3CYMA

Crystal structure of protein bad_0989 from bifidobacterium adolescentis
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
415
Chain Sequence
b'EPKLLAEPREGVPNVIDTLPAFRDYCSELASSHGSLAADAERASGFRYGHEDWLVQFKRDGAGIGLLDPQALAAAGADWNDFNRAVGDAVWILHDSLQDLPGFDELGMEPQRLFDTEIAARLLGLKRFGLAAVTEHFLGLTLAKEHSAADWSYRPLPRDWRNYAALDVELLIELETKMRAELKRQGKMEWAQEEFDYALKEGLGPRKEHLIPWMHVSHITEVMRDRQALAIVRALWTRRDELAREYDIAPTLLLSDSSIIEVAKRKPHNAAQFRSIRSINERVRIHTDSEQDKMFERYAPIQRKIKPSMWKNIIQDALALPPSEWPDSAPKSIRVWKERYPERLQVLNRVRKAVSQIAEDTRTPVEIVIKPQYLRNLCWTDEPRKRDVARFLSEQGARDWQVSLVAESVSRAIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein BAD_0989
publication title Crystal structure of protein BAD_0989 from Bifidobacterium adolescentis.
rcsb
source organism Bifidobacterium adolescentis atcc 15703
molecule tags Structural genomics, unknown function
total genus 150
structure length 415
sequence length 429
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
A PF18305 DNA_pol_A_exoN 3' to 5' exonuclease C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3cymA03
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3cymA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cymA01
1C0MA 4ICLA 1EETA 1C6VA 2X78A 1TKDA 1SKRA 3K5MA 4LSNA 2EX3A 4DTNA 3ZSZA 3OYEA 4DSFA 5FROA 4DQQA 4LSLA 3SUOA 3TR8A 4KHQA 5KRSA 3TAFA 3DLEA 2BANA 4CGFA 3VQBA 3OS0A 4AH9A 4FLXA 4CFDA 3AVKA 4CGIA 1GOBA 4W5TA 2JGUA 3OJSA 1GOCA 3C95A 3NF8A 4DSKA 4BE0A 4HCCA 1FXXA 3DM2A 4M42A 2G8IA 3HPGA 3V9SA 2OPPA 1BL3A 3CYMA 4CDGA 4Q5VA 1GO3F 1KTQA 3QINA 2RKIA 3DOLA 3OYJA 4DS5A 2KW4A 1RNHA 1RT3A 1TKTA 4CFAA 5C42A 4DTRA 4B9SA 4FZZA 3QO9A 4N5SA 2RF2A 4HHTA 1C1AA 3DMJA 4DU4A 2DFHA 3WNGA 3RRHA 3S9HA 1QSSA 3OYGA 4DFPA 3IAYA 1LW2A 3VA3A 4DU1A 4DQRA 5JS1A 1TK0A 4AHTA 4Z4HA 4CIFA 4CECA 1HQEA 1EX4A 4CHQA 1T03A 4PY5A 1GOAA 4FJ5A 1BCMA 3HPHA 2XO7A 3O3HA 4DTSA 1XHXA 1UOCA 4OVLA 4K8ZA 3AO3A 3C6UA 1XC9A 1Y97A 2IC3A 3JSMA 2PY5A 3PO5A 1B9FA 3G10A 4CJUA 4FJXA 3OJUA 1D8BA 3DRRA 4I9LA 4CJQA 3QNOA 3V9XA 3NAEA 1TVRA 2RRDA 3LP2A 3S3OA 3SAHA 1A5XA 4RW4A 1LWFA 3V1OA 2I5JA 3SI6A 1RBUA 3DLBA 4KV8A 4RW6A 4O5BA 1BISA 4IDKA 4CGJA 4I7FA 3KLGA 1TKXA 4BACA 3HYFA 4FCYA 2DTUA 1U4BA 1IH7A 3NHGA 4CCHA 2VG7A 1KVCA 3LP1A 1FK9A 4FW2A 4IG3A 1QTMA 4NCAA 2HNYA 4FK2A 2XY7A 4E19A 3OS2A 1F21A 1REVA 3B6PA 3ISNC 4W5OA 1J54A 2HHXA 1ASWA 4CGHA 1VRUA 2RHFA 3K5LA 3KKSA 4DS4A 3U3GA 1IKXA 1LW0A 3KK3A 4BDZA 3QEWA 3FFIA 3LPTA 3TAPA 5CYQA 3MXIA 4M3YA 1JXEA 1WSHA 4JS5A 4CEQA 1RDAA 2G8VA 1D5AA 3B6OA 3TANA 1HMVA 1UAXA 3C94A 1IO2A 5KRTA 3ZSRA 5EU7A 3AVFA 1QSYA 1RT4A 3U6FA 1S6QA 4PUOA 2E1FA 3LP3A 4QAGA 3WNFA 3L2VA 1EXQA 3LAKA 3CG7A 4CJVA 3AVCA 1HYZA 4H8KA 4CJ4A 1DTQA 3QETA 4ID5A 4AILC 3QNNA 4NYNA 3RTVA 5KTQA 1Z25A 4J2EA 1RT7A 4FJMA 5I42A 4FM0A 3U3YA 4ID1A 1N6QA 2RN2A 1NOYA 3AA3A 3RR8A 2QKKA 4C8KA 2YNFA 3NDKA 2WOMA 4FK4A 3LAMA 3SQ1A 2OPRA 3NFAA 3K5NA 3PX4A 2XY8A 3V4IA 1RILA 4UQGA 3SZ2A 3L2QA 1BI4B 2D0AA 3LPUA 3SNNA 1RT2A 2A1SA 2XY5A 3RMDA 4M41A 1RDBA 4FZXC 1KSPA 4CIEA 1TK8A 4OO1J 2LSNA 1LV5A 3VQQA 2GV9A 4QCLA 1VSEA 4M45A 3PV8A 4MFBA 5K14A 3QEXA 2IDOA 4M3UA 4LH4A 1W0HA 3NE6A 1L5UA 4DFMA 4Z4IA 4M3TA 4PWDA 2ZE2A 4CEEA 4F2SA 4W5RA 4QJFB 2IAJA 4EP4A 5J2MA 4Z4FA 3VQ6A 3CM5A 2QKBA 3AA2A 3ALYA 1KCFA 2WONA 4AHUA 4AHRA 1TGOA 3UIQA 4RW9A 1ZBHA 4CGDA 1ZBUA 1T05A 2KZMA 1U47A 3SUPA 2IOCA 2B4JA 5C25A 3TI0A 3RWUA 3P83D 4IFVA 1ASVA 5HLFA 4W5NA 1RBVA 4Y1CA 3KJVA 3KLEA 2Y1JA 5HP1A 1NK8A 3V9ZA 1SL0A 4KHYA 2G8HA 2DY4A 1VRTA 3O4QA 2X6SA 3VQEA 5D3GA 1DLOA 1WSGA 1L3UA 2QXFA 1YTAA 2HVHA 4FVMA 3SJJA 3O4NA 1KLNA 4KHSA 1RT1A 1W9HA 4JRPA 3KLFA 1NK5A 3F73A 1IKWA 1U45A 4IKFA 1YT3A 1WUDA 4DWIA 3L3UA 2HW3A 2D0CA 3OYLA 4OGEA 1SL1A 4CJLA 4K8XA 4Q0BA 1NJZA 3S3NA 1QHTA 5KGWA 2YHBA 2E1EA 1Q9YA 1S6PA 3HP9A 4KREA 4B9LA 4I2PA 3M8SA 3HJFA 4OKKA 1X9WA 4CGGA 1DTTA 2DGZA 3KLHA 1B9DA 1S1UA 3NGYA 1U49A 3G0ZA 4FLUA 3PX0A 5HRPA 3MXMA 1I39A 1D9FA 1QSLA 2HHQA 4QOZB 4CFCA 4E7IA 4B9MA 1JLGA 3AO2A 2NUBA 4CF2A 3L8BA 3CFRA 1I3AA 5HROA 5FRMA 1S1TA 4KKOA 4CE9A 4ZTFA 1TAQA 1NKBA 1L3VA 4J2AA 4KI6A 1RDCA 2CPRA 5SZTA 2HB5A 1KFSA 4E1NA 4QIWF 3NBPA 1YVUA 4FJ8A 2KV2A 4FLZA 1ZBFA 3OYBA 1SV5A 3TAQA 4I9QA 2W42A 5E41A 3AVBA 4CJFA 3SUQA 4M3XA 2HBMA 1HQUA 1QE1A 4LH5A 1BIUA 4DTXA 2F8SA 4CF1A 2QK9A 4B3OA 1MU2A 3NF7A 3HVRA 4F8RA 3RMCA 4CF0A 2HHTA 3E01A 3ZSOA 2Y1IA 1U04A 3DLRA 2Z1HA 3I0SA 1HRHA 4O4GA 4AHCA 4F4KA 4Z4EA 1ASUA 4CEZA 3QERA 1CZ9A 3MEGA 4FZYA 3OYKA 1KLMA 4KB0A 4NLBA 4GW6A 4E1MA 1KVBA 3OS1A 4DU3A 3ZSQA 1X9SA 4Z4CA 2G8UA 2HBKA 1BQNA 1CZBA 1J5OA 1VK0A 2G8WA 1RTDA 2FBXA 2Z1JA 3HT3A 5FDLA 4DFJA 4O0JA 1WNSA 3T19A 3O3GA 4CK1A 4C8MA 3ITHA 4CJWA 1S9EA 3IG1A 4ZHRA 3TABA 2FBTA 4MQ3A 3HO1A 3HXMA 2O4GA 3KD1E 3HSTB 3I0RA 3A2FA 3QEIA 3DRPA 5HBMA 3VQCA 4ELTA 5DMRA 3MXJA 3TARA 4DG1A 4FJGA 3D45A 4W5QA 2O4IA 1T7PA 4CFBA 1WAFA 2HBLA 4OGCA 3TAGA 1VSJA 1IKVA 1S5JA 3DI6A 3VQPA 3QESA 3S3MA 4FK0A 1CXQA 1TKZA 3M8RA 3QEPA 3AV9A 4CJRA 3HP6A 3AVLA 2HVIA 4DSIA 1A5WA 4DFKA 3PX6A 2KFZA 3VQ9A 4DTPA 1NKCA 2YV0X 4B9TA 1NK9A 1S1WA 4CERA 3K2PA 4DSEA 2D0BA 4FM2A 1NOZA 4F3OA 1XWLA 1KRPA 3RMAA 3QIOA 1RCHA 2YNHA 3OYCA 3SV3A 4R5PA 4CJKA 