1FIQA

Crystal structure of xanthine oxidase from bovine milk
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of bovine milk xanthine dehydrogenase and xanthine oxidase: structure-based mechanism of conversion.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords XANTHINE OXIDASE
total genus 39
structure length 164
sequence length 164
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1fiqA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fiqA01
1E10A 1YJIA 1L6UA 5G5GA 1RM6C 1FXAA 3P1MA 3VRAB 1RWSA 2BS2B 3B2FA 4YTMB 3NRZA 2WLBA 4KX6B 3AEBB 1IUEA 1L5PA 1ZUD2 2KAJA 1GPXA 2W55A 1KF6B 1JQ4A 1OQQA 3NVYA 2OHFA 1J7CA 1N5WA 2HTME 3AE4B 3AECB 3RPFC 1RFKA 1T3QA 1EWYC 1JW9D 1FIQA 4HRSA 5EE9A 1NEKB 1YJJA 2W3SA 3AEFB 3AM9A 1SF0A 1FRDA 2L52A 1TKYA 1WYGA 1L6VA 1WRIA 2JQRB 3B9JA 2AX5A 2N0SB 2PVGC 1J7BA 2CU3A 2WS3B 1FFVA 3HVZA 2K22A 2MJ3A 2K9XA 3P4PB 5C2TB 4LTUA 1F0ZA 4YSZB 1VDVA 3KWLA 1L0VB 3ZYYX 4YSXB 5MPOA 1WXQA 3AE1B 1E0ZA 2PVOD 4P6VF 1R7SA 3AEAB 1KFYB 3AE5B 1QOAA 3P4SB 1V97A 2DWQA 1FFUA 2QIEB 2WDQB 3AE6B 2CJOA 1YQ3B 3AE3B 3AE2B 4HROA 4YTPB 5H92C 3B2GA 1FMAD 2K5PA 1DGJA 2M56B 1QLBB 1QT9A 1NYQA 1DOXA 2WP9B 1NENB 1XO3A 2Y5CA 3BIID 3SFDB 3AE7B 1JROA 4JWUC 2W54A 1VJKA 1FRRA 2H88B 2L83A 2MJEA 5GXGB 4ZHOA 3AEEB 1QOGA 1N61A 2BS4B 1A70A 3P63A 4C80A 2JX5A 3WCQA 3VR8B 2B76B 3L4PA 1TYGB 3AB5A 1PFDA 1PDXA 3VR9B 1FM0D 1PUTA 2WU2B 2PKOA 3W5VB 4WWMA 5C3JB 1KRHA 1NYRA 2WQYB 1JALA 1OFFA 1V8CA 1YQ4B 2FBWB 3AEDB 3LXFA 3AV8A 3NS1A 1J7AA 1XLNA 3AE8B 3SR6A 1NI3A 2H89B 1WWTA 1N60A 2Q5WD 2WDVB 3DWMA 4WQMA 1B9RA 1DOYA 5EE3A 3W9CB 1SIJA 4US8A 2DBYA 2M19A 4YT0B 3P4QB 3SFEB 4N59A 5AUKA 1OQRA 2WU5B 3NVZA 4YTNB 3ABVB 1N63A 1VLBA 3FAHA 3ETRA 4YXDB 3PO0A 3AN1A 3W5UB 1JWAD 4IDIA 1E7PB 1SB3C 1AYFA 4ITKA 3HUIA 1E9MA 4C7YA 2BT6A 4US9A 2CJNA 1XLPA 2E3TA 1TKEA 2BS3B 3CIRB 3HRDD 1N62A 5H8YE 1TJEA 2KMMA 3NVVA 2WDRB 1QF6A 3AEGB 1ZXIA 4YSYB 1UWMA 3FC4A 4A9AA 3LB8C 3NVWA 2PIAA 5AUIA 1ZOYB 1FO4A 4JWSC 4ZHPA 2MJDA 1DOIA 1GAQB 1JRPA 1XLOA 3VRBB 3AMZA 2G1EA 5EE1A 1FXIA 1E6EB 4N58A 1AWDA 1ROEA 4JX1C 2W3RA 4N6EB 1WGKA 1XLQA 1TKGA 5G5HA 2LEKA 5EE0A 1QOBA 1CJEA 1JWBD 4USAA 1NVID 3P4RB 1ZP0B 4ZOHC 4C7ZA 1QOFA 3AE9B 3CWIA 1I7HA 1CZPA 3AH7A 3DWGC 2QJLA 2EKIA 4FXCA 1RYJA 1N5XA 3EUB2 2MH7A 2ACZB
chains in the Genus database with same CATH superfamily
1R4NI 1ZQQA 2CN1A 1L6UA 5KAIU 4FBTA 4K4IA 4QJFB 3UINB 1H8CA 2PMVA 3V3XA 1L5UA 4KKJA 1TZ1A 2G06A 4PPXA 5L95C 5F9NA 5L1IA 2OJRA 2QEJC 3M7DA 2K39A 2OXOA 3AE4B 3RPFC 4IQUA 3DHIC 3SI8A 2ZJDA 1XCQL 3VCBA 5KT4A 3EFUA 1SL2A 5GTIU 3BJYA 5IINA 1QSSA 4KLSA 2BYEA 3IXSA 5HHIA 1ZQCA 3V7LA 3GFKB 4GDKB 3Q8AA 2LGIA 3KW5B 4FA6A 3PZ7A 1S8OA 3OGUA 3OWEB 3QUCA 1RRBA 3BWUD 5DLGA 3ZJTA 4RMAA 3TAQA 4J9OA 4PJ0U 3OSPA 2KTQA 5EWFA 4RCOA 5KL8B 2MBQA 7ICEA 2FLNA 2WDQB 4BKSA 4PT5A 5H92C 4DXGA 4HPLB 2W03A 4DSLA 2J7QB 2Y5CA 3SAGA 5LXIB 1RQLA 4F8CB 1TFRA 5KT5A 4EZKA 5FP0A 3M95A 4BBNF 1Z1VA 4EUTA 5KFOA 2MRLA 1UPHA 2WB1C 3RNEC 4QZCA 3QQ8B 7ICFA 2WXQA 3Q3MC 2KACA 4Q43A 5J2IA 2M0AA 4BZAA 2LGDA 3Q3OC 4M9NA 2KD1A 4XQ8A 4ECTA 2M8SA 4RQ8A 4LNKA 4IM0A 4ED0A 8ICZA 5ALFA 4LDTD 3NUHB 2ZPNA 3PW7A 3GIJA 5AUKA 2C7HA 4ECSA 4DHJD 4DEZA 2WXIA 1KW4A 2H3FA 4F5OA 4J9NA 3CMMB 2YTUA 1XSNA 2ICIA 1L3SA 3KYDD 2RPQA 5KT6A 4Q8FA 1E8YA 3NOBA 3BVGA 4C7YA 2I6XA 7ICOA 2BS3B 1SE2A 2I1KA 3DBLB 2D3DA 2KMDA 1TJEA 3NY5A 3NVVA 5AM3A 1QF6A 4LNIA 1RQNA 4A9AA 2AEHA 1ZQBA 3HM3A 1JWUD 3LB8C 1Q8KA 5KG4A 5HR7A 5KFRA 4KX5A 1ZGUB 4JWSC 4HLEA 3C21A 3ZRFA 3QU2A 2YY6A 3I5JC 1M94A 4KLGA 1E6EB 4CRXA 1FXIA 2WXLA 4II3B 3EC8A 1XLQA 2LPEA 2UVUA 4ICUA 1ZQJA 4DO9A 4A3OA 2BGWA 9ICXA 4NLNA 2BS4B 4NLBA 2K1FA 4R65A 3MR5A 4UB3A 1V49A 4RPXA 2IA6A 5ALPA 5ALXA 4II2B 3JSVA 3RZWC 4AP4C 1U45A 1C4AA 3K1ZA 5GTHU 5B66U 2QC8A 4P1CC 2KAJA 2AJQA 4GU2A 1Q0WB 3A9KB 2EQYA 1QSLA 1JXEA 1KKXA 2RLTA 4ECUA 2AL3A 2EDUA 2HI0A 1QLNA 3RB3A 2ASLA 5AIBA 1MHHE 4NAWA 1P98A 2BTEA 2H3QA 3M63B 1M4VA 2MSNA 3VUWA 3ZI4A 1SZHA 2K8CB 4HYKA 2RDHA 2G0AA 1WGDA 4K7UA 3MHSD 3DQVA 4XX5A 4O3PA 4NWIA 4TQSA 4TQRA 3RB6A 4GMVA 1NK9A 2BDPA 3Q69A 1NJXA 1V1PB 3MGIA 4EEKA 8ICWA 1I4HA 5G55A 3C2KA 3ZD9A 4YTPB 5J0SA 3AE3B 4Y2XA 3AE2B 2XI9A 2YMLA 1MG8A 4DS5A 3WAPA 5KFXA 2LUMA 4RQ5A 4NJCA 4UAUA 2FMQA 1NI2A 1NK7A 4EYHB 3UXNA 4J9RA 2D3AA 2BCUA 2BZFA 2G5HB 1KBUA 5CHWA 4ZHOA 1RYRA 2QMTA 1X2IA 4YR0A 2SEBD 4F71A 2ZIUA 2B76B 1TYGB 2HOFA 2FI1A 1PDXA 1ZQPA 2PW9A 2KSOA 3D2QA 5DBAA 2MSED 5KG6A 1URJA 1ZQMA 4PGYA 2PXIA 3AEDB 2OOBB 3SAFA 2BPCA 1NK4A 5CA7A 4WJ3B 2B6GA 3V05A 4QWBA 2IHMA 5FKAC 1KQQA 4QZAA 2CS4A 3RNBC 3TEXA 4BKGA 4KLUA 3QJZA 2K25A 8ICNA 2KV2A 3L16A 3RULA 3KZXA 1VLBA 4EELA 5L1JA 2MUTA 3AN1A 2KOXA 1TS3A 2LHTA 4ECWA 5L9XA 1T3NA 2MBOA 2VANA 3CIRB 3HRDD 1N62A 1QTMA 2KJRA 8ICLA 3BQ1A 5LNK1 3JPNA 2K8HA 2WDRB 1QQ5A 3AL0B 3D32A 2Y1JA 1SKRA 3BS5B 2NVUI 4W9FA 5AKKA 2KHVA 2BCSA 1E90A 2LI6A 5BO4B 1L7YA 4Q2JA 3ONNA 4DFMA 3HKZF 3GIMA 5AM2A 1WJ6A 2NPTB 2V9WA 2N9EB 4EE2A 1CJEA 2M9NA 7ICTA 2IGGA 4C7ZA 4OJPA 3AE9B 1ZD5A 4BVUC 1E8XA 1T0SC 1I42A 2RDGA 3ZDCA 2JMGA 1WX7A 3QC8B 2R8GA 2ACZB 2LASA 3QXGA 3Q8MA 1E10A 1D8LA 4OJOA 3RH6A 1YJIA 2DYOA 5AZFA 3QARA 4B9KA 2J6UA 2L32A 3MDAA 9ICNA 5AZGA 2HOIA 3V6CB 5AZHA 3QUQA 1I4RA 1MN8A 4F4KA 1CI4A 2GBKA 2HDOA 4IM2A 5FR3A 4FZLA 1PZNA 1UQVA 4NY8A 1C76A 1SJHD 1OXJA 1RLFA 3L54A 4FLHA 1F44A 7ICPA 4WWOA 3THVA 4NQLB 3SU8X 3BINA 4DL7A 1QQ6A 3JPPA 2J42A 4DHZB 3H4DA 2FPKA 3WK6A 1A77A 3F2BA 1C4PA 2DNFA 4WJNA 3APFA 5HFYA 3T3OA 3B9JA 4DF8A 3F53A 1FFVA 2MJ3A 1P7DA 1C7YA 2K9XA 7ICIA 3ZTCA 3H7IA 2O6KA 4U7CA 2FNJB 5KHOA 4BAXA 5AKEA 2LFIA 1YN4A 5BMIA 2LGYA 3V60A 4ZRPA 3O13A 3N7RC 5ALRA 4FZMA 4AWJA 1LXDA 2PLPA 2WTFA 1Z4NA 3N7PD 1AN8A 2BKRB 2F1HA 2C7NB 3GIIA 2JYEA 2XNAC 2ZUCA 3IM1A 3A1QB 3TIXA 3ZNZB 2ASQA 4WJPA 3KHHA 8ICQA 4UAZA 1WE6A 2ZIUB 3NASA 3PHWB 1UHUA 2LJ5A 4DBGA 3RFAA 3PPAA 2J0JA 3GP7A 5E79U 2W7OA 2K8AA 4HAIA 2L83A 3J9CA 2W8LA 8ICPA 1N61A 2KQSA 1IBXA 3VR8B 4YD2A 2Y0SC 4B9LA 3WK5A 2WFAA 2DQNB 3TEWA 3PVXA 5CR0A 4RGMA 3NJTA 5AEKB 3SYZA 5TSSA 1T8EA 2IGDA 2F1IA 3SZ2A 1IBXB 4R3DA 4F5PA 2BPGA 1IPGA 1X1MA 5D3IB 2LVPA 1N60A 4MEMA 1ZQYA 1SZPA 1DOYA 5ALHA 4ED6A 3DHHC 3E9SA 2GBNA 4US8A 3SHQA 4DXFA 4YD1A 2IY0B 4F4WA 3A33B 2B21A 4LZDA 2XCPA 2JXXA 3JVZX 4IKGA 5EOZA 4UARA 2WXRA 4F93B 2G07A 1C4CA 4QZ8A 3NUQA 2D3BA 4BGDA 4IS7A 2XIDA 3ZW3A 2LZ6A 3ALBA 1KLGD 2E1FA 4RQNA 1ZETA 1UGMA 4NY0A 2KICA 1E8WA 2PFNA 4GFJA 3QA8A 4DFDA 3TMPB 1B22A 1ZQAA 2KT7A 2FUG1 3EECA 2W9AA 3NVWA 1Z00B 4GGQA 1BPXA 1MG4A 4ZHPA 1L3TA 4MH8A 1NK8A 4CDGA 5J8YC 2BW2A 2INPE 1B0XA 5J2JA 2N9XA 2L0FA 4D2KA 1EXNA 1LFDA 4N58A 3TADA 4DLEA 4NJ7A 2XVTA 3TJPA 2ON8A 4YQWA 1BMLC 2LD9A 4USAA 4CF4A 5KFMA 3AH7A 5J0WA 3L17A 2AHOB 1QH9A 2F3NA 2NRZA 4UB5A 5DG8A 3KUDB 4BKTA 4O3NA 3KUZA 4GIVA 3NGDA 3VUYA 2N1RA 1TGZB 1YIWA 2BF8B 5IA7A 4FHKA 3HM6X 3M8RA 4HDOA 2RD0A 5L1KA 3H0LB 7ICJA 2INDC 1Y88A 4JMUA 3APCA 3RT3B 1L8LA 3PV8A 3B0XA 2QARA 1L7MA 2WX0A 3N1ZC 3ORYA 2KYWA 4IWOA 5HHHA 3QK0A 4M6WB 2IZVB 4J03A 2JZPA 1T3QA 4J9MA 1TV9A 4PYZA 1A6SA 1SF0A 1V5TA 3BZKA 3PNCA 2KK8A 5TZVA 1ZQ1C 1XSPA 1WG8A 1ZQZA 1SE9A 3PLUA 1U49A 4F8RA 5ALMA 2K22A 4TMAB 1QSYA 3TL5A 4HEA1 4JLCA 1WXMA 5K4LA 5ALWA 2UVRA 3H8MA 1WSPA 1XCTL 5DKWA 3WKDA 5JXVA 2V3NA 5MPOA 1ZDVA 3OAWA 3PT2B 1T0YA 1K1QA 3DDHA 3GZNB 1EWCA 3ZIMA 3H7PA 5AKLA 2PFPA 4KN4A 2RDIA 5KFQA 2XO7A 1MQ3A 3AQEA 4WWPA 4EZLA 4YG2A 9ICMA 4BWMA 4ICAA 2IO2B 2JHDA 2IO0B 1S97A 2BQQA 1U4BA 2XK5A 3MP9A 3P63A 3N97B 2DZMA 1IP9A 4DL2A 5G2NA 2HVIA 3BZCA 2AGOA 4KLIA 2BCQA 1J8CA 2JSVX 1K52A 4X5VA 4KSKC 2EAPA 1ZJMA 4I29A 3C19A 3M6KA 3RFZB 4JB3A 2ZNVB 4OJ5A 1GJZA 5FR6A 4WQMA 5C23A 2R8JA 2JXJA 1MHXA 2NRXA 5J2FA 2IBKA 3SFEB 4S17A 4ECXA 1GOZA 2GOWA 2KTFA 5KFAA 1L3UA 2FPLA 4MACA 3Q8SB 4ARCA 3PO4A 5J17A 3FAHA 5BMGA 4WAFA 3LVVA 2PEAA 3OTQA 3ZNID 2K4PA 3RZFA 2RP5A 2RR9A 2J53A 4IG7B 2C9WB 4TUUA 1ZXIA 4YXJA 1FO4A 3HVDA 4KZ0A 2E6XA 3PZPA 3GE8C 1XLOA 3VRBB 1XNSA 1WZ3A 2ZJAA 3ZVVA 8ICYA 2GI9A 2JZBA 2HJ8A 5J0PA 3K1RB 1TK8A 1HTOA 2MBHA 1WWVA 3M3JA 4MF8A 5BYQA 3PMLA 4AYBF 4Q44A 1M6YA 3HW8A 3C29A 4B9MA 3RJGA 1CMXB 2NBUA 1ZQKA 3N7SC 8ICKA 2K6QA 2EAOA 1LGRA 3QWZB 4P2HA 5HR6A 1PK1B 4C56C 1FCCC 2HBKA 1RWSA 4FJZA 2KDEB 4KX6B 4GSWA 2PPHA 3U2SC 1IM4A 3RJEA 4Z6EA 1NK5A 2KKVA 3NVYA 2Y5PA 5J2DA 5T14A 3QU9A 3PGEA 5KT7A 1PYWD 2N1VA 4QZDA 1PGBA 1IXRA 2LBOA 5J0TA 1VCBA 3TBLD 1V9PA 5ALVA 1D3ZA 4O1NA 4Y2JA 3C8YA 2HHXA 1MSWD 2ZIVB 2LVQA 4P16A 5HP4A 4G9BA 5J2GA 2J6TA 4TUSA 4FBJB 3EPIA 3VVWB 1G6JA 2H3IA 3CRXA 4QWEA 1ED1A 2MHJA 1E0ZA 3HIZA 2KHQA 3TACB 4U6PA 1ZQLA 4IOIE 4ECQA 1HA5A 4MJSA 1IG6A 2BCRA 4RGNA 3AE6B 4MSQB 5T8IA 4HROA 3T5KA 2EELA 2AQ2B 9ICSA 1DOXA 3WK4A 5IIOA 2VJ5A 3EZ5A 3KFUF 1KLNA 3BQTA 1VJKA 2OJWA 2F76X 5KFVA 4HPMB 3TARA 3WANA 2WF7A 2HJ1A 1A70A 1WJUA 3WAOA 1YX6B 5KFWA 4C4VB 1S77D 3RAQA 8ICMA 3VR9B 3KH0A 1H38A 3WK8A 9ICWA 3SQIA 4B9NA 1Q1OA 5C5JA 3R66C 4RH6A 1JWMD 1V2YA 3ETLA 1XLNA 1SSNA 3QE9Y 2RDBC 4KGSA 3LYSA 5GMVA 1ZQWA 2ZIXB 3QNMA 3C2MA 5ALJA 4UDUC 4RNNA 1KL9A 2P6UA 1MI0A 2B3AA 4YTNB 4FJVB 2BQRA 4AJWA 5FK9C 1EF1A 5AI6A 2KFKB 4MGYE 