2KSOB

Epha2:ship2 sam:sam complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
59
structure length
59
Chain Sequence
GMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Structure and function of the EphA2:SHIP2 SAM domain heterodimer
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 16
structure length 59
sequence length 59
ec nomenclature ec 3.1.3.86: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase.
pdb deposition date 2010-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2ksoB00
4NL9C 2E8OA 2E8PA 1COKA 1B0XA 3KKAA 1UCVA 2ESEA 2Y9UA 5F3XB 3HILA 2YTUA 2QB0B 4RQMA 2FE9A 2F3NA 2E8NA 2EAPA 1PK1A 5JU5A 1LKYA 3TADA 1SV0A 2QARA 4PZOA 1KW4A 2K4PA 3SENA 2ES6A 2GLEA 2B6GA 2KSOA 4NJ8A 3BS7A 2DL0A 5J8YC 1V38A 5JRTA 2F44A 2L5YA 2D3DA 2QB1A 1SXEA 1X66A 2KE7A 1PK1B 4PZNA 2QARB 2KMDA 3H8MA 3TACB 2EANA 2KSOB 1SGGA 1V85A 1WWVA 4NL9A 5J8YA 1OXJA 5L1MA 1Z1VA 1X9XA 2KIVA 1JI7A 1RG6A 2DKZA 4IS7A 2Y9TA 3BS5A 1F0MA 1LKYB 3KKAC 5KNIA 1UQVA 4RQNA 1X40A 1PK3A 5JTIA 3BQ7A 1DXSA 2F8KA 3K1RB 2EAMA 2KG5A 2LMRA 1WWUA 2QB0A 1OW5A 3TADC 2JV3A 1SV0C 1SXDA 4MHVA 1B4FA 2LPEA 2EAOA 2K60A 2E8MA 3BS5B 2DKXA 2QKQA 3SEIA 1SV4A 3IDWA 2D8CA
chains in the Genus database with same CATH superfamily
5ALMA 2WF7A 5AKHA 2WAQF 4Y2YA 3AM9A 3WKBA 2HHQA 4DLGA 5KAFU 1U47A 5ALXA 2JEJA 2EZZA 3CNHA 1C20A 1ECWA 2FE9A 4QZFA 4IL6U 2KP7A 2WF9A 2BPCA 3C21A 8ICNA 1N48A 3GIIA 1ZQZA 3IG5A 1VDVA 9ICHA 4MEYA 9ICRA 3OGUA 1COOA 5B5EU 3CP8A 2KJ8A 4TURA 8ICWA 2NRVA 4YMNA 3NVVA 4I29A 4IR9A 4BXOA 5DG8A 1N61A 1V97A 4ECZA 1ZQDA 1YZ6A 1SZPA 3BQ2A 2C2EA 2AXTU 4O3NA 4Q43A 1OXJA 3K75D 1PUZA 1N5WA 2AH5A 2PI4A 1X9MA 9ICSA 5KG3A 5EWGA 4RNNA 1ZD3A 4IS7A 4GXJA 7ICRA 5BOLA 2W9CB 1JRPA 7ICHA 5CHGA 2BDUA 4FBTA 2KZ3A 1S77D 3RH5A 1NOMA 2KKVA 3WKDA 5J0RA 3KD3A 3E2EA 5IIJA 5F9NA 2YB4A 3F5EA 1S5LU 2KIWA 3D2SA 1RYRA 2OXOA 1X9WA 9ICEA 4M9JA 1TE2A 1SXDA 3UM9A 4DSEA 2W8KA 5AKJA 2FI1A 3HWTA 4HAIA 4UB5A 8ICQA 3RJEA 3HPOA 5DGAA 3ZDEA 4KLDA 5IIKA 4J9LA 5EE1A 1N62A 3RF9A 4DL2A 4FS1A 2C22A 2JHDA 3H8JA 3GV8B 2FDRA 4J9RA 4FZNA 3ONNA 1PVQA 2XCPA 5ALJA 3C23A 4ICAA 4DSLA 3MR3A 1NJWA 1WCLA 4B9VA 1XO0A 4KLMA 4A8EA 4JWMA 2HW3A 4B9UA 3SV4A 1ED1A 2HCFA 8ICXA 1BPEA 2LHTA 5DLGA 3RJHA 1YT3A 8ICTA 3TFSA 1UA1A 3GV5B 2QARB 2B0CA 2VA2A 1ZRMA 4Y2QA 1TK8A 4J9PA 2KK0A 3C1ZA 5HMMA 4J9SA 5AIBA 5L1IA 5HR7A 4KLHA 5D4BA 9ICNA 5J0XA 2Q0ZX 5KFXA 1UPHA 1KN5A 3HJEA 4FZLA 4QZHA 1XNSA 5DBCA 4NM1A 3WKAA 3GDXA 3RB0A 2DQNB 5KFGA 2IBKA 2EZXA 4UB6U 1ZQAA 4B9NA 5AI5A 1BGXT 2FPLA 1S9FA 3LWMA 3BQ7A 2H3IA 4GC6A 1S76D 4PGQA 5IIOA 4XUSA 1IG6A 4QZGA 2DF4B 3LDAA 2QB0A 2R8JA 2WF6A 1JIHA 4R63A 4U6PA 2ZJ5A 5AK3A 4Z6CA 3TARA 2EAOA 2ASJA 3CYMA 3SV3A 2E8MA 2LM4A 2HHSA 1A77A 1XU4A 2O6KA 4Y2XA 3S6JA 4KLGA 4EX6A 2OHFA 4J03A 4M04A 1TFRA 1CRXA 4I2JA 2YTUA 1L7PA 4ED1A 1D8BA 1BNOA 7ICVA 4C0ZA 4UB2A 3SENA 3IHQB 4XRHA 3OSNA 1L3TA 3KHLA 3ORYA 4I28A 2YMQA 5KFRA 1K1QA 4R65A 5EE9A 5DB7A 8ICHA 2B21A 2Q4TA 3Q8RB 4Y2UA 2XGPA 2BR0A 4ELTA 4F8RA 2W9AA 2ZIUA 9ICKA 5KFMA 2MRLA 3AQFA 1Q3UA 4EYIB 4QZBA 3CW2C 4RU9A 1KQQA 1ZQMA 2HBLA 2PMZC 1TAUA 1XO1A 4MEXA 3ZD9A 3RH4A 4DS4A 3G6YA 1ZD5A 5AM5A 4QIWF 5AKKA 3HW8A 3TQ1A 4C4TA 3JPQA 4AYBC 5EWEA 5CB1A 5KT7A 7ICSA 4TUQA 5KG1A 3NRWA 4G9BA 2FLNA 5ALRA 4B9LA 2DBYA 4NXZA 2I5HA 2C28A 4IRCA 2ZIVA 4C80A 2HSZA 2FMPA 1XC9A 2VIXA 7ICPA 2P35A 2Y1IA 4O9MA 1KKXA 1X6JA 3N7PD 3C2MA 3ED5A 1NJXA 4DSJA 2LPEA 4FO6A 2KOBA 3Q8LA 1HUOA 2P6RA 4RNMA 2FPKA 1SV4A 4F71A 3C1YA 3PW7A 1Q3VA 2A1JB 4I2GA 3AMZA 8ICMA 4F4KA 1D9DA 2W11A 5EWFA 1SWVA 3UXNA 3RB3A 2G09A 2EAPA 9ICIA 1LKYA 4C8NA 3KFUF 1L8LA 1MN8A 5AM4A 1Z00B 1KW4A 3FAHA 4Q44A 2BDPA 2HVHA 1X6IA 2YMPA 4QW8A 3T5KA 1ZQOA 2OH2A 4Y2RA 4C8MA 9ICFA 4P0PA 4QNLA 1TAMA 3QXGA 3LK9A 4EELA 2WTFA 2DPJA 2J6UA 2ISPA 3QEBZ 4Z6DA 4QZEA 9ICOA 3A0BU 2W3SA 4QWCA 2KJ5A 4ECSA 1ZJMA 3V7JA 1SL2A 4F5OA 4RQ8A 3H0LB 3M9NB 4RPYA 1U48A 1L6NA 4OJ6A 3ZDAA 4O3RA 1TK0A 2XI9A 3RJJA 4OCZA 2AHOB 3VC8A 2NRWA 1ZQBA 1ZQJA 1IM4A 4MF2A 1L3UA 4Q8FA 1F44A 4MFAA 4PGXA 3IP4B 2N1RA 3N28A 3ZD8A 1JUDA 1TKDA 4F2SA 4TUSA 