2K4PA

Solution structure of ship2-sam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
b'SGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2
publication title NMR Studies of a Heterotypic Sam-Sam Domain Association: The Interaction between the Lipid Phosphatase Ship2 and the EphA2 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 65
sequence length 65
ec nomenclature ec 3.1.3.86: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase.
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k4pA00
2D3DA 2QARA 1JI7A 1B0XA 3BQ7A 5JTIA 5JRTA 2QB1A 3K1RB 5F3XB 4NL9C 1X40A 2JV3A 2QB0B 3IDWA 2B6GA 3SENA 2F44A 2FE9A 2DL0A 2KE7A 2YTUA 1KW4A 5J8YC 2K4PA 3KKAC 2KSOA 3KKAA 1UQVA 3TACB 4PZOA 2EAPA 1V85A 5KNIA 1PK3A 1OW5A 1SXEA 2ES6A 3HILA 1SV0C 2E8OA 4IS7A 4NL9A 1SV0A 2LPEA 2F8KA 5L1MA 4RQMA 1X66A 2EANA 1SV4A 2D8CA 3BS5B 3TADC 2QB0A 1WWVA 4MHVA 5J8YA 1SXDA 4RQNA 1X9XA 2KG5A 1COKA 1PK1B 2Y9TA 2L5YA 2E8PA 1LKYB 3BS7A 2EAOA 1RG6A 2DKXA 2QARB 1Z1VA 1B4FA 2GLEA 5JU5A 3SEIA 1WWUA 2KMDA 1UCVA 2KIVA 3TADA 2QKQA 3H8MA 2DKZA 2K60A 2E8NA 2KSOB 3BS5A 4PZNA 1F0MA 2ESEA 1V38A 2F3NA 1SGGA 1DXSA 2LMRA 2Y9UA 2E8MA 4NJ8A 2EAMA 1PK1A 1LKYA 1OXJA
chains in the Genus database with same CATH superfamily
2P6UA 2HSZA 4CF4A 4QZ9A 2R8GA 2ZIUA 8ICHA 4MFCA 4YQWA 2HBLA 4YG2A 3MR5A 4F8RA 2KICA 4UATA 5EE9A 9ICMA 5AM4A 3OSNA 1IM4A 2B21A 2HBKA 1KQQA 4O5CA 2FE9A 3KBBA 2ISOA 4B6JA 1HEKA 5KL8B 1UHUA 2XIDA 2NO4A 4BWJA 4GXIA 5ALVA 2VA8A 3LWLA 2BCRA 4Y2XA 4UAVA 3MFHA 1NK9A 2R8JA 2KKVA 4O3PA 5KFMA 4LZGA 1Z1BA 5C5JA 1ZD3A 2PFNA 3BJYA 2WF5A 1UT8A 1F5SA 9ICNA 5CP2A 1WWVA 2F77X 5KFOA 9ICOA 2JMGA 4ACOA 5KG7A 4BDPA 1JMSA 2ZIUB 2P6RA 2GLEA 1XNSA 1ZQEA 3SV3A 2M9NA 2ZJ8A 2YMLA 1N56A 5AM3A 1NNLA 1SL1A 4B9TA 4YMOA 2HW3A 4UB6U 1MC8A 4ELUA 2PFPA 1T7PA 3LYSA 9ICVA 4OJ6A 3THVA 4IQUA 4NM1A 9ICRA 4QWEA 9ICJA 1DXSA 2JEJA 1HUOA 3WU2U 1YT3A 3PMNA 1KDHA 4UW9A 4B9UA 5AKJA 5GTIU 1TK5A 4M9HA 3BQ7A 4M0AA 5BPCA 2A1JA 3M6ZA 3IDWA 1Z19A 2GO7A 5AK3A 4DS5A 4ED8A 4I29A 4BX9C 4Z6CA 3KHGA 3ISCA 5J0RA 5AIAA 2I5HA 3M9MB 4F4XA 3KKAC 4C4TA 2C22A 5ALGA 4PGXA 1EXNA 3UMCA 2H3IA 3PW0A 4F4WA 3K1ZA 2ZJAA 3IRUA 4ECUA 3ZDDA 2A1AA 3FM9A 2KHVA 4GXJA 3PVXA 3OGUA 5DQHA 3LK9A 1CRXA 4B9VA 2PXIA 2I1QA 4PHAA 3FYHA 3RB4A 2FI1A 4I2GA 1NOMA 1KSPA 4XUSA 4DQQA 1V9PA 3T79A 2KG5A 4DL4A 1S0NA 5KFFA 4F5OA 4O0IA 5BOMA 4PHEA 4Z6EA 1TFRA 4Y2JA 4KITB 4Y2SA 3F2BA 4QZDA 3TI0A 4J9QA 1WWUA 3WK7A 2JXJA 2LM4A 2A1JB 5DDMA 2JZBA 3WK6A 4RQ8A 8ICAA 2CPRA 3WK9A 1P7DA 1U9LA 2AGPA 3AEVA 3ED5A 4KLSA 1S5LU 2K60A 4R66A 2JH1A 5AKZA 4O5EA 3QZ8A 1F0MA 3MR2A 2F3NA 1ZQBA 2DPIA 5TISU 4DL3A 5FP0A 5AKEA 2YX8A 2Y0SF 1NK4A 5DLGA 4OJ5A 2QARA 7ICHA 1BPBA 1B0XA 8ICIA 2I6XA 4Y2PA 3HKZF 3E58A 5TZVA 4KLQA 3WKBA 1SWWA 4P4OA 5ALNA 4UB2A 2YTUA 1SZHA 7ICOA 2ZUDA 1D9FA 3IN5A 4Y2RA 2BCUA 2JZBB 2JEFA 5EE1A 3N28A 3ETRA 1S8OA 1ZQXA 4BJQA 2F8KA 3JPNA 3GIIA 3OJUA 2AGOA 4KX5A 1NJYA 2EZXA 4B9LA 4RQ1A 4IQWA 2G08A 3G6VA 4MHVA 4KTQA 9ICHA 2XICA 3GV7B 3H0LB 4PHPA 5B5EU 1PVQA 1QH9A 3KTQA 4EYIB 3N7RC 2QARB 3MC1A 3NRWA 1RYSA 2HBMA 3PSTA 3ORYA 3PV8A 3A0BU 2YB4A 1KKXA 2WHEA 1ZQGA 3WK4A 4DOCA 4RQ6A 5AM5A 2V4RA 4QIWF 2XI9A 3SMVA 3GDXA 4EEYA 2KIVA 3AL0B 2W54A 2XVTA 2BQ3A 1ZQUA 3H8MA 4ECXA 2OM6A 1V38A 4YFKA 3TAQA 1IXRA 3TARA 2KOBA 4YXJA 2NO5A 2QLTA 5H2FU 2WAQF 2BQUA 1NK7A 3J81j 5KFVA 3AN1A 2BCQA 1QQ6A 2ASJA 5L1JA 3TQ1A 1SKRA 2QB1A 5AI9A 2AXTU 2JV3A 5J2GA 3OPXA 3RTVA 2JR5A 4M47A 1L6NA 3MGVA 2ODGA 3CRXA 3RAQA 2FJ6A 4CF3A 4J9LA 1LV5A 8ICQA 3TACB 2EAPA 2XY6A 4JV1A 1OW5A 4USAA 2HHVA 1SV0C 5AIBA 2O6KA 3EPGA 2LYHA 4Q44A 1SKWA 4ED0A 5KT7A 3IG8A 4ED2A 4DO9A 1ZJMA 1U48A 1PVRA 3ZD9A 3TADC 4UBCA 4TURA 4DQSA 1SKSA 1QLNA 1TAUA 4YVZA 3MFIA 2BQRA 1NJZA 2KHQA 2HVIA 3AMZA 3BDPA 1ZQOA 2YN4A 4DLGA 3N7SC 3TKAA 2E3TA 3ZDBA 4Y2VA 4KN7A 3PX6A 4UAWA 3HJEA 2KP7A 3S6JA 1BVSA 4C80A 5KFAA 4CF5A 2Y0SC 4J9NA 2LMRA 3EW9A 1NKBA 2E8MA 4NJ8A 7ICKA 3M9NB 4QZ8A 3C5GA 3GFKB 1OXJA 2NV3A 3T5HA 9ICKA 5EOZA 3HKZC 2MAXA 2HOFA 1Z00A 9ICAA 1MQ2A 2ZXHA 1WYGA 3IV6A 3C2KA 3T5JA 4IRDA 5J2BA 3QUQA 3EZ5A 