1FIQA

Crystal structure of xanthine oxidase from bovine milk
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords XANTHINE OXIDASE
publication title Crystal structures of bovine milk xanthine dehydrogenase and xanthine oxidase: structure-based mechanism of conversion.
pubmed doi rcsb
total genus 39
structure length 164
sequence length 164
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1fiqA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fiqA01
3W5VB 3AE9B 1CZPA 1EWYC 2QJLA 1RYJA 3B2GA 1ROEA 2PKOA 3SFDB 1OFFA 1JALA 3FC4A 1FFVA 1JRPA 1J7BA 1XLNA 3AE7B 5EE1A 3AE6B 2WU2B 1FMAD 1KFYB 3VRBB 1V97A 2JX5A 4IDIA 4ZHPA 1ZUD2 3AB5A 4USAA 3LXFA 1QF6A 3L4PA 2N0SB 1KF6B 2WDVB 2WU5B 3AEAB 1FO4A 3AE4B 4LTUA 1XLPA 4JWUC 4N58A 3NRZA 1RM6C 2K5PA 2BS2B 1PUTA 3NVWA 4N59A 2Y5CA 3AEDB 4FXCA 4C7ZA 1QOBA 1QT9A 2OHFA 1VDVA 2MJDA 1QLBB 2K9XA 1PFDA 1FFUA 2M56B 3KWLA 3PO0A 4YT0B 4YSXB 4ZHOA 4US9A 1AYFA 1L5PA 1YJIA 2G1EA 1YQ3B 2WDRB 1WGKA 1JWBD 5H92C 3VR8B 2K22A 3B2FA 1J7CA 1E6EB 1E7PB 5C3JB 4US8A 5G5GA 3AV8A 2WS3B 1VLBA 3P4SB 4JX1C 1FRRA 1YJJA 5AUIA 2BS3B 5MPOA 1NI3A 3AH7A 1N60A 3P1MA 2Q5WD 2CU3A 1DGJA 3ZYYX 1N63A 3AEGB 2PVOD 2WDQB 1SIJA 1FXIA 5H8YE 4WQMA 3HRDD 1E0ZA 3W5UB 3DWGC 1DOYA 3EUB2 1JQ4A 1NVID 2PIAA 1AWDA 1TKEA 3P4RB 2CJOA 1E10A 2LEKA 1OQRA 2W3SA 5EE3A 1CJEA 2L83A 1WRIA 3NS1A 1NENB 4N6EB 2WP9B 1DOXA 1FM0D 1FXAA 1RFKA 2DWQA 2WLBA 3P4PB 2W55A 4HROA 1SF0A 4KX6B 3NVVA 4HRSA 2B76B 2BS4B 4WWMA 2WQYB 3B9JA 4YTNB 1KRHA 3P63A 1GPXA 1T3QA 1ZXIA 1DOIA 3AEBB 3W9CB 1TKYA 2AX5A 3AE1B 1J7AA 2KMMA 2L52A 4YTPB 1E9MA 3ETRA 1L6UA 2QIEB 3ABVB 4JWSC 1N61A 3FAHA 2M19A 3AE2B 4P6VF 2MJEA 2MH7A 4YSZB 1WYGA 4A9AA 1JWAD 3AECB 3VRAB 3NVZA 3SFEB 3HUIA 1ZP0B 1SB3C 4YXDB 1GAQB 1WXQA 4YTMB 3CWIA 3DWMA 1NYRA 2PVGC 1OQQA 3AE8B 1N5XA 2HTME 1N62A 1NYQA 1TYGB 1XLQA 3AE5B 4ITKA 3VR9B 1QOAA 1TJEA 1XO3A 5EE9A 3AN1A 1A70A 1JROA 5AUKA 2EKIA 1JW9D 2DBYA 1VJKA 1FRDA 4ZOHC 3AEEB 1NEKB 1UWMA 1L0VB 3CIRB 4C80A 3NVYA 1WWTA 2ACZB 2W3RA 2E3TA 2BT6A 3AM9A 1TKGA 3AE3B 3WCQA 4C7YA 3RPFC 3BIID 1I7HA 1B9RA 1L6VA 3SR6A 1PDXA 1F0ZA 5GXGB 1N5WA 1R7SA 5G5HA 1RWSA 1IUEA 1FIQA 1ZOYB 2H88B 1XLOA 2H89B 2KAJA 2MJ3A 4YSYB 3P4QB 3LB8C 1V8CA 1QOFA 2FBWB 1YQ4B 2W54A 1QOGA 2CJNA 3HVZA 5EE0A 2JQRB 5C2TB 3AMZA 3AEFB
chains in the Genus database with same CATH superfamily
1H8CA 4K3BA 2AGOA 3RFZB 3N1ZC 4B95A 1FFVA 1E7UA 4NJ8A 2KIWA 2ZW1A 3RF9A 3VHTC 4ECYA 5KFMA 3V05A 4DXGA 5IIKA 4KZCA 1YNTE 1ZQFA 1KSPA 3LXFA 1ZQKA 4FS1A 4W9GA 1FO4A 4YMNA 4EBDA 8ICQA 3Q3OC 2JY6A 4N58A 1L8LA 5TISU 3ETLA 2ZCCA 2K4EA 4NNJB 4YMMA 4U7CA 4ECTA 1C1YB 2PE9A 4WJNA 1UQVA 3W1SC 2HOQA 4BXOA 4J3OD 3L10B 1AYFA 3HWTA 2K39A 2MQJA 1T3NA 4GXIA 2WDRB 2NBWB 1WGKA 3OSNA 3Q8EA 4G0NB 1C4AA 1FNUA 3CW2C 4P7IA 1I4GA 4BOSC 4LDTD 3NG0A 4WWNA 2WS3B 4YCXA 1SIFA 3LYSA 3F5AA 3TAPA 1KDHA 2OJWA 3RB4A 2PPHA 4GB9A 3W5UB 1SE3A 3B1LX 3EYZA 1NK8A 1NVID 2LMRA 2FAZA 1TKEA 5AKHA 3V6EB 2DKZA 2Y3AA 2OJRA 2E8NA 3VC8A 3PNCA 3AQEA 2MLBA 2WFAA 2BCSA 5C23A 9ICWA 3EHVA 2QDFA 4LZDA 1WH3A 4YTNB 4II3B 1KLVA 3ZLZA 4A3OA 3ECIA 4DS4A 4PT5A 2BQQA 5G2NA 5JZEB 2KK8A 2DL0A 5FR3A 4YQWA 5IP4D 3FAHA 5AKEA 3EA6A 4AUQC 3GILA 5CJ7A 1HUZA 1Z3EB 9ICCA 9ICGA 3R2TA 2ZW0A 5KFRA 8ICEA 3MR6A 3DWMA 2WAQC 4OO1J 2DF4B 3PVXA 1RQLA 1UT8A 3VXWA 4G11A 1KL9A 3ZI4A 4BAXA 4MFCA 4GGQA 2RLTA 1WJNA 2WXHA 4MFFA 1VJKA 3D2NA 2MAXA 4D2KA 3AEEB 3SI8A 2QB0B 1SXDA 4JV2A 3D2SA 2DHZA 4II2B 3ISBA 4ED7A 5BMHA 5AM2A 1ZQXA 3PX0A 2PTLA 4ZRIA 2B6GA 1KKXA 4BDPA 3TARA 4R3DA 1XO1A 1P7DA 1ZQRA 3P4QB 1YOVB 3PV1A 3HVZA 2V4QA 4PK1A 3AMZA 1CEZA 4GOCA 5DGBA 3EPGA 2ASDA 2W9CB 1EWYC 1X1MA 3QE9Y 4CRXA 3AU5A 1V80A 3ZXVA 2F44A 3PS6A 2DPJA 3VAWA 5AKIA 4W9EA 4KGRA 4IQWA 4K4HA 1P7EA 1TKDA 1ZUD2 1TZ1A 1S0NA 4ICVA 3ZXRA 4RQ1A 2JEJA 3PV8A 1VCBA 3RD2A 1LFDA 4WJ3B 4K81A 3SENA 1I4QA 1WRDB 2FIFA 4QZAA 4N59A 1JUDA 3UINB 3DVGY 1ZQZA 2F3NA 2CHWA 4ICUA 3PX6A 2F1IA 2ON8A 4UB2A 2XK5B 5KT4A 5KG5A 2O6KA 4KDIC 4P1BC 5G55A 3H9DA 3QUCA 1JWMD 4DLEA 5KFJA 1S97A 2UU7A 4M0AA 1SGHA 4HEA1 5DB6A 3M63B 4HDQA 4W9DA 4TURA 3FILA 3TANA 4IQVA 3JVZX 3U52E 5KG2A 1N63A 2HHXA 1C77A 1EUVB 3ZJVA 2F1HA 1RQNA 3MP9A 5T8IA 4I27A 2QB0A 2ZTCA 1YZ6A 2EKEC 1JQ4A 3WK4A 4Q44A 2R8KA 3M3JA 3RMKC 5LXHA 4NQKE 3FM9A 5J2HA 2LYAA 2ZXIA 2L83A 2QARB 4YD1A 1N48A 1WF9A 3SU8X 3GE3C 5DQGA 2VRRB 2L32A 9ICVA 5ALRA 1ZQOA 1HE8A 2WQYB 3B9JA 1ZQIA 1Z00B 1TK0A 4DFJA 4MELA 5AKZA 2L52A 3MC9A 2NYVA 1U49A 2F2AB 3DHGC 2W9CA 4NLKA 3OJSA 3O65B 2MBHA 2HMXA 4FE3A 1XQQA 4A9AA 2MSNA 2IA6A 3I9V1 4RU9A 3PSTA 2M17A 1V6EA 4C8NA 3RNEC 2KP7A 5J2FA 4MGZE 1L7YA 4W9JA 3DDHA 4TUSA 1L4DB 2Y9TA 3V6KA 1N62A 3AE5B 4KLJA 4MSMB 4DHZE 3RNGC 1UBQA 2RDIA 4RPXA 5KT6A 1SL0A 1A76A 3L17A 4ZRJA 2V9HA 5J0YA 3SQIA 5AM1A 3C8YA 3U8ZA 1SZHA 2VZKB 1YN4A 2JXTA 2RRDA 3PHXB 2X38A 4DSEA 4NJ6A 3Q3JA 4JLCA 2PI5A 3JPTA 2LPEA 4MM3B 8ICRA 3RI7C 2G45B 4UASA 2IBIB 4BZAA 2XK5A 8ICYA 1RRBA 4M2YA 4KLGA 1WR1A 2JZBA 2H88B 4IG7B 3RNAC 3FYHA 5J2RA 8ICGA 2R2OA 5AI5A 1QOFA 5E79U 2OXOA 5KG6A 1P98A 4DK5A 2WF5A 2SEBD 1NZPA 1GC6A 4EELA 5AICA 1O03A 2WXGA 9ICHA 2ZNVB 3EECA 4G50A 1JRPA 3WKAA 4ELVA 4B9NA 3KZIU 3RR7A 1BMLC 4M8MA 1V97A 1QQ6A 1LXDA 3SDLC 2QARA 2BGWA 2MEKA 2Q4TA 1RZTA 2G5IB 2VANA 1Z1VA 3KZXA 5GTIU 1Q0WB 2ZUBA 5CWRA 1BNPA 2KDBA 4F91B 3K75D 1ZJMA 4B0MA 1Z00A 1DK3A 3PSPA 2IMWP 4C7ZA 3I63C 1AARA 2DZIA 1ZQAA 5GTHU 2HI0A 1V9PA 4YT0B 3I76A 1NBFC 2PKEA 2KDFB 2ZIUB 2DFLA 5J2EA 1X6JA 2NO5A 3C1YA 2LKYA 1XT9B 3M9NB 3R2IA 2GH1A 1J7CA 3MFIA 3TBLD 3QIJA 5IINA 1HEKA 2OM6A 4M0WA 1VLBA 1F77A 4EYIB 3P4SB 2K1FA 4M6WA 1QCKA 4UQGA 3Q8BA 3GIJA 5IIIA 2PMVA 2ZVNA 5KFFA 1WJUA 3RT3B 1CI4A 1F52A 2KIVA 2QEJC 5DBCA 5IIMA 1TS5A 2UYZB 4M00A 4JV1A 3A9JA 3DBHI 4AWJA 2KZ3A 2IO1B 3DPDA 4NLCA 4R64A 2RMMA 4TQ1A 2JF5A 4ARIA 1C7YA 2VH2A 3AQFA 1OGWA 4TMAB 3VTWA 5J8YC 4AJYB 2KKVA 2WXJA 2DYBA 3NUHB 1T3QA 2ES6A 1U48A 3H7PA 3W9CB 2KZMA 1C3TA 1U47A 1RYSA 3RYTA 2BYVE 4Y2XA 3ORYA 2NRVA 1WXVA 1ZQ1C 2KJRA 4I2GA 1L0YB 2DYMA 1PK1A 2MSED 4YTMB 2NCNA 3SMVA 1WXQA 4Z6FA 2QSDA 2HHSA 5BYSA 3C2LA 1ZOLA 3B0XA 2BWES 2INPE 3MC8A 9ICLA 2KX0A 4UAZA 1FPYA 2PFQA 4Q2JA 1WCLA 1H38A 4NJ7A 1DYQA 2OH2A 4S17A 3QK0A 2KVSA 4LNIA 3A33B 1QSYA 4F8RA 3QU2A 1MHXA 3D6JA 1ZETA 1KM7A 4B6WA 2A3VA 2H3IA 3H0LB 2ACZB 4QZDA 4GDKB 7ICNA 2C5LC 1ZQHA 2MBQA 2FIDA 3IT6B 1QQRA 3ZRFA 2ZIUA 2KTRB 2KQ4X 5EWGA 5TZVA 2KJHB 3MHSD 1U45A 2BCUA 4H2AA 2W9NA 3AL0B 2W54A 1SEBD 4ED2A 2HCFA 3TEYA 5IIOA 2ZTEA 1XEEA 1JRUA 1VRAB 4O5CA 3EWAA 4QZCA 4DFKA 1TV9A 3TADC 2BPFA 2JUOA 3SFDB 5IN7A 1XS9D 2LRUA 1L3SA 5J0OA 8ICKA 4OD0A 2FE9A 1V38A 4F4XA 1ZDXA 4F5NA 1KFYB 2MRPA 1Q46A 1OXJA 3SEIA 3VDZA 1I4HA 5BMGA 2L8JA 5AKGA 1C76A 4O3RA 8ICMA 3UIPB 1X6IA 3LK9A 1I4RA 1C78A 4EZ6A 2Y0SF 3QZ8A 2ZPNA 3Q69A 4I2IA 3QXGA 3Q2AC 4WURA 2BPSA 3T5JA 4IL6U 2MJDA 4K7WA 2YB1A 4KIKB 4PH5A 3ZIMA 4PS7A 1XXGA 3UMCA 4ELTA 5J0RA 3VR8B 5H92C 1B1ZA 2NMQA 1MA7A 4HYKA 2MHJA 3MHZA 3BK1A 3PRPB 4IW0A 2QILA 1NI3A 3BDPA 1DXSA 4QJFB 3L08A 4EZLA 1SIJA 3PZ7A 4X57B 1TS4A 5KFIA 2FUG1 3QU4A 2XO7A 5DGAA 3DWGC 1LO5D 4GXKA 2KHQA 4TUUA 4DDID 2K0PA 4EBEA 1MFWA 3KHGA 1TFRA 4K7UA 5KHOA 4LJOB 3PW7A 2K6DB 2JPHA 3HPOA 5HR7A 1WRIA 1YX5B 1T0RC 2JWUA 2LHTA 1KW4A 1FM0D 2WLBA 3R7QA 3RJFA 2N7DA 5J0XA 2I6XA 2BS4B 2M4NA 4UBBA 2UVVA 4NM2A 1KFDA 3T3NA 2KD1A 3QC8B 3AEBB 2KZRA 2G4DB 2ZTDA 3QX1A 4EYHB 5DPWA 2PXIA 3H0RB 4YVZA 1PGBA 3HX0A 1N2XA 4UW9A 1CK1A 1K51A 1KFSA 4KGSA 3RJIA 4DOBA 1A70A 5LLIA 4S0RA 3BVMA 2CRXA 1IV8A 4KZ0A 2W9BB 1NOMA 3KOOA 3PO5A 1YN5A 1ZKHA 2AQ3B 3WAOA 1X9XA 2E1FA 5C5JA 1ET6A 1UWMA 2JRIB 5KT3A 3NVYA 5ALEA 4NLNA 3IRUA 4F5QA 3M6KA 2HHWA 3RPFC 4ELUA 2CXYA 5AM3A 3FKYA 1L3VA 3I5JC 4RGNA 8ICSA 1FXTB 3QJZA 2H89B 1NK7A 1PYWD 2ZJ8A 2G9HD 1V8CA 4WH4A 2CJNA 2KKPA 4L2YA 5C2TB 1L3TA 2BHNA 4DFDA 3RN9C 3AI5A 4GDLA 4R65A 2JXJA 2LXAA 1J7BA 4OJPA 4IOIE 5KG7A 3N4MB 3RZFA 2KT7A 3K1RB 4GSWA 4RNAA 2PMZF 4ZHPA 3APCA 2HW3A 2N0SB 4MH8A 3PZDA 3KHRA 4YD2A 3UF8A 1VZ6A 1VZ8A 2H3FA 4M9HA 3N9YC 5CHVC 4FULA 4A8EA 2BYTA 5F9LA 1KRPA 4RQ6A 4LK0M 1PFDA 1RYUA 1SGGA 4GMVA 1KN5A 1T94A 3NGDA 3BVGA 1YJIA 1BPXA 1KTQA 1YQ3B 5H2FU 2LI5A 3P2BA 4HCPB 4PS8A 5DDYA 4EEKA 4KSKC 1ZQLA 3RNFC 4HWIB 3H7IA 3T79A 1SJED 5E6OA 2KANA 1M6YA 1S77D 1LKYB 2BQ3A 3BQ1A 4C8MA 3VCBA 5I4DA 2N9LA 4DWIA 1EWCA 2MUTB 2XY6A 2VKQA 2FUHB 1SKRA 3BS7A 5H8YE 2IGDA 3QU7A 4I2HA 2GBNA 3VTUA 5J2DA 2BF8B 4W9CA 3R7RA 1WZ0A 4TUQA 3GU3A 4UDUC 2FLLA 2ZCBA 4R8UA 4C4RA 2BW2A 3KYCD 4ICAA 3ZD9A 4F4WA 2NV3A 5CHGA 1TGZB 3ZDMC 2O6VB 1KRHA 2GLEA 3QU5A 2XN9C 4J03A 3A0BU 4KLHA 2KX3A 3NTUA 1FCCC 2KC2A 3EGRA 2IY0B 4UB1A 2GB1A 1SE4A 4AS1A 4KN7A 1TS2A 4YSZB 4A8XC 1QQ7A 2D5GA 2WXPA 4B9KA 1WFYA 4NV0A 3PHWB 1JWAD 8ICZA 5ALJA 5KFYA 4OHJA 5BOLA 2ATLA 1ZP0B 2KYWA 4XC2A 8ICLA 1NYRA 2VA3A 2HTME 9ICIA 1JCKB 2DAFA 2V3PA 1TTNA 1V1PA 1A0PA 1BPZA 2D07B 2DYOA 5E6JA 3WANA 1K1QA 4O5EA 2LHEA 2L5YA 3KKAC 5J2KA 1E8YA 3PSIA 2B21A 4C80A 3RFAA 1XU4A 1GOZA 2UVUA 3IBEA 3NASA 3HIZA 1B9RA 4BXOB 3N3KB 5KFAA 5KFZA 3HT3A 3KH0A 3Q8LA 4QZFA 5FP0A 5KFVA 1UA0A 1MVKA 2YTUA 4JQWC 1SE2A 4OZBA 2HBJA 1IYFA 4Y2SA 3PW2A 