1FIQA

Crystal structure of xanthine oxidase from bovine milk
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of bovine milk xanthine dehydrogenase and xanthine oxidase: structure-based mechanism of conversion.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords XANTHINE OXIDASE
total genus 39
structure length 164
sequence length 164
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1fiqA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fiqA01
1KF6B 4KX6B 1I7HA 4HRSA 1XLPA 1AWDA 2HTME 2WS3B 1E6EB 1A70A 1XLOA 3ETRA 3B2FA 2B76B 1VLBA 4JX1C 4JWUC 1WGKA 2PIAA 3AE8B 2QIEB 1RWSA 1FXAA 4LTUA 1FXIA 1FO4A 1IUEA 1NI3A 2PVGC 2W55A 2BS2B 3P4QB 4IDIA 3AH7A 2QJLA 4ITKA 2M19A 3W5VB 1SF0A 1ZP0B 1DOIA 2LEKA 2K5PA 1N61A 1UWMA 1NYRA 2JQRB 5EE0A 5AUIA 3NVZA 2KMMA 3AEEB 2CU3A 1CZPA 3NS1A 1VDVA 4YTMB 1JQ4A 3NRZA 1OQQA 2W3RA 3AE7B 3AEBB 2PKOA 1JWAD 1XLNA 1YJIA 3P4RB 4C80A 1NVID 1QT9A 2G1EA 3AE6B 1QLBB 2KAJA 1TKYA 3HUIA 1TJEA 2DBYA 1JWBD 3LXFA 4USAA 1JW9D 3NVYA 3WCQA 2AX5A 3SFEB 5C3JB 1GAQB 4YXDB 1JALA 3P4PB 1R7SA 2H88B 1SIJA 1QOFA 3CIRB 1GPXA 3AE3B 1RYJA 3SR6A 1CJEA 3B9JA 1T3QA 3W5UB 1PUTA 1NENB 1WRIA 3LB8C 3VRAB 3L4PA 3FC4A 4ZOHC 1ZOYB 2WDQB 2FBWB 1E9MA 1QF6A 3AEAB 3AE2B 4WWMA 5G5GA 3NVWA 1FFUA 1PDXA 3AEGB 1XO3A 3DWGC 3SFDB 2EKIA 2WQYB 2M56B 2Y5CA 4N59A 2OHFA 1KFYB 3AEDB 1N60A 1L0VB 4FXCA 4A9AA 3PO0A 3BIID 3AE1B 3B2GA 3VR8B 2W3SA 1JRPA 1FMAD 1WXQA 5GXGB 1L6VA 5H92C 1ZXIA 5MPOA 1V8CA 1DGJA 1FIQA 2Q5WD 1TKGA 2N0SB 3AV8A 3RPFC 1QOGA 2JX5A 1YQ4B 3VRBB 1J7CA 4YSZB 2ACZB 3EUB2 3KWLA 4YT0B 2WDRB 4YTNB 3FAHA 2BT6A 5C2TB 1OQRA 1RFKA 1TKEA 1FRRA 2WP9B 3AB5A 5EE9A 2E3TA 1VJKA 1DOXA 5G5HA 1EWYC 3AECB 1YJJA 1N5WA 2MJEA 2L52A 3AE4B 1J7BA 3VR9B 4YSXB 2W54A 1N5XA 2WDVB 1F0ZA 1FM0D 1N63A 1J7AA 4C7ZA 3AMZA 2WU2B 3HRDD 3AEFB 3HVZA 4US8A 1KRHA 4WQMA 3ZYYX 1FRDA 4N58A 4US9A 1V97A 4N6EB 4ZHOA 1DOYA 1L6UA 3P1MA 3P63A 1OFFA 1QOAA 2MJ3A 3CWIA 2L83A 2PVOD 4JWSC 1RM6C 1PFDA 1YQ3B 2BS3B 2K9XA 3AM9A 1B9RA 1E0ZA 4YTPB 1N62A 5EE1A 3W9CB 5AUKA 1E10A 2BS4B 2CJNA 1ZUD2 2K22A 1FFVA 2WLBA 2WU5B 1XLQA 3AN1A 3P4SB 1WWTA 4HROA 2MH7A 5EE3A 3DWMA 4YSYB 4C7YA 2MJDA 1NYQA 1QOBA 1E7PB 1WYGA 1ROEA 2DWQA 4P6VF 5H8YE 1L5PA 2CJOA 1AYFA 1JROA 4ZHPA 2H89B 3ABVB 3AE5B 1TYGB 1SB3C 3AE9B 1NEKB 3NVVA
chains in the Genus database with same CATH superfamily
2KN7A 1JCKB 1WE6A 2IOFA 1L5UA 2NS5A 3T79A 4W9DA 2F8LA 2EKEC 1VCBA 3K1RB 1WGKA 4DHZB 2NTTA 4F5PA 2KZZA 1HTOA 3DHGC 4MF8A 8ICLA 1IUEA 4UAZA 4MSMB 4M8NA 5DG9A 8ICHA 2Q0ZX 4E3CA 2P6UA 3UGBB 2LGYA 1SE4A 3ZNGC 1J2NA 4ICAA 2M0AA 3WANA 4KLEA 5TISU 2BYEA 1E8YA 1ZP0B 4BZAA 4IUMB 5AIAA 4NY0A 3A0BU 5IILA 1DOQA 3NVZA 1KFSA 2R8HA 4YTMB 3GIKA 5ALXA 4I27A 4F92B 3V62A 4PHDA 1GG3A 2W8KA 2FLLA 1Z4OA 4KLDA 1GB4A 1T6BX 3OHBA 4RM8A 2YMPA 4UB8U 3OJSA 3NVYA 4BXOB 2VH2A 5C3JB 5AKIA 4Z6FA 5DDYA 5KT4A 2E8MA 4YXDB 7ICSA 4RNNA 2C2DA 2LYBA 2F2AB 3DHIC 1ZQNA 5FK9C 2K8BB 4F8CB 4J9NA 4W9JA 4Q8FA 5ALMA 2J7QB 2ZJ5A 2IYDB 1S0NA 1WXVA 2L0FA 1T3QA 1IBXB 1XXGA 3BJYA 4F4XA 3EPIA 2L3ZA 9ICIA 1V1OA 5EWGA 1FD6A 3L5KA 3IT6B 5AKXA 3QXGA 3E58A 1JWMD 3P42A 2IBIB 4OVZA 3KZXA 2GB1A 4DFPA 3PO0A 2NV3A 2KE7A 3QARA 2GWSA 1BGXT 2BCSA 1YN4A 3I3TB 3QUBA 1C9FA 3F5AA 8ICJA 2JSVX 5H92C 7ICLA 4DK5A 4WWOA 3AU4A 4FN2A 2FUHB 4A3OA 1PQSA 2KC1A 4QZIA 4ZRPA 4NNJB 4C8LA 4CCHA 5AZGA 3AQEA 1C76A 3VAWA 4N9F4 1QH9A 3RUIB 1L8OA 2J6UA 1SL1A 4MF2A 4FO6A 4RNAA 2KD1A 1NBFC 3IAS1 1RG6A 2BYTA 2BVCA 2O2VB 1KLUD 1PGAA 4GIBA 2JF5A 4CO7A 2IBKA 3WALA 2LWPA 2JZBB 2PKEA 4UB6U 2EZZA 4N6EB 8ICCA 4K7SA 2K4IA 4EZKA 3M9NB 4KDIC 1KW4A 3KHRA 3T5LA 1SIFA 3SD7A 2B6GA 4HCNB 4IOIE 4RMAA 4WJPA 3AM9A 1VRAB 2QC8A 5HI1A 3ZTDA 5KHQA 2PI5A 3ZW3A 2A1AA 4QZ8A 2R8GA 3ORYA 7ICKA 1HXYD 1SSNA 2ZVNA 1JMSA 1KSPA 4ECQA 2IZVB 4FBJB 4ELTA 4ED6A 3MHSD 4ASWC 1A77A 2G5HB 5ALPA 5T8IA 1NEKB 4BUGA 4RF1A 3H0LB 2BW2A 3KLSX 3LJ3A 4RQMA 3G6XA 1KQQA 5IOIA 4G3IA 2IY1B 1RYRA 4LVSA 2NBVB 4XX5A 1WJUA 2Z7JA 4Y2UA 5J0QA 8ICTA 1FO4A 2WXFA 1TIFA 4O3MA 5GTHU 3URYA 5AM3A 2WXRA 4AJYB 5J2AA 1SF0A 1L3VA 5EE0A 3OJ3A 4J9QA 2QDFA 3AEBB 3F2BA 1V85A 5E6JA 4B9KA 4Q2JA 1A76A 2DFLA 4C4VA 3T5JA 3HPOA 3C1YA 1LVHA 2KAJA 4DXAB 2R8IA 1K51A 1JWBD 1E90A 1ZQWA 3L3FX 4RH6A 1I35A 2WXPA 2J6SA 3ZDEA 2HBJA 5KT2A 4ECWA 3N9YC 4JWNA 9ICBA 2K4HA 4DQQA 3RFZB 2F76X 2NMQA 3TQ1A 8ICFA 3SV4A 2VKQA 1CJEA 4YP3A 1KJTA 3W5UB 1ZQLA 1I4QA 3N30A 4DSIA 3V05A 4DBGA 3VVWB 1FEHA 3A9KA 5TR5A 2H3QA 3FILA 2HJ1A 1L8LA 1FFUA 4J6IA 1EXNA 4B95A 1SE2A 4RQ0A 2HW3A 2MHJA 4C0ZA 1NZPA 4ED0A 4CF3A 3I76A 1BUIC 2DZKA 4FXCA 4Y2YA 4DDGD 5DB8A 3AULA 1U45A 4IM0A 2WXGA 1FIQA 1WCNA 2N0SB 5AK3A 2W9BA 1D3ZA 4QIWF 4J9PA 2OXOA 4F5RA 4KKJA 1WE7A 3C28A 2XK5B 1HZ5A 2KFNA 4ARIA 3A9KB 1NK0A 2MW5A 4AJWA 3U2SC 1ZQSA 3ONNA 1OEYJ 1IPGA 2FI1A 1X2IA 2QCZA 3G6VA 8ICNA 2RP5A 1WY8A 1FXTB 2W54A 4YFKA 1U4BA 4GMVA 4DXFA 4B9UA 3NZ3A 3NY5A 3VTWA 2N7EA 2RDHA 2GO7A 3BS5B 3O13A 4NQLB 3SAHA 2C22A 2PXIA 3UIPB 1A5RA 2MJ3A 3CWIA 1T5XD 2JRIB 3ZKJC 3C8YA 4RNMA 4FA6A 1BPEA 3TJPA 3GOEA 5IA7A 4IL6U 2V4RA 2J53A 3RBDA 2HJ8A 2KSOB 3OTQA 5J2FA 1E8ZA 2LGIA 2D11A 2MU2A 4UAVA 4O5KA 4RCOA 4B6WA 1WYGA 1WH3A 4QZ9A 2JVCA 1JROA 1ZOLA 2JXXA 2I1KA 3AE5B 2W9CB 5AI0A 2LPEA 1WJ6A 1XNSA 4MGYE 3D2SA 3EC8A 2OWOA 4F2RA 5J17A 1ZQDA 3MR6A 5F3XB 5FP0A 2OH2A 2FCQA 4YD2A 2GBRA 2HTME 3N7PD 3B2FA 4GOCA 8ICOA 2D3CA 1KN5A 1L3TA 4LCDE 5LXIB 2DF4B 2YMLA 4M9HA 4OD0A 3AH7A 4FJZA 4DSKA 3QUCA 4UW9A 1DOIA 2MAXA 1XCTL 4NJCA 5ALJA 2L05A 5AUIA 4F1SA 2RDBC 3KH0A 2WB1F 2AQ2B 2LVPA 1XCQL 3WKDA 4B0EA 3AE7B 4JUZA 4KLFA 1JWAD 4QZGA 4J9OA 2R2OA 7ICIA 8ICWA 1HZ6A 3QCAA 1GUAB 3DVNV 3WK6A 2GRIA 4NXZA 1H8CA 3N1XC 3RFAA 3OSPA 3Q8KA 4WWPA 5KFAA 3SMVA 4EELA 2P66A 1GB1A 1L4ZB 4IRCA 3RN9C 5KFMA 2H88B 2CRXA 2C2RA 1GPXA 1V6EA 1GC7A 2DAJA 3B9JA 3GIMA 1PVPA 1CK1A 4EFOA 1PUTA 4W9LA 4ED2A 4RQ5A 3FC4A 3VH4B 4UAWA 1NZBA 2FBWB 1HJPA 1LKYB 3ALBA 2ES6A 1I4PA 1PDXA 4KLMA 1R4MI 3ZQ4A 1B22A 1EWCA 3IBEA 4QWBA 2FUG1 1N60A 4PJ0U 3IAM1 3GZNB 3TCAA 2KKVA 2VJ4A 3HM6X 3TL5A 4BAXA 3A0HU 4RQ6A 4IR1A 5FR3A 3UIOB 2JX5A 4RQ3A 3VRBB 1R4MB 2IGDA 3QX7A 2ZJ8A 3QA8A 1SBBB 2RGFA 4LJXA 1SXTA 5KG7A 1ZGUB 1LB2B 2PFPA 1UHUA 2NO4A 2YQEA 3TAQA 1ZQRA 2C60A 7ICNA 4XC2A 3NZSA 4EENA 4F5OA 7ICTA 3T3NA 1YN5A 3PNCA 1K53A 3Q8CA 2ZTDA 3UQ2A 3WAMA 3BQ7A 2CN1A 2DKXA 2W7PA 4C7ZA 3BQ0A 1BPYA 2JRZA 1WYWB 3OAWA 4BOSC 1F1HA 4C8KA 5ALQA 2WAQC 3OGUA 2C7HA 1OFFA 1ET9A 5KFHA 1FNUA 3KW5B 2LJIA 1L2NA 4JIOU 1S76D 1ZQFA 1TTNA 1C4CA 1FCCC 4MELA 4ECZA 1P7DA 5AZHA 1SKRA 1FFVA 4JWMA 5J2BA 4J9MA 1JIHA 2IOHA 2D07B 2KDMA 2M8SA 4A6QA 3T8MA 1RQNA 5L9XA 1L5PA 3GDXA 2CJOA 4DL7A 2EELA 1J8CA 2RQ5A 2J52A 4CQNA 3MBYA 3L10B 5BYQA 4NPNA 3PX4A 1AWDA 3H8HA 1ZQKA 1RRBA 3T5KA 4RPXA 3H4DA 4DL2A 5IO9A 2LHTA 2ZG6A 1NK6A 2MP2A 1T8EA 3N20C 2BQRA 3PHXB 4GB9A 1IGDA 5TZVA 4LZGA 2B21A 2GMIC 2NRZA 4P4OA 4O9MA 1TE2A 1WUDA 4LDTD 2HVIA 1WXAA 2PE9A 3OG5A 3VTVA 1V2YA 3ZJVA 3V60A 3EGRA 3HP6A 4RU9A 2XNAC 1C3TA 4K7WA 2CXYA 4ACFA 2G3QB 7ICOA 1N48A 3V6KA 2M0XA 4RT3A 1WMHB 1TKYA 3V3XA 2LUEA 3Q2AC 2H3FA 2XK5A 2IO1B 4WJOA 4MH0E 2IMWP 4YL8A 2OEDA 1Q3VA 3P4PB 2JZPA 4GN1A 2ZVOA 2WF6A 2K8CB 4GU2A 3CMMB 2VIXA 4OJLA 3V72A 2G06A 1WR1A 4KLLA 2N9KA 3PW0A 4P0QA 4DS4A 3LVWA 5J2KA 4HPPA 2WDQB 1B4FA 3N7SC 3CRXA 3K75D 2ZTCA 3DWGC 2V4LA 1X9XA 4KLQA 3TACB 2FE8A 4TMAB 3F2CA 1ZETA 3QE9Y 1ZQPA 1KFYB 3PT2B 3AE8B 4IRKA 3TMPB 4A9AA 3ZJUA 2CU1A 5J2IA 3H7SA 2KXJA 4I2DA 3HW8A 3ONSA 3BZDB 1MSWD 4P1BC 4M47A 1F77A 3ZTCA 9ICWA 3R2TA 5KHOA 3ENEA 1ZD2P 2XBBC 3TAPA 2JH1A 2JHDA 5KFKA 5AKYA 2MBHA 1OQRA 4QWAA 5KFTA 1SXEA 4TQRA 2E3TA 1EU3A 2ZEQA 2QARB 1YJJA 3H8JA 3ZD8A 4R66A 3GE8C 3WAPA 2LGSA 3BQ2A 4KLOA 2KWVB 3NZUA 1G6JA 2PFNA 1QSYA 1BXTA 2RPQA 3HIZA 5LLIA 2DZJA 2WU2B 3PR4A 2ZXHA 1UBQA 4NJ7A 3EHVA 2PJHA 4DSLA 2XVTA 2YMQA 4US9A 2K39A 5C23A 4EBEA 1PUZA 4R8UB 1TBEA 2L83A 4HDOA 4JWSC 4I2JA 1CMXB 3QHTA 5CR0A 4NL9C 1C4AA 4ED3A 5HP4A 1HA5A 4FBTA 9ICHA 1ESFA 2NYVA 2K22A 3Q8FA 1C78A 2BCRA 1KTKA 1WWTA 1ZJNA 2GBKA 2K1FA 3JPRA 3ZDDA 4UB2A 3RBEA 3OLMD 2E1FA 5DG8A 5AHXA 4P6VF 4KLUA 3RNCC 1AYFA 2Y1IA 4NM1A 4AOFA 2NTSA 5ALNA 4G0NB 3ZRFA 5EOZA 2DAFA 4ZH4A 2KVCA 1E8XA 2W11A 3M8RA 2D3GA 2MP2B 3U26A 8ICEA 5DB9A 9ICMA 1VZ6A 3PV1A 4TQ1A 1GNUA 5ALHA 3TEZA 2ONQA 3RF9A 1JMLA 5BYRA 3VHTC 3RJFA 3DV9A 4PYUA 2XIDA 4XZ4A 2HCFA 5AKHA 1Q3UA 4F4WA 3P4QB 2BS2B 2QLTA 5J2JA 3MHZA 1EF5A 2JZBA 2VJ5A 3FYHA 3QZ7A 1B1ZA 1TS2A 4I2AA 2LXAA 1ZQYA 4EEKA 3TFRA 3EPGA 3DCGA 3PZ8A 3HKZF 4C8MA 1WJ4A 5AK4A 1URJA 1CZPA 2IPKD 3WKEA 1SKWA 4ZYNA 4ACOA 1O08A 3GILA 2LXCA 4C80A 2OJWA 3BS7A 3OPXA 2RDJA 1QT9A 4HPMB 1SE3A 4KIKA 4QAYA 4C00A 1Z2MA 2BGWA 4JMUA 3RB6A 3GV7B 2IY0B 2YB4A 1SV4A 7ICVA 1GAQB 4JE3B 1X1MA 1OTRB 5ALYA 1VD2A 2IHNA 2WX0A 4MJSB 5FKAC 2KQSA 3R7RA 2EZYA 1I42A 1UH6A 1XO0A 4IC7B 5J18A 5DPWA 3JPPA 9ICUA 1Z1BA 3IP4B 5DB7A 4KDLB 4TUPA 2R8JA 1HE8A 2XC9A 2I1QA 3DBHB 2ASJA 4DFJA 3AE2B 2G45B 4NV0A 3M7DA 1MI0A 3TFSA 4K4HA 4K3BA 4OJOA 4M9NA 3QUQA 4M9GA 2UWQA 2V3NA 3RH5A 1LM8B 4XE0A 1IXRA 1Q5WB 7ICRA 4NLNA 1QOGA 1Z1VA 1UGMA 2O6KA 2BB6A 1ZQXA 4YT0B 5DQGA 4P0PB 4P0PA 4F4KA 1T0SC 