1UQVA

Sam domain from ste50p
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
b'GSHMNNEDFSQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDSKLEWKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STE50 PROTEIN
publication title Structure of the Sterile {Alpha} Motif (Sam) Domain of the Saccharomyces Cerevisiae Mitogen-Activated Protein Kinase Pathway-Modulating Protein Ste50 and Analysis of its Interaction with the Ste11 Sam
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09235 SAM_Ste50p Ste50p, sterile alpha motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1uqvA00
1F0MA 1PK3A 3HILA 2F3NA 5KNIA 4RQNA 2B6GA 2QB1A 3K1RB 4NL9C 1DXSA 2F44A 2QB0A 2EAPA 1SV0C 1V38A 3IDWA 1WWVA 2QB0B 2FE9A 3KKAC 2EAOA 2EANA 1LKYA 1Z1VA 1X66A 2LMRA 2ESEA 3TADA 5F3XB 2Y9UA 1JI7A 2KIVA 2DKZA 1LKYB 3BS5A 2D8CA 2LPEA 2YTUA 1UQVA 3H8MA 1SXEA 1B4FA 3BS5B 5J8YC 1OW5A 2F8KA 2KG5A 5JTIA 4NJ8A 1RG6A 1V85A 2E8OA 2QKQA 1SGGA 1SXDA 2DL0A 5JRTA 4PZOA 3BS7A 2GLEA 2EAMA 1B0XA 2QARA 2K60A 4NL9A 3BQ7A 1SV4A 1SV0A 2E8NA 5JU5A 2QARB 4PZNA 2ES6A 5L1MA 3SEIA 5J8YA 2E8MA 1OXJA 1COKA 1WWUA 3KKAA 2JV3A 3SENA 3TADC 2E8PA 2KE7A 2D3DA 1PK1B 1X40A 1KW4A 4MHVA 3TACB 2K4PA 2KMDA 2KSOA 1X9XA 1UCVA 2L5YA 2DKXA 2Y9TA 4RQMA 1PK1A 2KSOB 4IS7A
chains in the Genus database with same CATH superfamily
3LK9A 2GH1A 1PK3A 2FLNA 3EYZA 1ZQ1C 2W8LA 2R8HA 3RB3A 4RQ8A 5BPCA 4DFPA 3C2MA 3QU2A 3C28A 2NRZA 5KFMA 3H4DA 5ALSA 2W11A 4EX6A 3E58A 3ORYA 5KFOA 3ZD9A 3UMGA 1DOQA 1Z4NA 1COOA 4Z6DA 3QE9Y 5ALJA 3HPOA 3T79A 1Z1BA 1S77D 2W9CB 4IL6U 1H38A 2JEFA 3QU5A 5AICA 4DL4A 3H8MA 5AKEA 2DUYA 4C4SA 3RJHA 4M47A 4B9TA 8ICYA 1S0VA 1T3NA 4XUSA 4ED1A 5JTIA 3F2DA 5L1JA 1FO4A 4RQ1A 2C22A 3RB6A 5KFSA 4QWAA 4YR2A 4NWIA 4RQ6A 2GLEA 2LM4A 8ICWA 1Q3UA 4YMNA 5KT2A 1HUZA 3SAFA 4QZBA 9ICSA 9ICHA 2E8MA 5DQIA 1OXJA 3B0YA 3VCBA 3ZDAA 1RPLA 1EXNA 5AKZA 7ICFA 3UQ2A 3T5LA 1ZOLA 3JPTA 2A3VA 4AYBC 4UB5A 1X9WA 5ALTA 4PGQA 5AKYA 4C4RA 2H3FA 4TQRA 1KLNA 3N4MB 8ICFA 5KFKA 1D9DA 4MF2A 3AU2A 3M9MB 3IHQB 2BQ3A 4ED0A 4FZMA 2GWSA 3C1YA 5J0UA 4OJPA 1ZQSA 2DPIA 4QZIA 1YT3A 2BHNA 2G06A 1V97A 4RQNA 4K4HA 3RB0A 5ALFA 7ICRA 1BNPA 1TAUA 1ZXIA 4M6WB 5AI5A 3F2CA 2E1EA 2JH1A 4QZHA 4TUQA 3ED5A 3HWTA 1WWVA 4C4TA 4C8MA 1K1SA 2W9MA 2W03A 5ALKA 9ICPA 1X66A 1RQNA 1NI3A 1RYUA 2FI1A 2KN7A 4ECWA 2Y9UA 2JH7A 4FBUA 1NKEA 4QWEA 1U9LA 2PMZC 4R8UA 4C7YA 2MA1A 1MQ3A 5IINA 5J0QA 2WAQF 1JRPA 4LZGA 3AQFA 4OJLA 2PFQA 7ICEA 2HHSA 4DQQA 2KK0A 4KMOB 2B21A 5CRXA 1ZQMA 2HHUA 3C29A 4MFCA 4E0DA 2K4IA 4QZAA 2BCQA 2DL0A 2VJ4A 4YG2A 2J6SA 2F2AB 5J2IA 3RRGA 2WB1F 3HP6A 4LJXA 1NK7A 3PW7A 3QNMA 4JB3A 1UA0A 3CNHA 5KFJA 2E8NA 2KZMA 4I2JA 4AP9A 2UVRA 5KFUA 1JMSA 3OPXA 3OHBA 2ISPA 4F71A 3N7PD 4ELVA 4DL5A 1ZD4A 3RJGA 2XVTA 1PUZA 1X40A 3B9JA 1VDVA 2VJ5A 4O3QA 2BDUA 2I1QA 4DF4A 1ZQCA 5HR7A 2F8LA 4DOCA 2AH5A 9ICGA 1KKXA 1C7YA 4FFDA 4J9QA 4NY8A 1LVHA 1SKRA 9ICEA 4HYKA 1NOMA 5ALWA 1F0MA 3I76A 2G5HB 2KFNA 3CP8A 4KLTA 5KAIU 3C2KA 2BCUA 9ICJA 3PY8A 1WG8A 3L3FX 4QWBA 2VA3A 1RDFA 5G5GA 3IN5A 2W7OA 4QNLA 3QYPA 5J2EA 2F1HA 3OTQA 3V7LA 3WKEA 1TFRA 1N61A 4F5QA 4QZFA 4TUSA 3JPSA 5AKXA 1D8YA 3RTVA 1L7PA 1DK2A 4GC7A 2JR5A 3QUTA 3J81j 2DKZA 1ECWA 3BS5A 1FFUA 3SV3A 5ALIA 4IQTA 2NO4A 2HOIA 4YP3A 8ICCA 3MR5A 3TARA 2ASDA 2EQYA 3AM9A 1FEZA 1SKSA 3SAGA 5B66U 2UVUA 1TK5A 2I6XA 4DS4A 3ETLA 4GLXA 3PW4A 1WUDA 3MGVA 5KFTA 1A6SA 4C80A 4NXZA 2HDOA 4UB8U 3QU9A 1OUQA 3V6KA 4GIBA 4JUZA 1SWWA 4Q43A 4PL1A 3AL0B 3RBDA 5EWFA 4ELTA 2WF8A 2KP7A 5DB6A 2FMSA 2ZXIA 5DBAA 4KLEA 8ICMA 5AKJA 9ICBA 3M9OB 4TURA 1QSYA 4EYHB 4KLUA 2DWQA 2KJ8A 4Y2TA 3UMCA 5DG8A 3B0XA 1ZYQA 1NZBA 2PFPA 4IS7A 4F4KA 3R9KA 3GU3A 2YB4A 2B6GA 3RJKA 2QB1A 2EAPA 5IIIA 4UB4A 2H3VA 2ZJ8A 5E79U 3GV8B 3F2BA 1RM6C 1L6NA 1ZQLA 5ALXA 4ECRA 2Q4TA 5KFRA 2ODGA 3MR2A 2BCVA 4CCHA 5CHGA 4QZ9A 4M9JA 1KFDA 7ICSA 4QJFB 3F5EA 1NJYA 2JZBB 2IHNA 4TQSA 4BWMA 1S76D 4QZDA 5KTQA 1RZTA 2JEIA 2LYAA 1Q8KA 1L8OA 8ICQA 3WKCA 3PSPA 1IM4A 2YY6A 3DV9A 4J9MA 2ASLA 1ZQYA 4PZOA 3WK6A 5DG7A 2QARA 1TK8A 5KFEA 1PZNA 1U47A 1S10A 5KFVA 3NTUA 2P35A 