2ASJA 3V7KA 1NDDA 1D5MC 4ZYNA 3IN5A 1BUIC 2FPLA 4MEXA 4M47A 5KFQA 1NZBA 1MG8A 2PKOA 3DBRI 3LJ3A 1WE7A 1XLNA 3F2DA 3UPQA 3UIOB 4NWIA 5AIBA 2IY1B 2N9KA 3ML8A 4FA6A 2V4LA 7ICFA 1HTOA 2YN4A 3C28A 1ZYQA 3RJJA 4FHJA 4MACA 7ICOA 2L1AA 4KGTA 1SZPA 4LTUA 2FNJB 5KG0A 1KLNA 2BS2B 4LNNA 2PLPA 2J6TA 1RFAA 4E3CA 2JVCA 9ICXA 4E71A 2WB1F 2QHOA 2UWQA 1SV4A 2IOFA 1TK5A 2C7MB 3JPSA 3NUQA 3OG5A 5HHIA 2WHIA 3PW0A 4KLDA 7ICGA 4TV3A 1V9JA 3SV3A 1TIFA 1BXTA 2K22A 3B2FA 3OLMD 5JTIA 2MP2A 2CPRA 3RJKA 5AUIA 1N60A 2DNFA 4QIWC 5L1IA 3HW8A 2INCC 1IP9A 4M04A 2YMQA 2M9NA 2HBMA 4KMUA 3M1YA 2M1MA 5AI8A 2EH9A 4C8KA 3DBLI 4KN4A 4PL2A 2CR5A 2CJOA 2N1VA 4BGDA 4RQ4A 4IWQA 2INNE 1ZRMA 2K4HA 2N9PC 2V3NA 3JPQA 4OVUA 5AK4A 2KQSA 1ZQMA 5J0QA 3HKZC 3GFKB 5F9NA 3GIMA 4PL1A 4NL9C 3MGIA 4PHAA 3NRWA 2LUEA 2LVQA 4NJCA 5KFSA 3TJPA 4QNLA 2YB4A 2K25A 2WXRA 1N61A 2HHQA 3NJTA 4P6VF 4URKA 4OJ5A 2XY7A 2R8GA 3AECB 2FE8A 3QU9A 3LVVA 1GAQB 3PGEA 2EAMA 1L0XB 4F5OA 1V49A 4IC7B 4XDCA 1ZW7A 4FZLA 2E8PA 2SAKA 5KFDA 2HHVA 3KYDD 3BVZA 3NZUA 1ZE3D 3M95A 1KFTA 2W9AA 3FDSA 4FZMA 4Q8EA 2K6QA 3AM9A 3AE3B 1SL2A 2BKEA 2LUMA 1UHUA 1N5WA 2FCSA 5G5HA 2KJ8A 9ICAA 2BPCA 2M0AA 4Z6EA 4DSJA 4GC7A 2KSOA 5ALDA 5CP2A 1T0QC 3CNHA 4XUSA 3ZDDA 5KFKA 4HDOA 2QIEB 4TSSA 3WKCA 4KLUA 3H8SA 5ALYA 1OQYA 3AE9B 3FILB 4DHZB 7ICRA 2MCNB 2L05A 2JRZA 2FDRA 2ZIXA 5EE1A 4JUZA 3L5KA 5ALTA 3PZPA 3IP4B 1ZQJA 4DQSA 3IAM1 1ZQVA 4QWAA 2XEWA 1UGMA 3L4PA 5CB1A 1KEJA 2VJ5A 5T14A 3ZDAA 4JK1A 4DEZA 5J0TA 1QH9A 2XIDA 4ZRQA 2RDHA 4BJQA 3PMLA 1QT9A 8ICXA 1NKEA 2BGFA 2KO3A 1QLBB 4BOZB 2EZYA 1B4FA 2GOLA 3H7SA 3V60A 1XSNA 5B66U 4M9GA 5D6JB 1URJA 2MA1A 5IAAC 1MSWD 4Z6DA 1YX6B 4PHDA 2J52A 1SWWA 2FI1A 4CF4A 5LNK1 3BY4B 4JX1C 2N7JA 3ZNHB 4DL3A 4DHJD 2BS3B 3T3OA 4ACFA 2C28A 5L95C 3ZDEA 4I2JA 2WDQB 4O9MA 1ZXHA 3ZUNA 1GB4A 1L3UA 1XD3B 4FJZA 4LJXA 3EUB2 3DHIC 2PIAA 1QSSA 3PR5B 2KWVB 5DBBA 4WIPA 4F93B 2KTQA 4I6PA 4KLOA 1NENB 3RBEA 2PE6B 1IIPA 4I29A 2DENB 3IHPC 3ML9A 2W55A 3QEBZ 3NVVA 3WK8A 2J4XA 2KJ5A 3WKEA 4QZEA 4EENA 2PW9A 1BNOA 2JZBB 1ZGUB 1AN8A 1DOIA 8ICPA 5D94A 4HK2A 2PFNA 3HM3A 2ONQA 4UB4A 5IKCM 2R18A 4P4PA 5F3XB 4NLGA 1R4NI 4RQ8A 2F76X 5ALWA 4ECRA 1LVHA 4L1BA 1WGDA 4UB5A 1S76D 3HUIA 2G5HB 4FADA 1ZQWA 2BZFA 2AH5A 5IA7A 4JMUA 4F92B 3L3FX 1XLQA 5BO4B 3M8RA 4PGQA 1QOAA 4K1RB 2NVUI 5BMIA 3C2MA 4LCDE 1HZ6A 1N6ZA 2DBYA 3QZ7A 1E8ZA 3DBRB 1TT5B 4B9LA 3I57A 1SE9A 1ZQTA 3GV8B 3DOWA 1WWTA 2F77X 4J9KA 4DSLA 1ZD4A 2VIXA 3GIIA 2D3GA 3LDZE 3L0WB 2ZEQA 3H8HA 1XWLA 4MEYA 3GV7B 3EFCA 2AQ0A 2UVRA 4XE0A 3T3FA 3MJ5A 4KKIA 2N7EA 3N7SC 1ZQQA 1UT5A 5KAFU 2IOFK 4BWMA 2G06A 1JWUD 1F44A 2JQRB 3PW5A 4M0WB 4ZYSA 4AYBC 4M6WB 2KFZA 7ICHA 3ZDCA 1ROEA 2X8XX 4RT2A 4QWCA 2KG5A 2AXTU 2MA9B 4ECSA 2IGHA 4WAAA 5BOMA 3WK6A 3A9JB 3EW9A 2L0FA 4ACOA 8ICAA 4M9LA 1Y8RC 2ZXHA 3JPRA 4F71A 2WXIA 3F53A 4KTQA 1KF6B 2RHFA 2DX5B 2RGFA 5D49A 1RPLA 4TKNA 3N1XC 1RXWA 3TEZA 1L8OA 5KFTA 3BINA 1KQQA 3CMMB 3LWMA 3NS8A 4M8NA 2Y5CA 3AEDB 1Q1OA 4EX6A 2HTHA 4CHKA 2BCQA 3H7PB 3DBLB 1SKSA 1RG6A 3H1UA 3PO0A 4DL4A 3W2DA 5J0WA 2F8KA 2YX8A 4YWGG 1WG8A 5ALSA 2LMCA 4KLLA 5AI9A 5DPTA 5KFOA 5L1KA 4PYUA 3ZTCA 1PK1B 3CSFA 4DFMA 2PFOA 4MDKE 3H8JA 3P1MA 4GN1A 4NZLB 2D6FC 1WIAA 2CU3A 1DGJA 1MQ3A 4RF1A 3VH3B 1C9FA 2RDBC 3ZNGC 3TFSA 4F2RA 4WWOA 1PVQA 4A55A 4CE6A 3CSTA 3RB0A 2AU0A 2Q0ZX 3EZ5A 4JE3B 4P4OA 1AWDA 2IHMA 3QYPA 4QW8A 1SL1A 3RR8A 2L00B 2XC9A 4NAWA 4XZ4A 3L16A 2EZXA 4C8LA 4KX6B 4RM9A 4ECQA 2KVZA 4XYCA 1A5RA 3ALBA 2LGXA 1WGHA 1ZQBA 3U26A 2LASA 4Q43A 4MH0E 3WIMA 3UMGA 2KK0A 5AKYA 5DKWA 4ED0A 1E9MA 3ETRA 1L6UA 4EUTA 2NTSA 1UCVA 2LBOA 1ZQDA 1HQRD 2JZ3B 3VVWB 3S6JA 3MC0B 3A4RA 2D3AA 1X9WA 3SAHA 3N32A 2YQEA 4RCOA 3ZW3A 1CQVA 4J9OA 1EU4A 1TYGB 3MGVA 5KT2A 3QHTA 3X23A 1D6EC 1L7OA 1RXVA 2AQ1B 1NK4A 4RMAA 2BR0A 5D3IB 3E2EA 1JX4A 2WYQA 3SAFA 4CO7A 1UF0A 3UXOA 2DZMA 4DQIA 2HE7A 2EDUA 2YMPA 2LJIA 1M4VA 1F5SA 3OHBA 2E3TA 5AI0A 2AJQA 4ZRPA 2HBLA 2LM4A 3SR6A 1SV0C 2I38A 2IDYA 1TE2A 3ZVVA 1WR6E 3T5HA 1F2RC 2KKCA 1E8WA 3RH5A 2A1JB 4M9JA 4XDDA 2JEGA 1UZXB 2FMSA 2AQ4A 4F3OA 2BWFA 5EE0A 1D5ZC 3THVA 2QJLA 4W9KA 3W1SA 4J9SA 3R9KA 1WGGA 1Z5SB 1NJYA 4E0DA 1WJ6A 4CF5A 4B9UA 2KVRA 2ZIWB 5CTRC 5HHHA 5BPCA 2KFNA 1VD2A 2NBVB 2D3BA 4BKGA 4MFAA 4WJPA 5AKXA 1PZNA 5HMLA 1L5UA 1L2NA 5HHDG 1P3QU 1WE6A 3EPIA 1GJZA 3PO4A 4Y2PA 4F7ZA 2IO0B 4KVGB 8ICCA 2LYHA 2PEAA 2KN5A 2Z59B 2WAQF 5KG3A 3DVGX 1V81A 2QLTA 2ZJAA 2OHFA 4I28A 1X9SA 3EFUA 3T5LA 2M56B 4JWNA 4ZHOA 3KD3A 1ZD5A 2FLPA 4US9A 1D5XC 4E74A 1ZRNA 2DQNB 4UAVA 4IS7A 1SWVA 4Y2JA 4ED8A 2NPTA 4WJQA 4UB8U 2C7HA 1E6EB 2LGIA 1Y56A 3H6NA 4ECZA 2Q5WD 3ZYYX 4IRDA 2K3UA 5JHBA 1ET9A 2GLSA 1EF1A 4Z6CA 1SKWA 2N9XA 2Y9UA 2LGYA 1R4NB 4FLHA 4EBCA 2HJ1A 4B0EA 2KICA 5BYRA 3BQ2A 4LZGA 2IZVB 1RDFA 4OJ6A 1DOXA 2Y5BB 3GZFA 2DWQA 4HROA 1ECWA 3HM6X 4HRSA 2B76B 4DDGD 1UPHA 2G07A 3Q8SB 4G9BA 1TZOA 2A1JA 1UNSA 2KHWB 2PJHA 3I3TB 5DCNA 2KD0A 3OJ4B 2MRLA 1TKYA 1YZ7A 2HDEA 2VH1A 3RCZA 4AP9A 1TK8A 3NY5A 1Q3UA 1GNUA 1XCTL 4P0QB 2IOHA 2BVCA 4GDLB 4BWJA 1ZD3A 4LVSA 2MX2A 1WXAA 4RQ7A 2ZIWA 3Q8AA 4I6NB 3I28A 4MGIE 1GB1A 7ICSA 4Q8FA 1ISNA 2G3QB 5CHFA 5DLGA 2IO3B 3RH6A 5J2IA 2I1JA 4JPSA 2AGPA 2L3ZA 1J0GA 2V0GA 1B0XA 2YEPB 4UB6U 3H4DA 1XSLA 4JIOU 5DB8A 3MFGA 2WHEA 1HZ5A 1Z2MA 1J2NA 4ZOHC 1FRDA 2EANA 3ZDTA 2WXLA 3N7RC 4MJSA 1MPEA 2CHXA 4F4YA 3SD7A 2J53A 5E6NA 4XA5A 4C7YA 1UWXA 2FCQA 2H3VA 1LM8B 4QZ8A 2JGAA 1J97A 2C2EA 1RWSA 2LVPA 4DF4A 3ZDBA 1WUDA 5AM4A 1QILA 3O13A 2MBOA 2D2QA 2NS5A 5J2JA 1IBXA 4GXJA 3IDWA 5AM0A 1IXRA 2XGQA 4KITB 4IRKA 5FR6A 2ISOA 4RM8A 4RZRA 1KJTA 2Y1IA 2BQUA 2YEPF 3BYTB 1LV5A 1ENFA 2ZJDA 1V5OA 3BS5A 2A4ZA 1QF6A 4M9NA 3UXNA 1UGJA 3AEAB 4RQ0A 1N56A 1DGSA 4R8UB 4HLEA 1RM6C 5DQHA 2JYEA 3T8MA 1PUTA 2WWZA 1ESFA 2G08A 3C19A 1QOBA 9ICEA 2JR5A 4CF3A 5J2GA 4C0ZA 4O1NA 4GFJA 2C2RA 2HHTA 4P0QA 1C79A 3QARA 2Y1JA 3QEAZ 3LYYA 3RNBC 3WAMA 1C20A 9ICMA 3N7PD 1E90A 3GZNI 2DUYA 1V2YA 2OOBB 2J6SA 5L9XA 5D46A 3R3MA 4REZA 3K9OB 1D9FA 3MR3A 3AH7A 3KFUF 1Z1BA 2WXMA 3ONNA 2WF8A 4OVVA 2TSSA 1V1PB 4PZNA 2W9MA 1FXIA 2ASLA 2GI9A 3PRZA 1WGRA 4FJYA 1DOYA 3TKAA 1WSPA 3P4RB 3L13A 2D3DA 2ZUDA 4RNNA 5ALXA 3DBHB 3N30A 3ZNID 3KHLA 1RFKA 7ICKA 4I2DA 5IO9A 3GV5B 4WWMA 3RAXA 4O0IA 4BKSD 4BKSA 1J8CA 5KHQA 1ZQSA 5HMMA 3CP8A 1GPXA 1CRXA 5L83A 2BCRA 2KMMA 4YL8A 1ZQYA 2W7PA 1SSNA 2BB5A 1MHHE 2RPQA 1RAXA 2DLBA 2KJ6A 2MH7A 4CYEA 2RD0A 8ICVA 2OCEA 5AZFA 5HG2A 1TAMA 4B9TA 1WGYA 4RGOS 4C4SA 1C4PA 5FKAC 1MG4A 4YXDB 4IKGA 4DQQA 4PGXA 2BB6A 2XGPA 5IILA 3PX4A 1EO6A 1U4AA 4RQMA 1BPYA 4BX9C 1BGXT 3HJEA 2FMPA 1VZ7A 3OSPA 3BQ7A 1JROA 3H40A 5KFBA 3OAWA 5JUMA 3JPOA 1FEHA 3Q3FA 3PTFC 4P1CC 4L23A 7ICQA 3ZO5B 1XO0A 4KKJA 1IGDA 2RQ5A 9ICKA 2AHOB 2BKFA 1FNWA 3WK5A 1NNLA 1LQBA 3KUDB 3AU2A 3AU6A 4DSIA 4FHKA 4KLIA 3V7LA 5ALQA 5TR5A 4RH6A 1ZOYB 1WX9A 3GB1A 1RYRA 2I1QA 8ICUA 4NXZA 4FZNA 2KVCA 3PMNA 2BDUA 4R63A 2MP2B 1P7FA 1RLFA 2AGQA 2KTFA 2I2YA 3KUZA 5KL8B 4EOYA 2KWDA 1R4MI 2V4IB 4F2SA 3GS2A 4UAWA 4AQ7A 4GIVA 3JPNA 1XNSA 4XWWA 1KOTA 1FMAD 1M94A 4DL2A 2B3AA 2WGSA 4USAA 5CEHA 4DQPA 4QWDA 3OHAA 2MW5A 4BKTA 2ALZA 2K8CB 3AE4B 4MSQB 4BBNF 1B22A 4CDGA 4PS3A 2A1AA 3NVWA 2O2VB 4UARA 1V5TA 3TACB 1ZQEA 4YXJA 2J6UA 2GWSA 3Q8KA 4I6LB 1IM4A 1K8RB 2K9XA 1EXNA 3G6XA 3KVFB 2RDJA 3KWLA 5DPRA 2BYEA 3X0WA 2K8AA 3QWZB 3HK0A 4IQTA 2QKQA 3DV9A 2RSUA 1S8OA 3H0MB 4QWBA 2BQRA 8ICFA 2LXCA 2Y5PA 1U9LA 5JRTA 3SZ2A 1TBEA 1E7PB 7ICJA 5J8YA 5G5GA 2LGDA 4RPZA 4UAYA 1ED1A 3IVFA 1GC7A 1D3ZA 3DQVA 5TSSA 4TQRA 4F50A 1HEZE 5J2AA 4QW9A 2JT4B 1STEA 1WX8A 3KWVA 4DOAA 3RJGA 1PQSA 1UD7A 1ZQNA 3ED5A 2HD5B 2KFKB 5J2BA 4ANXA 4HPMB 3QAQA 5EOZA 3LVWA 1QTMA 2OWOA 4YFKA 4Y2UA 2W04A 3F2CA 4IRCA 1K1SA 5ALHA 2AEHA 3IXSA 5HKHA 1X42A 3ALRA 1KTKA 2KZZA 5DPSA 4ZDVA 4ECVA 2WX1A 2JHDA 5HP4A 1S9FA 2I5HA 4J9RA 4N9F4 1SXTA 3MDCA 2P6RA 4O3MA 9ICFA 1ZXIA 2AWTA 3BZKA 2KSOB 5AI6A 2AL6A 4BVUC 2AX5A 2ICIA 2LHDA 1UH6A 2XY5A 4DWFA 1T8EA 1EM7A 2N9EB 2K4IA 2MJEA 3N1YC 3KUCB 3E9SA 4Y2QA 2H3QA 3QNMA 2ZIXB 4DQOC 2PFPA 7ICVA 2PVGC 4DL5A 7ICEA 2KOBA 1A6SA 3TUOA 1XO3A 2K8CA 1X2IA 2K8HA 4EKUA 1AROP 2LZ6A 3PPAA 5HNKA 1I4PA 2O2VA 3TADA 2G0AA 3U7DA 3M9OB 2ZNVC 3WCQA 3I1YA 5KAIU 1L6VA 3JSVA 1F0ZA 1FD6A 4IR9A 4IR1A 5KFXA 1L7MA 8ICJA 3U4EG 3O0FA 2LJ5A 4YSYB 5AKLA 2FBWB 2ZIVB 4B9VA 2EAOA 5KFPA 1I4XA 4RNMA 3AEFB 4DHJB 3IG3A 2K8BB 5L1LA 2ZJ5A 3TI0A 2BDPA 1CZPA 3K9PB 2JH7A 1BPEA 1AW7A 4XGAB 4LNOA 1TS3A 3AE7B 3QA8A 2H3ZA 1XC9A 2KFKA 2EMSA 4U6PA 3HHMA 3GZNB 4IDIA 1EF5A 3PLVA 2EMTA 1T7PA 3JW0X 1QKZA 2WDVB 5JHAA 1C4CA 4C8OA 2HOFA 1TVAA 4PHEA 2IHNA 3OTQA 4DFPA 2V3SA 1UUPA 2WF7A 9ICPA 3C29A 2BCVA 4M01A 3N20C 2KC1A 2WDTB 2NRZA 1L7NA 5ALLA 1E8XA 2G1EA 4Y2RA 4Y2YA 4HXDA 1NK5A 4F8CB 3MABA 2ZG6A 4J9NA 1L7PA 4DOCA 1FNVA 1FRRA 3AEVA 4KDLB 1BPDA 5BYQA 5AI4A 1BT0A 3WKBA 2E6XA 1PK3A 2JSVX 2Z0EB 1D9DA 4DXFA 2QB1A 4Y2TA 2PVOD 1JI7A 3UXPA 1JWSD 3Q8FA 5CHWA 5ALFA 3Q8QB 3MJWA 1JMLA 2KQ7A 2DZJA 5ALVA 3TL5A 2RP5A 2M8SA 2FCMA 2LEKA 1OQRA 2W3SA 5EE3A 5KFNA 1I35A 5AZHA 1CJEA 5AK3A 1F9JA 3V62A 1T4GA 1ZPSA 5JH5C 4XQ8A 4KLQA 1Q8KA 2HOIA 3P4PB 9ICSA 1SF0A 4X5VA 5AM5A 5IIJA 3C1ZA 