3CYMA

Crystal structure of protein bad_0989 from bifidobacterium adolescentis
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
415
Chain Sequence
EPKLLAEPREGVPNVIDTLPAFRDYCSELASSHGSLAADAERASGFRYGHEDWLVQFKRDGAGIGLLDPQALAAAGADWNDFNRAVGDAVWILHDSLQDLPGFDELGMEPQRLFDTEIAARLLGLKRFGLAAVTEHFLGLTLAKEHSAADWSYRPLPRDWRNYAALDVELLIELETKMRAELKRQGKMEWAQEEFDYALKEGLGPRKEHLIPWMHVSHITEVMRDRQALAIVRALWTRRDELAREYDIAPTLLLSDSSIIEVAKRKPHNAAQFRSIRSINERVRIHTDSEQDKMFERYAPIQRKIKPSMWKNIIQDALALPPSEWPDSAPKSIRVWKERYPERLQVLNRVRKAVSQIAEDTRTPVEIVIKPQYLRNLCWTDEPRKRDVARFLSEQGARDWQVSLVAESVSRAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein BAD_0989 from Bifidobacterium adolescentis.
rcsb
source organism Bifidobacterium adolescentis atcc 15703
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein BAD_0989
total genus 150
structure length 415
sequence length 429
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
A PF18305 DNA_pol_A_exoN 3' to 5' exonuclease C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3cymA03
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3cymA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cymA01
4FK0A 4OO1J 1IKVA 1BQNA 4O0JA 3OYDA 4JS4A 3OYLA 3SAHA 4DTSA 2OPSA 3CYMA 1A5WA 2GUIA 2RKIA 3AV9A 4LSLA 2WOMA 4HUEA 2PYLA 2IOCA 3VQPA 4CDGA 4KB0A 1VSMA 2HNDA 4YFUA 2DGZA 2XY7A 4FJ7A 4O55A 4CESA 3LZJA 1L3UA 1S1WA 3V1QA 4KO0A 5KRSA 1T05A 4B8CA 1S9GA 4FK2A 1S9EA 2HBKA 3AO3A 5CYQA 3ZSZA 5HP1A 1UWBA 4B9LA 1J53A 4BE0A 4N56A 4O0IA 4DQQA 1RT7A 4I2QA 1XHZA 1L3TA 3KTQA 3MXJA 4FJJA 4OLAA 3C6TA 1O1WA 4CE9A 2Q3SA 3LAMA 3LP0A 3H08A 4IBNA 2A1SA 1RT3A 4CEOA 4BE1A 5HROA 1BGXT 4FXDA 4FLTA 2E1EA 2FBYA 4CEQA 1VSKA 1WSJA 3SUQA 5T7BA 1UA0A 4N5SA 3CM6A 3MEDA 2D0BA 5J2MA 1RBSA 1VRTA 4CFCA 4BWMA 4FCYA 1X1PA 3BDPA 4FZZA 3ZT3A 3NH2A 3HPHA 3F9KA 3ULDA 1W0HA 1NKEA 1LV5A 4DSJA 4CIFA 3SQ0A 2HBLA 1G15A 3PX6A 1IG9A 3AO5A 4W5OA 2KFZA 4NLBA 1S1TA 3AVHA 4RW4A 3QEIA 3SNNA 3O3HA 1GOCA 2DFFA 1JLQA 2Z1GA 4Y1CA 1HMVA 3C6UA 3L8BA 4FJNA 4QCLA 1NK7A 4KHUA 1REVA 2GBZA 3SUNA 1BI4B 4M3YA 1LW0A 4JS5A 3PY8A 4IFYA 1JXEA 2I5JA 2HB5A 1TVRA 3QLHA 1GOAA 3AA5X 3KJVA 2HHWA 2VG7A 3FFIA 4AHCA 5C42A 4NLCA 5HRPA 4BDZA 1NKCA 5CZ1A 4DSIA 3TAFA 1ZBUA 5J2QA 4H4MA 3ASMA 1RNHA 5J1EA 4R5PA 4CJTA 3OYHA 4KRFA 4DU3A 4TSXA 4DTRA 2XRIA 1EP4A 1KCFA 2Y1JA 4DTOA 1JL2A 4OKJA 1L5UA 3V81A 3PX0A 1RT4A 1MU2A 3CQ8A 1CXUA 3LAKA 2G8KA 2Z1HA 1RT6A 4B3OA 2DFHA 4GVMA 3QIOA 3OYJA 1BCOA 1ZBLA 2ETJA 4M3ZA 1A5XA 3CFRA 1T7PA 4JLHA 3SAGA 4B8AB 2HHVA 2CPRA 3ZSWA 4W5NA 1YT3A 3ZT2A 2X6NA 1U47A 4J2AA 4CEDA 4DMNA 2E6MA 2KTQA 3DRSA 2HNYA 1NK8A 3OYKA 4J2BA 2YNHA 1TKZA 2HHXA 4HCBA 4CERA 3S3MA 4BDPA 1SKSA 2G8IA 4MFBA 5HBMA 4CF1A 1JLCA 4FM0A 2BDPA 1WUDA 1HQUA 3OVNA 3ZT4A 4W5RA 2P5GA 3OJUA 1VSFA 1S1XA 3VQQA 3KLFA 3ZT1A 4CJPA 4ZTFA 1TGOA 1FXXA 3VQAA 4NYNA 3AVGA 2FBTA 5EU7A 3VQDA 1VSEA 3V9UA 4DSEA 1VSIA 1CLQA 3QEXA 1NJXA 3L3UA 5D3GA 1RBUA 3M8PA 4FJ8A 1KLNA 3KLIA 2KFNA 1ASVA 3PUFA 1SUQA 1K6YA 4DQIA 4J2EA 4Z4GA 4CIGA 4N41A 3OYFA 1KRPA 4FW2A 3SZ2A 1Q8IA 4XIUA 2RF2A 3AA3A 4OLBA 3DOLA 3AO4A 3KLHA 4DLEA 4HCCA 1TK5A 1EXQA 4E1MA 4IG3A 2XY8A 3NHGA 3K5MA 3L2QA 2HBMA 2VWJA 4HHTA 4KHQA 1ASWA 4E89A 1Q9XA 3DRPA 3OS1A 1C1CA 2YKNA 3SV3A 1KSPA 4FLYA 3LZIA 1C0MA 3KKRA 2E1FA 3V1OA 1QQCA 4FLXA 1ZYQA 3HO1A 2BGGA 2YNFA 3CM5A 4IFVA 1SL2A 2VG6A 2YV0X 1D8YA 4GMJB 3RR8A 3HVRA 3TAEA 1BCMA 1YVUA 4CGGA 1RT1A 1LWFA 1Z26A 4DFPA 4CHOA 3QERA 4OVLA 2G8HA 4Z4FA 4AH9A 1ZBHA 4CFAA 4KTZA 4Z0UA 2OPPA 3AVNA 4CEEA 4PY5A 1S5JA 4DG1A 3ZSYA 4CFBA 1X9WA 1NK9A 1D9DA 4G1QA 4FK4A 4FYDA 3NF9A 3RRGA 4ELTA 4E7KA 1ZBIA 4LY7A 5KRTA 1I3AA 4E7HA 4FJMA 3IS9A 1R0AA 4W5TA 3AVMA 3ZSRA 3QNOA 4UQGA 1JXBA 4AHRA 3K5NA 4LD0A 4CEAA 2OZMA 3AA2A 3L3VA 3MXIA 1ITGA 4M3RA 1UA1A 1D9FA 4M3UA 5KGWA 4FLVA 1RDAA 2IAJA 3QEPA 1HYZA 2GV9A 4CJVA 3M8RA 3VA3A 3SQ4A 2DTUA 1TKTA 5DMRA 4DTXA 1J9AA 1C6VA 1JKHA 4OJRA 1NK0A 4KREA 5E41A 4CF8A 4PWDA 4JRQA 4BWJA 4AHTA 3NCIA 4DLGA 3T1AA 4E1NA 4CCHA 2NUBA 1RTDA 3V9XA 1NKBA 3K2PA 5FDLA 1VSDA 3B6OA 3ZSOA 3KK1A 1J5OA 3LP2A 4K8ZA 1U04A 4Z4IA 2IGIA 1I39A 1WSHA 3LANA 4K8XA 4CJRA 4F4KA 1VSLA 4F3OA 1VRUA 2PY5A 1HJRA 4CIEA 5HRNA 3RWUA 4KTWA 1TKXA 3O3GA 3AVBA 5J2PA 4ELUA 4CJ3A 2KV2A 1IH7A 1RTJA 3NGYA 2PZSA 3TI0A 4CGHA 1HNVA 1UAXA 3VQEA 3P5JA 2PYJA 3MXMA 1Q9YA 1TKDA 3VQ9A 4M41A 4QJFB 4DSFA 3O3FA 2O4GA 5SWMA 1JLFA 3QESA 3KK2A 3SI6A 4CJKA 1KVAA 1W9HA 3HXMA 1EX4A 4E7IA 4DF8A 3C94A 4IG0A 4LH4A 3SPYA 4C8OA 1T03A 4NCBA 1B9DA 1KLMA 5FRMA 5CY4A 4WE1A 4MQ3A 3DMJA 4ICLA 4ID1A 4KFBA 4B9MA 3NGZA 3WNFA 2XHBA 1CZ9A 3TARA 3V9SA 3VA0A 2FC0A 2XY6A 3VN5A 2IC3A 2B6AA 1NJYA 1FK9A 3AVJA 4AHUA 4FJ9A 4DTMA 1F21A 3TAMA 2OPRA 4W5QA 4DQSA 3NF6A 4ELVA 2HNZA 4HUFA 3L2WA 1C1AA 1QTMA 2O4IA 1IKYA 2QXFA 3DOKA 3IAYA 4CEFA 3G10A 3LP1A 3LDSA 1HYSA 4M45A 4CHPA 4KAZA 1LAWA 1U4BA 4PUOA 3HP9A 4H4OA 1ZBFA 4RW7A 3V9ZA 1BHLA 3QINA 2X6SA 4HTUA 2RN2A 2G8FA 4J2DA 4KHNA 1WAJA 3QNNA 2G8VA 3RR7A 4CJ4A 4AHSA 4FM2A 1VSJA 1HNIA 4BE2A 4DSLA 1SV5A 2XY5A 1J54A 1C1BA 4CECA 1B92A 3JYTA 4CHNA 3V4IA 3E01A 2EHGA 4FJKA 5I3UA 1RTHA 4HVJA 4PQUA 1BIUA 4CJSA 3K58A 1RDCA 3AVCA 4CFDA 3LWMA 1EKEA 3F73A 2FBXA 1SKWA 