1UQVA

Sam domain from ste50p
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
GSHMNNEDFSQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDSKLEWKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords STE50 PROTEIN
publication title Structure of the Sterile {Alpha} Motif (Sam) Domain of the Saccharomyces Cerevisiae Mitogen-Activated Protein Kinase Pathway-Modulating Protein Ste50 and Analysis of its Interaction with the Ste11 Sam
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2003-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09235 SAM_Ste50p Ste50p, sterile alpha motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1uqvA00
2EANA 2DL0A 2E8MA 1UCVA 1WWUA 4NJ8A 1KW4A 2KG5A 3IDWA 2DKXA 3BS7A 3KKAA 2K4PA 2QARA 2F3NA 2D8CA 1LKYB 1OXJA 2YTUA 4RQMA 1UQVA 2EAOA 2LPEA 1OW5A 3K1RB 2K60A 2LMRA 2KSOB 4IS7A 2KIVA 2ESEA 3BQ7A 2D3DA 5KNIA 1Z1VA 5L1MA 2QB0B 4PZNA 1LKYA 3SEIA 5J8YC 5J8YA 1V38A 3TADC 1PK1A 1PK1B 2E8NA 3TADA 2FE9A 2DKZA 2L5YA 2GLEA 2E8PA 2KSOA 3H8MA 4PZOA 1X40A 5F3XB 2Y9UA 1COKA 2Y9TA 1SV0C 3BS5B 2ES6A 1B4FA 1PK3A 2QB0A 1SV0A 4MHVA 2B6GA 1JI7A 1DXSA 2KE7A 4RQNA 4NL9C 2QKQA 3TACB 4NL9A 1SXDA 5JU5A 2QB1A 1SGGA 3HILA 1X66A 2EAMA 2EAPA 1SXEA 3KKAC 2JV3A 2F8KA 2KMDA 1RG6A 2QARB 3BS5A 1X9XA 1F0MA 1V85A 1WWVA 5JTIA 1SV4A 2F44A 5JRTA 2E8OA 1B0XA 3SENA
chains in the Genus database with same CATH superfamily
4CF3A 2HVIA 5ALUA 1BVSA 4PH5A 2W9BA 3KHHA 4F92B 1QQ5A 4DS4A 3T3FA 8ICWA 3OSPA 4BDPA 3AU2A 4K4GA 3B9JA 4YMMA 4ECTA 1ZQAA 1N61A 4KTQA 4DL5A 7ICNA 1ZQQA 4TQRA 5IIKA 1S77D 2P6UA 3HKZF 3G6YA 3QE9Y 2ZUCA 4P0QA 3GV7B 4RQ3A 2W7OA 5J0OA 3D2NA 4PZNA 2IOHA 2ALZA 3AU6A 1TFRA 7ICHA 4BXOA 3UXPA 3C2LA 2DKZA 2FPMA 1U47A 1KDHA 5F9LA 3SAGA 5AIAA 1ZD3A 2Y9UA 5AK3A 4JV0A 4QZGA 3AQEA 2HVHA 1ZQYA 2EZXA 4DQPA 1SZHA 5ALTA 1L8LA 2UVUA 4P0PB 8ICUA 1ZQIA 2OWOA 4UATA 1O03A 2ZIUA 4CGZA 5KAFU 1SL2A 1S9FA 4KX3A 1D9DA 2ZTDA 5J0TA 5EE0A 4EYHB 5AK6A 4B9LA 4J9LA 3KKAC 3QUTA 4DFKA 5DBBA 4NM2A 4QZFA 2CN1A 3PW7A 3UQ2A 4IRDA 3Q8KA 1Z1BA 5CP2A 4J9PA 3RJIA 5K4LA 5HR6A 3PSFA 3HT3A 5KFCA 5AI5A 4MEYA 8ICSA 4F2SA 2ZUBA 4QZIA 2ZXIA 3MABA 2VJ4A 5KFMA 3KTQA 5AKGA 5EE1A 1ZRMA 2AXTU 2AGOA 5G5HA 1L3VA 5BOMA 4LJXA 1RXVA 3RB0A 2BR0A 4DFMA 3K1RB 2W9MA 3QU4A 4PHEA 3HJEA 1N56A 1S5LU 5DDYA 4I2CA 2XIDA 4DSLA 5ALKA 3BQTA 5IIOA 1J2MA 3WKAA 4GC6A 2XCPA 3RB3A 2KKPA 2DUYA 3QX7A 4I2AA 5ALJA 2AGQA 3M7DA 4UB1A 4FO6A 3TI0A 3PX4A 2JZBA 4ECVA 1ZQCA 4Q44A 1BPDA 1PK1A 2HDOA 4PHPA 1ZQZA 1Z4NA 2QLTA 4NLNA 4R8UA 2LYBA 3H8MA 4PZOA 3WK7A 2WF7A 1O08A 5KFTA 2N1RA 5KFEA 2A1JA 3WU2U 3UMGA 3PZPA 2HHWA 4DL2A 2VJ5A 2J6SA 1X42A 4DFJA 3QNMA 2OH2A 4LZDA 3GQCA 5A0LA 2BQUA 9ICOA 2HHVA 3L3FX 4UAUA 5DQHA 2G06A 2K8CB 3RTVA 2HHTA 1SXEA 2MAXA 3RRHA 4QZEA 1NJXA 5AICA 3ZDCA 4Y2XA 3WK8A 2HOIA 1DRGA 5J2FA 3QZ7A 4U7CA 2O6KA 2LM1A 8ICEA 5AKJA 5D49A 1RPLA 2OXOA 4QZHA 2G09A 3D2QA 3BDPA 3UMBA 3EPIA 1NJWA 3TKAA 2KKVA 1HJPA 4OJ6A 4C7YA 3C28A 2PFOA 4A8EA 1A0PA 1X2IA 3UXOA 4EENA 2ZIXB 3V6KA 3LVWA 4ED8A 4AYBC 3LVVA 4RUAA 1UQVA 1LB2B 3A0BU 4UQGA 1L7NA 4OCZA 1OW5A 1KQQA 4ED1A 4QZBA 1QSSA 5KFDA 3NVVA 2LBOA 3LK9A 4Q8EA 1D8BA 5AK4A 2ESEA 1NKEA 1ZQ1C 2F2AB 1ZD2P 3ZI4A 5KT5A 1ZQFA 2D3DA 1Z1VA 4EEYA 4UAVA 4MFCA 3SEIA 2F77X 1XS9D 3U26A 5C5JA 4QZAA 5ALQA 4EZ9A 4Y2JA 3CRXA 4FZNA 2ISOA 2EZZA 4YR3A 2ZUDA 7ICGA 1XWLA 2JHDA 2G5HB 3SQIA 1COKA 4J9QA 4OJLA 3HP6A 1QSLA 2HOFA 2IHNA 4Z6DA 1NK5A 1ZQUA 1SV0A 2YMQA 4RQ6A 3M1YA 1Q3VA 1NZBA 3N97B 1UT5A 1NJZA 1NK9A 1QQ6A 5ALRA 4JV2A 4TQSA 2FPLA 3VC8A 1TV9A 1ZD4A 4OO1J 4F4ZA 2KN7A 1XU4A 3IG5A 4F4XA 3SD7A 1RG6A 8ICKA 2B0CA 5DG8A 4YVZA 2NO4A 1F5SA 1SL1A 4YCXA 5ALZA 2ODGA 4F4YA 3PX0A 1ZETA 2KEYA 2WF9A 8ICMA 1RQLA 3RH6A 2W9BB 1MQ3A 2UVWA 2H3VA 5ALFA 2HBKA 3ORYA 1ZOLA 1QSYA 4DSIA 9ICMA 3ETLA 4GIBA 2A19A 4KLUA 3RRGA 4C4RA 2KSOB 1SL0A 2XCAA 2KIVA 1KRPA 3MFHA 2Y1JA 2BPGA 4CDGA 4P0QB 3CNHA 4UAYA 4I2DA 4YQWA 3I1YA 3FYHA 3HRDD 2K4IA 2ATLA 3M6KA 2JXJA 1K1SA 1FFUA 2OYYA 2IOFK 3BJYA 2H3ZA 4G9BA 3SAHA 4M04A 5F3XB 1SKRA 1ZRNA 5J29A 4EZ6A 4UW9A 3ISBA 3BS5B 7ICOA 2ZJ8A 4M9HA 3EWAA 4ED3A 5CJ7A 