3CYMA

Crystal structure of protein bad_0989 from bifidobacterium adolescentis
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
415
Chain Sequence
EPKLLAEPREGVPNVIDTLPAFRDYCSELASSHGSLAADAERASGFRYGHEDWLVQFKRDGAGIGLLDPQALAAAGADWNDFNRAVGDAVWILHDSLQDLPGFDELGMEPQRLFDTEIAARLLGLKRFGLAAVTEHFLGLTLAKEHSAADWSYRPLPRDWRNYAALDVELLIELETKMRAELKRQGKMEWAQEEFDYALKEGLGPRKEHLIPWMHVSHITEVMRDRQALAIVRALWTRRDELAREYDIAPTLLLSDSSIIEVAKRKPHNAAQFRSIRSINERVRIHTDSEQDKMFERYAPIQRKIKPSMWKNIIQDALALPPSEWPDSAPKSIRVWKERYPERLQVLNRVRKAVSQIAEDTRTPVEIVIKPQYLRNLCWTDEPRKRDVARFLSEQGARDWQVSLVAESVSRAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein BAD_0989 from Bifidobacterium adolescentis.
rcsb
source organism Bifidobacterium adolescentis atcc 15703
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein BAD_0989
total genus 150
structure length 415
sequence length 429
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
A PF18305 DNA_pol_A_exoN 3' to 5' exonuclease C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3cymA03
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3cymA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cymA01
2HVIA 3CM6A 2E1FA 4Y1DA 4RW4A 2JLEA 2YNIA 4CJ4A 3HL8A 4CFBA 1NK0A 1Q9YA 3THVA 4OLBA 3DOKA 2RHFA 1TL1A 3AVBA 3NGZA 4I2QA 3TARA 4B9SA 3KLGA 2X74A 4DTNA 1L5UA 4ID5A 2HNYA 4FJ9A 4HUFA 4CJVA 2IC3A 3OYKA 2BGGA 1QS4A 1QTMA 4O0IA 1ITGA 2P5OA 4CJWA 3LZIA 3DYAA 2G8WA 3DLHA 3HPOA 3K57A 4C8MA 1W0HA 3OYGA 1A5XA 2XY5A 2VG5A 2YNFA 3LDSA 2PY5A 4KREA 2IGIA 1XHXA 1YTAA 3ISNC 5JS2A 4CEAA 5SZTA 1D8BA 2P5GA 3KIOA 3T1AA 1S1WA 3VQDA 3OS2A 3MAQA 2YHBA 2OZMA 1EP4A 1J53A 3D45A 4M3WA 1NJYA 4W5NA 3H08A 3KTQA 1Q8IA 3QEPA 1ASWA 4MFBA 3QESA 3CFOA 4JS5A 3KD5E 4FLYA 1IKWA 4NCAA 2EX3A 4Z4GA 2IOCA 3ZSXA 4B8AB 2DY4A 2IDOA 4DSIA 3HO1A 4HCBA 1JKHA 4FJLA 4DTJA 4PUOA 3AO1A 3JYTA 4B8CA 3VQEA 1J54A 4JLHA 2CPRA 1YTUA 4J2AA 3RMCA 4PA1A 4RW9A 3VA3A 4KHWA 1N5YA 3TAFA 2FC0A 1KTQA 2NUBA 3MEEA 4DTSA 1Z26A 5HBMA 4OKKA 5FROA 3K5LA 2XHBA 1QSSA 1Z25A 1TV6A 4JRQA 2HMIA 4Q5VA 1JLCA 4FZZA 5HRSA 1XWLA 3DLRA 1X9WA 1YT3A 2YKNA 4E7LA 3M8QA 4FM0A 4F8RA 3K2PA 3KLIA 3IAYA 4H8KA 3SQ0A 1NJXA 1I39A 4NYNA 3MXMA 2DFEA 4OPKA 1T03A 4Z4EA 3IG1A 4OKJA 3P83D 3DRPA 3KK2A 3C94A 1BCMA 4DU4A 3SUOA 4NCGA 5HRRA 4DS5A 4CDGA 2VWKA 4E7HA 3L2UA 2HBMA 1IH7A 1RT5A 4CK2A 4CEEA 5EU7A 1ZBLA 1U45A 3AO2A 4CJUA 3SV3A 3RRHA 3KKSA 3O3FA 1WSEA 3L2RA 3QIOA 3MXIA 1L3TA 3KK3A 4KPYA 2G8VA 1QE1A 4CHOA 1RNHA 3NFAA 2P1JA 1VSDA 2DFFA 4DQSA 1RCHA 4H4OA 1F21A 3OYCA 3OYLA 1WAFA 1WSJA 1KFSA 4CGFA 4C8OA 2QKKA 2D0AA 4ELVA 1VSLA 3TAQA 1CLQA 3HVTA 2FBVA 3LAMA 2HNDA 1T05A 5E41A 4DF8A 1VSJA 4M3YA 1SUQA 3MXJA 3SUPA 4BE2A 4K8XA 3MEGA 3WNEA 5FDLA 4IG3A 4KAZA 3C6UA 2G8KA 4RW6A 3NHGA 3AV9A 4CIGA 3NBPA 4N41A 1QSYA 1LAVA 5J2MA 4B3OA 1TAUA 4AHVA 1KVCA 4FK4A 2RPIA 4DTPA 3ZSRA 1QQCA 1HMVA 3HPGA 1QHTA 4NLCA 2DGZA 4UQGA 2E6LA 3OYIA 2BANA 5KI6A 4E7JA 4PY5A 4F4KA 3V4IA 1RDBA 1UOCA 3LWLA 4N47A 3HSTB 4OVLA 3RRGA 4CF1A 3HYFA 2XRIA 4KB1A 4DTMA 1IKYA 1L3SA 3LZJA 5FRNA 1HYSA 1EX4A 1TGOA 4W5RA 3VQQA 4ZHRA 4BDZA 4FM1A 1L3VA 1D8YA 1RBVA 1LWEA 5KGXA 3AVAA 4CJ3A 4FLWA 4OGEA 1KLNA 1BI4A 4OJRA 3OYHA 4CGHA 4CHPA 4KI6A 2Z1GA 4I9LA 3PX0A 4N56A 2HHQA 4K8ZA 2F8SA 4FM2A 1MU2A 1NK6A 3OY9A 4OKEA 3V9WA 1TKTA 5CZ2A 2G8UA 4B9TA 2KW4A 1HNIA 3MEDA 3F73A 4F3TA 1NK4A 2BDPA 1WSHA 4B9VA 2O4GA 2YNHA 1W9HA 2IS3A 3OS1A 3K59A 1N6QA 5D3GA 1O1WA 3M8PA 4CEFA 3OS0A 3TANA 3HVRA 1KSPA 4ELTA 3PV8A 3DI6A 1B9FA 5J2QA 1RTJA 1WLJA 2WOMA 4E19A 5HLFA 1Y97A 3ITHA 1LWCA 1CZ9A 2DFHA 3LP2A 1C1AA 4LD0A 5KRTA 2PYLA 2Y1JA 1RDDA 4Z0UA 5SWMA 3M8SA 4E7IA 4AHUA 2OYQA 1BIZA 3AO3A 4KTZA 3ZSVA 1XHZA 4CK3A 3FFIA 3DM2A 2ATQA 3SZ2A 4KRFA 3NH0A 4CJLA 1TKDA 3ASMA 1BL3A 3HP9A 4B9UA 4N76A 2HBLA 2VG6A 4KI4A 3RMBA 3V9UA 1WN7A 1NK8A 1DTTA 3SAGA 1FKOA 3NE6A 2QK9A 3VQ5A 4CERA 2ITGA 2OPRA 3IRXA 3AVMA 4AHCA 4DQQA 4OLAA 3EYZA 3OYBA 3TABA 4CGIA 3QNNA 4DG1A 3HK2A 4L8RB 4NYFA 3L2VA 4DF4A 4QIWF 4DTUA 4DFKA 3CQ8A 4E0DA 3AVGA 3DOLA 2LSNA 3OYNA 1EXQA 3RMDA 3AVLA 4KO0A 1IG9A 3QO9A 1NJZA 3M8RA 1NK7A 4FXDA 4DFMA 1TK0A 1HJRA 3AA4A 3V1RA 4FJXA 4IBNA 3TAGA 1U49A 3S3NA 3ZT4A 3CFPA 4B9LA 1SKWA 3I0SA 3KLFA 3DLKA 4DLEA 4DSKA 1JXEA 3B6OA 4AHSA 3ZSWA 4G1QA 3HP6A 1RTHA 4C8NA 3LP1A 3V1QA 4Z4FA 3VQ7A 1KCFA 1BI4B 1C0UA 1D5AA 3HPHA 3L2WA 1NKEA 1CXUA 5HRNA 4O3MA 3KKRA 4KHYA 3ZT2A 3VQ6A 5J1EA 2PZSA 5KGWA 2MA1A 2B5JA 5J2NA 4NCBA 4DQRA 4M3TA 4FJJA 3T3FA 4OO1J 3PY8A 2HHVA 4CF0A 1BCOA 4QJFB 1G15A 2I5JA 3CFRA 1UA1A 2OPPA 3U3GA 1JLGA 4FCYA 3RMAA 3OYDA 3RR7A 1KVAA 4ICLA 3WNGA 1SL0A 4C8KA 4J2EA 4KHQA 3NF7A 4ID1A 3U6FA 4EZ6A 2O4IA 1TVRA 5C24A 1WUDA 1WNSA 4CECA 4CEQA 4H4MA 3QEXA 3NGYA 1ZBFA 2Z1JA 4OGCA 4CIEA 5KTQA 3SAFA 3NCIA 4FYDA 3I8DA 1C1BA 3BGRA 3BDPA 3HJFA 1GOCA 2WONA 4DU3A 5I42A 1FKPA 1LAWA 3AVCA 3LALA 5HRPA 3AA2A 4OPJA 2RN2A 2KZZA 3ZCMA 3TAEA 4EP5A 4FJNA 4PWDA 1FXXA 4IFVA 1RT3A 1HNVA 2OZSA 3E01A 4CJKA 1WSGA 1TL3A 3QETA 1VSHA 2GUIA 3O3GA 1VSIA 1HPZA 3B6PA 3C6TA 4CHZA 4O55A 1VRUA 3V9XA 3I0RA 2QKBA 3NAEA 1ZBHA 4O44A 4BDPA 3F9KA 3VQAA 2F96A 4KKOA 2GV9A 4I9QA 4HTUA 4FJ8A 1JL2A 3OYJA 4RW7A 3AO4A 4HHTA 1S5JA 1HYZA 5DK5A 3L8BA 