4FZYA 3NAEA 3MECA 3DLKA 4AILC 3QEVA 3PO5A 4JRPA 3T19A 3KKSA 3SCXA 1X9SA 1BI4A 4CK3A 1JLGA 1RT5A 1JL1A 1LAVA 3WNGA 4BACA 1X9MA 1WSGA 3OYEA 3UIQA 4O5BA 2QKBA 3A2FA 5CZ2A 3DLRA 3MAQA 4O3MA 1WSIA 1SL0A 3RMCA 2BE2A 4KKOA 2JLEA 4N47A 4H8KA 3SJJA 3NGIA 2QK9A 3M8QA 4DTPA 1GO3F 3HSTB 3OYCA 1RCHA 3NF8A 3ITHA 3EZ5A 4DQRA 2KQ2A 4BDYA 1LW2A 3SYZA 2YNGA 4CF9A 3OYNA 3OS0A 2X74A 1JLEA 4FLUA 3AVLA 2F8TA 1VK0A 5J2NA 4NYFA 4CJUA 3LWLA 3AO2A 4CF0A 1BQMA 3S9HA 4CJFA 3ZSQA 1TK8A 1CZBA 5I42A 1IKXA 2OYQA 2VG5A 4M3XA 4M3WA 2AJQA 1N5YA 3DLHA 4OPJA 1RILA 3QEWA 1UOCA 1KFDA 4C8LA 1BISA 3TAGA 4IDKA 1BL3A 3NE6A 3VQCA 4PA1A 1U48A 3NH1A 4E3SA 1XWLA 4B9UA 3I0SA 4N76A 2E6LA 4F8RA 2QKKA 3NFAA 5C24A 4DTJA 3I8DA 5KTQA 2Y1IA 1NK6A 4OGEA 4E0DA 1Z25A 3U6FA 3B6PA 1WNSA 1JLBA 1WN7A 2B5JA 2Z1JA 3K57A 1RDDA 3DLEA 5DK5A 4C8NA 5FROA 4I9QA 3L2RA 1HQEA 4OPKA 3C95A 4OGCA 4CJEA 1KFSA 1C0UA 2ITGA 3AVAA 4EP5A 4F3TA 1RBTA 4CGIA 4CHZA 2D0CA 4AHVA 3S3NA 3KK3A 4RW8A 3MEEA 4CF2A 3K5LA 3SUPA 4KTQA 4CEBA 2HVIA 4ZHRA 1QSYA 3WNEA 3HK2A 4FZXC 5JS1A 4YNQA 3LALA 3THVA 3VQ4A 1U45A 3TR8A 2P51A 3DRRA 2YHAA 4DQPA 4KHSA 1QE1A 3U3GA 1S1VA 1XC9A 3HP6A 1TAUA 1FKPA 4FJ5A 3NDKA 5FRNA 1IKWA 4B9VA 3V1RA 3IG1A 2HHTA 1RBRA 3ZSVA 4CGJA 3CFOA 4CEZA 2HHQA 2G8WA 4RG8A 5C0YA 3PV8A 4O4GA 2YKMA 4CHQA 2G8UA 3TWHA 4KI6A 4RW9A 2W42A 4F2RA 1A5VA 2KZMA 4O44A 1HRHA 3OJSA 3KIOA 3RMAA 4Y1DA 2VWKA 2OZSA 3NF7A 4E7LA 4DTUA 3OYAA 3OYGA 4CJ5A 4KPYA 3NBPA 4FW1A 4CJWA 3MEGA 3TANA 4Z4CA 2B4JA 2F8SA 3EY1A 3L2UA 2WONA 3L2VA 1DTQA 4ZTJA 3OYBA 2YHBA 1DLOA 4E19A 3TABA 4Q0BA 1C0TA 3RMBA 4LH5A 1YTAA 3M8SA 1NOYA 1WAFA 3DI6A 3KD1E 4NCAA 4CGFA 4HUGA 2LSNA 3SAFA 1VSHA 3V9WA 4CJQA 2JGUA 2DFEA 2ZQBA 3TAQA 2HBJA 4F2SA 2RRDA 5HLFA 4GW6A 1WSFA 2HHUA 2MA1A 3V6DA 4B9SA 1EETA 4FLZA 1HYVA 3AA4A 4CJLA 3LPTA 4I7FA 4NCGA 4DU4A 1S6PA 3AO1A 3HT3A 1N6QA 4FJXA 3NH0A 1DTTA 2D5RA 4DFJA 1LWEA 1Y97A 5JS2A 3KLEA 2X78A 3P1GA 4LSNA 3D0PA 3SPZA 1NJZA 4DWIA 1T8EA 4Z4EA 4EZ6A 1FKOA 3G0ZA 4DF4A 3SQ1A 3VQ5A 2XO7A 3SV4A 3SQ2A 1BIZA 1D8BA 2DY4A 4B9TA 2Z1IA 3DM2A 4C8KA 3ZCMA 1S6QA 5HRRA 1SL1A 2P5OA 4C8MA 4CK1A 3ZSXA 4FJGA 3AVIA 4KB1A 1JLAA 4FM1A 4KHWA 1B9FA 3QO9A 4DFKA 2OPQA 4FLWA 3IRXA 4OKEA 2R7YA 3LP3A 2EX3A 5K14A 4DTNA 3DYAA 1S1UA 1KTQA 3DLGA 3ISNC 1TK0A 3LPUA 3U3YA 3EYZA 1HPZA 3RRHA 1TV6A 3VQ8A 4DSKA 1GOBA 4L8RB 4Z4HA 1KVCA 3QIPA 2HHSA 4OKKA 3VQ6A 4ID5A 4EP4A 2A1RA 3O4QA 4EZ9A 3JSMA 2D0AA 1RDBA 1TL3A 3HM9A 4DS4A 4QIWF 3QETA 2P1JA 3RMDA 4DS5A 1YTUA 1KVBA 4KV8A 4B08A 4RW6A 3HPGA 1RBVA 2KZZA 4QAGA 2RPIA 4KHYA 1TAQA 1QHTA 1L3VA 4M3TA 3CG7A 2E4LA 2OA8A 3KLGA 4FJHA 3HL8A 5HRSA 3PO4A 3HYFA 3D45A 2HW3A 4E7JA 4DFMA 3SUOA 1IO2A 1XI1A 3P83D 2HMIA 3OY9A 1L3SA 3ALYA 5KI6A 3HPOA 1WLJA 1LWCA 2IS3A 3VQBA 4M42A 2IDOA 1NK5A 4Q5VA 4DU1A 3TAPA 4QOZB 3HVTA 3I0RA 3KD5E 3PX4A 3OYIA 1NOZA 2RHFA 3DLBA 1D5AA 3CFPA 4FJLA 1NK4A 4B9NA 2ATQA 1WSEA 2ZE2A 4CK2A 1NJWA 1QSSA 2KW4A 3O4NA 3VQ7A 4FJIA 1RT2A 3K5OA 2F96A 4I2PA 4CGDA 4FVMA 5SZTA 3BGRA 3RTVA 3AVKA 3K59A 4CGZA 3T3FA 4I9LA 4IKFA 1TL1A 3ZT0A 3WNHA 1QSLA 3OS2A 2HVHA 2BANA 2FBVA 3S3OA 4CHYA 3OYMA 1ASUA 5KGXA 5CYMA 1CXQA 1QS4A 3AVFA 5C25A 1SKRA 1XHXA 4KI4A 1RTIA 3HJFA 1U49A 2ZD1A 2YNIA
chains in the Genus database with same CATH superfamily
4FK0A 3VEZA 3RB0A 4O0JA 3LDLA 4JS4A 1SWWA 3OYLA 3O5BA 4DTSA 4DV1K 2F1IA 3D6RA 3VEWA 1ZD5A 4X66K 2WOMA 5AKEA 2AP1A 1A6SA 2OH2A 1GLJO 5AQWA 3G25A 2QI2A 3VQPA 4O55A 7ICRA 4OD0A 2F1JA 1NZPA 7ICEA 9ICXA 3QXGA 4B8CA 4YOUA 3QUCA 2HBKA 4QZCA 4ED6A 4LC9B 4BE0A 1XNQK 4DQQA 3O1BA 1EWQA 2FMPA 4FWOA 4BE1A 4LF7K 4FXDA 1Z19A 1BGXT 3VEOA 4FLTA 2FBYA 2OEHA 1WSJA 4BUGA 3RJKA 5ADXH 3MEDA 5AI9A 3ZT3A 5L1KA 3HPHA 1LV5A 1W0HA 3AAPA 1SXDA 3PX6A 2ZIUB 1IG9A 1VQ7N 1OH5A 5J2CA 3JAMO 3NGDA 4KLMA 4DQ8A 4QIWC 1COKA 1S1TA 3IUCA 2M0NA 3QEIA 3ICXA 3WK4A 3EPGA 3O3HA 4H5NA 5F9NA 3E9OA 3GQCA 1N34K 2W54A 3QZ8A 3VOVA 4FJNA 1NK7A 3F2KA 2QB0B 2HF3A 4IOCL 3SUNA 2DPIA 4M3YA 4QW8A 2IHMA 2FLNA 4UBBA 1KAXA 5L9XA 2IMWP 1GLCG 3AA5X 1DK2A 2E1YA 5AQJA 3CCUN 4AHCA 5AQOA 4OJLA 1QHAA 2FLLA 5BREA 5J8YA 4H4MA 2DPNA 5J1EA 2I9GA 3OYHA 3TTFA 5DGAA 1XQSC 5JMVA 1KCFA 4OJPA 4P0PA 1JL2A 1Q18A 5KPTA 2WB1C 1ZQRA 3V81A 1HNWK 2HHHK 1C20A 3CQ8A 2E8OA 3DEEA 2G8KA 4DV7K 1Z4OA 2DFHA 5AQLA 3O80A 1KQSM 3KZIU 3CFRA 1T7PA 4JLHA 1BPXA 4KLTA 4ED7A 5KFXA 2CPRA 4HYKA 4NO7A 1EXNA 4J9RA 3WEEB 5DKWA 2YQEA 4O5EA 4BREA 4KLEA 2X6NA 5E84A 1VQKN 4J2AA 4JD2A 3QUTA 1BO5O 4H5WA 9ICWA 2CN1A 3RBEA 2ISPA 2KKVA 1TKZA 4B9QA 2WUSA 2G8IA 4MFBA 4FM0A 3FC4A 4DEZA 2BDPA 1HQUA 4W5RA 1HUOA 5BRDA 3ZDCA 2PFQA 3C6AA 4CJPA 5E79U 1FXXA 2C2DA 3QUBA 4K42A 3VQAA 3VQDA 3V9UA 1XU4A 4DSEA 3Q7CA 1VSIA 4JKHA 1NJXA 1NMDA 4JKAA 2LBOA 1HPMA 4B1ZA 3UMGA 2KFNA 3PUFA 3VGMA 1K6YA 4K41A 1ZXIA 2O8DA 3OYFA 1G99A 3SZ2A 4FW2A 4XIUA 1VHXA 2W40A 3SK3A 3DOLA 5J2HA 3KLHA 2G07A 2E20A 3RB6A 1EXQA 3ZLJA 1YZ7A 4C7ZA 5LL6Z 3NHGA 1PUZA 1W97L 3L2QA 4ED8A 9ICNA 2DF4B 4BGBA 1C1CA 2YKNA 1KSPA 3TPQA 1HNZK 3LZIA 4B1YB 3UMBA 3J8AA 2KHVA 2RHKA 4ICAA 3KKRA 1QQCA 4HWIA 5C15A 1ZYQA 2J6UA 1J2MA 1LKYB 4LF6K 3ETRA 2VCPA 4RPZA 2YNFA 4IFVA 3CCLN 2VG6A 2YV0X 5KFLA 3RJFA 1GLLO 2Y9UA 3SLCA 1ZQWA 2R8IA 4YOVA 1RQLA 3HVRA 4DUZK 2HMPA 