2K4PA

Solution structure of ship2-sam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
SGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2
publication title NMR Studies of a Heterotypic Sam-Sam Domain Association: The Interaction between the Lipid Phosphatase Ship2 and the EphA2 Receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 65
sequence length 65
ec nomenclature ec 3.1.3.86: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase.
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k4pA00
1UQVA 3TADC 4IS7A 5L1MA 2B6GA 1LKYB 2K4PA 3KKAA 2KSOA 3HILA 2QKQA 1SXDA 1SGGA 1SV4A 1DXSA 2E8NA 2DKXA 5J8YA 3BS5B 1WWUA 2Y9TA 2K60A 3TADA 2QB1A 1UCVA 2LMRA 2E8PA 3BS5A 2DKZA 4PZOA 1Z1VA 1RG6A 2D8CA 3SEIA 5F3XB 1OXJA 2KMDA 5JU5A 1KW4A 2EANA 2DL0A 1PK3A 4RQMA 3IDWA 2EAPA 4PZNA 2GLEA 1JI7A 1LKYA 2EAOA 5JRTA 5JTIA 2E8OA 2LPEA 2D3DA 1X40A 2EAMA 4MHVA 2KE7A 2KIVA 2F44A 2E8MA 3H8MA 1PK1B 1SV0C 2ES6A 4RQNA 2Y9UA 2FE9A 5J8YC 2KSOB 5KNIA 4NL9C 2QARB 2KG5A 1V85A 2YTUA 1PK1A 1WWVA 4NJ8A 3SENA 3TACB 1V38A 2ESEA 3BS7A 1F0MA 1SXEA 1SV0A 1X66A 2QARA 3BQ7A 2QB0B 2F8KA 1X9XA 1B4FA 4NL9A 2JV3A 3K1RB 2L5YA 3KKAC 1COKA 2QB0A 2F3NA 1B0XA 1OW5A
chains in the Genus database with same CATH superfamily
1JMSA 2WF9A 4J9LA 1ZQVA 4CF5A 3JPTA 5J2KA 4GC7A 2KSOA 3UXNA 4R65A 3RAQA 3RJEA 2Y0SF 5KFFA 4MF2A 4NLGA 8ICCA 2ISOA 1YT3A 4O5KA 4OO1J 5TISU 2P6RA 4Y2VA 4IC9A 1MC8A 2EDUA 5JUMA 3Q8LA 3T5JA 4DLGA 8ICBA 2DF4B 2WFAA 4Z6FA 2HBLA 4R66A 3RRGA 2F1JA 3L5KA 5AKHA 4RQ7A 3GFKB 1OXJA 8ICEA 5AKLA 2VKQA 5KFOA 3IDWA 1S76D 4DOBA 1S0NA 1LVHA 8ICQA 1D8YA 1UPHA 2CXYA 2DQNB 2LYHA 2K4IA 4DO9A 5F9LA 1JALA 8ICGA 5CP2A 1Q3VA 9ICSA 4O5EA 4IRKA 3PSPA 4OJPA 4DL5A 2JZBB 3QU7A 1ZQSA 3H8MA 4YD2A 4FFDA 1SV0C 5J0XA 2IOFK 3MDAA 2JZBA 4ECUA 3RFAA 2FDRA 2KG5A 2Q4TA 2PFOA 9ICNA 4EX7A 4YCXA 4ECYA 1ZQUA 7ICPA 2VA2A 1ED1A 3D2QA 5DB8A 2XI9A 3U26A 3H4DA 3GV8B 4HAIA 1JUDA 4J9RA 4RT2A 4RQ5A 2JXJA 3NUQA 4DQQA 3TAQA 1KRPA 2JHDA 4RU9A 2ZIVB 2KZZA 3PR5B 3TADC 5DLFA 3SD7A 3PY8A 2WB1F 3SAHA 3HILA 2HVHA 4DCCA 3QUTA 4QZEA 3T5KA 4RPXA 4RT3A 4XRHA 1BNOA 3AU2A 4CF4A 1SWVA 2K8BB 4FS1A 4EBCA 5T14A 1ZQOA 1SL0A 5D46A 2EH9A 4PZOA 1U45A 3BQ2A 1H38A 1FIQA 4RQ1A 5L1LA 4CF3A 4DL2A 9ICCA 1A76A 4DEZA 4PZNA 2BQUA 5KFHA 2BPGA 3WU2U 2BDPA 1HUZA 2HBMA 4Y2JA 2OHFA 2VJ5A 1HJPA 1ZRMA 8ICIA 1XU4A 1N61A 2W9CB 9ICHA 3AN1A 3OGUA 5EWGA 1ZQAA 1O03A 3N97B 4KLIA 1C7YA 8ICSA 4F5NA 1QSSA 2JH1A 4TURA 4KLTA 2W9CA 4HYKA 2RDJA 1C20A 3B0YA 1KL9A 8ICNA 5ALXA 4DSEA 3MGIA 2IA6A 5KT7A 3EZ5A 4ECRA 3Q8RB 1JXEA 2KVCA 3SQIA 2FI1A 1NJZA 5KT6A 2A1JB 1Z19A 4Q8EA 4BJQA 1JN3A 2B0CA 5DB6A 2PMZF 1TK8A 4ED8A 8ICYA 3V7KA 1ZQDA 4RQ6A 2F76X 4F93B 1YZ6A 5CB1A 1KFTA 4F4WA 1L8LA 2ZIUB 3IG5A 4QWCA 1KTQA 5ALPA 2ZIUA 5ALYA 2WB1C 4PGXA 5KFGA 2XVTA 2ZXIA 3MR3A 3T79A 4A8EA 4DLEA 2H3VA 3F5AA 4YG2A 3M9NB 3OTQA 2UVVA 4ED7A 3NS1A 2IMWP 4I2FA 4C8OA 1J2NA 3PO4A 4UBBA 4KLMA 1RG6A 3TFSA 5ALZA 1NJYA 2RHFA 5J29A 2HVIA 1JRPA 9ICIA 3NTUA 2YN4A 1WYGA 5AI9A 1KW4A 4RQMA 5HMMA 2GLEA 4QZGA 4GIBA 1DGJA 3F5EA 5KFQA 3ZDDA 1U9LA 2A3VA 2ZTEA 2D3DA 2KJ9A 2ISPA 1QQ6A 2BHNA 5DGBA 1D9DA 5J2DA 2N1RA 2CRXA 1T4GA 1MQ2A 3AMZA 4LZDA 3RJHA 1HIWA 5KFYA 5A0LA 5HR7A 3H8JA 3KHGA 5CR0A 3UMCA 1XNSA 3G6YA 2YTUA 1Z3EB 3IP4B 4EX6A 1K5OA 3C2MA 5D49A 1RPLA 5KG1A 3SENA 1Z4NA 4BWMA 3BZCA 1D9FA 4I27A 1SV0A 3GV5B 3KHRA 3ORYA 4YQWA 3KHLA 3KKAC 2PMZC 2ZXHA 2EZZA 3NVZA 4QZ8A 5HR6A 1ZRNA 5AM3A 3UMGA 2G08A 4CNQA 1RZTA 4I2IA 4Y2QA 5IIIA 5B5EU 2XC9A 4JWMA 2WF5A 2MA1A 2AXTU 3GIMA 4UAWA 4CRXA 2YX8A 1UA1A 1NK0A 1A6SA 1X2IA 2WAQC 4Q8FA 1L3UA 3TADA 5AKGA 2QB1A 1BPBA 3Q8QB 1KLNA 8ICKA 1XS9D 3N28A 4ACOA 9ICPA 2ZUDA 4J9MA 4M9LA 2W8KA 3E2EA 4FE3A 1AROP 9ICVA 9ICBA 2ZUBA 4ECXA 3MFIA 2W43A 4EEKA 4ED3A 1PUZA 4FS2A 5JRTA 3TQ1A 8ICTA 4USAA 3PX0A 1XSLA 4ZOHC 4J9OA 2FPKA 3TI0A 2FMSA 3PV8A 3H0LB 2W9AA 3ZDAA 4QZHA 4LVSA 1X9SA 3T5LA 5KFBA 1IIPA 3UM9A 4RNNA 4YXJA 5AKJA 5KT3A 4BDPA 4CDGA 1ZD3A 5KFPA 2ODGA 4P4OA 4YR3A 3F2DA 2KZMA 5KFNA 4NL9C 1ZD4A 3KD3A 2KNJA 5DBBA 1PVPA 4KLFA 3WKCA 7ICJA 2A19A 4UQGA 3SAFA 