3CYMA

Crystal structure of protein bad_0989 from bifidobacterium adolescentis
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
415
Chain Sequence
EPKLLAEPREGVPNVIDTLPAFRDYCSELASSHGSLAADAERASGFRYGHEDWLVQFKRDGAGIGLLDPQALAAAGADWNDFNRAVGDAVWILHDSLQDLPGFDELGMEPQRLFDTEIAARLLGLKRFGLAAVTEHFLGLTLAKEHSAADWSYRPLPRDWRNYAALDVELLIELETKMRAELKRQGKMEWAQEEFDYALKEGLGPRKEHLIPWMHVSHITEVMRDRQALAIVRALWTRRDELAREYDIAPTLLLSDSSIIEVAKRKPHNAAQFRSIRSINERVRIHTDSEQDKMFERYAPIQRKIKPSMWKNIIQDALALPPSEWPDSAPKSIRVWKERYPERLQVLNRVRKAVSQIAEDTRTPVEIVIKPQYLRNLCWTDEPRKRDVARFLSEQGARDWQVSLVAESVSRAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein BAD_0989
publication title Crystal structure of protein BAD_0989 from Bifidobacterium adolescentis.
rcsb
source organism Bifidobacterium adolescentis atcc 15703
total genus 150
structure length 415
sequence length 429
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
A PF18305 DNA_pol_A_exoN 3' to 5' exonuclease C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3cymA03
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3cymA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cymA01
1JLBA 1UWBA 2RKIA 3MEEA 1VSDA 5K14A 4E1NA 4CJPA 4DF4A 3QIOA 4DTMA 4M41A 3RMBA 3A2FA 1NKBA 1L3UA 3ZT1A 1LW2A 1FK9A 2MA1A 4O55A 2IS3A 3VQ9A 4FM0A 3LAKA 4B9UA 2RHFA 4O3MA 4CFAA 4FJLA 3OY9A 3E01A 3P5JA 3QEXA 1IO2A 1TKXA 4DQIA 1S9GA 3SUOA 4Q0BA 3HVTA 2FBXA 4I2QA 3NH2A 5HRPA 4CJ5A 3AA2A 3HO1A 3PX0A 4CJFA 1HRHA 1ZBIA 4KFBA 2OZSA 4OPKA 3T19A 2KZMA 4CGHA 2KV2A 1WAJA 1D5AA 2QKBA 4BWJA 1TAQA 4CJSA 3SAHA 2G8FA 2YHAA 2W42A 4B9VA 3ZT3A 1JLCA 3S3MA 1X9SA 3VQ6A 3L2VA 2Z1HA 1U4BA 3AO2A 3MXMA 2I5JA 3NF7A 1JXEA 5I42A 2XY8A 2ATQA 4BWMA 1R0AA 4ELVA 4FJJA 3AVIA 3M8RA 3OYAA 2XY5A 3QEPA 3TAQA 1NJZA 3ZT4A 3OYHA 3RTVA 4DTRA 3NAEA 4KI4A 5J2PA 4RW6A 1IH7A 4CEDA 1RT1A 1WSHA 4AILC 2OZMA 3AVMA 3RMDA 1D8YA 4CIGA 3SI6A 4CFBA 4HCBA 3VA0A 1JLEA 4CGJA 4FJ5A 4DQPA 3F73A 2YV0X 3OJSA 4JRPA 1U49A 4NLCA 3QIPA 5HROA 1S1VA 5SWMA 1A5XA 3DRRA 4DS5A 4KHYA 4O0JA 3WNHA 4ELTA 4LSNA 1RT2A 3K59A 4DTSA 2PZSA 4M3WA 4AHUA 3ZSVA 1CZ9A 4DU1A 3SUPA 1D8BA 1ZBHA 3JYTA 1X1PA 4DFKA 4GVMA 2RPIA 4B9TA 2HMIA 4K8XA 2BGGA 1B9FA 1KLMA 3PO4A 4JS4A 4FW1A 3K5OA 4DMNA 3KD1E 1K6YA 3ULDA 3VQPA 1C1AA 1NOZA 1TKTA 4N76A 1WNSA 4F4KA 5CZ2A 1WSFA 1YT3A 4N41A 1RBUA 1B9DA 4FK2A 4B9LA 4E89A 3SNNA 1YTAA 1T7PA 2P1JA 1NJWA 3MEGA 5KRTA 3U6FA 3LDSA 4JRQA 4PA1A 2Q3SA 4OPJA 4C8MA 1HYVA 3DLGA 3LAMA 2IC3A 1VRUA 3ZSQA 4FJMA 2VWJA 4W5TA 3SQ0A 1WSGA 3K2PA 4YFUA 4M3UA 1CXQA 1BISA 2O4GA 4B9NA 1EXQA 1ZBLA 1KRPA 3BGRA 1VSIA 2Z1IA 2DGZA 3AVLA 4ZHRA 1BIZA 3EYZA 3OVNA 4B8AB 4CEBA 4E1MA 5FDLA 2Z1JA 4DTOA 3VN5A 1WSEA 3QLHA 3RRHA 3DLBA 3OYBA 4B08A 3HXMA 1NK5A 3HP6A 1RBTA 4LSLA 3VQAA 1TKDA 1RT4A 4OGCA 3LPUA 1FKPA 4M42A 2YKNA 1KTQA 5J2QA 1LV5A 4OKJA 1XWLA 2R7YA 4DWIA 1EX4A 1IKWA 3AVBA 4DQRA 1NK0A 1LAWA 1C1BA 2Z1GA 4Y1DA 1RT5A 3ZSZA 2BE2A 3NF9A 4OKEA 4HTUA 3SV4A 4DFJA 2QKKA 4EP5A 1GO3F 3ZSYA 1ZYQA 3HPHA 4R5PA 3RMCA 1C1CA 4CK1A 1I39A 4KPYA 4RW8A 4CJEA 2ITGA 2HVIA 3SAGA 4H8KA 3KLEA 3S3NA 2OPPA 4I9QA 1NK4A 2DY4A 3C6TA 1RT3A 2NUBA 2HBJA 3V1OA 4CEZA 3OS1A 3V1RA 5DMRA 4ID5A 3G10A 1CLQA 4AHRA 3QNOA 1X9MA 2ZD1A 2G8UA 4FYDA 2XY7A 2IOCA 2YNGA 3CM6A 2KZZA 2YHBA 1TV6A 1BHLA 2X6NA 3F9KA 2WOMA 4RW7A 5C24A 4Z4HA 1DTTA 1QSSA 4PQUA 1ASUA 1JL2A 3TWHA 3AVNA 3K5NA 1RTHA 2D5RA 4L8RB 4E7LA 4AHVA 3SQ4A 3QINA 4KTZA 3WNEA 1I3AA 3O3HA 2ZQBA 1W0HA 2HBMA 1VK0A 4E3SA 3V1QA 3AO4A 3OYFA 2P5OA 3HPGA 4FJ9A 1NK9A 1SKWA 1BQMA 4IBNA 5KGXA 4DQSA 4BE0A 4FK0A 4Z4GA 4F8RA 1Q8IA 3AO3A 3AA4A 1VSMA 4IG3A 3K57A 3THVA 1D9FA 4CCHA 4IKFA 4W5OA 1TL3A 1UOCA 3KKRA 1RBRA 3QEWA 1RTDA 3HL8A 1U04A 3DRSA 3LP3A 3L2UA 3KK3A 2D0BA 2E6LA 3V9XA 4CJ3A 4DFPA 3RRGA 4ZTFA 4F2SA 2DTUA 4OJRA 1TGOA 3U3YA 3KKSA 2PYJA 4FZXC 1QHTA 1IKYA 1VSJA 4M3YA 1BQNA 3SV3A 4FW2A 4FJKA 4PWDA 2VG7A 2AJQA 2GUIA 1KVBA 2KW4A 3PX6A 4CJUA 4M3ZA 1VSKA 3IG1A 4IG0A 5C0YA 2OPRA 4FLWA 1SKRA 4FJHA 4QCLA 4CGGA 1HQUA 1SKSA 2B6AA 1KLNA 2Y1IA 2ETJA 5J1EA 3LZIA 1U48A 3ZT2A 2X78A 4I2PA 4W5NA 4QIWF 4FLVA 3O3FA 4HHTA 2FBTA 4CJ4A 3LP2A 3OJUA 3RMAA 4KKOA 4CGIA 1HPZA 1JL1A 4DTPA 1ASWA 3NGYA 1J54A 4I7FA 1N6QA 4KRFA 4N5SA 2HW3A 1EP4A 4CF0A 1KSPA 2G8KA 2HHSA 2XRIA 3D45A 4CJRA 3CFPA 1KFDA 3NHGA 2BDPA 3ALYA 4MQ3A 4CEOA 3KK1A 2HHTA 1F21A 1LAVA 4BDYA 4UQGA 2HHQA 4KHNA 1A5VA 4FZZA 2IAJA 1Q9YA 4CHYA 4FZYA 3CYMA 1QSYA 3KJVA 1RTIA 4BDZA 1J5OA 4M45A 2YKMA 4BACA 2F96A 3SZ2A 3AV9A 2A1RA 4H4MA 2DFEA 5I3UA 1QE1A 1TVRA 4Q5VA 3VQDA 3D0PA 1KVAA 1JXBA 1SV5A 3OS2A 3ZT0A 3AA5X 3KLFA 3CFOA 4KTQA 4GMJB 3TANA 2PY5A 5DK5A 4N47A 1SL0A 3MECA 4XIUA 4HUEA 4NYNA 4AHSA 4CEFA 2RRDA 5FROA 3OYNA 3RR8A 1C6VA 4CIFA 2KFZA 3HPOA 2KQ2A 4IDKA 3NCIA 1JLFA 2HBKA 3HP9A 4O4GA 3KLIA 4CEAA 1LWEA 4FJ7A 5HLFA 1UA1A 4DSFA 1WLJA 2D0AA 4HUGA 1TK0A 5CZ1A 4AHTA 4BDPA 4J2DA 4CK3A 5HRRA 4LH4A 3V9ZA 4CJQA 2HVHA 2OPSA 3DMJA 2E1EA 4CGFA 4DU3A 2DFFA 5JS2A 1S6PA 1GOBA 4E0DA 3NH1A 3TARA 4F3OA 2RN2A 3B6OA 1W9HA 2E1FA 3MAQA 3K58A 1Z25A 5JS1A 4Z4FA 3LP0A 1RT6A 4KHSA 1VSHA 1S1XA 4AH9A 1BIUA 4FLUA 4OGEA 4CFDA 3NH0A 3V4IA 3SPYA 1NK8A 2FBVA 2CPRA 4C8NA 1HQEA 3ZSRA 3LZJA 1NKEA 