4WWNA 1V5OA 4C4VB 1TKEA 1UWXA 4G11A 1EM7A 4L23A 3F53A 4HJKA 1IV8A 2D3DA 1D5ZC 3KUCB 4RQ4A 1T0RC 4B9NA 2N9XA 5AZFA 2AGQA 4DF4A 4YQWA 2WDVB 3KYCD 3IV6A 2PI4A 5DBCA 5CHGA 4JK1A 4NJ6A 1GOZA 1KLGD 5KFFA 4KGRA 4KKIA 3WKBA 3APFA 3CW2C 4M2YA 5AKGA 2IO3B 3LK9A 3QU4A 2BS3B 2G9HD 2RLTA 3KYDD 1TVAA 1XS9D 1V49A 4S0RA 2CJNA 2G5IB 2VANA 2FLNA 8ICVA 4ZDVA 5EE3A 5J2DA 4NAWA 2ISOA 5L1LA 1KBUA 4B6JA 5KFWA 3GE3C 3KQ4A 3KD3A 3UXPA 3HK0A 2C7NB 2INDC 2PEAA 1V81A 1ENFA 2CHWA 1EUVB 5G2NA 2XO7A 2KNBA 5C0YA 5KG5A 1TY2A 5GMVA 5AI4A 2M0NA 5ALIA 1E6EB 2B3AA 2V3PA 3RCZA 4MHVA 2KTRA 2HE7A 4QZFA 2GBNA 3TKAA 4RT2A 4UB1A 2G07A 1OUQA 3K1ZA 5B5EU 2BCQA 3RRGA 4Z6DA 2BWES 7ICFA 1COKA 3N1YC 1NI3A 4JQWC 4ANXA 1L7MA 4O0IA 1C7YA 2DLBA 2DZMA 3Q3OC 4IDIA 2OEHA 5J0TA 3A33B 4M00A 4L2YA 2YN4A 1LQBA 4PGYA 4YMOA 5CEHA 1F9JA 4NLKA 1TZ1A 3NS1A 3PRZA 5L1MA 2KFKA 3Q8QB 1UD7A 2VZKD 4O3SA 3GB1A 2FMQA 5EWEA 1QLBB 2HOIA 2RDIA 2M9NA 3GS2A 4KX5A 1KKXA 4K7UA 1ZQUA 5CTRC 3SFEB 3W1SC 3M9MB 2JUOA 1SIJA 1L3SA 2OJRA 4I2FA 4C4TA 9ICLA 5ALWA 2EANA 1JRUA 1WRIA 2DHZA 2ZJDA 1EO6A 2FPKA 1U9LA 4MFAA 4PS8A 3BY4B 3IHPC 4BWJA 3H8MA 8ICKA 3GP7A 2PE6B 2RSUA 3J81j 4RQ7A 1T0QC 4DLGA 4FS1A 3Q8PB 1I4XA 1ZQOA 4ELVA 3H9DA 4NJ8A 1L0VB 2K6QA 2N9EB 3X0WA 3U52E 1ZQTA 1I4GA 3ZDCA 2JEGA 2W3SA 3SEIA 1Y8RC 7ICMA 4UAUA 5DG7A 1ZD5A 4XUSA 5DBBA 3RH6A 3C29A 1DGJA 1NJWA 2B0CA 3QQ8B 2GBJA 4EOYA 3DOWA 1XO1A 3KTQA 3HJEA 5JHAA 4BVUC 3UXOA 3RI7C 4IS7A 4HWIB 4WIPA 3PY8A 5KFUA 4EZ6A 1PGXA 4HKQA 1L0XB 2KN4A 3SU8X 3L0WB 3ISDA 2HHWA 5J0UA 3VR9B 3FDSA 4PS7A 1WX9A 1Q10A 3S2AA 2LMRA 1P0RA 1UZXB 4WQMA 5D2MB 4WAAA 4RUCA 3C19A 2WB1C 4MT5A 4UATA 3UMGA 3TEYA 1I4HA 5D3IB 4FBUA 3EECA 7ICPA 3QU5A 4JL9A 8ICMA 3P2BA 4QNLA 3C1ZA 4GXJA 2KC2A 3DVNU 1E10A 4CYEA 4F71A 2WU5B 4O3QA 4B9VA 4YCXA 2FPMA 1J19A 1XLQA 3P4SB 4J9KA 4XWTA 2JEFA 4KZCA 1NYQA 1AQ6A 2BPFA 9ICPA 2BBCA 1WIAA 2K8HA 3A1QA 3BINA 1MQ2A 1ZQHA 9ICKA 2ZPYA 3IFWB 2EMSA 5KG4A 9ICCA 3BYYB 5AI9A 2UU7A 3PW7A 3VUXA 2WS3B 1KTQA 3MC9A 1SL2A 4Y2JA 1T4GA 4I29A 2N1RA 5ALEA 4EBCA 1UBIA 4DXGA 4R8UA 1ISNA 3CF6E 1BT0A 1FXIA 2PVGC 2KYWA 4DLEA 1XSPA 2EAPA 4QZDA 2KTFA 4DL6A 5DQIA 3X23A 1O03A 2K89A 1WFYA 4IM3A 2NRWA 2KIVA 2K5PA 2ZNVB 2PFQA 2HMXA 1NI2A 4NM2A 4PHEA 1MJDA 5KT6A 5ALFA 3QU7A 2KVZA 4BGDA 1OQQA 2W3RA 3KWVA 3Q8AA 4ZRJA 4YR3A 1D4BA 2CPRA 2J0KA 1MC8A 2BDUA 3AQFA 5IIOA 1WM2A 1XQQA 4OJPA 1WCLA 4NLCA 2DNFA 4IG7B 1NK5A 4GXKA 2LJ5A 3QUTA 2EAOA 4IQWA 4PS3A 3OJ4B 2DUYA 3DBSA 4FJVB 4GFJA 1C4PA 5HHHA 2KWUB 1JALA 2MWSB 4ED1A 3NASA 3A9JB 4XQ8A 1E7VA 3CIRB 4JGHB 5JRTA 1L7NA 4DL5A 4ELUA 3LB8C 4DCCA 3AL0B 4IWOA 1JXEA 1WM3A 2A5UA 4O1NA 1BNPA 2C5LC 3TBLD 1KL9A 2G4DB 3NVWA 4QW9A 4A55A 3WK8A 9ICAA 1XO3A 1YX5B 5DCNA 1V5TA 3H7IA 1T3NA 2Y5CA 2OHFA 5J0RA 4KLTA 4EBDA 2XI9A 1AN8A 2MUTA 3AE1B 1YD8U 5KFXA 4G50A 4I2EA 4K1RB 3AUOA 1RYUA 9ICXA 1H38A 3BVMA 4Q8EA 2KX0A 1TAUA 3O65B 3S6JA 1QKZA 4ANWA 1D9DA 1VZ7A 4WH4A 5DPRA 2DGZA 1P3QU 2IHMA 1K52A 2ACZB 2WDRB 4CDGA 3UM9A 2BKRB 1WGDA 4A8EA 1FRRA 3TSSA 4DQSA 3VCBA 2BPCA 2K0PA 4LNFA 4PZNA 1IBXA 5A0LA 2PLPA 2WYQA 5IP4D 1WSPA 3PMNA 3M95A 1SV0C 2BCVA 5C1ZA 3VUWA 1K5OA 2BB5A 1FM0D 4PPXA 4P4MA 3PVXA 2K8AA 2Y0SF 3SZ2A 2HI0A 3HRDD 5CRXA 4IQTA 5F9LA 3MC0B 3MFGA 1HTQA 5BOMA 2AQ1B 2RRDA 5AM2A 1Z4NA 4K4IA 2QILA 2HBLA 5E6OA 2PMZC 4HXDA 4F3OA 2SEBD 4ECYA 2K6DB 1T7PA 2KJHB 5KAFU 3G6YA 1SXDA 1NK7A 4MGKE 5GTIU 3AN1A 4KSLC 1XF5L 3PW5A 3ISCA 3W1YA 5IIKA 1SEBD 4I2CA 4EX7A 2I1JA 2A19A 2E8PA 1SB3C 3DQVA 1DGSA 1M4VA 3DVGX 4J9LA 3PSEB 2XN9C 1ZJMA 2ZUDA 5ALGA 5HKHA 4GXIA 4I2HA 2WNMA 2K25A 4O3RA 2KLCA 4LTUA 4Z6CA 3OHAA 4LZDA 2ZIXB 2ZTEA 1RXWA 4JV0A 2L00B 3EYZA 2FJ6A 1WGGA 1N61A 2FLPA 4M04A 3PO4A 2ESEA 3V6JA 4ANVA 3BZCA 5H2FU 2KJ8A 1NDDA 3QU9A 2NRTA 1Z00B 4HK2A 4CGZA 4USAA 8ICQA 5AK5A 3VTUA 3RJIA 3KBBA 1N2XA 2INCC 3L08A 2KHVA 1PGBA 2CR5A 2JY6A 9ICVA 5DPTA 5AKJA 2MA9B 1IIPA 1ZQCA 2KTRB 2O6VD 3DBHI 2WXJA 3SV3A 4GLXA 3PR5B 1WI0A 2PW9A 3B08A 3NG0A 4FHKA 2WF8A 2G08A 2ISPA 8ICIA 2D3BA 2MSED 3MDAA 3MC8A 3ZLZA 1U48A 2EKIA 4HVBA 2NRXA 3NUHB 2XY6A 3IG8A 1PK1B 1DXSA 2DYMA 2YTUA 4C8OA 5JH5C 3W1SA 5GXGB 3MC1A 4ZRIA 4XDCA 1TAQA 4P4PA 2WWZA 3N7RC 3DBRB 4LNKA 2KT7A 4RPYA 1S0MA 1QSSA 3BK1A 3PRPB 4C56C 2A1JB 1CRXA 1ZPSA 2KP7A 3UMCA 3NGDA 5CWRA 3WK9A 5KFIA 1S1QB 2VA8A 1STEA 3F5EA 3OSNA 4RFBA 2Z59B 3THVA 1UUPA 4YSXB 5IKCM 1RLFA 3JSVA 2MCNB 4UASA 3QK0A 1RPLA 1HUZA 2ZIUB 1L7YA 4KLGA 1ZQ1C 2F1JA 4BJQA 3RB0A 2XY5A 3GFKB 4N58A 4YN4A 3K4GA 2JMGA 4IQVA 5CJ7A 3ZI4A 1TV9A 1L6UA 1QOAA 3ISBA 5KFVA 1T0YA 4UBBA 3U7DA 4BKGA 3EA6A 3WAOA 3E56A 4RQNA 4HJGE 1E0ZA 1ZYQA 1JXLA 1V38A 5TSSA 3Q8BA 4RQ8A 4M9JA 2MLBA 3HHMA 3IHQB 2XGQA 2HHUA 3VDZA 1EU4A 2H3VA 3DWMA 1ZKHA 5E79U 5B66U 3T3FA 1WG8A 4YD1A 5CB1A 2CHXA 3R3MA 1LGRA 2K3UA 3NVVA 2VH1A 2ASLA 1AARA 4L1BA 2N7DA 1TK5A 4JX1C 4OO1J 1VLBA 2KJ6A 3GV8B 1RFAA 2HHTA 3DDCB 5CHWA 7ICQA 4YWGG 8ICZA 2BYVE 3IDWA 3W5VB 5I4DA 2HDEA 2HOFA 4FZNA 3U7ZA 1WGRA 4HLEA 4TQSA 3V7KA 2MSNA 2KICA 1NYRA 1TT5B 2V4IB 2KMMA 4E0DA 1SZPA 3AEEB 3T9LA 1JQ4A 4GIVA 3UINB 5E6PA 4K3CA 4KMOB 1ACCA 3E2EA 3P4RB 2CS4A 5AKKA 3TEXA 4U7CA 9ICFA 2FE9A 2DBYA 2KJ5A 5EWFA 3QEBZ 3KHGA 1FEZA 3ZNID 5J2GA 4CF5A 1PVRA 3WKAA 2LHEA 5DPSA 2AYOB 1NK4A 4II3B 2NCNA 1MPEA 1MFWA 3GZNI 1QCKA 1UA1A 2PTLA 3RD2A 4Q45A 3KHLA 4JPSA 4XYCA 2WXKA 1XU4A 2JWUA 3D32A 1SJED 3AEAB 2WXLA 4R3DA 4ED7A 4BDPA 2A3VA 3ZVVA 3CNHA 4N59A 2ZJAA 1S3SG 1D6EC 3BIID 3BZKA 5ALKA 3PTFC 4GDLB 3KVFB 1ZQIA 3FM9A 4AYBC 5D7GA 2I6XA 2MRPA 2G0AA 2VRRB 3AV8A 1EF1A 2DQNB 2LI6A 2C28A 1ZRNA 3QU2A 1WWUA 5AM1A 2BT6A 3V61A 4NWIA 4ECRA 3F2DA 1COOA 2AGOA 2WP9B 2KZMA 9ICOA 4LJPB 2JPHA 3APCA 3BWUD 4TV3A 9ICJA 1QILA 1TS3A 3AI5A 1UCVA 3MFHA 2AEHA 1UT5A 4HKZE 5KG6A 2QMTA 1YMHE 5KFZA 3H8WA 3PSIA 5HR6A 4RPZA 4NLZA 2RPVA 2QARA 3TADA 3Q3FA 1DOYA 4E74A 4GC7A 3FILB 4I6LB 5ALTA 1YIWA 2JEJA 3R9KA 4ECVA 2FNJB 3TI0A 3I1YA 1B9RA 2W9NA 3DDHA 9ICRA 4P2HA 4UBCA 2WLBA 1UF0A 2LHDA 1X9WA 4II2B 1WJNA 2MRLA 3OWEB 5C5JA 2KOXA 9ICNA 7ICJA 1TYGB 3LVVA 4O3PA 1KLNA 4NY8A 4LDTB 1ZD3A 3NTUA 1XD3B 3C21A 1I7HA 1XLPA 4MDKE 3RH4A 3I28A 4GDKB 3WK4A 1XLOA 2KFKB 1S10A 2WXIA 3Q3JA 2LGDA 4W9GA 2FIDA 4NLBA 4QZAA 1FXAA 2O6VA 4MM3B 3A1QB 1BPXA 5AM4A 2JYEA 4ITKA 3VQIA 1H4RA 3LDZE 4UB3A 2OCEA 4TUQA 2BPGA 1DYQA 4C8NA 3GIIA 4AWJA 1RYSA 4QIWC 4QW8A 5J0OA 3H4BA 1SGHA 3ZUNA 4IQUA 4DOCA 4FZMA 3MR2A 3K9OB 2AU0A 1K50A 1E8WA 5HR7A 5EDSA 4DL4A 3IRUA 4QJFB 2FPLA 1Z5SB 2HTHA 5BYSA 1UGJA 1TJEA 4RGOS 2VA2A 3RJEA 4EYHB 2LD9A 3N97B 4DS5A 5J8YC 4YR0A 2AX5A 3QJZA 4PYZA 2W04A 4W9EA 3KHHA 5KFNA 4RZRA 5J8YA 2Y3AA 1HIWA 5L95C 1QOFA 2KTQA 3AE3B 5J2EA 4PL2A 5T14A 1RYJA 4Q43A 4FHJA 4XRHA 3BQ1A 3PW2A 1BMLC 4W9IA 3KUZA 4KGSA 3L4PA 8ICGA 1TFRA 4LJOB 1QF6A 3RR7A 9ICSA 4WWMA 3RMKC 5IIJA 1NKCA 1NOMA 3VC8A 1YX6B 1D8LA 2F1HA 1SV0A 3H6NA 1L6NA 3TARA 4Q44A 1MG8A 5AI5A 3TANA 2DYBA 4B9SA 4NAMA 2QSDA 3RJGA 3CYMA 2NPTA 1A6SA 1JRPA 1X66A 8ICPA 3MTNB 1L6VA 5BO4B 4Y2PA 4F50A 3ECIA 2YLMA 2Q5WD 3KZIU 4M0AA 3O0FA 3H7PB 1V9PA 2NBWB 8ICUA 4M0WA 4Y2VA 4YSZB 3M9OB 3EUB2 1SE9A 1QZEA 5K4LA 4ECUA 4H2AA 4PGXA 7ICHA 3H8SA 4M02A 5L1KA 5C2TB 4QWDA 3BVGA 5JZEB 2KVRA 1Q1OA 1DOXA 1AW7A 3AE4B 3BVZA 2WTFA 2HHSA 4B9LA 2ZUCA 4GDLA 1Y88A 2LUMA 2CHZA 3AU2A 3PZ7A 4KN4A 1GJZA 1FRDA 4WQOB 2Q4TA 2QB1A 3HKZC 4ZHOA 3JPOA 4KLIA 4P7IA 5JHBA 4I6PA 1D9FA 3UF8A 3ZNZB 5D3DA 4RQ2A 1N62A 4MEYA 3PSTA 3LDAA 3H7PA 2BS4B 4M0WB 5F9NA 1ZUD2 2LASA 4HROA 4B0MA 1N6ZA 4MJSA 2MJDA 4OZAA 4DSJA 3UQ0A 2BF8B 2JWZA 4MEMA 5H8YE 2C7MB 1SGGA 2Z0EB 3ABVB 1K8RB 4OZBA 1D8YA 4BKSD 3EFUA 7ICUA 4BKSA 2L7RA 5CX3A 1A70A 4F2SA 1S0VA 5ALLA 4DHJD 2KHWB 2ZNVC 4DOAA 4J3OD 3RT3B 2LBOA 2M17A 2K4PA 1C79A 4PHAA 3IG3A 5KFSA 3RNFC 3EZ5A 3UQAA 2KSOA 4R63A 2CU3A 2J0MA 4QWCA 2YMMA 5BMIA 2R2QA 2PKOA 2RMMA 1XLNA 2Y0SC 3C5FA 4IR9A 1SWVA 1NVID 3ZRCA 4F4YA 1RDFA 3HUIA 2WXNA 4KMUA 3KKAA 1B0XA 2UVRA 1Q0WB 4B9MA 2PPHA 3JPQA 1QQ7A 2JH7A 4TQ0A 4BBNF 2LVQA 5AKEA 2V3SA 3MGVA 1LV5A 2NVUI 1UNSA 3H40A 2KFJA 1ED1A 4X57B 4D2KA 2N1WA 3RYTA 4EKUA 4G3XB 1QTMA 4OVUA 2ODGA 3SR6A 4ECSA 3QYPA 2KZ3A 3D6JA 4AP4C 4DOBA 2EDUA 2LRUA 3UMBA 3PSPA 1LKYA 2FMSA 2INPE 2MBEA 2N9PC 2ZZPB 4IM2A 4EZJA 4YMNA 2ZPNA 5J2RA 4P0QB 1C1YB 2W9AA 1SZHA 1UA0A 1P7EA 1ZD4A 1ZQMA 3AEDB 3ZNHB 2DYOA 3WK7A 4EE2A 2BGFA 2QHOA 2L5YA 2MBQA 3SI8A 4MGZE 5KFRA 4O5CA 4WJNA 5HMLA 2RHFA 5HG2A 3KWLA 4ED8A 3WKCA 1CQVA 1KLVA 2MX2A 3N4MB 1Z00A 2P6RA 3ZDTA 4DFKA 3GZFA 2K60A 3SYZA 5D49A 3BK2A 4BWMA 4MSQB 1SKSA 1K1QA 5KNIA 4PH5A 1BPZA 2WXHA 3PPAA 4S17A 1M6YA 2KQ7A 3HT3A 1NKEA 2YY6A 5L1IA 3AEFB 4US8A 3PV8A 1KRHA 5KAIU 3KFUF 2JZ3B 4BXOA 4TUUA 1TGZB 5KFGA 1NKBA 3KOOA 2D6FC 4IC9A 4KLJA 2KJRA 2TSSA 3P1MA 3P63A 4MH8A 2PVOD 3I5JC 3Q8LA 3MR3A 4MFFA 4PGQA 1PZNA 2LGXA 3W9CB 3ZJTA 4HAIA 2I2YA 4NL9A 2J42A 2QB0A 1VR9A 2K8CA 3SEBA 3OJUA 3U30A 1ZE3D 2EQYA 1F5SA 2QKQA 1E7PB 1YJ1A 4FADA 1DK2A 3ZXRA 3Q14C 4AP9A 3L17A 4KZ0A 2EMTA 2LYHA 2H89B 3ETLA 4Y2RA 2E6XA 3AE9B 2M1MA 3D2QA 4DFMA 2F8KA 2YVCA 5KFOA 7ICGA 2LZ6A 5DGAA 2KDIA 4W9FA 2XCAA 3RULA 3HWTA 2LM1A 4R64A 2KG5A 5DB6A 5IIMA 2HHXA 2KX3A 3R7QA 2QJLA 2G09A 1S8OA 5LNK1 4HYKA 1F0MA 