2K4PA

Solution structure of ship2-sam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
SGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2
publication title NMR Studies of a Heterotypic Sam-Sam Domain Association: The Interaction between the Lipid Phosphatase Ship2 and the EphA2 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 65
sequence length 65
ec nomenclature ec 3.1.3.86: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase.
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k4pA00
1SV0A 2D8CA 4NJ8A 2EAOA 1V85A 1LKYB 4NL9C 1SGGA 2GLEA 5J8YA 3KKAA 1PK3A 3BS5B 3TACB 3TADA 2QB0B 5JTIA 1OW5A 5JU5A 2QB1A 2ESEA 3BQ7A 1F0MA 2KIVA 2K4PA 2QARA 2F44A 2KSOA 2LPEA 4RQNA 2YTUA 2LMRA 1PK1B 1RG6A 2E8MA 2EAPA 4IS7A 2K60A 1OXJA 3H8MA 2QKQA 1UCVA 3HILA 5F3XB 2DKZA 4RQMA 2JV3A 5JRTA 1COKA 2Y9TA 1WWUA 1X40A 2D3DA 2E8OA 2QARB 1SV0C 3K1RB 4NL9A 4PZOA 2FE9A 2EANA 1X9XA 2KE7A 2L5YA 1X66A 2DKXA 2KG5A 1JI7A 3SENA 2KMDA 2E8NA 3KKAC 1KW4A 3BS7A 2B6GA 1UQVA 1B4FA 1SXDA 1DXSA 2ES6A 4MHVA 1WWVA 1Z1VA 3SEIA 1PK1A 1LKYA 2KSOB 2F3NA 5L1MA 2Y9UA 3BS5A 1B0XA 2F8KA 1V38A 2QB0A 4PZNA 2DL0A 5J8YC 2E8PA 2EAMA 5KNIA 3IDWA 1SXEA 1SV4A 3TADC
chains in the Genus database with same CATH superfamily
1X42A 4DLEA 3HP6A 3GDXA 4UB1A 4RQ3A 1SL2A 5KT6A 2GLEA 4G9BA 4F72A 1Z4NA 5EWGA 4ECQA 1XWLA 1Q8KA 1EXNA 1FIQA 5KG2A 4O3MA 2R8IA 2HHSA 4ZH4A 4OCZA 4UB3A 3H8JA 2W3SA 2AQ4A 1ZRMA 1MQ3A 4DWIA 2W43A 2XGQA 3F53A 3IN5A 1J2MA 5AK6A 4KLQA 2FPLA 2LMRA 5AM2A 1PK1B 3EW9A 1VLBA 5AKYA 3MGIA 4BJQA 1CRXA 9ICOA 5HMLA 3D6JA 2WF9A 3UQ0A 3NVVA 2DKZA 1JMSA 4DEZA 4YVZA 1ZQQA 1CUKA 4TUSA 2KFZA 4I2HA 4PHPA 2FE9A 4R8UB 2XVTA 7ICPA 4DF4A 4RQ5A 3GFKB 4NLGA 4PGXA 4YCXA 3LWLA 2LKYA 1X6IA 4E0DA 3UPQA 3QUBA 2DUYA 3FDSA 4UAZA 2EZXA 2WTFA 5KFPA 4C7ZA 3RBEA 1F44A 1JN3A 1NK4A 4NLZA 4M9NA 3WK4A 4J9PA 1O03A 1KDHA 2K89A 5KFTA 1SXEA 4QIWC 1KTQA 2EQYA 5HNKA 5E79U 4NJ8A 3RH4A 2FJ6A 5AKZA 1L7NA 1L7PA 5ALXA 2DBYA 4DFDA 2W03A 3H0LB 2B21A 4FZMA 3JPPA 5KG3A 3ONNA 3HPOA 1JIHA 4QIWF 4FZNA 4O9MA 1ZQZA 8ICLA 9ICLA 5KFQA 5ALWA 3C29A 5B5EU 3BQ7A 3K75D 3KBBA 4NXZA 2JEGA 2NRTA 2KHQA 1ZQSA 2JEIA 3M9MB 3BQ0A 1BGXT 2EAPA 1BPZA 4ED1A 2LI6A 4UAWA 5J0RA 5L9XA 2Y1IA 5J0XA 3GV7B 8ICEA 3RJHA 3THVA 1ZOLA 2JV3A 5ALSA 1CI4A 3PW5A 1ZQDA 1UHUA 3KFUF 3OGUA 2GWSA 1N56A 3AQEA 5DDYA 2KP7A 4DFJA 4ED0A 1L3UA 3E0FA 4GC6A 3BDPA 2OYYA 5J2BA 1BNPA 4YXJA 1NKEA 1HEKA 4BUGA 2C2EA 2BPCA 3I28A 4I28A 1RPLA 3B0YA 3AU2A 4GLXA 2NRVA 1RYRA 5G5GA 4RQ0A 4C8NA 4R64A 4O0IA 2FMSA 5J8YC 2Y1JA 9ICXA 3KHGA 5KFBA 5KFRA 2AGOA 2IOHA 3K1ZA 2W9BB 4O3SA 3N28A 5TISU 5DGBA 2KFNA 4C4SA 2IBKA 4P4PA 4M6WB 2JZBA 5KL1B 1S10A 5J8YA 3RJJA 2KTQA 3BS5B 5BOMA 1IM4A 1FFUA 1OW5A 3C2LA 3GZFA 4Q44A 4ECUA 4B9TA 2H3VA 1BPDA 3L5KA 3RJEA 3PMLA 2OXOA 4RQNA 4O3QA 1ZQAA 5J29A 4YN4A 1N48A 4IRKA 3T5KA 1WCNA 4K4HA 1LVHA 4DSKA 1SL1A 2R8KA 3H0MB 5ALIA 4F71A 4RQ4A 3G6YA 1TK5A 3KTQA 5A0LA 8ICJA 4JV1A 5KAIU 1NJXA 2FLNA 2K4EA 2F8LA 3TANA 1UA1A 4RZRA 2J6SA 1DGJA 2EANA 3D2NA 5KFFA 3PO4A 3IRUA 4RT2A 3T5HA 4J9QA 3SI8A 2JRZA 4NLNA 5AI6A 1ZQOA 2KMDA 1ZQLA 4Y2SA 2HVHA 2ASJA 2BCSA 4RUCA 5J0UA 4RQ2A 1ZETA 1WWVA 1Z1VA 4CRXA 1NJZA 2W7OA 3Q8MA 3PX4A 2Y9UA 4DSEA 2PI5A 3RF9A 3HRDD 1ZD2P 4MEXA 5CWRA 3AUOA 1SV0A 4QWDA 3M8RA 4FZLA 1QQ5A 1ZQVA 3ZI4A 4JV0A 3ORYA 5L1JA 2G07A 1DK3A 4RQ6A 3C28A 1SKWA 4LZGA 1PK3A 1S8OA 4I2DA 2E3TA 3EWAA 4XQ8A 5KFMA 3K4GA 2CN1A 5JU5A 1SIJA 4P4OA 4EEYA 1L3SA 2KIVA 1T4GA 3KZIU 1OUQA 4QZEA 2VJ5A 4KLHA 3PV8A 4EENA 4YQWA 5ALDA 4QZBA 8ICWA 4YP3A 2VA8A 8ICHA 2ASDA 1XS9D 2BGWA 3BZKA 4ELVA 2IA6A 1HIWA 1P7DA 3B9JA 3M6ZA 4FBUA 3ALRA 2BR0A 2YB4A 3T5JA 2KE7A 2XY5A 4PPXA 9ICTA 1X9WA 4OJLA 2CPRA 2KG5A 5DKWA 5J2DA 3I1YA 4QZGA 1KW4A 1SKSA 3ZDDA 2HBMA 1ZQFA 3SZ2A 4KLFA 3A0BU 4USAA 1S97A 3TFRA 4CF4A 5ALLA 2VA2A 5AK4A 4R65A 5H2FU 4M04A 5HMMA 4DL4A 2YB1A 5KL8B 5KFNA 1S0NA 1ED1A 1L5UA 3RRGA 1SB3C 1YZ7A 2W55A 2DF4B 2RDJA 3N97B 3Q8KA 2J6UA 3RAXA 4EZ9A 2EAMA 4RNOA 2LHTA 3IDWA 5BPCA 1XC9A 2HHQA 5ALEA 2Z7JA 2F1HA 3MR5A 5L1KA 1K1QA 3NS1A 1IV8A 3NRZA 4F50A 3PR4A 1D8YA 