5KG7A 3NVZA 5JU5A 3TFRA 1UHUA 3FC4A 3EW9A 3MFHA 2YMQA 2H5XA 4ECYA 2UVVA 8ICLA 4O5CA 2LBOA 3PX4A 4ECZA 2F1JA 2VANA 5KFDA 5ALUA 1PK1B 1FFVA 5L9XA 4RUAA 4FS1A 2O6KA 2W04A 1UPHA 4Y2YA 3H8WA 1ZQXA 9ICVA 5ALQA 2HW3A 2KSOA 4ACOA 3ZD8A 1N62A 5AK4A 2HBLA 4F4ZA 3NS1A 5GTHU 1BGXT 3UM9A 4P4OA 4Y2RA 3PO4A 4US8A 2BPCA 2KOBA 2ZIWB 4ED6A 1TVAA 3ZDBA 2BDPA 4B9NA 4RT3A 3SR6A 1SL1A 2XIDA 1YZ7A 3H7IA 3KTQA 3M8RA 4RNMA 2KJ9A 4QZEA 3QUCA 2W9CA 3TKAA 5J2AA 2EAOA 1KQQA 4UAVA 1XWLA 2ZTEA 1BPXA 1HJPA 9ICWA 4F5PA 2NYVA 4EBCA 4J9LA 1TK0A 5BOMA 7ICLA 2LPEA 4YMMA 3AUOA 1UA1A 3MGHA 2HOFA 3NGDA 4ZH4A 1XU4A 2AGPA 1C20A 4OD0A 2YMPA 1L3VA 4YN4A 4Q45A 5EE9A 4KLGA 3D2SA 1SV0A 3IG5A 4CDGA 7ICVA 1ZETA 5ALDA 4B9MA 1BPBA 3E0FA 2LKYA 4WJ3B 9ICXA 4G3IA 8ICHA 2E5SA 1IIPA 5KAFU 2PFNA 3RAXA 2MUTB 3PSTA 4CRXA 3HX0A 4ECQA 5KFZA 5L1LA 2HHVA 9ICKA 4KITB 5AI8A 3WK9A 7ICUA 3KHLA 4PL2A 4M6WA 1M6YA 2E1FA 5KNIA 1ZQPA 4MFAA 3MBYA 4B9UA 5IIJA 5AHXA 2FLPA 2VKQA 3IDWA 1NK5A 2RDIA 4UB1A 5ALNA 3GV5B 2IBKA 3ALRA 5ALGA 4NLKA 3MDAA 2AU0A 8ICRA 5DDYA 3JPRA 4EBDA 1N48A 2FPLA 3GV7B 4BWJA 4FZLA 2ZIVB 5DLGA 5DB8A 2KZZA 2CPRA 3NRWA 4I29A 5AM4A 2ZIXB 4YR3A 4I28A 4DL7A 3PO5A 5AKLA 4I2AA 5AK3A 9ICIA 2HSZA 4UB2A 4JWMA 1SL0A 2AQ0A 3M8SA 1B4FA 5J2GA 2NV3A 5KFBA 2KG5A 4O5EA 5J0YA 1D8BA 1QH9A 4P0PB 2HHWA 1PVQA 1RQLA 9ICTA 4RU9A 3JPNA 1ZQBA 5KG2A 2WF6A 3C5FA 1O08A 2ZXHA 3Q8QB 4YMOA 3RFAA 3V6HA 1NZPA 3T3FA 1TV9A 1LB2B 8ICJA 4GFJA 5D49A 1WWUA 5ALEA 4KLDA 5DG9A 1S0MA 3ISCA 2EH9A 4JV0A 4O3PA 5DKWA 1KW4A 2XY6A 3WKAA 4UASA 1SB3C 4QW9A 2OM6A 3SQIA 3RRHA 4M2YA 4IRDA 9ICCA 1L7OA 3NVVA 3WK7A 3TANA 3EZ5A 5J0PA 1ZJNA 3PR4A 3OGUA 4NL9C 3BZCA 1BVSA 2K8BB 5ALYA 4DLGA 2WFAA 1T8EA 2KV2A 2BGWA 2NRTA 2R8GA 2BQRA 3ZDCA 2EANA 2V4QA 2EDUA 2Y1IA 1Z1VA 1IV8A 2LMRA 4UQGA 3M9NB 4RT2A 4CGZA 4KLOA 3Q8PB 1TKDA 4LVSA 2YTUA 2HBJA 4MF8A 1X9SA 9ICOA 4JMUA 5HHHA 1DK3A 2NRXA 2VIXA 5EE0A 5DB7A 2OEHA 1L7NA 4F92B 5K4LA 4R65A 1VJ5A 1Z4OA 2AHOB 5KL1B 5CJ7A 5HMMA 3KZXA 3NUQA 1V85A 2JMGA 5DLFA 8ICTA 8ICAA 3MR3A 2FLLA 5G5HA 4DSIA 1Z3EB 1T3QA 3D6JA 8ICUA 1JUDA 2ASJA 4UAWA 2RP5A 3KKAA 4CNQA 3S6JA 3ZDDA 2E8PA 4RUCA 2R18A 4UBCA 4YXMA 4IR1A 2KVCA 3KOOA 3PMNA 5J2HA 1ZQJA 4ECVA 4RPYA 5KT3A 2HBKA 4FO6A 4J9KA 8ICEA 2W54A 2Y9TA 3WK4A 2Y1JA 2DPJA 7ICQA 4C7ZA 1QLNA 4US9A 3C23A 7ICTA 2WHEA 3ONNA 3TQ1A 1NKBA 4PHPA 3GIMA 2BPGA 4XQ8A 2QB0B 1WYGA 3U26A 1SL2A 4EZ9A 4KLLA 2JZBA 3BJYA 2QLTA 2ESEA 2W9AA 3TADA 5F3XB 2ZIUB 7ICKA 1AROP 5AI9A 3DDHA 4I2CA 4I2IA 4RPZA 4M04A 2D8CA 1N2XA 1XS9D 4FBTA 3N7RC 5T14A 1KRPA 3UMBA 5DQGA 4F4WA 4Y2SA 4BGDA 4CF3A 4RNNA 3BDPA 5EE3A 3WK5A 1OW5A 2F8KA 3IM1A 2PI5A 4I2GA 9ICNA 4NJ8A 4JV1A 5KL8B 1DRGA 2XCPA 2C2EA 3M7DA 4ECXA 5EWGA 4B6JA 5ALLA 3UQ0A 5J2JA 2R8JA 4YVZA 3C1ZA 1O03A 5KFGA 4M9LA 2RQ5A 2XY7A 1ZQWA 4PGYA 3SV4A 1MA7A 1ZQIA 3N7SC 1COKA 4F93B 3DEEA 5KG5A 2KFZA 1ZQVA 3RR8A 2J6UA 2ZJAA 5KG6A 1GO3F 5J2DA 3T5JA 2KICA 4JWNA 5KG0A 2BPFA 1N60A 3M6ZA 4F3OA 9ICMA 1KDHA 1X9XA 4I2EA 1ZRMA 4Y2VA 4F2SA 2ZIWA 4O3SA 2J6TA 2HBMA 2KHVA 4F72A 5J2BA 5DBCA 3NVWA 3T5KA 5ALRA 3ZI4A 1NK6A 4C0ZA 5HHIA 5EOZA 2YQEA 7ICOA 1LV5A 4NM1A 3UXPA 3KBBA 1A77A 7ICGA 1L5UA 4ECUA 2V4RA 4YCXA 1PVRA 3ICXA 4BXOB 2AQ4A 1U45A 2FMQA 5FP0A 3WK8A 3GIKA 3K1ZA 1Z19A 3AQEA 5D46A 4PH5A 2W7PA 9ICUA 1L8LA 2WF9A 1TAQA 5J0TA 1IG6A 1ZQAA 2FPMA 5KG4A 2KZ3A 2VA8A 4R66A 1RG6A 4IQVA 1NK4A 5KFYA 4DWIA 5L1IA 2JRZA 1U49A 2ISOA 2RDJA 1HIWA 4GXKA 4DO9A 4DFMA 4QIWC 2KEYA 2F76X 4BUGA 2RRDA 8ICGA 4C8OA 2ALZA 2V9WA 4J9RA 4Z6EA 5HR6A 4J9SA 4Q8FA 5J2KA 2AGQA 4KLHA 1DGJA 4JK1A 2IA6A 2IOFK 3K4GA 4DSLA 4DS5A 2IOFA 3PW0A 2D3DA 4DQPA 1ZD2P 3QU4A 3G6XA 1K1QA 2KKVA 5IILA 1CI4A 2HVIA 4BX9C 2A1JA 5ALPA 5J0WA 1X9MA 1HEKA 2DKXA 1RXVA 1MQ2A 2P6RA 3MC1A 4ELUA 3HILA 3OJUA 1A0PA 4I2DA 5ALZA 4PHEA 3RJJA 4P4PA 1D8LA 3A0HU 3K75D 4RQ0A 5KT6A 2CRXA 2AXTU 1Y88A 2G08A 1JIHA 1ZQOA 4DOAA 1Z00A 2PFOA 1NK9A 2ZIVA 3GIJA 5F9LA 2XICA 2CXYA 3AEVA 3LWMA 2ZIXA 5AI4A 1QSSA 2HOQA 4OJ5A 3KFUF 3H8SA 5J2CA 1X6IA 2YMMA 3FYHA 2OXOA 3GQCA 3M1YA 3TAPA 2I9GA 2IHMA 4EEKA 8ICXA 2OCEA 2KJ5A 1QQ5A 3L4PA 3IP4B 2BQUA 3V6JA 4USAA 