2ZIXA 3U4EG 4NZLB 1UWMA 1JN3A 4ICUA 2ZUBA 4YVZA 5CHVC 2W7OA 2IGHA 3E0FA 1ZQVA 3NRZA 5ALVA 1TY0A 2ALZA 1NJYA 3SENA 8ICBA 1LXDA 3ZDAA 1C77A 4RGTA 3LXFA 2KFZA 5BOLA 1JW9D 4A3PA 3T5HA 2NBUA 5JTIA 3ZDMC 2GH1A 3V7LA 1TKDA 1ZQZA 2O6VB 3HILA 5KFLA 4MM3A 2QB0B 2D3AA 2R18A 4WURA 4WAFA 3VH3B 2QEJC 3K9PB 4TKNA 4O3NA 4ZOHC 2WHIA 3SHQA 2NR2A 4XDDA 5E6NA 1E9MA 4F4ZA 2D8CA 4F72A 4QZBA 4ICVA 5BMHA 2L32A 4J9RA 3SFDB 4O3OA 1UQVA 2WDTB 3PX0A 3NJTA 2KANA 4RGNA 1ZXHA 1XC9A 2JEIA 4MACA 2KOBA 1KDHA 3GV5B 3AXCA 1OXJA 1PK1A 4DSEA 1PYWD 4GSWA 3RZWC 4W9KA 1TKGA 3RPFC 1YQ4B 3AEVA 3H0RB 3APDA 3M6KA 1QSLA 2XICA 5EE9A 4CRXA 5AIBA 5KFPA 3RTVA 2L52A 1ZQQA 1J7BA 2D5GA 4DDID 2G4SA 3M3JA 2V9WA 2KLGA 1C20A 3QEAZ 4FJYA 3RZFA 2IO0B 4A90A 1ZQAA 1KH0A 1WXMA 2A1JA 1KOTA 3MGIA 5D94A 4JV2A 1CEZA 2HBKA 4AYBF 1GC6A 4FLHA 8ICXA 2H5XA 3TUOA 5AUKA 8ICRA 4C4SA 3PO5A 2KQ4X 3ZDBA 2E8OA 2JXTA 1L7OA 3PW4A 1NJXA 1BNOA 1Z19A 1D8BA 1IGCA 3M62B 1KEJA 2F3NA 4M8MA 2LI5A 2LVOA 1P9DU 1NK8A 2WXMA 4I28A 2D10A 3QAQA 1CUKA 4KX6B 1XSLA 3TIXA 3ALRA 4LNNA 3ZXVA 1ZRMA 2QIEB 2BWFA 1RWSA 4J03A 2AHOB 1JX4A 4IRDA 1ZDVA 3RNAC 3PLVA 2IOFK 4QZEA 2KV2A 4DQOC 2I5HA 1JUDA 2AJQA 1F52A 2JQRB 1HEKA 5IIIA 1DK3A 3GIJA 4DF8A 8ICSA 4YR2A 4DQRA 2WX1A 5J0YA 3HM3A 3M63B 2ZIVA 4EZLA 4I2IA 2G1EA 3AE6B 2H3IA 2FDRA 3WA0A 1TS4A 4OW0A 3A4SC 1P98A 4QWEA 2FCSA 3Q69A 2KWDA 2W9BB 1S97A 3RJKA 4M9LA 2DPIA 4FULA 4DHJB 2LMCA 3RNEC 1S0OA 4Y2SA 3JSVB 2GI9A 2KD0A 3VUYA 3MABA 1D5XC 2A4ZA 3MJ5A 1NENB 3R66C 1WF9A 3VRAB 5KFDA 5J2CA 4OZCA 2Y9TA 2GLSA 3N3KB 3DEEA 2BR0A 1L4DB 3PVLA 4GGQA 4DL3A 5D6JB 2M56B 3BS5A 2DZIA 4HCPB 2KDFB 1L0YB 3QC8B 5D4BA 2KK8A 1KRPA 3B2GA 3RRHA 5KG1A 3LYSA 2V4QA 1WXQA 2GLEA 1RXVA 3PGEA 2PMZF 4FE3A 3RNGC 2O2VA 4F91B 1MVKA 1BPDA 3RB4A 3DVGY 2HHVA 2L8JA 1MN8A 3HX0A 2F1IA 2DPJA 2HSZA 1MA7A 1P1AA 4XGAB 1V1PB 5AM0A 1RFKA 4RUAA 1LO5D 3I9V1 4AQ7A 4K81A 2ZIVB 3NRWA 2JRHA 5HFYA 4RQ1A 1NNLA 2M4NA 2WF9A 2J4XA 2JR5A 4IWPA 1MG4A 3V6CB 3ZIMA 2NRVA 1P7FA 5ALSA 2W43A 1FPYA 4R65A 2GOWA 4M6WB 4Z6EA 2WHEA 5ALDA 4DFDA 2JV3A 1FCLA 5KT5A 4TURA 4Y2TA 1YQ3B 1D5MC 1OGWA 1B43A 5LXHA 4YTPB 2JU6X 2HVHA 4I2GA 4CF4A 1WWVA 5DKWA 1YOVB 4PL1A 2K4EA 4QZHA 2MH7A 1RQLA 1N56A 2N7JA 3PLUA 4FZLA 4BOZB 4F5QA 4DQPA 1KM7A 3CP8A 5ALOA 2E8NA 1KF6B 2BKFA 5KFQA 1WX7A 3MDCA 3C0RB 1X9SA 2WXQA 4EZ9A 1WXSA 3ETRA 2B76B 2L76A 2FIFA 1K1SA 4KLSA 4EUTA 1YQBA 5KL1B 2L0TA 2ZIUA 3L16A 4CHKA 2AH5A 4RGMA 4FFDA 4WJ3B 5KFBA 5L83A 4I6NB 4RNOA 9ICQA 1LFDA 4Y2QA 3JPTA 5J0SA 3Q8RB 4CE6A 1QQ6A 1WRDB 5KFEA 3JYUA 1BPBA 3R8BA 5ALUA 1OQYA 3GU3A 3BDPA 2SAKA 5IN7A 3LWLA 2HDOA 3GQCA 1JWSD 4QZCA 5J0XA 4OHJA 2E5SA 2WGSA 2BYFA 2KIWA 3QNMA 1ECWA 1HQRD 2XCPA 2BTEA 4IKGA 1S77D 3ZO5B 3C2LA 3VFKA 1MQ3A 4A20A 5KT3A 3PRMB 2EAMA 3RAXA 3AEGB 3DPDA 2W9CA 1PVQA 4BFRA 1QQ5A 1XWLA 2YX8A 5AICA 1FNWA 1WR6E 4XA5A 2FMPA 2E1EA 1ZQBA 3VR8B 2BCUA 3PHWB 5ALZA 1J97A 1X6IA 2IO2B 2PMVA 3MP9A 4PZOA 3LYYA 4IWQA 1V8CA 1KFDA 3JW0X 1E5WA 1IYFA 4BX9C 3ED5A 1DRGA 4O5EA 1J7CA 3CSTA 4UDUC 3A4RA 4ARCA 2YEPF 4YG2A 1UELA 1UPHA 3SDLC 4KIKB 3AB5A 5AKLA 2I38A 1Q8KA 1WZ0A 5L1JA 3AECB 2KJ9A 3IG5A 3B0AA 1X6JA 5DQHA 1NJZA 3B1LX 3A9JA 2D2QA 3QIJA 1N63A 3PZPA 8ICAA 2KKCA 1TS5A 2Z8LA 2KVSA 1Y56A 3C2MA 3Q8EA 4OJ5A 1X9MA 2V1YA 3IXSA 1SL0A 2JT4B 1YZ7A 3WK5A 3ML9A 2W03A 2AQ4A 1ZDXA 2IJ0A 5BPCA 4KV2A 5BMGA 2WFAA 1RM6C 3MFIA 4AUQC 4DO9A 1PFDA 2KZRA 3SAGA 1UT8A 2W8LA 1TAMA 4ZRQA 5EE1A 5AI8A 3ZGZA 4PHPA 2FCMA 2J0JA 3QZ8A 5CP2A 2K8BA 2RDGA 2YEPB 5KT7A 3UQBA 2LYAA 9ICGA 3IVFA 3VXWA 3J9CA 5AK6A 1JWUD 5G55A 5AI6A 7ICEA 5HNKA 3AU6A 1R7SA 3NOBA 1TK8A 4W9CA 4F7ZA 3M1YA 1QLNA 3UXNA 4REZA 4AS1A 4HRSA 4ZRKA 2ZIWA 2ZIWB 3U8ZA 4Y2XA 4MEXA 2N9LA 3NUQA 4JWUC 3B0XA 4G9BA 1U4AA 1YNTE 2W55A 1ZQJA 4F5NA 3PX6A 5AKZA 4NLGA 4KX3A 2JZZA 1T94A 2M19A 2R61A 4EYIB 4EEYA 2KDEB 2LEKA 3R2IA 4NAWB 2HBMA 2KHQA 1V80A 2ZW1A 4PT5A 3UI3A 1VDVA 2YB1A 3IM1A 1PK3A 2UVVA 3Q8MA 2PFOA 4KGTA 2KNJA 2OYYA 1YJIA 3LWMA 2BPSA 3N32A 1QQRA 2JGAA 2XEWA 3M8SA 3EFCA 2F44A 2RD0A 5FR6A 3D2NA 1V86A 2BHNA 4K4GA 4M6WA 4KVGB 2GBMA 3I63C 5D46A 4YXJA 3WIMA 4LLGM 2BKEA 2Y9UA 3M6ZA 1XEEA 3DBLB 3KUDB 3B0YA 2AWTA 3RB3A 1L7PA 2AXTU 3RJHA 4ECTA 2BDPA 1J0GA 4EEWA 2OOBB 2UVUA 1WGHA 1Z3EB 3BQTA 3IN5A 1CI4A 1MHXA 4UARA 2KO3A 3MR5A 1V9JA 2KN5A 3KKAC 2MEKA 4W9HA 3AU5A 2MA1A 3EW9A 2ZCBA 3IT4B 4E71A 4X5VA 2N4FA 5J2HA 2V9HA 4LNOA 4TUSA 4OCZA 1ZXIA 1SJHD 4P1CC 3ZD9A 4DHZE 4UB5A 3NS8A 5MPOA 1YZ6A 1A0PA 4OJ6A 2ZW0A 3HVDA 3L13A 3EWAA 3RAQA 2MQJA 1Q46A 4YTNB 3FAHA 3H1UA 2C9WB 1RAXA 1WMHA 1MHHE 4LK0M 3CSFA 2DKZA 2BQQA 2CKHB 2XY7A 2KK0A 2FCNA 2HD5B 2FAZA 1F0ZA 2P35A 3SD5A 4JB3A 1RZTA 1KFTA 1J7AA 3AMZA 2X8XX 3I57A 4GXBA 2V0GA 2F77X 2ATLA 2LFIA 2ICIA 4FS2A 3JPNA 3V6HA 1F2RC 3ZYYX 4ANUA 3V7JA 1AROP 2UVWA 5DDMA 4I2BA 1V97A 4U6PA 5KG0A 4KN7A 3H0MB 1X42A 1V1PA 3MGHA 3TADC 3SAFA 2VA3A 2LM4A 2HOQA 5KG3A 5DLFA 4DQIA 5KTQA 5DGBA 1VZ8A 4PK1A 2AL6A 1U49A 4DWFA 2KDBA 4HEA1 4C7YA 2C2EA 1OW5A 1ZQGA 1QOBA 2KKPA 3T3OA 1ROEA 5DBAA 4DWIA 4ZHPA 2RR9A 4JLCA 2AGPA 3TEWA 3DBRI 3DBLI 1YT3A 4DSFA 5IAAC 4GC6A 4ZYSA 3N28A 2J6TA 4XWWA 2EH9A 2KMAA 2WF7A 4GDKA 4UQGA 5JXVA 5JU5A 2PIAA 1NK9A 4J9SA 4BBNC 2BQUA 5AEKB 3PSFA 1BVSA 2DENB 5DLGA 2WXOA 1HUOA 2REXA 1WX8A 3SQIA 1HEZE 3ICXA 1IG6A 2Y5PA 4F8RA 2XGPA 5AM5A 4KLHA 2H3ZA 2WAQF 2ZXIA 4ECXA 5J29A 2INNE 4RF0A 8ICYA 2Z0DB 4JV1A 1L3UA 1E7UA 4EX6A 2N1VA 2OM6A 3L54A 5KFYA 4C4RA 4UB4A 9ICEA 2L1AA 3DHHC 2MBOA 5KFCA 2AQ0A 1TZOA 3WCQA 3QWZB 3Q8SB 3Q3MC 2WF5A 4IW0A 2NPTB 2JXJA 2Y5BB 3MJWA 2GOLA 2I9GA 5HHIA 5JUMA 3RJJA 5HHDG 5KL8B 1XSNA 2R8KA 4YMMA 2IGGA 2AL3A 4F93B 1ZOYB 2MBBB 4HDQA 4DEZA 4LNIA 2DL0A 5G5GA 3RR8A 2EZXA 1ET6A 2WQYB 3C5GA 2IA6A 3NHEB 4URKA 4MGIE 5ALRA 1WZ3A 1GO3F 2IDYA 1FMAD 1YN3A 4MFCA 1XT9B 1SWWA 2ASDA 5KG2A 2W9MA 3E9SA 4P16A 1ZW7A 3C23A 2BZFA 2KMCA 4BKTA 9ICTA 4WJQA 3PMLA 5J0WA 4GLSC 1U47A 1X40A 3UPQA 2AQ3B 2KWCA 3JVZX 1VJKA 5G5HA 1TK0A 1EWYC 2X38A 1N5WA 2MJEA 5HMMA 1N5XA 2Y1JA 1R4NI 2UYZB 2ZCCA 3RNBC 4UAYA 2LKYA 3Q3NC 1J2MA 5J0PA 2MUTB 2ASQA 4OVVA 3HVZA 4RM9A 2BQ3A 1F2RI 1S9FA 2NO5A 1VJ5A 3PS6A 5IINA 2W82A 2KEYA 1IP9A 2ON8A 5CHFA 3JPSA 4CNQA 1FNVA 3BYTB 3N1ZC 1M94A 1F44A 1OEYA 1ZQEA 2JYTA 4NQKE 3W2DA 3QX1A 1R4NB 4KITB 2K9XA 3V6EB 3WU2U 4TSSA 1IM4A 3PZDA 4M01A 4B9TA 5CA7A 3ML8A 2LRWA 4YSYB 2KACA 4HPLB 4KSKC 4YXMA 1S5LU 2DWQA 1JI7A 3PREA 4KTQA 2HHQA 2DX5B 5KFJA 2KMDA 3Q6BA 2VZKB 3FKYA 4A8XC 3C2KA 1I4RA 1WGYA
chains in the Genus database with same CATH topology
1JCKB 4KX6B 1VZ6A 4L1BA 4TQ1A 4JX1C 1VLBA 3TEZA 1WGKA 2ONQA 1JMLA 5BYRA 2NTTA 2QIEB 1RWSA 1ZDVA 1IUEA 4YWGG 3P4QB 2BS2B 3MHZA 1SE4A 4DQOC 2M0AA 1B1ZA 1TS2A 2HDEA 3W5VB 5I4DA 1ZP0B 3U7ZA 3PZ8A 2V4IB 1NYRA 2JQRB 3NVZA 2KMMA 3AEEB 1CZPA 4YTMB 2IPKD 1JQ4A 1ACCA 3P4RB 4C80A 1QT9A 2G1EA 3AE6B 1SE3A 1GB4A 1T6BX 1TS4A 3TEXA 4OW0A 3Q69A 2DBYA 2KWDA 3NVYA 5C3JB 1GAQB 2LMCA 4YXDB 4JE3B 2LHEA 5FKAC 5FK9C 2GI9A 1MPEA 1D5XC 2PTLA 1IBXB 3MJ5A 1T3QA 1NENB 1XXGA 3VRAB 4JPSA 1V1OA 2WXKA 1FD6A 4OZCA 2JWUA 1SJED 3AEAB 3AE2B 3IT6B 2WXLA 1JWMD 1L4DB 4R3DA 3P42A 4OVZA 2M56B 2GB1A 4N59A 1MI0A 1D6EC 1L0YB 3PO0A 3BIID 3B2GA 4GDLB 1YN4A 1WXQA 1C9FA 5H92C 2JSVX 2V3NA 5D7GA 4XE0A 1MVKA 3AV8A 4ZRPA 1QOGA 2BB6A 4YT0B 1C76A 2BT6A 1V1PB 1RFKA 1TKEA 1UWXA 2WP9B 1EM7A 1LO5D 3I9V1 4L23A 4RNAA 4AQ7A 1D5ZC 5HFYA 3BWUD 3IAS1 2BYTA 1QILA 1TS3A 1KLUD 2J4XA 2WDVB 1PGAA 4HKZE 2QMTA 1YMHE 1P7FA 1GOZA 1KLGD 4KKIA 2RPVA 4KGRA 1DOYA 4N6EB 1FCLA 3FILB 1YQ3B 2BS3B 2G9HD 1D5MC 4IOIE 3AM9A 1B9RA 1VRAB 2JU6X 4YTPB 5HI1A 2CJNA 2WLBA 2LHDA 1HXYD 1SSNA 2MH7A 5EE3A 2N7JA 3OWEB 3KQ4A 1TYGB 5T8IA 1NEKB 1ENFA 4RF1A 1KF6B 1I7HA 2BW2A 3KLSX 1XLPA 1TY2A 2WXQA 4GDKB 1E6EB 1XLOA 3ETRA 2V3PA 2B76B 2WXIA 3AE8B 1FXAA 1FO4A 4MM3B 2WXFA 1NI3A 2DLBA 2JYEA 4IDIA 3URYA 2WXRA 4ITKA 3VQIA 1SF0A 4L2YA 4RGMA 1DYQA 5EE0A 3NS1A 3AEBB 5E6JA 4Q2JA 1K50A 2VZKD 3GB1A 1QLBB 2KAJA 5BYSA 1UGJA 1TJEA 4RGOS 1K51A 1JWBD 3GS2A 4RH6A 2WXPA 3R8BA 2AX5A 3SFEB 2SAKA 3N9YC 2Y3AA 1SIJA 3RFZB 2NMQA 1JWSD 1QOFA 4OHJA 3AE3B 1RYJA 1CJEA 1HQRD 2BTEA 3W5UB 1BMLC 4IKGA 1WRIA 4KGSA 1I4QA 3L4PA 3V05A 3GP7A 1FEHA 1QF6A 3FILA 4WWMA 1FFUA 3AEGB 1SE2A 1I4XA 1FNWA 4FXCA 1BUIC 1L0VB 3U52E 4NAMA 3VR8B 2QSDA 1I4GA 2W3SA 1JRPA 1L6VA 2PMVA 3MP9A 2WXGA 3LYYA 1V8CA 1DGJA 1FIQA 2Q5WD 2N0SB 4M0WA 4KKJA 1J7CA 4YSZB 3EUB2 1HZ5A 4UDUC 4ARCA 4ARIA 2YEPF 4H2AA 5C2TB 3U2SC 4WIPA 3AB5A 2I38A 1PGXA 4HKQA 3BVGA 1L0XB 1DOXA 2KN4A 3AECB 1AW7A 3AE4B 3BVZA 3VR9B 2W54A 1Q10A 1N63A 4DXFA 3NZ3A 2LUMA 4WQMA 1TS5A 2Z8LA 2RDHA 3PZ7A 1Y56A 3O13A 3Q8EA 1FRDA 4MT5A 3TEYA 3IXSA 4ZHOA 1I4HA 5D3IB 1ZDXA 2IJ0A 2MJ3A 3CWIA 1T5XD 5BMGA 3C8YA 1RM6C 1PFDA 5D3DA 4ZRQA 1N62A 5EE1A 3ZGZA 1E10A 2BS4B 2J53A 2WU5B 1ZUD2 1XLQA 3P4SB 2RDGA 2LGIA 2YEPB 4HROA 4RCOA 4XWTA 4B0MA 2MJDA 1NYQA 4OZAA 1WYGA 5H8YE 3J9CA 1JROA 1JWUD 3ABVB 2BBCA 3AE5B 1R7SA 4OZBA 3BYYB 4REZA 4AS1A 4HRSA 2HTME 2WS3B 1A70A 3B2FA 4JWUC 2N9LA 4DXGA 4J3OD 1FXIA 2PVGC 1YNTE 2W55A 3AH7A 2M19A 2R61A 1C79A 1DOIA 1XCTL 2LEKA 2K5PA 2ZW1A 3R2IA 4NAWB 4NJCA 4PT5A 3UI3A 5AUIA 2AQ2B 2CU3A 1VDVA 1XCQL 3Q8AA 