1U9LA

Structural basis for a nusa- protein n interaction
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
b'AHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation protein nusA
publication title Structural basis for the interaction of Escherichia coli NusA with protein N of phage lambda
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 22
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u9lA00
5JUMA 3KHLA 5KFJA 4XRHA 4ED7A 2R8IA 5DBCA 2XY6A 3RJKA 1U49A 1NKEA 3UXPA 3V72A 3JPRA 3LDAA 1ZYQA 1KEJA 3TQ1A 5DG9A 5KFYA 7ICIA 4QZ9A 4FBUA 4I2AA 9ICMA 1HUOA 8ICLA 3TFSA 3QEAZ 4F3OA 3THVA 4DS5A 1BPYA 3KHHA 5KFEA 1H38A 2J6SA 4O5CA 4DSIA 2KZMA 1K1SA 2I9GA 2XC9A 3UQ2A 4DL4A 7ICSA 5CR0A 5KFMA 4RUCA 4M9HA 1BPBA 1EXNA 4DF8A 3NTUA 1NK6A 3GV5B 4ED1A 4Q44A 3RB0A 9ICTA 8ICFA 8ICJA 1X2IA 3FYHA 4O3QA 4GXIA 4JWMA 4RPYA 1ZQHA 3Q8RB 4NM1A 3V7JA 4PGXA 4P4OA 5DBAA 4J9KA 3K75D 2XY5A 2DPJA 4DL3A 4PH5A 4YN4A 5CWRA 4C8NA 3PX6A 3RJJA 3E2EA 4ED8A 1ZQIA 4ED0A 4DS4A 5J2BA 3MR6A 2NRZA 1RPLA 4BXOA 2F1JA 4IR1A 4QZCA 5J2JA 3UQ0A 1UT8A 5L1JA 5CJ7A 4ECWA 1XSNA 4RZRA 4I2CA 5KFBA 5KFRA 4YR3A 3V7KA 3RTVA 4BDPA 4IQWA 1KFTA 1K1QA 1MC8A 1T4GA 9ICIA 4PHEA 4QZIA 3JPOA 5KFZA 4DQRA 4KLSA 2HHWA 4Z6FA 5J0TA 4KMUA 4J9MA 1QLNA 4MEYA 1TVAA 3RJHA 5DB7A 2W9CA 1L3TA 2JEFA 5DBBA 7ICJA 1KLNA 3N97B 2V4RA 1KFDA 5KFCA 3PW5A 2BQ3A 4NLGA 4KN7A 4R65A 4BXOB 1WCNA 5J2DA 4LVSA 4RUAA 4ECXA 1S9FA 3BJYA 4RQ3A 4J9QA 4QZAA 3QEBZ 5KG1A 1TKDA 4F92B 2BDPA 4QZHA 7ICHA 4KLMA 2FMQA 5EWGA 5L1LA 2ZUBA 4J9OA 4JWNA 2Q0ZX 5CP2A 3T5LA 3PNCA 3MABA 4DL2A 4DL6A 4P4PA 3ISCA 4GLXA 4ELUA 3QZ8A 3RB3A 3IHQB 2W9CB 1JMSA 5KG0A 2ASLA 4NY8A 8ICNA 4MF8A 4NM2A 4C8MA 5J0PA 4YR0A 2MUTA 5DG8A 5KT2A 4QZGA 1NKCA 4MFCA 2HHUA 2BCVA 9ICVA 4O3OA 4QW8A 4JV0A 1DGSA 8ICTA 3Q8SB 5KFUA 2P66A 4ECTA 5BOLA 1ZQUA 2PXIA 5DB6A 5KFNA 3OJUA 4IQTA 1XSLA 3GDXA 4O5EA 4NLZA 4I2FA 8ICCA 8ICBA 4RQ4A 8ICIA 4KLGA 3K4GA 4F5QA 4KLQA 2HW3A 3NGDA 5J0SA 4Z6EA 5J0OA 4I2JA 1TK5A 1SL0A 4J9PA 2MUTB 1WCLA 5J0YA 3MGIA 2FMSA 1CUKA 3C5GA 2W9MA 1SZPA 1XC9A 2W9AA 1ZJMA 1ZETA 4IRKA 2NRVA 1JXEA 4KN4A 4F50A 4F4KA 1QSYA 2HHVA 4F93B 4KTQA 2BPGA 2PFPA 4QWCA 4JK1A 3PX4A 2W8KA 1ZQZA 4YG2A 2C2RA 1U48A 4QWEA 2LYHA 3PO5A 3M9MB 2Y1JA 4B9MA 4DEZA 8ICMA 3GQCA 5KFFA 2FPMA 4BGDA 5KFVA 3PW0A 3PV8A 2VA3A 4QZBA 2JZBA 4GXKA 3SZ2A 1S97A 1Y88A 4DSJA 1B22A 3N4MB 1DOQA 4B9TA 1S0MA 1XU4A 4R66A 4QZ8A 1L3UA 2PFNA 3ETLA 1QSLA 1TFRA 3OSPA 5HNKA 1UA1A 4MFFA 1COOA 3BDPA 4JV2A 4LZDA 4O3NA 2C22A 1ZQTA 2FMPA 4DWIA 1RXVA 4RNMA 1T8EA 4DL7A 2JZBB 3GIKA 1IM4A 3OJSA 5J2IA 5HP4A 1CEZA 1ZQWA 4NLNA 1ZQXA 4DSEA 1SKSA 1ZQPA 3TFRA 3ISBA 8ICOA 5KG6A 3RJGA 4EZ6A 4JV1A 4KLEA 2IHNA 3Q8PB 5J2HA 2ZJ5A 3BQTA 3V6KA 4YVZA 3MR3A 7ICNA 3JPNA 2HHSA 9ICEA 4I28A 4RT2A 5DGAA 1D8LA 4FS1A 1ZQRA 5DKWA 3RRHA 1L3SA 2BCUA 4I2HA 4RQ5A 4DLGA 9ICBA 4DLEA 5L9XA 2R8HA 3G6XA 4TUSA 5IIOA 8ICKA 1S0NA 3PVXA 5KG4A 4EYIB 2NRTA 3T5KA 1T3NA 7ICVA 4O3PA 4YFKA 1RZTA 4KLUA 3SYZA 4QWAA 4FS2A 3C2LA 9ICUA 1V9PA 4KLJA 7ICRA 4TUPA 4O0IA 2ISOA 4DSLA 4DO9A 2BHNA 1X9MA 2FPLA 5J0QA 5BOMA 4J9NA 1TK8A 7ICFA 3OHAA 2ZTEA 5F9LA 4DQSA 2IA6A 1S76D 3MDAA 2C2EA 3ZD8A 5D46A 3M8SA 4RQ2A 2ATLA 4QZEA 4QWDA 1C7YA 5KG2A 3M9OB 4XQ8A 4F4ZA 4B9LA 1BPEA 4I2GA 2HHTA 5CB1A 3ORYA 5D49A 5J0RA 4RQ6A 2P6RA 9ICNA 2BQUA 2FPKA 3B0YA 4QZFA 1JX4A 1ZQJA 2FLNA 2UVRA 1LV5A 3GV7B 5HHHA 4FBTA 5KFTA 2HHQA 3LK9A 2AGPA 4ECUA 4Q45A 4O9MA 4RPXA 4B9UA 5KG3A 4RU9A 3C21A 5HHIA 9ICLA 7ICUA 1ZQNA 1PZNA 4UB1A 2BPCA 4P4MA 3H4DA 1KSPA 5J0WA 1BGXT 4RQ8A 4NXZA 4M6WA 4QWBA 4TQRA 5L1KA 5DG7A 4M9JA 4F2SA 5IIJA 1NKBA 4F91B 3JPSA 8ICEA 2OWOA 3RH4A 4TURA 4M9GA 2VANA 3HP6A 2ZUCA 3AUOA 5KFOA 2XO7A 8ICXA 8ICAA 4FO6A 3ZDCA 2F1IA 4YMNA 1ZQQA 4M0AA 4I2EA 4Q43A 4ELVA 4M9LA 5TZVA 4X5VA 8ICVA 4UAZA 2PI4A 2DPIA 5KFIA 5KTQA 9ICOA 4Z6CA 2AGQA 2C28A 3FDSA 4QZDA 2H5XA 3RAQA 4O5KA 4I27A 4RNNA 4DOCA 7ICQA 4M6WB 2F1HA 5KFDA 2XGQA 3C2KA 2XCAA 4DOAA 8ICUA 4ZH4A 4RPZA 3T5HA 3JPPA 2R8KA 2XGPA 3GIMA 5DB8A 5KFWA 4RQ7A 1U45A 1ZQFA 3EW9A 2AGOA 2DFLA 3C1YA 1ZQOA 1KTQA 4IRDA 1ZQYA 2ZUDA 3UXOA 1HUZA 5KG7A 3EZ5A 5DLGA 1TAQA 1X9SA 4DFJA 5DDYA 4M04A 4DFKA 3GILA 5KT4A 3PX0A 3C5FA 3JPQA 1KDHA 4EBDA 5J2CA 4ED2A 4F5PA 3TANA 3ISDA 1NK8A 1QSSA 9ICFA 3T5JA 3PW7A 4UBCA 1RYSA 9ICRA 4UB3A 3H4BA 2ASJA 3BQ1A 2ZTCA 5HMMA 3LWMA 2JEJA 8ICPA 4MEXA 4ECRA 4PGYA 4GXJA 4G3IA 4YCXA 5KT5A 3PY8A 4UAWA 1SKWA 4K4HA 4K4IA 2JEIA 2KTQA 8ICGA 4ECVA 3G6YA 1TAUA 2A1JA 1D9DA 4DL5A 3EWAA 4RQ1A 3LWLA 4F5OA 2HVIA 5DQHA 5BPCA 1NJXA 4UQGA 3RJIA 1L5UA 3EPGA 5CHGA 2AQ4A 3ZD9A 3M8RA 1JXLA 2NRXA 2MAXA 4MFAA 4B9VA 4RNOA 2KFNA 4EZ9A 5L1IA 3RH6A 2W8LA 4PHAA 3H8WA 1Z00A 3H8SA 3Q8KA 2C2DA 3MR5A 5DQIA 3V6JA 2J6TA 2AU0A 4DQIA 4PHPA 3Q8LA 9ICPA 2A1JB 4F4YA 5IIIA 4R8UA 4J9SA 7ICGA 2KFZA 5J0UA 3AU2A 3HPOA 4KLDA 2ZTDA 3H8JA 4YD2A 1AROP 4DFMA 3PW4A 1S0OA 2BCQA 3EYZA 4JUZA 1ZQCA 1IXRA 3C23A 3M9NB 3OHBA 2IHMA 3PW2A 3ZDAA 5DDMA 4PPXA 1Z00B 4QW9A 1JIHA 4EEYA 2V4QA 3ZDEA 4DOBA 4I2DA 3RAXA 4TUQA 4MF2A 2KN7A 4K4GA 9ICWA 2JEGA 4R8UB 2R8GA 4YMOA 2M9NA 3H40A 9ICJA 4EYHB 5IILA 1A77A 4XUSA 4M47A 7ICEA 7ICOA 4EBCA 4KLOA 3MGHA 1NJZA 2BPFA 5F9NA 4DQPA 5KT7A 3G6VA 1U4BA 5J2GA 1BPZA 2ASDA 2P6UA 2WTFA 5DB9A 7ICLA 2BKEA 3RB6A 9ICQA 4KITB 2KZZA 4RT3A 1NOMA 4KLIA 2Y1IA 3PR5B 5J29A 1T7PA 3C1ZA 4ELTA 3RB4A 1X9WA 1XWLA 4ECQA 5EOZA 4YP3A 8ICRA 1NK4A 5KFXA 4TQSA 4LZGA 1ZQBA 2J6UA 4I29A 3Q8MA 5KG5A 4YD1A 7ICKA 2ZJAA 4R63A 1RXWA 3KHRA 2RDJA 1ZJNA 1BVSA 4YXMA 1A76A 3RBEA 4O3SA 4IR9A 3SI8A 8ICWA 1TK0A 3UPQA 1RYRA 3V6HA 4GC7A 5KFSA 1S10A 2UVUA 4Q8FA 4B9SA 9ICAA 2ALZA 4F4XA 3BQ2A 2KZ3A 3B0XA 5IIKA 3MR2A 3SV4A 3RBDA 3AU6A 2BCRA 4F8RA 1ZQMA 7ICPA 5J0XA 1ZQEA 5EWFA 4NLKA 4IQVA 1S0VA 4HYKA 3OGUA 4GC6A 4YR2A 4IRCA 1KRPA 4UB2A 5KFLA 5CA7A 3HT3A 4RQ0A 2BR0A 1BPXA 1NK7A 4KLLA 4DSKA 1B43A 5KFAA 4C8LA 4IQUA 5IINA 1UA0A 1ZQLA 2IBKA 1ZQGA 4Z6DA 1D9FA 1NK5A 1KFSA 5HMLA 3BQ0A 4F5NA 2VA2A 4DF4A 2BGWA 2VA8A 4KLTA 4ECYA 4DFPA 1XS9D 2FLPA 2HHXA 5KFGA 3KTQA 4DSFA 4BWMA 5DQGA 2NRWA 4J9LA 1ZQVA 4CCHA 3V7LA 1TV9A 3PO4A 2UVVA 9ICGA 1HJPA 2PFOA 3HW8A 1U47A 5C5JA 3KHGA 2PI5A 9ICXA 4I2IA 3HX0A 1ZQAA 3ZDBA 1XSPA 3C2MA 7ICTA 8ICZA 4ECZA 2BCSA 8ICHA 2I1QA 5KFKA 3GIJA 1NK0A 4M2YA 4B9NA 3MBYA 4XA5A 4BWJA 4R64A 5D4BA 2XY7A 2V9WA 4F4WA 4F5RA 3ZDDA 5KT3A 4UAYA 1ZQKA 3HWTA 5DGBA 1U9LA 4C8KA 3JPTA 4ECSA 4YQWA 1ZQDA 4KLFA 2AQ0A 4J9RA 1MQ3A 4UBBA 9ICHA 2W9BA 2RDIA 5IIMA 2GWSA 3MDCA 1NJYA 1SL2A 5KFQA 4ED6A 9ICCA 3RR7A 3QZ7A 5J2KA 1LB2B 3Q8QB 1ZQSA 4F2RA 4DQQA 1NJWA 1JN3A 4PHDA 3H7IA 2BQRA 8ICSA 3RJEA 7ICMA 4P2HA 3RJFA 4PGQA 1SKRA 2FLLA 5KFPA 3OSNA 9ICSA 1MQ2A 3PMLA 4I2BA 4ED3A 5DLFA 2UVWA 2W9BB 1N48A 3RRGA 3UXNA 3IM1A 3GFKB 5EWEA 1N56A 3TAPA 4E0DA 3SV3A 3T3FA 3PR4A 1L3VA 1S77D 3PMNA 4M9NA 1Z3EB 1NK9A 8ICYA 5J2EA 4KLHA 3TI0A 4C8OA 4Q8EA 3TAQA 1D8YA 2B21A 4UB5A 3TARA 3QE9Y 4UB4A 4O3RA 2HVHA 1QTMA 2R8JA 1BPDA 2ZJ8A 2ISPA 3MFIA 2PFQA 2AJQA 5J2AA 3RH5A 9ICKA 5J2FA 1MSWD 8ICQA 2XCPA 1XO1A 1UT5A 4YXJA 4YMMA 3GV8B 3EPIA 4EBEA 2IMWP 3GIIA 1SL1A 3RR8A 5KT6A 5KFHA 3MFHA
chains in the Genus database with same CATH superfamily
