG8 A;  2BCR A;  3F5E A;  3RR7 A;  5KG4 A;  1KFT A;  1WWU A;  1NKB A;  4F50 A;  3PW0 A;  1IG6 A;  3RJK A;  3OSP A;  8ICN A;  5F9N A;  2F3N A;  1N5W A;  5AIA A;  2I6X A;  2WHE A;  1H38 A;  4PZO A;  5AI5 A;  4OJL A;  4Z6F A;  2KD1 A;  3ZD9 A;  3ONN A;  4B9S A;  2N1R A;  2RRD A;  2HHV A;  2NRT A;  4NM2 A;  4QWD A;  3QYP A;  4AP9 A;  4I29 A;  5KFY A;  4UB8 U;  4Q8E A;  4F4X A;  5IIK A;  3ZDA A;  5KG5 A;  1RM6 C;  1BPX A;  1RYS A;  3GDX A;  2BDP A;  9ICK A;  3BS5 B;  3FYH A;  4DOC A;  3RH4 A;  4FBT A;  4P0Q B;  8ICA A;  4JWN A;  3EUB 2;  2KIV A;  5AKE A;  2ZXI A;  3JPT A;  4RT3 A;  2G07 A;  4Y2P A;  3KD3 A;  4RU9 A;  1ZXI A;  2JRZ A;  3M6K A;  4MFA A;  1EXN A;  2OM6 A;  2WF5 A;  3K4G A;  4F2S A;  3BS5 A;  2EAN A;  4EEN A;  5ALV A;  3S6J A;  2BQR A;  3UMG A;  3KHL A;  5DGA A;  3RB4 A;  4IR9 A;  1A0P A;  5ALP A;  3MDC A;  4O3R A;  1QSL A;  4DOA A;  2I1Q A;  2FE9 A;  2EZY A;  2MUT B;  1S0N A;  3K1R B;  5ALE A;  7ICQ A;  5KT6 A;  3H0L B;  4YMN A;  3NS1 A;  1CI4 A;  5J29 A;  2ZJ8 A;  5T14 A;  4OJP A;  2FLP A;  3T5H A;  2WB1 C;  1SIJ A;  5KFN A;  1Q8K A;  1OUQ A;  5KT2 A;  4DWI A;  1ZQD A;  1HUO A;  2BGW A;  4YP3 A;  1KQQ A;  2MRL A;  5HHI A;  2PFP A;  2ZIW B;  2B21 A;  1ZQV A;  4QZI A;  2EAO A;  3QEB Z;  2XCA A;  2EDU A;  5AKG A;  2QAR B;  1NJW A;  3BQT A;  3F2D A;  3SQI A;  1CEZ A;  3UXP A;  3AMZ A;  1ZRM A;  2RP5 A;  3PSI A;  3KZI U;  4DL7 A;  5AM4 A;  3UXN A;  5J0Y A;  1Q3U A;  2ZIX B;  5ALL A;  4JV0 A;  2HSZ A;  4GXK A;  2LYA A;  1ZYQ A;  4DL4 A;  1XSL A;  3RAQ A;  1O03 A;  1QSS A;  2YN4 A;  5KFL A;  1UT5 A;  3N7P D;  4DS4 A;  1KL9 A;  2KKP A;  8ICT A;  3RAX A;  2G5H B;  3UQ2 A;  3WKE A;  4M6W B;  4YR3 A;  2RQ5 A;  2HBJ A;  2E1F A;  3I1Y A;  5DB6 A;  3QUC A;  2P35 A;  1S0O A;  5L9X A;  1RXV A;  1JIH A;  5KT5 A;  5HMM A;  3SAF A;  4DQP A;  4XQ8 A;  4DFK A;  1ED1 A;  5CA7 A;  4MEX A;  2KK0 A;  1ZQN A;  2KHQ A;  2KFN A;  2YMM A;  9ICR A;  4QZA A;  5AKL A;  3OSN A;  2CXY A;  1RQN A;  3WU2 U;  3C21 A;  5KAI U;  4TUQ A;  3RBD A;  4QZC A;  4C7Z A;  1SB3 C;  4RQ8 A;  3RRG A;  1ZJM A;  3WK7 A;  2LM1 A;  3TAQ A;  2QKQ A;  3BZK A;  3EWA A;  2JH1 A;  2LI6 A;  5F9L A;  3C5G A;  4PGQ A;  3M9N B;  5L1M A;  2I9G A;  3FAH A;  4Y2J A;  8ICL A;  4EZ6 A;  1JMS A;  3IG5 A;  5ALK A;  1ZQZ A;  4DEZ A;  5J2D A;  2C2E A;  2JEF A;  2K4E A;  3EPG A;  1ZQC A;  2ZIU B;  5DB7 A;  4FZL A;  7ICM A;  3OHB A;  5ALQ A;  9ICM A;  1S5L U;  2NV3 A;  2E1E A;  3SEN A;  5JTI A;  5AKH A;  4F92 B;  4CGZ A;  4CF3 A;  4KLI A;  3MFH A;  2HHU A;  