1NK0A

Adenine-guanine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk0A01
2OPRA 4Z4FA 2RKIA 4O3NA 4YMNA 1MC8A 1EKEA 1ZQAA 3O3FA 3SQ0A 5J2IA 2LSNA 4AHCA 1QLNA 4N47A 9ICMA 1C1AA 3PY8A 4YMOA 3UQ0A 4HUEA 4KITB 4FZXC 1BI4A 2UVVA 1S1VA 5C42A 4RQ0A 4JRPA 5HRNA 4IRDA 4QZCA 2P5OA 4F5OA 5FRNA 1B22A 2V9WA 4I2CA 4FJGA 4OGEA 5BOLA 3JSMA 1Q9XA 4MFAA 3OS0A 3ZT4A 1W0HA 3ZT2A 4AILC 4OLBA 5F9LA 4CJ3A 3MR3A 3OYBA 1C6VA 5KGWA 4J2DA 1S0NA 4LH4A 3T5JA 2ZJ5A 4C8NA 1LWFA 1ASWA 1N48A 2AJQA 4QZDA 4YR3A 5D4BA 3L3VA 1S6PA 4R5PA 8ICYA 4QWBA 3VQDA 3GIMA 4I2DA 1KDHA 3ASMA 4KB1A 4OGCA 4PA1A 1CXQA 1JXLA 2C2RA 4JS4A 5J0QA 3RR8A 4X5VA 3JPNA 1XWLA 8ICCA 3RH5A 4KB0A 3HP9A 4EZ9A 4B9TA 4ZH4A 1JIHA 1HJRA 3SUQA 3I0SA 4AHUA 8ICAA 4ED2A 4ECRA 1XU4A 7ICPA 2UVUA 2PFPA 1ZQGA 4DU3A 3NHGA 4UB2A 2X6SA 1ZQYA 2F1JA 8ICKA 4ID1A 3OYHA 3Q8PB 2OYQA 4UAWA 2ISPA 4ED8A 2AGOA 1BPYA 5KT3A 4KFBA 1HRHA 2OZMA 5CYMA 9ICOA 2HNDA 9ICSA 3RJIA 4R64A 4ELTA 4J9PA 1FKOA 4IQVA 1XSNA 9ICRA 4F2RA 4UB5A 4PGXA 5KFQA 7ICNA 3K58A 4O3PA 2BPCA 5HMMA 1IKXA 4CK2A 4I2FA 4KLHA 4DFPA 3RJJA 2F96A 3ISNC 3ULDA 3NGYA 1ZQLA 4ECUA 2AQ4A 3AA2A 5HP4A 5JUMA 2XGPA 3T19A 3OY9A 9ICWA 5KG2A 3MFIA 4DL3A 3VQ7A 4B3OA 5KFLA 3V9UA 1ZQBA 4GXKA 1RT7A 1VSEA 1TAUA 2BGWA 4J9RA 5L1LA 3NH0A 4BDPA 2ETJA 4DG1A 2Z1IA 1JL2A 8ICJA 4J9NA 4ECXA 4JV1A 1ZQDA 1ZQWA 1C0TA 4ZTJA 5CJ7A 3EPIA 4BE1A 3AO4A 1ZQZA 3KHLA 8ICQA 3NTUA 9ICIA 3C1ZA 2I5JA 5HBMA 5HLFA 1ZQXA 3CG7A 4O3SA 1BHLA 1RBVA 2VG7A 3DYAA 1XI1A 2OPQA 4O3QA 5KG0A 1S1UA 2MAXA 2FPLA 1S9GA 1ZQSA 2VANA 3NGZA 3KK3A 3K5LA 4RQ3A 3C2KA 9ICLA 5DK5A 4CJFA 1HQEA 3OSNA 5KT2A 4DQQA 3V9SA 2JEJA 4DLGA 2A1SA 2ZUCA 5D46A 4YR0A 2PXIA 1BGXT 4RW9A 1TKDA 2NRWA 9ICNA 4Y1CA 1KCFA 1RDAA 4R65A 1HYSA 1ZQCA 4IG3A 4DTJA 2J6UA 4DSEA 3MEGA 1KVCA 3OYLA 1BISA 4DU4A 4B9UA 1ZQOA 4YN4A 3B6PA 5CYQA 2BE2A 5KG4A 5J2JA 3HPHA 4IQTA 2Q0ZX 4JV2A 2OPPA 4KO0A 4F5QA 2ZTCA 2AGPA 4F4KA 1CZBA 4E1MA 1EX4A 3SCXA 1QHTA 4LSNA 4FJJA 2YKNA 1F21A 4CFBA 1XSPA 3OYCA 2FLNA 4IQUA 4HVJA 3MDCA 1RTIA 3KLFA 2XY5A 3KLIA 1QSSA 1SL1A 4O9MA 2D5RA 2VG5A 2NRZA 4QWDA 4FLUA 4ECWA 2KN7A 4IG0A 4L8RB 3NF6A 3SQ2A 1BIZA 4ECYA 7ICEA 4K8ZA 4CEFA 4TQSA 1X2IA 3HX0A 4O0JA 1NK6A 4K4IA 4E3SA 2YHBA 2IA6A 4XRHA 1A5WA 3FYHA 2G8KA 4IR1A 3AVBA 1IXRA 2H5XA 4I2AA 9ICPA 4I9QA 1QQCA 4OPKA 3QEXA 1NK4A 4M9NA 4RW7A 4Z0UA 4BXOA 4CFDA 3JPPA 3GIKA 2YNGA 3DRSA 2DPJA 2HNYA 1RT5A 3L2RA 2W8LA 4DOBA 5CZ2A 1LB2B 4O5EA 1RDCA 4CHQA 1NOMA 3QEVA 7ICLA 2X78A 4E1NA 3QZ7A 1GOAA 3C21A 5DLFA 3MGIA 3QETA 4CEZA 4F3TA 9ICFA 2VWJA 4DTNA 4FZZA 1MU2A 1MSWD 4OKKA 4QZGA 3SQ1A 5CA7A 4CE9A 2UVWA 3RMCA 2A1RA 5IIIA 3LZJA 4CK1A 3RMDA 1DOQA 4Q45A 1Q8IA 4MF8A 3KHHA 2IHMA 4LSLA 3QERA 1VSJA 2JLEA 3SYZA 4I2HA 3AA5X 3K2PA 4CHPA 5L1JA 4FW1A 8ICLA 4FM2A 1BCMA 3NF7A 4FJKA 5HHHA 4QZHA 4PGQA 4Z4GA 4OLAA 4RW8A 5J0RA 1U47A 4UBBA 4N41A 4M47A 2HHXA 3V7KA 1VSKA 4Q44A 1HQUA 1S1WA 3AO5A 3LK9A 3PO4A 1O1WA 3ZT1A 4E7LA 4M0AA 4F3OA 3HJFA 1Z25A 4KAZA 3K5MA 4FJLA 4YFKA 4CK3A 4CEQA 5DB6A 3GV8B 4BE0A 4I27A 3M9NB 1KFTA 7ICMA 2G8IA 4CEEA 4TUPA 2Z1HA 1LW0A 1RYSA 3TAEA 2BCRA 1ZQJA 2ZE2A 2Y1JA 2P6UA 1S5JA 2FBTA 3V7JA 2XRIA 8ICVA 1JLBA 4Z6EA 3KLGA 4CF1A 1JKHA 3LP2A 2IAJA 3NGIA 2HW3A 2YHAA 1NKBA 3CFPA 4DFMA 5FRMA 3M8QA 4LH5A 1S97A 1JLEA 2J6TA 8ICEA 3V1OA 4CJVA 3SJJA 4NCGA 3N4MB 2ITGA 3KJVA 4CHYA 3SV3A 3DLHA 3VQ6A 4CGGA 2G8UA 2ISOA 3BQTA 4GVMA 3F9KA 3PMNA 3QEAZ 3AU6A 4AHTA 2OA8A 1R0AA 3LDAA 4FXDA 4M9GA 3I0RA 7ICKA 3GIJA 9ICHA 1RXWA 2YNHA 4XQ8A 2ZD1A 3MEDA 4B08A 3C23A 2DTUA 3MABA 2HHQA 4RT2A 3LANA 1YTAA 1TKXA 3M9OB 4FS1A 3VQPA 3PUFA 4DL2A 4IKFA 3NF9A 4I29A 3RAQA 3H08A 3C6TA 4M3WA 1FXXA 5KI6A 4FCYA 4JUZA 3DRRA 4BWMA 4IFYA 4F4WA 5DG9A 3FFIA 1KRPA 1RNHA 2ASDA 3O4NA 3VQ9A 2DFFA 4Y1DA 3SPZA 4M2YA 5DBCA 4B9VA 2XO7A 1DTTA 3ZSVA 3SUPA 7ICIA 1S9FA 1Z00A 4DWIA 3RTVA 3NGDA 1WSFA 5KT6A 1FK9A 2BQUA 3C5GA 4JV0A 3GQCA 5DQGA 5KFYA 4LVSA 5KG7A 4KHNA 4DTPA 4EP4A 2GWSA 4I9LA 2FLLA 1SKSA 1VSFA 4I2JA 3JYTA 4FM1A 4DSIA 4O3RA 3WNEA 1ZBIA 4YMMA 4KTQA 3LWMA 3RB0A 4CHNA 3T5KA 4EYIB 4M3YA 3OYIA 4FLZA 1NK0A 4NCBA 5L1KA 5J2HA 4R66A 2C22A 4DL7A 3HK2A 4DTRA 3QE9Y 4LY7A 4RG8A 3IG1A 2BPGA 5KFSA 1TVRA 1JX4A 2WONA 4M3ZA 3NF8A 1ITGA 4BWJA 3JPSA 2HMIA 1NJWA 3QEWA 2RDJA 3RJEA 3ORYA 2JEGA 1NK9A 2OZSA 1T4GA 4FJHA 1N5YA 4DL4A 2FBVA 3B0XA 1LW2A 1FKPA 2RN2A 8ICWA 3QO9A 1C0MA 3B0YA 1XSLA 1JMSA 5J1EA 3NH1A 3AVGA 2PYLA 4FJ5A 4YVZA 4CEAA 1LV5A 2X6NA 4P4OA 4JK1A 5HMLA 4Q8FA 1C7YA 1S76D 4CESA 4M9HA 4O3OA 4J9SA 3PMLA 4O5BA 3ZSXA 3B6OA 3AUOA 1I39A 1TL3A 3C94A 1MQ2A 4DL6A 4FJMA 1X9WA 5DGAA 3AVCA 3TAMA 1W9HA 3PX4A 3RB6A 3E2EA 3T1AA 7ICGA 1T03A 2G8WA 3HWTA 7ICOA 2BDPA 1K1QA 3OSPA 2J6SA 3SZ2A 8ICNA 2NRTA 1WSGA 1A77A 2C2EA 2IOCA 4QCLA 1XO1A 1EP4A 4PQUA 3PX0A 4KLUA 4B8CA 4M6WA 4PH5A 4KMUA 2VG6A 2O4GA 4QWCA 4ECZA 3ZDAA 2DFEA 4JLHA 4CJEA 4CJUA 2I1QA 1RILA 3ZSWA 1Y88A 1RBTA 2P66A 2R8IA 4GW6A 8ICMA 4I2QA 4DTOA 3DOLA 2PY5A 1ZQTA 3MR5A 3MECA 4CJLA 4J9KA 1KVBA 4Q0BA 4J9QA 3DI6A 1ZQNA 2R8HA 4FS2A 3G10A 3QESA 1BVSA 1RPLA 4UQGA 3OYDA 4GMJB 