1NK0A

Adenine-guanine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk0A01
4CERA 3BQ0A 2W9BB 3DLBA 4DL3A 3MEGA 4FJ8A 5CP2A 2YNIA 1S77D 7ICGA 4KHYA 2JLEA 2XY8A 4CHPA 5DG9A 4OVLA 4P4OA 5HLFA 2BGGA 4R63A 4CK1A 4M6WA 5KFIA 4O9MA 3VA3A 4J9MA 1ZETA 1GOAA 4ED7A 5DGBA 3MR6A 3GDXA 1Z25A 4TQRA 1CZ9A 3AVLA 5KG6A 2J6TA 4CEZA 5BOMA 4NXZA 5CYMA 3C6TA 1D9DA 4B9MA 5EOZA 3LP2A 5IIIA 1WAJA 4M41A 2V9WA 5KFWA 4OKKA 4RQ1A 2IMWP 4I9LA 1S9FA 2PFQA 4NLNA 5JS2A 2XRIA 3MFIA 4KN7A 8ICRA 3UQ2A 8ICVA 1L3UA 4I2QA 4PA1A 4I9QA 2H5XA 3O3HA 4QZCA 1T7PA 4TSXA 4FZZA 2J6UA 4DL2A 3QEWA 3PY8A 1GOCA 3KD5E 4DTJA 1U45A 2BPFA 2IHNA 2B5JA 3C2MA 4Q45A 4F4KA 1Z3EB 1S6PA 4P4MA 3ULDA 2HHWA 4CEDA 1XC9A 3GV7B 3PX0A 3E01A 3OHBA 2HHSA 3T1AA 5T7BA 4DTUA 5DQIA 4CF0A 3AVCA 1XSLA 4F4XA 4FK0A 3V9XA 5KFMA 3UXNA 2W9AA 1RT4A 1RYSA 1S0OA 3NH2A 4RQ3A 5I42A 5J2QA 4KLEA 4YR3A 4AH9A 1ZQPA 3VN5A 4ECSA 3KIOA 3Q8QB 1SKSA 3P1GA 2PZSA 3MDCA 1NK5A 1BPZA 4Z6CA 2UVUA 3SCXA 9ICXA 4I2DA 3NGIA 1JLFA 3KJVA 4H4OA 1NKEA 9ICOA 3TWHA 4PGXA 3B6OA 5CA7A 1JIHA 3KKRA 1FXXA 2P5OA 2RDIA 4FS2A 3JPNA 2DFLA 4J2EA 2G8IA 1HQEA 4M47A 4FLUA 5J2HA 1ZQGA 4BGDA 3OYLA 2D0BA 1SUQA 2RPIA 5IIJA 4CJ4A 3ZSXA 4FJ5A 4DU1A 4KTQA 4IQTA 2DY4A 4J9LA 4RNMA 3AV9A 3SPYA 1BPYA 5J0TA 2ZE2A 3KHGA 1X2IA 1WSEA 2FMQA 9ICFA 1NJWA 1ZQLA 5KI6A 1S6QA 3DYAA 3NGZA 2AGOA 1DOQA 4RG8A 1L3TA 5KFVA 4HYKA 5JS1A 3OSPA 2MUTA 3PV8A 1RXWA 4DOCA 3ZT1A 4CIFA 5KT3A 7ICLA 1TL1A 4M9HA 3GQCA 1TVRA 3O3GA 4O5CA 3Q8SB 5DQHA 4DOAA 5KG1A 4F50A 3JPRA 5IINA 1BI4B 1VRTA 3DLKA 4LSLA 2OWOA 5KFYA 3PW7A 4FBUA 3KKSA 3E2EA 4N56A 4GMJB 4EYIB 1ZJMA 4FXDA 2ZJ5A 3SJJA 2BQ3A 3DLRA 4IQWA 4KI4A 3G6VA 4FZYA 5KG4A 3HL8A 4ECXA 5EU7A 4E7KA 4F2SA 3S9HA 1S9GA 1A5VA 1HMVA 7ICEA 1EKEA 1ITGA 5EWGA 3ZT0A 1C7YA 3JPOA 3PR5B 4RQ0A 4ICLA 1GOBA 4TQSA 3AA5X 3HVRA 2BANA 2NRXA 3C1YA 1U48A 3QO9A 2VWKA 1QS4A 3LZJA 4KLMA 2PFNA 4K4GA 1MSWD 2ZUCA 4DLEA 4O5KA 4YR0A 1RTJA 5EWEA 5J2FA 1DLOA 2QXFA 4O5BA 3TAGA 1X1PA 5SZTA 4YR2A 2ISOA 5DDYA 4NYNA 4CK2A 4ELVA 3H4DA 2DFHA 4JV0A 5FROA 3S3NA 4F5RA 3QNNA 3ZT3A 2IGIA 1XU4A 1JLEA 1XHZA 4YD2A 2FLPA 1QQCA 2YNHA 4CGHA 1B43A 4FLTA 5KFTA 4E7HA 3AVHA 4PWDA 1VSEA 4KN4A 5TZVA 2OPRA 1CUKA 4DL4A 3GIJA 5DG7A 4LVSA 1S1WA 3M8PA 4MEYA 1SZPA 3PMLA 4IRKA 1S1TA 4UB4A 9ICKA 1VRUA 5DBBA 3CM6A 4RPZA 4ECTA 3IRXA 2BCVA 1JLBA 4W5RA 4ID1A 4FK4A 3C6UA 3QEBZ 4KLOA 4H8KA 3RMAA 5HHIA 3OS0A 2XGPA 5HNKA 3L2WA 3V6JA 5J2EA 5CJ7A 3NF6A 3ZSYA 4CJSA 2HNDA 1D8YA 3LAMA 3RJIA 1ZQJA 4CHYA 4FLZA 4TUPA 2EX3A 3ZT2A 4J9QA 1ZQSA 4CIEA 3QETA 4ED2A 1KLMA 2ZTEA 5J0UA 3LK9A 9ICUA 1N6QA 4CEOA 3ISBA 1S1XA 4O4GA 3AVGA 5DDMA 5KFPA 3MEDA 2VA2A 3B0YA 7ICSA 3O4NA 1X9WA 3NBPA 3KLFA 1T03A 2XCPA 4CEQA 1ZBIA 2P6UA 4FO6A 4ECYA 1NJXA 3RTVA 4UAYA 4FJMA 5KFOA 4RU9A 2GV9A 3MR2A 4ECWA 3T5LA 2OPQA 1B22A 4CJKA 2DPIA 4YMOA 1VSMA 4CJEA 3L2VA 4RPXA 1VSLA 1C0UA 2W8LA 1SL1A 5KFLA 3HP6A 3OYGA 3JPTA 4KLQA 2YNFA 1HUZA 1ZQDA 2FPMA 5DKWA 7ICFA 1SKRA 1ZQMA 4BE2A 4C8MA 1NK9A 4EEYA 4I27A 9ICJA 2ITGA 3RJJA 5KGXA 4MFAA 3TANA 3ZSQA 2VG5A 3QEAZ 4O3RA 4W5QA 3OYEA 5HMLA 4ELUA 1HJRA 5J2MA 3ZDAA 4KLUA 2QK9A 3VQ5A 4LSNA 3Q8PB 2DTUA 4EBEA 1U47A 5L1IA 2PXIA 3HPHA 4R8UB 4FLYA 3VA0A 1ZQBA 1NJZA 4G1QA 2Z1HA 3HM9A 3QERA 4HUFA 4DTSA 5L1LA 2ATQA 2ZQBA 3DLEA 3H7IA 1HNIA 4J2AA 4DTMA 1JLCA 3UQ0A 3NH1A 2FPKA 3QE9Y 1BPXA 3ZDCA 1NK4A 1RT2A 3N4MB 1L3VA 3OYFA 1BCOA 1WSJA 1NK8A 3GIKA 1VSJA 1B9FA 5D49A 3C95A 4IR9A 1CEZA 2DPJA 1ZBLA 4KRFA 1PZNA 2IOCA 4GVMA 4YFUA 2E6LA 3ZSZA 5DK5A 8ICJA 4I2IA 4PY5A 4I2CA 4CJ3A 7ICMA 3GIIA 3EPIA 4KLFA 5HRSA 4RW9A 4Q8EA 3EW9A 3TFSA 3OS2A 4UQGA 1SV5A 2G8KA 3C5GA 4IBNA 3AO1A 3K58A 5DBAA 2I9GA 1QSSA 4O3QA 4UBCA 3PW0A 3M9MB 4DO9A 4ED1A 3JPPA 4JK1A 4QWDA 5CZ2A 4FLXA 3DLGA 3KK1A 3NF8A 3WNFA 3DMJA 4E7JA 4RUCA 3G10A 1QSYA 2B6AA 3ZSRA 2Q3SA 5L1JA 3ZT4A 4M9NA 1TK8A 3KLIA 8ICHA 1V9PA 2VANA 4I2JA 2ETJA 4FCYA 7ICPA 2I5JA 3VQ8A 4CJFA 2OZMA 1KFDA 3OYKA 3HJFA 4HUGA 1ZQVA 3IS9A 1Z00B 2GWSA 3RH4A 1LV5A 1WAFA 1RDCA 3VQEA 3N97B 1ZQKA 3V72A 2AGPA 4UB2A 3SUNA 4QZAA 1WSGA 4DTXA 1LWCA 4W5NA 1I39A 1ZBFA 3NFAA 5KFNA 4E7IA 2XY7A 1ZQIA 8ICGA 1B9DA 1JXEA 5D3GA 1A76A 2ZD1A 9ICAA 4Z4IA 1BCMA 2KW4A 1U4BA 2Z1IA 4KLDA 4DTPA 5KG5A 1YTAA 4YFKA 3U3YA 4RT2A 1WCNA 4EP5A 4B8CA 3DLHA 1JLGA 9ICHA 4DLGA 3TAEA 1VSFA 2I1QA 2W9MA 4CEEA 3AVNA 4M45A 8ICXA 1K1SA 4O3PA 3RMDA 2M9NA 3MGIA 2X78A 1Q9YA 4M42A 1XS9D 2ASLA 1S0VA 4FJXA 3IM1A 2F96A 3EY1A 4AHSA 4RZRA 3HVTA 4CJ5A 4G3IA 4F3TA 2YKMA 5DB7A 4C8NA 3ALYA 8ICEA 3LWLA 3PO4A 5KG0A 5KFKA 2VWJA 4PHPA 2ISPA 1TVAA 4W5OA 3EYZA 7ICNA 5KFAA 3T3FA 5J0WA 7ICTA 1ASWA 2OPSA 5KT4A 3S3OA 3SI8A 3V6KA 2O4GA 2YV0X 2F1HA 3TAPA 1T4GA 2HHXA 3MDAA 2FLNA 2C2RA 1RBSA 4F4WA 5E41A 3OYDA 4ECRA 1NOMA 5KFXA 3JYTA 3C2LA 1JXBA 1S76D 4CF2A 1A77A 4F93B 3AO5A 4O3SA 3UXPA 3EZ5A 2JEGA 2RKIA 8ICTA 1JN3A 4KMUA 3UPQA 2A1RA 1KDHA 4O3NA 1ZQTA 2QKKA 3MXJA 1HJPA 4BDPA 3P83D 3NF9A 3Q8MA 1N56A 1IKXA 2BPGA 4CHQA 2RN2A 3TAMA 5J0RA 4B9VA 1KTQA 3U3GA 1NKCA 3L8BA 1ZQZA 5DG8A 4YCXA 4KO0A 2NUBA 3AO3A 3LANA 1NKBA 2IC3A 3HPGA 