3GILA 2K4HA 5KFHA 3ZDBA 2A1AA 2ZIUB 4QW8A 4PPXA 5KG0A 1P7DA 4GXKA 1TK5A 3TFRA 4F5OA 5KFNA 1RDFA 1TAQA 3Q8QB 2Y1IA 2B21A 2W9AA 4ED0A 1PVPA 1X6JA 2R8IA 2KJ5A 5J2AA 5ALLA 5ALDA 1WCLA 4I2HA 1SWWA 4F8RA 1A77A 2RLTA 4RT2A 4UBBA 4KLIA 2HHUA 2BQRA 4I2JA 5J2DA 9ICBA 7ICMA 4UB5A 3ETRA 3PY8A 2E8MA 5F9NA 2JRZA 1JX4A 7ICJA 4EBCA 3TARA 2KHQA 2VANA 4DEZA 2W03A 2DF4B 1CEZA 2F3NA 3H8SA 5AKXA 3MBYA 2CXYA 4GC7A 1UT8A 2HOQA 4MFAA 5ALXA 1HUOA 4F3OA 2VA2A 4YN4A 5KFXA 4JWNA 1XSNA 3H0LB 4Y2SA 4O3QA 2MSNA 1BNOA 5AI6A 3KFUF 2KJ9A 2DGZA 3BQ2A 2KK0A 4NY8A 4RUCA 4IQTA 3PO5A 2AU0A 2JZBB 1PK1B 2WF6A 1ZQGA 4PHDA 5KFSA 4R8UB 3SMVA 2C2DA 2D6FC 4RQ7A 4Y2YA 2KFNA 3E58A 4AYBF 2IMWP 1VDVA 2A1JB 4KN4A 4NL9C 1ZQXA 4NLKA 3LWMA 2LI6A 3CP8A 1COOA 3HILA 2LYAA 4UAZA 2I9GA 1T7PA 1PVRA 1D9FA 5EOZA 4RQ4A 1LVHA 2NRXA 2YQEA 4O5EA 4F2RA 3WK9A 3ISDA 3AMZA 5KFPA 3JPNA 1X9XA 8ICVA 2W04A 3BQ0A 5ALOA 3Q8LA 5AKEA 4Z6CA 1QQ7A 1S10A 2JEIA 3IHQB 3RH4A 3KHRA 4F5QA 4RQ8A 5KFQA 9ICEA 2W11A 4UARA 2ZTEA 4IQWA 4MFFA 5J2EA 1CI4A 4IC9A 5KFUA 2KNJA 1YZ7A 3LYSA 1T94A 3C2MA 4C4TA 2I6XA 5KG2A 1J97A 3KZXA 1RYSA 8ICLA 4US9A 3IV6A 5ALSA 4KLDA 5AM3A 1TAUA 2KICA 4PHAA 2PFPA 1S76D 2R8HA 3ZDAA 3GU3A 2KHVA 4DOCA 3UPQA 2PKEA 3V6HA 1N60A 2BPCA 3TADA 2HHSA 5J2JA 5J2HA 3V7JA 4DL6A 2OEHA 4P4OA 3E2EA 3IP4B 2KSOA 3ONNA 8ICOA 2UVRA 9ICTA 1X40A 4RU9A 1SKWA 3H0MB 4QWEA 4XRHA 4O9MA 1ZQNA 4C4SA 4I2EA 1CUKA 2FLLA 2FMPA 4EX7A 3F2DA 4QWAA 4GXJA 5J2IA 3L5KA 2E5SA 1JI7A 3OHBA 2A3VA 2IHMA 1SWVA 2K89A 2BCRA 2YB1A 1DOQA 1IG6A 4I2FA 4KLHA 3ZDDA 3K4GA 3S6JA 1Z19A 2R18A 2GH1A 1FIQA 3BS5A 4JUZA 1ZQVA 5HNKA 8ICFA 2YX8A 2HBMA 2G07A 2PFNA 5JRTA 2Y0SC 1B0XA 3SENA 5KG1A 4G3IA 8ICHA 2KFZA 1UCVA 1SKSA 4NWIA 5ALPA 1V9PA 3T5LA 4B9MA 4RQMA 3MGIA 2LPEA 1JALA 1L8OA 4M0AA 2DPIA 5ALVA 1UPHA 4ZOHC 2DPJA 1KN5A 4IR9A 2YN4A 3C21A 4JB3A 4TUSA 4ELTA 5GTIU 1ZD5A 4GFJA 2KZZA 1BPYA 1Q3UA 2PMZC 2NRVA 5KT7A 4K4IA 1L6NA 3RJHA 1L7OA 2I1QA 4DS5A 2L5YA 4EX6A 4B6JA 3RBEA 4ED2A 3PSPA 2XGPA 4J9RA 5KFWA 4RNNA 3HW8A 3SI8A 1C7YA 5B66U 4FS1A 4QIWF 5DB8A 2P66A 3F2BA 3RBDA 2W7PA 1B4FA 3PNCA 1XO1A 1ZXIA 1M6YA 2W43A 2K8AA 1JROA 3PX6A 1XSLA 2F1HA 4KLLA 4KLOA 5AKHA 1T3QA 3KD3A 3LDAA 4QZCA 5ALIA 2KZMA 1KFTA 2JEFA 2GOLA 4RT3A 5KG6A 1JXLA 3N7SC 4I28A 1YZ6A 4TUPA 3OJSA 4C8NA 4Z6FA 1F0MA 2JMGA 1B43A 1NNLA 2FDRA 1V85A 3T5KA 4F5PA 2DFLA 1SV4A 1NKCA 3TAPA 4FBUA 1ZQWA 3O0FA 4PGYA 2KJ8A 4CCHA 4KLJA 3V6JA 5HR7A 4C7ZA 5L1LA 2C2EA 3JPSA 5KAIU 5KFRA 2K60A 1RZTA 4C80A 4ECYA 3PSTA 9ICAA 4JK1A 4UB4A 4J9SA 2OHFA 4R65A 4O3NA 1NK8A 1HUZA 3GV5B 5J0UA 1T3NA 3WKCA 1ZQBA 8ICZA 2C2RA 4CF5A 2DWQA 2NYVA 3V7LA 3N4MB 5IINA 4J03A 2BCVA 4DSJA 3C5GA 3HPOA 3WK6A 3JPOA 3EUB2 5CR0A 4Q8FA 3RJFA 5IIMA 8ICAA 5HMLA 2RQ5A 2ZIWA 4O3MA 3C23A 1U4BA 1ZQHA 3MR2A 2YMMA 2B6GA 5J0RA 4YFKA 4Q45A 1DXSA 1KKXA 2QKQA 3ALRA 4QZ9A 3JPQA 4QW9A 4DOAA 2KD1A 3RAQA 2G0AA 1T4GA 2WB1C 4CRXA 4YR0A 5KG5A 2EAPA 9ICCA 4RQ1A 4FZMA 1S0MA 2LHTA 1C20A 2HHXA 3AEVA 2QARB 4Y2TA 3G6VA 1HEKA 9ICIA 4R63A 2ASDA 1ZQEA 4U6PA 2DBYA 1XNSA 3AL0B 1WWVA 2WTFA 4CF4A 5AI0A 4RQ2A 8ICXA 3H7IA 1NK4A 4BWMA 2XI9A 3R9KA 3M8SA 3K1ZA 4KLTA 1KW4A 5DB6A 4X5VA 7ICTA 1BPXA 2K4PA 2YMPA 4DO9A 4ACOA 4M2YA 3L4PA 1OXJA 4DFPA 4QWCA 4B9TA 4OJ5A 4DOBA 3PVXA 1XO0A 2UVVA 4NV0A 4QWBA 4I27A 4ELVA 1T8EA 1K5OA 4RPZA 3NGDA 4UB3A 5KFYA 3M9NB 1UHUA 5TZVA 5EE9A 5KFLA 3WK4A 1IIPA 3BZKA 4TURA 3KBBA 5DB9A 5KNIA 2WAQC 5J8YA 2ZJAA 1UA1A 3ISCA 5AI8A 7ICKA 3NRWA 4C8KA 5ALYA 4Y2UA 1NK0A 3QU2A 5KG3A 5H2FU 5AKKA 2AQ0A 4XUSA 4QZDA 5L9XA 5AI4A 3OPXA 4MF8A 2HBLA 1L3SA 4ECUA 4CNQA 3TANA 5CRXA 4RQNA 5EWFA 4HAIA 2JR5A 3TACB 2HBJA 3SZ2A 2JEJA 5DLGA 3MGVA 1SB3C 1ZYQA 3C2KA 1EXNA 4OJPA 3F2CA 2NRZA 3UM9A 5AM4A 3JPRA 2NRWA 2XY6A 5IIJA 5KG7A 2PMZF 3H4BA 5HHIA 5DBAA 1H38A 2OCEA 4KMUA 4DL7A 7ICVA 4O5CA 3EW9A 1NJYA 1KFDA 1URJA 3N7RC 4O3SA 4BX9C 4LVSA 4JMUA 2DL0A 4PL2A 1ZJNA 3QU7A 4ELUA 4M9NA 3MDAA 1ZQOA 5L1JA 1X9MA 4UB6U 2WFAA 8ICTA 1L7MA 4ECSA 4OD0A 1LKYB 5AKYA 3H40A 3IG8A 3RAXA 1Y88A 2EAOA 3I28A 2VA8A 3C1YA 4O3OA 3THVA 2AQ4A 1JXEA 1L3TA 4JV1A 2ASLA 4DLEA 3AUOA 3GIKA 2W55A 5EWEA 4FFDA 3OJUA 