3TFRA 3NOBA 4DL6A 4KLEA 1NJWA 2ZIVA 2C9WB 2E8MA 3IAS1 3KQ4A 4DBGA 4O3PA 3C5FA 2WNMA 4YTPB 8ICIA 3ABVB 2K8BA 4JWSC 5CA7A 1D8LA 4C4VB 1WYGA 1E7VA 5ALKA 9ICOA 3VRAB 2Y0SC 5DB7A 1SB3C 4B9MA 2MBEA 9ICQA 3HP6A 3RNCC 3RBDA 5J0SA 1MN8A 9ICJA 3DBSA 1N5XA 4AJWA 3UGBB 3VFKA 1TJEA 2D10A 4HJKA 3WU2U 3M7DA 4GLSC 1T0YA 4FBTA 2EKIA 1S0VA 4HKQA 3RB3A 3QUBA 1X66A 4ZRKA 1R4MB 5K4LA 1NEKB 4NY0A 3RRGA 3BQTA 3UI3A 3CIRB 2JZPA 4EX7A 2YMMA 2NR2A 4JB3A 3TEWA 3DEEA 5ALIA 1K50A 3M8SA 3DDCB 2JEIA 2E8OA 4P2HA 1IPGA 4DLGA 2BKRB 3VQIA 4GIBA 4F72A 4YR2A 3KHHA 1FIQA 4J9PA 1IUEA 3BK2A 3M62B 4LLGM 2KAJA 4ARCA 2KV2A 3ICXA 1YN3A 5KTQA 4YP3A 2C60A 1SBBB 4QZGA 2JMGA 3SEBA 3W5VB 1HUOA 4KX5A 4OZAA 3RTVA 5AHXA 3WA0A 1IG6A 2WXQA 2WXNA 2N1WA 3AE6B 3VUWA 3SD5A 4EEWA 2J0JA 2JX5A 3RRHA 4PPXA 1JXLA 2GBJA 3AB5A 4PZOA 1QQ5A 8ICHA 4EE2A 4W9IA 3WK9A 2W03A 4NAWB 2KDIA 1XLPA 2XNAC 4WQOB 2NRXA 2K5PA 1ZJNA 2W7OA 4I2AA 5D3DA 3OGUA 5ALUA 4QZ9A 1MQ2A 3PRMB 2JRHA 3NHEB 5J2CA 4GU2A 2XCAA 2J0KA 3MR5A 4K4GA 4DF8A 5ALZA 4C4VA 3RJHA 2DPIA 4BFRA 3Q3MC 1MC8A 1WWUA 3IM1A 1KLUD 2NO4A 4EZKA 2BYFA 2OYYA 3PSEB 3ENEA 4UAUA 5AK5A 3N97B 1T5XD 3V6CB 4US8A 4JL9A 5C3JB 2IGGA 2HBKA 3OPXA 2DKXA 2KNBA 3T9LA 1DRGA 3UQ2A 2NBUA 3H4BA 3QCAA 3ZTDA 2PI4A 1P0RA 5JXVA 2FJ6A 4WQMA 3HRDD 1K5OA 2DGZA 4P0PB 2ASQA 3BWUD 4I2BA 4RNOA 1QLNA 7ICTA 4YXMA 5A0LA 1ZQPA 2JV3A 4I2EA 4F4ZA 3G6VA 5KT7A 5ALNA 1GO3F 3TAQA 3NS1A 2JU6X 2WP9B 3RH4A 4K7SA 2XI9A 4W9FA 1T0SC 5KL1B 1DOQA 1S5LU 2EZZA 1NK0A 3AU4A 1WXMA 2PMZC 2JZZA 3KKAA 7ICIA 2AQ2B 1J7AA 2V9WA 2WXFA 2W11A 7ICMA 4GC6A 3PLUA 2KEYA 2UVWA 4QZHA 3NVZA 3OJ3A 2Z0DB 1PUZA 4O3OA 3Q8MA 2IYDB 3PR4A 4FS2A 1JN3A 3PW4A 2HHUA 2KOXA 1Y88A 1LB2B 2KN7A 1S1QB 2CU1A 2ZZPB 3PVLA 1UBIA 3MFHA 3QQ8B 3A9KB 3RZWC 1Z19A 2JYTA 5AUKA 1JW9D 2C2DA 1V86A 3ISCA 2HVHA 1ZD2P 5DDMA 3GQCA 1T6BX 3RULA 1BVSA 5DLFA 1L0VB 2A19A 4OJLA 4MGYE 4QIWF 4CNQA 1QZEA 3NZSA 3ONSA 1PDXA 3E56A 2VA8A 3CRXA 1R7SA 3B0YA 1DK2A 2J0MA 1VJ5A 2NPTB 4G3XB 3QUTA 2R8JA 4HPPA 3HILA 4F5PA 3RAQA 2AYOB 5KFLA 5IOIA 3WAPA 2EQYA 1O08A 3IHQB 4NLZA 3KBBA 5CRXA 2DZKA 7ICUA 1E5WA 5AKKA 5D7GA 1RYJA 4LNKA 1OFFA 4HPLB 3FC4A 4O5KA 5AZGA 4P0PA 4RPYA 3HKZF 1P9DU 1G6JA 5AKJA 1HTQA 1MI0A 2FMQA 4YN4A 4RQ2A 3BJYA 2IPKD 3U30A 4W9LA 3MBYA 1PGAA 1L6NA 3JYUA 3PY8A 3NZ3A 4IM0A 5ALOA 5J29A 2KWUB 2VZKD 3D2QA 4TQ0A 3APDA 3AUOA 1HJPA 3UQBA 3Q8PB 4MM3A 2K4PA 3P42A 4NAMA 1KH0A 2RR9A 2BPGA 4FXCA 5CX3A 2GOWA 4OJOA 2P6UA 4WAFA 1VDVA 3IV6A 3V3XA 1CMXB 4HVBA 4O3SA 4XX5A 2LD9A 2KNJA 5KFEA 5ALMA 1F2RI 5KG1A 2E1EA 1FEZA 2WF6A 1KLGD 2LGSA 3TIXA 1YJJA 2XICA 3MC1A 3W1YA 3A9KA 4A3PA 4NL9A 5KFWA 4XRHA 2LYBA 1TAQA 3AEGB 2YVCA 4GXBA 4BBNC 5C0YA 2MBBB 5J17A 4EFOA 3GP7A 1BPBA 4DO9A 5B5EU 4YMOA 2JXXA 3UM9A 3EC8A 1S10A 2JEFA 2C7NB 4WWPA 3UQ0A 2CS4A 5D2MB 9ICTA 4MJSB 4EZJA 4N6EB 5KFCA 4F5RA 3V6JA 4LJPB 2GBKA 2N4FA 4DSFA 2GBRA 3P63A 3WALA 2J42A 1NKCA 2VA2A 2KE7A 3IG5A 3IT4B 1IBXB 3PZ8A 5C1ZA 1JIHA 1X9MA 3UMBA 4HKZE 3DVNU 5EDSA 8ICOA 2GRIA 2R2QA 2EAPA 2ISPA 1YQBA 1AQ6A 3B08A 3SFEB 3J81j 1X40A 1YMHE 2KLCA 2WTFA 3RJEA 2FPKA 2YMLA 3C2KA 4ITKA 2WB1C 2G4SA 1V1OA 2LI6A 2WX0A 2RDGA 4M02A 3BS5B 3AN1A 2W8LA 2LWPA 2OEHA 3Q3NC 4O3NA 1WCNA 5KT5A 2H5XA 2F1JA 3C5GA 1NK9A 4B6JA 2F8LA 4IUMB 1H4RA 4Q45A 4KV2A 3ZJUA 4UBCA 2LFIA 4Y2VA 2BT6A 4KMOB 3BIID 2YLMA 5AK6A 4JGHB 4ZH4A 1QSLA 1XLOA 4PGYA 3V6HA 2ODGA 5FK9C 2B0CA 1K52A 1YT3A 1QOGA 2G09A 1YJ1A 2LM1A 4DS5A 3E58A 4NM1A 4UB3A 3ISDA 3VUYA 4F1SA 3B2GA 1F1HA 1TY2A 1ZQUA 2W8KA 1PVRA 2CKHB 3WK7A 5J18A 2P35A 3SV4A 4J9LA 1IGCA 2D11A 2XVTA 2KWCA 3M6ZA 4A90A 2IJ0A 8ICNA 4RQ3A 4IQUA 4YG2A 2INDC 3RB6A 1NI2A 5L1MA 2LRWA 1U4BA 3R8BA 2FCNA 2NRWA 3ZGZA 4ANWA 5DG7A 4A6QA 2CHZA 4DQRA 4NPNA 1ZQGA 5HR6A 1HIWA 1K53A 2FLNA 1XF5L 2GBMA 1S0MA 5KFGA 4EEYA 1XSPA 3CF6E 4ED3A 1WY8A 2NTTA 4FBUA 2J7QB 2N1RA 3BZDB 4GDKA 4W9HA 4C4TA 4FN2A 4DXAB 3C23A 2KTRA 1A77A 2BTEA 4YSXB 4MHVA 3BQ0A 2KACA 1WI0A 3GIKA 4C00A 3GDXA 1NKBA 3TMPB 3IG8A 4G3IA 3D32A 4AP4C 4KLSA 5MPOA 4ECWA 2JH1A 1UA1A 4F4KA 3SHQA 2AL3A 3Q14C 3TEXA 3A1QB 3VH4B 4J6IA 2ESEA 5ALPA 3TQ1A 4RUAA 1E0ZA 4QWEA 2K89A 1WZ3A 4WJOA 5JU5A 1E10A 4ECXA 4KX3A 2WXKA 1WWVA 1Q3VA 4K3CA 3UQAA 3F2BA 4AYBF 4TUPA 4YR3A 3GE8C 1V85A 3U7ZA 2L0TA 2W43A 3C21A 4ED1A 4OW0A 4K4IA 3J9CA 2E5SA 4ASWC 5J0PA 1PGXA 3VTVA 3AE1B 4KIKA 4DSKA 4XWTA 1WX7A 1ACCA 1J19A 2L7RA 4LNFA 1WM3A 2I1KA 1GUAB 4YR0A 3MR2A 1COKA 2NRTA 1GG3A 3MDAA 1WMHB 4NLBA 2YY6A 3BYYB 4I2CA 2A5UA 3CWIA 2GO7A 1Q5WB 1OQQA 3LDAA 1NYQA 3PT2B 3VR9B 4RQ5A 5D4BA 1P1AA 2KN4A 1WYWB 1J2MA 2KHVA 3JPPA 4HAIA 3LWLA 2D3CA 5ALGA 1Z4NA 1NJXA 2QC8A 2V4RA 4IWOA 1I42A 4CCHA 2HJ8A 1JXEA 2V1YA 4OZCA 4JV0A 3SAGA 3ZQ4A 2P66A 3N28A 1HA5A 2MWSB 2ZVOA 2W82A 1NK6A 5AEKB 1KBUA 3BZCA 2D8CA 3MTNB 4IC9A 1HXYD 4B9SA 1WXSA 2KMAA 7ICLA 1CUKA 3LB8C 4ANVA 1YQ4B 3TCAA 1JMSA 4EZ9A 3KW5B 4NY8A 3V7JA 2REXA 3KTQA 3VUXA 3RUIB 3A1QA 2JWZA 4MGKE 1SXEA 3QUQA 5DB9A 2HDOA 1JALA 4CQNA 4PHPA 2R8HA 3V61A 4RFBA 1MJDA 3S2AA 3K1ZA 8ICWA 1S3SG 1F0MA 2WU2B 5CR0A 4MT5A 3VRBB 2C22A 4TQSA 2ZPYA 4IM3A 1Z4OA 3T5KA 2WU5B 2W9BA 4FO6A 2FPMA 4J9MA 4JWUC 1TAUA 5GMVA 3L54A 3NRZA 2CN1A 9ICRA 3B0AA 4A20A 5AIAA 4DL7A 3E0FA 4RQNA 1LGRA 1YIWA 3IFWB 3SYZA 2R61A 3PSFA 1ZDVA 3KLSX 2LVOA 4OVZA 1FFUA 4MF2A 1WJ4A 3AXCA 3DHHC 3OWEB 4KLTA 2IO2B 3ZRCA 1L5PA 5KG4A 1JWBD 5DBAA 1WM2A 2L76A 1WMHA 3Q6BA 4DCCA 4HJGE 2RPVA 3DVNV 5HFYA 5E6PA 1UELA 3AV8A 5DG8A 4PYZA 3ZNZB 5LXIB 3GOEA 4KSLC 2HVIA 3Q8RB 2KXJA 5L1JA 9ICUA 4HCNB 1ZQCA 2KMCA 1EU3A 2DAJA 1D8YA 4QZBA 4IM2A 2GMIC 4NQLB 2VJ4A 3OJUA 3G6YA 2HSZA 3A4SC 2Z7JA 4AOFA 8ICTA 1COOA 2M0NA 1FXAA 1OW5A 3H8MA 8ICBA 1B43A 4ED6A 3QX7A 4JWMA 2QMTA 3JSVB 3U2SC 2M0XA 2Z8LA 4FFDA 2XBBC 4RGTA 3ZJTA 2I9GA 2KDMA 3V72A 4RUCA 3K4GA 2QCZA 4C56C 2IBKA 3MGHA 1XCQL 4I2FA 5DQIA 1OTRB 2M19A 3AE2B 4FBJB 4R66A 4P16A 3C0RB 5KNIA 2KJ9A 3H8WA 4OCZA 1TY0A 2K60A 5HI1A 2KDEB 1SV0A 7ICPA 1D4BA 4RF0A 1LKYA 5J0UA 4LDTB 1D8BA 3AE8B 5EWFA 4RT3A 1VR9A 3F5EA 4UATA 1OUQA 4BUGA 2MUTA 2KLGA 5EE9A 4CGZA 5DG9A 4J9QA 3HVDA 4PJ0U 2R8IA 4QAYA 3ZD8A 4O3QA 9ICBA 2EELA 2ZUCA 9ICNA 2XCPA 1SJHD 3URYA 3ZKJC 1S0OA 2OEDA 4QZIA 4ECUA 4RGMA 1OEYJ 2WXOA 2W3RA 1Q10A 2MU2A 3CYMA 1TKGA 4GLXA 4MEMA 4IWPA 1I7HA 2BBCA 2KFJA 3A0HU 3APFA 5GXGB 2WF9A 3AULA 2O6VD 4MF8A 1NJZA 2O6VA 3M9MB 4FJVB 1L4ZB 5KFHA 3Q8CA 5KFUA 3WKDA 4KLMA 2MJ3A 3TSSA 4ANUA 2KMDA 5EWEA 4KLFA 1YD8U 3DCGA 3R66C 4P4MA 1PVPA 3PREA 1OEYA 1FCLA
chains in the Genus database with same CATH topology
3SEBA 3W5VB 2QJLA 4OZAA 3W1SA 3RFZB 1FFVA 2WXQA 1J7BA 2WXNA 2ZW1A 4IOIE 3AE6B 4RNAA 2JX5A 3V05A 4ZHPA 4DXGA 1YNTE 3AB5A 3LXFA 5HHDG 4MH8A 2N0SB 4EE2A 4NAWB 1FO4A 5EE0A 1VZ6A 1XLPA 2XNAC 4N58A 1VZ8A 2K5PA 3N9YC 5D3DA 2BYTA 2OHFA 4J3OD 4LK0M 1PFDA 2M56B 4ZHOA 4US9A 1AYFA 1D5XC 3BVGA 1YJIA 2WDRB 1YQ3B 1WGKA 1KLUD 3Q8EA 1C4AA 1FNUA 1I4GA 1E6EB 2LGIA 4CQNA 1T5XD 5C3JB 1SJED 4US8A 2IGGA 2WS3B 1Y56A 5I4DA 2Q5WD 2N9LA 3ZYYX 2K3UA 1EWCA 1ET9A 5JXVA 5H8YE 2IGDA 3HRDD 3BWUD 4WQMA 3W5UB 1SE3A 1NVID 4B0EA 1TKEA 4UDUC 5BYRA 3NS1A 2Y3AA 2JU6X 2WP9B 2BW2A 1DOXA 2DWQA 4HROA 4HRSA 2B76B 1UNSA 1TZOA 4YTNB 1KRHA 2XN9C 4PT5A 1TKYA 2AQ2B 1J7AA 2HDEA 1FCCC 5FR3A 3EGRA 2GB1A 1SE4A 2WXFA 3FAHA 4YSZB 1TS2A 1XCTL 3EA6A 4A8XC 4AS1A 2D5GA 2WXPA 1JWAD 4GDLB 3R2TA 3NVZA 2ZW0A 4OHJA 1ZP0B 3Q8AA 1GB1A 3DWMA 1NYRA 2HTME 4JPSA 1JCKB 2V3PA 1V1PA 2V0GA 2YEPB 2DYOA 2JYTA 5AUKA 5E6JA 1JW9D 2WXHA 3MFGA 1HZ5A 1VJKA 2LHEA 4D2KA 1FRDA 4ZOHC 3AEEB 1T6BX 2WXLA 1L0VB 4C80A 1MPEA 5BMHA 2J53A 1GOZA 4C7YA 1UWXA 2PTLA 1B9RA 1PDXA 3E56A 1RWSA 1R7SA 4R3DA 1QILA 3O13A 1MVKA 3P4QB 3HVZA 4OZBA 1SE2A 1IBXA 3AMZA 1D5MC 1BUIC 1EWYC 1RYJA 5D7GA 2PKOA 1OFFA 3FC4A 1XLNA 5C2TB 2N9KA 2YEPF 3BYTB 1ENFA 4KGRA 1P7EA 1MI0A 1ZUD2 4MACA 2IPKD 1PGAA 1QF6A 3NZ3A 2L1AA 4KGTA 1UGJA 3AEAB 2VZKD 4LTUA 4TQ0A 1RM6C 1I4QA 2BS2B 1PUTA 1KH0A 2JYEA 2PLPA 1ESFA 3P42A 4FXCA 4N59A 1QOBA 4WAFA 1VDVA 4O1NA 3V3XA 1C79A 2ON8A 3LYYA 1BXTA 2K22A 3B2FA 1F2RI 1JWMD 4REZA 1KLGD 4HEA1 1YJJA 5AUIA 3FILA 3AH7A 1N60A 2WXMA 3U52E 2TSSA 1N63A 1C77A 1V1PB 3ZJVA 3AEGB 1FXIA 3MP9A 5T8IA 2GI9A 3GP7A 1DOYA 1WSPA 1JQ4A 3P4RB 2CJOA 2L83A 4N6EB 2INNE 2V3NA 2L32A 1RFKA 4WWMA 2WQYB 3B9JA 1GPXA 3P63A 2J42A 4NJCA 2KMMA 2L52A 3IT4B 1IBXB 3PZ8A 1SSNA 2BB5A 2WXRA 1N61A 1MHHE 4P6VF 2DLBA 4HKZE 2MH7A 5HG2A 2GRIA 4A9AA 3I9V1 3AECB 2FE8A 4RGOS 3SFEB 1C4PA 5FKAC 4YXDB 1GAQB 4IKGA 1L0XB 1L4DB 1YMHE 2BB6A 1N62A 3AE5B 4ITKA 4XDCA 1V1OA 1VZ7A 2RDGA 2SAKA 3AN1A 1JROA 3BVZA 3C8YA 1FEHA 1ZE3D 4L23A 2VZKB 1YN4A 2JXTA 2X38A 3ZJUA 4MM3B 2LFIA 4KKJA 1IGDA 2BT6A 3AM9A 1FNWA 3AE3B 3BIID 2LUMA 1N5WA 5G5HA 4RH6A 1ZOYB 2H88B 2M0AA 1XLOA 3GB1A 5FK9C 1K52A 1QOFA 1QOGA 2QIEB 4TSSA 1P7FA 2I2YA 2SEBD 2KWDA 3AE9B 3FILB 3B2GA 1TY2A 2V4IB 2WXGA 3GS2A 4AQ7A 1JRPA 4A90A 1IGCA 5EE1A 2IJ0A 4XWWA 1FMAD 1BMLC 1V97A 3R8BA 3IAM1 2MEKA 3ZGZA 4USAA 4A6QA 3L4PA 1XF5L 3AE4B 1K53A 4B0MA 4ZRQA 2NTTA 3NVWA 3BZDB 2RDHA 4C7ZA 1QT9A 1QLBB 2K9XA 3KWLA 4YT0B 2BTEA 4YSXB 2KACA 2Y5PA 3R2IA 2J52A 1J7CA 1E7PB 5G5GA 4JX1C 4M0WA 1VLBA 1F77A 2N7JA 3P4SB 5LNK1 5MPOA 2BS3B 5TSSA 