1XWLA

Bacillus stearothermophilus (newly identified strain as yet unnamed) dna polymerase fragment
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a thermostable Bacillus DNA polymerase I large fragment at 2.1 A resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Dna replication
molecule keywords DNA POLYMERASE I
total genus 206
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1xwlA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1xwlA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xwlA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xwlA01
4IDKA 5KFVA 1HPZA 1QLNA 5DDMA 1MC8A 3ZDCA 2VWKA 2V4RA 4ED3A 3RTVA 3ZSVA 4G3IA 5KFPA 4KHNA 4RUCA 2I9GA 5J29A 4E7JA 2KQ2A 4JRPA 3GFKB 5J0PA 1XI1A 1MSWD 4DOCA 1S1TA 4EBCA 2DFHA 1ZQJA 1S0OA 3MBYA 1D9DA 1RYRA 5HROA 3C2KA 4FLXA 9ICSA 4E19A 4TUQA 3SUQA 4M6WB 3K75D 1S1VA 2ASLA 1VSIA 2OA8A 5DK5A 1IM4A 5KG6A 4KTQA 2BQUA 3MEDA 3CM6A 3HPOA 4B9SA 1ZQKA 5KFMA 1KCFA 2HVHA 2PFQA 4CEAA 3UPQA 1T03A 2V4QA 4YR2A 1REVA 3EWAA 4ED2A 5KFAA 1TKDA 5EU7A 3SQ2A 4KLFA 3GV5B 2IBKA 5E41A 1JLQA 4UB2A 3OJSA 2RN2A 4DSKA 2MUTB 4M0AA 9ICFA 5J2EA 4AHTA 4BDYA 1XO1A 1BPXA 4DQSA 5KG4A 3DI6A 3SQ0A 3PR5B 2BKEA 1N48A 4CFCA 2QKBA 2JLEA 3PMNA 2X6SA 2VA8A 3VQ9A 4AHRA 3JPOA 3OSPA 5J2JA 1RT1A 3AVLA 3JPSA 3RJGA 2BQRA 4HCBA 4B9NA 2Y1IA 4OLBA 4DG1A 4FJGA 4NLNA 3AO3A 1HNVA 4GVMA 1NKCA 4CK2A 1JLCA 5J1EA 3DYAA 4B08A 3DLHA 4DU1A 5J2QA 1WNSA 1RDDA 1S1UA 1ZQIA 4DS4A 2P51A 2YNIA 1S9GA 2IC3A 3KLFA 3EY1A 2XO7A 5KFKA 5J2KA 3GDXA 3KLGA 2YKMA 3AU6A 3QINA 2W9BB 3LP2A 3SV4A 1S6QA 4R65A 2ZD1A 5HRSA 5KFYA 2IDOA 4PY5A 5I42A 4DFPA 5J0XA 3M9NB 4RNMA 4P4MA 5BOLA 3PX0A 4FJLA 4M9GA 3NH2A 3B6OA 1S0VA 4ED6A 4O3SA 3RBDA 2H5XA 2OZSA 1A5WA 2P1JA 4J9NA 1U9LA 4KLDA 1HJRA 8ICIA 3MAQA 5KFFA 1DOQA 4FJMA 1SKWA 1VSFA 4J2EA 1RYSA 4I2DA 3LZJA 1UOCA 3Q8KA 3M8QA 3QEIA 3V7KA 5IIMA 4UBCA 3RMAA 3HM9A 3RR7A 3HP6A 3Q8QB 4I2HA 1Y88A 1S0NA 4KRFA 3C5GA 8ICRA 3DOKA 4IRCA 3I0SA 1XU4A 4JS4A 4BE0A 4M3UA 4EZ9A 1RILA 1XHXA 3HPHA 4ZH4A 4RNOA 3MEGA 1HRHA 4Z4EA 2ZUDA 2KN7A 1HMVA 4DF8A 1RTJA 1S5JA 1UAXA 3NTUA 4F8RA 1S76D 5DG8A 3U3YA 1EKEA 1HQUA 4CJVA 1D8LA 2HHUA 5FROA 3HO1A 4KLOA 4FZYA 3TFSA 3OYFA 1RTDA 4IFVA 3NGDA 1JLBA 2UVUA 2D0BA 2BQ3A 1BCMA 5J0TA 4F3OA 4PH5A 3AA5X 3HWTA 3KIOA 1VRTA 3MXIA 4FCYA 3BJYA 4M3ZA 3T3FA 5KG3A 4Z4CA 1BPDA 4I29A 2XCAA 1JXLA 3BQ2A 4ECSA 7ICIA 4J9RA 2PFPA 5J2NA 3BGRA 1B9DA 1W0HA 4Y1DA 5J2HA 5KRTA 3WNHA 1VSHA 2XRIA 2HHSA 3MFHA 4PGYA 4NCBA 2IHNA 4F2RA 3K59A 1NK8A 4J9OA 3KK3A 3VQ4A 4CK3A 3ZSOA 3BQ1A 3M8RA 8ICUA 2QK9A 3B0YA 3NCIA 4CEQA 2G8UA 4ECWA 4PGQA 1TAQA 3RH5A 3V72A 4ZTFA 7ICGA 1C1BA 3KKRA 2A1RA 2HNDA 4UQGA 3L2UA 1VK0A 4F3TA 2AQ0A 2ZE2A 4YFKA 5HMMA 4XIUA 1L3SA 7ICOA 4BE1A 4MFFA 2AGOA 2HW3A 1X9WA 4RT2A 2BCUA 1XC9A 4IRDA 2OYQA 2Z1HA 3UIQA 2ISOA 1J54A 5DGBA 1ZQVA 4DSEA 3ZT3A 3RMDA 4I2IA 3DLRA 3K5LA 2ZJ5A 4E7KA 4E0DA 2KZ3A 5KT2A 1HYZA 4DU4A 4YD2A 2KZMA 4ID1A 5BOMA 3OS1A 4FJ8A 2J6UA 4I2FA 1A76A 3LDSA 3V9XA 4UAYA 4O0IA 2HNYA 4IG3A 3DLEA 1YT3A 4CHOA 2RDIA 2G8FA 4RW7A 3KLHA 5KFOA 3ISCA 1B22A 2E6LA 4HUGA 1SKSA 7ICSA 4CJSA 2HMIA 4QZAA 1ZQCA 4M04A 1J5OA 1CEZA 4YMMA 2IHMA 2YNFA 2BCRA 1T3NA 3G6YA 4PHAA 1BPEA 4RU9A 1CXUA 1RT7A 1WSIA 3AA4A 3KLIA 3SQ1A 3C1YA 3IS9A 4RQ3A 1ZQYA 9ICMA 4LZDA 4FM0A 1U48A 5KFGA 2NRTA 1KLMA 3ASMA 3JYTA 3H8JA 4RW4A 1JIHA 2VA2A 8ICOA 3MEEA 1JL1A 4FBTA 3NAEA 1EX4A 3AVFA 3U6FA 3GILA 4K4IA 4DTPA 3UQ0A 3M8PA 3AVJA 1LWCA 4KLHA 3CFPA 4FLYA 2BGGA 1DGSA 4N76A 2ZTCA 1Q8IA 3KK2A 2FLPA 2A1SA 5CZ1A 2G8KA 2I5JA 3ORYA 3ZD9A 4NM1A 1QSLA 4N56A 1GOBA 3DLKA 4LH5A 3TAFA 4O5CA 1ZBHA 4O5KA 1ZQWA 4EYHB 1RPLA 4CHYA 3RWUA 2PZSA 4KHQA 4E89A 1WCNA 4BGDA 4J2DA 1A77A 2KZZA 4W5QA 2DY4A 4KI6A 4W5NA 3DOLA 4LD0A 1TL3A 8ICWA 5C25A 3V1QA 2VANA 4RQ1A 2M9NA 2R8HA 3HSTB 3RJHA 1WAJA 2D0CA 4EBDA 4TSXA 4KHSA 3T5HA 1ZQUA 3JPNA 5T7BA 1NJXA 4ECYA 4TUSA 4QZIA 2XGPA 1JMSA 1RDAA 3DM2A 4HUEA 4DTOA 5DG7A 2BE2A 2R8JA 3ALYA 3HYFA 1HQEA 2FPLA 1X9MA 3P5JA 4F4KA 4DEZA 3H4DA 4BWMA 3OGUA 3KTQA 9ICOA 4KI4A 3T1AA 4KTWA 3S3MA 2F1HA 4F5PA 4QOZB 2R8GA 4RQ0A 4KLLA 9ICCA 3HW8A 3MR6A 1WSFA 3UXPA 4IR9A 4F91B 5HBMA 2W9CB 3T5LA 5KT5A 1S10A 5KFEA 4QWBA 3QEWA 5KFWA 2FMQA 2PY5A 3PX4A 9ICLA 1NK6A 4CJPA 3AVMA 3KK1A 4RUAA 4DSJA 1Z26A 1RDBA 4E3SA 2HHTA 2PXIA 2YNGA 3ISBA 4B9UA 2E4LA 2JZBA 3VQ5A 2DFEA 3A2FA 4M9NA 1Q9YA 4CHQA 2DFLA 7ICJA 3SYZA 4BXOB 1S0MA 2XY6A 4CF8A 3PW2A 4DL4A 2IS3A 3WNGA 3BQ0A 1C0UA 1BQNA 5J2PA 4KITB 1J53A 1ZQFA 1Z00B 1VSKA 2G8VA 4O55A 4W5TA 8ICGA 5EWFA 4YR3A 4PHDA 3N4MB 1NK0A 3CYMA 5KFIA 4CFAA 3UQ2A 4CJWA 3TAGA 1BPBA 4QWCA 1ZBIA 2FMSA 1K1QA 1UA1A 4YD1A 2VG6A 3VQ6A 2Z1IA 4CCHA 2P66A 4NXZA 4ED8A 3E2EA 4Q8FA 5J2GA 3LDAA 4NM2A 4TUPA 1CZ9A 7ICEA 4Q44A 2KFZA 5DBAA 3O4QA 4KHYA 1LWEA 4QWAA 4M6WA 3P1GA 4GC7A 3VA0A 3MR2A 9ICJA 4DSIA 5KFJA 3ZCMA 3V6DA 3Q8MA 4RPXA 4FJHA 3SZ2A 3K2PA 3V1OA 2HB5A 1KVCA 3NGIA 1JLFA 4CGHA 3TAQA 3L2VA 2BDPA 1ZYQA 3SV3A 1RT3A 5J0UA 1WSHA 3QZ7A 2Q3SA 4CJ3A 1QTMA 9ICXA 3AVIA 3G6VA 4PHEA 4H4OA 2J6TA 4E7IA 1EETA 1RDCA 1WLJA 7ICRA 4P2HA 3KD5E 5HRPA 1KVBA 7ICLA 1QS4A 3QEXA 1N6QA 