1LKYB 3QX7A 4NL9C 2P6RA 4B6JA 4DCCA 5J0YA 1N2XA 1U48A 2IHMA 1V9PA 3RJGA 3F2CA 1TKDA 1L7MA 3MFHA 2ZJ8A 5KG5A 5JTIA 3S6JA 2JEFA 4P0PA 4F4WA 4FS2A 3Q8PB 1WYGA 5ALFA 3SAFA 1NK6A 2F1IA 2KSOA 2YTUA 5HR6A 3UQ2A 2W7PA 2YMMA 4RQ8A 1ZQMA 1NK8A 1JALA 2G09A 2XCAA 1JXEA 4ED8A 4OJ6A 2ZIWA 2BQUA 1TK0A 5KG0A 2LM1A 1QSLA 5DG9A 2UVUA 2HW3A 4CDGA 5AM4A 4DQPA 2Y0SC 2B0CA 1S9FA 2H3ZA 5ALPA 3BQ1A 1ZQUA 5EE0A 1PZNA 3TI0A 1NK7A 1NNLA 4Y2RA 3ZDCA 3OPXA 3GIMA 4P2HA 4NLCA 4YR3A 3OHAA 4XRHA 3PO5A 5T14A 4GC7A 5J2IA 8ICTA 5EWEA 5AI9A 3ISBA 4WJ3B 3HT3A 3CW2C 1BNOA 3JPQA 5J2AA 4F4ZA 5J2GA 2XICA 1KRPA 2C2DA 4R63A 1ZQIA 3MGHA 2P35A 3L4PA 4KLTA 4ED6A 2ZG6A 3RR8A 2ZIUA 1TV9A 5DQHA 4NY8A 3OSNA 2PFPA 3IG5A 4C7YA 2C2RA 4K4IA 4O5CA 3HX0A 4C8KA 1Z3EB 5DG7A 5KT5A 5IIOA 2WB1C 5IIMA 3KD3A 4F2SA 1SGGA 2MUTB 4RU9A 1A6SA 1Y88A 5KFOA 3JPOA 5CA7A 2BDPA 7ICQA 3IP4B 4M0AA 2K4IA 2PI4A 2QB0B 4QWCA 2WB1F 4IR1A 5AI4A 1TE2A 3C1ZA 4TQSA 2YY6A 4EBEA 1CEZA 5KFDA 1KLNA 5AM0A 5EE9A 2KVCA 1X6JA 1VJ5A 4YD2A 4BGDA 1XNSA 2OH2A 5J2HA 8ICOA 4DS5A 1Q3UA 2XIDA 5CRXA 2H5XA 1RZTA 3WK6A 2DQNB 2MU2A 4JWNA 4PH5A 4KLSA 2FPMA 3M7DA 3EYZA 3G6VA 4F8RA 2W9AA 2VANA 4GFJA 2Q0ZX 3H40A 3T79A 5CJ7A 4I2FA 2M0NA 2XC9A 5J0WA 5AIAA 4DL2A 1QCKA 3GIIA 3SQIA 4KN4A 3VC8A 4BXOA 1PK1A 4F4YA 5KG6A 5DG8A 2JGAA 2BCUA 9ICQA 5KFSA 3PSPA 1M6YA 2NRXA 2KVSA 4C0ZA 2RQ5A 4C8MA 1RYSA 3PX6A 1JUDA 1NK0A 5KFWA 1NZBA 5KNIA 1TAMA 4DL6A 3RH6A 1XSLA 1B22A 2V4RA 4O5EA 5KFXA 1ZJMA 2KJ9A 5GTIU 8ICQA 5DLGA 3EUB2 1ZQWA 3D2QA 1JRPA 4FO6A 1N60A 5AICA 3J81j 1DOQA 1RXWA 4QZIA 1KN5A 2CRXA 3NRWA 2PKEA 4QWBA 4US9A 3PW0A 3TARA 5KT7A 4DSJA 8ICGA 3F5AA 3IHQB 2DPJA 4DOCA 2LPEA 3T5LA 4KLJA 3TAQA 3H4DA 3V7KA 1ZQCA 7ICKA 2E8MA 2KV2A 5AKKA 2E5SA 2KKVA 1MN8A 4UB4A 9ICCA 7ICFA 2ZXIA 1N61A 2V4QA 4RQMA 4KX5A 5JRTA 2P6UA 5KFGA 2XGPA 9ICUA 4GXIA 2BPFA 3QUTA 5EWFA 5J0TA 3EPIA 1L7OA 3E2EA 4YG2A 2LYBA 9ICJA 2PFNA 7ICLA 1HUZA 5CR0A 3WK9A 4BWJA 4NLKA 4NV0A 3AM9A 4JB3A 5J0SA 1XSNA 5AK3A 3LVWA 1B4FA 2XI9A 5L1LA 3N4MB 2G0AA 3LVVA 4P0QA 1ECWA 4QZDA 2NRZA 5KFJA 2VIXA 3PMNA 4M9GA 4DL3A 2F8KA 4YMOA 2ZTEA 4PHDA 5KFAA 2P66A 1JXLA 4B9NA 3WK8A 1JROA 4ECZA 4RQ1A 4C4TA 1N5XA 2BQ3A 4ICAA 1ZJNA 7ICHA 8ICNA 2HDOA 4AP9A 4RT3A 1NK9A 4ED7A 2JH7A 1IG6A 3MR6A 3AMZA 1ZQKA 4KN7A 2IOFK 3DDHA 3H4BA 5KG1A 2ESEA 1F0MA 1UA0A 4QZFA 2K4PA 2QARA 4Y2UA 2YMLA 2KZZA 2HHTA 2YN4A 2W8LA 3ETRA 4OJ5A 3QYPA 3UXOA 4IC9A 3H7IA 2EZYA 5KFZA 4IS7A 5F9LA 2BHNA 2JZBB 4AYBC 3N7PD 4MEYA 9ICAA 3OSPA 4UAVA 4EYIB 1AROP 2GOLA 3UMGA 4DL7A 2W11A 5KT4A 4M47A 4I2CA 3SYZA 4AYBF 2I5HA 2BKEA 3EPGA 3QNMA 4M6WA 4PZOA 4EX7A 5C5JA 3AN1A 1HJPA 1JI7A 5KFUA 1A77A 3KKAC 2ZIXB 5KFCA 4J9RA 2B6GA 3PW4A 1X9SA 3QZ8A 3MC1A 5KT2A 5DQIA 3V72A 4BWMA 3QU5A 8ICPA 4KMOB 4MFCA 2ZJAA 4I2IA 4FE3A 3PNCA 9ICMA 3RJFA 2KIWA 2R8JA 1TFRA 4YFKA 5J0OA 8ICCA 2ZUDA 4F3OA 3UMCA 1FFVA 5FP0A 2FMPA 2N1RA 3V7LA 1T7PA 2IHNA 3OTQA 9ICWA 3KZXA 3QEBZ 2AGPA 3NVWA 1QQ7A 2NO5A 3UMBA 2JHDA 3R9KA 4GXKA 4Q45A 4QW8A 3WU2U 4O5KA 3PY8A 1FO4A 4NM1A 7ICOA 3NTUA 3QUQA 4JK1A 4I2EA 3U26A 3KHLA 3PSFA 3L3FX 1J97A 8ICVA 4B9UA 5ALRA 3V6JA 3RTVA 3JPRA 2ALZA 4BDPA 4EEKA 4EBCA 1Z00A 5DB9A 1COKA 4B9MA 2JR5A 1X40A 2E8OA 2KN7A 5DB7A 5KFVA 4KLDA 5AKGA 2ZUCA 2YMQA 4IL6U 4CNQA 2RRDA 4MF8A 2L5YA 4CCHA 5HR7A 2E1FA 3SV3A 5AKJA 4OJPA 3WK7A 3C1YA 5HHHA 2ZXHA 1ZQPA 2BCRA 1ZQHA 4J03A 1QTMA 1VDVA 1UQVA 2K8BB 2YQEA 8ICUA 3PVXA 3ZDBA 2A1JB 5ALZA 2OM6A 1U45A 8ICBA 1ZQYA 3PZPA 3IG8A 1ZRNA 3BQ2A 5BOLA 2K8AA 1HUOA 4UW9A 4RPXA 2I9GA 2DPIA 4DFPA 1NKCA 1T94A 1SV4A 3PR5B 3AU6A 2AJQA 3TADC 4YMNA 3Q8RB 2D8CA 3O0FA 1QLNA 2GH1A 5DGAA 1JX4A 5ALJA 2JH1A 1PVPA 1KEJA 3RBDA 1X9MA 1RYUA 5K4LA 4CF5A 1RDFA 8ICFA 2W54A 4B9LA 3ZD9A 3Q8QB 2NO4A 4DFMA 2ZTDA 4QWEA 1T3NA 3TADA 4J9NA 3ED5A 2UVWA 3MABA 9ICFA 3RB0A 3RH5A 3WKAA 3M8SA 4F92B 1NKBA 4G3IA 1MA7A 1PUZA 2OWOA 4KITB 2VKQA 2EH9A 1U4BA 5ALKA 2LYAA 4EBDA 1NOMA 1KSPA 3C2MA 3V7JA 5IILA 4QZ8A 2XY6A 1GO3F 3SAHA 5ALGA 1ZQBA 5KFIA 9ICVA 4DS4A 4NL9A 1ZQRA 4LJXA 3BJYA 1X9XA 4C8LA 4TUPA 1T8EA 2ZIVA 2KKPA 4QZ9A 4GIBA 2OEHA 3NVZA 1URJA 2RDIA 5D46A 5GTHU 