3T3OA 3Q8BA 2PMVA 1HEZE 3TEXA 2QEJC 1STEA 2WDQB 1TS5A 1ZXHA 3KWVA 1E0ZA 1GB4A 3EUB2 2PIAA 1E10A 2WXKA 2RMMA 4TQ1A 4WIPA 4ARIA 3IXSA 1NENB 3U7ZA 1KTKA 4OW0A 2W55A 4TMAB 3NVVA 2J4XA 3J9CA 2WXJA 1SXTA 1PGXA 2PW9A 3NUHB 4L2YA 1T3QA 1ZXIA 1AN8A 1DOIA 3W9CB 2AX5A 2ICIA 2LHDA 3AE1B 4XWTA 2ONQA 1ACCA 1EM7A 2MJEA 4L1BA 3E9SA 1L0YB 3HUIA 2DYMA 4YTMB 1WXQA 2QSDA 3BYYB 3CWIA 4DQOC 5BYSA 2PVGC 1OQQA 2INPE 1NYQA 3VR9B 1XLQA 4Q2JA 3TUOA 1QOAA 2KN4A 1XO3A 5BMIA 1DYQA 1HZ6A 2DBYA 1I4PA 3I57A 1MHXA 2ACZB 1WWTA 4GDKB 4OZCA 3WCQA 3ZQ4A 3IT6B 1QQRA 1HA5A 1L6VA 3H8HA 1F0ZA 1FD6A 2W82A 2KQ4X 4XE0A 3MJ5A 4KKIA 3U4EG 1HXYD 4H2AA 4YSYB 3LB8C 2FBWB 1YQ4B 2W54A 1SEBD 4ZYSA 1JWUD 2JQRB 3TEYA 1XEEA 1I4XA 3AEFB 1VRAB 1CZPA 1ROEA 3SFDB 1JALA 1AW7A 1ZDXA 4RFBA 1TS3A 3AE7B 2WU2B 1KFYB 2IGHA 4MT5A 3VRBB 4IDIA 1I4HA 5BMGA 1C76A 2WXIA 1KF6B 1QKZA 1I4RA 2WDVB 2WU5B 3TEZA 1C78A 1C4CA 4JWUC 3NRZA 3Q69A 2Y5CA 3AEDB 2R61A 4WURA 1UUPA 1ZDVA 3KLSX 2MJDA 4OVZA 1FFUA 3PO0A 3OWEB 3W2DA 4YWGG 1L5PA 1XXGA 2G1EA 2LMCA 1JWBD 5H92C 3VR8B 1B1ZA 2NMQA 4HJGE 2RPVA 3MHZA 5HFYA 3AV8A 3BK1A 1FNVA 1FRRA 2QILA 1NI3A 3P1MA 5BYQA 4NZLB 2E6XA 2CU3A 2JSVX 1DGJA 4RF1A 4DXFA 1C9FA 2PVOD 1JWSD 3Q8FA 1SIJA 3PZ7A 1EU3A 1TS4A 2FUG1 4A55A 3DWGC 4JE3B 1JMLA 1LO5D 1AWDA 2K0PA 2LEKA 1OQRA 2W3SA 5EE3A 1CJEA 1WRIA 2JWUA 1ZPSA 1FM0D 1FXAA 2WLBA 4KX6B 3P4PB 1SF0A 2QMTA 3U2SC 2BS4B 2Z8LA 3ZJTA 4RGTA 3T3NA 3KQ4A 2KDMA 3AEBB 3IAS1 4C56C 2WNMA 4YTPB 1E9MA 3ETRA 1L6UA 3ABVB 1XCQL 4JWSC 2NTSA 2M19A 3AE2B 1HQRD 4P16A 1WYGA 1TY0A 3VRAB 3MC0B 5HI1A 1PGBA 1SB3C 1D4BA 1CK1A 4RF0A 4RCOA 1CQVA 1EU4A 3AE8B 1N5XA 1K51A 1TYGB 1VR9A 1D6EC 1TJEA 2AQ1B 5D3IB 5EE9A 4KGSA 1A70A 3HVDA 4GLSC 2EKIA 3BVMA 2EELA 4HKQA 1YN5A 1SJHD 1NEKB 2AQ3B 2OEDA 3URYA 1UWMA 1ET6A 2LJIA 3UI3A 4RGMA 3CIRB 2WXOA 3NVYA 1M4VA 2JZPA 2W3RA 2E3TA 1Q10A 1TKGA 3TEWA 1K50A 3RPFC 1I7HA 4NAMA 4ZRPA 2BBCA 3SR6A 5GXGB 3VQIA 2I38A 2IDYA 4RGNA 1IUEA 1FIQA 1F2RC 3BK2A 1L4ZB 4LLGM 2H89B 2KAJA 3Q8CA 2MJ3A 3TSSA 1PYWD 4ARCA 2G9HD 1YN3A 4XDDA 1V8CA 4WH4A 2CJNA 1D5ZC 1SBBB 1FCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5V B;  3AE9 B;  1CZP A;  1EWY C;  2QJL A;  1RYJ A;  3B2G A;  1ROE A;  2PKO A;  3SFD B;  1OFF A;  1JAL A;  3FC4 A;  1FFV A;  1JRP A;  1J7B A;  1XLN A;  3AE7 B;  5EE1 A;  3AE6 B;  2WU2 B;  1FMA D;  1KFY B;  3VRB B;  1V97 A;  2JX5 A;  4IDI A;  4ZHP A;  1ZUD 2;  3AB5 A;  4USA A;  3LXF A;  1QF6 A;  3L4P A;  2N0S B;  1KF6 B;  2WDV B;  2WU5 B;  3AEA B;  1FO4 A;  3AE4 B;  4LTU A;  1XLP A;  4JWU C;  4N58 A;  3NRZ A;  1RM6 C;  2K5P A;  2BS2 B;  1PUT A;  3NVW A;  4N59 A;  2Y5C A;  3AED B;  4FXC A;  4C7Z A;  1QOB A;  1QT9 A;  2OHF A;  1VDV A;  2MJD A;  1QLB B;  2K9X A;  1PFD A;  1FFU A;  2M56 B;  3KWL A;  3PO0 A;  4YT0 B;  4YSX B;  4ZHO A;  4US9 A;  1AYF A;  1L5P A;  1YJI A;  2G1E A;  1YQ3 B;  2WDR B;  1WGK A;  1JWB D;  5H92 C;  3VR8 B;  2K22 A;  3B2F A;  1J7C A;  1E6E B;  1E7P B;  5C3J B;  4US8 A;  5G5G A;  3AV8 A;  2WS3 B;  1VLB A;  3P4S B;  4JX1 C;  1FRR A;  1YJJ A;  5AUI A;  2BS3 B;  5MPO A;  1NI3 A;  3AH7 A;  1N60 A;  3P1M A;  2Q5W D;  2CU3 A;  1DGJ A;  3ZYY X;  1N63 A;  3AEG B;  2PVO D;  2WDQ B;  1SIJ A;  1FXI A;  5H8Y E;  4WQM A;  3HRD D;  1E0Z A;  3W5U B;  3DWG C;  1DOY A;  3EUB 2;  1JQ4 A;  1NVI D;  2PIA A;  1AWD A;  1TKE A;  3P4R B;  2CJO A;  1E10 A;  2LEK A;  1OQR A;  2W3S A;  5EE3 A;  1CJE A;  2L83 A;  1WRI A;  3NS1 A;  1NEN B;  4N6E B;  2WP9 B;  1DOX A;  1FM0 D;  1FXA A;  1RFK A;  2DWQ A;  2WLB A;  3P4P B;  2W55 A;  4HRO A;  1SF0 A;  4KX6 B;  3NVV A;  4HRS A;  2B76 B;  2BS4 B;  4WWM A;  2WQY B;  3B9J A;  4YTN B;  1KRH A;  3P63 A;  1GPX A;  1T3Q A;  1ZXI A;  1DOI A;  3AEB B;  3W9C B;  1TKY A;  2AX5 A;  3AE1 B;  1J7A A;  2KMM A;  2L52 A;  4YTP B;  1E9M A;  3ETR A;  1L6U A;  2QIE B;  3ABV B;  4JWS C;  1N61 A;  3FAH A;  2M19 A;  3AE2 B;  4P6V F;  2MJE A;  2MH7 A;  4YSZ B;  1WYG A;  4A9A A;  1JWA D;  3AEC B;  3VRA B;  3NVZ A;  3SFE B;  3HUI A;  1ZP0 B;  1SB3 C;  4YXD B;  1GAQ B;  1WXQ A;  4YTM B;  3CWI A;  3DWM A;  1NYR A;  2PVG C;  1OQQ A;  3AE8 B;  1N5X A;  2HTM E;  1N62 A;  1NYQ A;  1TYG B;  1XLQ A;  3AE5 B;  4ITK A;  3VR9 B;  1QOA A;  1TJE A;  1XO3 A;  5EE9 A;  3AN1 A;  1A70 A;  1JRO A;  5AUK A;  2EKI A;  1JW9 D;  2DBY A;  1VJK A;  1FRD A;  4ZOH C;  3AEE B;  1NEK B;  1UWM A;  1L0V B;  3CIR B;  4C80 A;  3NVY A;  1WWT A;  2ACZ B;  2W3R A;  2E3T A;  2BT6 A;  3AM9 A;  1TKG A;  3AE3 B;  3WCQ A;  4C7Y A;  3RPF C;  3BII D;  1I7H A;  1B9R A;  1L6V A;  3SR6 A;  1PDX A;  1F0Z A;  5GXG B;  1N5W A;  1R7S A;  5G5H A;  1RWS A;  1IUE A;  1FIQ A;  1ZOY B;  2H88 B;  1XLO A;  2H89 B;  2KAJ A;  2MJ3 A;  4YSY B;  3P4Q B;  3LB8 C;  1V8C A;  1QOF A;  2FBW B;  1YQ4 B;  2W54 A;  1QOG A;  2CJN A;  3HVZ A;  5EE0 A;  2JQR B;  5C2T B;  3AMZ A;  3AEF B; 
#chains in the Genus database with same CATH topology
 1H8C A;  4K3B A;  2AGO A;  3RFZ B;  3N1Z C;  4B95 A;  1FFV A;  1E7U A;  4NJ8 A;  2KIW A;  2ZW1 A;  3RF9 A;  3VHT C;  4ECY A;  5KFM A;  3V05 A;  4DXG A;  5IIK A;  4KZC A;  1YNT E;  1ZQF A;  1KSP A;  3LXF A;  1ZQK A;  4FS1 A;  4W9G A;  1FO4 A;  4YMN A;  4EBD A;  8ICQ A;  3Q3O C;  2JY6 A;  4N58 A;  1L8L A;  5TIS U;  3ETL A;  2ZCC A;  2K4E A;  4NNJ B;  4YMM A;  4U7C A;  4ECT A;  1C1Y B;  2PE9 A;  4WJN A;  1UQV A;  3W1S C;  2HOQ A;  4BXO A;  4J3O D;  3L10 B;  1AYF A;  3HWT A;  2K39 A;  2MQJ A;  1T3N A;  4GXI A;  2WDR B;  2NBW B;  1WGK A;  3OSN A;  3Q8E A;  4G0N B;  1C4A A;  1FNU A;  3CW2 C;  4P7I A;  1I4G A;  4BOS C;  4LDT D;  3NG0 A;  4WWN A;  2WS3 B;  4YCX A;  1SIF A;  3LYS A;  3F5A A;  3TAP A;  1KDH A;  2OJW A;  3RB4 A;  2PPH A;  4GB9 A;  3W5U B;  1SE3 A;  3B1L X;  3EYZ A;  1NK8 A;  1NVI D;  2LMR A;  2FAZ A;  1TKE A;  5AKH A;  3V6E B;  2DKZ A;  2Y3A A;  2OJR A;  2E8N A;  3VC8 A;  3PNC A;  3AQE A;  2MLB A;  2WFA A;  2BCS A;  5C23 A;  9ICW A;  3EHV A;  2QDF A;  4LZD A;  1WH3 A;  4YTN B;  4II3 B;  1KLV A;  3ZLZ A;  4A3O A;  3ECI A;  4DS4 A;  4PT5 A;  2BQQ A;  5G2N A;  5JZE B;  2KK8 A;  2DL0 A;  5FR3 A;  4YQW A;  5IP4 D;  3FAH A;  5AKE A;  3EA6 A;  4AUQ C;  3GIL A;  5CJ7 A;  1HUZ A;  1Z3E B;  9ICC A;  9ICG A;  3R2T A;  2ZW0 A;  5KFR A;  8ICE A;  3MR6 A;  3DWM A;  2WAQ C;  4OO1 J;  2DF4 B;  3PVX A;  1RQL A;  1UT8 A;  3VXW A;  4G11 A;  1KL9 A;  3ZI4 A;  4BAX A;  4MFC A;  4GGQ A;  2RLT A;  1WJN A;  2WXH A;  4MFF A;  1VJK A;  3D2N A;  2MAX A;  4D2K A;  3AEE B;  3SI8 A;  2QB0 B;  1SXD A;  4JV2 A;  3D2S A;  2DHZ A;  4II2 B;  3ISB A;  4ED7 A;  5BMH A;  5AM2 A;  1ZQX A;  3PX0 A;  2PTL A;  4ZRI A;  2B6G A;  1KKX A;  4BDP A;  3TAR A;  4R3D A;  1XO1 A;  1P7D A;  1ZQR A;  3P4Q B;  1YOV B;  3PV1 A;  3HVZ A;  2V4Q A;  4PK1 A;  3AMZ A;  1CEZ A;  4GOC A;  5DGB A;  3EPG A;  2ASD A;  2W9C B;  1EWY C;  1X1M A;  3QE9 Y;  4CRX A;  3AU5 A;  1V80 A;  3ZXV A;  2F44 A;  3PS6 A;  2DPJ A;  3VAW A;  5AKI A;  4W9E A;  4KGR A;  4IQW A;  4K4H A;  1P7E A;  1TKD A;  1ZUD 2;  1TZ1 A;  1S0N A;  4ICV A;  3ZXR A;  4RQ1 A;  2JEJ A;  3PV8 A;  1VCB A;  3RD2 A;  1LFD A;  4WJ3 B;  4K81 A;  3SEN A;  1I4Q A;  1WRD B;  2FIF A;  4QZA A;  4N59 A;  1JUD A;  3UIN B;  3DVG Y;  1ZQZ A;  2F3N A;  2CHW A;  4ICU A;  3PX6 A;  2F1I A;  2ON8 A;  4UB2 A;  2XK5 B;  5KT4 A;  5KG5 A;  2O6K A;  4KDI C;  4P1B C;  5G55 A;  3H9D A;  3QUC A;  1JWM D;  4DLE A;  5KFJ A;  1S97 A;  2UU7 A;  4M0A A;  1SGH A;  4HEA 1;  5DB6 A;  3M63 B;  4HDQ A;  4W9D A;  4TUR A;  3FIL A;  3TAN A;  4IQV A;  3JVZ X;  3U52 E;  5KG2 A;  1N63 A;  2HHX A;  1C77 A;  1EUV B;  3ZJV A;  2F1H A;  1RQN A;  3MP9 A;  5T8I A;  4I27 A;  2QB0 A;  2ZTC A;  1YZ6 A;  2EKE C;  1JQ4 A;  3WK4 A;  4Q44 A;  2R8K A;  3M3J A;  3RMK C;  5LXH A;  4NQK E;  3FM9 A;  5J2H A;  2LYA A;  2ZXI A;  2L83 A;  2QAR B;  4YD1 A;  1N48 A;  1WF9 A;  3SU8 X;  3GE3 C;  5DQG A;  2VRR B;  2L32 A;  9ICV A;  5ALR A;  1ZQO A;  1HE8 A;  2WQY B;  3B9J A;  1ZQI A;  1Z00 B;  1TK0 A;  4DFJ A;  4MEL A;  5AKZ A;  2L52 A;  3MC9 A;  2NYV A;  1U49 A;  2F2A B;  3DHG C;  2W9C A;  4NLK A;  3OJS A;  3O65 B;  2MBH A;  2HMX A;  4FE3 A;  1XQQ A;  4A9A A;  2MSN A;  2IA6 A;  3I9V 1;  4RU9 A;  3PST A;  2M17 A;  1V6E A;  4C8N A;  3RNE C;  2KP7 A;  5J2F A;  4MGZ E;  1L7Y A;  4W9J A;  3DDH A;  4TUS A;  1L4D B;  2Y9T A;  3V6K A;  1N62 A;  3AE5 B;  4KLJ A;  4MSM B;  4DHZ E;  3RNG C;  1UBQ A;  2RDI A;  4RPX A;  5KT6 A;  1SL0 A;  1A76 A;  3L17 A;  4ZRJ A;  2V9H A;  5J0Y A;  3SQI A;  5AM1 A;  3C8Y A;  3U8Z A;  1SZH A;  2VZK B;  1YN4 A;  2JXT A;  2RRD A;  3PHX B;  2X38 A;  4DSE A;  4NJ6 A;  3Q3J A;  4JLC A;  2PI5 A;  3JPT A;  2LPE A;  4MM3 B;  8ICR A;  3RI7 C;  2G45 B;  4UAS A;  2IBI B;  4BZA A;  2XK5 A;  8ICY A;  1RRB A;  4M2Y A;  4KLG A;  1WR1 A;  2JZB A;  2H88 B;  4IG7 B;  3RNA C;  3FYH A;  5J2R A;  8ICG A;  2R2O A;  5AI5 A;  1QOF A;  5E79 U;  2OXO A;  5KG6 A;  1P98 A;  4DK5 A;  2WF5 A;  2SEB D;  1NZP A;  1GC6 A;  4EEL A;  5AIC A;  1O03 A;  2WXG A;  9ICH A;  2ZNV B;  3EEC A;  4G50 A;  1JRP A;  3WKA A;  