3RR7A 4EZ9A 4DSIA 2HB5A 2F8SA 3L2QA 4E7KA 4M3XA 3OYCA 4CJWA 1SL2A 1WSIA 3O4NA 1KFSA 2HNZA 5T7BA 4KHUA 5HRNA 4NLBA 2ZE2A 4OO1J 4Z4CA 1LWCA 4ICLA 4DTUA 4KI6A 3DYAA 3DLHA 2FC0A 4FJ8A 4CHZA 4B8CA 1TK8A 3MXJA 3AO1A 3SYZA 3LWLA 3DM2A 1VSLA 3CFRA 4QOZB 3B6PA 3VQCA 1XHXA 1T8EA 4CDGA 2DFHA 3LALA 4NCGA 3EZ5A 3QEIA 2OPQA 4CECA 4M3RA 2QK9A 2EHGA 3RWUA 1TK5A 1Z26A 5E41A 4YNQA 3H08A 1C0TA 3OYGA 1UA0A 4C8OA 3QEVA 3HK2A 1RTJA 4CF9A 4DTXA 1Y97A 4E19A 2JGUA 1HNIA 5EU7A 4G1QA 4LD0A 4CIEA 5FRMA 1MU2A 2G8IA 4CK2A 4IFYA 4CJKA 4OLBA 3O3GA 4CJVA 3ASMA 4I9LA 2P5GA 3MXIA 1LW0A 5KTQA 5J2NA 1U47A 4FM1A 4BE2A 3VQEA 3SAFA 3NFAA 2BANA 3DLEA 3M8PA 1TKZA 3HT3A 3M8SA 1XI1A 4DU4A 4AHCA 1U45A 5FRNA 1RDDA 4E7IA 3SUNA 2HNDA 3QESA 3TAMA 4KHQA 1S6QA 3VQQA 3BDPA 4DSJA 1QQCA 2GV9A 4OVLA 3QO9A 4FLXA 1S5JA 5C42A 5CY4A 2G8WA 3AVAA 4CESA 3NGIA 4CFCA 3FFIA 4JS5A 4E7JA 3HJFA 2IDOA 3AVCA 3ISNC 4O44A 4FJNA 3DLRA 4B9SA 1A5WA 2A1SA 3DOKA 4GW6A 3AVHA 3OYLA 4FVMA 3PUFA 1S1TA 4O5BA 1QS4A 3S3OA 3IRXA 4FK4A 1BGXT 4FJGA 1L3TA 4CHQA 1RT7A 4CERA 1S1UA 3TAGA 1FKOA 4Z0UA 3I0RA 4HCCA 4Z4EA 3K5MA 2X74A 1RBVA 3VQ8A 5SZTA 2FBYA 2B5JA 1NK7A 1JKHA 1XC9A 2HBLA 4J2EA 4CHOA 1ASVA 1RDAA 1KCFA 3OS0A 4BE1A 2WONA 3AVKA 4C8KA 3L2WA 4DFMA 3C94A 4DG1A 3NBPA 2O4IA 1HYSA 2KFNA 3NF6A 5KRSA 2QXFA 4CEQA 2XY6A 4E7HA 3L8BA 4J2BA 3OYEA 3OYIA 2G8HA 4KB0A 4ELUA 4Z4IA 1NJYA 3TAFA 5HBMA 3TAEA 1D9DA 3SQ2A 3UIQA 2JLEA 3SCXA 2E4LA 1RCHA 4LY7A 4HUFA 1X9WA 1NK6A 4FXDA 2HHXA 4H4OA 1HNVA 3KLHA 4ZTJA 1JLAA 3O4QA 3NGZA 3OYJA 4DQQA 3L2RA 5CYMA 3V81A 2D0CA 4FCYA 4DS4A 3VQ5A 3PX4A 1C0UA 4KTWA 3LP1A 4O0IA 1TAUA 4JLHA 3ZSOA 4OKKA 4N56A 4KREA 1GOCA 1WSJA 2VWKA 3ZSXA 3NE6A 2XO7A 1HYZA 3CQ8A 3TABA 1O1WA 4OLAA 4K8ZA 2HHVA 1VSFA 1HJRA 2Y1JA 3DOLA 1EKEA 1N5YA 3LPTA 4PY5A 3SQ1A 2HNYA 3OYDA 3V6DA 4DSKA 1S1WA 4NCAA 3IAYA 1VRTA 3HYFA 3HM9A 3HVRA 3KK2A 1DTQA 4CF8A 4DSLA 1L3VA 1IKVA 1CZBA 4DLEA 5C25A 3DI6A 3QETA 1Q9XA 3EY1A 3SPZA 1TL1A 4PUOA 1XHZA 1EETA 2YNIA 3P83D 4TSXA 3VQ7A 5KI6A 3ZSWA 1LWFA 3PY8A 4B3OA 1J9AA 3C95A 3LWMA 1S9EA 1YVUA 4DLGA 4FJXA 1T03A 1RDBA 3VQBA 1WUDA 1L3SA 1CXUA 3VA3A 2PYLA 3U3GA 3DRPA 1DLOA 4DF8A 1VSEA 1BI4B 2EX3A 3KTQA 2X6SA 1GOAA 3DLKA 4F3TA 1ITGA 2P51A 1QTMA 3K5LA 4C8LA 3JSMA 1JLQA 4KAZA 4NCBA 4WE1A 4ID1A 3WNFA 1YTUA 1J53A 1ZBFA 4CF2A 3OYMA 1ZBUA 4CJLA 1NOYA 1KVCA 2VG5A 4W5RA 3L3VA 2XHBA 1BL3A 3IS9A 1HMVA 3PV8A 3KD5E 1IKXA 3PO5A 4J2AA 4RW4A 3MEDA 4QAGA 4HVJA 3ZCMA 1NJXA 4IFVA 4Y1CA 2GBZA 3AVJA 2IGIA 4RW9A 5HRSA 4CGZA 1QSLA 3OYKA 1BI4A 3SJJA 3NF8A 3V9WA 3S9HA 2HHUA 3T3FA 3KIOA 4CJTA 3SUQA 4KO0A 1BCMA 3QERA 3M8QA 1RILA 4CEEA 3I8DA 4W5QA 5J2MA 1C0MA 3V9SA 1WN7A 1RBSA 4CE9A 4CHNA 3C6UA 1B92A 3ITHA 1L5UA 1WAFA 4FJIA 3V9UA 2OA8A 1JLGA 4KV8A 3P1GA 4DSEA 2F8TA 4FLZA 3AVFA 2YNHA 4DTJA 1SUQA 4FLYA 3QNNA 3AVGA 5HP1A 3L3UA 1T05A 3NDKA 1REVA 1IG9A 3KLGA 4B9MA 1NKCA 3TR8A 4KB1A 4EZ6A 3HSTB 4KHWA 4DTNA 1FXXA 2KTQA 3T1AA 3AO5A 4RG8A 3WNGA 3VQ4A 3LANA 4LH5A 4CGDA 4EP4A 2LSNA 1RNHA 2B4JA 3G0ZA 3TAPA 2E6MA 4M3TA 2RF2A 1BCOA 3AA3A 2YNFA 5D3GA 2G8VA 4F2RA 1UAXA 3CG7A 1RDCA 1G15A 4MFBA 3TI0A 4FLTA 2HHWA 2OYQA 3I0SA 5CYQA 5KGWA 4CHPA 4CF1A 1SL1A 2VG6A 3CM5A 4FM2A 4NYFA 4QJFB
chains in the Genus database with same CATH superfamily
1T3NA 1VSDA 2NRRA 4E1NA 3TSPA 5TKWA 4DTMA 1KBUA 4JK8A 3SD7A 3KWGA 3RMBA 1V97A 3A2FA 4YR3A 1ZQQA 3R8EA 3ZT1A 1FK9A 4FM0A 2RHFA 2XVTA 4O3MA 2BPGA 2JV3A 2C28A 2VCPA 1N63A 4DQIA 5KT4A 1ZC6A 1S9GA 5AQWA 5BN9A 3HVTA 1OW5A 3LDOA 5T14A 4XUSA 4FZMA 8ICZA 7ICRA 3VEWA 1ZBIA 3WK9A 1HRHA 4KFBA 4CBWA 3Q8MA 1SWWA 1HUXA 3HBTA 2YY6A 3NVKA 3BQ0A 2QKBA 2KHQA 2R8KA 3TTFA 3SAHA 3JS6A 4U7CA 4H5TA 1FW6A 4KREA 5DGBA 3EE9A 2YHAA 5EE0A 5DDYA 3ZT3A 1JLCA 3KZXA 3CHWA 4KLDA 1XSPA 3SK3A 5LJVA 9ICIA 4WJ3B 1MDUB 2HSTA 3NUQA 3VQ6A 5CHIA 3L2VA 2I5JA 2ATLA 5I42A 4BWMA 1T6CA 3O9QA 4FJJA 3M8RA 4M04A 3E1YA 4J9LA 3TAQA 3T5KA 3OYHA 3HKZF 2RP5A 5DG9A 3NAEA 5ELZA 4NB4A 1RT1A 3RMDA 1D8YA 4CIGA 3SI6A 5F3XB 5ADXA 4IEIA 3ZYYX 4HCBA 4FJ5A 5L1MA 5H1SQ 4B3TK 1U49A 4A59A 4DR7K 1HEKA 4DV0K 3MDCA 1J2MA 3CCUN 4F93B 1XSNA 3WKAA 2KE7A 3WNHA 4GV3A 4M9NA 5KFOA 4BQLA 1CLQA 5ALQA 1IBKK 2C22A 1CZ9A 4A61A 4DFKA 4B9TA 3CCRN 4BC5A 4U67L 4K8XA 1GLCG 1KLMA 5CJ7A 3VEOA 3IHQB 4GIBA 4F72A 5J8YA 3RB6A 4JS4A 4FW1A 4DMNA 1RDFA 5AKEA 1KEJA 1C1AA 1VJ5A 3K1RB 1NOZA 3LM2A 3JPSA 2YTUA 1WNSA 5EVZA 2UUBK 2P9KA 4N41A 4BR2A 1XNRK 2EAOA 3SNNA 1YTAA 3K0SA 4EHUA 5KRTA 4JRQA 2ZJ8A 4K4IA 2QB0B 4F4ZA 3C2KA 1VRUA 3CCMN 3NVMA 1L7PA 4W5TA 3OTQA 1WSGA 3K2PA 4YFUA 3AU2A 4B9NA 3C5FA 1CXQA 2WF5A 3C29A 2PKEA 3RH4A 1KRPA 4IQWA 3FZMA 2KD1A 4H5NA 2DGZA 3AVLA 4YMMA 2JH1A 4ZHRA 2VANA 1L8LA 2E88A 1LVHA 4ED2A 2Z1JA 5C12A 2FSKA 3I56N 4TUPA 3BS5A 3I8BA 3HP6A 1RBTA 4B08A 3VQAA 3EKSA 5JVHL 2QA4N 4QZGA 1RT4A 4OGCA 4CZLA 5LMNK 2W11A 5AKHA 2YKNA 8ICHA 4QZAA 5IINA 1XWLA 1Z1VA 4GXJA 3GFKB 4DWIA 3VGMA 3TU5A 4DQRA 4JWNA 3RJGA 1C0GA 1C1BA 4WYBA 1RT5A 1JCFA 4RNNA 4YCXA 1C1CA 4RW8A 2ITGA 4TUQA 4A8EA 4O5KA 2DL0A 3FZLA 4BREA 1E4GT 2OPPA 2ODGA 4I9QA 4PGYA 4Q43A 1SZPA 1RT3A 5HR7A 3OS1A 1W7AA 1X9MA 3O6WA 3RVCA 2ZD1A 3PMLA 4FYDA 5F9NA 1RYSA 2YNGA 4YDUA 1DGJA 3SEIA 5E26A 3AARA 5B5EU 4E1JA 1NJIO 5KFXA 3RAXA 