3GILA 4UB4A 1VRUA 2F1HA 1QSLA 3OYMA 2PFQA 1S6QA 1ZQQA 5KFRA 5L9XA 1LWEA 3RB4A 4Z4HA 4I2EA 4CFCA 3L8BA 4J9MA 4FBUA 1KLNA 2B5JA 4JS5A 1WCLA 4LD0A 4KLFA 1NK7A 4FO6A 4EYHB 9ICTA 3CM6A 3VQCA 3V1QA 2ASJA 3DLEA 5DB8A 1S1TA 1BI4B 1S10A 1ZQMA 3DMJA 5J2GA 5KG6A 3V9XA 5DLGA 2C28A 3LP0A 1T3NA 3GV7B 3AVHA 2A1JB 2LYHA 2I9GA 2AU0A 3QZ8A 4UB1A 3RJKA 1H38A 3PW2A 3HPOA 4DFJA 3ETLA 4Z6CA 3AU2A 3HT3A 1JXBA 5J2MA 4PWDA 1ZQKA 2E6LA 4DF8A 5EWFA 3V6JA 1U48A 2XCAA 4DL5A 4M3TA 3EWAA 3PW7A 3KLHA 1JLAA 3DLKA 4YCXA 1IH7A 4BDZA 4IQWA 2OPSA 4FK0A 4KKOA 4DTXA 3MBYA 4FLYA 5KRSA 3V6KA 3S9HA 3VQBA 4CGDA 3OHBA 1ZBUA 2C2DA 1BIUA 3QLHA 3ZCMA 5HRPA 5J29A 1TVAA 4P4MA 3BDPA 1RT3A 4M41A 2V4RA 8ICRA 4KI4A 5KFTA 3VQ4A 4MEXA 2W9BA 1D5AA 4KLLA 3V72A 9ICEA 4G1QA 3C2LA 9ICVA 2XY8A 1J54A 4CHOA 4CIFA 5HP1A 3K5NA 4FZYA 2AQ0A 2XY7A 4DOCA 4DSFA 4DTUA 4C8KA 3AVAA 4CF8A 4YXMA 4UBCA 4ED0A 1DTQA 5KG3A 1NKEA 4KHUA 2JZBB 4QZIA 9ICUA 1BL3A 3L2VA 1KEJA 1N56A 2DFHA 3UXOA 2QXFA 2E6MA 5IIOA 1ZQPA 4PY5A 3KD5E 3KKSA 1TK0A 4TURA 8ICSA 1RT2A 3EZ5A 1BPDA 4DTMA 2VWKA 1ZBFA 2KZMA 4DF4A 5D49A 3SPYA 3K4GA 3VQ5A 4RQ8A 4AHVA 2MUTB 2DY4A 3MGHA 4QZFA 4HYKA 1ZQEA 1S0VA 4DQPA 2IDOA 1T05A 4JRQA 1Z26A 1UT8A 3RJFA 4R8UA 2BCQA 4P2HA 4ECVA 4RNMA 5IIMA 2ASLA 5I3UA 3CFOA 1TFRA 4KN7A 4CGIA 1A5VA 7ICTA 1X9SA 1S77D 2P5GA 4PHDA 4ELVA 4E19A 2VA3A 2KW4A 3TAFA 2FBYA 3NFAA 4FW2A 3RH4A 5J0OA 2BHNA 3UPQA 3OS1A 4IBNA 2IHNA 2ATLA 1B43A 3PX6A 4DTSA 1D8LA 3C1YA 5DG7A 1RT1A 4NM2A 5DGBA 4ZHRA 3THVA 4KLOA 3AVJA 3LPUA 1ZQUA 1HUOA 2JEIA 4EP5A 4RNNA 1CUKA 3RB3A 4RQ7A 3V9ZA 3H40A 1RDBA 3SQ4A 1SV5A 1IO2A 3G0ZA 1A76A 4FYDA 2AGQA 4O4GA 1QS4A 5KFWA 1UA0A 2P1JA 3T3FA 3LP1A 3VN5A 2QKKA 2DFLA 1ZJNA 1ZETA 1IKWA 1WLJA 4LZGA 1PZNA 3P1GA 3NBPA 2D0AA 3QNNA 2W9MA 4N76A 4RW6A 1Q9YA 4JWNA 2ZJ8A 5KFOA 1WN7A 3OVNA 5CY4A 1WSIA 2ZUBA 4FM0A 1NJYA 3IHQB 4Q43A 3CFRA 2HHUA 4M9LA 4OJRA 2HHVA 4IFVA 4AHSA 5EWEA 3RBEA 1WAFA 5JS2A 3JPQA 3PVXA 3ZDBA 4DQRA 2UVRA 3ZSYA 1BPEA 3MDAA 4ED7A 4MF2A 3AVLA 4N5SA 2FMPA 3K5OA 4CJ4A 2D0CA 3K59A 2P6RA 3L2UA 3EPGA 3ZDDA 3BQ2A 2IC3A 7ICFA 3HXMA 3LDSA 3RMAA 4HTUA 5HRRA 3RRGA 1S9EA 3NE6A 1ZQRA 3AO3A 3LAKA 3KIOA 1RZTA 1UOCA 3PR4A 4DS4A 4FLTA 1DGSA 3RJHA 1U9LA 2B21A 5KFFA 5J2QA 1RXVA 5KFKA 1TK8A 3DRPA 2BCUA 3DLBA 2ZQBA 5DMRA 3TI0A 2ATQA 3HYFA 4P4PA 2IS3A 4IRKA 4BE2A 7ICQA 4FVMA 2NUBA 3TQ1A 3RAXA 8ICTA 2PFOA 3QIOA 4W5RA 2XC9A 4QZBA 2HVHA 2FMSA 1TL1A 4ZTFA 4NM1A 9ICJA 1BCOA 3ISBA 1VSMA 5KG1A 4Z4CA 2O4IA 1WSJA 1JLQA 1IKYA 5KFGA 4GC7A 1C0UA 5KFPA 4B9SA 2FPKA 3JPRA 3E01A 7ICJA 4GLXA 2R8JA 1KTQA 1BPZA 5J2CA 3WNGA 3ZT3A 4YQWA 5J0XA 3MXMA 4F4YA 4OPJA 4QWEA 5DQHA 3GIIA 1SUQA 4O44A 4RUAA 5KFVA 4FJ8A 2HHSA 3SV4A 5I42A 4DSKA 3H8JA 5J2FA 3ZDEA 1RYRA 5IIKA 3TABA 5EU7A 1KLMA 1T8EA 3SUNA 1BQMA 4KV8A 2F1IA 4ED3A 3OYEA 3CYMA 3CM5A 2YNFA 3H4DA 1MQ3A 2BR0A 3ZT0A 5J0SA 2JGUA 4H8KA 5J2PA 4QZ9A 4J2AA 3JPTA 2IMWP 3TARA 3SUOA 4CEOA 3AVFA 4PPXA 3ISDA 4RT3A 4KHYA 3HM9A 4B8AB 3ZDCA 5K14A 3QEBZ 2BGGA 1EXNA 4CFAA 3LAMA 3RJGA 4I2GA 2W9CB 3UXNA 5KFXA 3NAEA 3JPOA 4K4GA 1VSDA 1TV9A 3V81A 3C5FA 5L1IA 1HYVA 1RCHA 4F2SA 4F91B 1D9FA 4I28A 1L3UA 4YR2A 3VQAA 1B9DA 3V6DA 4Q5VA 2VA2A 4DEZA 3OJUA 3O3HA 3MXJA 4MQ3A 1UA1A 3L3UA 4IDKA 4DOAA 1VSIA 4KLGA 3TANA 1RTHA 1ZBHA 1RT6A 2ZTDA 3KKRA 4H4MA 1B92A 4KLJA 5DB7A 2XHBA 4CEBA 5E41A 2GV9A 5D3GA 2G8FA 4RUCA 3VQEA 2IBKA 4PHEA 4RQ6A 3V1RA 5C24A 4C8MA 4KLMA 5DDMA 1TAQA 4PHPA 1CEZA 5KFMA 3IAYA 4KHWA 3WNFA 4E7KA 4XUSA 3KLEA 3OYKA 3HW8A 2R7YA 3TFRA 1J53A 2QKBA 3OYJA 2KFZA 4NYFA 1S0MA 3KTQA 4OKJA 1YT3A 1DLOA 2YNIA 2ZJAA 4PGYA 1EXQA 4ICLA 4RQ5A 4CCHA 4HUGA 1HMVA 3DOKA 2G8VA 4DSJA 4F8RA 4Q8EA 4LZDA 3IRXA 3BGRA 3AO1A 4ED1A 3RR7A 2R8KA 4GC6A 3TAQA 4W5TA 4J2EA 4DSLA 3AA3A 2W9AA 3QEIA 3AVNA 4QOZB 1JXEA 3AVIA 3GDXA 4KLQA 2Z1JA 1U04A 4EZ6A 3MFHA 9ICQA 5IINA 3TAPA 1I3AA 4B9NA 3M9MB 3QEPA 4QZEA 1YVUA 5KTQA 1RBUA 4CEDA 4NLGA 4EEYA 3NCIA 2A1JA 5KT4A 4FJ7A 4NLNA 2KTQA 4XIUA 1XS9D 9ICGA 4K8XA 4W5QA 2BCVA 2V4QA 4YXJA 2XCPA 5DQIA 3D45A 3HSTB 1WSEA 5FDLA 3SI8A 5C25A 2RPIA 1KFDA 4H4OA 1TKZA 3Q8KA 1Z00B 4WE1A 1ZBLA 3PR5B 3Q8QB 4J9OA 8ICFA 1WSHA 2BCSA 4RZRA 2VA8A 4MFBA 4EBCA 4MFFA 4FJXA 3UQ2A 4I2BA 4CGFA 5J2BA 2B4JA 2PI5A 5J0UA 4CF9A 4GXIA 5DBAA 4B9LA 1ZQIA 8ICHA 3ZD8A 3RH6A 4F50A 5CHGA 3C95A 1WCNA 3RBDA 9ICKA 3DLGA 4KLTA 4E7JA 1V9PA 4Z6FA 5EOZA 4IR9A 1Y97A 1GOBA 4M04A 2EHGA 4RW4A 3M8PA 1REVA 1CXUA 4YNQA 5SWMA 2JZBA 4KTWA 1CLQA 3K75D 1UWBA 1RTJA 4O5KA 1RTDA 4KTZA 4CIGA 3AVKA 3LALA 1HNIA 4KLIA 3KHGA 1TGOA 1K6YA 4AHRA 4HHTA 3VQ8A 2QK9A 2FBXA 8ICXA 1JN3A 4RPZA 4KLSA 5CB1A 3A2FA 5J2NA 5HNKA 1XHZA 1WAJA 3GFKB 2MUTA 4DQSA 3AO2A 2PYJA 1U45A 5KT5A 9ICCA 1ASUA 4Z4EA 2F8TA 4CGJA 2BKEA 1NJXA 4G3IA 1XHXA 1ZQVA 2ZUDA 2BQ3A 1KVAA 4CJSA 3TWHA 2HVIA 4I2PA 3RWUA 4FK4A 2FMQA 4HUFA 4CIEA 4M3UA 1IG9A 4MEYA 4N56A 1RDDA 3OHAA 9ICXA 3O4QA 1ASVA 5SZTA 2PZSA 4M45A 5CZ1A 2HNZA 4M6WB 2W42A 5DB9A 4CJKA 3I8DA 4CJRA 1HPZA 4E0DA 4EBDA 3HVTA 1NOZA 4DO9A 3PV8A 5KGXA 9ICAA 4CJQA 3ZD9A 1KFSA 4AH9A 4NLKA 3OGUA 1IKVA 3O3GA 3OJSA 