2K4PA

Solution structure of ship2-sam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
SGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2
publication title NMR Studies of a Heterotypic Sam-Sam Domain Association: The Interaction between the Lipid Phosphatase Ship2 and the EphA2 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 65
sequence length 65
ec nomenclature ec 3.1.3.86: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase.
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k4pA00
1F0MA 1V85A 5J8YC 2E8NA 3BS7A 2E8PA 2KIVA 2JV3A 3KKAC 5KNIA 2DL0A 2E8OA 1SV0C 2YTUA 1COKA 2KSOB 2KSOA 1RG6A 3HILA 4RQNA 5L1MA 5J8YA 2QB1A 2QB0A 1V38A 3BQ7A 3IDWA 2F44A 1B0XA 2K4PA 1WWVA 3KKAA 1SV4A 3BS5B 2EAOA 2Y9TA 1SGGA 2F8KA 2KMDA 5JU5A 2D3DA 3K1RB 5F3XB 2QARB 5JRTA 4NL9C 3TADC 2K60A 2DKXA 4IS7A 2EAMA 4NJ8A 1KW4A 2ES6A 1SV0A 3BS5A 1SXEA 1X40A 1Z1VA 2KE7A 4RQMA 2FE9A 3TADA 1PK1B 2E8MA 2ESEA 2QARA 2GLEA 2EANA 2D8CA 2L5YA 2EAPA 1PK3A 1JI7A 1DXSA 1UCVA 3TACB 1OXJA 1B4FA 1WWUA 1UQVA 1SXDA 2F3NA 2DKZA 2B6GA 2QKQA 4PZOA 2LMRA 3H8MA 4NL9A 3SEIA 1OW5A 1X66A 5JTIA 2KG5A 1PK1A 1X9XA 2LPEA 2Y9UA 4MHVA 2QB0B 4PZNA 3SENA 1LKYB 1LKYA
chains in the Genus database with same CATH superfamily
5J2BA 2JEIA 2G5HB 1MQ2A 2PFNA 1KFTA 4O3OA 4BX9C 3Q8QB 2XY5A 1AQ6A 7ICPA 4P4MA 4F50A 3RTVA 1PUZA 1BPYA 1ZQQA 4U7CA 4YG2A 1NZBA 1RPLA 4QZIA 4EX6A 2W9AA 3D6JA 5DKWA 4UAWA 4FE3A 1X6IA 5G5HA 2KMDA 3RB3A 5DLGA 1F5SA 4RQ8A 4Z6CA 2R8JA 5DG8A 4BDPA 4XQ8A 1SL1A 5BPCA 3ZI4A 1TAUA 5CEHA 4QZFA 5AM5A 2F77X 4JWNA 1X40A 5ALZA 1S0NA 2XO7A 2P6RA 1F44A 2ZXIA 2GLEA 3CP8A 2DQNB 2NRZA 4ED0A 2IMWP 2R8KA 4J9OA 4IQTA 2KZMA 1SZHA 4RPXA 4ZOHC 1XSPA 1B4FA 3WKAA 4DSIA 2M9NA 3T5KA 2PFPA 4FBTA 4ECRA 2PI5A 4DOBA 4JV0A 1IV8A 1ZQJA 2KEYA 4C0ZA 2IOHA 5DGAA 5ALTA 3PO4A 4NM2A 3PZPA 9ICBA 4QW8A 8ICHA 4DLGA 2AJQA 4M9HA 1NKCA 5KAIU 4MFCA 4K4GA 4BJQA 4Y2TA 5ALPA 4JMUA 1L3SA 4RQ5A 5ALQA 4C4RA 3IP4B 2EZYA 4RQ4A 4JB3A 2A1JB 4R66A 3H7IA 3M1YA 5HMLA 3T5JA 9ICTA 3IRUA 4QWAA 2HBLA 4F4KA 5KFMA 3IDWA 1NK0A 4F2SA 4IQWA 1TV9A 4Y2VA 3FAHA 8ICZA 4C80A 2F8KA 1QSSA 2YY6A 3MGIA 4Z6DA 2P6UA 4A8EA 4DQRA 3TI0A 1Q46A 3HW8A 2BKEA 3ETLA 3QU4A 3PW0A 1NKBA 4DWIA 4JWMA 4UAZA 4UW9A 3QU5A 1C7YA 2HHUA 5KFKA 3HWTA 5KG0A 5G5GA 3BZCA 4P0QB 9ICAA 3Q8RB 3M8SA 4QZGA 4EZ6A 3OHBA 3D2NA 3H8JA 3WKDA 4R65A 3GV5B 2FLNA 2HW3A 2BCUA 5KTQA 1MSWD 1T4GA 1OUQA 2ZXHA 5ALIA 2BR0A 3HKZC 3SYZA 4LZGA 4KLDA 4BXOB 5IIJA 3V6JA 4Y2PA 5KFIA 5DB9A 2IOFA 5D46A 1X42A 3K4GA 3M7DA 3ONNA 2FPKA 3H8SA 4QZHA 5ALNA 1TE2A 2FJ6A 3QYPA 3KD3A 2AGOA 5KFBA 2ODGA 5K4LA 5DGBA 4M9NA 2EZXA 4BUGA 1SWWA 3OSPA 4EZ9A 5J8YC 8ICTA 4DOCA 5KFRA 3GIKA 5AM2A 2R8IA 4O9MA 1M6YA 1XSLA 3H40A 2Z7JA 4UB4A 1T7PA 3BZKA 1SKSA 3EPGA 1C20A 4IRCA 1QCKA 2Y1IA 5KFVA 5HHIA 1LB2B 1MN8A 4DLEA 2WB1C 4IR1A 3K1RB 2ZIUA 2I9GA 4IL6U 1UA0A 4NL9C 4EYHB 2EQYA 5AM4A 4QWEA 2MA1A 3AL0B 1KBUA 4GIBA 5EE9A 4QIWF 2FPLA 2VJ4A 3B0YA 2ZIVA 4UBBA 2MRLA 2JZBA 4NLZA 4OJOA 1X9WA 2ES6A 2YQEA 1ZQGA 4JV2A 1SV0A 9ICKA 5DBBA 9ICXA 4EENA 2E8MA 1KKXA 4F5PA 4B9SA 5D4BA 1N48A 1NK4A 4B9TA 4EEKA 5KFHA 3TQ1A 2RDIA 4M9LA 2W9MA 2OM6A 4QW9A 2PKEA 2DKZA 4GFJA 3RR7A 2G07A 4R63A 3MGVA 5DQHA 2FMSA 2KK0A 1S8OA 4Y2SA 1PK1A 4DS5A 2BQUA 4ECUA 4F91B 3C1ZA 4I2JA 3RJEA 2R8GA 3QNMA 3SMVA 4E0DA 4US8A 4PJ0U 4DSJA 5CA7A 5J0TA 4J9NA 2XI9A 1X9MA 4Y2JA 2XCPA 2G5IB 2AGQA 3QUBA 4KLIA 5A0LA 5EE1A 2ZTEA 5AKZA 4YXMA 2CXYA 4K4HA 3MR5A 3L5KA 4KLUA 3Q8PB 4PL2A 2RP5A 3QUTA 1ECWA 5ALUA 5J8YA 1T8EA 4UB2A 1ZRNA 4QZBA 3QU9A 9ICJA 4F4WA 2RLTA 3F53A 2HOFA 2YB4A 2KJ5A 3MFHA 5AKHA 3H4BA 1ZOLA 5B66U 1U45A 2ZTDA 2UVRA 4NLGA 4ED6A 5AKJA 1BPDA 3M6KA 8ICRA 2KVCA 5KFYA 1QTMA 2HHVA 3MR6A 3SR6A 3ISCA 8ICXA 3EPIA 1J2NA 2ZUDA 2HHWA 3RB0A 2KV2A 2F2AB 3KHGA 4BWMA 4I2EA 1KW4A 5DG9A 7ICGA 5J29A 4I2GA 4YR3A 3PX0A 1N62A 5ALVA 4NWIA 1D8LA 3V7KA 4QZDA 4M47A 1NZPA 3HPOA 1SKWA 4RZRA 4O5KA 3GV8B 7ICLA 3N4MB 2BPCA 5J2GA 3SQIA 4DL4A 2AQ0A 1IG6A 1S5LU 1QQ5A 1Q8KA 4ED3A 4NXZA 1ZD5A 2HCFA 4YR2A 3QZ7A 2P35A 9ICEA 2WFAA 1PVPA 4C8MA 1FIQA 1ZQFA 1XNSA 1ZQWA 