3SENA 5EOZA 5DB6A 1S0MA 3GV5B 4DQQA 2HOIA 4O3NA 2AHOB 4DOAA 2ES6A 2VJ4A 1ZQJA 3CRXA 4O3OA 2RLTA 3RJIA 3KOOA 7ICIA 2HBJA 2QLTA 4TQRA 3IV6A 2PFOA 3KHRA 1D8BA 5L1MA 1IXRA 2FLPA 4CGZA 2EZZA 5EE1A 4YR2A 2Y0SF 5AKIA 4PZNA 2DL0A 3H0RB 1S77D 8ICZA 4KLGA 4NWIA 2XY7A 1KKXA 2FI1A 4RQ7A 1XSPA 1N63A 1U47A 1ZQGA 1V85A 5TZVA 3NGDA 4IR9A 2KICA 5EE3A 1FEZA 4F5NA 3ZD8A 3H8WA 3OJUA 5KFLA 3MDCA 2ZIUB 4QZAA 4J9LA 5ALOA 5ALUA 2LBOA 4ECWA 3SMVA 4GXJA 2ZJ5A 4Y2XA 5J0PA 4MFFA 4PGYA 3C2KA 2EDUA 5HHIA 2DWQA 1RG6A 3PW7A 2DFLA 3EZ5A 3QE9Y 1ZD3A 9ICGA 4F93B 2FDRA 4C8OA 3UXPA 5F3XB 5AI8A 3SAGA 4M9JA 4RNMA 4QW9A 2W9CA 4B9VA 1D9DA 2KZMA 1WWUA 1C20A 5AKEA 2WHEA 3IM1A 3QXGA 4QNLA 2V9WA 1NZPA 1T3QA 1ZQEA 2O6KA 2ATLA 1YT3A 4PHAA 4YMMA 4Q8EA 2CXYA 5DQGA 1C7YA 1X66A 4JUZA 3BQTA 3QU2A 7ICGA 4CE6A 5J2FA 2NYVA 4KMUA 4ED2A 3GU3A 2PMZC 4Y2YA 4TUQA 9ICPA 2C28A 4KLIA 3V6KA 2E1EA 2K8CB 5ALNA 5KAFU 3SEIA 1MC8A 2KJ5A 3QUCA 1A76A 2PMZF 1K5OA 4XUSA 5J2KA 1L3VA 1RQNA 1H38A 1F5SA 4UB5A 4JMUA 3ISDA 3Q8SB 1SWWA 4Z6CA 4FS1A 3DV9A 5AKLA 2IMWP 2ISPA 3RR7A 2EAOA 2LYHA 4QZHA 4BXOB 3N7RC 5CEHA 4RPYA 2R8HA 5G5HA 3KHHA 4PJ0U 3PSIA 3HW8A 4ED3A 5L1IA 2AXTU 4I29A 3GQCA 5DB8A 2K4HA 3C5GA 2ZTCA 2F44A 4M2YA 9ICRA 4F4XA 4R8UA 4F5RA 5DBAA 2KK0A 3A0HU 4QWAA 2BQRA 3DEEA 1SZHA 2K60A 1OXJA 4Z6DA 2ISOA 1D9FA 2HI0A 1TAUA 4DOBA 7ICTA 4F5PA 5ALVA 5J0QA 4Q43A 2BDUA 4IQVA 3M6KA 4US8A 3JPTA 4PGQA 4I27A 4J9OA 4IRDA 1K1SA 4UB6U 2E8NA 3PSTA 3NVYA 4ELUA 8ICSA 3LYSA 2F2AB 5AM1A 4DL5A 3FM9A 2HVIA 3UM9A 1SXDA 3QU4A 2HOQA 4DSLA 4EX6A 4UARA 4Z6EA 3MR2A 1BPXA 3ETLA 5DBCA 3C21A 1DK2A 3HWTA 3LDAA 2ASLA 8ICKA 4EELA 2MA1A 2HBKA 2E8PA 2NRWA 3NUQA 1U9LA 3FAHA 4UBCA 1S76D 2PFQA 3RB6A 4DF8A 4F4KA 3GILA 2YMPA 3D2SA 2OCEA 4P0QB 1DRGA 3RB3A 5KG4A 2G06A 2OHFA 2W9MA 5IIJA 8ICIA 4HYKA 1ZQTA 4DO9A 7ICJA 2HSZA 2QB1A 3WKEA 4KX3A 3M1YA 7ICMA 7ICEA 3HJEA 7ICVA 2KJ8A 4I2JA 4Y2JA 3JPNA 4ACOA 3FC4A 2MAXA 2ODGA 3VCBA 1V97A 8ICYA 1TK8A 4XA5A 1ZXIA 1RQLA 5AK5A 4EYHB 9ICNA 2HCFA 4C4RA 1RM6C 4F5OA 4UATA 3C5FA 9ICSA 3JPSA 1PVQA 2D3DA 3TFSA 2QARB 3K1RB 3RFAA 2RHFA 1B43A 2BZFA 1Z19A 2DKXA 3MGVA 2VA3A 3TKAA 5KFYA 2YX8A 3ZDEA 3HKZC 2I6XA 2M9NA 4J9MA 2HHWA 2W9BA 4Z6FA 2PXIA 9ICBA 1DXSA 4MHVA 1KL9A 3AL0B 5ALYA 4F5QA 2LM4A 2D6FC 2I1QA 4ECVA 2WF7A 5DLFA 3HKZF 5KFHA 3BS5A 4KLMA 4A8EA 3RRHA 1V38A 5AM3A 4OO1J 4MF2A 2A3VA 7ICUA 5J2EA 1LV5A 5CHGA 4ECSA 2FPKA 2F76X 1NJYA 2MSNA 4CF3A 2KD1A 9ICEA 3AQFA 4M9HA 4DSIA 2HBLA 3KKAA 2AH5A 2ZIXA 3B0XA 3CYMA 4J9KA 2HOFA 1QSYA 1TVAA 1D8LA 1ZD5A 4J9SA 5AI0A 1ZQNA 5KFEA 3F2DA 4KLEA 4QZCA 3ISCA 1ZQ1C 2HHUA 4DFKA 1UT8A 5AHXA 3CP8A 1XO1A 4PHEA 3RAQA 1U49A 3SD7A 3LK9A 4KLLA 5DDMA 4X5VA 1UCVA 4ECTA 2BCQA 1SWVA 3G6XA 4IQUA 3GIJA 1MQ2A 4OJOA 3H8SA 1SV0C 5AKXA 4ECYA 1KBUA 4TURA 2MRLA 3AEVA 4NLBA 1S5LU 8ICRA 3N7SC 3E58A 1QSSA 2W04A 3OJSA 1Z00B 1KFSA 4ECXA 3RJKA 1J2NA 5AM5A 1TAQA 2R18A 2H3FA 2G5HB 2C22A 5D4BA 2J6TA 9ICHA 1NI3A 5AKHA 7ICRA 2G5IB 2JMGA 4UAYA 3MFIA 3RB4A 4O3RA 5JUMA 3V6HA 3MR3A 4UBBA 2AQ0A 4DLGA 5HP4A 4LVSA 2W8KA 2A1AA 4UQGA 4BX9C 1BPEA 2KNJA 4PL2A 3QEAZ 3GIKA 4HAIA 1QQ6A 4QJFB 1UPHA 9ICKA 2HMXA 4NM2A 5IINA 4UAUA 1XO0A 3SR6A 5ALQA 3MBYA 2WF6A 2WAQC 4RPZA 4U6PA 2WF5A 3NASA 5J2JA 3M9OB 3QZ7A 3SV4A 4UASA 4M9LA 1O08A 1AQ6A 2GO7A 3Q8LA 2A1JA 5CP2A 4FFDA 4KTQA 3WK5A 2DGZA 2WAQF 1MSWD 7ICNA 1BPBA 3I76A 1BPYA 1KQQA 1XU4A 1RXVA 2H3IA 4ECRA 4YR0A 4IRCA 3MDAA 2W3RA 3F2BA 2KHVA 2XO7A 3ZDAA 3CNHA 1BVSA 2H3QA 5C0YA 1Q46A 3C23A 2QKQA 2IOFA 4OD0A 4FBTA 5CB1A 4C80A 1ZD4A 2WF8A 4LZDA 2Y9TA 1WCLA 3UXNA 2JEJA 2UVRA 1L6NA 3WKCA 4K4GA 2G08A 3TQ1A 5IIKA 4DQIA 1X2IA 2NV3A 1YZ6A 5KFKA 4R66A 2KZ3A 2JXJA 5KG7A 4DSFA 3T3FA 5AI5A 3GV8B 4P0PB 4UB2A 8ICXA 4Q8FA 1A0PA 4YXMA 1LKYA 2KSOB 4I2GA 4IQTA 2F1JA 5KTQA 2A19A 3M9NB 2F3NA 2F77X 3QU7A 1Q3VA 2ZIVB 4ELTA 1B0XA 3F5EA 1N5WA 2ZIWB 2FLLA 3WKDA 3PX0A 4Y2QA 1Z4OA 1IIPA 3PW2A 5B66U 4U7CA 4DQRA 1L3TA 1L8LA 4Y2VA 1KFDA 7ICSA 5AIBA 4I2BA 5F9NA 1QH9A 4B9SA 4DQSA 4RNNA 2HHVA 3QU9A 4RUAA 4IQWA 5J2CA 1ZQXA 4Y2TA 4EZ6A 2RP5A 1Z1BA 2HHXA 8ICAA 3TACB 5D49A 1SZPA 4UB8U 4ZOHC 2Q4TA 3OHBA 8ICMA 1L8OA 1UT5A 2FMQA 3BZCA 4F91B 4PL1A 1S0VA 4Y2PA 3LWMA 3H8MA 2KEYA 3HILA 4I2AA 3WKBA 4O3PA 3ICXA 3TAPA 4YD1A 5ALHA 1LB2B 1NJWA 1DGSA 2UVVA 4F2RA 2ZUBA 2AGQA 1NK5A 5ALTA 4JV2A 5IIIA 3BS7A 1WG8A 4KLUA 5DBBA 4MFAA 3FYHA 2BPGA 2W9CB 1N62A 2BCVA 2XCPA 1PVRA 2WFAA 1ZYQA 1COOA 1SKRA 2MUTA 4KLOA 2R8GA 5ALMA 2AU0A 2KOBA 9ICIA 5KT3A 2QB0A 1KFTA 1WUDA 1SL0A 4JWMA 1S0OA 4P4MA