1OQQA 3KWVA 2W3RA 3AE7B 4B0EA 5BMIA 2PKOA 2RMMA 4KGTA 1JWAD 1XLNA 1YJIA 1D4BA 1QQRA 1NVID 1HZ6A 2GRIA 3HUIA 2WXNA 4TQ0A 1GB1A 1L4ZB 1C4PA 1UNSA 4LLGM 1JALA 2H88B 4D2KA 1XEEA 3CIRB 1GPXA 3SR6A 3B9JA 1CK1A 1PUTA 3LB8C 3FC4A 2FBWB 2INPE 4O1NA 3NVWA 1I4PA 1MHXA 1PDXA 4A55A 1XO3A 3ZQ4A 1EWCA 2Y5CA 1P7EA 2MEKA 2OHFA 2FUG1 1N60A 3AEDB 3IAM1 1AN8A 3AE1B 2DYOA 3IT4B 4EE2A 1SJHD 1ZXIA 5MPOA 3BVMA 5FR3A 1QKZA 1VZ7A 2JX5A 4WH4A 3VRBB 2ZW0A 3HVDA 1K52A 2ACZB 2IGDA 3KWLA 5HG2A 1CQVA 2WDRB 1SBBB 4YTNB 3FAHA 1SXTA 1MHHE 4LK0M 1FRRA 3TSSA 3BK2A 2K0PA 3T3NA 1YN5A 1K53A 1IBXA 3Q8CA 2PLPA 1WSPA 2WXHA 2BB5A 1F0ZA 1FM0D 1J7AA 2V0GA 3I57A 4C7ZA 3AMZA 3HRDD 3AEFB 2LFIA 4US8A 1KRHA 3MC0B 2ICIA 3ZYYX 1F2RC 3MFGA 2AQ1B 1V97A 3P1MA 3P63A 1OFFA 1ET9A 1FNUA 1V1PA 2QILA 2TSSA 4MH8A 2PVOD 2LJIA 2SEBD 1C4CA 1FCCC 3W9CB 3ZJTA 2I2YA 2J42A 1FFVA 1VZ8A 3AN1A 1VR9A 1XF5L 3SEBA 2KDMA 4HEA1 4C7YA 1ZE3D 4A6QA 1QOBA 3T3OA 1E7PB 1ROEA 1SEBD 1L5PA 2CJOA 2EELA 4ZHPA 2H89B 3TEWA 1SB3C 2E6XA 3AE9B 2J52A 1M4VA 4ZYSA 4CQNA 2XN9C 5BYQA 4XWWA 1AWDA 3H8HA 5JXVA 2PIAA 2WNMA 4LTUA 1IGDA 2WXOA 2QJLA 1HEZE 5LNK1 2Y5PA 3U4EG 1N61A 1UWMA 4NZLB 3ZJVA 3EGRA 2INNE 4RF0A 2XNAC 2IGHA 3NRZA 1TY0A 2L1AA 1TKYA 3V3XA 4RGTA 1C77A 3LXFA 4USAA 1JW9D 1TZOA 3WCQA 1PGBA 2OEDA 3P4PB 2JZPA 4WURA 4WAFA 2N9KA 2QEJC 2WXJA 5HHDG 4ZOHC 2IGGA 2PW9A 1ZOYB 2WDQB 4XDDA 1E9MA 5BMHA 5G5GA 2L32A 3DWGC 3SFDB 2FE8A 1ET6A 2EKIA 2WQYB 4TMAB 3NUHB 1KFYB 4RGNA 1ZXHA 4A9AA 3ZJUA 2DYMA 2IDYA 4MACA 1FMAD 1YN3A 5GXGB 3W1SA 1PYWD 4XDCA 3BZDB 1TKGA 3E9SA 3RPFC 4P16A 1F77A 1YQ4B 3R2TA 4GLSC 3BK1A 4C56C 1OQRA 5EE9A 2AQ3B 1ZPSA 2E3TA 1EU3A 1VJKA 5G5HA 1EWYC 1YJJA 1N5WA 2X38A 2MJEA 2L52A 1STEA 1J7BA 2D5GA 4RFBA 1UUPA 4YSXB 1N5XA 1BXTA 2WU2B 3HVZA 1F2RI 4A90A 1KH0A 4N58A 4US9A 2W82A 1L6UA 2ON8A 1QOAA 1FNVA 2L83A 3BYTB 4JWSC 3EA6A 3E56A 2JYTA 3W2DA 1C4AA 2K9XA 4HJGE 1HA5A 1E0ZA 5TSSA 3TUOA 4TSSA 1ESFA 3Q8BA 5AUKA 2K22A 2KQ4X 3Q8FA 1C78A 1KTKA 1WWTA 2JXTA 1EU4A 3DWMA 4YSYB 2KACA 1IGCA 2DWQA 4P6VF 1AYFA 2NTSA 2VZKB 2WXMA 4A8XC 2K3UA 3NVVA 1I4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KF6 B;  4KX6 B;  1I7H A;  4HRS A;  1XLP A;  1AWD A;  2HTM E;  2WS3 B;  1E6E B;  1A70 A;  1XLO A;  3ETR A;  3B2F A;  2B76 B;  1VLB A;  4JX1 C;  4JWU C;  1WGK A;  2PIA A;  3AE8 B;  2QIE B;  1RWS A;  1FXA A;  4LTU A;  1FXI A;  1FO4 A;  1IUE A;  1NI3 A;  2PVG C;  2W55 A;  2BS2 B;  3P4Q B;  4IDI A;  3AH7 A;  2QJL A;  4ITK A;  2M19 A;  3W5V B;  1SF0 A;  1ZP0 B;  1DOI A;  2LEK A;  2K5P A;  1N61 A;  1UWM A;  1NYR A;  2JQR B;  5EE0 A;  5AUI A;  3NVZ A;  2KMM A;  3AEE B;  2CU3 A;  1CZP A;  3NS1 A;  1VDV A;  4YTM B;  1JQ4 A;  3NRZ A;  1OQQ A;  2W3R A;  3AE7 B;  3AEB B;  2PKO A;  1JWA D;  1XLN A;  1YJI A;  3P4R B;  4C80 A;  1NVI D;  1QT9 A;  2G1E A;  3AE6 B;  1QLB B;  2KAJ A;  1TKY A;  3HUI A;  1TJE A;  2DBY A;  1JWB D;  3LXF A;  4USA A;  1JW9 D;  3NVY A;  3WCQ A;  2AX5 A;  3SFE B;  5C3J B;  1GAQ B;  4YXD B;  1JAL A;  3P4P B;  1R7S A;  2H88 B;  1SIJ A;  1QOF A;  3CIR B;  1GPX A;  3AE3 B;  1RYJ A;  3SR6 A;  1CJE A;  3B9J A;  1T3Q A;  3W5U B;  1PUT A;  1NEN B;  1WRI A;  3LB8 C;  3VRA B;  3L4P A;  3FC4 A;  4ZOH C;  1ZOY B;  2WDQ B;  2FBW B;  1E9M A;  1QF6 A;  3AEA B;  3AE2 B;  4WWM A;  5G5G A;  3NVW A;  1FFU A;  1PDX A;  3AEG B;  1XO3 A;  3DWG C;  3SFD B;  2EKI A;  2WQY B;  2M56 B;  2Y5C A;  4N59 A;  2OHF A;  1KFY B;  3AED B;  1N60 A;  1L0V B;  4FXC A;  4A9A A;  3PO0 A;  3BII D;  3AE1 B;  3B2G A;  3VR8 B;  2W3S A;  1JRP A;  1FMA D;  1WXQ A;  5GXG B;  1L6V A;  5H92 C;  1ZXI A;  5MPO A;  1V8C A;  1DGJ A;  1FIQ A;  2Q5W D;  1TKG A;  2N0S B;  3AV8 A;  3RPF C;  1QOG A;  2JX5 A;  1YQ4 B;  3VRB B;  1J7C A;  4YSZ B;  2ACZ B;  3EUB 2;  3KWL A;  4YT0 B;  2WDR B;  4YTN B;  3FAH A;  2BT6 A;  5C2T B;  1OQR A;  1RFK A;  1TKE A;  1FRR A;  2WP9 B;  3AB5 A;  5EE9 A;  2E3T A;  1VJK A;  1DOX A;  5G5H A;  1EWY C;  3AEC B;  1YJJ A;  1N5W A;  2MJE A;  2L52 A;  3AE4 B;  1J7B A;  3VR9 B;  4YSX B;  2W54 A;  1N5X A;  2WDV B;  1F0Z A;  1FM0 D;  1N63 A;  1J7A A;  4C7Z A;  3AMZ A;  2WU2 B;  3HRD D;  3AEF B;  3HVZ A;  4US8 A;  1KRH A;  4WQM A;  3ZYY X;  1FRD A;  4N58 A;  4US9 A;  1V97 A;  4N6E B;  4ZHO A;  1DOY A;  1L6U A;  3P1M A;  3P63 A;  1OFF A;  1QOA A;  2MJ3 A;  3CWI A;  2L83 A;  2PVO D;  4JWS C;  1RM6 C;  1PFD A;  1YQ3 B;  2BS3 B;  2K9X A;  3AM9 A;  1B9R A;  1E0Z A;  4YTP B;  1N62 A;  5EE1 A;  3W9C B;  5AUK A;  1E10 A;  2BS4 B;  2CJN A;  1ZUD 2;  2K22 A;  1FFV A;  2WLB A;  2WU5 B;  1XLQ A;  3AN1 A;  3P4S B;  1WWT A;  4HRO A;  2MH7 A;  5EE3 A;  3DWM A;  4YSY B;  4C7Y A;  2MJD A;  1NYQ A;  1QOB A;  1E7P B;  1WYG A;  1ROE A;  2DWQ A;  4P6V F;  5H8Y E;  1L5P A;  2CJO A;  1AYF A;  1JRO A;  4ZHP A;  2H89 B;  3ABV B;  3AE5 B;  1TYG B;  1SB3 C;  3AE9 B;  1NEK B;  3NVV A; 
#chains in the Genus database with same CATH topology
 2KN7 A;  1JCK B;  1WE6 A;  2IOF A;  1L5U A;  2NS5 A;  3T79 A;  4W9D A;  2F8L A;  2EKE C;  1VCB A;  3K1R B;  1WGK A;  4DHZ B;  2NTT A;  4F5P A;  2KZZ A;  1HTO A;  3DHG C;  4MF8 A;  8ICL A;  1IUE A;  4UAZ A;  4MSM B;  4M8N A;  5DG9 A;  8ICH A;  2Q0Z X;  4E3C A;  2P6U A;  3UGB B;  2LGY A;  1SE4 A;  3ZNG C;  1J2N A;  4ICA A;  2M0A A;  3WAN A;  4KLE A;  5TIS U;  2BYE A;  1E8Y A;  1ZP0 B;  4BZA A;  4IUM B;  5AIA A;  4NY0 A;  3A0B U;  5IIL A;  1DOQ A;  3NVZ A;  1KFS A;  2R8H A;  4YTM B;  3GIK A;  5ALX A;  4I27 A;  4F92 B;  3V62 A;  4PHD A;  1GG3 A;  2W8K A;  2FLL A;  1Z4O A;  4KLD A;  1GB4 A;  1T6B X;  3OHB A;  4RM8 A;  2YMP A;  4UB8 U;  3OJS A;  3NVY A;  4BXO B;  2VH2 A;  5C3J B;  5AKI A;  4Z6F A;  5DDY A;  5KT4 A;  2E8M A;  4YXD B;  7ICS A;  4RNN A;  2C2D A;  2LYB A;  2F2A B;  3DHI C;  1ZQN A;  5FK9 C;  2K8B B;  4F8C B;  4J9N A;  4W9J A;  4Q8F A;  5ALM A;  2J7Q B;  2ZJ5 A;  2IYD B;  1S0N A;  1WXV A;  2L0F A;  1T3Q A;  1IBX B;  1XXG A;  3BJY A;  4F4X A;  3EPI A;  2L3Z A;  9ICI A;  1V1O A;  5EWG A;  1FD6 A;  3L5K A;  3IT6 B;  5AKX A;  3QXG A;  3E58 A;  1JWM D;  3P42 A;  2IBI B;  4OVZ A;  3KZX A;  2GB1 A;  4DFP A;  3PO0 A;  2NV3 A;  2KE7 A;  3QAR A;  2GWS A;  1BGX T;  2BCS A;  1YN4 A;  3I3T B;  3QUB A;  1C9F A;  3F5A A;  8ICJ A;  2JSV X;  5H92 C;  7ICL A;  4DK5 A;  4WWO A;  3AU4 A;  4FN2 A;  2FUH B;  4A3O A;  1PQS A;  2KC1 A;  4QZI A;  4ZRP A;  4NNJ B;  4C8L A;  4CCH A;  5AZG A;  3AQE A;  1C76 A;  3VAW A;  4N9F 4;  1QH9 A;  3RUI B;  1L8O A;  2J6U A;  1SL1 A;  4MF2 A;  4FO6 A;  4RNA A;  2KD1 A;  1NBF C;  3IAS 1;  1RG6 A;  2BYT A;  2BVC A;  2O2V B;  1KLU D;  1PGA A;  4GIB A;  2JF5 A;  4CO7 A;  2IBK A;  3WAL A;  2LWP A;  2JZB B;  2PKE A;  4UB6 U;  2EZZ A;  4N6E B;  8ICC A;  4K7S A;  2K4I A;  4EZK A;  3M9N B;  4KDI C;  1KW4 A;  3KHR A;  3T5L A;  1SIF A;  3SD7 A;  2B6G A;  4HCN B;  4IOI E;  4RMA A;  4WJP A;  3AM9 A;  1VRA B;  2QC8 A;  5HI1 A;  3ZTD A;  5KHQ A;  2PI5 A;  3ZW3 A;  2A1A A;  4QZ8 A;  2R8G A;  3ORY A;  7ICK A;  1HXY D;  1SSN A;  2ZVN A;  1JMS A;  1KSP A;  4ECQ A;  2IZV B;  4FBJ B;  4ELT A;  4ED6 A;  3MHS D;  4ASW C;  1A77 A;  2G5H B;  5ALP A;  5T8I A;  1NEK B;  4BUG A;  4RF1 A;  3H0L B;  2BW2 A;  3KLS X;  3LJ3 A;  4RQM A;  3G6X A;  1KQQ A;  5IOI A;  4G3I A;  2IY1 B;  1RYR A;  4LVS A;  2NBV B;  4XX5 A;  1WJU A;  2Z7J A;  4Y2U A;  5J0Q A;  8ICT A;  1FO4 A;  2WXF A;  1TIF A;  4O3M A;  5GTH U;  3URY A;  5AM3 A;  2WXR A;  4AJY B;  5J2A A;  1SF0 A;  1L3V A;  5EE0 A;  3OJ3 A;  4J9Q A;  2QDF A;  3AEB B;  3F2B A;  1V85 A;  5E6J A;  4B9K A;  4Q2J A;  1A76 A;  2DFL A;  4C4V A;  3T5J A;  3HPO A;  3C1Y A;  1LVH A;  2KAJ A;  4DXA B;  2R8I A;  1K51 A;  1JWB D;  1E90 A;  1ZQW A;  3L3F X;  4RH6 A;  1I35 A;  2WXP A;  2J6S A;  3ZDE A;  2HBJ A;  5KT2 A;  4ECW A;  3N9Y C;  4JWN A;  9ICB A;  2K4H A;  4DQQ A;  3RFZ B;  2F76 X;  2NMQ A;  3TQ1 A;  8ICF A;  3SV4 A;  2VKQ A;  1CJE A;  4YP3 A;  1KJT A;  3W5U B;  1ZQL A;  1I4Q A;  3N30 A;  4DSI A;  3V05 A;  4DBG A;  3VVW B;  1FEH A;  3A9K A;  5TR5 A;  2H3Q A;  3FIL A;  2HJ1 A;  1L8L A;  1FFU A;  4J6I A;  1EXN A;  4B95 A;  1SE2 A;  4RQ0 A;  2HW3 A;  2MHJ A;  4C0Z A;  1NZP A;  4ED0 A;  4CF3 A;  3I76 A;  1BUI C;  2DZK A;  4FXC A;  4Y2Y A;  4DDG D;  5DB8 A;  3AUL A;  1U45 A;  4IM0 A;  2WXG A;  1FIQ A;  1WCN A;  2N0S B;  5AK3 A;  2W9B A;  1D3Z A;  4QIW F;  4J9P A;  2OXO A;  4F5R A;  4KKJ A;  1WE7 A;  3C28 A;  2XK5 B;  1HZ5 A;  2KFN A;  4ARI A;  3A9K B;  1NK0 A;  2MW5 A;  4AJW A;  3U2S C;  1ZQS A;  3ONN A;  1OEY J;  1IPG A;  2FI1 A;  1X2I A;  2QCZ A;  3G6V A;  8ICN A;  2RP5 A;  1WY8 A;  1FXT B;  2W54 A;  4YFK A;  1U4B A;  4GMV A;  4DXF A;  4B9U A;  3NZ3 A;  3NY5 A;  3VTW A;  2N7E A;  2RDH A;  2GO7 A;  3BS5 B;  3O13 A;  4NQL B;  3SAH A;  2C22 A;  2PXI A;  3UIP B;  1A5R A;  2MJ3 A;  3CWI A;  1T5X D;  2JRI B;  3ZKJ C;  3C8Y A;  4RNM A;  4FA6 A;  1BPE A;  3TJP A;  3GOE A;  5IA7 A;  4IL6 U;  2V4R A;  2J53 A;  3RBD A;  2HJ8 A;  2KSO B;  3OTQ A;  5J2F A;  1E8Z A;  2LGI A;  2D11 A;  2MU2 A;  4UAV A;  4O5K A;  4RCO A;  4B6W A;  