1XWLA 1SKRA 2D5RA 2FMPA 5KFHA 1BVSA 4FK2A 4WE1A 3SNNA 4MEYA 2WOMA 1VRUA 1Z25A 1TK5A 4OLAA 4ECXA 8ICZA 4KPYA 4KHUA 1KRPA 2ZUCA 3SI6A 5DDYA 1TVAA 1VSMA 1RXVA 4CK1A 7ICHA 1WN7A 4FZXC 4HTUA 4B9TA 5DB6A 1UT5A 1KSPA 3KD1E 1WCLA 2P5OA 5KFTA 1RZTA 1ZQXA 1RTHA 1C1CA 3KHGA 3D45A 3JPTA 1EP4A 1MQ3A 9ICAA 3SUOA 8ICVA 5J0OA 4M9HA 4P4OA 2IGIA 4RT3A 4RNNA 3MABA 4UAZA 1BIZA 4RW9A 4ECZA 4UB5A 4JRQA 1T7PA 4GC6A 3VQBA 4PWDA 2JEIA 4CESA 3AUOA 4LSNA 3RH6A 1FKPA 4OGEA 1L3UA 5DQIA 3OVNA 9ICHA 4QZ9A 4CJQA 4RQ2A 4EBEA 4RPZA 4CGIA 1X1PA 2DTUA 2XY8A 4FJNA 4FM2A 1ZQRA 2W8LA 2RPIA 3RJEA 3RAQA 4XRHA 3TAMA 1KFDA 4M2YA 3GV8B 3Q8PB 3QE9Y 1ZJNA 4DFJA 3AVNA 1KVAA 2UVRA 4QZFA 3ITHA 4CJTA 2X74A 4CJRA 9ICGA 3MXMA 3LANA 1NK9A 2NUBA 1BI4A 3RRHA 4QZBA 3N97B 4JV1A 3SUNA 5HHIA 3QIPA 4KB0A 4RW8A 4UB1A 3MFIA 1VSDA 3HL8A 1EXQA 1JLAA 3IRXA 4EEYA 3K5NA 5CB1A 2OPRA 4IBNA 9ICWA 1HUZA 4R5PA 1L5UA 3PR4A 3AO4A 1ZQBA 1IKWA 4H8KA 3BQTA 2OWOA 3WNEA 4OPJA 4K8ZA 1O1WA 4B9LA 4DOAA 8ICAA 3PUFA 8ICQA 4OPKA 1TFRA 4FM1A 3AVCA 2C2EA 3VQ7A 5JUMA 1TV9A 3VQ8A 1LW0A 4Z4HA 3NF9A 4RQ7A 4Z6CA 1LV5A 3FFIA 1ZQSA 4CFDA 7ICNA 3C6TA 9ICEA 4NLKA 4R64A 4KN4A 4CF2A 1ZQZA 4NCGA 3CQ8A 4BDPA 2UVVA 2NRVA 3L8BA 4F93B 4Z6EA 1X9SA 2QXFA 4PQUA 1RT6A 4JUZA 2JZBB 9ICTA 4FW1A 3D0PA 4DTXA 4KB1A 4J9LA 2IMWP 4IQTA 4FJXA 4FBUA 4O0JA 1DLOA 4W5OA 4KKOA 1UT8A 4KLTA 3AA3A 1ASUA 4CHNA 2BPFA 5KG0A 1XSNA 3ZT0A 5L1KA 1U04A 1LWFA 3RMCA 4ED1A 1BGXT 3RMBA 4QW8A 5DMRA 3JPPA 1U4BA 2EX3A 4Z4IA 3NF7A 5HNKA 3OHBA 3C1ZA 8ICYA 4KTZA 1ZETA 2JEGA 5KGWA 2ATQA 1LAVA 5FDLA 4N47A 4FJ9A 1GOAA 4CGFA 4IQVA 3HK2A 3V6HA 4IQUA 4FJ7A 2W42A 3O3FA 1NOYA 3L2QA 3DRSA 2PFNA 4QZEA 3V4IA 2HNZA 4GXJA 3SPZA 2NRZA 4I2JA 2ZJAA 3EPGA 3IM1A 1SL0A 4CJKA 3HVRA 5DQHA 3ZSRA 3TFRA 2B21A 4DTSA 4UBBA 2FBTA 5HP4A 1A5VA 1TL1A 3ZSZA 4E7LA 5KFUA 1TK0A 3SQ4A 4Q45A 3DRPA 5D46A 1ZQHA 4O5EA 3KLEA 7ICPA 3HVTA 3LP0A 2P6RA 5CWRA 3MR5A 3B6PA 1TKTA 5KGXA 5J2FA 3QIOA 3QERA 3CG7A 2QKKA 4QW9A 4OKEA 4ED0A 4B9VA 4RQ4A 3ZSWA 1JN3A 3GIMA 3LWMA 3VA3A 2ZJ8A 3ULDA 3L3UA 3MR3A 1TGOA 5DBCA 2GWSA 2AGPA 3GIKA 3ZD8A 8ICFA 4CEBA 8ICNA 3OHAA 2W9BA 3O3GA 4GXKA 3HT3A 4QCLA 1Z3EB 3ZDBA 1QSYA 1XSPA 3S9HA 5DB8A 3QZ8A 3PV8A 5J2AA 1G15A 1HYVA 1JXBA 4QZ8A 2X78A 3QO9A 5DG9A 4BDZA 3PVXA 4DTNA 4JWMA 2J6SA 4FLUA 2C28A 3L3VA 2ALZA 2JEFA 3OYJA 1XS9D 1YTAA 3Q8SB 3ZSQA 1T4GA 4JS5A 2ZUBA 3B0XA 4B3OA 1FXXA 3AO1A 9ICVA 4C8NA 4OKJA 2MUTA 3LAMA 3U3GA 3H8WA 1SL2A 4IR1A 3DMJA 3VQQA 1YVUA 1L3VA 4DL3A 1WSEA 4ELVA 1NJZA 1U47A 3VQCA 4FK0A 2Z1JA 3ZT2A 4F5OA 4YXJA 3C95A 4DTUA 2DPIA 4BACA 1U45A 4PHPA 5DKWA 4RQ5A 1D9FA 4CEEA 2G8HA 2AJQA 1IG9A 4C8OA 1EXNA 4CIGA 9ICKA 9ICIA 2W8KA 2F1JA 4IQWA 3K5MA 3TI0A 2B6AA 2DFFA 4J9SA 4CEFA 3ISNC 4C8MA 2WTFA 2W9CA 4Q8EA 1T8EA 4M3RA 3H8SA 4Z6FA 3G10A 1K1SA 1AROP 1NKBA 1SZPA 4MF8A 9ICNA 3PO5A 4PA1A 3PW5A 4CE9A 5HMLA 4JK1A 3SJJA 1FKOA 4JWNA 4R8UB 3PW4A 2GUIA 4RZRA 2EHGA 3VN5A 2KFNA 8ICLA 1NJYA 3O3HA 2LYHA 4KLUA 3HP9A 4J9QA 4Z4GA 1ITGA 2DPJA 4FS2A 3AVBA 4DFKA 4P4PA 3F9KA 4FO6A 3OYGA 3I8DA 4I2AA 5CYQA 4Q43A 4YN4A 3MGIA 3ZT4A 2B5JA 8ICCA 4BWJA 5KTQA 3C21A 3EYZA 1S9FA 3MXJA 5CY4A 5SWMA 3LP1A 1HNIA 8ICEA 1IKVA 3CM5A 3EZ5A 4M42A 2PYJA 4FS1A 1W9HA 4EP5A 4QAGA 1NJWA 1BPYA 4I2GA 3HJFA 4F5QA 4CJFA 4F4XA 5J0YA 4G1QA 5J2DA 3THVA 1ZQTA 5L1IA 3T19A 3OJUA 4I2EA 5KFDA 1UWBA 2R7YA 1KFSA 3JPRA 5CR0A 2A1JB 5KI6A 2BANA 4IKFA 4E1NA 1ZBLA 3G0ZA 1Q9XA 4DQQA 3ISDA 3NFAA 7ICQA 4DSLA 2WONA 3TABA 4HYKA 3SPYA 4DL6A 5L1JA 5C5JA 3HXMA 4FLZA 3AU2A 1B92A 3AO5A 4FXDA 3UXNA 3TR8A 4OKKA 2Y1JA 4NLGA 4DF4A 3V7JA 5J0RA 1S77D 4JV2A 4GW6A 1N56A 4ECRA 4O4GA 2ZTDA 9ICRA 1DTQA 2P5GA 3NBPA 4QZDA 5CJ7A 2Z1GA 2ZQBA 1KFTA 4CJEA 4CF9A 4FW2A 3VQAA 3ZDAA 2NRXA 1BQMA 4J2AA 2YKNA 1ZBFA 3MDCA 5KFNA 5KT6A 7ICKA 3FYHA 4B8CA 2C2RA 1ZQNA 3PY8A 1KEJA 2X6NA 4CEDA 4DOBA 5KT4A 4EZ6A 4KLMA 3OYKA 3NGYA 1J9AA 4Z4FA 2XHBA 5C24A 5FRNA 2ATLA 4CJUA 4TURA 5DBBA 4F5RA 4CFBA 4B9MA 3MECA 4ECVA 2HHVA 4FJKA 1QQCA 4IG0A 3H4BA 1ZQOA 3H7IA 3C2LA 3RB6A 4FLTA 2FLNA 5IILA 2IA6A 4M9LA 3EW9A 4X5VA 3OYCA 4AILC 3RBEA 3RB0A 4M3WA 4YQWA 3VQEA 1BIUA 4OVLA 2G8WA 5KG1A 3QEVA 3LPUA 8ICTA 5HRNA 4MEXA 3OSNA 4I2PA 4M47A 3WNFA 5KFXA 4NYFA 4K4HA 2O4IA 3OYDA 3IG1A 3Q8LA 1XHZA 2IAJA 4C8LA 3E01A 1L3TA 4DL5A 4CF1A 1LB2B 4DWIA 2BHNA 4K4GA 4BXOA 2ITGA 2OPPA 4YFUA 5KFLA 3OYNA 5HP1A 3KKSA 4HVJA 1B43A 2F8TA 5EWGA 2ZTEA 4I27A 1RT4A 2NRWA 3K5OA 4HUFA 3S3OA 4I7FA 3ZDEA 1QSSA 1ASVA 3LP3A 4UB3A 5J0SA 4ZHRA 5I3UA 4NY8A 1D8YA 5KFSA 9ICUA 4KLIA 2AU0A 3FDSA 4O3QA 3OYLA 1RBSA 1ZQLA 1X2IA 2JGUA 2F8SA 2XY5A 1I39A 3V9WA 1KDHA 1CZBA 1NK4A 4PGXA 3H08A 1YTUA 4CEOA 3TAEA 4UAWA 2KTQA 1ZJMA 4KAZA 1TKXA 4CJLA 3PO4A 4O3RA 1DTTA 2BCVA 8ICXA 3RB3A 4KHWA 1RT5A 2FC0A 4QZHA 1NOMA 1QE1A 4H4MA 5KFCA 2O4GA 1RT2A 1C0TA 3AV9A 4DTRA 1S1XA 4YNQA 3IAYA 4I9LA 1I3AA 4Z0UA 1ZQMA 4CERA 2FPKA 1VSJA 1IKYA 4CGDA 3V81A 4FJJA 4KLSA 4DO9A 4NLZA 5J2CA 3GIJA 2B4JA 5KT3A 4YR0A 5J2IA 5EOZA 1ZQAA 4LZGA 5KFZA 1WSGA 1SV5A 4MF2A 3NDKA 3MDAA 2FLLA 2R8KA 4F2SA 4FYDA 1IO2A 4KLJA 1ZQEA 4FZZA 4ECTA 3LALA 4CJ5A 4ICLA 1UA0A 4ED7A 5J2MA 4PPXA 3AVGA 4CECA 