1U9LA

Structural basis for a nusa- protein n interaction
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
AHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation protein nusA
publication title Structural basis for the interaction of Escherichia coli NusA with protein N of phage lambda
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 22
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u9lA00
5DG8A 7ICEA 3RH5A 5KFBA 4F92B 5J0TA 5J0WA 2I1QA 3H7IA 4Q45A 4O0IA 4DOCA 4QWEA 3OHBA 4KLEA 1RPLA 4J9LA 1U9LA 4PHPA 4ED3A 1TV9A 8ICAA 9ICHA 5KFJA 8ICNA 1NKCA 1ZQHA 4MF8A 4DF4A 1ZJNA 2V9WA 9ICGA 5L1LA 5KT2A 3OSNA 5KT6A 2V4RA 3G6YA 1NK4A 4GXIA 3RJEA 3ZD8A 4YR2A 1KFTA 2AU0A 3NGDA 3JPQA 4DS4A 4YQWA 3RR7A 8ICIA 3HWTA 2FLNA 3MGIA 4ELVA 2FPLA 4QZHA 1NJZA 4LVSA 3MBYA 3RJGA 5KFIA 7ICLA 1QSLA 4YD1A 3BQ2A 3EWAA 4DL3A 4JV1A 2ZTDA 3ETLA 2DPIA 2NRTA 4BXOA 4YXJA 4R63A 7ICIA 1ZQWA 4F4ZA 2IHMA 5L1JA 9ICBA 4JWNA 2ISOA 1ZQYA 5HNKA 7ICRA 4XUSA 4TQRA 4PGXA 4UB1A 2ISPA 2Y1IA 3JPRA 4DL5A 4KLQA 1SKRA 4GXKA 3RB3A 4GLXA 3OGUA 3M9MB 1PZNA 4QZ8A 4J9QA 5J2KA 3PW5A 3V7KA 7ICNA 9ICMA 4EBDA 4JV2A 4ED7A 3V7JA 1ZQUA 4KN4A 5CR0A 3GIMA 3RJKA 1U4BA 4M9LA 1NK0A 4M0AA 4B9UA 2OWOA 2JEJA 5DDMA 3SYZA 2F1HA 3UPQA 2XO7A 3PW7A 1KEJA 2PFQA 1S0MA 3RH6A 5KFXA 4O3RA 7ICKA 5KFUA 5KFMA 4RQ0A 4K4HA 4ED6A 4RQ3A 1TK8A 2F1IA 4LZDA 5J0YA 2PXIA 4DQPA 4F4XA 4KLDA 3PW4A 2NRWA 4KLOA 1QTMA 4RQ7A 4NY8A 8ICUA 2H5XA 5KFVA 2VA8A 9ICQA 3EYZA 4XRHA 4M9JA 5JUMA 5J0QA 1SL0A 1NKEA 1T3NA 1L3SA 1K1QA 2LYHA 2HHSA 4DLEA 4Z6DA 3EPIA 3T5JA 3OJUA 8ICGA 4F2RA 4R8UB 1NK5A 7ICMA 7ICUA 9ICPA 2PFOA 4DL7A 8ICFA 3GFKB 4YP3A 1L3UA 3Q8LA 2I9GA 2ZJ5A 4M6WA 3M8SA 4MEXA 4QZEA 3JPSA 4ELUA 3TI0A 4I2HA 5D49A 2BPFA 3RTVA 1S0VA 5TZVA 3B0YA 3SV4A 4F3OA 3MDAA 3H8WA 8ICYA 9ICJA 4F5NA 4O5EA 3RRGA 3QZ7A 3MDCA 3RJFA 4RU9A 3PMLA 5CB1A 2C2EA 4GC7A 4YVZA 5J2FA 4P4OA 1Z00A 4XA5A 4TUQA 3PO4A 4QZCA 4RPXA 4KLHA 2VANA 3ISBA 3BJYA 1HJPA 3C1ZA 3HT3A 1ZJMA 4I27A 3GIJA 3GV8B 2BPGA 3JPTA 4M9GA 4RQ8A 1X9MA 4KITB 2W9CA 2NRVA 3QEBZ 2JEGA 4MFFA 5DB7A 2BCQA 1AROP 5DGBA 4UAZA 2P6RA 4DFKA 5HMLA 4JV0A 1S9FA 4I2FA 1NJWA 3RR8A 8ICVA 4RPZA 2FMSA 1TK0A 2FPKA 3OJSA 4UAWA 2C28A 2HHXA 3H8SA 2XCPA 2BHNA 4DQQA 1S77D 4ECSA 4J9SA 4IRCA 1RXWA 5DG7A 3TFSA 5DBAA 3MR3A 2Y1JA 3LK9A 1X9SA 1WCLA 2XY7A 3UQ2A 2JEFA 3FYHA 4MFAA 5J0OA 4FO6A 2ASJA 4I29A 4KLIA 2NRXA 4R66A 4DFPA 4KTQA 8ICCA 4QZDA 4TURA 2FLLA 4NLNA 4EYIB 2A1JA 5EWGA 1TFRA 5DB9A 5KFAA 5KFRA 4RPYA 3GV7B 2W9AA 3C5FA 3T5HA 3RBDA 1SL1A 4C8KA 1K1SA 4P2HA 2F1JA 4O3SA 3MFIA 7ICQA 3KHGA 2IMWP 1NK9A 4UB4A 4EYHB 4QZFA 4I2IA 7ICPA 1BPXA 1KFDA 1ZQMA 4F91B 4J9MA 4PPXA 5DBBA 2PFNA 4RQ6A 4YR0A 4O3PA 4F5RA 5DB6A 3Q8KA 1L3TA 4G3IA 3OHAA 3G6VA 4MFCA 2P66A 4RUAA 1BPBA 5CA7A 4O9MA 4ECVA 5F9NA 4JUZA 2AGQA 1LB2B 4BGDA 4Q8EA 2RDIA 4IRKA 2VA2A 4NLKA 4XQ8A 4C8LA 2ZUBA 4EBCA 5KFYA 4JWMA 2HHTA 9ICOA 2ZJ8A 5HHIA 4F5OA 2W9BB 4FBTA 3PR4A 3M9NB 4K4IA 1NK8A 1WCNA 3H4DA 2V4QA 3HPOA 8ICQA 3AU2A 1NK6A 2C2DA 1CUKA 2BCSA 7ICHA 3IM1A 1ZQGA 5DGAA 5KFOA 8ICJA 5L9XA 5IINA 5J2HA 2JEIA 2ASDA 2IHNA 5J0XA 4MF2A 1UT8A 2BPCA 3ISDA 8ICTA 3M8RA 4ECWA 4CCHA 2XY6A 1RZTA 4UQGA 1D8LA 5BOLA 1ZQVA 1U47A 5IILA 9ICWA 2HHUA 4Z6EA 3GILA 3G6XA 4ECZA 5BPCA 4DQRA 4DO9A 4PHEA 3E2EA 4I2AA 2R8IA 8ICHA 2ZUCA 4YMNA 4DFMA 5KT5A 4QZBA 4ECRA 1QSSA 4QWBA 3Q8MA 4DLGA 5KFNA 1RYRA 4J9KA 1D9FA 1ZQTA 4RT3A 5L1KA 4PHDA 3GQCA 4DSJA 4M9NA 2KFNA 3K75D 2BQRA 3PW2A 5DQGA 1KRPA 1IM4A 3OSPA 2VA3A 3BDPA 4O5KA 2BCUA 8ICBA 4ECXA 5J0SA 3EZ5A 2FMQA 4M6WB 5CWRA 2ZTEA 1S10A 1KDHA 8ICOA 1JIHA 3C2LA 1MSWD 1N56A 4EZ9A 3Q8QB 1UA1A 2FLPA 1B43A 4F50A 3TFRA 2J6TA 4B9SA 3HP6A 5EOZA 2C2RA 1ZQJA 4NM1A 2XGPA 3V7LA 5IIJA 5KFPA 5J2EA 2ALZA 2KZMA 2FPMA 2KN7A 3EPGA 5L1IA 1RYSA 4QW8A 3UXOA 5J2IA 4F4KA 1SZPA 1MQ3A 3KHLA 4ECUA 5KFEA 4F4WA 4MEYA 3Q8RB 2XCAA 4R64A 2W9CB 2AGPA 3ISCA 5KFSA 4NM2A 1NK7A 3HX0A 4YMMA 3MR6A 4ED0A 3SV3A 1SL2A 3KTQA 3KHRA 4RQ5A 2ATLA 8ICPA 4FS1A 4RQ2A 5DBCA 1T8EA 4I2JA 2DFLA 4F5PA 4F93B 2BCVA 9ICTA 5HMMA 1Y88A 2MUTA 1L3VA 2W8LA 2AQ4A 3MR5A 2R8KA 8ICZA 4GXJA 4EZ6A 3C2MA 1H38A 1BPYA 4ECTA 1ZQOA 3RH4A 5IIMA 3Q8SB 4Q43A 1JMSA 4B9NA 1S0NA 3Q8PB 3PX0A 4Q8FA 2ZJAA 3HW8A 4DOBA 3PVXA 5HHHA 4I2GA 2M9NA 4ECYA 4IQTA 3V6JA 5KFKA 2MAXA 2PI4A 3FDSA 4RNMA 5DQHA 4RUCA 3GIKA 2HVHA 1X2IA 5KG0A 1N48A 4YXMA 9ICRA 4KLUA 9ICVA 1ZQEA 4DL4A 5J0UA 4K4GA 3PNCA 2J6SA 2RDJA 1HUOA 4DS5A 4DSKA 9ICXA 4J9PA 3QE9Y 1NJXA 5KFGA 4KLSA 1SKSA 1RXVA 2WTFA 1BPDA 3RJJA 5D4BA 4TUPA 1ZQFA 3BQ0A 1NKBA 2JZBA 4F8RA 4YN4A 1KLNA 4F4YA 1ZQBA 3NTUA 8ICWA 4KLJA 5J2CA 2ASLA 1ZQSA 3B0XA 8ICXA 9ICIA 4DF8A 1XSPA 1TKDA 3UXPA 4IR1A 1S0OA 1ZQIA 3TQ1A 1T7PA 4QW9A 3PX4A 4KLGA 4I28A 2KFZA 4PH5A 4JK1A 5KFTA 4IQUA 5D46A 2ZTCA 3GDXA 4F2SA 4PGYA 1ZQRA 4C8MA 5J2GA 4NLZA 4Q44A 4EBEA 3C2KA 1SKWA 1D8YA 1D9DA 4IRDA 2KTQA 2HW3A 5DQIA 8ICEA 4RNNA 4DSIA 1NOMA 3EW9A 4UB2A 4DFJA 1V9PA 1TK5A 4DWIA 3PW0A 1B22A 5KG2A 1C7YA 3C1YA 4BWMA 2AQ0A 3RB6A 4QZAA 2W9MA 4J9RA 5BOMA 4IQVA 4RQ1A 3PV8A 3PR5B 3BQ1A 1A76A 1JX4A 4NLGA 4O3OA 5J0PA 4B9TA 2BDPA 1ZQPA 4M47A 8ICLA 2DPJA 5J29A 9ICNA 4LZGA 3LWLA 4O3NA 4QZGA 1DOQA 3RAXA 1MC8A 2BQ3A 4ED1A 3N97B 8ICKA 4B9MA 3ZDBA 2R8GA 3MGHA 4I2CA 4YG2A 3M9OB 1ZQDA 1UA0A 7ICVA 4I2DA 3TANA 5KG3A 3MABA 3THVA 3ZDDA 5CJ7A 4RT2A 2UVUA 2KZ3A 3H40A 4TUSA 1XSNA 5IIOA 5HP4A 2UVWA 3AUOA 1TAQA 4KLTA 2FMPA 3QZ8A 4YR3A 4UAYA 4ED2A 1LV5A 4DEZA 2BR0A 9ICAA 4ECQA 2W9BA 2W8KA 1U48A 3RAQA 2UVRA 1ZQLA 3T5KA 2UVVA 9ICFA 4C8NA 1ZQKA 3PMNA 4GC6A 4ELTA 4ZH4A 4QWDA 2HHQA 7ICJA 4Z6FA 4DSLA 9ICCA 1QLNA 7ICOA 3T5LA 7ICSA 5DDYA 3T3FA 5KT4A 3UXNA 3ORYA 4P4MA 3RJIA 4M9HA 5C5JA 5CHGA 3QEAZ 1EXNA 1JN3A 5KFDA 3PX6A 1NJYA 2BGWA 3C21A 4DL2A 1Z3EB 1ZQNA 5CP2A 1ZQAA 1XO1A 2R8HA 1JXLA 3RB0A 1KFSA 1Z00B 1BPZA 1XWLA 5DB8A 1U45A 2C22A 1XU4A 3BQTA 5KG7A 1L5UA 1KTQA 5IIIA 4YMOA 4YFKA 4PGQA 4I2EA 4ED8A 3V72A 1JXEA 5J0RA 5DKWA 1ZQXA 4QWAA 3GV5B 4B9VA 4E0DA 1S76D 8ICSA 3C23A 7ICTA 1ZQCA 3TAQA 3JPOA 1XC9A 5KFZA 1CEZA 4KLLA 1KSPA 3TAPA 2AJQA 4YCXA 4KLFA 1A77A 9ICSA 3SZ2A 5KG6A 2MUTB 4R65A 4NXZA 4DL6A 5DLGA 5J2BA 3ZDAA 2NRZA 4F5QA 3UQ0A 3RBEA 5F9LA 1X9WA 7ICFA 2AGOA 5J2DA 9ICLA 3AU6A 4DSEA 1TAUA 3H8JA 4B9LA 2J6UA 3ZDCA 5KFQA 1MQ2A 8ICRA 4KN7A 5KT3A 5J2AA 4UBCA 1UT5A 4QWCA 4J9NA 4DSFA 2ZUDA 2PI5A 4FS2A 3PO5A 4BWJA 1XSLA 2HHVA 3LWMA 5DG9A 3V6HA 1ZQQA 2B21A 4R8UA 3SI8A 2BKEA 5KFCA 3JPNA 4KMUA 3GIIA 3RB4A 4C8OA 2R8JA 4O5CA 4I2BA 2A1JB 4BXOB 4BDPA 8ICMA 5KFHA 2XY5A 1DGSA 4QZIA 1BGXT 2HVIA 1HUZA 5KT7A 3MR2A 1IXRA 1TVAA 2JZBB 5KG5A 5KTQA 5EWEA 4RNOA 4UB5A 1BPEA 3MFHA 4HYKA 1ZETA 3PY8A 2KZZA 4QZ9A 3N4MB 3IHQB 4YD2A 3TARA 2P6UA 1U49A 4UB3A 5KFFA 2XGQA 4TQSA 4M2YA 2BCRA 4DOAA 2Q0ZX 4RZRA 3V6KA 1XS9D 2IA6A 1BVSA 7ICGA 4DQSA 4X5VA 9ICKA 2GWSA 4RQ4A 3LDAA 2PFPA 4IR9A 2IBKA 3K4GA 3RJHA 3ZD9A 4PHAA 4M04A 4DQIA 1ZQZA 5J2JA 1QSYA 5KFLA 3RRHA 9ICUA 4FBUA 4EEYA 4O3QA 2BQUA 4Z6CA 5DLFA 4J9OA 5KG1A 3JPPA 9ICEA 4KLMA 1T4GA 5KFWA 4P4PA 1S97A 5KG4A 3ZDEA 3KHHA 5EWFA 5IIKA 2HHWA 4IQWA 2XC9A 3H4BA 1COOA 1ZYQA 4UBBA 3C5GA
chains in the Genus database with same CATH superfamily