1KBUA 1TK5A 3SD7A 4K4GA 4I2IA 3QNMA 4EEKA 2I1QA 3OSPA 1ZQ1C 4ECRA 2E8OA 5KT4A 4GXKA 3MDCA 3RRGA 2VJ5A 5DDMA 5DG7A 8ICOA 4M6WA 3KHGA 5KFPA 3GFKB 2A3VA 3NTUA 3N4MB 1LB2B 3RRHA 1TVAA 5ALSA 3EPGA 4O5EA 1KDHA 1D8YA 1L3SA 1HEKA 4DQPA 3V6JA 4F5RA 7ICKA 3BS7A 5DBBA 1NK5A 3PR4A 3SR6A 1M6YA 4ECYA 2F77X 7ICMA 1EXNA 2HOIA 2D3DA 2HVIA 4DL6A 3JPNA 5KFWA 8ICEA 1JROA 2W9CA 4RQ2A 2W7PA 5J2JA 3OHAA 2ATLA 3GZFA 4IC9A 3QU2A 1D8LA 5F9LA 5KFIA 4IQUA 8ICAA 1KL9A 3WU2U 5ALOA 2Y0SC 1P7DA 4PHDA 2KFZA 5IINA 3THVA 2WB1F 4GLXA 2PFQA 1LKYB 5KFOA 5B66U 1X42A 3V72A 5AM1A 3PW0A 2NO5A 2G0AA 3PY8A 4UBCA 2BCRA 2F1JA 1NK9A 5AK5A 4NLCA 3TKAA 1Z3EB 2Z7JA 1Z4NA 3NVYA 2BKEA 1L7OA 2R8GA 3N7SC 4B6JA 2I6XA 4ACOA 3HX0A 4US8A 2UVUA 2NO4A 4QZDA 4UQGA 2VA8A 2YX8A 4C4RA 3WK4A 4NL9C 2NRTA 2Y1JA 1COKA 5J0SA 1CEZA 1J2NA 1ZJNA 5J0OA 4FFDA 5KFFA 3PR5B 3Q8MA 5FP0A 3H4BA 4NLKA 4JWNA 2MSNA 3ZDDA 3G6VA 3AU6A 4JK1A 2QARA 2LM1A 1HIWA 2W03A 3H7IA 3B0XA 7ICTA 4ELUA 2F1HA 4DQIA 1NK4A 4DFKA 3PMNA 4M47A 1NK8A 5DG9A 2F44A 2W8LA 1K1SA 2YY6A 1O03A 5T14A 4X5VA 2IOFA 1UT8A 3GQCA 3KHRA 4O5KA 3ZI4A 1BPDA 3T79A 4M9HA 2G07A 1NJZA 2VANA 1O08A 4NWIA 1FIQA 4LVSA 3PX0A 5HHHA 2FJ6A 3WK6A 4PL1A 4YR0A 3HKZC 3UMBA 5J8YA 3NRZA 4UAYA 3HKZF 3SI8A 2HBMA 3KZIU 4M6WB 7ICGA 5DQGA 3I76A 1BNPA 1U45A 2E1FA 5KG4A 5DLFA 1QSYA 1T8EA 4ECUA 2LI6A 2AU0A 2DPIA 4IQWA 2AQ0A 1XSNA 8ICFA 8ICBA 4YVZA 4OJPA 4PH5A 9ICLA 3G6XA 3UQ0A 5AM3A 4F4XA 1U9LA 1RQNA 3H0RB 4ZOHC 4UBBA 4IR1A 4YMOA 5ALLA 4Z6FA 3TI0A 1SKWA 2KIVA 2PFOA 5KL8B 5AKYA 5L9XA 1QQ6A 1FO4A 2KV2A 2MA1A 3Q8PB 2CRXA 5KFHA 4US9A 1XSPA 2ZIWB 4UATA 2ZIXB 2OYYA 2JZBB 4YP3A 4NM2A 2WF8A 3TANA 3M1YA 5KFVA 3R9KA 2OCEA 3JPRA 4C7ZA 4P4PA 4G3IA 4UB1A 2C2RA 4O3OA 2L5YA 3ETRA 5KFUA 5KG0A 1ZQTA 4O5CA 3QU4A 3C5GA 1IXRA 5HMLA 4QWEA 3F5AA 2ZUBA 1PK1B 5CEHA 4F2RA 1U4BA 2KVCA 1DRGA 5AI9A 1K5OA 3NUQA 1WUDA 5ALKA 2K4IA 3LVWA 4Y2TA 2RP5A 5AKEA 1T3NA 3IG8A 5TZVA 8ICUA 4I2CA 9ICGA 2EZYA 5ALGA 4CCHA 3H8WA 3UQ2A 2IOHA 1TAQA 2DKZA 3JPOA 2LYHA 2UVVA 4QWDA 1KRPA 3EZ5A 8ICPA 3WK5A 5KFCA 2YMLA 2A1JA 1ZQWA 3RBEA 2W3RA 2EAMA 2LMRA 3BZKA 2VKQA 4Q45A 4Y2VA 3QZ7A 2K60A 3BJYA 2GH1A 3MFHA 3FDSA 4MF8A 3NS1A 1Z00A 2BZFA 3N7RC 5AKLA 4QZIA 2ODGA 2PXIA 1HJPA 3RB4A 4KLFA 3PX4A 2C2DA 1Y88A 5DQHA 2VJ4A 4RQ7A 1H38A 3HILA 3MR6A 4P2HA 3L3FX 3M8RA 1MQ3A 4RZRA 4BWMA 1T4GA 4R8UB 5J8YC 2BPGA 4GXIA 2HHXA 4KN7A 1N56A 5KFBA 2JEIA 3VCBA 7ICFA 4ZH4A 5ALWA 1BPBA 1ZD2P 5C5JA 3EW9A 4RUAA 4EENA 4QW9A 2KSOB 3KTQA 1X2IA 3UPQA 3ETLA 2DFLA 4UAWA 4F92B 2F76X 1X9XA 4CNQA 1QQ5A 4KX5A 5J0PA 1N5XA 3PSFA 1B43A 1SIJA 4TUPA 4DFMA 5KFDA 5KFJA 4DQSA 4NLNA 2PMZF 4C8OA 2QLTA 5J0UA 1DK3A 1Z4OA 4OD0A 1KFSA 5AIAA 3SMVA 2JV3A 5KG2A 5J2EA 2ASLA 1L8OA 2V9WA 2RHFA 3F53A 4AYBF 3OJUA 4KX3A 4KLLA 4UARA 3V7LA 4ED2A 1UA0A 3QUCA 3V7KA 2UVWA 2Y9UA 3H4DA 3NVZA 4ELVA 3LVVA 4O3MA 1RQLA 3WKCA 8ICRA 2CXYA 4NLZA 1CUKA 4UAVA 2WF5A 3F2CA 2NV3A 5AI0A 8ICJA 1NI3A 1IIPA 2BGWA 1S0MA 3D2NA 2OWOA 1ZYQA 5C0YA 2ASDA 3K4GA 3U26A 1L5UA 4OJOA 3QU7A 2BCVA 5BOMA 2QB1A 1T7PA 2ZG6A 5KG6A 4NY8A 4I2EA 4DOBA 5J29A 3M9MB 4DFPA 3FC4A 2ZTDA 3MR5A 2RLTA 4I2AA 2RQ5A 2R18A 1RZTA 4F3OA 1WWVA 4NL9A 5KL1B 3JPTA 2ZTEA 4XQ8A 2W9BA 3GIJA 4B9TA 2E1EA 4YCXA 5AI6A 3L5KA 4DF8A 4RT3A 2Y9TA 2IA6A 4YXJA 2JRZA 5KFQA 5J0WA 3EYZA 1UQVA 3Q8QB 2KZZA 4YD1A 2LYBA 2F8KA 2F2AB 4CDGA 1ZXIA 5DKWA 1T94A 4Y2SA 1KLNA 1JXLA 3ISDA 2DUYA 5L1KA 1MSWD 2QKQA 4R66A 3C2KA 4DCCA 4ED3A 2V4RA 3N97B 2K89A 7ICUA 2LYAA 3KZXA 4PHPA 4QWBA 3AU2A 4ECWA 1Q8KA 4YR3A 4RQMA 2F3NA 4JV0A 3TADA 3O0FA 2IHMA 1SV0A 8ICZA 4PZOA 2JXJA 3AEVA 4NJ8A 3Q8SB 4PL2A 5KFLA 1WCNA 2VA3A 4EBEA 3PMLA 2EH9A 1ZQSA 3PV8A 4DLEA 3QE9Y 1V9PA 3LWLA 2NYVA 1BPXA 3K1ZA 2MUTB 5AM2A 4DF4A 3M7DA 3PW2A 2H3ZA 5GTIU 2J6SA 4Y2JA 2KMDA 5ALFA 3C28A 5HP4A 4R64A 1QSLA 4EX7A 3AQEA 4O3SA 2JH7A 5ALDA 4KLOA 4IQTA 4RQ4A 1KTQA 2H5XA 4DL4A 1NJYA 2PKEA 1F5SA 3GIMA 2H3VA 1J97A 3RAXA 3MR2A 9ICBA 7ICOA 5ALUA 4F5QA 3KOOA 1RG6A 3GV7B 4YG2A 1ZQPA 5CA7A 3L4PA 4DL7A 2KZMA 1Q46A 5G5HA 4UASA 2BPFA 4Z6EA 3EPIA 3T3FA 2A1AA 4ED0A 2HOFA 2W04A 4I2BA 2DGZA 2KG5A 4J9OA 3BQ0A 