1FIQA

Crystal structure of xanthine oxidase from bovine milk
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE OXIDASE
publication title Crystal structures of bovine milk xanthine dehydrogenase and xanthine oxidase: structure-based mechanism of conversion.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 39
structure length 164
sequence length 164
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1fiqA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fiqA01
1SF0A 4WQMA 1FFVA 4N58A 1JWAD 2WU2B 3NRZA 2QIEB 1QOGA 1A70A 4JWUC 2Y5CA 3BIID 3NVWA 1YQ4B 1T3QA 1NI3A 1ZP0B 2OHFA 4KX6B 1JQ4A 4P6VF 2E3TA 4YSYB 3AEEB 1FXIA 1J7BA 4JX1C 3VRBB 4IDIA 2M19A 5G5GA 1N5WA 3P1MA 3AEAB 4JWSC 1ZUD2 3HRDD 1V8CA 2WDVB 3AE2B 1GAQB 1FRRA 1KRHA 3HUIA 2CJOA 3P4PB 3CIRB 2WS3B 3SFDB 1V97A 4ZHPA 1GPXA 4LTUA 2WQYB 1VDVA 1WXQA 3AEDB 3NVYA 4C80A 2MH7A 1PUTA 1ZOYB 1FRDA 3AE9B 3KWLA 4ZOHC 1NVID 3LB8C 3NVVA 2K5PA 3AMZA 3AE4B 4N6EB 1QF6A 1L6UA 1QOFA 3AH7A 1E10A 1YJJA 5G5HA 3AB5A 1E0ZA 1R7SA 4C7ZA 5EE9A 3AE8B 1AYFA 5MPOA 3DWGC 2W54A 1SB3C 1YQ3B 3ETRA 3ABVB 3VR9B 5AUKA 2B76B 2WDRB 3HVZA 1RWSA 1DOYA 2H88B 1L5PA 2KMMA 2DBYA 1N62A 1WRIA 4YTPB 1JW9D 2LEKA 1FIQA 3NVZA 1PFDA 1VLBA 2K9XA 1XLOA 2KAJA 1FFUA 1NEKB 1NENB 1J7AA 1WYGA 3NS1A 2BS3B 2H89B 1OFFA 1JALA 2M56B 4ZHOA 2PVOD 4C7YA 3P4SB 1TYGB 1F0ZA 1XLQA 3B2GA 2K22A 1KFYB 2FBWB 1XLNA 3RPFC 2N0SB 3FC4A 2Q5WD 3AV8A 5EE0A 2WP9B 1QT9A 3AEFB 2L83A 4YSXB 4YTMB 4YT0B 1JRPA 1J7CA 2CU3A 3B2FA 2JX5A 4ITKA 2BS4B 2QJLA 4FXCA 2L52A 1DOIA 3SFEB 3WCQA 3FAHA 1XO3A 3AEGB 1ZXIA 3B9JA 1OQQA 2AX5A 3LXFA 3PO0A 1TJEA 2BT6A 4A9AA 1KF6B 1DOXA 3AEBB 1JWBD 1TKYA 1TKGA 5H8YE 3AE3B 3W5VB 5AUIA 1N63A 2W3RA 2PKOA 3AE7B 1OQRA 1B9RA 1L0VB 5EE3A 5C3JB 1YJIA 2EKIA 1QOAA 2HTME 2MJ3A 2CJNA 1N60A 1DGJA 3P63A 3VR8B 1WGKA 2ACZB 5C2TB 3P4RB 2PVGC 1RFKA 2WDQB 1FMAD 1RM6C 1FO4A 1ROEA 1L6VA 3AE6B 1NYRA 3W5UB 1QOBA 4YTNB 3L4PA 1CZPA 4YXDB 3AECB 4US8A 2DWQA 4US9A 4USAA 1CJEA 1QLBB 1I7HA 1NYQA 2W55A 1WWTA 2JQRB 3SR6A 5H92C 3AE5B 3AM9A 3CWIA 3VRAB 5GXGB 3W9CB 4YSZB 1FM0D 3P4QB 4HRSA 1EWYC 1PDXA 1VJKA 1N5XA 1E9MA 4N59A 1XLPA 3ZYYX 1FXAA 3AN1A 1E7PB 1IUEA 1E6EB 1RYJA 1JROA 1AWDA 1TKEA 1UWMA 2G1EA 2WLBA 4WWMA 3EUB2 1N61A 2PIAA 2MJDA 2MJEA 2W3SA 2BS2B 4HROA 3AE1B 5EE1A 3DWMA 2WU5B 1SIJA
chains in the Genus database with same CATH superfamily
2J0MA 3WU2U 1CUKA 1LV5A 1ZJMA 5J2AA 7ICVA 2W9MA 1A70A 5ALOA 4IC7B 2KOBA 3R2TA 3QNMA 1NI2A 4W9DA 2YB4A 1SSNA 4R3DA 5G5GA 5EOZA 2B0CA 2WXPA 2ES6A 2KVSA 5C0YA 2NR2A 8ICMA 4XRHA 3GV8B 3C1YA 8ICUA 3IHPC 3T3NA 1T6BX 4F2SA 1SE4A 4II3B 2KK0A 3H7PA 3KZIU 2VA8A 5CX3A 5KG5A 3PW0A 4GXJA 5KT5A 1QF6A 1IYFA 2D6FC 2LRWA 1L2NA 5KFJA 4WJNA 2K25A 2OEDA 3HIZA 1UT5A 3QXGA 3D2NA 1C20A 5DB8A 3NUHB 5MPOA 3ZTDA 3J9CA 4YN4A 1U4AA 5B5EU 1SV0C 3H7IA 4J6IA 5HFYA 4F72A 4MFCA 4PGQA 3OTQA 2FE8A 2KJ9A 3V6JA 5TSSA 4DWIA 3H8MA 2DBYA 5CWRA 1N62A 4YD2A 2IDYA 4KKJA 1JWSD 1FIQA 3D6JA 1WXAA 5KFYA 2CRXA 2KJHB 2KV2A 2PMVA 5J2HA 2F3NA 2BWFA 2C60A 3I3TB 4EUTA 1LVHA 4WWOA 2K8CA 3HT3A 3M9OB 2AWTA 5JHAA 3ZW3A 3L5KA 4YR3A 2P6UA 5AKGA 2KP7A 1KLVA 1V81A 3PW2A 4JV1A 2N0SB 4PH5A 5CR0A 4YMOA 2A1JB 2NV3A 1FNUA 2H3QA 1PGAA 2M1MA 5J2BA 1GG3A 3GIKA 3GZNB 4QNLA 2H3ZA 4YMNA 2K60A 5DQIA 4RQ2A 2W82A 4NWIA 2J4XA 2WXQA 3H8SA 1ZQNA 2FMPA 4MACA 3D2QA 4CF4A 1TKGA 3GZFA 1N63A 5KT4A 7ICOA 3AU6A 5C3JB 5KFKA 2LGYA 1YJIA 4RPZA 4CYEA 1EUVB 3E56A 2DL0A 4NY8A 3RFAA 4XUSA 1WR6E 1R4MI 1YN4A 4YR0A 3QARA 4IQTA 2BYTA 2QCZA 5H2FU 3PRZA 2LKYA 2UVVA 2YLMA 2HHWA 5AZFA 1XO1A 3OHBA 4YXDB 3AECB 4RQ5A 4Q45A 3H0MB 1SBBB 3AEVA 5ALPA 2RDJA 1XSNA 4FN2A 5H92C 3BS5A 5J0OA 1UELA 3W9CB 2ZVOA 1KRPA 2MUTB 1ZD3A 1E9MA 2LXAA 1S10A 3A4RA 2DYOA 8ICSA 2NRWA 4P4OA 2P6RA 9ICUA 2C2RA 2J6TA 2ZIUA 3RB3A 5AKIA 2KKCA 3PZ7A 4B0MA 2J0KA 4RT2A 1S0VA 2MJEA 2E8PA 3Q8PB 2QC8A 1J97A 1UNSA 2KZ3A 3DPDA 4ZHOA 2KANA 4ARCA 2KDFB 1SF0A 1XCQL 2EAOA 3ZDCA 3NRZA 4EZKA 1AN8A 2KLGA 4GXBA 2F8LA 1PUZA 3WA0A 1L3SA 3QAQA 4KX6B 5HP4A 2X8XX 2ZZPB 2WAQF 2B6GA 1ZQLA 3HKZF 2MU2A 5DBCA 3EYZA 1TV9A 3DDCB 3K9OB 4JB3A 2WXIA 3P4PB 2Z7JA 1V97A 5J0YA 4CNQA 4DFMA 3A0BU 3VAWA 2MBQA 1MG8A 3KUZA 3G6XA 2F1IA 3EZ5A 2XY7A 5LNK1 5ALGA 2HE7A 3QQ8B 4DEZA 4FJZA 1YJJA 1QQRA 1MPEA 2RRDA 4RNAA 2LYBA 4YVZA 4MHVA 5J0XA 3DEEA 3JW0X 1SWVA 4DS4A 8ICXA 1L4ZB 4BAXA 1JUDA 4DBGA 3PMLA 4DQIA 9ICHA 1L5PA 3ZXVA 2QARB 3OPXA 2XK5B 5AM3A 2EMTA 4M02A 1NENB 3TAPA 1WYGA 2UVUA 9ICVA 4ECRA 2G5IB 3Q8KA 3HVDA 1QILA 4LNIA 1JALA 3TJPA 3EWAA 3OGUA 3MGHA 1AROP 5HMLA 1PK1A 4W9KA 5L1MA 3R3MA 1XLNA 1D8LA 2PE9A 4I2BA 3BZCA 1L6NA 1BPEA 4EZ9A 1VZ6A 2IZVB 2QSDA 1PGXA 2W9CB 3SMVA 3BVMA 4P16A 3ZIMA 4A55A 4HDOA 3BZDB 2AGQA 1ZQQA 2LHTA 1R4NI 1ZXIA 3B9JA 1XO0A 2OEHA 2KDEB 1XT9B 3Q8SB 7ICUA 4TUUA 2RQ5A 2MLBA 2RDGA 3EPGA 3MR2A 3BYTB 4ANWA 5KFVA 5AUIA 1OQRA 3DBLI 1Z00A 1JWMD 4KSKC 4QZEA 4DSLA 2N9EB 1P7FA 1ESFA 2CJNA 1ZPSA 1V1PA 5C2TB 2ACZB 4U7CA 3OJUA 3TL5A 4BXOB 1FMAD 2F1JA 5KFZA 3C21A 3RR8A 3GOEA 1TK8A 1FXTB 3L4PA 2ISPA 4J9OA 1Q3UA 2A4ZA 4ZYNA 2N1RA 1QLBB 2ZUBA 3HWTA 3VFKA 3UF8A 2I6XA 2JYEA 4CHKA 2L0FA 4HPLB 2IBIB 5J2JA 4EKUA 2F1HA 5IIIA 5ALWA 4L2YA 8ICVA 1C4CA 2JXTA 4FFDA 1XLPA 2KJRA 2KE7A 4UAYA 5KFFA 5DPSA 4OVVA 3QCAA 2BPSA 4K3CA 1J2NA 3ZNHB 4BOSC 3QU9A 2K4IA 3KQ4A 2WU5B 3C29A 4HDQA 2QDFA 2YMQA 2MRPA 5ALZA 1S1QB 4DQQA 1Y8RC 1JWAD 1YOVB 4KSLC 4N58A 8ICYA 4M9NA 4FJVB 1AW7A 4NV0A 3RF9A 4KN7A 4F1SA 3D2SA 1X66A 2XVTA 1YD8U 3RI7C 5KG3A 2ZG6A 4XWTA 1WXVA 3EECA 1A77A 4LK0M 1V5TA 4AWJA 3HILA 5KAIU 2DPIA 1OXJA 4MF2A 2L05A 3SFDB 3VH3B 4Q43A 4IM0A 2WQYB 2H5XA 4QZ8A 3NVYA 2EQYA 1SL2A 4NLGA 1FCCC 2MH7A 1WWVA 1PUTA 2DUYA 2WX0A 4BFRA 2YMLA 4QIWC 1NVID 2KK8A 4LNKA 5KHQA 3C19A 4ZYSA 5KFNA 1UQVA 3AH7A 4K3BA 5AK6A 3JPRA 4G9BA 1HE8A 4JPSA 1D5ZC 1QH9A 4DQRA 2XEWA 5DBBA 4LCDE 2ASQA 4AQ7A 2KD1A 4UAUA 3TFRA 2W9AA 4MELA 2LASA 4B9MA 2Q0ZX 2R8GA 1E90A 3PO4A 5KG0A 4I2CA 2I1QA 3WK9A 5E6NA 1ZETA 2YX8A 2KAJA 2ZJ5A 5DQHA 1ZE3D 1D8BA 2ZIWA 4YCXA 4OHJA 2N7JA 2KZRA 2FPLA 4RPXA 2HBKA 1Q46A 3RBDA 4DHZE 3E9SA 3ZNID 1RYSA 2BGWA 1WE6A 5IOIA 1YQBA 2VRRB 2L83A 1V6EA 4F8CB 3PPAA 4ASWC 2XC9A 2JF5A 4M9LA 3K1ZA 4EYHB 4J9RA 4FXCA 1QCKA 2KJ5A 2IA6A 3H7PB 4IWOA 5GMVA 4FA6A 4JLCA 2F77X 2KMCA 2MRLA 4W9FA 4NJ8A 1LO5D 3RH4A 3MGVA 2KTFA 3N1XC 2W3RA 1GB4A 3AE7B 1SZHA 2BHNA 1L0VB 1T94A 1JRUA 1PGBA 4QZHA 2XCAA 1J8CA 2IOFK 2YN4A 2IY0B 2OWOA 3DVNV 4PK1A 4PHPA 4MFAA 2AHOB 4PPXA 3ORYA 1KBUA 2XNAC 3HHMA 2W03A 2UVWA 1P7EA 1WWTA 2D07B 1TE2A 2K8CB 3SAGA 2L76A 4EZLA 2TSSA 4JUZA 5ALIA 2L1AA 3AQFA 5KT3A 1KLUD 3TMPB 3TEYA 2KFZA 1N61A 2IOFA 5IIKA 2FPKA 2C7MB 2W3SA 1ZQVA 5DDMA 1IGCA 3DWMA 1KW4A 2LWPA 4FO6A 1ZJNA 4IM3A 5E79U 3T5HA 2RD0A 3ZJUA 2J6SA 3O13A 2IO3B 3M9NB 3ZKJC 5CTRC 2UU7A 2KTQA 1V80A 2KQSA 2BCSA 3GFKB 3MC9A 1FRRA 2CJOA 2JZZA 3IVFA 1HUZA 2ZJ8A 1VDVA 3CYMA 2CU1A 4KLQA 1BGXT 2GBJA 2LD9A 5K4LA 4J9KA 1Q1OA 4C56C 1SV0A 1UA1A 1C7YA 3BS5B 2CKHB 3N30A 1PVQA 1M6YA 9ICPA 3R8BA 4OW0A 4J03A 3L54A 3RNEC 2LVQA 5AI5A 3ABVB 2RHFA 2ZIUB 4UB4A 3G6YA 1Z19A 2BWES 2WDRB 1WG8A 3BK2A 3PNCA 4GGQA 4M9GA 2EZXA 4I2JA 5IP4D 1OGWA 1I4PA 3IFWB 2LRUA 5CHGA 9ICLA 3QU5A 2E6XA 2Y3AA 2D3BA 3ZNGC 1QKZA 4DSEA 1P98A 3H4BA 3E58A 3LWMA 3L10B 3R7QA 3ZDAA 2AQ4A 4TKNA 4YSXB 4EBCA 2HCFA 1UBQA 3E0FA 3VTVA 4AP9A 4GLSC 3WKEA 1UPHA 1LXDA 2L52A 3UIOB 3RB0A 4TQ0A 4P0PA 5GTIU 4HVBA 2JH1A 2KMAA 5D2MB 4ELUA 2RP5A 4NL9A 1HJPA 2KDMA 4F3OA 3LYYA 2J52A 2EDUA 1B9RA 3N3KB 4WQOB 2ZJAA 4NLCA 2XY6A 3ZDTA 3I28A 1WGKA 5F9NA 5J2KA 3P4RB 3N20C 5AKHA 1MVKA 5JHBA 1Z1BA 2MA9B 4C0ZA 2WXFA 1RM6C 1ZQEA 3BYYB 1NYRA 1QOBA 8ICQA 3AL0B 2WAQC 2BKFA 2DQNB 3IG8A 1YMHE 2BKRB 1ISNA 4QWDA 2JZPA 3Q14C 3HKZC 5J2CA 4M04A 1YT3A 3DBHB 3KH0A 4NM1A 1X6IA 4RU9A 1HQRD 3TEWA 3MP9A 3CWIA 2M0XA 3TCAA 1PK1B 4Y2UA 1WGDA 2JSVX 4ZRQA 1PDXA 3QU7A 3FDSA 1ET6A 2KDIA 5E6OA 5KFTA 2OJWA 5KFQA 5AM2A 3PX6A 5AIBA 3K1RB 4C4VA 5IN7A 3F2BA 3FM9A 4UB3A 2ODGA 4K4GA 2KQ4X 1XQQA 3R66C 2BDPA 2AJQA 4WQMA 2AYOB 5AI8A 1MHHE 3KLSX 1B0XA 4PHEA 1RLFA 3D32A 1TVAA 1YQ4B 4NPNA 1LGRA 2V1YA 1NNLA 3CSTA 4KLTA 2ZPNA 3OWEB 8ICAA 2M19A 1ZQUA 1N5WA 3ML9A 4ED2A 1KTQA 3PSFA 4EX7A 1KTKA 2RDBC 2ZEQA 2E8OA 2MHJA 3UM9A 1S76D 8ICRA 5JRTA 4P2HA 2KZZA 2DYBA 1BPXA 2Y0SF 3MC1A 2KKVA 4E0DA 1IG6A 1BT0A 4GC6A 4NNJB 4QZBA 8ICNA 2NTSA 4K7UA 1SXTA 5J17A 2HHUA 1LKYA 3KUDB 4MEXA 1TS2A 1HTOA 3N7PD 5FR3A 2P35A 2KVRA 2G06A 4J9NA 3EFCA 4WH4A 4XX5A 3DDHA 2K6DB 3HVZA 2JWUA 4C8NA 1PZNA 2JH7A 1CMXB 1CQVA 4JIOU 4GN1A 2BKEA 3QYPA 2GLEA 4RUAA 5AI9A 4KMOB 1ZQYA 3RRGA 2VA2A 1RRBA 2FIFA 3ECIA 3RFZB 4RFBA 2PFQA 1ZQCA 4HWIB 4JV2A 5D7GA 2G5HB 3ZDBA 8ICCA 2KC2A 1HZ6A 2E5SA 4DFPA 3PLUA 5D6JB 4ECXA 1F44A 2PEAA 5C1ZA 5KFBA 2N7EA 4UQGA 4M47A 2A19A 2N1WA 1JRPA 5KNIA 2IJ0A 4HXDA 1RQLA 4MGYE 3PZPA 2ICIA 4Y2TA 2Q4TA 2NPTA 1RFAA 1ZQTA 2LVOA 1SKRA 5J2GA 4DL3A 5D46A 3SI8A 3ZDMC 5AM1A 3TI0A 4RUCA 2SAKA 4K7SA 1WCLA 4FJYA 1WM2A 2IHNA 2FCMA 2V0GA 2Z59B 4I2EA 4MH8A 1ZQBA 1N60A 1DGJA 5T14A 5CEHA 1L0XB 3L0WB 5HG2A 3NGDA 1S0OA 3M8RA 5L1JA 3W5UB 4JL9A 4MGIE 3AUOA 3R2IA 4YTNB 2LJIA 2E8NA 3LK9A 3H0LB 3P42A 5AKJA 3AU5A 3IN5A 