chains in the Genus database with same CATH topology
1SV0A 2D8CA 4NJ8A 2EAOA 1V85A 1LKYB 4NL9C 1SGGA 2GLEA 5J8YA 3KKAA 1PK3A 3BS5B 3TACB 3TADA 2QB0B 5JTIA 1OW5A 5JU5A 2QB1A 2ESEA 3BQ7A 1F0MA 2KIVA 2K4PA 2QARA 2F44A 2KSOA 2LPEA 4RQNA 2YTUA 2LMRA 1PK1B 1RG6A 2E8MA 2EAPA 4IS7A 2K60A 1OXJA 3H8MA 2QKQA 1UCVA 3HILA 5F3XB 2DKZA 4RQMA 2JV3A 5JRTA 1COKA 2Y9TA 1WWUA 1X40A 2D3DA 2E8OA 2QARB 1SV0C 3K1RB 4NL9A 4PZOA 2FE9A 2EANA 1X9XA 2KE7A 2L5YA 1X66A 2DKXA 2KG5A 1JI7A 3SENA 2KMDA 2E8NA 3KKAC 1KW4A 3BS7A 2B6GA 1UQVA 1B4FA 1SXDA 1DXSA 2ES6A 4MHVA 1WWVA 1Z1VA 3SEIA 1PK1A 1LKYA 2KSOB 2F3NA 5L1MA 2Y9UA 3BS5A 1B0XA 2F8KA 1V38A 2QB0A 4PZNA 2DL0A 5J8YC 2E8PA 2EAMA 5KNIA 3IDWA 1SXEA 1SV4A 3TADC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV0 A;  2D8C A;  4NJ8 A;  2EAO A;  1V85 A;  1LKY B;  4NL9 C;  1SGG A;  2GLE A;  5J8Y A;  3KKA A;  1PK3 A;  3BS5 B;  3TAC B;  3TAD A;  2QB0 B;  5JTI A;  1OW5 A;  5JU5 A;  2QB1 A;  2ESE A;  3BQ7 A;  1F0M A;  2KIV A;  2K4P A;  2QAR A;  2F44 A;  2KSO A;  2LPE A;  4RQN A;  2YTU A;  2LMR A;  1PK1 B;  1RG6 A;  2E8M A;  2EAP A;  4IS7 A;  2K60 A;  1OXJ A;  3H8M A;  2QKQ A;  1UCV A;  3HIL A;  5F3X B;  2DKZ A;  4RQM A;  2JV3 A;  5JRT A;  1COK A;  2Y9T A;  1WWU A;  1X40 A;  2D3D A;  2E8O A;  2QAR B;  1SV0 C;  3K1R B;  4NL9 A;  4PZO A;  2FE9 A;  2EAN A;  1X9X A;  2KE7 A;  2L5Y A;  1X66 A;  2DKX A;  2KG5 A;  1JI7 A;  3SEN A;  2KMD A;  2E8N A;  3KKA C;  1KW4 A;  3BS7 A;  2B6G A;  1UQV A;  1B4F A;  1SXD A;  1DXS A;  2ES6 A;  4MHV A;  1WWV A;  1Z1V A;  3SEI A;  1PK1 A;  1LKY A;  2KSO B;  2F3N A;  5L1M A;  2Y9U A;  3BS5 A;  1B0X A;  2F8K A;  1V38 A;  2QB0 A;  4PZN A;  2DL0 A;  5J8Y C;  2E8P A;  2EAM A;  5KNI A;  3IDW A;  1SXE A;  1SV4 A;  3TAD C; 
#chains in the Genus database with same CATH topology
 1X42 A;  4DLE A;  3HP6 A;  3GDX A;  4UB1 A;  4RQ3 A;  1SL2 A;  5KT6 A;  2GLE A;  4G9B A;  4F72 A;  1Z4N A;  5EWG A;  4ECQ A;  1XWL A;  1Q8K A;  1EXN A;  1FIQ A;  5KG2 A;  4O3M A;  2R8I A;  2HHS A;  4ZH4 A;  4OCZ A;  4UB3 A;  3H8J A;  2W3S A;  2AQ4 A;  1ZRM A;  1MQ3 A;  4DWI A;  2W43 A;  2XGQ A;  3F53 A;  3IN5 A;  1J2M A;  5AK6 A;  4KLQ A;  2FPL A;  2LMR A;  5AM2 A;  1PK1 B;  3EW9 A;  1VLB A;  5AKY A;  3MGI A;  4BJQ A;  1CRX A;  9ICO A;  5HML A;  3D6J A;  2WF9 A;  3UQ0 A;  3NVV A;  2DKZ A;  1JMS A;  4DEZ A;  4YVZ A;  1ZQQ A;  1CUK A;  4TUS A;  2KFZ A;  4I2H A;  4PHP A;  2FE9 A;  4R8U B;  2XVT A;  7ICP A;  4DF4 A;  4RQ5 A;  3GFK B;  4NLG A;  4PGX A;  4YCX A;  3LWL A;  2LKY A;  1X6I A;  4E0D A;  3UPQ A;  3QUB A;  2DUY A;  3FDS A;  4UAZ A;  2EZX A;  2WTF A;  5KFP A;  4C7Z A;  3RBE A;  1F44 A;  1JN3 A;  1NK4 A;  4NLZ A;  4M9N A;  3WK4 A;  4J9P A;  1O03 A;  1KDH A;  2K89 A;  5KFT A;  1SXE A;  4QIW C;  1KTQ A;  2EQY A;  5HNK A;  5E79 U;  4NJ8 A;  3RH4 A;  2FJ6 A;  5AKZ A;  1L7N A;  1L7P A;  5ALX A;  2DBY A;  4DFD A;  2W03 A;  3H0L B;  2B21 A;  4FZM A;  3JPP A;  5KG3 A;  3ONN A;  3HPO A;  1JIH A;  4QIW F;  4FZN A;  4O9M A;  1ZQZ A;  8ICL A;  9ICL A;  5KFQ A;  5ALW A;  3C29 A;  5B5E U;  3BQ7 A;  3K75 D;  3KBB A;  4NXZ A;  2JEG A;  2NRT A;  2KHQ A;  1ZQS A;  2JEI A;  3M9M B;  3BQ0 A;  1BGX T;  2EAP A;  1BPZ A;  4ED1 A;  2LI6 A;  4UAW A;  5J0R A;  5L9X A;  2Y1I A;  5J0X A;  3GV7 B;  8ICE A;  3RJH A;  3THV A;  1ZOL A;  2JV3 A;  5ALS A;  1CI4 A;  3PW5 A;  1ZQD A;  1UHU A;  3KFU F;  3OGU A;  2GWS A;  1N56 A;  3AQE A;  5DDY A;  2KP7 A;  4DFJ A;  4ED0 A;  1L3U A;  3E0F A;  4GC6 A;  3BDP A;  2OYY A;  5J2B A;  1BNP A;  4YXJ A;  1NKE A;  1HEK A;  4BUG A;  2C2E A;  2BPC A;  3I28 A;  4I28 A;  1RPL A;  3B0Y A;  3AU2 A;  4GLX A;  2NRV A;  1RYR