2KSOB

Epha2:ship2 sam:sam complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
59
structure length
59
Chain Sequence
GMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ephrin type-A receptor 2
publication title Structure and function of the EphA2:SHIP2 SAM domain heterodimer
rcsb
source organism Homo sapiens
total genus 16
structure length 59
sequence length 59
ec nomenclature ec 3.1.3.86: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase.
pdb deposition date 2010-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ksoB00
1OW5A 5F3XB 2ESEA 2YTUA 1SV0C 2LPEA 2QB0A 1PK1A 3TACB 2QARA 2F44A 2Y9UA 1V85A 1COKA 2D8CA 1SXDA 3BQ7A 1X40A 1SGGA 1B4FA 2L5YA 1WWUA 2DKZA 3KKAA 2KE7A 2E8OA 2EANA 2F8KA 2K4PA 2KSOA 1X9XA 1SV4A 2D3DA 2QB0B 1PK1B 5JRTA 2QB1A 3HILA 2QARB 5J8YA 1WWVA 1OXJA 2DL0A 4RQNA 5KNIA 1B0XA 1JI7A 2B6GA 2K60A 5J8YC 1X66A 2LMRA 2KSOB 2Y9TA 2KIVA 2QKQA 2EAPA 3SEIA 1UQVA 4PZNA 1F0MA 3KKAC 3H8MA 2DKXA 1PK3A 1UCVA 1KW4A 1V38A 2GLEA 2KMDA 5L1MA 2F3NA 3K1RB 4NL9A 5JTIA 3SENA 4IS7A 3BS5B 3BS5A 4MHVA 2E8NA 2FE9A 3TADA 2EAOA 3BS7A 4NL9C 4RQMA 3IDWA 1Z1VA 1RG6A 2ES6A 1SV0A 5JU5A 1LKYB 2E8MA 2E8PA 2JV3A 1LKYA 4PZOA 4NJ8A 3TADC 1DXSA 1SXEA 2KG5A 2EAMA
chains in the Genus database with same CATH superfamily
2RDIA 4JV0A 1BPDA 3PX4A 4R64A 4US9A 4PGXA 4JWNA 2A1AA 1ZD2P 2C2RA 5AKLA 2W55A 4ECWA 9ICKA 5AK5A 3RH6A 4QWBA 5KT3A 4UASA 3QUTA 4J9RA 3TQ1A 2HHTA 1QSYA 2H3VA 4YR2A 1MC8A 2H3QA 7ICIA 1J2NA 3N7PD 5EE9A 4HYKA 4NLKA 4DFKA 4C8LA 1ZQIA 4DEZA 2KTQA 2A1JA 2MU2A 1NKCA 5DLGA 2Q4TA 4DCCA 1MQ2A 4NLNA 3OJUA 5ALGA 2K8CB 7ICLA 2NRXA 1KDHA 1T3NA 1T94A 2KK0A 2JEIA 2BCUA 1YZ7A 1SL0A 4ED7A 4O3PA 4KLJA 3OHAA 1PUZA 4YR3A 3FM9A 1IV8A 5AM3A 5H2FU 2KZMA 5E79U 3NVWA 4DL4A 2RRDA 4RPXA 1O03A 5L1MA 4ELUA 1WCNA 7ICGA 9ICBA 3H8WA 4QZIA 5JTIA 3F5EA 1KEJA 4Y2PA 4EEYA 5J29A 3IHQB 4UB5A 5KFIA 1Z3EB 2G5IB 4KLUA 4RZRA 1BGXT 5AKXA 2HHQA 4DQSA 1NOMA 4KLFA 5DQIA 4B9VA 4YMNA 3RTVA 3G6YA 3RJEA 3H8SA 3QEBZ 4ED1A 4ED6A 1N48A 4NJ8A 3M8RA 5KAFU 8ICVA 2LI6A 2HOFA 2GO7A 3EW9A 3TACB 2XICA 4DQIA 2W3SA 3ZDCA 4UB8U 4PH5A 3IP4B 1ZXIA 2XCPA 1ZD4A 1A0PA 5DB7A 1RXWA 1D9FA 5DBBA 3OSPA 3WK8A 5KG7A 2R8KA 3KHGA 1TK0A 1P7DA 4CRXA 2HOQA 5D4BA 4K4IA 8ICQA 5KFEA 4G9BA 2JZBB 3RB3A 2ASDA 5EWEA 4OJPA 5HP4A 1X6JA 2KV2A 3M9OB 4F4ZA 2AU0A 3GDXA 3NVZA 3LYSA 5J0OA 1KKXA 1ZQHA 4BXOA 2WF9A 5AICA 4M9HA 1S77D 3Q8PB 4C0ZA 2ZTCA 1JXLA 4YVZA 3GIIA 2BKEA 2LYHA 2HHUA 4RQ8A 4KLSA 4MF2A 5CR0A 1F0MA 2PKEA 4DLGA 2V9WA 3Q8LA 2FLNA 5KFYA 1SL1A 4ICAA 5IIMA 3AQFA 1UCVA 5L1JA 2GLEA 4JV1A 4ACOA 4MF8A 3C5GA 4Q8EA 4PHEA 1JXEA 2E8NA 1QSSA 3H0LB 2ES6A 2XIDA 1LKYB 1RYRA 2E8PA 2G06A 5AI6A 1ZJMA 2K4EA 3NVYA 1KFTA 1RQNA 2IHMA 2EAMA 1TKDA 8ICYA 4Q45A 2XCAA 1SV0C 5DGBA 5J2EA 1XU4A 4MFCA 3T5KA 4GFJA 5BPCA 4Z6CA 1KN5A 2YMLA 4C8KA 3NUQA 1TAUA 4NLBA 4UATA 4YXJA 1XWLA 1ZRNA 3F5AA 4DQRA 4QZFA 2J6TA 2FJ6A 3BQ0A 4E0DA 4KITB 2DPJA 2DPIA 1KFSA 5DGAA 3HKZC 2ZIWB 5D46A 3EUB2 3SAHA 3F2BA 4BDPA 4GXJA 2I5HA 1EXNA 1GO3F 1TE2A 2N1RA 7ICNA 3I76A 2BPFA 5KFZA 4C8MA 4I2IA 2A3VA 9ICGA 5J8YC 1QQ6A 4M9JA 7ICPA 5T14A 3RF9A 2YY6A 2I9GA 3UXOA 2VANA 3CYMA 4KX5A 2ZIUB 2KIVA 1ZQRA 2HSZA 8ICNA 2ZUCA 4PZNA 3TARA 2MUTB 4FBUA 5AM5A 4KX3A 4XQ8A 1ZD5A 1RXVA 1KBUA 3M8SA 4PHAA 1ZJNA 1HUZA 2KFNA 2WF6A 2IA6A 4CGZA 3BS5B 3AEVA 1A6SA 3ED5A 4RQMA 4Y2QA 8ICLA 2BGWA 1M6YA 3MR3A 2JMGA 1B22A 5ALOA 5DB8A 2G09A 2LYBA 3KD3A 1SXEA 4MEYA 5IINA 1V97A 3VCBA 4FFDA 5DB6A 1UHUA 7ICSA 1U9LA 5KFXA 3H8JA 1TV9A 3H4DA 4CNQA 9ICHA 3PO5A 4QNLA 3IV6A 4P0PB 5ALXA 3BQ7A 5KFVA 4OJOA 5CEHA 3T3FA 3PW4A 3RJFA 9ICEA 1X42A 5AI8A 3ETRA 3D2QA 1WWUA 2K4IA 1PVRA 1NKBA 7ICFA 1FFVA 4WJ3B 2A19A 3RR8A 5DBAA 3SAFA 5KFJA 1N5WA 4R8UA 4UW9A 1L5UA 3ISCA 3MDAA 3LWMA 1ZQDA 8ICHA 4M9NA 5HHHA 2ZG6A 4QZDA 5HMMA 2AHOB 4F92B 2WHEA 1QQ5A 5AI9A 3NTUA 5KFWA 1ZQXA 5DQHA 3KKAC 2BCVA 2K4HA 1NK6A 4QZ9A 3Q8RB 3TKAA 3SV4A 2R8IA 3JPPA 4IQVA 3SR6A 1B43A 3QYPA 1KL9A 5J0PA 4TQSA 2HHVA 3HT3A 9ICAA 1F5SA 3M6ZA 2VJ5A 1ZQNA 4NL9C 1Z1VA 4RQ2A 4QIWF 2I1QA 5KFNA 3RBDA 1TK8A 4KN7A 4BGDA 2E1FA 3ZDEA 