5AK5A 4ICVA 4E3CA 2RDIA 2ZIWB 2ZXIA 1XWLA 3AQEA 5BPCA 4GDKA 9ICAA 4G11A 4QZ9A 3BINA 5IAAC 3OJSA 3AM9A 1SGHA 3RR7A 1KEJA 1NKEA 3TBLD 3KYCD 2CPRA 4YXMA 2KO3A 3Q8AA 1NK8A 1JROA 2G08A 3QU4A 4KIKA 5D94A 5AI6A 4W9CA 4WAAA 4MSMB 2BS2B 3PLVA 4QZIA 2ZUDA 4O5KA 4GU2A 4IW0A 4KGSA 4KDIC 4W9GA 5E6PA 3AI5A 2LJ5A 5ALJA 1LFDA 5EDSA 1NI3A 2IO1B 3BWUD 3I5JC 3IG3A 1C4PA 1Z1VA 1SIFA 2E1EA 2KHWB 2WXGA 2W9NA 3P1MA 2G4DB 2WF8A 2WF6A 1V8CA 3H6NA 4LDTB 4LJXA 8ICJA 5DCNA 2GMIC 4CF5A 5KL1B 4DCCA 5ALSA 5KFEA 4IR9A 1V2YA 2XBBC 1QQ5A 2V4QA 4GIVA 1RPLA 1ZOYB 1FRDA 3QA8A 2ZNVC 4DOBA 2ZXHA 3FKYA 3UQBA 5HHIA 5G5HA 1NJZA 1ZQFA 1TAQA 1E0ZA 5EE9A 4JK1A 3H4DA 1PQSA 1AYFA 1RXVA 2W54A 1KDHA 1JCKB 4UAZA 2LYAA 2WGSA 1TK0A 1XF5L 3BK1A 4YFKA 1P3QU 3GIIA 1BVSA 1P9DU 5JTIA 5KFHA 2AQ2B 3SENA 4TQSA 5KFLA 1WGRA 1ZYQA 3IAM1 1PFDA 1ZQXA 2A1AA 1VR9A 2HVHA 1NEKB 1XLOA 1UBIA 4ED8A 4WWNA 4KLJA 8ICEA 3N1ZC 2K3UA 4C7YA 4F5PA 3ZI4A 1WF9A 2RMMA 3MC0B 3RNCC 8ICWA 4DXFA 3OAWA 3RYTA 3I63C 4IRCA 4RM9A 3FC4A 2Q5WD 4EBEA 1YZ6A 5IIMA 4IL6U 4YWGG 5AKEA 2C7NB 1F0MA 1FD6A 4DL7A 3S2AA 2KG5A 3C2LA 2CHZA 1MFWA 4K4HA 1IPGA 3Q3NC 4RNNA 3I9V1 1NJWA 5AM5A 2JVCA 3QUBA 3VTWA 3LDZE 1ZQMA 3HP6A 3N32A 1I42A 3MC8A 3MR5A 3UXPA 1T0SC 3ALBA 1SWWA 1P0RA 3M7DA 1CI4A 1TT5B 1QZEA 4ARIA 1ROEA 2GBMA 5L83A 4GDLA 2WXNA 5DDYA 2XGQA 3F53A 1I7HA 1NYQA 2R8IA 2MQJA 4YD1A 7ICTA 2D10A 2BYVE 3MDCA 4LNFA 5GXGB 3R7RA 4GMVA 4F50A 2KXJA 4F93B 1BPBA 2CXYA 1XC9A 2WXOA 4M9HA 2ZPYA 2WX1A 1UWMA 2PI5A 5KG2A 1J19A 4KLUA 5J2IA 1KQQA 1A0PA 2PFPA 4Y2RA 4O3MA 1J2MA 4P0PB 4ED0A 2O6VD 1SIJA 1ZD5A 3F2CA 3IBEA 2ZTCA 3PHWB 3PSTA 3L16A 1TTNA 2HBMA 3NY5A 9ICRA 1E7VA 2V3NA 2I38A 4OJPA 2WXLA 2WNMA 1ZP0B 3VXWA 2N7DA 2K89A 3T3FA 3PW5A 1JQ4A 2E3TA 3WAOA 4Y2YA 4B9VA 2KWCA 3NS8A 4JWSC 4F5RA 4BKSD 2INDC 3GS2A 2HTHA 2IOHA 1ZD2P 3UMBA 2PFOA 2JY6A 3MFGA 5KFUA 3SAHA 4KTQA 2KIWA 9ICEA 4E74A 3ISCA 3LB8C 3DQVA 2GBRA 5KHOA 3UIPB 1L6UA 1JIHA 3TADC 4QWAA 3QUTA 1QOFA 2K4PA 2JMGA 2GB1A 3RT3B 1NZBA 4JV0A 1R7SA 2DNFA 2JEJA 4M01A 2V4IB 2DAJA 4BDPA 2N1VA 2KTRA 4HEA1 4FZLA 1GC7A 4C4VB 4DL6A 2D3AA 1NK6A 2LUEA 3PSIA 1SL1A 1WRIA 2KSOA 2NBVB 3V61A 2X38A 4UB5A 1OUQA 2I9GA 4LLGM 4NLBA 4HJKA 1J7AA 3PHXB 4BOZB 1X9WA 4A8EA 4Q44A 3UQ0A 2MP2A 4ZRKA 1QTMA 2J0JA 5AZGA 3WAPA 1F0ZA 2BCVA 2XN9C 2GLSA 1OW5A 3DBHI 1XNSA 4XC2A 1MQ2A 2PPHA 3JPSA 4F91B 4RQ0A 4XGAB 2LVPA 4YL8A 3N7RC 1ZQJA 3WKDA 3PO0A 2JZ3B 3THVA 2BTEA 5J2DA 3KKAC 2DZKA 3W5VB 2PKOA 4YP3A 1LKYB 3KHGA 3C5GA 1WFYA 1Z4NA 3TIXA 3ZO5B 3WK5A 1V1OA 1PVPA 3KBBA 1N6ZA 1EF5A 3MR6A 1FO4A 1SGGA 1X1MA 1WJ4A 1RYUA 1KL9A 7ICFA 2KD0A 1QSSA 1IP9A 4Y2QA 4GFJA 3BVZA 1XD3B 1X6JA 4US9A 2E8MA 3GU3A 3ZXRA 2BDUA 2GBKA 4QWEA 3ONSA 1WX9A 4MGKE 1IBXA 2M4NA 2I2YA 2FCNA 2F44A 4C00A 1ZQPA 3W1SA 2Y0SC 4EZ6A 2HJ8A 3FILB 1C76A 1WZ3A 1JXEA 3VVWB 5ALHA 4MT5A 3Q8FA 1B43A 2NPTB 3BDPA 4MF8A 2RSUA 1OEYA 4QZFA 3DOWA 3LVVA 3R9KA 1AQ6A 4BZAA 1FFVA 3NRWA 2FJ6A 2QB1A 2G3QB 1QOGA 8ICHA 2D2QA 2W9BA 1ED1A 2KX0A 4AP4C 2GWSA 1VD2A 1STEA 1KFSA 4X5VA 4YSYB 1E8XA 4JX1C 3TEXA 2RGFA 4RT3A 4JMUA 1KOTA 2IY1B 3ALRA 4Q2JA 4FZMA 2JEFA 3C1ZA 7ICRA 1Q10A 4F2RA 3KVFB 2DAFA 3T5KA 2FUG1 1RDFA 3RB6A 3X23A 2FIDA 8ICZA 4GDKB 4I2GA 2VZKB 3BZKA 4M6WA 4KLIA 1SKWA 2L5YA 3A1QA 5ALFA 3RB4A 1TAMA 1Q8KA 1L5UA 3SHQA 2BCQA 3WKCA 4FLHA 5HHDG 2JXJA 1ZQWA 4F4WA 2PTLA 4KIKB 4NY0A 2BB5A 2ZIVA 4RPYA 3U8ZA 4GXKA 9ICSA 4YTPB 1SEBD 4EEKA 4NZLB 4G3XB 1P7DA 2FUHB 8ICKA 3RAQA 3BVGA 4J9MA 1N56A 2IGGA 2NTTA 2BCRA 1L7NA 1GUAB 2PVOD 4P7IA 4IRKA 4R66A 2Y1IA 3MHSD 5CJ7A 4PL1A 2JEGA 1VCBA 3MGIA 3EA6A 2G09A 3EPIA 4YT0B 1J7CA 3PVLA 1ZDVA 4A90A 1UGMA 4PYUA 9ICNA 4I27A 1XO3A 2V9WA 2HSZA 2GI9A 3JPTA 7ICLA 2HD5B 2YEPB 4WIPA 3NUQA 2CHWA 1KF6B 4MM3A 3U7ZA 1DOXA 3DBRB 1JWBD 3CW2C 1K8RB 3MJ5A 4QW8A 4IOIE 4BWMA 3AXCA 3P63A 2KFKA 1SE2A 1N48A 5J8YC 3RN9C 5AHXA 4PGYA 4DHZB 8ICTA 1NKCA 3UMGA 5J0PA 1EO6A 1UGJA 1BXTA 3ZUNA 4ED6A 5BYQA 2P66A 2DZIA 5DB7A 3DCGA 4UB2A 5HI1A 2JXXA 4DQSA 3QZ7A 4YSZB 2ZW0A 3P4QB 4OD0A 2NS5A 3RUIB 5EWEA 2LI6A 4RM8A 3L17A 4OJ6A 4NJ6A 2AEHA 1TKDA 2HJ1A 4AYBF 1L8LA 4ECWA 2J6UA 1TKEA 4FULA 2EH9A 5BMHA 3SEIA 2G0AA 1OQYA 4GLXA 1WIAA 4LNOA 2XY5A 5D3DA 4D2KA 3GIMA 2GBNA 4K7WA 4ECZA 2VH2A 5DBAA 3C28A 1ZOLA 1ZQOA 4F4XA 4AOFA 4OJLA 1C4AA 3GDXA 1SE3A 5AKKA 4P6VF 4PT5A 3V72A 3DHGC 3AEEB 2V3SA 5KFWA 4DF4A 4ED1A 1NK7A 4I29A 2IO2B 3UINB 3VRBB 3SZ2A 4JQWC 1IV8A 3C0RB 5BYSA 4WURA 5J0RA 5FKAC 3M95A 2N4FA 5G2NA 2WS3B 4CE6A 4GDLB 2KNJA 4DLGA 5TISU 4ZOHC 2EKEC 9ICQA 1C1YB 2L0TA 1T0RC 4Z6DA 1FEHA 3Q8CA 3BQ0A 3RBEA 2ZTEA 4JGHB 4TURA 4IG7B 3C5FA 3V7KA 3AE8B 3PT2B 3K9PB 2UVRA 5BOLA 1SB3C 2ZIXA 3SYZA 4DFDA 4F5QA 3KFUF 4EENA 2K8AA 4LJOB 3TUOA 3QK0A 1UD7A 4M0WA 3HW8A 4O0IA 2BB6A 2KMMA 2BQ3A 1JW9D 3PMNA 1ACCA 2FCQA 2CHXA 5KFDA 3SQIA 2R18A 1E8ZA 2ZJDA 4HLEA 1NK9A 5ALQA 5HKHA 3NS1A 2KHQA 4I6PA 1WRDB 1MI0A 4PGXA 4U6PA 1T5XD 3MJWA 1CK1A 4RQ1A 1XLQA 2MWSB 5BO4B 1KFYB 5EE0A 3GZNI 4CO7A 3ISBA 4HPMB 3PV1A 4AUQC 2GOLA 2K39A 2I5HA 3J81j 2KHVA 5KG4A 4DFJA 2QB0A 3KOOA 2ALZA 4DSJA 1NZPA 2BT6A 5AM0A 1ZQIA 1GB1A 3QUQA 1TKYA 1WGGA 2FLNA 3ZD8A 4I2AA 1Z2MA 4YXJA 4OZBA 5BMIA 1KM7A 1QSLA 1QOAA 2WHEA 5AM4A 4YMMA 1BPZA 2KTRB 2BF8B 1WE7A 3WIMA 2BCUA 2EMSA 1L6VA 4FZNA 4UBBA 2KSOB 3RULA 4KITB 2PLPA 2XI9A 2IBKA 4P1CC 1IXRA 5FK9C 1XSLA 1XU4A 3A9JA 2MP2B 2NCNA 5JXVA 2O6KA 5ALRA 2E1FA 3ML8A 1I4QA 3RJGA 1U48A 4HAIA 4Z6CA 2XGPA 3N4MB 1EWYC 2C22A 2IGDA 4XWWA 1VJ5A 1YJ1A 3X0WA 1D9DA 4LZDA 1AWDA 1UA0A 4DXGA 4EX6A 1JMLA 3Q3OC 3UI3A 2B3AA 1NK5A 3ETLA 5EE1A 1NBFC 1WXSA 4DOAA 2ASJA 1NJXA 4Q8EA 1B22A 3VUWA 1B1ZA 1VZ7A 2NMQA 1E7UA 1XS9D 4ECUA 5CHVC 4QWBA 2VKQA 1T3NA 4F4YA 4EZJA 2A3VA 1T8EA 1HTQA 2LHEA 3GIJA 2QLTA 3Q3JA 9ICJA 4IWQA 3V6HA 3O65B 2R8JA 3CIRB 3B08A 5AI4A 2HOFA 1I35A 3UXNA 3OJ4B 5DB6A 3M8SA 3AEDB 5L1LA 1CRXA 9ICCA 1L7YA 3KWLA 1EF1A 2FE9A 3U52E 3AMZA 1H38A 5DPWA 1IBXB 1ECWA 1T0QC 1WGHA 3KUCB 3TARA 4URKA 2NRXA 5J0UA 4PS8A 1IGDA 3Q8RB 2RLTA 5A0LA 1RZTA 3NOBA 4UASA 3AU4A 4ZRJA 3DWGC 1MHXA 2BR0A 4WAFA 4B0EA 2VANA 4DL2A 4LNNA 4JWMA 1RWSA 4RQ6A 1V85A 4ECVA 5EWGA 4FBTA 2IHMA 1BPDA 2HBLA 1ZKHA 2IPKD 2QMTA 2LEKA 1K50A 4KZ0A 3ZJVA 4O3SA 9ICIA 4BUGA 5KTQA 2LFIA 3C8YA 2FPMA 5KG7A 2BPFA 1HIWA 2W9BB 4I6NB 4TV3A 2MAXA 2HHTA 2K22A 4ICUA 2LUMA 5DG9A 3T5LA 2WP9B 1XSPA 2YMMA 2MBHA 4YTMB 4B95A 2WB1F 2GO7A 2C9WB 3SAFA 1ZW7A 5J2FA 3V6CB 2K4HA 5F9LA 4EOYA 3KKAA 3WKBA 3PREA 5ALVA 1TJEA 2MEKA 9ICWA 3JVZX 3Q2AC 2EAPA 4M6WB 5EWFA 4FS2A 3NZUA 4IC9A 5H8YE 2AGOA 3A1QB 1MSWD 3HK0A 5KL8B 1S5LU 1F5SA 5EE3A 2NO5A 8ICPA 1YX6B 3VR8B 4OO1J 3JPOA 3KW5B 2LGSA 3AULA 3PR5B 3EHVA 4FADA 2UWQA 3UQAA 1SZPA 2LBOA 3T79A 2ZIVB 3PW4A 2EELA 3RAXA 2KJ6A 3DVGX 3FILA 4DK5A 5KFIA 3JSVA 4USAA 5ALMA 3QC8B 4JE3B 5BYRA 3RZFA 1FPYA 3QUCA 3SR6A 4O3PA 3BQTA 5AI0A 4IKGA 4II2B 4RQNA 2ZUCA 1MG4A 1VJKA 3APFA 4HKQA 2C28A 1WX8A 4B6WA 2B21A 1E7PB 4RZRA 4MSQB 3I57A 2HDOA 2HMXA 4PZNA 2MJDA 3PY8A 2NRVA 2UYZB 3C23A 8ICOA 3BY4B 3ZVVA 1PK3A 1V9JA 4WJOA 1PVRA 4I2HA 4O3RA 3U2SC 4MM3B 4DQPA 5ALXA 4O9MA 4RNMA 5J0QA 4DS5A 2Y5CA 4F92B 4QAYA 1T3QA 1GOZA 2G45B 3IM1A 4NQLB 2AQ1B 4DL4A 1ZDXA 1OTRB 2BQQA 5IKCM 5AEKB 2KFKB 2LI5A 5E6JA 4F5NA 4DO9A 2JU6X 2PMZF 1HEKA 2KWUB 3TACB 2HOIA 3Q8BA 4ZRIA 5KFSA 2AL3A 2BZFA 2KLCA 2CN1A 2PXIA 4DHJD 2G4SA 1S97A 1TK5A 4N6EB 3H8WA 3Q8MA 3AE4B 1D9FA 1L3TA 3SD5A 4HK2A 4RCOA 4S17A 3H40A 2KYWA 2WXMA 3TAQA 4KX5A 3OSNA 2Y1JA 4OCZA 3QEBZ 5ALKA 2BYEA 3M1YA 4A3OA 4LVSA 1X9SA 3PO5A 1I4XA 2D3GA 1C3TA 2H88B 4F8RA 1V38A 2ZCBA 3DBRI 4KVGB 3H8JA 4KDLB 5J18A 1KN5A 1WX7A 4KKIA 5HNKA 3NVZA 2HDEA 2HHQA 1JMSA 2L8JA 5CB1A 2KJ8A 2WXJA 5AIAA 3N1YC 1UT8A 2W7OA 3KHLA 3PV8A 1OFFA 1X9MA 4Y2VA 3AU2A 2KVZA 1BMLC 2BQUA 1GNUA 1EM7A 2Z0EB 3LDAA 4K81A 2R61A 3SV3A 4UB6U 8ICIA 1SE9A 2I1KA 4XYCA 4ITKA 1KJTA 1K1SA 3B0AA 2L00B 1OQQA 4JWNA 1S0NA 4ZDVA 4AYBC 4ELTA 1MA7A 5D3IB 4WJQA 1TZ1A 1UH6A 5TR5A 3RNBC 5JU5A 5IINA 5J8YA 4FHKA 3NJTA 1A76A 1YX5B 4MEYA 1WY8A 4PHDA 4ECQA 2ZIXB 3N28A 4XA5A 3MR3A 1WMHA 2KT7A 2PVGC 2DGZA 2HW3A 1F2RI 4NLNA 4PZOA 3M6ZA 4M00A 4OVUA 3TFSA 4M0WB 3WAMA 4AJYB 2WWZA 4ED7A 3T5JA 3A9KA 1L7PA 2QHOA 1N2XA 1GJZA 1SXDA 2V3PA 1FEZA 2KIVA 2VH1A 2JQRB 3AE5B 2IGHA 3MHZA 4QW9A 3VRAB 1JN3A 3IG5A 2Y9UA 5C23A 3JPPA 2DYMA 3ZQ4A 3AN1A 4WWMA 2KNBA 1A5RA 2RPVA 2FLPA 2DHZA 4I6LB 1EXNA 1UHUA 1PYWD 2K6QA 2QB0B 2BGFA 4KX3A 4KN4A 1YIWA 4KLHA 4NLZA 1MC8A 4M2YA 3Q3FA 2N9PC 4W9HA 1H8CA 2F2AB 2AH5A 5GTHU 2KACA 4NAMA 5IO9A 4IDIA 4EEYA 2LZ6A 2BQRA 2W43A 3WK6A 1YN5A 3N7SC 2WDVB 2GH1A 4I2DA 5BMGA 5JH5C 4WWPA 1TY2A 2ZVNA 3IT6B 4I2FA 4M8MA 4DFKA 1L8OA 4C80A 2GRIA 1NDDA 3APDA 3V6EB 4MDKE 3RNAC 3ZDEA 3A9JB 5KFGA 3URYA 1ZQKA 3ONNA 3H7SA 4XZ4A 3AB5A 4RGTA 4C7ZA 5DG7A 3PX0A 3OLMD 7ICHA 4HJGE 2ZW1A 3V60A 4EFOA 2D11A 4O3NA 4BGDA 2DF4B 3F5EA 1LQBA 5D4BA 2KWVB 3MABA 1AARA 5T8IA 4F4ZA 1P1AA 4Y2PA 2LMCA 1VLBA 5AKYA 4ECYA 1TBEA 4TUQA 1Z5SB 4A20A 4NL9C 5DG8A 1MJDA 3PTFC 4BBNF 4A3PA 7ICIA 2M56B 5FR6A 1DXSA 1DGSA 9ICBA 2R2QA 1GO3F 3P4SB 1TYGB 5AKZA 3QE9Y 2FBWB 5DQGA 3H9DA 2K8HA 3RPFC 2HBJA 3JPNA 3AV8A 4PS3A 3I76A 3RH5A 4B9TA 2Z0DB 2NRZA 1KSPA 3SEBA 3U7DA 2J42A 