3CYMA

Crystal structure of protein bad_0989 from bifidobacterium adolescentis
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
415
Chain Sequence
EPKLLAEPREGVPNVIDTLPAFRDYCSELASSHGSLAADAERASGFRYGHEDWLVQFKRDGAGIGLLDPQALAAAGADWNDFNRAVGDAVWILHDSLQDLPGFDELGMEPQRLFDTEIAARLLGLKRFGLAAVTEHFLGLTLAKEHSAADWSYRPLPRDWRNYAALDVELLIELETKMRAELKRQGKMEWAQEEFDYALKEGLGPRKEHLIPWMHVSHITEVMRDRQALAIVRALWTRRDELAREYDIAPTLLLSDSSIIEVAKRKPHNAAQFRSIRSINERVRIHTDSEQDKMFERYAPIQRKIKPSMWKNIIQDALALPPSEWPDSAPKSIRVWKERYPERLQVLNRVRKAVSQIAEDTRTPVEIVIKPQYLRNLCWTDEPRKRDVARFLSEQGARDWQVSLVAESVSRAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein BAD_0989
publication title Crystal structure of protein BAD_0989 from Bifidobacterium adolescentis.
rcsb
source organism Bifidobacterium adolescentis atcc 15703
molecule tags Structural genomics, unknown function
total genus 150
structure length 415
sequence length 429
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
A PF18305 DNA_pol_A_exoN 3' to 5' exonuclease C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3cymA03
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3cymA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cymA01
1SV5A 3U6FA 4CFAA 4NCGA 1KFDA 4FZYA 4ELTA 3ZSWA 4FJJA 1RNHA 2FC0A 2HW3A 4E1NA 2KFZA 3QINA 2E6LA 4DS5A 4E89A 4DTMA 2HMIA 3OYEA 5JS1A 1G15A 4OKEA 1RDBA 3NHGA 1YVUA 4N47A 3LWLA 4BDZA 3HO1A 3V81A 4NYNA 5HROA 1UA0A 4CK2A 4KHSA 5D3GA 3AVBA 3I0SA 4EP5A 2A1SA 3ZSRA 1W9HA 1A5VA 2G8KA 4O0IA 4CDGA 4Y1DA 3DLHA 3TI0A 3TAFA 4CGDA 4PUOA 1DTTA 2HB5A 3MEDA 2HVIA 1X9SA 4DSFA 1ITGA 4CFDA 3OVNA 2Z1GA 1LV5A 3T1AA 1GOAA 3IG1A 4CEAA 2Q3SA 3K5OA 2GUIA 3QEWA 4Q5VA 1LWCA 4NLBA 3VQPA 4CEFA 1BHLA 1LAVA 1NK5A 1RDAA 2IC3A 4C8LA 4FLZA 2PYJA 4M3YA 4DFKA 1VRTA 3AV9A 2PY5A 5FROA 4CERA 3M8PA 2QKKA 1JXEA 3PX0A 1TK0A 4KFBA 3OYJA 1HYVA 3VQDA 2IOCA 3AVKA 3K58A 1Z26A 4AHVA 1YTAA 4C8OA 4LSNA 3MXIA 1EKEA 5C0YA 1TKZA 3AO2A 3P5JA 2D0CA 4QAGA 4CEBA 3M8SA 2Y1IA 4FJXA 3V9WA 4FLWA 3OYHA 4M3XA 2HHXA 4DQRA 1IKXA 1KCFA 5HLFA 1HRHA 1JLAA 3OS1A 3OYBA 3LDSA 3OS2A 1QQCA 1NK6A 3DRRA 5CZ1A 4J2EA 2YNGA 1N5YA 3HPGA 1VSHA 3HK2A 1RT6A 4FJ7A 3WNEA 4HCBA 2FBTA 4CESA 1KVCA 2YHAA 3FFIA 4C8KA 3K57A 3OYDA 3KIOA 2E1EA 4PQUA 4CK3A 2HHWA 1RTIA 3LAMA 4CGIA 3NF9A 4DTOA 3QESA 3AVCA 4DWIA 3SUPA 2HVHA 4YFUA 3V9XA 3G10A 3OJSA 4B9UA 2WONA 2OA8A 4FK0A 4CF8A 3SQ1A 3AO4A 3LALA 3C95A 1UWBA 2F8SA 1NK8A 4AILC 4B08A 3S9HA 4ICLA 3D45A 2XY7A 3B6OA 4CEQA 1JLFA 5HRNA 3TAMA 2OZMA 5SWMA 1ZBHA 4HVJA 2G8VA 4K8ZA 3HVTA 2VWKA 4OGEA 1SUQA 3O4QA 5I42A 3KLGA 4KHQA 3CYMA 3K59A 2PYLA 5HRSA 4JRQA 1RT1A 1D9FA 1RDCA 1VSDA 1TVRA 1U04A 1WLJA 2CPRA 4CHOA 3NGZA 4KHYA 1C0MA 1WAFA 1A5XA 4Y1CA 4B8CA 4J2BA 1UOCA 1F21A 3SYZA 1UAXA 2MA1A 4FJNA 1RT3A 3D0PA 3V1QA 4H8KA 1B9DA 3NH1A 2XHBA 2W42A 4Q0BA 1IKVA 4BDPA 5KRTA 3SZ2A 2X6SA 1K6YA 2HNDA 3U3GA 2YHBA 1SL1A 1VSLA 3O4NA 3HT3A 3THVA 3OY9A 3CG7A 4W5QA 1YT3A 3PX6A 4MQ3A 4KI4A 4O0JA 5KTQA 1NK0A 5I3UA 1U45A 1HQUA 4HHTA 3SPZA 3SQ4A 1S1XA 1KTQA 2XY5A 3L2WA 3QEIA 3QERA 3RWUA 3C94A 4E7KA 4CGZA 3SUNA 4W5NA 3NF7A 4KTZA 3ISNC 3L2VA 2KFNA 2E6MA 1D5AA 2Z1HA 3KKRA 4BWJA 5KGXA 4DSIA 1JLBA 3HPOA 3ZSYA 3KK2A 3VN5A 4BACA 1JLGA 4OPJA 1NJWA 1C1BA 2OPSA 4IDKA 4PWDA 3CFRA 1CZBA 1TK8A 4DSJA 4M42A 3L3VA 3V1RA 4DF4A 3P1GA 1WSGA 1SKRA 3ZSOA 3KTQA 1LW2A 3DI6A 1BI4B 4AHUA 3AVLA 1Q8IA 3TARA 4B9MA 4IG3A 4N76A 1RTJA 3ZCMA 3RMCA 4CF9A 3RR7A 3S3MA 3ZSXA 3RR8A 4F4KA 1UA1A 4MFBA 4KV8A 4XIUA 4IKFA 4B9NA 1QS4A 3AVAA 3SUQA 3NF8A 3MEGA 4CJLA 3V4IA 3SQ0A 4B9VA 3ZT2A 4Z4GA 3I0RA 3TAQA 1LAWA 1QSSA 2HHTA 1XHXA 4FZZA 2BGGA 3LPUA 2XY6A 4DMNA 4DFPA 3SAFA 1BQNA 3L2RA 4NCAA 5HBMA 3WNFA 1JLCA 4AH9A 1HYSA 2G8HA 4QIWF 3F73A 1RILA 2BE2A 4CF0A 4CHQA 3KLFA 4DS4A 3QLHA 1WNSA 4CIGA 3CFPA 3ULDA 4G1QA 1GO3F 4RW6A 4FJKA 4BWMA 3TANA 3ZT3A 3NDKA 3S3OA 4KRFA 4FLXA 1HPZA 3IRXA 4LH4A 4LSLA 3SPYA 5C24A 4DTSA 3JYTA 3PV8A 3QIPA 1RT2A 4O4GA 1D8YA 3OYNA 1VRUA 4FYDA 1I39A 4HUGA 3RRHA 1RBSA 1WSEA 3TR8A 1RT7A 4DTNA 4KTWA 1NKEA 4ELUA 1RBUA 1GOCA 2HBLA 1S6PA 2P51A 4O44A 4M41A 4M3ZA 1RCHA 4FJGA 4EP4A 4NYFA 1NJXA 4CJKA 1FKPA 2RPIA 3KLIA 4RW8A 5CYQA 4ELVA 2O4GA 3SI6A 2HHSA 1QTMA 3SAGA 3PUFA 4JS5A 3S3NA 3SUOA 1QSLA 1WSFA 1WSJA 2VG7A 4FW2A 4CJEA 3L2QA 3RTVA 1TKDA 2DTUA 4JLHA 2ETJA 3QIOA 4ZHRA 3AA3A 1RBTA 3K2PA 3LP1A 3OYFA 1KFSA 3AVMA 2HHQA 1CLQA 3H08A 1JLEA 4CJ4A 4F2RA 1NOYA 4DTJA 5DMRA 3NF6A 3VQ6A 1QSYA 2DFEA 4CEEA 4CJ3A 1C1AA 3OYAA 4HUFA 1X9WA 4I9QA 2P5OA 3LP0A 1BGXT 4CEZA 4CFBA 1IKYA 2KZZA 1C0UA 3NGYA 4IG0A 5CZ2A 3KD5E 1VSIA 4DU1A 4O3MA 2Y1JA 4FXDA 1JL1A 3DRSA 4FVMA 4GW6A 5T7BA 1SKWA 2OZSA 3NAEA 4OGCA 1IKWA 2YNHA 4CGHA 3O3GA 1NK9A 3O3FA 3DLBA 3VQQA 2ZE2A 2HBKA 3U3YA 3MXMA 4DTXA 1Y97A 1KLMA 4E19A 4N56A 1EP4A 1U48A 3LZJA 1TV6A 3PO4A 4CJRA 1CZ9A 4EZ6A 4ID5A 1L5UA 4OKKA 1RTHA 3HSTB 4CJFA 4CFCA 1RBRA 3DLRA 3KJVA 3KKSA 3VA0A 3HPHA 1U47A 3BDPA 4E0DA 2QXFA 3C6UA 4LH5A 4CJVA 4N41A 2D5RA 4FW1A 1SL0A 4E7JA 5CY4A 3SV3A 1SKSA 4NLCA 1T7PA 4CGGA 3HL8A 1S6QA 3OYGA 2WOMA 4DG1A 1XHZA 2VWJA 1T05A 2O4IA 4TSXA 4RW4A 4AHRA 4Z4CA 4OJRA 4IFYA 2OYQA 4OLAA 4CHYA 3F9KA 1TK5A 1D9DA 1HNIA 2YKMA 3AVNA 4E7LA 3OS0A 3V6DA 2F96A 