3EWAA 4P4PA 5TISU 3JPRA 2ALZA 8ICTA 3RAQA 2NRZA 4Z6FA 1RPLA 1N62A 4EYIB 2W7PA 3IN5A 3A0HU 2HVIA 3IG5A 3NRWA 1PVPA 4F5OA 4ED2A 4M0AA 1SGGA 1JN3A 5KFDA 2HVHA 5L1KA 3MR2A 3HKZF 4USAA 7ICHA 2JRZA 3IRUA 2H3FA 2ZIUA 1XNSA 1QCKA 4ECSA 4KMUA 2W9BB 2K89A 5CWRA 4RNMA 2MSNA 2MUTA 2C2DA 5KG4A 3FDSA 4Q43A 3JPQA 4J9PA 9ICNA 3PW2A 3IM1A 1L7PA 2BCSA 9ICLA 1FFUA 2EZYA 3BDPA 8ICBA 1TAQA 4U6PA 4ELTA 3L4PA 3CNHA 4YCXA 5IIKA 5AK6A 1N5XA 4F4KA 3WK9A 5EWFA 4C8OA 2J6SA 2J6UA 4QWEA 1V38A 2HBMA 2W9MA 5ALQA 3Q8QB 3F2CA 1NK5A 4DO9A 2KHQA 1BPZA 2FPKA 2JEGA 3GV8B 5KFSA 1A76A 2ZTDA 4J9QA 3IG8A 1L3VA 3RB6A 5AI4A 4P0PA 4J9MA 5ALIA 3UQ2A 3FYHA 4O3OA 3QUBA 1ZQCA 5DG9A 4CF5A 2HHXA 2Y1JA 4F4YA 5AIAA 1C20A 4Q44A 2YN4A 3GFKB 3GV5B 2OH2A 3NRZA 4Y2JA 1ZD3A 5L1LA 3C28A 1NK9A 7ICEA 4BUGA 2XI9A 3MC1A 4EBEA 1NK4A 2IOFK 3GILA 2L5YA 1NJYA 3D2SA 3KKAA 3RH4A 3ZD8A 1TVAA 9ICWA 4Y2XA 2PFOA 2YB1A 8ICWA 2UVWA 1SV4A 3AUOA 8ICEA 1ED1A 2KZZA 5KT5A 3VC8A 4F4WA 4OJ6A 4F93B 5KFKA 4KTQA 5ALPA 3AQEA 2ZTEA 3MBYA 3SZ2A 2OM6A 1JRPA 4DL5A 4P4MA 4QZGA 1ECWA 4DOAA 1ZQLA 4O9MA 4FBTA 4J9OA 2IOFA 2KSOB 2BPGA 1V9PA 4RNNA 3TAQA 2PXIA 4G3IA 3D6JA 9ICSA 1KLNA 3KZIU 2F1HA 2B21A 4O3QA 3H4BA 5AHXA 4F5RA 4UARA 4TUPA 9ICMA 1WUDA 3SENA 5L9XA 4RU9A 1ZQZA 4EBDA 1RYSA 4FZMA 3TADA 3SYZA 4B9LA 1QSLA 4YQWA 2LBOA 5KT7A 1HEKA 2Y1IA 2HBLA 2K8BB 4I2DA 5KG2A 1UA0A 1IIPA 3EPIA 5KL1B 3RJIA 3N97B 2CPRA 4NXZA 5KT2A 2BCRA 5J0UA 2YMMA 1XO1A 5IILA 4R65A 3KFUF 1D8BA 5ALVA 2H3ZA 1C7YA 2W9BA 5F9NA 3GV7B 5J2IA 4Y2RA 1U4BA 3QU7A 1V85A 2RDJA 3UPQA 3BQTA 2W43A 3WKCA 4M9GA 5DLFA 1L3SA 2ASLA 4MFAA 2XGQA 9ICRA 5ALTA 2F77X 4NV0A 5J0SA 3PR4A 4UB4A 2BDUA 3GIKA 1Q3VA 3C1YA 4B9UA 2F76X 1S97A 4FZLA 2GOLA 4PL2A 3HPOA 2D6FC 4M6WB 9ICVA 3QU4A 3SI8A 2DF4B 2FDRA 2R8HA 8ICJA 4O3RA 1XO0A 1VLBA 4IRKA 2Y9TA 3V6HA 4DL3A 2I6XA 3PNCA 3RB4A 1ZQAA 2ZJ5A 1L8LA 3JPTA 2BPCA 2W9CB 3QNMA 4O3MA 5AKGA 3BZKA 1DGSA 2XVTA 1MQ3A 4TQRA 4B9SA 1ZETA 5KTQA 4Y2YA 4CF4A 3WU2U 1N56A 3J81j 2G08A 1ZQGA 5J2JA 3HJEA 3N4MB 4DOCA 3CW2C 3QZ7A 4O3SA 4UAWA 1RZTA 2C2EA 2EAOA 3BS7A 5J2HA 2XY6A 1NZBA 2RHFA 3BZCA 4B9TA 3KHRA 1U49A 4ECVA 2LKYA 3E0FA 1S0VA 2PFQA 2CN1A 4RQ4A 4DFDA 1L7NA 3RB0A 4KN4A 5KFGA 4IQUA 4KLLA 4NM2A 4RQ3A 4GXKA 3T5HA 5EWGA 4AYBF 4KLDA 1FEZA 1O08A 2ESEA 2BZFA 3RRHA 9ICJA 4FE3A 1FO4A 1MN8A 2FPLA 3QE9Y 5AK3A 5AKHA 4JV2A 2AXTU 2F44A 4UB2A 5HHIA 5CB1A 4YN4A 1X9WA 3I1YA 3K1ZA 4TUSA 4KLGA 1X40A 4OD0A 7ICQA 4UB6U 8ICFA 4EELA 5J0TA 5HR6A 4F3OA 2F8KA 2KSOA 3ZD9A 4IC9A 3KBBA 3WK5A 3A0BU 4I2EA 3I28A 5HNKA 4QWAA 1ZQWA 3N7SC 1X9MA 1JI7A 3BQ2A 3C29A 5KFRA 5AM1A 5ALLA 3MFIA 1U48A 3T5LA 4J9KA 2PI5A 2EDUA 2CRXA 1ZQKA 4F5PA 5F9LA 3TAPA 3LVWA 5CP2A 4YXMA 3UXNA 4PGYA 2ZIVB 1D9DA 1HUOA 2F2AB 4BJQA 3SEIA 5ALMA 3KOOA 4FS2A 2DKXA 2KZ3A 3PZPA 3V7LA 5D49A 2BDPA 4CE6A 3OJSA 3S6JA 2JHDA 2NRTA 3V6JA 4EZ6A 1MA7A 4IS7A 3QX7A 1S5LU 3WK7A 3HWTA 3ONNA 4MHVA 4LVSA 4Z6EA 5KG1A 4B9NA 7ICMA 2LHTA 5KT6A 4IRDA 4PL1A 5AKKA 4DL2A 3T79A 2FLLA 3RJGA 3B0YA 1UT8A 3Q8SB 4EEKA 2KEYA 5AKIA 4NM1A 2KP7A 1T8EA 4UQGA 4RPZA 4C7ZA 1AROP 2LPEA 5ALRA 5J2DA 2JGAA 2KFZA 5AM4A 5KL8B 9ICQA 4OJLA 1COKA 1DK2A 1SXDA 5AIBA 2RP5A 2B0CA 2YMQA 4IRCA 3UQ0A 4AP9A 3TFRA 3PVXA 1BPEA 2F1JA 2O6KA 3CP8A 2VA8A 2ZJAA 1SL2A 2KJ9A 3C1ZA 4O3NA 5FP0A 2JZBA 1SWWA 1RQLA 9ICIA 5KFLA 4MEXA 4RQNA 1B0XA 2W9CA 1UPHA 5J2FA 4I28A 2ODGA 5BOMA 4ECQA 1XS9D 1ZQFA 2LMRA 1TK5A 1ZQYA 5KFAA 4LZDA 4NLGA 1SKRA 3H8MA 1X9SA 4QW9A 4ED0A 3QZ8A 3JPOA 3GIJA 3ZDBA 2W04A 2F3NA 3AM9A 3F53A 3OGUA 4DL7A 4YMMA 2XGPA 2KVSA 2M0NA 1NJXA 2Z7JA 3AU6A 1ZQTA 4HAIA 2W3RA 3HP6A 1DK3A 4QZ8A 1XSNA 4CCHA 2VIXA 2ZIXB 3IDWA 3WKEA 4JMUA 2IHNA 4ECUA 1SV0A 5J0YA 1S9FA 1U45A 5ALNA 1LKYA 2W54A 2XC9A 4YD1A 1Z4NA 2DWQA 1NZPA 2KG5A 2YTUA 4QW8A 3B9JA 1CI4A 3GZFA 5AKYA 5KAIU 1S0NA 2NRWA 4DWIA 5AKJA 3QU2A 3E58A 1OUQA 4Z6DA 4JUZA 5DG7A 3ZDAA 5AK4A 1L8OA 1QQ7A 3RR7A 3KTQA 3PSTA 1L3TA 3OSNA 2EANA 2VKQA 4KLMA 1COOA 2D3DA 2ZIWA 4P4OA 2ZIVA 4ZOHC 3NGDA 4DOBA 5J8YA 3BQ1A 3C5FA 1XC9A 2E1EA 5ALSA 4C4TA 4RQ7A 3NVVA 5CA7A 4F2SA 1RYUA 4I2JA 1NJWA 2PI4A 4OO1J 3T5JA 1CUKA 5G5GA 4UAZA 