1NK0A

Adenine-guanine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk0A01
1REVA 1SKRA 4IKFA 3OHBA 3HM9A 3H4DA 4AHTA 1S6QA 5KFXA 3KD5E 1BQMA 4CIEA 3PO4A 8ICVA 3L2QA 3V7KA 1C6VA 3JPOA 4M9JA 3SUQA 4O3SA 4GC7A 1ZQVA 5C25A 4DL2A 3OGUA 4F5PA 3DRPA 4CEBA 1JLEA 2P5OA 3LZIA 2FMQA 3LP0A 4QZBA 1NOMA 1ZQDA 4QZCA 4M2YA 4JV0A 3ZSQA 1C0MA 1O1WA 4IR9A 4ECUA 3C21A 4CJTA 5DG9A 1QS4A 4PY5A 4KLGA 4YP3A 5J0SA 1DOQA 2HHTA 3JPTA 1T03A 2P6UA 5J2AA 4JV2A 3AUOA 5CZ2A 2BCRA 4AHUA 4CHPA 5HMMA 3IAYA 1S1WA 1ZQTA 2RDIA 1DGSA 3C94A 5DG7A 4UB2A 1HMVA 3DLKA 5BPCA 4L8RB 3G6VA 2UVUA 1KRPA 3I8DA 2XHBA 8ICIA 1U48A 4IDKA 1RBVA 4QWAA 3BJYA 4KHQA 2R8KA 4QZIA 2FLLA 4NCAA 1MQ3A 4RT2A 5J0PA 4PGXA 2HVHA 5HRRA 1KCFA 1S10A 4ED7A 4E7KA 3HO1A 3C2MA 1HPZA 3B0YA 1VK0A 1NK9A 3L8BA 4TQRA 7ICGA 2AQ4A 4FW2A 1FKPA 2OZSA 3RTVA 1ZBIA 1VRTA 1AROP 9ICFA 5D49A 9ICAA 4Z4HA 5CYQA 3ITHA 1BGXT 1FKOA 3AA2A 4CHNA 4ED8A 2BANA 4CF0A 4OGCA 1ZQUA 5D4BA 4B9LA 1TL1A 1UT8A 2JEFA 2I9GA 3ZT0A 3L2VA 4PA1A 3U3GA 5DBAA 4KLTA 5J2BA 3IHQB 1UT5A 4K8ZA 3OJSA 1XSPA 2ZD1A 3M8QA 4CHYA 4ZTFA 4M3RA 2F8TA 2YNFA 1RTJA 1RTHA 1ZQCA 4CCHA 9ICVA 4FS2A 2ZQBA 2P66A 4I2PA 1Z00B 3EZ5A 3TAEA 4KHYA 4KHSA 4EP4A 3BDPA 4KLDA 2RDJA 1L3TA 3MR3A 3OYCA 1T3NA 4ED0A 3RH4A 1Q9YA 1KFSA 2Y1JA 5J2GA 4F3TA 4FJ7A 3ZDAA 2P5GA 7ICLA 2OPQA 4R8UA 4B9VA 4EEYA 2BQUA 3QIOA 4K4IA 3ZT2A 3DYAA 4CF1A 3O3FA 4QCLA 4KLOA 3SQ0A 3KK3A 3L3VA 4P2HA 1TK0A 3U3YA 3WNFA 1LAVA 3AVJA 1NK5A 4JS5A 2F1JA 3RR7A 2NRVA 4RW9A 4XUSA 4QZEA 5DMRA 7ICMA 4FM1A 4CEFA 2MAXA 4F5QA 3EYZA 3SJJA 3G0ZA 9ICWA 4M9GA 7ICKA 5L1JA 4I29A 1RBUA 4KHWA 3SUOA 4YN4A 4Q45A 3OYLA 1RBRA 5KG1A 5KT7A 7ICFA 1ASVA 1LW2A 3RAQA 2C22A 5TZVA 4MQ3A 2W9CA 3LP2A 2GWSA 4C8LA 2J6SA 3RMAA 4PWDA 4I2EA 4DL5A 3AVKA 4FLYA 3NHGA 4Z4IA 3M9OB 3KHRA 1CXUA 1RT3A 4KV8A 3Q8SB 2XCAA 3UXPA 1N6QA 4DTXA 3KD1E 2IHNA 2GUIA 3C6UA 2E6LA 1WLJA 4RUAA 3TAPA 1ZQXA 4DTRA 4TURA 2ITGA 3K75D 1U4BA 2J6UA 8ICBA 4YR0A 4Q8EA 4IQTA 5JS1A 3MEGA 3PX4A 3P83D 1ZQRA 4CJFA 3DOLA 4F4XA 1KLMA 2XGQA 4RQ4A 4KKOA 1XSLA 2KW4A 1BCOA 3OS2A 2C2RA 3UXNA 1RCHA 3OYAA 3DM2A 4CF9A 3MXIA 2BGWA 4M6WB 2PFOA 4QZ9A 4XA5A 1RT4A 3HPHA 4O3QA 1ZQEA 8ICTA 3RJJA 1LV5A 5SZTA 3IRXA 1JKHA 5FROA 4M42A 3V6HA 3QETA 2FMSA 4TSXA 4CEQA 1CUKA 4DTSA 3HL8A 5DQHA 2A1SA 1N56A 5SWMA 3HX0A 1RPLA 3ZSYA 2PI5A 2B21A 4FO6A 4FBTA 4DG1A 3LWLA 1TFRA 4GVMA 4I9QA 3ZCMA 4RW8A 2LYHA 4GW6A 4J9MA 5HROA 4XRHA 1FXXA 3A2FA 5KFNA 4YFKA 4DFJA 4CJVA 4DOAA 3UPQA 3NTUA 4CJ5A 4OLAA 3F9KA 5KG4A 2OPRA 4DFMA 5KT2A 3RMCA 4F3OA 4DOBA 4ECQA 3CQ8A 1QE1A 9ICEA 3OSNA 4E7LA 4E1MA 1HNIA 4W5QA 2YNIA 2KZ3A 3SUPA 3ZSWA 8ICUA 4R5PA 4O5BA 4UBCA 3AVFA 1BVSA 2KZMA 1JLBA 1RNHA 2VA8A 4F91B 3AO5A 4FW1A 3ZSRA 9ICRA 1YT3A 4DSKA 4R66A 4J9OA 3OYDA 4FCYA 2DFFA 1UOCA 4JUZA 5IIMA 3QEXA 2IA6A 3AO4A 1U49A 1S5JA 3L2WA 5DGBA 9ICIA 8ICXA 4LH4A 4NY8A 4J9QA 3TWHA 4O0JA 1IKWA 1JN3A 3OYJA 4PHAA 3ULDA 9ICLA 5EOZA 4B08A 5KT6A 1ZQKA 1D8LA 2HHQA 2VWJA 2JEIA 4X5VA 3KK1A 3IM1A 5KFQA 4FJGA 4Y1CA 1IH7A 1ZQWA 3LAMA 3HVTA 1J54A 3T3FA 3HWTA 4FJXA 4QZGA 4KLMA 1IKXA 2FPKA 3S9HA 4B9SA 1QSYA 2DY4A 4M45A 3PW0A 3NF9A 8ICOA 3OHAA 5IIOA 1S9EA 3BQTA 1ZQHA 5BOMA 2IC3A 1Q9XA 3C5FA 4YVZA 5KFSA 5KT4A 3THVA 5FRMA 1RDDA 2BCUA 3O3HA 3TARA 3U6FA 1B9DA 3VQEA 1VSDA 4IG0A 4DQRA 5HRSA 3QIPA 1TAQA 3MR5A 3TR8A 2ATLA 1VSFA 1A5WA 1J53A 1HUZA 4RQ6A 4OKJA 4I2HA 1NKBA 1RXWA 1Y88A 1BPEA 5L1KA 1JL2A 4IG3A 1G15A 1ZQQA 2Z1IA 4YQWA 2KTQA 4M3UA 1NOZA 4BXOB 1NJYA 1BIZA 5DK5A 4KLFA 2IBKA 4K4HA 3T5JA 3L2RA 4OJRA 3PX0A 2AU0A 1S1VA 3JPQA 1HRHA 2KFNA 4M04A 4FJJA 2A1JB 3AO2A 4UAZA 3RJHA 4BWMA 3QZ7A 1A77A 1CLQA 4PH5A 4CFAA 2NRXA 4RQ1A 3MABA 2OWOA 2BR0A 2F96A 4RZRA 1TKXA 4H4OA 1WCLA 4EZ9A 3B6PA 1C1BA 4O3NA 2ZUCA 3SV4A 3RAXA 2R7YA 2VG5A 5IIJA 4E1NA 4JRQA 4M41A 4F5RA 2GBZA 4OLBA 4DL6A 1BQNA 1BIUA 4LH5A 3RMBA 3I0SA 2QXFA 3QINA 4E0DA 2BCVA 4I2GA 9ICKA 4DQSA 3T5HA 7ICTA 4JV1A 1ZQGA 9ICQA 4HCCA 3F73A 4CK3A 3M9MB 1BPBA 4O5CA 1JLAA 4KTWA 3VQ7A 4CESA 1JIHA 2BDPA 2ZJ5A 4LY7A 1BI4A 3PO5A 4Y1DA 4CJWA 3T19A 4KRFA 2DTUA 7ICOA 4R63A 4CJ4A 1KFDA 3ZDEA 3LK9A 1ZQFA 1X9WA 4Q44A 2ISOA 1WAFA 4F8RA 1PZNA 3Q8MA 2PY5A 2HNDA 4F5NA 4FZYA 4J2AA 3CFPA 1A5VA 4JLHA 4KAZA 1T7PA 1J9AA 4E3SA 3JYTA 5C24A 4UBBA 3GIIA 3ZT4A 2WOMA 3D45A 1XI1A 2W9BB 3WNHA 2RF2A 4ECZA 3KLEA 1S6PA 4N5SA 5J0OA 2AGPA 2ZJAA 1CZ9A 4M3TA 5HRPA 3RMDA 4ED1A 1RT2A 3ZDBA 2DPJA 3SPZA 3RB6A 4J9SA 8ICMA 4EYHB 5J0YA 4O5EA 3QEPA 4ECXA 2FPLA 3QEBZ 1VSEA 4IFYA 4JWMA 3OYIA 4Z4FA 4IQUA 1RZTA 4E7HA 2V4QA 3H7IA 1F21A 2PFQA 3ISCA 1IKVA 3QESA 2HHVA 4KLLA 3MECA 4B9TA 1IM4A 3V9XA 3HP9A 1HQUA 1HJPA 1L5UA 4DFPA 4C8OA 3JPNA 5D46A 2EX3A 4B9NA 3UQ2A 5I3UA 4FLWA 1LB2B 3ZDCA 4IRKA 1IO2A 1Z25A 3V1RA 4DO9A 4OGEA 1KSPA 4I2QA 2ATQA 1JLQA 1DTTA 8ICGA 3DLHA 3OYFA 4J9PA 3MXJA 3AVAA 3TQ1A 3AU6A 4CHOA 3OYMA 4ELUA 3RB0A 1VSHA 4QWEA 2ZTEA 9ICXA 4ECSA 2YKMA 5CYMA 3PW4A 4KLHA 4E7JA 1UWBA 4DF4A 8ICCA 5J2PA 3S3OA 3HJFA 1S1UA 2P1JA 1SL2A 3WNEA 3GIJA 2VG7A 4AH9A 3TABA 1R0AA 1QLNA 4R65A 2D5RA 5KFFA 1HYZA 1ZBLA 1X2IA 4DEZA 4DMNA 3RBEA 