4IBNA 3AVHA 3TAPA 1CXQA 2B5JA 1TKTA 4FK4A 4KTQA 4I2QA 2Z1IA 1WUDA 2B4JA 3NE6A 3QO9A 3ALYA 1KLNA 1QHTA 2YNIA 3QNOA 1LWFA 4ZTJA 4K8XA 4B9LA 1WAJA 3HP9A 4CIFA 2P5GA 3QNNA 4Z4FA 4CCHA 1REVA 3LP2A 3TAGA 3DOLA 4RG8A 4FK2A 4FM2A 4DSKA 4I9LA 3NH2A 3VQAA 4JRPA 4CE9A 4DU3A 4DLEA 1NKCA 1FKOA 2XRIA 1T03A 4OLBA 3PY8A 4M3RA 2HHVA 1S1UA 1D8BA 4KAZA 3KLEA 2B6AA 1L3TA 3P83D 4CECA 3IAYA 4FJIA 4CJTA 1WN7A 2JGUA 4L8RB 1TGOA 1NJZA 1HMVA 1U49A 1RBVA 1Z25A 4AHCA 4CJSA 1T8EA 1S1TA 4B3OA 3L2UA 2DFHA 2KTQA 4M3UA 2FBYA 3DLGA 4OKJA 5KRSA 1B9FA 4BDYA 4F8RA 3TWHA 1U4BA 1EX4A 3ZT0A 3NCIA 5FRNA 4DQIA 1TKXA 1GOBA 3LPTA 2RN2A 4H4OA 3VQ7A 5KI6A 2F8TA 3BGRA 3AA2A 4FLTA 3RRGA 4DQSA 1I3AA 4CJWA 3SQ2A 3LANA 4C8MA 2JLEA 1QE1A 5J1EA 2FBVA 4W5RA 1BI4A 4CJ5A 4ID1A 1L3UA 1ZBFA 4DSEA 2IGIA 2PZSA 4Z0UA 4R5PA 2AJQA 2DY4A 1RT5A 2D0BA 4Z4HA 2DGZA 3JSMA 5E41A 4B9SA 4DFMA 1TAQA 4FJ8A 1L3SA 3QEVA 4OVLA 2GBZA 4CGFA 3QEXA 4OO1J 2RF2A 3OJUA 1C0TA 3CM5A 2FBXA 4FJLA 3WNHA 3DRPA 2IAJA 1LWEA 4CHZA 3I8DA 4FM1A 1NJYA 4KHWA 4F3TA 1MU2A 3OYLA 2LSNA 4F2SA 3DMJA 2GV9A 2YKNA 4CF1A 1SL2A 4OPKA 1C1CA 3NBPA 3ZSVA 1Q9YA 1S5JA 3NH0A 1JLQA 1BIZA 2HNYA 3MXJA 1VK0A 2OPPA 3AO5A 1HQEA 2BANA 3O3HA 3CM6A 3VQEA 4DQQA 1A5WA 5DK5A 3RMBA 5HP1A 3E01A 4DQPA 3T3FA 5J2NA 4GMJB 2ITGA 4HCCA 1VSKA 1JKHA 3LWMA 4J2DA 3LZIA 1R0AA 3LP3A 4E7HA 1ASUA 3V9UA 2A1RA 4I7FA 2EHGA 3G0ZA 5HRRA 4F3OA 3TAEA 1BCMA 4E3SA 1HNVA 3QEPA 4CJUA 1S1VA 4BE2A 3KD1E 2D0AA 3VQ8A 4CHPA 3VQ5A 3LAKA 4NCBA 1BISA 2IS3A 3KK3A 3HP6A 4RW7A 3VQBA 3OYKA 3TABA 1O1WA 1VSFA 3CFOA 4CGJA 2X74A 4AHSA 1NKBA 5KGWA 2NUBA 1XWLA 5FDLA 3EZ5A 4CK1A 1X9MA 3SJJA 3IS9A 3C6TA 4FLYA 2VG6A 3AA4A 2VG5A 4RW9A 1WSIA 3MECA 1L3VA 4DTPA 3A2FA 1RDDA 4HUEA 1LW0A 4KHNA 1BL3A 3DYAA 4LD0A 4PA1A 3HM9A 1J54A 4JS4A 4KB1A 4BE1A 2HBJA 1RT4A 4FM0A 3B6PA 1N6QA 2ATQA 4N5SA 2IDOA 3AO3A 2HBMA 4DU4A 4H4MA 3OYMA 4E1MA 2G8FA 5JS2A 1DTQA 2KW4A 4CEOA 4YNQA 3QETA 5CYMA 1CXUA 2KZMA 3MEEA 1KSPA 3PO5A 3K5LA 4UQGA 3RMAA 4EZ9A 5C25A 5SZTA 3V9SA 3HVRA 3AA5X 3VQCA 1VSMA 4FLUA 5J2MA 4DSLA 4CIEA 4W5TA 5FRMA 3K5NA 2KQ2A 3AVFA 4M3TA 1NOZA 3AO1A 1TL1A 1KVAA 3DOKA 4FCYA 3DLKA 4WE1A 4CEDA 1S9GA 5J2QA 2G8WA 4FJMA 2XO7A 1DLOA 2Z1JA 2ZD1A 4KI6A 4KO0A 1VSEA 4QJFB 1J9AA 4ZTFA 1YTUA 4W5OA 2YNFA 1ZBUA 2XY8A 4M45A 3ZSQA 4HTUA 1BQMA 3KLHA 4FJ5A 4FJ9A 3ZT1A 4AHTA 2KV2A 3ASMA 4B8AB 2R7YA 2G8UA 4FJHA 4GVMA 1FXXA 1JL2A 1IH7A 2I5JA 4O55A 3NGIA 4FLVA 5C42A 1FK9A 4KREA 3T19A 4KPYA 2EX3A 4C8NA 3SV4A 2HNZA 2DFFA 2OPRA 3VQ9A 4O5BA 4KB0A 4QOZB 1KVBA 3WNGA 5EU7A 4I2PA 3HJFA 2P1JA 1TL3A 3UIQA 4PY5A 3ZT4A 4LY7A 1XI1A 2HHUA 1TAUA 3VQ4A 4KKOA 4Z4EA 3AVIA 1VSJA 3NFAA 3M8RA 1EETA 4DF8A 4FZXC 4CJPA 2BDPA 4BE0A 4CHNA 1S1WA 4DFJA 3OYIA 2G8IA 1IO2A 3RMDA 5HRPA 3OYCA 3AVJA 4M3WA 1J53A 4B9TA 4DLGA 1BIUA 2E1FA 1BCOA 3AVGA 3KK1A 3HXMA 3V9ZA 2RHFA 1ZBLA 4CJQA 1ZBIA 1ZYQA 4Z4IA 5K14A 2OPQA 3DLEA 3EY1A 1ASVA 2RKIA 4J2AA 2X78A 1J5OA 3L8BA 2ZQBA 1IG9A 1NK7A 2RRDA 3SCXA 4E7IA 1B92A 4QCLA 3ZSZA 4DTRA 5J2PA 1KRPA 3VA3A 3V1OA 3EYZA 1XC9A 2X6NA 3L3UA 3HYFA 1JXBA 1ASWA 1W0HA 2E4LA 3M8QA 3CQ8A 1HYZA 1HJRA 3PX4A 3K5MA 1C6VA 1NK4A 3SAHA 1Q9XA 2QKBA 1S9EA 3MAQA 2QK9A 1WSHA 3DM2A 3SNNA 1EXQA 4IFVA 3ITHA 4DTUA 1X1PA 4CF2A 4KHUA 2YV0X 1RTDA
chains in the Genus database with same CATH superfamily
2ZUCA 3VEZA 1HUOA 3RVCA 3L4IA 4Y2PA 2HW3A 3H1VX 1RNHA 2FC0A 2Q2RA 3HJEA 3Q7CA 5F9LA 3QINA 5E84A 1SGGA 3WEEB 4QNLA 2QXLA 4CZJA 4RPXA 2E1YA 2W03A 3UM9A 5ALNA 2OANA 5AQYA 2P9IA 4N47A 3BZCA 1AQ6A 4UATA 2BQRA 1ZQJA 4CK2A 2W7PA 1KAYA 5ALYA 4Y2VA 1DOQA 4JV0A 2BZFA 4I2EA 1H1VA 1HEKA 9ICOA 3ZSRA 4Y1DA 3DLHA 2E1ZA 3TI0A 3TAFA 4DV3K 2GOLA 1YJNN 4Y2XA 4PUOA 3MEDA 3GOIA 1X9SA 1ZQLA 3IFRA 3Q8QB 1H38A 4DR4K 3IG1A 3K5OA 2GUIA 4OJ6A 3QEWA 1NGIA 2PFUA 1LWCA 4Q5VA 4H0VB 4CEFA 2R18A 1BHLA 4DFKA 1R59O 1HNXK 1VRTA 2PY5A 5TISU 2GEMA 3VGLA 3M8PA 4XA5A 5J8YC 4LZGA 1ZQSA 1XUPO 3LDQA 3UKUB 3OYJA 3QU5A 3K58A 4C8OA 4B1XB 5E26A 1YITN 2KZ3A 1EKEA 2Y1IA 1YZ6A 7ICRA 4BRFA 4PZOA 3M8SA 4NWIA 4CJ7A 2ALZA 4FJXA 2DKZA 2HHXA 4PGYA 2HOIA 5AR0A 2C2EA 1JLAA 1FFVA 5JRTA 2LYBA 4C4RA 3GG4A 4X64K 5ALGA 2YJFA 9ICGA 4ISGA 5J0SA 3N7SC 3GZFA 3L0QA 3PLAA 2YHAA 3FFIA 1ZQTA 4QZIA 4C8KA 3ZX2A 4ACOA 3UMCA 5KFCA 2E1EA 2W9CB 1DGKN 3OYDA 1KQSM 1XNRK 3THYB 1SWVA 2W7OA 2HHWA 4DTOA 3NF9A 1Y88A 8ICZA 1DKGD 3FLCO 4BC3A 3CMAN 3SUPA 3F9MA 5J0PA 4YFUA 3V9XA 3C28A 2OA8A 2WC9A 2NZTA 4Z6EA 4KN4A 4EELA 4CF8A 1ZQMA 3SQ1A 5KFPA 4IR9A 1UWBA 4B1ZA 2F8SA 4AILC 1MWKA 4B08A 3MX5A 2VQEK 2P9NB 1VQPN 4BREA 2ZXIA 4JNEA 4O3SA 3TAMA 3D2SA 4FPAA 4HVJA 5EWEA 5C5JA 1SS6A 1QQ7A 4BUGA 4IRKA 1SUQA 3LDNA 3O4QA 7ICQA 4IZ9A 4KHQA 3MWPA 4OPHA 3GQCA 5AZJA 1N33K 1BPEA 1E4GT 1RDCA 2ES6A 7ICOA 2E8MA 4CHOA 4YCXA 4J2BA 4I28A 3PZPA 1F21A 1UAXA 4GKKK 3BF3A 4FJNA 3KKAA 4H8KA 4BDPA 7ICMA 1EWRA 5M1NA 3IDWA 1RDUA 3QUCA 3CG7A 3PX6A 2P9PB 1W7AA 3R6MA 1ESVA 1CUKA 5KTQA 4I2FA 3CCJN 4JI1K 1MDUB 3NUQA 3ONNA 1NK0A 3WU2U 3A0BU 3KD3A 1JCEA 8ICWA 2KSOA 3QEIA 3HRGA 3RWUA 4BG8A 3SEIA 5AKGA 3E9PA 3H3OB 4TUQA 4KTZA 4LF8K 1BA1A 2UVWA 2E6MA 3KKRA 5KGXA 5AQRA 4CBXA 1JLBA 3HPOA 3KK2A 3VN5A 1JLGA 4JKEA 2Q0ZX 4IDKA 9ICVA 3VPZA 2IOFA 3L3VA 3P1GA 1KN5A 5E79U 4A5AA 1FJGK 1SXEA 