4ELV A;  4B9N A;  3KZI U;  3RR7 A;  1BML C;  4M8M A;  1V97 A;  1QQ6 A;  1LXD A;  3SDL C;  2QAR A;  2BGW A;  2MEK A;  2Q4T A;  1RZT A;  2G5I B;  2VAN A;  1Z1V A;  3KZX A;  5GTI U;  1Q0W B;  2ZUB A;  5CWR A;  1BNP A;  2KDB A;  4F91 B;  3K75 D;  1ZJM A;  4B0M A;  1Z00 A;  1DK3 A;  3PSP A;  2IMW P;  4C7Z A;  3I63 C;  1AAR A;  2DZI A;  1ZQA A;  5GTH U;  2HI0 A;  1V9P A;  4YT0 B;  3I76 A;  1NBF C;  2PKE A;  2KDF B;  2ZIU B;  2DFL A;  5J2E A;  1X6J A;  2NO5 A;  3C1Y A;  2LKY A;  1XT9 B;  3M9N B;  3R2I A;  2GH1 A;  1J7C A;  3MFI A;  3TBL D;  3QIJ A;  5IIN A;  1HEK A;  2OM6 A;  4M0W A;  1VLB A;  1F77 A;  4EYI B;  3P4S B;  2K1F A;  4M6W A;  1QCK A;  4UQG A;  3Q8B A;  3GIJ A;  5III A;  2PMV A;  2ZVN A;  5KFF A;  1WJU A;  3RT3 B;  1CI4 A;  1F52 A;  2KIV A;  2QEJ C;  5DBC A;  5IIM A;  1TS5 A;  2UYZ B;  4M00 A;  4JV1 A;  3A9J A;  3DBH I;  4AWJ A;  2KZ3 A;  2IO1 B;  3DPD A;  4NLC A;  4R64 A;  2RMM A;  4TQ1 A;  2JF5 A;  4ARI A;  1C7Y A;  2VH2 A;  3AQF A;  1OGW A;  4TMA B;  3VTW A;  5J8Y C;  4AJY B;  2KKV A;  2WXJ A;  2DYB A;  3NUH B;  1T3Q A;  2ES6 A;  1U48 A;  3H7P A;  3W9C B;  2KZM A;  1C3T A;  1U47 A;  1RYS A;  3RYT A;  2BYV E;  4Y2X A;  3ORY A;  2NRV A;  1WXV A;  1ZQ1 C;  2KJR A;  4I2G A;  1L0Y B;  2DYM A;  1PK1 A;  2MSE D;  4YTM B;  2NCN A;  3SMV A;  1WXQ A;  4Z6F A;  2QSD A;  2HHS A;  5BYS A;  3C2L A;  1ZOL A;  3B0X A;  2BWE S;  2INP E;  3MC8 A;  9ICL A;  2KX0 A;  4UAZ A;  1FPY A;  2PFQ A;  4Q2J A;  1WCL A;  1H38 A;  4NJ7 A;  1DYQ A;  2OH2 A;  4S17 A;  3QK0 A;  2KVS A;  4LNI A;  3A33 B;  1QSY A;  4F8R A;  3QU2 A;  1MHX A;  3D6J A;  1ZET A;  1KM7 A;  4B6W A;  2A3V A;  2H3I A;  3H0L B;  2ACZ B;  4QZD A;  4GDK B;  7ICN A;  2C5L C;  1ZQH A;  2MBQ A;  2FID A;  3IT6 B;  1QQR A;  3ZRF A;  2ZIU A;  2KTR B;  2KQ4 X;  5EWG A;  5TZV A;  2KJH B;  3MHS D;  1U45 A;  2BCU A;  4H2A A;  2W9N A;  3AL0 B;  2W54 A;  1SEB D;  4ED2 A;  2HCF A;  3TEY A;  5IIO A;  2ZTE A;  1XEE A;  1JRU A;  1VRA B;  4O5C A;  3EWA A;  4QZC A;  4DFK A;  1TV9 A;  3TAD C;  2BPF A;  2JUO A;  3SFD B;  5IN7 A;  1XS9 D;  2LRU A;  1L3S A;  5J0O A;  8ICK A;  4OD0 A;  2FE9 A;  1V38 A;  4F4X A;  1ZDX A;  4F5N A;  1KFY B;  2MRP A;  1Q46 A;  1OXJ A;  3SEI A;  3VDZ A;  1I4H A;  5BMG A;  2L8J A;  5AKG A;  1C76 A;  4O3R A;  8ICM A;  3UIP B;  1X6I A;  3LK9 A;  1I4R A;  1C78 A;  4EZ6 A;  2Y0S F;  3QZ8 A;  2ZPN A;  3Q69 A;  4I2I A;  3QXG A;  3Q2A C;  4WUR A;  2BPS A;  3T5J A;  4IL6 U;  2MJD A;  4K7W A;  2YB1 A;  4KIK B;  4PH5 A;  3ZIM A;  4PS7 A;  1XXG A;  3UMC A;  4ELT A;  5J0R A;  3VR8 B;  5H92 C;  1B1Z A;  2NMQ A;  1MA7 A;  4HYK A;  2MHJ A;  3MHZ A;  3BK1 A;  3PRP B;  4IW0 A;  2QIL A;  1NI3 A;  3BDP A;  1DXS A;  4QJF B;  3L08 A;  4EZL A;  1SIJ A;  3PZ7 A;  4X57 B;  1TS4 A;  5KFI A;  2FUG 1;  3QU4 A;  2XO7 A;  5DGA A;  3DWG C;  1LO5 D;  4GXK A;  2KHQ A;  4TUU A;  4DDI D;  2K0P A;  4EBE A;  1MFW A;  3KHG A;  1TFR A;  4K7U A;  5KHO A;  4LJO B;  3PW7 A;  2K6D B;  2JPH A;  3HPO A;  5HR7 A;  1WRI A;  1YX5 B;  1T0R C;  2JWU A;  2LHT A;  1KW4 A;  1FM0 D;  2WLB A;  3R7Q A;  3RJF A;  2N7D A;  5J0X A;  2I6X A;  2BS4 B;  2M4N A;  4UBB A;  2UVV A;  4NM2 A;  1KFD A;  3T3N A;  2KD1 A;  3QC8 B;  3AEB B;  2KZR A;  2G4D B;  2ZTD A;  3QX1 A;  4EYH B;  5DPW A;  2PXI A;  3H0R B;  4YVZ A;  1PGB A;  3HX0 A;  1N2X A;  4UW9 A;  1CK1 A;  1K51 A;  1KFS A;  4KGS A;  3RJI A;  4DOB A;  1A70 A;  5LLI A;  4S0R A;  3BVM A;  2CRX A;  1IV8 A;  4KZ0 A;  2W9B B;  1NOM A;  3KOO A;  3PO5 A;  1YN5 A;  1ZKH A;  2AQ3 B;  3WAO A;  1X9X A;  2E1F A;  5C5J A;  1ET6 A;  1UWM A;  2JRI B;  5KT3 A;  3NVY A;  5ALE A;  4NLN A;  3IRU A;  4F5Q A;  3M6K A;  2HHW A;  3RPF C;  4ELU A;  2CXY A;  5AM3 A;  3FKY A;  1L3V A;  3I5J C;  4RGN A;  8ICS A;  1FXT B;  3QJZ A;  2H89 B;  1NK7 A;  1PYW D;  2ZJ8 A;  2G9H D;  1V8C A;  4WH4 A;  2CJN A;  2KKP A;  4L2Y A;  5C2T B;  1L3T A;  2BHN A;  4DFD A;  3RN9 C;  3AI5 A;  4GDL A;  4R65 A;  2JXJ A;  2LXA A;  1J7B A;  4OJP A;  4IOI E;  5KG7 A;  3N4M B;  3RZF A;  2KT7 A;  3K1R B;  4GSW A;  4RNA A;  2PMZ F;  4ZHP A;  3APC A;  2HW3 A;  2N0S B;  4MH8 A;  3PZD A;  3KHR A;  4YD2 A;  3UF8 A;  1VZ6 A;  1VZ8 A;  2H3F A;  4M9H A;  3N9Y C;  5CHV C;  4FUL A;  4A8E A;  2BYT A;  5F9L A;  1KRP A;  4RQ6 A;  4LK0 M;  1PFD A;  1RYU A;  1SGG A;  4GMV A;  1KN5 A;  1T94 A;  3NGD A;  3BVG A;  1YJI A;  1BPX A;  1KTQ A;  1YQ3 B;  5H2F U;  2LI5 A;  3P2B A;  4HCP B;  4PS8 A;  5DDY A;  4EEK A;  4KSK C;  1ZQL A;  3RNF C;  4HWI B;  3H7I A;  3T79 A;  1SJE D;  5E6O A;  2KAN A;  1M6Y A;  1S77 D;  1LKY B;  2BQ3 A;  3BQ1 A;  4C8M A;  3VCB A;  5I4D A;  2N9L A;  4DWI A;  1EWC A;  2MUT B;  2XY6 A;  2VKQ A;  2FUH B;  1SKR A;  3BS7 A;  5H8Y E;  2IGD A;  3QU7 A;  4I2H A;  2GBN A;  3VTU A;  5J2D A;  2BF8 B;  4W9C A;  3R7R A;  1WZ0 A;  4TUQ A;  3GU3 A;  4UDU C;  2FLL A;  2ZCB A;  4R8U A;  4C4R A;  2BW2 A;  3KYC D;  4ICA A;  3ZD9 A;  4F4W A;  2NV3 A;  5CHG A;  1TGZ B;  3ZDM C;  2O6V B;  1KRH A;  2GLE A;  3QU5 A;  2XN9 C;  4J03 A;  3A0B U;  4KLH A;  2KX3 A;  3NTU A;  1FCC C;  2KC2 A;  3EGR A;  2IY0 B;  4UB1 A;  2GB1 A;  1SE4 A;  4AS1 A;  4KN7 A;  1TS2 A;  4YSZ B;  4A8X C;  1QQ7 A;  2D5G A;  2WXP A;  4B9K A;  1WFY A;  4NV0 A;  3PHW B;  1JWA D;  8ICZ A;  5ALJ A;  5KFY A;  4OHJ A;  5BOL A;  2ATL A;  1ZP0 B;  2KYW A;  4XC2 A;  8ICL A;  1NYR A;  2VA3 A;  2HTM E;  9ICI A;  1JCK B;  2DAF A;  2V3P A;  1TTN A;  1V1P A;  1A0P A;  1BPZ A;  2D07 B;  2DYO A;  5E6J A;  3WAN A;  1K1Q A;  4O5E A;  2LHE A;  2L5Y A;  3KKA C;  5J2K A;  1E8Y A;  3PSI A;  2B21 A;  4C80 A;  3RFA A;  1XU4 A;  1GOZ A;  2UVU A;  3IBE A;  3NAS A;  3HIZ A;  1B9R A;  4BXO B;  3N3K B;  5KFA A;  5KFZ A;  3HT3 A;  3KH0 A;  3Q8L A;  4QZF A;  5FP0 A;  5KFV A;  1UA0 A;  1MVK A;  2YTU A;  4JQW C;  1SE2 A;  4OZB A;  2HBJ A;  1IYF A;  4Y2S A;  3PW2 A;  2ASJ A;  3V7K A;  1NDD A;  1D5M C;  4ZYN A;  3IN5 A;  1BUI C;  2FPL A;  4MEX A;  4M47 A;  5KFQ A;  1NZB A;  1MG8 A;  2PKO A;  3DBR I;  3LJ3 A;  1WE7 A;  1XLN A;  3F2D A;  3UPQ A;  3UIO B;  4NWI A;  5AIB A;  2IY1 B;  2N9K A;  3ML8 A;  4FA6 A;  2V4L A;  7ICF A;  1HTO A;  2YN4 A;  3C28 A;  1ZYQ A;  3RJJ A;  4FHJ A;  4MAC A;  7ICO A;  2L1A A;  4KGT A;  1SZP A;  4LTU A;  2FNJ B;  5KG0 A;  1KLN A;  2BS2 B;  4LNN A;  2PLP A;  2J6T A;  1RFA A;  4E3C A;  2JVC A;  9ICX A;  4E71 A;  2WB1 F;  2QHO A;  2UWQ A;  1SV4 A;  2IOF A;  1TK5 A;  2C7M B;  3JPS A;  3NUQ A;  3OG5 A;  5HHI A;  2WHI A;  3PW0 A;  4KLD A;  7ICG A;  4TV3 A;  1V9J A;  3SV3 A;  1TIF A;  1BXT A;  2K22 A;  3B2F A;  3OLM D;  5JTI A;  2MP2 A;  2CPR A;  3RJK A;  5AUI A;  1N60 A;  2DNF A;  4QIW C;  5L1I A;  3HW8 A;  2INC C;  1IP9 A;  4M04 A;  2YMQ A;  2M9N A;  2HBM A;  4KMU A;  3M1Y A;  2M1M A;  5AI8 A;  2EH9 A;  4C8K A;  3DBL I;  4KN4 A;  4PL2 A;  2CR5 A;  2CJO A;  2N1V A;  4BGD A;  4RQ4 A;  4IWQ A;  2INN E;  1ZRM A;  2K4H A;  2N9P C;  2V3N A;  3JPQ A;  4OVU A;  5AK4 A;  2KQS A;  1ZQM A;  5J0Q A;  3HKZ C;  3GFK B;  5F9N A;  3GIM A;  4PL1 A;  4NL9 C;  3MGI A;  4PHA A;  3NRW A;  2LUE A;  2LVQ A;  4NJC A;  5KFS A;  3TJP A;  4QNL A;  2YB4 A;  2K25 A;  2WXR A;  1N61 A;  2HHQ A;  3NJT A;  4P6V F;  4URK A;  4OJ5 A;  2XY7 A;  2R8G A;  3AEC B;  2FE8 A;  3QU9 A;  3LVV A;  1GAQ B;  3PGE A;  2EAM A;  1L0X B;  4F5O A;  1V49 A;  4IC7 B;  4XDC A;  1ZW7 A;  4FZL A;  2E8P A;  2SAK A;  5KFD A;  2HHV A;  3KYD D;  3BVZ A;  3NZU A;  1ZE3 D;  3M95 A;  1KFT A;  2W9A A;  3FDS A;  4FZM A;  4Q8E A;  2K6Q A;  3AM9 A;  3AE3 B;  1SL2 A;  2BKE A;  2LUM A;  1UHU A;  1N5W A;  2FCS A;  5G5H A;  2KJ8 A;  9ICA A;  2BPC A;  2M0A A;  4Z6E A;  4DSJ A;  4GC7 A;  2KSO A;  5ALD A;  5CP2 A;  1T0Q C;  3CNH A;  4XUS A;  3ZDD A;  5KFK A;  4HDO A;  2QIE B;  4TSS A;  3WKC A;  4KLU A;  3H8S A;  5ALY A;  1OQY A;  3AE9 B;  3FIL B;  4DHZ B;  7ICR A;  2MCN B;  2L05 A;  2JRZ A;  2FDR A;  2ZIX A;  5EE1 A;  4JUZ A;  3L5K A;  5ALT A;  3PZP A;  3IP4 B;  1ZQJ A;  4DQS A;  3IAM 1;  1ZQV A;  4QWA A;  2XEW A;  1UGM A;  3L4P A;  5CB1 A;  1KEJ A;  2VJ5 A;  5T14 A;  3ZDA A;  4JK1 A;  4DEZ A;  5J0T A;  1QH9 A;  2XID A;  4ZRQ A;  2RDH A;  4BJQ A;  3PML A;  1QT9 A;  8ICX A;  1NKE A;  2BGF A;  2KO3 A;  1QLB B;  4BOZ B;  2EZY A;  1B4F A;  2GOL A;  3H7S A;  3V60 A;  1XSN A;  5B66 U;  4M9G A;  5D6J B;  1URJ A;  2MA1 A;  5IAA C;  1MSW D;  4Z6D A;  1YX6 B;  4PHD A;  2J52 A;  1SWW A;  2FI1 A;  4CF4 A;  5LNK 1;  3BY4 B;  4JX1 C;  2N7J A;  3ZNH B;  4DL3 A;  4DHJ D;  2BS3 B;  3T3O A;  4ACF A;  2C28 A;  5L95 C;  3ZDE A;  4I2J A;  2WDQ B;  4O9M A;  1ZXH A;  3ZUN A;  1GB4 A;  1L3U A;  1XD3 B;  4FJZ A;  4LJX A;  3EUB 2;  3DHI C;  2PIA A;  1QSS A;  3PR5 B;  2KWV B;  5DBB A;  4WIP A;  4F93 B;  2KTQ A;  4I6P A;  4KLO A;  1NEN B;  3RBE A;  2PE6 B;  1IIP A;  4I29 A;  2DEN B;  3IHP C;  3ML9 A;  2W55 A;  3QEB Z;  3NVV A;  3WK8 A;  2J4X A;  2KJ5 A;  3WKE A;  4QZE A;  4EEN A;  2PW9 A;  1BNO A;  2JZB B;  1ZGU B;  1AN8 A;  1DOI A;  8ICP A;  5D94 A;  4HK2 A;  2PFN A;  3HM3 