1ZQXA 8ICFA 5KFQA 4DQQA 4BXOA 4GXIA 4Q44A 3VQBA 4AHRA 3SQ4A 2BR0A 9ICGA 1J53A 1Q9XA 1Y88A 1VSIA 4J2DA 2HNZA 4O0IA 1S10A 3HT3A 2E4LA 4FJ7A 3HYFA 4CGJA 3SQ0A 2F8SA 3VQ7A 4HCBA 3DOLA 1EETA 5CB1A 4AHTA 5KFHA 4M3YA 5CWRA 4RPYA 4OLBA 2ZJAA 5HBMA 4BDYA 4JRPA 1NOYA 4RQ2A 1RYRA 4FW1A 5HMMA 1RBTA 4J9NA 4IFVA 3SPZA 3I8DA 2XC9A 4I2GA 3KHRA 4KHNA 1ZYQA 2RDJA 3NGDA 8ICZA 2G8UA 2A1SA 2QKBA 3KTQA 2WTFA 2OPPA 5J2PA 3MXIA 3KD1E 3PVXA 3I0RA 1TGOA 2PI5A 4PPXA 1N5YA 4QWEA 4GXKA 2JZBA 1XSPA 4KHWA 4ECZA 3F73A 4ED0A 2MUTB 2OYQA 2XO7A 4N47A 3Q8KA 1D9FA 4J2BA 5DQGA 2ASJA 3HX0A 4RUAA 4I2AA 3K5OA 5HHHA 3UXOA 4NM2A 4UB1A 1ASVA 3M8RA 3TAQA 4WE1A 4HCCA 4C8LA 1MU2A 3NGYA 4M3WA 5HRPA 3VQDA 2PYLA 5IIOA 2FBVA 3HXMA 2X6SA 4DEZA 8ICQA 3CG7A 3AO4A 1LW0A 1MC8A 4F5QA 8ICPA 3S3MA 2Y1IA 2UVVA 2AQ4A 5KRSA 3TAFA 1HRHA 4N41A 4TURA 5CR0A 4CHNA 3EWAA 4MQ3A 3F9KA 1TKDA 3AVJA 4GLXA 4Z4HA 1TAQA 3CYMA 3L3VA 2Y1JA 1ZQHA 4CGDA 4LZDA 3SUOA 2JEFA 2KTQA 3K5LA 5HRRA 3QIPA 3AA4A 3RJKA 3B0XA 3KLEA 3HK2A 4E3SA 1Y97A 3BQ2A 2ZTDA 3RR8A 4QWCA 4BACA 4MEXA 3T5HA 1FKPA 5CHGA 3PO5A 3OGUA 3LP3A 1CXUA 4KV8A 1N48A 4YMNA 3LWMA 3V1OA 4N5SA 4YXJA 2BGWA 1S97A 4FM1A 3A2FA 4J9KA 3M9OB 1CZBA 3KLHA 3CM5A 4FLVA 5J2NA 3GIMA 1XI1A 4MFBA 1F21A 2A1JA 4RNNA 1S1UA 4B9UA 3GV8B 1XO1A 4YN4A 2BKEA 4NLKA 4YNQA 4DQRA 1WSFA 3AVBA 7ICOA 4CK3A 9ICBA 4CFCA 3SUPA 2P51A 1RTDA 1IKVA 1ZBHA 9ICPA 2W42A 2HW3A 4DFJA 3PW5A 1U49A 4CGIA 3SYZA 4FZXC 1ZQFA 4AHVA 4QW8A 4ECQA 4B08A 8ICUA 1VSKA 3G6YA 4HHTA 4Z4FA 1SKWA 4M3XA 4K4IA 8ICAA 1RT6A 3KK2A 4ED3A 1TK0A 2J6SA 3BGRA 2OA8A 1BGXT 1J9AA 3V6DA 1ASUA 4YXMA 3OHAA 4L8RB 1NK6A 7ICIA 1O1WA 1C0TA 1KFSA 2ASDA 7ICJA 8ICYA 3NE6A 5IIKA 3FDSA 9ICCA 3PR4A 3OVNA 4RW4A 4Z6DA 5C25A 5IIMA 3VQ4A 1KVBA 4KLHA 4QZFA 2JEJA 4NLGA 4QZHA 3C94A 3NF7A 4KREA 2BCSA 5K14A 4O5EA 3KK3A 1Q8IA 1EX4A 3QINA 4OJRA 2V4RA 1WSHA 3MABA 1MQ3A 4RT3A 4FBTA 3RRHA 4KI6A 1KEJA 2BQUA 4RQ7A 3D0PA 4JS4A 4M3ZA 1QSLA 4UAWA 1XSNA 5I3UA 4J9OA 3ZDEA 1C1AA 5KT6A 5J29A 3SI6A 3BQ1A 2W9CA 4ZTFA 4E19A 1C1BA 1XWLA 4QZEA 3V9UA 3T5KA 3K4GA 4IFYA 3U6FA 4GW6A 3OSNA 1NJYA 3G0ZA 5FDLA 2NRZA 2HHVA 1R0AA 4TUSA 2XGQA 3JPSA 4Z4GA 2R8IA 5J1EA 5DB9A 4OGCA 3KHHA 3ISNC 3PW2A 4DSJA 4HVJA 4RW7A 1YTUA 3OYJA 3VQCA 5KFCA 4CF8A 7ICVA 3ASMA 1HUOA 2ZTCA 4BWJA 3KHLA 1RT5A 4GC6A 4PHDA 8ICOA 3NCIA 1BPBA 2VA3A 9ICLA 4FJHA 4ECVA 5L9XA 3DRPA 2Z1JA 5FRNA 4M3RA 2R8GA 3V1RA 3FFIA 4DTRA 2PFPA 3RWUA 3AVKA 4CJPA 2ZUDA 3PW4A 2Z1GA 1BISA 4F8RA 2YKNA 3OYAA 8ICCA 3OYBA 1S0NA 3ETLA 4OPKA 4ZH4A 2KFNA 3DM2A 2FC0A 4DTOA 4DS4A 1LWEA 2HMIA 3LDAA 1HQUA 4KHUA 3BDPA 4XIUA 5KFZA 4W5TA 3KLGA 3SZ2A 1REVA 4CJQA 3OS1A 3PUFA 4B9NA 1TV6A 2GUIA 4F5NA 2RF2A 4Q0BA 4QZBA 3HSTB 3SUQA 1T3NA 4B8AB 3RH5A 4E1NA 4RNOA 4C8KA 5KG7A 3OYHA 1IH7A 2P5GA 1C1CA 3Q8RB 1ZQUA 4CF1A 4FJKA 4DFKA 2LYHA 3UIQA 1SL2A 5DMRA 2ZUBA 4QZGA 3K2PA 4CHZA 4DF8A 2Q0ZX 2XY6A 1C0MA 2B21A 4OPJA 4TUQA 4OKJA 4F4ZA 4KLGA 4CHOA 2NRVA 4RQ6A 1TV9A 4F5PA 3AVFA 3VQPA 3VQQA 4M3TA 1EP4A 4YD1A 1IXRA 3I0SA 4IRDA 5J0XA 3DOKA 4MFCA 1IO2A 4QAGA 3QEIA 1Z00A 3AO2A 1NK0A 4DU4A 4IQVA 4M04A 4FJJA 3ZDBA 1TL3A 4F91B 3QZ7A 4CJTA 3L3UA 4M3UA 3WNEA 8ICSA 1YT3A 4I7FA 4NYFA 4M6WB 2YNGA 1JLAA 2W9BA 3NH0A 1U04A 4UB3A 1EXQA 3G6XA 3C1ZA 3QEXA 4MF2A 5HROA 3OYMA 1UT8A 3OJUA 5DB8A 4KB0A 1RTHA 4CJVA 5KRTA 1ZQAA 4FJLA 2YHAA 3L2UA 4JWMA 4CGFA 1RILA 3JSMA 2XCAA 4GC7A 9ICVA 3HP9A 2BDPA 1A5WA 2PY5A 4FM2A 4BWMA 4R5PA 3PX6A 5KGWA 4F92B 3C2KA 2R8HA 4ECUA 1ZQEA 1A5XA 3MXMA 4ZHRA 3SNNA 4E7LA 2ALZA 5IILA 5D46A 1TFRA 4R65A 2X74A 4DSKA 3H40A 5JUMA 3RAQA 4UB5A 4BE0A 4PUOA 5J2GA 4Z4CA 4KHQA 4MF8A 1CLQA 4YMMA 8ICWA 3DRSA 2EHGA 1S1VA 4Z6EA 4HUEA 1ZQYA 4DU3A 8ICMA 4M9GA 4CJWA 4KPYA 1U9LA 4PHEA 4F3OA 3VQ6A 1UA0A 4DMNA 2AQ0A 1L3SA 5J2JA 1JMSA 2VG6A 1QE1A 3MFHA 1S9EA 5SWMA 4IQUA 3HWTA 3AA2A 4DL7A 2UVWA 5KTQA 4CJLA 4KTZA 4Q43A 2IAJA 5F9LA 2G8VA 4DTNA 3THVA 4DQSA 4Z6FA 5C24A 4YG2A 1K6YA 7ICHA 1DGSA 1QLNA 3H4BA 2LSNA 3V4IA 2P66A 5HP4A 8ICNA 2R8KA 1HNVA 5J2BA 3NTUA 2FBTA 1KCFA 1VSDA 3ZSWA 4KLLA 1JLQA 3AVIA 3ZDDA 1BIUA 3RB6A 2BPCA 5KFUA 2ATLA 3TARA 5J2AA 4M2YA 4BXOB 8ICLA 3AU2A 3OYNA 3CFOA 5DLFA 4I2HA 3RB3A 4QWBA 3GILA 4F5OA 9ICRA 1RBUA 1T8EA 2YHBA 3CFPA 1RXVA 3CFRA 5KFGA 4CFBA 2C28A 1RBVA 4KFBA 1MQ2A 1VSHA 4QZ8A 3SV3A 3TQ1A 4XQ8A 4DG1A 8ICBA 1ZQNA 3V6HA 3V7KA 1KVCA 3ZCMA 3RRGA 3RBEA 3RB4A 4QOZB 2HB5A 3AUOA 3RR7A 4FJIA 3K57A 3NAEA 3CQ8A 9ICWA 3OY9A 4QZDA 4DQPA 4I2FA 3ORYA 3H08A 4IDKA 4ED8A 2KZZA 2WOMA 5KFJA 1RZTA 1HYVA 4H4MA 3QLHA 1ZQQA 4DSFA 3DRRA 4XRHA 4FVMA 5KFDA 2PFOA 1DTTA 4CCHA 3O3FA 1H38A 2JZBB 5J0SA 4Y1CA 3K75D 2MAXA 3P5JA 2F1JA 1BPDA 1JXLA 1WN7A 1HPZA 3V9WA 4DSEA 1B92A 4J9SA 1RDBA 1UOCA 2DFEA 3LDSA 4EBCA 4B9LA 4DL6A 4RQ5A 1EXNA 4OGEA 1RT1A 1BQMA 3DI6A 4DWIA 4IG3A 1IKWA 4QCLA 2C2EA 5CY4A 4QWAA 1LWFA 4AHCA 4CEBA 3OJSA 1RBRA 2R7YA 3M8QA 4RW6A 3AU6A 1BI4A 3B6PA 2FPLA 3AVMA 3ITHA 4CGGA 4PH5A 4RQ8A 3H8JA 4AHUA 1YVUA 4AILC 1C6VA 2PI4A 2VA8A 1KVAA 2ZJ8A 1KRPA 4GXJA 4CEFA 4ED6A 2KZ3A 2KZMA 1QTMA 4KLSA 4KLIA 1TKZA 3QEPA 2O4IA 3NDKA 