1FIQA

Crystal structure of xanthine oxidase from bovine milk
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE OXIDASE
publication title Crystal structures of bovine milk xanthine dehydrogenase and xanthine oxidase: structure-based mechanism of conversion.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 39
structure length 164
sequence length 164
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1fiqA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fiqA01
1RFKA 3CIRB 3P63A 1FFUA 1VJKA 1N5WA 1ZXIA 2G1EA 1XLNA 3AE7B 3BIID 1V8CA 3AB5A 2BS4B 1E6EB 4A9AA 1YJIA 3AE3B 3FAHA 1TKEA 3HRDD 2KAJA 3P4QB 3AEAB 5C2TB 4ZHOA 1VLBA 4P6VF 2BS2B 1N5XA 1AYFA 5G5GA 1TKGA 2PVOD 1JWBD 1E7PB 2KMMA 1PUTA 1SF0A 1YQ3B 1VDVA 1SB3C 1NYRA 3P4RB 4YTMB 1QOGA 2JQRB 1KRHA 1WYGA 1ZP0B 1FRRA 2H89B 2WU2B 2H88B 4N59A 2DWQA 1NVID 1GPXA 4ZOHC 2M56B 1RYJA 3ABVB 2QJLA 4LTUA 3DWMA 4YSZB 3SFDB 1PFDA 3VRBB 1N62A 4C80A 1TJEA 3DWGC 1DOXA 4YTNB 2HTME 1E9MA 2MJ3A 3AEGB 2WDRB 4ITKA 1RM6C 4YTPB 2B76B 4US9A 4N58A 5GXGB 1FRDA 1QOAA 4JWSC 1TYGB 3AH7A 1R7SA 3W5UB 3AE5B 5G5HA 1PDXA 1QF6A 1JWAD 2CU3A 1FXIA 3LXFA 1ZOYB 3AE1B 1ROEA 1JALA 3AM9A 1F0ZA 1YQ4B 5AUKA 2CJNA 3SFEB 1DOYA 2CJOA 2EKIA 2QIEB 2OHFA 1NENB 3AE4B 1FFVA 1OQRA 1QOBA 3VR9B 5C3JB 3NVYA 1JW9D 3AEFB 2Q5WD 4IDIA 1OQQA 4YT0B 2Y5CA 1OFFA 1L5PA 1QOFA 1FXAA 2L83A 3W5VB 3HUIA 1AWDA 1N60A 2W3SA 4N6EB 3B2GA 3RPFC 1NYQA 3AE8B 3CWIA 4JX1C 2ACZB 3AE9B 5EE9A 2WS3B 3VR8B 2MJEA 1V97A 2W3RA 2PIAA 1L0VB 2PVGC 3AN1A 1FO4A 3P4SB 2BT6A 2WDVB 2WQYB 1CJEA 1L6VA 5EE1A 2DBYA 1NEKB 1JRPA 1RWSA 3AECB 2K9XA 2PKOA 2AX5A 3PO0A 1N61A 4KX6B 4YSXB 1QT9A 1XO3A 1E0ZA 2L52A 2W55A 1A70A 3HVZA 2K5PA 2M19A 3NVZA 4ZHPA 2MH7A 1T3QA 3SR6A 3P1MA 1XLQA 3KWLA 5EE3A 4HROA 1QLBB 4YXDB 1N63A 3NS1A 1J7BA 2JX5A 3AMZA 3NRZA 2MJDA 2E3TA 3ZYYX 2K22A 1JROA 3L4PA 1TKYA 1YJJA 4WQMA 2WDQB 4HRSA 3NVVA 4C7YA 4WWMA 3AE6B 3AEEB 5H8YE 1L6UA 1SIJA 1FM0D 5AUIA 1WXQA 4FXCA 4USAA 1XLOA 3B2FA 4YSYB 3AEDB 5H92C 1FMAD 5MPOA 3EUB2 1GAQB 2LEKA 3LB8C 1EWYC 2WU5B 2N0SB 4C7ZA 1IUEA 1KF6B 1NI3A 3P4PB 1J7CA 3VRAB 1JQ4A 1DOIA 3NVWA 2FBWB 1UWMA 1J7AA 3AEBB 3B9JA 1E10A 2BS3B 1WWTA 2W54A 3FC4A 3W9CB 1KFYB 1CZPA 1I7HA 1WGKA 3AE2B 1ZUD2 1FIQA 3WCQA 3AV8A 2WP9B 1DGJA 1XLPA 1WRIA 2WLBA 1B9RA 4US8A 3ETRA 4JWUC 5EE0A
chains in the Genus database with same CATH superfamily
4GXIA 3Q8KA 1RFKA 2XBBC 5KFCA 5L9XA 3M63B 1WRDB 3M3JA 4K3BA 1WGYA 2JEGA 2KYWA 1KDHA 5KFQA 2AGQA 5KNIA 2GLSA 1TKGA 4KSKC 1BT0A 3PW4A 3EFUA 2WYQA 1D9DA 2NTTA 3PZ7A 3P4RB 1D5ZC 1COOA 3PX0A 4HXDA 1DGSA 2J6UA 5KG5A 3MR3A 2ES6A 2VJ5A 1GO3F 4KMUA 4ZRJA 4U6PA 3F2CA 2ZPNA 3QIJA 2WF7A 4PZOA 3CW2C 5ALIA 2E6XA 2KDIA 2RPVA 2ZIUA 1ZQKA 2IGDA 2XI9A 1C20A 2V4LA 5GMVA 3EA6A 1DOXA 2J42A 1WCLA 2R18A 2N9XA 3N1XC 3KLSX 2ZNVC 2YY6A 4RH6A 2VJ4A 1X2IA 3TANA 1G6JA 3RB6A 1MG4A 1QF6A 9ICVA 2DENB 2FUHB 2CJNA 3U2SC 4NLBA 4NLNA 3A9KA 3S6JA 3RCZA 2JGAA 2J7QB 5HNKA 3LWLA 3V7KA 1XO1A 2W9AA 3RR8A 1WIAA 4JGHB 4HLEA 2NBWB 2K4IA 3D6JA 3EHVA 1OQQA 4YT0B 2IO3B 2LHEA 2FPLA 1QOFA 3PVLA 3PX6A 1NK9A 4Y2JA 1J2NA 1TVAA 4DLGA 3B2GA 3TEXA 4AP4C 3GV7B 4ARIA 1KTKA 1L3UA 1TGZB 2ACZB 1WG8A 2JZBA 2V4QA 2WXHA 2EQYA 4HAIA 4UAZA 3Q69A 3R66C 4K4HA 2PKOA 3OG5A 4IS7A 2HBJA 2B21A 2FMSA 1C79A 2G4DB 2ZJDA 3DCGA 4GFJA 4MEMA 1ET6A 2NCNA 3ONSA 1VRAB 5BMIA 4DDGD 4WH4A 2FLLA 3JW0X 3I63C 2DAJA 4IRKA 1WJ6A 4KLHA 4EZ9A 1L4ZB 4UB2A 3PY8A 4UARA 2LPEA 1ZQHA 1ENFA 1JWSD 3G6XA 2PI4A 4Q2JA 4DL4A 3W2DA 3RRGA 1SWVA 5ALQA 2WXQA 5KFMA 3EPIA 3APCA 3DBHB 3OJ4B 4UBCA 4DDID 2J0JA 4PH5A 4WJQA 5C1ZA 5JHBA 1ZD5A 5CJ7A 3H1UA 3K1RB 2XICA 2G06A 2FMQA 5AKLA 1JQ4A 3IAM1 1XD3B 2GOWA 2AQ3B 2WFAA 2KKCA 1PUZA 1Z00A 1JXEA 5KTQA 4HKZE 2K4HA 1NZBA 5ALYA 4MACA 4RQ8A 1SEBD 1TK8A 2KT7A 1T6BX 1WRIA 4B9SA 4ZYNA 4M04A 3UXPA 2SAKA 2BKFA 2BYVE 2ZVOA 4IM2A 5G55A 4EYHB 4ECSA 1L8OA 1YZ6A 1JI7A 3WK4A 3C1ZA 3UIPB 2XGPA 1VZ6A 3FAHA 1B1ZA 1D5XC 3PLVA 3ZKJC 3ZQ4A 3AEAB 3BQ7A 5ALDA 4GLXA 7ICKA 4HPPA 2NYVA 5J18A 1SE2A 4ED3A 7ICSA 4HJGE 2IBIB 5AK4A 4M9HA 1HE8A 1K52A 4F3OA 4EEKA 3CYMA 1U45A 5T8IA 2ZJ8A 9ICBA 1ZQEA 3IG5A 8ICBA 3GZFA 1E8XA 5AHXA 3ZD8A 4G3XB 2OM6A 5KT5A 3F2BA 4DS4A 3H40A 4MFAA 1F1HA 5KFPA 1P7EA 2VIXA 4ACOA 3Q8FA 1XT9B 5CB1A 5KG1A 1S0MA 3AE5B 4HPLB 4DL6A 1V9JA 2MA9B 3SAGA 4BKGA 3RJGA 3LVWA 4EZJA 3LXFA 5F9NA 4JV2A 2K8HA 2AQ2B 4B0EA 1TKDA 3C8YA 1Z1VA 4D2KA 4DXAB 2OHFA 3QZ8A 3AE4B 4YXJA 3W1SC 3GE3C 3RN9C 1BGXT 8ICMA 1YMHE 1TS4A 2MBOA 3T5HA 5K4LA 4IWPA 4PYUA 4RU9A 1ZOLA 3APDA 3N4MB 2MP2A 1JRUA 4DOCA 2AQ1B 4M8NA 4C00A 4FBUA 8ICJA 3T3NA 1NK6A 2A4ZA 3IT6B 4OVZA 3ML8A 3HK0A 4UDUC 1HTOA 3F53A 4R8UB 1NOMA 1O08A 5EE1A 3N7PD 1E8WA 2AX5A 4TURA 3MC1A 1KOTA 4XQ8A 5JH5C 1WZ3A 4W9LA 2DLBA 1X9WA 4YXDB 4TQRA 4PGXA 5AZFA 2F77X 5EOZA 3EYZA 3HPOA 1RRBA 5KFTA 2RRDA 4B9TA 2CHXA 4F4YA 1RG6A 2IGGA 4DWFA 3RF9A 2G08A 3SHQA 1SGGA 2ZJAA 3ZYYX 3IVFA 2WAQF 1UGMA 4DL5A 2C9WB 1K53A 2KMCA 2K6DB 5DG7A 3MR5A 3BQ1A 4MFCA 1JWUD 4BXOB 2L05A 3E9SA 3KW5B 4ED8A 1EUVB 2UU7A 2CKHB 2C2DA 3HM6X 7ICNA 1ZQ1C 4DQIA 2W8KA 4M0AA 1J7AA 2W7OA 4ANXA 2G07A 2HHTA 3LK9A 2NO4A 1L7NA 2BCUA 2ZTEA 3WK6A 4QWAA 1AROP 3AE2B 3ZW3A 1ZQDA 1X42A 3V60A 5KFOA 1KKXA 4NZLB 4FS2A 1E90A 1V86A 3PTFC 2G5IB 4O9MA 4RT3A 1F44A 2J6SA 4JWUC 4ECTA 3PW2A 2DKZA 3RJIA 4FS1A 2ATLA 5J0WA 2BS4B 2R8IA 4P16A 4E71A 1T8EA 3BVMA 2A19A 3HW8A 2K8CA 3QUBA 2PMVA 1TS5A 5AI4A 5DGBA 4AUQC 5D3IB 3QU4A 1E8ZA 5AIBA 4QZ9A 2IDYA 2KMMA 1KTQA 3U8ZA 2C28A 1YQ3B 2RP5A 2WNMA 3M6KA 1ZP0B 1BMLC 4DXGA 4WAFA 5ALSA 2BBCA 1MHHE 2BW2A 9ICNA 2HDOA 4UAVA 2R8HA 4OVVA 2M56B 2HCFA 3ABVB 2A1JB 4E3CA 2C5LC 2K6QA 1N62A 3SV3A 2IJ0A 2QB1A 5J0TA 4XGAB 1UPHA 2RGFA 2V0GA 2EH9A 3MC0B 1IPGA 4JV1A 2NRTA 4US9A 5D3DA 4CGZA 2O6VA 2FMPA 1KFSA 1Z4OA 2KNBA 2K8AA 3H8SA 1SV0A 4RT2A 4YMMA 2E8PA 2D3BA 1UUPA 2JR5A 1ZDXA 2DZKA 2GMIC 1C7YA 3BWUD 5J2DA 3ECIA 2GWSA 1NENB 2KE7A 2WX1A 4ED6A 1QOBA 1QSSA 3UMGA 5CRXA 1C78A 4TKNA 2DZMA 5D94A 2AGPA 3JPNA 3AU4A 1H4RA 2KNJA 4BGDA 2BB6A 3HP6A 4QJFB 3RYTA 1LKYA 3VCBA 1K1QA 4I2FA 4CF5A 4C8NA 5DGAA 1C1YB 1X66A 2KZMA 4F4ZA 1WXMA 3PSPA 4BUGA 3DBLI 3QX1A 2FIDA 2PVGC 5D46A 5TSSA 2WDVB 2CU1A 3H7IA 1NEKB 3GB1A 1KN5A 4KX6B 5LXHA 1HJPA 4RQ0A 2LWPA 1MG8A 2R2OA 4AQ7A 2MH7A 2MQJA 1GOZA 3QNMA 2D10A 4JV0A 4QZCA 4BZAA 4KGTA 1A76A 1NK5A 9ICHA 4NJ8A 2FCQA 4MEYA 2J6TA 3GILA 3N97B 3D2SA 4I2JA 1UGJA 1WY8A 2BWFA 5J0SA 2NBVB 3V6HA 2WXPA 1VCBA 1URJA 4PHAA 4B9NA 1WWUA 1YJJA 2WB1C 3WAPA 4MJSA 3NG0A 4FFDA 4EKUA 1ZQSA 4PS8A 3RMKC 3NOBA 1MJDA 4P0PB 2ASQA 4M0WB 3E0FA 1I4GA 2O6VD 4IQUA 2FIFA 3W9CB 5L1MA 5J0UA 3VUXA 3M9MB 4Q8FA 5HFYA 3ZXRA 1COKA 3BZKA 2WP9B 1DGJA 3ZDDA 1QQ5A 1KQQA 3JYUA 3PNCA 2KEYA 2KTQA 1F77A 2KFKB 1K8RB 2KD0A 2JXJA 3HWTA 1V1PB 3ISBA 4DOAA 2PVOD 2YN4A 1MHXA 2W9CB 2UVWA 1ZD4A 2W9BB 1XXGA 2KTRB 3SAFA 3KKAC 4UB8U 3I1YA 1XU4A 2FDRA 4MH0E 4RNAA 3WK5A 2NRWA 4F8RA 3JPRA 2BGWA 3V7JA 2DWQA 2DYBA 5ALUA 5DKWA 3MFGA 2ZNVB 4OCZA 2WTFA 9ICMA 1M4VA 1CQVA 4F4KA 1SE9A 4C80A 4CE6A 4YTNB 2HHVA 2ZIXA 4HPMB 2V3SA 5IIOA 1H8CA 3MC9A 1FRDA 1NI2A 4LCDE 4C8KA 1F0MA 3OHBA 4OZAA 4DSJA 3AE1B 3NHEB 1GC6A 3I5JC 4ECWA 7ICTA 4B6JA 2JUOA 2QCZA 1TAUA 3IG8A 5KFLA 1WMHB 3UQAA 2HD5B 2KVCA 3A1QB 5AKYA 2OEHA 3L0WB 4WWPA 3VH3B 2FI1A 1GJZA 1FXAA 2RSUA 5LNK1 2CXYA 2Y3AA 3ZNGC 5ALPA 3IDWA 4Y2SA 2JY6A 3FKYA 3NASA 3GV8B 2J52A 3CWIA 2OJRA 3SU8X 1ZRNA 4A6QA 1V97A 2JRZA 3QHTA 2P35A 5TZVA 2KIWA 1Q8KA 4TQSA 9ICTA 1L8LA 3C23A 4QZDA 5FR3A 2HHWA 3PO0A 1A5RA 1FNWA 1SXTA 4MM3B 2DZJA 3EECA 3KQ4A 1A70A 2JWZA 4ANUA 4WQOB 1ZJMA 4ANVA 1S9FA 3RI7C 2EAPA 4I2EA 1EU3A 4HROA 2OWOA 4ZRIA 2GBMA 5L1LA 1Y56A 2D11A 3WKDA 5KG7A 2UVUA 1ET9A 3ZDTA 3U7ZA 1TZ1A 5DQIA 2ASDA 3DDHA 3IV6A 3M95A 5DB7A 1TKYA 3FYHA 1EXNA 1L3SA 3BYTB 1S8OA 3AEEB 5H8YE 4NY0A 9ICOA 1OUQA 1QCKA 4NXZA 4LZGA 3H0LB 3B2FA 4F4WA 3AEDB 5ALZA 4ECZA 2LMCA 2LEKA 2WDTB 3H7PB 3LB8C 4RNOA 3U4EG 3K9OB 3NRWA 1WM3A 1N48A 2P6UA 3PRPB 4FN2A 3SDLC 4DSLA 2HVHA 2WF6A 3KTQA 4C8OA 2V9WA 5J17A 3I3TB 5AKHA 2QB0B 2ZEQA 3C0RB 7ICQA 2DL0A 4W9EA 3PHXB 1WWVA 4J03A 3ETRA 3DDCB 3E58A 4KLDA 4OZCA 5ALHA 1XLNA 2PXIA 3QU5A 1TTNA 2VANA 4JIOU 4TUQA 3TFSA 3DBRI 2KAJA 4Y2VA 4ZHOA 3A9JA 3HX0A 2V9HA 3KWVA 1AYFA 4ICUA 1PUTA 3RBDA 1ZQJA 2X8XX 3PW5A 4YG2A 4RF0A 2Z59B 3L17A 3MTNB 4ACFA 2JQRB 4AJYB 4F50A 4YWGG 3I9V1 2F76X 5HR7A 1T4GA 1ZQYA 3J81j 3HIZA 2ZUDA 1NVID 1D6EC 2MU2A 3VHTC 2KWVB 3RJKA 2MBQA 2LMRA 1S10A 4DHZE 2W9NA 4KX3A 4MELA 1Y8RC 5IN7A 2EZXA 2HOFA 2WXRA 2OXOA 2MUTA 1WXSA 4FZLA 2BDUA 2LYHA 1RQLA 2AXTU 4JWSC 4N58A 4FADA 3W5UB 1RXWA 4GC6A 4MGZE 1ZYQA 1FXIA 3M9OB 3H0RB 1ZOYB 1FEZA 4WJOA 3V7LA 4CNQA 2P6RA 2N7EA 3AEFB 3DVNV 1KLVA 1OGWA 4OJ5A 4ANWA 4MGYE 4DQSA 5A0LA 1AWDA 1N60A 1B0XA 4MGIE 5DQHA 5J0PA 2A5UA 3TACB 5D7GA 2G0AA 1SWWA 3ZDCA 2GBNA 1N56A 3T3FA 2HHQA 4XUSA 3AUOA 4A90A 5KFJA 4W9FA 1ZDVA 2PIAA 3H8WA 3KHLA 1QZEA 1LB2B 3AECB 3KZIU 2KP7A 4OHJA 1N61A 1V49A 2DAFA 5FKAC 2XK5B 2W8LA 9ICGA 1T5XD 2K5PA 5HG2A 3Q8CA 2Z0DB 1TY0A 2FCMA 4YR2A 4M9GA 4II2B 3BS5B 1E5WA 1IP9A 2NPTA 3HVDA 3Q8AA 4AWJA 1J97A 2KVRA 4ZDVA 4PL2A 3Q8QB 3MDAA 2MJDA 1F2RI 3L4PA 5AICA 1T0RC 