1Z26A 3TAEA 4DFPA 4CHOA 2WC9A 5ADXA 5J0OA 1ZBHA 7ICIA 4F5QA 4PY5A 5IILA 2WF8A 5EWFA 3ZSYA 1HIWA 3CCRN 5ALQA 1Q3VA 3NF9A 4E7KA 4LVSA 4LY7A 1I3AA 4BRLA 2R8JA 5ALOA 4RT2A 2ZUDA 4UQGA 5FPNA 4FFDA 4AHRA 2LYAA 1JMSA 2OTJN 4IR1A 4LD0A 2KSOA 3L3VA 1P7DA 1ITGA 8ICOA 5KGWA 2IAJA 2ZJPL 2IOFA 5BPLA 5LMUK 3WKBA 3T5KA 4OJRA 4KREA 5KT7A 5KFDA 4F5NA 5KFAA 1NLVA 4PWDA 4BWJA 4Q8FA 3TKAA 5KFSA 3ZD8A 2UUCK 3ULEB 1NKBA 3AGKA 4JI2K 3KK1A 4C4SA 1DEJA 1U04A 4RZRA 5IIOA 2QB1A 4F3OA 1VRUA 1OUQA 1OH7A 3RWUA 4KTWA 4ELUA 5DDMA 2KV2A 5ALGA 3UXNA 1IH7A 1N5XA 2QLTA 1HNVA 2I7NA 2Q4TA 3P5JA 2PYJA 1HNXK 2ZJ5A 3LM9A 2I1QA 3MXMA 4KITB 2FF6A 4BRNA 5AQZA 1Q82O 3N7SC 3VQ9A 2O8BA 1KXPA 3N28A 1NNEA 5SWMA 5AHXA 4UAVA 1T3QA 8ICGA 3CC7N 1D8LA 4JWMA 1EQYA 5AQHA 4DF8A 4IG0A 4LH4A 5DBBA 4M9HA 7ICKA 2D3DA 4NCBA 1ILYA 5LMNK 2E8PA 1CI4A 3VA3A 4UB8U 5KFBA 3DMJA 4MQ3A 4IEEA 3WNFA 3O9RA 1ZQMA 2XY6A 3O1WA 3VN5A 3VGKA 5AQFA 3O9UA 4NV0A 5IIIA 1FFVA 4NB4A 4FJ9A 4DTMA 1F21A 3QUQA 3NF6A 4QZDA 1XNSA 3TU5A 3L2WA 3QDKA 5BN9A 1QTMA 2P9PA 4FBUA 2NYVA 4USAA 3MWTA 5EXWA 3BF1A 4ILHA 4UB6U 1KD1O 4I28A 4YG2A 4KAZA 3TTDA 3ZEUA 1WYGA 4JK1A 4RW7A 4KX5A 5CP2A 4KX3A 2X6SA 2RN2A 2G8FA 3MGVA 1Y64A 3QNNA 1EO1A 1NGEA 1NZBA 5BOMA 3AL0B 4AHSA 1N8RO 1VSJA 1HNIA 2GO7A 4JKGA 1HLUA 2VKQA 4RNNA 3GDXA 2BR0A 2XY5A 2P9KA 1S0OA 4A5AA 1NJIO 1B92A 3LM2A 3MX5A 2BTFA 3E01A 1N48A 4NWIA 5KT6A 1BIUA 3NS1A 5HHIA 4CJSA 4CFDA 3THYA 4PQUA 5KFVA 2FBXA 5EOZA 1Z00A 4FZYA 5TZVA 3DXKA 5KT4A 2GLEA 3NAEA 1Q86O 3DLKA 4QZFA 9ICGA 4ECVA 4GIBA 1XSPA 2ZJ8A 1S77D 5JU5A 3KKSA 3T19A 3MR5A 1ZQ1C 4JI8K 2W3SA 2XCAA 2WF6A 1UPHA 1MN8A 2G06A 4K43A 1JCFA 2Q0RA 1NMNA 2K8AA 1ZQSA 3DLRA 5KQ8A 4MO4A 1SL0A 3WK6A 3CF5L 1GLFO 2KK0A 3SQ4A 4KN4A 4M2YA 2OYYA 3ATVA 4MFCA 1RCHA 5B66U 4RQ2A 2PFOA 3NF8A 5HNKA 3QFPA 4DQRA 4EHUA 2WAQC 4DFDA 3MGHA 4BDYA 1YXQA 2ASJA 3OYNA 3OS0A 3VERA 1J5EK 1JLEA 4FLUA 3LVWA 5J2NA 3KK7A 2PKEA 3TADC 3PVXA 3QBXA 5C2DA 8ICRA 1TE2A 5J2EA 4CF0A 1BQMA 4MFFA 3WK8A 4RUCA 2ASDA 3ZSQA 4QS9A 3K4GA 2VG5A 4Q44A 8ICZA 3MN7A 4CZMA 1IBLK 3CJBA 4A57A 2EZXA 1BISA 1BPBA 3K1ZA 4IDKA 2XGPA 4X65K 3NH1A 5ALJA 5AKZA 4N76A 3EEQA 2QKKA 4QZEA 1PK1A 4DTJA 4I2EA 4DL3A 3EWAA 4IO9L 5AQPA 3U6FA 5DDYA 2B5JA 1DGSA 3A5NC 3C7NA 5DK5A 1BU6O 4WFBL 5CWRA 4OGCA 2EAPA 3HJEA 4EAHD 1IV8A 3AVAA 4JYAK 1RBTA 2PAVA 2RP5A 3S3NA 3CCQN 4JKCA 1ZQGA 2BPGA 1Z6RA 1QSYA 5EY4A 8ICXA 5JS1A 3E58A 9ICOA 4A62A 4DQPA 2YHAA 2GWKA 1S72N 1ZQNA 3PSPA 1X2IA 5AIAA 2F3NA 1RXWA 1TAUA 1NNLA 5ALRA 3NDKA 2O8FB 3LYSA 4B9VA 5J2AA 2HHTA 3IG1A 5KL1B 3ZSVA 5HR6A 2MAXA 4I27A 3CFOA 5AM0A 4H0TB 5E26A 4CGJA 2G8WA 3DXMB 4IXCA 4KLHA 5F3XB 3TWHA 1TVAA 4RW9A 1YVNA 1HRHA 2V52B 1VLBA 5F9LA 1S76D 3KIOA 4I2CA 4E7LA 4JI7K 3AMZA 4J9KA 1ZXOA 3OYGA 4FW1A 1SB3C 2QKQA 1PK3A 2L5YA 3TANA 3WKCA 2F8SA 3THYB 2DUYA 3H40A 1DTQA 4CD1A 2YHBA 3TABA 2PMZF 3JPRA 1YTAA 3BQ1A 3Q8MA 3DI6A 2MSNA 1YITN 3KD1E 5AK3A 4JUZA 5BRHA 3SAFA 5AI4A 4EBDA 2BGWA 1VSHA 3O4WA 4PL7A 2P9LA 3TAQA 4F2SA 3WT0A 2RRDA 2JZBA 3SR6A 4GW6A 2HHUA 4U7CA 5AQNA 4V19S 3BZCA 1EETA 4FLZA 3AA4A 2AU0A 4AM6A 4P4PA 4I7FA 5BOLA 4CJLA 3AO1A 3HT3A 3HZ6A 1FW6A 4GLXA 9ICLA 1SV0A 5DM7L 1Y97A 2C22A 2X78A 1NJZA 3R3LA 3ZDEA 1T8EA 4CBXA 4Z4EA 4IRCA 1FKOA 5GAHP 3ALRA 3CRXA 1BIZA 3SQ2A 2Z1IA 3ATUA 4C8KA 3N4QA 4BRHA 3KFUF 1SS6A 3VESA 1JLAA 4C0ZA 4NXZA 3CJAA 3M7DA 9ICKA 3QO9A 2QWOA 4ECZA 4YR0A 3HKZF 1S1UA 1TK0A 2FF3B 1QQ5A 3EYZA 5CE3A 1TV6A 4RNOA 7ICFA 1GOBA 2OTLN 4OKKA 3VQ6A 4EP4A 4UATA 4BRMA 3Q7BA 2A1RA 7ICNA 1YTUA 3RMDA 5KT3A 4BRDA 4I2HA 1H1VA 1K9MO 2KZZA 5KFIA 1QHTA 2OANA 2IA6A 3HL8A 4PPXA 4GXKA 2B6GA 3UQ2A 4IDHA 4BC2A 2H3VA 4E7JA 2EZZA 3PW7A 1KAZA 2E1ZA 4Y0WA 5KI6A 1BWFO 3GL1A 1BPEA 4I2JA 5DQIA 2IDOA 1NK5A 4QOZB 3VEXA 3JPTA 5J2IA 3HVTA 4FWSA 2J6TA 4FZNA 1JCGA 4ED1A 3VTHA 4X62K 3IMXA 2AXTU 3CFPA 4K4IA 1K1QA 5AK5A 3BJYA 4QWAA 2WB1F 1COOA 1AROP 3UXPA 3WXKA 4CK2A 5HHHA 3M5RA 3WEEA 3K5OA 4M6WB 2W9BA 2KSOB 8ICQA 3ENOA 4I2PA 5SZTA 4IKFA 3K59A 2ZTCA 3WNHA 1ZRNA 1PVRA 2JV3A 3S3OA 3GG4A 4UW9A 2F4VK 5CYMA 4Y2JA 1SKRA 7ICJA 1HX1A 4KI4A 1XSLA 4PHPA 2ZD1A 3H4DA 1RQNA 1BQNA 3OYDA 3MN6A 2UXBK 3TSUA 5DB9A 1QLNA 3PR4A 3C23A 4P4MA 1YJNN 3I56N 2PYLA 1ZQYA 2IOCA 4CDGA 3KHYA 3C5FA 2HNDA 5DGBA 3LZJA 3A0IX 1L3UA 2F76X 3SEIA 4YOYA 3P39A 2F1HA 3CERA 4FK2A 1S9EA 5CYQA 4B9LA 1UWBA 3FZLA 3OBYA 3KTQA 1DRGA 2P35A 4YDUA 5IINA 3I28A 3MR3A 2Q3SA 3H08A 2GWJA 4R63A 1RT3A 2WFAA 2A1SA 3LP0A 4IBNA 2E1EA 8ICVA 3HTVA 3T69A 2YHYA 1UHUA 5AKLA 9ICCA 2K4HA 3AEVA 4N5SA 3NMUA 4O3SA 2D0BA 5J2MA 1DKGD 1RBSA 3BDPA 1X1PA 3CHWA 1YF5L 4GC7A 2QTDA 4FWNA 4RQ8A 4WFNL 4W5OA 4NLBA 4A2BA 5CA7A 4CZHA 1X9XA 3HSCA 4IRDA 3NVZA 4J9OA 3KHLA 1JLQA 4IR9A 3QU2A 3LK9A 1IG8A 4ECSA 5KG3A 1REVA 4QNLA 3KHGA 5CRXA 4JS5A 3GDQA 1MQ3A 1QH9A 4F9OA 3QLHA 2R8GA 2O8EA 1K8AO 5H2FU 3OA9A 1T3VA 1NKCA 9ICEA 5CZ1A 4YR3A 3TAFA 5AQGA 2BPFA 2AQ0A 2QWQA 4B1XB 3Q8QB 3ASMA 1VQ9N 3CMEN 4KLIA 1VQNN 4AQYK 4KRFA 1L6NA 5DQGA 4DTRA 4GV6A 2XRIA 1YI2N 2Y1JA 3F53A 4C80A 1L5UA 1EP4A 4FL9A 5A2QO 2KICA 3VETA 1J2NA 5K4LA 3PX0A 3WXJA 2H5XA 5J0YA 2XICA 4PL8A 3KKAC 1MU2A 3LAKA 3QU4A 2FPMA 5ALHA 1KEJA 2I7PA 5FPDA 1VQ5N 1RT6A 4GVMA 3HRDD 4ECQA 1K1SA 2ZIXB 5KFOA 2ETJA 