2J6TA 2PMZF 5ALWA 5KFZA 3MBYA 1BPDA 1COOA 2YY6A 4XA5A 4RQ0A 2K4PA 4EEKA 4DL5A 4E0DA 1CEZA 5J2AA 5KG0A 4DSLA 3NVYA 3PW5A 5KFIA 5ALFA 5KG4A 4NLBA 4FO6A 3MR3A 1ZQKA 5J2FA 5L1MA 2HHSA 2NRVA 4RQMA 1NZBA 4K4IA 1SIJA 9ICFA 1CUKA 4Y2UA 3F53A 5DQIA 1COKA 4U6PA 3ZDAA 2W8KA 2R18A 2PKEA 5J0XA 2BPGA 4QZHA 5AI8A 8ICZA 4F3OA 4C8NA 1S76D 1Z00B 4QIWC 4MF8A 5JU5A 5J2JA 5DB9A 4Z6DA 5DG7A 1KEJA 3F2DA 2KMDA 2CRXA 4UARA 4OCZA 5HHIA 3TADA 2DBYA 2QKQA 4P0QA 2VJ4A 5KFRA 5CA7A 4DOBA 3BQ2A 2WAQC 1SGGA 1ZJNA 4K4HA 3H0MB 5KFSA 1Y88A 1NK8A 2IHMA 5AKLA 5CEHA 1C20A 3V7JA 1JRPA 5KT5A 3PO4A 7ICVA 5L1LA 4HYKA 7ICFA 3LVWA 4YR2A 1JI7A 5AM1A 3GIJA 2HHQA 3H40A 1X9MA 1T8EA 1N63A 3TFSA 3JPRA 2RRDA 5J0WA 2ZUCA 2KIWA 3RBEA 4F4KA 2NRWA 3EYZA 4QW9A 3I1YA 5ALRA 5J2KA 4MF2A 5J8YC 3D2QA 5DKWA 2EZZA 5J2EA 2OCEA 2ASLA 5AKHA 3C29A 5JUMA 4QWCA 4O3NA 4UQGA 9ICPA 9ICUA 4O3RA 2W9AA 1ZYQA 4F5QA 4CE6A 8ICVA 2BCSA 3K4GA 4C8OA 4B9MA 4LZDA 4P0QB 3I76A 2LBOA 5AK5A 2XGQA 2B0CA 4QNLA 1B22A 4ECVA 4FZLA 1NI3A 2DQNB 5AHXA 4UBBA 2EQYA 2K8CB 2MUTA 3PSIA 1S0MA 7ICSA 4I2JA 3GV8B 1HJPA 2KV2A 5IIIA 4RNMA 3ALRA 2RHFA 4EBEA 2BPCA 4ZOHC 1VDVA 2WFAA 2H5XA 1ZQSA 3ZD8A 4LJXA 4QZCA 1N48A 2F8LA 1ZQZA 2MRLA 3ZDEA 5DQGA 1UT5A 3H7IA 3IM1A 2NRZA 4PZNA 3Q8QB 4UB8U 1X6JA 3GQCA 1MQ3A 1IG6A 4KMOB 1ZQMA 3UMGA 1D8BA 5L9XA 5J0UA 2AQ0A 4CGZA 1LKYA 4DFMA 2PMZC 8ICYA 2I9GA 2EZYA 1QCKA 3UQ2A 4KLTA 4F5RA 5KFTA 1BNPA 5DBAA 1PUZA 4YMNA 5KAFU 2ZJ5A 1U49A 3WKEA 2XO7A 4Y2YA 3V72A 2MUTB 5GTHU 4M9GA 2AU0A 2KSOA 3B9JA 2YB1A 4NLZA 4O3MA 4EYHB 4PZOA 3GV5B 4F5NA 1L5UA 8ICKA 3EPIA 7ICGA 2ZIWA 5DG9A 2HOIA 4EZ6A 2KJ9A 3MDCA 1TE2A 4P4PA 4DF8A 1CI4A 1ZXIA 4IC9A 3L3FX 2WF6A 2QB0A 2HMXA 5J8YA 2DF4B 2P35A 2ZIVA 5EWFA 2XC9A 1LKYB 2FLPA 4PGYA 1J2MA 4UB4A 3C1ZA 9ICXA 2KKPA 8ICBA 1ZQTA 3E2EA 3T5KA 2J6UA 4U7CA 5J0PA 2MSNA 1L3VA 8ICNA 1ZD2P 5EWGA 3G6XA 1V97A 4ECTA 4EX7A 3V6KA 4IQVA 2KSOB 2ZXIA 2H3ZA 4Q43A 1ZQAA 3AM9A 4ED7A 1DGSA 3IG5A 4CRXA 4J9KA 4AYBF 2ZIWB 1XS9D 8ICEA 4XQ8A 5HHHA 1FIQA 4RQ5A 1RDFA 4ELVA 1D8YA 2VA3A 5DBBA 3RJFA 3PSPA 3JPPA 2BDPA 1X40A 4EBDA 4GXKA 1XSPA 2QB0B 2WF7A 2RLTA 4B9SA 1N2XA 2ZTCA 2ZIVB 4I2AA 2OH2A 2R8IA 4F72A 2F1HA 1T3NA 5AI0A 8ICWA 4DSFA 4AP9A 4NLKA 1YZ6A 3C2MA 4PL1A 3QE9Y 1L3SA 1X66A 5ALSA 2RP5A 3FAHA 3JPOA 1ZQQA 3Q8PB 1K1SA 2FPMA 2LI6A 1X9XA 4IRKA 4PPXA 4NLNA 5AKKA 4WJ3B 4JK1A 5J0QA 1Z3EB 4MFAA 1B4FA 1RXVA 4OJOA 4US9A 3NGDA 4ECYA 4EELA 1FEZA 2P66A 4KLUA 4IRCA 5BOLA 3V7KA 1ZQRA 3RJEA 3JPSA 5DB6A 2F1IA 5J29A 3F2CA 4FS2A 3ISBA 3NS1A 2C2DA 1WUDA 5KG5A 3ZDCA 2RDJA 5J0TA 4NM2A 2FDRA 2KVCA 3CP8A 5KG1A 5ALIA 2MA1A 2F1JA 1ZQVA 2AHOB 2KZ3A 3M9OB 5ALMA 1RM6C 4G3IA 2K89A 1B43A 2GOLA 3E0FA 4OD0A 5KTQA 1FFUA 4B9NA 3QU4A 8ICMA 4KLOA 2BPFA 3K75D 3PR4A 3HW8A 2LKYA 4KN4A 4RPZA 3RJGA 4UAYA 2F44A 4A8EA 4PHDA 2KE7A 3C28A 4YN4A 2ATLA 4P2HA 1RXWA 4I2BA 3D2NA 2HVHA 2K4EA 4CDGA 1KFSA 2W7OA 1XU4A 4HAIA 1TK8A 3QU5A 1HIWA 5IIOA 2W11A 1SXEA 2H3QA 3QU7A 3HILA 1RYRA 2WF8A 3MABA 1MN8A 1TVAA 5KFQA 3PR5B 5CRXA 5L1IA 5HNKA 2EANA 5CB1A 1SV4A 3LWMA 4J03A 1X9SA 2JH7A 4G9BA 3QEAZ 2C2EA 1SXDA 2AJQA 2L5YA 3DV9A 5KFHA 2HBJA 3GILA 2LYBA 4PL2A 3M8RA 1QQ7A 2EAOA 7ICJA 2YQEA 7ICLA 2HHTA 5C0YA 1X42A 4YXMA 5AICA 3KHRA 1S97A 4IL6U 5ALHA 1DOQA 2HDOA 4TUQA 2BGWA 2G5IB 4RPYA 2W9CA 2PFQA 3QXGA 4TQSA 4AYBC 1LB2B 4FE3A 5AI4A 2XY5A 3RRGA 4C8KA 2Y9UA 1ZQWA 3Q8RB 8ICGA 3WKDA 3EUB2 3VC8A 4O3SA 2JHDA 1T4GA 3AU2A 4DS4A 5B66U 5F9NA 2BCVA 2YMMA 3V6HA 4GC7A 4DQIA 3Q8SB 1NK5A 5IIKA 4FFDA 5CJ7A 3RH6A 2LM1A 4OJPA 1OUQA 2G0AA 2HOQA 4DSEA 1RYUA 2W43A 4F71A 1RPLA 4I28A 5G5GA 4X5VA 3PSFA 5E79U 5J2CA 1K1QA 5ALXA 9ICBA 9ICLA 3PZPA 5EWEA 4C8LA 5CWRA 1T94A 2W3SA 1KLNA 4DFPA 9ICCA 4Y2TA 4KLGA 2FPKA 2BHNA 3BZCA 1K5OA 3H4BA 8ICJA 4DL2A 3OHAA 2W9CB 2DPJA 4UB3A 1MSWD 4QWBA 4DQPA 1MA7A 2FLLA 5KFGA 4R63A 3MDAA 2V4QA 2PFOA 1Q3VA 3C5FA 1BPYA 3CNHA 1S77D 1S0OA 4I2CA 3O0FA 1GO3F 5HP4A 2EDUA 4PJ0U 3GZFA 4KLMA 9ICWA 1JROA 1A77A 3UPQA 3NRZA 1QTMA 3WKCA 1ZQPA 5AK4A 2IOFA 3M6KA 5J0YA 4FBTA 3HPOA 4Q8EA 4EBCA 2W04A 5IIJA 2AH5A 1A6SA 2G09A 3RH4A 1L7MA 3UXPA 4JV0A 4US8A 4DF4A 