1NK0A

Adenine-guanine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk0A01
1QTMA 5J0YA 4C8LA 4Z4CA 5CY4A 4FCYA 1QHTA 4CJ3A 3TAMA 4QWEA 3UXOA 4UBBA 1HYVA 3AVCA 2XGPA 2YNIA 1S0VA 5HRPA 2ISPA 4H4MA 2G8FA 3HPOA 5KRTA 4QWBA 4R64A 1LW2A 1NKEA 3DLRA 3ISBA 2EHGA 4OLAA 3KHGA 4TUQA 3LAKA 8ICPA 4RQ5A 3ZSVA 1KSPA 8ICJA 1A76A 4KLGA 2R8HA 1CZ9A 2IAJA 4QZHA 1CUKA 3HK2A 2NRWA 5F9LA 5KFOA 4F93B 2JEFA 1EX4A 5KGWA 1RDDA 4Z4FA 2BHNA 3V9UA 4FLVA 4EYHB 3QIOA 9ICXA 4JRQA 3UQ2A 4RW9A 2D0AA 2JEJA 4CJPA 1S1VA 4BE0A 3Q8RB 3VQ9A 4DS5A 4J9MA 1XC9A 5J29A 3O3HA 1ASUA 3IHQB 2JZBB 3OYKA 4CEAA 2KZZA 7ICPA 1SKSA 4N47A 8ICXA 4PWDA 4MFBA 4CK1A 2PXIA 4J2AA 3TAEA 4HYKA 3VQ8A 1U04A 4GLXA 1KFTA 5HRRA 1VSHA 9ICIA 3L3UA 4O44A 1KVAA 3H08A 1NJXA 4KHWA 3A2FA 4FJ8A 3NH1A 3PX4A 3C1YA 5K14A 3VQEA 4FXDA 1HYSA 4RT2A 4ED1A 1RT7A 3C2KA 3QEBZ 4M3YA 3V9ZA 4QZDA 1SUQA 4QWDA 1A5XA 1BCOA 2ALZA 3C5FA 8ICCA 3GQCA 5KFJA 1ZQOA 3LPTA 1S5JA 3V9SA 2UVWA 2W9MA 1RBVA 5F9NA 1D5AA 3C5GA 2J6UA 9ICCA 3PNCA 3NGZA 3K5MA 4CEEA 3BGRA 3KTQA 3KJVA 4DTMA 4DL3A 2ASDA 4FK2A 2BCVA 1LWCA 1CZBA 5CZ2A 1K1QA 4BDYA 1JLFA 4X5VA 3OYMA 4KLDA 4KAZA 1KEJA 5L1JA 4CIEA 3PW0A 2DFLA 3DM2A 3V7JA 5J0QA 4QZ8A 3KK1A 1B43A 4C8KA 3QEVA 4NCBA 4CJ5A 4QW9A 2W9BA 4F4WA 3UPQA 3PW7A 2KFNA 1IO2A 4OGEA 4YFKA 1DOQA 4R8UB 3SQ1A 3TANA 4DTSA 3Q8SB 5J2JA 3VQCA 5J2PA 4DSFA 1KVBA 2W42A 5D46A 5DB6A 4PGXA 5KFVA 5CZ1A 4M2YA 1KFSA 1FKPA 4IRKA 4XQ8A 4RZRA 3V7KA 2IS3A 3KLGA 3KD1E 3RJJA 4N5SA 4NYFA 3ZT4A 2FLPA 4CIGA 3DI6A 1BPYA 5KFYA 4R66A 3VQ6A 4J9SA 2KQ2A 2VA3A 3LDAA 3OSPA 4QZEA 1X2IA 4DTNA 4O0IA 1B9FA 4TQRA 2BQUA 3DRPA 5J2CA 3THVA 2HHXA 4YMMA 4DSJA 3OYEA 1ZQNA 1RDBA 4ELTA 5KGXA 4HVJA 4DTXA 5EWEA 1S0NA 4RNNA 4EEYA 4YMNA 4G3IA 3KLIA 3DRSA 4JV1A 4I29A 3NF8A 2BR0A 4BXOA 2YHAA 3GILA 3KKRA 3JPSA 2KZMA 3CFPA 1RT5A 4YVZA 2A1SA 3AO1A 4OKKA 1Q9XA 3SJJA 4FJGA 1W0HA 3HSTB 3M8QA 4LD0A 4P4MA 4E7KA 3OYLA 4TUPA 4ECWA 4Q8FA 3HX0A 4KO0A 2J6TA 1S10A 1ZQPA 1BPEA 3V1OA 2AJQA 2B6AA 4J2EA 4OLBA 2Q0ZX 9ICEA 4RQ8A 1BI4A 1KTQA 4W5QA 2PY5A 5L1LA 4YD2A 3AVLA 1VSEA 4JK1A 5KT3A 4DOCA 1GOCA 4RQ4A 1HJRA 4I2GA 3HM9A 4GXIA 4ECSA 5TZVA 4CGIA 2G8VA 3QEWA 1R0AA 2D0CA 1ZQAA 2Z1IA 1S97A 5C42A 4ED0A 5I42A 4KRFA 3S3NA 3NFAA 3RB4A 1T7PA 3PW2A 3KK3A 2BPCA 4UQGA 1NK8A 3ISDA 2HHUA 3RMBA 3S3OA 5DBAA 4FJKA 4NCGA 4Q5VA 1VSKA 5J2DA 1S6QA 3K59A 2XCPA 4CJQA 4TSXA 4ECUA 4RT3A 5J0RA 4RQ3A 1QQCA 4FK0A 1C0TA 2B21A 3AVJA 1TK5A 4CESA 4KHNA 4KTQA 3LWLA 5SWMA 3C23A 4DSKA 3MXJA 1Y88A 1NOMA 2I5JA 4YNQA 5CJ7A 2IBKA 3AUOA 2RPIA 4JRPA 2FBXA 4ECXA 4CFCA 1VSDA 1L3TA 3LP0A 3HXMA 5L9XA 4EBEA 3WNHA 3PO5A 4Z4GA 4R5PA 8ICYA 2MAXA 1JLBA 5DQGA 3AVBA 1SKRA 4AHTA 1LW0A 1TKZA 7ICTA 1LWFA 3LANA 4QZ9A 9ICRA 3EWAA 7ICVA 4KLSA 3NF9A 3OS2A 4K4IA 4C8OA 1U9LA 4KTWA 4CJTA 5J2MA 4DL4A 1WAJA 2IGIA 3ZD8A 1L3VA 1S9GA 4B9UA 3L2UA 4FZZA 4DF8A 7ICGA 3SNNA 4FLXA 1KDHA 4CF0A 3IS9A 2C22A 4QZAA 2P66A 5FRNA 4J2DA 3E01A 2G8UA 9ICVA 3K2PA 4M6WB 2OPPA 4DQQA 1RCHA 4E3SA 5KFIA 3PMLA 4YR0A 4R63A 3LPUA 4DOBA 4W5RA 2P1JA 2KTQA 3T19A 4DTUA 1JL1A 7ICRA 1DTTA 1WLJA 4BACA 4RW6A 3CQ8A 3RJEA 1XO1A 3RMCA 5J0XA 3V9XA 8ICAA 2F8TA 3ISNC 4FLUA 2DTUA 1N48A 3LP1A 2V4QA 4DEZA 1IKXA 4DOAA 1EP4A 2XGQA 4NLGA 4LH5A 1HUZA 3SQ0A 4J9OA 8ICHA 3K4GA 4M41A 1J5OA 3G10A 4OJRA 1UT8A 2NRTA 5KFRA 3M9MB 1WCNA 4NY8A 4ZHRA 2E4LA 4H4OA 5HP4A 1ZQBA 3DOKA 4HUEA 1CLQA 2V9WA 9ICPA 3ZSZA 4J9LA 5DGAA 4DSEA 3L2RA 2Q3SA 2R8JA 2VG6A 2W9CA 3ZSRA 1BISA 4XRHA 5KI6A 4L8RB 3V6DA 5DQIA 3Q8QB 1A5VA 4DU3A 3ZDEA 1ZBLA 4W5TA 1N56A 2HHWA 4BGDA 4YXMA 4ED2A 3QETA 4JV2A 1VRTA 1NK7A 3MFHA 2YV0X 1BPZA 1EXQA 3TFRA 4E1NA 4N76A 4F4YA 5HBMA 4IFYA 4CJ4A 1L5UA 4RQ0A 4CEQA 1Z00A 4IQWA 1F21A 4JS4A 1TKDA 4UB5A 1HMVA 3M8RA 4ED6A 3RJFA 1VK0A 2OA8A 4HUGA 4MF8A 5KFHA 4MQ3A 3GV7B 3DOLA 3ZSQA 4QOZB 1BVSA 5KG4A 2Y1JA 3VQ7A 1BQNA 3MDCA 1ZQHA 3AVIA 3V6JA 4TQSA 9ICWA 1K1SA 1X9SA 4O5BA 2FPMA 9ICQA 5I3UA 3JPOA 3ETLA 2FLLA 2C2EA 4JWMA 2YNFA 1SL2A 4J9NA 2F8SA 3KIOA 2Z1HA 1U47A 2F1IA 1IG9A 2IHNA 1DTQA 4DQRA 4BE2A 4EYIB 3HP6A 5FROA 4K8ZA 5FDLA 5L1KA 4Z4HA 4CFAA 3F9KA 4DQPA 4IKFA 3K58A 3JPRA 2OYQA 9ICAA 4MFFA 2IMWP 3IM1A 4CJKA 4BWJA 1WSHA 4O3RA 3ZT3A 4CGDA 1ZQEA 4LY7A 3NHGA 1I39A 4IFVA 3KLFA 3LP3A 4CF2A 4DL5A 4GMJB 3OYBA 5DBCA 4RUCA 4W5OA 1RZTA 2G8HA 3FYHA 4YD1A 4B3OA 3FFIA 1VSFA 1JLGA 2YHBA 3QEXA 4EP4A 9ICMA 4KLTA 4R65A 3VQPA 2F1JA 5CWRA 4Y1CA 4KB0A 3ZD9A 2X6NA 3QZ8A 4FJ7A 1UAXA 4MF2A 4CJEA 3CM5A 3C1ZA 1S77D 4XIUA 8ICBA 1XS9D 3RJHA 2ZJ8A 1XU4A 2JZBA 5KTQA 3Q8PB 1G15A 4OVLA 1RT4A 1UT5A 4ELVA 2IA6A 4IQTA 4DTJA 1JL2A 1QE1A 1MQ2A 4PHPA 4AHUA 4QWCA 4F4KA 3EYZA 1X1PA 5KFZA 1S9EA 1RYSA 5J0PA 3RBEA 3P5JA 1S1WA 2XC9A 3RH5A 3I8DA 5C24A 3OYCA 5DG9A 1VSIA 3C2MA 2HMIA 5J0SA 3HL8A 5CA7A 3PW5A 1Y97A 4IBNA 4I2AA 3RJGA 4K4HA 3RB3A 2QKBA 1ZQJA 2PFOA 3V7LA 3HP9A 5KFPA 2RDJA 4CFBA 3MEDA 3V9WA 4DTPA 2P6RA 4O4GA 4UB3A 1ZYQA 4CHNA 5IIMA 1ZQGA 1BL3A 2PYLA 4C8NA 3KK2A 1KRPA 3MXIA 3SV3A 1S0OA 2NRVA 2DPJA 2BCUA 3VQ4A 3DLEA 4F91B 1RT6A 3CFOA 2QKKA 2FBYA 4CGFA 2KZ3A 2P6UA 8ICMA 8ICWA 