1UQVA

Sam domain from ste50p
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
GSHMNNEDFSQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDSKLEWKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STE50 PROTEIN
publication title Structure of the Sterile {Alpha} Motif (Sam) Domain of the Saccharomyces Cerevisiae Mitogen-Activated Protein Kinase Pathway-Modulating Protein Ste50 and Analysis of its Interaction with the Ste11 Sam
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09235 SAM_Ste50p Ste50p, sterile alpha motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1uqvA00
1X66A 2DKXA 1OW5A 1B4FA 2F8KA 3BQ7A 1SXDA 2KMDA 2FE9A 2KE7A 2LPEA 3SENA 2KIVA 2D8CA 1SV0A 1F0MA 2K4PA 2EAOA 2B6GA 5JRTA 3K1RB 1X9XA 2QB1A 2QB0A 2F3NA 2Y9TA 2E8PA 2ESEA 2DKZA 4RQNA 1WWVA 1PK1A 2QKQA 1SV0C 5L1MA 1COKA 2E8NA 3IDWA 1Z1VA 1SV4A 3SEIA 2Y9UA 5F3XB 1V85A 4IS7A 4RQMA 2QB0B 4PZOA 4NL9A 2L5YA 4NJ8A 1UCVA 2E8MA 1UQVA 3TACB 1PK3A 5KNIA 2LMRA 1PK1B 2KSOA 1V38A 2ES6A 3TADC 1OXJA 1SGGA 3H8MA 3BS5A 2EANA 1SXEA 4NL9C 3BS5B 1X40A 3TADA 1WWUA 2K60A 1JI7A 2D3DA 3KKAA 3BS7A 5JTIA 2DL0A 5J8YA 1LKYA 2JV3A 2QARA 1DXSA 1RG6A 1LKYB 2QARB 2EAMA 1B0XA 5JU5A 4MHVA 2KSOB 4PZNA 2KG5A 2GLEA 1KW4A 3KKAC 2E8OA 2F44A 2EAPA 5J8YC 3HILA 2YTUA
chains in the Genus database with same CATH superfamily
2K8BB 2KK0A 3MABA 3AL0B 1SL1A 5KFTA 3H4BA 1RXWA 1L7PA 3NGDA 1NK5A 5TZVA 2KTQA 2HSZA 1L7NA 3E58A 9ICTA 3KHHA 3H0RB 1Z00B 3RAXA 4UB6U 1KTQA 3LK9A 4KMUA 3E2EA 2FLPA 5AIAA 1X9XA 5J2DA 2F3NA 2KKVA 1PVQA 4TQRA 5ALQA 5DDYA 3SZ2A 4YN4A 2LYBA 4JWNA 5AK5A 2GWSA 4M9LA 3A0BU 2W8LA 5KG6A 2OXOA 5CB1A 7ICIA 3NVWA 3T5LA 1YT3A 1N63A 4O3NA 2CPRA 2FPMA 3RR7A 4YMOA 1RPLA 3I28A 1NZPA 3EPGA 4A8EA 2ISPA 5KFBA 2HDOA 4PHEA 3IG8A 3NUQA 5ALHA 2WB1F 4GXIA 2FMSA 1DGJA 1PK3A 2LHTA 4EX6A 3RH6A 3LVWA 3TAPA 8ICEA 1KSPA 1OXJA 2GH1A 8ICOA 4C8NA 4I28A 1J2MA 3Q8SB 5J2KA 3ZDDA 4KLHA 7ICRA 4MEXA 4DEZA 2MUTA 5DBCA 4NWIA 5KFNA 1NK9A 3WK6A 2VIXA 5IILA 5DBBA 1ZD4A 2ZTDA 3EYZA 4PZNA 9ICFA 4ED6A 2PI5A 4RQ3A 4Z6CA 3WK4A 2I6XA 1J97A 4RQ4A 2HHWA 3HILA 3KHLA 5BOMA 9ICRA 3QU9A 4MFFA 1MA7A 2LYAA 2XVTA 2QLTA 1IXRA 2NYVA 5ALTA 3BQ7A 1QQ7A 2IOHA 2MSNA 1BPBA 2AU0A 5IIOA 1D8BA 3QU4A 3PV8A 4DSLA 4NV0A 2HMXA 2IOFA 5AI4A 1A6SA 3SMVA 4OJOA 2G08A 1SZHA 8ICGA 4P0PA 4G3IA 4JV0A 3RFAA 5EE1A 1NK7A 2XI9A 4KITB 4P4OA 1XNSA 2AH5A 1P7DA 1L6NA 4DSFA 2W8KA 5AKJA 2BHNA 1XSPA 2BCVA 4YP3A 5IIJA 3RBEA 2RP5A 1U49A 1AQ6A 2K8CB 4DSJA 2DFLA 3OSPA 4FZLA 4PL1A 4Q44A 5L9XA 4R64A 8ICTA 4OCZA 9ICUA 1ZQBA 2R8IA 2RDJA 2BQUA 4J9OA 4B9LA 5ALYA 1L7OA 4ECXA 4GLXA 1WWUA 1Z19A 4EENA 1Z1BA 3BS7A 4DQIA 4UB2A 4ED7A 5KFKA 2JV3A 3NVYA 1RG6A 4BGDA 4RPXA 5B66U 4DFPA 3OHAA 4UAZA 4OO1J 5KFXA 3JPTA 5D46A 4O3MA 2VJ4A 5J8YC 4KMOB 2DKXA 2R8KA 5J2CA 3LDAA 3QU5A 4YR3A 1BPEA 4B9TA 5AKIA 8ICIA 4FFDA 3MBYA 2ASDA 2HOQA 5KFFA 9ICWA 3GV8B 3N7RC 1MQ3A 3RB0A 1PVPA 1KFDA 3B0YA 3L5KA 4FS1A 2K4EA 3K1RB 8ICMA 3ETRA 1TK0A 3QU2A 3BZCA 5J2HA 2NO5A 2BCQA 2E8PA 3IV6A 5J0PA 4I2FA 2QKQA 4EEYA 1L3SA 3KHGA 2KZMA 2WF5A 3G6XA 1COKA 2HHQA 2Y0SC 5HR7A 1IM4A 5FP0A 4CCHA 2W9BB 7ICFA 2Q0ZX 4QZAA 4Z6EA 4UAWA 5AI8A 4M04A 1BGXT 5DDMA 4DCCA 1ZQTA 1URJA 2JEIA 2G06A 3KHRA 3TI0A 4O0IA 3TACB 3HT3A 4FZMA 5ALMA 3QNMA 3F5AA 5AKLA 4DQPA 9ICEA 3TADC 4O3SA 2BCUA 1ZQWA 4UBBA 5EWGA 4LVSA 4TUSA 2LYHA 3PX0A 1JI7A 1ZETA 4CGZA 3KKAA 1RQLA 3SI8A 3QUTA 4CF5A 5J0OA 2MAXA 3HJEA 3SAGA 4O3QA 2WF6A 2YB1A 1QQ5A 1Z00A 2GO7A 2AGPA 4BXOB 5J0UA 4KLOA 1S9FA 2WF8A 2EZXA 5CWRA 4Y2XA 2KP7A 5KFAA 1UPHA 5KG2A 1S0NA 9ICMA 2W9MA 4F4WA 4F93B 3F53A 1CUKA 1D8LA 5T14A 3GQCA 3PW2A 2BQRA 5KFGA 2O6KA 1MN8A 2ZIWB 3UXPA 7ICJA 1LVHA 3DEEA 1ED1A 2BPFA 2E1FA 4YD1A 1ZQQA 1A76A 1L3TA 1IV8A 2M0NA 3T79A 3RR8A 2DKZA 3RJGA 1WCLA 2ODGA 9ICKA 9ICSA 1KRPA 4EEKA 3KTQA 2HOFA 4FO6A 2E8NA 3FYHA 3JPRA 4J9QA 4QWAA 8ICLA 4F4XA 3V7JA 4RQ6A 8ICUA 5HHIA 2W04A 4C8KA 1PK1B 2PI4A 1PVRA 4I2HA 9ICVA 1V38A 5CP2A 1X6JA 5KAIU 3V7LA 3M7DA 3PW0A 2BCSA 4TUQA 3AQFA 1COOA 1XO0A 4LZGA 1B43A 4BUGA 4M47A 1VDVA 2CXYA 2KZZA 4ZH4A 1LKYA 1TAQA 4J9RA 2W54A 3UQ2A 3BQ0A 