A;  5G5G A;  4RQ0 A;  4C8N A;  4R64 A;  4O0I A;  2FMS A;  5J8Y C;  2Y1J A;  9ICX A;  3KHG A;  5KFB A;  5KFR A;  2AGO A;  2IOH A;  3K1Z A;  2W9B B;  4O3S A;  3N28 A;  5TIS U;  5DGB A;  2KFN A;  4C4S A;  2IBK A;  4P4P A;  4M6W B;  2JZB A;  5KL1 B;  1S10 A;  5J8Y A;  3RJJ A;  2KTQ A;  3BS5 B;  5BOM A;  1IM4 A;  1FFU A;  1OW5 A;  3C2L A;  3GZF A;  4Q44 A;  4ECU A;  4B9T A;  2H3V A;  1BPD A;  3L5K A;  3RJE A;  3PML A;  2OXO A;  4RQN A;  4O3Q A;  1ZQA A;  5J29 A;  4YN4 A;  1N48 A;  4IRK A;  3T5K A;  1WCN A;  4K4H A;  1LVH A;  4DSK A;  1SL1 A;  2R8K A;  3H0M B;  5ALI A;  4F71 A;  4RQ4 A;  3G6Y A;  1TK5 A;  3KTQ A;  5A0L A;  8ICJ A;  4JV1 A;  5KAI U;  1NJX A;  2FLN A;  2K4E A;  2F8L A;  3TAN A;  1UA1 A;  4RZR A;  2J6S A;  1DGJ A;  2EAN A;  3D2N A;  5KFF A;  3PO4 A;  3IRU A;  4RT2 A;  3T5H A;  4J9Q A;  3SI8 A;  2JRZ A;  4NLN A;  5AI6 A;  1ZQO A;  2KMD A;  1ZQL A;  4Y2S A;  2HVH A;  2ASJ A;  2BCS A;  4RUC A;  5J0U A;  4RQ2 A;  1ZET A;  1WWV A;  1Z1V A;  4CRX A;  1NJZ A;  2W7O A;  3Q8M A;  3PX4 A;  2Y9U A;  4DSE A;  2PI5 A;  3RF9 A;  3HRD D;  1ZD2 P;  4MEX A;  5CWR A;  3AUO A;  1SV0 A;  4QWD A;  3M8R A;  4FZL A;  1QQ5 A;  1ZQV A;  3ZI4 A;  4JV0 A;  3ORY A;  5L1J A;  2G07 A;  1DK3 A;  4RQ6 A;  3C28 A;  1SKW A;  4LZG A;  1PK3 A;  1S8O A;  4I2D A;  2E3T A;  3EWA A;  4XQ8 A;  5KFM A;  3K4G A;  2CN1 A;  5JU5 A;  1SIJ A;  4P4O A;  4EEY A;  1L3S A;  2KIV A;  1T4G A;  3KZI U;  1OUQ A;  4QZE A;  2VJ5 A;  4KLH A;  3PV8 A;  4EEN A;  4YQW A;  5ALD A;  4QZB A;  8ICW A;  4YP3 A;  2VA8 A;  8ICH A;  2ASD A;  1XS9 D;  2BGW A;  3BZK A;  4ELV A;  2IA6 A;  1HIW A;  1P7D A;  3B9J A;  3M6Z A;  4FBU A;  3ALR A;  2BR0 A;  2YB4 A;  3T5J A;  2KE7 A;  2XY5 A;  4PPX A;  9ICT A;  1X9W A;  4OJL A;  2CPR A;  2KG5 A;  5DKW A;  5J2D A;  3I1Y A;  4QZG A;  1KW4 A;  1SKS A;  3ZDD A;  2HBM A;  1ZQF A;  3SZ2 A;  4KLF A;  3A0B U;  4USA A;  1S97 A;  3TFR A;  4CF4 A;  5ALL A;  2VA2 A;  5AK4 A;  4R65 A;  5H2F U;  4M04 A;  5HMM A;  4DL4 A;  2YB1 A;  5KL8 B;  5KFN A;  1S0N A;  1ED1 A;  1L5U A;  3RRG A;  1SB3 C;  1YZ7 A;  2W55 A;  2DF4 B;  2RDJ A;  3N97 B;  3Q8K A;  2J6U A;  3RAX A;  4EZ9 A;  2EAM A;  4RNO A;  2LHT A;  3IDW A;  5BPC A;  1XC9 A;  2HHQ A;  5ALE A;  2Z7J A;  2F1H A;  3MR5 A;  5L1K A;  1K1Q A;  3NS1 A;  1IV8 A;  3NRZ A;  4F50 A;  3PR4 A;  1D8Y A;  1LKY B;  3QX7 A;  4NL9 C;  2P6R A;  4B6J A;  4DCC A;  5J0Y A;  1N2X A;  1U48 A;  2IHM A;  1V9P A;  3RJG A;  3F2C A;  1TKD A;  1L7M A;  3MFH A;  2ZJ8 A;  5KG5 A;  5JTI A;  3S6J A;  2JEF A;  4P0P A;  4F4W A;  4FS2 A;  3Q8P B;  1WYG A;  5ALF A;  3SAF A;  1NK6 A;  2F1I A;  2KSO A;  2YTU A;  5HR6 A;  3UQ2 A;  2W7P A;  2YMM A;  4RQ8 A;  1ZQM A;  1NK8 A;  1JAL A;  2G09 A;  2XCA A;  1JXE A;  4ED8 A;  4OJ6 A;  2ZIW A;  2BQU A;  1TK0 A;  5KG0 A;  2LM1 A;  1QSL A;  5DG9 A;  2UVU A;  2HW3 A;  4CDG A;  5AM4 A;  4DQP A;  2Y0S C;  2B0C A;  1S9F A;  2H3Z A;  5ALP A;  3BQ1 A;  1ZQU A;  5EE0 A;  1PZN A;  3TI0 A;  1NK7 A;  1NNL A;  4Y2R A;  3ZDC A;  3OPX A;  3GIM A;  4P2H A;  4NLC A;  4YR3 A;  3OHA A;  4XRH A;  3PO5 A;  5T14 A;  4GC7 A;  5J2I A;  8ICT A;  5EWE A;  5AI9 A;  3ISB A;  4WJ3 B;  3HT3 A;  3CW2 C;  1BNO A;  3JPQ A;  5J2A A;  4F4Z A;  5J2G A;  2XIC A;  1KRP A;  2C2D A;  4R63 A;  1ZQI A;  3MGH A;  2P35 A;  3L4P A;  4KLT A;  4ED6 A;  2ZG6 A;  3RR8 A;  2ZIU A;  1TV9 A;  5DQH A;  4NY8 A;  3OSN A;  2PFP A;  3IG5 A;  4C7Y A;  2C2R A;  4K4I A;  4O5C A;  3HX0 A;  4C8K A;  1Z3E B;  5DG7 A;  5KT5 A;  5IIO A;  2WB1 C;  5IIM A;  3KD3 A;  4F2S A;  1SGG A;  2MUT B;  4RU9 A;  1A6S A;  1Y88 A;  5KFO A;  3JPO A;  5CA7 A;  2BDP A;  7ICQ A;  3IP4 B;  4M0A A;  2K4I A;  2PI4 A;  2QB0 B;  4QWC A;  2WB1 F;  4IR1 A;  5AI4 A;  1TE2 A;  3C1Z A;  4TQS A;  2YY6 A;  4EBE A;  1CEZ A;  5KFD A;  1KLN A;  5AM0 A;  5EE9 A;  2KVC A;  1X6J A;  1VJ5 A;  4YD2 A;  4BGD A;  1XNS A;  2OH2 A;  5J2H A;  8ICO A;  4DS5 A;  1Q3U A;  2XID A;  5CRX A;  2H5X A;  1RZT A;  3WK6 A;  2DQN B;  2MU2 A;  4JWN A;  4PH5 A;  4KLS A;  2FPM A;  3M7D A;  3EYZ A;  