3AXCA 4TUPA 4ECQA 4WWMA 1SV4A 2INDC 1SIJA 3H0MB 4C8MA 1P7DA 8ICYA 4YSYB 3T9LA 5IAAC 3MR2A 2JXTA 8ICLA 1XWLA 1U47A 2LRWA 4DQQA 3KUZA 2I1JA 2LVOA 4YN4A 2C2EA 3VVWB 3T3OA 7ICVA 1SJHD 1NKEA 3TIXA 2G45B 3HKZF 1UBIA 1YX6B 4NAMA 2C2RA 4C4VA 4DLEA 5KFKA 4MF8A 1P7FA 3EZ5A 2GRIA 4BWMA 2O6KA 3FDSA 1DYQA 3ZJUA 2BCRA 8ICZA 4O3RA 8ICCA 1FFUA 1KBUA 1M6YA 4JE3B 3PPAA 2JMGA 1E6EB 3QK0A 4HKQA 2JXXA 2JPHA 1VZ7A 2KK8A 2N7DA 4PHPA 3TADA 2PW9A 2F1HA 2KZRA 4XA5A 2D3DA 5FR6A 2DHZA 1V85A 2IGHA 3PZ8A 4DFDA 1KRHA 2J0KA 2H89B 4NLGA 4EE2A 2QSDA 4B9LA 4XYCA 2VZKB 8ICRA 5F3XB 1ZQWA 2I5HA 3H4DA 5KFUA 2E1FA 1WR1A 3BDPA 4F5NA 4ECUA 1R4MI 5AIAA 2IBKA 4HCPB 2HTHA 1MPEA 4L1BA 1L7YA 5JXVA 2HTME 4Z6EA 1ED1A 3AEGB 4H2AA 1L2NA 2Y0SF 1RPLA 1RYSA 1P0RA 1WE6A 4WJ3B 5T14A 2KJ6A 4RZRA 2FPKA 5KG0A 5J2EA 2M4NA 3M7DA 2OYYA 3BQ0A 4K7WA 3JPTA 1K5OA 2RDGA 4YR3A 1TIFA 2YX8A 1SSNA 1L0YB 4KLJA 5C3JB 2ZUBA 2JU6X 4LDTD 3UPQA 1AN8A 1WUDA 2D3AA 4M00A 4B6WA 5BOMA 2PEAA 4C4RA 4DL7A 4DSKA 2ZG6A 3ETLA 2E8OA 5JRTA 4CQNA 1UWXA 3GDXA 1LO5D 2XO7A 1Q1OA 3PREA 3X0WA 5E79U 2JRHA 2KC2A 4NL9A 2BT6A 2KANA 2VH2A 4M6WA 5GTIU 3ISCA 2WQYB 1WX8A 3H6NA 5KHOA 1KEJA 1MVKA 3TMPB 1CI4A 2DGZA 3IP4B 1FD6A 2KVSA 2L52A 9ICJA 9ICUA 2M1MA 1RYRA 1T3QA 4G50A 4KV2A 4XX5A 4Y2PA 1KJTA 1OQYA 3JSVA 3QJZA 4F92B 2KDMA 1D8LA 5ALXA 3Q3OC 3E2EA 4R64A 3TJPA 4CF3A 3Q3MC 3N1ZC 2E3TA 3BVGA 1L3TA 1WM2A 1ZRMA 4PS3A 1SKRA 4C7YA 4RFBA 3URYA 2NRXA 5D4BA 5DB8A 4Z6CA 5MPOA 4M9NA 5BMGA 1EWYC 1NI3A 2W03A 5E6PA 1BPEA 2I1KA 4PGYA 4P1BC 3RZWC 1X6IA 1BVSA 1FNVA 5HHIA 3HHMA 3PW0A 4F2SA 1CZPA 7ICPA 2R61A 3WK9A 2LI6A 1WGKA 5AM2A 1YT3A 1WJUA 3PO5A 4JL9A 4EZ6A 5AI0A 2PE6B 3LYYA 1ZQIA 1OW5A 4DWIA 2F3NA 4AP9A 2H3VA 2WGSA 2Y5PA 2XY5A 4LJOB 2HBKA 7ICHA 4TUSA 2LM1A 1ZXIA 4BFRA 2I1QA 8ICPA 3V61A 5BMHA 3WK8A 5IKCM 5ALVA 2MBBB 4DHJD 4MFFA 3PV8A 4K81A 2BPGA 4O3NA 4GN1A 1N5XA 3K9PB 1ZQNA 3Q8MA 2W7PA 1SF0A 3AU5A 4QW9A 1UQVA 4G11A 1WYGA 2JF5A 2KOBA 2IA6A 5J8YA 4AJWA 2WB1F 3PV1A 5ALEA 2C60A 1ISNA 1GPXA 4HEA1 4GIVA 3P42A 3KH0A 4G9BA 4BVUC 2GBRA 4UB1A 1TV9A 1GB1A 4LTUA 4FULA 1SKSA 3V3XA 1E7UA 4P4OA 1HUZA 1D5MC 2H3ZA 2LVQA 1XQQA 2DX5B 1QILA 4DSEA 1PZNA 4RCOA 2YEPF 1Y88A 4HK2A 4HYKA 3M9NB 4YR0A 4XRHA 2RD0A 3OAWA 4RQMA 1I42A 2W9MA 2WXGA 3BQ2A 4ZRKA 2JH7A 3PZPA 4ECRA 4DFKA 2VA2A 2QIEB 1HEZE 4P0QA 5L83A 4GIBA 2VA3A 2Q5WD 1RLFA 4GOCA 5KFDA 2AYOB 3Q8LA 1SZPA 2L76A 2UWQA 5AK5A 2NTSA 4OO1J 2NS5A 4P7IA 3VTUA 5IA7A 3MGIA 3BQTA 5AK6A 4A8EA 4F4XA 4EBEA 4C4SA 1FXTB 1S0NA 4QNLA 2LJ5A 4N6EB 3ALBA 3K75D 1NYQA 3J9CA 5D49A 4I6LB 5KFSA 4QZFA 2ZZPB 4FZNA 1HIWA 2M8SA 3RD2A 5J2RA 5AI9A 3IAS1 1L5UA 3BK1A 2C22A 1ZQBA 2K8BB 2W04A 4UB3A 2EELA 2L8JA 5B66U 4GXBA 4W9HA 3RB3A 2YMQA 4HVBA 2CS4A 3L13A 4Q8EA 1WR6E 2M19A 1FEHA 3H8JA 3FILB 4FZMA 4GDLB 1GB4A 4YVZA 2IHMA 1P9DU 7ICIA 1BNPA 2B3AA 1NDDA 1SXDA 3RT3B 5J0OA 3JPSA 4DFPA 1ZQLA 2F8KA 1L7MA 3AMZA 2JX5A 3NRZA 2Z7JA 4AYBF 2Q0ZX 4NM2A 4XE0A 1PK1A 4WURA 2WHEA 4M2YA 3TEZA 5GTHU 3DHHC 3HKZC 3N20C 5J2BA 2LVPA 1RDFA 4KIKB 5ALWA 2DQNB 3AL0B 4LNOA 4I29A 3PR4A 1CK1A 4PYZA 2KK0A 1C3TA 3VTVA 8ICKA 1SV0C 3SEBA 2NPTB 2F44A 2W54A 1BPYA 2ZXIA 2AEHA 3OTQA 4DK5A 2ZUCA 1EWCA 3H4BA 1B9RA 4XC2A 3PR5B 3R2IA 2XEWA 3CIRB 2LUEA 1VJKA 3AE7B 1EM7A 2R2QA 2KN7A 4XWTA 4YL8A 3APFA 4I2CA 2PJHA 3EFCA 5KFAA 4J9RA 2WXKA 2ZXHA 3DBSA 4AS1A 1C9FA 5HKHA 1TBEA 2QDFA 3KOOA 1T0SC 4E74A 3L08A 5BYSA 4YTMB 2KKVA 3HT3A 1WX7A 1SIFA 2WF9A 3CRXA 1FRRA 5CWRA 4II3B 4L23A 2Y0SC 2YQEA 3WKBA 3TFRA 1XEEA 2WXJA 4GDKA 5DG9A 4N59A 4QWEA 4GXJA 2AQ0A 5J2HA 2G4SA 1KH0A 3P2BA 3HM3A 1WJNA 5TR5A 2HHUA 1UBQA 2O2VB 3KFUF 2CR5A 3GE8C 1SE3A 4MSQB 4RQ7A 2JHDA 1WI0A 2IO2B 4QZEA 3LDAA 8ICSA 3DOWA 1HQRD 4KKIA 2PI5A 5BPCA 1KSPA 2EKIA 4O1NA 5KT7A 1HTQA 2W11A 4DSFA 1L6NA 5ALKA 4FBJB 3GZNB 3GIJA 4W9DA 4IQWA 2BYEA 2N9LA 3BVZA 4DF4A 2NMQA 3K1ZA 4RNMA 4ZRQA 4GB9A 4QWCA 5EE9A 4EX7A 3AE9B 1J19A 2HJ8A 4C4TA 3Q8PB 3DVGX 3QUQA 5E6OA 3UMCA 1L6VA 1UF0A 2JRIB 3DVGY 4A3PA 2M0XA 3PSTA 4YMOA 8ICQA 1IM4A 5HMMA 2KFZA 4BOSC 3NY5A 4ZH4A 1XLQA 1XCQL 2ZIUB 2HVIA 2N4FA 2D07B 4Q43A 5L1JA 3GS2A 3TAPA 4DCCA 4P4PA 1N2XA 5DQGA 1DRGA 2BQQA 2DZIA 4BAXA 5IOIA 2OEDA 5HR6A 2QARA 3QUCA 4RQ4A 4I2HA 2CHZA 2HW3A 3IXSA 2PFNA 3AE6B 3F5EA 3B08A 2BVCA 2XCAA 2LXCA 1ZQZA 3KHGA 2KTFA 3A9KB 2F2AB 1UA1A 1P1AA 1IBXA 2WU5B 2REXA 1S1QB 2EMSA 4ZRPA 3MABA 2BGFA 3ORYA 2GH1A 3AEBB 3V62A 1U48A 5DPRA 3FC4A 2V3NA 1XNSA 4ELUA 2ZPYA 2JZPA 1F52A 4UW9A 3AULA 4FJVB 4F93B 5KAFU 2EZYA 5J0XA 1XLPA 5B5EU 9ICKA 2JZBB 1KLUD 3WKEA 3BIID 1MN8A 1S5LU 1UT8A 1PQSA 4Y2UA 3UXOA 3SQIA 4GSWA 2BZFA 1NK4A 2ZIWA 3P4QB 3IM1A 3PMNA 1Q46A 1E7PB 1ZD3A 2H3FA 3PSFA 3L54A 1VDVA 4KVGB 4RGTA 1E8YA 1NJWA 2FNJB 3MHSD 4OJPA 4HWIB 1LXDA 3M8RA 1R4NI 4M02A 3RNBC 4BOZB 2ZIVA 3ZTDA 2MJ3A 3PRZA 2WDRB 4ITKA 2KD1A 3SD7A 4DSIA 4W9IA 3A4SC 5GXGB 1JN3A 4KN7A 2FLNA 4B9VA 4LZDA 1JWMD 3N9YC 3TARA 2L0TA 4RNNA 2QEJC 2GO7A 2DPIA 5KFVA 1Z00B 5AKZA 3PLUA 2NO5A 3ZDEA 2AWTA 4I28A 3B0XA 2MBHA 3C1YA 2I38A 3DBHI 1OQRA 1V5OA 1P98A 3RJFA 1Z19A 1JW9D 3QE9Y 2DKXA 3RH4A 3T5JA 1L7OA 2GB1A 4MSMB 3WKAA 2KVZA 4IR9A 3L10B 1LVHA 1MI0A 4B0MA 1WJ4A 3UI3A 3OJSA 2KSOA 1L0XB 2DYOA 3VXWA 1XF5L 1HA5A 3QWZB 3ZD9A 3N32A 4JLCA 5JTIA 3AN1A 4W9KA 5CHFA 7ICLA 3G6YA 2NV3A 1HUOA 3E56A 4AYBC 4J9NA 5BYRA 4DQOC 1V2YA 5DLFA 3R8BA 3U7DA 3U52E 4QZBA 2LGDA 4ZHPA 5AKJA 5L1IA 4QWBA 1YZ7A 4J9OA 1N63A 3ONNA 2KFNA 1WGHA 2BB5A 7ICFA 4C8LA 2GOLA 5HI1A 1V81A 3NGDA 1NK0A 3Q6BA 3RNCC 5DCNA 1UT5A 1F9JA 5IIMA 1PGAA 4OJ6A 5DDYA 4K7UA 2WXFA 5IIKA 4ELVA 1FM0D 3UMBA 3Q8EA 3MP9A 2KX0A 1YD8U 5H92C 1FMAD 3MJ5A 2XY6A 4KLSA 2JEJA 2AGOA 1NKCA 3TCAA 3RAQA 1DOIA 9ICIA 3T5LA 9ICXA 2XIDA 8ICIA 4LNFA 2Y9UA 3RB4A 4ED0A 2LASA 2KJRA 2MP2B 2WXNA 3F2DA 1MC8A 4TQ1A 5CHVC 4WIPA 1UD7A 5J0RA 2LHDA 3AV8A 3WCQA 2GLEA 5KG6A 1PVQA 4YFKA 4KTQA 1CEZA 4US8A 1DK2A 2KACA 2MEKA 1KM7A 3PRMB 1V38A 7ICUA 3ZGZA 2ZCCA 2WXLA 1Q3VA 2OH2A 4O5EA 3Q8BA 4KLLA 2KOXA 3MGHA 4KLOA 2BS2B 4F5OA 2HMXA 2BPCA 2WXOA 4F72A 4O3QA 4DF8A 1QOGA 5FP0A 3SI8A 2FE9A 5KFRA 7ICRA 5D2MB 2AHOB 2JVCA 4K4GA 1YNTE 4DQPA 1U9LA 5JU5A 1J0GA 4QZ8A 3T5KA 1ZQCA 2AL3A 5FK9C 2N1WA 3DQVA 4YSZB 3B1LX 2D8CA 1VR9A 4KLUA 1TJEA 3EW9A 4F8CB 2EAOA 2RQ5A 5ALTA 1DK3A 3C19A 2F8LA 2B76B 1Q5WB 1TYGB 4ICVA 4KGRA 2NRZA 2JV3A 5KFHA 5G5HA 3SAHA 2RDJA 5CR0A 3PVXA 1PDXA 1WGRA 4UAWA 4M01A 1YOVB 1ESFA 1BPXA 1TK0A 2ASJA 4IWQA 3AM9A 4F71A 1WZ0A 4ASWC 2ICIA 3KUDB 3SV4A 2IYDB 3IG3A 4NLCA 5G2NA 2M0NA 5AKXA 2BQ3A 2DNFA 1WGDA 1TE2A 1PVRA 1A77A 1V9PA 3ALRA 3CP8A 2K8CB 3RTVA 9ICEA 2KMDA 1FNUA 1UELA 4JB3A 2ESEA 5AKIA 2IO1B 4Q45A 3AE8B 5CX3A 3VR8B 2HHXA 2MJEA 9ICSA 4FJYA 5DPWA 2DUYA 2QC8A 2OCEA 3RAXA 2MBEA 2PMZC 1CJEA 1CRXA 2F1IA 2L0FA 3BY4B 1QT9A 9ICCA 3QUTA 3C5GA 4I2AA 3PZDA 4NJCA 1STEA 2LM4A 4O3SA 3KD3A 4ECVA 3M62B 2AU0A 3ZDMC 5L95C 5EDSA 4KLEA 1WF9A 1LQBA 1ZQTA 2V4RA 2ZJ5A 1TT5B 4CRXA 1SJED 4DL3A 2O6VB 2G09A 4QIWC 4QWDA 1ZQFA 3B0YA 4YQWA 2KLCA 4C56C 1T0YA 4I2IA 2LGSA 3L16A 5AUIA 2A1AA 3ZRFA 1UHUA 4USAA 1XLOA 2RMMA 2JT4B 5KFYA 2N0SB 1IUEA 1P3QU 2J0MA 2JWUA 1YQBA 3N28A 4KLGA 1UCVA 5ALJA 3B9JA 4LK0M 4RMAA 2PFOA 3OSNA 1I7HA 2XVTA 2C7MB 1D8YA 2CN1A 4KLIA 2KN4A 2LGYA 1LKYB 1OEYJ 3VFKA 2R8GA 4IWOA 2L5YA 1JX4A 1PYWD 5DB6A 4WAAA 3MR6A 1N5WA 1BNOA 3D2NA 1K50A 2JYTA 2VH1A 2KJHB 9ICRA 2OJWA 2QHOA 4OJOA 1NKBA 2KJ9A 2Z8LA 5BYQA 5AKEA 3RJEA 3A33B 3QXGA 4NL9C 3UF8A 2KIVA 4R8UA 5F9LA 4YD2A 5J2FA 2WU2B 2HOQA 2JEFA 3EC8A 2HDEA 3IRUA 3I76A 2ISOA 2LKYA 1A6SA 1X40A 4FHJA 1RYJA 3RNGC 1KFTA 2LGXA 5KL8B 1F2RC 4MJSB 4J9LA 3IN5A 3MBYA 3L5KA 4YMNA 2WHIA 5CHGA 1D4BA 1BXTA 4RGOS 3ICXA 4MDKE 2G9HD 4XDCA 1MQ2A 1NBFC 1TAQA 5IO9A 4DO9A 1JWAD 4ARCA 1XSNA 2BYFA 5LXIB 3DHIC 5ALNA 1BPDA 1JALA 3JPOA 1V6EA 5AKGA 2KJ5A 3D32A 4PHEA 4BXOA 4LNIA 3ZUNA 8ICXA 1QKZA 5EWEA 4RQ6A 3IHPC 2KV2A 5AI8A 1KLGD 1OFFA 2L83A 5JZEB 4K4IA 4KZCA 4CF4A 4RPXA 1ZQOA 4NLZA 5DG8A 4P1CC 4JX1C 5IINA 4EELA 1T3NA 2AJQA 4B9KA 2W3RA 2OOBB 5IIIA 3SZ2A 3I57A 3ZTCA 1SE4A 1BPBA 5KT3A 2BF8B 4DFJA 4EZLA 3KBBA 2K9XA 4UAYA 2AQ4A 2MWSB 5AZHA 3MDCA 3HVZA 1I35A 4OW0A 1QQ7A 2D3GA 5KL1B 1WXAA 2ZW0A 3KWLA 2E1EA 3PX4A 4EEYA 4KGSA 3UQ0A 5J8YC 3LVVA 1FPYA 2ZIXB 1QQ6A 2HHSA 1UA0A 3O13A 2A1JA 8ICVA 2IO0B 3NVVA 4RM8A 1XSLA 4FBTA 4O5KA 3BZCA 3QAQA 3I28A 4A3OA 4IC7B 4R66A 4KKJA 3V72A 2N7JA 2TSSA 1MFWA 1Q10A 2HI0A 3ML9A 1ZQGA 4F1SA 4KDIC 4CYEA 4S0RA 1HEKA 2BR0A 2UYZB 3DBLB 2K4PA 3LWMA 1J2MA 3ZDAA 9ICPA 1DXSA 3C2LA 1ZUD2 4RPYA 4RGMA 2IOHA 2WLBA 3CSFA 4ZYSA 1AQ6A 4I6NB 3ZJTA 3CNHA 3NZUA 3QQ8B 3Q3NC 4A9AA 5KFWA 3OSPA 1Z1BA 3RR7A 1V8CA 7ICEA 3PSIA 4UATA 1YJIA 3AE3B 3WALA 3M6ZA 3ZNID 2FLPA 1Z2MA 1XO0A 4DOBA 2YEPB 1VLBA 3QX7A 2YTUA 1NJXA 4RPZA 1NK7A 5DPSA 8ICGA 2ON8A 2VRRB 4IL6U 2BKRB 2IY0B 4NJ6A 4EENA 2MLBA 4O5CA 2NVUI 2BYTA 1ZQVA 3KHHA 2A3VA 4BDPA 4K3CA 2EMTA 4JQWC 2CRXA 1MSWD 3RRHA 1XS9D 2K39A 3HJEA 2KZZA 4ED1A 2WF8A 4O3OA 3ZLZA 2LYAA 2QJLA 5ALMA 1ZQMA 4EEWA 4LVSA 2RDHA 4PJ0U 2BPSA 1TFRA 4YXMA 3PT2B 1ZQUA 3U26A 3U30A 1QOAA 3MFHA 3A4RA 2KICA 2N9EB 4JK1A 2KWUB 4CO7A 1R4NB 4EZKA 5CP2A 4FJZA 2M0AA 5E6NA 5AUKA 4KX5A 1YN4A 4WWNA 3RNFC 2CJOA 4I27A 