1RTDA 1RDAA 4FW1A 4IFYA 1VSKA 1S1UA 4KHNA 4CHYA 3OJSA 4CGJA 2KFNA 3T19A 1HQUA 1JL1A 3L3VA 4LH5A 1EETA 1K6YA 4E3SA 4Z4CA 1A5WA 4YNQA 4M41A 4HUGA 1SL1A 3V9SA 3A2FA 1GO3F 4FK0A 1ZBIA 1KRPA 1DLOA 1NOZA 1ASUA 4CJEA 1R0AA 1D9DA 2XO7A 3KJVA 4CF8A 3TI0A 4F3OA 1GOAA 3ZT3A 4J2BA 4DU1A 1GOBA 2W42A 4BE0A 3QINA 1S6PA 3O4QA 3NDKA 3SPYA 2KQ2A 5CZ1A 1VSEA 4FJMA 4FJHA 3SI6A 4E89A 4FJKA 3SQ1A 1S9EA 2IAJA 4BWJA 3SQ2A 2PYJA 4CFDA 4EZ9A 4CHNA 4EP4A 4IG0A 1RBTA 4CCHA 4GW6A 1TKZA 1BQNA 2D5RA 2RKIA 4I2PA 4BACA 4QCLA 3TAPA 4QOZB 1LW0A 4W5QA 4FLVA 3VQ8A 2VWJA 4FLZA 1S1XA 4O4GA 3QEWA 2G8FA 4FJ7A 3QLHA 3V9ZA 4AHTA 1RT6A 4KHUA 4ELUA 4WE1A 3PX6A 1UAXA 2HBJA 3L3UA 1ASVA 3VQ9A 3HXMA 1IKXA 4W5OA 3VA0A 4MQ3A 4FJ5A 1WAJA 2A1RA 3G0ZA 3ZSQA 4XIUA 4CJFA 2Z1HA 4KB0A 1IKVA 1ZYQA 3AO5A 1NK5A 2AJQA 1JLQA 2X6NA 4LY7A 1SL2A 3AVJA 3VN5A 4CJRA 4CGZA 2G8IA 1LW2A 4DFPA 3EZ5A 1TKXA 2B6AA 2X6SA 3TAMA 1IO2A 3SUNA 1U4BA 1U47A 4KTWA 2HHXA 4DMNA 2HHWA 3L2QA 2RRDA 4F2RA 1NJWA 3SQ4A 2YKMA 4CGDA 1DTQA 3CYMA 4DQIA 4Y1CA 3VQ4A 4CJPA 3NH1A 3QEIA 4FZYA 1CZBA 4FJGA 4FLTA 3SAHA 1EKEA 4CFCA 4CJTA 4CF9A 4Q0BA 3DRRA 2HB5A 1B9DA 1U48A 2YNGA 4M3ZA 1JXBA 3SPZA 4DTRA 3K5MA 1BQMA 4KHSA 1I3AA 2ZD1A 3NF9A 4DTOA 3V6DA 1XI1A 4DSJA 3LPUA 5C25A 4DTXA 1L3UA 1C1CA 2X78A 5HP1A 2JGUA 3QIPA 3ULDA 1BHLA 4TSXA 1C0MA 4N5SA 4M3UA 3AA5X 3LWMA 3ZSYA 3RWUA 1J9AA 2Y1IA 3RR8A 4KTQA 2VG7A 1S1VA 4CIFA 3AVIA 3KK1A 3EY1A 1BGXT 3SYZA 1HRHA 3O4NA 1KVBA 1C6VA 1HQEA 4W5TA 1UWBA 3SV4A 5CYQA 3TWHA 3OYFA 2FBYA 3VQBA 2ETJA 1BIUA 1A5VA 1T7PA 4Z4HA 4LH4A 4JS4A 4QAGA 2KV2A 2D0BA 2E4LA 3P1GA 3TR8A 3DRSA 1NK9A 2YHAA 5CY4A 3OJUA 1X9MA 4KFBA 4CEBA 1JLAA 1TAQA 3ZT1A 1RT7A 3LAKA 4CEZA 3OYAA 4O5BA 2GBZA 4B08A 1VSFA 1WSIA 1B92A 2XY6A 2B4JA 3K58A 4LSNA 2BE2A 4DWIA 2DTUA 3KLHA 1J5OA 4CESA 2ZQBA 4GMJB 3V81A 1ZBUA 1REVA 1S9GA 2EHGA 3AA3A 5K14A 2OA8A 1T8EA 3SJJA 2G8HA 2HHTA 3S3MA 4DSLA 2R7YA 5C42A 2Z1IA 4HVJA 2XY7A 5KRSA 4CFAA 4ZTFA 3PO4A 4B9NA 4E1NA 3PO5A 4DQPA 4HCCA 3QEVA 4FLUA 1JLBA 3G10A 3AVNA 2KZMA 1X1PA 1BISA 3LP3A 4FZXC 1FK9A 4C8LA 3AVKA 2XY8A 4FLXA 2FBXA 3LP0A 3NF6A 3VQPA 3OYMA 3KLEA 3JSMA 4M3XA 3IS9A 1XC9A 3WNFA 1X9SA 2E6MA 1NOYA 2HW3A 2Q3SA 2KTQA 1CXQA 3NH2A 3OYEA 2RF2A 3MECA 3NF8A 3KD1E 4FK2A 4CJQA 3S3OA 4E7KA 4PQUA 4CEOA 5T7BA 3AVFA 1RT4A 3LANA 2F8TA 3SCXA 2OPSA 3CG7A 3SNNA 4NLBA 4YFUA 4DLGA 4IDKA 4HUEA 1QSLA 1JLEA 3DLBA 2QXFA 1KFDA 1SKRA 4AH9A 4I7FA 4Z4IA 5DMRA 4B9MA 1C0TA 1RDCA 1NKBA 5CYMA 3ZSOA 2KFZA 3HT3A 2P51A 4DSEA 4AILC 4DSFA 3PUFA 2HBKA 4CGGA 3PX4A 2D0CA 4F2SA 3LPTA 4M45A 2YV0X 5C0YA 1JLFA 1WSFA 4AHRA 3QERA 4RG8A 5FRMA 2E1EA 2HNZA 1KLMA 3CM5A 3VQCA 3NGIA 3RTVA 4CK1A 4ZTJA 4J2DA 4CF2A 1RBRA 4M3RA 3K5OA 3SUQA 2FBTA 4FW2A 4CJSA 4R5PA 5I3UA 1LV5A 2HVHA 3AVHA 3QNOA 5JS1A 4O0JA 1VRTA 1VSMA 4KV8A 3O3HA 5J2PA 1S6QA 4BE1A 1UA0A 4GVMA 4DS4A 1TK5A 4JRPA 4CJ5A 4DFJA 1LWFA 4BWMA 4CE9A 1NKCA 3DLGA 4BDYA 3D0PA 3DLEA 3V1OA 3ALYA 3P5JA 3DMJA 1RBSA 1VK0A 3UIQA 4FJIA 1U04A 1Q9XA 1RTIA 1RBUA 1RT2A 3C95A 3ZT0A 3K5NA 3OVNA 1D9FA 4IKFA 1HYVA 2HHSA 1SV5A 1RT1A 3U3YA 1SKSA 4LSLA 1S1TA 2ZE2A 5HROA 1TK8A 2HHUA 3HM9A 4CHQA 4M42A 2A1SA 4E1MA 3ZSZA 1YVUA 3S9HA 1RILA 4CEDA 4RW8A 3WNHA 2OPQA 4FVMA
chains in the Genus database with same CATH superfamily
2HVIA 3CM6A 4FPBA 4B6JA 2E1FA 2JLEA 3K9KA 3THVA 4DR4K 3AVBA 7ICQA 1JCGA 2KIVA 4FJ9A 3BZKA 1VLBA 4ID5A 2BPGA 1MA7A 2ZJPL 2P5OA 2OTJN 2DQNB 4DQ8A 4CJWA 4CI6A 1A76A 3K57A 4MFFA 3TSUA 3OYGA 3UMCA 2VG5A 2YNFA 1ZC6A 1Z00B 2LYHA 1J6ZA 2DL0A 3AQFA 2YI1A 3KIOA 3OS2A 3SD7A 5F0XA 4F93B 3MAQA 2BKEA 3HOSA 3NVYA 3K0SA 1NJIO 2OZMA 4BY9C 5AK6A 4XH4A 1S5LU 4KLTA 1J53A 3D45A 5BPLA 1JIHA 1ZXIA 3QESA 4JS5A 1IKWA 5AQFA 3EE8A 3Q7BA 4Z4GA 3RBEA 4B8AB 5CJ7A 4DTJA 4PUOA 3AO1A 5AIBA 4NXZA 4JLHA 1C7YA 5AQWA 3VF6A 2CPRA 3RMCA 4PA1A 9ICVA 3RF9A 4LF4K 3TAFA 3TTFA 4OJ5A 4DTSA 2W54A 1Z25A 4FZZA 1X6JA 1XWLA 3IMXA 1X66A 1YT3A 4E7LA 3M8QA 3K2PA 4FS2A 5ALRA 1E3MA 3T69A 4QZIA 4CZGA 3DV9A 4ED3A 3IG1A 3FYHA 1X2IA 2FPLA 3G6VA 3AAQA 3W3DA 3KHYA 4BC4A 4WF9L 5EOZA 7ICSA 1YHQN 3G4SN 4YY3K 4CDGA 2VWKA 2HBMA 1IH7A 4CEEA 4KHNA 2XC9A 1VAZA 4JI3K 2E88A 5AI0A 1VSDA 2DFFA 4DQSA 3IHQB 8ICSA 4J03A 7ICTA 1KXPA 3CCJN 4Q45A 4JK8A 1ZQXA 4C0ZA 2D0AA 3ZETA 3D2NA 3M5RA 4NLGA 4Z6EA 4IXCA 4MDAA 4FZNA 3C5FA 5ALKA 4BR2A 5E41A 3QZ7A 3MX5A 1SUQA 3SUPA 4I2BA 4BE2A 2LMRA 3RB0A 3WNEA 3O9UA 3GG4A 3C1ZA 3NHGA 2JGAA 1QSYA 4RWTA 2Y9UA 4FWNA 4BGDA 5AI4A 3RJIA 2NNWA 4E1JA 1CZAN 1QHTA 4NLCA 3CNHA 5HOOA 4F4KA 1GLLO 3HSTB 4IEEA 4OVLA 1J2MA 4EBEA 4US9A 3HYFA 3OSNA 3JPQA 4I2DA 4MEYA 1RG6A 4JMUA 4KN7A 1TGOA 1S0NA 3VQQA 4ZHRA 4BDZA 1L3VA 1D8YA 3WXMB 1OH5A 4PH5A 3T5KA 4EELA 5KGXA 4JI7K 4MLEA 1YJNN 3NUQA 4IRDA 4OJRA 5AKXA 1SS6A 3UM9A 4KLDA 3H6EA 4CE6A 5E84A 3TADC 4OKEA 5ALGA 5GTHU 4B9TA 1TKTA 3THWA 4F91B 1RM6C 2KW4A 3MEDA 3F73A 4F3TA 2I1QA 5BR8K 2YY6A 3R1XA 1K1SA 4JV0A 1W9HA 2IS3A 1K9MO 5D3GA 3TANA 1KSPA 4ELTA 3OS0A 3HVRA 3PV8A 4BRPA 4DCHA 4IC9A 5C2DA 1RTJA 3DEEA 1ZQJA 4E19A 3T79A 4KBOA 5HLFA 1XC3A 1LWCA 1CZ9A 2DFHA 3CCSN 1PK3A 5BN8A 4Z0UA 5JU5A 4KTZA 3BF1A 1HKCA 1XU4A 3PW5A 4XRHA 1CI4A 4F5OA 3IKMA 4CJLA 4JD2A 2OM6A 3ASMA 3N4MB 1RQNA 5BPNA 4N76A 1UCVA 2B0CA 5BR9A 