4K8XA 4FLWA 2YKNA 3VQBA 4XUSA 4RQ7A 3N4MB 2XCAA 3MDAA 3UIQA 7ICKA 7ICIA 1HQUA 2UVUA 1N5YA 5IIOA 1ZJMA 3P1GA 1CXQA 5JS1A 3PY8A 4CEFA 2R8KA 2ZE2A 1ZQIA 3ZDCA 4CECA 4Z4EA 2BCQA 4HHTA 9ICOA 4PQUA 4CF8A 3HVTA 4Q43A 3V1QA 3PR5B 4YQWA 4I2BA 2RKIA 4O55A 5HRNA 4RNOA 2YNGA 1XSLA 5KFEA 4N56A 1WAFA 1BCMA 3HT3A 1SL0A 3B6PA 3O3GA 5J2NA 2IHMA 3T1AA 4B8CA 5IILA 3WNFA 3MECA 4GC6A 4CE9A 9ICNA 3H40A 2XRIA 4YMOA 3ZSOA 9ICUA 3CG7A 2PI5A 3TAFA 3EZ5A 4B9NA 1ZQUA 4CFDA 3Q8KA 3MFIA 5CYMA 4NLNA 8ICQA 2HHSA 3O4NA 5CYQA 5CHGA 1RBSA 4O3SA 2GBZA 4M9LA 2ZQBA 4NCAA 2P51A 2J6SA 5D3GA 1LB2B 3LWMA 5DB9A 3FDSA 4ED3A 5J0TA 2OWOA 5KT2A 3PR4A 3I0SA 4CERA 3LZIA 4E7HA 4N41A 1ITGA 4I2PA 1NK4A 2W9AA 4DLGA 4Z0UA 3UQ0A 2JLEA 1WSIA 1RPLA 4O5EA 2BQRA 5KFUA 1C1AA 4UBCA 5J2FA 1YVUA 3NCIA 1ZQWA 3MAQA 4RQ1A 4IDKA 4JLHA 4CHQA 3QINA 4DQIA 2JEIA 4PGYA 2W9BB 5KFQA 3EY1A 3V6HA 4O9MA 2FMSA 2IC3A 4KLEA 4M9JA 1S1TA 1JMSA 3OSNA 4E7JA 4CIFA 4ED7A 4AHSA 3ISCA 5HHHA 1LV5A 2NRZA 2OZSA 4M47A 1H38A 1ZQYA 1BIUA 2DPIA 2PFPA 1N6QA 2PZSA 3AO2A 5J1EA 4JUZA 1T8EA 2A1RA 2NUBA 3OYFA 3UXNA 1IKWA 4QZGA 3DLKA 1HYZA 5KFNA 3G6YA 9ICSA 3ULDA 1IH7A 4GXKA 3LZJA 4FW2A 4FJ9A 3GV5B 1D9DA 1NKCA 4KLMA 4OKEA 4KHYA 3BJYA 1NJZA 5SZTA 1EXNA 3AVNA 1U4BA 4IR9A 3NH0A 3AO5A 2OPQA 3V6KA 3IG1A 5KFAA 2A1JB 1Z3EB 4QZBA 2X6SA 4ECQA 4J9QA 5CP2A 4BDZA 1X9WA 3HVRA 2ZTCA 4P2HA 1HRHA 5DLGA 3GFKB 1BQMA 4DMNA 2FMPA 1RXVA 1TVAA 2F1HA 1NK9A 2C2RA 1WSGA 3TQ1A 4J9RA 3MR2A 2ZTDA 4F3OA 2PYJA 2ZD1A 3OYDA 3G0ZA 4FK4A 2ISOA 3ZT2A 4GW6A 4NM2A 4DTOA 1TKTA 3QEPA 3AO4A 3OYIA 9ICFA 1TAUA 4MFAA 2HNYA 1RNHA 2ZUCA 2R7YA 3L2WA 3PMNA 3AU2A 1S0MA 4FVMA 3UXPA 4AHVA 3LK9A 3DLGA 1S76D 2I1QA 2UVVA 4O5KA 4QZCA 3VQQA 4K4GA 4F5QA 1LWEA 2GUIA 4ED8A 5KFMA 1QS4A 1V9PA 3AVAA 2RF2A 4E7IA 1TV6A 1CEZA 4M9NA 8ICEA 4YP3A 4F5RA 4I2CA 3BQ1A 5JUMA 3L3VA 3SV4A 4OGCA 4M3UA 5DBBA 3VA0A 3S9HA 1JLCA 3TI0A 4PA1A 2KN7A 3RAQA 4RQ6A 1VSJA 3ZSYA 2HNZA 4LVSA 1QSSA 3O4QA 4E89A 1TL3A 1S1UA 4I2EA 3SZ2A 3KHLA 1RT1A 1ZQSA 3AO3A 4PUOA 2HHQA 3D45A 4B9SA 4F92B 4H8KA 2D5RA 4G1QA 3RR7A 3MEEA 3E2EA 8ICKA 5HLFA 1TK0A 4NM1A 3HO1A 2I9GA 4LZGA 4Q45A 3DMJA 2LSNA 1RTIA 2VWKA 3EPGA 3M9NB 1ZBIA 4RNMA 1SL1A 3SPYA 4EBCA 3NDKA 3RR8A 2E6LA 3GIKA 4PPXA 3AVMA 5KG5A 2XY5A 1TK8A 5DK5A 4RW8A 4HCCA 1MC8A 2YKMA 1QSLA 3MEGA 1PZNA 5HMLA 7ICNA 3O3FA 2PFQA 3OS1A 3OHAA 4O0JA 2OPSA 4CK2A 5J2AA 5C25A 2ITGA 4FLYA 3M9OB 4JV0A 4PGQA 4KTZA 1C1BA 1S9FA 1L3UA 3TABA 5J0WA 4DFJA 3H7IA 2R8GA 4B08A 1UOCA 3ZCMA 2ZJ5A 3QEAZ 3OYNA 3IAYA 3T5HA 1RDCA 3QE9Y 4CGGA 7ICLA 2XY8A 1HJPA 3AA5X 7ICMA 1JN3A 2HW3A 4CEOA 5KFKA 1NOZA 4HCBA 1D8LA 1ZQMA 4KITB 5DQHA 3NF7A 5HMMA 4I9QA 1NK5A 4O3QA 3CFRA 1VRUA 2B5JA 3GV8B 4KMUA 3MABA 4CJVA 4MFCA 1YTAA 2BGGA 3V1RA 1IXRA 4ECRA 1JLQA 4ECYA 4DFPA 2BKEA 4ID1A 4F2SA 3KHHA 1ZQFA 2RN2A 2VWJA 4F2RA 9ICGA 2G8IA 4W5NA 3RRHA 2BDPA 4LH4A 2VANA 2PI4A 1XHXA 2UVRA 3H8SA 3ASMA 4FZYA 1JX4A 1WCLA 5BOLA 3OVNA 4FJ5A 5HP1A 3EPIA 3OS0A 4F5NA 3NAEA 4I2DA 9ICHA 2AGOA 1IKYA 4M3RA 2HHTA 4CHZA 4CJWA 3AV9A 5J2IA 1Z00B 3EW9A 4KLJA 2FPLA 3ZSWA 3D0PA 1RT3A 1HUOA 4DS4A 5J2KA 2QXFA 2H5XA 3BQTA 3RH6A 2E6MA 8ICNA 5KFCA 8ICFA 1CXUA 2Y1IA 4IRDA 2DY4A 3G6XA 4PHAA 3ZDBA 3JSMA 2XY6A 1TAQA 2B4JA 4HTUA 3QNNA 3SI6A 1U48A 3I0RA 3BQ2A 4YCXA 2AU0A 4OPKA 5DGBA 5J2QA 4UB4A 4I2JA 3WNEA 1B22A 4LZDA 1Q8IA 2BQ3A 4AHRA 4JWNA 3ORYA 2AQ0A 2AGPA 7ICJA 4KI6A 1JXLA 4RPYA 2MUTB 1ASWA 4GXJA 3L8BA 3H8WA 3GIIA 4ECTA 4CJLA 3RAXA 2FMQA 1TFRA 1FK9A 2ZUBA 2ATLA 3MGIA 4KLFA 2DFEA 4JS5A 1UA0A 3PUFA 2P5GA 4NYNA 2GV9A 1AROP 4DQSA 3B6OA 1SZPA 5KT4A 3T5KA 3PO4A 3AVKA 3ITHA 5KG7A 1YTUA 4B9TA 4CEBA 4IG3A 4EP5A 1KVCA 4Q0BA 4BDPA 9ICTA 2IDOA 3SYZA 4FJNA 3HYFA 1ZQLA 1DGSA 1NK0A 5KFBA 3AVFA 3SPZA 4CHYA 1RTHA 3RWUA 2HVIA 3DLBA 1RXWA 4CJUA 9ICLA 2BE2A 4FLTA 3OGUA 4M3XA 4HUFA 1ZJNA 1ZQKA 3T3FA 3K5LA 4YG2A 4E7LA 5IIKA 4CEZA 1TV9A 3MR6A 2XY7A 3S3MA 1KLMA 3MBYA 2OPRA 1S1XA 5J2EA 4ZH4A 4FS2A 1J9AA 4CHPA 4M9HA 5DB7A 4M3WA 4WE1A 4ZTJA 3AA2A 3NH2A 4M0AA 4BWMA 4KHSA 4I28A 3G6VA 2C28A 4I27A 1L3SA 4FJLA 4EZ6A 5C5JA 5DB8A 4I2FA 1XSPA 3AU6A 7ICSA 4M04A 5KG3A 3C95A 3V4IA 3OYAA 4TURA 1ZBFA 4XA5A 4KKOA 4R8UA 3VQAA 3L2QA 4FJIA 4UAYA 2X78A 1XHZA 4KLLA 5CB1A 3HPGA 3TARA 3QIPA 1A77A 5KFXA 1Z25A 8ICLA 4CK3A 3K75D 4KFBA 3SI8A 5J0OA 3VQDA 2BCRA 4CF1A 3B0YA 3Q8LA 1RBUA 3OYJA 5J2HA 3CM6A 4I2QA 1UA1A 3RJKA 1B92A 3QO9A 3SUQA 1HNIA 4IQUA 3HW8A 2YNHA 1QLNA 4FBTA 4IQVA 1BGXT 3AVGA 4YR3A 3ZDAA 4M3ZA 3LP2A 3RRGA 4LSNA 3GIJA 3SUOA 1BIZA 4Q44A 4YR2A 4FJJA 3QESA 5CR0A 4CJSA 4QW8A 1JLEA 2NRXA 2M9NA 4FO6A 2VA8A 5KFWA 4DLEA 5DMRA 4F4XA 4CJFA 1XSNA 8ICTA 4CEDA 1ZQXA 3OJSA 1FKOA 4M42A 3OJUA 4LSLA 4F3TA 3ALYA 1GOBA 3TWHA 4ECZA 1K6YA 4UAWA 4TUSA 1ZBHA 3PVXA 4B9MA 1EETA 4CCHA 3AA4A 3C94A 3H4BA 1A5WA 1ZQCA 5D4BA 4IRCA 3H8JA 7ICHA 2G8KA 3KD5E 3NBPA 3SCXA 2EX3A 7ICUA 1BPDA 2BPGA 1J54A 3BQ0A 3JYTA 4DU4A 4CGJA 1RYRA 4RPZA 2Z1GA 3HPHA 4EBDA 4PHEA 5KFDA 4J9KA 3VN5A 3N97B 1Z26A 4FM0A 2HVHA 4B8AB 3F73A 4DO9A 4ECVA 1JXEA 4KLUA 3RH4A 1RBTA 1NK6A 4P4OA 2PFNA 4UAZA 5IIJA 