2BQRA 2W42A 2XY8A 5KG5A 4DTJA 4ECWA 4P4OA 1RDAA 5KFLA 4RPZA 5HP1A 3TAGA 1UA0A 1KEJA 5DDYA 1ZJNA 4ED2A 4UQGA 4KFBA 2VA2A 3B6OA 1ZQMA 9ICUA 3H4BA 4PHEA 2IMWP 1QHTA 5KFAA 3GIMA 3EPIA 4ED3A 3HSTB 3UQ0A 4DS4A 1U45A 4KLQA 5KFVA 9ICTA 3ZT3A 3PNCA 3G6XA 3K4GA 4B3OA 2R8JA 4CGJA 3C6TA 4TUSA 8ICRA 3SPYA 3C5GA 3DLRA 4CFDA 4QZFA 4RW6A 3ZD8A 4QWDA 1ASWA 3MFHA 2KFZA 1JLCA 3UXOA 4CFBA 4J9KA 4DS5A 2EHGA 4GLXA 1VSLA 3OYNA 1VSKA 3VQQA 1T4GA 4HTUA 2X6SA 2ZUDA 4O9MA 4FS1A 2YHAA 3DRRA 2PI4A 2ASDA 3ISBA 2Q3SA 3KKSA 2HNYA 2PYJA 1NJZA 4BDPA 3HPGA 4NLNA 1NOYA 4BACA 4BE1A 1LWCA 1I39A 2G8IA 3SI6A 5KGXA 5L9XA 2ASJA 2NRZA 3NH2A 4H8KA 4RPXA 4CIFA 1CEZA 4KPYA 4OKKA 4RG8A 4J9RA 4R8UB 3GILA 9ICSA 1MU2A 2XO7A 1S1TA 4FLTA 1BCMA 4OPJA 7ICIA 1KVAA 2BPCA 4H4MA 1CZBA 4KMUA 1ZETA 2FC0A 3SI8A 4KHUA 3KLHA 1RTIA 1RDBA 3RJEA 4FLVA 1K6YA 5FRNA 3CM6A 4CGFA 2UVWA 3DMJA 2IAJA 3NE6A 5KTQA 4W5RA 3AA3A 4DQQA 2D0CA 4NM2A 4ZHRA 1ZQBA 5HHIA 2HVIA 3NH0A 1ZQAA 1U47A 4LSLA 3S3NA 3V1OA 4FLUA 2AJQA 5KI6A 2I5JA 4CECA 4HYKA 2ISPA 4KITB 4K8XA 3AA4A 4DU3A 3VQ6A 3DOKA 3KLIA 1GOAA 3NBPA 1B22A 1VRUA 4IRDA 3OYEA 4ECVA 4YFUA 1KTQA 2OPSA 4DTUA 4KLSA 3K59A 3T5KA 1NJXA 9ICHA 3AU2A 1FK9A 3LALA 4RW7A 3I0RA 1WCNA 1BPYA 2UVVA 5KRSA 4JWNA 4HUEA 1ZQSA 2BPGA 3AO3A 2NRWA 3VQ5A 5DQGA 3P5JA 5IIKA 3QEIA 1D8YA 1Q8IA 3HT3A 4XQ8A 3NCIA 2BQ3A 4DQIA 4O3OA 3CG7A 3RH5A 4AILC 4FJNA 4CJUA 4ZH4A 4RQ3A 3OS1A 2A1JA 5KGWA 2FPMA 4MFCA 4DF8A 3VQCA 1S97A 5KFZA 1BHLA 1SKSA 1LAWA 3HK2A 8ICPA 3KLFA 4FJ8A 5BOLA 4AHRA 1TKTA 4HHTA 4F5OA 3C2LA 1EP4A 2I1QA 3HYFA 3TFRA 1BPXA 3SCXA 4CHQA 4C8MA 4CF8A 1IKYA 2BHNA 3D0PA 3MXMA 4Z6EA 5J0WA 4I2FA 4KHNA 7ICNA 2D0BA 4J2DA 3QO9A 3OVNA 4QZ8A 4DTMA 3GV8B 3OYKA 3V9UA 3N97B 4B8AB 4HCBA 2Z1HA 3DLGA 3PX6A 1T8EA 3HVRA 3DI6A 4RQ5A 1JLGA 5KFIA 3QNNA 1XS9D 4KREA 2AGQA 4FJLA 1RDCA 3M9NB 4KN7A 3MAQA 3JPRA 2QK9A 3M8RA 5IILA 4OPKA 4F2RA 3K5LA 4RNNA 1XHXA 3FFIA 3IS9A 4DSFA 1TV6A 4CGDA 1L3UA 3KKRA 4DFKA 4IQVA 5J2IA 1JXLA 1ZQOA 5KRTA 2VANA 2W9AA 4Z6DA 5KG0A 4LVSA 1SZPA 4MF8A 4O4GA 3BQ1A 1GOCA 4QW9A 1C1AA 5DQIA 1QTMA 8ICJA 3AA5X 3ZSXA 2ZUBA 1RXVA 3NGZA 4YMOA 1SV5A 2QKKA 3FDSA 5KT3A 2IOCA 2X78A 4F4KA 2FLPA 1C0TA 3SYZA 3AVIA 3ALYA 4FK0A 5DKWA 3T1AA 5CHGA 2BKEA 3MDCA 4FLZA 4QOZB 1EX4A 4Z6FA 4Z4CA 4NXZA 2NUBA 3LPUA 2ZTDA 8ICNA 1TGOA 3V6JA 4CERA 3C1ZA 3GQCA 2IHMA 4UAWA 1ZQNA 3ORYA 1ZQLA 4GXKA 2B5JA 2G8KA 3RRHA 3RR8A 2RN2A 5HRNA 5KFOA 1ZYQA 5HHHA 3MGIA 2DFLA 3K2PA 3OSPA 1RYSA 4NLKA 4DTNA 1GOBA 3UIQA 4YR3A 3KK2A 1S0VA 1JXBA 4BDZA 4N76A 3VA0A 1MSWD 4I9LA 3VQ4A 3AO1A 3H8WA 4F93B 1NJWA 4I2JA 2W9CB 2ZE2A 4MF2A 5L1LA 3DLBA 4PUOA 1KVCA 2W9MA 4MFFA 1HYVA 1ZBFA 5IIIA 4HUGA 3C23A 2GV9A 3RRGA 3RJGA 3WNGA 3OYBA 4OVLA 2P51A 4F4WA 1XHZA 1KVBA 4O55A 1HYSA 4RU9A 5EWGA 4RUCA 2WTFA 2Z1GA 1XSNA 1S9FA 5CWRA 4FBUA 4O0IA 2DFEA 3EWAA 4N41A 8ICWA 4FYDA 4CFCA 1L3SA 1SUQA 2BCSA 3KLGA 5KFCA 2YV0X 4HVJA 3V9ZA 5HP4A 4XIUA 2XY7A 3PY8A 4DQPA 2B6AA 1S9GA 3C1YA 1TV9A 3TFSA 7ICEA 3KJVA 5J2HA 5L1IA 2BE2A 2XCPA 3CFOA 3L3UA 4E7IA 4UB1A 2X74A 3NH1A 3EY1A 1W9HA 1JL1A 9ICJA 4CJEA 1RT7A 4CJQA 4DU1A 3MGHA 5KFTA 5C42A 2DFHA 5CY4A 5C5JA 3V7LA 3JPPA 8ICFA 5KFWA 3RBDA 3EPGA 3LWMA 2X6NA 2YHBA 4LSNA 3PR4A 2DPIA 4KTQA 4KLUA 4QWCA 4F4ZA 3HP6A 8ICZA 4Z4EA 1EETA 5FDLA 3SZ2A 5EWEA 2HNZA 4IRCA 2RKIA 3GIKA 5KFDA 1YTAA 9ICOA 7ICUA 4CJRA 4KB1A 4N56A 2R8IA 5HBMA 1WSEA 4CGIA 4NYNA 3PMLA 2RPIA 3ETLA 3AVBA 4RQ2A 4RQ0A 1Z3EB 1X1PA 3AVNA 3QEAZ 3V4IA 1CXQA 1TK5A 3V6DA 4F92B 3OS0A 3V9WA 2O4GA 2WONA 3MDAA 2IS3A 1D9FA 4CJKA 8ICSA 7ICQA 5J2CA 1S0OA 3DRSA 5J2MA 3CM5A 5CZ1A 9ICBA 4M47A 4NLGA 1XU4A 4DL4A 3Q8KA 1Z00A 4AHSA 4I2IA 2QKBA 4GMJB 1HQEA 1MC8A 1X9MA 1D5AA 4GXIA 4M0AA 4CIGA 2YNGA 2FBXA 3VQAA 3VN5A 2ZJ8A 2PFNA 1WNSA 4CE9A 4KLIA 2G8FA 1ZBUA 2BGGA 3QEVA 3CYMA 4Q43A 5J1EA 3BQ2A 5J0UA 2FLNA 2FBYA 4O3RA 5CB1A 4FVMA 1W0HA 2XRIA 5DB6A 1S77D 4ELVA 5F9LA 3V7JA 5DLGA 2PFPA 1C7YA 3KTQA 4YNQA 8ICEA 4M3ZA 1ZQIA 3K5OA 1COOA 4ICLA 3LP3A 1LWFA 5D3GA 3LZJA 3P1GA 1SL0A 1ASUA 3SV3A 1U04A 2OA8A 3PW5A 4PPXA 3LAKA 4KI4A 3V6KA 4CJPA 2JGUA 3H8SA 4EZ6A 2OYQA 3EW9A 3MEDA 3KHHA 1RT1A 1VSIA 5KFEA 2YKNA 4KTZA 5EWFA 5KFUA 2HHXA 2FBVA 4M3WA 5DB9A 3G10A 2J6TA 3HXMA 3KIOA 1XC9A 3RH6A 9ICGA 2HW3A 5KG6A 4YCXA 4TUQA 2JEGA 4RQ7A 3VQPA 3ZDDA 5HLFA 1NK6A 7ICRA 3SQ4A 5KT5A 1BI4B 3OYGA 4NCBA 4M9HA 4QZHA 4FM0A 5KFGA 1QSSA 5F9NA 4PQUA 3NGDA 2XGPA 2ZTCA 4FM2A 3MBYA 4DSLA 3TAFA 3SQ2A 5KFRA 5KFMA 4IBNA 3VQ8A 2MUTA 4I2BA 4NCGA 5J2NA 4FK2A 1A76A 4DSIA 4P4PA 3AVGA 4RQ8A 3RWUA 5KG7A 2FMPA 4K4GA 2V9WA 1WSIA 4Z4GA 4ECYA 1A5XA 2V4RA 2PZSA 1X9SA 4BDYA 4CEDA 3LP1A 2JZBA 1XO1A 4Z0UA 3PUFA 4FJHA 4QAGA 2W9BA 3QE9Y 1ZQPA 4FJIA 3NGIA 1SKWA 1V9PA 4W5NA 7ICJA 1L3VA 1K1QA 3NF7A 3NFAA 4J2BA 3SNNA 4I28A 1LW0A 2KQ2A 2Y1IA 1RTDA 1RBSA 3MR6A 1RT5A 4M9LA 1JLFA 2FBTA 4DTOA 3LPTA 3RJIA 3NF6A 1H38A 1S76D 1NKCA 5HNKA 3IG1A 4BE2A 4RW4A 4QZAA 5J0TA 2MUTB 4EBDA 5KFJA 2JEJA 3GV7B 4J2EA 4RT3A 1TKDA 3BGRA 4ED6A 1S0MA 5CA7A 4CJLA 2P6RA 1ZQYA 1RYRA 4QWBA 1JMSA 4EYIB 2JLEA 1EXNA 4FJKA 4ECTA 5IINA 