4I2FA 4KLLA 3KWIA 3ZEUA 1SWVA 1RFQA 4XA5A 2D5RA 3CW2C 4I2CA 3VCBA 4RUAA 2BQ3A 2YHWA 3WNEA 3OHAA 1V38A 2ZQBA 5EXWA 3SBGA 5DB9A 2AGQA 4EX7A 4JK9A 3V1QA 2YMLA 5BR9A 2P5OA 7ICVA 2W9CA 1XO0A 2PI4A 2W3RA 3BQ7A 2A3VA 4KLTA 7ICPA 4JK7A 3OPXA 5CE3A 4IBNA 4F4XA 4DQSA 5KGXA 4BE0A 4F8RA 1Q8IA 3ZLJA 4IOCL 5AQJA 1XQSC 2AQ0A 1RTDA 3NRWA 5KFKA 1JCGA 1N33K 2ASOA 5CEHA 7ICFA 3KK3A 1VQMN 3RJHA 4ILHA 5KG2A 3NRZA 4DFPA 4CJ3A 4QW8A 4F2SA 3V7JA 4FZXC 3CPEA 1QHTA 4M3YA 5HR6A 3SV3A 1BQNA 1MA9B 2KKPA 3BF1A 1YJNN 2I5HA 1ZQOA 3IG1A 1VQ4N 2AXTU 1SXEA 3GDQA 4OJ5A 2Y1IA 2YMPA 3V6HA 3OSPA 1FEZA 2G5HB 4KLQA 2ETJA 1U48A 4JI8K 4PHEA 2WFBA 3M1YA 2X78A 4W5NA 3A5NC 3KBBA 3DJCA 1BDGA 2P9KB 2QTDA 1HPZA 1NGAA 4I7FA 3CP8A 4ZH4A 7ICNA 2W04A 4KRFA 1OH6A 3H8MA 4X62K 1KSPA 2WBNA 2W6KA 2G8KA 4RT3A 5F9LA 3BS7A 2JMGA 2HHSA 2XRIA 2HOFA 3NGDA 3VOVA 3CFPA 1Q3UA 1ZD3A 4IC9A 4QNLA 5J0XA 2A41A 4FPAA 2DF4B 4IO8A 2IMWP 4KHPK 1A5VA 1N34K 4RQ3A 4CHYA 2Q0ZX 4G9ZA 5BRHA 3QU4A 3Q7CA 3JPPA 2A1RA 3JPTA 2ITMA 2DFEA 5I3UA 3D0PA 5CP2A 1HUOA 2P66A 2QWPA 3WEEB 1B22A 4DO9A 1ZRMA 5AKKA 3KKAC 3CFOA 1K9MO 4ECXA 4BRFA 1SL0A 3CF5L 1Z1BA 1X9XA 4NLKA 9ICSA 5FROA 1JX4A 3HPOA 3OTOK 2HBKA 2Y9UA 4O4GA 1UA1A 4QS8A 4DSFA 3MN6A 1L7MA 4KMUA 5KFDA 2VGMA 4AHTA 4QIWC 4CK3A 1RG6A 5AK5A 2EDUA 5HRRA 1YZ6A 3DMJA 4CGFA 1RPLA 3THYB 4OJPA 4UATA 1K5OA 2UVUA 4LZGA 4R65A 1N60A 5D46A 4F3OA 1HPMA 3B6OA 2YB1A 3MCAB 5JS1A 3KHRA 1RT6A 3ENHA 4H0YB 1BIUA 3NH0A 2FBVA 3ZSRA 1HQEA 1KQSM 1NKEA 3AEVA 1UT8A 3ETRA 2HB5A 3ZEUB 3NMUA 3ID6A 1KFSA 4FOEA 5AHXA 5J2CA 4DQ8A 5KG1A 3J81O 4Z4CA 3GV5B 3ENOA 4FJ8A 1HJPA 1NI3A 4JV5K 3GG4A 4IS7A 3SYZA 2A1AA 1P7DA 4RQ5A 4ISFA 2FPLA 4PHTX 1UPHA 3KHLA 3VENA 3LALA 3EZ5A 4H0TB 5KFAA 3SJHA 5AQSA 8ICKA 1TK5A 2HSZA 5E41A 4YNQA 2EZZA 1C0TA 3PNCA 5KT5A 1UA0A 1QH9A 3AAPA 4DTXA 3ETLA 5ALWA 2WAQC 2MAXA 5KFVA 1P8ZA 1HNIA 4CIEA 5ALPA 2NNWA 4IFYA 4US9A 4CJVA 1BPDA 4RQ4A 1ZD2P 4AYBC 4I9LA 3CCLN 3LDAA 3K9JA 3QEBZ 4F91B 3TTCA 4CF4A 2OM6A 2NRZA 3VQEA 2HVHA 3M8PA 5FRNA 1TKZA 4AHCA 1JROA 2Q1NA 1X3NA 1JN3A 2KEYA 3TAMA 5KT3A 4JI7K 1SGGA 4Z6EA 2V4QA 4MEXA 4DSJA 5F2RA 4EELA 5D4BA 2GV9A 1FO4A 3QO9A 1S5JA 2V52B 5CY4A 5C42A 4FLXA 2G8WA 1YAGA 4CFCA 1S9FA 4E7JA 2IDOA 2OANA 1JMSA 4UASA 4O44A 3WXKA 4P4OA 2EANA 3OSNA 4UB4A 1BA0A 3EO3A 4RQ0A 4FVMA 1DOQA 2C2DA 4JKFA 5AK4A 4GV6A 4FWNA 1ECWA 5ALHA 3NVVA 4KITB 2JXJA 4DR5K 4I2JA 5HMMA 2LMRA 1RBVA 5SZTA 5ALMA 1JKHA 2HBLA 2FJ6A 2ASLA 2VYPA 3ZDAA 4O3OA 4PZNA 1IXRA 4FOIA 4A5BA 4K0KK 4DFMA 3OBWA 3ZDEA 1SV0C 4CF3A 5J2JA 3NF6A 4CZEA 5KRSA 2HHHK 1O08A 4P2HA 1BUPA 2A19A 1VQ7N 3H6EA 2XY6A 4E7HA 4J2BA 2E2QA 4EEKA 2DUYA 5J2EA 1D9DA 3OBYA 4FXDA 1XC3A 1RCHA 4I2BA 4H4OA 4P0QA 1SQKA 3ORYA 4FFDA 1ZBSA 4OD0A 4XH5A 3NGZA 2BH1A 1URJA 4DQQA 4KLJA 3CQXA 3L2RA 1DEJA 3E58A 2J6UA 4FCYA 3FDSA 3PX4A 4O0IA 1K73O 5JU5A 1MA7A 4R64A 3G6YA 2F9WA 1UT5A 3SMVA 2HCFA 4H5VA 3TABA 4OLAA 4X64K 2WF9A 3R9KA 1HJRA 1EKEA 1RQNA 1S97A 3E2EA 5A2QO 3AY9A 2O8DA 3V6DA 4FWSA 2K8AA 3RH6A 4CI6A 3IAYA 3B0YA 4BQZA 2DBYA 2QM1A 4UAVA 5BRDA 7ICQA 1CZBA 3QETA 1IJJA 5FPDA 1EO1A 1GLAG 4PUOA 1XHZA 1ED1A 3FZKA 2WAQF 3TADC 1A6SA 4F9OA 3AUOA 2ZTEA 4JI4K 5IIJA 4YOYA 8ICJA 1RDBA 2CGLA 4AYBF 1CXUA 4J9KA 4Y0WA 2EQYA 3O80A 3QUBA 5JTIA 4I27A 1BI4B 1RYUA 3KTQA 4FSVA 3PSPA 2CH6A 5JVGL 2E8AA 5C15A 1JCEA 4C1NK 3JSMA 2A40A 1LCUA 3RSEA 5AQUA 1J53A 3CCJN 2DFLA 1ZBFA 1B4FA 3OYMA 4CJLA 1Q81O 2PI5A 1NOYA 4BRCA 2VG5A 5M1PA 2BPCA 3GV7B 5ALXA 5AKXA 4QAGA 3LVVA 1NJXA 1ZD4A 4OJ6A 3ZCMA 1YITN 3GV8B 1QSLA 4BRGA 3G6VA 3SJJA 3IFRA 4IFEA 2W55A 2HHUA 2IHMA 4EBDA 3T3FA 4OX9K 4B1WB 2EZXA 3QERA 4OPHA 4NCAA 2K8CB 1C0MA 4HAIA 2VWBA 1RBSA 3AQEA 3V9SA 5HHHA 3C6UA 3H46O 4FL9A 1CEZA 2Q97A 3V9UA 4ED6A 4KV8A 4FLZA 3KHHA 3CJ1A 4DTJA 1SUQA 5KAIU 5BPNA 1BPXA 5HP1A 2HHVA 8ICWA 1WBDA 1CZAN 4EZ6A 3C28A 2FI1A 3QFUA 1X6JA 3ISBA 2JEIA 5CR4A 5L1KA 3TACB 3EL2A 4TUSA 4RG8A 3VPZA 3WNGA 4MLHA 3VQ4A 4CD3A 3Q8KA 4GC6A 2ISOA 2LSNA 2HOQA 4M3TA 4JV2A 1OVQA 2YNFA 3R1XA 3ISCA 2HHWA 2OYQA 1SL1A 3MR3A 4FBUA 1U6ZA 3I0SA 4M9LA 3LDQA 4Z6DA 3HZ6A 4NYFA 4FM2A 1JLBA 3MEEA 3QEAZ 1ZQXA 4CJPA 4JD2A 5ALEA 4J9SA 4OPAA 3N97B 1VDVA 2BPFA 4H0VB 4JN4A 4M41A 1S22A 4YOXA 4DL3A 3SI8A 5HMLA 4YP3A 1XU4A 1LW2A 1RQLA 2D0OA 5EWGA 1KAXA 1ESVA 5J0OA 4CFAA 4FJLA 1BVSA 3KHGA 3P5JA 2F1IA 3QEXA 4P0QB 3FFKB 4F5OA 1TVAA 4Y2VA 2F7TA 4JI3K 2KVCA 3O0FA 4J9MA 4CJ5A 1Z4NA 3AA2A 3PX0A 3HO1A 4CVNE 2YMMA 3TSQA 4CGHA 2KV2A 4KLIA 3L3FX 2KKVA 1B43A 4BWJA 1D5AA 1VQ6N 2FDRA 1WWVA 1ZXIA 5LL6Z 4B9VA 4BRIA 2O8DB 1ZQ1C 3MCPA 5KFJA 3S3MA 3RB0A 1X9SA 4BUGA 5J8YC 1U4BA 4KLGA 4I2AA 1ZQYA 5G5GA 4QZCA 1ZQSA 3HJEA 3OHBA 1QHAA 4ELVA 1N8RO 3VTIA 1H38A 3OYAA 3QEPA 3ZT4A 3C2LA 9ICPA 3MR5A 1IG8A 1A76A 3RTVA 8ICTA 1JJ2M 8ICSA 4I6MA 4AILC 4CBXA 5I9EB 4JI2K 4CFBA 5BPMA 5DG7A 1JLEA 3VA0A 3HRDD 4DQPA 3F73A 4YMOA 2YV0X 3Q8LA 3QIPA 5HROA 4YOTA 4PGXA 5J0WA 1S1VA 1XMOK 3WK5A 5ALOA 3G25A 4O0JA 5KT2A 2P9UA 1SV0A 2QKQA 2A6AA 3VESA 3K59A 2PZSA 4WCEL 1ZBHA 1FFUA 4RU9A 1D8BA 3GL1A 1X1PA 4GVMA 2RPIA 4NM1A 3RSEB 8ICMA 4LFAK 2LBOA 2KLAA 1V85A 4CW7B 3KD1E 1L8OA 1K6YA 1N2XA 1VQLN 4O9MA 1MQ3A 5J0RA 1TKTA 4N76A 3VF6A 4M6WA 3WK6A 2XIDA 1YT3A 4JKHA 1B9DA 2XICA 3AGRA 