1NK0A

Adenine-guanine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk0A01
1LW0A 1J5OA 4DL5A 3SNNA 2DFFA 5C42A 1UA0A 2BQRA 4PGQA 1NK7A 3O3HA 1Z26A 4KPYA 2FMPA 4CCHA 3C1ZA 4CERA 1JX4A 1W0HA 4M9LA 3JPOA 4YXJA 2GUIA 5KT4A 2UVWA 3PMNA 1NJWA 1J9AA 5EU7A 3AVBA 3AVHA 1R0AA 4QZBA 4JWNA 4DTNA 4HUEA 3M9NB 2X78A 3PR4A 4FYDA 3T1AA 1BCMA 3AA2A 4UAWA 5CR0A 4KKOA 2HW3A 4CJRA 4DL3A 1CEZA 4W5OA 4F4ZA 1CZ9A 3OSPA 2DY4A 3V1RA 1ZBLA 4KTZA 1RT5A 5FROA 4MEXA 4YMNA 2IA6A 1WSHA 3JPNA 1ZQIA 5KFEA 4TUSA 4M9GA 2FBTA 4DL4A 3LAMA 3IG1A 5HROA 1RBVA 1TAUA 2ZE2A 4MFFA 8ICTA 5JS1A 4F2SA 5DQIA 4CGGA 4ID1A 4AHVA 4O3SA 2ZJ5A 2HHTA 1MSWD 1B43A 3KLFA 2W42A 2PI5A 1A5XA 2IMWP 4QWAA 8ICQA 5J2KA 3BDPA 4RW6A 4DQSA 2FBYA 4CGDA 2Q0ZX 3OY9A 1RTHA 4O3PA 4M41A 4FLTA 4DS4A 4DTPA 1SZPA 3C94A 3CM6A 2W9BB 3RMAA 4O4GA 5KFGA 1S0NA 1XC9A 3ULDA 4YNQA 1VRUA 7ICTA 1S0MA 9ICUA 1UT5A 4M3XA 4IFYA 9ICTA 1BIZA 2V4RA 1C0MA 1NOMA 3EZ5A 2XGPA 7ICMA 3EPGA 3NTUA 3AVFA 5C25A 3MDAA 5KFAA 4RQ6A 1WLJA 4ECQA 5KT2A 4CF1A 4ECTA 1VK0A 2P51A 3QO9A 4O0JA 5KFRA 1S1WA 4H4OA 1I3AA 4R5PA 3LZIA 3V6DA 1TV6A 4DOBA 5DBBA 4C8LA 4KLFA 3H4DA 2QKKA 5J2NA 3K5OA 4FLWA 4DTXA 3SI8A 3V9WA 3KTQA 4KLEA 3IM1A 3KJVA 2KTQA 3HYFA 4B3OA 5J0QA 1IKVA 3RJGA 4PH5A 4KITB 1JL1A 4KLTA 2LYHA 2ZJAA 4NCBA 3KHHA 1NKEA 2W8KA 1ZQRA 4CJVA 5KFHA 3MEEA 4FJJA 3OVNA 5I42A 4YFUA 3K2PA 2ZTCA 1Y97A 1G15A 3QEPA 4I2QA 1RT7A 1BCOA 3V4IA 4MQ3A 3H8SA 4DU4A 4Z6EA 3LPTA 1PZNA 5DGBA 3RRHA 2FBVA 1JXBA 2BCRA 1BHLA 2ISPA 4KB1A 3AA3A 1WSJA 4AHCA 1ZQZA 3BQ2A 4I7FA 1RT6A 3PUFA 4ZHRA 1D9FA 2YV0X 4MFAA 3TWHA 4FBUA 5DDYA 3NH2A 3PW0A 9ICEA 1ZQUA 2BQUA 1XSPA 3EPIA 4DTUA 4RQ5A 5KFZA 1B22A 4ED2A 4EBCA 4E7JA 2BQ3A 2HHSA 4FK2A 7ICQA 4O55A 1TKTA 3V6HA 2DTUA 4FLXA 2C2EA 1NK6A 2OWOA 2X6SA 3TI0A 4OPKA 4CEFA 3AO2A 4QZFA 1RT1A 4IR9A 2R8JA 2C22A 3AO5A 4FLZA 4R64A 8ICNA 3NGZA 3BQ1A 3RWUA 3SQ4A 1S77D 3VQ4A 1NK9A 5CJ7A 1ZBHA 3PW2A 2ITGA 4BXOA 4CJPA 3QETA 3LAKA 1BVSA 3PX6A 5FDLA 3CQ8A 3RJJA 4NM1A 5KFSA 5KFYA 3L2QA 1ZQXA 3HX0A 4GMJB 1RYRA 3CM5A 4MFBA 8ICMA 2HHQA 1S9EA 4DO9A 1DLOA 4J9RA 4Q44A 1ASWA 4FJHA 4UB5A 2YHBA 3U3YA 4FJ9A 4P4PA 2OYQA 1Q9YA 1DTQA 3CFRA 3PV8A 2BPFA 4I2HA 4GVMA 3IAYA 4ICLA 3RAQA 1LB2B 4ED3A 3NGIA 1X9MA 3AVJA 3SQ1A 1ZQJA 5DB8A 4BE1A 1Q8IA 4BACA 4Y1DA 3NF6A 3ZCMA 4QWDA 1JKHA 1A5WA 4W5RA 1JXEA 2F96A 1ZQFA 5J1EA 3MAQA 4MEYA 2VA3A 1J54A 4KHUA 3B6OA 5KT7A 2WONA 2NRWA 1RDAA 2KQ2A 4DFKA 2UVVA 8ICHA 1NK4A 3LDAA 4CJ4A 4F4KA 3LK9A 1LWFA 4DL2A 4RT3A 3PY8A 1Z00A 4NM2A 1RDBA 3SCXA 5DB6A 1KVAA 3L3UA 4KLUA 3ZD9A 1TGOA 2W8LA 5HHIA 2R8IA 3VQ8A 4ID5A 2ZUDA 4B9LA 3OYMA 3TQ1A 3NBPA 1Z3EB 3K75D 3AVMA 1TVAA 3KKRA 5K14A 2G8KA 3PR5B 3MXJA 2YNIA 4DWIA 4J9MA 4ZTJA 2FC0A 3V9XA 5EWGA 4KLLA 1WCNA 3C5GA 4B9SA 4JV1A 3ISCA 4NLGA 1GOBA 4TUQA 4FM1A 3V81A 1F21A 3VQ5A 3DRSA 4UQGA 4DLEA 2AQ0A 2UVUA 1QHTA 3LP3A 4M6WA 2YKMA 4RNMA 4CJ3A 2D0AA 1N6QA 4KLMA 4DSFA 2ASLA 3OYDA 1NK5A 1QE1A 4ELTA 2Z1HA 1NJZA 4J9OA 3JPTA 4CE9A 1JL2A 1KEJA 1KVCA 4Z4FA 4P4OA 3HSTB 2P66A 3V1QA 4OJRA 5J2QA 4KHQA 3NGDA 1XS9D 2RDIA 3DLKA 4TSXA 2NRXA 1KLMA 4QZDA 3L2VA 4R8UA 5C24A 5HLFA 4J2DA 5KFXA 4YD2A 3OYJA 2IHNA 5J0XA 2F1JA 2HNYA 3RB4A 2MAXA 2XY6A 1ZQYA 2C28A 3OYKA 5KG3A 5F9NA 2YNFA 1YTUA 2KW4A 5KG1A 4C8KA 4EP5A 2W9AA 4DQPA 3OHBA 4YCXA 1JXLA 5J0YA 2V4QA 4NXZA 3LALA 2RN2A 1BISA 4OGEA 3KK1A 3KK2A 3H4BA 2FLNA 1YT3A 4DFJA 2Y1JA 3M8PA 1TL3A 5I3UA 3UQ2A 1EP4A 3JSMA 1Z00B 3HP6A 5KI6A 2A1RA 4CF9A 8ICWA 4G3IA 3VN5A 3FYHA 4GW6A 4Q43A 1BPBA 2XGQA 5DBCA 3TARA 2IOCA 5KTQA 7ICNA 4RPXA 3QNOA 2RKIA 4BDYA 8ICGA 4E19A 1TKDA 1HNIA 4KHSA 4OKEA 4DSKA 4KRFA 2P6RA 1LWCA 3DOKA 3V9UA 4ELUA 1T7PA 4K4IA 3T19A 1HQEA 3H08A 4I2PA 5DK5A 1O1WA 1ZQBA 4CEAA 3ZT0A 7ICIA 3RH6A 4I2DA 3WNGA 4HTUA 4PHDA 3MDCA 4N5SA 4IQTA 5J2AA 4RU9A 3I8DA 2I5JA 1RDDA 5DBAA 2A1JA 4FS1A 3CFOA 5J0PA 3ZSWA 3C95A 3LP0A 8ICYA 4B9MA 4RPZA 5KFDA 4Q8FA 3SYZA 5HP4A 1S0VA 4DG1A 3QZ8A 3C21A 4YFKA 3VQCA 1RPLA 3SV3A 4M9JA 7ICJA 1RT3A 4FXDA 4DTMA 9ICPA 1CXQA 5J2EA 3PX4A 5SZTA 5KFQA 4MFCA 3UXNA 4UAYA 4ECXA 3MECA 3CG7A 3KD5E 2KZMA 1QSSA 4DF4A 4M3WA 3HM9A 4FJXA 5J2DA 2HHVA 4FW2A 4I2AA 4KN4A 3TANA 3KD1E 4IRCA 5KFTA 2X74A 3ALYA 1IO2A 4QW9A 1YTAA 5HMMA 4CFAA 4O3OA 5BOLA 4DMNA 5D4BA 1VRTA 1DOQA 4ECYA 4NY8A 5DKWA 4J9QA 4Z6CA 4KO0A 4KLJA 1XSLA 4RQ8A 4FJMA 3SPYA 3MR5A 4JS4A 1S9FA 3G6YA 3KLIA 1RDCA 4QZ9A 4KFBA 3C5FA 3KLEA 1N56A 3MFHA 4AHTA 4J9SA 3OHAA 4KLQA 5IIIA 4BWMA 2KZ3A 1HUOA 1XHXA 4F5RA 4ECUA 2IC3A 3B0XA 1XHZA 4DFMA 1U49A 2J6UA 3DRPA 1RBUA 2WOMA 3G6VA 2C2DA 3MGHA 2JEFA 3Q8QB 3MR2A 1JLCA 4R65A 1WSFA 5DQHA 2HHUA 1ZQMA 4YQWA 1Z25A 3UIQA 4GLXA 3QIOA 5L1JA 3OS0A 2XHBA 3SZ2A 1ZJNA 4XQ8A 5BPCA 3C23A 1KTQA 4DLGA 2W9CB 1SL2A 3VA3A 9ICIA 9ICQA 3N4MB 4KLDA 4MF8A 1ZJMA 2BANA 1KSPA 3PW4A 3GIJA 3V72A 2F1IA 3HPOA 1ZQDA 1RXVA 1JLAA 3IRXA 1C1AA 4E1MA 4PWDA 4Z6FA 5HRRA 5JUMA 1EX4A 4YMMA 4UB2A 3GV7B 4FLVA 2HNDA 4R63A 3LZJA 5KG2A 5J2CA 4IG0A 3C2MA 5J0OA 4DOCA 1EETA 3ZT4A 5C5JA 1T8EA 3LPUA 8ICSA 1ZQAA 1S1TA 4QOZB 3M8RA 4K8ZA 2ZD1A 5KFPA 3PX0A 4I2EA 2DFEA 4KB0A 