1UQVA

Sam domain from ste50p
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
GSHMNNEDFSQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDSKLEWKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Sterile {Alpha} Motif (Sam) Domain of the Saccharomyces Cerevisiae Mitogen-Activated Protein Kinase Pathway-Modulating Protein Ste50 and Analysis of its Interaction with the Ste11 Sam
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords STE50 PROTEIN
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09235 SAM_Ste50p Ste50p, sterile alpha motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1uqvA00
2D3DA 3TADA 3BQ7A 2JV3A 2F3NA 1X40A 1F0MA 2DL0A 2KSOA 3BS5A 3SENA 1OW5A 1Z1VA 2DKZA 2KE7A 3K1RB 1JI7A 2E8MA 2QB0A 2LMRA 5L1MA 1V85A 5JTIA 2QB1A 2F44A 2F8KA 3KKAA 2E8NA 3HILA 1PK3A 3H8MA 4MHVA 2B6GA 2QARA 1PK1A 1SXDA 5JRTA 1UCVA 2D8CA 5J8YA 1WWUA 1RG6A 2KMDA 2Y9UA 2EAMA 3KKAC 1B4FA 1SV4A 2Y9TA 3BS7A 1PK1B 1X66A 4RQNA 5JU5A 2ESEA 4RQMA 2L5YA 4IS7A 4NL9C 2ES6A 2YTUA 2EANA 5J8YC 1X9XA 2KIVA 1UQVA 1WWVA 3TACB 1KW4A 2EAPA 4PZNA 1SV0A 2DKXA 2LPEA 3SEIA 1COKA 2E8PA 1SGGA 1V38A 1OXJA 4NL9A 2QKQA 1DXSA 4NJ8A 2FE9A 3TADC 5F3XB 1LKYB 2EAOA 2K60A 2KSOB 3BS5B 2KG5A 1B0XA 1LKYA 3IDWA 2E8OA 4PZOA 2K4PA 5KNIA 2QB0B 1SV0C 1SXEA 2GLEA 2QARB
chains in the Genus database with same CATH superfamily
2MSNA 1RQNA 3IV6A 4F50A 1JXLA 3BS5A 3MGHA 1QCKA 8ICRA 2XC9A 3L4PA 3A0HU 1TK0A 2NO5A 5KT3A 3LWMA 4ECWA 2WB1C 8ICXA 5HNKA 4HAIA 3U26A 1WUDA 1L6NA 5KFPA 4KLIA 1D8YA 3UM9A 4ECYA 5J2DA 2AHOB 1ZETA 1JRPA 4C8MA 5KAIU 7ICUA 1L3UA 2BPFA 1S0VA 4EBEA 3C2LA 2IOFK 2V4RA 4O3NA 3BQ1A 4DL7A 5DB8A 3PW2A 1RG6A 5D4BA 1S10A 1N48A 2JEJA 2ZIWA 1RXVA 3H4BA 2HBMA 4DFJA 4ELVA 1RZTA 3PY8A 1ZXIA 2KD1A 1ED1A 5ALOA 4C7YA 4ACOA 5KFVA 4FO6A 9ICNA 3GIIA 9ICUA 2XIDA 2W3SA 3ZDEA 2YB1A 2W8KA 4PPXA 1V38A 3H0LB 7ICOA 3T5JA 5AM0A 5ALQA 2A1AA 7ICIA 1B22A 3MR3A 5KT5A 3AEVA 4RU9A 1A0PA 2JZBB 5C0YA 1ZQZA 2LYHA 3KD3A 5FP0A 5IIIA 3PR4A 4NLZA 4F4KA 5E79U 3UMCA 1BPEA 3N7PD 2D3DA 2F3NA 1X40A 2HHXA 7ICJA 4UATA 1IIPA 1TE2A 1S77D 2DKZA 2WF8A 2G5HB 3PX4A 4US8A 1L7OA 4R63A 3M8SA 4QZ9A 1MA7A 3WKBA 4DOAA 2H3QA 2F8LA 4I2DA 4OJ5A 3SI8A 2MUTA 3KKAA 1L3TA 2DQNB 1NK8A 2Y1JA 4QZEA 3BZCA 2HOFA 2ZIUA 5ALTA 1SZHA 2NYVA 3QEAZ 5AKYA 4Y2JA 3JPPA 3AU6A 1NKBA 2KMDA 4UB5A 5ALGA 8ICYA 1U45A 3V72A 2R8KA 3HWTA 4C0ZA 2ZJAA 1UT5A 5CWRA 1XNSA 2PMZF 4QZHA 3EW9A 4PH5A 2WTFA 8ICJA 4IL6U 2BDPA 3QU7A 1SKRA 1K1SA 3ALRA 2A19A 4NL9A 3WK6A 3PX6A 2G5IB 3F53A 1QSYA 1A77A 2ASDA 8ICQA 1ZQPA 1HUZA 7ICNA 4ED8A 5AKKA 4TUQA 2H5XA 3BQ2A 2BR0A 1L5UA 4I2HA 2LYBA 3JPRA 2F77X 1KDHA 4TQSA 1SXEA 2RDIA 5EE0A 1ZJNA 1JROA 2QARB 8ICSA 5CJ7A 1KSPA 5EOZA 4QJFB 5ALLA 3C29A 3OJUA 1GO3F 2ZG6A 2Y1IA 1URJA 5CR0A 2W7PA 1IG6A 3BZKA 2QB0A 1ZQBA 4G3IA 2BCQA 2M0NA 1RM6C 2ALZA 3RH5A 4R64A 2QB1A 3QZ7A 2XO7A 3CW2C 1SL0A 5DBBA 2R8JA 3UXPA 4RQ3A 7ICSA 4RQ8A 3HILA 9ICLA 4A8EA 1NK6A 2RP5A 1SXDA 1RDFA 3NS1A 2OWOA 2YB4A 2B0CA 3H0RB 1WWUA 4Q8EA 5EWFA 4DSIA 5ALKA 2I6XA 3RJJA 4F4XA 3NGDA 4QIWF 1ZD4A 3I76A 4RQNA 2DPIA 3TAQA 2BPCA 3CYMA 3Q8KA 5J2KA 4P0QB 3KTQA 2F1HA 4RQ5A 3NASA 1H38A 1S9FA 4AYBF 3C5GA 5KL8B 4O3SA 4U7CA 2PFQA 3C2KA 5J29A 2W8LA 4F5RA 5ALHA 1JN3A 2HSZA 3TFSA 4QIWC 1U9LA 5DG8A 1PVPA 2MUTB 2XY5A 2YMQA 2KSOB 3GV7B 5J2HA 7ICPA 2JHDA 5KG2A 4PL2A 2AH5A 1XWLA 1BPDA 3N7RC 1BVSA 4F71A 1ZD5A 1SZPA 4NLNA 3QYPA 5AKGA 1L8LA 2MA1A 4KN7A 4QZ8A 4BWJA 3C23A 1ZQHA 4ECTA 4O5EA 9ICMA 2HBJA 2BQRA 2HHQA 4UQGA 5AKZA 4NM2A 3RB3A 3CP8A 1YT3A 3C2MA 4UAWA 4R66A 5JTIA 3NTUA 4B9VA 3J81j 3RR8A 7ICRA 3RBEA 1YZ7A 2OH2A 2BCUA 2K4IA 2ZIVA 2ZXHA 2DFLA 2A1JA 3H8MA 4JV1A 4WJ3B 1WCNA 1XSLA 5GTIU 4RNOA 4UB6U 3MGIA 1SKWA 3QU4A 4DOCA 4DS4A 5KAFU 1OUQA 5D49A 2F76X 3V6JA 1Q3VA 5CB1A 5ALDA 4Z6FA 5JU5A 2ESEA 1YZ6A 1AQ6A 3M1YA 4DSLA 4MEXA 4I2IA 1O03A 2ZUBA 4ICAA 3A0BU 4F5OA 1ZQIA 4IRCA 2EAPA 4RQ0A 4PZNA 2RQ5A 4DL3A 5ALZA 4DQPA 2AGPA 1NOMA 1VDVA 4RUCA 4YN4A 3KHLA 2DKXA 4Y2UA 3TKAA 5J0OA 4C8KA 1ZQUA 4QW9A 3MFHA 4I2JA 3C21A 4OO1J 2AQ4A 4MF8A 3I28A 1NKEA 1S0NA 4UASA 1N61A 3ZD8A 4QWAA 