4I2HA 1Q9YA 3HJFA 4Q8EA 4AHCA 4P4PA 3RMDA 1C0MA 5EWFA 3KLEA 1WNSA 8ICIA 1NJYA 2OZMA 2AQ4A 4QCLA 1EKEA 4CJRA 1T03A 3C2LA 4YXJA 2WTFA 1HNVA 2XHBA 3SUPA 4F8RA 3T5LA 4DSLA 2Z1JA 3QEIA 4FS1A 2A1JA 1C7YA 4QWAA 3TAPA 5KG2A 4YN4A 2FBVA 3RTVA 3ZSXA 4J2BA 4FW1A 3V81A 1COOA 1WSFA 4BE1A 3C6TA 2BPFA 5KG0A 1J53A 1NKBA 4GC7A 4KLIA 1T3NA 1JXBA 1TGOA 5DLFA 4OPJA 3U3YA 2V4RA 4DL6A 4ID5A 1LAWA 9ICBA 3LALA 4CF9A 2DFHA 4KB1A 1KCFA 5KG6A 2C2DA 2IOCA 3LDSA 1O1WA 4EZ9A 2G8WA 1RTDA 4BXOB 2JGUA 5JS2A 3RB0A 1JKHA 8ICZA 4C8MA 1IM4A 3OHBA 4Z6CA 2VA2A 4KPYA 1VSLA 2ZTEA 4NLZA 1D9FA 5BPCA 4DG1A 3AVHA 3GDXA 1MQ3A 4M6WA 3PX0A 3LAMA 1JIHA 2ZUDA 3K5OA 3C6UA 1BHLA 2D0BA 1BI4B 1KFDA 5KT5A 4M3TA 1RBRA 1RDAA 4KLHA 2FLNA 3H4DA 4F50A 4RW4A 1IKVA 5DG7A 3OYGA 1JLAA 5DKWA 4DFMA 3MXMA 2W8LA 4B9LA 4O3PA 3DYAA 1C0UA 3NGIA 1LAVA 4F5OA 4FJMA 1DLOA 4UB1A 2AGQA 2FC0A 3M8PA 3NTUA 5EU7A 3CYMA 8ICUA 4KI4A 4Z6FA 5HRSA 4O3NA 1U49A 3U6FA 4FJXA 4MEYA 3PX6A 4GVMA 2ETJA 1GOAA 2R8IA 2BANA 1XWLA 4J9PA 4F5PA 1NJWA 4KHUA 4AH9A 4PHDA 2KW4A 1ZETA 4FM2A 1QSYA 1REVA 3HWTA 4DFKA 3MR5A 5KFFA 3JPPA 5IINA 3Q8MA 2JEGA 4RU9A 2VG5A 5HHIA 3OYHA 2DFFA 2X74A 4RG8A 1BPXA 7ICEA 8ICGA 8ICSA 5KFLA 1MU2A 1FXXA 4Y1DA 5T7BA 1SV5A 1ZQZA 4YFUA 1UWBA 1RT2A 4KN7A 5J0UA 3TAQA 4FM1A 4DSIA 3KLHA 3B0XA 3MGHA 7ICQA 2ATQA 1SKWA 1WN7A 1BPBA 3KHRA 5FRMA 1RILA 4DL7A 1C1CA 9ICJA 3PW4A 4PY5A 2ASJA 5HROA 1T05A 3GIMA 1ASVA 5KG1A 3RB6A 3DRRA 4FYDA 4M9GA 1U45A 1TL1A 4QZFA 5EWGA 2BCSA 3V72A 2O4GA 4PH5A 1S6PA 3SQ4A 5HNKA 3JPTA 5EOZA 1RTJA 4NXZA 2BGWA 1ZQRA 7ICOA 4ZTFA 4RUAA 2HHVA 4KREA 1ZQQA 4Z6DA 1WSEA 4OKJA 5L1IA 2ZJAA 3NF6A 4KN4A 1B9DA 3RMAA 5DDMA 5J2GA 8ICRA 3SQ2A 3T5JA 1KLNA 4KLQA 2HNDA 5DDYA 3KKSA 5IIIA 4IG0A 2WONA 3DLHA 4I2IA 4KV8A 4O5CA 4RW7A 1NOYA 3VA3A 4ICLA 5BOMA 3QZ7A 3QNOA 3TFSA 4FLZA 1YT3A 1TKXA 4DF4A 3K5NA 3C21A 3OY9A 2FBTA 1ZQVA 4DU1A 4QAGA 2O4IA 4UB2A 3TAGA 5DG8A 5J2BA 1D8YA 3RBDA 4I7FA 2FPKA 4FBUA 7ICFA 4Z4IA 4FZXC 4QZIA 3ZT1A 3ZT0A 2KFZA 1ZQTA 1WSJA 4ELUA 5KFTA 2W9CB 2VG7A 5KFGA 5KT7A 3P83D 4CHOA 5KRSA 4CGHA 4KHQA 3VQ5A 3M8SA 8ICVA 2WOMA 5KT6A 3TR8A 3PV8A 4IR1A 2GWSA 1T4GA 1C6VA 4FJHA 2LYHA 2ASLA 4B9VA 4F4ZA 1I3AA 4DL2A 3RJIA 3JPNA 1ZQDA 8ICOA 4I9LA 3NE6A 2RDIA 9ICKA 3BDPA 1HQEA 4DTRA 3ZDDA 3U3GA 4DWIA 4NLKA 4M45A 2MUTA 4O3OA 1MSWD 3K57A 2W8KA 4MEXA 3IRXA 2HB5A 4KLOA 1HPZA 5E41A 3SUNA 4RPXA 3WNGA 3QERA 3MR3A 5D49A 3L2VA 4E19A 3NGDA 3JPQA 4E1MA 1XI1A 2XO7A 3AA3A 3NGYA 1W9HA 1X9MA 2QK9A 4E0DA 2P5OA 2F96A 4AILC 4Z6EA 4RQ2A 3QLHA 5KFSA 1ZBUA 1VSMA 1TVRA
chains in the Genus database with same CATH superfamily
3TAMA 2G2OA 2XQCA 1N8RO 4UBBA 3AVCA 2NLXA 1Y3KA 4DR2K 5LY3A 2ISPA 4H4MA 4QWBA 4NWIA 4R64A 1LW2A 2V2QA 1GLCG 1UQVA 3MWPA 2HDOA 3ET6B 4Y0FA 1R6VA 1KC8O 8ICPA 2H3IA 3ZSVA 1WUDA 2KJ9A 1KSPA 3Q83A 5HATA 4IOCL 4GO7X 4KLGA 5D6GA 1CUKA 3D5MA 3H6EA 2AZ1A 4CZJA 5J8YA 1O6XA 3I0RB 4GNIA 4CW7B 4IOBA 3GU0A 5K8NA 3IFRA 3GG1A 1L3KA 2MPUA 4WFBQ 2JEJA 2GJ2A 4ZVOB 1VQYA 3MC1A 1WG1A 4J9MA 4CZKA 3F2BA 1ZQ1C 1XNQK 1J5EJ 1RJJA 2E44A 4M5NA 4Z37A 3O3HA 3HFZB 4A8SA 3IHQB 3KWMA 2ZJQL 1FK9B 4N47A 8ICXA 2CG4A 3A5LC 3KHYA 2O67A 5D0RA 2NZTA 5HRRA 2W24A 1VSHA 3L3UA 4NXMK 3CSKA 4KHWA 3MHYA 2BYCA 1VFJA 1S1WB 4A8MP 3NH1A 1NXIA 3AA8A 3PX4A 5HMXA 2DF4B 1BNOA 1GLFO 2WF7A 1Q86T 1YZ7A 5K14A 4HEA9 1HYSA 1YJ9S 4BRNA 4M3YA 4QZDA 2KEYA 4PJ0U 1A5XA 1BCOA 3UDVA 3C5FA 3GQCA 5AI0A 3ZNJ1 1JJ2R 3IKMA 1ZD2P 2UVWA 3FSXA 1RBVA 3C5GA 2J6UA 3DXMA 5E3PA 1VQ8S 3CMES 2ZKTA 4LF4J 2E5GA 1NDLA 4DB3A 3WXMB 4DUZF 4ZJOA 5ELZA 4BQLA 1RZMA 1DQ9A 1ECWA 1CZBA 5CZ2A 4JI4J 1JLFA 5CXTA 1E3MA 2E2OA 4EWTA 3OYMA 4KAZA 2QN6B 4WYBA 3DM2A 2Z2YB 3V7JA 5J0QA 4QZ8A 2ZIUA 3B8AX 4AXJA 3GFXA 4O5FA 1B43A 4HHJA 2LU1A 4NCBA 4Y00A 3MMAA 4QW9A 1N5YB 3H0PA 3MTKA 2GMLA 1IO2A 3SQGA 2CADA 3E51A 2FJAB 1SQFA 2D4WA 4RBVA 1IBCB 4R8UB 3QGIA 3EGVA 4ILGB 3AQFA 5GMDA 3NCQA 1SS6A 3KG0A 2RAQA 4H0YB 1FWKA 5JLFA 2V8PA 2QRRA 4PQUB 4UOCA 3U9DA 4IRKA 4B3TJ 4WJBA 3SJHA 4YOWA 4ZCKA 5LMNF 3FSYA 3ZT4A 2Y9UA 2HVZA 3G71S 5KFYA 3VEVA 3VQ6A 1HNIB 4ITSA 1IM6A 3TZZA 2LKYA 5AKIA 4O0IA 1B9FA 4TQRA 1Y00A 4JI6F 4YMMA 2YWEA 4LSNB 4DSJA 4NLOA 5F3ZA 3M6XA 3IWLA 5KGXA 4DTXA 1YBTA 3DGPA 2D7SA 1AYEA 3EUB2 1QAXA 3PSTA 3KD3A 3ILJA 3AD8C 1LFPA 3O9RA 2KO1A 3BV8A 3CQYA 4BXOA 2YHAA 3UKUB 1F9HA 1CZAN 3SCJE 3CD6N 2QWPA 2OEMA 1WBBA 5D3GB 1Q9XA 2XNQA 5FPEA 4GKJK 4P4MA 4TUPA 2YKPA 2PC6A 2NYVA 3I0SB 4ZPWR 4A5BA 4CI6A 2J6TA 2FIUA 2Q43A 3NBPB 1ZQPA 2EFVA 4B1UB 1TL7B 5E79U 4HACB 1VBZA 4RQ8A 4W5QA 2PY5A 1AA1B 1H72C 4YD2A 5B0EA 5KT3A 4I2GA 4QR0A 2ZHOA 2A5XA 4IDKB 4CGIA 4JYAF 2N3OA 1UZDA 1YJNN 2D0CA 3KLEB 1QZ6A 2D74B 4CI0B 4OX8A 2CQBA 2GEMA 1NHKL 1RTZA 5ETQA 3NFAA 4JI7J 1T7PA 3PW2A 1F5SA 2YX1A 2YJEA 4FJKA 4NA1A 1FRLA 2IIHA 3IN5A 3EVWA 4AQYF 1T0TV 5H9EJ 4MIBA 1DQ8A 5J2DA 5B0BA 5DM7Q 3AEVA 2C2ZB 3K59A 2C2NA 2XLIA 2VFSA 1G4CA 1RWVB 2B21A 3H20A 3DLKB 4CESA 5ALQA 4KHNA 3LWLA 3C23A 1U6ZA 4B3RJ 2JHEA 4XTTA 3QU7A 2H65B 2XMTA 4C8ZA 5AKYA 5CJ7A 2IBKA 3AUOA 3OFGA 1RP5A 2HBMA 1VSDA 1KQQA 2BW7A 4ID5B 1RWXB 