4RQ1A 1XC9A 4P0PA 2ALZA 4M0WA 1QH9A 2CHWA 5KFNA 3Q3FA 3EPGA 3C2MA 3M1YA 2GI9A 4KLTA 3RBEA 3CMMB 1X9XA 2R8JA 5IILA 2L32A 2PE9A 4URKA 4TV3A 4EX6A 5EWGA 3Q3JA 3RPFC 2WXMA 1TS3A 2KLGA 3A9JB 1D8BA 1S77D 2KFJA 5KT2A 2D6FC 1GC7A 2KFKA 1NJZA 3P4SB 4NAWA 4F5RA 5CEHA 1KL9A 5AM0A 1V1PA 2DBYA 1OTRB 1JRPA 3MGVA 1SKWA 1ZKHA 2LZ6A 1E0ZA 3AU6A 3PS6A 4MGKE 4IUMB 2MHJA 3NVZA 2W9CA 4BKTA 2KTRA 2W9BA 3P1MA 4J9KA 3T79A 1IG6A 1QLBB 4I6PA 4U7CA 2VKQA 2V1YA 4UASA 4J3OD 2MUTB 1D3ZA 4YCXA 4Z6DA 3ZNHB 4FA6A 2K22A 4K7SA 4QZHA 2HBMA 4PGQA 3PW7A 3LJ3A 1HZ6A 4JWMA 2X38A 1KW4A 1ZQRA 5ALOA 1KFDA 2FAZA 2K0PA 3OLMD 3NUQA 2I9GA 1GAQB 1C4PA 2Y1IA 2ISPA 1YJ1A 1SXEA 1LGRA 4W9GA 3NVWA 2PTLA 2AH5A 3TKAA 1QSYA 1M94A 4Y2XA 3UINB 2K4EA 4RM9A 9ICFA 5KHQA 3GOEA 4DXFA 3MC8A 3SYZA 2N9PC 1Q3UA 4M9LA 4ED2A 1VJ5A 2JH1A 3AEVA 1NJYA 1WMHA 2XCPA 1WXVA 3A1QA 1BUIC 1ACCA 2FE8A 2G1EA 3GIKA 2NR2A 1MA7A 1PGXA 3HRDD 3LDZE 3SMVA 3QEAZ 4IG7B 5C2TB 2YLMA 3GP7A 1T94A 3SENA 3BYYB 2WF5A 5KFGA 4FHKA 4PK1A 4KITB 1JCKB 2F1JA 1TK5A 1NYRA 1S3SG 3RB0A 5C23A 1T0QC 4XWWA 5AKKA 2ONQA 4MM3A 2KQSA 4MF2A 2SEBD 2KQ4X 4KSLC 3DWMA 3VTWA 2IPKD 3ISDA 3DVNU 3DWGC 3R7QA 2K3UA 4A55A 3IFWB 2KXJA 4IW0A 2XY7A 4IM0A 2ZTDA 1S97A 2WWZA 3KYCD 4CCHA 3Q14C 4JWNA 3RH6A 1YX5B 4LDTB 1EF5A 2RDIA 1IGCA 2BQRA 4G3IA 4O0IA 1JMLA 4GGQA 4DEZA 2K1FA 1SBBB 3RZFA 1ECWA 1YQ4B 1Z4NA 1WGGA 8ICHA 4QAYA 1NZPA 3H7PA 4C4VB 5KFIA 1ZETA 1FFVA 1L3VA 2MCNB 3DBRB 2MSED 4K1RB 4IDIA 2KHVA 3QCAA 3S2AA 3R2TA 3W5VB 2Y1JA 3RNAC 3RH5A 3VUYA 5AI6A 2QB0A 1LFDA 4DQRA 3A0HU 5CTRC 1PK3A 1MQ3A 4JPSA 4KN4A 4OVUA 3GV5B 3N7SC 2KX3A 4OJLA 3EGRA 4L2YA 1FO4A 4M9JA 4NQKE 3ZVVA 1WFYA 3B0AA 2EAMA 3NTUA 1X1MA 2LHTA 1RWSA 3UQ2A 2WXIA 4RQ3A 4S17A 2IY1B 2R8KA 3GU3A 4B9MA 3H7SA 1EU4A 4I2DA 4CHKA 1K1SA 1FCCC 3V05A 1RQNA 3O65B 3QC8B 4GLSC 3MFIA 5J2JA 2BCVA 1S0VA 3R9KA 2LXAA 4REZA 4J9SA 3N30A 2N9KA 2KWCA 3RJHA 1WCNA 1ZQXA 4F5QA 2RR9A 3IBEA 3UIOB 2L3ZA 2XN9C 4GXKA 2LYBA 2EKEC 2J4XA 4PL1A 1SL0A 1L6UA 1RYUA 1N6ZA 1YN5A 3NUHB 4FXCA 1AARA 3AQFA 3BJYA 1Z5SB 5LLIA 4C7ZA 3W1SA 1ZD2P 2FCSA 2B0CA 3QARA 1YIWA 2FBWB 1BPZA 3VAWA 5AM3A 4DHJB 2RPQA 2K89A 1ZW7A 1RXVA 3A0BU 2JZ3B 2LI5A 2BWES 4IKGA 4BBNF 4M47A 3OPXA 4Y2TA 4ED7A 5D6JB 2MX2A 1DOQA 2PMZF 4BWJA 3KVFB 5DBAA 2IOFK 5EWFA 3P63A 2YMLA 3RJJA 4BKSA 1SL1A 4M6WB 1WYWB 1FCLA 1TKEA 4LJXA 5ALLA 1I4HA 2C7HA 1A0PA 4RQNA 1IXRA 4PHDA 4TUUA 1YN3A 5G5GA 2KC1A 5J0YA 2FCNA 2EANA 4RGNA 3BS7A 3V6CB 1C76A 1WX9A 2I2YA 2MRLA 2GBJA 2KDBA 3DHGC 1ZXHA 3JSVB 4RQ5A 2UVVA 3TBLD 2DPJA 4QIWF 4I2BA 4GC7A 4X5VA 2MAXA 5BOLA 5KT6A 2XK5A 5BO4B 3KHRA 8ICAA 2MSNA 1S0OA 3H8HA 3WAMA 5CHWA 3BS5A 3HILA 1E9MA 3X23A 1B43A 2GBKA 2CPRA 2INCC 1ZQAA 2D5GA 3K4GA 3AH7A 1R7SA 5E6JA 3VDZA 2M9NA 4J9MA 2CU3A 4NWIA 4XZ4A 9ICQA 3PMLA 4DL2A 3KZXA 3WA0A 1ROEA 2ODGA 2IHNA 1J8CA 2BQUA 2FUG1 1F0ZA 4IRDA 4IQVA 2KZ3A 4Y2YA 4RUAA 1K51A 4W9CA 5KFXA 2N1VA 2HJ1A 3VR9B 2BCSA 2YMMA 2LBOA 4NQLB 2K25A 3PGEA 3Q8RB 4CDGA 1T7PA 1L7PA 3C2KA 1TY2A 3RFZB 4FO6A 2AL6A 1KLNA 3V6KA 1S76D 4PZNA 4NY8A 1QQRA 1UH6A 3OJUA 1TZOA 2KWDA 2BKEA 5AZGA 5AI5A 4A20A 1KRPA 1R4MB 4F2RA 4ELTA 3KYDD 4BKSD 4YSXB 2PLPA 2EDUA 2RDBC 2ZCBA 4NM1A 4EBCA 2L7RA 2QMTA 8ICUA 8ICWA 1WH3A 2DF4B 5EE3A 2Z0EB 2IOFA 5KFEA 1U49A 4KLMA 1B22A 3JVZX 4NJ7A 1ZPSA 2INPE 1ZQQA 2FJ6A 2L1AA 4NAWB 1U4BA 3FM9A 5DPTA 4Z6FA 4F91B 3R7RA 3OGUA 4HRSA 5DB9A 4EUTA 3PSEB 3THVA 1EO6A 2MRPA 1EF1A 1D9FA 2HE7A 4UBBA 2KQ7A 3AI5A 2IZVB 3EUB2 1GG3A 3N3KB 1GUAB 3ZJVA 5HP4A 1KF6B 4P0QB 1J7CA 3WAOA 1X6JA 2XNAC 2EZZA 2YVCA 3MHZA 2KMAA 1PVPA 5L1KA 2BS3B 3TL5A 2PKEA 1KFYB 4E0DA 1CMXB 2H3QA 4Y2RA 3TUOA 4AOFA 5DDMA 3DV9A 2H5XA 4LJPB 2V3PA 4LNNA 2MW5A 5EE0A 2PPHA 3TEWA 3NZSA 3R3MA 4KLFA 1IYFA 3AB5A 3N1YC 5JUMA 3GIMA 1LM8B 2INNE 1TAMA 1PGBA 1X9SA 1OEYA 4KZ0A 3G6VA 3C29A 3EWAA 4P6VF 4R63A 4JMUA 5KG2A 1JWBD 4IC9A 2I6XA 2JSVX 1SB3C 4ECXA 4F5PA 5TISU 4RQ2A 4MH8A 2IMWP 3RULA 2LUMA 2G5HB 1I4QA 2QKQA 1NK8A 2LJIA 3NS8A 5J2KA 5H2FU 4I2GA 4TSSA 2KN5A 1PK1B 2KG5A 3JPQA 2HOIA 2LD9A 3BINA 3DPDA 1E7VA 1V80A 1V5TA 1O03A 2KKPA 1RZTA 2BHNA 4NPNA 2E8MA 2NBUA 3O0FA 4YTPB 3AU2A 3F5AA 4EFOA 4TQ0A 4FLHA 2KHQA 7ICOA 2Y9TA 2VZKD 2JEIA 3RFAA 3VC8A 1UNSA 4HJKA 4N9F4 3WIMA 4A8XC 5KFZA 3SD5A 2WAQC 4IQTA 1JUDA 5AM5A 4QZAA 1C4CA 3TEYA 1V1OA 3NZ3A 3RNEC 4DBGA 2BTEA 2PFPA 4R3DA 5KT4A 5AK3A 3QU9A 2Y5CA 1L5PA 4DS5A 1JIHA 1U4AA 4X57B 3PO4A 2W3SA 1ZQPA 2QLTA 1VD2A 3TAQA 2KJ8A 4RUCA 4OD0A 5KAIU 2DYMA 4W9JA 2WS3B 4B9UA 1JMSA 8ICFA 5DLGA 4TMAB 3KKAA 2K60A 2KHWB 3V6JA 4EYIB 1LV5A 3C21A 5ALRA 4P4MA 4G0NB 4GDKB 3UXNA 1XO3A 4F7ZA 4DHZB 2BCQA 4PS7A 1WSPA 4P2HA 3SR6A 3TQ1A 3NS1A 3ZXVA 5ALGA 8ICEA 2D2QA 4IRCA 4LNKA 2E5SA 4R65A 4NNJB 2JYEA 4HDOA 2HSZA 3MJWA 2C7NB 4IM3A 1JROA 4WQMA 3ENEA 1I4PA 2WDQB 4QW8A 1ZJNA 4IR1A 3QA8A 3OHAA 4EBDA 7ICJA 4BBNC 2NRVA 5KFBA 3PHWB 5AEKB 3D2QA 1C4AA 3P4PB 3WU2U 4C0ZA 2V4IB 3AQEA 4GMVA 4NV0A 1SZHA 1UWMA 4J6IA 2HBLA 3TADC 4LLGM 2M17A 1JXLA 2MA1A 1E10A 1WWTA 3H9DA 8ICNA 2XC9A 4EOYA 4OZBA 1L4DB 1Z3EB 1FIQA 3C5FA 4KLQA 1IGDA 3VH4B 2W82A 4HDQA 1HZ5A 1GNUA 5I4DA 4FE3A 1IIPA 5HHHA 4KDLB 2ZVNA 3N7RC 5KFFA 3GZNI 3ZRCA 3W1YA 4O3PA 4YP3A 3GFKB 5C0YA 3DEEA 2ZW1A 5HHDG 2K8BA 4MEXA 5J0QA 5CA7A 2RLTA 2H88B 3Q2AC 3CF6E 2W43A 5ALFA 5J29A 4ZOHC 3Q8SB 2E8NA 2D3CA 3FILA 3RUIB 2QARB 4GDLA 2Y5BB 3BZDB 3SFDB 1PFDA 4UB6U 3QU2A 3GQCA 2QILA 2BDPA 1UZXB 4WJNA 3M8SA 3QYPA 3C28A 2ZTCA 1RM6C 1IV8A 2P66A 4NLKA 1CUKA 2VA8A 3WK7A 1WE7A 2JZZA 4HCNB 3UQBA 1IBXB 4IOIE 5AM1A 7ICGA 2WX0A 4BX9C 4QZGA 3ZO5B 4MHVA 3NJTA 3OJ3A 4B95A 3CSTA 2KDEB 3ZI4A 3H8MA 4MT5A 4KIKA 4KMOB 1QSLA 2FPMA 9ICLA 5JHAA 3ZDBA 4DFMA 4RF1A 3SFEB 4J9QA 5J2CA 1DOYA 2H3IA 4Q44A 4JUZA 4UB4A 4O3MA 1TS2A 3TSSA 3NVYA 2L00B 4UAUA 3V6EB 3ZIMA 1XSPA 3L3FX 4J9PA 1C77A 8ICTA 5IIJA 1X9MA 3QZ7A 5KG4A 9ICWA 3HUIA 3GIIA 3UGBB 2LFIA 4ICAA 2B6GA 2ZIWB 5C5JA 3TI0A 4M8MA 4BJQA 2ASLA 3WKCA 2UVRA 3IHQB 3QEBZ 5KG3A 2DFLA 4PT5A 1L0VB 5IP4D 1HXYD 2LRUA 7ICMA 5DBBA 1NNLA 2BPFA 2YB1A 4Y2QA 1RFAA 1I4RA 3IT4B 2W55A 4XDDA 3ED5A 5J2AA 2YMPA 3T8MA 1ZGUB 3WANA 4YD1A 4GU2A 2ZIVB 1J7BA 3JPPA 1RAXA 4WJPA 3LYSA 1SL2A 2PFQA 4ECYA 3SEIA 3BK2A 2LGIA 8ICOA 2N1RA 1QTMA 3OWEB 1H38A 2YB4A 3ZNZB 5DBCA 1WXQA 2KDFB 2RHFA 1XCTL 5J2GA 4WWOA 2O2VA 2Q4TA 4UB5A 1B4FA 4UQGA 5J2IA 1SGHA 3VRBB 1I4XA 3VRAB 5HMLA 9ICAA 3QU7A 2J53A 5AM4A 1Q0WB 3VQIA 3UM9A 1QLNA 1VZ8A 4QZIA 2KO3A 2G3QB 1OXJA 1ZE3D 1F5SA 4PPXA 2KSOB 2XGQA 3KUCB 3VUWA 1AW7A
chains in the Genus database with same CATH topology
1BUIC 1RFKA 4OZCA 1ACCA 2FE8A 2G1EA 3BIID 1XLNA 1PGXA 2KAJA 3HRDD 3P4QB 5C2TB 4ZHOA 3GP7A 3KWVA 3BYYB 1TKGA 1AYFA 1E7PB 1PUTA 2NTTA 1VDVA 1JCKB 1NYRA 3PZ7A 4RGTA 3P4RB 4RF0A 1D5ZC 2JQRB 4YWGG 3I9V1 4XWWA 2ONQA 1NVID 1D6EC 2SEBD 2KQ4X 2E6XA 2RPVA 3DWMA 2IPKD 2IGDA 3DWGC 3EA6A 1DOXA 2K3UA 2J42A 4A55A 2WXRA 2MJ3A 2WDRB 3KLSX 4ITKA 4N58A 5GXGB 4JWSC 4RH6A 3W5UB 3N9YC 1IGCA 1JWMD 1QF6A 2QEJC 1JMLA 1FXIA 1ZOYB 1SBBB 1YQ4B 2CJNA 3U2SC 2I38A 1FFVA 1OQRA 1JW9D 3AEFB 4IDIA 1OQQA 4YT0B 2GB1A 2LHEA 1QOFA 3R2TA 3W5VB 1AWDA 1N60A 3B2GA 3TEXA 1MI0A 5D7GA 4B0MA 4ARIA 3UI3A 1KTKA 2DYOA 1L0XB 2ACZB 4JPSA 1XF5L 1HA5A 4A90A 2WXHA 3EGRA 1ZDVA 2PIAA 4L2YA 3AN1A 1FO4A 3Q69A 3E56A 1RWSA 3AECB 2PKOA 4OHJA 2WXIA 1N61A 1C79A 5FKAC 5BYRA 4DQOC 3R8BA 1ET6A 3U52E 1T5XD 1VRAB 2K5PA 5HG2A 5BMIA 4ZHPA 1EU4A 3Q8CA 4WH4A 1FCCC 3V05A 1TY0A 1N63A 4GLSC 2BB5A 3HVDA 4REZA 3Q8AA 5HI1A 1L4ZB 2N9KA 2MJDA 1F2RI 1ENFA 4Q2JA 3L4PA 1JWSD 3W2DA 1PGAA 2WXQA 2XN9C 4WWMA 2J4XA 2WXFA 1L6UA 1SIJA 1FM0D 1YN5A 3NUHB 4FXCA 3Q8EA 3MP9A 4YSYB 5H92C 1FMAD 3MJ5A 2JXTA 4C7ZA 3W1SA 1JQ4A 3IAM1 1DOIA 2FBWB 2AQ3B 3T3OA 1SJHD 4HKZE 4NAMA 4IKGA 4MACA 2WXNA 4TQ1A 1P7FA 3WCQA 4WIPA 1SEBD 2GRIA 2LHDA 3AV8A 1T6BX 1WRIA 1DYQA 2MEKA 3ZJUA 2KACA 4US8A 2SAKA 3P63A 1FFUA 4JE3B 3ZGZA 1E6EB 4HKQA 1VZ6A 2WXLA 3FAHA 1B1ZA 1TKEA 1I4HA 1D5XC 3Q8BA 1FCLA 3ZQ4A 1VZ7A 3AEAB 2BS2B 1YN3A 5G5GA 2PW9A 4RGNA 2WXOA 1SE2A 1C76A 2IGHA 2I2YA 1QOGA 3PZ8A 1KRHA 1ZXHA 4HJGE 2H89B 1K52A 4EE2A 2QSDA 1YNTE 5T8IA 2VZKB 5FK9C 3H8HA 4YSZB 1VR9A 1TJEA 1MPEA 4L1BA 5JXVA 1P7EA 2HTME 1E9MA 3AEGB 4H2AA 3Q8FA 2B76B 2D5GA 1TYGB 3AH7A 1R7SA 4KGRA 3AE5B 5E6JA 5G5HA 1PDXA 2CU3A 3LXFA 1ROEA 1ESFA 2AQ2B 2FUG1 4B0EA 3AM9A 3C8YA 1F0ZA 4D2KA 2ICIA 2OHFA 1K51A 2RDGA 3AE4B 1YMHE 1SSNA 1L0YB 1TS4A 3VR9B 5C3JB 2JU6X 1AN8A 2AQ1B 1FNUA 3AE8B 4CQNA 1TY2A 3VR8B 1UWXA 1LO5D 3T3NA 2MJEA 3IT6B 4OVZA 1QQRA 4UDUC 1TZOA 2BT6A 2KWDA 2WQYB 1CJEA 5EE1A 4YSXB 2AX5A 1MVKA 1QT9A 2PLPA 1FD6A 2L52A 4NJCA 1STEA 1T3QA 2DLBA 5EE3A 4YXDB 2KDMA 2IGGA 1ZPSA 2INPE 2L1AA 4NAWB 2E3TA 1SJED 3ZYYX 3BVGA 4C56C 4HRSA 1K53A 4C7YA 4RFBA 3URYA 5AUIA 4USAA 1XLOA 2RMMA 1JWUD 3E9SA 5BMGA 5MPOA 3EUB2 3ZJVA 1EWYC 2N0SB 1IUEA 1KF6B 1NI3A 1J7CA 2JWUA 2XNAC 3MHZA 1J7AA 3B9JA 4LK0M 2BS3B 1FNVA 1KFYB 1CZPA 2R61A 1I7HA 1WGKA 3AE2B 2KN4A 3TUOA 4NZLB 3LYYA 2V3PA 2Y5PA 1PYWD 4JWUC 5EE0A 3TEWA 1N5WA 1ZXIA 3AB5A 1K50A 2BS4B 2JYTA 4P16A 5BMHA 3BVMA 2INNE 1PGBA 2Z8LA 2PMVA 1TS5A 4P6VF 1N5XA 5D3IB 1JWBD 5BYQA 2IDYA 2KMMA 1SF0A 2JSVX 1YQ3B 1SB3C 4MH8A 2WNMA 1WYGA 2LUMA 1ZP0B 