2FLPA 3AN1A 4OJOA 3QZ8A 1V38A 1RQNA 3UQ0A 8ICRA 2ISPA 5AM2A 4Y2VA 2E8PA 5IILA 2HCFA 3OGUA 1N48A 1U9LA 3QUBA 1BGXT 3RJJA 7ICSA 3NS1A 2RP5A 2BCQA 1SV0C 2JEGA 1PK3A 1QCKA 4IQUA 3QYPA 2Q4TA 4MHVA 2LM4A 3NTUA 4RQ0A 3MC1A 3RJKA 1SXDA 1OUQA 2W3SA 5J2BA 3FM9A 4O3RA 5KL8B 1X6IA 3PMNA 7ICLA 3KZIU 4BJQA 4BUGA 3TAQA 4J9OA 4ICAA 2BGWA 2ZG6A 4B9SA 5FP0A 3GIIA 9ICNA 5J0PA 2ZJ5A 2P35A 3OSNA 3JPTA 4KX5A 4F5RA 1LV5A 5DGAA 2Q0ZX 3H0RB 2E8OA 1D8LA 2EANA 1JUDA 3QUCA 2F8LA 2FI1A 2KIWA 9ICGA 3DDHA 4US8A 2PXIA 2QARA 4M9JA 3Q8RB 4DCCA 5J0YA 5ALMA 1RXWA 2WB1F 5AKIA 1JMSA 4YMOA 1Z00A 2LMRA 5J2CA 1MC8A 1AQ6A 1KFSA 4Y2PA 2FMSA 7ICFA 3C29A 4IL6U 4QNLA 4KITB 3RH5A 5BOLA 5L1MA 2EZYA 2AH5A 5KFIA 3AQFA 2VA3A 4QWDA 2BCUA 2XC9A 3ZD9A 1AROP 5D46A 2E3TA 8ICIA 1WUDA 2WHEA 3BQ1A 4I2IA 3M9MB 2ZXHA 5AIBA 4F71A 1BPZA 4M47A 4EBEA 4NLBA 2ZIWB 2Y9TA 2V4QA 1WG8A 4DLGA 3GFKB 1L5UA 3QEAZ 4P2HA 4UBCA 5HP4A 4EBDA 4I2BA 1TE2A 2VKQA 1X66A 3PR5B 4YD2A 4EEKA 3NUQA 3KHGA 4ECWA 3LWLA 7ICPA 5KFOA 5DG7A 4Q43A 1RYRA 2WAQF 1SIJA 2KVSA 1QLNA 2M0NA 2I5HA 3NASA 5E79U 1ZQDA 7ICRA 4K4HA 9ICHA 3RJGA 1TAMA 3CYMA 3PW0A 2P6RA 4DSEA 4J9MA 1L3UA 3HWTA 2J6TA 1ZQTA 4FS2A 1KBUA 2MUTA 2W3RA 5AI9A 3PW5A 3M6ZA 2EDUA 3EPGA 2R8GA 4CE6A 1B22A 9ICWA 3D2SA 4MEXA 2E1EA 1XC9A 1S0OA 2F76X 1S0VA 2JGAA 1L7PA 5ALEA 2Z7JA 5EWGA 5KFBA 2PI4A 3G6XA 3WKEA 2F1JA 4NM1A 4BGDA 3J81j 5G5GA 7ICUA 1NK6A 5DB7A 2BKEA 4R64A 2KV2A 1LKYA 1QH9A 2BDUA 1U49A 2XO7A 5AM5A 3RF9A 1NK7A 2GLEA 3RFAA 2KZ3A 4F93B 5KT6A 3MR3A 4I29A 1GO3F 9ICLA 3N7PD 2JH1A 2ZIVA 2ASJA 4HYKA 1ZQJA 4YD1A 2XVTA 2KVCA 3I76A 2ES6A 5EE3A 1ZQLA 5CWRA 1N62A 5AKLA 4RNMA 4IRKA 3H8JA 1NOMA 3OTQA 4KLMA 1FFVA 2MA1A 3BZCA 3FC4A 5KTQA 4EYIB 1ECWA 9ICVA 3Q8MA 2C28A 4DL4A 2AJQA 2MU2A 2JV3A 1UA0A 3T5HA 3AM9A 1PVQA 1YT3A 4NLZA 9ICPA 4DQIA 1PZNA 5KT4A 4FE3A 1CRXA 4YG2A 3MR5A 3PV8A 4DSKA 2OM6A 1JRPA 3IN5A 2V9WA 9ICQA 4DF8A 4NLCA 5KFJA 3NVYA 1X9SA 1U48A 3NVWA 1MSWD 5D4BA 1DGSA 4B9VA 3OHAA 2XGQA 2C22A 1DK3A 3H8WA 1ZQMA 3V7KA 2W54A 3BQ7A 4IRCA 3KHLA 4FZLA 2QB0B 3C1ZA 3F53A 4XQ8A 5AHXA 3TADC 5DLFA 5DQIA 4WJ3B 2XY7A 1WYGA 3N28A 5HMMA 1TK0A 4GXIA 1Q8KA 4I2GA 1SZPA 1X9WA 4PGXA 2JH7A 7ICIA 5J2KA 3V72A 4QZ8A 4KLQA 3PW2A 1IM4A 1KEJA 2YMLA 1NKBA 1N5WA 1QTMA 5ALGA 4C0ZA 3Q8PB 3RB6A 2QB1A 3GZFA 2R8KA 2YY6A 3MFIA 2R8JA 4NXZA 4PJ0U 3CW2C 5DGBA 4KMOB 2LYHA 1S97A 2F8KA 3K75D 3PW4A 4MF2A 8ICGA 2W9CA 3RR7A 1FEZA 4UB8U 3ED5A 2G5IB 3C5FA 2IBKA 1VJ5A 2RDIA 4C8MA 2PI5A 3ICXA 2IOFA 2BQ3A 1PUZA 2EQYA 5ALNA 2FMQA 1WWUA 4NJ8A 3TFSA 2CRXA 2RRDA 2HW3A 4PL1A 1S8OA 4O0IA 9ICSA 4UB2A 7ICEA 5KT3A 2YTUA 1XSPA 4ED6A 2BDPA 1N63A 3SV3A 2BZFA 2XICA 3B0YA 1ZQRA 2YB4A 4M6WB 4F72A 5ALWA 1Z00B 2ZTCA 1MN8A 4F5NA 1NI3A 3PO4A 5ALHA 3H4DA 4QJFB 2H5XA 1BNPA 5CA7A 2RDJA 2AGPA 4RQ5A 2E8NA 4ECXA 3MDCA 2HHQA 3HX0A 3UXNA 2K4EA 3QU9A 4M9GA 2FPKA 5AKZA 3UMCA 5AK5A 4DQRA 4ECRA 1ZQSA 5IIIA 1ED1A 5DG9A 2DQNB 2KE7A 3JPPA 3TQ1A 3KOOA 2HMXA 3F5EA 4P0PA 4NL9A 4XA5A 5GTHU 2Y0SF 2XY5A 2EAMA 3EZ5A 1MA7A 3RR8A 2K8BB 2BPFA 5KG4A 4F91B 3MR6A 4USAA 2FLNA 5JUMA 3HKZC 2H3IA 9ICKA 4J9KA 4ECZA 3SAFA 1Z4OA 1F44A 5J0QA 3SYZA 4P4MA 4O3PA 3SV4A 3M8RA 3RB4A 1TVAA 2FJ6A 5KFAA 1RYUA 4KLGA 4DSFA 9ICRA 1KL9A 3ZD8A 3ZDEA 1V97A 2KG5A 4RPXA 3GIMA 2MUTB 3IDWA 5TISU 2WF8A 3BS7A 3WKBA 4DQQA 4KLSA 4RNOA 2D8CA 4IR1A 1IV8A 9ICXA 4BWJA 2H3FA 4YMNA 2W8KA 3SR6A 4BXOB 8ICYA 1U45A 4Y2QA 5DKWA 3NVZA 2BHNA 5L1KA 2HI0A 3PR4A 4YXJA 8ICCA 1A6SA 1RM6C 4E0DA 1KTQA 4FBTA 1N5XA 3QUQA 2NRTA 5KFVA 1JIHA 1N2XA 5BPCA 4KN7A 2WF5A 1ZJMA 4DL3A 4LZGA 1DK2A 1WCNA 4ECQA 3D6JA 3NRZA 1VLBA 2ZIVB 2QB0A 3GDXA 1BPEA 2NO5A 3IRUA 4DFDA 4TUQA 1NZPA 2KTQA 5JU5A 3T79A 1SGGA 1KSPA 3PMLA 3RJEA 3PSIA 3F5AA 4B9NA 4KLFA 4F4WA 9ICJA 2F1IA 1ZQPA 5T14A 3M9OB 2CPRA 4QIWC 8ICNA 4RZRA 5AM1A 5C0YA 1J2NA 4YP3A 8ICQA 4J9NA 3GV8B 4DF4A 4Y2RA 4O5KA 5DBCA 2F44A 4AP9A 1K1QA 1Z3EB 4C8LA 2RHFA 4NLGA 5HHHA 2J6UA 2VIXA 2ZIXA 2DKXA 3KKAA 4RPYA 4Z6EA 3WKDA 5CB1A 9ICUA 9ICFA 2HSZA 1A76A 1JN3A 1HIWA 3IM1A 1S0NA 4JWMA 5KFKA 2PFQA 5KL1B 4F50A 4DQSA 2KOBA 2LKYA 3B0XA 3FDSA 3FAHA 2MRLA 4GLXA 4DWIA 4IS7A 4R66A 1DGJA 4YR2A 5J0WA 2BCSA 5CHGA 1ZQKA 3EYZA 3WK5A 3QXGA 3A0HU 4YXMA 5L1IA 5J8YC 2H3QA 2IA6A 4P4PA 5J0XA 2FE9A 3T5JA 5AM0A 2E1FA 4M6WA 4PGQA 3Q8SB 2EH9A 5J0SA 5KT2A 4UASA 2M9NA 5J2GA 3MGHA 5CEHA 1IXRA 1BPBA 5DDMA 2GWSA 2KP7A 3QU5A 1FO4A 2G08A 1Q46A 2V4RA 2NV3A 3VCBA 3DEEA 5KFGA 4EELA 1TK8A 4ZH4A 8ICJA 5KFZA 5B5EU 4C8OA 2GO7A 2W8LA 7ICQA 1D8YA 5DQGA 2KMDA 4KLEA 1MQ2A 4IQVA 2AHOB 8ICBA 4F4KA 3DV9A 4ED7A 1KLNA 4UAWA 2W9CB 3E0FA 3GIJA 3QEBZ 5JTIA 5KFFA 4M9LA 1TKDA 8ICPA 4B9UA