3GZFA 4RNMA 2YMPA 1YZ6A 2FJ6A 2BDUA 2ZIXA 5D49A 4US9A 5B5EU 5J2AA 3GU3A 3D6JA 1DRGA 3AU2A 2NV3A 2ZTEA 3WKDA 3HW8A 4MF8A 2K8AA 7ICGA 4QZBA 3PX4A 2E3TA 3ONNA 4J9SA 4DFMA 1BNOA 5BPCA 3PR4A 2Y0SF 3MFHA 5J2BA 2ZUCA 2VA8A 4RQNA 2PXIA 4J9LA 3L4PA 3OGUA 1T4GA 4DOCA 1L3UA 3RJFA 9ICXA 1SV0C 4C7ZA 1XS9D 2JH1A 4Y2PA 1N61A 2H3ZA 4IRCA 1ZJNA 4QIWC 2YMMA 1ZQ1C 4PHPA 1KL9A 2HW3A 3TARA 8ICQA 1PZNA 5DB7A 1ZQUA 3RJHA 3CW2C 1UQVA 4FBTA 3GIMA 1U48A 2W11A 1N62A 4KLUA 5CHGA 2MRLA 1KEJA 1JROA 7ICLA 2C2EA 1HUZA 3H8MA 3ZDEA 2ZIVB 3T5KA 4KLLA 2WTFA 4I2CA 5AKZA 4C0ZA 5KG3A 4RQ1A 3Q8MA 1Q8KA 2D3DA 4NM1A 1ZQMA 2FPLA 4OJ6A 4F4YA 5HNKA 5EOZA 1ZQZA 2GOLA 2XICA 1T94A 1OUQA 4BWJA 3RB4A 4ECQA 4EYHB 2HHXA 4RPYA 2GLEA 4UATA 9ICJA 4C80A 4M9GA 2HI0A 1NK0A 1C20A 3SQIA 5EWEA 8ICJA 3ZD9A 4CE6A 5J0RA 1NJWA 4ED2A 3MC1A 4DWIA 2F76X 3MDAA 1NNLA 2KE7A 4YG2A 4R65A 2W9BA 4M9JA 3C5FA 2KJ5A 3C29A 1V9PA 4OJ5A 3J81j 7ICPA 5HR6A 1KDHA 1XWLA 3WK7A 2MU2A 4M6WB 3BJYA 2AGQA 5F9NA 2KIWA 3JPPA 2I9GA 1O08A 5F9LA 2NRWA 4YD2A 1RYUA 4R8UB 3WKAA 3WKEA 2XGQA 3RTVA 3NVZA 1GO3F 4IC9A 1ZQRA 5ALVA 1V97A 2IHMA 4ED1A 2KZ3A 4FZNA 1NK8A 4BXOA 3QXGA 5J2JA 4Y2SA 1Q46A 2HHSA 4FE3A 3NVVA 4RPZA 4F5NA 3BS5A 4QZIA 2HCFA 3Q8RB 4DQSA 1K5OA 2JR5A 3RH4A 3AM9A 1NKBA 1S0OA 2W9CA 5J2GA 1FFVA 3JPQA 4ICAA 3GV7B 2FMQA 5KT5A 2FPKA 5J8YA 2ZIWA 2DUYA 4IQTA 2Y1JA 1Q3VA 5JU5A 1S0MA 1L7MA 2ASLA 4F3OA 1FFUA 2KJ9A 2JHDA 4DQRA 2EZZA 2G07A 3Q8QB 2AXTU 4CRXA 4DL3A 5G5HA 4M0AA 3ALRA 3MGHA 4KTQA 4G9BA 3OTQA 4IRDA 4ED3A 4C4SA 7ICQA 5AKEA 1X9SA 2K4HA 4P0QB 5L1LA 4NY8A 3IRUA 4AP9A 8ICWA 4QJFB 5J0SA 3C2MA 5JRTA 3AUOA 5AM3A 1NKCA 3M9MB 2FI1A 4QIWF 1X42A 3K4GA 3HP6A 1PK1A 5ALJA 5AK4A 5KFZA 5L1MA 8ICBA 5KFIA 4QZEA 2V4QA 1YZ7A 3L3FX 4DL5A 2RHFA 2JZBA 1XO1A 1S76D 4NJ8A 2UVRA 3B0XA 2HBKA 2HVIA 3R9KA 4GIBA 3BQ1A 3BDPA 2ES6A 2BDPA 2KFNA 4NXZA 2K4IA 3QUCA 4PGQA 4DS4A 4DFKA 4ELVA 4I2IA 4DSEA 5GTHU 5AHXA 5AKHA 5AI9A 1NI3A 4RQ7A 2KOBA 4NM2A 2DGZA 4PPXA 5KFEA 2YQEA 2LM4A 4BDPA 2EAMA 5AK3A 3LWMA 1ZXIA 3LYSA 4KLFA 1TKDA 2FMPA 3M8RA 3SAHA 4YR2A 2LBOA 5L1KA 4F92B 1L8OA 1U47A 2HBMA 3KZXA 1SKSA 5KT6A 4O9MA 3M6ZA 4NLNA 1DOQA 1CI4A 4QWEA 1L8LA 5ALIA 3BZKA 4ECWA 1N5WA 2FE9A 3HPOA 4KN7A 4NLCA 4UAVA 4QW9A 1L3VA 2A19A 1UHUA 7ICHA 3OPXA 3BQTA 3I76A 3ICXA 5KG5A 5AKYA 4QZDA 4F5RA 4O5KA 2Y1IA 3GFKB 3KOOA 5ALDA 3TFSA 4CF3A 2D6FC 7ICMA 3M9OB 4UB8U 1JXEA 2H3FA 1TV9A 2NO4A 1FEZA 2P66A 2YX8A 5KT2A 4KLDA 2ZJ8A 4JK1A 5DG8A 3CRXA 1K1SA 2JRZA 5AM2A 1JALA 2AJQA 5ALPA 2XY5A 1TK8A 3QZ7A 7ICUA 4YQWA 2J6TA 5AK6A 4DO9A 4GXJA 3QEBZ 1ZQAA 1N2XA 1DGSA 4NL9C 2WF7A 5J29A 1F5SA 3KD3A 5ALUA 2ATLA 2BZFA 1S77D 2B0CA 4NLGA 3F2CA 2KEYA 3V7KA 5JTIA 3PW7A 1BPXA 2M9NA 2QARB 4ECTA 9ICIA 9ICBA 3S6JA 5J2IA 2YN4A 3OJSA 3NRWA 5L1JA 1NZBA 3C5GA 4QWCA 5ALSA 4F5PA 3QEAZ 4DOBA 4K4IA 1KFSA 3MR3A 3H8WA 5CR0A 1ZQYA 4YXMA 3T3FA 4RT2A 2KNJA 3SR6A 4DL6A 2F8KA 4KLTA 1SIJA 3H4DA 4R8UA 3RRHA 1JRPA 1ZQJA 1U4BA 5CJ7A 3RAQA 1SV0A 2A1JB 2XY6A 1D8YA 2R8GA 1Z4OA 2ALZA 4M9HA 4F5OA 4XRHA 5IIMA 1BPZA 2PFPA 2VKQA 2XCPA 2HBLA 2ZJ5A 1T7PA 5J0WA 4QZCA 3VCBA 5DKWA 4YVZA 4GXKA 3UMCA 2XC9A 1LB2B 4FS2A 4UAUA 3SEIA 3V72A 3M1YA 4E0DA 1T3QA 2HOIA 3NASA 5HMMA 4UW9A 3TANA 3IG5A 3WU2U 8ICYA 5KFVA 5HP4A 1DK2A 1C7YA 4RQ2A 2PMZC 2RDIA 3GIJA 4LJXA 2ZUDA 4QZFA 5J0XA 3RBDA 3UPQA 4IR1A 4DL4A 3GV5B 2HHVA 4KX5A 5J0QA 2EQYA 2WAQC 4I29A 4DFJA 1WG8A 3CP8A 1H38A 9ICNA 4P0QA 5KFWA 1DXSA 1ZQNA 1NJYA 1JMSA 2I1QA 1X6IA 4JB3A 8ICKA 4P4PA 5AI5A 5KG7A 2F8LA 4I2JA 5DGBA 2E8OA 1X9WA 5ALFA 4AYBC 2PFQA 4KLQA 5HMLA 3WKBA 3IM1A 2AHOB 4GC6A 1JXLA 2JEGA 3JPSA 2A3VA 2KVSA 1BPYA 1ZOLA 4UARA 8ICRA 5IIKA 3HWTA 4UB1A 2G09A 3QZ8A 2H3QA 3GIKA 1ZQKA 2D8CA 2F1JA 5K4LA 3TFRA 1RM6C 2CN1A 1AROP 4F2SA 3PMLA 4TURA 2Y9TA 4PJ0U 5J0YA 3RB6A 2ESEA 5BOLA 2MA1A 1WWVA 4US8A 8ICNA 1SZPA 3IP4B 3PZPA 3C1ZA 3ETLA 4J9PA 4UQGA 4RQ5A 1Q3UA 4ECUA 2H3VA 1NOMA 2VANA 3IDWA 3WK5A 4EBDA 5J2FA 5TISU 5F3XB 2OWOA 3RJJA 4RQMA 4TQSA 4ACOA 1KFTA 3MDCA 2H5XA 8ICPA 5ALEA 2IBKA 1B22A 2YMLA 1SGGA 5C5JA 4RUCA 4UAYA 2XO7A 5ALOA 1JX4A 2G5HB 4RNOA 2K89A 2OM6A 1SWVA 4O5EA 2H3IA 