1D9FA 4US9A 1JIHA 1UHUA 2EH9A 2K8AA 1CEZA 3FDSA 4F72A 4OJOA 3B9JA 3BQ7A 2FLPA 4Z6DA 5KFUA 4YMOA 4PHAA 1SKSA 1BPZA 4BUGA 2W54A 5AK5A 1Z1VA 3O0FA 1F5SA 2JGAA 2MRLA 1JI7A 1X6IA 5F9NA 5AM3A 4RNMA 5AI8A 2Y0SC 5AM4A 2GO7A 4OJPA 2ZIXB 2KFZA 1MSWD 3WKCA 5AKIA 3RB4A 4UW9A 5ALFA 2IMWP 4M9LA 1CRXA 4JWMA 4RQ7A 4UB8U 4QWBA 4IQVA 1ZQXA 2IOHA 9ICXA 3ETLA 4FS1A 3H8SA 5L1JA 4DSFA 3OHBA 1JX4A 3ZI4A 3RJHA 2WHEA 1L7NA 4HYKA 7ICEA 1LVHA 1Z1BA 3PX0A 2RHFA 4XUSA 2FPLA 2YTUA 1L7MA 2EANA 5J0QA 4P2HA 2Z7JA 2G0AA 3UMGA 1SL2A 2J6TA 2NRWA 4YQWA 1CUKA 1KEJA 3PSPA 4CNQA 4EELA 4RQ6A 1KFTA 4QNLA 2BDUA 3QNMA 1SGGA 1ZJMA 4MFFA 1OXJA 5IINA 2JMGA 2WF6A 2KJ9A 1TAMA 2ASJA 4LVSA 2ZTCA 1ZQLA 2LKYA 2FJ6A 2VKQA 1C20A 3QXGA 3GV5B 1B0XA 3DDHA 4IQUA 2XGQA 2W9AA 3ICXA 4NY8A 1SL1A 3WKEA 4Y2QA 4J9RA 2JV3A 3VC8A 4DQIA 5J2GA 2WF7A 3HKZF 4CGZA 3K1ZA 3QU2A 1HIWA 4RT3A 4O5KA 4KLUA 2VA8A 4GC6A 4C8LA 1V9PA 2JH7A 4KLMA 3MBYA 1KFDA 4BX9C 4DF8A 2FMSA 4YR0A 3B0YA 2V4QA 1WG8A 4NM1A 2EDUA 5KFYA 1X9SA 3ZDAA 4BDPA 2LM1A 5ALYA 4DCCA 4Z6CA 3WK7A 2XCAA 4E0DA 3C1ZA 5JUMA 2W03A 4Q43A 1ZQCA 2HBKA 1PK1A 3RH6A 5KG3A 3GIMA 3M8RA 4EEYA 2BCRA 3ZD9A 3F2CA 4CF4A 1ZQ1C 2VJ5A 4B6JA 4DF4A 3LDAA 3UMBA 3M7DA 5AI0A 3RAQA 1XS9D 3Q8PB 3LYSA 4DLEA 5DGAA 5G5GA 4KLGA 2XVTA 5BPCA 1B4FA 7ICQA 3MDAA 4GIBA 3N7SC 5AK4A 8ICVA 4F2SA 3ISDA 4IS7A 9ICGA 4M04A 1ZQYA 1X9XA 1NK4A 5ALSA 5KFXA 5KT2A 1D8LA 3RB0A 1TAUA 4M9GA 2W11A 3FAHA 5J0RA 4J9LA 3MDCA 4FFDA 5KFBA 5KG0A 1DXSA 4JMUA 2B21A 1JALA 4FZMA 1LKYB 3RH4A 2VA2A 2R8IA 4DEZA 3NUQA 4CCHA 5IILA 5J0XA 4Y2VA 4KLEA 8ICPA 4UB4A 2KG5A 4GLXA 1Q3UA 4F93B 9ICKA 5DQHA 1UT8A 5AKHA 2K89A 4PJ0U 3PW0A 3DV9A 2D6FC 1N5XA 4I27A 1FEZA 2KP7A 3SV3A 3RB6A 2BKEA 2NRTA 5J2JA 9ICTA 1DK3A 3PO5A 3LWLA 1NK5A 4ELUA 1NK0A 1ZQSA 2VJ4A 2LMRA 5L1MA 3RFAA 2R8GA 3VCBA 4ECSA 9ICFA 3KBBA 2BCSA 2HHUA 4YCXA 4YXMA 4C80A 1KBUA 3ETRA 2BHNA 3BDPA 4MHVA 2E5SA 5J2BA 4QZAA 2WF9A 3V7JA 1ZQDA 3RJKA 4UARA 3ORYA 4Q44A 5KG4A 4K4HA 4KLOA 2O6KA 4MFCA 5DLGA 4RQ2A 1ZQWA 3H7IA 5DB6A 1PVRA 4KLLA 4DFKA 4J03A 8ICTA 3D2NA 5KG5A 7ICHA 2KIVA 1KN5A 3ISBA 2PFOA 1TAQA 4Z6EA 1UPHA 4QZCA 2PXIA 4EBDA 5HMMA 4EENA 5AIAA 1T3QA 3SAGA 4DL4A 4GXJA 5IIJA 3QEBZ 5KFAA 2JEIA 1TVAA 3TADC 4J9PA 2KNJA 3ZDCA 5KT4A 2RDJA 3PVXA 3WU2U 4O3QA 4ECUA 5J2CA 2DWQA 4DSJA 3THVA 3WKAA 4ED2A 1BPXA 5L1LA 1QTMA 4R65A 3PMLA 1Z00A 2QB0B 5AM5A 4EBCA 2YN4A 4DFMA 2UVWA 3MC1A 1U49A 2DL0A 3GZFA 3RBDA 1Z3EB 4B9MA 3UXOA 4RQ1A 4O0IA 3PW7A 2XGPA 2HHTA 3E2EA 5AK6A 9ICPA 1IV8A 5KG1A 4KTQA 4KITB 4FBUA 1N5WA 2IBKA 2F8KA 1WCLA 3G6XA 1HUOA 3RJEA 1DOQA 4EX6A 4I2GA 4F91B 2I9GA 2PFPA 2FPKA 1S5LU 2D8CA 4M9JA 1KLNA 5T14A 3C5FA 1BNPA 3E58A 2KZ3A 4KX5A 2ZTEA 5IIOA 3SAFA 3E0FA 4NV0A 2KZMA 5AKJA 3GV8B 3PNCA 5ALNA 2FLNA 3C1YA 5TZVA 4B9LA 1S8OA 1QSLA 4DFDA 4U6PA 1IXRA 4KMOB 1UQVA 2H3ZA 1NK7A 5F9LA 3LVWA 1SV0A 2ATLA 4KMUA 4Y2YA 2YMMA 3FC4A 4LZGA 8ICAA 2E8PA 4AP9A 3NRZA 2PI4A 2HHSA 2ZJ5A 2C2DA 1HEKA 1Y88A 3MR2A 4QZIA 5DG9A 1UA1A 5AKXA 3NVWA 1LKYA 1XSNA 5DG7A 1RPLA 2OXOA 4PZOA 4TQRA 5K4LA 4C4TA 3OSNA 3MR5A 4RPYA 2W7OA 4F5QA 2HVIA 3HW8A 3TADA 1T7PA 5CHGA 2QLTA 2LYAA 1OW5A 5AM1A 2N1RA 4I2FA 2YMLA 1ECWA 3KHHA 4M9NA 3C28A 2P6UA 3PW4A 1DRGA 5DDMA 2JZBA 2JEGA 1D9DA 8ICHA 4MF2A 2AXTU 4J9OA 1BNOA 1FFUA 4BGDA 3FYHA 5DBCA 9ICBA 1ZQOA 2PMZC 4XRHA 3IP4B 2LHTA 4KLFA 2NV3A 5KFEA 4RT2A 4ZH4A 4YP3A 4JV0A 3BJYA 1JXEA 5HHHA 2C2RA 8ICWA 1C7YA 5DDYA 3SYZA 2CN1A 1PVQA 1S0OA 3QZ8A 5KFFA 4DQRA 2MAXA 8ICFA 3KZIU 9ICHA 4ECXA 2KKPA 2KOBA 4Y2PA 3Q8LA 3G6YA 4DSKA 2P66A 4IC9A 3T5LA 3SR6A 3EPGA 3RAXA 4QWDA 4M6WA 4J9NA 1DGSA 3D2SA 4NLKA 5HP4A 3DEEA 3RJFA 5J8YC 5J2FA 4C4RA 1KL9A 3TARA 5KFHA 2RLTA 3LVVA 4P0QA 3BQTA 3IG8A 1HJPA 1AROP 2DGZA 1NI3A 3PZPA 4IQWA 4UB3A 3JPQA 2Q0ZX 1U4BA 1COKA 2ASLA 5BOLA 1T94A 3GFKB 1TFRA 3ONNA 5CRXA 1FFVA 4YMMA 3ISCA 1IM4A 4DSEA 3NVZA 2WB1F 2FDRA 5AM2A 3SZ2A 1MN8A 2F1IA 3SAHA 2HDOA 2F2AB 5DB9A 4DLGA 2XY6A 3GIKA 5ALMA 3RJGA 2GLEA 8ICBA 3KFUF 2AGOA 2K4HA 3AU2A 1L7PA 2OHFA 4F2RA 1NNLA 3Q8SB 5KFMA 5AICA 5J0YA 4KLSA 3OSPA 2KE7A 5KFRA 1T3NA 4ZOHC 2OEHA 2NRVA 4OCZA 4XQ8A 1ZQMA 5L1IA 2E8MA 4ELTA 