1NK0A

Adenine-guanine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk0A01
1S10A 1WSGA 1WAJA 4HHTA 4I2JA 3MAQA 2BCSA 3SNNA 4CE9A 2B6AA 5KFXA 4OKKA 2DFEA 1GOBA 4OPKA 2P5GA 4FK0A 2PYLA 1UAXA 2RN2A 5CA7A 4FO6A 1IKWA 1NJXA 7ICJA 4R8UA 4F3TA 4YD1A 4FBUA 3LWMA 3OHBA 5DB6A 1SZPA 7ICLA 1NK7A 1LW2A 1WCNA 3V72A 1L3VA 4UB5A 1ZQAA 4KI6A 2FBYA 2ZTEA 4YR0A 1Z25A 1N5YA 4YMMA 1DGSA 4CHNA 1JKHA 3QLHA 3V9SA 3DLRA 4N76A 5KFQA 3NF7A 4EBCA 2NRVA 2ZQBA 3NDKA 4P2HA 4CECA 3GIJA 1RTDA 3VQAA 3RBDA 1XHXA 3RTVA 5KFFA 4C8MA 1NK8A 4O3QA 3KK2A 5KFPA 9ICLA 1ZBLA 4QZIA 4FM0A 4QZHA 1U45A 4ED0A 3L3UA 2ZJ5A 3AU2A 1RBTA 4DLGA 3AA5X 4DS5A 2R8IA 3NGDA 4J9RA 4YR3A 3TWHA 5KFKA 5DBBA 4DSIA 1S0MA 4Q8EA 1NK4A 2G8HA 3SPYA 1TK0A 1QHTA 4KHNA 4DEZA 4FJNA 4NCAA 3LP3A 5IIIA 5KFJA 4DF4A 5C42A 2W9CA 4DL7A 4FLVA 4N56A 4HUEA 2NUBA 1D9DA 2KZMA 2ZJ8A 7ICFA 3NGYA 3OYDA 4NCGA 4CJVA 4DTMA 1IM4A 5HLFA 3DLHA 3K58A 4DQPA 5KG4A 1QTMA 4GLXA 2P1JA 3WNFA 4J2AA 5DQHA 1TVAA 3ZD8A 4MEXA 1B9FA 3L2RA 3SYZA 1J5OA 3THVA 3V6KA 1RTJA 4CJFA 3QEBZ 1BCMA 2BKEA 4I2FA 1EX4A 4ECWA 4CERA 2IA6A 4ECQA 2YHBA 2OPQA 1F21A 1ZJMA 3Q8SB 4M9LA 3ZSWA 3HJFA 5J0RA 4J9PA 2PI5A 8ICBA 2I9GA 1UA0A 2OA8A 4X5VA 1RXWA 3L8BA 3NFAA 4FW1A 3O4QA 4ECXA 2HHUA 4KITB 3ZDEA 3HWTA 1Z3EB 4F4ZA 1LW0A 1K6YA 3VQ8A 2RDIA 4FJKA 4CJ5A 3LP2A 1RBUA 1YTAA 1COOA 9ICGA 3UXNA 4CFBA 1TL3A 1K1SA 4DG1A 3T5KA 3M9NB 3NF9A 3PO4A 4BWJA 3H40A 2F96A 1JXLA 5JS1A 8ICXA 3ZD9A 5L1JA 3NH0A 1BPYA 4KRFA 4RNOA 2RKIA 2PZSA 3LP1A 7ICGA 4ECZA 1RYRA 2NRWA 3V9WA 1T05A 1ZQPA 4I2IA 3PX4A 4HUGA 1QQCA 2QK9A 5IIJA 1VSKA 3QIPA 3GQCA 3NH2A 3UQ2A 1RTHA 3S3NA 1IG9A 4O3RA 3DOLA 5KFNA 4IFYA 9ICAA 3GV5B 5CB1A 3MECA 5KI6A 3F73A 3AA4A 4CGDA 3HP6A 5KGWA 3SCXA 5T7BA 3ZT2A 1ZQDA 4HUFA 5J2PA 3M8SA 4M9HA 3NAEA 4F3OA 2OZSA 4Y1DA 2X6NA 1LAWA 3L2VA 2P5OA 2PI4A 4RW8A 1C7YA 3CM6A 7ICKA 2HMIA 4JS4A 2QXFA 1SL0A 1IO2A 9ICMA 3M8PA 1UT8A 4CGIA 1D8LA 1S9GA 4MFCA 1VRTA 1HQUA 4DF8A 1AROP 4DSEA 1WSIA 3K5OA 1NK9A 1REVA 4FM2A 1S1XA 1JLEA 4FW2A 1CZ9A 4FBTA 4AHUA 3C6TA 3N4MB 5KFZA 5I3UA 4DFJA 4RT3A 2G8VA 5J0OA 3V7LA 7ICTA 4CEAA 3HPGA 1HNIA 4I2CA 2GWSA 1VSEA 3Q8QB 3RB0A 3AVFA 4DTOA 3QZ7A 1XWLA 5HRSA 3M9MB 3CFPA 3AU6A 5J0WA 4NLNA 2EX3A 2GV9A 2XY5A 7ICQA 4H8KA 3RJGA 2ISPA 3KLEA 3QIOA 5DG9A 1QSLA 1TAUA 1NJZA 3SQ2A 1WCLA 4M3TA 3MFHA 3VQEA 3RH5A 4RPZA 3F9KA 3AVJA 2JEJA 3HW8A 3KIOA 4AHSA 3NE6A 4KLJA 2XGPA 3PMNA 4I2PA 3JPSA 2ASLA 1NKCA 3DLEA 4E3SA 2BDPA 4DL3A 4P4PA 4J9NA 5KT3A 9ICTA 3ZSVA 2UVWA 3RR8A 1HMVA 4CJ4A 3MXIA 4RU9A 4E7IA 1VSFA 3QEPA 1IKYA 3MEDA 2VA2A 1W9HA 1VRUA 1L3SA 4ED6A 4FLUA 3C5FA 2HVIA 4UQGA 3ORYA 1BGXT 5JUMA 1S1WA 4DTJA 1X9SA 2A1RA 4IQWA 1WSJA 5J2HA 4EZ9A 5KRSA 4KB0A 2YNHA 4CCHA 4DTUA 2ETJA 3JPPA 2IHMA 4BDYA 2OZMA 2ZD1A 4DL6A 4GVMA 3GV8B 2AU0A 4NM2A 5FDLA 8ICOA 1EXQA 2X78A 3LZIA 3CFOA 1RBRA 1HJRA 3K75D 3D45A 7ICIA 2VG5A 4FYDA 5D49A 3JYTA 2IBKA 4F92B 4KLSA 4DTPA 3KK3A 3QNNA 1KDHA 3PX6A 2V4RA 3ZSQA 2ZTCA 4DOCA 4IRCA 4IQUA 2IDOA 4PQUA 1D8YA 4QOZB 4R8UB 1A5WA 5HMMA 3JPQA 3UXPA 4ECRA 1RT3A 3BQ0A 5J0XA 2DFHA 3OYBA 4CGGA 4EYIB 5KFWA 5J0TA 4Q5VA 4R5PA 3ZSZA 1K1QA 3FFIA 4OKEA 3MXMA 1CUKA 2V4QA 1HPZA 2YNGA 3HP9A 4CFDA 1DTQA 4B9MA 4CJSA 4KLOA 3FYHA 4YFKA 2P51A 4DQIA 1LWCA 5DB7A 4LVSA 8ICLA 4Z6EA 4KLIA 4E89A 3H7IA 2PFNA 4Q8FA 3QEWA 2B4JA 4CHYA 3HSTB 3VQPA 1Q9YA 4RQ4A 4EBDA 4I2BA 2WOMA 4YFUA 4E1NA 5EU7A 3HVRA 3U3GA 3QEIA 5SWMA 4QW8A 4RQ2A 2JEGA 4Y1CA 2VG6A 9ICVA 4CGHA 5C5JA 1GOCA 1HQEA 4FJXA 4RG8A 7ICHA 1X9MA 2YKNA 5J2BA 3OYAA 4BE1A 2OPSA 3GIMA 2FBTA 4R65A 3OYNA 4LZGA 1DOQA 3OVNA 5L9XA 3GV7B 3CQ8A 2W9CB 4CEBA 5CJ7A 1RNHA 4M6WA 4CHPA 1RZTA 5KT7A 1S0NA 3KD1E 4BXOA 9ICXA 3G6YA 3O4NA 1BIUA 8ICIA 3MXJA 2HNDA 4CHQA 5J2GA 2J6UA 4F2SA 4DU4A 3P1GA 4CJEA 4GXIA 4DU3A 5IIOA 3KTQA 4FM1A 4W5RA 4KLTA 1XI1A 2ALZA 4F91B 2D0BA 1XC9A 2E6MA 2D0AA 5DK5A 5DG8A 4CEQA 2HHXA 2AJQA 4ED2A 4DSKA 1TKXA 3AA2A 5KG7A 1ZBIA 2ZUCA 3JSMA 3TAPA 3DRRA 2Q0ZX 2C28A 4NCBA 3VQDA 5SZTA 3RH4A 3PW5A 5DMRA 3Q8PB 1BVSA 4QWAA 4YG2A 4QZDA 4J9QA 1ZQHA 4O3PA 4NM1A 3GILA 5J2EA 4F4WA 2AQ0A 4ZHRA 3PNCA 4B9UA 3CG7A 3RBEA 4BACA 3QEAZ 4AHRA 4J9KA 2YKMA 2Y1IA 1JLAA 3KHHA 4KHSA 8ICQA 2P6UA 2OWOA 4DTRA 4F8RA 4LSLA 2AGPA 1KSPA 1XU4A 3MEGA 3RJIA 4CJQA 1TKZA 2W9BB 2W8LA 4DU1A 3V9XA 3G6XA 1QSYA 2J6SA 1NKBA 1EETA 4PHDA 4LH4A 4Z6FA 4F5PA 3PO5A 3C6UA 4GC7A 3S9HA 3RRHA 4RPYA 3AVBA 1N48A 4CF0A 5L1LA 4O3OA 4PH5A 1TKTA 1TKDA 2VWJA 5IIMA 4KB1A 1S97A 1Q9XA 3NF8A 4O5BA 5D4BA 4AHVA 3G0ZA 4HYKA 3SJJA 4B9SA 5J0YA 4JWNA 1FXXA 4JK1A 4CF9A 5J29A 1KEJA 2UVRA 4EP5A 2DFFA 5J0QA 2ZTDA 4F4XA 2V9WA 4CFAA 1S77D 3TABA 8ICZA 4M42A 9ICBA 2XO7A 5KG2A 2W42A 4DSFA 1ZBUA 2DTUA 1O1WA 2VA8A 1U48A 1LWEA 4KHUA 4M0AA 1UWBA 4NY8A 3DM2A 3DOKA 5I42A 4LY7A 1ZQWA 8ICKA 4KLFA 2O4IA 2XHBA 5DGAA 3SV3A 3TAFA 1JL1A 2MUTB 4O9MA 1A5XA 2WONA 3PW0A 4H4OA 3TAMA 1KVAA 1RT2A 1JMSA 3M8RA 1WAFA 3PVXA 2PXIA 4Z4IA 3MEEA 1RT6A 4FXDA 3ZSOA 2R8KA 1WSFA 3NGZA 4RNNA 3V9ZA 2Z1HA 4IG0A 7ICSA 3SQ4A 4QWDA 3VQ9A 3P83D 4HCBA 3IHQB 1T8EA 2C22A 4MQ3A 3M9OB 4KREA 2GUIA 