3PR5B 3WKBA 4CNQA 1ZXOA 4IG3A 1ZQVA 5CRXA 5FPEA 3ZSXA 3U26A 3S3MA 4FO0A 5KAIU 4MFBA 4QZGA 4FPBA 3NVYA 4CJLA 5DKWA 3V4IA 4B9VA 3GBTA 3P38A 2NLXA 5HHIA 1QSSA 4H0PA 4NM2A 3RB4A 3PIOL 2VGNA 4B1VA 5J0YA 5BOLA 3WNFA 2G5IB 1NBWA 2DPIA 1HYSA 4QIWF 2YHWA 4MFFA 5DBBA 1RILA 4CHQA 2O8CB 4Q45A 4DS4A 2QWLA 4YY3K 1NI3A 4G1QA 2FJ6A 4F5NA 3NDKA 3DJCA 3S3OA 3CNHA 4LSLA 3CJ9A 3SPYA 4DTSA 3PV8A 4O4GA 1VRUA 3WEEA 1K73O 4PGQA 1WSEA 4WF9L 3MMVA 1X40A 4ELUA 2HBLA 1ZQOA 1A6SA 4EP4A 4Y2SA 9ICLA 4H5VA 1NJXA 2RPIA 4F92B 4RW8A 2YN4A 5AQPA 3TSUA 2WB1C 4QZDA 2KMDA 1OUQA 2WTUA 3PW5A 4RT3A 5DQGA 1WSJA 4CJEA 3UE5A 4MFAA 5AKLA 3CPWM 2NRTA 4BGDA 2JEIA 3CJCA 2YB4A 1A77A 1NOYA 5CB1A 1O03A 3A5MC 5DMRA 3CCRN 4NV0A 4MF8A 1QSYA 2CGKA 1IV0A 4ECQA 2DFEA 5JLFA 1X9WA 3NVZA 2P5OA 4DEZA 2VWBA 3FE1A 1KAXA 3KKAC 3MGHA 2DKXA 3OBWA 3SMSA 3UKUA 9ICMA 1C0UA 3NGYA 2LBOA 1KW4A 3JPSA 3U9ZA 3F5EA 1S0NA 4Y2YA 1OVYA 1SKWA 3NAEA 4JYAK 1S0MA 3DV9A 3VQQA 2ZE2A 2LYHA 3MXMA 4HCBA 4DTXA 1O13A 4N56A 2EAOA 8ICIA 9ICRA 3WK6A 2FLNA 3PO4A 4EZ6A 2QTDA 1JXLA 4FWLA 3FZMA 1RTHA 1SIJA 3TQ1A 7ICFA 3E9LA 2BR0A 4E0DA 1FIQA 5BPCA 1ZBIA 2YY6A 2YI1A 4LH5A 1SL0A 3HBTA 4E7JA 1SKSA 4RQ6A 4KLFA 3IUCA 3WK4A 3O1WA 2W9CA 4Z6CA 1X6JA 3THYA 5AHXA 5ALKA 2CGJA 3JPTA 1YIJN 3BZKA 3QE9Y 3DAWA 4OLAA 4BJQA 3BQTA 1D9DA 2BPGA 1NGAA 4JI7K 4JI8K 2PFQA 4JKCA 4U6PA 2F96A 3ZEUB 4J9QA 3NGDA 3RJHA 5ALDA 7ICJA 1CXQA 5CR0A 1TKTA 3KZXA 4FK4A 5AQQA 4KTQA 2Z1IA 1WUDA 3NVVA 3F5AA 4C7YA 4RQ2A 1DK3A 4NLKA 4KLEA 4FOEA 4IFEA 1L7MA 1X3MA 2FF3B 3C23A 1QQOA 4Z4FA 1VDVA 4NY8A 1SAZA 2BTFA 3QUBA 3QEAZ 4K43A 4RG8A 4FK2A 3NH2A 1L7PA 4ISEA 3JPQA 3TSPA 8ICVA 5KG4A 4DLEA 1T3NA 9ICIA 4LFAK 3F2CA 3ZDBA 1VQON 2F8KA 1D8BA 4KAZA 2I5HA 3KWIA 2P9PA 3P83D 4CECA 2JGUA 4NXMK 1VLBA 3C1YA 5IIOA 1U49A 1RBVA 1Z25A 2EAMA 1BNOA 4UB6U 1S1TA 2VA2A 3M1YA 4CZLA 2KTQA 5I9EB 4NXNK 4OKJA 5KRSA 4BDYA 4OD0A 4I29A 2E2NA 2YV0X 3TWHA 4OX9K 1EX4A 3NCIA 2P9LB 4ICAA 3LPTA 2RN2A 3WK5A 2F8TA 3A0IX 4JK7A 3G71N 2CH6A 3BY5A 1UQVA 2GWSA 3WKEA 1I3AA 2G09A 1SQKA 4CJWA 3LANA 4FWMA 5ALXA 1Z19A 4FBUA 2I6XA 4PKHA 2I1QA 4YD1A 2ASLA 1DT9A 4YOWA 3AMZA 3H8JA 1UCVA 4Z0UA 3LDPA 4R5PA 4LVSA 2CRXA 4K4HA 2HOEA 3JSMA 1HKGA 1TAQA 1JJ2M 3F2BA 3QEVA 3ZD9A 3WK9A 3MGIA 3OJUA 4Y2QA 5HL7L 4K4GA 2PMZF 2IAJA 2O8CA 2V7YA 2V4QA 4FOIA 1YJ9N 3OYLA 4QWAA 1SL2A 1QQMA 2KE7A 3ICXA 4OPKA 4YG2A 3ZSVA 4Y2TA 1HNWK 1Q9YA 4Y0WA 3H7IA 4O9MA 2NRZA 2HNYA 3MXJA 2OPPA 1HQEA 2BANA 3RMBA 4GV6A 4J9MA 2FDRA 3N97B 4YD2A 1ZBSA 2H3FA 2GLEA 4OJLA 1JKHA 4RQ7A 4H03B 4O5FA 4GC6A 2FPLA 3MBYA 3SR6A 4KLSA 1Z4NA 5D49A 1BCMA 4CJUA 2H3IA 4KLGA 3U8XA 3H3NO 4BE2A 4FZLA 1VQNN 2D0AA 3O4WA 3VQ8A 4CRXA 4NCBA 1RFQA 2CH5A 3RJFA 3OYKA 4M9JA 1IG8A 3TKAA 4ECSA 3CFOA 3CP8A 2F7TA 2QWRA 3ISCA 5ALEA 8ICTA 3C6TA 3SJJA 2VG6A 3AA4A 2VG5A 5ALJA 5J29A 2BCRA 2FXUA 3R8EA 3A2FA 1RDDA 4C0ZA 1LW0A 2ZJRL 1P7DA 3ZYYX 3NVKA 1XNQK 2UU9K 3SBTA 4CBWA 4KB1A 4BE1A 3K1ZA 2ATQA 4JUZA 2BKEA 2RP5A 4PHDA 2IDOA 4DU4A 4J9KA 4KLOA 4Y2UA 3ATUA 4E1MA 3D6RA 1HLUA 2BGWA 4CEOA 5CYMA 3QETA 1WCNA 3Q8RB 5C25A 5AQFA 2O8DB 4UAUA 4DL5A 5SZTA 5KFMA 1A0PA 4DSLA 4XQ8A 4PJ0U 1ZXIA 2BPFA 3AVFA 4M3TA 4IO9L 3UXPA 3V6JA 2H5XA 1KVAA 3OHBA 4IO8A 2XVTA 2NO5A 2G8WA 1S9GA 2EZXA 4JHDB 5F0XA 2XO7A 3E2EA 5FLXO 4FJMA 5DM7L 4KI6A 3LM9A 1MC8A 4QJFB 1VHXA 1YTUA 2PXIA 5J0TA 3PSTA 1NGBA 3H0MB 3KLHA 2HCFA 2Q1NA 3NMUA 1Z6RA 1K5OA 3EE9A 4FJHA 2KOBA 2A41A 4GV3A 1JL2A 1IH7A 4O55A 3VEVA 3NGIA 3RF9A 4FLVA 2LPEA 3A8YA 3ZEUA 4RQ4A 2EX3A 2DFFA 2OXOA 2KLAA 4KB0A 1JRPA 2BHNA 5EE0A 3HJFA 3RJEA 3UIQA 2VIXA 4LY7A 2HHUA 1TAUA 4UB5A 4KKOA 4Z4EA 3TTFA 4YQWA 2G0AA 4DF8A 4FZMA 3CETA 4CHNA 4F4XA 3QICA 1S1WA 1IO2A 1DK2A 5AM5A 1D4XA 2K8AA 1BG3A 2VCPA 2KJ9A 8ICGA 1ZBLA 4JB3A 3HI0A 5KQDA 5EE3A 2A42A 2ZTDA 5JUMA 4J9OA 3DLEA 2PI4A 3J80O 4FWKA 5HOOA 4KH6A 3VERA 1NGFA 4DV4K 1QVGM 5AKEA 1Y64A 3CJBA 5J2PA 1XC9A 4JD2B 3R3LA 2BCSA 2P9LA 2UYTA 2VANA 2ZIUB 2WTFA 2B6GA 1GLEG 1Z05A 3QEBZ 1K8KA 2E4LA 3VOVA 1SB3C 1VAZA 3M6GA 4O8KA 1Q9XA 1XQSC 1S9EA 2IHNA 4IFVA 2NRXA 4BRQA 3AN1A 1X1PA 4RNMA 4CF2A 4Q8EA 4O5BA 1Q8KA 1SV5A 2FPMA 4TQRA 2PAVA 2QB0B 5DDYA 1OKJA 4IS7A 4FJJA 1ATNA 2O8BB 3E1YA 2VJ4A 4NM1A 4E1NA 2PFNA 2NRWA 4JKDA 2E6LA 1B4FA 4E89A 4M04A 2HMIA 4M0AA 4KLJA 4NLGA 2KEYA 3FM9A 5KT2A 2ISPA 3LWLA 1YVUA 5HROA 4NYNA 2QKQA 3ZX3A 4MDAA 4OJ5A 4IEEA 9ICQA 4KHSA 2FLLA 5D3GA 3AVBA 3I0SA 2A1SA 2KIVA 4O0IA 2BUPA 3LM2A 3Q8LA 4GKJK 1ED1A 3CJ7A 1N63A 5J0RA 2E20A 5KFXA 4DSFA 1N2XA 2IBKA 4CFDA 5M1KA 4KLDA 8ICEA 2Z1GA 3OVNA 1F0MA 3B8AX 4QZCA 5KT4A 1GOAA 3CQYA 3ID8A 5BN8A 2BCUA 2RLTA 3KHLA 1WCLA 2MAXA 4C8LA 2IC3A 2PYJA 4FE3A 2GWJA 2WUSA 2DFLA 4M3YA 3C29A 5GADP 2QKKA 3PX0A 5IWAK 3MR5A 1HYVA 4J03A 4AHVA 1YTAA 3NRZA 4LSNA 3VA0A 1IIPA 4A8EA 5C0YA 3AO2A 4CEBA 4CZKA 4X66K 3J7ZO 4JK8A 4DQRA 5KFQA 4NJ8A 5LJVA 2ASPA 3CI5A 1HRHA 2K8BB 3TU5A 3ENOA 4BRAA 4PKIA 3WK7A 3OS1A 3VF4A 2WFAA 3LDSA 1QQCA 5AQUA 5CZ1A 5EWFA 3ETRA 2YNGA 3IG8A 3HPGA 1S8OA 2Q36A 4GXIA 3WNEA 1X3NA 3I55N 4F93B 4CESA 4X62K 3CJAA 5EE1A 5AI5A 5DB6A 1ZQWA 3BQ0A 1RZTA 4YMOA 5KG2A 1RTIA 4BQLA 3AVCA 4Q43A 2NRHA 3QUTA 1IBKK 2NV3A 4B9UA 4FK0A 4F50A 3BQ1A 2E8AA 3RSEA 1S9FA 2NRRA 3UMBA 5AQGA 1ZD5A 2O8DA 2P9UB 