2ZIWA 3F2DA 4P0QB 1VLBA 2KEYA 3IV6A 2KKPA 2ZIXA 4M9LA 2HBJA 9ICWA 2JZBA 3PX6A 4KLUA 2HI0A 2Y0SF 2GO7A 3NGDA 4USAA 3QYPA 4EZ6A 4F4WA 4DSFA 3DDHA 2LKYA 1ZQUA 4FZMA 4KLSA 5ALZA 5J2CA 2ESEA 1DGSA 2WFAA 5AI4A 2EQYA 5KG5A 5ALPA 3TAPA 3WK9A 3JPSA 4M0AA 2W9BB 2XY5A 4F4YA 2AJQA 1PK1A 1ZQQA 4GIBA 4XA5A 2R8KA 4RQ3A 1ZD4A 1ZQNA 3SAHA 2W54A 4F5NA 2DL0A 2YMMA 4OO1J 3HT3A 1FFUA 5DB6A 1ZQFA 2KNJA 4DL3A 2AGOA 3SAFA 4UB8U 4PHAA 8ICCA 5HHIA 5CRXA 3WK8A 5CP2A 4DO9A 4O3PA 3UXPA 4DEZA 5G5GA 5AM0A 1A6SA 3SQIA 3BQ1A 5KAIU 1XS9D 3RBDA 1SZHA 1Z1VA 1ZQYA 3C2LA 4E0DA 4M9GA 5DDYA 2JMGA 1J2MA 1T3QA 4F4ZA 1WG8A 3PZPA 2BQRA 7ICNA 1QQ7A 5J2FA 3AN1A 1TV9A 5KNIA 4IRKA 2WAQC 3BQTA 4Y2PA 5AKZA 2HHUA 2XICA 3NVWA 2K8BB 5ALHA 2K8CB 4I2FA 5IIMA 2F8LA 2K4EA 3C29A 4I2DA 3TADC 1SV0C 1URJA 2D6FC 5K4LA 2JH1A 9ICUA 4LZGA 3Q8KA 4J9NA 1JALA 2WHEA 5IILA 1IV8A 3BDPA 5TISU 1NK0A 8ICVA 5AHXA 3RJGA 1GO3F 4R8UA 1B0XA 2XY6A 5DGBA 1UCVA 3ZDBA 4C7YA 4DL5A 1CI4A 2V4QA 4YR2A 2XVTA 1X9SA 1WYGA 4YMMA 4KLTA 4KMOB 2XIDA 2GLEA 3T5HA 2KSOA 1S10A 3DEEA 2FLPA 5AICA 5A0LA 4AP9A 4QZAA 4RQ0A 5ALIA 4KTQA 3QU9A 1L7MA 3QU5A 4NLGA 2XGQA 2PI5A 2HMXA 2XCAA 3RJFA 4CE6A 1NZPA 2KE7A 2KHQA 3M6KA 8ICYA 1N63A 3ICXA 4KMUA 1LV5A 1RM6C 3RFAA 5EOZA 3D2QA 1SL1A 1N2XA 4DFDA 1VJ5A 2E5SA 4JV2A 4F50A 3DV9A 5ALNA 2R8HA 4UW9A 4UB4A 4JV1A 4Q8EA 2HHVA 4TQSA 5KG7A 2BHNA 4DOAA 4BWJA 4FE3A 5KFZA 2JGAA 1ZQHA 3PO4A 2CN1A 3K1RB 2NRXA 4B9MA 2ZXIA 3QZ8A 3EWAA 1ZOLA 2OEHA 4C8LA 4JUZA 2EDUA 4DSIA 1JX4A 4MHVA 2P6UA 1RYSA 3BS5B 2ZXHA 1S97A 4KLIA 3IDWA 1L7NA 3RH6A 3SZ2A 5KFSA 3V6KA 3KKAA 3RJIA 5F3XB 5J2IA 1DGJA 2HDOA 5KFYA 3QEAZ 5L1LA 3AUOA 1UT5A 2RRDA 3B0YA 3JPPA 3H8SA 4YN4A 4BX9C 1NZBA 2BQUA 4NLBA 4F93B 2RDIA 4QZCA 1QTMA 3D6JA 3QUBA 3PO5A 2YN4A 2KICA 3HP6A 4YXMA 5KT3A 4DFJA 2IOFK 4EZ9A 5AI8A 1XSLA 2PFPA 4ED7A 8ICGA 4EEYA 8ICLA 3TACB 2M9NA 2F1IA 2HOQA 4BGDA 4ECQA 2XC9A 1MQ2A 1SL0A 1QH9A 4NV0A 4F72A 5DB8A 4F91B 2A19A 5L1MA 3OHBA 2HHTA 5CR0A 3T5LA 1JI7A 1JMSA 2FPMA 1MC8A 1S0OA 3MABA 2ZJAA 4BXOB 3PSIA 2E3TA 4CF5A 5E79U 5ALVA 4BJQA 4C4SA 5KFEA 3TAQA 4DQRA 1Z19A 5DB9A 2K8AA 1KSPA 2ISOA 2FLLA 1OW5A 2ZTCA 2R8IA 2W9MA 7ICLA 5KTQA 5EE0A 3MDAA 2DKXA 3I1YA 2NRZA 2D8CA 9ICQA 4RPXA 2HBKA 5KFTA 1QLNA 2E8PA 3PW5A 3GU3A 2RDJA 5J2KA 1A76A 1XWLA 1RDFA 5KT6A 4J9QA 1AROP 4ECTA 2MUTA 3QUTA 1ZQRA 3ZDCA 2OM6A 8ICSA 2KN7A 4J9MA 2B6GA 1ZQKA 4MFFA 1ZQIA 3H40A 5DBAA 1Z1BA 4FBUA 4QWAA 3RR8A 1V38A 4RT2A 4QIWC 3PW4A 3QUQA 1ZQVA 4LZDA 1L3VA 4M2YA 4DQQA 4MFCA 2ZUDA 8ICKA 4KLJA 4RPZA 4I27A 2G5IB 4PGYA 1DK2A 2JR5A 3KHHA 1UHUA 2H3FA 9ICMA 2PFNA 3RAQA 3FYHA 2ZJ8A 4EBCA 4P0QA 5HR6A 2H3QA 3PVXA 4PJ0U 4DS5A 3T5JA 2BCUA 4UAUA 4C8KA 5J2AA 2KFNA 4DWIA 4CF3A 1ZETA 1F0MA 3KKAC 1ZRNA 1U49A 5HNKA 4QZ9A 1X40A 5JTIA 5J2BA 1S0NA 1RYUA 3PNCA 5L1JA 1DXSA 5EE3A 5JUMA 4K4IA 2P66A 4ECVA 1MA7A 1RPLA 3MFIA 1WWUA 4DSKA 9ICJA 1PVPA 2KTQA 7ICQA 4U7CA 1ZQXA 1KFDA 5H2FU 3OPXA 2AGQA 2IHNA 7ICIA 1NKEA 4QJFB 3RJKA 4PHEA 4P4MA 4KLQA 2BQ3A 1NK6A 3IM1A 4KLEA 3MGHA 3C5FA 3GIKA 2QB0B 1BPYA 4ECXA 2M0NA 3CRXA 4I2HA 2W7OA 2G08A 9ICAA 5ALQA 1FEZA 2YB1A 2K4PA 3UXOA 4JMUA 3A0HU 4BDPA 1ZQEA 2GOLA 1NKCA 5JRTA 3M9OB 1ZQCA 5J0TA 3PSTA 1HUZA 4KN4A 3EUB2 5ALEA 2BCQA 1SKRA 1X66A 4ED8A 4CGZA 3B9JA 4RQ5A 3J81j 3MBYA 3H8MA 4O3QA 3SAGA 2MU2A 1ZQGA 5BPCA 2MAXA 4RQ1A 3IRUA 1V85A 2FMSA 8ICIA 5ALTA 4LJXA 5J2GA 4M9NA 5DQIA 3H0MB 3GILA 3OTQA 4DOCA 1BPZA 5KFAA 3RR7A 2ZIUB 4OJ5A 7ICEA 5KT5A 3SYZA 4RQNA 5KFKA 1C7YA 1PK3A 3UMCA 5AKGA 1NKBA 5J2HA 1NNLA 4GFJA 5AKIA 3MC1A 4HYKA 4FS2A 1RXWA 4P4OA 4F5PA 2KJ9A 5KT2A 2J6TA 1FFVA 3LYSA 2KHVA 4CF4A 1AQ6A 2IMWP 3QX7A 2JEGA 1KEJA 4O0IA 9ICTA 4YD2A 1SB3C 4KITB 1QSSA 3UMGA 2ZIVB 4TQRA 5D46A 5J0YA 5CWRA 2K4HA 5GTHU 4UB3A 3ISBA 1RXVA 4YQWA 1LVHA 3I28A 3RB6A 9ICCA 1SWWA 3BZCA 5CJ7A 2BCSA 3MGVA 5J0QA 1B22A 4IRDA 1S0VA 5AK6A 2GWSA 9ICPA 2E8NA 5KFNA 3FM9A 3HRDD 7ICJA 5JU5A 4EYHB 9ICXA 3OJSA 4OJLA 3E58A 1ZQLA 2ES6A 3TFRA 4EBDA 1D9FA 3V6HA 5IIIA 1SKSA 3M6ZA 2AQ4A 3MGIA 3RTVA 4BUGA 3E0FA 4ED6A 1JXEA 4RNOA 3WKEA 5D49A 3ISCA 2I9GA 1BVSA 1SXEA 3WK7A 2FMQA 2ZUCA 2WB1C 4J9KA 2DWQA 2W55A 4PZNA 2HHWA 4GC7A 2G06A 4WJ3B 2EANA 2KVSA 1SGGA 4YFKA 3ALRA 4PPXA 9ICVA 2G5HB 4P0PB 1PZNA 1DOQA 1QCKA 5AKXA 1N60A 3IN5A 4B9SA 3NASA 3BS5A 2LBOA 4K4HA 1KFTA 1S8OA 1PVRA 1YZ7A 2W43A 5ALYA 1A0PA 3PSPA 3M8SA 2ALZA 4RUCA 2JEFA 2UVRA 4UAZA 5J2DA 1NK7A 3KBBA 5AK4A 1OUQA 4JB3A 2XO7A 2KD1A 4RQ6A 4IQVA 2YQEA 4QZ8A 3AL0B 3F2BA 1JN3A 1B4FA 4CRXA 2CPRA 3SEIA 2AGPA 2XY7A