5ALUA 7ICEA 1A6SA 4QWEA 2A1AA 3KKAC 4J9LA 4PHPA 4ED3A 1TAMA 3QYPA 4U6PA 8ICNA 1ZJNA 3G6YA 4GXIA 3RJEA 1F5SA 2K8AA 4YR2A 4DS4A 8ICIA 2W3RA 3MBYA 5KFIA 7ICLA 2AHOB 3SQIA 3EWAA 2ZTDA 3ETLA 2NRTA 4F4ZA 2ISOA 2W11A 5ALPA 1ZQ1C 5AKIA 4DL5A 4KLQA 1SKRA 1J97A 2MRLA 5A0LA 3OGUA 3V7KA 3HKZC 7ICNA 2OWOA 2JEJA 2F1HA 3PW7A 1SZHA 7ICKA 3PSTA 3F2BA 1RG6A 4RQ3A 5J0YA 1N2XA 2KEYA 4NY8A 2H5XA 4M9JA 4XRHA 1T3NA 4NL9C 3K1ZA 2LYHA 3U26A 5ALVA 3T5JA 3KZXA 1NK5A 7ICMA 3MGVA 4DL7A 1L3UA 2I9GA 5EE1A 3M8SA 4I2HA 4GFJA 1ZD4A 5TZVA 4O5EA 3QZ7A 1LVHA 3PMLA 4JMUA 3WU2U 2C2EA 5J2FA 1Z00A 4XA5A 3PO4A 1N62A 4UAVA 3ISBA 1HJPA 1RM6C 3DDHA 3JPTA 1QQ5A 4KITB 2W9CA 3QEBZ 2BCQA 4UAZA 4DFKA 4I2FA 5ALGA 3RR8A 4PZOA 1TK0A 2FPKA 3OJSA 4C80A 2E5SA 4ECSA 2E3TA 4QNLA 1RXWA 5DG7A 1X9SA 1WCLA 1OXJA 4MFAA 4KLIA 2NRXA 4R66A 5ALJA 4QZDA 1WWUA 2A1JA 5EWGA 1TFRA 5DB9A 4RPYA 2KZMA 3T5HA 2EDUA 2BZFA 3RBDA 4C8KA 1K1SA 2F1JA 3PSIA 1BPXA 4J9MA 2KE7A 4O3PA 4G3IA 4RUAA 1N63A 2HBJA 5J8YA 1LB2B 4Q8EA 5ALXA 2ZUBA 9ICOA 4F5OA 2EANA 2W9BB 2YMPA 4MHVA 3PR4A 3M9NB 3SEIA 4K4IA 2Y9TA 3HPOA 1NK6A 2BCSA 3IM1A 1F0MA 5KFOA 4F72A 2JR5A 2BPCA 3ISDA 5JRTA 4CCHA 1RZTA 1ZQVA 4ECZA 4UASA 4DQRA 5AKGA 3IDWA 2DUYA 3QUQA 2LM1A 4DLGA 1RYRA 2DBYA 1ZQTA 1YZ7A 3PW2A 2I6XA 2WF5A 5DQGA 2VA3A 3OSPA 2BCUA 8ICBA 2ZIXB 1PK3A 1S10A 4B6JA 3H0MB 2VIXA 3KZIU 2G5IB 4NM1A 1UCVA 2XGPA 5IIJA 5KFPA 5J2EA 3EPGA 3AEVA 1MQ3A 5KFEA 4MEYA 5GTIU 1JI7A 1L7PA 1LKYB 3KTQA 5AM3A 4GIBA 3KHRA 1V85A 3AQEA 2ATLA 4FS1A 2KVCA 5ALYA 2DFLA 4F5PA 2BCVA 4US8A 1BPYA 1H38A 1JROA 3F2DA 4B9NA 3IV6A 3BZKA 2IOHA 4I2GA 2M9NA 5KFKA 1X2IA 4C4SA 4YXMA 3PNCA 2RDJA 4DSKA 5AK4A 2YTUA 3QE9Y 4KLSA 2F8LA 5D4BA 3BQ0A 3NTUA 8ICWA 5J2CA 2ASLA 2F77X 4CGZA 4IR1A 5KFTA 5D46A 1L6NA 2YN4A 5J2GA 4NLZA 2JMGA 2KTQA 5DQIA 3EW9A 2QKQA 4DFJA 2JV3A 5KG2A 3D2QA 3C1YA 5CRXA 2W9MA 1J2NA 4IQVA 1ZD3A 4RQ1A 3PR5B 3RF9A 1ECWA 2XIDA 4O3NA 1DOQA 3NS1A 1MC8A 1X40A 2XI9A 3N97B 4B9MA 3CYMA 2F44A 2EH9A 5CJ7A 2F3NA 1XSNA 1LV5A 2BR0A 2W9BA 4IL6U 1U48A 1ZQLA 3T5KA 5E79U 4GC6A 4USAA 9ICCA 2ZIWB 1QLNA 1O08A 3UXNA 3ORYA 1JN3A 5KFDA 2RHFA 2G0AA 3C21A 1SIJA 4DL2A 3QUTA 1XO1A 2KNJA 3RFAA 3BQTA 5KG7A 1L5UA 1KTQA 4PGQA 1DXSA 1GO3F 5ALZA 2HHQA 1DK3A 1ZQXA 3GV5B 2QB0B 4E0DA 8ICSA 1ZQCA 3F53A 3QUCA 2K4HA 4KLFA 9ICSA 5KG6A 2MUTB 4DL6A 2NRZA 3UQ0A 1X9WA 2ZIXA 4DSEA 3ZDCA 5AKEA 5KFQA 1MQ2A 5KT3A 1UT5A 2ZUDA 2G5HB 2PI5A 4BWJA 2HHVA 5DG9A 2Y0SF 2KSOB 1T3QA 4R8UA 3SI8A 3ALRA 3GZFA 3WK8A 4Y2JA 4QZIA 2HVIA 5AICA 2JZBB 2JXJA 4HYKA 2KKVA 1BPEA 3ETRA 3C29A 3N4MB 3IHQB 2H3VA 3I1YA 5AHXA 1ZD5A 3WKEA 1BVSA 2XICA 5AM0A 3LDAA 4IR9A 3K4GA 4M04A 3AMZA 5ALTA 1PK1B 3RRHA 5DLFA 4J9OA 3QNMA 4C0ZA 2KHVA 3H4BA 1COOA 3C5GA 5DG8A 5KFBA 5J0WA 4O0IA 2I1QA 3H7IA 1U9LA 1TV9A 3SAGA 3QXGA 9ICHA 1UHUA 1NKCA 2V9WA 4MF8A 2CN1A 9ICGA 5KT2A 2V4RA 4YQWA 3RR7A 2HMXA 2FLNA 1JUDA 3MGIA 2FPLA 1KKXA 3RJGA 1OUQA 1X6IA 1ZOLA 4YD1A 1SXEA 2YB4A 4YXJA 4R63A 1ZQWA 4XUSA 2JRZA 4TQRA 4PGXA 2Z7JA 2WFAA 3M9MB 4J9QA 5J2KA 2WF8A 2W03A 4EBDA 4ED7A 3V7JA 5CR0A 5JTIA 3RJKA 2KJ5A 4M0AA 5DDMA 2YMLA 3SYZA 2RP5A 4O3RA 5KFXA 4ED6A 4ACOA 2F1IA 4LZDA 3DV9A 2OM6A 4F4XA 1CRXA 2L5YA 1QTMA 5KFVA 2VA8A 2M0NA 1BNPA 2Q4TA 5JU5A 1K1QA 1SWWA 2HHSA 1HIWA 4Z6DA 2W7PA 3EPIA 4ZOHC 4Y2QA 2PFOA 1FEZA 3Q8LA 4MEXA 4ELUA 2KKPA 3B0YA 3SV4A 8ICYA 4F5NA 5ALNA 3RRGA 3MDCA 3WKCA 3RJFA 2EZXA 5CB1A 4FZLA 4GC7A 4P4OA 4BX9C 1Z1VA 4QZCA 3H8MA 2VANA 3BJYA 3HT3A 2BPGA 3CP8A 1X9MA 2QB0A 1SWVA 2LM4A 2CRXA 2JEGA 5DB7A 1AROP 3B9JA 4BUGA 2W43A 1S9FA 4JV0A 4J03A 8ICVA 5AM1A 2HHXA 2C28A 2OCEA 4DQQA 1S77D 4IRCA 3TFSA 2YB1A 5DBAA 3BS5B 2Y1JA 2XY7A 3FYHA 3HILA 4I29A 4DFPA 4KTQA 1BNOA 1PVPA 1FIQA 4CDGA 4EEKA 3N7SC 4NLNA 4IS7A 5KFAA 5KFRA 3GV7B 5AKXA 2D6FC 3SR6A 2IMWP 2DF4B 4UB8U 7ICPA 4I2IA 2DKXA 2WF7A 2LYBA 4KX3A 5DBBA 4AP9A 4F5RA 3AL0B 5DB6A 3OHAA 3G6VA 2HBKA 1BPBA 3DEEA 4O9MA 4OJ6A 4JUZA 2RDIA 4IRKA 2HI0A 1ZRMA 4XQ8A 4KMOB 4EBCA 3EUB2 4EX7A 5KNIA 2GH1A 2V4QA 8ICQA 1CUKA 7ICHA 8ICJA 3H0RB 2JEIA 8ICTA 3M8RA 1D8LA 5BOLA 3G6XA 5BPCA 3E2EA 4I2AA 2EAOA 2R8IA 1QSSA 4QWBA 1S8OA 3WKBA 4DSJA 4RT3A 4PHDA 2RLTA 1XNSA 3K75D 1HEKA 1RQNA 1WYGA 3TADC 4O5KA 5J0SA 4Y2RA 3EZ5A 3SD7A 2FMQA 4M6WB 3I76A 2FE9A 8ICOA 1JIHA 4FE3A 3C2LA 3AQFA 2D3DA 3Q8QB 1UA1A 1B43A 4F50A 5ALRA 3TFRA 1SXDA 4OD0A 3V7LA 2ALZA 1RYSA 2DL0A 4ECUA 5B5EU 3UMCA 3ISCA 4NM2A 1F44A 3TKAA 4ED0A 3MR6A 1SL2A 2Y9UA 4RQ2A 1COKA 5DBCA 2KP7A 2G08A 1CI4A 2O6KA 5GTHU 3IG5A 1L3VA 2AQ4A 8ICZA 3MR5A 1NZBA 1VDVA 1ZQOA 5AK5A 3I28A 3Q8SB 1JMSA 1L8OA 1RDFA 1S0NA 3PX0A 4Q8FA 3HW8A 3PVXA 1N5XA 1L7OA 5H2FU 4NV0A 3V6JA 4IQTA 2KD1A 2EAPA 4RNMA 3GIKA 9ICRA 1N48A 9ICVA 5J0UA 1Q8KA 4K4GA 2J6SA 5C0YA 5EE3A 4DS5A 9ICXA 1NJXA 1SKSA 1N60A 3RJJA 4TUPA 2I5HA 1NKBA 1RYUA 4FZNA 4F4YA 1KLNA 2ZIUB 8ICXA 2ZIVA 1ZQSA 3QU9A 3QU5A 3AN1A 3UXPA 1S0OA 1NI3A 3VC8A 3TQ1A 1T7PA 5AI4A 2ZTCA 1N61A 1MA7A 4F2SA 3BS5A 3C2KA 1D8YA 4UAUA 2KOBA 1Z19A 4DSIA 1TK5A 4BWMA 3RB6A 2OXOA 4J9RA 5BOMA 3PV8A 2LMRA 1JX4A 4B9TA 4M47A 5J29A 4LZGA 4QZGA 2BQ3A 8ICKA 1M6YA 2R8GA 4I2CA 5AI8A 5AIAA 3ZDDA 2KZ3A 3H40A 5HP4A 2OHFA 2UVWA 1B4FA 2W3SA 2KHQA 3QZ8A 9ICAA 3FM9A 4DEZA 1J2MA 4PZNA 3RAQA 2UVRA 2UVVA 4ELTA 4ZH4A 1L8LA 4QWDA 7ICJA 4Z6FA 2B0CA 5KL8B 7ICSA 4KLTA 4U7CA 2MU2A 1Z1BA 2K8BB 3M6KA 1NJYA 2BGWA 4FZMA 1Z3EB 2Y0SC 5AI9A 1JXLA 5AKLA 1KFSA 1BPZA 1U45A 1XU4A 5ALLA 2NYVA 4Y2VA 4B9VA 2VJ4A 5ALOA 3C23A 7ICTA 3JPOA 2DKZA 1CEZA 1A77A 5DLGA 4NWIA 5J2BA 3ZDAA 3HKZF 3RBEA 5F9LA 2RQ5A 5J2DA 9ICLA 3CW2C 8ICRA 4KN7A 5FP0A 4UBCA 4J9NA 1ZQQA 2B21A 2A19A 2BKEA 3RB4A 3JPNA 4KMUA 4C8OA 2LBOA 4I2BA 4BXOB 4BDPA 8ICMA 2XY5A 1DGSA 4OO1J 3HRDD 1TVAA 5KG5A 3MFHA 4RNOA 3PY8A 1ZETA 2KZZA 1UQVA 4QZ9A 2P35A 4TQSA 4DOAA 2Q0ZX 4RZRA 3V6KA 3A0BU 4DQSA 3KBBA 1Z4NA 4X5VA 2PFPA 2IBKA 2JH1A 4PHAA 3D2NA 2HOQA 5J2JA 2PMZF 3IRUA 1JRPA 1X66A 9ICUA 2VJ5A 4FFDA 4O3QA 2BQUA 5KG1A 3JPPA 4O3MA 2ZXHA 3KHHA 2HHWA 4IQWA 1ZYQA 4OJOA 4KX5A 3RH5A 1YT3A 1TE2A 1V97A 4F92B 5J0TA 4Q45A 4DOCA 2OEHA 3OHBA 4CE6A 4KLEA 1RPLA 1ZQHA 4NLBA 3OSNA 5KT6A 1NK4A 2HSZA 3ZD8A 2AU0A 3NGDA 3JPQA 2IOFK 3VCBA 4ELVA 4QZHA 1NJZA 4P0QB 4LVSA 4Y2XA 2FJ6A 1QSLA 4DL3A 3ICXA 2DPIA 2F76X 7ICIA 5L1JA 1ZQYA 5HNKA 4UB1A 2Y1IA 4EELA 3JPRA 4GLXA 2LI6A 1PZNA 4QZ8A 3PW5A 5ALQA 3SAHA 4JV2A 3GIMA 4M9LA 1U4BA 1NK0A 3UPQA 2XO7A 1KEJA 2PFQA 3RH6A 4Y2TA 5KFUA 4K4HA 1TK8A 5ALMA 3F2CA 3PW4A 2NRWA 4KLOA 1DK2A 9ICQA 2DWQA 3EYZA 5JUMA 1SL0A 1NKEA 4EENA 1WUDA 5J8YC 3E58A 3OJUA 8ICGA 2A3VA 8ICFA 1IIPA 3GFKB 2CPRA 4QZEA 3TI0A 1SV4A 5D49A 3RTVA 1S0VA 3IG8A 3KKAA 3MDAA 2KIVA 3H8WA 5AK6A 5TISU 4RU9A 3A0HU 4YVZA 4TUQA 5EE9A 4UW9A 4C7YA 4I27A 4M9GA 1D8BA 2WF9A 2GOLA 2KMDA 2QARB 4Y2PA 1X6JA 4Y2YA 5DGBA 1JALA 2PKEA 5AM5A 2P6RA 1LKYA 1NJWA 2FMSA 4UAWA 3H8SA 2XCPA 2BHNA 3OPXA 3OTQA 4UATA 3QU7A 3LK9A 1FFVA 3UQ2A 2ASJA 4OJ5A 3HJEA 4TURA 1XO0A 2FLLA 4BXOA 2W9AA 4F3OA 1ZD2P 7ICQA 3KHGA 1ED1A 4UB4A 4QZFA 4EYHB 1ZQMA 4F91B 3F5EA 2XVTA 4MFCA 5CA7A 5F9NA 2AGQA 4BGDA 4CRXA 2VA2A 4C8LA 2KG5A 5KFYA 5HHIA 4ICAA 2G07A 1NK8A 1WCNA 2W7OA 2H3FA 2HOFA 2C2DA 2EZZA 1ZQGA 5DGAA 1B0XA 5IINA 2EZYA 4OJPA 2ASDA 2IHNA 5J0XA 1UT8A 1NZPA 4C4TA 2XY6A 1DRGA 4UQGA 3J81j 3ZI4A 4Z6EA 8ICHA 4DO9A 4PHEA 2ZUCA 4YMNA 5KT5A 4QZBA 3LVWA 3Q8MA 1D9FA 5L1KA 3TACB 4M9NA 2YMMA 2BQRA 2KJ9A 2FI1A 1KRPA 3BDPA 4ECXA 5CWRA 2ZTEA 1KDHA 4PL1A 4CNQA 4EZ9A 4PJ0U 4C4RA 4A8EA 3E0FA 1RQLA 1Q3UA 3HP6A 2C2RA 2FDRA 1V38A 1KBUA 2K60A 5B66U 2FPMA 2KN7A 2ZIWA 4QW8A 3Q8RB 2XCAA 2W9CB 1KL9A 1NK7A 3HX0A 4OCZA 4YMMA 2RRDA 2ZXIA 4F93B 2DQNB 2MUTA 3F5AA 4LJXA 2W8LA 4EZ6A 3C2MA 4WJ3B 4ECTA 5HR6A 4Q43A 3R9KA 3Q8PB 2JHDA 3WKAA 2MSNA 5HHHA 4ECYA 2K4EA 2KSOA 2MAXA 2PI4A 3FDSA 3CNHA 2HVHA 1Z4OA 4KLUA 1ZQEA 5L1MA 5ALWA 5KFGA 3ED5A 1RXVA 2WTFA 4F8RA 3NASA 2JZBA 1ZQBA 2QARA 4KLJA 3B0XA 9ICIA 2OYYA 1TKDA 4KLGA 4QW9A 4PH5A 4JK1A 2HCFA 4IQUA 1UPHA 1SB3C 4EBEA 5AM2A 3MC1A 5AKYA 1Q46A 1PK1A 3K1RB 1NOMA 4UB2A 1V9PA 2DGZA 1C7YA 1NNLA 2B6GA 4QZAA 1P7DA 3QU2A 5AKZA 3WKDA 4O3OA 1Q3VA 4NLGA 8ICLA 2DPJA 2QLTA 4Y2UA 4ED1A 5KL1B 3ZDBA 4YG2A 1ZQDA 1K5OA 1UA0A 4I2DA 1KQQA 3TANA 5KG3A 3THVA 2KIWA 2K89A 4AYBF 5IIOA 4NJ8A 3AUOA 1TAQA 4UAYA 2W8KA 9ICFA 3QUBA 3PMNA 2BDUA 3KD3A 4DSLA 3T5LA 5DDYA 3T3FA 3RJIA 5C5JA 3QEAZ 3PX6A 3PSFA 4CF5A 5CP2A 1L7MA 2WB1F 2E8OA 5DB8A 1QQ7A 5IIIA 4YFKA 4YMOA 2WHEA 4ED8A 3V72A 1JXEA 1S76D 4QWAA 5KFZA 3N7RC 4OJLA 2AJQA 1N5WA 4YCXA 3SZ2A 4NXZA 3UMBA 2WAQF 3L4PA 3SENA 3AM9A 1WWVA 1TAUA 5ALEA 5J2AA 4DSFA 2HBMA 4QWCA 3NVWA 