3PW2A 1NJWA 3U6FA 2ZF5O 4PA1A 5D49A 9ICLA 4I2DA 5DB8A 1RM6C 1VAZA 2IC3A 5AQRA 3G4SN 4LF7K 2IVOA 4BR0A 2GELA 3SQ0A 1KDHA 1KC8O 1X42A 3MGHA 3E66A 2JR5A 1Q3VA 3BGRA 5BRFA 2Z1IA 5AQIA 3WXIA 4CEBA 4E1MA 2W9MA 5FDLA 4DTOA 4Y2PA 1WSEA 1NK5A 2UVWA 5KFUA 2ZGZA 4YDUC 3WT0A 1YI2N 3J7AP 2ZJ5A 4J9PA 2KNJA 1MWKA 1P90A 3LPUA 4M42A 2O8CA 3WKDA 3KVGA 3WXJA 2F8LA 1N5WA 2Y9TA 5KG6A 2R7YA 3RFAA 1ZQFA 1VQ8N 1EWRA 3H3OB 5KFFA 2QWOA 3SBTA 3VEVA 3NF9A 1ZQKA 4EP5A 5IIMA 3HPHA 4CK1A 1I39A 2DPJA 3F5EA 4XQ8A 2W40A 4CJEA 4X65K 2HVIA 4JI6K 3KLEA 3S3NA 4JD2B 4PL1A 2OXOA 3C6TA 2NUBA 1GLJO 2HBJA 3V1OA 1ZQVA 2D1KA 3A0BU 3VEZA 5DMRA 3ZX3A 2UXCK 3L6QA 4BR5A 3LDLA 2G8UA 3GIIA 3DXKA 3CM6A 2YMQA 3RBDA 1ZQNA 3D2QA 2YHBA 3F9KA 4I2HA 1QSSA 2WOMA 2I7PA 4Z4HA 1DTTA 5AQPA 3TWHA 3LYSA 1RTHA 2VGNA 2LYBA 3FZHA 3I33A 2M0NA 1VQKN 3EE8A 1M90O 1PVPA 1I3AA 3J8AA 2FPKA 4E3SA 2BHNA 2HBMA 1J5EK 2OTLN 2NV3A 4NXNK 3V7LA 1HUZA 3AO4A 4FJ9A 1SKWA 4K4HA 4FZNA 1D8LA 9ICMA 5EE1A 2KN7A 2C2RA 4M47A 8ICVA 4ECZA 3AA4A 3CERA 4IKFA 4NLNA 1UOCA 4I6MB 5KFSA 2D0BA 2E3TA 4KLHA 2E6LA 4YORA 5M1KA 5DQGA 5J0YA 4ZTFA 2V9WA 4BGDA 3U3YA 2K60A 3BJYA 5AQMA 5KFPA 5DM7L 3GZFA 4B6JA 4FW2A 4EBEA 2AJQA 2VG7A 2P9UB 2WUSA 2KW4A 5HHIA 2AA4A 3CCSN 2NRHA 5DM6L 1Z05A 1ZOLA 4M3ZA 2O8FA 1Z3EB 4G3IA 4BRHA 5C0YA 2OPRA 3B8AX 4QCLA 2PFNA 3D2SA 2RDJA 2B6AA 1KLNA 1ZXOA 2Q2RA 5AQYA 1HKBA 3WXLA 4QZFA 9ICCA 3HILA 2RHKA 3W0LA 4YQWA 4M6WB 4HHTA 5KFWA 1DGSA 4CJ4A 3OJUA 3RMAA 4IQVA 1T44A 5ALNA 4ISEA 4KKOA 3QBWA 4AM6A 4KLSA 1JL1A 4CGIA 3CETA 4DTPA 3T5HA 1J54A 3NGYA 5EX5A 3O08A 4EX6A 5FPNA 5EOZA 4N5SA 1YJWN 2PBDA 4RQ2A 2LI6A 2QWQA 1I94K 1F21A 2ZJRL 4C23A 4Z6CA 2HF3A 4UQGA 2HHQA 1L6NA 3FGUA 4BDYA 2YX8A 4UAYA 4AM7A 1Q9YA 3SMPA 4FWOA 1NGHA 3F53A 4ED3A 4HTLA 4F5RA 3CCEN 1RTIA 1J5OA 4M45A 3SZ2A 2F96A 4NXMK 1VQON 1VQ9N 1NLVA 3R6MA 1QE1A 3PVXA 4Q5VA 2VA8A 1GLEG 1KVAA 3MDQA 1OH5A 4DOCA 2O8CB 5EY4A 4KTQA 5ALTA 3M6GA 4N47A 1QCKA 4XIUA 4Y2RA 1YJ9N 3WUHA 4CEFA 1XO1A 2RRDA 2BKEA 4Q8FA 2HDOA 2KFZA 2KQ2A 1K1SA 3A0IX 4BR9A 5LY3A 1N5XA 1D4XA 1OH8A 4WQ5C 3N4PA 1WLJA 2D0AA 3IDHA 1SB3C 3E9OA 1XNSA 8ICIA 3E9PA 2ASPA 5HNKA 4LH4A 3UKUA 2OPSA 2DPNA 2JWLA 2BCSA 1S6PA 4YMNA 4ILGB 3NH1A 2RN2A 2FMSA 3WEEA 3K58A 1M6YA 3MAQA 5BN8A 5J2DA 1WG8A 3H4BA 4IL6U 4DL2A 3LP0A 1FFVA 3DXKB 4FZLA 2QLTA 1S1XA 2PAVA 4IZ9A 4AH9A 4OGEA 4FLUA 4UB8U 2QWLA 2CPRA 9ICFA 3RR7A 4DSIA 4IEEA 2O8EA 4Y2YA 2F8SA 4CJWA 1S0MA 3O4NA 4KHUA 3PIPL 1G99A 4OO1J 3TSUA 2LYHA 5ALLA 3DYAA 3DLHA 2EZYA 4CHZA 1KD1O 2OYYA 2R8JA 2N1RA 4YR2A 4LF8K 3VGKA 3THYA 4DR4K 2FF6A 3LWLA 3DM2A 5KQ8A 2KICA 3CFRA 5L1JA 3B6PA 2ZIWA 1BU6O 3QBXA 4CDGA 4NCGA 2KHOA 3IG5A 3U26A 3D7EO 2EHGA 3LL3A 2JZBA 5AM0A 3H08A 4C8OA 4FVUA 3QEVA 1HJOA 3O4WA 4CF9A 5BR8K 1ZQAA 4J9QA 1Y97A 2F77X 4EYHB 8ICLA 4G1QA 2G8IA 3H3NO 3O3GA 4O8UA 4DCHA 3H0RB 9ICUA 3WQTA 2VJ4A 8ICOA 3MXIA 4M9HA 4RPXA 4ISGA 4QS7A 5GAEP 4FM1A 3HWTA 4BE2A 3CNHA 3SAFA 5KL1B 4L8RB 1U45A 3DLEA 1XI1A 1MQ2A 4RCHA 3UXOA 2FLNA 1U2VA 1TE2A 3F2DA 2O8FB 2V4RA 4KHQA 3BDPA 4QWCA 2BCQA 1JI7A 1QQMA 5AQGA 4C7YA 4NWIA 2ZUCA 1HLUA 3NGIA 3FFIA 4BC4A 4JS5A 4UB3A 3ISNC 1X2IA 4ILJA 3Q8PB 3DLRA 3DOKA 3AVHA 4F5NA 3QE9Y 3PUFA 4O5BA 2YX6A 3P31A 4FPBA 3CPWM 4Z0UA 2NRXA 3EUB2 3UMGA 2GO7A 3AMZA 1OXJA 1KAYA 5AQLA 4PJ0U 3F5AA 4GXKA 1NK7A 2X74A 3VQ8A 4M9JA 2FBYA 3K5MA 1Z4OA 4QZ8A 1RDAA 2E1YA 2V7YA 1VQNN 5AR0A 4BG8A 3IP4B 4C8KA 2WONA 2JEGA 3AVKA 4UBCA 3Q8QB 2KFNA 3C6HA 2V7ZA 4Y2XA 3H4DA 3V72A 1NBWA 4CEQA 1ZQGA 2E20A 3O9TA 3CJ7A 2G8HA 4M9GA 1COOA 5DDMA 4KB0A 4Z4IA 3TAFA 5HBMA 3THXA 4NXZA 2DPIA 3SQ2A 3C1YA 2JLEA 4LY7A 2UYTA 3U9ZA 3KLHA 4DV1K 3H45C 1QVGM 3O4QA 2QWNA 5CYMA 2ZXHA 1C0UA 4JLHA 2Z7JA 4LF4K 1Q82O 1GOCA 3NE6A 3UKUB 1Q18A 3ICXA 4Z6FA 1HYZA 1X9JA 1O1WA 7ICTA 1VSFA 2Y1JA 1AQ6A 1NGIA 5AQNA 3CCQN 2LM4A 1N32K 3EWAA 3LPTA 4PY5A 3SQ1A 1NOMA 1ZJNA 4B3MK 4B1VA 5J2GA 4JWMA 3KK2A 3DLLL 2O8EB 4GKKK 2E8MA 3GILA 1C0FA 1L3VA 4GXIA 3I1YA 4C0ZA 4DLEA 3V6JA 1IKVA 2A42A 3DI6A 4JEPA 3SPZA 4QZIA 1EETA 3ONNA 3H7IA 3AU6A 2YNIA 2NZTA 3T79A 4TSXA 5KI6A 1J9AA 1UCVA 3C95A 1S9EA 5ALSA 1J97A 1YVUA 4DLGA 5JLFA 4QWBA 2AP1A 2BZFA 3SENA 3IG8A 4OCZA 2QI2A 3FM9A 3F2BA 4JYAK 4JKAA 8ICEA 2ZIWB 2EX3A 5KFRA 1BA1A 4ED8A 3DLKA 5KG0A 3J7ZO 3PSIA 1ITGA 1QTMA 2P51A 5AQQA 1ATRA 3HOTA 1NGFA 1JLQA 5KPRA 3CI5A 2W6LA 2JZBB 4WE1A 5AIAA 1QQOA 3L4PA 2H3VA 1QLNA 4CF2A 3EW9A 2K4PA 3EPGA 1C20A 5AM2A 1KVCA 4EHTA 5GAGP 2XHBA 1BL3A 1HMVA 3UB5A 4I2EA 1ZQUA 4CE6A 4F4YA 4RW4A 4WQ5A 1BNOA 4IFVA 5AIBA 3N7RC 2E2OA 2CXYA 2IGIA 3CJ9A 3ZETA 4HWIA 1BI4A 1ATNA 3NF8A 4FWLA 5AFUH 4AF1A 1B0XA 1U2VB 4J8FA 4Y2UA 2B6GA 2OEHA 4RTFD 1C7YA 2QWMA 3M8QA 4WF9L 4WQ4A 2ZXIA 3ITHA 4MF2A 2P9SA 2OA8A 2RDIA 4IR9A 1ZQTA 4PH5A 3BQ1A 3ULEA 4KN7A 1REVA 4B9MA 3KLGA 1NKCA 3M6ZA 1GLFO 3TR8A 3D6RA 4DTNA 5GINA 8ICXA 4YOWA 4I28A 2KTQA 4V19S 3CD6N 3AO5A 4RPYA 1ZQZA 1RXWA 4LH5A 1YZ7A 2BDUA 4O3NA 1KKXA 1RNHA 2B4JA 2VA2A 5ALUA 5CRXA 1M1KO 4UARA 3UMBA 2RF2A 3AA3A 4KBOA 4YOUA 2G8VA 4TQSA 1RDCA 2VIXA 1G15A 3AN1A 4MFBA 5AKLA 4H0PA 5KGWA 1YXQA 3P39A 4CF1A 2VG6A 1UWBA 5KFTA 4AP9A 3DEEA 4QZBA 2JEJA 5K14A 2CH5A 4DF4A 4EENA 4WFNL 4RZRA 2E8NA 1L3UA 1NKBA 4Q45A 2EH9A 3VQ9A 3THXB 2H3QA 