3I1YA 3ETRA 3URYA 8ICXA 3UF8A 4C4TA 1UZXB 1AYFA 5BOLA 4M0AA 2N1WA 2KJ8A 4KITB 4DWIA 3DVGY 5D3DA 4IWQA 2R8IA 4IC7B 3IT6B 4K7WA 2KANA 1UBQA 2WF5A 2MUTB 1C3TA 2Z0EB 3ZQ4A 2G3QB 2G08A 3MR2A 2W9NA 2E8OA 1XWLA 5AHXA 2AGQA 2R61A 2ZTCA 4N6EB 4Y2UA 5DB6A 1WGKA 2LEKA 3ISBA 1NJZA 1WF9A 4PS7A 1QOBA 3W2DA 1ZYQA 4ZOHC 1CUKA 1CEZA 2WXMA 3R8BA 1ZKHA 2M4NA 1UD7A 3H1UA 1TKDA 2L7RA 1JN3A 1E5WA 2IPKD 2KJHB 3B1LX 3I28A 4A90A 2YMQA 4ZRQA 1BGXT 4I6PA 4ANWA 1KRPA 2ZXHA 1L7OA 2PFOA 3VQIA 2A19A 2X8XX 4MSMB 4YP3A 3NRZA 2M0NA 1WJ4A 5KFDA 2KSOB 2KDFB 2KC2A 5EWGA 2KDMA 5ALIA 3QAQA 3TEZA 1RPLA 1J0GA 1J2MA 4KLEA 4HRSA 1KSPA 3MABA 1C20A 2JUOA 4F5NA 3PX0A 3H40A 1J97A 2KWCA 4LVSA 1NOMA 1BPBA 5HG2A 1TKYA 2JQRB 1L6VA 4KIKB 5KFFA 4NPNA 2W9MA 2WF8A 1C78A 2RHFA 2W8KA 1IGDA 9ICHA 4QNLA 1WXQA 2PVOD 4RT3A 3E58A 4DL5A 1XT9B 3OHAA 3AE5B 1UT5A 2QIEB 1K5OA 4AUQC 2YB4A 4EX6A 4UASA 4RT2A 5ALYA 4RQ0A 3JPTA 3T9LA 1XO3A 2ATLA 3CW2C 4O0IA 2ZG6A 2XY7A 3H6NA 4EBDA 4TV3A 1K51A 3OJ4B 5DPWA 3WKAA 2FCMA 2ZUBA 3QCAA 2IOFA 1YQ4B 1V8CA 2WWZA 3AE8B 1O03A 1K53A 1F1HA 4FJYA 2AH5A 3AUOA 1ZQDA 2MCNB 2BQ3A 1KDHA 2XN9C 1CK1A 1KFDA 3W9CB 4P4MA 1RZTA 1MA7A 4WJOA 1XC9A 2XBBC 3Q8LA 3PR4A 2NCNA 3PRPB 4GXBA 3G6XA 4JIOU 2ZW0A 4P0QB 1V81A 4G50A 3LYYA 4O5CA 2WXNA 3X23A 7ICUA 4KSLC 4JGHB 1ZXHA 4AOFA 1XLPA 5IP4D 2W9BA 3R9KA 1UGJA 4RPYA 3PSFA 5H8YE 4IQWA 5DLFA 1EU3A 2EMSA 2TSSA 3JPSA 4ZYSA 4KN7A 5BYSA 4ED8A 2WGSA 3GZFA 3BYTB 4UAVA 8ICFA 2PI4A 5AM4A 1V9JA 2I2YA 1JUDA 5E6JA 3U30A 4MT5A 1WMHB 1KTKA 4F50A 4IWPA 4RQ6A 4IC9A 2CR5A 2V4IB 3NZ3A 3T3NA 8ICAA 1I7HA 4M6WA 1F77A 3RRHA 3O65B 7ICMA 5J2EA 2WXOA 3A0BU 1ZOLA 4AJYB 1X6IA 2FPMA 4DDGD 5DQGA 2VRRB 3RH4A 2JZ3B 2DENB 4TQ1A 2RDJA 2Q0ZX 4CCHA 1IUEA 1SE4A 3K75D 2LI5A 4PYUA 1GPXA 2W55A 2BQUA 1YOVB 2K8BA 2KDIA 2Z59B 4E71A 4AQ7A 4M9HA 2QLTA 2JH7A 2DF4B 5DB8A 2YMMA 3DPDA 3L08A 1SL1A 2KNBA 2V4LA 5JH5C 1WJNA 2CXYA 5KAFU 1ZQHA 2DL0A 4I2IA 4M9LA 3V6JA 2K8BB 1WX9A 2L05A 2V9HA 1LKYB 3U4EG 4EEYA 4DK5A 1WRIA 5KFHA 4RZRA 5C2TB 4KLMA 2HHVA 4PH5A 2RQ5A 3RB4A 3UGBB 4BOSC 3KLSX 1AROP 2V4RA 4W9IA 3IT4B 2KTRB 3MFIA 2YLMA 3UQBA 3IRUA 2JEFA 1R7SA 2JH1A 2OYYA 3MC9A 3QX7A 4M9JA 2DWQA 4RPZA 4IUMB 4ECRA 1JCKB 5DBBA 3Q8FA 3KQ4A 2LM4A 4J9QA 2NYVA 5CWRA 1ZQEA 2K5PA 4RUAA 1NENB 4L1BA 2K8CA 4DOAA 2GLSA 3U7DA 1SKWA 2WYQA 4AP9A 1GUAB 5IIKA 3VTVA 5AKGA 1OEYJ 2O6VA 5AK5A 3UQ0A 1C77A 2AQ1B 1C9FA 4RQ7A 2CHZA 7ICSA 4PGQA 2FBWB 4RF0A 1WH3A 2HW3A 4NLGA 2LYAA 1YNTE 2QB1A 4KDIC 5I4DA 1SE3A 2FMSA 7ICGA 3RTVA 4HWIB 4IW0A 1C79A 2EZYA 1TZOA 1L4DB 1D6EC 1LVHA 1AW7A 2JU6X 3NVZA 3VFKA 8ICUA 1WCLA 1KH0A 1N63A 2W9CA 2J6SA 2BVCA 2C22A 2NR2A 4K7SA 4J9LA 2RPVA 3T5LA 3RBEA 1SWVA 2ZTDA 1N56A 3I9V1 4PS3A 2C60A 2ASJA 2PTLA 4YXDB 1ZD3A 4IDIA 4NJ8A 2MQJA 3BVZA 5HMLA 4QWDA 3DBHB 4HJGE 1ZD2P 2E3TA 2V4QA 4IR9A 5HNKA 2AQ4A 4DSIA 1FCLA 2JT4B 5KG0A 2YB1A 2ZPYA 2HCFA 3PRZA 1R4NB 1UH6A 2WB1F 1ZJNA 5ALZA 4M47A 4J9PA 4HJKA 3RJKA 1AWDA 2GLEA 2WHEA 4KLTA 4NQKE 2JYTA 4LK0M 1WR1A 5JHBA 4IRKA 4PZOA 2CRXA 4GB9A 3B0YA 2D2QA 2DZKA 3AEVA 2EKIA 4FXCA 3R2TA 1JMSA 2AXTU 4L23A 3N4MB 1NDDA 3DVGX 1NKEA 2D6FC 3ZDBA 2DYBA 4F1SA 8ICRA 5EWEA 1IIPA 2R8KA 2OWOA 1HIWA 2BS2B 2P66A 5KG3A 2KK0A 4KMOB 3GV5B 2V1YA 3IDWA 3AEBB 2BYVE 5HMMA 5CJ7A 9ICVA 1TIFA 2ZNVC 1N5WA 2HTME 2NMQA 3M9OB 3A9JB 4P4OA 4A20A 3UI3A 2BBCA 3MJ5A 3NG0A 3TADC 1NEKB 4KLOA 4LJPB 4KLDA 2HMXA 4KV2A 3QU7A 2DHZA 4I2AA 1T6BX 2GBRA 1AQ6A 1PK1A 1WFYA 3ZTDA 3WU2U 1JX4A 2AWTA 4GOCA 2ZCBA 2N9PC 3KHRA 1V5OA 2ZTEA 1VJ5A 3VAWA 1SXDA 3AQFA 2DKXA 4MHVA 4Y2QA 4M0WB 3AU6A 4QIWC 4N9F4 4EEWA 1TAMA 5IIIA 3RN9C 1GB1A 2H3VA 3PW4A 1TVAA 1FFUA 5JTIA 4F4ZA 1QCKA 2Y3AA 4TUPA 4YMOA 1TK5A 2WP9B 1D4BA 3F5AA 2H88B 1PVQA 1FRRA 3C5FA 1HEKA 2IOFK 1TY2A 4PHAA 2DLBA 2JRIB 4ECVA 4EX7A 1I4GA 3IAS1 2KX3A 5AM0A 3Q8BA 4BWJA 4UB4A 4NZLB 1L0XB 4YN4A 3VH4B 1ZQUA 1XS9D 2BDUA 1ACCA 4JPSA 4BXOB 5GXGB 3VC8A 1OFFA 1MVKA 2ZZPB 2CHWA 2JRHA 2FIDA 4G3IA 4WH4A 4A8XC 4KGRA 1V86A 5CHVC 1VRAB 4DSEA 4YL8A 1D9FA 4M02A 1B9RA 1SIJA 2VA2A 2KFZA 4J3OD 4I2CA 2KE7A 4UBCA 1PQSA 5KFEA 2JZZA 5JRTA 4UB2A 4I2JA 2ZIXA 2OEDA 5ALNA 3A4RA 1WWUA 3PO0A 4KMUA 2VKQA 4QZEA 3RI7C 1WGYA 4ITKA 2L5YA 5DGBA 2MP2A 4ZRIA 4US9A 4MFFA 5D94A 4HK2A 3RF9A 4RQ1A 2HTHA 2G09A 4DL3A 1CRXA 4YMMA 3AEGB 5J8YA 2PI5A 4YSYB 3FC4A 1XU4A 2ASDA 2VA8A 4I28A 1V85A 5AUIA 4RU9A 1DOIA 2FLPA 3RAXA 2BPSA 1PGAA 1ZQIA 2YQEA 1WRDB 1X6JA 2J0KA 1JIHA 4W9GA 1K8RB 4JWNA 3VDZA 1TE2A 2D3CA 5EE0A 5DG9A 2DZIA 1ZQOA 2KN4A 1Y8RC 3JPRA 3TQ1A 4MJSB 3DOWA 3HHMA 3ZNHB 3B0AA 3MJWA 2WXJA 4KTQA 3E56A 1L2NA 4NL9C 1Y56A 3FM9A 2KFKA 2JR5A 2VH2A 4CGZA 5G5GA 3FYHA 3GILA 1YMHE 2KVSA 2BYFA 5HHDG 1RAXA 2A1AA 4TQ0A 2WLBA 2EAMA 5J2CA 4UAWA 4LJXA 1OQQA 1SGGA 1RYSA 4NNJB 2A1JA 3GV7B 2KLGA 2NS5A 4EZ9A 1ZRNA 1FIQA 1ZQRA 1P0RA 1EM7A 3ECIA 3MC0B 4LDTB 1WXSA 4WAAA 1KLVA 2ALZA 5CRXA 2D10A 1RFAA 2LJIA 2GBJA 9ICEA 3UM9A 3DVNU 1D9DA 3AXCA 5BMHA 1HZ6A 3MGHA 4JV1A 4M00A 2Q4TA 2AU0A 1A76A 1YZ7A 2ISPA 1WGRA 4EFOA 5BYRA 4FZNA 1D5XC 4DSKA 1F0MA 3GS2A 1D8BA 1QZEA 5KG7A 3M8SA 4HCPB 5J0XA 3WKCA 3MC1A 3QEAZ 4S0RA 4UB1A 8ICHA 3AULA 2CJOA 2KWUB 2W11A 2LVOA 4XC2A 2G4SA 2H3ZA 3KOOA 4Q8EA 1D5MC 3B2GA 1S0VA 4JL9A 4NJ6A 2NRTA 3E0FA 1ZQNA 3PSEB 2KQ4X 4WURA 3MGVA 4K1RB 1L4ZB 5KG2A 4O3RA 5C1ZA 5C3JB 7ICKA 5AI0A 1S9FA 4C8KA 3N1YC 1KRHA 4Y2TA 2FCQA 3QYPA 3RUIB 4GC7A 1XSLA 3NS1A 3NRWA 2P35A 7ICHA 1L7NA 1NI3A 5J0QA 8ICOA 2ZIWA 3TFSA 4FFDA 2SAKA 5DPRA 1NZBA 2WDVB 1Q3UA 1MQ2A 4K4HA 3HILA 3RR8A 4OZBA 4KLLA 2E1EA 5L1LA 2WU5B 1YN5A 2HHUA 4BOZB 4OVZA 4JK1A 1GO3F 1ZW7A 1F9JA 4G11A 4ZYNA 1IYFA 2D3GA 2XY6A 2DAFA 3V61A 1UT8A 1E9MA 2R2OA 1EU4A 1F52A 2BT6A 2Z8LA 5J0RA 1DGSA 1I4XA 2N7JA 5CX3A 2NO5A 3F5EA 3H4BA 2WF9A 5DQIA 4J9KA 4DFKA 2G45B 2ONQA 4BUGA 5KFZA 1T4GA 2XK5B 3R2IA 4EENA 4I2DA 2E8PA 2G1EA 4B6WA 1KTQA 3H8WA 2BHNA 4LNNA 5G5HA 2RGFA 2KFJA 4QAYA 3Q2AC 4O3QA 5ALKA 3H7PB 4UAYA 9ICLA 1LB2B 1WMHA 1X42A 3QZ8A 4FULA 3EUB2 5DB9A 3JW0X 4DQSA 4QIWF 4Q45A 1DOQA 4O3MA 1ZQVA 1DXSA 1IV8A 3ZDDA 1QILA 3MBYA 4ANVA 3PW5A 3SV4A 5D46A 3DBHI 3RJJA 2DKZA 1RXWA 3B08A 2Y9UA 5D2MB 7ICLA 4DQQA 1JW9D 5EE9A 5KFJA 4I2FA 2YN4A 3PLVA 2C5LC 1HUOA 4O9MA 3KHLA 5AICA 3U7ZA 3NHEB 3M6ZA 1UNSA 1Z5SB 4JUZA 2N0SB 4WIPA 5DPSA 2VA3A 4Z6DA 1E8ZA 4F7ZA 3MR6A 1T0RC 4OD0A 3UMBA 3KWLA 1RG6A 3IVFA 2KWVB 8ICJA 3A9JA 1SL0A 3ISCA 2MLBA 4BFRA 4UQGA 3K4GA 3UXPA 2L1AA 3EW9A 2NTSA 1QOAA 3C23A 2M1MA 3ZKJC 1K50A 4RF1A 1WM2A 1A0PA 4W9EA 4Y2PA 1NYQA 4DL4A 3X0WA 3NS8A 1IGCA 1VD2A 5KFBA 4PHEA 9ICKA 4DQRA 2KVRA 3CP8A 3N30A 1SV4A 4F4YA 1LO5D 4RGOS 3O0FA 1L0YB 4DHZE 8ICVA 2PKOA 3W5VB 2KX0A 2UWQA 4C00A 3LWLA 1ZD4A 3GDXA 3G6VA 1WZ0A 1P7FA 2OCEA 3AV8A 3MTNB 2LUEA 3T79A 4P0QA 1V1OA 2A4ZA 3N1XC 5AK4A 4HKQA 3ZDTA 2KVZA 5J2KA 4PHDA 4DQIA 3OSNA 4R63A 3DBRB 2KEYA 1Z4OA 2ZIVA 4IRDA 1NZPA 1ZQSA 2MBEA 9ICGA 3CF6E 2VH1A 3F2DA 4KX3A 4NAMA 4QW9A 4UATA 4M04A 3KKAA 3BVMA 1QQRA 1FPYA 1WM3A 2KZMA 3N9YC 4YFKA 4R8UB 9ICJA 1UELA 3U26A 2GRIA 2KKCA 4JV2A 4DDID 1F5SA 4DSFA 5E6NA 4R64A 4GLSC 1NKCA 3V7JA 2KN7A 4MELA 4CNQA 3T8MA 4PL2A 1UWMA 2MWSB 3V6EB 4LNFA 2B0CA 2UYZB 3PO5A 1JRUA 2LYBA 2KD0A 4RFBA 3KD3A 5KFUA 4MF2A 2QKQA 2R8HA 1Z3EB 1ROEA 2Y9TA 2ZIWB 2BPFA 1MFWA 2N7DA 3T5HA 2FCSA 1HUZA 2I1JA 1QOFA 2N4FA 4YXMA 3DCGA 3P2BA 4BXOA 2YMPA 3TAPA 2A3VA 4C8LA 3OJUA 3QZ7A 2QB0B 1DK2A 4FE3A 3OHBA 4M0WA 4YSXB 4NM2A 4CE6A 2KDBA 3A9KA 3VUXA 1YZ6A 2JVCA 1U48A 4WJQA 1T0QC 2ESEA 2LWPA 2YX8A 1TAUA 2ZEQA 3B2FA 1HEZE 1ESFA 1Z1BA 2L0TA 1I35A 3ZNGC 2KO3A 2EMTA 1YJ1A 4DL6A 1N2XA 5AIAA 9ICPA 3HP6A 2OHFA 5IILA 2I9GA 1J7CA 1R4MB 4EZ6A 1S1QB 4TURA 3Q8EA 3BK2A 1YJJA 3K9OB 4I2EA 3D2NA 1S0OA 4L2YA 2NRWA 1SV0A 5HKHA 3ZJUA 4AYBC 1L8OA 2XEWA 2DUYA 2C2RA 3ZDMC 1D5ZC 4QZ9A 1TTNA 5ALUA 4R8UA 5B5EU 3FDSA 9ICFA 3RNFC 3OJSA 3IG8A 4XRHA 4E0DA 4P0PA 5J0YA 3R7RA 5C0YA 2DPJA 5KT3A 1DGJA 1B1ZA 1B43A 1WR6E 2K4HA 4PL1A 1YX5B 1RXVA 3OLMD 2O2VA 3OG5A 1S5LU 3KVFB 2JRZA 3PSPA 4B9UA 3AEEB 2FE9A 1U4AA 2LKYA 4C80A 3RNCC 3WCQA 4HVBA 2KHWB 4XWTA 2QHOA 3PW2A 4A3PA 2HVHA 2RSUA 4WWMA 2BYTA 2GBMA 3DBLI 1HJPA 2DGZA 3SR6A 2BR0A 1TS5A 2H89B 4UBBA 5KFKA 1COKA 2WF6A 4XWWA 4NV0A 2Q5WD 3T3FA 2WHIA 2G5IB 3L5KA 4ED1A 2WXPA 2HHWA 4NLCA 2D07B 2VZKB 4N59A 5HI1A 1RDFA 4KGTA 4I2GA 2E8MA 2K60A 1NKBA 3ML8A 2A5UA 2BGFA 4MH0E 1GC6A 1SIFA 2KVCA 5ALTA 3W1SA 2N9KA 4G3XB 3I57A 4YCXA 2IOHA 4ANUA 4GDLB 7ICVA 3HUIA 1PVRA 2ZJ5A 1X9WA 4I2BA 1SXEA 1ZQGA 2LRWA 3Q3JA 5J2BA 4HDQA 2DZJA 2NPTA 3MFHA 3NZUA 2O6VB 5AKHA 5AKYA 1NBFC 4M01A 3MHZA 2ZCCA 3RJIA 2RRDA 3CSTA 5EE1A 3EYZA 9ICAA 2KJ9A 4ELVA 2Y5BB 4LLGM 4F91B 4RQ2A 2FDRA 5KFCA 2KMCA 4GDKA 4K81A 3JPOA 1JWBD 3PHXB 4JWMA 3DV9A 3RBDA 4MGIE 3D6JA 4ECYA 2JZBB 3DHGC 3R3MA 2CPRA 1AARA 5KTQA 4RGTA 4MGKE 3RNAC 5DB7A 4ZH4A 1T5XD 4I27A 4OZAA 3VHTC 1SWWA 3NTUA 4ELTA 2M17A 3P1MA 3MC8A 3S2AA 3VRAB 3ZO5B 5AM5A 4B9VA 4B6JA 3Q6BA 1DK3A 4EBEA 2GOLA 1KF6B 2K3UA 3U8ZA 1LKYA 3M9NB 1KFSA 3GU3A 2MP2B 4KZCA 4UB8U 1X9SA 3GOEA 4ZRKA 2JY6A 4P1BC 3M9MB 5A0LA 2IMWP 8ICTA 1ZE3D 1ECWA 1N48A 2F77X 1S3SG 4CHKA 3AM9A 1FRDA 2HSZA 4C8NA 4QZIA 4FADA 3RNGC 4OO1J 5DG7A 3EGRA 5KG1A 2GH1A 1L0VB 4OVVA 