3C23A 1ZQCA 4EP4A 3IG1A 4B9SA 2FBYA 4R66A 5BPCA 3V9SA 4Q5VA 3MEEA 1TKTA 1JKHA 4FJ9A 2PYJA 3H8SA 3TABA 5EWFA 4LH5A 2HVIA 1ZQOA 4LY7A 2FMPA 4EZ9A 3LAKA 5KT5A 3LP0A 5J0QA 4JRQA 5KG2A 2X6NA 2W8KA 4XA5A 5C42A 3ZSOA 4CE9A 2AU0A 1LW2A 3RH6A 4B3OA 5KG3A 2OZSA 2R8JA 4FLWA 3JPQA 2DFFA 5DBCA 4FW2A 5KFBA 4IG0A 2BCQA 4YQWA 4ZTJA 5DB6A 3VQAA 1WNSA 4P2HA 4YVZA 5J0YA 1UAXA 4Z4EA 4I2PA 2XHBA 2A1JB 4EYHB 3FYHA 4PGQA 3GV5B 4BE1A 3M9NB 2F1IA 1FK9A 4KTWA 5DLGA 2KQ2A 1FKOA 2FLLA 9ICIA 2P6RA 9ICEA 5J2DA 3RAXA 4JV1A 5CZ1A 1RDAA 1ZBUA 5KT7A 2FMSA 3RJFA 1IM4A 4FYDA 3RMBA 5KFRA 4CESA 4FM0A 2UVRA 3QIOA 1J54A 3RMCA 4FJGA 4M9LA 1L5UA 1ZQRA 3RJGA 1XHXA 3SV4A 2BHNA 4JWNA 3PMNA 9ICSA 3ZD9A 2IDOA 4KAZA 1WCLA 1UT5A 4E89A 4I28A 4NY8A 1BPEA 1RPLA 4N76A 4BDZA 3PX4A 1D5AA 1S5JA 1D8LA 4PHAA 3SQ2A 2IS3A 1KFTA 4K8XA 5F9NA 3NHGA 4IR1A 1TAUA 4NM1A 4CJRA 3LPUA 4KB1A 5FRMA 5CYQA 3MR3A 1QHTA 5DGAA 7ICUA 5KFFA 4YP3A 1LAVA 4R64A 4DSLA 4IRCA 3WNHA 3BQTA 1RDDA 4O0JA 3T19A 2IA6A 2KN7A 3RJHA 4RQ4A 3K5NA 4QZ9A 4DQIA 4K4HA 4FJNA 1CXQA 7ICKA 2C22A 4I29A 7ICQA 3QESA 4Q8FA 5BOLA 5J2KA 1JL2A 3LALA 1Z26A 2HHTA 1ZQWA 3TFRA 1JX4A 4I2EA 3V9ZA 2W9CB 4JV2A 4PGYA 2GBZA 2NRTA 8ICKA 4O44A 4IKFA 3MR5A 2D5RA 4EBDA 4HTUA 3LP1A 5C5JA 3AVAA 1JL1A 3ISDA 4J9RA 3H8WA 4QW9A 2JEIA 3HW8A 9ICQA 1WSIA 5KFSA 3BJYA 1RTIA 4MFFA 4XUSA 2C2DA 1T05A 2VG7A 4CEAA 3OYCA 3QEVA 4CJUA 4LH4A 4CFDA 3MAQA 1IG9A 4NLZA 5J0PA 5J2CA 4FS1A 1UWBA 4JLHA 4CFAA 2AJQA 4NCAA 4UAZA 3GFKB 4R8UA 3M8SA 4J9PA 4M0AA 4KLJA 2P1JA 1X9MA 3WNGA 1HYZA 4KKOA 9ICTA 3V7JA 4LD0A 3RBDA 3TR8A 3EPGA 3TI0A 4CECA 1TK5A 4M9JA 1IKYA 5HP1A 5L1KA 3MBYA 5D4BA 4OKEA 2WONA 3HPOA 4O55A 3SQ1A 2BCUA 3ZSVA 3MGHA 3V7LA 3L2QA 9ICMA 4X5VA 3AA3A 4CF9A 2F8TA 4PQUA 4O3OA 3QZ8A 1RNHA 2BCRA 4Y1DA 3Q8LA 3QNOA 5HRNA 2G8HA 5KT2A 4DFMA 7ICRA 4ELTA 1RT7A 4JUZA 1WLJA 1KLNA 4DSIA 3C21A 3PNCA 2HNYA 1BIZA 3V81A 4QZIA 4UBBA 3RJEA 4NCGA 4CIGA 1W9HA 3IAYA 4F4YA 9ICNA 4ID5A 2V4QA 4DFPA 2NRWA 3T5JA 4JS5A 1VK0A 2XY5A 5J2IA 5J0OA 3IHQB 3K5MA 1X9SA 1I3AA 1BQNA 4DOBA 3C5FA 1J5OA 3K59A 1TKXA 1COOA 1G15A 2D0AA 4FK2A 4KLTA 1RCHA 4C8OA 1RT3A 2FBXA 3LPTA 2AGQA 1DTQA 3HO1A 3RB0A 4K8ZA 2G8FA 3D45A 3O4QA 3L2RA 4KHSA 2E6MA 2HVHA 2BE2A 4E0DA 4F2RA 4E1MA 1KSPA 1UA1A 5KFEA 4DS5A 4DF4A 4I2BA 1ZJNA 4EZ6A 4LZGA 1LB2B 1LAWA 4OLAA 3MECA 1BHLA 4RW8A 1NK7A 4B9TA 2JGUA 1SL0A 3LZIA 4KITB 2B4JA 1AROP 2KFZA 1K1QA 4Z0UA 3ISCA 1BVSA 2D0CA 2IHMA 2HHQA 8ICIA 2IBKA 4DL5A 4NCBA 3VQ9A 1W0HA 3V1QA 1HYSA 1NOZA 2G8WA 4P4PA 2HHUA 1BL3A 3ZD8A 2BQRA 1S0MA 3OYIA
chains in the Genus database with same CATH superfamily
5TISU 2WVDA 1WOPA 2JOQA 2KVQE 3DLBA 4JBCA 4FDFA 3IFEA 5CP2A 1SAZA 1S77D 2QG9B 2ZKTA 2NYHA 2BACA 4LQ3A 1WBDA 1PILA 5B0FA 1GEHA 1OH6A 5EHHA 3JAMO 4JI4K 1Z25A 3AVLA 2NXNA 3ULEA 1NGJA 2O5DA 4NXZA 2QL9B 1RLCL 1EX8A 4ZHRB 3I1YA 1D9DA 4B9MA 4JV5K 5KOWA 3RW6A 3HZEA 2OM6A 4YOUA 2V9WA 3ZI4A 1SH0A 2YN4A 2GTDA 4TVAB 3DRSB 5JS2A 3VCBA 8ICVA 4KN7A 1L3UA 3GG1A 4GKKJ 1VQ7N 2H5XA 4ZLPA 2KYZA 1Q1KA 2D41A 4CYUA 2LEBA 4TSXA 1NDKA 4KH6A 2J6UA 3QEWA 3I4PA 3KD5E 3GG4A 4LIWA 4AF1A 2C2NA 3WIVA 1Z3EB 1HNXF 4DCCA 3TUJC 1S6PA 5C24B 4CBXA 5GTIU 1X40A 2W7AA 3QU5A 3PX0A 3KJQB 4QNLA 4M63C 3FCHA 2ZHAA 5DQIA 3UR3C 1UTAA 2MQOA 1X7VA 5FLXO 5E3RA 4BROA 1HNVB 4FWSA 2W9AA 3NH2A 4RQ3A 4KLEA 4OI3A 2QTDA 4BC3A 3UI3A 4FWQA 3VN5A 2FB0A 2HYIB 3H0MB 4ECSA 3KIOA 2HMXA 3D2QA 3MDCA 4L74A 5EY4A 1AA1B 3F2DA 3OXFA 2QL7B 2UVUA 4NLDA 4BRIA 1DQ8A 4OI1A 4V19J 3P31A 2MKJA 4KFBB 2W6KA 3VESA 4C0ZA 3IM8A 1Z05A 1FWKA 5HQLA 3B6OA 3EDQB 3O2IA 4OLOA 2DFLA 1N2XA 3EJMA 2HVDA 2ERRA 4ZOHC 5AXMA 1U25A 3DC2A 1F2HA 1SUQA 2CPHA 4A46A 4LREA 4BGAA 5HI7A 3QLHB 2G2OA 4PWWA 5HR6A 3A3NB 3OFHA 2DY4A 3SPYA 2ZJQL 5J0TA 4CDIA 1DTTB 1B64A 1X2IA 2Y0BB 3UNYA 1J2VA 2ZIWB 1NJWA 2VQEF 3DLLL 2I1RA 3SD7A 5B09A 5AE3A 3NGZA 5KAIU 2AGOA 2RQKA 1M90T 2FPHX 1NNLA 2HIQA 3PV8A 1RXWA 5KT3A 5A2QO 2PFDA 7ICLA 1TL1A 3I4HX 5BRHA 3Q8SB 2PKEA 3MCAB 4PL7A 4HR2A 5KG1A 3JPRA 5D4NA 2ZJQQ 3ITHB 3O1LA 2AIRB 2H3ZA 2F7TA 1T9TA 2IM0A 4LSLA 3HFKA 5KFYA 3F41A 3PW7A 4FBUA 4XH5A 3UPFA 2K3KA 2DO4A 2KN4A 4UW2A 3DKDA 1J2NA 2ZJ5A 2BQ3A 2E7WA 4QYRA 1HBNA 5KG4A 3HL8A 2FY8A 4F2SA 1HNZK 2V51B 2PMZD 2P9PA 2CPFA 5EWGA 4ATNA 5ETOA 3PR5B 1KOOA 3H6EA 4ICLA 2EWHA 2DBYA 3CCLN 3O6QA 3FSXA 2A6OA 3M8YA 2E1YA 2BANA 2PMHA 4B3OB 3C1YA 4FXVA 4DUYJ 3CMAN 3O80A 2VWKA 4IG0B 5L1MA 3RSEB 2PFNA 1MSWD 1N36J 4OZ5A 2HGNA 2FJEB 5IXUA 2EPIA 4C23A 3TW0A 3W61A 3TAGA 3MAAB 2AA4A 5SZTA 4YR2A 2ISOA 4CK2A 3Q8UA 1FK9B 4LSZB 5FROA 1D9AA 5DJBA 3C0BA 3D2FA 5AM3A 2WAQC 2MQ8A 4CT9A 4KH4A 2JL9A 4KGKA 2V67A 3ZT3A 2OUGA 1ZZFA 2J8AA 5EN1A 3LOUA 1B43A 3CC2S 4FLTA 2AZ1A 4E7HA 2W01A 4KN4A 2CJKA 4JKAA 5B0CA 2L41A 2OPRA 4XEIA 2XQCA 4DL4A 3GIJA 2J5AA 4X64F 4OIXA 3FUYA 1S1TA 3DXMA 1YJ9S 4CLTA 4UB4A 9ICKA 1VRUA 4RPZA 3W3DA 3IRXA 2BCVA 4ID1A 3ENWA 2UXBK 1WYGA 1QQOA 2QARA 4WQ4C 1FNMA 2V8HA 5HNKA 1AUDA 1CS4A 1GNKA 3NS7B 5GINA 5J2EA 5HVFA 5CJ7A 1D8YA 2OFHX 3RJIA 1J5EK 2MJUA 4TUPA 3ZT2A 1TL5A 2AF6A 3PG9A 4WXWA 4J9QA 2G0AA 3QETA 