4US9A 5AKKA 4FS2A 3PO5A 1SV0A 2F8KA 3V6HA 4RQMA 2ZG6A 5KFCA 2PMZC 2W04A 3WK7A 2LKYA 5KFHA 2AXTU 1HUZA 3MR2A 2F2AB 2W55A 4UB5A 3PZPA 4YD2A 2EQYA 3TARA 2P6UA 2WF6A 2NO5A 2XGQA 4M2YA 2BCRA 2IA6A 7ICGA 2LPEA 5ALDA 9ICKA 2EAMA 4HAIA 3RJHA 2LHTA 4DQIA 1C20A 1QSYA 4FBUA 4BJQA 3N28A 2GO7A 9ICEA 3C28A 1S97A 3ZDEA 1DGJA 2XC9A 4C7ZA 8ICAA 3D6JA 1URJA 5KFJA 3SMVA 4DF4A 3NRWA 5L1LA 2K8CB 4QIWF 1KFTA 3QX7A 2HOIA 5AI0A 3HWTA 5G5GA 3BQ2A 2KICA 4JV1A 5AKJA 9ICBA 2IHMA 4NLCA 4JWNA 7ICRA 1PVRA 2ISPA 4GXKA 3RB3A 2JGAA 9ICMA 3T79A 1ZQUA 2E8NA 4KN4A 4CF4A 5KAFU 4B9UA 4Y2SA 2H3QA 3BZCA 2E1FA 1S0MA 2H3IA 5KFMA 2YY6A 2IOFA 4RQ0A 2PXIA 4DQPA 4KLDA 2KK0A 5G5HA 8ICUA 4RQ7A 4PL2A 5J0QA 1L3SA 4DLEA 2G09A 1VLBA 3M6ZA 4DCCA 5ALKA 3LVVA 4F2RA 4R8UB 7ICUA 9ICPA 4YP3A 2ZJ5A 4M6WA 3JPSA 2BPFA 5EE0A 4P0PB 9ICJA 5ALFA 5K4LA 4RPXA 4KLHA 3WK9A 3C1ZA 1ZJMA 3GIJA 3GV8B 2HBLA 4RQ8A 2NRVA 3O0FA 4MFFA 1QCKA 5HMLA 4RPZA 5KAIU 3NVYA 2LYAA 4J9SA 3MR3A 3ONNA 2JEFA 3UM9A 2YQEA 5J0OA 4FO6A 8ICCA 5F3XB 4EYIB 1SGGA 3C5FA 1SL1A 4P2HA 4O3SA 3MFIA 1NK9A 1KFDA 4PPXA 2PFNA 3IP4B 4RQ6A 4YR0A 1FFUA 3M7DA 3Q8KA 1L3TA 2VKQA 2P66A 4ECVA 2ZIUA 4NLKA 2HHTA 4JWMA 5ALHA 2ZJ8A 3LYSA 1QH9A 4FBTA 3NVVA 3H4DA 3AU2A 1SV0C 2ES6A 1PVQA 3BQ7A 5L9XA 5J2HA 4QJFB 4MF2A 2R18A 4ECWA 5AI5A 9ICWA 1U47A 5IILA 2HHUA 3GILA 2CXYA 4F71A 2K4IA 5AI6A 4DFMA 4ECRA 4EX6A 5KFNA 2YX8A 4J9KA 3GQCA 2KFNA 1ZXIA 1IM4A 2N1RA 5T14A 2E8PA 1MSWD 1N56A 3KOOA 5AIBA 2E8MA 2FLPA 5AK3A 2J6TA 4B9SA 5EOZA 1ZQJA 2GLEA 5L1IA 3UXOA 2D8CA 5J2IA 4F4KA 1SZPA 3KHLA 4F4WA 4R64A 2AGPA 2MA1A 5KFSA 3SV3A 4RQ5A 3WK5A 5AKHA 3SAFA 1QQ6A 8ICPA 1KN5A 1T8EA 4I2JA 4RQNA 9ICTA 5HMMA 1Y88A 2R8KA 4GXJA 5AM4A 3RH4A 5IIMA 2NV3A 2ZJAA 4DOBA 3N7PD 4G9BA 4P0PA 2JH7A 2QB1A 1AQ6A 5ALIA 5DQHA 4RUCA 5KG0A 1X42A 4DL4A 1FO4A 2KVSA 3NUQA 1HUOA 4J9PA 3TADA 1BPDA 1ZQFA 4YN4A 5ALSA 4DF8A 1XSPA 1ZQIA 4NL9A 3PX4A 2KFZA 4I28A 3GDXA 4PGYA 1ZQRA 4C8MA 4Q44A 2NO4A 4UB6U 4AYBC 1SKWA 2ODGA 1D9DA 4IRDA 2HW3A 8ICEA 1VJ5A 4RNNA 4DWIA 3PW0A 1B22A 2AQ0A 3BQ1A 5HR7A 1A76A 5J0PA 2BDPA 1ZQPA 9ICNA 3LWLA 3RAXA 4UARA 3L5KA 2WB1C 2E1EA 3MGHA 3M9OB 7ICVA 3H0LB 3MABA 4RT2A 2UVUA 4TUSA 3KFUF 2KJ8A 2HDOA 2FMPA 4YR3A 4ED2A 1L7NA 4P0QA 4ECQA 1S5LU 2AH5A 4C8NA 1ZQKA 2WAQC 3BS7A 3NVZA 3UMGA 7ICOA 4M9HA 5KT4A 4P4MA 3GU3A 5CHGA 1EXNA 1PUZA 1ZQNA 3WK4A 1T94A 1ZQAA 1OW5A 2R8HA 3RB0A 1Z00B 1XWLA 2C22A 2YMQA 2G06A 4I2EA 2ESEA 5J0RA 3QU4A 5DKWA 1YZ6A 3TAQA 1XC9A 2K4PA 4KLLA 1KSPA 3TAPA 3CRXA 4JB3A 3L3FX 4R65A 1IV8A 4CF3A 4F5QA 7ICFA 2AGOA 3AU6A 3H8JA 4B9LA 2J6UA 2KV2A 1A0PA 1O03A 1XSLA 3LWMA 2H3ZA 1ZRNA 2OH2A 3GIIA 4O5CA 3S6JA 2R8JA 1WG8A 2A1JB 3M1YA 1BGXT 5KT7A 3WK6A 1IXRA 5KTQA 3NRZA 5EWEA 2ZIVB 3PSPA 4IC9A 1U49A 4UB3A 3FC4A 5KFFA 1XS9D 2GWSA 4RQ4A 2W54A 3D2SA 3ZD9A 4QIWC 1KW4A 3IN5A 4DFDA 1ZQZA 5CEHA 5KFLA 1IG6A 4EEYA 1X9XA 4Z6CA 4KLMA 1T4GA 5KFWA 4P4PA 5KG4A 5EWFA 5IIKA 3FAHA 4UBBA 1MN8A
chains in the Genus database with same CATH topology
5DG8A 7ICEA 3RH5A 5KFBA 4F92B 5J0TA 5J0WA 2I1QA 3H7IA 4Q45A 4O0IA 4DOCA 4QWEA 3OHBA 4KLEA 1RPLA 4J9LA 1U9LA 4PHPA 4ED3A 1TV9A 8ICAA 9ICHA 5KFJA 8ICNA 1NKCA 1ZQHA 4MF8A 4DF4A 1ZJNA 2V9WA 9ICGA 5L1LA 5KT2A 3OSNA 5KT6A 2V4RA 3G6YA 1NK4A 4GXIA 3RJEA 3ZD8A 4YR2A 1KFTA 2AU0A 3NGDA 3JPQA 4DS4A 4YQWA 3RR7A 8ICIA 3HWTA 2FLNA 3MGIA 4ELVA 2FPLA 4QZHA 1NJZA 4LVSA 3MBYA 3RJGA 5KFIA 7ICLA 1QSLA 4YD1A 3BQ2A 3EWAA 4DL3A 4JV1A 2ZTDA 3ETLA 2DPIA 2NRTA 4BXOA 4YXJA 4R63A 7ICIA 1ZQWA 4F4ZA 2IHMA 5L1JA 9ICBA 4JWNA 2ISOA 1ZQYA 5HNKA 7ICRA 4XUSA 4TQRA 4PGXA 4UB1A 2ISPA 2Y1IA 3JPRA 4DL5A 4KLQA 1SKRA 4GXKA 3RB3A 4GLXA 3OGUA 3M9MB 1PZNA 4QZ8A 4J9QA 5J2KA 3PW5A 3V7KA 7ICNA 9ICMA 4EBDA 4JV2A 4ED7A 3V7JA 1ZQUA 4KN4A 5CR0A 3GIMA 3RJKA 1U4BA 4M9LA 1NK0A 4M0AA 4B9UA 2OWOA 2JEJA 5DDMA 3SYZA 2F1HA 3UPQA 2XO7A 3PW7A 1KEJA 2PFQA 1S0MA 3RH6A 5KFXA 4O3RA 7ICKA 5KFUA 5KFMA 4RQ0A 4K4HA 4ED6A 4RQ3A 1TK8A 2F1IA 4LZDA 5J0YA 2PXIA 4DQPA 4F4XA 4KLDA 3PW4A 2NRWA 4KLOA 1QTMA 4RQ7A 4NY8A 8ICUA 2H5XA 5KFVA 2VA8A 9ICQA 3EYZA 4XRHA 4M9JA 5JUMA 5J0QA 1SL0A 1NKEA 1T3NA 1L3SA 1K1QA 2LYHA 2HHSA 4DLEA 4Z6DA 3EPIA 3T5JA 3OJUA 8ICGA 4F2RA 4R8UB 1NK5A 7ICMA 7ICUA 9ICPA 2PFOA 4DL7A 8ICFA 3GFKB 4YP3A 1L3UA 3Q8LA 2I9GA 2ZJ5A 4M6WA 3M8SA 4MEXA 4QZEA 3JPSA 4ELUA 3TI0A 4I2HA 5D49A 2BPFA 3RTVA 1S0VA 5TZVA 3B0YA 3SV4A 4F3OA 3MDAA 3H8WA 8ICYA 9ICJA 4F5NA 4O5EA 3RRGA 3QZ7A 3MDCA 3RJFA 4RU9A 3PMLA 5CB1A 2C2EA 4GC7A 4YVZA 5J2FA 4P4OA 1Z00A 4XA5A 4TUQA 3PO4A 4QZCA 4RPXA 4KLHA 2VANA 3ISBA 3BJYA 1HJPA 3C1ZA 3HT3A 1ZJMA 4I27A 3GIJA 3GV8B 2BPGA 3JPTA 4M9GA 4RQ8A 1X9MA 4KITB 2W9CA 2NRVA 3QEBZ 2JEGA 4MFFA 5DB7A 2BCQA 1AROP 5DGBA 4UAZA 2P6RA 4DFKA 5HMLA 4JV0A 1S9FA 4I2FA 1NJWA 3RR8A 8ICVA 4RPZA 2FMSA 1TK0A 2FPKA 3OJSA 4UAWA 2C28A 2HHXA 3H8SA 2XCPA 2BHNA 4DQQA 1S77D 4ECSA 4J9SA 4IRCA 1RXWA 5DG7A 3TFSA 5DBAA 3MR3A 2Y1JA 3LK9A 1X9SA 1WCLA 2XY7A 3UQ2A 2JEFA 3FYHA 4MFAA 5J0OA 4FO6A 2ASJA 4I29A 4KLIA 2NRXA 4R66A 4DFPA 4KTQA 8ICCA 4QZDA 4TURA 2FLLA 4NLNA 4EYIB 2A1JA 5EWGA 1TFRA 5DB9A 5KFAA 5KFRA 4RPYA 3GV7B 2W9AA 3C5FA 3T5HA 3RBDA 1SL1A 4C8KA 1K1SA 4P2HA 2F1JA 4O3SA 3MFIA 7ICQA 3KHGA 2IMWP 1NK9A 4UB4A 4EYHB 4QZFA 4I2IA 7ICPA 1BPXA 1KFDA 1ZQMA 4F91B 4J9MA 4PPXA 5DBBA 2PFNA 4RQ6A 4YR0A 4O3PA 4F5RA 5DB6A 3Q8KA 1L3TA 4G3IA 3OHAA 3G6VA 4MFCA 2P66A 4RUAA 1BPBA 5CA7A 4O9MA 4ECVA 5F9NA 4JUZA 2AGQA 1LB2B 4BGDA 4Q8EA 2RDIA 4IRKA 2VA2A 4NLKA 4XQ8A 4C8LA 2ZUBA 4EBCA 5KFYA 4JWMA 2HHTA 9ICOA 2ZJ8A 5HHIA 4F5OA 2W9BB 4FBTA 3PR4A 3M9NB 4K4IA 1NK8A 1WCNA 3H4DA 2V4QA 3HPOA 8ICQA 3AU2A 1NK6A 2C2DA 1CUKA 2BCSA 7ICHA 3IM1A 1ZQGA 5DGAA 5KFOA 8ICJA 5L9XA 5IINA 5J2HA 2JEIA 2ASDA 2IHNA 5J0XA 4MF2A 1UT8A 2BPCA 3ISDA 8ICTA 3M8RA 4ECWA 4CCHA 2XY6A 1RZTA 4UQGA 1D8LA 5BOLA 1ZQVA 1U47A 5IILA 9ICWA 2HHUA 4Z6EA 3GILA 3G6XA 4ECZA 5BPCA 4DQRA 4DO9A 4PHEA 3E2EA 4I2AA 2R8IA 8ICHA 2ZUCA 4YMNA 4DFMA 5KT5A 4QZBA 4ECRA 1QSSA 4QWBA 3Q8MA 4DLGA 5KFNA 1RYRA 4J9KA 1D9FA 1ZQTA 4RT3A 5L1KA 4PHDA 3GQCA 4DSJA 4M9NA 2KFNA 3K75D 2BQRA 3PW2A 5DQGA 1KRPA 1IM4A 3OSPA 2VA3A 3BDPA 4O5KA 2BCUA 8ICBA 4ECXA 5J0SA 3EZ5A 2FMQA 4M6WB 5CWRA 2ZTEA 1S10A 1KDHA 8ICOA 1JIHA 3C2LA 1MSWD 1N56A 4EZ9A 3Q8QB 1UA1A 2FLPA 1B43A 4F50A 3TFRA 2J6TA 4B9SA 3HP6A 5EOZA 2C2RA 1ZQJA 4NM1A 2XGPA 3V7LA 5IIJA 5KFPA 5J2EA 2ALZA 2KZMA 2FPMA 2KN7A 3EPGA 5L1IA 1RYSA 4QW8A 3UXOA 5J2IA 4F4KA 1SZPA 1MQ3A 3KHLA 4ECUA 5KFEA 4F4WA 4MEYA 3Q8RB 2XCAA 4R64A 2W9CB 2AGPA 3ISCA 5KFSA 4NM2A 1NK7A 3HX0A 4YMMA 3MR6A 4ED0A 3SV3A 1SL2A 3KTQA 3KHRA 4RQ5A 2ATLA 8ICPA 4FS1A 4RQ2A 5DBCA 1T8EA 4I2JA 2DFLA 4F5PA 4F93B 2BCVA 9ICTA 5HMMA 1Y88A 2MUTA 1L3VA 2W8LA 2AQ4A 3MR5A 2R8KA 8ICZA 4GXJA 4EZ6A 3C2MA 1H38A 1BPYA 4ECTA 1ZQOA 3RH4A 5IIMA 3Q8SB 4Q43A 1JMSA 4B9NA 1S0NA 3Q8PB 3PX0A 4Q8FA 2ZJAA 3HW8A 4DOBA 3PVXA 5HHHA 4I2GA 2M9NA 4ECYA 4IQTA 3V6JA 5KFKA 2MAXA 2PI4A 3FDSA 4RNMA 5DQHA 4RUCA 3GIKA 2HVHA 1X2IA 5KG0A 1N48A 4YXMA 9ICRA 4KLUA 9ICVA 1ZQEA 4DL4A 5J0UA 4K4GA 3PNCA 2J6SA 2RDJA 1HUOA 4DS5A 4DSKA 9ICXA 4J9PA 3QE9Y 1NJXA 5KFGA 4KLSA 1SKSA 1RXVA 2WTFA 1BPDA 3RJJA 5D4BA 4TUPA 1ZQFA 3BQ0A 1NKBA 2JZBA 4F8RA 4YN4A 1KLNA 4F4YA 1ZQBA 3NTUA 8ICWA 4KLJA 5J2CA 2ASLA 1ZQSA 3B0XA 8ICXA 9ICIA 4DF8A 1XSPA 1TKDA 3UXPA 4IR1A 1S0OA 1ZQIA 3TQ1A 1T7PA 4QW9A 3PX4A 4KLGA 4I28A 2KFZA 4PH5A 4JK1A 5KFTA 4IQUA 5D46A 2ZTCA 3GDXA 4F2SA 4PGYA 1ZQRA 4C8MA 5J2GA 4NLZA 4Q44A 4EBEA 3C2KA 1SKWA 1D8YA 1D9DA 4IRDA 2KTQA 2HW3A 5DQIA 8ICEA 4RNNA 4DSIA 1NOMA 3EW9A 4UB2A 4DFJA 1V9PA 1TK5A 4DWIA 3PW0A 1B22A 5KG2A 1C7YA 3C1YA 4BWMA 2AQ0A 3RB6A 4QZAA 2W9MA 4J9RA 5BOMA 4IQVA 4RQ1A 3PV8A 3PR5B 3BQ1A 1A76A 1JX4A 4NLGA 4O3OA 5J0PA 4B9TA 2BDPA 1ZQPA 4M47A 8ICLA 2DPJA 5J29A 9ICNA 4LZGA 3LWLA 4O3NA 4QZGA 1DOQA 3RAXA 1MC8A 2BQ3A 4ED1A 3N97B 8ICKA 4B9MA 3ZDBA 2R8GA 3MGHA 4I2CA 4YG2A 3M9OB 1ZQDA 1UA0A 7ICVA 