2PYJA 4DSJA 2RPIA 3OYIA 3SAGA 1RT6A 3IS9A 2KTQA 1FKPA 4DTMA 3SQ0A 2P5OA 4FJ9A 3THVA 3ZCMA 4HUGA 2F8TA 1RTJA 2ZQBA 3M8QA 1FKOA 1XHZA 1K6YA 4WE1A 1C1BA 3DLGA 3DLHA 3L2WA 2OA8A 4C8NA 5J2PA 1RBTA 3PUFA 3SPZA 3SUNA 4DQPA 4KTQA 3CQ8A 3SCXA 1EP4A 4FJKA 3V9WA 3MEDA 2HHWA 1WSEA 1BGXT 4EZ6A 4B9NA 2IS3A 3TWHA 4IBNA 4G1QA 2XRIA 3ZT4A 2AJQA 3DLKA 2BE2A 1X1PA 4EP5A 1IKYA 4DF8A 1HPZA 4N56A 4CJPA 5HRSA 2YNGA 4YNQA 4OPKA 2OPQA 4CJEA 3LALA 1Q9XA 1C1CA 4DSLA 1SKSA 4DMNA 4Z4GA 1ITGA 4N41A 4FW1A 4FLVA 1ZYQA 3VQ8A 3CFOA 4DF4A 3KLIA 3NH0A 4CESA 3HM9A 1NK6A 3WNHA 1T8EA 1S1VA 3BDPA 4GMJB 1LWCA 1S9GA 4OKJA 3V1RA 5KGXA 3OYNA 4DTOA 3VQ4A 1NK0A 5CZ2A 3K5OA 3SAFA 4CEDA 3CM6A 3L2UA 1D9DA 3WNEA 2F96A 2ITGA 3L3VA 1BCOA 2PZSA 1JL2A 3ASMA 1VSMA 3C6TA 3H08A 3D0PA 4CJSA 4F2RA 4DLGA 4M3ZA 2FC0A 5DK5A 3V81A 2Z1GA 3MECA 2VG6A 4KB1A 5FRNA 2YNIA 3NGIA 3OYFA 2MA1A 1KFDA 4JRQA 1L3TA 2JLEA 1CLQA 3OYHA 4OKEA 4BWMA 1UA1A 1ZBLA 1JL1A 4CHPA 1WLJA 3AVMA 1S1XA 4BE2A 3K59A 2A1RA 3LANA 3AO5A 2HHSA 4LY7A 3BGRA 1NK4A 5CY4A 4CHNA 3AVAA 4KHNA 1VSFA 2HHUA 1JLEA 3ZT3A 3MEEA 1HNIA 1SKWA 3T1AA 1QQCA 1EKEA 3M8PA 4DTJA 1J53A 1LAWA 2OZSA 3F9KA 4FYDA 2KZZA 4BDYA 3SQ4A 4FJIA 1WSIA 2GUIA 3AO1A 1LAVA 1C0UA 2YHAA 3VA0A 4KFBA 4M3RA 3V9UA 1RDDA 4CF9A 2XY6A 3AVNA 3OYMA 2DFEA 4PA1A 3TAMA 4CK2A 4E7KA 1X9MA 4OJRA 4YFUA 1JLCA 4E7LA 1TAUA 3DRSA 5CZ1A 4HUFA 4I2QA 3V6DA 1J9AA 3ZSWA 4CEBA 1JKHA 3LZIA 2OZMA 2OPSA 5T7BA 1IG9A 2VWKA 3VQ5A 2OYQA 3ZSVA 4ELUA 1RBSA 1Q8IA 3KKRA 2E4LA 4B08A 2YKNA 3L2RA 4DQSA 4O3MA 1R0AA 1VSDA 3LP0A 1A5VA 1NK7A 3ZT1A 1TV6A 1RTHA 4CJ3A 2VG5A 4N47A 4Z0UA 2ATQA 3VQDA 2XHBA 3NF6A 4ZTJA 1CXUA 2B5JA 1HNVA 5I3UA 4C8OA 4JLHA 4CGZA 1O1WA 4BWJA 2BDPA 1RBRA 3CFPA 3LDSA 4IG0A 2ZD1A 4RG8A 4RW7A 4NLCA 3V1QA 4DLEA 1D8YA 2G8FA 4FJLA 4FXDA 1VSIA 3P1GA 3ZT0A 1QS4A 1TL1A 1SUQA 1JLQA 1WN7A 5J1EA 2Z1IA 4CJTA 3EY1A 3SYZA 3OYAA 2BGGA 4FJ7A 1XI1A 4CHYA 3RMBA 1VSKA 4FLWA 4O44A 3K57A 1BHLA 1L3SA 2GBZA 5J2NA 3HVTA 3DOKA 5C24A 4CIGA 4B8AB 2YKMA 3HPOA 2P51A 4OLBA 4FJJA 4KTZA 4HCBA 4KI4A 4EZ9A 2FBVA 5C0YA 2X6NA 4O55A 1N5YA 3QIPA 4KTWA 4E7HA 2D5RA 4J2BA 1HYSA 1LWEA 1YTUA 4DTUA 2X74A 4CJ5A 3NGZA 3NH1A 3KK1A 4BE1A 4BDPA 4NYFA 3KD5E 4HUEA 3PY8A 3O3FA 4L8RB 4E7JA 1NJWA 1VSLA 1U48A 3NH2A 2FBYA 3K58A 1B92A 3QLHA 5SWMA 3AVHA 4B8CA 4FM1A 1WSFA 4HTUA 2ETJA 4H4MA 4Y1DA 4CEAA 4CHOA 4CHZA 3DYAA 4E89A 5HRNA 3OY9A 4FLTA 1NJXA 4KHWA 4F3TA 1UA0A 2P5GA 3AVIA 2DFFA 1BI4A 1RTIA 1ZBIA 2E6LA 1JLFA 3HL8A 4XIUA 3T3FA 4KRFA 2Q3SA 4RW8A 3OYDA 3IRXA 4ELVA 2P1JA 5J2QA 1C0TA 1JLAA 4LD0A 4KO0A 3JYTA 1WAJA 4FJHA 3LWLA 3QEVA 4B9VA 3LZJA 3SPYA 4OPJA 1UWBA 4AHSA 5KI6A 4CK3A 4E3SA 4KPYA 1BQMA 1JLBA 2HBJA 3AA4A 3I8DA 4B9UA 3AA5X 4TSXA 2HNDA 3SQ2A 4KAZA 2PYLA 3LWMA 3KK2A 3AVGA 1BIZA 4PQUA 3EYZA 3NCIA 2KFNA 3HK2A 3EZ5A 1SL2A 1Z26A 3MAQA 2HHVA 2B6AA 1NJYA 4CEFA 1TL3A 3ZSYA 4GVMA 4E0DA 4AHVA 2IGIA 3AVJA 4FJNA 3KIOA 2KQ2A 3VN5A 5HRRA 4O0IA 4FLYA 3RR7A 3AO4A 4OLAA 1NKEA 4CEOA 1JXBA 4NCBA 2R7YA 3PO4A 1KVAA 5JS2A 1TK5A 4IFYA 3TAEA 1RT5A 3OVNA 3ULDA 2HMIA 1HYVA 3P5JA 4JS4A 3RRGA 2EHGA 1WSJA 2G8KA 3KTQA 4J2DA 5CYMA 4HVJA 2VWJA 3ZT2A 4M3WA 1VSHA 4H4OA 4NCGA 2HNZA 3NF9A 1HJRA 3VQAA 3SV4A 4N76A 4CF8A 4KHUA 3ZSXA 4C8LA 4DQIA 1G15A 2E6MA 3VQ7A
chains in the Genus database with same CATH superfamily
1K1SA 3AN1A 4CI6A 1IBLK 4BY9C 4EBCA 5DDYA 1TKDA 1SKRA 1SZHA 4C0ZA 4GKKK 1BWFO 2O8CA 4LSLA 3TR8A 3OHRA 3PIPL 3TAFA 3OS0A 3VQBA 1QTMA 4AH9A 4FLXA 1S22A 4CFDA 4W5TA 3C5FA 1WB9A 1YF5L 1FXXA 3HPGA 4DOCA 3PW2A 2OPPA 3U26A 3LDLA 1Q82O 4CDGA 4CJ7A 3WEEB 4DR7K 3ID6A 3QINA 3H0MB 2RKIA 2EQYA 3WKEA 3FZLA 1RNHA 4P0QB 1DKGD 5C42A 3CPWM 4B9SA 4FZZA 3O9TA 3QO9A 4H5TA 4N5SA 2ZJQL 4HHTA 4ACOA 2A40A 4EHTA 1V4SA 1QSSA 2F76X 3S9HA 5JU5A 5ALFA 3VA3A 4UASA 5ALJA 5J2BA 4AHTA 3CJAA 4K4IA 4Z4HA 8ICNA 2FSNA 1X40A 1VQNN 3K1ZA 4B1WB 3H8WA 5A2QO 3AMZA 3GFKB 4KLMA 7ICRA 3AO3A 3C6UA 5AQYA 1VAZA 4J8FA 3G10A 3OJUA 4ILGB 3F53A 4DL3A 1JMSA 2KG5A 2VJ4A 2AGPA 2FLNA 3LP2A 2EDUA 4RW4A 4UBBA 1LWFA 3SI6A 4M3XA 4KAZA 4KV8A 3D7EO 4FCYA 2LM4A 3ISDA 3HZ6A 2DTUA 1Y88A 4CCHA 4BRGA 5KFFA 4FW2A 4NCAA 4BRPA 1F21A 4F93B 5KG2A 2HHXA 4AQYK 4C80A 4KX5A 9ICHA 4BQLA 4CGHA 1VRUA 9ICCA 3V6JA 1U2VA 2RDIA 3KKSA 3GIIA 9ICAA 1KFTA 3C6AA 3KBBA 1TUUA 4BDZA 3FFIA 1KXPA 2YJEA 5J0YA 1WSHA 4CE6A 5AFUH 3ULEB 4BREA 2W3SA 2H3IA 3QUQA 4QZIA 2XCPA 1HMVA 2G8VA 5ALPA 4YG2A 1IO2A 3FFKB 4JN4A 5KRTA 3MCPA 3CHWA 1S6QA 4B1VA 3KD3A 3ZDDA 3OHAA 3OA9A 3L2VA 3CG7A 4CJVA 5FPEA 1HYZA 5HHIA 5AM0A 2QW9A 4RQ0A 4H8KA 4LF7K 3RAQA 3QETA 3BUZB 1JN3A 3RTVA 4KLOA 5KTQA 1HKCA 3EWAA 1Z25A 5J0OA 1VQON 4FJMA 2PFOA 2NV3A 4FM0A 5IIKA 4ID1A 3RR8A 3CJCA 2QB0B 4C8KA 3OBYA 4FK4A 1MN8A 8ICUA 2LKYA 3Q8RB 2OPRA 3MR3A 2P9LB 2XY8A 4UQGA 3RB6A 3ENBA 4BC2A 1BI4B 5J2HA 2CXYA 3UMCA 4WJ3B 4CF5A 2XY5A 2A1SA 3CCEN 1IV0A 2F1HA 4DV1K 2F8LA 1KSPA 3B0XA 1TK8A 1ZQMA 4A62A 3VF2A 2ATLA 1LV5A 4UAUA 1ZJNA 3P31A 3PV8A 4IR9A 1H1VA 2H3ZA 5BOMA 1J5EK 1RDWX 7ICGA 1L5UA 3TKAA 2JWLA 4YMNA 3JXUA 5F9LA 5KFMA 5J2JA 4UB3A 3R3LA 4DV4K 5EWGA 2YJFA 3BS5B 3HX0A 1ZQJA 3C7NB 4EP4A 5H2FU 5J2MA 2JEFA 2Q36A 3VQ6A 2YMMA 2YX8A 3UMBA 2WONA 3QBWA 4AHRA 4G9BA 1X6IA 4CGDA 4IR1A 2ZWHA 1T05A 2O8EB 