1UQVA

Sam domain from ste50p
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
GSHMNNEDFSQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDSKLEWKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STE50 PROTEIN
publication title Structure of the Sterile {Alpha} Motif (Sam) Domain of the Saccharomyces Cerevisiae Mitogen-Activated Protein Kinase Pathway-Modulating Protein Ste50 and Analysis of its Interaction with the Ste11 Sam
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09235 SAM_Ste50p Ste50p, sterile alpha motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1uqvA00
4NJ8A 5JTIA 1RG6A 3KKAC 2QB1A 1PK1B 1WWVA 2ESEA 3SEIA 2KSOA 2EAMA 2D3DA 2EANA 2E8PA 3SENA 1DXSA 2DL0A 1SV0A 5L1MA 3BS5A 1OXJA 4NL9A 2KIVA 1B0XA 2EAOA 1JI7A 4PZOA 1LKYA 2L5YA 2QARA 2QB0B 2ES6A 2K4PA 2KSOB 4RQMA 1SV4A 1X40A 2F44A 2DKZA 2EAPA 1UCVA 2LMRA 3H8MA 3KKAA 3TADC 2D8CA 5J8YC 1X9XA 2QKQA 1LKYB 5KNIA 2DKXA 2YTUA 2F8KA 5JRTA 1V85A 2GLEA 2KMDA 5JU5A 1PK3A 2F3NA 2Y9UA 3IDWA 1SXEA 1Z1VA 2FE9A 2E8MA 3TACB 1F0MA 3K1RB 2E8NA 1SXDA 1X66A 1UQVA 2E8OA 2K60A 3BS5B 4PZNA 1SGGA 2Y9TA 3HILA 1KW4A 2QARB 1WWUA 2JV3A 1SV0C 2KE7A 2QB0A 3TADA 3BQ7A 1V38A 4NL9C 3BS7A 2LPEA 1OW5A 1PK1A 5J8YA 4RQNA 2B6GA 1B4FA 5F3XB 1COKA 4IS7A 2KG5A 4MHVA
chains in the Genus database with same CATH superfamily
4ED0A 5AI4A 4UARA 4G3IA 3PSPA 2D6FC 3ICXA 8ICPA 3QXGA 2W55A 2BPFA 5KG0A 1X9WA 5D4BA 5AKEA 1S97A 1A77A 2I6XA 1ZQYA 2Y1IA 3AEVA 4ECSA 2Y0SF 3ISBA 1DXSA 5DB9A 2DL0A 2KNJA 2KFNA 3WK6A 1UHUA 1SKRA 3DV9A 3NVVA 5AKHA 4KX3A 4YR0A 2A19A 5D49A 1LKYA 2CPRA 3UXNA 1S77D 2HBLA 3D2SA 4KLTA 3NASA 4F4XA 4IQWA 4NWIA 3WK5A 3KHLA 4O3OA 5ALEA 1RXWA 4TQRA 4PHDA 4ZH4A 3PZPA 1ZQEA 3QUQA 1ZQVA 3T5KA 4DS5A 3TANA 4QZAA 3I76A 4NLBA 2H3FA 4DL7A 4J9PA 2LYBA 3Q8MA 4P2HA 4ECRA 1ZQJA 9ICKA 9ICMA 3EYZA 8ICLA 3F2BA 3OHAA 3SV3A 4XQ8A 1XC9A 5DG8A 2WTFA 4EYHB 3I28A 2W54A 2Y9TA 4KN7A 5ALSA 3EPGA 2VANA 4Z6DA 1NK4A 4Z6FA 4PGXA 5K4LA 3BQ7A 2FMSA 1OW5A 1PK1A 5J8YA 3QZ8A 1PZNA 5AKIA 5KAIU 2BQUA 2O6KA 3GIMA 3PX4A 3KHRA 1A0PA 5KFLA 3V6JA 4F5PA 4DS4A 2KVCA 7ICQA 5HR6A 1N62A 3G6XA 4JWNA 2V9WA 4B6JA 4IRCA 4QWBA 2OCEA 1D8BA 1NI3A 1SZHA 4O3MA 1VLBA 4O5EA 5AM1A 2WB1C 1Y88A 1MA7A 3D2NA 4CRXA 7ICTA 4EZ9A 5AI5A 1NK0A 4B9MA 4TURA 5KFMA 2I1QA 4C4RA 1P7DA 4PZOA 3RAXA 4MFCA 4OJOA 1BNOA 1ZQTA 1BVSA 2IHMA 5AI0A 5DQIA 4EX6A 2AXTU 3ED5A 5KFRA 5KG2A 4DWIA 5J0UA 2HW3A 4QZFA 5C0YA 4A8EA 7ICFA 2DFLA 4BUGA 5IINA 1ZQWA 4J9LA 2BPGA 3RTVA 3QZ7A 4HYKA 2NYVA 3FAHA 7ICLA 2W3RA 3BQTA 4I2BA 2KD1A 5KFQA 4I2AA 3RJIA 3KD3A 3KTQA 4B9LA 2ZIVB 5AKXA 2WFAA 4Y2SA 3QE9Y 2RQ5A 5ALWA 1KQQA 3C2LA 7ICNA 2KE7A 4F4YA 3TADA 9ICCA 3MR5A 3J81j 9ICLA 2H3ZA 1N5XA 2C28A 2BKEA 3KHHA 4UAUA 2UVVA 2W7PA 2IMWP 2BR0A 3GV7B 1IIPA 2JXJA 1T3QA 1X6IA 4G9BA 5J2BA 2AGQA 5AKJA 2HOIA 2EZZA 2CN1A 3LVVA 4ZOHC 1L7MA 4DFPA 8ICNA 1TVAA 4DL3A 4Y2TA 5KFGA 1SZPA 3HKZF 5J2DA 4DQIA 5KAFU 7ICPA 2QB0B 1WCNA 8ICSA 2R18A 4FZNA 4ACOA 5EE0A 3RH4A 1JXLA 1DRGA 2ZIWA 4Y2VA 5DBBA 4RZRA 4J9OA 4MEXA 4F3OA 1IG6A 4PJ0U 4ECTA 5A0LA 3AN1A 3PR4A 5HNKA 2VA3A 5ALIA 3QUBA 2PI4A 5AI9A 2LMRA 4C0ZA 3SYZA 2Q0ZX 2OWOA 2JEJA 1Z19A 1LKYB 5KNIA 2G5IB 2DF4B 3FYHA 3F2DA 1ZQCA 4IRDA 1D9FA 1ZQQA 1K5OA 2MRLA 1L8LA 1QTMA 4EBEA 8ICHA 4GLXA 1IM4A 2E8NA 5KL1B 1UQVA 2OEHA 2PKEA 8ICOA 4Y2JA 2K60A 1ED1A 4FZLA 3T79A 4KLIA 1FIQA 1JMSA 2NRWA 5AM2A 2KTQA 2P6RA 5G5GA 3F5AA 1MC8A 5KFXA 3WU2U 4CNQA 3BQ2A 1UT5A 2HBJA 4FFDA 2PMZF 2W9MA 1MN8A 1V38A 1KN5A 4I2GA 1O08A 4ECYA 5J2KA 3UQ2A 5TISU 2QLTA 3B0YA 4JUZA 4QWAA 2KOBA 5AK4A 3T5JA 3SD7A 3AU6A 2HHTA 2PI5A 2PFNA 1BPXA 4PH5A 4ED7A 2RDJA 2BCRA 4KITB 4DQRA 3HP6A 1PK1B 4UASA 4UBBA 4DO9A 5KFEA 1NK8A 1TAUA 2ZTCA 5KFYA 1ZQGA 5KFDA 2CRXA 4M9NA 4ICAA 4KLDA 3A0HU 4C80A 2P66A 2ALZA 3NTUA 3KBBA 1IV8A 5FP0A 1L8OA 4IR1A 1CUKA 3QU2A 3TI0A 4F2RA 2XICA 3ISCA 4I29A 2F8LA 2P35A 8ICVA 4IR9A 2PFQA 1KBUA 2BDPA 5AK5A 1ZD4A 2WHEA 1N5WA 2H5XA 4ECVA 5J8YC 5ALTA 2W9AA 4QIWF 4DLGA 3ALRA 4NV0A 2KEYA 1HIWA 4BDPA 5IIOA 1RQNA 4TUSA 3AQFA 1U45A 2MUTA 1KRPA 4F71A 1ZQNA 1SB3C 1X42A 4Y2XA 5H2FU 5KFFA 