5DQGA 4KLMA 3K1ZA 4TUPA 1LKYA 4CDGA 3BS7A 1ZQBA 4MFAA 2ISOA 4MF8A 3GU3A 3V6HA 2JV3A 4KLOA 2YMLA 9ICVA 4FZLA 3MC1A 4O5EA 1NJZA 1WG8A 4B6JA 3HKZF 2PFQA 3HP6A 4Y2QA 8ICVA 5KT3A 1ZQVA 5KFCA 2FI1A 2LYBA 2BQRA 3G6YA 5FP0A 3PV8A 5AKXA 2DFLA 4QJFB 4RQ6A 2VKQA 5KAFU 3PNCA 2GH1A 5AICA 1J97A 3AUOA 2VANA 5AI5A 4B9MA 3TADC 3G6VA 3NS1A 2K60A 4YVZA 2CRXA 3F2DA 3BQ0A 3WK8A 5KFNA 5E79U 4F93B 2F1JA 3UXOA 4NJ8A 4KLEA 5AK5A 2D6FC 2KJ8A 4C7YA 2F8LA 5CJ7A 2AGPA 3C2KA 4RPYA 5AI9A 5F9NA 2ZJ5A 5DB8A 4F2RA 3SV3A 5KG4A 2UVWA 1S97A 2WB1F 2ZUCA 5EE3A 3PY8A 2DGZA 3RBDA 4UARA 2MUTA 4RNMA 3C21A 2KFNA 1UQVA 4LVSA 1UPHA 2F3NA 2RRDA 8ICYA 1L3VA 4IQUA 1JX4A 1JXLA 3N7PD 5KG3A 3U26A 2KG5A 1WCLA 4DFJA 2OXOA 3RH4A 3HRDD 3TANA 3RJIA 2HDOA 7ICSA 1NK6A 4ECQA 1A77A 4M2YA 4FBUA 4QWDA 4O3NA 1XU4A 2E3TA 1TKDA 3JPOA 2DL0A 2ZIUB 4GXIA 5KG1A 1TAQA 2R18A 4GXKA 1QQ6A 2ZTCA 2WTFA 2XCAA 3AQEA 4OJLA 2KIWA 3C28A 3BQ7A 2VA8A 2ZIVB 3MGHA 2WF9A 1Z00A 4PHPA 4B9UA 1IIPA 1QLNA 1LV5A 1WYGA 4RUAA 2IA6A 3CW2C 4Y2RA 1JMSA 4BWJA 4YN4A 3Q8SB 1ZQSA 8ICOA 3RR8A 4UAUA 2XVTA 1ZQLA 3NASA 8ICJA 1XSNA 3O0FA 3AN1A 3KBBA 4KLGA 2P66A 2F76X 4I2CA 4RQMA 2K8AA 3TADA 1RYRA 5AI6A 1PK1B 3UMGA 5AIBA 1ZRMA 5DG7A 4YD2A 4RQ2A 1HIWA 5J2AA 4EBCA 2ZJAA 1UCVA 1EXNA 4GLXA 1T3NA 5KG5A 3DEEA 3LVWA 3RRHA 5L9XA 3AU2A 1U47A 1FO4A 4JK1A 2BDPA 4DFDA 2WAQC 3ZDCA 3RJJA 7ICMA 4OJ6A 5CRXA 3HT3A 2AU0A 1HJPA 4NV0A 9ICIA 4Y2YA 4RU9A 2HHTA 5AM0A 1UT8A 2W9CB 4YCXA 4DF8A 4ECTA 2W9BA 1ZQDA 2WF7A 1PVRA 1D9FA 3LYSA 2W11A 3JPRA 1DGJA 1S77D 4F71A 3V72A 4M9JA 2KKVA 2A1AA 1RM6C 3ETRA 1NK7A 5ALKA 4RUCA 1Z4NA 3NVWA 5J2DA 2H3IA 5ALFA 3QEBZ 3GV7B 1VLBA 4I2BA 2XGQA 4EBEA 9ICFA 3JPPA 1TAMA 2EAOA 2G0AA 3A0HU 1U4BA 5GTIU 3F2BA 2HVIA 5AI8A 1HUOA 4TQSA 1CRXA 7ICEA 2NRVA 2KP7A 2G09A 1BNOA 4DFMA 2UVUA 2C22A 3DV9A 4B9LA 3HJEA 5KFOA 1ZQYA 2Q0ZX 2G06A 2K4IA 2BQ3A 1JN3A 1SXEA 3QUQA 2ISPA 3RF9A 2FE9A 4QZAA 4Q44A 2KHVA 2NO4A 4KX5A 3AM9A 4YMMA 1ZETA 1UA1A 1DXSA 1FEZA 4DFKA 3ALRA 4RQ1A 7ICOA 1FFUA 2JMGA 3PW5A 1WWUA 5KFTA 5AK6A 8ICMA 5J0YA 3RJHA 5L1LA 4CF3A 4ED1A 1Z3EB 4AYBC 4I2DA 5J0WA 4JUZA 2KICA 2NRTA 5ALYA 4KLTA 3EW9A 1D9DA 5J0PA 7ICJA 4PHDA 3H0RB 2HHXA 1ZQXA 1QSLA 3C1YA 1KEJA 4Z6EA 2CN1A 4O3QA 1Z1BA 5CP2A 5L1KA 9ICMA 2E8NA 1K5OA 5KFAA 2XC9A 5KFJA 2KIVA 2WF6A 2BCQA 2PXIA 2XICA 2KSOA 3OJUA 5DDMA 2MSNA 4I27A 5L1MA 2HBJA 4DOAA 2QB1A 2ZIWA 3I1YA 3I76A 5CWRA 4RQ0A 3KOOA 3NRWA 2OHFA 1AROP 1DRGA 5C0YA 3PX4A 4J9QA 2N1RA 2Y9TA 7ICNA 3UQ2A 3S6JA 3RH5A 3PW2A 1RQNA 3WK5A 4NLBA 3UM9A 2I6XA 2MUTB 3WK7A 1PZNA 1NK5A 4R8UA 2ZUBA 1JUDA 4YXJA 4PH5A 3NVVA 1S9FA 2DUYA 4PGQA 4M6WA 1L7MA 1N60A 5KG6A 4F3OA 2JHDA 4YD1A 2YN4A 5IINA 5IIIA 2XY6A 1ZQZA 2JEGA 4EX7A 4IR9A 1ZD3A 2L5YA 3ZD9A 2HOIA 1XS9D 2JRZA 3UPQA 2JH7A 4F8RA 1TK0A 2FMPA 5D49A 5AKGA 1OXJA 2BGWA 8ICPA 4QZ8A 1RYUA 3OTQA 4OD0A 1SIJA 4ED8A 5IIKA 5AKYA 2JXJA 2H3VA 2ZJ8A 1KQQA 3SEIA 3RRGA 5EWEA 1O03A 1RZTA 1MC8A 3PVXA 2AH5A 4FO6A 1NK9A 8ICQA 2W54A 5KT6A 1X9SA 3F5EA 1Z00B 5AKKA 4DQSA 3E58A 3C29A 2HOQA 4O3RA 1N5WA 2KNJA 3RJKA 2GWSA 3BDPA 2EDUA 2ZG6A 2J6UA 4RQ3A 5J0OA 4RNOA 3QUCA 1MA7A 1RG6A 3TAPA 3T3FA 2WAQF 5KFPA 2OCEA 2F44A 4ELUA 3ICXA 5AK3A 5J0UA 4F72A 1SV4A 4O0IA 3WKEA 4ECWA 3BQTA 1KDHA 1SL2A 1KRPA 5ALEA 4QWBA 4F5QA 9ICWA 2JEFA 5DDYA 2W8KA 2ASLA 3NVYA 1Z4OA 5KFWA 4QNLA 5AK4A 2EH9A 3NVZA 5AKIA 2BDUA 5ALXA 1L3UA 3PMNA 5KFGA 8ICKA 1L8LA 2W55A 3RJGA 3PSPA 8ICAA 9ICLA 5KFQA 3MDAA 3Q8LA 2W9BB 2K4EA 3TACB 3SAFA 5EOZA 2RHFA 2V4RA 5AIAA 3RFAA 4Q43A 2QLTA 4GC7A 4ECZA 1BPZA 4MEYA 4NLCA 9ICRA 3OHAA 4NL9A 4CCHA 2W7PA 4DQIA 4DSEA 1X9XA 4XA5A 8ICWA 1HUZA 1IM4A 2W3RA 2KN7A 5F9LA 4C8OA 4CNQA 3PR4A 3PO5A 3UXPA 9ICNA 3RBEA 4MF2A 1F0MA 3CYMA 5ALJA 3WKCA 1BPBA 3C5GA 1JRPA 2A19A 5ALGA 3J81j 3LK9A 2K89A 4UB3A 3IHQB 2H3FA 4AYBF 1B0XA 4O3PA 1A6SA 3IV6A 4Q45A 2AXTU 9ICPA 4CF4A 5IIOA 2G08A 2H3QA 1SGGA 2D3DA 5DQIA 2W7OA 3PSTA 1SB3C 4DO9A 1N5XA 1RXVA 3PW4A 1WCNA 2HHQA 2LHTA 1X6JA 3EZ5A 5ALOA 5ALMA 2EAMA 4P0QA 1S0VA 1ZQAA 9ICGA 2IOFK 1UHUA 9ICUA 3UMBA 4PPXA 3F5AA 4FFDA 4ECSA 8ICIA 1UT5A 4TUSA 1K1QA 5J0QA 4Y2UA 4J9LA 3BJYA 