1PK1A 3OTQA 5ALKA 3A0HU 2K4HA 4ELTA 4DEZA 3NUQA 3Q8KA 1SL0A 1BNOA 4M9JA 3C1YA 4C0ZA 1NKCA 1ZQCA 4RNNA 2KFZA 1NJXA 5AI5A 3UXOA 4DLEA 3N4MB 3SENA 2LYAA 4QJFB 2DL0A 1KW4A 2DWQA 2E1FA 2FMSA 3DDHA 1NKEA 4KX3A 4ECRA 3QNMA 1UQVA 1FO4A 3QU9A 4RT2A 4ECQA 3TANA 5DB8A 1KFDA 2MU2A 2ZTDA 2KZMA 3SI8A 3HP6A 5DDYA 1N60A 7ICRA 2BZFA 1WCNA 4GFJA 2F76X 2UVUA 2LPEA 2NRXA 4Q8FA 1NJWA 3RBDA 1ZOLA 5DGBA 2H3VA 8ICTA 4NLCA 1PK1B 4EENA 4QWAA 3WK8A 2Y1IA 2JEGA 3TAPA 2FPLA 1L3UA 4PH5A 1QSSA 4JV2A 5AM0A 1ZQNA 1Z1VA 3GIMA 1X9WA 4NWIA 1ZQ1C 1KFTA 3H0RB 4IR1A 4YD1A 5KG2A 5IIMA 5CHGA 1URJA 5KFDA 4QZIA 2ISPA 2DKZA 2K4IA 4ECWA 2E8NA 4KLIA 5AKYA 2N1RA 2OXOA 1KL9A 3SQIA 5KG3A 2ALZA 2IA6A 1ZQHA 2XCAA 3H4DA 3UMBA 2XY7A 2M0NA 4M2YA 1BPEA 5KFUA 3KZIU 1D8LA 3IHQB 4BUGA 1NK6A 4JUZA 1J2NA 3NVVA 4ECSA 3I28A 1Q46A 2HHUA 3ICXA 1TKDA 1ZQFA 2KEYA 3JPTA 4QWDA 3SD7A 4J9MA 4ED3A 5HR7A 3MGIA 5IILA 1TAMA 2HCFA 1F44A 3RAXA 8ICLA 2YMPA 1C7YA 4IQTA 4M9NA 1RQLA 2ZG6A 3GU3A 4YR3A 4F92B 1VLBA 4NV0A 1UA1A 3RB6A 2BDUA 3M7DA 2VKQA 1S10A 3HRDD 1DK2A 3F5EA 5EE0A 4QZGA 5DLFA 1IIPA 2AQ4A 4DWIA 2KTQA 4O3QA 2R8KA 2UVWA 1BPXA 4I2FA 4BWMA 3Q8LA 3PW7A 3CW2C 2EH9A 4RNOA 1AQ6A 1JUDA 3AQEA 1UCVA 4F2RA 2G06A 2WB1F 4FZNA 1HUZA 1O08A 5KFPA 1PZNA 3OHBA 3BS5A 4M6WA 2HHWA 4M9LA 4J9RA 3QUBA 1TK0A 2OEHA 4KLEA 3QU2A 5HMMA 3BQTA 2FMPA 4GC6A 1YZ7A 1U4BA 3UQ0A 4Z6FA 3T5LA 7ICQA 2GWSA 4JMUA 2OYYA 4RQ3A 2E5SA 5JRTA 1QSLA 2KVSA 3L4PA 2WTFA 5F3XB 4DQRA 2Y1JA 4PGQA 4O9MA 2XGPA 3QUCA 2IMWP 3PX0A 2W8LA 2KD1A 4CNQA 2FLNA 4F50A 2DGZA 2G5HB 1L3TA 1S0VA 3M1YA 5ALQA 4XRHA 1Z4NA 4ZH4A 4RUCA 5AK6A 2VANA 4GLXA 2KNJA 1ECWA 1ZETA 4RUAA 1QQ5A 4JWMA 8ICFA 3R9KA 1V85A 5KNIA 1PK3A 5D49A 4NXZA 1X2IA 7ICTA 4K4GA 3V7LA 5AI6A 8ICPA 4YMMA 1H38A 4ED1A 3RRHA 5KG6A 5KFNA 2IHNA 4QZFA 3BS5B 4M6WB 4J9SA 5J2HA 5HMLA 3N7PD 3ZI4A 3L5KA 3AU6A 1JALA 7ICIA 2W7PA 1X6IA 3OJSA 3NASA 2G07A 1JIHA 3NTUA 2E8PA 1XSNA 3HWTA 3V6JA 3C2LA 1DGJA 7ICMA 2KJ5A 1SB3C 2DKXA 3RR8A 5F9LA 4FS1A 1DK3A 1JX4A 1U47A 3SEIA 4DCCA 2CN1A 2KN7A 1ZQLA 4BXOA 4RT3A 1IV8A 4I2DA 2FMQA 3PNCA 4ECZA 4DFJA 3KD3A 4DL6A 5KFLA 2R8HA 4DFKA 3UM9A 9ICEA 3H8WA 5KT2A 4YD2A 8ICUA 3JPQA 5J2DA 1NZPA 4O3OA 4I27A 1FFVA 5D4BA 1UA0A 5KFWA 4JWNA 3SYZA 5KT3A 3C21A 2YMQA 7ICUA 2W55A 5HR6A 2D3DA 1QSYA 3HT3A 4BGDA 1O03A 3SAHA 3QYPA 4F4ZA 3LDAA 2IBKA 4C7YA 4F4YA 4QW8A 3RJJA 3C23A 4QZBA 1NK0A 1D9DA 2CXYA 3NVZA 4CCHA 2OHFA 2W9BA 2JEIA 5DBCA 3RJIA 3PW2A 2AGQA 3OSPA 3QX7A 1L7PA 4F5PA 1ZD4A 5CR0A 2IOHA 4RQ7A 3KHLA 8ICXA 4DSJA 5J0OA 5A0LA 3KKAA 7ICNA 4DL7A 4YP3A 1XO0A 5ALYA 4KLHA 4I2HA 2ES6A 3RB0A 4BXOB 5IINA 5DB7A 3HX0A 3TFRA 2E8OA 1U45A 5G5HA 4DSKA 3BQ1A 1ZQYA 2KZZA 2E1EA 3KHHA 2W9MA 5KFEA 3GIKA 1Z4OA 2OWOA 2C28A 4Q45A 4R65A 3M8SA 3ETLA 3PW4A 1JXEA 4OJLA 4EX6A 1L8LA 5ALEA 2ZTEA 2KK0A 5DGAA 5L1KA 2DUYA 5EE3A 4P4MA 1SZPA 2WB1C 3RB3A 2ZUBA 4O5KA 3KZXA 4KMUA 2W9BB 3G6YA 4I2EA 4C4SA 7ICEA 4TUSA 3CYMA 4R64A 2RQ5A 3QZ7A 5KL1B 2XCPA 3PMLA 4UAUA 2ESEA 2W3RA 4GIBA 3SZ2A 4TQRA 3ISDA 3N97B 3B0XA 5ALUA 4ED6A 5ALDA 2VJ5A 5KFJA 5J0SA 3SAFA 5KFBA 3QEBZ 2Q0ZX 4P0PA 1J97A 1BPZA 2K8AA 5KFCA 1T3QA 1WG8A 3MR6A 5ALTA 3WKAA 2K8BB 4NL9C 2UVRA 4KLDA 2HI0A 9ICQA 4KLJA 3PY8A 1XWLA 4TUPA 1RZTA 2BKEA 2IOFK 1SWVA 4RPXA 2Q4TA 3RFAA 1XO1A 4F93B 5ALZA 1KN5A 2JGAA 1ZQDA 3ONNA 1ZQIA 3EWAA 4JB3A 4R8UA 3QUTA 4KLLA 3F5AA 4I2IA 4C7ZA 1ZRMA 1N5XA 1KBUA 5J2IA 4QZAA 4Y2QA 3RF9A 2KFNA 2V9WA 2NRTA 2D8CA 1L8OA 4J9OA 1S9FA 9ICSA 4ICAA 5KT4A 2JRZA 2A3VA 2A19A 1KRPA 8ICOA 2Y9TA 1JN3A 2LHTA 1ED1A 3RH5A 1M6YA 4UAZA 1RG6A 4P0PB 1VJ5A 2W03A 3RJHA 3B0YA 4KLFA 1LVHA 7ICPA 3KFUF 2KJ8A 4F91B 4RZRA 2VA2A 4F2SA 5AKXA 4RQ2A 9ICGA 5AM2A 4RU9A 5AKIA 5AKGA 4EZ9A 5ALPA 4UB5A 5KAIU 2GH1A 1L7OA 1DRGA 1JXLA 4IR9A 4R8UB 3WK5A 1UPHA 1ZD5A 4MEYA 2ZIXA 3BZKA 9ICIA 2VIXA 5JTIA 4MFFA 1Q8KA 3IP4B 3K1RB 2BR0A 5ALLA 1TV9A 8ICRA 2J6SA 2B6GA 2NYVA 2HHXA 1A76A 1PVPA 3PO5A 5ALOA 3SR6A 3D2SA 3RJKA 4OO1J 4DOAA 9ICTA 4DFDA 5KT6A 3NVWA 1WCLA 4RQ4A 3SV4A 1TAQA 3H8JA 3BQ0A 3FC4A 5K4LA 4LVSA 5DG8A 1N5WA 4YR0A 3UXNA 8ICCA 1Q3UA 4IS7A 4NL9A 1SV0A 3D6JA 1ZRNA 1SL2A 3AQFA 1AROP 2DFLA 1A0PA 3Q8MA 5KFXA 2F2AB 2RDIA 4NLGA 3VCBA 4RQNA 3DEEA 1RQNA 1N61A 4C4RA 3BS7A 2D6FC 4NY8A 3RR7A 2C2RA 2ZIXB 2ASDA 3H8SA 1XC9A 2H3FA 4DSIA 4QZEA 5ALJA 2WF9A 3FDSA 5T14A 1L7NA 1ZQJA 1BGXT 1N62A 3LVVA 4UASA 4M04A 3U26A 4FBUA 2PI5A 5D46A 4UB1A 2Z7JA 5KFYA 4MEXA 3T3FA 3SAGA 3PX4A 4FZMA 1KTQA 4J9PA 1XSLA 2PI4A 3AUOA 4C8MA 2EAMA 4YCXA 3MGHA 3KOOA 2UVVA 5KFKA 8ICSA