1TV9A 1F5SA 5AI8A 3PX0A 3GIJA 8ICKA 4M9HA 1ZQBA 1HEKA 3BZCA 2ZXIA 3EW9A 3LVWA 2C2EA 2HHQA 4QZ8A 1KKXA 4BXOA 2JEGA 1ZQLA 2NV3A 5KFJA 1T8EA 1NNLA 1L3UA 4YFKA 3V72A 5KFIA 3WKDA 4UAYA 2E1FA 3MFHA 2A1AA 3N28A 1RPLA 5AKLA 2ZUBA 4UB2A 1KTQA 3L5KA 4R66A 3K4GA 1T4GA 2NRVA 3JPTA 8ICCA 5HMMA 1UPHA 1OUQA 2DPJA 4EX7A 5ALUA 1MSWD 2W9CA 2XCPA 9ICIA 4PL2A 4NM2A 2KN7A 1XWLA 2EANA 2J6UA 1ZETA 3IG8A 2M9NA 3ZI4A 2K8AA 2EDUA 5ALHA 3PW7A 5BPCA 4LZDA 1VJ5A 1ZQXA 4C8NA 5HMLA 3ZDDA 2MSNA 4B9TA 4M0AA 1SWVA 5ALDA 3NVWA 2DKZA 3TADC 2DGZA 4JV1A 3RAQA 3JPPA 1K1QA 1ZQRA 2F8KA 5KFUA 3GILA 1ECWA 3AUOA 1XNSA 4KLQA 2GLEA 2KMDA 4RNNA 1XO1A 2KHQA 2HMXA 2J6SA 1QSLA 2F3NA 3IDWA 1DGSA 1SXEA 1Z1VA 1GO3F 2YMMA 1TE2A 3K1RB 4JV0A 2JRZA 3M7DA 1MQ2A 4RQ7A 4OO1J 3AU2A 2R8KA 2G09A 2GO7A 2ZUCA 2QARB 8ICQA 2W43A 4F2SA 4R63A 4EYIB 3ZDAA 2Z7JA 4O3QA 2NRZA 3L4PA 4F72A 2YQEA 4WJ3B 1WCLA 2FLPA 5ALLA 2J6TA 1ZQKA 1L7PA 1T3NA 3QEAZ 4YD1A 4XA5A 4FE3A 3M9NB 2KKPA 1SL1A 5AK3A 1TAMA 2XY7A 4YD2A 4DFMA 3Q8KA 1A76A 3WKCA 3BDPA 2AGOA 5L1KA 2JGAA 2M0NA 4RUCA 4BWJA 1BNPA 3RJJA 5J2CA 1KLNA 4UB4A 2HOFA 3IM1A 1PUZA 1YZ6A 5KT3A 4J9NA 2BGWA 3WK8A 4I27A 2YB1A 4RQMA 1CRXA 1X40A 4GXKA 4U6PA 5G5HA 5HHIA 4RPZA 4J9RA 7ICRA 4YCXA 4TUQA 2VA2A 3NVYA 1QQ7A 2VIXA 9ICSA 4OJ6A 5AM5A 2DKXA 4YP3A 1CEZA 4B9VA 5DBCA 4IC9A 5AIBA 2F1IA 4F93B 3RB0A 5CRXA 1KFDA 5AKZA 3PVXA 5KFKA 1KSPA 3OTQA 3UMBA 4R8UA 3PNCA 1ZXIA 2E8OA 1NKBA 5KFSA 1LV5A 4MF2A 5GTIU 8ICAA 2ZTEA 5E79U 5J29A 1RYRA 2W04A 3WKEA 2MUTB 2WF7A 3GFKB 4JB3A 2FLNA 2XGPA 1ZQIA 4ELVA 3UMGA 4JWMA 1XSNA 3D2QA 3DEEA 2F1HA 5ALQA 3MDCA 4M6WA 3AM9A 2W8LA 2KHVA 4YXMA 4KX5A 3RJHA 3JPSA 4Y2UA 4UB8U 4DOBA 3OJSA 5J0YA 1Z00A 3WKBA 2DBYA 2H3VA 3KFUF 5EE9A 8ICRA 3H0LB 5KL8B 2ESEA 4M2YA 5L1LA 3RH5A 2EAMA 3KZIU 5DB7A 2WAQC 3SENA 3LK9A 2RHFA 3RH6A 2OYYA 1QQ6A 1QCKA 2B0CA 2FLLA 4OJ5A 2VJ5A 2CXYA 2W9CB 3UXPA 2KJ9A 3SMVA 2GH1A 3T5LA 1XU4A 3MGHA 2KIWA 3OGUA 1RZTA 2AHOB 2MAXA 3IG5A 5L1JA 2YB4A 3EUB2 5CA7A 5AM0A 3CYMA 1KDHA 5HP4A 5F9LA 2OH2A 4F92B 5IIJA 4F4WA 2BCUA 4PHPA 5DQHA 3RRHA 4Z6CA 1U4BA 5TZVA 3Q8SB 5CWRA 1U49A 3E2EA 1QSSA 4EZ6A 5KFTA 4DFKA 5DB6A 9ICWA 4ECUA 3I1YA 2YMLA 1ZJMA 2C22A 5KG1A 2FPLA 4C4TA 5KFNA 3THVA 2JV3A 3RBDA 2EQYA 9ICEA 1H38A 4UB3A 1S0NA 2LPEA 3PW2A 2DWQA 4AYBC 4IQVA 3OSNA 1QSYA 7ICGA 3D6JA 1Z3EB 1BPZA 2KG5A 1JUDA 4US9A 5JTIA 1SWWA 1ZQMA 5KG5A 1NK7A 7ICJA 3N97B 4DCCA 4DOAA 4KLJA 5B5EU 2K8BB 3M6KA 4RNMA 4UAZA 4F8RA 4K4GA 1Z1BA 3QNMA 1EXNA 3RJGA 1SV0A 4OD0A 1KEJA 2EAOA 4DL2A 3GDXA 4IQTA 4KLHA 3G6VA 5CP2A 4FS1A 4RPXA 4F50A 8ICZA 1XSLA 1SL2A 3UQ0A 4DSJA 3B0XA 2R8IA 3KKAA 3H8MA 3ETRA 4E0DA 2AH5A 4Q8FA 5B66U 4KLEA 4MEYA 2KV2A 1FFVA 9ICJA 2JHDA 4ELTA 3MC1A 1S76D 1UA1A 3BJYA 3V7KA 1N60A 1XO0A 4GC7A 5AIAA 1ZD3A 3M9OB 4OJLA 5DBAA 4C8LA 2Y0SC 5DGAA 4FO6A 1J2MA 7ICKA 4O0IA 2E1EA 4J9KA 2V4QA 2A1JA 1NZBA 2ISOA 4QWEA 1D8YA 5KG6A 2IOHA 2LM4A 9ICGA 4TUPA 2UVWA 4DFDA 3H8JA 2VA8A 2AQ4A 4F5QA 5KFPA 1J97A 1S0VA 4KLGA 1DK2A 4YMMA 5J2EA 1IXRA 2PFOA 2HHWA 4Q45A 1NOMA 1AROP 2HBMA 2ODGA 5ALFA 2KJ8A 4M6WB 3SEIA 4PGQA 2ISPA 5ALYA 1PVRA 5J0OA 9ICTA 4KLMA 1ZYQA 8ICJA 1X2IA 2MU2A 3BS5A 1F44A 5J0XA 1Z00B 2KIVA 5AHXA 3EWAA 3WK4A 3SAGA 3TAQA 4M9GA 3IP4B 3M8SA 4NLZA 4JMUA 4OCZA 1NK5A 4Y2RA 5EE1A 3NUQA 3C23A 1DOQA 4QZHA 1UCVA 5AM4A 3RFAA 4ED8A 4R65A 2FPKA 2VKQA 4GC6A 4I2IA 4LVSA 3C29A 3N7PD 1NJXA 1COOA 2NO4A 5KT2A 1PK3A 3CP8A 4GIBA 2W7OA 1F0MA 3QUTA 4USAA 2GOLA 2FJ6A 4PZNA 4KLFA 1SGGA 1ZRMA 9ICPA 5CR0A 1JIHA 4QNLA 2KICA 5KTQA 3QU7A 4US8A 4PGYA 4KLLA 5BOMA 1MQ3A 9ICOA 4RNOA 2HI0A 1ZQOA 1NJYA 3MR6A 3WK7A 1TK5A 1DGJA 3T3FA 1NKCA 1HJPA 4ECXA 2OHFA 2UVUA 3MR2A 4RU9A 2C2DA 2HVIA 3BQ0A 3PW4A 8ICEA 3KZXA 1S5LU 1NK9A 1SKWA 4JV2A 4YR2A 5AM3A 3VCBA 5KG3A 4P0PA 3H8SA 5L1MA 3UM9A 1LB2B 4AP9A 2Y1JA 3TQ1A 2R8HA 3GU3A 2ES6A 1L7NA 4BJQA 3GQCA 4DQSA 4Y2YA 4UBCA 4PL1A 1B43A 4UQGA 1A6SA 3QU9A 3RB6A 4EENA 5J2GA 2LHTA 4F91B 2BDUA 2YY6A 3E0FA 3KOOA 4QZBA 3OJUA 3G6YA 2KFZA 2BZFA 3S6JA 5AK6A 7ICHA 2ASJA 4BWMA 1ZQUA 1N2XA 1NK6A 5DG7A 2GWSA 3HRDD 2FE9A 3RJFA 3TFSA 4YXJA 1S9FA 2WB1F 2I9GA 3Q8RB 5DGBA 