2ONQA 4IUMB 1RQNA 3SFEB 3VDZA 7ICEA 2WTFA 2AX5A 3CRXA 5F3XB 3QWZB 3CSFA 1TZOA 1HUOA 4KLDA 4F7ZA 4M9JA 4GB9A 2YQEA 1XCTL 5KG1A 2JPHA 4L23A 3HM3A 3VH4B 3RNGC 2OYYA 3Q69A 4S0RA 1SV4A 3ICXA 1UZXB 1L3UA 4NXZA 3C2MA 5G55A 1BUIC 2MSNA 2AL6A 2O6VA 1JX4A 4RQ3A 3QZ8A 1BNOA 3CP8A 2BBCA 3OSPA 4MEMA 4YR2A 3LJ3A 4W9JA 3ZNZB 1M4VA 3PSEB 2NRTA 1S3SG 4WJ3B 2OH2A 3RRHA 1VZ8A 3A4SC 4UB8U 4NAWA 1RYRA 1IIPA 2MX2A 1FNVA 2MBBB 1RYJA 3ZRCA 4BKSA 1TIFA 2DX5B 1X9XA 3Q8QB 1E8YA 5J29A 4EYIB 1HZ5A 4XQ8A 5KFOA 3FYHA 2NBUA 2MCNB 3PRMB 4QZGA 3E2EA 2LPEA 3DVGY 5JUMA 4C8KA 5LXHA 5J0WA 5ALDA 5AK3A 1WCNA 1I4HA 2WU2B 1T0YA 3IAS1 4JWUC 4NM2A 2XIDA 3NVWA 3BJYA 2QEJC 4OZAA 2C7HA 3KHRA 4KZCA 5I4DA 2BYFA 4QJFB 2DZJA 4IM2A 4CF3A 3AEAB 2JYTA 1B4FA 7ICPA 2O2VA 2DPJA 5L95C 2KICA 4C8OA 2FCSA 5KFCA 3OG5A 3F5AA 4DSFA 3V7LA 2BPGA 4L1BA 2G07A 4EEWA 1Z4OA 1GPXA 3GQCA 4FBJB 2NYVA 3JSVB 1GC6A 9ICGA 4REZA 4BKTA 3NVVA 4TQRA 2WB1C 1COKA 5KT7A 4YQWA 3B0YA 2JGAA 4I28A 1JI7A 1L4DB 1DRGA 2R8KA 5AKXA 2WF9A 4MJSA 1KFDA 4O3OA 2PI4A 1ZRMA 3ETRA 4BWJA 4DDGD 1DOYA 1S9FA 3VHTC 3W1YA 4UW9A 3TKAA 5ALYA 5DKWA 1C78A 1WJ6A 5ALEA 3RJFA 5CHFA 1ZQGA 1ZQAA 2R8HA 2BVCA 1WYWB 3UPQA 3Q8EA 1URJA 4TUSA 3U30A 3GP7A 7ICSA 2ON8A 2R2OA 1Y88A 2DENB 1LM8B 1T4GA 4C4TA 4PJ0U 2L7RA 1Q0WB 3GE8C 2FLLA 3PVXA 2WF7A 3RH6A 2RR9A 2KC1A 3H1UA 2AQ3B 4C4RA 2YB1A 4Z6FA 1YNTE 4KLMA 2AU0A 4CCHA 1KLGD 2INNE 3AEGB 5KG6A 4RNOA 2V4RA 3K4GA 2OOBB 4RQ8A 8ICLA 3BQ7A 1UWXA 3AEBB 2OXOA 4N9F4 2JRIB 1M94A 4KLOA 3QEAZ 2IO0B 3VCBA 1U45A 3RTVA 1T7PA 2EANA 2IYDB 3TSSA 2M17A 3T3OA 1JXLA 3DBSA 2JUOA 1ZRNA 4P0QA 3AE6B 2D5GA 2Y5PA 3MTNB 4ZRPA 3Q3MC 4G0NB 5B66U 3M3JA 2W8KA 2K4EA 3IHQB 2ISOA 1IM4A 1CJEA 3PZ8A 2PMZC 2W55A 5DGAA 3I1YA 1NKBA 2WDTB 3GV7B 3CNHA 2J7QB 2M0NA 1K51A 1TS4A 2LGIA 3DVNU 5ALNA 3ED5A 5J0TA 4HRSA 2J53A 3B1LX 1SJED 5JZEB 2C2EA 1FXAA 1WJUA 3BQ1A 3O0FA 4J9QA 1L3VA 3DHIC 2PKEA 3QU2A 2G1EA 4LDTD 4IQWA 2W8LA 2K8BA 1F9JA 4UAWA 2XCPA 3LYSA 2N9KA 4XDDA 3B0XA 4C8LA 3UXOA 3A33B 1D4BA 1F52A 4B9LA 1V86A 5LLIA 9ICTA 8ICGA 4ANUA 1WXMA 4ANXA 4GOCA 4UBCA 1WMHB 4DHJB 2KWDA 3MBYA 2KDBA 1ZUD2 2JZBA 1O08A 2ZCCA 1UCVA 4R63A 3HUIA 1D5MC 3L13A 2JRHA 1X42A 4LTUA 2OM6A 3A9KB 1C79A 3GB1A 3WK4A 1Y56A 2PFNA 3AE9B 1TGZB 1WUDA 1TY0A 2K5PA 9ICMA 5KT6A 1NJYA 2KN4A 5DPRA 3PR4A 3KYDD 1E10A 2LHDA 4B9KA 1WJNA 3ZGZA 2DFLA 2INPE 1KKXA 3GE3C 4DWFA 3WANA 2N9XA 3WK7A 4XE0A 1YQ3B 2M8SA 4Q8FA 4G50A 5AUKA 4R8UA 1X40A 4J3OD 2JWZA 4CQNA 4KGRA 3U4EG 2ASLA 4DOCA 4KLLA 2K9XA 1S0MA 3ZD9A 5CP2A 4UB1A 2AGPA 3JPQA 3TQ1A 1ZQ1C 1F2RC 2JR5A 4DQOC 1J0GA 4F4KA 1L7MA 3HM6X 4HPPA 2D3DA 4MFFA 8ICBA 3ZLZA 2FDRA 2HVIA 4K4IA 2HI0A 3UMCA 4GXIA 2PE6B 4EBDA 3TANA 2CU3A 3RCZA 2WFAA 2JX5A 2NBWB 3DV9A 2QJLA 2RPQA 2LGDA 3KD3A 4B6JA 5DLGA 1DOIA 1E8WA 1ZXHA 4P4MA 4TUPA 2V4LA 3FAHA 4OZCA 1ZQSA 2K1FA 4A9AA 4RGNA 1SKSA 4GIBA 2FMSA 3AE3B 2Y5BB 4IS7A 2Y9TA 4P1BC 3V62A 1ENFA 2MJ3A 4UARA 3V3XA 3QX1A 2MBEA 3W2DA 4NJ7A 2W11A 2FI1A 2JEIA 1RFKA 1BPYA 3RJHA 2MBOA 5J0SA 4KGTA 1C77A 2LXCA 5CHWA 1CZPA 2H3FA 1UUPA 4US8A 1ZGUB 2H3VA 4J9SA 3NG0A 3RJKA 4Z6EA 3U26A 2YY6A 2F8KA 5FP0A 3BS7A 2KOXA 3L08A 7ICJA 1C9FA 3ZRFA 1XXGA 2HHSA 1N5XA 3KZXA 2AQ0A 1DK2A 4N59A 1UF0A 1D6EC 1LB2B 3L3FX 1MQ3A 4BKGA 2WLBA 2HHXA 3GV5B 2KVCA 4DSKA 2JHDA 2A5UA 2PW9A 3RMKC 1L0YB 2DKZA 4IWPA 1QQ6A 3AE1B 1L7OA 2YTUA 4RMAA 4RQ7A 3GILA 4M0AA 1F1HA 3DHHC 1TS3A 1R4MB 4G3IA 2QIEB 1JWUD 2XICA 2YMPA 1NOMA 3BIID 1FNWA 5L1IA 3HPOA 4IQVA 1FXIA 4H2AA 4J9PA 4O5CA 7ICMA 3HRDD 4FBUA 2A1JA 3ZTCA 3AE2B 4BBNC 5HMMA 7ICQA 2KN5A 3QHTA 4F5OA 1KRHA 3UGBB 4GC7A 3F2DA 4BVUC 2EZZA 1RAXA 2EAMA 4ZHPA 5BOMA 4AS1A 1D5XC 2O6VB 2ASDA 4B9SA 1D3ZA 4PYZA 2D8CA 2JRZA 2D3CA 2WF5A 5CA7A 3MFIA 1WM3A 1WSPA 2W7PA 1Q5WB 3CMMB 4KLFA 1QQ7A 4O3QA 4LZGA 1QLNA 4NQKE 4EE2A 1WI0A 2ATLA 3NZ3A 3EFUA 2XO7A 1X2IA 3IT4B 2KMDA 4NAWB 3RJJA 5L1KA 8ICFA 2VJ5A 1TS5A 2REXA 3VR9B 2B76B 4QZCA 4XDCA 4DSIA 4PL2A 3VC8A 3H8HA 1HXYD 1WGYA 2GOWA 2N9LA 5ALTA 2K0PA 1WR1A 3RJIA 3IP4B 2WXHA 3VQIA 3TADA 2BS3B 3RNFC 5C5JA 1E5WA 4HCNB 2MW5A 2SEBD 5CRXA 5HHHA 2MUTA 2L3ZA 4KMUA 4Y2JA 4R65A 5AK4A 1QT9A 4A8XC 3S6JA 2KFNA 2M0AA 2O2VB 4A6QA 2JV3A 1V5OA 2JT4B 4O1NA 5ALLA 4ACOA 2BW2A 7ICGA 4ELVA 2BS4B 1U47A 9ICOA 2MA1A 3N9YC 2EZYA 2LGXA 4MGZE 3QX7A 2KQ7A 2LM1A 2ESEA 4C8MA 1CEZA 5AZHA 3V7JA 3IRUA 1WZ0A 2LYHA 7ICKA 3IDWA 5DGBA 5J2EA 3VUYA 4KLGA 2KFJA 4UAVA 1WH3A 3G6VA 1KH0A 2HTME 3SDLC 4MJSB 3WALA 4Y2SA 1NK0A 1U9LA 3W1SC 1NK4A 3NASA 1TFRA 3NTUA 4BJQA 5DLFA 2L32A 2WYQA 4ACFA 2OJRA 5KAFU 4DL5A 5J2RA 4KV2A 9ICFA 2F76X 4OJOA 4Y2XA 3Q8LA 2H3IA 2DWQA 5KFRA 3HX0A 3H0RB 1Z00B 4KLSA 1S8OA 4BX9C 1HA5A 3KTQA 1K5OA 2WHIA 1V1PB 4IQUA 4B9NA 3CF6E 3TEZA 1V9PA 1U4BA 4HKZE 1R4NB 4IRDA 3PX4A 5DPTA 3ZYYX 2VJ4A 1I4GA 1ZQRA 3ENEA 1IUEA 1E6EB 5KFAA 4DLEA 3PZDA 4X57B 4UDUC 2VA3A 2W04A 1HEZE 2MSED 2PIAA 3C2KA 2ZTDA 4WJPA 3RZWC 4FE3A 1EU3A 3DBLB 4TQ1A 2QARA 4HROA 2XK5A 1KFTA 4PS7A 1I4RA 3NHEB 3OJ3A 1K52A 3T8MA 2VZKD 1SXEA 5AKLA 2M9NA 4J9LA 4CRXA 5HR6A 7ICNA 1H4RA 3IXSA 4MH0E 3M9MB 2INCC 2WXKA 1YZ7A 2OHFA 1TAUA 1YN3A 2AXTU 1ZQHA 3RJEA 1J7BA 1EWCA 2KKPA 4QWCA 3SV4A 1K53A 1MN8A 4EELA 2VIXA 4P4PA 5KFMA 4ECTA 3PRPB 4TMAB 4I2IA 3OHAA 4P0QB 1GAQB 3K75D 2W9CA 4C4SA 2DZMA 1S77D 4R64A 1DK3A 3RD2A 3A0HU 1ET9A 1WXQA 1EU4A 3EC8A 1COOA 2G9HD 4ICAA 1F77A 3ISDA 3LWLA 1V49A 4FS1A 2RDHA 4KLEA 3WK8A 4B9UA 3ZJTA 3PGEA 4RF1A 4ANVA 4PHAA 2NVUI 2QKQA 2I1JA 5AICA 5ALUA 1FCLA 5D49A 1DYQA 4DF8A 4OJ5A 4BXOA 1XEEA 3PSPA 4QZDA 2HOQA 2Z8LA 4RF0A 1WWUA 1O03A 2K8BB 2FAZA 3T9LA 3BQ2A 3NZSA 4M8NA 3MFHA 4ECSA 4RQMA 1FFUA 1SJHD 3MDAA 4RQ4A 3EGRA 5L9XA 2H89B 5KFXA 3KHHA 1Z3EB 1U49A 1D8YA 1BNPA 3APCA 3QIJA 5IA7A 3B2GA 3UQ2A 4DDID 1KLNA 5HR7A 4AJWA 3AEFB 2JZBB 4QIWF 3QJZA 4NLKA 2FNJB 5LXIB 3B2FA 4CDGA 4F71A 2BPCA 3WKAA 4GSWA 3LVWA 4NJCA 4TSSA 5IIJA 1QSYA 2HHVA 3WCQA 3ZDDA 2CR5A 2YEPF 3LXFA 4O5EA 4HCPB 5TZVA 3KWVA 2KZMA 4ED3A 2LM4A 3M6KA 3SU8X 2KEYA 4RGOS 2OCEA 2IMWP 3V6KA 4W9EA 4W9LA 2FMQA 2CS4A 3M62B 4DXAB 1ZD4A 2WXRA 4K1RB 2EKIA 3V05A 5IIOA 3JYUA 1ZQZA 4UATA 4R8UB 5KT2A 2WDQB 2PJHA 2NO4A 3EW9A 3VTUA 3SD7A 9ICKA 3Q6BA 3PS6A 4RH6A 1DOQA 4W9IA 4CGZA 1ZQDA 2ZNVB 4OVZA 4FHJA 2KX3A 2V9HA 1Q3VA 2KN7A 5IILA 1SL0A 2LMRA 1RG6A 3P2BA 2YVCA 4YG2A 2C5LC 1FM0D 2DLBA 1OEYJ 1K1QA 2QILA 1G6JA 4IR1A 3PW7A 4HYKA 2C2DA 1RXWA 1A6SA 4ZH4A 4RGMA 9ICXA 4E71A 2DKXA 3EUB2 3N97B 1VRAB 3HJEA 5DB9A 4QZAA 3M63B 3VUXA 3IV6A 4LJPB 5KFPA
chains in the Genus database with same CATH topology
4WQMA 3IAS1 1I4HA 1MHHE 2WU2B 3KLSX 1A70A 4JWUC 1C4AA 3NVWA 1YQ4B 2QEJC 1SE3A 3R2TA 4OZAA 4P6VF 4PT5A 3AEEB 5I4DA 3VRBB 1SSNA 3OWEB 4R3DA 2M19A 5G5GA 2WXPA 1N5WA 3AEAB 2JYTA 5BYSA 4WURA 5FKAC 1KTKA 4L1BA 3T3NA 2WS3B 1T6BX 4GDLB 1GPXA 1SE4A 4ZOHC 4REZA 3NVVA 1QF6A 1FEHA 3Q8CA 2OEDA 2NTSA 1SXTA 1L4DB 3AE8B 3NUHB 1TS2A 5FR3A 5MPOA 3J9CA 4WH4A 1SB3C 3ETRA 5HFYA 3HVZA 2FE8A 2JWUA 3TUOA 1DOYA 5TSSA 4M0WA 1CQVA 2KMMA 2BB6A 2DBYA 1N62A 2IDYA 1C78A 1JW9D 1JWSD 4KKJA 1FIQA 1ACCA 3RFZB 3Q8EA 4RFBA 3GP7A 2ON8A 2PMVA 3NS1A 5D7GA 1MI0A 1T5XD 1HZ6A 1CK1A 1XLQA 1KFYB 2N0SB 5EE0A 1PGAA 1JRPA 1FNUA 2IJ0A 2AQ3B 2ICIA 1YNTE 3AEGB 1KLGD 2INNE 2W82A 2J4XA 2WXQA 2BT6A 1UWXA 4MACA 3AEBB 2SAKA 1GB1A 1TKYA 1TKGA 1N63A 4OZBA 2V0GA 5C3JB 5BMIA 1YJIA 1QOAA 4MH8A 1N60A 1DGJA 5HG2A 1L0XB 3E56A 3TSSA 3T3OA 1YN4A 2BYTA 1L6VA 3AE6B 2D5GA 3W5UB 2Y5PA 3R2IA 4YTNB 4ZRPA 2LJIA 4YXDB 2PLPA 3AECB 3P42A 1CJEA 5FK9C 1SBBB 3PZ8A 2W55A 5H92C 3AM9A 5JXVA 1I4QA 1K51A 1TS4A 2LGIA 3W9CB 4HRSA 4XWWA 2IGDA 1EWYC 2J53A 1SJED 1E9MA 1FXAA 2DYOA 3Q8AA 1JROA 1AWDA 3PZ7A 4B0MA 2G1EA 4DXGA 1JMLA 3UI3A 2MJEA 2BS2B 5EE1A 1UNSA 4ZHOA 4ARCA 2N9KA 4XDDA 4KGSA 1SF0A 1D4BA 1XCQL 3NRZA 1AN8A 1B1ZA 1VZ7A 2NMQA 1NI3A 3BWUD 4KX6B 1C4PA 2WXGA 2LHEA 3P1MA 2KWDA 1ZUD2 1V8CA 3TEYA 3HUIA 2WXIA 3P4PB 1D5MC 3CIRB 1V97A 4LTUA 3AEDB 1C79A 3GB1A 1Y56A 1ZOYB 1FRDA 3AE9B 3KWLA 1TY0A 3U52E 2K5PA 3AMZA 5LNK1 2KN4A 1IBXB 1E10A 1YJJA 5G5HA 2LHDA 1IGDA 1E0ZA 1QQRA 5EE9A 2INPE 3ZGZA 1MPEA 1AYFA 3DWGC 1MHXA 2W54A 1JCKB 4RNAA 1YQ3B 4XE0A 4WAFA 4B0EA 5AUKA 1XF5L 3BK1A 1RWSA 1L4ZB 4J3OD 4CQNA 1L5PA 2AQ2B 4KGRA 3U4EG 2QMTA 2IPKD 2LEKA 1K50A 3IAM1 1PFDA 2K9XA 3ZJVA 1XLOA 1VR9A 1NEKB 1NENB 2LFIA 1WYGA 3C8YA 1F2RC 3HVDA 1QILA 4DQOC 1JALA 2K3UA 4C7YA 2RMMA 3MC0B 4DXFA 2K22A 1XLNA 2LUMA 3FC4A 2Q5WD 2WP9B 4YTMB 1VZ6A 2CU3A 2QSDA 1PGXA 4YWGG 2JX5A 3BVMA 4P16A 2QJLA 4A55A 1FD6A 3BZDB 1ZXHA 1DOIA 3FAHA 4OZCA 1ZXIA 3B9JA 1TJEA 2MEKA 4A9AA 3I9V1 2RDGA 4RGNA 3BYTB 5H8YE 3AE3B 5AUIA 1OQRA 1JWMD 5EE3A 1ENFA 1P7FA 2CJNA 1ESFA 1ZPSA 2MJ3A 3V3XA 1V1PA 3VR8B 5C2TB 2ACZB 3W2DA 1RFKA 1FMAD 4ARIA 1ROEA 4KGTA 2EELA 1C77A 3L4PA 1CZPA 1UUPA 2WXNA 3FILA 4US8A 4USAA 1QLBB 1I7HA 1NYQA 4JE3B 5BYRA 2JYEA 3SR6A 4IKGA 5GXGB 4L2YA 1C9FA 1VJKA 1XXGA 4HKQA 1N5XA 1C4CA 2JXTA 4N59A 1XLPA 2WXOA 1D6EC 1E7PB 1UWMA 3I57A 2WLBA 2MJDA 2PW9A 1L0YB 3AE1B 3KQ4A 2WU5B 1SIJA 1TS3A 4MM3B 4N58A 1JWAD 3U2SC 2QIEB 2V3NA 1JWUD 2I38A 2Y5CA 2WXLA 3BIID 1AW7A 2WNMA 1FNWA 1T3QA 1GOZA 1ZP0B 1JQ4A 2AQ1B 2E3TA 1ZDXA 1FXIA 4XWTA 4H2AA 5E6JA 4JWSC 2JU6X 