2KSOB

Epha2:ship2 sam:sam complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
59
structure length
59
Chain Sequence
b'GMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Structure and function of the EphA2:SHIP2 SAM domain heterodimer
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 16
structure length 59
sequence length 59
ec nomenclature ec 3.1.3.86: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase.
pdb deposition date 2010-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ksoB00
1RG6A 4PZNA 4IS7A 1SXEA 2Y9TA 2KE7A 3TADA 1DXSA 2KMDA 1WWUA 4NJ8A 2ESEA 2EAMA 1SV0C 2E8MA 2LMRA 5JRTA 1UQVA 1F0MA 1WWVA 3H8MA 1JI7A 3KKAA 2K4PA 2D3DA 1V85A 1Z1VA 2JV3A 5J8YC 3BS7A 3TADC 2F8KA 3SEIA 1COKA 4RQNA 5F3XB 2DKXA 2DKZA 2ES6A 2K60A 1X40A 1B0XA 5L1MA 2EAPA 2Y9UA 3BQ7A 2KIVA 1SGGA 3BS5A 3BS5B 2F44A 3K1RB 3HILA 4NL9C 2QB0A 2LPEA 2QKQA 2QB0B 3TACB 1OXJA 3IDWA 2KSOA 2KSOB 2B6GA 1SXDA 1SV0A 2EAOA 1PK3A 2YTUA 5KNIA 2DL0A 2E8NA 1UCVA 2EANA 3SENA 2QB1A 1V38A 1KW4A 2QARA 5JU5A 2D8CA 4PZOA 3KKAC 1X9XA 5J8YA 1OW5A 2E8OA 2L5YA 5JTIA 2KG5A 2GLEA 1B4FA 4MHVA 2E8PA 2FE9A 2F3NA 1SV4A 1LKYA 1X66A 1LKYB 2QARB 4NL9A 4RQMA 1PK1A 1PK1B
chains in the Genus database with same CATH superfamily
4Y2XA 3PV8A 4I2IA 4NLKA 1T7PA 1SZHA 1L7MA 2JR5A 2MUTA 3LYSA 2VA8A 4XA5A 3ONNA 1T3QA 4RT2A 2EAMA 5KG2A 3CP8A 9ICSA 3NVWA 4GC6A 2JEIA 3NASA 1J2NA 2NO4A 4QIWF 3THVA 4FBTA 2V9WA 5EE0A 3KTQA 1ZD3A 2WTFA 3QU9A 3SD7A 3BZKA 4J9PA 4KTQA 3MC1A 9ICQA 2BDPA 4QIWC 5J0UA 2Q0ZX 3MFHA 3BQ0A 3DDHA 3NUQA 2ISOA 1HIWA 4JV2A 1WYGA 3C29A 4YN4A 5KFAA 3DEEA 4BXOA 4QZDA 5F9NA 5HMMA 2I9GA 2QKQA 4UAUA 1OXJA 2ASDA 4OJ6A 3VCBA 1TK8A 4DFPA 2DBYA 1NZBA 4EBCA 3UPQA 1O08A 2OXOA 3I28A 3SENA 4M47A 8ICUA 1XSNA 4B9NA 3PZPA 3PW4A 3BDPA 1D9FA 4I2JA 3I76A 2ZUDA 4KX5A 3C2KA 5KFGA 2HHWA 4I2AA 3FDSA 4F5QA 8ICMA 3C28A 7ICTA 5BOLA 4QWCA 5B66U 2W3SA 4DSJA 4UAWA 4B9MA 4FO6A 4O5EA 3D2NA 2E8PA 3H0RB 3PX6A 2EZZA 1TV9A 2HOFA 1U48A 2FDRA 1BPBA 5KG0A 2LYBA 4Y2RA 3MABA 1PK1B 4ELTA 4J9KA 4K4GA 2OCEA 3TAQA 3OHBA 1ZJMA 1QQ6A 2YMMA 2LYAA 1CUKA 4EZ6A 4NLZA 4DL5A 2LHTA 4R66A 1ZOLA 2W04A 5AM1A 3KKAA 1N62A 3UQ0A 4RU9A 4BX9C 1NKBA 3PSIA 4UBCA 2NRVA 4YMOA 5DGBA 4P0QB 4US8A 1JMSA 1ZQDA 1HEKA 2XVTA 5ALFA 3Q8PB 3V6JA 3AQEA 5EE1A 5KG7A 2KIVA 1MQ3A 2DPIA 4KLJA 2RHFA 4O5CA 5KFVA 5ALJA 1D9DA 3OPXA 3GFKB 4PL2A 2Q4TA 3EPGA 3V6HA 2EZXA 5IINA 2C2RA 4I2EA 2J6TA 3RJIA 2V4QA 4DOAA 2KSOA 5KFIA 1ZQGA 3PSTA 3H4DA 2WF7A 2C22A 2G0AA 5DG8A 4O9MA 3F2DA 1MN8A 1KFDA 4ED6A 3L3FX 4FBUA 1BNOA 1A77A 4I2HA 3KKAC 4ECRA 3F2CA 1L3TA 1KRPA 4ED3A 2E8OA 1VDVA 3MGIA 2HBKA 2F1IA 2WF6A 3HW8A 4B9VA 1N48A 2KG5A 4MHVA 1ZQYA 1ZD2P 5ALUA 5E79U 4F5RA 3OTQA 4HAIA 4DFDA 3ORYA 4YD2A 4KLHA 1RG6A 2HBMA 1PVQA 2FMPA 1Q46A 5AKGA 3WK9A 3NGDA 7ICKA 3BQ2A 3ETRA 2VANA 2ZIUB 3H0MB 4B9LA 2P6RA 4P4OA 3SZ2A 2JZBB 1PVRA 2DPJA 5DQIA 2O6KA 3LVVA 3H8MA 5KFJA 5KFNA 1SWVA 5DG7A 1WCLA 5KT5A 1PVPA 5KFFA 2BQRA 4Y2TA 4DO9A 4QZ8A 4UW9A 5KG6A 3RB4A 2DKXA 2GWSA 2KEYA 2IA6A 3SQIA 1UT8A 1ZRMA 4F93B 3OSNA 3VC8A 3RJJA 3RF9A 4DQIA 2F2AB 4F4ZA 4RNMA 3N7SC 3CNHA 5KT2A 2IMWP 4UB3A 4J9MA 3MR3A 3AN1A 3ZDDA 2W03A 4DCCA 3LWMA 1D8LA 3CYMA 5DLFA 4MFAA 3BQ1A 2AJQA 1Z4OA 1ZQJA 3RJFA 4F5PA 2HHQA 5J2EA 2WB1F 4C8LA 1BPYA 3WKDA 1QSLA 4NV0A 3A0HU 5AK6A 1Y88A 4LZGA 3MBYA 3N7PD 4NM1A 2FLPA 5ALGA 1BPDA 4RQ1A 1DK2A 4PGQA 3OGUA 2WB1C 4OO1J 2G5IB 3IP4B 5ALLA 5KFQA 4NL9A 1PK1A 1MA7A 4F50A 1ZQQA 7ICSA 3A0BU 5J0PA 4OJOA 4DQPA 5AI5A 5KFLA 2KMDA 3K4GA 2XO7A 1TAQA 3UXNA 2K89A 5ALDA 1S0OA 4DF4A 4E0DA 3H8WA 4FZNA 2NV3A 2D3DA 9ICIA 1Z1VA 4O3QA 5ALIA 3Q8KA 2MAXA 1WCNA 4LJXA 1T8EA 2Y0SC 2KTQA 4CE6A 4P0QA 4NLNA 7ICQA 2UVUA 1ZQKA 3ZD9A 1ZQFA 2OEHA 5CHGA 4C0ZA 4RQ6A 8ICNA 4GLXA 4ECYA 4UAVA 3F5AA 4UB2A 3EYZA 5DB9A 3G6VA 1D8BA 2CRXA 3SAFA 3M7DA 4NL9C 4G3IA 4EEYA 5DLGA 5AKJA 3L5KA 4C4SA 2B6GA 9ICVA 4YG2A 5ALWA 8ICZA 5AI8A 1SZPA 2W7PA 4P2HA 1ZJNA 2D6FC 1U47A 3KOOA 5ALKA 4Z6DA 2ZTCA 3H7IA 4ECVA 4KX3A 2AQ0A 4RUCA 5EWGA 1FEZA 1JX4A 4DLEA 2RQ5A 2NRTA 1TK5A 4DSKA 4US9A 2UVVA 5KFZA 2F3NA 1SB3C 1X66A 