3G6V A;  4F8R A;  2W9A A;  2VAN A;  4GFJ A;  2Q0Z X;  3H40 A;  3T79 A;  5CJ7 A;  4I2F A;  2M0N A;  2XC9 A;  5J0W A;  5AIA A;  4DL2 A;  1QCK A;  3GII A;  3SQI A;  4KN4 A;  3VC8 A;  4BXO A;  1PK1 A;  4F4Y A;  5KG6 A;  5DG8 A;  2JGA A;  2BCU A;  9ICQ A;  5KFS A;  3PSP A;  1M6Y A;  2NRX A;  2KVS A;  4C0Z A;  2RQ5 A;  4C8M A;  1RYS A;  3PX6 A;  1JUD A;  1NK0 A;  5KFW A;  1NZB A;  5KNI A;  1TAM A;  4DL6 A;  3RH6 A;  1XSL A;  1B22 A;  2V4R A;  4O5E A;  5KFX A;  1ZJM A;  2KJ9 A;  5GTI U;  8ICQ A;  5DLG A;  3EUB 2;  1ZQW A;  3D2Q A;  1JRP A;  4FO6 A;  1N60 A;  5AIC A;  3J81 j;  1DOQ A;  1RXW A;  4QZI A;  1KN5 A;  2CRX A;  3NRW A;  2PKE A;  4QWB A;  4US9 A;  3PW0 A;  3TAR A;  5KT7 A;  4DSJ A;  8ICG A;  3F5A A;  3IHQ B;  2DPJ A;  4DOC A;  2LPE A;  3T5L A;  4KLJ A;  3TAQ A;  3H4D A;  3V7K A;  1ZQC A;  7ICK A;  2E8M A;  2KV2 A;  5AKK A;  2E5S A;  2KKV A;  1MN8 A;  4UB4 A;  9ICC A;  7ICF A;  2ZXI A;  1N61 A;  2V4Q A;  4RQM A;  4KX5 A;  5JRT A;  2P6U A;  5KFG A;  2XGP A;  9ICU A;  4GXI A;  2BPF A;  3QUT A;  5EWF A;  5J0T A;  3EPI A;  1L7O A;  3E2E A;  4YG2 A;  2LYB A;  9ICJ A;  2PFN A;  7ICL A;  1HUZ A;  5CR0 A;  3WK9 A;  4BWJ A;  4NLK A;  4NV0 A;  3AM9 A;  4JB3 A;  5J0S A;  1XSN A;  5AK3 A;  3LVW A;  1B4F A;  2XI9 A;  5L1L A;  3N4M B;  2G0A A;  3LVV A;  4P0Q A;  1ECW A;  4QZD A;  2NRZ A;  5KFJ A;  2VIX A;  3PMN A;  4M9G A;  4DL3 A;  2F8K A;  4YMO A;  2ZTE A;  4PHD A;  5KFA A;  2P66 A;  1JXL A;  4B9N A;  3WK8 A;  1JRO A;  4ECZ A;  4RQ1 A;  4C4T A;  1N5X A;  2BQ3 A;  4ICA A;  1ZJN A;  7ICH A;  8ICN A;  2HDO A;  4AP9 A;  4RT3 A;  1NK9 A;  4ED7 A;  2JH7 A;  1IG6 A;  3MR6 A;  3AMZ A;  1ZQK A;  4KN7 A;  2IOF K;  3DDH A;  3H4B A;  5KG1 A;  2ESE A;  1F0M A;  1UA0 A;  4QZF A;  2K4P A;  2QAR A;  4Y2U A;  2YML A;  2KZZ A;  2HHT A;  2YN4 A;  2W8L A;  3ETR A;  4OJ5 A;  3QYP A;  3UXO A;  4IC9 A;  3H7I A;  2EZY A;  5KFZ A;  4IS7 A;  5F9L A;  2BHN A;  2JZB B;  4AYB C;  3N7P D;  4MEY A;  9ICA A;  3OSP A;  4UAV A;  4EYI B;  1ARO P;  2GOL A;  3UMG A;  4DL7 A;  2W11 A;  5KT4 A;  4M47 A;  4I2C A;  3SYZ A;  4AYB F;  2I5H A;  2BKE A;  3EPG A;  3QNM A;  4M6W A;  4PZO A;  4EX7 A;  5C5J A;  3AN1 A;  1HJP A;  1JI7 A;  5KFU A;  1A77 A;  3KKA C;  2ZIX B;  5KFC A;  4J9R A;  2B6G A;  3PW4 A;  1X9S A;  3QZ8 A;  3MC1 A;  5KT2 A;  5DQI A;  3V72 A;  4BWM A;  3QU5 A;  8ICP A;  4KMO B;  4MFC A;  2ZJA A;  4I2I A;  4FE3 A;  3PNC A;  9ICM A;  3RJF A;  2KIW A;  2R8J A;  1TFR A;  4YFK A;  5J0O A;  8ICC A;  2ZUD A;  4F3O A;  3UMC A;  1FFV A;  5FP0 A;  2FMP A;  2N1R A;  3V7L A;  1T7P A;  2IHN A;  3OTQ A;  9ICW A;  3KZX A;  3QEB Z;  2AGP A;  3NVW A;  1QQ7 A;  2NO5 A;  3UMB A;  2JHD A;  3R9K A;  4GXK A;  4Q45 A;  4QW8 A;  3WU2 U;  4O5K A;  3PY8 A;  1FO4 A;  4NM1 A;  7ICO A;  3NTU A;  3QUQ A;  4JK1 A;  4I2E A;  3U26 A;  3KHL A;  3PSF A;  3L3F X;  1J97 A;  8ICV A;  4B9U A;  5ALR A;  3V6J A;  3RTV A;  3JPR A;  2ALZ A;  4BDP A;  4EEK A;  4EBC A;  1Z00 A;  5DB9 A;  1COK A;  4B9M A;  2JR5 A;  1X40 A;  2E8O A;  2KN7 A;  5DB7 A;  5KFV A;  4KLD A;  5AKG A;  2ZUC A;  2YMQ A;  4IL6 U;  4CNQ A;  2RRD A;  4MF8 A;  2L5Y A;  4CCH A;  5HR7 A;  2E1F A;  3SV3 A;  5AKJ A;  4OJP A;  3WK7 A;  3C1Y A;  5HHH A;  2ZXH A;  1ZQP A;  2BCR A;  1ZQH A;  4J03 A;  1QTM A;  1VDV A;  1UQV A;  2K8B B;  2YQE A;  8ICU A;  3PVX A;  3ZDB A;  2A1J B;  5ALZ A;  2OM6 A;  1U45 A;  8ICB A;  1ZQY A;  3PZP A;  3IG8 A;  1ZRN A;  3BQ2 A;  5BOL A;  2K8A A;  1HUO A;  4UW9 A;  4RPX A;  2I9G A;  2DPI A;  4DFP A;  1NKC A;  1T94 A;  1SV4 A;  3PR5 B;  3AU6 A;  2AJQ A;  3TAD C;  4YMN A;  3Q8R B;  2D8C A;  3O0F A;  1QLN A;  2GH1 A;  5DGA A;  1JX4 A;  5ALJ A;  2JH1 A;  1PVP A;  1KEJ A;  3RBD A;  1X9M A;  1RYU A;  5K4L A;  4CF5 A;  1RDF A;  8ICF A;  2W54 A;  4B9L A;  3ZD9 A;  3Q8Q B;  2NO4 A;  4DFM A;  2ZTD A;  4QWE A;  1T3N A;  3TAD A;  4J9N A;  3ED5 A;  2UVW A;  3MAB A;  9ICF A;  3RB0 A;  3RH5 A;  3WKA A;  3M8S A;  4F92 B;  1NKB A;  4G3I A;  1MA7 A;  1PUZ A;  2OWO A;  4KIT B;  2VKQ A;  2EH9 A;  1U4B A;  