3WKAA 1SV4A 2D8CA 3LDAA 2KSOB 2HI0A 3OPXA 7ICIA 4I2AA 4F3OA 4DS5A 1BPYA 5KFEA 4DSIA 3SEIA 1NK6A 3NTUA 4ED1A 4Q44A 1X2IA 4GXIA 4RPYA 4NM1A 2XY5A 2DPJA 4C8NA 2ZIWB 2H3QA 4BXOA 2F1JA 3CW2C 5J2JA 3UQ0A 3T79A 1BNOA 5L1JA 1XSNA 2GOLA 2E8NA 5KFBA 1MC8A 9ICIA 4PHEA 5KFZA 4DQRA 1QLNA 1IIPA 1TVAA 2E8PA 4C0ZA 2W9CA 1OXJA 7ICJA 3IDWA 5DBBA 3N97B 2V4RA 5E79U 1WCNA 5J2DA 1N61A 3PSPA 4LVSA 1S9FA 3BJYA 1CI4A 4J9QA 4QZAA 3QEBZ 1TKDA 4F92B 2BDPA 4QZHA 2FMQA 2ZUBA 3T5LA 5CP2A 4KX3A 5K4LA 4DL2A 2Y0SC 3F2DA 2F3NA 3RB3A 1T3QA 5AI0A 3IHQB 3K1ZA 4NY8A 4RQMA 4YR0A 4QZGA 2HHUA 2YTUA 5AI8A 4QW8A 1Z1VA 2DKZA 2P66A 5BOLA 1ZQUA 2PXIA 3OJUA 8ICCA 4I2FA 4KLGA 5J0OA 4I2JA 1KN5A 3H0RB 3C5GA 2FMSA 1SZPA 5JU5A 2W9AA 2EAOA 5ALSA 4F50A 4F4KA 4F93B 3ED5A 5AICA 3B9JA 3IV6A 3PX4A 2C2RA 1U48A 3WK5A 4QWEA 2Y1JA 2EDUA 8ICMA 5AHXA 3BS5B 3GQCA 2VA3A 4QZBA 4GXKA 1Y88A 2OCEA 1B22A 4Y2XA 1DOQA 1S0MA 4R66A 2E8OA 3ETLA 1QSLA 5HNKA 4JV2A 2AXTU 4O3NA 3M1YA 1KW4A 2EAMA 1J2MA 2JZBB 3GIKA 1IM4A 1ZXIA 2BDUA 3R9KA 2IHNA 1RYUA 3I76A 5J2HA 2ODGA 3V6KA 7ICNA 1SIJA 3MR3A 3JPNA 4I28A 4RT2A 1D8LA 1ZQRA 4FZLA 5DKWA 1L3SA 2BCUA 4I2HA 2R8HA 1ZD2P 5KG4A 4EYIB 4KLUA 2WF7A 1Q8KA 3C2LA 1X6JA 5F3XB 4WJ3B 4DO9A 2BHNA 2FPLA 5J0QA 4J9NA 2C2EA 3M8SA 4PL2A 4Y2VA 5GTHU 2ATLA 1BPEA 4IS7A 5CB1A 5J0RA 2P6RA 4Y2JA 4QZFA 1JX4A 5KNIA 2KICA 4FBTA 1A6SA 4OJPA 3QX7A 2AGPA 1J97A 9ICLA 1ZQNA 4P4MA 4TQRA 1BGXT 4F2SA 3N7RC 5B66U 2OWOA 5KFOA 3E58A 4FO6A 5HR7A 5AKEA 4M0AA 4M9LA 3K1RB 5TZVA 4G9BA 9ICOA 5KFIA 5KTQA 3RAQA 3F5AA 3C2KA 5AKJA 3T5HA 2R8KA 2FJ6A 2XGPA 3BQ7A 1KL9A 1ZQFA 3EW9A 2DFLA 3C1YA 4IRDA 1O03A 1TAQA 1X9SA 5DDYA 2YMPA 4PL1A 5ALJA 3PX0A 1QQ6A 3MGVA 4ED2A 1QSSA 9ICFA 3T5JA 4UBCA 1RYSA 3N7SC 2ES6A 1XNSA 3LWMA 1ZD4A 2GH1A 4MEXA 2DQNB 2A3VA 1SB3C 2H3IA 4C7YA 5CRXA 2ZIXA 5KT5A 1IV8A 4K4HA 1X6IA 2OEHA 1TAUA 3EWAA 3LWLA 1RDFA 1FEZA 5DQHA 4UQGA 2AQ4A 2NRXA 4OCZA 1VDVA 2KFNA 5AKYA 1KQQA 4PHAA 3H8SA 2C2DA 2WHEA 3MR5A 3BZKA 5ALHA 3V6JA 2J6TA 1Q46A 3PZPA 5AIAA 4NLCA 2ZTDA 4DFMA 1AROP 2QB0A 3PW4A 1IXRA 2D3DA 2NV3A 3ZDAA 5DDMA 4PPXA 1Z00B 1ZRMA 4I2DA 3S6JA 5FP0A 9ICWA 4B6JA 3L3FX 4YMOA 1A77A 4U7CA 4DQPA 3AQFA 5AM3A 5KT7A 1BPZA 2WTFA 5DB9A 9ICQA 4KITB 2KHVA 4UATA 3C1ZA 4P0QB 2B0CA 3F53A 5KFXA 4UW9A 2JR5A 4LZGA 1ZQBA 4I29A 5KG5A 2ZIUA 1RXWA 1ZJNA 1BVSA 4NV0A 5ALYA 4IR9A 1B4FA 8ICWA 1BNPA 3V6HA 5KFSA 1S10A 4Q8FA 2ALZA 1N2XA 4F4XA 3DEEA 2BZFA 2KZ3A 3MR2A 3AU6A 7ICPA 1ZQMA 4IQVA 4HYKA 3OGUA 2YN4A 1Z1BA 4RQ0A 1BPXA 1VJ5A 3FAHA 4IQUA 5IINA 1ZQLA 2IBKA 3D6JA 4F5NA 2BGWA 1PK1A 2KD1A 2FLPA 2HHXA 4DSFA 2KK0A 1ZQVA 1TV9A 9ICXA 3KHGA 2EZXA 5T14A 3TADA 7ICTA 1L7OA 4B9NA 2K4IA 1ZQKA 3WKDA 5DGBA 2FI1A 2NO4A 2QARB 1TE2A 2NYVA 2RDIA 5IIMA 1SL2A 5AI5A 4CF5A 5J2KA 1JN3A 3H7IA 2K4HA 3IRUA 3RJFA 5ALRA 3SR6A 5KFPA 3OSNA 1Z4OA 1N48A 1LVHA 5EWEA 1N56A 3KZXA 1L3VA 4RQNA 1NK9A 1VLBA 5J2EA 4EX7A 2B21A 1QQ5A 4UB4A 3MFIA 2PFQA 3I28A 3RH5A 5J2FA 1MSWD 3GV8B 2LPEA 2IMWP 1SL1A 5JUMA 3KHLA 4XRHA 2WF9A 3VC8A 4ED7A 3LVWA 3QU7A 3UXPA 5AK3A 1ZYQA 5KFYA 5DG9A 4DFDA 2NO5A 5EE3A 4FBUA 9ICMA 8ICLA 2ZXHA 1H38A 1LKYB 2WFAA 1K1SA 4M9HA 3TACB 3SD7A 3RB0A 8ICJA 3FYHA 3C29A 3Q8RB 3V7JA 1SXDA 4DL3A 1JUDA 4F72A 4YN4A 3PX6A 3E2EA 1ZQIA 4DS4A 1RPLA 4IR1A 4QZCA 2LMRA 2JV3A 4ECWA 4I2CA 5KFRA 1YZ7A 1K1QA 3JPOA 1KKXA 2HHWA 4Z6FA 5AK5A 4J9MA 4MEYA 3RJHA 1L3TA 1X66A 3AN1A 2WF5A 1KFDA 2BQ3A 4KN7A 4R65A 2KKVA 4CNQA 3H8MA 5EWGA 5L1LA 4JWNA 2KVCA 2Q0ZX 3UMGA 3BS7A 3TADC 3H0LB 2YX8A 4P4PA 3ISCA 4ELUA 3NVVA 2DBYA 8ICNA 4MF8A 1M6YA 4C8MA 5J0PA 5DG8A 1NKCA 3QU9A 4MFCA 4JV0A 2G09A 3Q8SB 5C0YA 4O5EA 2W54A 5G5HA 3AMZA 1V97A 3SAGA 1YT3A 3NGDA 4OJ6A 1SL0A 1WUDA 4NL9A 1FFVA 2MUTB 1WCLA 5J0YA 1CUKA 2W9MA 4FZNA 1ZETA 4IRKA 1QSYA 2JRZA 1ZD5A 2BPGA 2PFPA 4QWCA 4UB8U 4F71A 2W8KA 3NRZA 4QIWF 2Q4TA 3M9MB 2HSZA 4DEZA 4AYBF 1S97A 4B9TA 1XU4A 2HBJA 3O0FA 5AI6A 1TFRA 1SXEA 1COOA 3M7DA 4NJ8A 2C22A 2FMPA 4QJFB 2KIVA 2OYYA 3E0FA 4DSEA 1SKSA 3TFRA 3ETRA 3Q8PB 3FM9A 2KJ8A 2W7OA 3RRHA 4RQ5A 4DLGA 1V38A 4TUSA 8ICKA 3PVXA 3I1YA 3T5KA 2HOQA 1RZTA 5GTIU 3SYZA 4QWAA 7ICRA 4KLJA 1WWUA 3OHAA 2IA6A 3MDAA 4RQ2A 1URJA 5KG2A 2JXJA 4XQ8A 4F4ZA 3ORYA 5D49A 2QLTA 2FPKA 2BQUA 1ZQJA 5HHHA 4ECUA 4A8EA 4O9MA 5AKLA 5ALKA 2BPCA 3H4DA 2HHTA 2WAQF 4RQ8A 4NXZA 4M6WA 4QWBA 5DG7A 8ICEA 3KFUF 3JPSA 5ALFA 4TURA 1TAMA 4M9GA 3AUOA 8ICXA 1SGGA 2F1IA 1MA7A 4Q43A 3QU4A 4EENA 2PI4A 4Z6CA 2AGQA 2C28A 4QZDA 7ICQA 2JHDA 2F1HA 5KFDA 2XCAA 4DOAA 2KKPA 1UHUA 3GIMA 2YMMA 3WK9A 1ZQOA 1ZQYA 2DUYA 4NL9C 3EZ5A 5DLGA 5KT4A 3KOOA 3C5FA 3JPQA 1KDHA 5J2CA 3TANA 3KZIU 4UB3A 3H4BA 4UAVA 8ICPA 4ECRA 4G3IA 3PY8A 4UAWA 1P7DA 4K4IA 2JEIA 5A0LA 5AM0A 4ECVA 3G6YA 2A1JA 1D9DA 1Z4NA 3FC4A 5ALXA 1L5UA 3EPGA 1DRGA 1ZRNA 2A19A 2MAXA 4MFAA 4EZ9A 5AIBA 4FFDA 3IG5A 5DQIA 4PHPA 3Q8LA 5IIIA 4BUGA 4R8UA 7ICGA 5L1MA 5J0UA 3HPOA 3M6KA 3H8JA 2BCQA 4JUZA 3C23A 3PW2A 1JIHA 2V4QA 3RAXA 2JEGA 1X40A 2R8GA 4EYHB 7ICEA 4M47A 2H3FA 7ICOA 4EBCA 3MGHA 3DDHA 3M6ZA 1WG8A 2KJ9A 3ALRA 1U4BA 1ZQ1C 2P6UA 5J29A 4ELTA 3RB4A 4ECQA 4YP3A 5ALZA 8ICRA 2PMZF 1QH9A 4YD1A 4YXMA 1A76A 5AKHA 3RBEA 4P0PA 1TK0A 3UPQA 2UVUA 3B0XA 2BCRA 2G5IB 2HCFA 2KHQA 4YR2A 1KRPA 2BR0A 3QU2A 2IOHA 5EE9A 2XICA 3QNMA 1NK5A 5G5GA 2VA2A 1RG6A 2PKEA 2KV2A 2W55A 2F77X 4CRXA 2ZG6A 4BWMA 5DQGA 2NRWA 4UB6U 5B5EU 4CCHA 3PO4A 9ICGA 1HJPA 1U47A 4I2IA 1ZQAA 2GLEA 4ECZA 8ICHA 2I1QA 5KFKA 1NK0A 4M2YA 2LYBA 3MBYA 4XA5A 5D4BA 4R64A 3ZDDA 4UAYA 5TISU 5ALOA 5ALMA 4YQWA 2AQ0A 3J81j 4J9RA 3QU5A 3ICXA 3DV9A 2W9BA 2GWSA 3MDCA 1NJYA 5KFQA 1JRPA 3ZI4A 3QZ7A 4F2RA 2F8KA 4JMUA 4PGQA 1SKRA 9ICSA 5AKIA 3PMLA 4I2BA 5KL8B 2LI6A 4OJ5A 2JMGA 2ZIVA 4E0DA 3GZFA 3SAFA 1XO0A 2E1FA 8ICYA 4KLHA 3TI0A 2KSOA 4C8OA 2HBLA 3ONNA 3TARA 2R8JA 1BPDA 2ZJ8A 9ICKA 5J2AA 2W03A 3EPIA 1UT5A 1XO1A 2F8LA 3GIIA 2E1EA 3NVZA 1A0PA 3RJKA 1U49A 1N60A 4Y2PA 4Y2QA 2WB1F 4QZ9A 1HUOA 2ZIWA 3TFSA 3KHHA 4O5CA 2I9GA 1SZHA 3UQ2A 4RUCA 4DF8A 1F5SA 4IC9A 3UM9A 3GV5B 9ICTA 3RF9A 2ZXIA 4JWMA 2XIDA 1ZQHA 4PGXA 5DBAA 4J9KA 3U26A 4PH5A 3RJJA 2KMDA 5JRTA 3WKBA 3MR6A 2NRZA 1NI3A 4CF4A 1AQ6A 5AI4A 1QQ7A 5CJ7A 1D8BA 4C4TA 4YR3A 4BDPA 4IQWA 1KFTA 1T4GA 4QZIA 1DK3A 2JH7A 1SWWA 4KMUA 2VIXA 5DB7A 2JEFA 5JTIA 1KLNA 3PW5A 4BXOB 3D2QA 4RUAA 4ECXA 5ALGA 5AKGA 2EH9A 2EZYA 3UMCA 2W3SA 2K4EA 4KLMA 1DGJA 2HMXA 4J9OA 3PNCA 3OTQA 2H3VA 2R18A 3NUQA 2W9CB 1JMSA 1X9XA 5KG0A 4NWIA 2BCVA 4O3OA 1DGSA 1ZOLA 4ECTA 2DWQA 5DB6A 5KFNA 4IQTA 4NLZA 4RQ4A 3PSTA 2K8AA 1YZ6A 2HW3A 4EELA 5J0SA 2P35A 4Z6EA 3BS5A 4J9PA 2LM1A 1XC9A 2K8CB 1JXEA 5AKKA 2HHVA 2F76X 1OUQA 4KTQA 1J2NA 2I5HA 2CN1A 3CRXA 3QYPA 2FPMA 4BGDA 3PW0A 2JZBA 4DSJA 4UASA 4QZ8A 1L3UA 2PFNA 2KJ5A 3OSPA 3QUCA 4MFFA 1X42A 3BDPA 5ALDA 1ZQTA 2MSNA 5ALLA 1RXVA 1N63A 3HRDD 4RNMA 4J03A 1PVPA 1NZBA 5ALQA 3OJSA 5J2IA 3RFAA 2K4PA 4NLNA 5KG6A 4EZ6A 4JV1A 2ZJ5A 2HHSA 3WK4A 3HJEA 9ICBA 5L9XA 5EE1A 5IIOA 1S8OA 1T3NA 2KVSA 7ICVA 1F0MA 5AM1A 9ICUA 2YY6A 4TUPA 4O0IA 2ISOA 4DSLA 3D2NA 2G08A 2GO7A 1JI7A 2MA1A 1TK8A 7ICFA 1DK2A 2ZTEA 3ZD8A 5D46A 3L5KA 4QZEA 1C7YA 3M9OB 3B0YA 2FLNA 1CRXA 4QIWC 5KFTA 2HHQA 3A0BU 1O08A 2OHFA 4OO1J 4Q45A 3KBBA 4RPXA 4AYBC 5KG3A 7ICUA 3WK7A 8ICBA 1NKBA 3RH4A 2VANA 5AK4A 3HP6A 2ZUCA 2XO7A 8ICAA 3ZDCA 2E8MA 4YMNA 4I2EA 4ELVA 2KNJA 4UAZA 4C4RA 4UARA 2DPIA 3AL0B 2RP5A 4O5KA 4I27A 4DOCA 2RLTA 4ICAA 3AM9A 8ICUA 4RPZA 3JPPA 2HDOA 2LBOA 5DB8A 4GIBA 2AGOA 4FZMA 2ZUDA 3UXOA 1HUZA 1L6NA 1L7MA 4M04A 1HEKA 2EQYA 4EBDA 4F5PA 3WKCA 1SV0A 3D2SA 2ASJA 3BQ1A 2ZTCA 2JEJA 2FDRA 1L8LA 4YCXA 2W43A 1S5LU 2KTQA 8ICGA 2VJ4A 4OD0A 3PSFA 2DF4B 4RQ1A 3F5EA 4NLBA 3RJIA 5KAFU 1JXLA 4B9VA 3ZD9A 3M8RA 4RNOA 3HKZF 5L1IA 2W8LA 2ZIXB 1Z00A 3QXGA 2WAQC 4DQIA 4F4YA 5AI9A 4OJLA 4J9SA 2KFZA 4PZOA 4YD2A 3EYZA 2QB1A 3M9NB 3OHBA 2IHMA 4QW9A 4EEYA 4DOBA 5ALTA 4K4GA 2DGZA 4P0QA 2M9NA 9ICJA 5IILA 2G0AA 2QB0B 5F9NA 5J2GA 2MRLA 4KLIA 2Y1IA 3PR5B 2H3ZA 2N1RA 1T7PA 1X9WA 5EOZA 2K60A 2ZJAA 4R63A 3L4PA 2RDJA 3SI8A 1RYRA 4KMOB 4B9SA 9ICAA 2JH1A 3BQ2A 4PJ0U 4PZNA 3SV4A 3RBDA 2G06A 1S0VA 4IRCA 5CA7A 3HT3A 2ZIUB 4KLLA 1B43A 5KFAA 1ZQGA 1D9FA 2W04A 5HMLA 3BQ0A 4DF4A 3WK6A 3H0MB 2VA8A 4Y2RA 4KLTA 4ECYA 4DFPA 1XS9D 4O3MA 5KFGA 2QARA 4Y2YA 1N62A 4J9LA 1L7NA 2PI5A 1XSPA 1SV0C 2K8BB 8ICZA 3GIJA 4ZOHC 1PK1B 4F5RA 2XI9A 5KT3A 3EUB2 1MQ3A 2I6XA 4UBBA 4CF3A 9ICHA 2PMZC 4LJXA 9ICCA 3RR7A 1LB2B 3Q8QB 4DQQA 4EX6A 4C7ZA 2BQRA 3QUQA 2DL0A 1OW5A 3KKAA 3RJEA 4P2HA 2E5SA 2FLLA 3AEVA 4ED3A 2UVWA 1FFUA 3RRGA 3IM1A 3TAPA 3SV3A 3PR4A 1S77D 2EAPA 3GU3A 1COKA 