A;  2ONQ A;  4UB4 A;  5IKC M;  2R18 A;  4P4P A;  5F3X B;  4NLG A;  1R4N I;  4RQ8 A;  2F76 X;  5ALW A;  4ECR A;  1LVH A;  4L1B A;  1WGD A;  4UB5 A;  1S76 D;  3HUI A;  2G5H B;  4FAD A;  1ZQW A;  2BZF A;  2AH5 A;  5IA7 A;  4JMU A;  4F92 B;  3L3F X;  1XLQ A;  5BO4 B;  3M8R A;  4PGQ A;  1QOA A;  4K1R B;  2NVU I;  5BMI A;  3C2M A;  4LCD E;  1HZ6 A;  1N6Z A;  2DBY A;  3QZ7 A;  1E8Z A;  3DBR B;  1TT5 B;  4B9L A;  3I57 A;  1SE9 A;  1ZQT A;  3GV8 B;  3DOW A;  1WWT A;  2F77 X;  4J9K A;  4DSL A;  1ZD4 A;  2VIX A;  3GII A;  2D3G A;  3LDZ E;  3L0W B;  2ZEQ A;  3H8H A;  1XWL A;  4MEY A;  3GV7 B;  3EFC A;  2AQ0 A;  2UVR A;  4XE0 A;  3T3F A;  3MJ5 A;  4KKI A;  2N7E A;  3N7S C;  1ZQQ A;  1UT5 A;  5KAF U;  2IOF K;  4BWM A;  2G06 A;  1JWU D;  1F44 A;  2JQR B;  3PW5 A;  4M0W B;  4ZYS A;  4AYB C;  4M6W B;  2KFZ A;  7ICH A;  3ZDC A;  1ROE A;  2X8X X;  4RT2 A;  4QWC A;  2KG5 A;  2AXT U;  2MA9 B;  4ECS A;  2IGH A;  4WAA A;  5BOM A;  3WK6 A;  3A9J B;  3EW9 A;  2L0F A;  4ACO A;  8ICA A;  4M9L A;  1Y8R C;  2ZXH A;  3JPR A;  4F71 A;  2WXI A;  3F53 A;  4KTQ A;  1KF6 B;  2RHF A;  2DX5 B;  2RGF A;  5D49 A;  1RPL A;  4TKN A;  3N1X C;  1RXW A;  3TEZ A;  1L8O A;  5KFT A;  3BIN A;  1KQQ A;  3CMM B;  3LWM A;  3NS8 A;  4M8N A;  2Y5C A;  3AED B;  1Q1O A;  4EX6 A;  2HTH A;  4CHK A;  2BCQ A;  3H7P B;  3DBL B;  1SKS A;  1RG6 A;  3H1U A;  3PO0 A;  4DL4 A;  3W2D A;  5J0W A;  2F8K A;  2YX8 A;  4YWG G;  1WG8 A;  5ALS A;  2LMC A;  4KLL A;  5AI9 A;  5DPT A;  5KFO A;  5L1K A;  4PYU A;  3ZTC A;  1PK1 B;  3CSF A;  4DFM A;  2PFO A;  4MDK E;  3H8J A;  3P1M A;  4GN1 A;  4NZL B;  2D6F C;  1WIA A;  2CU3 A;  1DGJ A;  1MQ3 A;  4RF1 A;  3VH3 B;  1C9F A;  2RDB C;  3ZNG C;  3TFS A;  4F2R A;  4WWO A;  1PVQ A;  4A55 A;  4CE6 A;  3CST A;  3RB0 A;  2AU0 A;  2Q0Z X;  3EZ5 A;  4JE3 B;  4P4O A;  1AWD A;  2IHM A;  3QYP A;  4QW8 A;  1SL1 A;  3RR8 A;  2L00 B;  2XC9 A;  4NAW A;  4XZ4 A;  3L16 A;  2EZX A;  4C8L A;  4KX6 B;  4RM9 A;  4ECQ A;  2KVZ A;  4XYC A;  1A5R A;  3ALB A;  2LGX A;  1WGH A;  1ZQB A;  3U26 A;  2LAS A;  4Q43 A;  4MH0 E;  3WIM A;  3UMG A;  2KK0 A;  5AKY A;  5DKW A;  4ED0 A;  1E9M A;  3ETR A;  1L6U A;  4EUT A;  2NTS A;  1UCV A;  2LBO A;  1ZQD A;  1HQR D;  2JZ3 B;  3VVW B;  3S6J A;  3MC0 B;  3A4R A;  2D3A A;  1X9W A;  3SAH A;  3N32 A;  2YQE A;  4RCO A;  3ZW3 A;  1CQV A;  4J9O A;  1EU4 A;  1TYG B;  3MGV A;  5KT2 A;  3QHT A;  3X23 A;  1D6E C;  1L7O A;  1RXV A;  2AQ1 B;  1NK4 A;  4RMA A;  2BR0 A;  5D3I B;  3E2E A;  1JX4 A;  2WYQ A;  3SAF A;  4CO7 A;  1UF0 A;  3UXO A;  2DZM A;  4DQI A;  2HE7 A;  2EDU A;  2YMP A;  2LJI A;  1M4V A;  1F5S A;  3OHB A;  2E3T A;  5AI0 A;  2AJQ A;  4ZRP A;  2HBL A;  2LM4 A;  3SR6 A;  1SV0 C;  2I38 A;  2IDY A;  1TE2 A;  3ZVV A;  1WR6 E;  3T5H A;  1F2R C;  2KKC A;  1E8W A;  3RH5 A;  2A1J B;  4M9J A;  4XDD A;  2JEG A;  1UZX B;  2FMS A;  2AQ4 A;  4F3O A;  2BWF A;  5EE0 A;  1D5Z C;  3THV A;  2QJL A;  4W9K A;  3W1S A;  4J9S A;  3R9K A;  1WGG A;  1Z5S B;  1NJY A;  4E0D A;  1WJ6 A;  4CF5 A;  4B9U A;  2KVR A;  2ZIW B;  5CTR C;  5HHH A;  5BPC A;  2KFN A;  1VD2 A;  2NBV B;  2D3B A;  4BKG A;  4MFA A;  4WJP A;  5AKX A;  1PZN A;  5HML A;  1L5U A;  1L2N A;  5HHD G;  1P3Q U;  1WE6 A;  3EPI A;  1GJZ A;  3PO4 A;  4Y2P A;  4F7Z A;  2IO0 B;  4KVG B;  8ICC A;  2LYH A;  2PEA A;  2KN5 A;  2Z59 B;  2WAQ F;  5KG3 A;  3DVG X;  1V81 A;  2QLT A;  2ZJA A;  2OHF A;  4I28 A;  1X9S A;  3EFU A;  3T5L A;  2M56 B;  4JWN A;  4ZHO A;  3KD3 A;  1ZD5 A;  2FLP A;  4US9 A;  1D5X C;  4E74 A;  1ZRN A;  2DQN B;  4UAV A;  4IS7 A;  1SWV A;  4Y2J A;  4ED8 A;  2NPT A;  4WJQ A;  4UB8 U;  2C7H A;  1E6E B;  2LGI A;  1Y56 A;  3H6N A;  4ECZ A;  2Q5W D;  3ZYY X;  4IRD A;  2K3U A;  5JHB A;  1ET9 A;  2GLS A;  1EF1 A;  4Z6C A;  1SKW A;  2N9X A;  2Y9U A;  2LGY A;  1R4N B;  4FLH A;  4EBC A;  2HJ1 A;  4B0E A;  2KIC A;  5BYR A;  3BQ2 A;  4LZG A;  2IZV B;  1RDF A;  4OJ6 A;  1DOX A;  2Y5B B;  3GZF A;  2DWQ A;  4HRO A;  1ECW A;  3HM6 X;  4HRS A;  2B76 B;  4DDG D;  1UPH A;  2G07 A;  3Q8S B;  4G9B A;  1TZO A;  2A1J A;  1UNS A;  2KHW B;  2PJH A;  3I3T B;  5DCN A;  2KD0 A;  3OJ4 B;  2MRL A;  1TKY A;  1YZ7 A;  2HDE A;  2VH1 A;  3RCZ A;  4AP9 A;  1TK8 A;  3NY5 A;  1Q3U A;  1GNU A;  1XCT L;  4P0Q B;  2IOH A;  2BVC A;  4GDL B;  4BWJ A;  1ZD3 A;  4LVS A;  2MX2 A;  1WXA A;  4RQ7 A;  2ZIW A;  3Q8A A;  4I6N B;  3I28 A;  4MGI E;  1GB1 A;  7ICS A;  4Q8F A;  1ISN A;  2G3Q B;  5CHF A;  5DLG A;  2IO3 B;  3RH6 A;  5J2I A;  2I1J A;  4JPS A;  2AGP A;  2L3Z A;  1J0G A;  2V0G A;  1B0X A;  2YEP B;  4UB6 U;  3H4D A;  1XSL A;  4JIO U;  5DB8 A;  3MFG A;  2WHE A;  1HZ5 A;  1Z2M A;  1J2N A;  4ZOH C;  1FRD A;  2EAN A;  3ZDT A;  2WXL A;  3N7R C;  4MJS A;  1MPE A;  2CHX A;  4F4Y A;  3SD7 A;  2J53 A;  5E6N A;  4XA5 A;  4C7Y A;  1UWX A;  2FCQ A;  2H3V A;  1LM8 B;  4QZ8 A;  2JGA A;  1J97 A;  2C2E A;  1RWS A;  2LVP A;  4DF4 A;  3ZDB A;  1WUD A;  5AM4 A;  1QIL A;  3O13 A;  2MBO A;  2D2Q A;  2NS5 A;  5J2J A;  1IBX A;  4GXJ A;  3IDW A;  5AM0 A;  1IXR A;  2XGQ A;  4KIT B;  4IRK A;  5FR6 A;  2ISO A;  4RM8 A;  4RZR A;  1KJT A;  2Y1I A;  2BQU A;  2YEP F;  3BYT B;  1LV5 A;  1ENF A;  2ZJD A;  1V5O A;  3BS5 A;  2A4Z A;  1QF6 A;  4M9N A;  3UXN A;  1UGJ A;  3AEA B;  4RQ0 A;  1N56 A;  1DGS A;  4R8U B;  4HLE A;  1RM6 C;  5DQH A;  2JYE A;  3T8M A;  1PUT A;  2WWZ A;  1ESF A;  2G08 A;  3C19 A;  1QOB A;  9ICE A;  2JR5 A;  4CF3 A;  5J2G A;  4C0Z A;  4O1N A;  4GFJ A;  2C2R A;  2HHT A;  4P0Q A;  1C79 A;  3QAR A;  2Y1J A;  3QEA Z;  3LYY A;  3RNB C;  3WAM A;  1C20 A;  9ICM A;  3N7P D;  1E90 A;  3GZN I;  2DUY A;  1V2Y A;  2OOB B;  2J6S A;  5L9X A;  5D46 A;  3R3M A;  4REZ A;  3K9O B;  1D9F A;  3MR3 A;  3AH7 A;  3KFU F;  1Z1B A;  2WXM A;  3ONN A;  2WF8 A;  4OVV A;  2TSS A;  1V1P B;  4PZN A;  2W9M A;  1FXI A;  2ASL A;  2GI9 A;  3PRZ A;  1WGR A;  4FJY A;  1DOY A;  3TKA A;  1WSP A;  3P4R B;  3L13 A;  2D3D A;  2ZUD A;  4RNN A;  5ALX A;  3DBH B;  3N30 A;  3ZNI D;  3KHL A;  1RFK A;  7ICK A;  4I2D A;  5IO9 A;  3GV5 B;  4WWM A;  3RAX A;  4O0I A;  4BKS D;  4BKS A;  1J8C A;  5KHQ A;  1ZQS A;  5HMM A;  3CP8 A;  1GPX A;  1CRX A;  5L83 A;  2BCR A;  2KMM A;  4YL8 A;  1ZQY A;  2W7P A;  1SSN A;  2BB5 A;  1MHH E;  2RPQ A;  1RAX A;  2DLB A;  2KJ6 A;  2MH7 A;  4CYE A;  2RD0 A;  8ICV A;  2OCE A;  5AZF A;  5HG2 A;  1TAM A;  4B9T A;  1WGY A;  4RGO S;  4C4S A;  1C4P A;  5FKA C;  1MG4 A;  4YXD B;  4IKG A;  4DQQ A;  4PGX A;  2BB6 A;  2XGP A;  5IIL A;  3PX4 A;  1EO6 A;  1U4A A;  4RQM A;  1BPY A;  4BX9 C;  1BGX T;  3HJE A;  2FMP A;  1VZ7 A;  3OSP A;  3BQ7 A;  1JRO A;  3H40 A;  5KFB A;  3OAW A;  5JUM A;  3JPO A;  1FEH A;  3Q3F A;  3PTF C;  4P1C C;  4L23 A;  7ICQ A;  3ZO5 B;  1XO0 A;  4KKJ A;  1IGD A;  2RQ5 A;  9ICK A;  2AHO B;  2BKF A;  1FNW A;  3WK5 A;  1NNL A;  1LQB A;  3KUD B;  3AU2 A;  3AU6 A;  4DSI A;  4FHK A;  4KLI A;  3V7L A;  5ALQ A;  5TR5 A;  4RH6 A;  1ZOY B;  1WX9 A;  3GB1 A;  1RYR A;  2I1Q A;  8ICU A;  4NXZ A;  4FZN A;  2KVC A;  3PMN A;  2BDU A;  4R63 A;  2MP2 B;  1P7F A;  1RLF A;  2AGQ A;  2KTF A;  2I2Y A;  3KUZ A;  5KL8 B;  4EOY A;  2KWD A;  1R4M I;  2V4I B;  4F2S A;  3GS2 A;  4UAW A;  4AQ7 A;  4GIV A;  3JPN A;  1XNS A;  4XWW A;  1KOT A;  1FMA D;  1M94 A;  4DL2 A;  2B3A A;  2WGS A;  4USA A;  5CEH A;  4DQP A;  4QWD A;  3OHA A;  2MW5 A;  4BKT A;  2ALZ A;  2K8C B;  3AE4 B;  4MSQ B;  4BBN F;  1B22 A;  4CDG A;  4PS3 A;  2A1A A;  3NVW A;  2O2V B;  4UAR A;  1V5T A;  3TAC B;  1ZQE A;  4YXJ A;  2J6U A;  2GWS A;  3Q8K A;  4I6L B;  1IM4 A;  1K8R B;  2K9X A;  1EXN A;  3G6X A;  3KVF B;  2RDJ A;  3KWL A;  5DPR A;  2BYE A;  3X0W A;  2K8A A;  3QWZ B;  3HK0 A;  4IQT A;  2QKQ A;  3DV9 A;  2RSU A;  1S8O A;  3H0M B;  4QWB A;  2BQR A;  8ICF A;  2LXC A;  2Y5P A;  1U9L A;  5JRT A;  3SZ2 A;  1TBE A;  1E7P B;  7ICJ A;  5J8Y A;  5G5G A;  2LGD A;  4RPZ A;  4UAY A;  1ED1 A;  3IVF A;  1GC7 A;  1D3Z A;  3DQV A;  5TSS A;  4TQR A;  4F50 A;  1HEZ E;  5J2A A;  4QW9 A;  2JT4 B;  1STE A;  1WX8 A;  3KWV A;  4DOA A;  3RJG A;  1PQS A;  1UD7 A;  1ZQN A;  3ED5 A;  2HD5 B;  2KFK B;  5J2B A;  4ANX A;  4HPM B;  3QAQ A;  5EOZ A;  3LVW A;  1QTM A;  2OWO A;  4YFK A;  4Y2U A;  2W04 A;  3F2C A;  4IRC A;  1K1S A;  5ALH A;  2AEH A;  3IXS A;  5HKH A;  1X42 A;  3ALR A;  1KTK A;  2KZZ A;  5DPS A;  4ZDV A;  4ECV A;  2WX1 A;  2JHD A;  5HP4 A;  1S9F A;  2I5H A;  4J9R A;  4N9F 4;  1SXT A;  3MDC A;  2P6R A;  4O3M A;  9ICF A;  1ZXI A;  2AWT A;  3BZK A;  2KSO B;  5AI6 A;  2AL6 A;  4BVU C;  2AX5 A;  2ICI A;  2LHD A;  1UH6 A;  2XY5 A;  4DWF A;  1T8E A;  1EM7 A;  2N9E B;  2K4I A;  2MJE A;  3N1Y C;  3KUC B;  3E9S A;  4Y2Q A;  2H3Q A;  3QNM A;  2ZIX B;  4DQO C;  2PFP A;  7ICV A;  2PVG C;  4DL5 A;  7ICE A;  2KOB A;  1A6S A;  3TUO A;  1XO3 A;  2K8C A;  1X2I A;  2K8H A;  4EKU A;  1ARO P;  2LZ6 A;  3PPA A;  5HNK A;  1I4P A;  2O2V A;  3TAD A;  2G0A A;  3U7D A;  3M9O B;  2ZNV C;  3WCQ A;  3I1Y A;  5KAI U;  1L6V A;  3JSV A;  1F0Z A;  1FD6 