3QHTA 1HZ5A 3SV3A 4F2SA 3HWTA 3GQCA 2FIFA 1HTQA 4P6VF 3RB0A 3BY4B 3GE3C 3PSIA 2C7MB 4IRCA 1VZ8A 3SMVA 3N32A 2PFQA 2DAJA 2DX5B 1MC8A 2LMCA 2M56B 4MDKE 1KJTA 3AE7B 2KZZA 2HE7A 5ALQA 1ISNA 3UQAA 4ED3A 2JX5A 4DLGA 1BXTA 3R7QA 4XDCA 1PUTA 2WU2B 2OH2A 1F2RC 1FD6A 4OCZA 3KBBA 1E7VA 5E6OA 5J18A 4B0MA 3ZGZA 1KOTA 1TS2A 4I6NB 2XCAA 4W9DA 5AI8A 4M2YA 1GC7A 3KTQA 4TSSA 4KLQA 2BKEA 4MGZE 3ICXA 4DSJA 4YT0B 3KYCD 1RYUA 2IGHA 1J2NA 1UUPA 2W9BB 1WIAA 2J0MA 9ICCA 5ALOA 5JUMA 1COOA 1GG3A 4IM3A 4IR1A 1SB3C 3PVLA 2Y1IA 3UMGA 3I76A 7ICNA 2C28A 2W04A 4A55A 2WX1A 3FILA 3RMKC 2K4EA 3C28A 2FCNA 4C4RA 5IN7A 4A6QA 2L76A 2PIAA 1B4FA 1FNUA 4Y2VA 5KFGA 3Q8QB 1GAQB 4M8MA 3AMZA 3QIJA 2XICA 5DCNA 2WAQF 3FILB 2W3RA 2PMZC 4OW0A 1TKGA 3I63C 3D2SA 4RM8A 4W9KA 1XO0A 8ICSA 2A1JB 2INNE 2MEKA 5KFIA 2IHNA 2K4IA 3PZ8A 2OM6A 2I38A 1UA0A 2LHDA 4XYCA 1UF0A 2E5SA 1F2RI 1ZPSA 3W1SC 5LXHA 3TANA 4I2HA 4YTMB 3H9DA 8ICCA 5CP2A 3IBEA 2F8KA 2GMIC 1GNUA 1I4PA 1JQ4A 3ZDEA 2W7PA 3ONSA 4PHPA 2KZRA 3N28A 2V3SA 4LCDE 3A4SC 1EWYC 1L7PA 5CTRC 4BDPA 3RCZA 2QARB 5J2HA 5J0UA 3C0RB 2LHEA 3PY8A 2KKPA 3UPQA 2LM1A 3OPXA 4DHJB 2LXAA 4HXDA 2VIXA 3H0RB 1SBBB 2AX5A 2JXTA 3ZRCA 2WS3B 3P4PB 3C1YA 1A5RA 1UBIA 2XGQA 3IN5A 4GXJA 3V6KA 3HT3A 2LGSA 1VDVA 1UWXA 4P7IA 5KNIA 1TT5B 5KT2A 4RQ4A 3HX0A 4XGAB 4DS4A 2NTTA 4K4GA 1BUIC 5JU5A 2ISOA 1JWSD 5L1MA 1PUZA 1V97A 5KFLA 4Z6FA 1FXTB 2ZW1A 2YVCA 2ZVNA 3WK9A 5D6JB 3TI0A 3HK0A 3JYUA 5LLIA 2UU7A 3Q3FA 4PK1A 4Y2RA 1Z19A 5KL1B 2R2QA 1QOGA 1WY8A 1V6EA 1O08A 4OHJA 3L4PA 4UW9A 3SEIA 1SV0C 4NAWB 4EKUA 1TBEA 3WKBA 4MM3A 5CEHA 9ICRA 1NYRA 2XY5A 5AK3A 3SD7A 3LXFA 1U47A 2L00B 1JXLA 2KG5A 2UVWA 2MA1A 4F72A 1OW5A 1WGHA 4ARIA 4ICVA 4CF5A 1WI0A 4FS2A 1P1AA 5EE3A 2NBWB 4NXZA 2M19A 3PW0A 2VZKD 4W9HA 1SXTA 3P4QB 1WYWB 3BS7A 3PX4A 4YR3A 1LM8B 3T5JA 1YT3A 3EPGA 1KEJA 4B9SA 1UA1A 4GIBA 2HHTA 3Q8PB 1NK6A 1BT0A 2F1JA 2LRUA 3BZDB 1JWAD 4DQPA 4KDLB 5J29A 2NBVB 4GXIA 3TCAA 3RR7A 3LDAA 1LV5A 1T94A 2IYDB 3ED5A 1ENFA 7ICQA 2X38A 2ZUDA 5DDMA 2O6VD 9ICUA 4NLZA 2ZJ8A 1TK0A 2IDYA 3H0MB 3CYMA 4F5RA 2PJHA 4M8NA 4W9JA 1GB4A 1KN5A 2QILA 3BDPA 3JSVB 4FHJA 2C2EA 3IHPC 2WNMA 4G0NB 1Q3VA 5AI4A 2KMAA 4JX1C 4UB6U 2REXA 3TUOA 4FS1A 7ICRA 2WXGA 4YWGG 1NVID 4EBCA 3CWIA 5J0OA 3ZDAA 2KFNA 1ZRMA 4KLFA 2JPHA 4KKIA 3U52E 4J6IA 2HBMA 1ET6A 1RYJA 2AL6A 5JHAA 2AQ0A 3PZDA 4MEXA 3BS5A 1WUDA 2JEGA 8ICEA 3WAMA 4DCCA 1STEA 3ISDA 4W9CA 3H8JA 5IAAC 2IJ0A 4DF4A 1BNPA 1EO6A 5KFSA 9ICQA 4F2RA 3UIOB 1WGGA 1L3VA 2HHSA 1KLUD 3KKAC 5F3XB 1BPDA 1X9MA 3TKAA 1Z2MA 5DQHA 1PVPA 3AEFB 2I1QA 3DBRI 3GIKA 2HBJA 1YD8U 5D7GA 3UMCA 5TISU 2PVGC 1J7BA 1WE7A 2QCZA 3HVZA 5AM1A 2O2VB 3RRGA 2W9CB 4J9SA 3EA6A 3C1ZA 3WALA 5ALEA 4LJOB 1R4MI 2JWUA 3K9PB 1NJWA 2C2DA 2NV3A 4CF3A 2WXFA 2WXHA 4OVUA 3F2CA 9ICOA 1QLBB 3VTWA 3M62B 5J2AA 3BIID 4WWNA 2KN5A 4JWUC 2MJEA 2K6DB 2P6RA 3GB1A 2LYHA 4DXAB 2CU1A 5BOMA 3AU5A 3SD5A 4CQNA 4RM9A 1V1PA 5AI9A 3UXOA 4BBNC 5IIMA 3VH3B 2KIVA 2L3ZA 2WQYB 4HKZE 1OTRB 2WAQC 3ML9A 5J2RA 3H8SA 4OJ6A 3DWMA 5ALLA 2HDEA 4O5KA 4F5QA 3DBSA 2JGAA 2DBYA 1WXAA 1OGWA 2K0PA 2KTRA 3QUBA 2F44A 2OEHA 3NZSA 4A8EA 3EFCA 1UCVA 3UIPB 2LGXA 4Y2SA 3QX1A 1E7PB 8ICIA 3EHVA 3RJFA 1WX8A 5CB1A 2YEPF 1X40A 2ZXIA 2MX2A 4B95A 2L8JA 3SDLC 4B9TA 1J19A 3BK1A 5EDSA 3PRMB 2K89A 2MBBB 4CYEA 3ALRA 4IQTA 5ALGA 5JZEB 3KUCB 4F3OA 1N6ZA 3QEBZ 3Q8CA 2KLCA 2DPIA 2PE9A 1X66A 3SEBA 5IOIA 3DWGC 1ZDXA 1CZPA 2BB6A 2QJLA 2KIWA 3Q3NC 5AK6A 2F8LA 1FNVA 1P3QU 1XXGA 3P42A 3ZXRA 1FNWA 1KM7A 4E3CA 3KZIU 2MRPA 8ICGA 1XO1A 4DQOC 2FJ6A 4HCNB 2KZ3A 3IHQB 1FXAA 4NLKA 2DYMA 2QSDA 2KOBA 2NO4A 4GXKA 3SAHA 1TY0A 3LVWA 3OJ3A 1Q46A 2HOQA 5D49A 1L5PA 1ZUD2 8ICBA 3AU4A 2MW5A 3IAM1 2FE8A 5DPTA 3J81j 5KFNA 1RFKA 1VZ6A 2ODGA 1V80A 3L3FX 2IBIB 2HD5B 1ET9A 4ACFA 4C8OA 2E8NA 2V0GA 4F92B 2MA9B 2KJ5A 4C0ZA 2L52A 3G6YA 3I3TB 1JI7A 2R18A 1OUQA 2GWSA 4ZRJA 4LTUA 1K1SA 1SEBD 4K3CA 4GDLA 4RQMA 2AGPA 1BNOA 4REZA 1XF5L 3Q8RB 4B0EA 4PZNA 3PX6A 1VR9A 2FAZA 2JF5A 4H2AA 3WIMA 2D8CA 2HBLA 1S0MA 1KFYB 3DDCB 1T7PA 4IL6U 1DYQA 1YQ3B 4TKNA 3RD2A 5KFTA 4ECZA 4YR2A 4DWFA 4C4SA 2EH9A 5AKJA 2WDTB 3JPQA 4JE3B 1QT9A 2H5XA 4PS8A 5KFYA 1QQ7A 4ED2A 2J4XA 3SFDB 1OEYA 2Z0DB 3PREA 4XUSA 4PGXA 2JWZA 2KC1A 3PV1A 1FEZA 4QZGA 4GC6A 9ICBA 3WKEA 2BWFA 1BVSA 2CKHB 2RMMA 3AB5A 2I5HA 4RQ3A 4AS1A 4MEYA 3VTUA 1CQVA 3V72A 2UVVA 1P9DU 5CHGA 4NM1A 5F9LA 1J7AA 1Q5WB 1QKZA 1ZQTA 3LK9A 3TEYA 4NL9A 1S0NA 3MFGA 1EF5A 4MM3B 4BJQA 9ICIA 1XD3B 3PS6A 3BQ7A 3V6HA 4KIKA 3LJ3A 4C8MA 4DFJA 5KFPA 4DFPA 2YEPB 2IO3B 2QB0A 4XA5A 3AI5A 4GLXA 2D11A 3V7KA 4FN2A 3IG3A 4LZGA 5ALDA 2W82A 2JEJA 3TSSA 4FBUA 1HXYD 4XZ4A 2EZXA 3APDA 1TKEA 3IP4B 1NJYA 1V38A 3CSFA 2KMMA 1S10A 2KXJA 3IFWB 4XE0A 5IO9A 2KP7A 2PMZF 4Z6CA 3MR3A 4R66A 1H4RA 4OJLA 4P4PA 2XC9A 3GZNI 4OZCA 2INCC 4YMNA 4QW8A 1JRPA 4F4XA 2BCVA 5TR5A 4EOYA 2QDFA 4ED7A 4KLHA 1P7EA 3ZD8A 4BX9C 3RYTA 3HJEA 3TFRA 3UQ2A 3S6JA 5CHFA 2MU2A 2JV3A 3KHGA 3GV8B 1BPYA 3P4RB 1TAQA 3WK7A 2M0XA 3PMNA 2EKEC 4MFCA 1BPZA 4I6LB 3AU2A 3HKZC 2MAXA 4EYIB 3IG5A 2CHXA 3N20C 1MPEA 5AKIA 1RM6C 4QZBA 1E7UA 2NRVA 3H8HA 3H7SA 2N9LA 3SENA 4FO6A 4DOCA 2VJ4A 3BQ0A 2G9HD 2LMRA 1L6NA 2GO7A 5DGAA 3AECB 2LXCA 3A1QA 2ZVOA 2N7EA 2IY1B 2W3SA 3PSTA 2HHQA 1WXVA 4GN1A 2BKFA 1OQYA 1HE8A 1C1YB 1XQQA 3QUTA 3LWMA 1WYGA 4QWCA 5KHQA 2ES6A 2CU3A 3KWVA 3ZLZA 3FKYA 3PTFC 1F0ZA 2F2AB 3DVNV 2KWDA 4YSZB 5DBCA 3PR5B 3QU4A 4JQWC 4RNMA 4BKSD 3ZYYX 1JMLA 3CNHA 3AE1B 4RUCA 2J52A 2DFLA 3RJHA 1S76D 3P4SB 3V62A 1YN3A 4ELUA 2D5GA 3C5GA 4O3SA 1FMAD 1SKSA 1I4QA 3Q14C 4WQOB 2FLLA 4KVGB 1JROA 3BQ2A 2W54A 4DOBA 5IKCM 3W1YA 3ZXVA 9ICTA 4IQVA 2W43A 3VXWA 2EANA 2JEIA 3A0HU 3EWAA 3E2EA 5IIJA 1PFDA 1FM0D 3MDCA 3HPOA 4XDDA 4LNOA 1EUVB 3L13A 5AKZA 2AQ3B 4HPPA 2WXKA 3L10B 1JALA 4O5EA 5E6PA 3N3KB 2Y0SF 4C4VA 5BPCA 4MFAA 3LDZE 1WWTA 5AKXA 3ENEA 3DEEA 1FEHA 5KG5A 1D8YA 1LQBA 1TS4A 1NK0A 4URKA 5DDYA 1BPEA 1SJED 2GB1A 4M9GA 1YQBA 2PKEA 1Z00A 4YVZA 1OQRA 1XEEA 3ABVB 4Y2YA 5D4BA 3QU5A 2AYOB 3RH5A 4W9LA 2IO1B 5H2FU 3W5UB 2FUHB 2V3PA 3ZJVA 3IV6A 2KNJA 1ZQFA 3Q8KA 2KQ7A 2CJNA 4ZDVA 1MJDA 3AEAB 5L83A 1SGHA 1NNLA 4X57B 1HQRD 4P0PB 2KJ6A 3BYYB 2XGPA 1U9LA 5AI5A 4QZFA 4QZHA 4RNAA 4QWAA 1PGXA 3C2LA 1ZOYB 2Z7JA 2MJDA 3WA0A 1KFTA 4E74A 4CO7A 2BB5A 4O3OA 1PK3A 4ACOA 4ASWC 1WCNA 4EZJA 2FMPA 3ZUNA 4TUQA 1ZQXA 2PE6B 2BWES 4K3BA 1ZP0B 1Q10A 3M1YA 4ANXA 2EZZA 4JV0A 1X9XA 5ALSA 2G4DB 4RNOA 1VZ7A 4KLJA 1N5XA 1DRGA 3L0WB 2MH7A
chains in the Genus database with same CATH topology
1L6UA 1F2RI 1ZPSA 5G5GA 1YMHE 5HHDG 4C56C 1FCCC 2PMVA 1RWSA 3V3XA 4YTMB 4KKJA 4TQ0A 2WLBA 4KX6B 2QEJC 3U2SC 1I4PA 1JQ4A 1OQQA 3NVYA 2Y5PA 3AE4B 3RPFC 1PYWD 1PGBA 1EWYC 1FIQA 3MC0B 1EM7A 4O1NA 1XCQL 2LHEA 3C8YA 3IXSA 2LJIA 4GDKB 3Q8AA 2LGIA 1SBBB 2AX5A 2JXTA 3PZ7A 4P16A 1HZ6A 5BMHA 2WS3B 3P4PB 3OWEB 3BWUD 1VDVA 1UWXA 3ZJTA 5BYRA 1D5XC 2NTTA 3GS2A 1BUIC 1E0ZA 1JWSD 4RCOA 4IOIE 1HA5A 1V97A 4RGNA 2WDQB 3AE6B 2CJOA 4PT5A 5H92C 5T8IA 4HROA 2EELA 2ZW1A 1D5MC 3B2GA 4DXGA 2AQ2B 1DOXA 2Y5CA 1VJKA 1QOGA 2KQ4X 4WURA 1A70A 4OHJA 1L4ZB 3L4PA 3VR9B 4NAWB 5C3JB 1KRHA 4RH6A 1JWMD 1NYRA 2WXQA 2KACA 3LXFA 2M0AA 3NS1A 1SSNA 1XLNA 4KGSA 1NI3A 4ARIA 2SAKA 2WDVB 3NUHB 5EE3A 2M19A 2VZKD 4UDUC 1SXTA 3P4QB 4OZBA 1MI0A 5AUKA 2WU5B 4YTNB 1YN5A 2WXIA 5FK9C 4OVZA 3ETRA 3URYA 2ICIA 3BZDB 1JWAD 1AYFA 3BVGA 1E9MA 4C7YA 1EU4A 2BT6A 2Z8LA 2BS3B 5D3DA 1SE2A 1TJEA 1I4XA 3IT6B 3NVVA 1ENFA 2N7JA 2X38A 1QF6A 2ONQA 4A9AA 3ZQ4A 1JWUD 2IDYA 3LB8C 4JWSC 1GB4A 2QILA 3R2IA 2G1EA 2R61A 2WNMA 1FXIA 1E6EB 2WXLA 4JX1C 4N6EB 1WGKA 1XLQA 2LEKA 5G5HA 3TUOA 1QOBA 2WXGA 4YWGG 3W2DA 1NVID 4ZOHC 3CWIA 4KKIA 2WXMA 3R8BA 3U52E 1ET6A 1RYJA 2IPKD 2BS4B 4A90A 3EUB2 4ZRQA 3VQIA 1QILA 1STEA 1C4AA 3NRZA 2KAJA 2IJ0A 2KDMA 3TEZA 1KLUD 1JW9D 4HRSA 5EE9A 1MHHE 3AEFB 2BTEA 1M4VA 3U7ZA 5HG2A 5D7GA 1TKYA 1UNSA 1L6VA 2JQRB 2N0SB 2PVGC 1J7BA 3HVZA 1C78A 2RDHA 3EA6A 3KWLA 1IGDA 1WXQA 2JWUA 2PVOD 3Q69A 1V1PB 2L1AA 1I4HA 2NTSA 1QOAA 3AE5B 2WXFA 1K50A 2QIEB 4RF1A 3AE3B 4YTPB 3AE2B 2WXHA 4NJCA 2LUMA 1QLBB 1NYQA 1XO3A 3BIID 4JWUC 1IGCA 2MJEA 4ZHOA 3GB1A 2QMTA 2SEBD 1LO5D 4RGOS 2B76B 1TYGB 1K51A 1L0YB 1PDXA 4CQNA 2PKOA 2PW9A 3W5VB 1V1PA 2WQYB 1P7FA 1YQ4B 1V8CA 3AEDB 3AV8A 3AE8B 1K53A 4HKZE 3V05A 1V1OA 5FKAC 4HKQA 3DWMA 2XN9C 1CK1A 2HDEA 3TEXA 3W9CB 2DBYA 2K0PA 2ZW0A 4NAMA 1VLBA 3LYYA 2WXNA 3BVMA 3AN1A 1TS3A 1E7PB 1QQRA 3N9YC 1ZXHA 1XLPA 2GRIA 2YEPF 3CIRB 1UGJA 3HRDD 1N62A 4GLSC 5LNK1 5H8YE 3BK1A 1EU3A 2TSSA 2WDRB 4ZYSA 5BYSA 1UWMA 3BYTB 2I2YA 4RFBA 4Q2JA 5E6JA 4MT5A 1ROEA 3Q8CA 1KTKA 4EE2A 1CJEA 3NZ3A 2IGGA 2V4IB 3SEBA 4C7ZA 1QOFA 3T3NA 3AE9B 1ZDXA 1I7HA 1CZPA 3DWGC 1F77A 2BB6A 2QJLA 1FNVA 2RDGA 1XXGA 3P42A 1FNWA 2WXOA 4M0WA 2ACZB 4DQOC 4YSXB 1E10A 1YJIA 2DYOA 1FXAA 2DYMA 2QSDA 3B2FA 2L32A 1HEZE 1ESFA 1TY0A 4TQ1A 1I4RA 1IUEA 1SE4A 1L5PA 1ZUD2 3IAM1 1GPXA 2W55A 5FR3A 2FE8A 4AQ7A 1SJHD 1C76A 2OHFA 1J7CA 1RFKA 1VZ6A 3Q8EA 3BK2A 1ET9A 1YJJA 2J42A 3U4EG 2V0GA 1C4PA 2L52A 4L2YA 5HFYA 3ZJUA 1WRIA 3T3OA 3B9JA 1FFVA 5C2TB 2MJ3A 2K9XA 4LTUA 1SEBD 1D5ZC 2LFIA 1YN4A 5BMIA 3KLSX 4REZA 1XF5L 3O13A 3IT4B 