4GIBA 4EEKA 9ICTA 4CEQA 2OZMA 5HRNA 3VESA 2YB1A 3H45C 3WUHA 4BRIA 3J7YP 5KT6A 1ZQBA 2VWKA 3AY9A 2MRLA 3GIMA 1JMSA 3SJHA 4AYBF 2NYVA 3G6YA 2E8PA 3EKUA 1TVRA 2QW9A 1U04A 4JHDA 5DGAA 2ZUBA 4KHYA 5KNIA 1K1QA 1UOCA 1P90A 4UBBA 5ELZA 4JMUA 3HSCA 3EPGA 2FI1A 4RWTA 4QWDA 3D0PA 3V1QA 3VF2A 8ICKA 2A5XA 2W42A 2ZJ8A 5KRTA 2X6SA 5AZIB 4E1JA 1YZ7A 2JRZA 1K6YA 2YHBA 3BS5B 3U3GA 4K41A 3N28A 4UB1A 4CZGA 3BUZB 4MQ3A 4W5QA 3OW2M 3C6HA 2W9BB 2Q97A 4WFAL 5ADXH 5I3UA 2QARB 5ALRA 2PMZC 2YX8A 1U45A 1MSWD 1S1XA 1TAMA 3ISBA 2AGOA 3QERA 4BRNA 3C94A 1JALA 4E7KA 1ZQZA 4CGZA 3SUNA 3UXOA 5G5GA 3H6EA 4ECUA 3F2KA 4HTLA 2Z1HA 3M9MB 3BEXA 4B1YB 4OPJA 1NJWA 4DV5K 5JLHA 4F4WA 4RQNA 1TK8A 4DSJA 3VTIA 3CFRA 2UUAK 3CCQN 4PWDA 3V1RA 1K1SA 4XH4A 4FWRA 1TV9A 4AHUA 3AVLA 4N76A 2FSJA 3RMCA 2W8LA 1ZQUA 3FZFA 4DV7K 3PW2A 4M6WB 3VEOA 3PW4A 4KV8A 4WCEL 4IKFA 2LKYA 1QS4A 3ETLA 3AVAA 4YMMA 4JD2A 3I0RA 2K4EA 2ZIUA 4YFKA 2HHTA 3DXKB 2KD1A 3LPUA 2QWQA 3UPQA 2JEFA 4AH9A 3VGMA 1BO5O 1CRXA 2G8HA 2BE2A 3KLFA 3WT0A 5AKJA 2XIDA 9ICEA 3JPPA 1KXPA 2E2QA 3HWTA 4FJKA 4BWMA 4H5NA 3TANA 4YOTA 2QB0A 4KRFA 4CF5A 5A2QO 2ITMA 2O8BA 3R1XA 3DDHA 3PSPA 3RRHA 4HUGA 2KKVA 8ICMA 4FSVA 2HF4A 1ATSA 5AJ3K 3D6JA 2P51A 1S6PA 1V97A 4H5WA 2D4WA 1RCHA 2ZG6A 4F5PA 3FFKB 3M6KA 5L1IA 4KITB 1FKPA 1LVHA 2XCPA 3H8SA 2JV3A 1PVPA 2A1JA 2KHQA 4O3OA 4JS5A 1YI2N 5GINA 5AM3A 2E8NA 2HOFA 3L2QA 3RTVA 1TKDA 2DTUA 2FLPA 2R8IA 3QFPA 4JLHA 2K4PA 4ZHRA 3AA3A 1RBTA 3K2PA 2UUCK 1JUDA 4USAA 1KFSA 5IIIA 3RH5A 2HHQA 4EEYA 3H08A 1JLEA 4QZEA 8ICXA 4GY2B 2RDIA 2A3ZA 4CEEA 4KLMA 1C1AA 3OYAA 4I9QA 4WYBA 4CZMA 1BGXT 1HUZA 1U9LA 1IKYA 4QZFA 2KZZA 5CZ2A 4DV0K 4O3MA 2Y1JA 1MWMA 9ICXA 1ZRNA 2OZSA 4JK9A 2YNHA 4CGHA 3DLBA 3RB3A 5LL6Z 3V6KA 1Y97A 1KLMA 4E19A 1RDFA 2NO4A 1EP4A 1HJPA 5AI0A 2WHEA 4CJRA 1L5UA 2F2AB 2RQ5A 5EE9A 1ZQXA 4OKKA 4K25A 2E2PA 4CFCA 1RBRA 3DLRA 2RHKA 3KKSA 4JN4A 4CJFA 4BX9C 4JWMA 3KJVA 4EYHB 3C6UA 2UXDK 2D5RA 3O0FA 2ZIWA 2Y9UA 4CF3A 4DR7K 5KFRA 4EHUA 1GLJO 1SZPA 5CEHA 4AHRA 4Z4CA 5AI8A 3H4DA 2OYQA 1Z1VA 2BCQA 8ICAA 3F9KA 3G6EN 1WBBA 3ZX0A 1HNIA 2R8KA 4EAHD 4YVZA 3V7LA 2YKMA 2BPCA 2K8CB 3I76A 2JR5A 3OS0A 1QQ6A 3ZDCA 2QLTA 2P9UA 5LY3A 2CXYA 4IBNA 4UB4A 2B5JA 1GLLO 2W6LA 3NE6A 1JX4A 1XSPA 9ICCA 2C2DA 3A5OC 3QNOA 3AU6A 1VQ9N 4PHEA 3OGUA 4H0YB 3LVVA 2IVOA 1T44A 4CZHA 1WAJA 3HP9A 2GELA 4M7YA 9ICWA 3VGKA 5AFUA 5MLCQ 3C65A 1REVA 4QS9A 1HKCA 1F44A 4JI4K 4UY8O 5FPNA 5ADXA 1JIHA 4CE9A 1PK3A 5AZIA 3BS5A 2HHVA 2ZJAA 4O5CA 3KLEA 1CEZA 4FVUA 1V38A 3WKCA 3TFRA 3IAYA 2W9BA 4ECXA 2ZTEA 3PSFA 1RYSA 4FBTA 4NXZA 2PKEA 1BNPA 3H1QA 4RZRA 4AHCA 2QARA 4CJSA 4B3OA 2FE9A 1IV8A 5G5HA 3RB6A 5AQSA 3UQ2A 7ICPA 4F8RA 1PUZA 5ALOA 1U4BA 3ZT0A 1T3QA 5FRNA 4DQIA 3THXB 5DG8A 2JH7A 3NVMA 7ICUA 1OH5A 3VQ7A 4M2YA 1V4TA 2W04A 5KG1A 2I7PA 3AA2A 1WWVA 1UT5A 4YOUA 2H3ZA 4RU9A 3IKMA 1QE1A 5DQIA 2E2OA 4WFBL 2R8HA 4W5RA 5J2CA 3AM9A 5T14A 1N36K 4ID1A 1ZBFA 3EW9A 5L1JA 2PZSA 4M6WA 4IOXA 4BC5A 2P35A 5CWRA 3NTUA 2W41A 5HNKA 5BPMA 5KFLA 3DXKA 4FJ8A 2HDOA 5J0UA 2GBZA 4M9GA 4CGFA 3QEXA 4JKAA 2QI2A 5CHIA 5AK5A 4CHZA 3I8DA 4KHWA 5CR4A 4DR5K 4ED0A 5AI9A 4F2SA 3W0LA 3DMJA 2GV9A 2OWOA 2YKNA 4CF1A 2UXCK 2OM6A 5KFGA 3V7JA 1GLDG 4Q44A 3L5KA 1Q86O 2J6SA 4QZBA 4BR9A 2V52B 1JLQA 5FP0A 4K4IA 3AO5A 3ZETB 4DQQA 5KT5A 5IILA 2OTLN 1ZQRA 5EOZA 1A5WA 5DK5A 5J2NA 1NNEA 3S41A 4HCCA 4DKWA 2WAQC 2F3NA 3FAHA 3LP3A 4E7HA 2A1RA 3V9UA 2DF4B 5AK4A 5F1XA 4ECVA 3RH4A 4MEXA 4Q8FA 8ICHA 4F71A 1S1VA 2JGAA 5H1SQ 3KD1E 4AYBC 4UBCA 4FFDA 3CF5L 3LAKA 1BISA 2IS3A 5D4BA 4RPZA 3HP6A 5AQKA 3VQBA 4HAIA 4YOXA 1VSFA 4CGJA 5ALSA 5DQHA 2ASJA 5FDLA 3EZ5A 1XSNA 2VGMA 3MECA 1VQ6N 1XS9D 3PR4A 4DTPA 3QFUA 4KMUA 4HUEA 1QQNA 5DB8A 3HM9A 4KH4A 3L4QA 1J54A 4JS4A 2HBJA 4KH5A 4N5SA 2YMLA 1PVQA 2HBMA 4ILGB 4DL6A 2G8FA 4TUPA 5JS2A 1DTQA 1OXJA 2KW4A 3SMVA 1OH6A 4RQMA 1KSPA 2KZMA 4O3NA 3T5JA 4UQGA 3K5LA 3RMAA 5BRDA 2BQ3A 4QZAA 4RQ8A 4ED3A 2PI5A 3ZD8A 1BPBA 4ED2A 4CZEA 3EWAA 4W5TA 3K5NA 3O80A 4UB8U 4GFJA 1TL1A 4FCYA 3DLKA 3GIJA 3TPQA 2VQFK 3L6QA 4WE1A 3KOOA 3PW7A 4F4YA 5HHHA 1N5XA 2F8LA 4JV1A 2YNFA 3O5BA 1YVNA 3CERA 3QDKA 1J5EK 4AHTA 3ASMA 2G8UA 2XICA 3MDAA 3JXUA 5CJ7A 2I5JA 4KREA 3T19A 4X5VA 4KPYA 3NRWA 4JI5K 5AIBA 4C8NA 4PH5A 1ZETA 3H0LB 3TFSA 2FMPA 3AL0B 3HTVA 5L1MA 1TUUA 3RJIA 4QOZB 5EU7A 3GDXA 2EH9A 3ZT4A 2ASOA 4C4SA 4F5QA 3HKZF 2GH1A 3NFAA 2EANA 2BDPA 4BE0A 2F9WA 3CCEN 4DFJA 5EX5A 4CW7B 3RMDA 1S10A 3IDHA 1J6ZA 3OYCA 1HJOA 2G06A 4DFDA 2L5YA 1J53A 3AVJA 4MO5A 4DLGA 2E1FA 3WKAA 3GIIA 1WG8A 3AVGA 1K8KB 3U9DA 3HXMA 3ALRA 4F4ZA 4DCCA 4CJQA 4UW9A 2XGQA 8ICSA 3QXGA 3EY1A 1KAZA 1ASVA 3MN6A 4X65K 2X78A 1IG9A 1L7NA 3UKRB 4RUAA 5HP4A 4DV1K 2RRDA 4E7IA 4QCLA 3C0BA 1KRPA 3KBBA 3QU9A 4IL6U 1GLBG 4B3SK 3V1OA 2X6NA 1TVAA 3THXA 4OJPA 1TUYA 1C0GA 1WB9A 3C1ZA 4F72A 3E9OA 4BQZA 3WXIA 3CJ1A 4KLQA 3D7EO 4K42A 1WSHA 1EXQA 1YXQA 1MA9B 2P66A 5AICA 1ZOLA 5CE3A 4YR2A 1NZPA 4C80A 4BY9C 1XC3A 4CFAA 4NCGA 4UAWA 1A76A 4QS7A 1T6DA 2OH2A 2KFZA 4BRPA 4MLEA 3E0FA 4DS5A 1V9PA 4PKGA 1RDBA 4BR0A 2M0NA 2XI9A 3NHGA 5GAGP 4ED1A 4H0OA 4O8UA 3HO1A 1WYGA 4R64A 2EDUA 4FWPA 3RB0A 4C7ZA 2GO7A 2JXJA 2G8KA 2UVUA 4UARA 1A5VA 1W9HA 4DUYK 4MEYA 4CDGA 4IR1A 3SBGA 