5IILA 2W6LA 3MBYA 4I2CA 5C25A 3M7DA 3SUPA 3VEVA 3GZFA 4J9LA 3RJIA 4Y0WA 3RB4A 2Y1JA 3KLEA 1LKYB 1NK8A 2FMQA 2UXBK 2HI0A 1T3NA 2ASPA 2P9SA 3RSEA 1VRTA 2P9UA 3VQEA 5KPTA 4HAIA 3F2CA 8ICMA 2ZJAA 3O4NA 1KLNA 3GIJA 1RT1A 4KHSA 3EO3A 1Q86O 1Z1BA 2K4EA 1YT3A 1WUDA 3VEWA 4CBWA 1SL1A 1C7YA 4CJLA 3C1ZA 4FS2A 3NVYA 4KLEA 3VTHA 4BGBA 1N36K 3NASA 3M5RA 4QZDA 4CBUA 1S72N 1N34K 2IA6A 1QHTA 2YHBA 5DBBA 1Q9YA 4PKIA 4IC9A 1NGAA 3M8SA 4OKKA 4QZEA 3TTDA 2DGZA 4NL9A 2R8GA 3KLHA 1S1UA 1QSLA 3G0ZA 2E8PA 3PX0A 5HRPA 3MXMA 1IM4A 4QOZB 4QW8A 3KKAA 2OM6A 1OH8A 3AO2A 5FRMA 3CFRA 1S1TA 4ZTFA 1TAQA 1ZQNA 1SIJA 1RDCA 3KZIU 1BO5O 3I56N 4E1NA 3QNMA 8ICIA 3ZYYX 5ALWA 2UUCK 1XO1A 4FJ8A 5KFSA 1PK3A 1S0MA 4ED0A 1SV5A 1ZBFA 3CIPA 4AF1A 5LJWA 2W42A 3MN7A 3AVBA 2KVSA 9ICPA 4PKGA 2HBMA 4JKGA 4JK1A 4DTXA 1SWWA 2QK9A 2CN1A 4X65K 4CF0A 3ZSOA 4F4YA 1U04A 5EWFA 3I0SA 1HRHA 5KFHA 2D8CA 2VQFK 1Q7YO 4CEZA 1CZ9A 8ICYA 1BA0A 2KP7A 5DG9A 1KLMA 4I6MA 4NLBA 3WK9A 4GW6A 4H5VA 4E1MA 1BG3A 4US9A 1ZQDA 3RJFA 4BR4A 4A5BA 1CZBA 5AQVA 5CB1A 4MEXA 1VK0A 2PFNA 2W11A 2I1QA 3UXNA 3HT3A 2I9GA 2FBXA 1RTDA 4GKJK 4DFJA 3J7YP 3PSPA 1WNSA 4C8MA 5KG4A 8ICSA 4FSVA 4IDHA 3GV8B 1JUDA 1JI7A 1S9EA 3AY9A 3HO1A 5KFGA 2YI1A 1ZC6A 3HXMA 2Y0SC 3HSTB 3KD1E 3I0RA 5AQIA 1SB3C 5AKYA 1YI2N 4ELTA 4YD1A 1RFQA 1OVQA 4BVOA 2ASDA 4Y2SA 2AQ4A 5J8YC 5DM7L 2V4RA 2O4IA 1WAFA 3O80A 4OGCA 3BZKA 2YX6A 2OH2A 5HR6A 1VSJA 2FI1A 3DI6A 3QESA 1WBBA 3AU6A 5GTIU 3HP6A 2C28A 4CJRA 3NVZA 2HVIA 2P9IA 4DSIA 2VGNA 2MSNA 1N48A 3PX6A 4PHDA 3HW8A 1NKCA 3ALRA 3VQ9A 4Z6EA 4DTPA 3NVWA 3RFAA 1WOQA 3CQXA 3ONNA 4CERA 3K2PA 1ZQVA 5KFRA 1JRPA 4OJ5A 4CF4A 4DSEA 1IBKK 4P4PA 1NOZA 5ADXH 1AQ6A 3LK9A 4AYBF 4RQ6A 3QIOA 2XGPA 1RCHA 4IOAL 5AI4A 3E0FA 2FLOA 3KHYA 5FLXO 4UAVA 2PYJA 2LBOA 1DK3A 5IIMA 2JXJA 3IS9A 4YVZA 5E26A 4TUPA 3C23A 2KN7A 3SQ0A 4YMOA 1ZD3A 4I27A 1R59O 3ZCMA 2F8TA 2AGOA 4FZMA 4DR6K 4H0XB 1K6YA 4RQMA 5AI0A 4DCHA 2GUPA 1QQ6A 1C1BA 3DLGA 5AQXA 3OTOK 3O4WA 3QICA 5CE3A 1RBTA 3PUFA 3LDOA 4CZKA 5M1NA 4JKCA 3THXA 5DB7A 4GLXA 1A6SA 3CQ8A 1EP4A 4EYHB 3A5LC 4MF2A 1WSEA 4C7YA 2IS3A 5ALRA 1IV8A 4M9HA 3DLKA 3V72A 2BE2A 3UXPA 4EP5A 2G0AA 4IEEA 4EELA 4QZGA 4CJPA 4RQ3A 2GTDA 2YNGA 1S97A 4CJEA 4OPKA 1Q9XA 4XEIA 1YUWA 3UM9A 1SKSA 2E5SA 3I28A 5IIJA 4DMNA 4Z4GA 4B1XB 1X9XA 4G9ZA 2QWQA 3EL2A 3CFOA 1FFUA 5ALUA 4UAWA 3KLIA 4IJNA 3QBXA 3HM9A 1IBMK 5F9NA 2WTFA 1NGBA 3AUOA 1IG8A 3BDPA 3E58A 3WNHA 1OH6A 5DLGA 3V1RA 4OKJA 1V85A 3GU3A 5CP2A 5BRHA 1FEZA 4RU9A 1KEJA 3N97B 1ZQOA 5AZIA 3L3VA 2K4PA 1QQNA 4F92B 1JL2A 5KFCA 1VSMA 2CH6A 3D0PA 3SBTA 4DLGA 1BNPA 2FC0A 2UXDK 5AQZA 1VQKN 4KB1A 4R8UB 2YNIA 3H8MA 2QM1A 1UA1A 4BWMA 4M0AA 4BC4A 1VQ7N 5F1XA 4PGXA 1A0PA 2HF3A 1XNSA 2NRHA 2PFQA 1DK2A 1ZRMA 1SAZA 3AO5A 3D2EB 3ZLJA 4F4WA 3C5GA 2O6KA 1S76D 4DR3K 1VSFA 4KHNA 2I6XA 1S8OA 4QZ9A 2HHUA 2F9TA 3MEEA 4BGAA 3MGHA 2W04A 3IM1A 4RNMA 3F9KA 4BG8A 2ISOA 4FYDA 3IDWA 4FJIA 4IS7A 1OKJA 3W3DA 4DV5K 2YHAA 7ICEA 5CWRA 5HOOA 4DV2K 1Z05A 3L4PA 2W9BB 8ICXA 5DBCA 1MQ3A 2O8BB 1XNQK 1ZQBA 1SS6A 4KHPK 3SMVA 4I2QA 4DV7K 3V6DA 3QXGA 1JKHA 5AICA 5ALXA 2VWKA 2OYQA 3WK8A 3D2FB 3SK3A 3VEZA 5M1FA 4YOYA 3PMNA 4YP3A 2E4LA 4BR0A 4DV0K 3UXOA 4DQSA 2C2DA 4B3TK 5IIIA 1NK7A 3NTUA 3DLLL 3ZT1A 3KHRA 4RWTA 5MLCQ 4N47A 1WYGA 2WAQF 4Z0UA 3VQDA 5KQ8A 4IRCA 4ZTJA 4C23A 2EH9A 5L1IA 2A1JA 1RBRA 3LDSA 2G8FA 3PSIA 3V1QA 5J2DA 1D8YA 4MLEA 4RQ2A 5JMVA 1KBUA 8ICCA 5KFUA 1QS4A 3SJHA 1JLQA 1WN7A 3EY1A 2BGGA 5FPDA 3SYZA 1BPEA 3OGUA 4PHTX 2DFLA 1Z00B 3C29A 3PW0A 2QI2A 4IWVA 3OYAA 4CHYA 1HJPA 5J0WA 4EX6A 3AAPA 4FLWA 3CETA 8ICGA 3FLCO 4PHEA 3GV7B 9ICRA 5EE3A 1N5XA 5JLHA 3HVTA 4CIGA 1Y64A 4IRKA 3HPOA 4Q44A 5DDMA 4YMMA 2YKMA 3AARA 3L4QA 4KI4A 2NO5A 4JHDA 4FPAA 4BXOB 3VERA 1N63A 1YJNN 1N5YA 1V38A 3VGKA 5J29A 3TFSA 4NB4A 4J2BA 5AK4A 3NH1A 4ECYA 3KZBA 5AQOA 2W7PA 3CERA 4J9SA 5ALQA 4O5KA 1KD1O 5ALZA 1C0GA 3BF1A 4LFCK 3MN6A 1LVHA 3NUQA 4BC3A 4FM1A 5HRNA 3OY9A 2ZJRL 2GWKA 5J0PA 3T5HA 1F44A 2P66A 1NJXA 1SXDA 1QLNA 3DYAA 3N4PA 1HR0K 4KHWA 2Q0UA 1N60A 1RTIA 3HL8A 4XIUA 5KFNA 7ICSA 3FDSA 2W55A 3RAXA 1ZQZA 4ELVA 1T44A 4QNLA 1JLAA 3AEVA 1WAJA 1NBWA 4B9VA 4KLFA 8ICQA 3T1HK 2R8IA 2QLTA 1C0FA 4KMUA 5KI6A 3A5OC 2LYAA 3G71N 2HNDA 2QARB 4JD2B 4NM1A 3KK2A 1QVFM 3PW5A 2P9PA 1ZQHA 3JAMO 3EZ5A 3GIMA 1VDVA 2ASLA 2HHVA 1ZD2P 4O8KA 4E0DA 4K25A 4YOXA 4XRHA 1Z4OA 4P4OA 2KQ2A 4O0IA 3KIOA 1HIWA 5HHHA 4O8UA 4FJNA 4MDAA 3N7SC 4HTLA 9ICXA 7ICPA 1QCKA 1KVAA 4GV9A 4C4TA 1RT5A 3OVNA 2HMIA 1ZRNA 3C2MA 1QQMA 4J2DA 4HVJA 4M3WA 2XGQA 2V7YA 3M6KA 1VSHA 3PR4A 1HUOA 2HNZA 4Y2YA 4JKDA 2EAMA 3ZSXA 1KDHA 3AGKA 2EAPA 4WF9L 1XUPO 2E6MA 4JI0K 2V51B 1VQ5N 3H0LB 4RTFD 2EX3A 3FYHA 2ZUBA 3CC4N 4NJ8A 4KHQA 2ZJPL 3Q8PB 3TAQA 1RXWA 3I8BA 3F2KA 3UKRA 3K0SA 4DOAA 4OJLA 3Q8LA 3C95A 1A77A 3DM2A 2R8KA 4M42A 4NV0A 3KWIA 2ZUCA 2L5YA 3ATVA 4H5RA 1FJGK 1GLAG 2P9KA 3T5LA 3WQTA 3DOLA 3OYJA 4DS5A 3PLAA 4UATA 5AHXA 4O3RA 1RT3A 4CFAA 4M3ZA 2BHNA 3DMJA 3D2SA 4UARA 5KPZA 3RRHA 4RUAA 3IAYA 1PK1B 1QHAA 3O8MA 4CECA 3CC2N 1ATRA 4MLHA 4PY5A 4CZHA 5F3XB 2VYPA 1EO1A 4CZLA 1BCMA 5BREA 2XO7A 3HKZC 3O3HA 4DTSA 4JI7K 3ZX3A 3VEXA 3CCSN 2JZBA 3JSMA 4O3OA 4KLIA 3Q8SB 2BTFA 1N56A 1D8BA 3NAEA 1TVRA 