1A77A 5KG6A 2KHVA 2OYYA 1QH9A 1S0OA 1N61A 4P2HA 4ZH4A 1KRPA 2WFAA 7ICKA 4ED3A 2EQYA 3ALRA 2UVUA 2BR0A 2AGOA 3AN1A 4RT2A 4ECYA 1S76D 1H38A 2C22A 1YZ6A 2R8GA 1ZQPA 3BS5A 2ZXHA 2BHNA 2FE9A 1BPXA 4DF4A 2FLPA 5ALDA 4Y2UA 4NLCA 4QZHA 3GU3A 4LZGA 4FO6A 4GXIA 1N60A 2NRVA 3RH5A 1XSLA 4R63A 1NK7A 1ZQOA 4F5NA 8ICZA 4I27A 2NO5A 3TANA 3ISBA 5KFHA 2G0AA 4Y2TA 2Y0SC 4DLEA 4PJ0U 3M9MB 1SB3C 3LWLA 2DFLA 2Y9UA 2V4QA 1FIQA 2GWSA 4YG2A 3GIMA 2R8JA 3CRXA 1JUDA 3PR5B 4UBBA 1BPBA 3V72A 2KD1A 2BQRA 4I2GA 4DFJA 2E8OA 4GIBA 2ATLA 5GTIU 5CJ7A 1NI3A 4RUAA 5JRTA 2QARB 5KFCA 5KT4A 5KFUA 2E3TA 2WAQC 1N63A 2YQEA 2B6GA 2K8AA 5B66U 2AGQA 1ZYQA 2IMWP 2W11A 4UAVA 5J2KA 5ALZA 8ICOA 4DSLA 1SIJA 2RLTA 3DV9A 3V6KA 2KOBA 2GH1A 5EE0A 2PFNA 2ZIXA 4BWMA 3H0RB 5KFOA 3Q8KA 2HCFA 4Y2VA 3TFSA 7ICUA 3ZI4A 4KLQA 5AM0A 4NL9A 2G07A 5J0RA 5J2GA 1L3UA 1YT3A 1T7PA 1HIWA 3N28A 2P6UA 1L7OA 3TI0A 1BPYA 3KHHA 4YR0A 5HR7A 2LYAA 2UVRA 5JU5A 4QWCA 3N7RC 4RQ1A 3PSFA 2M9NA 4TURA 1SKWA 3EPGA 3GQCA 3QEAZ 4GC7A 1JX4A 9ICXA 5DQGA 3OHBA 2DBYA 3JPNA 4I2BA 4I2HA 4F91B 4A8EA 2XY5A 4MFFA 4C4SA 5DKWA 2AJQA 4JWMA 3Q8MA 3DDHA 5EE3A 4F72A 1DOQA 3PW5A 1TAMA 2P35A 4C80A 5IIOA 2VA3A 1KSPA 1J97A 2DKZA 1ZQQA 2OXOA 2ZXIA 3H40A 4RQ0A 2KICA 1X9XA 8ICXA 2JH7A 1ZQVA 4QZAA 1PK1B 2YB4A 3R9KA 1CRXA 1WWVA 2MRLA 3V7JA 4C7YA 1CEZA 3U26A 3MGIA 3THVA 2WF8A 5AI5A 4O5EA 7ICVA 2HW3A 1J2MA 3H0MB 5DDMA 1ZQUA 2NO4A 4YMOA 4P0QB 3M7DA 2AQ4A 4YFKA 1ZQSA 2JEFA 2DUYA 4ED8A 2OHFA 4M04A 3QUCA 4NLZA 1IG6A 1L6NA 2H3IA 1JROA 5DG8A 2RQ5A 5J0XA 2PMZC 4M2YA 2KKPA 1X6IA 2Q0ZX 1N2XA 2ISOA 3MR6A 3EYZA 2VA2A 2R18A 4EYHB 3DEEA 2BQ3A 2OCEA 5ALFA 5ALJA 2FMQA 8ICGA 4RT3A 1UT5A 2YMPA 1JIHA 1XSPA 4UAUA 7ICOA 2Y0SF 3WKAA 4DSIA 4RNOA 7ICJA 2YX8A 1WYGA 5TZVA 4KLEA 5IIIA 3AMZA 4J9NA 5L1IA 2W9AA 8ICKA 2HMXA 2QARA 4R66A 2JEJA 4EBCA 4IL6U 4BWJA 2JR5A 5J0WA 9ICTA 1B4FA 4BX9C 2HDOA 4K4GA 1NKEA 4I2AA 1ZQBA 2K4PA 4R8UB 2WB1C 5ALYA 2WAQF 4KMOB 4PHDA 9ICOA 2FPMA 3L3FX 4DSKA 3SQIA 2ISPA 2P66A 4UB3A 2EZXA 3C2KA 4PPXA 3B0XA 3PY8A 2ZJ8A 2HHSA 2WF7A 5K4LA 2HI0A 1DGJA 2XO7A 3C21A 4JB3A 3RBEA 4TUQA 4O5CA 1MSWD 1Z4OA 3O0FA 4EENA 3HW8A 2DQNB 1HJPA 1S8OA 2WF5A 3LK9A 5CRXA 1RDFA 2IBKA 1PK3A 5IIJA 4QIWC 2KVCA 2C28A 4I29A 2LM4A 1Z1BA 4C8NA 4J9LA 1ZQ1C 5DB9A 4M9LA 4NWIA 2PFPA 3PW0A 5C5JA 4XUSA 4EX6A 4CF3A 3OTQA 2MAXA 5AM2A 1JALA 3LVVA 3M1YA 5ALKA 4UAYA 4F71A 2AH5A 4DSFA 2E8MA 2JV3A 1NNLA 3AL0B 4F4XA 1DXSA 3HRDD 5ALHA 2OEHA 4DQPA 1ZQJA 3OPXA 1OW5A 4O0IA 3JPSA 4DF8A 3RJKA 3MABA 8ICMA 5B5EU 2ASJA 1K5OA 4ELVA 1PK1A 3ETLA 4JK1A 2HHWA 3QUQA 3UMCA 5DDYA 1D8YA 4B6JA 4O5KA 3D2NA 1LVHA 4XRHA 3K75D 4P0QA 3UMBA 2ZUBA 2P6RA 4FZNA 3SD7A 2F1IA 2QB0B 3KHLA 5J2CA 3QU5A 3HILA 2FMPA 4CDGA 3WK4A 4KLIA 3PV8A 4M6WA 9ICFA 1ZQMA 3PX0A 4RQ6A 1PVQA 9ICPA 5EOZA 5AKZA 4RPYA 4DFMA 3QU9A 5AKEA 1NJZA 1T4GA 2KJ8A 3MGHA 4IQWA 1KFDA 1UQVA 2PMZF 3E2EA 4F2RA 2NYVA 2HBKA 1SZPA 1Z00B 2ZUDA 3UXPA 2CXYA 1KW4A 1QTMA 3EZ5A 2W03A 1Q46A 2MA1A 3F2DA 4FS1A 4EX7A 1X2IA 3WK6A 4C4RA 3ICXA 3SV3A 4Y2SA 5AI0A 5KFBA 5DBCA 3RJJA 4F8RA 5BOLA 3UM9A 2KIWA 4PGQA 1Q8KA 1S0MA 4I2CA 2E5SA 3SAGA 4M47A 3PX6A 2QLTA 3QXGA 3RAXA 2FMSA 1Y88A 4LJXA 4IR9A 1TFRA 4QZBA 3ORYA 2EZZA 1ZRMA 4DFPA 8ICCA 7ICTA 3G6XA 1DRGA 4B9MA 4PHPA 2W8KA 3PW7A 4US8A 4F5QA 1K1QA 1KQQA 9ICUA 4NY8A 3FC4A 3HX0A 4QJFB 2H5XA 5J2AA 1RM6C 1NK8A 2HBJA 2WB1F 3NASA 3NS1A 2AGPA 1ZOLA 1AQ6A 2KN7A 4X5VA 1NK0A 2BCQA 2KKVA 1T3QA 4ECXA 1ZQEA 2OWOA 1Z19A 2K60A 5ALEA 4ECRA 4GLXA 4EZ9A 4QZCA 2V4RA 1URJA 3PMLA 4ECZA 5ALWA 1X66A 4DQQA 4I2FA 3KZXA 1S10A 3UMGA 4OJ5A 3MFHA 4ECTA 4GC6A 2A1JB 2JH1A 2QKQA 2EAPA 3PSIA 4Q8FA 9ICCA 4XA5A 4DS5A 1JMSA 5CHGA 5KFTA 4KLHA 1SWVA 3L5KA 3WKBA 1QLNA 3V7KA 8ICUA 3C2MA 5KFPA 3PSPA 4RUCA 7ICRA 4IR1A 3MGVA 1PZNA 4DL6A 1BNOA 3LDAA 4DSEA 3MDCA 8ICIA 2VJ4A 4PZOA 4UBCA 3TADC 4J9SA 4KLOA 5F3XB 4K4HA 2EH9A 1WCLA 5J0QA 2QB0A 1KTQA 3H7IA 5KG0A 3C23A 2HOIA 4UB1A 3M9NB 2D8CA 2IOHA 4DS4A 2BQUA 5JUMA 4YD2A 2WTFA 1BNPA 4F50A 1IM4A 3SMVA 3PO4A 2KE7A 4DSJA 5KG3A 2W7OA 3RFAA 2XY7A 1F44A 2QB1A 3G6VA 4YP3A 1LV5A 1OXJA 2DGZA 2DL0A 5KNIA 1UA1A 3BJYA 3FAHA 3C2LA 3MR5A 4J03A 3AU2A 5ALUA 5KFQA 1Z00A 3WKDA 4KLTA 5KG5A 5G5HA 4IQTA 1VDVA 2KJ5A 3RRGA 8ICSA 2W8LA 5KFMA 2AQ0A 1SKSA 1WG8A 3ZDDA 2LM1A 4OCZA 4QWDA 3PMNA 8ICAA 8ICPA 2KNJA 4U7CA 4RQ5A 5J2BA 1IXRA 5C0YA 5EE1A 3ISDA 1L7MA 4BXOB 2KMDA 4QZEA 1SZHA 3K1RB 1BVSA 3RJHA 8ICRA 2NV3A 4AYBC 5KFFA 1LB2B 3M6KA 5GTHU 1K1SA 2FI1A 5A0LA 1RG6A 1D8LA 1Q3UA 3K4GA 5HMLA 2G5HB 2F8LA 1U47A 2UVVA 2JXJA 1VJ5A