3KHLA 1EKEA 3PW2A 3QERA 3C21A 8ICSA 5CHGA 3AVAA 4CK2A 4E19A 1C0TA 3PMLA 3OYLA 1RT1A 4M3XA 3HYFA 4M2YA 4Z4EA 1S6PA 2XCPA 3RMBA 4DSJA 2FBXA 1S0VA 3GFKB 4K4IA 4DS4A 3MR3A 1IKVA 5C24A 1X2IA 1ZQSA 3UIQA 3SUOA 2FLLA 4J9OA 2W9BA 4PUOA 2QKKA 5KFGA 4K8XA 3PV8A 4CEZA 3K59A 1ZBFA 2AGOA 1XS9D 4UAZA 4Z4FA 3C1ZA 3CM5A 4F5RA 1HUOA 3PY8A 3C2KA 4XQ8A 5L1KA 2YNFA 1YTUA 4M3ZA 3M8QA 1QS4A 3AO5A 1VSMA 4TQSA 4CIEA 5BOLA 4J9SA 4FS2A 4F5QA 3UPQA 3V81A 3C2LA 2KFZA 4GMJB 3LDSA 3ZSRA 3SQ1A 4KHYA 4OKJA 4YCXA 3O3FA 3HO1A 1JXEA 2YNIA 4NXZA 3KD5E 4DFKA 3CFRA 4N41A 1LAVA 1S9FA 5DDMA 1VSJA 4JRQA 4Z4CA 5HNKA 9ICIA 3IAYA 5KFAA 4FJ8A 1HYSA 1TV6A 3BQ1A 1PZNA 3C2MA 4UBBA 3QINA 3E01A 2ATLA 3HPHA 8ICEA 5KFEA 4XRHA 3KJVA 4BE2A 4W5OA 1TVRA 4KLGA 1ZQBA 4PGXA 7ICUA 4QZAA 4RQ1A 1MQ3A 3OYHA 4FS1A 1S76D 4B9LA 8ICRA 3UQ0A 1BPBA 4CEOA 4E7LA 4IQVA 3AO3A 4B3OA 1C1BA 4KMUA 2R8GA 9ICJA 3LPTA 4E7JA 2G8WA 5F9NA 5HP1A 2O4GA 4J9LA 3B6OA 1RDCA 9ICWA 5KT6A 1BQMA 2MUTA 4W5NA 4CGJA 9ICOA 3OS1A 4KN4A 1TL1A 3KLGA 4F4YA 3WNEA 5HRRA 3TAGA 3V6DA 4KI4A 3AVKA 3T19A 3Q8RB 2ZUDA 4CJKA 4RQ7A 3AO2A 5KG0A 1ZQCA 1J9AA 2IHNA 3OYMA 5KFSA 1ZQRA 1RBVA 5J1EA 1B22A 4HCCA 4FLWA 1ZQGA 2BPGA 3L2QA 3ETLA 3RWUA 2XC9A 3TQ1A 4RNMA 2KTQA 5EWFA 8ICFA 1IH7A 5J2MA 3B0XA 3PX0A 2VA3A 4JWMA 4CESA 1C0MA 4JV2A 4YP3A 3TANA 2J6TA 4DFPA 4IQTA 4FLZA 5D3GA 5HRPA 2HHTA 1TK8A 2XRIA 2HHVA 2F1IA 4M6WB 4K4HA 5KT5A 4UB3A 4BXOB 1RPLA 3T5LA 3AVCA 4WE1A 4CIFA 1KCFA 4RQ3A 4CHZA 5CWRA 4NYNA 3NHGA 2G8IA 4RPXA 3VN5A 3T3FA 4EZ6A 1W0HA 4OVLA 3AVIA 1C6VA 3LP0A 3V1RA 4C8KA 4KLQA 3D0PA 5KRTA 3LZJA 1JLBA 2W9AA 2C2RA 8ICPA 2JGUA 1U04A 4KHQA 1B9DA 2RPIA 1ZQLA 4M04A 4PHPA 3AUOA 1U9LA 4OPJA 1SL1A 2XGQA 1KVBA 4DFMA 4M9JA 1BI4B 5KFRA 4JLHA 1RILA 4YXJA 4Z4GA 1TV9A 1Y88A 2HNZA 1TAQA 1H38A 3A2FA 1KLNA 2BGGA 4HVJA 3MR6A 5IINA 4KPYA 3ZT1A 4RW4A 1KTQA 4QZ9A 1ZQUA 1NOMA 5KFTA 4RT2A 4IR9A 4YXMA 4QZFA 5BPCA 2JZBB 3I0RA 1A77A 3LDAA 5KFVA 4BWMA 2IMWP 2WTFA 5KFLA 9ICKA 3LALA 2ZJAA 2BCUA 4KLHA 4O5EA 8ICTA 1ASVA 1VSLA 4QZBA 4R64A 4IDKA 5DDYA 1QLNA 1T03A 1FKOA 1VSDA 1MQ2A 3RR7A 1IKXA 3ASMA 2AQ4A 1YT3A 3MABA 3LPUA 4O4GA 5DBAA 8ICCA 5BOMA 2G8UA 4B9NA 5DKWA 4YR2A 4EP4A 3NBPA 3O3HA 3OYKA 4XA5A 1T7PA 4ID1A 4F4KA 4QWBA 1U49A 4I29A 4DWIA 3RJFA 3ZDBA 3RH6A 1KFTA 4ID5A 1RXVA 3WNHA 4I2GA 2JEFA 2XY8A 2F8TA 4F50A 2RDJA 5KFBA 5KFYA 5CY4A 4OJRA 2E6LA 5DQGA 4FJJA 3KLIA 3RMAA 4MF2A 1RT5A 5KFDA 2NRXA 4BE0A 2FPKA 4QZEA 2HB5A 4DQQA 4JV0A 2VG7A 4QAGA 4OGEA 5KGXA 5HHHA 2YV0X 4IR1A 1D9FA 2D5RA 4DOAA 4KLEA 1D5AA 2BHNA 4DO9A 2KZ3A 5TZVA 3Q8MA 1ASUA 4QW9A 3JPOA 3VQ7A 3DLBA 5KG3A 1DTTA 2QKBA 1WSHA 2A1SA 4J2DA 4EBEA 1NJWA 4LSNA 4XIUA 2P6RA 1SKRA 4RQ8A 3K5NA 4DL4A 1NOZA 4QZCA 4RUCA 2M9NA 3RAQA 5J0SA 2FLNA 4ECYA 4J2EA 1V9PA 2A1JB 5JS2A 4PPXA 4Z6CA 3AA3A 5J2KA 3B0YA 3ZT3A 3AVMA 4CEFA 4PWDA 3ZT0A 4G1QA 3EZ5A 4NLKA 7ICNA 9ICEA 1WN7A 5J2CA 4C8OA 4CJLA 4Q44A 4L8RB 1TFRA 4ELVA 4DTNA 3IS9A 2JEIA 3T5JA 5E41A 1RBSA 1VSHA 3RMDA 2GBZA 3GDXA 4M47A 5KFIA 5KFCA 4TURA 1BI4A 4UB2A 3H8SA 4YMOA 4PHEA 4M3WA 4ICLA 4Z4HA 1HJPA 1XO1A 1C0UA 3SUPA 1BCOA 1A5VA 4I2EA 5DB9A 3C5GA 4RZRA 2X6SA 4TUQA 4DL2A 3EWAA 1RDBA 3RB6A 4OGCA 2W9MA 5HP4A 4I28A 3ISBA 2JZBA 3OSNA 2G8FA 2E4LA 1HUZA 3LK9A 3VQBA 4CGFA 1JLCA 4ELTA 1DLOA 2EHGA 2W8KA 4P4MA 1WLJA 3OYIA 2FC0A 5C25A 1XHZA 3EPIA 4PGQA 3OGUA 4M3UA 1KFDA 5CR0A 3HPOA 1CZBA 2BE2A 3TAEA 3SI6A 3L2WA 3VA3A 2IC3A 1R0AA 3OHAA 1NK0A 4QWEA 2F8SA 4HTUA 3SI8A 4CJRA 4CK3A 5EOZA 2G8KA 3EW9A 4MFAA 3VQ4A 4ED3A 1EXNA 3T5HA 1Y97A 1BPDA 4MFFA 5DBCA 4RUAA 5J0PA 2DFLA 3BJYA 1VSIA 2ASJA 5D46A 1UOCA 2LYHA 4UBCA 4B9VA 5EWEA 1ZQFA 1ZJNA 3AVNA 3WNGA 3BQTA 4H4MA 9ICFA 4Q0BA 3GIKA 3RJKA 3DLKA 1TGOA 3AO4A 3IM1A 2BQUA 2VWKA 4LZDA 1ZQIA 1SUQA 4CEEA 1NOYA 8ICMA 4M41A 5HROA 4B08A 2FMQA 3JPTA 4FLTA 4ECVA 1X1PA 3EPGA 4DOBA 5HBMA 3OSPA 3ISCA 4BDPA 2P66A 2DPJA 9ICCA 4Z0UA 4M45A 3QNOA 8ICWA 4Z6DA 3HVTA 1C1AA 5IILA 1FKPA 4I2DA 1S0OA 3IG1A 3ZDAA 3EY1A 5DGBA 4OLBA 3H4DA 4FZXC 4FVMA 2I1QA 1G15A 9ICNA 8ICAA 4MF8A 4FJ5A 2PFQA 1U47A 2A1JA 3SZ2A 1NK5A 3SV4A 4KLUA 3LWLA 3MGHA 3V4IA 2FMSA 5KT4A 3KHGA 3TI0A 5J2DA 7ICEA 1MC8A 2BANA 2HNYA 3LANA 4O5KA 1KVCA 4FJHA 3KKSA 2BCQA 4RW6A 1ZQOA 3JPRA 4CHOA 4KHWA 4O0JA 4KTQA 8ICHA 4AILC 5J0UA 1I39A 4OLAA 3CYMA 1JLQA 3TAQA 3EYZA 3OS0A 4ELUA 1NKEA 1UA1A 4RQ0A 8ICGA 4I9QA 5HHIA 4FZZA 5J2IA 4M3RA 1C1CA 2B21A 4W5QA 1SKWA 3QESA 2FPLA 3MDCA 4N47A 2BQRA 3FDSA 3VQ5A 3P5JA 3S3OA 4I2QA 4TUPA 4PGYA 3ZCMA 4CJUA 9ICHA 2B5JA 4DSLA 2AGQA 4JS5A 3V7KA 1CEZA 3OS2A 3ZDCA 3OYEA 3K5MA 2MAXA 1S5JA 5DG7A 7ICOA 1ITGA 4FCYA 1XSNA 1VK0A 3IRXA 5EWGA 4J9MA 4CF8A 3QZ8A 1JLFA 4CK1A 2ATQA 1CXUA 1SL2A 1S9EA 2YHAA 1QSSA 4O3NA 1EP4A 4M9GA 4ZH4A 1BISA 1Q8IA 4KKOA 4QWCA 1XSPA 4CF2A 3GIIA 3NH1A 4CJWA 3G10A 3AVGA 3Q8LA 5KTQA 2BQ3A 1RDAA 2ITGA 5HMLA 3RJHA 1RT4A 3Q8KA 1SKSA 3V6JA 3SUQA 4I9LA 3TARA 1I3AA 3AV9A 3DRSA 1HNVA 2OYQA 5IIKA 1LB2B 2H5XA 3H4BA 4O44A 3RJEA 4E0DA 1BPXA 2DY4A 5FROA 3DMJA 4O5CA 4RQ6A 4UB4A 3HX0A 1B43A 1JN3A 7ICMA 3DRPA 3K4GA 3DI6A 3C95A 1ZBHA 3O3GA 