9ICKA 1NOMA 8ICIA 4NWIA 2YN4A 2H5XA 4RUAA 1SL2A 3C1YA 1NNLA 2KE7A 1S0MA 8ICVA 2N1RA 4HYKA 3MGVA 4YD1A 3WK4A 1SWWA 3HRDD 4EYIB 1TKDA 4ECTA 2JZBA 4UB8U 4DFKA 2FPKA 2I1QA 2XGQA 2MSNA 1S76D 1CI4A 3HJEA 2HHTA 2VA3A 1Z1BA 3IG5A 4M6WB 3N97B 4YR3A 5J0XA 2JRZA 2F8KA 5B5EU 4TUQA 4KLOA 2G07A 5L9XA 1M6YA 2KVCA 3GIJA 1X6JA 4IL6U 1NJZA 4CF3A 3L4PA 4UATA 5J2FA 1Q8KA 3ALRA 3LK9A 1JXEA 4RQ2A 1RQNA 3WKEA 4KN4A 3KHRA 3QEBZ 1NZPA 3GZFA 2I5HA 5KFRA 4KLLA 3MR2A 4KLIA 2K4HA 4R64A 4DL4A 4C4TA 2NRXA 1ZQUA 8ICAA 2ALZA 5J2IA 2YMLA 2E8NA 3RAQA 4JWNA 2E3TA 1RYSA 2QB1A 1NK7A 3WK8A 5KFBA 2XCAA 1DK3A 1T4GA 1WG8A 3F5EA 3ISBA 3HX0A 5DDYA 2L5YA 3KHHA 2FJ6A 4KLSA 2GOLA 4UB6U 5IIOA 2RRDA 5KFTA 4FE3A 3E58A 1BPZA 4NLCA 2JMGA 7ICMA 1KFSA 2P6UA 9ICLA 5CP2A 5CA7A 4KLUA 2Y9TA 4RT3A 1NK5A 5AM5A 2JEGA 4F5OA 4Y2YA 3PNCA 1KL9A 3H4BA 1B43A 5J0YA 5JRTA 2KOBA 4UB1A 8ICKA 2R18A 3JPRA 2ZJ5A 3ZD8A 1S0NA 4C8OA 4PPXA 5DBBA 5KG1A 3PR4A 3C23A 2JH7A 1ZQBA 1QTMA 9ICNA 4DF8A 5G5HA 2R8KA 1NK6A 3T5HA 2K4IA 3SEIA 5ALSA 2CXYA 2ES6A 3F53A 3S6JA 2Y9UA 1HUZA 3QU2A 3BS5B 4YMNA 1KN5A 2OYYA 2Z7JA 2ZJ8A 4M9LA 8ICYA 3H8SA 3D6JA 1XU4A 2KP7A 3B9JA 1N63A 1PUZA 2XIDA 4F4XA 2HHUA 3Q8LA 1K1SA 2QARA 3C5FA 3GV8B 5K4LA 5H2FU 2DUYA 3PX4A 3C21A 4EEKA 3QUCA 5AKZA 3HPOA 2IHNA 4Q8FA 4DFMA 2DGZA 1CRXA 2C2EA 1TE2A 2HHSA 1NI3A 4CDGA 4RPYA 3WU2U 2UVRA 1JRPA 5FP0A 4K4IA 3SAGA 1S10A 9ICAA 1NJWA 1NK8A 3T79A 2JGAA 3TARA 2PFQA 2XY7A 5KFSA 4M9NA 3ZI4A 1ZD4A 5KT7A 3V7JA 2NYVA 4DSIA 4F3OA 1FFUA 3QE9Y 2YB4A 1O03A 5AM4A 3BQTA 4M6WA 1QSYA 1Z00B 4RZRA 1XSPA 4QW8A 4M9JA 3AM9A 2HVHA 3V7KA 5TISU 2DFLA 4TQRA 3OHAA 2NO5A 4OJ5A 2Y1IA 4QWBA 4TUSA 1YZ6A 3T5JA 1NK0A 1L3UA 3UMGA 2M0NA 2QB0B 3TACB 4GXKA 4B9TA 3KFUF 3QUQA 7ICFA 2J6UA 2R8HA 2YB1A 2W9CB 2HBJA 2G09A 2BCRA 2DF4B 2BQUA 8ICHA 1ZQWA 4C80A 5KT3A 4IR1A 4YFKA 5C0YA 5KFKA 1ZQEA 9ICOA 4F2RA 3EUB2 3SMVA 2HBLA 4PZOA 4YVZA 2WF5A 5J8YA 2KN7A 3ZDAA 4F2SA 1WUDA 5T14A 4M2YA 2BKEA 3ETLA 4I27A 3K1ZA 2LI6A 2AQ4A 1V9PA 2W54A 5CRXA 3GIKA 1YT3A 4Z6EA 3J81j 4KLTA 3GDXA 2YY6A 2H3FA 3FM9A 5AK4A 2KHQA 5KFUA 2HMXA 2ZXHA 4KLQA 5EE9A 1TK0A 3PO4A 5J2DA 8ICQA 1RZTA 1N60A 5DQGA 2LYHA 4KLFA 1F5SA 2E1EA 4ACOA 1RXVA 4O5KA 1ZD5A 4A8EA 5ALVA 5DQHA 3Q8SB 5KL1B 4Y2QA 2I6XA 3C2LA 2VJ5A 3TFSA 2JV3A 2HOIA 3O0FA 5J8YC 1X9MA 4PL1A 1X6IA 3TADC 1N56A 3OJUA 2WF8A 2ZIWB 1SIJA 3F2BA 8ICLA 1JN3A 8ICWA 1AQ6A 3M6KA 1U49A 5ALYA 2GH1A 4YQWA 1SGGA 3BS5A 3OJSA 3LWLA 2KZMA 3IRUA 3UM9A 3CW2C 3NRZA 4B9UA 4UBBA 1EXNA 4ECSA 3RRGA 9ICJA 7ICRA 8ICOA 1UHUA 4YMMA 3B0XA 2DWQA 4KLGA 1KLNA 4KLEA 3EWAA 2ZIVB 5EWEA 5DKWA 1XC9A 1TVAA 4CGZA 1Q3VA 2BR0A 2V4RA 3KZXA 5IIIA 1XWLA 7ICLA 3NVYA 4ED2A 5AKLA 7ICGA 4KMOB 4GFJA 4U7CA 3OSPA 1X2IA 2PI5A 3MR6A 3ICXA 2KK0A 4EYHB 3KHLA 3DV9A 7ICEA 5L1JA 2EZYA 4ICAA 4UARA 4DOBA 2IBKA 3AL0B 4KMUA 1DXSA 3H40A 5DB7A 3B0YA 4QZAA 4C8KA 2YQEA 2BCVA 1F0MA 2PKEA 4AYBC 3N4MB 1MSWD 1K5OA 1F44A 4R65A 4EZ9A 4RNOA 4RNNA 4ED7A 4R63A 5HR7A 2KVSA 1SKRA 2W7OA 2KFNA 2K4EA 3UXOA 5DGAA 1Z00A 2EQYA 2ZXIA 5D46A 4EENA 4OJLA 5F3XB 3PSPA 3WK6A 2G5HB 3JPTA 1TAMA 1A0PA 4FS1A 3H0LB 1DGJA 2Y0SF 2XGPA 5CWRA 2ZJAA 4F5NA 1S9FA 3Q8RB 1S0VA 4KN7A 2QB0A 4XUSA 3IDWA 3RJEA 3FC4A 2W9CA 5G5GA 5AKKA 4IR9A 2A1AA 5J29A 7ICHA 2HW3A 1VLBA 2DL0A 4QJFB 2ZTEA 2KJ9A 7ICPA 2EANA 9ICXA 2G08A 2A19A 4DS5A 4FZLA 4FZMA 5ALQA 1ECWA 2HSZA 5DB6A 1JUDA 5A0LA 1T94A 2G06A 3T5KA 4IRKA 4O3OA 2PFPA 1XO1A 3SR6A 2Y1JA 1U4BA 2R8IA 1CEZA 5ALMA 3PY8A 4PHAA 3ZDEA 1SKSA 3NRWA 1X9WA 5HP4A 5L1IA 2FE9A 2IOFA 3ISCA 1BVSA 5KFPA 5J2JA 4PJ0U 2H3ZA 2QARB 1L3SA 1IIPA 1L7PA 2W11A 2KKVA 4IQTA 3PW7A 4ED8A 4IS7A 1SXEA 5ALTA 2BPFA 3U26A 4GC7A 3T5LA 4BUGA 3IHQB 1WWUA 1U9LA 4DL2A 5AI0A 1MQ2A 4Q45A 3JPSA 4Y2UA 1ED1A 1V85A 4DSLA 2P35A 2W8KA 4RQ5A 2ODGA 3SYZA 2B0CA 2LKYA 1HJPA 5HNKA 2ZIWA 5IILA 3M6ZA 2RDJA 5CEHA 2FPLA 2DKZA 8ICXA 4YR0A 3PVXA 1B0XA 5L1MA 2EAPA 1UA0A 1ZYQA 4JUZA 3TFRA 5C5JA 2VJ4A 2F8LA 3RJHA 5D49A 2KJ8A 1RPLA 5TZVA 1KQQA 4DLGA 4Z6CA 2LPEA 3HWTA 4YR2A 3D2QA 3MDAA 3JPQA 9ICRA 3AEVA 4OD0A 2HDOA 5J2KA 2FLLA 1ZQZA 5AK3A 2BCQA 9ICFA 2ZIVA 1KW4A 5D4BA 4ECWA 