1SXD A;  1VLB A;  5KFR A;  4M9H A;  9ICF A;  1RZT A;  4UB4 A;  2ASJ A;  2PFN A;  2OXO A;  2OCE A;  4AYB C;  1RPL A;  5KFD A;  3D2Q A;  5J0U A;  1ZQJ A;  5ALI A;  5ALX A;  4DQI A;  2ALZ A;  4KLO A;  4F8R A;  5IIM A;  1U9L A;  1DRG A;  4B9N A;  1PZN A;  5AM5 A;  3SMV A;  3HJE A;  1C20 A;  2H3V A;  3Q8P B;  4O3N A;  4NLK A;  5GTI U;  2WF7 A;  4PHP A;  2LKY A;  4M9G A;  2AH5 A;  3D6J A;  1MQ3 A;  2W9B A;  3MGH A;  3MGV A;  7ICN A;  3C2K A;  2C22 A;  1Z1B A;  4PL1 A;  1NOM A;  2I5H A;  1N61 A;  1XS9 D;  1ZQE A;  3PO4 A;  1QQ5 A;  3M9O B;  4MHV A;  4O3O A;  4EEK A;  5J0S A;  2NRW A;  2OEH A;  3MC1 A;  4NM1 A;  1SL2 A;  3GQC A;  1X40 A;  1L3V A;  1KN5 A;  4P2H A;  4Y2Q A;  4UB5 A;  2LYB A;  4IC9 A;  1FFV A;  3HP6 A;  3M1Y A;  3D2N A;  3MFI A;  5AK5 A;  3JPR A;  1N2X A;  3V72 A;  4EZ9 A;  2F8K A;  2H3Q A;  4F5R A;  2R8J A;  4QIW C;  2HMX A;  3AUO A;  3V6J A;  1SKW A;  2KHV A;  5J0X A;  1L7M A;  4QIW F;  1L7P A;  5KFK A;  2AXT U;  4EEL A;  3RFA A;  5G5G A;  2F44 A;  4KLJ A;  1Y88 A;  4CRX A;  3PW5 A;  4FE3 A;  4DO9 A;  3KKA C;  1BPB A;  5AIB A;  3LVV A;  1KDH A;  3WKB A;  5EE1 A;  3V6K A;  5IIO A;  2ASD A;  5KL8 B;  5ALJ A;  3HW8 A;  3T79 A;  4UQG A;  3PR5 B;  3H4B A;  4P4O A;  2HVH A;  2AU0 A;  2MAX A;  2ZIX A;  1XWL A;  4EYI B;  2M0N A;  2Y1J A;  3A0B U;  1BPE A;  5J2K A;  4DSF A;  3MR2 A;  4KX5 A;  4KLU A;  4Q45 A;  5DLF A;  5CRX A;  2LPE A;  4LZG A;  7ICS A;  8ICV A;  2KOB A;  2HHQ A;  3GFK B;  3KTQ A;  3IRU A;  4EBE A;  3AM9 A;  4J9P A;  4I28 A;  4KN7 A;  1KRP A;  3TKA A;  9ICP A;  2G08 A;  5CHG A;  4RPY A;  3MR6 A;  1U48 A;  1FEZ A;  1HUZ A;  3CYM A;  4RUC A;  2BPC A;  2WF6 A;  8ICK A;  2PI4 A;  3TAD C;  3ISD A;  3PW4 A;  2XY6 A;  8ICM A;  3BQ1 A;  1Z3E B;  4AYB F;  5HML A;  3QU5 A;  2JZB B;  5KFW A;  1X2I A;  1T94 A;  3UMB A;  5A0L A;  1LV5 A;  2W7O A;  8ICQ A;  3AQE A;  2BCU A;  1BNP A;  1UT8 A;  2ATL A;  1TVA A;  2ASL A;  4KLF A;  4DF4 A;  3AU2 A;  3QU2 A;  4FFD A;  4FO6 A;  4OJ5 A;  3QXG A;  1TK8 A;  7ICF A;  5HR6 A;  2JXJ A;  3KFU F;  5JU5 A;  4R8U B;  3PMN A;  5KFB A;  3SD7 A;  4OO1 J;  2XY5 A;  2E8P A;  2UVW A;  4QZD A;  4CF5 A;  8ICJ A;  4FZN A;  7ICT A;  2DPJ A;  4X5V A;  8ICI A;  3M6Z A;  4IL6 U;  4J9L A;  4OCZ A;  1NNL A;  3N7R C;  4DQS A;  4RZR A;  1ZQQ A;  3NVY A;  1ZQO A;  2NRV A;  3GU3 A;  4QWB A;  1SWW A;  5AKZ A;  5ALG A;  5J2B A;  2EZZ A;  3QEA Z;  3T5L A;  5DGB A;  1ZET A;  4UAR A;  5EE3 A;  1LKY B;  3HRD D;  5J2F A;  4ACO A;  1SV4 A;  4NLG A;  4RQ6 A;  2W03 A;  4UAV A;  3QUQ A;  