5J2DA 4PHDA 3PR5B 1VSJA 2H5XA 1TKZA 2PYLA 1S0NA 4F4YA 2HB5A 2VA3A 4EP5A 1TL3A 4RNOA 4Z6CA 3RB4A 3V81A 2M9NA 4DL7A 3H40A 3KHLA 2KZZA 3ZSVA 1IG9A 3AV9A 4ECRA 4YMNA 4IFVA 3V1QA 3SQ1A 4IR1A 5T7BA 5J2KA 4CEAA 5JUMA 1BPDA 4LZGA 4CJ3A 2A1RA 5KFHA 3NDKA 3C2KA 3T5LA 4E19A 4O3PA 4ID5A 2AQ0A 3Q8QB 4BXOA 3ZSOA 2F1HA 8ICQA 3GFKB 3K5MA 3MR2A 3M8PA 3ZSZA 4GXJA 2C28A 8ICHA 4EBEA 1BPZA 3C95A 2Q0ZX 3JSMA 3K58A 8ICKA 8ICAA 4RPYA 4WE1A 2OZMA 3O3GA 4G3IA 3ASMA 4CK2A 5J0RA 2G8VA 1WSJA 4BE0A 3PMNA 3E2EA 1UA1A 3TAQA 1HNVA 4DL3A 3NGYA 4MEXA 3N4MB 1TVAA 1B43A 2YNHA 4YR2A 4MFAA 3HW8A 4UB5A 4OKEA 3OY9A 4C8KA 2G8UA 9ICMA 2HHSA 7ICVA 4YMMA 4UAYA 3M8SA 4DSJA 2PXIA 4DOCA 2D0AA 1MQ2A 1BISA 2F1IA 5HMLA 4IQWA 1DTQA 4DTPA 4KO0A 1JXEA 4YG2A 4TQSA 1NK8A 2HMIA 3E01A 4Q0BA 4YXJA 3S3MA 4CGGA 2XY5A 3Q8RB 3RJKA 2F8SA 5CR0A 3MEEA 8ICYA 4KB0A 4FXDA 5DDMA 1C1CA 4BWJA 4KN4A 1WSHA 1TK8A 2ETJA 4M3XA 4AHVA 3DLEA 1NKEA 1S1XA 3HPOA 1EXQA 5J2FA 5EU7A 2ALZA 2NRTA 1QQCA 3AVMA 4CEEA 4G1QA 1C0UA 4JK1A 1Z26A 4DU4A 1RBTA 3VQDA 4QZDA 4FJMA 2UVRA 7ICHA 3QLHA 1D9DA 1UAXA 4YXMA 7ICPA 4PHPA 3TANA 4ZTJA 1K1SA 1ZBHA 4JS4A 3NAEA 4JRPA 1Y97A 4B8CA 3AVCA 4I2AA 4O5KA 3H8JA 2HHUA 3QERA 4FJ5A 2HHWA 5K14A 5J2EA 3SUNA 3V72A 5KFBA 3PVXA 1ZQJA 4PGYA 2W8KA 3CFRA 1B92A 4CEOA 4TUPA 9ICNA 4FJ9A 3Q8PB 4MEYA 3ZD9A 5DGAA 4LD0A 1LWEA 3GV5B 2KN7A 4R64A 4ID1A 4Q8FA 2W8LA 4NLZA 2Z1JA 5DBCA 4CK1A 3V9SA 1HJRA 8ICLA 1QSLA 1ZJMA 5J2QA 3LDAA 4DWIA 1JX4A 4J9NA 3PW2A 4BGDA 5J0QA 3VA3A 1WSGA 1WN7A 3VQ9A 3QEWA 2IDOA 3JPSA 4PGQA 2C2DA 1HUOA 3O4QA 3K5NA 2BPFA 1N48A 3LANA 2OPPA 3QZ8A 1WAJA 2VG6A 3L2UA 1NK7A 4C8NA 9ICCA 4M6WA 3RJFA 1XWLA 5J2JA 5DB7A 5KFPA 3OJUA 4I27A 4KLEA 2O4IA 2G8HA 4W5TA 2G8WA 4LZDA 4CHZA 3PV8A 2B4JA 3B0XA 3KHGA 1YVUA 4CEZA 5KG3A 4KLJA 7ICSA 2R8HA 4AHCA 3Q8LA 2AGOA 3K57A 1N5YA 4NYFA 4QW8A 5KG2A 4B9UA 2LSNA 1B9FA 5DG8A 5KFKA 4I2DA 1IXRA 4GC6A 1WSFA 4FZZA 4P4MA 4M9NA 4ELTA 4CF2A 3QNOA 1TAUA 3H08A 3BQ0A 4FLXA 3VQBA 4DLEA 2E4LA 1TVRA 3PW7A 3GDXA 1J5OA 2XY6A 4UB4A 5DLFA 1ITGA 1KLNA 4YD1A 1BL3A 1EKEA 4DSEA 5JS2A 1RT6A 4MFBA 2JZBB 5CP2A 1RILA 3ZT1A 4E89A 1SL1A 3MFIA 4CJSA 3AVLA 4Q5VA 5KFYA 1U9LA 1NK0A 4M3YA 4UB3A 3ISDA 4CGHA 4O44A 4EBCA 5E41A 4FZXC 4YD2A 9ICPA 3FYHA 5CJ7A 3RB3A 1DLOA 3OYHA 3O4NA 1I3AA 3G6YA 2IGIA 2XC9A 4B9MA 4W5OA 5I42A 2E6MA 1KFTA 1T05A 4RNMA 4DLGA 2R8GA 1KDHA 4I2CA 5J0XA 5DBBA 1YTUA 4N47A 1VSMA 2BCQA 4NM1A 3NF8A 2C2EA 2ASLA 5J29A 4J9LA 4F50A 1NK4A 3ISNC 4HUFA 2VWKA 3LDSA 1ZQZA 4F2SA 5DB8A 4KI6A 4FK4A 4I7FA 3TI0A 3AVHA 3TAMA
chains in the Genus database with same CATH superfamily
1REVA 3OHBA 1TL7A 1JLFB 3HM9A 2IM3A 3H4DA 1RT5B 2GH1A 3GP9A 1RAGB 1S6QA 2IVNA 5KFXA 2AEFA 1RTDB 3D6RA 1PIEA 4DUYF 4CIEA 4DPXA 1RKIA 3DDNA 2KSOB 3EZOA 4ZPDA 3D1HA 4PYAA 1ZQVA 1GQEA 3OGUA 1CI4A 4LF6J 4J37A 3CIZA 3WXMB 4DR4K 3DRPA 4Y00A 1JLEA 3OUYA 4RLEA 5LMUK 3GE9A 2P5OA 1R59O 1S7HA 3UNGC 1VQPN 4O23A 1IBKJ 3QBCA 3C21A 4FVCA 1QS4A 4KLGA 4TU9A 4YP3A 1FKOB 5HMZA 1DOQA 2HHTA 2D6FC 3JPTA 5AM5A 1HHQA 5J2AA 2DY9A 3CHWA 4CHPA 4O4GB 4NWIA 1S1WA 1ZQTA 5H9EJ 5DG7A 1Q16B 4AQYF 2WB1C 4DJBA 1WSRA 3H3OB 3VOVA 4CDGA 8ICIA 4IDKA 2J7WA 4KHQA 3CC2S 1VLOA 4NCAA 5J8YA 2O8CB 1MQ3A 2H48B 1IM6A 4RT2A 4PGXA 2M8HA 4DR3K 4E7KA 2D1CA 3ALRA 1HPZA 2Q1NA 1N33F 2ITMA 2MTLA 2FYXA 5A0LA 2W41A 3K0SA 1FKPA 4V19J 5EUHA 1YTYA 4DX5A 3U1LA 3NAHA 5D49A 2FHJA 2UUAJ 4FZNA 5CYQA 2H3ZA 2QN6B 4NZ6A 3SMSA 4CHNA 2I8EA 2K8GA 3IR7B 3CDEA 1ZQUA 2E8NA 3VQSA 1B7YB 2JEFA 1PC5A 2CGJA 3K9JA 2G06A 2PA3A 3U3GA 2XICA 3ZO7A 2EBGA 1G6BA 4IKAA 5FDLB 3OUYB 1UT5A 1TMMA 4C4WA 3M8QA 4ZTFA 4M3RA 4ZHRB 3CDAA 2GGPB 4LF4K 4C1NK 3DMJB 4FYYB 2GX8A 4K2JA 1TUWA 2P66A 5C2DA 2DPNA 1HQEB 4RNFA 4FWLA 3TAEA 3Q7BA 4KHSA 3SSQA 4LF6F 3MR3A 3HSCA 2Y1JA 2KLAA 4F3TA 4FJ7A 3ZDAA 4N7TA 3OTOF 4RBTA 4CRJA 3V6DB 3QIOA 4HT7A 1E6YA 2BJ7A 3DYAA 1N33K 1NEEA 1VBZA 4NLQA 8ATCB 5DZ7A 3SQ0A 1JNZB 4NLTA 4P2HA 3FZKA 4M5NA 2NO4A 1U1PA 2ATCB 2HRTA 2YWWA 3NMAA 4JS5A 2F1JA 4XUSA 1U09A 3THXB 4FKXA 2MQLA 1BNPA 4KX3A 4Z7CA 4ZVOB 2MAXA 3EYZA 3D2NA 1FF2A 1BUXA 1NAQA 1RHJB 2XLJA 4PKDB 2D41A 4KIAA 2B4UA 2V94A 1RBRA 1J27A 3CJ9A 4MQ3A 5GAHP 1Q81O 3D3CJ 2J6SA 1RWXB 4RCHA 3M2UA 2F44A 4WCEQ 2ZVSA 3T1YJ 1HHSA 2V69A 1YDLA 5C42B 4CZLA 4Z4IA 3M9OB 1HI0P 4JKCA 2DHGA 2CIMA 2KN4A 4EAHD 1N6QA 2QM1A 4DTXA 3NP5A 2GUIA 1SH2A 1DXSA 3MCNA 3A8YA 2G08A 5ETSA 1WLJA 4JN4A 2P9IB 1FWPA 3KJVB 1Q7YT 1U4BA 1WI8A 4OPHA 2NXEA 2OEJA 4Q8EA 4IQTA 4ANDA 3GG1A 1FRMA 3P83D 1KLMA 1M90T 2XGQA 1SKUB 4DV6K 2G0IA 3T1YK 1SCJB 3N0VA 3QAEA 2N7CA 5GIPA 3ENOA 2VQFJ 1CPZA 4CF9A 3C16B 3X1LB 4JYAK 1IBLF 4M6WB 3KUGA 2Y0SC 1RWKB 2HIYA 5EX3A 3BBCA 4NL9A 3HPHA 4O3QA 2D3OR 2VG6B 4HLBA 3ZETA 4M63C 4U8YA 2WBNA 4O8UA 5EE9A 4LRDA 1LV5A 3QETA 1K0TA 4CEQA 2VPYB 4DTSA 3AQPA 3ID6A 5SWMA 4EIAA 3D6JA 2WSEC 3ZSYA 4IXCA 4FO6A 4DG1A 4GVMA 3NASA 1JRPA 4L3KA 4O4RA 4GW6A 5HROA 2P6SA 2MLXA 4M7XA 4XRHA 2EFVA 4UUXA 4B3OB 3R5CA 3F9KA 4DFMA 3M7DA 5A8KB 1HNIA 3PJXA 2GA7A 4NLDA 4ZCIA 3SUPA 4X65F 2KL8A 3ILJA 3KHYA 1RNHA 2ROGA 1XNRK 1UZHA 