5ALIA 3LAKA 4IO9L 2KVSA 2ZTCA 3OY9A 3E01A 2WHEA 1TKXA 1S72N 2YN4A 3M9NB 8ICCA 4GNIA 2NYVA 9ICGA 4GY2B 4BRLA 2HMXA 3OHRA 5HRPA 5DQHA 3GIJA 2OZSA 3MX5A 3O9UA 3MWTA 3QUQA 4P4PA 4FS1A 1WUAA 1MWMA 1WCLA 4BGBA 3CMAN 2F2AB 4CJSA 2BQUA 5J0TA 5KG5A 4RQNA 2G8FA 2W42A 4XH1A 3EEQA 1JALA 1IG6A 2Z1HA 3NVYA 3AO2A 4P4MA 1JXEA 2FSNA 2ATQA 4QZHA 3AVIA 2XCPA 4NL9A 2XY5A 3WKCA 5K4LA 1E4FT 4RW6A 1IH7A 4CEDA 2KJ5A 3LVWA 2OZMA 5DBBA 1J6ZA 3FC4A 4PPXA 1DKGD 4CGJA 4JRPA 2WTUA 4NLCA 7ICGA 7ICEA 2K4HA 1LB2B 3L8BA 3N7SC 3JPOA 1A5XA 5J29A 3DRRA 5IWAK 4C4SA 3MBYA 2CGKA 4YHHK 5ALKA 1JRPA 1KL9A 4ELTA 4LSNA 1RT2A 4M3WA 4DTSA 4AHUA 3ZSVA 3KK7A 3SUPA 5ALGA 1VQPN 4H0XB 5ALFA 2A5XA 5L1IA 2BGGA 2HMIA 1B9FA 2WF7A 3PO4A 3MWPA 2DKXA 3K5OA 2KP7A 2VJ5A 4F4KA 8ICNA 4BRMA 5AI4A 2E5SA 2H3IA 1WSFA 1RBUA 5AQXA 4FK2A 3GU3A 1QQ5A 4B9LA 4E89A 3ZETB 2P1JA 4BRAA 3MEGA 3G6EN 2LM1A 3Q8RB 5HP4A 3ZX0A 4P0PA 1Z19A 2Q3SA 3MK6A 3LAMA 1L7NA 3ZSQA 4JUZA 4BY9C 2VWJA 4ICAA 2VQFK 1VHXA 4J9RA 1ZBLA 4H03B 3M9OB 5DG8A 1VSIA 5KFNA 2B21A 2P9SB 3PSTA 5KG4A 3HM8A 4FWQA 3VERA 1HIWA 3EYZA 8ICBA 4BGAA 1Y64A 4B8AB 3PW7A 4J9NA 3ULEB 2UU9K 4IJAA 3RRHA 5FLXO 5KFQA 3M9MB 4LSLA 4BROA 4RUCA 5KNIA 4A62A 4IOAL 1KTQA 1LV5A 3V6KA 4JMUA 3ZDBA 4K25A 4NY8A 1Q7YO 5KFCA 3AVBA 4K41A 1NK0A 3BQTA 1LAWA 4Y1DA 4IXCA 3ZSZA 4HTUA 1XMQK 4DFJA 1GO3F 3ZSYA 5GIPA 5KFIA 4R5PA 7ICKA 2G0AA 1GLLO 4KLOA 2LPEA 4K42A 4BR7A 4R79A 4GFJA 2W8LA 2GEMA 1L7OA 1Q8KA 2JHDA 3JPQA 3A5LC 4CEZA 5JMVA 3V1RA 5AI8A 4AHRA 2ESEA 3QNOA 5KT6A 4NJ8A 9ICVA 2H3GX 4F5PA 5M1OA 2KZZA 1N36K 4IQTA 2QARA 1S0NA 3V7KA 1BHLA 4JK1A 4BVOA 4RW7A 1LKYA 1JUDA 4RQ7A 3AVNA 3IMXA 9ICXA 2P9NA 4AHVA 3LDNA 3SQ4A 4CRXA 5AKJA 4KTZA 4QS9A 1W0HA 1ZJMA 3DDHA 1IBLK 2EAPA 3GDXA 3VETA 1KQQA 5ALZA 2ALZA 5AJ3K 3QICA 2AQ4A 4DV2K 1NK9A 4YD1A 1BQMA 5AZIA 4RNOA 1A0PA 3C21A 1ZQLA 4IJNA 3CJCA 3THVA 3AO3A 1D9FA 5DQIA 4CCHA 4KLMA 4R66A 3CJAA 5KFZA 4W5OA 1TL3A 2WF6A 3QEWA 5H2FU 4J9OA 3HL8A 4YN4A 1U04A 3LP3A 5AKYA 1YVNA 2IOHA 3PIOL 5DKWA 5AM1A 5ALYA 3RRGA 3WXMB 2O6KA 4MFAA 4OJRA 2PYJA 3KKSA 4B3RK 1SV4A 4CNQA 2W9AA 3C1ZA 4IDHA 4FJKA 1T94A 2GUIA 5IT9O 1KN5A 5BREA 1KVBA 3KFUF 4YG2A 2MUTA 3T5JA 1NZPA 2QW9A 2KMDA 5L9XA 1BOTO 4IG0A 3E9LA 2ZG6A 1PVRA 1SKRA 1T6DA 4BRPA 4FLWA 2F4VK 4CGGA 3NTUA 3EKUA 1BPYA 1K8KA 4JKEA 1JIHA 4DV5K 1HR0K 4O3RA 4JKCA 2PFQA 4FLVA 3O3FA 2FBTA 2G08A 4UAUA 3LP2A 2NRWA 1ZQEA 1ASWA 4A5AA 5GADP 5F0XA 1N6QA 4JI0K 3UXNA 1V9PA 2HW3A 4P0PB 1EP4A 3LM9A 3CC4N 4NLGA 4CZGA 3BP8A 2BDPA 4CJRA 3NHGA 3ALYA 4MQ3A 1NGEA 9ICOA 2HHTA 4UW9A 1BG3A 1SIJA 2MRLA 1LAVA 3GIKA 4KHNA 1ZQPA 5GIOA 4FZZA 5EE9A 4O5CA 2W9BA 1IV8A 4FZYA 3CYMA 1QSYA 4JKGA 4M7YA 1NZBA 3UE5A 2YKMA 3A5OC 7ICOA 3AV9A 1DGKN 1TVRA 5DLGA 1XNQK 1JXBA 1SV5A 2F9TA 2Q0RA 3OS2A 8ICQA 1V4TA 3D2FA 3KLFA 5AQKA 2GOLA 4ECTA 2YI1A 8ICYA 2F8KA 3TANA 3MABA 3QU7A 2PY5A 3T69A 5AK6A 3RJJA 4NYNA 4AHSA 4BG9A 2Q31A 3ZD9A 5KAFU 3NCIA 1JLFA 3PZPA 3D6JA 8ICFA 1FJGK 2Y0SF 4TQRA 2UVRA 1LWEA 5HLFA 5TISU 1TK0A 7ICMA 4HUGA 2CRXA 5CZ1A 4A2AA 4NLZA 1X3MA 4CJQA 4IOXA 1U9LA 2H5XA 4QZEA 2E1EA 4PHPA 5JS2A 1GOBA 4E0DA 3TARA 1H1VA 2XC9A 4C7ZA 3DAWA 2ZUDA 4C1NI 2GWSA 4DV3K 3R9PA 3WU2U 1VSHA 3V4IA 3SPYA 1K1QA 2A1JA 2QARB 3RJIA 4C8NA 4JB3A 4FBTA 1LKYB 4Y2TA 3RF9A 4M3XA 3OYCA 2PMZC 1SL2A 2ZJAA 1WSIA 2HNZA 4EEYA 9ICAA 5HRNA 3FZFA 3WKBA 4NLBA 1IBMK 1BWFO 4ZOHC 2P9NB 4ICLA 4YXMA 4DTUA 3HSCA 2FC0A 4U6PA 1MC8A 3GBTA 4B8CA 2IHNA 1TK8A 1PK3A 5J0PA 4DR1K 3AO1A 5AM4A 7ICJA 3EN9A 3O9RA 5MLCQ 5CB1A 4QOZB 2XGQA 3UKRA 1T8EA 3QEIA 5AZIB 3DXMA 4CECA 4ACOA 3MFHA 4Z94A 4M3RA 4PGQA 1S0OA 3RWUA 3HK2A 4KLFA 3QX7A 4O5EA 7ICHA 1RTJA 1YF5L 4R8UA 4Y2JA 4E19A 1HNWK 2E8OA 3MC1A 3JPNA 4LD0A 5FPEA 5FRMA 3TPQA 4CK2A 4OLBA 3IN5A 3ASMA 4CZMA 1NWKA 4ECVA 4JHDA 2P5GA 2PFUA 1DK3A 5KTQA 5J2NA 2UXBK 1U47A 2JEFA 3SMSA 2ES6A 2MU2A 3HT3A 2BANA 3SQIA 4KN4A 1BPBA 2MUTB 4DU4A 3RBEA 4H0OA 1S0VA 3U8XA 4YR0A 5AQFA 5J0SA 4QZ9A 4RT2A 4CJ7A 4BJQA 3C5GA 1TUYA 1TYQA 3RB3A 1S6QA 1GLBG 5B8HA 4LJXA 3KK1A 1S76D 4OVLA 1K8KB 3AVAA 3TFSA 4LZDA 2R18A 3AVCA 2FPMA 3MMVA 3VF2A 4C80A 2ASJA 3OYLA 4DU3A 4GW6A 4BX9C 3AGKA 3AL0B 2P9PA 3IRXA 1BGXT 4FJGA 1X6IA 5DLFA 4QW9A 1MSWD 2FLPA 5AKZA 4KH6A 4CHQA 4CERA 5DGAA 1NM1A 1S1UA 4GVEA 4IRCA 4C4RA 1FKOA 1GLDG 4RQMA 2E2PA 4RQ6A 3I0RA 5IIIA 5AQOA 2JH7A 4CZIA 4AQYK 3BF3A 4HCCA 1HNXK 2HMPA 3TTDA 4Z4EA 4MHVA 3BEXA 3J80O 4RQ1A 1XC9A 2W9BB 3BUZB 4J2EA 1ASVA 1T4GA 4JKGB 4RNMA 3H1VX 3OS0A 5IIKA 3C94A 4DG1A 1HYSA 3MFIA 1SS6A 7ICIA 3HX0A 3RJKA 1DXSA 3D2FB 2W03A 3D2NA 4Y2QA 1J2NA 8ICAA 3UIQA 5AZJA 5FP0A 1X9WA 1NK6A 4JV1A 2HHXA 1JXLA 4M0AA 4B9QA 4BRKA 3V81A 1XUPO 2PMZF 4M7XA 1DK2A 3THWA 3MGIA 1TAUA 3VQ5A 1F5SA 3LP1A 2Q4TA 3ZSOA 1Y88A 2IOFA 5L1LA 1WSJA 3ZSXA 3PW0A 2XO7A 5ADXH 4K8ZA 3UQ2A 1CRXA 4PKIA 3N4QA 1N5YA 3SLCA 4DV6K 2HI0A 2HNYA 4DSKA 4ECWA 2KZ3A 1S1WA 2A1JB 4PL7A 3O5BA 3HYFA 3ZI4A 1YIJN 4MFFA 3HVRA 4KMOB 1DTQA 3UM9A 3WK7A 4DSLA 3T1YK 5CHGA 5C25A 5A0LA 2W54A 4MEYA 2IVPA 1E3MA 5M1FA 2KHVA 1TL1A 3P38A 3I28A 3ZSWA 4FWRA 3PY8A 2AH5A 4B3OA 3QNMA 7ICLA 4USAA 3VQBA 1WUDA 3S6JA 3WQUA 3VA3A 3K1ZA 2KSOA 3MR2A 3JPRA 3PMNA 4IWVA 4DF8A 3HI0A 3UKRB 1GOAA 1YHQN 3DXMB 3MGVA 1N62A 2WB1C 2LYAA 