2K4PA

Solution structure of ship2-sam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
SGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Studies of a Heterotypic Sam-Sam Domain Association: The Interaction between the Lipid Phosphatase Ship2 and the EphA2 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2
total genus 14
structure length 65
sequence length 65
ec nomenclature ec 3.1.3.86: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase.
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k4pA00
2EAOA 5JTIA 1WWVA 3BQ7A 5F3XB 2E8OA 2ES6A 3BS7A 1SXEA 5JU5A 1PK1A 2LMRA 4RQMA 1COKA 2E8NA 2FE9A 1X40A 1DXSA 3H8MA 1SV0A 2D8CA 2JV3A 2ESEA 2KG5A 1SGGA 1SXDA 2EAPA 2K60A 2E8MA 4NJ8A 1RG6A 3KKAA 2F8KA 2EAMA 1V85A 2LPEA 4NL9C 3KKAC 2K4PA 1B4FA 2QKQA 2QB1A 3BS5A 3K1RB 2GLEA 1Z1VA 1X9XA 4MHVA 1OXJA 2KMDA 1F0MA 1UQVA 2EANA 1UCVA 5J8YA 4PZOA 3SEIA 1X66A 2DL0A 3TACB 3SENA 2Y9TA 3HILA 5J8YC 2F44A 2Y9UA 2DKZA 2L5YA 1OW5A 2KE7A 1PK1B 1LKYB 1PK3A 1JI7A 4IS7A 5JRTA 2E8PA 1SV0C 1SV4A 2D3DA 2QARB 1B0XA 2QB0A 3IDWA 2QB0B 2KSOB 1KW4A 1V38A 4NL9A 3BS5B 2F3NA 2KSOA 2DKXA 2YTUA 3TADA 1WWUA 4RQNA 4PZNA 5L1MA 5KNIA 1LKYA 2QARA 3TADC 2KIVA 2B6GA
chains in the Genus database with same CATH superfamily
5J2BA 4RQ1A 3V7JA 3SV3A 3BS7A 4KN4A 1A6SA 5KFPA 1ZQWA 4G3IA 2E8NA 1RM6C 1PVQA 2PMZC 3UQ0A 1O08A 1SV0A 3ZDEA 9ICLA 5AKJA 5D49A 1C7YA 3MGIA 5AI6A 2MRLA 1GO3F 2E8MA 2BPCA 1DOQA 1KQQA 3EW9A 2KFNA 4EX6A 2HHUA 5ALMA 5ALJA 1ZRMA 2W8LA 1N5XA 4J9MA 7ICLA 3D2QA 4QZDA 3G6YA 9ICUA 1PUZA 4YR2A 5IILA 3GILA 5IIMA 1U48A 3AN1A 5KFUA 3DV9A 4F72A 4XQ8A 3AU2A 4TUPA 4I29A 5AM0A 3F53A 1JRPA 1ZJNA 2HBMA 1FO4A 2Y9TA 1XO0A 2F44A 3RJHA 4K4GA 1UA0A 4BXOA 5KFNA 2BQUA 2BCSA 4NLGA 2YB4A 2WF6A 4DSKA 2VA3A 1SV0C 4M9NA 4RQ6A 1RZTA 2ZIUB 1RYSA 4I2BA 5ALEA 3N7SC 3RRGA 1XO1A 2XVTA 4EBDA 2PFOA 1ZOLA 5KFMA 3GIJA 5J0UA 1L3TA 3BS5B 1S77D 3QU9A 3TADA 1F5SA 4GC6A 4RQNA 3CP8A 2BPGA 1NKCA 2K4HA 4KMUA 4F4YA 8ICIA 1ZQQA 4YXMA 4O3MA 2JEIA 8ICHA 1QQ6A 3RTVA 4Q45A 4Z6DA 2I5HA 4U6PA 4ECTA 2D8CA 1L7MA 1P7DA 5AK6A 2KFZA 4DSLA 4QWEA 1TKDA 1U49A 1YT3A 2KEYA 4ED2A 4J9LA 1CRXA 1RQNA 3K75D 1L6NA 5KFJA 2JEGA 7ICQA 4ECWA 2YX8A 3MR5A 4EX7A 3BJYA 9ICNA 1Z1VA 3KTQA 5KFWA 5AKYA 2H3VA 1F0MA 5A0LA 1XU4A 2EANA 2HHVA 2JEJA 1UCVA 3EYZA 4IQWA 5AKZA 3JPQA 5DDYA 2IOFA 3IRUA 3PX0A 5J0OA 3J81j 4FBTA 1NK7A 2E8PA 4J03A 3JPTA 4UAYA 2YMLA 4IRCA 3M9MB 3K1ZA 3R9KA 2R8IA 4DLEA 2UVWA 4EEYA 3SMVA 4I2JA 5ALFA 4US9A 1FEZA 4QJFB 5KFCA 2JMGA 5AK5A 2VJ4A 5AI0A 4F91B 4EBCA 5DGAA 4F5QA 8ICBA 1AQ6A 4ELUA 4NM1A 1DK2A 4M6WB 3GDXA 3PW2A 4I2GA 3DEEA 1K5OA 4J9NA 5AI4A 4FS1A 8ICAA 1U45A 4DFMA 3AEVA 3BQ0A 3IN5A 3ORYA 3N28A 3V6KA 5ALDA 2W7OA 4YMOA 2F8KA 2P6UA 2NO4A 3NASA 4PHDA 4NL9C 4F4WA 1PVPA 1K1QA 2FLNA 4KLLA 1XSLA 1X42A 5HMMA 2H3IA 3RB6A 1BPYA 1J2NA 3PW5A 5KFDA 2J6UA 2ZTEA 7ICIA 4CF4A 4ELVA 3IP4B 1ZQZA 2BCUA 2HHWA 4IR1A 7ICTA 4CDGA 2VA2A 3AU6A 2BQ3A 5GTIU 4NV0A 3HILA 4DS4A 4FO6A 4KLIA 1MN8A 3WK7A 4YFKA 2L5YA 3ZDCA 7ICSA 5T14A 2P66A 4F50A 2OEHA 2D6FC 2VKQA 2Z7JA 2JRZA 3ZDDA 3PMLA 3G6VA 4UB5A 3T5HA 2KZMA 5KFOA 2HSZA 5ALRA 5IIJA 2HOIA 3C1ZA 5ALXA 1A76A 2HW3A 3BZCA 1NK6A 3LWLA 2OCEA 2HCFA 2DKXA 4DOAA 1Q8KA 8ICTA 1RYUA 3M6KA 3I28A 2G5IB 3GV5B 4DL2A 2KZ3A 2HBJA 9ICBA 4NY8A 1OUQA 3H0MB 5JTIA 5J2JA 1HIWA 5J0SA 3T5KA 4M0AA 2FJ6A 1ZQDA 4Y2PA 9ICHA 1XSPA 4DOCA 1N60A 4EENA 4QZFA 2PXIA 1MQ2A 5AI8A 3B9JA 4F5RA 1WG8A 2BDUA 7ICOA 2JV3A 4O9MA 4ELTA 4YXJA 1X9WA 2KG5A 4DFJA 3MR3A 3KHHA 4R8UA 5ALKA 5AM2A 4Y2SA 2LM1A 3Q8RB 1NOMA 1KRPA 3EUB2 3JPNA 3LWMA 1WUDA 4IQTA 1ZQOA 5AKXA 4XUSA 4DSIA 3PR4A 2WF8A 1RYRA 3KHRA 9ICOA 1IXRA 5KG4A 2KNJA 4P0QB 4UATA 5KFGA 4QZ8A 5DLGA 2Y0SC 5B66U 3SENA 5CRXA 2W9CB 3C2LA 4QZIA 3D6JA 4OJ5A 4GXKA 5AK3A 3Q8MA 3RJGA 2ZIVB 4OJOA 1JROA 2KTQA 4F5NA 4NLNA 1L3UA 3WKCA 4QZHA 4PL1A 3HJEA 1HUOA 8ICUA 3WU2U 2FPLA 5BPCA 2W9AA 4MFAA 3NRZA 3M9NB 4UB8U 5IIIA 4YD2A 1FFUA 2FPMA 2FMQA 5AICA 5L1JA 2Y0SF 8ICOA 1WWUA 1FFVA 1LKYA 4QWBA 1N5WA 5KTQA 4Y2QA 9ICEA 2HHQA 1J97A 4HAIA 4O3QA 4PPXA 4Q8FA 2KV2A 2EDUA 5J0XA 4YG2A 