1UQVA

Sam domain from ste50p
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
GSHMNNEDFSQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDSKLEWKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Sterile {Alpha} Motif (Sam) Domain of the Saccharomyces Cerevisiae Mitogen-Activated Protein Kinase Pathway-Modulating Protein Ste50 and Analysis of its Interaction with the Ste11 Sam
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords STE50 PROTEIN
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09235 SAM_Ste50p Ste50p, sterile alpha motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1uqvA00
1SV0A 1V38A 3KKAA 3KKAC 4NJ8A 2E8PA 1JI7A 5J8YA 5J8YC 2DL0A 1SV0C 1B4FA 4IS7A 5L1MA 2KSOA 2JV3A 3BS7A 1OXJA 1X66A 1COKA 2EAOA 1V85A 2D8CA 3HILA 2K60A 3TADC 2KMDA 2LMRA 2F3NA 1PK1A 2KSOB 2F8KA 1WWUA 2EANA 4MHVA 1RG6A 1DXSA 5JTIA 2E8NA 2L5YA 1PK1B 4RQNA 1X40A 2KIVA 1Z1VA 3K1RB 1SV4A 2EAPA 2LPEA 2Y9UA 2ES6A 3BS5A 2ESEA 5F3XB 5JU5A 2DKXA 1KW4A 3IDWA 3TACB 4RQMA 1PK3A 2FE9A 5KNIA 3BS5B 2K4PA 3BQ7A 2B6GA 4PZOA 1F0MA 2QB0A 4PZNA 4NL9C 1UQVA 3SENA 1SGGA 3TADA 3SEIA 2QB1A 1WWVA 2QB0B 5JRTA 1SXEA 2E8MA 3H8MA 2Y9TA 1LKYB 2E8OA 1B0XA 1X9XA 2QARB 1LKYA 2F44A 2QKQA 2YTUA 1UCVA 2EAMA 2KE7A 2QARA 2DKZA 4NL9A 1SXDA 2KG5A 1OW5A 2D3DA 2GLEA
chains in the Genus database with same CATH superfamily
4EX6A 2K89A 5DBAA 1A6SA 5HMMA 4XUSA 4YD2A 4BXOA 1MQ2A 3AN1A 4IS7A 5L1MA 2GOLA 5J2CA 3C2LA 2O6KA 3QUQA 2F3NA 3O0FA 2BHNA 3OSPA 2ZIXB 4DSIA 5C5JA 5ALWA 2LM4A 4DSLA 4NY8A 2AGOA 2EZYA 3DEEA 3PNCA 3CP8A 1PK1B 1ZOLA 3RJHA 4F71A 8ICYA 3MGHA 3WK8A 4RQ5A 3HPOA 3OGUA 4OJOA 2ESEA 3PZPA 4EEKA 2XO7A 5KFHA 3SI8A 7ICLA 2ATLA 5KNIA 4FO6A 1HEKA 4QZEA 1U45A 2B6GA 1KEJA 2HOFA 3A0HU 3I28A 1SL2A 2KZ3A 1ZQIA 1S76D 5AI5A 3QEBZ 1L7NA 3JPPA 4UB5A 9ICNA 3Q8SB 3H40A 5KG6A 4F5NA 3GV5B 3PW0A 5KFCA 1WWVA 2BPFA 4C4RA 5ALSA 4UB1A 2MU2A 4NLZA 2IOFA 1A0PA 3H0RB 3DV9A 2ASLA 3QU5A 2AJQA 4NLCA 3ISBA 1WUDA 2J6UA 2WHEA 2KKVA 4CE6A 5KFKA 1BGXT 2FJ6A 3T5JA 3WKBA 4O3PA 4M9LA 1L3UA 2AH5A 2XC9A 3V7JA 2D3DA 2UVVA 2PI4A 2HHXA 3N7PD 2F1HA 3ZD9A 1FFUA 4C4SA 1RZTA 5J8YA 2KSOA 4DFKA 1X2IA 1KL9A 4DSEA 3IG8A 1XO1A 2BPGA 4OCZA 3RAXA 5KT5A 4M6WA 2DFLA 4QW9A 1CEZA 8ICCA 1SZHA 1SB3C 1Z19A 2H5XA 1B22A 4O3QA 5ALHA 4JWMA 1F5SA 1YT3A 4KN4A 3ISCA 4ELUA 5F3XB 4O3MA 2HI0A 3C2MA 3IDWA 1RQLA 3TACB 3HWTA 3BZCA 2G5IB 3BS5B 3BQ7A 2ZIVB 4J9RA 2KK0A 3V72A 4O5CA 5KAFU 3PO4A 5ALEA 3H0LB 5IIIA 4UAVA 3MGVA 3ZDDA 3MGIA 3ETRA 1Z00B 2ZTEA 2OM6A 1UPHA 2QB0B 2LI6A 4OJLA 8ICIA 2P6UA 3RH4A 4P4OA 2PI5A 5DGAA 2KZZA 5J0WA 5KFIA 4I2DA 1RYSA 3PSIA 4FBUA 1QSYA 1BPBA 1JMSA 1KSPA 4F5PA 1JX4A 4YD1A 1UCVA 1SIJA 4QW8A 2W9CA 2IHMA 1SXDA 5ALGA 5DB6A 3RR8A 3ZI4A 3Q8RB 2HBMA 1L5UA 4C7ZA 3KKAA 5G5GA 2KFNA 1ZETA 1KN5A 1UHUA 4AP9A 4QZFA 3MFIA 2EZXA 3MR2A 4TUQA 2DPJA 1S77D 4P4MA 8ICMA 5AICA 4GXIA 3RF9A 5J2FA 1L6NA 1N61A 1WCLA 3D2SA 2WF8A 3TAQA 1VLBA 1B43A 1BPYA 1IV8A 1ZQRA 3KOOA 2DGZA 2ZJ5A 1NJWA 2LPEA 1D9DA 5A0LA 3E2EA 4JK1A 3JPOA 4F5RA 4IRCA 1TK5A 7ICSA 2VKQA 2FE9A 1RM6C 3K75D 5J0TA 4DS4A 4M04A 5BOLA 2GO7A 5AKGA 3JPQA 4ECXA 5KT4A 3TANA 4JUZA 1S97A 4ECVA 1LKYB 4Z6DA 1AQ6A 4QZDA 8ICSA 1K1SA 2JZBA 3HT3A 3ZD8A 1X9XA 5ALZA 5B66U 5ALIA 2ASJA 4LZDA 2ZG6A 4PL1A 2MRLA 9ICTA 5T14A 1L3VA 1IIPA 3T5LA 5DQHA 3J81j 1ZQBA 5KFVA 4F4ZA 2ISPA 2V9WA 1T4GA 3K4GA 1X9WA 1V38A 3ONNA 4UB2A 3BQ2A 3M7DA 1HUOA 3GDXA 8ICNA 4PL2A 5KFDA 1MC8A 2ASDA 1J2MA 3THVA 3FM9A 5AK3A 4F91B 1PUZA 5KG0A 3N7SC 3WK4A 4B9UA 5ALQA 5KG3A 1ZQPA 2NV3A 2HVIA 1Q46A 2L5YA 5ALDA 4DS5A 5AM1A 1ZQXA 2G09A 5IIMA 1TVAA 4AYBF 4E0DA 4RQ3A 2CRXA 2KVSA 2WF6A 2ES6A 2R8KA 2LHTA 4Y2JA 2XGPA 4MFFA 1PZNA 9ICRA 3RTVA 1ZXIA 5EE1A 1NJXA 2EDUA 3RB6A 5DDMA 4XQ8A 4PGXA 1N2XA 3RJJA 2KFZA 3GIIA 3RAQA 5KTQA 3AL0B 2MUTB 2B21A 4C8KA 1ZQSA 1SKSA 1N60A 2YMLA 4UASA 1QLNA 3JPSA 5J0UA 4P0QB 2E8OA 2KJ5A 2K8BB 4J9QA 4HAIA 1DGJA 3RJKA 2C2RA 4I2HA 2OH2A 3M1YA 3LVWA 4QZCA 3B9JA 5GTIU 5KFWA 5CEHA 3JPNA 3Q8KA 4NL9A 5DQIA 7ICQA 4F3OA 2MA1A 2ZUCA 4QZAA 3TARA 3NASA 4TQRA 2M9NA 2W9CB 4NJ8A 4O3OA 2E8PA 5CWRA 1KBUA 