chains in the Genus database with same CATH topology
1OW5A 5F3XB 2ESEA 2YTUA 1SV0C 2LPEA 2QB0A 1PK1A 3TACB 2QARA 2F44A 2Y9UA 1V85A 1COKA 2D8CA 1SXDA 3BQ7A 1X40A 1SGGA 1B4FA 2L5YA 1WWUA 2DKZA 3KKAA 2KE7A 2E8OA 2EANA 2F8KA 2K4PA 2KSOA 1X9XA 1SV4A 2D3DA 2QB0B 1PK1B 5JRTA 2QB1A 3HILA 2QARB 5J8YA 1WWVA 1OXJA 2DL0A 4RQNA 5KNIA 1B0XA 1JI7A 2B6GA 2K60A 5J8YC 1X66A 2LMRA 2KSOB 2Y9TA 2KIVA 2QKQA 2EAPA 3SEIA 1UQVA 4PZNA 1F0MA 3KKAC 3H8MA 2DKXA 1PK3A 1UCVA 1KW4A 1V38A 2GLEA 2KMDA 5L1MA 2F3NA 3K1RB 4NL9A 5JTIA 3SENA 4IS7A 3BS5B 3BS5A 4MHVA 2E8NA 2FE9A 3TADA 2EAOA 3BS7A 4NL9C 4RQMA 3IDWA 1Z1VA 1RG6A 2ES6A 1SV0A 5JU5A 1LKYB 2E8MA 2E8PA 2JV3A 1LKYA 4PZOA 4NJ8A 3TADC 1DXSA 1SXEA 2KG5A 2EAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW5 A;  5F3X B;  2ESE A;  2YTU A;  1SV0 C;  2LPE A;  2QB0 A;  1PK1 A;  3TAC B;  2QAR A;  2F44 A;  2Y9U A;  1V85 A;  1COK A;  2D8C A;  1SXD A;  3BQ7 A;  1X40 A;  1SGG A;  1B4F A;  2L5Y A;  1WWU A;  2DKZ A;  3KKA A;  2KE7 A;  2E8O A;  2EAN A;  2F8K A;  2K4P A;  2KSO A;  1X9X A;  1SV4 A;  2D3D A;  2QB0 B;  1PK1 B;  5JRT A;  2QB1 A;  3HIL A;  2QAR B;  5J8Y A;  1WWV A;  1OXJ A;  2DL0 A;  4RQN A;  5KNI A;  1B0X A;  1JI7 A;  2B6G A;  2K60 A;  5J8Y C;  1X66 A;  2LMR A;  2KSO B;  2Y9T A;  2KIV A;  2QKQ A;  2EAP A;  3SEI A;  1UQV A;  4PZN A;  1F0M A;  3KKA C;  3H8M A;  2DKX A;  1PK3 A;  1UCV A;  1KW4 A;  1V38 A;  2GLE A;  2KMD A;  5L1M A;  2F3N A;  3K1R B;  4NL9 A;  5JTI A;  3SEN A;  4IS7 A;  3BS5 B;  3BS5 A;  4MHV A;  2E8N A;  2FE9 A;  3TAD A;  2EAO A;  3BS7 A;  4NL9 C;  4RQM A;  3IDW A;  1Z1V A;  1RG6 A;  2ES6 A;  1SV0 A;  5JU5 A;  1LKY B;  2E8M A;  2E8P A;  2JV3 A;  1LKY A;  4PZO A;  4NJ8 A;  3TAD C;  1DXS A;  1SXE A;  2KG5 A;  2EAM A; 
#chains in the Genus database with same CATH topology
 2RDI A;  4JV0 A;  1BPD A;  3PX4 A;  4R64 A;  4US9 A;  4PGX A;  4JWN A;  2A1A A;  1ZD2 P;  2C2R A;  5AKL A;  2W55 A;  4ECW A;  9ICK A;  5AK5 A;  3RH6 A;  4QWB A;  5KT3 A;  4UAS A;  3QUT A;  4J9R A;  3TQ1 A;  2HHT A;  1QSY A;  2H3V A;  4YR2 A;  1MC8 A;  2H3Q A;  7ICI A;  1J2N A;  3N7P D;  5EE9 A;  4HYK A;  4NLK A;  4DFK A;  4C8L A;  1ZQI A;  4DEZ A;  2KTQ A;  2A1J A;  2MU2 A;  1NKC A;  5DLG A;  2Q4T A;  4DCC A;  1MQ2 A;  4NLN A;  3OJU A;  5ALG A;  2K8C B;  7ICL A;  2NRX A;  1KDH A;  1T3N A;  1T94 A;  2KK0 A;  2JEI A;  2BCU A;  1YZ7 A;  1SL0 A;  4ED7 A;  4O3P A;  4KLJ A;  3OHA A;  1PUZ A;  4YR3 A;  3FM9 A;  1IV8 A;  5AM3 A;  5H2F U;  2KZM A;  5E79 U;  3NVW A;  4DL4 A;  2RRD A;  4RPX A;  1O03 A;  5L1M A;  4ELU A;  1WCN A;  7ICG A;  9ICB A;  3H8W A;  4QZI A;  5JTI A;  3F5E A;  1KEJ A;  4Y2P A;  4EEY A;  5J29 A;  3IHQ B;  4UB5 A;  5KFI A;  1Z3E B;  2G5I B;  4KLU A;  4RZR A;  1BGX T;  5AKX A;  2HHQ A;  4DQS A;  1NOM A;  4KLF A;  5DQI A;  4B9V A;  4YMN A;  3RTV A;  3G6Y A;  3RJE A;  3H8S A;  3QEB Z;  4ED1 A;  4ED6 A;  1N48 A;  4NJ8 A;  3M8R A;  5KAF U;  8ICV A;  2LI6 A;  2HOF A;  2GO7 A;  3EW9 A;  3TAC B;  2XIC A;  4DQI A;  2W3S A;  3ZDC A;  4UB8 U;  4PH5 A;  3IP4 B;  1ZXI A;  2XCP A;  1ZD4 A;  1A0P A;  5DB7 A;  1RXW A;  1D9F A;  5DBB A;  3OSP A;  3WK8 A;  5KG7 A;  2R8K A;  3KHG A;  1TK0 A;  1P7D A;  4CRX A;  2HOQ A;  5D4B A;  4K4I A;  8ICQ A;  5KFE A;  4G9B A;  2JZB B;  3RB3 A;  2ASD A;  5EWE A;  4OJP A;  5HP4 A;  1X6J A;  2KV2 A;  3M9O B;  4F4Z A;  2AU0 A;  3GDX A;  3NVZ A;  3LYS A;  5J0O A;  1KKX A;  1ZQH A;  4BXO A;  2WF9 A;  5AIC A;  4M9H A;  1S77 D;  3Q8P B;  4C0Z A;  2ZTC A;  1JXL A;  4YVZ A;  3GII A;  2BKE A;  2LYH A;  2HHU A;  4RQ8 A;  4KLS A;  4MF2 A;  5CR0 A;  1F0M A;  2PKE A;  4DLG A;  2V9W A;  3Q8L A;  