5F9LA 5ALZA 3K75D 3QU5A 2XC9A 1SL1A 2CPRA 2A3VA 5L1LA 3M1YA 4R8UB 4P4PA 3N7RC 1QCKA 3NS1A 1ZQIA 2VA2A 1FFVA 2NRZA 9ICTA 2PFOA 2AGQA 5J0TA 2W3RA 2XY6A 5AKIA 3QX7A 2OM6A 2BGWA 4DL7A 3C2MA 5KL8B 3AU2A 4DFJA 1LVHA 2B21A 3EW9A 9ICWA 2W9BB 1B22A 4J03A 4M0AA 4J9OA 3ED5A 4XRHA 4NJ8A 2M9NA 5EE3A 2E8MA 2ZUBA 1WWVA 3SAHA 3EZ5A 5ALOA 3RBEA 1KTQA 3JPNA 5CR0A 2RDIA 4PHEA 2F1HA 1C7YA 3PW0A 1N5XA 4EBDA 1KBUA 5HHHA 2WHEA 5KTQA 4QZCA 1JXLA 1QLNA 3N28A 1KKXA 1RDFA 1MC8A 5J2AA 2ASJA 1COKA 2ATLA 2HHVA 3M9MB 5KFXA 1X40A 2FLNA 2NRWA 4YP3A 2F1JA 2ZIXB 4IQVA 4EX7A 2IOHA 2W8LA 4P0PB 2KICA 2K8AA 1S77D 3GV7B 4NXZA 4DQQA 2GO7A 5ALEA 2E5SA 3HKZF 8ICSA 5J2CA 4YCXA 4LVSA 5DDMA 2RP5A 2AH5A 3PMLA 4C4RA 2YTUA 4F91B 1QH9A 3RB0A 4CF5A 3C5GA 3HKZC 4RQ7A 1UA1A 5DBAA 3PX0A 4Y2SA 5KT4A 3M9OB 3GILA 2EDUA 3RB6A 5AM0A 1S97A 1UT5A 5AI4A 1XS9D 2PMZF 1L8OA 5BPCA 4C7YA 4I2BA 1B4FA 2KKPA 4I28A 2KNJA 5ALHA 1RYUA 2PMZC 4RQMA 1OUQA 4UB5A 4F72A 9ICPA 4TQSA 1NKCA 3UMCA 5AKYA 4LZDA 4I2GA 4UQGA 3RH6A 5HMLA 8ICPA 2ESEA 2W43A 4MEXA 2MU2A 4O3RA 2LMRA 3KHGA 4JV1A 7ICNA 1XSLA 1JI7A 1NKEA 2OWOA 1BPXA 2PXIA 3RTVA 4JWMA 2FMSA 3QU7A 2AHOB 2JEFA 4I2FA 5HR6A 4K4HA 3PR5B 1V97A 4BJQA 3GIIA 3IN5A 1ZQNA 1N2XA 4M9GA 1BPEA 8ICTA 1N61A 2ZTDA 2XY5A 1FIQA 4NM2A 1DOQA 3PW2A 9ICBA 4ED0A 2P66A 1ZRNA 2KHVA 3PO5A 3Q8QB 4PHDA 3SI8A 5J0WA 4Y2JA 1ZQSA 4ELUA 4O3SA 1ZQRA 8ICFA 4JK1A 3FYHA 5L1KA 4QZIA 1ZQTA 3T3FA 3RAXA 2FI1A 2PI4A 3GU3A 3RJGA 1V38A 4Y2PA 3D2SA 4ECQA 2J6SA 3ISDA 2LBOA 2JHDA 4X5VA 5J2GA 1OW5A 1L7OA 3RB3A 4C7ZA 4R8UA 1QSSA 4PGYA 1ZQ1C 4Q44A 4IQUA 4CCHA 4F71A 8ICCA 2GLEA 4ECUA 1H38A 3BJYA 2XICA 3SV3A 2RLTA 4QWAA 2YMPA 4F4KA 3RR8A 1KEJA 2H3QA 3M8RA 2KFZA 5BOMA 1ZXIA 2VIXA 2W9BA 3TADA 3UXPA 1NK9A 5J0OA 3WKBA 4QZ9A 1U45A 1UQVA 3KBBA 4QZEA 1Q3UA 2YMQA 3UQ2A 4PHPA 2BZFA 1N5WA 2A1JB 3QZ8A 3TI0A 4DEZA 3FAHA 1QQ7A 2JH1A 4NLGA 3E0FA 5KG4A 1GO3F 5IIKA 2FPMA 3E2EA 2VKQA 2ISPA 5DB8A 1A76A 4AP9A 2K60A 4Q8EA 2ZIXA 4P0PA 2AXTU 3BQ7A 5AI9A 1KFTA 5AIAA 4Y2VA 4JV0A 3HILA 4FFDA 2JEJA 4KLMA 2OHFA 1KSPA 4CRXA 4QZGA 3SV4A 3QYPA 5AICA 4BWMA 4O0IA 3V72A 4O3PA 1SV0A 8ICRA 2EAOA 5KNIA 1S8OA 4DS4A 1ZQXA 2HHXA 3MDCA 2OH2A 3RR7A 2BCSA 5ALXA 3QEAZ 4DL3A 4YXMA 3PSFA 8ICGA 1NJYA 1TAUA 1SL0A 4I2DA 5KFDA 4PH5A 3C1ZA 4QNLA 5JUMA 1TFRA 4ZH4A 3AU6A 4O3NA 2WFAA 3Q8MA 1L3VA 3V7LA 3PW5A 2CN1A 2ZUCA 1SV4A 5J2BA 2AGOA 1LKYB 1IV8A 4UB4A 5AIBA 3EPIA 4F8RA 2HI0A 9ICMA 1L6NA 4IQWA 2K8CB 2W9MA 4BWJA 1ZQAA 1ZQVA 7ICOA 3MGHA 5IIMA 1SV0C 5CB1A 4CF4A 4ED1A 2UVWA 4BGDA 4MF2A 3WKCA 2H3VA 2W9AA 4GIBA 1DRGA 7ICIA 3MFIA 4AYBF 4NY8A 5KAFU 5KAIU 3BS7A 2EH9A 4Z6FA 3GIMA 2R8GA 1RXWA 5AI6A 3MR5A 4IRDA 4RQ0A 5J0RA 5HHIA 5KFMA 2F44A 4U6PA 4NLBA 3RBDA 2KV2A 4MFCA 4MF8A 2ZG6A 2C2DA 4MFFA 4J9SA 1ZQCA 1ZETA 1PK3A 2JXJA 3ZDBA 1DGSA 4GXIA 4IC9A 4EELA 7ICUA 4G9BA 2F76X 3LVWA 5IIJA 2MA1A 4OJPA 5AK5A 3M9NB 4B6JA 1NJXA 1ZQLA 5EOZA 5J0SA 5AHXA 1S5LU 5KT6A 1XO0A 3AUOA 9ICCA 1IG6A 3RH4A 7ICVA 4RQ8A 3TQ1A 4QZFA 2DQNB 2BHNA 4RQ3A 1K1QA 4DL6A 1BGXT 2E1FA 2R8JA 2YX8A 4B9SA 2H3IA 4DOCA 4QW9A 4RPZA 1RM6C 3V6KA 4DSEA 2FMQA 4CNQA 2QLTA 1XNSA 2MUTB 1D8YA 5KFOA 3AMZA 4WJ3B 3JPPA 5J0QA 2BPGA 4ZOHC 1X42A 5J2HA 2KIWA 4M04A 1L8LA 3WK7A 2K4PA 2BPCA 3QNMA 2A1JA 2XI9A 4O3MA 3IG8A 4P4MA 9ICUA 4M9HA 4TUPA 4QWDA 3WK5A 5AKXA 3AQFA 4RQNA 4Q43A 3NVZA 8ICBA 4UAZA 1LV5A 2KZZA 1Z4NA 3K1RB 1FO4A 2HOQA 5KFCA 1COOA 4FS2A 1LB2B 3TANA 4BXOB 1QQ5A 4TURA 1ZQMA 4J9QA 3JPOA 5ALRA 4QZBA 3HT3A 1L7NA 1SXDA 4KLDA 2KJ5A 1X9SA 4USAA 4RPXA 4UASA 2LM4A 5KFWA 1JALA 4ECZA 2HCFA 1UPHA 2WAQF 4J9NA 8ICJA 5KG5A 1P7DA 4EBEA 2W55A 1X9XA 2MRLA 5ALNA 2ASLA 3GQCA 9ICHA 3NTUA 4JB3A 4OCZA 2WAQC 5JTIA 4MEYA 2ZIUA 2PFNA 2XCPA 5AKHA 2WF9A 4F92B 1ZQHA 4DSFA 1BNPA 4ELVA 1AROP 1LKYA 2F77X 4J9LA 1Z19A 2C28A 1J2MA 4DQSA 3RFAA 4PZNA 3UMBA 5KG3A 3M8SA 3QUBA 4JMUA 2KD1A 1HUOA 1SKWA 5GTIU 3I1YA 5AM3A 3QZ7A 3WKAA 3IV6A 2BQ3A 5DG9A 5CJ7A 4ECXA 4QWEA 3ZDCA 1PZNA 1Z3EB 4J9RA 1NK4A 4RQ4A 1J97A 2IHMA 3G6YA 1C20A 3CRXA 4C8NA 1VJ5A 4XQ8A 2KZ3A 2AU0A 4PGXA 5GTHU 3PMNA 3RRHA 1JROA 3G6XA 4I29A 7ICJA 3H8JA 3QXGA 3GV5B 5KFEA 4QZHA 3IM1A 2AGPA 2K8BB 1JIHA 3KZIU 5KFYA 1RQLA 2KSOB 4BDPA 3BZCA 1IXRA 3TAPA 4UAYA 4GXJA 2BCUA 1UCVA 1RYRA 1KDHA 9ICEA 2IOFK 5JU5A 2HVIA 2D8CA 1ZQOA 4I2CA 1T3NA 3QUTA 4KITB 4DWIA 3NVVA 1A6SA 1L5UA 4F4YA 3KD3A 4YXJA 3HP6A 3TKAA 3RH5A 1ZQPA 5DBCA 5EWFA 8ICEA 9ICGA 2LM1A 3R9KA 1URJA 3RJKA 5AM2A 4F4WA 5ALPA 4DQRA 4C8MA 1IM4A 3LDAA 5KFHA 5AKEA 1YZ7A 4IRCA 3QU4A 4EX6A 2BDUA