4F5P A;  2FDR A;  5KTQ A;  2R8I A;  4MF8 A;  3THV A;  1QH9 A;  4ICA A;  1SZH A;  5J0W A;  2ISO A;  2R8H A;  3N97 B;  4CCH A;  3CRX A;  2DWQ A;  4RUA A;  3UQ0 A;  4JK1 A;  1JI7 A;  5III A;  4I2J A;  1IV8 A;  3NRW A;  1ZQA A;  1NI3 A;  1TAM A;  4Y2Y A;  2ESE A;  2YTU A;  4KLD A;  4J03 A;  4IQW A;  9ICO A;  2QLT A;  3ZD8 A;  4ECS A;  4DFP A;  5ALM A;  3JPN A;  4DQR A;  1JN3 A;  1WCL A;  3HPO A;  9ICI A;  2EAP A;  4ECY A;  1COO A;  4PHD A;  1A77 A;  5J2G A;  4OD0 A;  3RR8 A;  5TIS U;  3JPQ A;  1IM4 A;  4F93 B;  7ICJ A;  5HP4 A;  4IQU A;  2IA6 A;  1RYU A;  5BOL A;  1D9F A;  5EWF A;  4FS1 A;  2V4Q A;  2EZX A;  2ODG A;  3TQ1 A;  3NGD A;  1A76 A;  2HW3 A;  4QZ8 A;  5AKJ A;  1JXL A;  3B0X A;  3GIL A;  1GO3 F;  2WB1 F;  4ED0 A;  3MAB A;  4C80 A;  2BQU A;  4US9 A;  4KLT A;  4UAS A;  4G3I A;  1KBU A;  2GO7 A;  4PJ0 U;  1L7N A;  2NO4 A;  1SL1 A;  1UPH A;  4I2H A;  2BPG A;  1ZQU A;  3V7L A;  1U47 A;  1L8O A;  4ECT A;  1KEJ A;  2GLE A;  3QU9 A;  1ZJN A;  3ALR A;  5DBA A;  5KT7 A;  1B22 A;  4O9M A;  5KAF U;  2FMP A;  4TQR A;  2MA1 A;  3SYZ A;  2WFA A;  2QB0 A;  3PV8 A;  2EQY A;  4R65 A;  1HIW A;  1TFR A;  2FPK A;  3CNH A;  5AK4 A;  1LB2 B;  3G6V A;  1J2M A;  1L5U A;  2PFO A;  2YML A;  2WF8 A;  4YXM A;  5KFX A;  3OJU A;  4DQQ A;  5B5E U;  4IRD A;  4DSL A;  1KW4 A;  9ICC A;  3LYS A;  4LZD A;  3GIM A;  3F2B A;  2ISP A;  2K4I A;  3QUT A;  4BX9 C;  5HR7 A;  2IOF K;  4TQS A;  2W9B B;  1QCK A;  2QB0 B;  1KFS A;  3WK8 A;  4ZOH C;  1QQ7 A;  7ICR A;  1F5S A;  2FMQ A;  2ZJ5 A;  3C29 A;  5C5J A;  5KL1 B;  4I27 A;  2V4R A;  2BHN A;  3U26 A;  4KLM A;  1ZRN A;  4LVS A;  1FIQ A;  3WK6 A;  2R18 A;  3ETL A;  2RHF A;  3TAD A;  4US8 A;  2BKE A;  2AHO B;  2OH2 A;  4QWC A;  3SV4 A;  4YG2 A;  3O0F A;  1NK6 A;  1P7D A;  3CP8 A;  2ZIV A;  1D8Y A;  4DFM A;  2DBY A;  4ED7 A;  1AQ6 A;  2YB1 A;  5JUM A;  4TUR A;  4F71 A;  5J0T A;  2HBM A;  5IIL A;  1U4B A;  3NVV A;  3B0Y A;  9ICL A;  2ZTD A;  4FZM A;  5KFG A;  4O5E A;  8ICS A;  3GV5 B;  2VA8 A;  4DL5 A;  9ICV A;  4R64 A;  2K8B B;  1JRO A;  5AHX A;  3C23 A;  1L3U A;  3IV6 A;  5ALD A;  1N56 A;  2HBL A;  5KT3 A;  4DSI A;  1DOQ A;  5AK6 A;  4QNL A;  1ZQY A;  4NLB A;  3L3F X;  3PW2 A;  1YZ6 A;  4YMO A;  1UQV A;  5DDM A;  3NUQ A;  2E8O A;  8ICC A;  1NK4 A;  2ES6 A;  2G09 A;  3LVW A;  4YXJ A;  4DL3 A;  3IP4 B;  2FI1 A;  1XNS A;  4J9N A;  3MDA A;  5D49 A;  4IRC A;  2IHM A;  3TAP A;  4YQW A;  5DBC A;  1ZD2 P;  3EZ5 A;  3M8S A;  2KIC A;  3QZ7 A;  2IOF A;  2KZZ A;  2KNJ A;  4NL9 C;  2KSO A;  1SKR A;  