5J0WA 3V9SA 3DLGA 2BR0A 4DMNA 4M9JA 3GV7B 2RKIA 2BGWA 4KMUA 3OS0A 4RQ8A 3TANA 4OGCA 4DS5A 4KFBA 7ICVA 2ISPA 4LH4A 1ZBUA 2HVIA 1BCOA 2ETJA 1MQ2A 4DLEA 4EP4A 4MFAA 1XSLA 1RCHA 8ICPA 3M9MB 3OYAA 3P83D 1IH7A 3L2WA 3C6UA 5C42A 1TKZA 4F92B 3RJIA 5KFBA 4XA5A 5BPCA 5EWEA 3CFRA 5DB7A 3M9OB 4NYNA 1JLGA 2XGQA 5DLGA 4M45A 5CHGA 4DQIA 4FLVA 2RF2A 3PNCA 1BISA 4CIFA 3RR8A 1IXRA 3QNNA 1B9FA 4KLGA 4KLEA 5KFQA 3RAXA 4YG2A 4QZGA 4I2QA 2XY7A 3IHQB 5J0QA 2A1JA 4TQRA 2PFOA 4J9KA 5KRSA 3T5KA 4QZCA 1U49A 3T5JA 4RQ6A 4N41A 4LY7A 3OS2A 1RBTA 4FVMA 4BE2A 4QWEA 2P6UA 3ETLA 4B8AB 3QESA 8ICMA 4MQ3A 5SZTA 1RBRA 2YHBA 1KTQA 1RNHA 3K58A 3SCXA 3H40A 1NK7A 1F21A 4K8XA 1TVRA 3C23A 3K57A 1MU2A 1K6YA 3AVKA 4O3NA 2VG5A 4ECUA 2YNHA 3S3NA 1JXEA 4GXIA 1CUKA 3F73A 4O5BA 3ZSYA 2XC9A 4GMJB 1S9EA 4DQPA 2VG7A 4M41A 3PX6A 1NK5A 3OYIA 3RH4A 5TZVA 4ZTJA 4CGGA 5KG5A 4L8RB 5L1LA 4AHUA 1C1AA 5DQGA 1ZQQA 8ICSA 3NGZA 4YP3A 4CF0A 3OY9A 4CGJA 4ECQA 1Y97A 4R66A 2VA3A 1C6VA 2IOCA 3C2MA 2C22A 3Q8RB 3V9ZA 4TQSA 4DU3A 2ASJA 2C2DA 2F1IA 4YMOA 2FBXA 4KREA 3LWLA 1Z00A 3V6JA 4AH9A 4R8UA 8ICJA 4YXMA 1HYSA 1CLQA 5CYMA 1LW2A 4O3PA 5D3GA 3DRRA 2MAXA 3MGHA 1SL1A 3VQDA 3OYBA 4CHZA 2ASDA 3NE6A 3QEBZ 4NCAA 2KW4A 3KHLA 3NH1A 1WSJA 1HUOA 4OJRA 4HCCA 1QHTA 4UB4A 4F50A 3AO2A 4F5NA 1JLEA 4DFMA 2GBZA 4I9QA 1LAWA 5IIKA 5KT7A 2E6MA 4KV8A 2PI4A 4AHSA 1COOA 3LK9A 1VSEA 1ZQPA 2HHQA 2AQ4A 4I2CA 4YCXA 1C7YA 4HHTA 4I2BA 3V7LA 7ICMA 4J9PA 1JX4A 3TARA 2PI5A 3QEPA 1RBUA 2R8IA 5JS2A 2HHXA 3JPQA 4CJ4A 4M3TA 3VQPA 4O3OA 4JLHA 2W9AA 1H38A 4Q5VA 4AHCA 7ICFA 4C8KA 1PZNA 3SI8A 3AVHA 5KFRA 4CEZA 3HX0A 3NHGA 1FK9A 3KHRA 3M8SA 2YV0X 4W5RA 2BPCA 2OZMA 2GV9A 4ELUA 2XCPA 4FLWA 2FBVA 2AGQA 3CFOA 3TAPA 3PW7A 1TK8A 3RJFA 5CA7A 3AVAA 3GIIA 1KLNA 4IFYA 4RW6A 2D0AA 4F4YA 1S1WA 4KLQA 3NF6A 3PW0A 4E7HA 5FRMA 4F4ZA 3G6XA 4DSFA 1RBVA 2BCSA 5K14A 4KN7A 4CIEA 4Z6DA 3RJKA 5HHHA 4LVSA 5D49A 4CHPA 1A5XA 1N5YA 1R0AA 4GLXA 4DTJA 2W9MA 9ICBA 1SUQA 4JV0A 3RRGA 4KO0A 2BPGA 2OPQA 4YVZA 4IRKA 9ICQA 4DLGA 3OYEA 3QLHA 3UXOA 8ICHA 4MFBA 1BHLA 4DQRA 4ELTA 4M3XA 3KHHA 4XQ8A 3QNOA 2YHAA 3SUPA 3OYHA 3HPGA 5HLFA 4N5SA 3C94A 4DL7A 2JEJA 4MFCA 5CZ2A 3BDPA 1JKHA 4PUOA 1RXWA 4O44A 1NKEA 3ZT1A 8ICBA 2Q0ZX 5F9NA 1V9PA 3RJJA 5IIIA 5IIOA 2FBYA 3ZDDA 3V6KA 5J2BA 3QEAZ 3QETA 5JS1A 2VWJA 4E1MA 3V1RA 1IKXA 5KG2A 4FJIA 2F96A 4LSLA 1HJPA 2PYLA 4R63A 3AA2A 4AHVA 3LPTA 3NF8A 4QWDA 5F9LA 3TQ1A 4DTMA 1C0MA 4DL2A 5DB9A 4O9MA 5CP2A 1JL2A 4XUSA 1ASWA 7ICTA 3TWHA 4EYIB 1D5AA 5D4BA 5DLFA 1RTIA 1BL3A 3EPIA 2BCQA 2I1QA 2RDJA 5IIJA 4F4WA 3KJVA 3JSMA 2G8IA 4FJ5A 1GOCA 4FK4A 3NH0A 3DLBA 5IINA 1CXQA 8ICKA 1VSLA 2OPSA 4I28A 3ZSXA 3L2RA 1TV6A 5KG7A 4YMNA 3V9UA 4Q0BA 1NOZA 2V9WA 3LZIA 4RG8A 1T05A 4Y1CA 4J9MA 3I0RA 9ICPA 5L9XA 1WAFA 3GQCA 2LSNA 1S97A 3O4NA 1ZQDA 1TAUA 4M3YA 2HHWA 1BI4B 3PMLA 3C5FA 1ZQGA 3LAKA 5HRRA 1BPZA 7ICUA 4J2BA 1S6PA 3K4GA 3RB4A 2FPMA 3OYMA 2UVWA 4ID5A 5DGAA 4RPYA
chains in the Genus database with same CATH superfamily
2GOLA 2CGLA 3I87A 2M8DB 5KFVA 4XDCA 1HPZA 2P9PA 3ZDCA 2VWKA 2V4RA 3RTVA 3ZSVA 4G3IA 2BV3A 3M2VA 2QFIA 2KQ2A 2XM3A 1C2PA 1OUQA 1ZD2P 1S1TA 3WU2U 4EBCA 4FWRA 2DFHA 3ENQA 1ZQJA 4WYLA 3MBYA 1TUGB 1RYRA 1XMQK 5JLHA 9ICSA 3PEHA 2HBLA 5KAIU 2VPWB 4M6WB 3MZIA 3TNVA 5AKYA 3AOBA 3NNAA 3WKAA 3H5YA 2K4HA 4LSLB 3AD7C 1C1CB 1KQSM 5AI5A 2D0PA 5A8WA 1KCFA 2P9UB 4CEAA 3UPQA 1T03A 3M1YA 3I56N 3EWAA 4P0PA 4LF6K 3R1LA 4ED2A 3E9LA 5KFAA 1TKDA 5C2FA 1HNXF 5EU7A 4K4ZA 4DSKA 1Q81O 3TYTA 3CJKA 2A19A 1H73A 3PR5B 3K0SA 3DAWA 3SK3A 1NZPA 3FEXB 3D6JA 1PK3A 3BB5A 3ZLJA 3GZ7A 3JPOA 1JQGA 3QLHB 3AVLA 3O9SA 5AIBA 4AYBD 4IDHA 5D0RA 2MKSA 4KH5A 1EB0A 2JVRA 2CH6A 1M1KT 4FJGA 4KAIA 1HNVA 2D3ZA 2BJEA 4WIQA 3J7YI 1JLCA 3DYAA 3N7RC 5DM6L 2RNEA 2OFGX 3DOMA 3KVGA 2RS2A 4DS4A 1RAJA 2P51A 2W40A 3IRXB 4DX6A 3LA0A 3WK6A 3K5PA 2HSTA 3M6UA 4CWBA 3M6GA 3S6JA 1UJ5A 5CHIA 2NSBA 2J4RA 4NMXA 4YB5A 2HBKA 3AU6A 1Z4OA 3SV4A 3R9LA 4CNQA 2A5XA 4R65A 2JRSA 3PNIA 5HRSA 2KMDA 1IKWB 3G82A 2N3LA 4PY5A 2YMPA 3NY0A 1K44A 4RNMA 5D77A 4P4MA 2VDHA 4HEA9 1LKYB 4M9GA 1S0VA 3RBDA 2ADBA 2XO6A 5J1EB 3H6EA 3MEGB 2OZSA 2G5HB 4OZ2A 1GLLO 2P1JA 4J9NA 1HJRA 4MLHA 3MAQA 2VIXA 4LFCK 1DOQA 4J2EA 3K1RB 5JVGQ 2C1EB 2ZOMA 1RYSA 3U7JA 4I2DA 4P71A 2YB1A 2Y1RI 2ZHBA 3Q8KA 3V7KA 4NCGB 4WFBQ 3RMAA 5E79U 2FJXA 3HM9A 2RQ5A 1VQ6N 3IR6B 3HSJA 3Q8QB 3K7RA 4R0JA 2QTWA 2ZWPA 2VQFK 3MM9A 4ZS6A 4CZGA 3Q8UA 3I0RB 4IRCA 4JI0F 3AH6A 1M1KO 2ODGA 1QQ5A 4M3UA 3H0LB 4UB8U 5HQMA 1HRHA 4Y2QA 4BRLA 3O8MA 4FPAA 4DF8A 1RTJA 1UAXA 4F8RA 1S76D 3ZTSA 1VC5A 3U3YA 5LSLA 1HQUA 4CJVA 2P9KA 2YN4A 1D8LA 5FROA 2DYAA 4ANDA 4OYIA 1RTDA 3OYFA 4IFVA 1NB7A 2E5IA 1U6BA 5GAEP 2D0BA 4PL7A 1Z05A 2KXFA 5IZHA 2ZOFA 1HLWA 3CCJN 2IHR1 4Y2PA 2R7QA 2R3VA 1HWUA 2ZH9A 4DPOA 1E6VA 2JOQA 4RU2A 4DR7F 3WZ0A 3ZETA 2A3VA 4NXMK 3BQ2A 1B4FA 7ICIA 1VQPN 3N01A 4I4BA 2COLA 3JAMU 5KRTA 1HI1A 2UU9K 3QFWA 1N32K 4ZPAA 2IHNA 3LP0B 4OI6A 2QYGA 1P9YA 4EO8A 3ONQA 3BQ1A 3A0HU 2BVZA 2QK9A 3NCIA 4CP5A 2G8UA 4CVNE 1TL1B 2CQ4A 1HNXK 1VQ5S 4PGQA 3RH5A 3HHLB 7ICGA 3KKRA 5F0WA 2A1RA 2N4DA 2DHXA 2LMIA 2W2PP 2VYPA 