chains in the Genus database with same CATH topology
1RG6A 4PZNA 4IS7A 1SXEA 2Y9TA 2KE7A 3TADA 1DXSA 2KMDA 1WWUA 4NJ8A 2ESEA 2EAMA 1SV0C 2E8MA 2LMRA 5JRTA 1UQVA 1F0MA 1WWVA 3H8MA 1JI7A 3KKAA 2K4PA 2D3DA 1V85A 1Z1VA 2JV3A 5J8YC 3BS7A 3TADC 2F8KA 3SEIA 1COKA 4RQNA 5F3XB 2DKXA 2DKZA 2ES6A 2K60A 1X40A 1B0XA 5L1MA 2EAPA 2Y9UA 3BQ7A 2KIVA 1SGGA 3BS5A 3BS5B 2F44A 3K1RB 3HILA 4NL9C 2QB0A 2LPEA 2QKQA 2QB0B 3TACB 1OXJA 3IDWA 2KSOA 2KSOB 2B6GA 1SXDA 1SV0A 2EAOA 1PK3A 2YTUA 5KNIA 2DL0A 2E8NA 1UCVA 2EANA 3SENA 2QB1A 1V38A 1KW4A 2QARA 5JU5A 2D8CA 4PZOA 3KKAC 1X9XA 5J8YA 1OW5A 2E8OA 2L5YA 5JTIA 2KG5A 2GLEA 1B4FA 4MHVA 2E8PA 2FE9A 2F3NA 1SV4A 1LKYA 1X66A 1LKYB 2QARB 4NL9A 4RQMA 1PK1A 1PK1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RG6 A;  4PZN A;  4IS7 A;  1SXE A;  2Y9T A;  2KE7 A;  3TAD A;  1DXS A;  2KMD A;  1WWU A;  4NJ8 A;  2ESE A;  2EAM A;  1SV0 C;  2E8M A;  2LMR A;  5JRT A;  1UQV A;  1F0M A;  1WWV A;  3H8M A;  1JI7 A;  3KKA A;  2K4P A;  2D3D A;  1V85 A;  1Z1V A;  2JV3 A;  5J8Y C;  3BS7 A;  3TAD C;  2F8K A;  3SEI A;  1COK A;  4RQN A;  5F3X B;  2DKX A;  2DKZ A;  2ES6 A;  2K60 A;  1X40 A;  1B0X A;  5L1M A;  2EAP A;  2Y9U A;  3BQ7 A;  2KIV A;  1SGG A;  3BS5 A;  3BS5 B;  2F44 A;  3K1R B;  3HIL A;  4NL9 C;  2QB0 A;  2LPE A;  2QKQ A;  2QB0 B;  3TAC B;  1OXJ A;  3IDW A;  2KSO A;  2KSO B;  2B6G A;  1SXD A;  1SV0 A;  2EAO A;  1PK3 A;  2YTU A;  5KNI A;  2DL0 A;  2E8N A;  1UCV A;  2EAN A;  3SEN A;  2QB1 A;  1V38 A;  1KW4 A;  2QAR A;  5JU5 A;  2D8C A;  4PZO A;  3KKA C;  1X9X A;  5J8Y A;  1OW5 A;  2E8O A;  2L5Y A;  5JTI A;  2KG5 A;  2GLE A;  1B4F A;  4MHV A;  2E8P A;  2FE9 A;  2F3N A;  1SV4 A;  1LKY A;  1X66 A;  1LKY B;  2QAR B;  4NL9 A;  4RQM A;  1PK1 A;  1PK1 B; 
#chains in the Genus database with same CATH topology
 4Y2X A;  3PV8 A;  4I2I A;  4NLK A;  1T7P A;  1SZH A;  1L7M A;  2JR5 A;  2MUT A;  3LYS A;  2VA8 A;  4XA5 A;  3ONN A;  1T3Q A;  4RT2 A;  2EAM A;  5KG2 A;  3CP8 A;  9ICS A;  3NVW A;  4GC6 A;  2JEI A;  3NAS A;  1J2N A;  2NO4 A;  4QIW F;  3THV A;  4FBT A;  2V9W A;  5EE0 A;  3KTQ A;  1ZD3 A;  2WTF A;  3QU9 A;  3SD7 A;  3BZK A;  4J9P A;  4KTQ A;  3MC1 A;  9ICQ A;  2BDP A;  4QIW C;  5J0U A;  2Q0Z X;  3MFH A;  3BQ0 A;  3DDH A;  3NUQ A;  2ISO A;  1HIW A;  4JV2 A;  1WYG A;  3C29 A;  4YN4 A;  5KFA A;  3DEE A;  4BXO A;  4QZD A;  5F9N A;  5HMM A;  2I9G A;  2QKQ A;  4UAU A;  1OXJ A;  2ASD A;  4OJ6 A;  3VCB A;  1TK8 A;  4DFP A;  2DBY A;  1NZB A;  4EBC A;  3UPQ A;  1O08 A;  2OXO A;  3I28 A;  3SEN A;  4M47 A;  8ICU A;  1XSN A;  4B9N A;  3PZP A;  3PW4 A;  3BDP A;  1D9F A;  4I2J A;  3I76 A;  2ZUD A;  4KX5 A;  3C2K A;  5KFG A;  2HHW A;  4I2A A;  3FDS A;  4F5Q A;  8ICM A;  3C28 A;  7ICT A;  5BOL A;  4QWC A;  5B66 U;  2W3S A;  4DSJ A;  4UAW A;  4B9M A;  4FO6 A;  4O5E A;  3D2N A;  2E8P A;  3H0R B;  3PX6 A;  2EZZ A;  1TV9 A;  2HOF A;  1U48 A;  2FDR A;  1BPB A;  5KG0 A;  2LYB A;  4Y2R A;  3MAB A;  1PK1 B;  4ELT A;  4J9K A;  4K4G A;  2OCE A;  3TAQ A;  3OHB A;  1ZJM A;  1QQ6 A;  2YMM A;  2LYA A;  1CUK A;  4EZ6 A;  4NLZ A;  4DL5 A;  2LHT A;  4R66 A;  1ZOL A;  2W04 A;  5AM1 A;  3KKA A;  1N62 A;  3UQ0 A;  4RU9 A;  4BX9 C;  1NKB A;  3PSI A;  4UBC A;  2NRV A;  4YMO A;  5DGB A;  4P0Q B;  4US8 A;  1JMS A;  1ZQD A;  1HEK A;  2XVT A;  5ALF A;  3Q8P B;  3V6J A;  3AQE A;  5EE1 A;  5KG7 A;  2KIV A;  1MQ3 A;  2DPI A;  4KLJ A;  2RHF A;  4O5C A;  5KFV A;  5ALJ A;  1D9D A;  3OPX A;  3GFK B;  4PL2 A;  2Q4T A;  3EPG A;  3V6H A;  2EZX A;  5IIN A;  2C2R A;  4I2E A;  2J6T A;  3RJI A;  2V4Q A;  4DOA A;  2KSO A;  5KFI A;  1ZQG A;  3PST A;  3H4D A;  2WF7 A;  2C22 A;  2G0A