4QZEA 4FJLA 7ICGA 1U9LA 3L2UA 1NOYA 5F9LA 5L1IA 3RJKA 2R7YA 3GV8B 1RBTA 1C6VA 3Q8PB 3ORYA 1EKEA 3ZSQA 3VA0A 2FPKA 3MXIA 4OVLA 4KHNA 4FZYA 7ICEA 1ZQVA 3AV9A 4NCGA 3T3FA 4F8RA 1ASUA 4CHPA 3G6XA 5IIMA 3AO1A 4HYKA 1ZQPA 4RQ1A 1S1XA 4CJUA 1IH7A 3DLBA 1HNVA 1N48A 3ZDDA 3RMCA 4PA1A 3DYAA 4YD1A 4I2BA 3WNFA 3RMDA 4IBNA 2XY7A 3P1GA 2ZUBA 4B9VA 3M8QA 4PHEA 4CHZA 3MXMA 4JS5A 4DFPA 4DOAA 2AU0A 2JEGA 1XWLA 5CZ1A 3RJEA 4CJWA 3DI6A 3D0PA 4M6WB 4UB4A 4CK2A 2P1JA 4RQ0A 4ED7A 3VQ6A 4DS5A 4Y1CA 5J2MA 2OPRA 4TQRA 4CK3A 5SWMA 4CGIA 1JLEA 4KAZA 4LZDA 5KFWA 2BPGA 5E41A 3KHGA 3OJUA 1IG9A 5DDMA 5KT6A 3TAPA 3ZSRA 5JS2A 1IKXA 3B0YA 1ZQEA 3SUQA 5IINA 3GDXA 4FCYA 1A5VA 1HUZA 1TFRA 4I9LA 3DOLA 3AU6A 9ICJA 3WNEA 8ICVA 3PO4A 1ZQKA 1RTIA 3DLRA 1K1SA 9ICKA 2R8KA 1ZBFA 5KFIA 3SJJA 9ICSA 4CJ5A 4HHTA 3C6UA 4IFVA 4AHRA 7ICSA 4RQ7A 2BDPA 3RH4A 4I28A 2P5OA 4ED1A 4P4MA 3ZDCA 1HYSA 2IGIA 1COOA 3QEXA 3OGUA 1ZETA 4EBEA 1X1PA 1S97A 3ZT2A 1RT4A 1WSIA 4I27A 2XC9A 4N47A 3S3MA 4DTRA 5J2HA 1VSKA 3RJFA 9ICWA 3UXPA 4FJ7A 4ECZA 9ICHA 3OYGA 5DLFA 2W9BA 2PYLA 4C8MA 3RJHA 2IAJA 4KTQA 1NJXA 2MUTB 4CK1A 4FJNA 3OYFA 3SQ0A 3O4QA 3KLGA 8ICBA 5J0RA 4CHYA 4F4XA 1WSGA 4J2AA 5CYMA 3RB3A 3NFAA 4EZ6A 3BQTA 4NLNA 3QEAZ 3RBDA 5CYQA 3JPPA 3N97B 1QSLA 5J29A 3MR6A 4RT2A 2Z1GA 1BPEA 3PVXA 9ICCA 1S76D 5KG4A 4QWCA 1JN3A 1BI4A 3DLHA 1CXUA 4I2JA 5HNKA 3F9KA 2XCAA 2HNZA 5KFJA 3G10A 1VSMA 4RNNA 4F4YA 2BCVA 3Q8KA 3NGYA 4NCAA 4W5TA 5HRNA 3L2RA 3JPSA 3BGRA 3AU2A 3RBEA 1QTMA 2Z1JA 9ICXA 7ICLA 3GFKB 3ZSZA 3V7KA 2UVRA 2OPPA 3V9SA 4YR3A 1ZYQA 5CZ2A 1JLGA 1D8YA 4O5BA 5KFCA 1B92A 4J9NA 1D8LA 3HPGA 4J2EA 3VQDA 3NDKA 3VQ7A 3SUNA 1BQMA 1QQCA 4RNOA 4DTJA 3RAXA 8ICCA 3AVAA 2VANA 1JLQA 4Z0UA 2DPJA 1RT2A 5BOMA 1TK5A 4C8OA 2HVIA 1C0UA 4CJFA 3ZSXA 3M9OB 3QIPA 2AJQA 1RNHA 3HVTA 3QNNA 4RUAA 3AVIA 4CJSA 2PY5A 2JEJA 3AO3A 1KFDA 3TAGA 1HYZA 4AILC 3RMBA 3HXMA 2BKEA 9ICNA 3S9HA 2P5GA 4FK4A 5KFLA 8ICPA 1FKPA 4IQVA 3THVA 4CIFA 4EZ9A 4O5CA 5KG6A 2VG7A 3KIOA 3V9ZA 4M3YA 4YR2A 1L3SA 1ZQWA 1U48A 5HHHA 2KN7A 2G8FA 1X2IA 8ICZA 3JPRA 5KFBA 2ASDA 4FJKA 1XI1A 3SUOA 4LSLA 4PUOA 4KI6A 4PHPA 4AH9A 4FLUA 4BGDA 1UA1A 1CLQA 4M3TA 9ICGA 3JYTA 3KHLA 4CFDA 1X9WA 4UB1A 3O3GA 2FBXA 1X9SA 2P6UA 9ICBA 3VQBA 3U3GA 3QERA 5FRNA 4F93B 4CIEA 4KI4A 4HCCA 4DSLA 1ZQQA 3H7IA 4RW8A 3UQ0A 4W5QA 4E1NA 4CEQA 5D49A 4IG3A 3VQ9A 4O5EA 1ITGA 3I0SA 3E2EA 8ICKA 4DTSA 1BPZA 2G8VA 2ZJ8A 4KLHA 5KT3A 1HMVA 4K8XA 3IHQB 1ZQOA 4GC7A 5HRSA 1NK0A 3K59A 4RG8A 4JV2A 2R8GA 3OYHA 4DSJA 4CEOA 4FJGA 2VWJA 3NH0A 4CHNA 1L3VA 3LANA 4RUCA 2IHMA 4O44A 1KFTA 1GOAA 2BPCA 7ICHA 4F50A 3HT3A 1U4BA 3PMLA 4MF2A 2HVHA 1BL3A 5J2PA 1KVBA 5EWEA 4TUPA 3I0RA 1LAVA 4DTOA 3V1OA 3HK2A 1JLFA 3GV5B 1RBSA 4EEYA 4FO6A 4CEDA 1S5JA 4O3QA 1UWBA 1ASVA 1WAJA 3ZT1A 1ZBIA 1SL0A 2B6AA 4DSIA 3ETLA 4ZH4A 2KZZA 4M3UA 4B08A 3HP9A 4E89A 3AO4A 4E7LA 5TZVA 4M9HA 3T5KA 4W5NA 2HB5A 4HVJA 1TK0A 7ICPA 2W9MA 1RBRA 3QLHA 3AVGA 5KG7A 8ICEA 3C2LA 4O0IA 4XA5A 4QZAA 2HMIA 5DG8A 4QZCA 1S9GA 2OPQA 4F2RA 1LW2A 4F5OA 2QK9A 3MEGA 3C6TA 1S0OA 3E01A 4F5NA 1HQUA 3OYAA 4CECA 3Q8RB 4RZRA 4JWMA 4J9LA 4Q8EA 2FMQA 3RTVA 3K57A 4CHOA 2FPLA 2FPMA 3TAQA 3DLEA 3QEWA 4EYIB 2I1QA 9ICRA 2F1HA 4RW7A 2FMSA 2VG6A 3U6FA 2PFQA 5KFFA 4FS2A 4YP3A 3BQ0A 5CB1A 1AROP 1QS4A 3GQCA 4ZTFA 4HUGA 5DB9A 2D5RA 3UPQA 5D3GA 3P5JA 5J0UA 1U47A 3MBYA 2J6SA 3V7LA 2RF2A 2X6NA 1CZBA 5KFMA 5J0TA 3OYCA 4I2CA 4DEZA 3SUPA 5DB7A 5KRSA 2JEIA 5IIJA 4BDPA 1C1BA 4M3ZA 3OYIA 4L8RB 4OKJA 2E6MA 9ICFA 1WNSA 2G8UA 4Z4HA 4GC6A 4M0AA 5J2JA 3V7JA 3AA4A 4JRPA 1LV5A 4OLBA 3S3NA 3AVKA 4I2FA 3HW8A 4DU3A 1UOCA 3SV4A 4CJKA 1H38A 9ICOA 1JIHA 3AUOA 2HHWA 4P2HA 5D46A 3VQQA 1VSIA 3KK3A 1KRPA 4FVMA 3RB6A 4I2GA 1NKBA 1VSJA 3GILA 3MEDA 3KHRA 4EBDA 3QEBZ 4RQ2A 2YNHA 3MR3A 4KMUA 2JLEA 1KLNA 9ICMA 8ICXA 8ICJA 2W9CA 4HUFA 3OYBA 2XY5A 3ZT3A 3Q8LA 3OJSA 4F3TA 1IM4A 3BJYA 1NOZA 2BCQA 3PW7A 4FLYA 1VSLA 4CEZA 4CJLA 4QWEA 1C1CA 1SUQA 4DL6A 3M9MB 1UT8A 1L3TA 2DFLA 3ZSVA 3TFSA 1BPXA 4FBTA 4N76A 5KGXA 4X5VA 1HPZA 3HJFA 3C2KA 4FZXC 1BQNA 3GIMA 4LD0A 4KLGA 2XO7A 1I39A 2ZUCA 3DLGA 3VQAA 4BXOB 3MABA 3OS1A 1C0TA 4CF2A 5HP1A 4YR0A 4E3SA 4UB3A 3RRGA 3L3VA 4R66A 2DFHA 4F91B 3IS9A 1BIUA 1ZQLA 4BDZA 3K5NA 1YVUA 3ZDBA 1JMSA 1Y88A 8ICUA 1RTDA 4HCBA 4FW1A 5DG9A 4JV0A 4IRDA 4F5QA 4O9MA 3KLHA 1ZQNA 1S10A 4OLAA 2ZQBA 2E4LA 4LH5A 4LSNA 5J2IA 3G0ZA 3LDSA 4Z4GA 1IXRA 4RW4A 2BCUA 2H5XA 2IDOA 7ICFA 3AA5X 4DQIA 4RQ3A 4H4MA 1C7YA 4F4WA 4CF0A 1TKXA 4QCLA 4IDKA 4AHUA 4DU1A 1NJYA 1JLBA 4FM2A 3HWTA 4N56A 1K1QA 1U04A 8ICOA 3QEIA 3KKSA 3ISDA 1ZQHA 4ED8A 2OZMA 5KG0A 1XU4A 4ED6A 4OPJA 1BGXT 1A76A 3HPHA 2A1JB 2VG5A 2KFNA 5J2BA 1LAWA 4QWBA 3WNHA 4IQWA 1B9FA 3L2WA 5DQGA 4TQSA 2B21A 1MC8A 3AVCA 4I29A 2HHXA 7ICRA 4Z6DA 2OPSA 5IIKA 4I2IA 3TR8A 5EOZA 3VQEA 2AQ4A 1HRHA 3RR8A 4PY5A 1ZQSA 4UBBA 2PXIA 2DPIA 5IIOA 4E7HA 4QZIA 4UAZA 3MFIA 1SKWA 1S6PA 2Q3SA 4BE2A 1KDHA 1EXNA 2BCSA 2EX3A 3L8BA 1DGSA 1ZQCA 2PI4A 4AHSA 4CGJA 4CGFA 4NYFA 3V6KA 3OYLA 1BI4B 4OGCA 4RQ4A 4M47A 1VSHA 1S1VA 2JGUA 4RPYA 4FZZA 4KTWA 