1XWLA

Bacillus stearothermophilus (newly identified strain as yet unnamed) dna polymerase fragment
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a thermostable Bacillus DNA polymerase I large fragment at 2.1 A resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Dna replication
molecule keywords DNA POLYMERASE I
total genus 206
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1xwlA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1xwlA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xwlA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xwlA01
1RT1A 3LWLA 1DGSA 4CEBA 1RBRA 4M3WA 5L1KA 4O55A 3V9ZA 3HPOA 2A1RA 4TSXA 1C1AA 1G15A 4QAGA 1SL1A 4CJEA 1JXLA 3TAEA 1B22A 4NLKA 4RZRA 2BGWA 5J2MA 4TQRA 4BDYA 4M3UA 1ZQRA 3KLGA 3OY9A 3C6TA 1ZBLA 5CHGA 2D0AA 4MFBA 3TQ1A 1N56A 1ZQQA 2X78A 3JPOA 3IG1A 5J0PA 2IGIA 3K4GA 2YKNA 3PY8A 1RTJA 2X6SA 2ZJ8A 1VSJA 3NTUA 2XCAA 4F5RA 1NJYA 4QWCA 3AVFA 5BOLA 3MGHA 1WCLA 5J2KA 3Q8LA 4GW6A 3AA4A 4E89A 4M45A 2DFEA 8ICNA 5J0OA 5KFBA 4CERA 5J2AA 4KTQA 1RXVA 5KG4A 2G8IA 3UIQA 3LP3A 3CG7A 4DLGA 2PFPA 3K2PA 4XA5A 2BGGA 4CJUA 1T03A 3KHRA 1JIHA 4XUSA 1RYRA 1RBTA 1RILA 5IIKA 7ICLA 4Q45A 3GDXA 3AUOA 1XU4A 3K75D 4KHUA 5KG6A 4UAWA 4KN4A 1JLFA 2F1HA 2AGQA 1NJXA 4B9UA 1ZQVA 3HPGA 3T5LA 4YMNA 2OZMA 2FC0A 1L3VA 5KFWA 5CWRA 2JEGA 1JKHA 1B9DA 4NM2A 3MEDA 4IR9A 1JL1A 3NHGA 2UVRA 1NK0A 4M3RA 9ICNA 1BCMA 4KN7A 1YTAA 1XO1A 2HHVA 3RJEA 1WSHA 1XHXA 3WNGA 4BACA 8ICYA 4FK2A 2C2DA 3KKSA 1CLQA 4AHVA 4DOAA 1EXQA 3K5MA 4NXZA 1ZBFA 2ATQA 4RQ1A 5KFKA 1T7PA 4QZEA 3LAKA 4ZTJA 3C5FA 4CEFA 2FPLA 3HPHA 2WOMA 2XO7A 4OKEA 4E7KA 4PQUA 4O44A 4F8RA 4P2HA 1QE1A 3TAGA 1PZNA 4FLVA 3AV9A 1WAFA 1T4GA 1IKVA 2BCQA 1BI4A 4M3ZA 4YP3A 4M9LA 2YNGA 2IMWP 2ITGA 4PHPA 4LZGA 1RBUA 1S0MA 4FLYA 3RAQA 4PGQA 4KMUA 3V7LA 2JLEA 4CGDA 4E7LA 4DFKA 4NM1A 3ZT2A 1QSSA 5K14A 4B8CA 4OKKA 2HHTA 4KB0A 5KFGA 1T3NA 3DOLA 2AU0A 5KGWA 1T05A 3AO2A 2Z1JA 3VQQA 4C8MA 1MQ3A 1RT2A 5KRTA 3T3FA 4EYIB 2XY6A 2PFNA 5DLGA 5J2FA 3AVJA 5HRRA 3CFRA 4DL6A 5DGBA 1SL0A 2IHMA 3JPRA 4J9RA 2YKMA 4ECQA 4DEZA 5KRSA 3ULDA 4B9SA 2OZSA 3V1OA 4RNOA 2F1IA 2AQ0A 4ECRA 4DTXA 3PMNA 3OGUA 5EU7A 8ICOA 1VSDA 8ICBA 4NLNA 1ZQXA 2D0BA 1WCNA 3RJIA 2BDPA 2Z1GA 4HCCA 1W0HA 2HNDA 3ZSOA 3M8SA 1EXNA 2RDIA 4NLGA 5KFMA 4UBCA 5KFZA 3AVKA 3RB6A 3V81A 3GIIA 1U45A 3OYKA 4FJKA 3RJFA 4CFBA 3Q8SB 3AO4A 3TFRA 3HP6A 4FCYA 1K6YA 4IQTA 8ICFA 3QEBZ 3PMLA 4Z4CA 4M3XA 3OVNA 2JEIA 1NKEA 2A1JA 2BPGA 4ECZA 1QQCA 4RQ2A 4KKOA 7ICPA 1DOQA 1TGOA 5DB6A 1S76D 1NOMA 3NCIA 3BDPA 3L3VA 4E19A 3RMDA 1UAXA 9ICJA 5EOZA 3AVNA 4ID5A 5IIIA 9ICTA 3DLHA 4Q8EA 4BXOB 3UQ0A 2ZE2A 4LH5A 3ZDDA 3OYIA 5KG1A 2B5JA 2XRIA 4QZHA 4B9TA 1NK6A 4J9OA 4M3TA 5J0QA 1XSPA 1RBVA 9ICHA 3ZD8A 4RNNA 5DKWA 4I2PA 3KD1E 3HSTB 4AHCA 1D8LA 2VWKA 4JRQA 4KLGA 3QESA 5HBMA 3MECA 4DO9A 4BGDA 1QTMA 4YG2A 1X1PA 4FLXA 1SL2A 4Y1DA 4FJLA 1ZQTA 2C2RA 2P6UA 1VSKA 5CYMA 4RT3A 3ZSQA 1VSMA 4FZXC 4E3SA 7ICRA 1Z25A 3OS1A 5DB9A 3MR2A 8ICAA 4CIEA 1RT3A 4EBEA 5HNKA 4CK3A 5CA7A 4ECWA 2MUTA 3VQ6A 4NLZA 1YVUA 3UQ2A 4FJNA 3OSPA 2PFQA 5KFYA 4CEZA 2KFNA 4KREA 1JMSA 5KG0A 4EP5A 4GC6A 2OPQA 4YD2A 2BPFA 3QEXA 1HNIA 4NYFA 3LZJA 3SCXA 4I2HA 1XI1A 2RF2A 4Z0UA 1C6VA 4RPYA 8ICXA 1LWFA 1U4BA 2JGUA 4LD0A 3SI6A 2KN7A 5J0XA 4RW6A 3VQ4A 5DB7A 2J6TA 2HHWA 1ZQIA 5J2CA 3U3GA 1NK9A 5D46A 1VSLA 4ED7A 4O5KA 3UPQA 3IM1A 5DG7A 3DM2A 4UB4A 3OYJA 3V1QA 3CM6A 3VQAA 3HJFA 4QZ8A 4CEAA 5IINA 2LYHA 1D9FA 5L1LA 1B43A 3O4NA 4E7JA 1TK5A 1NK7A 4N41A 3C5GA 4FW1A 4FLZA 3SJJA 2RDJA 1C1BA 2P1JA 3QIOA 1KEJA 4FYDA 4FJXA 5D49A 3OSNA 4O3QA 2V4RA 4M04A 4IDKA 1S0OA 2R8GA 2JEJA 8ICQA 3DLRA 5F9LA 3A2FA 2FBXA 3P5JA 1CEZA 1RTHA 4RUCA 1X9SA 2VG7A 4CHOA 5KFJA 4R5PA 5KFVA 4YNQA 3EW9A 4B9MA 4DOCA 1FXXA 3AA5X 4CJVA 3ZSRA 5CYQA 4CCHA 3NBPA 2UVUA 2G8UA 4FLWA 1S6QA 3TWHA 3MXMA 4ID1A 3TR8A 2O4GA 2KQ2A 1RXWA 3VQ5A 4FM2A 3VA3A 4IG0A 1S77D 4O3SA 1QHTA 4OPJA 3LAMA 3PVXA 1TVRA 2RPIA 5KFRA 1JXBA 4JLHA 2HHSA 1VRUA 1XSLA 3MGIA 4FK0A 3ZT3A 5SZTA 1RCHA 1U9LA 4KTZA 5EWFA 4MFAA 2OA8A 4EP4A 3L2VA 3M8QA 1NOZA 5KI6A 4I2IA 1K1QA 3OYLA 5HRPA 5KFOA 3UXOA 1ZETA 2W8KA 3S3OA 2Q0ZX 3PX0A 3ZDCA 3AVMA 2W9CB 4KI6A 4YCXA 5KT6A 4K8ZA 4CJRA 1FK9A 1J53A 3C1YA 4F4KA 1Y97A 2PFOA 1LWEA 3GV5B 4YFUA 4QW8A 4AHRA 5I42A 2AQ4A 7ICTA 4JWMA 3Q8RB 5HMLA 3AVCA 5J2BA 3CM5A 4KLEA 1MQ2A 3BQ2A 9ICUA 1KLNA 3AVAA 3FFIA 1ZBIA 4MEXA 5DBBA 1NOYA 4M9JA 3VQ9A 4J9SA 4DF4A 1C0MA 3Q8KA 3ZSWA 3C1ZA 5IILA 3ALYA 8ICRA 4RU9A 4IQVA 3L8BA 4YXJA 2PXIA 1WSJA 5CJ7A 4ELVA 2HHXA 5KFSA 1BPBA 1L5UA 4CFAA 9ICPA 4FJJA 1MC8A 5J2DA 2C2EA 3QO9A 5J2IA 4P4MA 2YNFA 5DQGA 3NFAA 4I27A 3VQCA 4Q44A 4MFCA 4CJ5A 4HVJA 3O3HA 2HW3A 4ECVA 4QZCA 3C21A 4MF8A 2Z1IA 5CP2A 9ICSA 5EWEA 3G6XA 1GOBA 2W8LA 4IQUA 2XC9A 3QETA 3SQ2A 1COOA 4KPYA 1UT8A 1ASWA 1UA0A 4UBBA 4Z6EA 4O3OA 5D4BA 1U47A 2GUIA 2PI4A 1U04A 4BE2A 4K4IA 1RNHA 4ZH4A 1WN7A 3B0YA 1J5OA 1TFRA 4DU3A 2PYLA 4R63A 2B6AA 5J0WA 3O4QA 3SUPA 1TAQA 5EWGA 2KZ3A 3HM9A 1BI4B 3KLIA 3MXIA 5JS2A 3UXPA 7ICMA 3MFHA 2ASLA 2R8KA 1ASVA 1JXEA 1TAUA 1BQNA 4BWJA 4I2CA 3K57A 4B3OA 4YD1A 1LWCA 1BPDA 