2KICA 3LK9A 5ALTA 3BS7A 1X66A 5KG4A 4RNMA 4PHPA 4C0ZA 4J9KA 4X5VA 2D8CA 3IM1A 4F92B 3UXPA 4BWMA 4KLMA 9ICVA 1NNLA 1T8EA 4NLGA 4ED8A 2RRDA 5AKEA 3HKZF 2NRWA 3T5HA 4US8A 1ZQJA 2NRVA 3T3FA 1X40A 1S0NA 5KG5A 4J9LA 5KFAA 5AK6A 4QWAA 2KVCA 5KG1A 4ED7A 4OJ6A 4ECWA 3ALRA 3V6KA 4KLJA 3BQTA 4FBTA 4TUPA 8ICTA 3MC1A 3ORYA 9ICEA 2JH1A 4I2AA 3KFUF 3N7RC 1F0MA 4EYIB 4RQ2A 2P35A 4YG2A 1IM4A 1TV9A 4QIWC 3PSFA 4KLOA 9ICOA 4KTQA 2GH1A 3ETLA 3WKCA 1RYUA 4MFCA 5J2JA 4P0PA 3RB3A 4J9NA 5IINA 1QTMA 2I6XA 4RUCA 5AI9A 4RZRA 3PO5A 4RT2A 1N48A 4MFAA 3RBDA 1VJ5A 2HDOA 2FMSA 2UVUA 7ICEA 4CF5A 5DKWA 2KN7A 4CGZA 5KFOA 2JZBB 2K8AA 3OJSA 4GC6A 5ALUA 2ZIUB 4F4KA 3QUCA 2E1FA 3GIKA 3EPGA 5D49A 5AI0A 1KRPA 7ICOA 4UAZA 3TAPA 4BUGA 4OO1J 2YY6A 1OXJA 2LBOA 3KD3A 4ECYA 1L8OA 2HHUA 1NJYA 1V85A 3PVXA 1IXRA 9ICIA 2WAQC 2KMDA 2LMRA 4IC9A 1ZQKA 2MSNA 5KFUA 5F9LA 1QCKA 1MQ3A 5HHIA 1ZQAA 4Y2VA 3UMBA 5KT6A 1NK7A 4RQ0A 4I2JA 1K5OA 4Y2QA 1YZ6A 1P7DA 3T5KA 2PMZC 5J0XA 3RFAA 5HP4A 4Z6EA 2PXIA 8ICQA 3H7IA 4M0AA 3UMCA 5KT7A 3QYPA 5DBBA 3DDHA 2F1IA 5ALOA 2HBKA 3HKZC 4PHDA 3WK5A 3SENA 3H4BA 1NI3A 3B0XA 5KFYA 2CXYA 1YZ7A 2A19A 8ICBA 1KLNA 1NK6A 4UBBA 2MUTA 2YMQA 2I9GA 9ICBA 3QUBA 3FC4A 4R64A 1B0XA 4UBCA 1K1QA 4R8UB 3EWAA 1ZYQA 4I2EA 1Z4OA 1ZRNA 4P0QA 2W3SA 5KFTA 5HNKA 2HCFA 2G0AA 2HMXA 2DF4B 2XICA 5KT2A 2DKZA 3RJIA 2PFQA 2RHFA 3LYSA 2K4IA 2KG5A 4DSKA 2ZJ8A 2RQ5A 1SV0A 5KFXA 5J29A 3OPXA 3M8RA 2Y0SC 2V4RA 9ICLA 4M9HA 2K8CB 4F93B 2JR5A 8ICXA 2JV3A 5CA7A 4IR9A 3B0YA 1COKA 1FIQA 4IQUA 2UVWA 1X6JA 5HHHA 1JROA 2HVHA 1ZJNA 3QU9A 4DF4A 2J6SA 3BQ0A 4B9SA 1L7MA 3VC8A 2Y1JA 1TFRA 1SV4A 3SV4A 3PW5A 1SWVA 1FEZA 1KFTA 3M9OB 5KL1B 3M9NB 2W7PA 5DQGA 1CUKA 3SR6A 2JHDA 2XY7A 2W8LA 5AIAA 2C2DA 1KKXA 3BZKA 2WF9A 2J6TA 4TUSA 1JXLA 4PZOA 1U4BA 1X42A 1ZQ1C 3I1YA 2AGQA 1Q3UA 3GU3A 4DL2A 1T3QA 1BPDA 5KFJA 2HHTA 5J2BA 4IQVA 2VANA 4PGQA 2KIWA 2ZUBA 5KFRA 2HHQA 1ZD4A 3WKAA 5KFSA 4M47A 5J0YA 4DOAA 3IP4B 4ECZA 1UT5A 5ALJA 9ICPA 5IIOA 5BPCA 2Y9TA 4XRHA 2H3ZA 1QQ7A 2CN1A 4EBDA 4OJ5A 4Y2SA 1RXVA 1LKYA 7ICUA 2ZIUA 8ICWA 1RQNA 4CDGA 1RXWA 2H3FA 2EAMA 3MDCA 4ECRA 2W03A 5ALXA 3TI0A 5J2HA 1T3NA 1X9SA 5EE9A 4Q8EA 3NGDA 9ICCA 4YMNA 5EWFA 3TFRA 2F77X 5J0OA 4YXMA 4C4TA 2G08A 5J0QA 4EBCA 5ALMA 9ICAA 2LYBA 4YCXA 4HYKA 4RPZA 2LM1A 1NK4A 1JALA 2E5SA 4RQNA 1NKEA 1A77A 5D46A 3K1RB 3PX4A 4LJXA 3SAHA 1Z4NA 4ECUA 2C2EA 4KX3A 2JGAA 4O3NA 1ZQFA 5DG8A 2DQNB 2FDRA 1TE2A 2DPIA 2R8IA 3WK9A 3L4PA 2WTFA 1PVRA 1Z3EB 4TQSA 4I27A 4OJPA 2ODGA 5L1LA 3BQ1A 4QZ8A 4Y2YA 3F2DA 2FMQA 1NZPA 3M8SA 3I76A 9ICKA 1DK2A 2JEGA 2KP7A 3HRDD 2MAXA 1U47A 5KFEA 1ZQUA 2RDIA 1IG6A 2IOFK 5JUMA 1SKWA 4WJ3B 1JRPA 1ZQQA 3RRGA 4DQPA 3CW2C 3WK6A 4DL3A 4KLLA 3Q8PB 1QQ5A 4NLNA 2YB4A 5KAIU 4F2RA 2W43A 4GLXA 3S6JA 5DGBA 4U7CA 3EYZA 3V6JA 4YR3A 1FFVA 1PVPA 1TK8A 4KLTA 1BPZA 1PVQA 4C8LA 4YMMA 9ICXA 3NTUA 3NVZA 3KHHA 1J97A 5HR6A 2VA8A 2HHVA 3AQFA 3C23A 4YR2A 2ZIXA 4CCHA 2XIDA 4BXOB 5KFFA 3LDAA 1ZQDA 4R66A 3ZDAA 1BVSA 1QQ6A 5AM5A 4Q43A 1PK1A 4UARA 4A8EA 2XY5A 4AYBC 2KKPA 1RG6A 4F4WA 2YX8A 4ELVA 3N4MB 2E8NA 2VJ4A 2ISOA 4GFJA 2AGPA 1OUQA 1Z1VA 2A1JA 4I2CA 3Q8LA 1ZQLA 4YMOA 2EAPA 4EZ6A 4J9PA 3RJFA 4O5EA 5BOMA 2XVTA 5EE0A 1NK9A 4BWJA 1L8LA 4DO9A 2IOHA 4PJ0U 4NLKA 8ICFA 4KN7A 3IHQB 1U49A 3PSPA 4NM1A 2EQYA 3OHAA 4RQ4A 5IILA 2FMPA 1ECWA 2NO4A 3D2QA 3R9KA 2M0NA 4F5QA 5ALKA 7ICRA 4RPYA 3G6XA 3PR4A 4CF4A 2E8MA 2EH9A 3H0MB 2BCUA 4C8NA 4C80A 5KFMA 3M6KA 1Q8KA 4R63A 3PMLA 4LZGA 4J03A 4QNLA 3PX0A 5AM4A 3SQIA 1N62A 4F50A 4EENA 2QKQA 4I2IA 2OWOA 1ZJMA 2W8KA 1XU4A 4QJFB 4ED1A 2NO5A 2KE7A 4I2FA 4ED2A 5AK5A 2W9BB 5L1KA 2XI9A 4DF8A 2XGQA 1U48A 4C8MA 4K4IA 2YMPA 5KFQA 5EWGA 2FI1A 2PMZF 1JI7A 4QZHA 5DBCA 4NV0A 5AKKA 1B4FA 3ZDEA 3F2CA 2KTQA 5ALRA 4Z6FA 3MABA 4KITB 3UPQA 1CRXA 3HW8A 1ZQNA 2FPMA 1DXSA 2PFPA 4RQ6A 4UATA 2JEFA 1DOQA 2OCEA 4JWNA 1CI4A 4QIWF 4DQRA 4FZNA 4Q8FA 2Y9UA 1V9PA 3FYHA 4B9LA 5CR0A 4PHAA 3V6HA 4G9BA 4QWCA 2KNJA 1PK3A 3GIMA 5KG2A 2H3VA 4DFPA 4B9NA 1Z00A 4EX7A 5L1JA 1MSWD 5KFGA 5CRXA 4EYHB 5ALLA 4PZNA 8ICJA 2P6RA 4CNQA 5DG7A 4QZIA 4F5OA 2QB1A 4K4HA 3KHLA 1XSNA 2VA3A 