4ELU A;  2RDI A;  5G5H A;  5AKY A;  4DLE A;  2W9C B;  4DFJ A;  9ICW A;  1HJP A;  2KJ9 A;  3KOO A;  3EPI A;  4DLG A;  4F4Z A;  4M04 A;  2KVS A;  4NXZ A;  3R9K A;  4NLZ A;  1X42 A;  3MR3 A;  2BR0 A;  4B9V A;  2ZIU A;  1X6I A;  1DK3 A;  5J2C A;  1U45 A;  2VA2 A;  1X66 A;  3KHR A;  2KP7 A;  3J81 j;  5EOZ A;  3KHH A;  4RQ3 A;  1S10 A;  2E5S A;  4BJQ A;  4DOB A;  2JEG A;  1KKX A;  2Y9U A;  2JEJ A;  3ZI4 A;  2VJ4 A;  2DFL A;  1S0M A;  3NVZ A;  2VA3 A;  1BVS A;  4PH5 A;  4O5C A;  2YX8 A;  4G9B A;  3Q8M A;  3QU7 A;  1DK2 A;  5KFJ A;  1NK0 A;  3GV8 B;  7ICK A;  2KTQ A;  1N48 A;  3C1Z A;  2W8K A;  8ICU A;  2BPF A;  5BPC A;  3L4P A;  3RTV A;  4GC7 A;  4UAZ A;  4RNN A;  4ECZ A;  4P0P A;  4O3Q A;  2MUT A;  2HHX A;  2UVU A;  1S0V A;  2K60 A;  1ZQ1 C;  3TI0 A;  3Q8L A;  3V6H A;  3H7I A;  4NL9 A;  2IHN A;  1QTM A;  2W54 A;  4F5N A;  4RQ2 A;  2ZTC A;  3BDP A;  5DQG A;  4P0Q A;  4C4R A;  1T4G A;  4ED3 A;  8ICE A;  4KTQ A;  2KIW A;  4ECR A;  2R8K A;  3AL0 B;  1XU4 A;  2V9W A;  1WYG A;  4DSK A;  4HYK A;  1ZQB A;  1SGG A;  4YR0 A;  3Q8K A;  9ICH A;  1B43 A;  1UA1 A;  4B9T A;  4Y2X A;  1L6N A;  1Z1V A;  3UMC A;  5B66 U;  1D9D A;  3WKD A;  1UCV A;  1FFU A;  1ZQH A;  5KFF A;  1SKS A;  1J97 A;  2JV3 A;  2FLN A;  4QJF B;  2XGP A;  1ZQS A;  1PUZ A;  1JX4 A;  2DQN B;  3PY8 A;  9ICA A;  4UW9 A;  4KMO B;  1Z4N A;  4RNO A;  4HAI A;  5KFH A;  5CEH A;  4BGD A;  4QWA A;  4YFK A;  2JR5 A;  5ALT A;  5KFI A;  3RB0 A;  1MSW D;  5EE0 A;  3UM9 A;  2J6S A;  3BZC A;  3IM1 A;  4C8O A;  4OJ6 A;  9ICS A;  1XC9 A;  5AM0 A;  5J2E A;  5ALZ A;  9ICJ A;  4P0P B;  2IBK A;  9ICX A;  2QB1 A;  3G6Y A;  5KFZ A;  3RB3 A;  3NVW A;  1OW5 A;  4O5K A;  4K4H A;  1NKE A;  4QZE A;  9ICU A;  4O3M A;  2WAQ F;  2JGA A;  4XUS A;  2KJ5 A;  2AQ4 A;  2KJ8 A;  5L1I A;  3N4M B;  4UB2 A;  3K75 D;  4KIT B;  1DGS A;  4BWJ A;  4RQ4 A;  7ICI A;  4EYH B;  3BJY A;  1WWV A;  2RLT A;  1URJ A;  2DUY A;  5J2H A;  4UAT A;  1NZB A;  2EAM A;  3LK9 A;  1K1Q A;  1PK1 B;  4QW9 A;  4UAW A;  4IQV A;  3H40 A;  4A8E A;  2KZ3 A;  5K4L A;  2KZM A;  3N7S C;  2DGZ A;  3PST A;  1ZQP A;  2KN7 A;  2NRZ A;  2AGQ A;  2IMW P;  4B9U A;  2W43 A;  5J8Y C;  1ZQG A;  4KLH A;  4M0A A;  5KFS A;  4DL2 A;  1N63 A;  3Q8Q B;  4YMM A;  4O0I A;  4LJX A;  3JPS A;  2XID A;  8ICP A;  3AQF A;  1RQL A;  3AEV A;  2JH7 A;  2D3D A;  3OTQ A;  1V9P A;  4ECV A;  1Z00 B;  4JMU A;  4CF4 A;  4PPX A;  3BQ2 A;  2C2R A;  3OGU A;  3ED5 A;  5H2F U;  2OYY A;  3QX7 A;  4EX6 A;  1VJ5 A;  2XGQ A;  2FPL A;  1UHU A;  2KE7 A;  1VDV A;  3HKZ C;  1ZQR A;  1D8B A;  5KG3 A;  2KVC A;  4ECX A;  3ZDB A;  5ALS A;  2KG5 A;  4PHE A;  2K4P A;  2NO5 A;  1OXJ A;  4Q44 A;  1IIP A;  2PKE A;  3H8J A;  3HT3 A;  1TK0 A;  2KMD A;  5KFT A;  4PGX A;  4DSE A;  4GIB A;  4ED1 A;  4RT2 A;  3E0F A;  5JRT A;  5KFM A;  4GFJ A;  9ICG A; 