5BOMA 2FI1A 2P35A 4F8RA 3UQ0A 4DQQA 1MQ3A 5J0SA 1ZRNA 3QUQA 3RR7A 9ICQA 1ZQQA 1KQQA 4CF5A 2KV2A 1UA0A 3GQCA 3ED5A 7ICGA 3AMZA 5KFLA 4DOBA 8ICOA 3F2BA 1BPYA 4KLDA 1L8OA 5AI5A 1JMSA 5HMLA 3Q8QB 1U47A 5AI9A 2W9BA 2CRXA 4JK1A 3PO4A 2LM4A 3NRWA 3EYZA 3SQIA 3M6ZA 1D8BA 2Y9UA 2C28A 3H4DA 2IA6A 3OJSA 1PK1B 1X66A 2XI9A 5AI6A 4M2YA 4EEKA 4AYBC 4R8UA 2ISPA 1JUDA 2OYYA 2DF4B 4F5PA 3TAPA 8ICIA 4FS2A 4UAVA 1TK8A 4B9TA 3AQEA 7ICKA 3QU5A 2LPEA 3F5EA 2NRZA 1TV9A 2UVVA 1KKXA 2VA3A 4ED1A 1ZQGA 3HJEA 3WK4A 3WK9A 4PHEA 1Z19A 1K1QA 4DL5A 4CDGA 3HT3A 5ALXA 5KFZA 4FZLA 2PFNA 3B0XA 1PZNA 1J97A 3PR5B 4J9KA 2KK0A 1K5OA 1NJYA 2IHNA 2G08A 5EE9A 2WF5A 4DL2A 5B66U 3EPIA 1ZYQA 4KLQA 2HVHA 9ICVA 4QZBA 7ICTA 5IIKA 2H3VA 4EYIB 7ICLA 4MFAA 1RQLA 4F3OA 2HOIA 4YR2A 4F4WA 2KJ5A 3QUBA 2F44A 5IIMA 4PL1A 2FMQA 4K4GA 4K4IA 1QQ5A 1RXWA 3ZDBA 4FZNA 4O3RA 8ICEA 5HHIA 9ICWA 5AK3A 2RRDA 2AQ0A 3LK9A 3G6VA 4QZGA 4KN4A 1QQ6A 1RYUA 4QWCA 3OTQA 1V97A 2BQ3A 1NJXA 4OJLA 3GILA 2Q4TA 1A76A 5L1KA 2E1EA 2UVRA 2W9BB 5HR6A 2G06A 3MABA 2VIXA 4J9SA 4P4OA 1ZQFA 2W9CB 5AHXA 2K4EA 4UAUA 1KFSA 1A6SA 4ECZA 4ED3A 3NVVA 9ICSA 3SEIA 1FIQA 4B9SA 3QUTA 2EAOA 1TKDA 4KX3A 3D6JA 4YXJA 2KICA 1RYRA 2H3FA 2XICA 3KZXA 4JWNA 4F5NA 8ICNA 3R9KA 1PUZA 4RNNA 3RRHA 2OCEA 8ICCA 5AIBA 2KVCA 2KSOA 1QLNA 4NWIA 2KEYA 5KFQA 3K1RB 3HKZC 3F5AA 1MQ2A 2YMPA 5EWGA 2W3RA 4JUZA 1MC8A 1RYSA 3V7KA 1ZRMA 5D46A 5KFSA 2E8NA 4IQTA 3AM9A 1ZQTA 2HW3A 2KN7A 4R8UB 2EZYA 5GTHU 3AQFA 1N2XA 7ICMA 1WYGA 4JB3A 4I2CA 3K4GA 4IR1A 1BGXT 3H0MB 2JRZA 5AKEA 3GIJA 4PHPA 4OD0A 2Y9TA 3BS7A 4NLGA 1SIJA 4I2BA 9ICOA 3GU3A 4RQMA 1Z4OA 2R8HA 4USAA 3T5HA 2GWSA 5KFDA 1COOA 3HPOA 3M9OB 3EZ5A 1U48A 4J9QA 1ZQKA 2HMXA 3RJIA 3MGVA 5L9XA 2MU2A 5G5HA 4EZ9A 3V6KA 1N63A 2JXJA 2DUYA 5DLFA 3IM1A 1ZQRA 2W04A 5ALPA 5CA7A 3WKDA 3T3FA 2EZXA 3V7LA 8ICZA 2E8OA 4DO9A 2HBLA 5ALUA 4EX7A 4B9UA 1VLBA 2W9CA 2HOQA 2AGQA 4QZFA 4PGYA 4O3OA 1ZQAA 1SWVA 4O3PA 3JPNA 9ICEA 3PSFA 1DK2A 4TUPA 5KFOA 4DS5A 5AI4A 4IR9A 4PGQA 2IHMA 5KFWA 2XCPA 2ISOA 1X9WA 4I2EA 2KFNA 2W43A 2NO4A 1Q46A 2ZUCA 5KFIA 3L3FX 3H8JA 2PKEA 2K8CB 2M9NA 2YY6A 1P7DA 4M6WB 4J9MA 9ICJA 3SMVA 4NLCA 1SV4A 3SV4A 1LV5A 2KZZA 4M9HA 2H3IA 2W9MA 5J2IA 5KFNA 3QU9A 3GDXA 3MFIA 2WAQC 5DKWA 3UXNA 4NLBA 2ES6A 1TK5A 2HHWA 1SB3C 2WAQF 2PI5A 3K75D 4YG2A 1KW4A 4PGXA 4ECVA 4GFJA 3S6JA 4TUSA 1N56A 1ZQEA 2LI6A 2XY7A 3EUB2 2C22A 2ZTDA 1QQ7A 3H8WA 2K60A 4UB2A 5KT7A 5DB7A 3AUOA 5ALRA 4DQSA 5J0WA 1SWWA 1M6YA 4YMNA 5DQIA 2K4PA 2J6SA 3FM9A 5DGBA 4I29A 5DBAA 1Z00B 4KLHA 1KTQA 2NRXA 4BWMA 1LB2B 4KLJA 2ZIVB 4BJQA 4P0PA 1B43A 2YX8A 3N97B 4ED7A 4ED0A 1X6JA 1S76D 4RZRA 1L3VA 3UQ2A 4O3MA 4RQ4A 5J0PA 4C8NA 2C2EA 4UAYA 3RTVA 3N4MB 1PK3A 4DL6A 4FBTA 5C5JA 4IRDA 4CF3A 4UAZA 4JV2A 7ICFA 2BGWA 2ZIUB 2KTQA 4IRKA 4YR3A 2I1QA 4YFKA 5J2AA 4Y2XA 1QH9A 3JPTA 3Q8MA 4RPZA 4EZ6A 3TFRA 4KLTA 1Z4NA 2W55A 4UB1A 2G09A 1NZBA 1CI4A 9ICIA 9ICAA 3F2DA 2HHVA 2OM6A 9ICRA 8ICMA 2WFAA 4NJ8A 2J6UA 3OHAA 2DPJA 2FLLA 2I5HA 3BS5B 4ECRA 1F44A 4O5CA 3TANA 3EWAA 4GXIA 3KHGA 3M9MB 4B9NA 4P4MA 5KG6A 4M0AA 4UBCA 3V6HA 3HX0A 4RPXA 2ZXIA 3NVYA 4Q8FA 2UVUA 3AN1A 5KFJA 5AKLA 2KHQA 8ICUA 1S0MA 3TQ1A 5EE3A 1NJWA 2K8BB 5ALVA 2GOLA 1ZQVA 4P0PB 3IHQB 5ALJA 8ICKA 3HP6A 4M47A 4BXOA 2BCVA 1ZD3A 4DFPA 2EZZA 1NKCA 8ICGA 2V9WA 2ZIXA 2LBOA 3BQ0A 4Y2SA 4QWEA 4GXKA 1DGJA 2QARA 2B6GA 7ICVA 4F92B 5J0UA 5KFTA 3OGUA 4YD1A 2AJQA 1UCVA 5DQGA 2ZIWB 3L5KA 5KFKA 2CXYA 3I1YA 4CRXA 5KL1B 3H40A 4ECQA 1ZQJA 4TURA 2EAMA 2Y0SF 3T5KA 2P6RA 4BXOB 8ICLA 4C7ZA 5CEHA 2ODGA 4RUAA 2L5YA 5EWEA 1BPBA 5A0LA 2E1FA 1WWVA 1FO4A 4YVZA 3PMNA 3TACB 2KIWA 4ED6A 2JEFA 4QZDA 1Q8KA 4Q45A 3QX7A 3WK5A 1NZPA 2ZUDA 1KRPA 2FE9A 1O08A 4OJ6A 5J2EA 5F3XB 2G07A 4Y2TA 5TISU 1ZQNA 3IG5A 2AU0A 1J2NA 3QUCA 3PSTA 1XC9A 3IDWA 3PW5A 2BPGA 3QE9Y 1XU4A 3SD7A 2CPRA 4NXZA 3WK8A 2KJ8A 4LJXA 5KG7A 3PV8A 2YQEA 1N60A 5KTQA 3UPQA 4X5VA 1F0MA 1ZOLA 1X42A 2KHVA 5KT6A 4CE6A 2JH1A 3SENA 1X2IA 3N28A 2JR5A 3JPOA 3JPSA 5KFCA 3RRGA 1V85A 4P4PA 1XO0A 2A1JB 3KOOA 2DBYA 5H2FU 4G9BA 5B5EU 2HCFA 5ALWA 1T4GA 3MR6A 4UBBA 4LZDA 4QW8A 4PHDA 1S97A 4I28A 5JRTA 4C8OA 2KKVA 4FE3A 2A3VA 3TI0A 2KVSA 2BZFA 5J8YA 4O9MA 3RF9A 1L3SA 3CNHA 3PSIA 1N62A 2FPMA 4F4ZA 3IRUA 3KKAC 1NK9A 1XO1A 2ZJ8A 3ZDDA 2R18A 5KFGA 5J0TA 3T79A 4F4YA 3HRDD 2HI0A 4NL9C 3M6KA 2E3TA 2BQUA 1QSSA 3CRXA 5ALIA 3OPXA 3KHRA 2IOFA 1ZD2P 5ALEA 4C4SA 2QKQA 1T8EA 4YD2A 1EXNA 3AL0B 1XSPA 4MEYA 5EE1A 9ICCA 2EQYA 2VANA 3M9NB 3Q8RB 2GH1A 3D2QA 1NJZA 4XA5A 2F1JA 5HR7A 4Y2RA 1J2MA 5KNIA 3IN5A 4GC7A 1SV0C 4DWIA 4EYHB 2FMPA 1VJ5A 1X9MA 5CP2A 4I2AA