4U7CA 2PFQA 2ODGA 4TQSA 3C1YA 2BKEA 5HMLA 5J0TA 4RQ8A 1NK9A 1ZQGA 4BDPA 2JH7A 2PFPA 1KEJA 2ZUDA 3OSNA 2DPJA 2UVUA 1NJZA 4RQ7A 2ZIXB 1KFTA 4OJPA 2E5SA 1S0NA 2R8KA 1S5LU 3UM9A 3LVVA 2EAMA 2O6KA 4RT2A 3HX0A 9ICTA 4YR3A 4LZGA 5KT6A 5KL1B 5DBBA 4FZLA 1ZQAA 5J2AA 4JV0A 3N7PD 4RNOA 4C8KA 4R8UB 3PW0A 1A77A 5KFFA 4KLMA 4DL6A 1CEZA 4RQ3A 2LI6A 5EE1A 2RLTA 2ZUBA 2BHNA 1NZPA 3KOOA 2JHDA 4DEZA 4ECXA 1ZQKA 1ZQ1C 3RFAA 5K4LA 5DBAA 3F2BA 3MDAA 1Y88A 2DBYA 4ED3A 3JPSA 2A1JA 4C7YA 1EXNA 2DQNB 4GXIA 1VLBA 4DL3A 3OTQA 3WKBA 2V4QA 4YQWA 1KW4A 1DGSA 2NYVA 2P35A 2RP5A 4RZRA 3KZXA 4EBEA 2Q0ZX 4QZBA 3OJSA 2NRXA 4JB3A 3TI0A 2FMSA 1JN3A 4M9LA 5HHHA 3HT3A 4NLCA 3H4BA 8ICEA 3PZPA 3M8SA 2RDJA 1NK5A 2ZJ5A 3RJJA 4Y2RA 5KT3A 5ALWA 3V72A 4J9SA 1Z1BA 1TE2A 3UXOA 1IG6A 5ALHA 3HWTA 2YMQA 3ZD9A 2QKQA 1UHUA 1ZJMA 1KN5A 2Y1JA 3TKAA 3NTUA 2Q4TA 5KFKA 4JV1A 3F5EA 2KHQA 1L3VA 1T3NA 5KFRA 5G5GA 4UASA 5KFZA 1T7PA 3HKZF 3GV7B 2AHOB 1SZPA 9ICSA 3PO5A 2BZFA 2HI0A 3RAXA 3UQ2A 4O0IA 5AI9A 4UW9A 5J2DA 3C2KA 3RB4A 1S9FA 4KX5A 2KE7A 2IA6A 3MR2A 5FP0A 1IV8A 4IS7A 2KJ5A 4OD0A 4OJ6A 5KFQA 4DO9A 1X6IA 2D3DA 2MUTA 4BWMA 5ALOA 4XRHA 2NV3A 2HVIA 1XSNA 2HDOA 4RNNA 1S0VA 2B21A 4FZMA 4RPZA 3D2NA 2RDIA 1SKSA 3THVA 3PV8A 4P4MA 1H38A 3RRHA 4O3PA 4DF4A 4QZCA 5CP2A 4JWNA 5KT5A 2F1JA 2M0NA 1S10A 2WB1C 2ZTCA 3BZKA 4BGDA 3QZ8A 2W9BB 4B9MA 1U9LA 3AQEA 2ES6A 1PZNA 4NXZA 3C28A 5AKHA 3EZ5A 2PI4A 2LYBA 4I2HA 2JH1A 3ETLA 5F9NA 5HNKA 3V7LA 2FE9A 3LDAA 4CNQA 1ZQIA 3OSPA 1SGGA 2K60A 3H8JA 3V6JA 4FBUA 4AYBC 2WFAA 2W43A 4K4HA 5HR7A 4P2HA 4DFKA 3EWAA 4F5PA 2WAQF 5ALVA 3PVXA 5EWGA 2ISOA 2YMMA 2YN4A 3N7RC 2WHEA 3WK9A 5KG6A 4EELA 4J9OA 1NKEA 1ZD2P 8ICFA 4ECZA 4ED7A 3NGDA 2FI1A 2ALZA 4CF5A 3GIIA 3OJUA 1MSWD 1RDFA 4YP3A 1ZQBA 2W03A 4UAVA 4R65A 5CA7A 1TFRA 3IG5A 7ICKA 5C5JA 3N4MB 3B0XA 3NVWA 5AIAA 8ICVA 2XY6A 1B0XA 4RNMA 3RF9A 3QU5A 4NM2A 5ALIA 1WCLA 4JV2A 3OHBA 3G6XA 3BQTA 2RQ5A 1COOA 1HEKA 4TUQA 5DBCA 1ZD5A 2EQYA 1SKWA 2PMZF 1ZD4A 3C2MA 3Q8KA 1KBUA 1A0PA 5KFVA 3ISDA 1QSYA 1U4BA 5ALQA 4P0QA 5DQGA 3MR6A 2HHXA 3NVYA 3ZDBA 5KT4A 5CJ7A 4KLTA 1SL0A 7ICGA 1IIPA 3RR7A 2R8GA 3AUOA 1KFDA 1K1SA 4NJ8A 3IG8A 1KDHA 1V97A 3M7DA 1HUZA 5KFSA 5J0QA 3ONNA 4AP9A 1D9FA 4E0DA 2WTFA 4I2EA 1LV5A 5ALPA 4GC7A 4BWJA 5HHIA 3LVWA 1Z3EB 2WAQC 1ZQCA 3RH5A 4CF3A 3GU3A 5J0PA 1SIJA 2W7PA 1Z00A 4ECSA 2BGWA 1NJXA 9ICVA 3GIKA 3SEIA 2I9GA 2AU0A 3SR6A 5J8YC 3ISCA 5J2CA 4JWMA 4UQGA 2IOHA 2ZJAA 4XA5A 4NWIA 4ED8A 4B9NA 4NLZA 2F77X 1SWVA 4FS2A 2A19A 4P0PA 3MFHA 3QU7A 2KJ8A 2KK0A 5DB7A 4DSEA 3T79A 2QARB 4LZDA 5DDMA 4OO1J 1RPLA 4JUZA 1ZETA 3RBEA 2QB0B 5TZVA 3E0FA 8ICPA 5CR0A 2FMPA 3QNMA 2K89A 3MGHA 2OHFA 4F71A 3PMNA 3EPIA 5AKLA 2CN1A 5ALZA 1N62A 4LJXA 5EE9A 5JRTA 2B6GA 2KIVA 4F2RA 2C2EA 4PHAA 4P0PB 3UMGA 5AIBA 4QZAA 1S0MA 4B9VA 4DQSA 2HBKA 8ICKA 2KZZA 3C5FA 2N1RA 3SYZA 3N97B 9ICQA 5KT2A 4UB4A 5B5EU 4DLGA 3V7KA 3WK8A 4C0ZA 2JZBA 3TFSA 3JPPA 1WCNA 4I2DA 5KG7A 3RBDA 2V9WA 4IQUA 3KKAA 2IHMA 1UT8A 3WKAA 3JPRA 1V85A 2I1QA 2LPEA 2YMPA 4DQPA 4TUSA 2BCQA 2IMWP 1N48A 2EZXA 1RXWA 3UXPA 4KLUA 4UB1A 3M1YA 1NNLA 3ZI4A 1Z19A 2KVCA 3IM1A 2J6TA 1MQ3A 4X5VA 3HP6A 3KFUF 5AHXA 1T4GA 4C4SA 8ICQA 5D46A 2H3ZA 1ZQYA 4YMMA 4FZNA 4IC9A 4MEYA 5DQIA 4PGQA 4DFDA 4P4PA 1XWLA 5ALNA 2BDPA 3MGVA 4J9RA 1ZQRA 9ICPA 3PSPA 4GLXA 5EOZA 3QUTA 2G07A 3QUCA 4K4IA 2W11A 2OWOA 2GWSA 2JXJA 3AMZA 5KFAA 3WK6A 2A1JB 4C4RA 4M9HA 1NI3A 2MAXA 3RJFA 4PZNA 2AGOA 5KNIA 3CW2C 8ICLA 2FPKA 1Z4NA 1T94A 3BQ2A 4O3NA 3ETRA 1D8BA 1S76D 4QZ9A 2QLTA 4F3OA 2KD1A 1SXEA 3BQ1A 5J2GA 9ICJA 4DSJA 4FE3A 2FDRA 2CRXA 4M47A 4O5CA 3PO4A 8ICMA 4C80A 4YCXA 2VA8A 4IL6U 3IV6A 4Z6EA 3RH4A 4QWDA 2AH5A 1NK0A 8ICJA 2K8AA 1B4FA 4C8LA 2ZIXA 5BOMA 3FDSA 4UAUA 1TK8A 5BOLA 2PFNA 3RB0A 2GH1A 1NJWA 5JUMA 4MHVA 3KBBA 4Y2XA 2HOFA 2F2AB 1ZQHA 2OM6A 3FAHA 2ASLA 1UQVA 4F8RA 1BNPA 2LYAA 4PZOA 2WF5A 3CRXA 1X66A 2BCRA 1TAQA 1ZQSA 2Y9UA 1RQLA 3RJIA 1N56A 4F4XA 1BVSA 9ICKA 4PGXA 1LKYB 4DL5A 5ALYA 5TISU 4YD1A 4KX3A 1JMSA 1X9MA 3PSIA 3MBYA 4USAA 5ALLA 3DDHA 4ED1A 1JUDA 4UARA 1YZ7A 4TQRA 4O3SA 2FLLA 1JALA 4R66A 2IOFK 3NVZA 