1A5XA 4NXMK 4M3ZA 4JMUA 3PW5A 2JRZA 4MF2A 3SAGA 2HHVA 5AJ3K 5CJ7A 5EWGA 4EYIB 4BR7A 3CC2N 1B0XA 2RDIA 5TKWA 4C7YA 2PI5A 5AM1A 2WF7A 2W9CB 2LHTA 4P0QB 4B3MK 4HCBA 4JK8A 4BDPA 4DUYK 1ZQVA 5ELZA 4AF1A 5HBMA 4CF1A 1JLCA 2BKEA 4YD2A 4B1VA 3MCPA 4YFKA 2KJ5A 1VQ8N 3OTOK 3HWTA 3D2FA 1RXVA 4KLQA 9ICSA 5BR9A 3ZT1A 3H0RB 4NYNA 3AVGA 2FBTA 5EU7A 1VSEA 1HJPA 2NO5A 3ZDBA 1CLQA 5L1IA 3AUOA 3R9PA 3L3UA 2KMDA 4BRKA 1Q3UA 3CCJN 1WWVA 3KLIA 3OHAA 4KLJA 4DR4K 2A42A 3V7JA 3QE9Y 4WFAL 2ZJRL 4J2EA 4Z4GA 1YAGA 4N41A 1KRPA 2ITMA 4UAUA 2RF2A 4FWPA 2EQYA 3AO4A 4DLEA 1ZJMA 4HCCA 2B21A 4E1MA 2KHOA 1SZHA 3K5MA 4OPHA 1E4GT 4FWRA 1Q9XA 4FLYA 5TISU 9ICRA 2P9IA 5KFTA 9ICVA 2P9PB 3HO1A 3KKAA 4QWBA 3ZETA 3T5LA 2BCVA 1D8YA 2DKZA 1I94K 1RT1A 1ZQTA 2H3QA 5EE1A 4CFAA 1D4XA 4IFEA 9ICPA 2OPPA 4G3IA 5J2BA 3MN5A 1ZD3A 1Q46A 3BEXA 4DR2K 2WTUA 3IKMA 4F72A 5M1KA 5HOOA 2ZIWA 4G1QA 4C4RA 4FK4A 3FZFA 1ZBIA 1HJOA 4K25A 5KRTA 5KL8B 2GUPA 4E7HA 3IS9A 4FJMA 1R0AA 4IQWA 4W5TA 5KFKA 2ZUBA 4B3TK 4IOXA 1KQQA 2YMLA 3LDOA 4CEAA 1ZETA 1UA1A 1LVHA 2E2PA 4M3RA 4M3UA 3JPOA 3QEPA 1RDAA 4K4GA 4H5TA 3KD3A 1HYZA 3FZMA 2YB4A 5DMRA 4DTXA 5KG6A 3V7KA 4CD3A 8ICKA 3HOSA 1JKHA 4CZFA 2YX6A 5AKXA 5E41A 5AM2A 4CF8A 4AHTA 3HX0A 3WKDA 3NCIA 2NRHA 4WQ4A 3VEYA 2KIWA 4CF3A 3B6OA 3K9KA 1Z1VA 1RDWX 1P8ZA 3V6HA 3P31A 2IGIA 3LANA 3GV5B 4WQ4C 5D49A 3T5JA 4BC5A 2E5LK 5EE0A 4KLGA 1TKXA 5J2PA 3AVBA 4RQMA 4CBUA 8ICTA 3TI0A 4CGHA 4U7BA 1S9FA 3FDSA 5GIPA 4TUPA 2XC9A 3A5LC 3C7NB 5JLFA 1WCNA 3M3ZA 2EH9A 4DOBA 1CRXA 4DSFA 5AQIA 2KJ9A 2O4GA 1NWKA 1KDHA 3QESA 3EUB2 1ZQOA 2KIVA 3SI6A 1W9HA 1EX4A 3H8SA 3C94A 3SPYA 1T03A 2W55A 1MWMA 2EAOA 2LM1A 5CY4A 2O8CA 3C6HA 2P9UA 4ID1A 4P2HA 1OVYA 3RFAA 4B1WB 1FK9A 1RDFA 3NVMA 3QB0A 4QW9A 2OPRA 4W5QA 1ATNA 5KFRA 2HNZA 3L0QA 2PFNA 4HUFA 5AZIA 4Y2SA 4YXMA 2O4IA 1S97A 2YTUA 2QXFA 2D0PA 3DOKA 3IAYA 1FJGK 1KFTA 1HYSA 1JALA 2W7PA 4DV5K 1U4BA 1U6ZA 4PUOA 3HP9A 3N4MB 3V9ZA 4NM2A 3H1QA 5ALZA 3H46O 3HBTA 3KHHA 5AZIB 4KHNA 1WAJA 3M9OB 3J7AP 2EAMA 1YJWN 1M1KO 4H0OA 2QARA 4EFHA 4FBTA 2KVSA 5CHIA 2FPLA 4DSLA 2E5SA 2XIDA 1J54A 9ICMA 3V72A 4CECA 3ID8A 2M9NA 5J2GA 2BCRA 2E8MA 3GIIA 4LZDA 4R65A 1EKEA 1EWRA 2W41A 3NVVA 4RQ0A 3C2LA 2OHFA 4A8EA 2BQUA 1KL9A 5ALEA 5AFUH 1ATSA 3H7IA 3MECA 5KFJA 3QEVA 4JRPA 3SCXA 4PJ0U 4CK3A 4JKBA 2UXDK 2HOQA 2IVPA 1N32K 1JL1A 1LAVA 4CNQA 3WNGA 1WSGA 3A2FA 4ECWA 2CGLA 4GV9A 4HTLA 4Z6EA 4G9BA 4J9SA 3I8BA 1SV0C 4DV4K 4XRHA 4N47A 4C4TA 3MR2A 2C28A 4O5KA 4DTPA 1GO3F 8ICFA 3CJCA 3OYCA 4PL1A 3F2CA 3P38A 2KQ2A 1LW2A 4FO0A 2YNGA 2ZTEA 4CF9A 4JK9A 1VQON 3IN5A 3UPQA 1IM4A 4DL2A 2F8TA 1Z1BA 1VK0A 1NGCA 1A77A 1KC8O 5J8YC 1XS9D 3LWLA 4WF9L 4CZKA 2VGNA 3S9HA 2V4QA 2G08A 2W43A 1WWUA 4CJFA 1CZBA 5AKJA 5M1NA 2O8FA 1IKXA 5JVHL 3TFRA 2WF9A 3RH4A 3ZI4A 4M3WA 5FP0A 5AI8A 2BCQA 4F5RA 3QEWA 3WUHA 1UOCA 4MEYA 1SZPA 5AK4A 2FSNA 1O03A 1JI7A 1BL3A 4OJ5A 2ASOA 3L4QA 3VQCA 1VQMN 4B9UA 4PA1A 4E3SA 4J9LA 1XWLA 4F8RA 5AQTA 5C24A 3I8DA 4ECXA 3WK7A 4AYBF 4OGEA 4E0DA 2VQEK 3B6PA 2KG5A 4I9QA 5KFMA 4C8NA 3OSNA 1RYUA 4FOEA 3L2RA 2OM6A 2FMQA 1C0UA 3Q8SB 5AQUA 4FOIA 3IG5A 5ALNA 4EP5A 1X3NA 4A2AA 4F3TA 1NGGA 1HKCA 1X42A 2D0CA 3CCSN 3MEEA 4JKEA 3O9QA 4BRGA 3QX7A 2HVIA 4Y2YA 4ZHRA 3BZKA 1X3MA 2LM4A 5KFGA 4FZXC 4Y2QA 4J9NA 2P51A 3CXCM 3LDAA 1QE1A 1XC9A 1PVQA 4OX9K 3AQFA 4FJ5A 4Y2TA 2ESEA 1ECWA 5D46A 1IKWA 3HI0A 2W6KA 2F8KA 2C2RA 5B8HA 4TQRA 4J8FA 5JVGL 1IBMK 2BCUA 3MDQA 2G8UA 4IZ9A 2O8CB 3BQ0A 2G09A 4WYBA 4KI6A 2W42A 4OCZA 3FGUA 3H45C 2E88A 3NF7A 1TYQB 3RAXA 3IFRA 3FR0A 5AQKA 4PL2A 5FPMA 3RH6A 2MUTA 3MEGA 5TKYA 4UAZA 3CPEA 2ZIVA 3PSTA 2WONA 3OYBA 4E19A 4Q0BA 3RMBA 2LYHA 2Q97A 4RQ4A 3C21A 3N97B 2N1RA 1HEKA 2AH5A 3D2QA 4IOAL 3I33A 5EX5A 4RT3A 8ICCA 1Z05A 2QWRA 4ACOA 1J97A 2ZQBA 2KKZA 1JUDA 2EWSA 1A0PA 5HLFA 3OYMA 2LKYA 3NRZA 1ZQHA 4B9SA 3V6DA 1F0MA 4GV3A 2GOLA 2EANA 3RBDA 3QEAZ 3LPTA 3E0FA 2QW9A 4FJXA 3NH0A 4FVUA 1DTTA 2D5RA 4US9A 4DFJA 1T94A 1LWEA 5JS2A 3P1GA 4LSNA 5ALYA 2FI1A 2OCEA 3V6JA 5GTHU 1U9LA 2XCPA 2XO7A 2GTDA 4XEIA 1D8BA 5AQXA 3UM9A 5J29A 3C28A 1QQ7A 3DM2A 2A3ZA 1YIJN 1S6QA 5HRRA 1ZJNA 1JROA 4C8MA 4MEXA 1X6JA 4H03B 4KB1A 4LF4K 1OXJA 2Q2RA 3K1RB 1OVQA 3RJJA 2OPQA 3FFKB 4FLWA 3F5TA 1C0GA 2EX3A 7ICHA 1ZQKA 3RB4A 3LPUA 5IT9O 5ALXA 3RRHA 4J9PA 3MGIA 4Z4HA 1KVCA 2WAQF 1NI3A 3QU7A 4KMUA 4B1UB 3A0HU 4DS4A 2D0AA 3QETA 2MU2A 2ASMA 2PFUA 4DS5A 4GVEA 1KVBA 4KV8A 2E8NA 2A1AA 2YN4A 4Z6DA 4RW6A 4QAGA 2RPIA 1L3VA 3ISCA 4JI0K 2VIXA 1Z3EB 2KJ8A 4YHHK 3KLGA 5AQVA 1VDVA 3WU2U 4GXJA 4DB3A 4FJHA 3ZX3A 3QU9A 3PO4A 3HYFA 1E4FT 3D2FB 1S8OA 3WK9A 3IDWA 1ZQEA 4F4WA 4IL6U 1IO2A 1SQKA 5ALKA 3GIMA 3P83D 3OY9A 1XI1A 4K0KK 4JKDA 2ZJAA 2EDUA 2LI6A 3VQBA 3TAPA 3RF9A 4Q5VA 4DU1A 1SWVA 2F44A 3H3NO 3G71N 3KD5E 3GIKA 4F4YA 3DLBA 1D5AA 3MC1A 3CQXA 3ENHA 4FJLA 4B9NA 3U4LA 5ALSA 5DB7A 2ATQA 1WSEA 2E2NA 1MSWD 2PMZC 2F96A 4CGZA 3D2SA 4I9LA 5ALFA 3OPXA 5AKHA 1TL1A 3OS2A 2BANA 3K75D 2FBVA 1NGAA 3HM8A 2Q36A 2AGPA 3B8AX 4LF5K 2KEYA 5G5GA 1N63A 1IKVA 2HSTA 4RQNA 3EKUA 4KHPK 1TAMA 3SAHA 2IVOA 2OPSA 3CYMA 1A5WA 2RKIA 4LSLA 5KFZA 3THWB 1VSMA 4YFUA 2DGZA 4QZAA 1K73O 4FJ7A 4CESA 2W9AA 3HW8A 2PFPA 5M1FA 2Q31A 1S1WA 3LDNA 9ICAA 3SQIA 5KRSA 