chains in the Genus database with same CATH topology
4NL9C 2E8OA 2E8PA 1COKA 1B0XA 3KKAA 1UCVA 2ESEA 2Y9UA 5F3XB 3HILA 2YTUA 2QB0B 4RQMA 2FE9A 2F3NA 2E8NA 2EAPA 1PK1A 5JU5A 1LKYA 3TADA 1SV0A 2QARA 4PZOA 1KW4A 2K4PA 3SENA 2ES6A 2GLEA 2B6GA 2KSOA 4NJ8A 3BS7A 2DL0A 5J8YC 1V38A 5JRTA 2F44A 2L5YA 2D3DA 2QB1A 1SXEA 1X66A 2KE7A 1PK1B 4PZNA 2QARB 2KMDA 3H8MA 3TACB 2EANA 2KSOB 1SGGA 1V85A 1WWVA 4NL9A 5J8YA 1OXJA 5L1MA 1Z1VA 1X9XA 2KIVA 1JI7A 1RG6A 2DKZA 4IS7A 2Y9TA 3BS5A 1F0MA 1LKYB 3KKAC 5KNIA 1UQVA 4RQNA 1X40A 1PK3A 5JTIA 3BQ7A 1DXSA 2F8KA 3K1RB 2EAMA 2KG5A 2LMRA 1WWUA 2QB0A 1OW5A 3TADC 2JV3A 1SV0C 1SXDA 4MHVA 1B4FA 2LPEA 2EAOA 2K60A 2E8MA 3BS5B 2DKXA 2QKQA 3SEIA 1SV4A 3IDWA 2D8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL9 C;  2E8O A;  2E8P A;  1COK A;  1B0X A;  3KKA A;  1UCV A;  2ESE A;  2Y9U A;  5F3X B;  3HIL A;  2YTU A;  2QB0 B;  4RQM A;  2FE9 A;  2F3N A;  2E8N A;  2EAP A;  1PK1 A;  5JU5 A;  1LKY A;  3TAD A;  1SV0 A;  2QAR A;  4PZO A;  1KW4 A;  2K4P A;  3SEN A;  2ES6 A;  2GLE A;  2B6G A;  2KSO A;  4NJ8 A;  3BS7 A;  2DL0 A;  5J8Y C;  1V38 A;  5JRT A;  2F44 A;  2L5Y A;  2D3D A;  2QB1 A;  1SXE A;  1X66 A;  2KE7 A;  1PK1 B;  4PZN A;  2QAR B;  2KMD A;  3H8M A;  3TAC B;  2EAN A;  2KSO B;  1SGG A;  1V85 A;  1WWV A;  4NL9 A;  5J8Y A;  1OXJ A;  5L1M A;  1Z1V A;  1X9X A;  2KIV A;  1JI7 A;  1RG6 A;  2DKZ A;  4IS7 A;  2Y9T A;  3BS5 A;  1F0M A;  1LKY B;  3KKA C;  5KNI A;  1UQV A;  4RQN A;  1X40 A;  1PK3 A;  5JTI A;  3BQ7 A;  1DXS A;  2F8K A;  3K1R B;  2EAM A;  2KG5 A;  2LMR A;  1WWU A;  2QB0 A;  1OW5 A;  3TAD C;  2JV3 A;  1SV0 C;  1SXD A;  4MHV A;  1B4F A;  2LPE A;  2EAO A;  2K60 A;  2E8M A;  3BS5 B;  2DKX A;  2QKQ A;  3SEI A;  1SV4 A;  3IDW A;  2D8C A; 
#chains in the Genus database with same CATH topology
 5ALM A;  2WF7 A;  5AKH A;  2WAQ F;  4Y2Y A;  3AM9 A;  3WKB A;  2HHQ A;  4DLG A;  5KAF U;  1U47 A;  5ALX A;  2JEJ A;  2EZZ A;  3CNH A;  1C20 A;  1ECW A;  2FE9 A;  4QZF A;  4IL6 U;  2KP7 A;  2WF9 A;  2BPC A;  3C21 A;  8ICN A;  1N48 A;  3GII A;  1ZQZ A;  3IG5 A;  1VDV A;  9ICH A;  4MEY A;  9ICR A;  3OGU A;  1COO A;  5B5E U;  3CP8 A;  2KJ8 A;  4TUR A;  8ICW A;  2NRV A;  4YMN A;  3NVV A;  4I29 A;  4IR9 A;  4BXO A;  5DG8 A;  1N61 A;  1V97 A;  4ECZ A;  1ZQD A;  1YZ6 A;  1SZP A;  3BQ2 A;  2C2E A;  2AXT U;  4O3N A;  4Q43 A;  1OXJ A;  3K75 D;  1PUZ A;  1N5W A;  2AH5 A;  2PI4 A;  1X9M A;  9ICS A;  5KG3 A;  5EWG A;  4RNN A;  1ZD3 A;  4IS7 A;  4GXJ A;  7ICR A;  5BOL A;  2W9C B;  1JRP A;  7ICH A;  5CHG A;  2BDU A;  4FBT A;  2KZ3 A;  1S77 D;  3RH5 A;  1NOM A;  2KKV A;  3WKD A;  5J0R A;  3KD3 A;  3E2E A;  5IIJ A;  5F9N A;  2YB4 A;  3F5E A;  1S5L U;  2KIW A;  3D2S A;  1RYR A;  2OXO A;  1X9W A;  9ICE A;  4M9J A;  1TE2 A;  1SXD A;  3UM9 A;  4DSE A;  2W8K A;  5AKJ A;  2FI1 A;  3HWT A;  4HAI A;  4UB5 A;  8ICQ A;  3RJE A;  3HPO A;  5DGA A;  3ZDE A;  4KLD A;  5IIK A;  4J9L A;  5EE1 A;  1N62 A;  3RF9 A;  4DL2 A;  4FS1 A;  2C22 A;  2JHD A;  3H8J A;  3GV8 B;  2FDR A;  4J9R A;  4FZN A;  3ONN A;  1PVQ A;  2XCP A;  5ALJ A;  3C23 A;  4ICA A;  4DSL A;  3MR3 A;  1NJW A;  1WCL A;  4B9V A;  1XO0 A;  4KLM A;  4A8E A;  4JWM A;  2HW3 A;  4B9U A;  3SV4 A;  1ED1 A;  2HCF A;  8ICX A;  1BPE A;  2LHT A;  5DLG A;  3RJH A;  1YT3 A;  8ICT A;  3TFS A;  1UA1 A;  3GV5 B;  2QAR B;  2B0C A;  2VA2 A;  1ZRM A;  4Y2Q A;  1TK8 A;  4J9P A;  2KK0 A;  3C1Z A;  5HMM A;  4J9S A;  5AIB A;  5L1I A;  5HR7 A;  4KLH A;  5D4B A;  9ICN A;  5J0X A;  2Q0Z X;  5KFX A;  1UPH A;  1KN5 A;  3HJE A;  4FZL A;  4QZH A;  1XNS A;  5DBC A;  4NM1 A;  3WKA A;  3GDX A;  3RB0 A;  2DQN B;  5KFG A;  2IBK