chains in the Genus database with same CATH topology
2EANA 2DL0A 2E8MA 1UCVA 1WWUA 4NJ8A 1KW4A 2KG5A 3IDWA 2DKXA 3BS7A 3KKAA 2K4PA 2QARA 2F3NA 2D8CA 1LKYB 1OXJA 2YTUA 4RQMA 1UQVA 2EAOA 2LPEA 1OW5A 3K1RB 2K60A 2LMRA 2KSOB 4IS7A 2KIVA 2ESEA 3BQ7A 2D3DA 5KNIA 1Z1VA 5L1MA 2QB0B 4PZNA 1LKYA 3SEIA 5J8YC 5J8YA 1V38A 3TADC 1PK1A 1PK1B 2E8NA 3TADA 2FE9A 2DKZA 2L5YA 2GLEA 2E8PA 2KSOA 3H8MA 4PZOA 1X40A 5F3XB 2Y9UA 1COKA 2Y9TA 1SV0C 3BS5B 2ES6A 1B4FA 1PK3A 2QB0A 1SV0A 4MHVA 2B6GA 1JI7A 1DXSA 2KE7A 4RQNA 4NL9C 2QKQA 3TACB 4NL9A 1SXDA 5JU5A 2QB1A 1SGGA 3HILA 1X66A 2EAMA 2EAPA 1SXEA 3KKAC 2JV3A 2F8KA 2KMDA 1RG6A 2QARB 3BS5A 1X9XA 1F0MA 1V85A 1WWVA 5JTIA 1SV4A 2F44A 5JRTA 2E8OA 1B0XA 3SENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAN A;  2DL0 A;  2E8M A;  1UCV A;  1WWU A;  4NJ8 A;  1KW4 A;  2KG5 A;  3IDW A;  2DKX A;  3BS7 A;  3KKA A;  2K4P A;  2QAR A;  2F3N A;  2D8C A;  1LKY B;  1OXJ A;  2YTU A;  4RQM A;  1UQV A;  2EAO A;  2LPE A;  1OW5 A;  3K1R B;  2K60 A;  2LMR A;  2KSO B;  4IS7 A;  2KIV A;  2ESE A;  3BQ7 A;  2D3D A;  5KNI A;  1Z1V A;  5L1M A;  2QB0 B;  4PZN A;  1LKY A;  3SEI A;  5J8Y C;  5J8Y A;  1V38 A;  3TAD C;  1PK1 A;  1PK1 B;  2E8N A;  3TAD A;  2FE9 A;  2DKZ A;  2L5Y A;  2GLE A;  2E8P A;  2KSO A;  3H8M A;  4PZO A;  1X40 A;  5F3X B;  2Y9U A;  1COK A;  2Y9T A;  1SV0 C;  3BS5 B;  2ES6 A;  1B4F A;  1PK3 A;  2QB0 A;  1SV0 A;  4MHV A;  2B6G A;  1JI7 A;  1DXS A;  2KE7 A;  4RQN A;  4NL9 C;  2QKQ A;  3TAC B;  4NL9 A;  1SXD A;  5JU5 A;  2QB1 A;  1SGG A;  3HIL A;  1X66 A;  2EAM A;  2EAP A;  1SXE A;  3KKA C;  2JV3 A;  2F8K A;  2KMD A;  1RG6 A;  2QAR B;  3BS5 A;  1X9X A;  1F0M A;  1V85 A;  1WWV A;  5JTI A;  1SV4 A;  2F44 A;  5JRT A;  2E8O A;  1B0X A;  3SEN A; 
#chains in the Genus database with same CATH topology
 4CF3 A;  2HVI A;  5ALU A;  1BVS A;  4PH5 A;  2W9B A;  3KHH A;  4F92 B;  1QQ5 A;  4DS4 A;  3T3F A;  8ICW A;  3OSP A;  4BDP A;  3AU2 A;  4K4G A;  3B9J A;  4YMM A;  4ECT A;  1ZQA A;  1N61 A;  4KTQ A;  4DL5 A;  7ICN A;  1ZQQ A;  4TQR A;  5IIK A;  1S77 D;  2P6U A;  3HKZ F;  3G6Y A;  3QE9 Y;  2ZUC A;  4P0Q A;  3GV7 B;  4RQ3 A;  2W7O A;  5J0O A;  3D2N A;  4PZN A;  2IOH A;  2ALZ A;  3AU6 A;  1TFR A;  7ICH A;  4BXO A;  3UXP A;  3C2L A;  2DKZ A;  2FPM A;  1U47 A;  1KDH A;  5F9L A;  3SAG A;  5AIA A;  1ZD3 A;  2Y9U A;  5AK3 A;  4JV0 A;  4QZG A;  3AQE A;  2HVH A;  1ZQY A;  2EZX A;  4DQP A;  1SZH A;  5ALT A;  1L8L A;  2UVU A;  4P0P B;  8ICU A;  1ZQI A;  2OWO A;  4UAT A;  1O03 A;  2ZIU A;  4CGZ A;  5KAF U;  1SL2 A;  1S9F A;  4KX3 A;  1D9D A;  2ZTD A;  5J0T A;  5EE0 A;  4EYH B;  5AK6 A;  4B9L A;  4J9L A;  3KKA C;  3QUT A;  4DFK A;  5DBB A;  4NM2 A;  4QZF A;  2CN1 A;  3PW7 A;  3UQ2 A;  4IRD A;  3Q8K A;  1Z1B A;  5CP2 A;  4J9P A;  3RJI A;  5K4L A;  5HR6 A;  3PSF A;  3HT3 A;  5KFC A;  5AI5 A;  4MEY A;  8ICS A;  4F2S A;  2ZUB A;  4QZI A;  2ZXI A;  3MAB A;  2VJ4 A;  5KFM A;  3KTQ A;  5AKG A;  5EE1 A;  1ZRM A;  2AXT U;  2AGO A;  5G5H A;  1L3V A;  5BOM A;  4LJX A;  1RXV A;  3RB0 A;  2BR0 A;  4DFM A;  3K1R B;  2W9M A;  3QU4 A;  4PHE A;  3HJE A;  1N56 A;  1S5L U;  5DDY A;  4I2C A;  2XID A;  4DSL A;  5ALK A;  3BQT A;  5IIO A;  1J2M A;  3WKA A;  4GC6 A;  2XCP A;  3RB3 A;  2KKP A;  2DUY A;  3QX7 A;  4I2A A;  5ALJ A;  2AGQ A;  3M7D A;  4UB1 A;  4FO6 A;  3TI0 A;  3PX4 A;  2JZB A;  4ECV A;  1ZQC A;  4Q44 A;  1BPD A;  1PK1 A;  2HDO A;  4PHP A;  1ZQZ A;  1Z4N A;  2QLT A;  4NLN A;  4R8U A;  2LYB A;  3H8M A;  4PZO A;  3WK7 A;  2WF7 A;  1O08 A;  5KFT A;  2N1R A;  5KFE A;  2A1J A;  3WU2 