1NGEA 5M1OA 3FGUA 2BDUA 2OHFA 3C2LA 3SAHA 4JV1A 4BJQA 4BACA 3W0LA 1XC9A 4CGJA 1TKXA 3MDAA 2A41A 3SENA 1U4BA 1HNZK 2DWQA 1KVCA 3LP1A 1FK9A 3WK5A 2ZIWA 4NL9C 4BRQA 1REVA 3B6PA 4W5OA 1WG8A 1YVNA 1RDUA 3LVVA 3L3FX 5IWAK 1NJIO 3LVWA 3KKAC 5ALDA 4G3IA 2KJ9A 1LW0A 4RQNA 5CYQA 1HEKA 2G09A 3T1YK 2K60A 2ZF5O 1S3XA 3A0IX 1RDAA 5TISU 3R9PA 3TANA 2W8LA 3S41A 5IIOA 4BG9A 2KSOA 1PUZA 4P0PA 3C0BA 3ATUA 2FXUA 3VESA 2E8MA 3LAKA 5KFIA 7ICQA 4CJ4A 2D1KA 4ECSA 5AK6A 4TUSA 4NYNA 1KQSM 2WTUA 3MC1A 4I2BA 3P39A 2Q31A 5KFYA 4BRKA 1RT7A 5I42A 2KIWA 4B6JA 2OXOA 2PKEA 4K43A 1N6QA 1CI4A 3BQ0A 4MFFA 4PHAA 3AA3A 1IJJA 2YNFA 4BGDA 5DQIA 3V4IA 1RILA 5KPRA 2ODGA 3O9RA 5HP4A 3SNNA 2XI9A 3QE9Y 1ZQSA 1RT2A 9ICUA 2HSZA 4NXNK 1RDBA 4FZXC 1VQMN 1N5WA 4CIEA 4IEIA 4ECUA 2LSNA 2W54A 2OYYA 4FL9A 2GV9A 4GNIA 3NS1A 1U9LA 2VKQA 4MFBA 4GXJA 5K14A 3QEXA 2IDOA 2KHVA 2DUYA 4Z6DA 5KFBA 5JRTA 3OBWA 4DFMA 1J2NA 4PWDA 2ZE2A 4JYAK 2O8DA 5AQSA 2IAJA 1EWRA 3BQ1A 3CM5A 5KG7A 2QKBA 3AA2A 5KG3A 3RJJA 3M1FA 2FMSA 3H4BA 4RW9A 1XSPA 2UUAK 4ILJA 3HBTA 3MFHA 5DKWA 3ZDEA 3LDAA 2Q97A 2WFAA 3HI0A 1RBVA 5AZJB 3KJVA 3NMUA 3RH6A 3M9NB 3P4IA 2G8HA 3O4QA 2WB1F 2PFUA 3QUBA 1YTAA 3SJJA 4GXIA 3EZWA 3C21A 2QTDA 1F5SA 2E20A 3RSEB 3SMSA 2P9UB 1NK5A 2PI4A 2BGWA 1CEZA 2FLLA 1IKWA 4IKFA 3UQ2A 4ECXA 4H0YB 5AQTA 1NLVA 2D0CA 2W43A 4DEZA 3OYLA 7ICJA 2O8FA 5KGWA 1VQPN 4KREA 1ESVA 4B9LA 4BRLA 1XQSC 3ORYA 4CGGA 1DTTA 2ES6A 2F44A 4KMOB 1U49A 5AQQA 4EBEA 1D9FA 2ZIVA 3GG4A 3UKUB 2DF4B 4B9MA 1JLGA 3LM2A 4CF2A 2W41A 1I3AA 9ICTA 2YN4A 4QIWC 4KKOA 2PXIA 1L3VA 3MX5A 2ASOA 2F7TA 4FO0A 4KI6A 2CPRA 5SZTA 3ISBA 1KFSA 5GAHP 3WKAA 2WF6A 5CHIA 3VCBA 3NBPA 1OH5A 4FVUA 3OYBA 3F5AA 4I9QA 3T69A 5IINA 5E41A 1CRXA 2ZTEA 2WF7A 5I9EB 5B8HA 4LH5A 1PVQA 1BIUA 3ZI4A 4RPZA 2G07A 4GC7A 3NF7A 3HVRA 4JI8K 3E01A 2Y1IA 2Y9TA 1S5LU 2Z1HA 4ED1A 4UB5A 2R8JA 2LYHA 3OYKA 4DU3A 1KVBA 4DR2K 1X9SA 1H38A 3B0YA 3ZSQA 4B3MK 4LFAK 2G8UA 2YMQA 1BQNA 1J5OA 1QH9A 4I6MB 1WBDA 1Q81O 3VF6A 3NVVA 3FZKA 4O0JA 3T19A 3N7RC 2QWLA 3JPPA 4CK1A 3O3GA 4I2GA 1VJ5A 4QS7A 3IUCA 5KFZA 4CJWA 1X2IA 3SMPA 1W97L 4Y2RA 3TABA 4FS1A 5KFQA 9ICMA 5J0RA 3GE1A 4ILHA 3DXKA 3QEIA 3M1YA 5HBMA 3VQCA 4A2BA 3MXJA 1Q46A 3EUB2 1HNXK 5D46A 1O13A 4FJGA 1RXVA 2V52B 4O5EA 4O3QA 3NRWA 4UB2A 4EEKA 2HOFA 1MA9B 4ECQA 1JCGA 4ECVA 2WFBA 4EHUA 2ZXHA 5JTIA 2EZYA 2YCHA 3ID8A 5BPCA 3V7JA 3VQPA 4CZGA 3S3MA 1K8AO 4OCZA 1TKZA 3M8RA 3QEPA 3AVLA 1ZQKA 5K4LA 4EEYA 5DQHA 2R18A 4B9TA 3O9QA 1S0VA 1S1WA 4BUGA 2P9IB 5BR9A 2DKZA 4F3OA 1KRPA 5DM6L 2YNHA 2J6SA 3SV3A 2NRWA 4QWBA 1L6NA 5EOYA 4R5PA 1LOTB 1P90A 5EE0A 3OYIA 1RT6A 3IP4B 3TFRA 4DTMA 1K8KA 1VQ6N 3SR6A 4DL7A 2ZQBA 4JV2A 3M8QA 1KQQA 2UUBK 1Z6RA 1TV9A 3L0QA 1L7PA 3QUTA 4FOEA 4M04A 5J0TA 5L1KA 1K5OA 3SCXA 2DPJA 3MEDA 3FZHA 2RE2A 3M9OB 5AM5A 1BNOA 5CEHA 3TWHA 3THXB 2BQ3A 4IBNA 5G5HA 4JK9A 2AJQA 1B43A 2R8HA 5KT4A 2DPIA 5M1PA 3ZT4A 4NY8A 2VA8A 4KLHA 4N56A 5TZVA 3TQ1A 5AQGA 3WQUA 5BPNA 1BU6O 1DGKN 1RQNA 4MHVA 4N41A 4BC5A 2MUTB 4DF4A 3VQ8A 1JIHA 4IQUA 4IQTA 7ICHA 1S1VA 4JI1K 4GMJB 4OX9K 2E2PA 9ICKA 3A5MC 5KGXA 1EWQA 1NK0A 1AROP 3SAFA 3K5OA 3CM6A 3L2UA 2W9CA 5KG1A 2ITGA 1E3MA 2DPNA 1BOTO 3Q7CA 1QQ7A 3H08A 2KMDA 2RLTA 1Q3VA 4Y2UA 4O5CA 5DK5A 2Z1GA 2VG6A 1ATSA 1SWVA 4DL5A 3OYFA 2UXCK 3C2KA 5KFWA 1KFDA 5AM1A 5GADP 8ICFA 1ZBLA 3AQFA 4F71A 1XSNA 1JL1A 1WLJA 2KHQA 2FSKA 5KNIA 3AVMA 1ED1A 2H3FA 4C1NI 3K59A 4I29A 3LANA 5FPMA 3MWTA 1YAGA 4LFBK 4C7ZA 1JLEA 1HNIA 3WEEA 3J7ZO 4DTJA 1YIJN 2FDRA 1X9JA 2XIDA 3TACB 4RT3A 1WSIA 1C0UA 3VA0A 2I7NA 5EE1A 5AIBA 2WUSA 4KFBA 7ICLA 2KOBA 3H7IA 4CF9A 4QZAA 3WXLA 4RPYA 4AP9A 4FWQA 4DB3A 5CZ1A 3N4QA 1HJOA 4CEBA 2IIRA 4KH5A 1XC3A 2OPSA 1IG9A 3LDPA 4RUCA 5F2RA 3T5KA 8ICEA 1T4GA 3I55N 1VSDA 4Y2QA 1RTHA 2GX9A 4CW7B 2H3GX 2XHBA 1CXUA 5I3UA 2Q0ZX 4C8OA 4CGZA 4JLHA 3MR2A 3ZDBA 2YHXA 4QWCA 3DJCA 3E9LA 2P9NB 2DL0A 4IG0A 4DLEA 3M6GA 4RW7A 4BVPA 5KT7A 3THYA 1VSIA 3P1GA 2W7OA 2A1JB 5ALMA 2Z1IA 1ZQFA 4FJ7A 1KW4A 1NGFA 3QZ7A 1VSKA 1NGHA 1U6ZA 3SQIA 1L3SA 4JKBA 4KLQA 2GBZA 2YY6A 5KG0A 5D4BA 2P51A 4KTZA 2XC9A 2KHOA 4L3QA 1YXQA 3JPTA 2VJ5A 3QMLA 1HYSA 1LWEA 4JHDB 4BDPA 2OTLN 2A5XA 3H8JA 4HUEA 3GQCA 3UQ0A 2B6GA 2V7ZA 4J9QA 3O3FA 4E7JA 4L8RB 3RWUA 1NJWA 2KLAA 1U48A 5AQLA 2I5HA 4U67L 4BRHA 3B8AX 3NH2A 2QA4N 5GIPA 4Q43A 1HUXA 3F9MA 5LL6Z 3AVHA 1UHUA 1WSFA 4HTUA 3S3OA 4H4MA 4E89A 5KFTA 3KHGA 1P8ZA 4CHZA 4ZH4A 4FLTA 2P9LA 2BUPA 2ZM6K 2PI5A 3EE8A 4NLGA 3AVIA 2IOHA 1BI4A 5AFUA 1ZBIA 9ICBA 3T3FA 4YQWA 1NGJA 2E6LA 4KRFA 4RW8A 3Q8MA 3OYDA 5AQKA 4WQ5C 5J2QA 4KO0A 3LWLA 3LZJA 4AHSA 4BRFA 4B1YB 2BZFA 2C2RA 4CK3A 2QWMA 4KPYA 4JWNA 3I8DA 2HBJA 4OJPA 2KK0A 2M0NA 2GELA 2ZJ5A 1BIZA 4EAHD 4U7BA 7ICVA 2YTUA 3PIOL 1TE2A 4J9RA 8ICKA 3NCIA 1SL2A 3BS5A 3C7NA 4KN7A 3MAQA 4CEFA 3I76A 3ZSYA 4GVMA 4A59A 4AHVA 4WQ4C 3J8AA 4EFHA 4FLYA 3AO4A 5KL8B 1NOMA 4H0VB 5C2DA 3H40A 2ZIUB 2O8EA 4A61A 1TK5A 5L1JA 3AGRA 1ZXOA 3RJEA 5J0SA 1LKYA 2QWOA 3KTQA 1WSJA 5CYMA 2K8AA 1ZQRA 1ZQIA 2CGKA 1N32K 3BS7A 4KHUA 3M6ZA 4F4ZA 2PFPA 4CF8A 5LY3A 5KT3A 3RF9A 3QDKA 1C0MA 4ICLA 1EETA 1C6VA 4DV6K 4KITB 2X78A 1N61A 1B0XA 5A0LA 4LSNA 3O5BA 4NXMK 3OYEA 4DSFA 4PJ0U 4DQQA 1NZBA 2UYTA 1GLDG 3ENHA 2FMPA 5LMNK 