4QZBA 3KLFA 2DFLA 2G8VA 1BPEA 1VSEA 4PGXA 3NF7A 3JPTA 1WSFA 1RT6A 2D5RA 4CEQA 2OYQA 1ZQNA 3PX6A 4J9PA 1VSIA 1HMVA 2H5XA 1XWLA 2JEFA 4B9NA 1JLQA 4QWDA 4L8RB 3DLKA 4F5NA 4ELUA 4KLDA 5KT5A 1D5AA 1RDCA 4BE1A 3IHQB 3JPQA 1V9PA 1WLJA 2A1SA 4CF0A 4CEDA 2V4QA 1RTDA 4GC7A 3T19A 1S97A 5DK5A 4OLAA 4DSEA 3QIPA 1S0NA 1NJZA 3E01A 2X74A 4DU4A 2BCUA 4FM0A 4GLXA 4JWNA 4NYNA 2B21A 3HT3A 2ZTCA 4PGYA 3PO4A 9ICIA 5F9NA 4J9LA 1TV6A 2XHBA 5J2JA 4EBCA 1IO2A 5L1IA 4R64A 1KDHA 3IS9A 4J2BA 5J2QA 2KZMA 3TARA 1H38A 5L9XA 4KLSA 3C2LA 2IC3A 2W9AA 2VWJA 1IM4A 3RH4A 4EEYA 4E7HA 5J0RA 3K59A 3SQ1A 1L3SA 1ZJMA 2B4JA 4KLUA 2R7YA 3G6YA 2NUBA 4K4HA 3AVIA 3LZIA 3RWUA 4DTOA 4FLUA 3GFKB 5HRSA 3MBYA 8ICPA 4LVSA 2FMPA 2NRZA 4Z6CA 4F4XA 3UXNA 4JV0A 5C42A 1RDBA 3LP0A 3RH5A 4CGGA 1JL2A 4FJGA 4JUZA 7ICUA 3MR3A 5J0TA 2W9CA 3KIOA 4CJQA 3EY1A 4R66A 4ZTFA 2FMQA 4EZ6A 4DS5A 1BHLA 4O0IA 2ISOA 1N48A 4DG1A 2VA2A 4M9GA 4DL7A 5KFNA 4DTSA 5JS1A 5FDLA 4FK4A 4YR2A 5J2PA 1TVAA 4WE1A 5DG8A 1SUQA 3BGRA 1HPZA 4I28A 4QW9A 4ECSA 3SZ2A 3H8SA 1BIUA 4I2DA 4DL3A 1RT4A 5KFEA 2ZQBA 1ZQFA 2OPPA 2JZBA 1A5WA 4KITB 3T5KA 1D9DA 3WNEA 3TI0A 2HMIA 3VN5A 5IIJA 4CFDA 1KLMA 4BE0A 4I9QA 1ASUA 3V4IA 5KG2A 1HYZA 4YN4A 5DB8A 2DPJA 3SQ4A 4UAZA 1X2IA 7ICGA 1RT7A 4FS1A 3AU2A 2MAXA 2VG5A 3AVGA 4ICLA 5CZ2A 4FJ8A 3LALA 2HNZA 3C2KA 1NKBA 3SPYA 1BPXA 4RQ7A 5DGAA 1ZQZA 5KFLA 2R8HA 4F2SA 4AHUA 1WNSA 3ASMA 4LZDA 3AU6A 1QS4A 4CJ4A 4QZIA 4RPZA 4IRDA 1HYVA 4KO0A 4NCAA 1ZQKA 1ZQEA 3NE6A 1TKDA 1ITGA 5HP1A 3DRRA 3PUFA 5HHIA 4B8AB 2P5OA 4DTUA 4F4WA 3CFPA 8ICCA 4MFFA 8ICVA 2OPSA 3SV4A 1CZBA 3V9WA 3RJGA 3BJYA 4DL5A 3ZDBA 3C94A 3N4MB 4YXMA 8ICIA 3OYEA 4ECXA 4CIGA 4CHNA 5DDMA 2DFFA 3KLHA 5DG9A 1SZPA 5IIMA 2FLNA 5DQHA 3GILA 1HYSA 3H7IA 1EETA 3RB4A 2IS3A 4J9MA 4NY8A 4J2DA 1B9FA 9ICWA 3PW0A 5T7BA 3TAPA 3OYHA 2C28A 4F4ZA 7ICVA 3KD5E 2FBTA 1QSLA 3ISDA 4JS4A 1WSGA 3NAEA 7ICHA 3JPPA 3F9KA 1S9FA 1BCOA 3V6DA 4DSJA 3NH1A 3HX0A 5J0UA 4DFPA 5BPCA 3E2EA 3DYAA 5C24A 4QOZB 2FMSA 3O3FA 3JSMA 3LPUA 2RKIA 1JLGA 2AGOA 4FJ5A 4Z4FA 1ZQCA 4DL2A 2E6LA 5SWMA 3DLBA 4I2JA 1A5XA 5HLFA 1Z00A 2IAJA 3ISBA 2KFZA 4AHSA 1VK0A 3SUQA 4GXKA 2I9GA 1L3TA 3QERA 3TAFA 3V1RA 3M9NB 3PV8A 3OYBA 3SPZA 4M42A 1RZTA 2HB5A 2KW4A 1UT5A 9ICGA 1JLBA 2PYJA 1YT3A 2BANA 3HVTA 1ZQLA 4J2EA 2IBKA 2R8JA 2ZUBA 4QWAA 3RJKA 5CB1A 4RNMA 2DFHA 7ICEA 4PHAA 9ICAA 4JV2A 1RTIA 3NGIA 5HRNA 5KG5A 3IRXA 4HHTA 1WAJA 2Z1HA 4KFBA 1U48A 3HWTA 1Y88A 1IKWA 2BHNA 1I39A 4CJTA 5J29A 1BISA 3OYFA 3V9UA 3SUNA 4F3TA 1BPYA 4NCGA 1W9HA 4OVLA 2G8WA 4DSKA 1DTQA 1F21A 1S1XA 3GV8B 5KT3A 3BQ1A 5DMRA 8ICGA 4Z4GA 2YHBA 2IDOA 1EKEA 4F2RA 1T8EA 3SI8A 2UVWA 2XGPA 3RB0A 2QKKA 2G8HA 1DLOA 2PI5A 1RT5A 3DI6A 1HNVA 1ZBHA 1A5VA 4DFJA 5KFPA 4Z4IA 4C8KA 3MEGA 4IRCA 2FBVA 4PY5A 4RQ8A 2BR0A 1BPZA 4JV1A 2P51A 8ICKA 4FLTA 4RQ4A 4CJFA 1X9MA 1S1WA 1FKPA 4DSIA 3RJHA 1BVSA 4FVMA 3RBEA 4RW8A 5KFFA 1ZQSA 4Q43A 4KTWA 4IG3A 1S0VA 3DMJA 3C6UA 3MABA 4DMNA 3LDAA 3RMBA 2EX3A 4RW9A 4YQWA 4FO6A 8ICJA 3D45A 3NGZA 3EPGA 1XHZA 4K4GA 3QNOA 1A77A 4OGEA 3OJSA 2X6NA 1KVBA 3RR8A 3AVLA 2P5GA 5KT2A 1HUZA 3QEPA 4DQSA 4ELTA 1S6PA 4CK1A 1ZQJA 1CZ9A 4I2AA 4GVMA 4DL4A 4E1NA 2IOCA 2I5JA 1KFSA 1NJWA 5KG7A 4F5OA 2ASJA 4I29A 2XY7A 5DBCA 4R65A 3WNHA 1S1TA 3HYFA 4IQWA 3PX4A 2MUTB 4ZHRA 1RDAA 4O0JA 3AA2A 4UAYA 3Q8PB 3LP1A 2XGQA 3QE9Y 2HVHA 3PW7A 3PNCA 3FDSA 4HTUA 3OYCA 3QNNA 2P66A 2BPCA 1BQMA 3ZDEA 3T5JA 1HQUA 3EZ5A 3EYZA 2GWSA 4DTJA 4CECA 3M8PA 1KTQA 3V7KA 4C8LA 3B6PA 5TZVA 3ISNC 3OYDA 1HQEA 1N5YA 4ED0A 8ICZA 2YNHA 4F5QA 3HVRA 3VQDA 4XIUA 3I8DA 4P4OA 1IXRA 5HHHA 4Q8FA 3ZDAA 2FLPA 3PW4A 1XC9A 4AH9A 1ZQGA 3VQEA 4YFKA 5KFHA 5KG3A 1EP4A 2Y1JA 3GV7B 2VA3A 4MF2A 4QZ9A 1ZBUA 1VSHA 1S9GA 3RB3A 4BWMA 3DRPA 3ZD9A 4FM1A 4BDPA 5DBAA 4AHTA 2ZD1A 2G8KA 3TANA 4KI4A 4ECTA 2FBYA 2BCRA 8ICWA 1SV5A 4N47A 1IH7A 3KHLA 1TK0A 2ZJ5A 4DOBA 4KHWA 3SYZA 4FJ9A 3QINA 4W5NA 3N97B 3H4DA 1CXUA 4PWDA 2KTQA 1ZQUA 4CIFA 3ZT0A 2PY5A 4Z6DA 5HMMA 4I2QA 5KTQA 4RG8A 4CJWA 4Y1CA 4DS4A 5KFIA 3C95A 3CQ8A 4O3RA 5J1EA 3L2WA 1C0TA 4GXJA 1J9AA 4ED6A 3TFSA 4UB1A 1GOCA 4TUSA 4J9QA 1BL3A 3KJVA 4I2GA 3PR5B 3DOKA 5IIOA 1SKWA 2BQRA 4KHQA 4YR3A 2FPKA 3MXJA 3NF6A 8ICLA 1TV9A 3V9XA 4N5SA 4DQRA 4QZDA 4KLIA 4Q0BA 1ZQWA 2WONA 5HP4A 7ICKA 5KT7A 3V6JA 4E1MA 4PH5A 4QZAA 2ZTDA 2ATLA 1ZYQA 3VQBA 4NCBA 1Q9XA 1ZQAA 2E4LA 1RPLA 4F93B 3V6KA 1UA1A 4ED8A 2NRWA 3G0ZA 4HUEA 3NH2A 4I2EA 4HUGA 1HJPA 4UB2A 3SQ0A 4DSFA 3HL8A 3SNNA 1BGXT 5I3UA 3ITHA 4RPXA 3RRGA 2F8SA 4X5VA 2LSNA 7ICJA 4EBDA 3KKRA 1RBSA 2BKEA 9ICRA 1NK8A 2C22A 4DLEA 3U3YA 2DTUA 5E41A 4W5QA 3T1AA 4HCBA 1ZQYA 1S1UA 1ZJNA 2ASDA 4FJIA 1LAVA 4P4PA 2NRVA 3FYHA 3LP2A 2QXFA 3DLEA 1R0AA 5J2GA 3C2MA 3GIMA 3HK2A 2YNIA 3QZ7A 4QZGA 1SKSA 3Q8QB 4BXOA 2KZZA 3NGYA 4B9LA 4R8UA 3RBDA 2IA6A 2BCVA 4EYHB 3DRSA 4DWIA 3IAYA 3TABA 4M6WA 3GIKA 4CHYA 4KLQA 4QWBA 1S10A 4O9MA 3D0PA 1NKCA 4B9VA 4CK2A 5DDYA 3THVA 4LY7A 1S9EA 4M2YA 4KB1A 1C7YA 1X9WA 1VRTA 4TUQA 1RYSA 2GV9A 1KSPA 3ISCA 2EHGA 2ZTEA 3EPIA 3ZSYA 4M41A 3GIJA 4ECYA 1LW0A 4RQ0A 5KFXA 4YR0A 2M9NA 1ZQHA 4G1QA 2DPIA 1TKXA 2ZUDA 3PW5A 4ED2A 3MEEA 3RR7A 