1MQ2A 5HRPA 5KT5A 2WTFA 1VSDA 3TABA 1GOCA 4J9KA 3D45A 4GXJA 4R8UB 4YMOA 3NH1A 1LWEA 2F8TA 2YKNA 4XIUA 2O4IA 2ALZA 1RCHA 5KFNA 1WAFA 2AGPA 3LP2A 4ECWA 4M2YA 3O4NA 4CIGA 5KFUA 3QEVA 4PGYA 4PHAA 4KHYA 1BPYA 4FJ8A 2IBKA 3HO1A 2ATLA 1L3UA 5KGWA 3T5JA 4CGHA 4J2BA 4Z4CA 1S1UA 3RB0A 4YN4A 5DLGA 4QAGA 4Q0BA 3QZ7A 2PFPA 2JZBB 1CUKA 2NUBA 3HVRA 3TFRA 5KFKA 5CY4A 4CESA 1HJPA 3NF7A 2GV9A 1SKRA 4M45A 1REVA 1MQ3A 1WCLA 5CWRA 2PYJA 1ZBUA 3F73A 2O4GA 1FXXA 1J53A 2PFOA 5CHGA 3EY1A 5J2GA 1XO1A 2YNGA 5J0WA 4XUSA 4LH4A 3NE6A 3RH5A 1TL1A 2D0CA 1WN7A 9ICAA 4KLSA 4PQUA 4YXMA 1VSEA 2BGGA 4KV8A 2XCPA 3SQ2A 3NF8A 1VSFA 2FLLA 3ITHA 3B6PA 3PW5A 4IQUA 3VQPA 4H8KA 3DMJA 1HJRA 2QXFA 3TAEA 3V6JA 2ETJA 2B5JA 4M42A 1N5YA 5IILA 3P83D 1XSNA 4B8CA 3QESA 4YG2A 1FKOA 2RDJA 4KLIA 4QZ8A 2GWSA 2ZTDA 3CFPA 4M9NA 2LSNA 4UBCA 4DQQA 4YVZA 3K58A 1V9PA 3SPZA 2KFZA 5KRTA 1IKWA 4KREA 3ISBA 4Z4EA 4BWJA 3GIKA 1SV5A 4DF8A 5L1KA 5CP2A 3QINA 3LWMA 3NAEA 2QKBA 4I9QA 4EP4A 1D9DA 2OZSA 2PFNA 2PZSA 4M04A 1W9HA 8ICFA 2XY8A 4PGXA 4PPXA 3RR7A 3T5LA 4CJTA 4FJIA 3ZSOA 5CA7A 1A77A 2J6TA 1EXQA 3DRRA 4QZHA 1MU2A 4G1QA 3SI6A 1T3NA 1RILA 1B9DA 3H40A 5KFVA 3Q8MA 3TAFA 2VA8A 4RW9A 4O5KA 7ICVA 1SKSA 1IKYA 3LP1A 1Q9XA 4CJQA 1T03A 4CJEA 3LWLA 2E6LA 2BR0A 4EYHB 7ICOA 4E7IA 2FLPA 2NRVA 2ASJA 3NHGA 4DL7A 3AVLA 3C1YA 3FDSA 3FFIA 4CFCA 2BE2A 2IS3A 4ED0A 3K5LA 4XRHA 3S3OA 5FRMA 2ISOA 1UAXA 4E0DA 1TAQA 3H8JA 4BE0A 5EWFA 4ECRA 4NLKA 4ELVA 3EYZA 1WSEA 5T7BA 3O3FA 2B4JA 4LVSA 3DM2A 4FM0A 4JRQA 1ZQTA 1U45A 1TVRA 4F92B 2I9GA 4ECVA 4KN7A 4NLZA 1QSYA 4IR1A 3HL8A 1RXWA 2V9WA 2ZTEA 3T5HA 2OA8A 4O3RA 4O3NA 3ZD8A 3PNCA 4K4HA 2MUTA 2AGQA 1SL1A 2GBZA 3OS2A 4JUZA 4IRKA 2R8HA 2XRIA 3OYEA 3GIIA 4IKFA 1ZQGA 5HBMA 3K4GA 4CF8A 3JPQA 3Q8SB 2A1SA 2JZBA 3TAMA 2BHNA 3M8SA 3ZDAA 1RYSA 8ICAA 1TKZA 4CEBA 4Q5VA 5J0SA 4LZGA 1HYVA 1KCFA 2EHGA 2VWKA 4FK0A 1DTTA 2RPIA 3ISNC 4FJ5A 1T4GA 5DG7A 2G8IA 8ICLA 1BPDA 4QZGA 2NRZA 5J2FA 3A2FA 1NKCA 5DGAA 1L5UA 5KG5A 2BGWA 1TK8A 2Z1IA 3ZDEA 3RJIA 4JK1A 4Z4IA 3ASMA 4LY7A 1RZTA 4E7KA 1NK8A 4ECSA 3UXOA 1K6YA 2G8HA 4NYNA 5KFOA 5DMRA 8ICIA 3EWAA 2F8SA 4F3OA 7ICUA 4B8AB 1RTJA 4TURA 9ICVA 8ICRA 1T05A 1KFSA 2D0BA 4CFBA 4DQRA 2VA2A 1S6QA 9ICLA 1QLNA 4KHWA 5HMLA 7ICKA 4DSEA 5L9XA 4Q45A 4CHQA 4CEEA 3AVNA 1FK9A 3H8WA 4B9UA 4GXKA 4QW8A 3QE9Y 5L1LA 4K4GA 2ATQA 3MGIA 3OYNA 3NF9A 1TV9A 3CYMA 3K5MA 4KLOA 3PO5A 4J9PA 4B9NA 4WE1A 2AGOA 2YHAA 3ZSYA 2Y1IA 4JLHA 3OSNA 2G8WA 2M9NA 2C2RA 4F5PA 1D5AA 3EW9A 4N41A 4C8NA 4OKKA 3NCIA 4B9TA 4GXIA 2NRTA 4M3RA
chains in the Genus database with same CATH superfamily
4ZVHA 1EZZB 1CQMA 4K43A 4Y2AA 2GEMA 1C1BB 3OXGA 4NLPA 2LDIA 2NZCA 2QWQA 4JK7A 3C1ZA 4CERA 1W0HA 4K41A 4M9LA 1BY9A 4OHXA 3BDEA 4Q0BB 1ZA1B 1OH5A 2GUIA 1IJEB 3S6JA 3OTOJ 1A9NB 2WOMB 4Y28C 1J9AA 2E8PA 4AT1B 4JI8K 2B7CB 1VQSA 1N0UA 4DTNA 3ETMA 1WOQA 1MROB 2X78A 2C1EB 4CNQA 1M90O 2R2RA 4CO3A 1BCMA 3HFKA 2MKSA 1Q79A 3AA2A 4JI4K 4UAWA 5CR0A 2RQ4A 3Q23A 2HW3A 3H0MB 1HNZK 2NR0A 1X60A 3ZZUA 1CEZA 4D3HA 3BH7B 1PG5B 1J6ZA 3OSPA 5CABA 3ATUA 2YB1A 2CQ3A 4KTZA 4YMNA 3RGIA 1VQ7N 5B66U 5KFEA 4A2AA 4TUSA 4O0NA 2FBTA 4YS2A 4DL4A 3LAMA 1U1OA 1TAUA 5LJVA 3UFCX 5AKYA 4WFAQ 1RHQB 3C14B 8ICTA 5JS1A 1NB7A 3WEEB 4ID1A 4AHVA 2HHTA 2ZJ5A 1F5CA 4JI5J 2PI5A 2P9KB 4F9OA 2IMWP 5HSPA 3PSPA 3KJFB 2Q0ZX 3OY9A 4OHZA 2UU9J 1BA1A 4M41A 4DR6F 3HZ6A 1IJJA 2KXFA 1WNEA 2HDOA 5A2QU 2Y0BB 4X4PA 3RMAA 1S0NA 5FIIA 4RNFA 2WONB 2O1PA 9ICUA 1S4EA 3TP2A 3DRXA 2OEJA 4PQAA 4IFYA 1D09B 9ICTA 4GRSA 5EX0A 4LMZA 2KT3A 1TV6B 3EPGA 2YX7A 5FP0A 5KFAA 2CNOB 4RQ6A 3OVAA 1WLJA 2QRRA 1RDFA 1QTNB 2IOFA 4CF1A 5CZXA 2F65A 3V4IB 4NMXA 2YY3A 3CCRS 1HKCA 4H4OA 1TTHB 1TV6A 3SLCA 4ZLNA 4XK8C 4DOBA 5DBBA 4HTLA 2MQNA 1SJ1A 3H42A 1FE0A 1MDUB 4UW9A 3HD2A 2KD1A 3KTQA 3PG9A 3FZMA 3IM1A 3TADA 3DU6A 1BO5O 3M1VB 1RYUA 2JR5A 1T05B 1N36J 2KTQA 3QLHB 3RJGA 1WWHA 1QAXA 4AD6A 4KITB 1EQ0A 4CM0A 4KLTA 2LYHA 5D6GA 4DPTA 2DBYA 1NKEA 1ZQRA 4JI4J 2DNRA 1M5KC 2IM0A 1DQAA 4KPCA 3QEPA 3NLCA 4MFBB 4LF7K 5ALTA 4EEKA 3V4IA 2V94A 5GAHU 4X4RA 3H8SA 5M1QA 5T14A 1FT8A 2I6XA 1RA6A 3C14A 4NA3A 5IXUA 4NYZA 3RRHA 1ZD3A 1QAJA 1F5AA 2BCRA 3R9KA 1Q7YT 1R0CB 4YOXA 1WSJA 2K4HA 3RYLA 3CCZA 4ZHRA 3QWUA 3PUFA 1D9FA 3J7ZO 3TWHA 4FBUA 4USHA 4RL1A 2CVIA 9ICEA 3OBWA 2BQUA 2DXEA 1XSPA 3EPIA 4P0PA 4DTUA 4RQ5A 2L41A 2V5HG 4RWTA 5HROB 3DLKB 4ED2A 1SV5B 3R8YA 2WFBA 4EBCA 4E7JA 3O2IA 2ITMA 4IJAA 2XBPA 1RADB 4GNIA 3BGLA 4AYBF 2KMDA 1UP1A 1RGVA 1NK6A 2OWOA 1EHWA 1VK8A 5LM7E 3C6UB 4OPKA 4CEFA 3DC2A 2JGAA 5AKGA 4WP9A 3BO4A 4IR9A 4WKYA 3GZFA 5LMNK 2C22A 1Y0HA 2OANA 8ICNA 5AICA 3BQ1A 2HBKA 3KWGA 1S77D 1NK9A 3ZX0A 3SBTA 1RAFB 4CJPA 5EE9A 4XH5A 4MK7A 3AAWB 3AA9A 5KFYA 3L2QA 1U1MA 4GMJB 1J2MA 1RYRA 1MWYA 1VHXA 4CLKA 3ZX3A 3IGVA 2AZ3A 2WB4A 4OJ6A 3HFZB 2ZEJA 5CD4A 4BC4A 1DTQA 2EWSA 2L5YA 3CJ9A 4FE3A 1C20A 2R7QA 3RAQA 3T1YF 4LSLB 1YBTA 4F71A 3PACA 1S72N 4KSEB 3AVJA 4BRQA 2A6OA 1RBLA 3GCWP 1XR6A 2VB6A 2KXNB 2AJ1A 8ATCB 2NQPA 5GAGI 1PJ5A 1ZQFA 3N0VA 1JJCB 4PXDA 1Q8LA 2WCXA 2VA3A 2JLGA 