4RQ5A 5J2FA 4F5OA 4LD0A 3L2UA 3PR5B 4YQWA 4EEYA 4N5SA 1J53A 3ZSXA 3N97B 2NRTA 4I27A 7ICVA 3I8DA 5J2QA 3VQ6A 1BL3A 3ZT4A 5KG1A 1JL2A 4XUSA 4FZYA 4BGDA 4I2HA 1B92A 2IOCA 4G3IA 2R8HA 2BR0A 4F2RA 2F1JA 3E2EA 4P4OA 4KLDA 4CEDA 4CJPA 2FMPA 3ITHA 1L3TA 1S1UA 9ICUA 4UAWA 1ZQEA 1T4GA 1KRPA 5HRNA 2RF2A 2NRZA 3QE9Y 1QE1A 1L3UA 3ULDA 2PFOA 2F1HA 1CXQA 4KV8A 3SQ0A 4F93B 3BGRA 2DPIA 1NK6A 3TR8A 4KTWA 2ZUBA 5FRMA 1T3NA 4FJIA 1RDDA 3OJSA 4ECTA 4TUSA 3RMCA 4RW7A 4ZTJA 3H08A 5DLFA 8ICNA 1XSLA 1J54A 2R8JA 1L5UA 4E1MA 3NGIA 4CJ3A 2I5JA 3RRGA 7ICPA 1ZETA 3OYCA 4B8CA 1LWFA 5L1IA 3OYFA 4PY5A 4UB1A 4YD2A 2IS3A 3VQQA 1CLQA 3C23A 3PW4A 3RAXA 4M9NA 3ZSYA 3H8JA 2PYJA 1BIZA 3C94A 3NCIA 1SV5A 3OY9A 5CZ1A 2FPMA 4GC6A 4I2AA 1GOAA 3HM9A 3UXOA 4LH5A 4TQRA 2C2DA 4R63A 2ISOA 5FRNA 1ZYQA 4C8LA 2IGIA 4IBNA 3KLFA 4JUZA 9ICPA 2KFNA 5KFHA 3QEVA 3QEXA 3MFIA 3HL8A 1MU2A 4DTXA 2XY7A 2C2EA 5KG6A 1Z00B 4KO0A 3H8WA 4IRDA 1N6QA 5KFMA 3BQ2A 1JX4A 2PFPA 4FLXA 5KT2A 2KN7A 4IRKA 4ED7A 4KN7A 1JXBA 3PW7A 5J2NA 4QZGA 5CP2A 4ECSA 3MR2A 4GXKA 2HHSA 1NJYA 4DL5A 4K8ZA 3MR5A 1ZQKA 2KZZA 3KK1A 2HHQA 4AH9A 2FBVA 3AVHA 3TFSA 4MEYA 5DB8A 1A76A 4DMNA 4ECUA 2Q3SA 3K2PA 1RT7A 8ICYA 4KLLA 4DQSA 4KAZA 2UVUA 4GW6A 3C1YA 4DLEA 2Z1JA 1ZQYA 3B6PA 3PR4A 2Z1GA 3V7JA 3K5LA 3OYJA 5J2AA 1RCHA 3T1AA 3ZDDA 3KKRA 5CYQA 4ZTFA 2BCRA 4FJ7A 4YMNA 4CFCA 3TFRA 2LSNA 4B8AB 3LAMA 4K4GA 4FJGA 1ASWA 1WSEA 5K14A 3VQCA 2IAJA 3MDAA 1ZQMA 4J2BA 4IFVA 3K57A 3L3VA 1U4BA 3V9UA 4JRPA 1X9WA 4Q45A 3MBYA 5KFOA 4F5NA 4EYHB 3KLHA 7ICRA 2OPRA 1HYVA 4NLZA 5KFUA 1ZQJA 4E7KA 4O55A 4BDZA 4M3YA 4W5TA 2OPPA 1ZQNA 4GXJA 1KLMA 1S6QA 1BQNA 1ZQZA 4DQRA 4FJ9A 4O0IA 1ZQVA 4NYFA 4FLYA 4R66A 4CIGA 4AHTA 5DQIA 3DYAA 2HHWA 1HRHA 1ZQXA 1FK9A 3I0SA 4ED8A 5DLGA 4JV1A 1Z26A 4FJLA 4NLGA 4RW9A 2Z1IA 1JLGA 3LAKA 1JIHA 2ASDA 2HW3A 8ICJA 1HYZA 3AO1A 3ISNC 3DLGA 1IXRA 3G6VA 4DTSA 4KLMA 3AVLA 2KQ2A 1BPEA 2UVVA 3JPNA 3OYGA 3U3YA 2JLEA 3V1QA 4FJMA 4YVZA 1ZQTA 4MFBA 4YNQA 2HVHA 4C8NA 8ICVA 1YVUA 4E7HA 4ED1A 2XCAA 1BPZA 4Q43A 3HT3A 2X74A 3V1OA 1WNSA 3HXMA 3QETA 2ZE2A 9ICRA 4FK2A 3RB4A 3QO9A 2VANA 1BHLA 2PY5A 1S1TA 2BGWA 3S3MA 2BPCA 3NF6A 3ISDA 1KFSA 8ICUA 3ALYA 4CJTA 1MSWD 1S1VA 1LV5A 1UT5A 9ICQA 1Z00A 9ICSA 4CF1A 4YN4A 4UAYA 5F9LA 2FLPA 5KG5A 2D0CA 3BDPA 3V6HA 2BPFA 5CZ2A 3NTUA 3SPZA 4IG3A 4I7FA 2KW4A 2R7YA 4PA1A 1N56A 2XY6A 3RB3A 4PHAA 3SUNA 3KHRA 4O3SA 2Y1JA 1RYSA 1RTIA 3OJUA 3MGIA 3RJJA 2BCVA 4TSXA 4AHCA 5J2JA 1ZQQA 4KTZA 4FK4A 3U6FA 3HK2A 1TK5A 4QCLA 3VA0A 4QZ8A 3PUFA 4KFBA 4IKFA 4B9TA 5CYMA
chains in the Genus database with same CATH superfamily
5FLXY 1RWOB 1SJ4P 2C2KB 1WF2A 3IRXB 4LF8F 1LCUA 1WSGA 4HHTA 3A8YA 2JFDA 3ICXA 3MAQA 2BCSA 3IGNA 4CE9A 1FDBA 4RWTA 1PAEX 4QIGA 3UD3P 2AMCB 3LA0A 3U02A 4HHUA 3UQSA 1GOBA 5CYJA 2P5GA 3MM5B 2B56A 3FR0A 2ZFHA 1F60B 5ETTA 1IBKK 1VFJA 2VKRA 2QSWA 1IKWA 7ICJA 4R8UA 2YY6A 4WJ3B 4YD1A 2F8MA 4FBUA 2RB7A 2DD8S 3LWMA 2V94A 4ZLPA 1X66A 1XR6A 1SZPA 1J5EJ 2Q2RA 4DR4F 2ACYA 1WCNA 2DY9A 2WBRA 1HNVB 5CZXA 1N5YA 5LT5A 2KH9A 2CPRA 4O44B 3CCWA 1VC0A 1EIYB 1DGSA 3NNCA 3QLHA 2WVDA 1V5IB 5AKJA 3GYNA 5EE0A 5SUHA 4LJMA 5CABA 3DI6B 4RNFA 4Y2SA 4F0MA 1RTDA 3VQAA 4OX6A 3THYA 1R8BA 1XHXA 3OFHA 4C8MA 3A5OC 4O3QA 2EQYA 4K4ZA 5HVFA 2BYCA 4M5DB 1B0PA 4WQ5A 9ICLA 4X65K 3B4DA 1EQMA 3MHYA 3AFGA 2CDRB 3AU2A 1RBTA 2UUAF 2R7OA 3A5LC 4H03B 2IJFA 2HCFA 3TWHA 2VBYA 2GQQA 5DBBA 5HQMA 4DSIA 3ZZYA 1S0MA 4Q8EA 2G8HA 2LXUA 1TK0A 3VEXA 2ZEJA 2BUNA 4LRAA 3J81j 2CQ0A 2V51B 4CDIA 2IYGA 1WBBA 1T9VA 4DEZA 3QT6A 1Y5NB 2M0NA 4NCAA 1QE1B 3TZZA 5IIIA 5KFJA 4DF4A 1EHWA 3CPWM 2L5YA 4XAKA 1WOSA 2P9UB 1VRTB 1IBCB 4FLVA 2AYGA 2NUBA 2V34A 1NBWA 1KP6A 2J9EA 1XC3A 2V8VA 3VEOA 1MN9A 4DTMA 3H3OB 5AIAA 2P1JA 2LI6A 2LMRA 1ZTWA 1F2GA 2CQ4A 1HNIB 2K2PA 3L2RA 3GTYX 1CJVA 3SYZA 1RTJA 1YGYA 3KKAC 3QAUA 1EQ0A 1D1UA 2BKEA 4I2FA 3AD9C 1XN9A 4ECQA 5CQGA 1UEUA 1BD6A 2OPQA 1FJGF 1F21A 3C0BA 3PTWA 4A8EA 3ZSWA 5J0RA 1CQMA 3ZEUB 4CE6A 2FJVA 8ICBA 3D7EO 2O8DA 3FZKA 4DR6F 2DEJA 4QR1A 1R8CA 3CJ2A 4OYPA 2G1HA 2HHUA 4KITB 5EX0A 3M30A 3RRKA 4ISGA 3EM1A 3TTCA 3PKMA 3KLFB 4FJKA 1XO0A 2E1YA 2QC3A 3SCJE 1A9NB 9ICGA 3UXNA 1H2TZ 2HMXA 3M9NB 1BC6A 1C20A 4KO0B 2O8CA 4QQBA 3FGUA 5L1JA 1X4GA 2YCHA 3BH7B 3OFGA 1TZ0A 1SH3A 5AE3A 1U1QA 1DURA 2PZSA 4B6JA 2VFSA 5L39A 3BSAA 5J2NB 2WVFA 1W26A 2H3FA 1QQNA 3ADAC 3M8WA 4JI2J 3FQKA 1JI7A 2MRLA 1S49A 2KV2A 3D66A 4ZP7A 4EIAA 1QQCA 2AZ3A 3UCZP 3KVGA 2QEXS 2D69A 3GQCA 1BMQB 5D0RA 3AGRA 4BRQA 1UVMA 1NNLA 1S3XA 3QBWA 3GBTA 3GV5B 3KZXA 2PMWA 4WFNQ 3MECA 4JI3F 1O6XA 4IOXA 3ENQA 3DC2A 2VJUA 1ZBTA 4M5DA 1FRLA 1S6UA 3SCLE 2VPWB 4HUFA 1AT1B 4DV0K 3OTEA 4H0OA 4Y1DA 1T94A 4HEA9 2KG0A 4WFAL 4C0ZA 1M1GA 2P5OA 2PI4A 3OTCA 2DXFA 1RWKB 2V4JB 2HIQA 2V8HA 4C1NK 2QXFA 1S99A 3CUNA 4EGLA 5ALMA 3M8PA 1UT8A 2CDQA 4RR5A 5CH7B 4P72A 1QCKA 1D8LA 1QVGM 4MFCA 1VRTA 1AROP 4OPAA 1FJ7A 1S1XA 4DX7A 1JLEA 2ZM6J 3KJNB 4CNQA 4U7UD 3NCQA 3F5AA 5I3UA 3N5BA 2WAQF 4RT3A 2G8VA 2APOA 1WDTA 1HNIA 1X4EA 5BRDA 3MMVA 4LVNP 1VSEA 1MLAA 3DYAB 1TELA 3AVFA 3JS9A 