4UAZA 2ZJPL 3K5LA 4C8LA 2IVNA 2W8KA 1R59O 4B1YB 3QXGA 3WNFA 1YTUA 2VA3A 2H3ZA 3FAHA 3C2MA 4FWMA 3F9MA 4R8UB 1ZBUA 4F4WA 2PFOA 2K4IA 3PV8A 3L3VA 2CGJA 2PXIA 3PO5A 3MEDA 4JHDB 2ZM6K 1Z00B 3IV6A 2F76X 1RDUA 2OH2A 2GBZA 2ZGYA 3AVJA 4Z4FA 4CGZA 4O8KA 4DUZK 1RDWX 3OYKA 5AI5A 3GQCA 2K8BB 3S9HA 9ICTA 3I76A 1NMDA 2QEXN 4KLUA 4YOVA 3KIOA 3SUQA 1TYQB 3ISDA 4CF5A 4I2GA 1BCMA 3O1BA 4EAHD 5AKGA 1RILA 4BVPA 4W5QA 3I8DA 5AI9A 3H40A 4CHNA 5J2KA 4FJIA 2FE9A 2DWQA 4DSEA 3P1GA 1WYGA 5AKIA 5KG7A 2KIVA 4F71A 1NNLA 4LF6K 1T05A 8ICGA 3NDKA 2P9PB 2KKZA 1IG9A 1IM4A 3BZCA 4KB1A 3C6AA 4KHWA 4DR6K 4ED0A 1QQ6A 1FXXA 5JLHA 2FLLA 4M63C 1O13A 3CJBA 2R8IA 3LANA 1K8AO 4A57A 5ALVA 3QUCA 3G0ZA 2E6MA 4HYKA 1BCOA 2D8CA 5D3GA 4LVSA 1N48A 1UAXA 1TAMA 3CG7A 1EWQA 5BOLA 5CYQA 4CHPA 3QMLA 2J6SA 4K4GA 4CZKA 4QJFB 1RYRA 2RKIA 5AQZA 9ICRA 4BRDA 3QIOA 4DL5A 4DOAA 4DHYA 5LMUK 1HKGA 3TKAA 2AU0A 2MA1A 4O55A 2IS3A 4NL9C 3Q7BA 4B9UA 5AZJB 4EFHA 2KOBA 3A8YA 1IO2A 5J0QA 1IIPA 1EXNA 3L5KA 1OH7A 3SUOA 4Q0BA 3MDAA 2FBXA 4I2QA 3NH2A 3THWB 4CJFA 4KH5A 2NO5A 3R3LA 1ZQHA 2LHTA 2KZMA 3T19A 4OPKA 4IRKA 2VKQA 1WAJA 3U9DA 4DL4A 1O03A 1TAQA 3ZDCA 3O1WA 1TV9A 4CBUA 1HNZK 3M3ZA 3H1QA 5AM5A 2YCHA 4H5RA 3CRXA 2WFAA 2WB1F 5ALJA 3MXMA 2WF8A 3NF7A 5AICA 4FWPA 4G9BA 2XY8A 1R0AA 1KFTA 3F2KA 2VQEK 3VC8A 1NJZA 4PKGA 3GIMA 5AI0A 4DTRA 4KI4A 4QZDA 5J2PA 1WSHA 3AVMA 4GV9A 2NLXA 2IOFK 9ICQA 4O3SA 3OJSA 2KSOB 4H5WA 2YHYA 1ZQRA 5HL7L 5SWMA 4LC9B 1NGDA 1PZNA 4DS5A 4KHYA 1ZQIA 3MN7A 2Q36A 1NNEA 2RE2A 4DU1A 4ED1A 3JYTA 3K75D 2UXDK 3T1HK 1WWUA 1Q46A 2QXLA 2OWOA 5J2FA 4M2YA 4B1UB 3UQ0A 2JRZA 2GWJA 3CCVN 2YB4A 3ULDA 3VQPA 4JNEA 2G5IB 4PHDA 4B1ZA 1AROP 5HOOA 3A5MC 3L0QA 3C65A 5CZ2A 1WCNA 3BS5B 4PL2A 9ICHA 2ZWHA 3VTHA 3ED5A 2J6TA 1FIQA 2GH1A 1QZ6A 2J4RA 4WFAL 1T7PA 3LDSA 3RJFA 2YJEA 4OPJA 2G07A 4C8MA 5KT7A 3BQ2A 1S3XA 1HYVA 3DLGA 4FJMA 3JXUA 4EIAA 4XEIA 4M3UA 1BISA 1BO5O 2O4GA 1EXQA 2I7NA 2NRTA 3H0LB 3OA9A 4O5FA 2DKZA 3M6KA 5J2AA 4GC7A 1F44A 1BIZA 4DR2K 3OVNA 1SXDA 3KZIU 3VN5A 3T5LA 2GX9A 2KG5A 3QLHA 3DLBA 5BPLA 3OYBA 3HXMA 2UUAK 2C2EA 2WC9A 1TKDA 3HTVA 5AFUA 1FKPA 2W43A 3RJEA 4CZJA 4DL6A 2QB1A 5J2QA 4O3PA 3FLCO 4OKJA 2ISPA 4CZFA 3QUTA 1EX4A 1IKWA 2O8BA 3UMCA 4ECYA 2LKYA 5DB7A 2Z1GA 3SV4A 4YY3K 2BE2A 2QKKA 4QWEA 4OKEA 3CC2N 1ZYQA 5KPTA 3RMCA 4KPYA 2E8PA 3BZKA 4RPZA 9ICKA 4MDBA 3SAGA 2W7OA 1ZETA 3KHYA 4H8KA 8ICPA 3FR0A 3LK9A 3RAQA 3ZD8A 7ICUA 1NK4A 2DY4A 1ATSA 2ZIXA 5AM3A 2W9CB 4ID5A 3G10A 1S5LU 5BPCA 5GAHP 2XY7A 2IOCA 4IQUA 5KFMA 4DV4K 1TV6A 2X6NA 5J2HA 5C24A 3T7ZA 4PQUA 2BQRA 1T3VA 1ASUA 1JL2A 3O8MA 3ATVA 3K5NA 3M5RA 3ALRA 4E7LA 4UBBA 2RLTA 4DUYK 1OKJA 3HRGA 3QINA 5TKYA 1EQYA 2NRVA 2FMPA 3O3HA 1W2BM 1VK0A 3CXCM 2BCUA 3CC7N 3PLAA 4DKWA 3OYFA 4FS2A 2ZIVA 1ZQDA 3L4IA 3HPGA 1KW4A 4BXOA 4FK0A 4Z4GA 1QVFM 1MN8A 1TUUA 2F1HA 1VSMA 2D0PA 3H8JA 4IG3A 3K57A 1DT9A 5JRTA 3KKRA 1X66A 1RBRA 2AHOB 4I2IA 2XGPA 3DRSA 4EYIB 3L2UA 2F1JA 3VGLA 3V9XA 3E0FA 2EWSA 4ED7A 1S77D 2DTUA 2MSNA 1TGOA 5KFBA 1IKYA 1VSJA 2F3NA 4FWKA 2PFPA 4PWDA 4UY8O 3C23A 4X66K 2KJ9A 2P9LA 3PX6A 4CJUA 2E5LK 3HW8A 1VSKA 4BC3A 3PSFA 4BC2A 4FJHA 5KFHA 1SKSA 1HQUA 3DWLA 1NU0A 5J1EA 4DOBA 3LZIA 4L3QA 4WQ4C 4JI1K 3VEXA 3ZT2A 3O9SA 4I2PA 4QIWF 3H8SA 4OJLA 1HKCA 4OJOA 1NG9A 1RXVA 3QB0A 2YHXA 3IDWA 5GTHU 1ZQWA 4CF0A 5CR0A 2HOEA 4R63A 3D45A 1KFDA 2ASMA 4X5VA 4CEOA 3LDPA 3KD3A 3TFRA 1SAZA 3GOIA 5FPMA 2R8HA 2GLEA 2A3ZA 2IAJA 5C2DA 3CQYA 3KJVA 4BDZA 5IILA 2BTFA 3Q8SB 3FE1A 3KZBA 3WK8A 3P4IA 4BACA 4B3SK 2OTJN 4F92B 1NGGA 4H4MA 2IBKA 4IR1A 1Z6RA 3VQDA 4QWDA 5KQDA 4BR4A 3ZT0A 2XCAA 3AA5X 4PKHA 1XS9D 4GMJB 4US8A 4DL7A 5DK5A 2I1QA 1T3QA 5KFGA 3MECA 3PR4A 4HUEA 2O8BB 3F5TA 3RR8A 3OYNA 3QZ7A 1C6VA 5J0UA 2V51B 4CIFA 3C0BA 4IDKA 4DV7K 5JUMA 3HP9A 3QDKA 3KLIA 4CEAA 4FJ7A 1SZHA 4Q8EA 4BDPA 4J2DA 4ECQA 3MR6A 2ZIUA 4PHAA 4EBCA 3V9ZA 2P35A 1TFRA 2R8GA 2DFFA 2G09A 3IM1A 3N28A 1WOQA 2ZIXB 5EWFA 1W9HA 2E1FA 2FMQA 3BY5A 1PK1A 1Z25A 4MO4A 4KHSA 1NK8A 4CFDA 1BPEA 1ZD5A 2E1ZA 3C7NA 3LZJA 3SR6A 4EZ9A 3F2CA 3KKAA 4BRQA 3L2QA 3QYPA 4E7KA 5AK3A 4Q44A 1OUQA 3WK4A 5T7BA 4JV0A 2ZE2A 3AAQA 2I9GA 1LWCA 1UHUA 5EOYA 4KI6A 1V4SA 3G6XA 2ZTDA 3MXJA 4LFBK 2ZIVB 1ZQMA 1VSLA 1BNPA 3NASA 3VQCA 3CMEN 5ALDA 1XHXA 5DBAA 1UQVA 1WBBA 2DFHA 5AQHA 1ZRNA 4BXOB 2GWKA 2OPQA 3VMFB 1S8OA 3AQFA 2DQNB 2JWKA 3ZDDA 3UXPA 2QK9A 1ZQBA 1ILYA 8ICRA 1Z26A 2YJFA 4YXJA 2Y0SC 4MDAA 3OYGA 5AI6A 3PW4A 1LOTB 5C5JA 4FO0A 2JGUA 5EU7A 4LF9K 1MU2A 2EAMA 4CJKA 3MN5A 3N4MB 4ECSA 4XRHA 1LW0A 3VEYA 2FLOA 3OGUA 2BCRA 3NFAA 5KFYA 2P9LB 3M8SA 1RDDA 3EPIA 4E7IA 3SUNA 2HNDA 3M7DA 3QESA 3VQQA 1QQCA 4F50A 8ICUA 4C4TA 4KLEA 2FF3B 4CESA 2E2NA 3K4GA 3HJFA 3A0HU 3U4LA 3G71N 3QU9A 4QWAA 1NGBA 4PZOA 2AGOA 4FJNA 2ZUBA 4B9SA 2H3FA 1A5WA 2A1SA 2P6RA 5JICA 3S3OA 1S1TA 1QS4A 3D2EA 4FK4A 2FSJA 1L3TA 4UB1A 4JKDA 9ICEA 1RT7A 3TAGA 2GUPA 5C10A 3PW5A 3NS1A 2P9IA 4CD1A 1A77A 2G06A 2B0CA 5BOMA 1VQ5N 1CI4A 3K9KA 3UPQA 2B5JA 3VF4A 2UUCK 1YUWA 4CHOA 1X40A 4Y2SA 5EE3A 4TURA 4I29A 3RH5A 3PR5B 1KCFA 4BE1A 3L2WA 2CN1A 5KG3A 2QWRA 1OVYA 1COKA 3NBPA 2O4IA 1N56A 5ALRA 2QXFA 2BUPA 3ENBA 2WTFA 1VLBA 3NVZA 1RGIA 4O3QA 5DBCA 4MF8A 1QQNA 1ZQCA 3W3DA 2F44A 3OYEA 