4ED2A 2AJ0A 2ZTEA 2WK4A 3EEQA 4KGMA 4MK9A 1N6QA 2HI0A 3OL6A 3WK6A 3T69A 3MEDA 1XNRF 3B0YA 3MTJA 4F71A 3OPXA 2J76E 3O4NA 1X9WA 3ZNUA 4ILJA 3CC7S 1GT8A 1Q82O 2FJXA 3SCLE 3DGVA 4FJMA 4EWTA 4RU9A 3CCEN 2JLFA 2AD9A 3T5LA 2OPQA 3ZC4A 4JI0F 4J9VA 5I3UB 5GAGP 3EKUA 3KMQA 3PYGA 3HP6A 2QSFA 2E5IA 4ZDNA 1JI7A 1RSCA 3EXCX 2PFFB 3EUNA 2E7VA 2F2AB 5DKWA 4ANDA 1T9XA 4DV4F 4A8SA 2O8DB 1ZQMA 2R4FA 4FXWA 1NK9A 4I27A 3QRPA 5KGXA 3CCVS 2WUSA 4MFAA 4P72A 4US9A 1NGAA 4ZA1A 3TANA 2DVIA 2VG5A 3QEAZ 3QMLA 4W5QA 2ZH5A 5HMLA 5J2MA 2MKHA 4CM2A 1PK3A 4OYMA 1RTIB 3BR8A 4OLPA 5D78A 4KLUA 2QK9A 4BRQA 2VJ4A 2YMPA 2D69A 1CJVB 4ZPBA 1XERA 5L1IA 1YF5L 4R8UB 4FLYA 4FWPA 3D6JA 2DT9A 1NJZA 1FRHA 1Z19A 2V63A 2OEJA 2IRYA 1F5SA 3D9BA 3H7IA 1NZPA 1P27B 3NOGA 5HP1B 1Q8BA 2FPKA 1BPXA 1F3VA 3V5RA 1G1XA 1NK8A 4FF4A 3GIKA 1VSJA 2F4VK 2Q3PA 1DY3A 3C95A 1FTRA 1NM1A 4KRFA 4J03A 4A8KA 4ZVOB 2HSEB 2IVFB 2IOCA 1TUGB 3H8MA 8ICJA 2XO6A 3F5EA 3W2WA 2QMXA 3NNHA 1NO8A 2ASOA 2HNYB 4NCGB 4C0HA 2VV5A 4I2CA 1VAZA 3GIIA 5HRSA 1LWXA 4RW9A 2QWOA 4OD0A 1VLYA 2QE5A 1SV5A 3MDFA 5DBAA 3BH7B 5C7PA 2ZZNA 1MN7A 3M9MB 5F8IA 2EKNA 4ED1A 4USJC 1NGEA 2NQPA 1DTQB 5JJBA 4V1Ak 3J81O 3TACB 2DTJA 3JPPA 2BE7D 4EUVA 2KXNB 5LT5A 2EXUA 4OZ0A 1FRKA 3I82A 4WFYA 4ES3A 3NF8A 3WNFA 4E7JA 4RUCA 1AUSL 1VQ5N 1RISA 2B6AA 3GLJA 3C29A 2Q3SA 3ZT4A 4M9NA 1TK8A 3FBCA 1V9PA 4FCYA 2ETJA 2EW9A 2ILYA 2CQ1A 3CWJA 4X4NA 5A0LA 3D68A 4DX5A 4CJFA 1HEKA 1KFDA 1YVFA 3HJFA 3K2YA 3IMQJ 2HHHJ 2YHYA 5ALQA 2CIMA 2QWQA 1LV5A 3VC8A 1WAFA 3CO9A 4WK1A 1A6SA 5KNIA 1TYQB 1KHVA 4HVZA 3ZNJ1 1ZQIA 1DARA 4CZCA 2GWJA 1MWQA 3MEGB 3RFAA 1CJUA 5LJWA 4Z4IA 2ZUGA 1BCMA 1RB0A 3J81j 2EDUA 2KW4A 3QFWA 1U4BA 1HHQA 1ZTTA 1VFJA 4H4KA 5KG5A 1YTAA 3SMVA 1EQYA 4RT2A 3VZIA 3U3YA 1NEEA 3NVMA 1WCNA 2FIUA 3CB4A 3C28A 4AL5A 2YCHA 3IG5A 3O8WA 1WNEA 2LKZA 2E29A 3C6TB 4JAXA 4M45A 4CH7A 3LP2B 3L6QA 2D1KA 2J7WA 5IT9U 4M63A 4CLKA 2E3TA 1XS9D 3ZZTA 1RWXB 2CGJA 3CPWR 1O0PA 4AHSA 1BXNA 4RZRA 2G09A 3HVTA 3QFUA 4G3IA 4BRCA 2MB0B 2JHEA 3UN3A 3SEIA 3U8XA 2RVJA 2AZ3A 4WFAL 2WHEA 3I32A 3ZTQA 1UFLA 2NRRA 2UUAJ 2RU3A 1NSPA 4W5OA 7ICNA 3T3FA 5J0WA 2OPSA 5KT4A 3CPWM 2E8NA 2ZHBA 5LOQA 2YV0X 3RVCA 3CCUN 2F1HA 4DR2K 4H54A 1W25A 2FLNA 3TSPA 4DR4F 1RBSA 4F4WA 5E41A 2CVEA 3S01A 3C2LA 1VQKN 3WK8A 3EZ5A 2JEGA 1TELA 4WFAQ 2RKIA 3TZXA 2YXLA 2OELA 3WXLA 3UPQA 4MK7A 2A1RA 2QKKA 2KXHA 3L7PA 3MXJA 1HJPA 5GVQA 4BDPA 3P83D 1RT4B 1NB7A 2IPOB 3ONNA 2FHMA 1B0TA 2CQBA 4CHQA 5J2QB 1GX5A 4KHPJ 2EG2A 5K8NA 5E2QA 3WKCA 4DV6K 2GEMA 2XYGB 5HN0A 4I67A 2NUBA 5GAGU 3LANA 4C3LA 3AO3A 3IP0A 4ID8A 8ICFA 9ATCB 3UR0A 3PACA 4B3TK 1KW4A 4JI5F 2Q1LA 3VQBA 1MWZA 2BR0A 2K4HA 2DGSA 1U24A 3I9ZA 3CMEN 3J7AP 2IRXA 1LOUA 4FWNA 4J2DA 3SR6A 2LQJA 4Y2YA 1S10A 1HHTP 3KXDA 2IRUA 1QJHA 4FJ7A 3VQ7A 2GVDB 3MM7B 2ZKUA 1BHNA 5CWRA 3R6LB 2FE9A 4LF4F 5A8KB 3KDNA 3UWTA 3AD9C 3WQUA 4RQ2A 4FW1A 3GCXP 5HMMA 1YI2N 3ZX2A 4NLWA 2CJ9A 1EJ7L 2YBVA 4I2GA 2ZE2B 4WFNL 4KHNA 3GOIA 1ZYQA 2RDJA 5AQKA 3G82B 2A1SA 5AQHA 2EQYA 4JKCA 3D2NA 2LQ9A 1BUPA 1S6QB 1I94J 3DYAB 3I0RA 1IQTA 2PI5A 1NB2A 2C2MB 1N32F 3SQGA 1RAJA 1XSPA 4KHWA 3P6YC 3MUMP 1F3FA 1GLFO 4B3SF 2XO7A 3Q8KA 2BH1A 4K4XA 3H5XA 3CCQN 4J2BA 2WF8A 2HAFA 1YG0A 2KJ5A 4B1ZA 1VRTB 3K5OA 3CJ1A 3UXOA 4UB1A 4WFNQ 1LQ9A 4QS9A 4E8UA 2ZWOA 4XH4A 4GKJK 3GSDA 4A5BA 1NZAA 1AFJA 3WK7A 4AYBD 2HGLA 3ZZPA 3HXMA 2AJFE 2EKYA 3M1YA 2ZZTA 4DV0K 3CHWA 3P5TL 3CG7A 4ZMMA 4ZS6A 3WKBA 1MC8A 2KO1A 3N6NA 2Y1IA 2UVVA 1JKHB 2P9IB 4EI2A 2W2NP 1HRHA 1R8BA 2D9OA 4JI1F 4P6QA 1TKDA 5A8RA 4BQLA 3TX0A 3CCRN 3KFUF 4Z4HA 3CYMA 2KL8A 2V52B 3DOMA 3G8SA 3AEVA 3SUOA 2KTQA 3FVYA 1HNWF 3QIPA 5M1FA 2NUUG 3U02A 3B0XA 2DIVA 2KYXA 3QO9B 4QJFB 3KLEA 3HK2A 2JLGA 1UPPA 4EX6A 2MGZA 2ZIXA 1Y97A 5IC6B 1GTHA 2ZTDA 2AH5A 2OJ3A 3D3CJ 1JJ2R 1FKPA 1YDLA 1BY9A 3TZYA 1RTJB 1KVJA 4LF6K 5FPMA 3ZYYX 2ZIUA 4DN9A 4WQ4A 3LWMA 3QWPA 2P9UA 3V1OA 3M2RA 2BGWA 1S97A 1O8BA 4J9KA 5B08A 2GQQA 4PYAA 1LVHA 1OY9A 4QZVB 3ZFVA 2KT5A 4B9UA 4H5NA 4U7UD 1JJ2M 2D3DA 3UW1A 2KP7A 1JXVA 3LDNA 2ZJRL 2CRXA 5CAAA 1Y0HA 4MDAA 4CK3A 3MMAB 1HI0P 2GAHC 4WU3A 2Z2MA 3RGIA 3M8PB 1K0TA 5KPRA 4CZIA 2DNHA 3CMQA 2RB7A 1U49A 5CYJA 3VMFB 1UW4A 3SYZA 2IDLA 2JWKA 1DURA 3BZCA 5GTHU 2HQIA 1WD6A 4DXLA 2ZNZA 4X66F 4Z4FA 1SKWA 4JHDA 2A6MA 2HNDB 1TK0A 1XR5A 1FDBA 2FD2A 1FRJA 1NK6A 5AQTA 3LQVA 4LFCJ 2HF3A 2Z57B 4NA1A 2G13A 4DHVA 3WQPA 3GMGA 8ICYA 1BE4A 4FL9A 3FDSA 2I7NA 2F8EX 4C3MA 3P45B 1F2GA 2CN1A 1SWWA 2BUNA 4HHUA 1R8AA 1FEEA 3QRQA 4QOTA 3LM9A 3CQXA 1SJQA 3TZZA 4RW4A 4Z6DA 1RP5A 2UV8A 4QZFA 4WJ3B 2JEJA 4NLGA 1ZM9A 4K0KJ 4O5EA 2R2UA 3SCKE 3PIOL 1DQ9A 4B3RJ 2HDOA 1CSJA 2UUTA 1RKJA 2DJWA 3T6BA 3RRHA 2ZOFA 4KI6A 2G0CA 2FVSA 2GZOA 1HW9A 3C16A 2VGNA 2YNFB 4UAUA 4RQ7A 2N1RA 4UAWA 3AOCA 4J9OA 2ZEJA 2CRLA 4FVCA 2F4FA 1C1AA 1K5OA 1U1NA 3FBFA 3PIOQ 1WKJA 5C2GA 3K4GA 1Z1BA 3GFYA 4NI2B 2GVZB 3B8HA 1BO5O 1UZDA 4OZ2A 3B4DA 4DQ8A 5CA5A 2X1FA 4LSNB 4I64A 4KMOB 3D1HA 2VQFK 2PC6A 1M6YA 5G0RA 1A0PA 4PXEA 1YRTA 3ISNC 1GTEA 5FPNA 4CF8A 7ICVA 3ASMA 5BPLA 3KHLA 2XI2A 2NO4A 