2ASDA 1IM4A 1ECWA 4O3RA 4F93B 4US8A 5DKWA 3D2SA 2YTUA 3HPOA 4UB6U 4PGYA 3Q8LA 2XICA 1WWVA 4B6JA 3A0BU 4RU9A 5IIKA 2XIDA 4KMOB 2XC9A 3HRDD 1NK4A 1COKA 1QQ5A 8ICYA 2ISPA 5AI5A 1CI4A 3NUQA 7ICNA 2OYYA 3QU2A 1ZQLA 3I76A 3T3FA 3UXNA 4MF8A 5CHGA 3JPOA 1X9SA 4R63A 2LBOA 8ICSA 3KKAC 5DGBA 5KG5A 1KFSA 3TQ1A 3H8SA 2QB1A 3UMBA 1NJYA 4B9LA 2XCPA 4UAZA 3K1RB 3A0HU 3GQCA 2V4RA 1L3SA 4KLDA 2ZXIA 2GLEA 4QNLA 4YR0A 1TAMA 1OXJA 3M9OB 1DK3A 1T3QA 5ALUA 9ICCA 3VC8A 1ZQUA 5L1LA 1SZHA 8ICXA 1SB3C 2EZZA 2KP7A 2KN7A 2YB1A 3F2DA 3H40A 2F76X 5KFTA 4DFPA 1ZQEA 4ICAA 2DWQA 7ICUA 4KLSA 3OHAA 1XNSA 2QB0A 2K8CB 3ZDAA 3GZFA 1Q3VA 1ZD3A 4PL2A 5DG7A 2ATLA 4M04A 3AM9A 1XC9A 2FLPA 4O5EA 2KSOA 1ZYQA 5J29A 3TAQA 2DF4B 9ICGA 2A3VA 4RUAA 2QARA 3L3FX 5ALGA 2KOBA 5CB1A 2HMXA 4MF2A 3M8RA 4MEXA 3B0YA 1TAUA 4Y2JA 1BPEA 1PK1A 2IHNA 2LMRA 3LYSA 2A1AA 2AXTU 7ICEA 5J2IA 1X40A 3PW7A 3H0RB 5J2FA 4AYBF 9ICXA 4UAWA 2EAPA 2W9BA 1MC8A 2NRWA 4B9UA 4ECVA 4PHEA 1S8OA 5L1KA 1BPBA 2AQ0A 2HVHA 1URJA 4QIWC 2NRTA 7ICPA 2ZTDA 4UBBA 2XGPA 1N61A 1HJPA 2E1FA 7ICHA 3EPGA 2ZIUA 2BPFA 2XY5A 5HP4A 1Q3UA 2LKYA 4DL4A 8ICWA 4ECUA 4MFCA 2HHTA 5DLFA 4UB2A 2B0CA 3TAPA 3Q8SB 3SV4A 3TFRA 4RPXA 4J9PA 3T5JA 3AQFA 3PX4A 4QZGA 2K8BB 2PKEA 3Q8PB 2YQEA 3CYMA 4Q44A 1DGJA 5J0RA 1OW5A 5KAFU 1D9DA 5HR6A 5GTHU 5G5HA 2W55A 5KG0A 1SV4A 2W9MA 3H4DA 2DGZA 5KAIU 4BJQA 1RXVA 3IDWA 5ALSA 2IBKA 2KKPA 4Q43A 3RH6A 2G08A 2OXOA 1BPDA 5L1MA 4R64A 3E58A 1U47A 4OCZA 5AM5A 4YMNA 2XY7A 4Y2TA 3RB3A 3T5LA 4RQ0A 1YZ6A 4PH5A 4KLOA 2R8JA 2F1IA 3GIMA 4C7ZA 2H5XA 3PY8A 3SAFA 4RQMA 2DPIA 2H3FA 5J2EA 1VJ5A 3RR8A 1KLNA 1DXSA 3H8MA 5KFIA 3KD3A 8ICNA 1WYGA 1KTQA 2ZJ8A 9ICAA 3LK9A 1UPHA 1QSSA 1RG6A 1C20A 1KSPA 3SI8A 4WJ3B 4DOBA 3MFIA 3U26A 5DG8A 3ED5A 1QH9A 4KITB 4DL7A 2VJ5A 3HW8A 4C4TA 8ICRA 2ASJA 5EWFA 1BNOA 2GO7A 4C8NA 3KHGA 1Z4OA 7ICRA 2EZYA 4PHPA 5J8YA 3QZ7A 4I2FA 1L8OA 1N2XA 2F1HA 4ZOHC 2DL0A 3PR5B 4HYKA 4OJLA 1UT5A 3NVVA 1PK1B 1PK3A 4GFJA 4LVSA 1JI7A 2C28A 3QX7A 4QWCA 2DUYA 5H2FU 2CPRA 3MABA 3RAQA 3L5KA 1JX4A 1FIQA 3K4GA 1T8EA 2YY6A 1TV9A 2UVVA 5KL8B 5AM3A 2RRDA 5KFYA 3GV8B 1SWWA 5L9XA 2KSOB 1V38A 1B22A 5DB9A 2HHSA 4A8EA 9ICMA 4BX9C 4Z6CA 3H0LB 2WF7A 2JEFA 2ZIWB 3QEBZ 4ED0A 4UBCA 4DWIA 3MC1A 1QCKA 4J9KA 4EYHB 1SL2A 3SQIA 3TARA 2PI5A 2K4IA 1LB2B 4Q8EA 2AJQA 2R18A 4M9GA 2C22A 3E2EA 2ZG6A 2BCVA 4KN7A 3SD7A 5CEHA 5AKEA 4FFDA 4CCHA 1ZQVA 1ZQPA 4O3OA 3Q8QB 5KG1A 1SXDA 2LM4A 4RPYA 4YN4A 2XO7A 3QE9Y 4M9JA 2XI9A 3PNCA 3ALRA 3O0FA 4DCCA 4EYIB 3FYHA 4KLGA 5AK4A 1D8LA 4DS5A 3BS5A 2OH2A 3OPXA 1SKRA 5IINA 4BUGA 2C2RA 4ED6A 3QUQA 2AGPA 1X9XA 3PX6A 5IIOA 9ICIA 4GIBA 3H8WA 5DB6A 2KMDA 4KTQA 1KL9A 2ZIVA 4CRXA 4RT3A 3QU4A 4JMUA 4P4OA 4DQQA 4O5KA 1KKXA 1JXLA 4IRKA 1QLNA 5KFLA 4QW9A 2DKZA 4B9SA 4QW8A 1X2IA 3ISBA 4RQ2A 3OGUA 1NK8A 1D8YA 4IQVA 2J6SA 4KLJA 4I2IA 2W04A 3FC4A 1TK5A 2KICA 1V9PA 1ZXIA 3SAHA 2KJ9A 3L4PA 1UA1A 2ZIWA 3C21A 1LVHA 1ED1A 2E1EA 5L1IA 3V6HA 1JIHA 1L7NA 5ALTA 1ZQFA 1L7PA 4QZEA 7ICMA 3C23A 2VIXA 1Q46A 1N63A 3NRWA 3BQ7A 5F3XB 2CXYA 2MU2A 4F92B 4KLQA 2NO5A 3I1YA 3SAGA 2E8OA 1ZQNA 3C29A 5JU5A 3PSFA 4I27A 2XGQA 4IRDA 3VCBA 5KFEA 2C2DA 2HBLA 3QXGA 3F2CA 2WF9A 2GOLA 3AL0B 2HOQA 1ZRNA 2W3SA 3WKDA 5EE3A 5J2HA 9ICWA 1JXEA 4ECRA 3TANA 1BGXT 2NRZA 2LYHA 3S6JA 4RQ5A 2K4PA 4J9QA 2F8LA 4RQ4A 2MUTB 3ZD8A 1B43A 3BDPA 4DSFA 4Y2UA 3HKZC 2AGQA 2KVSA 4C8OA 5D4BA 4I28A 1QSLA 3WK5A 1MA7A 4CE6A 2KKVA 2WB1F 7ICVA 3C5GA 1ZQTA 1QQ7A 8ICGA 1L8LA 2E3TA 2VANA 2XCAA 2BR0A 3ICXA 4UB3A 7ICFA 4F2SA 1S0OA 5F9LA 1TK0A 3H7IA 9ICFA 2JR5A 4G9BA 1L7OA 2RHFA 2M9NA 4Y2VA 1ZQXA 3UMCA 4EEKA 5KFHA 2W8KA 2G09A 1QTMA 5AM1A 3WK4A 5KG2A 4I2AA 2P6RA 4NL9A 3WKEA 2F3NA 4ZH4A 4ECQA 1VDVA 2AQ4A 4B9TA 8ICZA 1ZQMA 3FM9A 5CWRA 4PJ0U 1NZBA 2W9CA 4EZ9A 2EAOA 5E79U 4NLBA 2K4EA 4TURA 4EZ6A 2H3QA 4BXOB 4F4KA 9ICRA 3CNHA 3PSTA 2R8HA 2ZXHA 4M6WA 4KLHA 3RJEA 1CUKA 3RJKA 1J2MA 2W3RA 3PW4A 2ESEA 5KT7A 4CGZA 1F44A 4DQRA 1L5UA 4KLFA 2NRVA 1DRGA 3MDCA 2BQRA 3F5AA 2G5HB 2MSNA 5J0WA 5DG9A 4KLEA 7ICJA 1NKBA 1SL1A 1O03A 1BPXA 4Y2YA 2W54A 5C0YA 5AM4A 4ACOA 4YVZA 4QIWF 3IHQB 4GXJA 4MFFA 2G0AA 5AKKA 5DQHA 3GFKB 4JK1A 1PVRA 3KZIU 1TVAA 1ZQJA 4Z6FA 2JZBB 5EE0A 2Y1IA 5AKIA 3SZ2A 5KFBA 5DB8A 5J0YA 1S97A 3TACB 2I6XA 1Z00B 3UPQA 4QWAA 4F4ZA 4ECYA 5KG3A 4DF8A 4M2YA 3QEAZ 5KFXA 1X6JA 5AKGA 2G06A 4F5OA 2LHTA 2KIWA 1AROP 8ICCA 1BPZA 4RUCA 2MA1A 4IR9A 5EWEA 3QUBA 3M6ZA 1XS9D 4DQIA 3KHLA 5J2KA 4NLKA 2KHVA 1M6YA 2UVRA 3QYPA 2JGAA 4I2CA 2EH9A 2DFLA 4C8MA 3TADC 2ZUCA 3NS1A