3SUOA 2WF9A 3HRGA 4FWNA 3KHHA 2BANA 4DSKA 3RBEA 1GOBA 3OJSA 3AVKA 4MDBA 1Z1VA 3NF8A 2IVPA 4JI6K 3V9SA 1QZ6A 5EXWA 4ED2A 1BL3A 4M7YA 4XH4A 3CYMA 5HMLA 3S6JA 3QYPA 4Q5VA 1GO3F 1KTQA 4F5RA 1ZETA 3CXCM 4J9KA 3G6YA 1KC8O 1TKTA 4DTRA 1XSLA 3BQ2A 5AKLA 3RBDA 2RF2A 3PSFA 4DU4A 1I94K 3EN9A 4YXJA 2IOFK 3A8YA 4V19S 1LW2A 4DL6A 2J4RA 2QWPA 2P6UA 2EANA 4DU1A 1TK0A 4CIFA 4B1UB 3QU9A 3NGDA 3HJEA 5AI8A 1EX4A 4CHQA 1SQKA 1GOAA 1C20A 2DKXA 5DBAA 3MR6A 4IRDA 3HPHA 2Z7JA 4BROA 2JV3A 2ZGZA 4J9OA 4OVLA 4X5VA 2YMLA 4WFAL 1NG9A 3PO5A 2IC3A 2PY5A 1B9FA 4CJUA 4FJXA 2E2OA 4I9LA 4Q8FA 3QNOA 3V9XA 2RRDA 3RJHA 1SZPA 2JZBB 1A5XA 1HLUA 2I5JA 1RBUA 1B22A 4IFEA 1BISA 4IDKA 2JHDA 4I7FA 4O5BA 4RW6A 4Y2TA 3HYFA 3KLGA 1IH7A 4JKAA 4M47A 2E3TA 3E66A 4GV6A 1RYSA 1Z19A 2HNYA 4FK2A 4E19A 3OS2A 4CBXA 2GWJA 2JMGA 1D4XA 3N7PD 2ITMA 4WFNL 1IKXA 3K9JA 3KK3A 2LPEA 3TAPA 1X42A 3LPTA 4JS5A 9ICWA 3IHQB 2E1ZA 3ZSRA 1NU0A 2FSJA 9ICSA 3U6FA 4TUQA 2AHOB 5G5GA 4UY8O 4PZOA 4FWLA 3AVCA 2F77X 4ED3A 1ZD4A 1DTQA 4KN4A 4RQ7A 1YJ9N 1PZNA 2YB1A 4HYKA 1BPXA 3H3NO 4J2EA 3TTFA 5CRXA 3U3YA 3WXJA 4CZJA 2RN2A 3NDKA 3LAMA 2JEGA 3PX4A 4O5FA 2G5HB 5KG5A 4AYBC 2E8NA 4KLUA 3O9UA 1T94A 2D0OA 4WFBL 3RMDA 3QUCA 4TURA 2UU9K 1NGCA 9ICNA 3VQQA 1OH7A 4QCLA 1VSEA 4M45A 3C28A 1SZ2A 1NMNA 2HOQA 3MK6A 3TSPA 2E8OA 2KVCA 1PVRA 4F50A 3NE6A 4Z4IA 2BCVA 5ALVA 4CEEA 4W5RA 3HM8A 5AKGA 2BR0A 4F72A 3IMXA 2UVRA 7ICIA 5ADXA 1KCFA 1W2BM 2O8DB 2GOLA 2PMZF 3O1BA 1ZBUA 2ASMA 1Q3UA 2JH7A 3OSPA 3RJKA 1U47A 3ZDCA 2KZMA 5HR7A 8ICHA 3TI0A 2QB1A 5KG6A 3P83D 4IFVA 1ASVA 4B9QA 5HLFA 4Y1CA 5HP1A 2RP5A 2NNWA 3CPEA 2RQ5A 3V9ZA 4M6WB 3WXMB 2CRXA 2DY4A 2X6SA 3QU7A 5D3GA 4GY2B 2HVHA 2QXFA 3EKUA 3L4IA 4UAYA 3HWTA 4X66K 3KLFA 1U45A 2HOIA 4CVNE 5KT6A 1IG6A 4DWIA 5DQGA 2HW3A 4OGEA 3HSCA 3ZETA 2O8CB 3TADC 1ZJMA 4EBDA 2YHYA 3V7KA 1NJZA 8ICBA 4JNEA 5EVZA 1ECWA 3GDQA 2OTJN 2D0PA 2MRLA 1S6PA 3H4DA 1TYQA 4JI2K 5EWEA 1B9DA 4DV3K 3NGYA 1B4FA 3CJ1A 4FLUA 5HNKA 5AM2A 1I39A 4ED7A 2HHQA 3DWLA 4DO9A 2N1RA 5DB9A 3L5KA 4CFCA 4ICAA 4E7IA 5LJVA 3L8BA 4EX7A 3RB3A 2IBKA 3QEAZ 4O3NA 4JK8A 5HROA 4CE9A 1NKBA 4J2AA 3QU4A 3ZDAA 1ZQPA 4QWAA 2IVNA 3C6HA 4LF8K 4QIWF 1YVUA 2KV2A 2LYBA 3MABA 2W9BA 4HWIA 2AP1A 2O8BA 5E79U 4C4RA 1TAMA 5EOZA 2WBNA 4DR5K 1OXJA 4KLTA 1TUYA 1VQ8N 5AM4A 4IXCA 5J2EA 2F8SA 2ZTDA 9ICQA 3U9ZA 5JVGL 1HUZA 4F5OA 2KJ5A 4F4KA 3D2FA 1N2XA 3MDQA 4AHCA 1DOQA 1D8LA 3QERA 3MEGA 1COOA 4F5NA 7ICMA 4KB0A 3TU5A 3IKMA 3UE5A 2VA2A 1UCVA 2BKEA 5EY4A 1Z3EB 1Z4NA 3ISCA 2HBKA 1FIQA 2XCAA 3U9DA 2P6RA 4WQ5A 2WAQC 4NLNA 1TFRA 2LMRA 5DLFA 3KZXA 3WT0A 2HMXA 1E4GT 1U2VB 3MWPA 2RDJA 1XO0A 4YR2A 1X66A 4O9MA 3J80O 4IO9L 2WF5A 1J2MA 3A2FA 2K4HA 3D2QA 4YY3K 3CF5L 3JS6A 2LI6A 4DG1A 2F4VK 3D45A 2YB4A 3DXKB 2VGMA 3MDCA 3B9JA 4WQ4A 2YMPA 4CFBA 4R79A 4JKHA 3TAGA 4J03A 1S5JA 3MFIA 4A2AA 1CXQA 2BPGA 1HKGA 4ECTA 4BRNA 3AV9A 5C15A 2HHHK 9ICLA 1G99A 2HMPA 3FZFA 5KAFU 1A5WA 4DFKA 1BUPA 2JRZA 3MN9A 4FWRA 5BN9A 3G6XA 5M1QA 3CCVN 3K1RB 1SXEA 2KJ8A 5J0XA 3CC7N 2D0BA 5BRDA 3M9MB 4FM2A 1XWLA 4ISEA 1XNRK 3RMAA 3VF4A 3BY5A 4M7XA 3F5EA 8ICWA 3V7LA 5AKEA 2OEHA 3KHLA 2EZXA 4J9PA 1OUQA 4DSJA 2RPIA 4CJKA 3SAGA 2H3VA 2D4WA 4CRXA 1FKPA 1HKBA 2RHKA 4FZLA 1S10A 3O1WA 3AM9A 2FPMA 1GLLO 2P5OA 2VANA 3VPZA 1RTJA 2ZIXA 1XHZA 3L6QA 1K8KB 3AL0B 4JAXA 3L2WA 2KE7A 2NYVA 5KFDA 4LF5K 4C8NA 5J2PA 4DR4K 1SV4A 7ICOA 4KTQA 3DXMA 3SLCA 4YCXA 3VMFB 2B0CA 2QARA 5AI5A 9ICOA 4RZRA 1IIPA 3N4MB 4G1QA 2XRIA 4JEPA 3ZEUA 2Q2RA 4MF8A 4DF8A 1IKYA 2PAVA 2NO4A 1BPDA 5HRSA 1XMQK 4FO6A 3LALA 4JKFA 3IN5A 3E2EA 1L7OA 1GLCG 2GEMA 4FW1A 5J2IA 3N28A 4GVEA 4IOXA 2P9SB 4RT2A 4P2HA 1YZ7A 7ICUA 1T8EA 3JPRA 3O08A 3VQ4A 1M6YA 1LCUA 1D9DA 4RQ4A 4YXMA 1L8OA 3PMLA 5CR4A 3WNEA 4QZHA 3IFRA 1BCOA 1ZQUA 2XVTA 3ASMA 4XH1A 3MGIA 2J6UA 2OANA 4F2RA 2W9CB 5DGAA 2A6AA 2E2NA 3H6EA 3FC4A 4O3SA 3MECA 3VEYA 3V81A 1QVGM 1QQOA 8ICTA 3NGIA 4M2YA 2MA1A 1L3TA 3QFUA 2JLEA 4F4XA 2ISPA 1CLQA 4OKEA 2EZZA 4CHPA 1S0NA 2VQEK 2KKVA 4I2FA 2F1IA 1S1XA 4BE2A 2HHSA 3O0FA 4I2AA 2A1RA 1T3QA 1Q18A 3BGRA 4CHNA 3AVAA 3QFPA 3SEIA 3ZT3A 1SKWA 4EYIB 5AQHA 3T1AA 3WKDA 1QQCA 1JALA 5TKWA 1J53A 1T3VA 1BPZA 2KZZA 4BDYA 4NM2A 2HF4A 3BEXA 3SQ4A 3K4GA 2GUIA 2K8CB 2KIVA 4PZNA 5KFOA 2Y9UA 7ICKA 4QZCA 5BN8A 1PK1A 1RDDA 1DEJA 3J7AP 3JPSA 5B66U 3WXIA 2DFEA 4CK2A 3OYMA 4TQRA 1X9MA 4YFUA 1JLCA 4E7LA 4JKGB 1K73O 3DRSA 3GBTA 4CNQA 1J9AA 5ALNA 4KLSA 1E4FT 4MO4A 5AQJA 5GAEP 5T7BA 1HNWK 3MCAB 3FAHA 4YOWA 4YDUA 3NVKA 4IO8A 1FFVA 5AR0A 2OWOA 3L2RA 4UAZA 4NLKA 4O3MA 2A1AA 3LP0A 1V9PA 4KLLA 4KLJA 4EENA 1TV6A 5AIAA 3MGVA 3I33A 5TKYA 2VG5A 4CJ3A 1GLFO 4A5AA 2ATQA 4DUYK 3RJGA 2EAOA 2B5JA 4YORA 4JWMA 2BDPA 1ZD5A 4B1ZA 3CFPA 2ZD1A 4RG8A 4NLCA 9ICVA 2JEIA 4FJLA 4DL4A 2KEYA 3Q8KA 2DQNB 2Y0SF 1TL1A 3ZT0A 3SI8A 3WXKA 5J1EA 1EQYA 1RQLA 4J9MA 9ICEA 2BPCA 2HOEA 3VTIA 4JI3K 3THYB 4YOUA 3THWA 3RMBA 2QWNA 3TTCA 4CZEA 1M1KO 4A8EA 4M9JA 1BHLA 3VEOA 3K57A 5J2NA 4WCEL 4RNOA 3MMVA 4U7CA 3DOKA 5C24A 1NZPA 2FPLA 1MWKA 4FJJA 1RPLA 4EZ9A 4CZMA 2FBVA 5C0YA 2KKPA 3FE1A 5IT9O 5DB8A 3QIPA 4KTWA 4JI4K 4JB3A 3V6HA 1MDUB 2D5RA 4QS9A 1YTUA 4DOBA 4DTUA 2X74A 4BE1A 2IMWP 3KVGA 3KD5E 3PY8A 5H1SQ 5DGBA 3F5TA 2NZTA 1VSLA 4LC9B 