3C1ZA 5CJ7A 8ICVA 7ICNA 4US9A 5EE3A 3EUB2 2Z7JA 3CRXA 2Q4TA 4CF3A 2OEHA 5IIJA 4KMUA 3RB0A 2A3VA 1ZQCA 1S0OA 1RYRA 2ALZA 4RNNA 3N28A 1O03A 3H8JA 2CPRA 2KV2A 3NS1A 3IV6A 4DFDA 8ICRA 3SZ2A 1OW5A 4PGYA 2GLEA 3KZIU 4DOCA 5KFNA 4RUAA 1S0VA 2H3QA 2AQ0A 4KLSA 3SD7A 2HSZA 2W9AA 3BDPA 4R65A 2XCPA 1NK5A 2BCVA 3V7KA 1LV5A 2R8GA 5AIBA 2WAQF 2UVRA 2DBYA 8ICEA 1JUDA 4Q44A 1F44A 3CYMA 4QWDA 2JEJA 2KD1A 4FZLA 2F8KA 4NM2A 4M9GA 1JIHA 2BPCA 5DB8A 2A1JB 2FPKA 2W3RA 5D4BA 3KTQA 5KFLA 1SL1A 3LVVA 3ICXA 3IN5A 2C28A 2YN4A 7ICMA 2KIVA 3TQ1A 4UB6U 4UB8U 1FO4A 2RDJA 5AKYA 3WU2U 1KQQA 2NRZA 4YXJA 3HX0A 4DLGA 3UQ0A 4DQQA 3EZ5A 4KLIA 2JXJA 3A0BU 2ZXIA 9ICSA 3PR5B 2FLNA 2W9MA 2D6FC 3MFHA 4DL7A 4IL6U 8ICKA 1JN3A 4RQ1A 2F8LA 3RBEA 4FE3A 3U26A 2KZMA 3QZ7A 4IRDA 7ICVA 2BQ3A 7ICFA 3GIJA 5DLFA 2EZZA 4FS2A 1WCNA 5KL8B 2VIXA 4ECQA 4DLEA 2W11A 5EOZA 1T7PA 1S0MA 2WF5A 5AK4A 4DOBA 4UAYA 1J2NA 1JXEA 4YQWA 7ICHA 1O08A 3GV8B 2Q0ZX 2OYYA 5AKJA 2IBKA 5FP0A 3K1ZA 5AM3A 1T94A 3QEAZ 5HMLA 4MEXA 3KHGA 3KKAC 3D6JA 2H3IA 1S10A 5AM0A 1SV0C 4F2SA 1KFDA 4DSFA 3GQCA 4O3SA 5AKIA 1L3SA 5CHGA 1EXNA 3RH6A 2XCAA 2K60A 2R8JA 1D8LA 1AROP 3V7LA 3G6VA 4ZOHC 3AMZA 4G3IA 4JB3A 3L5KA 8ICUA 3VCBA 1RDFA 2K4EA 3OTQA 3M9MB 5J0SA 3SMVA 2BCSA 4J9SA 4DEZA 2Y1IA 3QX7A 4O9MA 4JV0A 3RB4A 5H2FU 1ZQEA 5JU5A 4NXZA 1KW4A 1ZQZA 5AM2A 3RRHA 2BCRA 4QZ9A 2BZFA 2I1QA 2KHQA 3C5GA 4UAUA 4B9TA 5J0PA 3PV8A 5F9NA 4ICAA 3NVYA 3AU2A 1N5XA 1NZBA 2F2AB 2FPLA 5J2KA 1Q3VA 4PHEA 2ZTCA 1HJPA 3EW9A 3GFKB 3SEIA 7ICKA 4Q45A 3NUQA 3QU2A 4U6PA 1ZQGA 3QU7A 3ZDBA 2HW3A 3NRWA 2BDUA 1HIWA 1BNPA 3KZXA 4IR1A 3MR3A 3HP6A 1NK8A 4M9JA 2W7OA 8ICHA 1COOA 3Q8MA 3KHRA 2F44A 4Y2TA 4ACOA 2VA2A 1WG8A 1NJZA 2HOQA 2RP5A 5CB1A 5EWEA 1TKDA 1ZQHA 5HR7A 2OXOA 9ICFA 4DL6A 8ICZA 2GWSA 3AUOA 1NKBA 2Y0SF 1TAUA 2RLTA 4JV2A 9ICQA 1C20A 2NYVA 3QU4A 4C7YA 2OHFA 4UW9A 2JMGA 1TK0A 1A76A 1WWUA 7ICIA 3PY8A 3F53A 1DRGA 9ICUA 4RPXA 1L7PA 4QWEA 1QSLA 2G07A 4RQ8A 5ALNA 4Y2PA 3AU6A 4UAWA 3E0FA 3NVVA 3PW7A 3C1YA 4M2YA 3MBYA 3C29A 5L1IA 4J9OA 4PPXA 2AU0A 4RQ7A 4FS1A 4DSJA 8ICLA 1ZD2P 4B9VA 4O3RA 4GXJA 1UQVA 4RU9A 5DB7A 4DQIA 2HHSA 3C28A 4M9NA 5J0RA 2BCQA 4F4YA 3FDSA 4GIBA 2PFOA 1MN8A 3WKDA 3IG5A 4P0PB 4ZH4A 3TFSA 4I29A 2BQRA 4OD0A 4ECSA 3PW4A 3C2KA 4FZMA 1ED1A 2F1JA 4O5KA 2HBLA 3QUTA 3PSTA 2G06A 5DB9A 5J2DA 1DGSA 3CNHA 3N97B 5B5EU 3RJGA 3H4DA 5TISU 5AKZA 9ICGA 1BPEA 3GV7B 2BR0A 5DLGA 1LVHA 4BDPA 2ZIWA 1LB2B 9ICJA 2W54A 2YMMA 1XS9D 2W9BA 1UA1A 1ZQMA 3EPIA 3AQEA 4MEYA 4KLEA 5J8YC 2DL0A 4ED6A 2BDPA 2F76X 5E79U 3QE9Y 3SAGA 2EAOA 3SYZA 3TADC 4DFMA 5GTHU 4B6JA 4YP3A 3PW2A 1S5LU 2YQEA 4LVSA 4P4PA 4JV1A 2BKEA 3RH5A 4UQGA 4KX5A 4DCCA 4EELA 4ECTA 1QSSA 1N56A 1ZQYA 5KFBA 2QLTA 3BS5A 1L7OA 1QH9A 2P66A 1U9LA 2I5HA 2WB1F 1SKRA 2ZJAA 4IQTA 2HOIA 4F8RA 4KLHA 4B9MA 3QNMA 3HJEA 1ZQOA 1DK3A 4BJQA 3D2NA 2DUYA 2YB1A 3C5FA 4NWIA 4I28A 1D8BA 2QB0A 3AM9A 4ELTA 3QXGA 4NL9C 4Z6CA 4ED3A 5ALYA 4MF2A 2R8HA 5CP2A 4PH5A 1SGGA 1NOMA 3M6ZA 1N63A 3UQ2A 5J2IA 5JRTA 3JPTA 1C7YA 3OJUA 1KFSA 4FFDA 5ALVA 1HUZA 4KLQA 4R8UA 2AQ4A 2FLLA 4GXKA 1D9FA 4QWBA 1Z1BA 4BGDA 1KTQA 8ICGA 2XY6A 2JH7A 2KJ9A 5G5HA 1KDHA 5ALPA 1D8YA 2WFAA 4J9MA 2YTUA 5K4LA 4I2BA 1XNSA 2QARA 1N5WA 4I2GA 4KLUA 2HBJA 4Y2UA 3BJYA 1ZRMA 5AHXA 2B0CA 5AI4A 5AI6A 1VDVA 4UB4A 7ICGA 2IA6A 1UA0A 3PMNA 4RNOA 2LYHA 3NVWA 5DG9A 2E1EA 5KFPA 2DWQA 3RR7A 2G5HB 2KJ8A 1ZD3A 1ZD5A 4GC7A 1Y88A 3KBBA 1ZQVA 1V97A 2EANA 4MHVA 1GO3F 5JTIA 3H8SA 4TURA 4CRXA 3SAFA 7ICTA 3JPRA 2K4HA 5DDYA 2IMWP 2PKEA 3SV3A 1XSPA 5AI8A 4K4GA 4DL5A 1SWWA 3ISDA 2AXTU 4P2HA 3PX6A 2LYAA 2PFNA 2DKXA 1NKCA 4QZBA 1S9FA 2K4PA 3UMGA 9ICHA 3GZFA 4XA5A 4EZ9A 1XO0A 2E3TA 3LWLA 3TADA 4DFJA 3F5EA 5KT3A 4MF8A 1BPXA 4KLDA 2NRXA 1M6YA 3L3FX 2JRZA 8ICOA 4JMUA 3E58A 3MR6A 4IRKA 1TAMA 5AKHA 2N1RA 1SL0A 2C22A 3IRUA 3OHBA 2NRTA 2A1AA 2FLPA 1H38A 4QZGA 2ZIWB 4O0IA 4F72A 3MR5A 4DL4A 4NLBA 1X6IA 3ZDCA 5AKLA 2ZTDA 3FAHA 5L9XA 2ZXHA 1MA7A 3WKEA 3T79A 3UXOA 2ZUDA 2LKYA 3OSNA 3MDAA 9ICMA 1WYGA 4USAA 2KHVA 1XWLA 4M6WB 2W55A 1RPLA 4EBEA 3NRZA 3F2BA 1S8OA 3HILA 3G6YA 9ICWA 2KSOB 1ZQTA 3ED5A 5IIKA 3WK7A 4Y2RA 3UXNA 3Q8QB 5J2EA 3RJEA 3C21A 1UT8A 1SZPA 2W04A 7ICJA 2ZIVA 8ICPA 4RT3A 3UM9A 5J2GA 5ALFA 4DQSA 5TZVA 4RQMA 1TAQA 2VJ5A 5AKXA 1XC9A 2HHWA 8ICAA 1X9MA 1L3TA 3QZ8A 1ZQWA 3H8WA 3F5AA 1BNOA 4YR0A 4F4XA 4DWIA 7ICPA 5J2AA 3TKAA 4YVZA 3AEVA 4UB3A 2JEIA 4EEYA 1URJA 4C8OA 4KLFA 5KFZA 2KOBA 2V4QA 1NK0A 1SXEA 3H8MA 2KEYA 2WB1C 4ED0A 2BGWA 3LWMA 2BQUA 5C0YA 2WF7A 4KMOB 2QARB 4IQWA 3GILA 2R18A 1XSLA 5KG7A 4BX9C 4Y2XA 4YN4A 2AHOB 4YFKA 4KLGA 2IHNA