4G1PA 3W2WA 2MAXA 2VF3A 1LW0A 1TKZA 1LWFA 2M70A 1WORA 1QQ6A 2XEXA 5B0GA 1NU4A 4BJQA 2CQPA 4ES1A 5J2MA 4DL4A 1WAJA 4DR6F 4KHPK 2GO7A 4PWWA 1FX4A 2K89A 1JKHB 2IA0A 4FZZA 7ICGA 2RU9A 3MN9A 2W4DA 3G6ES 3D9BA 2G8UA 2GWKA 1HARA 1I94F 3K2PA 3R7BB 2W6KA 1ZA2B 3AARA 4HI2A 2KT3A 4HTJA 3IFEA 4DCPB 4CLFA 2F63A 2KICA 4DQQA 5LXYA 3CCSS 2VDHA 2JX2A 4JV5F 4DOBA 2P1JA 3T19A 3N5BA 5HQLA 3KKFA 3I5CA 4JI5F 1DTTA 3RJEA 3ENVA 1DLOB 1XMOJ 2DTUA 3C2PA 2V4QA 1ATSA 4FDFA 2K4EA 4JI3F 3MCMA 5D0EA 1IBLK 1QQ5A 4NLGA 1HUZA 4YB5A 3SQ0A 3FGUA 1N33K 4J9OA 3CD0A 1FA0A 5SUHA 4K0KJ 2GS8A 3TEHB 5DDQC 2NRTA 1X42A 3IXQA 3R1XA 3UKRB 4CO4A 3BR9A 2M3DA 4N8NA 3GFZA 2GGPB 1WSRA 3KJQB 1JLCB 2DK2A 4MYUA 2X7IA 1QVFR 1BWVA 5AM0A 1TL3B 2WB1C 5ALDA 4HUEA 2JVOA 2KT5A 5GTIU 4J9LA 3N01A 5ETPA 3GMGA 5HJYA 4JN4A 2R8JA 3K1ZA 1CS4A 2VG6A 1C2PA 2W9CA 5AZIA 1ZXIA 5LMUF 4QIFA 5DQIA 4OHZA 3I32A 1A5VA 3AAPA 1HHSA 1PBUA 4QPXA 3CF5Q 4Y2JA 4BGDA 2Y8YA 4ED2A 1KS2A 2CNKB 4JV2A 2MSSA 3CERA 4FWKA 2V67A 3G4SN 2F4VF 1LOUA 4H5WA 4DCCA 5AQKA 4OO1J 2CJBA 4UZBA 5HBMA 4G65A 4BGAA 4CJ4A 1L5UA 1Z00A 2DD8S 2E5LF 4JS4A 4RW8B 3VHQA 1TL1B 2IIRA 5D0HA 1ZM9A 2HBKA 2RHSB 1RGIA 4QOZB 3GV7B 1ULRA 3JB9k 1L7OA 1ZQHA 5AM3A 3UQSA 5DDRC 3QBXA 3W9HA 4C48A 3Q86A 5HVFA 4UW9A 1Q3UA 4NLUA 1RWNB 2JRSA 2F8HA 9ICQA 4QS9A 3BEXA 3QSIA 1JRPA 1VK8A 3LL3A 4JWMA 2YNFA 3L6QA 3MTJA 1U47A 4CM0A 2F1IA 4LREA 3CWJA 1IG9A 2Y8WA 1I6JA 2BDUA 3MN6A 3W62A 3HP6A 5ALKA 5FDLA 3HCXA 2WB1D 1TKXB 5BR9A 3NNHA 4BUGA 1GLAG 3JPRA 1VRUB 4FPRA 9ICAA 4LF5K 4MFFA 4I7FB 4BWJA 4FZMA 3MEKA 4CGDA 2QWRA 4EO8A 1ZQEA 3NHGA 4FZLA 2VC1A 2JR5A 1WC4A 2WB1F 4IFVA 3RW7A 1IG8A 4CF2A 2Q1NA 3MM8A 5DBCA 5T41A 2LBOA 4RUCA 4ANEA 3VF2A 1ZA1B 2VGMA 4YD1A 4B3OA 5IT9O 2PIIA 1JLGA 3TVYA 3QEXA 4EP4A 9ICMA 2CH6A 4KLTA 5I4MA 1MA9B 4EENA 2P9IA 2ZOMA 3ZD9A 2X6NA 4YDDB 4FJ7A 1UAXA 5CD4H 1FVSA 3C1ZA 3EEQA 1S77D 3OTEA 4XIUA 8ICBA 1HQEB 1XS9D 4WFBL 3RJHA 3A8JA 4FWNA 3WEEB 1RAAB 3L7UA 4NZ7A 2H4YB 3I4PA 1XU4A 5IFMA 5KTQA 3Q8PB 1G15A 4UQTA 2O6KA 3GSIA 2EW9A 4OX6A 4ELVA 4OYIA 3A12A 4JKEA 4RTFD 1N60A 4DTJA 4PHPA 3I31A 2VWBA 2VKRA 1S9EA 5J0PA 2LLZA 3D2FA 5D77A 2UXBK 3THYA 5HR7A 1FWPA 2XC9A 3RH5A 5IT9U 3I8DA 5C24A 1XC3A 5DG9A 2DR5A 1GX5A 1WB9A 3C46A 5CA7A 3KZBA 4IBNA 2NUUG 1SXDA 3BGFA 4K4HA 5E7OB 1FF2A 3LM9A 4OZ2A 3NCPA 2MKKA 2QKBA 1ZQJA 1ZAXA 3HP9A 4LF9F 3MEDA 5A8WB 3EMTA 1D0EA 1PBAA 1AZSA 2UUCF 2EVZA 2ZZTA 4OZLA 1BL3A 2PYLA 2ZXHA 2OFGX 4K4VA 4C7YA 1KRPA 3J7YP 3S7RA 3SV3A 1S0OA 2AWZA 2LFVA 2DPJA 2XLKA 2RE2A 5BRHA 3ITHB 4FSVA 2AEFA 2HCFA 5AK3A 2GWJA 3F44A 3BO2A 8ICWA 4FLWA 1KOHA 2IM3A 2F8EX 4GFJA 4RQ7A 4CLTA 2X1BA 2XCAA 4M5GA 4RU2A 7ICKA 7ICIA 4P6QA 2UVUA 5IIOA 2DCUB 2ZG6A 1CXQA 4CT9A 4USKA 2CYYA 1U25A 1HUXA 3GFHA 2OO4A 5AQJA 4YN3B 5ALLA 1IWGA 1NMEB 2ZE2A 4CECA 5TKWA 3IBFB 3FC9A 3TJ9A 2BCQA 4HR2A 2OPRB 4K4SA 1ZD5A 2PO4A 1SXEA 4OZNA 4C7ZA 3A5OC 5HRNA 2C3MA 4RNOA 1HWJA 3W5XA 4A62A 4N56A 5AQOA 3B6PA 5IT9Y 1Q79A 1FTCA 2IHMA 2B4UA 2B9WA 3T1AA 4JKFA 4B8CA 1WEYA 3CJ1A 3WNFA 3MECA 2ZZMA 2GJFA 4JP8A 1X8DA 2XRIA 4H5RA 2PI5A 2BJ1A 3TAFA 4B9NA 3WK5A 3C14B 4PXCA 1G3OA 2QTDA 5DRKA 5CHGA 4ES2A 1RBSA 4NPOA 1SCJB 3PEJA 2KJ8A 4O3SA 4TVAB 5L9NA 4M9LA 4NCAA 3OUYB 2E5JA 2OWOA 1P1LA 4P0PB 5E3AA 2ZIWB 2A10A 2HZCA 4NLYA 1X4GA 5AKLA 1NK4A 4DUYK 2YPYA 3NWGA 4Z0UA 3SENA 3UQ0A 3KJFB 1WSIA 3JS9A 5KFUA 2FF6A 3P8BB 2P9GA 3Q22A 3QT7A 5C10A 4MYTA 4NXNK 1ZQWA 2BOAA 4ZA1A 3KK1B 4AD6A 4KPCA 1AUSL 1VDVA 3T1YK 3EY1A 5KFQA 1CRXA 2FMSA 4KLEA 4DR7K 4E7JA 3MDFA 3J7AN 3M4XA 4AHSA 3ISCA 3THWB 1EETB 2DY9A 2WW4A 4Y65A 4OJ3A 1ZPWX 2BTFA 2IOFK 4M47A 3D68A 1ZQYA 3DJCA 2DPIA 2PFPA 2W1BA 3WXJA 3AO2A 2DNOA 3AQPA 2KHOA 2E2PA 3OYFA 4QZGA 4JD2A 1GT8A 3O4WA 2FHOB 4DCHA 5DM7L 3FBBA 3HSZA 2O8CA 2DNHA 1IH7A 4KIAA 3LZJA 3FZHA 5AQNA 4FWSA 1C4CA 1D9AA 1SPBP 2MXYA 4CNQA 1NKCA 2K7JA 3DOMB 1NZPA 3TUJC 2A6OA 4OKEA 1NJZA 1EXNA 3AVNA 1HNVB 2ZIVB 2OPQA 1XBWA 3PHEA 2DNRA 5KFAA 2R2RA 4EHUA 1BU6O 2Z2LA 4K59A 3UN2A 3HVRA 3JQMA 2L9NA 2NYHA 3N7RC 1Z4NA 4P2HA 5CCLA 3SBGA 5DLGA 1BQMA 4DV5F 1PC5A 4DMNA 1TVAA 4JNEA 3MWBA 1H73A 2YVSA 1OH5A 4U67Q 3CHWA 2C1EB 4LJXA 2ZD1A 2F7VA 3MAAB 4CIOA 2UU9F 2CGLA 3C6HA 1TAUA 2ZUCA 1HQ2A 2U1AA 2K3KA 2HZVA 4KX5A 3L2WA 1HBNB 1SH2A 3HHNB 3PMNA 1S0MA 4BRPA 2XBPA 4OYMA 3CDWA 2JWNA 1S76D 1VQ7S 4O5KA 4QZCA 3WDOA 5ETKA 1PYSB 3TYTA 1WYGA 4YORA 2GUIA 5KFMA 1RSCA 4DN9A 4OYOA 4GVBB 1SGGA 2MKHA 3N7PD 1CEZA 4M9NA 1YJ7A 4DG1B 1N32F 1RBAA 3BPDA 1SJ4P 4CO2A 3THXA 2KRRA 2Z8QA 4LF2A 1OO0B 3THPA 3ADAC 5DBBA 3VA0A 3S9HA 4JI8K 3UR3C 4PA1A 3TWZA 3TTDA 1C0TB 1VSJA 3QUBA 1SQKA 2PAVA 2G0JA 3QJLA 1JMTA 1Y5NB 5AI5A 1S1UA 2QL9B 3SZ2A 1KBUA 3DYAB 2GX8A 1A7GE 3D45A 3TUPA 2F9TA 1P9QC 2HOFA 2NXEA 4DR5F 2D5RA 2DIVA 3MEEA 3E2EA 5DDOC 2R7RA 5D4NA 1F0MA 5HLFA 1P27B 3HSGA 4MHVA 3MXHP 3HO1A 5GINA 2I9GA 4Q45A 2BXJA 2HRTA 1RTIA 2JWLA 3DGVA 1N5WA 1ZRNA 3CF5L 3IRUA 4OX9K 5D78A 3HVWA 2ZKUA 3NVYA 2CKWA 3SPYA 4ZK7M 3PJXA 3L95X 1UW4A 1V5IB 2XY5A 5DK5A 4BRQA 2VG5B 4HCCA 5AI8A 2I0XA 4ZOHC 1SZHA 1QSLA 3IR7B 3MEGA 7ICNA 2M7SA 