#chains in the Genus database with same CATH homology
 1TAU A;  4YXM A;  5KFX A;  4Z6D A;  3OJU A;  3MGI A;  4DQQ A;  4IRD A;  3C21 A;  2A1J B;  3HWT A;  4PHA A;  4DSL A;  9ICQ A;  4TUQ A;  3RBD A;  4QZC A;  5DG7 A;  2NRX A;  9ICC A;  2FLL A;  3UXO A;  4RQ8 A;  3RRG A;  4LZD A;  3GIM A;  8ICW A;  1XSN A;  5J0P A;  1ZJM A;  5DG9 A;  2ISP A;  1L3T A;  4TQS A;  4UB1 A;  3ZDD A;  2W9B B;  3TAQ A;  4TUP A;  1KFS A;  2FPM A;  5J0R A;  3EWA A;  3GV7 B;  1ARO P;  4DSJ A;  7ICR A;  4KMU A;  2JZB A;  2FMQ A;  5F9L A;  2ZJ5 A;  3C5G A;  3SZ2 A;  4F3O A;  4C8M A;  1X9S A;  5C5J A;  4PGQ A;  3M9N B;  4I27 A;  2V4R A;  2I9G A;  1KTQ A;  2BHN A;  4EEY A;  4KLM A;  1ZQW A;  8ICL A;  4EZ6 A;  4LVS A;  1JMS A;  1ZQZ A;  1SL0 A;  4KLQ A;  5KG0 A;  4DEZ A;  5J2D A;  4J9O A;  2C2E A;  3TFR A;  5HHH A;  3ETL A;  5DQI A;  2JEF A;  4M9J A;  5KFV A;  3EPG A;  1ZQC A;  5DB7 A;  2BKE A;  4JUZ A;  7ICM A;  2BCV A;  5CR0 A;  4QWC A;  3OHB A;  3SV4 A;  4YG2 A;  3ZDE A;  5L1K A;  4I2G A;  9ICM A;  5J2A A;  5CB1 A;  1NK6 A;  2Y1I A;  3RJE A;  5HNK A;  1XO1 A;  4GLX A;  1D8Y A;  4F92 B;  1QSY A;  1S76 D;  4F4Y A;  4KLI A;  4DFM A;  4NY8 A;  5KFC A;  3MFH A;  2HHU A;  5DB8 A;  5KFR A;  4E0D A;  4ED7 A;  4M9H A;  9ICF A;  5KG7 A;  1RZT A;  8ICX A;  5J0Q A;  4UB4 A;  2ASJ A;  2PFN A;  5JUM A;  1NJZ A;  1RPL A;  4TUR A;  4FS2 A;  5KFD A;  8ICO A;  5J0U A;  3T5J A;  5EWE A;  5J0T A;  5IIL A;  1ZQJ A;  4DQI A;  2ALZ A;  4KLO A;  4F8R A;  1U4B A;  2XY7 A;  5IIM A;  1U9L A;  3B0Y A;  3RRH A;  9ICL A;  4B9N A;  8ICY A;  7ICP A;  4ED2 A;  4RPZ A;  2ZTD A;  5KFG A;  4C8L A;  5KFE A;  1PZN A;  4O5E A;  5D46 A;  4GC6 A;  4JWM A;  8ICS A;  3GV5 B;  2VA8 A;  4DL5 A;  9ICV A;  4ELT A;  4R64 A;  2AGO A;  4KLE A;  3Q8P B;  1TAQ A;  4O3N A;  4NLK A;  4J9S A;  2JEI A;  3C23 A;  5J0O A;  1KSP A;  1L3U A;  4PHP A;  2BCS A;  4M9G A;  3OHA A;  3ISC A;  1MQ3 A;  2C2D A;  1N56 A;  2UVR A;  5KT3 A;  2RDJ A;  5CWR A;  3QE9 Y;  2HHS A;  2XO7 A;  4DSI A;  1DOQ A;  5EWG A;  2W9B A;  1ZQY A;  2UVV A;  3MGH A;  1ZQI A;  2PI5 A;  7ICN A;  3C2K A;  4YCX A;  1IXR A;  4F5O A;  3PW2 A;  2C22 A;  1ZQX A;  7ICG A;  1NOM A;  4RNM A;  4YMO A;  7ICL A;  4KLL A;  4YD1 A;  5KT4 A;  1XS9 D;  1ZQE