2GFFA 2E1CA 2MKCA 3MR7A 1U0HB 3GYNA 2H1YA 4QIFA 4FCYA 4I56A 1UOCA 4QJVA 1OS5A 4X64F 4AL5A 1YWXA 3G4SN 4TYAA 9ICIA 1R7IA 4LH4A 4FWMA 4O0JA 5JMVA 9ICLA 5IM0B 2YH0A 1WUUA 4MKBA 3KOAA 1JJ2R 2VWJA 3RZAA 4X5VA 3IM1A 5HVFA 3OTBA 4FJGA 3DV9A 3BR8A 4UASA 1VQYA 2WVCA 1ZQWA 3CC2N 2W2NP 1HNWJ 1J54A 2DKZA 3HWTA 4P72A 2JRSA 5A2QY 5A8WA 2G5IB 3S9HA 4BRMA 1UVJA 1F5SA 1SJFA 2DY4A 4ZP6A 3PW0A 3QXGA 4AYBD 1S9EA 2N7YA 2AF6A 2IC3A 3PLAA 1SV0C 3MECB 3TA1A 4OI6A 4TVAB 4US9A 1WEYA 1VC0A 1TAQA 3MR5A 2Y8WA 4WE1B 1VSFA 5M1PA 1KQSM 3A5NC 1A5WA 1U6BA 1LK7A 2Z30B 4KHPJ 2CJXB 1BPEA 3D1QA 5I3PA 3FZHA 4IG3A 1JCEA 1RKJA 1TP7A 4I68A 1P1TA 4YQWA 3AM9A 3FBCA 1IBMJ 1NJYA 5CXTA 1MN8A 4Y2AA 5HSPA 4K4HA 3IMQJ 3FZ2A 1YJWS 3UR0A 3KZXA 2AU0A 1JCGA 3MDQA 1FDAA 4IWVA 2CQ2A 5L9NA 3JYTB 5E7OB 4JYAF 3S6EA 2CXEA 1CLQA 1V5IB 1LKZA 4UY8T 4DPWA 2DCUB 3MABA 4BHQA 4H4OA 4Y2MA 5E3QA 3SV4A 2XMJA 4BGBA 2R7YA 4PG5A 2R42A 3WK5A 1X66A 4C9DA 4NCGB 1WHWA 2H3FA 2JH1A 4DPOA 3L7PA 2GJ2A 4O8KA 2CPRA 5BR8J 4UB8U 1BIUA 1VJWA 3I0SA 2QXFA 5EY4A 3QINA 2BCVA 2H3EB 4QBUA 4NA1A 9ICKA 2QLTA 3RG6A 4JV1A 1ZQGA 1YBUA 2ZZTA 4MO4A 3RGIA 3J81j 1BPBA 4A8XA 1S22A 4CESA 1VRUB 3EEQA 2ZJ5A 1BI4A 4AT1B 3M8WA 2XYPB 4CJ4A 1KFDA 3LK9A 1ZQFA 2IRYA 2MYFA 2OCEA 1K8KB 3AQEA 1DHMA 3BSOA 1PZNA 2PY5A 1RQ0A 4ZVGA 3WC0A 1OQ3A 1WHYA 4LSZB 3CFPA 3V2UC 5BPNA 5A6WA 1F6TA 1A5VA 1KXPA 1T7PA 3TX8A 4E3SA 3I56S 2YX7A 4K4YA 2WOMA 2Z57B 3D45A 2NXJA 3VALA 2HQCA 1VGYA 2W9BB 2V7YA 4K41A 2JLFA 1UJ5A 4P0PA 2P9LA 3JAMO 5HRPA 1Y3KA 1RT2A 2Q36A 2MSNA 3ZDBA 1VMBA 4NYZA 4EYHB 2CPHA 3QEPA 5ALYA 1YJNN 2EWHA 2L9DA 1PYTA 4JWMA 2E88A 3CW2C 4IQUA 2YWHA 5KPZA 2V4QA 1FKAF 3HHLD 5D8HB 2EAMA 5B0CA 4NLWA 3ISCA 1IKVA 2I6XA 1B0VA 2X3DA 4NL5A 4B9TA 5CZVA 4JK9A 2O8BB 2DR5A 1HJPA 1L5UA 4DFPA 4C8OA 3RBZA 4B9NA 5I3UA 3CJSA 4YOEA 2HBZB 4IRKA 3FNNA 1UL3A 3PRBA 1UVLA 1JLQA 1RP5A 3CJ1A 4R79A 3UKUA 8ICGA 4E98A 3FJ2A 4J9PA 4J7CA 3MXJA 3WIVA 5AXMA 4CHOA 4ELUA 1VSHA 1F9EB 3HVTB 3S1TA 4ECSA 5AM1A 2YKMA 3PIPL 3PW4A 4KLHA 3P5BP 4DF4A 1DTQB 4UY8O 2E7WA 3TR5A 2YN4A 3MC1A 3CB4A 4F7VA 4NMXA 4WIQA 4LFAK 3WNEA 3GIJA 3TABA 1ZM9A 3C15B 3UMBA 2D5RA 2HZAA 5FLXO 4KRWA 4URQU 1HQUB 4DR7F 2BQRA 2XY8A 2P2CB 5AQKA 3LVWA 2XLIA 5E0OA 2BKNA 2J0WA 2G4BA 4HTLA 1RDAA 1OIAA 4RPZA 1YGYA 3GMGA 2QFJA 7FD1A 2KE7A 5DDYA 2DR7A 1B64A 2RQ5A 4UQGA 2CNLB 2VA2A 3LW5C 1TMJA 5DDPC 1ZQMA 4DL0C 3H4BA 3SFUA 3CQYA 4GKJK 2MY7A 3EPIA 2ZEJA 1FO4A 3HSTB 4DS4A 3PFOA 3NVMA 2OLWA 3CF5L 2IPOB 2VZ9A 1VJ5A 2CQ1A 3QU7A 2R7VA 3DLRA 2SXLA 3U7JA 4QZFA 3EE8A 1X8DA 3MFHA 2CN1A 1K9MO 3NWRA 2B6AB 4GKJJ 4DS5A 4GLXA 4M5LA 3GZ7A 1T4GA 3EKUA 2X6SA 2ZUDA 4O9MA 5IT9Y 4QU6A 2YHAA 1AXQA 2ASDA 5HBMB 4C7QA 1TL3B 1P8ZA 2XG8A 1XR5A 3ISBA 1YRXA 2BYCA 2Q3SA 2HNYA 1TKZB 1IVZA 3HPGA 2E1RA 2UXBJ 4NLNA 2RMLA 2DB1A 1ZXOA 2K8AA 5ALNA 1T9VA 1VQ8N 4YMEA 1VQ5N 4JB8B 4QZVB 2GZOA 4F02A 2ASJA 2NRZA 4LSNB 3NH2A 5AQZA 4BRKA 2VV5A 4CIFA 4EELA 4Y2TA 3LGNA 4B02A 4P75A 4OKKA 2V67A 3ZXWA 3GILA 1MU2A 2CVEA 5D0RA 2XO7A 1Q78A 2OD6A 4RW4B 4X66F 5A2QO 4CH7A 2MDAA 1MN7A 2CPIA 2HFSA 4X66J 3ZX2A 1KVAA 4H4MA 2E5JA 3EVWA 4K59A 3BKTA 2J9CA 4JI4F 4KMUA 4I6WA 2FC0A 3SI8A 3DKDA 2G09A 1JMTA 3BS7A 3BM7A 3MWTA 5FRNA 3CM6A 4CGFA 2HBJA 4Y6IA 2UVWA 4WTOB 4W5RA 1J5EJ 1BDGA 2D0CA 4OYWA 2QTWA 2G07A 3BO2A 1PAUB 2HVIA 2KM8C 3CSKA 4F0HA 4OV1A 1ZQAA 4LSLA 4JK8A 1N34F 4H0TB 4FLUA 2QMUB 5KI6A 2I5JA 4CECA 4NLBA 1GK8A 2ISPA 3NS5A 3WUHA 3AGKA 2WB1D 3AA4A 3IV6A 4DZDA 5I4MA 1OVYA 3VQ6A 4KY3A 4YOVA 5SUHA 5B0FA 3AFGA 3ZZUA 4XDCA 2HOFA 3T5KA 4F25A 1P9YA 4AQYJ 2OKQA 5FPMA 4DV7K 2A19A 2VKZG 2PT0A 2BJ8A 3G6ES 1ZQSA 2V8HA 1I51B 3SQOP 5DQGA 2E1AA 3EO3A 2DR8A 1CLFA 3MMJA 3U1NA 3IRUA 4ZK7M 1Y00A 3TEGA 1BQXA 4IOAL 4ZVTB 4CLTA 4LF1A 3NGSA 2GWJA 4O3OA 3D9BA 3FZBA 4B3RF 1XNSA 3C19A 2GIRA 4I2PB 2FPMA 3M1VA 2IYIA 4WYWA 3N4PA 3L09A 2YTCA 1UFLA 2LU1A 4YORA 1L8LA 1SKSA 5IQ6A 2R2UA 1YBTA 8ICPA 1B7FA 5BOLA 4AHRA 1N32F 3BUZB 3QT8A 1B4SA 3IP0A 2Z0GA 4NYPA 4PCQA 4HHTA 1IUJA 1CQMA 4ILJA 2W03A 4F5OA 2DGQA 4PKHA 2MJNA 1FJCA 4B1WB 4CHQA 1VQON 3DLLQ 3P45B 4CF8A 1IKYA 2VQEF 2BHNA 2G9OA 2MGZB 4OCZA 3R9PA 1F2GA 7AT1B 4J2DA 3QO9A 3QNMA 4HDGA 3OYKA 4HCBA 2KXFA 2PAVA 3PX6A 2L3MA 3QNNA 2W01A 5LL6d 4FJLA 1NNLA 3T9ZA 4LFBK 1XMQJ 4OZ2A 4USMA 3M9NB 4HT5A 1SZHA 1AB8A 5GAGU 1U1NA 3EGVA 3JPRA 3IFEA 4F2RA 1B99A 3BKUA 3AY0A 2BH1A 4QYZJ 3IS9A 4DSFA 1TV6A 2B43A 4EWTA 4I6MB 1L3UA 1NGCA 1ZQOA 1IN0A 4JI6K 3J7AN 5KRTA 2W9AA 3OLAA 4Z6DA 5KG0A 3THWA 5IT0A 4ATNA 1NPKA 1C1AA 1RXVA 4TLQA 3ULEB 3HD1A 2RHSB 2O5DA 3LA0A 3FBFA 2FLPA 5KPTA 3BSAA 1C0TA 3SDEB 4CLUA 4FK0A 1HNXJ 4FKYA 3DEEA 3MDCA 1MROB 3IAM9 3FZFA 4CBWA 4ILRA 1ATSA 2WUSA 2RKIB 3RW6A 2MQQA 3C16A 3LPUA 2ZBIA 1HKCA 1V4TA 4H03B 2IHMA 4UAWA 5IC6B 4UAVA 2KJVA 1ZQNA 3HSJA 1ZQLA 4LQ9A 3H0MB 1Q4RA 4E1JA 2JV3A 4NLPA 2RN2A 5KFOA 2UU9F 5HHHA 1QQMA 1V3RA 1X42A 1YF5L 1RYSA 4NLKA 4DTNA 1GOBA 3KK2A 3CCWA 1WJ9A 2BBEA 3IGNA 3HI9A 3M2UB 3Q83A 1NJWA 2OTLS 4I2JA 4JI5F 2ZE2A 1V38A 5L1LA 4PUOA 4WF9Q 5AZIA 4B3TF 1AT1B 1T0TV 3GJSB 2OSRA 4GV6A 4DV5K 4ZLJA 