chains in the Genus database with same CATH topology
2D3DA 2QARA 1JI7A 1B0XA 3BQ7A 5JTIA 5JRTA 2QB1A 3K1RB 5F3XB 4NL9C 1X40A 2JV3A 2QB0B 3IDWA 2B6GA 3SENA 2F44A 2FE9A 2DL0A 2KE7A 2YTUA 1KW4A 5J8YC 2K4PA 3KKAC 2KSOA 3KKAA 1UQVA 3TACB 4PZOA 2EAPA 1V85A 5KNIA 1PK3A 1OW5A 1SXEA 2ES6A 3HILA 1SV0C 2E8OA 4IS7A 4NL9A 1SV0A 2LPEA 2F8KA 5L1MA 4RQMA 1X66A 2EANA 1SV4A 2D8CA 3BS5B 3TADC 2QB0A 1WWVA 4MHVA 5J8YA 1SXDA 4RQNA 1X9XA 2KG5A 1COKA 1PK1B 2Y9TA 2L5YA 2E8PA 1LKYB 3BS7A 2EAOA 1RG6A 2DKXA 2QARB 1Z1VA 1B4FA 2GLEA 5JU5A 3SEIA 1WWUA 2KMDA 1UCVA 2KIVA 3TADA 2QKQA 3H8MA 2DKZA 2K60A 2E8NA 2KSOB 3BS5A 4PZNA 1F0MA 2ESEA 1V38A 2F3NA 1SGGA 1DXSA 2LMRA 2Y9UA 2E8MA 4NJ8A 2EAMA 1PK1A 1LKYA 1OXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3D A;  2QAR A;  1JI7 A;  1B0X A;  3BQ7 A;  5JTI A;  5JRT A;  2QB1 A;  3K1R B;  5F3X B;  4NL9 C;  1X40 A;  2JV3 A;  2QB0 B;  3IDW A;  2B6G A;  3SEN A;  2F44 A;  2FE9 A;  2DL0 A;  2KE7 A;  2YTU A;  1KW4 A;  5J8Y C;  2K4P A;  3KKA C;  2KSO A;  3KKA A;  1UQV A;  3TAC B;  4PZO A;  2EAP A;  1V85 A;  5KNI A;  1PK3 A;  1OW5 A;  1SXE A;  2ES6 A;  3HIL A;  1SV0 C;  2E8O A;  4IS7 A;  4NL9 A;  1SV0 A;  2LPE A;  2F8K A;  5L1M A;  4RQM A;  1X66 A;  2EAN A;  1SV4 A;  2D8C A;  3BS5 B;  3TAD C;  2QB0 A;  1WWV A;  4MHV A;  5J8Y A;  1SXD A;  4RQN A;  1X9X A;  2KG5 A;  1COK A;  1PK1 B;  2Y9T A;  2L5Y A;  2E8P A;  1LKY B;  3BS7 A;  2EAO A;  1RG6 A;  2DKX A;  2QAR B;  1Z1V A;  1B4F A;  2GLE A;  5JU5 A;  3SEI A;  1WWU A;  2KMD A;  1UCV A;  2KIV A;  3TAD A;  2QKQ A;  3H8M A;  2DKZ A;  2K60 A;  2E8N A;  2KSO B;  3BS5 A;  4PZN A;  1F0M A;  2ESE A;  1V38 A;  2F3N A;  1SGG A;  1DXS A;  2LMR A;  2Y9U A;  2E8M A;  4NJ8 A;  2EAM A;  1PK1 A;  1LKY A;  1OXJ A; 
#chains in the Genus database with same CATH topology
 2P6U A;  2HSZ A;  4CF4 A;  4QZ9 A;  2R8G A;  2ZIU A;  8ICH A;  4MFC A;  4YQW A;  2HBL A;  4YG2 A;  3MR5 A;  4F8R A;  2KIC A;  4UAT A;  5EE9 A;  9ICM A;  5AM4 A;  3OSN A;  1IM4 A;  2B21 A;  2HBK A;  1KQQ A;  4O5C A;  2FE9 A;  3KBB A;  2ISO A;  4B6J A;  1HEK A;  5KL8 B;  1UHU A;  2XID A;  2NO4 A;  4BWJ A;  4GXI A;  5ALV A;  2VA8 A;  3LWL A;  2BCR A;  4Y2X A;  4UAV A;  3MFH A;  1NK9 A;  2R8J A;  2KKV A;  4O3P A;  5KFM A;  4LZG A;  1Z1B A;  5C5J A;  1ZD3 A;  2PFN A;  3BJY A;  2WF5 A;  1UT8 A;  1F5S A;  9ICN A;  5CP2 A;  1WWV A;  2F77 X;  5KFO A;  9ICO A;  2JMG A;  4ACO A;  5KG7 A;  4BDP A;  1JMS A;  2ZIU B;  2P6R A;  2GLE A;  1XNS A;  1ZQE A;  3SV3 A;  2M9N A;  2ZJ8 A;  2YML A;  1N56 A;  5AM3 A;  1NNL A;  1SL1 A;  4B9T A;  4YMO A;  2HW3 A;  4UB6 U;  1MC8 A;  4ELU A;  2PFP A;  1T7P A;  3LYS A;  9ICV A;  4OJ6 A;  3THV A;  4IQU A;  4NM1 A;  9ICR A;  4QWE A;  9ICJ A;  1DXS A;  2JEJ A;  1HUO A;  3WU2 U;  1YT3 A;  3PMN A;  1KDH A;  4UW9 A;  4B9U A;  5AKJ A;  5GTI U;  1TK5 A;  4M9H A;  3BQ7 A;  4M0A A;  5BPC A;  2A1J A;  3M6Z A;  3IDW A;  1Z19 A;  2GO7 A;  5AK3 A;  4DS5 A;  4ED8 A;  4I29 A;  4BX9 C;  4Z6C A;  3KHG A;  3ISC A;  5J0R A;  5AIA A;  2I5H A;  3M9M B;  4F4X A;  3KKA C;  4C4T A;  2C22 A;  5ALG A;  4PGX A;  1EXN A;  3UMC A;  2H3I A;  3PW0 A;  4F4W A;  3K1Z A;  2ZJA A;  3IRU A;  4ECU A;  3ZDD A;  2A1A A;  3FM9 A;  2KHV A;  4GXJ A;  3PVX A;  3OGU A;  5DQH A;  3LK9 A;  1CRX A;  4B9V A;  2PXI A;  2I1Q A;  4PHA A;  3FYH A;  3RB4 A;  2FI1 A;  4I2G A;  1NOM A;  1KSP A;  4XUS A;  4DQQ A;  1V9P A;  3T79 A;  2KG5 A;  4DL4 A;  1S0N A;  5KFF A;  4F5O A;  4O0I A;  5BOM A;  4PHE A;  4Z6E A;  1TFR A;  4Y2J A;  4KIT B;  4Y2S A;  3F2B A;  4QZD A;  3TI0 A;  4J9Q A;  1WWU A;  3WK7 A;  2JXJ A;  2LM4 A;  2A1J B;  5DDM A;  2JZB A;  3WK6 A;  4RQ8 