3I0SB 2J8SA 3QZ7A 5HRSA 2UXBF 5A0YA 2A6AA 3OBIA 3CTRA 3R7NB 3AU6A 2BH1A 4IOBA 4A8FA 4CF4A 2GV9A 5GAEI 4A59A 2HVEA 1HQEB 4LF4J 2GAHC 3KLEA 3C16B 4RUBA 2ZJRL 3BZQA 1MW7A 3SQ2A 1X5PA 4M3TA 3VQEA 4RPZA 2JEJA 4NXNF 3UMGA 3WHIA 3HW8A 3KIOA 3LDOA 3PMNA 3CCSS 3PIOQ 3O3LA 2Q43A 4CT8A 5AKZA 3JPSA 4X64F 2CJBA 4F9OA 1NKCA 3DLEA 2E5IA 5HOOA 2FTRA 2YY3A 1T02A 1MG7A 4DL3A 5HJYA 3BS5B 3IMQJ 4JB3A 1S1TB 2IY5B 2K7KA 3R8EA 9ICTA 2CRLA 3K1ZA 3ZSVA 4USUA 1V3SA 3F2BA 1HLWA 2C3YA 1WKJA 3HHLB 4TVAB 4E7IA 5JRTA 1IKYA 5ETLA 2QB0B 1C4CA 3ZTQA 1L3SA 4MIBA 4ED6A 3ORYA 1BGXT 1E4FT 2E66A 1LVHA 4QJFB 2Y3YA 1UWAA 4DU7A 2A1RA 1VQLS 1OVQA 4CCHA 2POKA 5J8YC 3IFEA 2ETJA 3JPPA 3CMES 1FEHA 1RP5A 1O03A 2OZMA 3K8VA 3BSNA 4GKJK 4M95A 1NDCA 4GVMA 4NM2A 5FDLA 2EK1A 1R8AA 3I56S 3LZIA 3CFOA 1VQON 1C2PA 2UUCK 1OSDA 2VG5A 2D3ZA 4FYDA 4DPXA 3JYTA 4R25A 2F3NA 2HOQA 4CO3A 1W7AA 2UXDF 3UKUB 4E1JA 2V4RA 3ZSQA 2YKMB 3R9KA 4DOCA 2IDOA 5DZ6A 4U7CA 3HHNB 4ILHA 5HMMA 3MEGB 4LFCF 1FTCA 3L4PA 3OYBA 3AY9A 4FKYA 3JSBA 1LW2B 2LMIA 2YBVA 5J0TA 4R5PA 4K7QA 1EETB 1K1QA 3MXMA 4OYAA 2PD1A 4ZVUB 2WK4A 4HKQA 2J4RA 4M7YA 2RRBA 3CPEA 3C7NB 4KLOA 2AEJA 3F44A 4DPWA 1M1KT 3CJQA 2GIRA 1TKTB 1QZ6A 2PFNA 4E89A 1TR0A 4Y2CA 5E3PA 1NNEA 4I2BA 3LW5C 3FJ2A 1U0HB 3CJKB 3U3GA 1N32F 1IBMJ 2FVRA 1O08A 1B0TA 4NXMK 2OAUA 4Y1CA 2VG6A 4CGHA 2YX6A 1GOCA 3UE5A 1HQEA 2O3DA 3F2CA 3TTFA 5U47A 5D6GA 3C6HA 2HQDA 3OYAA 2VF3A 3CMQA 3M7VA 1XEZA 3LVVA 2E2PA 4QYZJ 1TE2A 4LZGA 1TL4A 2GFFA 3D2WA 4EO8A 3L6QA 3OVNA 2O01C 5ALNA 3BS5A 4M6WA 1UWBB 5HVGA 3M6KA 4NCGB 1OH7A 5ALKA 1ZPWX 2OM6A 4NLRA 3CIMA 1BHNA 2DGQA 2AJ0A 1YBUA 4DU4A 2R4FA 2K4IA 2BJ8A 3L7UA 1VQ9S 1QQMA 1K5OA 3CB4A 2DR5A 4DU3A 2BABA 5IIOA 2HURA 2MLZA 2FHJD 5DK5A 4WU3A 4BR4A 5K8MA 4DV4K 2GNKA 4DR7J 2A2CA 2WFBA 1TKXA 5KG7A 4DUYK 1ZBIA 4RJVA 3CC7S 4Y65A 2QI2A 2Q0ZX 1RXOB 5KOXA 1R6VA 4LFBF 4JI0J 1JNZB 1TYQA 2RHQB 3W63A 3PW5A 3C66A 5DMRA 1WTBA 1AQ6A 1ZQHA 1UZHA 2G09A 5G0RB 2DT9A 2VJ5A 3TNVA 3LP2B 4Y2JA 3KD3A 2WF8A 4PKGA 3UKUA 4LF8J 2OSRA 1TL3B 2YKMA 2Y1IA 2EG1A 3KHHA 2FGOA 4MKYA 8ICQA 2KP7A 3NNHA 1IKVB 4DTRA 2E7WA 4LSLA 3MEGA 2ZH1A 1RUSA 3RJIA 2ASMA 2E29A 1RKIA 3W65A 3UN5A 2KKVA 4ZVPB 1ZA2B 2J6SA 2QG9B 1EETA 4PHDA 1N33K 2GX9A 2FZCB 3PKYA 2F9TA 4ZVSB 3WK5A 3S9HA 3RRHA 4DR4J 3C7NA 2OIHA 5G5GA 1RAGB 1RTHB 2B0CA 4PH5A 1VGYA 4S0MA 4W4MA 3V5RA 1TKTA 4IFYB 1UP1A 3Q0AA 1NGAA 5JMVA 2GUPA 4KB1A 2R2TA 5KAFU 2ZG6A 3E0FA 5H9EJ 2J0QD 3CJKA 2A40A 4G1IA 3KZBA 4I67A 4O5BA 1VQNN 3BGUA 1J5EK 3HKWA 4AHVA 4OLOA 5J0YA 4IFEA 3W8PA 3SENA 4JK1A 2XMTA 4CP5A 5J29A 4X66F 2B0GA 4B1ZA 4PR6A 3C65A 3S6EA 2ZTDA 2GV1A 1H0HB 1ZAVA 1S77D 2UUAJ 3UCGA 5AK5A 1RE1B 2MZSA 4LF9K 1T3QA 2E8AA 3PXGa 2DTUA 1O1WA 4CO2A 1R0CB 1WBDA 2M0GB 2VA8A 2DKZA 1HQUB 1AB8A 2BRLA 3J81Y 3HULA 4MT1A 1J2MA 1UWBA 5DDRC 4NY8A 4BR0A 4LF2A 2EKNA 1ZQWA 5HP1B 2XHBA 1WC4A 3DRYA 4PG7A 4X4QA 2VWBA 2MUTB 3BBBA 3BZCA 1RA6A 1NM2A 5K20B 3E3XA 3NEKA 2P9PB 3WT0A 1BLUA 1NGCA 1B70B 4H0TB 4FWLA 3T1HK 1XMQF 3KOAA 2Z1HA 5AZIB 3V9ZA 3R2CJ 3NVZA 3P83D 2YN4A 1CC8A 1YJUA 1YJTA 2DNGA 3N4PA 4B17A 3ZZPA 1NHUA 3UVJB 2LM1A 5T7LB 1FJGJ 3TQEA 4I2PB 1N5TA 3EKUA 2M4MA 4LRFA 4OJ1A 5LMNF 1WC0A 2ITMA 5D3GB 5G0RA 4DR6J 2XMWA 2CPHA 3FUYA 2V67A 1RT1A 4M3XA 4USHA 2I7PA 1S0VA 1CRXA 3D6FB 4DS4A 3MR3A 1IKVA 3TVZA 3TOQA 5IM0A 1O8BA 1PO6A 3MWPA 4C11B 3IKMA 3LP0B 2QKKA 1RISA 2VCPA 2A0FB 4DHYA 2AGOA 3D2QA 4UAZA 5D15A 4QIFA 4Z4FA 2JLFA 3PACA 3CM5A 2W24A 4F5RA 3K7RA 2UV8A 4I1TA 1RFQA 2GQCA 2KRRA 5BYSA 1N8RO 2WHEA 4M3ZA 2QYGA 3L95X 3M8QA 1FXLA 2OEKA 2QFIA 3I9V9 4CIEA 4F5QA 3UPQA 2WCXA 3CDEA 4C97A 1GLJO 3ZSRA 1V97A 1NDKA 1N5XA 3H5XA 3CCSN 3BM7A 3HO1A 3FSXA 5ETMA 3ONQA 5AQIA 2WF5A 3FBFA 4RW4B 2ZH4A 2GQ2A 2OMOA 2K7JA 2HOEA 2BKNA 1VSJA 4KH0B 4JI3J 3HM8A 4M63A 4JI2K 1NHVA 1Z1BA 4BC9A 3FE1A 1CI4A 5KFAA 2ZH9A 4RUHA 4FJ8A 4PQUB 3C2MA 2K1RA 3HFVA 3CCZA 1B0VA 3N79A 4AT1B 3KJVA 4BE2A 3SSRA 1FKOB 3IBFB 4W5OA 2CNNB 3QSIA 3P45B 3W60A 1XMOF 2XULA 4B1XB 3W2VA 1S76D 3UQ0A 2CJXB 1HBNB 3AO3A 3CMEN 2R8GA 5TKWA 2G8WA 3QFHA 5BXIA 2QSFA 5HP1A 1DEJA 4ID5B 1PYSB 4ENOA 9ICWA 5KT6A 2MUTA 5M1OA 4BR7A 1SB3C 3I56N 5BR8F 2HBQB 2P9PA 2LEBA 1RBAA 4HACA 2WOMB 3EICA 1UVNA 3ILOA 1NDLA 5HRRA 3QFWA 4ZP6A 3SR6A 4KI4A 5G4DA 3Q8RB 1M1KO 1J9AA 3OYMA 1RBVA 2P9NB 1FWLA 2UXBJ 3L2QA 3NCPA 2NQPA 2YKNB 1VK8A 3TQ1A 5EWFA 5D77A 2ZM6K 1V3ZA 2H3IA 3B0XA 3PX0A 4L72B 2VA3A 1IG8A 3QNMA 5T7LA 4BC2A 4TYAA 3WXKA 2E1AA 5EGYA 5D3GA 4NXNJ 2IVYA 2O66A 4Q7AA 2F1IA 3UDLA 1G2EA 4P0QA 5KT5A 2C3PA 2AEFA 2HEKA 4X64J 1N88A 3T5LA 4TU7A 1S5ZA 2EAPA 4WE1A 3U7JA 2V5HG 2R7VA 2RU9A 3ENVA 4CIFA 4LF4K 5AK4A 2G8IA 3CETA 2QWQA 4RPXA 4EZ6A 5HATA 4JNEA 4PWDB 1C6VA 3LP0A 1VQPS 4KLQA 3HKZC 3MAHA 1JLBA 1BDGA 2W9AA 1NH7A 3WK6A 1U04A 3GJRB 2RPIA 4CLZA 1UTAA 1CBKA 1U9LA 2FVSA 4OPJA 1SL1A 2XGQA 3KKFA 2W43A 3NS5A 1NSAA 2AJ1A 2B9YA 1KONA 2Z57B 1N34F 5MAOA 1H38A 2DEIA 3A2FA 3MR6A 1NZ8A 3HFZB 5IINA 4B1WB 3ZT1A 4FFDA 4RW4A 1VC6A 2PIIA 1KTQA 5JU5A 3R9LA 2ERRA 4YXMA 1NGDA 1PKUA 3MN9A 1A77A 3HTVA 3LDAA 5KFVA 2NZTA 3LALA 