5EWGA 1HNVA 8ICOA 4FJNA 4KHSA 4KLDA 3OS2A 1TK5A 3UIQA 4RQ1A 3U3GA 3QIPA 1JLGA 3NDKA 1UT5A 5CR0A 4O5CA 4CGHA 1JLCA 3KD1E 1D8YA 5KFNA 3S3MA 7ICVA 1RBRA 4YFUA 5IILA 3OYAA 8ICUA 3V4IA 4FJIA 1X9MA 2M9NA 3HO1A 4DMNA 3V7LA 1NK8A 1S1XA 4TQRA 3S3NA 1KSPA 3F73A 1VSHA 4UAYA 4E7IA 1U4BA 5KFIA 3GV5B 4RQ2A 3MAQA 2EX3A 5HHIA 2KQ2A 3VA0A 4Z4IA 4JWMA 4YP3A 3HP6A 4KREA 4J2BA 4TUSA 3MR2A 3P5JA 5FROA 4YD2A 4DLEA 4CF2A 2XGQA 3IS9A 3Q8SB 3CQ8A 2BANA 4J9LA 3HL8A 2F8SA 3H4BA 3T5HA 4UB3A 3PO5A 3H8SA 5DKWA 5DG8A 3ISCA 2WOMA 3AVMA 4RPXA 4M3XA 3HVRA 3V6HA 4I2IA 5KRTA 4IRCA 2DPIA 3TAGA 4KN4A 4NXZA 2FLPA 1QSYA 3C2MA 3M8RA 2Q3SA 4ID5A 3QNOA 3S3OA 3DLRA 3D0PA 2E4LA 5KFDA 4C8OA 3KK1A 1U49A 4ECSA 4CF0A 8ICGA 2W8KA 3MEEA 3LP3A 3P83D 3U6FA 1TV6A 4FLVA 5J0WA 1QE1A 4BGDA 3PNCA 2GBZA 2RF2A 2W9BB 5BOMA 2YV0X 4O55A 1NKCA 3N97B 4FK2A 1T7PA 3LPTA 1COOA 3BQ1A 2XY6A 4RNOA 4GXJA 5TZVA 4F4ZA 1UAXA 4KHQA 3Q8LA 3UXPA 1VK0A 3VQQA 3ZSRA 4YD1A 1WNSA 5T7BA 1SKRA 1L5UA 4NLZA 1LAWA 5KFJA 1QTMA 1IM4A 4FJ9A 3ALYA 1N6QA 3OYNA 2WTFA 4CJPA 3V9WA 1VRTA 2PI4A 5KFEA 1NJZA 2BQRA 2B6AA 1ZYQA 3G6YA 1SL2A 3G6VA 3TR8A 1C1CA 3AA4A 2D0BA 3ZSQA 3L2QA 3OYGA 4R8UB 3Q8MA 5J0YA 3Q8RB 4M9JA 4MFCA 2W9CA 4DS5A 5DDYA 1Z3EB 1G15A 3HPGA 3ZSZA 3T5LA 1AROP 1X1PA 1SKWA 1LAVA 1ZQHA 1SL0A 2GUIA 5JS1A 1RBSA 5C5JA 4E7HA 3WNHA 3BJYA 1NK5A 2YKMA 3VA3A 1L3SA 5HRSA 4OKEA 3SI6A 1SZPA 3NH2A 1A5XA 1HUZA 3LWLA 5KFCA 8ICPA 5KFHA 2KZZA 4QZ8A 4DU1A 4B9MA 4DFKA 1CZ9A 4DQIA 4PHAA 2NRXA 4NYNA 4QAGA 2IGIA 4QW8A 1YTUA 4BXOB 4F5RA 2HHTA 4FLWA 1HYZA 1RT4A 8ICIA 3AV9A 4UAZA 3EW9A 4CJTA 2Z1GA 4PUOA 2NRVA 7ICSA 3KHRA 3SNNA 1XC9A 3QINA 2FC0A 9ICBA 4ELUA 4C8LA 2ZTEA 5J2KA 4RU9A 1HJPA 5KFUA 1LWCA 4F92B 5J0TA 4XA5A 3TFSA 4NY8A 4ED6A 4W5NA 4ECQA 4BACA 3G6XA 1JLFA 1K1SA 1B9FA 4ECTA 2ALZA 4F5NA 5F9NA 3LZIA 2RDIA 4KRFA 4Z6DA 3FDSA 3OYFA 2OWOA 4M42A 3ITHA 3MR6A 3PW0A 1S0OA 5CP2A 2R8GA 2HHWA 3U3YA 5J2DA 1J9AA 4W5OA 1BPXA 1ZJMA 4CERA 3K57A 4HCBA 4RPYA 4K4HA 2BPFA 4NCAA 1VSLA 4F4XA 4OVLA 5CWRA 5IIJA 5J2EA 4F5PA 2X74A 1BQNA 4R63A 4KPYA 5DBBA 2KFNA 4CECA 1J5OA 4F93B 8ICBA 1C1BA 3EY1A 2JEFA 3MXIA 4BDYA 4TUQA 3PW4A 4FBTA 1ZQFA 2P51A 5J0PA 3RRHA 4QWAA 5KT7A 5HROA 4RQ4A 7ICRA 4QZAA 1GOCA 3H7IA 3RMBA 3ZSOA 4TSXA 4I7FA 5J2AA 1TKTA 3KK2A 4KLEA 4KI6A 2HB5A 3BQ0A 1L3VA 5KG5A 1BPBA 3H8WA 4CJ5A 4EBEA 3L2WA 4E89A 4YG2A 5KFBA 4O0IA 4CHZA 3M8SA 3C6UA 4CJWA 2KZ3A 7ICUA 8ICZA 2Y1IA 5KFZA 2PFNA 7ICHA 5KFAA 3EYZA 3IM1A 1EETA 4M3RA 4QW9A 4HCCA 3PW5A 1D9DA 2G8HA 1L3TA 4FLXA 3DM2A 5BPCA 2FPMA 1JL1A 1NOYA
chains in the Genus database with same CATH superfamily
2WB1C 2F9WA 2Q0UA 4USTA 3I76A 1EKEA 4NMXA 4AHCA 4ZPBA 3OTBA 1C1AA 1R0AB 4DN0A 1MWMA 4YMOA 4OIXA 4LRAA 2K60A 4QNLA 4WFZA 2D3O1 2E8PA 3HCXA 2DRDA 5LSLA 3BN4A 4YB1P 4RQ0A 3R5BA 4LF1A 4JI6K 4F5OA 3IR6B 1AYEA 2JJ4D 2D3UA 4NJ8A 4OLPA 3QUTA 3LUYA 3ZETB 4YDXA 5AQYA 2VGMA 2OANA 2OJ3A 2MKYA 2B6GA 5GMEA 5AJ3F 3V81B 3EDQB 2KT3A 3D6RA 2MTLA 3MR3A 1K8AO 2LEPA 5KGWA 2ZJPL 3SIPB 2VGNA 1S0NA 2M3DA 4DR1J 4LH4A 3QWUA 5ALJA 3U4LA 1LWFA 3W9JA 4IO9Q 1ASWA 5C0YA 4KR0B 4IDKB 2KHQA 1RGVA 3LM2A 5AK6A 3I1YA 1RT6B 1S6PA 1SH0A 4R5PA 2DWQA 3W65A 1BDGA 3JAMY 5ALIA 1DKGD 3GIMA 1KKXA 3I8BA 4WXOA 4KB1A 5AK5A 1YZ7A 1U1NA 3NVKA 1CSJA 1HD1A 4DDFA 1JXLA 1YJVA 5AKGA 1E6YA 3RR8A 4C2MA 3BR8A 4I67A 1FRIA 3RW6A 4Y2UA 4DV6K 4CLZA 3VGTA 2XLKA 1JIHA 3KUGA 3I0SA 4AHUA 1N5XA 2ZOFA 2HHHK 4HAIA 4ECRA 4MK9A 4QS9A 4EMDA 2PFPA 4IOAQ 1YLXA 3QU9A 4UB2A 1BUXA 1HLUA 4JKGA 3WXJA 3OYHA 2AIRB 3UMGA 2OYQA 1BPYA 3TADA 3DXMB 5KAIU 2MZ1A 2B43A 2OZMA 5CYMA 4H5TA 3WDOA 9ICOA 4L75A 3RJIA 2GHWA 3THWA 3ET6B 2HFZA 4JKDA 1XSNA 2KJ9A 1LKYA 3D54A 1PBUA 4UW2A 2KIWA 4HACB 3R1HA 3MC1A 3NP5A 3SBMA 4O3PA 5HMMA 3VTHA 4CK2A 2F96A 1F5AA 1X5TA 4NLDA 3NGYA 4Y2XA 1V3SA 4OI2A 4ECUA 1TL7B 1TL3B 1VLBA 4AXJA 1U2RA 5HP4A 1AQ6A 4OX9K 3O8WA 5B0CA 2W43A 1ZOTA 1VSEA 2HBLA 1ILYA 1WHWA 5L1LA 5LSOA 3AY9A 4PL8A 1XMQK 5AIAA 4TXSA 8ICJA 4MFBB 3UO0A 2RSQA 4FOEA 2W2MP 2MQLA 2A3VA 5CJ7A 4DPTA 1WDDA 2H54B 4FKYA 5JJBA 3AO4A 2N82B 5JVHL 3MM7A 4EFAC 2M4MA 5HBMA 2OKQA 1DK2A 1BHLA 3H0MB 4B1WB 2VG7A 3GJRB 2KXHA 2OPQA 4O3QA 2XWXA 4FZLA 5H9EK 1S1UA 2YH1A 4BGAA 2MAXA 1UVKA 1L3KA 2GFFA 1LWEB 3AAQA 1T95A 5AIBA 4RQ3A 3R5CA 3M1VA 4CJFA 5DK5A 4URSA 3B54A 2ITMA 3WQUA 4DQQA 3V9SA 2JEJA 4DLGA 3DLLQ 1FO4A 2AKWB 3GG1A 5D46A 4DV2F 2E3TA 3AGRA 3MMVA 4IDHA 3BKUA 3NCRA 1ZH5A 2KVIA 3D2EA 3DLEB 2GJFA 2NZTA 4ZP9A 9ICNA 4DUZK 1KCFA 3NRZA 4R65A 4IG3A 5K9FA 2ZZNA 1V97A 1SJ1A 1CVJA 4DSEA 5ALZA 2QMWA 1UWAA 3UCZP 3OYLA 4B9UA 2W2QP 4ETZA 4NEYA 5J2MB 4W4MA 3MCNA 4ZVGA 4KO0A 3W5ZA 2O8EB 4CBUA 2ZIVA 1EX4A 5LY3A 3ZZUA 4DUTA 1N36K 4IO8A 2FGOA 2HFVA 3L4IA 2H3IA 1T9XA 3A3OB 1HI0P 3OYCA 3C7NB 1JRPA 3MDCA 4FZNA 2OPSB 4OL8A 2VG5A 4NI2A 3B6BA 4FXVA 4ECWA 2EKNA 4A47A 3SQ2A 1BIZA 4TVAB 5HQ8A 4M63A 4DR4F 4K8ZA 1OPZA 4LJXA 2JOQA 5EDWA 1ZAVA 4E3SA 4AYBD 3EEQA 2YHBA 4XRHA 1A5WA 3FYHA 3HVTB 4IR1A 4G1QB 3AQPA 2PA3A 4QJFB 1CJTB 4HTIA 1V3RA 1AT1B 3LYSA 4L76A 1VQLN 4EIAA 1NK4A 4M9NA 1DTQB 4OYOA 2YQ3A 4RW7A 