2QWMA 4Y2TA 2C2DA 4H5TA 2C2EA 4JN4A 2MUTA 3THXA 4CRXA 3J7ZO 2ITGA 3IRXA 3VEOA 5FPNA 3M9MB 4ED6A 4JKDA 5AQQA 3FZHA 4BRGA 4BC5A 3TABA 4L8RB 4NYFA 2Q1NA 3L2VA 2NRVA 4E0DA 4CD1A 1KEJA 2K8BB 3RMDA 4EEYA 4BXOB 3Q8QB 3IDHA 1TVAA 1IG9A 3E1YA 1NK7A 3F5AA 1PVRA 4QZEA 4DFMA 1TUUA 3V1RA 4FXDA 3FZLA 4IBNA 3M9NB 2YMPA 4GKKK 2ZTDA 4BJQA 2W9CB 3QICA 4DSKA 4DLEA 2ZGZA 1OH7A 1RTHA 4C8NA 4WQ5A 3LP1A 3V1QA 1BNPA 3QU2A 1ZQRA 1NBWA 2P9IB 3HWTA 2KJ9A 5AI9A 2W9BB 4IDHA 4AYBC 1S76D 2JHDA 2LKYA 2PFNA 1CXUA 5EE0A 2P9IA 3KKRA 4KHYA 4PKHA 5J1EA 2B5JA 3ZDDA 4M3TA 1TYQA 3VTIA 3TSPA 4QZFA 8ICTA 3ZDBA 2EQYA 4QJFB 1MQ2A 4X5VA 2KNJA 3H1QA 1XNRK 4YXMA 4UAYA 3OYDA 3NF7A 3FM9A 4EZ6A 4ECYA 2FE9A 4B1VA 1ZQCA 3QEXA 4NLZA 3NGYA 3WXIA 1ZBFA 4CIEA 4PKGA 2G0AA 2EH9A 3SAFA 2FXUA 4M6WB 4EEKA 1C1BA 2W3SA 4MF8A 1XO0A 3MBYA 3CXCM 2EDUA 3HJFA 2WONA 4FO0A 4LZDA 2E2OA 4JI1K 2ZIVA 4OD0A 1FKPA 2HF4A 1LAWA 2Y0SF 3AVCA 1NU0A 3T5LA 2RN2A 3ZCMA 3ETLA 4RQ5A 1SXDA 4BRKA 4PZNA 1L7NA 1WSGA 3CMAN 1OXJA 1TL3A 3QETA 3N4PA 2GUIA 1VQPN 3C6HA 2YX6A 1HPZA 4PHDA 3PMNA 5KG0A 4O55A 4CD3A 3NRWA 2F76X 3PZPA 3F9KA 3WQTA 2F96A 2GV9A 2ZXHA 3KWIA 3O80A 1PVPA 3AO4A 1S5JA 5DK5A 3KD3A 4JWMA 4O8UA 5AK4A 3L8BA 2NRXA 4OJOA 1VSKA 5ELZA 3T1HK 5FP0A 4CGJA 3C28A 3QB0A 4LFCK 3L3VA 2W43A 2AGPA 1K6YA 3D2FB 9ICHA 3RAXA 2YMQA 5L1MA 4MO5A 3GQCA 5KFAA 3CJAA 4CW7B 4BG9A 4CZFA 3WK5A 4CJEA 2K4EA 3WU2U 2Q36A 5AQJA 1GOAA 3O6WA 3ZD9A 5CA7A 3Q8RB 4J9KA 3GDQA 4DU1A 5J2FA 3C0BA 3F53A 4BE0A 1S6PA 1TFRA 3SPYA 3WKAA 3QUQA 5CZ1A 5AZIA 1K8AO 4E89A 4AF1A 3SQ2A 5TISU 5GTIU 2CGKA 3VC8A 2LYBA 5DM6L 4CZLA 1ATNA 3D2QA 5J0OA 4IG0A 3Q8KA 4H0XB 2QARB 4EP4A 4BACA 2BPFA 7ICPA 3TAPA 1FJGK 4A62A 4W5QA 4CJ7A 2Q0ZX 2NYVA 3M1FA 4IOXA 4RT3A 1S1XA 4O4GA 3LVWA 4FLZA 3THYA 4FJ7A 5CP2A 3QU5A 5F3XB 2WF5A 3TU5A 4TURA 3VPZA 3HXMA 3C23A 2Q31A 3VA0A 4UB2A 1V9PA 4MQ3A 2E20A 4FJ5A 8ICPA 5AQSA 2ZG6A 5ALUA 4EYHB 4OJPA 1IKVA 3I28A 2AJQA 3WK8A 2F8LA 1SL2A 1ZQYA 2XICA 8ICEA 3NMUA 4NJ8A 4CGZA 1Z1BA 2I9GA 3ZETB 2BHNA 3UMGA 3NVMA 5ALVA 3EZ5A 1TKXA 2B6AA 5FPDA 3TADA 3SUNA 3MK6A 2ZIWA 5AIAA 1ZQTA 5DGAA 3LDQA 3L2QA 4F2RA 4KLOA 4JYAK 3NVZA 3SQ4A 5LL6Z 3CYMA 4DQIA 2YQEA 1BPZA 4B3RK 4CJPA 3N97B 1I94K 4B1UB 7ICVA 4FJGA 5EWGA 4EBDA 4CFCA 4CJTA 1ZQWA 2YNGA 1NGGA 2E1ZA 3UKUA 1BPDA 1BQMA 1N5WA 5AQVA 4KHSA 1I3AA 4RQ6A 4CZKA 2HDOA 5MLCQ 4DSJA 1C1CA 3LM2A 1O03A 3ULDA 1BHLA 4TSXA 1C0MA 2NZTA 1ZETA 3P31A 3O9QA 3ZSYA 1R59O 1NGHA 3SMSA 3BS7A 5KFLA 4KTQA 2VG7A 3J81O 5J2KA 3SYZA 2HOEA 4C1NK 1KDHA 1HQEA 3RSEA 5CR4A 5CYQA 3OYFA 2FBYA 3MGVA 3CCVN 3O9SA 3NVWA 3ORYA 5KT5A 2NO5A 2A1JA 4PL2A 2Q2RA 4JS4A 2D0BA 2E4LA 5KPRA 1NK9A 3UKRA 1RZTA 4CEBA 1JLAA 1IG6A 1XI1A 3OYAA 2UVRA 2KZ3A 4KLHA 8ICCA 3DXMA 2KKVA 2YTUA 5DDYA 7ICHA 3MR3A 2K8CB 4O5KA 3VESA 1B92A 2B4JA 4O3NA 3IN5A 2NV3A 2YCHA 4M63C 2OCEA 9ICNA 1J5OA 4OX9K 4FVUA 1KAZA 1W2BM 9ICRA 4GMJB 1O08A 5DBAA 2QWQA 4JKFA 1ZBUA 4UB1A 3SMPA 4RPZA 2EHGA 3AA3A 3Q8PB 3H7IA 2YX8A 3HTVA 2KG5A 3MDCA 3SJJA 3S3MA 1ZQLA 2WAQC 5C42A 2KMDA 4HVJA 5EXWA 5AM1A 5DLFA 3SBTA 1HUZA 1EO1A 4UB5A 3PO5A 2BTFA 4H5VA 3VEWA 4IQVA 4FLUA 1IBMK 2VA3A 1JLBA 2KZMA 3G10A 1OH8A 1NGIA 4FZXC 1HR0K 4YOVA 5IIOA 1GLBG 3AVKA 4B3SK 3LP0A 3VQPA 3WNFA 5ALIA 7ICNA 4TUQA 1NGEA 2E6MA 4FWRA 4FK2A 1MA9B 2V7YA 3G6XA 3CC2N 3ED5A 4BR4A 2O8DB 4PQUA 2JMGA 5IILA 3LANA 4QS7A 1ZD3A 4ECXA 1J2NA 3RFAA 1ZQHA 3SCXA 2RE2A 4IJAA 3CG7A 5AFUA 4LFAK 3C29A 4JV2A 3TFRA 2M0NA 4DLGA 4YFUA 4IDKA 7ICGA 5KG4A 2KHQA 5ALPA 1JLEA 3A5LC 4C80A 3DLBA 4AH9A 3QEAZ 5CYMA 5AFUH 3ZSOA 3NGDA 5KT7A 2P51A 4C4TA 4WFAL 3WK4A 4RQ1A 1YITN 3BUZB 3PX4A 4PZOA 4F2SA 2D0CA 2YV0X 2DF4B 4EIAA 5AQKA 2P6RA 3QERA 4P0QA 2E1EA 3CM5A 3VF4A 3NGIA 1BU6O 3ZX0A 4CF2A 4M3RA 2WHEA 1GLEG 3GV7B 3SUQA 4B1WB 5I3UA 1NI3A 2HVHA 5DQHA 5JS1A 3C6AA 3O3HA 2AHOB 5J2PA 1S6QA 3ONNA 1SAZA 3H1VX 4CBWA 4K4HA 1KN5A 2LBOA 3N4QA 4JKGB 4CE9A 2NRWA 1NKCA 3FZFA 5KFEA 2EZZA 2PI4A 5BOLA 3ALYA 1RBSA 1VK0A 1H38A 4IKFA 1RBUA 1D9FA 4IL6U 3C95A 1X40A 3ZT0A 3PR4A 2FMPA 4M7XA 3MN6A 7ICKA 4A5AA 1B43A 5DB8A 2ZE2A 1TK8A 5HROA 2XGPA 4CHQA 1UPHA 1ED1A 5AQTA 3S9HA 3CCRN 2UXDK 3VCBA 4RW8A 4C23A 3WNHA 2OPQA 4CJ4A 4JKAA 1Q9YA 4BG8A 5DB9A 4DV6K 3F5EA 3NGZA 2WB1F 4PHEA 1L5UA 3RJJA 5KG5A 2X74A 4ILJA 5AQRA 1FFVA 3I56N 4CJVA 3OYKA 3AQEA 1QTMA 4O0IA 1ITGA 3DYAA 5H1SQ 2G8WA 2JEJA 4M04A 4BUGA 2HF3A 5F9LA 5JMVA 1XHXA 1YTAA 2EZXA 2O8FA 3H45C 3I1YA 2LPEA 5AHXA 5ALEA 4OJLA 2W9BA 4PKIA 4CEAA 1S1WA 3VQDA 3Q7CA 3O1WA 2VIXA 3NASA 4DOAA 1EP4A 9ICXA 4M3WA 1NJYA 3H8SA 2WB1C 3LDAA 4MFBA 2K4HA 3CFOA 3QX7A 5GADP 3VEYA 2BR0A 4B3MK 5L1LA 4FLYA 1MWKA 2ZWHA 4YMOA 1YZ7A 1XSNA 2QWPA 3CETA 3C21A 3VOVA 2ZJRL 2IDOA 2DY4A 2E3TA 1WCNA 1JKHA 3JYTA 3U26A 2Q97A 2FI1A 4F72A 4KITB 3MN5A 5IT9O 1X6IA 5J2AA 3WKCA 1Z4OA 4DL3A 4M6WA 3CQXA 1KTQA 3MEEA 5ADXH 5EWEA 5FROA 3HOTA 2I6XA 1S3XA 1JLCA 2BUPA 2HOQA 4KLMA 1Y64A 5HRSA 4BR9A 1TE2A 4RQ7A 1SV0C 4DUZK 1NJXA 4B3TK 2NLXA 1ZRMA 5TZVA 4IFEA 3MXMA 1T03A 2W8KA 4MEXA 4I2AA 2KHOA 5AQZA 3DRPA 3KK2A 5M1QA 2BCQA 5DBCA 4XA5A 1BCMA 1CEZA 3GZFA 2ZUCA 1SQKA 2ZXIA 2DKXA 1UQVA 3L2UA 4IWVA 3CPWM 1NJWA 5EU7A 4O5EA 3SV3A 3O3FA 5C5JA 1WSEA 3L2RA 1L3TA 3KK3A 1QE1A 1RNHA 3NFAA 4ILHA 5IIMA 