4I2DA 3TANA 5KG3A 3MABA 3THVA 3ZDDA 5CJ7A 4RT2A 2UVUA 2KZ3A 3H40A 4TUSA 1XSNA 5IIOA 5HP4A 2UVWA 3AUOA 1TAQA 4KLTA 2FMPA 3QZ8A 4YR3A 4UAYA 4ED2A 1LV5A 4DEZA 2BR0A 9ICAA 4ECQA 2W9BA 2W8KA 1U48A 3RAQA 2UVRA 1ZQLA 3T5KA 2UVVA 9ICFA 4C8NA 1ZQKA 3PMNA 4GC6A 4ELTA 4ZH4A 4QWDA 2HHQA 7ICJA 4Z6FA 4DSLA 9ICCA 1QLNA 7ICOA 3T5LA 7ICSA 5DDYA 3T3FA 5KT4A 3UXNA 3ORYA 4P4MA 3RJIA 4M9HA 5C5JA 5CHGA 3QEAZ 1EXNA 1JN3A 5KFDA 3PX6A 1NJYA 2BGWA 3C21A 4DL2A 1Z3EB 1ZQNA 5CP2A 1ZQAA 1XO1A 2R8HA 1JXLA 3RB0A 1KFSA 1Z00B 1BPZA 1XWLA 5DB8A 1U45A 2C22A 1XU4A 3BQTA 5KG7A 1L5UA 1KTQA 5IIIA 4YMOA 4YFKA 4PGQA 4I2EA 4ED8A 3V72A 1JXEA 5J0RA 5DKWA 1ZQXA 4QWAA 3GV5B 4B9VA 4E0DA 1S76D 8ICSA 3C23A 7ICTA 1ZQCA 3TAQA 3JPOA 1XC9A 5KFZA 1CEZA 4KLLA 1KSPA 3TAPA 2AJQA 4YCXA 4KLFA 1A77A 9ICSA 3SZ2A 5KG6A 2MUTB 4R65A 4NXZA 4DL6A 5DLGA 5J2BA 3ZDAA 2NRZA 4F5QA 3UQ0A 3RBEA 5F9LA 1X9WA 7ICFA 2AGOA 5J2DA 9ICLA 3AU6A 4DSEA 1TAUA 3H8JA 4B9LA 2J6UA 3ZDCA 5KFQA 1MQ2A 8ICRA 4KN7A 5KT3A 5J2AA 4UBCA 1UT5A 4QWCA 4J9NA 4DSFA 2ZUDA 2PI5A 4FS2A 3PO5A 4BWJA 1XSLA 2HHVA 3LWMA 5DG9A 3V6HA 1ZQQA 2B21A 4R8UA 3SI8A 2BKEA 5KFCA 3JPNA 4KMUA 3GIIA 3RB4A 4C8OA 2R8JA 4O5CA 4I2BA 2A1JB 4BXOB 4BDPA 8ICMA 5KFHA 2XY5A 1DGSA 4QZIA 1BGXT 2HVIA 1HUZA 5KT7A 3MR2A 1IXRA 1TVAA 2JZBB 5KG5A 5KTQA 5EWEA 4RNOA 4UB5A 1BPEA 3MFHA 4HYKA 1ZETA 3PY8A 2KZZA 4QZ9A 3N4MB 3IHQB 4YD2A 3TARA 2P6UA 1U49A 4UB3A 5KFFA 2XGQA 4TQSA 4M2YA 2BCRA 4DOAA 2Q0ZX 4RZRA 3V6KA 1XS9D 2IA6A 1BVSA 7ICGA 4DQSA 4X5VA 9ICKA 2GWSA 4RQ4A 3LDAA 2PFPA 4IR9A 2IBKA 3K4GA 3RJHA 3ZD9A 4PHAA 4M04A 4DQIA 1ZQZA 5J2JA 1QSYA 5KFLA 3RRHA 9ICUA 4FBUA 4EEYA 4O3QA 2BQUA 4Z6CA 5DLFA 4J9OA 5KG1A 3JPPA 9ICEA 4KLMA 1T4GA 5KFWA 4P4PA 1S97A 5KG4A 3ZDEA 3KHHA 5EWFA 5IIKA 2HHWA 4IQWA 2XC9A 3H4BA 1COOA 1ZYQA 4UBBA 3C5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DG8 A;  7ICE A;  3RH5 A;  5KFB A;  4F92 B;  5J0T A;  5J0W A;  2I1Q A;  3H7I A;  4Q45 A;  4O0I A;  4DOC A;  4QWE A;  3OHB A;  4KLE A;  1RPL A;  4J9L A;  1U9L A;  4PHP A;  4ED3 A;  1TV9 A;  8ICA A;  9ICH A;  5KFJ A;  8ICN A;  1NKC A;  1ZQH A;  4MF8 A;  4DF4 A;  1ZJN A;  2V9W A;  9ICG A;  5L1L A;  5KT2 A;  3OSN A;  5KT6 A;  2V4R A;  3G6Y A;  1NK4 A;  4GXI A;  3RJE A;  3ZD8 A;  4YR2 A;  1KFT A;  2AU0 A;  3NGD A;  3JPQ A;  4DS4 A;  4YQW A;  3RR7 A;  8ICI A;  3HWT A;  2FLN A;  3MGI A;  4ELV A;  2FPL A;  4QZH A;  1NJZ A;  4LVS A;  3MBY A;  3RJG A;  5KFI A;  7ICL A;  1QSL A;  4YD1 A;  3BQ2 A;  3EWA A;  4DL3 A;  4JV1 A;  2ZTD A;  3ETL A;  2DPI A;  2NRT A;  4BXO A;  4YXJ A;  4R63 A;  7ICI A;  1ZQW A;  4F4Z A;  2IHM A;  5L1J A;  9ICB A;  4JWN A;  2ISO A;  1ZQY A;  5HNK A;  7ICR A;  4XUS A;  4TQR A;  4PGX A;  4UB1 A;  2ISP A;  2Y1I A;  3JPR A;  4DL5 A;  4KLQ A;  1SKR A;  4GXK A;  3RB3 A;  4GLX A;  3OGU A;  3M9M B;  1PZN A;  4QZ8 A;  4J9Q A;  5J2K A;  3PW5 A;  3V7K A;  7ICN A;  9ICM A;  4EBD A;  4JV2 A;  4ED7 A;  3V7J A;  1ZQU A;  4KN4 A;  5CR0 A;  3GIM A;  3RJK A;  1U4B A;  4M9L A;  1NK0 A;  4M0A A;  4B9U A;  2OWO A;  2JEJ A;  5DDM A;  3SYZ A;  2F1H A;  3UPQ A;  2XO7 A;  3PW7 A;  1KEJ A;  2PFQ A;  1S0M A;  3RH6 A;  5KFX A;  4O3R A;  7ICK A;  5KFU A;  5KFM A;  4RQ0 A;  4K4H A;  4ED6 A;  4RQ3 A;  1TK8 A;  2F1I A;  4LZD A;  5J0Y A;  2PXI A;  4DQP A;  4F4X A;  4KLD A;  3PW4 A;  2NRW A;  4KLO A;  1QTM A;  4RQ7 A;  4NY8 A;  8ICU A;  2H5X A;  5KFV A;  2VA8 A;  9ICQ A;  3EYZ A;  4XRH A;  4M9J A;  5JUM A;  5J0Q A;  1SL0 A;  1NKE A;  1T3N A;  1L3S A;  1K1Q A;  2LYH A;  2HHS A;  4DLE A;  4Z6D A;  3EPI A;  3T5J A;  3OJU A;  8ICG A;  4F2R A;  4R8U B;  1NK5 A;  7ICM A;  7ICU A;  9ICP A;  2PFO A;  4DL7 A;  8ICF A;  3GFK B;  4YP3 A;  1L3U A;  3Q8L A;  2I9G A;  2ZJ5 A;  4M6W A;  3M8S A;  4MEX A;  4QZE A;  3JPS A;  4ELU A;  3TI0 A;  4I2H A;  5D49 A;  2BPF A;  3RTV A;  1S0V A;  5TZV A;  3B0Y A;  3SV4 A;  4F3O A;  3MDA A;  3H8W A;  8ICY A;  9ICJ A;  4F5N A;  4O5E A;  3RRG A;  3QZ7 A;  3MDC A;  3RJF A;  4RU9 A;  3PML A;  5CB1 A;  2C2E A;  4GC7 A;  4YVZ A;  5J2F A;  4P4O A;  1Z00 A;  4XA5 A;  4TUQ A;  3PO4 A;  4QZC A;  4RPX A;  4KLH A;  2VAN A;  3ISB A;  3BJY A;  1HJP A;  3C1Z A;  3HT3 A;  1ZJM A;  4I27 A;  3GIJ A;  3GV8 B;  2BPG A;  3JPT A;  4M9G A;  4RQ8 A;  1X9M A;  4KIT B;  2W9C A;  2NRV A;  3QEB Z;  2JEG A;  4MFF A;  5DB7 A;  2BCQ A;  1ARO P;  5DGB A;  4UAZ A;  2P6R A;  4DFK A;  5HML A;  4JV0 A;  1S9F A;  4I2F A;  1NJW A;  3RR8 A;  8ICV A;  4RPZ A;  2FMS A;  1TK0 A;  2FPK A;  3OJS A;  4UAW A;  2C28 A;  2HHX A;  3H8S A;  2XCP A;  2BHN A;  4DQQ A;  1S77 D;  4ECS A;  4J9S A;  4IRC A;  1RXW A;  5DG7 A;  3TFS A;  5DBA A;  3MR3 A;  2Y1J A;  3LK9 A;  1X9S A;  1WCL A;  2XY7 A;  3UQ2 A;  2JEF A;  3FYH A;  4MFA A;  5J0O A;  4FO6 A;  2ASJ A;  4I29 A;  4KLI A;  2NRX A;  4R66 A;  4DFP A;  4KTQ A;  8ICC A;  4QZD A;  4TUR A;  2FLL A;  4NLN A;  4EYI B;  2A1J A;  5EWG A;  1TFR A;  5DB9 A;  5KFA A;  5KFR A;  4RPY A;  3GV7 B;  2W9A A;  3C5F A;  3T5H A;  3RBD A;  1SL1 A;  4C8K A;  1K1S A;  4P2H A;  2F1J A;  4O3S A;  3MFI A;  7ICQ A;  3KHG A;  2IMW P;  1NK9 A;  4UB4 A;  4EYH B;  4QZF A;  4I2I A;  7ICP A;  1BPX A;  1KFD A;  1ZQM A;  4F91 B;  4J9M A;  4PPX A;  5DBB A;  2PFN A;  4RQ6 A;  4YR0 A;  4O3P A;  4F5R A;  5DB6 A;  3Q8K A;  1L3T A;  4G3I A;  3OHA A;  3G6V A;  4MFC A;  2P66 A;  4RUA A;  1BPB A;  5CA7 A;  4O9M A;  4ECV A;  5F9N A;  4JUZ A;  2AGQ A;  1LB2 B;  4BGD A;  4Q8E A;  2RDI A;  4IRK A;  2VA2 A;  4NLK A;  4XQ8 A;  4C8L A;  2ZUB A;  4EBC A;  5KFY A;  4JWM A;  2HHT A;  9ICO A;  2ZJ8 A;  5HHI A;  4F5O A;  2W9B B;  4FBT A;  3PR4 A;  3M9N B;  4K4I A;  1NK8 A;  1WCN A;  3H4D A;  2V4Q A;  3HPO A;  8ICQ A;  3AU2 A;  1NK6 A;  2C2D A;  1CUK A;  2BCS A;  7ICH A;  3IM1 A;  1ZQG A;  5DGA A;  5KFO A;  8ICJ A;  5L9X A;  5IIN A;  5J2H A;  2JEI A;  2ASD A;  2IHN A;  5J0X A;  4MF2 A;  1UT8 A;  2BPC A;  3ISD A;  8ICT A;  3M8R A;  4ECW A;  4CCH A;  2XY6 A;  1RZT A;  4UQG A;  1D8L A;  5BOL A;  1ZQV A;  1U47 A;  5IIL A;  9ICW A;  2HHU A;  4Z6E A;  3GIL A;  3G6X A;  4ECZ A;  5BPC A;  4DQR A;  4DO9 A;  4PHE A;  3E2E A;  4I2A A;  2R8I A;  8ICH A;  2ZUC A;  4YMN A;  4DFM A;  5KT5 A;  4QZB A;  4ECR A;  1QSS A;  4QWB A;  3Q8M A;  4DLG A;  5KFN A;  1RYR A;  4J9K A;  1D9F A;  1ZQT A;  4RT3 A;  5L1K A;  4PHD A;  3GQC A;  4DSJ A;  4M9N A;  2KFN A;  3K75 D;  2BQR A;  3PW2 A;  5DQG A;  1KRP A;  1IM4 A;  3OSP A;  2VA3 A;  3BDP A;  4O5K A;  2BCU A;  8ICB A;  4ECX A;  5J0S A;  3EZ5 A;  2FMQ A;  4M6W B;  5CWR A;  2ZTE A;  1S10 A;  1KDH A;  8ICO A;  1JIH A;  3C2L A;  1MSW D;  1N56 A;  4EZ9 A;  3Q8Q B;  1UA1 A;  2FLP A;  1B43 A;  4F50 A;  3TFR A;  2J6T A;  4B9S A;  3HP6 A;  5EOZ A;  2C2R A;  1ZQJ A;  4NM1 A;  2XGP A;  3V7L A;  5IIJ A;  5KFP A;  5J2E A;  2ALZ A;  2KZM A;  2FPM A;  2KN7 A;  3EPG A;  5L1I A;  1RYS A;  4QW8 A;  3UXO A;  5J2I A;  4F4K A;  1SZP A;  1MQ3 A;  3KHL A;  4ECU A;  5KFE A;  4F4W A;  4MEY A;  3Q8R B;  2XCA A;  4R64 A;  2W9C B;  2AGP A;  3ISC A;  5KFS A;  4NM2 A;  1NK7 A;  3HX0 A;  4YMM A;  3MR6 A;  4ED0 A;  3SV3 A;  1SL2 A;  3KTQ A;  3KHR A;  4RQ5 A;  2ATL A;  8ICP A;  4FS1 A;  4RQ2 A;  5DBC A;  1T8E A;  4I2J A;  2DFL A;  4F5P A;  4F93 B;  2BCV A;  9ICT A;  5HMM A;  1Y88 A;  2MUT A;  1L3V A;  2W8L A;  2AQ4 A;  3MR5 A;  2R8K A;  8ICZ A;  4GXJ A;  4EZ6 A;  3C2M A;  1H38 A;  1BPY A;  4ECT A;  1ZQO A;  3RH4 A;  5IIM A;  3Q8S B;  4Q43 A;  1JMS A;  4B9N A;  1S0N A;  3Q8P B;  3PX0 A;  4Q8F A;  2ZJA A;  3HW8 A;  4DOB A;  3PVX A;  5HHH A;  4I2G A;  2M9N A;  4ECY A;  4IQT A;  3V6J A;  5KFK A;  2MAX A;  2PI4 A;  3FDS A;  4RNM A;  5DQH A;  4RUC A;  3GIK A;  2HVH A;  1X2I A;  5KG0 A;  1N48 A;  4YXM A;  9ICR A;  4KLU A;  9ICV A;  1ZQE A;  4DL4 A;  5J0U A;  4K4G A;  3PNC A;  