1XMOJ 1Q7YO 2BM0A 1HNIB 1S99A 2DF4B 8ICOA 1TUWA 1RDUA 1BPBA 4CO3A 2XTJP 5AKIA 3TUPA 3RW7A 5L9XA 5FPEA 5ALMA 1L8LA 3MC1A 3M6WA 4C7QA 4CJPA 2WHOA 1FFVA 3M32A 1YGYA 2RUGA 3KFWX 4WZQA 4F8RA 2HHPA 2YKNA 4PYDA 2P8IA 1X42A 3AOBA 4DDFA 4OPKA 2E2NA 2KFNA 4A5AA 2QJ3A 2XLJA 4DS4A 3BDPA 4K4VA 4R79A 3MZIA 3I31A 1CZAN 1REVA 4CJQA 3OR1A 1ACMB 3PUFA 2ZF5O 5TKYA 2E66A 8AT1B 1K9MT 3ZZOA 5CABA 1T3NA 1EB0A 4GKKK 1TMMA 1UCVA 4Y0FA 1NRKA 5KG7A 1ELOA 4CF1A 2QO3A 1X0PA 5AT1B 2ZC3A 2H3IA 1T02A 3UIQA 2OTLN 3ZETB 1L6NA 3HKWA 4ZIWA 1RWUA 4OJHA 4WQ5C 3OTQA 1QZ6A 4CHOA 1E6VB 4RQ6A 4F5PA 3KK7A 3AVFA 1BG3A 2FJWA 1X4AA 4C7ZA 2F8KA 3FJ2A 2IOHA 1CRXA 2CUYA 4Y2AA 1LWCB 5E3AA 3DOKA 4N77A 4QAGA 1Z00A 4WU2A 1NK0A 2WB1D 2KD1A 2V4JA 4LF5J 3T1YJ 5K20B 3H2LA 1X4BA 5DM7L 5LSOA 5CR4A 3CJ0A 5A76A 1Q16B 3U7JA 1X3NA 2CPXA 3L0QA 3S7RA 3ENHA 5DRKA 3OYMA 2K8BB 3FGVA 5DB8A 2FHJA 4BRNA 1J2MA 2JDJA 5EE3A 4QIVA 5J1NA 1BDGA 3TYTA 3HP9A 5MAOA 5DM7Q 4X65F 1A5WA 4OI4A 2PY5A 2CDQA 5KGWA 2YY3A 4I56A 3N28A 5HOOA 2B8PA 2KVCA 1ZQEA 4FF2A 2DIUA 3JTNA 4ZHRA 3MXMA 2LHTA 3T9NA 3WKDA 1ZAVA 1P6TA 4R65A 1RZMA 4WPAA 3ILJA 5LMNF 3RAQA 3M1VB 4YOWA 3NRZA 2IBOA 3SBTA 8ICWA 3DRSA 2EHGA 2AJ2A 3H0LB 4DR3J 4HUEA 4F3QA 3D2WA 3JXOA 1RHRB 2CPYA 4CJWA 4F3OA 4IH6A 3G71N 1Y3JA 2AQ0A 2DHAA 4DKWA 3A8YA 5HVHA 4JI6F 3QXGA 3MFHA 4IQUA 3Q2TC 3KOOA 2UVWA 4CJLA 1R31A 3FGUA 1FFSB 4Q43A 2E20A 3CETA 4DQSA 1VJ5A 2FGCA 5C24A 4UARA 1DGSA 2J9EA 3QB0A 2LSNA 3G86A 5HP4A 1IKXB 1YTYA 8ICNA 1OH8A 2N82B 3GJRB 2RRAA 3WXMB 2QLTA 1X6IA 4Y28C 1HNVA 1ZAWA 2RLTA 2F63A 4USIA 4KO0B 3H0RB 1N33J 1VSDA 2XYPB 1BIUA 2JV3A 3UE2A 1NNEA 5KFUA 3NVWA 3TARA 3Q7BA 1R6YA 3EO3A 3RB3A 4M7XA 4MAKA 4F5OA 2R2TA 1RBUA 3WK9A 3EUB2 1T8EA 3CGIA 3BKTA 2LYVA 4DUYK 4N8OA 4KFBA 4GFJA 5AE2A 1OY6A 4H0PA 1N36K 3M6UA 4M8LA 2WF7A 1HQ2A 3SV3A 1WHVA 1JNRB 4PRFA 1KVCA 4L3QA 2E2OA 3ZZZA 4EFAC 1RTZA 2V8PA 4I2FA 4LFBF 3A5LC 4ED8A 1RZTA 3E66A 3UD3P 1SQGA 2OPPB 5J2PB 1PGZA 5CE3A 3QLHA 1XNQJ 4OPAA 5AXLA 1VIXA 4FVMA 5HR7A 5KFDA 1EWQA 1DTTA 1PYTA 2PSZA 3GB0A 4MKVA 4FWRA 2ZIWA 2UUBJ 1BPDA 5AK3A 4BQZA 4P10A 1MA9B 2PA3A 3V9WA 1VJQA 1UVJA 4DSEA 1NXIA 1B92A 4J9SA 1RDBA 2QWNA 2DFEA 4LF8J 2YVSA 3LDSA 4B9LA 4DL6A 3IA0A 4WKRA 1QVFR 4JN4A 5K8OA 3GE9A 1SKUB 4QCLA 2C2EA 4CEBA 4QWAA 1LWFA 2Q1NA 3EVWA 1NLKL 3ITHA 5BR8J 4AT1B 4FZVA 2W24A 1C6VA 4C0BA 1FCAA 4JI8F 1LW0B 4FZNA 2XYHB 5JU5A 3TA1A 1QVFM 4F7VA 3MN9A 2WRMA 4KLSA 4KRWA 2ZH9A 2G4BA 4R66A 1OVYA 1WKLA 2PYJA 3TABA 2W4DA 4MMOA 5EWFA 2HSTA 4OYXA 4IJNA 2HVIA 1H2UX 1ZQOA 3M6GA 1IUJA 5KT5A 4K4SA 3OQ2A 3CD6N 3S6JA 4NLCA 3G87A 5C2DA 4CTAB 5HJXA 4B3OA 2R8JA 3Q8VA 2DNPA 4FLWA 3CIMA 4A62A 4C8ZA 4IG0A 2QA4N 3RSEA 4KE5A 3AGKA 4CZEA 4M5LA 4ZTJA 2ZBQA 2NXEA 4P74A 2AJ1A 3C2PA 2MHNA 1RK8A 2GAGC 4Z4EA 1F44A 1I51B 3FYHA 3GP9A 4PGQA 1S1UB 3MAAA 2YTCA 1FK9A 2K4EA 2MY8A 4UOHA 2WAQD 2KQ2A 5AXNA 9ICIA 3AJDA 3M05A 2CJXB 4JV1A 1SIJA 1S1WB 1S57A 3R5GA 1ATNA 1ZBUA 1IKVB 4QJVA 2PMZF 1IM4A 1QUPA 1F0XA 5KFRA 3RMBA 2UVRA 2QI2A 3QIOA 3DDKA 4KQZA 4M9LA 1ZPWX 1OPIA 4JEPA 2DWQA 3RJGA 1PSDA 4JWNA 2V9KA 3CJCA 1S22A 1VISA 2DCLA 3RAMA 4KAZA 3A0BU 1UT5A 5EOYA 3CP8A 4OZJA 3KK2B 4I28A 3BGRB 1KN5A 2HFSA 3T79A 1BPEA 4WFBL 2JH7A 3V6DB 4CJ7A 3PX4A 4K25A 4OYPA 1RABB 5C0YA 3A5NC 1XQSC 2JFKA 3R9LA 1TAUA 1CQNA 4OO1J 3NBPB 1IBKJ 3KJFB 4X4UA 3QGPA 3ZX0A 3N6MA 2HSZA 3U27A 3CCES 2BKNA 3TU5A 3IN5A 2YQ0A 3F56A 3BQTA 2ZWHA 2Y9TA 2ZBPA 5M2RA 3T19A 3J7Z5 1GMVA 4WFBQ 1P8ZA 3RJHA 1GLAG 2Q0UA 4AP9A 4DQIA 4YN3B 5G5HA 4K4HA 4H5RA 2C22A 5D4OA 1URRA 1KQGB 5BOLA 1PKUA 4NPOA 3JTPA 3ZZYA 5AQSA 1FJGJ 2HHTA 3TFRA 2R2SA 4I2EA 1PVQA 2RQMA 1R8PA 1NPPA 2DKXA 1K47A 8ICKA 2O8DA 2XS5A 2O8EB 3MR5A 1V38A 4FE3A 4ZPCA 5C5JA 4JKHA 5EE9A 2ZM6F 3M3ZA 2OXOA 2QGFB 3VAIA 1XMQF 5GAHI 4J9UE 1JL1A 2B56A 4CLYA 1R0AB 2HHHK 4O4RA 2JEIA 3PEJA 2DHXA 1WSIA 4OJOA 2VH7A 4K4WA 5LJ5Y 1RTIA 5AQLA 2CZVC 5ALVA 3VGSA 2CNKB 4RW7B 4ISGA 2R9LA 2YI1A 3LM2A 4BR4A 3JQKA 1CJVA 1IG9A 2CNNB 5K8PA 1LKZA 4FS1A 4CFAA 2CPEA 4PG5A 3K1RB 4R8UA 4M1KA 1Q53A 4RU2A 4DV3F 5EE0A 4YDUC 3AD8C 3B8AX 3V7JA 4PL2A 2IHR1 2QW9A 3FFIB 4URSA 3EZWA 1YXQA 3VAMA 3ZTSA 4LR8A 1RYUA 1Q0NA 4JI2F 1RCOB 1QHAA 5HP1A 1P9QC 2VC1A 5L1KA 3MBYA 1IJFB 1QQ7A 2K7JA 4P0QB 2FSNA 4O55A 2HKEA 3SQ1A 3M8ZA 3ZSVA 1FE0A 2D74B 3T1HJ 1YJVA 3THWB 4AD6A 4WQ5A 1HQUB 4O3OA 4AQYF 3QZ8A 3JSRA 3Q8LA 3KLGB 4CIOA 2F9WA 5KT2A 4DFMA 4G9BA 3MTKA 3QNMA 2MMYA 5FP0A 2CGKA 5AQXA 3C21A 2HNYA 4NCGA 2BDUA 1QAIA 2FSKA 1RU2A 4DFPA 2NRWA 3T5JA 1YRUA 3AFGA 4FZLA 2XY5A 2GIQA 3Q22A 1X9SA 5LJVA 2V8GA 2EI5A 2JX2A 1M90O 4DOBA 3C5FA 1H98A 3FCWA 1VQ5S 2UUAK 2NLXA 4WWSA 1WACA 2P6SA 2Q66A 2DY9A 1DTQA 1FDNA 1QQ5A 3NEKA 3QBXA 2B4PA 4DV5J 2GIRA 3QSYB 1RAIB 3D45A 2FJ6A 4JNEA 5T7LB 4U96A 5H9FJ 1IQZA 1YJTA 1UFWA 3EE3A 5AFUH 5KFEA 2BV3A 3KD3A 2CWKA 4EZ6A 4CO4A 4A2AA 1RWPB 4DV1F 1TL7B 3L3CA 2BOAA 5AJ3J 2YMMA 1Y3KA 5BN8A 4KITB 3O1WA 4G1IA 4IUFA 4E98A 1RHUB 1TL3B 2IHMA 2D0CA 2IBKA 4DL5A 1OVQA 4KHPK 1W0HA 1VQMS 4H5TA 1AFIA 4LFAJ 1TYQA 3VAJA 3J7ZT 2AV5A 4DR5F 2ILZA 2XMMA 3HVRA 1IM6A 