4ZRPA 4B0EA 2PLPA 1R7SA 1AN8A 1VR9A 2XNAC 2JYEA 3AEAB 4H2AA 4WIPA 1KFYB 2DWQA 1JCKB 1DYQA 1YQ3B 3Q8FA 3KQ4A 2K5PA 1DGJA 1B1ZA 1QT9A 4JE3B 1NENB 2J4XA 3GP7A 3SFDB 4L1BA 2L83A 3J9CA 3AEEB 1N61A 4C80A 3WCQA 1IBXA 3VR8B 4XWTA 2RMMA 3AB5A 4AS1A 1C77A 2AQ1B 4WWMA 3TEWA 2BYTA 4RGMA 1C9FA 1CQVA 5TSSA 2FBWB 4RF0A 2IGDA 1J7AA 1QKZA 3SR6A 1IBXB 1TS5A 1YNTE 2H89B 4R3DA 5I4DA 3TEYA 3MFGA 1SE3A 5D3IB 1N60A 4XWWA 2Q5WD 4MM3B 1DOYA 3E9SA 1C79A 1TZOA 4US8A 2WXPA 1L4DB 5HI1A 2VZKB 4DXFA 4N59A 1D6EC 2JU6X 1AW7A 4KGTA 3NVZA 2YEPB 1KH0A 1N63A 4IKGA 2WXRA 3W1SA 1C4CA 2N9KA 2RPVA 3I9V1 3I57A 4YXDB 2PTLA 2W82A 4IDIA 4GDLB 3HUIA 3TSSA 3BVZA 1HXYD 4HJGE 1KLGD 2E3TA 1TKEA 1FCLA 2KMMA 2FUG1 4XE0A 4OZCA 3NVWA 3MHZA 4ZHPA 4MH8A 1JRPA 2INPE 2BW2A 5EE1A 1P7EA 4D2KA 4N58A 1AWDA 4LLGM 2JYTA 2ON8A 4LK0M 1BMLC 1JWBD 4USAA 3P4RB 3AH7A 2EKIA 4FXCA 3R2TA 4L23A 4RGTA 1MPEA 1T5XD 4OZAA 1RM6C 3P1MA 3VRAB 3H8HA 2BS2B 2N9LA 3AEBB 2G9HD 1KF6B 2K3UA 3AECB 1N5WA 2HTME 2NMQA 3UI3A 2JZPA 1T3QA 2BBCA 3MJ5A 1NEKB 2W3SA 1ZE3D 1T6BX 3AM9A 1SF0A 1FRDA 1WYGA 2CU3A 3KWVA 2K22A 1F0ZA 4TMAB 2KWDA 3EGRA 4HEA1 4YSZB 1WSPA 1L0VB 3ZYYX 1XCTL 1HZ5A 5MPOA 5JXVA 2V3NA 1JMLA 1ZDVA 3AE1B 4P6VF 2J52A 1EWCA 1GB1A 1VZ8A 3P4SB 1FFUA 1YN3A 2D5GA 2LMCA 1FMAD 1I4QA 2M56B 2Y3AA 2WP9B 1D4BA 3AE7B 1JROA 2W54A 2H88B 1FRRA 1TY2A 2DLBA 3MP9A 3P63A 2JX5A 1I4GA 1BXTA 3IAS1 4XDCA 1PFDA 3Q8BA 1FM0D 1PUTA 2WU2B 4NZLB 1L0XB 1F2RC 4XDDA 1FD6A 1ACCA 2AQ3B 4JPSA 2WXKA 1JALA 1K52A 1OFFA 1MVKA 2JSVX 5GXGB 4B0MA 3ZGZA 1TS2A 3RFZB 4WH4A 4A8XC 1WWTA 4KGRA 1VRAB 1FEHA 4WQMA 1TS4A 4TSSA 1B9RA 1SIJA 1SJED 2GB1A 1MHXA 4YT0B 4J3OD 3SFEB 2IGHA 1GOZA 1OQRA 1UUPA 1XEEA 3ABVB 4MACA 4ARCA 2OEDA 3FAHA 5BMGA 3PO0A 3W5UB 4WAFA 1SB3C 2V3PA 4ITKA 3ZJVA 2CJNA 4US9A 1HQRD 3BYYB 2J53A 4A55A 3FILA 4RNAA 3AEGB 1ZXIA 4YSYB 3FC4A 1PGXA 4A6QA 5AUIA 2PIAA 1FNUA 1ZOYB 1FO4A 3HVDA 2E6XA 2MJDA 1DOIA 1GAQB 1XLOA 3VRBB 3AMZA 1PGAA 2BB5A 2GI9A 3FILB 2W3RA 4OW0A 1TKGA 5EE0A 5BYQA 2KN4A 1ZP0B 1Q10A 2INNE 2MEKA 2WXJA 3PZ8A 3E56A 1VZ7A 2I38A 1N5XA 1Y56A 2LHDA 2MH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E10 A;  1YJI A;  1L6U A;  5G5G A;  1RM6 C;  1FXA A;  3P1M A;  3VRA B;  1RWS A;  2BS2 B;  3B2F A;  4YTM B;  3NRZ A;  2WLB A;  4KX6 B;  3AEB B;  1IUE A;  1L5P A;  1ZUD 2;  2KAJ A;  1GPX A;  2W55 A;  1KF6 B;  1JQ4 A;  1OQQ A;  3NVY A;  2OHF A;  1J7C A;  1N5W A;  2HTM E;  3AE4 B;  3AEC B;  3RPF C;  1RFK A;  1T3Q A;  1EWY C;  1JW9 D;  1FIQ A;  4HRS A;  5EE9 A;  1NEK B;  1YJJ A;  2W3S A;  3AEF B;  3AM9 A;  1SF0 A;  1FRD A;  2L52 A;  1TKY A;  1WYG A;  1L6V A;  1WRI A;  2JQR B;  3B9J A;  2AX5 A;  2N0S B;  2PVG C;  1J7B A;  2CU3 A;  2WS3 B;  1FFV A;  3HVZ A;  2K22 A;  2MJ3 A;  2K9X A;  3P4P B;  5C2T B;  4LTU A;  1F0Z A;  4YSZ B;  1VDV A;  3KWL A;  1L0V B;  3ZYY X;  4YSX B;  5MPO A;  1WXQ A;  3AE1 B;  1E0Z A;  2PVO D;  4P6V F;  1R7S A;  3AEA B;  1KFY B;  3AE5 B;  1QOA A;  3P4S B;  1V97 A;  2DWQ A;  1FFU A;  2QIE B;  2WDQ B;  3AE6 B;  2CJO A;  1YQ3 B;  3AE3 B;  3AE2 B;  4HRO A;  4YTP B;  5H92 C;  3B2G A;  1FMA D;  2K5P A;  1DGJ A;  2M56 B;  1QLB B;  1QT9 A;  1NYQ A;  1DOX A;  2WP9 B;  1NEN B;  1XO3 A;  2Y5C A;  3BII D;  3SFD B;  3AE7 B;  1JRO A;  4JWU C;  2W54 A;  1VJK A;  1FRR A;  2H88 B;  2L83 A;  2MJE A;  5GXG B;  4ZHO A;  3AEE B;  1QOG A;  1N61 A;  2BS4 B;  1A70 A;  3P63 A;  4C80 A;  2JX5 A;  3WCQ A;  3VR8 B;  2B76 B;  3L4P A;  1TYG B;  3AB5 A;  1PFD A;  1PDX A;  3VR9 B;  1FM0 D;  1PUT A;  2WU2 B;  2PKO A;  3W5V B;  4WWM A;  5C3J B;  1KRH A;  1NYR A;  2WQY B;  1JAL A;  1OFF A;  1V8C A;  1YQ4 B;  2FBW B;  3AED B;  3LXF A;  3AV8 A;  3NS1 A;  1J7A A;  1XLN A;  3AE8 B;  3SR6 A;  1NI3 A;  2H89 B;  1WWT A;  1N60 A;  2Q5W D;  2WDV B;  3DWM A;  4WQM A;  1B9R A;  1DOY A;  5EE3 A;  3W9C B;  1SIJ A;  4US8 A;  2DBY A;  2M19 A;  4YT0 B;  3P4Q B;  3SFE B;  4N59 A;  5AUK A;  1OQR A;  2WU5 B;  3NVZ A;  4YTN B;  3ABV B;  1N63 A;  1VLB A;  3FAH A;  3ETR A;  4YXD B;  3PO0 A;  3AN1 A;  3W5U B;  1JWA D;  4IDI A;  1E7P B;  1SB3 C;  1AYF A;  4ITK A;  3HUI A;  1E9M A;  4C7Y A;  2BT6 A;  4US9 A;  2CJN A;  1XLP A;  2E3T A;  1TKE A;  2BS3 B;  3CIR B;  3HRD D;  1N62 A;  5H8Y E;  1TJE A;  2KMM A;  3NVV A;  2WDR B;  1QF6 A;  3AEG B;  1ZXI A;  4YSY B;  1UWM A;  3FC4 A;  4A9A A;  3LB8 C;  3NVW A;  2PIA A;  5AUI A;  1ZOY B;  1FO4 A;  4JWS C;  4ZHP A;  2MJD A;  1DOI A;  1GAQ B;  1JRP A;  1XLO A;  3VRB B;  3AMZ A;  2G1E A;  5EE1 A;  1FXI A;  1E6E B;  4N58 A;  1AWD A;  1ROE A;  4JX1 C;  2W3R A;  4N6E B;  1WGK A;  1XLQ A;  1TKG A;  5G5H A;  2LEK A;  5EE0 A;  1QOB A;  1CJE A;  1JWB D;  4USA A;  1NVI D;  3P4R B;  1ZP0 B;  4ZOH C;  4C7Z A;  1QOF A;  3AE9 B;  3CWI A;  1I7H A;  1CZP A;  3AH7 A;  3DWG C;  2QJL A;  2EKI A;  4FXC A;  1RYJ A;  1N5X A;  3EUB 2;  2MH7 A;  2ACZ B; 
#chains in the Genus database with same CATH topology
 1R4N I;  1ZQQ A;  2CN1 A;  1L6U A;  5KAI U;  4FBT A;  4K4I A;  4QJF B;  3UIN B;  1H8C A;  2PMV A;  3V3X A;  1L5U A;  4KKJ A;  1TZ1 A;  2G06 A;  4PPX A;  5L95 C;  5F9N A;  5L1I A;  2OJR A;  2QEJ C;  3M7D A;  2K39 A;  2OXO A;  3AE4 B;  3RPF C;  4IQU A;  3DHI C;  3SI8 A;  2ZJD A;  1XCQ L;  3VCB A;  5KT4 A;  3EFU A;  1SL2 A;  5GTI U;  3BJY A;  5IIN A;  1QSS A;  4KLS A;  2BYE A;  3IXS A;  5HHI A;  1ZQC A;  3V7L A;  3GFK B;  4GDK B;  3Q8A A;  2LGI A;  3KW5 B;  4FA6 A;  3PZ7 A;  1S8O A;  3OGU A;  3OWE B;  3QUC A;  1RRB A;  3BWU D;  5DLG A;  3ZJT A;  4RMA A;  3TAQ A;  4J9O A;  4PJ0 U;  3OSP A;  2KTQ A;  5EWF A;  4RCO A;  5KL8 B;  2MBQ A;  7ICE A;  2FLN A;  2WDQ B;  4BKS A;  4PT5 A;  5H92 C;  4DXG A;  4HPL B;  2W03 A;  4DSL A;  2J7Q B;  2Y5C A;  3SAG A;  5LXI B;  1RQL A;  4F8C B;  1TFR A;  5KT5 A;  4EZK A;  5FP0 A;  3M95 A;  4BBN F;  1Z1V A;  4EUT A;  5KFO A;  2MRL A;  1UPH A;  2WB1 C;  3RNE C;  4QZC A;  3QQ8 B;  7ICF A;  2WXQ A;  3Q3M C;  2KAC A;  4Q43 A;  5J2I A;  2M0A A;  4BZA A;  2LGD A;  3Q3O C;  4M9N A;  2KD1 A;  4XQ8 A;  4ECT A;  2M8S A;  4RQ8 A;  4LNK A;  4IM0 A;  4ED0 A;  8ICZ A;  5ALF A;  4LDT D;  3NUH B;  2ZPN A;  3PW7 A;  3GIJ A;  5AUK A;  2C7H A;  4ECS A;  4DHJ D;  4DEZ A;  2WXI A;  1KW4 A;  2H3F A;  4F5O A;  4J9N A;  3CMM B;  2YTU A;  1XSN A;  2ICI A;  1L3S A;  3KYD D;  2RPQ A;  5KT6 A;  4Q8F A;  1E8Y A;  3NOB A;  3BVG A;  4C7Y A;  2I6X A;  7ICO A;  2BS3 B;  1SE2 A;  2I1K A;  3DBL B;  2D3D A;  2KMD A;  1TJE A;  3NY5 A;  3NVV A;  5AM3 A;  1QF6 A;  4LNI A;  1RQN A;  4A9A A;  2AEH A;  1ZQB A;  3HM3 A;  1JWU D;  3LB8 C;  1Q8K A;  5KG4 A;  5HR7 A;  5KFR A;  4KX5 A;  1ZGU B;  4JWS C;  4HLE A;  3C21 A;  3ZRF A;  3QU2 A;  2YY6 A;  3I5J C;  1M94 A;  4KLG A;  1E6E B;  4CRX A;  1FXI A;  2WXL A;  4II3 B;  3EC8 A;  1XLQ A;  2LPE A;  2UVU A;  4ICU A;  1ZQJ A;  4DO9 A;  4A3O A;  2BGW A;  9ICX A;  4NLN A;  2BS4 B;  4NLB A;  2K1F A;  4R65 A;  3MR5 A;  4UB3 A;  1V49 A;  4RPX A;  2IA6 A;  5ALP A;  5ALX A;  4II2 B;  3JSV A;  3RZW C;  4AP4 C;  1U45 A;  1C4A A;  3K1Z A;  5GTH U;  5B66 U;  2QC8 A;  4P1C C;  2KAJ A;  2AJQ A;  4GU2 A;  1Q0W B;  3A9K B;  2EQY A;  1QSL A;  1JXE A;  1KKX A;  2RLT A;  4ECU A;  2AL3 A;  2EDU A;  2HI0 A;  1QLN A;  3RB3 A;  2ASL A;  5AIB A;  1MHH E;  4NAW A;  1P98 A;  2BTE A;  2H3Q A;  3M63 B;  1M4V A;  2MSN A;  3VUW A;  3ZI4 A;  1SZH A;  2K8C B;  4HYK A;  2RDH A;  2G0A A;  1WGD A;  4K7U A;  3MHS D;  3DQV A;  4XX5 A;  4O3P A;  4NWI A;  4TQS A;  4TQR A;  3RB6 A;  4GMV A;  1NK9 A;  2BDP A;  3Q69 A;  1NJX A;  1V1P B;  3MGI A;  4EEK A;  8ICW A;  1I4H A;  5G55 A;  3C2K A;  3ZD9 A;  4YTP B;  5J0S A;  3AE3 B;  4Y2X A;  3AE2 B;  2XI9 A;  2YML A;  1MG8 A;  4DS5 A;  3WAP A;  5KFX A;  2LUM A;  4RQ5 A;  4NJC A;  4UAU A;  2FMQ A;  1NI2 A;  1NK7 A;  4EYH B;  3UXN A;  4J9R A;  2D3A A;  2BCU A;  2BZF A;  2G5H B;  1KBU A;  5CHW A;  4ZHO A;  1RYR A;  2QMT A;  1X2I A;  4YR0 A;  2SEB D;  4F71 A;  2ZIU A;  2B76 B;  1TYG B;  2HOF A;  2FI1 A;  1PDX A;  1ZQP A;  2PW9 A;  2KSO A;  3D2Q A;  5DBA A;  2MSE D;  5KG6 A;  1URJ A;  1ZQM A;  4PGY A;  2PXI A;  3AED B;  2OOB B;  3SAF A;  2BPC A;  1NK4 A;  5CA7 A;  4WJ3 B;  2B6G A;  3V05 A;  4QWB A;  2IHM A;  5FKA C;  1KQQ A;  4QZA A;  2CS4 A;  3RNB C;  3TEX A;  4BKG A;  4KLU A;  3QJZ A;  2K25 A;  8ICN A;  2KV2 A;  3L16 A;  3RUL A;  3KZX A;  1VLB A;  4EEL A;  5L1J A;  2MUT A;  3AN1 A;  2KOX A;  1TS3 A;  2LHT A;  4ECW A;  5L9X A;  1T3N A;  2MBO A;  2VAN A;  3CIR B;  3HRD D;  1N62 A;  1QTM A;  2KJR A;  8ICL A;  3BQ1 A;  5LNK 1;  3JPN A;  2K8H A;  2WDR B;  1QQ5 A;  3AL0 B;  3D32 A;  2Y1J A;  1SKR A;  3BS5 B;  2NVU I;  4W9F A;  5AKK A;  2KHV A;  2BCS A;  1E90 A;  2LI6 A;  5BO4 B;  1L7Y A;  4Q2J A;  3ONN A;  4DFM A;  3HKZ F;  3GIM A;  5AM2 A;  1WJ6 A;  2NPT B;  2V9W A;  2N9E B;  4EE2 A;  1CJE A;  2M9N A;  7ICT A;  2IGG A;  4C7Z A;  4OJP A;  3AE9 B;  1ZD5 A;  4BVU C;  1E8X A;  1T0S C;  1I42 A;  2RDG A;  3ZDC A;  2JMG A;  1WX7 A;  3QC8 B;  2R8G A;  2ACZ B;  2LAS A;  3QXG A;  3Q8M A;  1E10 A;  1D8L A;  4OJO A;  3RH6 A;  