2AP1A 1Q3VA 4KHPK 3RAQA 1NGDA 5KFIA 4U6PA 1RCHA 2MRLA 3N7PD 4O3PA 3V6KA 5C12A 3OYCA 1JALA 1X3NA 2W55A 2EAMA 5KFTA 4PGYA 2WF8A 2E5SA 3D6JA 1VSLA 3TAQA 2CRXA 5D4BA 2FBVA 5AKKA 5J8YA 4NXNK 3LAMA 5HHHA 3BQ0A 1T05A 4ED8A 4M3YA 1VSJA 2VA2A 2LM4A 4ED7A 2KJ8A 4IS7A 3QBXA 1COOA 5FDLA 4FWOA 5J2HA 1N62A 3AV9A 3M6GA 2DPNA 1RQLA 2ALZA 3IM1A 3WXJA 4FK4A 3KZBA 3ZSRA 1QQCA 3OYIA 3HPGA 3CHWA 1DRGA 2E6LA 1T3NA 2BANA 4KLGA 4E7JA 2V51B 3R3LA 1DT9A 3V4IA 3LWLA 1ZQFA 4I2GA 3RRGA 4KMOB 1XNSA 1O13A 1ZQAA 1JXLA 3B8AX 3EUB2 1L3SA 2P9PA 3LDLA 4ECZA 1ESVA 1URJA 3AVAA 1PZNA 2P9PB 4CJ3A 3R8EA 4OGEA 1BI4A 4KI6A 3VERA 8ICAA 2Z1GA 3WXLA 1ZQMA 5KFBA 2EAOA 1NGBA 4FFDA 3PW7A 1QH9A 2G8UA 4UASA 3TKAA 1SZPA 4TUSA 2G5IB 1NK4A 1WSHA 1YJWN 1WYGA 1TYQB 3FFKB 1ZJMA 2YNHA 4ISFA 3K59A 3CF5L 3LDOA 1O1WA 1JCFA 4NXMK 3H8JA 2IA6A 2ZUBA 5AQPA 3VEZA 5J2QA 4UAWA 4DL6A 1Y97A 1RXWA 3PIPL 3LP2A 2DBYA 1MSWD 2P9NB 4M9NA 1ZQZA 3A0HU 3QDKA 2Y1JA 1IIPA 3V6JA 2PFQA 1BIZA 4QWBA 3QUTA 3FFIA 3H0MB 1HNXK 5EY4A 1BPYA 3ETRA 2P9LA 3NH0A 4U7CA 5J2JA 5DQIA 1NMNA 3CJ7A 1WN7A 3SAGA 2A42A 4CERA 2RLTA 3QUBA 3B0XA 5EE3A 2H3QA 2YB1A 5J0WA 3ZD8A 2VQEK 3QNNA 3HK2A 3TTDA 3D2EA 4FWSA 2R8GA 3CQ8A 1MN8A 2LSNA 4KO0A 4QW8A 4I28A 1XNQK 4Z6CA 3M8RA 5HR6A 3MR6A 4IQUA 4I2IA 1U49A 3ZT4A 3MDQA 5DM7L 2XIDA 1JXEA 3B6OA 3J7AP 4C4RA 3D2SA 1W7AA 4UAUA 4KLFA 1KCFA 2QI2A 1Z00A 4FWLA 4BROA 1C0UA 4MF2A 1D5AA 3KWGA 5M1OA 1Z1VA 3HPHA 4M9HA 3G6YA 1Q81O 1SWVA 5AKGA 1HKBA 2UU9K 1RPLA 4O3MA 5ALWA 3ZDCA 3VQ6A 4AM6A 2VANA 4AM7A 1FW6A 2UVUA 2WF6A 4NCBA 2VKQA 3L4PA 1DEJA 1XQSC 5D46A 3FAHA 4F5RA 2AU0A 1HLUA 3HZ6A 4RCHA 1G15A 3CFRA 1BG3A 3ENHA 2OPPA 3RR7A 1JLGA 3WNGA 1SL0A 4JK7A 4DFDA 4ID1A 2FDRA 3SENA 3V7KA 2O4IA 4CEQA 3O8MA 1WUDA 4GXKA 4CECA 5B8HA 5AK5A 3A5OC 2A19A 2Z1JA 4UW9A 4Y2YA 4QWCA 3NCIA 5HR7A 1IV0A 2V9WA 4JI2K 3BGRA 1L7PA 4GFJA 2JXJA 4CZMA 4DU3A 1F44A 2K60A 4ZOHC 2GX9A 1HUOA 4P0PA 7ICFA 3AA2A 4EP5A 4FJNA 1BPEA 4QZCA 3PSIA 1RT3A 1HNVA 2OZSA 4CJKA 1SB3C 4YHHK 4BRFA 1T6CA 1SGGA 3DAWA 4YOXA 3O3GA 3CRXA 4CHZA 3I76A 2A3ZA 4I2FA 4JK1A 3QBWA 4BGAA 3TSQA 2D3DA 3CD6N 2H3ZA 3VQAA 4I9QA 2CN1A 3A5MC 3OYJA 2P9SB 2W3RA 1HYZA 2OHFA 2BCRA 2IOFK 4JK9A 1RGIA 2C22A 4IFYA 3AU2A 3A0IX 3OJSA 1P8ZA 4QZBA 5J0XA 1NGJA 2ISOA 2W9MA 4FS1A 3T5JA 4M41A 4YNQA 5ALNA 2WTFA 1ZBIA 2KSOB 2KJ5A 1ASUA 2ZF5O 3U9DA 4YQWA 4P4OA 2MAXA 3TI0A 2AH5A 2IBKA 5KT6A 3ZT3A 3J8AA 3SMVA 7ICOA 4WQ4C 2W42A 4GKJK 3NDKA 3O4QA 1S22A 2KQ2A 1L8LA 4L3QA 2P35A 4FJKA 2V7ZA 3F2CA 5C2FA 4EZ9A 2BCVA 5DG8A 9ICPA 2FMQA 5BPMA 1RBTA 4GW6A 1TKZA 3V6HA 4A57A 1L8OA 1RYUA 4BGBA 4FLVA 4PPXA 3VQ8A 4HTLA 2QARA 2GLEA 2G8FA 1VQLN 4KHUA 2L5YA 3F9MA 4WE1A 2HBJA 4P4PA 3AM9A 1GLJO 3L3UA 3AMZA 1BVSA 1AROP 2P9UA 1WAJA 5FPMA 3G0ZA 2A1RA 4RT2A 4XIUA 1ZQEA 4CJFA 4DL7A 5I9EB 3UMBA 2ZIUA 2WF7A 4U7BA 5AKZA 1LVHA 4DEZA 4YG2A 2GUPA 2G8IA 1LW2A 2P9KB 1U4BA 4FSVA 5TKWA 1IO2A 4LF6K 1Q8KA 4DMNA 3C65A 2IHNA 3CPEA 4JI4K 3D6RA 2XVTA 2J6SA 2YKMA 3T1YK 2PMZF 3NH1A 2R18A 4P4MA 5KG3A 1CZBA 2R8JA 7ICUA 3M3ZA 5KT3A 3SAHA 1SXEA 3FDSA 2YHXA 4FLTA 3LL3A 2HB5A 1OW5A 4NO7A 3VMFB 3SPZA 2IIRA 1LB2B 3LDPA 2J4RA 4UAZA 2JV3A 3NF9A 3GDXA 8ICNA 5CHIA 4DTOA 4DR1K 4H5RA 4C7ZA 3LPUA 3QXGA 2Q0RA 4WFNL 4DTXA 7ICEA 4JNEA 5HP1A 2JGUA 3QIPA 2BH1A 4KLIA 3SQIA 2W6LA 4BC3A 1RDFA 2KHVA 5KFUA 2D4WA 5K4LA 4M3UA 3VENA 3L4QA 4H5WA 3BP8A 4XUSA 3KK1A 3EY1A 5AQGA 4UB3A 1HRHA 4W5TA 1UWBA 1ZQDA 2V52B 3VQBA 4IO9L 1YAGA 4YXJA 1UT5A 1LOTB 2I5HA 1BIUA 1T7PA 3THWB 5T14A 3CP8A 4Z4HA 1KKXA 1JI7A 2CXYA 3TR8A 3P1GA 3DRSA 4O3SA 3TFSA 3OJUA 1V97A 1X9MA 2FSJA 4KFBA 4CEZA 5AQNA 5B5EU 3N28A 4RZRA 2GBZA 4B08A 4DR3K 3S41A 4DR2K 4R63A 1WSIA 3FZMA 3FC4A 4BRLA 3OSPA 1OVYA 3VF2A 2GELA 1L7OA 1HPMA 4F50A 4LSNA 5AQUA 2LYAA 4DO9A 1HX1A 4CESA 5AKLA 3V81A 2D1KA 2OEHA 5BOMA 4NL9C 2DUYA 4YMNA 1REVA 5J2DA 5F1XA 4G3IA 2BQ3A 5K14A 2JWLA 7ICJA 4BRMA 4R8UA 3JPTA 2Z1IA 3O1BA 2GH1A 4ZTFA 3IV6A 2DPJA 4B9NA 4RQ4A 4HCCA 4I2HA 3RH5A 1QZ5A 4X64K 3MMVA 4ECRA 3LP3A 4BVOA 1FK9A 3K75D 2I7NA 5AQOA 4XH5A 3IS9A 1N36K 4JKBA 5JICA 5AZJA 1X9SA 1NOYA 2KTQA 2Q3SA 3MECA 3KD1E 3KK7A 1W97L 3ZYYX 1B4FA 4CEOA 3CJ1A 1NGCA 5T7BA 2KD1A 1VQON 1Q82O 5AKHA 4A61A 2Q0UA 5ADXA 2ZTEA 4ICAA 2OPSA 5J29A 1VQ7N 4RUCA 2P9SA 3ENOA 1N61A 5KFGA 4HUEA 4YR0A 5GINA 1AQ6A 3E2EA 4FE3A 1LCUA 1KFDA 1WUAA 1C0TA 1NKBA 2O8FB 2A1JB 3HT3A 3L4IA 4P0QB 4DSEA 5KG7A 5LMNK 4DSFA 2HBKA 4CGGA 5J2CA 4M45A 1JLFA 1WSFA 3BEXA 4G9BA 1KLMA 4ZTJA 1YI2N 2JZBB 1ZQSA 1RBRA 3K5OA 3AL0B 2FBTA 1NNLA 4CJSA 1LV5A 3AVHA 3DXKA 4O0JA 1ZQVA 5J0YA 5BPCA 1VSMA 3PIOL 5J8YC 1UA0A 4DS4A 1TK5A 4QS8A 2BCUA 4YDUC 5GIOA 1LWFA 1X42A 4JAXA 3MR5A 3DLGA 1ZQGA 1HEKA 3QUCA 3D0PA 1NGAA 4I29A 1Z05A 1ZQKA 3LVVA 3DMJA 4FJIA 3UIQA 4GIBA 1U04A 1RTIA 1RT2A 4CF4A 3OVNA 2Y0SC 3WKBA 2HHSA 3QFUA 3LYSA 1ZQBA 3CCMN 4LSLA 4EAHD 2A3VA 3CERA 1XS9D 4E1MA 1QQMA 5EWFA 1YVUA 5LMUK 2ZJAA 1RILA 3GIJA 4USAA 4JI6K 4MFAA 3MCPA 4Y1DA 1N5XA 2YNIA 3HL8A 1NK0A 2RHFA 1TL1A 4BXOA 3BS5B 4KLLA 4J9NA 1NG9A 4KLEA 1SZHA 4J9SA 4DTNA 2HNYA 4F92B 4YVZA 5ALJA 8ICBA 4HWIA 2D0OA 2IC3A 4MDBA 5M1NA 3QU9A 1QS4A 3SEIA 3WUHA 1JCEA 4TQRA 4DL5A 3LZIA 3HKZF 1RFQA 2KVSA 4R79A 5C10A 1IG8A 1A5XA 2PY5A 1DKGD 4KREA 