4CFDA 3GIKA 2YNGA 2N3OA 3AY0A 5ETOA 1QM9A 2BZ2A 2X51A 4O5EA 1XMOF 3PZPA 3LW5C 3QEVA 2F63A 2HFNA 3IFRA 4IOXA 4IS7A 1D8ZA 4F3TA 1RT2B 2CRLA 2EC0A 5AQNA 5A8RB 3MURP 3U1NA 4X62F 1MU2A 1MSWD 3BUZB 2LKZA 2IDEA 5CA7A 1TFYA 4EI2A 1HX1A 4CE9A 3RMCA 3EJMA 5IIIA 3PYGA 3RMDA 1DOQA 3HHEA 5C2CA 2BJ7A 1Q8IA 1LEOA 3LL3A 3RW7A 2JLEA 4BRCA 4FW1A 1CLFA 1GLCG 2ASMA 8ICLA 4DR6J 4GKJJ 3DHWC 4FJKA 3MMAB 1BE4A 2O8DB 3QRRA 4ZCLA 2QWMA 1HIYA 5HAOA 4WJBA 4OLAA 1U47A 5E84A 2VDHA 3CMAN 2HHXA 1HQUA 4C3KA 1WWVA 1O1WA 3ZT1A 4ID5B 2BX6A 4DJBA 4CF5A 3OR2B 3KK1B 3O80A 5ETPA 1SJRA 1UQVA 4HI2A 4CEQA 4IXCA 1FW6A 3LP1B 4RKUC 2G8IA 2MU2A 4HHHA 2Z1HA 1LW0A 3HKZF 2BCRA 4WPAA 1TYQA 3G87A 1F5SA 2ZE2A 5IS2A 3NKYA 1B0XA 5BR8K 1QVFR 4XK8C 4OZ5A 2UV8G 3UKRA 5AXLA 3NGIA 2HW3A 2XTJP 1NKBA 2XMKA 4DFMA 2YY3A 5FRMA 4AD6A 4DV1F 4Y6IA 1QDUB 2Y9TA 1JLEA 1U26A 1FA0A 3CCZA 2NSCA 2J6TA 1ZAXA 3V1OA 3ZO7A 1NLVA 4PYAA 2BOAA 4CD1A 2HQ3A 3KZXA 4NCGA 3N4MB 3KJVA 2ITGA 3KLVA 5D15A 1U6ZA 2W25A 2J7UA 2IC3B 3ENWA 1X6JA 3QEAZ 1Z6RA 2PFFB 4CO1A 2O01C 1J5EJ 4M9GA 2E8NA 5JTIA 2Y8WA 7ICKA 3GIJA 9ICHA 4URQU 2O8BB 3MEDA 5ALLA 3CF5Q 3CCJS 1RAJA 1EB0A 4DR2F 2XM3A 5J2QB 3SJHA 1NB2A 1D4XA 4F36A 3C6TA 4M3WA 5KI6A 3DRRA 4BWMA 4WIIA 4LF9K 4YDDB 1XC3A 1ZD3A 3G4SS 1KRPA 2Q3PA 5I3QA 1RNHA 1W7AA 4DV5J 2O1PA 2HI0A 4M2YA 3ISND 3O0FA 1N34K 1DTTA 2HURA 3ZXWA 3SUPA 1Z00A 4DWIA 1NU4A 3NGDA 3HHLC 4X4OA 3RSEB 1N5TA 2E2OA 2XNQA 1ZQ1C 1IJFB 2CPJA 1XUPO 5C12A 4HDHA 2B0CA 2JL9A 1WB9A 2WC9A 5AQHA 1SQGA 3SBGA 1I94J 5JICA 4JV5F 3TACB 3D68A 4I9LA 1RT4B 1O13A 2BZFA 4NL5A 3CCWA 3JYTA 4L3KA 3WNEA 4O44B 3P39A 4PUOB 5I42B 3CCJN 3KKFA 4WBFA 3RB0A 4BC5A 2H3EB 2V6AA 1RLDA 4FLZA 4D3GA 3D6TB 1BQMB 4KV8B 3EGVA 3P5TL 2NPIA 4R66A 2YQ0A 4Q2MA 4DL7A 3HK2A 5JRTA 2QJ3A 2RT3A 3IG1A 2D9OA 1M90T 1TVRA 1JX4A 2WONA 3MPVA 2HMIA 3R6MA 1NJWA 3KXDA 3D1OA 1BD6A 3EKSA 1EIYB 2OZSA 3Q8UA 4WP9A 2CJAA 3GLJA 3ZI4A 2LDYA 2FBVA 2A1AA 1LW2A 1FKPA 2RN2A 4FF2A 3ALRA 2KLAA 4USUA 4ALZA 1LXNA 4C11A 1C0MA 3AOBA 5EHHA 5AJ3J 1RHRB 2LFVA 4DV4F 3CJ3A 5HK4A 3LDLA 4K42A 4CEAA 3UW1A 4Q8FA 2ZFHA 3BSCA 4RBTA 4P9SA 3H2LA 2BJ3A 3VCBA 1V5IB 1I39A 2J9EA 1XNQF 2MB0B 4QIWF 2ZUGA 2P6TA 3CCQS 3E2EA 3C15A 3FZ2A 3T1AA 7ICGA 2QARB 7ICOA 2BBEA 4JK9A 3SZ2A 1U2VA 5C24B 4NXMF 1WSGA 4J7CA 2IOCA 4QCLA 3J81Y 2CNLB 3FGUA 4KMUA 1HWLA 2VG6A 5CEHA 1Y00A 4IOCL 4JLHA 4CJUA 2QIFA 3EO3A 1IBKK 3R97A 2P66A 4I2QA 4DTOA 1ZQTA 1Q82O 1UCVA 4Q0BA 1ZQNA 3QAUA 3OYDA 3CULA 3QUBA 5IT0A 3DJCA 3FQKA 3K8VA 3OYMA 2MGZB 4EGLA 1ZQQA 1B99A 1VGYA 4MIWA 2CQ4A 4A8WA 3MCMA 4FPRA 2A3ZA 4FBUA 4CDGA 4WU3A 5A6WA 4JS5A 2J5AA 4RUHA 3PCOB 5ETSA 1WCLA 4YHHK 5DJBA 3CCQN 3CM6A 3VQCA 4ES3A 3V1QA 3SCIE 1X7VA 4MYUA 1OH7A 1H74A 2XG8A 2Z57B 1FXDA 4FFDA 1I5OB 3PYDA 1U2CA 2CQPA 3CJAA 3H1QA 3RJKA 3PW2A 4Z6CA 1ZD5A 4BC9A 5FLXU 3GFXA 4PWDA 1PVRA 1ZQKA 2AZ3A 4C0BA 5AK4A 1YDLA 2XNRA 4GVBB 2KG5A 4DF8A 4FWQA 4NOHA 2XCAA 3C65A 1X4HA 1NSKL 1JLAA 3DLKA 4YCXA 1Q53A 3J80O 4MAKA 4KX5A 1NPPA 5AM2A 1KHWA 4DTXA 3MBYA 1CZAN 4FLYA 2Y8YA 4GO5X 3S9HA 2V51B 3OHBA 3RG6A 1SC1B 2FD2A 6FD1A 2M5YA 3QLHA 2HLTA 3Q8YA 5AKKA 1UVJA 1YWXA 1P9YA 1RT3A 2R7SA 2V4RA 1F60B 2PA8D 3VVTA 2MMYA 3U1MA 3VQ4A 1OWXA 3CQYA 2CRXA 3DLGB 4R25A 1J54A 2XY8A 2WVEA 3CEDA 3KMQA 3PTWA 2P5VA 2AQ0A 2KKZA 2DO0A 1VC6A 3AVAA 1X4GA 2CJYB 2W3RA 2YWWA 2JZBB 2ZH1A 1EQYA 2WCXA 3BKTA 4DV2J 3T7ZA 1RTDB 2HSEB 2V8VA 4K4SA 1BQXA 3L2VA 1NGEA 4IUFA 2IIRA 4DV5K 2KH9A 2V68A 2P9GA 1HNIB 1HBMB 2IOHA 2GJ2A 2E6MA 4DV3F 1CBKA 4PY5A 1A6LA 3KKSA 4CM2A 4QYZJ 1BPDA 3CI5A 5D0EA 4DF4A 4ZLJA 3E0FA 3VQ5A 3CWJA 3VAHA 2N1RA 5IFMA 4AHVA 3MK6A 2FJBB 4G65A 3W66A 2DY4A 1S57A 5D8HB 2RP5A 3CIPA 1ZQEA 1SV0C 1S0VA 3VEYA 4ICAA 1U1QA 4DQPA 1WUAA 2RB7A 1M5HA 3RVCA 2JC0A 5DM7Q 1VK8A 1UT8A 2VQEF 2ZWHA 2I0XA 1GTHA 5FLXY 4QJVA 3K0JA 3H2UB 1N60A 1Q81T 1TFRA 4KN7A 1ED1A 3OL8A 3J7YU 4C0HA 1A5VA 5LXRA 2CJKA 1X9SA 5BYSA 4I64A 3DXKB 2P5GA 2QWRA 4ELVA 3C2PA 5J1NA 2KW4A 4CZIA 2MSNA 4DR4J 1SAZA 3RH4A 2ZXHA 4DG1B 3R1XA 2DHGA 3OS1A 4IBNA 3OQ2A 3JTNA 2ALYB 1FIQA 1KL9A 2PMZC 4DTSA 1D8LA 1Z4UA 5DG7A 5CHCB 4O8UA 1YG0A 5EX5A 2QN6B 4PZOA 4ZHRA 1OVQA 4KLOA 4FDFA 2ZIUA 2JEIA 2HVEA 4EP5A 3RB3A 3H40A 3MWPA 1SV5A 2H65B 4RWWA 2GUPA 4RQNA 1QS4A 1WWHA 2L9DA 2CXEA 2QRRA 3THYB 1ZETA 5HATA 3J7AP 5D4OA 1PZNA 2C2ZB 4YORA 4DFDA 3QFPA 3KK3B 3NBPA 2D0AA 2QB0A 2BRKA 1DQAA 3W2WB 1XMOJ 1CPZA 1Q9YA 1K73O 1RCXB 3BGFA 3EWGA 1WSIA 2ZUBA 3I6PA 4RW9B 1XNRK 4Q43A 3CFRA 4IFVA 2GX9A 4X62J 1JJ4A 4AHSA 2UUWA 3FBCA 5EWEA 3RBEA 4HTJA 3JPQA 3ZDBA 1T6DA 3UMBA 1YI2S 4CDIA 4WF9Q 2VQFK 1CS4A 4N5SA 2VOPA 3HSJA 5GIPA 2MJNA 2B9EA 1MN9A 1PUZA 4M5KA 3QBWA 3H7HB 4P0QA 2BE2B 3VAJA 2GVDA 4ZP6A 2DHXA 2Q1NA 4NE9C 3RMAA 1UW9A 3OVBA 4LSNB 2QGFB 2DH9A 5A8WB 1ZQRA 1YSJA 3N01A 1FD8A 1UOCA 3PR4A 4ZJQA 5CE3A 3KLIB 4MT1A 3IA0A 1WJ9A 5K8NA 1RXVA 1RADB 1YTYA 1VBXA 2HBKA 3WC0A 2VODA 3ZTSA 5D77A 2V2QA 4P10A 1GXUA 4OYIA 4URGA 4P4PA 4B6JA 1QAYA 2RD5C 4IRKA 4BE2A 4US9A 4FVMA 2KEYA 4MKVA 3MEEB 3ETMA 2HOQA 1VI7A 3RAXA 3JQJA 1HNXF 1UVNA 3A5OC 2XC9A 4ACOA 2RAQA 