chains in the Genus database with same CATH topology
1SV0A 1V38A 3KKAA 3KKAC 4NJ8A 2E8PA 1JI7A 5J8YA 5J8YC 2DL0A 1SV0C 1B4FA 4IS7A 5L1MA 2KSOA 2JV3A 3BS7A 1OXJA 1X66A 1COKA 2EAOA 1V85A 2D8CA 3HILA 2K60A 3TADC 2KMDA 2LMRA 2F3NA 1PK1A 2KSOB 2F8KA 1WWUA 2EANA 4MHVA 1RG6A 1DXSA 5JTIA 2E8NA 2L5YA 1PK1B 4RQNA 1X40A 2KIVA 1Z1VA 3K1RB 1SV4A 2EAPA 2LPEA 2Y9UA 2ES6A 3BS5A 2ESEA 5F3XB 5JU5A 2DKXA 1KW4A 3IDWA 3TACB 4RQMA 1PK3A 2FE9A 5KNIA 3BS5B 2K4PA 3BQ7A 2B6GA 4PZOA 1F0MA 2QB0A 4PZNA 4NL9C 1UQVA 3SENA 1SGGA 3TADA 3SEIA 2QB1A 1WWVA 2QB0B 5JRTA 1SXEA 2E8MA 3H8MA 2Y9TA 1LKYB 2E8OA 1B0XA 1X9XA 2QARB 1LKYA 2F44A 2QKQA 2YTUA 1UCVA 2EAMA 2KE7A 2QARA 2DKZA 4NL9A 1SXDA 2KG5A 1OW5A 2D3DA 2GLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV0 A;  1V38 A;  3KKA A;  3KKA C;  4NJ8 A;  2E8P A;  1JI7 A;  5J8Y A;  5J8Y C;  2DL0 A;  1SV0 C;  1B4F A;  4IS7 A;  5L1M A;  2KSO A;  2JV3 A;  3BS7 A;  1OXJ A;  1X66 A;  1COK A;  2EAO A;  1V85 A;  2D8C A;  3HIL A;  2K60 A;  3TAD C;  2KMD A;  2LMR A;  2F3N A;  1PK1 A;  2KSO B;  2F8K A;  1WWU A;  2EAN A;  4MHV A;  1RG6 A;  1DXS A;  5JTI A;  2E8N A;  2L5Y A;  1PK1 B;  4RQN A;  1X40 A;  2KIV A;  1Z1V A;  3K1R B;  1SV4 A;  2EAP A;  2LPE A;  2Y9U A;  2ES6 A;  3BS5 A;  2ESE A;  5F3X B;  5JU5 A;  2DKX A;  1KW4 A;  3IDW A;  3TAC B;  4RQM A;  1PK3 A;  2FE9 A;  5KNI A;  3BS5 B;  2K4P A;  3BQ7 A;  2B6G A;  4PZO A;  1F0M A;  2QB0 A;  4PZN A;  4NL9 C;  1UQV A;  3SEN A;  1SGG A;  3TAD A;  3SEI A;  2QB1 A;  1WWV A;  2QB0 B;  5JRT A;  1SXE A;  2E8M A;  3H8M A;  2Y9T A;  1LKY B;  2E8O A;  1B0X A;  1X9X A;  2QAR B;  1LKY A;  2F44 A;  2QKQ A;  2YTU A;  1UCV A;  2EAM A;  2KE7 A;  2QAR A;  2DKZ A;  4NL9 A;  1SXD A;  2KG5 A;  1OW5 A;  2D3D A;  2GLE A; 
#chains in the Genus database with same CATH topology
 4EX6 A;  2K89 A;  5DBA A;  1A6S A;  5HMM A;  4XUS A;  4YD2 A;  4BXO A;  1MQ2 A;  3AN1 A;  4IS7 A;  5L1M A;  2GOL A;  5J2C A;  3C2L A;  2O6K A;  3QUQ A;  2F3N A;  3O0F A;  2BHN A;  3OSP A;  2ZIX B;  4DSI A;  5C5J A;  5ALW A;  2LM4 A;  4DSL A;  4NY8 A;  2AGO A;  2EZY A;  3DEE A;  3PNC A;  3CP8 A;  1PK1 B;  1ZOL A;  3RJH A;  4F71 A;  8ICY A;  3MGH A;  3WK8 A;  4RQ5 A;  3HPO A;  3OGU A;  4OJO A;  2ESE A;  3PZP A;  4EEK A;  2XO7 A;  5KFH A;  3SI8 A;  7ICL A;  2ATL A;  5KNI A;  4FO6 A;  1HEK A;  4QZE A;  1U45 A;  2B6G A;  1KEJ A;  2HOF A;  3A0H U;  3I28 A;  1SL2 A;  2KZ3 A;  1ZQI A;  1S76 D;  5AI5 A;  3QEB Z;  1L7N A;  3JPP A;  4UB5 A;  9ICN A;  3Q8S B;  3H40 A;  5KG6 A;  4F5N A;  3GV5 B;  3PW0 A;  5KFC A;  1WWV A;  2BPF A;  4C4R A;  5ALS A;  4UB1 A;  2MU2 A;  4NLZ A;  2IOF A;  1A0P A;  3H0R B;  3DV9 A;  2ASL A;  3QU5 A;  2AJQ A;  4NLC A;  3ISB A;  1WUD A;  2J6U A;  2WHE A;  2KKV A;  4CE6 A;  5KFK A;  1BGX T;  2FJ6 A;  3T5J A;  3WKB A;  4O3P A;  4M9L A;  1L3U A;  2AH5 A;  2XC9 A;  3V7J A;  2D3D A;  2UVV A;  2PI4 A;  2HHX A;  3N7P D;  2F1H A;  3ZD9 A;  1FFU A;  4C4S A;  1RZT A;  5J8Y A;  2KSO A;  4DFK A;  1X2I A;  1KL9 A;  4DSE A;  3IG8 A;  1XO1 A;  2BPG A;  4OCZ A;  3RAX A;  5KT5 A;  4M6W A;  2DFL A;  4QW9 A;  1CEZ A;  8ICC A;  1SZH A;  1SB3 C;  1Z19 A;  2H5X A;  1B22 A;  4O3Q A;  5ALH A;  4JWM A;  1F5S A;  1YT3 A;  4KN4 A;  3ISC A;  4ELU A;  5F3X B;  4O3M A;  2HI0 A;  3C2M A;  3IDW A;  1RQL A;  3TAC B;  3HWT A;  3BZC A;  2G5I B;  3BS5 B;  3BQ7 A;  2ZIV B;  4J9R A;  2KK0 A;  3V72 A;  4O5C A;  5KAF U;  3PO4 A;  5ALE A;  3H0L B;  5III A;  4UAV A;  3MGV A;  3ZDD A;  3MGI A;  3ETR A;  1Z00 B;  2ZTE A;  2OM6 A;  1UPH A;  2QB0 B;  2LI6 A;  4OJL A;  8ICI A;  2P6U A;  3RH4 A;  4P4O A;  2PI5 A;  5DGA A;  2KZZ A;  5J0W A;  5KFI A;  4I2D A;  1RYS A;  3PSI A;  4FBU A;  1QSY A;  1BPB A;  1JMS A;  1KSP A;  4F5P A;  1JX4 A;  4YD1 A;  1UCV A;  1SIJ A;  4QW8 A;  2W9C A;  2IHM A;  1SXD A;  5ALG A;  5DB6 A;  3RR8 A;  3ZI4 A;  3Q8R B;  2HBM A;  1L5U A;  4C7Z A;  3KKA A;  5G5G A;  2KFN A;  1ZET A;  1KN5 A;  1UHU A;  4AP9 A;  4QZF A;  3MFI A;  2EZX A;  3MR2 A;  4TUQ A;  2DPJ A;  1S77 D;  4P4M A;  8ICM A;  5AIC A;  4GXI A;  3RF9 A;  5J2F A;  1L6N A;  1N61 A;  1WCL A;  3D2S A;  2WF8 A;  3TAQ A;  1VLB A;  1B43 A;  1BPY A;  1IV8 A;  1ZQR A;  3KOO A;  2DGZ A;  2ZJ5 A;  1NJW A;  2LPE A;  1D9D A;  5A0L A;  3E2E A;  4JK1 A;  3JPO A;  4F5R A;  4IRC A;  1TK5 A;  7ICS A;  2VKQ A;  2FE9 A;  1RM6 C;  3K75 D;  5J0T A;  4DS4 A;  4M04 A;  5BOL A;  2GO7 A;  5AKG A;  3JPQ A;  4ECX A;  5KT4 A;  3TAN A;  4JUZ A;  1S97 A;  4ECV A;  1LKY B;  4Z6D A;  1AQ6 A;  4QZD A;  8ICS A;  1K1S A;  2JZB A;  3HT3 A;  3ZD8 A;  1X9X A;  5ALZ A;  5B66 U;  5ALI A;  2ASJ A;  4LZD A;  2ZG6 A;  4PL1 A;  2MRL A;  9ICT A;  5T14 A;  1L3V A;  1IIP A;  3T5L A;  5DQH A;  3J81 j;  1ZQB A;  5KFV A;  4F4Z A;  2ISP A;  2V9W A;  1T4G A;  3K4G A;  1X9W A;  1V38 A;  3ONN A;  4UB2 A;  3BQ2 A;  3M7D A;  1HUO A;  3GDX A;  8ICN A;  4PL2 A;  5KFD A;  1MC8 A;  2ASD A;  1J2M A;  3THV A;  3FM9 A;  5AK3 A;  4F91 B;  1PUZ A;  5KG0 A;  3N7S C;  3WK4 A;  4B9U A;  5ALQ A;  5KG3 A;  1ZQP A;  2NV3 A;  2HVI A;  1Q46 A;  2L5Y A;  5ALD A;  4DS5 A;  5AM1 A;  1ZQX A;  2G09 A;  5IIM A;  1TVA A;  4AYB F;  4E0D A;  4RQ3 A;  2CRX A;  2KVS A;  2WF6 A;  2ES6 A;  2R8K A;  2LHT A;  4Y2J A;  2XGP A;  4MFF A;  1PZN A;  9ICR A;  3RTV A;  1ZXI A;  5EE1 A;  1NJX A;  2EDU A;  3RB6 A;  5DDM A;  4XQ8 A;  4PGX A;  1N2X A;  3RJJ A;  2KFZ A;  3GII A;  3RAQ A;  5KTQ A;  3AL0 B;  2MUT B;  2B21 A;  4C8K A;  1ZQS A;  1SKS A;  1N60 A;  2YML A;  4UAS A;  1QLN A;  3JPS A;  5J0U A;  4P0Q B;  2E8O A;  2KJ5 A;  2K8B B;  4J9Q A;  4HAI A;  1DGJ A;  3RJK A;  2C2R A;  4I2H A;  2OH2 A;  3M1Y A;  3LVW A;  4QZC A;  3B9J A;  5GTI U;  5KFW A;  5CEH A;  3JPN A;  3Q8K A;  4NL9 A;  5DQI A;  7ICQ A;  4F3O A;  2MA1 A;  2ZUC A;  4QZA A;  3TAR A;  3NAS A;  4TQR A;  2M9N A;  2W9C B;  4NJ8 A;  4O3O A;  2E8P A;  5CWR A;  1KBU A;  2KIC A;  3LK9 A;  5ALT A;  3BS7 A;  1X66 A;  5KG4 A;  4RNM A;  4PHP A;  4C0Z A;  4J9K A;  4X5V A;  2D8C A;  3IM1 A;  4F92 B;  3UXP A;  4BWM A;  4KLM A;  9ICV A;  1NNL A;  1T8E A;  4NLG A;  4ED8 A;  2RRD A;  5AKE A;  3HKZ F;  2NRW A;  3T5H A;  4US8 A;  1ZQJ A;  2NRV A;  3T3F A;  1X40 A;  1S0N A;  5KG5 A;  4J9L A;  5KFA A;  5AK6 A;  4QWA A;  2KVC A;  5KG1 A;  4ED7 A;  4OJ6 A;  4ECW A;  3ALR A;  3V6K A;  4KLJ A;  3BQT A;  4FBT A;  4TUP A;  8ICT A;  3MC1 A;  3ORY A;  9ICE A;  2JH1 A;  4I2A A;  3KFU F;  3N7R C;  1F0M A;  4EYI B;  4RQ2 A;  2P35 A;  4YG2 A;  1IM4 A;  1TV9 A;  4QIW C;  3PSF A;  4KLO A;  9ICO A;  4KTQ A;  2GH1 A;  3ETL A;  3WKC A;  1RYU A;  4MFC A;  5J2J A;  4P0P A;  3RB3 A;  4J9N A;  5IIN A;  1QTM A;  2I6X A;  4RUC A;  5AI9 A;  4RZR A;  3PO5 A;  4RT2 A;  1N48 A;  4MFA A;  3RBD A;  1VJ5 A;  2HDO A;  2FMS A;  2UVU A;  7ICE A;  4CF5 A;  5DKW A;  2KN7 A;  4CGZ A;  5KFO A;  2JZB B;  2K8A A;  3OJS A;  4GC6 A;  5ALU A;  2ZIU B;  4F4K A;  3QUC A;  2E1F A;  3GIK A;  3EPG A;  5D49 A;  5AI0 A;  1KRP A;  7ICO A;  4UAZ A;  3TAP A;  4BUG A;  4OO1 J;  2YY6 A;  1OXJ A;  2LBO A;  3KD3 A;  4ECY A;  1L8O A;  2HHU A;  1NJY A;  1V85 A;  3PVX A;  1IXR A;  9ICI A;  2WAQ C;  2KMD A;  2LMR A;  4IC9 A;  1ZQK A;  2MSN A;  5KFU A;  5F9L A;  1QCK A;  1MQ3 A;  5HHI A;  1ZQA A;  4Y2V A;  3UMB A;  5KT6 A;  1NK7 A;  4RQ0 A;  4I2J A;  1K5O A;  4Y2Q A;  1YZ6 A;  1P7D A;  3T5K A;  2PMZ C;  5J0X A;  3RFA A;  5HP4 A;  4Z6E A;  2PXI A;  8ICQ A;  3H7I A;  4M0A A;  3UMC A;  5KT7 A;  3QYP A;  5DBB A;  3DDH A;  2F1I A;  5ALO A;  2HBK A;  3HKZ C;  4PHD A;  3WK5 A;  3SEN A;  3H4B A;  1NI3 A;  3B0X A;  5KFY A;  2CXY A;  1YZ7 A;  2A19 A;  8ICB A;  1KLN A;  1NK6 A;  4UBB A;  2MUT A;  2YMQ A;  2I9G A;  9ICB A;  3QUB A;  3FC4 A;  4R64 