chains in the Genus database with same CATH topology
2EAOA 5JTIA 1WWVA 3BQ7A 5F3XB 2E8OA 2ES6A 3BS7A 1SXEA 5JU5A 1PK1A 2LMRA 4RQMA 1COKA 2E8NA 2FE9A 1X40A 1DXSA 3H8MA 1SV0A 2D8CA 2JV3A 2ESEA 2KG5A 1SGGA 1SXDA 2EAPA 2K60A 2E8MA 4NJ8A 1RG6A 3KKAA 2F8KA 2EAMA 1V85A 2LPEA 4NL9C 3KKAC 2K4PA 1B4FA 2QKQA 2QB1A 3BS5A 3K1RB 2GLEA 1Z1VA 1X9XA 4MHVA 1OXJA 2KMDA 1F0MA 1UQVA 2EANA 1UCVA 5J8YA 4PZOA 3SEIA 1X66A 2DL0A 3TACB 3SENA 2Y9TA 3HILA 5J8YC 2F44A 2Y9UA 2DKZA 2L5YA 1OW5A 2KE7A 1PK1B 1LKYB 1PK3A 1JI7A 4IS7A 5JRTA 2E8PA 1SV0C 1SV4A 2D3DA 2QARB 1B0XA 2QB0A 3IDWA 2QB0B 2KSOB 1KW4A 1V38A 4NL9A 3BS5B 2F3NA 2KSOA 2DKXA 2YTUA 3TADA 1WWUA 4RQNA 4PZNA 5L1MA 5KNIA 1LKYA 2QARA 3TADC 2KIVA 2B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAO A;  5JTI A;  1WWV A;  3BQ7 A;  5F3X B;  2E8O A;  2ES6 A;  3BS7 A;  1SXE A;  5JU5 A;  1PK1 A;  2LMR A;  4RQM A;  1COK A;  2E8N A;  2FE9 A;  1X40 A;  1DXS A;  3H8M A;  1SV0 A;  2D8C A;  2JV3 A;  2ESE A;  2KG5 A;  1SGG A;  1SXD A;  2EAP A;  2K60 A;  2E8M A;  4NJ8 A;  1RG6 A;  3KKA A;  2F8K A;  2EAM A;  1V85 A;  2LPE A;  4NL9 C;  3KKA C;  2K4P A;  1B4F A;  2QKQ A;  2QB1 A;  3BS5 A;  3K1R B;  2GLE A;  1Z1V A;  1X9X A;  4MHV A;  1OXJ A;  2KMD A;  1F0M A;  1UQV A;  2EAN A;  1UCV A;  5J8Y A;  4PZO A;  3SEI A;  1X66 A;  2DL0 A;  3TAC B;  3SEN A;  2Y9T A;  3HIL A;  5J8Y C;  2F44 A;  2Y9U A;  2DKZ A;  2L5Y A;  1OW5 A;  2KE7 A;  1PK1 B;  1LKY B;  1PK3 A;  1JI7 A;  4IS7 A;  5JRT A;  2E8P A;  1SV0 C;  1SV4 A;  2D3D A;  2QAR B;  1B0X A;  2QB0 A;  3IDW A;  2QB0 B;  2KSO B;  1KW4 A;  1V38 A;  4NL9 A;  3BS5 B;  2F3N A;  2KSO A;  2DKX A;  2YTU A;  3TAD A;  1WWU A;  4RQN A;  4PZN A;  5L1M A;  5KNI A;  1LKY A;  2QAR A;  3TAD C;  2KIV A;  2B6G A; 
#chains in the Genus database with same CATH topology
 5J2B A;  4RQ1 A;  3V7J A;  3SV3 A;  3BS7 A;  4KN4 A;  1A6S A;  5KFP A;  1ZQW A;  4G3I A;  2E8N A;  1RM6 C;  1PVQ A;  2PMZ C;  3UQ0 A;  1O08 A;  1SV0 A;  3ZDE A;  9ICL A;  5AKJ A;  5D49 A;  1C7Y A;  3MGI A;  5AI6 A;  2MRL A;  1GO3 F;  2E8M A;  2BPC A;  1DOQ A;  1KQQ A;  3EW9 A;  2KFN A;  4EX6 A;  2HHU A;  5ALM A;  5ALJ A;  1ZRM A;  2W8L A;  1N5X A;  4J9M A;  7ICL A;  3D2Q A;  4QZD A;  3G6Y A;  9ICU A;  1PUZ A;  4YR2 A;  5IIL A;  3GIL A;  5IIM A;  1U48 A;  3AN1 A;  5KFU A;  3DV9 A;  4F72 A;  4XQ8 A;  3AU2 A;  4TUP A;  4I29 A;  5AM0 A;  3F53 A;  1JRP A;  1ZJN A;  2HBM A;  1FO4 A;  2Y9T A;  1XO0 A;  2F44 A;  3RJH A;  4K4G A;  1UA0 A;  4BXO A;  5KFN A;  2BQU A;  2BCS A;  4NLG A;  2YB4 A;  2WF6 A;  4DSK A;  2VA3 A;  1SV0 C;  4M9N A;  4RQ6 A;  1RZT A;  2ZIU B;  1RYS A;  4I2B A;  5ALE A;  3N7S C;  3RRG A;  1XO1 A;  2XVT A;  4EBD A;  2PFO A;  1ZOL A;  5KFM A;  3GIJ A;  5J0U A;  1L3T A;  3BS5 B;  1S77 D;  3QU9 A;  3TAD A;  1F5S A;  4GC6 A;  4RQN A;  3CP8 A;  2BPG A;  1NKC A;  2K4H A;  4KMU A;  4F4Y A;  8ICI A;  1ZQQ A;  4YXM A;  4O3M A;  2JEI A;  8ICH A;  1QQ6 A;  3RTV A;  4Q45 A;  4Z6D A;  2I5H A;  4U6P A;  4ECT A;  2D8C A;  1L7M A;  1P7D A;  5AK6 A;  2KFZ A;  4DSL A;  4QWE A;  1TKD A;  1U49 A;  1YT3 A;  2KEY A;  4ED2 A;  4J9L A;  1CRX A;  1RQN A;  3K75 D;  1L6N A;  5KFJ A;  2JEG A;  7ICQ A;  4ECW A;  2YX8 A;  3MR5 A;  4EX7 A;  3BJY A;  9ICN A;  1Z1V A;  3KTQ A;  5KFW A;  5AKY A;  2H3V A;  1F0M A;  5A0L A;  1XU4 A;  2EAN A;  2HHV A;  2JEJ A;  1UCV A;  3EYZ A;  4IQW A;  5AKZ A;  3JPQ A;  5DDY A;  2IOF A;  3IRU A;  3PX0 A;  5J0O A;  3J81 j;  4FBT A;  1NK7 A;  2E8P A;  4J03 A;  3JPT A;  4UAY A;  2YML A;  4IRC A;  3M9M B;  3K1Z A;  3R9K A;  2R8I A;  4DLE A;  2UVW A;  4EEY A;  3SMV A;  4I2J A;  5ALF A;  4US9 A;  1FEZ A;  4QJF B;  