3SR6A 4DL3A 1S10A 3RH4A 1L6NA 2QB0B 2KJ5A 2I5HA 4IQWA 2PFPA 5ALTA 3WK9A 1KEJA 3ZDBA 2WTFA 2R8JA 1KBUA 3HRDD 4UASA 3LWLA 2FPLA 2QB0A 2OXOA 5ALRA 1N62A 4CGZA 3FAHA 2W7PA 2ZUCA 3TANA 5KFDA 2W9BB 1SKRA 3WKBA 1ZQCA 1WUDA 4UATA 2XY5A 1NK7A 5AI0A 2QKQA 5KT5A 3SV4A 2W9BA 2V4RA 3RB6A 4EYIB 2A1AA 1CUKA 1WWUA 3ISCA 3M6KA 3WKDA 1KQQA 3MR2A 1N2XA 3LVWA 1X6IA 4F8RA 2C22A 5AKIA 3V6JA 2E1FA 5AM1A 4P0PB 1YZ7A 2D8CA 1SKWA 4Z6CA 1Q3UA 1S9FA 9ICWA 4UAYA 4GC6A 7ICRA 2KP7A 3PSFA 4DSIA 5JU5A 2ZJ5A 4P0PA 5AK3A 3JPSA 3BQ1A 5ALQA 2DGZA 2BPCA 4F4YA 2LPEA 3CW2C 1UA0A 4Y2TA 1IG6A 5AKEA 4Q45A 2YMQA 1ZQRA 3QUBA 4NLKA 2BKEA 4IR9A 5AM4A 4CCHA 5KAFU 1S97A 1ZQZA 3PW5A 1QTMA 4YXMA 2LHTA 3VCBA 4P4PA 3KHHA 2Y1IA 2ZIWB 3MR6A 1KDHA 4NJ8A 2KV2A 4M9GA 5ALDA 1X9WA 1LB2B 2LKYA 4GLXA 2ZIWA 1M6YA 3FDSA 3H0RB 5EE9A 5L1IA 2DWQA 4ZH4A 2ZJAA 4O3MA 4PHPA 2YMLA 2W11A 3K75D 5KL8B 5G5HA 3QU2A 2XCAA 3C2KA 3LDAA 5IILA 5J0TA 4ED1A 2K4PA 3KKAA 5CA7A 1SXDA 1ZJMA 3K4GA 7ICGA 1U49A 1N5XA 5J8YA 5DLGA 2CN1A 2Y9TA 2YMMA 2K60A 4QIWC 5KFIA 1UCVA 2AQ0A 4DQPA 4UB3A 1Y88A 2DFLA 5L1JA 5ALMA 4R63A 5ALFA 3LK9A 1PK3A 2HW3A 4O5CA 8ICLA 3SAGA 1ZD5A 1UT8A 3SYZA 5ALSA 1XWLA 2XY6A 2K8CB 2RLTA 4FO6A 2VIXA 1BPYA 4KLSA 4C80A 2DPIA 1PVRA 4P2HA 2BCRA 1Z00B 4QZ9A 3Q8KA 5C0YA 2ES6A 4ED6A 3QYPA 5G5GA 5KFCA 3WKEA 4I2HA 1KFSA 1XSPA 3H7IA 1V85A 4RQ4A 2KJ8A 3RBEA 4QW9A 2K4HA 3OPXA 3B0XA 3JPQA 3QZ8A 2V4QA 4NL9A 2HCFA 4NXZA 3DDHA 1L3TA 2F3NA 4JUZA 1RYRA 3IN5A 2KICA 5H2FU 4B9VA 5KG2A 2HOIA 1NI3A 5L1MA 1SKSA 3RR7A 4DQIA 5J0UA 3BQTA 2ZTDA 2UVUA 4DFDA 1SV4A 2F77X 2MSNA 3ISBA 7ICOA 1D8BA 3JPOA 2MUTB 4QNLA 4F4XA 4OD0A 2HMXA 3QZ7A 4QWBA 4RPYA 3SEIA 1RYSA 2MUTA 2HBKA 2ZIVA 5KFRA 4UB4A 3OSNA 2FLPA 2VANA 1QSYA 4Y2UA 5KG6A 3KOOA 2EAPA 5KFJA 1VDVA 5KT2A 3GIIA 4NM2A 2W3RA 4Z6EA 4Y2XA 2E3TA 3OJUA 4PHAA 4OJ5A 2KKPA 4NLCA 1CI4A 2G07A 2NYVA 1N63A 1NZPA 5DG8A 1SZHA 3H8SA 1XC9A 5KFAA 4M9HA 2G5IB 4UB1A 3FM9A 4I2JA 3MDCA 4DF8A 4DSFA 5HHIA 3OHAA 2XGPA 4I29A 5J2BA 4IRCA 3I28A 3OJSA 1RXWA 1RM6C 1V38A 3Q8PB 2W7OA 4DSLA 2ESEA 4NLZA 3MFHA 1SXEA 1P7DA 3NGDA 3BQ7A 4DFMA 4BXOB 2XY7A 4M6WB 2XGQA 1TAMA 1B4FA 2BPFA 2W54A 3GZFA 2KTQA 5J0YA 2HHSA 4BXOA 2OCEA 4M6WA 5KFMA 2BQ3A 4M04A 3THVA 3PX4A 1BPDA 2BDUA 4X5VA 4B9SA 3QU4A 1X6JA 1FO4A 5ALVA 2OM6A 2BCVA 3BS5B 2A1JA 3QU9A 4M9NA 2XICA 8ICMA 7ICUA 1L3SA 2E8PA 2KIWA 4XQ8A 2QLTA 3BS5A 8ICAA 2BQRA 4B9LA 1TAQA 3M9OB 4F92B 4C8LA 4K4HA 4KX3A 9ICOA 4PGQA 5J2AA 4OJOA 4IQTA 7ICTA 4AYBC 2WAQF 4F91B 3FYHA 4UAUA 1TFRA 2H3IA 3QXGA 1QH9A 1IV8A 1JXLA 3RH5A 2FMQA 2NRZA 2OH2A 1COOA 4YR0A 2AQ4A 9ICQA 5BOMA 3UXPA 4LZGA 5IIOA 2D6FC 3M7DA 3QUCA 2NRTA 1K1SA 3NVVA 4DSKA 4KMUA 2KIVA 3PR4A 2HOFA 3E0FA 5KTQA 3WK4A 4PL1A 3VC8A 1T3QA 4DOAA 1N48A 3ZI4A 4DWIA 2QARB 2HDOA 5CEHA 5HNKA 4KN4A 1XO0A 4F71A 2NRVA 2F1IA 3RB4A 2QARA 2F8KA 4I2DA 3ISDA 3TAPA 4M2YA 2AU0A 1NK8A 2H3FA 3IV6A 1COKA 3V72A 1N5WA 1J97A 2PI5A 3ALRA 1ZQIA 4MEXA 2YB4A 1IXRA 4C4SA 2YQEA 2LBOA 1CEZA 2DUYA 4O0IA 1GO3F 2YMPA 2HBJA 1LKYB 5J0WA 8ICRA 5J2CA 4FBTA 1NKBA 4U7CA 7ICMA 4JWNA 3HKZF 3G6XA 3KZIU 1URJA 4QZDA 4J9NA 2LMRA 4TUQA 4YMNA 2P6UA 5ALOA 1SWWA 2RP5A 2KHVA 2WF7A 4QZCA 9ICJA 5ALJA 1TVAA 5DB9A 1NK4A 1L8OA 2JEIA 2KMDA 2JGAA 3N7PD 4BUGA 1NK6A 4ECQA 1ZQGA 1JI7A 3DV9A 2KVSA 1RQNA 2J6SA 5AM2A 5B66U 3MGVA 1V9PA 3OHBA 1J2MA 4C8NA 9ICGA 3CNHA 8ICFA 2HSZA 3PVXA 4B9UA 2PXIA 1OUQA 1DK3A 4XA5A 2W3SA 1KKXA 3NRZA 4TQSA 5C5JA 4Z6DA 2JRZA 2PFQA 4J9SA 2K4EA 1ZQKA 2LYAA 3HT3A 3GIJA 1CRXA 4ECTA 4KLQA 4C4RA 5KFXA 1S0VA 2HOQA 3RJFA 4C8KA 5IIKA 2Y1JA 5CHGA 4NM1A 2XO7A 2J6UA 4G3IA 2JEJA 4DFPA 1KSPA 4F5OA 4O3NA 4Y2PA 1L5UA 3QEAZ 3V7LA 1RDFA 3H0MB 5FP0A 3ZD9A 2GO7A 1ZQJA 5AK6A 2E8NA 1NKEA 5ALIA 3CRXA 2R18A 3HKZC 2W55A 4TUSA 4Y2YA 5J0PA 1KN5A 4EYHB 1TV9A 3MC1A 4UAVA 1ZQTA 2AGOA 3L4PA 1FFVA 3D2NA 2WF6A 4DL4A 2IHMA 4QIWF 2EAOA 3C1ZA 2E8OA 1L3VA 3T5HA 4FZMA 5CJ7A 4KLDA 3LWMA 2LM1A 1QQ7A 2KKVA 1S5LU 1X40A 5DG7A 2B21A 2IHNA 3PW4A 2E1EA 2G5HB 3H40A 1DRGA 3EWAA 2EZXA 3SZ2A 8ICJA 3GILA 1O08A 8ICOA 4C7YA 1F44A 5J2GA 5KFVA 1PK1B 3QUQA 2PKEA 2KEYA 2OWOA 1XSNA 7ICKA 5KG4A 