2PFQA 3OS1A 1HNZF 2XSFA 3DDNA 2OPSA 3FR0A 5C25A 3KVGA 1X4DA 4OHXA 3VOVA 2W3RA 1C1BA 1S3XA 4DFJA 3K0JA 2BZ2A 3KWIA 4B08A 3DXKA 1I51B 1FRIA 5M1KA 1M90O 5F8JA 1CLFA 3IP4B 3TZYA 3PFOA 1URRA 3BY5A 2ADBA 2AX1A 3MZIA 7ICLA 2UUWA 1HJPA 3TACB 2GCFA 1R0BG 2Z0GA 7ICMA 2HW3A 3TP2A 1NOZA 4HCBA 1D1UA 1D8LA 3EDRB 4KITB 4ZKAA 1WOPA 3NF7A 1ATRA 1NK5A 3FVYA 4KMUA 2J0XA 3WKCA 4LF6J 4DUTA 2VJUA 5GIOA 1YTAA 2XMMA 2BKEA 1V85A 3M30A 2M8HA 1U7LA 1U0SA 1MNEA 2PMWA 1K8AT 4DU8A 1NMNA 2QYGA 4OZ0A 4OJHA 4W5NA 4LH4A 2WONB 3CJKA 2HZAA 2P6TA 1JX4A 3GYXB 1V38A 5BOLA 4FJ5A 4ICLB 4KBIA 5HP1A 3HF5A 3M7VA 5FPMA 1EKRA 1Y3JA 3OTOJ 4I2DA 2AGOA 1QH9A 4PCQA 4X4UA 1MDUB 5B0DA 3CE8A 3A4TA 4M3RA 2HHTA 5IQQA 2LCWA 1QJHA 4LF4K 2BKOA 4NWBA 5AE3A 4KLJA 1VIOA 2PMZD 3FNNA 3ZSWA 1RT3A 1HUOA 1GK8A 1ZM4A 3BQTA 3IBWA 4LFBJ 1H1VA 3ZZRA 1Q4RA 1V97A 5KFCA 4YUDA 4IRDA 1VQON 3G6XA 5AK4A 2MKCA 1BQNB 1PUZA 1RFQA 2XY6A 4P2FA 4MLEA 2PMZF 2EAPA 4NA2A 3SI6A 4RCHA 1NG9A 1NGEA 1M1KT 3I96A 3I1YA 4YCXA 3W7BA 5DGBA 1PC4A 2W25A 2WVDA 4I2JA 4AHRA 1VRQC 4LVOP 4FYWB 1KOOA 4YMEA 1X5PA 4C4RA 4HT7A 2XSJA 4H54A 2VJ4A 1J5EF 2Z56B 4YOYA 2DXDA 4KH1B 4RPYA 1CQMA 4ZCLA 3IAM9 2J9DA 1VC0A 2NRHA 3D54A 3H8WA 1HI8A 2ZUBA 2ATLA 3MOJB 2DFEA 2MYFA 3PUFA 4NYNA 2GV9A 3KJNB 3B6OA 3EZWA 2ZH8A 4PXEA 5KT4A 5M1OA 2WFAA 4IXCA 1U1RA 2I9SA 3PO4A 4B9TA 2ADCA 4CEBA 1W2IA 4IG3A 3QICA 4BDPA 1Z4UA 1ZQLA 5BPNA 4DX6A 4LF8J 2CQIA 1WDTA 5GVQA 2CNNB 2ZBIA 2HVIA 4HHHA 1EQ0A 2BE2A 3TAMB 2LYAA 4WYLA 1ZJNA 2YX4A 3K5LA 4URQU 4FWRA 2KU7A 4E7LA 3W8PA 2KFYA 5LMNK 2J7KA 2GW8A 1TV9A 2DGTA 2KD1A 4XDDA 3QGPA 2V2ZA 2XY7A 2WVBA 3S3MA 1KLMA 4AUKA 2E8MA 2MSTA 3QBCA 2OSQA 4MDBA 3SD7A 4BC9A 1S1XA 2KVIA 4AFFA 2GVDA 1H98A 5J2EA 1FO1A 2QLBB 1J9AA 2I5HA 1YTYA 2DTJA 1YJUA 1W97L 4BWMA 1M5KC 3G6VA 5BN8A 4NLTA 1QUPA 1L3SA 4O8UA 4FJLA 3CD6S 2HQ3A 2IBOA 3SCLE 1QY7A 5C5JA 2CGKA 2DEJA 4I2FA 1DK2A 5KQDA 4MIWA 2ZC4A 1SV0C 3OYAA 1SI9A 2FGCA 4MT1A 3C0BA 3FAHA 2HVDA 1IBMJ 4KKOA 2IVFB 3SDEA 4PYDA 5LXRA 5CB1A 4LRCA 4IEEA 1Z25A 4CK3A 4CDGA 2VD3A 3K75D 1Y7PA 2D3O1 2O01C 4B3TF 1Q7YO 2QE5A 3ZTOA 2QB0B 4BRHA 3B0YA 1RBUA 3NMUA 5L39A 4UY8T 2MA1A 4TXSA 4I2QA 4OPAA 1B92A 3QO9A 3E66A 4IQUA 4LR8A 2MQLA 2YNHA 2O1PA 4FBTA 1YJNS 1BGXT 3KK2B 3G87A 4DV4J 1YKWA 4YR3A 5GMEA 2G2ZA 2MLXA 5A0LA 1S8OA 1FTRA 3LP2A 2FI1A 4KMOB 4WP8A 1TE2A 3SMVA 3SQOP 4S0MA 1NGHA 5CR0A 4ED5A 2QFIA 4QW8A 5K14B 1JLEA 4FO6A 1HYSB 2VA8A 2YKNB 1QQMA 1IUJA 3EDQB 5G0RA 1TUWA 1YI2N 2QB1A 4M42A 1SWWA 5DDPC 1BDGA 3ALYA 3BF4A 1K6YA 3DXMB 1ZBHA 3J81O 3PVXA 2G0AA 1JCGA 1SJFA 3H4BA 4LR7A 1VC5A 2LYBA 1ZQCA 7ICHA 3KD5E 4PKHA 2EX3A 3QFUA 2YTUA 2MQ8A 2H3GX 4CO1A 1JLFB 1I5OB 1QCKA 3JYTA 3HBTA 4CGJA 1RYRA 2F4FA 3CJ5A 4EBDA 2RKIB 5KFDA 4J9KA 3CCEN 2HVHA 1U1QA 4DO9A 2CQ4A 4KLUA 3DM2B 4GRSA 3H0MB 2PFNA 2ZIUB 2ZDOA 4UAZA 2NXJA 5J2NB 4U7BA 4X4SA 4I2HA 4C0BA 5A2QO 4P4PA 2L41A 1WNSA 4DR6K 2OZMA 4J90A 4FVUA 3IGVA 3SCIE 1T03A 1HKGA 2K2PA 2XHBA 4F8RA 4X65J 4C98A 2A1JA 3BEGB 5CYQB 3KMQA 5LOQA 2FBVA 1I94K 1R89A 2HFOA 1CJTB 1XQIA 4XO0A 3J81U 4F71A 1WC3A 2ODGA 4A57A 4B3RF 5BYSA 4GC7A 5LL6d 1T3NA 2RS8A 4U67L 1NJIO 4DL6A 2LXFA 1LAWA 3K1RB 4DR4J 5A2QU 4X2BA 2C2DA 1DEJA 2ZJPQ 2IOCA 1O1WA 3L4BC 1RTDA 1FFUA 2V94A 3OR2A 4BXOB 2YX6A 2JGUA 2IC3B 3MI7X 8ICZA 2A1AA 3G9CA 3HHDA 3SAGA 2NREA 2AD9A 4NLSA 2VA2A 5ALHA 4H5VA 4NLZA 2LDYA 5BPCA 3CXCM 1GMWD 4M6WA 3PX0A 3V4MA 2ZUDA 1KFDA 1RBRA 1RDAA 4KLHA 1YVNA 4CLZA 1ESVA 5CHIA 1PK1A 2FGOA 1IKWB 2MGZA 4F50A 3T9ZA 1HWIA 4BY9C 1XMQJ 1FVQA 3HSDA 1WHVA 3OVBA 4HT5A 4LFAK 4B9LA 4O3PA 3P31A 2WFBA 4FJMA 2JH1A 1VJ5A 1EX8A 2FUG9 2W2PP 1T3VA 3J81Y 5HRSA 3U6FA 1U49A 2RH3A 3NUQA 4CH0S 4FJXA 2VBWA 4K0KF 2ETJA 4OZJA 1E6YA 5KOXA 3D6JA 1OSCA 4CBXA 4WIIA 1EARA 1BWFO 3IO1A 3M3ZA 5ALSA 4J9PA 1D09B 4CZLA 2OCEA 3U02A 1NLVA 3LDLA 4P10A 5GAGP 2K4PA 2CPIA 3VGSA 5JVHQ 4AM6A 1KR4A 3FMWA 1IIPA 4PEOA 2YWKA 4IOAQ 5IINA 3Q8MA 4A5AA 4DU7A 2JEGA 4RU9A 4Y2MA 1OW5A 4M8LA 1YXQA 5A2QY 1SJ3P 1TKTB 4ZP7A 1XJWB 3ZZTA 1VC6A 1T02A 4Y3CA 1RCXB 2W2MP 1L8OA 1LW0B 3TAQA 1TKZB 2ZVSA 2XLJA 1DARA 2Q2RA 1Q1KA 3PYEA 2M2BA 3B0XA 4CLSA 5J2MB 2IVMA 4LBPA 3CRXA 1BPBA 4DPTA 1RILA 1C1CA 4JI2F 2YCHA 1F0XA 2VQEJ 2B9EA 5ALPA 3B82A 2QW9A 4Y2SA 3K7RA 3DRRA 4M9GA 2DL0A 2MQQA 3VQSA 3D28A 4QZFA 5EWGA 2BCSA 4BRMA 2W7OA 4F0MA 1N0VC 3UD4P 4ER8A 3UI3A 4DR1J 1RTJA 2BM0A 3T1HJ 2WRMA 3OV7A 4RUAA 4PG4A 3H46O 3AT1B 3PACA 3H98A 2D3DA 5L1IA 1VCTA 5JU5A 3OFHA 1DAXA 3RBZA 3RMAA 3OVAA 1QUVA 2B9XA 3SQ2A 3M6WA 2HNDA 5HMYA 4IG0A 3DLHA 1IWAA 5AIBA 4O5CA 3R6GB 3NY0A 1KD1O 3QZ7A 2HOIA 1N2XA 3WIUA 2HS3A 4HH1A 2XZDB 1A0OB 3FFKB 2HIQA 4YB1P 4C97A 3CCZA 5J2BA 3RBDA 2QO3A 3NOCA 1C4AA 4RNFA 1RUSA 4U7UD 3B78A 4I4BA 2YN4A 2KFZA 5AQQA 4ELUA 1CS4B 2VG6B 1QVGR 2W9CB 2VG7A 1VYAA 5KT7A 1SB3C 4CHOA 4CGHA 2AJ1A 1E6VA 3HD2A 3HI0A 1RA7A 2V5HG 5ALRA 3NLCA 1N36J 1WUAA 3LPYA 3MM7B 4WK1A 4IR1A 2GWSA 3AJ2A 1C6VA 4FJHA 4B9VA 4LF9K 1WF0A 3JPNA 1F9FA 4NA3A 5HBMB 4KSEB 4Z7CA 4ERDA 4UB6U 4PKGA 3U3GA 4I68A 3AY0A 2EH9A 5AI9A 2NR0A 4BRDA 2W8KA 2V68A 4MEXA 3M2VB 2B5JB 