1XS9D 5J0PA 1O03A 1QQ5A 3M6ZA 2ATLA 4GXJA 2LYAA 4DSIA 3HKZC 1QLNA 4Q44A 2RP5A 2W3SA 4EELA 2JMGA 2ZIWB 2IBKA 1NJZA 1SV0C 4P4PA 3HWTA 9ICQA 3BS7A 1UA0A 4ECZA 4M47A 1SIJA 4DL6A 2YN4A 2B6GA 4X5VA 5KFOA 5J2FA 3ETLA 3GZFA 2NRXA 4EEKA 3LDAA 4IS7A 4F5NA 2W8KA 3H0RB 1X9MA 2W03A 1ZQHA 3KKAC 4NLCA 3JPQA 5KFBA 2K4IA 5HHHA 2ZIUA 2XVTA 4PHEA 2F1JA 5CJ7A 3MABA 2KSOA 3EPIA 2D3DA 3RJKA 3GV8B 2JEFA 4Y2PA 3QEBZ 3U26A 2K4EA 2RRDA 1ZQSA 2HHVA 2ZIVA 4KLUA 5KFCA 1LVHA 1Q46A 4DLEA 1TK8A 1B0XA 4FBTA 9ICBA 4CF5A 1BGXT 8ICWA 3PSTA 2PMZC 4QZCA 1ZQPA 4P4MA 2N1RA 4RT2A 2AQ0A 4C8KA 4DFJA 2ZIXA 3SQIA 3BQ1A 1ZD2P 2XGQA 2D8CA 4ECQA 1V9PA 4UAVA 2YX8A 3GV5B 4Y2QA 2F77X 4RQ8A 2F2AB 3M8RA 3MGIA 3PSIA 1BPDA 2HOQA 1ZQ1C 2XC9A 1L6NA 3DDHA 3FC4A 2WF8A 1Q3VA 1C20A 4NLGA 8ICYA 1PVPA 5IIMA 4B9UA 2G0AA 3HILA 1KW4A 3ZDCA 1URJA 3C2KA 2QB0A 4C4SA 2AU0A 4U7CA 5J2IA 2G08A 4RQ1A 2KVSA 3UXOA 4I2JA 8ICFA 4RQ0A 3HJEA 4QIWC 2FMQA 1FEZA 3CNHA 2WF6A 2E3TA 5ALPA 1L3VA 1NZPA 2R8JA 7ICIA 2QB1A 4CCHA 2IHNA 2JZBA 1JXEA 5ALGA 2KP7A 3IV6A 2AGPA 5J0QA 2VJ4A 2XY5A 5JUMA 4TQSA 3MGVA 3L3FX 1ZJNA 2G5HB 4EEYA 4NL9A 4BXOB 1TKDA 4ED6A 2KZ3A 4KLSA 3QYPA 5DLFA 2YMPA 1S10A 4HAIA 1SV4A 1RYUA 3HT3A 4CF3A 3ORYA 3ZD9A 3RBEA 3V7LA 8ICGA 3MDAA 1WYGA 4P0PB 2EAPA 2PFPA 3ZDBA 4O3NA 5ALOA 2JEIA 2DUYA 4QZEA 2KKVA 2HCFA 2Q4TA 5KFHA 5JRTA 3B9JA 5ALMA 4DSLA 1V85A 3K1ZA 3C5FA 4YG2A 1S0OA 8ICBA 4RUAA 2XIDA 4DSEA 4UB1A 2FDRA 4BGDA 5T14A 3BZKA 4RQ6A 2ZXHA 3PO4A 1SXDA 1X66A 2HHSA 5KT5A 3RRGA 4O5KA 7ICVA 1V97A 8ICMA 4J03A 1L3SA 2DQNB 4K4IA 5KFAA 3Q8PB 4ED1A 4O3SA 3IRUA 5EWGA 3EZ5A 1HUZA 4KTQA 4KMOB 2ZUDA 2HHXA 1RQLA 1Z4OA 3VC8A 2B21A 1JROA 4MFAA 3SV4A 3H7IA 9ICNA 1XSPA 2FPMA 3HX0A 3QX7A 4DF8A 2BCSA 4I2HA 3F53A 1S8OA 2RDIA 3TKAA 3CW2C 1NKEA 1X6JA 2BHNA 2BQRA 4BX9C 1J2NA 2ZTDA 4B9NA 5J0SA 4ED3A 4JK1A 3F2CA 4I28A 2LKYA 4DQPA 3ISDA 1M6YA 5KT4A 4QW9A 2OXOA 3RR7A 4EBDA 3C28A 1L3TA 1OXJA 2ZIUB 5ALNA 5ALVA 2ZJ8A 3UMCA 5EE3A 2K4PA 3HPOA 2KSOB 8ICUA 4RPYA 3WKAA 1YZ7A 7ICUA 4YMNA 1N56A 3PW0A 4QWCA 1X9XA 1L7OA 4B9SA 2KJ5A 1X9SA 3RB4A 1JN3A 5KT7A 2FMPA 3OHBA 3MR3A 4M04A 5JU5A 3C1YA 3SZ2A 3IN5A 2ZIXB 2E8MA 2EZXA 4UAWA 3TACB 1JRPA 1ZQZA 3Q8LA 4KLOA 7ICSA 4FZMA 5D46A 3PW5A 3N4MB 1B22A 1HUOA 5CEHA 5KFWA 1ZQFA 2ZG6A 2H3IA 2P6UA 1WWUA 3AMZA 4P0QA 5IILA 1Q3UA 1D8LA 2H3QA 5J2JA 2DPIA 2RLTA 2LBOA 1JX4A 5KT6A 2FI1A 4QZDA 7ICMA 2ASLA 5ALKA 5BOLA 4RQ5A 4RQ2A 4LJXA 4I2DA 4J9MA 7ICOA 3FM9A 5KFVA 3QU4A 1BPYA 3NVZA 3TARA 5AKKA 4ELUA 3H4BA 4R8UB 3HW8A 8ICTA 2G06A 1RXVA 2HSZA 2V4RA 2A3VA 3RR8A 2BCQA 3MFIA 2OM6A 3SR6A 4K4HA 3TAPA 4I2CA 2JZBB 1JI7A 1PVQA 2QARA 4ED2A 3M9MB 2LI6A 4C7ZA 4OJPA 3V6KA 3O0FA 2LM1A 4CF4A 4M9JA 5AKYA 4R64A 1U9LA 2I5HA 5DKWA 2XI9A 1D9DA 2W9BA 2C2RA 5IIKA 9ICXA 2NRTA 3CRXA 4UATA 9ICFA 1T7PA 2BPCA 3H4DA 3NRZA 3T5HA 4GFJA 4IQUA 1SKSA 3K75D 4NLNA 5F9NA 3OSPA 4F5RA 4DEZA 1N63A 3NRWA 3ONNA 2PXIA 3FDSA 4F5OA 3RJEA 3MBYA 2HHUA 3PV8A 2UVRA 3AQEA 4CDGA 3TFRA 4Q8EA 4O3PA 3N7SC 1JALA 3N7RC 3Q8QB 2K89A 5J2AA 3M1YA 4NL9C 3F5EA 2AJQA 5AI6A 3V6HA 3SAHA 4RQNA 1UT8A 4NXZA 4NM1A 2ZJAA 4I2FA 5F3XB 5J0RA 5CB1A 2BQ3A 3PMNA 5GTHU 1RG6A 4FS2A 3C21A 5L9XA 1TK0A 5ALXA 1BPEA 2W11A 1S0MA 1TFRA 3LWLA 4IRKA 1WWVA 3ZDEA 3SI8A 4UB6U 5KG7A 2IOFA 4CGZA 2E8PA 4QW8A 1CI4A 3PY8A 4UW9A 3PSFA 3AL0B 2HDOA 4C8MA 1N48A 2YMQA 2KK0A 4LZGA 4EBCA 5EWEA 3PO5A 1WUDA 1DK3A 3PR5B 4DL5A 4YMOA 2NO5A 5C5JA 4IL6U 2F44A 4F4KA 3WK9A 1WG8A 3H0MB 4C8OA 4MFFA 1Z4NA 2QKQA 3LWMA 3ZD8A 4C7YA 4RQ3A 1U48A 3E58A 4XRHA 2YTUA 3A0BU 5ALZA 1KL9A 4Z6EA 4DOCA 1RYSA 5HR7A 3GIKA 2Y9UA 1TAQA 3QUCA 4F4ZA 3GIIA 3PX6A 4KMUA 4YQWA 4YVZA 2KZZA 2WAQF 4YN4A 3PMLA 4Q43A 3JPRA 4ECWA 8ICIA 1KFTA 2R8GA 3QU5A 9ICUA 2EH9A 4KN4A 1N61A 7ICEA 5DG9A 2JR5A 3V7JA 5DQGA 5CHGA 4UB5A 4MF8A 3RF9A 9ICRA 1COKA 4P4OA 1T94A 5AKGA 4GXIA 4MHVA 9ICVA 4NJ8A 2EZYA 4QZGA 5DLGA 4XUSA 5IIIA 4RQ4A 3UPQA 4O5CA 4P0QB 2MA1A 2WF9A 2KZMA 2IOFK 4RT3A 3R9KA 1ZRNA 4O9MA 5ALRA 2BCVA 1NJWA 1AQ6A 1U47A 4QJFB 5DDYA 4O3RA 2A1JB 5KFZA 5J0TA 3C5GA 2ASDA 4M9LA 1ZOLA 2L5YA 2JH7A 3H40A 1FO4A 2XY6A 5KG4A 1SL0A 1Q8KA 4PPXA 4AYBF 4DSKA 1VDVA 5L1IA 5EWFA 4PHAA 4I2EA 1K1SA 5J0WA 2E5SA 4QWDA 1BPBA 2HBKA 4QZ9A 1FFUA 3KHGA 2K8CB 3C1ZA 3JPNA 3RB3A 2G07A 1QH9A 4NLKA 2ZJ5A 4DF4A 2XCAA 1ZQDA 1C7YA 9ICAA 2IA6A 5DB8A 4DQQA 1L5UA 5J2HA 1ZQAA 3C2MA 2W9BB 4QZIA 3BS5B 4NY8A 4DL4A 3JPOA 3NGDA 4CE6A 5AICA 5DDMA 5EOZA 1RM6C 4J9QA 1ZD5A 1RDFA 3OPXA 2HVHA 4YR3A 3LYSA 3NS1A 2F76X 2JH1A 8ICXA 4DSFA 4FBUA 2K4HA 3IHQB 1KFSA 9ICHA 1B4FA 5ALJA 1YT3A 2XO7A 4J9SA 2WF5A 3SAFA 3H8WA 2LYHA