2ZE2A 2LDYA 4K4VA 1L3SA 5DM7L 2ZH4A 4DUTA 3A12A 2QB0A 2HW3A 2M70A 2WC9A 1S1TB 2Z1HA 3D2EA 4U7CA 1ZQVA 1RWWB 5HANA 3ATVA 4BRKA 5C12A 4K42A 2ZJ5A 1VYAA 3JTPA 4DZ6A 3HD2A 2HNDB 1WF1A 4BROA 1EWRA 4DU4A 2KM8B 5BOMA 2ASOA 2KU7A 3HBTA 3OS1A 3T1YF 1YJRA 4ALZA 4NXNJ 2E66A 1B0VA 4UAYA 3NRWA 4FKXA 2GC8A 2WHEA 4QIFA 3HX9A 3BSAA 4RW7A 2I1RA 5KFOA 4B3OB 4CJSA 5DJBA 4M04A 1FWLA 1J5OA 3VAKA 1S4EA 4B1VA 4RU9A 3CC4N 1KVKA 1WSIA 3KFWX 3OBWA 4F04B 2W43A 2DEJA 1VQOS 3IS9A 4RQ3A 1IKYB 2IFXA 4LZDA 4CT8A 4Y28C 4C0ZA 3OTBA 2GS8A 3ASMA 3JYTA 4RW4A 3E58A 2VA2A 4LBPA 1JL1A 2K4PA 1U8SA 4FBTA 3MPVA 2ZIVA 3CCES 4CTAB 3H7HB 2D3UA 2ALYB 4K4IA 3J81O 4ITSA 2E8AA 2NREA 4M5DA 1BUPA 5A6PA 2NCKL 3RGIA 2PA3A 2ZH1A 3PLAA 1U24A 3BN7A 1DGSA 4FZMA 2K60A 1Q8IA 2EDUA 2G8KA 2I5JA 3ORYA 3PG9A 4NM1A 2RT3A 4OJ1A 4O5CA 1NSKL 3MAHA 3LGMA 5AJ3F 5IM0B 2OHFA 5L8RC 1FVQA 2BEFA 5AQVA 1RPLA 2M7SA 3RWUA 2PZSA 2W2QP 4E89A 4BGDA 2G09A 4ZVFA 2CAJA 2BOAA 4W5QA 4OJHA 2CADA 4W5NA 1HKGA 3KUGA 1HKBA 2VICA 4B3TF 2JFKA 3CNQP 1X4CA 4KHRA 2UUCK 2L5YA 1WHVA 3RJHA 1WAJA 5CA5A 1HBMA 2D0CA 2G2ZA 4TSXA 2HRUA 2VOPA 3UNYA 3OTQA 2P9IA 1E6VB 2ZIUA 5JVHQ 4J91A 4ECYA 4TUSA 4DTOA 2XG8A 3T79A 2BE2A 3NVVA 3CMAS 1ZM3A 2YY6A 2N82B 3BH6B 4EWTA 2C3UA 5EX0A 2QL5B 3SJHA 2Q1LA 2EFGA 4ZPVR 4DEZA 3H4DA 1FA0A 1I94J 3MHYA 2JC0A 4UZCA 1UVKA 4QOZB 3W2VA 2BUPA 3VTHA 2LQ5A 1PK1A 2NRRA 4PG5A 1QJHA 1R6VA 1WSFA 5HBMA 1OWXA 5KFEA 4QWBA 1X5TA 2VQEK 3M6KA 5KFWA 2FMQA 2WSFC 2KJ9A 2MY7A 2PY5A 4FOEA 3DXMB 2CNNB 2PXIA 1QCKA 3ISBA 4B9UA 4NPOA 2E4LA 1WWVA 3HSGA 3VQ5A 3R8EA 2BBEA 3A2FA 2ZJQL 2V0NA 4CHQA 1H3DA 2DFLA 4QU6A 1S0MA 2E9RX 4N77A 2AKWB 2QA4S 4LR7A 2XY6A 1XNSA 3J7YP 1BQNA 5J2PA 4BVPA 1Z1BA 2KM8C 1BC6A 1HW9A 2G8VA 2GIFA 2ROEA 5BN9A 3TVYA 4YR3A 2DNKA 4PHDA 2K3KA 2LU2A 1SB6A 4X4QA 1QVGM 3CYMA 1ZXIA 2MQNA 3VGKA 4DCOB 1BPBA 2ZHAA 2B43A 3AGRA 4CYUB 1X5OA 2CIMA 1UA1A 4YD1A 2B4VA 2VG6A 4UUWA 3VQ6A 2Z1IA 2Q3PA 3TUJC 4NXZA 4KIAA 3E2EA 4Q8FA 3LDAA 4Q44A 4WTYA 4X4PA 4K4YA 5AK5A 2AW0A 2A10A 1VRUB 3AA9A 1LWEA 1PVRA 5AQWA 1CULA 2C2ZB 2IRUA 3I96A 5C10A 2CXYA 3V6DA 5AT1B 4FJHA 3IDWA 4ZKAA 3K2PA 1KVCA 4LIWA 1JLFA 1JNRB 5BR9A 5KOXA 5ALJA 3TAQA 3L2VA 5AICA 2KD1A 4RW8B 2XMKA 2P9NA 4OZ0A 5DETA 1LOTB 3W3DA 3AJ2A 4DI6A 2XNQA 1F44A 1QTMA 2HMPA 4O44B 2R7XA 4H4OA 2J6TA 3G6ES 1N63A 2R9LA 2BE9B 3GG4A 1FK9B 4B3SK 1FKAF 4P2HA 4DX5A 2CDQA 1LNQA 5HOOA 2UXBF 3I76A 3CJKB 1KVBA 3DI6B 1Q78A 2FZGB 3MMBB 1PJ6A 1YZ7A 9RUBA 5GMEA 1UCNA 2LCWA 4XDDA 3Q2TC 2WVFA 5KFHA 3DOLB 3KXDA 4FK2A 4WE1A 3SNNA 4LF8K 1TK5A 2FGCA 4ZPDA 4DMZA 3BKUA 3SDEA 4KPYA 4KHUA 2HNZB 1KRPA 2ZXHA 1GTEA 2HFNA 2EWHA 4CK1A 7ICHA 1H7WA 4K4WA 2BRLA 4HTUA 4OHWA 4B9TA 5DB6A 3NVMA 2AYEA 4W4MA 1KSPA 1S59A 1RTHA 2YNIB 2BOPA 2MKJA 4ISEA 4JI3F 4OLOA 5J0OA 4AXIA 4M9HA 4EGLA 3R1HA 1KOHA 1RTJB 1HNWJ 5ALXA 3J81j 1UEVA 4QS9A 1T7PA 1A6SA 4GC6A 4PWDA 4R25A 2HKEA 2W24A 4LSNA 3QNWB 4OGEA 1L3UA 3C29A 3F5EA 1N2XA 4RPZA 4CGIA 5D0EA 1X1PA 2OSQA 5AFUA 3H8MA 3UKUA 4FM2A 2M0NA 4FF4A 3MX2A 3ET6B 2W8LA 4XRHA 3TAMA 3GV8B 1G99A 4PAAA 1TUYA 3Q8PB 3FCWA 2V2ZA 3NNHA 5C2GA 4DFJA 4TU9A 4LUBA 4QZFA 2XTJP 2MSNA 2O6KA 2FY8A 2EVZA 1FJGF 2NUBA 3M6WA 5AQPA 3RRHA 4B3MJ 4IO1A 1UFWA 3DEEA 1R0AB 4KHPJ 1DFDA 4EEYA 3W65A 2UXDF 3CRXA 1FD8A 2OPRA 4NWBA 1KAYA 3GOIA 4H5WA 5J2MB 4KH4A 5AKEA 1T11A 1HUZA 3DXBA 4L3NA 4M94A 5HVGA 3PIPQ 1DRZA 3M2RA 4G6VB 1IKWA 3KOAA 2OWOA 4OPJA 3TQEA 4ES2A 1VC6A 2E7VA 2MZSA 1RT6B 4H5NA 1F6TA 3O0FA 3UR0A 4QIGA 3AVCA 1NGEA 3Q2SC 2MHEA 3E01B 1BQMB 2HVZA 1LW0A 1UMJA 1WDDA 3ZO7A 4Z6CA 4Y00A 4AUKA 2YWWA 4YOUA 2MLZA 7ICNA 3C6TA 1X7VA 1XN9A 5ALYA 2NRVA 2DNMA 2HWHA 3OXGA 2K8AA 9ICTA 2CQGA 3HSZA 3P39A 2X1BA 4DTXA 4KB1A 1PBAA 1DKGD 2G5IB 3UQSA 4PZNA 4FJXA 1AQ6A 2GIQA 4CM2A 1DLOA 2G2YA 4W5OA 3PM9A 4ZPWR 4QR0A 2MQOA 3AA3A 1ASUA 3OR1A 1XSNA 3FBEA 2BDUA 2BE7D 3BBFA 2CQCA 3HMJG 1U4BA 3OA9A 4I1TA 1YJNN 3NF7A 1ZH5A 3THYB 5HNKA 3DCAA 8ICYA 2CA9A 1NGDA 1K0TA 5KGWA 4O3MA 5CQGA 4N47A 1DQAA 4CF3A 4M5GA 3V6HA 1H98A 2KHDA 1OY8A 1WUUA 2W42A 4NJ8A 3GJSB 4OX9K 1WI6A 2HNZA 5F3XB 4GXJA 5ALRA 2ZBIA 4ZVTB 3DJCA 1YJ9S 2V4JA 3IM1A 5DQHA 3I6PA 1QHAA 1D09B 4US9A 3TFRA 4IH5A 4DTSA 5HP4A 5D4OA 4A46A 2UUBF 3CMAN 1OQ6A 4BREA 1JLQB 1A5VA 5M2UA 1TK0A 1SQFA 4Z37A 2CGJA 4FPRA 3KYLA 3MMCB 7ICPA 2CQPA 3HVTA 4X84A 1T02A 3BF4A 3C15B 1FHTA 5B8HA 1ATSA 2ASMA 1RFQA 2MA1A 5J2FA 2LA4A 3EGNA 3CCLN 4B3RF 5B0EA 4ED0A 4OKEA 3MCMA 1Q79A 4JYAF 3OFGA 3LWMA 2P9LA 2NXUA 3VA3A 1PKUA 4EELA 4MJKA 3ULDA 1YITN 4A5AA 2GWSA 3MM8A 1JLEB 3US5A 1A7GE 3VAHA 3W2VB 1RBLA 3U9ZA 8ICFA 3FBFA 1EQMA 3ILIA 2GH1A 2DXDA 3OHAA 2QWPA 4LR8A 3I55N 2KV2A 3I0SB 4QCLA 2QJ3A 2DD8S 1VHIA 1SUQB 3VZHA 2YQ3A 3CCLS 2DL0A 1DK3A 4JV5K 3PV8A 1MROB 4C8ZA 2K2PA 3NGRA 1R43A 3KLEB 3D2QA 4LJMA 4JHDB 3F9MA 4NLWA 3PVXA 3J81U 2UZAA 2J6SA 2EXUA 2C28A 3D3CJ 2JEFA 2H3VA 2G0AA 1GLBG 4KJIA 1YRUA 3PCOB 4PZVA 4EFAC 3Q8SB 1WC6A 1T4GA 4JS5A 3B0XA 4B3OA 5JVGL 4U8YA 3K0JA 2OELA 3MR7A 2GEMA 1JXVA 4CZKA 3DMJA 5EX5A 4IOXA 4JKGA 1GQEA 1L3VA 4ELVA 1NJZA 4IOAQ 3VQCA 1N8RO 2CQ0A 1CBKA 2Y3YA 3ZT2A 4H0XB 1NHKL 4F5OA 3MTKA 3AN1A 4CZLA 3MK6A 5IOLA 