2HB5A 3R9PA 1JWWA 2RNEA 4AF1A 1HPZA 5E41A 2HRUA 3FKBA 3MR3A 2ZVIA 5D49A 4ZPCA 5HANA 5AI6A 2MY7A 4E1MA 2BOPA 2C3UA 2XO7A 1SH3A 3W2VA 3W3DA 2YNFB 4E0DA 2P5OA 4CH1A 4Z6EA 4RQ2A 3QLHA 3OLBA 1M5OC 3IWNC 5J0YA 2N4CA 4Z4CA 2KHQA 4FCYA 1BY9A 2GQ2A 2UXDJ 4QR1A 3UXOA 5FDLB 4M5DA 2KK0A 1HJOA 2CJXB 1S0VA 5D4LA 5HRPA 1O8BA 5KRTA 4DV0F 1HKBA 3DLRA 5B09A 1OQ3A 1IN0A 2F1FA 4IH5A 5F2RA 4OLAA 5CCMA 4TUQA 3LAKA 4CBWA 4IFVB 4RQ5A 2ZM6J 8ICJA 3K9KA 1SV4A 3MM8B 4M5LA 4JI0J 3OBYA 5H9FJ 1CZ9A 3CTRA 2IAJA 4B3OB 3ID8A 4M5JA 3HK2A 1K0VA 2NRWA 5F9LA 3OXLA 1JLGB 1HNXK 5MLCQ 4F93B 5KGWA 4PPZA 3WX8A 2BHNA 3V9UA 1Y10A 3LUYA 2ZBCA 9ATCB 4FLVA 4EYHB 2P9IB 4JRQA 4WF9Q 3UQ2A 4USJC 2V7YA 4RW9A 1X5SA 1UPPA 3Q8RB 2BUPA 5ETMA 1V4SA 4KT0C 1EIYB 1PJ7A 3R27A 1APSA 3NVZA 1ASUA 1T3QA 3KNGA 1T9UA 1KWMA 3CPWM 2BJDA 2NZ4A 2EANA 3NKYA 4NEYA 4UOFA 4PWDA 2YJFA 4MFBA 4ZP8A 2PXIA 2GMJA 2QARA 4L3NA 4A46A 3CJ0A 5JMVA 1HR0F 9ICIA 4EX6A 1S9EB 3R5JB 3H08A 2CQ0A 4Q0BB 3THYB 1Q82O 4FJ8A 4WXWA 4NLWA 5C24B 3VGKA 4LBHA 1HL6A 4RT2A 4ED1A 1RT7A 1Y4ZB 3V9ZA 4RWTA 4QWDA 5K5MA 1P9YA 4OJLA 3PRDA 5B7WA 4FVCA 3LPTA 1S5JA 2WVCA 2ZITA 2W9MA 9ICCA 2M0GB 2G1DA 4C1NI 3KJVA 2LEPA 4DL3A 1U02A 4KE5A 1X9JA 4DDFA 4FK2A 1S22A 4BRFA 4NLXA 2NXNA 2OXOA 3P4UB 4KLDA 5EUHA 1KEJA 5L1JA 4GV3A 4WE1B 1BO5O 3EGWB 1GXLA 3RGIA 1KQFB 2A0FB 3EUNA 3QEVA 4A47A 4CQ1A 3ZTQA 5ALZA 3VESA 1JALA 3PW7A 4LJMA 2UYTA 4USMA 2KFNA 3UCUP 2CPJA 1DJ0A 4DV5K 4TU7A 3SQ1A 4DTSA 3Q8SB 2Z7JA 5J2JA 5J2PA 4C11B 4OYPA 4QJVA 2HBQB 4I56A 5D46A 4PGXA 3MPYA 2A41A 4M2YA 1KFSA 1FKPA 4P7TA 4XQ8A 3V7KA 4YHHJ 2H3QA 3KD1E 4DR2J 3RJJA 3VETA 4N5SA 4B3MF 2RRAA 4XDCA 4CGZA 3FRZA 3K9JA 5ALGA 4J9SA 4CVNE 4OFZA 4US8A 1K0TA 4ZLJA 2KM8C 1X2IA 2BBEA 2BQUA 5J2CA 2UUAF 3MECB 3THVA 2BE9B 3CC2N 1VQ9S 3E8OA 3OYEA 4HH0A 4KB7A 1RDBA 4P0QB 3VGLA 2ASOA 1SB6A 5EX0A 3R8EA 1HKAA 3CC7N 3ZTSA 1WDDA 4KC5A 4X84A 1QDUB 1VBYA 1U2RA 3G8SA 4JV1A 2A2CA 4F0HA 2W4PA 4WQ5A 3KKRA 5IC4B 3CFPA 2B6GA 4MTPA 2ZJPL 3IWXA 4BR4A 2ZDPA 2A1SA 3AO1A 4OKKA 3KWGA 3SJJA 1W0HA 3M8QA 2OEJA 2DRDA 5HVGA 3OYLA 4KO0A 1S10A 2AJQA 2B6AA 5E3RA 2GTDA 4OLBA 4JB8B 2Q0ZX 1BI4A 2VCPA 1YJ9N 1UVMA 1IV0A 3WZ0A 5AKXA 4AL7A 4JK1A 4FWMA 4M95A 4DOCA 3ZX2A 1BHNA 1HJRA 4ECSA 3NS7B 1NMDA 3G25A 4NXMJ 1F3FA 2QWNA 1B99A 1ZQAA 2DGVA 2Z1IA 1JJCB 5IXUA 4ED0A 2M0NA 5I42A 4KRFA 2XULA 3S3NA 3KK3A 2BPCA 3TR5A 1NK8A 3MCNA 1RWKB 3KKAC 2QXLA 2BJ3A 4FZVA 5F0UA 1N0UA 2ASYA 4YY3F 8RUCA 4ECUA 1QQCA 4JD2B 3AVJA 1NNLA 1TK5A 4KTQA 4TLQA 5SWMA 4DSKA 1RAHB 2O8CB 5I9EB 2GNKA 1BQXA 4JI1K 4DV6F 5JVHL 3OPKA 5GMKa 3R1HA 1RU1A 1TFYA 2RPIA 2FBXA 4JRPA 4ECXA 1QQOA 3HZEA 3CVKA 4IOAL 3QUTA 2CGJA 3H1QA 3LP0A 4EBEA 4US9A 3PO5A 4R5PA 1VQNN 3QRQA 2A40A 3M32A 3DHWC 2OPQB 4AHTA 3EWAA 4K42A 4ETZA 4KLSA 2XS2A 4K4IA 4C8OA 2GH1A 4KTWA 3BZKA 1L3VA 1S9GA 2P9EA 5EXWA 1NZAA 1BQMB 1R8BA 3SNNA 1KDHA 2JOQA 3OTOK 4IQXA 3IS9A 4ISGA 2WCXA 4QZAA 3MUMP 2VFTA 5K9FA 4PG8A 5AZJA 4GKKJ 3CCLS 4K4UA 9ICVA 3FGVA 2ZD1B 1HBUA 4IH6A 3C6UB 3CDBA 4XPEA 1TU0B 2YMPA 2RHQB 2CN1A 5AKKA 2AJ2A 3GR0A 5IV4A 3LPUA 2KTQA 2Z30B 2W55A 3CJCA 3DAWA 4DTUA 3AODA 1WLJA 4BACA 2G09A 1XO1A 3RMCA 3V9XA 8ICAA 2E1EA 1N48A 3LP1A 4NYPA 1IKXA 1EP4A 4M94A 1UJ5A 2DKXA 3GBTA 1Q5YA 1KL9A 2FXUA 3IAS9 3G10A 4OJRA 1UT8A 1U2VB 3THXB 4JKCA 4KH6A 4UT4A 4NY8A 3SEOA 4FE3A 4I69A 2KHCA 4F4AA 4GKJJ 1REVB 4H4OA 1OKJA 5HP4A 4CYUA 3CJ8A 2C3YA 4LF6F 2EZZA 1ZQBA 1WC5A 2DHHA 3DOKA 5KNIA 1RAEB 3UVJB 1S1UB 1N62A 3DN9A 3ZSZA 3THTA 2QLXA 3NMRA 5AJ3F 3MEEB 2V8DA 3BH7B 5KI6A 3BS9A 1UWBB 3Q8UA 3V6DA 2WBNA 3Q8QB 1LOTB 4DU3A 5HLFB 3R9KA 4LF8K 1ZBLA 2OD6A 3MDQA 4W5TA 1N56A 2V8GA 4YXMA 4CZEA 3QETA 4DJBA 5E3QA 3WC0A 1RTIB 1NK7A 2DO0A 1EAYC 2I8EA 1PSDA 4N76A 1UPMB 3VAKA 4RR5A 1OH6A 1VIXA 4RQ0A 2VH7A 4CEQA 5C0YA 1IBKK 3W1YC 1F21A 2KB2A 3CIPA 2QLFB 1VJQA 5IM0A 3W63A 5LJVA 1ZZNA 1PGZA 5BR8J 1QM9A 1W25A 4LRAA 2RUGA 3KFWX 4ED6A 3S8SA 4L73A 4PRFA 5KFHA 3ZSQA 4QYZJ 2OPSB 1VJWA 5C25B 3V6JA 4TQSA 4RO0A 1K1SA 1X9SA 3MM6A 4KGZB 2HG4A 1C1BB 2E1MC 4J37A 5M2PA 4O5BA 2VC0A 1RAFB 2NLWA 1T44A 5I3UA 2VDIA 3ETLA 2EFQA 2JC0A 2BZFA 4G6VB 3Q24A 2E20A 4NV0A 3TVZA 4J9NA 4DZDA 3TUIC 3KIOA 1X3MA 4M7XA 4H5NA 1GTHA 3B8HA 4KHPJ 2IHNA 4BE2A 1OVYA 4EYIB 3PYFA 2RE1A 3ZC4A 2I7PA 4K8ZA 4UW2A 3LDNA 4V19S 4DQPA 4IKFA 3MPDA 1AT1B 3IMXA 2N4DA 2IMWP 3J7A1 4OI4A 4CJKA 1YHQN 4ZJQA 3ZT3A 3GZ7A 4C4SA 4GY2B 2J9EA 5HN0A 2AX0A 2BABA 3BDEA 4DL5A 1V6HA 3Q89A 4W5OA 2M52A 1SVDA 2G8HA 3VCBA 1VGYA 2DVIA 5ADXH 3CJKB 3JQKA 3GPAA 3D66A 3J7ZT 3H7HB 3CJTA 1N63A 3P5BP 2H3FA 1COKA 5CWRA 4BHQA 1N33J 2P9UA 2E1YA 4WP3A 4MF2A 3KUGA 3P49B 4M63A 4X62F 3BF3A 1JJ2M 2HFZA 1VQMN 1YBAA 1DURA 4RPFA 1RT3B 5D4PA 3TOQA 2JZBA 4OVLA 1SKUB 4DPUA 4USVA 2B3TB 1HBOA 1WC0A 3GR1A 4DV1F 2GAHC 1YI2S 4AHUA 2FJWA 4F4KA 1TUGB 4WKYA 3CJRA 5ALIA 4ZCIA 2LXIA 3EZUA 1N88A 4EHTA 2XB2D 3N4WA 4OJPA 3N6NA 4JKHA 4EK2A 2XSJB 2IJRA 2PFOA 4FN5A 4BRKA 3ENWA 2RDJA 3T6JA 3B6BA 3V9WA 4DTPA 2P6RA 1PCAA 4UB3A 5IIMA 2Z2ZA 4JKBA 1ZQGA 3O8WA 1YQHA 1FEZA 3WC2A 3EJMA 4DV4F 1QQNA 1CJKA 2EXUA 4B1VA 