1WYG A;  1WH3 A;  4QZ9 A;  2JVC A;  1JRO A;  1ZOL A;  2JXX A;  2I1K A;  3AE5 B;  2W9C B;  5AI0 A;  2LPE A;  1WJ6 A;  1XNS A;  4MGY E;  3D2S A;  3EC8 A;  2OWO A;  4F2R A;  5J17 A;  1ZQD A;  3MR6 A;  5F3X B;  5FP0 A;  2OH2 A;  2FCQ A;  4YD2 A;  2GBR A;  2HTM E;  3N7P D;  3B2F A;  4GOC A;  8ICO A;  2D3C A;  1KN5 A;  1L3T A;  4LCD E;  5LXI B;  2DF4 B;  2YML A;  4M9H A;  4OD0 A;  3AH7 A;  4FJZ A;  4DSK A;  3QUC A;  4UW9 A;  1DOI A;  2MAX A;  1XCT L;  4NJC A;  5ALJ A;  2L05 A;  5AUI A;  4F1S A;  2RDB C;  3KH0 A;  2WB1 F;  2AQ2 B;  2LVP A;  1XCQ L;  3WKD A;  4B0E A;  3AE7 B;  4JUZ A;  4KLF A;  1JWA D;  4QZG A;  4J9O A;  2R2O A;  7ICI A;  8ICW A;  1HZ6 A;  3QCA A;  1GUA B;  3DVN V;  3WK6 A;  2GRI A;  4NXZ A;  1H8C A;  3N1X C;  3RFA A;  3OSP A;  3Q8K A;  4WWP A;  5KFA A;  3SMV A;  4EEL A;  2P66 A;  1GB1 A;  1L4Z B;  4IRC A;  3RN9 C;  5KFM A;  2H88 B;  2CRX A;  2C2R A;  1GPX A;  1V6E A;  1GC7 A;  2DAJ A;  3B9J A;  3GIM A;  1PVP A;  1CK1 A;  4EFO A;  1PUT A;  4W9L A;  4ED2 A;  4RQ5 A;  3FC4 A;  3VH4 B;  4UAW A;  1NZB A;  2FBW B;  1HJP A;  1LKY B;  3ALB A;  2ES6 A;  1I4P A;  1PDX A;  4KLM A;  1R4M I;  3ZQ4 A;  1B22 A;  1EWC A;  3IBE A;  4QWB A;  2FUG 1;  1N60 A;  4PJ0 U;  3IAM 1;  3GZN B;  3TCA A;  2KKV A;  2VJ4 A;  3HM6 X;  3TL5 A;  4BAX A;  3A0H U;  4RQ6 A;  4IR1 A;  5FR3 A;  3UIO B;  2JX5 A;  4RQ3 A;  3VRB B;  1R4M B;  2IGD A;  3QX7 A;  2ZJ8 A;  3QA8 A;  1SBB B;  2RGF A;  4LJX A;  1SXT A;  5KG7 A;  1ZGU B;  1LB2 B;  2PFP A;  1UHU A;  2NO4 A;  2YQE A;  3TAQ A;  1ZQR A;  2C60 A;  7ICN A;  4XC2 A;  3NZS A;  4EEN A;  4F5O A;  7ICT A;  3T3N A;  1YN5 A;  3PNC A;  1K53 A;  3Q8C A;  2ZTD A;  3UQ2 A;  3WAM A;  3BQ7 A;  2CN1 A;  2DKX A;  2W7P A;  4C7Z A;  3BQ0 A;  1BPY A;  2JRZ A;  1WYW B;  3OAW A;  4BOS C;  1F1H A;  4C8K A;  5ALQ A;  2WAQ C;  3OGU A;  2C7H A;  1OFF A;  1ET9 A;  5KFH A;  1FNU A;  3KW5 B;  2LJI A;  1L2N A;  4JIO U;  1S76 D;  1ZQF A;  1TTN A;  1C4C A;  1FCC C;  4MEL A;  4ECZ A;  1P7D A;  5AZH A;  1SKR A;  1FFV A;  4JWM A;  5J2B A;  4J9M A;  1JIH A;  2IOH A;  2D07 B;  2KDM A;  2M8S A;  4A6Q A;  3T8M A;  1RQN A;  5L9X A;  1L5P A;  3GDX A;  2CJO A;  4DL7 A;  2EEL A;  1J8C A;  2RQ5 A;  2J52 A;  4CQN A;  3MBY A;  3L10 B;  5BYQ A;  4NPN A;  3PX4 A;  1AWD A;  3H8H A;  1ZQK A;  1RRB A;  3T5K A;  4RPX A;  3H4D A;  4DL2 A;  5IO9 A;  2LHT A;  2ZG6 A;  1NK6 A;  2MP2 A;  1T8E A;  3N20 C;  2BQR A;  3PHX B;  4GB9 A;  1IGD A;  5TZV A;  4LZG A;  2B21 A;  2GMI C;  2NRZ A;  4P4O A;  4O9M A;  1TE2 A;  1WUD A;  4LDT D;  2HVI A;  1WXA A;  2PE9 A;  3OG5 A;  3VTV A;  1V2Y A;  3ZJV A;  3V60 A;  3EGR A;  3HP6 A;  4RU9 A;  2XNA C;  1C3T A;  4K7W A;  2CXY A;  4ACF A;  2G3Q B;  7ICO A;  1N48 A;  3V6K A;  2M0X A;  4RT3 A;  1WMH B;  1TKY A;  3V3X A;  2LUE A;  3Q2A C;  2H3F A;  2XK5 A;  2IO1 B;  4WJO A;  4MH0 E;  2IMW P;  4YL8 A;  2OED A;  1Q3V A;  3P4P B;  2JZP A;  4GN1 A;  2ZVO A;  2WF6 A;  2K8C B;  4GU2 A;  3CMM B;  2VIX A;  4OJL A;  3V72 A;  2G06 A;  1WR1 A;  4KLL A;  2N9K A;  3PW0 A;  4P0Q A;  4DS4 A;  3LVW A;  5J2K A;  4HPP A;  2WDQ B;  1B4F A;  3N7S C;  3CRX A;  3K75 D;  2ZTC A;  3DWG C;  2V4L A;  1X9X A;  4KLQ A;  3TAC B;  2FE8 A;  4TMA B;  3F2C A;  1ZET A;  3QE9 Y;  1ZQP A;  1KFY B;  3PT2 B;  3AE8 B;  4IRK A;  3TMP B;  4A9A A;  3ZJU A;  2CU1 A;  5J2I A;  3H7S A;  2KXJ A;  4I2D A;  3HW8 A;  3ONS A;  3BZD B;  1MSW D;  4P1B C;  4M47 A;  1F77 A;  3ZTC A;  9ICW A;  3R2T A;  5KHO A;  3ENE A;  1ZD2 P;  2XBB C;  3TAP A;  2JH1 A;  2JHD A;  5KFK A;  5AKY A;  2MBH A;  1OQR A;  4QWA A;  5KFT A;  1SXE A;  4TQR A;  2E3T A;  1EU3 A;  2ZEQ A;  2QAR B;  1YJJ A;  3H8J A;  3ZD8 A;  4R66 A;  3GE8 C;  3WAP A;  2LGS A;  3BQ2 A;  4KLO A;  2KWV B;  3NZU A;  1G6J A;  2PFN A;  1QSY A;  1BXT A;  2RPQ A;  3HIZ A;  5LLI A;  2DZJ A;  2WU2 B;  3PR4 A;  2ZXH A;  1UBQ A;  4NJ7 A;  3EHV A;  2PJH A;  4DSL A;  2XVT A;  2YMQ A;  4US9 A;  2K39 A;  5C23 A;  4EBE A;  1PUZ A;  4R8U B;  1TBE A;  2L83 A;  4HDO A;  4JWS C;  4I2J A;  1CMX B;  3QHT A;  5CR0 A;  4NL9 C;  1C4A A;  4ED3 A;  5HP4 A;  1HA5 A;  4FBT A;  9ICH A;  1ESF A;  2NYV A;  2K22 A;  3Q8F A;  1C78 A;  2BCR A;  1KTK A;  1WWT A;  1ZJN A;  2GBK A;  2K1F A;  3JPR A;  3ZDD A;  4UB2 A;  3RBE A;  3OLM D;  2E1F A;  5DG8 A;  5AHX A;  4P6V F;  4KLU A;  3RNC C;  1AYF A;  2Y1I A;  4NM1 A;  4AOF A;  2NTS A;  5ALN A;  4G0N B;  3ZRF A;  5EOZ A;  2DAF A;  4ZH4 A;  2KVC A;  1E8X A;  2W11 A;  3M8R A;  2D3G A;  2MP2 B;  3U26 A;  8ICE A;  5DB9 A;  9ICM A;  1VZ6 A;  3PV1 A;  4TQ1 A;  1GNU A;  5ALH A;  3TEZ A;  2ONQ A;  3RF9 A;  1JML A;  5BYR A;  3VHT C;  3RJF A;  3DV9 A;  4PYU A;  2XID A;  4XZ4 A;  2HCF A;  5AKH A;  1Q3U A;  4F4W A;  3P4Q B;  2BS2 B;  2QLT A;  5J2J A;  3MHZ A;  1EF5 A;  2JZB A;  2VJ5 A;  3FYH A;  3QZ7 A;  1B1Z A;  1TS2 A;  4I2A A;  2LXA A;  1ZQY A;  4EEK A;  3TFR A;  3EPG A;  3DCG A;  3PZ8 A;  3HKZ F;  4C8M A;  1WJ4 A;  5AK4 A;  1URJ A;  1CZP A;  2IPK D;  3WKE A;  1SKW A;  4ZYN A;  4ACO A;  1O08 A;  3GIL A;  2LXC A;  4C80 A;  2OJW A;  3BS7 A;  3OPX A;  2RDJ A;  1QT9 A;  4HPM B;  1SE3 A;  4KIK A;  4QAY A;  4C00 A;  1Z2M A;  2BGW A;  4JMU A;  3RB6 A;  3GV7 B;  2IY0 B;  2YB4 A;  1SV4 A;  7ICV A;  1GAQ B;  4JE3 B;  1X1M A;  1OTR B;  5ALY A;  1VD2 A;  2IHN A;  2WX0 A;  4MJS B;  5FKA C;  2KQS A;  3R7R A;  2EZY A;  1I42 A;  1UH6 A;  1XO0 A;  4IC7 B;  5J18 A;  5DPW A;  3JPP A;  9ICU A;  1Z1B A;  3IP4 B;  5DB7 A;  4KDL B;  4TUP A;  2R8J A;  1HE8 A;  2XC9 A;  2I1Q A;  3DBH B;  2ASJ A;  4DFJ A;  3AE2 B;  2G45 B;  4NV0 A;  3M7D A;  1MI0 A;  3TFS A;  4K4H A;  4K3B A;  4OJO A;  4M9N A;  3QUQ A;  4M9G A;  2UWQ A;  2V3N A;  3RH5 A;  1LM8 B;  4XE0 A;  1IXR A;  1Q5W B;  7ICR A;  4NLN A;  1QOG A;  1Z1V A;  1UGM A;  2O6K A;  2BB6 A;  1ZQX A;  4YT0 B;  5DQG A;  4P0P B;  4P0P A;  4F4K A;  1T0S C;  4WWN A;  1V5O A;  4C4V B;  1TKE A;  1UWX A;  4G11 A;  1EM7 A;  4L23 A;  3F53 A;  4HJK A;  1IV8 A;  2D3D A;  1D5Z C;  3KUC B;  4RQ4 A;  1T0R C;  4B9N A;  2N9X A;  5AZF A;  2AGQ A;  4DF4 A;  4YQW A;  2WDV B;  3KYC D;  3IV6 A;  2PI4 A;  5DBC A;  5CHG A;  4JK1 A;  4NJ6 A;  1GOZ A;  1KLG D;  5KFF A;  4KGR A;  4KKI A;  3WKB A;  3APF A;  3CW2 C;  4M2Y A;  5AKG A;  2IO3 B;  3LK9 A;  3QU4 A;  2BS3 B;  2G9H D;  2RLT A;  3KYD D;  1TVA A;  1XS9 D;  1V49 A;  4S0R A;  2CJN A;  2G5I B;  2VAN A;  2FLN A;  8ICV A;  4ZDV A;  5EE3 A;  5J2D A;  4NAW A;  2ISO A;  5L1L A;  1KBU A;  4B6J A;  5KFW A;  3GE3 C;  3KQ4 A;  3KD3 A;  3UXP A;  3HK0 A;  2C7N B;  2IND C;  2PEA A;  1V81 A;  1ENF A;  2CHW A;  1EUV B;  5G2N A;  2XO7 A;  2KNB A;  5C0Y A;  5KG5 A;  1TY2 A;  5GMV A;  5AI4 A;  2M0N A;  5ALI A;  1E6E B;  2B3A A;  2V3P A;  3RCZ A;  4MHV A;  2KTR A;  2HE7 A;  4QZF A;  2GBN A;  3TKA A;  4RT2 A;  4UB1 A;  2G07 A;  1OUQ A;  3K1Z A;  5B5E U;  2BCQ A;  3RRG A;  4Z6D A;  2BWE S;  7ICF A;  1COK A;  3N1Y C;  1NI3 A;  4JQW C;  4ANX A;  1L7M A;  4O0I A;  1C7Y A;  2DLB A;  2DZM A;  3Q3O C;  4IDI A;  2OEH A;  5J0T A;  3A33 B;  4M00 A;  4L2Y A;  2YN4 A;  1LQB A;  4PGY A;  4YMO A;  5CEH A;  1F9J A;  4NLK A;  1TZ1 A;  3NS1 A;  3PRZ A;  5L1M A;  2KFK A;  3Q8Q B;  1UD7 A;  2VZK D;  4O3S A;  3GB1 A;  2FMQ A;  5EWE A;  1QLB B;  2HOI A;  2RDI A;  2M9N A;  3GS2 A;  4KX5 A;  1KKX A;  4K7U A;  1ZQU A;  5CTR C;  3SFE B;  3W1S C;  3M9M B;  2JUO A;  1SIJ A;  1L3S A;  2OJR A;  4I2F A;  4C4T A;  9ICL A;  5ALW A;  2EAN A;  1JRU A;  1WRI A;  2DHZ A;  2ZJD A;  1EO6 A;  2FPK A;  1U9L A;  4MFA A;  4PS8 A;  3BY4 B;  3IHP C;  4BWJ A;  3H8M A;  8ICK A;  3GP7 A;  2PE6 B;  2RSU A;  3J81 j;  4RQ7 A;  1T0Q C;  4DLG A;  4FS1 A;  3Q8P B;  1I4X A;  1ZQO A;  4ELV A;  3H9D A;  4NJ8 A;  1L0V B;  2K6Q A;  2N9E B;  3X0W A;  3U52 E;  1ZQT A;  1I4G A;  3ZDC A;  2JEG A;  2W3S A;  3SEI A;  1Y8R C;  7ICM A;  4UAU A;  5DG7 A;  1ZD5 A;  4XUS A;  5DBB A;  3RH6 A;  3C29 A;  1DGJ A;  1NJW A;  2B0C A;  3QQ8 B;  2GBJ A;  4EOY A;  3DOW A;  1XO1 A;  3KTQ A;  3HJE A;  5JHA A;  4BVU C;  3UXO A;  3RI7 C;  4IS7 A;  4HWI B;  4WIP A;  3PY8 A;  5KFU A;  4EZ6 A;  1PGX A;  4HKQ A;  1L0X B;  2KN4 A;  3SU8 X;  3L0W B;  3ISD A;  2HHW A;  5J0U A;  3VR9 B;  3FDS A;  4PS7 A;  1WX9 A;  1Q10 A;  3S2A A;  2LMR A;  1P0R A;  1UZX B;  4WQM A;  5D2M B;  4WAA A;  4RUC A;  3C19 A;  2WB1 C;  4MT5 A;  4UAT A;  3UMG A;  3TEY A;  1I4H A;  5D3I B;  4FBU A;  3EEC A;  7ICP A;  3QU5 A;  4JL9 A;  8ICM A;  3P2B A;  4QNL A;  3C1Z A;  4GXJ A;  2KC2 A;  3DVN U;  1E10 A;  4CYE A;  4F71 A;  2WU5 B;  4O3Q A;  4B9V A;  4YCX A;  2FPM A;  1J19 A;  1XLQ A;  3P4S B;  4J9K A;  4XWT A;  2JEF A;  4KZC A;  1NYQ A;  1AQ6 A;  2BPF A;  9ICP A;  2BBC A;  1WIA A;  2K8H A;  3A1Q A;  3BIN A;  1MQ2 A;  1ZQH A;  9ICK A;  2ZPY A;  3IFW B;  2EMS A;  5KG4 A;  9ICC A;  3BYY B;  5AI9 A;  2UU7 A;  3PW7 A;  3VUX A;  2WS3 B;  1KTQ A;  3MC9 A;  1SL2 A;  4Y2J A;  1T4G A;  4I29 A;  2N1R A;  5ALE A;  4EBC A;  1UBI A;  4DXG A;  4R8U A;  1ISN A;  3CF6 E;  1BT0 A;  1FXI A;  2PVG C;  2KYW