5L1JA 3CQYA 3ZSZA 1J53A 1LCUA 3BS5B 2KZMA 1L3TA 5KG5A 1RT7A 4N56A 3S41A 4FJJA 1PZNA 3C6TA 5L1LA 4CE9A 3LAMA 4JI1K 4CEOA 4CEQA 2HF4A 2ZIXA 3L6QA 2BQRA 3CM6A 2VJ5A 5AK6A 4CFCA 4YN4A 1ZQIA 4IRKA 3UKUA 2H3IA 3C1ZA 2K4EA 4GXIA 3ZDDA 3PIPL 3ULDA 3QNMA 1NKEA 2HBLA 4Y2VA 2NO4A 4JI3K 3AO5A 4I2IA 3I55N 2KFZA 3FE1A 3MWPA 1ZQZA 4DL5A 3SNNA 4F71A 3DXKB 3VENA 4E1JA 2Z1GA 2EZYA 7ICUA 4Y1CA 5M1PA 1HMVA 3C6UA 3T1HK 4LJXA 4DKWA 2I5HA 4DR5K 5KG2A 5KFEA 8ICEA 1BI4B 1LW0A 4BXOB 5CEHA 4YP3A 3MFHA 1BA0A 2I5JA 1TVRA 4IFYA 5C10A 1GOAA 2HHWA 2DWQA 5AKYA 2VG7A 3FFIA 5G5HA 5C42A 5HRPA 2K8CB 4NLKA 1X6IA 4I2GA 3RB3A 1RNHA 4R5PA 4F92B 5J0SA 4TSXA 4BRCA 4M9JA 4BQZA 4OKJA 2UXCK 3M6KA 3FAHA 5J2FA 1BA1A 3OBWA 2ES6A 1RYRA 2E2OA 4YOTA 3HILA 2Z1HA 3VF6A 4YMNA 3UB5A 3H1VX 2KHQA 3ZEUB 5AI6A 3QIOA 1ZBLA 4FZLA 1V9PA 3ZDAA 4UB4A 1NGHA 8ICIA 7ICGA 2WTFA 1PK1B 2FE9A 3DDHA 3VCBA 2V7ZA 4NM1A 1YT3A 4ILGB 1U47A 4CRXA 5M1QA 1VQ6N 1RZTA 2ZUCA 2GX9A 4CEDA 4DMNA 2GWSA 4QS8A 3DRSA 2HNYA 3RSEB 4PHTX 5ALUA 1BNPA 4RUAA 3O0FA 2QWMA 4Y2XA 2YNHA 2HHXA 4K4HA 4BX9C 4MDBA 5ALWA 4FWQA 4JN4A 4CERA 1SKSA 2J4RA 4JI6K 4BG8A 4J03A 5ALLA 4O3QA 3KWGA 4R64A 4IQUA 2ZIVB 5AR0A 1WUDA 3W0LA 3ZT4A 2P5GA 4BR9A 3OJUA 1ZQCA 1KN5A 3GZFA 5AKIA 3KLFA 2UVUA 4MLEA 3SJHA 4FWKA 5FLXO 2DTUA 1TGOA 5KAIU 3MDAA 5B5EU 5IIKA 1UT8A 5F1XA 3KHRA 4M6WA 2W9BB 1RBUA 4FJ8A 2IIRA 2YJFA 2W04A 1ASVA 4A61A 2Y0SF 2UVWA 1S0NA 4DQIA 1YJ9N 5AM3A 3BP8A 3BS5A 4H0PA 3O6WA 3H8WA 3QMLA 4ZH4A 5HMLA 1TK5A 1RM6C 1C0FA 3GOIA 4FWLA 4B3RK 4IG3A 5DG8A 1GLEG 4H5RA 4HHTA 4KHQA 1P90A 4KH6A 3SV3A 4HAIA 1ZQAA 5DLFA 4O3PA 1C0MA 2CXYA 3AN1A 4FO6A 1MWKA 3IDHA 2KOBA 4BGAA 4OJOA 4JD2B 4O3NA 4BG9A 3M1YA 3S6JA 5EOYA 3SBTA 1SL2A 2I6XA 4GMJB 3RR8A 2QWPA 3TTCA 1BCMA 5DM6L 1N61A 1LWFA 2G8HA 4OVLA 3CCEN 4AH9A 3MDCA 4FS2A 2KLAA 4KTZA 4KLSA 3ZD9A 3F9MA 2ODGA 1HUXA 3RAQA 4KLDA 1GLAG 1D9DA 3ORYA 3MBYA 2RQ5A 2JGAA 3IM1A 3ZSRA 5KNIA 3RJGA 3O08A 2HSZA 2NRVA 3FLCO 3AA2A 3EE9A 3MXIA 3CJ1A 4JKFA 2NRWA 4DR7K 2GV9A 4CJVA 2YY6A 3OSPA 1BPYA 2A1JB 1TKTA 5BRFA 4Y2PA 5JRTA 4LFBK 2NLXA 4DR1K 1N36K 4DV0K 4BRIA 1RG6A 5KFWA 3J7ZO 5DB6A 5KFQA 2YI1A 4BC4A 4DLGA 4BGDA 4CCHA 1QQOA 1F5SA 3RH5A 1RTDA 4RQ5A 4AYBC 1ZQFA 1DGJA 1VSDA 3ZSOA 4CZJA 1FEZA 1Q8KA 1J5OA 4Z4IA 3U26A 2IVNA 4H0YB 1I39A 1WSHA 2F9WA 4J9MA 4CJRA 4U6PA 4F4KA 4YMMA 5M1OA 1N5WA 2Q0ZX 1HJRA 5HRNA 2PY5A 3DV9A 3O3GA 1TYQA 2F2AB 1UQVA 4CJ3A 2PZSA 3NGYA 4EELA 3UKUB 1UAXA 3D2EA 3IP4B 4O8UA 4C1NI 1Q9YA 5KG0A 1TKDA 4PHEA 5J2DA 3AU2A 3O3FA 1TUYA 1JLFA 2IOFK 4FPBA 3CW2C 3VPZA 1IIPA 2GH1A 2AQ4A 4JV1A 3KK2A 4CJKA 4CZGA 1AQ6A 1DOQA 2NRXA 5CR0A 4C8OA 2F7TA 4XA5A 2HOIA 4WQ5C 1SIJA 5LJWA 1KLMA 5F2RA 5FRMA 3MCAB 1S5LU 3H8MA 4KFBA 2XHBA 2VA2A 3V9SA 3VA0A 3E9LA 1TFRA 2IC3A 2B6AA 4DOCA 1MC8A 3N7PD 2NRRA 3AVJA 5BN8A 4BRFA 4AHUA 1X66A 4ELVA 3TAMA 4JI5K 1C1AA 3C29A 3T1YK 4UAWA 4LFCK 3G10A 3LP1A 3IG8A 2LPEA 4CHPA 2QEXN 4QZGA 4H4OA 1ZBFA 3QINA 1O13A 4HTUA 3H0MB 2V51B 4CE6A 2XVTA 5BPCA 3RR7A 4H0XB 2G8VA 1RGIA 2P9LB 4CJ4A 9ICHA 4O8KA 1K8KA 1SV5A 3QYPA 1C1BA 9ICIA 3JYTA 4CHNA 3V4IA 4QZ8A 1RTHA 4HVJA 2QB0A 3AQEA 3K58A 5ALIA 3LWMA 4O5FA 2ATLA 4CZIA 8ICUA 2A5XA 3H3OB 2DL0A 5DBAA 4DR3K 4AILC 3PO5A 1VJ5A 5KAFU 4QWEA 4UASA 1BI4A 1WB9A 2UYTA 1JLGA 1RT5A 4I29A 2XI9A 4IJNA 5KT5A 3UIQA 1Z00B 8ICSA 3U8XA 3DWLA 2QKBA 3DXMA 4YMOA 1FIQA 4M47A 4O3RA 1WSIA 1S0MA 3RMCA 3BF3A 1L7MA 4PZOA 2BE2A 4KKOA 5DQHA 2P66A 2YX8A 1TV9A 1T3NA 5HR7A 7ICTA 2Q0UA 3LL3A 3HSTB 3ITHA 4L3QA 3H6EA 3EZ5A 2BUPA 4F5OA 2UVRA 4P4OA 4OJ6A 1SAZA 5AM4A 4RQ3A 2W7OA 4NYFA 3WXIA 2KKPA 3NTUA 3MFIA 3K0SA 3CC4N 1TK8A 4BR4A 2OYQA 2YMQA 5KPZA 1XMOK 4M3XA 2AJQA 3DLHA 1YHQN 4PKGA 4YCXA 3TAGA 1KBUA 3NE6A 4MO5A 1U48A 2JR5A 1HUZA 3I0SA 3F2BA 2FLOA 2Y1IA 1BNOA 3I76A 5AKKA 4R8UB 5KTQA 4I2BA 4BVOA 2K89A 2P9KB 3J81O 1Z25A 1WNSA 1JLBA 3KBBA 1WN7A 2Z1JA 1RDDA 5FROA 2JEIA 3WXMB 3WKEA 3H8JA 1KFSA 1A76A 1HQEA 4OPKA 4JWNA 1F44A 5GAGP 7ICMA 2ITGA 3FM9A 4GFJA 5GAEP 4CGIA 3VC8A 4AHVA 4RW8A 4NLGA 3ONNA 3SUPA 4CW7B 3SBGA 1QVGM 3RJEA 1IG6A 4QZBA 3A5OC 2R18A 3WNEA 1M90O 4YNQA 4TUQA 3LALA 1SGGA 3VQ4A 3TR8A 2YHXA 4IC9A 4YR2A 5JICA 4KHSA 1V4TA 1ZOLA 4ILJA 3HP6A 1FKPA 3OGUA 2PXIA 1NGBA 3K9JA 3Q8LA 2QA4N 3PSIA 4MLHA 5EWEA 1RBRA 4IEIA 2HHQA 4ED3A 4RG8A 3PV8A 3T5HA 2YKMA 4O4GA 5MLCQ 2DBYA 4O44A 4YQWA 3PSFA 4RPYA 3RMAA 1HR0K 4Y1DA 3IV6A 1M6YA 2VWKA 4UB5A 3THXA 4DTUA 2KZ3A 2CRXA 2QARB 3V7LA 3OYAA 3GV8B 4IO8A 4KPYA 4CJWA 3F5AA 4PHDA 2FSKA 2DQNB 3G6XA 1ZQLA 2JWLA 3PMNA 2E8AA 3EY1A 3L2UA 3L2VA 4ZTJA 4BR2A 4MF8A 3ETLA 3TACB 4UARA 1XO0A 3M8SA 1XMQK 3W3DA 1NOYA 3CIPA 3DAWA 1WG8A 4P0QA 3AARA 4CGFA 2LSNA 1DXSA 4JAXA 4HUGA 4YOXA 3V9WA 4C23A 1ZD2P 5J0PA 4NLZA 2DFEA 4JNEA 5KFHA 2HBJA 3J81j 2MA1A 1HYVA 1S6PA 4P0PB 1N6QA 1OH6A 3SPZA 3KLEA 4CVNE 4DWIA 2ASPA 3D0PA 3KWIA 5ALTA 2A3VA 4F50A 3G0ZA 2ZIWB 4JV0A 3VQ5A 3SV4A 4JK7A 2XGQA 3B0YA 8ICLA 3GILA 3OW2M 3ZCMA 4R8UA 2P5OA 4BXOA 4CK1A 3ZSXA 2D6FC 4UAYA 3AVIA 4FM1A 3EZWA 3PNCA 4DL4A 1B9FA 2ALZA 4DV3K 4MHVA 3IRXA 4OKEA 3LP3A 2F77X 5EE3A 5K14A 2G5IB 3ZX0A 3ISNC 1KTQA 4GY2B 4A5BA 5DBCA 3U3YA 1L7OA 1UCVA 4PKIA 4DSKA 1VQPN 4BVPA 1URJA 3LDQA 2HHSA 2FJ6A 4BJQA 1QVFM 4RPXA 4NY8A 1S3XA 4ID5A 