3IP4B 5DKWA 2VBXA 1T3VA 3PIOL 2WF6A 2B51A 1D9FA 4CEEA 1O08A 1YKWA 4WP8A 1EXNA 3HTVA 5GTIU 4KV8B 1PVQA 2F1JA 3K5MA 3CPEA 2DGVA 3JTOA 3S6EA 4F7VA 2W4PA 1G1XA 5CH7B 3SMPA 4C8MA 1TYQA 2KI2A 4FVCA 1N36K 2BKPA 2A3JA 1T8EA 4M3RA 3O08A 2VFUA 5IWAJ 2DBYA 1WELA 2GQQA 4RR5A 1SZPA 5DS7A 4GRSA 3PO5A 4WK3A 1DZ5A 5AE3A 1FWPA 5HMLA 4C7YA 4BRIA 4AYBC 4C4SA 4JWNA 2DY1A 3AB4B 2GUIA 3WHIA 2LM1A 1TZ0A 2DNZA 3OUYA 3OTCA 3CCSN 2W04A 1N34F 3A8KA 4IUFA 3AEVA 4PPZA 3I8DA 4I2AA 2ZC4A 3NVZA 4YN4A 3MGIA 1IUJA 3OPKA 3QO9B 3QRQA 1S9FA 2HFZA 2B0CA 1UEUA 3D6TB 5AQOA 5KAKA 1BNOA 1NNLA 1IKVA 3CM5A 4M42A 2BKOA 3LP2B 3M5RA 2JZ5A 5BR8K 2GMJA 3IMQJ 4GVLA 2DTJA 3IN5A 2E1EA 1BPYA 3VAFA 2QL7B 4CJFA 4F4XA 2DGZA 4YHHJ 1SJ4P 4QIVA 2DR7A 1YSJA 3ZTPA 1ZQTA 3T19A 3R9KA 5ALPA 5EOYA 2QWRA 4DU8A 4NXMJ 3GFXA 1URNA 3D6HB 3R6GB 1GK8A 1FDBA 2R7YA 3TA2A 2RQKA 5CR0A 2RDDA 2GFFA 2E9TA 3FSXA 4IKFA 4E1NA 3G0ZA 1Q9XA 4CLFA 4FWMA 3FC4A 4I6WA 2QWOA 2FSKA 3TR8A 2F9WA 2P6TA 3TJAA 1J5EF 2UXDJ 1BMQB 3NWGA 3NWRA 9ICRA 3NAIA 3TZXA 3NBPA 2Z1GA 2GGPB 1KEKA 3I55S 4KGZB 4FW2A 3VQAA 3T1HF 3DRSB 3FZBA 1T9VA 1FVSA 4KO0B 5E3CA 1Q7LB 2W7AA 4J2AA 3PSIA 5KFNA 5KT6A 2RU9A 1ULRA 4WK1A 1H6KX 1G3OA 1RDWX 2P9KB 5EE9A 2CGKA 3J7ZO 1EAYC 3QGIA 3L3FX 1HNZJ 4WFNQ 4CEDA 4IO9Q 3NCPA 5KT4A 4EZ6A 2Q36A 4Z4FA 2IDLA 5FRNA 2ATLA 4CDIA 3ZTRA 5FPMA 3W8GA 1EQ0A 2HHVA 4DV4J 3DKDA 4FJKA 2A1BA 1Y5LB 1QQCA 3H4BA 3C2LA 2FLNA 5IILA 5FPNA 4V19S 4KE5A 4A8YA 4ZPTR 4AILC 1X4BA 2KE7A 4BC7A 4KH0B 3QEVA 4I2PA 3CDBA 4A48A 1YJVA 4K4HA 1RT5B 1PYOB 2IAJA 4C8LA 3E01A 1L3TA 5IV3A 1VQ4S 3DLEB 4CF1A 2JVOA 2FC8A 4WJBA 1YIJN 2XBPA 3KKSA 3GYNA 1REGX 1WSRA 4JMUA 1FTRA 2VFSA 3TTCA 3CDWA 1LK7A 4I27A 3CMEN 3F44A 1OMSA 3IC1A 3ZDEA 3LP3A 4ZN1A 4RNFA 1OPIA 5KFSA 9ICUA 2OPRB 3T1HK 4KLIA 3FDSA 4O3QA 2NYHA 1RBSA 3KWIA 1ZQLA 1X2IA 3MEDB 4HL9A 2VCPA 2IVNA 5JU5A 3F2KA 3P38A 1DLOB 4O23A 4PGXA 3H08A 4M5JA 1YTUA 4CEOA 2KTQA 2P9EA 3MGJA 4KAZA 2OTJS 3J7AN 4CJLA 5AK4A 4O3RA 3MX5A 2BCVA 1VK3A 2UUBJ 4DV3K 4AD6A 4KHWA 1C4AA 4QBUA 1E3MA 4US8A 4H4MA 1RT7B 3SAHA 1NXIA 2O4GA 4YNQA 4CGDA 1T9XA 2LLZA 3V81A 4FJJA 4KLSA 3T69A 5J2CA 1IBLF 3C28A 2HNYB 2DXEA 1SC4B 2QG9B 3ZZYA 5EOZA 4H0YB 1ZQAA 4CH0S 1QTNB 5KFZA 2XS5A 1S99A 1U7LA 4MF2A 4PL1A 2VZ9A 4DPYA 4BG9A 5HL7Q 5DDPC 3WBZA 5EGYA 1NZ8A 4NOHA 1IO2A 5A2QY 2R7WA 2QMWA 3LALA 5FLXY 4LFBF 4PG8A 4ICLA 1MWYA 4ED7A 4RPFA 1SVDA 4KRWA 2QB0B 5BJRA 1VQNN 3F5TA 2BR0A 3MN9A 2LEAA 2A41A 3THWB 3T1YK 1X6JA 4EO6A 2AIRB 4P10A 2YKOA 4PQUB 1PGZA 4USWA 2ISPA 4LH4A 1BCOA 5ALWA 2HIYA 4QR2A 5HJXA 4EP4A 1XSLA 4IH7A 4JKBA 2ACYA 2F9TA 3OYAA 1IH7A 3L2WA 2YWGA 3HKWA 4AM7A 4MIAA 1DTQB 5E26A 5C42A 2FF6A 3CQYA 3HHNB 3CCWA 5KFBA 5BPCA 4NYNA 1JLGA 2XGQA 2IVYA 5CHGA 1U09A 1DBDA 3GFHA 3T1YJ 1Q82O 5KFQA 2G1HA 2F63A 4PG7A 1ZTWA 2XY7A 5AM0A 5D6GA 4DQ8A 5J0QA 3P5BP 5LT5A 2AD9A 5B0DA 3H2VE 3U1LA 3IRWP 3D2WA 3CCUS 1OY9A 1IQZA 2RRNA 3NMRA 2QARA 3JXOA 2GX8A 1RBTA 2WFBA 4BE2A 4QWEA 3DLLQ 4YOTA 4B8AB 3QESA 3N5BA 4JKEA 1PVPA 1UW4A 1RNHA 3C66A 1F21A 3MN6A 3QNMA 4NLXA 3K57A 1MU2A 2ZDOA 1B99A 4C7ZA 3MMVA 1KW4A 3L4QA 2VG6B 5DM7Q 3IR7B 2IM2A 3VQSA 3PSTA 2G07A 2QRRA 2CZ4A 4M41A 3THPA 3D6RA 3HFVA 3C15A 4CBXA 4AHUA 2MZTA 2QL9B 4KGKA 3H0MB 3C16B 1U6ZA 4NLVA 3CPWR 2Y1LB 5K8OA 1Q4RA 1N34J 4ECQA 2HRYA 2Y8WA 2MZ1A 1WKJA 2RIJA 5A8RA 4CBUA 2X51A 5AJ3J 4WJ3B 4I6AA 4TQSA 3ZFVA 1W2BM 2XMVA 2QGFB 5FD1A 1HHTP 3G96A 3V6JA 1CLQA 5CYMA 4HACB 2B3TB 1EWQA 4A8EA 3LOUA 3HF5A 3PJ9A 2GTDA 4JNEA 1SL1A 2CJKA 2K1RA 2OD6A 3NE6A 4NZ6A 4V19J 2FI1A 2ZF5O 1JLGB 3LGHA 2CQ1A 1HUOA 2O8FA 5E84A 2WB1C 6AT1B 2BM1A 1QDUB 2QSWA 2V7YA 1NDPA 1QHTA 1QAXA 4DFMA 1NHUA 2GBZA 1MN9A 4Y2VA 4IL6U 4CLKA 1LAWA 4NLYA 2X3GA 1B0TA 5L1MA 3QWPA 1VSEA 2PKEA 1KQSR 2J8AA 1C7YA 3V7LA 7ICMA 5CYJA 2OAUA 1FFWB 1JX4A 3WK4A 5IFMA 1KXPA 1JI7A 1RAFB 3UCGA 2MLXA 2PI5A 5LMNK 1RU1A 2LQBA 5BYSA 1UCVA 3P49B 2O8EA 3KLVA 3MURP 2HHHF 4JI8K 3FQLA 3CCVS 1RLDA 3W8PA 1GLEG 1ZOLA 7ICFA 4C8KA 3SI8A 4NRTA 2ZIUB 2YV0X 2WW8A 2XMUA 3RW7A 1NLKL 1S72N 2W7OA 2HGMA 2XI2A 1HBMB 1U1PA 3CFOA 1W7WA 5U47A 3VZIA 5HK4A 3FUYA 2DITA 1KLNA 4UASA 3BBBA 2Q79A 5A8WB 4F02A 4HH0A 2WF7A 3NF6A 2F3JA 4ISGA 4GVEA 3LDOA 1UL3A 3L4BC 2VUGA 5HLFB 4WP9A 4P2FA 3G6XA 4DV4F 3OW2R 2YKPA 3TA0A 3L7UA 2OLWA 4AT1B 1IKVB 1WWHA 3AQPA 1A6LA 3GL1A 4QOTA 1R0AA 4DTJA 4JV0A 3ISND 1B0XA 2FGOA 3OYEA 8ICHA 4HR2A 2R2TA 4MFBA 2F7TA 3CCRN 2C42A 4M3XA 3O9QA 5H9EK 4PCQA 2YHAA 3QNOA 2RJZA 1OO0B 1R3NA 4J90A 3OYHA 1ZPVA 4N5SA 4M5MA 2JEJA 4MFCA 4BRMA 3MTJA 1QAIA 5L39A 4CNZA 4PUOA 2IYIA 1NKEA 1JCGA 2Q0ZX 5F9NA 2NZTA 3HKZD 1T94A 2D3DA 3RJJA 3JQMA 1VR6A 1UHUA 4C98A 2H3ZA 3SSRA 4FOIA 2N3OA 5JS1A 2VWJA 4E1MA 3DRYA 1J2VA 1HJPA 2PYLA 3N6NA 2E5LJ 4R63A 3AA2A 5CRXA 3VEZA 4BJQA 2ZNYA 1Y4ZB 4C48A 2YH0A 1GXLA 4WFXA 4BGAA 5DB9A 2FVCA 1JL2A 1IWAA 1KHWA 5AM2A 3I32A 4M95A 1PBUA 3TWHA 4EYIB 1JRPA 4MAKA 1BL3A 2HMXA 3H8YA 3M8ZA 2I1QA 3A1YG 4NL9C 3KJVA 2JGAA 3LP1B 1WHWA 4FJ5A 2FTRA 3CB4A 3NH0A 3EL2A 2WBRA 1BWFO 4I28A 3OFFA 3L2RA 2F8EX 5ETKA 4RKUC 1V4SA 4JBCA 4LF5K 3V9UA 5B08A 2V9WA 5ETNA 3WXLA 4JI5J 4J9MA 3HHKA 3O4NA 1VOMA 3NCQA 1G6BA 