2WU2B 1BMLC 4DXGA 1I4QA 2LJIA 4WAFA 2BBCA 2BW2A 1MHHE 2HDEA 1GPXA 4TSSA 4HEA1 3P42A 2M56B 1RYJA 3ABVB 1GB1A 4LTUA 1F2RC 1N62A 2IJ0A 3V3XA 1D5MC 2V0GA 3MC0B 1D4BA 1BXTA 1QILA 4RGOS 4YTPB 4US9A 4RCOA 2G9HD 2YEPF 5D3DA 4TQ0A 4XDCA 2VZKD 1UNSA 4A8XC 1JWAD 4ARCA 1UUPA 1JALA 1ZDXA 2WXGA 1C4CA 3BWUD 3TEYA 1V1OA 3NZ3A 1QKZA 2QIEB 1NENB 1HEZE 1QOBA 2BTEA 2Q5WD 1C78A 4R3DA 2Y5CA 1KLGD 1L5PA 1OFFA 3RFZB 2L83A 2NTSA 2W3SA 2BB6A 4N6EB 1NYQA 3J9CA 4JX1C 2DYMA 2WS3B 2W3RA 2PVGC 3IAS1 4TMAB 3I57A 3BK1A 5TSSA 1SE4A 2WDVB 2EELA 1NEKB 2K9XA 3GB1A 4KX6B 4GDKB 1XO3A 1WSPA 3HVZA 2M19A 4OW0A 4AQ7A 1FEHA 2MH7A 3FILB 3SR6A 1GOZA 3KWLA 4GDLB 2ZW0A 1GB4A 3NS1A 4KGTA 4KGSA 2ZW1A 2JX5A 3AMZA 2QMTA 1UGJA 3NRZA 2WXPA 4XE0A 3O13A 2JYEA 4WURA 1JROA 1YJJA 4WQMA 3TEZA 1I4PA 2WDQB 3NVVA 4KKJA 1C4AA 2N7JA 2TSSA 3P4PB 1CK1A 2V4IB 1Q10A 1I4GA 3SEBA 1UWMA 4LLGM 1E10A 3W9CB 1WWTA 2W54A 5HFYA 4OZBA 1L4DB 1ZUD2 1FIQA 1EWCA 2WP9B 1DGJA 4RGMA 2WLBA 1IGDA 4ZYSA 1B9RA 3ZJTA 2W82A 1F77A 3R2IA 1HZ5A 3CIRB 5I4DA 1VJKA 3AE7B 1EM7A 4XWTA 4A9AA 1V8CA 1V1PB 1YJIA 3AE3B 2WXKA 2YEPB 4AS1A 1VLBA 1C9FA 2PVOD 1MHXA 1XXGA 2ON8A 5BYSA 4YTMB 5HHDG 1FRRA 4RNAA 2BYTA 4L23A 1XEEA 2WXJA 2H88B 4N59A 2DWQA 3MFGA 4ZOHC 3FILA 1KH0A 2QJLA 3BZDB 1M4VA 1CQVA 3SFDB 1PFDA 2RDHA 4C80A 2QILA 4YTNB 1RM6C 1IBXB 1SE3A 1FRDA 1QOAA 4IOIE 1HQRD 4OZAA 3AE1B 4MT5A 4KKIA 2M0AA 5AUKA 4RF1A 3SFEB 1YN4A 1DOYA 2CJOA 2EKIA 4O1NA 4M0WA 1TS2A 2GI9A 3NVYA 3TSSA 1C77A 2N9LA 1FXAA 3BVZA 2L32A 3HUIA 5LNK1 2Y3AA 2NMQA 2LFIA 3RPFC 2WXMA 4ZRQA 1TS3A 2J52A 3CWIA 5EE9A 3AE9B 4A6QA 1V97A 4PT5A 3P4SB 1L0VB 1HXYD 1V1PA 1L6VA 2DBYA 1JRPA 5FR3A 3PO0A 1FNWA 1I4RA 1SXTA 4MM3B 1E0ZA 3IT4B 2W55A 3KQ4A 4XDDA 1A70A 3NVZA 3P1MA 1XLQA 1EU3A 1QLBB 1XCQL 4HROA 3GS2A 1J7BA 1Y56A 4J3OD 1ET9A 3U7ZA 3BK2A 2LGIA 2K22A 2OEDA 1TKYA 3OWEB 3IXSA 3BYTB 3AE6B 3AEEB 5H8YE 1HZ6A 2X38A 1WXQA 1XCTL 2K0PA 3B2FA 3AEDB 1IBXA 2LMCA 1GAQB 2LEKA 1C4PA 3LB8C 2WU5B 3VRBB 1I4XA 3VRAB 4ZRPA 3U4EG 2J53A 3VQIA 3NVWA 2PTLA 3AEBB 3FC4A 2V3NA 1VZ8A 2JZPA 4DXFA 1ZE3D 1XLPA 1KLUD 3ETRA 1AW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFK A;  3CIR B;  3P63 A;  1FFU A;  1VJK A;  1N5W A;  1ZXI A;  2G1E A;  1XLN A;  3AE7 B;  3BII D;  1V8C A;  3AB5 A;  2BS4 B;  1E6E B;  4A9A A;  1YJI A;  3AE3 B;  3FAH A;  1TKE A;  3HRD D;  2KAJ A;  3P4Q B;  3AEA B;  5C2T B;  4ZHO A;  1VLB A;  4P6V F;  2BS2 B;  1N5X A;  1AYF A;  5G5G A;  1TKG A;  2PVO D;  1JWB D;  1E7P B;  2KMM A;  1PUT A;  1SF0 A;  1YQ3 B;  1VDV A;  1SB3 C;  1NYR A;  3P4R B;  4YTM B;  1QOG A;  2JQR B;  1KRH A;  1WYG A;  1ZP0 B;  1FRR A;  2H89 B;  2WU2 B;  2H88 B;  4N59 A;  2DWQ A;  1NVI D;  1GPX A;  4ZOH C;  2M56 B;  1RYJ A;  3ABV B;  2QJL A;  4LTU A;  3DWM A;  4YSZ B;  3SFD B;  1PFD A;  3VRB B;  1N62 A;  4C80 A;  1TJE A;  3DWG C;  1DOX A;  4YTN B;  2HTM E;  1E9M A;  2MJ3 A;  3AEG B;  2WDR B;  4ITK A;  1RM6 C;  4YTP B;  2B76 B;  4US9 A;  4N58 A;  5GXG B;  1FRD A;  1QOA A;  4JWS C;  1TYG B;  3AH7 A;  1R7S A;  3W5U B;  3AE5 B;  5G5H A;  1PDX A;  1QF6 A;  1JWA D;  2CU3 A;  1FXI A;  3LXF A;  1ZOY B;  3AE1 B;  1ROE A;  1JAL A;  3AM9 A;  1F0Z A;  1YQ4 B;  5AUK A;  2CJN A;  3SFE B;  1DOY A;  2CJO A;  2EKI A;  2QIE B;  2OHF A;  1NEN B;  3AE4 B;  1FFV A;  1OQR A;  1QOB A;  3VR9 B;  5C3J B;  3NVY A;  1JW9 D;  3AEF B;  2Q5W D;  4IDI A;  1OQQ A;  4YT0 B;  2Y5C A;  1OFF A;  1L5P A;  1QOF A;  1FXA A;  2L83 A;  3W5V B;  3HUI A;  1AWD A;  1N60 A;  2W3S A;  4N6E B;  3B2G A;  3RPF C;  1NYQ A;  3AE8 B;  3CWI A;  4JX1 C;  2ACZ B;  3AE9 B;  5EE9 A;  2WS3 B;  3VR8 B;  2MJE A;  1V97 A;  2W3R A;  2PIA A;  1L0V B;  2PVG C;  3AN1 A;  1FO4 A;  3P4S B;  2BT6 A;  2WDV B;  2WQY B;  1CJE A;  1L6V A;  5EE1 A;  2DBY A;  1NEK B;  1JRP A;  1RWS A;  3AEC B;  2K9X A;  2PKO A;  2AX5 A;  3PO0 A;  1N61 A;  4KX6 B;  4YSX B;  1QT9 A;  1XO3 A;  1E0Z A;  2L52 A;  2W55 A;  1A70 A;  3HVZ A;  2K5P A;  2M19 A;  3NVZ A;  4ZHP A;  2MH7 A;  1T3Q A;  3SR6 A;  3P1M A;  1XLQ A;  3KWL A;  5EE3 A;  4HRO A;  1QLB B;  4YXD B;  1N63 A;  3NS1 A;  1J7B A;  2JX5 A;  3AMZ A;  3NRZ A;  2MJD A;  2E3T A;  3ZYY X;  2K22 A;  1JRO A;  3L4P A;  1TKY A;  1YJJ A;  4WQM A;  2WDQ B;  4HRS A;  3NVV A;  4C7Y A;  4WWM A;  3AE6 B;  3AEE B;  5H8Y E;  1L6U A;  1SIJ A;  1FM0 D;  5AUI A;  1WXQ A;  4FXC A;  4USA A;  1XLO A;  3B2F A;  4YSY B;  3AED B;  5H92 C;  1FMA D;  5MPO A;  3EUB 2;  1GAQ B;  2LEK A;  3LB8 C;  1EWY C;  2WU5 B;  2N0S B;  4C7Z A;  1IUE A;  1KF6 B;  1NI3 A;  3P4P B;  1J7C A;  3VRA B;  1JQ4 A;  1DOI A;  3NVW A;  2FBW B;  1UWM A;  1J7A A;  3AEB B;  3B9J A;  1E10 A;  2BS3 B;  1WWT A;  2W54 A;  3FC4 A;  3W9C B;  1KFY B;  1CZP A;  1I7H A;  1WGK A;  3AE2 B;  1ZUD 2;  1FIQ A;  3WCQ A;  3AV8 A;  2WP9 B;  1DGJ A;  1XLP A;  1WRI A;  2WLB A;  1B9R A;  4US8 A;  3ETR A;  4JWU C;  5EE0 A; 
#chains in the Genus database with same CATH topology
 4GXI A;  3Q8K A;  1RFK A;  2XBB C;  5KFC A;  5L9X A;  3M63 B;  1WRD B;  3M3J A;  4K3B A;  1WGY A;  2JEG A;  2KYW A;  1KDH A;  5KFQ A;  2AGQ A;  5KNI A;  2GLS A;  1TKG A;  4KSK C;  1BT0 A;  3PW4 A;  3EFU A;  2WYQ A;  1D9D A;  2NTT A;  3PZ7 A;  3P4R B;  1D5Z C;  1COO A;  3PX0 A;  4HXD A;  1DGS A;  2J6U A;  5KG5 A;  3MR3 A;  2ES6 A;  2VJ5 A;  1GO3 F;  4KMU A;  4ZRJ A;  4U6P A;  3F2C A;  2ZPN A;  3QIJ A;  2WF7 A;  4PZO A;  3CW2 C;  5ALI A;  2E6X A;  2KDI A;  2RPV A;  2ZIU A;  1ZQK A;  2IGD A;  2XI9 A;  1C20 A;  2V4L A;  5GMV A;  3EA6 A;  1DOX A;  2J42 A;  1WCL A;  2R18 A;  2N9X A;  3N1X C;  3KLS X;  2ZNV C;  2YY6 A;  4RH6 A;  2VJ4 A;  1X2I A;  3TAN A;  1G6J A;  3RB6 A;  1MG4 A;  1QF6 A;  9ICV A;  2DEN B;  2FUH B;  2CJN A;  3U2S C;  4NLB A;  4NLN A;  3A9K A;  3S6J A;  3RCZ A;  2JGA A;  2J7Q B;  5HNK A;  3LWL A;  3V7K A;  1XO1 A;  2W9A A;  3RR8 A;  1WIA A;  4JGH B;  4HLE A;  2NBW B;  2K4I A;  3D6J A;  3EHV A;  1OQQ A;  4YT0 B;  2IO3 B;  2LHE A;  2FPL A;  1QOF A;  3PVL A;  3PX6 A;  1NK9 A;  4Y2J A;  1J2N A;  1TVA A;  4DLG A;  3B2G A;  3TEX A;  4AP4 C;  3GV7 B;  4ARI A;  1KTK A;  1L3U A;  1TGZ B;  2ACZ B;  1WG8 A;  2JZB A;  2V4Q A;  2WXH A;  2EQY A;  4HAI A;  4UAZ A;  3Q69 A;  3R66 C;  4K4H A;  2PKO A;  3OG5 A;  4IS7 A;  2HBJ A;  2B21 A;  2FMS A;  1C79 A;  2G4D B;  2ZJD A;  3DCG A;  4GFJ A;  4MEM A;  1ET6 A;  2NCN A;  3ONS A;  1VRA B;  5BMI A;  4DDG D;  4WH4 A;  2FLL A;  3JW0 X;  3I63 C;  2DAJ A;  4IRK A;  1WJ6 A;  4KLH A;  4EZ9 A;  1L4Z B;  4UB2 A;  3PY8 A;  4UAR A;  2LPE A;  1ZQH A;  1ENF A;  1JWS D;  3G6X A;  2PI4 A;  4Q2J A;  4DL4 A;  3W2D A;  3RRG A;  1SWV A;  5ALQ A;  2WXQ A;  5KFM A;  3EPI A;  3APC A;  3DBH B;  3OJ4 B;  4UBC A;  4DDI D;  2J0J A;  4PH5 A;  4WJQ A;  5C1Z A;  5JHB A;  1ZD5 A;  5CJ7 A;  3H1U A;  3K1R B;  2XIC A;  2G06 A;  2FMQ A;  5AKL A;  1JQ4 A;  3IAM 1;  1XD3 B;  2GOW A;  2AQ3 B;  2WFA A;  2KKC A;  1PUZ A;  1Z00 A;  1JXE A;  5KTQ A;  4HKZ E;  2K4H A;  1NZB A;  5ALY A;  4MAC A;  4RQ8 A;  1SEB D;  1TK8 A;  2KT7 A;  1T6B X;  1WRI A;  4B9S A;  4ZYN A;  4M04 A;  3UXP A;  2SAK A;  2BKF A;  2BYV E;  2ZVO A;  4IM2 A;  5G55 A;  4EYH B;  4ECS A;  1L8O A;  1YZ6 A;  1JI7 A;  3WK4 A;  3C1Z A;  3UIP B;  2XGP A;  1VZ6 A;  3FAH A;  1B1Z A;  1D5X C;  3PLV A;  3ZKJ C;  3ZQ4 A;  3AEA B;  3BQ7 A;  5ALD A;  4GLX A;  7ICK A;  4HPP A;  2NYV A;  5J18 A;  1SE2 A;  4ED3 A;  7ICS A;  4HJG E;  2IBI B;  5AK4 A;  4M9H A;  1HE8 A;  1K52 A;  4F3O A;  4EEK A;  3CYM A;  1U45 A;  5T8I A;  2ZJ8 A;  9ICB A;  1ZQE A;  3IG5 A;  8ICB A;  3GZF A;  1E8X A;  5AHX A;  3ZD8 A;  4G3X B;  2OM6 A;  5KT5 A;  3F2B A;  4DS4 A;  3H40 A;  4MFA A;  1F1H A;  5KFP A;  1P7E A;  2VIX A;  4ACO A;  3Q8F A;  1XT9 B;  5CB1 A;  5KG1 A;  1S0M A;  3AE5 B;  4HPL B;  4DL6 A;  1V9J A;  2MA9 B;  3SAG A;  4BKG A;  3RJG A;  3LVW A;  4EZJ A;  3LXF A;  5F9N A;  4JV2 A;  2K8H A;  2AQ2 B;  4B0E A;  1TKD A;  3C8Y A;  1Z1V A;  4D2K A;  4DXA B;  2OHF A;  3QZ8 A;  3AE4 B;  4YXJ A;  3W1S C;  3GE3 C;  3RN9 C;  1BGX T;  8ICM A;  1YMH E;  1TS4 A;  2MBO A;  3T5H A;  5K4L A;  4IWP A;  4PYU A;  4RU9 A;  1ZOL A;  3APD A;  3N4M B;  2MP2 A;  1JRU A;  4DOC A;  2AQ1 B;  4M8N A;  4C00 A;  4FBU A;  8ICJ A;  3T3N A;  1NK6 A;  2A4Z A;  3IT6 B;  4OVZ A;  3ML8 A;  3HK0 A;  4UDU C;  1HTO A;  3F53 A;  4R8U B;  1NOM A;  1O08 A;  5EE1 A;  3N7P D;  1E8W A;  2AX5 A;  4TUR A;  3MC1 A;  1KOT A;  4XQ8 A;  5JH5 C;  1WZ3 A;  4W9L A;  2DLB A;  1X9W A;  4YXD B;  4TQR A;  4PGX A;  5AZF A;  2F77 X;  5EOZ A;  3EYZ A;  3HPO A;  1RRB A;  5KFT A;  2RRD A;  4B9T A;  2CHX A;  4F4Y A;  1RG6 A;  2IGG A;  4DWF A;  3RF9 A;  2G08 A;  3SHQ A;  1SGG A;  2ZJA A;  3ZYY X;  3IVF A;  2WAQ F;  1UGM A;  4DL5 A;  2C9W B;  1K53 A;  2KMC A;  2K6D B;  5DG7 A;  3MR5 A;  3BQ1 A;  4MFC A;  1JWU D;  4BXO B;  2L05 A;  3E9S A;  3KW5 B;  4ED8 A;  1EUV B;  2UU7 A;  2CKH B;  2C2D A;  3HM6 X;  7ICN A;  1ZQ1 C;  4DQI A;  2W8K A;  4M0A A;  1J7A A;  2W7O A;  4ANX A;  2G07 A;  2HHT A;  3LK9 A;  2NO4 A;  1L7N A;  2BCU A;  2ZTE A;  3WK6 A;  4QWA A;  1ARO P;  3AE2 