5L1MA 2K8BB 3O4QA 9ICTA 1TL3A 2JEGA 4QIWF 1J6ZA 1B22A 3L3FX 2KN7A 4RU9A 3HPGA 1RBVA 3ENBA 1JIHA 4M3TA 3CG7A 3GE1A 2OA8A 2YB1A 1W2BM 4UB1A 5HRSA 5J2JA 2HCFA 4DOAA 2K60A 4NLNA 2HW3A 2BCSA 3BQ2A 2DPJA 1VQLN 1NM1A 2HMIA 1L3SA 4BY9C 3ALYA 3VMFB 1WLJA 7ICQA 1LWCA 2GELA 4YORA 3TSQA 4M42A 4US8A 3THWA 2RDJA 3PX4A 3E9PA 3TADA 1BUPA 4BC3A 4LFAK 2RHFA 2ZIUA 5AQSA 1Z4NA 1NK4A 4F93B 4KLOA 1NJWA 4B6JA 1JX4A 3O4NA 3UKRA 3BGRA 3ISDA 2FPKA 1L7PA 5T14A 2HVHA 3SI8A 2JMGA 4ED0A 4BQLA 1CXQA 3AVFA 3RVCA 2IHNA 9ICFA 1XHXA 1U49A 4RQ1A 1ZQUA 2J6SA 3M6GA 4OO1J 4BROA 4XUSA 5BR8K 3O8MA 4YOWA 4Z6FA 2GUIA 3AV9A 2WFBA 5FPEA 3CJ7A 4TUSA 4FPAA 4HUEA 4KB0A 2JHDA 2HMXA 2XY7A 2E3TA 4LF8K 2B0CA 4EBCA 2ZJQL 2FSJA 3V1QA 5J0XA 3KOOA 1R59O 4KO0A 1T05A 1S9GA 2YJEA 2VANA 3AO3A 3Q8PB 2A19A 1X9JA 5AI5A 5HP1A 2NRZA 1N2XA 2NV3A 4O0IA 4ECYA 4ECUA 4I2QA 3AU6A 4Z94A 1XHZA 3MXJA 4OLAA 2YHWA 9ICQA 1O1WA 4BRQA 1IV0A 5C2FA 4PZNA 4EENA 2D4WA 5HROA 4F4XA 5DB8A 1CZAN 2ZWHA 5CHGA 1L8OA 1VSKA 1WBDA 1UA0A 5T7BA 3CCMN 1T44A 3SUQA 3ZYYX 3HOTA 1VRTA 4FCYA 5AI0A 4BWMA 1WBBA 4FZZA 2W03A 4DSJA 3NH2A 3F9KA 5AZJB 4CIFA 2BDUA 2KNJA 1G15A 3SQ0A 2YMPA 5IWAK 1KW4A 3E2EA 5AFUA 3D45A 2NZTA 2ZGYA 2NRTA 1S0VA 3EKSA 3QBWA 3AVHA 4RW4A 8ICMA 1GOCA 3T7ZA 3BQ7A 2DFFA 1Q7YO 1FO4A 4EHTA 3L8BA 4QCLA 4KHUA 2GBZA 4IQVA 3PY8A 2W8KA 5J0WA 3QFUA 1JXEA 4YY3K 2HB5A 3EL2A 3KJVA 4UY8O 2VYPA 4NLCA 4BDZA 2LMRA 5AIBA 4DSIA 1ZBUA 3WQTA 4M9GA 1MDUB 5J2QA 5KFPA 3IHQB 4CJTA 4DU3A 2AGOA 3O9TA 4LZGA 4XH5A 4DTOA 4M9NA 4X64K 1RT4A 1CXUA 4CF5A 4KMOB 5JLHA 3UMCA 4H5VA 4B3OA 3OYJA 3Q8KA 1BCOA 4CI6A 3C65A 5JUMA 1QQ6A 3TFSA 4B8AB 3CD6N 4DO9A 3ZSWA 4QZ9A 4W5NA 3G6VA 3Q8RB 3MR6A 1BG3A 3ZT2A 5ALPA 8ICWA 4JHDB 3C2KA 4JHDA 2E6MA 4PH5A 2KTQA 1H38A 5J0QA 1NK8A 2ZXHA 3OYKA 5J0TA 2WBNA 4J2BA 5KFFA 2K4PA 3WQUA 5AQMA 1UT5A 4I2FA 3S3MA 3PR5B 3DJCA 4I6MB 2V9WA 4FZMA 3AGRA 3FZHA 3RJHA 3OVNA 5KG1A 3AY9A 3T79A 1C7YA 1VSFA 3H0LB 5KG7A 1S1XA 2Q1NA 1XO1A 1SXEA 3VQQA 2DKXA 4YD1A 4ZTFA 1V85A 4Q43A 2NNWA 3LDPA 2H3FA 3GIJA 5HMMA 5C5JA 2E2QA 2H3ZA 3L5KA 1NOMA 4WJ3B 4PKHA 3QEXA 5D3GA 3UQ0A 3M8PA 1KLNA 5KFCA 2MUTB 4QS7A 1SUQA 4FSVA 3SMSA 4QWCA 4QWDA 3F2DA 4KLUA 4Q8EA 5ALDA 3MMVA 4CIGA 3PW0A 2O8DB 4NJ8A 1Q8IA 2IOHA 3AA3A 4OLBA 2KVCA 3B9JA 3G6YA 1DT9A 1NGJA 3NVWA 4PHAA 3SD7A 4ED2A 2H3GX 2VGMA 3CI5A 1KKXA 4ECTA 2PBDA 1ED1A 3MX2A 2XY8A 2VWJA 2KD1A 2HBMA 8ICJA 1WUAA 1ASWA 4E89A 4JB3A 1ZQPA 3DRPA 3OS1A 1ZC6A 3M1FA 4DCHA 1OW5A 3B0XA 3V1OA 2E1FA 4R66A 4KLFA 3C5GA 1Y88A 4FLXA 3JPNA 1DGKN 2BGGA 1ZBSA 2FDRA 1ZD4A 3EE8A 4U67L 3D6JA 3CM5A 1IBKK 3UE5A 2JWKA 2HI0A 1YVUA 4CGGA 4Z4FA 3ZX2A 3QERA 1ZQJA 3RJIA 4Z0UA 2IBKA 3AVNA 9ICBA 4CEEA 2W3RA 1S5JA 4DG1A 3CETA 3FYHA 1X9WA 4CFBA 3J7YP 1NK9A 3CMAN 5GTIU 4FYDA 4ELTA 3RRGA 1JJ2M 1Q81O 3AVMA 3QNOA 1JXBA 2A6AA 3K5NA 1JCEA 3TQ1A 2P9NA 2OZMA 1D9FA 3CPWM 2BPCA 3CJ9A 3PMLA 2ZXIA 3VEVA 4FLVA 2D8CA 4Y2RA 4IQTA 1QQNA 1L7NA 3M8RA 3NUQA 4JI4K 3ZETB 5EE9A 3SENA 5KQDA 1J9AA 4CGDA 3MK6A 1ZQXA 4DCCA 8ICNA 1C6VA 1NK0A 3PIOL 4O3OA 1OH8A 5AQYA 4DR6K 4M9LA 4JRQA 3KZBA 2VJ4A 4C1NK 3T1AA 1XC3A 4E1NA 2NUBA 3NVYA 3G6EN 3V9XA 4BR0A 4RWTA 5DG7A 4DHYA 2FXUA 3GV7B 4IS7A 2A40A 3M9MB 2QM1A 3K2PA 5FDLA 3LP2A 3UKRB 4K8ZA 4XH1A 4K8XA 2OXOA 2C2EA 1VSLA 4DL7A 4CIEA 3N7RC 3E66A 1NGFA 3THXB 2HOEA 1RTJA 4UB3A 4RQ7A 4R79A 3VQEA 3D2NA 1LB2B 2WHEA 1VQ4N 2F9TA 5J0UA 4M41A 4QJFB 5BPNA 2W9MA 4A59A 4EX7A 1LOTB 2QWLA 1BPDA 1KVAA 3HXMA 3HRGA 4E7IA 1QQMA 3R6MA 5DG9A 1HKGA 1JXLA 4AM7A 1B9DA 3C1YA 1U2VA 5KPRA 4WE1A 4ICLA 4KBOA 4B9MA 3JXUA 3NGZA 2VQFK 5GINA 3TARA 4EEKA 2JEFA 1CZ9A 2FC0A 5J2KA 2CGJA 2G0AA 3J80O 5AKGA 1NJYA 1SV4A 2QXLA 4YDUC 3G4SN 5GIOA 4I2DA 1XUPO 1GLDG 4DQSA 4M04A 5EVZA 3C2MA 4CF4A 1S22A 3A0BU 2BQ3A 7ICVA 5DLGA 4UBCA 4I2AA 4JEPA 2UUBK 2D1KA 5CB1A 1IKYA 1ATRA 2ZGZA 2P6RA 3UXOA 4CEFA 3LDSA 4F4ZA 4M45A 1CEZA 1LAWA 5KG4A 1BHLA 3U9DA 1T4GA 2UVVA 3ID6A 4J2DA 1OKJA 1K5OA 4NL9A 5D4BA 1WOQA 4YVZA 3O9SA 4FM2A 4BE2A 1ZRMA 1NBWA 3LVVA 5LY3A 1MA9B 8ICYA 1DK3A 3CP8A 3EW9A 1ESVA 2FMSA 2P9IB 4FJKA 2EHGA 4GKJK 5I3UA 7ICPA 3C0BA 2O8BB 2AGQA 5CR4A 4JV2A 1RDCA 3AVCA 3F73A 2JZBB 1U2VB 1XSNA 1SKWA 4WQ5A 1FFUA 3JS6A 8ICHA 2CH5A 4H0VB 2O8EB 1X9SA 1RYSA 4Z6CA 2Z7JA 4ZOHC 3PLAA 4RNMA 1VAZA 8ICPA 1X9MA 2V7YA 4DV6K 3OYEA 4BACA 2GEMA 4O5BA 5AZJA 3SMVA 5CZ2A 4BRAA 4CZLA 3E1YA 5A0LA 4O3MA 3MAQA 4RTFD 2JLEA 4J9QA 4H8KA 3ULEA 5H1SQ 3NGIA 1BPZA 3KZXA 8ICBA 3SJJA 3M8QA 2QK9A 3QEBZ 4ISGA 4G9ZA 1MA7A 4KN7A 1ZQDA 2CGKA 3NRWA 3SYZA 1N62A 1PVPA 5KT2A 1N60A 4CZEA 2X74A 3IRUA 4AP9A 3AVLA 1MQ2A 2AA4A 1HKBA 4CJUA 1T6DA 1V97A 4BRPA 3AO2A 3EO3A 5ALMA 9ICJA 7ICSA 1KAYA 4IJAA 4MDAA 2RE2A 5KFNA 5I42A 4KH4A 2AHOB 2W8LA 1B43A 1JN3A 3FZKA 4OPJA 1N5YA 1RILA 4WCEL 1CUKA 2JH1A 1KFDA 4C8LA 4B3SK 2ASLA 3CCVN 5IIMA 3V6KA 2BHNA 3JPQA 1IJJA 4MFAA 2E6LA 4OPAA 3NFAA 1NK6A 3QZ7A 4JV5K 4TURA 4QZHA 1T6CA 3K57A 3DLEA 2HOFA 4CBWA 3C95A 2PI4A 4CJEA 1LKYA 3H4BA 3R8EA 3HKZC 3JPPA 2OWOA 4CHZA 4DL6A 3KK3A 2K4IA 1W7AA 2ZTDA 3A8YA 1O08A 4CF2A 4KTQA 2A41A 5AQRA 4CEBA 3K5LA 2JXJA 4O9MA 4CJ7A 1GLBG 3L4IA 2ZF5O 3HK2A 3ED5A 1QZ5A 3THVA 5KFYA 1U45A 3DRRA 1YZ6A 3PW4A 2P6UA 4YXJA 3U3GA 1S1VA 1XNRK 9ICUA 5AICA 2ISOA 