2KKPA 2YN4A 5KFQA 5KT4A 1D8BA 3H4DA 3T1AA 1Z19A 1Y88A 1N32K 1ZJNA 3GV8B 2YHBA 2JRZA 3LK9A 1QHAA 1ZQNA 3KTQA 9ICJA 1Q8IA 4H5NA 5AQXA 4FOEA 3KD5E 4ECVA 1LKYA 3KFUF 3SJHA 4YR2A 2EX3A 1QCKA 4WFBL 2IOCA 4OJ6A 1NZPA 5ALYA 5KFCA 3DXKB 1VQKN 1IBLK 3CCEN 3VQEA 8ICYA 1X9JA 5FPEA 4F5NA 2KN7A 4JV5K 4GLXA 1N5YA 5CEHA 2FC0A 3E58A 3QU4A 4OKKA 4BRDA 2XHBA 2HMIA 2WFAA 4JRQA 2E5LK 1WOQA 2NRRA 9ICKA 3RJKA 3WEEA 1F5SA 3O9RA 4F8RA 4BQLA 3O08A 3KLIA 4H8KA 4NWIA 1I39A 1N33K 4NM1A 4OPKA 4Z4EA 4B1ZA 4K41A 4DV0K 3Q8MA 4DR7K 2V4QA 3OA9A 3C94A 4QZHA 3L5KA 3QEBZ 4NCGA 2ZTCA 3PR5B 5KFZA 4DS5A 5HMLA 5EX5A 1RYSA 1RT5A 3AO2A 4LVSA 1ZQUA 3QIOA 3MXIA 4KPYA 3J7YP 2G8VA 4J9QA 1NOMA 3AEVA 4CHOA 3DLLL 5J0UA 4RQNA 2DKZA 1YXQA 1F21A 3A5NC 3BY5A 1KFSA 3CQYA 3GBTA 4ISEA 4JKEA 4ELVA 2GEMA 2M9NA 2AXTU 1CLQA 2ZIWB 2FLOA 8ICWA 2MSNA 1KAYA 4DF8A 1N48A 3MXJA 2Q4TA 2JH1A 4RQ0A 3S6JA 2VA8A 4KAZA 3P38A 2O8BA 4N41A 4CIGA 2FMSA 3NBPA 3C2LA 1QLNA 1LAVA 5J2MA 4UATA 4JKCA 1GLAG 1KVCA 1Z6RA 5A2QO 4B3OA 2RPIA 2DGZA 4CBXA 5L1IA 4PY5A 3GIKA 1UOCA 4FWKA 3ZDAA 2F8KA 4N47A 4LF5K 4CF1A 5AJ3K 4KX3A 4DTMA 5FRNA 1N63A 1EX4A 4W5RA 2D6FC 2WBNA 2RHKA 1RBVA 4F9OA 5TKYA 1LWEA 4OCZA 2ZUDA 1KLNA 3AAPA 4CGHA 2HHQA 4KN4A 4I9LA 4N56A 3UQ2A 4FL9A 4K8ZA 4QZGA 2H5XA 2F8SA 1NK6A 3CI5A 3OY9A 2PAVA 3VGKA 2ATLA 4O5FA 5CR0A 5CZ2A 2ZJ8A 2ODGA 2BDPA 4B9VA 4QZ8A 2YMLA 4YORA 3H8MA 4ECQA 9ICTA 1HJOA 2P9NA 4Y2SA 5KFFA 3CJBA 1B9FA 3DXMB 4X66K 4RQ8A 7ICRA 3GIIA 1VQNN 3VGMA 3ITHA 4CVNE 2F2AB 1C1AA 4JKGA 5KRTA 3KKAC 2OYQA 2KFNA 1B0XA 3M8SA 2ISPA 1OVQA 1RDDA 2VGNA 3ID6A 4GNIA 3AO3A 4MLHA 4E7IA 3EN9A 1S72N 1XHZA 2G5HB 2ATQA 3SZ2A 2PFUA 2E8PA 3QFPA 4R64A 5DG9A 1TKDA 1BL3A 5KPTA 4I6MB 3SLCA 2VG6A 3NRZA 2F1JA 3H40A 4IQTA 2QWLA 1NK8A 3V9UA 3RMBA 9ICMA 5AZJB 4O3QA 9ICLA 2QK9A 2OPRA 3UE5A 4A8EA 4AHCA 4OLAA 4KLSA 3EYZA 1QVGM 4K0KK 2J6TA 4DFKA 3KHLA 5L1KA 1QZ6A 3AVGA 3DOLA 3RVCA 3CCUN 1EXQA 2ASMA 3AVLA 4LF9K 2O8CA 2VJ5A 1XMOK 3QO9A 1HJRA 3AA4A 5ALHA 1T44A 3G6EN 3I0SA 3RB4A 3MFIA 2QW9A 2HSZA 3HP6A 1MWMA 3WK9A 4G1QA 3ZSWA 3ZLJA 4Z4FA 4FOIA 2G06A 3E9PA 2FJ6A 1D4XA 1VHXA 5KT2A 1C0FA 3O5BA 3OHRA 3KZXA 3BQ2A 9ICUA 4RTFD 4DV3K 4DUYK 1RYRA 3ZT2A 3CCQN 2UUBK 2BZFA 3T5HA 5KGWA 5AI8A 3CC4N 3ZDEA 5KFSA 3WK7A 4BRCA 3RH4A 3T3FA 3PY8A 2R8HA 4Q8FA 4CF0A 3O9TA 1BCOA 4J9MA 4JB3A 4P2HA 1ZXOA 1ZD4A 3E0FA 3U3GA 4FCYA 3RMAA 3QNMA 1IM4A 1KVAA 4ICLA 5GAGP 4EFHA 4KHQA 1N60A 3JXUA 1TVRA 5C24A 1WNSA 4DV4K 4FYDA 5KTQA 4OGCA 5BRDA 1JX4A 3I8DA 4FO6A 4DKWA 4I2JA 3BDPA 4UB8U 1VQ4N 5I42A 2F77X 3LALA 4BRIA 4IOAL 2KZZA 4JHDB 3M6ZA 2MUTB 3TAEA 4PWDA 2RDIA 1FO4A 1S77D 5A0LA 5LY3A 3E01A 4BX9C 5KFVA 2OH2A 1T94A 2XGQA 2P6UA 1ZD5A 1VSHA 1ZOLA 1ZBSA 2EWSA 4ED0A 2F4VK 3B6PA 3D2EB 4XH1A 4TUPA 5IINA 1TV9A 3C6TA 5KFWA 1VRUA 4M9GA 4JI5K 4BRNA 4I27A 3KBBA 3NVKA 7ICLA 2HOFA 2UUAK 4FJ8A 4C1NI 1JL2A 3IUCA 1NGFA 4RW7A 4HHTA 4GV9A 5AKIA 4DV2K 4M0AA 8ICMA 4CHYA 2PFPA 3T19A 1EETA 4Z4CA 1Z4NA 4HUGA 2ZIXA 3OHAA 3V9SA 1KD1O 2OYYA 1KRPA 3ZX3A 1LKYB 2K4PA 1DLOA 2YJEA 1S9FA 1R0AA 3D2FA 1ZQQA 1IJJA 2F44A 1D9DA 5KG6A 3I55N 4IEIA 4EENA 4CF8A 4F3OA 4UAVA 5AM3A 3ISCA 2JEIA 4NL9A 3PW4A 1MC8A 4I2EA 1GOBA 1JJ2M 4US8A 1VSEA 1VJ5A 2VGMA 3AARA 3MN9A 2PYJA 5KL1B 1SV4A 4CCHA 2D5RA 1BQNA 2D0PA 4Y2RA 2HOIA 3F5TA 2OXOA 4QOZB 1LW0A 4BREA 1JROA 2VWJA 3H8WA 4K42A 2A40A 3E9LA 3QEWA 1Q86O 2QB0A 1DGKN 3RB3A 2CGLA 1RT6A 2OWOA 8ICVA 4MO4A 3PX6A 4O3RA 1YZ6A 2K8AA 1UAXA 4KH4A 3GE1A 5AK3A 4W5OA 4F4XA 2D8CA 1K8KB 4Y2UA 4KLQA 3G25A 5KFJA 3MC1A 3C2KA 3IDWA 3EWAA 2QTDA 2ZJQL 1OH6A 1YJ9N 4KB0A 3EEQA 1ZYQA 1H1VA 4BRAA 2A6AA 3BS5A 1QVFM 2RQ5A 5KFKA 3TPQA 1JLQA 2X6NA 4LY7A 3AVJA 4WQ5C 4CJRA 2QWRA 1DXSA 4DFPA 4AYBF 4YD2A 3TAMA 2FSNA 2HHWA 4KTWA 2Y9TA 3J81j 4H03B 3DDHA 4DV7K 1JN3A 5GIPA 4J8FA 3D7EO 4IZ9A 5M1FA 3SI8A 4GXJA 4CGDA 4PL1A 2UUCK 1XSPA 1ZQOA 4Y1CA 3QEIA 3H3OB 4FZYA 4DR5K 3DWLA 5JLHA 4BQZA 1EKEA 3PW2A 4RNNA 4CNQA 2GO7A 4GV6A 3DRRA 4DCCA 1B9DA 4Q0BA 1EWRA 5AM5A 1U2VB 4DTRA 4PHAA 2KE7A 3V72A 1HKGA 1NM1A 3KKAA 3CIPA 5JUMA 4RNOA 3F2KA 3MWTA 1YIJN 2O8EB 3M7DA 4QWAA 2PXIA 3G71N 3QU7A 4M9JA 4NLNA 5AZIB 5C25A 1L3UA 3QZ8A 1WB9A 3M6KA 2HI0A 1S10A 3GU3A 3WT0A 5G5HA 3AA5X 3LWMA 3P4IA 4IO8A 2K4IA 3ATVA 4BC2A 2BGWA 3E66A 3RWUA 3CW2C 5ALDA 4GXIA 3RR8A 2BPCA 1X9XA 3KHGA 1S1VA 2E1YA 3SBGA 4CIFA 1SZ2A 1DK3A 4UBBA 3GFKB 1C6VA 2HHHK 3SV4A 1PK1B 3WKDA 1HUXA 3FE1A 2EAPA 2IVNA 4BRHA 3MGHA 2E8AA 2FPKA 1A5VA 5EVZA 4LH4A 3ALRA 2GOLA 4QAGA 2KV2A 8ICUA 2YHAA 5CY4A 5CB1A 3C7NA 1KQQA 2QKQA 4BR0A 1RT7A 1SWWA 2AQ0A 3L3FX 1ZRNA 3RBDA 9ICWA 1WBBA 4O5BA 4JEPA 1VSFA 3R6MA 1BWFO 3VTHA 4DB3A 3HX0A 4R66A 2BE2A 4DV5K 2DTUA 1BO5O 5EE9A 3JPNA 2ZQBA 1X3MA 5KFRA 1S9GA 2F1HA 2ESEA 1OKJA 2OA8A 2I7PA 3A8YA 4H0YB 2G8HA 3BQ1A 2NRZA 4DSLA 4AP9A 4YFKA 4RU9A 5EOYA 2IHMA 3N7RC 2XY7A 1MQ3A 5KRSA 3HI0A 3PO4A 3LM9A 3PSPA 2VJ4A 3EE9A 4CFAA 4O9MA 4DQPA 2IVPA 1M90O 3QEVA 5KNIA 5JVGL 3UKUB 3GILA 4C8LA 4PJ0U 3HW8A 2UYTA 4Y2JA 2XY8A 4GC7A 3OYMA 3JSMA 3KLEA 4M3XA 2O8DA 3HBTA 2KOBA 2W04A 1L6NA 5KPZA 2RF2A 4ECTA 2HMXA 5J0PA 3NF8A 3NH2A 3OYEA 3S3OA 1EWQA 5IIIA 1RT4A 9ICEA 3T7ZA 4WCEL 2F9TA 2UVWA 1U9LA 3SNNA 4NLBA 2E8MA 3EPGA 4J9PA 9ICGA 1QSLA 5AQHA 1VQ8N 4KH6A 