A;  2EZX A;  4UB6 U;  1ZQA A;  4B9N A;  5AI5 A;  1BGX T;  2FPL A;  1S9F A;  3LWM A;  3BQ7 A;  2H3I A;  4GC6 A;  1S76 D;  4PGQ A;  5IIO A;  4XUS A;  1IG6 A;  4QZG A;  2DF4 B;  3LDA A;  2QB0 A;  2R8J A;  2WF6 A;  1JIH A;  4R63 A;  4U6P A;  2ZJ5 A;  5AK3 A;  4Z6C A;  3TAR A;  2EAO A;  2ASJ A;  3CYM A;  3SV3 A;  2E8M A;  2LM4 A;  2HHS A;  1A77 A;  1XU4 A;  2O6K A;  4Y2X A;  3S6J A;  4KLG A;  4EX6 A;  2OHF A;  4J03 A;  4M04 A;  1TFR A;  1CRX A;  4I2J A;  2YTU A;  1L7P A;  4ED1 A;  1D8B A;  1BNO A;  7ICV A;  4C0Z A;  4UB2 A;  3SEN A;  3IHQ B;  4XRH A;  3OSN A;  1L3T A;  3KHL A;  3ORY A;  4I28 A;  2YMQ A;  5KFR A;  1K1Q A;  4R65 A;  5EE9 A;  5DB7 A;  8ICH A;  2B21 A;  2Q4T A;  3Q8R B;  4Y2U A;  2XGP A;  2BR0 A;  4ELT A;  4F8R A;  2W9A A;  2ZIU A;  9ICK A;  5KFM A;  2MRL A;  3AQF A;  1Q3U A;  4EYI B;  4QZB A;  3CW2 C;  4RU9 A;  1KQQ A;  1ZQM A;  2HBL A;  2PMZ C;  1TAU A;  1XO1 A;  4MEX A;  3ZD9 A;  3RH4 A;  4DS4 A;  3G6Y A;  1ZD5 A;  5AM5 A;  4QIW F;  5AKK A;  3HW8 A;  3TQ1 A;  4C4T A;  3JPQ A;  4AYB C;  5EWE A;  5CB1 A;  5KT7 A;  7ICS A;  4TUQ A;  5KG1 A;  3NRW A;  4G9B A;  2FLN A;  5ALR A;  4B9L A;  2DBY A;  4NXZ A;  2I5H A;  2C28 A;  4IRC A;  2ZIV A;  4C80 A;  2HSZ A;  2FMP A;  1XC9 A;  2VIX A;  7ICP A;  2P35 A;  2Y1I A;  4O9M A;  1KKX A;  1X6J A;  3N7P D;  3C2M A;  3ED5 A;  1NJX A;  4DSJ A;  2LPE A;  4FO6 A;  2KOB A;  3Q8L A;  1HUO A;  2P6R A;  4RNM A;  2FPK A;  1SV4 A;  4F71 A;  3C1Y A;  3PW7 A;  1Q3V A;  2A1J B;  4I2G A;  3AMZ A;  8ICM A;  4F4K A;  1D9D A;  2W11 A;  5EWF A;  1SWV A;  3UXN A;  3RB3 A;  2G09 A;  2EAP A;  9ICI A;  1LKY A;  4C8N A;  3KFU F;  1L8L A;  1MN8 A;  5AM4 A;  1Z00 B;  1KW4 A;  3FAH A;  4Q44 A;  2BDP A;  2HVH A;  1X6I A;  2YMP A;  4QW8 A;  3T5K A;  1ZQO A;  2OH2 A;  4Y2R A;  4C8M A;  9ICF A;  4P0P A;  4QNL A;  1TAM A;  3QXG A;  3LK9 A;  4EEL A;  2WTF A;  2DPJ A;  2J6U A;  2ISP A;  3QEB Z;  4Z6D A;  4QZE A;  9ICO A;  3A0B U;  2W3S A;  4QWC A;  2KJ5 A;  4ECS A;  1ZJM A;  3V7J A;  1SL2 A;  4F5O A;  4RQ8 A;  3H0L B;  3M9N B;  4RPY A;  1U48 A;  1L6N A;  4OJ6 A;  3ZDA A;  4O3R A;  1TK0 A;  2XI9 A;  3RJJ A;  4OCZ A;  2AHO B;  3VC8 A;  2NRW A;  1ZQB A;  1ZQJ A;  1IM4 A;  4MF2 A;  1L3U A;  4Q8F A;  1F44 A;  4MFA A;  4PGX A;  3IP4 B;  2N1R A;  3N28 A;  3ZD8 A;  1JUD A;  1TKD A;  4F2S A;  4TUS A;  1KBU A;  1TK5 A;  3SD7 A;  4K4G A;  4I2I A;  3QNM A;  4EEK A;  2I1Q A;  3OSP A;  1ZQ1 C;  4ECR A;  2E8O A;  5KT4 A;  4GXK A;  3MDC A;  3RRG A;  2VJ5 A;  5DDM A;  5DG7 A;  8ICO A;  4M6W A;  3KHG A;  5KFP A;  3GFK B;  2A3V A;  3NTU A;  3N4M B;  1LB2 B;  3RRH A;  1TVA A;  5ALS A;  3EPG A;  4O5E A;  1KDH A;  1D8Y A;  1L3S A;  1HEK A;  4DQP A;  3V6J A;  4F5R A;  7ICK A;  3BS7 A;  5DBB A;  1NK5 A;  3PR4 A;  3SR6 A;  1M6Y A;  4ECY A;  2F77 X;  7ICM A;  1EXN A;  2HOI A;  2D3D A;  2HVI A;  4DL6 A;  3JPN A;  5KFW A;  8ICE A;  1JRO A;  2W9C A;  4RQ2 A;  2W7P A;  5J2J A;  3OHA A;  2ATL A;  3GZF A;  4IC9 A;  3QU2 A;  1D8L A;  5F9L A;  5KFI A;  4IQU A;  8ICA A;  1KL9 A;  3WU2 U;  5ALO A;  2Y0S C;  1P7D A;  4PHD A;  2KFZ A;  5IIN A;  3THV A;  2WB1 F;  4GLX A;  2PFQ A;  1LKY B;  5KFO A;  5B66 U;  1X42 A;  3V72 A;  5AM1 A;  3PW0 A;  2NO5 A;  2G0A A;  3PY8 A;  4UBC A;  2BCR A;  2F1J A;  1NK9 A;  5AK5 A;  4NLC A;  3TKA A;  1Z3E B;  2Z7J A;  1Z4N A;  3NVY A;  2BKE A;  1L7O A;  2R8G A;  3N7S C;  4B6J A;  2I6X A;  4ACO A;  3HX0 A;  4US8 A;  2UVU A;  2NO4 A;  4QZD A;  4UQG A;  2VA8 A;  2YX8 A;  4C4R A;  3WK4 A;  4NL9 C;  2NRT A;  2Y1J A;  1COK A;  5J0S A;  1CEZ A;  1J2N A;  1ZJN A;  5J0O A;  4FFD A;  5KFF A;  3PR5 B;  3Q8M A;  5FP0 A;  3H4B A;  4NLK A;  4JWN A;  2MSN A;  3ZDD A;  3G6V A;  3AU6 A;  4JK1 A;  2QAR A;  2LM1 A;  1HIW A;  2W03 A;  3H7I A;  3B0X A;  7ICT A;  4ELU A;  2F1H A;  4DQI A;  1NK4 A;  4DFK A;  3PMN A;  4M47 A;  1NK8 A;  5DG9 A;  2F44 A;  2W8L A;  1K1S A;  2YY6 A;  1O03 A;  5T14 A;  4X5V A;  2IOF A;  1UT8 A;  3GQC A;  3KHR A;  4O5K A;  3ZI4 A;  1BPD A;  3T79 A;  4M9H A;  2G07 A;  1NJZ A;  2VAN A;  