A;  4B9M A;  4ZH4 A;  5DDM A;  5IIN A;  3PO4 A;  3RJG A;  2P66 A;  1T3N A;  4ECQ A;  3M9O B;  3GIK A;  5BOM A;  8ICC A;  4O3O A;  1CUK A;  1NK4 A;  5J0S A;  2M9N A;  4YXJ A;  4RQ0 A;  4DL3 A;  2NRW A;  9ICB A;  1UA0 A;  4I2A A;  4NM1 A;  4J9N A;  3MDA A;  2ZTE A;  5D49 A;  3GQC A;  1SL2 A;  4IRC A;  2IHM A;  4Q8F A;  3MR5 A;  3TAP A;  1L3V A;  5KFA A;  4P2H A;  2AJQ A;  4YQW A;  5DBC A;  4UB5 A;  1QLN A;  2XC9 A;  1C7Y A;  4F91 B;  4BDP A;  2GWS A;  3EZ5 A;  3HP6 A;  3M8S A;  1XSP A;  5DLG A;  3AU6 A;  3MFI A;  3QZ7 A;  3JPR A;  2KZZ A;  3OJS A;  3V72 A;  2Q0Z X;  4O3P A;  1X9M A;  4EZ9 A;  4BWM A;  4F5R A;  1SKR A;  1NK8 A;  1ZQF A;  4ELU A;  2AGP A;  2R8J A;  7ICU A;  2RDI A;  1BGX T;  7ICV A;  4C8K A;  4YD2 A;  4R66 A;  3AUO A;  1S77 D;  1TKD A;  3V6J A;  4ED8 A;  1SKW A;  4F2R A;  4DLE A;  3PX6 A;  5DQH A;  5DG8 A;  4JV2 A;  5J0X A;  4DL6 A;  2W9C B;  2FMS A;  8ICR A;  4GXI A;  9ICN A;  5KFK A;  3JPO A;  2HHT A;  4DFJ A;  3PX4 A;  3TAN A;  4BXO A;  9ICW A;  4M9L A;  1HJP A;  3C1Y A;  1S97 A;  4Z6E A;  5DBB A;  3KHG A;  3EPI A;  4KLJ A;  4DLG A;  3PR4 A;  1U49 A;  1Y88 A;  4F4Z A;  4QZF A;  3QZ8 A;  4M04 A;  3PW5 A;  3GII A;  1BPY A;  5DDY A;  4NXZ A;  4DO9 A;  3RH5 A;  1BPB A;  4NLZ A;  1RXW A;  3M8R A;  1KDH A;  5J2I A;  3V6K A;  5IIO A;  3MR3 A;  2LYH A;  2BR0 A;  2ASD A;  3Q8R B;  3HW8 A;  2W9C A;  3V7K A;  4B9V A;  4M9N A;  4UQG A;  3PR5 B;  5J2C A;  4DS5 A;  1NK9 A;  1U45 A;  3H4B A;  2WTF A;  4P4O A;  2VA2 A;  2KFZ A;  2HVH A;  3G6X A;  2AU0 A;  2W9M A;  2MAX A;  3KHR A;  4QWE A;  1XWL A;  4EYI B;  5EOZ A;  1NK7 A;  3KHH A;  4RQ3 A;  4QZ9 A;  2Y1J A;  1S10 A;  8ICG A;  4DOB A;  2JEG A;  9ICT A;  2JEJ A;  1TK5 A;  4BXO B;  4I2E A;  1BPE A;  2DFL A;  3EYZ A;  1S0M A;  5J2K A;  4M6W A;  8ICH A;  2R8G A;  3MR2 A;  4DSF A;  1BVS A;  4PH5 A;  4UBB A;  4ECU A;  2VA3 A;  4O5C A;  4MEY A;  4I2C A;  3Q8M A;  5KG6 A;  4F5Q A;  4J9Q A;  2PFQ A;  4DF8 A;  1Z00 A;  4XA5 A;  5L1J A;  4KLU A;  3IHQ B;  4Q45 A;  5KFJ A;  3C5F A;  5DLF A;  1T7P A;  4B9L A;  3E2E A;  3C2L A;  3RH6 A;  4LZG A;  1NK0 A;  3GV8 B;  7ICK A;  7ICS A;  4F4W A;  2KTQ A;  8ICV A;  5D4B A;  2ZUC A;  3MBY A;  3C1Z A;  1N48 A;  4Q43 A;  2W8K A;  2HHQ A;  5KFP A;  8ICU A;  2BPF A;  5BPC A;  3GFK B;  3RTV A;  4RQ5 A;  3KTQ A;  3ZDC A;  7ICH A;  4EBE A;  2A1J A;  4IRK A;  4MFF A;  5KFU A;  4GC7 A;  5L1L A;  2ZUB A;  4J9P A;  4I28 A;  4KN7 A;  1KRP A;  4UAZ A;  4RNN A;  3H4D A;  4ECZ A;  9ICP A;  3LDA A;  1U48 A;  5CHG A;  4RPY A;  3MR6 