4PGYA 2AQ0A 4YN4A 4E1JA 4JI5K 3U4LA 4Y1DA 2NRRA 4F3TA 5AKIA 1UA0A 3TADA 5AKZA 4A57A 1DGSA 4OJ6A 5ALSA 2DFFA 3G6EN 1SV0A 4LZDA 3ENOA 3IRXA 3IV6A 4MO5A 2P1JA 1L7MA 1C0TA 3R1XA 4XH5A 3U8XA 3JYTA 2MU2A 4QW9A 1VQ4N 4OJOA 4OPJA 4Z94A 4QZFA 1YZ6A 2GO7A 3A0HU 4FWPA 4N76A 1DT9A 3FR0A 4E3SA 4IL6U 4B9UA 9ICIA 1JX4A 4TSXA 4F5QA 1UT5A 3SQ2A 1KKXA 4US8A 5JLFA 2PYLA 3LWMA 2E88A 4Y2JA 2BCSA 3AVGA 4JMUA 2LHTA 4RPXA 3IRUA 3BQTA 5KFLA 4PQUA 3CRXA 2CH5A 4DHYA 3HK2A 4XQ8A 3HRDD 1Z26A 1TVAA 5AK3A 2B6AA 1TL3A 1A76A 3ED5A 1MC8A 3EW9A 3IG5A 1TAUA 3RR7A 3VN5A 3QU2A 4OLAA 2W3RA 1GLEG 1JXBA 3OSNA 4NCBA 2R7YA 3PO4A 1YHQN 1J97A 1PVPA 1FO4A 1CZAN 4IFYA 1XU4A 3OTQA 1DRGA 3ULDA 4H0TB 5AZJA 4JS4A 3RRGA 3HTVA 3DV9A 2VWJA 3ZT2A 2W8KA 2WB1C 2BQUA 1RYRA 3SV4A 1HJRA 3QEBZ 2W6KA 2ALZA 5AM3A 2E2QA 4OPAA 5AZIB 5M1KA 3CCUN 3F2DA 4DQIA 1COKA 1KL9A 2F2AB 1G15A 1RG6A 4GIBA 1S77D 2GLEA 1ILYA 3K5MA 4CF3A 4DTNA 4GFJA 3ZSZA 5DB6A 5JUMA 5J2GA 1NNLA 5FROA 1UT8A 5GINA 5KRSA 1ZQQA 3BF3A 3DLEA 4KLDA 1NKEA 1KAXA 4CGFA 2JR5A 3ZD8A 1QZ5A 3CJ7A 4CGIA 2EWSA 2JGUA 1GOCA 1P7DA 1W7AA 2G8IA 4BE0A 5ALEA 3IDHA 5BPLA 4YOTA 4P0QA 2DBYA 4QS8A 3KWGA 4LVSA 3CCRN 3UKUA 1ZQCA 3KFUF 4FWSA 3CD6N 2KW4A 2FLPA 2C22A 5HMMA 2KKZA 1C1AA 2DFHA 3WNGA 4AM6A 4DFPA 3OYGA 4DQRA 5JS1A 1HQEA 1T03A 5AJ3K 4FJ5A 3UB5A 2Q4TA 5KQDA 3E9OA 2F1JA 3H8SA 1XHXA 4DQ8A 4C1NK 1UOCA 4K8ZA 8ICOA 5C5JA 1Y97A 2YHWA 4M63C 1X3NA 4Z4EA 3DRRA 4CJQA 3CMAN 4Z6CA 3V6KA 4CD1A 5J2AA 1J6ZA 4R66A 3V1OA 3DLBA 4PPXA 3K75D 3VC8A 4Z4FA 4HCCA 5C12A 5KT2A 1BVSA 3NHGA 2VG7A 3PSTA 4FWMA 4IG3A 2XY7A 2BH1A 3ISNC 4RCHA 5CHGA 1KAYA 1J54A 4PKHA 5BOLA 4IQWA 4M9NA 1ASWA 2E8AA 3SBGA 5J0QA 2RHFA 3ZX2A 3K5LA 4DS4A 5AKJA 3U3GA 3ULEA 3QEWA 3MXIA 3TSUA 3PR5B 4CD3A 3C65A 4H0PA 5AI9A 4Q45A 8ICVA 4CZIA 1JXEA 4M3YA 1N33K 4NWIA 4CEQA 3WKCA 2FJ6A 1D5AA 3B6OA 8ICAA 1O08A 1UAXA 3C94A 1KAZA 5DG8A 3G6VA 8ICPA 5EU7A 3AVFA 1QSYA 1RT4A 4PUOA 2WF8A 2E1FA 9ICGA 4ECRA 3LP3A 4QAGA 3WNFA 1EXQA 5AKXA 2BCRA 1ZQXA 4NXZA 4NLZA 4ISGA 1GLBG 2I7PA 2BCQA 3DAWA 3BZCA 4ID5A 4AILC 3QNNA 3IG8A 4XA5A 3AAQA 2QB0A 5CA7A 5J2KA 2K4IA 1NOYA 4JUZA 1MWMA 2QKKA 4K0KK 2WOMA 4OPHA 5LMUK 3K5NA 3NFAA 3SQ1A 3UMGA 4CHOA 1Q8KA 2W9MA 1X3MA 5ALIA 3SZ2A 2A42A 5AQUA 2D0AA 3LPUA 4IZ9A 1N62A 4I2DA 3L2QA 1L7NA 5GIOA 1ZQGA 4M41A 4RNNA 4UB1A 2G5IB 3WU2U 4DUZK 4OO1J 2JEJA 4F5PA 3T5JA 5AQWA 2GH1A 5ALLA 3WK4A 2W9AA 3D2NA 4BQZA 4M3UA 5JICA 3G4SN 4LH4A 1W0HA 1KN5A 8ICRA 3F2BA 2IVOA 1YITN 3GV5B 2P9PB 5AQPA 4M3TA 4F2SA 4Q8EA 1VQ9N 4QJFB 4H5NA 3H0RB 4DFDA 3VOVA 3SD7A 2CGJA 4YR0A 1LB2B 9ICFA 1RGIA 3ALYA 3P38A 4AHUA 4Y2XA 1TGOA 2MAXA 3UIQA 1ZBHA 4GV3A 4QZBA 2FPKA 4QWDA 2B4JA 2D6FC 2IOCA 1X6JA 2ASJA 2GWSA 4W5NA 4DKWA 2MUTA 5EE9A 5J0UA 2M9NA 4ED8A 3EPIA 1SL0A 4BRCA 4BX9C 4KHYA 1O03A 4PH5A 4PHPA 1DLOA 2ZUDA 1WSGA 1L3UA 1QQ5A 4FZNA 3D6RA 4FVMA 1DXSA 2H3QA 1W9HA 4I28A 4JRPA 3F73A 4KLGA 5KFVA 5J2FA 5CR0A 2A3VA 4BR5A 5BRFA 3L3UA 4LF9K 4K8XA 1V97A 3VENA 2ESEA 3H46O 4Q0BA 3CCLN 2E5LK 4JV0A 5KFAA 3CJ9A 3S3NA 4IJAA 2E1EA 3HP9A 4ZOHC 1ZQEA 4I2PA 3UKRB 8ICZA 3ZETB 4LF6K 3HJFA 1X9WA 5JVHL 4YOVA 3D6JA 5ALKA 1TYQB 4M9GA 4BRIA 2P9KB 5ALYA 2OCEA 1VQLN 3AU2A 2NUBA 1VLBA 3PZPA 3HOTA 1IXRA 2IHNA 1UQVA 2KNJA 2A3ZA 2HB5A 4FOIA 1T6CA 4B3SK 3RH5A 2JGAA 3LDNA 4BR9A 4FLZA 1OW5A 2E1YA 4H03B 4CJFA 3RH4A 3HKZF 4H0OA 3SUQA 3R9KA 1XS9D 1HQUA 1QE1A 1NI3A 4IOCL 1BPBA 4USAA 3GDXA 3BJYA 4CF1A 5C10A 4B3OA 1MU2A 7ICNA 2HHTA 2NRVA 3WKBA 1MA7A 3RMCA 3EEQA 2NRXA 3DLRA 4O4GA 5F0XA 3J81O 4DL2A 3C1YA 1ASUA 4FZYA 4MFAA 2WC9A 4JK7A 4R64A 2A19A 3NRZA 3OS1A 7ICFA 2B21A 4Z4CA 5ALTA 2ZIWB 1JXLA 2G8WA 5KFXA 2VA3A 2Z1JA 5FDLA 4JV5K 9ICJA 1ZQTA 1NNEA 2P9NA 3ITHA 5KFKA 3IG1A 4ZHRA 2Q0RA 1EXNA 1ZQAA 2FBTA 4MQ3A 1YJWN 4UBCA 4YR3A 4F9OA 2O4GA 4F91B 4C4SA 3DRPA 3ZX0A 2NLXA 3AQEA 5DMRA 3TARA 5DG7A 1RM6C 2KSOB 1WWVA 4P0PB 4W5QA 4GXKA 1T7PA 4H5WA 2KZ3A 4KBOA 2FE9A 2HBLA 3HOSA 4U6PA 4FFDA 1IKVA 3MN5A 4WYBA 3A5NC 4ECWA 4FK0A 2K8BB 1MQ2A 3ETRA 3PW4A 4LZGA 3TSQA 4QZ8A 5AK5A 3OPXA 4YDUC 2KFZA 4UW9A 1MSWD 2YV0X 2BQRA 1NK9A 4OD0A 1FW6A 4FE3A 4MFCA 3VGLA 1XMOK 5GAGP 4LJXA 3OYCA 2VIXA 4X64K 3NVMA 4FWOA 3QU5A 2FF6A 4RQ8A 3FZMA 1URJA 2CGLA 5D49A 5AQNA 2KTQA 3KOOA 3I1YA 4PL1A 3T79A 3THVA 3E1YA 3EE9A 4FJ9A 2AXTU 4HUGA 2P35A 2V4QA 1M90O 1FKOA 4LF4K 4WE1A 5GTHU 3A0BU 3DLHA 2JWKA 2OA8A 3Q8QB 4FBUA 4I2IA 2ZIXB 1K1QA 3SPZA 3LDQA 3SUNA 3HILA 4DQPA 1NMDA 4FJKA 4J9NA 3E9PA 3V9WA 2HHWA 5C2FA 1BGXT 4EZ6A 5HL7L 4IQVA 5T14A 4B9NA 3DXMB 4BR2A 5ALHA 1X1PA 1HPZA 3CJBA 4Y2VA 1JROA 4YNQA 2OPQA 2IOFA 4KX3A 5L9XA 3ZEUB 1C1CA 4DSLA 4DR1K 3ICXA 1ITGA 4FLVA 1ZYQA 5AQRA 2ZIUA 4PGQA 3G25A 3NH0A 4CESA 3QZ8A 4Y2PA 1NK6A 8ICJA 4I2JA 5EX5A 1ZQYA 5AKKA 1ZXIA 7ICTA 1LWCA 1S9GA 5BPMA 2W03A 3OYNA 3OW2M 4DTOA 5CZ2A 2F8KA 4CEDA 2XICA 2AA4A 3MX2A 2F96A 2PZSA 1SV0C 4R8UA 5ELZA 4UB8U 3GILA 3C6TA 3Q7BA 3CMEN 4BR7A 4YD2A 4CJSA 1JJ2M 4DCCA 4UB6U 4YHHK 4BRMA 2O8FB 2ZJ8A 2QKQA 5FRNA 1NGIA 4KH6A 4JRQA 1BPYA 3D2EA 3OYHA 1S0OA 3CCQN 8ICLA 1ATNA 1NGDA 3K9KA 3CW2C 3MR5A 1BDGA 2VWBA 5KAIU 1ZBSA 3JPQA 2ZIVB 4LY7A 1NK4A 5CY4A 5ALOA 1DGJA 3FM9A 1SGGA 4CZFA 3JPOA 5AI6A 1EKEA 2ZG6A 3M8PA 1ZOLA 1LAWA 3H1VX 2OZSA 1WCLA 1HPMA 1WUAA 