A;  4DLE A;  1XSP A;  2EAP A;  4QZD A;  2KTF A;  4DL6 A;  5DQI A;  3X23 A;  1O03 A;  2K89 A;  1WFY A;  4IM3 A;  2NRW A;  2KIV A;  2K5P A;  2ZNV B;  2PFQ A;  2HMX A;  1NI2 A;  4NM2 A;  4PHE A;  1MJD A;  5KT6 A;  5ALF A;  3QU7 A;  2KVZ A;  4BGD A;  1OQQ A;  2W3R A;  3KWV A;  3Q8A A;  4ZRJ A;  4YR3 A;  1D4B A;  2CPR A;  2J0K A;  1MC8 A;  2BDU A;  3AQF A;  5IIO A;  1WM2 A;  1XQQ A;  4OJP A;  1WCL A;  4NLC A;  2DNF A;  4IG7 B;  1NK5 A;  4GXK A;  2LJ5 A;  3QUT A;  2EAO A;  4IQW A;  4PS3 A;  3OJ4 B;  2DUY A;  3DBS A;  4FJV B;  4GFJ A;  1C4P A;  5HHH A;  2KWU B;  1JAL A;  2MWS B;  4ED1 A;  3NAS A;  3A9J B;  4XQ8 A;  1E7V A;  3CIR B;  4JGH B;  5JRT A;  1L7N A;  4DL5 A;  4ELU A;  3LB8 C;  4DCC A;  3AL0 B;  4IWO A;  1JXE A;  1WM3 A;  2A5U A;  4O1N A;  1BNP A;  2C5L C;  3TBL D;  1KL9 A;  2G4D B;  3NVW A;  4QW9 A;  4A55 A;  3WK8 A;  9ICA A;  1XO3 A;  1YX5 B;  5DCN A;  1V5T A;  3H7I A;  1T3N A;  2Y5C A;  2OHF A;  5J0R A;  4KLT A;  4EBD A;  2XI9 A;  1AN8 A;  2MUT A;  3AE1 B;  1YD8 U;  5KFX A;  4G50 A;  4I2E A;  4K1R B;  3AUO A;  1RYU A;  9ICX A;  1H38 A;  3BVM A;  4Q8E A;  2KX0 A;  1TAU A;  3O65 B;  3S6J A;  1QKZ A;  4ANW A;  1D9D A;  1VZ7 A;  4WH4 A;  5DPR A;  2DGZ A;  1P3Q U;  2IHM A;  1K52 A;  2ACZ B;  2WDR B;  4CDG A;  3UM9 A;  2BKR B;  1WGD A;  4A8E A;  1FRR A;  3TSS A;  4DQS A;  3VCB A;  2BPC A;  2K0P A;  4LNF A;  4PZN A;  1IBX A;  5A0L A;  2PLP A;  2WYQ A;  5IP4 D;  1WSP A;  3PMN A;  3M95 A;  1SV0 C;  2BCV A;  5C1Z A;  3VUW A;  1K5O A;  2BB5 A;  1FM0 D;  4PPX A;  4P4M A;  3PVX A;  2K8A A;  2Y0S F;  3SZ2 A;  2HI0 A;  3HRD D;  5CRX A;  4IQT A;  5F9L A;  3MC0 B;  3MFG A;  1HTQ A;  5BOM A;  2AQ1 B;  2RRD A;  5AM2 A;  1Z4N A;  4K4I A;  2QIL A;  2HBL A;  5E6O A;  2PMZ C;  4HXD A;  4F3O A;  2SEB D;  4ECY A;  2K6D B;  1T7P A;  2KJH B;  5KAF U;  3G6Y A;  1SXD A;  1NK7 A;  4MGK E;  5GTI U;  3AN1 A;  4KSL C;  1XF5 L;  3PW5 A;  3ISC A;  3W1Y A;  5IIK A;  1SEB D;  4I2C A;  4EX7 A;  2I1J A;  2A19 A;  2E8P A;  1SB3 C;  3DQV A;  1DGS A;  1M4V A;  3DVG X;  4J9L A;  3PSE B;  2XN9 C;  1ZJM A;  2ZUD A;  5ALG A;  5HKH A;  4GXI A;  4I2H A;  2WNM A;  2K25 A;  4O3R A;  2KLC A;  4LTU A;  4Z6C A;  3OHA A;  4LZD A;  2ZIX B;  2ZTE A;  1RXW A;  4JV0 A;  2L00 B;  3EYZ A;  2FJ6 A;  1WGG A;  1N61 A;  2FLP A;  4M04 A;  3PO4 A;  2ESE A;  3V6J A;  4ANV A;  3BZC A;  5H2F U;  2KJ8 A;  1NDD A;  3QU9 A;  2NRT A;  1Z00 B;  4HK2 A;  4CGZ A;  4USA A;  8ICQ A;  5AK5 A;  3VTU A;  3RJI A;  3KBB A;  1N2X A;  2INC C;  3L08 A;  2KHV A;  1PGB A;  2CR5 A;  2JY6 A;  9ICV A;  5DPT A;  5AKJ A;  2MA9 B;  1IIP A;  1ZQC A;  2KTR B;  2O6V D;  3DBH I;  2WXJ A;  3SV3 A;  4GLX A;  3PR5 B;  1WI0 A;  2PW9 A;  3B08 A;  3NG0 A;  4FHK A;  2WF8 A;  2G08 A;  2ISP A;  8ICI A;  2D3B A;  2MSE D;  3MDA A;  3MC8 A;  3ZLZ A;  1U48 A;  2EKI A;  4HVB A;  2NRX A;  3NUH B;  2XY6 A;  3IG8 A;  1PK1 B;  1DXS A;  2DYM A;  2YTU A;  4C8O A;  5JH5 C;  3W1S A;  5GXG B;  3MC1 A;  4ZRI A;  4XDC A;  1TAQ A;  4P4P A;  2WWZ A;  3N7R C;  3DBR B;  4LNK A;  2KT7 A;  4RPY A;  1S0M A;  1QSS A;  3BK1 A;  3PRP B;  4C56 C;  2A1J B;  1CRX A;  1ZPS A;  2KP7 A;  3UMC A;  3NGD A;  5CWR A;  3WK9 A;  5KFI A;  1S1Q B;  2VA8 A;  1STE A;  3F5E A;  3OSN A;  4RFB A;  2Z59 B;  3THV A;  1UUP A;  4YSX B;  5IKC M;  1RLF A;  3JSV A;  2MCN B;  4UAS A;  3QK0 A;  1RPL A;  1HUZ A;  2ZIU B;  1L7Y A;  4KLG A;  1ZQ1 C;  2F1J A;  4BJQ A;  3RB0 A;  2XY5 A;  3GFK B;  4N58 A;  4YN4 A;  3K4G A;  2JMG A;  4IQV A;  5CJ7 A;  3ZI4 A;  1TV9 A;  1L6U A;  1QOA A;  3ISB A;  5KFV A;  1T0Y A;  4UBB A;  3U7D A;  4BKG A;  3EA6 A;  3WAO A;  3E56 A;  4RQN A;  4HJG E;  1E0Z A;  1ZYQ A;  1JXL A;  1V38 A;  5TSS A;  3Q8B A;  4RQ8 A;  4M9J A;  2MLB A;  3HHM A;  3IHQ B;  2XGQ A;  2HHU A;  3VDZ A;  1EU4 A;  2H3V A;  3DWM A;  1ZKH A;  5E79 U;  5B66 U;  3T3F A;  1WG8 A;  4YD1 A;  5CB1 A;  2CHX A;  3R3M A;  1LGR A;  2K3U A;  3NVV A;  2VH1 A;  2ASL A;  1AAR A;  4L1B A;  2N7D A;  1TK5 A;  4JX1 C;  4OO1 J;  1VLB A;  2KJ6 A;  3GV8 B;  1RFA A;  2HHT A;  3DDC B;  5CHW A;  7ICQ A;  4YWG G;  8ICZ A;  2BYV E;  3IDW A;  3W5V B;  5I4D A;  2HDE A;  2HOF A;  4FZN A;  3U7Z A;  1WGR A;  4HLE A;  4TQS A;  3V7K A;  2MSN A;  2KIC A;  1NYR A;  1TT5 B;  2V4I B;  2KMM A;  4E0D A;  1SZP A;  3AEE B;  3T9L A;  1JQ4 A;  4GIV A;  3UIN B;  5E6P A;  4K3C A;  4KMO B;  1ACC A;  3E2E A;  3P4R B;  2CS4 A;  5AKK A;  3TEX A;  4U7C A;  9ICF A;  2FE9 A;  2DBY A;  2KJ5 A;  5EWF A;  3QEB Z;  3KHG A;  1FEZ A;  3ZNI D;  5J2G A;  4CF5 A;  1PVR A;  3WKA A;  2LHE A;  5DPS A;  2AYO B;  1NK4 A;  4II3 B;  2NCN A;  1MPE A;  1MFW A;  3GZN I;  1QCK A;  1UA1 A;  2PTL A;  3RD2 A;  4Q45 A;  3KHL A;  4JPS A;  4XYC A;  2WXK A;  1XU4 A;  2JWU A;  3D32 A;  1SJE D;  3AEA B;  2WXL A;  4R3D A;  4ED7 A;  4BDP A;  2A3V A;  3ZVV A;  3CNH A;  4N59 A;  2ZJA A;  1S3S G;  1D6E C;  3BII D;  3BZK A;  5ALK A;  3PTF C;  4GDL B;  3KVF B;  1ZQI A;  3FM9 A;  4AYB C;  5D7G A;  2I6X A;  2MRP A;  2G0A A;  2VRR B;  3AV8 A;  1EF1 A;  2DQN B;  2LI6 A;  2C28 A;  1ZRN A;  3QU2 A;  1WWU A;  5AM1 A;  2BT6 A;  3V61 A;  4NWI A;  4ECR A;  3F2D A;  1COO A;  2AGO A;  2WP9 B;  2KZM A;  9ICO A;  4LJP B;  2JPH A;  3APC A;  3BWU D;  4TV3 A;  9ICJ A;  1QIL A;  1TS3 A;  3AI5 A;  1UCV A;  3MFH A;  2AEH A;  1UT5 A;  4HKZ E;  5KG6 A;  2QMT A;  1YMH E;  5KFZ A;  3H8W A;  3PSI A;  5HR6 A;  4RPZ A;  4NLZ A;  2RPV A;  2QAR A;  3TAD A;  3Q3F A;  1DOY A;  4E74 A;  4GC7 A;  3FIL B;  4I6L B;  5ALT A;  1YIW A;  2JEJ A;  3R9K A;  4ECV A;  2FNJ B;  3TI0 A;  3I1Y A;  1B9R A;  2W9N A;  3DDH A;  9ICR A;  4P2H A;  4UBC A;  2WLB A;  1UF0 A;  2LHD A;  1X9W A;  4II2 B;  1WJN A;  2MRL A;  3OWE B;  5C5J A;  2KOX A;  9ICN A;  7ICJ A;  1TYG B;  3LVV A;  4O3P A;  1KLN A;  4NY8 A;  4LDT B;  1ZD3 A;  3NTU A;  1XD3 B;  3C21 A;  1I7H A;  1XLP A;  4MDK E;  3RH4 A;  3I28 A;  4GDK B;  3WK4 A;  1XLO A;  2KFK B;  1S10 A;  2WXI A;  3Q3J A;  2LGD A;  4W9G A;  2FID A;  4NLB A;  4QZA A;  1FXA A;  2O6V A;  4MM3 B;  3A1Q B;  1BPX A;  5AM4 A;  2JYE A;  4ITK A;  3VQI A;  1H4R A;  3LDZ E;  4UB3 A;  2OCE A;  4TUQ A;  2BPG A;  1DYQ A;  4C8N A;  3GII A;  4AWJ A;  1RYS A;  4QIW C;  4QW8 A;  5J0O A;  3H4B A;  1SGH A;  3ZUN A;  4IQU A;  4DOC A;  4FZM A;  3MR2 A;  3K9O B;  2AU0 A;  1K50 A;  1E8W A;  5HR7 A;  5EDS A;  4DL4 A;  3IRU A;  4QJF B;  2FPL A;  1Z5S B;  2HTH A;  5BYS A;  1UGJ A;  1TJE A;  4RGO S;  2VA2 A;  3RJE A;  4EYH B;  2LD9 A;  3N97 B;  4DS5 A;  5J8Y C;  4YR0 A;  2AX5 A;  3QJZ A;  4PYZ A;  2W04 A;  4W9E A;  3KHH A;  5KFN A;  4RZR A;  5J8Y A;  2Y3A A;  1HIW A;  5L95 C;  1QOF A;  2KTQ A;  3AE3 B;  5J2E A;  4PL2 A;  5T14 A;  1RYJ A;  4Q43 A;  4FHJ A;  4XRH A;  3BQ1 A;  3PW2 A;  1BML C;  4W9I A;  3KUZ A;  4KGS A;  3L4P A;  8ICG A;  1TFR A;  4LJO B;  1QF6 A;  3RR7 A;  9ICS A;  4WWM A;  3RMK C;  5IIJ A;  1NKC A;  1NOM A;  3VC8 A;  1YX6 B;  1D8L A;  2F1H A;  1SV0 A;  3H6N A;  1L6N A;  3TAR A;  4Q44 A;  1MG8 A;  5AI5 A;  3TAN A;  2DYB A;  4B9S A;  4NAM A;  2QSD A;  3RJG A;  3CYM A;  2NPT A;  1A6S A;  1JRP A;  1X66 A;  8ICP A;  3MTN B;  1L6V A;  5BO4 B;  4Y2P A;  4F50 A;  3ECI A;  2YLM A;  2Q5W D;  3KZI U;  4M0A A;  3O0F A;  3H7P B;  1V9P A;  2NBW B;  8ICU A;  4M0W A;  4Y2V A;  4YSZ B;  3M9O B;  3EUB 2;  1SE9 A;  1QZE A;  5K4L A;  4ECU A;  4H2A A;  4PGX A;  7ICH A;  3H8S A;  4M02 A;  5L1K A;  5C2T B;  4QWD A;  3BVG A;  5JZE B;  2KVR A;  1Q1O A;  1DOX A;  1AW7 A;  3AE4 B;  3BVZ A;  2WTF A;  2HHS A;  4B9L A;  2ZUC A;  4GDL A;  1Y88 A;  2LUM A;  2CHZ A;  3AU2 A;  3PZ7 A;  4KN4 A;  1GJZ A;  1FRD A;  4WQO B;  2Q4T A;  2QB1 A;  3HKZ C;  4ZHO A;  3JPO A;  4KLI A;  4P7I A;  5JHB A;  4I6P A;  1D9F A;  3UF8 A;  3ZNZ B;  5D3D A;  4RQ2 A;  1N62 A;  4MEY A;  3PST A;  3LDA A;  3H7P A;  2BS4 B;  4M0W B;  5F9N A;  1ZUD 2;  2LAS A;  4HRO A;  4B0M A;  1N6Z A;  4MJS A;  2MJD A;  4OZA A;  4DSJ A;  3UQ0 A;  2BF8 B;  2JWZ A;  4MEM A;  5H8Y E;  2C7M B;  1SGG A;  2Z0E B;  3ABV B;  1K8R B;  4OZB A;  1D8Y A;  4BKS D;  3EFU A;  7ICU A;  4BKS A;  2L7R A;  5CX3 A;  1A70 A;  4F2S A;  1S0V A;  5ALL A;  4DHJ D;  2KHW B;  2ZNV C;  4DOA A;  4J3O D;  3RT3 B;  2LBO A;  2M17 A;  2K4P A;  1C79 A;  4PHA A;  3IG3 A;  5KFS A;  3RNF C;  3EZ5 A;  3UQA A;  2KSO A;  4R63 A;  2CU3 A;  2J0M A;  4QWC A;  2YMM A;  5BMI A;  2R2Q A;  2PKO A;  2RMM A;  1XLN A;  2Y0S C;  3C5F A;  4IR9 A;  1SWV A;  1NVI D;  3ZRC A;  4F4Y A;  1RDF A;  3HUI A;  2WXN A;  4KMU A;  3KKA A;  1B0X A;  2UVR A;  1Q0W B;  4B9M A;  2PPH A;  3JPQ A;  1QQ7 A;  2JH7 A;  4TQ0 A;  4BBN F;  2LVQ A;  5AKE A;  2V3S A;  3MGV A;  1LV5 A;  2NVU I;  1UNS A;  3H40 A;  2KFJ A;  1ED1 A;  4X57 B;  4D2K A;  2N1W A;  3RYT A;  4EKU A;  4G3X B;  1QTM A;  4OVU A;  2ODG A;  3SR6 A;  4ECS A;  3QYP A;  2KZ3 A;  3D6J A;  4AP4 C;  4DOB A;  2EDU A;  2LRU A;  3UMB A;  3PSP A;  1LKY A;  2FMS A;  2INP E;  2MBE A;  2N9P C;  2ZZP B;  4IM2 A;  4EZJ A;  4YMN A;  2ZPN A;  5J2R A;  4P0Q B;  1C1Y B;  2W9A