5J8YC 3PNCA 2LM1A 3A0BU 3VC8A 9ICQA 1XO0A 1NJWA 1QCKA 4OJ6A 3TI0A 4M0AA 5KFCA 3LYSA 3MABA 1Q46A 1SWVA 4YQWA 1KSPA 4YR0A 5J0OA 5KG1A 1KFSA 5AM1A 1ZQKA 7ICMA 2EAMA 1JN3A 3OHAA 2ZG6A 1F5SA 3E2EA 4PHDA 2C2RA 3JPOA 1SV4A 3LWLA 4IR9A 2H3QA 5ALVA 5DQHA 4Z6CA 2JHDA 4F2RA 3ISBA 4CF4A 2JEJA 1SZPA 3HW8A 1S97A 8ICBA 3RAQA 3RJFA 3I1YA 2IMWP 4KTQA 1ZQGA 9ICRA 2ZTCA 3H0RB 4OCZA 3PX6A 1KBUA 3RH5A 5KFNA 3GIIA 3N97B 4O3RA 2W55A 1SKWA 2XO7A 3QZ8A 3PSFA 8ICOA 1L3SA 5DDMA 2ZUCA 3IV6A 5GTIU 2NRVA 2K4EA 4O3OA 2PXIA 2FE9A 4ED2A 4DLEA 3MDCA 4DQRA 3PV8A 1NJXA 1NK0A 4EEYA 4O5KA 1JI7A 2KIVA 1LKYB 3CW2C 3G6VA 2YN4A 5J0SA 5AKGA 3GILA 4JV2A 4RQ5A 4Q8EA 4F50A 4R63A 1ZQTA 7ICHA 4DQIA 1K5OA 4DCCA 4OO1J 4DFKA 4M9GA 4ICAA 3CYMA 3NASA 1SXDA 3OJSA 2HCFA 5JRTA 5J29A 1JX4A 2DF4B 4UATA 4DL3A 2K60A 4QZGA 2P66A 3SI8A 1ZQZA 4F8RA 1TAMA 5IIKA 4J9NA 2G0AA 3D2NA 4ECSA 4EX7A 5TISU 4O9MA 3SENA 4FZNA 5AM2A 2D6FC 1VLBA 2W9BB 1ZD3A 2ZUBA 5KFQA 3EWAA 3H4BA 4RPXA 3AN1A 4IC9A 3TACB 1A76A 1UT8A 1BPYA 2DBYA 1HUOA 1MC8A 4I2BA 3AMZA 2Z7JA 2HHXA 4QWDA 4PPXA 4KLMA 3D2QA 1ED1A 2XI9A 1F44A 4KLIA 1NJZA 2YMLA 4KLQA 3RJIA 3HKZC 4KN4A 2OHFA 1XSNA 1KN5A 2F44A 2QB0A 2XCAA 2OWOA 4DSJA 2BZFA 3EPIA 4O3MA 3V7KA 2JXJA 1KL9A 5CA7A 2ZIUA 3H0LB 5CP2A 5KG3A 2A19A 3WKBA 1WCNA 2W3RA 4YFKA 3RJEA 2EZYA 5AM5A 2GO7A 2FDRA 4EZ6A 5A0LA 5L1KA 4ED3A 1B43A 5CEHA 1XSLA 5HP4A 3QX7A 4QW8A 2G5IB 2WF5A 1SZHA 3F53A 1ZQRA 4YD2A 4U7CA 1BPDA 2QKQA 1Q3VA 4P0QB 1CRXA 2H3ZA 4K4GA 5KT5A 1NKCA 2KD1A 1S0NA 4GXJA 4KLJA 4G9BA 3TFSA 1NNLA 2BCSA 5DGAA 7ICIA 5J8YA 4FS2A 3SD7A 4DF8A 1U4BA 2LHTA 2RLTA 2FMPA 3G6YA 5KFIA 4QIWF 2MAXA 4MHVA 3QXGA 3M6KA 1P7DA 1FIQA 4YD1A 4DQSA 4B9VA 2K4PA 2DFLA 1QTMA 2MU2A 1UCVA 3BQ2A 3UXOA 4J9OA 4BJQA 4RQ2A 7ICPA 1N63A 2JGAA 4ZOHC 1CEZA 4OJOA 2F77X 2Y0SC 2K4HA 7ICJA 3PR5B 3GDXA 4Z6FA 4RZRA 1DXSA 3Q8KA 4EYIB 2HHQA 2KKPA 3GFKB 3CRXA 4BXOA 3LDAA 5KFWA 3QEBZ 4QWCA 4NLNA 4K4IA 1RXWA 1ZJMA 2K8AA 2LI6A 2H3IA 3ETRA 3PZPA 2R8IA 4TUPA 4QZ8A 1BPZA 5AKIA 1UQVA 3SAHA 1SXEA 5IIOA 4GXIA 2NRWA 1X2IA 1X6JA 2ZJ5A 1T94A 3Q8SB 2EZZA 2KTQA 5AM3A 3F5AA 5B5EU 5KFFA 3QZ7A 3SMVA 5AKHA 4MFFA 4ED8A 5DBBA 4Y2JA 2LYBA 4B9SA 2MRLA 5CB1A 5KFHA 2ES6A 4DSEA 2IOHA 3KZIU 3SEIA 4EENA 2AGOA 3JPQA 1S5LU 2JV3A 4DL6A 2E3TA 2CN1A 3PMLA 4DFDA 1XO1A 3KD3A 1URJA 3RH4A 2C2DA 2C28A 3PW5A 4M9HA 2KHQA 4NLZA 3BQTA 1BNOA 8ICIA 3MFIA 2NO5A 5CWRA 1ZQNA 2F1IA 4Y2PA 4RQ7A 9ICFA 2W8KA 1V9PA 2KVSA 3RB4A 1PK1A 1B22A 4KX5A 1NK8A 2JEGA 1QSLA 2F3NA 4F4XA 4KN7A 8ICPA 4GC6A 3THVA 2KNJA 4F5RA 1SV0C 4I2HA 3C5GA 5J2FA 5JUMA 4MEXA 3EPGA 1L7MA 5AKKA 5D4BA 2K8CB 3OSPA 1T4GA 2OH2A 5CR0A 5TZVA 4DSFA 3RR7A 1JXLA 2W43A 2FPKA 5KFLA 2YB1A 1JALA 3HT3A 1SIJA 4DSKA 3FAHA 8ICKA 4R8UB 1MSWD 1N5XA 3N28A 2E8OA 9ICLA 2Q0ZX 2LYHA 1L3UA 2AJQA 1B0XA 2KIWA 2UVWA 4NL9A 3NRZA 4KMUA 4PZNA 1PVPA 3QU7A 3FM9A 4UB3A 3IG8A 5KFAA 5KFXA 5L1MA 1ZD5A 5ALMA 3Q8LA 4F5OA 1U48A 4XA5A 4DOBA 2VA2A 4UAZA 3QUBA 2KE7A 1MN8A 4QZCA 4XRHA 2PKEA 5DGBA 3PW2A 3LVVA 3V7JA 1ZQUA 1L3TA 4PHAA 3HJEA 4C8NA 9ICAA 4BDPA 3BQ0A 3BQ1A 1RYSA 2XGPA 3RBEA 1IXRA 3KHGA 2L5YA 3BZKA 3H8JA 3UPQA 3SYZA 4B9LA 3WKDA 4U6PA 1AQ6A 4F91B 4PJ0U 1ZQFA 1JXEA 3H0MB 2MUTA 2XGQA 1X42A 5KT7A 2YX8A 4UARA 4O0IA 5IIMA 5HNKA 5AIBA 4UAYA 2WAQC 3Q8MA 4RQ4A 4DFJA 1LKYA 4C8KA 3HKZF 4NV0A 4KLFA 3QEAZ 1WCLA 2R8KA 8ICNA 5AK6A 5ALOA 4IQWA 2K89A 3EUB2 4Y2QA 5H2FU 4NLCA 3RF9A 5J0XA 3AU6A 3KHRA 3MGIA 4DEZA 4UB6U 2WB1C 3BS5B 3GZFA 4ED7A 2HVHA 5HMLA 5C5JA 2N1RA 3LVWA 5AM0A 4I27A 1N56A 1SGGA 5C0YA 5EWEA 4R64A 1ZQDA 4IQUA 5AIAA 1JROA 5EE1A 4RNOA 2HMXA 1TE2A 2RHFA 3MR6A 4P4MA 3BQ7A 5DB9A 2B0CA 3NVYA 3C2LA 3UXNA 2W9BA 5KT4A 4NLGA 2I5HA 4P0PA 3JPPA 3WU2U 1CUKA 4AYBF 4Y2XA 1S9FA 3ISDA 4F5NA 2FJ6A 3KHHA 2WTFA 1UT5A 4UBBA 2MSNA 7ICNA 1J97A 2XY5A 3HRDD 1T7PA 3PSIA 4YXJA 5F9NA 5ALHA 2M0NA 1S8OA 3IRUA 1KTQA 1BPEA 1XSPA 3TAQA 3C21A 2P6UA 4A8EA 1ZQHA 4C8LA 2W3SA 1J2NA 3FDSA 3OSNA 3PVXA 4RQ3A 1ZRNA 3K1RB 3PX0A 1YZ6A 2ATLA 1V38A 1ZQQA 3T5HA 4UAUA 4Q44A 2G09A 2A1AA 3RH6A 3KKAC 3V72A 1KEJA 1XC9A 3O0FA 2M9NA 4PGXA 2Y0SF 2G07A 2OYYA 5AI0A 2PMZF 8ICSA 4I2FA 4ECTA 5KFPA 4NM2A 4UW9A 4DL2A 4EBEA 2ZTDA 2ZUDA 4P0QA 1RYRA 1S0OA 2XC9A 4Y2UA 3SZ2A 4CF5A 4CE6A 4M9NA 1N5WA 3BS7A 3L5KA 5AK5A 5BOLA 2HI0A 2DQNB 4KLSA 4EELA 4F4YA 2DGZA 2QARB 1QQ7A 1J2MA 1ZQEA 1D9FA 2A1JB 2GOLA 2EZXA 2WF7A 4J03A 1QQ6A 4IRKA 3TADC 2BCRA 5AI6A 8ICZA 4O3NA 2BKEA 5J0RA 4MEYA 3Q8RB 2HHTA 4IRCA 8ICVA 3QUQA 4P2HA 4X5VA 3I28A 4NLBA 2KMDA 1XNSA 4LZDA 4FE3A 4J9PA 3H40A 4KX3A 1Z00B 1KFTA 1DGSA 2PI4A 4RQMA 2KSOB 2BR0A 3ZDEA 4HAIA