A;  8ICA A;  2CPR A;  3WK9 A;  1P7D A;  1U9L A;  2AGP A;  3AEV A;  3ED5 A;  4KLS A;  1S5L U;  2K60 A;  4R66 A;  2JH1 A;  5AKZ A;  4O5E A;  3QZ8 A;  1F0M A;  3MR2 A;  2F3N A;  1ZQB A;  2DPI A;  5TIS U;  4DL3 A;  5FP0 A;  5AKE A;  2YX8 A;  2Y0S F;  1NK4 A;  5DLG A;  4OJ5 A;  2QAR A;  7ICH A;  1BPB A;  1B0X A;  8ICI A;  2I6X A;  4Y2P A;  3HKZ F;  3E58 A;  5TZV A;  4KLQ A;  3WKB A;  1SWW A;  4P4O A;  5ALN A;  4UB2 A;  2YTU A;  1SZH A;  7ICO A;  2ZUD A;  1D9F A;  3IN5 A;  4Y2R A;  2BCU A;  2JZB B;  2JEF A;  5EE1 A;  3N28 A;  3ETR A;  1S8O A;  1ZQX A;  4BJQ A;  2F8K A;  3JPN A;  3GII A;  3OJU A;  2AGO A;  4KX5 A;  1NJY A;  2EZX A;  4B9L A;  4RQ1 A;  4IQW A;  2G08 A;  3G6V A;  4MHV A;  4KTQ A;  9ICH A;  2XIC A;  3GV7 B;  3H0L B;  4PHP A;  5B5E U;  1PVQ A;  1QH9 A;  3KTQ A;  4EYI B;  3N7R C;  2QAR B;  3MC1 A;  3NRW A;  1RYS A;  2HBM A;  3PST A;  3ORY A;  3PV8 A;  3A0B U;  2YB4 A;  1KKX A;  2WHE A;  1ZQG A;  3WK4 A;  4DOC A;  4RQ6 A;  5AM5 A;  2V4R A;  4QIW F;  2XI9 A;  3SMV A;  3GDX A;  4EEY A;  2KIV A;  3AL0 B;  2W54 A;  2XVT A;  2BQ3 A;  1ZQU A;  3H8M A;  4ECX A;  2OM6 A;  1V38 A;  4YFK A;  3TAQ A;  1IXR A;  3TAR A;  2KOB A;  4YXJ A;  2NO5 A;  2QLT A;  5H2F U;  2WAQ F;  2BQU A;  1NK7 A;  3J81 j;  5KFV A;  3AN1 A;  2BCQ A;  1QQ6 A;  2ASJ A;  5L1J A;  3TQ1 A;  1SKR A;  2QB1 A;  5AI9 A;  2AXT U;  2JV3 A;  5J2G A;  3OPX A;  3RTV A;  2JR5 A;  4M47 A;  1L6N A;  3MGV A;  2ODG A;  3CRX A;  3RAQ A;  2FJ6 A;  4CF3 A;  4J9L A;  1LV5 A;  8ICQ A;  3TAC B;  2EAP A;  2XY6 A;  4JV1 A;  1OW5 A;  4USA A;  2HHV A;  1SV0 C;  5AIB A;  2O6K A;  3EPG A;  2LYH A;  4Q44 A;  1SKW A;  4ED0 A;  5KT7 A;  3IG8 A;  4ED2 A;  4DO9 A;  1ZJM A;  1U48 A;  1PVR A;  3ZD9 A;  3TAD C;  4UBC A;  4TUR A;  4DQS A;  1SKS A;  1QLN A;  1TAU A;  4YVZ A;  3MFI A;  2BQR A;  1NJZ A;  2KHQ A;  2HVI A;  3AMZ A;  3BDP A;  1ZQO A;  2YN4 A;  4DLG A;  3N7S C;  3TKA A;  2E3T A;  3ZDB A;  4Y2V A;  4KN7 A;  3PX6 A;  4UAW A;  3HJE A;  2KP7 A;  3S6J A;  1BVS A;  4C80 A;  5KFA A;  4CF5 A;  2Y0S C;  4J9N A;  2LMR A;  3EW9 A;  1NKB A;  2E8M A;  4NJ8 A;  7ICK A;  3M9N B;  4QZ8 A;  3C5G A;  3GFK B;  1OXJ A;  2NV3 A;  3T5H A;  9ICK A;  5EOZ A;  3HKZ C;  2MAX A;  2HOF A;  1Z00 A;  9ICA A;  1MQ2 A;  2ZXH A;  1WYG A;  3IV6 A;  3C2K A;  3T5J A;  4IRD A;  5J2B A;  3QUQ A;  3EZ5 A;  2J6T A;  2PMZ F;  5ALW A;  5KFZ A;  3MBY A;  1BPD A;  1COO A;  2YY6 A;  4XA5 A;  4RQ0 A;  2K4P A;  4EEK A;  4DL5 A;  4E0D A;  1CEZ A;  5J2A A;  5KG0 A;  4DSL A;  3NVY A;  3PW5 A;  5KFI A;  5ALF A;  5KG4 A;  4NLB A;  4FO6 A;  3MR3 A;  1ZQK A;  5J2F A;  5L1M A;  2HHS A;  2NRV A;  4RQM A;  1NZB A;  4K4I A;  1SIJ A;  9ICF A;  1CUK A;  4Y2U A;  3F53 A;  5DQI A;  1COK A;  4U6P A;  3ZDA A;  2W8K A;  2R18 A;  2PKE A;  5J0X A;  2BPG A;  4QZH A;  5AI8 A;  8ICZ A;  4F3O A;  4C8N A;  1S76 D;  1Z00 B;  4QIW C;  4MF8 A;  5JU5 A;  5J2J A;  5DB9 A;  4Z6D A;  5DG7 A;  1KEJ A;  3F2D A;  2KMD A;  2CRX A;  4UAR A;  4OCZ A;  5HHI A;  3TAD A;  2DBY A;  2QKQ A;  4P0Q A;  2VJ4 A;  5KFR A;  5CA7 A;  4DOB A;  3BQ2 A;  2WAQ C;  1SGG A;  1ZJN A;  4K4H A;  3H0M B;  5KFS A;  1Y88 A;  1NK8 A;  2IHM A;  5AKL A;  5CEH A;  1C20 A;  3V7J A;  1JRP A;  5KT5 A;  3PO4 A;  7ICV A;  5L1L A;  4HYK A;  7ICF A;  3LVW A;  4YR2 A;  1JI7 A;  5AM1 A;  3GIJ A;  2HHQ A;  3H40 A;  1X9M A;  1T8E A;  1N63 A;  3TFS A;  3JPR A;  2RRD A;  5J0W A;  2ZUC A;  2KIW A;  3RBE A;  4F4K A;  2NRW A;  3EYZ A;  4QW9 A;  3I1Y A;  5ALR A;  5J2K A;  4MF2 A;  5J8Y C;  3D2Q A;  5DKW A;  2EZZ A;  5J2E A;  2OCE A;  2ASL A;  5AKH A;  3C29 A;  5JUM A;  4QWC A;  4O3N A;  4UQG A;  9ICP A;  9ICU A;  4O3R A;  2W9A A;  1ZYQ A;  4F5Q A;  4CE6 A;  8ICV A;  2BCS A;  3K4G A;  4C8O A;  4B9M A;  4LZD A;  4P0Q B;  3I76 A;  2LBO A;  5AK5 A;  2XGQ A;  2B0C A;  4QNL A;  1B22 A;  4ECV A;  4FZL A;  1NI3 A;  2DQN B;  5AHX A;  4UBB A;  2EQY A;  2K8C B;  2MUT A;  3PSI A;  1S0M A;  7ICS A;  4I2J A;  3GV8 B;  1HJP A;  2KV2 A;  5III A;  4RNM A;  3ALR A;  2RHF A;  4EBE A;  2BPC A;  4ZOH C;  