1PK1A 4QZBA 3C29A 4UW9A 1ZOLA 3HP6A 2AJQA 1X66A 5AM0A 4Y2RA 5ALLA 3PZPA 4DSJA 3SMVA 1S8OA 2KHQA 3AEVA 1IM4A 3N7SC 5HHHA 2KD1A 3BQ0A 5DDYA 4JV2A 1U47A 1B22A 2KOBA 2ZG6A 3MGHA 2HHQA 1XO1A 2KN7A 9ICRA 2J6TA 3NVYA 3C21A 5DDMA 1S0MA 1TE2A 5J2IA 5J2JA 3KZXA 2C2DA 1NNLA 2GH1A 4K4IA 3H8WA 2Q0ZX 3BJYA 3UPQA 1ZQLA 4JV1A 3RR8A 4ECZA 1K1QA 3F53A 5DBAA 2IOHA 3L3FX 2DKZA 4PJ0U 4PH5A 1FEZA 5ALKA 4C4TA 5AI6A 4UARA 5KFKA 3UXOA 5EE3A 3RAXA 2DL0A 3EPIA 5AKXA 2R8HA 3GQCA 5EE0A 3AL0B 1FFUA 2Z7JA 3PMLA 1U4BA 1X9MA 5K4LA 2HHUA 4JK1A 2E5SA 2KE7A 3H4BA 3SV3A 2W03A 2C28A 3ZDCA 1S77D 2VJ4A 2KZ3A 5GTIU 2HHXA 2KSOB 4KLLA 5KG0A 4RNMA 1X42A 4XUSA 2ATLA 5AIAA 4F72A 1SB3C 1S0OA 4F5RA 3IRUA 5GTHU 5KFWA 3HPOA 2ZJ8A 4QWEA 3PNCA 1JX4A 2O6KA 3ICXA 4DOCA 1Z00A 4PL2A 2ASDA 5AKZA 2V9WA 1ZQ1C 5AKKA 1SIJA 1BNPA 1VJ5A 4JV0A 4I2CA 4IRDA 3T3FA 2F2AB 2G06A 1SGGA 1ZQPA 5J0RA 3S6JA 3QE9Y 3HWTA 1Z4OA 4F3OA 1NK5A 2HHVA 5BOLA 5EWFA 2W9MA 4ECSA 3C2LA 4ELUA 4MF8A 3BZKA 4BGDA 1JIHA 4PHDA 5KL1B 4J03A 4M9JA 5ALUA 5KFLA 2M9NA 3Q8MA 2FJ6A 5KG3A 2AGQA 1EXNA 5EOZA 3ONNA 1NOMA 1LV5A 4US8A 4OJLA 3LVVA 3AUOA 3GIKA 4RPZA 4U6PA 2MU2A 2EZYA 5KT4A 5J2FA 4QZIA 3I1YA 3RF9A 2VA8A 4I2GA 1UT5A 4KLUA 1SL2A 4I28A 5AM5A 4M0AA 1MQ3A 3ETLA 4AYBF 1WG8A 1ZQBA 1N56A 5AI8A 1JROA 4KN7A 3MR5A 2FE9A 4TUPA 2FLNA 5AICA 3C1YA 8ICXA 4YP3A 3OSPA 3GV7B 2JEFA 5TZVA 2ASLA 4M47A 4QZFA 1F5SA 4NLBA 3EYZA 4TQRA 3WK8A 2Y0SC 4BX9C 5J2HA 4K4GA 3AM9A 3HX0A 1ZQFA 3IM1A 2HHTA 3ETRA 9ICAA 5EE1A 1UQVA 2G09A 4LJXA 1L7MA 5BPCA 4O9MA 3KBBA 2B6GA 4P0QB 3KFUF 3UQ2A 3ZD8A 5J0OA 5AI4A 4P0QA 1A77A 4NWIA 3PW2A 3I76A 4IR1A 1Q8KA 2XIDA 2FLLA 2BCUA 4C7ZA 4DFKA 4ICAA 2GWSA 3F2CA 3AU6A 1BGXT 2C2EA 4EENA 3JPNA 5ALGA 3M8SA 3C5GA 5ALHA 4EEYA 4UBCA 1MA7A 4IQVA 1ZQNA 5DBCA 4DQRA 1ZD2P 3N7RC 4ECVA 3PMNA 5KFUA 3A0BU 4YMMA 7ICHA 2NRXA 4RQ8A 4MHVA 3M6ZA 5HP4A 5DQHA 4DS5A 4F5QA 4US9A 4DF4A 1ZJNA 2PI4A 2DBYA 4QJFB 2RDIA 3K1ZA 2JMGA 5KFTA 8ICWA 5IINA 2R8GA 4ELVA 2RRDA 3NRWA 4RQ2A 2P66A 2F8LA 3D6JA 1ZXIA 1WWVA 4EZ9A 4O3SA 4I2AA 4KLGA 1F0MA 1BVSA 9ICMA 4IL6U 1PZNA 4UB2A 3N4MB 2PFNA 1X9XA 1V97A 5ALWA 2BCQA 1NJWA 2YB1A 1ZQXA 5KFSA 3CYMA 2JV3A 2L5YA 3K1RB 3QEBZ 5EWEA 4DS4A 2UVWA 3R9KA 9ICKA 3AQEA 2W04A 2LYBA 3EW9A 1OW5A 2NO5A 4UB6U 4YD1A 4F4ZA 4B9TA 4YR2A 4NY8A 2YY6A 4JMUA 1ZQMA 4UB8U 5AK5A 3M1YA 4UB5A 4Q43A 4KX5A 1DXSA 7ICEA 2DKXA 4Y2SA 4O3RA 7ICIA 5CWRA 2K8AA 5KFEA 4B6JA 4RUAA 3IG8A 3E58A 1Z1BA 5HMLA 9ICFA 5AKYA 1L7NA 3WK7A 4J9PA 4C0ZA 1KFDA 2MAXA 3O0FA 3C5FA 3RB3A 4B9NA 5F9NA 1Z1VA 4KITB 4RUCA 5F3XB 3EUB2 1N60A 4PPXA 3TKAA 4Q44A 4CE6A 4O3QA 1LKYA 5JTIA 4KLJA 7ICFA 7ICQA 7ICVA 4MFFA 4KTQA 2P35A 3C23A 2EQYA 1MSWD 7ICLA 4I2EA 5AHXA 2AH5A 9ICLA 2BR0A 1DOQA 5J2EA 1BPZA 2OYYA 3RRHA 4FBUA 1HEKA 2E8MA 1NKCA 3PO5A 4GXIA 1TAUA 8ICVA 4RQNA 5J8YC 5KNIA 4RZRA 2HHWA 2AHOB 2LI6A 1Q46A 3PSIA 4BWJA 5IIJA 4RQ3A 1NZBA 2R8IA 1ZQQA 3AQFA 3BS7A 3KTQA 4OJ6A 4R8UB 3ZDEA 2I6XA 4WJ3B 1T3NA 3WK6A 2JH7A 9ICTA 1MN8A 1DGSA 4C8MA 3G6VA 4DQSA 5CRXA 1SL1A 4R8UA 1VLBA 4GXKA 3PX6A 1TKDA 2BGWA 5AIBA 3ED5A 5E79U 4PHEA 3PW0A 4IS7A 3RJKA 5KAIU 4ELTA 5DKWA 4KMOB 1T7PA 2I9GA 5AI5A 1DK2A 2K89A 4DL6A 3JPRA 4YVZA 9ICXA 2HI0A 3HW8A 2LM4A 4GFJA 5DGAA 3A0HU 1D8LA 2GOLA 2WHEA 4F5PA 1QLNA 2KK0A 5AK4A 3IHQB 9ICUA 4KLHA 4MFAA 4MEYA 5L1KA 2AGPA 3B9JA 3TFRA 1RQLA 4FZNA 8ICPA 3CP8A 3RJGA 4O3PA 1ZQEA 2CPRA 2WF8A 1ECWA 1T94A 2UVRA 2BZFA 2H3QA 4EELA 3WKAA 2JEGA 4P4MA 4R64A 2F44A 3EPGA 2OEHA 2W8LA 4JB3A 1WCNA 1RXVA 3RJIA 4QZAA 3SI8A 3V6KA 2H5XA 5D4BA 4J9KA 8ICUA 4QWDA 3C28A 5J0QA 3RH6A 2RQ5A 4IQUA 3HJEA 3TACB 2KFZA 3FC4A 1L7OA 5DG9A 5ALEA 1T8EA 4F2SA 5DQGA 3TARA 2ASJA 3D2SA 4E0DA 2IOFA 3GU3A 3PW7A 7ICSA 2VA3A 4PGYA 1B0XA 4OCZA 1ZQYA 7ICNA 1BPXA 2R8KA 1QCKA 4NLNA 1UHUA 3UMBA 1WCLA 4YN4A 2I1QA 4FZLA 4ECWA 2ZIXB 2C2RA 1ZYQA 1NJXA 3WK5A 2H3ZA 5ALNA 4EZ6A 4EBEA 4DFJA 3BDPA 3F2BA 3DEEA 5DB7A 2ZIXA 4EBDA 3QU5A 1ZETA 4I2BA 5J0SA 3RB0A 5KFZA 4RNOA 2BCSA 4G9BA 1ZQWA 2DPJA 2ALZA 2EANA 2KFNA 1PVQA 4GXJA 3RBDA 1QSLA 1BPEA 5KG7A 4AP9A 3QNMA 4KLOA 3RTVA 1B43A 5IIMA 4ED2A 3JPPA 3LYSA 3NVWA 2M0NA 3MABA 2G0AA 3MBYA 2EAMA 4MFCA 3Q8SB 1QQ5A 4NV0A 1U48A 2XCPA 4DL7A 5DQIA 5KG5A 2JR5A 3M8RA 4B9MA 1SZPA 1AQ6A 2FMPA 9ICEA 4UAZA 2FPMA 4O3OA 1L7PA 1ZQHA 8ICHA 4F4KA 1TK0A 3NASA 2F1HA 2Y9UA 4RQ0A 3V7JA 3UQ0A 2NRWA 4QW8A 5L9XA 4ED0A 4QWAA 1NK9A 4J9QA 4YMOA 3V6HA 8ICZA 3M9MB 1A0PA 4F2RA 2MRLA 3GDXA 4F50A 3QX7A 1TK5A 2NV3A 3RJJA 1HUOA 2ZTCA 2IBKA 2NO4A 4YFKA 3PSTA 1RYUA 3J81j 4KLEA