A;  1B0X A;  4UBC A;  1K1Q A;  4R8U B;  3EWA A;  1ZYQ A;  4I2E A;  1Z4O A;  1ZRN A;  4P0Q A;  2W3S A;  5KFT A;  5HNK A;  2HCF A;  2G0A A;  2HMX A;  2DF4 B;  2XIC A;  5KT2 A;  2DKZ A;  3RJI A;  2PFQ A;  2RHF A;  3LYS A;  2K4I A;  2KG5 A;  4DSK A;  2ZJ8 A;  2RQ5 A;  1SV0 A;  5KFX A;  5J29 A;  3OPX A;  3M8R A;  2Y0S C;  2V4R A;  9ICL A;  4M9H A;  2K8C B;  4F93 B;  2JR5 A;  8ICX A;  2JV3 A;  5CA7 A;  4IR9 A;  3B0Y A;  1COK A;  1FIQ A;  4IQU A;  2UVW A;  1X6J A;  5HHH A;  1JRO A;  2HVH A;  1ZJN A;  3QU9 A;  4DF4 A;  2J6S A;  3BQ0 A;  4B9S A;  1L7M A;  3VC8 A;  2Y1J A;  1TFR A;  1SV4 A;  3SV4 A;  3PW5 A;  1SWV A;  1FEZ A;  1KFT A;  3M9O B;  5KL1 B;  3M9N B;  2W7P A;  5DQG A;  1CUK A;  3SR6 A;  2JHD A;  2XY7 A;  2W8L A;  5AIA A;  2C2D A;  1KKX A;  3BZK A;  2WF9 A;  2J6T A;  4TUS A;  1JXL A;  4PZO A;  1U4B A;  1X42 A;  1ZQ1 C;  3I1Y A;  2AGQ A;  1Q3U A;  3GU3 A;  4DL2 A;  1T3Q A;  1BPD A;  5KFJ A;  2HHT A;  5J2B A;  4IQV A;  2VAN A;  4PGQ A;  2KIW A;  2ZUB A;  5KFR A;  2HHQ A;  1ZD4 A;  3WKA A;  5KFS A;  4M47 A;  5J0Y A;  4DOA A;  3IP4 B;  4ECZ A;  1UT5 A;  5ALJ A;  9ICP A;  5IIO A;  5BPC A;  2Y9T A;  4XRH A;  2H3Z A;  1QQ7 A;  2CN1 A;  4EBD A;  4OJ5 A;  4Y2S A;  1RXV A;  1LKY A;  7ICU A;  2ZIU A;  8ICW A;  1RQN A;  4CDG A;  1RXW A;  2H3F A;  2EAM A;  3MDC A;  4ECR A;  2W03 A;  5ALX A;  3TI0 A;  5J2H A;  1T3N A;  1X9S A;  5EE9 A;  4Q8E A;  3NGD A;  9ICC A;  4YMN A;  5EWF A;  3TFR A;  2F77 X;  5J0O A;  4YXM A;  4C4T A;  2G08 A;  5J0Q A;  4EBC A;  5ALM A;  9ICA A;  2LYB A;  4YCX A;  4HYK A;  4RPZ A;  2LM1 A;  1NK4 A;  1JAL A;  2E5S A;  4RQN A;  1NKE A;  1A77 A;  5D46 A;  3K1R B;  3PX4 A;  4LJX A;  3SAH A;  1Z4N A;  4ECU A;  2C2E A;  4KX3 A;  2JGA A;  4O3N A;  1ZQF A;  5DG8 A;  2DQN B;  2FDR A;  1TE2 A;  2DPI A;  2R8I A;  3WK9 A;  3L4P A;  2WTF A;  1PVR A;  1Z3E B;  4TQS A;  4I27 A;  4OJP A;  2ODG A;  5L1L A;  3BQ1 A;  4QZ8 A;  4Y2Y A;  3F2D A;  2FMQ A;  1NZP A;  3M8S A;  3I76 A;  9ICK A;  1DK2 A;  2JEG A;  2KP7 A;  3HRD D;  2MAX A;  1U47 A;  5KFE A;  1ZQU A;  2RDI A;  1IG6 A;  2IOF K;  5JUM A;  1SKW A;  4WJ3 B;  1JRP A;  1ZQQ A;  3RRG A;  4DQP A;  3CW2 C;  3WK6 A;  4DL3 A;  4KLL A;  3Q8P B;  1QQ5 A;  4NLN A;  2YB4 A;  5KAI U;  4F2R A;  2W43 A;  4GLX A;  3S6J A;  5DGB A;  4U7C A;  3EYZ A;  3V6J A;  4YR3 A;  1FFV A;  1PVP A;  1TK8 A;  4KLT A;  1BPZ A;  1PVQ A;  4C8L A;  4YMM A;  9ICX A;  3NTU A;  3NVZ A;  3KHH A;  1J97 A;  5HR6 A;  2VA8 A;  2HHV A;  3AQF A;  3C23 A;  4YR2 A;  2ZIX A;  4CCH A;  2XID A;  4BXO B;  5KFF A;  3LDA A;  1ZQD A;  4R66 A;  3ZDA A;  1BVS A;  1QQ6 A;  5AM5 A;  4Q43 A;  1PK1 A;  4UAR A;  4A8E A;  2XY5 A;  4AYB C;  2KKP A;  1RG6 A;  4F4W A;  2YX8 A;  4ELV A;  3N4M B;  2E8N A;  2VJ4 A;  2ISO A;  4GFJ A;  2AGP A;  1OUQ A;  1Z1V A;  2A1J A;  4I2C A;  3Q8L A;  1ZQL A;  4YMO A;  2EAP A;  4EZ6 A;  4J9P A;  3RJF A;  4O5E A;  5BOM A;  2XVT A;  5EE0 A;  1NK9 A;  4BWJ A;  1L8L A;  4DO9 A;  2IOH A;  4PJ0 U;  4NLK A;  8ICF A;  4KN7 A;  3IHQ B;  1U49 A;  3PSP A;  4NM1 A;  2EQY A;  3OHA A;  4RQ4 A;  5IIL A;  2FMP A;  1ECW A;  2NO4 A;  3D2Q A;  3R9K A;  2M0N A;  4F5Q A;  5ALK A;  7ICR A;  4RPY A;  3G6X A;  3PR4 A;  4CF4 A;  2E8M A;  2EH9 A;  3H0M B;  2BCU A;  4C8N A;  4C80 A;  5KFM A;  3M6K A;  1Q8K A;  4R63 A;  3PML A;  4LZG A;  4J03 A;  4QNL A;  3PX0 A;  5AM4 A;  3SQI A;  1N62 A;  4F50 A;  4EEN A;  2QKQ A;  4I2I A;  2OWO A;  1ZJM A;  2W8K A;  1XU4 A;  4QJF B;  4ED1 A;  2NO5 A;  2KE7 A;  4I2F A;  4ED2 A;  5AK5 A;  2W9B B;  5L1K A;  2XI9 A;  4DF8 A;  2XGQ A;  1U48 A;  4C8M A;  4K4I A;  2YMP A;  5KFQ A;  5EWG A;  2FI1 A;  2PMZ F;  1JI7 A;  4QZH A;  5DBC A;  4NV0 A;  5AKK A;  1B4F A;  3ZDE A;  3F2C A;  2KTQ A;  5ALR A;  4Z6F A;  3MAB A;  4KIT B;  3UPQ A;  1CRX A;  3HW8 A;  1ZQN A;  2FPM A;  1DXS A;  2PFP A;  4RQ6 A;  4UAT A;  2JEF A;  1DOQ A;  2OCE A;  4JWN A;  1CI4 A;  4QIW F;  4DQR A;  4FZN A;  4Q8F A;  2Y9U A;  1V9P A;  3FYH A;  4B9L A;  5CR0 A;  4PHA A;  3V6H A;  4G9B A;  4QWC A;  2KNJ A;  1PK3 A;  3GIM A;  