3UXNA 1COKA 4CGDA 5TKYA 3T5LA 5J2BA 3G25A 3N7RC 1BPXA 1ITGA 4MDBA 3C2LA 1ZQIA 2RDJA 1LV5A 1M90O 2W3SA 3T1AA 4CEAA 2Q3SA 5AKIA 1NMDA 2EWSA 3ZETA 4NLBA 3VQPA 1ZD2P 1LAVA 4BC2A 5L1KA 1T6CA 3FZKA 3OBYA 4FLZA 2UUBK 3MFIA 4KLHA 4NB4A 3O1BA 4WQ4A 3ORYA 3AV9A 3DWLA 1TK0A 3VQDA 2IOCA 5ALPA 5JU5A 1Z26A 2W8KA 4YMNA 4I6MA 3N4QA 4WQ5A 4EX6A 1N32K 4M3XA 4FLWA 3ENHA 5DLGA 4JKFA 2D0PA 1WOQA 1KCFA 2IVNA 2XC9A 4C4TA 1NK6A 2WF6A 4F5RA 1XO0A 4J2EA 3RAXA 2UXBK 1VSHA 3HK2A 1JN3A 3MN9A 3RSEB 2ODGA 3LDAA 3TADA 3OHAA 2B0CA 4P4PA 1KVCA 3HX0A 4YXMA 3K57A 3ZDEA 3KIOA 4F5OA 4PQUA 4YXJA 3T1YK 2KICA 3LAMA 5KT3A 3CRXA 4CGIA 1X9JA 1ZQCA 2HVHA 4GVEA 3G10A 1EWQA 4TURA 2KK0A 4MFCA 3C95A 1B0XA 2H3VA 7ICVA 1E4FT 1S76D 2AP1A 2OYYA 2XY7A 3FZLA 1ZBHA 5KFJA 3PVXA 1C20A 2I7NA 5SWMA 2G8VA 4EBCA 4JAXA 4UB2A 3HVTA 4OGEA 5I42A 1W2BM 3I1YA 3KLGA 1UT8A 3K59A 5AQOA 2PYLA 1XO1A 3J8AA 1RT1A 7ICTA 1D9FA 5H2FU 4J8FA 4JRQA 4FWQA 1M1KO 2IOHA 2YMQA 1VSDA 3MN5A 2YQEA 1WWUA 3NGZA 5JICA 3EZWA 1C0MA 3V72A 1A5XA 3EL2A 4Y1CA 2MA1A 2OCEA 5BR8K 2HHHK 3LVWA 4PL2A 3JPOA 1RT3A 2HMPA 1IXRA 1B9DA 3NH1A 2JMGA 2XHBA 3DEEA 5B5EU 1KKXA 3SZ2A 2QB1A 5C2DA 7ICGA 2HNDA 1SL1A 2R8JA 3THVA 3HT3A 3O4NA 1BOTO 3OY9A 1YT3A 5AQLA 4KI4A 3O6WA 4F9OA 3QU4A 5KFFA 2C22A 1BUPA 2WFBA 3FR0A 2D3DA 1XSLA 2F76X 2H3GX 3QMLA 3AEVA 1S72N 4I2HA 4BGAA 2YMPA 3AQEA 5KG7A 2XY5A 1QLNA 2ZWHA 1Z3EB 1EXNA 4W5NA 3NF7A 5KFOA 2B21A 1D5AA 4BWJA 2WBNA 3ZSYA 4BACA 5AKHA 1C1BA 3K9JA 4RTFD 1CZBA 3KTQA 9ICAA 3CHWA 1SKRA 1RG6A 1WSGA 4H5TA 3ZSOA 3MX2A 3DI6A 4J9PA 3ISDA 1ZQPA 9ICPA 1ZQ1C 2V51B 3TARA 4A2AA 3T1HK 3DLLL 1GLAG 1TFRA 5KFDA 3ID6A 3RR7A 4F4KA 4WQ4C 1DXSA 1UA1A 3UKRA 1BA0A 3U4LA 3NF8A 2W11A 2EZYA 3K4GA 1JI7A 8ICUA 1NLVA 4YR0A 3EEQA 3ZT2A 1Q46A 4Z4GA 4F91B 4WQ5C 1QQ5A 3JPRA 1KBUA 4DFPA 3SAFA 1BQNA 3L2RA 3GE1A 3Q7BA 1N60A 1JLCA 5HBMA 4JI0K 4TUSA 4GXKA 3F73A 3MDCA 5KPZA 3QLHA 1WNSA 4LF9K 3CFPA 1KFTA 1V4SA 4OCZA 3RAQA 4RW6A 2HMXA 2A1AA 4QW9A 5AQTA 3AUOA 1HPZA 4MLHA 4LH4A 5C15A 5JVHL 1D8YA 5C24A 3JYTA 2ZGYA 2A1JB 3TADC 4FYDA 3CCUN 3OYNA 3HM8A 1I39A 4DQ8A 1FFUA 1CZAN 1NKEA 2IA6A 1RT7A 4FWNA 3BQ2A 9ICHA 4KTWA 3TR8A 8ICRA 1GOCA 2RE2A 3T5HA 2AH5A 5DGBA 2J4RA 3MABA 2I9GA 5TKWA 2D0OA 3CW2C 1YJWN 4CJKA 1NOMA 7ICEA 5CYQA 4M63C 3G4SN 2ZJ5A 2O4GA 3SI6A 1QTMA 3SAGA 2E88A 2QWMA 3PUFA 3SUOA 3VF6A 2V4RA 2VG7A 4FW2A 3D2FB 5JMVA 5FPMA 2FF6A 3QIOA 2AQ0A 3AVMA 5KL8B 2AA4A 5KG6A 4FL9A 1LB2B 1CLQA 4EFHA 4DTJA 1G99A 4BRLA 3NF6A 4HWIA 2ZUDA 3SLCA 2E3TA 3VQ6A 4DV2K 4MO4A 4CJ3A 4HUFA 1ECWA 2P9SB 3LP0A 1T3VA 5HMMA 4IG0A 4B1UB 5ALMA 3O9TA 1VSIA 3HOSA 4DU1A 4I2GA 5ALTA 3RJKA 1FO4A 1BPDA 3DRSA 4XRHA 4FVMA 5T7BA 4FXDA 2ZIWB 5IIKA 3TSQA 5BR9A 3Q8MA 1IKWA 5B8HA 1FEZA 3O3FA 4AF1A 2OTJN 3LZJA 4P4MA 5JTIA 3V6HA 3N4MB 1B22A 1CZ9A 2VA3A 3HKZC 4ID5A 4JI6K 1NGDA 3HSTB 3SPZA 1SZHA 4US9A 4CF4A 4JEPA 4B1WB 8ICYA 3BDPA 2MUTB 3HPHA 4PL8A 4CJVA 2WAQF 4N41A 1T7PA 4LZDA 3AAQA 5CY4A 3IG5A 4NLCA 3KHHA 2DL0A 1S6QA 3OYGA 1COOA 2WOMA 3VENA 4DG1A 5GIOA 2BH1A 2F4VK 5J2IA 4TSXA 2F44A 4RW4A 3P4IA 2MU2A 4IFYA 4OJRA 4PGXA 4DL3A 4KHPK 2QEXN 2YHXA 3PW0A 4YOVA 2PFOA 4BXOB 4B9QA 2QWOA 4E7LA 3LYSA 5DBCA 4G9ZA 5IIMA 3TAPA 4I2QA 2B4JA 3QO9A 5KFHA 2YNIA 1AROP 4YP3A 5AFUH 1LWFA 4XEIA 4ZTJA 4IWVA 4K8XA 1N48A 5KFWA 4AP9A 5A0LA 4ZH4A 2W9MA 4CIFA 2P5GA 3FDSA 3N7PD 4CCHA 3DOLA 4FM2A 4DSKA 2W43A 2IHMA 8ICBA 2HF3A 3VQAA 3HZ6A 4DHYA 4JRPA 9ICSA 4DU3A 1T03A 2ZIXB 3CCLN 1S1UA 4KX5A 3V7KA 1L3TA 4YN4A 5KPRA 4FJIA 4L8RB 1HMVA 4P0PB 1T8EA 2F1JA 5CA7A 2EAPA 3L2UA 1VQLN 1L8LA 3SK3A 4M3UA 2H3QA 3CXCM 2PFPA 5K4LA 1B9FA 2D1KA 1L7OA 4J9NA 1TKXA 3HILA 5KL1B 3ED5A 3HOTA 1EQYA 4ED8A 3RRGA 1W97L 4NLZA 3GV8B 4WJ3B 3SQ2A 1OH8A 1QCKA 2JLEA 3L3UA 5J1EA 2FBVA 1HPMA 5AQIA 4Z6FA 4U67L 4DUZK 1ILYA 2ZM6K 5J2GA 3CCSN 3FC4A 1L3UA 3W3DA 4DSEA 3VEXA 4UAVA 5AM2A 2J6TA 1S77D 1ZQKA 1RT5A 1SZ2A 2D0BA 4Z4HA 4DFMA 4QWBA 3PMNA 3AQFA 3QZ8A 4OO1J 2RF2A 1C0TA 2E5SA 4FJLA 3WNHA 5KG0A 3DRPA 2EQYA 1NM1A 4FM1A 4GV9A 4IDHA 4JI3K 3IV6A 3VTHA 2CN1A 4BRMA 4B3TK 2W54A 2LSNA 1UPHA 4Y2JA 4DR6K 4YDUA 3RH6A 3CC7N 3D2EB 1MN8A 1S5JA 7ICNA 5GIPA 2K4IA 3NH0A 1BIZA 1VK0A 1TYQB 4DQPA 3E01A 4CI6A 3T3FA 4B3MK 3L4PA 4GMJB 2ITGA 4RQ0A 3QX7A 5BPNA 1VSKA 4HYKA 3LWMA 1NZBA 4J2DA 5IT9O 9ICJA 4KN7A 4UB3A 4DB3A 2EHGA 3G0ZA 5HRRA 4F3OA 4C1NK 4V19S 4E3SA 2KP7A 1HNVA 2W55A 1MQ2A 2HSTA 3LL3A 4FWSA 4M9NA 2KIWA 3I8BA 3QU7A 5LJWA 5ALUA 3F53A 3NASA 5J2KA 3QB0A 3D2FA 3VQ5A 3KK3A 4DV6K 1NMNA 1KC8O 5KFZA 3MDQA 4PHTX 3TABA 4JV5K 2O6KA 1PZNA 5J0WA 2X74A 3K9KA 1NGCA 1J2MA 2NUBA 1YHQN 4CK1A 3IN5A 1RPLA 3MR2A 4GC7A 3IS9A 1WSIA 3C2KA 4RPYA 1E3MA 1PK1B 1L3VA 2P9SA 5J0XA 1OW5A 2Q0RA 3DYAA 4DOCA 3I33A 4PA1A 5KFVA 4UAZA 2UVRA 4QS8A 1RT4A 3B6PA 2QM1A 1N6QA 8ICNA 2KKZA 4BVPA 1UHUA 2GWKA 3RJGA 4IQUA 4GLXA 3MEEA 3PO5A 4J9LA 5F9NA 3R9KA 8ICPA 2FSKA 3AA5X 4FLUA 5FRMA 3A0HU 2G07A 2KQ2A 2ZF5O 2MUTA 1NOZA 1QZ6A 3BQ7A 3AO1A 3O9RA 4ECZA 3E66A 3F2DA 5J2QA 1HUXA 3VETA 2Z1JA 2ZD1A 1IG6A 3H40A 4KO0A 1VSEA 2EZZA 3O9QA 1X66A 5DLFA 1ZBUA 3FYHA 1V85A 4HTUA 1BQMA 4FJ5A 2C2RA 2R7YA 8ICJA 1X9XA 4BXOA 1LKYB 1NGHA 1FK9A 2P6UA 9ICBA 4JKGB 3SV4A 2HNZA 4ED6A 2PBDA 2JWKA 8ICQA 3QNMA 5DB7A 3QYPA 4RUCA 1KVBA 