2FLN A;  5KFY A;  1SL1 A;  4ICA A;  5IIM A;  3AQF A;  1UCV A;  5L1J A;  2GLE A;  4JV1 A;  4ACO A;  4MF8 A;  3C5G A;  4Q8E A;  4PHE A;  1JXE A;  2E8N A;  1QSS A;  3H0L B;  2ES6 A;  2XID A;  1LKY B;  1RYR A;  2E8P A;  2G06 A;  5AI6 A;  1ZJM A;  2K4E A;  3NVY A;  1KFT A;  1RQN A;  2IHM A;  2EAM A;  1TKD A;  8ICY A;  4Q45 A;  2XCA A;  1SV0 C;  5DGB A;  5J2E A;  1XU4 A;  4MFC A;  3T5K A;  4GFJ A;  5BPC A;  4Z6C A;  1KN5 A;  2YML A;  4C8K A;  3NUQ A;  1TAU A;  4NLB A;  4UAT A;  4YXJ A;  1XWL A;  1ZRN A;  3F5A A;  4DQR A;  4QZF A;  2J6T A;  2FJ6 A;  3BQ0 A;  4E0D A;  4KIT B;  2DPJ A;  2DPI A;  1KFS A;  5DGA A;  3HKZ C;  2ZIW B;  5D46 A;  3EUB 2;  3SAH A;  3F2B A;  4BDP A;  4GXJ A;  2I5H A;  1EXN A;  1GO3 F;  1TE2 A;  2N1R A;  7ICN A;  3I76 A;  2BPF A;  5KFZ A;  4C8M A;  4I2I A;  2A3V A;  9ICG A;  5J8Y C;  1QQ6 A;  4M9J A;  7ICP A;  5T14 A;  3RF9 A;  2YY6 A;  2I9G A;  3UXO A;  2VAN A;  3CYM A;  4KX5 A;  2ZIU B;  2KIV A;  1ZQR A;  2HSZ A;  8ICN A;  2ZUC A;  4PZN A;  3TAR A;  2MUT B;  4FBU A;  5AM5 A;  4KX3 A;  4XQ8 A;  1ZD5 A;  1RXV A;  1KBU A;  3M8S A;  4PHA A;  1ZJN A;  1HUZ A;  2KFN A;  2WF6 A;  2IA6 A;  4CGZ A;  3BS5 B;  3AEV A;  1A6S A;  3ED5 A;  4RQM A;  4Y2Q A;  8ICL A;  2BGW A;  1M6Y A;  3MR3 A;  2JMG A;  1B22 A;  5ALO A;  5DB8 A;  2G09 A;  2LYB A;  3KD3 A;  1SXE A;  4MEY A;  5IIN A;  1V97 A;  3VCB A;  4FFD A;  5DB6 A;  1UHU A;  7ICS A;  1U9L A;  5KFX A;  3H8J A;  1TV9 A;  3H4D A;  4CNQ A;  9ICH A;  3PO5 A;  4QNL A;  3IV6 A;  4P0P B;  5ALX A;  3BQ7 A;  5KFV A;  4OJO A;  5CEH A;  3T3F A;  3PW4 A;  3RJF A;  9ICE A;  1X42 A;  5AI8 A;  3ETR A;  3D2Q A;  1WWU A;  2K4I A;  1PVR A;  1NKB A;  7ICF A;  1FFV A;  4WJ3 B;  2A19 A;  3RR8 A;  5DBA A;  3SAF A;  5KFJ A;  1N5W A;  4R8U A;  4UW9 A;  1L5U A;  3ISC A;  3MDA A;  3LWM A;  1ZQD A;  8ICH A;  4M9N A;  5HHH A;  2ZG6 A;  4QZD A;  5HMM A;  2AHO B;  4F92 B;  2WHE A;  1QQ5 A;  5AI9 A;  3NTU A;  5KFW A;  1ZQX A;  5DQH A;  3KKA C;  2BCV A;  2K4H A;  1NK6 A;  4QZ9 A;  3Q8R B;  3TKA A;  3SV4 A;  2R8I A;  3JPP A;  4IQV A;  3SR6 A;  1B43 A;  3QYP A;  1KL9 A;  5J0P A;  4TQS A;  2HHV A;  3HT3 A;  9ICA A;  1F5S A;  3M6Z A;  2VJ5 A;  1ZQN A;  4NL9 C;  1Z1V A;  4RQ2 A;  4QIW F;  2I1Q A;  5KFN A;  3RBD A;  1TK8 A;  4KN7 A;  4BGD A;  2E1F A;  3ZDE A;  3EWA A;  4P4P A;  5TIS U;  3JPR A;  2ALZ A;  8ICT A;  3RAQ A;  2NRZ A;  4Z6F A;  1RPL A;  1N62 A;  4EYI B;  2W7P A;  3IN5 A;  3A0H U;  2HVI A;  3IG5 A;  3NRW A;  1PVP A;  4F5O A;  4ED2 A;  4M0A A;  1SGG A;  1JN3 A;  5KFD A;  2HVH A;  5L1K A;  3MR2 A;  3HKZ F;  4USA A;  7ICH A;  2JRZ A;  3IRU A;  2H3F A;  2ZIU A;  1XNS A;  1QCK A;  4ECS A;  4KMU A;  2W9B B;  2K89 A;  5CWR A;  4RNM A;  2MSN A;  2MUT A;  2C2D A;  5KG4 A;  3FDS A;  4Q43 A;  3JPQ A;  4J9P A;  9ICN A;  3PW2 A;  3IM1 A;  1L7P A;  2BCS A;  9ICL A;  1FFU A;  2EZY A;  3BDP A;  8ICB A;  1TAQ A;  4U6P A;  4ELT A;  3L4P A;  3CNH A;  4YCX A;  5IIK A;  5AK6 A;  1N5X A;  4F4K A;  3WK9 A;  5EWF A;  4C8O A;  2J6S A;  2J6U A;  4QWE A;  1V38 A;  2HBM A;  2W9M A;  5ALQ A;  3Q8Q B;  3F2C A;  1NK5 A;  4DO9 A;  2KHQ A;  1BPZ A;  2FPK A;  2JEG A;  3GV8 B;  5KFS A;  1A76 A;  2ZTD A;  4J9Q A;  3IG8 A;  1L3V A;  3RB6 A;  5AI4 A;  4P0P A;  4J9M A;  5ALI A;  3UQ2 A;  3FYH A;  4O3O A;  3QUB A;  1ZQC A;  5DG9 A;  4CF5 A;  2HHX A;  2Y1J A;  4F4Y A;  5AIA A;  1C20 A;  4Q44 A;  2YN4 A;  3GFK B;  3GV5 B;  2OH2 A;  3NRZ A;  4Y2J A;  1ZD3 A;  5L1L A;  3C28 A;  1NK9 A;  7ICE A;  4BUG A;  2XI9 A;  3MC1 A;  4EBE A;  1NK4 A;  2IOF K;  3GIL A;  2L5Y A;  1NJY A;  3D2S A;  3KKA A;  3RH4 A;  3ZD8 A;  1TVA A;  9ICW A;  4Y2X A;  2PFO A;  2YB1 A;  8ICW A;  2UVW A;  1SV4 A;  3AUO A;  8ICE A;  1ED1 A;  2KZZ A;  5KT5 A;  3VC8 A;  4F4W A;  4OJ6 A;  4F93 B;  5KFK A;  4KTQ A;  5ALP A;  3AQE A;  2ZTE A;  3MBY A;  3SZ2 A;  2OM6 A;  1JRP A;  4DL5 A;  4P4M A;  4QZG A;  1ECW A;  4DOA A;  1ZQL A;  4O9M A;  4FBT A;  4J9O A;  2IOF A;  2KSO B;  2BPG A;  1V9P A;  4RNN A;  3TAQ A;  2PXI A;  4G3I A;  3D6J A;  9ICS A;  1KLN