2CGJA 2QXFA 3Q8LA 1EXNA 1SKRA 4I7FA 4PL7A 4Z4IA 4B9MA 1RDCA 4J9OA 2KFZA 2QA4N 8ICQA 4AILC 3EKUA 2HSTA 2UXCK 4A2AA 3PSFA 5C0YA 1WWUA 5KG1A 2DWQA 4RPYA 4JKHA 2W7OA 3RTVA 3VQCA 4B9QA 3F2DA 2W8LA 3UPQA 4KLUA 1B22A 2FLNA 4CK1A 4J2DA 3VETA 2E8OA 4JV1A 4FW2A 4H0VB 4R5PA 2ASJA 4H0PA 4IRKA 1ATRA 5F2RA 4YOTA 2ASLA 4KV8A 4R65A 1FEZA 4JRPA 4CJ5A 2DFLA 5KL8B 4PHTX 4EX6A 4BWMA 4DOCA 4ECUA 2JEFA 3JPSA 3DLEA 2KVCA 3V1OA 3P5JA 3CJ9A 4JHDA 5DQGA 4W5NA 5GAHP 4TQSA 5CRXA 4B1XB 5KFOA 4GC6A 4EBCA 5JTIA 1RT1A 4F71A 2KKZA 4QWDA 3AGKA 5ALOA 2HHUA 3L0QA 5KFNA 3DJCA 4Z94A 4UARA 5ALMA 1KL9A 2FPMA 2CH6A 1A0PA 1ZQ1C 2H3VA 3MWPA 5KFXA 4ECWA 1F0MA 1TAUA 4IJNA 3KHHA 4B8CA 4CFBA 4RW4A 2JH7A 1NZBA 4OLBA 3DOKA 5KQ8A 3O0FA 4Q43A 3TARA 4I2QA 4B9SA 3MFHA 3KLGA 2BGGA 2F3NA 8ICRA 1XSLA 2WF9A 5EE1A 3DLHA 3HPOA 3MCAB 2G07A 2Z7JA 4C8MA 2XY5A 1W0HA 3PSTA 3P39A 4OPAA 3ULEA 3LDSA 2ZIXB 2IGIA 3ISNC 1NWKA 2W6KA 4HUFA 5JS2A 2P5GA 5SZTA 5F9NA 3JPRA 1ILYA 4V19S 1S8OA 4YDUA 3IRUA 1GLCG 3L6QA 4O3OA 4GVEA 4DHYA 3H08A 1K73O 4DV1K 2IOHA 4A5BA 2R8KA 1ASWA 4K43A 2ES6A 1TAMA 4UB4A 8ICLA 3H46O 3VEXA 2NRHA 4A2BA 4NCAA 1S0MA 4QZDA 3ZSXA 4F4YA 4DSIA 1PVQA 1KAXA 1D8LA 4NV0A 4HCBA 4FJLA 3HO1A 2C2RA 2KEYA 1J54A 2A41A 4M7YA 3FLCO 5AR0A 5AQYA 4CBUA 1YTUA 4YP3A 5J2IA 3EPIA 4J2AA 2LI6A 9ICSA 2QB0B 4RW9A 3VA3A 3MABA 4KHWA 5HHIA 3QE9Y 3ICXA 2NUBA 4HAIA 1Z26A 5HBMA 3K5LA 5AKJA 1QSSA 1S0VA 1TV6A 3TTCA 3QMLA 2ZIVB 4Q5VA 1X9WA 2ZGYA 3DLRA 4PHPA 1K8KA 4UBCA 4HYKA 2W41A 2YKNA 2B21A 4FM0A 4CZJA 5CE3A 3IAYA 4LZGA 3SQ0A 3MR2A 2ZM6K 4NYNA 1ECWA 4YR3A 4QWEA 2DFEA 2W11A 4OKJA 3UKRB 3P83D 2OTLN 2YHWA 3IG8A 4DU4A 3SUOA 4XQ8A 7ICMA 5HRRA 4X65K 3I8BA 3PVXA 3ZX2A 4E7HA 2PBDA 2P9KA 2F1IA 4CK2A 4M42A 1ZBLA 5HMMA 3RRHA 5ALQA 1U45A 4M9LA 3R9KA 3FGUA 3KKSA 4H0TB 4CJUA 3QYPA 5KFHA 4YN4A 1N8RO 4JI0K 5J2BA 5KFPA 3J80O 1Q3UA 5JVHL 4FZLA 3GV5B 3KOOA 2ZIUB 5AKYA 2P1JA 2GTDA 2YHYA 3JPPA 4H4OA 4XEIA 3ZEUB 4Y2QA 4C8OA 5KAFU 5CHGA 1WSJA 1WAFA 4CGFA 3ULEB 3OYLA 2QKKA 3JPOA 2PMZC 1JUDA 3HVTA 4MHVA 1NMDA 1IBKK 2FLPA 2QM1A 3WQUA 5AM4A 9ICBA 3UXPA 2HNDA 3HRGA 4K4GA 1BA0A 1E4GT 1A6SA 1N56A 4AQYK 1M1KO 8ICXA 4IQWA 3MEGA 4K8XA 2F7TA 4IG3A 3C6UA 3THXB 2G8KA 1IV8A 3Q8SB 4RW6A 2UXBK 5AM2A 1V4TA 4AHVA 3BQTA 3CJCA 1V85A 4DTPA 2JWKA 4BR7A 5AI6A 1HMVA 4RNMA 4UQGA 3UB5A 3RJHA 5KI6A 1RDBA 2N1RA 3MDAA 1YUWA 1JRPA 3A0BU 2XRIA 4KB1A 1IKYA 3LDNA 3WKEA 4RQMA 3LZJA 1HYSA 1K5OA 4Q8EA 4FM1A 8ICGA 3HRDD 3TQ1A 4PGQA 1S0OA 2JEGA 4FLWA 4G9ZA 2C28A 3C7NB 5DG7A 1A77A 1ZQIA 2PI5A 4CHPA 3OYHA 4Y2VA 3PX0A 2QB1A 4FM2A 1MU2A 5KFMA 2IVOA 3K1ZA 3V9WA 4KH5A 5ALSA 3WK6A 1HNIA 3W0LA 2KLAA 2O4GA 3OS1A 1N6QA 7ICIA 1P90A 2O6KA 1BOTO 3M8PA 4CEFA 5C15A 3DI6A 4UB6U 1WLJA 2WOMA 3U8XA 3ISBA 2YMMA 9ICQA 5D49A 1T3VA 2ASPA 2W03A 4BVPA 3AGRA 4LD0A 3OW2M 2W40A 2PYLA 5SWMA 4M3ZA 4AHUA 3ZSVA 4RQ2A 1XUPO 2R8IA 4CK3A 3EZWA 3DM2A 2WAQF 3BZCA 3BJYA 5IWAK 4KRFA 8ICOA 5AQMA 3PMLA 1KBUA 8ICFA 3HP9A 4UY8O 4B9UA 1V4SA 3OGUA 2HBLA 4R8UB 5J0RA 4KI4A 3VEVA 1HJPA 4O5CA 1DTTA 2HMPA 5HL7L 1FKOA 4YCXA 3NE6A 3VQ5A 4PL8A 3JAMO 1WBDA 2O8EA 1WCLA 3AVMA 4DQQA 2E2QA 2LHTA 3HILA 3OYBA 4CGIA 2ITMA 4DG1A 3CC7N 1BPBA 4QIWF 4DF4A 4DTUA 3V7JA 3OYNA 2WFBA 3BF3A 4PGXA 2W9CA 1NJZA 1TK0A 2AA4A 4FJXA 3TAGA 4DR6K 2O8CB 3S3NA 1C20A 2IOFA 3CFPA 4LFBK 4B9LA 3HJEA 1SKWA 4QZ9A 5M1PA 2HCFA 3KLFA 3DLKA 4AHSA 5DBBA 5B66U 3VQ7A 1Z3EB 4X62K 1BI4B 2JR5A 1NKEA 1QQ6A 5HP4A 3L2WA 2NO4A 1HNWK 4FWQA 4QIWC 4EHUA 5HRNA 2ASOA 2RDJA 3IFRA 5DDMA 1KFTA 3PW0A 2PZSA 2KSOA 2G09A 2MA1A 3KHRA 5J2NA 4DQRA 1QQOA 4FJJA 1VQ6N 2GWSA 1HNZK 3F2BA 4OO1J 2HHVA 5J2GA 5AI5A 2WC9A 3ISDA 4ED2A 4Y2PA 1UA1A 5H2FU 2W9AA 2I5JA 3K9JA 1U6ZA 4WYBA 4C8KA 1FFUA 3OBYA 5AM0A 5KFDA 4I2CA 2F9WA 1N2XA 3U6FA 4J2EA 2PFOA 4NLKA 3GOIA 4H4MA 1SV0A 2A1AA 1VQMN 3PLAA 1DGSA 1J97A 1ATSA 1GOCA 3THYB 3NTUA 2VCPA 1KQSM 5AKEA 9ICAA 5HRPA 4OPJA 4KX5A 1FXXA 5ALTA 4IFVA 3C1YA 5BREA 1UT8A 2YJFA 3UXOA 2E2PA 2EANA 4LJXA 1N34K 5E26A 4M2YA 5IIKA 4JWNA 1VSIA 5AQLA 4GY2B 3V9XA 4CZEA 5GAEP 2H3FA 1QQNA 3C2MA 3I0RA 2QKBA 3NAEA 1ZBHA 4YMMA 4BDPA 2KIWA 2IMWP 4O44A 4CZHA 4Q44A 3MGIA 4KKOA 3H3NO 4EYIB 4HTUA 3HKZC 1VQ5N 4GV3A 4ECSA 4FBUA 4CF5A 2WTUA 4Z6FA 1RTDA 3KZIU 1RDAA 4FW1A 1S1UA 3MN7A 1M6YA 4RPXA 2A5XA 1ZQPA 2BCSA 5AICA 1JL1A 1HQUA 4LH5A 4E3SA 1T6DA 1A5WA 2W7PA 1CRXA 4QZAA 8ICKA 5M1KA 1SL1A 3A2FA 1GO3F 3M1YA 4FK0A 3V7LA 1VDVA 5KG2A 3IP4B 1NOZA 4WQ4A 4NB4A 2XO7A 3CMEN 1COKA 3KJVA 3K4GA 4J2BA 4QNLA 1BA1A 3OTQA 1DOQA 3QINA 3VGLA 4ACOA 4FJMA 4FJHA 3SI6A 3N7SC 3SQ1A 1UHUA 1S9EA 4BWJA 2IAJA 2VYPA 8ICIA 4U67L 4CFDA 3K1RB 4RUAA 1RDWX 3ATUA 4CHNA 3JS6A 4J9LA 3ID8A 2E2NA 2B6GA 4I2PA 2RKIA 5KQDA 3M9OB 4QCLA 5ALZA 3OHBA 2OANA 8ICHA 3QLHA 3V9ZA 4AHTA 3EL2A 1CUKA 4ZH4A 4ELUA 3UXNA 2AGQA 2V4RA 4ILGB 3VQ9A 1ASVA 2VQFK 1IKXA 3FZKA 3WEEB 4CZIA 4FBTA 1HIWA 3EO3A 1T3QA 4QW9A 3I33A 2H3IA 3ZSQA 5LJVA 1BPXA 1T4GA 2Z1HA 1NK5A 2EZYA 2P9UB 3AO5A 5BRFA 5AQIA 1NNEA 8ICJA 5J2EA 5BN9A 3VN5A 3ZEUA 4O8KA 3HSCA 1RDUA 1FIQA 2HHXA 2X6SA 2RP5A 1IXRA 2LM1A 5KAIU 1U47A 3AY9A 4FPAA 3U4LA 1WWVA 3PNCA 3HM8A 2XCAA 1BNOA 2RRDA 4KMUA 3RB6A 3H4BA 2PKEA 3MX2A 1DTQA 2BQUA 4MFCA 1U2VA 3O4WA 3VQ4A 2O8BB 3OTOK 2WUSA 