B;  3ZW3 A;  1ZQD A;  1X42 A;  3V60 A;  5KFO A;  1KKX A;  4NZL B;  4FS2 A;  1E90 A;  1V86 A;  3PTF C;  2G5I B;  4O9M A;  4RT3 A;  1F44 A;  2J6S A;  4JWU C;  4ECT A;  3PW2 A;  2DKZ A;  3RJI A;  4FS1 A;  2ATL A;  5J0W A;  2BS4 B;  2R8I A;  4P16 A;  4E71 A;  1T8E A;  3BVM A;  2A19 A;  3HW8 A;  2K8C A;  3QUB A;  2PMV A;  1TS5 A;  5AI4 A;  5DGB A;  4AUQ C;  5D3I B;  3QU4 A;  1E8Z A;  5AIB A;  4QZ9 A;  2IDY A;  2KMM A;  1KTQ A;  3U8Z A;  2C28 A;  1YQ3 B;  2RP5 A;  2WNM A;  3M6K A;  1ZP0 B;  1BML C;  4DXG A;  4WAF A;  5ALS A;  2BBC A;  1MHH E;  2BW2 A;  9ICN A;  2HDO A;  4UAV A;  2R8H A;  4OVV A;  2M56 B;  2HCF A;  3ABV B;  2A1J B;  4E3C A;  2C5L C;  2K6Q A;  1N62 A;  3SV3 A;  2IJ0 A;  2QB1 A;  5J0T A;  4XGA B;  1UPH A;  2RGF A;  2V0G A;  2EH9 A;  3MC0 B;  1IPG A;  4JV1 A;  2NRT A;  4US9 A;  5D3D A;  4CGZ A;  2O6V A;  2FMP A;  1KFS A;  1Z4O A;  2KNB A;  2K8A A;  3H8S A;  1SV0 A;  4RT2 A;  4YMM A;  2E8P A;  2D3B A;  1UUP A;  2JR5 A;  1ZDX A;  2DZK A;  2GMI C;  1C7Y A;  3BWU D;  5J2D A;  3ECI A;  2GWS A;  1NEN B;  2KE7 A;  2WX1 A;  4ED6 A;  1QOB A;  1QSS A;  3UMG A;  5CRX A;  1C78 A;  4TKN A;  2DZM A;  5D94 A;  2AGP A;  3JPN A;  3AU4 A;  1H4R A;  2KNJ A;  4BGD A;  2BB6 A;  3HP6 A;  4QJF B;  3RYT A;  1LKY A;  3VCB A;  1K1Q A;  4I2F A;  4CF5 A;  4C8N A;  5DGA A;  1C1Y B;  1X66 A;  2KZM A;  4F4Z A;  1WXM A;  3PSP A;  4BUG A;  3DBL I;  3QX1 A;  2FID A;  2PVG C;  5D46 A;  5TSS A;  2WDV B;  2CU1 A;  3H7I A;  1NEK B;  3GB1 A;  1KN5 A;  4KX6 B;  5LXH A;  1HJP A;  4RQ0 A;  2LWP A;  1MG8 A;  2R2O A;  4AQ7 A;  2MH7 A;  2MQJ A;  1GOZ A;  3QNM A;  2D10 A;  4JV0 A;  4QZC A;  4BZA A;  4KGT A;  1A76 A;  1NK5 A;  9ICH A;  4NJ8 A;  2FCQ A;  4MEY A;  2J6T A;  3GIL A;  3N97 B;  3D2S A;  4I2J A;  1UGJ A;  1WY8 A;  2BWF A;  5J0S A;  2NBV B;  3V6H A;  2WXP A;  1VCB A;  1URJ A;  4PHA A;  4B9N A;  1WWU A;  1YJJ A;  2WB1 C;  3WAP A;  4MJS A;  3NG0 A;  4FFD A;  4EKU A;  1ZQS A;  4PS8 A;  3RMK C;  3NOB A;  1MJD A;  4P0P B;  2ASQ A;  4M0W B;  3E0F A;  1I4G A;  2O6V D;  4IQU A;  2FIF A;  3W9C B;  5L1M A;  5J0U A;  3VUX A;  3M9M B;  4Q8F A;  5HFY A;  3ZXR A;  1COK A;  3BZK A;  2WP9 B;  1DGJ A;  3ZDD A;  1QQ5 A;  1KQQ A;  3JYU A;  3PNC A;  2KEY A;  2KTQ A;  1F77 A;  2KFK B;  1K8R B;  2KD0 A;  2JXJ A;  3HWT A;  1V1P B;  3ISB A;  4DOA A;  2PVO D;  2YN4 A;  1MHX A;  2W9C B;  2UVW A;  1ZD4 A;  2W9B B;  1XXG A;  2KTR B;  3SAF A;  3KKA C;  4UB8 U;  3I1Y A;  1XU4 A;  2FDR A;  4MH0 E;  4RNA A;  3WK5 A;  2NRW A;  4F8R A;  3JPR A;  2BGW A;  3V7J A;  2DWQ A;  2DYB A;  5ALU A;  5DKW A;  3MFG A;  2ZNV B;  4OCZ A;  2WTF A;  9ICM A;  1M4V A;  1CQV A;  4F4K A;  1SE9 A;  4C80 A;  4CE6 A;  4YTN B;  2HHV A;  2ZIX A;  4HPM B;  2V3S A;  5IIO A;  1H8C A;  3MC9 A;  1FRD A;  1NI2 A;  4LCD E;  4C8K A;  1F0M A;  3OHB A;  4OZA A;  4DSJ A;  3AE1 B;  3NHE B;  1GC6 A;  3I5J C;  4ECW A;  7ICT A;  4B6J A;  2JUO A;  2QCZ A;  1TAU A;  3IG8 A;  5KFL A;  1WMH B;  3UQA A;  2HD5 B;  2KVC A;  3A1Q B;  5AKY A;  2OEH A;  3L0W B;  4WWP A;  3VH3 B;  2FI1 A;  1GJZ A;  1FXA A;  2RSU A;  5LNK 1;  2CXY A;  2Y3A A;  3ZNG C;  5ALP A;  3IDW A;  4Y2S A;  2JY6 A;  3FKY A;  3NAS A;  3GV8 B;  2J52 A;  3CWI A;  2OJR A;  3SU8 X;  1ZRN A;  4A6Q A;  1V97 A;  2JRZ A;  3QHT A;  2P35 A;  5TZV A;  2KIW A;  1Q8K A;  4TQS A;  9ICT A;  1L8L A;  3C23 A;  4QZD A;  5FR3 A;  2HHW A;  3PO0 A;  1A5R A;  1FNW A;  1SXT A;  4MM3 B;  2DZJ A;  3EEC A;  3KQ4 A;  1A70 A;  2JWZ A;  4ANU A;  4WQO B;  1ZJM A;  4ANV A;  1S9F A;  3RI7 C;  2EAP A;  4I2E A;  1EU3 A;  4HRO A;  2OWO A;  4ZRI A;  2GBM A;  5L1L A;  1Y56 A;  2D11 A;  3WKD A;  5KG7 A;  2UVU A;  1ET9 A;  3ZDT A;  3U7Z A;  1TZ1 A;  5DQI A;  2ASD A;  3DDH A;  3IV6 A;  3M95 A;  5DB7 A;  1TKY A;  3FYH A;  1EXN A;  1L3S A;  3BYT B;  1S8O A;  3AEE B;  5H8Y E;  4NY0 A;  9ICO A;  1OUQ A;  1QCK A;  4NXZ A;  4LZG A;  3H0L B;  3B2F A;  4F4W A;  3AED B;  5ALZ A;  4ECZ A;  2LMC A;  2LEK A;  2WDT B;  3H7P B;  3LB8 C;  4RNO A;  3U4E G;  3K9O B;  3NRW A;  1WM3 A;  1N48 A;  2P6U A;  3PRP B;  4FN2 A;  3SDL C;  4DSL A;  2HVH A;  2WF6 A;  3KTQ A;  4C8O A;  2V9W A;  5J17 A;  3I3T B;  5AKH A;  2QB0 B;  2ZEQ A;  3C0R B;  7ICQ A;  2DL0 A;  4W9E A;  3PHX B;  1WWV A;  4J03 A;  3ETR A;  3DDC B;  3E58 A;  4KLD A;  4OZC A;  5ALH A;  1XLN A;  2PXI A;  3QU5 A;  1TTN A;  2VAN A;  4JIO U;  4TUQ A;  3TFS A;  3DBR I;  2KAJ A;  4Y2V A;  4ZHO A;  3A9J A;  3HX0 A;  2V9H A;  3KWV A;  1AYF A;  4ICU A;  1PUT A;  3RBD A;  1ZQJ A;  2X8X X;  3PW5 A;  4YG2 A;  4RF0 A;  2Z59 B;  3L17 A;  3MTN B;  4ACF A;  2JQR B;  4AJY B;  4F50 A;  4YWG G;  3I9V 1;  2F76 X;  5HR7 A;  1T4G A;  1ZQY A;  3J81 j;  3HIZ A;  2ZUD A;  1NVI D;  1D6E C;  2MU2 A;  3VHT C;  2KWV B;  3RJK A;  2MBQ A;  2LMR A;  1S10 A;  4DHZ E;  2W9N A;  4KX3 A;  4MEL A;  1Y8R C;  5IN7 A;  2EZX A;  2HOF A;  2WXR A;  2OXO A;  2MUT A;  1WXS A;  4FZL A;  2BDU A;  2LYH A;  1RQL A;  2AXT U;  4JWS C;  4N58 A;  4FAD A;  3W5U B;  1RXW A;  4GC6 A;  4MGZ E;  1ZYQ A;  1FXI A;  3M9O B;  3H0R B;  1ZOY B;  1FEZ A;  4WJO A;  3V7L A;  4CNQ A;  2P6R A;  2N7E A;  3AEF B;  3DVN V;  1KLV A;  1OGW A;  4OJ5 A;  4ANW A;  4MGY E;  4DQS A;  5A0L A;  1AWD A;  1N60 A;  1B0X A;  4MGI E;  5DQH A;  5J0P A;  2A5U A;  3TAC B;  5D7G A;  2G0A A;  1SWW A;  3ZDC A;  2GBN A;  1N56 A;  3T3F A;  2HHQ A;  4XUS A;  3AUO A;  4A90 A;  5KFJ A;  4W9F A;  1ZDV A;  2PIA A;  3H8W A;  3KHL A;  1QZE A;  1LB2 B;  3AEC B;  3KZI U;  2KP7 A;  4OHJ A;  1N61 A;  1V49 A;  2DAF A;  5FKA C;  2XK5 B;  2W8L A;  9ICG A;  1T5X D;  2K5P A;  5HG2 A;  3Q8C A;  2Z0D B;  1TY0 A;  2FCM A;  4YR2 A;  4M9G A;  4II2 B;  3BS5 B;  1E5W A;  1IP9 A;  2NPT A;  3HVD A;  3Q8A A;  4AWJ A;  1J97 A;  2KVR A;  4ZDV A;  4PL2 A;  3Q8Q B;  3MDA A;  2MJD A;  1F2R I;  3L4P A;  5AIC A;  1T0R C;  3AXC A;  4TUP A;  4ECQ A;  4WWM A;  1SV4 A;  2IND C;  1SIJ A;  3H0M B;  4C8M A;  1P7D A;  8ICY A;  4YSY B;  3T9L A;  5IAA C;  3MR2 A;  2JXT A;  8ICL A;  1XWL A;  1U47 A;  2LRW A;  4DQQ A;  3KUZ A;  2I1J A;  2LVO A;  4YN4 A;  2C2E A;  3VVW B;  3T3O A;  7ICV A;  1SJH D;  1NKE A;  3TIX A;  2G45 B;  3HKZ F;  1UBI A;  1YX6 B;  4NAM A;  2C2R A;  4C4V A;  4DLE A;  5KFK A;  4MF8 A;  1P7F A;  3EZ5 A;  2GRI A;  4BWM A;  2O6K A;  3FDS A;  1DYQ A;  3ZJU A;  2BCR A;  8ICZ A;  4O3R A;  8ICC A;  1FFU A;  1KBU A;  1M6Y A;  4JE3 B;  3PPA A;  2JMG A;  1E6E B;  3QK0 A;  4HKQ A;  2JXX A;  2JPH A;  1VZ7 A;  2KK8 A;  2N7D A;  4PHP A;  3TAD A;  2PW9 A;  2F1H A;  2KZR A;  4XA5 A;  2D3D A;  5FR6 A;  2DHZ A;  1V85 A;  2IGH A;  3PZ8 A;  4DFD A;  1KRH A;  2J0K A;  2H89 B;  4NLG A;  4EE2 A;  2QSD A;  4B9L A;  4XYC A;  2VZK B;  8ICR A;  5F3X B;  1ZQW A;  2I5H A;  3H4D A;  5KFU A;  2E1F A;  1WR1 A;  3BDP A;  4F5N A;  4ECU A;  1R4M I;  5AIA A;  2IBK A;  4HCP B;  2HTH A;  1MPE A;  4L1B A;  1L7Y A;  5JXV A;  2HTM E;  4Z6E A;  1ED1 A;  3AEG B;  4H2A A;  1L2N A;  2Y0S F;  1RPL A;  1RYS A;  1P0R A;  1WE6 A;  4WJ3 B;  5T14 A;  2KJ6 A;  4RZR A;  2FPK A;  5KG0 A;  5J2E A;  2M4N A;  3M7D A;  2OYY A;  3BQ0 A;  4K7W A;  3JPT A;  1K5O A;  2RDG A;  4YR3 A;  1TIF A;  2YX8 A;  1SSN A;  1L0Y B;  4KLJ A;  5C3J B;  2ZUB A;  2JU6 X;  4LDT D;  3UPQ A;  1AN8 A;  1WUD A;  2D3A A;  4M00 A;  4B6W A;  5BOM A;  2PEA A;  4C4R A;  4DL7 A;  4DSK A;  2ZG6 A;  3ETL A;  2E8O A;  5JRT A;  4CQN A;  1UWX A;  3GDX A;  1LO5 D;  2XO7 A;  1Q1O A;  3PRE A;  3X0W A;  5E79 U;  2JRH A;  2KC2 A;  4NL9 A;  2BT6 A;  2KAN A;  2VH2 A;  4M6W A;  5GTI U;  3ISC A;  2WQY B;  1WX8 A;  3H6N A;  5KHO A;  1KEJ A;  1MVK A;  3TMP B;  1CI4 A;  2DGZ A;  3IP4 B;  1FD6 A;  2KVS A;  2L52 A;  9ICJ A;  9ICU A;  2M1M A;  1RYR A;  1T3Q A;  4G50 A;  4KV2 A;  4XX5 A;  4Y2P A;  1KJT A;  1OQY A;  3JSV A;  3QJZ A;  4F92 B;  2KDM A;  1D8L A;  5ALX A;  3Q3O C;  3E2E A;  4R64 A;  3TJP A;  4CF3 A;  3Q3M C;  3N1Z C;  2E3T A;  3BVG A;  1L3T A;  1WM2 A;  1ZRM A;  4PS3 A;  1SKR A;  4C7Y A;  4RFB A;  3URY A;  2NRX A;  5D4B A;  5DB8 A;  4Z6C A;  5MPO A;  4M9N A;  5BMG A;  1EWY C;  1NI3 A;  2W03 A;  5E6P A;  1BPE A;  2I1K A;  4PGY A;  4P1B C;  3RZW C;  1X6I A;  1BVS A;  1FNV A;  5HHI A;  3HHM A;  3PW0 A;  4F2S A;  1CZP A;  7ICP A;  2R61 A;  3WK9 A;  2LI6 A;  1WGK A;  5AM2 A;  1YT3 A;  1WJU A;  3PO5 A;  4JL9 A;  4EZ6 A;  5AI0 A;  2PE6 B;  3LYY A;  1ZQI A;  1OW5 A;  4DWI A;  2F3N A;  4AP9 A;  2H3V A;  2WGS A;  2Y5P A;  2XY5 A;  4LJO B;  2HBK A;  7ICH A;  4TUS A;  2LM1 A;  1ZXI A;  4BFR A;  2I1Q A;  8ICP A;  3V61 A;  5BMH A;  3WK8 A;  5IKC M;  5ALV A;  2MBB B;  4DHJ D;  4MFF A;  3PV8 A;  4K81 A;  2BPG A;  4O3N A;  4GN1 A;  1N5X A;  3K9P B;  1ZQN A;  3Q8M A;  2W7P A;  1SF0 A;  3AU5 A;  4QW9 A;  1UQV A;  4G11 A;  1WYG A;  2JF5 A;  2KOB A;  2IA6 A;  5J8Y A;  4AJW A;  2WB1 F;  3PV1 A;  5ALE A;  2C60 A;  1ISN A;  1GPX A;  4HEA 1;  4GIV A;  3P42 A;  3KH0 A;  4G9B A;  4BVU C;  2GBR A;  4UB1 A;  1TV9 A;  1GB1 A;  4LTU A;  4FUL A;  1SKS A;  3V3X A;  1E7U A;  4P4O A;  