U;  3UMG A;  3PZP A;  2HHW A;  4DL2 A;  2VJ5 A;  2J6S A;  1X42 A;  4DFJ A;  3QNM A;  2OH2 A;  4LZD A;  3GQC A;  5A0L A;  2BQU A;  9ICO A;  2HHV A;  3L3F X;  4UAU A;  5DQH A;  2G06 A;  2K8C B;  3RTV A;  2HHT A;  1SXE A;  2MAX A;  3RRH A;  4QZE A;  1NJX A;  5AIC A;  3ZDC A;  4Y2X A;  3WK8 A;  2HOI A;  1DRG A;  5J2F A;  3QZ7 A;  4U7C A;  2O6K A;  2LM1 A;  8ICE A;  5AKJ A;  5D49 A;  1RPL A;  2OXO A;  4QZH A;  2G09 A;  3D2Q A;  3BDP A;  3UMB A;  3EPI A;  1NJW A;  3TKA A;  2KKV A;  1HJP A;  4OJ6 A;  4C7Y A;  3C28 A;  2PFO A;  4A8E A;  1A0P A;  1X2I A;  3UXO A;  4EEN A;  2ZIX B;  3V6K A;  3LVW A;  4ED8 A;  4AYB C;  3LVV A;  4RUA A;  1UQV A;  1LB2 B;  3A0B U;  4UQG A;  1L7N A;  4OCZ A;  1OW5 A;  1KQQ A;  4ED1 A;  4QZB A;  1QSS A;  5KFD A;  3NVV A;  2LBO A;  3LK9 A;  4Q8E A;  1D8B A;  5AK4 A;  2ESE A;  1NKE A;  1ZQ1 C;  2F2A B;  1ZD2 P;  3ZI4 A;  5KT5 A;  1ZQF A;  2D3D A;  1Z1V A;  4EEY A;  4UAV A;  4MFC A;  3SEI A;  2F77 X;  1XS9 D;  3U26 A;  5C5J A;  4QZA A;  5ALQ A;  4EZ9 A;  4Y2J A;  3CRX A;  4FZN A;  2ISO A;  2EZZ A;  4YR3 A;  2ZUD A;  7ICG A;  1XWL A;  2JHD A;  2G5H B;  3SQI A;  1COK A;  4J9Q A;  4OJL A;  3HP6 A;  1QSL A;  2HOF A;  2IHN A;  4Z6D A;  1NK5 A;  1ZQU A;  1SV0 A;  2YMQ A;  4RQ6 A;  3M1Y A;  1Q3V A;  1NZB A;  3N97 B;  1UT5 A;  1NJZ A;  1NK9 A;  1QQ6 A;  5ALR A;  4JV2 A;  4TQS A;  2FPL A;  3VC8 A;  1TV9 A;  1ZD4 A;  4OO1 J;  4F4Z A;  2KN7 A;  1XU4 A;  3IG5 A;  4F4X A;  3SD7 A;  1RG6 A;  8ICK A;  2B0C A;  5DG8 A;  4YVZ A;  2NO4 A;  1F5S A;  1SL1 A;  4YCX A;  5ALZ A;  2ODG A;  4F4Y A;  3PX0 A;  1ZET A;  2KEY A;  2WF9 A;  8ICM A;  1RQL A;  3RH6 A;  2W9B B;  1MQ3 A;  2UVW A;  2H3V A;  5ALF A;  2HBK A;  3ORY A;  1ZOL A;  1QSY A;  4DSI A;  9ICM A;  3ETL A;  4GIB A;  2A19 A;  4KLU A;  3RRG A;  4C4R A;  2KSO B;  1SL0 A;  2XCA A;  2KIV A;  1KRP A;  3MFH A;  2Y1J A;  2BPG A;  4CDG A;  4P0Q B;  3CNH A;  4UAY A;  4I2D A;  4YQW A;  3I1Y A;  3FYH A;  3HRD D;  2K4I A;  2ATL A;  3M6K A;  2JXJ A;  1K1S A;  1FFU A;  2OYY A;  2IOF K;  3BJY A;  2H3Z A;  4G9B A;  3SAH A;  4M04 A;  5F3X B;  1SKR A;  1ZRN A;  5J29 A;  4EZ6 A;  4UW9 A;  3ISB A;  3BS5 B;  7ICO A;  2ZJ8 A;  4M9H A;  3EWA A;  4ED3 A;  5CJ7 A;  3GIL A;  2K4H A;  5KFH A;  3ZDB A;  2A1A A;  2ZIU B;  4QW8 A;  4PPX A;  5KG0 A;  1P7D A;  4GXK A;  1TK5 A;  3TFR A;  4F5O A;  5KFN A;  1RDF A;  1TAQ A;  3Q8Q B;  2Y1I A;  2B21 A;  2W9A A;  4ED0 A;  1PVP A;  1X6J A;  2R8I A;  2KJ5 A;  5J2A A;  5ALL A;  5ALD A;  1WCL A;  4I2H A;  1SWW A;  4F8R A;  1A77 A;  2RLT A;  4RT2 A;  4UBB A;  4KLI A;  2HHU A;  2BQR A;  4I2J A;  5J2D A;  9ICB A;  7ICM A;  4UB5 A;  3ETR A;  3PY8 A;  2E8M A;  5F9N A;  2JRZ A;  1JX4 A;  7ICJ A;  4EBC A;  3TAR A;  2KHQ A;  2VAN A;  4DEZ A;  2W03 A;  2DF4 B;  1CEZ A;  2F3N A;  3H8S A;  5AKX A;  3MBY A;  2CXY A;  4GC7 A;  1UT8 A;  2HOQ A;  4MFA A;  5ALX A;  1HUO A;  4F3O A;  2VA2 A;  4YN4 A;  5KFX A;  4JWN A;  1XSN A;  3H0L B;  4Y2S A;  4O3Q A;  2MSN A;  1BNO A;  5AI6 A;  3KFU F;  2KJ9 A;  2DGZ A;  3BQ2 A;  2KK0 A;  4NY8 A;  4RUC A;  4IQT A;  3PO5 A;  2AU0 A;  2JZB B;  1PK1 B;  2WF6 A;  1ZQG A;  4PHD A;  5KFS A;  4R8U B;  3SMV A;  2C2D A;  2D6F C;  4RQ7 A;  4Y2Y A;  2KFN A;  3E58 A;  4AYB F;  2IMW P;  1VDV A;  2A1J B;  4KN4 A;  4NL9 C;  1ZQX A;  4NLK A;  3LWM A;  2LI6 A;  3CP8 A;  1COO A;  3HIL A;  2LYA A;  4UAZ A;  2I9G A;  1T7P A;  1PVR A;  1D9F A;  5EOZ A;  4RQ4 A;  1LVH A;  2NRX A;  2YQE A;  4O5E A;  4F2R A;  3WK9 A;  3ISD A;  3AMZ A;  5KFP A;  3JPN A;  1X9X A;  8ICV A;  2W04 A;  3BQ0 A;  5ALO A;  3Q8L A;  5AKE A;  4Z6C A;  1QQ7 A;  1S10 A;  2JEI A;  3IHQ B;  3RH4 A;  3KHR A;  4F5Q A;  4RQ8 A;  5KFQ A;  9ICE A;  2W11 A;  4UAR A;  2ZTE A;  4IQW A;  4MFF A;  5J2E A;  1CI4 A;  4IC9 A;  5KFU A;  2KNJ A;  1YZ7 A;  3LYS A;  1T94 A;  3C2M A;  4C4T A;  2I6X A;  5KG2 A;  1J97 A;  3KZX A;  1RYS A;  8ICL A;  4US9 A;  3IV6 A;  5ALS A;  4KLD A;  5AM3 A;  1TAU A;  2KIC A;  4PHA A;  2PFP A;  1S76 D;  2R8H A;  3ZDA A;  3GU3 A;  2KHV A;  4DOC A;  3UPQ A;  2PKE A;  3V6H A;  