2LM4A 4Q8EA 3TAQA 1D8YA 4UB5A 2HVHA 1QTMA 2AJQA 1LKYA 2EANA 2Y0SF 8ICQA 2XCPA 3RR8A 2CPRA 4ACOA 3MC1A 5KT6A 5KFHA 3MFHA 7ICLA 3NVWA 5KFJA 2OM6A 2R8IA 5DBCA 2XY6A 4OJOA 1NKEA 3V72A 3JPRA 1KEJA 3TQ1A 3TKAA 3QEAZ 3THVA 2J6SA 5ALVA 2KZMA 3IN5A 2XC9A 4DL4A 7ICSA 5CR0A 5KFMA 1BPBA 1EXNA 4Y2UA 3WU2U 8ICFA 5AM4A 4O3QA 1FO4A 4P4OA 3K75D 5CWRA 4ED8A 4ED0A 1WYGA 5J2BA 2OXOA 2Y9TA 2ESEA 2FE9A 4BJQA 4BX9C 1L7PA 1UT8A 4RZRA 1B0XA 5KL1B 3V7KA 3RTVA 5EE0A 1V85A 4KLSA 3SAHA 5J0TA 2XVTA 3UMBA 5KFCA 4NLGA 4U6PA 4RQ3A 5KG1A 7ICHA 5AK6A 3MABA 4DL6A 3BZCA 4GLXA 3QZ8A 5ALUA 2QKQA 2ASLA 4NM2A 2MUTA 1L8OA 5KT2A 9ICVA 4JB3A 2WB1C 8ICTA 5KFUA 5ALPA 1XSLA 3GDXA 2KOBA 2F2AB 8ICIA 3K4GA 4F5QA 5CEHA 1TK5A 2YMLA 3KKAC 3MGIA 4GFJA 1ZJMA 2NRVA 1FIQA 4KN4A 5ALWA 4Y2SA 5AKZA 4JK1A 1F44A 1ZQZA 3N28A 4YG2A 2LYHA 3PO5A 4B9MA 5KFFA 5KFVA 3PV8A 3SZ2A 3N4MB 2G07A 1GO3F 2YB4A 2LHTA 4US8A 1PVQA 1UA1A 4AP9A 5ALNA 2IOFK 2L5YA 4LZDA 4DWIA 1T8EA 1KBUA 1ZD3A 4DL7A 2MU2A 5HP4A 2B6GA 1CEZA 5H2FU 3QUBA 1ZQWA 2W11A 1ZQXA 4KX5A 1ZQPA 1RM6C 3ISBA 8ICOA 3RJGA 3F2CA 4KLEA 3BQTA 9ICEA 4YVZA 5DGAA 4FS1A 1PVRA 2HOIA 5ALIA 4DLEA 3G6XA 1S0NA 3KD3A 2NRTA 4O3PA 4YFKA 5AKXA 4FS2A 1V9PA 1X9MA 2DKXA 1PUZA 5BOMA 4DQSA 5F9LA 1S76D 3LVVA 4QWDA 4B9LA 4I2GA 9ICNA 2K89A 4RQ6A 2D6FC 2UVRA 1K5OA 2RQ5A 1LV5A 3GV7B 2VKQA 2YQEA 3LK9A 4B9UA 4RU9A 1NZPA 3C21A 4DCCA 5HHIA 1PZNA 2LYAA 4UB1A 1KSPA 5J0WA 4M9JA 5L1KA 4MHVA 5IIJA 4F91B 1C20A 1UPHA 3CNHA 1RQNA 3NRWA 1ED1A 1ZQQA 1UQVA 4X5VA 8ICVA 3FDSA 2H5XA 4RNNA 4M6WB 2XGQA 3QUTA 4ZH4A 2RRDA 2KEYA 4RQ7A 5KFWA 1U45A 3NS1A 1Z19A 1KTQA 5KG7A 4UAUA 4DFJA 4DFKA 3GILA 1N5WA 3ISDA 1NK8A 3WKEA 3PW7A 9ICRA 4US9A 5HMMA 3N7PD 4PGYA 4GXJA 1SKWA 2VJ5A 4Y2TA 2WF8A 2OH2A 4DL5A 5J8YA 2HVIA 3C28A 4F5OA 4HAIA 5BPCA 1NJXA 1DXSA 3PSIA 5CHGA 3RH6A 3H8WA 2AU0A 9ICPA 4QNLA 2A1JB 2EZZA 1Q3VA 5KAIU 3AU2A 4KLDA 1S0OA 1JALA 1ZQCA 2AHOB 1N5XA 3ZDEA 2WF6A 1QCKA 4TUQA 4MF2A 1Q3UA 2KN7A 2AH5A 4R8UB 1IG6A 3H40A 4XUSA 3F2BA 4KLOA 1NJZA 2BPFA 2CXYA 3CYMA 3G6VA 2ASDA 4CGZA 2BKEA 3RB6A 2KZZA 4RT3A 1NOMA 1ECWA 2LKYA 1XWLA 4FE3A 1NK4A 2KG5A 4TQSA 3A0HU 3IP4B 2J6UA 3Q8MA 7ICKA 4CDGA 3KHRA 4O3SA 2KIWA 2A1AA 2W3RA 1HIWA 4GC7A 2HBKA 5IIKA 4F8RA 3HKZC 2W7PA 3WK8A 5J0XA 1ZQEA 5EWFA 4NLKA 4GC6A 4UB2A 5KFLA 5HR6A 2E3TA 1NK7A 4DSKA 4C8LA 4P0PB 1UA0A 1UCVA 4Z6DA 1KFSA 2KP7A 2F44A 3KTQA 4USAA 2Z7JA 5AM2A 3V7LA 2UVVA 2PFOA 3HW8A 5C5JA 3HX0A 3IG8A 3ZDBA 2KE7A 3C2MA 1MN8A 2BCSA 1PK3A 3SQIA 5ALEA 2XY7A 2V9WA 4F4WA 3HWTA 2CRXA 3AQEA 1U9LA 4C8KA 2M0NA 3JPTA 4ECSA 4C80A 1ZQDA 4KLFA 2YB1A 3HILA 5J8YC 4C4SA 4CE6A 3SMVA 2HOFA 2IOFA 4ED6A 2YMQA 1ZQSA 2G5HB 1NJWA 4IL6U 4PHDA 8ICSA 7ICMA 5AM5A 1SWVA 3NASA 1MQ2A 3LYSA 3SENA 5DLFA 2W9BB 2Y9UA 3UXNA 2JGAA 3GFKB 4EEKA 3T3FA 3PMNA 4M9NA 1Z3EB 3VCBA 1RQLA 2HBMA 2RHFA 4O3RA 3QE9Y 1T94A 2O6KA 3NVYA 1JROA 2ISPA 1WWVA 1NNLA 4YXJA 4KLQA 4YMMA 4EBEA 2ZIVB 4BWJA 3Q8KA 3CP8A
chains in the Genus database with same CATH topology
5JUMA 3KHLA 5KFJA 4XRHA 4ED7A 2R8IA 5DBCA 2XY6A 3RJKA 1U49A 1NKEA 3UXPA 3V72A 3JPRA 3LDAA 1ZYQA 1KEJA 3TQ1A 5DG9A 5KFYA 7ICIA 4QZ9A 4FBUA 4I2AA 9ICMA 1HUOA 8ICLA 3TFSA 3QEAZ 4F3OA 3THVA 4DS5A 1BPYA 3KHHA 5KFEA 1H38A 2J6SA 4O5CA 4DSIA 2KZMA 1K1SA 2I9GA 2XC9A 3UQ2A 4DL4A 7ICSA 5CR0A 5KFMA 4RUCA 4M9HA 1BPBA 1EXNA 4DF8A 3NTUA 1NK6A 3GV5B 4ED1A 4Q44A 3RB0A 9ICTA 8ICFA 8ICJA 1X2IA 3FYHA 4O3QA 4GXIA 4JWMA 4RPYA 1ZQHA 3Q8RB 4NM1A 3V7JA 4PGXA 4P4OA 5DBAA 4J9KA 3K75D 2XY5A 2DPJA 4DL3A 4PH5A 4YN4A 5CWRA 4C8NA 3PX6A 3RJJA 3E2EA 4ED8A 1ZQIA 4ED0A 4DS4A 5J2BA 3MR6A 2NRZA 1RPLA 4BXOA 2F1JA 4IR1A 4QZCA 5J2JA 3UQ0A 1UT8A 5L1JA 5CJ7A 4ECWA 1XSNA 4RZRA 4I2CA 5KFBA 5KFRA 4YR3A 3V7KA 3RTVA 4BDPA 4IQWA 1KFTA 1K1QA 1MC8A 1T4GA 9ICIA 4PHEA 4QZIA 3JPOA 5KFZA 4DQRA 4KLSA 2HHWA 4Z6FA 5J0TA 4KMUA 4J9MA 1QLNA 4MEYA 1TVAA 3RJHA 5DB7A 2W9CA 1L3TA 2JEFA 5DBBA 7ICJA 1KLNA 3N97B 2V4RA 1KFDA 5KFCA 3PW5A 2BQ3A 4NLGA 4KN7A 4R65A 4BXOB 1WCNA 5J2DA 4LVSA 4RUAA 4ECXA 1S9FA 3BJYA 4RQ3A 4J9QA 4QZAA 3QEBZ 5KG1A 1TKDA 4F92B 2BDPA 4QZHA 7ICHA 4KLMA 2FMQA 5EWGA 5L1LA 2ZUBA 4J9OA 4JWNA 2Q0ZX 5CP2A 3T5LA 3PNCA 3MABA 4DL2A 4DL6A 4P4PA 3ISCA 4GLXA 4ELUA 3QZ8A 3RB3A 3IHQB 2W9CB 1JMSA 5KG0A 2ASLA 4NY8A 8ICNA 4MF8A 4NM2A 4C8MA 5J0PA 4YR0A 2MUTA 5DG8A 5KT2A 4QZGA 1NKCA 4MFCA 2HHUA 2BCVA 9ICVA 4O3OA 4QW8A 4JV0A 1DGSA 8ICTA 3Q8SB 5KFUA 2P66A 4ECTA 5BOLA 1ZQUA 2PXIA 5DB6A 5KFNA 3OJUA 4IQTA 1XSLA 3GDXA 4O5EA 4NLZA 4I2FA 8ICCA 8ICBA 4RQ4A 8ICIA 4KLGA 3K4GA 4F5QA 4KLQA 2HW3A 3NGDA 5J0SA 4Z6EA 5J0OA 4I2JA 1TK5A 1SL0A 4J9PA 2MUTB 1WCLA 5J0YA 3MGIA 2FMSA 1CUKA 3C5GA 2W9MA 1SZPA 1XC9A 2W9AA 1ZJMA 1ZETA 4IRKA 2NRVA 1JXEA 4KN4A 4F50A 4F4KA 1QSYA 2HHVA 4F93B 4KTQA 2BPGA 2PFPA 4QWCA 4JK1A 3PX4A 2W8KA 1ZQZA 4YG2A 2C2RA 1U48A 4QWEA 2LYHA 3PO5A 3M9MB 2Y1JA 4B9MA 4DEZA 8ICMA 3GQCA 5KFFA 2FPMA 4BGDA 5KFVA 3PW0A 3PV8A 2VA3A 4QZBA 2JZBA 4GXKA 3SZ2A 1S97A 1Y88A 4DSJA 1B22A 3N4MB 1DOQA 4B9TA 1S0MA 1XU4A 4R66A 4QZ8A 1L3UA 2PFNA 3ETLA 1QSLA 1TFRA 3OSPA 5HNKA 1UA1A 4MFFA 1COOA 3BDPA 4JV2A 4LZDA 4O3NA 2C22A 1ZQTA 2FMPA 4DWIA 1RXVA 4RNMA 1T8EA 4DL7A 2JZBB 3GIKA 1IM4A 3OJSA 5J2IA 5HP4A 1CEZA 1ZQWA 4NLNA 1ZQXA 4DSEA 1SKSA 1ZQPA 3TFRA 3ISBA 8ICOA 5KG6A 3RJGA 4EZ6A 4JV1A 4KLEA 2IHNA 3Q8PB 5J2HA 2ZJ5A 3BQTA 3V6KA 4YVZA 3MR3A 7ICNA 3JPNA 2HHSA 9ICEA 4I28A 4RT2A 5DGAA 1D8LA 4FS1A 1ZQRA 5DKWA 3RRHA 1L3SA 2BCUA 4I2HA 4RQ5A 4DLGA 9ICBA 4DLEA 5L9XA 2R8HA 3G6XA 4TUSA 5IIOA 8ICKA 1S0NA 3PVXA 5KG4A 4EYIB 2NRTA 3T5KA 1T3NA 7ICVA 4O3PA 4YFKA 1RZTA 4KLUA 3SYZA 4QWAA 4FS2A 3C2LA 9ICUA 1V9PA 4KLJA 7ICRA 4TUPA 4O0IA 2ISOA 4DSLA 4DO9A 2BHNA 1X9MA 2FPLA 5J0QA 5BOMA 4J9NA 1TK8A 7ICFA 3OHAA 2ZTEA 5F9LA 4DQSA 2IA6A 1S76D 3MDAA 2C2EA 3ZD8A 5D46A 3M8SA 4RQ2A 2ATLA 4QZEA 4QWDA 1C7YA 5KG2A 3M9OB 4XQ8A 4F4ZA 4B9LA 1BPEA 4I2GA 2HHTA 5CB1A 3ORYA 5D49A 5J0RA 4RQ6A 2P6RA 9ICNA 2BQUA 2FPKA 3B0YA 4QZFA 1JX4A 1ZQJA 2FLNA 2UVRA 1LV5A 3GV7B 5HHHA 4FBTA 5KFTA 2HHQA 3LK9A 2AGPA 4ECUA 4Q45A 4O9MA 4RPXA 4B9UA 5KG3A 4RU9A 3C21A 5HHIA 9ICLA 7ICUA 1ZQNA 1PZNA 4UB1A 2BPCA 4P4MA 3H4DA 1KSPA 5J0WA 1BGXT 4RQ8A 4NXZA 4M6WA 4QWBA 4TQRA 5L1KA 5DG7A 4M9JA 4F2SA 5IIJA 1NKBA 4F91B 3JPSA 8ICEA 2OWOA 3RH4A 4TURA 4M9GA 2VANA 3HP6A 2ZUCA 3AUOA 5KFOA 2XO7A 8ICXA 8ICAA 4FO6A 3ZDCA 2F1IA 4YMNA 1ZQQA 4M0AA 4I2EA 4Q43A 4ELVA 4M9LA 5TZVA 4X5VA 8ICVA 4UAZA 2PI4A 2DPIA 5KFIA 5KTQA 9ICOA 4Z6CA 2AGQA 2C28A 3FDSA 4QZDA 2H5XA 3RAQA 4O5KA 4I27A 4RNNA 4DOCA 7ICQA 4M6WB 2F1HA 5KFDA 2XGQA 3C2KA 2XCAA 4DOAA 8ICUA 4ZH4A 4RPZA 3T5HA 3JPPA 2R8KA 2XGPA 3GIMA 5DB8A 5KFWA 4RQ7A 1U45A 1ZQFA 3EW9A 2AGOA 2DFLA 3C1YA 1ZQOA 1KTQA 4IRDA 1ZQYA 2ZUDA 3UXOA 1HUZA 5KG7A 3EZ5A 5DLGA 1TAQA 1X9SA 4DFJA 5DDYA 4M04A 4DFKA 3GILA 5KT4A 3PX0A 3C5FA 3JPQA 1KDHA 4EBDA 5J2CA 4ED2A 4F5PA 3TANA 3ISDA 1NK8A 1QSSA 9ICFA 3T5JA 3PW7A 4UBCA 1RYSA 9ICRA 4UB3A 3H4BA 2ASJA 3BQ1A 2ZTCA 5HMMA 3LWMA 2JEJA 8ICPA 4MEXA 4ECRA 4PGYA 4GXJA 4G3IA 4YCXA 5KT5A 3PY8A 4UAWA 1SKWA 4K4HA 4K4IA 2JEIA 2KTQA 8ICGA 4ECVA 3G6YA 1TAUA 2A1JA 1D9DA 4DL5A 3EWAA 4RQ1A 3LWLA 4F5OA 2HVIA 5DQHA 5BPCA 1NJXA 4UQGA 3RJIA 1L5UA 3EPGA 5CHGA 2AQ4A 3ZD9A 3M8RA 1JXLA 2NRXA 2MAXA 4MFAA 4B9VA 4RNOA 2KFNA 4EZ9A 5L1IA 3RH6A 2W8LA 4PHAA 3H8WA 1Z00A 3H8SA 3Q8KA 2C2DA 3MR5A 5DQIA 3V6JA 2J6TA 2AU0A 4DQIA 4PHPA 3Q8LA 9ICPA 2A1JB 4F4YA 5IIIA 4R8UA 4J9SA 7ICGA 2KFZA 5J0UA 3AU2A 3HPOA 4KLDA 2ZTDA 3H8JA 4YD2A 1AROP 4DFMA 3PW4A 1S0OA 2BCQA 3EYZA 4JUZA 1ZQCA 1IXRA 3C23A 3M9NB 3OHBA 2IHMA 3PW2A 3ZDAA 5DDMA 4PPXA 1Z00B 4QW9A 1JIHA 4EEYA 2V4QA 3ZDEA 4DOBA 4I2DA 3RAXA 4TUQA 4MF2A 2KN7A 4K4GA 9ICWA 2JEGA 4R8UB 2R8GA 4YMOA 2M9NA 3H40A 9ICJA 4EYHB 5IILA 1A77A 4XUSA 4M47A 7ICEA 7ICOA 4EBCA 4KLOA 3MGHA 1NJZA 2BPFA 5F9NA 4DQPA 5KT7A 3G6VA 1U4BA 5J2GA 1BPZA 2ASDA 2P6UA 2WTFA 5DB9A 7ICLA 2BKEA 3RB6A 9ICQA 4KITB 