3HRDD 4LK0M 3AE2B 3GS2A 1KRHA 3SFDB 3Q8BA 3MFGA 4ZHPA 4AS1A 1D5XC 2WQYB 3NVYA 1FCCC 2MH7A 1PUTA 4N6EB 3LB8C 1NVID 1WSPA 3AE4B 4ZYSA 1L6UA 1QOFA 3AH7A 4EE2A 3NZ3A 2GB1A 4JPSA 1D5ZC 4RCOA 3IT4B 1R7SA 2WXMA 4NAWB 4AQ7A 2V4IB 1TS5A 1I4XA 3VR9B 2B76B 4HEA1 2H88B 4XDCA 3H8HA 1HXYD 1WRIA 2N9LA 2K0PA 4KKIA 2HDEA 3NVZA 2X38A 2KAJA 2WXJA 4LLGM 1J7AA 1ZE3D 2WXHA 3VQIA 2BS3B 2N7JA 4OHJA 1OFFA 3E9SA 2SEBD 1BMLC 1F0ZA 2XN9C 1EM7A 1QT9A 4A8XC 2R61A 4A6QA 2L83A 2M0AA 4O1NA 2BW2A 4ITKA 2BS4B 4FXCA 3N9YC 1OQQA 3PO0A 5D3IB 1LO5D 2BTEA 3W5VB 2PKOA 2W3RA 1GB4A 3AE7B 1L0VB 1KH0A 2HTME 1PGBA 2PVGC 1F2RI 1V1OA 2L32A 1FO4A 2XNAC 2DWQA 3BVZA 4US9A 2V3PA 1HA5A 1P7EA 1WWTA 2JQRB 1V1PB 3TEZA 1IBXA 3AE5B 2IGHA 3MHZA 4HKZE 3VRAB 2TSSA 2I2YA 3W1SA 2L1AA 2DYMA 3ZQ4A 1KLUD 3AN1A 1I4GA 3ZYYX 3FILB 1IUEA 1C76A 1E6EB 4WWMA 2RPVA 1HEZE 4UDUC 2PIAA 1N61A 4MT5A 3Q8FA 1EU3A 1PYWD 2W3SA 4TQ1A 4HROA 1IGCA 3DWMA 1I4RA 1FFVA 1K52A 2VZKD 1QOGA 3ZJUA 3IXSA 3O13A 2WXKA 2OHFA 1STEA 1YN3A 4NAMA 2KACA 4YSYB 1J7BA 4JX1C 1EWCA 4IDIA 3TEXA 1K53A 1YN5A 2WDVB 4TMAB 1GAQB 4Q2JA 5BMGA 1FRRA 1TY2A 2CJOA 1Q10A 3IT6B 2FUG1 1VDVA 1ET9A 1WXQA 4C80A 2GRIA 1EU4A 4GDKB 2G9HD 2VZKB 1F77A 3URYA 4C56C 2RDHA 3ZJTA 3AB5A 4RF1A 4RGTA 4C7ZA 3R8BA 4OW0A 4HJGE 1FCLA 2ZW1A 3ABVB 1DYQA 5HHDG 2WDRB 2PTLA 1XEEA 2BB5A 2Z8LA 3BK2A 4RF0A 5T8IA 4YTPB 1SEBD 2LMCA 1VLBA 4NZLB 1FFUA 1I4PA 3BVGA 2IGGA 2H89B 2NTTA 3EGRA 2M56B 2PVOD 3P4SB 2E6XA 2Y3AA 1TYGB 1QKZA 3B2GA 2FBWB 3RPFC 3AV8A 3AEFB 3EA6A 4YSXB 4YT0B 1J7CA 3B2FA 1ZDVA 3SEBA 4GLSC 4A90A 2J42A 2ONQA 2L52A 4NJCA 4TSSA 4TQ0A 3SFEB 3WCQA 1XO3A 2YEPF 2GI9A 3LXFA 2AX5A 4WIPA 2KDMA 2YEPB 3KWVA 3U7ZA 1KF6B 1DOXA 1TZOA 3LYYA 1JWBD 2J52A 4RGOS 1B9RA 3MJ5A 2WXRA 2EKIA 1XCTL 3V05A 4IOIE 4L23A 3P63A 1WGKA 1SE2A 3P4RB 3Q69A 2WDQB 1MVKA 2WXFA 1RM6C 3BYYB 1NYRA 4RH6A 1QOBA 1BUIC 1YMHE 2JZPA 4OVZA 2BBCA 1UGJA 1BXTA 1HQRD 5BYQA 3TEWA 3MP9A 3CWIA 5HI1A 1M4VA 4YSZB 4ZRQA 1FM0D 1VZ8A 2DLBA 2JSVX 2QILA 1PDXA 1ET6A 2ZW0A 3P4QB 4RGMA 1FNVA 1RYJA 1TKEA 5BMHA 3EUB2 1VRAB 1HZ5A 5D3DA 1SJHD 4D2KA 2KQ4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SF0 A;  4WQM A;  1FFV A;  4N58 A;  1JWA D;  2WU2 B;  3NRZ A;  2QIE B;  1QOG A;  1A70 A;  4JWU C;  2Y5C A;  3BII D;  3NVW A;  1YQ4 B;  1T3Q A;  1NI3 A;  1ZP0 B;  2OHF A;  4KX6 B;  1JQ4 A;  4P6V F;  2E3T A;  4YSY B;  3AEE B;  1FXI A;  1J7B A;  4JX1 C;  3VRB B;  4IDI A;  2M19 A;  5G5G A;  1N5W A;  3P1M A;  3AEA B;  4JWS C;  1ZUD 2;  3HRD D;  1V8C A;  2WDV B;  3AE2 B;  1GAQ B;  1FRR A;  1KRH A;  3HUI A;  2CJO A;  3P4P B;  3CIR B;  2WS3 B;  3SFD B;  1V97 A;  4ZHP A;  1GPX A;  4LTU A;  2WQY B;  1VDV A;  1WXQ A;  3AED B;  3NVY A;  4C80 A;  2MH7 A;  1PUT A;  1ZOY B;  1FRD A;  3AE9 B;  3KWL A;  4ZOH C;  1NVI D;  3LB8 C;  3NVV A;  2K5P A;  3AMZ A;  3AE4 B;  4N6E B;  1QF6 A;  1L6U A;  1QOF A;  3AH7 A;  1E10 A;  1YJJ A;  5G5H A;  3AB5 A;  1E0Z A;  1R7S A;  4C7Z A;  5EE9 A;  3AE8 B;  1AYF A;  5MPO A;  3DWG C;  2W54 A;  1SB3 C;  1YQ3 B;  3ETR A;  3ABV B;  3VR9 B;  5AUK A;  2B76 B;  2WDR B;  3HVZ A;  1RWS A;  1DOY A;  2H88 B;  1L5P A;  2KMM A;  2DBY A;  1N62 A;  1WRI A;  4YTP B;  1JW9 D;  2LEK A;  1FIQ A;  3NVZ A;  1PFD A;  1VLB A;  2K9X A;  1XLO A;  2KAJ A;  1FFU A;  1NEK B;  1NEN B;  1J7A A;  1WYG A;  3NS1 A;  2BS3 B;  2H89 B;  1OFF A;  1JAL A;  2M56 B;  4ZHO A;  2PVO D;  4C7Y A;  3P4S B;  1TYG B;  1F0Z A;  1XLQ A;  3B2G A;  2K22 A;  1KFY B;  2FBW B;  1XLN A;  3RPF C;  2N0S B;  3FC4 A;  2Q5W D;  3AV8 A;  5EE0 A;  2WP9 B;  1QT9 A;  3AEF B;  2L83 A;  4YSX B;  4YTM B;  4YT0 B;  1JRP A;  1J7C A;  2CU3 A;  3B2F A;  2JX5 A;  4ITK A;  2BS4 B;  2QJL A;  4FXC A;  2L52 A;  1DOI A;  3SFE B;  3WCQ A;  3FAH A;  1XO3 A;  3AEG B;  1ZXI A;  3B9J A;  1OQQ A;  2AX5 A;  3LXF A;  3PO0 A;  1TJE A;  2BT6 A;  4A9A A;  1KF6 B;  1DOX A;  3AEB B;  1JWB D;  1TKY A;  1TKG A;  5H8Y E;  3AE3 B;  3W5V B;  5AUI A;  1N63 A;  2W3R A;  2PKO A;  3AE7 B;  1OQR A;  1B9R A;  1L0V B;  5EE3 A;  5C3J B;  1YJI A;  2EKI A;  1QOA A;  2HTM E;  2MJ3 A;  2CJN A;  1N60 A;  1DGJ A;  3P63 A;  3VR8 B;  1WGK A;  2ACZ B;  5C2T B;  3P4R B;  2PVG C;  1RFK A;  2WDQ B;  1FMA D;  1RM6 C;  1FO4 A;  1ROE A;  1L6V A;  3AE6 B;  1NYR A;  3W5U B;  1QOB A;  4YTN B;  3L4P A;  1CZP A;  4YXD B;  3AEC B;  4US8 A;  2DWQ A;  4US9 A;  4USA A;  1CJE A;  1QLB B;  1I7H A;  1NYQ A;  2W55 A;  1WWT A;  2JQR B;  3SR6 A;  5H92 C;  3AE5 B;  3AM9 A;  3CWI A;  3VRA B;  5GXG B;  3W9C B;  4YSZ B;  1FM0 D;  3P4Q B;  4HRS A;  1EWY C;  1PDX A;  1VJK A;  1N5X A;  1E9M A;  4N59 A;  1XLP A;  3ZYY X;  1FXA A;  3AN1 A;  1E7P B;  1IUE A;  1E6E B;  1RYJ A;  1JRO A;  1AWD A;  1TKE A;  1UWM A;  2G1E A;  2WLB A;  4WWM A;  3EUB 2;  1N61 A;  2PIA A;  2MJD A;  2MJE A;  2W3S A;  2BS2 B;  4HRO A;  3AE1 B;  5EE1 A;  3DWM A;  2WU5 B;  1SIJ A; 
#chains in the Genus database with same CATH topology
 2J0M A;  3WU2 U;  1CUK A;  1LV5 A;  1ZJM A;  5J2A A;  7ICV A;  2W9M A;  1A70 A;  5ALO A;  4IC7 B;  2KOB A;  3R2T A;  3QNM A;  1NI2 A;  4W9D A;  2YB4 A;  1SSN A;  4R3D A;  5G5G A;  5EOZ A;  2B0C A;  2WXP A;  2ES6 A;  2KVS A;  5C0Y A;  2NR2 A;  8ICM A;  4XRH A;  3GV8 B;  3C1Y A;  8ICU A;  3IHP C;  3T3N A;  1T6B X;  4F2S A;  1SE4 A;  4II3 B;  2KK0 A;  3H7P A;  3KZI U;  2VA8 A;  5CX3 A;  5KG5 A;  3PW0 A;  4GXJ A;  5KT5 A;  1QF6 A;  1IYF A;  2D6F C;  2LRW A;  1L2N A;  5KFJ A;  4WJN A;  2K25 A;  2OED A;  3HIZ A;  1UT5 A;  3QXG A;  3D2N A;  1C20 A;  5DB8 A;  3NUH B;  5MPO A;  3ZTD A;  3J9C A;  4YN4 A;  1U4A A;  5B5E U;  1SV0 C;  3H7I A;  4J6I A;  5HFY A;  4F72 A;  4MFC A;  4PGQ A;  3OTQ A;  2FE8 A;  2KJ9 A;  3V6J A;  5TSS A;  4DWI A;  3H8M A;  2DBY A;  5CWR A;  1N62 A;  4YD2 A;  2IDY A;  4KKJ A;  1JWS D;  1FIQ A;  3D6J A;  1WXA A;  5KFY A;  2CRX A;  2KJH B;  2KV2 A;  2PMV A;  5J2H A;  2F3N A;  2BWF A;  2C60 A;  3I3T B;  4EUT A;  1LVH A;  4WWO A;  2K8C A;  3HT3 A;  3M9O B;  2AWT A;  5JHA A;  3ZW3 A;  3L5K A;  4YR3 A;  2P6U A;  5AKG A;  2KP7 A;  1KLV A;  1V81 A;  3PW2 A;  4JV1 A;  2N0S B;  4PH5 A;  5CR0 A;  4YMO A;  2A1J B;  2NV3 A;  1FNU A;  2H3Q A;  1PGA A;  2M1M A;  5J2B A;  1GG3 A;  3GIK A;  3GZN B;  4QNL A;  2H3Z A;  4YMN A;  2K60 A;  5DQI A;  4RQ2 A;  2W82 A;  4NWI A;  2J4X A;  2WXQ A;  3H8S A;  1ZQN A;  2FMP A;  4MAC A;  3D2Q A;  4CF4 A;  1TKG A;  3GZF A;  1N63 A;  5KT4 A;  7ICO A;  3AU6 A;  5C3J B;  5KFK A;  2LGY A;  1YJI A;  4RPZ A;  4CYE A;  1EUV B;  3E56 A;  2DL0 A;  4NY8 A;  3RFA A;  4XUS A;  1WR6 E;  1R4M I;  1YN4 A;  4YR0 A;  3QAR A;  4IQT A;  2BYT A;  2QCZ A;  5H2F U;  3PRZ A;  2LKY A;  2UVV A;  2YLM A;  2HHW A;  5AZF A;  1XO1 A;  3OHB A;  4YXD B;  3AEC B;  4RQ5 A;  4Q45 A;  3H0M B;  1SBB B;  3AEV A;  5ALP A;  2RDJ A;  1XSN A;  4FN2 A;  5H92 C;  3BS5 A;  5J0O A;  1UEL A;  3W9C B;  2ZVO A;  1KRP A;  2MUT B;  1ZD3 A;  1E9M A;  2LXA A;  1S10 A;  3A4R A;  2DYO A;  8ICS A;  2NRW A;  4P4O A;  2P6R A;  9ICU A;  2C2R A;  2J6T A;  2ZIU A;  3RB3 A;  5AKI A;  2KKC A;  3PZ7 A;  4B0M A;  2J0K A;  4RT2 A;  1S0V A;  2MJE A;  2E8P A;  3Q8P B;  2QC8 A;  1J97 A;  1UNS A;  2KZ3 A;  3DPD A;  4ZHO A;  2KAN A;  4ARC A;  2KDF B;  1SF0 A;  1XCQ L;  2EAO A;  3ZDC A;  3NRZ A;  4EZK A;  1AN8 A;  2KLG A;  4GXB A;  2F8L A;  1PUZ A;  3WA0 A;  1L3S A;  3QAQ A;  4KX6 B;  5HP4 A;  2X8X X;  2ZZP B;  2WAQ F;  2B6G A;  1ZQL A;  3HKZ F;  2MU2 A;  5DBC A;  3EYZ A;  1TV9 A;  3DDC B;  3K9O B;  4JB3 A;  2WXI A;  3P4P B;  2Z7J A;  1V97 A;  5J0Y A;  4CNQ A;  4DFM A;  3A0B U;  3VAW A;  2MBQ A;  1MG8 A;  3KUZ A;  3G6X A;  2F1I A;  3EZ5 A;  2XY7 A;  5LNK 1;  5ALG A;  2HE7 A;  3QQ8 B;  4DEZ A;  4FJZ A;  1YJJ A;  1QQR A;  1MPE A;  2RRD A;  4RNA A;  2LYB A;  4YVZ A;  4MHV A;  5J0X A;  3DEE A;  3JW0 X;  1SWV A;  4DS4 A;  8ICX A;  1L4Z B;  4BAX A;  1JUD A;  4DBG A;  3PML A;  4DQI A;  9ICH A;  1L5P A;  3ZXV A;  2QAR B;  3OPX A;  2XK5 B;  5AM3 A;  2EMT A;  4M02 A;  1NEN B;  3TAP A;  1WYG A;  2UVU A;  9ICV A;  4ECR A;  2G5I B;  3Q8K A;  3HVD A;  1QIL A;  4LNI A;  1JAL A;  3TJP A;  3EWA A;  3OGU A;  3MGH A;  1ARO P;  5HML A;  1PK1 A;  4W9K A;  5L1M A;  3R3M A;  1XLN A;  1D8L A;  2PE9 A;  4I2B A;  3BZC A;  1L6N A;  1BPE A;  4EZ9 A;  1VZ6 A;  2IZV B;  2QSD A;  1PGX A;  2W9C B;  3SMV A;  3BVM A;  4P16 A;  3ZIM A;  4A55 A;  4HDO A;  3BZD B;  2AGQ A;  1ZQQ A;  2LHT A;  1R4N I;  1ZXI A;  3B9J A;  1XO0 A;  2OEH A;  2KDE B;  1XT9 B;  3Q8S B;  7ICU A;  4TUU A;  2RQ5 A;  2MLB A;  2RDG A;  3EPG A;  3MR2 A;  3BYT B;  4ANW A;  5KFV A;  5AUI A;  1OQR A;  3DBL I;  1Z00 A;  1JWM D;  4KSK C;  4QZE A;  4DSL A;  2N9E B;  1P7F A;  1ESF A;  2CJN A;  1ZPS A;  1V1P A;  5C2T B;  2ACZ B;  4U7C A;  3OJU A;  3TL5 A;  4BXO B;  1FMA D;  2F1J A;  5KFZ A;  3C21 A;  3RR8 A;  3GOE A;  1TK8 A;  1FXT B;  3L4P A;  2ISP A;  4J9O A;  1Q3U A;  2A4Z A;  4ZYN A;  2N1R A;  1QLB B;  2ZUB A;  3HWT A;  3VFK A;  3UF8 A;  2I6X A;  2JYE A;  4CHK A;  2L0F A;  4HPL B;  2IBI B;  5J2J A;  4EKU A;  2F1H A;  5III A;  5ALW A;  