1YJI A;  2DYO A;  5AZF A;  3QAR A;  4B9K A;  2J6U A;  2L32 A;  3MDA A;  9ICN A;  5AZG A;  2HOI A;  3V6C B;  5AZH A;  3QUQ A;  1I4R A;  1MN8 A;  4F4K A;  1CI4 A;  2GBK A;  2HDO A;  4IM2 A;  5FR3 A;  4FZL A;  1PZN A;  1UQV A;  4NY8 A;  1C76 A;  1SJH D;  1OXJ A;  1RLF A;  3L54 A;  4FLH A;  1F44 A;  7ICP A;  4WWO A;  3THV A;  4NQL B;  3SU8 X;  3BIN A;  4DL7 A;  1QQ6 A;  3JPP A;  2J42 A;  4DHZ B;  3H4D A;  2FPK A;  3WK6 A;  1A77 A;  3F2B A;  1C4P A;  2DNF A;  4WJN A;  3APF A;  5HFY A;  3T3O A;  3B9J A;  4DF8 A;  3F53 A;  1FFV A;  2MJ3 A;  1P7D A;  1C7Y A;  2K9X A;  7ICI A;  3ZTC A;  3H7I A;  2O6K A;  4U7C A;  2FNJ B;  5KHO A;  4BAX A;  5AKE A;  2LFI A;  1YN4 A;  5BMI A;  2LGY A;  3V60 A;  4ZRP A;  3O13 A;  3N7R C;  5ALR A;  4FZM A;  4AWJ A;  1LXD A;  2PLP A;  2WTF A;  1Z4N A;  3N7P D;  1AN8 A;  2BKR B;  2F1H A;  2C7N B;  3GII A;  2JYE A;  2XNA C;  2ZUC A;  3IM1 A;  3A1Q B;  3TIX A;  3ZNZ B;  2ASQ A;  4WJP A;  3KHH A;  8ICQ A;  4UAZ A;  1WE6 A;  2ZIU B;  3NAS A;  3PHW B;  1UHU A;  2LJ5 A;  4DBG A;  3RFA A;  3PPA A;  2J0J A;  3GP7 A;  5E79 U;  2W7O A;  2K8A A;  4HAI A;  2L83 A;  3J9C A;  2W8L A;  8ICP A;  1N61 A;  2KQS A;  1IBX A;  3VR8 B;  4YD2 A;  2Y0S C;  4B9L A;  3WK5 A;  2WFA A;  2DQN B;  3TEW A;  3PVX A;  5CR0 A;  4RGM A;  3NJT A;  5AEK B;  3SYZ A;  5TSS A;  1T8E A;  2IGD A;  2F1I A;  3SZ2 A;  1IBX B;  4R3D A;  4F5P A;  2BPG A;  1IPG A;  1X1M A;  5D3I B;  2LVP A;  1N60 A;  4MEM A;  1ZQY A;  1SZP A;  1DOY A;  5ALH A;  4ED6 A;  3DHH C;  3E9S A;  2GBN A;  4US8 A;  3SHQ A;  4DXF A;  4YD1 A;  2IY0 B;  4F4W A;  3A33 B;  2B21 A;  4LZD A;  2XCP A;  2JXX A;  3JVZ X;  4IKG A;  5EOZ A;  4UAR A;  2WXR A;  4F93 B;  2G07 A;  1C4C A;  4QZ8 A;  3NUQ A;  2D3B A;  4BGD A;  4IS7 A;  2XID A;  3ZW3 A;  2LZ6 A;  3ALB A;  1KLG D;  2E1F A;  4RQN A;  1ZET A;  1UGM A;  4NY0 A;  2KIC A;  1E8W A;  2PFN A;  4GFJ A;  3QA8 A;  4DFD A;  3TMP B;  1B22 A;  1ZQA A;  2KT7 A;  2FUG 1;  3EEC A;  2W9A A;  3NVW A;  1Z00 B;  4GGQ A;  1BPX A;  1MG4 A;  4ZHP A;  1L3T A;  4MH8 A;  1NK8 A;  4CDG A;  5J8Y C;  2BW2 A;  2INP E;  1B0X A;  5J2J A;  2N9X A;  2L0F A;  4D2K A;  1EXN A;  1LFD A;  4N58 A;  3TAD A;  4DLE A;  4NJ7 A;  2XVT A;  3TJP A;  2ON8 A;  4YQW A;  1BML C;  2LD9 A;  4USA A;  4CF4 A;  5KFM A;  3AH7 A;  5J0W A;  3L17 A;  2AHO B;  1QH9 A;  2F3N A;  2NRZ A;  4UB5 A;  5DG8 A;  3KUD B;  4BKT A;  4O3N A;  3KUZ A;  4GIV A;  3NGD A;  3VUY A;  2N1R A;  1TGZ B;  1YIW A;  2BF8 B;  5IA7 A;  4FHK A;  3HM6 X;  3M8R A;  4HDO A;  2RD0 A;  5L1K A;  3H0L B;  7ICJ A;  2IND C;  1Y88 A;  4JMU A;  3APC A;  3RT3 B;  1L8L A;  3PV8 A;  3B0X A;  2QAR A;  1L7M A;  2WX0 A;  3N1Z C;  3ORY A;  2KYW A;  4IWO A;  5HHH A;  3QK0 A;  4M6W B;  2IZV B;  4J03 A;  2JZP A;  1T3Q A;  4J9M A;  1TV9 A;  4PYZ A;  1A6S A;  1SF0 A;  1V5T A;  3BZK A;  3PNC A;  2KK8 A;  5TZV A;  1ZQ1 C;  1XSP A;  1WG8 A;  1ZQZ A;  1SE9 A;  3PLU A;  1U49 A;  4F8R A;  5ALM A;  2K22 A;  4TMA B;  1QSY A;  3TL5 A;  4HEA 1;  4JLC A;  1WXM A;  5K4L A;  5ALW A;  2UVR A;  3H8M A;  1WSP A;  1XCT L;  5DKW A;  3WKD A;  5JXV A;  2V3N A;  5MPO A;  1ZDV A;  3OAW A;  3PT2 B;  1T0Y A;  1K1Q A;  3DDH A;  3GZN B;  1EWC A;  3ZIM A;  3H7P A;  5AKL A;  2PFP A;  4KN4 A;  2RDI A;  5KFQ A;  2XO7 A;  1MQ3 A;  3AQE A;  4WWP A;  4EZL A;  4YG2 A;  9ICM A;  4BWM A;  4ICA A;  2IO2 B;  2JHD A;  2IO0 B;  1S97 A;  2BQQ A;  1U4B A;  2XK5 A;  3MP9 A;  3P63 A;  3N97 B;  2DZM A;  1IP9 A;  4DL2 A;  5G2N A;  2HVI A;  3BZC A;  2AGO A;  4KLI A;  2BCQ A;  1J8C A;  2JSV X;  1K52 A;  4X5V A;  4KSK C;  2EAP A;  1ZJM A;  4I29 A;  3C19 A;  3M6K A;  3RFZ B;  4JB3 A;  2ZNV B;  4OJ5 A;  1GJZ A;  5FR6 A;  4WQM A;  5C23 A;  2R8J A;  2JXJ A;  1MHX A;  2NRX A;  5J2F A;  2IBK A;  3SFE B;  4S17 A;  4ECX A;  1GOZ A;  2GOW A;  2KTF A;  5KFA A;  1L3U A;  2FPL A;  4MAC A;  3Q8S B;  4ARC A;  3PO4 A;  5J17 A;  3FAH A;  5BMG A;  4WAF A;  3LVV A;  2PEA A;  3OTQ A;  3ZNI D;  2K4P A;  3RZF A;  2RP5 A;  2RR9 A;  2J53 A;  4IG7 B;  2C9W B;  4TUU A;  1ZXI A;  4YXJ A;  1FO4 A;  3HVD A;  4KZ0 A;  2E6X A;  3PZP A;  3GE8 C;  1XLO A;  3VRB B;  1XNS A;  1WZ3 A;  2ZJA A;  3ZVV A;  8ICY A;  2GI9 A;  2JZB A;  2HJ8 A;  5J0P A;  3K1R B;  1TK8 A;  1HTO A;  2MBH A;  1WWV A;  3M3J A;  4MF8 A;  5BYQ A;  3PML A;  4AYB F;  4Q44 A;  1M6Y A;  3HW8 A;  3C29 A;  4B9M A;  3RJG A;  1CMX B;  2NBU A;  1ZQK A;  3N7S C;  8ICK A;  2K6Q A;  2EAO A;  1LGR A;  3QWZ B;  4P2H A;  5HR6 A;  1PK1 B;  4C56 C;  1FCC C;  2HBK A;  1RWS A;  4FJZ A;  2KDE B;  4KX6 B;  4GSW A;  2PPH A;  3U2S C;  1IM4 A;  3RJE A;  4Z6E A;  1NK5 A;  2KKV A;  3NVY A;  2Y5P A;  5J2D A;  5T14 A;  3QU9 A;  3PGE A;  5KT7 A;  1PYW D;  2N1V A;  4QZD A;  1PGB A;  1IXR A;  2LBO A;  5J0T A;  1VCB A;  3TBL D;  1V9P A;  5ALV A;  1D3Z A;  4O1N A;  4Y2J A;  3C8Y A;  2HHX A;  1MSW D;  2ZIV B;  2LVQ A;  4P16 A;  5HP4 A;  4G9B A;  5J2G A;  2J6T A;  4TUS A;  4FBJ B;  3EPI A;  3VVW B;  1G6J A;  2H3I A;  3CRX A;  4QWE A;  1ED1 A;  2MHJ A;  1E0Z A;  3HIZ A;  2KHQ A;  3TAC B;  4U6P A;  1ZQL A;  4IOI E;  4ECQ A;  1HA5 A;  4MJS A;  1IG6 A;  2BCR A;  4RGN A;  3AE6 B;  4MSQ B;  5T8I A;  4HRO A;  3T5K A;  2EEL A;  2AQ2 B;  9ICS A;  1DOX A;  3WK4 A;  5IIO A;  2VJ5 A;  3EZ5 A;  3KFU F;  1KLN A;  3BQT A;  1VJK A;  2OJW A;  2F76 X;  5KFV A;  4HPM B;  3TAR A;  3WAN A;  2WF7 A;  2HJ1 A;  1A70 A;  1WJU A;  3WAO A;  1YX6 B;  5KFW A;  4C4V B;  1S77 D;  3RAQ A;  8ICM A;  3VR9 B;  3KH0 A;  1H38 A;  3WK8 A;  9ICW A;  3SQI A;  4B9N A;  1Q1O A;  5C5J A;  3R66 C;  4RH6 A;  1JWM D;  1V2Y A;  3ETL A;  1XLN A;  1SSN A;  3QE9 Y;  2RDB C;  4KGS A;  3LYS A;  5GMV A;  1ZQW A;  2ZIX B;  3QNM A;  3C2M A;  5ALJ A;  4UDU C;  4RNN A;  1KL9 A;  2P6U A;  1MI0 A;  2B3A A;  4YTN B;  4FJV B;  2BQR A;  4AJW A;  5FK9 C;  1EF1 A;  5AI6 A;  2KFK B;  4MGY E;  3I1Y A;  3ETR A;  3URY A;  8ICX A;  3UF8 A;  4C4T A;  1UZX B;  1AYF A;  5BOL A;  4M0A A;  2N1W A;  2KJ8 A;  4KIT B;  4DWI A;  3DVG Y;  5D3D A;  4IWQ A;  2R8I A;  4IC7 B;  3IT6 B;  4K7W A;  2KAN A;  1UBQ A;  2WF5 A;  2MUT B;  1C3T A;  2Z0E B;  3ZQ4 A;  2G3Q B;  2G08 A;  3MR2 A;  2W9N A;  2E8O A;  1XWL A;  5AHX A;  2AGQ A;  2R61 A;  2ZTC A;  4N6E B;  4Y2U A;  5DB6 A;  1WGK A;  2LEK A;  3ISB A;  1NJZ A;  1WF9 A;  4PS7 A;  1QOB A;  3W2D A;  1ZYQ A;  4ZOH C;  1CUK A;  1CEZ A;  2WXM A;  3R8B A;  1ZKH A;  2M4N A;  1UD7 A;  3H1U A;  1TKD A;  2L7R A;  1JN3 A;  1E5W A;  2IPK D;  2KJH B;  3B1L X;  3I28 A;  4A90 A;  2YMQ A;  4ZRQ A;  1BGX T;  4I6P A;  4ANW A;  1KRP A;  2ZXH A;  1L7O A;  2PFO A;  3VQI A;  2A19 A;  2X8X X;  4MSM B;  4YP3 A;  3NRZ A;  2M0N A;  1WJ4 A;  5KFD A;  2KSO B;  2KDF B;  2KC2 A;  5EWG A;  2KDM A;  5ALI A;  3QAQ A;  3TEZ A;  1RPL A;  1J0G A;  1J2M A;  4KLE A;  4HRS A;  1KSP A;  3MAB A;  1C20 A;  2JUO A;  4F5N A;  3PX0 A;  3H40 A;  1J97 A;  2KWC A;  4LVS A;  1NOM A;  1BPB A;  5HG2 A;  1TKY A;  2JQR B;  1L6V A;  4KIK B;  5KFF A;  4NPN A;  2W9M A;  2WF8 A;  1C78 A;  2RHF A;  2W8K A;  1IGD A;  9ICH A;  4QNL A;  1WXQ A;  2PVO D;  4RT3 A;  3E58 A;  4DL5 A;  1XT9 B;  3OHA A;  3AE5 B;  1UT5 A;  2QIE B;  1K5O A;  4AUQ C;  2YB4 A;  4EX6 A;  4UAS A;  4RT2 A;  5ALY A;  4RQ0 A;  3JPT A;  3T9L A;  1XO3 A;  2ATL A;  3CW2 C;  4O0I A;  2ZG6 A;  2XY7 A;  3H6N A;  4EBD A;  4TV3 A;  1K51 A;  3OJ4 B;  5DPW A;  3WKA A;  2FCM A;  2ZUB A;  3QCA A;  2IOF A;  1YQ4 B;  1V8C A;  2WWZ A;  3AE8 B;  1O03 A;  1K53 A;  1F1H A;  4FJY A;  2AH5 A;  3AUO A;  1ZQD A;  2MCN B;  2BQ3 A;  1KDH A;  2XN9 C;  1CK1 A;  1KFD A;  3W9C B;  4P4M A;  1RZT A;  1MA7 A;  4WJO A;  1XC9 A;  2XBB C;  3Q8L A;  3PR4 A;  2NCN A;  3PRP B;  4GXB A;  3G6X A;  4JIO U;  2ZW0 A;  4P0Q B;  1V81 A;  4G50 A;  3LYY A;  4O5C A;  2WXN A;  3X23 A;  7ICU A;  4KSL C;  4JGH B;  1ZXH A;  4AOF A;  1XLP A;  5IP4 D;  2W9B A;  3R9K A;  1UGJ A;  4RPY A;  3PSF A;  5H8Y E;  4IQW A;  5DLF A;  1EU3 A;  2EMS A;  2TSS A;  3JPS A;  4ZYS A;  4KN7 A;  5BYS A;  4ED8 A;  2WGS A;  3GZF A;  3BYT B;  4UAV A;  8ICF A;  2PI4 A;  5AM4 A;  1V9J A;  2I2Y A;  1JUD A;  5E6J A;  3U30 A;  4MT5 A;  1WMH B;  1KTK A;  4F50 A;  4IWP A;  4RQ6 A;  4IC9 A;  2CR5 A;  2V4I B;  3NZ3 A;  3T3N A;  8ICA A;  1I7H A;  4M6W A;  1F77 A;  3RRH A;  3O65 B;  7ICM A;  5J2E A;  2WXO A;  3A0B U;  1ZOL A;  4AJY B;  1X6I A;  2FPM A;  4DDG D;  5DQG A;  2VRR B;  3RH4 A;  2JZ3 B;  2DEN B;  4TQ1 A;  2RDJ A;  2Q0Z X;  4CCH A;  1IUE A;  1SE4 A;  3K75 D;  2LI5 A;  4PYU A;  1GPX A;  2W55 A;  2BQU A;  1YOV B;  2K8B A;  2KDI A;  2Z59 B;  4E71 A;  4AQ7 A;  4M9H A;  2QLT A;  2JH7 A;  2DF4 B;  5DB8 A;  2YMM A;  3DPD A;  3L08 A;  1SL1 A;  2KNB A;  2V4L A;  5JH5 C;  1WJN A;  2CXY A;  5KAF U;  1ZQH A;  2DL0 A;  4I2I A;  4M9L A;  3V6J A;  2K8B B;  1WX9 A;  2L05 A;  2V9H A;  1LKY B;  3U4E G;  4EEY A;  4DK5 A;  1WRI A;  5KFH A;  4RZR A;  5C2T B;  4KLM A;  2HHV A;  4PH5 A;  2RQ5 A;  3RB4 A;  3UGB B;  4BOS C;  3KLS X;  1ARO P;  2V4R A;  4W9I A;  3IT4 B;  2KTR B;  3MFI