2J6S A;  2RDJ A;  1HUO A;  4DS5 A;  4DSK A;  9ICX A;  4J9P A;  3QE9 Y;  1NJX A;  5KFG A;  4KLS A;  1SKS A;  1RXV A;  2WTF A;  1BPD A;  3RJJ A;  5D4B A;  4TUP A;  1ZQF A;  3BQ0 A;  1NKB A;  2JZB A;  4F8R A;  4YN4 A;  1KLN A;  4F4Y A;  1ZQB A;  3NTU A;  8ICW A;  4KLJ A;  5J2C A;  2ASL A;  1ZQS A;  3B0X A;  8ICX A;  9ICI A;  4DF8 A;  1XSP A;  1TKD A;  3UXP A;  4IR1 A;  1S0O A;  1ZQI A;  3TQ1 A;  1T7P A;  4QW9 A;  3PX4 A;  4KLG A;  4I28 A;  2KFZ A;  4PH5 A;  4JK1 A;  5KFT A;  4IQU A;  5D46 A;  2ZTC A;  3GDX A;  4F2S A;  4PGY A;  1ZQR A;  4C8M A;  5J2G A;  4NLZ A;  4Q44 A;  4EBE A;  3C2K A;  1SKW A;  1D8Y A;  1D9D A;  4IRD A;  2KTQ A;  2HW3 A;  5DQI A;  8ICE A;  4RNN A;  4DSI A;  1NOM A;  3EW9 A;  4UB2 A;  4DFJ A;  1V9P A;  1TK5 A;  4DWI A;  3PW0 A;  1B22 A;  5KG2 A;  1C7Y A;  3C1Y A;  4BWM A;  2AQ0 A;  3RB6 A;  4QZA A;  2W9M A;  4J9R A;  5BOM A;  4IQV A;  4RQ1 A;  3PV8 A;  3PR5 B;  3BQ1 A;  1A76 A;  1JX4 A;  4NLG A;  4O3O A;  5J0P A;  4B9T A;  2BDP A;  1ZQP A;  4M47 A;  8ICL A;  2DPJ A;  5J29 A;  9ICN A;  4LZG A;  3LWL A;  4O3N A;  4QZG A;  1DOQ A;  3RAX A;  1MC8 A;  2BQ3 A;  4ED1 A;  3N97 B;  8ICK A;  4B9M A;  3ZDB A;  2R8G A;  3MGH A;  4I2C A;  4YG2 A;  3M9O B;  1ZQD A;  1UA0 A;  7ICV A;  4I2D A;  3TAN A;  5KG3 A;  3MAB A;  3THV A;  3ZDD A;  5CJ7 A;  4RT2 A;  2UVU A;  2KZ3 A;  3H40 A;  4TUS A;  1XSN A;  5IIO A;  5HP4 A;  2UVW A;  3AUO A;  1TAQ A;  4KLT A;  2FMP A;  3QZ8 A;  4YR3 A;  4UAY A;  4ED2 A;  1LV5 A;  4DEZ A;  2BR0 A;  9ICA A;  4ECQ A;  2W9B A;  2W8K A;  1U48 A;  3RAQ A;  2UVR A;  1ZQL A;  3T5K A;  2UVV A;  9ICF A;  4C8N A;  1ZQK A;  3PMN A;  4GC6 A;  4ELT A;  4ZH4 A;  4QWD A;  2HHQ A;  7ICJ A;  4Z6F A;  4DSL A;  9ICC A;  1QLN A;  7ICO A;  3T5L A;  7ICS A;  5DDY A;  3T3F A;  5KT4 A;  3UXN A;  3ORY A;  4P4M A;  3RJI A;  4M9H A;  5C5J A;  5CHG A;  3QEA Z;  1EXN A;  1JN3 A;  5KFD A;  3PX6 A;  1NJY A;  2BGW A;  3C21 A;  4DL2 A;  1Z3E B;  1ZQN A;  5CP2 A;  1ZQA A;  1XO1 A;  2R8H A;  1JXL A;  3RB0 A;  1KFS A;  1Z00 B;  1BPZ A;  1XWL A;  5DB8 A;  1U45 A;  2C22 A;  1XU4 A;  3BQT A;  5KG7 A;  1L5U A;  1KTQ A;  5III A;  4YMO A;  4YFK A;  4PGQ A;  4I2E A;  4ED8 A;  3V72 A;  1JXE A;  5J0R A;  5DKW A;  1ZQX A;  4QWA A;  3GV5 B;  4B9V A;  4E0D A;  1S76 D;  8ICS A;  3C23 A;  7ICT A;  1ZQC A;  3TAQ A;  3JPO A;  1XC9 A;  5KFZ A;  1CEZ A;  4KLL A;  1KSP A;  3TAP A;  2AJQ A;  4YCX A;  4KLF A;  1A77 A;  9ICS A;  3SZ2 A;  5KG6 A;  2MUT B;  4R65 A;  4NXZ A;  4DL6 A;  5DLG A;  5J2B A;  3ZDA A;  2NRZ A;  4F5Q A;  3UQ0 A;  3RBE A;  5F9L A;  1X9W A;  7ICF A;  2AGO A;  5J2D A;  9ICL A;  3AU6 A;  4DSE A;  1TAU A;  3H8J A;  4B9L A;  2J6U A;  3ZDC A;  5KFQ A;  1MQ2 A;  8ICR A;  4KN7 A;  5KT3 A;  5J2A A;  4UBC A;  1UT5 A;  4QWC A;  4J9N A;  4DSF A;  2ZUD A;  2PI5 A;  4FS2 A;  3PO5 A;  4BWJ A;  1XSL A;  2HHV A;  3LWM A;  5DG9 A;  3V6H A;  1ZQQ A;  2B21 A;  4R8U A;  3SI8 A;  2BKE A;  5KFC A;  3JPN A;  4KMU A;  3GII A;  3RB4 A;  4C8O A;  2R8J A;  4O5C A;  4I2B A;  2A1J B;  4BXO B;  4BDP A;  8ICM A;  5KFH A;  2XY5 A;  1DGS A;  4QZI A;  1BGX T;  2HVI A;  1HUZ A;  5KT7 A;  3MR2 A;  1IXR A;  1TVA A;  2JZB B;  5KG5 A;  5KTQ A;  5EWE A;  4RNO A;  4UB5 A;  1BPE A;  3MFH A;  4HYK A;  1ZET A;  3PY8 A;  2KZZ A;  4QZ9 A;  3N4M B;  3IHQ B;  4YD2 A;  3TAR A;  2P6U A;  1U49 A;  4UB3 A;  5KFF A;  2XGQ A;  4TQS A;  4M2Y A;  2BCR A;  4DOA A;  2Q0Z X;  4RZR A;  3V6K A;  1XS9 D;  2IA6 A;  1BVS A;  7ICG A;  4DQS A;  4X5V A;  9ICK A;  2GWS A;  4RQ4 A;  3LDA A;  2PFP A;  4IR9 A;  2IBK A;  3K4G A;  3RJH A;  3ZD9 A;  4PHA A;  4M04 A;  4DQI A;  1ZQZ A;  5J2J A;  1QSY A;  5KFL A;  3RRH A;  9ICU A;  4FBU A;  4EEY A;  4O3Q A;  2BQU A;  4Z6C A;  5DLF A;  4J9O A;  5KG1 A;  3JPP A;  9ICE A;  4KLM A;  1T4G A;  5KFW A;  4P4P A;  1S97 A;  5KG4 A;  3ZDE A;  3KHH A;  5EWF A;  5IIK A;  2HHW A;  4IQW A;  2XC9 A;  3H4B A;  1COO A;  1ZYQ A;  4UBB A;  3C5G A; 
#chains in the Genus database with same CATH topology
 5ALU A;  7ICE A;  1A6S A;  4QWE A;  2A1A A;  3KKA C;  4J9L A;  4PHP A;  4ED3 A;  1TAM A;  3QYP A;  4U6P A;  8ICN A;  1ZJN A;  3G6Y A;  4GXI A;  3RJE A;  1F5S A;  2K8A A;  4YR2 A;  4DS4 A;  8ICI A;  2W3R A;  3MBY A;  5KFI A;  7ICL A;  2AHO B;  3SQI A;  3EWA A;  2ZTD A;  3ETL A;  2NRT A;  4F4Z A;  2ISO A;  2W11 A;  5ALP A;  1ZQ1 C;  5AKI A;  4DL5 A;  4KLQ A;  1SKR A;  1J97 A;  2MRL A;  5A0L A;  3OGU A;  3V7K A;  3HKZ C;  7ICN A;  2OWO A;  2JEJ A;  2F1H A;  3PW7 A;  1SZH A;  7ICK A;  3PST A;  3F2B A;  1RG6 A;  4RQ3 A;  5J0Y A;  1N2X A;  2KEY A;  4NY8 A;  2H5X A;  4M9J A;  4XRH A;  1T3N A;  4NL9 C;  3K1Z A;  2LYH A;  3U26 A;  5ALV A;  3T5J A;  3KZX A;  1NK5 A;  7ICM A;  3MGV A;  4DL7 A;  1L3U A;  2I9G A;  5EE1 A;  3M8S A;  4I2H A;  4GFJ A;  1ZD4 A;  5TZV A;  4O5E A;  3QZ7 A;  1LVH A;  3PML A;  4JMU A;  3WU2 U;  2C2E A;  5J2F A;  1Z00 A;  4XA5 A;  3PO4 A;  1N62 A;  4UAV A;  3ISB A;  1HJP A;  1RM6 C;  3DDH A;  3JPT A;  1QQ5 A;  4KIT B;  2W9C A;  3QEB Z;  2BCQ A;  4UAZ A;  4DFK A;  4I2F A;  5ALG A;  3RR8 A;  4PZO A;  1TK0 A;  2FPK A;  3OJS A;  4C80 A;  2E5S A;  4ECS A;  2E3T A;  4QNL A;  1RXW A;  5DG7 A;  1X9S A;  1WCL A;  1OXJ A;  4MFA A;  4KLI A;  2NRX A;  4R66 A;  5ALJ A;  4QZD A;  1WWU A;  2A1J A;  5EWG A;  1TFR A;  5DB9 A;  4RPY A;  2KZM A;  3T5H A;  2EDU A;  2BZF A;  3RBD A;  4C8K A;  1K1S A;  2F1J A;  3PSI A;  1BPX A;  4J9M A;  2KE7 A;  4O3P A;  4G3I A;  4RUA A;  1N63 A;  2HBJ A;  5J8Y A;  1LB2 B;  4Q8E A;  5ALX A;  2ZUB A;  9ICO A;  4F5O A;  2EAN A;  2W9B B;  2YMP A;  4MHV A;  3PR4 A;  3M9N B;  3SEI A;  4K4I A;  2Y9T A;  3HPO A;  1NK6 A;  2BCS A;  3IM1 A;  1F0M A;  5KFO A;  4F72 A;  2JR5 A;  2BPC A;  3ISD A;  5JRT A;  4CCH A;  1RZT A;  1ZQV A;  4ECZ A;  4UAS A;  4DQR A;  5AKG A;  3IDW A;  2DUY A;  3QUQ A;  2LM1 A;  4DLG A;  1RYR A;  2DBY A;  1ZQT A;  1YZ7 A;  3PW2 A;  2I6X A;  2WF5 A;  5DQG A;  2VA3 A;  3OSP A;  2BCU A;  8ICB A;  2ZIX B;  1PK3 A;  1S10 A;  4B6J A;  3H0M B;  2VIX A;  3KZI U;  2G5I B;  4NM1 A;  1UCV A;  2XGP A;  5IIJ A;  5KFP A;  5J2E A;  3EPG A;  3AEV A;  1MQ3 A;  5KFE A;  4MEY A;  5GTI U;  1JI7 A;  1L7P A;  1LKY B;  3KTQ A;  5AM3 A;  4GIB A;  3KHR A;  1V85 A;  3AQE A;  2ATL A;  4FS1 A;  2KVC A;  5ALY A;  2DFL A;  4F5P A;  2BCV A;  4US8 A;  1BPY A;  1H38 A;  1JRO A;  3F2D A;  4B9N A;  3IV6 A;  3BZK A;  2IOH A;  4I2G A;  2M9N A;  5KFK A;  1X2I A;  4C4S A;  4YXM A;  3PNC A;  2RDJ A;  4DSK A;  5AK4 A;  2YTU A;  3QE9 Y;  4KLS A;  2F8L A;  5D4B A;  3BQ0 A;  3NTU A;  8ICW A;  5J2C A;  2ASL A;  2F77 X;  4CGZ A;  4IR1 A;  5KFT A;  5D46 A;  1L6N A;  2YN4 A;  5J2G A;  4NLZ A;  2JMG A;  2KTQ A;  5DQI A;  3EW9 A;  2QKQ A;  4DFJ A;  2JV3 A;  5KG2 A;  3D2Q A;  3C1Y A;  5CRX A;  2W9M A;  1J2N A;  4IQV A;  1ZD3 A;  4RQ1 A;  3PR5 B;  3RF9 A;  1ECW A;  2XID A;  4O3N A;  1DOQ A;  3NS1 A;  1MC8 A;  1X40 A;  2XI9 A;  3N97 B;  4B9M A;  3CYM A;  2F44 A;  2EH9 A;  5CJ7 A;  2F3N A;  1XSN A;  1LV5 A;  2BR0 A;  2W9B A;  4IL6 U;  1U48 A;  1ZQL A;  3T5K A;  5E79 U;  4GC6 A;  4USA A;  9ICC A;  2ZIW B;  1QLN A;  1O08 A;  3UXN A;  3ORY A;  1JN3 A;  5KFD A;  2RHF A;  2G0A A;  3C21 A;  1SIJ A;  4DL2 A;  3QUT A;  1XO1 A;  2KNJ A;  3RFA A;  3BQT A;  5KG7 A;  1L5U A;  1KTQ A;  4PGQ A;  1DXS A;  1GO3 F;  5ALZ A;  2HHQ A;  1DK3 A;  1ZQX A;  3GV5 B;  2QB0 B;  4E0D A;  8ICS A;  1ZQC A;  3F53 A;  3QUC A;  2K4H A;  4KLF A;  9ICS A;  5KG6 A;  2MUT B;  4DL6 A;  2NRZ A;  3UQ0 A;  1X9W A;  2ZIX A;  4DSE A;  3ZDC A;  5AKE A;  5KFQ A;  1MQ2 A;  5KT3 A;  1UT5 A;  2ZUD A;  2G5H B;  2PI5 A;  4BWJ A;  2HHV A;  5DG9 A;  2Y0S F;  2KSO B;  1T3Q A;  4R8U A;  3SI8 A;  3ALR A;  3GZF A;  3WK8 A;  4Y2J A;  4QZI A;  2HVI A;  