1VK3A 2QRRA 5AQQA 4O5EA 3PHEA 1VSLA 1VQ9N 4B1YB 4IDKA 1QLNA 3D3BJ 3HSGA 1FKOA 1T03A 2UXDJ 1SJ3P 1TKZB 1X4AA 4FZNA 1VQYA 1WEZA 1HARA 4JI7F 5DBAA 8ICCA 1ZD3A 4YB5A 3TTDA 2D9OA 4NRUA 5AQYA 3T41A 2YMPA 3UO0A 4LFCJ 1FDNA 2GVDB 4F4KA 2CQBA 2DCLA 5L8RC 4CNYA 3ZDBA 2LDYA 4GV9A 2ZWPA 2MZRA 4ID5A 5E33A 1RXVA 3WNHA 4I2GA 2Z56B 2KICA 4N7TA 4F50A 1AFIA 3DLKB 4OV6A 1VHFA 4A46A 2N3OA 2CUYA 3G8SA 1R7IA 3G4SS 4M1KA 4FJJA 4LBPA 2RHKA 4BE0A 3AOBA 2HB5A 4BVPA 4CZCA 2DHAA 1M90T 3KK7A 5KGXA 5HBMB 5HHHA 3HJVA 3ZZ0A 4IR1A 1N32J 2HVZA 2GOLA 5CXTA 3ZZRA 4IH6A 1N5WA 2HPUA 4DO9A 4G9BA 1FRJA 2QM1A 2E2OA 5TZVA 2MSSA 4NLQA 3Q8MA 4QW9A 5B8HA 4CM0A 4MDBA 4MO5A 2Y0SF 1BXNA 2F40A 3DLBA 2F5GA 1NJIT 1U2VB 4MIAA 2QKBA 2A1SA 4J2DA 4K2JA 2WSCC 4DV5F 1YJVA 4IOCQ 3DN9A 4ES1A 2ZJPL 1NOZA 1N0VC 5J0SA 3QWPA 2A1JB 4CI0B 3EVOA 1IBMK 5JS2A 4Z6CA 5FPNA 1RLDA 5I3QA 3TJ8A 5AR0A 3B0YA 3AVMA 1A6SA 1T11A 2W2MP 4PWDA 2OMLA 3MDQA 2H9ZA 4G1QA 5LL6Z 2CQIA 3EZ5A 4WU2A 4NLKA 1LOTB 4QYZK 4CJLA 1TFRA 3MOZA 4RX6A 1XQSC 1Y3KA 2I7NA 4ELVA 3Q89A 1X60A 3LDNA 2VDIA 5E41A 1Q53A 1RAIB 3RMDA 3GDXA 4M47A 4B3MF 3I5BA 2DUYA 1KDNA 4YMOA 4M3WA 2VBXA 4Z4HA 1C0UA 2AJ4A 3SUPA 4H4KA 3D5MA 4NLOA 3SIPB 1UEKA 4I2EA 4Y00A 5L1MA 3C5GA 3J7YU 2W25A 4V1Ak 4LFBJ 3VF0B 2B5JB 5F8LA 1X8DA 1ZQ1C 4LVOP 1KW4A 3EWAA 4FF3A 3RB6A 1S6PB 5HP4A 3TU5A 4I28A 1Q8LA 2AH5A 4DN0A 3EJMA 3S6JA 2UUBF 3Q23A 3VAHA 3BS9A 4OYZA 3FM9A 1KFDA 5CR0A 2I0XA 4AD6A 3L2WA 2E5LF 3VA3A 3N28A 1R0AA 2YX8A 3OHAA 1NK0A 4HTUA 1VLYA 4JI0K 5HAOA 3GG4A 1GXLA 2XWYA 4ED3A 1WORA 1NPRA 3ILJA 3AHPA 5D46A 2ILZA 1RT4B 4JI8F 3CCLS 2ZH6A 1ZJNA 4M63C 3AVNA 3WNGA 4LF8K 4HL9A 3LO3A 1NLVA 4FWRA 1HI8A 1YLXA 4JD2A 2QB1A 4X4RA 3GIKA 2YKQA 3RJKA 1GLDG 3DLKA 3QICA 1TGOA 3O9TA 3AO4A 3ZTPA 1EO1A 2KVIA 2YNIB 3AN1A 2VWKA 4CZLA 3Q8VA 4CLKA 3FCHA 2CKWA 3QBXA 2IFXA 2W2PP 5HQ8A 2DGWA 3GU3A 2QZ8A 4PZNA 3EPGA 2BW7A 4DOBA 5HBMA 1HYSB 3D6TB 2P66A 2DPJA 2CNOB 2LQ9A 4DR4K 1IWAA 4Z6DA 4LSZB 1TVRB 4UB6U 2KJVA 4X66J 4MAKA 5K8PA 2MKKA 2K8AA 2FYXA 1FHTA 1OKJA 2X1BA 3JS6A 1Z1ZA 4I2DA 3EY1A 5DGBA 1VHXA 5H9EK 4CZMA 3BY5A 2I1QA 2VB6A 4MF8A 4DOZA 2PFQA 2A1JA 1NK5A 4A5BA 3SV4A 5DRKA 1V5VA 2XI2A 2FY1A 2N82B 2F2AB 1RI7A 5EOYA 7ICEA 2L9WA 4DI6A 3KLGB 2QLTA 2W6KA 1VYAA 2GMHA 1YBAA 2BCQA 2P8IA 4OX9F 4CHOA 3P39A 3SQGA 3QPIA 5GAGI 3KUHA 4DV6F 2NO4A 4KPCA 5J0UA 4ILRA 1UW4A 1RADB 1FFWB 1UA1A 3PYFA 1UPHA 1XMQJ 5AQXA 3IO1A 3ILIA 8ICGA 4MJKA 4I9QA 5HHIA 3RU0A 4YY3F 3Q7BA 1G3OA 4M3RA 4W5QA 2KK0A 1JQGA 4N47A 3P5JA 5DM7L 2JHEA 4TUPA 3D2EA 1DY3A 3ZCMA 2P9EA 3QMQA 4CJUA 3LYSA 2B5JA 2E9RX 3ZDCA 3C46A 2HG4A 2ZOMA 2RE2A 5DG7A 1ITGA 5LMNJ 1VK0A 4CF8A 3GCXP 2CQ2A 2F8HA 5F2RA 4GVLA 3HJEA 2GX8A 1MNEA 4O3NA 4ZH4A 3ISZA 5F1XA 2R7TA 4JBCA 3R1LA 3GSDA 4CJWA 1FJGK 4PXCA 3ENBA 3Q8LA 2LEPA 1M5SA 2XS2A 5HMLA 4K4WA 1IIPA 3H5YA 2PMZC 1RT4A 3DU5A 3LPYA 5AKYA 1I3AA 2OO4A 3CULA 5AQTA 1QZ5A 4UUXA 5EUHA 2OYQA 3H4BA 2HNZB 3GJSB 1D8BA 1SC4B 2RQKA 2IM1A 3ENWA 4UB4A 3HX0A 2DGOA 3K4GA 2DNOA 2F4VF 3C95A 5AZJB 1ZBHA 4U6PA 2QLWA 2BM1A 1I3OB 3L2UA 4FSVA 1G4CA 3PR5B 2K60A 4YQWA 3CJRA 3D6RA 2XMMA 3ZSXA 1NXIA 5H9FJ 2CQHA 3I8DA 4J7CA 4BR9A 5ALEA 2IVPA 3WK4A 2O8EA 2CPZA 1BL3A 3MTKA 5DZ7A 5KG1A 1O5JA 4U9RA 1PVPA 4O4GB 2W2OP 1N5VA 2FJ6A 2Y0BB 2O8BA 2I1RA 1VQ8S 4Y2TA 1B92A 2IOCA 3VVUA 4G3IA 4P4OA 5EVZA 3G6EN 4CJPA 2BEFA 3ITHA 2CJQA 3TSUA 4ZVQB 3N4QA 1WUUA 1XMOJ 2H4WB 3RBXA 1ZQEA 1KL9A 2D41A 2ZXIA 2IVFB 4JI3K 3WKEA 3V2UC 2ZHOA 2PFOA 3HSZA 2ZJPQ 5AQKA 2A3VA 2W40A 3FBEA 2K4HA 3TR8A 2HRUA 3FKBA 1DRZA 4AM7A 2OPPB 1K73T 4ECTA 4ZTJA 3MCAB 1EAYC 3NNAA 5BR8J 4BR2A 2KSOA 1XSLA 1AZSA 2V7ZA 4QS7A 4CJ3A 3DXKB 3FGVA 3RRGA 2HQFA 4DV2F 3AJ1A 5AK6A 3HHEA 2L48A 3SAFA 1OY8A 5L1IA 2XVTA 1JUDA 1RDWX 3AXKA 2PO4A 2EEYA 4OCZA 5AKHA 4P71A 2IM0A 4PWUA 4C4RA 4YOVA 1M90O 3RAXA 4M9NA 5ALSA 3A8JA 4H5NA 2WF9A 1FWKA 5IQ6A 4DUZF 2KFYA 1Y64A 4LC9B 3NCIA 2XMVA 1FFSB 3WQPA 1LEOA 3I9ZA 2FJBB 1NJIO 4X4UA 2FPMA 4GC6A 1WDDA 3UXOA 3O2IA 3O80A 3P49B 3OTOF 2C2DA 4JKAA 4B9QA 1ZYQA 1P9YA 1FO4A 5FPMA 2BE9B 2KFNA 2Z2LA 4ILLA 3HL8A 3G4SN 3NY0A 2WBNA 1L8LA 1NU0A 4BRIA 1N6QA 3UE2A 3RW6A 3BQ2A 1JX4A 1ATRA 1Y9OA 2FHMA 4NXNK 3MMAB 4GIBA 4KN7A 3PW7A 4NLUA 4F0KA 2ZGZA 4PWWA 5AI6A 1XTZA 4GXKA 1FD8A 2W04A 2MZJA 2ASOA 2B8QA 3GZFA 1BO5O 4ANDA 4K4XA 4PJ0U 2HAIA 4FDFA 1P9QC 3THWB 4BRPA 1RT7A 1N34J 1HQ2A 3TYTA 2MLYA 8ICYA 1R31A 2EANA 1T6CA 1QUPA 4USIA 2HIYA 4DQSA 2DR8A 3VEVA 3B82A 2P6TA 3IA0A 1ZQYA 3B6PA 2EK6A 3PR4A 3FEZA 4FNHA 2ZKUA 3VF4A 2J76E 1HBOB 1JJ2R 1HJOA 1EARA 2J8AA 2B6AB 5JVGL 4YMNA 2IC3B 4CFCA 4FJGA 4B8AB 4ISFA 2YVSA 2IAJA 3MDAA 5AFUH 1B0XA 4C8YA 4ANCA 5AQLA 4JI7J 3W7BA 1MN7A 3L3VA 2D6FC 4Q45A 3MBYA 9ATCB 5KFOA 4WZMA 4YDUA 3WEEA 1NGHA 2MTLA 2Q6BA 1VBXA 5GAHP 2AYMA 1SJQA 3PIPL 2B4UA 4OJGA 2OPPA 1PVQA 1HPMA 4GXJA 1KLMA 4YUDA 2UXDK 4DQRA 2DNMA 1V3RA 4NYFA 3NRZA 1RHUB 1B7FA 4AF1A 4FLYA 3BGFA 4TLQA 1X6JA 4LFCK 4Q2MA 1FTRA 2HHWA 4JKBA 1N54B 3DXKA 4RO0A 4CW7B 1RK8A 5DLGA 4ES3A 2LFVA 3TEGA 4BC4A 2GIQA 3WK9A 1FRXA 4DTSA 4KLMA 1FKPB 8AT1B 3JPNA 3MMBB 