3CP8A 4DFKA 2KQ2A 5K8MA 2CPEA 1NK4A 5AK5A 4MMOA 3PY8A 1FERA 3P8BB 3VEVA 5BPMA 1V5IB 1FW6A 1NGHA 4ZOHC 2XSJA 2R8IA 3D2SA 2ZUDA 1Z3EB 2HLUA 3D0HE 1HQ2A 3FRYA 2GHVC 5DDRC 2YH0A 4DWIA 3W9JA 2K1RB 2F7TA 5BRHA 1HIYA 4JP8A 1YXQA 4IJNA 4KLLA 4K4TA 3GFZA 1UETA 3HKZD 4JV1A 2SXLA 5GADI 4FM1A 3V81A 1MN9A 1F21A 2MLZA 5M1FA 2IAJB 3DRSA 1KD1T 5BN9A 3G86A 1HLWA 3RF9A 1EJ7L 4R79A 1XQIA 3PZPA 2D0AA 2XZDB 3OYDA 1S1VB 5IC4B 1RAOA 3WUHA 1NK5A 1SC1B 1QE1A 4ELTA 1GLFO 3GZ7A 1NJZA 4UOFA 3TX0A 3QX7A 2IYGA 1JL2A 4WF9L 2A18A 4U8YA 4OJRA 4KHQA 4M5DA 3KJVB 2Q43A 3DLKA 2NRXA 1KLMA 4QZDA 4L3QA 5KFXA 2IHNA 4USWA 4D3GA 2HNYA 3AFGA 4XDCA 2CJYB 2XMVA 2XY6A 1ZQYA 2C28A 3VQSA 4JI0K 4CE6A 3O9UA 1OY6A 2KW4A 3AL0B 3TVKA 3OTEA 4BGAA 2RQMA 3OHBA 2YX1A 3PRBA 2ZNYA 4NI2A 1JXLA 4Y65A 3I5CA 4DG1B 4NXZA 2B0CA 2HGMA 3KK2A 1BISA 4F04B 5DZ6A 3H4BA 1H73A 2H3EB 3M8PA 1TL3A 3UQ2A 3JSMA 2DNYA 1RT2B 3HP6A 3DRSB 2HGLA 2YQ0A 1YITN 1KAZA 3I9ZA 4Q43A 1BPBA 1NNDA 2H5IB 4J8FA 3TZXA 1FF2A 1FD2A 7ICNA 3QNOA 2BJ1A 1N6QB 2RKIA 4BDYA 2KNJA 5BPLA 5THWA 4L3NA 4KRFA 4LF2A 4CH0S 5KQDA 3CC2S 2YKQA 2HK3A 5JLHA 2HNZB 1I94F 1HQEA 4I2PA 1O1WA 2VC0A 2CUYA 1VQON 2UUBF 3DLLQ 4E2FB 3BS9A 2I2YA 1N32J 3TA0A 3LOUA 1EWQA 2O8FA 2KK0A 4PHDA 5ALJA 2PDAA 4CZCA 5I3QA 5LT5A 5AXNA 4N5SA 2JH1A 2GC8A 4ANCA 3MC1A 3HHLA 3F56A 1RDDA 2A1JA 1KQSM 3E58A 4F0MA 3ZSWA 2H65B 3LP0A 4B9MA 4RPZA 4OYOA 2M88A 2IYIA 3OTOF 3SYZA 5HP4A 2ZJQL 4OZ1A 1OYEA 1HWKA 4UUXA 3TSUA 1RPLA 2P35A 5AKJA 2XLJA 4MK9A 4X2BA 1CXQA 1HA1A 1QAYA 2W24A 1O8BA 5SZTA 2W7AA 4MFCA 4ECXA 3KD5E 4NLQA 5BR9A 3HM9A 4FJXA 1LEOA 2VBXA 2E9RX 2E8MA 4I2AA 4NYPA 3TANA 1OQ3A 3GE1A 3KD1E 3NWGA 2KKHA 1N5TA 3ALYA 3F9MA 4P0PB 5HMMA 4P71A 4ERDA 3PXGa 1TUGB 5D4BA 4GVBB 1Q3VA 2MA1A 2J9CA 2LXUA 4LF9K 2NO5A 4QR0A 2UP1A 1VQOS 4JS4A 3MAAA 5L38A 3KLEA 1ZTWA 4LF4F 3U26A 4G9BA 1N34F 3OHAA 3TU5A 3HVTB 2DRDA 1IBMF 2KE7A 4B3TK 2VBZA 1Q7YO 2B8QA 3L4PA 1PYTA 4ECUA 1GLBG 3QYPA 3DRPA 3EM1A 2WOMA 1RBUA 2C2DA 1M5SA 4P73A 3MR2A 1UVIA 4R65A 5D77A 3RUBL 3FZKA 4PZOA 5ALZA 1NSPA 3UIQA 2J0XA 2YQ1A 5AQUA 5L1JA 2XHBA 1XUPO 5ETTA 3G9CA 1H74A 2W9CB 2WVCA 4KLDA 1T6CA 4MF8A 2IY5B 2BANA 1KSPA 3PW4A 3V72A 1NO8A 3OW2R 3HPOA 1ZQDA 1FKPB 3VAMA 3JXOA 2DEJA 1C1AA 1BXNA 4E1MA 1X4GA 2BZ2A 3L4QA 2BDUA 5JUMA 5L39A 4DV5F 1EX4A 2E2NA 3QBXA 2BV3A 2EZYA 2QA2A 5CAAA 5KG2A 1UPMB 3O8MA 1CJKA 4IG0A 2QM1A 1T8EA 3LPUA 4PG6A 1ZQAA 4QOZB 2ERRA 1F5SA 1ZM9A 3IS9B 3SMZA 2YMPA 4JI7J 4FJLA 1U9LA 1NOYA 5G0RB 3ZZPA 3ILLA 1JLQB 4AQYF 4BG8A 3HHLB 1A0PA 1GQEA 3ORYA 2NSCA 1EKEA 3R7SB 1NH7A 3H5SA 3L7OA 4USTA 4DR7K 2D74B 2DK2A 3BF4A 3DDKA 1FXRA 4IQMA 3NMAA 4B17A 2M7SA 4RQ1A 5ETSA 3BO2A 4H03B 3ZDDA 3J7YI 2DJWA 2EPIA 2FJDB 3HTVA 1NHVA 2E8AA 4IBNA 3P1GA 1N5SA 1REGX 2ZHBA 3MXMA 3ICXA 2O5DA 4DFPA 4DOAA 1E4FT 5CZ1A 3ZLJA 2DHAA 4IUFA 4NXNF 2NXCA 3F2KA 3E51A 3PSFA 4CH1A 2P1JA 1U1QA 3O1BA 5DS7A 5AZJA 4Y1CA 4DR1K 4CH7A 4S0MA 3KOAA 4PG5A 5GTIU 3DXMA 1NDPA 2OPRA 3MN9A 4XDDA 2DO0A 1RWWB 4M5MA 1HUXA 2BPGA 3J7ZT 4CZIA 4AQYK 3CCEN 2HG4A 3M30A 5E41A 1IG9A 3POTB 3J81j 3TAPA 1QQ5A 3B0YA 4FCYA 3OHRA 3QSIA 3TKAA 4FZNA 3I0SB 4WCEL 3AA8A 3O1WA 1NGEA 1D8BA 4Z7CA 5F3XB 3PNIA 3VEWA 1AFIA 1RTIA 2KHOA 2HF4A 4QR2A 4M63C 4UUWA 3CDBA 5ALKA 2QLWA 4CJ5A 2WAQD 1D9AA 1K8AO 3GDQA 3H98A 4NXMK 1XMQF 2LHTA 3RH4A 1LWCB 1Y4ZB 4I28A 2B3TB 2LCWA 2P5OA 3ZDCA 3N5BA 3QEXA 2LQJA 2DY9A 4WZQA 5CQGA 2HBLA 4RW7B 3VAKA 1X1PA 5GIOA 1S97A 1RT4A 1WSIA 1UWBB 2Y0SC 4N47A 4DTRA 9ICWA 4BR4A 4OPHA 5E79U 4RWXA 3P4UB 1GAOA 4C8MA 1FDAA 2IAJA 3ZYYX 1NJXA 4W4MA 2HFSA 3OYFA 2LXFA 3O4QA 3KLGA 2RJZA 8ICBA 3AODA 2Y9TA 5E0OA 5JJBA 2E5LF 3FBBA 1GLAG 1SC3B 4URQU 2HVDA 4CP5A 3BQTA 2NUUG 2N82B 5CYQA 3SSRA 4TYAA 5MAOA 5CH7B 3HX9A 4URSA 3WHIA 3OPXA 5FPMA 1HNZF 3IDWA 4PL7A 4XH4A 9ICCA 5AFUA 4QWCA 1JN3A 2RHKA 1XMBA 1BI4A 2EFVA 2VPXB 3MWBA 1SQKA 2HNZA 3E0FA 1V3ZA 2ZUGA 5EUHA 4X66F 4F4YA 2LEBA 3NGYA 2HURA 2F1FA 5HRNA 3L2RA 2HQFA 3RBEA 3BGRA 3K2YA 4AYBC 4ZVPB 2BKOA 1ZYQA 4O5BA 1D8YA 4DX5A 4BGBA 2YKOA 2FF6A 3CO0P 3TVZA 4MT1A 5F3TA 2ADCA 3T7ZA 4BRPA 3NDKA 4J2EA 4UY85 3RVCA 4PXCA 2AP1A 3TUJC 4RNOA 3GFHA 4EHTA 1S79A 3PRVA 3ATVA 1XNRK 1WHWA 3D1OA 2PMHA 4I2PB 3DJCA 1QQOA 3FZLA 2NREA 3DGPA 4NLVA 5BOMA 1TK5A 2HSEB 4NLDA 2MKIA 3DLJA 2HVIA 1HBOA 2GS8A 1LK7A 4GKJF 3ZSXA 4Z94A 5MLCQ 4OX9K 3CRXA 3L7UA 3VGSA 3O5BA 4DUYF 4ZP9A 4RUAA 3AVIA 3W62A 4CZKA 3AO3A 4BR5A 1MA9B 4EO8A 4DV5K 5AQPA 2Q36A 2BKEA 4C7QA 1HPZB 3S9HA 2IRUA 2MQLA 4FVUA 5AI4A 3HD1A 3CJCA 4FK4A 5CRXA 1R0BG 3THVA 2KKZA 3WXKA 4CIFA 4P72A 1K8AT 3Q7BA 3MUTP 3TACB 3M6XA 4NLOA 3D2NA 1WG4A 2P9CA 1WHXA 5HHHA 3JTPA 3A5MC 1C0GA 4FJKA 1XI1A 2OEHA 3CJRA 3SUOA 2Z2LA 3QRQA 4LSLA 4KI6A 5LY3A 3ZX2A 1WHVA 5A8KA 4CLZA 3D28A 9ICGA 3SDEB 5IOLA 3JYTA 2EH9A 4CFDA 4UASA 2RE2A 3R5JB 2M5YA 5A2QO 3QXGA 5D4PA 3GOIA 2P6UA 1U1RA 2KVIA 3O80A 4CIEA 3TZZA 2WVFA 4KI4A 3I6PA 4BVOA 3MEDB 2ZM6F 4O5EA 1VQYA 4X62F 3I0SA 2GV1A 2FHMA 3HI9A 4LVNP 4KLHA 1HMVA 4BBYA 4GC7A 2LQ9A 3FEZA 1IN0A 1VQPN 4BC7A 4A47A 4DSJA 1XMOJ 4CDIA 2W6LA 1VQ7S 1DURA 2VWJA 3NH0A 