A;  1SZH A;  1UA0 A;  1P7E A;  1ZD4 A;  1ZQM A;  3AED B;  3ZNH B;  2DYO A;  3WK7 A;  4EE2 A;  2BGF A;  2QHO A;  2L5Y A;  2MBQ A;  3SI8 A;  4MGZ E;  5KFR A;  4O5C A;  4WJN A;  5HML A;  2RHF A;  5HG2 A;  3KWL A;  4ED8 A;  3WKC A;  1CQV A;  1KLV A;  2MX2 A;  3N4M B;  1Z00 A;  2P6R A;  3ZDT A;  4DFK A;  3GZF A;  2K60 A;  3SYZ A;  5D49 A;  3BK2 A;  4BWM A;  4MSQ B;  1SKS A;  1K1Q A;  5KNI A;  4PH5 A;  1BPZ A;  2WXH A;  3PPA A;  4S17 A;  1M6Y A;  2KQ7 A;  3HT3 A;  1NKE A;  2YY6 A;  5L1I A;  3AEF B;  4US8 A;  3PV8 A;  1KRH A;  5KAI U;  3KFU F;  2JZ3 B;  4BXO A;  4TUU A;  1TGZ B;  5KFG A;  1NKB A;  3KOO A;  2D6F C;  4IC9 A;  4KLJ A;  2KJR A;  2TSS A;  3P1M A;  3P63 A;  4MH8 A;  2PVO D;  3I5J C;  3Q8L A;  3MR3 A;  4MFF A;  4PGQ A;  1PZN A;  2LGX A;  3W9C B;  3ZJT A;  4HAI A;  2I2Y A;  4NL9 A;  2J42 A;  2QB0 A;  1VR9 A;  2K8C A;  3SEB A;  3OJU A;  3U30 A;  1ZE3 D;  2EQY A;  1F5S A;  2QKQ A;  1E7P B;  1YJ1 A;  4FAD A;  1DK2 A;  3ZXR A;  3Q14 C;  4AP9 A;  3L17 A;  4KZ0 A;  2EMT A;  2LYH A;  2H89 B;  3ETL A;  4Y2R A;  2E6X A;  3AE9 B;  2M1M A;  3D2Q A;  4DFM A;  2F8K A;  2YVC A;  5KFO A;  7ICG A;  2LZ6 A;  5DGA A;  2KDI A;  4W9F A;  2XCA A;  3RUL A;  3HWT A;  2LM1 A;  4R64 A;  2KG5 A;  5DB6 A;  5IIM A;  2HHX A;  2KX3 A;  3R7Q A;  2QJL A;  2G09 A;  1S8O A;  5LNK 1;  4HYK A;  1F0M A;  2ZIX A;  3U4E G;  4NZL B;  1UWM A;  1JN3 A;  4ICU A;  2ZUB A;  4YVZ A;  5CHV C;  2W7O A;  2IGH A;  3E0F A;  1ZQV A;  3NRZ A;  5ALV A;  1TY0 A;  2ALZ A;  1NJY A;  3SEN A;  8ICB A;  1LXD A;  3ZDA A;  1C77 A;  4RGT A;  3LXF A;  2KFZ A;  5BOL A;  1JW9 D;  4A3P A;  3T5H A;  2NBU A;  5JTI A;  3ZDM C;  2GH1 A;  3V7L A;  1TKD A;  1ZQZ A;  2O6V B;  3HIL A;  5KFL A;  4MM3 A;  2QB0 B;  2D3A A;  2R18 A;  4WUR A;  4WAF A;  3VH3 B;  2QEJ C;  3K9P B;  4TKN A;  4O3N A;  4ZOH C;  2WHI A;  3SHQ A;  2NR2 A;  4XDD A;  5E6N A;  1E9M A;  4F4Z A;  2D8C A;  4F72 A;  4QZB A;  4ICV A;  5BMH A;  2L32 A;  4J9R A;  3SFD B;  4O3O A;  1UQV A;  2WDT B;  3PX0 A;  3NJT A;  2KAN A;  4RGN A;  1ZXH A;  1XC9 A;  2JEI A;  4MAC A;  2KOB A;  1KDH A;  3GV5 B;  3AXC A;  1OXJ A;  1PK1 A;  4DSE A;  1PYW D;  4GSW A;  3RZW C;  4W9K A;  1TKG A;  3RPF C;  1YQ4 B;  3AEV A;  3H0R B;  3APD A;  3M6K A;  1QSL A;  2XIC A;  5EE9 A;  4CRX A;  5AIB A;  5KFP A;  3RTV A;  2L52 A;  1ZQQ A;  1J7B A;  2D5G A;  4DDI D;  2G4S A;  3M3J A;  2V9W A;  2KLG A;  1C20 A;  3QEA Z;  4FJY A;  3RZF A;  2IO0 B;  4A90 A;  1ZQA A;  1KH0 A;  1WXM A;  2A1J A;  1KOT A;  3MGI A;  5D94 A;  4JV2 A;  1CEZ A;  2HBK A;  4AYB F;  1GC6 A;  4FLH A;  8ICX A;  2H5X A;  3TUO A;  5AUK A;  8ICR A;  4C4S A;  3PO5 A;  2KQ4 X;  3ZDB A;  2E8O A;  2JXT A;  1L7O A;  3PW4 A;  1NJX A;  1BNO A;  1Z19 A;  1D8B A;  1IGC A;  3M62 B;  1KEJ A;  2F3N A;  4M8M A;  2LI5 A;  2LVO A;  1P9D U;  1NK8 A;  2WXM A;  4I28 A;  2D10 A;  3QAQ A;  1CUK A;  4KX6 B;  1XSL A;  3TIX A;  3ALR A;  4LNN A;  3ZXV A;  1ZRM A;  2QIE B;  2BWF A;  1RWS A;  4J03 A;  2AHO B;  1JX4 A;  4IRD A;  1ZDV A;  3RNA C;  3PLV A;  2IOF K;  4QZE A;  2KV2 A;  4DQO C;  2I5H A;  1JUD A;  2AJQ A;  1F52 A;  2JQR B;  1HEK A;  5III A;  1DK3 A;  3GIJ A;  4DF8 A;  8ICS A;  4YR2 A;  4DQR A;  2WX1 A;  5J0Y A;  3HM3 A;  3M63 B;  2ZIV A;  4EZL A;  4I2I A;  2G1E A;  3AE6 B;  2H3I A;  2FDR A;  3WA0 A;  1TS4 A;  4OW0 A;  3A4S C;  1P98 A;  4QWE A;  2FCS A;  3Q69 A;  2KWD A;  2W9B B;  1S97 A;  3RJK A;  4M9L A;  2DPI A;  4FUL A;  4DHJ B;  2LMC A;  3RNE C;  1S0O A;  4Y2S A;  3JSV B;  2GI9 A;  2KD0 A;  3VUY A;  3MAB A;  1D5X C;  2A4Z A;  3MJ5 A;  1NEN B;  3R66 C;  1WF9 A;  3VRA B;  5KFD A;  5J2C A;  4OZC A;  2Y9T A;  2GLS A;  3N3K B;  3DEE A;  2BR0 A;  1L4D B;  3PVL A;  4GGQ A;  4DL3 A;  5D6J B;  2M56 B;  3BS5 A;  2DZI A;  4HCP B;  2KDF B;  1L0Y B;  3QC8 B;  5D4B A;  2KK8 A;  1KRP A;  3B2G A;  3RRH A;  5KG1 A;  3LYS A;  2V4Q A;  1WXQ A;  2GLE A;  1RXV A;  3PGE A;  2PMZ F;  4FE3 A;  3RNG C;  2O2V A;  4F91 B;  1MVK A;  1BPD A;  3RB4 A;  3DVG Y;  2HHV A;  2L8J A;  1MN8 A;  3HX0 A;  2F1I A;  2DPJ A;  2HSZ A;  1MA7 A;  1P1A A;  4XGA B;  1V1P B;  5AM0 A;  1RFK A;  4RUA A;  1LO5 D;  3I9V 1;  4AQ7 A;  4K81 A;  2ZIV B;  3NRW A;  2JRH A;  5HFY A;  4RQ1 A;  1NNL A;  2M4N A;  2WF9 A;  2J4X A;  2JR5 A;  4IWP A;  1MG4 A;  3V6C B;  3ZIM A;  2NRV A;  1P7F A;  5ALS A;  2W43 A;  1FPY A;  4R65 A;  2GOW A;  4M6W B;  4Z6E A;  2WHE A;  5ALD A;  4DFD A;  2JV3 A;  1FCL A;  5KT5 A;  4TUR A;  4Y2T A;  1YQ3 B;  1D5M C;  1OGW A;  1B43 A;  5LXH A;  4YTP B;  2JU6 X;  2HVH A;  4I2G A;  4CF4 A;  1WWV A;  5DKW A;  1YOV B;  4PL1 A;  2K4E A;  4QZH A;  2MH7 A;  1RQL A;  1N56 A;  2N7J A;  3PLU A;  4FZL A;  4BOZ B;  4F5Q A;  4DQP A;  1KM7 A;  3CP8 A;  5ALO A;  2E8N A;  1KF6 B;  2BKF A;  5KFQ A;  1WX7 A;  3MDC A;  3C0R B;  1X9S A;  2WXQ A;  4EZ9 A;  1WXS A;  3ETR A;  2B76 B;  2L76 A;  2FIF A;  1K1S A;  4KLS A;  4EUT A;  1YQB A;  5KL1 B;  2L0T A;  2ZIU A;  3L16 A;  4CHK A;  2AH5 A;  4RGM A;  4FFD A;  4WJ3 B;  5KFB A;  5L83 A;  4I6N B;  4RNO A;  9ICQ A;  1LFD A;  4Y2Q A;  3JPT A;  5J0S A;  3Q8R B;  4CE6 A;  1QQ6 A;  1WRD B;  5KFE A;  3JYU A;  1BPB A;  3R8B A;  5ALU A;  1OQY A;  3GU3 A;  3BDP A;  2SAK A;  5IN7 A;  3LWL A;  2HDO A;  3GQC A;  1JWS D;  4QZC A;  5J0X A;  4OHJ A;  2E5S A;  2WGS A;  2BYF A;  2KIW A;  3QNM A;  1ECW A;  1HQR D;  2XCP A;  2BTE A;  4IKG A;  1S77 D;  3ZO5 B;  3C2L A;  3VFK A;  1MQ3 A;  4A20 A;  5KT3 A;  3PRM B;  2EAM A;  3RAX A;  3AEG B;  3DPD A;  2W9C A;  1PVQ A;  4BFR A;  1QQ5 A;  1XWL A;  2YX8 A;  5AIC A;  1FNW A;  1WR6 E;  4XA5 A;  2FMP A;  2E1E A;  1ZQB A;  3VR8 B;  2BCU A;  3PHW B;  5ALZ A;  1J97 A;  1X6I A;  2IO2 B;  2PMV A;  3MP9 A;  4PZO A;  3LYY A;  4IWQ A;  1V8C A;  1KFD A;  3JW0 X;  1E5W A;  1IYF A;  4BX9 C;  3ED5 A;  1DRG A;  4O5E A;  1J7C A;  3CST A;  4UDU C;  3A4R A;  4ARC A;  2YEP F;  4YG2 A;  1UEL A;  1UPH A;  3SDL C;  4KIK B;  3AB5 A;  5AKL A;  2I38 A;  1Q8K A;  1WZ0 A;  5L1J A;  3AEC B;  2KJ9 A;  3IG5 A;  3B0A A;  1X6J A;  5DQH A;  1NJZ A;  3B1L X;  3A9J A;  2D2Q A;  3QIJ A;  1N63 A;  3PZP A;  8ICA A;  2KKC A;  1TS5 A;  2Z8L A;  2KVS A;  1Y56 A;  3C2M A;  3Q8E A;  4OJ5 A;  1X9M A;  2V1Y A;  3IXS A;  1SL0 A;  2JT4 B;  1YZ7 A;  3WK5 A;  3ML9 A;  2W03 A;  2AQ4 A;  1ZDX A;  2IJ0 A;  5BPC A;  4KV2 A;  5BMG A;  2WFA A;  1RM6 C;  3MFI A;  4AUQ C;  4DO9 A;  1PFD A;  2KZR A;  3SAG A;  1UT8 A;  2W8L A;  1TAM A;  4ZRQ A;  5EE1 A;  5AI8 A;  3ZGZ A;  4PHP A;  2FCM A;  2J0J A;  3QZ8 A;  5CP2 A;  2K8B A;  2RDG A;  2YEP B;  5KT7 A;  3UQB A;  2LYA A;  9ICG A;  3IVF A;  3VXW A;  3J9C A;  5AK6 A;  1JWU D;  5G55 A;  5AI6 A;  7ICE A;  5HNK A;  3AU6 A;  1R7S A;  3NOB A;  1TK8 A;  4W9C A;  4F7Z A;  3M1Y A;  1QLN A;  3UXN A;  4REZ A;  4AS1 A;  4HRS A;  4ZRK A;  2ZIW A;  2ZIW B;  3U8Z A;  4Y2X A;  4MEX A;  2N9L A;  3NUQ A;  4JWU C;  3B0X A;  4G9B A;  1U4A A;  1YNT E;  2W55 A;  1ZQJ A;  4F5N A;  3PX6 A;  5AKZ A;  4NLG A;  4KX3 A;  2JZZ A;  1T94 A;  2M19 A;  2R61 A;  4EYI B;  4EEY A;  2KDE B;  2LEK A;  3R2I A;  4NAW B;  2HBM A;  2KHQ A;  1V80 A;  2ZW1 A;  4PT5 A;  3UI3 A;  1VDV A;  2YB1 A;  3IM1 A;  1PK3 A;  2UVV A;  3Q8M A;  2PFO A;  4KGT A;  2KNJ A;  2OYY A;  1YJI A;  3LWM A;  2BPS A;  3N32 A;  1QQR A;  2JGA A;  2XEW A;  3M8S A;  3EFC A;  2F44 A;  2RD0 A;  5FR6 A;  3D2N A;  1V86 A;  2BHN A;  4K4G A;  4M6W A;  4KVG B;  2GBM A;  3I63 C;  5D46 A;  4YXJ A;  3WIM A;  4LLG M;  2BKE A;  2Y9U A;  3M6Z A;  1XEE A;  3DBL B;  3KUD B;  3B0Y A;  2AWT A;  3RB3 A;  1L7P A;  2AXT U;  3RJH A;  4ECT A;  2BDP A;  1J0G A;  4EEW A;  2OOB B;  2UVU A;  1WGH A;  1Z3E B;  3BQT A;  3IN5 A;  1CI4 A;  1MHX A;  4UAR A;  2KO3 A;  3MR5 A;  1V9J A;  2KN5 A;  3KKA C;  2MEK A;  4W9H A;  3AU5 A;  2MA1 A;  3EW9 A;  2ZCB A;  3IT4 B;  4E71 A;  4X5V A;  2N4F A;  5J2H A;  2V9H A;  4LNO A;  4TUS A;  4OCZ A;  1ZXI A;  1SJH D;  4P1C C;  3ZD9 A;  4DHZ E;  4UB5 A;  3NS8 A;  5MPO A;  1YZ6 A;  1A0P A;  4OJ6 A;  2ZW0 A;  3HVD A;  3L13 A;  3EWA A;  3RAQ A;  2MQJ A;  1Q46 A;  4YTN B;  3FAH A;  3H1U A;  2C9W B;  1RAX A;  1WMH A;  1MHH E;  4LK0 M;  3CSF A;  2DKZ A;  2BQQ A;  2CKH B;  2XY7 A;  2KK0 A;  2FCN A;  2HD5 B;  2FAZ A;  1F0Z A;  2P35 A;  3SD5 A;  4JB3 A;  1RZT A;  1KFT A;  1J7A A;  3AMZ A;  2X8X X;  3I57 A;  4GXB A;  2V0G A;  2F77 X;  2ATL A;  2LFI A;  2ICI A;  4FS2 A;  3JPN A;  3V6H A;  1F2R C;  3ZYY X;  4ANU A;  3V7J A;  1ARO P;  2UVW A;  5DDM A;  4I2B A;  1V97 A;  4U6P A;  5KG0 A;  4KN7 A;  3H0M B;  1X42 A;  1V1P A;  3MGH A;  3TAD C;  3SAF A;  2VA3 A;  2LM4 A;  2HOQ A;  5KG3 A;  5DLF A;  4DQI A;  5KTQ A;  5DGB A;  1VZ8 A;  4PK1 A;  2AL6 A;  1U49 A;  4DWF A;  2KDB A;  4HEA 1;  4C7Y A;  2C2E A;  1OW5 A;  1ZQG A;  1QOB A;  2KKP A;  3T3O A;  1ROE A;  5DBA A;  4DWI A;  4ZHP A;  2RR9 A;  4JLC A;  2AGP A;  3TEW A;  3DBR I;  3DBL I;  1YT3 A;  4DSF A;  5IAA C;  4GC6 A;  4ZYS A;  3N28 A;  2J6T A;  4XWW A;  2EH9 A;  2KMA A;  2WF7 A;  4GDK A;  4UQG A;  5JXV A;  5JU5 A;  