chains in the Genus database with same CATH topology
4NJ8A 5JTIA 1RG6A 3KKAC 2QB1A 1PK1B 1WWVA 2ESEA 3SEIA 2KSOA 2EAMA 2D3DA 2EANA 2E8PA 3SENA 1DXSA 2DL0A 1SV0A 5L1MA 3BS5A 1OXJA 4NL9A 2KIVA 1B0XA 2EAOA 1JI7A 4PZOA 1LKYA 2L5YA 2QARA 2QB0B 2ES6A 2K4PA 2KSOB 4RQMA 1SV4A 1X40A 2F44A 2DKZA 2EAPA 1UCVA 2LMRA 3H8MA 3KKAA 3TADC 2D8CA 5J8YC 1X9XA 2QKQA 1LKYB 5KNIA 2DKXA 2YTUA 2F8KA 5JRTA 1V85A 2GLEA 2KMDA 5JU5A 1PK3A 2F3NA 2Y9UA 3IDWA 1SXEA 1Z1VA 2FE9A 2E8MA 3TACB 1F0MA 3K1RB 2E8NA 1SXDA 1X66A 1UQVA 2E8OA 2K60A 3BS5B 4PZNA 1SGGA 2Y9TA 3HILA 1KW4A 2QARB 1WWUA 2JV3A 1SV0C 2KE7A 2QB0A 3TADA 3BQ7A 1V38A 4NL9C 3BS7A 2LPEA 1OW5A 1PK1A 5J8YA 4RQNA 2B6GA 1B4FA 5F3XB 1COKA 4IS7A 2KG5A 4MHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ8 A;  5JTI A;  1RG6 A;  3KKA C;  2QB1 A;  1PK1 B;  1WWV A;  2ESE A;  3SEI A;  2KSO A;  2EAM A;  2D3D A;  2EAN A;  2E8P A;  3SEN A;  1DXS A;  2DL0 A;  1SV0 A;  5L1M A;  3BS5 A;  1OXJ A;  4NL9 A;  2KIV A;  1B0X A;  2EAO A;  1JI7 A;  4PZO A;  1LKY A;  2L5Y A;  2QAR A;  2QB0 B;  2ES6 A;  2K4P A;  2KSO B;  4RQM A;  1SV4 A;  1X40 A;  2F44 A;  2DKZ A;  2EAP A;  1UCV A;  2LMR A;  3H8M A;  3KKA A;  3TAD C;  2D8C A;  5J8Y C;  1X9X A;  2QKQ A;  1LKY B;  5KNI A;  2DKX A;  2YTU A;  2F8K A;  5JRT A;  1V85 A;  2GLE A;  2KMD A;  5JU5 A;  1PK3 A;  2F3N A;  2Y9U A;  3IDW A;  1SXE A;  1Z1V A;  2FE9 A;  2E8M A;  3TAC B;  1F0M A;  3K1R B;  2E8N A;  1SXD A;  1X66 A;  1UQV A;  2E8O A;  2K60 A;  3BS5 B;  4PZN A;  1SGG A;  2Y9T A;  3HIL A;  1KW4 A;  2QAR B;  1WWU A;  2JV3 A;  1SV0 C;  2KE7 A;  2QB0 A;  3TAD A;  3BQ7 A;  1V38 A;  4NL9 C;  3BS7 A;  2LPE A;  1OW5 A;  1PK1 A;  5J8Y A;  4RQN A;  2B6G A;  1B4F A;  5F3X B;  1COK A;  4IS7 A;  2KG5 A;  4MHV A; 
#chains in the Genus database with same CATH topology
 4ED0 A;  5AI4 A;  4UAR A;  4G3I A;  3PSP A;  2D6F C;  3ICX A;  8ICP A;  3QXG A;  2W55 A;  2BPF A;  5KG0 A;  1X9W A;  5D4B A;  5AKE A;  1S97 A;  1A77 A;  2I6X A;  1ZQY A;  2Y1I A;  3AEV A;  4ECS A;  2Y0S F;  3ISB A;  1DXS A;  5DB9 A;  2DL0 A;  2KNJ A;  2KFN A;  3WK6 A;  1UHU A;  1SKR A;  3DV9 A;  3NVV A;  5AKH A;  4KX3 A;  4YR0 A;  2A19 A;  5D49 A;  1LKY A;  2CPR A;  3UXN A;  1S77 D;  2HBL A;  3D2S A;  4KLT A;  3NAS A;  4F4X A;  4IQW A;  4NWI A;  3WK5 A;  3KHL A;  4O3O A;  5ALE A;  1RXW A;  4TQR A;  4PHD A;  4ZH4 A;  3PZP A;  1ZQE A;  3QUQ A;  1ZQV A;  3T5K A;  4DS5 A;  3TAN A;  4QZA A;  3I76 A;  4NLB A;  2H3F A;  4DL7 A;  4J9P A;  2LYB A;  3Q8M A;  4P2H A;  4ECR A;  1ZQJ A;  9ICK A;  9ICM A;  3EYZ A;  8ICL A;  3F2B A;  3OHA A;  3SV3 A;  4XQ8 A;  1XC9 A;  5DG8 A;  2WTF A;  4EYH B;  3I28 A;  2W54 A;  2Y9T A;  4KN7 A;  5ALS A;  3EPG A;  2VAN A;  4Z6D A;  1NK4 A;  4Z6F A;  4PGX A;  5K4L A;  3BQ7 A;  2FMS A;  1OW5 A;  1PK1 A;  5J8Y A;  3QZ8 A;  1PZN A;  5AKI A;  5KAI U;  2BQU A;  2O6K A;  3GIM A;  3PX4 A;  3KHR A;  1A0P A;  5KFL A;  3V6J A;  4F5P A;  4DS4 A;  2KVC A;  7ICQ A;  5HR6 A;  1N62 A;  3G6X A;  4JWN A;  2V9W A;  4B6J A;  4IRC A;  4QWB A;  2OCE A;  1D8B A;  1NI3 A;  1SZH A;  4O3M A;  1VLB A;  4O5E A;  5AM1 A;  2WB1 C;  1Y88 A;  1MA7 A;  3D2N A;  4CRX A;  7ICT A;  4EZ9 A;  5AI5 A;  1NK0 A;  4B9M A;  4TUR A;  5KFM A;  2I1Q A;  4C4R A;  1P7D A;  4PZO A;  3RAX A;  4MFC A;  4OJO A;  1BNO A;  1ZQT A;  1BVS A;  2IHM A;  5AI0 A;  5DQI A;  4EX6 A;  2AXT U;  3ED5 A;  5KFR A;  5KG2 A;  4DWI A;  5J0U A;  2HW3 A;  4QZF A;  5C0Y A;  4A8E A;  7ICF A;  2DFL A;  4BUG A;  5IIN A;  1ZQW A;  4J9L A;  2BPG A;  3RTV A;  3QZ7 A;  4HYK A;  2NYV A;  3FAH A;  7ICL A;  2W3R A;  3BQT A;  4I2B A;  2KD1 A;  