3V9SA 1K1SA 5J2HA 2WTFA 3OS2A 3AO5A 4F5PA 5J0YA 4EZ9A 4TURA 4RQ5A 4RQ3A 3HXMA 4KLJA 2R8IA 1S1VA 4KHNA 3K5LA 1XS9D 2P6RA 1Q9YA 3OHAA 9ICVA 1WSIA 1TL1A 1XSNA 3O3GA 2BE2A 2PZSA 2NRXA 4ED3A 4OKJA 4E0DA 1MU2A 4KV8A 3ZSZA 2E6MA 1Z00B 4W5RA 4O4GA 4YMMA 3MDCA 3KK2A 3LPTA 7ICFA 5KT4A 3HP9A 5FRNA 2W42A 4IBNA 3L2QA 2XY8A 3I0RA 2OWOA 3RMCA 3L3UA 4W5TA 3JPSA 3ZSVA 3KTQA 4BDZA 4F92B 1HUOA 3ETLA 2ZUCA 1EX4A 1Q8IA 3U6FA 2O4IA 1J54A 2D0CA 1JLAA 2F8TA 5J0SA 4I7FA 4Q5VA 2VA8A 3RAXA 7ICIA 3MAQA 4RQ6A 4B08A 1N6QA 3S9HA 4CHQA 4PUOA 3V6HA 4KRFA 1CXQA 3H4BA 2F1JA 1JN3A 2ISPA 2DY4A 1YTUA 4OGCA 5CY4A 5D3GA 3C23A 1LW2A 2YHAA 4JK1A 4M3YA 4QWEA 2ALZA 4TUPA 1QLNA 2AGPA 4H8KA 4AILC 5KFDA 4C8NA 3NGDA 1LAWA 3M8RA 4H4OA 2F96A 3NF9A 4DF8A 1CUKA 5FRMA 5KFTA 5DLFA 4CGFA 8ICMA 4PA1A 4IR1A 4M0AA 1TK8A 3QLHA 3LANA 1HJRA 4M47A 8ICSA 4DFMA 4G3IA 4YMOA 1JLEA 4CJLA 1ZQDA 3OHBA 4KLLA 3ZT4A 3V7JA 4I2FA 4W5OA 4PPXA 1TKZA 4CJKA 1VSFA 4DSLA 1KRPA 3QEVA 4UB3A 4DQIA 3DLGA 2RN2A 3VA0A 4FBUA 1S5JA 4CEOA 4I9LA 3H40A 3Q8MA 5L1JA 1I3AA 7ICOA 4QCLA 3ORYA 4KLHA 3MFIA 1NK5A 2QK9A 9ICMA 2JZBB 3RRHA 1O1WA 9ICEA 3KHGA 3G10A 4FXDA 3M9MB 5KFAA 3AA3A 1LV5A 4YVZA 1IKXA 9ICCA 2W9BB 5C25A 1Z3EB 4CGHA 4IKFA 4KLOA 3H8WA 1KVCA 4UQGA 4FS2A 1FKOA 4DU1A 2BQUA 3QEWA 4Z6FA 2AJQA 4K8XA 3ZSXA 3LWMA 3KHHA 2ETJA 3KLEA 1KVAA 3OJUA 2W9MA 3RH6A 1DTTA 4CHPA 3QEIA 4DTNA 3RTVA 4PHEA 4CJPA 3KK1A 7ICSA 2Y1IA 3HO1A 4CF9A 4HUFA 1C0UA 5KFQA 3OS0A 4IRKA 4OJRA 3PR4A 5DQIA 4LH4A 4KAZA 1KFDA 4FW2A 2BQ3A 3MR6A 1L3UA 4F3OA 2OPRA 4ECUA 3I0SA 3T5HA 2J6UA 4DQPA 1BIZA 4H4MA 4TQSA 4C8OA 9ICFA 3LK9A 2IHNA 1JX4A 3PW2A 5J2EA 4O5CA 1HRHA 5FROA 4KHYA 3M9OB 1ZQBA 1C1CA 3K5NA 4F91B 1D8YA 1GOAA 4F50A 2FLLA 4CGIA 4M9NA 2VG6A 3PO5A 3B6OA 3F73A 4E7IA 4CF1A 4CJ3A 1KFTA 3SV3A 9ICOA 4DTPA 5KFUA 1QSYA 4DTMA 4KLMA 1UWBA 1TL3A 4CE9A 2XCPA 4IFVA 2I1QA 4XQ8A 1MSWD 4N56A 4CF2A 3HW8A 4KHSA 2BCSA 4RW4A 4M9HA 4FJHA 4J9NA 7ICNA 1LB2B 2HHQA 9ICXA 5BOMA 1ZQPA 3CFOA 4UB5A 4FZZA 3P83D 4DTRA 3H08A 3QEAZ 4RT2A 8ICHA 2XY5A 3CYMA 3JYTA 4QZFA 1JLCA 4LSLA 2A1JB 2HHUA 4M6WB 4ED1A 3L2RA 2V9WA 2QKBA 1KCFA 4R8UB 4LSNA 4O5BA 1IKYA 3RJJA 3KK3A 2VANA 3AO1A 3L2UA 4Z4EA 3K5OA 3S3MA 3AVHA 3OYMA 1B92A 8ICEA 4GMJB 3V72A 1RDDA 3P1GA 5CZ1A 3NH0A 3TAQA 3H8JA 3TAMA 8ICUA 2NRTA 1ZQMA 4RUAA 2FPMA 5KFCA 2YV0X 4FJMA 4MEYA 3MDAA 1Z26A 3AO3A 3OYAA 4J2AA 3K58A 4DQQA 4MQ3A 3BQ0A 4FJ7A 3S3NA 8ICTA 3LDSA 4O5EA 4F4YA 3NF8A 1UOCA 3BQTA 9ICQA 1REVA 4JS5A 3B0XA 2G8FA 5HROA 2HNYA 3VQ8A 3MR5A 2J6SA 1SKRA 4CEEA 5C5JA 4FZYA 3ZT1A 4O3NA 2HVIA 4OLBA 1ZQOA 3RMAA 7ICQA 3EWAA 2W9BA 3JPNA 3GQCA 1NK4A 3VQPA 2GBZA 4CESA 4CJSA 4N76A 5J2NA 2Q3SA 1TKTA 4J9KA 2ZJAA 9ICKA 3AVBA 9ICLA 4FBTA 3QZ8A 1A76A 3OYNA 4JRPA 1IG9A 4CFCA 3OYGA 4GXIA 4KLTA 4O3PA 5JUMA 4I2BA 4OPKA 4IFYA 1AROP 4CF8A 3G6VA 4Z4HA 9ICBA 4CHZA 5KGXA 2UVVA 5CR0A 4RW7A 3ZCMA 1U49A 4XRHA 3WNFA 4HYKA 4KLFA 1WSEA 3SUOA 3NDKA 4CGJA 3VQ7A 4PHDA
chains in the Genus database with same CATH superfamily
4PZVA 5CYQB 1RBRA 3W60A 5A6WA 1VQPS 5GAGP 3V9ZA 4TSXA 3OLAA 2VG5B 2XI3A 2ZJPL 4OFZA 1A0OB 6AT1B 1JXLA 3TAEA 2BGWA 3IR7B 4BDYA 1ZQRA 3KLGA 1ZBLA 1RQ0A 2D0AA 2CKWA 2ASPA 3TQ1A 2YMLA 1N56A 2AYEA 1ZQQA 4DX7A 2JH3A 1W26A 2RRAA 5C25B 2RD5C 4DR1J 1BNOA 2Q0RA 4IUFA 4X4PA 1DXSA 1GQEA 2ZJ8A 4WJ3B 4F5RA 1H7XA 4KRWA 3CCLS 1NJYA 3BUZB 1FKOB 2NZ4A 3QDKA 1WCLA 1V85A 2CQCA 2RMLA 4MFBB 2IY5B 4M45A 2HOFA 8ICNA 5J0OA 5AI0A 5J2AA 4EK2A 2MMYA 1RM6C 3LP3A 3CG7A 1U6ZA 4O3MA 3K2YA 3K2PA 1NMNA 2BGGA 5M2RA 1W2BM 1TZ0A 4CJUA 3MMCA 3KOOA 3PYEA 5DRKA 3KHRA 1RILA 5IIKA 1FCAA 1UL3A 1ZM9A 4WFNL 1VIXA 4UAWA 2EQYA 2HQIA 2F1HA 2AGQA 1IM6A 1NJXA 1ZQVA 3T5LA 2KG0A 3QGIA 3R3TA 2R2TA 4GV9A 5FP0A 3Q89A 1KVIA 1RCOB 5J8YC 1B9DA 4NM2A 4IR9A 2UVRA 1ZBTA 5ALRA 3W5XA 4B1WB 4KN7A 1XO1A 2HHVA 2BJDA 4EO6A 4BACA 4DJBA 4WCEQ 2NYHA 4XH4A 1WKKA 3KZIU 1NJIT 5AJ3K 2ATQA 2CQIA 4FYYB 2EFNA 5AQSA 5KFKA 1T7PA 4ETZA 2HMXA 2GVZB 2P9IA 2A6OA 2WOMA 4RW8B 1QE1A 3TAGA 4H5VA 4CLFA 3AV9A 1WAFA 3KD3A 1T4GA 1IKVA 3PRBA 2BCQA 3KLIB 4BG9A 4YP3A 4C98A 1S3XA 4DV2K 1HNIB 4LZGA 3QSYB 1RBUA 4FLYA 2PE8A 3CCRN 4PPZA 1Q86T 5HANA 2JLEA 2NXNA 3SR6A 3R1XA 2KKZA 3D2WA 1XC3A 1ULRA 4C7QA 4F67A 3I56N 2EXUA 4KB0A 3PSTA 5JLFA 1T3NA 3DOLA 1X5OA 1T05A 4B17A 3AO2A 2MKIA 4DUZK 3UDEA 4HHJA 2GQQA 4ANDA 3H2VE 4CW7B 5KRTA 4EYIB 3MECB 2PFNA 4YHHF 1S6PB 5DLGA 5HRRA 4DL6A 2P9PB 3JPRA 1H2UX 4J9RA 3AARA 2E1FA 1S1XB 1RT3B 4K0KF 4RNOA 2F1IA 3SDEB 4CGZA 1LEOA 3M05A 1RDWX 4USJC 3NEKA 3TWZA 1FNXH 1VSDA 1UEUA 2DO0A 1ZQXA 2ZXIA 2Z1GA 4ILJA 4DUYJ 1EB0A 1F9EB 2KMDA 3M8SA 1WD6A 2XMAA 2E1YA 5KFMA 3F53A 1IBLJ 4RQMA 2NXCA 4Y3CA 4USAA 3GJRB 2FSJA 3R5JB 3GIIA 1L7OA 2G2YA 4Y0FA 3RJFA 4ZVPB 2UXCF 2GX9A 3BPSP 3B4MA 1WF0A 4KR0B 2GEMA 3PMLA 3VOVA 4Z4CA 4NYPA 1TVRB 2BPGA 3QIPB 4ECZA 2QTDA 4U7CA 1ZPWX 2V69A 2OELA 4CZFA 1DOQA 3CEDA 2UXDJ 2AMCB 3LM9A 3O0FA 1ITPA 4CO5A 2LXIA 4ID5A 1UVNA 1XR5A 1LFWA 1N32J 2OM6A 3U1NA 4C9DA 4Q8EA 3ET6B 1NGAA 4LH5A 3OYIA 2B9YA 2B5JA 3EGZA 2FXUA 2J76E 4B9TA 1T05B 3NS5A 2WHOA 3IWNC 1XSPA 2FJWA 1DKGD 1OPZA 4RNNA 4HACB 2YH0A 3AM9A 5DKWA 3AOCA 1I51B 