2FMSA 2RF2B 3M6ZA 4FYYB 1S8OA 3ISBA 2W7OA 4Z4CA 1PYTA 5AQUA 1VQ6S 1N62A 1K8KB 3O44A 5KFGA 1C0UA 4LF5F 4B9SA 4DBQA 1U1LA 2PMWA 3A0IX 4GLXA 3DRSB 1KTQA 2MQOA 1S22A 4NLPA 3WNGA 4A8XA 4OHWA 3MXMA 3IG8A 5ALDA 1RHUB 3K7RA 4DV1J 2F8HA 3GIIA 4NZ6A 4FJ8A 2EFOA 3W2VB 1RYRA 3KMSA 1ZM9A 3TABA 1JCGA 3G8SA 3UQSA 3SUNA 5TKWA 4OHZA 1PC5A 2BR0A 2OGUA 2I6WA 2H3QA 2JGUA 3WK6A 2KXFA 2IMWP 4BRGA 3TARA 3WKAA 2B6AB 4M5NA 3N0VA 4Q2LA 4CEOA 3OTOK 4TYBA 3AVFA 3SUOA 4KHYA 4RT3A 2YX4A 2R9LA 4B8AB 3M6XA 1VQ6N 1EXNA 4PKDB 3HBTA 4DR2J 3LAMA 2ZC4A 1IUJA 3NAEA 4CYUB 3JPOA 5IC6B 3CJKB 2CPXA 1UEVA 3PYFA 2HIYA 3CCUN 3C5FA 5L1IA 1HYVA 2UUAK 4F2SA 3HZEA 3TRGA 3TX8A 4PZNA 4YR2A 2VA2A 4DEZA 5HR7A 2YWGA 4WZQA 2W3SA 1VSIA 2NZ4A 3TANA 2DBBA 4BQZA 4U95A 2DGUA 3ENBA 4ANCA 4BVOA 2LECA 2XHBA 1SB6A 3WXIA 3J7YP 2V4JA 5E41A 4C1NK 2K8BB 3FNNA 2G8FA 2IBKA 2ROPA 4JV5J 1SC4B 3UDCA 3C19A 2NLWA 2MY7A 2VJ5A 2CQIA 5M1NA 3AOCA 2BV3A 2RILA 3KLGB 5LJ3Y 3W0LA 2UUCF 4XUSA 2JGAA 3OYKA 3G6EN 3U8XA 3PKYA 1C4AA 2QKBA 4JHDA 4NYFA 3KTQA 2YNIA 2ZJAA 4PGYA 2W1BA 2HZAA 5DM6Q 3SQIA 1CJKA 1HMVA 3WK8A 4C0OC 4DSJA 4F8RA 4Q8EA 3I87A 3BGRA 1XMBA 3PYEA 2AJ4A 1U09A 2B8PA 2VFTA 1UZDA 3TAQA 2YWHA 4B17A 4DPXA 2BUNA 2W9AA 3G8QA 3NVMA 2B7CB 1KW4A 3AVIA 3FR0A 2MHNA 5LMUF 4KLQA 4EZ6A 2F9DA 9ICQA 3TAPA 5ETNA 3R8YA 3QEPA 4DZ6A 3C3LA 4O4RA 2E9RX 3N4PA 4DV4J 2KJ5A 3A0HU 1RBUA 1SV0A 3F5AA 3NCIA 2A1JA 5CRXA 2B4OA 3K9JA 2O5DA 4FJ7A 4OV1A 1NO8A 3D2QA 4W5QA 3KWGA 2BCVA 4AXIA 1XNQJ 4KE5A 4TKTA 3BR9A 3HSTB 1ECWA 1WSEA 3SI8A 4H4OA 1KFDA 2IYGA 1TKZA 3Q8KA 3R2DJ 1TKTB 1F3VA 4QR0A 4WE1A 2OP5A 4JKBA 2XYGB 4X62K 1FK9B 2VFUA 1CQNA 3OPXA 3OA9A 3AGKA 4NXMJ 2K3IA 4A61A 3B9JA 1RISA 2CNOB 2WVDA 4DX6A 4YDUC 2ZIXA 1G99A 3LO3A 4CGFA 3EICA 5J2BA 1Y9OA 2W54A 4X4TA 2PO4A 3I56S 2JV3A 4JKAA 1U8SA 3H46O 4GXIA 5DBAA 4B9LA 1UFWA 1XQSC 2CVEA 2HBRB 1QAIA 1HPMA 4LVOP 5DZ7A 4AM7A 1UPPA 2PN6A 9ICKA 4QIFA 3THPA 4E7JA 1N32K 1D3WA 4IR9A 1Y97A 3D1QA 2QLBB 3M8PA 4IQMA 1REVA 2EG2A 2BM0A 1CXUA 2JLGA 4YNQA 2WVCA 2VASA 4ILRA 4KTWA 1ESVA 1SIWB 3K75D 3VQSA 1RTJA 4LT6A 4PXCA 4Y28C 4CO4A 1VQ8S 1QAXA 3MDFA 2B9WA 5MLCV 2IRYA 2IY5B 3HF5A 1TGOA 5MLCQ 2PGCA 5F3TA 4LSZB 1F5CA 1VQKS 1K6YA 4AHRA 4HHTA 2FBXA 2G0AA 2E1RA 3H90A 5J2NA 2E9ZA 1GLBG 4J9VA 1WNEA 4E8UA 2VKRA 4DQSA 4L73A 3M8WA 3C6AA 1BC6A 3PSTA 4RQMA 1ASUA 3C0BA 1V6HA 3MMCA 3C8YA 2IMOA 1R31A 4DV1K 3AJDA 1LWFB 3W3DA 2ZUDA 4L3QA 1KVJA 4G9BA 1KVAA 3TWHA 3E3XA 4I2PA 1KR4A 3AMZA 2FMQA 3GYNA 3TAMB 4R5PB 2E5HA 3MM9A 4N56A 5EE0A 3BF4A 1XQIA 2F44A 4JI5F 1ULRA 2VHGA 1RDDA 1IG8A 2HQFA 4ZPDA 4KQZA 3OHAA 2EFPA 3O4QA 1ASVA 2Y9UA 1SCJB 1VQ8N 4UQTA 2EC2A 2AHOB 3C28A 3BZQA 2PZSA 3M2VB 4P71A 4M6WB 2QSWA 4C80A 1W7WA 5HI7A 3FCWA 3I8DA 5CZXA 1UP1A 4EBDA 3NGRA 3GG4A 3I0SB 1FFGB 4H5NA 1KFSA 2BJ8A 1R59O 3OGUA 4JI7F 3OL9A 1IKVA 3O3GA 3OJSA 1HNVA 3DI6B 4JKGB 4KLDA 3UIQA 2ZH4A 4KGKA 4YOTA 3UVJB 4H54A 1F9FA 1JLCA 5J8YA 2IJRA 4YFUA 5IILA 4D3HA 2LU2A 4C48A 4DV3J 4PAAA 1PAEX 3FQLA 2QE5A 2QZ8A 3M8YA 1LOTB 3V7LA 1S1XA 3EVMA 1SJFA 4TQRA 1LKYB 3S3NA 2PMZF 1VSHA 5LJWA 1HEKA 3GV5B 5CR4A 4RQ2A 2EX3A 1MNEA 2JWLA 2CQ2A 5F2RA 1F3FA 4HEA9 3F56A 1UJ4A 3MR2A 4X84A 3WK9A 4C8ZA 2OAUA 3VGSA 3DDHA 2FJEB 3BH6B 4F0HA 2QTDA 4DPUA 6AT1B 2VQEJ 2BANA 2XLIA 2K1RA 4ES2A 4X64K 3PO5A 5DKWA 2E1ZA 2W2PP 5DG8A 3VWSA 4RPXA 4JI3K 4RX6A 2ACMA 5KRTA 2DUYA 4LQ3A 2WBNA 4IRCA 4KN4A 1IVZA 3E66A 1QSYA 2FSNA 3PFOA 1KBUA 1W2IA 3HHNB 3D0PA 2W24A 2E5SA 3GFYA 4C8OA 3C66A 3IP0A 5K5MA 1U49A 4ECSA 2HS4A 2W8KA 3MM7B 3LP3A 1TV6A 5J0WA 4ZLPA 4WTYA 4BGDA 2WHOA 1Q3VA 4DB3A 4WFXA 4CLYA 2HLUA 5BOMA 2YV0X 4AP9A 2EFGA 1NKCA 3N97B 3M1VB 2Y3YA 2O8FA 1KAYA 5AQZA 4BX9C 3OV7A 4RNOA 3ZNJ1 3DEEA 5TZVA 4F4ZA 1UAXA 4P7VA 3TTFA 1VK0A 3D2EB 3VQQA 1H7XA 2CQ1A 4OHXA 3FMBA 1VK3A 3D2WA 2H5JB 1WNSA 2CH5A 1KBRA 2G2YA 5T7BA 1L5UA 4NLZA 1LAWA 1QTMA 3B8HA 2AF6A 4IG3B 1IM4A 2VONA 4M5JA 4EU0A 2LEAA 5AQOA 1JI7A 5GINA 5LT5A 2WTFA 3PIPL 3LA0A 1NBWA 1RM6C 4U6PA 4A8FA 5LJ5Y 5KFEA 1HNZF 2BJDA 2GS8A 4MK8A 3V4MA 2E7VA 1ZYQA 2YKAA 3G6YA 5E2QA 4CH7A 1HWJA 4DU8A 3ZSQA 2ZG6A 3R5DA 2MLYA 3L2QA 3CDEA 3Q8MA 1FTRA 1Q5YA 5J0YA 4H0TB 3Q8RB 2RDDA 2W9CA 2FZGB 5DDYA 1Z3EB 2JXJA 5FPNA 1Y3JA 4P2MA 2RS8A 5KNIA 3QJLA 2HDOA 1YF5L 1WHYA 1SKWA 3ENQA 1KN6A 4PG4A 1HNXJ 2DR6A 1L3SA 1QY7A 1TUWA 1S6OA 1RQNA 2GGPA 4H5RA 3LWLA 9ATCB 3NH2A 2B9YA 2DR9A 5B66U 5KFHA 4CBWA 3EXYA 2XMAA 2DNRA 4DU1A 4DFKA 1WOOA 2NRXA 2QO3A 4O4GB 2YXLA 4NYNA 1R8PA 4QAGA 4LF5J 1YTUA 4GKKK 3PNIA 1IKWB 5JLHA 3W3SA 2ZOGA 3AV9A 3CJRA 4ZLLA 3G96A 2FJXA 3S41A 1MROA 2NRVA 3CPWR 1XC9A 4RW6B 5ETKA 1U8WA 3UNGC 4PYDA 2LDIA 2FC0A 4ELUA 4C8LA 1LKZA 2I8EA 1D8BA 4CZFA 1HJPA 3QXGA 5J0TA 2VYPA 2FXUA 2UU9K 4RWXA 4HR2A 2ODGA 4XH5A 4ECQA 5HR6A 3GCXP 1U0HB 2K7JA 1L8OA 3GJSB 3CDUA 4F5NA 3EE8A 5AQQA 3PHEA 5IZHA 3ZZ0A 2DKXA 3OYFA 2XZTB 5ALPA 5IT9U 3Q22A 2QT7A 2DY9A 2R8GA 4QIWD 2HWIA 1XK8A 1VISA 4W5OA 1BPXA 1HNWK 1ZJMA 2LHTA 2KD1A 4RPYA 4HT7A 1VSLA 3VTIA 4Y2YA 1VC5A 2RU3A 5J2EA 4F5PA 2X74A 3NVYA 3L7UA 1HQUB 3DRPB 4CWBA 3AAPA 2KFNA 5F0UA 4CECA 