5KFQ A;  4I2A A;  3RJI A;  3KD3 A;  3KTQ A;  4B9L A;  2ZIV B;  5AKX A;  2WFA A;  4Y2S A;  3QE9 Y;  2RQ5 A;  5ALW A;  1KQQ A;  3C2L A;  7ICN A;  2KE7 A;  4F4Y A;  3TAD A;  9ICC A;  3MR5 A;  3J81 j;  9ICL A;  2H3Z A;  1N5X A;  2C28 A;  2BKE A;  3KHH A;  4UAU A;  2UVV A;  2W7P A;  2IMW P;  2BR0 A;  3GV7 B;  1IIP A;  2JXJ A;  1T3Q A;  1X6I A;  4G9B A;  5J2B A;  2AGQ A;  5AKJ A;  2HOI A;  2EZZ A;  2CN1 A;  3LVV A;  4ZOH C;  1L7M A;  4DFP A;  8ICN A;  1TVA A;  4DL3 A;  4Y2T A;  5KFG A;  1SZP A;  3HKZ F;  5J2D A;  4DQI A;  5KAF U;  7ICP A;  2QB0 B;  1WCN A;  8ICS A;  2R18 A;  4FZN A;  4ACO A;  5EE0 A;  3RH4 A;  1JXL A;  1DRG A;  2ZIW A;  4Y2V A;  5DBB A;  4RZR A;  4J9O A;  4MEX A;  4F3O A;  1IG6 A;  4PJ0 U;  4ECT A;  5A0L A;  3AN1 A;  3PR4 A;  5HNK A;  2VA3 A;  5ALI A;  3QUB A;  2PI4 A;  5AI9 A;  2LMR A;  4C0Z A;  3SYZ A;  2Q0Z X;  2OWO A;  2JEJ A;  1Z19 A;  1LKY B;  5KNI A;  2G5I B;  2DF4 B;  3FYH A;  3F2D A;  1ZQC A;  4IRD A;  1D9F A;  1ZQQ A;  1K5O A;  2MRL A;  1L8L A;  1QTM A;  4EBE A;  8ICH A;  4GLX A;  1IM4 A;  2E8N A;  5KL1 B;  1UQV A;  2OEH A;  2PKE A;  8ICO A;  4Y2J A;  2K60 A;  1ED1 A;  4FZL A;  3T79 A;  4KLI A;  1FIQ A;  1JMS A;  2NRW A;  5AM2 A;  2KTQ A;  2P6R A;  5G5G A;  3F5A A;  1MC8 A;  5KFX A;  3WU2 U;  4CNQ A;  3BQ2 A;  1UT5 A;  2HBJ A;  4FFD A;  2PMZ F;  2W9M A;  1MN8 A;  1V38 A;  1KN5 A;  4I2G A;  1O08 A;  4ECY A;  5J2K A;  3UQ2 A;  5TIS U;  2QLT A;  3B0Y A;  4JUZ A;  4QWA A;  2KOB A;  5AK4 A;  3T5J A;  3SD7 A;  3AU6 A;  2HHT A;  2PI5 A;  2PFN A;  1BPX A;  4PH5 A;  4ED7 A;  2RDJ A;  2BCR A;  4KIT B;  4DQR A;  3HP6 A;  1PK1 B;  4UAS A;  4UBB A;  4DO9 A;  5KFE A;  1NK8 A;  1TAU A;  2ZTC A;  5KFY A;  1ZQG A;  5KFD A;  2CRX A;  4M9N A;  4ICA A;  4KLD A;  3A0H U;  4C80 A;  2P66 A;  2ALZ A;  3NTU A;  3KBB A;  1IV8 A;  5FP0 A;  1L8O A;  4IR1 A;  1CUK A;  3QU2 A;  3TI0 A;  4F2R A;  2XIC A;  3ISC A;  4I29 A;  2F8L A;  2P35 A;  8ICV A;  4IR9 A;  2PFQ A;  1KBU A;  2BDP A;  5AK5 A;  1ZD4 A;  2WHE A;  1N5W A;  2H5X A;  4ECV A;  5J8Y C;  5ALT A;  2W9A A;  4QIW F;  4DLG A;  3ALR A;  4NV0 A;  2KEY A;  1HIW A;  4BDP A;  5IIO A;  1RQN A;  4TUS A;  3AQF A;  1U45 A;  2MUT A;  1KRP A;  4F71 A;  1ZQN A;  1SB3 C;  1X42 A;  4Y2X A;  5H2F U;  5KFF A;  1TV9 A;  1F5S A;  5AI8 A;  3PX0 A;  3GIJ A;  8ICK A;  4M9H A;  1ZQB A;  1HEK A;  3BZC A;  2ZXI A;  3EW9 A;  3LVW A;  2C2E A;  2HHQ A;  4QZ8 A;  1KKX A;  4BXO A;  2JEG A;  1ZQL A;  2NV3 A;  5KFJ A;  1T8E A;  1NNL A;  1L3U A;  4YFK A;  3V72 A;  5KFI A;  3WKD A;  4UAY A;  2E1F A;  3MFH A;  2A1A A;  3N28 A;  1RPL A;  5AKL A;  2ZUB A;  4UB2 A;  1KTQ A;  3L5K A;  4R66 A;  3K4G A;  1T4G A;  2NRV A;  3JPT A;  8ICC A;  5HMM A;  1UPH A;  1OUQ A;  2DPJ A;  4EX7 A;  5ALU A;  1MSW D;  2W9C A;  2XCP A;  9ICI A;  4PL2 A;  4NM2 A;  2KN7 A;  1XWL A;  2EAN A;  2J6U A;  1ZET A;  3IG8 A;  2M9N A;  3ZI4 A;  2K8A A;  2EDU A;  5ALH A;  3PW7 A;  5BPC A;  4LZD A;  1VJ5 A;  1ZQX A;  4C8N A;  5HML A;  3ZDD A;  2MSN A;  4B9T A;  4M0A A;  1SWV A;  5ALD A;  3NVW A;  2DKZ A;  3TAD C;  2DGZ A;  4JV1 A;  3RAQ A;  3JPP A;  1K1Q A;  1ZQR A;  2F8K A;  5KFU A;  3GIL A;  1ECW A;  3AUO A;  1XNS A;  4KLQ A;  2GLE A;  2KMD A;  4RNN A;  1XO1 A;  2KHQ A;  2HMX A;  2J6S A;  1QSL A;  2F3N A;  3IDW A;  1DGS A;  1SXE A;  1Z1V A;  1GO3 F;  2YMM A;  1TE2 A;  3K1R B;  4JV0 A;  2JRZ A;  3M7D A;  1MQ2 A;  4RQ7 A;  4OO1 J;  3AU2 A;  2R8K A;  2G09 A;  2GO7 A;  2ZUC A;  2QAR B;  8ICQ A;  2W43 A;  4F2S A;  4R63 A;  4EYI B;  3ZDA A;  2Z7J A;  4O3Q A;  2NRZ A;  3L4P A;  4F72 A;  2YQE A;  4WJ3 B;  1WCL A;  2FLP A;  5ALL A;  2J6T A;  1ZQK A;  1L7P A;  1T3N A;  3QEA Z;  4YD1 A;  4XA5 A;  4FE3 A;  3M9N B;  2KKP A;  1SL1 A;  5AK3 A;  1TAM A;  2XY7 A;  4YD2 A;  4DFM A;  3Q8K A;  1A76 A;  3WKC A;  3BDP A;  2AGO A;  5L1K A;  2JGA A;  2M0N A;  4RUC A;  4BWJ A;  1BNP A;  3RJJ A;  5J2C A;  1KLN A;  4UB4 A;  2HOF A;  3IM1 A;  1PUZ A;  1YZ6 A;  5KT3 A;  4J9N A;  2BGW A;  3WK8 A;  4I27 A;  2YB1 A;  4RQM A;  1CRX A;  1X40 A;  4GXK A;  4U6P