chains in the Genus database with same CATH topology
1F0MA 1PK3A 3HILA 2F3NA 5KNIA 4RQNA 2B6GA 2QB1A 3K1RB 4NL9C 1DXSA 2F44A 2QB0A 2EAPA 1SV0C 1V38A 3IDWA 1WWVA 2QB0B 2FE9A 3KKAC 2EAOA 2EANA 1LKYA 1Z1VA 1X66A 2LMRA 2ESEA 3TADA 5F3XB 2Y9UA 1JI7A 2KIVA 2DKZA 1LKYB 3BS5A 2D8CA 2LPEA 2YTUA 1UQVA 3H8MA 1SXEA 1B4FA 3BS5B 5J8YC 1OW5A 2F8KA 2KG5A 5JTIA 4NJ8A 1RG6A 1V85A 2E8OA 2QKQA 1SGGA 1SXDA 2DL0A 5JRTA 4PZOA 3BS7A 2GLEA 2EAMA 1B0XA 2QARA 2K60A 4NL9A 3BQ7A 1SV4A 1SV0A 2E8NA 5JU5A 2QARB 4PZNA 2ES6A 5L1MA 3SEIA 5J8YA 2E8MA 1OXJA 1COKA 1WWUA 3KKAA 2JV3A 3SENA 3TADC 2E8PA 2KE7A 2D3DA 1PK1B 1X40A 1KW4A 4MHVA 3TACB 2K4PA 2KMDA 2KSOA 1X9XA 1UCVA 2L5YA 2DKXA 2Y9TA 4RQMA 1PK1A 2KSOB 4IS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F0M A;  1PK3 A;  3HIL A;  2F3N A;  5KNI A;  4RQN A;  2B6G A;  2QB1 A;  3K1R B;  4NL9 C;  1DXS A;  2F44 A;  2QB0 A;  2EAP A;  1SV0 C;  1V38 A;  3IDW A;  1WWV A;  2QB0 B;  2FE9 A;  3KKA C;  2EAO A;  2EAN A;  1LKY A;  1Z1V A;  1X66 A;  2LMR A;  2ESE A;  3TAD A;  5F3X B;  2Y9U A;  1JI7 A;  2KIV A;  2DKZ A;  1LKY B;  3BS5 A;  2D8C A;  2LPE A;  2YTU A;  1UQV A;  3H8M A;  1SXE A;  1B4F A;  3BS5 B;  5J8Y C;  1OW5 A;  2F8K A;  2KG5 A;  5JTI A;  4NJ8 A;  1RG6 A;  1V85 A;  2E8O A;  2QKQ A;  1SGG A;  1SXD A;  2DL0 A;  5JRT A;  4PZO A;  3BS7 A;  2GLE A;  2EAM A;  1B0X A;  2QAR A;  2K60 A;  4NL9 A;  3BQ7 A;  1SV4 A;  1SV0 A;  2E8N A;  5JU5 A;  2QAR B;  4PZN A;  2ES6 A;  5L1M A;  3SEI A;  5J8Y A;  2E8M A;  1OXJ A;  1COK A;  1WWU A;  3KKA A;  2JV3 A;  3SEN A;  3TAD C;  2E8P A;  2KE7 A;  2D3D A;  1PK1 B;  1X40 A;  1KW4 A;  4MHV A;  3TAC B;  2K4P A;  2KMD A;  2KSO A;  1X9X A;  1UCV A;  2L5Y A;  2DKX A;  2Y9T A;  4RQM A;  1PK1 A;  2KSO B;  4IS7 A; 
#chains in the Genus database with same CATH topology
 3LK9 A;  2GH1 A;  1PK3 A;  2FLN A;  3EYZ A;  1ZQ1 C;  2W8L A;  2R8H A;  3RB3 A;  4RQ8 A;  5BPC A;  4DFP A;  3C2M A;  3QU2 A;  3C28 A;  2NRZ A;  5KFM A;  3H4D A;  5ALS A;  2W11 A;  4EX6 A;  3E58 A;  3ORY A;  5KFO A;  3ZD9 A;  3UMG A;  1DOQ A;  1Z4N A;  1COO A;  4Z6D A;  3QE9 Y;  5ALJ A;  3HPO A;  3T79 A;  1Z1B A;  1S77 D;  2W9C B;  4IL6 U;  1H38 A;  2JEF A;  3QU5 A;  5AIC A;  4DL4 A;  3H8M A;  5AKE A;  2DUY A;  4C4S A;  3RJH A;  4M47 A;  4B9T A;  8ICY A;  1S0V A;  1T3N A;  4XUS A;  4ED1 A;  5JTI A;  3F2D A;  5L1J A;  1FO4 A;  4RQ1 A;  2C22 A;  3RB6 A;  5KFS A;  4QWA A;  4YR2 A;  4NWI A;  4RQ6 A;  2GLE A;  2LM4 A;  8ICW A;  1Q3U A;  4YMN A;  5KT2 A;  1HUZ A;  3SAF A;  4QZB A;  9ICS A;  9ICH A;  2E8M A;  5DQI A;  1OXJ A;  3B0Y A;  3VCB A;  3ZDA A;  1RPL A;  1EXN A;  5AKZ A;  7ICF A;  3UQ2 A;  3T5L A;  1ZOL A;  3JPT A;  2A3V A;  4AYB C;  4UB5 A;  1X9W A;  5ALT A;  4PGQ A;  5AKY A;  4C4R A;  2H3F A;  4TQR A;  1KLN A;  3N4M B;  8ICF A;  5KFK A;  1D9D A;  4MF2 A;  3AU2 A;  3M9M B;  3IHQ B;  2BQ3 A;  4ED0 A;  4FZM A;  2GWS A;  3C1Y A;  5J0U A;  4OJP A;  1ZQS A;  2DPI A;  4QZI A;  1YT3 A;  2BHN A;  2G06 A;  1V97 A;  4RQN A;  4K4H A;  3RB0 A;  5ALF A;  7ICR A;  1BNP A;  1TAU A;  1ZXI A;  4M6W B;  5AI5 A;  3F2C A;  2E1E A;  2JH1 A;  4QZH A;  4TUQ A;  3ED5 A;  3HWT A;  1WWV A;  4C4T A;  4C8M A;  1K1S A;  2W9M A;  2W03 A;  5ALK A;  9ICP A;  1X66 A;  1RQN A;  1NI3 A;  1RYU A;  2FI1 A;  2KN7 A;  4ECW A;  2Y9U A;  2JH7 A;  4FBU A;  1NKE A;  4QWE A;  1U9L A;  2PMZ C;  4R8U A;  4C7Y A;  2MA1 A;  1MQ3 A;  5IIN A;  5J0Q A;  2WAQ F;  1JRP A;  4LZG A;  3AQF A;  4OJL A;  2PFQ A;  7ICE A;  2HHS A;  4DQQ A;  2KK0 A;  4KMO B;  2B21 A;  5CRX A;  1ZQM A;  2HHU A;  3C29 A;  4MFC A;  4E0D A;  2K4I A;  4QZA A;  