chains in the Genus database with same CATH topology
1UQVA 3TADC 4IS7A 5L1MA 2B6GA 1LKYB 2K4PA 3KKAA 2KSOA 3HILA 2QKQA 1SXDA 1SGGA 1SV4A 1DXSA 2E8NA 2DKXA 5J8YA 3BS5B 1WWUA 2Y9TA 2K60A 3TADA 2QB1A 1UCVA 2LMRA 2E8PA 3BS5A 2DKZA 4PZOA 1Z1VA 1RG6A 2D8CA 3SEIA 5F3XB 1OXJA 2KMDA 5JU5A 1KW4A 2EANA 2DL0A 1PK3A 4RQMA 3IDWA 2EAPA 4PZNA 2GLEA 1JI7A 1LKYA 2EAOA 5JRTA 5JTIA 2E8OA 2LPEA 2D3DA 1X40A 2EAMA 4MHVA 2KE7A 2KIVA 2F44A 2E8MA 3H8MA 1PK1B 1SV0C 2ES6A 4RQNA 2Y9UA 2FE9A 5J8YC 2KSOB 5KNIA 4NL9C 2QARB 2KG5A 1V85A 2YTUA 1PK1A 1WWVA 4NJ8A 3SENA 3TACB 1V38A 2ESEA 3BS7A 1F0MA 1SXEA 1SV0A 1X66A 2QARA 3BQ7A 2QB0B 2F8KA 1X9XA 1B4FA 4NL9A 2JV3A 3K1RB 2L5YA 3KKAC 1COKA 2QB0A 2F3NA 1B0XA 1OW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UQV A;  3TAD C;  4IS7 A;  5L1M A;  2B6G A;  1LKY B;  2K4P A;  3KKA A;  2KSO A;  3HIL A;  2QKQ A;  1SXD A;  1SGG A;  1SV4 A;  1DXS A;  2E8N A;  2DKX A;  5J8Y A;  3BS5 B;  1WWU A;  2Y9T A;  2K60 A;  3TAD A;  2QB1 A;  1UCV A;  2LMR A;  2E8P A;  3BS5 A;  2DKZ A;  4PZO A;  1Z1V A;  1RG6 A;  2D8C A;  3SEI A;  5F3X B;  1OXJ A;  2KMD A;  5JU5 A;  1KW4 A;  2EAN A;  2DL0 A;  1PK3 A;  4RQM A;  3IDW A;  2EAP A;  4PZN A;  2GLE A;  1JI7 A;  1LKY A;  2EAO A;  5JRT A;  5JTI A;  2E8O A;  2LPE A;  2D3D A;  1X40 A;  2EAM A;  4MHV A;  2KE7 A;  2KIV A;  2F44 A;  2E8M A;  3H8M A;  1PK1 B;  1SV0 C;  2ES6 A;  4RQN A;  2Y9U A;  2FE9 A;  5J8Y C;  2KSO B;  5KNI A;  4NL9 C;  2QAR B;  2KG5 A;  1V85 A;  2YTU A;  1PK1 A;  1WWV A;  4NJ8 A;  3SEN A;  3TAC B;  1V38 A;  2ESE A;  3BS7 A;  1F0M A;  1SXE A;  1SV0 A;  1X66 A;  2QAR A;  3BQ7 A;  2QB0 B;  2F8K A;  1X9X A;  1B4F A;  4NL9 A;  2JV3 A;  3K1R B;  2L5Y A;  3KKA C;  1COK A;  2QB0 A;  2F3N A;  1B0X A;  1OW5 A; 
#chains in the Genus database with same CATH topology
 1JMS A;  2WF9 A;  4J9L A;  1ZQV A;  4CF5 A;  3JPT A;  5J2K A;  4GC7 A;  2KSO A;  3UXN A;  4R65 A;  3RAQ A;  3RJE A;  2Y0S F;  5KFF A;  4MF2 A;  4NLG A;  8ICC A;  2ISO A;  1YT3 A;  4O5K A;  4OO1 J;  5TIS U;  2P6R A;  4Y2V A;  4IC9 A;  1MC8 A;  2EDU A;  5JUM A;  3Q8L A;  3T5J A;  4DLG A;  8ICB A;  2DF4 B;  2WFA A;  4Z6F A;  2HBL A;  4R66 A;  3RRG A;  2F1J A;  3L5K A;  5AKH A;  4RQ7 A;  3GFK B;  1OXJ A;  8ICE A;  5AKL A;  2VKQ A;  5KFO A;  3IDW A;  1S76 D;  4DOB A;  1S0N A;  1LVH A;  8ICQ A;  1D8Y A;  1UPH A;  2CXY A;  2DQN B;  2LYH A;  2K4I A;  4DO9 A;  5F9L A;  1JAL A;  8ICG A;  5CP2 A;  1Q3V A;  9ICS A;  4O5E A;  4IRK A;  3PSP A;  4OJP A;  4DL5 A;  2JZB B;  3QU7 A;  1ZQS A;  3H8M A;  4YD2 A;  4FFD A;  1SV0 C;  5J0X A;  2IOF K;  3MDA A;  2JZB A;  4ECU A;  3RFA A;  2FDR A;  2KG5 A;  2Q4T A;  2PFO A;  9ICN A;  4EX7 A;  4YCX A;  4ECY A;  1ZQU A;  7ICP A;  2VA2 A;  1ED1 A;  3D2Q A;  5DB8 A;  2XI9 A;  3U26 A;  3H4D A;  3GV8 B;  4HAI A;  1JUD A;  4J9R A;  4RT2 A;  4RQ5 A;  2JXJ A;  3NUQ A;  4DQQ A;  3TAQ A;  1KRP A;  2JHD A;  4RU9 A;  2ZIV B;  2KZZ A;  3PR5 B;  3TAD C;  5DLF A;  3SD7 A;  3PY8 A;  2WB1 F;  3SAH A;  3HIL A;  2HVH A;  4DCC A;  3QUT A;  4QZE A;  3T5K A;  4RPX A;  4RT3 A;  4XRH A;  1BNO A;  3AU2 A;  4CF4 A;  1SWV A;  2K8B B;  4FS1 A;  4EBC A;  5T14 A;  1ZQO A;  1SL0 A;  5D46 A;  2EH9 A;  4PZO A;  1U45 A;  3BQ2 A;  1H38 A;  1FIQ A;  4RQ1 A;  5L1L A;  4CF3 A;  4DL2 A;  9ICC A;  1A76 A;  4DEZ A;  4PZN A;  2BQU A;  5KFH A;  2BPG A;  3WU2 U;  2BDP A;  1HUZ A;  2HBM A;  4Y2J A;  2OHF A;  2VJ5 A;  1HJP A;  1ZRM A;  8ICI A;  1XU4 A;  1N61 A;  2W9C B;  9ICH A;  3AN1 A;  3OGU A;  5EWG A;  1ZQA A;  1O03 A;  3N97 B;  4KLI A;  1C7Y A;  8ICS A;  4F5N A;  1QSS A;  2JH1 A;  4TUR A;  4KLT A;  2W9C A;  4HYK A;  2RDJ A;  1C20 A;  3B0Y