2KZZA 4RT3A 1NOMA 4KLIA 2Y1IA 3PR5B 5J29A 1T7PA 3C1ZA 4ELTA 3RB4A 1X9WA 1XWLA 4ECQA 5EOZA 4YP3A 8ICRA 1NK4A 5KFXA 4TQSA 4LZGA 1ZQBA 2J6UA 4I29A 3Q8MA 5KG5A 4YD1A 7ICKA 2ZJAA 4R63A 1RXWA 3KHRA 2RDJA 1ZJNA 1BVSA 4YXMA 1A76A 3RBEA 4O3SA 4IR9A 3SI8A 8ICWA 1TK0A 3UPQA 1RYRA 3V6HA 4GC7A 5KFSA 1S10A 2UVUA 4Q8FA 4B9SA 9ICAA 2ALZA 4F4XA 3BQ2A 2KZ3A 3B0XA 5IIKA 3MR2A 3SV4A 3RBDA 3AU6A 2BCRA 4F8RA 1ZQMA 7ICPA 5J0XA 1ZQEA 5EWFA 4NLKA 4IQVA 1S0VA 4HYKA 3OGUA 4GC6A 4YR2A 4IRCA 1KRPA 4UB2A 5KFLA 5CA7A 3HT3A 4RQ0A 2BR0A 1BPXA 1NK7A 4KLLA 4DSKA 1B43A 5KFAA 4C8LA 4IQUA 5IINA 1UA0A 1ZQLA 2IBKA 1ZQGA 4Z6DA 1D9FA 1NK5A 1KFSA 5HMLA 3BQ0A 4F5NA 2VA2A 4DF4A 2BGWA 2VA8A 4KLTA 4ECYA 4DFPA 1XS9D 2FLPA 2HHXA 5KFGA 3KTQA 4DSFA 4BWMA 5DQGA 2NRWA 4J9LA 1ZQVA 4CCHA 3V7LA 1TV9A 3PO4A 2UVVA 9ICGA 1HJPA 2PFOA 3HW8A 1U47A 5C5JA 3KHGA 2PI5A 9ICXA 4I2IA 3HX0A 1ZQAA 3ZDBA 1XSPA 3C2MA 7ICTA 8ICZA 4ECZA 2BCSA 8ICHA 2I1QA 5KFKA 3GIJA 1NK0A 4M2YA 4B9NA 3MBYA 4XA5A 4BWJA 4R64A 5D4BA 2XY7A 2V9WA 4F4WA 4F5RA 3ZDDA 5KT3A 4UAYA 1ZQKA 3HWTA 5DGBA 1U9LA 4C8KA 3JPTA 4ECSA 4YQWA 1ZQDA 4KLFA 2AQ0A 4J9RA 1MQ3A 4UBBA 9ICHA 2W9BA 2RDIA 5IIMA 2GWSA 3MDCA 1NJYA 1SL2A 5KFQA 4ED6A 9ICCA 3RR7A 3QZ7A 5J2KA 1LB2B 3Q8QB 1ZQSA 4F2RA 4DQQA 1NJWA 1JN3A 4PHDA 3H7IA 2BQRA 8ICSA 3RJEA 7ICMA 4P2HA 3RJFA 4PGQA 1SKRA 2FLLA 5KFPA 3OSNA 9ICSA 1MQ2A 3PMLA 4I2BA 4ED3A 5DLFA 2UVWA 2W9BB 1N48A 3RRGA 3UXNA 3IM1A 3GFKB 5EWEA 1N56A 3TAPA 4E0DA 3SV3A 3T3FA 3PR4A 1L3VA 1S77D 3PMNA 4M9NA 1Z3EB 1NK9A 8ICYA 5J2EA 4KLHA 3TI0A 4C8OA 4Q8EA 3TAQA 1D8YA 2B21A 4UB5A 3TARA 3QE9Y 4UB4A 4O3RA 2HVHA 1QTMA 2R8JA 1BPDA 2ZJ8A 2ISPA 3MFIA 2PFQA 2AJQA 5J2AA 3RH5A 9ICKA 5J2FA 1MSWD 8ICQA 2XCPA 1XO1A 1UT5A 4YXJA 4YMMA 3GV8B 3EPIA 4EBEA 2IMWP 3GIIA 1SL1A 3RR8A 5KT6A 5KFHA 3MFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JUM A;  3KHL A;  5KFJ A;  4XRH A;  4ED7 A;  2R8I A;  5DBC A;  2XY6 A;  3RJK A;  1U49 A;  1NKE A;  3UXP A;  3V72 A;  3JPR A;  3LDA A;  1ZYQ A;  1KEJ A;  3TQ1 A;  5DG9 A;  5KFY A;  7ICI A;  4QZ9 A;  4FBU A;  4I2A A;  9ICM A;  1HUO A;  8ICL A;  3TFS A;  3QEA Z;  4F3O A;  3THV A;  4DS5 A;  1BPY A;  3KHH A;  5KFE A;  1H38 A;  2J6S A;  4O5C A;  4DSI A;  2KZM A;  1K1S A;  2I9G A;  2XC9 A;  3UQ2 A;  4DL4 A;  7ICS A;  5CR0 A;  5KFM A;  4RUC A;  4M9H A;  1BPB A;  1EXN A;  4DF8 A;  3NTU A;  1NK6 A;  3GV5 B;  4ED1 A;  4Q44 A;  3RB0 A;  9ICT A;  8ICF A;  8ICJ A;  1X2I A;  3FYH A;  4O3Q A;  4GXI A;  4JWM A;  4RPY A;  1ZQH A;  3Q8R B;  4NM1 A;  3V7J A;  4PGX A;  4P4O A;  5DBA A;  4J9K A;  3K75 D;  2XY5 A;  2DPJ A;  4DL3 A;  4PH5 A;  4YN4 A;  5CWR A;  4C8N A;  3PX6 A;  3RJJ A;  3E2E A;  4ED8 A;  1ZQI A;  4ED0 A;  4DS4 A;  5J2B A;  3MR6 A;  2NRZ A;  1RPL A;  4BXO A;  2F1J A;  4IR1 A;  4QZC A;  5J2J A;  3UQ0 A;  1UT8 A;  5L1J A;  5CJ7 A;  4ECW A;  1XSN A;  4RZR A;  4I2C A;  5KFB A;  5KFR A;  4YR3 A;  3V7K A;  3RTV A;  4BDP A;  4IQW A;  1KFT A;  1K1Q A;  1MC8 A;  1T4G A;  9ICI A;  4PHE A;  4QZI A;  3JPO A;  5KFZ A;  4DQR A;  4KLS A;  2HHW A;  4Z6F A;  5J0T A;  4KMU A;  4J9M A;  1QLN A;  4MEY A;  1TVA A;  3RJH A;  5DB7 A;  2W9C A;  1L3T A;  2JEF A;  5DBB A;  7ICJ A;  1KLN A;  3N97 B;  2V4R A;  1KFD A;  5KFC A;  3PW5 A;  2BQ3 A;  4NLG A;  4KN7 A;  4R65 A;  4BXO B;  1WCN A;  5J2D A;  4LVS A;  4RUA A;  4ECX A;  1S9F A;  3BJY A;  4RQ3 A;  4J9Q A;  4QZA A;  3QEB Z;  5KG1 A;  1TKD A;  4F92 B;  2BDP A;  4QZH A;  7ICH A;  4KLM A;  2FMQ A;  5EWG A;  5L1L A;  2ZUB A;  4J9O A;  4JWN A;  2Q0Z X;  5CP2 A;  3T5L A;  3PNC A;  3MAB A;  4DL2 A;  4DL6 A;  4P4P A;  3ISC A;  4GLX A;  4ELU A;  3QZ8 A;  3RB3 A;  3IHQ B;  2W9C B;  1JMS A;  5KG0 A;  2ASL A;  4NY8 A;  8ICN A;  4MF8 A;  4NM2 A;  4C8M A;  5J0P A;  4YR0 A;  2MUT A;  5DG8 A;  5KT2 A;  4QZG A;  1NKC A;  4MFC A;  2HHU A;  2BCV A;  9ICV A;  4O3O A;  4QW8 A;  4JV0 A;  1DGS A;  8ICT A;  3Q8S B;  5KFU A;  2P66 A;  4ECT A;  5BOL A;  1ZQU A;  2PXI A;  5DB6 A;  5KFN A;  3OJU A;  4IQT A;  1XSL A;  3GDX A;  4O5E A;  4NLZ A;  4I2F A;  8ICC A;  8ICB A;  4RQ4 A;  8ICI A;  4KLG A;  3K4G A;  4F5Q A;  4KLQ A;  2HW3 A;  3NGD A;  5J0S A;  4Z6E A;  5J0O A;  4I2J A;  1TK5 A;  1SL0 A;  4J9P A;  2MUT B;  1WCL A;  5J0Y A;  3MGI A;  2FMS A;  1CUK A;  3C5G A;  2W9M A;  1SZP A;  1XC9 A;  2W9A A;  1ZJM A;  1ZET A;  4IRK A;  2NRV A;  1JXE A;  4KN4 A;  4F50 A;  4F4K A;  1QSY A;  2HHV A;  4F93 B;  4KTQ A;  2BPG A;  2PFP A;  4QWC A;  4JK1 A;  3PX4 A;  2W8K A;  1ZQZ A;  4YG2 A;  2C2R A;  1U48 A;  4QWE A;  2LYH A;  3PO5 A;  3M9M B;  2Y1J A;  4B9M A;  4DEZ A;  8ICM A;  3GQC A;  5KFF A;  2FPM A;  4BGD A;  5KFV A;  3PW0 A;  3PV8 A;  2VA3 A;  4QZB A;  2JZB A;  4GXK A;  3SZ2 A;  1S97 A;  1Y88 A;  4DSJ A;  1B22 A;  3N4M B;  1DOQ A;  4B9T A;  1S0M A;  1XU4 A;  4R66 A;  4QZ8 A;  1L3U A;  2PFN A;  3ETL A;  1QSL A;  1TFR A;  3OSP A;  5HNK A;  1UA1 A;  4MFF A;  1COO A;  3BDP A;  4JV2 A;  4LZD A;  4O3N A;  2C22 A;  1ZQT A;  2FMP A;  4DWI A;  1RXV A;  4RNM A;  1T8E A;  4DL7 A;  2JZB B;  3GIK A;  1IM4 A;  3OJS A;  5J2I A;  5HP4 A;  1CEZ A;  1ZQW A;  4NLN A;  1ZQX A;  4DSE A;  1SKS A;  1ZQP A;  3TFR A;  3ISB A;  8ICO A;  5KG6 A;  3RJG A;  4EZ6 A;  4JV1 A;  4KLE A;  2IHN A;  3Q8P B;  5J2H A;  2ZJ5 A;  3BQT A;  3V6K A;  4YVZ A;  3MR3 A;  7ICN A;  3JPN A;  2HHS A;  9ICE A;  4I28 A;  4RT2 A;  5DGA A;  1D8L A;  4FS1 A;  1ZQR A;  5DKW A;  3RRH A;  1L3S A;  2BCU A;  4I2H A;  4RQ5 A;  4DLG A;  9ICB A;  4DLE A;  5L9X A;  2R8H A;  3G6X A;  4TUS A;  5IIO A;  8ICK A;  1S0N A;  3PVX A;  5KG4 A;  4EYI B;  2NRT A;  3T5K A;  1T3N A;  7ICV A;  4O3P A;  4YFK A;  1RZT A;  4KLU A;  3SYZ A;  4QWA A;  4FS2 A;  3C2L A;  9ICU A;  1V9P A;  4KLJ A;  7ICR A;  4TUP A;  4O0I A;  2ISO A;  4DSL A;  4DO9 A;  2BHN A;  1X9M A;  2FPL A;  5J0Q A;  5BOM A;  4J9N A;  1TK8 A;  7ICF A;  3OHA A;  2ZTE A;  5F9L A;  4DQS A;  2IA6 A;  1S76 D;  3MDA A;  2C2E A;  3ZD8 A;  5D46 A;  3M8S A;  4RQ2 A;  2ATL A;  4QZE A;  4QWD A;  1C7Y A;  5KG2 A;  3M9O B;  4XQ8 A;  4F4Z A;  4B9L A;  1BPE A;  4I2G A;  2HHT A;  5CB1 A;  3ORY A;  5D49 A;  5J0R A;  4RQ6 A;  2P6R A;  9ICN A;  2BQU A;  2FPK A;  3B0Y A;  4QZF A;  1JX4 A;  1ZQJ A;  2FLN A;  2UVR A;  1LV5 A;  3GV7 B;  5HHH A;  4FBT A;  5KFT A;  2HHQ A;  3LK9 A;  2AGP A;  4ECU A;  4Q45 A;  4O9M A;  4RPX A;  4B9U A;  5KG3 A;  4RU9 A;  3C21 A;  5HHI A;  9ICL A;  7ICU A;  1ZQN A;  1PZN A;  4UB1 A;  2BPC A;  4P4M A;  3H4D A;  1KSP A;  5J0W A;  1BGX T;  4RQ8 A;  4NXZ A;  4M6W A;  4QWB A;  4TQR A;  5L1K A;  5DG7 A;  4M9J A;  4F2S A;  5IIJ A;  1NKB A;  4F91 B;  3JPS A;  8ICE A;  2OWO A;  3RH4 A;  4TUR A;  4M9G A;  2VAN A;  3HP6 A;  2ZUC A;  3AUO A;  5KFO A;  2XO7 A;  8ICX A;  8ICA A;  4FO6 A;  3ZDC A;  2F1I A;  4YMN A;  1ZQQ A;  4M0A A;  4I2E A;  4Q43 A;  4ELV A;  4M9L A;  5TZV A;  4X5V A;  8ICV A;  4UAZ A;  2PI4 A;  2DPI A;  5KFI A;  5KTQ A;  9ICO A;  4Z6C A;  2AGQ A;  2C28 A;  3FDS A;  4QZD A;  2H5X A;  3RAQ A;  4O5K A;  4I27 A;  4RNN A;  4DOC A;  7ICQ A;  4M6W B;  2F1H A;  5KFD A;  2XGQ A;  3C2K A;  2XCA A;  4DOA A;  8ICU A;  4ZH4 A;  4RPZ A;  3T5H A;  3JPP A;  2R8K A;  2XGP A;  3GIM A;  5DB8 A;  5KFW A;  4RQ7 A;  1U45 A;  1ZQF A;  3EW9 A;  2AGO A;  2DFL A;  3C1Y A;  1ZQO A;  1KTQ A;  4IRD A;  1ZQY A;  2ZUD A;  3UXO A;  1HUZ A;  5KG7 A;  3EZ5 A;  5DLG A;  1TAQ A;  1X9S A;  4DFJ A;  5DDY A;  4M04 A;  4DFK A;  3GIL A;  5KT4 A;  3PX0 A;  3C5F A;  3JPQ A;  1KDH A;  4EBD A;  5J2C A;  4ED2 A;  4F5P A;  3TAN A;  3ISD A;  1NK8 A;  1QSS A;  9ICF A;  3T5J A;  3PW7 A;  4UBC A;  1RYS A;  9ICR A;  4UB3 A;  3H4B A;  2ASJ A;  3BQ1 A;  2ZTC A;  5HMM A;  3LWM A;  2JEJ A;  8ICP A;  4MEX A;  4ECR A;  4PGY A;  4GXJ A;  4G3I A;  4YCX A;  5KT5 A;  3PY8 A;  4UAW A;  