3HX0A 4DQQA 5KL1B 1TFRA 3HKZC 1UT5A 4TUPA 5CA7A 1BPDA 7ICOA 3H0LB 2WFAA 3PSPA 3F2BA 3T5HA 2KHQA 5GTIU 4QNLA 3VC8A 1K1QA 2W43A 1SKWA 4C4TA 5KAFU 5D4BA 3PSTA 1RXVA 1TAMA 3N7SC 1JIHA 2W3SA 2YTUA 1ZRMA 4P4MA 1UA0A 4O3OA 2ZIUB 4C8MA 2KIVA 5A0LA 7ICKA 5G5GA 1F0MA 2KHVA 2LKYA 2XGPA 2C22A 2LM1A 5EWFA 1ZQOA 2DF4B 4Z6DA 1J2NA 1QSSA 3A0HU 9ICQA 2P6UA 1TVAA 4RUAA 5KFUA 1ZJMA 2P35A 2PKEA 2Z7JA 4ZOHC 3PW4A 5KT7A 3C28A 1FIQA 1NK4A 2PMZF 3OSNA 2UVUA 4B9NA 4USAA 1Z1VA 3UMGA 3PNCA 8ICSA 2DPJA 4QZGA 3F5EA 4UASA 3ED5A 3PW5A 2L5YA 4Y2UA 2E8MA 2KJ8A 1ZQLA 2RQ5A 1UA1A 5KFRA 5AM5A 5EE9A 5CEHA 2OH2A 3GIIA 4Y2QA 1HUOA 5ALLA 1ZQSA 1ZQEA 9ICCA 3H7IA 2F77X 3PSIA 4DFDA 9ICAA 4QZ8A 4C8LA 3TKAA 2UVVA 4Y2YA 2A1AA 4AYBF 2DL0A 2HBJA 4DLEA 2DQNB 1CRXA 9ICPA 4DLGA 4O5CA 4F72A 4XA5A 2BPGA 1B0XA 2A1JA 2KG5A 4XQ8A 9ICOA 4DL7A 3EZ5A 3M8SA 2KD1A 2KICA 2NRXA 1QH9A 1MQ2A 4K4GA 5DGAA 5C0YA 1KLNA 1KKXA 1ZQDA 4F50A 4BJQA 1U45A 2HHUA 1RDFA 5HHHA 1LV5A 1SXDA 2LPEA 2JGAA 2N1RA 4JV1A 3MGIA 1QSLA 4U6PA 3UM9A 2IA6A 4KN4A 3PVXA 4EX7A 8ICFA 3EWAA 5KFCA 3WKCA 3NRZA 4PL2A 2FLLA 3D2QA 4YFKA 2WHEA 7ICTA 4WJ3B 4PGYA 2XIDA 5ALRA 5ALXA 4I27A 5AIBA 3B9JA 3PSFA 7ICVA 2ZG6A 3IHQB 1SV4A 2ZXHA 5DLGA 2ZUBA 2AGOA 4HAIA 4Y2TA 4PZOA 4NL9A 2OEHA 4EBCA 2J6UA 4RQ8A 5AICA 5KFQA 3HKZF 1A77A 3M6KA 1ECWA 2YMQA 3N4MB 3NS1A 1U9LA 4ECVA 4QWBA 3Q8PB 3TADA 3KBBA 3C1YA 1XC9A 3ZD8A 4YCXA 3C2LA 2V4RA 4YMNA 4DSKA 4RZRA 1LKYB 4KLSA 4EYIB 4M2YA 4OJPA 3SV3A 5KT4A 1L5UA 2KV2A 1N5XA 4KX3A 4GC7A 3ZDCA 4DL2A 4YMMA 2F2AB 3PX6A 3T5JA 2W7OA 1F44A 1KQQA 4NLZA 2ZIXB 4CNQA 4UB3A 3PY8A 4F4ZA 3ZDAA 2C2DA 4IR9A 3D2NA 2VJ5A 3KZIU 1T3NA 3MGVA 4F2RA 4B9VA 1PUZA 3PO5A 5ALKA 4ECSA 2NRZA 3E0FA 2C2RA 1JN3A 2KN7A 1KBUA 2K4PA 2EAOA 4R63A 1KN5A 5E79U 5KFHA 5AI6A 5KFMA 1TK5A 2FDRA 4Q45A 4I2EA 3ISDA 5KFYA 2W9AA 9ICHA 3N28A 5DB6A 2EH9A 2CRXA 1TAUA 1UT8A 1RYRA 2JH7A 3LVVA 2BKEA 2JEFA 1ZYQA 3FDSA 1N48A 4Y2JA 3O0FA 4UB4A 2W3RA 4HYKA 5DG9A 4DF8A 4I2BA 3AEVA 4IS7A 2QB0B 2FLNA 3SAFA 3WK9A 4MFCA 4YXJA 4MEYA 3UXOA 1ZQCA 3QUQA 1VJ5A 2B21A 1FO4A 3IN5A 2RLTA 1ZD5A 2W7PA 2LI6A 1QTMA 3EPIA 2ZIVA 4CF4A 3KFUF 5KFLA 3V6KA 4YR0A 1X40A 2XCAA 3MR6A 4R66A 1N56A 2YB4A 8ICVA 3OJUA 8ICZA 4JWMA 3H8SA 2ZIUA 3JPOA 4O3RA 4B6JA 1M6YA 5ALGA 1HIWA 5EE3A 2KSOB 3C2KA 3FAHA 2ZTCA 3QE9Y 5KG1A 5DQGA 2E5SA 3GILA 4OD0A 5L1IA 1WYGA 5AKXA 3ISBA 5AKKA 5AKGA 4J9NA 4EZ6A 3I1YA 5ALWA 4IRKA 5KG0A 4JUZA 1DK3A 3G6YA 2RRDA 4KLEA 4PH5A 5AI0A 3OHBA 3HRDD 2VA2A 2JMGA 2PFNA 4I2AA 1A0PA 2J6SA 5IINA 2B6GA 1ZQPA 2BCRA 3RJEA 2I5HA 4M6WA 1HJPA 4MF2A 1S8OA 4UBCA 4ECZA 3NTUA 1ZRNA 4I2DA 2V9WA 5KFOA 2KVCA 3QX7A 3FC4A 1HEKA 2IMWP 4NLBA 2IOFK 4QW8A 3U26A 5DQHA 3N7PD 2BR0A 1ZQGA 4K4HA 2Y9UA 3SYZA 2HVHA 4Y2VA 4UB5A 3MFIA 3F2DA 1S0VA 5KFPA 4PGXA 1NKEA 1ZD3A 4BWMA 4F5QA 4NLKA 4Q43A 3N97B 3FM9A 1D9FA 5KNIA 2LMRA 4IQWA 1O03A 2YY6A 3TQ1A 2ISOA 3CNHA 4KLJA 2EANA 1SXEA 3BS5B 7ICSA 3RRGA 2JEJA 5DG7A 3D2SA 1JUDA 3PR5B 4C7YA 3M9NB 2W9CB 3BQ2A 5EE0A 4Y2RA 2ZXIA 3Q8KA 3UQ0A 4DS5A 2DPIA 4FBUA 2F1IA 1ZQIA 3K1ZA 5KG4A 1EXNA 4ELUA 1CEZA 1TE2A 2Q4TA 3SD7A 1ZQHA 3MR5A 8ICAA 1QCKA 7ICNA 5DBAA 4I2GA 2OYYA 1Z3EB 4KLIA 2BGWA 2F1HA 1Z4NA 1SL0A 1B4FA 4B9MA 2MUTB 4QZ9A 4RU9A 2KKPA 4Q8FA 1ZD2P 1XSNA 3V6JA 2HHTA 5JUMA 3Q8LA 1SL2A 3PO4A 2BQ3A 1SKRA 8ICXA 2QB1A 2DWQA 2JXJA 3AMZA 5DLFA 4B9UA 2W03A 2VA3A 3C21A 3LWLA 4XUSA 2KFZA 4DOAA 2ZJAA 3THVA 4J9MA 3EW9A 5KL8B 2IHNA 5ALZA 3ISCA 4KLGA 2UVWA 1X9MA 2G5IB 5J2EA 4Q8EA 4IL6U 1ZQFA 3ZDBA 1V85A 5AM4A 4OJLA 2JZBB 4ELTA 2NRVA 3RJIA 2ASJA 3QU7A 2PFOA 4ED8A 2NRTA 4P0PB 2E1EA 2P6RA 3QUBA 4QZHA 3WK8A 2EDUA 4U7CA 3DDHA 4CDGA 3PMNA 2WB1C 5H2FU 5CRXA 2K60A 1MSWD 1QSYA 5KFJA 3H8JA 1N60A 1S5LU 2AQ4A 3DV9A 4P2HA 4F4KA 5DB8A 4LZDA 4F71A 4ECYA 1T8EA 4MHVA 3RJKA 3K75D 4F91B 4PHDA 4IQVA 3ORYA 3QYPA 1VLBA 4F8RA 3KKAC 4Z6FA 4EBEA 2F44A 1Y88A 2OCEA 1S10A 4ECRA 4KLMA 4JV2A 1X66A 4EZ9A 3RF9A 1OW5A 3H40A 3H0MB 3MR2A 4M9NA 2BPCA 3UMBA 1MC8A 2KMDA 5DQIA 5DB9A 3SENA 2C28A 3AQEA 2EZYA 3CYMA 3GDXA 4JMUA 5IIIA 4DSIA 2QB0A 4PHAA 2R18A 5AM0A 4O3PA 4RNNA 1ZQXA 7ICEA 1QQ6A 1WCNA 4IQUA 1S97A 5KT3A 4J9KA 1SB3C 5KTQA 4GFJA 1RYSA 1RZTA 4ED0A 4C4RA 4DF4A 4RT3A 1D9DA 4EELA 1BVSA 3V6HA 5ALNA 3SV4A 1XU4A 4J03A 4B9SA 2OHFA 3ZI4A 1IIPA 2WF9A 1IG6A 9ICGA 1UCVA 3JPNA 4BX9C 2KSOA 1RQNA 5KFSA 1XSLA 2R8JA 5J0TA 2R8HA 4RQ0A 4MFAA 1NK6A 3C23A 1WUDA 5AM1A 1QLNA 3G6VA 3RB3A 3AU6A 1NJXA 1SWWA 2XY7A 1ZQVA 3RH5A 3EUB2 2W55A 2QARA 2G0AA 1NJZA 2WAQF 4X5VA 3UXNA 8ICCA 2DBYA 8ICHA 9ICLA 5KFDA 2AQ0A 1KW4A 1BNPA 2EAPA 4C8OA 1X2IA 3AN1A 4QWDA 3TAQA