A;  5DG8 A;  4O9M A;  3F2D A;  1MN8 A;  1KFD A;  4ED6 A;  3L3F X;  4FBU A;  1BNO A;  1A77 A;  4I2H A;  3KKA C;  4ECR A;  3F2C A;  1L3T A;  1KRP A;  4ED3 A;  2E8O A;  1VDV A;  3MGI A;  2HBK A;  2F1I A;  2WF6 A;  3HW8 A;  4B9V A;  1N48 A;  2KG5 A;  4MHV A;  1ZQY A;  1ZD2 P;  5ALU A;  5E79 U;  4F5R A;  3OTQ A;  4HAI A;  4DFD A;  3ORY A;  4YD2 A;  4KLH A;  1RG6 A;  2HBM A;  1PVQ A;  2FMP A;  1Q46 A;  5AKG A;  3WK9 A;  3NGD A;  7ICK A;  3BQ2 A;  3ETR A;  2VAN A;  2ZIU B;  3H0M B;  4B9L A;  2P6R A;  4P4O A;  3SZ2 A;  2JZB B;  1PVR A;  2DPJ A;  5DQI A;  2O6K A;  3LVV A;  3H8M A;  5KFJ A;  5KFN A;  1SWV A;  5DG7 A;  1WCL A;  5KT5 A;  1PVP A;  5KFF A;  2BQR A;  4Y2T A;  4DO9 A;  4QZ8 A;  4UW9 A;  5KG6 A;  3RB4 A;  2DKX A;  2GWS A;  2KEY A;  2IA6 A;  3SQI A;  1UT8 A;  1ZRM A;  4F93 B;  3OSN A;  3VC8 A;  3RJJ A;  3RF9 A;  4DQI A;  2F2A B;  4F4Z A;  4RNM A;  3N7S C;  3CNH A;  5KT2 A;  2IMW P;  4UB3 A;  4J9M A;  3MR3 A;  3AN1 A;  3ZDD A;  2W03 A;  4DCC A;  3LWM A;  1D8L A;  3CYM A;  5DLF A;  4MFA A;  3BQ1 A;  2AJQ A;  1Z4O A;  1ZQJ A;  3RJF A;  4F5P A;  2HHQ A;  5J2E A;  2WB1 F;  4C8L A;  1BPY A;  3WKD A;  1QSL A;  4NV0 A;  3A0H U;  5AK6 A;  1Y88 A;  4LZG A;  3MBY A;  3N7P D;  4NM1 A;  2FLP A;  5ALG A;  1BPD A;  4RQ1 A;  1DK2 A;  4PGQ A;  3OGU A;  2WB1 C;  4OO1 J;  2G5I B;  3IP4 B;  5ALL A;  5KFQ A;  4NL9 A;  1PK1 A;  1MA7 A;  4F50 A;  1ZQQ A;  7ICS A;  3A0B U;  5J0P A;  4OJO A;  4DQP A;  5AI5 A;  5KFL A;  2KMD A;  3K4G A;  2XO7 A;  1TAQ A;  3UXN A;  2K89 A;  5ALD A;  1S0O A;  4DF4 A;  4E0D A;  3H8W A;  4FZN A;  2NV3 A;  2D3D A;  9ICI A;  1Z1V A;  4O3Q A;  5ALI A;  3Q8K A;  2MAX A;  1WCN A;  4LJX A;  1T8E A;  2Y0S C;  2KTQ A;  4CE6 A;  4P0Q A;  4NLN A;  7ICQ A;  2UVU A;  1ZQK A;  3ZD9 A;  1ZQF A;  2OEH A;  5CHG A;  4C0Z A;  4RQ6 A;  8ICN A;  4GLX A;  4ECY A;  4UAV A;  3F5A A;  4UB2 A;  3EYZ A;  5DB9 A;  3G6V A;  1D8B A;  2CRX A;  3SAF A;  3M7D A;  4NL9 C;  4G3I A;  4EEY A;  5DLG A;  5AKJ A;  3L5K A;  4C4S A;  2B6G A;  9ICV A;  4YG2 A;  5ALW A;  8ICZ A;  5AI8 A;  1SZP A;  2W7P A;  4P2H A;  1ZJN A;  2D6F C;  1U47 A;  3KOO A;  5ALK A;  4Z6D A;  2ZTC A;  3H7I A;  4ECV A;  4KX3 A;  2AQ0 A;  4RUC A;  5EWG A;  1FEZ A;  1JX4 A;  4DLE A;  2RQ5 A;  2NRT A;  1TK5 A;  4DSK A;  4US9 A;  2UVV A;  5KFZ A;  2F3N A;  1SB3 C;  1X66 A;  9ICK A;  1NOM A;  8ICI A;  4NWI A;  2YN4 A;  2H5X A;  4RUA A;  1SL2 A;  3C1Y A;  1NNL A;  2KE7 A;  1S0M A;  8ICV A;  2N1R A;  4HYK A;  3MGV A;  4YD1 A;  3WK4 A;  1SWW A;  3HRD D;  4EYI B;  1TKD A;  4ECT A;  2JZB A;  4UB8 U;  4DFK A;  2FPK A;  2I1Q A;  2XGQ A;  2MSN A;  1S76 D;  1CI4 A;  3HJE A;  2HHT A;  2VA3 A;  1Z1B A;  3IG5 A;  4M6W B;  3N97 B;  4YR3 A;  5J0X A;  2JRZ A;  2F8K A;  5B5E U;  4TUQ A;  4KLO A;  2G07 A;  5L9X A;  1M6Y A;  2KVC A;  3GIJ A;  1X6J A;  4IL6 U;  1NJZ A;  4CF3 A;  3L4P A;  4UAT A;  5J2F A;  1Q8K A;  3ALR A;  3LK9 A;  1JXE A;  4RQ2 A;  1RQN A;  3WKE A;  4KN4 A;  3KHR A;  3QEB Z;  1NZP A;  3GZF A;  2I5H A;  5KFR A;  4KLL A;  3MR2 A;  4KLI A;  2K4H A;  4R64 A;  4DL4 A;  4C4T A;  2NRX A;  1ZQU A;  8ICA A;  2ALZ A;  5J2I A;  2YML A;  2E8N A;  3RAQ A;  4JWN A;  2E3T A;  1RYS A;  2QB1 A;  1NK7 A;  3WK8 A;  5KFB A;  2XCA A;  1DK3 A;  1T4G A;  1WG8 A;  3F5E A;  3ISB A;  3HX0 A;  5DDY A;  2L5Y A;  3KHH A;  2FJ6 A;  4KLS A;  2GOL A;  4UB6 U;  5IIO A;  2RRD A;  5KFT A;  4FE3 A;  3E58 A;  1BPZ A;  4NLC A;  2JMG A;  7ICM A;  1KFS A;  2P6U A;  9ICL A;  5CP2 A;  5CA7 A;  4KLU A;  2Y9T A;  4RT3 A;  1NK5 A;  5AM5 A;  2JEG A;  4F5O A;  4Y2Y A;  3PNC A;  1KL9 A;  3H4B A;  1B43 A;  5J0Y A;  5JRT A;  2KOB A;  4UB1 A;  8ICK A;  2R18 A;  3JPR A;  2ZJ5 A;  3ZD8 A;  1S0N A;  4C8O A;  4PPX A;  5DBB A;  5KG1 A;  3PR4 A;  3C23 A;  2JH7 A;  1ZQB A;  1QTM A;  9ICN A;  4DF8 A;  5G5H A;  2R8K A;  1NK6 A;  3T5H A;  2K4I A;  3SEI A;  5ALS A;  2CXY A;  2ES6 A;  3F53 A;  3S6J A;  2Y9U A;  1HUZ A;  3QU2 A;  3BS5 B;  4YMN A;  1KN5 A;  2OYY A;  2Z7J A;  2ZJ8 A;  4M9L A;  8ICY A;  3H8S A;  3D6J A;  1XU4 A;  