2PIA A;  1NK9 A;  4J9S A;  4BBN C;  2BQU A;  5AEK B;  3PSF A;  1BVS A;  2DEN B;  5DLG A;  2WXO A;  1HUO A;  2REX A;  1WX8 A;  3SQI A;  1HEZ E;  3ICX A;  1IG6 A;  2Y5P A;  4F8R A;  2XGP A;  5AM5 A;  4KLH A;  2H3Z A;  2WAQ F;  2ZXI A;  4ECX A;  5J29 A;  2INN E;  4RF0 A;  8ICY A;  2Z0D B;  4JV1 A;  1L3U A;  1E7U A;  4EX6 A;  2N1V A;  2OM6 A;  3L54 A;  5KFY A;  4C4R A;  4UB4 A;  9ICE A;  2L1A A;  3DHH C;  2MBO A;  5KFC A;  2AQ0 A;  1TZO A;  3WCQ A;  3QWZ B;  3Q8S B;  3Q3M C;  2WF5 A;  4IW0 A;  2NPT B;  2JXJ A;  2Y5B B;  3MJW A;  2GOL A;  2I9G A;  5HHI A;  5JUM A;  3RJJ A;  5HHD G;  5KL8 B;  1XSN A;  2R8K A;  4YMM A;  2IGG A;  2AL3 A;  4F93 B;  1ZOY B;  2MBB B;  4HDQ A;  4DEZ A;  4LNI A;  2DL0 A;  5G5G A;  3RR8 A;  2EZX A;  1ET6 A;  2WQY B;  3C5G A;  2IA6 A;  3NHE B;  4URK A;  4MGI E;  5ALR A;  1WZ3 A;  1GO3 F;  2IDY A;  1FMA D;  1YN3 A;  4MFC A;  1XT9 B;  1SWW A;  2ASD A;  5KG2 A;  2W9M A;  3E9S A;  4P16 A;  1ZW7 A;  3C23 A;  2BZF A;  2KMC A;  4BKT A;  9ICT A;  4WJQ A;  3PML A;  5J0W A;  4GLS C;  1U47 A;  1X40 A;  3UPQ A;  2AQ3 B;  2KWC A;  3JVZ X;  1VJK A;  5G5H A;  1TK0 A;  1EWY C;  2X38 A;  1N5W A;  2MJE A;  5HMM A;  1N5X A;  2Y1J A;  1R4N I;  2UYZ B;  2ZCC A;  3RNB C;  4UAY A;  2LKY A;  3Q3N C;  1J2M A;  5J0P A;  2MUT B;  2ASQ A;  4OVV A;  3HVZ A;  4RM9 A;  2BQ3 A;  1F2R I;  1S9F A;  2NO5 A;  1VJ5 A;  3PS6 A;  5IIN A;  2W82 A;  2KEY A;  1IP9 A;  2ON8 A;  5CHF A;  3JPS A;  4CNQ A;  1FNV A;  3BYT B;  3N1Z C;  1M94 A;  1F44 A;  1OEY A;  1ZQE A;  2JYT A;  4NQK E;  3W2D A;  3QX1 A;  1R4N B;  4KIT B;  2K9X A;  3V6E B;  3WU2 U;  4TSS A;  1IM4 A;  3PZD A;  4M01 A;  4B9T A;  5CA7 A;  3ML8 A;  2LRW A;  4YSY B;  2KAC A;  4HPL B;  4KSK C;  4YXM A;  1S5L U;  2DWQ A;  1JI7 A;  3PRE A;  4KTQ A;  2HHQ A;  2DX5 B;  5KFJ A;  2KMD A;  3Q6B A;  2VZK B;  3FKY A;  4A8X C;  3C2K A;  1I4R A;  1WGY A; 
#chains in the Genus database with same CATH homology
 1JCK B;  4KX6 B;  1VZ6 A;  4L1B A;  4TQ1 A;  4JX1 C;  1VLB A;  3TEZ A;  1WGK A;  2ONQ A;  1JML A;  5BYR A;  2NTT A;  2QIE B;  1RWS A;  1ZDV A;  1IUE A;  4YWG G;  3P4Q B;  2BS2 B;  3MHZ A;  1SE4 A;  4DQO C;  2M0A A;  1B1Z A;  1TS2 A;  2HDE A;  3W5V B;  5I4D A;  1ZP0 B;  3U7Z A;  3PZ8 A;  2V4I B;  1NYR A;  2JQR B;  3NVZ A;  2KMM A;  3AEE B;  1CZP A;  4YTM B;  2IPK D;  1JQ4 A;  1ACC A;  3P4R B;  4C80 A;  1QT9 A;  2G1E A;  3AE6 B;  1SE3 A;  1GB4 A;  1T6B X;  1TS4 A;  3TEX A;  4OW0 A;  3Q69 A;  2DBY A;  2KWD A;  3NVY A;  5C3J B;  1GAQ B;  2LMC A;  4YXD B;  4JE3 B;  2LHE A;  5FKA C;  5FK9 C;  2GI9 A;  1MPE A;  1D5X C;  2PTL A;  1IBX B;  3MJ5 A;  1T3Q A;  1NEN B;  1XXG A;  3VRA B;  4JPS A;  1V1O A;  2WXK A;  1FD6 A;  4OZC A;  2JWU A;  1SJE D;  3AEA B;  3AE2 B;  3IT6 B;  2WXL A;  1JWM D;  1L4D B;  4R3D A;  3P42 A;  4OVZ A;  2M56 B;  2GB1 A;  4N59 A;  1MI0 A;  1D6E C;  1L0Y B;  3PO0 A;  3BII D;  3B2G A;  4GDL B;  1YN4 A;  1WXQ A;  1C9F A;  5H92 C;  2JSV X;  2V3N A;  5D7G A;  4XE0 A;  1MVK A;  3AV8 A;  4ZRP A;  1QOG A;  2BB6 A;  4YT0 B;  1C76 A;  2BT6 A;  1V1P B;  1RFK A;  1TKE A;  1UWX A;  2WP9 B;  1EM7 A;  1LO5 D;  3I9V 1;  4L23 A;  4RNA A;  4AQ7 A;  1D5Z C;  5HFY A;  3BWU D;  3IAS 1;  2BYT A;  1QIL A;  1TS3 A;  1KLU D;  2J4X A;  2WDV B;  1PGA A;  4HKZ E;  2QMT A;  1YMH E;  1P7F A;  1GOZ A;  1KLG D;  4KKI A;  2RPV A;  4KGR A;  1DOY A;  4N6E B;  1FCL A;  3FIL B;  1YQ3 B;  2BS3 B;  2G9H D;  1D5M C;  4IOI E;  3AM9 A;  1B9R A;  1VRA B;  2JU6 X;  4YTP B;  5HI1 A;  2CJN A;  2WLB A;  2LHD A;  1HXY D;  1SSN A;  2MH7 A;  5EE3 A;  2N7J A;  3OWE B;  3KQ4 A;  1TYG B;  5T8I A;  1NEK B;  1ENF A;  4RF1 A;  1KF6 B;  1I7H A;  2BW2 A;  3KLS X;  1XLP A;  1TY2 A;  2WXQ A;  4GDK B;  1E6E B;  1XLO A;  3ETR A;  2V3P A;  2B76 B;  2WXI A;  3AE8 B;  1FXA A;  1FO4 A;  4MM3 B;  2WXF A;  1NI3 A;  2DLB A;  2JYE A;  4IDI A;  3URY A;  2WXR A;  4ITK A;  3VQI A;  1SF0 A;  4L2Y A;  4RGM A;  1DYQ A;  5EE0 A;  3NS1 A;  3AEB B;  5E6J A;  4Q2J A;  1K50 A;  2VZK D;  3GB1 A;  1QLB B;  2KAJ A;  5BYS A;  1UGJ A;  1TJE A;  4RGO S;  1K51 A;  1JWB D;  3GS2 A;  4RH6 A;  2WXP A;  3R8B A;  2AX5 A;  3SFE B;  2SAK A;  3N9Y C;  2Y3A A;  1SIJ A;  3RFZ B;  2NMQ A;  1JWS D;  1QOF A;  4OHJ A;  3AE3 B;  1RYJ A;  1CJE A;  1HQR D;  2BTE A;  3W5U B;  1BML C;  4IKG A;  1WRI A;  4KGS A;  1I4Q A;  3L4P A;  3V05 A;  3GP7 A;  1FEH A;  1QF6 A;  3FIL A;  4WWM A;  1FFU A;  3AEG B;  1SE2 A;  1I4X A;  1FNW A;  4FXC A;  1BUI C;  1L0V B;  3U52 E;  4NAM A;  3VR8 B;  2QSD A;  1I4G A;  2W3S A;  1JRP A;  1L6V A;  2PMV A;  3MP9 A;  2WXG A;  3LYY A;  1V8C A;  1DGJ A;  1FIQ A;  2Q5W D;  2N0S B;  4M0W A;  4KKJ A;  1J7C A;  4YSZ B;  3EUB 2;  1HZ5 A;  4UDU C;  4ARC A;  4ARI A;  2YEP F;  4H2A A;  5C2T B;  3U2S C;  4WIP A;  3AB5 A;  2I38 A;  1PGX A;  4HKQ A;  3BVG A;  1L0X B;  1DOX A;  2KN4 A;  3AEC B;  1AW7 A;  3AE4 B;  3BVZ A;  3VR9 B;  2W54 A;  1Q10 A;  1N63 A;  4DXF A;  3NZ3 A;  2LUM A;  4WQM A;  1TS5 A;  2Z8L A;  2RDH A;  3PZ7 A;  1Y56 A;  3O13 A;  3Q8E A;  1FRD A;  4MT5 A;  3TEY A;  3IXS A;  4ZHO A;  1I4H A;  5D3I B;  1ZDX A;  2IJ0 A;  2MJ3 A;  3CWI A;  1T5X D;  5BMG A;  3C8Y A;  1RM6 C;  1PFD A;  5D3D A;  4ZRQ A;  1N62 A;  5EE1 A;  3ZGZ A;  1E10 A;  2BS4 B;  2J53 A;  2WU5 B;  1ZUD 2;  1XLQ A;  3P4S B;  2RDG A;  2LGI A;  2YEP B;  4HRO A;  4RCO A;  4XWT A;  4B0M A;  2MJD A;  1NYQ A;  4OZA A;  1WYG A;  5H8Y E;  3J9C A;  1JRO A;  1JWU D;  3ABV B;  2BBC A;  3AE5 B;  1R7S A;  4OZB A;  3BYY B;  4REZ A;  4AS1 A;  4HRS A;  2HTM E;  2WS3 B;  1A70 A;  3B2F A;  4JWU C;  2N9L A;  4DXG A;  4J3O D;  1FXI A;  2PVG C;  1YNT E;  2W55 A;  3AH7 A;  2M19 A;  2R61 A;  1C79 A;  1DOI A;  1XCT L;  2LEK A;  2K5P A;  2ZW1 A;  3R2I A;  4NAW B;  4NJC A;  4PT5 A;  3UI3 A;  5AUI A;  2AQ2 B;  2CU3 A;  1VDV A;  1XCQ L;  3Q8A A;  1OQQ A;  3KWV A;  2W3R A;  3AE7 B;  4B0E A;  5BMI A;  2PKO A;  2RMM A;  4KGT A;  1JWA D;  1XLN A;  1YJI A;  1D4B A;  1QQR A;  1NVI D;  1HZ6 A;  2GRI A;  3HUI A;  2WXN A;  4TQ0 A;  1GB1 A;  1L4Z B;  1C4P A;  1UNS A;  4LLG M;  1JAL A;  2H88 B;  4D2K A;  1XEE A;  3CIR B;  1GPX A;  3SR6 A;  3B9J A;  1CK1 A;  1PUT A;  3LB8 C;  3FC4 A;  2FBW B;  2INP E;  4O1N A;  3NVW A;  1I4P A;  1MHX A;  1PDX A;  4A55 A;  1XO3 A;  3ZQ4 A;  1EWC A;  2Y5C A;  1P7E A;  2MEK A;  2OHF A;  2FUG 1;  1N60 A;  3AED B;  3IAM 1;  1AN8 A;  3AE1 B;  2DYO A;  3IT4 B;  4EE2 A;  1SJH D;  1ZXI A;  5MPO A;  3BVM A;  5FR3 A;  1QKZ A;  1VZ7 A;  2JX5 A;  4WH4 A;  3VRB B;  2ZW0 A;  3HVD A;  1K52 A;  2ACZ B;  2IGD A;  3KWL A;  5HG2 A;  1CQV A;  2WDR B;  1SBB B;  4YTN B;  3FAH A;  1SXT A;  1MHH E;  4LK0 M;  1FRR A;  3TSS A;  3BK2 A;  2K0P A;  3T3N A;  1YN5 A;  1K53 A;  1IBX A;  3Q8C A;  2PLP A;  1WSP A;  2WXH A;  2BB5 A;  1F0Z A;  1FM0 D;  1J7A A;  2V0G A;  3I57 A;  4C7Z A;  3AMZ A;  3HRD D;  3AEF B;  2LFI A;  4US8 A;  1KRH A;  3MC0 B;  2ICI A;  3ZYY X;  1F2R C;  3MFG A;  2AQ1 B;  1V97 A;  3P1M A;  3P63 A;  1OFF A;  1ET9 A;  1FNU A;  1V1P A;  2QIL A;  2TSS A;  4MH8 A;  2PVO D;  2LJI A;  2SEB D;  1C4C A;  1FCC C;  3W9C B;  3ZJT A;  2I2Y A;  2J42 A;  1FFV A;  1VZ8 A;  3AN1 A;  1VR9 A;  1XF5 L;  3SEB A;  2KDM A;  4HEA 1;  4C7Y A;  1ZE3 D;  4A6Q A;  1QOB A;  3T3O A;  1E7P B;  1ROE A;  1SEB D;  1L5P A;  2CJO A;  2EEL A;  4ZHP A;  2H89 B;  3TEW A;  1SB3 C;  2E6X A;  3AE9 B;  2J52 A;  1M4V A;  4ZYS A;  4CQN A;  2XN9 C;  5BYQ A;  4XWW A;  1AWD A;  3H8H A;  5JXV A;  2PIA A;  2WNM A;  4LTU A;  1IGD A;  2WXO A;  2QJL A;  1HEZ E;  5LNK 1;  2Y5P A;  3U4E G;  1N61 A;  1UWM A;  4NZL B;  3ZJV A;  3EGR A;  2INN E;  4RF0 A;  2XNA C;  2IGH A;  3NRZ A;  1TY0 A;  2L1A A;  1TKY A;  3V3X A;  4RGT A;  1C77 A;  3LXF A;  4USA A;  1JW9 D;  1TZO A;  3WCQ A;  1PGB A;  2OED A;  3P4P B;  2JZP A;  4WUR A;  4WAF A;  2N9K A;  2QEJ C;  2WXJ A;  5HHD G;  4ZOH C;  2IGG A;  2PW9 A;  1ZOY B;  2WDQ B;  4XDD A;  1E9M A;  5BMH A;  5G5G A;  2L32 A;  3DWG C;  3SFD B;  2FE8 A;  1ET6 A;  2EKI A;  2WQY B;  4TMA B;  3NUH B;  1KFY B;  4RGN A;  1ZXH A;  4A9A A;  3ZJU A;  2DYM A;  2IDY A;  4MAC A;  1FMA D;  1YN3 A;  5GXG B;  3W1S A;  1PYW D;  4XDC A;  3BZD B;  1TKG A;  3E9S A;  3RPF C;  4P16 A;  1F77 A;  1YQ4 B;  3R2T A;  4GLS C;  3BK1 A;  4C56 C;  1OQR A;  5EE9 A;  2AQ3 B;  1ZPS A;  2E3T A;  1EU3 A;  1VJK A;  5G5H A;  1EWY C;  1YJJ A;  1N5W A;  2X38 A;  2MJE A;  2L52 A;  1STE A;  1J7B A;  2D5G A;  4RFB A;  1UUP A;  4YSX B;  1N5X A;  1BXT A;  2WU2 B;  3HVZ A;  1F2R I;  4A90 A;  1KH0 A;  4N58 A;  4US9 A;  2W82 A;  1L6U A;  2ON8 A;  1QOA A;  1FNV A;  2L83 A;  3BYT B;  4JWS C;  3EA6 A;  3E56 A;  2JYT A;  3W2D A;  1C4A A;  2K9X A;  4HJG E;  1HA5 A;  1E0Z A;  5TSS A;  3TUO A;  4TSS A;  1ESF A;  3Q8B A;  5AUK A;  2K22 A;  2KQ4 X;  3Q8F A;  1C78 A;  1KTK A;  1WWT A;  2JXT A;  1EU4 A;  3DWM A;  4YSY B;  2KAC A;  1IGC A;  2DWQ A;  4P6V F;  1AYF A;  2NTS A;  2VZK B;  2WXM A;  4A8X C;  2K3U A;  3NVV A;  1I4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...