1O08 A;  4NWI A;  1FIQ A;  4LVS A;  3PX0 A;  5HHH A;  2FJ6 A;  3WK6 A;  4PL1 A;  4YR0 A;  3HKZ C;  3UMB A;  5J8Y A;  3NRZ A;  4UAY A;  3HKZ F;  3SI8 A;  2HBM A;  3KZI U;  4M6W B;  7ICG A;  5DQG A;  3I76 A;  1BNP A;  1U45 A;  2E1F A;  5KG4 A;  5DLF A;  1QSY A;  1T8E A;  4ECU A;  2LI6 A;  2AU0 A;  2DPI A;  4IQW A;  2AQ0 A;  1XSN A;  8ICF A;  8ICB A;  4YVZ A;  4OJP A;  4PH5 A;  9ICL A;  3G6X A;  3UQ0 A;  5AM3 A;  4F4X A;  1U9L A;  1RQN A;  3H0R B;  4ZOH C;  4UBB A;  4IR1 A;  4YMO A;  5ALL A;  4Z6F A;  3TI0 A;  1SKW A;  2KIV A;  2PFO A;  5KL8 B;  5AKY A;  5L9X A;  1QQ6 A;  1FO4 A;  2KV2 A;  2MA1 A;  3Q8P B;  2CRX A;  5KFH A;  4US9 A;  1XSP A;  2ZIW B;  4UAT A;  2ZIX B;  2OYY A;  2JZB B;  4YP3 A;  4NM2 A;  2WF8 A;  3TAN A;  3M1Y A;  5KFV A;  3R9K A;  2OCE A;  3JPR A;  4C7Z A;  4P4P A;  4G3I A;  4UB1 A;  2C2R A;  4O3O A;  2L5Y A;  3ETR A;  5KFU A;  5KG0 A;  1ZQT A;  4O5C A;  3QU4 A;  3C5G A;  1IXR A;  5HML A;  4QWE A;  3F5A A;  2ZUB A;  1PK1 B;  5CEH A;  4F2R A;  1U4B A;  2KVC A;  1DRG A;  5AI9 A;  1K5O A;  3NUQ A;  1WUD A;  5ALK A;  2K4I A;  3LVW A;  4Y2T A;  2RP5 A;  5AKE A;  1T3N A;  3IG8 A;  5TZV A;  8ICU A;  4I2C A;  9ICG A;  2EZY A;  5ALG A;  4CCH A;  3H8W A;  3UQ2 A;  2IOH A;  1TAQ A;  2DKZ A;  3JPO A;  2LYH A;  2UVV A;  4QWD A;  1KRP A;  3EZ5 A;  8ICP A;  3WK5 A;  5KFC A;  2YML A;  2A1J A;  1ZQW A;  3RBE A;  2W3R A;  2EAM A;  2LMR A;  3BZK A;  2VKQ A;  4Q45 A;  4Y2V A;  3QZ7 A;  2K60 A;  3BJY A;  2GH1 A;  3MFH A;  3FDS A;  4MF8 A;  3NS1 A;  1Z00 A;  2BZF A;  3N7R C;  5AKL A;  4QZI A;  2ODG A;  2PXI A;  1HJP A;  3RB4 A;  4KLF A;  3PX4 A;  2C2D A;  1Y88 A;  5DQH A;  2VJ4 A;  4RQ7 A;  1H38 A;  3HIL A;  3MR6 A;  4P2H A;  3L3F X;  3M8R A;  1MQ3 A;  4RZR A;  4BWM A;  1T4G A;  4R8U B;  5J8Y C;  2BPG A;  4GXI A;  2HHX A;  4KN7 A;  1N56 A;  5KFB A;  2JEI A;  3VCB A;  7ICF A;  4ZH4 A;  5ALW A;  1BPB A;  1ZD2 P;  5C5J A;  3EW9 A;  4RUA A;  4EEN A;  4QW9 A;  2KSO B;  3KTQ A;  1X2I A;  3UPQ A;  3ETL A;  2DFL A;  4UAW A;  4F92 B;  2F76 X;  1X9X A;  4CNQ A;  1QQ5 A;  4KX5 A;  5J0P A;  1N5X A;  3PSF A;  1B43 A;  1SIJ A;  4TUP A;  4DFM A;  5KFD A;  5KFJ A;  4DQS A;  4NLN A;  2PMZ F;  4C8O A;  2QLT A;  5J0U A;  1DK3 A;  1Z4O A;  4OD0 A;  1KFS A;  5AIA A;  3SMV A;  2JV3 A;  5KG2 A;  5J2E A;  2ASL A;  1L8O A;  2V9W A;  2RHF A;  3F53 A;  4AYB F;  3OJU A;  4KX3 A;  4KLL A;  4UAR A;  3V7L A;  4ED2 A;  1UA0 A;  3QUC A;  3V7K A;  2UVW A;  2Y9U A;  3H4D A;  3NVZ A;  4ELV A;  3LVV A;  4O3M A;  1RQL A;  3WKC A;  8ICR A;  2CXY A;  4NLZ A;  1CUK A;  4UAV A;  2WF5 A;  3F2C A;  2NV3 A;  5AI0 A;  8ICJ A;  1NI3 A;  1IIP A;  2BGW A;  1S0M A;  3D2N A;  2OWO A;  1ZYQ A;  5C0Y A;  2ASD A;  3K4G A;  3U26 A;  1L5U A;  4OJO A;  3QU7 A;  2BCV A;  5BOM A;  2QB1 A;  1T7P A;  2ZG6 A;  5KG6 A;  4NY8 A;  4I2E A;  4DOB A;  5J29 A;  3M9M B;  4DFP A;  3FC4 A;  2ZTD A;  3MR5 A;  2RLT A;  4I2A A;  2RQ5 A;  2R18 A;  1RZT A;  4F3O A;  1WWV A;  4NL9 A;  5KL1 B;  3JPT A;  2ZTE A;  4XQ8 A;  2W9B A;  3GIJ A;  4B9T A;  2E1E A;  4YCX A;  5AI6 A;  3L5K A;  4DF8 A;  4RT3 A;  2Y9T A;  2IA6 A;  4YXJ A;  2JRZ A;  5KFQ A;  5J0W A;  3EYZ A;  1UQV A;  3Q8Q B;  2KZZ A;  4YD1 A;  2LYB A;  2F8K A;  2F2A B;  4CDG A;  1ZXI A;  5DKW A;  1T94 A;  4Y2S A;  1KLN A;  1JXL A;  3ISD A;  2DUY A;  5L1K A;  1MSW D;  2QKQ A;  4R66 A;  3C2K A;  4DCC A;  4ED3 A;  2V4R A;  3N97 B;  2K89 A;  7ICU A;  2LYA A;  3KZX A;  4PHP A;  4QWB A;  3AU2 A;  4ECW A;  1Q8K A;  4YR3 A;  4RQM A;  2F3N A;  4JV0 A;  3TAD A;  3O0F A;  2IHM A;  1SV0 A;  8ICZ A;  4PZO A;  2JXJ A;  3AEV A;  4NJ8 A;  3Q8S B;  4PL2 A;  5KFL A;  1WCN A;  2VA3 A;  4EBE A;  3PML A;  2EH9 A;  1ZQS A;  3PV8 A;  4DLE A;  3QE9 Y;  1V9P A;  3LWL A;  2NYV A;  1BPX A;  3K1Z A;  2MUT B;  5AM2 A;  4DF4 A;  3M7D A;  3PW2 A;  2H3Z A;  5GTI U;  2J6S A;  4Y2J A;  2KMD A;  5ALF A;  3C28 A;  5HP4 A;  4R64 A;  1QSL A;  4EX7 A;  3AQE A;  4O3S A;  2JH7 A;  5ALD A;  4KLO A;  4IQT A;  4RQ4 A;  1KTQ A;  2H5X A;  4DL4 A;  1NJY A;  2PKE A;  