chains in the Genus database with same CATH topology
1X66A 2DKXA 1OW5A 1B4FA 2F8KA 3BQ7A 1SXDA 2KMDA 2FE9A 2KE7A 2LPEA 3SENA 2KIVA 2D8CA 1SV0A 1F0MA 2K4PA 2EAOA 2B6GA 5JRTA 3K1RB 1X9XA 2QB1A 2QB0A 2F3NA 2Y9TA 2E8PA 2ESEA 2DKZA 4RQNA 1WWVA 1PK1A 2QKQA 1SV0C 5L1MA 1COKA 2E8NA 3IDWA 1Z1VA 1SV4A 3SEIA 2Y9UA 5F3XB 1V85A 4IS7A 4RQMA 2QB0B 4PZOA 4NL9A 2L5YA 4NJ8A 1UCVA 2E8MA 1UQVA 3TACB 1PK3A 5KNIA 2LMRA 1PK1B 2KSOA 1V38A 2ES6A 3TADC 1OXJA 1SGGA 3H8MA 3BS5A 2EANA 1SXEA 4NL9C 3BS5B 1X40A 3TADA 1WWUA 2K60A 1JI7A 2D3DA 3KKAA 3BS7A 5JTIA 2DL0A 5J8YA 1LKYA 2JV3A 2QARA 1DXSA 1RG6A 1LKYB 2QARB 2EAMA 1B0XA 5JU5A 4MHVA 2KSOB 4PZNA 2KG5A 2GLEA 1KW4A 3KKAC 2E8OA 2F44A 2EAPA 5J8YC 3HILA 2YTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X66 A;  2DKX A;  1OW5 A;  1B4F A;  2F8K A;  3BQ7 A;  1SXD A;  2KMD A;  2FE9 A;  2KE7 A;  2LPE A;  3SEN A;  2KIV A;  2D8C A;  1SV0 A;  1F0M A;  2K4P A;  2EAO A;  2B6G A;  5JRT A;  3K1R B;  1X9X A;  2QB1 A;  2QB0 A;  2F3N A;  2Y9T A;  2E8P A;  2ESE A;  2DKZ A;  4RQN A;  1WWV A;  1PK1 A;  2QKQ A;  1SV0 C;  5L1M A;  1COK A;  2E8N A;  3IDW A;  1Z1V A;  1SV4 A;  3SEI A;  2Y9U A;  5F3X B;  1V85 A;  4IS7 A;  4RQM A;  2QB0 B;  4PZO A;  4NL9 A;  2L5Y A;  4NJ8 A;  1UCV A;  2E8M A;  1UQV A;  3TAC B;  1PK3 A;  5KNI A;  2LMR A;  1PK1 B;  2KSO A;  1V38 A;  2ES6 A;  3TAD C;  1OXJ A;  1SGG A;  3H8M A;  3BS5 A;  2EAN A;  1SXE A;  4NL9 C;  3BS5 B;  1X40 A;  3TAD A;  1WWU A;  2K60 A;  1JI7 A;  2D3D A;  3KKA A;  3BS7 A;  5JTI A;  2DL0 A;  5J8Y A;  1LKY A;  2JV3 A;  2QAR A;  1DXS A;  1RG6 A;  1LKY B;  2QAR B;  2EAM A;  1B0X A;  5JU5 A;  4MHV A;  2KSO B;  4PZN A;  2KG5 A;  2GLE A;  1KW4 A;  3KKA C;  2E8O A;  2F44 A;  2EAP A;  5J8Y C;  3HIL A;  2YTU A; 
#chains in the Genus database with same CATH topology
 2K8B B;  2KK0 A;  3MAB A;  3AL0 B;  1SL1 A;  5KFT A;  3H4B A;  1RXW A;  1L7P A;  3NGD A;  1NK5 A;  5TZV A;  2KTQ A;  2HSZ A;  1L7N A;  3E58 A;  9ICT A;  3KHH A;  3H0R B;  1Z00 B;  3RAX A;  4UB6 U;  1KTQ A;  3LK9 A;  4KMU A;  3E2E A;  2FLP A;  5AIA A;  1X9X A;  5J2D A;  2F3N A;  2KKV A;  1PVQ A;  4TQR A;  5ALQ A;  5DDY A;  3SZ2 A;  4YN4 A;  2LYB A;  4JWN A;  5AK5 A;  2GWS A;  4M9L A;  3A0B U;  2W8L A;  5KG6 A;  2OXO A;  5CB1 A;  7ICI A;  3NVW A;  3T5L A;  1YT3 A;  1N63 A;  4O3N A;  2CPR A;  2FPM A;  3RR7 A;  4YMO A;  1RPL A;  3I28 A;  1NZP A;  3EPG A;  4A8E A;  2ISP A;  5KFB A;  2HDO A;  4PHE A;  3IG8 A;  3NUQ A;  5ALH A;  2WB1 F;  4GXI A;  2FMS A;  1DGJ A;  1PK3 A;  2LHT A;  4EX6 A;  3RH6 A;  3LVW A;  3TAP A;  8ICE A;  1KSP A;  1OXJ A;  2GH1 A;  8ICO A;  4C8N A;  4I28 A;  1J2M A;  3Q8S B;  5J2K A;  3ZDD A;  4KLH A;  7ICR A;  4MEX A;  4DEZ A;  2MUT A;  5DBC A;  4NWI A;  5KFN A;  1NK9 A;  3WK6 A;  2VIX A;  5IIL A;  5DBB A;  1ZD4 A;  2ZTD A;  3EYZ A;  4PZN A;  9ICF A;  4ED6 A;  2PI5 A;  4RQ3 A;  4Z6C A;  3WK4 A;  2I6X A;  1J97 A;  4RQ4 A;  2HHW A;  3HIL A;  3KHL A;  5BOM A;  9ICR A;  3QU9 A;  4MFF A;  1MA7 A;  2LYA A;  2XVT A;  2QLT A;  1IXR A;  2NYV A;  5ALT A;  3BQ7 A;  1QQ7 A;  2IOH A;  2MSN A;  1BPB A;  2AU0 A;  5IIO A;  1D8B A;  3QU4 A;  3PV8 A;  4DSL A;  4NV0 A;  2HMX A;  2IOF A;  5AI4 A;  1A6S A;  3SMV A;  4OJO A;  2G08 A;  1SZH A;  8ICG A;  4P0P A;  4G3I A;  4JV0 A;  3RFA A;  5EE1 A;  1NK7 A;  2XI9 A;  4KIT B;  4P4O A;  1XNS A;  2AH5 A;  1P7D A;  1L6N A;  4DSF A;  2W8K A;  5AKJ A;  2BHN A;  1XSP A;  2BCV A;  4YP3 A;  5IIJ A;  3RBE A;  2RP5 A;  1U49 A;  1AQ6 A;  2K8C B;  4DSJ A;  2DFL A;  3OSP A;  4FZL A;  4PL1 A;  4Q44 A;  5L9X A;  4R64 A;  8ICT A;  4OCZ A;  9ICU A;  1ZQB A;  