3H4BA 3M7DA 2F1IA 2P1JA 1TL3A 3T79A 5J2AA 1XI1A 1ATRA 2W40A 3EO3A 3VQ4A 4ZOHC 2WF8A 1OH7A 3AVIA 3CD6N 1VSJA 1U6ZA 3M8RA 3MR3A 3KFUF 1EETA 1QZ5A 4FZXC 4RQ3A 3M1FA 5GAHP 1K8AO 5ALZA 2YMMA 2J6UA 5AM1A 5HRPA 4YDUC 3C2MA 4M3WA 3KK7A 3ATVA 2ZIXA 3V9ZA 8ICOA 4A2BA 2RHFA 5KAFU 3CCMN 2R8GA 8ICLA 1ZYQA 4Z4IA 5K14A 2A6AA 2KJ8A 4P0PA 3RBEA 4RNOA 5M1OA 4J2AA 2W9AA 1J5OA 4IJAA 2ZQBA 2M9NA 3L8BA 4KMOB 3ZI4A 4GNIA 3M9NB 3SCXA 3M9OB 3ZSZA 2HSZA 1YAGA 2YTUA 1BDGA 3GL1A 4P0QB 3R9PA 3EYZA 5AM4A 5C10A 5LMNK 4FS1A 2DUYA 1NKCA 1JXBA 1EO1A 1HYZA 1HJRA 4G9BA 3K5MA 1IBLK 5AKZA 4OJOA 3SAHA 3UQ0A 1NK4A 3E58A 2A19A 2JZBB 3OPXA 4CZFA 5EOYA 4IRCA 4L3QA 4NLNA 3WQTA 1S0OA 2DBYA 1RTDA 2AHOB 3U6FA 3TTCA 1KFDA 3K0SA 4ELTA 3ZSWA 4FZYA 3AU2A 1F5SA 3MCPA 4LF4K 4DO9A 3K1RB 4DTMA 3OYEA 1Q7YO 5JS1A 1G15A 4OKEA 1ZQYA 3GILA 4IQTA 3J81O 4BDZA 2BCVA 1N34K 3V81A 1FW6A 2LM1A 1UA0A 3HRDD 3WXJA 5KFNA 2DPJA 5CP2A 4EP5A 4CD1A 1S0VA 4EBEA 3PSIA 3ZDDA 3BJYA 4Y2RA 4DL2A 1DTTA 2HVIA 2HB5A 5KFSA 3MFHA 3D2EA 5J2DA 1ZQHA 4I6MB 4B6JA 5B66U 3IMXA 1QHAA 3WKDA 5C12A 4IEIA 1TYQA 2Q4TA 4U7CA 1NK5A 4M47A 1RDAA 5BRFA 3WXLA 4IXCA 4DOAA 5KFAA 3QBWA 4WFNL 5FROA 4CERA 3H8MA 3CCVN 1JXEA 3WK8A 2GUPA 4KFBA 5AQXA 2BDUA 2Y9TA 3AVKA 3FZHA 7ICSA 4QAGA 4R63A 1TKZA 3P5JA 3MXIA 2D0CA 2YJEA 2QKBA 4IQVA 4CD3A 3IHQB 3V9WA 3VCBA 4BRCA 3OYHA 3D2QA 5KFYA 5HMLA 3I28A 1IKXA 1YUWA 4H0XB 3CQXA 3OSPA 5HLFA 4QWCA 3G6XA 3ULEB 3OYBA 2O8FB 3OS2A 9ICKA 2IVPA 3DRRA 3DXMB 1N5YA 1BWFO 1RT6A 4FJ7A 3KZBA 5AQZA 2BQUA 2FBTA 2GX9A 5BN9A 1HNZK 4YR3A 1PK1A 2E5LK 2GTDA 3C21A 4O5KA 2JWLA 2DQNB 3UMGA 3O9UA 2F77X 4R79A 4CK3A 2ZGZA 3KHRA 5ALQA 2JHDA 3QESA 5CHGA 4B3RK 4DWIA 3OJSA 1IBMK 2WONA 2LM4A 2ZXHA 3AO4A 3LALA 1T94A 1NK8A 2LI6A 3S9HA 1GLCG 2E8OA 1NGJA 4ICLA 4P2HA 5AQJA 5GTHU 3D45A 3B6OA 1JLFA 2VKQA 4KLIA 3KHYA 1VQ7N 4K8ZA 4R65A 4M9HA 3CYMA 4BGBA 5HRSA 4XUSA 2G5HB 3AGRA 1Q81O 4PZNA 1WLJA 2CPRA 1TE2A 5ALVA 2ZJPL 1WAFA 4B8CA 2MSNA 3SYZA 3RBDA 2P9NA 1L6NA 2VYPA 3GU3A 4ECTA 2O8EB 4Q0BA 1DRGA 1NJIO 1IKVA 5KFKA 3G6VA 1VSLA 1LKYA 3MGVA 3GIKA 4FO6A 3EKSA 4BRGA 4O0JA 4JKGA 1ZD4A 1Q3UA 3BF1A 5AQWA 1S97A 3GDQA 5DDMA 3THWB 4U7BA 4BRKA 3Q8PB 3BP8A 3Q8KA 1HQUA 1SWWA 3SD7A 3EPIA 4PPXA 1Z00B 4HHTA 1KTQA 3UB5A 4C23A 4DR1K 3L2WA 3SQ4A 3EUB2 5ALWA 1U2VB 2XCAA 1KL9A 1DGSA 3OSNA 2KFNA 1BVSA 3ISNC 4C1NI 3L2VA 4DSIA 1PVRA 5ALLA 3JPNA 4XH1A 1ZQDA 2Y0SF 4EHTA 2Q31A 2OPSA 1I94K 3T69A 2D6FC 4A5BA 4DF4A 1S5LU 4M42A 3MK6A 1LW2A 1NU0A 3CC4N 1BI4B 5M1FA 1Q18A 1KDHA 4MF2A 4KLLA 3D2NA 2AU0A 1RYRA 4B9MA 1Q8IA 1RTJA 3ZCMA 4XH5A 4YORA 4QZ8A 4CF9A 3MR6A 4R8UB 3RR8A 4NO7A 3WXMB 4XIUA 4B9NA 3T5KA 1C7YA 3SUQA 3MEGA 3SQ0A 4P0QA 4ECWA 3AAPA 1S22A 3T7ZA 3ZLJA 3TAQA 1Q3VA 1LAWA 5KFBA 3C5FA 3IM1A 3ZDAA 1XHXA 4BRHA 4FZZA 2BGGA 2XY6A 4DMNA 4NCAA 1T4GA 2N1RA 9ICUA 3KVGA 2JZBA 5AKXA 2UVVA 4CF0A 5L1LA 4I2IA 1NGGA 1RXVA 3MN7A 5AQVA 4CIGA 3ULDA 1GO3F 2NRVA 3ZT3A 3JS6A 4FLXA 3WQUA 3IRXA 4R66A 3QIPA 1RT2A 1IJJA 1KEJA 2HI0A 4LF5K 1RBSA 3EE8A 5KG5A 4DTNA 5GTIU 2QWPA 1RBUA 3LDOA 4EYIB 3H0RB 4O44A 7ICKA 2YX6A 1RM6C 4M41A 4M3ZA 3QBXA 4FJGA 3O8MA 1VJ5A 3L3FX 4NYFA 2DWQA 4MHVA 4JKBA 3H8WA 4ELVA 1LOTB 3KLIA 5EWGA 2Q0UA 1HIWA 2HHSA 4BROA 1K9MO 5J0QA 3S3NA 1QSLA 1WSFA 4A57A 4G3IA 1B43A 4YHHK 1C0FA 2ETJA 4DL4A 3LP1A 3OYFA 3B0YA 4DOBA 3A5NC 5C2FA 1VQKN 3N4PA 2JEJA 4F2RA 4I2AA 4IQWA 4CJ4A 7ICIA 5LMUK 5HR6A 4AQYK 4ISFA 1URJA 4LJXA 1BPZA 1HX1A 4ILJA 3RFAA 5AQMA 4CEZA 4LC9B 2D8CA 1MA7A 4CFBA 2LHTA 5AK3A 3KD5E 4GXJA 1GLFO 4BR5A 1JL1A 4TQSA 3AARA 4GW6A 4A59A 4OGCA 3O3GA 1NK9A 4EIAA 4B9LA 2HBKA 4EBDA 3U3YA 2V7ZA 2OHFA 1U48A 1TV6A 2O8FA 3ULEA 4DCHA 2WF9A 1D8LA 5AQHA 4QW8A 3DXMA 4FWOA 3CMEN 3BS7A 1WUAA 1RQNA 1U47A 2QXFA 2AQ4A 3C6AA 4FW1A 4O5EA 3SV3A 1XMQK 3MWTA 4CGGA 3HL8A 2KHOA 2FLOA 3LDLA 3I56N 1ZD3A 2ZTCA 1WBDA 2FSNA 1HKBA 1L8OA 1QH9A 1S3XA 1XHZA 2VWJA 1T05A 2O4IA 3KHGA 3CC2N 2KJ5A 1DEJA 4CVNE 4CHYA 9ICFA 1X6IA 1TK5A 2C28A 3AVNA 4QZHA 4RQ1A 1XMOK 4BG9A 2ATLA 2P9KB 3V6DA 3QZ7A 5F3XB 3AVHA 4BC4A 1SV4A 4J9RA 1KD1O 2A3VA 2YHYA 1KLNA 4US8A 3ALYA 1ZRMA 1QHTA 3GFKB 5EY4A 5AI4A 4LF6K 1YF5L 2KVCA 2W6KA 5M1QA 4RNNA 2DPNA 1KQQA 3VEYA 2FMSA 3P31A 1VQ5N 3QNNA 3LP2A 3TAGA 2ZIVB 8ICCA 1RXWA 5J2EA 4I9LA 2O8EA 2HOQA 1JCFA 3O9SA 1FKOA 3VC8A 4RQ5A 2OEHA 2XRIA 4PL1A 2ASMA 4EENA 3PY8A 4QIWC 1NWKA 4M3RA 3SMPA 4OLBA 2B6AA 2K89A 4CBUA 4ECYA 1WN7A 3KZIU 4ILHA 4CE6A 1TGOA 2QWNA 1NJZA 4CJTA 4QZ9A 1ZQGA 3LK9A 3THWA 3SENA 4EX7A 1Z00A 2WF5A 2DFHA 5KQ8A 2K60A 2F1HA 2FBYA 3DLGA 1MQ3A 1U2VA 3KWGA 4AM6A 5IIJA 1GOBA 3AGKA 3C7NB 4H4OA 2ASDA 1ZQEA 5KI6A 5GAEP 2KNJA 3FGUA 3BGRA 1VQ4N 4FLTA 1ZQAA 3IRUA 4DQSA 5D46A 4I2BA 4C8MA 3S6JA 5F2RA 2FPKA 5KFTA 2XGPA 4JI2K 1BI4A 1M6YA 2LYAA 4CJ5A 5ALHA 2ZJQL 3M3ZA 4IJNA 1RYUA 4RT2A 2IGIA 4R8UA 4M9LA 4AM7A 2IOFK 2KHVA 1Z1BA 2AJQA 2DY4A 3B9JA 4J9SA 5HR7A 2DGZA 4PHAA 5E41A 4B9SA 2P9IB 4IOCL 1Q82O 1JCGA 1L3SA 4OVLA 5JVGL 5KFUA 3CM5A 1ZJNA 3PNCA 4KX3A 1ZQNA 2FBXA 5KFIA 3QUQA 2KVSA 1RQLA 4I2DA 1LWEA 2YCHA 1NJYA 4F3TA 1CI4A 1MU2A 3GV5B 3B0XA 1C1CA 3NBPA 3SI8A 1NG9A 4KBOA 1N5WA 2W3RA 1BPYA 4P4OA 3RJJA 4BR2A 4IOAL 2JEGA 3CM6A 3VQEA 4PHPA 3O3HA 5HP1A 2LMRA 4KLUA 3NVWA 3J81j 5DBAA 2QA4N 3MC1A 4Z6DA 4NL9A 5IINA 4I2CA 5J0OA 3OTQA 4FZNA 3LZIA 1R0AA 5BOMA 1XU4A 4I7FA 4PL7A 1NNLA 3TAEA 1X2IA 3QEPA 5J2FA 5BREA 5DG9A 2IMWP 4O3RA 4A62A 2ISOA 4A61A 4CHPA 3SQIA 2IIRA 1SV0A 5AK6A 4IC9A 1JROA 2Z7JA 4RW7A 1NGEA 5M1PA 2VJ5A 4CZIA 4BRDA 3CQ8A 4BR4A 1O1WA 5BPLA 5EVZA 1ZJMA 5J2JA 5AQNA 4AHSA 2WF7A 5KGWA 1X9MA 1XWLA 5KPTA 3PIPL 4K0KK 1NKBA 4FLYA 4RW9A 5L9XA 3TACB 4KHNA 5BRHA 1BL3A 4ED7A 4LD0A 2KG5A 4JV2A 1J2NA 5FPDA 1ZQFA 1SXDA 4UASA 3OA9A 5EXWA 4FM0A 3F5TA 4LFCK 3NS1A 1VQ8N 2JH1A 4BVOA 3AO3A 3J7AP 2K4HA 2VA8A 3GV7B 1DGJA 4H4MA 4M7XA 3OYMA 1HR0K 3EN9A 4YNQA 3MCAB 1N61A 1CXUA 4EZ9A 1P8ZA 5DM6L 2G08A 3V9SA 3HVRA 5KG3A 3VQCA 1VSMA 3OTOK 5J2HA 5J2MA 4CIEA 1N8RO 2WB1F 3M5RA 2Y0SC 3CPEA 1O08A 4KLTA 5AZJB 1BU6O 3DOKA 4RCHA 5TZVA 4CEDA 4O3QA 3QU2A 4JWNA 1DLOA 1ZC6A 1ZQQA 4ZTFA 1J9AA 7ICLA 1IM4A 2P6RA 5AI6A 4JK1A 4W5OA 3IP4B 1LCUA 2XY8A 4M45A 3ZSQA 2AXTU 5J8YA 7ICHA 4ECRA 4FJ9A 1X42A 3ZT1A 2KV2A 4B8AB 4Z94A 3H46O 5AM0A 4GVMA 1FXXA 3PMLA 4FS2A 2KKPA 3OHRA 3ENBA 5C42A 2P9KA 4QWEA 4O3PA 4I2JA 4DL7A 4I27A 2NNWA 2OPRA 3CIPA 4H5RA 3VQ9A 5AIAA 1OVQA 4H0TB 5AKKA 2KN7A 3WNGA 3A5LC 4I2PA 4OPAA 4LF7K 2KSOB 4PY5A 3P39A 2CGLA 3WXKA 4UAYA 5DG7A 3C5GA 3VMFB 2FMQA 4JKHA 3HW8A 5KT7A 2ZIVA 1RDWX 4CJPA 9ICNA 3VEWA 1VQMN 5KFEA 5ALFA 3OYIA 3M6ZA 2G8IA 1J97A 1Z4OA 4B9TA 4IRDA 1N56A 1BIUA 3JAMO 1BCOA 3KK1A 4LFBK 3Q8SB 5ALIA 2OPQA 4YOYA 2RKIA 2ESEA 1QVFM 4DR2K 2V9WA 4NL9C 1NK7A 1N62A 1B92A 4DTRA 3K75D 3VA3A 2AGQA 2AGPA 8ICFA 3HYFA 1W0HA 3PX4A 1ASWA 5AKYA 3M8QA 4DR3K 3C7NA 3O08A 1C6VA 1XNSA 3TTDA 3MAQA 2QK9A 1SV0C 3DM2A 3SNNA 1RGIA 4BR7A 3ITHA 4DTUA 4KHUA 2A40A 2F9TA 1ASUA 5DB9A
chains in the Genus database with same CATH topology
2HW3A 1RNHA 2FC0A 3QINA 4QNLA 2W03A 4N47A 4CK2A 2W7PA 1HEKA 3ZSRA 4Y1DA 3DLHA 3TI0A 3TAFA 2GOLA 4PUOA 3MEDA 1X9SA 3IG1A 3K5OA 2GUIA 4OJ6A 3QEWA 4Q5VA 1LWCA 4CEFA 2R18A 1BHLA 4DFKA 1VRTA 2PY5A 3M8PA 3OYJA 3K58A 4C8OA 1EKEA 2Y1IA 3M8SA 4NWIA 4FJXA 2HHXA 2HOIA 1JLAA 2LYBA 3N7SC 3GZFA 2YHAA 3FFIA 4C8KA 4ACOA 3OYDA 2E1EA 2W7OA 2HHWA 4DTOA 3NF9A 3SUPA 4YFUA 3V9XA 3C28A 2OA8A 4CF8A 3SQ1A 1UWBA 2F8SA 4AILC 4B08A 2ZXIA 3TAMA 3D2SA 4HVJA 4BUGA 1SUQA 3O4QA 4KHQA 1RDCA 4CHOA 4J2BA 1F21A 3PZPA 1UAXA 4FJNA 4H8KA 4BDPA 3CG7A 3PX6A 5KTQA 3NUQA 3ONNA 1NK0A 3QEIA 3RWUA 4KTZA 2E6MA 3KKRA 5KGXA 1JLBA 3HPOA 3KK2A 3VN5A 1JLGA 4IDKA 3L3VA 3P1GA 4IG3A 5CRXA 3S3MA 3ZSXA 4MFBA 4CJLA 3V4IA 4B9VA 1QSSA 3WNFA 2G5IB 1HYSA 4QIWF 1RILA 4CHQA 4DS4A 4G1QA 3NDKA 3S3OA 4LSLA 3SPYA 4DTSA 3PV8A 4O4GA 1VRUA 1WSEA 4ELUA 2HBLA 1A6SA 4EP4A 1NJXA 2RPIA 4RW8A 2WB1C 1OUQA 1WSJA 4CJEA 2YB4A 1NOYA 5DMRA 4NV0A 1QSYA 2DFEA 1X9WA 2P5OA 1C0UA 3NGYA 2LBOA 3F5EA 1SKWA 3NAEA 3VQQA 2ZE2A 3MXMA 4HCBA 4DTXA 4N56A 3PO4A 4EZ6A 1RTHA 4E0DA 1ZBIA 4LH5A 1SL0A 4E7JA 1SKSA 4OLAA 4BJQA 1D9DA 4U6PA 2F96A 1CXQA 4FK4A 1TKTA 3KZXA 4KTQA 2Z1IA 1WUDA 3F5AA 4Z4FA 4RG8A 4FK2A 3NH2A 4DLEA 3F2CA 4KAZA 1D8BA 3P83D 4CECA 2JGUA 1U49A 1RBVA 1Z25A 1S1TA 2KTQA 4OKJA 5KRSA 4BDYA 3TWHA 1EX4A 3NCIA 4ICAA 3LPTA 2RN2A 2F8TA 1I3AA 2G09A 4CJWA 3LANA 1Z19A 4Z0UA 4R5PA 2CRXA 3JSMA 1TAQA 3F2BA 3QEVA 3OJUA 2PMZF 2IAJA 3OYLA 1SL2A 3ICXA 4OPKA 3ZSVA 1Q9YA 2HNYA 3MXJA 2OPPA 1HQEA 2BANA 3RMBA 2H3FA 4OJLA 1JKHA 1BCMA 4CJUA 2H3IA 4BE2A 4FZLA 2D0AA 3VQ8A 4NCBA 4CRXA 3OYKA 3CFOA 3CP8A 3SJJA 3C6TA 2VG6A 3AA4A 2VG5A 3A2FA 1RDDA 4C0ZA 1LW0A 1P7DA 4KB1A 4BE1A 3K1ZA 2ATQA 2RP5A 2IDOA 4DU4A 4E1MA 4CEOA 3QETA 5CYMA 5C25A 5SZTA 1A0PA 4DSLA 3AVFA 4M3TA 1KVAA 2XVTA 2G8WA 1S9GA 4FJMA 2XO7A 4KI6A 4QJFB 1YTUA 3PSTA 3H0MB 3KLHA 4FJHA 2KOBA 1JL2A 1IH7A 4O55A 3NGIA 3RF9A 4FLVA 2EX3A 2DFFA 2OXOA 4KB0A 3HJFA 3UIQA 2VIXA 4LY7A 2HHUA 1TAUA 4KKOA 4Z4EA 2G0AA 4DF8A 4FZMA 4CHNA 1S1WA 1IO2A 2K8AA 2KJ9A 1ZBLA 3DLEA 5J2PA 1XC9A 3L3UA 3CQ8A 2ZIUB 2E4LA 1Q9XA 1S9EA 4IFVA 1X1PA 4CF2A 4O5BA 1SV5A 4FJJA 4E1NA 2VJ4A 2E6LA 4E89A 2HMIA 2KEYA 1YVUA 3LWLA 5HROA 4NYNA 4KHSA 4OJ5A 5D3GA 3AVBA 3I0SA 2A1SA 4O0IA 1ED1A 4DSFA 4CFDA 3OVNA 2Z1GA 1GOAA 2IC3A 4C8LA 2PYJA 4FE3A 4M3YA 3C29A 2QKKA 3PX0A 1HYVA 4AHVA 1YTAA 4LSNA 1IIPA 4A8EA 5C0YA 3AO2A 4CEBA 4DQRA 1HRHA 2K8BB 3OS1A 3LDSA 1QQCA 5CZ1A 2YNGA 3IG8A 3HPGA 3WNEA 4CESA 1RTIA 3AVCA 2NV3A 4B9UA 4FK0A 2OZMA 4CEQA 5HRNA 2YB1A 2VWKA 2MRLA 4AYBF 1TVRA 1U04A 4KHYA 1UOCA 4JMUA 3D0PA 3V1QA 2W42A 5KRTA 2X6SA 1K6YA 3U3GA 2YHBA 4W5QA 4MQ3A 5I3UA 2YX8A 2PMZC 1U45A 1S1XA 1TAMA 3QERA 3C94A 4E7KA 4CGZA 3SUNA 2Z1HA 4OPJA 1NJWA 4PWDA 3CFRA 1TK8A 4DSJA 3V1RA 4AHUA 3AVLA 4N76A 3RMCA 4KV8A 4IKFA 2LKYA 1QS4A 3AVAA 3I0RA 2K4EA 2ZIUA 2HHTA 2KD1A 3LPUA 4AH9A 1CRXA 2G8HA 2BE2A 3KLFA 2XIDA 4FJKA 4BWMA 3TANA 4KRFA 3PSPA 4HUGA 3RRHA 2KKVA 2P51A 1S6PA 1RCHA 2ZG6A 3M6KA 1FKPA 1PVPA 4JS5A 2KHQA 2HOFA 3L2QA 3RTVA 1TKDA 2DTUA 4JLHA 4ZHRA 3AA3A 1RBTA 3K2PA 1KFSA 2HHQA 3H08A 1JLEA 4CEEA 1C1AA 3OYAA 4I9QA 1BGXT 1IKYA 2KZZA 5CZ2A 4O3MA 2Y1JA 2OZSA 2YNHA 4CGHA 3DLBA 1Y97A 1KLMA 4E19A 1EP4A 4CJRA 1L5UA 2F2AB 4OKKA 4CJFA 4CFCA 1RBRA 3DLRA 3KJVA 3KKSA 3VA0A 4BX9C 3C6UA 2D5RA 3O0FA 2ZIWA 4AHRA 4Z4CA 2OYQA 3F9KA 1HNIA 2YKMA 2K8CB 3OS0A 4IBNA 2B5JA 3NE6A 3QNOA 3LVVA 1WAJA 3HP9A 1REVA 1F44A 4CE9A 2HHVA 3KLEA 3IAYA 3PSFA 4AHCA 4CJSA 4B3OA 4F8RA 1U4BA 