3CJKB 1J6ZA 4CERA 2YNGB 5F0XA 3MEGA 5LMUF 5AKJA 2KVIA 4DPYA 2VKRA 2DNNA 1RGVA 4L6V3 2YJFA 4KHYA 2EC2A 3ILLA 1T6CA 2IY5B 1RTHB 2EAMA 4V19X 3OL8A 1Q18A 2GA7A 3JSMB 4A48A 3PFEA 1SZHA 2YTUA 1GOAA 1KVKA 5DGBA 1RDWX 3NOCA 5ETNA 3GDXA 4R5PB 3P38A 4TQRA 1H73A 2J6TA 4CEZA 2R7RA 2RAQA 1V9OA 4UATA 2BA9A 3C6TA 1XK8A 3LP2A 1VQ9S 1WAJA 4ZVHA 4M41A 3N7SC 2G5IB 2E2PA 3MPYA 4RQ1A 3MK6A 1KONA 4I9LA 1S9FA 2DH8A 1OYDA 1HI8A 2PFQA 3D0IE 1RHKB 1I94K 4WIIA 4A8YA 2XRIA 8ICRA 3UQ2A 3CCUS 4PA1A 2HBJA 2LXIA 5GMDA 3QT8A 3TTDA 1T7PA 1U7LA 1KXPA 1FVQA 2P35A 5IQQA 2LXUA 4BVOA 1VQNN 2LA6A 2BPFA 2IHNA 1NDLA 4X4RA 2B4OA 2XHCA 4Q45A 4F4KA 1S79A 3PZPA 2Q79A 1MWKA 1YSJA 1ZS6A 2CA9A 1RFQA 1RU1A 1BOTO 2B51A 2HHWA 4NXNF 3OHBA 2HHSA 3AL0B 1RJJA 3VEWA 4ILMA 4CF0A 5T7BA 5BYQA 3GPAA 3AVCA 1WI6A 4BS2A 1XSLA 4C80A 4F4XA 3MMCB 2KH9A 2O01C 1KWMA 2LQ8A 1RT4A 1H7WA 4ZLJA 5AQPA 1WBBA 1F5AA 2DO0A 5J2QA 1WWVA 4XPCA 3HTVA 4FYXB 2FUG9 3CMES 2YY6A 2P6TA 5A6WA 2XICA 5IC4B 2ZNYA 2D7SA 1Y4ZB 3K8WA 3CQYA 2YX1A 4LBIA 1BPZA 4Z6CA 2K8GA 1FO4A 4CT8A 4I2DA 2BTFA 3NGIA 1SWVA 4WP8A 4OX8A 2W3SA 5CA7A 1SH3A 4DG1B 3LYSA 1V3SA 4TXSA 4WBFA 1L3KA 4C0OC 4QQBA 4FS2A 1R59O 2G8IA 2GVDA 4M47A 3JTOA 4FLUA 5J2HA 3OYLA 1ESVA 5A8KA 5ETVA 4F0HA 2CGLA 4N8NA 1F9EB 2VONA 4DU1A 4KTQA 3QDKA 3BZKA 4J9LA 4JV5J 2LM4A 1BPYA 2ZE2A 3KHGA 2DNZA 1S4FA 2WF6A 4JOUA 3G82A 1Z2ZA 2FMQA 9ICFA 1UFKA 1ZQLA 1Q86T 5DM6L 1S6QA 2I38A 4ETZA 4X4QA 3DYAA 5KL8B 1DOQA 2JR5A 3D0HE 1L3TA 5KFVA 2JVRA 5JS1A 4USHA 3OSPA 4P2SA 4K4UA 1RT1B 4IG3B 1IKWB 3CD5A 1P90A 2W40A 3W7BA 4OJ3A 3THPA 2DNMA 3M8QB 4LF1A 2Q97A 1IBLJ 4GV3A 4DOAA 1BI4B 1B4SA 1VRTA 5ALGA 2RP5A 2CFXA 3H2VE 2AWZA 2W04A 2ROGA 1AQ6A 3PDNA 3UN2A 5DM6Q 2QV6A 4LFCK 4GMJB 1ZJMA 4BX9C 2HCFA 4AL6A 2UUCJ 1M5KC 4ERDA 3DLRA 4KI4A 3G6VA 4RBVA 4FZYA 5CCLA 3MPVA 3NCQA 3IG1B 5EU7A 3NS1A 4NXMJ 4K42A 4E7KA 1P8GA 2P9IA 4ILHA 1WHYA 3BGLA 1TKTB 7ICEA 2E1PA 1EKEA 4KHRA 2OFGX 1MMDA 2A3JA 2E44A 4PHTX 4K0KK 3ZT0A 4GVEA 1I3OB 2PMZC 4B3RK 3OW2R 4IKAA 3EDRB 4WTOB 3QIDA 1UW9A 2H48B 1CJKB 2OMLA 3GZ7A 1U48A 3QO9A 1QS4A 2DPNA 4HWIA 3LZJA 4K4GA 4FF3A 5BPNA 3NMAA 4LJXA 3PRVA 4YR0A 1RTJA 4UZCA 5GAHP 4RO0A 2MPUA 4AYBF 4I2PB 3OW2M 2QXFA 4O5BA 1X1PA 2VUGA 4NYNA 1LCUA 4ELVA 1B7YB 2MZQA 3ATUA 3TSQA 1TMJA 1FKOB 3UCZP 5TKWA 3M6XA 3AA9A 4URGA 3HZGA 3AY9A 1WORA 3QNNA 3ULHA 1XU4A 1XHZA 2XVTA 2FLPA 2HZVA 3VCDA 1S5ZA 3B54A 3MMAA 2E1EA 2QWRA 1VSEA 4LF9J 3OFGA 1XO0A 3NGRA 4YEAA 1CUKA 2NZCA 2UXDJ 4MH8A 5DG7A 4CRJA 1UPHA 3M8PA 4UUWA 4OFZA 1XMOK 1Y00A 5U47A 1XIQA 5DBBA 4WF9L 4NOHA 3C6UA 3QEBZ 2AYGA 3ZLJA 1WHXA 3E1YA 4UT4A 3CC2N 4RBTA 2GQCA 2CXYA 3CIZA 3BKUA 3P8BB 3V6JA 4HDGA 1FEZA 3GU3A 4CJSA 2HNDA 1UVMA 1FFUA 2QA1A 1ZQJA 2F3NA 2FGOA 1N60A 1YJ9N 3PKYA 1GLCG 4MKBA 2KSOA 3A8KA 4I0WA 3LK9A 3TO8A 5DZ7A 5EX5A 3FQKA 3ISBA 1VYAA 2GELA 3HD1A 1H0HB 5DDMA 1IR0A 1EZZB 5KFPA 1RKIA 3B6BA 4WF9Q 7ICSA 5LL6Z 3K9JA 2P6UA 3IWXA 1HI1A 2WFBA 4XDCA 4ECYA 3QRRA 4ILGB 4RWTA 2EFQA 2O3DA 3FSIA 2YHXA 4BCAA 4ECWA 2FSJA 3BB5A 2FJVA 4GV9A 1ZD3A 3BSNA 4YMOA 3NL0A 1FT8A 1SL1A 5KFLA 2JH3A 4ZIVA 1RI7A 2OHDA 1WUDA 2YNFA 7ICFA 3D1QA 2QX0A 2MKSA 4O44B 9ICJA 4K2XA 3RJJA 1WEZA 4NLBA 4DL0C 3CC4N 3NVVA 4EEKA 1HR0J 2K3IA 1HJRA 4NI2A 1YJUA 2M70A 4QPTA 5GIOA 2BABA 1IG8A 4YOXA 1KL9A 4LSNA 3CJRA 4EBEA 2KJVA 2WVCA 1U47A 3HPHA 4TYBA 3F2KA 4M5GA 5F8JA 4LF5K 3T1YK 2HQDA 1RCXB 2Z1HA 3QERA 4DPUA 1ICEB 4KKOB 4DTSA 1UVKA 3E9OA 3HULA 1DRZA 3HJVA 1XNSA 1WJ9A 3G25A 3K0SA 3KUGA 2BVZA 1HNIA 3P4UB 2D6FC 3W1YC 2HEKA 4DTMA 1IKYB 1Y64A 3UQ0A 3QE9Y 2E1ZA 3ZDCA 1KC8T 2NYIA 4IQMA 3GBTA 4IR9A 2DPJA 4PKIA 4YMEA 1PZNA 5HANA 2E6LA 3ZSZA 1VQ8S 2B7CB 2R3VA 2BBEA 3KWGA 2DNRA 2V2KA 3KZXA 5BRFA 4B1VA 4CJ3A 4A8EA 2O1PA 5KPTA 7ICMA 2VIHA 2IVNA 1CBKA 5T14A 2J8SA 4Q8EA 3HDSA 4BRLA 4JKDA 3TFSA 3OS2A 2NZTA 3P5BP 3C5GA 2GIFA 1QSSA 1QAXA 1ECWA 2M2BA 4UBCA 1J5OB 4H5WA 2JC0A 4DR3K 3MMBB 1N0VC 1EARA 2HWHA 1KKXA 4MO4A 3PJ9A 5CHIA 5CZ2A 3K9KA 3D6HB 1HFEL 2MYFA 3NXZA 2BE2B 2AYMA 4QR1A 2ZGZA 2C42A 3ZETA 1SC1B 3SQOP 3ZSRA 5L1JA 2V50A 2VANA 4DR6F 2K60A 4OYWA 3PKMA 4Q2LA 1SI9A 3M2UB 1E6VA 3TJAA 5DZ6A 3CIPA 2R2RA 3OXGA 4ZPVR 3RH4A 1Y5NB 1RDCA 3A8JA 3VQEA 2M52A 2JC1A 4LJMA 4ZLNA 3ENVA 3SUNA 1WSGA 1N33K 1LWCA 1WG5A 5KFNA 1UPMB 1VQ4S 3T7ZA 4A61A 4EFHA 8ICGA 1Q8LA 2E1RA 4DX8H 1A76A 4A8MP 3FM9A 2RHFA 4K7QA 4IXCA 2IIHA 2YNIB 2Q0RA 2DR5A 2L9NA 2VFUA 3LDLA 4DR3F 2HWTA 2Z1IA 4OYIA 4KLDA 5AQGA 4DTPA 4YFKA 5GAHU 4EP5A 5AQOA 3DLHA 2PMWA 2OSQA 2KRBA 2ABYA 5IWAJ 3TUIC 2W6LA 1TTHB 2P9LB 5CYMB 4L72B 3AVNA 2KKPA 3CUNA 1K1SA 2YPZA 5AI6A 3RMDA 3QT7A 2X78A 3MOZA 2I6XA 1C4AA 3F9MA 3F2BA 2XB2D 4FJXA 4FPIA 4H0YB 2W2PP 4BRMA 3EY1A 1FD8A 1XNQK 3QNWB 3F2CA 4CJ5A 2AX1A 2A1AA 3G71S 4I2QB 5DB7A 2WB1F 2NXUA 3M1VA 2M88A 3ALYA 2UUBK 3LWLA 3PO4A 1G4CA 4BC5A 5CHCB 3VEZA 2VG6B 3TVZA 1FX2A 5KFKA 3H90A 5CZVA 4PHPA 2MY7A 1TVAA 3EYZA 5KFAA 4LF8K 3V6KA 2O4GA 3WXJA 1ATRA 4PQAA 4FWKA 4KJIA 2QA2A 5ALOA 4YHHJ 5AZJB 1NOMA 1RAEB 5BR8K 1A77A 3E58A 4BRGA 1NNDA 3I6PA 3FZKA 4KMUA 3AH6A 2IVPA 1JROA 2YKQA 4PCQA 