1D8LA 3W64A 4Y2PA 2VWKA 2KIWA 4DO9A 4BGDA 4FLXA 2YTCA 5AFUA 4FJLA 5GINA 4USWA 2MLXA 3SMVA 2EANA 4RT3A 3CXCR 1VSMA 4LF6J 1U25A 4E3SA 2OPSB 3U26A 1Z25A 5DB9A 3OS1A 3QT6A 2VC1A 1RT3A 1SBRA 2GNKA 4KGVB 4EBEA 4CK3A 2KD1A 3OTCA 3VQ6A 2JFKA 2AXTU 2GQCA 5CA5A 2VGMA 1PG5B 2BJ3A 1XUPO 3AJ1A 5KFYA 2AJ2A 2LQ5A 1XMBA 2UUCK 4GC6A 3C6AA 3NRBA 1APSA 4NXMK 3OTOK 2BPFA 1SH0A 5A8WB 4LMZA 4NYFA 3LZJA 4CZJA 3VAMA 3VEVA 4BRPA 1U4BA 4O23A 2JGUA 4CM2A 1BWVA 1N54B 4RW6A 4LF7F 2HHWA 3TO8A 2RQ5A 4R5PB 2CJXB 1VSLA 9RUBA 1S7IA 4O5KA 3GU3A 4BRKA 3FEZA 1ZS6A 3DM2A 3CM6A 3VQAA 4OI4A 3EE8A 3QMQA 4CEAA 4A8MP 1XTZA 1ZM4A 3MUMP 2FPHX 2V9KA 3TTDA 4NOHA 4ZHRB 5L1LA 2WCXA 4DB3A 3DLJA 4GV6A 1B43A 3TVKA 3CETA 3D6HB 2HFUA 3LDPA 3LP1B 3C5GA 4FW1A 2RDJA 2BEFA 3E58A 1RZMA 1SC3B 3ELHA 4GFJA 4IC9A 4H4MB 2V4RA 4O3QA 2OLWA 2CVEA 2R8GA 8ICQA 3DLRA 5F9LA 1D1UA 1RTHA 2GJFA 3SENA 4WZMA 2V63A 3M7DA 2EW9A 1COKA 5KFVA 4YNQA 4JK8A 5GMEA 3EW9A 2P9NA 5CE3A 2D74B 4U6PA 4R0EA 3ZSRA 1E6YB 4CZKA 3NBPA 3CJ8A 4UZBA 3TR8A 2CGLA 4ZN1A 4FM2A 1SS6A 1S77D 4MK9A 2Y0BB 1TVRA 1Y9OA 2VG7B 4DG1B 4JLHA 3QU9A 4OIXA 3MPVA 1IJFB 4U7UK 1FX2A 4JAXA 3VETA 4E98A 3DGVA 2UV8A 3HKZF 2FHJA 1FJ7A 2AW0A 3B4DA 1IWGA 1JLFB 2BZ2A 4EP4A 3L2VA 1XNQK 2YX1A 3HD2A 2HSTA 1ELOA 1SUQB 2N4CA 3B78A 5HRPA 1XERA 4KI6A 3ZDCA 3AVMA 5KT6A 4JP8A 4CJRA 1LXNA 4ILGB 3C1YA 1HR0J 1IKYB 2V4JB 3IS9B 3GV5B 4YFUA 1YUWA 4QW8A 5D4LA 1CQNA 4DV1F 1NDPA 2IVNA 4QNLA 5EY4A 2W25A 3KG1A 4I6YA 1RWOB 1R8CA 2QMXA 4KLEA 2WW8A 3D28A 4N8NA 5LMUF 1ZBIA 2QTWA 2CADA 1RTJB 2GH1A 2F4FA 2O8DB 3VQ9A 4J9SA 2E7XA 5IQ6A 2E1CA 2E20A 1PO6A 3Q8KA 3EL2A 4CLSA 1MWMA 1Q46A 4BC4A 1GT8A 4P0QA 2EK6A 1DK2A 4IQVA 1IBMJ 2JLGA 9ICPA 3BYPA 4P4MA 3NFAA 2P8IA 2NRRA 2ITMA 2GV1A 2B51A 2LA6A 2QJ3A 1TUVA 5AKIA 4CNQA 1VDVA 1RI7A 2W1BA 4NLWA 2Y9HA 4LFAJ 5HROB 5AK3A 2Z1IA 4Y2SA 5CP2A 3QBCA 3K9JA 2BJEA 1X4DA 2QGFB 1COOA 5CD4H 4KPYA 4IS7A 4KC5A 5EDWA 2KHQA 5AQQA 1T95A 1SVDA 4BE2A 2WFAA 1RNHA 4ZH4A 5DZ6A 1WN7A 4WXOA 1TFRA 2PYLA 2H51B 4R63A 2B6AA 4BS2A 2VODA 3O4QA 3SUPA 1TAQA 5EWGA 2KZ3A 4NEZA 3RYLA 1N52B 3J8AA 1VQNN 2G2ZA 2AJ4A 4IDHA 3MD3A 2AHOB 1L8OA 1JXEA 1YTYA 4BWJA 3BZKA 4B3OA 1BPDA 3ID6A 3EZWA 3H59A 4IYQA 3NF7A 4NLYA 3KHYA 4NB4A 2A2DA 5D4PA 1ZQNA 2IBOA 4BRIA 4DV1K 4O0NA 2JR5A 1FFSB 4U7UD 3W2WB 5I3QA 5AKHA 1FDAA 3C6UB 1S6OA 5GMKa 3FZMA 2H5XA 2UUAF 1XWLA 1I5OB 2H5JB 3TW0A 4B9NA 2WF8A 2AX1A 5KT5A 3DI6B 1GLFO 1RGIA 4BE1A 3QU4A 3W65A 3CJRA 2UXCK 2PEHA 2E3TA 4FNHA 1NMDA 1ZC6A 4CEDA 4CF4A 5T41A 5DK5A 4OLAA 5HQMA 4F3QA 2X74A 4DU4A 4FM0A 2K4IA 4GLXA 2DGUA 1K0TA 3A3OB 4WYLA 1C2PA 1IVZA 4X64J 5F9NA 1KD1T 1U02A 3OFEA 3JTNA 3VF6A 2M3DA 4UOCA 4R64A 1KDHA 3SCIE 3TARA 2SXLA 2RHQB 4UY85 3W3DA 4LSLB 3C16A 3CJ3A 2RHKA 4EEYA 4U8VA 4EWTA 3CI5A 4LBPA 2HBMA 1L3SA 1ZJMA 2R7YA 4HTIA 3LGNA 2B4VA 2V8VA 1SXDA 3RWUA 1VQSA 1OY6A 1YJNS 3GFKB 3PCOB 8ICPA 1Z2ZA 4LVSA 5GADU 2HG4A 1OXJA 4JYAJ 3WX4A 3IGNA 1UJ5A 3LP0A 1RT7B 2HKEA 4JUZA 7ICUA 4CJQA 3L6QA 4OYOA 4R66A 3SXLA 2FMQA 3FBFA 3CJ4A 2YWHA 4DV5F 3KJVB 3H0RB 4GO7X 4DG1A 2V67A 3ZYYX 2YKAA 4OHXA 1TAMA 3CC4N 2HURA 1F5AA 1UFKA 5JS1A 1L3KA 5FDLA 4FK4A 2UUCF 2K8AA 2ZH2A 3CJ1A 1TVAA 3HSJA 1VC6A 3I5BA 2GLEA 4ECSA 4HL9A 2EAOA 1BIUA 3I8BA 4MH8A 2W2QP 2WSEC 1YZ7A 2RRDA 2A3ZA 1RT4A 1ZQFA 2XZWA 4Y34A 1VQ8S 4DV1J 5A8KA 5JTIA 2RQKA 4I2QB 2JVRA 5KPTA 1A5WA 4LIRA 2FVQA 2NSCA 2X51A 4BC9A 1UPHA 4ZPDA 4CFDA 1KLMA 1K8KB 4I9QA 1RUSA 3V4IA 2CZ4A 5KG2A 2CDRB 2FZCB 1PGZA 1HYZA 1R27B 4DDFA 1GX6A 1NSPA 2DR8A 1X2IA 4P9SA 3HVWA 3OTBA 2CQ0A 3SD7A 2E88A 5A8WA 2MAXA 4P73A 3EKUA 1Z19A 5AZIA 4X4VA 1O0PA 3HRDD 4FJ8A 3LALA 4K4VA 2XULA 3X1LB 2VL1A 2AYMA 1UPMB 3P5BP 2NREA 4BHQA 2B56A 3WQUA 4BC5A 2XO6A 2LI6A 3ASMA 4C6AA 4LZDA 4L76A 1QS4A 5AE3A 4YEAA 5TKYA 4NCAA 1PVRA 4B1UB 3AHPA 1G7CB 4DPTA 1S48A 1ITGA 2QARB 3KBBA 3DRYA 3D68A 5HHIA 1S99A 2P5OA 2QE5A 5HAOA 1HWLA 4CNZA 1QVGR 4ZN3A 4DTUA 2OAUA 8ICCA 3W8GA 8ICVA 3RFAA 3SV4A 1CZBA 3AFGA 3EUB2 5E7OB 1VQON 3N6LA 3ZDBA 4ZJLA 3C94A 2RB7A 1GLDG 4WZQA 1Q5VA 3JQKA 1HBNB 1SZPA 2FLNA 3CD5A 5K8OA 1O51A 4BVOA 1Z2LA 1RWNB 1EETA 1H72C 2AJ1A 3ENHA 3RB4A 2PMZC 2QWRA 4HHHA 4PG6A 3O1LA 1B9FA 2HFNA 3MM7A 3PW0A 2HZCA 3S7RA 2A19A 4JKBA 3TAPA 4HT7A 2RRNA 1VS3A 3C16B 2F3JA 1GLLO 7ICVA 4NI2A 5B0EA 4CRXA 2FE9A 3KD5E 3DXMB 3RW7A 3TUIC 3UN2A 4QBUA 3M1YA 1WSGA 7ICHA 3CE8A 3JPPA 4B3TF 3DXBA 3V6DA 3NH1A 5J0UA 4DFPA 5BPCA 3CJCA 3JSMA 4WYBA 2OP5A 2RKIA 4P2XA 1ZPVA 5IM0A 2ZUGA 2E6LA 5SWMA 3L3CA 5HLFA 2BV3A 1Z00A 2Y8YA 2V8GA 3EVWA 2KFZA 1JLGB 3OFHA 3QJLA 3SUQA 1E6VB 2OMOA 3QERA 2LDIA 3CIMA 4I6MA 3OYBA 2V2KA 3QPIA 2A3VA 4WFBL 4QIWD 1HKCA 4OJLA 4ISFA 1WG1A 4X64K 3HVTA 3BB5A 4WFYA 4J2EA 1TUWA 3VVTA 5CYJA 4RNMA 4OZ2A 4AUKA 3QRRA 2LDYA 1QUVA 4ZVSB 1GLEG 2IRYA 4PHAA 2G2OA 5BR8F 4RNHA 5HRNA 5KG5A 2OSQA 2W7AA 2JV3A 4EGLA 1RDUA 4KH6A 1GLCG 3MX2A 4WKYA 3WEEB 1F2HA 2WAQC 1Y88A 4A61A 2BHNA 2XNRA 1I39A 2OD4A 2DB1A 1O03A 3OYFA 3V9UA 2MZRA 1TMJA 4NCGA 3W9IA 3P31A 1Q16B 1GXTA 5FJ4A 3WXIA 5AQMA 2IRUA 3VEXA 3MC1A 3PDNA 1DTQA 5F41A 4DXLA 1S1XA 3KWIA 1RT2B 1EO1A 4B1XB 4FKXA 5D4NA 4Z4GA 3ZETA 1BNPA 2YHBA 3WK7A 