3OYIA 4ELUA 4NO7A 1NJYA 3TAEA 9ICJA 3SCXA 2E4LA 4HUFA 4MLEA 4CZHA 5CA7A 1HNVA 4A2BA 4YVZA 4ZTJA 1JLAA 3MX2A 3H0MB 2AGPA 3DV9A 3OYJA 2D4WA 4IRDA 2KIWA 5J2IA 4DS4A 9ICWA 1QZ5A 2IA6A 2KJ8A 2D0CA 3M1FA 4KTWA 5AQTA 4LFCK 4FE3A 2ZIUB 4OKKA 3IUCA 4N56A 2VWKA 1CUKA 1QQ7A 5KL8B 5TZVA 4RQ8A 2FXUA 9ICNA 4GKJK 3CQ8A 5KFLA 3IKMA 7ICSA 3DOLA 2D3DA 4NV0A 3AM9A 1PK1B 3ATUA 4UB2A 3OYDA 5GTIU 1NMNA 3B9JA 3KOOA 2D6FC 1VRTA 3C7NB 3HM9A 2BGWA 4GLXA 4MFCA 4CF8A 4WFBL 3J7YP 3CIPA 4K43A 2Q0UA 1Q9XA 5G5HA 4NM2A 3EY1A 4JI5K 3VQ7A 3P83D 3JAMO 3L4QA 1LWFA 4BRNA 5IIOA 3LWMA 5E79U 2BCVA 3EZWA 3NVWA 2M9NA 2W41A 1T03A 4FJXA 3I55N 2L5YA 3QFPA 1L3SA 1SZ2A 2PYLA 3U3GA 3DRPA 4KX5A 3HOSA 5EWEA 1DLOA 3QU5A 3S41A 1VSEA 4YFKA 3TQ1A 5CWRA 2BR0A 2UVVA 3ZX2A 2X6SA 3QZ8A 4F3TA 2NO4A 4RWTA 5J2BA 4ECRA 4DB3A 4DFDA 4KAZA 4NCBA 3OW2M 9ICBA 2W3SA 4ID1A 4B1XB 3WKEA 5DB6A 1WB9A 4F5QA 1NGCA 4DCCA 3HKZC 1KAZA 1KXPA 2JGAA 3N7PD 4YD2A 3RB4A 1PUZA 2HOIA 1PVQA 4W5RA 3IS9A 4PL8A 3KD5E 1IKXA 4J2AA 4HVJA 2HF4A 4XH4A 3TADA 4Y1CA 4DR3K 4RW9A 1RZTA 3H8WA 4UB5A 2XI9A 5HRSA 3GE1A 3MN9A 1DRGA 4J03A 3V9WA 2KK0A 2QB0A 1NGJA 2ASDA 2YQEA 5B66U 4U7BA 4CJTA 4KO0A 2IIRA 4CEEA 5J2MA 4UB6U 1WN7A 4CE9A 2ZJQL 3J81j 1L5UA 2P6UA 4ECUA 1B92A 1W97L 1WAFA 2K4EA 5AQVA 4UAWA 1JLGA 5KPZA 4DEZA 2F8TA 3AVFA 2YNHA 2OHFA 3QU2A 3FYHA 1F0MA 2RQ5A 4KH4A 3AVGA 4FLYA 3QNNA 3L3UA 1IV0A 5C2FA 2OCEA 1Z00A 3D2EB 3HSTB 5KFEA 3T1AA 3B0XA 2K89A 2P9IB 4FO6A 4MO5A 4CGDA 4EP4A 2GTDA 1S10A 1Q86O 3TAPA 4KX3A 4JAXA 1HX1A 4F2RA 3IRUA 5M1NA 2I6XA 1N61A 5M1QA 3TI0A 4FLTA 1ZQJA 2W7PA 1BPZA 3ID8A 5F1XA 5LJWA 4LF5K 3CM5A 5E84A 4JKBA 1XSLA
chains in the Genus database with same CATH topology
1VSDA 4E1NA 4DTMA 1KBUA 3RMBA 3A2FA 3ZT1A 1FK9A 4FM0A 2RHFA 2XVTA 4O3MA 4DQIA 1S9GA 3HVTA 5T14A 4FZMA 1ZBIA 1HRHA 4KFBA 2QKBA 2KHQA 3SAHA 4U7CA 2YHAA 3ZT3A 1JLCA 3KZXA 4WJ3B 3VQ6A 3NUQA 3L2VA 2I5JA 5I42A 4BWMA 4FJJA 3M8RA 3TAQA 3OYHA 3HKZF 2RP5A 3NAEA 1RT1A 3RMDA 1D8YA 4CIGA 3SI6A 4HCBA 4FJ5A 1U49A 1HEKA 3WNHA 1CLQA 1CZ9A 4DFKA 4B9TA 4K8XA 1KLMA 4JS4A 4FW1A 4DMNA 1C1AA 1NOZA 1WNSA 4N41A 3SNNA 1YTAA 5KRTA 4JRQA 1VRUA 4W5TA 1WSGA 3K2PA 4YFUA 1CXQA 4B9NA 3C29A 1KRPA 2KD1A 2DGZA 3AVLA 2JH1A 4ZHRA 2Z1JA 4B08A 3HP6A 1RBTA 3VQAA 1RT4A 4OGCA 2YKNA 1XWLA 4DWIA 4DQRA 1C1BA 1RT5A 1C1CA 4RW8A 2ITGA 4A8EA 2OPPA 4I9QA 1RT3A 5HR7A 3OS1A 1X9MA 2ZD1A 4FYDA 2YNGA 2D5RA 3VCBA 3WNEA 2ZQBA 3V1QA 2P5OA 1XO0A 2A3VA 3OPXA 4IBNA 5KGXA 4DQSA 4BE0A 4F8RA 1Q8IA 1RTDA 3NRWA 3KK3A 4CJ3A 4DFPA 4F2SA 4FZXC 1QHTA 4M3YA 5HR6A 1BQNA 3SV3A 2KKPA 3IG1A 4OJ5A 2Y1IA 2ETJA 2G5HB 1U48A 2X78A 4W5NA 1HPZA 4I7FA 3CP8A 4KRFA 2W04A 1KSPA 2G8KA 2HHSA 2XRIA 2JMGA 3CFPA 2HOFA 1Q3UA 4IC9A 3KK1A 4QNLA 2DF4B 1A5VA 4CHYA 2A1RA 5I3UA 2DFEA 3D0PA 3CFOA 1SL0A 1Z1BA 5FROA 3HPOA 2HBKA 4O4GA 1UA1A 4DSFA 4AHTA 4QIWC 4CK3A 5HRRA 3DMJA 4CGFA 4OJPA 4F3OA 3B6OA 2YB1A 5JS1A 1RT6A 1BIUA 3NH0A 2FBVA 3ZSRA 1HQEA 1NKEA 2HB5A 1KFSA 4Z4CA 4FJ8A 3SYZA 1P7DA 1UPHA 3LALA 3EZ5A 1TK5A 5E41A 4YNQA 1C0TA 1UA0A 4DTXA 2WAQC 1HNIA 4CIEA 4IFYA 4CJVA 4AYBC 4I9LA 2OM6A 3VQEA 2HVHA 3M8PA 5FRNA 1TKZA 4AHCA 2KEYA 3TAMA 4DSJA 2GV9A 3QO9A 4FLXA 1S5JA 5C42A 5CY4A 2G8WA 4CFCA 4E7JA 2IDOA 4O44A 4FVMA 1ECWA 1RBVA 5SZTA 1JKHA 2HBLA 4DFMA 3NF6A 5KRSA 2XY6A 4E7HA 4J2BA 1D9DA 4FXDA 1RCHA 4H4OA 4P0QA 3NGZA 1URJA 4DQQA 3L2RA 4FCYA 3PX4A 4O0IA 1MA7A 3SMVA 3TABA 4OLAA 1HJRA 1EKEA 3V6DA 2K8AA 3IAYA 1CZBA 3QETA 4PUOA 1XHZA 1ED1A 2WAQF 1A6SA 1RDBA 4AYBF 1CXUA 1BI4B 3KTQA 3PSPA 3JSMA 1J53A 1ZBFA 3OYMA 4CJLA 1NOYA 2VG5A 4QAGA 3LVVA 3ZCMA 4OJ6A 1NJXA 1QSLA 3SJJA 2HHUA 3T3FA 3QERA 4NCAA 2K8CB 1C0MA 3V9SA 1RBSA 3AQEA 3C6UA 3V9UA 4KV8A 4FLZA 4DTJA 1SUQA 5HP1A 2HHVA 4EZ6A 3C28A 4RG8A 3WNGA 3VQ4A 2LSNA 2HOQA 4M3TA 2YNFA 2HHWA 2OYQA 3I0SA 1SL1A 4FM2A 4NYFA 1JLBA 3MEEA 4CJPA 4M41A 1LW2A 4CFAA 4FJLA 3P5JA 3QEXA 4P0QB 2KVCA 3O0FA 4CJ5A 3AA2A 3HO1A 3PX0A 4CGHA 2KV2A 3L3FX 2KKVA 1D5AA 4BWJA 4B9VA 1ZQ1C 3S3MA 1X9SA 4BUGA 1U4BA 4ELVA 3OYAA 3QEPA 3ZT4A 3RTVA 4AILC 4CFBA 3VA0A 1JLEA 4DQPA 3F73A 2YV0X 5HROA 3QIPA 1S1VA 4O0JA 3K59A 2PZSA 1ZBHA 1D8BA 1X1PA 4GVMA 2RPIA 2LBOA 3KD1E 1K6YA 1TKTA 4N76A 2XIDA 1YT3A 1B9DA 2XICA 1NJWA 3U6FA 4PA1A 2IC3A 3SQ0A 1Q3VA 3BGRA 2Z1IA 4CEBA 4E1MA 5FDLA 4DTOA 1WSEA 1NK5A 2KNJA 3LPUA 4M42A 2F8LA 2R7YA 3RFAA 3NF9A 4EP5A 3HPHA 4CK1A 1I39A 3F5EA 4CJEA 2HVIA 3KLEA 3S3NA 4PL1A 2OXOA 3C6TA 2NUBA 3V1OA 2HBJA 5DMRA 2G8UA 3CM6A 3D2QA 2YHBA 3F9KA 2WOMA 1QSSA 4Z4HA 1DTTA 3TWHA 3LYSA 1RTHA 2LYBA 2M0NA 1PVPA 1I3AA 4E3SA 2HBMA 2NV3A 3AO4A 4FJ9A 1SKWA 4FZNA 3AA4A 4IKFA 1UOCA 2D0BA 2E6LA 4ZTFA 3U3YA 3GZFA 4FW2A 2VG7A 2AJQA 2KW4A 4M3ZA 5C0YA 2OPRA 4QCLA 3D2SA 2B6AA 1KLNA 4HHTA 4CJ4A 3OJUA 3RMAA 4KKOA 4CGIA 1JL1A 4DTPA 3NGYA 1J54A 4N5SA 1F21A 4BDYA 4UQGA 1L6NA 2HHQA 2YX8A 1Q9YA 3F53A 1RTIA 1J5OA 4M45A 3SZ2A 2F96A 1QE1A 4Q5VA 1KVAA 4KTQA 4N47A 4XIUA 4CEFA 2RRDA 2KFZA 2KQ2A 1WLJA 2D0AA 1XNSA 4LH4A 2OPSA 1S6PA 3NH1A 2RN2A 3K58A 3MAQA 4Z4FA 3LP0A 4FZLA 1S1XA 4AH9A 4FLUA 4OGEA 2CPRA 3RR7A 4DSIA 2F8SA 4CJWA 3O4NA 4KHUA 4OO1J 3DYAA 3DLHA 4CHZA 2OYYA 2N1RA 3LWLA 3DM2A 2KICA 3CFRA 3B6PA 2ZIWA 4CDGA 4NCGA 3IG5A 2EHGA 3H08A 4C8OA 3QEVA 4CF9A 