2R8I A;  2RDJ A;  2BQU A;  4J9O A;  4B9L A;  5ALY A;  1L7O A;  4ECX A;  4GLX A;  1WWU A;  1Z19 A;  4EEN A;  1Z1B A;  3BS7 A;  4DQI A;  4UB2 A;  4ED7 A;  5KFK A;  2JV3 A;  3NVY A;  1RG6 A;  4BGD A;  4RPX A;  5B66 U;  4DFP A;  3OHA A;  4UAZ A;  4OO1 J;  5KFX A;  3JPT A;  5D46 A;  4O3M A;  2VJ4 A;  5J8Y C;  4KMO B;  2DKX A;  2R8K A;  5J2C A;  3LDA A;  3QU5 A;  4YR3 A;  1BPE A;  4B9T A;  5AKI A;  8ICI A;  4FFD A;  3MBY A;  2ASD A;  2HOQ A;  5KFF A;  9ICW A;  3GV8 B;  3N7R C;  1MQ3 A;  3RB0 A;  1PVP A;  1KFD A;  3B0Y A;  3L5K A;  4FS1 A;  2K4E A;  3K1R B;  8ICM A;  3ETR A;  1TK0 A;  3QU2 A;  3BZC A;  5J2H A;  2NO5 A;  2BCQ A;  2E8P A;  3IV6 A;  5J0P A;  4I2F A;  2QKQ A;  4EEY A;  1L3S A;  3KHG A;  2KZM A;  2WF5 A;  3G6X A;  1COK A;  2HHQ A;  2Y0S C;  5HR7 A;  1IM4 A;  5FP0 A;  4CCH A;  2W9B B;  7ICF A;  2Q0Z X;  4QZA A;  4Z6E A;  4UAW A;  5AI8 A;  4M04 A;  1BGX T;  5DDM A;  4DCC A;  1ZQT A;  1URJ A;  2JEI A;  2G06 A;  3KHR A;  3TI0 A;  4O0I A;  3TAC B;  3HT3 A;  4FZM A;  5ALM A;  3QNM A;  3F5A A;  5AKL A;  4DQP A;  9ICE A;  3TAD C;  4O3S A;  2BCU A;  1ZQW A;  4UBB A;  5EWG A;  4LVS A;  4TUS A;  2LYH A;  3PX0 A;  1JI7 A;  1ZET A;  4CGZ A;  3KKA A;  1RQL A;  3SI8 A;  3QUT A;  4CF5 A;  5J0O A;  2MAX A;  3HJE A;  3SAG A;  4O3Q A;  2WF6 A;  2YB1 A;  1QQ5 A;  1Z00 A;  2GO7 A;  2AGP A;  4BXO B;  5J0U A;  4KLO A;  1S9F A;  2WF8 A;  2EZX A;  5CWR A;  4Y2X A;  2KP7 A;  5KFA A;  1UPH A;  5KG2 A;  1S0N A;  9ICM A;  2W9M A;  4F4W A;  4F93 B;  3F53 A;  1CUK A;  1D8L A;  5T14 A;  3GQC A;  3PW2 A;  2BQR A;  5KFG A;  2O6K A;  1MN8 A;  2ZIW B;  3UXP A;  7ICJ A;  1LVH A;  3DEE A;  1ED1 A;  2BPF A;  2E1F A;  4YD1 A;  1ZQQ A;  1A76 A;  1L3T A;  1IV8 A;  2M0N A;  3T79 A;  3RR8 A;  2DKZ A;  3RJG A;  1WCL A;  2ODG A;  9ICK A;  9ICS A;  1KRP A;  4EEK A;  3KTQ A;  2HOF A;  4FO6 A;  2E8N A;  3FYH A;  3JPR A;  4J9Q A;  4QWA A;  8ICL A;  4F4X A;  3V7J A;  4RQ6 A;  8ICU A;  5HHI A;  2W04 A;  4C8K A;  1PK1 B;  2PI4 A;  1PVR A;  4I2H A;  9ICV A;  1V38 A;  5CP2 A;  1X6J A;  5KAI U;  3V7L A;  3M7D A;  3PW0 A;  2BCS A;  4TUQ A;  3AQF A;  1COO A;  1XO0 A;  4LZG A;  1B43 A;  4BUG A;  4M47 A;  1VDV A;  2CXY A;  2KZZ A;  4ZH4 A;  1LKY A;  1TAQ A;  4J9R A;  2W54 A;  3UQ2 A;  3BQ0 A;  3GZF A;  4RNM A;  2YMP A;  1YZ6 A;  2FJ6 A;  2BDU A;  2ZIX A;  5D49 A;  4US9 A;  5B5E U;  5J2A A;  3GU3 A;  3D6J A;  1DRG A;  3AU2 A;  2NV3 A;  2ZTE A;  3WKD A;  3HW8 A;  4MF8 A;  2K8A A;  7ICG A;  4QZB A;  3PX4 A;  2E3T A;  3ONN A;  4J9S A;  4DFM A;  1BNO A;  5BPC A;  3PR4 A;  2Y0S F;  3MFH A;  5J2B A;  2ZUC A;  2VA8 A;  4RQN A;  2PXI A;  4J9L A;  3L4P A;  3OGU A;  1T4G A;  4DOC A;  1L3U A;  3RJF A;  9ICX A;  1SV0 C;  4C7Z A;  1XS9 D;  2JH1 A;  4Y2P A;  1N61 A;  2H3Z A;  4IRC A;  1ZJN A;  4QIW C;  2YMM A;  1ZQ1 C;  4PHP A;  1KL9 A;  2HW3 A;  3TAR A;  8ICQ A;  1PZN A;  5DB7 A;  1ZQU A;  3RJH A;  3CW2 C;  1UQV A;  4FBT A;  3GIM A;  1U48 A;  2W11 A;  1N62 A;  4KLU A;  5CHG A;  2MRL A;  1KEJ A;  1JRO A;  7ICL A;  2C2E A;  1HUZ A;  3H8M A;  3ZDE A;  2ZIV B;  3T5K A;  4KLL A;  2WTF A;  4I2C A;  5AKZ A;  4C0Z A;  5KG3 A;  4RQ1 A;  3Q8M A;  1Q8K A;  2D3D A;  4NM1 A;  1ZQM A;  2FPL A;  4OJ6 A;  4F4Y A;  5HNK A;  5EOZ A;  1ZQZ A;  2GOL A;  2XIC A;  1T94 A;  1OUQ A;  4BWJ A;  3RB4 A;  4ECQ A;  4EYH B;  2HHX A;  4RPY A;  2GLE A;  4UAT A;  9ICJ A;  4C80 A;  4M9G A;  2HI0 A;  1NK0 A;  1C20 A;  3SQI A;  5EWE A;  8ICJ A;  3ZD9 A;  4CE6 A;  5J0R A;  1NJW A;  4ED2 A;  3MC1 A;  4DWI A;  2F76 X;  3MDA A;  1NNL A;  2KE7 A;  4YG2 A;  4R65 A;  2W9B A;  4M9J A;  3C5F A;  2KJ5 A;  3C29 A;  1V9P A;  4OJ5 A;  3J81 j;  7ICP A;  5HR6 A;  1KDH A;  1XWL A;  3WK7 A;  2MU2 A;  4M6W B;  3BJY A;  2AGQ A;  5F9N A;  2KIW A;  3JPP A;  2I9G A;  1O08 A;  5F9L A;  2NRW A;  4YD2 A;  1RYU A;  4R8U B;  3WKA A;  3WKE A;  2XGQ A;  3RTV A;  3NVZ A;  1GO3 F;  4IC9 A;  1ZQR A;  5ALV A;  1V97 A;  2IHM A;  4ED1 A;  2KZ3 A;  4FZN A;  1NK8 A;  4BXO A;  3QXG A;  5J2J A;  4Y2S A;  1Q46 A;  2HHS A;  4FE3 A;  3NVV A;  4RPZ A;  4F5N A;  3BS5 A;  4QZI A;  2HCF A;  3Q8R B;  4DQS A;  1K5O A;  2JR5 A;  3RH4 A;  3AM9 A;  1NKB A;  1S0O A;  2W9C A;  5J2G A;  1FFV A;  3JPQ A;  4ICA A;  3GV7 B;  2FMQ A;  5KT5 A;  2FPK A;  5J8Y A;  2ZIW A;  2DUY A;  4IQT A;  2Y1J A;  1Q3V A;  5JU5 A;  1S0M A;  1L7M A;  2ASL A;  4F3O A;  1FFU A;  2KJ9 A;  2JHD A;  4DQR A;  2EZZ A;  2G07 A;  3Q8Q B;  2AXT U;  4CRX A;  4DL3 A;  5G5H A;  4M0A A;  3ALR A;  3MGH A;  4KTQ A;  4G9B A;  3OTQ A;  4IRD A;  4ED3 A;  4C4S A;  7ICQ A;  5AKE A;  1X9S A;  2K4H A;  4P0Q B;  5L1L A;  4NY8 A;  3IRU A;  4AP9 A;  8ICW A;  4QJF B;  5J0S A;  3C2M A;  5JRT A;  3AUO A;  5AM3 A;  1NKC A;  3M9M B;  2FI1 A;  4QIW F;  1X42 A;  3K4G A;  3HP6 A;  1PK1 A;  5ALJ A;  5AK4 A;  5KFZ A;  5L1M A;  8ICB A;  5KFI A;  4QZE A;  2V4Q A;  1YZ7 A;  3L3F X;  4DL5 A;  2RHF A;  2JZB A;  1XO1 A;  1S76 D;  4NJ8 A;  2UVR A;  3B0X A;  2HBK A;  2HVI A;  3R9K A;  4GIB A;  3BQ1 A;  3BDP A;  2ES6 A;  2BDP A;  2KFN A;  4NXZ A;  2K4I A;  3QUC A;  4PGQ A;  4DS4 A;  4DFK A;  4ELV A;  4I2I A;  4DSE A;  5GTH U;  5AHX A;  5AKH A;  5AI9 A;  1NI3 A;  4RQ7 A;  2KOB A;  4NM2 A;  2DGZ A;  4PPX A;  5KFE A;  2YQE A;  2LM4 A;  4BDP A;  2EAM A;  5AK3 A;  3LWM A;  1ZXI A;  3LYS A;  4KLF A;  1TKD A;  2FMP A;  3M8R A;  3SAH A;  4YR2 A;  2LBO A;  5L1K A;  4F92 B;  1L8O A;  1U47 A;  2HBM A;  3KZX A;  1SKS A;  5KT6 A;  4O9M A;  3M6Z A;  4NLN A;  1DOQ A;  1CI4 A;  4QWE A;  1L8L A;  5ALI A;  3BZK A;  4ECW A;  1N5W A;  2FE9 A;  3HPO A;  4KN7 A;  4NLC A;  4UAV A;  4QW9 A;  1L3V A;  2A19 A;  1UHU A;  7ICH A;  3OPX A;  3BQT A;  3I76 A;  3ICX A;  5KG5 A;  5AKY A;  4QZD A;  4F5R A;  4O5K A;  2Y1I A;  3GFK B;  3KOO A;  5ALD A;  3TFS A;  4CF3 A;  2D6F C;  7ICM A;  3M9O B;  4UB8 U;  1JXE A;  2H3F A;  1TV9 A;  2NO4 A;  1FEZ A;  2P66 A;  2YX8 A;  5KT2 A;  4KLD A;  2ZJ8 A;  4JK1 A;  5DG8 A;  3CRX A;  1K1S A;  2JRZ A;  5AM2 A;  1JAL A;  2AJQ A;  5ALP A;  2XY5 A;  1TK8 A;  3QZ7 A;  7ICU A;  4YQW A;  2J6T A;  5AK6 A;  4DO9 A;  4GXJ A;  3QEB Z;  1ZQA A;  1N2X A;  1DGS A;  4NL9 C;  2WF7 A;  5J29 A;  1F5S A;  3KD3 A;  5ALU A;  2ATL A;  2BZF A;  1S77 D;  2B0C A;  4NLG A;  3F2C A;  2KEY A;  3V7K A;  5JTI A;  3PW7 A;  1BPX A;  2M9N A;  2QAR B;  4ECT A;  9ICI A;  9ICB A;  3S6J A;  5J2I A;  2YN4 A;  3OJS A;  3NRW A;  5L1J A;  1NZB A;  3C5G A;  4QWC A;  5ALS A;  4F5P A;  3QEA Z;  4DOB A;  4K4I A;  1KFS A;  3MR3 A;  3H8W A;  5CR0 A;  1ZQY A;  4YXM A;  3T3F A;  4RT2 A;  2KNJ A;  3SR6 A;  4DL6 A;  2F8K A;  4KLT A;  1SIJ A;  3H4D A;  4R8U A;  3RRH A;  1JRP A;  1ZQJ A;  1U4B A;  5CJ7 A;  3RAQ A;  1SV0 A;  2A1J B;  2XY6 A;  1D8Y A;  2R8G A;  1Z4O A;  2ALZ A;  4M9H A;  4F5O A;  4XRH A;  5IIM A;  1BPZ A;  2PFP A;  2VKQ A;  2XCP A;  2HBL A;  2ZJ5 A;  1T7P A;  5J0W A;  4QZC A;  3VCB A;  5DKW A;  4YVZ A;  4GXK A;  3UMC A;  2XC9 A;  1LB2 B;  4FS2 A;  4UAU A;  3SEI A;  3V72 A;  3M1Y A;  4E0D A;  1T3Q A;  2HOI A;  3NAS A;  5HMM A;  4UW9 A;  3TAN A;  3IG5 A;  3WU2 U;  8ICY A;  5KFV A;  5HP4 A;  1DK2 A;  1C7Y A;  4RQ2 A;  2PMZ C;  2RDI A;  3GIJ A;  4LJX A;  2ZUD A;  4QZF A;  5J0X A;  3RBD A;  3UPQ A;  4IR1 A;  4DL4 A;  3GV5 B;  2HHV A;  4KX5 A;  5J0Q A;  2EQY A;  2WAQ C;  4I29 A;  4DFJ A;  1WG8 A;  3CP8 A;  1H38 A;  9ICN A;  4P0Q A;  5KFW A;  1DXS A;  1ZQN A;  1NJY A;  1JMS A;  2I1Q A;  1X6I A;  4JB3 A;  8ICK A;  4P4P A;  5AI5 A;  5KG7 A;  2F8L A;  4I2J A;  5DGB A;  2E8O A;  1X9W A;  5ALF A;  4AYB C;  2PFQ A;  4KLQ A;  5HML A;  3WKB A;  3IM1 A;  2AHO B;  4GC6 A;  1JXL A;  2JEG A;  3JPS A;  2A3V A;  2KVS A;  1BPY A;  1ZOL A;  4UAR A;  8ICR A;  5IIK A;  3HWT A;  4UB1 A;  2G09 A;  3QZ8 A;  2H3Q A;  3GIK A;  1ZQK A;  2D8C A;  2F1J A;  5K4L A;  3TFR A;  1RM6 C;  2CN1 A;  1ARO P;  4F2S A;  3PML A;  4TUR A;  2Y9T A;  4PJ0 U;  5J0Y A;  3RB6 A;  2ESE A;  5BOL A;  2MA1 A;  1WWV A;  4US8 A;  8ICN A;  1SZP A;  3IP4 B;  3PZP A;  3C1Z A;  3ETL A;  4J9P A;  4UQG A;  4RQ5 A;  1Q3U A;  4ECU A;  2H3V A;  1NOM A;  2VAN A;  3IDW A;  3WK5 A;  4EBD A;  5J2F A;  5TIS U;  5F3X B;  2OWO A;  