1N60 A;  2BPC A;  3TAD A;  2HHS A;  5J2J A;  5J2H A;  3V7J A;  4DL6 A;  2OEH A;  4P4O A;  3E2E A;  3IP4 B;  2KSO A;  3ONN A;  8ICO A;  2UVR A;  9ICT A;  1X40 A;  4RU9 A;  1SKW A;  3H0M B;  4QWE A;  4XRH A;  4O9M A;  1ZQN A;  4C4S A;  4I2E A;  1CUK A;  2FLL A;  2FMP A;  4EX7 A;  3F2D A;  4QWA A;  4GXJ A;  5J2I A;  3L5K A;  2E5S A;  1JI7 A;  3OHB A;  2A3V A;  2IHM A;  1SWV A;  2K89 A;  2BCR A;  2YB1 A;  1DOQ A;  1IG6 A;  4I2F A;  4KLH A;  3ZDD A;  3K4G A;  3S6J A;  1Z19 A;  2R18 A;  2GH1 A;  1FIQ A;  3BS5 A;  4JUZ A;  1ZQV A;  5HNK A;  8ICF A;  2YX8 A;  2HBM A;  2G07 A;  2PFN A;  5JRT A;  2Y0S C;  1B0X A;  3SEN A;  5KG1 A;  4G3I A;  8ICH A;  2KFZ A;  1UCV A;  1SKS A;  4NWI A;  5ALP A;  1V9P A;  3T5L A;  4B9M A;  4RQM A;  3MGI A;  2LPE A;  1JAL A;  1L8O A;  4M0A A;  2DPI A;  5ALV A;  1UPH A;  4ZOH C;  2DPJ A;  1KN5 A;  4IR9 A;  2YN4 A;  3C21 A;  4JB3 A;  4TUS A;  4ELT A;  5GTI U;  1ZD5 A;  4GFJ A;  2KZZ A;  1BPY A;  1Q3U A;  2PMZ C;  2NRV A;  5KT7 A;  4K4I A;  1L6N A;  3RJH A;  1L7O A;  2I1Q A;  4DS5 A;  2L5Y A;  4EX6 A;  4B6J A;  3RBE A;  4ED2 A;  3PSP A;  2XGP A;  4J9R A;  5KFW A;  4RNN A;  3HW8 A;  3SI8 A;  1C7Y A;  5B66 U;  4FS1 A;  4QIW F;  5DB8 A;  2P66 A;  3F2B A;  3RBD A;  2W7P A;  1B4F A;  3PNC A;  1XO1 A;  1ZXI A;  1M6Y A;  2W43 A;  2K8A A;  1JRO A;  3PX6 A;  1XSL A;  2F1H A;  4KLL A;  4KLO A;  5AKH A;  1T3Q A;  3KD3 A;  3LDA A;  4QZC A;  5ALI A;  2KZM A;  1KFT A;  2JEF A;  2GOL A;  4RT3 A;  5KG6 A;  1JXL A;  3N7S C;  4I28 A;  1YZ6 A;  4TUP A;  3OJS A;  4C8N A;  4Z6F A;  1F0M A;  2JMG A;  1B43 A;  1NNL A;  2FDR A;  1V85 A;  3T5K A;  4F5P A;  2DFL A;  1SV4 A;  1NKC A;  3TAP A;  4FBU A;  1ZQW A;  3O0F A;  4PGY A;  2KJ8 A;  4CCH A;  4KLJ A;  3V6J A;  5HR7 A;  4C7Z A;  5L1L A;  2C2E A;  3JPS A;  5KAI U;  5KFR A;  2K60 A;  1RZT A;  4C80 A;  4ECY A;  3PST A;  9ICA A;  4JK1 A;  4UB4 A;  4J9S A;  2OHF A;  4R65 A;  4O3N A;  1NK8 A;  1HUZ A;  3GV5 B;  5J0U A;  1T3N A;  3WKC A;  1ZQB A;  8ICZ A;  2C2R A;  4CF5 A;  2DWQ A;  2NYV A;  3V7L A;  3N4M B;  5IIN A;  4J03 A;  2BCV A;  4DSJ A;  3C5G A;  3HPO A;  3WK6 A;  3JPO A;  3EUB 2;  5CR0 A;  4Q8F A;  3RJF A;  5IIM A;  8ICA A;  5HML A;  2RQ5 A;  2ZIW A;  4O3M A;  3C23 A;  1U4B A;  1ZQH A;  3MR2 A;  2YMM A;  2B6G A;  5J0R A;  4YFK A;  4Q45 A;  1DXS A;  1KKX A;  2QKQ A;  3ALR A;  4QZ9 A;  3JPQ A;  4QW9 A;  4DOA A;  2KD1 A;  3RAQ A;  2G0A A;  1T4G A;  2WB1 C;  4CRX A;  4YR0 A;  5KG5 A;  2EAP A;  9ICC A;  4RQ1 A;  4FZM A;  1S0M A;  2LHT A;  1C20 A;  2HHX A;  3AEV A;  2QAR B;  4Y2T A;  3G6V A;  1HEK A;  9ICI A;  4R63 A;  2ASD A;  1ZQE A;  4U6P A;  2DBY A;  1XNS A;  3AL0 B;  1WWV A;  2WTF A;  4CF4 A;  5AI0 A;  4RQ2 A;  8ICX A;  3H7I A;  1NK4 A;  4BWM A;  2XI9 A;  3R9K A;  3M8S A;  3K1Z A;  4KLT A;  1KW4 A;  5DB6 A;  4X5V A;  7ICT A;  1BPX A;  2K4P A;  2YMP A;  4DO9 A;  4ACO A;  4M2Y A;  3L4P A;  1OXJ A;  4DFP A;  4QWC A;  4B9T A;  4OJ5 A;  4DOB A;  3PVX A;  1XO0 A;  2UVV A;  4NV0 A;  4QWB A;  4I27 A;  4ELV A;  1T8E A;  1K5O A;  4RPZ A;  3NGD A;  4UB3 A;  5KFY A;  3M9N B;  1UHU A;  5TZV A;  5EE9 A;  5KFL A;  3WK4 A;  1IIP A;  3BZK A;  4TUR A;  3KBB A;  5DB9 A;  5KNI A;  2WAQ C;  5J8Y A;  2ZJA A;  1UA1 A;  3ISC A;  5AI8 A;  7ICK A;  3NRW A;  4C8K A;  5ALY A;  4Y2U A;  1NK0 A;  3QU2 A;  5KG3 A;  5H2F U;  5AKK A;  2AQ0 A;  4XUS A;  4QZD A;  5L9X A;  5AI4 A;  3OPX A;  4MF8 A;  2HBL A;  1L3S A;  4ECU A;  4CNQ A;  3TAN A;  5CRX A;  4RQN A;  5EWF A;  4HAI A;  2JR5 A;  3TAC B;  2HBJ A;  3SZ2 A;  2JEJ A;  5DLG A;  3MGV A;  1SB3 C;  1ZYQ A;  3C2K A;  1EXN A;  4OJP A;  3F2C A;  2NRZ A;  3UM9 A;  5AM4 A;  3JPR A;  2NRW A;  2XY6 A;  5IIJ A;  5KG7 A;  2PMZ F;  3H4B A;  5HHI A;  5DBA A;  1H38 A;  2OCE A;  4KMU A;  4DL7 A;  7ICV A;  4O5C A;  3EW9 A;  1NJY A;  1KFD A;  1URJ A;  3N7R C;  4O3S A;  4BX9 C;  4LVS A;  4JMU A;  2DL0 A;  4PL2 A;  1ZJN A;  3QU7 A;  4ELU A;  4M9N A;  3MDA A;  1ZQO A;  5L1J A;  1X9M A;  4UB6 U;  2WFA A;  8ICT A;  1L7M A;  4ECS A;  4OD0 A;  1LKY B;  5AKY A;  3H40 A;  