1F5S A;  3GIM A;  2H3V A;  1J97 A;  3RAX A;  3MR2 A;  9ICB A;  7ICO A;  5ALU A;  4F5Q A;  3KOO A;  1RG6 A;  3GV7 B;  4YG2 A;  1ZQP A;  5CA7 A;  3L4P A;  4DL7 A;  2KZM A;  1Q46 A;  5G5H A;  4UAS A;  2BPF A;  4Z6E A;  3EPI A;  3T3F A;  2A1A A;  4ED0 A;  2HOF A;  2W04 A;  4I2B A;  2DGZ A;  2KG5 A;  4J9O A;  3BQ0 A;  2ZIW A;  3F2D A;  4P0Q B;  1VLB A;  2KEY A;  3IV6 A;  2KKP A;  2ZIX A;  4M9L A;  2HBJ A;  9ICW A;  2JZB A;  3PX6 A;  4KLU A;  2HI0 A;  2Y0S F;  2GO7 A;  3NGD A;  4USA A;  3QYP A;  4EZ6 A;  4F4W A;  4DSF A;  3DDH A;  2LKY A;  1ZQU A;  4FZM A;  4KLS A;  5ALZ A;  5J2C A;  2ESE A;  1DGS A;  2WFA A;  5AI4 A;  2EQY A;  5KG5 A;  5ALP A;  3TAP A;  3WK9 A;  3JPS A;  4M0A A;  2W9B B;  2XY5 A;  4F4Y A;  2AJQ A;  1PK1 A;  1ZQQ A;  4GIB A;  4XA5 A;  2R8K A;  4RQ3 A;  1ZD4 A;  1ZQN A;  3SAH A;  2W54 A;  4F5N A;  2DL0 A;  2YMM A;  4OO1 J;  3HT3 A;  1FFU A;  5DB6 A;  1ZQF A;  2KNJ A;  4DL3 A;  2AGO A;  3SAF A;  4UB8 U;  4PHA A;  8ICC A;  5HHI A;  5CRX A;  3WK8 A;  5CP2 A;  4DO9 A;  4O3P A;  3UXP A;  4DEZ A;  5G5G A;  5AM0 A;  1A6S A;  3SQI A;  3BQ1 A;  5KAI U;  1XS9 D;  3RBD A;  1SZH A;  1Z1V A;  1ZQY A;  3C2L A;  4E0D A;  4M9G A;  5DDY A;  2JMG A;  1J2M A;  1T3Q A;  4F4Z A;  1WG8 A;  3PZP A;  2BQR A;  7ICN A;  1QQ7 A;  5J2F A;  3AN1 A;  1TV9 A;  5KNI A;  4IRK A;  2WAQ C;  3BQT A;  4Y2P A;  5AKZ A;  2HHU A;  2XIC A;  3NVW A;  2K8B B;  5ALH A;  2K8C B;  4I2F A;  5IIM A;  2F8L A;  2K4E A;  3C29 A;  4I2D A;  3TAD C;  1SV0 C;  1URJ A;  2D6F C;  5K4L A;  2JH1 A;  9ICU A;  4LZG A;  3Q8K A;  4J9N A;  1JAL A;  2WHE A;  5IIL A;  1IV8 A;  3BDP A;  5TIS U;  1NK0 A;  8ICV A;  5AHX A;  3RJG A;  1GO3 F;  4R8U A;  1B0X A;  2XY6 A;  5DGB A;  1UCV A;  3ZDB A;  4C7Y A;  4DL5 A;  1CI4 A;  2V4Q A;  4YR2 A;  2XVT A;  1X9S A;  1WYG A;  4YMM A;  4KLT A;  4KMO B;  2XID A;  2GLE A;  3T5H A;  2KSO A;  1S10 A;  3DEE A;  2FLP A;  5AIC A;  5A0L A;  4AP9 A;  4QZA A;  4RQ0 A;  5ALI A;  4KTQ A;  3QU9 A;  1L7M A;  3QU5 A;  4NLG A;  2XGQ A;  2PI5 A;  2HMX A;  2XCA A;  3RJF A;  4CE6 A;  1NZP A;  2KE7 A;  2KHQ A;  3M6K A;  8ICY A;  1N63 A;  3ICX A;  4KMU A;  1LV5 A;  1RM6 C;  3RFA A;  5EOZ A;  3D2Q A;  1SL1 A;  1N2X A;  4DFD A;  1VJ5 A;  2E5S A;  4JV2 A;  4F50 A;  3DV9 A;  5ALN A;  2R8H A;  4UW9 A;  4UB4 A;  4JV1 A;  4Q8E A;  2HHV A;  4TQS A;  5KG7 A;  2BHN A;  4DOA A;  4BWJ A;  4FE3 A;  5KFZ A;  2JGA A;  1ZQH A;  3PO4 A;  2CN1 A;  3K1R B;  2NRX A;  4B9M A;  2ZXI A;  3QZ8 A;  3EWA A;  1ZOL A;  2OEH A;  4C8L A;  4JUZ A;  2EDU A;  4DSI A;  1JX4 A;  4MHV A;  2P6U A;  1RYS A;  3BS5 B;  2ZXH A;  1S97 A;  4KLI A;  3IDW A;  1L7N A;  3RH6 A;  3SZ2 A;  5KFS A;  3V6K A;  3KKA A;  3RJI A;  5F3X B;  5J2I A;  1DGJ A;  2HDO A;  5KFY A;  3QEA Z;  5L1L A;  3AUO A;  1UT5 A;  2RRD A;  3B0Y A;  3JPP A;  3H8S A;  4YN4 A;  4BX9 C;  1NZB A;  2BQU A;  4NLB A;  4F93 B;  2RDI A;  4QZC A;  1QTM A;  3D6J A;  3QUB A;  3PO5 A;  2YN4 A;  2KIC A;  3HP6 A;  4YXM A;  5KT3 A;  4DFJ A;  2IOF K;  4EZ9 A;  5AI8 A;  1XSL A;  2PFP A;  4ED7 A;  8ICG A;  4EEY A;  8ICL A;  3TAC B;  2M9N A;  2F1I A;  2HOQ A;  4BGD A;  4ECQ A;  2XC9 A;  1MQ2 A;  1SL0 A;  1QH9 A;  4NV0 A;  4F72 A;  5DB8 A;  4F91 B;  2A19 A;  5L1M A;  3OHB A;  2HHT A;  5CR0 A;  3T5L A;  1JI7 A;  1JMS A;  2FPM A;  1MC8 A;  1S0O A;  3MAB A;  2ZJA A;  4BXO B;  3PSI A;  2E3T A;  4CF5 A;  5E79 U;  5ALV A;  4BJQ A;  4C4S A;  5KFE A;  3TAQ A;  4DQR A;  1Z19 A;  5DB9 A;  2K8A A;  1KSP A;  2ISO A;  2FLL A;  1OW5 A;  2ZTC A;  2R8I A;  2W9M A;  7ICL A;  5KTQ A;  5EE0 A;  3MDA A;  2DKX A;  3I1Y A;  2NRZ A;  2D8C A;  9ICQ A;  4RPX A;  2HBK A;  5KFT A;  1QLN A;  2E8P A;  3PW5 A;  3GU3 A;  2RDJ A;  5J2K A;  1A76 A;  1XWL A;  1RDF A;  5KT6 A;  4J9Q A;  1ARO P;  4ECT A;  2MUT A;  3QUT A;  1ZQR A;  3ZDC A;  2OM6 A;  8ICS A;  2KN7 A;  4J9M A;  2B6G A;  1ZQK A;  4MFF A;  1ZQI A;  3H40 A;  5DBA A;  1Z1B A;  4FBU A;  4QWA A;  3RR8 A;  1V38 A;  4RT2 A;  4QIW C;  3PW4 A;  3QUQ A;  1ZQV A;  4LZD A;  1L3V A;  4M2Y A;  4DQQ A;  4MFC A;  2ZUD