1HUZ A;  1D5M C;  2H3Z A;  2LVQ A;  1XQQ A;  2DX5 B;  1QIL A;  4DSE A;  1PZN A;  4RCO A;  2YEP F;  1Y88 A;  4HK2 A;  4HYK A;  3M9N B;  4YR0 A;  4XRH A;  2RD0 A;  3OAW A;  4RQM A;  1I42 A;  2W9M A;  2WXG A;  3BQ2 A;  4ZRK A;  2JH7 A;  3PZP A;  4ECR A;  4DFK A;  2VA2 A;  2QIE B;  1HEZ E;  4P0Q A;  5L83 A;  4GIB A;  2VA3 A;  2Q5W D;  1RLF A;  4GOC A;  5KFD A;  2AYO B;  3Q8L A;  1SZP A;  2L76 A;  2UWQ A;  5AK5 A;  2NTS A;  4OO1 J;  2NS5 A;  4P7I A;  3VTU A;  5IA7 A;  3MGI A;  3BQT A;  5AK6 A;  4A8E A;  4F4X A;  4EBE A;  4C4S A;  1FXT B;  1S0N A;  4QNL A;  2LJ5 A;  4N6E B;  3ALB A;  3K75 D;  1NYQ A;  3J9C A;  5D49 A;  4I6L B;  5KFS A;  4QZF A;  2ZZP B;  4FZN A;  1HIW A;  2M8S A;  3RD2 A;  5J2R A;  5AI9 A;  3IAS 1;  1L5U A;  3BK1 A;  2C22 A;  1ZQB A;  2K8B B;  2W04 A;  4UB3 A;  2EEL A;  2L8J A;  5B66 U;  4GXB A;  4W9H A;  3RB3 A;  2YMQ A;  4HVB A;  2CS4 A;  3L13 A;  4Q8E A;  1WR6 E;  2M19 A;  1FEH A;  3H8J A;  3FIL B;  4FZM A;  4GDL B;  1GB4 A;  4YVZ A;  2IHM A;  1P9D U;  7ICI A;  1BNP A;  2B3A A;  1NDD A;  1SXD A;  3RT3 B;  5J0O A;  3JPS A;  4DFP A;  1ZQL A;  2F8K A;  1L7M A;  3AMZ A;  2JX5 A;  3NRZ A;  2Z7J A;  4AYB F;  2Q0Z X;  4NM2 A;  4XE0 A;  1PK1 A;  4WUR A;  2WHE A;  4M2Y A;  3TEZ A;  5GTH U;  3DHH C;  3HKZ C;  3N20 C;  5J2B A;  2LVP A;  1RDF A;  4KIK B;  5ALW A;  2DQN B;  3AL0 B;  4LNO A;  4I29 A;  3PR4 A;  1CK1 A;  4PYZ A;  2KK0 A;  1C3T A;  3VTV A;  8ICK A;  1SV0 C;  3SEB A;  2NPT B;  2F44 A;  2W54 A;  1BPY A;  2ZXI A;  2AEH A;  3OTQ A;  4DK5 A;  2ZUC A;  1EWC A;  3H4B A;  1B9R A;  4XC2 A;  3PR5 B;  3R2I A;  2XEW A;  3CIR B;  2LUE A;  1VJK A;  3AE7 B;  1EM7 A;  2R2Q A;  2KN7 A;  4XWT A;  4YL8 A;  3APF A;  4I2C A;  2PJH A;  3EFC A;  5KFA A;  4J9R A;  2WXK A;  2ZXH A;  3DBS A;  4AS1 A;  1C9F A;  5HKH A;  1TBE A;  2QDF A;  3KOO A;  1T0S C;  4E74 A;  3L08 A;  5BYS A;  4YTM B;  2KKV A;  3HT3 A;  1WX7 A;  1SIF A;  2WF9 A;  3CRX A;  1FRR A;  5CWR A;  4II3 B;  4L23 A;  2Y0S C;  2YQE A;  3WKB A;  3TFR A;  1XEE A;  2WXJ A;  4GDK A;  5DG9 A;  4N59 A;  4QWE A;  4GXJ A;  2AQ0 A;  5J2H A;  2G4S A;  1KH0 A;  3P2B A;  3HM3 A;  1WJN A;  5TR5 A;  2HHU A;  1UBQ A;  2O2V B;  3KFU F;  2CR5 A;  3GE8 C;  1SE3 A;  4MSQ B;  4RQ7 A;  2JHD A;  1WI0 A;  2IO2 B;  4QZE A;  3LDA A;  8ICS A;  3DOW A;  1HQR D;  4KKI A;  2PI5 A;  5BPC A;  1KSP A;  2EKI A;  4O1N A;  5KT7 A;  1HTQ A;  2W11 A;  4DSF A;  1L6N A;  5ALK A;  4FBJ B;  3GZN B;  3GIJ A;  4W9D A;  4IQW A;  2BYE A;  2N9L A;  3BVZ A;  4DF4 A;  2NMQ A;  3K1Z A;  4RNM A;  4ZRQ A;  4GB9 A;  4QWC A;  5EE9 A;  4EX7 A;  3AE9 B;  1J19 A;  2HJ8 A;  4C4T A;  3Q8P B;  3DVG X;  3QUQ A;  5E6O A;  3UMC A;  1L6V A;  1UF0 A;  2JRI B;  3DVG Y;  4A3P A;  2M0X A;  3PST A;  4YMO A;  8ICQ A;  1IM4 A;  5HMM A;  2KFZ A;  4BOS C;  3NY5 A;  4ZH4 A;  1XLQ A;  1XCQ L;  2ZIU B;  2HVI A;  2N4F A;  2D07 B;  4Q43 A;  5L1J A;  3GS2 A;  3TAP A;  4DCC A;  4P4P A;  1N2X A;  5DQG A;  1DRG A;  2BQQ A;  2DZI A;  4BAX A;  5IOI A;  2OED A;  5HR6 A;  2QAR A;  3QUC A;  4RQ4 A;  4I2H A;  2CHZ A;  2HW3 A;  3IXS A;  2PFN A;  3AE6 B;  3F5E A;  3B08 A;  2BVC A;  2XCA A;  2LXC A;  1ZQZ A;  3KHG A;  2KTF A;  3A9K B;  2F2A B;  1UA1 A;  1P1A A;  1IBX A;  2WU5 B;  2REX A;  1S1Q B;  2EMS A;  4ZRP A;  3MAB A;  2BGF A;  3ORY A;  2GH1 A;  3AEB B;  3V62 A;  1U48 A;  5DPR A;  3FC4 A;  2V3N A;  1XNS A;  4ELU A;  2ZPY A;  2JZP A;  1F52 A;  4UW9 A;  3AUL A;  4FJV B;  4F93 B;  5KAF U;  2EZY A;  5J0X A;  1XLP A;  5B5E U;  9ICK A;  2JZB B;  1KLU D;  3WKE A;  3BII D;  1MN8 A;  1S5L U;  1UT8 A;  1PQS A;  4Y2U A;  3UXO A;  3SQI A;  4GSW A;  2BZF A;  1NK4 A;  2ZIW A;  3P4Q B;  3IM1 A;  3PMN A;  1Q46 A;  1E7P B;  1ZD3 A;  2H3F A;  3PSF A;  3L54 A;  1VDV A;  4KVG B;  4RGT A;  1E8Y A;  1NJW A;  2FNJ B;  3MHS D;  4OJP A;  4HWI B;  1LXD A;  3M8R A;  1R4N I;  4M02 A;  3RNB C;  4BOZ B;  2ZIV A;  3ZTD A;  2MJ3 A;  3PRZ A;  2WDR B;  4ITK A;  2KD1 A;  3SD7 A;  4DSI A;  4W9I A;  3A4S C;  5GXG B;  1JN3 A;  4KN7 A;  2FLN A;  4B9V A;  4LZD A;  1JWM D;  3N9Y C;  3TAR A;  2L0T A;  4RNN A;  2QEJ C;  2GO7 A;  2DPI A;  5KFV A;  1Z00 B;  5AKZ A;  3PLU A;  2NO5 A;  3ZDE A;  2AWT A;  4I28 A;  3B0X A;  2MBH A;  3C1Y A;  2I38 A;  3DBH I;  1OQR A;  1V5O A;  1P98 A;  3RJF A;  1Z19 A;  1JW9 D;  3QE9 Y;  2DKX A;  3RH4 A;  3T5J A;  1L7O A;  2GB1 A;  4MSM B;  3WKA A;  2KVZ A;  4IR9 A;  3L10 B;  1LVH A;  1MI0 A;  4B0M A;  1WJ4 A;  3UI3 A;  3OJS A;  2KSO A;  1L0X B;  2DYO A;  3VXW A;  1XF5 L;  1HA5 A;  3QWZ B;  3ZD9 A;  3N32 A;  4JLC A;  5JTI A;  3AN1 A;  4W9K A;  5CHF A;  7ICL A;  3G6Y A;  2NV3 A;  1HUO A;  3E56 A;  4AYB C;  4J9N A;  5BYR A;  4DQO C;  1V2Y A;  5DLF A;  3R8B A;  3U7D A;  3U52 E;  4QZB A;  2LGD A;  4ZHP A;  5AKJ A;  5L1I A;  4QWB A;  1YZ7 A;  4J9O A;  1N63 A;  3ONN A;  2KFN A;  1WGH A;  2BB5 A;  7ICF A;  4C8L A;  2GOL A;  5HI1 A;  1V81 A;  3NGD A;  1NK0 A;  3Q6B A;  3RNC C;  5DCN A;  1UT5 A;  1F9J A;  5IIM A;  1PGA A;  4OJ6 A;  5DDY A;  4K7U A;  2WXF A;  5IIK A;  4ELV A;  1FM0 D;  3UMB A;  3Q8E A;  3MP9 A;  2KX0 A;  1YD8 U;  5H92 C;  1FMA D;  3MJ5 A;  2XY6 A;  4KLS A;  2JEJ A;  2AGO A;  1NKC A;  3TCA A;  3RAQ A;  1DOI A;  9ICI A;  3T5L A;  9ICX A;  2XID A;  8ICI A;  4LNF A;  2Y9U A;  3RB4 A;  4ED0 A;  2LAS A;  2KJR A;  2MP2 B;  2WXN A;  3F2D A;  1MC8 A;  4TQ1 A;  5CHV C;  4WIP A;  1UD7 A;  5J0R A;  2LHD A;  3AV8 A;  3WCQ A;  2GLE A;  5KG6 A;  1PVQ A;  4YFK A;  4KTQ A;  1CEZ A;  4US8 A;  1DK2 A;  2KAC A;  2MEK A;  1KM7 A;  3PRM B;  1V38 A;  7ICU A;  3ZGZ A;  2ZCC A;  2WXL A;  1Q3V A;  2OH2 A;  4O5E A;  3Q8B A;  4KLL A;  2KOX A;  3MGH A;  4KLO A;  2BS2 B;  4F5O A;  2HMX A;  2BPC A;  2WXO A;  4F72 A;  4O3Q A;  4DF8 A;  1QOG A;  5FP0 A;  3SI8 A;  2FE9 A;  5KFR A;  7ICR A;  5D2M B;  2AHO B;  2JVC A;  4K4G A;  1YNT E;  4DQP A;  1U9L A;  5JU5 A;  1J0G A;  4QZ8 A;  3T5K A;  1ZQC A;  2AL3 A;  5FK9 C;  2N1W A;  3DQV A;  4YSZ B;  3B1L X;  2D8C A;  1VR9 A;  4KLU A;  1TJE A;  3EW9 A;  4F8C B;  2EAO A;  2RQ5 A;  5ALT A;  1DK3 A;  3C19 A;  2F8L A;  2B76 B;  1Q5W B;  1TYG B;  4ICV A;  4KGR A;  2NRZ A;  2JV3 A;  5KFH A;  5G5H A;  3SAH A;  2RDJ A;  5CR0 A;  3PVX A;  1PDX A;  1WGR A;  4UAW A;  4M01 A;  1YOV B;  1ESF A;  1BPX A;  1TK0 A;  2ASJ A;  4IWQ A;  3AM9 A;  4F71 A;  1WZ0 A;  4ASW C;  2ICI A;  3KUD B;  3SV4 A;  2IYD B;  3IG3 A;  4NLC A;  5G2N A;  2M0N A;  5AKX A;  2BQ3 A;  2DNF A;  1WGD A;  1TE2 A;  1PVR A;  1A77 A;  1V9P A;  3ALR A;  3CP8 A;  2K8C B;  3RTV A;  9ICE A;  2KMD A;  1FNU A;  1UEL A;  4JB3 A;  2ESE A;  5AKI A;  2IO1 B;  4Q45 A;  3AE8 B;  5CX3 A;  3VR8 B;  2HHX A;  2MJE A;  9ICS A;  4FJY A;  5DPW A;  2DUY A;  2QC8 A;  2OCE A;  3RAX A;  2MBE A;  2PMZ C;  1CJE A;  1CRX A;  2F1I A;  2L0F A;  3BY4 B;  1QT9 A;  9ICC A;  3QUT A;  3C5G A;  4I2A A;  3PZD A;  4NJC A;  1STE A;  2LM4 A;  4O3S A;  3KD3 A;  4ECV A;  3M62 B;  2AU0 A;  3ZDM C;  5L95 C;  5EDS A;  4KLE A;  1WF9 A;  1LQB A;  1ZQT A;  2V4R A;  2ZJ5 A;  1TT5 B;  4CRX A;  1SJE D;  4DL3 A;  2O6V B;  2G09 A;  4QIW C;  4QWD A;  1ZQF A;  3B0Y A;  4YQW A;  2KLC A;  4C56 C;  1T0Y A;  4I2I A;  2LGS A;  3L16 A;  5AUI A;  2A1A A;  3ZRF A;  1UHU A;  4USA A;  1XLO A;  2RMM A;  2JT4 B;  5KFY A;  2N0S B;  1IUE A;  1P3Q U;  2J0M A;  2JWU A;  1YQB A;  3N28 A;  4KLG A;  1UCV A;  5ALJ A;  3B9J A;  4LK0 M;  4RMA A;  2PFO A;  3OSN A;  1I7H A;  2XVT A;  2C7M B;  1D8Y A;  2CN1 A;  4KLI A;  2KN4 A;  2LGY A;  1LKY B;  1OEY J;  3VFK A;  2R8G A;  4IWO A;  2L5Y A;  1JX4 A;  1PYW D;  5DB6 A;  4WAA A;  3MR6 A;  1N5W A;  1BNO A;  3D2N A;  1K50 A;  2JYT A;  2VH1 A;  2KJH B;  9ICR A;  2OJW A;  2QHO A;  4OJO A;  1NKB A;  2KJ9 A;  2Z8L A;  5BYQ A;  5AKE A;  3RJE A;  3A33 B;  3QXG A;  4NL9 C;  3UF8 A;  2KIV A;  4R8U A;  5F9L A;  4YD2 A;  5J2F A;  2WU2 B;  2HOQ A;  2JEF A;  3EC8 A;  2HDE A;  3IRU A;  3I76 A;  2ISO A;  2LKY A;  1A6S A;  1X40 A;  4FHJ A;  1RYJ A;  3RNG C;  1KFT A;  2LGX A;  5KL8 B;  1F2R C;  4MJS B;  4J9L A;  3IN5 A;  3MBY A;  3L5K A;  4YMN A;  2WHI A;  5CHG A;  1D4B A;  1BXT A;  4RGO S;  3ICX A;  4MDK E;  2G9H D;  4XDC A;  1MQ2 A;  1NBF C;  1TAQ A;  5IO9 A;  4DO9 A;  1JWA D;  4ARC A;  1XSN A;  2BYF A;  5LXI B;  3DHI C;  5ALN A;  1BPD A;  1JAL A;  3JPO A;  1V6E A;  5AKG A;  2KJ5 A;  3D32 A;  4PHE A;  4BXO A;  4LNI A;  3ZUN A;  8ICX A;  1QKZ A;  5EWE A;  4RQ6 A;  3IHP C;  2KV2 A;  5AI8 A;  1KLG D;  1OFF A;  2L83 A;  5JZE B;  4K4I A;  4KZC A;  4CF4 A;  4RPX A;  1ZQO A;  4NLZ A;  5DG8 A;  4P1C C;  4JX1 C;  5IIN A;  4EEL A;  1T3N A;  2AJQ A;  4B9K A;  2W3R A;  2OOB B;  5III A;  3SZ2 A;  3I57 A;  3ZTC A;  1SE4 A;  1BPB A;  5KT3 A;  2BF8 B;  4DFJ A;  4EZL A;  3KBB A;  2K9X A;  4UAY A;  2AQ4 A;  2MWS B;  5AZH A;  3MDC A;  3HVZ A;  1I35 A;  4OW0 A;  1QQ7 A;  2D3G A;  5KL1 B;  1WXA A;  2ZW0 A;  3KWL A;  2E1E A;  3PX4 A;  4EEY A;  4KGS A;  3UQ0 A;  5J8Y C;  3LVV A;  1FPY A;  2ZIX B;  1QQ6 A;  2HHS A;  1UA0 A;  3O13 A;  2A1J A;  8ICV A;  