4BY9C 4F2RA 1K9MT 4OZLA 2EK1A 1HLUA 2UUCJ 2XGPA 3A3PB 2YWFA 3NXZA 4WPAA 2YJFA 2XSFA 1QE1B 4IFEA 5K14B 1QM9A 2BKPA 2JMGA 3AH6A 3HT0A 3TX0A 3T9ZA 2F5GA 2FLOA 4C8KA 4IRCA 1XMQK 2VDIA 4LJMA 2ZUAA 1BPZA 4JV1A 2R7SA 2J0SD 5BPNA 1LXJA 1X9MA 2LMIA 4DSIA 2XLKA 4CDIA 3GG1A 2E2OA 1ZQSA 3O9TA 2FHJD 1VQPN 2O8DA 4KGXB 1YWXA 4P7TA 3NGZA 3D45A 3M2VB 4WIIA 1A77A 1SWWA 3MM5A 1RHJB 2X6NA 3CNHA 3ZZPA 4NLOA 5KT2A 3CJSA 1S6PA 2E7VA 4QU6A 3TP2A 1ZQJA 1P8GA 3BBCA 4E1NA 1A0PA 2Q2RA 1X7VA 4I29A 1QVFM 3MPDA 2F63A 2GC8A 2WBNA 1FERA 5K4LA 3UE5A 4PXEA 1S1TA 2P9IB 1FO1A 1GEHA 3C29A 3TJ9A 3GJQB 1RDAA 3AOAA 3HBTA 1X4HA 4FOIA 1FO4A 2MZJA 3BQ7A 5CYMB 1HHQA 3LP1A 3FRZA 1KKHA 3QE9Y 3PW7A 5ALHA 3PNCA 5C12A 2P66A 1Q5YA 3T5JA 1SC1B 3KK1B 3EZ5A 1HNZF 5FPEA 2WB1C 2GIRA 5A0YB 2VUGA 3KLGB 1M90T 3V7KA 1DZ5A 2Q66A 2KICA 5TZVA 2IVMA 4KT0C 2VICA 3OYDA 4Y2UA 3VGTA 2KG1A 1N5YA 1A9NB 1YBUA 8ICZA 2YNHA 3QATA 4F5QA 1B7YB 5F0WA 2FZGB 5F0XA 3I8DA 2DGSA 2CNNB 3P6YC 3ZDAA 4Y2KA 5H2FU 2FLPA 1K9MO 1B0XA 4GKKK 2ZOGA 2ZIXB 1YITN 3KUGA 3IDHA 3LP0B 1EP4A 4NLSA 3I9ZA 4CLYA 4JKEA 3AN1A 1VSHA 1KWMA 5B0BA 4BWMA 3A8KA 4N7TA 3UI3A 3ZD9A 5AKLA 4AXJA 2C3MA 3LA0A 4KI4A 1O8BA 4NZ7A 4TXSA 1L7MA 4B3TJ 4URQU 2HS4A 5C2CA 2XYGB 4FJ9A 1MWQA 3M8QB 5FD1A 5AXKA 3N97B 3AD8C 4CIFA 1ECWA 4JI4J 4KAIA 3CF5L 3DDHA 2EI5A 4CRJA 2F8EX 1LK7A 2LQ9A 3LF0A 1CBKA 4NLPA 4O3RA 3GU0A 5J1EA 3L2WA 2XMTA 4MK8A 3TFSA 3QWUA 5CHCB 1GOCA 4LFCF 1JLEB 2WRMA 2M0NA 4J9QA 3KJVA 3C6TB 4C1NI 4LF7J 3DOKA 5IIOA 2BQRA 2CVIA 2YB4A 4DN9A 5GAEI 4KHQA 1HD1A 4YR3A 2FPKA 5B5EU 2MSNA 4U67L 4C48A 3C46A 3MCOA 1BO5O 4OJHA 2ZKUA 5B0GA 5A0YA 5HP4A 3V6JA 3CCSS 2N3LA 4E1MA 3IAS9 2ZTDA 3E8OA 2N82B 2N1RA 2LM4A 3W2WA 1YRTA 1HNZK 3V6KA 3NS1A 1UA1A 3NH2A 4I2EA 3DMJB 3GR0A 4FNIA 1YKWA 4HUGA 2DNYA 1W97L 4HTJA 1HNWF 5D4OA 3HL8A 1D09B 3RRGA 3K1RB 2F8SA 2L9NA 1VAZA 5C2GA 1XMQJ 1ZH5A 4PR6A 2RHFA 2RT3A 5AI9A 9ICRA 2HK3A 3ZTPA 3OTEA 2ZVIA 3U02A 4QJFB 2YVSA 3GZFA 3PIPQ 3IA0A 2YHWA 3O3LA 2JWNA 1EX8A 1R59O 4YOWA 4HCBA 3VEZA 1HI0P 2FVCA 1S1UA 2P9SB 4P4PA 4J5OA 5IFMA 1LWFB 2QXFA 5J2GA 3UDVA 2EVZA 3GIMA 2YNIA 3R5GA 4LSZB 4QZGA 2DGTA 3E1YA 4TU8A 1E4GT 2MRLA 5AQPA 4R8UA 3RBDA 1HYSB 3BR8A 3FC4A 2EC2A 2IA6A 5EXWA 1E6VA 4DWIA 3IAYA 4U9RA 1KQFB 4DPYA 4CJ7A 4PYDA 5HLFB 4YOVA 3THVA 1ZOLA 4MIAA 3JSYA 4OCZA 2AZ3A 3NGRA 3MAHA 1VK3A 1RYSA 2KEYA 1KSPA 5CH7B 2EHGA 4DR6J 3ATUA 2ZTEA 5CAAA 2A41A 4UT4A 4ZOHC 5D78A 4ECYA 5HQLA 4B3RJ 3TU5A 3WKAA 3OR1B 3QO9B 4G1QA 4DU7A 4USTA 3WDOA 2DGOA 2R7QA 4JK7A 1CG2A 3RR7A 2WTFA 2N3OA 5ALSA 2VB6A 4O4GB 2XSJA 1ZRMA 1IQTA 4CLUA 4IH7A 4MKYA 2R8IA 2MZQA 1HNZJ 1QTNB 1Q9YA 2J9DA 5D0GA 5ALMA 5LL6d 1WSIA 4I64A 1XSNA 2B8PA 2PZSA 2NRXA 4ED3A 3G9CA 4DR1F 1F9FA 3DNCA 2KHCA 3VTHA 5AKYA 1NWKA 2YTUA 1ZAXA 3EZUA 3MUTP 1AZSB 3QFWA 4QJVA 4LFAF 4FZMA 2RILA 2E6MA 4W5RA 4O4GA 4YN3B 2E5LF 4CI0B 1HEKA 3KK2A 2P9CA 2AF6A 2F4VJ 2IVFB 3AD9C 4QZVB 2XY8A 2W2NP 3RMCA 2BM1A 3ZSVA 2YI1A 3DEEA 4F92B 3NRZA 2ZUCA 3U6FA 2O4IA 4PJ0U 2DEJA 3ZTQA 5J0SA 4NXNK 4Y2XA 5J2PB 1WTBA 2W3RA 1X4CA 2ROPA 3Q7CA 2VQFJ 3DXKA 4JI6J 4J9VA 1S5LU 3MAQA 5D15A 4AYBD 4ILMA 4B08A 2RAQA 3A5MC 3S9HA 3WU2U 1B4FA 2MGZA 4KRFA 4Y2RA 3FLCO 1KNZA 1NG9A 1JN3A 1U1NA 2DY4A 5CY4A 5D3GA 2CPRA 4M3YA 5IT0A 4TUPA 5GMDA 2AGPA 2BMBA 2ZHBA 2J0QD 3GYGA 4H8KA 4Y2YA 1M5HA 2VQEK 4EHUA 1Y11A 2Q1LA 3FC9A 4H4OA 4HVZA 4WU2A 1YJWN 5ALPA 3D0IE 1RAJA 1X4EA 2E8OA 3CPWM 1CUKA 4BQLA 5KFTA 1NLVA 4ZKAA 4YOUA 3AA9A 2QFIA 1HJRA 2W7PA 1YJRA 4DFMA 1GK8A 1UJ6A 3OHBA 2CAJA 3W7BA 1Q4RA 1RBOB 2L48A 3GJTB 3RSEA 4W5OA 4PPXA 1FEZA 4DSLA 2Y1RI 4Y2TA 3CDAA 4ZIVA 4Z7YA 4DQIA 4G9ZA 4YOYA 3OA9A 4I9LA 2NO5A 3MEGB 2ZF5O 4L3KA 5E26A 3AMZA 2W2PP 3ORYA 2FVPA 3Q22A 1NK5A 1C0FA 4CI6A 2QK9A 1NO8A 4LIWA 3KWGA 3RRHA 3A12A 9ICEA 5LSLA 4BC3A 2GO7A 3D9BA 4DX6A 2BOAA 4AL5A 4UTGA 1LV5A 3AEVA 2L5YA 2W9BB 5C25A 3NMRA 2FDRA 2KVSA 3M6ZA 2XMVA 2D3UA 2NLWA 4DCHA 2AP1A 4DI6A 1D0EA 2BQUA 2OEMA 2AJQA 2W4CA 3ZSXA 1GH8A 3CC7S 2W9MA 3AB2B 1ZD3A 3VEWA 4WTYA 4FVCA 2DQNB 3RH6A 3E51A 3EE3A 1GXUA 3BKFA 3MHYA 3UN5A 2CJQA 4XDCA 5BPLA 2F7VA 2Y1IA 4RW9B 3P39A 3CCVN 4HUFA 2ZEJA 4DUYK 3T1HK 4NYZA 4IRKA 1T6CA 4BLGA 3K8VA 2EFQA 4B3SJ 2GO9A 3Q0AA 5EX5A 4EX7A 3CDEA 2K4PA 2OPRA 3T5HA 2J6UA 4DQPA 2ZOMA 3FMBA 3H46O 1OVYA 1YXQA 2CNKB 3PW2A 3PHEA 2E29A 1HRHA 5FROA 3K17A 3F41A 1ZQBA 2CQBA 3K5NA 1D8YA 2IYGA 4B3RF 5LY3A 3LQVA 3OR1A 4CLZA 1TKTB 2HWTA 1WUDA 2E2NA 3F2DA 2CQ1A 3DN9A 5AM3A 3QJPA 5KPZA 2W7OA 1IBKF 4LF9J 4Y00A 5ALWA 3AOBA 2CJBA 1P90A 2E9RX 1CS4B 3KK7A 2KG5A 3LPEA 9ICOA 1NB2A 3W66A 1UWBA 1H74A 2ESEA 2RIJA 1QH9A 4DL0C 4X4RA 2KI2A 2I1QA 3WXJA 4KHSA 4RW4A 4LRAA 3EVOA 3R3LA 3GPAA 7ICNA 1LB2B 4KYZA 1PKUA 4JKFA 5BOMA 2K8GA 3THPA 4A2BA 2M8DB 4J03A 2VJUA 4FZZA 4IOXA 2KFYA 1X3MA 5AK4A 2PMWA 3MOJB 4RT2A 3WX8A 4F72A 1NGIA 3R5BA 1TFYA 2XVTA 2KHVA 4G1QB 4IH5A 4PXBA 4RLEA 4XDDA 1K8AO 1WHYA 4JN4A 4O5BA 4M5DB 4CZEA 3L4PA 3L2UA 1T94A 2O8EA 4OX9F 3K5OA 1X5TA 3S3MA 4OLPA 3A5LC 3ID8A 2ZBCA 3V72A 5K8PA 1JLCB 3P1GA 5CZ1A 1SJRA 4BC2A 1VQ5S 3CC7N 3VEYA 2W24A 2FPMA 3KK3B 4PL8A 2FQQB 2ATCB 5B0DA 2WC9A 4FJMA 3LW5C 1NJIO 4J2AA 