A;  4IR9 A;  4IR1 A;  5KFX A;  1L7M A;  8ICJ A;  3U4E G;  3O0F A;  2LJ5 A;  4YSY B;  5AKL A;  2FBW B;  2ZIV B;  4B9V A;  2EAO A;  5KFP A;  1I4X A;  4RNM A;  3AEF B;  4DHJ B;  3IG3 A;  2K8B B;  5L1L A;  2ZJ5 A;  3TI0 A;  2BDP A;  1CZP A;  3K9P B;  2JH7 A;  1BPE A;  1AW7 A;  4XGA B;  4LNO A;  1TS3 A;  3AE7 B;  3QA8 A;  2H3Z A;  1XC9 A;  2KFK A;  2EMS A;  4U6P A;  3HHM A;  3GZN B;  4IDI A;  1EF5 A;  3PLV A;  2EMT A;  1T7P A;  3JW0 X;  1QKZ A;  2WDV B;  5JHA A;  1C4C A;  4C8O A;  2HOF A;  1TVA A;  4PHE A;  2IHN A;  3OTQ A;  4DFP A;  2V3S A;  1UUP A;  2WF7 A;  9ICP A;  3C29 A;  2BCV A;  4M01 A;  3N20 C;  2KC1 A;  2WDT B;  2NRZ A;  1L7N A;  5ALL A;  1E8X A;  2G1E A;  4Y2R A;  4Y2Y A;  4HXD A;  1NK5 A;  4F8C B;  3MAB A;  2ZG6 A;  4J9N A;  1L7P A;  4DOC A;  1FNV A;  1FRR A;  3AEV A;  4KDL B;  1BPD A;  5BYQ A;  5AI4 A;  1BT0 A;  3WKB A;  2E6X A;  1PK3 A;  2JSV X;  2Z0E B;  1D9D A;  4DXF A;  2QB1 A;  4Y2T A;  2PVO D;  1JI7 A;  3UXP A;  1JWS D;  3Q8F A;  5CHW A;  5ALF A;  3Q8Q B;  3MJW A;  1JML A;  2KQ7 A;  2DZJ A;  5ALV A;  3TL5 A;  2RP5 A;  2M8S A;  2FCM A;  2LEK A;  1OQR A;  2W3S A;  5EE3 A;  5KFN A;  1I35 A;  5AZH A;  1CJE A;  5AK3 A;  1F9J A;  3V62 A;  1T4G A;  1ZPS A;  5JH5 C;  4XQ8 A;  4KLQ A;  1Q8K A;  2HOI A;  3P4P B;  9ICS A;  1SF0 A;  4X5V A;  5AM5 A;  5IIJ A;  3C1Z A;  3TFR A;  3NOB A;  4DL6 A;  4KLE A;  1NJW A;  2ZIV A;  2C9W B;  2E8M A;  3IAS 1;  3KQ4 A;  4DBG A;  4O3P A;  3C5F A;  2WNM A;  4YTP B;  8ICI A;  3ABV B;  2K8B A;  4JWS C;  5CA7 A;  1D8L A;  4C4V B;  1WYG A;  1E7V A;  5ALK A;  9ICO A;  3VRA B;  2Y0S C;  5DB7 A;  1SB3 C;  4B9M A;  2MBE A;  9ICQ A;  3HP6 A;  3RNC C;  3RBD A;  5J0S A;  1MN8 A;  9ICJ A;  3DBS A;  1N5X A;  4AJW A;  3UGB B;  3VFK A;  1TJE A;  2D10 A;  4HJK A;  3WU2 U;  3M7D A;  4GLS C;  1T0Y A;  4FBT A;  2EKI A;  1S0V A;  4HKQ A;  3RB3 A;  3QUB A;  1X66 A;  4ZRK A;  1R4M B;  5K4L A;  1NEK B;  4NY0 A;  3RRG A;  3BQT A;  3UI3 A;  3CIR B;  2JZP A;  4EX7 A;  2YMM A;  2NR2 A;  4JB3 A;  3TEW A;  3DEE A;  5ALI A;  1K50 A;  3M8S A;  3DDC B;  2JEI A;  2E8O A;  4P2H A;  1IPG A;  4DLG A;  2BKR B;  3VQI A;  4GIB A;  4F72 A;  4YR2 A;  3KHH A;  1FIQ A;  4J9P A;  1IUE A;  3BK2 A;  3M62 B;  4LLG M;  2KAJ A;  4ARC A;  2KV2 A;  3ICX A;  1YN3 A;  5KTQ A;  4YP3 A;  2C60 A;  1SBB B;  4QZG A;  2JMG A;  3SEB A;  3W5V B;  1HUO A;  4KX5 A;  4OZA A;  3RTV A;  5AHX A;  3WA0 A;  1IG6 A;  2WXQ A;  2WXN A;  2N1W A;  3AE6 B;  3VUW A;  3SD5 A;  4EEW A;  2J0J A;  2JX5 A;  3RRH A;  4PPX A;  1JXL A;  2GBJ A;  3AB5 A;  4PZO A;  1QQ5 A;  8ICH A;  4EE2 A;  4W9I A;  3WK9 A;  2W03 A;  4NAW B;  2KDI A;  1XLP A;  2XNA C;  4WQO B;  2NRX A;  2K5P A;  1ZJN A;  2W7O A;  4I2A A;  5D3D A;  3OGU A;  5ALU A;  4QZ9 A;  1MQ2 A;  3PRM B;  2JRH A;  3NHE B;  5J2C A;  4GU2 A;  2XCA A;  2J0K A;  3MR5 A;  4K4G A;  4DF8 A;  5ALZ A;  4C4V A;  3RJH A;  2DPI A;  4BFR A;  3Q3M C;  1MC8 A;  1WWU A;  3IM1 A;  1KLU D;  2NO4 A;  4EZK A;  2BYF A;  2OYY A;  3PSE B;  3ENE A;  4UAU A;  5AK5 A;  3N97 B;  1T5X D;  3V6C B;  4US8 A;  4JL9 A;  5C3J B;  2IGG A;  2HBK A;  3OPX A;  2DKX A;  2KNB A;  3T9L A;  1DRG A;  3UQ2 A;  2NBU A;  3H4B A;  3QCA A;  3ZTD A;  2PI4 A;  1P0R A;  5JXV A;  2FJ6 A;  4WQM A;  3HRD D;  1K5O A;  2DGZ A;  4P0P B;  2ASQ A;  3BWU D;  4I2B A;  4RNO A;  1QLN A;  7ICT A;  4YXM A;  5A0L A;  1ZQP A;  2JV3 A;  4I2E A;  4F4Z A;  3G6V A;  5KT7 A;  5ALN A;  1GO3 F;  3TAQ A;  3NS1 A;  2JU6 X;  2WP9 B;  3RH4 A;  4K7S A;  2XI9 A;  4W9F A;  1T0S C;  5KL1 B;  1DOQ A;  1S5L U;  2EZZ A;  1NK0 A;  3AU4 A;  1WXM A;  2PMZ C;  2JZZ A;  3KKA A;  7ICI A;  2AQ2 B;  1J7A A;  2V9W A;  2WXF A;  2W11 A;  7ICM A;  4GC6 A;  3PLU A;  2KEY A;  2UVW A;  4QZH A;  3NVZ A;  3OJ3 A;  2Z0D B;  1PUZ A;  4O3O A;  3Q8M A;  2IYD B;  3PR4 A;  4FS2 A;  1JN3 A;  3PW4 A;  2HHU A;  2KOX A;  1Y88 A;  1LB2 B;  2KN7 A;  1S1Q B;  2CU1 A;  2ZZP B;  3PVL A;  1UBI A;  3MFH A;  3QQ8 B;  3A9K B;  3RZW C;  1Z19 A;  2JYT A;  5AUK A;  1JW9 D;  2C2D A;  1V86 A;  3ISC A;  2HVH A;  1ZD2 P;  5DDM A;  3GQC A;  1T6B X;  3RUL A;  1BVS A;  5DLF A;  1L0V B;  2A19 A;  4OJL A;  4MGY E;  4QIW F;  4CNQ A;  1QZE A;  3NZS A;  3ONS A;  1PDX A;  3E56 A;  2VA8 A;  3CRX A;  1R7S A;  3B0Y A;  1DK2 A;  2J0M A;  1VJ5 A;  2NPT B;  4G3X B;  3QUT A;  2R8J A;  4HPP A;  3HIL A;  4F5P A;  3RAQ A;  2AYO B;  5KFL A;  5IOI A;  3WAP A;  2EQY A;  1O08 A;  3IHQ B;  4NLZ A;  3KBB A;  5CRX A;  2DZK A;  7ICU A;  1E5W A;  5AKK A;  5D7G A;  1RYJ A;  4LNK A;  1OFF A;  4HPL B;  3FC4 A;  4O5K A;  5AZG A;  4P0P A;  4RPY A;  3HKZ F;  1P9D U;  1G6J A;  5AKJ A;  1HTQ A;  1MI0 A;  2FMQ A;  4YN4 A;  4RQ2 A;  3BJY A;  2IPK D;  3U30 A;  4W9L A;  3MBY A;  1PGA A;  1L6N A;  3JYU A;  3PY8 A;  3NZ3 A;  4IM0 A;  5ALO A;  5J29 A;  2KWU B;  2VZK D;  3D2Q A;  4TQ0 A;  3APD A;  3AUO A;  1HJP A;  3UQB A;  3Q8P B;  4MM3 A;  2K4P A;  3P42 A;  4NAM A;  1KH0 A;  2RR9 A;  2BPG A;  4FXC A;  5CX3 A;  2GOW A;  4OJO A;  2P6U A;  4WAF A;  1VDV A;  3IV6 A;  3V3X A;  1CMX B;  4HVB A;  4O3S A;  4XX5 A;  2LD9 A;  2KNJ A;  5KFE A;  5ALM A;  1F2R I;  5KG1 A;  2E1E A;  1FEZ A;  2WF6 A;  1KLG D;  2LGS A;  3TIX A;  1YJJ A;  2XIC A;  3MC1 A;  3W1Y A;  3A9K A;  4A3P A;  4NL9 A;  5KFW A;  4XRH A;  2LYB A;  1TAQ A;  3AEG B;  2YVC A;  4GXB A;  4BBN C;  5C0Y A;  2MBB B;  5J17 A;  4EFO A;  3GP7 A;  1BPB A;  4DO9 A;  5B5E U;  4YMO A;  2JXX A;  3UM9 A;  3EC8 A;  1S10 A;  2JEF A;  2C7N B;  4WWP A;  3UQ0 A;  2CS4 A;  5D2M B;  9ICT A;  4MJS B;  4EZJ A;  4N6E B;  5KFC A;  4F5R A;  3V6J A;  4LJP B;  2GBK A;  2N4F A;  4DSF A;  2GBR A;  3P63 A;  3WAL A;  2J42 A;  1NKC A;  2VA2 A;  2KE7 A;  3IG5 A;  3IT4 B;  1IBX B;  3PZ8 A;  5C1Z A;  1JIH A;  1X9M A;  3UMB A;  4HKZ E;  3DVN U;  5EDS A;  8ICO A;  2GRI A;  2R2Q A;  2EAP A;  2ISP A;  1YQB A;  1AQ6 A;  3B08 A;  3SFE B;  3J81 j;  1X40 A;  1YMH E;  2KLC A;  2WTF A;  3RJE A;  2FPK A;  2YML A;  3C2K A;  4ITK A;  2WB1 C;  2G4S A;  1V1O A;  2LI6 A;  2WX0 A;  2RDG A;  4M02 A;  3BS5 B;  3AN1 A;  2W8L A;  2LWP A;  2OEH A;  3Q3N C;  4O3N A;  1WCN A;  5KT5 A;  2H5X A;  2F1J A;  3C5G A;  1NK9 A;  4B6J A;  2F8L A;  4IUM B;  1H4R A;  4Q45 A;  4KV2 A;  3ZJU A;  4UBC A;  2LFI A;  4Y2V A;  2BT6 A;  4KMO B;  3BII D;  2YLM A;  5AK6 A;  4JGH B;  4ZH4 A;  1QSL A;  1XLO A;  4PGY A;  3V6H A;  2ODG A;  5FK9 C;  2B0C A;  1K52 A;  1YT3 A;  1QOG A;  2G09 A;  1YJ1 A;  2LM1 A;  4DS5 A;  3E58 A;  4NM1 A;  4UB3 A;  3ISD A;  3VUY A;  4F1S A;  3B2G A;  1F1H A;  1TY2 A;  1ZQU A;  2W8K A;  1PVR A;  2CKH B;  3WK7 A;  5J18 A;  2P35 A;  3SV4 A;  4J9L A;  1IGC A;  2D11 A;  2XVT A;  2KWC A;  3M6Z A;  4A90 A;  2IJ0 A;  8ICN A;  4RQ3 A;  4IQU A;  4YG2 A;  2IND C;  3RB6 A;  1NI2 A;  5L1M A;  2LRW A;  1U4B A;  3R8B A;  2FCN A;  2NRW A;  3ZGZ A;  4ANW A;  5DG7 A;  4A6Q A;  2CHZ A;  4DQR A;  4NPN A;  1ZQG A;  5HR6 A;  1HIW A;  1K53 A;  2FLN A;  1XF5 L;  2GBM A;  1S0M A;  5KFG A;  4EEY A;  1XSP A;  3CF6 E;  4ED3 A;  1WY8 A;  2NTT A;  4FBU A;  2J7Q B;  2N1R A;  3BZD B;  4GDK A;  4W9H A;  4C4T A;  4FN2 A;  4DXA B;  3C23 A;  2KTR A;  1A77 A;  2BTE A;  4YSX B;  4MHV A;  3BQ0 A;  2KAC A;  1WI0 A;  3GIK A;  4C00 A;  3GDX A;  1NKB A;  3TMP B;  3IG8 A;  4G3I A;  3D32 A;  4AP4 C;  4KLS A;  5MPO A;  4ECW A;  2JH1 A;  1UA1 A;  4F4K A;  3SHQ A;  2AL3 A;  3Q14 C;  3TEX A;  3A1Q B;  3VH4 B;  4J6I A;  2ESE A;  5ALP A;  3TQ1 A;  4RUA A;  1E0Z A;  4QWE A;  2K89 A;  1WZ3 A;  4WJO A;  5JU5 A;  1E10 A;  4ECX A;  4KX3 A;  2WXK A;  1WWV A;  1Q3V A;  4K3C A;  3UQA A;  3F2B A;  4AYB F;  4TUP A;  4YR3 A;  3GE8 C;  1V85 A;  3U7Z A;  2L0T A;  2W43 A;  3C21 A;  4ED1 A;  4OW0 A;  4K4I A;  3J9C A;  2E5S A;  4ASW C;  5J0P A;  1PGX A;  3VTV A;  3AE1 B;  4KIK A;  4DSK A;  4XWT A;  1WX7 A;  1ACC A;  1J19 A;  2L7R A;  4LNF A;  1WM3 A;  2I1K A;  1GUA B;  4YR0 A;  3MR2 A;  1COK A;  2NRT A;  1GG3 A;  3MDA A;  1WMH B;  4NLB A;  2YY6 A;  3BYY B;  4I2C A;  2A5U A;  3CWI A;  2GO7 A;  1Q5W B;  1OQQ A;  3LDA A;  1NYQ A;  3PT2 B;  3VR9 B;  4RQ5 A;  5D4B A;  1P1A A;  2KN4 A;  1WYW B;  1J2M A;  2KHV A;  3JPP A;  4HAI A;  3LWL A;  2D3C A;  5ALG A;  1Z4N A;  1NJX A;  2QC8 A;  2V4R A;  4IWO A;  1I42 A;  4CCH A;  2HJ8 A;  1JXE A;  2V1Y A;  4OZC A;  4JV0 A;  3SAG A;  3ZQ4 A;  2P66 A;  3N28 A;  1HA5 A;  2MWS B;  2ZVO A;  2W82 A;  1NK6 A;  5AEK B;  1KBU A;  3BZC A;  2D8C A;  3MTN B;  4IC9 A;  1HXY D;  4B9S A;  1WXS A;  2KMA A;  7ICL A;  1CUK A;  3LB8 C;  4ANV A;  1YQ4 B;  3TCA A;  1JMS A;  4EZ9 A;  3KW5 B;  4NY8 A;  3V7J A;  2REX A;  3KTQ A;  3VUX A;  3RUI B;  3A1Q A;  2JWZ A;  4MGK E;  1SXE A;  3QUQ A;  5DB9 A;  2HDO A;  1JAL A;  4CQN A;  4PHP A;  2R8H A;  3V61 A;  4RFB A;  1MJD A;  3S2A A;  3K1Z A;  8ICW A;  1S3S G;  1F0M A;  2WU2 B;  5CR0 A;  4MT5 A;  3VRB B;  2C22 A;  4TQS A;  2ZPY A;  4IM3 A;  1Z4O A;  3T5K A;  2WU5 B;  2W9B A;  4FO6 A;  2FPM A;  4J9M A;  4JWU C;  1TAU A;  5GMV A;  3L54 A;  3NRZ A;  2CN1 A;  9ICR A;  