1SKW A;  4K4H A;  4K4I A;  2JEI A;  2KTQ A;  8ICG A;  4ECV A;  3G6Y A;  1TAU A;  2A1J A;  1D9D A;  4DL5 A;  3EWA A;  4RQ1 A;  3LWL A;  4F5O A;  2HVI A;  5DQH A;  5BPC A;  1NJX A;  4UQG A;  3RJI A;  1L5U A;  3EPG A;  5CHG A;  2AQ4 A;  3ZD9 A;  3M8R A;  1JXL A;  2NRX A;  2MAX A;  4MFA A;  4B9V A;  4RNO A;  2KFN A;  4EZ9 A;  5L1I A;  3RH6 A;  2W8L A;  4PHA A;  3H8W A;  1Z00 A;  3H8S A;  3Q8K A;  2C2D A;  3MR5 A;  5DQI A;  3V6J A;  2J6T A;  2AU0 A;  4DQI A;  4PHP A;  3Q8L A;  9ICP A;  2A1J B;  4F4Y A;  5III A;  4R8U A;  4J9S A;  7ICG A;  2KFZ A;  5J0U A;  3AU2 A;  3HPO A;  4KLD A;  2ZTD A;  3H8J A;  4YD2 A;  1ARO P;  4DFM A;  3PW4 A;  1S0O A;  2BCQ A;  3EYZ A;  4JUZ A;  1ZQC A;  1IXR A;  3C23 A;  3M9N B;  3OHB A;  2IHM A;  3PW2 A;  3ZDA A;  5DDM A;  4PPX A;  1Z00 B;  4QW9 A;  1JIH A;  4EEY A;  2V4Q A;  3ZDE A;  4DOB A;  4I2D A;  3RAX A;  4TUQ A;  4MF2 A;  2KN7 A;  4K4G A;  9ICW A;  2JEG A;  4R8U B;  2R8G A;  4YMO A;  2M9N A;  3H40 A;  9ICJ A;  4EYH B;  5IIL A;  1A77 A;  4XUS A;  4M47 A;  7ICE A;  7ICO A;  4EBC A;  4KLO A;  3MGH A;  1NJZ A;  2BPF A;  5F9N A;  4DQP A;  5KT7 A;  3G6V A;  1U4B A;  5J2G A;  1BPZ A;  2ASD A;  2P6U A;  2WTF A;  5DB9 A;  7ICL A;  2BKE A;  3RB6 A;  9ICQ A;  4KIT B;  2KZZ A;  4RT3 A;  1NOM A;  4KLI A;  2Y1I A;  3PR5 B;  5J29 A;  1T7P A;  3C1Z A;  4ELT A;  3RB4 A;  1X9W A;  1XWL A;  4ECQ A;  5EOZ A;  4YP3 A;  8ICR A;  1NK4 A;  5KFX A;  4TQS A;  4LZG A;  1ZQB A;  2J6U A;  4I29 A;  3Q8M A;  5KG5 A;  4YD1 A;  7ICK A;  2ZJA A;  4R63 A;  1RXW A;  3KHR A;  2RDJ A;  1ZJN A;  1BVS A;  4YXM A;  1A76 A;  3RBE A;  4O3S A;  4IR9 A;  3SI8 A;  8ICW A;  1TK0 A;  3UPQ A;  1RYR A;  3V6H A;  4GC7 A;  5KFS A;  1S10 A;  2UVU A;  4Q8F A;  4B9S A;  9ICA A;  2ALZ A;  4F4X A;  3BQ2 A;  2KZ3 A;  3B0X A;  5IIK A;  3MR2 A;  3SV4 A;  3RBD A;  3AU6 A;  2BCR A;  4F8R A;  1ZQM A;  7ICP A;  5J0X A;  1ZQE A;  5EWF A;  4NLK A;  4IQV A;  1S0V A;  4HYK A;  3OGU A;  4GC6 A;  4YR2 A;  4IRC A;  1KRP A;  4UB2 A;  5KFL A;  5CA7 A;  3HT3 A;  4RQ0 A;  2BR0 A;  1BPX A;  1NK7 A;  4KLL A;  4DSK A;  1B43 A;  5KFA A;  4C8L A;  4IQU A;  5IIN A;  1UA0 A;  1ZQL A;  2IBK A;  1ZQG A;  4Z6D A;  1D9F A;  1NK5 A;  1KFS A;  5HML A;  3BQ0 A;  4F5N A;  2VA2 A;  4DF4 A;  2BGW A;  2VA8 A;  4KLT A;  4ECY A;  4DFP A;  1XS9 D;  2FLP A;  2HHX A;  5KFG A;  3KTQ A;  4DSF A;  4BWM A;  5DQG A;  2NRW A;  4J9L A;  1ZQV A;  4CCH A;  3V7L A;  1TV9 A;  3PO4 A;  2UVV A;  9ICG A;  1HJP A;  2PFO A;  3HW8 A;  1U47 A;  5C5J A;  3KHG A;  2PI5 A;  9ICX A;  4I2I A;  3HX0 A;  1ZQA A;  3ZDB A;  1XSP A;  3C2M A;  7ICT A;  8ICZ A;  4ECZ A;  2BCS A;  8ICH A;  2I1Q A;  5KFK A;  3GIJ A;  1NK0 A;  4M2Y A;  4B9N A;  3MBY A;  4XA5 A;  4BWJ A;  4R64 A;  5D4B A;  2XY7 A;  2V9W A;  4F4W A;  4F5R A;  3ZDD A;  5KT3 A;  4UAY A;  1ZQK A;  3HWT A;  5DGB A;  1U9L A;  4C8K A;  3JPT A;  4ECS A;  4YQW A;  1ZQD A;  4KLF A;  2AQ0 A;  4J9R A;  1MQ3 A;  4UBB A;  9ICH A;  2W9B A;  2RDI A;  5IIM A;  2GWS A;  3MDC A;  1NJY A;  1SL2 A;  5KFQ A;  4ED6 A;  9ICC A;  3RR7 A;  3QZ7 A;  5J2K A;  1LB2 B;  3Q8Q B;  1ZQS A;  4F2R A;  4DQQ A;  1NJW A;  1JN3 A;  4PHD A;  3H7I A;  2BQR A;  8ICS A;  3RJE A;  7ICM A;  4P2H A;  3RJF A;  4PGQ A;  1SKR A;  2FLL A;  5KFP A;  3OSN A;  9ICS A;  1MQ2 A;  3PML A;  4I2B A;  4ED3 A;  5DLF A;  2UVW A;  2W9B B;  1N48 A;  3RRG A;  3UXN A;  3IM1 A;  3GFK B;  5EWE A;  1N56 A;  3TAP A;  4E0D A;  3SV3 A;  3T3F A;  3PR4 A;  1L3V A;  1S77 D;  3PMN A;  4M9N A;  1Z3E B;  1NK9 A;  8ICY A;  5J2E A;  4KLH A;  3TI0 A;  4C8O A;  4Q8E A;  3TAQ A;  1D8Y A;  2B21 A;  4UB5 A;  3TAR A;  3QE9 Y;  4UB4 A;  4O3R A;  2HVH A;  1QTM A;  2R8J A;  1BPD A;  2ZJ8 A;  2ISP A;  3MFI A;  2PFQ A;  2AJQ A;  5J2A A;  3RH5 A;  9ICK A;  5J2F A;  1MSW D;  8ICQ A;  2XCP A;  1XO1 A;  1UT5 A;  4YXJ A;  4YMM A;  3GV8 B;  3EPI A;  4EBE A;  2IMW P;  3GII A;  1SL1 A;  3RR8 A;  5KT6 A;  5KFH A;  3MFH A; 
#chains in the Genus database with same CATH topology
 3WKA A;  1SV4 A;  2D8C A;  3LDA A;  2KSO B;  2HI0 A;  3OPX A;  7ICI A;  4I2A A;  4F3O A;  4DS5 A;  1BPY A;  5KFE A;  4DSI A;  3SEI A;  1NK6 A;  3NTU A;  4ED1 A;  4Q44 A;  1X2I A;  4GXI A;  4RPY A;  4NM1 A;  2XY5 A;  2DPJ A;  4C8N A;  2ZIW B;  2H3Q A;  4BXO A;  2F1J A;  3CW2 C;  5J2J A;  3UQ0 A;  3T79 A;  1BNO A;  5L1J A;  1XSN A;  2GOL A;  2E8N A;  5KFB A;  1MC8 A;  9ICI A;  4PHE A;  5KFZ A;  4DQR A;  1QLN A;  1IIP A;  1TVA A;  2E8P A;  4C0Z A;  2W9C A;  1OXJ A;  7ICJ A;  3IDW A;  5DBB A;  3N97 B;  2V4R A;  5E79 U;  1WCN A;  5J2D A;  1N61 A;  3PSP A;  4LVS A;  1S9F A;  3BJY A;  1CI4 A;  4J9Q A;  4QZA A;  3QEB Z;  1TKD A;  4F92 B;  2BDP A;  4QZH A;  2FMQ A;  2ZUB A;  3T5L A;  5CP2 A;  4KX3 A;  5K4L A;  4DL2 A;  2Y0S C;  3F2D A;  2F3N A;  3RB3 A;  1T3Q A;  5AI0 A;  3IHQ B;  3K1Z A;  4NY8 A;  4RQM A;  4YR0 A;  4QZG A;  2HHU A;  2YTU A;  5AI8 A;  4QW8 A;  1Z1V A;  2DKZ A;  2P66 A;  5BOL A;  1ZQU A;  2PXI A;  3OJU A;  8ICC A;  4I2F A;  4KLG A;  5J0O A;  4I2J A;  1KN5 A;  3H0R B;  3C5G A;  2FMS A;  1SZP A;  5JU5 A;  2W9A A;  2EAO A;  5ALS A;  4F50 A;  4F4K A;  4F93 B;  3ED5 A;  5AIC A;  3B9J A;  3IV6 A;  3PX4 A;  2C2R A;  1U48 A;  3WK5 A;  4QWE A;  2Y1J A;  2EDU A;  8ICM A;  5AHX A;  3BS5 B;  3GQC A;  2VA3 A;  4QZB A;  4GXK A;  1Y88 A;  2OCE A;  1B22 A;  4Y2X A;  1DOQ A;  1S0M A;  4R66 A;  2E8O A;  3ETL A;  1QSL A;  5HNK A;  4JV2 A;  2AXT U;  4O3N A;  3M1Y A;  1KW4 A;  2EAM A;  1J2M A;  2JZB B;  3GIK A;  1IM4 A;  1ZXI A;  2BDU A;  3R9K A;  2IHN A;  1RYU A;  3I76 A;  5J2H A;  2ODG A;  3V6K A;  7ICN A;  1SIJ A;  3MR3 A;  3JPN A;  4I28 A;  4RT2 A;  1D8L A;  1ZQR A;  4FZL A;  5DKW A;  1L3S A;  2BCU A;  4I2H A;  2R8H A;  1ZD2 P;  5KG4 A;  4EYI B;  4KLU A;  2WF7 A;  1Q8K A;  3C2L A;  1X6J A;  5F3X B;  4WJ3 B;  4DO9 A;  2BHN A;  2FPL A;  5J0Q A;  4J9N A;  2C2E A;  3M8S A;  4PL2 A;  4Y2V A;  5GTH U;  2ATL A;  1BPE A;  4IS7 A;  5CB1 A;  5J0R A;  2P6R A;  4Y2J A;  4QZF A;  1JX4 A;  5KNI A;  2KIC A;  4FBT A;  1A6S A;  4OJP A;  3QX7 A;  2AGP A;  1J97 A;  9ICL A;  1ZQN A;  4P4M A;  4TQR A;  1BGX T;  4F2S A;  3N7R C;  5B66 U;  2OWO A;  5KFO A;  3E58 A;  4FO6 A;  5HR7 A;  5AKE A;  4M0A A;  4M9L A;  3K1R B;  5TZV A;  4G9B A;  9ICO A;  5KFI A;  5KTQ A;  3RAQ A;  3F5A A;  3C2K A;  5AKJ A;  3T5H A;  2R8K A;  2FJ6 A;  2XGP A;  3BQ7 A;  1KL9 A;  1ZQF A;  3EW9 A;  2DFL A;  3C1Y A;  4IRD A;  1O03 A;  1TAQ A;  1X9S A;  5DDY A;  2YMP A;  4PL1 A;  5ALJ A;  3PX0 A;  1QQ6 A;  3MGV A;  4ED2 A;  1QSS A;  9ICF A;  3T5J A;  4UBC A;  1RYS A;  3N7S C;  2ES6 A;  1XNS A;  3LWM A;  1ZD4 A;  2GH1 A;  4MEX A;  2DQN B;  2A3V A;  1SB3 C;  2H3I A;  4C7Y A;  5CRX A;  2ZIX A;  5KT5 A;  1IV8 A;  4K4H A;  1X6I A;  2OEH A;  1TAU A;  3EWA A;  3LWL A;  1RDF A;  1FEZ A;  5DQH A;  4UQG A;  2AQ4 A;  2NRX A;  4OCZ A;  1VDV A;  2KFN A;  5AKY A;  1KQQ A;  4PHA A;  3H8S A;  2C2D A;  2WHE A;  3MR5 A;  3BZK A;  5ALH A;  3V6J A;  2J6T A;  1Q46 A;  3PZP A;  5AIA A;  4NLC A;  2ZTD A;  4DFM A;  1ARO P;  2QB0 A;  3PW4 A;  1IXR A;  2D3D A;  2NV3 A;  3ZDA A;  5DDM A;  4PPX A;  1Z00 B;  1ZRM A;  4I2D A;  3S6J A;  5FP0 A;  9ICW A;  4B6J A;  3L3F X;  4YMO A;  1A77 A;  4U7C A;  4DQP A;  3AQF A;  5AM3 A;  5KT7 A;  1BPZ A;  2WTF A;  5DB9 A;  9ICQ A;  4KIT B;  2KHV A;  4UAT A;  3C1Z A;  4P0Q B;  2B0C A;  3F53 A;  5KFX A;  4UW9 A;  2JR5 A;  4LZG A;  1ZQB A;  4I29 A;  5KG5 A;  2ZIU A;  1RXW A;  1ZJN A;  1BVS A;  4NV0 A;  5ALY A;  4IR9 A;  1B4F A;  8ICW A;  1BNP A;  3V6H A;  5KFS A;  1S10 A;  4Q8F A;  2ALZ A;  1N2X A;  4F4X A;  3DEE A;  2BZF A;  2KZ3 A;  3MR2 A;  3AU6 A;  7ICP A;  1ZQM A;  4IQV A;  4HYK A;  3OGU A;  2YN4 A;  1Z1B A;  4RQ0 A;  1BPX A;  1VJ5 A;  