2AGQA 1WCNA 3AO1A 1LAVA 3H1QA 4K4HA 4M3RA 5L1LA 2H5XA 5AKHA 5J8YA 3GL1A 3V9UA 2XY6A 2UVWA 3BQ7A 3AVNA 2KD1A 4PA1A 3TAMA 4E7KA 5E84A 4RQ1A 4OJRA 4K4GA 2F3NA 4HUFA 2BCUA 3ZSWA 2IHMA 3LZIA 2OZMA 1N8RO 3CCMN 2QXLA 2WHEA 4I2EA 3VQ5A 3ZSVA 3EPGA 3R8EA 3CP8A 4ELUA 1RBSA 1Q8IA 1VHXA 3KKRA 2HDOA 4PL2A 4FPBA 2YKNA 4B08A 1R0AA 2LM1A 4PL7A 1ZQWA 1A5VA 1WWUA 4P4MA 5FP0A 2ZGYA 5J2CA 3NF6A 2K89A 1HNVA 4RQ5A 1O1WA 2UVUA 2ZXIA 4BWJA 3BP8A 1Z00A 4FXDA 3EKSA 2HSTA 5KFEA 4I2HA 1SUQA 5BR8K 4CJTA 1GLJO 1OVYA 1JCEA 3GOIA 1XI1A 2KICA 3KK7A 2W40A 3R6MA 4O44A 4BXOA 2D3DA 4B8AB 3THWB 3CCJN 4OLBA 4HCBA 2X6NA 4O55A 3WK6A 3JPNA 3LM9A 4BRAA 4E7HA 4XUSA 3GIKA 4JKEA 2V9WA 1L8LA 3RVCA 2BPFA 4Z6FA 1ZQLA 4CJ5A 3NGZA 2AH5A 2YQEA 2PBDA 3PNCA 4NYFA 5L1MA 3KK1A 1JCFA 4ED6A 4YFKA 3PW7A 4KH4A 5CJ7A 5AQMA 2NRTA 1T6DA 1S9FA 4FBTA 2FBYA 3CQYA 3QB0A 4PL8A 3K58A 3J81j 1B92A 3QLHA 5SWMA 4B3RK 1UPHA 1RDFA 5B5EU 4B8CA 3LL3A 4F8RA 2ETJA 1V4TA 4CEAA 5KFJA 4EIAA 5KFPA 4M9LA 1NGGA 1NWKA 3H45C 4ISFA 2P5GA 2QWRA 5KT5A 3OHBA 1JLFA 2Q3SA 1ZQ1C 4FWKA 3WK7A 3ZD9A 4UB4A 4K41A 4NO7A 2AU0A 4LD0A 2VCPA 2QEXN 4R65A 3CI5A 1HX1A 3QEVA 3SPYA 4FJHA 5ALGA 1NM1A 1UWBA 4JD2A 1CUKA 4BRDA 3M3ZA 3DDHA 4QWEA 1BQMA 1JLBA 2C2EA 2NRZA 2FF3B 3AA5X 3AA4A 2UVVA 1F0MA 3ETLA 3T7ZA 3DEEA 3EYZA 5AQFA 2KFNA 4O3PA 4R63A 2J6TA 1NJYA 5FPNA 3RB0A 4MEYA 3VETA 4X62K 2IGIA 3AVJA 3LYSA 3O6WA 5HRRA 4ECZA 4CEOA 3VGMA 2PMZC 2HCFA 5JS2A 4AM7A 3PVXA 3QX7A 3TAEA 3H3OB 1HYVA 4GC6A 4TQSA 3P5JA 2ZTCA 2EHGA 4K42A 3TPQA 1RZTA 4M6WA 2G8KA 1BA1A 2F9WA 3UPQA 1K9MO 5KL1B 2G06A 4H4OA 4NCGA 3CNHA 3WUHA 3NF9A 2G08A 3VQAA 2JH1A 1RYUA 4C8LA 3O9SA 2Q1NA 3VQ7A
chains in the Genus database with same CATH topology
1TKDA 1SKRA 1SZHA 4C0ZA 4LSLA 3TR8A 3TAFA 3OS0A 3VQBA 4FLXA 4AH9A 1QTMA 4CFDA 4W5TA 1FXXA 3HPGA 2OPPA 4CDGA 3QINA 3H0MB 2RKIA 1RNHA 4P0QB 5C42A 4B9SA 4FZZA 3QO9A 4N5SA 4HHTA 4ACOA 1QSSA 2F76X 3S9HA 3VA3A 4AHTA 4Z4HA 3K1ZA 3AO3A 3C6UA 3G10A 3OJUA 3F53A 2VJ4A 3LP2A 4RW4A 4M3XA 1LWFA 3SI6A 4KAZA 4KV8A 4FCYA 2DTUA 4CCHA 4FW2A 4NCAA 1F21A 2HHXA 4KX5A 4CGHA 1VRUA 3KKSA 4BDZA 3FFIA 1WSHA 2G8VA 2H3IA 1HMVA 1IO2A 5KRTA 1S6QA 3L2VA 3CG7A 4CJVA 1HYZA 4H8KA 3QETA 3RTVA 5KTQA 1Z25A 4FJMA 2NV3A 4FM0A 4ID1A 3RR8A 4C8KA 4FK4A 2OPRA 2LKYA 2XY8A 4UQGA 1BI4B 4WJ3B 2A1SA 2XY5A 2F8LA 1KSPA 1TK8A 1LV5A 3PV8A 2H3ZA 1L5UA 4EP4A 5J2MA 3VQ6A 2YX8A 2WONA 4AHRA 4CGDA 1T05A 3SUPA 3RWUA 5C25A 3M7DA 3GZFA 2Y1JA 3KLEA 1NK8A 1VRTA 3VQEA 3F2CA 3O4NA 1KLNA 4KHSA 1RT1A 1Z1BA 2K4EA 1YT3A 1WUDA 1SL1A 4CJLA 1QHTA 2YHBA 1Q9YA 4IC9A 3M8SA 4OKKA 2DGZA 3KLHA 1S1UA 3G0ZA 1QSLA 3PX0A 5HRPA 3MXMA 4QOZB 2OM6A 3AO2A 5FRMA 3CFRA 1S1TA 4ZTFA 1TAQA 1RDCA 4E1NA 4FJ8A 1ZBFA 1SV5A 2W42A 3AVBA 2HBMA 4DTXA 2QK9A 2CN1A 4CF0A 3ZSOA 1U04A 3I0SA 1HRHA 4CEZA 1CZ9A 1KLMA 4NLBA 4GW6A 4E1MA 1CZBA 1VK0A 1RTDA 2FBXA 3HT3A 4DFJA 3PSPA 1WNSA 4C8MA 1S9EA 3HO1A 3HXMA 2Y0SC 3HSTB 3KD1E 3I0RA 4ELTA 2O4IA 1WAFA 4OGCA 5HR6A 2OH2A 1VSJA 3DI6A 3QESA 3HP6A 4CJRA 2HVIA 4DSIA 3PX6A 3VQ9A 3ALRA 4DTPA 1NKCA 3RFAA 3ONNA 4CERA 3K2PA 4DSEA 4OJ5A 1NOZA 4AYBF 3QIOA 1RCHA 3E0FA 2PYJA 2LBOA 3IS9A 3SQ0A 3ZCMA 2F8TA 4FZMA 1K6YA 1C1BA 3DLGA 1RBTA 3PUFA 1A6SA 3CQ8A 1EP4A 1WSEA 2IS3A 3DLKA 2BE2A 4EP5A 2G0AA 4CJPA 2YNGA 4OPKA 1Q9XA 4CJEA 1SKSA 2E5SA 4DMNA 4Z4GA 3CFOA 3KLIA 3HM9A 3WNHA 3BDPA 3V1RA 4OKJA 3GU3A 3L3VA 1JL2A 1VSMA 3D0PA 4DLGA 2FC0A 4KB1A 2YNIA 1UA1A 4BWMA 1A0PA 1XNSA 3AO5A 4KHNA 1VSFA 2HHUA 3MEEA 2W04A 3F9KA 4FYDA 4FJIA 2YHAA 3SMVA 4I2QA 3V6DA 1JKHA 2VWKA 2OYQA 2E4LA 4DQSA 1NK7A 3ZT1A 4N47A 2WAQF 4Z0UA 3VQDA 4ZTJA 1RBRA 3LDSA 2G8FA 3PSIA 3V1QA 1D8YA 1KBUA 3EY1A 1QS4A 1JLQA 1WN7A 2BGGA 3SYZA 3OYAA 3C29A 4CHYA 4FLWA 3HVTA 4CIGA 2YKMA 3HPOA 4KI4A 1N5YA 4J2BA 3NH1A 2W7PA 3NUQA 4FM1A 5HRNA 3OY9A 4CHOA 3DYAA 1F44A 4KHWA 1NJXA 1RTIA 3HL8A 4XIUA 4ELVA 4QNLA 1JLAA 1WAJA 4B9VA 5KI6A 2LYAA 2HNDA 3KK2A 3EZ5A 2HHVA 4E0DA 4FJNA 3KIOA 2KQ2A 4O0IA 1HIWA 3N7SC 1KVAA 1RT5A 3OVNA 2HMIA 4J2DA 4HVJA 4M3WA 3M6KA 1VSHA 2HNZA 3ZSXA 2E6MA 3H0LB 2EX3A 4KHQA 3TAQA 4OJLA 3C95A 3DM2A 4M42A 4NV0A 3DOLA 3OYJA 4DS5A 1RT3A 4CFAA 4M3ZA 3DMJA 3D2SA 3RRHA 3IAYA 4CECA 4PY5A 1BCMA 2XO7A 3HKZC 3O3HA 4DTSA 3JSMA 1D8BA 3NAEA 1TVRA 2BDUA 3SAHA 4BJQA 4BACA 1XC9A 4CGJA 1TKXA 1U4BA 1KVCA 3LP1A 1FK9A 2ZIWA 4W5OA 1REVA 3B6PA 3LVVA 3L3FX 3LVWA 2KJ9A 1LW0A 5CYQA 1HEKA 2G09A 1RDAA 3TANA 4P0PA 3LAKA 4CJ4A 4NYNA 1RT7A 5I42A 2KIWA 2OXOA 1N6QA 3AA3A 2YNFA 3V4IA 1RILA 3SNNA 2XI9A 1RT2A 1RDBA 4FZXC 4CIEA 2LSNA 2OYYA 2GV9A 2VKQA 4MFBA 5K14A 3QEXA 2IDOA 2KHVA 4DFMA 4PWDA 2ZE2A 2IAJA 3CM5A 2QKBA 3AA2A 4RW9A 1RBVA 3KJVA 2G8HA 3O4QA 2WB1F 1YTAA 3SJJA 1NK5A 1IKWA 4IKFA 2D0CA 3OYLA 5KGWA 4KREA 4B9LA 4CGGA 1DTTA 4KMOB 1U49A 1D9FA 2ZIVA 2DF4B 4B9MA 1JLGA 4CF2A 1I3AA 4KKOA 4QIWC 1L3VA 4KI6A 2CPRA 5SZTA 1KFSA 3VCBA 3NBPA 3OYBA 3F5AA 4I9QA 5E41A 1CRXA 4LH5A 1PVQA 1BIUA 2G07A 3NF7A 3HVRA 3E01A 2Y1IA 2Z1HA 3OYKA 4DU3A 1KVBA 1X9SA 3ZSQA 2G8UA 1BQNA 1J5OA 4O0JA 3T19A 3N7RC 3O3GA 4CK1A 4CJWA 3TABA 3QEIA 5HBMA 3VQCA 3MXJA 4FJGA 3NRWA 2HOFA 2ZXHA 3VQPA 3S3MA 1TKZA 3M8RA 3QEPA 3AVLA 2R18A 4B9TA 1S1WA 4BUGA 4F3OA 1KRPA 2YNHA 3SV3A 1L6NA 4R5PA 3OYIA 1RT6A 3IP4B 4DTMA 2ZQBA 