chains in the Genus database with same CATH topology
2D3DA 3TADA 3BQ7A 2JV3A 2F3NA 1X40A 1F0MA 2DL0A 2KSOA 3BS5A 3SENA 1OW5A 1Z1VA 2DKZA 2KE7A 3K1RB 1JI7A 2E8MA 2QB0A 2LMRA 5L1MA 1V85A 5JTIA 2QB1A 2F44A 2F8KA 3KKAA 2E8NA 3HILA 1PK3A 3H8MA 4MHVA 2B6GA 2QARA 1PK1A 1SXDA 5JRTA 1UCVA 2D8CA 5J8YA 1WWUA 1RG6A 2KMDA 2Y9UA 2EAMA 3KKAC 1B4FA 1SV4A 2Y9TA 3BS7A 1PK1B 1X66A 4RQNA 5JU5A 2ESEA 4RQMA 2L5YA 4IS7A 4NL9C 2ES6A 2YTUA 2EANA 5J8YC 1X9XA 2KIVA 1UQVA 1WWVA 3TACB 1KW4A 2EAPA 4PZNA 1SV0A 2DKXA 2LPEA 3SEIA 1COKA 2E8PA 1SGGA 1V38A 1OXJA 4NL9A 2QKQA 1DXSA 4NJ8A 2FE9A 3TADC 5F3XB 1LKYB 2EAOA 2K60A 2KSOB 3BS5B 2KG5A 1B0XA 1LKYA 3IDWA 2E8OA 4PZOA 2K4PA 5KNIA 2QB0B 1SV0C 1SXEA 2GLEA 2QARB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3D A;  3TAD A;  3BQ7 A;  2JV3 A;  2F3N A;  1X40 A;  1F0M A;  2DL0 A;  2KSO A;  3BS5 A;  3SEN A;  1OW5 A;  1Z1V A;  2DKZ A;  2KE7 A;  3K1R B;  1JI7 A;  2E8M A;  2QB0 A;  2LMR A;  5L1M A;  1V85 A;  5JTI A;  2QB1 A;  2F44 A;  2F8K A;  3KKA A;  2E8N A;  3HIL A;  1PK3 A;  3H8M A;  4MHV A;  2B6G A;  2QAR A;  1PK1 A;  1SXD A;  5JRT A;  1UCV A;  2D8C A;  5J8Y A;  1WWU A;  1RG6 A;  2KMD A;  2Y9U A;  2EAM A;  3KKA C;  1B4F A;  1SV4 A;  2Y9T A;  3BS7 A;  1PK1 B;  1X66 A;  4RQN A;  5JU5 A;  2ESE A;  4RQM A;  2L5Y A;  4IS7 A;  4NL9 C;  2ES6 A;  2YTU A;  2EAN A;  5J8Y C;  1X9X A;  2KIV A;  1UQV A;  1WWV A;  3TAC B;  1KW4 A;  2EAP A;  4PZN A;  1SV0 A;  2DKX A;  2LPE A;  3SEI A;  1COK A;  2E8P A;  1SGG A;  1V38 A;  1OXJ A;  4NL9 A;  2QKQ A;  1DXS A;  4NJ8 A;  2FE9 A;  3TAD C;  5F3X B;  1LKY B;  2EAO A;  2K60 A;  2KSO B;  3BS5 B;  2KG5 A;  1B0X A;  1LKY A;  3IDW A;  2E8O A;  4PZO A;  2K4P A;  5KNI A;  2QB0 B;  1SV0 C;  1SXE A;  2GLE A;  2QAR B; 
#chains in the Genus database with same CATH topology
 2MSN A;  1RQN A;  3IV6 A;  4F50 A;  1JXL A;  3BS5 A;  3MGH A;  1QCK A;  8ICR A;  2XC9 A;  3L4P A;  3A0H U;  1TK0 A;  2NO5 A;  5KT3 A;  3LWM A;  4ECW A;  2WB1 C;  8ICX A;  5HNK A;  4HAI A;  3U26 A;  1WUD A;  1L6N A;  5KFP A;  4KLI A;  1D8Y A;  3UM9 A;  4ECY A;  5J2D A;  2AHO B;  1ZET A;  1JRP A;  4C8M A;  5KAI U;  7ICU A;  1L3U A;  2BPF A;  1S0V A;  4EBE A;  3C2L A;  2IOF K;  2V4R A;  4O3N A;  3BQ1 A;  4DL7 A;  5DB8 A;  3PW2 A;  1RG6 A;  5D4B A;  1S10 A;  1N48 A;  2JEJ A;  2ZIW A;  1RXV A;  3H4B A;  2HBM A;  4DFJ A;  4ELV A;  1RZT A;  3PY8 A;  1ZXI A;  2KD1 A;  1ED1 A;  5ALO A;  4C7Y A;  4ACO A;  5KFV A;  4FO6 A;  9ICN A;  3GII A;  9ICU A;  2XID A;  2W3S A;  3ZDE A;  2YB1 A;  2W8K A;  4PPX A;  1V38 A;  3H0L B;  7ICO A;  3T5J A;  5AM0 A;  5ALQ A;  2A1A A;  7ICI A;  1B22 A;  3MR3 A;  5KT5 A;  3AEV A;  4RU9 A;  1A0P A;  2JZB B;  5C0Y A;  1ZQZ A;  2LYH A;  3KD3 A;  5FP0 A;  5III A;  3PR4 A;  4NLZ A;  4F4K A;  5E79 U;  3UMC A;  1BPE A;  3N7P D;  2D3D A;  2F3N A;  1X40 A;  2HHX A;  7ICJ A;  4UAT A;  1IIP A;  1TE2 A;  1S77 D;  2DKZ A;  2WF8 A;  2G5H B;  3PX4 A;  4US8 A;  1L7O A;  4R63 A;  3M8S A;  4QZ9 A;  1MA7 A;  3WKB A;  4DOA A;  2H3Q A;  2F8L A;  4I2D A;  4OJ5 A;  3SI8 A;  2MUT A;  3KKA A;  1L3T A;  2DQN B;  1NK8 A;  2Y1J A;  4QZE A;  3BZC A;  2HOF A;  2ZIU A;  5ALT A;  1SZH A;  2NYV A;  3QEA Z;  5AKY A;  4Y2J A;  3JPP A;  3AU6 A;  1NKB A;  2KMD A;  4UB5 A;  5ALG A;  8ICY A;  1U45 A;  3V72 A;  2R8K A;  3HWT A;  4C0Z A;  2ZJA A;  1UT5 A;  5CWR A;  1XNS A;  2PMZ F;  4QZH A;  3EW9 A;  4PH5 A;  2WTF A;  8ICJ A;  4IL6 U;  2BDP A;  3QU7 A;  1SKR A;  1K1S A;  3ALR A;  2A19 A;  4NL9 A;  3WK6 A;  3PX6 A;  2G5I B;  3F53 A;  1QSY A;  1A77 A;  2ASD A;  8ICQ A;  1ZQP A;  1HUZ A;  7ICN