2BCQ A;  2DL0 A;  2VJ4 A;  4YG2 A;  2J6S A;  2F2A B;  5J2I A;  3RRG A;  2WB1 F;  3HP6 A;  4LJX A;  1NK7 A;  3PW7 A;  3QNM A;  4JB3 A;  1UA0 A;  3CNH A;  5KFJ A;  2E8N A;  2KZM A;  4I2J A;  4AP9 A;  2UVR A;  5KFU A;  1JMS A;  3OPX A;  3OHB A;  2ISP A;  4F71 A;  3N7P D;  4ELV A;  4DL5 A;  1ZD4 A;  3RJG A;  2XVT A;  1PUZ A;  1X40 A;  3B9J A;  1VDV A;  2VJ5 A;  4O3Q A;  2BDU A;  2I1Q A;  4DF4 A;  1ZQC A;  5HR7 A;  2F8L A;  4DOC A;  2AH5 A;  9ICG A;  1KKX A;  1C7Y A;  4FFD A;  4J9Q A;  4NY8 A;  1LVH A;  1SKR A;  9ICE A;  4HYK A;  1NOM A;  5ALW A;  1F0M A;  3I76 A;  2G5H B;  2KFN A;  3CP8 A;  4KLT A;  5KAI U;  3C2K A;  2BCU A;  9ICJ A;  3PY8 A;  1WG8 A;  3L3F X;  4QWB A;  2VA3 A;  1RDF A;  5G5G A;  3IN5 A;  2W7O A;  4QNL A;  3QYP A;  5J2E A;  2F1H A;  3OTQ A;  3V7L A;  3WKE A;  1TFR A;  1N61 A;  4F5Q A;  4QZF A;  4TUS A;  3JPS A;  5AKX A;  1D8Y A;  3RTV A;  1L7P A;  1DK2 A;  4GC7 A;  2JR5 A;  3QUT A;  3J81 j;  2DKZ A;  1ECW A;  3BS5 A;  1FFU A;  3SV3 A;  5ALI A;  4IQT A;  2NO4 A;  2HOI A;  4YP3 A;  8ICC A;  3MR5 A;  3TAR A;  2ASD A;  2EQY A;  3AM9 A;  1FEZ A;  1SKS A;  3SAG A;  5B66 U;  2UVU A;  1TK5 A;  2I6X A;  4DS4 A;  3ETL A;  4GLX A;  3PW4 A;  1WUD A;  3MGV A;  5KFT A;  1A6S A;  4C80 A;  4NXZ A;  2HDO A;  4UB8 U;  3QU9 A;  1OUQ A;  3V6K A;  4GIB A;  4JUZ A;  1SWW A;  4Q43 A;  4PL1 A;  3AL0 B;  3RBD A;  5EWF A;  4ELT A;  2WF8 A;  2KP7 A;  5DB6 A;  2FMS A;  2ZXI A;  5DBA A;  4KLE A;  8ICM A;  5AKJ A;  9ICB A;  3M9O B;  4TUR A;  1QSY A;  4EYH B;  4KLU A;  2DWQ A;  2KJ8 A;  4Y2T A;  3UMC A;  5DG8 A;  3B0X A;  1ZYQ A;  1NZB A;  2PFP A;  4IS7 A;  4F4K A;  3R9K A;  3GU3 A;  2YB4 A;  2B6G A;  3RJK A;  2QB1 A;  2EAP A;  5III A;  4UB4 A;  2H3V A;  2ZJ8 A;  5E79 U;  3GV8 B;  3F2B A;  1RM6 C;  1L6N A;  1ZQL A;  5ALX A;  4ECR A;  2Q4T A;  5KFR A;  2ODG A;  3MR2 A;  2BCV A;  4CCH A;  5CHG A;  4QZ9 A;  4M9J A;  1KFD A;  7ICS A;  4QJF B;  3F5E A;  1NJY A;  2JZB B;  2IHN A;  4TQS A;  4BWM A;  1S76 D;  4QZD A;  5KTQ A;  1RZT A;  2JEI A;  2LYA A;  1Q8K A;  1L8O A;  8ICQ A;  3WKC A;  3PSP A;  1IM4 A;  2YY6 A;  3DV9 A;  4J9M A;  2ASL A;  1ZQY A;  4PZO A;  3WK6 A;  5DG7 A;  2QAR A;  1TK8 A;  5KFE A;  1PZN A;  1U47 A;  1S10 A;  5KFV A;  3NTU A;  2P35 A;  5KG7 A;  3NVZ A;  5JU5 A;  3TFR A;  1UHU A;  3FC4 A;  3EW9 A;  3MFH A;  2YMQ A;  2H5X A;  4ECY A;  2UVV A;  8ICL A;  4O5C A;  2LBO A;  3PX4 A;  4ECZ A;  2F1J A;  2VAN A;  5KFD A;  5ALU A;  1PK1 B;  1FFV A;  5L9X A;  4RUA A;  4FS1 A;  2O6K A;  2W04 A;  1UPH A;  4Y2Y A;  3H8W A;  1ZQX A;  9ICV A;  5ALQ A;  2HW3 A;  2KSO A;  4ACO A;  3ZD8 A;  1N62 A;  5AK4 A;  2HBL A;  4F4Z A;  3NS1 A;  5GTH U;  1BGX T;  3UM9 A;  4P4O A;  4Y2R A;  3PO4 A;  4US8 A;  2BPC A;  2KOB A;  2ZIW B;  4ED6 A;  1TVA A;  3ZDB A;  2BDP A;  4B9N A;  4RT3 A;  3SR6 A;  1SL1 A;  2XID A;  1YZ7 A;  3H7I A;  3KTQ A;  3M8R A;  4RNM A;  2KJ9 A;  4QZE A;  3QUC A;  2W9C A;  3TKA A;  5J2A A;  2EAO A;  1KQQ A;  4UAV A;  1XWL A;  2ZTE A;  1BPX A;  1HJP A;  9ICW A;  4F5P A;  2NYV A;  4EBC A;  4J9L A;  1TK0 A;  5BOM A;  7ICL A;  2LPE A;  4YMM A;  3AUO A;  1UA1 A;  3MGH A;  2HOF A;  3NGD A;  4ZH4 A;  1XU4 A;  2AGP A;  1C20 A;  4OD0 A;  2YMP A;  1L3V A;  4YN4 A;  4Q45 A;  5EE9 A;  4KLG A;  3D2S A;  1SV0 A;  3IG5 A;  4CDG A;  7ICV A;  1ZET A;  5ALD A;  4B9M A;  1BPB A;  3E0F A;  2LKY A;  4WJ3 B;  9ICX A;  4G3I A;  8ICH A;  2E5S A;  1IIP A;  5KAF U;  2PFN A;  3RAX A;  2MUT B;  3PST A;  4CRX A;  3HX0 A;  4ECQ A;  5KFZ A;  5L1L A;  2HHV A;  9ICK A;  4KIT B;  5AI8 A;  3WK9 A;  7ICU A;  3KHL A;  4PL2 A;  4M6W A;  1M6Y A;  2E1F A;  5KNI A;  1ZQP A;  4MFA A;  3MBY A;  4B9U A;  5IIJ A;  5AHX A;  2FLP A;  2VKQ A;  3IDW A;  1NK5 A;  2RDI A;  4UB1 A;  5ALN A;  3GV5 B;  2IBK A;  3ALR A;  5ALG A;  4NLK A;  3MDA A;  2AU0 A;  8ICR A;  5DDY A;  3JPR A;  4EBD A;  1N48 A;  2FPL A;  3GV7 B;  4BWJ A;  4FZL A;  2ZIV B;  5DLG A;  5DB8 A;  2KZZ A;  2CPR A;  3NRW A;  4I29 A;  5AM4 A;  2ZIX B;  4YR3 A;  4I28 A;  4DL7 A;  3PO5 A;  5AKL A;  4I2A A;  5AK3 