1H38A 4IRKA 3OSNA 3D2QA 3DDHA 9ICSA 5KG7A 4J9MA 3V6KA 3QU2A 4I2IA 7ICFA 3BQ2A 4EBDA 1ZQTA 3GFKB 2LPEA 3T79A 3KHRA 2R8HA 3FC4A 5KFEA 4KTQA 2ZIWB 3TKAA 3WKBA 7ICQA 2FLLA 8ICFA 1QH9A 1YZ6A 2Y0SC 3ZDEA 1KTQA 2Q4TA 3V7JA 3AMZA 4B9NA 5KG2A 3B9JA 5EWFA 2CPRA 3LVVA 5ALWA 3KTQA 4CGZA 3F2CA 3SAHA 3N97B 2W43A 1U9LA 2XGPA 3HILA 3M9OB 8ICCA 4RQNA 4C4TA 3IN5A 4R8UB 2KHQA 5BOLA 3G6XA 4UASA 4M6WB 4QZEA 1BNPA 3OJSA 1QQ7A 2J6TA 3NRZA 5JRTA 4DL2A 4KN7A 5B5EU 5HNKA 3GIJA 4DSFA 3MABA 4O3MA 5KT5A 4DCCA 4M04A 3TAQA 4O5CA 3PR5B 4BGDA 1NJWA 5HR6A 2FPMA 1XO0A 8ICGA 5KT7A 2KZZA 2JZBB 5AKLA 4UATA 3C2MA 4YR0A 2KE7A 2HMXA 3NGDA 4DQQA 1VDVA 2ESEA 2EANA 2D8CA 2B0CA 3QXGA 3JPTA 3UQ0A 1P7DA 2LBOA 1TFRA 3KZXA 4DSLA 4FS2A 2KKPA 5CHGA 4OJPA 2C2EA 7ICVA 1ZQUA 2ZIXA 3ISBA 3IG8A 3FYHA 4P4OA 2FDRA 4QIWC 5EWGA 1X2IA 2NO5A 3MR3A 3MBYA 3KHLA 4PHAA 4IRDA 3RB4A 2BCVA 1YZ7A 4JV1A 3RB6A 3JPQA 2LM1A 2NYVA 4O3SA 2HHSA 1Z19A 3ZDBA 1DK3A 3NUQA 3GILA 4PHEA 4K4IA 4XRHA 4R64A 1WUDA 4ECVA 1T94A 3H0LB 2DWQA 4NM1A 3T5HA 5KNIA 3H0MB 5KL8B 4RNNA 1JALA 3PSFA 2AQ4A 5AI4A 2VA2A 1L3TA 4FS1A 4US9A 3L3FX 4RT3A 4OCZA 2KFZA 3Q8MA 3RJFA 3Q8KA 4PGXA 3GZFA 5IIMA 1SZPA 2NV3A 1NJXA 1ZQOA 4FZNA 4DL5A 2KD1A 2HBKA 3NTUA 3GDXA 2H3ZA 7ICHA 9ICHA 5J2FA 2BCRA 4YP3A 1Y88A 2BHNA 1SKRA 2LKYA 2JH1A 4KLJA 2VIXA 3ZDDA 5KT4A 1NK8A 3VCBA 4DL3A 2HSZA 1ZJNA 3C2LA 4FZMA 7ICUA 2EAPA 5KFSA 1PK3A 1SWVA 5GTHU 5J0SA 1BPEA 1LVHA 5ALRA 1L7PA 5CR0A 3IM1A 3RAXA 2KOBA 2H5XA 4KLQA 1N2XA 4M0AA 7ICIA 1CI4A 4GXJA 2LYAA 3H8MA 3HX0A 1L6NA 5J2CA 2KJ9A 1U49A 1KLNA 4KLHA 1U48A 3N28A 5T14A 2ASJA 5AHXA 5AI0A 4CE6A 4PL1A 4IQVA 1A76A 4MHVA 2K8CB 1ZQIA 5DBAA 1N56A 4DL6A 4HAIA 5H2FU 4C8LA 3E2EA 1LKYB 1TK5A 2E5SA 3UXNA 3C5FA 1GO3F 5HMMA 3EUB2 4UAVA 1HEKA 5HP4A 3PW7A 3KFUF 1SV0C 5TISU 8ICEA 2YTUA 4MEXA 3RH6A 1K1SA 2KTQA 4PGYA 2YMQA 2V9WA 4G3IA 4RPZA 4ACOA 2QB0A 2JEJA 2VA3A 2K4PA 1Q3UA 2B21A 2PMZC 3B0XA 2GO7A 1ZQCA 2PI4A 2I5HA 4YFKA 2FMQA 4F92B 4USAA 5BOMA 1VJ5A 4EEYA 2LM4A 5JU5A 1YT3A 2M0NA 2HI0A 5DB6A 5F3XB 5J2JA 4F5OA 3AU6A 2Y0SF 4DQPA 3SAGA 1ZQRA 2HBMA 5L1IA 1RYSA 1ZQNA 1JXEA 2Y1JA 3GIIA 4XUSA 3BS5A 5KL1B 2F1HA 4C7ZA 1PVQA 4C8NA 2WF8A 4J9RA 1S0MA 2QARA 2BZFA 4X5VA 3WK9A 4C8KA 8ICLA 3QE9Y 2OYYA 1CUKA 4KN4A 2KVSA 5IILA 3SD7A 4I2AA 1L7NA 3CRXA 4ECYA 5KFLA 4DEZA 4UB6U 2I1QA 1ZYQA 1S0OA 4U6PA 1T3QA 4KX3A 3I28A 2GOLA 5J0XA 5L1JA 4Y2XA 7ICRA 4I28A 1Q3VA 3UMCA 4MFFA 1ZQHA 2PFOA 1BVSA 3SENA 4DF4A 1KN5A 4NLKA 4P0PA 1V85A 2UVVA 2E8PA 3FDSA 3IG5A 3QZ8A 3KKAC 2K4HA 2O6KA 4OO1J 2V4QA 1COKA 3C23A 4UQGA 4Q8FA 4I29A 4YMNA 1ZQMA 1ZQKA 1B43A 2ALZA 4ELVA 3M6ZA 2C28A 1COOA 2WF5A 1JROA 3M9NB 1CEZA 3H8WA 3OPXA 4GC6A 2W3SA 1XO1A 4IC9A 2C2RA 2YMPA 4C4SA 1NKEA 2W03A 4ELTA 4QZ9A 1ZQ1C 5ALDA 3A0BU 4NLNA 3WK4A 4YQWA 2A3VA 3EYZA 5DBCA 1S10A 5DLFA 3R9KA 2C2DA 2DKXA 5JUMA 3JPSA 2YX8A 4NY8A 4G9BA 2ZIXB 1QSYA 4YMOA 2KZ3A 1L8OA 2E1EA 4J9PA 5J2EA 4HYKA 1N61A 1KFDA 1JIHA 1D8BA 4UB1A 5HR7A 1XWLA 2W04A 4UB5A 5C5JA 1RQLA 2AHOB 3PMLA 1L7OA 2RQ5A 1NJYA 1KL9A 4PZOA 2E1FA 4KITB 5CB1A 3MFIA 1OW5A 1X66A 5JTIA 3M8RA 4Z6FA 5J2KA 4TQRA 2W9CA 5KFUA 3D2SA 2Y9UA 2XY7A 1BGXT 4QZCA 4LZDA 2OWOA 4PZNA 1MQ3A 2NRWA 4ICAA 2LI6A 1XC9A 4ED2A 4I2FA 4DFPA 2IHNA 1DK2A 4UAYA 3GQCA 3ZDAA 5ALLA 2RDJA 2E8OA 3KZIU 9ICCA 3WU2U 4LJXA 3K75D 3MR2A 4UB8U 4KMUA 2MU2A 2ASDA 1WWVA 3KKAA 2VJ5A 4EYIB 3ISDA 3ORYA 2YMMA 4M9GA 4KLLA 4TUQA 2DF4B 3V7LA 5DB7A 1ZD2P 2J6SA 4RQ7A 4F4YA 4I2HA 2A1JA 4P2HA 3BQ1A 4ED7A 3TFSA 4F5NA 3QEAZ 3SV4A 4OJ5A 3VC8A 5J2HA 4DSKA 1Z1VA 5EE0A 1BPXA 4ECXA 2EZZA 3LWLA 2PMZF 3OGUA 4J9KA 2JGAA 8ICUA 4DL7A 2F1IA 1O08A 7ICTA 3RAQA 2B6GA 5TZVA 4P4PA 1KSPA 1URJA 2LMRA 4WJ3B 3L4PA 4TURA 3ZD8A 3TFRA 3PX6A 1RDFA 3M9MB 4J03A 3H4DA 2QB0B 3KHHA 4KMOB 5AM1A 1RXWA 3JPNA 1N63A 2JR5A 3THVA 4CRXA 1V9PA 2XIDA 3EWAA 5KFZA 4F4XA 8ICSA 4BXOA 2IBKA 1NI3A 2KSOB 1NOMA 5KFXA 8ICNA 5ALSA 5KFDA 2BPGA 2HVHA 3PSIA 3LDAA 1V38A 1ZXIA 5HHHA 2MAXA 1S76D 2WHEA 4F5RA 2DPIA 1B22A 3BS5B 4DS4A 5KT2A 1A0PA 1V97A 2DBYA 3QU7A 1D8YA 2QARB 4EELA 3FM9A 1ED1A 1TK8A 2FLPA 5J2IA 2ATLA 9ICQA 2BPFA 3AQFA 4IS7A 3SZ2A 4ZH4A 1DOQA 4J9SA 4KLFA 2BCSA 2W8LA 1DGSA 4UBCA 3AEVA 3E0FA 2LYHA 1NNLA 1ZQEA 4Q8EA 1J2MA 4F4ZA 4CF5A 1JI7A 5KFFA 5AKEA 3QX7A 5ALHA 2OEHA 3WK6A 1SXDA 4P0PB 3N7RC 2OH2A 3TARA 3CNHA 1TVAA 2QKQA 1SL0A 1KFSA 3GIMA 4AP9A 2IHMA 3ED5A 8ICBA 3LWMA 1IXRA 1L5UA 3N7SC 1ZQPA 2DPJA 1ZJMA 4KLSA 3MDCA 2K8BB 4RT2A 3SI8A 5AM3A 2YB1A 5J0RA 1ZD4A 2NRXA 9ICOA 4B9VA 7ICKA 1FFVA 3T5LA 4QWCA