A;  2YLM A;  3UQB A;  3IRU A;  2JEF A;  1R7S A;  2JH1 A;  2OYY A;  3MC9 A;  3QX7 A;  4M9J A;  2DWQ A;  4RPZ A;  4IUM B;  4ECR A;  1JCK B;  5DBB A;  3Q8F A;  3KQ4 A;  2LM4 A;  4J9Q A;  2NYV A;  5CWR A;  1ZQE A;  2K5P A;  4RUA A;  1NEN B;  4L1B A;  2K8C A;  4DOA A;  2GLS A;  3U7D A;  1SKW A;  2WYQ A;  4AP9 A;  1GUA B;  5IIK A;  3VTV A;  5AKG A;  1OEY J;  2O6V A;  5AK5 A;  3UQ0 A;  1C77 A;  2AQ1 B;  1C9F A;  4RQ7 A;  2CHZ A;  7ICS A;  4PGQ A;  2FBW B;  4RF0 A;  1WH3 A;  2HW3 A;  4NLG A;  2LYA A;  1YNT E;  2QB1 A;  4KDI C;  5I4D A;  1SE3 A;  2FMS A;  7ICG A;  3RTV A;  4HWI B;  4IW0 A;  1C79 A;  2EZY A;  1TZO A;  1L4D B;  1D6E C;  1LVH A;  1AW7 A;  2JU6 X;  3NVZ A;  3VFK A;  8ICU A;  1WCL A;  1KH0 A;  1N63 A;  2W9C A;  2J6S A;  2BVC A;  2C22 A;  2NR2 A;  4K7S A;  4J9L A;  2RPV A;  3T5L A;  3RBE A;  1SWV A;  2ZTD A;  1N56 A;  3I9V 1;  4PS3 A;  2C60 A;  2ASJ A;  2PTL A;  4YXD B;  1ZD3 A;  4IDI A;  4NJ8 A;  2MQJ A;  3BVZ A;  5HML A;  4QWD A;  3DBH B;  4HJG E;  1ZD2 P;  2E3T A;  2V4Q A;  4IR9 A;  5HNK A;  2AQ4 A;  4DSI A;  1FCL A;  2JT4 B;  5KG0 A;  2YB1 A;  2ZPY A;  2HCF A;  3PRZ A;  1R4N B;  1UH6 A;  2WB1 F;  1ZJN A;  5ALZ A;  4M47 A;  4J9P A;  4HJK A;  3RJK A;  1AWD A;  2GLE A;  2WHE A;  4KLT A;  4NQK E;  2JYT A;  4LK0 M;  1WR1 A;  5JHB A;  4IRK A;  4PZO A;  2CRX A;  4GB9 A;  3B0Y A;  2D2Q A;  2DZK A;  3AEV A;  2EKI A;  4FXC A;  3R2T A;  1JMS A;  2AXT U;  4L23 A;  3N4M B;  1NDD A;  3DVG X;  1NKE A;  2D6F C;  3ZDB A;  2DYB A;  4F1S A;  8ICR A;  5EWE A;  1IIP A;  2R8K A;  2OWO A;  1HIW A;  2BS2 B;  2P66 A;  5KG3 A;  2KK0 A;  4KMO B;  3GV5 B;  2V1Y A;  3IDW A;  3AEB B;  2BYV E;  5HMM A;  5CJ7 A;  9ICV A;  1TIF A;  2ZNV C;  1N5W A;  2HTM E;  2NMQ A;  3M9O B;  3A9J B;  4P4O A;  4A20 A;  3UI3 A;  2BBC A;  3MJ5 A;  3NG0 A;  3TAD C;  1NEK B;  4KLO A;  4LJP B;  4KLD A;  2HMX A;  4KV2 A;  3QU7 A;  2DHZ A;  4I2A A;  1T6B X;  2GBR A;  1AQ6 A;  1PK1 A;  1WFY A;  3ZTD A;  3WU2 U;  1JX4 A;  2AWT A;  4GOC A;  2ZCB A;  2N9P C;  3KHR A;  1V5O A;  2ZTE A;  1VJ5 A;  3VAW A;  1SXD A;  3AQF A;  2DKX A;  4MHV A;  4Y2Q A;  4M0W B;  3AU6 A;  4QIW C;  4N9F 4;  4EEW A;  1TAM A;  5III A;  3RN9 C;  1GB1 A;  2H3V A;  3PW4 A;  1TVA A;  1FFU A;  5JTI A;  4F4Z A;  1QCK A;  2Y3A A;  4TUP A;  4YMO A;  1TK5 A;  2WP9 B;  1D4B A;  3F5A A;  2H88 B;  1PVQ A;  1FRR A;  3C5F A;  1HEK A;  2IOF K;  1TY2 A;  4PHA A;  2DLB A;  2JRI B;  4ECV A;  4EX7 A;  1I4G A;  3IAS 1;  2KX3 A;  5AM0 A;  3Q8B A;  4BWJ A;  4UB4 A;  4NZL B;  1L0X B;  4YN4 A;  3VH4 B;  1ZQU A;  1XS9 D;  2BDU A;  1ACC A;  4JPS A;  4BXO B;  5GXG B;  3VC8 A;  1OFF A;  1MVK A;  2ZZP B;  2CHW A;  2JRH A;  2FID A;  4G3I A;  4WH4 A;  4A8X C;  4KGR A;  1V86 A;  5CHV C;  1VRA B;  4DSE A;  4YL8 A;  1D9F A;  4M02 A;  1B9R A;  1SIJ A;  2VA2 A;  2KFZ A;  4J3O D;  4I2C A;  2KE7 A;  4UBC A;  1PQS A;  5KFE A;  2JZZ A;  5JRT A;  4UB2 A;  4I2J A;  2ZIX A;  2OED A;  5ALN A;  3A4R A;  1WWU A;  3PO0 A;  4KMU A;  2VKQ A;  4QZE A;  3RI7 C;  1WGY A;  4ITK A;  2L5Y A;  5DGB A;  2MP2 A;  4ZRI A;  4US9 A;  4MFF A;  5D94 A;  4HK2 A;  3RF9 A;  4RQ1 A;  2HTH A;  2G09 A;  4DL3 A;  1CRX A;  4YMM A;  3AEG B;  5J8Y A;  2PI5 A;  4YSY B;  3FC4 A;  1XU4 A;  2ASD A;  2VA8 A;  4I28 A;  1V85 A;  5AUI A;  4RU9 A;  1DOI A;  2FLP A;  3RAX A;  2BPS A;  1PGA A;  1ZQI A;  2YQE A;  1WRD B;  1X6J A;  2J0K A;  1JIH A;  4W9G A;  1K8R B;  4JWN A;  3VDZ A;  1TE2 A;  2D3C A;  5EE0 A;  5DG9 A;  2DZI A;  1ZQO A;  2KN4 A;  1Y8R C;  3JPR A;  3TQ1 A;  4MJS B;  3DOW A;  3HHM A;  3ZNH B;  3B0A A;  3MJW A;  2WXJ A;  4KTQ A;  3E56 A;  1L2N A;  4NL9 C;  1Y56 A;  3FM9 A;  2KFK A;  2JR5 A;  2VH2 A;  4CGZ A;  5G5G A;  3FYH A;  3GIL A;  1YMH E;  2KVS A;  2BYF A;  5HHD G;  1RAX A;  2A1A A;  4TQ0 A;  2WLB A;  2EAM A;  5J2C A;  4UAW A;  4LJX A;  1OQQ A;  1SGG A;  1RYS A;  4NNJ B;  2A1J A;  3GV7 B;  2KLG A;  2NS5 A;  4EZ9 A;  1ZRN A;  1FIQ A;  1ZQR A;  1P0R A;  1EM7 A;  3ECI A;  3MC0 B;  4LDT B;  1WXS A;  4WAA A;  1KLV A;  2ALZ A;  5CRX A;  2D10 A;  1RFA A;  2LJI A;  2GBJ A;  9ICE A;  3UM9 A;  3DVN U;  1D9D A;  3AXC A;  5BMH A;  1HZ6 A;  3MGH A;  4JV1 A;  4M00 A;  2Q4T A;  2AU0 A;  1A76 A;  1YZ7 A;  2ISP A;  1WGR A;  4EFO A;  5BYR A;  4FZN A;  1D5X C;  4DSK A;  1F0M A;  3GS2 A;  1D8B A;  1QZE A;  5KG7 A;  3M8S A;  4HCP B;  5J0X A;  3WKC A;  3MC1 A;  3QEA Z;  4S0R A;  4UB1 A;  8ICH A;  3AUL A;  2CJO A;  2KWU B;  2W11 A;  2LVO A;  4XC2 A;  2G4S A;  2H3Z A;  3KOO A;  4Q8E A;  1D5M C;  3B2G A;  1S0V A;  4JL9 A;  4NJ6 A;  2NRT A;  3E0F A;  1ZQN A;  3PSE B;  2KQ4 X;  4WUR A;  3MGV A;  4K1R B;  1L4Z B;  5KG2 A;  4O3R A;  5C1Z A;  5C3J B;  7ICK A;  5AI0 A;  1S9F A;  4C8K A;  3N1Y C;  1KRH A;  4Y2T A;  2FCQ A;  3QYP A;  3RUI B;  4GC7 A;  1XSL A;  3NS1 A;  3NRW A;  2P35 A;  7ICH A;  1L7N A;  1NI3 A;  5J0Q A;  8ICO A;  2ZIW A;  3TFS A;  4FFD A;  2SAK A;  5DPR A;  1NZB A;  2WDV B;  1Q3U A;  1MQ2 A;  4K4H A;  3HIL A;  3RR8 A;  4OZB A;  4KLL A;  2E1E A;  5L1L A;  2WU5 B;  1YN5 A;  2HHU A;  4BOZ B;  4OVZ A;  4JK1 A;  1GO3 F;  1ZW7 A;  1F9J A;  4G11 A;  4ZYN A;  1IYF A;  2D3G A;  2XY6 A;  2DAF A;  3V61 A;  1UT8 A;  1E9M A;  2R2O A;  1EU4 A;  1F52 A;  2BT6 A;  2Z8L A;  5J0R A;  1DGS A;  1I4X A;  2N7J A;  5CX3 A;  2NO5 A;  3F5E A;  3H4B A;  2WF9 A;  5DQI A;  4J9K A;  4DFK A;  2G45 B;  2ONQ A;  4BUG A;  5KFZ A;  1T4G A;  2XK5 B;  3R2I A;  4EEN A;  4I2D A;  2E8P A;  2G1E A;  4B6W A;  1KTQ A;  3H8W A;  2BHN A;  4LNN A;  5G5H A;  2RGF A;  2KFJ A;  4QAY A;  3Q2A C;  4O3Q A;  5ALK A;  3H7P B;  4UAY A;  9ICL A;  1LB2 B;  1WMH A;  1X42 A;  3QZ8 A;  4FUL A;  3EUB 2;  5DB9 A;  3JW0 X;  4DQS A;  4QIW F;  4Q45 A;  1DOQ A;  4O3M A;  1ZQV A;  1DXS A;  1IV8 A;  3ZDD A;  1QIL A;  3MBY A;  4ANV A;  3PW5 A;  3SV4 A;  5D46 A;  3DBH I;  3RJJ A;  2DKZ A;  1RXW A;  3B08 A;  2Y9U A;  5D2M B;  7ICL A;  4DQQ A;  1JW9 D;  5EE9 A;  5KFJ A;  4I2F A;  2YN4 A;  3PLV A;  2C5L C;  1HUO A;  4O9M A;  3KHL A;  5AIC A;  3U7Z A;  3NHE B;  3M6Z A;  1UNS A;  1Z5S B;  4JUZ A;  2N0S B;  4WIP A;  5DPS A;  2VA3 A;  4Z6D A;  1E8Z A;  4F7Z A;  3MR6 A;  1T0R C;  4OD0 A;  3UMB A;  3KWL A;  1RG6 A;  3IVF A;  2KWV B;  8ICJ A;  3A9J A;  1SL0 A;  3ISC A;  2MLB A;  4BFR A;  4UQG A;  3K4G A;  3UXP A;  2L1A A;  3EW9 A;  2NTS A;  1QOA A;  3C23 A;  2M1M A;  3ZKJ C;  1K50 A;  4RF1 A;  1WM2 A;  1A0P A;  4W9E A;  4Y2P A;  1NYQ A;  4DL4 A;  3X0W A;  3NS8 A;  1IGC A;  1VD2 A;  5KFB A;  4PHE A;  9ICK A;  4DQR A;  2KVR A;  3CP8 A;  3N30 A;  1SV4 A;  4F4Y A;  1LO5 D;  4RGO S;  3O0F A;  1L0Y B;  4DHZ E;  8ICV A;  2PKO A;  3W5V B;  2KX0 A;  2UWQ A;  4C00 A;  3LWL A;  1ZD4 A;  3GDX A;  3G6V A;  1WZ0 A;  1P7F A;  2OCE A;  3AV8 A;  3MTN B;  2LUE A;  3T79 A;  4P0Q A;  1V1O A;  2A4Z A;  3N1X C;  5AK4 A;  4HKQ A;  3ZDT A;  2KVZ A;  5J2K A;  4PHD A;  4DQI A;  3OSN A;  4R63 A;  3DBR B;  2KEY A;  1Z4O A;  2ZIV A;  4IRD A;  1NZP A;  1ZQS A;  2MBE A;  9ICG A;  3CF6 E;  2VH1 A;  3F2D A;  4KX3 A;  4NAM A;  4QW9 A;  4UAT A;  4M04 A;  3KKA A;  3BVM A;  1QQR A;  1FPY A;  1WM3 A;  2KZM A;  3N9Y C;  4YFK A;  4R8U B;  9ICJ A;  1UEL A;  3U26 A;  2GRI A;  2KKC A;  4JV2 A;  4DDI D;  1F5S A;  4DSF A;  5E6N A;  4R64 A;  4GLS C;  1NKC A;  3V7J A;  2KN7 A;  4MEL A;  4CNQ A;  3T8M A;  4PL2 A;  1UWM A;  2MWS B;  3V6E B;  4LNF A;  2B0C A;  2UYZ B;  3PO5 A;  1JRU A;  2LYB A;  2KD0 A;  4RFB A;  3KD3 A;  5KFU A;  4MF2 A;  2QKQ A;  2R8H A;  1Z3E B;  1ROE A;  2Y9T A;  2ZIW B;  2BPF A;  1MFW A;  2N7D A;  3T5H A;  2FCS A;  1HUZ A;  2I1J A;  1QOF A;  2N4F A;  4YXM A;  3DCG A;  3P2B A;  4BXO A;  2YMP A;  3TAP A;  2A3V A;  4C8L A;  3OJU A;  3QZ7 A;  2QB0 B;  1DK2 A;  4FE3 A;  3OHB A;  4M0W A;  4YSX B;  4NM2 A;  4CE6 A;  2KDB A;  3A9K A;  3VUX A;  1YZ6 A;  2JVC A;  1U48 A;  4WJQ A;  1T0Q C;  2ESE A;  2LWP A;  2YX8 A;  1TAU A;  2ZEQ A;  3B2F A;  1HEZ E;  1ESF A;  1Z1B A;  2L0T A;  1I35 A;  3ZNG C;  2KO3 A;  2EMT A;  1YJ1 A;  4DL6 A;  1N2X A;  5AIA A;  9ICP A;  3HP6 A;  2OHF A;  5IIL A;  2I9G A;  1J7C A;  1R4M B;  4EZ6 A;  1S1Q B;  4TUR A;  3Q8E A;  3BK2 A;  1YJJ A;  3K9O B;  4I2E A;  3D2N A;  1S0O A;  4L2Y A;  2NRW A;  1SV0 A;  5HKH A;  3ZJU A;  4AYB C;  1L8O A;  2XEW A;  2DUY A;  2C2R A;  3ZDM C;  1D5Z C;  4QZ9 A;  1TTN A;  5ALU A;  4R8U A;  5B5E U;  3FDS A;  9ICF A;  3RNF C;  3OJS A;  3IG8 A;  4XRH A;  4E0D A;  4P0P A;  5J0Y A;  3R7R A;  5C0Y A;  2DPJ A;  5KT3 A;  1DGJ A;  1B1Z A;  1B43 A;  1WR6 E;  2K4H A;  4PL1 A;  1YX5 B;  1RXV A;  3OLM D;  2O2V A;  3OG5 A;  1S5L U;  3KVF B;  2JRZ A;  3PSP A;  4B9U A;  3AEE B;  2FE9 A;  1U4A A;  2LKY A;  4C80 A;  3RNC C;  3WCQ A;  4HVB A;  2KHW B;  4XWT A;  2QHO A;  3PW2 A;  4A3P A;  2HVH A;  2RSU A;  4WWM A;  2BYT A;  2GBM A;  3DBL I;  1HJP A;  2DGZ A;  3SR6 A;  2BR0 A;  1TS5 A;  2H89 B;  4UBB A;  5KFK A;  1COK A;  2WF6 A;  4XWW A;  4NV0 A;  2Q5W D;  3T3F A;  2WHI A;  2G5I B;  3L5K A;  4ED1 A;  2WXP A;  2HHW A;  4NLC A;  2D07 B;  2VZK