3FAH A;  4IQU A;  5IIN A;  1ZQL A;  2IBK A;  3D6J A;  4F5N A;  2BGW A;  1PK1 A;  2KD1 A;  2FLP A;  2HHX A;  4DSF A;  2KK0 A;  1ZQV A;  1TV9 A;  9ICX A;  3KHG A;  2EZX A;  5T14 A;  3TAD A;  7ICT A;  1L7O A;  4B9N A;  2K4I A;  1ZQK A;  3WKD A;  5DGB A;  2FI1 A;  2NO4 A;  2QAR B;  1TE2 A;  2NYV A;  2RDI A;  5IIM A;  1SL2 A;  5AI5 A;  4CF5 A;  5J2K A;  1JN3 A;  3H7I A;  2K4H A;  3IRU A;  3RJF A;  5ALR A;  3SR6 A;  5KFP A;  3OSN A;  1Z4O A;  1N48 A;  1LVH A;  5EWE A;  1N56 A;  3KZX A;  1L3V A;  4RQN A;  1NK9 A;  1VLB A;  5J2E A;  4EX7 A;  2B21 A;  1QQ5 A;  4UB4 A;  3MFI A;  2PFQ A;  3I28 A;  3RH5 A;  5J2F A;  1MSW D;  3GV8 B;  2LPE A;  2IMW P;  1SL1 A;  5JUM A;  3KHL A;  4XRH A;  2WF9 A;  3VC8 A;  4ED7 A;  3LVW A;  3QU7 A;  3UXP A;  5AK3 A;  1ZYQ A;  5KFY A;  5DG9 A;  4DFD A;  2NO5 A;  5EE3 A;  4FBU A;  9ICM A;  8ICL A;  2ZXH A;  1H38 A;  1LKY B;  2WFA A;  1K1S A;  4M9H A;  3TAC B;  3SD7 A;  3RB0 A;  8ICJ A;  3FYH A;  3C29 A;  3Q8R B;  3V7J A;  1SXD A;  4DL3 A;  1JUD A;  4F72 A;  4YN4 A;  3PX6 A;  3E2E A;  1ZQI A;  4DS4 A;  1RPL A;  4IR1 A;  4QZC A;  2LMR A;  2JV3 A;  4ECW A;  4I2C A;  5KFR A;  1YZ7 A;  1K1Q A;  3JPO A;  1KKX A;  2HHW A;  4Z6F A;  5AK5 A;  4J9M A;  4MEY A;  3RJH A;  1L3T A;  1X66 A;  3AN1 A;  2WF5 A;  1KFD A;  2BQ3 A;  4KN7 A;  4R65 A;  2KKV A;  4CNQ A;  3H8M A;  5EWG A;  5L1L A;  4JWN A;  2KVC A;  2Q0Z X;  3UMG A;  3BS7 A;  3TAD C;  3H0L B;  2YX8 A;  4P4P A;  3ISC A;  4ELU A;  3NVV A;  2DBY A;  8ICN A;  4MF8 A;  1M6Y A;  4C8M A;  5J0P A;  5DG8 A;  1NKC A;  3QU9 A;  4MFC A;  4JV0 A;  2G09 A;  3Q8S B;  5C0Y A;  4O5E A;  2W54 A;  5G5H A;  3AMZ A;  1V97 A;  3SAG A;  1YT3 A;  3NGD A;  4OJ6 A;  1SL0 A;  1WUD A;  4NL9 A;  1FFV A;  2MUT B;  1WCL A;  5J0Y A;  1CUK A;  2W9M A;  4FZN A;  1ZET A;  4IRK A;  1QSY A;  2JRZ A;  1ZD5 A;  2BPG A;  2PFP A;  4QWC A;  4UB8 U;  4F71 A;  2W8K A;  3NRZ A;  4QIW F;  2Q4T A;  3M9M B;  2HSZ A;  4DEZ A;  4AYB F;  1S97 A;  4B9T A;  1XU4 A;  2HBJ A;  3O0F A;  5AI6 A;  1TFR A;  1SXE A;  1COO A;  3M7D A;  4NJ8 A;  2C22 A;  2FMP A;  4QJF B;  2KIV A;  2OYY A;  3E0F A;  4DSE A;  1SKS A;  3TFR A;  3ETR A;  3Q8P B;  3FM9 A;  2KJ8 A;  2W7O A;  3RRH A;  4RQ5 A;  4DLG A;  1V38 A;  4TUS A;  8ICK A;  3PVX A;  3I1Y A;  3T5K A;  2HOQ A;  1RZT A;  5GTI U;  3SYZ A;  4QWA A;  7ICR A;  4KLJ A;  1WWU A;  3OHA A;  2IA6 A;  3MDA A;  4RQ2 A;  1URJ A;  5KG2 A;  2JXJ A;  4XQ8 A;  4F4Z A;  3ORY A;  5D49 A;  2QLT A;  2FPK A;  2BQU A;  1ZQJ A;  5HHH A;  4ECU A;  4A8E A;  4O9M A;  5AKL A;  5ALK A;  2BPC A;  3H4D A;  2HHT A;  2WAQ F;  4RQ8 A;  4NXZ A;  4M6W A;  4QWB A;  5DG7 A;  8ICE A;  3KFU F;  3JPS A;  5ALF A;  4TUR A;  1TAM A;  4M9G A;  3AUO A;  8ICX A;  1SGG A;  2F1I A;  1MA7 A;  4Q43 A;  3QU4 A;  4EEN A;  2PI4 A;  4Z6C A;  2AGQ A;  2C28 A;  4QZD A;  7ICQ A;  2JHD A;  2F1H A;  5KFD A;  2XCA A;  4DOA A;  2KKP A;  1UHU A;  3GIM A;  2YMM A;  3WK9 A;  1ZQO A;  1ZQY A;  2DUY A;  4NL9 C;  3EZ5 A;  5DLG A;  5KT4 A;  3KOO A;  3C5F A;  3JPQ A;  1KDH A;  5J2C A;  3TAN A;  3KZI U;  4UB3 A;  3H4B A;  4UAV A;  8ICP A;  4ECR A;  4G3I A;  3PY8 A;  4UAW A;  1P7D A;  4K4I A;  2JEI A;  5A0L A;  5AM0 A;  4ECV A;  3G6Y A;  2A1J A;  1D9D A;  1Z4N A;  3FC4 A;  5ALX A;  1L5U A;  3EPG A;  1DRG A;  1ZRN A;  2A19 A;  2MAX A;  4MFA A;  4EZ9 A;  5AIB A;  4FFD A;  3IG5 A;  5DQI A;  4PHP A;  3Q8L A;  5III A;  4BUG A;  4R8U A;  7ICG A;  5L1M A;  5J0U A;  3HPO A;  3M6K A;  3H8J A;  2BCQ A;  4JUZ A;  3C23 A;  3PW2 A;  1JIH A;  2V4Q A;  3RAX A;  2JEG A;  1X40 A;  2R8G A;  4EYH B;  7ICE A;  4M47 A;  2H3F A;  7ICO A;  4EBC A;  3MGH A;  3DDH A;  3M6Z A;  1WG8 A;  2KJ9 A;  3ALR A;  1U4B A;  1ZQ1 C;  2P6U A;  5J29 A;  4ELT A;  3RB4 A;  4ECQ A;  4YP3 A;  5ALZ A;  8ICR A;  2PMZ F;  1QH9 A;  4YD1 A;  4YXM A;  1A76 A;  5AKH A;  3RBE A;  4P0P A;  1TK0 A;  3UPQ A;  2UVU A;  3B0X A;  2BCR A;  2G5I B;  2HCF A;  2KHQ A;  4YR2 A;  1KRP A;  2BR0 A;  3QU2 A;  2IOH A;  5EE9 A;  2XIC A;  3QNM A;  1NK5 A;  5G5G A;  2VA2 A;  1RG6 A;  2PKE A;  2KV2 A;  2W55 A;  2F77 X;  4CRX A;  2ZG6 A;  4BWM A;  5DQG A;  2NRW A;  4UB6 U;  5B5E U;  4CCH A;  3PO4 A;  9ICG A;  1HJP A;  1U47 A;  4I2I A;  1ZQA A;  2GLE A;  4ECZ A;  8ICH A;  2I1Q A;  5KFK A;  1NK0 A;  4M2Y A;  2LYB A;  3MBY A;  4XA5 A;  5D4B A;  4R64 A;  3ZDD A;  4UAY A;  5TIS U;  5ALO A;  5ALM A;  4YQW A;  2AQ0 A;  3J81 j;  4J9R A;  3QU5 A;  3ICX A;  3DV9 A;  2W9B A;  2GWS A;  3MDC A;  1NJY A;  5KFQ A;  1JRP A;  3ZI4 A;  3QZ7 A;  4F2R A;  2F8K A;  4JMU A;  4PGQ A;  1SKR A;  9ICS A;  5AKI A;  3PML A;  4I2B A;  5KL8 B;  2LI6 A;  4OJ5 A;  2JMG A;  2ZIV A;  4E0D A;  3GZF A;  3SAF A;  1XO0 A;  2E1F A;  8ICY A;  4KLH A;  3TI0 A;  2KSO A;  4C8O A;  2HBL A;  3ONN A;  3TAR A;  2R8J A;  1BPD A;  2ZJ8 A;  9ICK A;  5J2A A;  2W03 A;  3EPI A;  1UT5 A;  1XO1 A;  2F8L A;  3GII A;  2E1E A;  3NVZ A;  1A0P A;  3RJK A;  1U49 A;  1N60 A;  4Y2P A;  4Y2Q A;  2WB1 F;  4QZ9 A;  1HUO A;  2ZIW A;  3TFS A;  3KHH A;  4O5C A;  2I9G A;  1SZH A;  3UQ2 A;  4RUC A;  4DF8 A;  1F5S A;  4IC9 A;  3UM9 A;  3GV5 B;  9ICT A;  3RF9 A;  2ZXI A;  4JWM A;  2XID A;  1ZQH A;  4PGX A;  5DBA A;  4J9K A;  3U26 A;  4PH5 A;  3RJJ A;  2KMD A;  5JRT A;  3WKB A;  3MR6 A;  2NRZ A;  1NI3 A;  4CF4 A;  1AQ6 A;  5AI4 A;  1QQ7 A;  5CJ7 A;  1D8B A;  4C4T A;  4YR3 A;  4BDP A;  4IQW A;  1KFT A;  1T4G A;  4QZI A;  1DK3 A;  2JH7 A;  1SWW A;  4KMU A;  2VIX A;  5DB7 A;  2JEF A;  5JTI A;  1KLN A;  3PW5 A;  4BXO B;  3D2Q A;  4RUA A;  4ECX A;  5ALG A;  5AKG A;  2EH9 A;  2EZY A;  3UMC A;  2W3S A;  2K4E A;  4KLM A;  1DGJ A;  2HMX A;  4J9O A;  3PNC A;  3OTQ A;  2H3V A;  2R18 A;  3NUQ A;  2W9C B;  1JMS A;  1X9X A;  5KG0 A;  4NWI A;  2BCV A;  4O3O A;  1DGS A;  1ZOL A;  4ECT A;  2DWQ A;  5DB6 A;  5KFN A;  4IQT A;  4NLZ A;  4RQ4 A;  3PST A;  2K8A A;  1YZ6 A;  2HW3 A;  4EEL A;  5J0S A;  2P35 A;  4Z6E A;  3BS5 A;  4J9P A;  2LM1 A;  1XC9 A;  2K8C B;  1JXE A;  5AKK A;  2HHV A;  2F76 X;  1OUQ A;  4KTQ A;  1J2N A;  2I5H A;  2CN1 A;  3CRX A;  3QYP A;  2FPM A;  4BGD A;  3PW0 A;  2JZB A;  4DSJ A;  4UAS A;  4QZ8 A;  1L3U A;  2PFN A;  2KJ5 A;  3OSP A;  3QUC A;  4MFF A;  1X42 A;  3BDP A;  5ALD A;  1ZQT A;  2MSN A;  5ALL A;  1RXV A;  1N63 A;  3HRD D;  4RNM A;  4J03 A;  1PVP A;  1NZB A;  5ALQ A;  3OJS A;  5J2I A;  3RFA A;  2K4P A;  4NLN A;  5KG6 A;  4EZ6 A;  4JV1 A;  2ZJ5 A;  2HHS A;  3WK4 A;  3HJE A;  9ICB A;  5L9X A;  5EE1 A;  5IIO A;  1S8O A;  1T3N A;  2KVS A;  7ICV A;  1F0M A;  5AM1 A;  9ICU A;  2YY6 A;  4TUP A;  4O0I A;  2ISO A;  4DSL A;  3D2N A;  2G08 A;  2GO7 A;  1JI7 A;  2MA1 A;  1TK8 A;  7ICF A;  1DK2 A;  2ZTE A;  3ZD8 A;  5D46 A;  3L5K A;  4QZE A;  1C7Y A;  3M9O B;  3B0Y A;  2FLN A;  1CRX A;  4QIW C;  5KFT A;  2HHQ A;  3A0B U;  1O08 A;  2OHF A;  4OO1 J;  4Q45 A;  3KBB A;  4RPX A;  4AYB C;  5KG3 A;  7ICU A;  3WK7 A;  8ICB A;  1NKB A;  3RH4 A;  2VAN A;  5AK4 A;  3HP6 A;  2ZUC A;  2XO7 A;  8ICA A;  3ZDC A;  2E8M A;  4YMN A;  4I2E A;  4ELV A;  2KNJ A;  4UAZ A;  4C4R A;  4UAR A;  2DPI A;  3AL0 B;  2RP5 A;  4O5K A;  4I27 A;  4DOC A;  2RLT A;  4ICA A;  3AM9 A;  8ICU A;  4RPZ A;  3JPP A;  2HDO A;  2LBO A;  5DB8 A;  4GIB A;  2AGO A;  4FZM A;  2ZUD A;  3UXO A;  1HUZ A;  1L6N A;  1L7M A;  4M04 A;  1HEK A;  2EQY A;  4EBD A;  4F5P A;  3WKC A;  1SV0 A;  3D2S A;  2ASJ A;  3BQ1 A;  2ZTC A;  2JEJ A;  2FDR A;  1L8L A;  4YCX A;  2W43 A;  1S5L U;  2KTQ A;  8ICG A;  2VJ4 A;  4OD0 A;  3PSF A;  2DF4 B;  4RQ1 A;  3F5E A;  4NLB A;  3RJI A;  5KAF U;  1JXL A;  4B9V A;  3ZD9 A;  3M8R A;  4RNO A;  3HKZ F;  5L1I A;  2W8L A;  2ZIX B;  1Z00 A;  3QXG A;  2WAQ C;  4DQI A;  4F4Y A;  5AI9 A;  4OJL A;  4J9S A;  2KFZ A;  4PZO A;  4YD2 A;  