3NGRA 4L6V3 2R7WA 1H7WA 1OO0B 3C23A 4EX7A 4IEIA 3RJGA 2ZH1A 1NZPA 3NVVA 2YPZA 3BN4A 2YHYA 1V5VA 1H73A 2F9TA 2MU2A 5AK4A 4RU9A 5EWGA 2WTFA 4ZKAA 2D9PA 4OIXA 2UV8A 3UVJB 4K5SA 2W2PP 3HHEA 5CCLA 2OTLN 4FYDA 4CGZA 1L3SA 3ZZZA 3KLGA 4KKOB 2KD1A 2PBDA 4NEZA 1KLMB 5HP4A 4YB7A 2XY7A 3PY8A 2B6AA 4WFAQ 4D3GA 2Y9UA 4PG6A 5E84A 2VUGA 3A0IX 2XCPA 4GVEA 4H4KC 4GIBA 3MCPA 4ZIVA 5CE3A 4DR7K 2JR5A 4H4MB 3UQSA 5AJ3K 9ICJA 2BE2B 4MMOA 3QGPA 5KFTA 2VFVA 2K3KA 3AGRA 1FNMA 2XI3A 4PWDB 3CNQP 5KFWA 3KDNA 1NI3A 4CF3A 4OYPA 3T1HJ 3SIPB 2HVEA 4DV2K 4LSNA 1N5SA 2FVQA 3HP6A 3T69A 4Z4EA 1KVIA 5FDLA 3W9JA 3Q2TC 4P73A 3SZ2A 2IOFK 3QT5A 2X7IA 1LWCB 4OMFG 2ZOMA 2KVQE 3K89A 5KFDA 3OR1B 4CJRA 1Q79A 2GHPA 3AL0B 4Y2RA 5HBMA 4OX6A 1Y3JA 2DK2A 2QMXA 3GJRB 4NYNA 2P9UA 2RPIA 3ETLA 3AVBA 1SH3A 4B6JA 1G7CB 3R6GB 3QEAZ 2FJAB 2EAPA 2LDYA 3CI5A 3GG4A 1TK5A 3V6DA 1BMQB 3VEWA 2R3VA 2GIFA 3MDAA 2UUWA 4EHTA 5H1SQ 1D9FA 1S7IA 3KG0A 3DRSA 5J2CA 1S0OA 1ZPVA 5J2MA 4ZVHA 5CZ1A 3OD2A 2LEAA 1U1MA 1FVSA 2D3UA 4I69A 1Q86O 2YHWA 3HOSA 2WSFC 4CIGA 3DGPA 4DCOB 3NS7B 4MK8A 5I9EB 2NPFA 1HMVB 1WC6A 2F77X 4KLIA 1JLGB 3DFEA 1NMNA 3QEVA 2B5JB 5J1EA 1HR0F 2FBYA 3DNCA 5CB1A 3ZEUB 4A2BA 4DR2J 3RU0A 1ZM3A 1FVQA 3H8YA 1S5LU 5F9LA 4FZLA 3PNIA 3U26A 2PFPA 2ZHOA 4YNQA 3KTQA 4QS8A 3GE1A 4M3ZA 1IV0A 3Q86A 3K5OA 4OHZA 3M32B 1X9JA 4P52A 3LP3A 2YX6A 4DUZJ 1K9MT 2E5GA 1Q3VA 2XIDA 4Y2CA 2ZITA 4C48A 3L6QA 1U04A 2QFIA 2CQBA 2XMTA 3PW5A 2JLGA 3ETMA 1VQ6S 4RO0A 2BE9B 5GAEU 3V6KA 2Q79A 2OAUA 4DB3A 1SBRA 3QFHA 1WSVA 3W65A 5BN8A 4M3WA 2IMOA 1SS6A 3I28A 4BC9A 1WF0A 3HXMA 3EUB2 3RH6A 4DUYJ 2BV3A 5KG6A 2QWRA 4TUQA 3ZDDA 2J7KA 2C2MB 4NLOA 5HLFA 1M5PC 1NK6A 1YZ7A 3QJPA 7ICRA 3IO1A 1BI4B 2D8CA 2F4VK 4B3TK 1VJQA 2Z2LA 1VFJA 2QSFA 4PQUA 3CUNA 3NGDA 1NGGA 2BEFA 4NA3A 1ELOA 3F2KA 4FWQA 1N36K 2KEYA 3MI7X 1S4EA 4F67A 5HJYA 4DSLA 2YTUA 4C1NI 5BRHA 1J2MA 5KFRA 5KFMA 2MUTA 2IM2A 3KLIB 4NCGA 2IJRA 2DNNA 2B9EA 5AM3A 4LF4J 3RWUA 2FMPA 3G4SS 4Z4GA 1BE4A 4BRHA 1ZD3A 2JZBA 2OHFA 3KLFB 3PUFA 4FJHA 2VGMA 1QQ7A 2W9BA 3M8ZA 4LFCK 4FJIA 3U1MA 1FHTA 2UXDJ 2QA4N 3HHLA 4DXLA 1CJUB 4LBPA 4KPCA 3SK3A 1OMSA 1S6QB 1JLFA 2MJUA 5CYJA 1S49A 4JI7F 3LPTA 3NF6A 2BDUA 1H38A 1HA1A 1O0PA 1O13A 2I2YA 2E2PA 4IG3B 3I96A 1Y64A 3IG1A 3CCRS 1T6CA 4QZAA 1DZ5A 5J0TA 1XMQK 4P6QA 5GAHI 2VQFK 2JEJA 3GV7B 4RT3A 4U9RA 1FE4A 2LP4A 2CPDA 1RHKB 2W4DA 2UXBK 4QWBA 2DISA 2JLEA 4MKVA 4IG0B 1EXNA 4M8LA 3H2LA 4PHDA 2VOPA 1UW4A 4KJIA 5C12A 4F4YA 3NOCA 3CJQA 2UUBF 2GMLA 2B9WA 3M4XA 1URNA 3GSDA 1MNEA 3CPEA 1Z1BA 4P2SA 3ZSVA 2K7KA 1VQMN 3K1RB 1E6VA 1RK8A 2LPEA 2WVFA 2WF6A 1I94J 5B0AA 5B0GA 4LFCF 1BPDA 3LDPA 1D3WA 2A2CA 4LIWA 5KFHA 3O1BA 1NCLA 2NREA 3GDQA 2W7OA 3ET6B 4CH1A 4ID5A 4Z7YA 3DJCA 2MKHA 3FUYA 5ALHA 2VASA 2F1HA 3GFKB 3K5MA 1WWVA 1LWFB 3O5TB 3FAHA 5F0WA 2XYHB 3K58A 8ICAA 2H3GX 3EZUA 4RPYA 1NJIO 2LQ9A 4WE1A 4FE3A 3O3GA 1U0HA 1H74A 1HD0A 4WXOA 4CK2A 2G8VA 2Y9TA 2FJDB 4LF8F 3PMNA 1NGFA 3NNCA 5BR8F 5IC4B 2YNHA 1KD1O 4MFAA 3HW8A 2P8IA 2AKWB 2KT2A 9ICMA 1MWZA 7ICVA 4YMMA 2PXIA 1NDPA 2D0AA 4X4UA 1NGIA 5ETNA 2M2BA 2A6OA 3GZFA 3DU6A 1HPMA 4E8UA 4YG2A 5C2CA 4CGGA 2GV1A 2XY5A 1VK3A 3NCRA 1UEVA 3FRZA 2F8SA 3UR3C 4KC5A 2ETJA 2XMVA 3DLEA 5AQNA 3J81Y 2NRTA 2KDOA 4CEEA 1WEXA 4G1QA 1HWUA 1L7OA 2UUBK 3I87A 1Z26A 4DU4A 4MO5A 4OJ5A 2DCLA 4FJMA 3CPWM 2KT5A 1VDHA 1KBRA 2PEBA 2YH1A 4PHPA 2RU9A 3FEXB 1K1SA 1SIJA 2V7ZA 3MUTP 4LFAF 2F4FA 4A8QA 4IDHA 3IBCB 3VAIA 3IDWA 3O9RA 3QERA 5J1EB 4OHYA 2A6MA 1IWAA 1S6OA 3OTQA 4PJ0U 3J7AP 4X64J 1YHQN 9ICNA 2I0XA 1YIJN 1H6KX 2QB0A 1LWEA 3ZNUA 3GV5B 5AKEA 3US5A 1M0SA 4Q8FA 1GMVA 3CXCM 5HATA 5DBCA 3V9SA 1HJRA 1QSLA 1ZJMA 1Q53A 3WXLA 3HI0A 3LDAA 1Q5VA 5C24B 2HWTA 1JX4A 4JI2K 3VA3A 4BGDA 1UTAA 1WSGA 1WN7A 3H2VE 3NEKA 2R4FA 4CM0A 1S57A 3F5EA 5GADU 4Y2JA 1N48A 3LANA 3DDHA 1CVJA 2D1KA 4X4QA 1YIJS 4A8OA 2VG6A 3AB2B 3P4IA 2U2FA 2P9SA 3O4WA 3CIPA 3RFAA 1BO5O 1U26A 2QA1A 3UE2A 2K4PA 1XWLA 3CULA 4PKIA 2E3TA 3OJUA 2G8HA 3BDEA 2V51B 2E2NA 2RDDA 2IJFA 5IV3A 5H2FU 2P9NA 4CHZA 3KHGA 4CEZA 2FPHX 4BRLA 7ICSA 1N5YA 2XMAA 5DG8A 3IG1B 4GC6A 3HKZF 3M8PB 1HKAA 3MM6B 2UZAA 3MDFA 4M9NA 4CF2A 2MQPA 3C6UB 2XHCA 4YOYA 4ZIWA 3A4TA 3GYGA 4PL7A 4XEIA 3GDXA 2DBYA 4DV6F 1J5OA 4OV6A 2V63A 2VFTA 4WFBL 3KJFB 3AH6A 1ZD4A 2WVBA 4CO5A 1QQ6A 3I5AA 4NO7A 2YMLA 2DKXA 4MFBA 2JZBB 5FD1A 5CP2A 3WBZA 5HOOA 3MFIA 4ZLPA 1X4HA 3RYLA 2V0NA 2A2DA 2EFPA 4UB3A 4CGHA 4GV9A 4Y2PA 9ICPA 3NCPA 3RB3A 3CQXA 1X4CA 2BW7A 3O4NA 1I3AA 3BREA 2IGIA 4FWNA 1S79A 4B9MA 1HBMB 2OO4A 4RNMA 4DLGA 1IG6A 3R1XA 2ZUAA 1SQFA 2XSJA 1GEHA 4E2FB 2RE1A 3DOMA 2BCQA 3OL9A 4NM1A 4PUOB 4RTFD 2C2EA 4I67A 3J80O 4LRAA 4ZN1A 3VPZA 2NV3A 2VFSA 4FK4A 4LR8A 3TI0A 1CC8A 1NGEA 3TAMA 4A5AA 1SKRA 2I1RA 2XB2D 2PMZF 2JZ5A 3HHKA 1IKXB 2JC1A 3MURP 3NGTA 2MQNA 3KD5E 4P2XA 1N62A 3PO4A 1S1VB 3JPOA 2AJ0A 4K50A 1WKKA 3CT9A 1SQGA 3U8XA 5C25A 3D7EO 2I7NA 1EZZB 3WKEA 2LYBA 2KG1A 4CEBA 4Y2VA 4C11B 4OZ1A 3LZIA 3LP0A 1NOMA 1ZQDA 3HFZB 3A13A 4JV0A 1WKLA 4P2FA 4IR9A 3H6EA 4FNIA 3TEHB 2E8PA 4EUVA 4IFEA 1RAAB 2CUYA 3GONA 