4L2Y A;  8ICV A;  1C4C A;  2JXT A;  4FFD A;  1XLP A;  2KJR A;  2KE7 A;  4UAY A;  5KFF A;  5DPS A;  4OVV A;  3QCA A;  2BPS A;  4K3C A;  1J2N A;  3ZNH B;  4BOS C;  3QU9 A;  2K4I A;  3KQ4 A;  2WU5 B;  3C29 A;  4HDQ A;  2QDF A;  2YMQ A;  2MRP A;  5ALZ A;  1S1Q B;  4DQQ A;  1Y8R C;  1JWA D;  1YOV B;  4KSL C;  4N58 A;  8ICY A;  4M9N A;  4FJV B;  1AW7 A;  4NV0 A;  3RF9 A;  4KN7 A;  4F1S A;  3D2S A;  1X66 A;  2XVT A;  1YD8 U;  3RI7 C;  5KG3 A;  2ZG6 A;  4XWT A;  1WXV A;  3EEC A;  1A77 A;  4LK0 M;  1V5T A;  4AWJ A;  3HIL A;  5KAI U;  2DPI A;  1OXJ A;  4MF2 A;  2L05 A;  3SFD B;  3VH3 B;  4Q43 A;  4IM0 A;  2WQY B;  2H5X A;  4QZ8 A;  3NVY A;  2EQY A;  1SL2 A;  4NLG A;  1FCC C;  2MH7 A;  1WWV A;  1PUT A;  2DUY A;  2WX0 A;  4BFR A;  2YML A;  4QIW C;  1NVI D;  2KK8 A;  4LNK A;  5KHQ A;  3C19 A;  4ZYS A;  5KFN A;  1UQV A;  3AH7 A;  4K3B A;  5AK6 A;  3JPR A;  4G9B A;  1HE8 A;  4JPS A;  1D5Z C;  1QH9 A;  4DQR A;  2XEW A;  5DBB A;  4LCD E;  2ASQ A;  4AQ7 A;  2KD1 A;  4UAU A;  3TFR A;  2W9A A;  4MEL A;  2LAS A;  4B9M A;  2Q0Z X;  2R8G A;  1E90 A;  3PO4 A;  5KG0 A;  4I2C A;  2I1Q A;  3WK9 A;  5E6N A;  1ZET A;  2YX8 A;  2KAJ A;  2ZJ5 A;  5DQH A;  1ZE3 D;  1D8B A;  2ZIW A;  4YCX A;  4OHJ A;  2N7J A;  2KZR A;  2FPL A;  4RPX A;  2HBK A;  1Q46 A;  3RBD A;  4DHZ E;  3E9S A;  3ZNI D;  1RYS A;  2BGW A;  1WE6 A;  5IOI A;  1YQB A;  2VRR B;  2L83 A;  1V6E A;  4F8C B;  3PPA A;  4ASW C;  2XC9 A;  2JF5 A;  4M9L A;  3K1Z A;  4EYH B;  4J9R A;  4FXC A;  1QCK A;  2KJ5 A;  2IA6 A;  3H7P B;  4IWO A;  5GMV A;  4FA6 A;  4JLC A;  2F77 X;  2KMC A;  2MRL A;  4W9F A;  4NJ8 A;  1LO5 D;  3RH4 A;  3MGV A;  2KTF A;  3N1X C;  2W3R A;  1GB4 A;  3AE7 B;  1SZH A;  2BHN A;  1L0V B;  1T94 A;  1JRU A;  1PGB A;  4QZH A;  2XCA A;  1J8C A;  2IOF K;  2YN4 A;  2IY0 B;  2OWO A;  3DVN V;  4PK1 A;  4PHP A;  4MFA A;  2AHO B;  4PPX A;  3ORY A;  1KBU A;  2XNA C;  3HHM A;  2W03 A;  2UVW A;  1P7E A;  1WWT A;  2D07 B;  1TE2 A;  2K8C B;  3SAG A;  2L76 A;  4EZL A;  2TSS A;  4JUZ A;  5ALI A;  2L1A A;  3AQF A;  5KT3 A;  1KLU D;  3TMP B;  3TEY A;  2KFZ A;  1N61 A;  2IOF A;  5IIK A;  2FPK A;  2C7M B;  2W3S A;  1ZQV A;  5DDM A;  1IGC A;  3DWM A;  1KW4 A;  2LWP A;  4FO6 A;  1ZJN A;  4IM3 A;  5E79 U;  3T5H A;  2RD0 A;  3ZJU A;  2J6S A;  3O13 A;  2IO3 B;  3M9N B;  3ZKJ C;  5CTR C;  2UU7 A;  2KTQ A;  1V80 A;  2KQS A;  2BCS A;  3GFK B;  3MC9 A;  1FRR A;  2CJO A;  2JZZ A;  3IVF A;  1HUZ A;  2ZJ8 A;  1VDV A;  3CYM A;  2CU1 A;  4KLQ A;  1BGX T;  2GBJ A;  2LD9 A;  5K4L A;  4J9K A;  1Q1O A;  4C56 C;  1SV0 A;  1UA1 A;  1C7Y A;  3BS5 B;  2CKH B;  3N30 A;  1PVQ A;  1M6Y A;  9ICP A;  3R8B A;  4OW0 A;  4J03 A;  3L54 A;  3RNE C;  2LVQ A;  5AI5 A;  3ABV B;  2RHF A;  2ZIU B;  4UB4 A;  3G6Y A;  1Z19 A;  2BWE S;  2WDR B;  1WG8 A;  3BK2 A;  3PNC A;  4GGQ A;  4M9G A;  2EZX A;  4I2J A;  5IP4 D;  1OGW A;  1I4P A;  3IFW B;  2LRU A;  5CHG A;  9ICL A;  3QU5 A;  2E6X A;  2Y3A A;  2D3B A;  3ZNG C;  1QKZ A;  4DSE A;  1P98 A;  3H4B A;  3E58 A;  3LWM A;  3L10 B;  3R7Q A;  3ZDA A;  2AQ4 A;  4TKN A;  4YSX B;  4EBC A;  2HCF A;  1UBQ A;  3E0F A;  3VTV A;  4AP9 A;  4GLS C;  3WKE A;  1UPH A;  1LXD A;  2L52 A;  3UIO B;  3RB0 A;  4TQ0 A;  4P0P A;  5GTI U;  4HVB A;  2JH1 A;  2KMA A;  5D2M B;  4ELU A;  2RP5 A;  4NL9 A;  1HJP A;  2KDM A;  4F3O A;  3LYY A;  2J52 A;  2EDU A;  1B9R A;  3N3K B;  4WQO B;  2ZJA A;  4NLC A;  2XY6 A;  3ZDT A;  3I28 A;  1WGK A;  5F9N A;  5J2K A;  3P4R B;  3N20 C;  5AKH A;  1MVK A;  5JHB A;  1Z1B A;  2MA9 B;  4C0Z A;  2WXF A;  1RM6 C;  1ZQE A;  3BYY B;  1NYR A;  1QOB A;  8ICQ A;  3AL0 B;  2WAQ C;  2BKF A;  2DQN B;  3IG8 A;  1YMH E;  2BKR B;  1ISN A;  4QWD A;  2JZP A;  3Q14 C;  3HKZ C;  5J2C A;  4M04 A;  1YT3 A;  3DBH B;  3KH0 A;  4NM1 A;  1X6I A;  4RU9 A;  1HQR D;  3TEW A;  3MP9 A;  3CWI A;  2M0X A;  3TCA A;  1PK1 B;  4Y2U A;  1WGD A;  2JSV X;  4ZRQ A;  1PDX A;  3QU7 A;  3FDS A;  1ET6 A;  2KDI A;  5E6O A;  5KFT A;  2OJW A;  5KFQ A;  5AM2 A;  3PX6 A;  5AIB A;  3K1R B;  4C4V A;  5IN7 A;  3F2B A;  3FM9 A;  4UB3 A;  2ODG A;  4K4G A;  2KQ4 X;  1XQQ A;  3R66 C;  2BDP A;  2AJQ A;  4WQM A;  2AYO B;  5AI8 A;  1MHH E;  3KLS X;  1B0X A;  4PHE A;  1RLF A;  3D32 A;  1TVA A;  1YQ4 B;  4NPN A;  1LGR A;  2V1Y A;  1NNL A;  3CST A;  4KLT A;  2ZPN A;  3OWE B;  8ICA A;  2M19 A;  1ZQU A;  1N5W A;  3ML9 A;  4ED2 A;  1KTQ A;  3PSF A;  4EX7 A;  1KTK A;  2RDB C;  2ZEQ A;  2E8O A;  2MHJ A;  3UM9 A;  1S76 D;  8ICR A;  5JRT A;  4P2H A;  2KZZ A;  2DYB A;  1BPX A;  2Y0S F;  3MC1 A;  2KKV A;  4E0D A;  1IG6 A;  1BT0 A;  4GC6 A;  4NNJ B;  4QZB A;  8ICN A;  2NTS A;  4K7U A;  1SXT A;  5J17 A;  2HHU A;  1LKY A;  3KUD B;  4MEX A;  1TS2 A;  1HTO A;  3N7P D;  5FR3 A;  2P35 A;  2KVR A;  2G06 A;  4J9N A;  3EFC A;  4WH4 A;  4XX5 A;  3DDH A;  2K6D B;  3HVZ A;  2JWU A;  4C8N A;  1PZN A;  2JH7 A;  1CMX B;  1CQV A;  4JIO U;  4GN1 A;  2BKE A;  3QYP A;  2GLE A;  4RUA A;  5AI9 A;  4KMO B;  1ZQY A;  3RRG A;  2VA2 A;  1RRB A;  2FIF A;  3ECI A;  3RFZ B;  4RFB A;  2PFQ A;  1ZQC A;  4HWI B;  4JV2 A;  5D7G A;  2G5H B;  3ZDB A;  8ICC A;  2KC2 A;  1HZ6 A;  2E5S A;  4DFP A;  3PLU A;  5D6J B;  4ECX A;  1F44 A;  2PEA A;  5C1Z A;  5KFB A;  2N7E A;  4UQG A;  4M47 A;  2A19 A;  2N1W A;  1JRP A;  5KNI A;  2IJ0 A;  4HXD A;  1RQL A;  4MGY E;  3PZP A;  2ICI A;  4Y2T A;  2Q4T A;  2NPT A;  1RFA A;  1ZQT A;  2LVO A;  1SKR A;  5J2G A;  4DL3 A;  5D46 A;  3SI8 A;  3ZDM C;  5AM1 A;  3TI0 A;  4RUC A;  2SAK A;  4K7S A;  1WCL A;  4FJY A;  1WM2 A;  2IHN A;  2FCM A;  2V0G A;  2Z59 B;  4I2E A;  4MH8 A;  1ZQB A;  1N60 A;  1DGJ A;  5T14 A;  5CEH A;  1L0X B;  3L0W B;  5HG2 A;  3NGD A;  1S0O A;  3M8R A;  5L1J A;  3W5U B;  4JL9 A;  4MGI E;  3AUO A;  3R2I A;  4YTN B;  2LJI A;  2E8N A;  3LK9 A;  3H0L B;  3P42 A;  5AKJ A;  3AU5 A;  3IN5 A;  5AK5 A;  4ICV A;  4E3C A;  2RDI A;  2ZIW B;  2ZXI A;  1XWL A;  3AQE A;  5BPC A;  4GDK A;  9ICA A;  4G11 A;  4QZ9 A;  3BIN A;  5IAA C;  3OJS A;  3AM9 A;  1SGH A;  3RR7 A;  1KEJ A;  1NKE A;  3TBL D;  3KYC D;  2CPR A;  4YXM A;  2KO3 A;  3Q8A A;  1NK8 A;  1JRO A;  2G08 A;  3QU4 A;  4KIK A;  5D94 A;  5AI6 A;  4W9C A;  4WAA A;  4MSM B;  2BS2 B;  3PLV A;  4QZI A;  2ZUD A;  4O5K A;  4GU2 A;  4IW0 A;  4KGS A;  4KDI C;  4W9G A;  5E6P A;  3AI5 A;  2LJ5 A;  5ALJ A;  1LFD A;  5EDS A;  1NI3 A;  2IO1 B;  3BWU D;  3I5J C;  3IG3 A;  1C4P A;  1Z1V A;  1SIF A;  2E1E A;  2KHW B;  2WXG A;  2W9N A;  3P1M A;  2G4D B;  2WF8 A;  2WF6 A;  1V8C A;  3H6N A;  4LDT B;  4LJX A;  8ICJ A;  5DCN A;  2GMI C;  4CF5 A;  5KL1 B;  4DCC A;  5ALS A;  5KFE A;  4IR9 A;  1V2Y A;  2XBB C;  1QQ5 A;  2V4Q A;  4GIV A;  1RPL A;  1ZOY B;  1FRD A;  3QA8 A;  2ZNV C;  4DOB A;  2ZXH A;  3FKY A;  3UQB A;  5HHI A;  5G5H A;  1NJZ A;  1ZQF A;  1TAQ A;  1E0Z A;  5EE9 A;  4JK1 A;  3H4D A;  1PQS A;  1AYF A;  1RXV A;  2W54 A;  1KDH A;  1JCK B;  4UAZ A;  2LYA A;  2WGS A;  1TK0 A;  1XF5 L;  3BK1 A;  4YFK A;  1P3Q U;  3GII A;  1BVS A;  1P9D U;  5JTI A;  5KFH A;  2AQ2 B;  3SEN A;  4TQS A;  5KFL A;  1WGR A;  1ZYQ A;  3IAM 1;  1PFD A;  1ZQX A;  2A1A A;  1VR9 A;  2HVH A;  1NEK B;  1XLO A;  1UBI A;  4ED8 A;  4WWN A;  4KLJ A;  8ICE A;  3N1Z C;  2K3U A;  4C7Y A;  4F5P A;  3ZI4 A;  1WF9 A;  2RMM A;  3MC0 B;  3RNC C;  8ICW A;  4DXF A;  3OAW A;  3RYT A;  3I63 C;  4IRC A;  4RM9 A;  3FC4 A;  2Q5W D;  4EBE A;  1YZ6 A;  5IIM A;  4IL6 U;  4YWG G;  5AKE A;  2C7N B;  1F0M A;  1FD6 A;  4DL7 A;  3S2A A;  2KG5 A;  3C2L A;  2CHZ A;  1MFW A;  4K4H A;  1IPG A;  3Q3N C;  4RNN A;  3I9V 1;  1NJW A;  5AM5 A;  2JVC A;  3QUB A;  3VTW A;  3LDZ E;  1ZQM A;  3HP6 A;  3N32 A;  1I42 A;  3MC8 A;  3MR5 A;  3UXP A;  1T0S C;  3ALB A;  1SWW A;  1P0R A;  3M7D A;  1CI4 A;  1TT5 B;  1QZE A;  4ARI A;  1ROE A;  2GBM A;  5L83 A;  4GDL A;  2WXN A;  5DDY A;  2XGQ A;  3F53 A;  1I7H A;  1NYQ A;  2R8I A;  2MQJ A;  4YD1 A;  7ICT A;  2D10 A;  2BYV E;  3MDC A;  4LNF A;  5GXG B;  3R7R A;  4GMV A;  4F50 A;  2KXJ A;  4F93 B;  1BPB A;  2CXY A;  1XC9 A;  2WXO A;  4M9H A;  2ZPY A;  2WX1 A;  1UWM A;  2PI5 A;  5KG2 A;  1J19 A;  4KLU A;  5J2I A;  1KQQ A;  1A0P A;  2PFP A;  4Y2R A;  4O3M A;  1J2M A;  4P0P B;  4ED0 A;  2O6V D;  1SIJ A;  1ZD5 A;  3F2C A;  3IBE A;  2ZTC A;  3PHW B;  3PST A;  3L16 A;  1TTN A;  2HBM A;  3NY5 A;  9ICR A;  1E7V A;  2V3N A;  2I38 A;  4OJP A;  2WXL A;  2WNM A;  1ZP0 B;  3VXW A;  2N7D A;  2K89 A;  3T3F A;  3PW5 A;  1JQ4 A;  2E3T A;  3WAO A;  4Y2Y A;  4B9V A;  2KWC A;  3NS8 A;  4JWS C;  4F5R A;  4BKS D;  2IND C;  3GS2 A;  2HTH A;  2IOH A;  1ZD2 P;  3UMB A;  2PFO A;  2JY6 A;  3MFG A;  5KFU A;  3SAH A;  4KTQ A;  2KIW A;  9ICE A;  4E74 A;  3ISC A;  3LB8 C;  3DQV A;  2GBR A;  5KHO A;  3UIP B;  1L6U A;  1JIH A;  3TAD C;  4QWA A;  3QUT A;  1QOF A;  2K4P A;  2JMG A;  2GB1 A;  3RT3 B;  1NZB A;  4JV0 A;  1R7S A;  2DNF A;  2JEJ A;  4M01 A;  2V4I B;  2DAJ A;  4BDP A;  2N1V A;  2KTR A;  4HEA 1;  4FZL A;  1GC7 A;  4C4V B;  4DL6 A;  2D3A A;  1NK6 A;  2LUE A;  