1VDV A;  2WFA A;  2H5X A;  1ZQS A;  3ZD8 A;  4LJX A;  4QZC A;  1N48 A;  2F8L A;  1ZQZ A;  2MRL A;  3ZDE A;  5DQG A;  1UT5 A;  3H7I A;  3IM1 A;  2NRZ A;  4PZN A;  3Q8Q B;  4UB8 U;  1X6J A;  3GQC A;  1MQ3 A;  1IG6 A;  4KMO B;  1ZQM A;  3UMG A;  1D8B A;  5L9X A;  5J0U A;  2AQ0 A;  4CGZ A;  1LKY A;  4DFM A;  2PMZ C;  8ICY A;  2I9G A;  2EZY A;  1QCK A;  3UQ2 A;  4KLT A;  4F5R A;  5KFT A;  1BNP A;  5DBA A;  1PUZ A;  4YMN A;  5KAF U;  2ZJ5 A;  1U49 A;  3WKE A;  2XO7 A;  4Y2Y A;  3V72 A;  2MUT B;  5GTH U;  4M9G A;  2AU0 A;  2KSO A;  3B9J A;  2YB1 A;  4NLZ A;  4O3M A;  4EYH B;  4PZO A;  3GV5 B;  4F5N A;  1L5U A;  8ICK A;  3EPI A;  7ICG A;  2ZIW A;  5DG9 A;  2HOI A;  4EZ6 A;  2KJ9 A;  3MDC A;  1TE2 A;  4P4P A;  4DF8 A;  1CI4 A;  1ZXI A;  4IC9 A;  3L3F X;  2WF6 A;  2QB0 A;  2HMX A;  5J8Y A;  2DF4 B;  2P35 A;  2ZIV A;  5EWF A;  2XC9 A;  1LKY B;  2FLP A;  4PGY A;  1J2M A;  4UB4 A;  3C1Z A;  9ICX A;  2KKP A;  8ICB A;  1ZQT A;  3E2E A;  3T5K A;  2J6U A;  4U7C A;  5J0P A;  2MSN A;  1L3V A;  8ICN A;  1ZD2 P;  5EWG A;  3G6X A;  1V97 A;  4ECT A;  4EX7 A;  3V6K A;  4IQV A;  2KSO B;  2ZXI A;  2H3Z A;  4Q43 A;  1ZQA A;  3AM9 A;  4ED7 A;  1DGS A;  3IG5 A;  4CRX A;  4J9K A;  4AYB F;  2ZIW B;  1XS9 D;  8ICE A;  4XQ8 A;  5HHH A;  1FIQ A;  4RQ5 A;  1RDF A;  4ELV A;  1D8Y A;  2VA3 A;  5DBB A;  3RJF A;  3PSP A;  3JPP A;  2BDP A;  1X40 A;  4EBD A;  4GXK A;  1XSP A;  2QB0 B;  2WF7 A;  2RLT A;  4B9S A;  1N2X A;  2ZTC A;  2ZIV B;  4I2A A;  2OH2 A;  2R8I A;  4F72 A;  2F1H A;  1T3N A;  5AI0 A;  8ICW A;  4DSF A;  4AP9 A;  4NLK A;  1YZ6 A;  3C2M A;  4PL1 A;  3QE9 Y;  1L3S A;  1X66 A;  5ALS A;  2RP5 A;  3FAH A;  3JPO A;  1ZQQ A;  3Q8P B;  1K1S A;  2FPM A;  2LI6 A;  1X9X A;  4IRK A;  4PPX A;  4NLN A;  5AKK A;  4WJ3 B;  4JK1 A;  5J0Q A;  1Z3E B;  4MFA A;  1B4F A;  1RXV A;  4OJO A;  4US9 A;  3NGD A;  4ECY A;  4EEL A;  1FEZ A;  2P66 A;  4KLU A;  4IRC A;  5BOL A;  3V7K A;  1ZQR A;  3RJE A;  3JPS A;  5DB6 A;  2F1I A;  5J29 A;  3F2C A;  4FS2 A;  3ISB A;  3NS1 A;  2C2D A;  1WUD A;  5KG5 A;  3ZDC A;  2RDJ A;  5J0T A;  4NM2 A;  2FDR A;  2KVC A;  3CP8 A;  5KG1 A;  5ALI A;  2MA1 A;  2F1J A;  1ZQV A;  2AHO B;  2KZ3 A;  3M9O B;  5ALM A;  1RM6 C;  4G3I A;  2K89 A;  1B43 A;  2GOL A;  3E0F A;  4OD0 A;  5KTQ A;  1FFU A;  4B9N A;  3QU4 A;  8ICM A;  4KLO A;  2BPF A;  3K75 D;  3PR4 A;  3HW8 A;  2LKY A;  4KN4 A;  4RPZ A;  3RJG A;  4UAY A;  2F44 A;  4A8E A;  4PHD A;  2KE7 A;  3C28 A;  4YN4 A;  2ATL A;  4P2H A;  1RXW A;  4I2B A;  3D2N A;  2HVH A;  2K4E A;  4CDG A;  1KFS A;  2W7O A;  1XU4 A;  4HAI A;  1TK8 A;  3QU5 A;  1HIW A;  5IIO A;  2W11 A;  1SXE A;  2H3Q A;  3QU7 A;  3HIL A;  1RYR A;  2WF8 A;  3MAB A;  1MN8 A;  1TVA A;  5KFQ A;  3PR5 B;  5CRX A;  5L1I A;  5HNK A;  2EAN A;  5CB1 A;  1SV4 A;  3LWM A;  4J03 A;  1X9S A;  2JH7 A;  4G9B A;  3QEA Z;  2C2E A;  1SXD A;  2AJQ A;  2L5Y A;  3DV9 A;  5KFH A;  2HBJ A;  3GIL A;  2LYB A;  4PL2 A;  3M8R A;  1QQ7 A;  2EAO A;  7ICJ A;  2YQE A;  7ICL A;  2HHT A;  5C0Y A;  1X42 A;  4YXM A;  5AIC A;  3KHR A;  1S97 A;  4IL6 U;  5ALH A;  1DOQ A;  2HDO A;  4TUQ A;  2BGW A;  2G5I B;  4RPY A;  2W9C A;  2PFQ A;  3QXG A;  4TQS A;  4AYB C;  1LB2 B;  4FE3 A;  5AI4 A;  2XY5 A;  3RRG A;  4C8K A;  2Y9U A;  1ZQW A;  3Q8R B;  8ICG A;  3WKD A;  3EUB 2;  3VC8 A;  4O3S A;  2JHD A;  1T4G A;  3AU2 A;  4DS4 A;  5B66 U;  5F9N A;  2BCV A;  2YMM A;  3V6H A;  4GC7 A;  4DQI A;  3Q8S B;  1NK5 A;  5IIK A;  4FFD A;  5CJ7 A;  3RH6 A;  2LM1 A;  4OJP A;  1OUQ A;  2G0A A;  2HOQ A;  4DSE A;  1RYU A;  2W43 A;  4F71 A;  1RPL A;  4I28 A;  5G5G A;  4X5V A;  3PSF A;  5E79 U;  5J2C A;  1K1Q A;  5ALX A;  9ICB A;  9ICL A;  3PZP A;  5EWE A;  4C8L A;  5CWR A;  1T94 A;  2W3S A;  1KLN A;  4DFP A;  9ICC A;  4Y2T A;  4KLG A;  2FPK A;  2BHN A;  3BZC A;  1K5O A;  3H4B A;  8ICJ A;  4DL2 A;  3OHA A;  2W9C B;  2DPJ A;  4UB3 A;  1MSW D;  4QWB A;  4DQP A;  1MA7 A;  2FLL A;  5KFG A;  4R63 A;  3MDA A;  2V4Q A;  2PFO A;  1Q3V A;  3C5F A;  1BPY A;  3CNH A;  1S77 D;  1S0O A;  