A;  1KL9 A;  8ICN A;  5ALX A;  4DSE A;  3MGI A;  2IA6 A;  5KT7 A;  3EZ5 A;  4ECR A;  3Q8R B;  1JXE A;  2KVC A;  3SQI A;  2FI1 A;  1NJZ A;  5KT6 A;  2A1J B;  1Z19 A;  4Q8E A;  4BJQ A;  1JN3 A;  2B0C A;  5DB6 A;  2PMZ F;  1TK8 A;  4ED8 A;  8ICY A;  3V7K A;  1ZQD A;  4RQ6 A;  2F76 X;  4F93 B;  1YZ6 A;  5CB1 A;  1KFT A;  4F4W A;  1L8L A;  2ZIU B;  3IG5 A;  4QWC A;  1KTQ A;  5ALP A;  2ZIU A;  5ALY A;  2WB1 C;  4PGX A;  5KFG A;  2XVT A;  2ZXI A;  3MR3 A;  3T79 A;  4A8E A;  4DLE A;  2H3V A;  3F5A A;  4YG2 A;  3M9N B;  3OTQ A;  2UVV A;  4ED7 A;  3NS1 A;  2IMW P;  4I2F A;  4C8O A;  1J2N A;  3PO4 A;  4UBB A;  4KLM A;  1RG6 A;  3TFS A;  5ALZ A;  1NJY A;  2RHF A;  5J29 A;  2HVI A;  1JRP A;  9ICI A;  3NTU A;  2YN4 A;  1WYG A;  5AI9 A;  1KW4 A;  4RQM A;  5HMM A;  2GLE A;  4QZG A;  4GIB A;  1DGJ A;  3F5E A;  5KFQ A;  3ZDD A;  1U9L A;  2A3V A;  2ZTE A;  2D3D A;  2KJ9 A;  2ISP A;  1QQ6 A;  2BHN A;  5DGB A;  1D9D A;  5J2D A;  2N1R A;  2CRX A;  1T4G A;  1MQ2 A;  3AMZ A;  4LZD A;  3RJH A;  1HIW A;  5KFY A;  5A0L A;  5HR7 A;  3H8J A;  3KHG A;  5CR0 A;  3UMC A;  1XNS A;  3G6Y A;  2YTU A;  1Z3E B;  3IP4 B;  4EX6 A;  1K5O A;  3C2M A;  5D49 A;  1RPL A;  5KG1 A;  3SEN A;  1Z4N A;  4BWM A;  3BZC A;  1D9F A;  4I27 A;  1SV0 A;  3GV5 B;  3KHR A;  3ORY A;  4YQW A;  3KHL A;  3KKA C;  2PMZ C;  2ZXH A;  2EZZ A;  3NVZ A;  4QZ8 A;  5HR6 A;  1ZRN A;  5AM3 A;  3UMG A;  2G08 A;  4CNQ A;  1RZT A;  4I2I A;  4Y2Q A;  5III A;  5B5E U;  2XC9 A;  4JWM A;  2WF5 A;  2MA1 A;  2AXT U;  3GIM A;  4UAW A;  4CRX A;  2YX8 A;  1UA1 A;  1NK0 A;  1A6S A;  1X2I A;  2WAQ C;  4Q8F A;  1L3U A;  3TAD A;  5AKG A;  2QB1 A;  1BPB A;  3Q8Q B;  1KLN A;  8ICK A;  1XS9 D;  3N28 A;  4ACO A;  9ICP A;  2ZUD A;  4J9M A;  4M9L A;  2W8K A;  3E2E A;  4FE3 A;  1ARO P;  9ICV A;  9ICB A;  2ZUB A;  4ECX A;  3MFI A;  2W43 A;  4EEK A;  4ED3 A;  1PUZ A;  4FS2 A;  5JRT A;  3TQ1 A;  8ICT A;  4USA A;  3PX0 A;  1XSL A;  4ZOH C;  4J9O A;  2FPK A;  3TI0 A;  2FMS A;  3PV8 A;  3H0L B;  2W9A A;  3ZDA A;  4QZH A;  4LVS A;  1X9S A;  3T5L A;  5KFB A;  1IIP A;  3UM9 A;  4RNN A;  4YXJ A;  5AKJ A;  5KT3 A;  4BDP A;  4CDG A;  1ZD3 A;  5KFP A;  2ODG A;  4P4O A;  4YR3 A;  3F2D A;  2KZM A;  5KFN A;  4NL9 C;  1ZD4 A;  3KD3 A;  2KNJ A;  5DBB A;  1PVP A;  4KLF A;  3WKC A;  7ICJ A;  2A19 A;  4UQG A;  3SAF A;  3SR6 A;  4DL3 A;  1S10 A;  3RH4 A;  1L6N A;  2QB0 B;  2KJ5 A;  2I5H A;  4IQW A;  2PFP A;  5ALT A;  3WK9 A;  1KEJ A;  3ZDB A;  2WTF A;  2R8J A;  1KBU A;  3HRD D;  4UAS A;  3LWL A;  2FPL A;  2QB0 A;  2OXO A;  5ALR A;  1N62 A;  4CGZ A;  3FAH A;  2W7P A;  2ZUC A;  3TAN A;  5KFD A;  2W9B B;  1SKR A;  3WKB A;  1ZQC A;  1WUD A;  4UAT A;  2XY5 A;  1NK7 A;  5AI0 A;  2QKQ A;  5KT5 A;  3SV4 A;  2W9B A;  2V4R A;  3RB6 A;  4EYI B;  2A1A A;  1CUK A;  1WWU A;  3ISC A;  3M6K A;  3WKD A;  1KQQ A;  3MR2 A;  1N2X A;  3LVW A;  1X6I A;  4F8R A;  2C22 A;  5AKI A;  3V6J A;  2E1F A;  5AM1 A;  4P0P B;  1YZ7 A;  2D8C A;  1SKW A;  4Z6C A;  1Q3U A;  1S9F A;  9ICW A;  4UAY A;  4GC6 A;  7ICR A;  2KP7 A;  3PSF A;  4DSI A;  5JU5 A;  2ZJ5 A;  4P0P A;  5AK3 A;  3JPS A;  3BQ1 A;  5ALQ A;  2DGZ A;  2BPC A;  4F4Y A;  2LPE A;  3CW2 C;  1UA0 A;  4Y2T A;  1IG6 A;  5AKE A;  4Q45 A;  2YMQ A;  1ZQR A;  3QUB A;  4NLK A;  2BKE A;  4IR9 A;  5AM4 A;  4CCH A;  5KAF U;  1S97 A;  1ZQZ A;  3PW5 A;  1QTM A;  4YXM A;  2LHT A;  3VCB A;  4P4P A;  3KHH A;  2Y1I A;  2ZIW B;  3MR6 A;  1KDH A;  4NJ8 A;  2KV2 A;  4M9G A;  5ALD A;  1X9W A;  1LB2 B;  2LKY A;  4GLX A;  2ZIW A;  1M6Y A;  3FDS A;  3H0R B;  5EE9 A;  5L1I A;  2DWQ A;  4ZH4 A;  2ZJA A;  4O3M A;  4PHP A;  2YML A;  2W11 A;  3K75 D;  5KL8 B;  5G5H A;  3QU2 A;  2XCA A;  3C2K A;  3LDA A;  5IIL A;  5J0T A;  4ED1 A;  2K4P A;  3KKA A;  5CA7 A;  1SXD A;  1ZJM A;  3K4G A;  7ICG A;  1U49 A;  1N5X A;  5J8Y A;  5DLG A;  2CN1 A;  2Y9T A;  2YMM A;  2K60 A;  4QIW C;  5KFI A;  1UCV A;  2AQ0 A;  4DQP A;  4UB3 A;  1Y88 A;  2DFL A;  5L1J A;  5ALM A;  4R63 A;  5ALF A;  3LK9 A;  1PK3 A;  2HW3 A;  4O5C A;  8ICL A;  