3PSI A;  1SL1 A;  1WRI A;  2KSO A;  2NBV B;  3V61 A;  2X38 A;  4UB5 A;  1OUQ A;  2I9G A;  4LLG M;  4NLB A;  4HJK A;  1J7A A;  3PHX B;  4BOZ B;  1X9W A;  4A8E A;  4Q44 A;  3UQ0 A;  2MP2 A;  4ZRK A;  1QTM A;  2J0J A;  5AZG A;  3WAP A;  1F0Z A;  2BCV A;  2XN9 C;  2GLS A;  1OW5 A;  3DBH I;  1XNS A;  4XC2 A;  1MQ2 A;  2PPH A;  3JPS A;  4F91 B;  4RQ0 A;  4XGA B;  2LVP A;  4YL8 A;  3N7R C;  1ZQJ A;  3WKD A;  3PO0 A;  2JZ3 B;  3THV A;  2BTE A;  5J2D A;  3KKA C;  2DZK A;  3W5V B;  2PKO A;  4YP3 A;  1LKY B;  3KHG A;  3C5G A;  1WFY A;  1Z4N A;  3TIX A;  3ZO5 B;  3WK5 A;  1V1O A;  1PVP A;  3KBB A;  1N6Z A;  1EF5 A;  3MR6 A;  1FO4 A;  1SGG A;  1X1M A;  1WJ4 A;  1RYU A;  1KL9 A;  7ICF A;  2KD0 A;  1QSS A;  1IP9 A;  4Y2Q A;  4GFJ A;  3BVZ A;  1XD3 B;  1X6J A;  4US9 A;  2E8M A;  3GU3 A;  3ZXR A;  2BDU A;  2GBK A;  4QWE A;  3ONS A;  1WX9 A;  4MGK E;  1IBX A;  2M4N A;  2I2Y A;  2FCN A;  2F44 A;  4C00 A;  1ZQP A;  3W1S A;  2Y0S C;  4EZ6 A;  2HJ8 A;  3FIL B;  1C76 A;  1WZ3 A;  1JXE A;  3VVW B;  5ALH A;  4MT5 A;  3Q8F A;  1B43 A;  2NPT B;  3BDP A;  4MF8 A;  2RSU A;  1OEY A;  4QZF A;  3DOW A;  3LVV A;  3R9K A;  1AQ6 A;  4BZA A;  1FFV A;  3NRW A;  2FJ6 A;  2QB1 A;  2G3Q B;  1QOG A;  8ICH A;  2D2Q A;  2W9B A;  1ED1 A;  2KX0 A;  4AP4 C;  2GWS A;  1VD2 A;  1STE A;  1KFS A;  4X5V A;  4YSY B;  1E8X A;  4JX1 C;  3TEX A;  2RGF A;  4RT3 A;  4JMU A;  1KOT A;  2IY1 B;  3ALR A;  4Q2J A;  4FZM A;  2JEF A;  3C1Z A;  7ICR A;  1Q10 A;  4F2R A;  3KVF B;  2DAF A;  3T5K A;  2FUG 1;  1RDF A;  3RB6 A;  3X23 A;  2FID A;  8ICZ A;  4GDK B;  4I2G A;  2VZK B;  3BZK A;  4M6W A;  4KLI A;  1SKW A;  2L5Y A;  3A1Q A;  5ALF A;  3RB4 A;  1TAM A;  1Q8K A;  1L5U A;  3SHQ A;  2BCQ A;  3WKC A;  4FLH A;  5HHD G;  2JXJ A;  1ZQW A;  4F4W A;  2PTL A;  4KIK B;  4NY0 A;  2BB5 A;  2ZIV A;  4RPY A;  3U8Z A;  4GXK A;  9ICS A;  4YTP B;  1SEB D;  4EEK A;  4NZL B;  4G3X B;  1P7D A;  2FUH B;  8ICK A;  3RAQ A;  3BVG A;  4J9M A;  1N56 A;  2IGG A;  2NTT A;  2BCR A;  1L7N A;  1GUA B;  2PVO D;  4P7I A;  4IRK A;  4R66 A;  2Y1I A;  3MHS D;  5CJ7 A;  4PL1 A;  2JEG A;  1VCB A;  3MGI A;  3EA6 A;  2G09 A;  3EPI A;  4YT0 B;  1J7C A;  3PVL A;  1ZDV A;  4A90 A;  1UGM A;  4PYU A;  9ICN A;  4I27 A;  1XO3 A;  2V9W A;  2HSZ A;  2GI9 A;  3JPT A;  7ICL A;  2HD5 B;  2YEP B;  4WIP A;  3NUQ A;  2CHW A;  1KF6 B;  4MM3 A;  3U7Z A;  1DOX A;  3DBR B;  1JWB D;  3CW2 C;  1K8R B;  3MJ5 A;  4QW8 A;  4IOI E;  4BWM A;  3AXC A;  3P63 A;  2KFK A;  1SE2 A;  1N48 A;  5J8Y C;  3RN9 C;  5AHX A;  4PGY A;  4DHZ B;  8ICT A;  1NKC A;  3UMG A;  5J0P A;  1EO6 A;  1UGJ A;  1BXT A;  3ZUN A;  4ED6 A;  5BYQ A;  2P66 A;  2DZI A;  5DB7 A;  3DCG A;  4UB2 A;  5HI1 A;  2JXX A;  4DQS A;  3QZ7 A;  4YSZ B;  2ZW0 A;  3P4Q B;  4OD0 A;  2NS5 A;  3RUI B;  5EWE A;  2LI6 A;  4RM8 A;  3L17 A;  4OJ6 A;  4NJ6 A;  2AEH A;  1TKD A;  2HJ1 A;  4AYB F;  1L8L A;  4ECW A;  2J6U A;  1TKE A;  4FUL A;  2EH9 A;  5BMH A;  3SEI A;  2G0A A;  1OQY A;  4GLX A;  1WIA A;  4LNO A;  2XY5 A;  5D3D A;  4D2K A;  3GIM A;  2GBN A;  4K7W A;  4ECZ A;  2VH2 A;  5DBA A;  3C28 A;  1ZOL A;  1ZQO A;  4F4X A;  4AOF A;  4OJL A;  1C4A A;  3GDX A;  1SE3 A;  5AKK A;  4P6V F;  4PT5 A;  3V72 A;  3DHG C;  3AEE B;  2V3S A;  5KFW A;  4DF4 A;  4ED1 A;  1NK7 A;  4I29 A;  2IO2 B;  3UIN B;  3VRB B;  3SZ2 A;  4JQW C;  1IV8 A;  3C0R B;  5BYS A;  4WUR A;  5J0R A;  5FKA C;  3M95 A;  2N4F A;  5G2N A;  2WS3 B;  4CE6 A;  4GDL B;  2KNJ A;  4DLG A;  5TIS U;  4ZOH C;  2EKE C;  9ICQ A;  1C1Y B;  2L0T A;  1T0R C;  4Z6D A;  1FEH A;  3Q8C A;  3BQ0 A;  3RBE A;  2ZTE A;  4JGH B;  4TUR A;  4IG7 B;  3C5F A;  3V7K A;  3AE8 B;  3PT2 B;  3K9P B;  2UVR A;  5BOL A;  1SB3 C;  2ZIX A;  3SYZ A;  4DFD A;  4F5Q A;  3KFU F;  4EEN A;  2K8A A;  4LJO B;  3TUO A;  3QK0 A;  1UD7 A;  4M0W A;  3HW8 A;  4O0I A;  2BB6 A;  2KMM A;  2BQ3 A;  1JW9 D;  3PMN A;  1ACC A;  2FCQ A;  2CHX A;  5KFD A;  3SQI A;  2R18 A;  1E8Z A;  2ZJD A;  4HLE A;  1NK9 A;  5ALQ A;  5HKH A;  3NS1 A;  2KHQ A;  4I6P A;  1WRD B;  1MI0 A;  4PGX A;  4U6P A;  1T5X D;  3MJW A;  1CK1 A;  4RQ1 A;  1XLQ A;  2MWS B;  5BO4 B;  1KFY B;  5EE0 A;  3GZN I;  4CO7 A;  3ISB A;  4HPM B;  3PV1 A;  4AUQ C;  2GOL A;  2K39 A;  2I5H A;  3J81 j;  2KHV A;  5KG4 A;  4DFJ A;  2QB0 A;  3KOO A;  2ALZ A;  4DSJ A;  1NZP A;  2BT6 A;  5AM0 A;  1ZQI A;  1GB1 A;  3QUQ A;  1TKY A;  1WGG A;  2FLN A;  3ZD8 A;  4I2A A;  1Z2M A;  4YXJ A;  4OZB A;  5BMI A;  1KM7 A;  1QSL A;  1QOA A;  2WHE A;  5AM4 A;  4YMM A;  1BPZ A;  2KTR B;  2BF8 B;  1WE7 A;  3WIM A;  2BCU A;  2EMS A;  1L6V A;  4FZN A;  4UBB A;  2KSO B;  3RUL A;  4KIT B;  2PLP A;  2XI9 A;  2IBK A;  4P1C C;  1IXR A;  5FK9 C;  1XSL A;  1XU4 A;  3A9J A;  2MP2 B;  2NCN A;  5JXV A;  2O6K A;  5ALR A;  2E1F A;  3ML8 A;  1I4Q A;  3RJG A;  1U48 A;  4HAI A;  4Z6C A;  2XGP A;  3N4M B;  1EWY C;  2C22 A;  2IGD A;  4XWW A;  1VJ5 A;  1YJ1 A;  3X0W A;  1D9D A;  4LZD A;  1AWD A;  1UA0 A;  4DXG A;  4EX6 A;  1JML A;  3Q3O C;  3UI3 A;  2B3A A;  1NK5 A;  3ETL A;  5EE1 A;  1NBF C;  1WXS A;  4DOA A;  2ASJ A;  1NJX A;  4Q8E A;  1B22 A;  3VUW A;  1B1Z A;  1VZ7 A;  2NMQ A;  1E7U A;  1XS9 D;  4ECU A;  5CHV C;  4QWB A;  2VKQ A;  1T3N A;  4F4Y A;  4EZJ A;  2A3V A;  1T8E A;  1HTQ A;  2LHE A;  3GIJ A;  2QLT A;  3Q3J A;  9ICJ A;  4IWQ A;  3V6H A;  3O65 B;  2R8J A;  3CIR B;  3B08 A;  5AI4 A;  2HOF A;  1I35 A;  3UXN A;  3OJ4 B;  5DB6 A;  3M8S A;  3AED B;  5L1L A;  1CRX A;  9ICC A;  1L7Y A;  3KWL A;  1EF1 A;  2FE9 A;  3U52 E;  3AMZ A;  1H38 A;  5DPW A;  1IBX B;  1ECW A;  1T0Q C;  1WGH A;  3KUC B;  3TAR A;  4URK A;  2NRX A;  5J0U A;  4PS8 A;  1IGD A;  3Q8R B;  2RLT A;  5A0L A;  1RZT A;  3NOB A;  4UAS A;  3AU4 A;  4ZRJ A;  3DWG C;  1MHX A;  2BR0 A;  4WAF A;  4B0E A;  2VAN A;  4DL2 A;  4LNN A;  4JWM A;  1RWS A;  4RQ6 A;  1V85 A;  4ECV A;  5EWG A;  4FBT A;  2IHM A;  1BPD A;  2HBL A;  1ZKH A;  2IPK D;  2QMT A;  2LEK A;  1K50 A;  4KZ0 A;  3ZJV A;  4O3S A;  9ICI A;  4BUG A;  5KTQ A;  2LFI A;  3C8Y A;  2FPM A;  5KG7 A;  2BPF A;  1HIW A;  2W9B B;  4I6N B;  4TV3 A;  2MAX A;  2HHT A;  2K22 A;  4ICU A;  2LUM A;  5DG9 A;  3T5L A;  2WP9 B;  1XSP A;  2YMM A;  2MBH A;  4YTM B;  4B95 A;  2WB1 F;  2GO7 A;  2C9W B;  3SAF A;  1ZW7 A;  5J2F A;  3V6C B;  2K4H A;  5F9L A;  4EOY A;  3KKA A;  3WKB A;  3PRE A;  5ALV A;  1TJE A;  2MEK A;  9ICW A;  3JVZ X;  3Q2A C;  2EAP A;  4M6W B;  5EWF A;  4FS2 A;  3NZU A;  4IC9 A;  5H8Y E;  2AGO A;  3A1Q B;  1MSW D;  3HK0 A;  5KL8 B;  1S5L U;  1F5S A;  5EE3 A;  2NO5 A;  8ICP A;  1YX6 B;  3VR8 B;  4OO1 J;  3JPO A;  3KW5 B;  2LGS A;  3AUL A;  3PR5 B;  3EHV A;  4FAD A;  2UWQ A;  3UQA A;  1SZP A;  2LBO A;  3T79 A;  2ZIV B;  3PW4 A;  2EEL A;  3RAX A;  2KJ6 A;  3DVG X;  3FIL A;  4DK5 A;  5KFI A;  3JSV A;  4USA A;  5ALM A;  3QC8 B;  4JE3 B;  5BYR A;  3RZF A;  1FPY A;  3QUC A;  3SR6 A;  4O3P A;  3BQT A;  5AI0 A;  4IKG A;  4II2 B;  4RQN A;  2ZUC A;  1MG4 A;  1VJK A;  3APF A;  4HKQ A;  2C28 A;  1WX8 A;  4B6W A;  2B21 A;  1E7P B;  4RZR A;  4MSQ B;  3I57 A;  2HDO A;  2HMX A;  4PZN A;  2MJD A;  3PY8 A;  2NRV A;  2UYZ B;  3C23 A;  8ICO A;  3BY4 B;  3ZVV A;  1PK3 A;  1V9J A;  4WJO A;  1PVR A;  4I2H A;  4O3R A;  3U2S C;  4MM3 B;  4DQP A;  5ALX A;  4O9M A;  4RNM A;  5J0Q A;  4DS5 A;  2Y5C A;  4F92 B;  4QAY A;  1T3Q A;  1GOZ A;  2G45 B;  3IM1 A;  4NQL B;  2AQ1 B;  4DL4 A;  1ZDX A;  1OTR B;  2BQQ A;  5IKC M;  5AEK B;  2KFK B;  2LI5 A;  5E6J A;  4F5N A;  4DO9 A;  2JU6 X;  2PMZ F;  1HEK A;  2KWU B;  3TAC B;  2HOI A;  3Q8B A;  4ZRI A;  5KFS A;  2AL3 A;  2BZF A;  2KLC A;  2CN1 A;  2PXI A;  4DHJ D;  2G4S A;  1S97 A;  1TK5 A;  4N6E B;  3H8W A;  3Q8M A;  3AE4 B;  1D9F A;  1L3T A;  3SD5 A;  4HK2 A;  4RCO A;  4S17 A;  3H40 A;  2KYW A;  2WXM A;  3TAQ A;  4KX5 A;  3OSN A;  2Y1J A;  4OCZ A;  3QEB Z;  5ALK A;  2BYE A;  3M1Y A;  4A3O A;  4LVS A;  1X9S A;  3PO5 A;  1I4X A;  2D3G A;  1C3T A;  2H88 B;  4F8R A;  1V38 A;  2ZCB A;  3DBR I;  4KVG B;  3H8J A;  4KDL B;  5J18 A;  1KN5 A;  1WX7 A;  4KKI A;  5HNK A;  3NVZ A;  2HDE A;  2HHQ A;  1JMS A;  2L8J A;  5CB1 A;  2KJ8 A;  2WXJ A;  5AIA A;  3N1Y C;  1UT8 A;  2W7O A;  3KHL A;  3PV8 A;  1OFF A;  1X9M A;  4Y2V A;  3AU2 A;  2KVZ A;  1BML C;  2BQU A;  1GNU A;  1EM7 A;  2Z0E B;  3LDA A;  4K81 A;  2R61 A;  3SV3 A;  4UB6 U;  8ICI A;  1SE9 A;  2I1K A;  4XYC A;  4ITK A;  1KJT A;  1K1S A;  3B0A A;  2L00 B;  1OQQ A;  4JWN A;  1S0N A;  4ZDV A;  4AYB C;  4ELT A;  1MA7 A;  5D3I B;  4WJQ A;  1TZ1 A;  1UH6 A;  5TR5 A;  3RNB C;  5JU5 A;  5IIN A;  5J8Y A;  4FHK A;  3NJT A;  1A76 A;  1YX5 B;  4MEY A;  1WY8 A;  4PHD A;  4ECQ A;  2ZIX B;  3N28 A;  4XA5 A;  3MR3 A;  1WMH A;  2KT7 A;  2PVG C;  2DGZ A;  2HW3 A;  1F2R I;  4NLN A;  4PZO A;  3M6Z A;  4M00 A;  4OVU A;  3TFS A;  4M0W B;  3WAM A;  4AJY B;  2WWZ A;  4ED7 A;  3T5J A;  3A9K A;  1L7P A;  2QHO A;  1N2X A;  1GJZ A;  1SXD A;  2V3P A;  1FEZ A;  2KIV A;  2VH1 A;  2JQR B;  3AE5 B;  2IGH A;  3MHZ A;  4QW9 A;  3VRA B;  