3EYZ A;  2QB1 A;  3M9N B;  3OHB A;  2IHM A;  4QW9 A;  4EEY A;  4DOB A;  5ALT A;  4K4G A;  2DGZ A;  4P0Q A;  2M9N A;  9ICJ A;  5IIL A;  2G0A A;  2QB0 B;  5F9N A;  5J2G A;  2MRL A;  4KLI A;  2Y1I A;  3PR5 B;  2H3Z A;  2N1R A;  1T7P A;  1X9W A;  5EOZ A;  2K60 A;  2ZJA A;  4R63 A;  3L4P A;  2RDJ A;  3SI8 A;  1RYR A;  4KMO B;  4B9S A;  9ICA A;  2JH1 A;  3BQ2 A;  4PJ0 U;  4PZN A;  3SV4 A;  3RBD A;  2G06 A;  1S0V A;  4IRC A;  5CA7 A;  3HT3 A;  2ZIU B;  4KLL A;  1B43 A;  5KFA A;  1ZQG A;  1D9F A;  2W04 A;  5HML A;  3BQ0 A;  4DF4 A;  3WK6 A;  3H0M B;  2VA8 A;  4Y2R A;  4KLT A;  4ECY A;  4DFP A;  1XS9 D;  4O3M A;  5KFG A;  2QAR A;  4Y2Y A;  1N62 A;  4J9L A;  1L7N A;  2PI5 A;  1XSP A;  1SV0 C;  2K8B B;  8ICZ A;  3GIJ A;  4ZOH C;  1PK1 B;  4F5R A;  2XI9 A;  5KT3 A;  3EUB 2;  1MQ3 A;  2I6X A;  4UBB A;  4CF3 A;  9ICH A;  2PMZ C;  4LJX A;  9ICC A;  3RR7 A;  1LB2 B;  3Q8Q B;  4DQQ A;  4EX6 A;  4C7Z A;  2BQR A;  3QUQ A;  2DL0 A;  1OW5 A;  3KKA A;  3RJE A;  4P2H A;  2E5S A;  2FLL A;  3AEV A;  4ED3 A;  2UVW A;  1FFU A;  3RRG A;  3IM1 A;  3TAP A;  3SV3 A;  3PR4 A;  1S77 D;  2EAP A;  3GU3 A;  1COK A;  2LM4 A;  4Q8E A;  3TAQ A;  1D8Y A;  4UB5 A;  2HVH A;  1QTM A;  2AJQ A;  1LKY A;  2EAN A;  2Y0S F;  8ICQ A;  2XCP A;  3RR8 A;  2CPR A;  4ACO A;  3MC1 A;  5KT6 A;  5KFH A;  3MFH A;  7ICL A;  3NVW A;  5KFJ A;  2OM6 A;  2R8I A;  5DBC A;  2XY6 A;  4OJO A;  1NKE A;  3V72 A;  3JPR A;  1KEJ A;  3TQ1 A;  3TKA A;  3QEA Z;  3THV A;  2J6S A;  5ALV A;  2KZM A;  3IN5 A;  2XC9 A;  4DL4 A;  7ICS A;  5CR0 A;  5KFM A;  1BPB A;  1EXN A;  4Y2U A;  3WU2 U;  8ICF A;  5AM4 A;  4O3Q A;  1FO4 A;  4P4O A;  3K75 D;  5CWR A;  4ED8 A;  4ED0 A;  1WYG A;  5J2B A;  2OXO A;  2Y9T A;  2ESE A;  2FE9 A;  4BJQ A;  4BX9 C;  1L7P A;  1UT8 A;  4RZR A;  1B0X A;  5KL1 B;  3V7K A;  3RTV A;  5EE0 A;  1V85 A;  4KLS A;  3SAH A;  5J0T A;  2XVT A;  3UMB A;  5KFC A;  4NLG A;  4U6P A;  4RQ3 A;  5KG1 A;  7ICH A;  5AK6 A;  3MAB A;  4DL6 A;  3BZC A;  4GLX A;  3QZ8 A;  5ALU A;  2QKQ A;  2ASL A;  4NM2 A;  2MUT A;  1L8O A;  5KT2 A;  9ICV A;  4JB3 A;  2WB1 C;  8ICT A;  5KFU A;  5ALP A;  1XSL A;  3GDX A;  2KOB A;  2F2A B;  8ICI A;  3K4G A;  4F5Q A;  5CEH A;  1TK5 A;  2YML A;  3KKA C;  3MGI A;  4GFJ A;  1ZJM A;  2NRV A;  1FIQ A;  4KN4 A;  5ALW A;  4Y2S A;  5AKZ A;  4JK1 A;  1F44 A;  1ZQZ A;  3N28 A;  4YG2 A;  2LYH A;  3PO5 A;  4B9M A;  5KFF A;  5KFV A;  3PV8 A;  3SZ2 A;  3N4M B;  2G07 A;  1GO3 F;  2YB4 A;  2LHT A;  4US8 A;  1PVQ A;  1UA1 A;  4AP9 A;  5ALN A;  2IOF K;  2L5Y A;  4LZD A;  4DWI A;  1T8E A;  1KBU A;  1ZD3 A;  4DL7 A;  2MU2 A;  5HP4 A;  2B6G A;  1CEZ A;  5H2F U;  3QUB A;  1ZQW A;  2W11 A;  1ZQX A;  4KX5 A;  1ZQP A;  1RM6 C;  3ISB A;  8ICO A;  3RJG A;  3F2C A;  4KLE A;  3BQT A;  9ICE A;  4YVZ A;  5DGA A;  4FS1 A;  1PVR A;  2HOI A;  5ALI A;  4DLE A;  3G6X A;  1S0N A;  3KD3 A;  2NRT A;  4O3P A;  4YFK A;  5AKX A;  4FS2 A;  1V9P A;  1X9M A;  2DKX A;  1PUZ A;  5BOM A;  4DQS A;  5F9L A;  1S76 D;  3LVV A;  4QWD A;  4B9L A;  4I2G A;  9ICN A;  2K89 A;  4RQ6 A;  2D6F C;  2UVR A;  1K5O A;  2RQ5 A;  1LV5 A;  3GV7 B;  2VKQ A;  2YQE A;  3LK9 A;  4B9U A;  4RU9 A;  1NZP A;  3C21 A;  4DCC A;  5HHI A;  1PZN A;  2LYA A;  4UB1 A;  1KSP A;  5J0W A;  4M9J A;  5L1K A;  4MHV A;  5IIJ A;  4F91 B;  1C20 A;  1UPH A;  3CNH A;  1RQN A;  3NRW A;  1ED1 A;  1ZQQ A;  1UQV A;  4X5V A;  8ICV A;  3FDS A;  2H5X A;  4RNN A;  4M6W B;  2XGQ A;  3QUT A;  4ZH4 A;  2RRD A;  2KEY A;  4RQ7 A;  5KFW A;  1U45 A;  3NS1 A;  1Z19 A;  1KTQ A;  5KG7 A;  4UAU A;  4DFJ A;  4DFK A;  3GIL A;  1N5W A;  3ISD A;  1NK8 A;  3WKE A;  3PW7 A;  9ICR A;  4US9 A;  5HMM A;  3N7P D;  4PGY A;  4GXJ A;  1SKW A;  2VJ5 A;  4Y2T A;  2WF8 A;  2OH2 A;  4DL5 A;  5J8Y A;  2HVI A;  3C28 A;  4F5O A;  4HAI A;  5BPC A;  1NJX A;  1DXS A;  3PSI A;  5CHG A;  3RH6 A;  3H8W A;  2AU0 A;  9ICP A;  4QNL A;  2A1J B;  2EZZ A;  1Q3V A;  5KAI U;  3AU2 A;  4KLD A;  1S0O A;  1JAL A;  1ZQC A;  2AHO B;  1N5X A;  3ZDE A;  2WF6 A;  1QCK A;  4TUQ A;  4MF2 A;  1Q3U A;  2KN7 A;  2AH5 A;  4R8U B;  1IG6 A;  3H40 A;  4XUS A;  3F2B A;  4KLO A;  1NJZ A;  2BPF A;  2CXY A;  3CYM A;  3G6V A;  2ASD A;  4CGZ A;  2BKE A;  3RB6 A;  2KZZ A;  4RT3 A;  1NOM A;  1ECW A;  2LKY A;  1XWL A;  4FE3 A;  1NK4 A;  2KG5 A;  4TQS A;  3A0H U;  3IP4 B;  2J6U A;  3Q8M A;  7ICK A;  4CDG A;  3KHR A;  4O3S A;  2KIW A;  2A1A A;  2W3R A;  1HIW A;  4GC7 A;  2HBK A;  5IIK A;  4F8R A;  3HKZ C;  2W7P A;  3WK8 A;  5J0X A;  1ZQE A;  5EWF A;  4NLK A;  4GC6 A;  4UB2 A;  5KFL A;  5HR6 A;  2E3T A;  1NK7 A;  4DSK A;  4C8L A;  4P0P B;  1UA0 A;  1UCV A;  4Z6D A;  1KFS A;  2KP7 A;  2F44 A;  3KTQ A;  4USA A;  2Z7J A;  5AM2 A;  3V7L A;  2UVV A;  2PFO A;  3HW8 A;  5C5J A;  3HX0 A;  3IG8 A;  3ZDB A;  2KE7 A;  3C2M A;  1MN8 A;  2BCS A;  1PK3 A;  3SQI A;  5ALE A;  2XY7 A;  2V9W A;  4F4W A;  3HWT A;  2CRX A;  3AQE A;  1U9L A;  4C8K A;  2M0N A;  3JPT A;  4ECS A;  4C80 A;  1ZQD A;  4KLF A;  2YB1 A;  3HIL A;  5J8Y C;  4C4S A;  4CE6 A;  3SMV A;  2HOF A;  2IOF A;  4ED6 A;  2YMQ A;  1ZQS A;  2G5H B;  1NJW A;  4IL6 U;  4PHD A;  8ICS A;  7ICM A;  5AM5 A;  1SWV A;  3NAS A;  1MQ2 A;  3LYS A;  3SEN A;  5DLF A;  2W9B B;  2Y9U A;  3UXN A;  2JGA A;  3GFK B;  4EEK A;  3T3F A;  3PMN A;  4M9N A;  1Z3E B;  3VCB A;  1RQL A;  2HBM A;  2RHF A;  4O3R A;  3QE9 Y;  1T94 A;  2O6K A;  3NVY A;  1JRO A;  2ISP A;  1WWV A;  1NNL A;  4YXJ A;  4KLQ A;  4YMM A;  4EBE A;  2ZIV B;  4BWJ A;  3Q8K A;  3CP8 A; 
#chains in the Genus database with same CATH homology
 5JUM A;  3KHL A;  5KFJ A;  4XRH A;  4ED7 A;  2R8I A;  5DBC A;  2XY6 A;  3RJK A;  1U49 A;  1NKE A;  3UXP A;  3V72 A;  3JPR A;  3LDA A;  1ZYQ A;  1KEJ A;  3TQ1 A;  5DG9 A;  5KFY A;  7ICI A;  4QZ9 A;  4FBU A;  4I2A A;  9ICM A;  1HUO A;  8ICL A;  3TFS A;  3QEA Z;  4F3O A;  3THV A;  4DS5 A;  1BPY A;  3KHH A;  5KFE A;  1H38 A;  2J6S A;  4O5C A;  4DSI A;  2KZM A;  1K1S A;  2I9G A;  2XC9 A;  3UQ2 A;  4DL4 A;  7ICS A;  5CR0 A;  5KFM A;  4RUC A;  4M9H A;  1BPB A;  1EXN A;  4DF8 A;  3NTU A;  1NK6 A;  3GV5 B;  4ED1 A;  4Q44 A;  3RB0 A;  9ICT A;  8ICF A;  8ICJ A;  1X2I A;  3FYH A;  4O3Q A;  4GXI A;  4JWM A;  4RPY A;  1ZQH A;  3Q8R B;  4NM1 A;  3V7J A;  4PGX A;  4P4O A;  5DBA A;  4J9K A;  3K75 D;  2XY5 A;  2DPJ A;  4DL3 A;  4PH5 A;  4YN4 A;  5CWR A;  4C8N A;  3PX6 A;  3RJJ A;  3E2E A;  4ED8 A;  1ZQI A;  4ED0 A;  4DS4 A;  5J2B A;  3MR6 A;  2NRZ A;  1RPL A;  4BXO A;  2F1J A;  4IR1 A;  4QZC A;  5J2J A;  3UQ0 A;  1UT8 A;  5L1J A;  5CJ7 A;  4ECW A;  1XSN A;  4RZR A;  4I2C A;  5KFB A;  5KFR A;  4YR3 A;  3V7K A;  3RTV A;  4BDP A;  4IQW A;  1KFT A;  1K1Q A;  1MC8 A;  1T4G A;  9ICI A;  4PHE A;  4QZI A;  3JPO A;  5KFZ A;  4DQR A;  4KLS A;  2HHW A;  4Z6F A;  5J0T A;  4KMU A;  4J9M A;  1QLN A;  4MEY A;  1TVA A;  3RJH A;  5DB7 A;  2W9C A;  1L3T A;  2JEF A;  5DBB A;  7ICJ A;  1KLN A;  3N97 B;  2V4R A;  1KFD A;  5KFC A;  3PW5 A;  2BQ3 A;  4NLG A;  4KN7 A;  4R65 A;  4BXO B;  1WCN A;  5J2D A;  4LVS A;  4RUA A;  4ECX A;  1S9F A;  3BJY A;  4RQ3 A;  4J9Q A;  4QZA A;  3QEB Z;  5KG1 A;  1TKD A;  4F92 B;  2BDP A;  4QZH A;  7ICH A;  4KLM A;  2FMQ A;  5EWG A;  5L1L A;  2ZUB A;  4J9O A;  4JWN A;  2Q0Z X;  5CP2 A;  3T5L A;  3PNC A;  3MAB A;  4DL2 A;  4DL6 A;  4P4P A;  3ISC A;  4GLX A;  4ELU A;  3QZ8 A;  3RB3 A;  3IHQ B;  2W9C B;  1JMS A;  5KG0 A;  2ASL A;  4NY8 A;  8ICN A;  4MF8 A;  4NM2 A;  4C8M A;  5J0P A;  4YR0 A;  2MUT A;  5DG8 A;  5KT2 A;  4QZG A;  1NKC A;  4MFC A;  2HHU A;  2BCV A;  9ICV A;  4O3O A;  4QW8 A;  4JV0 A;  1DGS A;  8ICT A;  3Q8S B;  5KFU A;  2P66 A;  4ECT A;  5BOL A;  1ZQU A;  2PXI A;  5DB6 A;  5KFN A;  3OJU A;  4IQT A;  1XSL A;  3GDX A;  4O5E