A;  4ED8 A;  5AKK A;  4TUQ A;  2H5X A;  3BQ2 A;  2BR0 A;  1L5U A;  4I2H A;  2LYB A;  3JPR A;  2F77 X;  1KDH A;  4TQS A;  1SXE A;  2RDI A;  5EE0 A;  1ZJN A;  1JRO A;  2QAR B;  8ICS A;  5CJ7 A;  1KSP A;  5EOZ A;  4QJF B;  5ALL A;  3C29 A;  3OJU A;  1GO3 F;  2ZG6 A;  2Y1I A;  1URJ A;  5CR0 A;  2W7P A;  1IG6 A;  3BZK A;  2QB0 A;  1ZQB A;  4G3I A;  2BCQ A;  2M0N A;  1RM6 C;  2ALZ A;  3RH5 A;  4R64 A;  2QB1 A;  3QZ7 A;  2XO7 A;  3CW2 C;  1SL0 A;  5DBB A;  2R8J A;  3UXP A;  4RQ3 A;  7ICS A;  4RQ8 A;  3HIL A;  9ICL A;  4A8E A;  1NK6 A;  2RP5 A;  1SXD A;  1RDF A;  3NS1 A;  2OWO A;  2YB4 A;  2B0C A;  3H0R B;  1WWU A;  4Q8E A;  5EWF A;  4DSI A;  5ALK A;  2I6X A;  3RJJ A;  4F4X A;  3NGD A;  4QIW F;  1ZD4 A;  3I76 A;  4RQN A;  2DPI A;  3TAQ A;  2BPC A;  3CYM A;  3Q8K A;  5J2K A;  4P0Q B;  3KTQ A;  2F1H A;  4RQ5 A;  3NAS A;  1H38 A;  1S9F A;  4AYB F;  3C5G A;  5KL8 B;  4O3S A;  4U7C A;  2PFQ A;  3C2K A;  5J29 A;  2W8L A;  4F5R A;  5ALH A;  1JN3 A;  2HSZ A;  3TFS A;  4QIW C;  1U9L A;  5DG8 A;  1PVP A;  2MUT B;  2XY5 A;  2YMQ A;  2KSO B;  3GV7 B;  5J2H A;  7ICP A;  2JHD A;  5KG2 A;  4PL2 A;  2AH5 A;  1XWL A;  1BPD A;  3N7R C;  1BVS A;  4F71 A;  1ZD5 A;  1SZP A;  4NLN A;  3QYP A;  5AKG A;  1L8L A;  2MA1 A;  4KN7 A;  4QZ8 A;  4BWJ A;  3C23 A;  1ZQH A;  4ECT A;  4O5E A;  9ICM A;  2HBJ A;  2BQR A;  2HHQ A;  4UQG A;  5AKZ A;  4NM2 A;  3RB3 A;  3CP8 A;  1YT3 A;  3C2M A;  4UAW A;  4R66 A;  5JTI A;  3NTU A;  4B9V A;  3J81 j;  3RR8 A;  7ICR A;  3RBE A;  1YZ7 A;  2OH2 A;  2BCU A;  2K4I A;  2ZIV A;  2ZXH A;  2DFL A;  2A1J A;  3H8M A;  4JV1 A;  4WJ3 B;  1WCN A;  1XSL A;  5GTI U;  4RNO A;  4UB6 U;  3MGI A;  1SKW A;  3QU4 A;  4DOC A;  4DS4 A;  5KAF U;  1OUQ A;  5D49 A;  2F76 X;  3V6J A;  1Q3V A;  5CB1 A;  5ALD A;  4Z6F A;  5JU5 A;  2ESE A;  1YZ6 A;  1AQ6 A;  3M1Y A;  4DSL A;  4MEX A;  4I2I A;  1O03 A;  2ZUB A;  4ICA A;  3A0B U;  4F5O A;  1ZQI A;  4IRC A;  2EAP A;  4RQ0 A;  4PZN A;  2RQ5 A;  4DL3 A;  5ALZ A;  4DQP A;  2AGP A;  1NOM A;  1VDV A;  4RUC A;  4YN4 A;  3KHL A;  2DKX A;  4Y2U A;  3TKA A;  5J0O A;  4C8K A;  1ZQU A;  4QW9 A;  3MFH A;  4I2J A;  3C21 A;  4OO1 J;  2AQ4 A;  4MF8 A;  3I28 A;  1NKE A;  1S0N A;  4UAS A;  1N61 A;  3ZD8 A;  4QWA A;  1D9F A;  4US9 A;  1JIH A;  1UHU A;  2EH9 A;  2K8A A;  1CEZ A;  3FDS A;  4F72 A;  4OJO A;  3B9J A;  3BQ7 A;  2FLP A;  4Z6D A;  5KFU A;  4YMO A;  4PHA A;  1SKS A;  1BPZ A;  4BUG A;  2W54 A;  5AK5 A;  1Z1V A;  3O0F A;  1F5S A;  2JGA A;  2MRL A;  1JI7 A;  1X6I A;  5F9N A;  5AM3 A;  4RNM A;  5AI8 A;  2Y0S C;  5AM4 A;  2GO7 A;  4OJP A;  2ZIX B;  2KFZ A;  1MSW D;  3WKC A;  5AKI A;  3RB4 A;  4UW9 A;  5ALF A;  2IMW P;  4M9L A;  1CRX A;  4JWM A;  4RQ7 A;  4UB8 U;  4QWB A;  4IQV A;  1ZQX A;  2IOH A;  9ICX A;  3ETL A;  4FS1 A;  3H8S A;  5L1J A;  4DSF A;  3OHB A;  1JX4 A;  3ZI4 A;  3RJH A;  2WHE A;  1L7N A;  4HYK A;  7ICE A;  1LVH A;  1Z1B A;  3PX0 A;  2RHF A;  4XUS A;  2FPL A;  2YTU A;  1L7M A;  2EAN A;  5J0Q A;  4P2H A;  2Z7J A;  2G0A A;  3UMG A;  1SL2 A;  2J6T A;  2NRW A;  4YQW A;  1CUK A;  1KEJ A;  3PSP A;  4CNQ A;  4EEL A;  4RQ6 A;  1KFT A;  4QNL A;  2BDU A;  3QNM A;  1SGG A;  1ZJM A;  4MFF A;  1OXJ A;  5IIN A;  2JMG A;  2WF6 A;  2KJ9 A;  1TAM A;  2ASJ A;  4LVS A;  2ZTC A;  1ZQL A;  2LKY A;  2FJ6 A;  2VKQ A;  1C20 A;  3QXG A;  3GV5 B;  1B0X A;  3DDH A;  4IQU A;  2XGQ A;  2W9A A;  3ICX A;  4NY8 A;  1SL1 A;  3WKE A;  4Y2Q A;  4J9R A;  2JV3 A;  3VC8 A;  4DQI A;  5J2G A;  2WF7 A;  3HKZ F;  4CGZ A;  3K1Z A;  3QU2 A;  1HIW A;  4RT3 A;  4O5K A;  4KLU A;  2VA8 A;  4GC6 A;  4C8L A;  1V9P A;  2JH7 A;  4KLM A;  3MBY A;  1KFD A;  4BX9 C;  4DF8 A;  2FMS A;  4YR0 A;  3B0Y A;  2V4Q A;  1WG8 A;  4NM1 A;  2EDU A;  5KFY A;  1X9S A;  3ZDA A;  4BDP A;  2LM1 A;  5ALY A;  4DCC A;  4Z6C A;  3WK7 A;  2XCA A;  4E0D A;  3C1Z A;  5JUM A;  2W03 A;  4Q43 A;  1ZQC A;  2HBK A;  1PK1 A;  3RH6 A;  5KG3 A;  3GIM A;  3M8R A;  4EEY A;  2BCR A;  3ZD9 A;  3F2C A;  4CF4 A;  1ZQ1 C;  2VJ5 A;  4B6J A;  4DF4 A;  3LDA A;  3UMB A;  3M7D A;  5AI0 