A;  5G5H A;  5HHI A;  4RPZ A;  4J9R A;  7ICR A;  4YCX A;  4TUQ A;  2VA2 A;  3NVY A;  1QQ7 A;  2VIX A;  9ICS A;  4OJ6 A;  5AM5 A;  2DKX A;  4YP3 A;  1CEZ A;  4B9V A;  5DBC A;  4IC9 A;  5AIB A;  2F1I A;  4F93 B;  3RB0 A;  5CRX A;  1KFD A;  5AKZ A;  3PVX A;  5KFK A;  1KSP A;  3OTQ A;  3UMB A;  4R8U A;  3PNC A;  1ZXI A;  2E8O A;  1NKB A;  5KFS A;  1LV5 A;  4MF2 A;  5GTI U;  8ICA A;  2ZTE A;  5E79 U;  5J29 A;  1RYR A;  2W04 A;  3WKE A;  2MUT B;  2WF7 A;  3GFK B;  4JB3 A;  2FLN A;  2XGP A;  1ZQI A;  4ELV A;  3UMG A;  4JWM A;  1XSN A;  3D2Q A;  3DEE A;  2F1H A;  5ALQ A;  3MDC A;  4M6W A;  3AM9 A;  2W8L A;  2KHV A;  4YXM A;  4KX5 A;  3RJH A;  3JPS A;  4Y2U A;  4UB8 U;  4DOB A;  3OJS A;  5J0Y A;  1Z00 A;  3WKB A;  2DBY A;  2H3V A;  3KFU F;  5EE9 A;  8ICR A;  3H0L B;  5KL8 B;  2ESE A;  4M2Y A;  5L1L A;  3RH5 A;  2EAM A;  3KZI U;  5DB7 A;  2WAQ C;  3SEN A;  3LK9 A;  2RHF A;  3RH6 A;  2OYY A;  1QQ6 A;  1QCK A;  2B0C A;  2FLL A;  4OJ5 A;  2VJ5 A;  2CXY A;  2W9C B;  3UXP A;  2KJ9 A;  3SMV A;  2GH1 A;  3T5L A;  1XU4 A;  3MGH A;  2KIW A;  3OGU A;  1RZT A;  2AHO B;  2MAX A;  3IG5 A;  5L1J A;  2YB4 A;  3EUB 2;  5CA7 A;  5AM0 A;  3CYM A;  1KDH A;  5HP4 A;  5F9L A;  2OH2 A;  4F92 B;  5IIJ A;  4F4W A;  2BCU A;  4PHP A;  5DQH A;  3RRH A;  4Z6C A;  1U4B A;  5TZV A;  3Q8S B;  5CWR A;  1U49 A;  3E2E A;  1QSS A;  4EZ6 A;  5KFT A;  4DFK A;  5DB6 A;  9ICW A;  4ECU A;  3I1Y A;  2YML A;  1ZJM A;  2C22 A;  5KG1 A;  2FPL A;  4C4T A;  5KFN A;  3THV A;  2JV3 A;  3RBD A;  2EQY A;  9ICE A;  1H38 A;  4UB3 A;  1S0N A;  2LPE A;  3PW2 A;  2DWQ A;  4AYB C;  4IQV A;  3OSN A;  1QSY A;  7ICG A;  3D6J A;  1Z3E B;  1BPZ A;  2KG5 A;  1JUD A;  4US9 A;  5JTI A;  1SWW A;  1ZQM A;  5KG5 A;  1NK7 A;  7ICJ A;  3N97 B;  4DCC A;  4DOA A;  4KLJ A;  5B5E U;  2K8B B;  3M6K A;  4RNM A;  4UAZ A;  4F8R A;  4K4G A;  1Z1B A;  3QNM A;  1EXN A;  3RJG A;  1SV0 A;  4OD0 A;  1KEJ A;  2EAO A;  4DL2 A;  3GDX A;  4IQT A;  4KLH A;  3G6V A;  5CP2 A;  4FS1 A;  4RPX A;  4F50 A;  8ICZ A;  1XSL A;  1SL2 A;  3UQ0 A;  4DSJ A;  3B0X A;  2R8I A;  3KKA A;  3H8M A;  3ETR A;  4E0D A;  2AH5 A;  4Q8F A;  5B66 U;  4KLE A;  4MEY A;  2KV2 A;  1FFV A;  9ICJ A;  2JHD A;  4ELT A;  3MC1 A;  1S76 D;  1UA1 A;  3BJY A;  3V7K A;  1N60 A;  1XO0 A;  4GC7 A;  5AIA A;  1ZD3 A;  3M9O B;  4OJL A;  5DBA A;  4C8L A;  2Y0S C;  5DGA A;  4FO6 A;  1J2M A;  7ICK A;  4O0I A;  2E1E A;  4J9K A;  2V4Q A;  2A1J A;  1NZB A;  2ISO A;  4QWE A;  1D8Y A;  5KG6 A;  2IOH A;  2LM4 A;  9ICG A;  4TUP A;  2UVW A;  4DFD A;  3H8J A;  2VA8 A;  2AQ4 A;  4F5Q A;  5KFP A;  1J97 A;  1S0V A;  4KLG A;  1DK2 A;  4YMM A;  5J2E A;  1IXR A;  2PFO A;  2HHW A;  4Q45 A;  1NOM A;  1ARO P;  2HBM A;  2ODG A;  5ALF A;  2KJ8 A;  4M6W B;  3SEI A;  4PGQ A;  2ISP A;  5ALY A;  1PVR A;  5J0O A;  9ICT A;  4KLM A;  1ZYQ A;  8ICJ A;  1X2I A;  2MU2 A;  3BS5 A;  1F44 A;  5J0X A;  1Z00 B;  2KIV A;  5AHX A;  3EWA A;  3WK4 A;  3SAG A;  3TAQ A;  4M9G A;  3IP4 B;  3M8S A;  4NLZ A;  4JMU A;  4OCZ A;  1NK5 A;  4Y2R A;  5EE1 A;  3NUQ A;  3C23 A;  1DOQ A;  4QZH A;  1UCV A;  5AM4 A;  3RFA A;  4ED8 A;  4R65 A;  2FPK A;  2VKQ A;  4GC6 A;  4I2I A;  4LVS A;  3C29 A;  3N7P D;  1NJX A;  1COO A;  2NO4 A;  5KT2 A;  1PK3 A;  3CP8 A;  4GIB A;  2W7O A;  1F0M A;  3QUT A;  4USA A;  2GOL A;  2FJ6 A;  4PZN A;  4KLF A;  1SGG A;  1ZRM A;  9ICP A;  5CR0 A;  1JIH A;  4QNL A;  2KIC A;  5KTQ A;  3QU7 A;  4US8 A;  4PGY A;  4KLL A;  5BOM A;  1MQ3 A;  9ICO A;  4RNO A;  2HI0 A;  1ZQO A;  1NJY A;  3MR6 A;  3WK7 A;  1TK5 A;  1DGJ A;  3T3F A;  1NKC A;  1HJP A;  4ECX A;  2OHF A;  2UVU A;  3MR2 A;  4RU9 A;  2C2D A;  2HVI A;  3BQ0 A;  3PW4 A;  8ICE A;  3KZX A;  1S5L U;  1NK9 A;  1SKW A;  4JV2 A;  4YR2 A;  5AM3 A;  3VCB A;  5KG3 A;  4P0P A;  3H8S A;  5L1M A;  3UM9 A;  1LB2 B;  4AP9 A;  2Y1J A;  3TQ1 A;  2R8H A;  3GU3 A;  2ES6 A;  1L7N A;  4BJQ A;  3GQC A;  4DQS A;  4Y2Y A;  4UBC A;  4PL1 A;  1B43 A;  4UQG A;  1A6S A;  3QU9 A;  3RB6 A;  4EEN A;  5J2G A;  2LHT A;  4F91 B;  2BDU A;  2YY6 A;  3E0F A;  