5ALK A;  2LYA A;  4EBD A;  1NOM A;  1KSP A;  3C2M A;  3V7J A;  5IIL A;  4QZ8 A;  2XY6 A;  1GO3 F;  3SAH A;  5ALG A;  1ZQB A;  5KFI A;  9ICV A;  4DS4 A;  4NL9 A;  1ZQR A;  4LJX A;  3BJY A;  1X9X A;  4C8L A;  4TUP A;  1T8E A;  2ZIV A;  2KKP A;  4QZ9 A;  4GIB A;  2OEH A;  3NVZ A;  1URJ A;  2RDI A;  5D46 A;  5GTH U;  3SEN A;  5EOZ A;  5DB6 A;  1S0M A;  3GV5 B;  4DQQ A;  2HOI A;  4O3N A;  2AHO B;  4DOA A;  2ES6 A;  2VJ4 A;  1ZQJ A;  3CRX A;  4O3O A;  2RLT A;  3RJI A;  3KOO A;  7ICI A;  2HBJ A;  2QLT A;  4TQR A;  3IV6 A;  2PFO A;  3KHR A;  1D8B A;  5L1M A;  1IXR A;  2FLP A;  4CGZ A;  2EZZ A;  5EE1 A;  4YR2 A;  2Y0S F;  5AKI A;  4PZN A;  2DL0 A;  3H0R B;  1S77 D;  8ICZ A;  4KLG A;  4NWI A;  2XY7 A;  1KKX A;  2FI1 A;  4RQ7 A;  1XSP A;  1N63 A;  1U47 A;  1ZQG A;  1V85 A;  5TZV A;  3NGD A;  4IR9 A;  2KIC A;  5EE3 A;  1FEZ A;  4F5N A;  3ZD8 A;  3H8W A;  3OJU A;  5KFL A;  3MDC A;  2ZIU B;  4QZA A;  4J9L A;  5ALO A;  5ALU A;  2LBO A;  4ECW A;  3SMV A;  4GXJ A;  2ZJ5 A;  4Y2X A;  5J0P A;  4MFF A;  4PGY A;  3C2K A;  2EDU A;  5HHI A;  2DWQ A;  1RG6 A;  3PW7 A;  2DFL A;  3EZ5 A;  3QE9 Y;  1ZD3 A;  9ICG A;  4F93 B;  2FDR A;  4C8O A;  3UXP A;  5F3X B;  5AI8 A;  3SAG A;  4M9J A;  4RNM A;  4QW9 A;  2W9C A;  4B9V A;  1D9D A;  2KZM A;  1WWU A;  1C20 A;  5AKE A;  2WHE A;  3IM1 A;  3QXG A;  4QNL A;  2V9W A;  1NZP A;  1T3Q A;  1ZQE A;  2O6K A;  2ATL A;  1YT3 A;  4PHA A;  4YMM A;  4Q8E A;  2CXY A;  5DQG A;  1C7Y A;  1X66 A;  4JUZ A;  3BQT A;  3QU2 A;  7ICG A;  4CE6 A;  5J2F A;  2NYV A;  4KMU A;  4ED2 A;  3GU3 A;  2PMZ C;  4Y2Y A;  4TUQ A;  9ICP A;  2C28 A;  4KLI A;  3V6K A;  2E1E A;  2K8C B;  5ALN A;  5KAF U;  3SEI A;  1MC8 A;  2KJ5 A;  3QUC A;  1A76 A;  2PMZ F;  1K5O A;  4XUS A;  5J2K A;  1L3V A;  1RQN A;  1H38 A;  1F5S A;  4UB5 A;  4JMU A;  3ISD A;  3Q8S B;  1SWW A;  4Z6C A;  4FS1 A;  3DV9 A;  5AKL A;  2IMW P;  2ISP A;  3RR7 A;  2EAO A;  2LYH A;  4QZH A;  4BXO B;  3N7R C;  5CEH A;  4RPY A;  2R8H A;  5G5H A;  3KHH A;  4PJ0 U;  3PSI A;  3HW8 A;  4ED3 A;  5L1I A;  2AXT U;  4I29 A;  3GQC A;  5DB8 A;  2K4H A;  3C5G A;  2ZTC A;  2F44 A;  4M2Y A;  9ICR A;  4F4X A;  4R8U A;  4F5R A;  5DBA A;  2KK0 A;  3A0H U;  4QWA A;  2BQR A;  3DEE A;  1SZH A;  2K60 A;  1OXJ A;  4Z6D A;  2ISO A;  1D9F A;  2HI0 A;  1TAU A;  4DOB A;  7ICT A;  4F5P A;  5ALV A;  5J0Q A;  4Q43 A;  2BDU A;  4IQV A;  3M6K A;  4US8 A;  3JPT A;  4PGQ A;  4I27 A;  4J9O A;  4IRD A;  1K1S A;  4UB6 U;  2E8N A;  3PST A;  3NVY A;  4ELU A;  8ICS A;  3LYS A;  2F2A B;  5AM1 A;  4DL5 A;  3FM9 A;  2HVI A;  3UM9 A;  1SXD A;  3QU4 A;  2HOQ A;  4DSL A;  4EX6 A;  4UAR A;  4Z6E A;  3MR2 A;  1BPX A;  3ETL A;  5DBC A;  3C21 A;  1DK2 A;  3HWT A;  3LDA A;  2ASL A;  8ICK A;  4EEL A;  2MA1 A;  2HBK A;  2E8P A;  2NRW A;  3NUQ A;  1U9L A;  3FAH A;  4UBC A;  1S76 D;  2PFQ A;  3RB6 A;  4DF8 A;  4F4K A;  3GIL A;  2YMP A;  3D2S A;  2OCE A;  4P0Q B;  1DRG A;  3RB3 A;  5KG4 A;  2G06 A;  2OHF A;  2W9M A;  5IIJ A;  8ICI A;  4HYK A;  1ZQT A;  4DO9 A;  7ICJ A;  2HSZ A;  2QB1 A;  3WKE A;  4KX3 A;  3M1Y A;  7ICM A;  7ICE A;  3HJE A;  7ICV A;  2KJ8 A;  4I2J A;  4Y2J A;  3JPN A;  4ACO A;  3FC4 A;  2MAX A;  2ODG A;  3VCB A;  1V97 A;  8ICY A;  1TK8 A;  4XA5 A;  1ZXI A;  1RQL A;  5AK5 A;  4EYH B;  9ICN A;  2HCF A;  4C4R A;  1RM6 C;  4F5O A;  4UAT A;  3C5F A;  9ICS A;  3JPS A;  1PVQ A;  2D3D A;  3TFS A;  2QAR B;  3K1R B;  3RFA A;  2RHF A;  1B43 A;  2BZF A;  1Z19 A;  2DKX A;  3MGV A;  2VA3 A;  3TKA A;  5KFY A;  2YX8 A;  3ZDE A;  3HKZ C;  2I6X A;  2M9N A;  4J9M A;  2HHW A;  2W9B A;  4Z6F A;  2PXI A;  9ICB A;  1DXS A;  4MHV A;  1KL9 A;  3AL0 B;  5ALY A;  4F5Q A;  2LM4 A;  2D6F C;  2I1Q A;  4ECV A;  2WF7 A;  5DLF A;  3HKZ F;  5KFH A;  3BS5 A;  4KLM A;  4A8E A;  3RRH A;  1V38 A;  5AM3 A;  4OO1 J;  4MF2 A;  2A3V A;  7ICU A;  5J2E A;  1LV5 A;  5CHG A;  4ECS A;  2FPK A;  2F76 X;  1NJY A;  2MSN A;  4CF3 A;  2KD1 A;  9ICE A;  3AQF A;  4M9H A;  4DSI A;  2HBL A;  3KKA A;  2AH5 A;  2ZIX A;  3B0X A;  3CYM A;  4J9K A;  2HOF