4HWIA 3MPUB 3NGTA 1GOAA 2BPCA 7ICHA 4WPAA 3W64A 1SV4A 5JXSA 1Q4RA 5C7PA 1Y64A 1YHQS 2MRLA 5ETKA 4LF5F 1KVBA 2OLWA 3Q0AA 4JAXA 5CEHA 3GV5B 4CEDA 1S5JA 4I69A 3MAHA 1UWBA 4G9ZA 3W1YC 2GNKA 3H2LA 3SQOP 1GT8A 1Y9OA 2DB1A 3AO4A 4WFBL 3FFIB 4HVJA 2E29A 5I9EB 2W9MA 4B3OB 2BJDA 1FA0A 2FY8A 4KRWA 1UMJA 2DHXA 4CBXA 2VZ9A 4O0IA 4QZAA 2HMIA 5DG8A 5AQZA 2OPQA 4F7VA 4YORA 1LW2A 1PK3A 2O8BB 1S0OA 5D0GA 1NRKA 5K9FA 1OSDA 4F5NA 2HFVA 4BRGA 2DHGA 4RZRA 4F02A 3T1YJ 3K57A 2P9IB 4JYAK 3DLEA 3C29A 4LBHA 3QEWA 4M95A 3PYDA 4FWNA 4RW7A 2FMSA 5EN1A 2MGZB 1XNQK 4FYVB 3LGNA 1ATSA 1EO1A 4A62A 1QS4A 5E2QA 1EAYC 2CJAA 2V8PA 2B9WA 3UPQA 2Z4PA 4C11A 1TUUA 2J6SA 3V7LA 1JROA 2YKAA 1CZBA 2GVZB 4DEZA 2BJ3A 1ICEB 3BO3A 4H4KC 2AD9A 2RRNA 1WKKA 5IIJA 4BDPA 5B5EU 2FJ6A 4WJ3B 1OWXA 4ZJQA 1WNSA 1PVPA 2G8UA 4ILHA 4ILGB 2FYXA 4M0AA 2DRBA 1T9XA 4I6YA 3HZEA 3V7JA 4RQNA 1FDBA 3RAMA 4JI5K 1I1GA 3VGTA 3EE8A 3T79A 3FFKB 7FD1A 3MN6A 3PKMA 4CJKA 1H38A 3G25A 3W66A 1FJGJ 3EKUA 1D8ZA 2VIXA 3AUOA 3OXLA 5D46A 2WBMA 3HJVA 4JI1K 4C11B 4FXVA 4M7YA 1NKBA 3MCPA 3GILA 3ZC4A 4RQ2A 3CC4N 3MR3A 4AP9A 5HAOA 2JLEA 3FCHA 4C4TA 2GJ2A 8ICJA 2W9CA 4HUFA 1CJKB 4IG0B 1IM4A 3G6EN 3NRBA 3PW7A 4K4VA 2MPUA 4FLYA 3O5TB 3CCJN 2ZWPA 3P96A 3R3TA 3LA0A 4F25A 2H3ZA 1SUQA 3VZHA 4NL9A 3LM9A 1RK8A 1L3TA 4IXCA 2DFLA 5HLFB 1BPXA 5KGXA 1HNXJ 3UKRB 4PXEA 1H0HB 3HRDD 4YUDA 2O8CA 2DIVA 5C2DA 2W7OA 4A46A 3EX7B 3KK3B 2XMMA 1I39A 2EKYA 3QFPA 1QVFM 1DHMA 1K9MO 1C0TA 3LP2B 4YR0A 4E3SA 4F26A 1C0UB 3IS9A 1BIUA 2NLWA 2XICA 3KJQB 3OT9A 4BDZA 3VERA 1R31A 3MHYA 5A8RA 3S7RA 4K4UA 3ZDBA 1Y88A 4P52A 1KKXA 4FW1A 4V1Ak 6FDRA 4P2FA 2RNEA 3SEIA 2W6KA 2DNPA 1S10A 1DT9A 2D9OA 2ZQBA 2E4LA 1ZH5A 3WKDA 3G0ZA 3C3LA 2KT5A 3ET6A 4LRDA 1IXRA 1CC7A 1S57A 3HSCA 1Q5YA 2H5XA 2DH9A 1BUPA 4KBIA 5DRKA 4G6VB 3KVGA 3AY9A 2DGSA 4DPUA 4H4MA 2FSKA 2ZOMA 4WQ4C 2ZWHA 3FAHA 1WC4A 2C2NA 2P9GA 2FZKB 2ZH2A 2QSWA 5BYQA 1RKJA 3W5XA 1HWLA 1K1QA 2VF3A 8ICOA 3K17A 1N61A 2HHHF 4ED8A 2MKHA 3NUQA 5M1OA 2OZMA 1CJTA 4X4QA 4X62J 3HPHA 2A1JB 5J2BA 2FVPA 5FPEA 3WNHA 2KI2A 3L2WA 2MGZA 3T1HJ 1Y3KA 1K44A 5A8KB 3SJHA 4FYWB 8RUCA 3BF1A 1ACMB 4Z6DA 2G09A 1JXVA 1WWVA 2OPSA 1T6DA 3ENWA 1WHYA 1ZQSA 3WK9A 4UBBA 1HNVB 2J9DE 1OPZA 3UNGC 4BRIA 3LDOA 2KIWA 3CTRA 4MIWA 3ZZOA 2BCSA 1C4CA 4JD2A 3L8BA 2G1DA 4AHSA 1S6QB 4CGJA 4NYFA 1U2CA 2ZH5A 1ECWA 4OGCA 4RQ4A 1EKRA 4M47A 4JBCA 5KPRA 2NV3A 1T9YA 3NEKA 4K5SA 3GLJA 4BX9C 1IKWB 2WTFA 4DV3K 3TABA 4QYZK 1HW8A 4JMUA 1OS5A 1JJ2M 4R8UB 1NCLA 4RU2A 1YQHA 3DYAB 1NGJA 3NH1A 5D4OA 2YKNA 1IBLF 3C8YA 6FD1A 6AT1B 2ALZA 1RCHA 5KFNA 5AM2A 1WAFA 4FZMA 4ECWA 1N62A 3O4NA 3PYGA 3ZZ0A 2UUTA 2LYAA 3CJ8A 2OHFA 3Q2TC 4KH6A 4M94A 2IBKA 3HO1A 2ATLA 1KC8T 1L3UA 3F53A 4J91A 5DDQC 3UO0A 2QWMA 4YOVA 1WC5A 1N33J 3SFUA 2XTJP 2D69A 2MZRA 2NCKL 3SAGA 2VWBA 4QAGA 1N5XA 4PWWA 1Y00A 3NKYA 5AQIA 3HVRA 3ENBA 2HWIA 2YWHA 5DM7L 1XIQA 3FSXA 3HZGA 3VGKA 2PYJA 2WHEA 1RHMB 2VQFF 3BREA 4OYMA 2DO4A 4UZBA 1FXXA 2M9KA 5EVZA 2FHKA 5KOWA 4DV0F 2ZOGA 3MN5A 4KH5A 4BRKA 5J0WA 5DM6L 3RBZA 3RH5A 2ZIXB 4C1NI 4MTPA 2VH7A 2R7UA 1KOHA 5AZIB 4BR9A 1JCGA 4I64A 4KLSA 1O0PA 3MTKA 1S1TB 2G9OA 1V6HA 2XSJB 1UTAA 4U6PA 2VPZB 4USVA 3CC7N 3B6PA 5ADZA 4QIWC 4H8KA 2O8DA 2QTDA 3MGVA 4BHQA 2QXFA 2UUCK 3TAEA 3PSTA 3V6JA 4CBWA 2BEFA 4M42A 3H8MA 2XMJA 3P83D 3CCVS 2QKQA 3MMJA 4OZ2A 2KKVA 1YJRA 2G0IA 1SC6A 5ALYA 1F2GA 3R3LA 3QESA 4YG2A 4KLIA 5AKEA 1Y10A 2BXJA 2LSNA 5F3ZA 2E20A 4LF7F 2Q6BA 4YVZA 3I4HX 1SJFA 3K58A 1VHFA 4BRMA 1K73O 3SPZA 4F72A 1P1TA 4OI2A 5AZIA 2GWKA 1IKWA 2U2FA 2BJ7A 3QU9A 4Z4EA 2OEMA 2OP5A 1X42A 4BWJA 3PJXA 4ZLPA 4CLUA 2JV3A 1BWFO 5CP2A 3THTA 1OH6A 1RDUA 2BM1A 5E7OB 4EP4A 2W03A 2PZSA 3MMAB 1BA0A 4PG8A 1W9HA 4DJBA 2OPRB 2RQCA 1HNWF 2XY8A 2A41A 4DCJB 2V2VA 1URRA 2JLFA 3LVWA 4CJTA 4FJIA 2J6TA 1HKBA 4ZOSA 1RAAB 1GNKA 3QNWB 3HKZC 2H3IA 2J7WA 2GJFA 1BUXA 3HCXA 3C46A 2W40A 5F0XA 4GKKJ 1DJ0A 1H2VZ 5AE1A 4FKXA 2HZVA 3M1YA 3OTBA 2RHQB 1PJ6A 3LWLA 2W3RA 5CYQB 4E7IA 1WC3A 1V38A 5AM3A 3EEQA 3M6ZA 5K20B 3JAMY 4U67Q 1ATRA 1T95A 4JI6F 3K5LA 3HSJA 2OH2A 3CD0A 3ICLA 4CF4A 3TEGA 1BMQB 5EWFA 4NLKA 2I1RA 1PK1B 4ELVA 3MMBA 3EYZA 3DHWC 4PG4A 1WSEA 3O3FA 5B0AA 2LA4A 3NOCA 3DM2A 4ILJA 1ZQTA 2IRXA 3NS6A 3TJ8A 4R5PB 2PFFB 4KN7A 4NLZA 3ZZTA 2BABA 3GMGA 2OPSB 4H5TA 1GMVA 4CNYA 4TY9A 2V0NA 2AEMA 2VHGA 2OA8A 4K4HA 3WXMB 3FLCO 4X65F 2W43A 3EE9A 2PSZA 3OS2A 4W90B 3TNVA 3WQTA 1Q81O 3WBZA 1ZQGA 5HBMA 2HQGA 5HANA 3TUPA 3JPQA 2FC8A 3UCZP 4G1IA 2IOFK 2BHNA 1CRXA 3ZDAA 3I8BA 4Q5VA 3QFHA 1HYVA 4DB3A 3UQSA 4G65A 2GJIA 3KZXA 3J7YU 1IBMJ 4FK0A 2EEYA 1DK3A 2RPIA 2Q4TA 3CMAN 1BPDA 3UDEA 4QZGA 3POTA 4WTOB 1FCAA 1PUZA 1RWMB 1WTFA 4DZ6A 2HHHJ 5DGAA 5KG5A 3HJEA 3LTOA 2MSTA 4LY7A 1E6VA 2VOPA 3UI3A 3QT7A 4H4OB 2AHOB 3UXOA 1K6YA 3PM9A 2G8HA 4WQ5A 1QZ6A 5KFOA 5DMRA 4DI6A 2LP4A 1OY9A 2XYHB 1J5EF 4HTIA 4ZVUB 2JMGA 2CQ0A 2PGCA 3KLEB 2OTLN 3T6BA 1T05A 4P7VA 4CFBA 4JI3F 4YB5A 2VQEF 2VG7B 3H5UA 4PYDA 2X1BA 4CHQA 4ZJOA 1FK9A 1U0HB 3H8WA 3ZNJ1 2CDQA 1GLLO 4QW8A 3I55N 3H2UB 3O1LA 4B1UB 3QE9Y 2ATQA 1ZAVA 4A4JA 