3KOO A;  4QZB A;  3OJU A;  3G6Y A;  2KFZ A;  2BZF A;  3S6J A;  5AK6 A;  7ICH A;  2ASJ A;  4BWM A;  1ZQU A;  1N2X A;  1NK6 A;  5DG7 A;  2GWS A;  3HRD D;  2FE9 A;  3RJF A;  3TFS A;  4YXJ A;  1S9F A;  2WB1 F;  2I9G A;  3Q8R B;  5DGB A;  1XS9 D;  5J0P A;  1O03 A;  1QQ5 A;  3M6Z A;  2ATL A;  4GXJ A;  2LYA A;  4DSI A;  3HKZ C;  1QLN A;  4Q44 A;  2RP5 A;  2W3S A;  4EEL A;  2JMG A;  2ZIW B;  2IBK A;  1NJZ A;  1SV0 C;  4P4P A;  3HWT A;  9ICQ A;  3BS7 A;  1UA0 A;  4ECZ A;  4M47 A;  1SIJ A;  4DL6 A;  2YN4 A;  2B6G A;  4X5V A;  5KFO A;  5J2F A;  3ETL A;  3GZF A;  2NRX A;  4EEK A;  3LDA A;  4IS7 A;  4F5N A;  2W8K A;  3H0R B;  1X9M A;  2W03 A;  1ZQH A;  3KKA C;  4NLC A;  3JPQ A;  5KFB A;  2K4I A;  5HHH A;  2ZIU A;  2XVT A;  4PHE A;  2F1J A;  5CJ7 A;  3MAB A;  2KSO A;  3EPI A;  2D3D A;  3RJK A;  3GV8 B;  2JEF A;  4Y2P A;  3QEB Z;  3U26 A;  2K4E A;  2RRD A;  1ZQS A;  2HHV A;  2ZIV A;  4KLU A;  5KFC A;  1LVH A;  1Q46 A;  4DLE A;  1TK8 A;  1B0X A;  4FBT A;  9ICB A;  4CF5 A;  1BGX T;  8ICW A;  3PST A;  2PMZ C;  4QZC A;  1ZQP A;  4P4M A;  2N1R A;  4RT2 A;  2AQ0 A;  4C8K A;  4DFJ A;  2ZIX A;  3SQI A;  3BQ1 A;  1ZD2 P;  2XGQ A;  2D8C A;  4ECQ A;  1V9P A;  4UAV A;  2YX8 A;  3GV5 B;  4Y2Q A;  2F77 X;  4RQ8 A;  2F2A B;  3M8R A;  3MGI A;  3PSI A;  1BPD A;  2HOQ A;  1ZQ1 C;  2XC9 A;  1L6N A;  3DDH A;  3FC4 A;  2WF8 A;  1Q3V A;  1C20 A;  4NLG A;  8ICY A;  1PVP A;  5IIM A;  4B9U A;  2G0A A;  3HIL A;  1KW4 A;  3ZDC A;  1URJ A;  3C2K A;  2QB0 A;  4C4S A;  2AU0 A;  4U7C A;  5J2I A;  2G08 A;  4RQ1 A;  2KVS A;  3UXO A;  4I2J A;  8ICF A;  4RQ0 A;  3HJE A;  4QIW C;  2FMQ A;  1FEZ A;  3CNH A;  2WF6 A;  2E3T A;  5ALP A;  1L3V A;  1NZP A;  2R8J A;  7ICI A;  2QB1 A;  4CCH A;  2IHN A;  2JZB A;  1JXE A;  5ALG A;  2KP7 A;  3IV6 A;  2AGP A;  5J0Q A;  2VJ4 A;  2XY5 A;  5JUM A;  4TQS A;  3MGV A;  3L3F X;  1ZJN A;  2G5H B;  4EEY A;  4NL9 A;  4BXO B;  1TKD A;  4ED6 A;  2KZ3 A;  4KLS A;  3QYP A;  5DLF A;  2YMP A;  1S10 A;  4HAI A;  1SV4 A;  1RYU A;  3HT3 A;  4CF3 A;  3ORY A;  3ZD9 A;  3RBE A;  3V7L A;  8ICG A;  3MDA A;  1WYG A;  4P0P B;  2EAP A;  2PFP A;  3ZDB A;  4O3N A;  5ALO A;  2JEI A;  2DUY A;  4QZE A;  2KKV A;  2HCF A;  2Q4T A;  5KFH A;  5JRT A;  3B9J A;  5ALM A;  4DSL A;  1V85 A;  3K1Z A;  3C5F A;  4YG2 A;  1S0O A;  8ICB A;  4RUA A;  2XID A;  4DSE A;  4UB1 A;  2FDR A;  4BGD A;  5T14 A;  3BZK A;  4RQ6 A;  2ZXH A;  3PO4 A;  1SXD A;  1X66 A;  2HHS A;  5KT5 A;  3RRG A;  4O5K A;  7ICV A;  1V97 A;  8ICM A;  4J03 A;  1L3S A;  2DQN B;  4K4I A;  5KFA A;  3Q8P B;  4ED1 A;  4O3S A;  3IRU A;  5EWG A;  3EZ5 A;  1HUZ A;  4KTQ A;  4KMO B;  2ZUD A;  2HHX A;  1RQL A;  1Z4O A;  3VC8 A;  2B21 A;  1JRO A;  4MFA A;  3SV4 A;  3H7I A;  9ICN A;  1XSP A;  2FPM A;  3HX0 A;  3QX7 A;  4DF8 A;  2BCS A;  4I2H A;  3F53 A;  1S8O A;  2RDI A;  3TKA A;  3CW2 C;  1NKE A;  1X6J A;  2BHN A;  2BQR A;  4BX9 C;  1J2N A;  2ZTD A;  4B9N A;  5J0S A;  4ED3 A;  4JK1 A;  3F2C A;  4I28 A;  2LKY A;  4DQP A;  3ISD A;  1M6Y A;  5KT4 A;  4QW9 A;  2OXO A;  3RR7 A;  4EBD A;  3C28 A;  1L3T A;  1OXJ A;  2ZIU B;  5ALN A;  5ALV A;  2ZJ8 A;  3UMC A;  5EE3 A;  2K4P A;  3HPO A;  2KSO B;  8ICU A;  4RPY A;  3WKA A;  1YZ7 A;  7ICU A;  4YMN A;  1N56 A;  3PW0 A;  4QWC A;  1X9X A;  1L7O A;  4B9S A;  2KJ5 A;  1X9S A;  3RB4 A;  1JN3 A;  5KT7 A;  2FMP A;  3OHB A;  3MR3 A;  4M04 A;  5JU5 A;  3C1Y A;  3SZ2 A;  3IN5 A;  2ZIX B;  2E8M A;  2EZX A;  4UAW A;  3TAC B;  1JRP A;  1ZQZ A;  3Q8L A;  4KLO A;  7ICS A;  4FZM A;  5D46 A;  3PW5 A;  3N4M B;  1B22 A;  1HUO A;  5CEH A;  5KFW A;  1ZQF A;  2ZG6 A;  2H3I A;  2P6U A;  1WWU A;  3AMZ A;  4P0Q A;  5IIL A;  1Q3U A;  1D8L A;  2H3Q A;  5J2J A;  2DPI A;  2RLT A;  2LBO A;  1JX4 A;  5KT6 A;  2FI1 A;  4QZD A;  7ICM A;  2ASL A;  5ALK A;  5BOL A;  4RQ5 A;  4RQ2 A;  4LJX A;  4I2D A;  4J9M A;  7ICO A;  3FM9 A;  5KFV A;  3QU4 A;  1BPY A;  3NVZ A;  3TAR A;  5AKK A;  4ELU A;  3H4B A;  4R8U B;  3HW8 A;  8ICT A;  2G06 A;  1RXV A;  2HSZ A;  2V4R A;  2A3V A;  3RR8 A;  2BCQ A;  3MFI A;  