A;  3RAQ A;  1XS9 D;  3Q8P B;  3LYS A;  4DLE A;  5DGA A;  5G5G A;  4KLG A;  2XVT A;  5BPC A;  1B4F A;  7ICQ A;  3MDA A;  4GIB A;  3N7S C;  5AK4 A;  8ICV A;  4F2S A;  3ISD A;  4IS7 A;  9ICG A;  4M04 A;  1ZQY A;  1X9X A;  1NK4 A;  5ALS A;  5KFX A;  5KT2 A;  1D8L A;  3RB0 A;  1TAU A;  4M9G A;  2W11 A;  3FAH A;  5J0R A;  4J9L A;  3MDC A;  4FFD A;  5KFB A;  5KG0 A;  1DXS A;  4JMU A;  2B21 A;  1JAL A;  4FZM A;  1LKY B;  3RH4 A;  2VA2 A;  2R8I A;  4DEZ A;  3NUQ A;  4CCH A;  5IIL A;  5J0X A;  4Y2V A;  4KLE A;  8ICP A;  4UB4 A;  2KG5 A;  4GLX A;  1Q3U A;  4F93 B;  9ICK A;  5DQH A;  1UT8 A;  5AKH A;  2K89 A;  4PJ0 U;  3PW0 A;  3DV9 A;  2D6F C;  1N5X A;  4I27 A;  1FEZ A;  2KP7 A;  3SV3 A;  3RB6 A;  2BKE A;  2NRT A;  5J2J A;  9ICT A;  1DK3 A;  3PO5 A;  3LWL A;  1NK5 A;  4ELU A;  1NK0 A;  1ZQS A;  2VJ4 A;  2LMR A;  5L1M A;  3RFA A;  2R8G A;  3VCB A;  4ECS A;  9ICF A;  3KBB A;  2BCS A;  2HHU A;  4YCX A;  4YXM A;  4C80 A;  1KBU A;  3ETR A;  2BHN A;  3BDP A;  4MHV A;  2E5S A;  5J2B A;  4QZA A;  2WF9 A;  3V7J A;  1ZQD A;  3RJK A;  4UAR A;  3ORY A;  4Q44 A;  5KG4 A;  4K4H A;  4KLO A;  2O6K A;  4MFC A;  5DLG A;  4RQ2 A;  1ZQW A;  3H7I A;  5DB6 A;  1PVR A;  4KLL A;  4DFK A;  4J03 A;  8ICT A;  3D2N A;  5KG5 A;  7ICH A;  2KIV A;  1KN5 A;  3ISB A;  2PFO A;  1TAQ A;  4Z6E A;  1UPH A;  4QZC A;  2PXI A;  4EBD A;  5HMM A;  4EEN A;  5AIA A;  1T3Q A;  3SAG A;  4DL4 A;  4GXJ A;  5IIJ A;  3QEB Z;  5KFA A;  2JEI A;  1TVA A;  3TAD C;  4J9P A;  2KNJ A;  3ZDC A;  5KT4 A;  2RDJ A;  3PVX A;  3WU2 U;  4O3Q A;  4ECU A;  5J2C A;  2DWQ A;  4DSJ A;  3THV A;  3WKA A;  4ED2 A;  1BPX A;  5L1L A;  1QTM A;  4R65 A;  3PML A;  1Z00 A;  2QB0 B;  5AM5 A;  4EBC A;  2YN4 A;  4DFM A;  2UVW A;  3MC1 A;  1U49 A;  2DL0 A;  3GZF A;  3RBD A;  1Z3E B;  4B9M A;  3UXO A;  4RQ1 A;  4O0I A;  3PW7 A;  2XGP A;  2HHT A;  3E2E A;  5AK6 A;  9ICP A;  1IV8 A;  5KG1 A;  4KTQ A;  4KIT B;  4FBU A;  1N5W A;  2IBK A;  2F8K A;  1WCL A;  3G6X A;  1HUO A;  3RJE A;  1DOQ A;  4EX6 A;  4I2G A;  4F91 B;  2I9G A;  2PFP A;  2FPK A;  1S5L U;  2D8C A;  4M9J A;  1KLN A;  5T14 A;  3C5F A;  1BNP A;  3E58 A;  2KZ3 A;  4KX5 A;  2ZTE A;  5IIO A;  3SAF A;  3E0F A;  4NV0 A;  2KZM A;  5AKJ A;  3GV8 B;  3PNC A;  5ALN A;  2FLN A;  3C1Y A;  5TZV A;  4B9L A;  1S8O A;  1QSL A;  4DFD A;  4U6P A;  1IXR A;  4KMO B;  1UQV A;  2H3Z A;  1NK7 A;  5F9L A;  3LVW A;  1SV0 A;  2ATL A;  4KMU A;  4Y2Y A;  2YMM A;  3FC4 A;  4LZG A;  8ICA A;  2E8P A;  4AP9 A;  3NRZ A;  2PI4 A;  2HHS A;  2ZJ5 A;  2C2D A;  1HEK A;  1Y88 A;  3MR2 A;  4QZI A;  5DG9 A;  1UA1 A;  5AKX A;  3NVW A;  1LKY A;  1XSN A;  5DG7 A;  1RPL A;  2OXO A;  4PZO A;  4TQR A;  5K4L A;  4C4T A;  3OSN A;  3MR5 A;  4RPY A;  2W7O A;  4F5Q A;  2HVI A;  3HW8 A;  3TAD A;  1T7P A;  5CHG A;  2QLT A;  2LYA A;  1OW5 A;  5AM1 A;  2N1R A;  4I2F A;  2YML A;  1ECW A;  3KHH A;  4M9N A;  3C28 A;  2P6U A;  3PW4 A;  1DRG A;  5DDM A;  2JZB A;  2JEG A;  1D9D A;  8ICH A;  4MF2 A;  2AXT U;  4J9O A;  1BNO A;  1FFU A;  4BGD A;  3FYH A;  5DBC A;  9ICB A;  1ZQO A;  2PMZ C;  4XRH A;  3IP4 B;  2LHT A;  4KLF A;  2NV3 A;  5KFE A;  4RT2 A;  4ZH4 A;  4YP3 A;  4JV0 A;  3BJY A;  1JXE A;  5HHH A;  2C2R A;  8ICW A;  1C7Y A;  5DDY A;  3SYZ A;  2CN1 A;  1PVQ A;  1S0O A;  3QZ8 A;  5KFF A;  4DQR A;  2MAX A;  8ICF A;  3KZI U;  9ICH A;  4ECX A;  2KKP A;  2KOB A;  4Y2P A;  3Q8L A;  3G6Y A;  4DSK A;  2P66 A;  4IC9 A;  3T5L A;  3SR6 A;  3EPG A;  3RAX A;  4QWD A;  4M6W A;  4J9N A;  1DGS A;  3D2S A;  4NLK A;  5HP4 A;  3DEE A;  3RJF A;  5J8Y C;  5J2F A;  4C4R A;  1KL9 A;  3TAR A;  5KFH A;  2RLT A;  3LVV A;  4P0Q A;  3BQT A;  3IG8 A;  1HJP A;  1ARO P;  2DGZ A;  1NI3 A;  3PZP A;  4IQW A;  4UB3 A;  3JPQ A;  2Q0Z X;  1U4B A;  1COK A;  2ASL A;  5BOL A;  1T94 A;  3GFK B;  1TFR A;  3ONN A;  5CRX A;  1FFV A;  4YMM A;  3ISC A;  1IM4 A;  4DSE A;  3NVZ A;  2WB1 F;  2FDR A;  5AM2 A;  3SZ2 A;  1MN8 A;  2F1I A;  3SAH A;  2HDO A;  2F2A B;  5DB9 A;  4DLG A;  2XY6 A;  3GIK A;  5ALM A;  3RJG A;  2GLE A;  8ICB A;  3KFU F;  