2HK2A 3CYMA 3MM7A 3K5MA 4J9PA 2JH3A 3W63A 4B9NA 2CGJA 4JLHA 2M9NA 3RU0A 2GUPA 5H9EK 2BTFA 2HQIA 3R5BA 4DV4J 5LSOA 3A3NB 1M1HA 3MM9B 1MWMA 4B9TA 4GXIA 4M1KA 1LW0A 2DFFA 1OQ6A 2PEHA 3LO3A 3JS9A 1U2FA 4LIRA 4PRFA 3RFAA 1NK7A 2FMPA 4CCHA 1HBUA 5TISU 2IM3A 5A0LA 1JX4A 2Y8YA 1UKUA 3D1HA 4QNLA 4YXJA 1NZ8A 3N7SC 1R89A 5J2QB 1D0EA 1XR5A 2EKNA 1KR4A 5AQFA 2V50A 3CD6N 2YWWA 4QZBA 1B0TA 2CZVC 5G0RA 5AQLA 4HUEA 3T1AA 5H9FJ 1UVNA 4TKTA 3ZO7A 2FJEB 4KKOA 1IUJA 2KICA 4DL3A 4ZK7M 1X0PA 2XMUA 2DY4A 3BS7A 3D2FA 1W7AA 1U6ZA 5FROA 4K5RA 4MJKA 4MEXA 2NXJA 1WSHA 3JPNA 2DYAA 1P6TA 5BR8F 2CKWA 4MDBA 3CCLS 3SCIE 4H0XB 3J80Y 5ETRA 4WFXA 2LYBA 1FWKA 3D6TB 3TVYA 4MFFA 5ETLA 4F2SA 3HLUA 3LF0A 5DQIA 3M7DA 2W42A 1M6YA 3D2EB 4Y2YA 4N8NA 1A5XA 4QWAA 8ICQA 4X4UA 3BDPA 3IBPA 4L6V3 2FBYA 1NB2A 4CO0A 4JKHA 4JI8J 1RTHA 4O3PA 3MF5A 1REVB 5BN8A 1KD1O 2AMCB 4ID8A 4DTPA 2O8EB 1Q7LB 3C94A 1L3KA 4KFBB 3PYEA 5KFGA 3MK6A 1VRUA 3N6LA 3FE1A 5L46A 1NSKL 5GAHP 3BEGB 3VETA 1EQYA 2V4RA 1KAXA 4AQYJ 3CMQA 3JSYA 2HFUA 4QU6A 2G07A 2VGNA 2P5VA 1JUDA 4ECQA 3DLEB 4U7BA 3L7PA 4ECTA 1RT7B 2ABYA 5GMEA 2P51A 5KFRA 1S1WA 4R5PA 1IBCB 3LZIA 2B4UA 3VGUA 2QLBB 4WXOA 4DV4F 4BJQA 4C8LA 1PC5A 3NG8A 4KLFA 1HR0K 2QKKA 3C6HA 1VC5A 3N4WA 3FGVA 1RCXB 5E3QA 3V9WA 1XNQF 3O44A 4OX8A 2B43A 1IV8A 3KKAA 3KJVA 2VOOA 1FHTA 3ZETB 3BBCA 2ZH1A 3MCNA 3M7VA 4B3OA 1NPKA 2L9WA 1KQQA 3UWTA 2BUNA 2QWPA 1JL1A 3QJJA 2FJVA 1QE1B 5GAEI 4NCBA 4YHHK 1XMOK 2W8KA 1E4GT 5KFHA 4CIOA 2AYGA 3GJQB 5HK4A 2RRAA 4NO7A 3DN9A 2UV8G 3OVNA 4YFUA 3CEDA 3K2PA 2C3UA 1Y97A 3L6QA 1I5OB 2P9EA 1Q86T 1BCOA 4FZLA 2EG2A 2HYIB 1WUUA 4Z6EA 1WORA 2LQ8A 1RHRB 2LM4A 2OAUA 1Q82T 1PZNA 5DGBA 1VJWA 4LR8A 4JI6J 1IKYB 3VOVA 2FBVA 1JXBA 3QAEA 1YJNN 2FDRA 3R5GA 1JNZB 4J90A 2ODGA 2ISPA 3EE3A 2G2OA 3DAWA 2WVDA 1F0XA 3FUYA 4DV5J 4MAKA 4TYBA 2YV0X 2HS3A 3O8WA 4IOAQ 5DDYA 3DRRB 3PW0A 3D3CJ 5GINA 2A2DA 3BKTA 1N34J 1BDGA 3KG4A 2AF6A 1QQ6A 2AJ0A 2P9PB 4KHRA 2AW0A 4UAVA 4FK2A 2ZGYA 1TKTA 1UWAA 4ZVRB 2DTUA 2YMLA 3HSZA 3IBFB 4NLXA 3KLIB 3IBWA 5KPTA 2HI0A 3AO2A 3ISND 1SKUB 3W0LA 3KBBA 4RW6B 4CDGA 2HBZB 2R8JA 4DR4K 2VKRA 3NGZA 1RTIB 3VQ4A 3MM6B 1ZBHA 2ITGA 4BXOA 3N4PA 3D54A 5BJRA 3A5NC 5FDLA 3NVMA 1JNRB 4FWMA 5KFSA 1ZQXA 2A3JA 1XTZA 4C0BA 1Q81T 4DR7F 2CPYA 1S9EA 4DO9A 3OLAA 1NNEA 2QXLA 4FJHA 2YHBA 3NASA 1ZZNA 4P0QA 1W2IA 2OYQA 1K73T 4GVMA 4ZPTR 4ICLA 2HOFA 4LF9J 1LB2B 4B02A 2IBOA 2EAMA 1WD6A 4BE1A 1RAHB 3ZFVA 2E1FA 1NGGA 4Y1DA 3CCUN 5JVGL 4CYUA 3JB9k 2CXYA 2A2CA 5J1EA 4CF5A 3NRWA 4C98A 4MEYA 1TYQB 2PC6A 5KT7A 4DR4F 4Y2UA 2NRWA 4RJVA 2GO8A 1QUVA 5AI5A 4LFBK 4CJ4A 2AT1B 2UXCK 2ZDPA 3ID8A 2MU2A 4DL2A 4OMFG 3CPWR 4NM2A 2R18A 2ZH8A 3SCXA 4EUVA 1DTQB 2IVOA 4JI2K 5ALDA 1GXLA 1TKZB 1X6IA 2W8LA 3TRGA 3VQ8A 4ID5A 3QGGA 4B9LA 1F3FA 3L3CA 1VI7A 3KK7A 3KKRA 1CC8A 5K14A 3FBFA 3MXJA 1S7HA 5KQ8A 4ZTJA 4NPOA 2F9TA 5EWGA 1WCNA 2YX8A 4RBVA 1N5YB 3ISCA 1GOBA 1GTHA 1ZM3A 5K4LA 2MKKA 2AP6A 2AQ0A 3FCVA 2UVUA 4OJ1A 4K50A 2KVSA 5E5NA 4C6AA 2YKMA 2P9SA 5AZJB 1RT3B 4KLMA 2CJXB 4DSFA 1HR0F 1XK8A 2ASLA 3M32A 1QVFR 3CJSA 4Y0WA 1BOTO 4IOBA 2R7RA 3EICA 3BUZB 1HBUB 1KS2A 3A1YG 3JPTA 3VAHA 1DRZA 4CE9A 2FJAB 4LFBF 4DDFA 4C23A 4PG7A 2CZ9A 1RP5A 3HSTB 4IEEA 3KUEA 1IBKJ 1XS9D 4IS7A 3UKUA 4OL8A 1H3DA 4Y2KA 4BC2A 1MWKA 4R8UA 2Y0SD 4YD2A 3OYJA 2QL5B 2F1JA 1UCVA 2P6TA 3CT9A 5CCMA 2MAXA 2WSFC 4DR7J 2YNFA 5KG1A 2W9AA 3BM7A 2AKWB 1LKYA 4DQPA 2DGQA 1UJ4A 4EHUA 2CPRA 3H0RB 1FXDA 2P9KA 3BS5B 2QA4G 2QN6B 3KK1A 3BN4A 5GMDA 5F41A 2FLNA 2Y1JA 3OL6A 1RWXB 5AQHA 1EP4A 1HD1A 3TUIC 4DR5J 3GE9A 2W3SA 2M8HA 3AB4B 2YJEA 3LM2A 3CNHA 2KHDA 4CF9A 1RWKB 2GAHC 4UZCA 2F8KA 2ROEA 3LDPA 4DR2K 1Y5NB 1KEKA 4K42A 5DBCA 2P9NA 3NGKA 5LJWA 2ASMA 1CS4A 3FVYA 2DKOB 4WKRA 2HWTA 4E8UA 2AH5A 3FJ2A 4Y3CA 3A8EA 1LWCA 2JFKA 3BSAA 1OXJA 1T7PA 4HI1A 4K4IA 3T19A 1W25A 3H08A 3U1MA 1SQGA 5D0RA 2XMKA 1LKYB 2YQ3A 3RZAA 4RO0A 2YWEA 3CCSS 2I0XA 2EZXA 4HTUA 4BC3A 3W8PA 4JI0F 1M1KO 5GVQA 3ULEB 1XC3A 2WBRA 4WXWA 1FNMA 5J2AA 4RU9A 2WW8A 1WG5A 4BC5A 1FJEB 4FS1A 4YEAA 5J0PA 1KC8O 4WBFA 1AQ6A 2EI5A 2RIJA 2GAGC 1XQSC 2RS8A 4YN3B 8ICYA 3DEEA 4Q8FA 2VFTA 4OX9J 4PKIA 3QZ8A 3C21A 4X4SA 1VYAA 4XH1A 4YFKA 1SB3C 1NGDA 2E1AA 5EOYA 3SV3A 1W97L 4M9JA 3S8SA 1RT3A 4OJ5A 4DTMA 3QYYA 9ICPA 1PKUA 1HR0J 1S22A 4Y2PA 4F67A 5KFQA 1U25A 1OO0B 4ZLLA 3N28A 3MECA 1TUWA 3QRPA 1LWFB 2KZMA 1C4AA 4FWSA 4DF4A 1FESA 5EX5A 2EFNA 3BZKA 1E6YA 3K89A 4PXBA 4FW2A 4EMDA 3MXHP 2BUPA 1IG8A 4X65J 3LL3A 2YX6A 3MX2A 3K9KA 3I33A 1IO2A 4UATA 2WW4A 5A6WA 5BOLA 2LLZA 4ZPBA 1VQLS 4WTYA 4YDUA 4RBUA 4J9QA 2HOQA 4Z6CA 4UAUA 3ENVA 5CXTA 1AA1B 1XSLA 5KAKA 2B4PA 4FJMA 2OHDA 3MR5A 5AK6A 4KJIA 3G6YA 2K4IA 1Q46A 3SSSA 3I32A 4NI2B 3H1QA 4J9SA 2B51A 5GMKa 3OFGA 5IIIA 4HLBA 4BWMA 2KZ3A 4P2SA 4F5RA 2IC3A 2NXUA 3F2DA 2DNZA 4DFMA 1TYQA 4AUKA 5BREA 2J6UA 4DR3K 1OUQA 2OTJS 2J0SD 4Y0FA 3VAFA 1FKAF 2QI2A 2JEFA 1U6FA 2O8BA 1JLCA 3CDWA 1WSFA 4XO0A 4DV1J 1ZQMA 2ZJRL 4YQWA 1F5BA 2HIQA 1ZJNA 4XQ8A 4DR5K 1SL2A 3VA3A 5ETPA 3GIRA 9ICQA 3N4MB 3UR3C 4QQBA 5ALXA 2P9SB 2BRLA 2E8NA 