1Y97A 2F77X 4G1QA 2G8IA 3O3GA 3H0RB 2VJ4A 3MXIA 4FM1A 4BE2A 3SAFA 5KL1B 4L8RB 1U45A 3DLEA 1XI1A 3F2DA 4KHQA 3BDPA 4NWIA 3NGIA 3FFIA 4JS5A 3ISNC 3DLRA 3DOKA 3AVHA 3PUFA 4O5BA 4Z0UA 3F5AA 2X74A 3VQ8A 3K5MA 1NK7A 2FBYA 1RDAA 3IP4B 2WONA 3AVKA 4C8KA 2KFNA 4CEQA 2G8HA 4KB0A 4Z4IA 3TAFA 5HBMA 3SQ2A 2JLEA 4LY7A 3KLHA 3O4QA 5CYMA 2ZXHA 1C0UA 4JLHA 2Z7JA 1GOCA 3NE6A 3ICXA 1HYZA 1O1WA 1VSFA 2Y1JA 3LPTA 4PY5A 3SQ1A 3KK2A 1L3VA 1IKVA 4C0ZA 4DLEA 3DI6A 3SPZA 1EETA 3ONNA 2YNIA 4TSXA 5KI6A 3T79A 1J9AA 3C95A 1S9EA 1YVUA 4DLGA 3IG8A 3F2BA 2ZIWB 2EX3A 3DLKA 3PSIA 1ITGA 2P51A 1QTMA 1JLQA 4WE1A 2H3VA 4CF2A 1KVCA 2XHBA 1BL3A 1HMVA 4RW4A 4IFVA 3N7RC 2IGIA 1BI4A 3NF8A 3M8QA 2ZXIA 3ITHA 2OA8A 1REVA 4B9MA 3KLGA 1NKCA 3M6ZA 3TR8A 4DTNA 2KTQA 3AO5A 4LH5A 2BDUA 1RNHA 2B4JA 5CRXA 2RF2A 3AA3A 2G8VA 1RDCA 2VIXA 1G15A 4MFBA 5KGWA 4CF1A 2VG6A 1UWBA 3DEEA 5K14A 4DF4A 1L3UA 1NKBA 3VQ9A 2H3QA 3LAKA 3OY9A 3E01A 1TKXA 2HMXA 5HRPA 2OZSA 2F2AB 4CJSA 2G8FA 2W42A 2Z1HA 3AO2A 1JXEA 2ATQA 3AVIA 2XY5A 4RW6A 1IH7A 4CEDA 2KJ5A 3LVWA 2OZMA 4CGJA 4JRPA 4NLCA 2K4HA 3N7SC 1A5XA 3DRRA 4ELTA 4LSNA 1RT2A 4M3WA 4DTSA 4AHUA 3ZSVA 3SUPA 2BGGA 2HMIA 1B9FA 3PO4A 3K5OA 2VJ5A 4F4KA 2E5SA 2H3IA 1WSFA 1RBUA 4FK2A 3GU3A 4B9LA 4E89A 2P1JA 3MEGA 4P0PA 1Z19A 2Q3SA 3LAMA 3ZSQA 2VWJA 4ICAA 1ZBLA 1VSIA 3PSTA 1HIWA 3EYZA 4B8AB 3RRHA 4LSLA 1KTQA 1LV5A 4JMUA 3AVBA 1NK0A 1LAWA 4Y1DA 3ZSZA 4HTUA 4DFJA 1GO3F 3ZSYA 4R5PA 2G0AA 4GFJA 2JHDA 4CEZA 3V1RA 4AHRA 3QNOA 2KZZA 1BHLA 4RW7A 3AVNA 4AHVA 3SQ4A 4CRXA 4KTZA 1W0HA 1NK9A 1BQMA 1A0PA 3AO3A 3THVA 1D9FA 4CCHA 4W5OA 1TL3A 3QEWA 3HL8A 1U04A 3LP3A 3RRGA 4OJRA 2PYJA 3KKSA 4FJKA 1T94A 2GUIA 1KVBA 3KFUF 4IG0A 2ZG6A 1PVRA 4FLWA 1SKRA 4CGGA 4FLVA 3O3FA 2FBTA 2G08A 3LP2A 1ASWA 1N6QA 2HW3A 4P0PB 1EP4A 4CJRA 2BDPA 3NHGA 3ALYA 4MQ3A 2HHTA 2MRLA 1LAVA 4KHNA 4FZZA 4FZYA 3CYMA 1QSYA 1NZBA 2YKMA 3AV9A 1TVRA 1JXBA 1SV5A 3OS2A 3KLFA 2GOLA 3TANA 2PY5A 4NYNA 4AHSA 3NCIA 1JLFA 3PZPA 2Y0SF 1LWEA 5HLFA 4HUGA 1TK0A 2CRXA 5CZ1A 4CJQA 2E1EA 5JS2A 1GOBA 4E0DA 3TARA 1VSHA 3V4IA 3SPYA 4C8NA 3RF9A 4M3XA 3OYCA 2PMZC 1WSIA 1SL2A 2HNZA 5HRNA 4NLBA 4ICLA 4DTUA 2FC0A 4U6PA 4B8CA 1TK8A 3AO1A 4QOZB 1T8EA 3QEIA 4CECA 4ACOA 4M3RA 3RWUA 3HK2A 1RTJA 4E19A 4LD0A 5FRMA 4CK2A 4OLBA 3IN5A 3ASMA 2P5GA 5KTQA 5J2NA 1U47A 2BANA 3HT3A 3SQIA 4DU4A 4BJQA 1S6QA 4OVLA 3AVAA 2R18A 3AVCA 3OYLA 4DU3A 4GW6A 4BX9C 3AL0B 3IRXA 1BGXT 4FJGA 4CHQA 4CERA 1S1UA 1FKOA 3I0RA 2JH7A 4HCCA 4Z4EA 1XC9A 4J2EA 1ASVA 3OS0A 3C94A 4DG1A 1HYSA 2W03A 3D2NA 3UIQA 1X9WA 1NK6A 2HHXA 2PMZF 3VQ5A 1TAUA 3LP1A 2Q4TA 3ZSOA 1WSJA 3ZSXA 2XO7A 4K8ZA 1CRXA 1N5YA 2HNYA 4DSKA 1S1WA 3HYFA 3HVRA 4KMOB 1DTQA 4DSLA 5C25A 5A0LA 2KHVA 1TL1A 3ZSWA 3PY8A 4B3OA 3VQBA 1WUDA 3VA3A 3K1ZA 4DF8A 1GOAA 3MGVA 2WB1C 2LYAA 3K5LA 4C8LA 3WNFA 1YTUA 2H3ZA 1ZBUA 2K4IA 3PV8A 3L3VA 3PO5A 3MEDA 2F76X 2OH2A 2GBZA 3AVJA 4CGZA 3OYKA 2K8BB 3S9HA 3KIOA 3SUQA 1BCMA 1RILA 3I8DA 4W5QA 4CHNA 4FJIA 4DSEA 3P1GA 1T05A 1IG9A 3NDKA 4KB1A 4KHWA 1FXXA 3LANA 3G0ZA 2E6MA 1BCOA 5D3GA 1UAXA 1TAMA 3CG7A 5CYQA 4CHPA 4QJFB 2RKIA 3QIOA 2MA1A 4O55A 2IS3A 4B9UA 2KOBA 1IO2A 1IIPA 3SUOA 4Q0BA 2FBXA 4I2QA 3NH2A 4CJFA 4OPKA 2LHTA 3T19A 2KZMA 2VKQA 1WAJA 1TAQA 3CRXA 2WB1F 3MXMA 3NF7A 2XY8A 1R0AA 3VC8A 1NJZA 4DTRA 4KI4A 5J2PA 1WSHA 3AVMA 3OJSA 5SWMA 4DS5A 4KHYA 4DU1A 3JYTA 2YB4A 3ULDA 3VQPA 2G5IB 5CZ2A 4PL2A 2GH1A 1T7PA 3LDSA 4OPJA 2G07A 4C8MA 1HYVA 3DLGA 4FJMA 4M3UA 1BISA 2O4GA 1EXQA 3H0LB 3M6KA 1F44A 1BIZA 3OVNA 3VN5A 3QLHA 3DLBA 3OYBA 3HXMA 1TKDA 1FKPA 5J2QA 4OKJA 1EX4A 1IKWA 2LKYA 2Z1GA 3SV4A 2BE2A 2QKKA 4OKEA 1ZYQA 3RMCA 4KPYA 3SAGA 2W7OA 4H8KA 1NK4A 2DY4A 2ZIXA 4ID5A 3G10A 2XY7A 2IOCA 1TV6A 2X6NA 5C24A 4PQUA 1ASUA 1JL2A 3K5NA 3ALRA 4E7LA 3QINA 3O3HA 1VK0A 3OYFA 2ZIVA 3HPGA 4FK0A 4Z4GA 4IG3A 1VSMA 3K57A 3KKRA 1RBRA 3DRSA 3L2UA 3V9XA 3E0FA 2DTUA 1TGOA 1IKYA 1VSJA 4PWDA 2KJ9A 3PX6A 4CJUA 1VSKA 3PSFA 4FJHA 1HQUA 1SKSA 5J1EA 3LZIA 3ZT2A 4I2PA 4QIWF 4OJLA 4OJOA 4CF0A 3D45A 1KFDA 4CEOA 2IAJA 3KJVA 4BDZA 4BACA 4H4MA 3VQDA 3ZT0A 3AA5X 4GMJB 5DK5A 3MECA 4HUEA 3OYNA 3RR8A 1C6VA 4CIFA 4IDKA 3HP9A 3KLIA 4CEAA 4FJ7A 1SZHA 4BDPA 4J2DA 2ZIUA 3V9ZA 2DFFA 2G09A 2ZIXB 1W9HA 2E1FA 1Z25A 4KHSA 1NK8A 4CFDA 3LZJA 4EZ9A 3F2CA 3L2QA 4E7KA 1OUQA 5T7BA 2ZE2A 1LWCA 4KI6A 3MXJA 2ZIVB 1VSLA 3VQCA 1XHXA 2DFHA 2OPQA 3AQFA 2DQNB 2QK9A 1Z26A 3OYGA 2Y0SC 2JGUA 5EU7A 1MU2A 4CJKA 1LW0A 3NFAA 3M8SA 1RDDA 4E7IA 3SUNA 2HNDA 3M7DA 3QESA 3VQQA 1QQCA 4CESA 3HJFA 4FJNA 4B9SA 2H3FA 1A5WA 2A1SA 3S3OA 1S1TA 1QS4A 4FK4A 1L3TA 1RT7A 3TAGA 2G06A 2B5JA 4CHOA 1KCFA 4BE1A 3L2WA 2CN1A 3NBPA 2O4IA 2QXFA 3L8BA 3OYEA 3OYIA 4ELUA 1NJYA 3TAEA 3SCXA 2E4LA 4HUFA 1HNVA 4ZTJA 1JLAA 3H0MB 3OYJA 2KIWA 2D0CA 4DS4A 3V81A 2KJ8A 4KTWA 4FE3A 2ZIUB 4OKKA 4N56A 4KREA 2VWKA 5KL8B 3CQ8A 3DOLA 4NV0A 3OYDA 2D6FC 1VRTA 3HM9A 4CF8A 1Q9XA 3EY1A 3VQ7A 3P83D 1LWFA 3LWMA 4FJXA 1T03A 1L3SA 2PYLA 3U3GA 3DRPA 4KX5A 1DLOA 1VSEA 2X6SA 4F3TA 4KAZA 4NCBA 4ID1A 3HKZC 2JGAA 3N7PD 2HOIA 1PVQA 4W5RA 3IS9A 3KD5E 1IKXA 4J2AA 4HVJA 4Y1CA 4RW9A 5HRSA 2XI9A 1DRGA 3V9WA 4CJTA 4KO0A 4CEEA 5J2MA 1WN7A 4CE9A 1B92A 1L5UA 1WAFA 2K4EA 1JLGA 2F8TA 3AVFA 2YNHA 4FLYA 3QNNA