2IO0 B;  3NVV A;  4RM8 A;  1XSL A;  4FBT A;  4O5K A;  3BZC A;  3QAQ A;  3I28 A;  4A3O A;  4IC7 B;  4R66 A;  4KKJ A;  3V72 A;  2N7J A;  2TSS A;  1MFW A;  1Q10 A;  2HI0 A;  3ML9 A;  1ZQG A;  4F1S A;  4KDI C;  4CYE A;  4S0R A;  1HEK A;  2BR0 A;  2UYZ B;  3DBL B;  2K4P A;  3LWM A;  1J2M A;  3ZDA A;  9ICP A;  1DXS A;  3C2L A;  1ZUD 2;  4RPY A;  4RGM A;  2IOH A;  2WLB A;  3CSF A;  4ZYS A;  1AQ6 A;  4I6N B;  3ZJT A;  3CNH A;  3NZU A;  3QQ8 B;  3Q3N C;  4A9A A;  5KFW A;  3OSP A;  1Z1B A;  3RR7 A;  1V8C A;  7ICE A;  3PSI A;  4UAT A;  1YJI A;  3AE3 B;  3WAL A;  3M6Z A;  3ZNI D;  2FLP A;  1Z2M A;  1XO0 A;  4DOB A;  2YEP B;  1VLB A;  3QX7 A;  2YTU A;  1NJX A;  4RPZ A;  1NK7 A;  5DPS A;  8ICG A;  2ON8 A;  2VRR B;  4IL6 U;  2BKR B;  2IY0 B;  4NJ6 A;  4EEN A;  2MLB A;  4O5C A;  2NVU I;  2BYT A;  1ZQV A;  3KHH A;  2A3V A;  4BDP A;  4K3C A;  2EMT A;  4JQW C;  2CRX A;  1MSW D;  3RRH A;  1XS9 D;  2K39 A;  3HJE A;  2KZZ A;  4ED1 A;  2WF8 A;  4O3O A;  3ZLZ A;  2LYA A;  2QJL A;  5ALM A;  1ZQM A;  4EEW A;  4LVS A;  2RDH A;  4PJ0 U;  2BPS A;  1TFR A;  4YXM A;  3PT2 B;  1ZQU A;  3U26 A;  3U30 A;  1QOA A;  3MFH A;  3A4R A;  2KIC A;  2N9E B;  4JK1 A;  2KWU B;  4CO7 A;  1R4N B;  4EZK A;  5CP2 A;  4FJZ A;  2M0A A;  5E6N A;  5AUK A;  4KX5 A;  1YN4 A;  4WWN A;  3RNF C;  2CJO A;  4I27 A;  4RQ1 A;  1XC9 A;  4P0P A;  2ALZ A;  4M0W A;  1QH9 A;  2CHW A;  5KFN A;  3Q3F A;  3EPG A;  3C2M A;  3M1Y A;  2GI9 A;  4KLT A;  3RBE A;  3CMM B;  1X9X A;  2R8J A;  5IIL A;  2L32 A;  2PE9 A;  4URK A;  4TV3 A;  4EX6 A;  5EWG A;  3Q3J A;  3RPF C;  2WXM A;  1TS3 A;  2KLG A;  3A9J B;  1D8B A;  1S77 D;  2KFJ A;  5KT2 A;  2D6F C;  1GC7 A;  2KFK A;  1NJZ A;  3P4S B;  4NAW A;  4F5R A;  5CEH A;  1KL9 A;  5AM0 A;  1V1P A;  2DBY A;  1OTR B;  1JRP A;  3MGV A;  1SKW A;  1ZKH A;  2LZ6 A;  1E0Z A;  3AU6 A;  3PS6 A;  4MGK E;  4IUM B;  2MHJ A;  3NVZ A;  2W9C A;  4BKT A;  2KTR A;  2W9B A;  3P1M A;  4J9K A;  3T79 A;  1IG6 A;  1QLB B;  4I6P A;  4U7C A;  2VKQ A;  2V1Y A;  4UAS A;  4J3O D;  2MUT B;  1D3Z A;  4YCX A;  4Z6D A;  3ZNH B;  4FA6 A;  2K22 A;  4K7S A;  4QZH A;  2HBM A;  4PGQ A;  3PW7 A;  3LJ3 A;  1HZ6 A;  4JWM A;  2X38 A;  1KW4 A;  1ZQR A;  5ALO A;  1KFD A;  2FAZ A;  2K0P A;  3OLM D;  3NUQ A;  2I9G A;  1GAQ B;  1C4P A;  2Y1I A;  2ISP A;  1YJ1 A;  1SXE A;  1LGR A;  4W9G A;  3NVW A;  2PTL A;  2AH5 A;  3TKA A;  1QSY A;  1M94 A;  4Y2X A;  3UIN B;  2K4E A;  4RM9 A;  9ICF A;  5KHQ A;  3GOE A;  4DXF A;  3MC8 A;  3SYZ A;  2N9P C;  1Q3U A;  4M9L A;  4ED2 A;  1VJ5 A;  2JH1 A;  3AEV A;  1NJY A;  1WMH A;  2XCP A;  1WXV A;  3A1Q A;  1BUI C;  1ACC A;  2FE8 A;  2G1E A;  3GIK A;  2NR2 A;  1MA7 A;  1PGX A;  3HRD D;  3LDZ E;  3SMV A;  3QEA Z;  4IG7 B;  5C2T B;  2YLM A;  3GP7 A;  1T94 A;  3SEN A;  3BYY B;  2WF5 A;  5KFG A;  4FHK A;  4PK1 A;  4KIT B;  1JCK B;  2F1J A;  1TK5 A;  1NYR A;  1S3S G;  3RB0 A;  5C23 A;  1T0Q C;  4XWW A;  5AKK A;  2ONQ A;  4MM3 A;  2KQS A;  4MF2 A;  2SEB D;  2KQ4 X;  4KSL C;  3DWM A;  3VTW A;  2IPK D;  3ISD A;  3DVN U;  3DWG C;  3R7Q A;  2K3U A;  4A55 A;  3IFW B;  2KXJ A;  4IW0 A;  2XY7 A;  4IM0 A;  2ZTD A;  1S97 A;  2WWZ A;  3KYC D;  4CCH A;  3Q14 C;  4JWN A;  3RH6 A;  1YX5 B;  4LDT B;  1EF5 A;  2RDI A;  1IGC A;  2BQR A;  4G3I A;  4O0I A;  1JML A;  4GGQ A;  4DEZ A;  2K1F A;  1SBB B;  3RZF A;  1ECW A;  1YQ4 B;  1Z4N A;  1WGG A;  8ICH A;  4QAY A;  1NZP A;  3H7P A;  4C4V B;  5KFI A;  1ZET A;  1FFV A;  1L3V A;  2MCN B;  3DBR B;  2MSE D;  4K1R B;  4IDI A;  2KHV A;  3QCA A;  3S2A A;  3R2T A;  3W5V B;  2Y1J A;  3RNA C;  3RH5 A;  3VUY A;  5AI6 A;  2QB0 A;  1LFD A;  4DQR A;  3A0H U;  5CTR C;  1PK3 A;  1MQ3 A;  4JPS A;  4KN4 A;  4OVU A;  3GV5 B;  3N7S C;  2KX3 A;  4OJL A;  3EGR A;  4L2Y A;  1FO4 A;  4M9J A;  4NQK E;  3ZVV A;  1WFY A;  3B0A A;  2EAM A;  3NTU A;  1X1M A;  2LHT A;  1RWS A;  3UQ2 A;  2WXI A;  4RQ3 A;  4S17 A;  2IY1 B;  2R8K A;  3GU3 A;  4B9M A;  3H7S A;  1EU4 A;  4I2D A;  4CHK A;  1K1S A;  1FCC C;  3V05 A;  1RQN A;  3O65 B;  3QC8 B;  4GLS C;  3MFI A;  5J2J A;  2BCV A;  1S0V A;  3R9K A;  2LXA A;  4REZ A;  4J9S A;  3N30 A;  2N9K A;  2KWC A;  3RJH A;  1WCN A;  1ZQX A;  4F5Q A;  2RR9 A;  3IBE A;  3UIO B;  2L3Z A;  2XN9 C;  4GXK A;  2LYB A;  2EKE C;  2J4X A;  4PL1 A;  1SL0 A;  1L6U A;  1RYU A;  1N6Z A;  1YN5 A;  3NUH B;  4FXC A;  1AAR A;  3AQF A;  3BJY A;  1Z5S B;  5LLI A;  4C7Z A;  3W1S A;  1ZD2 P;  2FCS A;  2B0C A;  3QAR A;  1YIW A;  2FBW B;  1BPZ A;  3VAW A;  5AM3 A;  4DHJ B;  2RPQ A;  2K89 A;  1ZW7 A;  1RXV A;  3A0B U;  2JZ3 B;  2LI5 A;  2BWE S;  4IKG A;  4BBN F;  4M47 A;  3OPX A;  4Y2T A;  4ED7 A;  5D6J B;  2MX2 A;  1DOQ A;  2PMZ F;  4BWJ A;  3KVF B;  5DBA A;  2IOF K;  5EWF A;  3P63 A;  2YML A;  3RJJ A;  4BKS A;  1SL1 A;  4M6W B;  1WYW B;  1FCL A;  1TKE A;  4LJX A;  5ALL A;  1I4H A;  2C7H A;  1A0P A;  4RQN A;  1IXR A;  4PHD A;  4TUU A;  1YN3 A;  5G5G A;  2KC1 A;  5J0Y A;  2FCN A;  2EAN A;  4RGN A;  3BS7 A;  3V6C B;  1C76 A;  1WX9 A;  2I2Y A;  2MRL A;  2GBJ A;  2KDB A;  3DHG C;  1ZXH A;  3JSV B;  4RQ5 A;  2UVV A;  3TBL D;  2DPJ A;  4QIW F;  4I2B A;  4GC7 A;  4X5V A;  2MAX A;  5BOL A;  5KT6 A;  2XK5 A;  5BO4 B;  3KHR A;  8ICA A;  2MSN A;  1S0O A;  3H8H A;  3WAM A;  5CHW A;  3BS5 A;  3HIL A;  1E9M A;  3X23 A;  1B43 A;  2GBK A;  2CPR A;  2INC C;  1ZQA A;  2D5G A;  3K4G A;  3AH7 A;  1R7S A;  5E6J A;  3VDZ A;  2M9N A;  4J9M A;  2CU3 A;  4NWI A;  4XZ4 A;  9ICQ A;  3PML A;  4DL2 A;  3KZX A;  3WA0 A;  1ROE A;  2ODG A;  2IHN A;  1J8C A;  2BQU A;  2FUG 1;  1F0Z A;  4IRD A;  4IQV A;  2KZ3 A;  4Y2Y A;  4RUA A;  1K51 A;  4W9C A;  5KFX A;  2N1V A;  2HJ1 A;  3VR9 B;  2BCS A;  2YMM A;  2LBO A;  4NQL B;  2K25 A;  3PGE A;  3Q8R B;  4CDG A;  1T7P A;  1L7P A;  3C2K A;  1TY2 A;  3RFZ B;  4FO6 A;  2AL6 A;  1KLN A;  3V6K A;  1S76 D;  4PZN A;  4NY8 A;  1QQR A;  1UH6 A;  3OJU A;  1TZO A;  2KWD A;  2BKE A;  5AZG A;  5AI5 A;  4A20 A;  1KRP A;  1R4M B;  4F2R A;  4ELT A;  3KYD D;  4BKS D;  4YSX B;  2PLP A;  2EDU A;  2RDB C;  2ZCB A;  4NM1 A;  4EBC A;  2L7R A;  2QMT A;  8ICU A;  8ICW A;  1WH3 A;  2DF4 B;  5EE3 A;  2Z0E B;  2IOF A;  5KFE A;  1U49 A;  4KLM A;  1B22 A;  3JVZ X;  4NJ7 A;  1ZPS A;  2INP E;  1ZQQ A;  2FJ6 A;  2L1A A;  4NAW B;  1U4B A;  3FM9 A;  5DPT A;  4Z6F A;  4F91 B;  3R7R A;  3OGU A;  4HRS A;  5DB9 A;  4EUT A;  3PSE B;  3THV A;  1EO6 A;  2MRP A;  1EF1 A;  1D9F A;  2HE7 A;  4UBB A;  2KQ7 A;  3AI5 A;  2IZV B;  3EUB 2;  1GG3 A;  3N3K B;  1GUA B;  3ZJV A;  5HP4 A;  1KF6 B;  4P0Q B;  1J7C A;  3WAO A;  1X6J A;  2XNA C;  2EZZ A;  2YVC A;  3MHZ A;  2KMA A;  1PVP A;  5L1K A;  2BS3 B;  3TL5 A;  2PKE A;  1KFY B;  4E0D A;  1CMX B;  2H3Q A;  4Y2R A;  3TUO A;  4AOF A;  5DDM A;  3DV9 A;  2H5X A;  4LJP B;  2V3P A;  4LNN A;  2MW5 A;  5EE0 A;  2PPH A;  3TEW A;  3NZS A;  3R3M A;  4KLF A;  1IYF A;  3AB5 A;  3N1Y C;  5JUM A;  3GIM A;  1LM8 B;  2INN E;  1TAM A;  1PGB A;  1X9S A;  1OEY A;  4KZ0 A;  3G6V A;  3C29 A;  3EWA A;  4P6V F;  4R63 A;  4JMU A;  5KG2 A;  1JWB D;  4IC9 A;  2I6X A;  2JSV X;  1SB3 C;  4ECX A;  4F5P A;  5TIS U;  4RQ2 A;  4MH8 A;  2IMW P;  3RUL A;  2LUM A;  2G5H B;  1I4Q A;  2QKQ A;  1NK8 A;  2LJI A;  3NS8 A;  5J2K A;  5H2F U;  4I2G A;  4TSS A;  2KN5 A;  1PK1 B;  2KG5 A;  3JPQ A;  2HOI A;  2LD9 A;  3BIN A;  3DPD A;  1E7V A;  1V80 A;  1V5T A;  1O03 A;  2KKP A;  1RZT A;  2BHN A;  4NPN A;  2E8M A;  2NBU A;  3O0F A;  4YTP B;  3AU2 A;  3F5A A;  4EFO A;  4TQ0 A;  4FLH A;  2KHQ A;  7ICO A;  2Y9T A;  2VZK D;  2JEI A;  3RFA A;  3VC8 A;  1UNS A;  4HJK A;  4N9F 4;  3WIM A;  4A8X C;  5KFZ A;  3SD5 A;  2WAQ C;  4IQT A;  1JUD A;  5AM5 A;  4QZA A;  1C4C A;  3TEY A;  1V1O A;  3NZ3 A;  3RNE C;  4DBG A;  2BTE A;  2PFP A;  4R3D A;  5KT4 A;  5AK3 A;  3QU9 A;  2Y5C A;  1L5P A;  4DS5 A;  1JIH A;  1U4A A;  4X57 B;  3PO4 A;  2W3S A;  1ZQP A;  2QLT A;  1VD2 A;  3TAQ A;  2KJ8 A;  4RUC A;  4OD0 A;  5KAI U;  2DYM A;  4W9J A;  2WS3 B;  4B9U A;  1JMS A;  8ICF A;  5DLG A;  4TMA B;  3KKA A;  2K60 A;  2KHW B;  3V6J A;  4EYI B;  1LV5 A;  3C21 A;  5ALR A;  4P4M A;  4G0N B;  4GDK B;  3UXN A;  1XO3 A;  4F7Z A;  4DHZ B;  2BCQ A;  4PS7 A;  1WSP A;  4P2H A;  3SR6 A;  3TQ1 A;  3NS1 A;  3ZXV A;  5ALG A;  8ICE A;  2D2Q A;  4IRC A;  4LNK A;  2E5S A;  4R65 A;  4NNJ B;  2JYE A;  4HDO A;  2HSZ A;  3MJW A;  2C7N B;  4IM3 A;  1JRO A;  4WQM A;  3ENE A;  1I4P A;  2WDQ B;  4QW8 A;  1ZJN A;  4IR1 A;  3QA8 A;  3OHA A;  4EBD A;  7ICJ A;  4BBN C;  2NRV A;  5KFB A;  3PHW B;  5AEK B;  3D2Q A;  1C4A A;  3P4P B;  3WU2 U;  4C0Z A;  2V4I B;  3AQE A;  4GMV A;  4NV0 A;  1SZH A;  1UWM A;  4J6I A;  2HBL A;  3TAD C;  4LLG M;  2M17 A;  1JXL A;  2MA1 A;  1E10 A;  1WWT A;  3H9D A;  8ICN A;  2XC9 A;  4EOY A;  4OZB A;  1L4D B;  1Z3E B;  1FIQ A;  3C5F A;  4KLQ A;  1IGD A;  3VH4 B;  2W82 A;  4HDQ A;  1HZ5 A;  1GNU A;  5I4D A;  4FE3 A;  1IIP A;  5HHH A;  4KDL B;  2ZVN A;  3N7R C;  5KFF A;  3GZN I;  3ZRC A;  3W1Y A;  4O3P A;  4YP3 A;  3GFK B;  