3RJJ A;  4RQM A;  4TQS A;  4ACO A;  1KFT A;  3MDC A;  2H5X A;  8ICP A;  5ALE A;  2IBK A;  1B22 A;  2YML A;  1SGG A;  5C5J A;  4RUC A;  4UAY A;  2XO7 A;  5ALO A;  1JX4 A;  2G5H B;  4RNO A;  2K89 A;  2OM6 A;  1SWV A;  4O5E A;  2H3I A;  3HX0 A;  4DQQ A;  5KL1 B;  1TFR A;  3HKZ C;  1UT5 A;  4TUP A;  5CA7 A;  1BPD A;  7ICO A;  3H0L B;  2WFA A;  3PSP A;  3F2B A;  3T5H A;  2KHQ A;  5GTI U;  4QNL A;  3VC8 A;  1K1Q A;  2W43 A;  1SKW A;  4C4T A;  5KAF U;  5D4B A;  3PST A;  1RXV A;  1TAM A;  3N7S C;  1JIH A;  2W3S A;  2YTU A;  1ZRM A;  4P4M A;  1UA0 A;  4O3O A;  2ZIU B;  4C8M A;  2KIV A;  5A0L A;  7ICK A;  5G5G A;  1F0M A;  2KHV A;  2LKY A;  2XGP A;  2C22 A;  2LM1 A;  5EWF A;  1ZQO A;  2DF4 B;  4Z6D A;  1J2N A;  1QSS A;  3A0H U;  9ICQ A;  2P6U A;  1TVA A;  4RUA A;  5KFU A;  1ZJM A;  2P35 A;  2PKE A;  2Z7J A;  4ZOH C;  3PW4 A;  5KT7 A;  3C28 A;  1FIQ A;  1NK4 A;  2PMZ F;  3OSN A;  2UVU A;  4B9N A;  4USA A;  1Z1V A;  3UMG A;  3PNC A;  8ICS A;  2DPJ A;  4QZG A;  3F5E A;  4UAS A;  3ED5 A;  3PW5 A;  2L5Y A;  4Y2U A;  2E8M A;  2KJ8 A;  1ZQL A;  2RQ5 A;  1UA1 A;  5KFR A;  5AM5 A;  5EE9 A;  5CEH A;  2OH2 A;  3GII A;  4Y2Q A;  1HUO A;  5ALL A;  1ZQS A;  1ZQE A;  9ICC A;  3H7I A;  2F77 X;  3PSI A;  4DFD A;  9ICA A;  4QZ8 A;  4C8L A;  3TKA A;  2UVV A;  4Y2Y A;  2A1A A;  4AYB F;  2DL0 A;  2HBJ A;  4DLE A;  2DQN B;  1CRX A;  9ICP A;  4DLG A;  4O5C A;  4F72 A;  4XA5 A;  2BPG A;  1B0X A;  2A1J A;  2KG5 A;  4XQ8 A;  9ICO A;  4DL7 A;  3EZ5 A;  3M8S A;  2KD1 A;  2KIC A;  2NRX A;  1QH9 A;  1MQ2 A;  4K4G A;  5DGA A;  5C0Y A;  1KLN A;  1KKX A;  1ZQD A;  4F50 A;  4BJQ A;  1U45 A;  2HHU A;  1RDF A;  5HHH A;  1LV5 A;  1SXD A;  2LPE A;  2JGA A;  2N1R A;  4JV1 A;  3MGI A;  1QSL A;  4U6P A;  3UM9 A;  2IA6 A;  4KN4 A;  3PVX A;  4EX7 A;  8ICF A;  3EWA A;  5KFC A;  3WKC A;  3NRZ A;  4PL2 A;  2FLL A;  3D2Q A;  4YFK A;  2WHE A;  7ICT A;  4WJ3 B;  4PGY A;  2XID A;  5ALR A;  5ALX A;  4I27 A;  5AIB A;  3B9J A;  3PSF A;  7ICV A;  2ZG6 A;  3IHQ B;  1SV4 A;  2ZXH A;  5DLG A;  2ZUB A;  2AGO A;  4HAI A;  4Y2T A;  4PZO A;  4NL9 A;  2OEH A;  4EBC A;  2J6U A;  4RQ8 A;  5AIC A;  5KFQ A;  3HKZ F;  1A77 A;  3M6K A;  1ECW A;  2YMQ A;  3N4M B;  3NS1 A;  1U9L A;  4ECV A;  4QWB A;  3Q8P B;  3TAD A;  3KBB A;  3C1Y A;  1XC9 A;  3ZD8 A;  4YCX A;  3C2L A;  2V4R A;  4YMN A;  4DSK A;  4RZR A;  1LKY B;  4KLS A;  4EYI B;  4M2Y A;  4OJP A;  3SV3 A;  5KT4 A;  1L5U A;  2KV2 A;  1N5X A;  4KX3 A;  4GC7 A;  3ZDC A;  4DL2 A;  4YMM A;  2F2A B;  3PX6 A;  3T5J A;  2W7O A;  1F44 A;  1KQQ A;  4NLZ A;  2ZIX B;  4CNQ A;  4UB3 A;  3PY8 A;  4F4Z A;  3ZDA A;  2C2D A;  4IR9 A;  3D2N A;  2VJ5 A;  3KZI U;  1T3N A;  3MGV A;  4F2R A;  4B9V A;  1PUZ A;  3PO5 A;  5ALK A;  4ECS A;  2NRZ A;  3E0F A;  2C2R A;  1JN3 A;  2KN7 A;  1KBU A;  2K4P A;  2EAO A;  4R63 A;  1KN5 A;  5E79 U;  5KFH A;  5AI6 A;  5KFM A;  1TK5 A;  2FDR A;  4Q45 A;  4I2E A;  3ISD A;  5KFY A;  2W9A A;  9ICH A;  3N28 A;  5DB6 A;  2EH9 A;  2CRX A;  1TAU A;  1UT8 A;  1RYR A;  2JH7 A;  3LVV A;  2BKE A;  2JEF A;  1ZYQ A;  3FDS A;  1N48 A;  4Y2J A;  3O0F A;  4UB4 A;  2W3R A;  4HYK A;  5DG9 A;  4DF8 A;  4I2B A;  3AEV A;  4IS7 A;  2QB0 B;  2FLN A;  3SAF A;  3WK9 A;  4MFC A;  4YXJ A;  4MEY A;  3UXO A;  1ZQC A;  3QUQ A;  1VJ5 A;  2B21 A;  1FO4 A;  3IN5 A;  2RLT A;  1ZD5 A;  2W7P A;  2LI6 A;  1QTM A;  3EPI A;  2ZIV A;  4CF4 A;  3KFU F;  5KFL A;  3V6K A;  4YR0 A;  1X40 A;  2XCA A;  3MR6 A;  4R66 A;  1N56 A;  2YB4 A;  8ICV A;  3OJU A;  8ICZ A;  4JWM A;  3H8S A;  2ZIU A;  3JPO A;  4O3R A;  4B6J A;  1M6Y A;  5ALG A;  1HIW A;  5EE3 A;  2KSO B;  3C2K A;  3FAH A;  2ZTC A;  3QE9 Y;  5KG1 A;  5DQG A;  2E5S A;  3GIL A;  4OD0 A;  5L1I A;  1WYG A;  5AKX A;  3ISB A;  5AKK A;  5AKG A;  4J9N A;  4EZ6 A;  3I1Y A;  5ALW A;  4IRK A;  5KG0 A;  4JUZ A;  1DK3 A;  3G6Y A;  2RRD A;  4KLE A;  4PH5 A;  5AI0 A;  3OHB A;  3HRD D;  2VA2 A;  2JMG A;  2PFN A;  4I2A A;  1A0P A;  2J6S A;  5IIN A;  2B6G A;  1ZQP A;  2BCR A;  3RJE A;  2I5H A;  4M6W A;  1HJP A;  4MF2 A;  