4I2C A;  3O0F A;  1GO3 F;  5HP4 A;  2EDU A;  4PJ0 U;  3GZF A;  4KLM A;  9ICW A;  1JRO A;  1A77 A;  3UPQ A;  3NRZ A;  1QTM A;  3WKC A;  1ZQP A;  5AK4 A;  2IOF A;  3M6K A;  5J0Y A;  4FBT A;  3HPO A;  4Q8E A;  4EBC A;  2W04 A;  5IIJ A;  2AH5 A;  1A6S A;  2G09 A;  3RH4 A;  1L7M A;  3UXP A;  4JV0 A;  4US8 A;  4DF4 A;  1PK1 A;  3OTQ A;  5ALK A;  3A0H U;  2K4H A;  4ELT A;  4DEZ A;  3NUQ A;  3Q8K A;  1SL0 A;  1BNO A;  4M9J A;  3C1Y A;  4C0Z A;  1NKC A;  1ZQC A;  4RNN A;  2KFZ A;  1NJX A;  5AI5 A;  3UXO A;  4DLE A;  3N4M B;  3SEN A;  2LYA A;  4QJF B;  2DL0 A;  1KW4 A;  2DWQ A;  2E1F A;  2FMS A;  3DDH A;  1NKE A;  4KX3 A;  4ECR A;  3QNM A;  1UQV A;  1FO4 A;  3QU9 A;  4RT2 A;  4ECQ A;  3TAN A;  5DB8 A;  1KFD A;  2MU2 A;  2ZTD A;  2KZM A;  3SI8 A;  3HP6 A;  5DDY A;  1N60 A;  7ICR A;  2BZF A;  1WCN A;  4GFJ A;  2F76 X;  2UVU A;  2LPE A;  2NRX A;  4Q8F A;  1NJW A;  3RBD A;  1ZOL A;  5DGB A;  2H3V A;  8ICT A;  4NLC A;  1PK1 B;  4EEN A;  4QWA A;  3WK8 A;  2Y1I A;  2JEG A;  3TAP A;  2FPL A;  1L3U A;  4PH5 A;  1QSS A;  4JV2 A;  5AM0 A;  1ZQN A;  1Z1V A;  3GIM A;  1X9W A;  4NWI A;  1ZQ1 C;  1KFT A;  3H0R B;  4IR1 A;  4YD1 A;  5KG2 A;  5IIM A;  5CHG A;  1URJ A;  5KFD A;  4QZI A;  2ISP A;  2DKZ A;  2K4I A;  4ECW A;  2E8N A;  4KLI A;  5AKY A;  2N1R A;  2OXO A;  1KL9 A;  3SQI A;  5KG3 A;  2ALZ A;  2IA6 A;  1ZQH A;  2XCA A;  3H4D A;  3UMB A;  2XY7 A;  2M0N A;  4M2Y A;  1BPE A;  5KFU A;  3KZI U;  1D8L A;  3IHQ B;  4BUG A;  1NK6 A;  4JUZ A;  1J2N A;  3NVV A;  4ECS A;  3I28 A;  1Q46 A;  2HHU A;  3ICX A;  1TKD A;  1ZQF A;  2KEY A;  3JPT A;  4QWD A;  3SD7 A;  4J9M A;  4ED3 A;  5HR7 A;  3MGI A;  5IIL A;  1TAM A;  2HCF A;  1F44 A;  3RAX A;  8ICL A;  2YMP A;  1C7Y A;  4IQT A;  4M9N A;  1RQL A;  2ZG6 A;  3GU3 A;  4YR3 A;  4F92 B;  1VLB A;  4NV0 A;  1UA1 A;  3RB6 A;  2BDU A;  3M7D A;  2VKQ A;  1S10 A;  3HRD D;  1DK2 A;  3F5E A;  5EE0 A;  4QZG A;  5DLF A;  1IIP A;  2AQ4 A;  4DWI A;  2KTQ A;  4O3Q A;  2R8K A;  2UVW A;  1BPX A;  4I2F A;  4BWM A;  3Q8L A;  3PW7 A;  3CW2 C;  2EH9 A;  4RNO A;  1AQ6 A;  1JUD A;  3AQE A;  1UCV A;  4F2R A;  2G06 A;  2WB1 F;  4FZN A;  1HUZ A;  1O08 A;  5KFP A;  1PZN A;  3OHB A;  3BS5 A;  4M6W A;  2HHW A;  4M9L A;  4J9R A;  3QUB A;  1TK0 A;  2OEH A;  4KLE A;  3QU2 A;  5HMM A;  3BQT A;  2FMP A;  4GC6 A;  1YZ7 A;  1U4B A;  3UQ0 A;  4Z6F A;  3T5L A;  7ICQ A;  2GWS A;  4JMU A;  2OYY A;  4RQ3 A;  2E5S A;  5JRT A;  1QSL A;  2KVS A;  3L4P A;  2WTF A;  5F3X B;  4DQR A;  2Y1J A;  4PGQ A;  4O9M A;  2XGP A;  3QUC A;  2IMW P;  3PX0 A;  2W8L A;  2KD1 A;  4CNQ A;  2FLN A;  4F50 A;  2DGZ A;  2G5H B;  1L3T A;  1S0V A;  3M1Y A;  5ALQ A;  4XRH A;  1Z4N A;  4ZH4 A;  4RUC A;  5AK6 A;  2VAN A;  4GLX A;  2KNJ A;  1ECW A;  1ZET A;  4RUA A;  1QQ5 A;  4JWM A;  8ICF A;  3R9K A;  1V85 A;  5KNI A;  1PK3 A;  5D49 A;  4NXZ A;  1X2I A;  7ICT A;  4K4G A;  3V7L A;  5AI6 A;  8ICP A;  4YMM A;  1H38 A;  4ED1 A;  3RRH A;  5KG6 A;  5KFN A;  2IHN A;  4QZF A;  3BS5 B;  4M6W B;  4J9S A;  5J2H A;  5HML A;  3N7P D;  3ZI4 A;  3L5K A;  3AU6 A;  1JAL A;  7ICI A;  2W7P A;  1X6I A;  3OJS A;  3NAS A;  2G07 A;  1JIH A;  3NTU A;  2E8P A;  1XSN A;  3HWT A;  3V6J A;  3C2L A;  1DGJ A;  7ICM A;  2KJ5 A;  1SB3 C;  2DKX A;  3RR8 A;  5F9L A;  4FS1 A;  1DK3 A;  1JX4 A;  1U47 A;  3SEI A;  4DCC A;  2CN1 A;  2KN7 A;  1ZQL A;  4BXO A;  4RT3 A;  1IV8 A;  4I2D A;  2FMQ A;  3PNC A;  4ECZ A;  4DFJ A;  3KD3 A;  4DL6 A;  5KFL A;  2R8H A;  4DFK A;  3UM9 A;  9ICE A;  3H8W A;  5KT2 A;  4YD2 A;  8ICU A;  3JPQ A;  5J2D A;  1NZP A;  4O3O A;  4I27 A;  1FFV A;  5D4B A;  1UA0 A;  5KFW A;  4JWN A;  3SYZ A;  5KT3 A;  3C21 A;  2YMQ A;  7ICU A;  2W55 A;  5HR6 A;  2D3D A;  1QSY A;  3HT3 A;  4BGD A;  1O03 A;  3SAH A;  3QYP A;  4F4Z A;  3LDA A;  2IBK A;  4C7Y A;  4F4Y A;  4QW8 A;  3RJJ A;  3C23 A;  4QZB A;  1NK0 A;  1D9D A;  2CXY A;  3NVZ A;  4CCH A;  2OHF A;  2W9B A;  2JEI A;  5DBC A;  3RJI A;  3PW2 A;  2AGQ A;  3OSP A;  3QX7 A;  1L7P A;  4F5P A;  1ZD4 A;  5CR0 A;  2IOH A;  4RQ7 A;  3KHL