5KFC A;  2JMG A;  5AK5 A;  2VJ4 A;  5AI0 A;  4F91 B;  4EBC A;  5DGA A;  4F5Q A;  8ICB A;  1AQ6 A;  4ELU A;  4NM1 A;  1DK2 A;  4M6W B;  3GDX A;  3PW2 A;  4I2G A;  3DEE A;  1K5O A;  4J9N A;  5AI4 A;  4FS1 A;  8ICA A;  1U45 A;  4DFM A;  3AEV A;  3BQ0 A;  3IN5 A;  3ORY A;  3N28 A;  3V6K A;  5ALD A;  2W7O A;  4YMO A;  2F8K A;  2P6U A;  2NO4 A;  3NAS A;  4PHD A;  4NL9 C;  4F4W A;  1PVP A;  1K1Q A;  2FLN A;  4KLL A;  1XSL A;  1X42 A;  5HMM A;  2H3I A;  3RB6 A;  1BPY A;  1J2N A;  3PW5 A;  5KFD A;  2J6U A;  2ZTE A;  7ICI A;  4CF4 A;  4ELV A;  3IP4 B;  1ZQZ A;  2BCU A;  2HHW A;  4IR1 A;  7ICT A;  4CDG A;  2VA2 A;  3AU6 A;  2BQ3 A;  5GTI U;  4NV0 A;  3HIL A;  4DS4 A;  4FO6 A;  4KLI A;  1MN8 A;  3WK7 A;  4YFK A;  2L5Y A;  3ZDC A;  7ICS A;  5T14 A;  2P66 A;  4F50 A;  2OEH A;  2D6F C;  2VKQ A;  2Z7J A;  2JRZ A;  3ZDD A;  3PML A;  3G6V A;  4UB5 A;  3T5H A;  2KZM A;  5KFO A;  2HSZ A;  5ALR A;  5IIJ A;  2HOI A;  3C1Z A;  5ALX A;  1A76 A;  2HW3 A;  3BZC A;  1NK6 A;  3LWL A;  2OCE A;  2HCF A;  2DKX A;  4DOA A;  1Q8K A;  8ICT A;  1RYU A;  3M6K A;  3I28 A;  2G5I B;  3GV5 B;  4DL2 A;  2KZ3 A;  2HBJ A;  9ICB A;  4NY8 A;  1OUQ A;  3H0M B;  5JTI A;  5J2J A;  1HIW A;  5J0S A;  3T5K A;  4M0A A;  2FJ6 A;  1ZQD A;  4Y2P A;  9ICH A;  1XSP A;  4DOC A;  1N60 A;  4EEN A;  4QZF A;  2PXI A;  1MQ2 A;  5AI8 A;  3B9J A;  4F5R A;  1WG8 A;  2BDU A;  7ICO A;  2JV3 A;  4O9M A;  4ELT A;  4YXJ A;  1X9W A;  2KG5 A;  4DFJ A;  3MR3 A;  3KHH A;  4R8U A;  5ALK A;  5AM2 A;  4Y2S A;  2LM1 A;  3Q8R B;  1NOM A;  1KRP A;  3EUB 2;  3JPN A;  3LWM A;  1WUD A;  4IQT A;  1ZQO A;  5AKX A;  4XUS A;  4DSI A;  3PR4 A;  2WF8 A;  1RYR A;  3KHR A;  9ICO A;  1IXR A;  5KG4 A;  2KNJ A;  4P0Q B;  4UAT A;  5KFG A;  4QZ8 A;  5DLG A;  2Y0S C;  5B66 U;  3SEN A;  5CRX A;  2W9C B;  3C2L A;  4QZI A;  3D6J A;  4OJ5 A;  4GXK A;  5AK3 A;  3Q8M A;  3RJG A;  2ZIV B;  4OJO A;  1JRO A;  2KTQ A;  4F5N A;  4NLN A;  1L3U A;  3WKC A;  4QZH A;  4PL1 A;  3HJE A;  1HUO A;  8ICU A;  3WU2 U;  2FPL A;  5BPC A;  2W9A A;  4MFA A;  3NRZ A;  3M9N B;  4UB8 U;  5III A;  4YD2 A;  1FFU A;  2FPM A;  2FMQ A;  5AIC A;  5L1J A;  2Y0S F;  8ICO A;  1WWU A;  1FFV A;  1LKY A;  4QWB A;  1N5W A;  5KTQ A;  4Y2Q A;  9ICE A;  2HHQ A;  1J97 A;  4HAI A;  4O3Q A;  4PPX A;  4Q8F A;  2KV2 A;  2EDU A;  5J0X A;  4YG2 A;  4U7C A;  2PFQ A;  2ODG A;  4TQS A;  3C1Y A;  2BKE A;  5HML A;  5J0T A;  4RQ8 A;  1NK9 A;  1ZQG A;  4BDP A;  2JH7 A;  2PFP A;  1KEJ A;  2ZUD A;  3OSN A;  2DPJ A;  2UVU A;  1NJZ A;  4RQ7 A;  2ZIX B;  1KFT A;  4OJP A;  2E5S A;  1S0N A;  2R8K A;  1S5L U;  3UM9 A;  3LVV A;  2EAM A;  2O6K A;  4RT2 A;  3HX0 A;  9ICT A;  4YR3 A;  4LZG A;  5KT6 A;  5KL1 B;  5DBB A;  4FZL A;  1ZQA A;  5J2A A;  4JV0 A;  3N7P D;  4RNO A;  4C8K A;  4R8U B;  3PW0 A;  1A77 A;  5KFF A;  4KLM A;  4DL6 A;  1CEZ A;  4RQ3 A;  2LI6 A;  5EE1 A;  2RLT A;  2ZUB A;  2BHN A;  1NZP A;  3KOO A;  2JHD A;  4DEZ A;  4ECX A;  1ZQK A;  1ZQ1 C;  3RFA A;  5K4L A;  5DBA A;  3F2B A;  3MDA A;  1Y88 A;  2DBY A;  4ED3 A;  3JPS A;  2A1J A;  4C7Y A;  1EXN A;  2DQN B;  4GXI A;  1VLB A;  4DL3 A;  3OTQ A;  3WKB A;  2V4Q A;  4YQW A;  1KW4 A;  1DGS A;  2NYV A;  2P35 A;  2RP5 A;  4RZR A;  3KZX A;  4EBE A;  2Q0Z X;  4QZB A;  3OJS A;  2NRX A;  4JB3 A;  3TI0 A;  2FMS A;  1JN3 A;  4M9L A;  5HHH A;  3HT3 A;  4NLC A;  3H4B A;  8ICE A;  3PZP A;  3M8S A;  2RDJ A;  1NK5 A;  2ZJ5 A;  3RJJ A;  4Y2R A;  5KT3 A;  5ALW A;  3V72 A;  4J9S A;  1Z1B A;  1TE2 A;  3UXO A;  1IG6 A;  5ALH A;  3HWT A;  2YMQ A;  3ZD9 A;  2QKQ A;  1UHU A;  1ZJM A;  1KN5 A;  2Y1J A;  3TKA A;  3NTU A;  2Q4T A;  5KFK A;  4JV1 A;  3F5E A;  2KHQ A;  1L3V A;  1T3N A;  5KFR A;  5G5G A;  4UAS A;  5KFZ A;  1T7P A;  3HKZ F;  3GV7 B;  2AHO B;  1SZP A;  9ICS A;  3PO5 A;  2BZF A;  2HI0 A;  3RAX A;  3UQ2 A;  4O0I A;  5AI9 A;  4UW9 A;  5J2D A;  3C2K A;  3RB4 A;  1S9F A;  4KX5 A;  2KE7 A;  2IA6 A;  3MR2 A;  5FP0 A;  1IV8 A;  4IS7 A;  2KJ5 A;  4OD0 A;  4OJ6 A;  5KFQ A;  4DO9 A;  1X6I A;  2D3D A;  2MUT A;  4BWM A;  5ALO