chains in the Genus database with same CATH topology
1F0MA 1V85A 5J8YC 2E8NA 3BS7A 2E8PA 2KIVA 2JV3A 3KKAC 5KNIA 2DL0A 2E8OA 1SV0C 2YTUA 1COKA 2KSOB 2KSOA 1RG6A 3HILA 4RQNA 5L1MA 5J8YA 2QB1A 2QB0A 1V38A 3BQ7A 3IDWA 2F44A 1B0XA 2K4PA 1WWVA 3KKAA 1SV4A 3BS5B 2EAOA 2Y9TA 1SGGA 2F8KA 2KMDA 5JU5A 2D3DA 3K1RB 5F3XB 2QARB 5JRTA 4NL9C 3TADC 2K60A 2DKXA 4IS7A 2EAMA 4NJ8A 1KW4A 2ES6A 1SV0A 3BS5A 1SXEA 1X40A 1Z1VA 2KE7A 4RQMA 2FE9A 3TADA 1PK1B 2E8MA 2ESEA 2QARA 2GLEA 2EANA 2D8CA 2L5YA 2EAPA 1PK3A 1JI7A 1DXSA 1UCVA 3TACB 1OXJA 1B4FA 1WWUA 1UQVA 1SXDA 2F3NA 2DKZA 2B6GA 2QKQA 4PZOA 2LMRA 3H8MA 4NL9A 3SEIA 1OW5A 1X66A 5JTIA 2KG5A 1PK1A 1X9XA 2LPEA 2Y9UA 4MHVA 2QB0B 4PZNA 3SENA 1LKYB 1LKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F0M A;  1V85 A;  5J8Y C;  2E8N A;  3BS7 A;  2E8P A;  2KIV A;  2JV3 A;  3KKA C;  5KNI A;  2DL0 A;  2E8O A;  1SV0 C;  2YTU A;  1COK A;  2KSO B;  2KSO A;  1RG6 A;  3HIL A;  4RQN A;  5L1M A;  5J8Y A;  2QB1 A;  2QB0 A;  1V38 A;  3BQ7 A;  3IDW A;  2F44 A;  1B0X A;  2K4P A;  1WWV A;  3KKA A;  1SV4 A;  3BS5 B;  2EAO A;  2Y9T A;  1SGG A;  2F8K A;  2KMD A;  5JU5 A;  2D3D A;  3K1R B;  5F3X B;  2QAR B;  5JRT A;  4NL9 C;  3TAD C;  2K60 A;  2DKX A;  4IS7 A;  2EAM A;  4NJ8 A;  1KW4 A;  2ES6 A;  1SV0 A;  3BS5 A;  1SXE A;  1X40 A;  1Z1V A;  2KE7 A;  4RQM A;  2FE9 A;  3TAD A;  1PK1 B;  2E8M A;  2ESE A;  2QAR A;  2GLE A;  2EAN A;  2D8C A;  2L5Y A;  2EAP A;  1PK3 A;  1JI7 A;  1DXS A;  1UCV A;  3TAC B;  1OXJ A;  1B4F A;  1WWU A;  1UQV A;  1SXD A;  2F3N A;  2DKZ A;  2B6G A;  2QKQ A;  4PZO A;  2LMR A;  3H8M A;  4NL9 A;  3SEI A;  1OW5 A;  1X66 A;  5JTI A;  2KG5 A;  1PK1 A;  1X9X A;  2LPE A;  2Y9U A;  4MHV A;  2QB0 B;  4PZN A;  3SEN A;  1LKY B;  1LKY A; 
#chains in the Genus database with same CATH topology
 5J2B A;  2JEI A;  2G5H B;  1MQ2 A;  2PFN A;  1KFT A;  4O3O A;  4BX9 C;  3Q8Q B;  2XY5 A;  1AQ6 A;  7ICP A;  4P4M A;  4F50 A;  3RTV A;  1PUZ A;  1BPY A;  1ZQQ A;  4U7C A;  4YG2 A;  1NZB A;  1RPL A;  4QZI A;  4EX6 A;  2W9A A;  3D6J A;  5DKW A;  4UAW A;  4FE3 A;  1X6I A;  5G5H A;  2KMD A;  3RB3 A;  5DLG A;  1F5S A;  4RQ8 A;  4Z6C A;  2R8J A;  5DG8 A;  4BDP A;  4XQ8 A;  1SL1 A;  5BPC A;  3ZI4 A;  1TAU A;  5CEH A;  4QZF A;  5AM5 A;  2F77 X;  4JWN A;  1X40 A;  5ALZ A;  1S0N A;  2XO7 A;  2P6R A;  1F44 A;  2ZXI A;  2GLE A;  3CP8 A;  2DQN B;  2NRZ A;  4ED0 A;  2IMW P;  2R8K A;  4J9O A;  4IQT A;  2KZM A;  1SZH A;  4RPX A;  4ZOH C;  1XSP A;  1B4F A;  3WKA A;  4DSI A;  2M9N A;  3T5K A;  2PFP A;  4FBT A;  4ECR A;  2PI5 A;  4DOB A;  4JV0 A;  1IV8 A;  1ZQJ A;  2KEY A;  4C0Z A;  2IOH A;  5DGA A;  5ALT A;  3PO4 A;  4NM2 A;  3PZP A;  9ICB A;  4QW8 A;  8ICH A;  4DLG A;  2AJQ A;  4M9H A;  1NKC A;  5KAI U;  4MFC A;  4K4G A;  4BJQ A;  4Y2T A;  5ALP A;  4JMU A;  1L3S A;  4RQ5 A;  5ALQ A;  4C4R A;  3IP4 B;  2EZY A;  4RQ4 A;  4JB3 A;  2A1J B;  4R66 A;  3H7I A;  3M1Y A;  5HML A;  3T5J A;  9ICT A;  3IRU A;  4QWA A;  2HBL A;  4F4K A;  5KFM A;  3IDW A;  1NK0 A;  4F2S A;  4IQW A;  1TV9 A;  4Y2V A;  3FAH A;  8ICZ A;  4C80 A;  2F8K A;  1QSS A;  2YY6 A;  3MGI A;  4Z6D A;  2P6U A;  4A8E A;  4DQR A;  3TI0 A;  1Q46 A;  3HW8 A;  2BKE A;  3ETL A;  3QU4 A;  3PW0 A;  1NKB A;  4DWI A;  4JWM A;  4UAZ A;  4UW9 A;  3QU5 A;  1C7Y A;  2HHU A;  5KFK A;  3HWT A;  5KG0 A;  5G5G A;  3BZC A;  4P0Q B;  9ICA A;  3Q8R B;  3M8S A;  4QZG A;  4EZ6 A;  3OHB A;  3D2N A;  3H8J A;  3WKD A;  4R65 A;  3GV5 B;  2FLN A;  2HW3 A;  2BCU A;  5KTQ A;  1MSW D;  1T4G A;  1OUQ A;  2ZXH A;  5ALI A;  2BR0 A;  3HKZ C;  3SYZ A;  4LZG A;  4KLD A;  4BXO B;  5IIJ A;  3V6J A;  4Y2P A;  5KFI A;  5DB9 