3R5JB 1T03A 3CCUN 4JV2A 2RRAA 5CZ2A 2AW0A 2HGMA 4ID8A 5IWAF 4IYQA 5B08A 2LLZA 4CZFA 5HMMA 1DGSA 3UCZP 1HMVA 4PQAA 2VF3A 3DGPB 1SV4A 1PK1B 2JHDA 5ETVA 1WF2A 2EC2A 2ZC3A 2XHBA 1Y5IB 1ULRA 3DXMB 3BJYA 2VFUA 3ISZA 3TU5A 4QZIA 2Z56B 2VBWA 5J0PA 2HAFA 3TVKA 3CCRN 3HO1A 4DV5F 3CCQS 1GLCG 4LJXA 5HR7A 1JJ4A 3GFYA 1TE2A 2V8GA 7ICGA 4DR5F 4FW2A 1EARA 4V19S 1AROP 4DR3F 1PG5B 1F0MA 4K42A 3QO9B 3L5KA 2PC6A 2C3OA 1BGXT 1FKOA 2B4VA 1IIPA 3MAAA 4GMKA 2KVSA 3P39A 1OH5A 1J2NA 5D4BA 1WBBA 2IVPA 1ZTWA 5B09A 5ALIA 5DBAA 3GFXA 2DIVA 4KLTA 1XSPA 4CHYA 2F8TA 4PL2A 2YNFA 1RTJA 4XH4A 2N1RA 2RNEA 1JLBB 3DC2A 2ODGA 2K7JA 1FE0A 2ZQBA 1UVNA 4DV1K 3VZHA 3KVGA 5ALKA 5G0RB 3VERA 3TA2A 4YN3B 2UUBJ 5KNIA 3OFEA 1TYQA 2GLEA 3CEDA 3EZ5A 1YXQA 3KLHB 1Q3UA 1QAJA 3MN5A 3BDPA 4KLDA 1HNWK 2RDJA 3OYCA 2NQPA 5GAEP 1YJWN 1X6JA 2RHKA 7ICLA 2FGCA 2OPQA 1NLVA 2XZTB 2R2RA 2LQ5A 4K4IA 1N61A 3VCDA 4EFAC 1YUWA 4ZJQA 2KV2A 3KK3A 1RCOB 1GXTA 3KWGA 2RIJA 4CI6A 4RQMA 4NXNJ 3AVJA 1FIQA 2DNYA 2VJUA 3RR7A 2D3DA 2ZXHA 4LC9B 5ETQA 5DMRA 1H7XA 1HWIA 3CCMN 1AZSB 4CEFA 2PSZA 3EKSA 5FPNA 3SJJA 4OO1J 3QFWA 3G0ZA 9ICWA 4M9GA 2ZNZA 5AQWA 5L1JA 3KJNB 4I29A 3JSYA 1YHQS 2I5JB 3MPUB 1RBUA 5E26A 3JB9k 2CA9A 3LM2A 2HFVA 4IH6A 4IOCL 2HFZA 5LJ3Y 1NZAA 7ICFA 3CCES 3RAQA 4RUHA 2C22A 3AB4B 5TZVA 2W9CA 2HAIA 2GWSA 4AD6A 4C8LA 2K1RA 4WFYA 4DL5A 4BG8A 3AVKA 4FWRA 3BPDA 2B0CA 1EIYB 1CXUA 1RT3A 4KV8A 1RB0A 4M1KA 3Q8SB 4Y28C 4DV1J 3TSQA 3KD1E 2IHNA 2E6LA 3T1YF 4RUAA 4WQ5C 2E8AA 1XIQA 1HX1A 2ITGA 4DOZA 4HACB 3BQ7A 4X4TA 2J6UA 4K4XA 9RUBA 3T1HF 4L75A 5JS1A 3MEGA 5BXIA 3PX4A 3DOLA 2XS5A 1IBLK 1Q8KA 4RQ4A 3HHLC 4NA2A 1LFPA 3ETOA 2FSKA 2HG4A 1BCOA 3NVYA 1F5CA 5M1OA 5HANA 1U2FA 2L41A 3UXNA 1RCHA 3DM2A 2BGWA 1U24A 3WHIA 1JQGA 3MOJB 2VIXA 2PFOA 3CMAS 3A1YG 4XA5A 2Q43A 3HJEA 1BWEA 3WKBA 8ICTA 3RJJA 2F8EX 5SZTA 3IRXA 3G9CA 2ZWPA 5AHXA 5FROA 3V6HA 2FJBB 4NE9C 4JI0K 1PKUA 3DLLL 3HL8A 5DQHA 3CRXA 2A1SA 2XNRA 2FE9A 3D54A 4C4TA 2B21A 5AI6A 4FBTA 1NSAA 1R8AA 1TFRA 3N7PD 2KHDA 4I9QA 3LYSA 4RW8A 2LYHA 4H5VA 3HZEA 1QVGM 2HQIA 5KFNA 1DT9A 4DFJA 2L08A 1XR7A 4PWWA 4MDAA 1REGX 3NTUA 4CJ5A 3DXMA 2P9KB 2OPRA 2P9PB 3RMCA 1OY6A 4DOBA 2MZTA 1QE1A 1XNRF 2BRLA 3OSNA 2DNKA 2ADBA 4W5QA 3FSXA 3SLCA 3THYB 4A8EA 4O5BA 2HZVA 1JLBA 2ZJPQ 4F91B 1RTJB 3DLGB 4FF4A 9ICRA 1OUQA 4DSKA 1XMBA 2XYGB 1IBKK 2A3JA 1T03B 3C65A 1CJKB 4CF5A 1N5XA 4JUZA 1ZXIA 3HX9A 1Z4OA 2IA6A 4K7QA 1S5JA 3BSCA 1IKYB 5KOWA 4J9QA 1IKWA 2K2PA 1L7PA 3P49B 3ULDA 3MAAB 2GC8A 4YOTA 5KT6A 1FDBA 1RAJA 1N5TA 2P9GA 1YJNS 4O5FA 5DO2A 2JEIA 3KK1A 1YI2S 4HHHA 1LFWA 2RF2B 3SXLA 3CCMS 1GFWB 3CJ3A 5TKYA 1N8RO 4YDXA 2MRLA 2ZH6A 5HK4A 3U02A 4KLMA 2DTJA 2XMMA 1OSCA 1IKXA 1HR0J 1SH0A 3CD7A 1QSYA 4DPUA 1XNQK 4W98A 4DR2F 3NF9A 3E0FA 1Q86T 2ZJQL 1ZTTA 1ZQHA 3DLKB 4BR5A 3THVA 3O9QA 3U6FA 3PCOB 2I9SA 3P4UB 5KPRA 5LY3A 3I0RB 4DQRA 5AR0A 4PG4A 5K20B 2DWQA 1IR1A 3KDOA 2ATLA 1VS3A 3MX5A 1RFQA 1J53A 5KL1B 3SFGA 3MZIA 3M1FA 1NNEA 5HMWA 2HDOA 4CIOA 3LO3A 4DBQA 1JL2A 4RWXA 4NJ8A 5ETOA 1FXLA 2GX9A 1YLXA 2FJ6A 3IMXA 2OH2A 2QWPA 2HGLA 4C11A 4BXOB 1BIZA 2MXYA 1RWOB 1HNZJ 1ROFA 5IFMA 5D4LA 2FF6A 4KE5A 1B0PA 2QT7A 3MN7A 3AQOA 3L2RA 2CJKA 3WX4A 1HRHA 2KFNA 1N0UA 2JX2A 1HIWA 2QLBB 1B70B 1LXJA 5FPDA 4UAZA 3RJHA 4BWMA 2LECA 3HSZA 2RSQA 4UATA 4URGA 4KGZB 1WCLA 3H5UA 3B6PA 2QB1A 1C1BA 3RAXA 2RHFA 5F8GA 3IKMA 1VISA 5J2NB 3QNWB 3DXSX 4F5RA 2GBZA 4DL6A 3CF5Q 3LF0A 1OPIA 2RQKA 4LF2A 4LH5A 4BC7A 3CJKA 2W43A 4I2GA 5I42B 4ER8A 3OBWA 7ICTA 9ICQA 2YX4A 5A0YA 4CK3A 1JLAA 4CYUA 4OI0A 2P5VA 1X3NA 2BDPA 3MOZA 4LVNP 4TYBA 5AQJA 4CJWA 2P9EA 3T19A 1DARA 4USUA 4ZP9A 1X9WA 5ALXA 2HPUA 2FI1A 2YX1A 2K4HA 3CJ2A 2DYAA 3PSPA 2G13A 2HNDA 2CWKA 3ZTPA 4J2AA 2JHEA 4JLHA 4KAZA 2WRMA 1J9AA 1SB3C 3JYTA 5C24A 1RQNA 3MM5A 4XPEA 3MEDB 3M6XA 2MKKA 1VDVA 2BJ1A 4OJLA 2M8DB 3OQ2A 2RF2A 4M7YA 4RW6B 3C0BA 4BR0A 2ASYA 3VAKA 2HMXA 5J0OA 2LA4A 2ZJAA 3C6AA 1RTIB 1NSKL 4M3TA 5GAGI 4DV3K 3O5BA 2V52B 1FFUA 2GIQA 4YDDB 2E5LK 1H72C 2OFGX 3NKYA 3KG1A 5KOXA 1VQPS 3QICA 1HR0K 2Q3PA 1ZA2B 2VU5A 1NH8A 1XNQJ 2YB1A 2WAQF 3B6BA 3VAGA 4JBCA 1VSEA 4TXSA 3NXZA 4NI2B 3CJRA 1CJKA 4Z4FA 2W1BA 2PFQA 4ZVFA 1H2VZ 3POTA 3OR2A 3HHDA 2V2KA 2HHVA 3RRKA 4KLLA 3K9KA 3MTKA 1ICEB 1HQUA 2IC3B 2KJ9A 4KAIA 4UF4A 3E58A 3N5BA 5D46A 2EX3A 2AA4A 4JHDB 1LB2B 4DCHA 1YKWA 1IO2A 1Z25A 1HARA 3FSYA 3GJTB 4DO9A 3OFGA 5M2UA 2M5YA 2V2ZA 1KSPA 4TY9A 1GLDG 1DTTA 3PKYA 3DLHA 1PAEX 1V3SA 3OYFA 3PJ9A 3ZTQA 4LREA 3J81U 3O6QA 3RB0A 4IOBA 3MCOA 1F2HA 2YX8A 1ZM2A 5AQUA 5C2FA 2UUAF 2A42A 3E01B 2CZ9A 1ESVA 1UWBA 5GAHU 8ICCA 1FT8A 4F36A 1QH9A 1FRXA 3ONQA 3S3OA 4IEEA 1Y7PA 2ZJRL 2Q6CA 5D4PA 1RHRB 2DUYA 2QB0B 4AH9A 3OBYA 4GO5X 3G71S 4R65A 5ALOA 1J6ZA 4F0KA 1G2EA 1HYZA 4JI8J 4LMZA 3RBEA 3VCBA 3V5RA 3IAS9 4OJOA 4IH5A 5KFLA 5HP1A 1KOHA 2ZJQQ 1KEJA 2CFXA 4DV3J 2KJWA 1ZJNA 4ED2A 1VC5A 3DOLB 3B6OA 2YY3A 1CQNA 4PHEA 1SXDA 2B0GA 3THYA 2H5IB 2KKZA 3GIMA 4ED3A 1ZRMA 3O1LA 4K0KF 3ZT3A 3S7RA 2OPRB 3O2IA 2K60A 3A8IA 2LQBA 3PNCA 1D9AA 2IIHA 3R2DJ 4CGJA 1ZZFA 2Q1LA 3AA9A 8ICRA 