A;  4XRH A;  2NV3 A;  2HVI A;  1XSN A;  2HDO A;  4RNN A;  1S0V A;  2B21 A;  4FZM A;  4RPZ A;  3D2N A;  2RDI A;  1SKS A;  3THV A;  3PV8 A;  4P4M A;  1H38 A;  3RRH A;  4O3P A;  4DF4 A;  4QZC A;  5CP2 A;  4JWN A;  5KT5 A;  2F1J A;  2M0N A;  1S10 A;  2WB1 C;  2ZTC A;  3BZK A;  4BGD A;  3QZ8 A;  2W9B B;  4B9M A;  1U9L A;  3AQE A;  2ES6 A;  1PZN A;  4NXZ A;  3C28 A;  5AKH A;  3EZ5 A;  2PI4 A;  2LYB A;  4I2H A;  2JH1 A;  3ETL A;  5F9N A;  5HNK A;  3V7L A;  2FE9 A;  3LDA A;  4CNQ A;  1ZQI A;  3OSP A;  1SGG A;  2K60 A;  3H8J A;  3V6J A;  4FBU A;  4AYB C;  2WFA A;  2W43 A;  4K4H A;  5HR7 A;  4P2H A;  4DFK A;  3EWA A;  4F5P A;  2WAQ F;  5ALV A;  3PVX A;  5EWG A;  2ISO A;  2YMM A;  2YN4 A;  3N7R C;  2WHE A;  3WK9 A;  5KG6 A;  4EEL A;  4J9O A;  1NKE A;  1ZD2 P;  8ICF A;  4ECZ A;  4ED7 A;  3NGD A;  2FI1 A;  2ALZ A;  4CF5 A;  3GII A;  3OJU A;  1MSW D;  1RDF A;  4YP3 A;  1ZQB A;  2W03 A;  4UAV A;  4R65 A;  5CA7 A;  1TFR A;  3IG5 A;  7ICK A;  5C5J A;  3N4M B;  3B0X A;  3NVW A;  5AIA A;  8ICV A;  2XY6 A;  1B0X A;  4RNM A;  3RF9 A;  3QU5 A;  4NM2 A;  5ALI A;  1WCL A;  4JV2 A;  3OHB A;  3G6X A;  3BQT A;  2RQ5 A;  1COO A;  1HEK A;  4TUQ A;  5DBC A;  1ZD5 A;  2EQY A;  1SKW A;  2PMZ F;  1ZD4 A;  3C2M A;  3Q8K A;  1KBU A;  1A0P A;  5KFV A;  3ISD A;  1QSY A;  1U4B A;  5ALQ A;  4P0Q A;  5DQG A;  3MR6 A;  2HHX A;  3NVY A;  3ZDB A;  5KT4 A;  5CJ7 A;  4KLT A;  1SL0 A;  7ICG A;  1IIP A;  3RR7 A;  2R8G A;  3AUO A;  1KFD A;  1K1S A;  4NJ8 A;  3IG8 A;  1KDH A;  1V97 A;  3M7D A;  1HUZ A;  5KFS A;  5J0Q A;  3ONN A;  4AP9 A;  1D9F A;  4E0D A;  2WTF A;  4I2E A;  1LV5 A;  5ALP A;  4GC7 A;  4BWJ A;  5HHI A;  3LVW A;  1Z3E B;  2WAQ C;  1ZQC A;  3RH5 A;  4CF3 A;  3GU3 A;  5J0P A;  1SIJ A;  2W7P A;  1Z00 A;  4ECS A;  2BGW A;  1NJX A;  9ICV A;  3GIK A;  3SEI A;  2I9G A;  2AU0 A;  3SR6 A;  5J8Y C;  3ISC A;  5J2C A;  4JWM A;  4UQG A;  2IOH A;  2ZJA A;  4XA5 A;  4NWI A;  4ED8 A;  4B9N A;  4NLZ A;  2F77 X;  1SWV A;  4FS2 A;  2A19 A;  4P0P A;  3MFH A;  3QU7 A;  2KJ8 A;  2KK0 A;  5DB7 A;  4DSE A;  3T79 A;  2QAR B;  4LZD A;  5DDM A;  4OO1 J;  1RPL A;  4JUZ A;  1ZET A;  3RBE A;  2QB0 B;  5TZV A;  3E0F A;  8ICP A;  5CR0 A;  2FMP A;  3QNM A;  2K89 A;  3MGH A;  2OHF A;  4F71 A;  3PMN A;  3EPI A;  5AKL A;  2CN1 A;  5ALZ A;  1N62 A;  4LJX A;  5EE9 A;  5JRT A;  2B6G A;  2KIV A;  4F2R A;  2C2E A;  4PHA A;  4P0P B;  3UMG A;  5AIB A;  4QZA A;  1S0M A;  4B9V A;  4DQS A;  2HBK A;  8ICK A;  2KZZ A;  3C5F A;  2N1R A;  3SYZ A;  3N97 B;  9ICQ A;  5KT2 A;  4UB4 A;  5B5E U;  4DLG A;  3V7K A;  3WK8 A;  4C0Z A;  2JZB A;  3TFS A;  3JPP A;  1WCN A;  4I2D A;  5KG7 A;  3RBD A;  2V9W A;  4IQU A;  3KKA A;  2IHM A;  1UT8 A;  3WKA A;  3JPR A;  1V85 A;  2I1Q A;  2LPE A;  2YMP A;  4DQP A;  4TUS A;  2BCQ A;  2IMW P;  1N48 A;  2EZX A;  1RXW A;  3UXP A;  4KLU A;  4UB1 A;  3M1Y A;  1NNL A;  3ZI4 A;  1Z19 A;  2KVC A;  3IM1 A;  2J6T A;  1MQ3 A;  4X5V A;  3HP6 A;  3KFU F;  5AHX A;  1T4G A;  4C4S A;  8ICQ A;  5D46 A;  2H3Z A;  1ZQY A;  4YMM A;  4FZN A;  4IC9 A;  4MEY A;  5DQI A;  4PGQ A;  4DFD A;  4P4P A;  1XWL A;  5ALN A;  2BDP A;  3MGV A;  4J9R A;  1ZQR A;  9ICP A;  3PSP A;  4GLX A;  5EOZ A;  3QUT A;  2G07 A;  3QUC A;  4K4I A;  2W11 A;  2OWO A;  2GWS A;  2JXJ A;  3AMZ A;  5KFA A;  3WK6 A;  2A1J B;  4C4R A;  4M9H A;  1NI3 A;  2MAX A;  3RJF A;  4PZN A;  2AGO A;  5KNI A;  3CW2 C;  8ICL A;  2FPK A;  1Z4N A;  1T94 A;  3BQ2 A;  4O3N A;  3ETR A;  1D8B A;  1S76 D;  4QZ9 A;  2QLT A;  4F3O A;  2KD1 A;  1SXE A;  3BQ1 A;  5J2G A;  9ICJ A;  4DSJ A;  4FE3 A;  2FDR A;  2CRX A;  4M47 A;  4O5C A;  3PO4 A;  8ICM A;  4C80 A;  4YCX A;  2VA8 A;  4IL6 U;  3IV6 A;  4Z6E A;  3RH4 A;  4QWD A;  2AH5 A;  1NK0 A;  8ICJ A;  2K8A A;  1B4F A;  4C8L A;  2ZIX A;  5BOM A;  3FDS A;  4UAU A;  1TK8 A;  5BOL A;  2PFN A;  3RB0 A;  2GH1 A;  1NJW A;  5JUM A;  4MHV A;  3KBB A;  4Y2X A;  2HOF A;  2F2A B;  1ZQH A;  2OM6 A;  3FAH A;  2ASL A;  1UQV A;  4F8R A;  1BNP A;  2LYA A;  4PZO A;  2WF5 A;  3CRX A;  1X66 A;  2BCR A;  