A;  2IOF A;  5D46 A;  1X42 A;  3K4G A;  3M7D A;  3ONN A;  2FPK A;  3H8S A;  4QZH A;  5ALN A;  1TE2 A;  2FJ6 A;  3QYP A;  3KD3 A;  2AGO A;  5KFB A;  2ODG A;  5K4L A;  5DGB A;  4M9N A;  2EZX A;  4BUG A;  1SWW A;  3OSP A;  4EZ9 A;  5J8Y C;  8ICT A;  4DOC A;  5KFR A;  3GIK A;  5AM2 A;  2R8I A;  4O9M A;  1M6Y A;  1XSL A;  3H40 A;  2Z7J A;  4UB4 A;  1T7P A;  3BZK A;  1SKS A;  3EPG A;  1C20 A;  4IRC A;  1QCK A;  2Y1I A;  5KFV A;  5HHI A;  1LB2 B;  1MN8 A;  4DLE A;  2WB1 C;  4IR1 A;  3K1R B;  2ZIU A;  2I9G A;  4IL6 U;  1UA0 A;  4NL9 C;  4EYH B;  2EQY A;  5AM4 A;  4QWE A;  2MA1 A;  3AL0 B;  1KBU A;  4GIB A;  5EE9 A;  4QIW F;  2FPL A;  2VJ4 A;  3B0Y A;  2ZIV A;  4UBB A;  2MRL A;  2JZB A;  4NLZ A;  4OJO A;  1X9W A;  2ES6 A;  2YQE A;  1ZQG A;  4JV2 A;  1SV0 A;  9ICK A;  5DBB A;  9ICX A;  4EEN A;  2E8M A;  1KKX A;  4F5P A;  4B9S A;  5D4B A;  1N48 A;  1NK4 A;  4B9T A;  4EEK A;  5KFH A;  3TQ1 A;  2RDI A;  4M9L A;  2W9M A;  2OM6 A;  4QW9 A;  2PKE A;  2DKZ A;  4GFJ A;  3RR7 A;  2G07 A;  4R63 A;  3MGV A;  5DQH A;  2FMS A;  2KK0 A;  1S8O A;  4Y2S A;  1PK1 A;  4DS5 A;  2BQU A;  4ECU A;  4F91 B;  3C1Z A;  4I2J A;  3RJE A;  2R8G A;  3QNM A;  3SMV A;  4E0D A;  4US8 A;  4PJ0 U;  4DSJ A;  5CA7 A;  5J0T A;  4J9N A;  2XI9 A;  1X9M A;  4Y2J A;  2XCP A;  2G5I B;  2AGQ A;  3QUB A;  4KLI A;  5A0L A;  5EE1 A;  2ZTE A;  5AKZ A;  4YXM A;  2CXY A;  4K4H A;  3MR5 A;  3L5K A;  4KLU A;  3Q8P B;  4PL2 A;  2RP5 A;  3QUT A;  1ECW A;  5ALU A;  5J8Y A;  1T8E A;  4UB2 A;  1ZRN A;  4QZB A;  3QU9 A;  9ICJ A;  4F4W A;  2RLT A;  3F53 A;  2HOF A;  2YB4 A;  2KJ5 A;  3MFH A;  5AKH A;  3H4B A;  1ZOL A;  5B66 U;  1U45 A;  2ZTD A;  2UVR A;  4NLG A;  4ED6 A;  5AKJ A;  1BPD A;  3M6K A;  8ICR A;  2KVC A;  5KFY A;  1QTM A;  2HHV A;  3MR6 A;  3SR6 A;  3ISC A;  8ICX A;  3EPI A;  1J2N A;  2ZUD A;  2HHW A;  3RB0 A;  2KV2 A;  2F2A B;  3KHG A;  4BWM A;  4I2E A;  1KW4 A;  5DG9 A;  7ICG A;  5J29 A;  4I2G A;  4YR3 A;  3PX0 A;  1N62 A;  5ALV A;  4NWI A;  1D8L A;  3V7K A;  4QZD A;  4M47 A;  1NZP A;  3HPO A;  1SKW A;  4RZR A;  4O5K A;  3GV8 B;  7ICL A;  3N4M B;  2BPC A;  5J2G A;  3SQI A;  4DL4 A;  2AQ0 A;  1IG6 A;  1S5L U;  1QQ5 A;  1Q8K A;  4ED3 A;  4NXZ A;  1ZD5 A;  2HCF A;  4YR2 A;  3QZ7 A;  2P35 A;  9ICE A;  2WFA A;  1PVP A;  4C8M A;  1FIQ A;  1ZQF A;  1XNS A;  1ZQW A;  5DQG A;  4KLM A;  3K1Z A;  4TUP A;  1LKY A;  4CDG A;  3BS7 A;  1ZQB A;  4MFA A;  2ISO A;  4MF8 A;  3GU3 A;  3V6H A;  2JV3 A;  4KLO A;  2YML A;  9ICV A;  4FZL A;  3MC1 A;  4O5E A;  1NJZ A;  1WG8 A;  4B6J A;  3HKZ F;  2PFQ A;  3HP6 A;  4Y2Q A;  8ICV A;  5KT3 A;  1ZQV A;  5KFC A;  2FI1 A;  2LYB A;  2BQR A;  3G6Y A;  5FP0 A;  3PV8 A;  5AKX A;  2DFL A;  4QJF B;  4RQ6 A;  2VKQ A;  5KAF U;  3PNC A;  2GH1 A;  5AIC A;  1J97 A;  3AUO A;  2VAN A;  5AI5 A;  4B9M A;  3TAD C;  3G6V A;  3NS1 A;  2K60 A;  4YVZ A;  2CRX A;  3F2D A;  3BQ0 A;  3WK8 A;  5KFN A;  5E79 U;  4F93 B;  2F1J A;  3UXO A;  4NJ8 A;  4KLE A;  5AK5 A;  2D6F C;  2KJ8 A;  4C7Y A;  2F8L A;  5CJ7 A;  2AGP A;  3C2K A;  4RPY A;  5AI9 A;  5F9N A;  2ZJ5 A;  5DB8 A;  4F2R A;  3SV3 A;  5KG4 A;  2UVW A;  1S97 A;  2WB1 F;  2ZUC A;  5EE3 A;  3PY8 A;  2DGZ A;  3RBD A;  4UAR A;  2MUT A;  4RNM A;  3C21 A;  2KFN A;  1UQV A;  4LVS A;  1UPH A;  2F3N A;  2RRD A;  8ICY A;  1L3V A;  4IQU A;  1JX4 A;  1JXL A;  3N7P D;  5KG3 A;  3U26 A;  2KG5 A;  1WCL A;  4DFJ A;  2OXO A;  3RH4 A;  3HRD D;  3TAN A;  3RJI A;  2HDO A;  7ICS A;  1NK6 A;  4ECQ A;  1A77 A;  4M2Y A;  4FBU A;  4QWD A;  4O3N A;  1XU4 A;  2E3T A;  1TKD A;  3JPO A;  2DL0 A;  2ZIU B;  4GXI A;  5KG1 A;  1TAQ A;  2R18 A;  4GXK A;  1QQ6 A;  2ZTC A;  2WTF A;  2XCA A;  3AQE A;  4OJL A;  2KIW A;  3C28 A;  3BQ7 A;  2VA8 A;  2ZIV B;  3MGH A;  2WF9 A;  1Z00 A;  4PHP A;  4B9U A;  1IIP A;  1QLN A;  1LV5 A;  1WYG A;  4RUA A;  2IA6 A;  3CW2 C;  4Y2R A;  1JMS A;  4BWJ A;  4YN4 A;  3Q8S B;  1ZQS A;  8ICO A;  3RR8 A;  4UAU A;  2XVT A;  1ZQL A;  3NAS A;  8ICJ A;  1XSN A;  3O0F A;  3AN1 A;  3KBB A;  4KLG A;  2P66 A;  2F76 X;  