5KG2 A;  2H3V A;  4DFP A;  4B9N A;  1Z00 A;  4EX7 A;  5L1J A;  1MSW D;  5KFG A;  5CRX A;  4EYH B;  5ALL A;  4PZN A;  8ICJ A;  2P6R A;  4CNQ A;  5DG7 A;  4QZI A;  4F5O A;  2QB1 A;  4K4H A;  3KHL A;  1XSN A;  2VA3 A;  3C1Z A;  5CJ7 A;  8ICV A;  7ICN A;  4US9 A;  5EE3 A;  3EUB 2;  2Z7J A;  3CRX A;  2Q4T A;  4CF3 A;  2OEH A;  5IIJ A;  4KMU A;  3RB0 A;  2A3V A;  1ZQC A;  1S0O A;  1RYR A;  2ALZ A;  4RNN A;  3N28 A;  1O03 A;  3H8J A;  2CPR A;  2KV2 A;  3NS1 A;  3IV6 A;  4DFD A;  8ICR A;  3SZ2 A;  1OW5 A;  4PGY A;  2GLE A;  3KZI U;  4DOC A;  5KFN A;  4RUA A;  1S0V A;  2H3Q A;  2AQ0 A;  4KLS A;  3SD7 A;  2HSZ A;  2W9A A;  3BDP A;  4R65 A;  2XCP A;  1NK5 A;  2BCV A;  3V7K A;  1LV5 A;  2R8G A;  5AIB A;  2WAQ F;  2UVR A;  2DBY A;  8ICE A;  1JUD A;  4Q44 A;  1F44 A;  3CYM A;  4QWD A;  2JEJ A;  2KD1 A;  4FZL A;  2F8K A;  4NM2 A;  4M9G A;  1JIH A;  2BPC A;  5DB8 A;  2A1J B;  2FPK A;  2W3R A;  5D4B A;  3KTQ A;  5KFL A;  1SL1 A;  3LVV A;  3ICX A;  3IN5 A;  2C28 A;  2YN4 A;  7ICM A;  2KIV A;  3TQ1 A;  4UB6 U;  4UB8 U;  1FO4 A;  2RDJ A;  5AKY A;  3WU2 U;  1KQQ A;  2NRZ A;  4YXJ A;  3HX0 A;  4DLG A;  3UQ0 A;  4DQQ A;  3EZ5 A;  4KLI A;  2JXJ A;  3A0B U;  2ZXI A;  9ICS A;  3PR5 B;  2FLN A;  2W9M A;  2D6F C;  3MFH A;  4DL7 A;  4IL6 U;  8ICK A;  1JN3 A;  4RQ1 A;  2F8L A;  3RBE A;  4FE3 A;  3U26 A;  2KZM A;  3QZ7 A;  4IRD A;  7ICV A;  2BQ3 A;  7ICF A;  3GIJ A;  5DLF A;  2EZZ A;  4FS2 A;  1WCN A;  5KL8 B;  2VIX A;  4ECQ A;  4DLE A;  2W11 A;  5EOZ A;  1T7P A;  1S0M A;  2WF5 A;  5AK4 A;  4DOB A;  4UAY A;  1J2N A;  1JXE A;  4YQW A;  7ICH A;  1O08 A;  3GV8 B;  2Q0Z X;  2OYY A;  5AKJ A;  2IBK A;  5FP0 A;  3K1Z A;  5AM3 A;  1T94 A;  3QEA Z;  5HML A;  4MEX A;  3KHG A;  3KKA C;  3D6J A;  2H3I A;  1S10 A;  5AM0 A;  1SV0 C;  4F2S A;  1KFD A;  4DSF A;  3GQC A;  4O3S A;  5AKI A;  1L3S A;  5CHG A;  1EXN A;  3RH6 A;  2XCA A;  2K60 A;  2R8J A;  1D8L A;  1ARO P;  3V7L A;  3G6V A;  4ZOH C;  3AMZ A;  4G3I A;  4JB3 A;  3L5K A;  8ICU A;  3VCB A;  1RDF A;  2K4E A;  3OTQ A;  3M9M B;  5J0S A;  3SMV A;  2BCS A;  4J9S A;  4DEZ A;  2Y1I A;  3QX7 A;  4O9M A;  4JV0 A;  3RB4 A;  5H2F U;  1ZQE A;  5JU5 A;  4NXZ A;  1KW4 A;  1ZQZ A;  5AM2 A;  3RRH A;  2BCR A;  4QZ9 A;  2BZF A;  2I1Q A;  2KHQ A;  3C5G A;  4UAU A;  4B9T A;  5J0P A;  3PV8 A;  5F9N A;  4ICA A;  3NVY A;  3AU2 A;  1N5X A;  1NZB A;  2F2A B;  2FPL A;  5J2K A;  1Q3V A;  4PHE A;  2ZTC A;  1HJP A;  3EW9 A;  3GFK B;  3SEI A;  7ICK A;  4Q45 A;  3NUQ A;  3QU2 A;  4U6P A;  1ZQG A;  3QU7 A;  3ZDB A;  2HW3 A;  3NRW A;  2BDU A;  1HIW A;  1BNP A;  3KZX A;  4IR1 A;  3MR3 A;  3HP6 A;  1NK8 A;  4M9J A;  2W7O A;  8ICH A;  1COO A;  3Q8M A;  3KHR A;  2F44 A;  4Y2T A;  4ACO A;  2VA2 A;  1WG8 A;  1NJZ A;  2HOQ A;  2RP5 A;  5CB1 A;  5EWE A;  1TKD A;  1ZQH A;  5HR7 A;  2OXO A;  9ICF A;  4DL6 A;  8ICZ A;  2GWS A;  3AUO A;  1NKB A;  2Y0S F;  1TAU A;  2RLT A;  4JV2 A;  9ICQ A;  1C20 A;  2NYV A;  3QU4 A;  4C7Y A;  2OHF A;  4UW9 A;  2JMG A;  1TK0 A;  1A76 A;  1WWU A;  7ICI A;  3PY8 A;  3F53 A;  1DRG A;  9ICU A;  4RPX A;  1L7P A;  4QWE A;  1QSL A;  2G07 A;  4RQ8 A;  5ALN A;  4Y2P A;  3AU6 A;  4UAW A;  3E0F A;  3NVV A;  3PW7 A;  3C1Y A;  4M2Y A;  3MBY A;  3C29 A;  5L1I A;  4J9O A;  4PPX A;  2AU0 A;  4RQ7 A;  4FS1 A;  4DSJ A;  8ICL A;  1ZD2 P;  4B9V A;  4O3R A;  4GXJ A;  1UQV A;  4RU9 A;  5DB7 A;  4DQI A;  2HHS A;  3C28 A;  4M9N A;  5J0R A;  2BCQ A;  4F4Y A;  3FDS A;  4GIB A;  2PFO A;  1MN8 A;  3WKD A;  3IG5 A;  4P0P B;  4ZH4 A;  3TFS A;  4I29 A;  2BQR A;  4OD0 A;  4ECS A;  3PW4 A;  3C2K A;  4FZM A;  1ED1 A;  2F1J A;  4O5K A;  2HBL A;  3QUT A;  3PST A;  2G06 A;  5DB9 A;  5J2D A;  1DGS A;  3CNH A;  3N97 B;  5B5E U;  3RJG A;  3H4D A;  5TIS U;  5AKZ A;  9ICG A;  1BPE A;  3GV7 B;  2BR0 A;  5DLG A;  1LVH A;  4BDP A;  2ZIW A;  1LB2 B;  9ICJ A;  2W54 A;  2YMM A;  1XS9 D;  2W9B A;  1UA1 A;  1ZQM A;  3EPI A;  3AQE A;  4MEY A;  4KLE A;  5J8Y C;  2DL0 A;  4ED6 A;  2BDP A;  2F76 X;  5E79 U;  3QE9 Y;  3SAG A;  2EAO A;  3SYZ A;  3TAD C;  4DFM A;  