1KW4A 1RXVA 4JD2B 4F4WA 1EQYA 4CF9A 4I6MA 5FLXO 1VQ9N 4JUZA 1U48A 3AN1A 2XI9A 1JXBA 5IIJA 2KICA 2GWKA 3K5MA 5DB7A 3AU6A 4NM2A 3EW9A 2BQRA 4YOYA 5ALLA 1OUQA 2ZD1A 1S97A 2P66A 3V6DA 1YF5L 2J6UA 1DGJA 3H0RB 2FLLA 2X78A 4BRQA 2H3GX 5L1JA 4IRCA 4N5SA 4ISGA 3RH6A 3U9ZA 3RSEB 9ICIA 1ZD2P 2Y1IA 1BDGA 1J9AA 3RJEA 3AVIA 3RJFA 1BGXT 4QS9A 3CCLN 5JRTA 3BQ7A 4F5PA 2VWBA 3O4NA 4C7YA 1KVBA 4FVMA 3TWHA 4FZMA 2CH5A 4RQ3A 1YVNA 2ETJA 5DGBA 1KC8O 5DB6A 2KK0A 4KLJA 2KP7A 5DKWA 9ICOA 1XO1A 2GWJA 1SIJA 3OBWA 1TAQA 3ZT1A 1C0GA 2MU2A 3LAKA 5ALXA 3KVGA 2G08A 1GLDG 2UVVA 2JZBA 2YB4A 4DL4A 3ENBA 2XY6A 3K58A 2XCPA 2FSKA 4DWIA 1E4FT 4IR9A 3KLHA 1J5EK 1GLFO 3ZI4A 3WXKA 4ED1A 3SK3A 2QLTA 2NRTA 4J9RA 4YOUA 1Q7YO 1T8EA 2HHTA 4JI8K 4WJ3B 2R7YA 1QQ5A 2BDUA 5CWRA 5BRHA 5JLFA 4DOBA 3B0YA 4IR1A 4E1NA 3AVNA 3GL1A 1X1PA 1BISA 1Q18A 4FLXA 3IG5A 1P7DA 2QXLA 2FBXA 3NF6A 4EHTA 5HNKA 1V38A 1XC9A 3EKSA 3R9PA 2HW3A 4LF7K 1CXQA 3E9OA 1L7MA 4CJQA 4E7KA 1Q46A 3AVFA 4BR5A 2QEXN 3TACB 4LC9B 5J0TA 5DLGA 2F8TA 5E79U 2K89A 4YOWA 4Y2XA 1G99A 1PUZA 1JMSA 3UQ0A 1PK1A 4LF8K 4F5QA 4FWPA 4CF3A 1MDUB 4B1YB 9ICCA 1QQ7A 5DMRA 4K4IA 4M47A 3GIMA 5G5GA 3C5GA 2QWNA 4YD1A 1WG8A 4FWMA 3PUFA 3OPXA 3LPTA 4AHRA 3H0LB 3SR6A 4RG8A 1TUYA 5FRMA 2HNZA 1BUPA 2ZJ5A 3B9JA 5KFYA 4C4SA 2FF3B 3AUOA 1XMQK 4IOCL 3QEPA 3QNOA 1VRTA 5L9XA 4OPHA 1NLVA 4BE1A 4GVMA 4DFJA 2E8NA 1DK2A 1K1QA 3NVVA 4BDYA 2QWOA 4NY8A 4DL2A 9ICFA 4F4ZA 4P0PB 2FF6A 3NS1A 2ASDA 2P9LB 5ALFA 3FR0A 3K5NA 3RJGA 1Q9XA 1HYVA 4H0OA 1SV5A 5LJWA 5J0SA 3U3YA 1SKSA 4EX7A 1S1TA 5J0QA 4A59A 4Z6DA 3HM9A 2A1SA 2DPIA 2AGOA 3ZSZA 4Y0WA 2AQ4A 4CEDA 4K25A 8ICZA
chains in the Genus database with same CATH topology
2HVIA 3CM6A 2E1FA 2JLEA 3THVA 3AVBA 4FJ9A 4ID5A 1MA7A 2P5OA 2DQNB 4CJWA 3K57A 3OYGA 2VG5A 2YNFA 3AQFA 3KIOA 3OS2A 3MAQA 2OZMA 1J53A 3D45A 3QESA 4JS5A 1IKWA 4Z4GA 4B8AB 4DTJA 4PUOA 3AO1A 4JLHA 2CPRA 3RMCA 4PA1A 3RF9A 3TAFA 4DTSA 4OJ5A 1Z25A 4FZZA 1XWLA 1YT3A 4E7LA 3M8QA 3K2PA 3IG1A 4CDGA 2VWKA 2HBMA 1IH7A 4CEEA 4KHNA 1VSDA 2DFFA 4DQSA 4C0ZA 2D0AA 3D2NA 4FZNA 5E41A 1SUQA 3SUPA 4BE2A 3WNEA 3NHGA 2JGAA 1QSYA 1QHTA 4NLCA 4F4KA 3HSTB 4OVLA 3HYFA 4JMUA 1TGOA 3VQQA 4ZHRA 4BDZA 1L3VA 1D8YA 5KGXA 3NUQA 4OJRA 4OKEA 1TKTA 4B9TA 2KW4A 3F73A 3MEDA 4F3TA 1W9HA 2IS3A 5D3GA 3TANA 1KSPA 3OS0A 4ELTA 3HVRA 3PV8A 4IC9A 1RTJA 3DEEA 4E19A 3T79A 5HLFA 1LWCA 1CZ9A 2DFHA 4Z0UA 4KTZA 4CJLA 2OM6A 3ASMA 4N76A 4CRXA 2ITGA 3IRXA 3TABA 4L8RB 4NYFA 3L2VA 4E0DA 2K8BB 3RMDA 1IG9A 1NK7A 4FXDA 3F5AA 1PVRA 4DFMA 3V1RA 4IBNA 4BJQA 4DSKA 4DLEA 1RTHA 4C8NA 3LP1A 3V1QA 2KJ9A 4AYBC 2JHDA 1CXUA 2LKYA 3KKRA 4KHYA 5J1EA 2B5JA 4M3TA 4QJFB 2KNJA 3OYDA 3NF7A 4EZ6A 3QEXA 3NGYA 1ZBFA 4CIEA 2G0AA 3SAFA 1C1BA 1XO0A 3HJFA 2WONA 2ZIVA 1FKPA 1LAWA 2Y0SF 3AVCA 2RN2A 3ZCMA 1WSGA 1TL3A 3QETA 2GUIA 1HPZA 4O55A 3NRWA 2F76X 3PZPA 3F9KA 2F96A 2GV9A 2ZXHA 1PVPA 3AO4A 1S5JA 5DK5A 3L8BA 4OJOA 1VSKA 4CGJA 3C28A 3L3VA 1K6YA 4CJEA 2K4EA 1GOAA 4DU1A 4BE0A 3F53A 1S6PA 3SPYA 5CZ1A 4E89A 3SQ2A 3VC8A 2LYBA 4EP4A 3D2QA 4IG0A 4BACA 3TAPA 4W5QA 4FLZA 1S1XA 4O4GA 3LVWA 4FJ7A 3HXMA 3VA0A 4MQ3A 4FJ5A 2ZG6A 4OJPA 1IKVA 2AJQA 2F8LA 1SL2A 2XICA 4CGZA 1Z1BA 3SUNA 3EZ5A 1TKXA 2B6AA 2ZIWA 3L2QA 4F2RA 3SQ4A 3CYMA 4DQIA 4CJPA 4FJGA 4CFCA 4CJTA 2YNGA 1BQMA 4KHSA 1I3AA 4DSJA 1C1CA 3ULDA 1BHLA 4TSXA 1C0MA 3ZSYA 4KTQA 2VG7A 3SYZA 1HQEA 5CYQA 3OYFA 2FBYA 3MGVA 4PL2A 4JS4A 2D0BA 2E4LA 1NK9A 4CEBA 1JLAA 3OYAA 2KKVA 2K8CB 1B92A 2B4JA 3IN5A 2NV3A 1J5OA 4GMJB 1ZBUA 2EHGA 3AA3A 2YX8A 3SJJA 3S3MA 2WAQC 5C42A 4HVJA 3PO5A 4FLUA 1JLBA 3G10A 2KZMA 4FZXC 3AVKA 3LP0A 3VQPA 3WNFA 2E6MA 4FK2A 4PQUA 2JMGA 3LANA 3RFAA 3SCXA 3CG7A 3C29A 2M0NA 4YFUA 4DLGA 4IDKA 2KHQA 1JLEA 3DLBA 4AH9A 5CYMA 3ZSOA 2P51A 3PX4A 2D0CA 4F2SA 2YV0X 2DF4B 3QERA 4P0QA 2E1EA 3CM5A 3NGIA 4CF2A 4M3RA 3SUQA 5I3UA 2HVHA 5JS1A 3O3HA 5J2PA 1S6QA 3ONNA 4CE9A 2LBOA 1NKCA 3ALYA 1RBSA 1VK0A 4IKFA 1RBUA 3C95A 3ZT0A 1D9FA 2ZE2A 5HROA 1TK8A 4CHQA 1UPHA 1ED1A 3S9HA 3VCBA 4RW8A 3WNHA 2OPQA 4CJ4A 1Q9YA 3F5EA 3NGZA 2WB1F 2X74A 1L5UA 4CJVA 3OYKA 3AQEA 1QTMA 4O0IA 1ITGA 3DYAA 2G8WA 4BUGA 1XHXA 1YTAA 4OJLA 4CEAA 1S1WA 3VQDA 2VIXA 1EP4A 4M3WA 1NJYA 2WB1C 4MFBA 2K4HA 3CFOA 4FLYA 2DY4A 2IDOA 1JKHA 3JYTA 1KTQA 3MEEA 5FROA 1JLCA 2HOQA 5HRSA 1NJXA 3MXMA 1T03A 3DRPA 3KK2A 1BCMA 3GZFA 2ZXIA 3L2UA 1NJWA 5EU7A 3SV3A 3O3FA 1WSEA 3L2RA 1L3TA 3KK3A 1QE1A 1RNHA 3NFAA 1Q3VA 1RCHA 4U6PA 2MRLA 3N7PD 3OYCA 2E5SA 1VSLA 3TAQA 2CRXA 2FBVA 3LAMA 1T05A 4M3YA 1VSJA 2KJ8A 5FDLA 3AV9A 4FK4A 3ZSRA 1QQCA 3OYIA 3HPGA 1DRGA 2E6LA 2BANA 4E7JA 3V4IA 3LWLA 3RRGA 4KMOB 1XNSA 1L3SA 1URJA 3AVAA 4CJ3A 4OGEA 1BI4A 4KI6A 2Z1GA 2G8UA 1NK4A 2G5IB 1WSHA 2YNHA 3K59A 1O1WA 5J2QA 1Y97A 3LP2A 2Y1JA 1IIPA 1BIZA 3FFIA 3H0MB 3NH0A 4U7CA 1WN7A 3SAGA 4CERA 2H3QA 2YB1A 3QNNA 3HK2A 3CQ8A 2LSNA 4KO0A 3M8RA 5HR6A 1U49A 3ZT4A 2XIDA 1JXEA 3B6OA 3D2SA 1KCFA 1C0UA 1D5AA 3HPHA 4O3MA 3VQ6A 4NCBA 2VKQA 1G15A 3CFRA 2OPPA 1JLGA 3RR7A 3WNGA 1SL0A 4ID1A 2O4IA 4CEQA 1WUDA 4CECA 2Z1JA 3NCIA 5HR7A 3BGRA 4GFJA 4DU3A 1F44A 3AA2A 4P0PA 4EP5A 4FJNA 3PSIA 1RT3A 1HNVA 2OZSA 4CJKA 3O3GA 3CRXA 4CHZA 2H3ZA 3VQAA 4I9QA 2CN1A 3OYJA 1HYZA 4IFYA 3OJSA 4YNQA 