1URJA 4YY3K 4F93B 1NEEA 4A2AA 1VBYA 4BDYA 4AYBC 4TUQA 2FIUA 2DJWA 3Q24A 2YMMA 4U7CA 3GB0A 1GOCA 4TSXA 3SQOP 3JXUA 2OTJS 3GG0A 2ZE2B 4CO5A 4CVNE 4KI6A 2YBVA 3BQ0A 5IV4A 1L3VA 4EO6A 2ILZA 3TSPA 3UKRB 3R1LA 2UUCJ 2AZ1A 5KFBA 1IIPA 4BHQA 2X1FA 4AFFA 4EX6A 4MKBA 3D67A 4CJWA 2KZ3A 5KFZA 2Z58B 2PFNA 5KFAA 4B1VA 1SUQB 3IM1A 1EETA 2HQDA 2QLFB 2AYBA 4Y0WA 2OD4A 4NCGB 3KJVB 3HHDA 2OPRA 5HJYA 1JJ2R 4K4ZA 1MC8A 4DV0F 4NZ0A 4K8RA 2LSNA 3IKMA 3VGMA 4N47A 2CWXA 3TA2A 9ICMA 2GELA 2MYFA 1T0TV 1L7MA 4C4TA 3MEDB 5LMUJ 4FZXC 2ZH8A 3TX0A 1BI4A 3MPWA 1N5SA 2OTJN 1S1VA 2WW8A 4IRDA 3KWIA 4USIA 4KPCA 4AUKA 2V9WA 1BLUA 3SLCA 2V94A 5IQQA 3C6TB 3JSMA 2FGCA 1Q9XA 4MFAA 5ALYA 1VIXA 3QT6A 3GP9A 3TEHB 3OVSA 1ZXIA 3N4WA 4AILC 1RABB 1DTTB 1C6VA 2EZXA 3OYBA 2JMGA 2NXJA 4NLQA 3V6DB 2E5LF 3OW2R 2ZWPA 4ZS6A 4NRUA 2VB6A 2ZJ5A 4DV7K 2B4VA 1WC3A 2AJQA 4KHPF 5L39A 4YR3A 4KH4A 2D4WA 2DKOB 2HBQB 4QWBA 2FVPA 5M2PA 4JI4K 1KDHA 3VHQA 4FP9A 5DDOC 1CXQA 5JLFA 2C2RA 4JS4A 2W4PA 5AE2A 3JYTB 3OUYB 1KD1O 1U24A 1T02A 2HMPA 3SEIA 3EMTA 4ILLA 1XWLA 8ICCA 1PYOB 3RH5A 1XIQA 3HP9A 3P31A 2CKWA 1HJRA 1N61A 1GLFO 2DH7A 1YJUA 4ED2A 3N7RC 5AKJA 1XU4A 3AAWB 2UVUA 4OI6A 3UNYA 4A48A 1HBOB 3NHGA 2X6SA 2WONB 2HEKA 3POTA 1N8RO 1WC5A 1HKAA 4C7YA 5AT1B 2M0NA 5BN9A 3Q8PB 2HMIB 2ES6A 4MMOA 2JRSA 4WWSA 4UAWA 2AGOA 3A1YG 3A3PB 4KFBA 1HNXK 1FKAF 1NGCA 4FWNA 4WQ4A 5AQSA 1LW2B 2DXEA 1RFQA 4WKYA 4YS2A 4FE3A 4C11B 3W7BA 5IWAF 3PG9A 7ICNA 4A8OA 3K58A 3EX7B 3T79A 2KKHA 4DXLA 2PDAA 2W04A 1RAIB 4DFPA 3RJJA 2P9LA 3QU5A 3ISNC 3ULDA 3HZ6A 1RAGB 2JZ5A 2FHKA 2Q97A 2JNJA 2AQ4A 3AA2A 1RKIA 3W5YA 3GTYX 3TZYA 3T19A 1F0XA 5TKYA 3OY9A 4U7BA 3C15B 2BTFA 3F2KA 4DL3A 3MFIA 3A4TA 3JTPA 5KFLA 1GH8A 4JI5J 1ZQBA 1RT7A 2GMHA 4CRJA 1OUQA 1U2VB 2H3FA 3IBFB 2G08A 3S01A 3CJ7A 4EHTA 2P9UA 2D1KA 2DPNA 2V8HA 2Z1IA 2NR0A 2W55A 4ECXA 1SQFA 5ITHA 4NZ7A 2HFOA 4LFAK 2XI2A 1Q7YT 1CQMA 1C0TA 3EPIA 2IVNA 1FWLA 3CJ0A 4BE1A 4YB7A 2A18A 4BLGA 4M1KA 4DCPB 5F0XA 8ICQA 3NTUA 4QR2A 4JI7J 4Q0BB 2NO4A 1NGGA 4RUBA 2KB2A 1ZQXA 1JMTA 4GVEA 3BEXA 3DYAA 3TWZA 4USHA 2OSRA 3ISZA 5KG0A 2CZ4A 1C2PA 1ZPWX 2MZRA 3ADAC 3ED5A 2VANA 3T41A 3C2KA 9ICLA 4RW4B 3CGIA 1SZHA 4LBHA 2A1SA 3WXLA 3DU6A 4XDDA 1EAYC 3FEXB 1BGXT 2RQ5A 2MEWA 5H1SV 4O23A 3IWXA 2YMLA 1KQQA 2CQBA 4V1Ak 1LVHA 4W92B 3L4BC 2C3OA 4CLUA 1ZQCA 4FN5A 4RCHA 4B3TK 3FZMA 1UVMA 1KVCA 1BISA 1ZQOA 4YN4A 5KG4A 4QS7A 3HPHA 4IQTA 4PWDB 3DLJA 2KP7A 4WJ3B 3DOMA 3T69A 1SIJA 2AGPA 5LL6d 3UKUB 4ANEA 3SD7A 4E1MA 3DXBA 3FBFA 3P38A 3SSQA 4BRHA 2DCLA 4FJJA 1JLAB 3DLKB 4WFAL 1XSPA 2FLNA 5H9FJ 1HBUB 1M5KC 4NB4A 3KLFA 1IN0A 1EKSA 1SL1A 2D5RA 5BN8A 4L8RB 3DU5A 2DISA 5I3PA 4ECYA 3QLHB 5A2QU 1ELOA 5I9EB 4CM0A 4PG5A 2KM8B 2J8AA 1RHQB 1RT3B 2CQGA 2FLOA 3H0RB 2P9NA 1YRUA 1AXQA 1NK6A 5BRDA 1RQLA 5KPTA 2CUYA 4BRQA 3KJFB 1IXRA 3RBXA 1J27A 4OPKA 4JI1K 2V2VA 4OZ2A 1Q0NA 2VU5A 2FVQA 4JI6F 3FUYA 3AN1A 1FDBA 4A8MP 4Z0UA 4A8QA 1RAAB 1YBAA 3E51A 2ZZMA 4BXOA 3JPPA 3DXSX 1GQEA 1YK9A 2B0GA 3I9V9 3CD5A 2FB0A 3AM9A 2E8AA 3L2RA 4YB5A 2FDNA 4CO0A 4CHQA 3FRZA 2R18A 2Y0SD 3QZ7A 4F25A 3MGIA 2B7BB 3QETA 4CEZA 2NV3A 1T9UA 9ICFA 2FJVA 3O9QA 4EEKA 1Q8KA 1FWPA 4FZZA 3CNHA 2HZVA 4QYRA 4CNZA 4QZGA 1FO1A 3QDKA 2R7RA 2UVWA 1Z1BA 3TU5A 4CK1A 1HNZJ 4MF8A 3GONA 3QERA 1VSJA 5T7LA 3SYZA 3CIZA 2F3JA 1NNEA 1VS3A 1HJOA 4O8KA 1ICEB 1VJQA 2JSXA 2IIHA 4DV6F 3BP8A 5M1QA 4CZKA 3IN5A 3NF7A 4QZHA 1FJ7A 1VQ9S 4B3RK 1AW0A 3VEVA 4RW8A 2KKPA 4UBBA 2HHHF 2XULA 4N8OA 2LM1A 1NDCA 2M52A 3AO5A 5A2QY 2ZIUB 4OJ3A 1Z25A 4UAUA 3K5MA 3BZKA 2QI2A 5EGYA 1UEUA 4Y2IA 3ICLA 1SV5B 5KOWA 2FE9A 3GFZA 1IWAA 3JS9A 4I27A 2A3JA 2I1RA 1DRZA 4CEEA 1RYSA 3U1LA 2DNZA 1YITN 1KC8O 2Y1JA 3NBPB 2QB0B 2XRIA 8ICVA 4CF1A 2GJIA 2PFDA 2YQEA 2IAJA 3EZWA 1T9TA 2UZAA 3CFPA 1N2XA 3D9BA 2VV5A 1S97A 3FSXA 3VESA 1ATRA 5LMNK 2WFBA 3NS5A 1WSRA 3NS6A 3TUZC 4AYBF 2DD8S 5M1FA 2F5GA 3H98A 1CS4B 4OX9F 5HVHA 3AHPA 2IM3A 1N6QB 2IJNA 4CHYA 2IHR1 2WSEC 2C2MB 3DLHA 2Z8QA 1VRTB 2GVDB 3AU6A 3BY5A 1FNXH 4PCQA 3H0PA 3IO1A 4XQ8A 2ZD1A 5B8HA 2OO4A 3AFGA 4B08A 2DTUA 4F0MA 2X1BA 3L7OA 5BYRA 4Z94A 4OI3A 1XBWA 1Z19A 5KQDA 4NV0A 4FCYA 1Z05A 1P8ZA 4IFYA 5DG9A 1VBKA 3HTVA 3DNCA 2EAPA 1M5SA 3BM7A 3SPZA 4B9VA 2A6AA 2YKMB 7ICIA 2FTRA 2YWEA 1VQSA 3U9ZA 3HSGA 2PIIA 3C5GA 4C98A 3VEXA 3CCES 3GQCA 2YMQA 1WYGA 2A41A 4LVSA 4ZJOA 4ZOSA 4DUZF 5KG7A 3FBBA 2I2YA 2YJEA 2ZUAA 4MH8A 4WFBQ 4KHNA 1BNPA 1VQ4N 3DGPB 3BSNA 4K5SA 3BS5A 1SKSA 4I2JA 2ZOMA 4CJ7A 1XN9A 4M5LA 2XMUA 3AD9C 3RF9A 2KHOA 3D4JA 4KTQA 5E33A 1ZPVA 1PCAA 2XMTA 3MPUB 4RR5A 1TL4A 2V8PA 1QQOA 2KKVA 4YUDA 1LWCB 1N36F 4NCBA 1IM6A 1ACMB 4PKGA 4DTRA 3G86A 4LY7A 4DV0J 2Z4PA 2HF3A 2RE1A 4M3ZA 3NF8A 3HD1A 5AHXA 1N4LA 3JPSA 1R8CA 1D9AA 3CJQA 3QEWA 2NYIA 3GZFA 3CJSA 4A8YA 1NAQA 1U1RA 3MDQA 3B0XA 4BREA 3QUCA 3QO9A 1JNRB 2WK4A 1XSLA 4BRKA 1F5BA 3O1WA 2NUHA 1JMSA 5J1EA 3AVGA 2RVJA 1SXEA 2EK1A 1CRXA 2X6NA 3AARA 1IXKA 4BR0A 3QU4A 4JK1A 3TUIC 1IR2A 3IR7B 1YJWS 2E5LJ 4O3OA 4J9SA 3ZSXA 4UAVA 3D3CJ 2YX7A 4FJMA 3FSYA 3DLLL 4KHPJ 3U26A 2PT0A 1W9HA 1SXDA 3PX4A 