2AGO A;  2K4H A;  3AU2 A;  1L7P A;  2OHF A;  4F2R A;  1NNL A;  3Q8S B;  5KFM A;  5AIC A;  5J0Y A;  4KLS A;  3OSP A;  2KE7 A;  5KFR A;  1T3N A;  4ZOH C;  2OEH A;  2NRV A;  4OCZ A;  4XQ8 A;  1ZQM A;  5L1I A;  2E8M A;  4ELT A;  5BOM A;  2FI1 A;  2P35 A;  4F8R A;  3UQ0 A;  4DQQ A;  1MQ3 A;  5J0S A;  1ZRN A;  3QUQ A;  3RR7 A;  9ICQ A;  1ZQQ A;  1KQQ A;  4CF5 A;  2KV2 A;  1UA0 A;  3GQC A;  3ED5 A;  7ICG A;  3AMZ A;  5KFL A;  4DOB A;  8ICO A;  3F2B A;  1BPY A;  4KLD A;  1L8O A;  5AI5 A;  1JMS A;  5HML A;  3Q8Q B;  1U47 A;  5AI9 A;  2W9B A;  2CRX A;  4JK1 A;  3PO4 A;  2LM4 A;  3NRW A;  3EYZ A;  3SQI A;  3M6Z A;  1D8B A;  2Y9U A;  2C28 A;  3H4D A;  2IA6 A;  3OJS A;  1PK1 B;  1X66 A;  2XI9 A;  5AI6 A;  4M2Y A;  4EEK A;  4AYB C;  4R8U A;  2ISP A;  1JUD A;  2OYY A;  2DF4 B;  4F5P A;  3TAP A;  8ICI A;  4FS2 A;  4UAV A;  1TK8 A;  4B9T A;  3AQE A;  7ICK A;  3QU5 A;  2LPE A;  3F5E A;  2NRZ A;  1TV9 A;  2UVV A;  1KKX A;  2VA3 A;  4ED1 A;  1ZQG A;  3HJE A;  3WK4 A;  3WK9 A;  4PHE A;  1Z19 A;  1K1Q A;  4DL5 A;  4CDG A;  3HT3 A;  5ALX A;  5KFZ A;  4FZL A;  2PFN A;  3B0X A;  1PZN A;  1J97 A;  3PR5 B;  4J9K A;  2KK0 A;  1K5O A;  1NJY A;  2IHN A;  2G08 A;  5EE9 A;  2WF5 A;  4DL2 A;  5B66 U;  3EPI A;  1ZYQ A;  4KLQ A;  2HVH A;  9ICV A;  4QZB A;  7ICT A;  5IIK A;  2H3V A;  4EYI B;  7ICL A;  4MFA A;  1RQL A;  4F3O A;  2HOI A;  4YR2 A;  4F4W A;  2KJ5 A;  3QUB A;  2F44 A;  5IIM A;  4PL1 A;  2FMQ A;  4K4G A;  4K4I A;  1QQ5 A;  1RXW A;  3ZDB A;  4FZN A;  4O3R A;  8ICE A;  5HHI A;  9ICW A;  5AK3 A;  2RRD A;  2AQ0 A;  3LK9 A;  3G6V A;  4QZG A;  4KN4 A;  1QQ6 A;  1RYU A;  4QWC A;  3OTQ A;  1V97 A;  2BQ3 A;  1NJX A;  4OJL A;  3GIL A;  2Q4T A;  1A76 A;  5L1K A;  2E1E A;  2UVR A;  2W9B B;  5HR6 A;  2G06 A;  3MAB A;  2VIX A;  4J9S A;  4P4O A;  1ZQF A;  2W9C B;  5AHX A;  2K4E A;  4UAU A;  1KFS A;  1A6S A;  4ECZ A;  4ED3 A;  3NVV A;  9ICS A;  3SEI A;  1FIQ A;  4B9S A;  3QUT A;  2EAO A;  1TKD A;  4KX3 A;  3D6J A;  4YXJ A;  2KIC A;  1RYR A;  2H3F A;  2XIC A;  3KZX A;  4JWN A;  4F5N A;  8ICN A;  3R9K A;  1PUZ A;  4RNN A;  3RRH A;  2OCE A;  8ICC A;  5AIB A;  2KVC A;  2KSO A;  1QLN A;  4NWI A;  2KEY A;  5KFQ A;  3K1R B;  3HKZ C;  3F5A A;  1MQ2 A;  2YMP A;  5EWG A;  2W3R A;  4JUZ A;  1MC8 A;  1RYS A;  3V7K A;  1ZRM A;  5D46 A;  5KFS A;  2E8N A;  4IQT A;  3AM9 A;  1ZQT A;  2HW3 A;  2KN7 A;  4R8U B;  2EZY A;  5GTH U;  3AQF A;  1N2X A;  7ICM A;  1WYG A;  4JB3 A;  4I2C A;  3K4G A;  4IR1 A;  1BGX T;  3H0M B;  2JRZ A;  5AKE A;  3GIJ A;  4PHP A;  4OD0 A;  2Y9T A;  3BS7 A;  4NLG A;  1SIJ A;  4I2B A;  9ICO A;  3GU3 A;  4RQM A;  1Z4O A;  2R8H A;  4USA A;  3T5H A;  2GWS A;  5KFD A;  1COO A;  3HPO A;  3M9O B;  3EZ5 A;  1U48 A;  4J9Q A;  1ZQK A;  2HMX A;  3RJI A;  3MGV A;  5L9X A;  2MU2 A;  5G5H A;  4EZ9 A;  3V6K A;  1N63 A;  2JXJ A;  2DUY A;  5DLF A;  3IM1 A;  1ZQR A;  2W04 A;  5ALP A;  5CA7 A;  3WKD A;  3T3F A;  2EZX A;  3V7L A;  8ICZ A;  2E8O A;  4DO9 A;  2HBL A;  5ALU A;  4EX7 A;  4B9U A;  1VLB A;  2W9C A;  2HOQ A;  2AGQ A;  4QZF A;  4PGY A;  4O3O A;  1ZQA A;  1SWV A;  4O3P A;  3JPN A;  9ICE A;  3PSF A;  1DK2 A;  4TUP A;  5KFO A;  4DS5 A;  5AI4 A;  4IR9 A;  4PGQ A;  2IHM A;  5KFW A;  2XCP A;  2ISO A;  1X9W A;  4I2E A;  2KFN A;  2W43 A;  2NO4 A;  1Q46 A;  2ZUC A;  5KFI A;  3L3F X;  3H8J A;  2PKE A;  2K8C B;  2M9N A;  2YY6 A;  1P7D A;  4M6W B;  4J9M A;  9ICJ A;  3SMV A;  4NLC A;  1SV4 A;  3SV4 A;  1LV5 A;  2KZZ A;  4M9H A;  2H3I A;  2W9M A;  5J2I A;  5KFN A;  3QU9 A;  3GDX A;  3MFI A;  2WAQ C;  5DKW A;  3UXN A;  4NLB A;  2ES6 A;  1TK5 A;  2HHW A;  1SB3 C;  2WAQ F;  2PI5 A;  3K75 D;  4YG2 A;  1KW4 A;  4PGX A;  4ECV A;  4GFJ A;  3S6J A;  4TUS A;  1N56 A;  1ZQE A;  2LI6 A;  2XY7 A;  3EUB 2;  2C22 A;  2ZTD A;  1QQ7 A;  3H8W A;  2K60 A;  4UB2 A;  5KT7 A;  5DB7 A;  3AUO A;  5ALR A;  4DQS A;  5J0W A;  1SWW A;  1M6Y A;  4YMN A;  5DQI A;  2K4P A;  2J6S A;  3FM9 A;  5DGB A;  4I29 A;  5DBA A;  1Z00 B;  4KLH A;  1KTQ A;  2NRX A;  4BWM A;  1LB2 B;  4KLJ A;  2ZIV B;  4BJQ A;  