2KP7 A;  3B9J A;  1N63 A;  1PUZ A;  2XID A;  4F4X A;  2HHU A;  3Q8L A;  1K1S A;  2QAR A;  3C5F A;  3GV8 B;  5K4L A;  5H2F U;  2DUY A;  3PX4 A;  3C21 A;  4EEK A;  3QUC A;  5AKZ A;  3HPO A;  2IHN A;  4Q8F A;  4DFM A;  2DGZ A;  1CRX A;  2C2E A;  1TE2 A;  2HHS A;  1NI3 A;  4CDG A;  4RPY A;  3WU2 U;  2UVR A;  1JRP A;  5FP0 A;  4K4I A;  3SAG A;  1S10 A;  9ICA A;  1NJW A;  1NK8 A;  3T79 A;  2JGA A;  3TAR A;  2PFQ A;  2XY7 A;  5KFS A;  4M9N A;  3ZI4 A;  1ZD4 A;  5KT7 A;  3V7J A;  2NYV A;  4DSI A;  4F3O A;  1FFU A;  3QE9 Y;  2YB4 A;  1O03 A;  5AM4 A;  3BQT A;  4M6W A;  1QSY A;  1Z00 B;  4RZR A;  1XSP A;  4QW8 A;  4M9J A;  3AM9 A;  2HVH A;  3V7K A;  5TIS U;  2DFL A;  4TQR A;  3OHA A;  2NO5 A;  4OJ5 A;  2Y1I A;  4QWB A;  4TUS A;  1YZ6 A;  3T5J A;  1NK0 A;  1L3U A;  3UMG A;  2M0N A;  2QB0 B;  3TAC B;  4GXK A;  4B9T A;  3KFU F;  3QUQ A;  7ICF A;  2J6U A;  2R8H A;  2YB1 A;  2W9C B;  2HBJ A;  2G09 A;  2BCR A;  2DF4 B;  2BQU A;  8ICH A;  1ZQW A;  4C80 A;  5KT3 A;  4IR1 A;  4YFK A;  5C0Y A;  5KFK A;  1ZQE A;  9ICO A;  4F2R A;  3EUB 2;  3SMV A;  2HBL A;  4PZO A;  4YVZ A;  2WF5 A;  5J8Y A;  2KN7 A;  3ZDA A;  4F2S A;  1WUD A;  5T14 A;  4M2Y A;  2BKE A;  3ETL A;  4I27 A;  3K1Z A;  2LI6 A;  2AQ4 A;  1V9P A;  2W54 A;  5CRX A;  3GIK A;  1YT3 A;  4Z6E A;  3J81 j;  4KLT A;  3GDX A;  2YY6 A;  2H3F A;  3FM9 A;  5AK4 A;  2KHQ A;  5KFU A;  2HMX A;  2ZXH A;  4KLQ A;  5EE9 A;  1TK0 A;  3PO4 A;  5J2D A;  8ICQ A;  1RZT A;  1N60 A;  5DQG A;  2LYH A;  4KLF A;  1F5S A;  2E1E A;  4ACO A;  1RXV A;  4O5K A;  1ZD5 A;  4A8E A;  5ALV A;  5DQH A;  3Q8S B;  5KL1 B;  4Y2Q A;  2I6X A;  3C2L A;  2VJ5 A;  3TFS A;  2JV3 A;  2HOI A;  3O0F A;  5J8Y C;  1X9M A;  4PL1 A;  1X6I A;  3TAD C;  1N56 A;  3OJU A;  2WF8 A;  2ZIW B;  1SIJ A;  3F2B A;  8ICL A;  1JN3 A;  8ICW A;  1AQ6 A;  3M6K A;  1U49 A;  5ALY A;  2GH1 A;  4YQW A;  1SGG A;  3BS5 A;  3OJS A;  3LWL A;  2KZM A;  3IRU A;  3UM9 A;  3CW2 C;  3NRZ A;  4B9U A;  4UBB A;  1EXN A;  4ECS A;  3RRG A;  9ICJ A;  7ICR A;  8ICO A;  1UHU A;  4YMM A;  3B0X A;  2DWQ A;  4KLG A;  1KLN A;  4KLE A;  3EWA A;  2ZIV B;  5EWE A;  5DKW A;  1XC9 A;  1TVA A;  4CGZ A;  1Q3V A;  2BR0 A;  2V4R A;  3KZX A;  5III A;  1XWL A;  7ICL A;  3NVY A;  4ED2 A;  5AKL A;  7ICG A;  4KMO B;  4GFJ A;  4U7C A;  3OSP A;  1X2I A;  2PI5 A;  3MR6 A;  3ICX A;  2KK0 A;  4EYH B;  3KHL A;  3DV9 A;  7ICE A;  5L1J A;  2EZY A;  4ICA A;  4UAR A;  4DOB A;  2IBK A;  3AL0 B;  4KMU A;  1DXS A;  3H40 A;  5DB7 A;  3B0Y A;  4QZA A;  4C8K A;  2YQE A;  2BCV A;  1F0M A;  2PKE A;  4AYB C;  3N4M B;  1MSW D;  1K5O A;  1F44 A;  4R65 A;  4EZ9 A;  4RNO A;  4RNN A;  4ED7 A;  4R63 A;  5HR7 A;  2KVS A;  1SKR A;  2W7O A;  2KFN A;  2K4E A;  3UXO A;  5DGA A;  1Z00 A;  2EQY A;  2ZXI A;  5D46 A;  4EEN A;  4OJL A;  5F3X B;  3PSP A;  3WK6 A;  2G5H B;  3JPT A;  1TAM A;  1A0P A;  4FS1 A;  3H0L B;  1DGJ A;  2Y0S F;  2XGP A;  5CWR A;  2ZJA A;  4F5N A;  1S9F A;  3Q8R B;  1S0V A;  4KN7 A;  2QB0 A;  4XUS A;  3IDW A;  3RJE A;  3FC4 A;  2W9C A;  5G5G A;  5AKK A;  4IR9 A;  2A1A A;  5J29 A;  7ICH A;  2HW3 A;  1VLB A;  2DL0 A;  4QJF B;  2ZTE A;  2KJ9 A;  7ICP A;  2EAN A;  9ICX A;  2G08 A;  2A19 A;  4DS5 A;  4FZL A;  4FZM A;  5ALQ A;  1ECW A;  2HSZ A;  5DB6 A;  1JUD A;  5A0L A;  1T94 A;  2G06 A;  3T5K A;  4IRK A;  4O3O A;  2PFP A;  1XO1 A;  3SR6 A;  2Y1J A;  1U4B A;  2R8I A;  1CEZ A;  5ALM A;  3PY8 A;  4PHA A;  3ZDE A;  1SKS A;  3NRW A;  1X9W A;  5HP4 A;  5L1I A;  2FE9 A;  2IOF A;  3ISC A;  1BVS A;  5KFP A;  5J2J A;  4PJ0 U;  2H3Z A;  2QAR B;  1L3S A;  1IIP A;  1L7P A;  2W11 A;  2KKV A;  4IQT A;  3PW7 A;  4ED8 A;  4IS7 A;  1SXE A;  5ALT A;  2BPF A;  3U26 A;  4GC7 A;  3T5L A;  4BUG A;  3IHQ B;  1WWU A;  1U9L A;  4DL2 A;  5AI0 A;  1MQ2 A;  4Q45 A;  3JPS A;  4Y2U A;  1ED1 A;  1V85 A;  4DSL A;  2P35 A;  2W8K A;  4RQ5 A;  2ODG A;  3SYZ A;  2B0C A;  2LKY A;  1HJP A;  5HNK A;  2ZIW A;  5IIL A;  3M6Z A;  2RDJ A;  5CEH A;  2FPL A;  2DKZ A;  8ICX A;  4YR0 A;  3PVX A;  1B0X A;  5L1M A;  2EAP A;  