5T14A 3K58A 4I1TA 4NE9C 3S3NA 8ICTA 3OPKA 2KVQE 2QMWA 4BQZA 2HFZA 1T3OA 5EE1A 5CEHA 1T02A 3B6BA 3M8WA 3B0XA 1WG5A 2G8FA 5HROA 3VQ8A 1NU0A 1SKRA 4CEEA 4HR2A 1S49A 2P9PA 1B70B 4QIWF 1M1KO 2FIUA 3EWAA 4NL9A 1MW7A 2W9BA 3JPNA 2GVZA 1NK4A 1Y7PA 4CESA 4CJSA 3NKYA 3M6WA 2HBKA 2OO4A 3M8YA 3BGUA 3AGKA 1U24A 4J9KA 4X66J 3CO0P 5F3ZA 3C19A 4WTOB 4M95A 3BDEA 2ZJAA 3F0NA 9ICKA 3KVGA 4GO5X 9ICLA 3J7Z5 3TNVA 3QZ8A 5LXRA 2M7SA 1A76A 4YY3K 2M88A 1K73O 1VISA 5MLCQ 2QARA 4GXIA 2ZNZA 4CF8A 2IM1A 5HMZA 2YH1A 4X62K 1S4EA 3W3SA 2I5HA 2OTJS 4CHZA 1EARA 4FF2A 2EFPA 2UVVA 2EEYA 1FTRA 3SQIA 2DISA 2UUWA 2OFGX 4DR1K 3VEOA 4M3WA 4JD2B 1SV5B 5E33A 2A1RA 1G15A 4CJEA 1SL1A 4GV3A 2J8AA 5J2MA 1RB0A 2KSOB 1XIQA 1X0FA 1FRIA 2FJBB 2MXYA 1RTIB 4PQUB 4JMUA 2MSSA 1YF5L 2MTLA 4OYBA 3QFHA 2IGIA 2JH1A 2Y9TA 1FRKA 1TU0B 1RTJA 1VSJA 2YMQA 4CH1A 2XCAA 3SSSA 4UAVA 2P9UB 5BOLA 3MGHA 3AA4A 4E89A 1PIEA 4IDKB 5EOYA 3BV8A 2OKQA 2DXDA 4KTQA 3W5YA 3TA2A 3UIQA 1Y5IB 1J27A 1TKXB 2HOQA 2VU5A 4DFDA 4QIGA 1T03A 4MTPA 3KZBA 2V51B 4BCAA 3HZ6A 7ICLA 2QWOA 4DV3K 3SQOP 3KK2B 1J6ZA 4FPIA 4E8UA 3K75D 4KHUA 5KG6A 1WEZA 3QUQA 4KN4A 1SJ4P 1UEKA 2OZMA 5BYQA 3P96A 1L3VA 1JQGA 2JEGA 4QYZJ 3VF2A 2J5AA 2L9DA 2HQFA 9ICNA 4ID5B 1BCMA 3LM2A 3T1YJ 3RJEA 4USKA 4LUBA 1XHXA 5GADP 4RTFD 3BEGB 1LWXA 8ICYA 2CPIA 2C2DA 4FN5A 5KAKA 3KKSA 1CLQA 4AHVA 4DOAA 3OL7A 3K5MA 2RDDA 4NXZA 4EHTA 1B0PA 3SCKE 4F0HA 3HMJG 1FE0A 2OD6A 3C65A 5D3GB 4OKEA 4E7KA 4PQUA 1F60B 4O44A 4P2HA 1HIYA 3AQPA 3O8MA 2JJ4D 3EM1A 1NXIA 2KSOA 3MUVP 1GTHA 3EDRB 4CO2A 4DR2J 2W6LA 2HEKA 2YKQA 1F3FA 1GMWA 4ES1A 2KH9A 1QQ7A 4OJ1A 4G65A 1RWKB 4K5RA 5H9FJ 1DQAA 1FKPB 4NM1A 3AD7C 3M32A 1QSSA 1M1HA 4ZITA 3T6JA 3J80U 2DRBA 5J1PA 4B8CA 3CCJS 2HHTA 5HSPA 2AU0A 4YS2A 5KGWA 2V7YA 2DVIA 3VQQA 1HLWA 4C8MA 3D2SA 1MQ3A 3G87A 2YCHA 4DV4F 4H4KC 1U0HB 2MQQA 4QOTA 2FC8A 3ZTRA 2W41A 2XY6A 2RQCA 4B9QA 2P9SA 1HBUB 3AVJA 5ADXA 1LOUA 1SL0A 2IHMA 4H5WA 2UUAJ 4JI8J 4E1JA 4CE6A 1HBOB 1WKJA 4H4KA 4B9SA 3ULDA 2AQ0A 2AEFA 4OI1A 3PMNA 1QUPA 3OGUA 3P3DA 4WP9A 4CD1A 3MCSA 4AE5A 2DK2A 4EENA 1J5OB 2CQGA 3NVWA 3QT5A 3RJIA 1VLYA 4HCCA 3QGHA 4NXMF 2MY7A 2RDIA 3BBFA 2V52B 2MU2A 2Y0SD 1UTAA 4FYVB 3AVKA 2Z30B 2CNLB 2MKSA 3DGPA 5B0AA 3W1YC 2K7JA 4FVUA 4LFCJ 3I0SB 3A0BU 1X8DA 3R9LA 3AO4A 3FBEA 3HP6A 4FCYA 2J7UA 1RDFA 1K6YA 4IQTA 3MAAB 2KK0A 1QQCA 1Q8LA 3CDWA 1WOOA 1P1LA 3J7ZT 4C7YA 1PUZA 4A8QA 3NCRA 1S76D 2WFBA 2WVBA 4P0QB 3UN3A 2WSFC 3KNAA 3L3VA 2XHWA 3E66A 1S1VB 4ZP6A 5JRTA 5CQGA 2I38A 3MMJA 5AZJB 9ICTA 1VC5A 5C24B 1FXDA 5GAHU 1UZDA 4BXOB 2WAQD 3OFGA 5J1EB 2W54A 1AYEA 1Q7LB 4ZOSA 5DDPC 4UB8U 1L7PA 8AT1B 4J9OA 4M3TA 4Y6IA 2DXEA 9ICHA 4DX8H 1F9HA 4I2PA 4QPXA 3HDSA 2HSZA 3HSTB 3G8SA 4DV0J 4I69A 2EAPA 2B9XA 3B54A 4ETXA 1N0VC 4KLGA 1TUGB 4HWIA 5HBMA 4CM0A 1M1KT 2VQEF 1SL2A 3P4IA 4Y1DA 4YB1P 2ASMA 3GYXB 4KGKA 2P6UA 2YQ3A 2GW8A 2G0AA 1XN9A 8ICAA 1HBOA 2FZKB 5B08A 2VIHA 4NLZA 4J90A 3UQ2A 2H9ZA 2FVSA 1H2TZ 2QMUB 1C20A 1XR6A 3AL0B 2KFNA 4QR1A 1JMSA 5KG0A 3HKZD 1YRXA 3EKSA 4EP5A 4CTAA 2AYGA 3QEXA 4R79A 3SCXA 2FJAB 1FXLA 2J8SA 3DLLL 3B8AX 2ZBIA 4LD0A 3QGGA 1Q8BA 3MTJA 3SI6A 2KN7A 3R2DJ 5J0XA 1FRHA 3GLJA 3OVBA 1ZQIA 3U3GA 1FFWB 3H2LA 4ED7A 4KO0B 2CA9A 4X62F 1N33J 4JKGB 4M7XA 4UB4A 3V1QA 4CBUA 2ZM6F 2EFVA 2YX6A 1X66A 1SQKA 4NLTA 1OQ3A 1WC3A 1YG0A 1ILYA 5IINA 2LYHA 1OY9A 2Y9UA 1R89A 4WE1B 2RQMA 3IWLA 1Y5LB 3N5FA 2XZDB 3OUYA 4FLZA 4NZ6A 5HMXA 5AQNA 3SJJA 2O01C 4WK1A 3QIOA 3SEOA 3UDLA 4A8XA 3RJMB 2FJVA 4FYDA 4FJXA 5D49A 2DGWA 2B4OA 4DV2J 3HD1A 4F02A 4IDKA 1S0OA 4I2PB 5EVZA 2NSBA 4BRHA 3A2FA 4US8A 1RHMB 1Q95G 4CHOA 3OXFA 4DOCA 2M2BA 1FXXA 2EG1A 3AA5X 4CJVA 4HACA 3R6LB 4KH4A 1G4CA 5CYQA 4JV5F 2R3VA 3CJQA 2G8UA 5MAOA 2IIRA 4JHDB 4CLTA 4PWWA 2YKOA 2YWKA 4P2SA 5LJ3Y 1YI2S 4FF1A 1S79A 1OH6A 4CZHA 4AL7A 1KAXA 4MYTA 2PMZF 2QFJA 4JI8F 3MGIA 4F4AA 4K4YA 1QZ5A 5IT9Y 1RCHA 1U9LA 4KTZA 4ITSA 1BOTO 2JDJA 5EWFA 3QX7A 1BG3A 2P9NB 4Z2XA 2QB0A 3M8QA 3S01A 1NOZA 4F0KA 5KI6A 1HWUA 4Y2VA 3WKEA 1N6QB 3UXOA 1RU1A 3KJFB 2W8KA 3S3OA 3PX0A 1HNVB 2E5IA 2ILZA 2E1AA 4K8ZA 4ZJQA 3GFZA 5A76A 3LVWA 1Y0HA 1P6TA 5I42A 4FP9A 4NLBA 2AQ4A 2ZM6K 3Q8RB 5HMLA 1VBKA 5AM4A 3EWGA 3BH6B 1MQ2A 2UUAK 3BQ2A 2ZGYA 1TL1B 4DV7K 3VERA 3AODA 1CRXA 3PJ9A 4BR5A 2NRHA 2DNKA 1C0MA 3JSBA 3I0RB 8ICRA 5AICA 4RU9A 3G4SN 3OTQA 3L8BA 5LJWA 1N5QA 3EJMA 1RWVB 3SAGA 2HFOA 1SQEA 5J2DA 2ZIVB 5J2IA 1TL5A 3OVSA 2K89A 5DQGA 1X3NA 1MU2B 4CO3A 3TUZC 1ZOTA 2OMLA 3AY9A 1NGGA 2P9LB 3O8WA 1SAZA 3TZYA 4Q44A 2VFSA 2E1MC 3OW2M 3O3HA 2HW3A 4F04B 4JV5K 4ECVA 4BRMA 3OL6A 1UVJA 5ETLA 4V1Ak 9ICSA 2HHHJ 5EWEA 2DR7A 1GOBA 1QQNA 2W8LA 2XC9A 3QETA 3GCXP 1RWXB 2EFOA 3TQEA 2X1BA 1ASWA 4Z6EA 1U1QA 4O3OA 1U47A 3POTA 2GUIA 3I56S 5E79U 3GB0A 2E7WA 1A6LA 4JI3J 3MM6B 3B0YA 5ETMA 4W90B 1PJ6A 4DU3A 2AIRB 1HW9A 1ZXOA 3NAHA 3HM9A 3KLIA 1ZTWA 2CPFA 3AT1B 1VJWA 1QAIA 3UXPA 3MXIA 7ICMA 4DV5K 4OX7A 3MFHA 2ASLA 1BWFO 2R8KA 4PG8A 4YY3F 1LKZA 4ZS6A 2Z2ZA 2ZZTA 1LWCA 3IR6B 1DK3A 2G8VA 1VSEA 1RT6A 2D5RA 2YX4A 2AA4A 2MQOA 2HLTA 2OYQA 2HIQA 1WORA 1BD6A 3R9KA 3BN7A 5C2FA 4NASA 4JI7K 1VSIA 1HMVA 2QM1A 2KE7A 4KY3A 