B;  4N59 A;  5HI1 A;  1RDF A;  4KGT A;  4I2G A;  2E8M A;  2K60 A;  1NKB A;  3ML8 A;  2A5U A;  2BGF A;  4MH0 E;  1GC6 A;  1SIF A;  2KVC A;  5ALT A;  3W1S A;  2N9K A;  4G3X B;  3I57 A;  4YCX A;  2IOH A;  4ANU A;  4GDL B;  7ICV A;  3HUI A;  1PVR A;  2ZJ5 A;  1X9W A;  4I2B A;  1SXE A;  1ZQG A;  2LRW A;  3Q3J A;  5J2B A;  4HDQ A;  2DZJ A;  2NPT A;  3MFH A;  3NZU A;  2O6V B;  5AKH A;  5AKY A;  1NBF C;  4M01 A;  3MHZ A;  2ZCC A;  3RJI A;  2RRD A;  3CST A;  5EE1 A;  3EYZ A;  9ICA A;  2KJ9 A;  4ELV A;  2Y5B B;  4LLG M;  4F91 B;  4RQ2 A;  2FDR A;  5KFC A;  2KMC A;  4GDK A;  4K81 A;  3JPO A;  1JWB D;  3PHX B;  4JWM A;  3DV9 A;  3RBD A;  4MGI E;  3D6J A;  4ECY A;  2JZB B;  3DHG C;  3R3M A;  2CPR A;  1AAR A;  5KTQ A;  4RGT A;  4MGK E;  3RNA C;  5DB7 A;  4ZH4 A;  1T5X D;  4I27 A;  4OZA A;  3VHT C;  1SWW A;  3NTU A;  4ELT A;  2M17 A;  3P1M A;  3MC8 A;  3S2A A;  3VRA B;  3ZO5 B;  5AM5 A;  4B9V A;  4B6J A;  3Q6B A;  1DK3 A;  4EBE A;  2GOL A;  1KF6 B;  2K3U A;  3U8Z A;  1LKY A;  3M9N B;  1KFS A;  3GU3 A;  2MP2 B;  4KZC A;  4UB8 U;  1X9S A;  3GOE A;  4ZRK A;  2JY6 A;  4P1B C;  3M9M B;  5A0L A;  2IMW P;  8ICT A;  1ZE3 D;  1ECW A;  1N48 A;  2F77 X;  1S3S G;  4CHK A;  3AM9 A;  1FRD A;  2HSZ A;  4C8N A;  4QZI A;  4FAD A;  3RNG C;  4OO1 J;  5DG7 A;  3EGR A;  5KG1 A;  2GH1 A;  1L0V B;  4OVV A;  3QHT A;  1HZ5 A;  3SV3 A;  4F2S A;  3HWT A;  3GQC A;  2FIF A;  1HTQ A;  4P6V F;  3RB0 A;  3BY4 B;  3GE3 C;  3PSI A;  2C7M B;  4IRC A;  1VZ8 A;  3SMV A;  3N32 A;  2PFQ A;  2DAJ A;  2DX5 B;  1MC8 A;  2LMC A;  2M56 B;  4MDK E;  1KJT A;  3AE7 B;  2KZZ A;  2HE7 A;  5ALQ A;  1ISN A;  3UQA A;  4ED3 A;  2JX5 A;  4DLG A;  1BXT A;  3R7Q A;  4XDC A;  1PUT A;  2WU2 B;  2OH2 A;  1F2R C;  1FD6 A;  4OCZ A;  3KBB A;  1E7V A;  5E6O A;  5J18 A;  4B0M A;  3ZGZ A;  1KOT A;  1TS2 A;  4I6N B;  2XCA A;  4W9D A;  5AI8 A;  4M2Y A;  1GC7 A;  3KTQ A;  4TSS A;  4KLQ A;  2BKE A;  4MGZ E;  3ICX A;  4DSJ A;  4YT0 B;  3KYC D;  1RYU A;  2IGH A;  1J2N A;  1UUP A;  2W9B B;  1WIA A;  2J0M A;  9ICC A;  5ALO A;  5JUM A;  1COO A;  1GG3 A;  4IM3 A;  4IR1 A;  1SB3 C;  3PVL A;  2Y1I A;  3UMG A;  3I76 A;  7ICN A;  2C28 A;  2W04 A;  4A55 A;  2WX1 A;  3FIL A;  3RMK C;  2K4E A;  3C28 A;  2FCN A;  4C4R A;  5IN7 A;  4A6Q A;  2L76 A;  2PIA A;  1B4F A;  1FNU A;  4Y2V A;  5KFG A;  3Q8Q B;  1GAQ B;  4M8M A;  3AMZ A;  3QIJ A;  2XIC A;  5DCN A;  2WAQ F;  3FIL B;  2W3R A;  2PMZ C;  4OW0 A;  1TKG A;  3I63 C;  3D2S A;  4RM8 A;  4W9K A;  1XO0 A;  8ICS A;  2A1J B;  2INN E;  2MEK A;  5KFI A;  2IHN A;  2K4I A;  3PZ8 A;  2OM6 A;  2I38 A;  1UA0 A;  2LHD A;  4XYC A;  1UF0 A;  2E5S A;  1F2R I;  1ZPS A;  3W1S C;  5LXH A;  3TAN A;  4I2H A;  4YTM B;  3H9D A;  8ICC A;  5CP2 A;  3IBE A;  2F8K A;  2GMI C;  1GNU A;  1I4P A;  1JQ4 A;  3ZDE A;  2W7P A;  3ONS A;  4PHP A;  2KZR A;  3N28 A;  2V3S A;  4LCD E;  3A4S C;  1EWY C;  1L7P A;  5CTR C;  4BDP A;  3RCZ A;  2QAR B;  5J2H A;  5J0U A;  3C0R B;  2LHE A;  3PY8 A;  2KKP A;  3UPQ A;  2LM1 A;  3OPX A;  4DHJ B;  2LXA A;  4HXD A;  2VIX A;  3H0R B;  1SBB B;  2AX5 A;  2JXT A;  3ZRC A;  2WS3 B;  3P4P B;  3C1Y A;  1A5R A;  1UBI A;  2XGQ A;  3IN5 A;  4GXJ A;  3V6K A;  3HT3 A;  2LGS A;  1VDV A;  1UWX A;  4P7I A;  5KNI A;  1TT5 B;  5KT2 A;  4RQ4 A;  3HX0 A;  4XGA B;  4DS4 A;  2NTT A;  4K4G A;  1BUI C;  5JU5 A;  2ISO A;  1JWS D;  5L1M A;  1PUZ A;  1V97 A;  5KFL A;  4Z6F A;  1FXT B;  2ZW1 A;  2YVC A;  2ZVN A;  3WK9 A;  5D6J B;  3TI0 A;  3HK0 A;  3JYU A;  5LLI A;  2UU7 A;  3Q3F A;  4PK1 A;  4Y2R A;  1Z19 A;  5KL1 B;  2R2Q A;  1QOG A;  1WY8 A;  1V6E A;  1O08 A;  4OHJ A;  3L4P A;  4UW9 A;  3SEI A;  1SV0 C;  4NAW B;  4EKU A;  1TBE A;  3WKB A;  4MM3 A;  5CEH A;  9ICR A;  1NYR A;  2XY5 A;  5AK3 A;  3SD7 A;  3LXF A;  1U47 A;  2L00 B;  1JXL A;  2KG5 A;  2UVW A;  2MA1 A;  4F72 A;  1OW5 A;  1WGH A;  4ARI A;  4ICV A;  4CF5 A;  1WI0 A;  4FS2 A;  1P1A A;  5EE3 A;  2NBW B;  4NXZ A;  2M19 A;  3PW0 A;  2VZK D;  4W9H A;  1SXT A;  3P4Q B;  1WYW B;  3BS7 A;  3PX4 A;  4YR3 A;  1LM8 B;  3T5J A;  1YT3 A;  3EPG A;  1KEJ A;  4B9S A;  1UA1 A;  4GIB A;  2HHT A;  3Q8P B;  1NK6 A;  1BT0 A;  2F1J A;  2LRU A;  3BZD B;  1JWA D;  4DQP A;  4KDL B;  5J29 A;  2NBV B;  4GXI A;  3TCA A;  3RR7 A;  3LDA A;  1LV5 A;  1T94 A;  2IYD B;  3ED5 A;  1ENF A;  7ICQ A;  2X38 A;  2ZUD A;  5DDM A;  2O6V D;  9ICU A;  4NLZ A;  2ZJ8 A;  1TK0 A;  2IDY A;  3H0M B;  3CYM A;  4F5R A;  2PJH A;  4M8N A;  4W9J A;  1GB4 A;  1KN5 A;  2QIL A;  3BDP A;  3JSV B;  4FHJ A;  2C2E A;  3IHP C;  2WNM A;  4G0N B;  1Q3V A;  5AI4 A;  2KMA A;  4JX1 C;  4UB6 U;  2REX A;  3TUO A;  4FS1 A;  7ICR A;  2WXG A;  4YWG G;  1NVI D;  4EBC A;  3CWI A;  5J0O A;  3ZDA A;  2KFN A;  1ZRM A;  4KLF A;  2JPH A;  4KKI A;  3U52 E;  4J6I A;  2HBM A;  1ET6 A;  1RYJ A;  2AL6 A;  5JHA A;  2AQ0 A;  3PZD A;  4MEX A;  3BS5 A;  1WUD A;  2JEG A;  8ICE A;  3WAM A;  4DCC A;  1STE A;  3ISD A;  4W9C A;  3H8J A;  5IAA C;  2IJ0 A;  4DF4 A;  1BNP A;  1EO6 A;  5KFS A;  9ICQ A;  4F2R A;  3UIO B;  1WGG A;  1L3V A;  2HHS A;  1KLU D;  3KKA C;  5F3X B;  1BPD A;  1X9M A;  3TKA A;  1Z2M A;  5DQH A;  1PVP A;  3AEF B;  2I1Q A;  3DBR I;  3GIK A;  2HBJ A;  1YD8 U;  5D7G A;  3UMC A;  5TIS U;  2PVG C;  1J7B A;  1WE7 A;  2QCZ A;  3HVZ A;  5AM1 A;  2O2V B;  3RRG A;  2W9C B;  4J9S A;  3EA6 A;  3C1Z A;  3WAL A;  5ALE A;  4LJO B;  1R4M I;  2JWU A;  3K9P B;  1NJW A;  2C2D A;  2NV3 A;  4CF3 A;  2WXF A;  2WXH A;  4OVU A;  3F2C A;  9ICO A;  1QLB B;  3VTW A;  3M62 B;  5J2A A;  3BII D;  4WWN A;  2KN5 A;  4JWU C;  2MJE A;  2K6D B;  2P6R A;  3GB1 A;  2LYH A;  4DXA B;  2CU1 A;  5BOM A;  3AU5 A;  3SD5 A;  4CQN A;  4RM9 A;  1V1P A;  5AI9 A;  3UXO A;  4BBN C;  5IIM A;  3VH3 B;  2KIV A;  2L3Z A;  2WQY B;  4HKZ E;  1OTR B;  2WAQ C;  3ML9 A;  5J2R A;  3H8S A;  4OJ6 A;  3DWM A;  5ALL A;  2HDE A;  4O5K A;  4F5Q A;  3DBS A;  2JGA A;  2DBY A;  1WXA A;  1OGW A;  2K0P A;  2KTR A;  3QUB A;  2F44 A;  2OEH A;  3NZS A;  4A8E A;  3EFC A;  1UCV A;  3UIP B;  2LGX A;  4Y2S A;  3QX1 A;  1E7P B;  8ICI A;  3EHV A;  3RJF A;  1WX8 A;  5CB1 A;  2YEP F;  1X40 A;  2ZXI A;  2MX2 A;  4B95 A;  2L8J A;  3SDL C;  4B9T A;  1J19 A;  3BK1 A;  5EDS A;  3PRM B;  2K89 A;  2MBB B;  4CYE A;  3ALR A;  4IQT A;  5ALG A;  5JZE B;  3KUC B;  4F3O A;  1N6Z A;  3QEB Z;  3Q8C A;  2KLC A;  2DPI A;  2PE9 A;  1X66 A;  3SEB A;  5IOI A;  3DWG C;  1ZDX A;  1CZP A;  2BB6 A;  2QJL A;  2KIW A;  3Q3N C;  5AK6 A;  2F8L A;  1FNV A;  1P3Q U;  1XXG A;  3P42 A;  3ZXR A;  1FNW A;  1KM7 A;  4E3C A;  3KZI U;  2MRP A;  8ICG A;  1XO1 A;  4DQO C;  2FJ6 A;  4HCN B;  2KZ3 A;  3IHQ B;  1FXA A;  4NLK A;  2DYM A;  2QSD A;  2KOB A;  2NO4 A;  4GXK A;  3SAH A;  1TY0 A;  3LVW A;  3OJ3 A;  1Q46 A;  2HOQ A;  5D49 A;  1L5P A;  1ZUD 2;  8ICB A;  3AU4 A;  2MW5 A;  3IAM 1;  2FE8 A;  5DPT A;  3J81 j;  5KFN A;  1RFK A;  1VZ6 A;  2ODG A;  1V80 A;  3L3F X;  2IBI B;  2HD5 B;  1ET9 A;  4ACF A;  4C8O A;  2E8N A;  2V0G A;  4F92 B;  2MA9 B;  2KJ5 A;  4C0Z A;  2L52 A;  3G6Y A;  3I3T B;  1JI7 A;  2R18 A;  1OUQ A;  2GWS A;  4ZRJ A;  4LTU A;  1K1S A;  1SEB D;  4K3C A;  4GDL A;  4RQM A;  2AGP A;  1BNO A;  4REZ A;  1XF5 L;  3Q8R B;  4B0E A;  4PZN A;  3PX6 A;  1VR9 A;  2FAZ A;  2JF5 A;  4H2A A;  3WIM A;  2D8C A;  2HBL A;  1S0M A;  1KFY B;  3DDC B;  1T7P A;  4IL6 U;  1DYQ A;  1YQ3 B;  4TKN A;  3RD2 A;  5KFT A;  4ECZ A;  4YR2 A;  4DWF A;  4C4S A;  2EH9 A;  5AKJ A;  2WDT B;  3JPQ A;  4JE3 B;  1QT9 A;  2H5X A;  4PS8 A;  5KFY A;  1QQ7 A;  4ED2 A;  2J4X A;  3SFD B;  1OEY A;  2Z0D B;  3PRE A;  4XUS A;  4PGX A;  2JWZ A;  2KC1 A;  3PV1 A;  1FEZ A;  4QZG A;  4GC6 A;  9ICB A;  3WKE A;  2BWF A;  1BVS A;  2CKH B;  2RMM A;  3AB5 A;  2I5H A;  4RQ3 A;  4AS1 A;  4MEY A;  3VTU A;  1CQV A;  3V72 A;  2UVV A;  1P9D U;  5CHG A;  4NM1 A;  5F9L A;  1J7A A;  1Q5W B;  1QKZ A;  1ZQT A;  3LK9 A;  3TEY A;  4NL9 A;  1S0N A;  3MFG A;  1EF5 A;  4MM3 B;  4BJQ A;  9ICI A;  1XD3 B;  3PS6 A;  3BQ7 A;  3V6H A;  4KIK A;  3LJ3 A;  4C8M A;  4DFJ A;  5KFP A;  4DFP A;  2YEP B;  2IO3 B;  2QB0 A;  4XA5 A;  3AI5 A;  4GLX A;  2D11 A;  3V7K A;  4FN2 A;  3IG3 A;  4LZG A;  5ALD A;  2W82 A;  2JEJ A;  3TSS A;  4FBU A;  1HXY D;  4XZ4 A;  2EZX A;  3APD A;  1TKE A;  3IP4 B;  1NJY A;  1V38 A;  3CSF A;  2KMM A;  1S10 A;  2KXJ A;  3IFW B;  4XE0 A;  5IO9 A;  2KP7 A;  2PMZ F;  4Z6C A;  3MR3 A;  4R66 A;  1H4R A;  4OJL A;  4P4P A;  2XC9 A;  3GZN I;  4OZC A;  2INC C;  4YMN A;  4QW8 A;  1JRP A;  4F4X A;  2BCV A;  5TR5 A;  4EOY A;  2QDF A;  4ED7 A;  4KLH A;  1P7E A;  3ZD8 A;  4BX9 C;  3RYT A;  3HJE A;  3TFR A;  3UQ2 A;  3S6J A;  5CHF A;  2MU2 A;  2JV3 A;  3KHG A;  3GV8 B;  1BPY A;  3P4R B;  1TAQ A;  3WK7 A;  2M0X A;  3PMN A;  2EKE C;  4MFC A;  1BPZ A;  4I6L B;  3AU2 A;  3HKZ C;  2MAX A;  4EYI B;  3IG5 A;  2CHX A;  3N20 C;  1MPE A;  5AKI A;  1RM6 C;  4QZB A;  1E7U A;  2NRV A;  3H8H A;  3H7S A;  2N9L A;  3SEN A;  4FO6 A;  4DOC A;  2VJ4 A;  3BQ0 A;  2G9H D;  2LMR A;  