4I2C A;  4RQM A;  2K8A A;  3TAD A;  1RYR A;  5AI6 A;  1PK1 B;  3UMG A;  5AIB A;  1ZRM A;  5DG7 A;  4YD2 A;  4RQ2 A;  1HIW A;  5J2A A;  4EBC A;  2ZJA A;  1UCV A;  1EXN A;  4GLX A;  1T3N A;  5KG5 A;  3DEE A;  3LVW A;  3RRH A;  5L9X A;  3AU2 A;  1U47 A;  1FO4 A;  4JK1 A;  2BDP A;  4DFD A;  2WAQ C;  3ZDC A;  3RJJ A;  7ICM A;  4OJ6 A;  5CRX A;  3HT3 A;  2AU0 A;  1HJP A;  4NV0 A;  9ICI A;  4Y2Y A;  4RU9 A;  2HHT A;  5AM0 A;  1UT8 A;  2W9C B;  4YCX A;  4DF8 A;  4ECT A;  2W9B A;  1ZQD A;  2WF7 A;  1PVR A;  1D9F A;  3LYS A;  2W11 A;  3JPR A;  1DGJ A;  1S77 D;  4F71 A;  3V72 A;  4M9J A;  2KKV A;  2A1A A;  1RM6 C;  3ETR A;  1NK7 A;  5ALK A;  4RUC A;  1Z4N A;  3NVW A;  5J2D A;  2H3I A;  5ALF A;  3QEB Z;  3GV7 B;  1VLB A;  4I2B A;  2XGQ A;  4EBE A;  9ICF A;  3JPP A;  1TAM A;  2EAO A;  2G0A A;  3A0H U;  1U4B A;  5GTI U;  3F2B A;  2HVI A;  5AI8 A;  1HUO A;  4TQS A;  1CRX A;  7ICE A;  2NRV A;  2KP7 A;  2G09 A;  1BNO A;  4DFM A;  2UVU A;  2C22 A;  3DV9 A;  4B9L A;  3HJE A;  5KFO A;  1ZQY A;  2Q0Z X;  2G06 A;  2K4I A;  2BQ3 A;  1JN3 A;  1SXE A;  3QUQ A;  2ISP A;  3RF9 A;  2FE9 A;  4QZA A;  4Q44 A;  2KHV A;  2NO4 A;  4KX5 A;  3AM9 A;  4YMM A;  1ZET A;  1UA1 A;  1DXS A;  1FEZ A;  4DFK A;  3ALR A;  4RQ1 A;  7ICO A;  1FFU A;  2JMG A;  3PW5 A;  1WWU A;  5KFT A;  5AK6 A;  8ICM A;  5J0Y A;  3RJH A;  5L1L A;  4CF3 A;  4ED1 A;  1Z3E B;  4AYB C;  4I2D A;  5J0W A;  4JUZ A;  2KIC A;  2NRT A;  5ALY A;  4KLT A;  3EW9 A;  1D9D A;  5J0P A;  7ICJ A;  4PHD A;  3H0R B;  2HHX A;  1ZQX A;  1QSL A;  3C1Y A;  1KEJ A;  4Z6E A;  2CN1 A;  4O3Q A;  1Z1B A;  5CP2 A;  5L1K A;  9ICM A;  2E8N A;  1K5O A;  5KFA A;  2XC9 A;  5KFJ A;  2KIV A;  2WF6 A;  2BCQ A;  2PXI A;  2XIC A;  2KSO A;  3OJU A;  5DDM A;  2MSN A;  4I27 A;  5L1M A;  2HBJ A;  4DOA A;  2QB1 A;  2ZIW A;  3I1Y A;  3I76 A;  5CWR A;  4RQ0 A;  3KOO A;  3NRW A;  2OHF A;  1ARO P;  1DRG A;  5C0Y A;  3PX4 A;  4J9Q A;  2N1R A;  2Y9T A;  7ICN A;  3UQ2 A;  3S6J A;  3RH5 A;  3PW2 A;  1RQN A;  3WK5 A;  4NLB A;  3UM9 A;  2I6X A;  2MUT B;  3WK7 A;  1PZN A;  1NK5 A;  4R8U A;  2ZUB A;  1JUD A;  4YXJ A;  4PH5 A;  3NVV A;  1S9F A;  2DUY A;  4PGQ A;  4M6W A;  1L7M A;  1N60 A;  5KG6 A;  4F3O A;  2JHD A;  4YD1 A;  2YN4 A;  5IIN A;  5III A;  2XY6 A;  1ZQZ A;  2JEG A;  4EX7 A;  4IR9 A;  1ZD3 A;  2L5Y A;  3ZD9 A;  2HOI A;  1XS9 D;  2JRZ A;  3UPQ A;  2JH7 A;  4F8R A;  1TK0 A;  2FMP A;  5D49 A;  5AKG A;  1OXJ A;  2BGW A;  8ICP A;  4QZ8 A;  1RYU A;  3OTQ A;  4OD0 A;  1SIJ A;  4ED8 A;  5IIK A;  5AKY A;  2JXJ A;  2H3V A;  2ZJ8 A;  1KQQ A;  3SEI A;  3RRG A;  5EWE A;  1O03 A;  1RZT A;  1MC8 A;  3PVX A;  2AH5 A;  4FO6 A;  1NK9 A;  8ICQ A;  2W54 A;  5KT6 A;  1X9S A;  3F5E A;  1Z00 B;  5AKK A;  4DQS A;  3E58 A;  3C29 A;  2HOQ A;  4O3R A;  1N5W A;  2KNJ A;  3RJK A;  2GWS A;  3BDP A;  2EDU A;  2ZG6 A;  2J6U A;  4RQ3 A;  5J0O A;  4RNO A;  3QUC A;  1MA7 A;  1RG6 A;  3TAP A;  3T3F A;  2WAQ F;  5KFP A;  2OCE A;  2F44 A;  4ELU A;  3ICX A;  5AK3 A;  5J0U A;  4F72 A;  1SV4 A;  4O0I A;  3WKE A;  4ECW A;  3BQT A;  1KDH A;  1SL2 A;  1KRP A;  5ALE A;  4QWB A;  4F5Q A;  9ICW A;  2JEF A;  5DDY A;  2W8K A;  2ASL A;  3NVY A;  1Z4O A;  5KFW A;  4QNL A;  5AK4 A;  2EH9 A;  3NVZ A;  5AKI A;  2BDU A;  5ALX A;  1L3U A;  3PMN A;  5KFG A;  8ICK A;  1L8L A;  2W55 A;  3RJG A;  3PSP A;  8ICA A;  9ICL A;  5KFQ A;  3MDA A;  3Q8L A;  2W9B B;  2K4E A;  3TAC B;  3SAF A;  5EOZ A;  2RHF A;  2V4R A;  5AIA A;  3RFA A;  4Q43 A;  2QLT A;  4GC7 A;  4ECZ A;  1BPZ A;  4MEY A;  4NLC A;  9ICR A;  3OHA A;  4NL9 A;  4CCH A;  2W7P A;  4DQI A;  4DSE A;  1X9X A;  4XA5 A;  8ICW A;  1HUZ A;  1IM4 A;  2W3R A;  2KN7 A;  5F9L A;  4C8O A;  4CNQ A;  3PR4 A;  3PO5 A;  3UXP A;  9ICN A;  3RBE A;  4MF2 A;  1F0M A;  3CYM A;  5ALJ A;  3WKC A;  1BPB A;  3C5G A;  1JRP A;  2A19 A;  5ALG A;  3J81 j;  3LK9 A;  2K89 A;  4UB3 A;  3IHQ B;  2H3F A;  4AYB F;  1B0X A;  4O3P A;  1A6S A;  3IV6 A;  4Q45 A;  2AXT U;  9ICP A;  4CF4 A;  5IIO A;  2G08 A;  2H3Q A;  1SGG A;  2D3D A;  5DQI A;  