3DLEB 3C5GA 2UXDF 2AT1B 2EPIA 3CCSS 4MK7A 4MLHA 4JI3K 1GTHA 5EDWA 2BE7D 1XO0A 3NVKA 2PMZD 3C8YA 4CRXA 4UOHA 2OEMA 4Q0BB 2LXIA 2R2SA 3ATUA 1MA9B 4G65A 2G2YA 1VSLA 2RAQA 3G82B 3VQQA 2LQJA 3IRXB 4Q7AA 2AMCB 2EKYA 5CD4A 2CNNB 2OIHA 1VOMA 5ADZA 3SCIE 3DRXA 4BRIA 3JQKA 1NJZA 2B9YA 4BDPA 5D4NA 1AZSA 4PAAA 3P5TL 4BE1A 2K4EA 3PRDA 1W2BR 5KQDA 3SQGA 2YKQA 1FRHA 5KGXA 1YVFA 2WB1F 3CP8A 4H8KA 1PYOB 5AE1A 4RPXA 2KVIA 3CD6N 1CEZA 4JI4J 1XQSC 1AYEA 3DCAA 1S1TA 3JXUA 4FLTA 1KNZA 2VG5B 3SMPA 2JXJA 2W6KA 1WF1A 1NU4A 1XMOF 4H4OB 4Q2MA 1PJ6A 3AD9C 2Q6BA 3B82A 3W5YA 3T6BA 5LMNK 1SIZA 3ET6A 3NG8A 3KLHA 1NM1A 5EE1A 2NCKL 1S59A 2B8PA 1N34J 2WTUA 4ZCMA 2IAJA 1S9GB 1SGGA 1FJGF 4OHXA 3TADA 1X60A 3NH0A 2HKEA 2ZKTA 3P96A 2GQQA 3H46O 3S3NA 2W4PA 4BX9C 2AJQA 3FMWA 3HSGA 2IRXA 2O67A 4KITB 3A0BU 2PMWA 2WK4A 3QUQA 4DU3A 3KLIA 4LFCJ 3CJAA 3WXJA 1N34K 4IRDA 1IJFB 4LF8K 2A41A 2UXDK 1K8AO 3VQTA 3EX7B 1YAGA 1FK9A 1NDLA 4ZVRB 1PK3A 4RW7A 3T79A 4UZBA 3N5FA 5LSRA 2NYIA 2Y3YA 3EXCX 3VQ5A 2R7OA 3P5JA 1Z1ZA 3C66A 4ZPCA 3W2WA 4B3MF 4A8MP 4K4UA 2JJ4D 2YJFA 3FFIB 3IN5A 2AIRB 5ALLA 3RH5A 4U8VA 3PHTA 3A8JA 4FJNA 3EN9A 1TFWA 1R8PA 4DX7A 1A0PA 4QU7A 1LVHA 5DM7L 3VQCA 3CDWA 2LU2A 3I76A 2C2ZB 5AQFA 1N52B 3JS9A 3KLFA 4FJ8A 2GTDA 1GX5A 1NXIA 3C2LA 2I1QA 3HYFA 2A40A 1BPXA 2DL0A 1VYAA 3HDSA 3ILOA 2H54B 4C80A 3D0PA 3MXMA 5MAOA 4Z6EA 1RGVA 4MKYA 2CQGA 2ZBQA 4I2FA 4RL1A 2LBOA 2EK6A 2CXYA 4KHNA 7ICNA 3W63A 2HF4A 2EKNA 2E9RX 2VBZA 1T9XA 3OVNA 1AA1B 1S6UA 3GV8B 3QIPB 4DR1F 4PQUB 4JI1K 4ES3A 4C0OC 3HFVA 1YI2N 4QR0A 5C25B 1T8EA 2VYPA 2O8FB 3N7RC 2CJBA 2QIFA 1RHMB 2AGQA 1BQMB 5D0GA 4KN7A 3PSTA 3MAQA 3FBEA 1QTNB 4XH1A 1M1KT 3K5LA 5I3QA 2B7CB 2VONA 4U96A 5CR4A 2J76E 5BPLA 2CQ0A 4DHVA 4NLRA 5LMNJ 3TTDA 3WKCA 1SZPA 4MF8A 2IVYA 3BQ1A 4QW9A 3NGZA 3ZSXA 1O51A 1QTMA 2E20A 2ZUBA 1SV5A 1X4BA 1TTHB 3MPVA 2IOCA 2VPZB 4OYXA 2MQOA 4DV3F 5AQLA 2D69A 3GU3A 5H1SV 1BXNA 1QDUB 3SYZA 3AVIA 2BRKA 2X51A 2GO9A 2PO4A 5CHGA 2BJDA 1SB6A 2KP7A 1YSJA 3TQEA 5E3RA 2ZM6J 2EG2A 3JS6A 1X3MA 2QL7B 1Q7LB 5AKHA 3GTYX 1JLEB 1RWPB 3MMBA 3V6JA 2NZCA 1GLLO 4CERA 3C1ZA 2MLYA 3GQCA 2UU9K 2WAQC 4BS2A 1XC3A 4FF2A 3UKRB 5KAFU 3UN5A 2G8KA 4R5PB 2IOHA 5JLHA 3RR8A 1OVQA 4CZKA 3ICXA 3TZXA 2C2OB 1ZYQA 1I3OB 3CTRA 3MGIA 3H1QA 3K2PA 4FPIA 4JNEA 3UIQA 4YR3A 4NXMJ 1YQHA 1S0VA 2KKHA 1REVB 4N76A 4CZJA 1M5SA 2H3IA 4F93B 2LYVA 4MF2A 2DF4B 1VQ8S 3FLCO 1N88A 1VQOS 4BVPA 1HYVA 1CULA 1ZBFA 1V97A 5BJRA 3QGIA 4JI5K 3N01A 2IRUA 3NBPB 4F4WA 3CCLS 1XHZA 2GHVC 1NMDA 3TZZA 3HTVA 1G99A 4AQYK 4C3MA 3OLBA 4JKHA 4B9QA 1R43A 5HL7Q 2OPPB 1DQ9A 3CJBA 4PXEA 2BJ9A 4O0IA 3EWAA 1MW7A 2OUGA 4CFCA 3O1WA 2BCSA 3MM9A 1EQ0A 2YV0X 3Q2SC 2DEIA 5KAIU 2KG5A 1FEHA 4DQPA 2F9WA 4ES2A 3MN9A 2M70A 3TFSA 7ICEA 4LF7F 3D6MB 2ZHBA 5G4DA 2RB7A 5JVHL 2BE2A 4I4BA 2DT9A 1TVRB 4E7IA 2XMKA 2QSWA 4UB1A 1X4FA 3KK2B 4KX5A 3EY1A 1LWEB 5MLCQ 2RUSA 3MGHA 1XNRJ 5CY4A 3V7LA 3EGNA 8ICFA 4FWSA 2CQIA 3TVYA 2XO6A 2WF9A 1XR6A 4NXMF 2E8OA 3O8MA 3MTJA 1KD1T 2JDJA 2X6NA 2UP1A 5L39A 2DPIA 2C42A 1WC5A 3J8AA 3D0IE 1EETA 3RW7A 3IWNC 3ISND 4IRCA 1UAWA 4LF9K 3FZLA 2DGVA 1YTAA 2Q2RA 7ICUA 3AD7C 3BKFA 3O80A 2R8IA 1C0TB 4A8FA 2YWKA 3VGKA 3DRRB 1DBDA 1Z4NA 1VQKS 2ABYA 4M5IA 4CH0S 3IFRA 1B0TA 4H54A 3NNAA 1PBUA 1T6DA 1M1GA 1L6NA 4OD0A 4AXIA 1RAOA 2DR6A 1NBEB 2DRBA 2QARA 1JLCB 3V9WA 2O4GA 1NLKL 4ZITA 1LOUA 2IS3A 8ICSA 4DU8A 3MN6A 5AT1B 3ID8A 4ZOSA 4I2QB 5EX0A 4HHUA 1XU4A 3Q8KA 5LMNF 4CZIA 1Z00A 4GMJB 1MC8A 4X62J 4M0AA 2YNGA 3VQAA 2QXLA 4CE9A 2G8FA 1P6TA 1SC6A 8RUCA 4Q43A 3O08A 4ZVPB 4X65J 1KC8T 2MKSA 3QUBA 4O3RA 1NPPA 4FVMA 1FFGB 1TQLA 5H9FK 5DB6A 2XRIA 3HKZC 3V7JA 5AM4A 2IBOA 2BJEA 4WZQA 2KFYA 1O5JA 2VC1A 2C2KB 2ZIXA 1TL1B 1ZQIA 4J5OA 2O8EB 3E1YA 2P9CA 1LWFA 3QUTA 2FZGB 2CJYB 1GLFO 2ZH3A 3P1GA 1ZD5A 2YJEA 3MMVA 1ASUA 3SV3A 4IQXA 2EH9A 3BO3A 2FHOB 1SV5B 4H0PA 2OA8A 1KP6A 4ED5A 1Y10A 3GB0A 5EX5A 5M1QA 4KI4A 3CIMA 4EZ6A 3EGZA 5FJ4A 1L8OA 2AHOB 3M1VB 2YKNA 4BGAA 4JI6F 5DB9A 2XM3A 4B3TJ 3G10A 2JOQA 2NYVA 3KIOA 2HS3A 2D4WA 2CJQA 4DPTA 3AAPA 4CM2A 4YY3J 1RDWX 3SD7A 2F40A 4RQ7A 2GNKA 3JQMA 5JICA 1KKHA 4ETZA 3G2XA 4BRNA 1HW9A 1D4XA 5KT5A 3SBGA 3D0GE 1B0XA 2HLTA 5IS2A 1IBMK 3S6JA 2ZFHA 2KU7A 4NCBA 4JKEA 3ZZTA 1OJ4A 4H5NA 1QSSA 1OYDA 2XGPA 3LDQA 1FK9B 4QQBA 3OL6A 1HNXK 5AQSA 4FM2A 2LCWA 1G1XA 2WHEA 3TAFA 2YWGA 3C28A 1GLEG 4IBNA 4BBYA 2GEMA 4H0YB 1DAXA 3LVVA 3IWLA 4R0EA 1N36F 2JNJA 4RWTA 5LMUF 1A76A 4HL9A 2DNHA 4P4PA 4I6AA 1VQ7N 4K4GA 5GTHU 4JMUA 1WSIA 5E3PA 1CG2A 4ECYA 4ID5B 1UHUA 1UJ4A 1QD1A 4BDYA 3PKMA 3LP1A 1XO1A 4Z0UA 1RE1B 2BUNA 4QAGA 3B8HA 1KQSR 1EO1A 4HI2A 3FFKB 3NGIA 1SKWA 3L9ZA 2F8KA 7ICJA 1YJVA 2RD5C 4LRBA 4WQ4A 4I28A 2RRBA 1RBSA 3M5RA 2OEHA 3MR6A 3FK4A 3NRBA 4TY8B 2Z58B 1DY3A 1VIOA 3RJIA 4Z37A 1SAZA 1S76D 3W2WB 3UNYA 3MUMP 1RBLA 4RW4A 3CC4N 4EBDA 5KFJA 2D7SA 2W6LA 2OXOA 4J2EA 4JKDA 4IS7A 1TKDA 1S0MA 4CJLA 2DKOB 2D3ZA 3BGFA 2P6RA 2YKPA 4NX9A 1P90A 3TYTA 3BBFA 1RYRA 1UFWA 1JMSA 2KIVA 5L1MA 1Q5YA 3M2VA 3NMUA 1VHIA 1RWMB 2CGLA 3TA0A 3CNHA 4PZNA 1VSJA 2AZ3A 2PYLA 