3B0A A;  4A20 A;  5AIA A;  4DL7 A;  3E0F A;  4RQN A;  1LGR A;  1YIW A;  3IFW B;  3SYZ A;  2R61 A;  3PSF A;  1ZDV A;  3KLS X;  2LVO A;  4OVZ A;  1FFU A;  4MF2 A;  1WJ4 A;  3AXC A;  3DHH C;  3OWE B;  4KLT A;  2IO2 B;  3ZRC A;  1L5P A;  5KG4 A;  1JWB D;  5DBA A;  1WM2 A;  2L76 A;  1WMH A;  3Q6B A;  4DCC A;  4HJG E;  2RPV A;  3DVN V;  5HFY A;  5E6P A;  1UEL A;  3AV8 A;  5DG8 A;  4PYZ A;  3ZNZ B;  5LXI B;  3GOE A;  4KSL C;  2HVI A;  3Q8R B;  2KXJ A;  5L1J A;  9ICU A;  4HCN B;  1ZQC A;  2KMC A;  1EU3 A;  2DAJ A;  1D8Y A;  4QZB A;  4IM2 A;  2GMI C;  4NQL B;  2VJ4 A;  3OJU A;  3G6Y A;  2HSZ A;  3A4S C;  2Z7J A;  4AOF A;  8ICT A;  1COO A;  2M0N A;  1FXA A;  1OW5 A;  3H8M A;  8ICB A;  1B43 A;  4ED6 A;  3QX7 A;  4JWM A;  2QMT A;  3JSV B;  3U2S C;  2M0X A;  2Z8L A;  4FFD A;  2XBB C;  4RGT A;  3ZJT A;  2I9G A;  2KDM A;  3V72 A;  4RUC A;  3K4G A;  2QCZ A;  4C56 C;  2IBK A;  3MGH A;  1XCQ L;  4I2F A;  5DQI A;  1OTR B;  2M19 A;  3AE2 B;  4FBJ B;  4R66 A;  4P16 A;  3C0R B;  5KNI A;  2KJ9 A;  3H8W A;  4OCZ A;  1TY0 A;  2K60 A;  5HI1 A;  2KDE B;  1SV0 A;  7ICP A;  1D4B A;  4RF0 A;  1LKY A;  5J0U A;  4LDT B;  1D8B A;  3AE8 B;  5EWF A;  4RT3 A;  1VR9 A;  3F5E A;  4UAT A;  1OUQ A;  4BUG A;  2MUT A;  2KLG A;  5EE9 A;  4CGZ A;  5DG9 A;  4J9Q A;  3HVD A;  4PJ0 U;  2R8I A;  4QAY A;  3ZD8 A;  4O3Q A;  9ICB A;  2EEL A;  2ZUC A;  9ICN A;  2XCP A;  1SJH D;  3URY A;  3ZKJ C;  1S0O A;  2OED A;  4QZI A;  4ECU A;  4RGM A;  1OEY J;  2WXO A;  2W3R A;  1Q10 A;  2MU2 A;  3CYM A;  1TKG A;  4GLX A;  4MEM A;  4IWP A;  1I7H A;  2BBC A;  2KFJ A;  3A0H U;  3APF A;  5GXG B;  2WF9 A;  3AUL A;  2O6V D;  4MF8 A;  1NJZ A;  2O6V A;  3M9M B;  4FJV B;  1L4Z B;  5KFH A;  3Q8C A;  5KFU A;  3WKD A;  4KLM A;  2MJ3 A;  3TSS A;  4ANU A;  2KMD A;  5EWE A;  4KLF A;  1YD8 U;  3DCG A;  3R66 C;  4P4M A;  1PVP A;  3PRE A;  1OEY A;  1FCL A; 
#chains in the Genus database with same CATH homology
 3SEB A;  3W5V B;  2QJL A;  4OZA A;  3W1S A;  3RFZ B;  1FFV A;  2WXQ A;  1J7B A;  2WXN A;  2ZW1 A;  4IOI E;  3AE6 B;  4RNA A;  2JX5 A;  3V05 A;  4ZHP A;  4DXG A;  1YNT E;  3AB5 A;  3LXF A;  5HHD G;  4MH8 A;  2N0S B;  4EE2 A;  4NAW B;  1FO4 A;  5EE0 A;  1VZ6 A;  1XLP A;  2XNA C;  4N58 A;  1VZ8 A;  2K5P A;  3N9Y C;  5D3D A;  2BYT A;  2OHF A;  4J3O D;  4LK0 M;  1PFD A;  2M56 B;  4ZHO A;  4US9 A;  1AYF A;  1D5X C;  3BVG A;  1YJI A;  2WDR B;  1YQ3 B;  1WGK A;  1KLU D;  3Q8E A;  1C4A A;  1FNU A;  1I4G A;  1E6E B;  2LGI A;  4CQN A;  1T5X D;  5C3J B;  1SJE D;  4US8 A;  2IGG A;  2WS3 B;  1Y56 A;  5I4D A;  2Q5W D;  2N9L A;  3ZYY X;  2K3U A;  1EWC A;  1ET9 A;  5JXV A;  5H8Y E;  2IGD A;  3HRD D;  3BWU D;  4WQM A;  3W5U B;  1SE3 A;  1NVI D;  4B0E A;  1TKE A;  4UDU C;  5BYR A;  3NS1 A;  2Y3A A;  2JU6 X;  2WP9 B;  2BW2 A;  1DOX A;  2DWQ A;  4HRO A;  4HRS A;  2B76 B;  1UNS A;  1TZO A;  4YTN B;  1KRH A;  2XN9 C;  4PT5 A;  1TKY A;  2AQ2 B;  1J7A A;  2HDE A;  1FCC C;  5FR3 A;  3EGR A;  2GB1 A;  1SE4 A;  2WXF A;  3FAH A;  4YSZ B;  1TS2 A;  1XCT L;  3EA6 A;  4A8X C;  4AS1 A;  2D5G A;  2WXP A;  1JWA D;  4GDL B;  3R2T A;  3NVZ A;  2ZW0 A;  4OHJ A;  1ZP0 B;  3Q8A A;  1GB1 A;  3DWM A;  1NYR A;  2HTM E;  4JPS A;  1JCK B;  2V3P A;  1V1P A;  2V0G A;  2YEP B;  2DYO A;  2JYT A;  5AUK A;  5E6J A;  1JW9 D;  2WXH A;  3MFG A;  1HZ5 A;  1VJK A;  2LHE A;  4D2K A;  1FRD A;  4ZOH C;  3AEE B;  1T6B X;  2WXL A;  1L0V B;  4C80 A;  1MPE A;  5BMH A;  2J53 A;  1GOZ A;  4C7Y A;  1UWX A;  2PTL A;  1B9R A;  1PDX A;  3E56 A;  1RWS A;  1R7S A;  4R3D A;  1QIL A;  3O13 A;  1MVK A;  3P4Q B;  3HVZ A;  4OZB A;  1SE2 A;  1IBX A;  3AMZ A;  1D5M C;  1BUI C;  1EWY C;  1RYJ A;  5D7G A;  2PKO A;  1OFF A;  3FC4 A;  1XLN A;  5C2T B;  2N9K A;  2YEP F;  3BYT B;  1ENF A;  4KGR A;  1P7E A;  1MI0 A;  1ZUD 2;  4MAC A;  2IPK D;  1PGA A;  1QF6 A;  3NZ3 A;  2L1A A;  4KGT A;  1UGJ A;  3AEA B;  2VZK D;  4LTU A;  4TQ0 A;  1RM6 C;  1I4Q A;  2BS2 B;  1PUT A;  1KH0 A;  2JYE A;  2PLP A;  1ESF A;  3P42 A;  4FXC A;  4N59 A;  1QOB A;  4WAF A;  1VDV A;  4O1N A;  3V3X A;  1C79 A;  2ON8 A;  3LYY A;  1BXT A;  2K22 A;  3B2F A;  1F2R I;  1JWM D;  4REZ A;  1KLG D;  4HEA 1;  1YJJ A;  5AUI A;  3FIL A;  3AH7 A;  1N60 A;  2WXM A;  3U52 E;  2TSS A;  1N63 A;  1C77 A;  1V1P B;  3ZJV A;  3AEG B;  1FXI A;  3MP9 A;  5T8I A;  2GI9 A;  3GP7 A;  1DOY A;  1WSP A;  1JQ4 A;  3P4R B;  2CJO A;  2L83 A;  4N6E B;  2INN E;  2V3N A;  2L32 A;  1RFK A;  4WWM A;  2WQY B;  3B9J A;  1GPX A;  3P63 A;  2J42 A;  4NJC A;  2KMM A;  2L52 A;  3IT4 B;  1IBX B;  3PZ8 A;  1SSN A;  2BB5 A;  2WXR A;  1N61 A;  1MHH E;  4P6V F;  2DLB A;  4HKZ E;  2MH7 A;  5HG2 A;  2GRI A;  4A9A A;  3I9V 1;  3AEC B;  2FE8 A;  4RGO S;  3SFE B;  1C4P A;  5FKA C;  4YXD B;  1GAQ B;  4IKG A;  1L0X B;  1L4D B;  1YMH E;  2BB6 A;  1N62 A;  3AE5 B;  4ITK A;  4XDC A;  1V1O A;  1VZ7 A;  2RDG A;  2SAK A;  3AN1 A;  1JRO A;  3BVZ A;  3C8Y A;  1FEH A;  1ZE3 D;  4L23 A;  2VZK B;  1YN4 A;  2JXT A;  2X38 A;  3ZJU A;  4MM3 B;  2LFI A;  4KKJ A;  1IGD A;  2BT6 A;  3AM9 A;  1FNW A;  3AE3 B;  3BII D;  2LUM A;  1N5W A;  5G5H A;  4RH6 A;  1ZOY B;  2H88 B;  2M0A A;  1XLO A;  3GB1 A;  5FK9 C;  1K52 A;  1QOF A;  1QOG A;  2QIE B;  4TSS A;  1P7F A;  2I2Y A;  2SEB D;  2KWD A;  3AE9 B;  3FIL B;  3B2G A;  1TY2 A;  2V4I B;  2WXG A;  3GS2 A;  4AQ7 A;  1JRP A;  4A90 A;  1IGC A;  5EE1 A;  2IJ0 A;  4XWW A;  1FMA D;  1BML C;  1V97 A;  3R8B A;  3IAM 1;  2MEK A;  3ZGZ A;  4USA A;  4A6Q A;  3L4P A;  1XF5 L;  3AE4 B;  1K53 A;  4B0M A;  4ZRQ A;  2NTT A;  3NVW A;  3BZD B;  2RDH A;  4C7Z A;  1QT9 A;  1QLB B;  2K9X A;  3KWL A;  4YT0 B;  2BTE A;  4YSX B;  2KAC A;  2Y5P A;  3R2I A;  2J52 A;  1J7C A;  1E7P B;  5G5G A;  4JX1 C;  4M0W A;  1VLB A;  1F77 A;  2N7J A;  3P4S B;  5LNK 1;  5MPO A;  2BS3 B;  5TSS A;  3T3O A;  3Q8B A;  2PMV A;  1HEZ E;  3TEX A;  2QEJ C;  1STE A;  2WDQ B;  1TS5 A;  1ZXH A;  3KWV A;  1E0Z A;  1GB4 A;  3EUB 2;  2PIA A;  1E10 A;  2WXK A;  2RMM A;  4TQ1 A;  4WIP A;  4ARI A;  3IXS A;  1NEN B;  3U7Z A;  1KTK A;  4OW0 A;  2W55 A;  4TMA B;  3NVV A;  2J4X A;  3J9C A;  2WXJ A;  1SXT A;  1PGX A;  2PW9 A;  3NUH B;  4L2Y A;  1T3Q A;  1ZXI A;  1AN8 A;  1DOI A;  3W9C B;  2AX5 A;  2ICI A;  2LHD A;  3AE1 B;  4XWT A;  2ONQ A;  1ACC A;  1EM7 A;  2MJE A;  4L1B A;  3E9S A;  1L0Y B;  3HUI A;  2DYM A;  4YTM B;  1WXQ A;  2QSD A;  3BYY B;  3CWI A;  4DQO C;  5BYS A;  2PVG C;  1OQQ A;  2INP E;  1NYQ A;  3VR9 B;  1XLQ A;  4Q2J A;  3TUO A;  1QOA A;  2KN4 A;  1XO3 A;  5BMI A;  1DYQ A;  1HZ6 A;  2DBY A;  1I4P A;  3I57 A;  1MHX A;  2ACZ B;  1WWT A;  4GDK B;  4OZC A;  3WCQ A;  3ZQ4 A;  3IT6 B;  1QQR A;  1HA5 A;  1L6V A;  3H8H A;  1F0Z A;  1FD6 A;  2W82 A;  2KQ4 X;  4XE0 A;  3MJ5 A;  4KKI A;  3U4E G;  1HXY D;  4H2A A;  4YSY B;  3LB8 C;  2FBW B;  1YQ4 B;  2W54 A;  1SEB D;  4ZYS A;  1JWU D;  2JQR B;  3TEY A;  1XEE A;  1I4X A;  3AEF B;  1VRA B;  1CZP A;  1ROE A;  3SFD B;  1JAL A;  1AW7 A;  1ZDX A;  4RFB A;  1TS3 A;  3AE7 B;  2WU2 B;  1KFY B;  2IGH A;  4MT5 A;  3VRB B;  4IDI A;  1I4H A;  5BMG A;  1C76 A;  2WXI A;  1KF6 B;  1QKZ A;  1I4R A;  2WDV B;  2WU5 B;  3TEZ A;  1C78 A;  1C4C A;  4JWU C;  3NRZ A;  3Q69 A;  2Y5C A;  3AED B;  2R61 A;  4WUR A;  1UUP A;  1ZDV A;  3KLS X;  2MJD A;  4OVZ A;  1FFU A;  3PO0 A;  3OWE B;  3W2D A;  4YWG G;  1L5P A;  1XXG A;  2G1E A;  2LMC A;  1JWB D;  5H92 C;  3VR8 B;  1B1Z A;  2NMQ A;  4HJG E;  2RPV A;  3MHZ A;  5HFY A;  3AV8 A;  3BK1 A;  1FNV A;  1FRR A;  2QIL A;  1NI3 A;  3P1M A;  5BYQ A;  4NZL B;  2E6X A;  2CU3 A;  2JSV X;  1DGJ A;  4RF1 A;  4DXF A;  1C9F A;  2PVO D;  1JWS D;  3Q8F A;  1SIJ A;  3PZ7 A;  1EU3 A;  1TS4 A;  2FUG 1;  4A55 A;  3DWG C;  4JE3 B;  1JML A;  1LO5 D;  1AWD A;  2K0P A;  2LEK A;  1OQR A;  2W3S A;  5EE3 A;  1CJE A;  1WRI A;  2JWU A;  1ZPS A;  1FM0 D;  1FXA A;  2WLB A;  4KX6 B;  3P4P B;  1SF0 A;  2QMT A;  3U2S C;  2BS4 B;  2Z8L A;  3ZJT A;  4RGT A;  3T3N A;  3KQ4 A;  2KDM A;  3AEB B;  3IAS 1;  4C56 C;  2WNM A;  4YTP B;  1E9M A;  3ETR A;  1L6U A;  3ABV B;  1XCQ L;  4JWS C;  2NTS A;  2M19 A;  3AE2 B;  1HQR D;  4P16 A;  1WYG A;  1TY0 A;  3VRA B;  3MC0 B;  5HI1 A;  1PGB A;  1SB3 C;  1D4B A;  1CK1 A;  4RF0 A;  4RCO A;  1CQV A;  1EU4 A;  3AE8 B;  1N5X A;  1K51 A;  1TYG B;  1VR9 A;  1D6E C;  1TJE A;  2AQ1 B;  5D3I B;  5EE9 A;  4KGS A;  1A70 A;  3HVD A;  4GLS C;  2EKI A;  3BVM A;  2EEL A;  4HKQ A;  1YN5 A;  1SJH D;  1NEK B;  2AQ3 B;  2OED A;  3URY A;  1UWM A;  1ET6 A;  2LJI A;  3UI3 A;  4RGM A;  3CIR B;  2WXO A;  3NVY A;  1M4V A;  2JZP A;  2W3R A;  2E3T A;  1Q10 A;  1TKG A;  3TEW A;  1K50 A;  3RPF C;  1I7H A;  4NAM A;  4ZRP A;  2BBC A;  3SR6 A;  5GXG B;  3VQI A;  2I38 A;  2IDY A;  4RGN A;  1IUE A;  1FIQ A;  1F2R C;  3BK2 A;  1L4Z B;  4LLG M;  2H89 B;  2KAJ A;  3Q8C A;  2MJ3 A;  3TSS A;  1PYW D;  4ARC A;  2G9H D;  1YN3 A;  4XDD A;  1V8C A;  4WH4 A;  2CJN A;  1D5Z C;  1SBB B;  1FCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...