A;  8ICX A;  4DSJ A;  5J0O A;  5A0L A;  3KKA A;  7ICN A;  4DL7 A;  4YP3 A;  1XO0 A;  5ALY A;  4KLH A;  4I2H A;  2ES6 A;  3RB0 A;  4BXO B;  5IIN A;  5DB7 A;  3HX0 A;  3TFR A;  2E8O A;  1U45 A;  5G5H A;  4DSK A;  3BQ1 A;  1ZQY A;  2KZZ A;  2E1E A;  3KHH A;  2W9M A;  5KFE A;  3GIK A;  1Z4O A;  2OWO A;  2C28 A;  4Q45 A;  4R65 A;  3M8S A;  3ETL A;  3PW4 A;  1JXE A;  4OJL A;  4EX6 A;  1L8L A;  5ALE A;  2ZTE A;  2KK0 A;  5DGA A;  5L1K A;  2DUY A;  5EE3 A;  4P4M A;  1SZP A;  2WB1 C;  3RB3 A;  2ZUB A;  4O5K A;  3KZX A;  4KMU A;  2W9B B;  3G6Y A;  4I2E A;  4C4S A;  7ICE A;  4TUS A;  3CYM A;  4R64 A;  2RQ5 A;  3QZ7 A;  5KL1 B;  2XCP A;  3PML A;  4UAU A;  2ESE A;  2W3R A;  4GIB A;  3SZ2 A;  4TQR A;  3ISD A;  3N97 B;  3B0X A;  5ALU A;  4ED6 A;  5ALD A;  2VJ5 A;  5KFJ A;  5J0S A;  3SAF A;  5KFB A;  3QEB Z;  2Q0Z X;  4P0P A;  1J97 A;  1BPZ A;  2K8A A;  5KFC A;  1T3Q A;  1WG8 A;  3MR6 A;  5ALT A;  3WKA A;  2K8B B;  4NL9 C;  2UVR A;  4KLD A;  2HI0 A;  9ICQ A;  4KLJ A;  3PY8 A;  1XWL A;  4TUP A;  1RZT A;  2BKE A;  2IOF K;  1SWV A;  4RPX A;  2Q4T A;  3RFA A;  1XO1 A;  4F93 B;  5ALZ A;  1KN5 A;  2JGA A;  1ZQD A;  3ONN A;  1ZQI A;  3EWA A;  4JB3 A;  4R8U A;  3QUT A;  4KLL A;  3F5A A;  4I2I A;  4C7Z A;  1ZRM A;  1N5X A;  1KBU A;  5J2I A;  4QZA A;  4Y2Q A;  3RF9 A;  2KFN A;  2V9W A;  2NRT A;  2D8C A;  1L8O A;  4J9O A;  1S9F A;  9ICS A;  4ICA A;  5KT4 A;  2JRZ A;  2A3V A;  2A19 A;  1KRP A;  8ICO A;  2Y9T A;  1JN3 A;  2LHT A;  1ED1 A;  3RH5 A;  1M6Y A;  4UAZ A;  1RG6 A;  4P0P B;  1VJ5 A;  2W03 A;  3RJH A;  3B0Y A;  4KLF A;  1LVH A;  7ICP A;  3KFU F;  2KJ8 A;  4F91 B;  4RZR A;  2VA2 A;  4F2S A;  5AKX A;  4RQ2 A;  9ICG A;  5AM2 A;  4RU9 A;  5AKI A;  5AKG A;  4EZ9 A;  5ALP A;  4UB5 A;  5KAI U;  2GH1 A;  1L7O A;  1DRG A;  1JXL A;  4IR9 A;  4R8U B;  3WK5 A;  1UPH A;  1ZD5 A;  4MEY A;  2ZIX A;  3BZK A;  9ICI A;  2VIX A;  5JTI A;  4MFF A;  1Q8K A;  3IP4 B;  3K1R B;  2BR0 A;  5ALL A;  1TV9 A;  8ICR A;  2J6S A;  2B6G A;  2NYV A;  2HHX A;  1A76 A;  1PVP A;  3PO5 A;  5ALO A;  3SR6 A;  3D2S A;  3RJK A;  4OO1 J;  4DOA A;  9ICT A;  4DFD A;  5KT6 A;  3NVW A;  1WCL A;  4RQ4 A;  3SV4 A;  1TAQ A;  3H8J A;  3BQ0 A;  3FC4 A;  5K4L A;  4LVS A;  5DG8 A;  1N5W A;  4YR0 A;  3UXN A;  8ICC A;  1Q3U A;  4IS7 A;  4NL9 A;  1SV0 A;  3D6J A;  1ZRN A;  1SL2 A;  3AQF A;  1ARO P;  2DFL A;  1A0P A;  3Q8M A;  5KFX A;  2F2A B;  2RDI A;  4NLG A;  3VCB A;  4RQN A;  3DEE A;  1RQN A;  1N61 A;  4C4R A;  3BS7 A;  2D6F C;  4NY8 A;  3RR7 A;  2C2R A;  2ZIX B;  2ASD A;  3H8S A;  1XC9 A;  2H3F A;  4DSI A;  4QZE A;  5ALJ A;  2WF9 A;  3FDS A;  5T14 A;  1L7N A;  1ZQJ A;  1BGX T;  1N62 A;  3LVV A;  4UAS A;  4M04 A;  3U26 A;  4FBU A;  2PI5 A;  5D46 A;  4UB1 A;  2Z7J A;  5KFY A;  4MEX A;  3T3F A;  3SAG A;  3PX4 A;  4FZM A;  1KTQ A;  4J9P A;  1XSL A;  2PI4 A;  3AUO A;  4C8M A;  2EAM A;  4YCX A;  3MGH A;  3KOO A;  2UVV A;  5KFK A;  8ICS A; 
#chains in the Genus database with same CATH homology
 2D3D A;  2QAR A;  1JI7 A;  1B0X A;  3BQ7 A;  5JTI A;  5JRT A;  2QB1 A;  3K1R B;  5F3X B;  4NL9 C;  1X40 A;  2JV3 A;  2QB0 B;  3IDW A;  2B6G A;  3SEN A;  2F44 A;  2FE9 A;  2DL0 A;  2KE7 A;  2YTU A;  1KW4 A;  5J8Y C;  2K4P A;  3KKA C;  2KSO A;  3KKA A;  1UQV A;  3TAC B;  4PZO A;  2EAP A;  1V85 A;  5KNI A;  1PK3 A;  1OW5 A;  1SXE A;  2ES6 A;  3HIL A;  1SV0 C;  2E8O A;  4IS7 A;  4NL9 A;  1SV0 A;  2LPE A;  2F8K A;  5L1M A;  4RQM A;  1X66 A;  2EAN A;  1SV4 A;  2D8C A;  3BS5 B;  3TAD C;  2QB0 A;  1WWV A;  4MHV A;  5J8Y A;  1SXD A;  4RQN A;  1X9X A;  2KG5 A;  1COK A;  1PK1 B;  2Y9T A;  2L5Y A;  2E8P A;  1LKY B;  3BS7 A;  2EAO A;  1RG6 A;  2DKX A;  2QAR B;  1Z1V A;  1B4F A;  2GLE A;  5JU5 A;  3SEI A;  1WWU A;  2KMD A;  1UCV A;  2KIV A;  3TAD A;  2QKQ A;  3H8M A;  2DKZ A;  2K60 A;  2E8N A;  2KSO B;  3BS5 A;  4PZN A;  1F0M A;  2ESE A;  1V38 A;  2F3N A;  1SGG A;  1DXS A;  2LMR A;  2Y9U A;  2E8M A;  4NJ8 A;  2EAM A;  1PK1 A;  1LKY A;  1OXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...