1UEVA 3VQ4A 3CCTA 2FD2A 3DLEA 1RT6A 3W5ZA 2EFOA 1VMBA 4YOEA 1U26A 1U0HA 2P6UA 1WTBA 8ICMA 5HO4A 2KRBA 2ZIXA 3AM9A 3N4MB 2KKPA 5L38A 3MDAA 2BE2B 1HQUA 1ZJMA 5JS1A 3MURP 4X64J 3D6RA 1FEEA 3MPVA 2R8KA 4FL9A 1ZQIA 3ZDCA 3AXMA 2GVZA 4HHTA 4OCZA 5ADZA 3GE9A 4KHRA 1S1XB 2PE8A 3HVTA 2GVDB 3FCVA 3LGHA 3V1QA 3BZQA 1W26A 3R5GA 3M6KA 4DCJB 3CETA 5KFEA 4TY9A 1FE4A 1BCMA 1WAFA 1SL0A 1XMQK 2HHHK 2HOEA 2BUNA 3BGLA 2VUGA 3VGTA 3ZX0A 4O44B 1WHWA 2RQKA 3L09A 2AF6A 4CE9A 1B64A 3AB2B 4FYVB 9ICNA 3U1NA 4FWPA 3H40A 3ZSOA 2KNJA 4CP5A 4KKOB 1A6SA 2H51B 3EZ5A 1ZQUA 3ZTRA 3MFIA 5CYMA 1MG7A 8ICQA 4BVOA 4JK7A 1H2VZ 2XM3A 4UATA 5ALXA 5HJXA 3LWMA 5DB9A 1YDLA 2XMJA 4I2QB 4OZ3A 3VAIA 4DV3K 1DHMA 3QO9B 5EX3A 5KT2A 2YNHB 4ILHA 1F5AA 2HRYA 3PR4A 1GLLO 5HAOA 3K17A 4I2PA 2LYVA 4ZJLA 2J76E 3TADA 3JTPA 5DZ7A 4FF1A 3LP2B 4DLGA 2K7KA 5HOOA 2JLEA 3I5BA 1Y5LB 3H25A 2BQRA 1C1AA 3BF1A 5AKHA 4UBCA 1PVRA 5J2FA 1JLEB 2HQCA 3MAQA 1X6IA 1TTHB 2NQPA 5CQGA 1VLBA 1H3DA 2GC8A 4JLHA 1MROA 3ZLJA 3QINA 4DQIA 2JEIA 2JH3A 4PGYA 2W9BB 2UXBJ 1S1TA 4KJIA 2HQGA 3OSNA 5HR6A 3ILIA 4CZMA 2GV1A 2CRLA 5HHHA 1LV5A 1RDWX 5ALUA 1GNKA 3QIDA 1H38A 2A3JA 4ZIVA 1N6QA 1OMSA 3JYTB 1F2HA 1B7YB 1NDKA 4K5RA 2UXCF 4I1TA 3DI6B 4GV9A 5GADI 4XEIA 5B08A 4LQ9A 5KFNA 3G6YA 4HLBA 3C66A 9ICSA 3T1HK 3ULDA 2ACYA 1PILA 5M1NA 2LEAA 4FJ9A 4PXDA 2EPIA 5E3CA 1D9DA 1YK9A 3BJYA 4PG5A 2DHAA 5SZTA 2YHWA 1T03B 4IR9A 4BC2A 2RRBA 3V6KA 3I82A 4ZVGA 4CLPA 3ZXWA 2A1JB 2KVQE 1RQ0A 4BQZA 2HK2A 3CMQA 4BDZA 1Q8BA 2BH1A 1X9WA 2KXFA 3VV2B 3PKYA 5T14A 1HRHA 2WZ1A 2G06A 1PVPA 1RXVA 4RBUA 2O8FA 1NK9A 3D1OA 2WVFA 3LVWA 4J9RA 3KUEA 2NCKL 2JRZA 4FK4A 4NM2A 4DTOA 2FQQB 3OYIA 4FOIA 3U1MA 2ZFHA 4B02A 1AFJA 2R7YA 3A1YG 3W60A 3M6GA 2XVTA 4OJGA 5M2RA 4URSA 4FVMA 2K8CB 3UXPA 4X4PA 1RTDB 4BRCA 3LK9A 3OR2B 3DLGA 3A8YA 4TNOA 2I1QA 2UVVA 1QQ7A 3VQQA 2VQEF 4F5QA 5C42B 1LWEA 4IH7A 2CPZA 1V9PA 4E7IA 1MMNA 3R7SB 2DGWA 1SC4B 1NSQA 4PXBA 5JJBA 1A6LA 1FE0A 4NCGB 4RNHA 2K06A 3RZAA 4O0NA 4IC9A 5JUMA 2O8EB 2W7PA 1S6QB 1PK1B 2KN7A 2MGZB 4RQ6A 3GONA 5HK4A 2W03A 2ZBRA 4NB4A 1HKCA 5ALNA 2HNZA 4LVSA 1QSSA 3O4QA 4E89A 3D1HA 4K5SA 3ENQA 4DUYJ 1M0SA 2C3OA 1RT1A 1ZQSA 4U7UK 2FJEB 5IWAK 2HHQA 4B9SA 1VI7A 2V51B 3MCPA 3RR7A 3EGZA 4NXNJ 4FF2A 5D8HB 4IFEA 1TK0A 4LZGA 1XNRK 2N7CA 4LF7F 3DMJA 2CWXA 5BREA 4P2MA 4DR7J 3M9NB 1B70B 3BS7A 1FDBA 3HZ6A 1ZBIA 2PN6A 4ICAA 3U9ZA 4J9UE 2ABYA 2QL7B 5GAHI 3A13A 3GCXP 3RR8A 2IDLA 2D9OA 1RGVA 3AVMA 1TK8A 4MDAA 4DHYA 1MC8A 2WBRA 2YKMA 4P9SA 1PZNA 5AQUA 4C80A 5AIAA 3OHAA 3MM9A 3R3LA 2ZM6K 1J97A 3RAMA 4CK2A 1WNEA 5J2AA 4PZNA 2VFRA 4JI0K 5H9FK 2P9NA 4PGQA 4KTZA 4RW6B 4MKYA 1L3UA 3MN5A 5J0WA 2X1AA 2VJVA 3H7IA 4M5IA 4B3SJ 1N36F 1C1CB 1RHUB 2HK3A 3LGMA 3NEKA 2K8GA 4F7VA 2ZJ5A 4QQBA 2VONA 3TKAA 5D0GA 5AFUH 3B9JA 1ZAWA 2G5HB 2QLJB 4DV7F 3QE9Y 3C16A 3W9IA 4C8YA 2YHYA 4DV0K 1BMQB 2CWKA 2XY8A 3AA5X 2NXCA 1JN3A 4CEOA 5KFKA 2MQMA 1ZQMA 3WT0A 2IYGA 1K73O 5DQHA 2VJ5A 1RTJB 3MUTP 2FHJA 1TUVA 3GV8B 2UV8G 3SCKE 4CJVA 1QAIA 2MZRA 3AAWB 4F3MA 4QBUA 3UO0A 3PLAA 4ID1A 4F2SA 3C29A 2E8AA 3KHHA 3SR6A 2VWJA 4F2RA 3OL7A 3VF6A 3WKDA 2G8IA 4BR9A 2HNDB 3LPEA 3Q2TC 2ZXIA 1R43A 3L7PA 3PJ9A 5BRFA 2VANA 2PI4A 1X6JA 3ASMA 4USIA 5FJ4A 3OVNA 2BX6A 3CCRN 3T41A 2IMOA 3EPIA 2HHPA 1KHWA 3QRPA 1SQEA 3FQLA 3QMQA 1BC6A 1IKYA 4IFYB 4C0OC 5J2IA 4R0EA 3CNQP 3ET6A 1CBKA 2G1HA 3D0PA 1S12A 2QXFA 2H5XA 3RH6A 2WF9A 4BG9A 8ICNA 3FMBA 4WFYA 3K8WA 4ZVSB 3ZDBA 4TLRA 3AMZA 2YXLA 2LMRA 1E6VB 4HTUA 4LBIA 1GLDG 3RW6A 1SC1B 3I0RA 3T6BA 3ETOA 5JTIA 2AU0A 4WTOB 3IRWP 9RUBA 2QFJA 2CZVC 4LZDA 1KEKA 1Q8IA 1YX2A 1KVJA 3G8TA 2A3VA 3PEHA 3GSDA 3IGNA 4H03B 3ORYA 2F9WA 1WOSA 2HQIA 5AE1A 2AGPA 3HX9A 2PGCA 4Y28C 1VBXA 4GXJA 4OX9J 2JMGA 3HRDD 1RM6C 4DL0C 1LXJA 4YHHK 5ETTA 4CJLA 5KOWA 4MJKA 1FK9A 2XYHB 4KLFA 4JKDA 1HPZB 2WK4A 5FLXO 4RWWA 1SZPA 3LW5C 5J1PA 5EN1A 2IOFA 2GIQA 2HGLA 3T5KA 5EE1A 3AVKA 1YTUA 3BO4A 4EP5A 3W2VB 3KLFB 2DR7A 1KVCA 2YKOA 4FJNA 1W7WA 2YBVA 3M2RB 5BYQA 4CO3A 5KFBA 3AVFA 4BX9C 2OMOA 3MAHA 1Z1ZA 2W40A 3RWUA 1HA1A 2KL8A 3BBCA 3DLBA 3WKAA 2OI2A 4FLTA 2P2CB 3ETRA 4M3XA 3FJ2A 4HWIA 3T3FA 1CC7A 2ZH9A 4C3MA 3H5XA 4IEIA 4YG2A 3O44A 5IIKA 4RQMA 1RBLA 3MR6A 2W41A 3J7AP 3OW2R 3CC2S 2LA4A 4C2MA 3EE3A 3CC7S 3MMBB 1N52B 1X5TA 5FLXU 3M1YA 4K4TA 2IAJB 4RL1A 4KHSA 3RSEB 2RQ5A 2NO4A 2MDAA 2X1GA 4PPDA 1LEOA 7ICSA 3OHRA 2FB0A 3FSIA 4CD1A 5KG3A 3UW1A 3V4IA 5BXIA 1ZBFA 2KG1A 4XA5A 2K1RB 4RW9B 3R6LB 4R8UA 3VQAA 2DNLA 3L2QA 2BRLA 1XHZA 1KAZA 3HPGA 3OQ2A 3TARA 2FY8A 3QIPA 1A77A 5KFXA 1U1PA 1UVLA 1LK7A 2BCRA 2XZWA 3IG5A 4DR2F 3Q8LA 3OYJA 1X40A 4PWDB 3GDQA 3VVTA 1HNIA 4MFBB 3CJ2A 3FEZA 3HW8A 2IRYA 1RYUA 2QARB 3K8VA 3EL2A 4M3ZA 5AQPA 2AV5A 3AOAA 4JBCA 3ATUA 5KPTA 3CJ9A 1Z6RA 4LSNA 2LQJA 4OHWA 3GIJA 4LFCK 2CPXA 3WK7A 1BIZA 3QESA 1F3VA 1H74A 4BR0A 2M9NA 1RT7B 4DLEA 2PA3A 2K8BB 2E66A 1X31C 3UKUA 3OJUA 4C4WA 2Q36A 1VOMA 1FJGF 4F3TA 1GOBA 3OR1A 4IO8A 4YY3K 5AK5A 5CABA 2OMLA 2MQPA 1UMJA 4B9MA 1YJVA 4CCHA 1XUPO 3AA4A 2VZ9A 1O5JA 3BKTA 4K2JA 1A5WA 4DUZJ 4IRCA 4NL5A 1XNQF 