1S0NA 2JC0A 3IGVA 2DGZA 2AD9A 4EP5A 1TL3A 4Z6CA 4H0OA 2M9NA 1M5HA 3H40A 1M6YA 1YITS 4JV5K 2KZZA 3CO9A 4IO1A 1IG9A 3EMTA 4F72A 3LQVA 3AV9A 4YMNA 1RHQB 1KBUA 4IR1A 1V4SA 4ZCLA 4LZGA 3HLUA 3VGVA 1HNXF 1F3VA 3HRGA 2BZ2A 1URRA 3PTWA 1U6FA 3NDKA 3C2KA 3T5LA 1C0GA 4O3PA 1UEKA 3IBPA 1H3DA 1W7WA 5EE3A 2AJ1A 2YKOA 4BRGA 1ZC6A 3HM8A 2WF5A 3M6VA 4PL1A 2J7UA 4GXJA 8ICHA 3ZX3A 3TVZA 4LF6K 4JI8F 1LQ9A 1YVNA 2XHWA 2Q0ZX 2DNLA 3JSMA 8ICKA 5CZXA 1K0VA 4ZJOA 3ZLJA 2W24A 2OZMA 3HSDA 1IWGA 4QIGA 5J0RA 2DXEA 3NGKA 5E2QA 1XMOJ 1UA1A 1HNVA 4DL3A 2AX0A 2KHVA 1TVAA 4DN0A 2HNYB 2F76X 4UB5A 5HLFB 4OKEA 2YNGB 3FBBA 1EAYC 3W2VB 4FPBA 4YDUC 2ZIUB 3ILLA 4G9ZA 3N4WA 2HHSA 2HLUA 3C15A 4Y2QA 4DOCA 1D1UA 1WTFA 4X4NA 1MQ2A 2F1IA 2QA4S 3F9MA 1RGIA 4DR5K 1NM2A 4DTPA 4KO0A 1JXEA 2ZH9A 2HMIA 3E01A 4Q0BA 1OW5A 4YXJA 1WG5A 3R3LA 2VQEJ 3FM9A 3Q8RB 3RJKA 3G87A 3RAMA 1XNQF 3BH7B 3MEEA 2F65A 1MWMA 4ZDNA 2HVZA 4KN4A 2NLWA 3UKUB 1TK8A 2QEXS 1A6SA 4AHVA 2MZSA 1FDNA 5J2FA 2ALZA 1AUSL 4B3MJ 2P9UB 4CJ7A 1KN6A 2QX0A 2G0CA 4L3NA 2FJVA 4JK1A 1QVGR 1RBTA 3VQDA 4EO6A 1WWHA 4B1UB 2UVRA 4CLLA 2HHHJ 3A5MC 4KH0B 1UAXA 3POTB 1U1OA 2BACA 1X4GA 1ZBHA 3H59A 4M5MA 6FD1A 1CJVA 1CJVB 1X0PA 4B8CA 3VEYA 3MMAA 3LUYA 4JEPA 2FDNA 2ZIVA 2O8DA 4FJ5A 4ZPBA 4WP9A 5J2EA 2VKQA 5D78A 5ALGA 1UFKA 5JTIA 1X5SA 3C6HA 3CFRA 1B92A 4FJ9A 3CJ7A 1RACB 4MKAA 3A5LC 4HH1A 1ZOLA 2CQDA 4R64A 2JSXA 5ALZA 5LSOA 2W8LA 1HHTP 3O8WA 2Z1JA 1G3OA 3TPQA 4DCPB 5HR6A 4CK1A 1UCVA 2YKMB 1R6YA 1UEUA 5AFUH 5J2QA 3CCVS 3VTHA 2MMYA 4CZEA 2LM4A 5J0QA 3ZTRA 4KO0B 3VQ9A 3CCSN 3L95X 3H2UB 3MM9B 4HI1A 3I5BA 1HUOA 4FXVA 3O6WA 4FWOA 2OPPA 3HD2A 3UCGA 3QZ8A 2NNWA 5I3UB 3CCEN 2XULA 4KHPF 3RVCA 1RT4B 2DNRA 5A6PA 3A0HU 1X4DA 3QGGA 4U7UD 1NK7A 2NSCA 1OPZA 3OPKA 3RJFA 1Q46A 3UW1A 1NB2A 2HNZB 1HBUA 3R7BB 4KGMA 4KHRA 2OJ3A 4DN9A 4W5TA 1NNDA 3A8KA 4AM7A 4LZDA 4X62K 5LJWA 5AZIB 2CPEA 3R6MA 4DX8H 1X5TA 4B3SJ 1B9FA 3AQFA 1IXRA 2RILA 4P4MA 3PEJA 4WCEL 1TAUA 2GVDB 4FLXA 3VQBA 1QJHA 4DLEA 1WC4A 3WDOA 3UFCX 3J7ZO 3LPYA 2E1FA 2XY6A 2QMWA 3CCZA 1ITGA 4NMLA 1KLNA 5J1PA 4DR6J 2X3GA 1U8SA 4BC4A 2RH3A 2NXCA 1C4CA 1RILA 4MJKA 3G8SA 4CLKA 4TN2A 2RRDA 3ZT1A 5AQIA 3R5AA 4DFDA 3T1HK 4CJSA 4LVOP 5HVHA 3I5CA 2BANB 4EBCA 5CJ7A 1ZPWX 5IT9O 1DLOA 2NUUG 4NXNF 1AUDA 3G6YA 2O1PA 3RJMB 5I42A 2E6MA 2ILZA 3ULEA 1KDHA 4OI1A 3MM7A 4I2CA 5BREA 3ENWA 5J0XA 3BBBA 1YTUA 4N47A 2ZE2B 1WELA 5J29A 4J9LA 1NK4A 4LF8J 4JAXA 5B0DA 4C97A 3NRZA 3LDSA 3M7VA 4F2SA 4KI6A 3WK8A 4I6MA 3FEYB 4FWPA 3WK6A 2H4YB 3OFHA 2RS2A 1UVKA 3VR1A 2HQGA 2G5HB 2DGUA 1BQMA 4UOFA 3BZKA 4U67L 2HHPA 3R9KA 2FGOA 1VAZA 5HL7L 8ICVA 3L2QA 3V7KA 4LBHA 1TL4A 3SUQA 1R8HA 4O3SA 4GC7A 2BZFA 4J91A 2IY5B 3MM8B 5AZJA 2ZIWA 4F5PA 4FZMA 1D8BA 3KBBA 4DU7A 4YOUA 5ETMA 2FMQA 2HFOA 2HZCA 4JOUA 4QZCA 2O01C 2B4OA 5RUBA 5DG9A 4PY5A 1VQ7S 3LGHA 5J0SA 3P8BB 3AUOA 2BCRA 4AHUA 2GW8A 2EK1A 2UUCF 2B8QA 3IAYA 1KDNA 3D2SA 1N0VC 2PGCA 2RDIA 3C94A 4UB2A 3U9DA 5DZ6A 3GBTA 1VQNN 1KN5A 3DLKA 5BPCA 2QC3A 1S9EB 4L8RB 3J80U 3G6VA 2UVUA 2ZJPL 2CG4A 1U48A 1RWNB 2FLLA 3J7ZT 2Y0SD 4MIWA 4OYAA 4JI2J 5HRRA 1KCFA 1RISA 1S10A 3R1LA 3ZZPA 2CQHA 1N2XA 1VK0A 5GMKa 4DUYK 3DRYA 3L8BA 2MSTA 2AQ4A 2J0XA 2FC9A 3WIUA 2XZWA 3UDVA 2JH3A 4ZPTR 1ZBIA 4KH6A 9ICAA 4Z4HA 2H5JB 3ITHA 4KGVB 4C0BA 3AA2A 3VEOA 4DV0K 1R8BA 3HOTA 5AQHA 2BANA 4CF0A 2ASOA 4OGCA 3Q0AA 4B9LA 1TL1A 2ZIXB 5K8PA 2I9GA 3ZT0A 1GAOA 2E2OA 4AUKA 3R8YA 3ENHA 2WAQD 3BS9A 5LMUJ 2VQEK 2ZD1A 4LF7K 3MM8A 3FQLA 5F3TA 1RTHA 4CCHA 3DXKB 9ICVA 3BGLA 4FS2A 2KK0A 2BUPA 1PVQA 3H8MA 4I2PA 1NUEA 2DNMA 4XPCA 2P9PA 4HTIA 4C0ZA 2F9JA 2PFFB 2IYGA 4Y2SA 4EP4A 3FC9A 1VQ4S 5H9EK 2H4WB 1Q9YA 2J8SA 3HRDD 5J2GA 4O3MA 3CD0A 2P5GA 1T9TA 2IVFB 4B9VA 2BQUA 4BLGA 3O3FA 3W5XA 4QCLA 3SSRA 2FHKA 4P7VA 4OJGA 2KH9A 3U3YA 3WNFA 1Q8BA 1RCXB 4FZVA 2NRVA 4RW9A 4A8SA 2W04A 3QUCA 2B7BB 2FTRA 4L74A 3ZETB 3TO8A 4FM1A 5DJBA 3Q8VA 4MLEA 1VK8A 4DCJB 5ALMA 1RZMA 7ICKA 4IO8A 4DV0J 4DUZF 3SUOA 2ADCA 1YITN 4C98A 4YN4A 3KD3A 4Q45A 3G82A 3KXDA 2DR9A 3KK3B 5KG1A 5KT7A 1VI7A 3AJ2A 1ASVA 1LW2A 3MEGB 1F0XA 3UMCA 3LP2A 4OYOA 3ATVA 4IOAQ 1RHUB 3OXLA 4ANCA 4ILLA 4FLYA 4ZCKA 3GG0A 3NHGA 2F2AB 2YQ3A 1MWYA 1Z2LA 2IIRA 3OHRA 2FD2A 2XCAA 1DEJA 3SAFA 5AQXA 4H0XB 4GV3A 1FERA 1DGJA 3UI3A 2ZUGA 4DTRA 1VQLN 2V4JB 4TURA 1FD8A 8ICBA 4YR0A 3R3TA 4HTJA 4W90B 5LL6Z 5AQYA 1ZQRA 4CJFA 3M6KA 2QWNA 3QRQA 1XSLA 4FF1A 5HAOA 2KW4A 3R1HA 3OS2A 2C2RA 3VF0B 3OYAA 2FY8A 3MXIA 1HBUB 4P10A 3TW0A 1OY9A 4FF3A 5CQGA 1O8BA 1Q18A 3LDOA 3C46A 1O08A 4QIEA 3UD3P 4A8WA 4XK8C 1RT4A 2G1DA 3THXA 1ZQEA 3Q7CA 1JKHA 3I9V9 5EXWA 3CDBA 1CS4B 4TSXA 4PZOA 1A0OB 3AOAA 2JH7A 2JRZA 3K8WA 1JK9B 4OFZA 3I33A 3DYAB 3Q23A 2PI5A 2QL9B 4RUBA 3VWSA 4IC9A 2VHGA 3D2QA 4U7BA 3ZCMA 3I8BA 2J9DE 1DTTB 4YFKA 2VDIA 5D0EA 4EI2A 5AQVA 1FTRA 1EWRA 3K1ZA 5ETLA 4OLAA 1RABB 5KT2A 3CQ8A 2WVEA 2UXCJ 4E1MA 2F8LA 2WF8A 2YNIA 4EMDA 4DQ8A 3O0FA 2QWOA 3AJDA 3T41A 4DV1F 1K44A 3AJ1A 1BVSA 2EZZA 4PABA 2NZ4A 3IXQA 4FW1A 3ZSRA 3SCKE 5AQTA 3OPXA 4J9OA 3OYDA 2PMHA 3TZWA 2DFFA 5IIMA 3FEZA 3QEXA