5LJWA 1KAZA 4Y2KA 2DGUA 4IH7A 3U3YA 4MO4A 1HWJA 2JLEA 3EUNA 1R27B 1S8OA 3BUZB 3B8HA 4YNQA 2HVHA 8ICVA 1YVUA 4E7HA 1RU2A 4CF3A 3HX9A 3VGKA 4Q43A 3D2SA 4DV5J 3CCLN 3O4WA 2OI2A 2ZE2A 2BJ9A 2YMMA 1N32K 2A6MA 2KU7A 3TR5A 2C2NA 1EKRA 3VHQA 2PY5A 4FNIA 5AQZA 3ISDA 1KFSA 3MM8A 4K0KJ 2NLWA 1UT5A 3IAM9 4RW6B 1NZAA 2UXCF 5AXLA 1MROB 1VBYA 4DPOA 4AQYF 1ZD2P 1TUVA 1K8AT 2DNRA 4KMOB 5AIBA 3BDPA 4IQMA 1KS2A 1X5SA 3FVYA 3NTUA 3UN2A 4AYBC 3W9HA 1SC1B 3HF5A 1J5OB 1N56A 3NVVA 4BLGA 3RB3A 4PHAA 4UAVA 5EDWA 3IXQA 3G96A 1RTIA 3L3CA 3MGIA 4EX6A 3CCVS 4KTZA 4B3MJ 5JJBA 1SQKA 1G7CB 2RAQA 4XPEA 2CGLA 4CIOA 4QCLA 3CCRN 4IKFA 1E6YA 3KG4A 2Y9HA 1UVLA 1S10A 1ZXIA 1JJCB 3GE9A 4YDXA 1ZZFA 1HBOA 2B7BB 4FP9A 2P2CB 2YJFA 2G2YA 1GK8A 2B6AA 5KFXA 4IDHA 4OKKA 1FFVA 1WWUA 3IBPA 2DFEA 2UUBJ 4KKOB 4FK0A 1M6YA 1UAXA 3EXCX 2VPXB 2WB1F 2BJDA 4F3TA 2E5LJ 3W3DA 4UW9A 4QIWC 1WUDA 4LFBK 4FPIA 4FXVA 5LSLA 3V72A 5EHHA 4EMDA 1ZQAA 4KX5A 4IL6U 5GTIU 1SH0A 3KBBA 4YMMA 3FSIA 1DXSA 4JI8J 3DMJB 4CHNA 4HI1A 4W98A 3QWUA 1J27A 3NF7A 4IZ9A 2NRVA 2ZQBA 5C15A 1WTFA 4ZITA 3A0IX 3ILLA 3RBDA 2HBMA 3NGUA 3RTVA 5KFFA 4Y2RA 3FCVA 1NK8A 1UCNA 1P8ZA 3P3DA 5IT4A 3KK2A 2CZ4A 3EMTA 2BJEA 4OPHA 4QZHA 4WWSA 1EKSA 2ZJ5A 3OL7A 1U6ZA 4C0HA 3AA5X 3BPSP 4YR3A 4JMUA 5KFKA 4BQLA 4PZVA 1NK4A 3BEXA 2NYIA 3ISND 3H2LA 4K59A 1VQ7S 1QHTA 2V9KA 2RF2B 4ZOSA 4LIRA 4F7VA 2D8CA 4DL7A 1IJFB 4BGBA 4WJBA 1S9GB 3M32B 2Z2MA 4KV8B 1J2VA 2MKSA 4HUEA 4OX7A 3BGRB 1SC6A 4BGAA 7ICFA 4C2MA 2FJWA 5HR7A 3NGYA 3OYDA 2E1RA 1IM4A 4FF4A 3A3PB 4ZJLA 1VC5A 1MROA 4DQPA 3WNFA 4J2AA 4PZOA 4OZ1A 3H98A 4MEXA 3NXZA 2E1EA 3GG1A 1B9FA 4PYAA 1J5OA 3V6KA 5FD1A 4OX9J 3QEBZ 1M5HA 3ICLA 2H5IB 2KJ5A 5ALYA 4DV6J 1C0GA 4YOXA 2ZF5O 1Z1VA 5HQLA 5B0BA 2FC9A 1TAMA 1RAJA 3Q8SB 4Y2XA 5BPMA 1SV5B 4J9PA 5IT9U 4O4RA 3CMAN 4YY3J 3S8SA 4P6QA 3VZIA 2PA3A 2OA8A 1ITPA 2HOIA 3IP0A 3CCQN 3NFAA 4ECXA 2K4EA 3ENAA 4FWOA 3CCMN 3HI9A 3HWTA 4TY8A 2YMLA 5CD4H 3JQMA 1LW0A 1NB7A 2AHOB 4RL1A 7FD1A 4Z2XA 4CJ5A 3LF0A 1COOA 3HSDA 1RHRB 1XMQK 4ETXA 4JYAF 1HMVB 2DF4B 3SAHA 3T5KA 1HBUB 5AM5A 4TNOA 5JS1A 3MEDB 4ZS6A 4B1UB 3NH0A 2JNJA 4A5AA 2DNLA 1RYRA 3EO3A 2NRWA 2C1EB 2OEJA 2VONA 5DO2A 4YHHF 5BN9A 5GMEA 5LMNK 3FK4A 4LR9A 2RU3A 2XYGB 5IIJA 1VSKA 2CQPA 4KRWA 3NH2A 1OH6A 3IRUA 1CJTA 1IG9A 1QM9A 1H72C 4A8SA 3ATUA 1RHJB 2QFJA 2QMXA 5CB1A 5AQPA 3PIPQ 1IM6A 2LECA 4CGDA 4XTTA 4P0PB 2F4VJ 3SCXA 5T7BA 1F6TA 1QVFR 1ZQDA 3IM9A 5J2PA 1VQMS 4YDUC 4M9HA 4G65A 5ETKA 2OZSA 2HAFA 2A10A 2E7VA 5CAAA 5KOWA 4RW8A 1C7YA 1HBMB 4EU0A 3IBCB 4M5KA 3VGTA 7ICKA 1RT3B 2A1BA 3HCXA 4CLTA 3OL9A 2W1BA 1SL0A 9ICMA 1KQQA 1TL7B 3G2XA 4USJC 4X84A 1I6JA 1S9GA 2F1FA 3R5CA 2YNGB 2HFOA 3BBFA 2D3O1 5H9FK 4DSEA 1KVIA 1WSIA 3RFAA 2Q1NA 5B09A 1OY6A 1RDRA 2KHCA 3N4MB 3WKAA 2XLJA 2GJ2A 1MN8A 1RAEB 4Z94A 3V7LA 3GCWP 4OIXA 1N60A 2GWSA 7AT1B 3AAQA 1U09A 3VGSA 1HWKA 4Y6IA 2XNRA 1B99A 1SBRA 1XMOK 5J0WA 4NLNA 1KVKA 1R43A 5HL7L 3RJGA 2ISPA 3PJXA 2NV3A 3CD6S 1QSLA 4DV2J 3H5SA 2ZDPA 3WU2U 2XNQA 4MFBB 3F9KA 3ONNA 2H3EB 1SIWB 3M6UA 3KYLA 4F26A 5AM1A 4AL6A 3NE6A 4KLJA 4MK8A 4DUZJ 4U96A 3DGVA 1FDDA 3UDEA 5AQRA 4KQZA 4CTAB 4ZVOB 4J9NA 4YB7A 3RR8A 1HMVA 1M5PC 3OTOJ 5ETOA 1TFWA 1JK9B 2OJ3A 4RU9A 1X40A 5J1NA 3QEPA 2P9SB 3MEDA 1SB6A 1W9HA 2NCKL 3U1LA 3C5FA 2QTDA 2BTFA 3BP8A 1S1WA 4OI0A 4DTJA 5AI9A 5J2HA 2R2UA 3BR9A 1PCAA 1S12A 2NXCA 4QR2A 2D0PA 1Q3UA 2XZDB 3J80Y 3QFUA 3CD0A 2F7VA 2AU0A 1Y4ZB 5AK3A 8ICOA 4KFBB 4DV3F 1K8KA 3C15B 3K89A 1QJHA 3CNHA 1IJEB 3K75D 3WQUA 3MD3A 4C3LA 2VFUA 5D49A 2WAQC 1VJ5A 4DTPA 3CNQP 4UY85 3MMCA 5KQ8A 5M1KA 4NJ8A 3WKDA 1HFEL 1X0FA 4DR5F 3T7ZA 2FDNA 1N33J 4QOZB 1A5WA 1HBMA 1FX4A 5MLCV 1RT3A 5F8HA 5J0XA 1N34K 2E88A 4CGGA 2FZKB 3TJAA 3LDLA 3ZSZA 3HVAA 2E1ZA 1NO8A 1HPZA 2YNGA 4CFDA 2X1GA 1IVZA 3WC2A 1HKAA 1JKHB 4AL5A 3BN7A 2DISA 3FYHA 1YRTA 1FIQA 4CRXA 4NA1A 1K0TA 5DB7A 4LVSA 3NS1A 8ICLA 2WF7A 4KLIA 1M5VC 4ILMA 3QYPA 5D4LA 5AI8A 4K8RA 4C48A 3QEWA 1W2BM 3NVWA 3HSTB 1TL5A 4HH1A 1HNXK 4YFUA 3ID6A 4E1NA 5EU7A 1E6VA 3HVRA 4JI7K 3HILA 1I94F 3H1QA 1YVNA 4RQ2A 3QXGA 2JEGA 2P9KA 3GFYA 1LKYB 3O44A 1F9EB 4DX5A 1FI4A 2B3TB 4MDAA 4PEOA 4BBYA 1PC5A 4URGA 4BE1A 5KNIA 1UEVA 4TKTA 2GA7A 2F8KA 4LF6F 2G0JA 2CVEA 2JV3A 1DOQA 2IA0A 5L9XA 5C42B 3CQ8A 2W9CB 3R7BB 3DLLL 4IEIA 1RNHA 2FQQB 1X6IA 1CJKB 5KT7A 4YB1P 1S0NA 4FKXA 3DM2B 1ZD5A 9ICXA 3G6YA 1X3NA 3O4NA 2DGZA 1BIUA 4UOFA 4WF9L 2B9WA 1S7HA 2JC0A 2JWKA 3MXJA 4CHQA 2WHOA 2OLWA 3MWBA 4NLBA 5ALVA 4Q2LA 2GHPA 2QLBB 1KBUA 1SXLA 2UXCJ 4W5RA 4KLTA 2ALZA 4PG4A 4AQYJ 4EWTA 1XC9A 2D0AA 2AT1B 5DG8A 4CEQA 1VQ5N 3QAEA 4KGMA 3MWTA 5AQVA 4DV5K 2AJQA 3J7AN 1T9UA 4AL7A 1SXEA 3AA2A 3ET6A 5LXRA 2RVJA 4U95A 5B0AA 3DU6A 1SWVA 4GV3A 3U27A 3RH4A 3AL0B 3R7SB 4F02A 3Q8PB 4QZDA 4HDHA 4O3PA 3GILA 2J0WA 3DOMB 1I51B 1FW6A 1ELOA 1JCEA 2Y9TA 1PSDA 2VU5A 4NZ7A 2QA4N 2OWOA 2CVIA 4B3MK 3DDNA 4J37A 2RKIB 3M1VB 3LP1B 3F41A 2W9BB 2W8LA 4DU1A 4PUOB 2L41A 4CH7A 1ZPVA 2NZCA 1U2CA 3MN7A 3U1MA 1KXPA 1VIXA 2PFUA 2OTLN 2NNWA 2NXJA 1N48A 4YOTA 4CF0A 3R3TA 4K4VA 5FPDA 4BG9A 4O3OA 