1ZJMA 1NI3A 4I2QB 3KDNA 1DEJA 1NEEA 3GIJA 4OIXA 5GIPA 4DV2F 3KUGA 3U9DA 2DD8S 1RAEB 4PWDA 3AD8C 2EBEA 4UB2A 3GV7B 4R63A 1JLEB 4DOCA 5J0OA 4L72B 5C5JA 1DK2A 1H7XA 2MZTA 2MEWA 5AK3A 3PX0A 4LF8F 1V4TA 4KB0A 4QZEA 7ICGA 3L2UA 5F9LA 3GB0A 5L1IA 2D1CA 3FBCA 3TPQA 4HI2A 2NRHA 1U1NA 4PPZA 2MQMA 1JJ4A 4YOYA 1C6VA 2DH8A 2FPKA 3MXIA 3O9RA 1CPZA 3IBCB 4NCGA 4F8RA 2RHSB 4TVAB 4CHPA 3G6XA 4R0JA 4GVLA 1IH7A 2ZH4A 1N48A 4US8A 4I2BA 4ZPVR 3RMDA 4OQJA 4PL2A 2ZUBA 4B9VA 4CHZA 3QJPA 4JS5A 4F3MA 4QR1A 2F40A 2HEKA 2KJWA 3DI6A 1L7NA 3BQ7A 4ZP6A 2V2QA 4CK2A 1KXPA 1K8KB 3MM8B 1S59A 3PJWA 4DS5A 1G2EA 1RHUB 2X1AA 4K25A 5SWMA 4CGIA 2XSFA 5B0GA 2BKNA 2RS2A 1X8DA 1K47A 1AUDA 2ZH3A 3CW2C 3KHGA 3OJUA 1FFGB 2POKA 3C16A 1J5EJ 2HBQB 1ESVA 1FO4A 1IKXA 3SUQA 4RBTA 3GDXA 9RUBA 3VGLA 1LVHA 3AU6A 4P0QB 1ZQKA 3BYPA 5GAEP 3DLRA 4OZ5A 1NUEA 3CDEA 2V67A 2DT9A 2IA0A 2R8KA 4C9DA 3M2VB 2CGLA 3SJJA 1WDTA 1HARA 3C6UA 1UVKA 4IFVA 3DXBA 4TXSA 5EXWA 4OI1A 3FEYB 2I9SA 2IVYA 2XQCA 4P4MA 1LCUA 2CJBA 2V69A 1COOA 3OGUA 2E7VA 1JK9B 4DV7J 4ZDNA 4YOTA 4HAIA 3R6GB 2F8LA 4A8KA 4KY3A 1R59O 3S3MA 1VSKA 1RJJA 3UXPA 4NRUA 9ICHA 2W7PA 3OYGA 1JALA 4QYZJ 2PYLA 4G1QB 4FDFA 3RJHA 2YKPA 1QD1A 5HJXA 1FWLA 2MUTB 2I8EA 3EZUA 3HOSA 2JC0A 4TNOA 5HJYA 1BQNB 5J1NA 4C8ZA 3G8TA 4BQLA 2ZIVB 2RHFA 5J0RA 3IC1A 3W61A 1WSGA 4J2AA 1SV0C 5CYMA 1YK9A 3RB3A 2DEIA 4BS2A 1UJ5A 4FWRA 4DPOA 3JPPA 1EB0A 1QSLA 1M5OC 5ITHA 5J29A 1WKJA 1XERA 4PPDA 4Z37A 2E1EA 1BPEA 4MHVA 4CJ7A 1NZBA 1S76D 3WX4A 3QFUA 1IR2A 1M5HA 4Y2RA 1X6JA 2XCAA 5KFJA 3DLLL 4RNNA 1AZSA 4OI4A 1U2RA 4N7TA 3MGJA 4W5TA 9ICXA 3GFKB 3ZSZA 4Y2CA 3ENHA 4RR5A 4YR3A 1J5OB 2GQQA 1RDRA 4UTGA 1B92A 1D8LA 2MJNA 3HPGA 3CE8A 4ICAA 3D0IE 5AI0A 1WOSA 1R8HA 3M8ZA 3TADC 4KE5A 8ICCA 3SAFA 1R6VA 3Q89A 2R2TA 5CR4A 2VANA 1JLQA 2HAIA 4Z0UA 2DPJA 4C8OA 2GHWA 5L8RC 3EUB2 3K7RA 5E3PA 3M9OB 3N9UC 4A59A 5A8RB 4NCGB 4CJSA 3NCPA 1KFDA 2IC3B 3HKZF 4AILC 4F36A 1B70B 4JKEA 2KT2A 4RNHA 2F4VK 9ICNA 4RW8B 1WC0A 4ACOA 3KYLA 4IQVA 2ZC4A 4CW7B 3IR6B 4A8OA 4EZ9A 3B8AX 4ZVTB 3G8SA 3V9ZA 1R43A 3H20A 1LXNA 4FWKA 3P3DA 4Y2MA 1L3SA 1R6YA 4ZPCA 1ZQWA 1U48A 4LF7J 4WYBA 4CNZA 3DDIA 1X2IA 2R42A 4LR9A 1HW9A 2JH7A 3HT0A 1DBDA 1HWIA 4BGDA 4X64J 5M1KA 1HIWA 3KHLA 1X9WA 1X4FA 1T9UA 1XEZA 2G4BA 3O3GA 1URNA 1HI1A 1YJ9S 4X4VA 4WFYA 5HMWA 3VQBA 3U3GA 1VQKN 5IFMA 5FRNA 4F93B 1S9GB 5JTIA 1RHKB 4ZVQB 4B3SJ 4CEQA 1WEZA 2QFIA 3VQ9A 1NDCA 2PIIA 1ITGA 2AEFA 4CLPA 4DTSA 1BPZA 4KQZA 2G8VA 2ZJ8A 2HRUA 3AM9A 2ZIUB 4HVZA 1NK0A 3K59A 4RG8A 4JV5J 2KIVA 4AYBD 3B9JA 1WF0A 4GV3A 3OYHA 4YB6A 2QYGA 2UU9F 4FJGA 2KP7A 4CHNA 2JWKA 2KRRA 2JHDA 4CT9A 1U4BA 1ZBTA 3F5EA 5AQGA 2FC9A 2Y1RI 3CSKA 5EWEA 1FJ7A 5ALQA 1IV0A 3B4MA 5DM7Q 2ZHAA 4EENA 3HK2A 4UARA 1UJ6A 4FO6A 4DL0C 1BWVA 2WSEC 1G7CB 1WAJA 2B8PA 3ZT1A 4MH8A 2B6AA 3LP1B 4DSIA 1OY8A 4K4ZA 2ALYB 3ETLA 3D67A 4CLTA 4M5HA 3OL8A 3U27A 1SUQB 4B08A 3MMCA 5B0CA 1WBDA 3T5KA 2IJRA 4W5NA 1RQNA 3AD7C 4CLLA 3GU3A 3QLHA 1RWUA 2CAJA 3DMJB 3OFEA 5DJBA 2NXEA 4LJMA 3AVGA 8ICEA 3W2WA 4N77A 4IO9L 2QV6A 1S9GA 3A0BU 2EVZA 1IBLJ 1Q8KA 1K0VA 3MEGA 3E1YA 5HR7A 2B4OA 2RDDA 4CO5A 1EP4B 1FVSA 2R9LA 3Q8RB 4JWMA 2BW7A 2CIMA 2HPUA 2EBGA 4JV5K 2GTDA 2HF3A 4O4GB 9ICRA 2HBJA 5B8HA 4GV9A 2F1HA 2JRZA 2FDNA 2EK6A 1DRGA 1HEKA 1WUDA 3U6FA 2PFQA 3KG1A 2WUSA 4YP3A 3BQ0A 5CB1A 2XI9A 3GQCA 4ZTFA 4IO9Q 2P2CB 3X3UA 3HI0A 1SWWA 3MBYA 2OCEA 5KFMA 4C4WA 4WYWA 3OYCA 2VJUA 3SUPA 4J37A 3W2VA 1HNXF 1UZDA 2JEIA 1N32F 1C1BA 3K8VA 3O9SA 3UPFA 2CQBA 4OKJA 9ICFA 1VDHA 3IM9A 2K8BB 4EX6A 4ZCIA 3AA4A 1FX4A 3NY0A 2HMIB 3ID6A 4JRPA 1DZ5A 3AVKA 2QARB 4DU3A 4AL5A 1X66A 3SV4A 3G82B 5IQQA 2XMWA 4MO4A 1YKWA 4N8OA 3OTCA 3IKMA 1XR7A 2P9UB 1KRPA 5B7WA 4I2GA 4YOWA 1RAIB 5FPDA 3MEDA 3FMWA 4EBDA 3SK3A 1WSRA 5D0HA 1YJWS 1X4HA 3NVZA 4WP3A 4I67A 2DR8A 9ICMA 2RB7A 4C0OC 5B08A 1U8WA 1P8GA 2XY5A 4OV1A 3ZT3A 3NP5A 3BJYA 2MMYA 3L5KA 1VSLA 4CEZA 3PHTA 1B0PA 4MYTA 5CHIA 1G99A 1C1CA 3TEHB 3M9MB 2WAQF 3O3LA 4OLPA 1NXIA 1Y11A 4WU3A 3ZSVA 5AE2A 4FBTA 3CD6S 2F63A 1S4FA 4FWPA 1BQNA 2R3VA 2Y0SF 1M5VC 2CVEA 3OVSA 5HOOA 4MLHA 5ADXA 1V5VA 3A12A 4BXOB 5ALSA 1WJ9A 1RTDB 2OFHX 5F8MA 3EGZA 3NGUA 3L3VA 2DKZA 4F91B 1ZQLA 1Z2ZA 3OBYA 1KLMB 1V3SA 4ZCMA 4KT0C 1YVUA 1T3QA 2XVTA 8ICUA 4HCBA 3OBIA 3HHLC 5DG9A 1NMEB 4JV0A 1ZXOA 4O9MA 2FSJA 1LOUA 1MWQA 3I4PA 2ZIVA 3ZTSA 4C3KA 3KLHA 2MYFA 1YX2A 4IH6A 4H54A 2QE5A 4QIVA 4UW2A 4OLAA 5B0DA 4PL8A 1IG6A 3VESA 3G87A 4USIA 2PMZC 2G0CA 3AQEA 2JWLA 3KMSA 3SQIA 2IDOA 7ICFA 3A0HU 4DQIA 4K7QA 4BR2A 2HAFA 4PAAA 3I87A 3I55S 1C7YA 4CF0A 4IDKA 1J27A 2KH9A 3SAHA 2VU5A 1VISA 2DNHA 4USMA 4NA2A 3JYTB 1EWRA 3M1FA 3HWTA 4N56A 3DOMA 3QEIA 3KKSA 3VEXA 2GGPB 3ISDA 5AJ3F 4A8FA 4OJOA 4LFCJ 4RTFD 4QPXA 2VJ5A 4FNIA 1LAWA 3GBTA 4QWBA 5I3UB 2ZBPA 3AGKA 1B4FA 4FN5A 5DQGA 4TQSA 1JCEA 2D3ZA 3TA2A 1YVFA 4WZMA 4I2IA 3DDNA 1VQ6N 1RWOB 3TX8A 3U9ZA 4V19X 4DU7A 2AQ4A 2BYCA 1GO3F 4PY5A 2IVPA 1FXLA 4UAZA 1WG1A 3MFIA 2XI2A 4BE2A 3CMAS 1BE4A 1KDHA 2ZHOA 2EX3A 2ZC3A 4HL9A 1XNQJ 3V6KA 2LXIA 3EVMA 2AEJA 3OYLA 1BI4B 1PCAA 2DVIA 