A;  3KZI U;  2F1H A;  2B21 A;  4O3Q A;  3H4B A;  5AHX A;  4F5R A;  4UAR A;  4TUP A;  9ICM A;  1WUD A;  3SEN A;  5L9X A;  4RU9 A;  1ZQZ A;  4EBD A;  1RYS A;  4FZM A;  3TAD A;  3SYZ A;  4B9L A;  1QSL A;  4YQW A;  2LBO A;  5KT7 A;  1HEK A;  2Y1I A;  2HBL A;  2K8B B;  4I2D A;  5KG2 A;  1UA0 A;  1IIP A;  3EPI A;  5KL1 B;  3RJI A;  3N97 B;  2CPR A;  4NXZ A;  5KT2 A;  2BCR A;  5J0U A;  2YMM A;  1XO1 A;  5IIL A;  4R65 A;  3KFU F;  1D8B A;  5ALV A;  2H3Z A;  1C7Y A;  2W9B A;  5F9N A;  3GV7 B;  5J2I A;  4Y2R A;  1U4B A;  3QU7 A;  1V85 A;  2RDJ A;  3UPQ A;  3BQT A;  2W43 A;  3WKC A;  4M9G A;  5DLF A;  1L3S A;  2ASL A;  4MFA A;  2XGQ A;  9ICR A;  5ALT A;  2F77 X;  4NV0 A;  5J0S A;  3PR4 A;  4UB4 A;  2BDU A;  3GIK A;  1Q3V A;  3C1Y A;  4B9U A;  2F76 X;  1S97 A;  4FZL A;  2GOL A;  4PL2 A;  3HPO A;  2D6F C;  4M6W B;  9ICV A;  3QU4 A;  3SI8 A;  2DF4 B;  2FDR A;  2R8H A;  8ICJ A;  4O3R A;  1XO0 A;  1VLB A;  4IRK A;  2Y9T A;  3V6H A;  4DL3 A;  2I6X A;  3PNC A;  3RB4 A;  1ZQA A;  2ZJ5 A;  1L8L A;  3JPT A;  2BPC A;  2W9C B;  3QNM A;  4O3M A;  5AKG A;  3BZK A;  1DGS A;  2XVT A;  1MQ3 A;  4TQR A;  4B9S A;  1ZET A;  5KTQ A;  4Y2Y A;  4CF4 A;  3WU2 U;  1N56 A;  3J81 j;  2G08 A;  1ZQG A;  5J2J A;  3HJE A;  3N4M B;  4DOC A;  3CW2 C;  3QZ7 A;  4O3S A;  4UAW A;  1RZT A;  2C2E A;  2EAO A;  3BS7 A;  5J2H A;  2XY6 A;  1NZB A;  2RHF A;  3BZC A;  4B9T A;  3KHR A;  1U49 A;  4ECV A;  2LKY A;  3E0F A;  1S0V A;  2PFQ A;  2CN1 A;  4RQ4 A;  4DFD A;  1L7N A;  3RB0 A;  4KN4 A;  5KFG A;  4IQU A;  4KLL A;  4NM2 A;  4RQ3 A;  4GXK A;  3T5H A;  5EWG A;  4AYB F;  4KLD A;  1FEZ A;  1O08 A;  2ESE A;  2BZF A;  3RRH A;  9ICJ A;  4FE3 A;  1FO4 A;  1MN8 A;  2FPL A;  3QE9 Y;  5AK3 A;  5AKH A;  4JV2 A;  2AXT U;  2F44 A;  4UB2 A;  5HHI A;  5CB1 A;  4YN4 A;  1X9W A;  3I1Y A;  3K1Z A;  4TUS A;  4KLG A;  1X40 A;  4OD0 A;  7ICQ A;  4UB6 U;  8ICF A;  4EEL A;  5J0T A;  5HR6 A;  4F3O A;  2F8K A;  2KSO A;  3ZD9 A;  4IC9 A;  3KBB A;  3WK5 A;  3A0B U;  4I2E A;  3I28 A;  5HNK A;  4QWA A;  1ZQW A;  3N7S C;  1X9M A;  1JI7 A;  3BQ2 A;  3C29 A;  5KFR A;  5AM1 A;  5ALL A;  3MFI A;  1U48 A;  3T5L A;  4J9K A;  2PI5 A;  2EDU A;  2CRX A;  1ZQK A;  4F5P A;  5F9L A;  3TAP A;  3LVW A;  5CP2 A;  4YXM A;  3UXN A;  4PGY A;  2ZIV B;  1D9D A;  1HUO A;  2F2A B;  4BJQ A;  3SEI A;  5ALM A;  3KOO A;  4FS2 A;  2DKX A;  2KZ3 A;  3PZP A;  3V7L A;  5D49 A;  2BDP A;  4CE6 A;  3OJS A;  3S6J A;  2JHD A;  2NRT A;  3V6J A;  4EZ6 A;  1MA7 A;  4IS7 A;  3QX7 A;  1S5L U;  3WK7 A;  3HWT A;  3ONN A;  4MHV A;  4LVS A;  4Z6E A;  5KG1 A;  4B9N A;  7ICM A;  2LHT A;  5KT6 A;  4IRD A;  4PL1 A;  5AKK A;  4DL2 A;  3T79 A;  2FLL A;  3RJG A;  3B0Y A;  1UT8 A;  3Q8S B;  4EEK A;  2KEY A;  5AKI A;  4NM1 A;  2KP7 A;  1T8E A;  4UQG A;  4RPZ A;  4C7Z A;  1ARO P;  2LPE A;  5ALR A;  5J2D A;  2JGA A;  2KFZ A;  5AM4 A;  5KL8 B;  9ICQ A;  4OJL A;  1COK A;  1DK2 A;  1SXD A;  5AIB A;  2RP5 A;  2B0C A;  2YMQ A;  4IRC A;  3UQ0 A;  4AP9 A;  3TFR A;  3PVX A;  1BPE A;  2F1J A;  2O6K A;  3CP8 A;  2VA8 A;  2ZJA A;  1SL2 A;  2KJ9 A;  3C1Z A;  4O3N A;  5FP0 A;  2JZB A;  1SWW A;  1RQL A;  9ICI A;  5KFL A;  4MEX A;  4RQN A;  1B0X A;  2W9C A;  1UPH A;  5J2F A;  4I28 A;  2ODG A;  5BOM A;  4ECQ A;  1XS9 D;  1ZQF A;  2LMR A;  1TK5 A;  1ZQY A;  5KFA A;  4LZD A;  4NLG A;  1SKR A;  3H8M A;  1X9S A;  4QW9 A;  4ED0 A;  3QZ8 A;  3JPO A;  3GIJ A;  3ZDB A;  2W04 A;  2F3N A;  3AM9 A;  3F53 A;  3OGU A;  4DL7 A;  4YMM A;  2XGP A;  2KVS A;  2M0N A;  1NJX A;  2Z7J A;  3AU6 A;  1ZQT A;  4HAI A;  2W3R A;  3HP6 A;  1DK3 A;  4QZ8 A;  1XSN A;  4CCH A;  2VIX A;  2ZIX B;  3IDW A;  3WKE A;  4JMU A;  2IHN A;  4ECU A;  1SV0 A;  5J0Y A;  1S9F A;  1U45 A;  5ALN A;  1LKY A;  2W54 A;  2XC9 A;  4YD1 A;  1Z4N A;  2DWQ A;  1NZP A;  2KG5 A;  2YTU A;  4QW8 A;  3B9J A;  1CI4 A;  3GZF A;  5AKY A;  5KAI U;  1S0N A;  2NRW A;  4DWI A;  5AKJ A;  3QU2 A;  3E58 A;  1OUQ A;  4Z6D A;  4JUZ A;  5DG7 A;  3ZDA A;  5AK4 A;  1L8O A;  1QQ7 A;  3RR7 A;  3KTQ A;  3PST A;  1L3T A;  