3SAG A;  1ZD5 A;  1UT8 A;  3SYZ A;  5ALS A;  1XWL A;  2XY6 A;  2K8C B;  2RLT A;  4FO6 A;  2VIX A;  1BPY A;  4KLS A;  4C80 A;  2DPI A;  1PVR A;  4P2H A;  2BCR A;  1Z00 B;  4QZ9 A;  3Q8K A;  5C0Y A;  2ES6 A;  4ED6 A;  3QYP A;  5G5G A;  5KFC A;  3WKE A;  4I2H A;  1KFS A;  1XSP A;  3H7I A;  1V85 A;  4RQ4 A;  2KJ8 A;  3RBE A;  4QW9 A;  2K4H A;  3OPX A;  3B0X A;  3JPQ A;  3QZ8 A;  2V4Q A;  4NL9 A;  2HCF A;  4NXZ A;  3DDH A;  1L3T A;  2F3N A;  4JUZ A;  1RYR A;  3IN5 A;  2KIC A;  5H2F U;  4B9V A;  5KG2 A;  2HOI A;  1NI3 A;  5L1M A;  1SKS A;  3RR7 A;  4DQI A;  5J0U A;  3BQT A;  2ZTD A;  2UVU A;  4DFD A;  1SV4 A;  2F77 X;  2MSN A;  3ISB A;  7ICO A;  1D8B A;  3JPO A;  2MUT B;  4QNL A;  4F4X A;  4OD0 A;  2HMX A;  3QZ7 A;  4QWB A;  4RPY A;  3SEI A;  1RYS A;  2MUT A;  2HBK A;  2ZIV A;  5KFR A;  4UB4 A;  3OSN A;  2FLP A;  2VAN A;  1QSY A;  4Y2U A;  5KG6 A;  3KOO A;  2EAP A;  5KFJ A;  1VDV A;  5KT2 A;  3GII A;  4NM2 A;  2W3R A;  4Z6E A;  4Y2X A;  2E3T A;  3OJU A;  4PHA A;  4OJ5 A;  2KKP A;  4NLC A;  1CI4 A;  2G07 A;  2NYV A;  1N63 A;  1NZP A;  5DG8 A;  1SZH A;  3H8S A;  1XC9 A;  5KFA A;  4M9H A;  2G5I B;  4UB1 A;  3FM9 A;  4I2J A;  3MDC A;  4DF8 A;  4DSF A;  5HHI A;  3OHA A;  2XGP A;  4I29 A;  5J2B A;  4IRC A;  3I28 A;  3OJS A;  1RXW A;  1RM6 C;  1V38 A;  3Q8P B;  2W7O A;  4DSL A;  2ESE A;  4NLZ A;  3MFH A;  1SXE A;  1P7D A;  3NGD A;  3BQ7 A;  4DFM A;  4BXO B;  2XY7 A;  4M6W B;  2XGQ A;  1TAM A;  1B4F A;  2BPF A;  2W54 A;  3GZF A;  2KTQ A;  5J0Y A;  2HHS A;  4BXO A;  2OCE A;  4M6W A;  5KFM A;  2BQ3 A;  4M04 A;  3THV A;  3PX4 A;  1BPD A;  2BDU A;  4X5V A;  4B9S A;  3QU4 A;  1X6J A;  1FO4 A;  5ALV A;  2OM6 A;  2BCV A;  3BS5 B;  2A1J A;  3QU9 A;  4M9N A;  2XIC A;  8ICM A;  7ICU A;  1L3S A;  2E8P A;  2KIW A;  4XQ8 A;  2QLT A;  3BS5 A;  8ICA A;  2BQR A;  4B9L A;  1TAQ A;  3M9O B;  4F92 B;  4C8L A;  4K4H A;  4KX3 A;  9ICO A;  4PGQ A;  5J2A A;  4OJO A;  4IQT A;  7ICT A;  4AYB C;  2WAQ F;  4F91 B;  3FYH A;  4UAU A;  1TFR A;  2H3I A;  3QXG A;  1QH9 A;  1IV8 A;  1JXL A;  3RH5 A;  2FMQ A;  2NRZ A;  2OH2 A;  1COO A;  4YR0 A;  2AQ4 A;  9ICQ A;  5BOM A;  3UXP A;  4LZG A;  5IIO A;  2D6F C;  3M7D A;  3QUC A;  2NRT A;  1K1S A;  3NVV A;  4DSK A;  4KMU A;  2KIV A;  3PR4 A;  2HOF A;  3E0F A;  5KTQ A;  3WK4 A;  4PL1 A;  3VC8 A;  1T3Q A;  4DOA A;  1N48 A;  3ZI4 A;  4DWI A;  2QAR B;  2HDO A;  5CEH A;  5HNK A;  4KN4 A;  1XO0 A;  4F71 A;  2NRV A;  2F1I A;  3RB4 A;  2QAR A;  2F8K A;  4I2D A;  3ISD A;  3TAP A;  4M2Y A;  2AU0 A;  1NK8 A;  2H3F A;  3IV6 A;  1COK A;  3V72 A;  1N5W A;  1J97 A;  2PI5 A;  3ALR A;  1ZQI A;  4MEX A;  2YB4 A;  1IXR A;  4C4S A;  2YQE A;  2LBO A;  1CEZ A;  2DUY A;  4O0I A;  1GO3 F;  2YMP A;  2HBJ A;  1LKY B;  5J0W A;  8ICR A;  5J2C A;  4FBT A;  1NKB A;  4U7C A;  7ICM A;  4JWN A;  3HKZ F;  3G6X A;  3KZI U;  1URJ A;  4QZD A;  4J9N A;  2LMR A;  4TUQ A;  4YMN A;  2P6U A;  5ALO A;  1SWW A;  2RP5 A;  2KHV A;  2WF7 A;  4QZC A;  9ICJ A;  5ALJ A;  1TVA A;  5DB9 A;  1NK4 A;  1L8O A;  2JEI A;  2KMD A;  2JGA A;  3N7P D;  4BUG A;  1NK6 A;  4ECQ A;  1ZQG A;  1JI7 A;  3DV9 A;  2KVS A;  1RQN A;  2J6S A;  5AM2 A;  5B66 U;  3MGV A;  1V9P A;  3OHB A;  1J2M A;  4C8N A;  9ICG A;  3CNH A;  8ICF A;  2HSZ A;  3PVX A;  4B9U A;  2PXI A;  1OUQ A;  1DK3 A;  4XA5 A;  2W3S A;  1KKX A;  3NRZ A;  4TQS A;  5C5J A;  4Z6D A;  2JRZ A;  2PFQ A;  4J9S A;  2K4E A;  1ZQK A;  2LYA A;  3HT3 A;  3GIJ A;  1CRX A;  4ECT A;  4KLQ A;  4C4R A;  5KFX A;  1S0V A;  2HOQ A;  3RJF A;  4C8K A;  5IIK A;  2Y1J A;  5CHG A;  4NM1 A;  2XO7 A;  2J6U A;  4G3I A;  2JEJ A;  4DFP A;  1KSP A;  4F5O A;  4O3N A;  4Y2P A;  1L5U A;  3QEA Z;  3V7L A;  1RDF A;  3H0M B;  5FP0 A;  3ZD9 A;  2GO7 A;  1ZQJ A;  5AK6 A;  2E8N A;  1NKE A;  5ALI A;  3CRX A;  2R18 A;  3HKZ C;  2W55 A;  4TUS A;  4Y2Y A;  5J0P A;  1KN5 A;  4EYH B;  1TV9 A;  3MC1 A;  4UAV A;  1ZQT A;  2AGO A;  3L4P A;  1FFV A;  3D2N A;  2WF6 A;  4DL4 A;  2IHM A;  4QIW F;  2EAO A;  3C1Z A;  2E8O A;  1L3V A;  3T5H A;  4FZM A;  