1WF2A 2CJYB 1IKXA 2BPGA 1KBRA 4MTPA 4F26A 4I1TA 2VBWA 4F4AA 2M0GB 1TUUA 3PCOB 6AT1B 3L8BA 3ENBA 5DG8A 2XMTA 4YCXA 2P2CB 4KO0A 3VGMA 3H5UA 2QT7A 1Q95G 2IC3A 2A1BA 2WMMA 2KHOA 4Q44A 3WX8A 2J7UA 1JLFB 3G9CA 1J53A 1JMTA 3M5RA 1Q9XA 4BGBA 2ZZMA 4BRKA 5F8MA 2H5JB 1IN0A 2WVBA 4JK7A 3HT3A 5DDRC 3HYFA 1R89A 4CGJA 1O08A 3BS9A 1HQEB 5AIAA 4K4TA 2VHGA 3N5FA 2ZJAA 4BDYA 4JRPA 3D2EB 2MZRA 1RYRA 4DR7J 1RBTA 4ZP9A 3QSIA 3I8DA 2CQHA 1RBAA 4FYWB 2MEWA 4CLZA 3NGDA 2G8UA 2BOPA 3M4XA 3VALA 5J2PA 1OW5A 2E7XA 2OPPA 3MXIA 3C46A 3KD1E 1GXUA 3NCRA 4LIRA 4KIAA 3OTEA 4QWEA 4ECZA 3F73A 2MUTB 3H1VX 2ZDOA 3ID6A 4N47A 4YB6A 3AD7C 1RM6C 1CQMA 5DQGA 5HQ8A 2J0WA 3K89A 2VDIA 1OKJA 3B78A 5F0UA 3E8OA 4NM2A 1ASVA 4CF5A 3M8RA 3TAQA 4HCCA 1V97A 2WCXA 2W55A 1EKSA 4NEZA 3ZXWA 4DR2J 2E5SA 4C8LA 1A7GE 1BC6A 5IIOA 2KHVA 3D1OA 3C19A 4DR1F 2FBVA 2A19A 1RG6A 2X6SA 4CD1A 2EZYA 3R8EA 3AO4A 1IBKK 1LW0A 1XR7A 1VK3A 3N7PD 1YZ7A 3S3MA 1HWLA 4N41A 4TURA 1UEKA 3O5TB 4CHNA 1H74A 3AVJA 4C48A 3CD6S 3KNAA 3CDWA 3W5YA 4PPDA 4QU7A 1K9MO 4CGDA 3LO3A 3ICXA 5C2CA 2Q31A 5F8HA 3NVKA 4Y2MA 4C1NI 3UN5A 1RWWB 1BNOA 3IR5B 2MQPA 4E3SA 3KUHA 3BQ2A 4K59A 1YUWA 4CTAA 4QWCA 3FEYB 2QEXS 4MEXA 3T5HA 3H2UB 1FJGK 3CTRA 1HHSA 4OX9F 4PZVA 1CXUA 3J80U 1N48A 4ZJQA 4JI3J 4Y65A 2FJAB 1N62A 4FM1A 2B9EA 2HGMA 4NLUA 1CZBA 3CM5A 2KG1A 3UDVA 2U1AA 1F21A 3SSRA 1F6TA 1S1UA 1S7IA 1VMBA 2K8AA 4YN4A 1BLUA 1JLEB 4DV7F 4RR5A 4YNQA 2YNHB 3QGGA 4UZBA 3V2UC 2QLWA 1H2TZ 2YMLA 4PWDB 3SUPA 3D66A 1SXLA 1IKVA 9ICPA 2W42A 2CQDA 3PW5A 2VFVA 3LDPA 4FZXC 2W54A 2F77X 5F41A 5M2PA 2LCWA 2HBMA 3D4JA 4F9OA 4B08A 4QBUA 4MK8A 2V8VA 2QWPA 3L4BC 3W0LA 1VDVA 5L38A 1WEYA 2XZWA 3KK2A 2ZOGA 2J6SA 3BGRA 4G9ZA 5GMKa 3BSOA 3V6DA 1HWJA 1ASUA 5C12A 1KLMB 7ICIA 3T1HK 1PJ7A 2HIYA 3JSYA 4RWXA 4TN2A 4WKYA 7ICJA 3LW5C 1S1XB 4O4GB 5HL7L 2HRYA 5M1OA 3PR4A 4YOVA 4ZVFA 2G0IA 2WAQF 1IWGA 5CZXA 3AB4B 5IIMA 1RQLA 2CVIA 4KLHA 2KVSA 3DAWA 4WYWA 4OJ1A 4IOAL 3NF7A 4KREA 2BCSA 3H1QA 3QINA 4OJRA 5B8HA 4BRPA 3ZEUB 4CO0A 4ZCLA 3MWTA 1C0UB 2CG4A 3O6WA 5HL7Q 1O13A 4F0MA 1MMLA 2O8FB 1KEJA 4JS4A 2XSFA 4KSEB 2W11A 5KOXA 2BUPA 4DV5K 5H9FK 2QYGA 2UXCJ 4IOAQ 3BV8A 2ASYA 3CD7A 4E19A 2O8EA 1EIYB 4M5HA 2PE8A 2DNOA 3N4PA 3OSNA 3BZQA 1NJYA 3J7YI 1JRPA 5AJ3K 1R0AA 5AQRA 1S72S 5AQZA 2R8IA 3KHHA 5LY3A 5JXSA 5CD4A 3PW2A 5AXKA 4RW7A 3MWBA 2KOBA 3VAHA 1B0XA 4LFAK 4BWJA 4CZMA 3N0VA 1X3MA 3DLEB 4GC6A 5IT9O 4PHDA 2XIDA 3IKMA 2NSCA 1JLCB 9ICLA 1M0SA 3A8EA 4FJHA 2QLJB 1FE4A 1RT2B 2Z1JA 4M3RA 2R8GA 4DTRA 3FFIA 4YB1P 2J0SD 3KLVA 1G2EA 3BN7A 4P2XA 1AW0A 4DV5F 4CLPA 2IIRA 4P0QA 3OYAA 4R0EA 3OYBA 2OGUA 5LSRA 1S0NA 2FC0A 3THWA 3LDAA 1OH5A 1HQUA 1QAJA 1PJ6A 3WZ0A 3NY0A 4F36A 2YX6A 3LL3A 2OMOA 3KLGA 1KAYA 3SZ2A 3OS1A 5AJ3F 4DPOA 5JVHQ 4IDHA 3PYDA 1H3DA 3G2XA 3HKZC 4F5NA 2N7CA 3HSTB 1WTFA 1KD1T 3O0FA 5HQMA 3RH5A 5LJ3Y 3WK4A 4E1NA 4RNOA 3NP5A 3K8VA 4EGLA 3BGFA 3CDBA 4O5FA 2R18A 1X5TA 4K5SA 1FJ7A 1K8KB 1IH7A 2P5GA 2P9KB 5AICA 1DQAA 1WOSA 5T41A 2JVOA 3DLGB 3KK1B 4CDGA 1N5SA 3DMJB 1SL2A 3RJMB 3SFGA 2ZUBA 5DMRA 4L76A 2KICA 2K06A 1N34F 2Q0ZX 3KLIB 4P7VA 3BDEA 1K0VA 3R5BA 5T7LA 2B21A 4OPJA 4RWWA 5HATA 1X4GA 3IS9B 2PBDA 3N7RC 8ATCB 1V4TA 3QJJA 1U8WA 3B4MA 2E5LJ 1IBMF 4B3MJ 2GQ2A 1IXRA 1TL7A 1RUSA 4CO5A 2LVWA 4QS7A 4R0JA 3U26A 4IRDA 4FNHA 1E4FT 3MF5A 3ID8A 4MFCA 1PO6A 3DXKB 3AO2A 3P49B 5HMZA 4FJJA 1TL3A 1EQMA 4OI2A 2X1GA 2B3TB 2ZD1B 1OWXA 4EHUA 3CCJS 1KNZA 3VTIA 5AQQA 3WNEA 1NMNA 1YT3A 8ICSA 3CJKA 4NYFA 2YNGA 3I55S 4CI6A 3BKFA 3G6XA 2YKAA 4PL8A 3HHKA 4PPZA 3VF6A 1RTHA 4CJVA 4OHWA 4E2FB 2YHAA 3L2UA 4JWMA 1SB6A 4USKA 2HFUA 2XSJB 2XCAA 3OUYB 3JSMA 4CD3A 3M1FA 2Z7JA 2AYEA 4R5PA 3SMZA 2LDYA 5M2UA 2R8HA 2MLYA 2R7QA 1YZ6A 3G8QA 2XI3A 2JSXA 1A5XA 2A10A 2EK6A 1YWXA 2W4CA 2FVCA 5AZIB 4CZKA 2ODGA 2ALZA 4DUZJ 4PG4A 1NPRA 1P7DA 4DSKA 5F3XB 5J2GA 4KHQA 4FYYB 1GMWD 4DHYA 1N8RT 5B7WA 2QLFB 2IVYA 1VQNS 2E1MC 8ICMA 2NUHA 2VASA 1UMJA 1VDHA 2QTWA 4USWA 4AM6A 4DMNA 1MWYA 4H0XB 5J2JA 1X66A 2Y0SC 3ILIA 2FDNA 3NGSA 1V4SA 2J7KA 4BRHA 1IBLK 4Y2IA 4PKGA 1YIJN 5ALUA 3PYFA 3HWTA 4F67A 4DL7A 4EMDA 3LVWA 4LRAA 4KTZA 2F8LA 2V2QA 2E5HA 2HFZA 4QIWC 3LGHA 1HKAA 3GFZA 3NCPA 1QLNA 1DK3A 2UUCK 4JI4F 1ITPA 3WXKA 1L7MA 2QXLA 3TAMB 1RWMB 4NXMK 3MMCA 2J0XA 2Y9UA 1UHUA 4X4TA 3ZSWA 2D8CA 4X62J 3MN6A 3ZDDA 4IS7A 4JV5F 2BPCA 3UFCX 2GMHA 5EUHA 1IV0A 5J2AA 2IYGA 3AU2A 3MGJA 3A0IX 2RRDA 2HLUA 2GH1A 3POTB 4I2HA 2VJVA 1L8OA 4QWBA 3SSQA 4C4WA 3E0FA 2F8MA 2VFTA 1FRXA 1HNXJ 3CFPA 2ASMA 3SFUA 1RXVA 4RLEA 1WUAA 1GMUA 4CFBA 1RBVA 1VI7A 5AE1A 2DGOA 2HK3A 1JCEA 1HJOA 3QQCD 4IH7A 3DOLB 1EETB 4PXBA 1BU6O 2IVOA 2F1FA 5F3TA 1SZ2A 4XQ8A 4DG1A 2IOFA 5HBMB 2MZ1A 1X5OA 3ZCMA 3CD0A 4QOZB 1UCNA 3CQ8A 5AKLA 3H08A 3U1LA 2B9YA 1N5YB 1WI8A 2CZ9A 2F9TA 4KHMA 2JZBB 1M5PC 2UP1A 4LF9K 2MAXA 4IOBA 2O6KA 3IM9A 2A41A 2F1JA 1RHQB 1JXLA 4OZLA 2UXDK 4PG6A 1N5VA 2IDEA 4EBCA 2KRRA 2MHEA 4RQ5A 1Z2LA 4OGEA 1RT1A 4WE1B 1WG8A 4DWIA 4IG3A 1IKWA 2H51B 2JJ4D 5HMYA 4DMZA 2VFSA 1BWEA 5CY4A 4AHCA 2R7YA 4H0VB 3M8QA 3AU6A 1BI4A 4N7TA 2FPLA 2GNKA 