3OSN A;  2EAN A;  2VKQ A;  4KLM A;  1COO A;  2D3D A;  2ZIW A;  4P4O A;  2ZIV A;  4ZOH C;  3NGD A;  4DOB A;  5J8Y A;  3BQ1 A;  3C5F A;  1XC9 A;  2E1E A;  5ALS A;  4C4T A;  4RQ7 A;  3NVV A;  5CA7 A;  4F2S A;  1RYU A;  4I2J A;  1NJW A;  2PI4 A;  4OO1 J;  3T5J A;  1CUK A;  5G5G A;  4UAZ A;  1A77 A;  5KG6 A;  2KHV A;  2OYY A;  1QH9 A;  1S0O A;  1N61 A;  4P2H A;  4ZH4 A;  1KRP A;  2WFA A;  7ICK A;  4ED3 A;  2EQY A;  3ALR A;  2UVU A;  2BR0 A;  2AGO A;  3AN1 A;  4RT2 A;  4ECY A;  1S76 D;  1H38 A;  2C22 A;  1YZ6 A;  2R8G A;  1ZQP A;  3BS5 A;  2ZXH A;  2BHN A;  2FE9 A;  1BPX A;  4DF4 A;  2FLP A;  5ALD A;  4Y2U A;  4NLC A;  4QZH A;  3GU3 A;  4LZG A;  4FO6 A;  4GXI A;  1N60 A;  2NRV A;  3RH5 A;  1XSL A;  4R63 A;  1NK7 A;  1ZQO A;  4F5N A;  8ICZ A;  4I27 A;  2NO5 A;  3TAN A;  3ISB A;  5KFH A;  2G0A A;  4Y2T A;  2Y0S C;  4DLE A;  4PJ0 U;  3M9M B;  1SB3 C;  3LWL A;  2DFL A;  2Y9U A;  2V4Q A;  1FIQ A;  2GWS A;  4YG2 A;  3GIM A;  2R8J A;  3CRX A;  1JUD A;  3PR5 B;  4UBB A;  1BPB A;  3V72 A;  2KD1 A;  2BQR A;  4I2G A;  4DFJ A;  2E8O A;  4GIB A;  2ATL A;  5GTI U;  5CJ7 A;  1NI3 A;  4RUA A;  5JRT A;  2QAR B;  5KFC A;  5KT4 A;  5KFU A;  2E3T A;  2WAQ C;  1N63 A;  2YQE A;  2B6G A;  2K8A A;  5B66 U;  2AGQ A;  1ZYQ A;  2IMW P;  2W11 A;  4UAV A;  5J2K A;  5ALZ A;  8ICO A;  4DSL A;  1SIJ A;  2RLT A;  3DV9 A;  3V6K A;  2KOB A;  2GH1 A;  5EE0 A;  2PFN A;  2ZIX A;  4BWM A;  3H0R B;  5KFO A;  3Q8K A;  2HCF A;  4Y2V A;  3TFS A;  7ICU A;  3ZI4 A;  4KLQ A;  5AM0 A;  4NL9 A;  2G07 A;  5J0R A;  5J2G A;  1L3U A;  1YT3 A;  1T7P A;  1HIW A;  3N28 A;  2P6U A;  1L7O A;  3TI0 A;  1BPY A;  3KHH A;  4YR0 A;  5HR7 A;  2LYA A;  2UVR A;  5JU5 A;  4QWC A;  3N7R C;  4RQ1 A;  3PSF A;  2M9N A;  4TUR A;  1SKW A;  3EPG A;  3GQC A;  3QEA Z;  4GC7 A;  1JX4 A;  9ICX A;  5DQG A;  3OHB A;  2DBY A;  3JPN A;  4I2B A;  4I2H A;  4F91 B;  4A8E A;  2XY5 A;  4MFF A;  4C4S A;  5DKW A;  2AJQ A;  4JWM A;  3Q8M A;  3DDH A;  5EE3 A;  4F72 A;  1DOQ A;  3PW5 A;  1TAM A;  2P35 A;  4C80 A;  5IIO A;  2VA3 A;  1KSP A;  1J97 A;  2DKZ A;  1ZQQ A;  2OXO A;  2ZXI A;  3H40 A;  4RQ0 A;  2KIC A;  1X9X A;  8ICX A;  2JH7 A;  1ZQV A;  4QZA A;  1PK1 B;  2YB4 A;  3R9K A;  1CRX A;  1WWV A;  2MRL A;  3V7J A;  4C7Y A;  1CEZ A;  3U26 A;  3MGI A;  3THV A;  2WF8 A;  5AI5 A;  4O5E A;  7ICV A;  2HW3 A;  1J2M A;  3H0M B;  5DDM A;  1ZQU A;  2NO4 A;  4YMO A;  4P0Q B;  3M7D A;  2AQ4 A;  4YFK A;  1ZQS A;  2JEF A;  2DUY A;  4ED8 A;  2OHF A;  4M04 A;  3QUC A;  4NLZ A;  1IG6 A;  1L6N A;  2H3I A;  1JRO A;  5DG8 A;  2RQ5 A;  5J0X A;  2PMZ C;  4M2Y A;  2KKP A;  1X6I A;  2Q0Z X;  1N2X A;  2ISO A;  3MR6 A;  3EYZ A;  2VA2 A;  2R18 A;  4EYH B;  3DEE A;  2BQ3 A;  2OCE A;  5ALF A;  5ALJ A;  2FMQ A;  8ICG A;  4RT3 A;  1UT5 A;  2YMP A;  1JIH A;  1XSP A;  4UAU A;  7ICO A;  2Y0S F;  3WKA A;  4DSI A;  4RNO A;  7ICJ A;  2YX8 A;  1WYG A;  5TZV A;  4KLE A;  5III A;  3AMZ A;  4J9N A;  5L1I A;  2W9A A;  8ICK A;  2HMX A;  2QAR A;  4R66 A;  2JEJ A;  4EBC A;  4IL6 U;  4BWJ A;  2JR5 A;  5J0W A;  9ICT A;  1B4F A;  4BX9 C;  2HDO A;  4K4G A;  1NKE A;  4I2A A;  1ZQB A;  2K4P A;  4R8U B;  2WB1 C;  5ALY A;  2WAQ F;  4KMO B;  4PHD A;  9ICO A;  2FPM A;  3L3F X;  4DSK A;  3SQI A;  2ISP A;  2P66 A;  4UB3 A;  2EZX A;  3C2K A;  4PPX A;  3B0X A;  3PY8 A;  2ZJ8 A;  2HHS A;  2WF7 A;  5K4L A;  2HI0 A;  1DGJ A;  2XO7 A;  3C21 A;  4JB3 A;  3RBE A;  4TUQ A;  4O5C A;  1MSW D;  1Z4O A;  3O0F A;  4EEN A;  3HW8 A;  2DQN B;  1HJP A;  1S8O A;  2WF5 A;  3LK9 A;  5CRX A;  1RDF A;  2IBK A;  1PK3 A;  5IIJ A;  4QIW C;  2KVC A;  2C28 A;  4I29 A;  2LM4 A;  1Z1B A;  4C8N A;  4J9L A;  1ZQ1 C;  5DB9 A;  4M9L A;  4NWI A;  2PFP A;  3PW0 A;  5C5J A;  4XUS A;  4EX6 A;  4CF3 A;  3OTQ A;  2MAX A;  5AM2 A;  1JAL A;  3LVV A;  3M1Y A;  5ALK A;  4UAY A;  4F71 A;  2AH5 A;  4DSF A;  2E8M A;  2JV3 A;  1NNL A;  3AL0 B;  4F4X A;  1DXS A;  3HRD D;  5ALH A;  2OEH A;  4DQP A;  1ZQJ A;  3OPX A;  1OW5 A;  4O0I A;  3JPS A;  4DF8 A;  3RJK A;  3MAB A;  8ICM A;  5B5E U;  2ASJ A;  