A;  4O3Q A;  4UB3 A;  2DPI A;  1HUZ A;  2MUT A;  4YR2 A;  4J9M A;  4YVZ A;  3V7J A;  2HHX A;  1JXE A;  2VAN A;  4RUC A;  2BPC A;  8ICK A;  2PI4 A;  1SZP A;  3ISD A;  4GXJ A;  2XY6 A;  3PW4 A;  5KFO A;  3RJH A;  2UVU A;  4QZG A;  1S0V A;  8ICM A;  2BCR A;  3RR7 A;  2H5X A;  3LWL A;  5KG4 A;  1KFT A;  5CP2 A;  3TI0 A;  3Q8L A;  3BQ1 A;  4F50 A;  3PW0 A;  1NKB A;  4NLN A;  1Z3E B;  1RYR A;  3RJK A;  5CJ7 A;  3OSP A;  3V6H A;  3H7I A;  5F9N A;  2IHN A;  8ICN A;  1QTM A;  4F5N A;  5HML A;  2ZUD A;  4RQ2 A;  4QZH A;  2JZB B;  2ZTC A;  1H38 A;  5KFW A;  3BDP A;  1X2I A;  4Z6F A;  5DQG A;  3T5K A;  5KFQ A;  1T4G A;  4ED3 A;  2W9A A;  8ICE A;  1K1S A;  1LV5 A;  8ICQ A;  4KTQ A;  2BCU A;  3ZD9 A;  4ECR A;  2R8K A;  1XU4 A;  1UT8 A;  2V9W A;  5DB9 A;  2ATL A;  1TVA A;  2ASL A;  4B9S A;  4DSK A;  4KLF A;  4FBU A;  4HYK A;  1ZQB A;  4DF4 A;  3AU2 A;  4YR0 A;  2J6U A;  3Q8K A;  2HHV A;  4FO6 A;  2NRT A;  4NM2 A;  4P4P A;  3RJI A;  4ED6 A;  1NJY A;  4QWD A;  9ICH A;  4I29 A;  1TK8 A;  1B43 A;  1UA1 A;  4B9T A;  4M47 A;  7ICF A;  5KFY A;  4Q8E A;  4F4X A;  1MC8 A;  4K4I A;  1D9D A;  4R8U B;  4I2B A;  5DKW A;  3PMN A;  5IIK A;  5KFB A;  3ZDA A;  5KG5 A;  5KFF A;  2ZJA A;  1ZQH A;  1BPX A;  3FDS A;  1SKS A;  2XY5 A;  2UVW A;  4C8N A;  4QZD A;  1RYS A;  3GDX A;  2FLN A;  2BDP A;  9ICK A;  2XGP A;  8ICJ A;  3FYH A;  4DOC A;  1ZQS A;  2PXI A;  3RH4 A;  1JX4 A;  7ICT A;  7ICO A;  2DPJ A;  3PY8 A;  4X5V A;  3RJJ A;  4FBT A;  9ICA A;  8ICA A;  2AQ0 A;  2P6R A;  4JWN A;  4EBC A;  4RNO A;  4EBD A;  1KLN A;  5KFH A;  8ICI A;  4J9L A;  3EW9 A;  2J6T A;  4R8U A;  4BGD A;  4QWA A;  3ISB A;  3JPT A;  4YFK A;  4RT3 A;  1D8L A;  4J9K A;  3RB0 A;  5KFI A;  4RZR A;  5TZV A;  4DQS A;  3ORY A;  1ZQQ A;  1MSW D;  4XRH A;  4RU9 A;  2NRV A;  1ZQO A;  2J6S A;  3IM1 A;  4QWB A;  4C8O A;  4KLG A;  5J2B A;  4MFA A;  5IIJ A;  3QEA Z;  9ICS A;  1EXN A;  1XC9 A;  4P4M A;  3T5L A;  5J2E A;  2HHW A;  5DGB A;  1ZET A;  3PML A;  3GIJ A;  3K4G A;  3SV3 A;  4F2S A;  4KLS A;  4QZB A;  1ZQL A;  9ICJ A;  4MFC A;  5KG2 A;  5J2F A;  2BQR A;  1ZQM A;  4F4K A;  3KHL A;  5DGA A;  1NK5 A;  2IBK A;  3RB4 A;  4IR9 A;  3MDC A;  4O3R A;  9ICX A;  1QSL A;  5KG1 A;  4NLG A;  4DOA A;  2I1Q A;  3G6Y A;  5KFZ A;  2HVI A;  4RQ6 A;  3RB3 A;  3JPP A;  4I2D A;  2MUT B;  1S0N A;  4O5K A;  4K4H A;  4F5P A;  7ICQ A;  5KTQ A;  1NKE A;  8ICB A;  2R8I A;  4QZE A;  2F1J A;  4MF8 A;  3THV A;  5KT6 A;  4YMN A;  9ICU A;  5J0W A;  4Z6C A;  2ISO A;  2R8H A;  3N97 B;  4CCH A;  5J29 