1JN3 A;  3IG5 A;  2Y9U A;  5C23 A;  3JPP A;  2DYM A;  3ZQ4 A;  3AN1 A;  4WWM A;  2KNB A;  1A5R A;  2RPV A;  2FLP A;  2DHZ A;  4I6L B;  1EXN A;  1UHU A;  1PYW D;  2K6Q A;  2QB0 B;  2BGF A;  4KX3 A;  4KN4 A;  1YIW A;  4KLH A;  4NLZ A;  1MC8 A;  4M2Y A;  3Q3F A;  2N9P C;  4W9H A;  1H8C A;  2F2A B;  2AH5 A;  5GTH U;  2KAC A;  4NAM A;  5IO9 A;  4IDI A;  4EEY A;  2LZ6 A;  2BQR A;  2W43 A;  3WK6 A;  1YN5 A;  3N7S C;  2WDV B;  2GH1 A;  4I2D A;  5BMG A;  5JH5 C;  4WWP A;  1TY2 A;  2ZVN A;  3IT6 B;  4I2F A;  4M8M A;  4DFK A;  1L8O A;  4C80 A;  2GRI A;  1NDD A;  3APD A;  3V6E B;  4MDK E;  3RNA C;  3ZDE A;  3A9J B;  5KFG A;  3URY A;  1ZQK A;  3ONN A;  3H7S A;  4XZ4 A;  3AB5 A;  4RGT A;  4C7Z A;  5DG7 A;  3PX0 A;  3OLM D;  7ICH A;  4HJG E;  2ZW1 A;  3V60 A;  4EFO A;  2D11 A;  4O3N A;  4BGD A;  2DF4 B;  3F5E A;  1LQB A;  5D4B A;  2KWV B;  3MAB A;  1AAR A;  5T8I A;  4F4Z A;  1P1A A;  4Y2P A;  2LMC A;  1VLB A;  5AKY A;  4ECY A;  1TBE A;  4TUQ A;  1Z5S B;  4A20 A;  4NL9 C;  5DG8 A;  1MJD A;  3PTF C;  4BBN F;  4A3P A;  7ICI A;  2M56 B;  5FR6 A;  1DXS A;  1DGS A;  9ICB A;  2R2Q A;  1GO3 F;  3P4S B;  1TYG B;  5AKZ A;  3QE9 Y;  2FBW B;  5DQG A;  3H9D A;  2K8H A;  3RPF C;  2HBJ A;  3JPN A;  3AV8 A;  4PS3 A;  3I76 A;  3RH5 A;  4B9T A;  2Z0D B;  2NRZ A;  1KSP A;  3SEB A;  3U7D A;  2J42 A;  2ONQ A;  4IUM B;  1RQN A;  3SFE B;  3VDZ A;  7ICE A;  2WTF A;  2AX5 A;  3CRX A;  5F3X B;  3QWZ B;  3CSF A;  1TZO A;  1HUO A;  4KLD A;  4F7Z A;  4M9J A;  4GB9 A;  2YQE A;  1XCT L;  5KG1 A;  2JPH A;  4L23 A;  3HM3 A;  3VH4 B;  3RNG C;  2OYY A;  3Q69 A;  4S0R A;  1SV4 A;  3ICX A;  1UZX B;  1L3U A;  4NXZ A;  3C2M A;  5G55 A;  1BUI C;  2MSN A;  2AL6 A;  2O6V A;  1JX4 A;  4RQ3 A;  3QZ8 A;  1BNO A;  3CP8 A;  2BBC A;  3OSP A;  4MEM A;  4YR2 A;  3LJ3 A;  4W9J A;  3ZNZ B;  1M4V A;  3PSE B;  2NRT A;  1S3S G;  4WJ3 B;  2OH2 A;  3RRH A;  1VZ8 A;  3A4S C;  4UB8 U;  4NAW A;  1RYR A;  1IIP A;  2MX2 A;  1FNV A;  2MBB B;  1RYJ A;  3ZRC A;  4BKS A;  1TIF A;  2DX5 B;  1X9X A;  3Q8Q B;  1E8Y A;  5J29 A;  4EYI B;  1HZ5 A;  4XQ8 A;  5KFO A;  3FYH A;  2NBU A;  2MCN B;  3PRM B;  4QZG A;  3E2E A;  2LPE A;  3DVG Y;  5JUM A;  4C8K A;  5LXH A;  5J0W A;  5ALD A;  5AK3 A;  1WCN A;  1I4H A;  2WU2 B;  1T0Y A;  3IAS 1;  4JWU C;  4NM2 A;  2XID A;  3NVW A;  3BJY A;  2QEJ C;  4OZA A;  2C7H A;  3KHR A;  4KZC A;  5I4D A;  2BYF A;  4QJF B;  2DZJ A;  4IM2 A;  4CF3 A;  3AEA B;  2JYT A;  1B4F A;  7ICP A;  2O2V A;  2DPJ A;  5L95 C;  2KIC A;  4C8O A;  2FCS A;  5KFC A;  3OG5 A;  3F5A A;  4DSF A;  3V7L A;  2BPG A;  4L1B A;  2G07 A;  4EEW A;  1Z4O A;  1GPX A;  3GQC A;  4FBJ B;  2NYV A;  3JSV B;  1GC6 A;  9ICG A;  4REZ A;  4BKT A;  3NVV A;  4TQR A;  2WB1 C;  1COK A;  5KT7 A;  4YQW A;  3B0Y A;  2JGA A;  4I28 A;  1JI7 A;  1L4D B;  1DRG A;  2R8K A;  5AKX A;  2WF9 A;  4MJS A;  1KFD A;  4O3O A;  2PI4 A;  1ZRM A;  3ETR A;  4BWJ A;  4DDG D;  1DOY A;  1S9F A;  3VHT C;  3W1Y A;  4UW9 A;  3TKA A;  5ALY A;  5DKW A;  1C78 A;  1WJ6 A;  5ALE A;  3RJF A;  5CHF A;  1ZQG A;  1ZQA A;  2R8H A;  2BVC A;  1WYW B;  3UPQ A;  3Q8E A;  1URJ A;  4TUS A;  3U30 A;  3GP7 A;  7ICS A;  2ON8 A;  2R2O A;  1Y88 A;  2DEN B;  1LM8 B;  1T4G A;  4C4T A;  4PJ0 U;  2L7R A;  1Q0W B;  3GE8 C;  2FLL A;  3PVX A;  2WF7 A;  3RH6 A;  2RR9 A;  2KC1 A;  3H1U A;  2AQ3 B;  4C4R A;  2YB1 A;  4Z6F A;  1YNT E;  4KLM A;  2AU0 A;  4CCH A;  1KLG D;  2INN E;  3AEG B;  5KG6 A;  4RNO A;  2V4R A;  3K4G A;  2OOB B;  4RQ8 A;  8ICL A;  3BQ7 A;  1UWX A;  3AEB B;  2OXO A;  4N9F 4;  2JRI B;  1M94 A;  4KLO A;  3QEA Z;  2IO0 B;  3VCB A;  1U45 A;  3RTV A;  1T7P A;  2EAN A;  2IYD B;  3TSS A;  2M17 A;  3T3O A;  1JXL A;  3DBS A;  2JUO A;  1ZRN A;  4P0Q A;  3AE6 B;  2D5G A;  2Y5P A;  3MTN B;  4ZRP A;  3Q3M C;  4G0N B;  5B66 U;  3M3J A;  2W8K A;  2K4E A;  3IHQ B;  2ISO A;  1IM4 A;  1CJE A;  3PZ8 A;  2PMZ C;  2W55 A;  5DGA A;  3I1Y A;  1NKB A;  2WDT B;  3GV7 B;  3CNH A;  2J7Q B;  2M0N A;  1K51 A;  1TS4 A;  2LGI A;  3DVN U;  5ALN A;  3ED5 A;  5J0T A;  4HRS A;  2J53 A;  3B1L X;  1SJE D;  5JZE B;  2C2E A;  1FXA A;  1WJU A;  3BQ1 A;  3O0F A;  4J9Q A;  1L3V A;  3DHI C;  2PKE A;  3QU2 A;  2G1E A;  4LDT D;  4IQW A;  2W8L A;  2K8B A;  1F9J A;  4UAW A;  2XCP A;  3LYS A;  2N9K A;  4XDD A;  3B0X A;  4C8L A;  3UXO A;  3A33 B;  1D4B A;  1F52 A;  4B9L A;  1V86 A;  5LLI A;  9ICT A;  8ICG A;  4ANU A;  1WXM A;  4ANX A;  4GOC A;  4UBC A;  1WMH B;  4DHJ B;  2KWD A;  3MBY A;  2KDB A;  1ZUD 2;  2JZB A;  1O08 A;  2ZCC A;  1UCV A;  4R63 A;  3HUI A;  1D5M C;  3L13 A;  2JRH A;  1X42 A;  4LTU A;  2OM6 A;  3A9K B;  1C79 A;  3GB1 A;  3WK4 A;  1Y56 A;  2PFN A;  3AE9 B;  1TGZ B;  1WUD A;  1TY0 A;  2K5P A;  9ICM A;  5KT6 A;  1NJY A;  2KN4 A;  5DPR A;  3PR4 A;  3KYD D;  1E10 A;  2LHD A;  4B9K A;  1WJN A;  3ZGZ A;  2DFL A;  2INP E;  1KKX A;  3GE3 C;  4DWF A;  3WAN A;  2N9X A;  3WK7 A;  4XE0 A;  1YQ3 B;  2M8S A;  4Q8F A;  4G50 A;  5AUK A;  4R8U A;  1X40 A;  4J3O D;  2JWZ A;  4CQN A;  4KGR A;  3U4E G;  2ASL A;  4DOC A;  4KLL A;  2K9X A;  1S0M A;  3ZD9 A;  5CP2 A;  4UB1 A;  2AGP A;  3JPQ A;  3TQ1 A;  1ZQ1 C;  1F2R C;  2JR5 A;  4DQO C;  1J0G A;  4F4K A;  1L7M A;  3HM6 X;  4HPP A;  2D3D A;  4MFF A;  8ICB A;  3ZLZ A;  2FDR A;  2HVI A;  4K4I A;  2HI0 A;  3UMC A;  4GXI A;  2PE6 B;  4EBD A;  3TAN A;  2CU3 A;  3RCZ A;  2WFA A;  2JX5 A;  2NBW B;  3DV9 A;  2QJL A;  2RPQ A;  2LGD A;  3KD3 A;  4B6J A;  5DLG A;  1DOI A;  1E8W A;  1ZXH A;  4P4M A;  4TUP A;  2V4L A;  3FAH A;  4OZC A;  1ZQS A;  2K1F A;  4A9A A;  4RGN A;  1SKS A;  4GIB A;  2FMS A;  3AE3 B;  2Y5B B;  4IS7 A;  2Y9T A;  4P1B C;  3V62 A;  1ENF A;  2MJ3 A;  4UAR A;  3V3X A;  3QX1 A;  2MBE A;  3W2D A;  4NJ7 A;  2W11 A;  2FI1 A;  2JEI A;  1RFK A;  1BPY A;  3RJH A;  2MBO A;  5J0S A;  4KGT A;  1C77 A;  2LXC A;  5CHW A;  1CZP A;  2H3F A;  1UUP A;  4US8 A;  1ZGU B;  2H3V A;  4J9S A;  3NG0 A;  3RJK A;  4Z6E A;  3U26 A;  2YY6 A;  2F8K A;  5FP0 A;  3BS7 A;  2KOX A;  3L08 A;  7ICJ A;  1C9F A;  3ZRF A;  1XXG A;  2HHS A;  1N5X A;  3KZX A;  2AQ0 A;  1DK2 A;  4N59 A;  1UF0 A;  1D6E C;  1LB2 B;  3L3F X;  1MQ3 A;  4BKG A;  2WLB A;  2HHX A;  3GV5 B;  2KVC A;  4DSK A;  2JHD A;  2A5U A;  2PW9 A;  3RMK C;  1L0Y B;  2DKZ A;  4IWP A;  1QQ6 A;  3AE1 B;  1L7O A;  2YTU A;  4RMA A;  4RQ7 A;  3GIL A;  4M0A A;  1F1H A;  3DHH C;  1TS3 A;  1R4M B;  4G3I A;  2QIE B;  1JWU D;  2XIC A;  2YMP A;  1NOM A;  3BII D;  1FNW A;  5L1I A;  3HPO A;  4IQV A;  1FXI A;  4H2A A;  4J9P A;  4O5C A;  7ICM A;  3HRD D;  4FBU A;  2A1J A;  3ZTC A;  3AE2 B;  4BBN C;  5HMM A;  7ICQ A;  2KN5 A;  3QHT A;  4F5O A;  1KRH A;  3UGB B;  4GC7 A;  3F2D A;  4BVU C;  2EZZ A;  1RAX A;  2EAM A;  4ZHP A;  5BOM A;  4AS1 A;  1D5X C;  2O6V B;  2ASD A;  4B9S A;  1D3Z A;  4PYZ A;  2D8C A;  2JRZ A;  2D3C A;  2WF5 A;  5CA7 A;  3MFI A;  1WM3 A;  1WSP A;  2W7P A;  1Q5W B;  3CMM B;  4KLF A;  1QQ7 A;  4O3Q A;  4LZG A;  1QLN A;  4NQK E;  4EE2 A;  1WI0 A;  2ATL A;  3NZ3 A;  3EFU A;  2XO7 A;  1X2I A;  3IT4 B;  2KMD A;  4NAW B;  3RJJ A;  5L1K A;  8ICF A;  2VJ5 A;  1TS5 A;  2REX A;  3VR9 B;  2B76 B;  4QZC A;  4XDC A;  4DSI A;  4PL2 A;  3VC8 A;  3H8H A;  1HXY D;  1WGY A;  2GOW A;  2N9L A;  5ALT A;  2K0P A;  1WR1 A;  3RJI A;  3IP4 B;  2WXH A;  3VQI A;  3TAD A;  2BS3 B;  3RNF C;  5C5J A;  1E5W A;  4HCN B;  2MW5 A;  2SEB D;  5CRX A;  5HHH A;  2MUT A;  2L3Z A;  4KMU A;  4Y2J A;  4R65 A;  5AK4 A;  1QT9 A;  4A8X C;  3S6J A;  2KFN A;  2M0A A;  2O2V B;  4A6Q A;  2JV3 A;  1V5O A;  2JT4 B;  4O1N A;  5ALL A;  4ACO A;  2BW2 A;  7ICG A;  4ELV A;  2BS4 B;  1U47 A;  9ICO A;  2MA1 A;  3N9Y C;  2EZY A;  2LGX A;  4MGZ E;  3QX7 A;  2KQ7 A;  2LM1 A;  2ESE A;  4C8M A;  1CEZ A;  5AZH A;  3V7J A;  3IRU A;  1WZ0 A;  2LYH A;  7ICK A;  3IDW A;  5DGB A;  5J2E A;  3VUY A;  4KLG A;  2KFJ A;  4UAV A;  1WH3 A;  3G6V A;  1KH0 A;  2HTM E;  3SDL C;  4MJS B;  3WAL A;  4Y2S A;  1NK0 A;  1U9L A;  3W1S C;  1NK4 A;  3NAS A;  1TFR A;  3NTU A;  4BJQ A;  5DLF A;  2L32 A;  2WYQ A;  4ACF A;  2OJR A;  5KAF U;  4DL5 A;  5J2R A;  4KV2 A;  9ICF A;  2F76 X;  4OJO A;  4Y2X A;  3Q8L A;  2H3I A;  2DWQ A;  5KFR A;  3HX0 A;  3H0R B;  1Z00 B;  4KLS A;  1S8O A;  4BX9 C;  1HA5 A;  3KTQ A;  1K5O A;  2WHI A;  1V1P B;  4IQU A;  4B9N A;  3CF6 E;  3TEZ A;  1V9P A;  1U4B A;  4HKZ E;  1R4N B;  4IRD A;  3PX4 A;  5DPT A;  3ZYY X;  2VJ4 A;  1I4G A;  1ZQR A;  3ENE A;  1IUE A;  1E6E B;  5KFA A;  4DLE A;  3PZD A;  4X57 B;  4UDU C;  2VA3 A;  2W04 A;  1HEZ E;  2MSE D;  2PIA A;  3C2K A;  2ZTD A;  4WJP A;  3RZW C;  4FE3 A;  1EU3 A;  3DBL B;  4TQ1 A;  2QAR A;  4HRO A;  2XK5 A;  1KFT A;  4PS7 A;  1I4R A;  3NHE B;  3OJ3 A;  1K52 A;  3T8M A;  2VZK D;  1SXE A;  5AKL A;  2M9N A;  4J9L A;  4CRX A;  5HR6 A;  7ICN A;  1H4R A;  3IXS A;  4MH0 E;  3M9M B;  2INC C;  2WXK A;  1YZ7 A;  2OHF A;  1TAU A;  1YN3 A;  2AXT U;  1ZQH A;  3RJE A;  1J7B A;  1EWC A;  2KKP A;  4QWC A;  3SV4 A;  1K53 A;  1MN8 A;  4EEL A;  2VIX A;  