7ICOA 2YCHA 5FRNA 2VA3A 4ECRA 3V1RA 2A1JA 2HDOA 4KLLA 4CEZA 3BS7A 2O6KA 5C0YA 5J0RA 3EPIA 4M0AA 4CHQA 3QICA 3D2EB 4F2RA 3OHRA 4IWVA 1A5VA 2JEJA 3OJSA 3OHBA 2FLPA 4O5CA 3QU5A 2OZSA 2WF5A 1K8KB 1N56A 2UUAK 4CJ5A 5JTIA 3NBPA 3GBTA 3BUZB 4ISFA 4Z4CA 2B4JA 2CH6A 1SZ2A 3OTQA 3WKAA 1DLOA 3D7EO 1C0TA 3CNHA 4FWMA 4LH5A 1WAFA 1RDUA 4EYHB 4FS1A 2KE7A 3GU3A 4NCAA 1RPLA 2LYBA 3MN9A 4CJQA 2ZG6A 2JGUA 4M7XA 3PW2A 4LF9K 2F8LA 3EN9A 2G5HB 1WSFA 2P9SB 5GADP 3M6ZA 2VWBA 4NCGA 4DU4A 2DFLA 4I6MA 4KH5A 3NVKA 3A5MC 2MRLA 4FE3A 1N33K 4JKGB 2ZM6K 4EZ6A 2W6LA 3KVGA 4DF4A 1ZQQA 3SQ1A 5HP4A 2DY4A 4NL9C 4GC6A 4B9TA 1WCLA 4UB2A 3BQTA 3R9KA 4DV2K 1SL1A 5BPMA 3WK5A 1YUWA 4FJGA 4PGQA 5C12A 2P9UB 4XQ8A 4KHWA 4DFKA 7ICLA 1NGDA 5KFUA 5AQQA 2R7YA 2R8KA 4DTNA 3TSPA 3DYAA 3SMPA 3DLGA 2UU9K 3WXLA 4GKKK 1HPZA 3VTIA 3VQ8A 4ISEA 4L8RB 4XH4A 3JPSA 4X5VA 3QIPA 3N4PA 2RLTA 3GFKB 1ZQBA 1BVSA 2JH7A 2V4RA 1S10A 4EZ9A 3JSMA 1QZ6A 1RDBA 3HM9A 2VA8A 1X40A 2BH1A 2P1JA 3P4IA 2R8HA 1NU0A 2QWNA 3AM9A 4B08A 4TQSA 1BOTO 1IXRA 4PGYA 4KHYA 1TAQA 4EX6A 2BZFA 1TUUA 3NASA 2E4LA 5I9EB 2W11A 8ICAA 1NG9A 3RSEA 4BR5A 2Y9TA 1JRPA 5HL7L 5AM5A 3VF2A 4DFMA 1NGIA 3SUOA 5IIJA 4EIAA 3HPOA 5LJVA 4NXNK 2IS3A 3U9ZA 4QZIA 3PZPA 3I0RA 3I1YA 4EBEA 2W9CA 5F0XA 2YMMA 1RFQA 3OYIA 1NOZA 4EEYA 4GNIA 1B4FA 5ALVA 4M7YA 3DLLL 3ISBA 3L4PA 4Q45A 4RQ6A 2KP7A 3VGLA 3BY5A 1V38A 2ZE2A 1QSSA 2KW4A 3VQ7A 3AAQA 4FJIA 1RT2A 4Y2UA 1BDGA 2D0OA 2P9NB 4F5PA 3RTVA 3F5EA 3T3FA 3AVKA 4FVMA 1E3MA 2Y0SC 3R1XA 4PGXA 4F91B 1QSLA 1V4SA 3ZT0A 3M9NB 3VF4A 3MABA 1ASUA 4M63C 4CHYA 1QS4A 4RCHA 5KGXA 5C25A 1QCKA 1RTIA 3HJFA 2P9SA 1L8LA 2YNIA
chains in the Genus database with same CATH topology
4FK0A 4JS4A 4O0JA 3OYLA 4DTSA 2WOMA 3VQPA 1A6SA 2OH2A 4O55A 4B8CA 2HBKA 4BE0A 4DQQA 4BE1A 4FXDA 1Z19A 1BGXT 4FLTA 2FBYA 1WSJA 4BUGA 3MEDA 3ZT3A 3HPHA 1LV5A 1W0HA 3PX6A 2ZIUB 1IG9A 4QIWC 1S1TA 2M0NA 3QEIA 3ICXA 3O3HA 4FJNA 1NK7A 3SUNA 4M3YA 3AA5X 4AHCA 4OJLA 4H4MA 5J1EA 3OYHA 1KCFA 4OJPA 4P0PA 1JL2A 2WB1C 3V81A 3CQ8A 3DEEA 2G8KA 2DFHA 3CFRA 1T7PA 4JLHA 2CPRA 2X6NA 4J2AA 2CN1A 2KKVA 1TKZA 2G8IA 4MFBA 4FM0A 2BDPA 1HQUA 4W5RA 4CJPA 1FXXA 3VQAA 3VQDA 3V9UA 4DSEA 1VSIA 1NJXA 2LBOA 2KFNA 3PUFA 1K6YA 3OYFA 4FW2A 3SZ2A 4XIUA 3DOLA 3KLHA 2G07A 1EXQA 3NHGA 3L2QA 2DF4B 1C1CA 2YKNA 1KSPA 3LZIA 3KKRA 2KHVA 4ICAA 1QQCA 1ZYQA 2YNFA 4IFVA 2VG6A 2YV0X 3HVRA 3TAEA 1Z26A 4DFPA 4CHOA 1ZBHA 4PY5A 3ZSYA 1HIWA 1Q3VA 3NF9A 4E7KA 4LY7A 1I3AA 4UQGA 4AHRA 2LYAA 4LD0A 3L3VA 1P7DA 1ITGA 5KGWA 2IAJA 4OJRA 4KREA 4PWDA 4BWJA 1NKBA 3KK1A 1U04A 4F3OA 1VRUA 1OUQA 3RWUA 4KTWA 4ELUA 2KV2A 1IH7A 1HNVA 2Q4TA 3P5JA 2PYJA 3MXMA 3N7SC 3VQ9A 5SWMA 4DF8A 4IG0A 4LH4A 4NCBA 4MQ3A 3DMJA 3WNFA 2XY6A 3VN5A 4NV0A 4FJ9A 4DTMA 1F21A 3NF6A 1XNSA 3L2WA 1QTMA 4KAZA 4RW7A 4KX5A 2G8FA 4KX3A 2X6SA 2RN2A 3MGVA 3QNNA 1NZBA 3AL0B 4AHSA 1VSJA 1HNIA 2VKQA 2XY5A 1B92A 3E01A 4NWIA 4PQUA 1BIUA 4CJSA 4CFDA 2FBXA 4FZYA 3NAEA 3DLKA 3T19A 3KKSA 1ZQ1C 1UPHA 2G06A 2K8AA 3DLRA 1SL0A 2OYYA 1RCHA 3NF8A 4DQRA 2WAQC 4BDYA 3OYNA 3OS0A 1JLEA 4FLUA 3LVWA 5J2NA 4CF0A 1BQMA 3ZSQA 2VG5A 1BISA 3K1ZA 4IDKA 3NH1A 4N76A 2QKKA 4DTJA 3U6FA 2B5JA 5DK5A 4OGCA 3AVAA 1RBTA 2RP5A 3S3NA 1QSYA 5JS1A 4DQPA 2YHAA 3PSPA 1TAUA 3NDKA 3LYSA 4B9VA 3IG1A 2HHTA 5KL1B 3ZSVA 5HR6A 3CFOA 4CGJA 2G8WA 3TWHA 4RW9A 1HRHA 3KIOA 4E7LA 3OYGA 4FW1A 3TANA 2F8SA 1DTQA 2YHBA 3TABA 2PMZF 1YTAA 3DI6A 3KD1E 3SAFA 1VSHA 3TAQA 4F2SA 2RRDA 4GW6A 2HHUA 4U7CA 1EETA 4FLZA 3AA4A 4CJLA 4I7FA 3AO1A 3HT3A 1Y97A 2X78A 1NJZA 1T8EA 4Z4EA 1FKOA 3ALRA 3CRXA 1BIZA 3SQ2A 2Z1IA 4C8KA 3KFUF 1JLAA 4C0ZA 3M7DA 3QO9A 3HKZF 1S1UA 1TK0A 3EYZA 1TV6A 1GOBA 4OKKA 3VQ6A 4EP4A 2A1RA 1YTUA 3RMDA 2KZZA 1QHTA 3HL8A 2H3VA 4E7JA 5KI6A 2IDOA 1NK5A 4QOZB 3HVTA 4FZNA 3CFPA 2WB1F 4CK2A 3K5OA 4I2PA 5SZTA 4IKFA 3K59A 3WNHA 1PVRA 3S3OA 5CYMA 1SKRA 4KI4A 2ZD1A 1BQNA 3OYDA 2PYLA 2IOCA 4CDGA 2HNDA 3LZJA 1L3UA 2F76X 4FK2A 1S9EA 5CYQA 1UWBA 4B9LA 3KTQA 1DRGA 2Q3SA 3LP0A 3H08A 4IBNA 2A1SA 1RT3A 2E1EA 2K4HA 4N5SA 2D0BA 5J2MA 1RBSA 3BDPA 1X1PA 4W5OA 4NLBA 1JLQA 1REVA 4QNLA 5CRXA 4JS5A 3QLHA 1NKCA 5CZ1A 3TAFA 3ASMA 4KRFA 1L6NA 4DTRA 2XRIA 1EP4A 3F53A 1L5UA 2Y1JA 2KICA 3PX0A 2XICA 1MU2A 3LAKA 1RT6A 4GVMA 2ZIXB 2ETJA 4M3ZA 1A5XA 4JMUA 3SAGA 2HHVA 2LHTA 4P0QB 4HCBA 4BDPA 5HBMA 4CF1A 1JLCA 2KJ5A 3ZT1A 3H0RB 4NYNA 3AVGA 2FBTA 5EU7A 1VSEA 1CLQA 3L3UA 1Q3UA 3KLIA 4J2EA 4Z4GA 4N41A 1KRPA 2RF2A 3AO4A 4DLEA 4HCCA 4E1MA 1SZHA 3K5MA 1Q9XA 4FLYA 3HO1A 1D8YA 1RT1A 2H3QA 4CFAA 2OPPA 2ZIWA 4G1QA 4FK4A 1ZBIA 5KRTA 5KL8B 4E7HA 4FJMA 3IS9A 1R0AA 4W5TA 4CEAA 1UA1A 4M3RA 4M3UA 3QEPA 1RDAA 1HYZA 2YB4A 5DMRA 4DTXA 1JKHA 5E41A 4CF8A 4AHTA 3NCIA 2KIWA 3B6OA 2IGIA 3LANA 1TKXA 5J2PA 3AVBA 3TI0A 4CGHA 1CRXA 4DSFA 2KJ9A 2O4GA 3QESA 3SI6A 1W9HA 1EX4A 3C94A 3SPYA 1T03A 5CY4A 4ID1A 3RFAA 1FK9A 2OPRA 4W5QA 2HNZA 4HUFA 2O4IA 2QXFA 3DOKA 3IAYA 1HYSA 2W7PA 1U4BA 4PUOA 3HP9A 3V9ZA 4KHNA 1WAJA 4DSLA 1J54A 2E5SA 2XIDA 4CECA 1EKEA 4A8EA 3MECA 3QEVA 4JRPA 3SCXA 4CK3A 2HOQA 1JL1A 1LAVA 3WNGA 1WSGA 3A2FA 4N47A 4DTPA 1GO3F 3OYCA 4PL1A 3F2CA 2KQ2A 1LW2A 2YNGA 4CF9A 3IN5A 2F8TA 1Z1BA 1VK0A 3LWLA 3S9HA 2G08A 4CJFA 1CZBA 1IKXA 4M3WA 3QEWA 