1UA0 A;  1ZYQ A;  4JUZ A;  3TFR A;  5C5J A;  2VJ4 A;  2F8L A;  3RJH A;  5D49 A;  2KJ8 A;  1RPL A;  5TZV A;  1KQQ A;  4DLG A;  4Z6C A;  2LPE A;  3HWT A;  4YR2 A;  3D2Q A;  3MDA A;  3JPQ A;  9ICR A;  3AEV A;  4OD0 A;  2HDO A;  5J2K A;  2FLL A;  1ZQZ A;  5AK3 A;  2BCQ A;  9ICF A;  2ZIV A;  1KW4 A;  5D4B A;  4ECW A;  5F9L A;  5ALZ A;  3K75 D;  3QU5 A;  2XC9 A;  1SL1 A;  2CPR A;  2A3V A;  5L1L A;  3M1Y A;  4R8U B;  4P4P A;  3N7R C;  1QCK A;  3NS1 A;  1ZQI A;  2VA2 A;  1FFV A;  2NRZ A;  9ICT A;  2PFO A;  2AGQ A;  5J0T A;  2W3R A;  2XY6 A;  5AKI A;  3QX7 A;  2OM6 A;  2BGW A;  4DL7 A;  3C2M A;  5KL8 B;  3AU2 A;  4DFJ A;  1LVH A;  2B21 A;  3EW9 A;  9ICW A;  2W9B B;  1B22 A;  4J03 A;  4M0A A;  4J9O A;  3ED5 A;  4XRH A;  4NJ8 A;  2M9N A;  5EE3 A;  2E8M A;  2ZUB A;  1WWV A;  3SAH A;  3EZ5 A;  5ALO A;  3RBE A;  1KTQ A;  3JPN A;  5CR0 A;  2RDI A;  4PHE A;  2F1H A;  1C7Y A;  3PW0 A;  1N5X A;  4EBD A;  1KBU A;  5HHH A;  2WHE A;  5KTQ A;  4QZC A;  1JXL A;  1QLN A;  3N28 A;  1KKX A;  1RDF A;  1MC8 A;  5J2A A;  2ASJ A;  1COK A;  2ATL A;  2HHV A;  3M9M B;  5KFX A;  1X40 A;  2FLN A;  2NRW A;  4YP3 A;  2F1J A;  2ZIX B;  4IQV A;  4EX7 A;  2IOH A;  2W8L A;  4P0P B;  2KIC A;  2K8A A;  1S77 D;  3GV7 B;  4NXZ A;  4DQQ A;  2GO7 A;  5ALE A;  2E5S A;  3HKZ F;  8ICS A;  5J2C A;  4YCX A;  4LVS A;  5DDM A;  2RP5 A;  2AH5 A;  3PML A;  4C4R A;  2YTU A;  4F91 B;  1QH9 A;  3RB0 A;  4CF5 A;  3C5G A;  3HKZ C;  4RQ7 A;  1UA1 A;  5DBA A;  3PX0 A;  4Y2S A;  5KT4 A;  3M9O B;  3GIL A;  2EDU A;  3RB6 A;  5AM0 A;  1S97 A;  1UT5 A;  5AI4 A;  1XS9 D;  2PMZ F;  1L8O A;  5BPC A;  4C7Y A;  4I2B A;  1B4F A;  2KKP A;  4I28 A;  2KNJ A;  5ALH A;  1RYU A;  2PMZ C;  4RQM A;  1OUQ A;  4UB5 A;  4F72 A;  9ICP A;  4TQS A;  1NKC A;  3UMC A;  5AKY A;  4LZD A;  4I2G A;  4UQG A;  3RH6 A;  5HML A;  8ICP A;  2ESE A;  2W43 A;  4MEX A;  2MU2 A;  4O3R A;  2LMR A;  3KHG A;  4JV1 A;  7ICN A;  1XSL A;  1JI7 A;  1NKE A;  2OWO A;  1BPX A;  2PXI A;  3RTV A;  4JWM A;  2FMS A;  3QU7 A;  2AHO B;  2JEF A;  4I2F A;  5HR6 A;  4K4H A;  3PR5 B;  1V97 A;  4BJQ A;  3GII A;  3IN5 A;  1ZQN A;  1N2X A;  4M9G A;  1BPE A;  8ICT A;  1N61 A;  2ZTD A;  2XY5 A;  1FIQ A;  4NM2 A;  1DOQ A;  3PW2 A;  9ICB A;  4ED0 A;  2P66 A;  1ZRN A;  2KHV A;  3PO5 A;  3Q8Q B;  4PHD A;  3SI8 A;  5J0W A;  4Y2J A;  1ZQS A;  4ELU A;  4O3S A;  1ZQR A;  8ICF A;  4JK1 A;  3FYH A;  5L1K A;  4QZI A;  1ZQT A;  3T3F A;  3RAX A;  2FI1 A;  2PI4 A;  3GU3 A;  3RJG A;  1V38 A;  4Y2P A;  3D2S A;  4ECQ A;  2J6S A;  3ISD A;  2LBO A;  2JHD A;  4X5V A;  5J2G A;  1OW5 A;  1L7O A;  3RB3 A;  4C7Z A;  4R8U A;  1QSS A;  4PGY A;  1ZQ1 C;  4Q44 A;  4IQU A;  4CCH A;  4F71 A;  8ICC A;  2GLE A;  4ECU A;  1H38 A;  3BJY A;  2XIC A;  3SV3 A;  2RLT A;  4QWA A;  2YMP A;  4F4K A;  3RR8 A;  1KEJ A;  2H3Q A;  3M8R A;  2KFZ A;  5BOM A;  1ZXI A;  2VIX A;  2W9B A;  3TAD A;  3UXP A;  1NK9 A;  5J0O A;  3WKB A;  4QZ9 A;  1U45 A;  1UQV A;  3KBB A;  4QZE A;  1Q3U A;  2YMQ A;  3UQ2 A;  4PHP A;  2BZF A;  1N5W A;  2A1J B;  3QZ8 A;  3TI0 A;  4DEZ A;  3FAH A;  1QQ7 A;  2JH1 A;  4NLG A;  3E0F A;  5KG4 A;  1GO3 F;  5IIK A;  2FPM A;  3E2E A;  2VKQ A;  2ISP A;  5DB8 A;  1A76 A;  4AP9 A;  2K60 A;  4Q8E A;  2ZIX A;  4P0P A;  2AXT U;  3BQ7 A;  5AI9 A;  1KFT A;  5AIA A;  4Y2V A;  4JV0 A;  3HIL A;  4FFD A;  2JEJ A;  4KLM A;  2OHF A;  1KSP A;  4CRX A;  4QZG A;  3SV4 A;  3QYP A;  5AIC A;  4BWM A;  4O0I A;  3V72 A;  4O3P A;  1SV0 A;  8ICR A;  2EAO A;  5KNI A;  1S8O A;  4DS4 A;  1ZQX A;  2HHX A;  3MDC A;  2OH2 A;  3RR7 A;  2BCS A;  5ALX A;  3QEA Z;  4DL3 A;  4YXM A;  3PSF A;  8ICG A;  1NJY A;  1TAU A;  1SL0 A;  4I2D A;  5KFD A;  4PH5 A;  3C1Z A;  4QNL A;  5JUM A;  1TFR A;  4ZH4 A;  3AU6 A;  4O3N A;  2WFA A;  3Q8M A;  1L3V A;  3V7L A;  3PW5 A;  2CN1 A;  2ZUC A;  1SV4 A;  5J2B A;  2AGO A;  1LKY B;  1IV8 A;  4UB4 A;  5AIB A;  3EPI A;  4F8R A;  2HI0 A;  9ICM A;  1L6N A;  4IQW A;  2K8C B;  2W9M A;  4BWJ A;  1ZQA A;  1ZQV A;  7ICO A;  3MGH A;  5IIM A;  1SV0 C;  5CB1 A;  4CF4 