3PMLA 2ZZMA 1ZQGA 3LAKA 5HRRA 1BPZA 2H4WB 1PCAA 1S6PA 3OFEA 2RRBA 2EK6A 3OYMA 4ID5A 3SCKE 4F0HA 4I0WA 1QLNA 4ED3A 3VTIA 3CJ3A 5KFPA 4KHNA 5J29A 3VGMA 2KH9A 4U95A 4E7JA 1MSWD 4RTFD 4D3HA 1SXDA 1MA7A 2E8NA 2HVEA 4QQBA 4TUQA 2MSSA 4ZLNA 3BYRA 2OA8A 1PYTA 4DR4J 2ZJQQ 1IM4A 5EHHA 4QJFB 5KG6A 1RQ0A 1X8DA 4JKCA 4B9SA 1ZQKA 1FXDA 5F8MA 2QFJA 1X4EA 3SQ2A 3GV5B 2XIDA 3KZXA 2YH1A 4O5FA 1TTHB 1JLQA 5LMUF 2BW2A 4UB2A 3QBCA 1PAUB 2K06A 2MUTB 4M0AA 9ICFA 5J2EA 4BDYA 1BPXA 5AKJA 5KG4A 3DI6A 2L9WA 1N48A 4CFCA 2JLEA 1XC3A 3AMZA 3TX8A 3MCSA 1FCAA 3QBXA 1SJFA 3CUNA 5J2JA 1RT1A 2ZIXA 2BQRA 3PSFA 3K9JA 5AQTA 4ETZA 3AO3A 2Z4PA 4WXWA 4FE3A 1U2VA 4O8KA 4B08A 3O9UA 2OUGA 1XIQA 5CHCB 2VB6A 1RDDA 2ZIWA 4CZFA 2YNIA 2IC3A 4ZVUB 2BH1A 3VF2A 1YG0A 4RJVA 1XJWB 2XO7A 2WMMA 5J2KA 2HDOA 7AT1B 1DQ9A 3QINA 2W9BB 4E8UA 3OTOK 2I6XA 1S6QA 2ZD1A 1OVYA 1OY6A 3CTRA 5LJ5Y 1Z6RA 2W7PA 1M5HA 2E1RA 4DFPA 5J0XA 3OTOJ 3NH2A 2KFYA 1EQYA 4NLTA 5KL8B 1NGFA 2H5XA 2H9ZA 2CG4A 1Y5IB 1AFIA 5F2RA 2WRMA 3P4IA 1UPHA 2HWTA 4C4WA 1BU6O 2FE9A 3QU2A 3VHQA 1SKWA 1VSFA 3HZEA 4DV5J 2MHNA 3IG8A 1NHVA 3M8QA 1UOCA 5ALHA 2RF2B 2ZDPA 3CULA 4U6PA 4U67Q 1X5PA 1PAEX 2WB1F 3H46O 3RR7A 3HP6A 5HVHA 3R8YA 1Y88A 1TE2A 2YWKA 3R7NB 1XU4A 3IR5B 3DFEA 3KWGA 3D68A 4C3MA 4EZ9A 1RILA 3OT9A 1K8AT 1EP4B 1XHXA 4RNOA 3AAPA 4Z4EA 1S5JA 1XK8A 3G86A 1EKEA 3D0GE 3KKAC 1V38A 4ANCA 2ATCB 3HO1A 4CLYA 3CIPA 1Y0HA 3R9PA 3GPAA 4NLSA 3NGDA 2YCHA 4B3RJ 1VDHA 2QMUB 4JYAJ 3D6FB 1IG6A 2D3OR 4ZOHC 2J9CA 4IFEA 4JI4J 2QWQA 3KIOA 2EFVA 3MCOA 4FCYA 3BJYA 1P6TA 1VBKA 1AUDA 4MIWA 2R2SA 5K9FA 4M3ZA 3T3FA 4Z4CA 1HNVB 4K2XA 2H5IB 2XCAA 1KAXA 3G8SA 4K5SA 4J03A 4ZVSB 4FYWB 4J9RA 2PFPA 1C20A 3I9V9 4CH7A 3BGRA 5AR0A 3UKUB 5J2HA 5ALGA 1YRTA 1IBKF 4JN4A 2XRIA 4NCBA 4PGYA 4F2RA 1NK8A 2OEJA 4YDUA 3KK3A 3VQ4A 3GFZA 3ZSOA 2ZH5A 5H1SQ 1U2FA 3O1BA 4YS2A 4HACA 4CJ7A 3NS6A 1TAQA 4AQYF 1EIYB 4H4MB 2HNDA 2NO4A 4LFCF 5AQGA 3MN7A 2QO3A 2YJFA 5F1XA 2UUAK 5GADU 1WF0A 2W2MP 3BP8A 1MMNA 3QT5A 4X66F 1SB3C 2O1PA 4MFFA 2QTDA 3WQTA 3OD2A 5EX3A 1X9WA 5AM5A 3M6XA 1XC9A 4I7FB 4JI6F 4WYBA 1NGIA 3U8XA 3LF0A 3CC2S 3GWCA 3MOJB 3R2DJ 3EXCX 2ISOA 1J54A 5DGBA 2VODA 1EX8A 4DSEA 1VQ8N 3AY9A 3RMDA 3DLRA 2HBZB 3M8PB 3K5LA 5JICA 1TFYA 1Q82T 4UY85 2LXUA 2KZ3A 5E3AA 2RRDA 5KT2A 1HMVB 4K8RA 4RW4B 8AT1B 3D0HE 4OZJA 3CC4S 4ZCMA 2QE5A 4FJ8A 3ENWA 4KQZA 1A76A 3HM8A 3QT6A 3V9XA 1CPZA 4CNYA 4DR1F 2HNYA 3O2IA 5FPDA 1HQEB 3DLEA 1YT3A 3TVZA 4H4KC 4USIA 2G8FA 3KLHA 3ISCA 1B22A 3W5YA 3DGPA 2EAMA 2HMIA 1CQNA 1ZQCA 1GAOA 2F65A 2YNFA 2D4WA 5ALFA 3CT9A 2DNGA 4J5OA 1HQ2A 1Y5NB 2E8PA 2O8EB 2XSJB 5AK3A 5FPEA 1P8GA 2DGTA 5KFGA 2NRTA 3H8JA 1JIHA 3SCLE 5KQ8A 3ZX0A 3MEEA 2DR6A 3DU6A 3TVKA 3AVFA 5K8PA 3O5BA 5H2FU 3UQ0A 3AVJA 5LY3A 3CFPA 1X42A 1LFWA 4JI5F 2NZCA 4N76A 1IV8A 3KK2A 2FLPA 2ZEJA 2EFPA 2W4DA 2WVDA 5CZ1A 4IDKB 1ZS6A 1GOBA 3M30B 2IIHA 3N28A 4MT1A 5ETMA 5A76A 1ZRNA 4B02A 2E5LK 2KN4A 2PC6A 4KHQA 2QWMA 2PMWA 1HWKA 1A77A 2KZZA 4ZCKA 2YMLA 1M1GA 2ZJRQ 3VETA 2XYGB 3LW5C 2Z8QA 2RE1A 2NLXA 1TL3A 4OFZA 8ICWA 1ZBSA 2E44A 4CO1A 5E33A 2IMOA 2M9NA 2R8HA 5FIIA 1MWQA 4ZCIA 3VCDA 3DLLL 2KT3A 4EX7A 4PUOB 1WG4A 4KHSA 4A8QA 4Y0FA 5T7BA 1RAGB 1F60B 2R7TA 4L73A 2XGPA 2XLJA 1JMSA 1RDAA 4OPHA 2R8JA 2KK0A 2MQ8A 4LT6A 2OCEA 3NCRA 5MLCQ 1X9MA 4F4KA 3BGRB 3OGUA 9ICOA 2NXCA 1WOOA 4KI4A 3T1AA 2M88A 3ZX2A 4F5PA 2R8GA 2HFUA 4KLLA 2APOA 3HW8A 1MU2B 2FHKA 2DHAA 2QV6A 3UXPA 4F91B 2DGQA 1F5BA 2W9CB 3Q24A 2W03A 4BY9C 1S10A 5HN0A 2HS3A 5GAHI 2YNHB 3QEWA 2DO4A 1R6YA 4YHHK 2K7KA 2GV1A 5GAGI 1RTZA 3GCWP 3AARA 3PXGa 1NK6A 4CJPA 3KK1A 1S1UB 3QU5A 4WBFA 1RDBA 1Z26A 4E3SA 3O6WA 2YNGA 3CQXA 2CH5A 1F2HA 3ITHB 5EE0A 4LRFA 4DUYF 2VASA 4W98A 4BXOB 5ADXH 1DXSA 1IJEB 3VGTA 2R2UA 4DCCA 1VQ8S 3WKEA 3W2WB 2KICA 3BQ0A 3OUYB 1P1LA 2H3IA 3VF4A 2RS8A 1Z00B 5AQHA 4O55A 3ZEUB 2I7PA 4W5TA 3UDEA 3P6YC 1TELA 4PG4A 1U0HA 4JP8A 3N4MB 4X4NA 3VEWA 2M8HA 5KFIA 3OHRA 3UQ2A 5LJ3Y 3TAGA 1YJWS 5BYQA 4QWCA 1ZBIA 2DKOB 1UWBB 1FX4A 4J9VA 3HOSA 2F8MA 4CCHA 3KDOA 2C3MA 4ED8A 4LMZA 1HUXA 2GO8A 5DBAA 3O4QA 2XS7A 4NL5A 3B9JA 4QWAA 4AL7A 3KLGB 5AQFA 3QFHA 1WHYA 4F0MA 3MR2A 4DSIA 5KFJA 1HWJA 1S6QB 2LKZA 4OJ5A 4IXCA 1QQOA 3ZXWA 4RPXA 3EDQB 5BREA 3SZ2A 3NGIA 4OZ5A 3ET6A 1V9OA 2WUSA 5AQSA 4EX6A 4CGHA 4QPTA 1J2MA 2VKZG 2V34A 3E51A 1ZYQA 3D2SA 3A4TA 2F8KA 2H5JB 1K8KB 1TKTB 2GO7A 5AIAA 2K3IA 4I6YA 2M5YA 2WBNA 2HOEA 5EE1A 2EKYA 3CF5L 1FO1A 2RE2A 7ICRA 3BS5A 2BMBA 3GFYA 5KL1B 4Y2MA 1QZ6A 4I2QB 3GE1A 1OH8A 1YGYA 1F0MA 5J1NA 1HBOB 4DR3K 3KLHB 5J8YA 4M5KA 4NI2B 4JI1F 2FMPA 2MY8A 1QZ5A 4DJBA 1J6ZA 2AHOB 2WOMA 4L3KA 1VRUA 2HHPA 2IYGA 2KYXA 1GMUA 2XI3A 2GW8A 1VJQA 4DU7A 3UN2A 4A47A 1XNQF 4QZVB 1L7PA 2ZUCA 3SI6A 2LP4A 1RHKB 5DDYA 3TACB 1TVAA 4UATA 1PILA 2M0GB 1WN7A 1B70B 1RHUB 3MM6B 4M5LA 1WCLA 4OYAA 3GDQA 2P5OA 4ENOA 5KFTA 4GKKJ 3KHGA 3D45A 4LF1A 2KHQA 4NLUA 3JPTA 1EP4A 1FXRA 1DARA 1D9AA 1OH7A 4UZBA 1N33F 1HNWK 3FAHA 3B82A 3O1WA 4Z94A 2IGIA 3LVVA 4RT3A 1RM6C 4UAZA 2XMMA 1E4GT 1SWVA 2XLKA 2RB7A 1S22A 4XH4A 2JEIA 4CESA 4TN2A 2MGZA 4AQYJ 1Z1VA 5DQIA 4URGA 4RQ2A 4EBEA 2LHTA 1Q0NA 2HZVA 3K2YA 