5AIC A;  2JZB B;  2JXJ A;  4HYK A;  2KKV A;  1BPE A;  3ETR A;  3C29 A;  3N4M B;  3IHQ B;  2H3V A;  3I1Y A;  5AHX A;  1ZD5 A;  3WKE A;  1BVS A;  2XIC A;  5AM0 A;  3LDA A;  4IR9 A;  3K4G A;  4M04 A;  3AMZ A;  5ALT A;  1PK1 B;  3RRH A;  5DLF A;  4J9O A;  3QNM A;  4C0Z A;  2KHV A;  3H4B A;  1COO A;  3C5G A;  5DG8 A;  5KFB A;  5J0W A;  4O0I A;  2I1Q A;  3H7I A;  1U9L A;  1TV9 A;  3SAG A;  3QXG A;  9ICH A;  1UHU A;  1NKC A;  2V9W A;  4MF8 A;  2CN1 A;  9ICG A;  5KT2 A;  2V4R A;  4YQW A;  3RR7 A;  2HMX A;  2FLN A;  1JUD A;  3MGI A;  2FPL A;  1KKX A;  3RJG A;  1OUQ A;  1X6I A;  1ZOL A;  4YD1 A;  1SXE A;  2YB4 A;  4YXJ A;  4R63 A;  1ZQW A;  4XUS A;  2JRZ A;  4TQR A;  4PGX A;  2Z7J A;  2WFA A;  3M9M B;  4J9Q A;  5J2K A;  2WF8 A;  2W03 A;  4EBD A;  4ED7 A;  3V7J A;  5CR0 A;  5JTI A;  3RJK A;  2KJ5 A;  4M0A A;  5DDM A;  2YML A;  3SYZ A;  2RP5 A;  4O3R A;  5KFX A;  4ED6 A;  4ACO A;  2F1I A;  4LZD A;  3DV9 A;  2OM6 A;  4F4X A;  1CRX A;  2L5Y A;  1QTM A;  5KFV A;  2VA8 A;  2M0N A;  1BNP A;  2Q4T A;  5JU5 A;  1K1Q A;  1SWW A;  2HHS A;  1HIW A;  4Z6D A;  2W7P A;  3EPI A;  4ZOH C;  4Y2Q A;  2PFO A;  1FEZ A;  3Q8L A;  4MEX A;  4ELU A;  2KKP A;  3B0Y A;  3SV4 A;  8ICY A;  4F5N A;  5ALN A;  3RRG A;  3MDC A;  3WKC A;  3RJF A;  2EZX A;  5CB1 A;  4FZL A;  4GC7 A;  4P4O A;  4BX9 C;  1Z1V A;  4QZC A;  3H8M A;  2VAN A;  3BJY A;  3HT3 A;  2BPG A;  3CP8 A;  1X9M A;  2QB0 A;  1SWV A;  2LM4 A;  2CRX A;  2JEG A;  5DB7 A;  1ARO P;  3B9J A;  4BUG A;  2W43 A;  1S9F A;  4JV0 A;  4J03 A;  8ICV A;  5AM1 A;  2HHX A;  2C28 A;  2OCE A;  4DQQ A;  1S77 D;  4IRC A;  3TFS A;  2YB1 A;  5DBA A;  3BS5 B;  2Y1J A;  2XY7 A;  3FYH A;  3HIL A;  4I29 A;  4DFP A;  4KTQ A;  1BNO A;  1PVP A;  1FIQ A;  4CDG A;  4EEK A;  3N7S C;  4NLN A;  4IS7 A;  5KFA A;  5KFR A;  3GV7 B;  5AKX A;  2D6F C;  3SR6 A;  2IMW P;  2DF4 B;  4UB8 U;  7ICP A;  4I2I A;  2DKX A;  2WF7 A;  2LYB A;  4KX3 A;  5DBB A;  4AP9 A;  4F5R A;  3AL0 B;  5DB6 A;  3OHA A;  3G6V A;  2HBK A;  1BPB A;  3DEE A;  4O9M A;  4OJ6 A;  4JUZ A;  2RDI A;  4IRK A;  2HI0 A;  1ZRM A;  4XQ8 A;  4KMO B;  4EBC A;  3EUB 2;  4EX7 A;  5KNI A;  2GH1 A;  2V4Q A;  8ICQ A;  1CUK A;  7ICH A;  8ICJ A;  3H0R B;  2JEI A;  8ICT A;  3M8R A;  1D8L A;  5BOL A;  3G6X A;  5BPC A;  3E2E A;  4I2A A;  2EAO A;  2R8I A;  1QSS A;  4QWB A;  1S8O A;  3WKB A;  4DSJ A;  4RT3 A;  4PHD A;  2RLT A;  1XNS A;  3K75 D;  1HEK A;  1RQN A;  1WYG A;  3TAD C;  4O5K A;  5J0S A;  4Y2R A;  3EZ5 A;  3SD7 A;  2FMQ A;  4M6W B;  3I76 A;  2FE9 A;  8ICO A;  1JIH A;  4FE3 A;  3C2L A;  3AQF A;  2D3D A;  3Q8Q B;  1UA1 A;  1B43 A;  4F50 A;  5ALR A;  3TFR A;  1SXD A;  4OD0 A;  3V7L A;  2ALZ A;  1RYS A;  2DL0 A;  4ECU A;  5B5E U;  3UMC A;  3ISC A;  4NM2 A;  1F44 A;  3TKA A;  4ED0 A;  3MR6 A;  1SL2 A;  2Y9U A;  4RQ2 A;  1COK A;  5DBC A;  2KP7 A;  2G08 A;  1CI4 A;  2O6K A;  5GTH U;  3IG5 A;  1L3V A;  2AQ4 A;  8ICZ A;  3MR5 A;  1NZB A;  1VDV A;  1ZQO A;  5AK5 A;  3I28 A;  3Q8S B;  1JMS A;  1L8O A;  1RDF A;  1S0N A;  3PX0 A;  4Q8F A;  3HW8 A;  3PVX A;  1N5X A;  1L7O A;  5H2F U;  4NV0 A;  3V6J A;  4IQT A;  2KD1 A;  2EAP A;  4RNM A;  3GIK A;  9ICR A;  1N48 A;  9ICV A;  5J0U A;  1Q8K A;  4K4G A;  2J6S A;  5C0Y A;  5EE3 A;  4DS5 A;  9ICX A;  1NJX A;  1SKS A;  1N60 A;  3RJJ A;  4TUP A;  2I5H A;  1NKB A;  1RYU A;  4FZN A;  4F4Y A;  1KLN A;  2ZIU B;  8ICX A;  2ZIV A;  1ZQS A;  3QU9 A;  3QU5 A;  3AN1 A;  3UXP A;  1S0O A;  1NI3 A;  3VC8 A;  3TQ1 A;  1T7P A;  5AI4 A;  2ZTC A;  1N61 A;  1MA7 A;  4F2S A;  3BS5 A;  3C2K A;  1D8Y A;  4UAU A;  2KOB A;  1Z19 A;  4DSI A;  1TK5 A;  4BWM A;  3RB6 A;  2OXO A;  4J9R A;  5BOM A;  3PV8 A;  2LMR A;  1JX4 A;  4B9T A;  4M47 A;  5J29 A;  4LZG A;  4QZG A;  2BQ3 A;  8ICK A;  1M6Y A;  2R8G A;  4I2C A;  5AI8 A;  5AIA A;  3ZDD A;  2KZ3 A;  3H40 A;  5HP4 A;  2OHF A;  2UVW A;  1B4F A;  2W3S A;  2KHQ A;  3QZ8 A;  9ICA A;  3FM9 A;  4DEZ A;  1J2M A;  4PZN A;  3RAQ A;  2UVR A;  2UVV A;  4ELT A;  4ZH4 A;  1L8L A;  4QWD A;  7ICJ A;  4Z6F A;  2B0C A;  5KL8 B;  7ICS A;  4KLT A;  4U7C A;  2MU2 A;  1Z1B A;  2K8B B;  3M6K A;  1NJY A;  2BGW A;  4FZM A;  1Z3E B;  2Y0S C;  5AI9 A;  1JXL A;  5AKL A;  1KFS A;  1BPZ A;  1U45 A;  1XU4 A;  5ALL A;  2NYV A;  4Y2V A;  4B9V A;  2VJ4 A;  5ALO A;  3C23 A;  7ICT A;  3JPO A;  2DKZ A;  1CEZ A;  1A77 A;  5DLG A;  4NWI A;  5J2B A;  3ZDA A;  3HKZ F;  3RBE A;  5F9L A;  2RQ5 A;  5J2D A;  9ICL A;  3CW2 C;  8ICR A;  4KN7 A;  5FP0 A;  4UBC A;  4J9N A;  1ZQQ A;  2B21 A;  2A19 A;  2BKE A;  3RB4 A;  3JPN A;  4KMU A;  4C8O A;  2LBO A;  4I2B A;  4BXO B;  4BDP A;  8ICM A;  2XY5 A;  1DGS A;  4OO1 J;  3HRD D;  1TVA A;  5KG5 A;  3MFH A;  4RNO A;  3PY8 A;  1ZET A;  2KZZ A;  1UQV A;  4QZ9 A;  2P35 A;  4TQS A;  4DOA A;  2Q0Z X;  4RZR A;  3V6K A;  3A0B U;  4DQS A;  3KBB A;  1Z4N A;  4X5V A;  2PFP A;  2IBK A;  2JH1 A;  4PHA A;  3D2N A;  2HOQ A;  5J2J A;  2PMZ F;  3IRU A;  1JRP A;  1X66 A;  9ICU A;  2VJ5 A;  4FFD A;  4O3Q A;  2BQU A;  5KG1 A;  3JPP A;  4O3M A;  2ZXH A;  3KHH A;  2HHW A;  4IQW A;  1ZYQ A;  4OJO A;  4KX5 A;  3RH5 A;  1YT3 A;  1TE2 A;  1V97 A;  4F92 B;  5J0T A;  4Q45 A;  4DOC A;  2OEH A;  3OHB A;  4CE6 A;  4KLE A;  1RPL A;  1ZQH A;  4NLB A;  3OSN A;  5KT6 A;  1NK4 A;  2HSZ A;  3ZD8 A;  2AU0 A;  3NGD A;  3JPQ A;  2IOF K;  3VCB A;  4ELV A;  4QZH A;  1NJZ A;  4P0Q B;  4LVS A;  4Y2X A;  2FJ6 A;  1QSL A;  4DL3 A;  3ICX A;  2DPI A;  2F76 X;  7ICI A;  5L1J A;  1ZQY A;  5HNK A;  4UB1 A;  2Y1I A;  4EEL A;  3JPR A;  4GLX A;  2LI6 A;  1PZN A;  4QZ8 A;  3PW5 A;  5ALQ A;  3SAH A;  4JV2 A;  3GIM A;  4M9L A;  1U4B A;  1NK0 A;  3UPQ A;  2XO7 A;  1KEJ A;  2PFQ A;  3RH6 A;  4Y2T A;  5KFU A;  4K4H A;  1TK8 A;  5ALM A;  3F2C A;  3PW4 A;  2NRW A;  4KLO A;  1DK2 A;  9ICQ A;  2DWQ A;  3EYZ A;  5JUM A;  1SL0 A;  1NKE A;  4EEN A;  1WUD A;  5J8Y C;  3E58 A;  3OJU A;  8ICG A;  2A3V A;  8ICF A;  1IIP A;  3GFK B;  2CPR A;  4QZE A;  3TI0 A;  1SV4 A;  5D49 A;  3RTV A;  1S0V A;  3IG8 A;  3KKA A;  3MDA A;  2KIV A;  3H8W A;  5AK6 A;  5TIS U;  4RU9 A;  3A0H U;  4YVZ A;  4TUQ A;  5EE9 A;  4UW9 A;  4C7Y A;  4I27 A;  4M9G A;  1D8B A;  2WF9 A;  2GOL A;  2KMD A;  2QAR B;  4Y2P A;  1X6J A;  4Y2Y A;  5DGB A;  1JAL A;  2PKE A;  5AM5 A;  2P6R A;  1LKY A;  1NJW A;  2FMS A;  4UAW A;  3H8S A;  2XCP A;  2BHN A;  3OPX A;  3OTQ A;  4UAT A;  3QU7 A;  3LK9 A;  1FFV A;  3UQ2 A;  2ASJ A;  4OJ5 A;  3HJE A;  4TUR A;  1XO0 A;  2FLL A;  4BXO A;  2W9A A;  4F3O A;  1ZD2 P;  7ICQ A;  3KHG A;  1ED1 A;  4UB4 A;  4QZF A;  4EYH B;  1ZQM A;  4F91 B;  3F5E A;  2XVT A;  4MFC A;  5CA7 A;  5F9N A;  2AGQ A;  4BGD A;  4CRX A;  2VA2 A;  4C8L A;  2KG5 A;  5KFY A;  5HHI A;  4ICA A;  2G07 A;  1NK8 A;  1WCN A;  2W7O A;  2H3F A;  2HOF A;  2C2D A;  2EZZ A;  1ZQG A;  5DGA A;  1B0X A;  5IIN A;  2EZY A;  4OJP A;  2ASD A;  2IHN A;  5J0X A;  1UT8 A;  1NZP A;  4C4T A;  2XY6 A;  1DRG A;  4UQG A;  3J81 j;  3ZI4 A;  4Z6E A;  8ICH A;  4DO9 A;  4PHE A;  2ZUC A;  4YMN A;  5KT5 A;  4QZB A;  3LVW A;  3Q8M A;  1D9F A;  5L1K A;  3TAC B;  4M9N A;  2YMM A;  2BQR A;  2KJ9 A;  2FI1 A;  1KRP A;  3BDP A;  4ECX A;  5CWR A;  2ZTE A;  1KDH A;  4PL1 A;  4CNQ A;  4EZ9 A;  4PJ0 U;  4C4R A;  4A8E A;  3E0F A;  1RQL A;  1Q3U A;  3HP6 A;  2C2R A;  2FDR A;  1V38 A;  1KBU A;  2K60 A;  5B66 U;  2FPM A;  2KN7 A;  2ZIW A;  4QW8 A;  3Q8R B;  2XCA A;  2W9C B;  1KL9 A;  1NK7 A;  3HX0 A;  4OCZ A;  4YMM A;  2RRD A;  2ZXI A;  4F93 B;  2DQN B;  2MUT A;  3F5A A;  4LJX A;  2W8L A;  4EZ6 A;  3C2M A;  4WJ3 B;  4ECT A;  5HR6 A;  4Q43 A;  3R9K A;  3Q8P B;  2JHD A;  3WKA A;  2MSN A;  5HHH A;  4ECY A;  2K4E A;  2KSO A;  2MAX A;  2PI4 A;  3FDS A;  3CNH A;  2HVH A;  1Z4O A;  4KLU A;  1ZQE A;  