1S8O A;  4UBC A;  4ECZ A;  3NTU A;  1ZRN A;  4I2D A;  2V9W A;  5KFO A;  2KVC A;  3QX7 A;  3FC4 A;  1HEK A;  2IMW P;  4NLB A;  2IOF K;  4QW8 A;  3U26 A;  5DQH A;  3N7P D;  2BR0 A;  1ZQG A;  4K4H A;  2Y9U A;  3SYZ A;  2HVH A;  4Y2V A;  4UB5 A;  3MFI A;  3F2D A;  1S0V A;  5KFP A;  4PGX A;  1NKE A;  1ZD3 A;  4BWM A;  4F5Q A;  4NLK A;  4Q43 A;  3N97 B;  3FM9 A;  1D9F A;  5KNI A;  2LMR A;  4IQW A;  1O03 A;  2YY6 A;  3TQ1 A;  2ISO A;  3CNH A;  4KLJ A;  2EAN A;  1SXE A;  3BS5 B;  7ICS A;  3RRG A;  2JEJ A;  5DG7 A;  3D2S A;  1JUD A;  3PR5 B;  4C7Y A;  3M9N B;  2W9C B;  3BQ2 A;  5EE0 A;  4Y2R A;  2ZXI A;  3Q8K A;  3UQ0 A;  4DS5 A;  2DPI A;  4FBU A;  2F1I A;  1ZQI A;  3K1Z A;  5KG4 A;  1EXN A;  4ELU A;  1CEZ A;  1TE2 A;  2Q4T A;  3SD7 A;  1ZQH A;  3MR5 A;  8ICA A;  1QCK A;  7ICN A;  5DBA A;  4I2G A;  2OYY A;  1Z3E B;  4KLI A;  2BGW A;  2F1H A;  1Z4N A;  1SL0 A;  1B4F A;  4B9M A;  2MUT B;  4QZ9 A;  4RU9 A;  2KKP A;  4Q8F A;  1ZD2 P;  1XSN A;  3V6J A;  2HHT A;  5JUM A;  3Q8L A;  1SL2 A;  3PO4 A;  2BQ3 A;  1SKR A;  8ICX A;  2QB1 A;  2DWQ A;  2JXJ A;  3AMZ A;  5DLF A;  4B9U A;  2W03 A;  2VA3 A;  3C21 A;  3LWL A;  4XUS A;  2KFZ A;  4DOA A;  2ZJA A;  3THV A;  4J9M A;  3EW9 A;  5KL8 B;  2IHN A;  5ALZ A;  3ISC A;  4KLG A;  2UVW A;  1X9M A;  2G5I B;  5J2E A;  4Q8E A;  4IL6 U;  1ZQF A;  3ZDB A;  1V85 A;  5AM4 A;  4OJL A;  2JZB B;  4ELT A;  2NRV A;  3RJI A;  2ASJ A;  3QU7 A;  2PFO A;  4ED8 A;  2NRT A;  4P0P B;  2E1E A;  2P6R A;  3QUB A;  4QZH A;  3WK8 A;  2EDU A;  4U7C A;  3DDH A;  4CDG A;  3PMN A;  2WB1 C;  5H2F U;  5CRX A;  2K60 A;  1MSW D;  1QSY A;  5KFJ A;  3H8J A;  1N60 A;  1S5L U;  2AQ4 A;  3DV9 A;  4P2H A;  4F4K A;  5DB8 A;  4LZD A;  4F71 A;  4ECY A;  1T8E A;  4MHV A;  3RJK A;  3K75 D;  4F91 B;  4PHD A;  4IQV A;  3ORY A;  3QYP A;  1VLB A;  4F8R A;  3KKA C;  4Z6F A;  4EBE A;  2F44 A;  1Y88 A;  2OCE A;  1S10 A;  4ECR A;  4KLM A;  4JV2 A;  1X66 A;  4EZ9 A;  3RF9 A;  1OW5 A;  3H40 A;  3H0M B;  3MR2 A;  4M9N A;  2BPC A;  3UMB A;  1MC8 A;  2KMD A;  5DQI A;  5DB9 A;  3SEN A;  2C28 A;  3AQE A;  2EZY A;  3CYM A;  3GDX A;  4JMU A;  5III A;  4DSI A;  2QB0 A;  4PHA A;  2R18 A;  5AM0 A;  4O3P A;  4RNN A;  1ZQX A;  7ICE A;  1QQ6 A;  1WCN A;  4IQU A;  1S97 A;  5KT3 A;  4J9K A;  1SB3 C;  5KTQ A;  4GFJ A;  1RYS A;  1RZT A;  4ED0 A;  4C4R A;  4DF4 A;  4RT3 A;  1D9D A;  4EEL A;  1BVS A;  3V6H A;  5ALN A;  3SV4 A;  1XU4 A;  4J03 A;  4B9S A;  2OHF A;  3ZI4 A;  1IIP A;  2WF9 A;  1IG6 A;  9ICG A;  1UCV A;  3JPN A;  4BX9 C;  2KSO A;  1RQN A;  5KFS A;  1XSL A;  2R8J A;  5J0T A;  2R8H A;  4RQ0 A;  4MFA A;  1NK6 A;  3C23 A;  1WUD A;  5AM1 A;  1QLN A;  3G6V A;  3RB3 A;  3AU6 A;  1NJX A;  1SWW A;  2XY7 A;  1ZQV A;  3RH5 A;  3EUB 2;  2W55 A;  2QAR A;  2G0A A;  1NJZ A;  2WAQ F;  4X5V A;  3UXN A;  8ICC A;  2DBY A;  8ICH A;  9ICL A;  5KFD A;  2AQ0 A;  1KW4 A;  1BNP A;  2EAP A;  4C8O A;  1X2I A;  3AN1 A;  4QWD A;  3TAQ A; 
#chains in the Genus database with same CATH homology
 1X66 A;  2DKX A;  1OW5 A;  1B4F A;  2F8K A;  3BQ7 A;  1SXD A;  2KMD A;  2FE9 A;  2KE7 A;  2LPE A;  3SEN A;  2KIV A;  2D8C A;  1SV0 A;  1F0M A;  2K4P A;  2EAO A;  2B6G A;  5JRT A;  3K1R B;  1X9X A;  2QB1 A;  2QB0 A;  2F3N A;  2Y9T A;  2E8P A;  2ESE A;  2DKZ A;  4RQN A;  1WWV A;  1PK1 A;  2QKQ A;  1SV0 C;  5L1M A;  1COK A;  2E8N A;  3IDW A;  1Z1V A;  1SV4 A;  3SEI A;  2Y9U A;  5F3X B;  1V85 A;  4IS7 A;  4RQM A;  2QB0 B;  4PZO A;  4NL9 A;  2L5Y A;  4NJ8 A;  1UCV A;  2E8M A;  1UQV A;  3TAC B;  1PK3 A;  5KNI A;  2LMR A;  1PK1 B;  2KSO A;  1V38 A;  2ES6 A;  3TAD C;  1OXJ A;  1SGG A;  3H8M A;  3BS5 A;  2EAN A;  1SXE A;  4NL9 C;  3BS5 B;  1X40 A;  3TAD A;  1WWU A;  2K60 A;  1JI7 A;  2D3D A;  3KKA A;  3BS7 A;  5JTI A;  2DL0 A;  5J8Y A;  1LKY A;  2JV3 A;  2QAR A;  1DXS A;  1RG6 A;  1LKY B;  2QAR B;  2EAM A;  1B0X A;  5JU5 A;  4MHV A;  2KSO B;  4PZN A;  2KG5 A;  2GLE A;  1KW4 A;  3KKA C;  2E8O A;  2F44 A;  2EAP A;  5J8Y C;  3HIL A;  2YTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...