3IG8 A;  3RAX A;  1Y88 A;  2EAO A;  3I28 A;  2VA8 A;  3C1Y A;  4O3O A;  3THV A;  2AQ4 A;  1JXE A;  1L3T A;  4JV1 A;  2ASL A;  4DLE A;  3AUO A;  3GIK A;  2W55 A;  5EWE A;  4FFD A;  3OJU A;  2FLP A;  3AN1 A;  4OJO A;  3QZ8 A;  1V38 A;  1RQN A;  3UQ0 A;  8ICR A;  2ISP A;  5AM2 A;  4Y2V A;  2E8P A;  5IIL A;  2HCF A;  3OGU A;  1N48 A;  1U9L A;  3QUB A;  1BGX T;  3RJJ A;  7ICS A;  3NS1 A;  2RP5 A;  2BCQ A;  1SV0 C;  2JEG A;  1PK3 A;  1QCK A;  4IQU A;  3QYP A;  2Q4T A;  4MHV A;  2LM4 A;  3NTU A;  4RQ0 A;  3MC1 A;  3RJK A;  1SXD A;  1OUQ A;  2W3S A;  5J2B A;  3FM9 A;  4O3R A;  5KL8 B;  1X6I A;  3PMN A;  7ICL A;  3KZI U;  4BJQ A;  4BUG A;  3TAQ A;  4J9O A;  4ICA A;  2BGW A;  2ZG6 A;  4B9S A;  5FP0 A;  3GII A;  9ICN A;  5J0P A;  2ZJ5 A;  2P35 A;  3OSN A;  3JPT A;  4KX5 A;  4F5R A;  1LV5 A;  5DGA A;  2Q0Z X;  3H0R B;  2E8O A;  1D8L A;  2EAN A;  1JUD A;  3QUC A;  2F8L A;  2FI1 A;  2KIW A;  9ICG A;  3DDH A;  4US8 A;  2PXI A;  2QAR A;  4M9J A;  3Q8R B;  4DCC A;  5J0Y A;  5ALM A;  1RXW A;  2WB1 F;  5AKI A;  1JMS A;  4YMO A;  1Z00 A;  2LMR A;  5J2C A;  1MC8 A;  1AQ6 A;  1KFS A;  4Y2P A;  2FMS A;  7ICF A;  3C29 A;  4IL6 U;  4QNL A;  4KIT B;  3RH5 A;  5BOL A;  5L1M A;  2EZY A;  2AH5 A;  5KFI A;  3AQF A;  2VA3 A;  4QWD A;  2BCU A;  2XC9 A;  3ZD9 A;  1ARO P;  5D46 A;  2E3T A;  8ICI A;  1WUD A;  2WHE A;  3BQ1 A;  4I2I A;  3M9M B;  2ZXH A;  5AIB A;  4F71 A;  1BPZ A;  4M47 A;  4EBE A;  4NLB A;  2ZIW B;  2Y9T A;  2V4Q A;  1WG8 A;  4DLG A;  3GFK B;  1L5U A;  3QEA Z;  4P2H A;  4UBC A;  5HP4 A;  4EBD A;  4I2B A;  1TE2 A;  2VKQ A;  1X66 A;  3PR5 B;  4YD2 A;  4EEK A;  3NUQ A;  3KHG A;  4ECW A;  3LWL A;  7ICP A;  5KFO A;  5DG7 A;  4Q43 A;  1RYR A;  2WAQ F;  1SIJ A;  2KVS A;  1QLN A;  2M0N A;  2I5H A;  3NAS A;  5E79 U;  1ZQD A;  7ICR A;  4K4H A;  9ICH A;  3RJG A;  1TAM A;  3CYM A;  3PW0 A;  2P6R A;  4DSE A;  4J9M A;  1L3U A;  3HWT A;  2J6T A;  1ZQT A;  4FS2 A;  1KBU A;  2MUT A;  2W3R A;  5AI9 A;  3PW5 A;  3M6Z A;  2EDU A;  3EPG A;  2R8G A;  4CE6 A;  1B22 A;  9ICW A;  3D2S A;  4MEX A;  2E1E A;  1XC9 A;  1S0O A;  2F76 X;  1S0V A;  2JGA A;  1L7P A;  5ALE A;  2Z7J A;  5EWG A;  5KFB A;  2PI4 A;  3G6X A;  3WKE A;  2F1J A;  4NM1 A;  4BGD A;  3J81 j;  5G5G A;  7ICU A;  1NK6 A;  5DB7 A;  2BKE A;  4R64 A;  2KV2 A;  1LKY A;  1QH9 A;  2BDU A;  1U49 A;  2XO7 A;  5AM5 A;  3RF9 A;  1NK7 A;  2GLE A;  3RFA A;  2KZ3 A;  4F93 B;  5KT6 A;  3MR3 A;  4I29 A;  1GO3 F;  9ICL A;  3N7P D;  2JH1 A;  2ZIV A;  2ASJ A;  4HYK A;  1ZQJ A;  4YD1 A;  2XVT A;  2KVC A;  3I76 A;  2ES6 A;  5EE3 A;  1ZQL A;  5CWR A;  1N62 A;  5AKL A;  4RNM A;  4IRK A;  3H8J A;  1NOM A;  3OTQ A;  4KLM A;  1FFV A;  2MA1 A;  3BZC A;  3FC4 A;  5KTQ A;  4EYI B;  1ECW A;  9ICV A;  3Q8M A;  2C28 A;  4DL4 A;  2AJQ A;  2MU2 A;  2JV3 A;  1UA0 A;  3T5H A;  3AM9 A;  1PVQ A;  1YT3 A;  4NLZ A;  9ICP A;  4DQI A;  1PZN A;  5KT4 A;  4FE3 A;  1CRX A;  4YG2 A;  3MR5 A;  3PV8 A;  4DSK A;  2OM6 A;  1JRP A;  3IN5 A;  2V9W A;  9ICQ A;  4DF8 A;  4NLC A;  5KFJ A;  3NVY A;  1X9S A;  1U48 A;  3NVW A;  1MSW D;  5D4B A;  1DGS A;  4B9V A;  3OHA A;  2XGQ A;  2C22 A;  1DK3 A;  3H8W A;  1ZQM A;  3V7K A;  2W54 A;  3BQ7 A;  4IRC A;  3KHL A;  4FZL A;  2QB0 B;  3C1Z A;  3F53 A;  4XQ8 A;  5AHX A;  3TAD C;  5DLF A;  5DQI A;  4WJ3 B;  2XY7 A;  1WYG A;  3N28 A;  5HMM A;  1TK0 A;  4GXI A;  1Q8K A;  4I2G A;  1SZP A;  1X9W A;  4PGX A;  2JH7 A;  7ICI A;  5J2K A;  3V72 A;  4QZ8 A;  4KLQ A;  3PW2 A;  1IM4 A;  1KEJ A;  2YML A;  1NKB A;  1N5W A;  1QTM A;  5ALG A;  4C0Z A;  3Q8P B;  3RB6 A;  2QB1 A;  3GZF A;  2R8K A;  2YY6 A;  3MFI A;  2R8J A;  4NXZ A;  4PJ0 U;  3CW2 C;  5DGB A;  4KMO B;  2LYH A;  1S97 A;  2F8K A;  3K75 D;  3PW4 A;  4MF2 A;  8ICG A;  2W9C A;  3RR7 A;  1FEZ A;  4UB8 U;  3ED5 A;  2G5I B;  3C5F A;  2IBK A;  1VJ5 A;  2RDI A;  4C8M A;  2PI5 A;  3ICX A;  2IOF A;  2BQ3 A;  1PUZ A;  2EQY A;  5ALN A;  2FMQ A;  1WWU A;  4NJ8 A;  3TFS A;  2CRX A;  2RRD A;  2HW3 A;  4PL1 A;  1S8O A;  4O0I A;  9ICS A;  4UB2 A;  7ICE A;  5KT3 A;  2YTU A;  1XSP