4FJNA 4Y2SA 1RHQB 1FRJA 3QSYB 2QWNA 2RPIA 2Z7JA 3QATA 1GXUA 4JKFA 1KFDA 4DR5J 5DZ7A 2EEYA 3BH7B 1KVAA 1T3QA 3JS6A 3D6MB 3ITHA 1XO0A 3LDLA 5AKXA 5THWA 4QZBA 1HWLA 1QQMA 1FFUA 5HR6A 3QIPA 1N52B 2YPYA 3MFIA 1VSDA 1EXQA 3DGVA 1JLAA 5D4NA 1C0GA 2CZVC 2ROGA 5A6WA 4IBNA 1S1VB 2W6KA 5F8LA 2VPZB 1FW6A 1WEYA 3TEGA 3AO4A 2GJIA 1WC4A 1HNXJ 4A62A 3O80A 1M5OC 3WNEA 4DR1J 4K8ZA 3M8WA 2Q66A 1RTIB 1LOUA 8ICQA 4URQU 2OMOA 2M4MA 1TFRA 4QIEA 2Z2YB 3CXCR 1M5SA 1JALA 3RU0A 1UW9A 3ATUA 1ZZFA 2CPZA 4DN0A 2LDIA 4Z4HA 3BEXA 3VR1A 3Q86A 4KT0C 1YBTA 2LYVA 2B56A 1JNZB 2YWEA 1NPPA 4P0QA 4CLZA 9ICEA 5KOWA 4BRNA 2OPPB 1TL7B 1BD6A 3FC9A 5HJYA 5FDLB 1G2EA 4QYRA 4F93B 1P7DA 1SZHA 2JZBB 3D0PA 2KIWA 1VMBA 3IWXA 3UWTA 3H98A 4J9LA 2IMWP 2BYCA 4FBUA 1W2BR 3VGLA 4CD3A 1UT8A 4P7TA 4KLTA 4L74A 4E1JA 3L6QA 1FKPB 4MLEA 2BPFA 3C0BA 4ZN3A 3E3XA 5L1KA 1U04A 1BGXT 3GJQB 1NCLA 5DMRA 5ALQA 2ERRA 5F8HA 4DV5K 3CNHA 4DV0K 4Z4IA 1O03A 5MLCV 1VQLS 3IWLA 2RUSA 3MEEB 1RBAA 4C23A 1HNIB 2MKCA 5M1PA 4FJ9A 1ESVA 2DF4B 4IQVA 1YX2A 3HK2A 2X1AA 3CJTA 3MF5A 4FJ7A 1NOYA 3O3FA 3DRSA 2PFNA 4QZEA 3V4IA 5T7LB 2W2NP 5M2PA 2CPYA 2NRZA 1WB9A 2VJ4A 1BWVA 3EPGA 1UFLA 4BC5A 2QLFB 3ZSRA 3MM7A 4FF1A 5B66U 1VQ4N 3L4PA 2A3ZA 3DDKA 4W92B 4X66K 1S5LU 2MZQA 3FVYA 1BUXA 1TL1A 5JRTA 3ZSZA 2L3MA 4KMOB 4E7LA 3AQOA 3SQ4A 3DRPA 5D46A 1ZQHA 2KLAA 3E9OA 2FDNA 1Z2ZA 3LP0A 3C14A 4P2XA 3MR5A 2PO4A 1JJ2R 3OVSA 2BW7A 2EI5A 5GINA 2CFXA 4QW9A 4CF5A 1KTVA 3ZC4A 1JJ2M 3CDAA 2UXBK 2VG5B 3TPQA 3MR3A 1HBUB 3KJVB 3KLFB 3CJBA 3OXLA 4NA3A 2W9BA 4FWOA 4WQ5A 4GXKA 3HT3A 1RCOB 3IFEA 2R4FA 4L72B 3G87A 5DZ6A 3QRPA 5DB8A 4U7BA 3PZPA 1KR4A 3OR1B 1HYVA 3FGVA 3UPFA 4QZ8A 2X78A 3QO9A 4DHVA 1TFWA 4DV1K 4JWMA 2HSEB 1GT8A 4UQTA 5JJBA 4ZPCA 3OYJA 1IQTA 3VEOA 4MN4C 3JQKA 1WEZA 3EUNA 1XS9D 3ZSQA 1S72S 1N4LA 1FXXA 1PSDA 3AO1A 4UOGA 4C8NA 4OKJA 4FYVB 3LAMA 4DX7A 4IR1A 1YVUA 1K8AO 3QB0A 4FK0A 1RKIA 1MN7A 1XMOK 1RWOB 1VBXA 4HHJA 3C95A 4DTUA 4K59A 1XQSC 1W2IA 2EK1A 2D41A 2AJQA 1DTTB 2VJVA 1H72C 1MWMA 3NGSA 3THTA 5D8HB 4CIGA 1K9MO 9ICKA 5FJ4A 5B5EU 2B6AA 4H4KA 3WEEA 4PHTX 4BX9C 3ISNC 1CJKB 2OXOA 4HT7A 4Q8EA 4HI1A 4NB4A 3FE1A 4NLBA 2J8SA 3NVKA 2B5JB 4WYWA 4XPEA 3MMCA 5FP0A 1K1SA 1LXJA 1AROP 5AK6A 4MF8A 2AH5A 2HFOA 3PW5A 1Y3JA 2GAGC 4JK1A 1EKSA 3SJJA 2DNYA 4RQNA 4U67L 5D3GB 4GIBA 1WTFA 4KGXB 4RW6B 3W5XA 4RZRA 3VPZA 2EHGA 8ICLA 3O1LA 3BPDA 1NJYA 2LYHA 4M1KA 4DFDA 3PHTA 4LFAJ 4H0VB 3RZAA 1EKRA 4DR3J 4NL9A 1R31A 4DFKA 1XNQJ 2GZOA 4P4PA 1NEEA 4WZMA 3CO9A 1M5VC 2PAVA 4ZVPB 3MUMP 1HIYA 3D0IE 5CYQA 4Q43A 1Y9OA 4ER8A 4NLQA 3UMGA 3R3LA 5KTQA 3B78A 3C21A 3EYZA 1NWKA 4ZIWA 4IWVA 3MXJA 5CY4A 5M1FA 3FKBA 4CLUA 4OYWA 5I42B 2NYIA 2YQEA 3EZ5A 5CD4H 1N0VC 3GB0A 1N32J 4EP5A 3UKRA 2XNRA 4DUYK 1NJWA 3KG1A 3HJFA 5LMUK 2KG5A 3JSBA 2XS2A 5AQZA 5IC6B 2OANA 3D2EB 3C2PA 5J2DA 2PMZF 4A8MP 5TKYA 2EZXA 2NQPA 1U1OA 3GU0A 1UWBA 4DV7K 3HLUA 5B0AA 3HHEA 3U1MA 2A1JB 1JJHA 3WIVA 1KDNA 3VCBA 3RW6A 2AYGA 4DQQA 3ISDA 3NFAA 1VIOA 7ICQA 5AZJA 4GV9A 5IQQA 2WONA 9ATCB 1UEKA 4HYKA 4EU0A 2KOBA 2VQEF 4B3RK 3HXMA 3HHLA 4OHXA 3R5AA 3UDLA 3AO5A 4LFAK 4OKKA 1DK2A 2UUTA 3TZWA 4Y3CA 4ECRA 1WI8A 4O4GA 2FJAB 2KIVA 1KN6A 4IG0B 2XB2D 3HCXA 4CJEA 4CF9A 4MMOA 3KG4A 1YI2S 3TSQA 1JWWA 1YWXA 4FZNA 2A6OA 3MDCA 2HSZA 5ALIA 4DV6J 3VGUA 4DCJB 4B8CA 1NZAA 3L09A 4QU7A 2R7UA 4A8KA 2FSJA 4U7UK 1ZD5A 4JHDA 1ZQNA 3D1HA 5L9NA 4CZJA 4EMDA 2NSCA 2B9XA 3VEXA 4Z7CA 3NGYA 3VEYA 4A59A 3JB9k 1UVJA 1KVIA 4F5RA 4B9MA 3MECA 2D9PA 3CPWM 2E8OA 4WFNL 4L3QA 4MDAA 2VJUA 1WC0A 4M7YA 4HLBA 3MCAB 2OEHA 3B54A 3EW9A 3L5KA 2ZH7A 2P9LB 3JXUA 3OYCA 2A6AA 3RB0A 4M3WA 4DV2K 1YIJS 4OVLA 1XNRK 2V8DA 2G8WA 5KG1A 3LPUA 2Q0UA 4MEXA 1X31C 3OSNA 4O4GB 5C25B 2O8DB 5AQJA 3WNFA 5AKHA 4YDUC 4NYFA 2L9NA 1OJ4A 2O4IA 3OYDA 4UF4A 3H1QA 3ENOA 3Q8LA 4DV1F 2VWBA 4DL5A 1NPRA 2DT9A 1SQKA 4DWIA 2BHNA 1TL3B 2OPPA 3G71N 4YFUA 1SV4A 4YY3K 4HVJA 1CJVB 2HFSA 3AFGA 4BC2A 5KNIA 1NLVA 4NYPA 5EWGA 2ZTEA 2O3DA 3C6UB 3HJVA 1BA1A 1RT2B 1RT4A 3OXFA 3K5OA 3BF1A 5BPNA 2ZBQA 2LKYA 4I7FA 2IVOA 1ASVA 4UB3A 4ZHRA 1YHQS 1D8YA 5F8IA 4Y0WA 2CKWA 1BXNA 3ZZPA 3UVJA 5AZIB 2AU0A 2P9CA 4X4RA 4ZP7A 3KJFB 4BC9A 2JGUA 2F8SA 4R5PB 2XY5A 3NEKA 1I39A 3V9WA 4PEOA 5DDOC 2D7SA 1RBOB 5KPRA 3EGWB 3TAEA 4WF9L 4UAWA 3KBBA 5GVQA 2EH9A 3WK5A 4I6MB 5AI0A 1DTTA 1AA1B 3CO0P 2QKQA 3U27A 5CABA 2AEFA 1RT5A 2DWQA 1SJ3P 3M8QB 3R7SB 1NOMA 2FC0A 4B3SF 5B09A 5M1NA 4MO5A 1BY9A 1I3AA 4Z0UA 1ZQMA 1NMDA 3D66A 2FPKA 2GJFA 5IT9O 3QUCA 1SXEA 4LSZB 4NLZA 1CQMA 1XMQJ 2G0IA 5KT3A 3SEOA 1IVZA 5J2IA 3ILOA 3ZI4A 1N6QB 3CP8A 3F41A 1WSGA 1SV5A 1IBKJ 5ALSA 2HMIB 3MDAA 3L7PA 1RP5A 4Q2LA 1RK8A 3KOOA 3BSNA 2OEKA 1PC4A 4F2SA 2DR9A 4FYDA 1V5IB 1SKUB 1ZQEA 2ZM6K 4RUHA 1YJ9N 2IA0A 3OVBA 1NJIO 3J7AP 1X9JA 1UA0A 3ZTQA 1NMNA 4ZCLA 4CECA 3GP9A 3SLCA 1WACA 5AKIA 3QMLA 2EW9A 2K4EA 2VKRA 3M2UA 3A3NB 1HNWF 4M9JA 3M8YA 3ULEA 4KMUA 3OS0A 4Y2TA 2SXLA 4RQ8A 3X3UA 1F0XA 4OGCA 4HDGA 2GQ2A 1D0EA 5AM4A 1ZBUA 2HVIA 2HPUA 1MQ2A 2ZZNA 3QGPA 3H5XA 2C2MB 3QJPA 1T9WA 1LVHA 1RHJB 1UWAA 1TKZA 2CVEA 2WF8A 3AM9A 2ILZA 2J7WA 4XA5A 5JTIA 3CFRA 5DB7A 3M9OB 4L75A 2UUAJ 2DQNB 