1L6N A;  2GO7 A;  5DGA A;  3AEC B;  2LXC A;  3A1Q A;  2ZVO A;  2N7E A;  2IY1 B;  2W3S A;  3PST A;  2HHQ A;  1WXV A;  4GN1 A;  2BKF A;  1OQY A;  1HE8 A;  1C1Y B;  1XQQ A;  3QUT A;  3LWM A;  1WYG A;  4QWC A;  5KHQ A;  2ES6 A;  2CU3 A;  3KWV A;  3ZLZ A;  3FKY A;  3PTF C;  1F0Z A;  2F2A B;  3DVN V;  2KWD A;  4YSZ B;  5DBC A;  3PR5 B;  3QU4 A;  4JQW C;  4RNM A;  4BKS D;  3ZYY X;  1JML A;  3CNH A;  3AE1 B;  4RUC A;  2J52 A;  2DFL A;  3RJH A;  1S76 D;  3P4S B;  3V62 A;  1YN3 A;  4ELU A;  2D5G A;  3C5G A;  4O3S A;  1FMA D;  1SKS A;  1I4Q A;  3Q14 C;  4WQO B;  2FLL A;  4KVG B;  1JRO A;  3BQ2 A;  2W54 A;  4DOB A;  5IKC M;  3W1Y A;  3ZXV A;  9ICT A;  4IQV A;  2W43 A;  3VXW A;  2EAN A;  2JEI A;  3A0H U;  3EWA A;  3E2E A;  5IIJ A;  1PFD A;  1FM0 D;  3MDC A;  3HPO A;  4XDD A;  4LNO A;  1EUV B;  3L13 A;  5AKZ A;  2AQ3 B;  4HPP A;  2WXK A;  3L10 B;  1JAL A;  4O5E A;  5E6P A;  3N3K B;  2Y0S F;  4C4V A;  5BPC A;  4MFA A;  3LDZ E;  1WWT A;  5AKX A;  3ENE A;  3DEE A;  1FEH A;  5KG5 A;  1D8Y A;  1LQB A;  1TS4 A;  1NK0 A;  4URK A;  5DDY A;  1BPE A;  1SJE D;  2GB1 A;  4M9G A;  1YQB A;  2PKE A;  1Z00 A;  4YVZ A;  1OQR A;  1XEE A;  3ABV B;  4Y2Y A;  5D4B A;  3QU5 A;  2AYO B;  3RH5 A;  4W9L A;  2IO1 B;  5H2F U;  3W5U B;  2FUH B;  2V3P A;  3ZJV A;  3IV6 A;  2KNJ A;  1ZQF A;  3Q8K A;  2KQ7 A;  2CJN A;  4ZDV A;  1MJD A;  3AEA B;  5L83 A;  1SGH A;  1NNL A;  4X57 B;  1HQR D;  4P0P B;  2KJ6 A;  3BYY B;  2XGP A;  1U9L A;  5AI5 A;  4QZF A;  4QZH A;  4RNA A;  4QWA A;  1PGX A;  3C2L A;  1ZOY B;  2Z7J A;  2MJD A;  3WA0 A;  1KFT A;  4E74 A;  4CO7 A;  2BB5 A;  4O3O A;  1PK3 A;  4ACO A;  4ASW C;  1WCN A;  4EZJ A;  2FMP A;  3ZUN A;  4TUQ A;  1ZQX A;  2PE6 B;  2BWE S;  4K3B A;  1ZP0 B;  1Q10 A;  3M1Y A;  4ANX A;  2EZZ A;  4JV0 A;  1X9X A;  5ALS A;  2G4D B;  4RNO A;  1VZ7 A;  4KLJ A;  1N5X A;  1DRG A;  3L0W B;  2MH7 A; 
#chains in the Genus database with same CATH homology
 1L6U A;  1F2R I;  1ZPS A;  5G5G A;  1YMH E;  5HHD G;  4C56 C;  1FCC C;  2PMV A;  1RWS A;  3V3X A;  4YTM B;  4KKJ A;  4TQ0 A;  2WLB A;  4KX6 B;  2QEJ C;  3U2S C;  1I4P A;  1JQ4 A;  1OQQ A;  3NVY A;  2Y5P A;  3AE4 B;  3RPF C;  1PYW D;  1PGB A;  1EWY C;  1FIQ A;  3MC0 B;  1EM7 A;  4O1N A;  1XCQ L;  2LHE A;  3C8Y A;  3IXS A;  2LJI A;  4GDK B;  3Q8A A;  2LGI A;  1SBB B;  2AX5 A;  2JXT A;  3PZ7 A;  4P16 A;  1HZ6 A;  5BMH A;  2WS3 B;  3P4P B;  3OWE B;  3BWU D;  1VDV A;  1UWX A;  3ZJT A;  5BYR A;  1D5X C;  2NTT A;  3GS2 A;  1BUI C;  1E0Z A;  1JWS D;  4RCO A;  4IOI E;  1HA5 A;  1V97 A;  4RGN A;  2WDQ B;  3AE6 B;  2CJO A;  4PT5 A;  5H92 C;  5T8I A;  4HRO A;  2EEL A;  2ZW1 A;  1D5M C;  3B2G A;  4DXG A;  2AQ2 B;  1DOX A;  2Y5C A;  1VJK A;  1QOG A;  2KQ4 X;  4WUR A;  1A70 A;  4OHJ A;  1L4Z B;  3L4P A;  3VR9 B;  4NAW B;  5C3J B;  1KRH A;  4RH6 A;  1JWM D;  1NYR A;  2WXQ A;  2KAC A;  3LXF A;  2M0A A;  3NS1 A;  1SSN A;  1XLN A;  4KGS A;  1NI3 A;  4ARI A;  2SAK A;  2WDV B;  3NUH B;  5EE3 A;  2M19 A;  2VZK D;  4UDU C;  1SXT A;  3P4Q B;  4OZB A;  1MI0 A;  5AUK A;  2WU5 B;  4YTN B;  1YN5 A;  2WXI A;  5FK9 C;  4OVZ A;  3ETR A;  3URY A;  2ICI A;  3BZD B;  1JWA D;  1AYF A;  3BVG A;  1E9M A;  4C7Y A;  1EU4 A;  2BT6 A;  2Z8L A;  2BS3 B;  5D3D A;  1SE2 A;  1TJE A;  1I4X A;  3IT6 B;  3NVV A;  1ENF A;  2N7J A;  2X38 A;  1QF6 A;  2ONQ A;  4A9A A;  3ZQ4 A;  1JWU D;  2IDY A;  3LB8 C;  4JWS C;  1GB4 A;  2QIL A;  3R2I A;  2G1E A;  2R61 A;  2WNM A;  1FXI A;  1E6E B;  2WXL A;  4JX1 C;  4N6E B;  1WGK A;  1XLQ A;  2LEK A;  5G5H A;  3TUO A;  1QOB A;  2WXG A;  4YWG G;  3W2D A;  1NVI D;  4ZOH C;  3CWI A;  4KKI A;  2WXM A;  3R8B A;  3U52 E;  1ET6 A;  1RYJ A;  2IPK D;  2BS4 B;  4A90 A;  3EUB 2;  4ZRQ A;  3VQI A;  1QIL A;  1STE A;  1C4A A;  3NRZ A;  2KAJ A;  2IJ0 A;  2KDM A;  3TEZ A;  1KLU D;  1JW9 D;  4HRS A;  5EE9 A;  1MHH E;  3AEF B;  2BTE A;  1M4V A;  3U7Z A;  5HG2 A;  5D7G A;  1TKY A;  1UNS A;  1L6V A;  2JQR B;  2N0S B;  2PVG C;  1J7B A;  3HVZ A;  1C78 A;  2RDH A;  3EA6 A;  3KWL A;  1IGD A;  1WXQ A;  2JWU A;  2PVO D;  3Q69 A;  1V1P B;  2L1A A;  1I4H A;  2NTS A;  1QOA A;  3AE5 B;  2WXF A;  1K50 A;  2QIE B;  4RF1 A;  3AE3 B;  4YTP B;  3AE2 B;  2WXH A;  4NJC A;  2LUM A;  1QLB B;  1NYQ A;  1XO3 A;  3BII D;  4JWU C;  1IGC A;  2MJE A;  4ZHO A;  3GB1 A;  2QMT A;  2SEB D;  1LO5 D;  4RGO S;  2B76 B;  1TYG B;  1K51 A;  1L0Y B;  1PDX A;  4CQN A;  2PKO A;  2PW9 A;  3W5V B;  1V1P A;  2WQY B;  1P7F A;  1YQ4 B;  1V8C A;  3AED B;  3AV8 A;  3AE8 B;  1K53 A;  4HKZ E;  3V05 A;  1V1O A;  5FKA C;  4HKQ A;  3DWM A;  2XN9 C;  1CK1 A;  2HDE A;  3TEX A;  3W9C B;  2DBY A;  2K0P A;  2ZW0 A;  4NAM A;  1VLB A;  3LYY A;  2WXN A;  3BVM A;  3AN1 A;  1TS3 A;  1E7P B;  1QQR A;  3N9Y C;  1ZXH A;  1XLP A;  2GRI A;  2YEP F;  3CIR B;  1UGJ A;  3HRD D;  1N62 A;  4GLS C;  5LNK 1;  5H8Y E;  3BK1 A;  1EU3 A;  2TSS A;  2WDR B;  4ZYS A;  5BYS A;  1UWM A;  3BYT B;  2I2Y A;  4RFB A;  4Q2J A;  5E6J A;  4MT5 A;  1ROE A;  3Q8C A;  1KTK A;  4EE2 A;  1CJE A;  3NZ3 A;  2IGG A;  2V4I B;  3SEB A;  4C7Z A;  1QOF A;  3T3N A;  3AE9 B;  1ZDX A;  1I7H A;  1CZP A;  3DWG C;  1F77 A;  2BB6 A;  2QJL A;  1FNV A;  2RDG A;  1XXG A;  3P42 A;  1FNW A;  2WXO A;  4M0W A;  2ACZ B;  4DQO C;  4YSX B;  1E10 A;  1YJI A;  2DYO A;  1FXA A;  2DYM A;  2QSD A;  3B2F A;  2L32 A;  1HEZ E;  1ESF A;  1TY0 A;  4TQ1 A;  1I4R A;  1IUE A;  1SE4 A;  1L5P A;  1ZUD 2;  3IAM 1;  1GPX A;  2W55 A;  5FR3 A;  2FE8 A;  4AQ7 A;  1SJH D;  1C76 A;  2OHF A;  1J7C A;  1RFK A;  1VZ6 A;  3Q8E A;  3BK2 A;  1ET9 A;  1YJJ A;  2J42 A;  3U4E G;  2V0G A;  1C4P A;  2L52 A;  4L2Y A;  5HFY A;  3ZJU A;  1WRI A;  3T3O A;  3B9J A;  1FFV A;  5C2T B;  2MJ3 A;  2K9X A;  4LTU A;  1SEB D;  1D5Z C;  2LFI A;  1YN4 A;  5BMI A;  3KLS X;  4REZ A;  1XF5 L;  3O13 A;  3IT4 B;  4ZRP A;  4B0E A;  2PLP A;  1R7S A;  1AN8 A;  1VR9 A;  2XNA C;  2JYE A;  3AEA B;  4H2A A;  4WIP A;  1KFY B;  2DWQ A;  1JCK B;  1DYQ A;  1YQ3 B;  3Q8F A;  3KQ4 A;  2K5P A;  1DGJ A;  1B1Z A;  1QT9 A;  4JE3 B;  1NEN B;  2J4X A;  3GP7 A;  3SFD B;  4L1B A;  2L83 A;  3J9C A;  3AEE B;  1N61 A;  4C80 A;  3WCQ A;  1IBX A;  3VR8 B;  4XWT A;  2RMM A;  3AB5 A;  4AS1 A;  1C77 A;  2AQ1 B;  4WWM A;  3TEW A;  2BYT A;  4RGM A;  1C9F A;  1CQV A;  5TSS A;  2FBW B;  4RF0 A;  2IGD A;  1J7A A;  1QKZ A;  3SR6 A;  1IBX B;  1TS5 A;  1YNT E;  2H89 B;  4R3D A;  5I4D A;  3TEY A;  3MFG A;  1SE3 A;  5D3I B;  1N60 A;  4XWW A;  2Q5W D;  4MM3 B;  1DOY A;  3E9S A;  1C79 A;  1TZO A;  4US8 A;  2WXP A;  1L4D B;  5HI1 A;  2VZK B;  4DXF A;  4N59 A;  1D6E C;  2JU6 X;  1AW7 A;  4KGT A;  3NVZ A;  2YEP B;  1KH0 A;  1N63 A;  4IKG A;  2WXR A;  3W1S A;  1C4C A;  2N9K A;  2RPV A;  3I9V 1;  3I57 A;  4YXD B;  2PTL A;  2W82 A;  4IDI A;  4GDL B;  3HUI A;  3TSS A;  3BVZ A;  1HXY D;  4HJG E;  1KLG D;  2E3T A;  1TKE A;  1FCL A;  2KMM A;  2FUG 1;  4XE0 A;  4OZC A;  3NVW A;  3MHZ A;  4ZHP A;  4MH8 A;  1JRP A;  2INP E;  2BW2 A;  5EE1 A;  1P7E A;  4D2K A;  4N58 A;  1AWD A;  4LLG M;  2JYT A;  2ON8 A;  4LK0 M;  1BML C;  1JWB D;  4USA A;  3P4R B;  3AH7 A;  2EKI A;  4FXC A;  3R2T A;  4L23 A;  4RGT A;  1MPE A;  1T5X D;  4OZA A;  1RM6 C;  3P1M A;  3VRA B;  3H8H A;  2BS2 B;  2N9L A;  3AEB B;  2G9H D;  1KF6 B;  2K3U A;  3AEC B;  1N5W A;  2HTM E;  2NMQ A;  3UI3 A;  2JZP A;  1T3Q A;  2BBC A;  3MJ5 A;  1NEK B;  2W3S A;  1ZE3 D;  1T6B X;  3AM9 A;  1SF0 A;  1FRD A;  1WYG A;  2CU3 A;  3KWV A;  2K22 A;  1F0Z A;  4TMA B;  2KWD A;  3EGR A;  4HEA 1;  4YSZ B;  1WSP A;  1L0V B;  3ZYY X;  1XCT L;  1HZ5 A;  5MPO A;  5JXV A;  2V3N A;  1JML A;  1ZDV A;  3AE1 B;  4P6V F;  2J52 A;  1EWC A;  1GB1 A;  1VZ8 A;  3P4S B;  1FFU A;  1YN3 A;  2D5G A;  2LMC A;  1FMA D;  1I4Q A;  2M56 B;  2Y3A A;  2WP9 B;  1D4B A;  3AE7 B;  1JRO A;  2W54 A;  2H88 B;  1FRR A;  1TY2 A;  2DLB A;  3MP9 A;  3P63 A;  2JX5 A;  1I4G A;  1BXT A;  3IAS 1;  4XDC A;  1PFD A;  3Q8B A;  1FM0 D;  1PUT A;  2WU2 B;  4NZL B;  1L0X B;  1F2R C;  4XDD A;  1FD6 A;  1ACC A;  2AQ3 B;  4JPS A;  2WXK A;  1JAL A;  1K52 A;  1OFF A;  1MVK A;  2JSV X;  5GXG B;  4B0M A;  3ZGZ A;  1TS2 A;  3RFZ B;  4WH4 A;  4A8X C;  1WWT A;  4KGR A;  1VRA B;  1FEH A;  4WQM A;  1TS4 A;  4TSS A;  1B9R A;  1SIJ A;  1SJE D;  2GB1 A;  1MHX A;  4YT0 B;  4J3O D;  3SFE B;  2IGH A;  1GOZ A;  1OQR A;  1UUP A;  1XEE A;  3ABV B;  4MAC A;  4ARC A;  2OED A;  3FAH A;  5BMG A;  3PO0 A;  3W5U B;  4WAF A;  1SB3 C;  2V3P A;  4ITK A;  3ZJV A;  2CJN A;  4US9 A;  1HQR D;  3BYY B;  2J53 A;  4A55 A;  3FIL A;  4RNA A;  3AEG B;  1ZXI A;  4YSY B;  3FC4 A;  1PGX A;  4A6Q A;  5AUI A;  2PIA A;  1FNU A;  1ZOY B;  1FO4 A;  3HVD A;  2E6X A;  2MJD A;  1DOI A;  1GAQ B;  1XLO A;  3VRB B;  3AMZ A;  1PGA A;  2BB5 A;  2GI9 A;  3FIL B;  2W3R A;  4OW0 A;  1TKG A;  5EE0 A;  5BYQ A;  2KN4 A;  1ZP0 B;  1Q10 A;  2INN E;  2MEK A;  2WXJ A;  3PZ8 A;  3E56 A;  1VZ7 A;  2I38 A;  1N5X A;  1Y56 A;  2LHD A;  2MH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...