3UDCA 5B5EU 4Y2UA 2UUBK 1TKDA 5IIMA 4ZPDA 2V2ZA 2ZGYA 1LXNA 4LF9F 2XMKA 1KHVA 4GVEA 3SAGA 4C7ZA 4X4OA 2BJ3A 2E5LK 3TA2A 3PHTA 4R79A 1HKBA 2HVDA 5D4BA 2XO6A 1YJNN 4I69A 3M2VB 1LKYA 1CVJA 4NMLA 4JWNA 4LREA 3TRGA 1FXXA 3D54A 2GS8A 3AXMA 3CD7A 5AKLA 3R9PA 2YH0A 5J0QA 2R2RA 5F8IA 4JI8K 4OI4A 2V9WA 3TABA 1SC3B 2HMIB 9ICBA 1T3OA 4YDDB 2W42A 4DSFA 4UUWA 4WP3A 1ZBUA 4ZJQA 4PPDA 2QL5B 2FY8A 3LTOA 2F65A 3T1HF 4O0NA 3CDBA 1U48A 1LWEA 1TUWA 1BNOA 2HGMA 4KHUA 1TUGB 1EB0A 4C98A 1REVB 3TVYA 3DM2A 2DWQA 3PRDA 1GMUA 3I5CA 4OYWA 4DV1F 3C6TB 1RWNB 4A8MP 5DGAA 3UNYA 2GVZB 2V2VA 1JL1A 4O9MA 3PW0A 2NLXA 2LBOA 1COKA 2DTJA 1JMSA 3O8WA 2L9NA 4EI2A 3SBGA 3SEOA 4Z4IA 4FWPA 3U1NA 3HRGA 4L3NA 3ZSOA 1NGJA 1WSFA 3DDKA 2HS4A 5AM3A 1VQMN 3PEHA 4QZVB 4XO0A 2Q3PA 4MH8A 3IHQB 3GYGA 1WHXA 4HCBA 1D8ZA 3EGWB 5J2MB 2AV5A 3D67A 4KREA 2GUIA 3OLBA 1PG5B 1EKEA 3CVKA 2QV6A 3E51A 3PW2A 4CZFA 3QERA 3CO9A 2X51A 3GOIA 3CJ7A 2VFRA 4QS8A 2DNZA 3AVAA 4HDGA 3HBTA 4E19A 1C0TA 2ROEA 4OX9K 4FWNA 2DIUA 3HYFA 4Z4EA 1ZRNA 4DV6K 4DSJA 2FBXA 3CJ3A 3GFKB 1NNDA 2KM8B 1Y11A 3HSJA 4K41A 2PA8D 1ZQSA 2DH7A 4JYAJ 3M1VA 2FLLA 4J9OA 2W9BA 4PUOA 5KFGA 2ZNYA 4K8XA 4YY3K 3PV8A 2FSJA 4CEZA 1XS9D 1P7DA 1AW0A 1U6FA 5AKEA 3C1ZA 3PY8A 3C2KA 2EDUA 1RKJA 4PL8A 2ZD1B 3CD6N 9RUBA 1PYTA 1RWPB 4YHHJ 1FXRA 5C10A 2W7PA 4Y2AA 2B6GA 3RUBL 4GMJB 2HLUA 2V8PA 1YJ9S 3I5AA 1WHWA 4ES2A 2H65B 3O3FA 3CT9A 5F0XA 4JHDB 2WSFC 3KD5E 2VASA 3MUTP 4DFKA 1Z4UA 3IGVA 5E0OA 1UJ5A 1KOOA 5DDMA 3M2VA 3IAYA 3HMJG 3I0RB 2E1PA 1SQFA 4C0OC 3OV7A 3SEIA 3QDKA 2LU1A 3HPHA 2ZIVB 8ICEA 5KFEA 3MF5A 2UUWA 1ZQBA 3T69A 1J6ZA 1MQ3A 4B9LA 8ICRA 3NRWA 1BPBA 4IQVA 4B3OA 4WCEQ 3ZYYX 3ZZZA 2X1AA 3LPTA 2F4VK 1OWXA 1H73A 2KT2A 2VOPA 1FNXH 2O4GA 2HBLA 2GVZA 3GYXB 1BQMA 3MM7B 4CGJA 2ZJQQ 2KRBA 1YAGA 2RP5A 3OS1A 3MCNA 2H1YA 4NEYA 4F4YA 2ZIWA 2R7SA 3TAGA 3T19A 3LDPA 1ZQCA 2Y1RI 4LQ9A 5J1EA 2KN4A 1B22A 2G0IA 4HCCA 4FLWA 1ZQGA 3C14B 2HHPA 2XC9A 2XSJB 2HK2A 2KTQA 4RNMA 4IWVA 1S7IA 1X4HA 5F3TA 5J2MA 5A6WA 2OPSB 1C0MA 2KMDA 1XMBA 3DDIA 1DTTB 5IS2A 2HFVA 2QA4G 3F53A 2LU2A 4JKHA 2MYFA 5IT0A 4B3RF 4DFPA 4IQTA 3BV8A 5HRPA 3J8AA 2HHTA 1TK8A 2FJXA 3K0SA 1RCXB 1SKUB 3M2UB 2MZ1A 2HHVA 5IOLA 2YWEA 2O5DA 2YQEA 1PJ5A 3M4XA 1KD1T 4BXOB 1RPLA 3TVKA 4FZVA 1UPPA 5KL1B 4RBUA 5C2GA 2HNDB 2I38A 4Z7YA 4CH1A 1Q46A 4RQ3A 4JI5F 2DRAA 3NHGA 4DV2K 3RJMB 2KT3A 4GKJJ 1NWKA 3B4MA 1W0HA 4OVLA 3AVIA 3V1RA 3T79A 3C19A 4C8KA 4NYZA 5KPTA 3D0PA 5KRTA 2EWSA 4ZIWA 3LZJA 2C2RA 1HD1A 8ICPA 2JGUA 4DUZK 1IWGA 1H6KX 1P90A 3FLCO 2P6SA 1WJ9A 1KVBA 4YOEA 2G5HB 1WKLA 2Y8WA 2D74B 5CEHA 3OTOK 5AHXA 4ICLB 4Z4GA 4HTIA 2G1DA 2BGGA 5AI4A 2DIVA 3CJAA 5IC4B 2CGJA 2D1KA 3N6NA 4DV3J 2M5YA 5KFTA 4RT2A 2BV3A 3EVWA 4RKUC 3P5BP 5BPCA 2JZBB 3I0RA 5A2QO 2IMWP 4CZHA 4CYUB 1JLCB 1YQHA 2R18A 3VEZA 2BCUA 3A8IA 2OXOA 8ICTA 4ZMMA 1YBTA 1RQLA 2ZIVA 4R64A 2F9JA 3ALRA 1IKXA 1FRIA 5AQJA 2COLA 4DR5J 1YK9A 5DKWA 1RAAB 1KC8O 2ZOGA 3AJDA 1U0SA 1Q79A 3OYKA 4XA5A 1T7PA 3C6UB 3VTHA 4QWBA 4F72A 2F4FA 2V8GA 3Q8YA 3KNAA 4W92B 1KFTA 1WC5A 2MKJA 3MOJB 3NGKA 2Z2ZA 2XY8A 4H0PA 1Q81T 3I33A 2DHSA 4LRCA 3UDVA 5KFBA 2LP4A 4YOYA 1ZM2A 2N3LA 5AQGA 5CY4A 5B66U 1VQ4N 2EC2A 3CO0P 4C3MA 1X5OA 1RT5A 3KWGA 4I6MB 3CF5L 4DQQA 4DX8H 2K89A 3C3LA 2XSJA 1I94J 4DOAA 1D5AA 2R9LA 1ZA1B 3VQ7A 5AXKA 5KG3A 1DTTA 4UOGA 3AOAA 5EN1A 4QIWF 2FUG9 3OR2B 1VR6A 4LSNA 2CIMA 3D4JA 1SKRA 2ZUGA 4RQ8A 2KIVA 4QZCA 3M2UA 4LF6J 2FLNA 1V9PA 3DOKB 5ALTA 3HZGA 3TZWA 4PPXA 3CW2C 3ZZUA 4DV4J 1X4FA 3P4UB 1OMSA 4H4OB 3ZT3A 4KBOA 1RT2B 4L74A 4OI1A 4K4YA 3ZT0A 1YKWA 1L7NA 3E9LA 7ICNA 5J2CA 1OO0B 1PJ7A 4CWBA 4QBUA 2ZIUB 4IG0B 1FF2A 4NLPA 4DTNA 2JEIA 1RBSA 4UW2A 3SBTA 3VC8A 1VSHA 1JLQB 3HKZD 2QXLA 5KFIA 4TURA 4PRFA 3NVKA 2Z58B 4UB2A 1XERA 1F9FA 1URNA 4ICLA 4EFHA 1HJPA 3PIOL 3N01A 4MMOA 3BF3A 4KGZB 4TUQA 4DL2A 1RDBA 2IOFK 1F5AA 3MTJA 4OGCA 2W9MA 2JZBA 2G8FA 2OANA 3LK9A 3CC2S 1JLCA 4ELTA 2VQEK 4OJHA 5J8YA 2XG8A 2EHGA 3OYIA 5C24B 1JLFB 1XHZA 4PGQA 3OBWA 1CZBA 3TAEA 4XDCA 4Y2MA 2XHCA 3HOSA 3UN3A 4QWEA 2RRNA 4E8UA 4CJRA 2KI2A 2P9IB 1XNQF 5EOZA 3EW9A 4MFAA 2Y0SC 3A3OB 2HS3A 2M7SA 1Y97A 1BPDA 5DBCA 3ZFVA 4RUAA 4KC5A 2DFLA 4UARA 4JI4F 1WSVA 2LYHA 4UBCA 1ZQFA 4CLYA 5DS7A 4BQZA 3SCIE 2W7OA 4RCHA 2WF6A 3V81B 2DXDA 2JOQA 2OTJS 4Q0BA 2NS1B 3KWIA 2QL9B 1RZMA 2BQUA 1L7OA 2A5XA 3J7YI 3DRPB 4CEEA 2H3GX 4FOEA 4LF9J 4X4SA 4I6MA 4O3MA 2GCFA 1SAZA 2FMQA 1UZDA 2OGUA 1TV6B 2QIFA 4LQ3A 9ICCA 4ZPBA 2R7QA 4DUTA 4OYIA 5J2QB 3MC1A 3QNOA 8ICWA 4FL9A 1WI8A 4LMZA 4PL2A 2FHKA 3SSSA 2DGSA 2QX0A 2V0NA 1S0OA 3IG1A 2UU9F 4OYMA 4HHHA 2K8GA 3H4DA 1RWWB 2QWPA 1C1BB 1S1UB 3SBMA 2M52A 9ICNA 1KQSR 4FJ5A 1U47A 3SZ2A 1MWYA 4OJ3A 3HT0A 3T1HJ 1I5OB 2IM2A 2CPYA 5KT4A 3PRVA 3KHGA 1GLFO 1YJ9N 1MC8A 1TL1B 2BANA 3BQ7A 3LANA 5A6PA 4DV1J 3PFEA 4O5KA 4CH0S 5A8KB 2CPFA 4FJHA 4RBTA 3RBZA 1UQVA 3JPRA 2ZIUA 4KHWA 2VOOA 3I32A 4OLAA 1JLQA 4QNLA 3TAQA 3EYZA 3CJ9A 5GADU 1VS3A 2BXJA 4KR0B 3POTB 3WKBA 5M1NA 1KKHA 2KM8C 1C1CA 3HZEA 4V19X 2IRXA 3MDCA 4R0JA 2CRXA 5ETPA 3S3OA 4PGYA 2MY8A 4ZIVA 3FC4A 