1T03A 2V4JB 2ZJQQ 2G8WA 3HWTA 2BDPA 1TUUA 1K1QA 2J6SA 3PJWA 2NRTA 3KK2B 1EP4A 4PQUA 2V8DA 4B8CA 3BS7A 2R2UA 2O4GA 4ECZA 3BSOA 2LXFA 4WQ5C 2FHJA 4CNYA 2ZH5A 3G8TA 3CPWM 1Y88A 2E5GA 2ZJRL 8ICMA 1PVPA 2DGOA 3DOLA 2PY5A 3ZTQA 4BS2A 2KG0A 3RJMB 3MECA 4CJLA 3O4WA 1NJIO 3R8EA 4J9QA 2R4FA 2YNIB 2RIJA 1A9NB 3R7NB 2YWFA 1YVNA 1CJKB 1NGDA 3GILA 2CQ0A 1HMVB 5L9NA 4UB4A 2CJXB 2R7QA 2XS7A 1VRUA 2LEBA 3DM2B 1RWNB 3BGRB 1S6QA 3N7PD 1YJWN 5AZJA 4RU2A 2ZM6F 2EDUA 4I2EA 4PHTX 4CFCA 1KLNA 3CCRS 1Z2ZA 3UD4P 4A5AA 1SV4A 1VQ5N 1HW8A 1NK7A 3CSKA 4FO6A 4EYHB 9ICTA 2X1GA 3UDEA 2OXOA 2ZBQA 1GO3F 1PILA 2B4PA 2B8QA 1S1TA 5IWAJ 3IBPA 1ZQMA 3DMJA 1N5QA 5DLGA 2C28A 3N7SC 3GV7B 1YJNN 1F0MA 2RRBA 2A1JB 1DBDA 1Q86O 3QZ8A 2APOA 3H20A 3HPOA 3HVAA 5E0OA 1OQ3A 1L7OA 1PK1A 3CMQA 5BR8F 2Y9HA 2OEJA 4TU9A 3R7BB 4H4OB 3T1HK 2KK0A 4M3TA 3EWAA 4WE1B 1WI6A 1BA0A 2AH5A 2F2AB 3KLHA 2BKPA 3SAGA 4IFEA 3SDEA 4KKOA 2G13A 5KRSA 4ISFA 3V6KA 3CCRN 2ZIXB 4P0PA 2P9SB 1MMDA 4BRPA 1LQ9A 4P52A 1ZBUA 2AJFE 4UOCA 1UW4A 1BIUA 4Y2KA 2G0CA 4F7VA 1PC4A 4FYXB 1TVAA 2D3ZA 4P4MA 3BDPA 1X42A 1KEKA 4UARA 3GZ7A 4KI4A 5FJ4A 2CPHA 1D5AA 4KLLA 1OO0B 2Q31A 3C2LA 2VJVA 1SXLA 5HP1A 4CHOA 4CIFA 3K5NA 4ZCKA 3TSUA 4DOCA 4DTUA 4C8KA 4JI2K 1REVB 2N7CA 1JJ2M 3W8GA 3FEYB 4HTLA 3VETA 2NXEA 4QZIA 1RTJB 4K41A 9ICUA 3M3ZA 5B7WA 1KEJA 4LF9F 2IVYA 2DFHA 1YRTA 4YN3B 3PIOQ 2QXFA 1ZQPA 3AQEA 3LF0A 4C3MA 1N34F 2BJEA 5THWA 1P9QC 3H45C 4NLYA 1VDHA 2HGMA 5DDPC 3WXMB 3SPYA 4MDAA 1MN8A 4CRXA 3MGHA 3EL2A 5F3XB 3LGMA 4HYKA 1FRHA 3UCGA 1IKXB 3MMCB 3J7ZT 1H2TZ 3WIVA 3J7Z5 4GIBA 1P8GA 2UXBK 4DX7A 4R8UA 2BCQA 2GH1A 3UMCA 4P2HA 3R3TA 1HI8A 5IIMA 2ASLA 2ZBPA 1ZTWA 3LVVA 3MM9B 3IC1A 1OSDA 3D5MA 4L72B 4C97A 4PHDA 1S72S 4E19A 5B0AA 4KRWA 1WI8A 1AFJA 2FBYA 4ZJLA 4YMEA 2ZEJA 5J0OA 2BHNA 1ATSA 4U67Q 2BUPA 4H0VB 1GAOA 4JNEA 4K4TA 4NL9A 2E20A 2VICA 3FVYA 3O5TB 2CPEA 5F1XA 3AQFA 3AVJA 5AXNA 3ENHA 2VBYA 1IKVB 1CUKA 4NLCA 4FYDA 2CVIA 1B0VA 3ETOA 5KFWA 2P1JA 3T3FA 4JI6J 3IBCB 2QKKA 4HT5A 2LPEA 5D4PA 4NMLA 4PZVA 3CF5L 3OHRA 1JLCB 3VCDA 2VFSA 4FKXA 4N76A 2DCUB 1YRXA 1JALA 2ZJ8A 1XEZA 4J03A 5CY4A 2EVZA 1S1XB 4BR5A 1LXJA 2PEBA 1RUSA 2RHQB 4E2FB 3NS7B 4FWKA 1S72N 3TADC 2WTUA 3CJ5A 1WAFA 3MGVA 1P6TA 2UVRA 3ZSYA 1BPEA 3MDAA 4ED7A 2CPFA 2ASYA 2H3VA 3FMWA 4CJ4A 1TAMA 2HS3A 3ONQA 2AWZA 2BANB 2P6RA 5K20B 4FVCA 2K1RB 3ZDDA 3BQ2A 2HRYA 7ICFA 3HXMA 5F3ZA 3IV6A 2GWKA 2D0OA 3MN5A 4DV6J 5JMVA 2ZH6A 3QU2A 3RRGA 1IBKF 3OBWA 1RU1A 3CCVN 3AO3A 3KIOA 3J7YI 2AX0A 2XMWA 1DGSA 1OIAA 3RJHA 1ZBTA 1U9LA 2B21A 4I6WA 2HHHJ 1UKUA 5KFKA 1EQMA 1G3OA 5D4LA 2BCUA 4IG0B 3JS6A 3D2SA 3Q23A 3BO4A 2ATQA 3QGIA 1KD1T 2BW2A 3O1BA 3G82A 2YKOA 2DF4B 3QIOA 3PJXA 4JAXA 2HWTA 1XR6A 1VMBA 3H42A 2HVHA 3AD7C 1TL1A 4RWTA 4YHHF 1VSMA 3HSCA 1KQSR 2D0PA 2O4IA 3DAWA 1HFEL 2VF3A 1JLQA 5E3RA 1ZBSA 4ERDA 2O8FB 3JPRA 4K0KK 2HBZB 4DU7A 5IV3A 4TN2A 3E01A 7ICJA 1YJ9S 1X0FA 4RPFA 1BPZA 5J2CA 4J37A 2HOEA 2A6OA 1RACB 3TP2A 4ED4A 3KG0A 5BJRA 4H03B 4WFAQ 3ZZZA 1LWXA 5DQHA 4RUAA 4DSKA 5J2FA 1LOUA 1IQTA 3ZDEA 4PJ0U 4M95A 3FGVA 5AQJA 4JBCA 1W26A 1QQ7A 4OX9J 2GMLA 1T8EA 2M2BA 2OYYA 4ED3A 3M6UA 3OYEA 3CE8A 3CYMA 4LC9B 2YHWA 2YHYA 1RBOB 3ZT0A 1XMQJ 5J0SA 2GAGC 4WYBA 4J2AA 1VDVA 3HFVA 2V7YA 3ISDA 1AB8A 3J8AA 3HM9A 1FJGK 1A0PA 3MN9A 3ZDCA 1SQKA 2BGGA 3QICA 1KOOA 4RJVA 4I2GA 2W9CB 3HKZC 7AT1B 1FWKA 4KB7A 2ZHAA 4K4GA 3WIUA 2FJ6A 3AD8C 4NEZA 1YJ9N 3K17A 3BGLA 3V81A 3DDKA 3OFHA 5H9EJ 2X3GA 5B5EU 1QH9A 2EBEA 2ZITA 1B0TA 1VQPS 4LBPA 1U6BA 2MKKA 1N88A 4NLWA 4Q5VA 1S59A 4OPHA 4M63C 5F8NA 1UA1A 1NXIA 4IDKA 4DOAA 2AJ0A 3NASA 2C42A 1N33F 3CJ1A 1RT6A 2A42A 3GYXB 1B92A 1YAGA 4KLJA 5DRKA 1YZ6A 2Q43A 4DUZJ 5JVGL 2QFIA 5D3GA 4RUCA 3V1RA 3WEEA 5K8OA 4X65F 3W61A 1VYAA 1JLBB 1TAQA 4CGZA 1JKHB 3S7RA 5IM0B 3WNFA 4JB3A 3MN6A 2CGJA 1L6NA 3HW8A 4ZVTB 2K8CB 3QATA 2EBGA 1ZC6A 1FEZA 1N36J 3H5SA 1SVDA 1DLOA 4XPCA 5FPEA 4ICLA 4RQ5A 4CCHA 3D2NA 3OR1A 4HUGA 2W41A 1VQPN 3NWGA 3UR0A 1Y4ZB 4LZDA 2N7YA 3OL7A 2HCFA 1UVIA 1MW7A 5AQPA 4GC6A 3TZXA 3UN5A 4J2EA 2AEFA 2WFAA 1PO6A 3AVNA 1JXEA 3R9PA 3GDXA 3SEOA 3CXCR 4CH0S 5IINA 4HACA 2D9PA 4RBUA 4QZEA 4HI1A 1YVUA 5KTQA 2OELA 4CLSA 4CEDA 4NLGA 3A8YA 4KY3A 4YOYA 3NAHA 1A6SA 2HAFA 4GFJA 1X5SA 4NLNA 2KTQA 9ICGA 1HHSA 1WUDA 2DO4A 4LF4K 3UE2A 1BOTO 1DRGA 4QQBA 3DWLA 4YXJA 2NRHA 5DQIA 3D45A 3TVKA 1KXPA 2EW9A 3H59A 2RPIA 3GE1A 3TYTA 1ZBLA 4ZP8A 4UY8T 4F72A 1IV8A 3Q8QB 2C3PA 2KHDA 3JSBA 3E1YA 8ICFA 4UY85 2DNLA 1XNRF 2JLFA 5AI0A 4MK7A 2FHOB 5ALHA 4MFBA 2H1YA 4FJXA 2PKEA 2DIUA 3SXLA 2VQFF 1IR0A 2ZHBA 1BO5O 2PI5A 5J0UA 3N6LA 1T3QA 3GOIA 2WSFC 3TEGA 1FX4A 4F50A 1M6YA 2PE8A 4IOBA 2JH7A 5DM7L 3UN3A 3RBDA 1SS6A 4KLTA 1V9PA 3F2BA 5AK3A 4Z37A 2UUTA 4M04A 2CPZA 2EHGA 2ZM6J 2AYGA 4LF8K 4BQLA 3QGHA 5SWMA 4G6VB 3IRWP 1RQ0A 4BC7A 3TSQA 5M1OA 3I82A 3SR6A 1SH2A 1WC0A 4QIWC 2R2TA 1RWWB 1S1VB 3R2CJ 4OCZA 3MCAB 2KL8A 4A4JA 4KLIA 4C7QA 4TLQA 2Y0BB 2NREA 3JSMB 3A2FA 3PSIA 1E6VB 2GO8A 3ILJA 2G2OA 4OI4A 2E2PA 2O8EA 3MWTA 2PYJA 1VJWA 3R6GB 3BKFA 4F3QA 5BR8J 9ICCA 3N9UC 2F8TA 3KYLA 