5C0Y A;  3DEE A;  2ZW1 A;  5HHD G;  2K8B A;  4MEX A;  5J0Q A;  5CA7 A;  2RLT A;  2H88 B;  3Q2A C;  3CF6 E;  2W43 A;  5ALF A;  5J29 A;  4ZOH C;  3Q8S B;  2E8N A;  2D3C A;  3FIL A;  3RUI B;  2QAR B;  4GDL A;  2Y5B B;  3BZD B;  3SFD B;  1PFD A;  4UB6 U;  3QU2 A;  3GQC A;  2QIL A;  2BDP A;  1UZX B;  4WJN A;  3M8S A;  3QYP A;  3C28 A;  2ZTC A;  1RM6 C;  1IV8 A;  2P66 A;  4NLK A;  1CUK A;  2VA8 A;  3WK7 A;  1WE7 A;  2JZZ A;  4HCN B;  3UQB A;  1IBX B;  4IOI E;  5AM1 A;  7ICG A;  2WX0 A;  4BX9 C;  4QZG A;  3ZO5 B;  4MHV A;  3NJT A;  3OJ3 A;  4B95 A;  3CST A;  2KDE B;  3ZI4 A;  3H8M A;  4MT5 A;  4KIK A;  4KMO B;  1QSL A;  2FPM A;  9ICL A;  5JHA A;  3ZDB A;  4DFM A;  4RF1 A;  3SFE B;  4J9Q A;  5J2C A;  1DOY A;  2H3I A;  4Q44 A;  4JUZ A;  4UB4 A;  4O3M A;  1TS2 A;  3TSS A;  3NVY A;  2L00 B;  4UAU A;  3V6E B;  3ZIM A;  1XSP A;  3L3F X;  4J9P A;  1C77 A;  8ICT A;  5IIJ A;  1X9M A;  3QZ7 A;  5KG4 A;  9ICW A;  3HUI A;  3GII A;  3UGB B;  2LFI A;  4ICA A;  2B6G A;  2ZIW B;  5C5J A;  3TI0 A;  4M8M A;  4BJQ A;  2ASL A;  3WKC A;  2UVR A;  3IHQ B;  3QEB Z;  5KG3 A;  2DFL A;  4PT5 A;  1L0V B;  5IP4 D;  1HXY D;  2LRU A;  7ICM A;  5DBB A;  1NNL A;  2BPF A;  2YB1 A;  4Y2Q A;  1RFA A;  1I4R A;  3IT4 B;  2W55 A;  4XDD A;  3ED5 A;  5J2A A;  2YMP A;  3T8M A;  1ZGU B;  3WAN A;  4YD1 A;  4GU2 A;  2ZIV B;  1J7B A;  3JPP A;  1RAX A;  4WJP A;  3LYS A;  1SL2 A;  2PFQ A;  4ECY A;  3SEI A;  3BK2 A;  2LGI A;  8ICO A;  2N1R A;  1QTM A;  3OWE B;  1H38 A;  2YB4 A;  3ZNZ B;  5DBC A;  1WXQ A;  2KDF B;  2RHF A;  1XCT L;  5J2G A;  4WWO A;  2O2V A;  2Q4T A;  4UB5 A;  1B4F A;  4UQG A;  5J2I A;  1SGH A;  3VRB B;  1I4X A;  3VRA B;  5HML A;  9ICA A;  3QU7 A;  2J53 A;  5AM4 A;  1Q0W B;  3VQI A;  3UM9 A;  1QLN A;  1VZ8 A;  4QZI A;  2KO3 A;  2G3Q B;  1OXJ A;  1ZE3 D;  1F5S A;  4PPX A;  2KSO B;  2XGQ A;  3KUC B;  3VUW A;  1AW7 A; 
#chains in the Genus database with same CATH homology
 1BUI C;  1RFK A;  4OZC A;  1ACC A;  2FE8 A;  2G1E A;  3BII D;  1XLN A;  1PGX A;  2KAJ A;  3HRD D;  3P4Q B;  5C2T B;  4ZHO A;  3GP7 A;  3KWV A;  3BYY B;  1TKG A;  1AYF A;  1E7P B;  1PUT A;  2NTT A;  1VDV A;  1JCK B;  1NYR A;  3PZ7 A;  4RGT A;  3P4R B;  4RF0 A;  1D5Z C;  2JQR B;  4YWG G;  3I9V 1;  4XWW A;  2ONQ A;  1NVI D;  1D6E C;  2SEB D;  2KQ4 X;  2E6X A;  2RPV A;  3DWM A;  2IPK D;  2IGD A;  3DWG C;  3EA6 A;  1DOX A;  2K3U A;  2J42 A;  4A55 A;  2WXR A;  2MJ3 A;  2WDR B;  3KLS X;  4ITK A;  4N58 A;  5GXG B;  4JWS C;  4RH6 A;  3W5U B;  3N9Y C;  1IGC A;  1JWM D;  1QF6 A;  2QEJ C;  1JML A;  1FXI A;  1ZOY B;  1SBB B;  1YQ4 B;  2CJN A;  3U2S C;  2I38 A;  1FFV A;  1OQR A;  1JW9 D;  3AEF B;  4IDI A;  1OQQ A;  4YT0 B;  2GB1 A;  2LHE A;  1QOF A;  3R2T A;  3W5V B;  1AWD A;  1N60 A;  3B2G A;  3TEX A;  1MI0 A;  5D7G A;  4B0M A;  4ARI A;  3UI3 A;  1KTK A;  2DYO A;  1L0X B;  2ACZ B;  4JPS A;  1XF5 L;  1HA5 A;  4A90 A;  2WXH A;  3EGR A;  1ZDV A;  2PIA A;  4L2Y A;  3AN1 A;  1FO4 A;  3Q69 A;  3E56 A;  1RWS A;  3AEC B;  2PKO A;  4OHJ A;  2WXI A;  1N61 A;  1C79 A;  5FKA C;  5BYR A;  4DQO C;  3R8B A;  1ET6 A;  3U52 E;  1T5X D;  1VRA B;  2K5P A;  5HG2 A;  5BMI A;  4ZHP A;  1EU4 A;  3Q8C A;  4WH4 A;  1FCC C;  3V05 A;  1TY0 A;  1N63 A;  4GLS C;  2BB5 A;  3HVD A;  4REZ A;  3Q8A A;  5HI1 A;  1L4Z B;  2N9K A;  2MJD A;  1F2R I;  1ENF A;  4Q2J A;  3L4P A;  1JWS D;  3W2D A;  1PGA A;  2WXQ A;  2XN9 C;  4WWM A;  2J4X A;  2WXF A;  1L6U A;  1SIJ A;  1FM0 D;  1YN5 A;  3NUH B;  4FXC A;  3Q8E A;  3MP9 A;  4YSY B;  5H92 C;  1FMA D;  3MJ5 A;  2JXT A;  4C7Z A;  3W1S A;  1JQ4 A;  3IAM 1;  1DOI A;  2FBW B;  2AQ3 B;  3T3O A;  1SJH D;  4HKZ E;  4NAM A;  4IKG A;  4MAC A;  2WXN A;  4TQ1 A;  1P7F A;  3WCQ A;  4WIP A;  1SEB D;  2GRI A;  2LHD A;  3AV8 A;  1T6B X;  1WRI A;  1DYQ A;  2MEK A;  3ZJU A;  2KAC A;  4US8 A;  2SAK A;  3P63 A;  1FFU A;  4JE3 B;  3ZGZ A;  1E6E B;  4HKQ A;  1VZ6 A;  2WXL A;  3FAH A;  1B1Z A;  1TKE A;  1I4H A;  1D5X C;  3Q8B A;  1FCL A;  3ZQ4 A;  1VZ7 A;  3AEA B;  2BS2 B;  1YN3 A;  5G5G A;  2PW9 A;  4RGN A;  2WXO A;  1SE2 A;  1C76 A;  2IGH A;  2I2Y A;  1QOG A;  3PZ8 A;  1KRH A;  1ZXH A;  4HJG E;  2H89 B;  1K52 A;  4EE2 A;  2QSD A;  1YNT E;  5T8I A;  2VZK B;  5FK9 C;  3H8H A;  4YSZ B;  1VR9 A;  1TJE A;  1MPE A;  4L1B A;  5JXV A;  1P7E A;  2HTM E;  1E9M A;  3AEG B;  4H2A A;  3Q8F A;  2B76 B;  2D5G A;  1TYG B;  3AH7 A;  1R7S A;  4KGR A;  3AE5 B;  5E6J A;  5G5H A;  1PDX A;  2CU3 A;  3LXF A;  1ROE A;  1ESF A;  2AQ2 B;  2FUG 1;  4B0E A;  3AM9 A;  3C8Y A;  1F0Z A;  4D2K A;  2ICI A;  2OHF A;  1K51 A;  2RDG A;  3AE4 B;  1YMH E;  1SSN A;  1L0Y B;  1TS4 A;  3VR9 B;  5C3J B;  2JU6 X;  1AN8 A;  2AQ1 B;  1FNU A;  3AE8 B;  4CQN A;  1TY2 A;  3VR8 B;  1UWX A;  1LO5 D;  3T3N A;  2MJE A;  3IT6 B;  4OVZ A;  1QQR A;  4UDU C;  1TZO A;  2BT6 A;  2KWD A;  2WQY B;  1CJE A;  5EE1 A;  4YSX B;  2AX5 A;  1MVK A;  1QT9 A;  2PLP A;  1FD6 A;  2L52 A;  4NJC A;  1STE A;  1T3Q A;  2DLB A;  5EE3 A;  4YXD B;  2KDM A;  2IGG A;  1ZPS A;  2INP E;  2L1A A;  4NAW B;  2E3T A;  1SJE D;  3ZYY X;  3BVG A;  4C56 C;  4HRS A;  1K53 A;  4C7Y A;  4RFB A;  3URY A;  5AUI A;  4USA A;  1XLO A;  2RMM A;  1JWU D;  3E9S A;  5BMG A;  5MPO A;  3EUB 2;  3ZJV A;  1EWY C;  2N0S B;  1IUE A;  1KF6 B;  1NI3 A;  1J7C A;  2JWU A;  2XNA C;  3MHZ A;  1J7A A;  3B9J A;  4LK0 M;  2BS3 B;  1FNV A;  1KFY B;  1CZP A;  2R61 A;  1I7H A;  1WGK A;  3AE2 B;  2KN4 A;  3TUO A;  4NZL B;  3LYY A;  2V3P A;  2Y5P A;  1PYW D;  4JWU C;  5EE0 A;  3TEW A;  1N5W A;  1ZXI A;  3AB5 A;  1K50 A;  2BS4 B;  2JYT A;  4P16 A;  5BMH A;  3BVM A;  2INN E;  1PGB A;  2Z8L A;  2PMV A;  1TS5 A;  4P6V F;  1N5X A;  5D3I B;  1JWB D;  5BYQ A;  2IDY A;  2KMM A;  1SF0 A;  2JSV X;  1YQ3 B;  1SB3 C;  4MH8 A;  2WNM A;  1WYG A;  2LUM A;  1ZP0 B;  2WU2 B;  1BML C;  4DXG A;  1I4Q A;  2LJI A;  4WAF A;  2BBC A;  2BW2 A;  1MHH E;  2HDE A;  1GPX A;  4TSS A;  4HEA 1;  3P42 A;  2M56 B;  1RYJ A;  3ABV B;  1GB1 A;  4LTU A;  1F2R C;  1N62 A;  2IJ0 A;  3V3X A;  1D5M C;  2V0G A;  3MC0 B;  1D4B A;  1BXT A;  1QIL A;  4RGO S;  4YTP B;  4US9 A;  4RCO A;  2G9H D;  2YEP F;  5D3D A;  4TQ0 A;  4XDC A;  2VZK D;  1UNS A;  4A8X C;  1JWA D;  4ARC A;  1UUP A;  1JAL A;  1ZDX A;  2WXG A;  1C4C A;  3BWU D;  3TEY A;  1V1O A;  3NZ3 A;  1QKZ A;  2QIE B;  1NEN B;  1HEZ E;  1QOB A;  2BTE A;  2Q5W D;  1C78 A;  4R3D A;  2Y5C A;  1KLG D;  1L5P A;  1OFF A;  3RFZ B;  2L83 A;  2NTS A;  2W3S A;  2BB6 A;  4N6E B;  1NYQ A;  3J9C A;  4JX1 C;  2DYM A;  2WS3 B;  2W3R A;  2PVG C;  3IAS 1;  4TMA B;  3I57 A;  3BK1 A;  5TSS A;  1SE4 A;  2WDV B;  2EEL A;  1NEK B;  2K9X A;  3GB1 A;  4KX6 B;  4GDK B;  1XO3 A;  1WSP A;  3HVZ A;  2M19 A;  4OW0 A;  4AQ7 A;  1FEH A;  2MH7 A;  3FIL B;  3SR6 A;  1GOZ A;  3KWL A;  4GDL B;  2ZW0 A;  1GB4 A;  3NS1 A;  4KGT A;  4KGS A;  2ZW1 A;  2JX5 A;  3AMZ A;  2QMT A;  1UGJ A;  3NRZ A;  2WXP A;  4XE0 A;  3O13 A;  2JYE A;  4WUR A;  1JRO A;  1YJJ A;  4WQM A;  3TEZ A;  1I4P A;  2WDQ B;  3NVV A;  4KKJ A;  1C4A A;  2N7J A;  2TSS A;  3P4P B;  1CK1 A;  2V4I B;  1Q10 A;  1I4G A;  3SEB A;  1UWM A;  4LLG M;  1E10 A;  3W9C B;  1WWT A;  2W54 A;  5HFY A;  4OZB A;  1L4D B;  1ZUD 2;  1FIQ A;  1EWC A;  2WP9 B;  1DGJ A;  4RGM A;  2WLB A;  1IGD A;  4ZYS A;  1B9R A;  3ZJT A;  2W82 A;  1F77 A;  3R2I A;  1HZ5 A;  3CIR B;  5I4D A;  1VJK A;  3AE7 B;  1EM7 A;  4XWT A;  4A9A A;  1V8C A;  1V1P B;  1YJI A;  3AE3 B;  2WXK A;  2YEP B;  4AS1 A;  1VLB A;  1C9F A;  2PVO D;  1MHX A;  1XXG A;  2ON8 A;  5BYS A;  4YTM B;  5HHD G;  1FRR A;  4RNA A;  2BYT A;  4L23 A;  1XEE A;  2WXJ A;  2H88 B;  4N59 A;  2DWQ A;  3MFG A;  4ZOH C;  3FIL A;  1KH0 A;  2QJL A;  3BZD B;  1M4V A;  1CQV A;  3SFD B;  1PFD A;  2RDH A;  4C80 A;  2QIL A;  4YTN B;  1RM6 C;  1IBX B;  1SE3 A;  1FRD A;  1QOA A;  4IOI E;  1HQR D;  4OZA A;  3AE1 B;  4MT5 A;  4KKI A;  2M0A A;  5AUK A;  4RF1 A;  3SFE B;  1YN4 A;  1DOY A;  2CJO A;  2EKI A;  4O1N A;  4M0W A;  1TS2 A;  2GI9 A;  3NVY A;  3TSS A;  1C77 A;  2N9L A;  1FXA A;  3BVZ A;  2L32 A;  3HUI A;  5LNK 1;  2Y3A A;  2NMQ A;  2LFI A;  3RPF C;  2WXM A;  4ZRQ A;  1TS3 A;  2J52 A;  3CWI A;  5EE9 A;  3AE9 B;  4A6Q A;  1V97 A;  4PT5 A;  3P4S B;  1L0V B;  1HXY D;  1V1P A;  1L6V A;  2DBY A;  1JRP A;  5FR3 A;  3PO0 A;  1FNW A;  1I4R A;  1SXT A;  4MM3 B;  1E0Z A;  3IT4 B;  2W55 A;  3KQ4 A;  4XDD A;  1A70 A;  3NVZ A;  3P1M A;  1XLQ A;  1EU3 A;  1QLB B;  1XCQ L;  4HRO A;  3GS2 A;  1J7B A;  1Y56 A;  4J3O D;  1ET9 A;  3U7Z A;  3BK2 A;  2LGI A;  2K22 A;  2OED A;  1TKY A;  3OWE B;  3IXS A;  3BYT B;  3AE6 B;  3AEE B;  5H8Y E;  1HZ6 A;  2X38 A;  1WXQ A;  1XCT L;  2K0P A;  3B2F A;  3AED B;  1IBX A;  2LMC A;  1GAQ B;  2LEK A;  1C4P A;  3LB8 C;  2WU5 B;  3VRB B;  1I4X A;  3VRA B;  4ZRP A;  3U4E G;  2J53 A;  3VQI A;  3NVW A;  2PTL A;  3AEB B;  3FC4 A;  2V3N A;  1VZ8 A;  2JZP A;  4DXF A;  1ZE3 D;  1XLP A;  1KLU D;  3ETR A;  1AW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...