3GG4A 3NBPA 5FLXY 4GKKK 2EFNA 2YH0A 4B6JA 3ENOA 3L3FX 3EVOA 1T9WA 1YGYA 1VQNS 2VODA 3BQ0A 5A0YA 3UDCA 2ASMA 2EKNA 3OXFA 4ATNA 4PHEA 3N97B 1WTFA 3SSRA 1AUDA 2A6AA 4RKUC 3VGVA 4M63C 4UY85 3E9PA 1BE4A 4FWOA 3RMDA 5F0XA 3KLEA 8ICIA 2CZ9A 3NVVA 4U9RA 2WSCC 1YITN 5GAHU 1EKEA 5EGYA 3M6UA 4YXJA 3LF0A 2WTFA 1V5VA 3SUPA 5HMZA 1MA7A 4LF1A 2RB7A 2F65A 5AQFA 3TAPA 3JSBA 1V3ZA 4DPYA 4YN4A 4U96A 3ZSXA 4J2BA 4FW1A 3V81A 3ZFVA 5LMNJ 2CJ9A 4BC4A 2YPZA 2ZHBA 2OANA 2F7TA 2QA4N 2HS0A 4I67A 2O66A 4CWBA 5AXKA 1FRKA 2QT7A 3BSOA 3PZPA 1F5BA 1WF1A 3AOCA 1JXBA 1OYEA 4JI6J 1RHJB 2HBZB 4ID5A 4BRAA 2OKQA 4BVPA 1TR0A 2DFHA 2GZOA 4MLHA 1UL3A 1W7AA 1ZBTA 2VGNA 4BCAA 1JKHA 4C8MA 1H2TZ 1B0XA 3D0HE 3M8QB 4J5OA 3VF4A 2B51A 1BA1A 3F2CA 3O0FA 4KO0B 3AVHA 5DO2A 1MQ3A 4YOTA 3SEIA 2B6AB 4OMFG 3LAMA 2CJYB 1GEHA 2KMDA 1WACA 1BI4B 3WXLA 4M3TA 2W7AA 4HDHA 5BR8K 4QNLA 5AI4A 1U6FA 4RW4A 3EWGA 1IKVA 4QYZK 1SAZA 2JNJA 1JLAA 5C2CA 3OYGA 5AJ3K 5DKWA 2W8LA 4ILLA 2K4IA 1KP6A 2YX7A 2KIWA 1PO6A 4I6MA 3A3PB 2P6SA 1NO8A 2IVYA 5IC6B 1DLOA 3PJWA 2AGQA 2FC0A 1RE1B 3M8PA 5EU7A 5M2UA 4Y2IA 2DR6A 4K4YA 3VWSA 4MEYA 3UD5A 4X66K 1XTZA 1WWUA 4A2AA 3TA0A 3JSRA 4M5KA 1XWLA 3UKRA 2VPYB 3LYSA 4AH9A 1Z1VA 1YZ6A 3A5NC 4DHVA 3HWTA 4DFKA 5LSLA 3MR5A 5ETNA 3BZCA 3GJTB 1X4HA 3CDAA 5GAEI 5HHIA 2DFFA 3I4HX 4RG8A 1P7DA 1U1LA 1K8KA 1UVKA 3ZI4A 5C2FA 4B1WB 8ICSA 3LP0B 5KFLA 5ALYA 4Y1DA 2QMUB 3M32B 2QTWA 1ZM3A 1XK8A 5AFUA 5J0UA 3U4LA 3MGHA 1SJ1A 2ATQA 1SKWA 5HI7A 4DR6J 2QGFB 3UDLA 1S9GB 1P1TA 9ICJA 3PW4A 4NLCA 2DKZA 4CJ7A 2FHKA 1O0PA 3IS9B 2VPWB 4M5HA 1FI4A 4C3LA 2J0WA 1YHQS 1TV6B 5AZJB 1I94J 4R0JA 4IL6U 1HBUB 1TL1A 1UW9A 3QBWA 2K60A 2EG2A 1L7MA 2O4GA 1YG0A 1S6PA 1G99A 3NNCA 4WCEQ 5EOZA 1UEUA 4JV5J 7ICOA 3QQCD 3S41A 1HEKA 2PEHA 5KQ8A 4KREA 2DEIA 4JI5J 2KI2A 1NB7A 4OKJA 2ZJAA 3LP1B 4FYXB 2QLTA 3CO0P 1IKXB 1PVQA 2BEFA 4G1QB 1ILYA 3VVUA 1VQMS 2ZH2A 2E29A 3BN7A 5JVGQ 3O6WA 4I2IA 4KV8A 4X62K 3F53A 4RW7A 3NOGA 3BH6B 5BOMA 3TFSA 3MF5A 1MWMA 4FLZA 3IR5B 1TKXA 4H4OB 4CYUB 4ZVRB 4DU1A 3DOKB 2RSQA 4QAGA 4DV1K 4UB2A 4WQ4A 4I7FA 3I9ZA 4C4TA 3L7OA 2E1FA 3WK9A 3FE1A 4K41A 2IDEA 3A0HU 1A9NB 3TO8A 1ZQTA 3FZ2A 2VBXA 1NUEA 5KFTA 3V6DB 3P83D 3D2SA 1TQLA 4LFAJ 4JHDB 4OYWA 1GH8A 2G0CA 8ICVA 4FWQA 1WG5A 3ONNA 5KT6A 3Q8YA 2J7UA 1YAGA 1IBLF 3CCMN 1UEKA 1EQMA 1N33F 2F4VJ 2LYHA 4F4ZA 3F0NA 1FD2A 4X64K 8ICOA 3D1QA 3O2IA 2HSTA 5JICA 3BDPA 2HAFA 1HQEA 2OD4A 2G08A 2XI3A 2E5LJ 1J2MA 3UB5A 4NLKA 1BD6A 1N34F 4M45A 2MUTA 4O3OA 1X5OA 2EEYA 1VHIA 1X60A 2B4VA 4RLEA 3O9SA 3ELHA 4A48A 3LDPA 2FHMA 3SUNA 4IOXA 4RPXA 1YVFA 3QNWB 3MM6B 1JLQB 3NS5A 3JPQA 2B0CA 2OTLN 3RVCA 5I3UB 1KONA 1X9MA 2QK9A 1WUUA 5ALJA 2VOPA 2F96A 4AILC 1ICEB 1ZBUA 3QSYB 4DXLA 1VSMA 3QT8A 3D6MB 1J6ZA 1QTMA 2F9DA 4C8LA 1QHTA 4CJ3A 4ILRA 4QWEA 4QIWC 4ZPTR 3L5KA 1HYVA 3WKEA 4DPOA 4LRDA 2E1PA 2E8PA 2G8FA 3HPOA 4OI0A 1ACMB 3D3BJ 4LSZB 3UCGA 2NSBA 5CAAA 3M8WA 1VQPN 1NGDA 5KL8B 3WQTA 1F6TA 1FJEB 4M1KA 3EE8A 1RDUA 4YOUA 3KHGA 1WI6A 2HWHA 1TYQA 3IR6B 5A8KA 5I3QA 2B0GA 4F72A 2OEHA 4YDXA 3CIZA 3D2WA 5EOYA 2WVEA 1KQGB 1K8AO 4PAAA 2NPFA 2W2QP 1K9MT 1YWXA 2ZGZA 2EAOA 4USUA 3L4IA 2CPHA 1RDDA 1FNXH 1OVQA 3PYGA 4CT8A 2B4OA 3QIOA 4RWXA 3D2EA 4L3QA 5AQGA 2ZJRQ 3HM8A 2W43A 2JVRA 2D0AA 4CJPA 1S1VA 5ALOA 2PFFB 4WBFA 4BE0A 2AW0A 2ROGA 2LU2A 2V9KA 3CJ7A 1XC9A 5J29A 4KY3A 3A8KA 2JZBB 3OYKA 1NNEA 4OYXA 3QFHA 3BN4A 1FHTA 2OHFA 2KZZA 7ICPA 2CA9A 4LF5F 3F41A 1SKSA 4CK1A 4PHTX 3B4MA 4J2AA 2VQFF 4N8OA 4HYKA 1NH7A 4A8WA 1KNZA 4OL8A 1VLOA 2JL9A 3UR0A 2GO9A 1XR7A 4C6AA 3C1YA 5BN9A 2R3VA 1CJVB 3MMCA 3AY9A 4QIWD 5C7PA 3C2KA 2JLGA 5AQTA 4H0PA 8ICCA 5HQ8A 2JDJA 1ZQOA 1ITPA 1IR1A 2AYEA 1NGFA 2Z58B 3PYDA 1RQNA 5LJ5Y 3OUYA 5F9NA 4LF9J 1D5AA 2QA2A 3NGZA 4CEEA 3TEGA 2N7YA 3CT9A 2UUCJ 3H45C 4FF3A 3KTQA 2ZIWA 3D0IE 4QIWF 4F67A 3E9LA 1CJKB 2ASDA 3HOSA 2P35A 2BCVA 1X3NA 1LWCA 5B8HA 3DLEB 1RT6B 4BDYA 1NCLA 4IZ9A 5LSRA 4X5VA 1HIYA 3BGOP 2EC0A 1V3RA 2XZTB 2UUBF 3MOZA 2QG9B 3TX8A 3CB4A 2CDQA 3T7ZA 3UPFA 3ICXA 4ED4A 2NXUA 3P39A 3KK1A 2HWIA 3SMPA 3I5AA 4F36A 2HQFA 1SIZA 1PAEX 2UXBF 4CJ5A 1HQUB 3QAUA 4KAIA 3R6MA 1L7NA 3CCVS 2LXUA 4ZPDA 4OGEA 1VLYA 4YFKA 1NH8A 4E2FB 3TANA 4WFZA 2E5IA 2H3EB 3W65A 4Y2XA 3OVSA 5GAEU 3VQCA 3LVVA 4OIXA 4DSFA 5AR0A 4Y34A 5DB6A 4KFBB 5KFVA 5CZ1A 3KDOA 3HVTB 4CF3A 4H4KC 4RZRA 2IS3A 2FE9A 4NYFA 4TY8A 2R7UA 1RCOB 1BPYA 3BR8A 3VENA 2KQ2A 3NNAA 2VA3A 3LDAA 1M1HA 2BW2A 4MKVA 4WKRA 3P4IA 2CQDA 2XYGB 3R5CA 4DTNA 1G2EA 4QIVA 4BC5A 3DRPA 3N0VA 2IPOB 2HHXA 3C15B 1M5SA 1ZQNA 3DOMA 1K5OA 2JGAA 2A42A 5EWEA 2ZWPA 4RNNA 2HBYB 4EEYA 3VALA 1IJJA 5CYMB 4PL7A 1HNXJ 2ATCB 1NPPA 4XPCA 3OPXA 3RFAA 1YF5L 3IMQJ 3GILA 2XWYA 2KZMA 4YVZA 1J2VA 2DJWA 1I3OB 4EAHD 3HSTB 2YKAA 4E7KA 4ZLPA 4UY8O 1F44A 1IJEB 3QB0A 4DR3K 4Q7AA 5EY4A 1BPEA 4I2PB 5E5NA 4DPXA 2Q31A 3V1OA 1UETA 2L3MA 4FF4A 5J8YC 4ZPVR 4J2EA 3MAAA 9ICEA 1HNWK 1W2BR 3FZBA 4P2SA 3L4QA 2AXTU 4DI6A 2EK1A 4Q2LA 4CF5A 1VSEA 4Y6IA 1X0PA 2D1CA 3BS5B 4RQ4A 2VKQA 2H9ZA 4GXIA 2KSOB 2LI6A 1MROB 2B4PA 1Q46A 3DRXA 3FZKA 3QEWA 4B3SK