5CJ7 A;  4KLD A;  3LWM A;  2LM1 A;  1QQ7 A;  2KKV A;  1S5L U;  1X40 A;  5DG7 A;  2B21 A;  2IHN A;  3PW4 A;  2E1E A;  2G5H B;  3H40 A;  1DRG A;  3EWA A;  2EZX A;  3SZ2 A;  8ICJ A;  3GIL A;  1O08 A;  8ICO A;  4C7Y A;  1F44 A;  5J2G A;  5KFV A;  1PK1 B;  3QUQ A;  2PKE A;  2KEY A;  2OWO A;  1XSN A;  7ICK A;  5KG4 A;  1PK1 A;  4QZB A;  3C29 A;  4UW9 A;  1ZOL A;  3HP6 A;  2AJQ A;  1X66 A;  5AM0 A;  4Y2R A;  5ALL A;  3PZP A;  4DSJ A;  3SMV A;  1S8O A;  2KHQ A;  3AEV A;  1IM4 A;  3N7S C;  5HHH A;  2KD1 A;  3BQ0 A;  5DDY A;  4JV2 A;  1U47 A;  1B22 A;  2KOB A;  2ZG6 A;  3MGH A;  2HHQ A;  1XO1 A;  2KN7 A;  9ICR A;  2J6T A;  3NVY A;  3C21 A;  5DDM A;  1S0M A;  1TE2 A;  5J2I A;  5J2J A;  3KZX A;  2C2D A;  1NNL A;  2GH1 A;  4K4I A;  3H8W A;  2Q0Z X;  3BJY A;  3UPQ A;  1ZQL A;  4JV1 A;  3RR8 A;  4ECZ A;  1K1Q A;  3F53 A;  5DBA A;  2IOH A;  3L3F X;  2DKZ A;  4PJ0 U;  4PH5 A;  1FEZ A;  5ALK A;  4C4T A;  5AI6 A;  4UAR A;  5KFK A;  3UXO A;  5EE3 A;  3RAX A;  2DL0 A;  3EPI A;  5AKX A;  2R8H A;  3GQC A;  5EE0 A;  3AL0 B;  1FFU A;  2Z7J A;  3PML A;  1U4B A;  1X9M A;  5K4L A;  2HHU A;  4JK1 A;  2E5S A;  2KE7 A;  3H4B A;  3SV3 A;  2W03 A;  2C28 A;  3ZDC A;  1S77 D;  2VJ4 A;  2KZ3 A;  5GTI U;  2HHX A;  2KSO B;  4KLL A;  5KG0 A;  4RNM A;  1X42 A;  4XUS A;  2ATL A;  5AIA A;  4F72 A;  1SB3 C;  1S0O A;  4F5R A;  3IRU A;  5GTH U;  5KFW A;  3HPO A;  2ZJ8 A;  4QWE A;  3PNC A;  1JX4 A;  2O6K A;  3ICX A;  4DOC A;  1Z00 A;  4PL2 A;  2ASD A;  5AKZ A;  2V9W A;  1ZQ1 C;  5AKK A;  1SIJ A;  1BNP A;  1VJ5 A;  4JV0 A;  4I2C A;  4IRD A;  3T3F A;  2F2A B;  2G06 A;  1SGG A;  1ZQP A;  5J0R A;  3S6J A;  3QE9 Y;  3HWT A;  1Z4O A;  4F3O A;  1NK5 A;  2HHV A;  5BOL A;  5EWF A;  2W9M A;  4ECS A;  3C2L A;  4ELU A;  4MF8 A;  3BZK A;  4BGD A;  1JIH A;  4PHD A;  5KL1 B;  4J03 A;  4M9J A;  5ALU A;  5KFL A;  2M9N A;  3Q8M A;  2FJ6 A;  5KG3 A;  2AGQ A;  1EXN A;  5EOZ A;  3ONN A;  1NOM A;  1LV5 A;  4US8 A;  4OJL A;  3LVV A;  3AUO A;  3GIK A;  4RPZ A;  4U6P A;  2MU2 A;  2EZY A;  5KT4 A;  5J2F A;  4QZI A;  3I1Y A;  3RF9 A;  2VA8 A;  4I2G A;  1UT5 A;  4KLU A;  1SL2 A;  4I28 A;  5AM5 A;  4M0A A;  1MQ3 A;  3ETL A;  4AYB F;  1WG8 A;  1ZQB A;  1N56 A;  5AI8 A;  1JRO A;  4KN7 A;  3MR5 A;  2FE9 A;  4TUP A;  2FLN A;  5AIC A;  3C1Y A;  8ICX A;  4YP3 A;  3OSP A;  3GV7 B;  2JEF A;  5TZV A;  2ASL A;  4M47 A;  4QZF A;  1F5S A;  4NLB A;  3EYZ A;  4TQR A;  3WK8 A;  2Y0S C;  4BX9 C;  5J2H A;  4K4G A;  3AM9 A;  3HX0 A;  1ZQF A;  3IM1 A;  2HHT A;  3ETR A;  9ICA A;  5EE1 A;  1UQV A;  2G09 A;  4LJX A;  1L7M A;  5BPC A;  4O9M A;  3KBB A;  2B6G A;  4P0Q B;  3KFU F;  3UQ2 A;  3ZD8 A;  5J0O A;  5AI4 A;  4P0Q A;  1A77 A;  4NWI A;  3PW2 A;  3I76 A;  4IR1 A;  1Q8K A;  2XID A;  2FLL A;  2BCU A;  4C7Z A;  4DFK A;  4ICA A;  2GWS A;  3F2C A;  3AU6 A;  1BGX T;  2C2E A;  4EEN A;  3JPN A;  5ALG A;  3M8S A;  3C5G A;  5ALH A;  4EEY A;  4UBC A;  1MA7 A;  4IQV A;  1ZQN A;  5DBC A;  4DQR A;  1ZD2 P;  3N7R C;  4ECV A;  3PMN A;  5KFU A;  3A0B U;  4YMM A;  7ICH A;  2NRX A;  4RQ8 A;  4MHV A;  3M6Z A;  5HP4 A;  5DQH A;  4DS5 A;  4F5Q A;  4US9 A;  4DF4 A;  1ZJN A;  2PI4 A;  2DBY A;  4QJF B;  2RDI A;  3K1Z A;  2JMG A;  5KFT A;  8ICW A;  5IIN A;  2R8G A;  4ELV A;  2RRD A;  3NRW A;  4RQ2 A;  2P66 A;  2F8L A;  3D6J A;  1ZXI A;  1WWV A;  4EZ9 A;  4O3S A;  4I2A A;  4KLG A;  1F0M A;  1BVS A;  9ICM A;  4IL6 U;  1PZN A;  4UB2 A;  3N4M B;  2PFN A;  1X9X A;  1V97 A;  5ALW A;  2BCQ A;  1NJW A;  2YB1 A;  1ZQX A;  5KFS A;  3CYM A;  2JV3 A;  2L5Y A;  3K1R B;  3QEB Z;  5EWE A;  4DS4 A;  2UVW A;  3R9K A;  9ICK A;  3AQE A;  2W04 A;  2LYB A;  3EW9 A;  1OW5 A;  2NO5 A;  4UB6 U;  4YD1 A;  4F4Z A;  4B9T A;  4YR2 A;  4NY8 A;  2YY6 A;  4JMU A;  1ZQM A;  4UB8 U;  5AK5 A;  3M1Y A;  4UB5 A;  4Q43 A;  4KX5 A;  1DXS A;  7ICE A;  2DKX A;  4Y2S A;  4O3R A;  7ICI A;  5CWR A;  2K8A A;  5KFE A;  4B6J A;  4RUA A;  3IG8 A;  3E58 A;  1Z1B A;  5HML A;  9ICF A;  5AKY A;  1L7N A;  3WK7 A;  4J9P A;  4C0Z A;  1KFD A;  2MAX A;  3O0F A;  3C5F