4CGGA 3DU6A 4RQ8A 4BRFA 4AILC 3A4TA 2VA8A 1KVAA 4L75A 1SJFA 3OT9A 3DLLQ 3GR1A 5E3QA 2VQEJ 1SH2A 4KX3A 2KZMA 4H03B 1QTMA 5M1PA 3QEPA 2IJFA 3W9JA 3IG1A 3KKAC 1D1UA 2LMIA 2KT3A 5D0GA 3IBPA 4U95A 3PJXA 3V9SA 4Q5VA 1SJRA 1VQLS 1TKTA 1HKBA 4LH5A 1GX6A 4XPEA 4RX6A 2FMPA 4LF9F 3VQTA 5IZHA 1WC0A 3MPDA 2X6NA 1Y11A 2OKQA 4PKDB 1V5VA 2BKOA 2BJ1A 4CE9A 1WC6A 2LEAA 1CJKA 7FD1A 4KYZA 2OZSA 3C6HA 2D3ZA 3JPQA 4KV8B 2HPUA 5BR9A 4FW2A 5KFBA 4C98A 4ZJLA 3SK3A 1WNSA 3MX2A 3KLHB 2DQNB 3UVJB 3FEZA 5J2NB 3J7YP 1BWVA 5J0YA 1UAXA 3AA8A 3SQIA 4I2PA 1WSRA 1HR0K 2V8DA 2F1IA 4NJ8A 2RILA 3TTCA 1FKOA 2P6RA 3OHRA 4Y2KA 1SXEA 2Z2ZA 3MM6B 2RE1A 2WBMA 4Q7AA 1RTDB 3RJFA 5AM0A 4TLRA 4FYDA 1VRUB 4CESA 3MM8B 4FJGA 1HNZF 3O9UA 1FXDA 2RMLA 2FJDB 2H9ZA 1RACB 3PMNA 4A4JA 1VBYA 2BKPA 1BA1A 3LDOA 2QMUB 4NY8A 3D7SB 4BDZA 1D8LA 2P9EA 2AP1A 3SQ2A 4Y6IA 2CH6A 2PEHA 2R42A 1KFTA 5AQMA 5F9NA 3NHGA 3P96A 2Q4TA 5A8WB 4YOYA 3SMPA 4NM1A 2ASPA 4AFFA 5FRMA 3PJWA 1QHTA 4CLSA 3S6EA 5C25B 2YWFA 2LQ5A 1U1KA 3IV6A 4CH0S 3WNHA 4FWLA 2WVEA 4X64J 3RRKA 3I56N 5K14B 3W3SA 3OLAA 3MM9B 1RADB 3LPYA 3I96A 3CERA 5ADZA 4IOCL 2O8BB 2VPXB 3ETOA 7ICKA 1ZRNA 1RE1B 1RWVB 3IGVA 7ICQA 3CJ7A 3THYB 2B43A 3CC4S 3CDEA 1JL2A 1Z26A 1ZQWA 2VBYA 4HACB 3FNNA 4UOFA 2W9CB 4JV2A 2XEXA 3NVYA 4ZPDA 2UXBF 4LVOP 4O44A 1T9WA 1XNRJ 2D5RA 4YOTA 4EBDA 2HZCA 4IOCQ 4HT7A 1O03A 2D1CA 2CDRB 5FDLB 3NKYA 3J7AN 4MN4C 2DYAA 2EZZA 1HLWA 3ISDA 2EVZA 2M8HA 1J5EF 2G2ZA 4JKGB 2BX6A 1X4DA 2UUWA 3BJYA 3OYCA 4Q2MA 4JI0J 3CJAA 1BNPA 2FTRA 2E1CA 5J0PA 3CE8A 4JLHA 1RT5B 3ZZRA 3GONA 3S8SA 1K8AT 3M8SA 4M0AA 4XK8C 1CJTB 4P75A 2P1JA 4EO6A 4DV4J 4KKOA 2LLZA 4LD0A 4I6WA 1SGGA 2XMKA 5ALRA 4RKUC 4ZVUB 1IKYA 4HTIA 3D6RA 2D3OR 2PGCA 5JTIA 5ELZA 5JMVA 3BY5A 2L48A 4OKEA 1H7XA 5IWAK 1R6VA 3HMJG 2ITMA 3BF1A 3V7LA 2YWKA 1R0BG 1LWEB 4X5VA 4CF9A 3CRXA 2HMIB 4TU7A 1RNHA 4Y1DA 1UETA 4GMKA 3QNOA 5HRNA 4MIAA 7ICRA 3D6MB 1XUPO 2GW8A 1TV6B 2WW8A 1WLJA 4QR0A 4Q0BB 2WBNA 4UBBA 3RJEA 2GMLA 4CIGA 1W9HA 3MDQA 4CO1A 1KBUA 2ZWPA 4JS5A 1Q86O 3K5MA 2DGWA 4DPWA 5B0DA 2A6AA 1LXNA 1J5OA 2D0AA 1COOA 1G15A 1RCHA 5K4LA 2FBXA 1W7AA 2LECA 3MMBA 3TPQA 3LPTA 4C4SA 2AGQA 3W66A 1VQON 2LYBA 4HHHA 3NWRA 3N9UC 3HSZA 1UJ4A 4EIAA 5LM7E 2RE2A 5ALYA 2W2MP 2GV1A 4NZ7A 2M4MA 4ZVQB 2E6MA 2BE2A 4YHHK 2OEKA 2J9DE 1ZTWA 4BJQA 1LXJA 4DS5A 4DF4A 3B82A 4J90A 1C20A 2YPYA 1PK1B 3U4LA 1EP4B 4LZGA 2M9KA 2F76X 1M5HA 1BHLA 3M2UA 4WCEL 2F4VF 2IA0A 2JGUA 2J9DA 2DH9A 1VQ6N 1YJNN 1ZM2A 3LZIA 2KFZA 3D67A 1K1QA 4LF2A 4ZPTR 3UNGC 2K1RB 1KQKA 1BVSA 1QVGR 2I9SA 8ICIA 4NCBA 5ALDA 1XMBA 3AXMA 2R7TA 2V7ZA 1NOZA 4P4PA 3WT0A 3LH2S 4I7FB 4P9SA 1NGHA 5DDOC 3ET6B 3BQ0A 3BS7A 3IG8A 4DL3A 2YNIA 1EQ0A 5HROB 3R8YA 7ICGA 2VIXA 4M5IA 5L46A 1QVGM 2KE7A 2JLEA 2XY8A 1B0VA 4CHPA 2BGGA 1VQMN 3FQLA 4M6WA 3MR7A 3J7YU 4O9MA 4ZKAA 2EBGA 3NVZA 1PJ5A 3MR6A 2F5GA 1NHKL 2EFVA 5KG6A 1RWKB 2QWMA 5BOMA 3IWLA 2P9LA 5CYMA 4DR7K 3VF4A 4PL1A 5IIIA 4O0NA 2NZ4A 1JCFA 4TLQA 4OKKA 2WTUA 4PUOB 4RUHA 2IMWP 3MAHA 2I6WA 4HT5A 1GAOA 4NLNA 1S1VB 4TNOA 4I2QA 2MXYA 3MN5A 4Y34A 2MZJA 4I9QA 3CT9A 3O3HA 1VQ9N 4QZCA 3PHTA 1WC5A 4C7YA 1XC3A 4NL5A 4FZZA 1QE1B 3Q7CA 2HQGA 1MW7A 4DL2A 1T0TV 3PY8A 1S9EB 4DOZA 1ZAXA 3FR0A 2W7PA 4DTJA 1U45A 1IWAA 3C2MA 3R6MA 3W9IA 4OYZA 4KGXB 1R43A 3HRGA 2A18A 2DISA 3TP2A 5AR0A 3BO2A 3D7EO 5AZJA 3ULDA 3AOAA 1YJWS 3BS5B 4ZN1A 4UB8U 3P39A 3KMSA 5AQJA 3T1AA 3NG8A 4Y2SA 1VBZA 3FCVA 1RWNB 1BQXA 4MIBA 4FK0A 3VR1A 3VTHA 3UXNA 4K2JA 4NO7A 1JLQB 5K5MA 2WVFA 3GTYX 4YR3A 2ZFHA 2Y8YA 2JFDA 1UL3A 5ETSA 2Z30B 3OV7A 5E0OA 2DNYA 4CZLA 2MKCA 2CWXA 1C0GA 1TUYA 2HBRB 4DR4J 2IFXA 3SCXA 2E8PA 1JLFA 1IXKA 1NKEA 2RIJA 3TWHA 2HOQA 4PGXA 1WOOA 1JIHA 2VU5A 2GJ2A 2QM1A 4IOXA 2ZITA 3KKRA 1P9YA 1FXXA 2ACMA 2RDIA 4J2EA 4JI3K 4F3MA 4P2MA 1HQEA 4DR2F 1ZQGA 2EWSA 1JJ4A 5A2QY 3ENOA 1NU0A 2D0BA 4C9DA 3D2EA 5IIJA 4FJ5A 4KGZB 4H4MB 3OTOJ 3R1LA 4IQTA 4RNMA 3D54A 4JI5J 5DDPC 1WSEA 5AQWA 4O3MA 1XEZA 3KKAA 2CH5A 4UB6U 2ZBRA 4BLGA 3FBEA 2D0PA 3H5SA 3CJTA 1HPZB 1NBWA 2IMOA 4CQ1A 4B1WB 2E9RX 4HYKA 4ZITA 2VL1A 2MUTA 4RTFD 4DV6F 3ZT1A 2F7VA 4M9HA 1BQMB 3DI6B 3GQCA 3F5TA 5HMWA 1NM2A 3O3GA 4O5CA 3EZOA 4B3TF 1LKYB 1S3XA 4LF4J 1VHFA 4QIFA 1RAAB 3OD2A 5DQHA 3IDHA 5IINA 4ES1A 4BR5A 3GFXA 1KC8O 2BE9B 3CNHA 1ZOLA 3MHYA 4GVBB 1YBTA 2OWOA 3RG6A 1ULRA 3E2EA 4JI3F 3C7NB 3KOAA 3SJJA 1YAGA 3FMWA 3R6GB 3DCAA 3CCTA 1NGCA 3SENA 4NRUA 5RUBA 2DH7A 4YB5A 2FHOB 1N32J 4ECXA 5G5GA 4ENOA 3R97A 4BREA 3S9HA 4BBYA 4B3SJ 1A5VA 4KBOA 2JMGA 5JLFA 5KAKA 3MGVA 1ITGA 3CDUA 3QU4A 1C7YA 2ZJPL 2X1BA 4RQ0A 1RA6A 2A3ZA 2R7UA 1GOBA 3TR5A 4XDDA 4TQSA 1PYSB 2DL0A 2C3PA 2WZ1A 4ANEA 5AQUA 3R5CA 4DLEA 4Y2XA 4MJKA 3C6AA 4O5KA 2UXCK 3FSYA 5EWEA 5J2FA 3C15B 3NUQA 2ZJPQ 3OVSA 1ZZNA 4JI1J 4GKJF 3QX7A 3H4DA 4Z7YA 2DFHA 1OUQA 3MMJA 3BP8A 4C1NK 4JV0A 3OPKA 4QYZJ 3P3DA 5ITHA 2ESEA 3EGZA 4CLLA 3S3NA 1D3WA 5BPMA 5AM1A 4BC9A 3X3UA 4DV0F 1Q81T 1HNWJ 2IGIA 1JLEA 2AT1B 1QQCA 5M1KA 1RAOA 2YNHA 4CGHA 2GWKA 1NSAA 3IAM9 4CBUA 1UKUA 5KFTA 4ISFA 4PWDA 4DCHA 1S12A 4RL1A 5AKHA 4CW7B 1N5QA