A;  9ICI A;  2HSZ A;  4UB2 A;  4JWM A;  1SL0 A;  2AQ0 A;  3M8S A;  1B4F A;  5J2G A;  2NV3 A;  5KFB A;  2KG5 A;  4O5E A;  5J0Y A;  1D8B A;  1QH9 A;  4P0P B;  2HHW A;  1PVQ A;  1RQL A;  9ICT A;  4RU9 A;  3JPN A;  1ZQB A;  5KG2 A;  2WF6 A;  3C5F A;  1O08 A;  2ZXH A;  3Q8Q B;  4YMO A;  3RFA A;  3V6H A;  1NZP A;  3T3F A;  1TV9 A;  1LB2 B;  8ICJ A;  4GFJ A;  5D49 A;  1WWU A;  5ALE A;  4KLD A;  5DG9 A;  1S0M A;  3ISC A;  2EH9 A;  4JV0 A;  4O3P A;  5DKW A;  1KW4 A;  2XY6 A;  3WKA A;  4UAS A;  1SB3 C;  4QW9 A;  2OM6 A;  3SQI A;  3RRH A;  4M2Y A;  4IRD A;  9ICC A;  1L7O A;  3NVV A;  3WK7 A;  3TAN A;  3EZ5 A;  5J0P A;  1ZJN A;  3PR4 A;  3OGU A;  4NL9 C;  3BZC A;  1BVS A;  2K8B B;  5ALY A;  4DLG A;  2WFA A;  1T8E A;  2KV2 A;  2BGW A;  2NRT A;  2R8G A;  2BQR A;  3ZDC A;  2EAN A;  2V4Q A;  2EDU A;  2Y1I A;  1Z1V A;  1IV8 A;  2LMR A;  4UQG A;  3M9N B;  4RT2 A;  4CGZ A;  4KLO A;  3Q8P B;  1TKD A;  4LVS A;  2YTU A;  2HBJ A;  4MF8 A;  1X9S A;  9ICO A;  4JMU A;  5HHH A;  1DK3 A;  2NRX A;  2VIX A;  5EE0 A;  5DB7 A;  2OEH A;  1L7N A;  4F92 B;  5K4L A;  4R65 A;  1VJ5 A;  1Z4O A;  2AHO B;  5KL1 B;  5CJ7 A;  5HMM A;  3KZX A;  3NUQ A;  1V85 A;  2JMG A;  5DLF A;  8ICT A;  8ICA A;  3MR3 A;  2FLL A;  5G5H A;  4DSI A;  1Z3E B;  1T3Q A;  3D6J A;  8ICU A;  1JUD A;  2ASJ A;  4UAW A;  2RP5 A;  3KKA A;  4CNQ A;  3S6J A;  3ZDD A;  2E8P A;  4RUC A;  2R18 A;  4UBC A;  4YXM A;  4IR1 A;  2KVC A;  3KOO A;  3PMN A;  5J2H A;  1ZQJ A;  4ECV A;  4RPY A;  5KT3 A;  2HBK A;  4FO6 A;  4J9K A;  8ICE A;  2W54 A;  2Y9T A;  3WK4 A;  2Y1J A;  2DPJ A;  7ICQ A;  4C7Z A;  1QLN A;  4US9 A;  3C23 A;  7ICT A;  2WHE A;  3ONN A;  3TQ1 A;  1NKB A;  4PHP A;  3GIM A;  2BPG A;  4XQ8 A;  2QB0 B;  1WYG A;  3U26 A;  1SL2 A;  4EZ9 A;  4KLL A;  2JZB A;  3BJY A;  2QLT A;  2ESE A;  2W9A A;  3TAD A;  5F3X B;  2ZIU B;  7ICK A;  1ARO P;  5AI9 A;  3DDH A;  4I2C A;  4I2I A;  4RPZ A;  4M04 A;  2D8C A;  1N2X A;  1XS9 D;  4FBT A;  3N7R C;  5T14 A;  1KRP A;  3UMB A;  5DQG A;  4F4W A;  4Y2S A;  4BGD A;  4CF3 A;  4RNN A;  3BDP A;  5EE3 A;  3WK5 A;  1OW5 A;  2F8K A;  3IM1 A;  2PI5 A;  4I2G A;  9ICN A;  4NJ8 A;  4JV1 A;  5KL8 B;  1DRG A;  2XCP A;  2C2E A;  3M7D A;  4ECX A;  5EWG A;  4B6J A;  5ALL A;  3UQ0 A;  5J2J A;  2R8J A;  4YVZ A;  3C1Z A;  1O03 A;  5KFG A;  4M9L A;  2RQ5 A;  2XY7 A;  1ZQW A;  4PGY A;  3SV4 A;  1MA7 A;  1ZQI A;  3N7S C;  1COK A;  4F93 B;  3DEE A;  5KG5 A;  2KFZ A;  1ZQV A;  3RR8 A;  2J6U A;  2ZJA A;  5KG6 A;  1GO3 F;  5J2D A;  3T5J A;  2KIC A;  4JWN A;  5KG0 A;  2BPF A;  1N60 A;  3M6Z A;  4F3O A;  9ICM A;  1KDH A;  1X9X A;  4I2E A;  1ZRM A;  4Y2V A;  4F2S A;  2ZIW A;  4O3S A;  2J6T A;  2HBM A;  2KHV A;  4F72 A;  5J2B A;  5DBC A;  3NVW A;  3T5K A;  5ALR A;  3ZI4 A;  1NK6 A;  4C0Z A;  5HHI A;  5EOZ A;  2YQE A;  7ICO A;  1LV5 A;  4NM1 A;  3UXP A;  3KBB A;  1A77 A;  7ICG A;  1L5U A;  4ECU A;  2V4R A;  4YCX A;  1PVR A;  3ICX A;  4BXO B;  2AQ4 A;  1U45 A;  2FMQ A;  5FP0 A;  3WK8 A;  3GIK A;  3K1Z A;  1Z19 A;  3AQE A;  5D46 A;  4PH5 A;  2W7P A;  9ICU A;  1L8L A;  2WF9 A;  1TAQ A;  5J0T A;  1IG6 A;  1ZQA A;  2FPM A;  5KG4 A;  2KZ3 A;  2VA8 A;  4R66 A;  1RG6 A;  4IQV A;  1NK4 A;  5KFY A;  4DWI A;  5L1I A;  2JRZ A;  1U49 A;  2ISO A;  2RDJ A;  1HIW A;  4GXK A;  4DO9 A;  4DFM A;  4QIW C;  2KEY A;  2F76 X;  4BUG A;  2RRD A;  8ICG A;  4C8O A;  2ALZ A;  2V9W A;  4J9R A;  4Z6E A;  5HR6 A;  4J9S A;  4Q8F A;  5J2K A;  2AGQ A;  4KLH A;  1DGJ A;  4JK1 A;  2IA6 A;  2IOF K;  3K4G A;  4DSL A;  4DS5 A;  2IOF A;  3PW0 A;  2D3D A;  4DQP A;  1ZD2 P;  3QU4 A;  3G6X A;  1K1Q A;  2KKV A;  5IIL A;  1CI4 A;  2HVI A;  4BX9 C;  2A1J A;  5ALP A;  5J0W A;  1X9M A;  1HEK A;  2DKX A;  1RXV A;  1MQ2 A;  2P6R A;  3MC1 A;  4ELU A;  3HIL A;  3OJU A;  1A0P A;  4I2D A;  5ALZ A;  4PHE A;  3RJJ A;  4P4P A;  1D8L A;  3A0H U;  3K75 D;  4RQ0 A;  5KT6 A;  2CRX A;  2AXT U;  1Y88 A;  2G08 A;  1JIH A;  1ZQO A;  4DOA A;  1Z00 A;  2PFO A;  1NK9 A;  2ZIV A;  3GIJ A;  5F9L A;  2XIC A;  2CXY A;  3AEV A;  3LWM A;  2ZIX