A;  3RB3 A;  4B9N A;  5F9N A;  1Z1V A;  4KIT B;  4RUC A;  5F3X B;  3EUB 2;  1N60 A;  4PPX A;  3TKA A;  4Q44 A;  4CE6 A;  4O3Q A;  1LKY A;  5JTI A;  4KLJ A;  7ICF A;  7ICQ A;  7ICV A;  4MFF A;  4KTQ A;  2P35 A;  3C23 A;  2EQY A;  1MSW D;  7ICL A;  4I2E A;  5AHX A;  2AH5 A;  9ICL A;  2BR0 A;  1DOQ A;  5J2E A;  1BPZ A;  2OYY A;  3RRH A;  4FBU A;  1HEK A;  2E8M A;  1NKC A;  3PO5 A;  4GXI A;  1TAU A;  8ICV A;  4RQN A;  5J8Y C;  5KNI A;  4RZR A;  2HHW A;  2AHO B;  2LI6 A;  1Q46 A;  3PSI A;  4BWJ A;  5IIJ A;  4RQ3 A;  1NZB A;  2R8I A;  1ZQQ A;  3AQF A;  3BS7 A;  3KTQ A;  4OJ6 A;  4R8U B;  3ZDE A;  2I6X A;  4WJ3 B;  1T3N A;  3WK6 A;  2JH7 A;  9ICT A;  1MN8 A;  1DGS A;  4C8M A;  3G6V A;  4DQS A;  5CRX A;  1SL1 A;  4R8U A;  1VLB A;  4GXK A;  3PX6 A;  1TKD A;  2BGW A;  5AIB A;  3ED5 A;  5E79 U;  4PHE A;  3PW0 A;  4IS7 A;  3RJK A;  5KAI U;  4ELT A;  5DKW A;  4KMO B;  1T7P A;  2I9G A;  5AI5 A;  1DK2 A;  2K89 A;  4DL6 A;  3JPR A;  4YVZ A;  9ICX A;  2HI0 A;  3HW8 A;  2LM4 A;  4GFJ A;  5DGA A;  3A0H U;  1D8L A;  2GOL A;  2WHE A;  4F5P A;  1QLN A;  2KK0 A;  5AK4 A;  3IHQ B;  9ICU A;  4KLH A;  4MFA A;  4MEY A;  5L1K A;  2AGP A;  3B9J A;  3TFR A;  1RQL A;  4FZN A;  8ICP A;  3CP8 A;  3RJG A;  4O3P A;  1ZQE A;  2CPR A;  2WF8 A;  1ECW A;  1T94 A;  2UVR A;  2BZF A;  2H3Q A;  4EEL A;  3WKA A;  2JEG A;  4P4M A;  4R64 A;  2F44 A;  3EPG A;  2OEH A;  2W8L A;  4JB3 A;  1WCN A;  1RXV A;  3RJI A;  4QZA A;  3SI8 A;  3V6K A;  2H5X A;  5D4B A;  4J9K A;  8ICU A;  4QWD A;  3C28 A;  5J0Q A;  3RH6 A;  2RQ5 A;  4IQU A;  3HJE A;  3TAC B;  2KFZ A;  3FC4 A;  1L7O A;  5DG9 A;  5ALE A;  1T8E A;  4F2S A;  5DQG A;  3TAR A;  2ASJ A;  3D2S A;  4E0D A;  2IOF A;  3GU3 A;  3PW7 A;  7ICS A;  2VA3 A;  4PGY A;  1B0X A;  4OCZ A;  1ZQY A;  7ICN A;  1BPX A;  2R8K A;  1QCK A;  4NLN A;  1UHU A;  3UMB A;  1WCL A;  4YN4 A;  2I1Q A;  4FZL A;  4ECW A;  2ZIX B;  2C2R A;  1ZYQ A;  1NJX A;  3WK5 A;  2H3Z A;  5ALN A;  4EZ6 A;  4EBE A;  4DFJ A;  3BDP A;  3F2B A;  3DEE A;  5DB7 A;  2ZIX A;  4EBD A;  3QU5 A;  1ZET A;  4I2B A;  5J0S A;  3RB0 A;  5KFZ A;  4RNO A;  2BCS A;  4G9B A;  1ZQW A;  2DPJ A;  2ALZ A;  2EAN A;  2KFN A;  1PVQ A;  4GXJ A;  3RBD A;  1QSL A;  1BPE A;  5KG7 A;  4AP9 A;  3QNM A;  4KLO A;  3RTV A;  1B43 A;  5IIM A;  4ED2 A;  3JPP A;  3LYS A;  3NVW A;  2M0N A;  3MAB A;  2G0A A;  3MBY A;  2EAM A;  4MFC A;  3Q8S B;  1QQ5 A;  4NV0 A;  1U48 A;  2XCP A;  4DL7 A;  5DQI A;  5KG5 A;  2JR5 A;  3M8R A;  4B9M A;  1SZP A;  1AQ6 A;  2FMP A;  9ICE A;  4UAZ A;  2FPM A;  4O3O A;  1L7P A;  1ZQH A;  8ICH A;  4F4K A;  1TK0 A;  3NAS A;  2F1H A;  2Y9U A;  4RQ0 A;  3V7J A;  3UQ0 A;  2NRW A;  4QW8 A;  5L9X A;  4ED0 A;  4QWA A;  1NK9 A;  4J9Q A;  4YMO A;  3V6H A;  8ICZ A;  3M9M B;  1A0P A;  4F2R A;  2MRL A;  3GDX A;  4F50 A;  3QX7 A;  1TK5 A;  2NV3 A;  3RJJ A;  1HUO A;  2ZTC A;  2IBK A;  2NO4 A;  4YFK A;  3PST A;  1RYU A;  3J81 j;  4KLE A; 
#chains in the Genus database with same CATH homology
 1UQV A;  3TAD C;  4IS7 A;  5L1M A;  2B6G A;  1LKY B;  2K4P A;  3KKA A;  2KSO A;  3HIL A;  2QKQ A;  1SXD A;  1SGG A;  1SV4 A;  1DXS A;  2E8N A;  2DKX A;  5J8Y A;  3BS5 B;  1WWU A;  2Y9T A;  2K60 A;  3TAD A;  2QB1 A;  1UCV A;  2LMR A;  2E8P A;  3BS5 A;  2DKZ A;  4PZO A;  1Z1V A;  1RG6 A;  2D8C A;  3SEI A;  5F3X B;  1OXJ A;  2KMD A;  5JU5 A;  1KW4 A;  2EAN A;  2DL0 A;  1PK3 A;  4RQM A;  3IDW A;  2EAP A;  4PZN A;  2GLE A;  1JI7 A;  1LKY A;  2EAO A;  5JRT A;  5JTI A;  2E8O A;  2LPE A;  2D3D A;  1X40 A;  2EAM A;  4MHV A;  2KE7 A;  2KIV A;  2F44 A;  2E8M A;  3H8M A;  1PK1 B;  1SV0 C;  2ES6 A;  4RQN A;  2Y9U A;  2FE9 A;  5J8Y C;  2KSO B;  5KNI A;  4NL9 C;  2QAR B;  2KG5 A;  1V85 A;  2YTU A;  1PK1 A;  1WWV A;  4NJ8 A;  3SEN A;  3TAC B;  1V38 A;  2ESE A;  3BS7 A;  1F0M A;  1SXE A;  1SV0 A;  1X66 A;  2QAR A;  3BQ7 A;  2QB0 B;  2F8K A;  1X9X A;  1B4F A;  4NL9 A;  2JV3 A;  3K1R B;  2L5Y A;  3KKA C;  1COK A;  2QB0 A;  2F3N A;  1B0X A;  1OW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...