4B3SF 1NGHA 1QCKA 1D5AA 1RDCA 1NI3A 4HEA9 1U8WA 3HKZC 3CCQN 1V9PA 2ZM6J 2A1SA 4CF0A 1VLOA 3T19A 2H5EA 1HHTP 2IJFA 5ALVA 3VAGA 3QIPA 1S0NA 1HNXF 3QSIA 3RU0A 2D6FC 2MQLA 5HJXA 2B21A 2CIMA 3QRQA 3R1HA 4CYUB 2XZTB 3PKYA 1LWEB 1XO0A 3OBWA 1UEVA 4ILLA 3M2UB 4KLSA 3G4SS 1PBUA 2VWJA 4P2FA 2YNGB 3E9PA 2LA4A 1IG6A 3I55N 4K4HA 2CYYA 4L74A 3BS7A 2ZZNA 2HOIA 2H54B 1HIWA 2DNOA 3LZIA 3THXB 1XNRK 4CNYA 4KHPK 4FLUA 5HRSA 3P8BB 2JSXA 2FMPA 2NRZA 4JB3A 4YB5A 3UXNA 4ANCA 4JV5J 2E8NA 1NGFA 2E8MA 1KN6A 1RDBA 5FLXY 3ZFVA 4P74A 4FJGA 3EY1A 5J0TA 2W9CA 3KIOA 1NLKL 1GLBG 4OYXA 4DHYA 1BHLA 2J9EA 2LQJA 2ISOA 4PRFA 1N48A 1TL7A 1F6TA 1SXLA 3AJDA 5I3PA 3F44A 3OVAA 2KOBA 2VKRA 2VA2A 3BKTA 4J7CA 5FPDA 3N4QA 4WU3A 4DL7A 1KC8O 4DTSA 3CB4A 2DXFA 4TYAA 4NJ8A 4YR2A 2A6MA 3KLVA 3SCJE 3I5AA 3CW2C 1FD2A 5LL6Z 2QWNA 4JI4F 2E5GA 4JI7F 1RABB 3H8SA 2W04A 3TJ8A 1E4FT 4KMOB 4DL3A 4DV7J 2P9KB 2E66A 3M30B 2G07A 2V5HG 3QJJA 2PKEA 4AM6A 2GVDA 5BPMA 1RE1B 1W2IA 1D9DA 4ZCLA 3NVZA 3TI0A 2HMIA 1XNRJ 3SFUA 1I6JA 3BS9A 3TADA 3OR2B 3DCAA 4BE0A 1HNXK 3MDFA 4HH1A 1HKGA 3K8WA 2E5HA 4IO9Q 4FDFA 2NZCA 3FZKA 2G08A 4ICLB 3AU2A 3KLEB 3HHNB 3D1HA 4QIEA 1RYUA 4ZVUB 2XG8A 1R6VA 2C2KB 2HRUA 2VG5A 3AVGA 2F8LA 3HHKA 1RLCL 3L09A 1PJ5A 4LJXA 3THXA 4QIWC 4RQ7A 5A2QO 3VGKA 5KFLA 2QSWA 2H3VA 2YBVA 1WNSA 1B99A 1X6IA 1BA1A 4YUDA 4CJ4A 3J7YI 3T69A 3ISND 5GIOA 1VFJA 1N88A 1PJ7A 2Z2MA 4IOCQ 4KO0A 2CFXA 1ZQEA 5D6GA 3NE6A 2QEXN 4KIAA 2YQ0A 5BR8K 3N5BA 1ZA2B 3DRRA 4DR3K 3M2RA 5C2DA 1BQMB 4B8AB 1FI4A 4LF8K 4NLUA 2QRRA 1S7HA 3CFPA 4MFFA 1S72S 3V9WA 3RJGA 3DKDA 3MMCB 4CIOA 1RAAB 3N4MB 4YXMA 4JK9A 8ICIA 1SJ1A 1JNRB 4ECXA 1KN5A 4CHNA 5DDMA 4PWUA 5IIMA 1EP4B 2OJ3A 4BR2A 4FZLA 5DQHA 3GILA 4JI4K 1WOPA 4URSA 3KOAA 2IS3A 2V94A 4NY8A 3OHRA 4J2DA 1FA0A 2R7WA 1GLJO 1FKAF 1B7FA 1REVB 5T7BA 4K5SA 4JI1J 3OYHA 1ED1A 2ROGA 3N6NA 2C28A 4KV8B 1X42A 3H2UB 3EE9A 3O9QA 2FBTA 4F71A 1RT4B 1T3QA 3ISDA 2UUBJ 2IM0A 3K1ZA 2EG2A 3BKUA 5LXYA 3M3ZA 5CR4A 3DXSX 3E2EA 4IG3B 5C24A 4BROA 1MN9A 4QOZB 5ALTA 3LPUA 4NLDA 2AGOA 1ZQCA 4UOHA 3HSGA 3QFPA 4OJ5A 2KJ5A 2FJ6A 5IM0B 5DO2A 3C2PA 2O1PA 3M9NB 5EHHA 4OLOA 3HKWA 2AD9A 1JCFA 2KW4A 3ZZUA 9ICGA 1JLBA 1GNKA 1YT3A 1KKXA 4JBCA 3FMWA 4FWSA 1ZQLA 1JI7A 2IBKA 1NZBA 2R8JA 2FY1A 1EHWA 4QWAA 3CJ0A 3N9UC 5CB1A 3KG0A 3CD7A 2DFHA 3QBWA 2KYZA 4WF9L 7ICEA 3K0JA 1FJCA 5ITHA 4JI6K 3KUEA 4CO4A 3ZLJA 2D3O1 3NGIA 3IRXA 1RG6A 2Z1HA 2B0GA 4I6MB 1NH8A 3MOZA 1JXVA 4CJTA 1E6YA 5GAGI 4DR2F 1DGJA 2G8WA 1F21A 4PXDA 3S6EA 3N7RC 3BQ1A 4LF6F 1KAZA 2YQEA 2MHNA 4H5RA 4BR7A 2IDOA 1EKEA 3UQSA 2V2VA 1ZM2A 4PKGA 1WDDA 1T8EA 1T44A 5A2QU 3TYTA 2IOFA 3RB0A 1ICEB 3HFVA 2PI5A 2G4BA 4DN0A 3CJ2A 1M5VC 1FRMA 3DI6A 3M8ZA 1HNVA 1A5VA 3DHXA 3UKUB 2NUHA 4Z4IA 2FBVA 4PY5A 4RQ8A 2JC1A 1U2VA 3KKAA 1V5IB 5JMVA 8ICKA 4FLTA 3TTCA 1D4XA 1M1GA 1VQ7N 4RQ4A 1IKVB 1J5EF 1S1WA 1FKPA 3M6KA 3RJHA 4FWKA 6FD1A 1FT8A 2GCFA 4Q43A 3CDUA 1SJFA 4O8UA 2ZWHA 5ETSA 1WEXA 4OX9K 4ZPVR 2ALYB 3MABA 3LDAA 3RMBA 1URNA 4RW9A 4FO6A 8ICJA 3EPGA 2AZ1A 1XHZA 3AA8A 3QNOA 2DHGA 1RT6B 1KVBA 2E1RA 3RR8A 3AVLA 3KFUF 1K8AT 2MZSA 1U1KA 2PBDA 1HUZA 2QLTA 4DQSA 4ELTA 3VVUA 4CK1A 4TY8B 3G96A 2AWZA 5IS2A 1CZ9A 2FF3B 4NL9C 4DL4A 3U7JA 4P10A 2IMOA 2LKZA 2BBEA 5ALNA 2OXOA 1N8RO 5A8KB 2CXEA 2O8FA 2W11A 1KL9A 2HVEA 3HYFA 4IQWA 3PX4A 2HF4A 2VPYB 3Q23A 1YIJN 1FWLA 3NWGA 2BXJA 4NL5A 1YBAA 2ZNYA 4EIAA 1WUAA 3QXGA 5CZXA 3CIPA 5BN9A 1SH3A 1RAGB 3FZLA 2I6XA 2P5VA 1MMDA 3QNNA 4PPDA 2BPCA 1OYDA 3ZDEA 2WSCC 3VMFB 5E3AA 1EQ0A 1S12A 3F56A 2GWSA 4WCEL 1WWUA 2KO1A 3HULA 2YN4A 3PYFA 4ED0A 3H25A 2VFVA 4OX8A 1FHTA 4BRFA 1HNWK 2YKNB 5LM7E 4NMXA 3ULHA 2D4WA 2IJNA 4P4OA 1KEKA 3O9SA 4DV0F 1RBAA 1BMQB 3V2UC 2F8MA 2C3OA 4JI1F 1ZQGA 2HFSA 2F9WA 2H3FA 2Y1JA 5C42B 3GV7B 1B64A 4MF2A 4QZ9A 4BR9A 2JGAA 4NRTA 2GHVC 2UUBF 4FM1A 4A8YA 4AHTA 2G8KA 4OYMA 1CJKB 1RAEB 3Q8VA 4KX5A 4ECTA 8ICWA 2XS2A 3KHLA 1VQ7S 1QAJA 2PA8D 3QINA 1KLMB 1K8KA 4PWDA 5M2PA 2UU9J 3E9OA 4CO0A 5HP1B 3FZBA 3LOUA 4Z6DA 5HMMA 4I2QA 1MMLA 4Y1CA 1T9VA 4RBTA 3IM9A 2K60A 2I7NA 3FGUA 2DKXA 4PQAA 5J2QB 5AI8A 5KFIA 1NSKL 3C95A 3CQ8A 1BUXA 3PYDA 3H5UA 4GXJA 1J9AA 2HGMA 3A8YA 2EKYA 3M6XA 4X66K 1PC5A 3UO0A 5D0EA 4DR7K 4ZLLA 4I2GA 1U6BA 3SMPA 2BE2B 3CC4S 2O8FB 1B3TA 1JJ4A 3MXJA 4LF8J 2W2OP 4ZMMA 4HTLA 1MROB 3K7RA 4QZDA 4KLIA 2OANA 2K1RB 1H6KX 7ICKA 3ZNJ1 2LHTA 5KT7A 1NRKA 1JWWA 2ATLA 1UW9A 4CLWA 1RPLA 4TLRA 4F93B 2J7KA 4DCOB 3O1WA 3ADAC 3ILJA 1N63A 4ZLPA 1ATNA 2DKOB 4TVAB 2WB1D 3UR0A 2MY8A 4UB2A 3CMEN 4DSFA 5I3UA 2ACMA 4RPXA 3JTOA 2Y1LB 4X5VA 2LSNA 4J91A 7ICJA 5BRDA 2XWXA 3KKRA 5E3QA 2MA1A 2YMPA 2C22A 4P75A 3U3YA 2DTUA 4X4OA 1KQQA 4W5QA 2O8CA 3T1AA 5F8JA 1ZQYA 4IOAL 4FWMA 2E5LK 2GHPA 2ASDA 4FJIA 1LAVA 2NRVA 5CABA 3I31A 1J5EJ 3LP2A 2VCPA 1Q78A 3FBCA 3DLEA 1R0AA 4JEPA 3HK2A 1HMVB 3QZ7A 3GG0A 4B3TK 3Q8QB 3NGYA 4M5DA 4C3KA 1H98A 2ZHAA 1TTHB 3DRSA 2DRDA 3EUNA 5AT1B 3A5NC 4CHYA 2FTRA 4KLQA 4X66F 4QWBA 3TKAA 2MQ8A 3IRWP 4BREA 3SIPB 1PBAA 4U96A 1JB0C 4LY7A 1S9EA 4M2YA 4KB1A 2KKPA 1X9WA 1P27B 1RADB 2EWHA 3NVVA 4L73A 4GKJJ 1F5CA 1V9OA 1V3ZA 5H9FK 3F5TA 4RCHA 3ISCA 4X64F 3JAMY 2X1GA 