2W7O A;  3PST A;  1SB3 C;  4DO9 A;  1N5X A;  1RXV A;  3PW4 A;  1WCN A;  2HHQ A;  2LHT A;  1X6J A;  3EZ5 A;  5ALO A;  5ALM A;  2EAM A;  4P0Q A;  1S0V A;  1ZQA A;  9ICG A;  2IOF K;  1UHU A;  9ICU A;  3UMB A;  4PPX A;  3F5A A;  4FFD A;  4ECS A;  8ICI A;  1UT5 A;  4TUS A;  1K1Q A;  5J0Q A;  4Y2U A;  4J9L A;  3BJY A;  1H38 A;  4IRK A;  3OSN A;  3D2Q A;  3DDH A;  9ICS A;  5KG7 A;  4J9M A;  3V6K A;  3QU2 A;  4I2I A;  7ICF A;  3BQ2 A;  4EBD A;  1ZQT A;  3GFK B;  2LPE A;  3T79 A;  3KHR A;  2R8H A;  3FC4 A;  5KFE A;  4KTQ A;  2ZIW B;  3TKA A;  3WKB A;  7ICQ A;  2FLL A;  8ICF A;  1QH9 A;  1YZ6 A;  2Y0S C;  3ZDE A;  1KTQ A;  2Q4T A;  3V7J A;  3AMZ A;  4B9N A;  5KG2 A;  3B9J A;  5EWF A;  2CPR A;  3LVV A;  5ALW A;  3KTQ A;  4CGZ A;  3F2C A;  3SAH A;  3N97 B;  2W43 A;  1U9L A;  2XGP A;  3HIL A;  3M9O B;  8ICC A;  4RQN A;  4C4T A;  3IN5 A;  4R8U B;  2KHQ A;  5BOL A;  3G6X A;  4UAS A;  4M6W B;  4QZE A;  1BNP A;  3OJS A;  1QQ7 A;  2J6T A;  3NRZ A;  5JRT A;  4DL2 A;  4KN7 A;  5B5E U;  5HNK A;  3GIJ A;  4DSF A;  3MAB A;  4O3M A;  5KT5 A;  4DCC A;  4M04 A;  3TAQ A;  4O5C A;  3PR5 B;  4BGD A;  1NJW A;  5HR6 A;  2FPM A;  1XO0 A;  8ICG A;  5KT7 A;  2KZZ A;  2JZB B;  5AKL A;  4UAT A;  3C2M A;  4YR0 A;  2KE7 A;  2HMX A;  3NGD A;  4DQQ A;  1VDV A;  2ESE A;  2EAN A;  2D8C A;  2B0C A;  3QXG A;  3JPT A;  3UQ0 A;  1P7D A;  2LBO A;  1TFR A;  3KZX A;  4DSL A;  4FS2 A;  2KKP A;  5CHG A;  4OJP A;  2C2E A;  7ICV A;  1ZQU A;  2ZIX A;  3ISB A;  3IG8 A;  3FYH A;  4P4O A;  2FDR A;  4QIW C;  5EWG A;  1X2I A;  2NO5 A;  3MR3 A;  3MBY A;  3KHL A;  4PHA A;  4IRD A;  3RB4 A;  2BCV A;  1YZ7 A;  4JV1 A;  3RB6 A;  3JPQ A;  2LM1 A;  2NYV A;  4O3S A;  2HHS A;  1Z19 A;  3ZDB A;  1DK3 A;  3NUQ A;  3GIL A;  4PHE A;  4K4I A;  4XRH A;  4R64 A;  1WUD A;  4ECV A;  1T94 A;  3H0L B;  2DWQ A;  4NM1 A;  3T5H A;  5KNI A;  3H0M B;  5KL8 B;  4RNN A;  1JAL A;  3PSF A;  2AQ4 A;  5AI4 A;  2VA2 A;  1L3T A;  4FS1 A;  4US9 A;  3L3F X;  4RT3 A;  4OCZ A;  2KFZ A;  3Q8M A;  3RJF A;  3Q8K A;  4PGX A;  3GZF A;  5IIM A;  1SZP A;  2NV3 A;  1NJX A;  1ZQO A;  4FZN A;  4DL5 A;  2KD1 A;  2HBK A;  3NTU A;  3GDX A;  2H3Z A;  7ICH A;  9ICH A;  5J2F A;  2BCR A;  4YP3 A;  1Y88 A;  2BHN A;  1SKR A;  2LKY A;  2JH1 A;  4KLJ A;  2VIX A;  3ZDD A;  5KT4 A;  1NK8 A;  3VCB A;  4DL3 A;  2HSZ A;  1ZJN A;  3C2L A;  4FZM A;  7ICU A;  2EAP A;  5KFS A;  1PK3 A;  1SWV A;  5GTH U;  5J0S A;  1BPE A;  1LVH A;  5ALR A;  1L7P A;  5CR0 A;  3IM1 A;  3RAX A;  2KOB A;  2H5X A;  4KLQ A;  1N2X A;  4M0A A;  7ICI A;  1CI4 A;  4GXJ A;  2LYA A;  3H8M A;  3HX0 A;  1L6N A;  5J2C A;  2KJ9 A;  1U49 A;  1KLN A;  4KLH A;  1U48 A;  3N28 A;  5T14 A;  2ASJ A;  5AHX A;  5AI0 A;  4CE6 A;  4PL1 A;  4IQV A;  1A76 A;  4MHV A;  2K8C B;  1ZQI A;  5DBA A;  1N56 A;  4DL6 A;  4HAI A;  5H2F U;  4C8L A;  3E2E A;  1LKY B;  1TK5 A;  2E5S A;  3UXN A;  3C5F A;  1GO3 F;  5HMM A;  3EUB 2;  4UAV A;  1HEK A;  5HP4 A;  3PW7 A;  3KFU F;  1SV0 C;  5TIS U;  8ICE A;  2YTU A;  4MEX A;  3RH6 A;  1K1S A;  2KTQ A;  4PGY A;  2YMQ A;  2V9W A;  4G3I A;  4RPZ A;  4ACO A;  2QB0 A;  2JEJ A;  2VA3 A;  2K4P A;  1Q3U A;  2B21 A;  2PMZ C;  3B0X A;  2GO7 A;  1ZQC A;  2PI4 A;  2I5H A;  4YFK A;  2FMQ A;  4F92 B;  4USA A;  5BOM A;  1VJ5 A;  4EEY A;  2LM4 A;  5JU5 A;  1YT3 A;  2M0N A;  2HI0 A;  5DB6 A;  5F3X B;  5J2J A;  4F5O A;  3AU6 A;  2Y0S F;  4DQP A;  3SAG A;  1ZQR A;  2HBM A;  5L1I A;  1RYS A;  1ZQN A;  1JXE A;  2Y1J A;  3GII A;  4XUS A;  3BS5 A;  5KL1 B;  2F1H A;  4C7Z A;  1PVQ A;  4C8N A;  2WF8 A;  4J9R A;  1S0M A;  2QAR A;  2BZF A;  4X5V A;  3WK9 A;  4C8K A;  8ICL A;  3QE9 Y;  2OYY A;  1CUK A;  4KN4 A;  2KVS A;  5IIL A;  3SD7 A;  4I2A A;  1L7N A;  3CRX A;  4ECY A;  5KFL A;  4DEZ A;  4UB6 U;  2I1Q A;  1ZYQ A;  1S0O A;  4U6P A;  1T3Q A;  4KX3 A;  3I28 A;  2GOL A;  5J0X A;  5L1J A;  4Y2X A;  7ICR A;  4I28 A;  1Q3V A;  3UMC A;  4MFF A;  1ZQH A;  2PFO A;  1BVS A;  3SEN A;  4DF4 A;  1KN5 A;  4NLK A;  4P0P A;  1V85 A;  2UVV A;  2E8P A;  3FDS A;  3IG5 A;  3QZ8 