A;  8ICK A;  4KLJ A;  4RPZ A;  4I27 A;  2G5I B;  4PGY A;  1DK2 A;  2JR5 A;  3KHH A;  1UHU A;  2H3F A;  9ICM A;  2PFN A;  3RAQ A;  3FYH A;  2ZJ8 A;  4EBC A;  4P0Q A;  5HR6 A;  2H3Q A;  3PVX A;  4PJ0 U;  4DS5 A;  3T5J A;  2BCU A;  4UAU A;  4C8K A;  5J2A A;  2KFN A;  4DWI A;  4CF3 A;  1ZET A;  1F0M A;  3KKA C;  1ZRN A;  1U49 A;  5HNK A;  4QZ9 A;  1X40 A;  5JTI A;  5J2B A;  1S0N A;  1RYU A;  3PNC A;  5L1J A;  1DXS A;  5EE3 A;  5JUM A;  4K4I A;  2P66 A;  4ECV A;  1MA7 A;  1RPL A;  3MFI A;  1WWU A;  4DSK A;  9ICJ A;  1PVP A;  2KTQ A;  7ICQ A;  4U7C A;  1ZQX A;  1KFD A;  5H2F U;  3OPX A;  2AGQ A;  2IHN A;  7ICI A;  1NKE A;  4QJF B;  3RJK A;  4PHE A;  4P4M A;  4KLQ A;  2BQ3 A;  1NK6 A;  3IM1 A;  4KLE A;  3MGH A;  3C5F A;  3GIK A;  2QB0 B;  1BPY A;  4ECX A;  2M0N A;  3CRX A;  4I2H A;  2W7O A;  2G08 A;  9ICA A;  5ALQ A;  1FEZ A;  2YB1 A;  2K4P A;  3UXO A;  4JMU A;  3A0H U;  4BDP A;  1ZQE A;  2GOL A;  1NKC A;  5JRT A;  3M9O B;  1ZQC A;  5J0T A;  3PST A;  1HUZ A;  4KN4 A;  3EUB 2;  5ALE A;  2BCQ A;  1SKR A;  1X66 A;  4ED8 A;  4CGZ A;  3B9J A;  4RQ5 A;  3J81 j;  3MBY A;  3H8M A;  4O3Q A;  3SAG A;  2MU2 A;  1ZQG A;  5BPC A;  2MAX A;  4RQ1 A;  3IRU A;  1V85 A;  2FMS A;  8ICI A;  5ALT A;  4LJX A;  5J2G A;  4M9N A;  5DQI A;  3H0M B;  3GIL A;  3OTQ A;  4DOC A;  1BPZ A;  5KFA A;  3RR7 A;  2ZIU B;  4OJ5 A;  7ICE A;  5KT5 A;  3SYZ A;  4RQN A;  5KFK A;  1C7Y A;  1PK3 A;  3UMC A;  5AKG A;  1NKB A;  5J2H A;  1NNL A;  4GFJ A;  5AKI A;  3MC1 A;  4HYK A;  4FS2 A;  1RXW A;  4P4O A;  4F5P A;  2KJ9 A;  5KT2 A;  2J6T A;  1FFV A;  3LYS A;  2KHV A;  4CF4 A;  1AQ6 A;  2IMW P;  3QX7 A;  2JEG A;  1KEJ A;  4O0I A;  9ICT A;  4YD2 A;  1SB3 C;  4KIT B;  1QSS A;  3UMG A;  2ZIV B;  4TQR A;  5D46 A;  5J0Y A;  5CWR A;  2K4H A;  5GTH U;  4UB3 A;  3ISB A;  1RXV A;  4YQW A;  1LVH A;  3I28 A;  3RB6 A;  9ICC A;  1SWW A;  3BZC A;  5CJ7 A;  2BCS A;  3MGV A;  5J0Q A;  1B22 A;  4IRD A;  1S0V A;  5AK6 A;  2GWS A;  9ICP A;  2E8N A;  5KFN A;  3FM9 A;  3HRD D;  7ICJ A;  5JU5 A;  4EYH B;  9ICX A;  3OJS A;  4OJL A;  3E58 A;  1ZQL A;  2ES6 A;  3TFR A;  4EBD A;  1D9F A;  3V6H A;  5III A;  1SKS A;  3M6Z A;  2AQ4 A;  3MGI A;  3RTV A;  4BUG A;  3E0F A;  4ED6 A;  1JXE A;  4RNO A;  3WKE A;  5D49 A;  3ISC A;  2I9G A;  1BVS A;  1SXE A;  3WK7 A;  2FMQ A;  2ZUC A;  2WB1 C;  4J9K A;  2DWQ A;  2W55 A;  4PZN A;  2HHW A;  4GC7 A;  2G06 A;  4WJ3 B;  2EAN A;  2KVS A;  1SGG A;  4YFK A;  3ALR A;  4PPX A;  9ICV A;  2G5H B;  4P0P B;  1PZN A;  1DOQ A;  1QCK A;  5AKX A;  1N60 A;  3IN5 A;  4B9S A;  3NAS A;  3BS5 A;  2LBO A;  4K4H A;  1KFT A;  1S8O A;  1PVR A;  1YZ7 A;  2W43 A;  5ALY A;  1A0P A;  3PSP A;  3M8S A;  2ALZ A;  4RUC A;  2JEF A;  2UVR A;  4UAZ A;  5J2D A;  1NK7 A;  3KBB A;  5AK4 A;  1OUQ A;  4JB3 A;  2XO7 A;  2KD1 A;  4RQ6 A;  4IQV A;  2YQE A;  4QZ8 A;  3AL0 B;  3F2B A;  1JN3 A;  1B4F A;  4CRX A;  2CPR A;  3SEI A;  2AGP A;  2XY7 A; 
#chains in the Genus database with same CATH homology
 4NL9 C;  2E8O A;  2E8P A;  1COK A;  1B0X A;  3KKA A;  1UCV A;  2ESE A;  2Y9U A;  5F3X B;  3HIL A;  2YTU A;  2QB0 B;  4RQM A;  2FE9 A;  2F3N A;  2E8N A;  2EAP A;  1PK1 A;  5JU5 A;  1LKY A;  3TAD A;  1SV0 A;  2QAR A;  4PZO A;  1KW4 A;  2K4P A;  3SEN A;  2ES6 A;  2GLE A;  2B6G A;  2KSO A;  4NJ8 A;  3BS7 A;  2DL0 A;  5J8Y C;  1V38 A;  5JRT A;  2F44 A;  2L5Y A;  2D3D A;  2QB1 A;  1SXE A;  1X66 A;  2KE7 A;  1PK1 B;  4PZN A;  2QAR B;  2KMD A;  3H8M A;  3TAC B;  2EAN A;  2KSO B;  1SGG A;  1V85 A;  1WWV A;  4NL9 A;  5J8Y A;  1OXJ A;  5L1M A;  1Z1V A;  1X9X A;  2KIV A;  1JI7 A;  1RG6 A;  2DKZ A;  4IS7 A;  2Y9T A;  3BS5 A;  1F0M A;  1LKY B;  3KKA C;  5KNI A;  1UQV A;  4RQN A;  1X40 A;  1PK3 A;  5JTI A;  3BQ7 A;  1DXS A;  2F8K A;  3K1R B;  2EAM A;  2KG5 A;  2LMR A;  1WWU A;  2QB0 A;  1OW5 A;  3TAD C;  2JV3 A;  1SV0 C;  1SXD A;  4MHV A;  1B4F A;  2LPE A;  2EAO A;  2K60 A;  2E8M A;  3BS5 B;  2DKX A;  2QKQ A;  3SEI A;  1SV4 A;  3IDW A;  2D8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...