1K5O A;  4ELV A;  1PK1 A;  3ETL A;  4JK1 A;  2HHW A;  3QUQ A;  3UMC A;  5DDY A;  1D8Y A;  4B6J A;  4O5K A;  3D2N A;  1LVH A;  4XRH A;  3K75 D;  4P0Q A;  3UMB A;  2ZUB A;  2P6R A;  4FZN A;  3SD7 A;  2F1I A;  2QB0 B;  3KHL A;  5J2C A;  3QU5 A;  3HIL A;  2FMP A;  4CDG A;  3WK4 A;  4KLI A;  3PV8 A;  4M6W A;  9ICF A;  1ZQM A;  3PX0 A;  4RQ6 A;  1PVQ A;  9ICP A;  5EOZ A;  5AKZ A;  4RPY A;  4DFM A;  3QU9 A;  5AKE A;  1NJZ A;  1T4G A;  2KJ8 A;  3MGH A;  4IQW A;  1KFD A;  1UQV A;  2PMZ F;  3E2E A;  4F2R A;  2NYV A;  2HBK A;  1SZP A;  1Z00 B;  2ZUD A;  3UXP A;  2CXY A;  1KW4 A;  1QTM A;  3EZ5 A;  2W03 A;  1Q46 A;  2MA1 A;  3F2D A;  4FS1 A;  4EX7 A;  1X2I A;  3WK6 A;  4C4R A;  3ICX A;  3SV3 A;  4Y2S A;  5AI0 A;  5KFB A;  5DBC A;  3RJJ A;  4F8R A;  5BOL A;  3UM9 A;  2KIW A;  4PGQ A;  1Q8K A;  1S0M A;  4I2C A;  2E5S A;  3SAG A;  4M47 A;  3PX6 A;  2QLT A;  3QXG A;  3RAX A;  2FMS A;  1Y88 A;  4LJX A;  4IR9 A;  1TFR A;  4QZB A;  3ORY A;  2EZZ A;  1ZRM A;  4DFP A;  8ICC A;  7ICT A;  3G6X A;  1DRG A;  4B9M A;  4PHP A;  2W8K A;  3PW7 A;  4US8 A;  4F5Q A;  1K1Q A;  1KQQ A;  9ICU A;  4NY8 A;  3FC4 A;  3HX0 A;  4QJF B;  2H5X A;  5J2A A;  1RM6 C;  1NK8 A;  2HBJ A;  2WB1 F;  3NAS A;  3NS1 A;  2AGP A;  1ZOL A;  1AQ6 A;  2KN7 A;  4X5V A;  1NK0 A;  2BCQ A;  2KKV A;  1T3Q A;  4ECX A;  1ZQE A;  2OWO A;  1Z19 A;  2K60 A;  5ALE A;  4ECR A;  4GLX A;  4EZ9 A;  4QZC A;  2V4R A;  1URJ A;  3PML A;  4ECZ A;  5ALW A;  1X66 A;  4DQQ A;  4I2F A;  3KZX A;  1S10 A;  3UMG A;  4OJ5 A;  3MFH A;  4ECT A;  4GC6 A;  2A1J B;  2JH1 A;  2QKQ A;  2EAP A;  3PSI A;  4Q8F A;  9ICC A;  4XA5 A;  4DS5 A;  1JMS A;  5CHG A;  5KFT A;  4KLH A;  1SWV A;  3L5K A;  3WKB A;  1QLN A;  3V7K A;  8ICU A;  3C2M A;  5KFP A;  3PSP A;  4RUC A;  7ICR A;  4IR1 A;  3MGV A;  1PZN A;  4DL6 A;  1BNO A;  3LDA A;  4DSE A;  3MDC A;  8ICI A;  2VJ4 A;  4PZO A;  4UBC A;  3TAD C;  4J9S A;  4KLO A;  5F3X B;  4K4H A;  2EH9 A;  1WCL A;  5J0Q A;  2QB0 A;  1KTQ A;  3H7I A;  5KG0 A;  3C23 A;  2HOI A;  4UB1 A;  3M9N B;  2D8C A;  2IOH A;  4DS4 A;  2BQU A;  5JUM A;  4YD2 A;  2WTF A;  1BNP A;  4F50 A;  1IM4 A;  3SMV A;  3PO4 A;  2KE7 A;  4DSJ A;  5KG3 A;  2W7O A;  3RFA A;  2XY7 A;  1F44 A;  2QB1 A;  3G6V A;  4YP3 A;  1LV5 A;  1OXJ A;  2DGZ A;  2DL0 A;  5KNI A;  1UA1 A;  3BJY A;  3FAH A;  3C2L A;  3MR5 A;  4J03 A;  3AU2 A;  5ALU A;  5KFQ A;  1Z00 A;  3WKD A;  4KLT A;  5KG5 A;  5G5H A;  4IQT A;  1VDV A;  2KJ5 A;  3RRG A;  8ICS A;  2W8L A;  5KFM A;  2AQ0 A;  1SKS A;  1WG8 A;  3ZDD A;  2LM1 A;  4OCZ A;  4QWD A;  3PMN A;  8ICA A;  8ICP A;  2KNJ A;  4U7C A;  4RQ5 A;  5J2B A;  1IXR A;  5C0Y A;  5EE1 A;  3ISD A;  1L7M A;  4BXO B;  2KMD A;  4QZE A;  1SZH A;  3K1R B;  1BVS A;  3RJH A;  8ICR A;  2NV3 A;  4AYB C;  5KFF A;  1LB2 B;  3M6K A;  5GTH U;  1K1S A;  2FI1 A;  5A0L A;  1RG6 A;  1D8L A;  1Q3U A;  3K4G A;  5HML A;  2G5H B;  2F8L A;  1U47 A;  2UVV A;  2JXJ A;  1VJ5 A; 
#chains in the Genus database with same CATH homology
 1OW5 A;  5F3X B;  2ESE A;  2YTU A;  1SV0 C;  2LPE A;  2QB0 A;  1PK1 A;  3TAC B;  2QAR A;  2F44 A;  2Y9U A;  1V85 A;  1COK A;  2D8C A;  1SXD A;  3BQ7 A;  1X40 A;  1SGG A;  1B4F A;  2L5Y A;  1WWU A;  2DKZ A;  3KKA A;  2KE7 A;  2E8O A;  2EAN A;  2F8K A;  2K4P A;  2KSO A;  1X9X A;  1SV4 A;  2D3D A;  2QB0 B;  1PK1 B;  5JRT A;  2QB1 A;  3HIL A;  2QAR B;  5J8Y A;  1WWV A;  1OXJ A;  2DL0 A;  4RQN A;  5KNI A;  1B0X A;  1JI7 A;  2B6G A;  2K60 A;  5J8Y C;  1X66 A;  2LMR A;  2KSO B;  2Y9T A;  2KIV A;  2QKQ A;  2EAP A;  3SEI A;  1UQV A;  4PZN A;  1F0M A;  3KKA C;  3H8M A;  2DKX A;  1PK3 A;  1UCV A;  1KW4 A;  1V38 A;  2GLE A;  2KMD A;  5L1M A;  2F3N A;  3K1R B;  4NL9 A;  5JTI A;  3SEN A;  4IS7 A;  3BS5 B;  3BS5 A;  4MHV A;  2E8N A;  2FE9 A;  3TAD A;  2EAO A;  3BS7 A;  4NL9 C;  4RQM A;  3IDW A;  1Z1V A;  1RG6 A;  2ES6 A;  1SV0 A;  5JU5 A;  1LKY B;  2E8M A;  2E8P A;  2JV3 A;  1LKY A;  4PZO A;  4NJ8 A;  3TAD C;  1DXS A;  1SXE A;  2KG5 A;  2EAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...