1TAQ A;  1ZQS A;  2Y9U A;  1RQL A;  3RJI A;  1N56 A;  4F4X A;  1BVS A;  9ICK A;  4PGX A;  1LKY B;  4DL5 A;  5ALY A;  5TIS U;  4YD1 A;  4KX3 A;  1JMS A;  1X9M A;  3PSI A;  3MBY A;  4USA A;  5ALL A;  3DDH A;  4ED1 A;  1JUD A;  4UAR A;  1YZ7 A;  4TQR A;  4O3S A;  2FLL A;  1JAL A;  4R66 A;  2IOF K;  3NVZ A;  2ASD A;  1IM4 A;  1ECW A;  4O3R A;  4F93 B;  4US8 A;  5DKW A;  3D2S A;  2YTU A;  3HPO A;  4UB6 U;  4PGY A;  3Q8L A;  2XIC A;  1WWV A;  4B6J A;  3A0B U;  4RU9 A;  5IIK A;  2XID A;  4KMO B;  2XC9 A;  3HRD D;  1NK4 A;  1COK A;  1QQ5 A;  8ICY A;  2ISP A;  5AI5 A;  1CI4 A;  3NUQ A;  7ICN A;  2OYY A;  3QU2 A;  1ZQL A;  3I76 A;  3T3F A;  3UXN A;  4MF8 A;  5CHG A;  3JPO A;  1X9S A;  4R63 A;  2LBO A;  8ICS A;  3KKA C;  5DGB A;  5KG5 A;  1KFS A;  3TQ1 A;  3H8S A;  2QB1 A;  3UMB A;  1NJY A;  4B9L A;  2XCP A;  4UAZ A;  3K1R B;  3A0H U;  3GQC A;  2V4R A;  1L3S A;  4KLD A;  2ZXI A;  2GLE A;  4QNL A;  4YR0 A;  1TAM A;  1OXJ A;  3M9O B;  1DK3 A;  1T3Q A;  5ALU A;  9ICC A;  3VC8 A;  1ZQU A;  5L1L A;  1SZH A;  8ICX A;  1SB3 C;  2EZZ A;  2KP7 A;  2KN7 A;  2YB1 A;  3F2D A;  3H40 A;  2F76 X;  5KFT A;  4DFP A;  1ZQE A;  4ICA A;  2DWQ A;  7ICU A;  4KLS A;  3OHA A;  1XNS A;  2QB0 A;  2K8C B;  3ZDA A;  3GZF A;  1Q3V A;  1ZD3 A;  4PL2 A;  5DG7 A;  2ATL A;  4M04 A;  3AM9 A;  1XC9 A;  2FLP A;  4O5E A;  2KSO A;  1ZYQ A;  5J29 A;  3TAQ A;  2DF4 B;  9ICG A;  2A3V A;  4RUA A;  2QAR A;  3L3F X;  5ALG A;  2KOB A;  5CB1 A;  2HMX A;  4MF2 A;  3M8R A;  4MEX A;  3B0Y A;  1TAU A;  4Y2J A;  1BPE A;  1PK1 A;  2IHN A;  2LMR A;  3LYS A;  2A1A A;  2AXT U;  7ICE A;  5J2I A;  1X40 A;  3PW7 A;  3H0R B;  5J2F A;  4AYB F;  9ICX A;  4UAW A;  2EAP A;  2W9B A;  1MC8 A;  2NRW A;  4B9U A;  4ECV A;  4PHE A;  1S8O A;  5L1K A;  1BPB A;  2AQ0 A;  2HVH A;  1URJ A;  4QIW C;  2NRT A;  7ICP A;  2ZTD A;  4UBB A;  2XGP A;  1N61 A;  1HJP A;  2E1F A;  7ICH A;  3EPG A;  2ZIU A;  2BPF A;  2XY5 A;  5HP4 A;  1Q3U A;  2LKY A;  4DL4 A;  8ICW A;  4ECU A;  4MFC A;  2HHT A;  5DLF A;  4UB2 A;  2B0C A;  3TAP A;  3Q8S B;  3SV4 A;  3TFR A;  4RPX A;  4J9P A;  3T5J A;  3AQF A;  3PX4 A;  4QZG A;  2K8B B;  2PKE A;  3Q8P B;  2YQE A;  3CYM A;  4Q44 A;  1DGJ A;  5J0R A;  1OW5 A;  5KAF U;  1D9D A;  5HR6 A;  5GTH U;  5G5H A;  2W55 A;  5KG0 A;  1SV4 A;  2W9M A;  3H4D A;  2DGZ A;  5KAI U;  4BJQ A;  1RXV A;  3IDW A;  5ALS A;  2IBK A;  2KKP A;  4Q43 A;  3RH6 A;  2G08 A;  2OXO A;  1BPD A;  5L1M A;  4R64 A;  3E58 A;  1U47 A;  4OCZ A;  5AM5 A;  4YMN A;  2XY7 A;  4Y2T A;  3RB3 A;  3T5L A;  4RQ0 A;  1YZ6 A;  4PH5 A;  4KLO A;  2R8J A;  2F1I A;  3GIM A;  4C7Z A;  2H5X A;  3PY8 A;  3SAF A;  4RQM A;  2DPI A;  2H3F A;  5J2E A;  1VJ5 A;  3RR8 A;  1KLN A;  1DXS A;  3H8M A;  5KFI A;  3KD3 A;  8ICN A;  1WYG A;  1KTQ A;  2ZJ8 A;  9ICA A;  3LK9 A;  1UPH A;  1QSS A;  1RG6 A;  1C20 A;  1KSP A;  3SI8 A;  4WJ3 B;  4DOB A;  3MFI A;  3U26 A;  5DG8 A;  3ED5 A;  1QH9 A;  4KIT B;  4DL7 A;  2VJ5 A;  3HW8 A;  4C4T A;  8ICR A;  2ASJ A;  5EWF A;  1BNO A;  2GO7 A;  4C8N A;  3KHG A;  1Z4O A;  7ICR A;  2EZY A;  4PHP A;  5J8Y A;  3QZ7 A;  4I2F A;  1L8O A;  1N2X A;  2F1H A;  4ZOH C;  2DL0 A;  3PR5 B;  4HYK A;  4OJL A;  1UT5 A;  3NVV A;  1PK1 B;  1PK3 A;  4GFJ A;  4LVS A;  1JI7 A;  2C28 A;  3QX7 A;  4QWC A;  2DUY A;  5H2F U;  2CPR A;  3MAB A;  3RAQ A;  3L5K A;  1JX4 A;  1FIQ A;  3K4G A;  1T8E A;  2YY6 A;  1TV9 A;  2UVV A;  5KL8 B;  5AM3 A;  2RRD A;  5KFY A;  3GV8 B;  1SWW A;  5L9X A;  2KSO B;  1V38 A;  1B22 A;  5DB9 A;  2HHS A;  4A8E A;  9ICM A;  4BX9 C;  4Z6C A;  3H0L B;  2WF7 A;  2JEF A;  2ZIW B;  3QEB Z;  4ED0 A;  4UBC A;  4DWI A;  3MC1 A;  1QCK A;  4J9K A;  4EYH B;  1SL2 A;  3SQI A;  3TAR A;  2PI5 A;  2K4I A;  1LB2 B;  4Q8E A;  2AJQ A;  2R18 A;  4M9G A;  2C22 A;  3E2E A;  2ZG6 A;  2BCV A;  4KN7 A;  3SD7 A;  5CEH A;  5AKE A;  4FFD A;  4CCH A;  1ZQV A;  1ZQP A;  4O3O A;  3Q8Q B;  5KG1 A;  1SXD A;  2LM4 A;  4RPY A;  4YN4 A;  2XO7 A;  3QE9 Y;  4M9J A;  2XI9 A;  3PNC A;  3ALR A;  3O0F A;  4DCC A;  4EYI B;  3FYH A;  