5L1M A;  5ALW A;  5KFG A;  3ED5 A;  1RXV A;  2WTF A;  4F8R A;  3NAS A;  2JZB A;  1ZQB A;  2QAR A;  4KLJ A;  3B0X A;  9ICI A;  2OYY A;  1TKD A;  4KLG A;  4QW9 A;  4PH5 A;  4JK1 A;  2HCF A;  4IQU A;  1UPH A;  1SB3 C;  4EBE A;  5AM2 A;  3MC1 A;  5AKY A;  1Q46 A;  1PK1 A;  3K1R B;  1NOM A;  4UB2 A;  1V9P A;  2DGZ A;  1C7Y A;  1NNL A;  2B6G A;  4QZA A;  1P7D A;  3QU2 A;  5AKZ A;  3WKD A;  4O3O A;  1Q3V A;  4NLG A;  8ICL A;  2DPJ A;  2QLT A;  4Y2U A;  4ED1 A;  5KL1 B;  3ZDB A;  4YG2 A;  1ZQD A;  1K5O A;  1UA0 A;  4I2D A;  1KQQ A;  3TAN A;  5KG3 A;  3THV A;  2KIW A;  2K89 A;  4AYB F;  5IIO A;  4NJ8 A;  3AUO A;  1TAQ A;  4UAY A;  2W8K A;  9ICF A;  3QUB A;  3PMN A;  2BDU A;  3KD3 A;  4DSL A;  3T5L A;  5DDY A;  3T3F A;  3RJI A;  5C5J A;  3QEA Z;  3PX6 A;  3PSF A;  4CF5 A;  5CP2 A;  1L7M A;  2WB1 F;  2E8O A;  5DB8 A;  1QQ7 A;  5III A;  4YFK A;  4YMO A;  2WHE A;  4ED8 A;  3V72 A;  1JXE A;  1S76 D;  4QWA A;  5KFZ A;  3N7R C;  4OJL A;  2AJQ A;  1N5W A;  4YCX A;  3SZ2 A;  4NXZ A;  3UMB A;  2WAQ F;  3L4P A;  3SEN A;  3AM9 A;  1WWV A;  1TAU A;  5ALE A;  5J2A A;  4DSF A;  2HBM A;  4QWC A;  3NVW A;  4US9 A;  5AKK A;  4FS2 A;  3PO5 A;  1SV0 A;  2F8K A;  3V6H A;  4RQM A;  2ZG6 A;  5KFC A;  2PMZ C;  2W04 A;  3WK7 A;  2LKY A;  5KFH A;  2AXT U;  1HUZ A;  3MR2 A;  2F2A B;  2W55 A;  4UB5 A;  3PZP A;  4YD2 A;  2EQY A;  3TAR A;  2P6U A;  2WF6 A;  2NO5 A;  2XGQ A;  4M2Y A;  2BCR A;  2IA6 A;  7ICG A;  2LPE A;  5ALD A;  9ICK A;  2EAM A;  4HAI A;  3RJH A;  2LHT A;  4DQI A;  1C20 A;  1QSY A;  4FBU A;  4BJQ A;  3N28 A;  2GO7 A;  9ICE A;  3C28 A;  1S97 A;  3ZDE A;  1DGJ A;  2XC9 A;  4C7Z A;  8ICA A;  3D6J A;  1URJ A;  5KFJ A;  3SMV A;  4DF4 A;  3NRW A;  5L1L A;  2K8C B;  4QIW F;  1KFT A;  3QX7 A;  2HOI A;  5AI0 A;  3HWT A;  5G5G A;  3BQ2 A;  2KIC A;  4JV1 A;  5AKJ A;  9ICB A;  2IHM A;  4NLC A;  4JWN A;  7ICR A;  1PVR A;  2ISP A;  4GXK A;  3RB3 A;  2JGA A;  9ICM A;  3T79 A;  1ZQU A;  2E8N A;  4KN4 A;  4CF4 A;  5KAF U;  4B9U A;  4Y2S A;  2H3Q A;  3BZC A;  2E1F A;  1S0M A;  2H3I A;  5KFM A;  2YY6 A;  2IOF A;  4RQ0 A;  2PXI A;  4DQP A;  4KLD A;  2KK0 A;  5G5H A;  8ICU A;  4RQ7 A;  4PL2 A;  5J0Q A;  1L3S A;  4DLE A;  2G09 A;  1VLB A;  3M6Z A;  4DCC A;  5ALK A;  3LVV A;  4F2R A;  4R8U B;  7ICU A;  9ICP A;  4YP3 A;  2ZJ5 A;  4M6W A;  3JPS A;  2BPF A;  5EE0 A;  4P0P B;  9ICJ A;  5ALF A;  5K4L A;  4RPX A;  4KLH A;  3WK9 A;  3C1Z A;  1ZJM A;  3GIJ A;  3GV8 B;  2HBL A;  4RQ8 A;  2NRV A;  3O0F A;  4MFF A;  1QCK A;  5HML A;  4RPZ A;  5KAI U;  3NVY A;  2LYA A;  4J9S A;  3MR3 A;  3ONN A;  2JEF A;  3UM9 A;  2YQE A;  5J0O A;  4FO6 A;  8ICC A;  5F3X B;  4EYI B;  1SGG A;  3C5F A;  1SL1 A;  4P2H A;  4O3S A;  3MFI A;  1NK9 A;  1KFD A;  4PPX A;  2PFN A;  3IP4 B;  4RQ6 A;  4YR0 A;  1FFU A;  3M7D A;  3Q8K A;  1L3T A;  2VKQ A;  2P66 A;  4ECV A;  2ZIU A;  4NLK A;  2HHT A;  4JWM A;  5ALH A;  2ZJ8 A;  3LYS A;  1QH9 A;  4FBT A;  3NVV A;  3H4D A;  3AU2 A;  1SV0 C;  2ES6 A;  1PVQ A;  3BQ7 A;  5L9X A;  5J2H A;  4QJF B;  4MF2 A;  2R18 A;  4ECW A;  5AI5 A;  9ICW A;  1U47 A;  5IIL A;  2HHU A;  3GIL A;  2CXY A;  4F71 A;  2K4I A;  5AI6 A;  4DFM A;  4ECR A;  4EX6 A;  5KFN A;  2YX8 A;  4J9K A;  3GQC A;  2KFN A;  1ZXI A;  1IM4 A;  2N1R A;  5T14 A;  2E8P A;  1MSW D;  1N56 A;  3KOO A;  5AIB A;  2E8M A;  2FLP A;  5AK3 A;  2J6T A;  4B9S A;  5EOZ A;  1ZQJ A;  2GLE A;  5L1I A;  3UXO A;  2D8C A;  5J2I A;  4F4K A;  1SZP A;  3KHL A;  4F4W A;  4R64 A;  2AGP A;  2MA1 A;  5KFS A;  3SV3 A;  4RQ5 A;  3WK5 A;  5AKH A;  3SAF A;  1QQ6 A;  8ICP A;  1KN5 A;  1T8E A;  4I2J A;  4RQN A;  9ICT A;  5HMM A;  1Y88 A;  2R8K A;  4GXJ A;  5AM4 A;  3RH4 A;  5IIM A;  2NV3 A;  2ZJA A;  4DOB A;  3N7P D;  4G9B A;  4P0P A;  2JH7 A;  2QB1 A;  1AQ6 A;  5ALI A;  5DQH A;  4RUC A;  5KG0 A;  1X42 A;  4DL4 A;  1FO4 A;  2KVS A;  3NUQ A;  1HUO A;  4J9P A;  3TAD A;  1BPD A;  1ZQF A;  4YN4 A;  5ALS A;  4DF8 A;  1XSP A;  1ZQI A;  4NL9 A;  3PX4 A;  2KFZ A;  4I28 A;  3GDX A;  4PGY A;  1ZQR A;  4C8M A;  4Q44 A;  2NO4 A;  4UB6 U;  4AYB C;  1SKW A;  2ODG A;  1D9D A;  4IRD A;  2HW3 A;  8ICE A;  1VJ5 A;  4RNN A;  4DWI A;  3PW0 A;  1B22 A;  2AQ0 A;  3BQ1 A;  5HR7 A;  1A76 A;  5J0P A;  2BDP A;  1ZQP A;  9ICN A;  3LWL A;  3RAX A;  4UAR A;  3L5K A;  2WB1 C;  2E1E A;  3MGH A;  3M9O B;  7ICV A;  3H0L B;  3MAB A;  4RT2 A;  2UVU A;  4TUS A;  3KFU F;  2KJ8 A;  2HDO A;  2FMP A;  4YR3 A;  4ED2 A;  1L7N A;  4P0Q A;  4ECQ A;  1S5L U;  2AH5 A;  4C8N A;  1ZQK A;  2WAQ C;  3BS7 A;  3NVZ A;  3UMG A;  7ICO A;  4M9H A;  5KT4 A;  4P4M A;  3GU3 A;  5CHG A;  1EXN A;  1PUZ A;  1ZQN A;  3WK4 A;  1T94 A;  1ZQA A;  1OW5 A;  2R8H A;  3RB0 A;  1Z00 B;  1XWL A;  2C22 A;  2YMQ A;  2G06 A;  4I2E A;  2ESE A;  5J0R A;  3QU4 A;  5DKW A;  1YZ6 A;  3TAQ A;  1XC9 A;  2K4P A;  4KLL A;  1KSP A;  3TAP A;  3CRX A;  4JB3 A;  3L3F X;  4R65 A;  1IV8 A;  4CF3 A;  4F5Q A;  7ICF A;  2AGO A;  3AU6 A;  3H8J A;  4B9L A;  2J6U A;  2KV2 A;  1A0P A;  1O03 A;  1XSL A;  3LWM A;  2H3Z A;  1ZRN A;  2OH2 A;  3GII A;  4O5C A;  3S6J A;  2R8J A;  1WG8 A;  2A1J B;  3M1Y A;  1BGX T;  5KT7 A;  3WK6 A;  1IXR A;  5KTQ A;  3NRZ A;  5EWE A;  2ZIV B;  3PSP A;  4IC9 A;  1U49 A;  4UB3 A;  3FC4 A;  5KFF A;  1XS9 D;  2GWS A;  4RQ4 A;  2W54 A;  3D2S A;  3ZD9 A;  4QIW C;  1KW4 A;  3IN5 A;  4DFD A;  1ZQZ A;  5CEH A;  5KFL A;  1IG6 A;  4EEY A;  1X9X A;  4Z6C A;  4KLM A;  1T4G A;  5KFW A;  4P4P A;  5KG4 A;  5EWF A;  5IIK A;  3FAH A;  4UBB A;  1MN8 A; 
#chains in the Genus database with same CATH homology
 5DG8 A;  7ICE A;  3RH5 A;  5KFB A;  4F92 B;  5J0T A;  5J0W A;  2I1Q A;  3H7I A;  4Q45 A;  4O0I A;  4DOC A;  4QWE A;  3OHB A;  4KLE A;  1RPL A;  4J9L A;  1U9L A;  4PHP A;  4ED3 A;  1TV9 A;  8ICA A;  9ICH A;  5KFJ A;  8ICN A;  1NKC A;  1ZQH A;  4MF8 A;  4DF4 A;  1ZJN A;  2V9W A;  9ICG A;  5L1L A;  5KT2 A;  3OSN A;  5KT6 A;  2V4R A;  3G6Y A;  1NK4 A;  4GXI A;  3RJE A;  3ZD8 A;  4YR2 A;  1KFT A;  2AU0 A;  3NGD A;  3JPQ A;  4DS4 A;  4YQW A;  3RR7 A;  8ICI A;  3HWT A;  2FLN A;  3MGI A;  4ELV A;  2FPL A;  4QZH A;  1NJZ A;  4LVS A;  3MBY A;  3RJG A;  5KFI A;  7ICL A;  1QSL A;  4YD1 A;  3BQ2 A;  3EWA A;  4DL3 A;  4JV1 A;  2ZTD A;  3ETL A;  2DPI A;  2NRT A;  4BXO A;  4YXJ A;  4R63 A;  7ICI A;  1ZQW A;  4F4Z A;  2IHM A;  5L1J A;  9ICB A;  4JWN A;  2ISO A;  1ZQY A;  5HNK A;  7ICR A;  4XUS A;  4TQR A;  4PGX A;  4UB1 A;  2ISP A;  2Y1I A;  3JPR A;  4DL5 A;  4KLQ A;  1SKR A;  4GXK A;  3RB3 A;  4GLX A;  3OGU A;  3M9M B;  1PZN A;  4QZ8 A;  4J9Q A;  5J2K A;  3PW5 A;  3V7K A;  7ICN A;  9ICM A;  4EBD A;  4JV2 A;  4ED7 A;  3V7J A;  1ZQU A;  4KN4 A;  5CR0 A;  3GIM A;  3RJK A;  1U4B A;  4M9L A;  1NK0 A;  4M0A A;  4B9U A;  2OWO A;  2JEJ A;  5DDM A;  3SYZ A;  2F1H A;  3UPQ A;  2XO7 A;  3PW7 A;  1KEJ A;  2PFQ A;  1S0M A;  3RH6 A;  5KFX A;  4O3R A;  7ICK A;  5KFU A;  5KFM A;  4RQ0 A;  4K4H A;  4ED6 A;  4RQ3 A;  1TK8 A;  2F1I A;  4LZD A;  5J0Y A;  2PXI A;  4DQP A;  4F4X A;  4KLD A;  3PW4 A;  2NRW A;  4KLO A;  1QTM A;  4RQ7 A;  4NY8 A;  8ICU A;  2H5X A;  5KFV A;  2VA8 A;  9ICQ A;  3EYZ A;  4XRH A;  4M9J A;  5JUM A;  5J0Q A;  1SL0 A;  1NKE A;  1T3N A;  1L3S A;  1K1Q A;  2LYH A;  2HHS A;  4DLE A;  4Z6D A;  3EPI A;  3T5J A;  3OJU A;  8ICG A;  4F2R A;  4R8U B;  1NK5 A;  7ICM A;  7ICU A;  9ICP A;  2PFO A;  4DL7 A;  8ICF A;  3GFK B;  4YP3 A;  1L3U A;  3Q8L A;  2I9G A;  2ZJ5 A;  4M6W A;  3M8S A;  4MEX A;  4QZE A;  3JPS A;  4ELU A;  3TI0 A;  4I2H A;  5D49 A;  2BPF A;  3RTV A;  1S0V A;  5TZV A;  3B0Y A;  3SV4 A;  4F3O A;  3MDA A;  3H8W A;  8ICY A;  9ICJ A;  4F5N A;  4O5E A;  3RRG A;  3QZ7 A;  3MDC A;  3RJF A;  4RU9 A;  3PML A;  5CB1 A;  2C2E A;  4GC7 A;  4YVZ A;  5J2F A;  4P4O A;  1Z00 A;  4XA5 A;  4TUQ A;  3PO4 A;  4QZC A;  4RPX A;  4KLH A;  2VAN A;  3ISB A;  3BJY A;  1HJP A;  3C1Z A;  3HT3 A;  1ZJM A;  4I27 A;  3GIJ A;  3GV8 B;  2BPG A;  3JPT A;  4M9G A;  4RQ8 A;  1X9M A;  4KIT B;  2W9C A;  2NRV A;  3QEB Z;  2JEG A;  4MFF A;  5DB7 A;  2BCQ A;  1ARO P;  5DGB A;  4UAZ A;  2P6R A;  4DFK A;  5HML A;  4JV0 A;  1S9F A;  4I2F A;  1NJW A;  3RR8 A;  8ICV A;  4RPZ A;  2FMS A;  1TK0 A;  2FPK A;  3OJS A;  4UAW A;  2C28 A;  2HHX A;  3H8S A;  2XCP A;  2BHN A;  4DQQ A;  1S77 D;  4ECS A;  4J9S A;  4IRC A;  1RXW A;  5DG7 A;  3TFS A;  5DBA A;  3MR3 A;  2Y1J A;  3LK9 A;  1X9S A;  1WCL A;  2XY7 A;  3UQ2 A;  2JEF A;  3FYH A;  4MFA A;  5J0O A;  4FO6 A;  2ASJ A;  4I29 A;  4KLI A;  2NRX A;  4R66 A;  4DFP A;  4KTQ A;  8ICC A;  4QZD A;  4TUR A;  2FLL A;  4NLN A;  4EYI B;  2A1J A;  5EWG A;  1TFR A;  5DB9 A;  5KFA A;  5KFR A;  4RPY A;  3GV7 B;  2W9A A;  3C5F A;  3T5H A;  3RBD A;  1SL1 A;  4C8K A;  1K1S A;  4P2H A;  2F1J A;  4O3S A;  3MFI A;  7ICQ A;  3KHG A;  2IMW P;  1NK9 A;  4UB4 A;  4EYH B;  4QZF A;  4I2I A;  7ICP A;  1BPX A;  1KFD A;  1ZQM A;  4F91 B;  4J9M A;  4PPX A;  5DBB A;  2PFN A;  4RQ6 A;  4YR0 A;  4O3P A;  4F5R A;  5DB6 A;  3Q8K A;  1L3T A;  4G3I A;  3OHA A;  3G6V A;  4MFC A;  2P66 A;  4RUA A;  1BPB A;  5CA7 A;  4O9M A;  4ECV A;  5F9N A;  4JUZ A;  2AGQ A;  1LB2 B;  4BGD A;  4Q8E A;  2RDI A;  4IRK A;  2VA2 A;  4NLK A;  4XQ8 A;  4C8L A;  2ZUB A;  4EBC A;  5KFY A;  4JWM A;  2HHT A;  9ICO A;  2ZJ8 A;  5HHI A;  4F5O A;  2W9B B;  4FBT A;  3PR4 A;  3M9N B;  4K4I A;  1NK8 A;  1WCN A;  3H4D A;  2V4Q A;  3HPO A;  8ICQ A;  3AU2 A;  1NK6 A;  2C2D A;  1CUK A;  2BCS A;  7ICH A;  3IM1 A;  1ZQG A;  5DGA A;  5KFO A;  8ICJ A;  5L9X A;  5IIN A;  5J2H A;  2JEI A;  2ASD A;  2IHN A;  5J0X A;  4MF2 A;  1UT8 A;  2BPC A;  3ISD A;  8ICT A;  3M8R A;  4ECW A;  4CCH A;  2XY6 A;  1RZT A;  4UQG A;  1D8L A;  5BOL A;  1ZQV A;  1U47 A;  5IIL A;  9ICW A;  2HHU A;  4Z6E A;  3GIL A;  3G6X A;  4ECZ A;  5BPC A;  4DQR A;  4DO9 A;  4PHE A;  3E2E A;  4I2A A;  2R8I A;  8ICH A;  2ZUC A;  4YMN A;  4DFM A;  5KT5 A;  4QZB A;  4ECR A;  1QSS A;  4QWB A;  3Q8M A;  4DLG A;  5KFN A;  1RYR A;  4J9K A;  1D9F A;  1ZQT A;  4RT3 A;  5L1K A;  4PHD A;  3GQC A;  4DSJ A;  4M9N A;  2KFN A;  3K75 D;  2BQR A;  3PW2 A;  5DQG A;  1KRP A;  1IM4 A;  3OSP A;  2VA3 A;  3BDP A;  4O5K A;  2BCU A;  8ICB A;  4ECX A;  5J0S A;  3EZ5 A;  2FMQ A;  4M6W B;  5CWR A;  2ZTE A;  1S10 A;  1KDH A;  8ICO A;  1JIH A;  3C2L A;  1MSW D;  1N56 A;  4EZ9 A;  3Q8Q B;  1UA1 A;  2FLP A;  1B43 A;  4F50 A;  3TFR A;  2J6T A;  4B9S A;  3HP6 A;  5EOZ A;  2C2R A;  1ZQJ A;  4NM1 A;  2XGP A;  3V7L A;  5IIJ A;  5KFP A;  5J2E A;  2ALZ A;  2KZM A;  2FPM A;  2KN7 A;  3EPG A;  5L1I A;  1RYS A;  4QW8 A;  3UXO A;  5J2I A;  4F4K A;  1SZP A;  1MQ3 A;  3KHL A;  4ECU A;  5KFE A;  4F4W A;  4MEY A;  3Q8R B;  2XCA A;  4R64 A;  2W9C B;  2AGP A;  3ISC A;  5KFS A;  4NM2 A;  1NK7 A;  3HX0 A;  4YMM A;  3MR6 A;  4ED0 A;  3SV3 A;  1SL2 A;  3KTQ A;  3KHR A;  4RQ5 A;  2ATL A;  8ICP A;  4FS1 A;  4RQ2 A;  5DBC A;  1T8E A;  4I2J A;  2DFL A;  4F5P A;  4F93 B;  2BCV A;  9ICT A;  5HMM A;  1Y88 A;  2MUT A;  1L3V A;  2W8L A;  2AQ4 A;  3MR5 A;  2R8K A;  8ICZ A;  4GXJ A;  4EZ6 A;  3C2M A;  1H38 A;  1BPY A;  4ECT A;  1ZQO A;  3RH4 A;  5IIM A;  3Q8S B;  4Q43 A;  1JMS A;  4B9N A;  1S0N A;  3Q8P B;  3PX0 A;  4Q8F A;  2ZJA A;  3HW8 A;  4DOB A;  3PVX A;  5HHH A;  4I2G A;  2M9N A;  4ECY A;  4IQT A;  3V6J A;  5KFK A;  2MAX A;  2PI4 A;  3FDS A;  4RNM A;  5DQH A;  4RUC A;  3GIK A;  2HVH A;  1X2I A;  5KG0 A;  1N48 A;  4YXM A;  9ICR A;  4KLU A;  9ICV A;  1ZQE A;  4DL4 A;  5J0U A;  4K4G A;  3PNC A;  2J6S A;  2RDJ A;  1HUO A;  4DS5 A;  4DSK A;  9ICX A;  4J9P A;  3QE9 Y;  1NJX A;  5KFG A;  4KLS A;  1SKS A;  1RXV A;  2WTF A;  1BPD A;  3RJJ A;  5D4B A;  4TUP A;  1ZQF A;  3BQ0 A;  1NKB A;  2JZB A;  4F8R A;  4YN4 A;  1KLN A;  4F4Y A;  1ZQB A;  3NTU A;  8ICW A;  4KLJ A;  5J2C A;  2ASL A;  1ZQS A;  3B0X A;  8ICX A;  9ICI A;  4DF8 A;  1XSP A;  1TKD A;  3UXP A;  4IR1 A;  1S0O A;  1ZQI A;  3TQ1 A;  1T7P A;  4QW9 A;  3PX4 A;  4KLG A;  4I28 A;  2KFZ A;  4PH5 A;  4JK1 A;  5KFT A;  4IQU A;  5D46 A;  2ZTC A;  3GDX A;  4F2S A;  4PGY A;  1ZQR A;  4C8M A;  5J2G A;  4NLZ A;  4Q44 A;  4EBE A;  3C2K A;  1SKW A;  1D8Y A;  1D9D A;  4IRD A;  2KTQ A;  2HW3 A;  5DQI A;  8ICE A;  4RNN A;  4DSI A;  1NOM A;  3EW9 A;  4UB2 A;  4DFJ A;  1V9P A;  1TK5 A;  4DWI A;  3PW0 A;  1B22 A;  5KG2 A;  1C7Y A;  3C1Y A;  4BWM A;  2AQ0 A;  3RB6 A;  4QZA A;  2W9M A;  4J9R A;  5BOM A;  4IQV A;  4RQ1 A;  3PV8 A;  3PR5 B;  3BQ1 A;  1A76 A;  1JX4 A;  4NLG A;  4O3O A;  5J0P A;  4B9T A;  2BDP A;  1ZQP A;  4M47 A;  8ICL A;  2DPJ A;  5J29 A;  9ICN A;  4LZG A;  3LWL A;  4O3N A;  4QZG A;  1DOQ A;  3RAX A;  1MC8 A;  2BQ3 A;  4ED1 A;  3N97 B;  8ICK A;  4B9M A;  3ZDB A;  2R8G A;  3MGH A;  4I2C A;  4YG2 A;  3M9O B;  1ZQD A;  1UA0 A;  7ICV A;  4I2D A;  3TAN A;  5KG3 A;  3MAB A;  3THV A;  3ZDD A;  5CJ7 A;  4RT2 A;  2UVU A;  2KZ3 A;  3H40 A;  4TUS A;  1XSN A;  5IIO A;  5HP4 A;  2UVW A;  3AUO A;  1TAQ A;  4KLT A;  2FMP A;  3QZ8 A;  4YR3 A;  4UAY A;  4ED2 A;  1LV5 A;  4DEZ A;  2BR0 A;  9ICA A;  4ECQ A;  2W9B A;  2W8K A;  1U48 A;  3RAQ A;  2UVR A;  1ZQL A;  3T5K A;  2UVV A;  9ICF A;  4C8N A;  1ZQK A;  3PMN A;  4GC6 A;  4ELT A;  4ZH4 A;  4QWD A;  2HHQ A;  7ICJ A;  4Z6F A;  4DSL A;  9ICC A;  1QLN A;  7ICO A;  3T5L A;  7ICS A;  5DDY A;  3T3F A;  5KT4 A;  3UXN A;  3ORY A;  4P4M A;  3RJI A;  4M9H A;  5C5J A;  5CHG A;  3QEA Z;  1EXN A;  1JN3 A;  5KFD A;  3PX6 A;  1NJY A;  2BGW A;  3C21 A;  4DL2 A;  1Z3E B;  1ZQN A;  5CP2 A;  1ZQA A;  1XO1 A;  2R8H A;  1JXL A;  3RB0 A;  1KFS A;  1Z00 B;  1BPZ A;  1XWL A;  5DB8 A;  1U45 A;  2C22 A;  1XU4 A;  3BQT A;  5KG7 A;  1L5U A;  1KTQ A;  5III A;  4YMO A;  4YFK A;  4PGQ A;  4I2E A;  4ED8 A;  3V72 A;  1JXE A;  5J0R A;  5DKW A;  1ZQX A;  4QWA A;  3GV5 B;  4B9V A;  4E0D A;  1S76 D;  8ICS A;  3C23 A;  7ICT A;  1ZQC A;  3TAQ A;  3JPO A;  1XC9 A;  5KFZ A;  1CEZ A;  4KLL A;  1KSP A;  3TAP A;  2AJQ A;  4YCX A;  4KLF A;  1A77 A;  9ICS A;  3SZ2 A;  5KG6 A;  2MUT B;  4R65 A;  4NXZ A;  4DL6 A;  5DLG A;  5J2B A;  3ZDA A;  2NRZ A;  4F5Q A;  3UQ0 A;  3RBE A;  5F9L A;  1X9W A;  7ICF A;  2AGO A;  5J2D A;  9ICL A;  3AU6 A;  4DSE A;  1TAU A;  3H8J A;  4B9L A;  2J6U A;  3ZDC A;  5KFQ A;  1MQ2 A;  8ICR A;  4KN7 A;  5KT3 A;  5J2A A;  4UBC A;  1UT5 A;  4QWC A;  4J9N A;  4DSF A;  2ZUD A;  2PI5 A;  4FS2 A;  3PO5 A;  4BWJ A;  1XSL A;  2HHV A;  3LWM A;  5DG9 A;  3V6H A;  1ZQQ A;  2B21 A;  4R8U A;  3SI8 A;  2BKE A;  5KFC A;  3JPN A;  4KMU A;  3GII A;  3RB4 A;  4C8O A;  2R8J A;  4O5C A;  4I2B A;  2A1J B;  4BXO B;  4BDP A;  8ICM A;  5KFH A;  2XY5 A;  1DGS A;  4QZI A;  1BGX T;  2HVI A;  1HUZ A;  5KT7 A;  3MR2 A;  1IXR A;  1TVA A;  2JZB B;  5KG5 A;  5KTQ A;  5EWE A;  4RNO A;  4UB5 A;  1BPE A;  3MFH A;  4HYK A;  1ZET A;  3PY8 A;  2KZZ A;  4QZ9 A;  3N4M B;  3IHQ B;  4YD2 A;  3TAR A;  2P6U A;  1U49 A;  4UB3 A;  5KFF A;  2XGQ A;  4TQS A;  4M2Y A;  2BCR A;  4DOA A;  2Q0Z X;  4RZR A;  3V6K A;  1XS9 D;  2IA6 A;  1BVS A;  7ICG A;  4DQS A;  4X5V A;  9ICK A;  2GWS A;  4RQ4 A;  3LDA A;  2PFP A;  4IR9 A;  2IBK A;  3K4G A;  3RJH A;  3ZD9 A;  4PHA A;  4M04 A;  4DQI A;  1ZQZ A;  5J2J A;  1QSY A;  5KFL A;  3RRH A;  9ICU A;  4FBU A;  4EEY A;  4O3Q A;  2BQU A;  4Z6C A;  5DLF A;  4J9O A;  5KG1 A;  3JPP A;  9ICE A;  4KLM A;  1T4G A;  5KFW A;  4P4P A;  1S97 A;  5KG4 A;  3ZDE A;  3KHH A;  5EWF A;  5IIK A;  2HHW A;  4IQW A;  2XC9 A;  3H4B A;  1COO A;  1ZYQ A;  4UBB A;  3C5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...