A;  5AI4 A;  1QSS A;  2HOQ A;  4OJ5 A;  3KFU F;  3H8S A;  5J2C A;  1X6I A;  2YMM A;  3FYH A;  2OXO A;  3GQC A;  3M1Y A;  3TAP A;  2I9G A;  2IHM A;  4EEK A;  8ICX A;  2OCE A;  2KJ5 A;  1QQ5 A;  3L4P A;  3IP4 B;  2BQU A;  3V6J A;  4USA A;  5J8Y C;  3PNC A;  2LM1 A;  3A0B U;  3VC8 A;  9ICQ A;  1XO0 A;  1NJW A;  1QCK A;  4OJ6 A;  3TI0 A;  4M0A A;  5KFC A;  3LYS A;  3MAB A;  1Q46 A;  1SWV A;  4YQW A;  1KSP A;  4YR0 A;  5J0O A;  5KG1 A;  1KFS A;  5AM1 A;  1ZQK A;  7ICM A;  2EAM A;  1JN3 A;  3OHA A;  2ZG6 A;  1F5S A;  3E2E A;  4PHD A;  2C2R A;  3JPO A;  1SV4 A;  3LWL A;  4IR9 A;  2H3Q A;  5ALV A;  5DQH A;  4Z6C A;  2JHD A;  4F2R A;  3ISB A;  4CF4 A;  2JEJ A;  1SZP A;  3HW8 A;  1S97 A;  8ICB A;  3RAQ A;  3RJF A;  3I1Y A;  2IMW P;  4KTQ A;  1ZQG A;  9ICR A;  2ZTC A;  3H0R B;  4OCZ A;  3PX6 A;  1KBU A;  3RH5 A;  5KFN A;  3GII A;  3N97 B;  4O3R A;  2W55 A;  1SKW A;  2XO7 A;  3QZ8 A;  3PSF A;  8ICO A;  1L3S A;  5DDM A;  2ZUC A;  3IV6 A;  5GTI U;  2NRV A;  2K4E A;  4O3O A;  2PXI A;  2FE9 A;  4ED2 A;  4DLE A;  3MDC A;  4DQR A;  3PV8 A;  1NJX A;  1NK0 A;  4EEY A;  4O5K A;  1JI7 A;  2KIV A;  1LKY B;  3CW2 C;  3G6V A;  2YN4 A;  5J0S A;  5AKG A;  3GIL A;  4JV2 A;  4RQ5 A;  4Q8E A;  4F50 A;  4R63 A;  1ZQT A;  7ICH A;  4DQI A;  1K5O A;  4DCC A;  4OO1 J;  4DFK A;  4M9G A;  4ICA A;  3CYM A;  3NAS A;  1SXD A;  3OJS A;  2HCF A;  5JRT A;  5J29 A;  1JX4 A;  2DF4 B;  4UAT A;  4DL3 A;  2K60 A;  4QZG A;  2P66 A;  3SI8 A;  1ZQZ A;  4F8R A;  1TAM A;  5IIK A;  4J9N A;  2G0A A;  3D2N A;  4ECS A;  4EX7 A;  5TIS U;  4O9M A;  3SEN A;  4FZN A;  5AM2 A;  2D6F C;  1VLB A;  2W9B B;  1ZD3 A;  2ZUB A;  5KFQ A;  3EWA A;  3H4B A;  4RPX A;  3AN1 A;  4IC9 A;  3TAC B;  1A76 A;  1UT8 A;  1BPY A;  2DBY A;  1HUO A;  1MC8 A;  4I2B A;  3AMZ A;  2Z7J A;  2HHX A;  4QWD A;  4PPX A;  4KLM A;  3D2Q A;  1ED1 A;  2XI9 A;  1F44 A;  4KLI A;  1NJZ A;  2YML A;  4KLQ A;  3RJI A;  3HKZ C;  4KN4 A;  2OHF A;  1XSN A;  1KN5 A;  2F44 A;  2QB0 A;  2XCA A;  2OWO A;  4DSJ A;  2BZF A;  3EPI A;  4O3M A;  3V7K A;  2JXJ A;  1KL9 A;  5CA7 A;  2ZIU A;  3H0L B;  5CP2 A;  5KG3 A;  2A19 A;  3WKB A;  1WCN A;  2W3R A;  4YFK A;  3RJE A;  2EZY A;  5AM5 A;  2GO7 A;  2FDR A;  4EZ6 A;  5A0L A;  5L1K A;  4ED3 A;  1B43 A;  5CEH A;  1XSL A;  5HP4 A;  3QX7 A;  4QW8 A;  2G5I B;  2WF5 A;  1SZH A;  3F53 A;  1ZQR A;  4YD2 A;  4U7C A;  1BPD A;  2QKQ A;  1Q3V A;  4P0Q B;  1CRX A;  2H3Z A;  4K4G A;  5KT5 A;  1NKC A;  2KD1 A;  1S0N A;  4GXJ A;  4KLJ A;  4G9B A;  3TFS A;  1NNL A;  2BCS A;  5DGA A;  7ICI A;  5J8Y A;  4FS2 A;  3SD7 A;  4DF8 A;  1U4B A;  2LHT A;  2RLT A;  2FMP A;  3G6Y A;  5KFI A;  4QIW F;  2MAX A;  4MHV A;  3QXG A;  3M6K A;  1P7D A;  1FIQ A;  4YD1 A;  4DQS A;  4B9V A;  2K4P A;  2DFL A;  1QTM A;  2MU2 A;  1UCV A;  3BQ2 A;  3UXO A;  4J9O A;  4BJQ A;  4RQ2 A;  7ICP A;  1N63 A;  2JGA A;  4ZOH C;  1CEZ A;  4OJO A;  2F77 X;  2Y0S C;  2K4H A;  7ICJ A;  3PR5 B;  3GDX A;  4Z6F A;  4RZR A;  1DXS A;  3Q8K A;  4EYI B;  2HHQ A;  2KKP A;  3GFK B;  3CRX A;  4BXO A;  3LDA A;  5KFW A;  3QEB Z;  4QWC A;  4NLN A;  4K4I A;  1RXW A;  1ZJM A;  2K8A A;  2LI6 A;  2H3I A;  3ETR A;  3PZP A;  2R8I A;  4TUP A;  4QZ8 A;  1BPZ A;  5AKI A;  1UQV A;  3SAH A;  1SXE A;  5IIO A;  4GXI A;  2NRW A;  1X2I A;  1X6J A;  2ZJ5 A;  1T94 A;  3Q8S B;  2EZZ A;  2KTQ A;  5AM3 A;  3F5A A;  5B5E U;  5KFF A;  3QZ7 A;  3SMV A;  5AKH A;  4MFF A;  4ED8 A;  5DBB A;  4Y2J A;  2LYB A;  4B9S A;  2MRL A;  5CB1 A;  5KFH A;  2ES6 A;  4DSE A;  2IOH A;  3KZI U;  3SEI A;  4EEN A;  2AGO A;  3JPQ A;  1S5L U;  2JV3 A;  4DL6 A;  2E3T A;  2CN1 A;  3PML A;  4DFD A;  1XO1 A;  3KD3 A;  1URJ A;  3RH4 A;  2C2D A;  2C28 A;  3PW5 A;  4M9H A;  2KHQ A;  4NLZ A;  3BQT A;  1BNO A;  8ICI A;  3MFI A;  2NO5 A;  5CWR A;  1ZQN A;  2F1I A;  4Y2P A;  4RQ7 A;  9ICF A;  2W8K A;  1V9P A;  2KVS A;  3RB4 A;  1PK1 A;  1B22 A;  4KX5 A;  1NK8 A;  2JEG A;  1QSL A;  2F3N A;  4F4X A;  4KN7 A;  8ICP A;  4GC6 A;  3THV A;  2KNJ A;  4F5R A;  1SV0 C;  4I2H A;  3C5G A;  5J2F A;  5JUM A;  