1S1VA 3O08A 1HKGA 5HRPA 4CO4A 2F2AB 5HL7Q 5ALPA 1VSDA 1D3WA 4DV2J 4J9KA 4B3RF 3D45A 3A5OC 1VQMS 3AJ1A 3DOKB 2B4VA 1Q18A 2F9WA 2F8TA 1H72C 4UOCA 3AD9C 4OX9F 2M3DA 2O4IA 5AM0A 1AYEA 1VBKA 2AGPA 3L0QA 3C15B 4KBOA 3CJ7A 3IP4B 4AXJA 4HH1A 3HRGA 4NYOA 3JQMA 5KFUA 5F1XA 3SXLA 2MKJA 4MKAA 2XEXA 1SZ2A 3CCQS 4KHYA 1VGYA 1BPYA 4FJ8A 3C7NB 4HTJA 3QICA 1V85A 2KFYA 4I6AA 3QIDA 1QJHA 5KGWA 4IYQA 1CBKA 1SIJA 4CGHA 2V8VA 3MD1A 4J2BA 4FOEA 2VQFJ 3WIVA 2FIUA 1SCJB 3CF5L 1CUKA 4H0TB 2W2OP 3NCQA 5AM4A 2GOLA 3TFRA 3SCLE 1N8RT 4M45A 1REVA 1MQ3A 5CWRA 1SH0A 2QMXA 1J53A 5HMXA 1Q53A 2PFOA 2U1AA 5J2GA 1Z05A 2ZBCA 1UVJA 2V34A 4DR1J 2YNGA 5F0WA 3F0NA 1VQ9S 3CJKB 1WG8A 4XUSA 3NE6A 1ZPWX 2KL8A 2RP5A 4CLFA 3WIUA 3D2WA 2YMMA 2YNHB 1M90T 2PN6A 2D0CA 1WN7A 3UKRA 2AX0A 4DV6J 1VSEA 4O44B 3NF8A 5ALIA 2ZBRA 4RW9B 3VMFB 2H4WB 3KUHA 3PW5A 4XPCA 1OKJA 2Y1LB 3EGVA 4QU7A 3W3DA 3KZBA 3IUCA 5IILA 2YKNB 1RU2A 2Z30B 5M1PA 1N88A 3S1TA 1VQ6S 3CCVN 3L4IA 2RDJA 4UBCA 4Y2SA 4DQQA 4JKFA 2QX0A 3U1NA 2Q6CA 1VQ8S 2EQYA 4KAIA 3UCUP 1TL1B 3EXCX 5J2PB 4WFZA 3FC4A 3ISBA 4RW4B 4MKBA 3IRWP 2E1PA 3J81U 2F44A 1SV5A 4BUGA 4DF8A 5L1KA 3QINA 2UXDK 3LWMA 3DCAA 4M63A 4K4XA 2PBDA 5F8NA 3M1VA 3KWMA 4PR6A 4M04A 4A48A 8ICFA 2YWFA 3LPYA 4Q2MA 3VQTA 4PGXA 3RR7A 3T5LA 4UB6U 4CM2A 5AM1A 1SXEA 2GFFA 3FZ2A 1VRQC 1UFWA 3I0RB 3THYA 2CDRB 2VASA 4ZA1A 1WF1A 3L95X 1HNWJ 1YG0A 1AB8A 4O5KA 4HKQA 1SKSA 3LP1A 1Q9XA 1KNZA 2P6SA 5AIAA 3MR7A 2E6LA 1G4CA 2BR0A 4EYHB 1N52B 1Y7PA 2ASJA 3AVLA 5AR0A 2VKQA 4FPAA 2BE2A 3DV9A 4ZJLA 4XRHA 2HFNA 1N54B 1E6YB 2NPFA 3S3OA 1DGKN 1P8ZA 2ISOA 4JOUA 3H8JA 3O9QA 1A0OB 1S1UB 3JQKA 4LFAJ 4U67L 4PYAA 4FM0A 2ZITA 1YBAA 2QC3A 4DV7F 4OFZA 1U1KA 4Q2LA 3UW1A 5ETVA 2I9GA 4ECVA 3WEEA 4NLYA 1U02A 3P49B 3PFOA 2D0PA 3T5HA 2LBOA 4O3NA 3BPDA 2F9JA 4LFCF 2IM2A 2RT3A 2GZOA 2DHHA 3OYEA 3GIIA 1FK9B 1U0HA 1ULRA 1RCOB 3PSIA 1RFQA 2A1SA 2JZBA 2WBNA 1RBAA 1A6LA 2CPZA 4LF6F 8ICAA 2W4DA 1YI2N 4I4BA 2OJ3A 4ZS6A 1BU6O 2VWKA 1IR1A 1NSAA 1YDLA 3ISNC 5HVFA 1T4GA 4X66J 1J5EK 1UVMA 3NNAA 3D5MA 3HHDA 1T9TA 2VFVA 1IJFB 4IH7A 5J2FA 3TZWA 1XO0A 2Y8WA 1L5UA 2GQ2A 2MQ8A 4GIBA 4WFNQ 3ZDEA 3RJIA 5FJ4A 4JK1A 5ETOA 3ASMA 2E5HA 3F5TA 1DARA 3G2XA 4C7YA 1I51B 4DR6J 3QU7A 2AWZA 7ICUA 2KVQE 3O9TA 3SMVA 2YPZA 3SQGA 2E5GA 1VQNN 2F9DA 4CI0B 2XNQA 3R5AA 4DUYK 4ETXA 3TTFA 7ICKA 3U7JA 4DSEA 5L9XA 3GJRB 1HI0P 3AVNA 5CA5A 1RLDA 1J97A 5BR8K 2O67A 2GELA 5L1LA 3FGUA 4NX9A 3P5TL 4WE1A 2AGOA 2YHAA 2I38A 2FGOA 3A13A 2V2KA 4F5PA 4KX5A 4OKKA 1KAYA 2PA8D 2PMZF 4WIIA 1X0FA 4M3RA 2YTUA 4C3MA 2VBYA 3SNNA 3T1YK 3UVJA 4QS7A 1HBMA 1GK8A 4ER8A 3SDEA 2BQRA 3AQOA 2WSCC 4PGQA 3O3HA 3ED5A 4KPYA 1S6PB 2VJ4A 2DGVA 4C97A 4RCHA 3Q83A 3KHYA 3K0SA 2WAQC 1HYSB 1HX1A 1NJWA 1FFUA 3AVBA 3W65A 1S6OA 2L9NA 3CJBA 1OH7A 5LOQA 4JWNA 4IH5A 3M9NB 2HNYB 2GLEA 3BH6B 4FYDA 4DX8H 1DTTB 3H2VE 3RBXA 4WYLA 4OX7A 1FEEA 1RWPB 3GJTB 3WKBA 4W5OA 4F4ZA 1VC0A 4DR3J 5ALRA 3AOAA 4NA1A 1ZBLA 3THWA 2FJBB 1RT5A 2E5LK 2IA6A 1YRTA 1WI6A 1YJWN 2GGPA 1H2UX 2WMMA 4ZIVA 4M9GA 2DNQA 4ATNA 4O8UA 5AQKA 2P9PA 1RBVA 1YBUA 2KB2A 1MW7A 1YGYA 3ZETA 4CGGA 4O3SA 1MSWD 1AZSB 2W55A 2RKIB 2C2KB 1T9VA 5J2KA 4DR4J 4RW6A 4DQSA 1COKA 4YY3K 4CGDA 3ENAA 4FLTA 4DS4A 1VQKS 4B3TJ 1SZPA 4K59A 5CYJA 3HM8A 4A8QA 3NXZA 4DN9A 1XC9A 3ULDA 1SZHA 4YNQA 2GHPA 2QWLA 1N4LA 1ZPVA 2QSFA 4H4KA 1PYSB 5CYMB 4M3XA 4EO6A 1TE2A 4QIWF 3CDAA 2N1RA 4FKYA 4B3RJ 2UUWA 3MEKA 5KOXA 2W4PA 1C0MA 1ZA2B 1NOMA 1Q8BA 2C42A 3HF5A 3EZ5A 2XGPA 7ICMA 3DLGB 1X3MA 3NTUA 5C25A 3MDAA 4LC9B 3NS7B 1EIYB 2BJEA 1YVNA 5KT2A 2CQIA 3R9PA 5KNIA 3QO9A 3NNCA 4O0JA 1I3AA 3V6DA 2CQ1A 3AT1B 3U4LA 1N5VA 4X4NA 3H4DA 1X7VA 2AJ2A 5J2NA 3SFGA 3FKBA 3K5OA 3FR0A 1FRJA 1S1WB 4WU2A 5DZ7A 4KLEA 3HVAA 1PILA 3KLHB 2W2QP 2GA7A 4HR2A 2YY6A 1IKVA 1WSVA 1HJOA 1U0SA 2FVCA 5F8LA 2QB0A 2ZJAA 5I3PA 3KHHA 2WVBA 2RH3A 3ITHB 1IBKF 4XTTA 4OZLA 2DITA 5I42A 4DX7A 4MQ3A 1FEZA 1X4DA 1MWZA 5LMNJ 4DV3F 3LPTA 3IO1A 2VODA 4C80A 5D4LA 4DR2J 1BHLA 4PWDB 3AA3A 2XYPB 3R8EA 3BQ2A 4I7FA 3QUQA 1RT6A 1TVRB 4MFAA 1AFJA 3PDNA 2R2SA 1ZOTA 1EETB 3ZXWA 2XS7A 2VQEK 3CWJA 2AZ1A 3P6YC 1UEUA 2G08A 5AHXA 2YTCA 1B22A 1F0MA 1VBZA 2BQ3A 7ICQA 1MMLA 4O55A 2XMAA 3HHNB 4FLXA 1X9JA 3TI0A 2WF9A 3GTYX 5IM0B 4QZFA 1RT1A 5LXRA 1TUVA 5AQNA 2GMJA 1T3OA 2K8AA 3AO5A 4B1YB 2QZ8A 4B9QA 1S12A 3VVTA 4FLZA 1IBKK 3VEOA 1O5JA 3SQ4A 2VPWB 2V51B 2JFDA 3PW2A 4QOTA 2VQFK 4OI3A 4FPIA 2VCPA 3OR1B 2ROGA 3QETA 1RM6C 2QB1A 1BVSA 3CQ8A 2XB2D 4WQ4A 4JI0J 4NM1A 3IR7B 1SIZA 1NHUA 1WELA 5HL7L 4MFBA 8ICMA 3SBGA 5IWAF 2UXDF 2ZFHA 2KJ8A 2JDJA 4UB5A 1TL4A 4FJ9A 4P4PA 5E33A 3CFRA 5AE3A 2BPFA 2WTUA 1FNOA 2RQKA 4ZITA 4ED3A 4CF3A 4KGMA 3NGIA 1UEVA 1X9MA 3SQ1A 1ZQJA 4DCHA 4OYWA 3M30B 3DXSX 5DB8A 1Q8IA 4BACA 1SAZA 2QWOA 3NF6A 1UW9A 3ZCMA 1NJIO 3IV6A 3AN1A 2HQDA 3NS1A 2C3OA 1A5WA 4W5RA 1D4XA 4B1WB 4OJGA 3QT5A 3MAQA 3N7RC 1J54A 3HDSA 2I5JB 4KHUA 1X3NA 3B6OA 3H7HB 3UMBA 2HOIA 4X66K 3CPWM 4M5NA 2UVVA 2VIHA 1RDAA 1OIAA 4F4KA 1R7IA 2Z57B 5JMNA 4RT3A 3CHWA 1Z00A 2QIFA 5DB6A 1KVAA 3GU0A 3TO8A 5F8GA 3UMCA 5HHIA