A;  3KKA C;  2K4H A;  2O6K A;  4OO1 J;  2V4Q A;  1COK A;  3C23 A;  4UQG A;  4Q8F A;  4I29 A;  4YMN A;  1ZQM A;  1ZQK A;  1B43 A;  2ALZ A;  4ELV A;  3M6Z A;  2C28 A;  1COO A;  2WF5 A;  1JRO A;  3M9N B;  1CEZ A;  3H8W A;  3OPX A;  4GC6 A;  2W3S A;  1XO1 A;  4IC9 A;  2C2R A;  2YMP A;  4C4S A;  1NKE A;  2W03 A;  4ELT A;  4QZ9 A;  1ZQ1 C;  5ALD A;  3A0B U;  4NLN A;  3WK4 A;  4YQW A;  2A3V A;  3EYZ A;  5DBC A;  1S10 A;  5DLF A;  3R9K A;  2C2D A;  2DKX A;  5JUM A;  3JPS A;  2YX8 A;  4NY8 A;  4G9B A;  2ZIX B;  1QSY A;  4YMO A;  2KZ3 A;  1L8O A;  2E1E A;  4J9P A;  5J2E A;  4HYK A;  1N61 A;  1KFD A;  1JIH A;  1D8B A;  4UB1 A;  5HR7 A;  1XWL A;  2W04 A;  4UB5 A;  5C5J A;  1RQL A;  2AHO B;  3PML A;  1L7O A;  2RQ5 A;  1NJY A;  1KL9 A;  4PZO A;  2E1F A;  4KIT B;  5CB1 A;  3MFI A;  1OW5 A;  1X66 A;  5JTI A;  3M8R A;  4Z6F A;  5J2K A;  4TQR A;  2W9C A;  5KFU A;  3D2S A;  2Y9U A;  2XY7 A;  1BGX T;  4QZC A;  4LZD A;  2OWO A;  4PZN A;  1MQ3 A;  2NRW A;  4ICA A;  2LI6 A;  1XC9 A;  4ED2 A;  4I2F A;  4DFP A;  2IHN A;  1DK2 A;  4UAY A;  3GQC A;  3ZDA A;  5ALL A;  2RDJ A;  2E8O A;  3KZI U;  9ICC A;  3WU2 U;  4LJX A;  3K75 D;  3MR2 A;  4UB8 U;  4KMU A;  2MU2 A;  2ASD A;  1WWV A;  3KKA A;  2VJ5 A;  4EYI B;  3ISD A;  3ORY A;  2YMM A;  4M9G A;  4KLL A;  4TUQ A;  2DF4 B;  3V7L A;  5DB7 A;  1ZD2 P;  2J6S A;  4RQ7 A;  4F4Y A;  4I2H A;  2A1J A;  4P2H A;  3BQ1 A;  4ED7 A;  3TFS A;  4F5N A;  3QEA Z;  3SV4 A;  4OJ5 A;  3VC8 A;  5J2H A;  4DSK A;  1Z1V A;  5EE0 A;  1BPX A;  4ECX A;  2EZZ A;  3LWL A;  2PMZ F;  3OGU A;  4J9K A;  2JGA A;  8ICU A;  4DL7 A;  2F1I A;  1O08 A;  7ICT A;  3RAQ A;  2B6G A;  5TZV A;  4P4P A;  1KSP A;  1URJ A;  2LMR A;  4WJ3 B;  3L4P A;  4TUR A;  3ZD8 A;  3TFR A;  3PX6 A;  1RDF A;  3M9M B;  4J03 A;  3H4D A;  2QB0 B;  3KHH A;  4KMO B;  5AM1 A;  1RXW A;  3JPN A;  1N63 A;  2JR5 A;  3THV A;  4CRX A;  1V9P A;  2XID A;  3EWA A;  5KFZ A;  4F4X A;  8ICS A;  4BXO A;  2IBK A;  1NI3 A;  2KSO B;  1NOM A;  5KFX A;  8ICN A;  5ALS A;  5KFD A;  2BPG A;  2HVH A;  3PSI A;  3LDA A;  1V38 A;  1ZXI A;  5HHH A;  2MAX A;  1S76 D;  2WHE A;  4F5R A;  2DPI A;  1B22 A;  3BS5 B;  4DS4 A;  5KT2 A;  1A0P A;  1V97 A;  2DBY A;  3QU7 A;  1D8Y A;  2QAR B;  4EEL A;  3FM9 A;  1ED1 A;  1TK8 A;  2FLP A;  5J2I A;  2ATL A;  9ICQ A;  2BPF A;  3AQF A;  4IS7 A;  3SZ2 A;  4ZH4 A;  1DOQ A;  4J9S A;  4KLF A;  2BCS A;  2W8L A;  1DGS A;  4UBC A;  3AEV A;  3E0F A;  2LYH A;  1NNL A;  1ZQE A;  4Q8E A;  1J2M A;  4F4Z A;  4CF5 A;  1JI7 A;  5KFF A;  5AKE A;  3QX7 A;  5ALH A;  2OEH A;  3WK6 A;  1SXD A;  4P0P B;  3N7R C;  2OH2 A;  3TAR A;  3CNH A;  1TVA A;  2QKQ A;  1SL0 A;  1KFS A;  3GIM A;  4AP9 A;  2IHM A;  3ED5 A;  8ICB A;  3LWM A;  1IXR A;  1L5U A;  3N7S C;  1ZQP A;  2DPJ A;  1ZJM A;  4KLS A;  3MDC A;  2K8B B;  4RT2 A;  3SI8 A;  5AM3 A;  2YB1 A;  5J0R A;  1ZD4 A;  2NRX A;  9ICO A;  4B9V A;  7ICK A;  1FFV A;  3T5L A;  4QWC A; 
#chains in the Genus database with same CATH homology
 1F0M A;  1V85 A;  5J8Y C;  2E8N A;  3BS7 A;  2E8P A;  2KIV A;  2JV3 A;  3KKA C;  5KNI A;  2DL0 A;  2E8O A;  1SV0 C;  2YTU A;  1COK A;  2KSO B;  2KSO A;  1RG6 A;  3HIL A;  4RQN A;  5L1M A;  5J8Y A;  2QB1 A;  2QB0 A;  1V38 A;  3BQ7 A;  3IDW A;  2F44 A;  1B0X A;  2K4P A;  1WWV A;  3KKA A;  1SV4 A;  3BS5 B;  2EAO A;  2Y9T A;  1SGG A;  2F8K A;  2KMD A;  5JU5 A;  2D3D A;  3K1R B;  5F3X B;  2QAR B;  5JRT A;  4NL9 C;  3TAD C;  2K60 A;  2DKX A;  4IS7 A;  2EAM A;  4NJ8 A;  1KW4 A;  2ES6 A;  1SV0 A;  3BS5 A;  1SXE A;  1X40 A;  1Z1V A;  2KE7 A;  4RQM A;  2FE9 A;  3TAD A;  1PK1 B;  2E8M A;  2ESE A;  2QAR A;  2GLE A;  2EAN A;  2D8C A;  2L5Y A;  2EAP A;  1PK3 A;  1JI7 A;  1DXS A;  1UCV A;  3TAC B;  1OXJ A;  1B4F A;  1WWU A;  1UQV A;  1SXD A;  2F3N A;  2DKZ A;  2B6G A;  2QKQ A;  4PZO A;  2LMR A;  3H8M A;  4NL9 A;  3SEI A;  1OW5 A;  1X66 A;  5JTI A;  2KG5 A;  1PK1 A;  1X9X A;  2LPE A;  2Y9U A;  4MHV A;  2QB0 B;  4PZN A;  3SEN A;  1LKY B;  1LKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...