4M41A 1ZBIA 2KJ5A 1ASUA 3TI0A 3ZT3A 3SMVA 2W42A 3NDKA 3O4QA 2KQ2A 4FJKA 3F2CA 4EZ9A 1RBTA 4GW6A 1TKZA 4FLVA 3VQ8A 2G8FA 4KHUA 4WE1A 2HBJA 3L3UA 1WAJA 2A1RA 3G0ZA 4XIUA 4CJFA 2ZIUA 2G8IA 1LW2A 1U4BA 1IO2A 4DMNA 2XVTA 2YKMA 2PMZF 3NH1A 2R18A 1CZBA 4FLTA 3SAHA 2HB5A 3SPZA 3NF9A 4DTOA 1XI1A 3LPUA 4DTXA 5HP1A 2JGUA 3QIPA 3SQIA 2KHVA 4M3UA 3KK1A 3EY1A 1HRHA 4W5TA 1UWBA 3VQBA 1BIUA 1T7PA 5T14A 3CP8A 4Z4HA 3TR8A 3P1GA 3DRSA 3OJUA 1X9MA 4KFBA 4CEZA 2GBZA 4B08A 1WSIA 4LSNA 2LYAA 4CESA 3V81A 1REVA 5K14A 2Z1IA 2GH1A 4ZTFA 4B9NA 4HCCA 3LP3A 1FK9A 3IS9A 1X9SA 1NOYA 2Q3SA 2KTQA 3MECA 3KD1E 4CEOA 5T7BA 2KD1A 4ICAA 2OPSA 4HUEA 4FE3A 1KFDA 1C0TA 1NKBA 3HT3A 4P0QB 4DSEA 4DSFA 2HBKA 4CGGA 4M45A 1JLFA 1WSFA 1KLMA 4ZTJA 1RBRA 3K5OA 3AL0B 2FBTA 4CJSA 1LV5A 3AVHA 4O0JA 1VSMA 1UA0A 4DS4A 1TK5A 1LWFA 3DLGA 1HEKA 3D0PA 3LVVA 4FJIA 3DMJA 3UIQA 1U04A 1RTIA 1RT2A 3OVNA 2Y0SC 2HHSA 3LYSA 4LSLA 2A3VA 4E1MA 1YVUA 1RILA 4Y1DA 2YNIA 3HL8A 1NK0A 2RHFA 1TL1A 1SZHA 4DTNA 2HNYA 4HUFA 2IC3A 1QS4A 3LZIA 3HKZF 1A5XA 2PY5A 4KREA 2KKPA 1D8BA 3T1AA 1Z19A 2YHBA 3KTQA 1Q8IA 3KD5E 3KFUF 2EX3A 2IOCA 4OJ6A 3VQEA 1N5YA 2FC0A 4OKKA 2XHBA 2HMIA 4JRQA 4F8RA 3KLIA 4H8KA 4NWIA 1I39A 4Z4EA 4OPKA 3C94A 4NCGA 4DS5A 1RT5A 3AO2A 3QIOA 3MXIA 4KPYA 2G8VA 4CHOA 1F21A 1KFSA 4ELVA 1CLQA 2ZIWB 4DF8A 3MXJA 2Q4TA 2JH1A 4KAZA 4N41A 4CIGA 3NBPA 1LAVA 5J2MA 4B3OA 1KVCA 2RPIA 2DGZA 4PY5A 1UOCA 4N47A 4CF1A 4KX3A 4DTMA 5FRNA 1EX4A 4W5RA 2D6FC 1RBVA 1LWEA 1KLNA 4CGHA 2HHQA 4I9LA 4N56A 4K8ZA 2F8SA 1NK6A 3OY9A 5CZ2A 2BDPA 4B9VA 1B9FA 3ITHA 2F2AB 1C1AA 5KRTA 2OYQA 2KFNA 1RDDA 3M8SA 4E7IA 3AO3A 1XHZA 2G5HB 2ATQA 3SZ2A 1TKDA 1BL3A 2VG6A 3RMBA 3V9UA 1NK8A 2QK9A 2OPRA 4AHCA 4A8EA 4OLAA 3EYZA 4DFKA 3AVGA 3DOLA 1EXQA 3AVLA 2VJ5A 3QO9A 1HJRA 3AA4A 3I0SA 3HP6A 3ZSWA 4G1QA 4Z4FA 2G06A 3KZXA 3ZT2A 5KGWA 3T3FA 3PY8A 4CF0A 1BCOA 3E0FA 3U3GA 4FCYA 3RMAA 1KVAA 4ICLA 4KHQA 1TVRA 5C24A 1WNSA 4FYDA 4OGCA 5KTQA 3I8DA 3BDPA 5I42A 2F77X 3LALA 2KZZA 3M6ZA 3TAEA 4PWDA 5A0LA 3E01A 4BX9C 2OH2A 1T94A 1VSHA 3B6PA 3C6TA 1VRUA 2HOFA 4FJ8A 1JL2A 4RW7A 4HHTA 4CHYA 3T19A 1EETA 4Z4CA 4HUGA 2ZIXA 3V9SA 2OYYA 1KRPA 1DLOA 1R0AA 1D9DA 4CF8A 4F3OA 1GOBA 1VSEA 2PYJA 5KL1B 4CCHA 2D5RA 1BQNA 2HOIA 2OXOA 4QOZB 1LW0A 2VWJA 3QEWA 1RT6A 3PX6A 1UAXA 2K8AA 4W5OA 4KB0A 1ZYQA 1JLQA 2X6NA 4LY7A 3AVJA 4CJRA 4AYBF 4DFPA 3TAMA 4KTWA 2HHWA 4CGDA 4PL1A 4Y1CA 3QEIA 4FZYA 1EKEA 4Q0BA 3DRRA 1B9DA 4DTRA 3M7DA 5C25A 1L3UA 3M6KA 3GU3A 3AA5X 3LWMA 2K4IA 3RWUA 3RR8A 1S1VA 4CIFA 1C6VA 3SV4A 1A5VA 4LH4A 3ALRA 2GOLA 4QAGA 2KV2A 2YHAA 5CY4A 1RT7A 3L3FX 4O5BA 1VSFA 2BE2A 2DTUA 2ZQBA 1S9GA 2OA8A 2G8HA 4DSLA 3N7RC 2XY7A 5KRSA 4CFAA 3PO4A 3PSPA 2VJ4A 4DQPA 3QEVA 4C8LA 2XY8A 3OYMA 3JSMA 3KLEA 4M3XA 2KOBA 2W04A 1L6NA 3NH2A 2RF2A 3NF8A 2HMXA 3OYEA 3S3OA 1RT4A 3SNNA 4NLBA 1QSLA 2QXFA 1SKRA 4Z4IA 4I7FA 4B9MA 1RDCA 2KFZA 4AILC 3PSFA 5C0YA 3VQCA 2W7OA 3RTVA 3F2DA 4CK1A 4J2DA 4FW2A 4R5PA 4KV8A 4JRPA 4CJ5A 5KL8B 4BWMA 3DLEA 2KVCA 3V1OA 3P5JA 4W5NA 5CRXA 1RT1A 2HHUA 1A0PA 1ZQ1C 2H3VA 4B8CA 1TAUA 4CFBA 4RW4A 2JH7A 1NZBA 4OLBA 3DOKA 3O0FA 4I2QA 3TARA 4B9SA 3KLGA 2BGGA 3DLHA 3HPOA 2G07A 2Z7JA 1W0HA 4C8MA 2XY5A 3PSTA 3LDSA 2ZIXB 2IGIA 3ISNC 5JS2A 2P5GA 5SZTA 3H08A 3QEPA 1ASWA 1TAMA 4NCAA 3ZSXA 4DSIA 1PVQA 4HCBA 4NV0A 3HO1A 4FJLA 2KEYA 1J54A 1YTUA 4J2AA 4RW9A 3VA3A 4KHWA 3ICXA 2NUBA 1Z26A 5HBMA 3K5LA 1QSSA 1TV6A 4Q5VA 2ZIVB 1X9WA 3DLRA 2YKNA 4FM0A 3IAYA 3SQ0A 4NYNA 1ECWA 2DFEA 4OKJA 3P83D 3IG8A 4DU4A 3SUOA 5HRRA 4E7HA 4M42A 4CK2A 1ZBLA 1U45A 4CJUA 3RRHA 3KKSA 1Q3UA 4FZLA 2P1JA 2ZIUB 4H4OA 3OYLA 1WAFA 1WSJA 4C8OA 4CGFA 2QKKA 2PMZC 3HVTA 2HNDA 1A6SA 4K8XA 3MEGA 4IG3A 3C6UA 2G8KA 4RW6A 4AHVA 4DTPA 1HMVA 4UQGA 5KI6A 1RDBA 2N1RA 2XRIA 4KB1A 1IKYA 3LZJA 1HYSA 4FM1A 4FLWA 3OYHA 4CHPA 3PX0A 4FM2A 1MU2A 3K1ZA 3V9WA 1HNIA 2O4GA 3OS1A 1N6QA 3M8PA 4CEFA 3DI6A 1WLJA 2WOMA 2W03A 4LD0A 2PYLA 5SWMA 4M3ZA 4AHUA 3ZSVA 4CK3A 3DM2A 2WAQF 4KRFA 1KBUA 3HP9A 4B9UA 2HBLA 4KI4A 1DTTA 1FKOA 3NE6A 3VQ5A 3AVMA 4DQQA 2LHTA 3OYBA 4CGIA 4DG1A 4DF4A 4QIWF 4DTUA 3OYNA 1NJZA 1TK0A 4FJXA 3TAGA 3S3NA 3CFPA 4B9LA 1SKWA 3KLFA 3DLKA 4AHSA 3VQ7A 1BI4B 3L2WA 1NKEA 4QIWC 5HRNA 2PZSA 2G09A 2MA1A 5J2NA 4DQRA 4FJJA 3F2BA 4OO1J 2HHVA 2I5JA 1UA1A 4C8KA 4J2EA 3U6FA 4H4MA 1GOCA 5HRPA 4OPJA 4KX5A 1FXXA 4IFVA 1VSIA 3V9XA 2H3FA 3I0RA 2QKBA 3NAEA 1ZBHA 4O44A 4BDPA 2KIWA 4KKOA 4HTUA 3HKZC 1RTDA 1RDAA 4FW1A 1S1UA 1HQUA 1JL1A 4LH5A 4E3SA 1A5WA 2W7PA 1CRXA 1SL1A 3A2FA 1GO3F 4FK0A 3IP4B 1NOZA 2XO7A 3KJVA 4J2BA 4QNLA 3QINA 4ACOA 4FJMA 4FJHA 3SI6A 3N7SC 3SQ1A 1S9EA 2IAJA 4BWJA 4CFDA 4CHNA 4I2PA 2RKIA 4QCLA 3QLHA 3V9ZA 4AHTA 4ELUA 3VQ9A 1ASVA 1IKXA 1HIWA 2H3IA 3ZSQA 2Z1HA 3AO5A 1NK5A 3VN5A 2X6SA 2HHXA 2RP5A 1U47A 2RRDA 1DTQA 3VQ4A 4CF9A 1U48A 2XI9A 1JXBA 2KICA 3K5MA 1OUQA 2ZD1A 3V6DA 3H0RB 2X78A 4N5SA 1J9AA 2Y1IA 3AVIA 1BGXT 3O4NA 1KVBA 3TWHA 4FZMA 2ETJA 1TAQA 3ZT1A 3LAKA 2G08A 2YB4A 2XY6A 3K58A 4DWIA 3KLHA 1T8EA 2HHTA 4WJ3B 2R7YA 2BDUA 4E1NA 3AVNA 1X1PA 1BISA 4FLXA 3IG5A 1P7DA 2FBXA 3NF6A 1XC9A 2HW3A 1CXQA 4CJQA 4E7KA 3AVFA 2F8TA 2K89A 5DMRA 3PUFA 3OPXA 3LPTA 4AHRA 3H0LB 4RG8A 5FRMA 2HNZA 3QNOA 1VRTA 4BE1A 4GVMA 4DFJA </