A;  4ED1 A;  2UVW A;  4BGD A;  4MF2 A;  3WKC A;  2H3V A;  2W9A A;  4GIB A;  1DRG A;  7ICI A;  3MFI A;  4AYB F;  4NY8 A;  5KAF U;  5KAI U;  3BS7 A;  2EH9 A;  4Z6F A;  3GIM A;  2R8G A;  1RXW A;  5AI6 A;  3MR5 A;  4IRD A;  4RQ0 A;  5J0R A;  5HHI A;  5KFM A;  2F44 A;  4U6P A;  4NLB A;  3RBD A;  2KV2 A;  4MFC A;  4MF8 A;  2ZG6 A;  2C2D A;  4MFF A;  4J9S A;  1ZQC A;  1ZET A;  1PK3 A;  2JXJ A;  3ZDB A;  1DGS A;  4GXI A;  4IC9 A;  4EEL A;  7ICU A;  4G9B A;  2F76 X;  3LVW A;  5IIJ A;  2MA1 A;  4OJP A;  5AK5 A;  3M9N B;  4B6J A;  1NJX A;  1ZQL A;  5EOZ A;  5J0S A;  5AHX A;  1S5L U;  5KT6 A;  1XO0 A;  3AUO A;  9ICC A;  1IG6 A;  3RH4 A;  7ICV A;  4RQ8 A;  3TQ1 A;  4QZF A;  2DQN B;  2BHN A;  4RQ3 A;  1K1Q A;  4DL6 A;  1BGX T;  2E1F A;  2R8J A;  2YX8 A;  4B9S A;  2H3I A;  4DOC A;  4QW9 A;  4RPZ A;  1RM6 C;  3V6K A;  4DSE A;  2FMQ A;  4CNQ A;  2QLT A;  1XNS A;  2MUT B;  1D8Y A;  5KFO A;  3AMZ A;  4WJ3 B;  3JPP A;  5J0Q A;  2BPG A;  4ZOH C;  1X42 A;  5J2H A;  2KIW A;  4M04 A;  1L8L A;  3WK7 A;  2K4P A;  2BPC A;  3QNM A;  2A1J A;  2XI9 A;  4O3M A;  3IG8 A;  4P4M A;  9ICU A;  4M9H A;  4TUP A;  4QWD A;  3WK5 A;  5AKX A;  3AQF A;  4RQN A;  4Q43 A;  3NVZ A;  8ICB A;  4UAZ A;  1LV5 A;  2KZZ A;  1Z4N A;  3K1R B;  1FO4 A;  2HOQ A;  5KFC A;  1COO A;  4FS2 A;  1LB2 B;  3TAN A;  4BXO B;  1QQ5 A;  4TUR A;  1ZQM A;  4J9Q A;  3JPO A;  5ALR A;  4QZB A;  3HT3 A;  1L7N A;  1SXD A;  4KLD A;  2KJ5 A;  1X9S A;  4USA A;  4RPX A;  4UAS A;  2LM4 A;  5KFW A;  1JAL A;  4ECZ A;  2HCF A;  1UPH A;  2WAQ F;  4J9N A;  8ICJ A;  5KG5 A;  1P7D A;  4EBE A;  2W55 A;  1X9X A;  2MRL A;  5ALN A;  2ASL A;  3GQC A;  9ICH A;  3NTU A;  4JB3 A;  4OCZ A;  2WAQ C;  5JTI A;  4MEY A;  2ZIU A;  2PFN A;  2XCP A;  5AKH A;  2WF9 A;  4F92 B;  1ZQH A;  4DSF A;  1BNP A;  4ELV A;  1ARO P;  1LKY A;  2F77 X;  4J9L A;  1Z19 A;  2C28 A;  1J2M A;  4DQS A;  3RFA A;  4PZN A;  3UMB A;  5KG3 A;  3M8S A;  3QUB A;  4JMU A;  2KD1 A;  1HUO A;  1SKW A;  5GTI U;  3I1Y A;  5AM3 A;  3QZ7 A;  3WKA A;  3IV6 A;  2BQ3 A;  5DG9 A;  5CJ7 A;  4ECX A;  4QWE A;  3ZDC A;  1PZN A;  1Z3E B;  4J9R A;  1NK4 A;  4RQ4 A;  1J97 A;  2IHM A;  3G6Y A;  1C20 A;  3CRX A;  4C8N A;  1VJ5 A;  4XQ8 A;  2KZ3 A;  2AU0 A;  4PGX A;  5GTH U;  3PMN A;  3RRH A;  1JRO A;  3G6X A;  4I29 A;  7ICJ A;  3H8J A;  3QXG A;  3GV5 B;  5KFE A;  4QZH A;  3IM1 A;  2AGP A;  2K8B B;  1JIH A;  3KZI U;  5KFY A;  1RQL A;  2KSO B;  4BDP A;  3BZC A;  1IXR A;  3TAP A;  4UAY A;  4GXJ A;  2BCU A;  1UCV A;  1RYR A;  1KDH A;  9ICE A;  2IOF K;  5JU5 A;  2HVI A;  2D8C A;  1ZQO A;  4I2C A;  1T3N A;  3QUT A;  4KIT B;  4DWI A;  3NVV A;  1A6S A;  1L5U A;  4F4Y A;  3KD3 A;  4YXJ A;  3HP6 A;  3TKA A;  3RH5 A;  1ZQP A;  5DBC A;  5EWF A;  8ICE A;  9ICG A;  2LM1 A;  3R9K A;  1URJ A;  3RJK A;  5AM2 A;  4F4W A;  5ALP A;  4DQR A;  4C8M A;  1IM4 A;  3LDA A;  5KFH A;  5AKE A;  1YZ7 A;  4IRC A;  3QU4 A;  4EX6 A;  2BDU A; 
#chains in the Genus database with same CATH homology
 1RG6 A;  4PZN A;  4IS7 A;  1SXE A;  2Y9T A;  2KE7 A;  3TAD A;  1DXS A;  2KMD A;  1WWU A;  4NJ8 A;  2ESE A;  2EAM A;  1SV0 C;  2E8M A;  2LMR A;  5JRT A;  1UQV A;  1F0M A;  1WWV A;  3H8M A;  1JI7 A;  3KKA A;  2K4P A;  2D3D A;  1V85 A;  1Z1V A;  2JV3 A;  5J8Y C;  3BS7 A;  3TAD C;  2F8K A;  3SEI A;  1COK A;  4RQN A;  5F3X B;  2DKX A;  2DKZ A;  2ES6 A;  2K60 A;  1X40 A;  1B0X A;  5L1M A;  2EAP A;  2Y9U A;  3BQ7 A;  2KIV A;  1SGG A;  3BS5 A;  3BS5 B;  2F44 A;  3K1R B;  3HIL A;  4NL9 C;  2QB0 A;  2LPE A;  2QKQ A;  2QB0 B;  3TAC B;  1OXJ A;  3IDW A;  2KSO A;  2KSO B;  2B6G A;  1SXD A;  1SV0 A;  2EAO A;  1PK3 A;  2YTU A;  5KNI A;  2DL0 A;  2E8N A;  1UCV A;  2EAN A;  3SEN A;  2QB1 A;  1V38 A;  1KW4 A;  2QAR A;  5JU5 A;  2D8C A;  4PZO A;  3KKA C;  1X9X A;  5J8Y A;  1OW5 A;  2E8O A;  2L5Y A;  5JTI A;  2KG5 A;  2GLE A;  1B4F A;  4MHV A;  2E8P A;  2FE9 A;  2F3N A;  1SV4 A;  1LKY A;  1X66 A;  1LKY B;  2QAR B;  4NL9 A;  4RQM A;  1PK1 A;  1PK1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...