The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
150
|
sequence length |
429
|
structure length |
415
|
Chain Sequence |
EPKLLAEPREGVPNVIDTLPAFRDYCSELASSHGSLAADAERASGFRYGHEDWLVQFKRDGAGIGLLDPQALAAAGADWNDFNRAVGDAVWILHDSLQDLPGFDELGMEPQRLFDTEIAARLLGLKRFGLAAVTEHFLGLTLAKEHSAADWSYRPLPRDWRNYAALDVELLIELETKMRAELKRQGKMEWAQEEFDYALKEGLGPRKEHLIPWMHVSHITEVMRDRQALAIVRALWTRRDELAREYDIAPTLLLSDSSIIEVAKRKPHNAAQFRSIRSINERVRIHTDSEQDKMFERYAPIQRKIKPSMWKNIIQDALALPPSEWPDSAPKSIRVWKERYPERLQVLNRVRKAVSQIAEDTRTPVEIVIKPQYLRNLCWTDEPRKRDVARFLSEQGARDWQVSLVAESVSRAIEG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Uncharacterized protein BAD_0989
|
publication title |
Crystal structure of protein BAD_0989 from Bifidobacterium adolescentis.
rcsb |
source organism |
Bifidobacterium adolescentis atcc 15703
|
molecule tags |
Structural genomics, unknown function
|
total genus |
150
|
structure length |
415
|
sequence length |
429
|
ec nomenclature | |
pdb deposition date | 2008-04-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00570 | HRDC | HRDC domain |
A | PF01612 | DNA_pol_A_exo1 | 3'-5' exonuclease |
A | PF18305 | DNA_pol_A_exoN | 3' to 5' exonuclease C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | DNA polymerase; domain 1 | DNA polymerase; domain 1 | ||
Mainly Alpha | Orthogonal Bundle | DNA polymerase; domain 1 | DNA polymerase; domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Nucleotidyltransferase; domain 5 | Ribonuclease H-like superfamily/Ribonuclease H |