4NX9A 4IEIA 3H20A 2HFVA 2LQ9A 3GONA 4OYPA 1BISA 4DCHA 3RR8A 4NI2A 4A8WA 2DBBA 3V2UC 1BE4A 4B3MF 1EETB 1H2TZ 4OX9F 3RYLA 1U1LA 4GV6A 3NS5A 4YG2A 4QZGA 1GFWB 4I2QA 3VAGA 3IHQB 2NNWA 3BS5B 5CR4A 3MUVP 1RE1B 3EN9A 4YOVA 2A1JA 3EGVA 2RHKA 3WK7A 2PFOA 5KRSA 4QNLA 5AI6A 1U49A 1VQKN 4K7QA 1Y11A 3GCXP 1EO1A 3SMZA 3R6LB 2DKXA 3LQVA 3TJ9A 4YMEA 2JWLA 1TUUA 2HQ3A 2ZM6J 1RBRA 4MQ3A 3K58A 3H40A 4PRFA 2CQHA 2J7KA 2IRXA 1RTDB 3CCMS 2VBWA 4FF3A 4O3NA 1JJ4A 4ECUA 2GQCA 1JXEA 4GXIA 1CUKA 4O5BA 1GLDG 2XC9A 2R18A 1QM9A 1S9EA 3RBXA 3QRRA 1RQLA 3CD5A 3PX6A 1O51A 1ATRA 3OYIA 5F3TA 3A3OB 3RH4A 5TZVA 5AI4A 3SDEB 4C4RA 4ZTJA 1YI2N 2LM4A 5KG5A 3CCQN 2EQYA 3CC7S 1D1UA 4CO2A 4JI4K 2O8FB 1ZQQA 2DRAA 3RJMB 1L7OA 3J8AA 2UUBK 4CO4A 2MRLA 3H2UB 4LFAF 1NRKA 5ETOA 3OY9A 1FD2A 1VQ6S 1QQNA 4ID5B 1Y97A 2D74B 3DWLA 2HQGA 1C6VA 3D7EO 4P74A 4DU3A 2ASJA 2C2DA 4F3QA 2I2YA 2F1IA 4YMOA 2FBXA 4KREA 2FY1A 3LWLA 1Y10A 4YXMA 4FWNA 1TL7A 2NO5A 4H54A 2LXFA 3DRRA 2MMYA 3HI0A 3NLCA 1SH0A 3SCIE 2A2DA 3VQDA 3OYBA 3DMJB 2IY5B 4I6MA 1NM1A 4M5NA 2V94A 3ID6A 3DV9A 5IT4A 3C65A 2G2OA 4UB4A 3NKYA 4PABA 3BY5A 4I9QA 1JLBB 2WW4A 5KT7A 4KV8A 4NZ0A 2PI4A 1LWEB 1VDVA 4OI3A 3QUQA 4I2BA 3PACA 3D67A 2C3PA 3TARA 2F76X 2RRAA 1RBUA 2VQEJ 2OO4A 2GHPA 2HHXA 3JPQA 4CJ4A 3VQPA 4NEZA 3OR2A 3CEDA 3WC2A 1RAAB 4ZOSA 2YX6A 2JH7A 3AXKA 3GG0A 3IAM9 1U1NA 1M0SA 1L8LA 3A5NC 4DV2J 4OX8A 4AHCA 3UMBA 2DHSA 1I94K 2AJ1A 5KFRA 3HX0A 1RT1B 3P31A 3NASA 1S7HA 2H1YA 2OFHX 3M8SA 3AY0A 3ETMA 2DR5A 2OZMA 2VONA 4TYBA 1RXOB 2MKKA 4FLWA 2FZKB 3FLCO 3F2BA 4DR7J 4ETXA 4LRCA 5EXWA 2HF3A 4MK8A 3PW7A 1IBCB 4H5TA 3GIIA 4CZCA 1O13A 2Q4TA 3ILJA 2KT5A 2D0AA 4F4YA 4TYAA 2IVPA 2JXJA 1S1WA 2OD4A 4KLQA 1KD1T 4GVBA 2E3TA 4MK9A 3PW0A 4ZITA 4USVA 5FRMA 3MM8B 5K14A 1RBVA 2BCSA 2ZH3A 3CD0A 2CQIA 1EJ7L 5HHHA 1QVGR 1E6YA 4CHPA 2FD2A 5HBMB 3DXMA 2YXLA 5JMNA 2W9MA 1WNEA 4LVOP 2JJ4D 1SH3A 1B0PA 4ICLB 1U8WA 5T41A 4IRKA 4HT5A 3FZHA 1Y7PA 2VBYA 4DLGA 3EVWA 1F9HA 4X4SA 3Q7CA 2AXTU 3SAGA 1WEXA 3A8JA 2DPNA 2XZDB 5GADP 1VQSA 2CXEA 2B8PA 3KHHA 5D4PA 3MPUB 4DV1J 1Q81T 2FHJD 4XQ8A 2KVIA 3Q0AA 1SQEA 1DHMA 5HATA 1R0BG 3C94A 2P9IB 5CZ2A 4PQAA 3BS7A 4O44A 2FBYA 4F9OA 3ZDDA 4RQMA 3QEAZ 2ZJPQ 1UETA 4DPWA 1FJEB 3VF6A 5T7LA 3FZLA 3QETA 3L4IA 3V1RA 4CF4A 3I5BA 3IAS9 1RZMA 5KG2A 2EFQA 4FJIA 1EZZB 4JI7K 1TMJA 2F40A 4OX6A 4Y2CA 1CS4B 1FJCA 1FRIA 5KPTA 3KJQB 1HKCA 2VPYB 2XWYA 5HAOA 4AHVA 1Q8LA 4MKYA 3NF8A 4O9MA 2F1FA 1Z4UA 5DLFA 3TADC 1LWCB 4P0PB 1SC6A 3EPIA 4ZJLA 5IWAF 2RDJA 4X65F 2EAPA 2Q0RA 1WWUA 4LF7F 3ZZUA 2F3NA 2GVZB 6FDRA 4X4VA 1CXQA 8ICKA 1TP7A 5H9FK 3J80U 1TV6A 3IV6A 5KG7A 1F9EB 2WVBA 5AZIA 3TA1A 4ZLLA 4F3MA 1ZZNA 2WCXA 4YB7A 3LZIA 5J2QB 2P2CB 1NGAA 9ICPA 3GQCA 1XR5A 2LSNA 1S97A 4RWTA 1ZQDA 1TAUA 4K4TA 4C1NK 3M3ZA 6FD1A 4TY9A 3C5FA 1ZD4A 7ICUA 2NV3A 1HNZK 4J2BA 2DISA 1B64A 4ILGB 4IJNA 4BRFA 5GAHP 5A8RB 3N7PD 3W63A 2UVWA 4F36A 5DGAA 3TTFA 1C4CA 3IUCA 4IDKA 3U9DA 1MC8A 4CGZA 3MWPA 1NH8A 4B3TJ 1LKYA 1ROFA 2YX4A 3A0IX 2I9GA 3QMQA 2Y0SC 4JRPA 4CLTA 2O8BB 3LVWA 1IBKK 1OXJA 5HMXA 5AXKA 2WB4A 1SJQA 1IV0A 2QLXA 1S0OA 2P6SA 4C80A 1D9DA 2CPRA 2YNGB 3UE2A 4EI2A 2R7RA 5ALOA 2CN1A 3C2KA 4USAA 3AD9C 3PRBA 4KGMA 4NXMF 2DVIA 4E19A 4MDBA 3SUQA 2NXNA 2PSZA 2KB2A 1S1VA 5DK5A 2GVDB 1YLXA 3HZGA 1YDLA 1CS4A 3VVUA 4KTQA 2BQUA 2AX1A 1HBNA 3CM6A 5LJWA 3CERA 2UUAF 2YNFB 2CPDA 4YR2A 5HI7A 4QS7A 2DKZA 1SI9A 5LM7E 2EANA 3CJ8A 5DDRC 2ZHOA 3CC7N 3A0BU 4OYBA 4DR6K 2XSJA 4TU8A 4KLFA 2IBKA 1TL4A 4WFAQ 5E41A 4EUVA 4IFYB 1YBAA 2HZAA 1KLMB 1UFKA 2A2CA 3ICXA 2UV8A 3Q8VA 2ZE2B 1QVFR 3C8YA 3S41A 5EVZA 2ILYA 2A18A 2QKBA 1WF2A 3PMNA 1RKJA 3T1HJ 3QU9A 2V9KA 4CM0A 3HSCA 3VQ9A 4DR1K 4AHRA 1CRXA 2Q97A 4W90B 3JPSA 2VHGA 4KR0B 4HCBA 4B9NA 4BR4A 3R5DA 3AQEA 3CJSA 4DG1A 4TXSA 2KP7A 1NGCA 4GVMA 1N61A 3DLJA 4CK2A 5J1EA 4BBYA 3HILA 4DCPB 2YI1A 4XH1A 3X1LB 4A5BA 1FFGB 1S1UA 5C2DA 3OL9A 1XUPO 3KLFA 3EY1A 2CJQA 5A8KA 4X62F 1RWXB 2YKMA 1NPKA 4C97A 4H0TB 1XERA 3LP2A 4L76A 1D4XA 2AYBA 3VERA 2QYCA 3GR1A 5I42A 4A8SA 2O8CA 2O66A 2CQ3A 4H0OA 1BDGA 4H03B 3PX0A 4FJLA 4LF7K 3ZZZA 3M2VB 1R89A 3DYAB 3O3LA 4O3SA 1JLCB 2H3QA 1A5WA 3QT7A 1U9LA 4KLDA 8ICIA 4KBIA 2XWXA 3FZFA 1KS2A 3ID8A 4FJMA 1RDUA 1RA7A 4PKHA 5I3QA 3LZJA 3OR2B 5LXRA 4WU2A 5IIMA 4MYUA 3QU4A 3CD6S 1RDFA 3FSIA 3M1VA 1HI8A 5T14A 2UXCF 5IV4A 1S0NA 3SFGA 8ICRA 2ZJPL 3LL3A 1A0OB 5J2NB 3N4PA 4JS4A 4BE0A 3UE5A 2CNOB 1Z1ZA 3HPHA 3MEGA 2FDRA 2WF5A 3C3LA 1B3TA 1HMVA 2KN7A 1ECWA 2W3RA 1VQPS 5DG8A 4ES3A 1ZC6A 1N62A 4DR2J 4Z7YA 1JLBA 2MJNA 2IJRA 2BQ3A 2HAFA 1BCMA 3DNCA 3L9ZA 2NS1B 4F3OA 3QU7A 3AA5X 3HWTA 5E3QA 1FEEA 3UKRB 1X4FA 3KLIB 3ILLA 3MXIA 5AE1A 4PXCA 2QARB 3N0VA 4PL8A 2M3DA 4ECSA 2OTLN 5BRHA 5C0YA 1H2UX 1B9DA 3WQPA 2F44A 3BGFA 3BR9A 1W0HA 3QSIA 2UYTA 4TKTA 3EX7B 3OBIA 2HHSA 3A8IA 3MFHA 2C2NA 5AQNA 3N79A 1OQ3A 1L7NA 4CK3A 3UD5A 8ICUA 3M8RA 1CSJA 4C6AA 4CEQA 5AXLA 4JD2A 2J5AA 1DGJA 3V72A 4ZTFA 2IOHA 3D54A 1RWPB 1UJ4A 1Z2LA 4UQGA 2AF6A 1VBYA 3L2UA 1ED1A 4F3TA 5AQKA 5HMMA 4XIUA 2RLTA 3IM8A 3TSUA 4ISFA 2AGOA 1ZQ1C 1V97A 3G8QA 4RT2A 3AOCA 2BCUA 3PYFA 4RBUA 3DLGB 1BG3A 4QJVA 4A2AA