A;  1QSY A;  1TVA A;  1D8L A;  1ZD5 A;  4J9S A;  5AI0 A;  1ZQN A;  5KFE A;  3F2D A;  4KLE A;  4QZC A;  3ISC A;  1ZQ1 C;  2HHU A;  4DFK A;  1UT8 A;  5AHX A;  3CP8 A;  1XO1 A;  4PHE A;  3RAQ A;  1U49 A;  3SD7 A;  3LK9 A;  4KLL A;  5DDM A;  4X5V A;  1UCV A;  4ECT A;  2BCQ A;  1SWV A;  3G6X A;  4IQU A;  3GIJ A;  1MQ2 A;  4OJO A;  3H8S A;  1SV0 C;  5AKX A;  4ECY A;  1KBU A;  4TUR A;  2MRL A;  3AEV A;  4NLB A;  1S5L U;  8ICR A;  3N7S C;  3E58 A;  1QSS A;  2W04 A;  3OJS A;  1Z00 B;  1KFS A;  4ECX A;  3RJK A;  1J2N A;  5AM5 A;  1TAQ A;  2R18 A;  2H3F A;  2G5H B;  2C22 A;  5D4B A;  2J6T A;  9ICH A;  1NI3 A;  5AKH A;  7ICR A;  2G5I B;  2JMG A;  4UAY A;  3MFI A;  3RB4 A;  4O3R A;  5JUM A;  3V6H A;  3MR3 A;  4UBB A;  2AQ0 A;  4DLG A;  5HP4 A;  4LVS A;  2W8K A;  2A1A A;  4UQG A;  4BX9 C;  1BPE A;  2KNJ A;  4PL2 A;  3QEA Z;  3GIK A;  4HAI A;  1QQ6 A;  4QJF B;  1UPH A;  9ICK A;  2HMX A;  4NM2 A;  5IIN A;  4UAU A;  1XO0 A;  3SR6 A;  5ALQ A;  3MBY A;  2WF6 A;  2WAQ C;  4RPZ A;  4U6P A;  2WF5 A;  3NAS A;  5J2J A;  3M9O B;  3QZ7 A;  3SV4 A;  4UAS A;  4M9L A;  1O08 A;  1AQ6 A;  2GO7 A;  3Q8L A;  2A1J A;  5CP2 A;  4FFD A;  4KTQ A;  3WK5 A;  2DGZ A;  2WAQ F;  1MSW D;  7ICN A;  1BPB A;  3I76 A;  1BPY A;  1KQQ A;  1XU4 A;  1RXV A;  2H3I A;  4ECR A;  4YR0 A;  4IRC A;  3MDA A;  2W3R A;  3F2B A;  2KHV A;  2XO7 A;  3ZDA A;  3CNH A;  1BVS A;  2H3Q A;  5C0Y A;  1Q46 A;  3C23 A;  2QKQ A;  2IOF A;  4OD0 A;  4FBT A;  5CB1 A;  4C80 A;  1ZD4 A;  2WF8 A;  4LZD A;  2Y9T A;  1WCL A;  3UXN A;  2JEJ A;  2UVR A;  1L6N A;  3WKC A;  4K4G A;  2G08 A;  3TQ1 A;  5IIK A;  4DQI A;  1X2I A;  2NV3 A;  1YZ6 A;  5KFK A;  4R66 A;  2KZ3 A;  2JXJ A;  5KG7 A;  4DSF A;  3T3F A;  5AI5 A;  3GV8 B;  4P0P B;  4UB2 A;  8ICX A;  4Q8F A;  1A0P A;  4YXM A;  1LKY A;  2KSO B;  4I2G A;  4IQT A;  2F1J A;  5KTQ A;  2A19 A;  3M9N B;  2F3N A;  2F77 X;  3QU7 A;  1Q3V A;  2ZIV B;  4ELT A;  1B0X A;  3F5E A;  1N5W A;  2ZIW B;  2FLL A;  3WKD A;  3PX0 A;  4Y2Q A;  1Z4O A;  1IIP A;  3PW2 A;  5B66 U;  4U7C A;  4DQR A;  1L3T A;  1L8L A;  4Y2V A;  1KFD A;  7ICS A;  5AIB A;  4I2B A;  5F9N A;  1QH9 A;  4B9S A;  4DQS A;  4RNN A;  2HHV A;  3QU9 A;  4RUA A;  4IQW A;  5J2C A;  1ZQX A;  4Y2T A;  4EZ6 A;  2RP5 A;  1Z1B A;  2HHX A;  8ICA A;  3TAC B;  5D49 A;  1SZP A;  4UB8 U;  4ZOH C;  2Q4T A;  3OHB A;  8ICM A;  1L8O A;  1UT5 A;  2FMQ A;  3BZC A;  4F91 B;  4PL1 A;  1S0V A;  4Y2P A;  3LWM A;  3H8M A;  2KEY A;  3HIL A;  4I2A A;  3WKB A;  4O3P A;  3ICX A;  3TAP A;  4YD1 A;  5ALH A;  1LB2 B;  1NJW A;  1DGS A;  2UVV A;  4F2R A;  2ZUB A;  2AGQ A;  1NK5 A;  5ALT A;  4JV2 A;  5III A;  3BS7 A;  1WG8 A;  4KLU A;  5DBB A;  4MFA A;  3FYH A;  2BPG A;  2W9C B;  1N62 A;  2BCV A;  2XCP A;  1PVR A;  2WFA A;  1ZYQ A;  1COO A;  1SKR A;  2MUT A;  4KLO A;  2R8G A;  5ALM A;  2AU0 A;  2KOB A;  9ICI A;  5KT3 A;  2QB0 A;  1KFT A;  1WUD A;  1SL0 A;  4JWM A;  1S0O A;  4P4M A; 
#chains in the Genus database with same CATH homology
 1SV0 A;  2D8C A;  4NJ8 A;  2EAO A;  1V85 A;  1LKY B;  4NL9 C;  1SGG A;  2GLE A;  5J8Y A;  3KKA A;  1PK3 A;  3BS5 B;  3TAC B;  3TAD A;  2QB0 B;  5JTI A;  1OW5 A;  5JU5 A;  2QB1 A;  2ESE A;  3BQ7 A;  1F0M A;  2KIV A;  2K4P A;  2QAR A;  2F44 A;  2KSO A;  2LPE A;  4RQN A;  2YTU A;  2LMR A;  1PK1 B;  1RG6 A;  2E8M A;  2EAP A;  4IS7 A;  2K60 A;  1OXJ A;  3H8M A;  2QKQ A;  1UCV A;  3HIL A;  5F3X B;  2DKZ A;  4RQM A;  2JV3 A;  5JRT A;  1COK A;  2Y9T A;  1WWU A;  1X40 A;  2D3D A;  2E8O A;  2QAR B;  1SV0 C;  3K1R B;  4NL9 A;  4PZO A;  2FE9 A;  2EAN A;  1X9X A;  2KE7 A;  2L5Y A;  1X66 A;  2DKX A;  2KG5 A;  1JI7 A;  3SEN A;  2KMD A;  2E8N A;  3KKA C;  1KW4 A;  3BS7 A;  2B6G A;  1UQV A;  1B4F A;  1SXD A;  1DXS A;  2ES6 A;  4MHV A;  1WWV A;  1Z1V A;  3SEI A;  1PK1 A;  1LKY A;  2KSO B;  2F3N A;  5L1M A;  2Y9U A;  3BS5 A;  1B0X A;  2F8K A;  1V38 A;  2QB0 A;  4PZN A;  2DL0 A;  5J8Y C;  2E8P A;  2EAM A;  5KNI A;  3IDW A;  1SXE A;  1SV4 A;  3TAD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...