4MEX A;  3EPG A;  1L7M A;  5AKK A;  5D4B A;  2K8C B;  3OSP A;  1T4G A;  2OH2 A;  5CR0 A;  5TZV A;  4DSF A;  3RR7 A;  1JXL A;  2W43 A;  2FPK A;  5KFL A;  2YB1 A;  1JAL A;  3HT3 A;  1SIJ A;  4DSK A;  3FAH A;  8ICK A;  4R8U B;  1MSW D;  1N5X A;  3N28 A;  2E8O A;  9ICL A;  2Q0Z X;  2LYH A;  1L3U A;  2AJQ A;  1B0X A;  2KIW A;  2UVW A;  4NL9 A;  3NRZ A;  4KMU A;  4PZN A;  1PVP A;  3QU7 A;  3FM9 A;  4UB3 A;  3IG8 A;  5KFA A;  5KFX A;  5L1M A;  1ZD5 A;  5ALM A;  3Q8L A;  4F5O A;  1U48 A;  4XA5 A;  4DOB A;  2VA2 A;  4UAZ A;  3QUB A;  2KE7 A;  1MN8 A;  4QZC A;  4XRH A;  2PKE A;  5DGB A;  3PW2 A;  3LVV A;  3V7J A;  1ZQU A;  1L3T A;  4PHA A;  3HJE A;  4C8N A;  9ICA A;  4BDP A;  3BQ0 A;  3BQ1 A;  1RYS A;  2XGP A;  3RBE A;  1IXR A;  3KHG A;  2L5Y A;  3BZK A;  3H8J A;  3UPQ A;  3SYZ A;  4B9L A;  3WKD A;  4U6P A;  1AQ6 A;  4F91 B;  4PJ0 U;  1ZQF A;  1JXE A;  3H0M B;  2MUT A;  2XGQ A;  1X42 A;  5KT7 A;  2YX8 A;  4UAR A;  4O0I A;  5IIM A;  5HNK A;  5AIB A;  4UAY A;  2WAQ C;  3Q8M A;  4RQ4 A;  4DFJ A;  1LKY A;  4C8K A;  3HKZ F;  4NV0 A;  4KLF A;  3QEA Z;  1WCL A;  2R8K A;  8ICN A;  5AK6 A;  5ALO A;  4IQW A;  2K89 A;  3EUB 2;  4Y2Q A;  5H2F U;  4NLC A;  3RF9 A;  5J0X A;  3AU6 A;  3KHR A;  3MGI A;  4DEZ A;  4UB6 U;  2WB1 C;  3BS5 B;  3GZF A;  4ED7 A;  2HVH A;  5HML A;  5C5J A;  2N1R A;  3LVW A;  5AM0 A;  4I27 A;  1N56 A;  1SGG A;  5C0Y A;  5EWE A;  4R64 A;  1ZQD A;  4IQU A;  5AIA A;  1JRO A;  5EE1 A;  4RNO A;  2HMX A;  1TE2 A;  2RHF A;  3MR6 A;  4P4M A;  3BQ7 A;  5DB9 A;  2B0C A;  3NVY A;  3C2L A;  3UXN A;  2W9B A;  5KT4 A;  4NLG A;  2I5H A;  4P0P A;  3JPP A;  3WU2 U;  1CUK A;  4AYB F;  4Y2X A;  1S9F A;  3ISD A;  4F5N A;  2FJ6 A;  3KHH A;  2WTF A;  1UT5 A;  4UBB A;  2MSN A;  7ICN A;  1J97 A;  2XY5 A;  3HRD D;  1T7P A;  3PSI A;  4YXJ A;  5F9N A;  5ALH A;  2M0N A;  1S8O A;  3IRU A;  1KTQ A;  1BPE A;  1XSP A;  3TAQ A;  3C21 A;  2P6U A;  4A8E A;  1ZQH A;  4C8L A;  2W3S A;  1J2N A;  3FDS A;  3OSN A;  3PVX A;  4RQ3 A;  1ZRN A;  3K1R B;  3PX0 A;  1YZ6 A;  2ATL A;  1V38 A;  1ZQQ A;  3T5H A;  4UAU A;  4Q44 A;  2G09 A;  2A1A A;  3RH6 A;  3KKA C;  3V72 A;  1KEJ A;  1XC9 A;  3O0F A;  2M9N A;  4PGX A;  2Y0S F;  2G07 A;  2OYY A;  5AI0 A;  2PMZ F;  8ICS A;  4I2F A;  4ECT A;  5KFP A;  4NM2 A;  4UW9 A;  4DL2 A;  4EBE A;  2ZTD A;  2ZUD A;  4P0Q A;  1RYR A;  1S0O A;  2XC9 A;  4Y2U A;  3SZ2 A;  4CF5 A;  4CE6 A;  4M9N A;  1N5W A;  3BS7 A;  3L5K A;  5AK5 A;  5BOL A;  2HI0 A;  2DQN B;  4KLS A;  4EEL A;  4F4Y A;  2DGZ A;  2QAR B;  1QQ7 A;  1J2M A;  1ZQE A;  1D9F A;  2A1J B;  2GOL A;  2EZX A;  2WF7 A;  4J03 A;  1QQ6 A;  4IRK A;  3TAD C;  2BCR A;  5AI6 A;  8ICZ A;  4O3N A;  2BKE A;  5J0R A;  4MEY A;  3Q8R B;  2HHT A;  4IRC A;  8ICV A;  3QUQ A;  4P2H A;  4X5V A;  3I28 A;  4NLB A;  2KMD A;  1XNS A;  4LZD A;  4FE3 A;  4J9P A;  3H40 A;  4KX3 A;  1Z00 B;  1KFT A;  1DGS A;  2PI4 A;  4RQM A;  2KSO B;  2BR0 A;  3ZDE A;  4HAI A; 
#chains in the Genus database with same CATH homology
 1F0M A;  1PK3 A;  3HIL A;  2F3N A;  5KNI A;  4RQN A;  2B6G A;  2QB1 A;  3K1R B;  4NL9 C;  1DXS A;  2F44 A;  2QB0 A;  2EAP A;  1SV0 C;  1V38 A;  3IDW A;  1WWV A;  2QB0 B;  2FE9 A;  3KKA C;  2EAO A;  2EAN A;  1LKY A;  1Z1V A;  1X66 A;  2LMR A;  2ESE A;  3TAD A;  5F3X B;  2Y9U A;  1JI7 A;  2KIV A;  2DKZ A;  1LKY B;  3BS5 A;  2D8C A;  2LPE A;  2YTU A;  1UQV A;  3H8M A;  1SXE A;  1B4F A;  3BS5 B;  5J8Y C;  1OW5 A;  2F8K A;  2KG5 A;  5JTI A;  4NJ8 A;  1RG6 A;  1V85 A;  2E8O A;  2QKQ A;  1SGG A;  1SXD A;  2DL0 A;  5JRT A;  4PZO A;  3BS7 A;  2GLE A;  2EAM A;  1B0X A;  2QAR A;  2K60 A;  4NL9 A;  3BQ7 A;  1SV4 A;  1SV0 A;  2E8N A;  5JU5 A;  2QAR B;  4PZN A;  2ES6 A;  5L1M A;  3SEI A;  5J8Y A;  2E8M A;  1OXJ A;  1COK A;  1WWU A;  3KKA A;  2JV3 A;  3SEN A;  3TAD C;  2E8P A;  2KE7 A;  2D3D A;  1PK1 B;  1X40 A;  1KW4 A;  4MHV A;  3TAC B;  2K4P A;  2KMD A;  2KSO A;  1X9X A;  1UCV A;  2L5Y A;  2DKX A;  2Y9T A;  4RQM A;  1PK1 A;  2KSO B;  4IS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...