4P4P A;  5KFM A;  4ECT A;  3PRP B;  4TMA B;  4I2I A;  3OHA A;  4P0Q B;  1GAQ B;  3K75 D;  2W9C A;  4C4S A;  2DZM A;  1S77 D;  4R64 A;  1DK3 A;  3RD2 A;  3A0H U;  1ET9 A;  1WXQ A;  1EU4 A;  3EC8 A;  1COO A;  2G9H D;  4ICA A;  1F77 A;  3ISD A;  3LWL A;  1V49 A;  4FS1 A;  2RDH A;  4KLE A;  3WK8 A;  4B9U A;  3ZJT A;  3PGE A;  4RF1 A;  4ANV A;  4PHA A;  2NVU I;  2QKQ A;  2I1J A;  5AIC A;  5ALU A;  1FCL A;  5D49 A;  1DYQ A;  4DF8 A;  4OJ5 A;  4BXO A;  1XEE A;  3PSP A;  4QZD A;  2HOQ A;  2Z8L A;  4RF0 A;  1WWU A;  1O03 A;  2K8B B;  2FAZ A;  3T9L A;  3BQ2 A;  3NZS A;  4M8N A;  3MFH A;  4ECS A;  4RQM A;  1FFU A;  1SJH D;  3MDA A;  4RQ4 A;  3EGR A;  5L9X A;  2H89 B;  5KFX A;  3KHH A;  1Z3E B;  1U49 A;  1D8Y A;  1BNP A;  3APC A;  3QIJ A;  5IA7 A;  3B2G A;  3UQ2 A;  4DDI D;  1KLN A;  5HR7 A;  4AJW A;  3AEF B;  2JZB B;  4QIW F;  3QJZ A;  4NLK A;  2FNJ B;  5LXI B;  3B2F A;  4CDG A;  4F71 A;  2BPC A;  3WKA A;  4GSW A;  3LVW A;  4NJC A;  4TSS A;  5IIJ A;  1QSY A;  2HHV A;  3WCQ A;  3ZDD A;  2CR5 A;  2YEP F;  3LXF A;  4O5E A;  4HCP B;  5TZV A;  3KWV A;  2KZM A;  4ED3 A;  2LM4 A;  3M6K A;  3SU8 X;  2KEY A;  4RGO S;  2OCE A;  2IMW P;  3V6K A;  4W9E A;  4W9L A;  2FMQ A;  2CS4 A;  3M62 B;  4DXA B;  1ZD4 A;  2WXR A;  4K1R B;  2EKI A;  3V05 A;  5IIO A;  3JYU A;  1ZQZ A;  4UAT A;  4R8U B;  5KT2 A;  2WDQ B;  2PJH A;  2NO4 A;  3EW9 A;  3VTU A;  3SD7 A;  9ICK A;  3Q6B A;  3PS6 A;  4RH6 A;  1DOQ A;  4W9I A;  4CGZ A;  1ZQD A;  2ZNV B;  4OVZ A;  4FHJ A;  2KX3 A;  2V9H A;  1Q3V A;  2KN7 A;  5IIL A;  1SL0 A;  2LMR A;  1RG6 A;  3P2B A;  2YVC A;  4YG2 A;  2C5L C;  1FM0 D;  2DLB A;  1OEY J;  1K1Q A;  2QIL A;  1G6J A;  4IR1 A;  3PW7 A;  4HYK A;  2C2D A;  1RXW A;  1A6S A;  4ZH4 A;  4RGM A;  9ICX A;  4E71 A;  2DKX A;  3EUB 2;  3N97 B;  1VRA B;  3HJE A;  5DB9 A;  4QZA A;  3M63 B;  3VUX A;  3IV6 A;  4LJP B;  5KFP A; 
#chains in the Genus database with same CATH homology
 4WQM A;  3IAS 1;  1I4H A;  1MHH E;  2WU2 B;  3KLS X;  1A70 A;  4JWU C;  1C4A A;  3NVW A;  1YQ4 B;  2QEJ C;  1SE3 A;  3R2T A;  4OZA A;  4P6V F;  4PT5 A;  3AEE B;  5I4D A;  3VRB B;  1SSN A;  3OWE B;  4R3D A;  2M19 A;  5G5G A;  2WXP A;  1N5W A;  3AEA B;  2JYT A;  5BYS A;  4WUR A;  5FKA C;  1KTK A;  4L1B A;  3T3N A;  2WS3 B;  1T6B X;  4GDL B;  1GPX A;  1SE4 A;  4ZOH C;  4REZ A;  3NVV A;  1QF6 A;  1FEH A;  3Q8C A;  2OED A;  2NTS A;  1SXT A;  1L4D B;  3AE8 B;  3NUH B;  1TS2 A;  5FR3 A;  5MPO A;  3J9C A;  4WH4 A;  1SB3 C;  3ETR A;  5HFY A;  3HVZ A;  2FE8 A;  2JWU A;  3TUO A;  1DOY A;  5TSS A;  4M0W A;  1CQV A;  2KMM A;  2BB6 A;  2DBY A;  1N62 A;  2IDY A;  1C78 A;  1JW9 D;  1JWS D;  4KKJ A;  1FIQ A;  1ACC A;  3RFZ B;  3Q8E A;  4RFB A;  3GP7 A;  2ON8 A;  2PMV A;  3NS1 A;  5D7G A;  1MI0 A;  1T5X D;  1HZ6 A;  1CK1 A;  1XLQ A;  1KFY B;  2N0S B;  5EE0 A;  1PGA A;  1JRP A;  1FNU A;  2IJ0 A;  2AQ3 B;  2ICI A;  1YNT E;  3AEG B;  1KLG D;  2INN E;  2W82 A;  2J4X A;  2WXQ A;  2BT6 A;  1UWX A;  4MAC A;  3AEB B;  2SAK A;  1GB1 A;  1TKY A;  1TKG A;  1N63 A;  4OZB A;  2V0G A;  5C3J B;  5BMI A;  1YJI A;  1QOA A;  4MH8 A;  1N60 A;  1DGJ A;  5HG2 A;  1L0X B;  3E56 A;  3TSS A;  3T3O A;  1YN4 A;  2BYT A;  1L6V A;  3AE6 B;  2D5G A;  3W5U B;  2Y5P A;  3R2I A;  4YTN B;  4ZRP A;  2LJI A;  4YXD B;  2PLP A;  3AEC B;  3P42 A;  1CJE A;  5FK9 C;  1SBB B;  3PZ8 A;  2W55 A;  5H92 C;  3AM9 A;  5JXV A;  1I4Q A;  1K51 A;  1TS4 A;  2LGI A;  3W9C B;  4HRS A;  4XWW A;  2IGD A;  1EWY C;  2J53 A;  1SJE D;  1E9M A;  1FXA A;  2DYO A;  3Q8A A;  1JRO A;  1AWD A;  3PZ7 A;  4B0M A;  2G1E A;  4DXG A;  1JML A;  3UI3 A;  2MJE A;  2BS2 B;  5EE1 A;  1UNS A;  4ZHO A;  4ARC A;  2N9K A;  4XDD A;  4KGS A;  1SF0 A;  1D4B A;  1XCQ L;  3NRZ A;  1AN8 A;  1B1Z A;  1VZ7 A;  2NMQ A;  1NI3 A;  3BWU D;  4KX6 B;  1C4P A;  2WXG A;  2LHE A;  3P1M A;  2KWD A;  1ZUD 2;  1V8C A;  3TEY A;  3HUI A;  2WXI A;  3P4P B;  1D5M C;  3CIR B;  1V97 A;  4LTU A;  3AED B;  1C79 A;  3GB1 A;  1Y56 A;  1ZOY B;  1FRD A;  3AE9 B;  3KWL A;  1TY0 A;  3U52 E;  2K5P A;  3AMZ A;  5LNK 1;  2KN4 A;  1IBX B;  1E10 A;  1YJJ A;  5G5H A;  2LHD A;  1IGD A;  1E0Z A;  1QQR A;  5EE9 A;  2INP E;  3ZGZ A;  1MPE A;  1AYF A;  3DWG C;  1MHX A;  2W54 A;  1JCK B;  4RNA A;  1YQ3 B;  4XE0 A;  4WAF A;  4B0E A;  5AUK A;  1XF5 L;  3BK1 A;  1RWS A;  1L4Z B;  4J3O D;  4CQN A;  1L5P A;  2AQ2 B;  4KGR A;  3U4E G;  2QMT A;  2IPK D;  2LEK A;  1K50 A;  3IAM 1;  1PFD A;  2K9X A;  3ZJV A;  1XLO A;  1VR9 A;  1NEK B;  1NEN B;  2LFI A;  1WYG A;  3C8Y A;  1F2R C;  3HVD A;  1QIL A;  4DQO C;  1JAL A;  2K3U A;  4C7Y A;  2RMM A;  3MC0 B;  4DXF A;  2K22 A;  1XLN A;  2LUM A;  3FC4 A;  2Q5W D;  2WP9 B;  4YTM B;  1VZ6 A;  2CU3 A;  2QSD A;  1PGX A;  4YWG G;  2JX5 A;  3BVM A;  4P16 A;  2QJL A;  4A55 A;  1FD6 A;  3BZD B;  1ZXH A;  1DOI A;  3FAH A;  4OZC A;  1ZXI A;  3B9J A;  1TJE A;  2MEK A;  4A9A A;  3I9V 1;  2RDG A;  4RGN A;  3BYT B;  5H8Y E;  3AE3 B;  5AUI A;  1OQR A;  1JWM D;  5EE3 A;  1ENF A;  1P7F A;  2CJN A;  1ESF A;  1ZPS A;  2MJ3 A;  3V3X A;  1V1P A;  3VR8 B;  5C2T B;  2ACZ B;  3W2D A;  1RFK A;  1FMA D;  4ARI A;  1ROE A;  4KGT A;  2EEL A;  1C77 A;  3L4P A;  1CZP A;  1UUP A;  2WXN A;  3FIL A;  4US8 A;  4USA A;  1QLB B;  1I7H A;  1NYQ A;  4JE3 B;  5BYR A;  2JYE A;  3SR6 A;  4IKG A;  5GXG B;  4L2Y A;  1C9F A;  1VJK A;  1XXG A;  4HKQ A;  1N5X A;  1C4C A;  2JXT A;  4N59 A;  1XLP A;  2WXO A;  1D6E C;  1E7P B;  1UWM A;  3I57 A;  2WLB A;  2MJD A;  2PW9 A;  1L0Y B;  3AE1 B;  3KQ4 A;  2WU5 B;  1SIJ A;  1TS3 A;  4MM3 B;  4N58 A;  1JWA D;  3U2S C;  2QIE B;  2V3N A;  1JWU D;  2I38 A;  2Y5C A;  2WXL A;  3BII D;  1AW7 A;  2WNM A;  1FNW A;  1T3Q A;  1GOZ A;  1ZP0 B;  1JQ4 A;  2AQ1 B;  2E3T A;  1ZDX A;  1FXI A;  4XWT A;  4H2A A;  5E6J A;  4JWS C;  2JU6 X;  3HRD D;  4LK0 M;  3AE2 B;  3GS2 A;  1KRH A;  3SFD B;  3Q8B A;  3MFG A;  4ZHP A;  4AS1 A;  1D5X C;  2WQY B;  3NVY A;  1FCC C;  2MH7 A;  1PUT A;  4N6E B;  3LB8 C;  1NVI D;  1WSP A;  3AE4 B;  4ZYS A;  1L6U A;  1QOF A;  3AH7 A;  4EE2 A;  3NZ3 A;  2GB1 A;  4JPS A;  1D5Z C;  4RCO A;  3IT4 B;  1R7S A;  2WXM A;  4NAW B;  4AQ7 A;  2V4I B;  1TS5 A;  1I4X A;  3VR9 B;  2B76 B;  4HEA 1;  2H88 B;  4XDC A;  3H8H A;  1HXY D;  1WRI A;  2N9L A;  2K0P A;  4KKI A;  2HDE A;  3NVZ A;  2X38 A;  2KAJ A;  2WXJ A;  4LLG M;  1J7A A;  1ZE3 D;  2WXH A;  3VQI A;  2BS3 B;  2N7J A;  4OHJ A;  1OFF A;  3E9S A;  2SEB D;  1BML C;  1F0Z A;  2XN9 C;  1EM7 A;  1QT9 A;  4A8X C;  2R61 A;  4A6Q A;  2L83 A;  2M0A A;  4O1N A;  2BW2 A;  4ITK A;  2BS4 B;  4FXC A;  3N9Y C;  1OQQ A;  3PO0 A;  5D3I B;  1LO5 D;  2BTE A;  3W5V B;  2PKO A;  2W3R A;  1GB4 A;  3AE7 B;  1L0V B;  1KH0 A;  2HTM E;  1PGB A;  2PVG C;  1F2R I;  1V1O A;  2L32 A;  1FO4 A;  2XNA C;  2DWQ A;  3BVZ A;  4US9 A;  2V3P A;  1HA5 A;  1P7E A;  1WWT A;  2JQR B;  1V1P B;  3TEZ A;  1IBX A;  3AE5 B;  2IGH A;  3MHZ A;  4HKZ E;  3VRA B;  2TSS A;  2I2Y A;  3W1S A;  2L1A A;  2DYM A;  3ZQ4 A;  1KLU D;  3AN1 A;  1I4G A;  3ZYY X;  3FIL B;  1IUE A;  1C76 A;  1E6E B;  4WWM A;  2RPV A;  1HEZ E;  4UDU C;  2PIA A;  1N61 A;  4MT5 A;  3Q8F A;  1EU3 A;  1PYW D;  2W3S A;  4TQ1 A;  4HRO A;  1IGC A;  3DWM A;  1I4R A;  1FFV A;  1K52 A;  2VZK D;  1QOG A;  3ZJU A;  3IXS A;  3O13 A;  2WXK A;  2OHF A;  1STE A;  1YN3 A;  4NAM A;  2KAC A;  4YSY B;  1J7B A;  4JX1 C;  1EWC A;  4IDI A;  3TEX A;  1K53 A;  1YN5 A;  2WDV B;  4TMA B;  1GAQ B;  4Q2J A;  5BMG A;  1FRR A;  1TY2 A;  2CJO A;  1Q10 A;  3IT6 B;  2FUG 1;  1VDV A;  1ET9 A;  1WXQ A;  4C80 A;  2GRI A;  1EU4 A;  4GDK B;  2G9H D;  2VZK B;  1F77 A;  3URY A;  4C56 C;  2RDH A;  3ZJT A;  3AB5 A;  4RF1 A;  4RGT A;  4C7Z A;  3R8B A;  4OW0 A;  4HJG E;  1FCL A;  2ZW1 A;  3ABV B;  1DYQ A;  5HHD G;  2WDR B;  2PTL A;  1XEE A;  2BB5 A;  2Z8L A;  3BK2 A;  4RF0 A;  5T8I A;  4YTP B;  1SEB D;  2LMC A;  1VLB A;  4NZL B;  1FFU A;  1I4P A;  3BVG A;  2IGG A;  2H89 B;  2NTT A;  3EGR A;  2M56 B;  2PVO D;  3P4S B;  2E6X A;  2Y3A A;  1TYG B;  1QKZ A;  3B2G A;  2FBW B;  3RPF C;  3AV8 A;  3AEF B;  3EA6 A;  4YSX B;  4YT0 B;  1J7C A;  3B2F A;  1ZDV A;  3SEB A;  4GLS C;  4A90 A;  2J42 A;  2ONQ A;  2L52 A;  4NJC A;  4TSS A;  4TQ0 A;  3SFE B;  3WCQ A;  1XO3 A;  2YEP F;  2GI9 A;  3LXF A;  2AX5 A;  4WIP A;  2KDM A;  2YEP B;  3KWV A;  3U7Z A;  1KF6 B;  1DOX A;  1TZO A;  3LYY A;  1JWB D;  2J52 A;  4RGO S;  1B9R A;  3MJ5 A;  2WXR A;  2EKI A;  1XCT L;  3V05 A;  4IOI E;  4L23 A;  3P63 A;  1WGK A;  1SE2 A;  3P4R B;  3Q69 A;  2WDQ B;  1MVK A;  2WXF A;  1RM6 C;  3BYY B;  1NYR A;  4RH6 A;  1QOB A;  1BUI C;  1YMH E;  2JZP A;  4OVZ A;  2BBC A;  1UGJ A;  1BXT A;  1HQR D;  5BYQ A;  3TEW A;  3MP9 A;  3CWI A;  5HI1 A;  1M4V A;  4YSZ B;  4ZRQ A;  1FM0 D;  1VZ8 A;  2DLB A;  2JSV X;  2QIL A;  1PDX A;  1ET6 A;  2ZW0 A;  3P4Q B;  4RGM A;  1FNV A;  1RYJ A;  1TKE A;  5BMH A;  3EUB 2;  1VRA B;  1HZ5 A;  5D3D A;  1SJH D;  4D2K A;  2KQ4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...