5D4NA 4DSLA 2AGQA 1E4GT 2Y8YA 1CEZA 5EE3A 2MAXA 4TYBA 3LDQA 3IRXA 5BRFA 2NR0A 5EWGA 4J9MA 2DGXA 1JLFA 4NASA 4GKKF 1ACMB 2DO4A 2CJYB 4O8KA 4CK1A 2ATQA 2BBEA 1CXUA 3CCJS 3KUEA 1SQGA 1KD1O 4M5NA 3L9ZA 4QWCA 4FZMA 4CF2A 3MM5A 1ATSA 3NH1A 3G10A 4Y3CA 3AVGA 4GV6A 2P9IA 4Z37A 5GAHU 2V69A 3CHWA 2GIFA 4NL9A 3KNGA 2W01A 2AEMA 1VQ6S 3SUQA 4I9LA 2YHXA 2AF6A 4NO7A 1HNVA 3CI5A 1LB2B 1OW5A 4O44A 2EVZA 3KDOA 2DRBA 5FROA 3AMZA 1NGEA 4A4JA 4ZCMA 4JYAK 5BYQA 3LGMA 4DZDA 3DRPA 3DI6A 3CIZA 2FJAB 4WP9A 4P75A 2X3DA 4DCCA 2VBZA 1U8SA 2Z30B 4FPBA 4N5SA 3N97B 4I27A 7ICVA 4JN4A 5J2QA 2VBWA 2HBKA 3B78A 1GXTA 4YHHK 3O08A 4XUSA 3CF5Q 4I2HA 4K43A 4BHQA 2R8HA 5K14B 4DCOB 3E2EA 4KLDA 3X3UA 3NBPB 2VDHA 4DL0C 2OP5A 2HFUA 2FMPA 2OH2A 1S1UA 3QJPA 1CG2A 2NXNA 1IV8A 1IR1A 1KRPA 3PDNA 2E44A 2VFTA 1QE1A 4I56A 3ULDA 2J9DA 3DKDA 2OPRB 2P9UA 2H3VA 3SQ0A 1PVRA 2X7IA 4K5RA 1YIJN 1QQOA 3QJLA 2HRYA 3TJ9A 1P27B 1WSRA 1RDDA 1BQNB 2HS0A 3LM9A 4JK7A 3H08A 1Q81O 8ICNA 3NOCA 3QMLA 3WZ0A 1EZZB 1QH9A 2VG7B 3CJTA 1L5UA 4E1MA 3DGPB 3G8TA 5MLCQ 2DR9A 5F3XB 1JLGB 3RG6A 3ENHA 3VQQA 3PW4A 5GTHU 1SIZA 4AP9A 1BIZA 3C94A 4M5LA 5BPNA 3ZEUA 3BKTA 2I9SA 2VC0A 1CC7A 5CZ1A 4B3RJ 3JTPA 3I6PA 2VIXA 1GOAA 3MPYA 1FDAA 4I64A 3SJHA 4DXLA 3KLFA 2GO7A 3DJCA 5KFHA 1Q7YT 3MFIA 4CO4A 4CBXA 5LMUF 4JI5J 1VLOA 5AI0A 4CVNE 3NVYA 2ZDOA 4KO0A 3H8WA 2C3UA 2PFPA 2FVCA 4IRKA 4ED7A 1N8RT 3BPDA 1JXBA 1YHQS 3SMPA 3C8YA 5J2NA 2D7SA 3IN5A 1ZQKA 2KZZA 1RAFB 2NPFA 2HQ3A 2FBVA 3AJ2A 3AVHA 2OKQA 2DNPA 2PMZD 5DB8A 1RWXB 2MSTA 3TX8A 3JXUA 4CLLA 1URJA 3K2PA 4PXBA 2Q66A 1QDUB 1X0PA 2GWKA 1JMTA 1OQ3A 3QYYA 3ZX3A 4KB7A 2W2NP 4CD3A 1FRMA 1UVIA 3V7JA 3GE1A 4EUVA 5J2AA 1ZM4A 2NO5A 1RWUA 4PQAA 1RCHA 3T1AA 3ZDDA 2BE2B 5F0UA 4ZTFA 2LSNA 3BGOP 4K4GA 2IIRA 4KT0C 2KG1A 3PRBA 5K14A 3VQCA 4NZ6A 1HNWK 1ZQMA 8ATCB 3K57A 2XHWA 2V4JA 4DV3K 3DXMB 3V9UA 1X9WA 2D1CA 2V68A 5LM7E 3O9QA 2YPYA 2OPRA 2ZWHA 4HI2A 1TU0B 1YITN 5A2QU 5I9EB 4NLZA 1ZQJA 1JJHA 4BDZA 1Z19A 1VDHA 4RWWA 4EHTA 1SUQB 5LOQA 3VOVA 1RSCA 1BQNA 1RJJA 4DR5K 4NMXA 1VQSA 2KXFA 4O0IA 2OCEA 1X4BA 3H1VX 1ZQVA 5HI7A 4R66A 3ELHA 4DX6A 3QU9A 3DYAA 7FDRA 3CC2N 1QAYA 2JX2A 3DGPA 3K9KA 3I0SA 4JI6K 3VCBA 4ED8A 4PG5A 3MM9B 2H5EA 5AKIA 4QIVA 1T0TV 4FJLA 1Y10A 1JLGA 1LXJA 8ICJA 1HYZA 1N63A 1V38A 3C16A 3OYGA 4BRAA 4LRBA 2QWLA 1M1HA 4LF5F 4B02A 1ATNA 4C8NA 2DJWA 3G25A 4ED1A 1F5CA 6AT1B 2XS7A 4KHMA 2J7WA 3PSTA 3HT3A 2P5VA 1S48A 2X74A 1YXQA 1WNSA 3HXMA 3QETA 2CZVC 9ICRA 5M2RA 1IUJA 1R3NA 1WC1A 4BUGA 1I94K 3VGUA 2HNYB 1YUWA 1S1TA 4JKGB 4U67L 3NASA 4C8ZA 3UNGC 3NF6A 1EJ7L 3ZNUA 4NI2B 3CDUA 1NSQA 4CJTA 3BSOA 2GTDA 5HLFB 4DBQA 4YN4A 4PKHA 5LXYA 5F9LA 3HHLA 1MWMA 4RTFD 3O6WA 3O9SA 4EO6A 2QB0A 5CZ2A 1HR0K 4WFBQ 2GHWA 4LF6K 2KW4A 2R7YA 4PA1A 2YXLA 1LFWA 5E79U 3DXSX 4DV7F 5GVQA 2DH9A 3SUNA 4O3SA 2Y1JA 1WOQA 2RRDA 3J7AP 3LPEA 2EC0A 4NB4A 3RJJA 1U02A 5ALOA 4AHCA 5J2JA 4AE5A 3E1YA 2KHDA 4I2QB 3ZLJA 4BJQA 2RHSB 4EFAC 2RILA 2EAMA 4QZ8A 1SJFA 3PUFA 5ADZA 3CJCA 4XH4A 2FF3B 4JP8A 4B3SF 1WAJA 1TP7A 4NL9C 2EFPA 4MKBA 3SNNA 3S01A 2K3KA 1NLKL 3UKRB 1DZ5A 3GFZA 3NVMA 4GMKA 2E5JA 4DG1B 3J7A1 1HUXA 3O5TB 2MB0B 4FO6A 2CH5A 3PM9A 1WEXA 2A42A 4E98A 1Q7LB 2FPHX 2ZH8A 2ZC4A 3OHBA 4TN2A 1JJ2M 2XMJA 4AFFA 1LW2A 2I5HA 3JAMO 2B7CB 4N8NA 1XNQJ 1L3VA 4UB5A 2KVCA 2AYBA 4KI6A 2FBYA 2ZTEA 3K9JA 4YR0A 4ZJOA 1Z25A 4CLSA 1LOUA 2CADA 4TU8A 4LR7A 1CSJA 3V9SA 3QIPB 5KFQA 3N0VA 4EBCA 1SCJB 2KE7A 4NYPA 3RW7A 1ICEB 1UFKA 3DOLB 1YI2S 5AXNA 3SFUA 2IBOA 3L09A 3GIJA 2AX1A 3E9OA 4LIWA 1U0HA 3MM9A 2PFFB 1ZBLA 1U45A 2NRHA 2NUHA 1GT8A 1TTHB 1Z4NA 4DLGA 4DS5A 4UAUA 3NGDA 3AQPA 4PPZA 2B9EA 4ZVEA 4ZVTB 3SPYA 2DH8A 2XYPB 1ZH5A 3PYDA 2W55A 2R7WA 4KHNA 4QJVA 2DGTA 2UU9J 1VQ6N 3NMUA 1RABB 3H3NO 2HZAA 4N56A 5C7PA 1WG5A 1D9DA 5ETNA 4OHWA 2ZJ8A 3IDHA 2O1PA 5B7WA 4NCGA 1N5SA 2H4YB 2QEXN 2JGAA 5L46A 2ZWOA 5HLFA 4HT7A 5KG4A 5AJ3F 1Y7PA 4X62F 5DQHA 1Y5LB 2DR6A 2ZUAA 1AA1B 2XBPA 3O1BA 1PILA 2I5JB 3THVA 5D78A 1BCMA 2QA1A 3QU2A 1LWFB 2WB1C 2DB1A 4ECWA 2CNLB 3OXLA 4CERA 2IA6A 1UL3A 4M5JA 5IV4A 2YKAA 4AYBD 4ZK7M 4D3GA 2QARB 4M9LA 3P6YC 4IOCL 3CD5A 4DV1K 2E5GA 1IBLK 1UA0A 3THPA 4F67A 4B1VA 4X5VA 1RXWA 1N36K 3O4QA 3OW2R 1U1RA 1PK1B 3U8XA 5K5MA 2Y9UA 3MPVA 1T95A 3VQ8A 2RDIA 4QPXA 3LP2A 1RBUA 3UKRA 1DBDA 4CFBA 1TL3A 1SVDA 4DG1A 3PO4A 4BWJA 4GKKJ 3H40A 3HD1A 8ICXA 5ALGA 1XUPO 4Y0FA 2QJ3A 4KRFA 1XQIA 1ZOLA 1Q7YO 3NKYA 2YKOA 7ICGA 3I82A 1TQLA 2BVZA 2JR5A 4LRDA 1HL6A 3DWLA 1RACB 5E3AA 1EWRA 3V9WA 1ZQPA 3P4IA 4I2IA 2I2YA 4QIWD 3NMAA 4KGVB 1NM1A 3QIPA 1Q5VA 2FJEB 2NSCA 4WFXA 2LKYA 1RTHA 4HH0A 3OVAA 3BEGB 4O3RA 2QWRA 3S3NA 1R0BG 3DOLA 1FE0A 4IFYA 3TX0A 9ICAA 1VAZA 4FWQA 3F73A 3AA4A 3CE8A 2BMBA 3H0PA 1W2IA 4H5VA 3ZT2A 5CYQB 3KK3B 3M8SA 1SV4A 2CFXA 4WTYA 5AKXA 4BRDA 4F3OA 4R0EA 3P38A 2M9KA 2X6NA 3D0IE 3A5MC 5DJBA 1S79A 3IRWP 3JTOA 5JICA 2FDRA 1OIAA 2VPZB 4JS4A 4J03A 1YHQN 4O5FA 1PBUA 1IO2A 4CLUA 4M8LA 4CGIA 1VQLN 5DDQC 3FFIB 2CPJA 2HKEA 4C9DA 1HQUA 2QL7B 3WXJA 2F44A 4OJ5A 1DTQB 5D0EA 4DF8A 4OV1A 3K5OA 1NK9A 2XI9A 1PGZA 4WXWA