A;  4ED6 A;  2BDP A;  1N63 A;  3SV3 A;  2BZF A;  2XIC A;  3B0Y A;  1ZQR A;  2YB4 A;  4M6W B;  4F72 A;  5ALW A;  1Z00 B;  2ZTC A;  1MN8 A;  4F5N A;  1NI3 A;  3PO4 A;  5ALH A;  3H4D A;  4QJF B;  2H5X A;  1BNP A;  5CA7 A;  2RDJ A;  2AGP A;  4RQ5 A;  2E8N A;  4ECX A;  3MDC A;  2HHQ A;  3HX0 A;  3UXN A;  2K4E A;  3QU9 A;  4M9G A;  2FPK A;  5AKZ A;  3UMC A;  5AK5 A;  4DQR A;  4ECR A;  1ZQS A;  5III A;  1ED1 A;  5DG9 A;  2DQN B;  2KE7 A;  3JPP A;  3TQ1 A;  3KOO A;  2HMX A;  3F5E A;  4P0P A;  4NL9 A;  4XA5 A;  5GTH U;  2Y0S F;  2XY5 A;  2EAM A;  3EZ5 A;  1MA7 A;  3RR8 A;  2K8B B;  2BPF A;  5KG4 A;  4F91 B;  3MR6 A;  4USA A;  2FLN A;  5JUM A;  3HKZ C;  2H3I A;  9ICK A;  4J9K A;  4ECZ A;  3SAF A;  1Z4O A;  1F44 A;  5J0Q A;  3SYZ A;  4P4M A;  4O3P A;  3SV4 A;  3M8R A;  3RB4 A;  1TVA A;  2FJ6 A;  5KFA A;  1RYU A;  4KLG A;  4DSF A;  9ICR A;  1KL9 A;  3ZD8 A;  3ZDE A;  1V97 A;  2KG5 A;  4RPX A;  3GIM A;  2MUT B;  3IDW A;  5TIS U;  2WF8 A;  3BS7 A;  3WKB A;  4DQQ A;  4KLS A;  4RNO A;  2D8C A;  4IR1 A;  1IV8 A;  9ICX A;  4BWJ A;  2H3F A;  4YMN A;  2W8K A;  3SR6 A;  4BXO B;  8ICY A;  1U45 A;  4Y2Q A;  5DKW A;  3NVZ A;  2BHN A;  5L1K A;  2HI0 A;  3PR4 A;  4YXJ A;  8ICC A;  1A6S A;  1RM6 C;  4E0D A;  1KTQ A;  4FBT A;  1N5X A;  3QUQ A;  2NRT A;  5KFV A;  1JIH A;  1N2X A;  5BPC A;  4KN7 A;  2WF5 A;  1ZJM A;  4DL3 A;  4LZG A;  1DK2 A;  1WCN A;  4ECQ A;  3D6J A;  3NRZ A;  1VLB A;  2ZIV B;  2QB0 A;  3GDX A;  1BPE A;  2NO5 A;  3IRU A;  4DFD A;  4TUQ A;  1NZP A;  2KTQ A;  5JU5 A;  3T79 A;  1SGG A;  1KSP A;  3PML A;  3RJE A;  3PSI A;  3F5A A;  4B9N A;  4KLF A;  4F4W A;  9ICJ A;  2F1I A;  1ZQP A;  5T14 A;  3M9O B;  2CPR A;  4QIW C;  8ICN A;  4RZR A;  5AM1 A;  5C0Y A;  1J2N A;  4YP3 A;  8ICQ A;  4J9N A;  3GV8 B;  4DF4 A;  4Y2R A;  4O5K A;  5DBC A;  2F44 A;  4AP9 A;  1K1Q A;  1Z3E B;  4C8L A;  2RHF A;  4NLG A;  5HHH A;  2J6U A;  2VIX A;  2ZIX A;  2DKX A;  3KKA A;  4RPY A;  4Z6E A;  3WKD A;  5CB1 A;  9ICU A;  9ICF A;  2HSZ A;  1A76 A;  1JN3 A;  1HIW A;  3IM1 A;  1S0N A;  4JWM A;  5KFK A;  2PFQ A;  5KL1 B;  4F50 A;  4DQS A;  2KOB A;  2LKY A;  3B0X A;  3FDS A;  3FAH A;  2MRL A;  4GLX A;  4DWI A;  4IS7 A;  4R66 A;  1DGJ A;  4YR2 A;  5J0W A;  2BCS A;  5CHG A;  1ZQK A;  3EYZ A;  3WK5 A;  3QXG A;  3A0H U;  4YXM A;  5L1I A;  5J8Y C;  2H3Q A;  2IA6 A;  4P4P A;  5J0X A;  2FE9 A;  3T5J A;  5AM0 A;  2E1F A;  4M6W A;  4PGQ A;  3Q8S B;  2EH9 A;  5J0S A;  5KT2 A;  4UAS A;  2M9N A;  5J2G A;  3MGH A;  5CEH A;  1IXR A;  1BPB A;  5DDM A;  2GWS A;  2KP7 A;  3QU5 A;  1FO4 A;  2G08 A;  1Q46 A;  2V4R A;  2NV3 A;  3VCB A;  3DEE A;  5KFG A;  4EEL A;  1TK8 A;  4ZH4 A;  8ICJ A;  5KFZ A;  5B5E U;  4C8O A;  2GO7 A;  2W8L A;  7ICQ A;  1D8Y A;  5DQG A;  2KMD A;  4KLE A;  1MQ2 A;  4IQV A;  2AHO B;  8ICB A;  4F4K A;  3DV9 A;  4ED7 A;  1KLN A;  4UAW A;  2W9C B;  3E0F A;  3GIJ A;  3QEB Z;  5JTI A;  5KFF A;  4M9L A;  1TKD A;  8ICP A;  4B9U A; 
#chains in the Genus database with same CATH homology
 2EAN A;  2DL0 A;  2E8M A;  1UCV A;  1WWU A;  4NJ8 A;  1KW4 A;  2KG5 A;  3IDW A;  2DKX A;  3BS7 A;  3KKA A;  2K4P A;  2QAR A;  2F3N A;  2D8C A;  1LKY B;  1OXJ A;  2YTU A;  4RQM A;  1UQV A;  2EAO A;  2LPE A;  1OW5 A;  3K1R B;  2K60 A;  2LMR A;  2KSO B;  4IS7 A;  2KIV A;  2ESE A;  3BQ7 A;  2D3D A;  5KNI A;  1Z1V A;  5L1M A;  2QB0 B;  4PZN A;  1LKY A;  3SEI A;  5J8Y C;  5J8Y A;  1V38 A;  3TAD C;  1PK1 A;  1PK1 B;  2E8N A;  3TAD A;  2FE9 A;  2DKZ A;  2L5Y A;  2GLE A;  2E8P A;  2KSO A;  3H8M A;  4PZO A;  1X40 A;  5F3X B;  2Y9U A;  1COK A;  2Y9T A;  1SV0 C;  3BS5 B;  2ES6 A;  1B4F A;  1PK3 A;  2QB0 A;  1SV0 A;  4MHV A;  2B6G A;  1JI7 A;  1DXS A;  2KE7 A;  4RQN A;  4NL9 C;  2QKQ A;  3TAC B;  4NL9 A;  1SXD A;  5JU5 A;  2QB1 A;  1SGG A;  3HIL A;  1X66 A;  2EAM A;  2EAP A;  1SXE A;  3KKA C;  2JV3 A;  2F8K A;  2KMD A;  1RG6 A;  2QAR B;  3BS5 A;  1X9X A;  1F0M A;  1V85 A;  1WWV A;  5JTI A;  1SV4 A;  2F44 A;  5JRT A;  2E8O A;  1B0X A;  3SEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...