3M8QA 3SCXA 3MEDA 3TWHA 4IBNA 3ZT4A 2AJQA 4N56A 4N41A 3VQ8A 4DF4A 1S1VA 4GMJB 5KGXA 1NK0A 3K5OA 3SAFA 3L2UA 3CM6A 2ITGA 3H08A 1Q3VA 5DK5A 2Z1GA 2VG6A 3OYFA 1KFDA 1ZBLA 3AQFA 1JL1A 1WLJA 2KHQA 3AVMA 1ED1A 2H3FA 3K59A 3LANA 1JLEA 1HNIA 4DTJA 2XIDA 1WSIA 1C0UA 3VA0A 4KFBA 2KOBA 4CF9A 5CZ1A 4CEBA 2OPSA 1IG9A 1VSDA 1RTHA 2XHBA 1CXUA 5I3UA 4C8OA 4JLHA 4CGZA 4IG0A 4RW7A 4DLEA 1VSIA 3P1GA 2W7OA 2Z1IA 4FJ7A 1VSKA 3SQIA 1L3SA 2GBZA 2P51A 4KTZA 2VJ5A 1HYSA 1LWEA 4BDPA 4HUEA 3O3FA 4L8RB 4E7JA 1NJWA 1U48A 3NH2A 3AVHA 3S3OA 1WSFA 4HTUA 4H4MA 4E89A 4CHZA 4FLTA 3AVIA 1BI4A 1ZBIA 2E6LA 3T3FA 4KRFA 4RW8A 3OYDA 5J2QA 4KO0A 3LWLA 3LZJA 4AHSA 4CK3A 4KPYA 3I8DA 2HBJA 4OJPA 2M0NA 1BIZA 3NCIA 1SL2A 3MAQA 4CEFA 3ZSYA 4GVMA 4AHVA 4FLYA 3AO4A 5KL8B 2ZIUB 1TK5A 1WSJA 3KTQA 5CYMA 2K8AA 4KHUA 3M6ZA 4CF8A 3RF9A 1C0MA 4ICLA 1EETA 1C6VA 2X78A 5A0LA 4LSNA 3OYEA 4DSFA 1NZBA 4DQQA 3SUOA 2BANA 3AVKA 4DSKA 1GOBA 3OJSA 3NF8A 3V9SA 1BL3A 3CYMA 4Q5VA 1GO3F 1KTQA 1TKTA 4DTRA 2RF2A 4DU4A 3PSFA 1LW2A 4DU1A 1TK0A 4CIFA 1EX4A 4CHQA 1GOAA 3HPHA 2Z7JA 4OVLA 3PO5A 2IC3A 2PY5A 1B9FA 4CJUA 4FJXA 4I9LA 3QNOA 3V9XA 2RRDA 1A5XA 2I5JA 1RBUA 4RW6A 4O5BA 1BISA 4IDKA 2JHDA 4I7FA 3KLGA 3HYFA 1IH7A 1Z19A 2HNYA 4FK2A 4E19A 3OS2A 2JMGA 3N7PD 1IKXA 3KK3A 3TAPA 3LPTA 4JS5A 3ZSRA 3U6FA 3AVCA 2F77X 1DTQA 2YB1A 4J2EA 5CRXA 3U3YA 2RN2A 3NDKA 3LAMA 3PX4A 2G5HB 4AYBC 1T94A 3RMDA 3VQQA 4QCLA 1VSEA 4M45A 3C28A 2HOQA 2KVCA 1PVRA 3NE6A 4Z4IA 4CEEA 4W5RA 1KCFA 2GOLA 2PMZF 1ZBUA 1Q3UA 2JH7A 2KZMA 1U47A 5HR7A 3TI0A 3P83D 4IFVA 1ASVA 5HLFA 4Y1CA 5HP1A 2RP5A 3V9ZA 2DY4A 2CRXA 2X6SA 5D3GA 2HVHA 2QXFA 3KLFA 1U45A 2HOIA 4DWIA 2HW3A 4OGEA 1NJZA 1ECWA 2MRLA 1S6PA 1B9DA 3NGYA 4FLUA 1I39A 2HHQA 2N1RA 4CFCA 4ICAA 4E7IA 3L8BA 5HROA 4CE9A 1NKBA 4J2AA 4QIWF 1YVUA 2KV2A 2LYBA 1TAMA 2F8SA 2KJ5A 4F4KA 4AHCA 3QERA 3MEGA 4KB0A 2HBKA 2WAQC 3KZXA 2HMXA 1XO0A 3A2FA 2K4HA 3D2QA 4DG1A 3D45A 2YB4A 4CFBA 3TAGA 1S5JA 1CXQA 3AV9A 1A5WA 4DFKA 2KJ8A 2D0BA 4FM2A 1XWLA 3RMAA 3F5EA 4CJKA 4DSJA 1OUQA 2RPIA 3SAGA 2H3VA 4CRXA 1FKPA 4FZLA 2P5OA 1RTJA 2ZIXA 1XHZA 3AL0B 3L2WA 4C8NA 5J2PA 4KTQA 1IIPA 4G1QA 2XRIA 1IKYA 4DF8A 5HRSA 3LALA 3IN5A 4FW1A 1T8EA 3VQ4A 1D9DA 3WNEA 1BCOA 2XVTA 3ASMA 4F2RA 3V81A 3MECA 3NGIA 2MA1A 1L3TA 2JLEA 1CLQA 4OKEA 4CHPA 2KKVA 1S1XA 4BE2A 2A1RA 3O0FA 2HHSA 3BGRA 4CHNA 3AVAA 3ZT3A 1SKWA 3T1AA 1QQCA 1J53A 2KZZA 4BDYA 3SQ4A 2GUIA 2K8CB 1RDDA 3OYMA 2DFEA 4CK2A 1X9MA 4YFUA 1JLCA 4E7LA 3DRSA 1J9AA 5T7BA 3L2RA 4O3MA 3LP0A 1TV6A 3MGVA 4CJ3A 2VG5A 2ATQA 2B5JA 2BDPA 3CFPA 2ZD1A 4RG8A 4NLCA 4FJLA 2KEYA 3ZT0A 2DQNB 2Y0SF 1TL1A 5J1EA 3RMBA 4A8EA 3K57A 1BHLA 5J2NA 4U7CA 3DOKA 5C24A 4FJJA 4EZ9A 2FBVA 5C0YA 2KKPA 3QIPA 4KTWA 2D5RA 1YTUA 4DTUA 2X74A 4BE1A 3KD5E 3PY8A 1VSLA 4Y1DA 4F3TA 1UA0A 4OJ6A 2DFFA 3IRXA 2P1JA 1C0TA 3JYTA 4OJOA 4OPJA 4E3SA 4B9UA 4TSXA 3SQ2A 2PYLA 3LWMA 3AVGA 4JMUA 2LHTA 4PQUA 3CRXA 3HK2A 1Z26A 2B6AA 1TL3A 3IG5A 3VN5A 3RR7A 1TAUA 4OLAA 1JXBA 4NCBA 2R7YA 3PO4A 1PVPA 4IFYA 1DRGA 3ULDA 4JS4A 3RRGA 2VWJA 3ZT2A 2WB1C 1HJRA 3SV4A 4N76A 3F2DA 1G15A 4DQIA 2F2AB 3K5MA 4DTNA 4GFJA 3ZSZA 5FROA 5KRSA 3DLEA 4CGFA 1NKEA 4CGIA 2JGUA 1GOCA 1P7DA 2G8IA 4BE0A 4P0QA 3KFUF 2KW4A 1C1AA 2DFHA 3WNGA 3OYGA 4DFPA 4DQRA 5JS1A 1HQEA 1T03A 4FJ5A 2Q4TA 1XHXA 1UOCA 4K8ZA 1Y97A 4Z4EA 3DRRA 4CJQA 3V1OA 3DLBA 3VC8A 4Z4FA 4HCCA 3NHGA 2VG7A 3PSTA 4IG3A 2XY7A 3ISNC 1J54A 1ASWA 2RHFA 3K5LA 4DS4A 3U3GA 3QEWA 3MXIA 4M3YA 1JXEA 4NWIA 4CEQA 1D5AA 3B6OA 1UAXA 3C94A 5EU7A 3AVFA 1QSYA 1RT4A 4PUOA 2E1FA 3LP3A 4QAGA 3WNFA 1EXQA 4ID5A 4AILC 3QNNA 3IG8A 2K4IA 1NOYA 2QKKA 2WOMA 3SQ1A 3K5NA 3NFAA 3SZ2A 3L2QA 2D0AA 3LPUA 4M41A 2G5IB 4OO1J 2GH1A 3D2NA 4M3UA 4LH4A 1W0HA 3F2BA 4M3TA 4F2SA 4QJFB 3H0RB 3ALYA 3UIQA 4AHUA 1ZBHA 1TGOA 2IOCA 2B4JA 2D6FC 4W5NA 1SL0A 4KHYA 4BX9C 1DLOA 1WSGA 1L3UA 4FZNA 4FVMA 2H3QA 1W9HA 4JRPA 3F73A 2A3VA 3L3UA 4K8XA 4Q0BA 3S3NA 2E1EA 3HP9A 4I2PA 3HJFA 1X9WA 2NUBA 3PZPA 2KNJA 2HB5A 2JGAA 4FLZA 4CJFA 3HKZF 3SUQA 1HQUA 1QE1A 4CF1A 4B3OA 1MU2A 3RMCA 2HHTA 1MA7A 3DLRA 4O4GA 1ASUA 4FZYA 3OS1A 4Z4CA 2ZIWB 2G8WA 2Z1JA 5FDLA 3ITHA 3IG1A 4ZHRA 2FBTA 4MQ3A 2O4GA 3DRPA 3AQEA 5DMRA 3TARA 4P0PB 4W5QA 1T7PA 2HBLA 4U6PA 1IKVA 4FK0A 2K8BB 3OPXA 2KFZA 2YV0X 1NK9A 4FE3A 3OYCA 2VIXA 1URJA 2KTQA 4PL1A 3T79A 4FJ9A 3THVA 4HUGA 1FKOA 4WE1A 3DLHA 2OA8A 2ZIXB 3SPZA 3SUNA 4DQPA 4FJKA 3V9WA 2HHWA 1BGXT 4EZ6A 4B9NA 5T14A 1X1PA 1HPZA 4YNQA 2OPQA 4KX3A 1C1CA 4DSLA 3ICXA 1ITGA 4FLVA 1ZYQA 2ZIUA 3NH0A 4CESA 1NK6A 1LWCA 1S9GA 2W03A 3OYNA 4DTOA 5CZ2A 4CEDA 2XICA 2F96A 2PZSA 3C6TA 4CJSA 5FRNA 4JRQA 3OYHA 2ZIVB 4LY7A 1NK4A 5CY4A 1EKEA 2ZG6A 3M8PA 1LAWA 2OZSA 3AO1A 1LAVA 4M3RA 3V9UA 2XY6A 3AVNA 2KD1A 4PA1A 3TAMA 4E7KA 4OJRA 4HUFA 3ZSWA 3LZIA 2OZMA 3VQ5A 3ZSVA 3CP8A 4ELUA 1RBSA 1Q8IA 3KKRA 4PL2A 4B08A 2YKNA 1R0AA 1A5VA 3NF6A 2K89A 1HNVA 1O1WA 2ZXIA 4BWJA 4FXDA 1SUQA 4CJTA 1XI1A 2KICA 4O44A 4B8AB 4OLBA 4HCBA 2X6NA 4O55A 4E7HA 4CJ5A 3NGZA 3KK1A 4NYFA 2FBYA 3K58A 1B92A 3QLHA 5SWMA 1UPHA 4B8CA 4F8RA 2ETJA 4CEAA 2P5GA 1JLFA 2Q3SA 1ZQ1C 4LD0A 4FJHA 3QEVA 3SPYA 1UWBA 1BQMA 1JLBA 3AA4A 3AA5X 3DEEA 3EYZA 2KFNA 1NJYA 2IGIA 3AVJA 3LYSA 5HRRA 4CEOA 2PMZC 5JS2A 3TAEA