1UOCA 1BL3A 4OJ5A 3VQCA 4PA1A 4B9UA 4E3SA 1XWLA 4F8RA 5C24A 3I8DA 4AYBF 4OGEA 4E0DA 3B6PA 4I9QA 4C8NA 3L2RA 2OM6A 1C0UA 3IG5A 4EP5A 4F3TA 2D0CA 3MEEA 2HVIA 4ZHRA 4FZXC 2P51A 1QE1A 1PVQA 1XC9A 3AQFA 4FJ5A 1ECWA 1IKWA 2G8UA 2G09A 4KI6A 2W42A 3NF7A 4PL2A 3MEGA 2ZIVA 3PSTA 2WONA 3OYBA 4E19A 4Q0BA 3RMBA 2N1RA 1HEKA 3D2QA 2ZQBA 4ACOA 1A0PA 5HLFA 2LKYA 4B9SA 3V6DA 2GOLA 3LPTA 3E0FA 4FJXA 3NH0A 1DTTA 2D5RA 4DFJA 1T94A 1LWEA 5JS2A 3P1GA 4LSNA 2XO7A 1D8BA 3C28A 3DM2A 1S6QA 5HRRA 4C8MA 4KB1A 2OPQA 4FLWA 2EX3A 3LPUA 3RRHA 4Z4HA 1KVCA 2WAQF 4DS4A 2D0AA 3QETA 4DS5A 1KVBA 4KV8A 4RW6A 4QAGA 2RPIA 1L3VA 2VIXA 2KJ8A 3KLGA 4FJHA 3PO4A 3HYFA 3D45A 1IO2A 1XI1A 3P83D 3OY9A 3VQBA 4Q5VA 3RF9A 4DU1A 3TAPA 3KD5E 3DLBA 1D5AA 4FJLA 4B9NA 2ATQA 1WSEA 2PMZC 2F96A 4CGZA 3D2SA 4I9LA 3OPXA 1TL1A 3OS2A 2BANA 2FBVA 2KEYA 1IKVA 1TAMA 3SAHA 2OPSA 3CYMA 1A5WA 2RKIA 4LSLA 1VSMA 4YFUA 2DGZA 4FJ7A 4CESA 1S1WA 3SQIA 5KRSA 3ZSZA 1J53A 4N56A 1L3TA 4FJJA 1RT7A 2KZMA 3C6TA 4CE9A 3LAMA 4CEOA 4CEQA 2ZIXA 3CM6A 2VJ5A 4CFCA 2H3IA 2K4EA 3ULDA 1NKEA 2HBLA 3AO5A 2KFZA 3SNNA 2Z1GA 4Y1CA 1HMVA 3C6UA 1BI4B 1LW0A 4IFYA 2I5JA 1TVRA 1GOAA 2HHWA 2VG7A 3FFIA 5C42A 5HRPA 2K8CB 1RNHA 4R5PA 4TSXA 4OKJA 3M6KA 2Z1HA 2KHQA 3QIOA 1ZBLA 4FZLA 3VCBA 1YT3A 1U47A 4CRXA 4CEDA 4DMNA 3DRSA 2HNYA 3O0FA 2YNHA 2HHXA 4BX9C 4CERA 1SKSA 2ZIVB 1WUDA 2P5GA 3ZT4A 3OJUA 3GZFA 3KLFA 1TGOA 1RBUA 4FJ8A 2W04A 1ASVA 2Y0SF 4DQIA 1TK5A 4IG3A 4HHTA 4KHQA 3SV3A 1C0MA 2KOBA 4OJOA 1SL2A 4GMJB 3RR8A 1BCMA 1LWFA 2G8HA 4OVLA 4AH9A 4KTZA 1D9DA 2JGAA 3ZSRA 3AA2A 3MXIA 2GV9A 4CJVA 1TKTA 4DLGA 4CCHA 1RTDA 4AYBC 3ZSOA 1VSDA 1J5OA 4Z4IA 1I39A 1WSHA 4CJRA 4U6PA 4F4KA 2PY5A 1HJRA 5HRNA 3O3GA 2F2AB 4CJ3A 2PZSA 3NGYA 1UAXA 3IP4B 1Q9YA 1TKDA 3O3FA 1JLFA 1IIPA 2GH1A 3KK2A 4CJKA 4C8OA 2HOIA 1KLMA 5FRMA 4KFBA 2XHBA 3V9SA 3VA0A 2IC3A 2B6AA 3N7PD 3AVJA 4AHUA 4ELVA 3TAMA 1C1AA 3C29A 3G10A 3LP1A 3IG8A 4CHPA 4H4OA 1ZBFA 3QINA 4HTUA 3H0MB 2XVTA 3RR7A 2G8VA 4CJ4A 1SV5A 1C1BA 3JYTA 4CHNA 3V4IA 1RTHA 4HVJA 3K58A 3AQEA 3LWMA 4AILC 3PO5A 1BI4A 1JLGA 1RT5A 2XI9A 3UIQA 2QKBA 1WSIA 3RMCA 2BE2A 4KKOA 2YX8A 5HR7A 3HSTB 3ITHA 3EZ5A 4OJ6A 2W7OA 4NYFA 2KKPA 1TK8A 2OYQA 4M3XA 2AJQA 3DLHA 3TAGA 1KBUA 3NE6A 1U48A 3I0SA 3F2BA 2Y1IA 5KTQA 2K89A 1Z25A 1WNSA 1JLBA 1WN7A 2Z1JA 1RDDA 5FROA 1HQEA 4OPKA 1KFSA 1F44A 2ITGA 4GFJA 4CGIA 3VC8A 4AHVA 4RW8A 3ONNA 3SUPA 3WNEA 2R18A 4YNQA 3LALA 3VQ4A 3TR8A 4IC9A 4KHSA 3HP6A 1FKPA 3PSIA 1RBRA 2HHQA 4RG8A 3PV8A 4O4GA 2YKMA 4O44A 3PSFA 3RMAA 4Y1DA 2VWKA 4DTUA 2CRXA 3OYAA 4KPYA 4CJWA 3F5AA 2DQNB 3EY1A 3L2UA 3L2VA 4ZTJA 1XO0A 3M8SA 1NOYA 4P0QA 4CGFA 4HUGA 2LSNA 3V9WA 2DFEA 2HBJA 2MA1A 1HYVA 1S6PA 4P0PB 1N6QA 3SPZA 3KLEA 4DWIA 3D0PA 2A3VA 3G0ZA 2ZIWB 3VQ5A 3SV4A 3ZCMA 2P5OA 4CK1A 3ZSXA 2D6FC 3AVIA 4FM1A 1B9FA 3IRXA 4OKEA 3LP3A 2F77X 5K14A 2G5IB 3ISNC 1KTQA 3U3YA 4DSKA 1URJA 2HHSA 4BJQA 4ID5A 3O4QA 2K8BB 1TL3A 4QIWF 3L3FX 3HPGA 1RBVA 4M3TA 3CG7A 2OA8A 2YB1A 5HRSA 2HW3A 2HMIA 1L3SA 3ALYA 1WLJA 1LWCA 4M42A 3PX4A 2RHFA 2ZIUA 1NK4A 1NJWA 3O4NA 3BGRA 2HVHA 5T14A 2JMGA 1CXQA 3AVFA 1XHXA 1U49A 4OO1J 2GUIA 3AV9A 4HUEA 4KB0A 2JHDA 2HMXA 2XY7A 3V1QA 4KO0A 1T05A 1S9GA 3AO3A 5HP1A 2NV3A 4O0IA 4I2QA 1XHZA 4OLAA 3MXJA 1O1WA 5HROA 1VSKA 3SUQA 5T7BA 1UA0A 1VRTA 4FCYA 4BWMA 4FZZA 2W03A 3NH2A 4DSJA 3F9KA 4CIFA 2BDUA 2KNJA 1G15A 3SQ0A 3AVHA 4RW4A 1GOCA 2DFFA 3L8BA 4QCLA 4KHUA 2GBZA 3PY8A 1JXEA 2HB5A 3KJVA 4NLCA 4BDZA 4DSIA 1ZBUA 5J2QA 4CJTA 4DU3A 4DTOA 1RT4A 1CXUA 4KMOB 4B3OA 3OYJA 1BCOA 4B8AB 3ZSWA 4W5NA 3ZT2A 2E6MA 2KTQA 1NK8A 2ZXHA 3OYKA 4J2BA 3S3MA 4FZMA 3OVNA 3T79A 1VSFA 3H0LB 1S1XA 3VQQA 4ZTFA 2H3FA 2H3ZA 4WJ3B 3QEXA 5D3GA 3M8PA 1KLNA 1SUQA 3F2DA 4CIGA 1Q8IA 3AA3A 4OLBA 2KVCA 1ED1A 2XY8A 2VWJA 2KD1A 2HBMA 1ASWA 4E89A 3DRPA 3OS1A 3V1OA 2E1FA 4FLXA 2BGGA 3CM5A 1YVUA 4CGGA 4Z4FA 3QERA 4Z0UA 3AVNA 4CEEA 1S5JA 4DG1A 4CFBA 1X9WA 1NK9A 4FYDA 4ELTA 3RRGA 3AVMA 3QNOA 1JXBA 3K5NA 2OZMA 1D9FA 2ZXIA 4FLVA 3M8RA 3NUQA 3VA3A 3SQ4A 2DTUA 1J9AA 1C6VA 1NK0A 4JRQA 2VJ4A 3T1AA 4E1NA 2NUBA 3V9XA 3K2PA 5FDLA 3LP2A 4K8ZA 4K8XA 2OXOA 1VSLA 4CIEA 3N7RC 1RTJA 3VQEA 3D2NA 4M41A 4QJFB 3HXMA 1KVAA 4E7IA 1B9DA 4WE1A 4ICLA 4B9MA 3NGZA 1CZ9A 3TARA 2FC0A 2G0AA 1NJYA 4DQSA 1IKYA 4CEFA 3LDSA 4M45A 1LAWA 1BHLA 4J2DA 4FM2A 4BE2A 3LVVA 3CP8A 4FJKA 2EHGA 5I3UA 1RDCA 3AVCA 3F73A 1SKWA 1X9SA 2Z7JA 4BACA 1X9MA 3OYEA 4O5BA 3SMVA 5CZ2A 5A0LA 4O3MA 3MAQA 2JLEA 4H8KA 3SJJA 3NGIA 3KZXA 2QK9A 3M8QA 1MA7A 3NRWA 3SYZA 1PVPA 2X74A 3AVLA 4CJUA 3AO2A 5I42A 1N5YA 4OPJA 1RILA 2JH1A 1KFDA 4C8LA 2E6LA 3NFAA 1NK6A 3K57A 3DLEA 2HOFA 3C95A 4CJEA 3HKZC 4CHZA 3KK3A 2K4IA 4CF2A 3K5LA 4KTQA 4CEBA 3HK2A 3THVA 1U45A 3DRRA 3U3GA 1S1VA 5FRNA 3V1RA 4CEZA 5C0YA 4CHQA 4F2RA 1A5VA 3OJSA 2OZSA 4CJ5A 3NBPA 4Z4CA 2B4JA 1DLOA 1C0TA 4LH5A 1WAFA 3GU3A 4NCAA 2LYBA 4CJQA 2ZG6A 2JGUA 2F8LA 2G5HB 1WSFA 3M6ZA 4NCGA 4DU4A 2MRLA 4FE3A 4EZ6A 4DF4A 3SQ1A 2DY4A 4B9TA 1SL1A 4FJGA 4KHWA 4DFKA 2R7YA 4DTNA 3DYAA 3DLGA 1HPZA 3VQ8A 4L8RB 3QIPA 2JH7A 4EZ9A 3JSMA 3HM9A 1RDBA 2P1JA 4B08A 4KHYA 1TAQA 2E4LA 4DFMA 3SUOA 3HPOA 2IS3A 3PZPA 3I0RA 3OYIA 1NOZA 2ZE2A 1QSSA 2KW4A 3VQ7A 4FJIA 1RT2A 4CGDA 4FVMA 3RTVA 3T3FA </