5GTH U;  4B6J A;  4YP3 A;  3PW2 A;  1S5L U;  2YQE A;  4LVS A;  4P4P A;  4JV1 A;  2BKE A;  3RH5 A;  4UQG A;  4KX5 A;  4DCC A;  4EEL A;  4ECT A;  1QSS A;  1N56 A;  1ZQY A;  5KFB A;  2QLT A;  3BS5 A;  1L7O A;  1QH9 A;  2P66 A;  1U9L A;  2I5H A;  2WB1 F;  1SKR A;  2ZJA A;  4IQT A;  2HOI A;  4F8R A;  4KLH A;  4B9M A;  3QNM A;  3HJE A;  1ZQO A;  1DK3 A;  4BJQ A;  3D2N A;  2DUY A;  2YB1 A;  3C5F A;  4NWI A;  4I28 A;  1D8B A;  2QB0 A;  3AM9 A;  4ELT A;  3QXG A;  4NL9 C;  4Z6C A;  4ED3 A;  5ALY A;  4MF2 A;  2R8H A;  5CP2 A;  4PH5 A;  1SGG A;  1NOM A;  3M6Z A;  1N63 A;  3UQ2 A;  5J2I A;  5JRT A;  3JPT A;  1C7Y A;  3OJU A;  1KFS A;  4FFD A;  5ALV A;  1HUZ A;  4KLQ A;  4R8U A;  2AQ4 A;  2FLL A;  4GXK A;  1D9F A;  4QWB A;  1Z1B A;  4BGD A;  1KTQ A;  8ICG A;  2XY6 A;  2JH7 A;  2KJ9 A;  5G5H A;  1KDH A;  5ALP A;  1D8Y A;  2WFA A;  4J9M A;  2YTU A;  5K4L A;  4I2B A;  1XNS A;  2QAR A;  1N5W A;  4I2G A;  4KLU A;  2HBJ A;  4Y2U A;  3BJY A;  1ZRM A;  5AHX A;  2B0C A;  5AI4 A;  5AI6 A;  1VDV A;  4UB4 A;  7ICG A;  2IA6 A;  1UA0 A;  3PMN A;  4RNO A;  2LYH A;  3NVW A;  5DG9 A;  2E1E A;  5KFP A;  2DWQ A;  3RR7 A;  2G5H B;  2KJ8 A;  1ZD3 A;  1ZD5 A;  4GC7 A;  1Y88 A;  3KBB A;  1ZQV A;  1V97 A;  2EAN A;  4MHV A;  1GO3 F;  5JTI A;  3H8S A;  4TUR A;  4CRX A;  3SAF A;  7ICT A;  3JPR A;  2K4H A;  5DDY A;  2IMW P;  2PKE A;  3SV3 A;  1XSP A;  5AI8 A;  4K4G A;  4DL5 A;  1SWW A;  3ISD A;  2AXT U;  4P2H A;  3PX6 A;  2LYA A;  2PFN A;  2DKX A;  1NKC A;  4QZB A;  1S9F A;  2K4P A;  3UMG A;  9ICH A;  3GZF A;  4XA5 A;  4EZ9 A;  1XO0 A;  2E3T A;  3LWL A;  3TAD A;  4DFJ A;  3F5E A;  5KT3 A;  4MF8 A;  1BPX A;  4KLD A;  2NRX A;  1M6Y A;  3L3F X;  2JRZ A;  8ICO A;  4JMU A;  3E58 A;  3MR6 A;  4IRK A;  1TAM A;  5AKH A;  2N1R A;  1SL0 A;  2C22 A;  3IRU A;  3OHB A;  2NRT A;  2A1A A;  2FLP A;  1H38 A;  4QZG A;  2ZIW B;  4O0I A;  4F72 A;  3MR5 A;  4DL4 A;  4NLB A;  1X6I A;  3ZDC A;  5AKL A;  2ZTD A;  3FAH A;  5L9X A;  2ZXH A;  1MA7 A;  3WKE A;  3T79 A;  3UXO A;  2ZUD A;  2LKY A;  3OSN A;  3MDA A;  9ICM A;  1WYG A;  4USA A;  2KHV A;  1XWL A;  4M6W B;  2W55 A;  1RPL A;  4EBE A;  3NRZ A;  3F2B A;  1S8O A;  3HIL A;  3G6Y A;  9ICW A;  2KSO B;  1ZQT A;  3ED5 A;  5IIK A;  3WK7 A;  4Y2R A;  3UXN A;  3Q8Q B;  5J2E A;  3RJE A;  3C21 A;  1UT8 A;  1SZP A;  2W04 A;  7ICJ A;  2ZIV A;  8ICP A;  4RT3 A;  3UM9 A;  5J2G A;  5ALF A;  4DQS A;  5TZV A;  4RQM A;  1TAQ A;  2VJ5 A;  5AKX A;  1XC9 A;  2HHW A;  8ICA A;  1X9M A;  1L3T A;  3QZ8 A;  1ZQW A;  3H8W A;  3F5A A;  1BNO A;  4YR0 A;  4F4X A;  4DWI A;  7ICP A;  5J2A A;  3TKA A;  4YVZ A;  3AEV A;  4UB3 A;  2JEI A;  4EEY A;  1URJ A;  4C8O A;  4KLF A;  5KFZ A;  2KOB A;  2V4Q A;  1NK0 A;  1SXE A;  3H8M A;  2KEY A;  2WB1 C;  4ED0 A;  2BGW A;  3LWM A;  2BQU A;  5C0Y A;  2WF7 A;  4KMO B;  2QAR B;  4IQW A;  3GIL A;  2R18 A;  1XSL A;  5KG7 A;  4BX9 C;  4Y2X A;  4YN4 A;  2AHO B;  4YFK A;  4KLG A;  2IHN A; 
#chains in the Genus database with same CATH homology
 1SV0 A;  1V38 A;  3KKA A;  3KKA C;  4NJ8 A;  2E8P A;  1JI7 A;  5J8Y A;  5J8Y C;  2DL0 A;  1SV0 C;  1B4F A;  4IS7 A;  5L1M A;  2KSO A;  2JV3 A;  3BS7 A;  1OXJ A;  1X66 A;  1COK A;  2EAO A;  1V85 A;  2D8C A;  3HIL A;  2K60 A;  3TAD C;  2KMD A;  2LMR A;  2F3N A;  1PK1 A;  2KSO B;  2F8K A;  1WWU A;  2EAN A;  4MHV A;  1RG6 A;  1DXS A;  5JTI A;  2E8N A;  2L5Y A;  1PK1 B;  4RQN A;  1X40 A;  2KIV A;  1Z1V A;  3K1R B;  1SV4 A;  2EAP A;  2LPE A;  2Y9U A;  2ES6 A;  3BS5 A;  2ESE A;  5F3X B;  5JU5 A;  2DKX A;  1KW4 A;  3IDW A;  3TAC B;  4RQM A;  1PK3 A;  2FE9 A;  5KNI A;  3BS5 B;  2K4P A;  3BQ7 A;  2B6G A;  4PZO A;  1F0M A;  2QB0 A;  4PZN A;  4NL9 C;  1UQV A;  3SEN A;  1SGG A;  3TAD A;  3SEI A;  2QB1 A;  1WWV A;  2QB0 B;  5JRT A;  1SXE A;  2E8M A;  3H8M A;  2Y9T A;  1LKY B;  2E8O A;  1B0X A;  1X9X A;  2QAR B;  1LKY A;  2F44 A;  2QKQ A;  2YTU A;  1UCV A;  2EAM A;  2KE7 A;  2QAR A;  2DKZ A;  4NL9 A;  1SXD A;  2KG5 A;  1OW5 A;  2D3D A;  2GLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...