1CC8A 1WC6A 2XHCA 2ODGA 3THWB 5BXIA 1LW0A 1S6UA 3CPWR 5L1MA 1WBDA 1ZQHA 3ZNUA 4CZCA 3SBGA 2BM0A 2B6AB 4GKKJ 2MYFA 4ED2A 2GX8A 3MEEA 1K1SA 5J2HA 3OS2A 4WQ4C 4F5PA 5AQWA 4RQ3A 3MM9B 3BF4A 4JYAF 1FRXA 3QYPA 3UVJA 2F9JA 4IFVB 3VQTA 4HLBA 3MM7B 3K5LA 1XS9D 2P6RA 2ZDOA 1VJQA 1FF2A 4FE3A 1IXKA 1MMNA 2BE2A 1DGKN 2Y8WA 2ZJQL 4NLRA 1S6QB 2HAIA 4ATNA 4OKJA 3NP5A 2AP6A 2R7UA 3MK6A 1YJTA 4NRUA 1IUJA 3ZX2A 4UB6U 2YX8A 5HO4A 5FRNA 2YXLA 4OYWA 3PEJA 2E2QA 3L3UA 3V6DB 3KTQA 3TJAA 4BDZA 4FF4A 4USUA 3O2IA 4M94A 1EX4A 1X6JA 2QC3A 3ENBA 5LMUK 1JLAA 3MN7A 3U1LA 2CXYA 4I7FA 3CC2S 4Q5VA 4RX6A 1ZD5A 2RS2A 2H48B 3RAXA 1V4TA 7ICIA 3HFZB 1V38A 2ZXHA 1T9XA 1N6QA 3DRPB 4G9BA 2ZH7A 3V6HA 3FNNA 1OH7A 3J80Y 1CXQA 2F1JA 2Y3YA 1YTUA 2KYXA 4G6VB 3T1HF 2ALZA 3PRVA 1NZAA 4A62A 2EFGA 4A4JA 5KFDA 1NUEA 3C7NA 1P9QC 2AX0A 9ATCB 1RXOB 1JJCB 1U6FA 1HA1A 1XMOJ 5DLFA 3CVKA 3MCMA 4LF8F 3DOKB 3LANA 4Y2CA 4NZ0A 4G3IA 1SQGA 1HQUB 1JLEA 3O6WA 4CJLA 2EWSA 1HARA 3ZT4A 1HNXJ 4I2FA 1G1XA 4EI2A 1TKZA 1KRPA 3MD1A 4UB3A 2V2ZA 2GMJA 1R0CB 4B3MJ 2RN2A 3VA0A 1FEEA 4K4WA 3Q8MA 5F3TA 4YB6A 3M32B 1TL7B 4M5LA 3ZETB 1NGJA 4WJBA 5G4DA 2YHYA 2DPNA 2JZBB 1O6XA 1O1WA 3M9MB 5GTHU 1IKXA 1Z3EB 4CGHA 1T9TA 4IJAA 4W98A 4KLOA 3SBMA 2HVZA 3HFKA 1DQ9A 2DCLA 1FKOA 2XLIA 4DU1A 2UUTA 4DHVA 2F77X 4Z6FA 4QQBA 3C15A 1VC0A 4OI2A 3BN4A 4J9UE 4TN2A 3SSQA 3LUYA 2DCUB 2EH9A 4FZNA 4XK8C 2VFUA 1DTTA 4CHPA 5L9NA 1LOTB 1SGGA 2B9EA 3RTVA 4MO4A 3FR0A 3MM5B 5C7PA 3KK1A 3N0VA 4N77A 1DURA 1NHUA 5FIIA 2UV8G 4FYWB 4L6V3 4OJRA 2J9DE 1HI1A 1YX2A 5LOQA 2BDUA 5DQIA 1RTHB 1RK8A 4KAZA 2O66A 5CHIA 1IG8A 4FW2A 2BQ3A 3MR6A 4MYUA 5ALKA 2MLYA 1WHVA 1YZ6A 1XK8A 2DH8A 3LK9A 3CD6S 1JX4A 1OS5A 4BBYA 5EX0A 3CMQA 5JU5A 2F65A 1HKBA 1XNRF 2ZWPA 4DV6J 2GWJA 4F91B 1KONA 1YJ9S 1GOAA 1JJ2M 5IQQA 4CGIA 2DR9A 2CPEA 3PRDA 4JI8K 3B6OA 1OIAA 3FZ2A 4CF1A 1HKAA 3UE2A 1KFTA 3P45B 3NASA 4ALZA 2B4UA 5HOOA 4RNFA 5AI4A 2GO8A 4NWBA 1UVKA 1QVGM 2OSRA 1S9EB 1WI8A 2CG8A 1T9WA 4IFVA 1T0TV 4XQ8A 1ESVA 1HJOA 1ZQ1C 5ALDA 3R5DA 4ZVEA 4M9HA 3MZIA 1Z1BA 3OQ2A 1V5VA 3NMUA 2HHQA 5LMNJ 1HBNA 1R8AA 1RISA 4UB5A 2WAQF 1CJTB 2M52A 1XNSA 2BTFA 1YJUA 5ALIA 2G0JA 8ICHA 2XY5A 1ATSA 4ZVFA 2ZJRL 4OYAA 1EKRA 2BYCA 3GMGA 2RHSB 1F1BB 3B82A 4ED1A 2VQEJ 2V9WA 1U1MA 4GNIA 5AFUH 2QKBA 1UPPA 3QAEA 1G6BA 1KCFA 4R8UB 3C6HA 3HOTA 3RJJA 3AO1A 3SAHA 1ZD2P 3OYMA 2VZ9A 5FPNA 1U2VB 4WF9Q 5KQ8A 3PLAA 4BJQA 3WXLA 2KVIA 3TAQA 2JH7A 3I4HX 2KV2A 4X65F 1BQXA 4KH1B 1ZQMA 1URRA 3W8PA 5KFCA 1AFJA 3OBYA 5HQ8A 2VKQA 3AO3A 4ZIWA 2B7BB 4MQ3A 3BQ0A 2HNZB 3ALRA 4ID8A 3N79A 4OV1A 2WF7A 3IXQA 4F4YA 3CJ5A 3G82A 3BQTA 3A0IX 3SFGA 1REVA 2BE7D 2JC0A 1Y10A 2HNYA 2IFXA 4FWLA 2DJWA 3ZT1A 3F2BA 1NH7A 4OLBA 2WVDA 2PEBA 7ICQA 3Q83A 3DJCA 1YJNN 3K5PA 4X62J 4PEOA 4WFXA 2IDLA 1KQSR 3SK3A 2D69A 3ETRA 4N76A 3OPXA 1G99A 2QT7A 2ADCA 1TKTA 3CD6N 1DT9A 2CZ9A 2LYBA 4IEEA 2CJKA 2BVZA 1Q0NA 2WK4A 3R6GB 5I4MA 4FBTA 1IV0A 1X4GA 4B1VA 1RAIB 4EFHA 1Y00A 2FSNA 4JRPA 4CFCA 4IXCA 5K5MA 4B3MF 2LYVA 5DJBA 1AROP 1KQGB 5KL1B 2P9KA 4Z4HA 1BE4A 4GY2B 1WG4A 3CO9A 3ZCMA 4XRHA 5HJYA 4PWDB 3WNFA 4KLFA 2XTJP 1CJTA 3NDKA 3SUOA 2KJWA 4PHDA 3LWLA 1DGSA 4PZOA 2FGCA 4CEBA 2UUBK 2DBYA 2MSTA 4F36A 1TYQB 1Q3VA 3CJAA 1C1AA 5AQHA 4QAGA 3J7AP 1F5SA 3MWBA 2PFFB 4ZP9A 3QU5A 5LSRA 3R6MA 4JKAA 4M3UA 1JROA 4QIFA 3ZTOA 1Z4OA 2X78A 5DM7L 3JPOA 1VR6A 3IG1A 5J0PA 3EX7B 5DETA 3IFRA 1FESA 2YKNA 3PY8A 2DGQA 3CTRA 4Y28C 2X6SA 3VAIA 1VYAA 3NTUA 4DCPB 3QNWB 4QWCA 3R8YA 3ZC4A 1NAQA 3AVFA 2OFHX 3I76A 1Y3KA 1JKHB 2YPYA 3Q8LA 5GVQA 5M2UA 1HHSA 2DFEA 5GTIU 4QYZK 4CERA 2MKJA 3IDWA 4DBQA 5ALEA 1IKXB 4ENOA 1RXVA 1NGCA 2VBYA 4DLGA 3LL3A 2PFPA 4XA5A 3ZI4A 3I82A 1JUDA 3EGWB 1VQ6S 4RO0A 2XEXA 4Q45A 3AUOA 3C3LA 1RHKB 2DTJA 3LO3A 3IG1B 1AW0A 3F9MA 4B9UA 5T7LB 5L39A 5KFWA 5CWRA 5ALGA 2DGXA 1RA6A 4OZNA 4RU2A 3PIOQ 3IM8A 1JL1A 2ZH4A 3I9V9 4EUVA 1YTAA 5L46A 4WK3A 2MKKA 4GVLA 2W55A 2U1AA 1KR4A 4WYWA 2PC6A 3GIRA 4UQTA 2E9ZA 3GBTA 1OKJA 3FAHA 2UZAA 3LAKA 4ZTJA 3ICLA 1EZZB 2XO7A 4ERDA 1WUUA 1W2BR 4F8RA 2Q6CA 3G6EN 2ILYA 1XMQF 1RP5A 5AIAA 2VGNA 2CZVC 4MLHA 1QAYA 1BI4A 2POKA 3QGPA 4M9LA 2IMWP 2ITGA 1WKLA 1WG8A 5G0RB 4PHPA 2DT9A 3MM8B 4PGQA 2Q36A 3M30A 4KMUA 3MMBB 1S57A 3CMAS 3V7LA 3MXHP 4H0VB 2OYYA 1QZ6A 2K4HA 3ED5A 1YJWS 2QLBB 4TY8A 3KYLA 1DLOB 3MMAB 1B0VA 2OGUA 2AKWB 4KJIA 4RBVA 3DDNA 5KFGA 3QBXA 4LR8A 4YY3J 2ACYA 2N7CA 2Z1JA 2JXJA 3L4IA 4CD3A 3T3FA 4AL6A 4JKDA 3BF3A 2ZIUB 3M7VA 1S1WB 1VHFA 5DGBA 2CN1A 3NGKA 4CBWA 1SCJB 2D7SA 3TVYA 2YKMA 4F26A 1R8HA 5KRSA 2DNQA 2OZSA 3V1OA 3UVJB 2I8EA 4RWWA 4DR6F 3ILLA 5HATA 2KM8B 2MZTA 4F7VA 8ICOA 8ICBA 5DDOC 3WXKA 4JYAK 4NLNA 2UU9F 3HOSA 3P5TL 3KKFA 2BDPA 2HRYA 4IQMA 1JJHA 1W0HA 1FNOA 3FCHA 1EXNA 4NLGA 1NZ8A 1DBDA 2AJ0A 2W4DA 5KFZA 5CZVA 3RB6A 1BUPA 3V81A 2VASA 5GAGU 1IIPA 2DHHA 2FUG9 2LPEA 3OYKA 3Q8SB 4RWXA 3TFRA 3LVVA 3HVTB 3NS7B 1A7GE 1HX1A 3TAMB 1SV0C 4GKJK 8ICFA 3FCWA 4V19J 4MJKA 4FF3A 3JS6A 3GFYA 4EEKA 2JRSA 4OV6A 2JEIA 5AKKA 1SI9A 4DV0K 1MROA 2ZDPA 1CULB 2ZHOA 4RQ2A 7ICPA 4X4SA 2KRRA 4FXVA 2G13A 2G5IB 2O6KA 5DB6A 3PHTA 4QS9A 4UASA 1VDHA 3NCIA 3BDPA 2PFDA