A;  4NLZ A;  4I2F A;  8ICC A;  8ICB A;  4RQ4 A;  8ICI A;  4KLG A;  3K4G A;  4F5Q A;  4KLQ A;  2HW3 A;  3NGD A;  5J0S A;  4Z6E A;  5J0O A;  4I2J A;  1TK5 A;  1SL0 A;  4J9P A;  2MUT B;  1WCL A;  5J0Y A;  3MGI A;  2FMS A;  1CUK A;  3C5G A;  2W9M A;  1SZP A;  1XC9 A;  2W9A A;  1ZJM A;  1ZET A;  4IRK A;  2NRV A;  1JXE A;  4KN4 A;  4F50 A;  4F4K A;  1QSY A;  2HHV A;  4F93 B;  4KTQ A;  2BPG A;  2PFP A;  4QWC A;  4JK1 A;  3PX4 A;  2W8K A;  1ZQZ A;  4YG2 A;  2C2R A;  1U48 A;  4QWE A;  2LYH A;  3PO5 A;  3M9M B;  2Y1J A;  4B9M A;  4DEZ A;  8ICM A;  3GQC A;  5KFF A;  2FPM A;  4BGD A;  5KFV A;  3PW0 A;  3PV8 A;  2VA3 A;  4QZB A;  2JZB A;  4GXK A;  3SZ2 A;  1S97 A;  1Y88 A;  4DSJ A;  1B22 A;  3N4M B;  1DOQ A;  4B9T A;  1S0M A;  1XU4 A;  4R66 A;  4QZ8 A;  1L3U A;  2PFN A;  3ETL A;  1QSL A;  1TFR A;  3OSP A;  5HNK A;  1UA1 A;  4MFF A;  1COO A;  3BDP A;  4JV2 A;  4LZD A;  4O3N A;  2C22 A;  1ZQT A;  2FMP A;  4DWI A;  1RXV A;  4RNM A;  1T8E A;  4DL7 A;  2JZB B;  3GIK A;  1IM4 A;  3OJS A;  5J2I A;  5HP4 A;  1CEZ A;  1ZQW A;  4NLN A;  1ZQX A;  4DSE A;  1SKS A;  1ZQP A;  3TFR A;  3ISB A;  8ICO A;  5KG6 A;  3RJG A;  4EZ6 A;  4JV1 A;  4KLE A;  2IHN A;  3Q8P B;  5J2H A;  2ZJ5 A;  3BQT A;  3V6K A;  4YVZ A;  3MR3 A;  7ICN A;  3JPN A;  2HHS A;  9ICE A;  4I28 A;  4RT2 A;  5DGA A;  1D8L A;  4FS1 A;  1ZQR A;  5DKW A;  3RRH A;  1L3S A;  2BCU A;  4I2H A;  4RQ5 A;  4DLG A;  9ICB A;  4DLE A;  5L9X A;  2R8H A;  3G6X A;  4TUS A;  5IIO A;  8ICK A;  1S0N A;  3PVX A;  5KG4 A;  4EYI B;  2NRT A;  3T5K A;  1T3N A;  7ICV A;  4O3P A;  4YFK A;  1RZT A;  4KLU A;  3SYZ A;  4QWA A;  4FS2 A;  3C2L A;  9ICU A;  1V9P A;  4KLJ A;  7ICR A;  4TUP A;  4O0I A;  2ISO A;  4DSL A;  4DO9 A;  2BHN A;  1X9M A;  2FPL A;  5J0Q A;  5BOM A;  4J9N A;  1TK8 A;  7ICF A;  3OHA A;  2ZTE A;  5F9L A;  4DQS A;  2IA6 A;  1S76 D;  3MDA A;  2C2E A;  3ZD8 A;  5D46 A;  3M8S A;  4RQ2 A;  2ATL A;  4QZE A;  4QWD A;  1C7Y A;  5KG2 A;  3M9O B;  4XQ8 A;  4F4Z A;  4B9L A;  1BPE A;  4I2G A;  2HHT A;  5CB1 A;  3ORY A;  5D49 A;  5J0R A;  4RQ6 A;  2P6R A;  9ICN A;  2BQU A;  2FPK A;  3B0Y A;  4QZF A;  1JX4 A;  1ZQJ A;  2FLN A;  2UVR A;  1LV5 A;  3GV7 B;  5HHH A;  4FBT A;  5KFT A;  2HHQ A;  3LK9 A;  2AGP A;  4ECU A;  4Q45 A;  4O9M A;  4RPX A;  4B9U A;  5KG3 A;  4RU9 A;  3C21 A;  5HHI A;  9ICL A;  7ICU A;  1ZQN A;  1PZN A;  4UB1 A;  2BPC A;  4P4M A;  3H4D A;  1KSP A;  5J0W A;  1BGX T;  4RQ8 A;  4NXZ A;  4M6W A;  4QWB A;  4TQR A;  5L1K A;  5DG7 A;  4M9J A;  4F2S A;  5IIJ A;  1NKB A;  4F91 B;  3JPS A;  8ICE A;  2OWO A;  3RH4 A;  4TUR A;  4M9G A;  2VAN A;  3HP6 A;  2ZUC A;  3AUO A;  5KFO A;  2XO7 A;  8ICX A;  8ICA A;  4FO6 A;  3ZDC A;  2F1I A;  4YMN A;  1ZQQ A;  4M0A A;  4I2E A;  4Q43 A;  4ELV A;  4M9L A;  5TZV A;  4X5V A;  8ICV A;  4UAZ A;  2PI4 A;  2DPI A;  5KFI A;  5KTQ A;  9ICO A;  4Z6C A;  2AGQ A;  2C28 A;  3FDS A;  4QZD A;  2H5X A;  3RAQ A;  4O5K A;  4I27 A;  4RNN A;  4DOC A;  7ICQ A;  4M6W B;  2F1H A;  5KFD A;  2XGQ A;  3C2K A;  2XCA A;  4DOA A;  8ICU A;  4ZH4 A;  4RPZ A;  3T5H A;  3JPP A;  2R8K A;  2XGP A;  3GIM A;  5DB8 A;  5KFW A;  4RQ7 A;  1U45 A;  1ZQF A;  3EW9 A;  2AGO A;  2DFL A;  3C1Y A;  1ZQO A;  1KTQ A;  4IRD A;  1ZQY A;  2ZUD A;  3UXO A;  1HUZ A;  5KG7 A;  3EZ5 A;  5DLG A;  1TAQ A;  1X9S A;  4DFJ A;  5DDY A;  4M04 A;  4DFK A;  3GIL A;  5KT4 A;  3PX0 A;  3C5F A;  3JPQ A;  1KDH A;  4EBD A;  5J2C A;  4ED2 A;  4F5P A;  3TAN A;  3ISD A;  1NK8 A;  1QSS A;  9ICF A;  3T5J A;  3PW7 A;  4UBC A;  1RYS A;  9ICR A;  4UB3 A;  3H4B A;  2ASJ A;  3BQ1 A;  2ZTC A;  5HMM A;  3LWM A;  2JEJ A;  8ICP A;  4MEX A;  4ECR A;  4PGY A;  4GXJ A;  4G3I A;  4YCX A;  5KT5 A;  3PY8 A;  4UAW A;  1SKW A;  4K4H A;  4K4I A;  2JEI A;  2KTQ A;  8ICG A;  4ECV A;  3G6Y A;  1TAU A;  2A1J A;  1D9D A;  4DL5 A;  3EWA A;  4RQ1 A;  3LWL A;  4F5O A;  2HVI A;  5DQH A;  5BPC A;  1NJX A;  4UQG A;  3RJI A;  1L5U A;  3EPG A;  5CHG A;  2AQ4 A;  3ZD9 A;  3M8R A;  1JXL A;  2NRX A;  2MAX A;  4MFA A;  4B9V A;  4RNO A;  2KFN A;  4EZ9 A;  5L1I A;  3RH6 A;  2W8L A;  4PHA A;  3H8W A;  1Z00 A;  3H8S A;  3Q8K A;  2C2D A;  3MR5 A;  5DQI A;  3V6J A;  2J6T A;  2AU0 A;  4DQI A;  4PHP A;  3Q8L A;  9ICP A;  2A1J B;  4F4Y A;  5III A;  4R8U A;  4J9S A;  7ICG A;  2KFZ A;  5J0U A;  3AU2 A;  3HPO A;  4KLD A;  2ZTD A;  3H8J A;  4YD2 A;  1ARO P;  4DFM A;  3PW4 A;  1S0O A;  2BCQ A;  3EYZ A;  4JUZ A;  1ZQC A;  1IXR A;  3C23 A;  3M9N B;  3OHB A;  2IHM A;  3PW2 A;  3ZDA A;  5DDM A;  4PPX A;  1Z00 B;  4QW9 A;  1JIH A;  4EEY A;  2V4Q A;  3ZDE A;  4DOB A;  4I2D A;  3RAX A;  4TUQ A;  4MF2 A;  2KN7 A;  4K4G A;  9ICW A;  2JEG A;  4R8U B;  2R8G A;  4YMO A;  2M9N A;  3H40 A;  9ICJ A;  4EYH B;  5IIL A;  1A77 A;  4XUS A;  4M47 A;  7ICE A;  7ICO A;  4EBC A;  4KLO A;  3MGH A;  1NJZ A;  2BPF A;  5F9N A;  4DQP A;  5KT7 A;  3G6V A;  1U4B A;  5J2G A;  1BPZ A;  2ASD A;  2P6U A;  2WTF A;  5DB9 A;  7ICL A;  2BKE A;  3RB6 A;  9ICQ A;  4KIT B;  2KZZ A;  4RT3 A;  1NOM A;  4KLI A;  2Y1I A;  3PR5 B;  5J29 A;  1T7P A;  3C1Z A;  4ELT A;  3RB4 A;  1X9W A;  1XWL A;  4ECQ A;  5EOZ A;  4YP3 A;  8ICR A;  1NK4 A;  5KFX A;  4TQS A;  4LZG A;  1ZQB A;  2J6U A;  4I29 A;  3Q8M A;  5KG5 A;  4YD1 A;  7ICK A;  2ZJA A;  4R63 A;  1RXW A;  3KHR A;  2RDJ A;  1ZJN A;  1BVS A;  4YXM A;  1A76 A;  3RBE A;  4O3S A;  4IR9 A;  3SI8 A;  8ICW A;  1TK0 A;  3UPQ A;  1RYR A;  3V6H A;  4GC7 A;  5KFS A;  1S10 A;  2UVU A;  4Q8F A;  4B9S A;  9ICA A;  2ALZ A;  4F4X A;  3BQ2 A;  2KZ3 A;  3B0X A;  5IIK A;  3MR2 A;  3SV4 A;  3RBD A;  3AU6 A;  2BCR A;  4F8R A;  1ZQM A;  7ICP A;  5J0X A;  1ZQE A;  5EWF A;  4NLK A;  4IQV A;  1S0V A;  4HYK A;  3OGU A;  4GC6 A;  4YR2 A;  4IRC A;  1KRP A;  4UB2 A;  5KFL A;  5CA7 A;  3HT3 A;  4RQ0 A;  2BR0 A;  1BPX A;  1NK7 A;  4KLL A;  4DSK A;  1B43 A;  5KFA A;  4C8L A;  4IQU A;  5IIN A;  1UA0 A;  1ZQL A;  2IBK A;  1ZQG A;  4Z6D A;  1D9F A;  1NK5 A;  1KFS A;  5HML A;  3BQ0 A;  4F5N A;  2VA2 A;  4DF4 A;  2BGW A;  2VA8 A;  4KLT A;  4ECY A;  4DFP A;  1XS9 D;  2FLP A;  2HHX A;  5KFG A;  3KTQ A;  4DSF A;  4BWM A;  5DQG A;  2NRW A;  4J9L A;  1ZQV A;  4CCH A;  3V7L A;  1TV9 A;  3PO4 A;  2UVV A;  9ICG A;  1HJP A;  2PFO A;  3HW8 A;  1U47 A;  5C5J A;  3KHG A;  2PI5 A;  9ICX A;  4I2I A;  3HX0 A;  1ZQA A;  3ZDB A;  1XSP A;  3C2M A;  7ICT A;  8ICZ A;  4ECZ A;  2BCS A;  8ICH A;  2I1Q A;  5KFK A;  3GIJ A;  1NK0 A;  4M2Y A;  4B9N A;  3MBY A;  4XA5 A;  4BWJ A;  4R64 A;  5D4B A;  2XY7 A;  2V9W A;  4F4W A;  4F5R A;  3ZDD A;  5KT3 A;  4UAY A;  1ZQK A;  3HWT A;  5DGB A;  1U9L A;  4C8K A;  3JPT A;  4ECS A;  4YQW A;  1ZQD A;  4KLF A;  2AQ0 A;  4J9R A;  1MQ3 A;  4UBB A;  9ICH A;  2W9B A;  2RDI A;  5IIM A;  2GWS A;  3MDC A;  1NJY A;  1SL2 A;  5KFQ A;  4ED6 A;  9ICC A;  3RR7 A;  3QZ7 A;  5J2K A;  1LB2 B;  3Q8Q B;  1ZQS A;  4F2R A;  4DQQ A;  1NJW A;  1JN3 A;  4PHD A;  3H7I A;  2BQR A;  8ICS A;  3RJE A;  7ICM A;  4P2H A;  3RJF A;  4PGQ A;  1SKR A;  2FLL A;  5KFP A;  3OSN A;  9ICS A;  1MQ2 A;  3PML A;  4I2B A;  4ED3 A;  5DLF A;  2UVW A;  2W9B B;  1N48 A;  3RRG A;  3UXN A;  3IM1 A;  3GFK B;  5EWE A;  1N56 A;  3TAP A;  4E0D A;  3SV3 A;  3T3F A;  3PR4 A;  1L3V A;  1S77 D;  3PMN A;  4M9N A;  1Z3E B;  1NK9 A;  8ICY A;  5J2E A;  4KLH A;  3TI0 A;  4C8O A;  4Q8E A;  3TAQ A;  1D8Y A;  2B21 A;  4UB5 A;  3TAR A;  3QE9 Y;  4UB4 A;  4O3R A;  2HVH A;  1QTM A;  2R8J A;  1BPD A;  2ZJ8 A;  2ISP A;  3MFI A;  2PFQ A;  2AJQ A;  5J2A A;  3RH5 A;  9ICK A;  5J2F A;  1MSW D;  8ICQ A;  2XCP A;  1XO1 A;  1UT5 A;  4YXJ A;  4YMM A;  3GV8 B;  3EPI A;  4EBE A;  2IMW P;  3GII A;  1SL1 A;  3RR8 A;  5KT6 A;  5KFH A;  3MFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...