2OM6 A;  3SR6 A;  4K4H A;  3TAP A;  4I2C A;  2JZB B;  1JI7 A;  1PVQ A;  2QAR A;  4ED2 A;  3M9M B;  2LI6 A;  4C7Z A;  4OJP A;  3V6K A;  3O0F A;  2LM1 A;  4CF4 A;  4M9J A;  5AKY A;  4R64 A;  1U9L A;  2I5H A;  5DKW A;  2XI9 A;  1D9D A;  2W9B A;  2C2R A;  5IIK A;  9ICX A;  2NRT A;  3CRX A;  4UAT A;  9ICF A;  1T7P A;  2BPC A;  3H4D A;  3NRZ A;  3T5H A;  4GFJ A;  4IQU A;  1SKS A;  3K75 D;  4NLN A;  5F9N A;  3OSP A;  4F5R A;  4DEZ A;  1N63 A;  3NRW A;  3ONN A;  2PXI A;  3FDS A;  4F5O A;  3RJE A;  3MBY A;  2HHU A;  3PV8 A;  2UVR A;  3AQE A;  4CDG A;  3TFR A;  4Q8E A;  4O3P A;  3N7S C;  1JAL A;  3N7R C;  3Q8Q B;  2K89 A;  5J2A A;  3M1Y A;  4NL9 C;  3F5E A;  2AJQ A;  5AI6 A;  3V6H A;  3SAH A;  4RQN A;  1UT8 A;  4NXZ A;  4NM1 A;  2ZJA A;  4I2F A;  5F3X B;  5J0R A;  5CB1 A;  2BQ3 A;  3PMN A;  5GTH U;  1RG6 A;  4FS2 A;  3C21 A;  5L9X A;  1TK0 A;  5ALX A;  1BPE A;  2W11 A;  1S0M A;  1TFR A;  3LWL A;  4IRK A;  1WWV A;  3ZDE A;  3SI8 A;  4UB6 U;  5KG7 A;  2IOF A;  4CGZ A;  2E8P A;  4QW8 A;  1CI4 A;  3PY8 A;  4UW9 A;  3PSF A;  3AL0 B;  2HDO A;  4C8M A;  1N48 A;  2YMQ A;  2KK0 A;  4LZG A;  4EBC A;  5EWE A;  3PO5 A;  1WUD A;  1DK3 A;  3PR5 B;  4DL5 A;  4YMO A;  2NO5 A;  5C5J A;  4IL6 U;  2F44 A;  4F4K A;  3WK9 A;  1WG8 A;  3H0M B;  4C8O A;  4MFF A;  1Z4N A;  2QKQ A;  3LWM A;  3ZD8 A;  4C7Y A;  4RQ3 A;  1U48 A;  3E58 A;  4XRH A;  2YTU A;  3A0B U;  5ALZ A;  1KL9 A;  4Z6E A;  4DOC A;  1RYS A;  5HR7 A;  3GIK A;  2Y9U A;  1TAQ A;  3QUC A;  4F4Z A;  3GII A;  3PX6 A;  4KMU A;  4YQW A;  4YVZ A;  2KZZ A;  2WAQ F;  4YN4 A;  3PML A;  4Q43 A;  3JPR A;  4ECW A;  8ICI A;  1KFT A;  2R8G A;  3QU5 A;  9ICU A;  2EH9 A;  4KN4 A;  1N61 A;  7ICE A;  5DG9 A;  2JR5 A;  3V7J A;  5DQG A;  5CHG A;  4UB5 A;  4MF8 A;  3RF9 A;  9ICR A;  1COK A;  4P4O A;  1T94 A;  5AKG A;  4GXI A;  4MHV A;  9ICV A;  4NJ8 A;  2EZY A;  4QZG A;  5DLG A;  4XUS A;  5III A;  4RQ4 A;  3UPQ A;  4O5C A;  4P0Q B;  2MA1 A;  2WF9 A;  2KZM A;  2IOF K;  4RT3 A;  3R9K A;  1ZRN A;  4O9M A;  5ALR A;  2BCV A;  1NJW A;  1AQ6 A;  1U47 A;  4QJF B;  5DDY A;  4O3R A;  2A1J B;  5KFZ A;  5J0T A;  3C5G A;  2ASD A;  4M9L A;  1ZOL A;  2L5Y A;  2JH7 A;  3H40 A;  1FO4 A;  2XY6 A;  5KG4 A;  1SL0 A;  1Q8K A;  4PPX A;  4AYB F;  4DSK A;  1VDV A;  5L1I A;  5EWF A;  4PHA A;  4I2E A;  1K1S A;  5J0W A;  2E5S A;  4QWD A;  1BPB A;  2HBK A;  4QZ9 A;  1FFU A;  3KHG A;  2K8C B;  3C1Z A;  3JPN A;  3RB3 A;  2G07 A;  1QH9 A;  4NLK A;  2ZJ5 A;  4DF4 A;  2XCA A;  1ZQD A;  1C7Y A;  9ICA A;  2IA6 A;  5DB8 A;  4DQQ A;  1L5U A;  5J2H A;  1ZQA A;  3C2M A;  2W9B B;  4QZI A;  3BS5 B;  4NY8 A;  4DL4 A;  3JPO A;  3NGD A;  4CE6 A;  5AIC A;  5DDM A;  5EOZ A;  1RM6 C;  4J9Q A;  1ZD5 A;  1RDF A;  3OPX A;  2HVH A;  4YR3 A;  3LYS A;  3NS1 A;  2F76 X;  2JH1 A;  8ICX A;  4DSF A;  4FBU A;  2K4H A;  3IHQ B;  1KFS A;  9ICH A;  1B4F A;  5ALJ A;  1YT3 A;  2XO7 A;  4J9S A;  2WF5 A;  3SAF A;  3H8W A;  2LYH A; 
#chains in the Genus database with same CATH homology
 4NJ8 A;  5JTI A;  1RG6 A;  3KKA C;  2QB1 A;  1PK1 B;  1WWV A;  2ESE A;  3SEI A;  2KSO A;  2EAM A;  2D3D A;  2EAN A;  2E8P A;  3SEN A;  1DXS A;  2DL0 A;  1SV0 A;  5L1M A;  3BS5 A;  1OXJ A;  4NL9 A;  2KIV A;  1B0X A;  2EAO A;  1JI7 A;  4PZO A;  1LKY A;  2L5Y A;  2QAR A;  2QB0 B;  2ES6 A;  2K4P A;  2KSO B;  4RQM A;  1SV4 A;  1X40 A;  2F44 A;  2DKZ A;  2EAP A;  1UCV A;  2LMR A;  3H8M A;  3KKA A;  3TAD C;  2D8C A;  5J8Y C;  1X9X A;  2QKQ A;  1LKY B;  5KNI A;  2DKX A;  2YTU A;  2F8K A;  5JRT A;  1V85 A;  2GLE A;  2KMD A;  5JU5 A;  1PK3 A;  2F3N A;  2Y9U A;  3IDW A;  1SXE A;  1Z1V A;  2FE9 A;  2E8M A;  3TAC B;  1F0M A;  3K1R B;  2E8N A;  1SXD A;  1X66 A;  1UQV A;  2E8O A;  2K60 A;  3BS5 B;  4PZN A;  1SGG A;  2Y9T A;  3HIL A;  1KW4 A;  2QAR B;  1WWU A;  2JV3 A;  1SV0 C;  2KE7 A;  2QB0 A;  3TAD A;  3BQ7 A;  1V38 A;  4NL9 C;  3BS7 A;  2LPE A;  1OW5 A;  1PK1 A;  5J8Y A;  4RQN A;  2B6G A;  1B4F A;  5F3X B;  1COK A;  4IS7 A;  2KG5 A;  4MHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...