A;  4ELV A;  9ICG A;  2ZJ8 A;  4RUA A;  3UPQ A;  3UQ0 A;  4I2I A;  4JK1 A;  4XUS A;  1L3S A;  1WCN A;  2FLP A;  5III A;  2W8L A;  4I2J A;  3PX0 A;  4RQ7 A;  3T5H A;  2AQ4 A;  1ZQA A;  5L1I A;  5KFN A;  3N4M B;  4UB2 A;  1BPD A;  1ZQK A;  4KLD A;  3K75 D;  5KT2 A;  3Q8S B;  4KIT B;  4DWI A;  9ICE A;  1DGS A;  4BWJ A;  4RQ4 A;  4IQW A;  3RB6 A;  1ZQD A;  1ZQT A;  7ICI A;  4EYH B;  3BJY A;  3ZD8 A;  1HUO A;  2BGW A;  9ICO A;  8ICF A;  4ECS A;  4DFP A;  4YP3 A;  3JPN A;  5J2H A;  4DQR A;  3LK9 A;  1K1Q A;  1JN3 A;  1KFD A;  1WCL A;  4RQ1 A;  4UAW A;  4QW9 A;  5HHI A;  4IQV A;  8ICZ A;  4QW8 A;  3H40 A;  2PFP A;  2KZ3 A;  2B21 A;  3H8S A;  3HPO A;  9ICI A;  1MQ2 A;  1ZQV A;  2KZM A;  4ECY A;  4QZI A;  3QEB Z;  1ZQP A;  1COO A;  2KN7 A;  2NRZ A;  2XCA A;  3RBE A;  4PHD A;  1A77 A;  5J2J A;  3BQT A;  5J2G A;  4YN4 A;  2AGQ A;  2BQ3 A;  1TV9 A;  3PW7 A;  1NJW A;  4IQT A;  3RR8 A;  2IMW P;  4B9U A;  3PVX A;  1CEZ A;  3UXP A;  1ZQG A;  4M2Y A;  4M0A A;  1X9W A;  3JPQ A;  4KLH A;  1IM4 A;  5KFS A;  4F93 B;  4DL2 A;  7ICJ A;  4JV1 A;  5HP4 A;  4IQU A;  2IA6 A;  3Q8Q B;  4YMM A;  5BOL A;  4O0I A;  3JPS A;  3BQ0 A;  4DL7 A;  3UXN A;  5J0Y A;  1D9F A;  5EWF A;  4JV0 A;  4FS1 A;  8ICP A;  2V4Q A;  4IR1 A;  4GXK A;  3PNC A;  1ZYQ A;  4DL4 A;  1XSL A;  4UBC A;  3SI8 A;  3TQ1 A;  2P6U A;  3RAQ A;  1QSS A;  5KFL A;  3C2M A;  1UT5 A;  4DS4 A;  3TAR A;  3NGD A;  1A76 A;  2HW3 A;  4QZ8 A;  1JXL A;  2BCQ A;  1V9P A;  3B0X A;  3GIL A;  1Z00 B;  4ECV A;  3RAX A;  2C28 A;  4PPX A;  8ICT A;  3BQ2 A;  3UQ2 A;  4R63 A;  4RPX A;  2C2R A;  3OGU A;  4ED0 A;  3MAB A;  4M6W B;  3TFS A;  2BQU A;  4KLT A;  4ECW A;  2F1H A;  4YR3 A;  3PO5 A;  4G3I A;  2XGQ A;  3T3F A;  1SL1 A;  2FPL A;  2XCP A;  3H8W A;  5DB6 A;  4I2H A;  2BPG A;  1ZQU A;  3V7L A;  1U47 A;  1S9F A;  3LWM A;  4ECT A;  1NKC A;  1ZQR A;  1S0O A;  1KEJ A;  5L9X A;  1RXV A;  1ZJN A;  3HX0 A;  1JIH A;  5KT5 A;  5KG3 A;  4PGY A;  5DBA A;  4ECX A;  5HMM A;  3ZDB A;  4MF2 A;  2F1I A;  5KT7 A;  4DQP A;  1B22 A;  4O3S A;  4O9M A;  4XQ8 A;  3M9M B;  4J9R A;  4PHE A;  2FMP A;  4TQR A;  4DFK A;  5CA7 A;  1NJX A;  4MEX A;  4I2F A;  3SYZ A;  3PV8 A;  4R65 A;  4Q44 A;  3H8J A;  1TK0 A;  3HT3 A;  3NTU A;  4K4G A;  1TFR A;  2FPK A;  1ZQN A;  4KN4 A;  1T8E A;  2KFN A;  5KFT A;  4PGX A;  4DSE A;  7ICE A;  9ICR A;  4TUS A;  1LB2 B;  1BPZ A;  3G6V A;  3RJF A;  4ED1 A;  4UAY A;  1L5U A;  2PFO A;  2OWO A;  4RT2 A;  5KFM A;  4QZA A;  3OSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...