3TUPA 3GL1A 4OYMA 4CIOA 4KBIA 2QB1A 1NJXA 1XHXA 3BYRA 3EGNA 3M6GA 2VKQA 3FKBA 3KFUF 3ONNA 4CJSA 3B78A 3RWUA 4IWVA 4HUFA 2JVOA 4EO8A 4CIEA 4M3UA 4H4KA 5HO4A 1PBAA 4LRCA 3NNCA 2GVZA 4RNHA 3E58A 1OH6A 3JSYA 4WF9L 3NOCA 4BVPA 4E0DA 4BG9A 3HVTA 3PEJA 2P9PA 1NOZA 3OTOF 2R7WA 1RA6A 2VFVA 4CJQA 3I33A 4NLKA 5GMDA 4HVZA 2WF7A 5EWGA 4FNHA 4FZMA 3G2XA 3OS2A 1TK5A 2NQPA 4X2BA 3U3GA 5B09A 2ROGA 3QIPA 1JLGA 3DC2A 3MF5A 4ZMMA 3SK3A 5HMXA 4LF9J 1RBRA 4KFBB 3OLAA 3HX9A 2DL0A 2IA0A 2CQHA 5DDRC 2UUAF 1OY8A 5EXWA 8ICUA 2B5JB 4FJIA 2A40A 3HO1A 1N34J 3OBIA 3QU7A 3F73A 2G5IB 1U4BA 3EGWB 3MAQA 5HHIA 3A5MC 3O1LA 3LP0B 4GV9A 4YP3A 3EZOA 4KREA 4H5VA 4PPDA 4J2BA 2HWHA 3P5JA 2P9LB 3LGNA 2WHEA 5FROA 4JP8A 4CF2A 4DLEA 5AM4A 5ALUA 2ZJRQ 1Q5VA 1AFIA 3T5HA 2NRRA 4UB3A 1HKCA 1TP7A 2ZKTA 1YBTA 1RT7B 3ISCA 3AVMA 3WQTA 3A8IA 2MQNA 2I5HA 2P9UB 2PAVA 3OT9A 2EZZA 3TAGA 2K06A 4OI0A 4ZA1A 3IRUA 2I7NA 1AUDA 2DNPA 3CMES 3M8RA 4ID5A 1C0TB 3DLRA 1HHQA 2YQ1A 3OR2A 3KK1A 8ICGA 4M5HA 2BM1A 3VEWA 4NA2A 2KJ8A 4K4VA 3PNCA 1U25A 4LVNP 3NOGA 5D0HA 5L1MA 2W9BB 2V50A 3DYAB 1VQYA 2YTCA 4KH1B 3QSYB 1ZTTA 4JB8B 1WTFA 1E4FT 2F9JA 3VAGA 4O55A 2W6LA 4YOVA 3CJ9A 2KYXA 5AM3A 1T7PA 2W03A 3BQ1A 3SENA 2XY6A 4ZDNA 4BY9C 4GNIA 1RYUA 4OJ1A 3ILOA 2V63A 4OYXA 3FZKA 2J0QD 1SJ3P 3HVWA 2RQKA 2QA2A 2VC1A 1X4DA 4I0WA 1N52B 4FJ9A 2COLA 1XERA 1DXSA 3CMEN 1Y10A 3OYNA 4NYOA 1TUVA 1F2HA 2D8CA 1MA9B 4CJPA 4EHUA 1NZPA 3JAMO 3PRDA 5KAFU 3DOMB 4TY8A 1G4CA 2HS0A 2PI4A 1GEHA 4FWSA 4N77A 1IBMK 4G1PA 3PHTA 2YB1A 3EKUA 2ABYA 4ZN1A 2O8BA 3TR8A 1IBKJ 2F77X 3L4PA 1HL6A 3QAEA 1UFKA 2XYHB 5I3UB 3QT7A 2MQQA 1Q7LB 4M9JA 2A2DA 1QQ5A 4F02A 1G15A 1X5OA 2HPUA 2ZM6K 1LAVA 1N32F 2W01A 1HI1A 3SFUA 2V2KA 5DM6L 1RBSA 2WMMA 2MZQA 1Q46A 4E7HA 3J81j 1L7PA 3BJYA 1NK5A 1WDTA 2V0NA 1PYSB 3VAIA 2OIHA 5HRSA 3SI6A 1SZPA 2BABA 1A5XA 3V5RA 4CT8A 8ICPA 4YHHJ 2X7IA 2KZZA 1NLKL 5AKHA 2KM8C 4B9MA 1X6IA 1S4EA 4FWMA 4DQIA 4WYWA 2EXUA 4WK3A 4QW8A 4BXOB 4F5RA 3BBCA 2HHTA 1TMMA 5JU5A 1HYZA 1T9WA 2QX0A 3KD3A 1RT4A 8ICIA 4HHJA 5CYJA 4PUOA 2AYEA 2CQDA 2ASPA 2ZWOA 1IBLK 9ICBA 4RU9A 1WC4A 1GMWD 4JOUA 2J8SA 4XA5A 4NY8A 2RE2A 2EQYA 3L3FX 4UASA 4ED6A 3CJCA 1B4FA 3WKDA 3QBXA 3M7VA 4NLSA 1K1SA 2P2CB 4ECTA 2A19A 1YBUA 3LZIA 2RDIA 2H5IB 1NBEB 3A5LC 5T7LB 4PXDA 4ZK7M 3ITHA 3MR6A 3PW0A 2MDAA 4KYZA 4OYBA 3ULHA 2CPRA 2ZZTA 3U3YA 5J2DA 2KXNB 2XI9A 4P75A 1S9EB 4CERA 4HCBA 2FY8A 1M1KT 4NCAA 2C1EB 2P8IA 1WHXA 4K7QA 1X8DA 5CWRA 3CC7S 3OLBA 1EWQA 3P3DA 1BQNA 1GLAG 4BRIA 1BXNA 5DBBA 1J97A 3K8WA 5FD1A 4AL7A 1C0GA 2E1PA 3JXOA 3MXIA 5EE9A 4O0NA 3PW4A 4DCJB 1ZQFA 2P51A 2HOIA 2O3DA 5J0PA 2DNYA 5HROA 4RQ4A 1N33J 1WG1A 4PWUA 1VQ7S 3TKAA 4ID8A 5AQFA 2F40A 5D0RA 2R3VA 4LF6K 5D78A 1CULB 4AQYK 2RMLA 3M2UA 3MUMP 3QWPA 4HDGA 4A5BA 4M5GA 2DGXA 4X65J 3UDLA 2GQCA 1IKYB 3OVAA 3BO2A 4NA1A 4CJ5A 2L48A 4ZVRB 1S99A 1WEXA 4ZVPB 4CHZA 2DEJA 3TOQA 4ZVQB 4A57A 2XICA 7ICHA 2DT9A 3CC7N 3WQPA 4M3RA 4X64F 4HCCA 3PW5A 1D9DA 1OW5A 2MGZA 4NXNK 1WEYA 1D0EA 1QHAA 2HGNA 4Z4FA 2ZH9A 5CQGA 2RKIA 1FRKA 4JI3F 2E2QA 3O3FA 5J2IA 3G4SN 4DR5K 6FDRA 2LYAA 1BY9A 3PY8A 3UQ0A 2ZD1B 2UVVA 2R7VA 2HBMA 5K14B 4JRPA 2P5OA 1B22A 2WBRA 2VH7A 2FJDB 2B4UA 2QC3A 4MIAA 1K9MT 4C0ZA 2HQCA 3OS0A 3DCAA 1HBNB 1X4EA 4IFYB 5A0YA 1B0PA 1UMJA 1W0HA 4OLBA 5F9LA 1NCLA 2WUSA 4GVBA 4QR1A 1NI3A 5CAAA 4J2DA 2XLJA 2HSZA 1FFUA 1FDAA 3W63A 3MPDA 2RRNA 4CZGA 4C8NA 1WWUA 1T94A 4AF1A 1U1OA 2B9XA 1XNRJ 1KQSM 3L3VA 2P9KA 4H4MB 1O51A 3VAMA 1YJ7A 4UUWA 1URRA 1YXQA 1KVKA 4I2DA 3ASMA 3BS5B 4OGCA 2VQFJ 3HSZA 1X9XA 5L38A 3M1YA 2KHVA 2I7PA 2GQQA 3SAHA 1RWMB 1OH5A 1VFJA 1LFWA 3ZZRA 2LYVA 4B9TA 4ZH4A 3Q89A 4PRFA 1YIJS 1FEHA 3SUQA 3P45B 2FHJD 1HHTP 3ULEA 8ICAA 2Q66A 2AJ2A 4OD0A 7ICPA 3HOTA 5E3QA 2PEHA 1ZQGA 4DU3A 3MTKA 2GV1A 1ZQYA 8ICKA 4LREA 3TZZA 4ID1A 4ZP7A 2DNMA 4JI0K 2QMXA 3GYGA 1UJ5A 3W62A 3IRXB 4TNOA 4NWIA 2ISPA 5KT3A 4UOFA 1R0CB 2WF6A 2VDIA 5ALVA 1ZA2B 3LDOA 1G7CB 4R64A 2VBWA 5JVGQ 1H7WA 9ICRA 3NMRA 4BRAA 4F2RA 4UB5A 1ZD2P 4PGXA 3AA8A 2IRUA 5J1EB 1DQ9A 5AZIA 2J9DE 4I2FA 4KLHA 1Q16B 2E44A 1YVFA 2Q1LA 1N54B 5AQRA 1KAXA 3JQMA 5HMZA 4GKKF 3O9TA 1ZRMA 4QU6A 2XGPA 5MAOA 5LOQA 9ICWA 2VIXA 5FDLB 5KG2A 1TMJA 4GXKA 3RFAA 2QL9B 4NRTA 4UZCA 2A6MA 1EP4B 3CT9A 4DG1A 4PQUB 2W6KA 5GAGU 3QB0A 2UU9F 4J9NA 2IVPA 4U8YA 2IPOB 3KFWX 2K8GA 5EX3A 1ZQWA 3CJ2A 4ZTJA 2BEFA 4LMZA 5HL7Q 3LTOA 3AXKA 3DOLB 3OTOJ 1KS2A 1RHKB 3MECB 3C1ZA 1ZM4A 2MQ8A 4O3SA 1RK8A 4P2SA 1RBVA 2DY1A 3THYA 1VRUB 4WXWA 2H48B 4XAKA 1S6QB 2HAIA 1Y64A 1HNWF 5AZJB 2FPLA 3KK3A 1DFDA 3W2WA 3J7AN 4TYAA 1V85A 3OSNA 2UUAJ 5KT2A 2J4RA 3QYYA 4MJKA 1KDNA 3UDVA 2MY8A 4XEIA 2PXIA 3K5PA 4RW9A 4YY3F 1H2UX 1S1TB 2LQ8A 2J0SD 1N33K 4R0JA 1TKDA 3CJ8A 4Q7AA 1DK3A 3D7SB 3OFEA 1RDAA 1ZAWA 4JI8K 4WCEL 4DTJA 2J6UA 1M90O 2UUBK 4CNQA 5IC4B 2J7KA 2R2SA 4X65K 4LF7F 2OFGX 3FC9A 4XDCA 1U2FA 2MJUA 3B6PA 3N5BA 2BE2A 4LR7A 4J5OA 3AEVA 2I6XA 4JV2A 2OPPA 3ZZOA 4OZJA 2OLWA 2ZTCA 1P1LA 3AB2B 1ROFA 4KGVB 1CZBA 1S3XA 3PLAA 3SCXA 3VF4A 4LSNA 1DQ8A 2YKNA 3KLHB 2QWNA 1F21A 4CFBA 3KWMA 2H4YB