4P0P A;  1B43 A;  2YX8 A;  3N97 B;  4ED7 A;  4ED0 A;  1X6J A;  1S76 D;  4RZR A;  1L3V A;  3UQ2 A;  4O3M A;  4RQ4 A;  5J0P A;  4C8N A;  2C2E A;  4UAY A;  3RTV A;  3N4M B;  1PK3 A;  4DL6 A;  4FBT A;  5C5J A;  4IRD A;  4CF3 A;  4UAZ A;  4JV2 A;  7ICF A;  2BGW A;  2ZIU B;  2KTQ A;  4IRK A;  4YR3 A;  2I1Q A;  4YFK A;  5J2A A;  4Y2X A;  1QH9 A;  3JPT A;  3Q8M A;  4RPZ A;  4EZ6 A;  3TFR A;  4KLT A;  1Z4N A;  2W55 A;  4UB1 A;  2G09 A;  1NZB A;  1CI4 A;  9ICI A;  9ICA A;  3F2D A;  2HHV A;  2OM6 A;  9ICR A;  8ICM A;  2WFA A;  4NJ8 A;  2J6U A;  3OHA A;  2DPJ A;  2FLL A;  2I5H A;  3BS5 B;  4ECR A;  1F44 A;  4O5C A;  3TAN A;  3EWA A;  4GXI A;  3KHG A;  3M9M B;  4B9N A;  4P4M A;  5KG6 A;  4M0A A;  4UBC A;  3V6H A;  3HX0 A;  4RPX A;  2ZXI A;  3NVY A;  4Q8F A;  2UVU A;  3AN1 A;  5KFJ A;  5AKL A;  2KHQ A;  8ICU A;  1S0M A;  3TQ1 A;  5EE3 A;  1NJW A;  2K8B B;  5ALV A;  2GOL A;  1ZQV A;  4P0P B;  3IHQ B;  5ALJ A;  8ICK A;  3HP6 A;  4M47 A;  4BXO A;  2BCV A;  1ZD3 A;  4DFP A;  2EZZ A;  1NKC A;  8ICG A;  2V9W A;  2ZIX A;  2LBO A;  3BQ0 A;  4Y2S A;  4QWE A;  4GXK A;  1DGJ A;  2QAR A;  2B6G A;  7ICV A;  4F92 B;  5J0U A;  5KFT A;  3OGU A;  4YD1 A;  2AJQ A;  1UCV A;  5DQG A;  2ZIW B;  3L5K A;  5KFK A;  2CXY A;  3I1Y A;  4CRX A;  5KL1 B;  3H40 A;  4ECQ A;  1ZQJ A;  4TUR A;  2EAM A;  2Y0S F;  3T5K A;  2P6R A;  4BXO B;  8ICL A;  4C7Z A;  5CEH A;  2ODG A;  4RUA A;  2L5Y A;  5EWE A;  1BPB A;  5A0L A;  2E1F A;  1WWV A;  1FO4 A;  4YVZ A;  3PMN A;  3TAC B;  2KIW A;  4ED6 A;  2JEF A;  4QZD A;  1Q8K A;  4Q45 A;  3QX7 A;  3WK5 A;  1NZP A;  2ZUD A;  1KRP A;  2FE9 A;  1O08 A;  4OJ6 A;  5J2E A;  5F3X B;  2G07 A;  4Y2T A;  5TIS U;  1ZQN A;  3IG5 A;  2AU0 A;  1J2N A;  3QUC A;  3PST A;  1XC9 A;  3IDW A;  3PW5 A;  2BPG A;  3QE9 Y;  1XU4 A;  3SD7 A;  2CPR A;  4NXZ A;  3WK8 A;  2KJ8 A;  4LJX A;  5KG7 A;  3PV8 A;  2YQE A;  1N60 A;  5KTQ A;  3UPQ A;  4X5V A;  1F0M A;  1ZOL A;  1X42 A;  2KHV A;  5KT6 A;  4CE6 A;  2JH1 A;  3SEN A;  1X2I A;  3N28 A;  2JR5 A;  3JPO A;  3JPS A;  5KFC A;  3RRG A;  1V85 A;  4P4P A;  1XO0 A;  2A1J B;  3KOO A;  2DBY A;  5H2F U;  4G9B A;  5B5E U;  2HCF A;  5ALW A;  1T4G A;  3MR6 A;  4UBB A;  4LZD A;  4QW8 A;  4PHD A;  1S97 A;  4I28 A;  5JRT A;  4C8O A;  2KKV A;  4FE3 A;  2A3V A;  3TI0 A;  2KVS A;  2BZF A;  5J8Y A;  4O9M A;  3RF9 A;  1L3S A;  3CNH A;  3PSI A;  1N62 A;  2FPM A;  4F4Z A;  3IRU A;  3KKA C;  1NK9 A;  1XO1 A;  2ZJ8 A;  3ZDD A;  2R18 A;  5KFG A;  5J0T A;  3T79 A;  4F4Y A;  3HRD D;  2HI0 A;  4NL9 C;  3M6K A;  2E3T A;  2BQU A;  1QSS A;  3CRX A;  5ALI A;  3OPX A;  3KHR A;  2IOF A;  1ZD2 P;  5ALE A;  4C4S A;  2QKQ A;  1T8E A;  4YD2 A;  1EXN A;  3AL0 B;  1XSP A;  4MEY A;  5EE1 A;  9ICC A;  2EQY A;  2VAN A;  3M9N B;  3Q8R B;  2GH1 A;  3D2Q A;  1NJZ A;  4XA5 A;  2F1J A;  5HR7 A;  4Y2R A;  1J2M A;  5KNI A;  3IN5 A;  4GC7 A;  1SV0 C;  4DWI A;  4EYH B;  2FMP A;  1VJ5 A;  1X9M A;  5CP2 A;  4I2A A; 
#chains in the Genus database with same CATH homology
 2D3D A;  3TAD A;  3BQ7 A;  2JV3 A;  2F3N A;  1X40 A;  1F0M A;  2DL0 A;  2KSO A;  3BS5 A;  3SEN A;  1OW5 A;  1Z1V A;  2DKZ A;  2KE7 A;  3K1R B;  1JI7 A;  2E8M A;  2QB0 A;  2LMR A;  5L1M A;  1V85 A;  5JTI A;  2QB1 A;  2F44 A;  2F8K A;  3KKA A;  2E8N A;  3HIL A;  1PK3 A;  3H8M A;  4MHV A;  2B6G A;  2QAR A;  1PK1 A;  1SXD A;  5JRT A;  1UCV A;  2D8C A;  5J8Y A;  1WWU A;  1RG6 A;  2KMD A;  2Y9U A;  2EAM A;  3KKA C;  1B4F A;  1SV4 A;  2Y9T A;  3BS7 A;  1PK1 B;  1X66 A;  4RQN A;  5JU5 A;  2ESE A;  4RQM A;  2L5Y A;  4IS7 A;  4NL9 C;  2ES6 A;  2YTU A;  2EAN A;  5J8Y C;  1X9X A;  2KIV A;  1UQV A;  1WWV A;  3TAC B;  1KW4 A;  2EAP A;  4PZN A;  1SV0 A;  2DKX A;  2LPE A;  3SEI A;  1COK A;  2E8P A;  1SGG A;  1V38 A;  1OXJ A;  4NL9 A;  2QKQ A;  1DXS A;  4NJ8 A;  2FE9 A;  3TAD C;  5F3X B;  1LKY B;  2EAO A;  2K60 A;  2KSO B;  3BS5 B;  2KG5 A;  1B0X A;  1LKY A;  3IDW A;  2E8O A;  4PZO A;  2K4P A;  5KNI A;  2QB0 B;  1SV0 C;  1SXE A;  2GLE A;  2QAR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...