4KLG A;  5AK4 A;  1D8L A;  4DS5 A;  3BS5 A;  2OH2 A;  3OPX A;  1SKR A;  5IIN A;  4BUG A;  2C2R A;  4ED6 A;  3QUQ A;  2AGP A;  1X9X A;  3PX6 A;  5IIO A;  9ICI A;  4GIB A;  3H8W A;  5DB6 A;  2KMD A;  4KTQ A;  1KL9 A;  2ZIV A;  4CRX A;  4RT3 A;  3QU4 A;  4JMU A;  4P4O A;  4DQQ A;  4O5K A;  1KKX A;  1JXL A;  4IRK A;  1QLN A;  5KFL A;  4QW9 A;  2DKZ A;  4B9S A;  4QW8 A;  1X2I A;  3ISB A;  4RQ2 A;  3OGU A;  1NK8 A;  1D8Y A;  4IQV A;  2J6S A;  4KLJ A;  4I2I A;  2W04 A;  3FC4 A;  1TK5 A;  2KIC A;  1V9P A;  1ZXI A;  3SAH A;  2KJ9 A;  3L4P A;  1UA1 A;  2ZIW A;  3C21 A;  1LVH A;  1ED1 A;  2E1E A;  5L1I A;  3V6H A;  1JIH A;  1L7N A;  5ALT A;  1ZQF A;  1L7P A;  4QZE A;  7ICM A;  3C23 A;  2VIX A;  1Q46 A;  1N63 A;  3NRW A;  3BQ7 A;  5F3X B;  2CXY A;  2MU2 A;  4F92 B;  4KLQ A;  2NO5 A;  3I1Y A;  3SAG A;  2E8O A;  1ZQN A;  3C29 A;  5JU5 A;  3PSF A;  4I27 A;  2XGQ A;  4IRD A;  3VCB A;  5KFE A;  2C2D A;  2HBL A;  3QXG A;  3F2C A;  2WF9 A;  2GOL A;  3AL0 B;  2HOQ A;  1ZRN A;  2W3S A;  3WKD A;  5EE3 A;  5J2H A;  9ICW A;  1JXE A;  4ECR A;  3TAN A;  1BGX T;  2NRZ A;  2LYH A;  3S6J A;  4RQ5 A;  2K4P A;  4J9Q A;  2F8L A;  4RQ4 A;  2MUT B;  3ZD8 A;  1B43 A;  3BDP A;  4DSF A;  4Y2U A;  3HKZ C;  2AGQ A;  2KVS A;  4C8O A;  5D4B A;  4I28 A;  1QSL A;  3WK5 A;  1MA7 A;  4CE6 A;  2KKV A;  2WB1 F;  7ICV A;  3C5G A;  1ZQT A;  1QQ7 A;  8ICG A;  1L8L A;  2E3T A;  2VAN A;  2XCA A;  2BR0 A;  3ICX A;  4UB3 A;  7ICF A;  4F2S A;  1S0O A;  5F9L A;  1TK0 A;  3H7I A;  9ICF A;  2JR5 A;  4G9B A;  1L7O A;  2RHF A;  2M9N A;  4Y2V A;  1ZQX A;  3UMC A;  4EEK A;  5KFH A;  2W8K A;  2G09 A;  1QTM A;  5AM1 A;  3WK4 A;  5KG2 A;  4I2A A;  2P6R A;  4NL9 A;  3WKE A;  2F3N A;  4ZH4 A;  4ECQ A;  1VDV A;  2AQ4 A;  4B9T A;  8ICZ A;  1ZQM A;  3FM9 A;  5CWR A;  4PJ0 U;  1NZB A;  2W9C A;  4EZ9 A;  2EAO A;  5E79 U;  4NLB A;  2K4E A;  4TUR A;  4EZ6 A;  2H3Q A;  4BXO B;  4F4K A;  9ICR A;  3CNH A;  3PST A;  2R8H A;  2ZXH A;  4M6W A;  4KLH A;  3RJE A;  1CUK A;  3RJK A;  1J2M A;  2W3R A;  3PW4 A;  2ESE A;  5KT7 A;  4CGZ A;  1F44 A;  4DQR A;  1L5U A;  4KLF A;  2NRV A;  1DRG A;  3MDC A;  2BQR A;  3F5A A;  2G5H B;  2MSN A;  5J0W A;  5DG9 A;  4KLE A;  7ICJ A;  1NKB A;  1SL1 A;  1O03 A;  1BPX A;  4Y2Y A;  2W54 A;  5C0Y A;  5AM4 A;  4ACO A;  4YVZ A;  4QIW F;  3IHQ B;  4GXJ A;  4MFF A;  2G0A A;  5AKK A;  5DQH A;  3GFK B;  4JK1 A;  1PVR A;  3KZI U;  1TVA A;  1ZQJ A;  4Z6F A;  2JZB B;  5EE0 A;  2Y1I A;  5AKI A;  3SZ2 A;  5KFB A;  5DB8 A;  5J0Y A;  1S97 A;  3TAC B;  2I6X A;  1Z00 B;  3UPQ A;  4QWA A;  4F4Z A;  4ECY A;  5KG3 A;  4DF8 A;  4M2Y A;  3QEA Z;  5KFX A;  1X6J A;  5AKG A;  2G06 A;  4F5O A;  2LHT A;  2KIW A;  1ARO P;  8ICC A;  1BPZ A;  4RUC A;  2MA1 A;  4IR9 A;  5EWE A;  3QUB A;  3M6Z A;  1XS9 D;  4DQI A;  3KHL A;  5J2K A;  4NLK A;  2KHV A;  1M6Y A;  2UVR A;  3QYP A;  2JGA A;  4I2C A;  2EH9 A;  2DFL A;  4C8M A;  3TAD C;  2ZUC A;  3NS1 A; 
#chains in the Genus database with same CATH homology
 2EAO A;  5JTI A;  1WWV A;  3BQ7 A;  5F3X B;  2E8O A;  2ES6 A;  3BS7 A;  1SXE A;  5JU5 A;  1PK1 A;  2LMR A;  4RQM A;  1COK A;  2E8N A;  2FE9 A;  1X40 A;  1DXS A;  3H8M A;  1SV0 A;  2D8C A;  2JV3 A;  2ESE A;  2KG5 A;  1SGG A;  1SXD A;  2EAP A;  2K60 A;  2E8M A;  4NJ8 A;  1RG6 A;  3KKA A;  2F8K A;  2EAM A;  1V85 A;  2LPE A;  4NL9 C;  3KKA C;  2K4P A;  1B4F A;  2QKQ A;  2QB1 A;  3BS5 A;  3K1R B;  2GLE A;  1Z1V A;  1X9X A;  4MHV A;  1OXJ A;  2KMD A;  1F0M A;  1UQV A;  2EAN A;  1UCV A;  5J8Y A;  4PZO A;  3SEI A;  1X66 A;  2DL0 A;  3TAC B;  3SEN A;  2Y9T A;  3HIL A;  5J8Y C;  2F44 A;  2Y9U A;  2DKZ A;  2L5Y A;  1OW5 A;  2KE7 A;  1PK1 B;  1LKY B;  1PK3 A;  1JI7 A;  4IS7 A;  5JRT A;  2E8P A;  1SV0 C;  1SV4 A;  2D3D A;  2QAR B;  1B0X A;  2QB0 A;  3IDW A;  2QB0 B;  2KSO B;  1KW4 A;  1V38 A;  4NL9 A;  3BS5 B;  2F3N A;  2KSO A;  2DKX A;  2YTU A;  3TAD A;  1WWU A;  4RQN A;  4PZN A;  5L1M A;  5KNI A;  1LKY A;  2QAR A;  3TAD C;  2KIV A;  2B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...