3ZT0A 5FRNA 4DQIA 2JH7A 3VQ7A 2W04A 3AA2A 2H3ZA 1QE1A 4W5RA 5T14A 4ID1A 1ZBFA 2PZSA 4FJ8A 2GBZA 4CGFA 3QEXA 4CHZA 3I8DA 4KHWA 4F2SA 3DMJA 2GV9A 2YKNA 4CF1A 2OM6A 1JLQA 3AO5A 4DQQA 1A5WA 5DK5A 5J2NA 4HCCA 2WAQC 3LP3A 4E7HA 2A1RA 3V9UA 2DF4B 1S1VA 2JGAA 3KD1E 4AYBC 3LAKA 1BISA 2IS3A 3HP6A 3VQBA 1VSFA 4CGJA 5FDLA 3EZ5A 3MECA 4DTPA 4HUEA 3HM9A 1J54A 4JS4A 2HBJA 4N5SA 1PVQA 2HBMA 2G8FA 5JS2A 1DTQA 2KW4A 3SMVA 2KZMA 1KSPA 3K5LA 4UQGA 3RMAA 4W5TA 3K5NA 4GFJA 1TL1A 4FCYA 3DLKA 4WE1A 2F8LA 2YNFA 4AHTA 3ASMA 2G8UA 2XICA 2I5JA 4KREA 3T19A 4KPYA 3NRWA 4C8NA 3AL0B 3H0LB 4QOZB 5EU7A 3ZT4A 3HKZF 2GH1A 3NFAA 2BDPA 4BE0A 4DFJA 3RMDA 3OYCA 2G06A 3AVJA 1J53A 4DLGA 2E1FA 3AVGA 3HXMA 3ALRA 4CJQA 3EY1A 1ASVA 2X78A 1IG9A 2RRDA 4E7IA 4QCLA 1KRPA 3V1OA 2X6NA 4OJPA 1WSHA 1EXQA 4CFAA 4NCGA 2OH2A 2KFZA 3E0FA 4DS5A 1RDBA 2M0NA 2XI9A 3NHGA 3HO1A 2G8KA 1W9HA 1A5VA 4CDGA 4CGDA 3N7RC 1ITGA 1LV5A 3T1AA 4CEAA 2Q3SA 4NLBA 3VQPA 1LAVA 4FLZA 3AV9A 1TK0A 3VQDA 2IOCA 1Z26A 4M3XA 4FLWA 1KCFA 1NK6A 4J2EA 1XO0A 1VSHA 3HK2A 1KVCA 3K57A 3KIOA 4PQUA 2KICA 3LAMA 3CRXA 4CGIA 2HVHA 3G10A 3C95A 2H3VA 2OYYA 2XY7A 1ZBHA 5SWMA 2G8VA 3HVTA 4OGEA 5I42A 3KLGA 3K59A 2PYLA 4JRQA 1RT1A 1D9FA 1VSDA 3NGZA 1C0MA 1A5XA 4Y1CA 2MA1A 3LVWA 4PL2A 1RT3A 2XHBA 1B9DA 3NH1A 2JMGA 3DEEA 3SZ2A 2HNDA 1SL1A 3O4NA 3HT3A 3THVA 3OY9A 1YT3A 4KI4A 2F76X 3AQEA 2XY5A 4W5NA 3NF7A 1D5AA 4BWJA 3ZSYA 4BACA 1C1BA 1CZBA 3KTQA 1WSGA 1SKRA 3ZSOA 3DI6A 1ZQ1C 3TARA 3RR7A 4F4KA 1UA1A 3NF8A 3ZT2A 4Z4GA 1KBUA 4DFPA 3SAFA 1BQNA 3L2RA 5HBMA 1JLCA 3F73A 3QLHA 1WNSA 3CFPA 4RW6A 2HMXA 1HPZA 4LH4A 5C24A 1D8YA 3JYTA 4FYDA 3OYNA 1I39A 3TR8A 1NKEA 1RT7A 4KTWA 1GOCA 4CJKA 5CYQA 2O4GA 3SI6A 1QTMA 3SAGA 3PUFA 3SUOA 2VG7A 4FW2A 3QIOA 3AVMA 5KL8B 1CLQA 4DTJA 3NF6A 3VQ6A 4CJ3A 4HUFA 1ECWA 3LP0A 4IG0A 1VSIA 4DU1A 4FXDA 3DRSA 4FVMA 5T7BA 2ZIWB 1IKWA 3O3FA 3LZJA 1CZ9A 4ID5A 3HKZC 3HSTB 1SZHA 3BDPA 3HPHA 4CJVA 2WAQF 4N41A 1T7PA 5CY4A 4NLCA 3IG5A 1S6QA 3OYGA 2WOMA 4DG1A 4TSXA 4RW4A 4OJRA 4IFYA 4E7LA 3LYSA 3TAPA 4I2QA 2B4JA 3QO9A 2YNIA 1LWFA 4ZTJA 4K8XA 5A0LA 4CIFA 2P5GA 3N7PD 4CCHA 3DOLA 4FM2A 4DSKA 3VQAA 4JRPA 4DU3A 1T03A 2ZIXB 1S1UA 4KX5A 1L3TA 4FJIA 4L8RB 1HMVA 4P0PB 1T8EA 3L2UA 4M3UA 2H3QA 1B9FA 1TKXA 5KL1B 3RRGA 4WJ3B 3SQ2A 2JLEA 5J1EA 2FBVA 1L3UA 4DSEA 1RT5A 2D0BA 4Z4HA 4DFMA 3AQFA 4OO1J 2RF2A 1C0TA 2E5SA 4FJLA 3WNHA 3DRPA 4FM1A 2CN1A 2LSNA 1UPHA 1S5JA 2K4IA 3NH0A 1BIZA 1VK0A 4DQPA 3E01A 3T3FA 4GMJB 2ITGA 1VSKA 4J2DA 1NZBA 3LWMA 1ASUA 2EHGA 3G0ZA 5HRRA 4F3OA 4E3SA 1HNVA 2KIWA 3F53A 3VQ5A 3KK3A 3TABA 2X74A 2NUBA 4CK1A 3IN5A 3IS9A 1WSIA 1L3VA 3DYAA 4PA1A 1RT4A 3B6PA 1N6QA 3MEEA 3PO5A 3AA5X 5FRMA 4FLUA 2G07A 2KQ2A 1NOZA 3AO1A 3F2DA 5J2QA 2Z1JA 2ZD1A 4KO0A 1VSEA 1ZBUA 4HTUA 1BQMA 4FJ5A 2R7YA 1FK9A 3SV4A 2HNZA 1KVBA 3M7DA 2P1JA 1TL3A 3T79A 1XI1A 3VQ4A 3AVIA 1VSJA 3M8RA 1EETA 3KFUF 4FZXC 5HRPA 4M3WA 2ZIXA 3V9ZA 2RHFA 1ZYQA 4Z4IA 5K14A 2KJ8A 4P0PA 4J2AA 1J5OA 3L8BA 2ZQBA 4KMOB 3SCXA 3ZSZA 4P0QB 3EYZA 1NKCA 1JXBA 1HYZA 1HJRA 3K5MA 1NK4A 4OJOA 3SAHA 3OPXA 1RTDA 3U6FA 1KFDA 4FZYA 4ELTA 3ZSWA 4DTMA 3OYEA 5JS1A 1G15A 4OKEA 4BDZA 3V81A 1UA0A 4EP5A 3PSIA 1DTTA 2HB5A 2HVIA 2Q4TA 4U7CA 1NK5A 1RDAA 5FROA 4CERA 1JXEA 4KFBA 2BDUA 3AVKA 3MXIA 4QAGA 1TKZA 2QKBA 3P5JA 2D0CA 3V9WA 3VCBA 3OYHA 3D2QA 1IKXA 5HLFA 3OYBA 3OS2A 3DRRA 1N5YA 1RT6A 4FJ7A 2FBTA 2DQNB 2F77X 4CK3A 2JHDA 3QESA 4DWIA 3OJSA 2WONA 2ZXHA 3AO4A 3LALA 1T94A 1NK8A 3S9HA 4ICLA 3D45A 3B6OA 1JLFA 2VKQA 4K8ZA 3CYMA 5HRSA 2G5HB 1WLJA 2CPRA 1WAFA 4B8CA 3SYZA 1L6NA 3GU3A 4Q0BA 1DRGA 1IKVA 1VSLA 3MGVA 4O0JA 1Q3UA 1HQUA 4HHTA 3SPZA 3SQ4A 1KTQA 3L2WA 3ISNC 3L2VA 2KFNA 4DSIA 1PVRA 2Y0SF 2OPSA 2D6FC 4M42A 4DF4A 1LW2A 1BI4B 3D2NA 1Q8IA 4B9MA 1RTJA 3ZCMA 4CF9A 3RR8A 4XIUA 4B9NA 3SUQA 3MEGA 3SQ0A 4P0QA 3TAQA 1Q3VA 1LAWA 1XHXA 4FZZA 2BGGA 2XY6A 4DMNA 4NCAA 2N1RA 4CF0A 4CIGA 3ULDA 1GO3F 3ZT3A 4FLXA 3IRXA 3QIPA 1RT2A 1RBSA 4DTNA 1RBUA 3H0RB 4O44A 4M41A 4M3ZA 4FJGA 3L3FX 4NYFA 3KLIA 4ELVA 1HIWA 2HHSA 3S3NA 1QSLA 1WSFA 2ETJA 3LP1A 3OYFA 4CJ4A 4F2RA 5HR6A 1URJA 3RFAA 4CEZA 4CFBA 1MA7A 2LHTA 3KD5E 1JL1A 4GW6A 4OGCA 3O3GA 1NK9A 4B9LA 2HBKA 3U3YA 1U48A 1TV6A 1U47A 2QXFA 4FW1A 3SV3A 4CGGA 3HL8A 1XHZA 2VWJA 1T05A 2O4IA 2KJ5A 4CHYA 1TK5A 3AVNA 3V6DA 3AVHA 2A3VA 1KLNA 3ALYA 1QHTA 2KVCA 3QNNA 3LP2A 3TAGA 2ZIVB 4I9LA 2HOQA 1FKOA 3VC8A 2XRIA 4PL1A 4OLBA 3PY8A 4QIWC 4M3RA 2B6AA 2K89A 4CJTA 1WN7A 1TGOA 1NJZA 2DFHA 2FBYA 3DLGA 1GOBA 4H4OA 5KI6A 2KNJA 3BGRA 4FLTA 4DQSA 4C8MA 1BI4A 2LYAA 4CJ5A 2IGIA 2KHVA 1Z1BA 2AJQA 2DY4A 5HR7A 2DGZA 5E41A 4B9SA 1L3SA 4OVLA 3CM5A 2FBXA 4KX3A 1LWEA 1NJYA 4F3TA 1MU2A 1C1CA 3NBPA 3O3HA 3CM6A 3VQEA 5HP1A 3LZIA 1R0AA 4FZNA 4I7FA 3TAEA 3QEPA 4CHPA 3SQIA 4IC9A 2Z7JA 4RW7A 2VJ5A 1O1WA 4AHSA 5KGWA 1X9MA 1XWLA 1NKBA 4FLYA 4RW9A 4KHNA 1BL3A 4LD0A 4FM0A 2JH1A 3AO3A 2K4HA 4H4MA 3OYMA 4YNQA 1CXUA 4EZ9A 2G08A 3V9SA 3HVRA 3VQCA 5J2MA 1VSMA 4CIEA 2WB1F 2Y0SC 3DOKA 4CEDA 1DLOA 4ZTFA 1J9AA 4W5OA 3IP4B 2XY8A 4M45A 3ZSQA 4FJ9A 3ZT1A 2KV2A 4B8AB 4GVMA 1FXXA 2KKPA 5C42A 2OPRA 3VQ9A 3WNGA 4I2PA 4PY5A 2ZIVA 4CJPA 3OYIA 3M6ZA 2G8IA 4B9TA 1BIUA 1BCOA 3KK1A 2OPQA 2RKIA 1NK7A 1B92A 4DTRA 3VA3A 3HYFA