1XWLA

Bacillus stearothermophilus (newly identified strain as yet unnamed) dna polymerase fragment
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a thermostable Bacillus DNA polymerase I large fragment at 2.1 A resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Dna replication
molecule keywords DNA POLYMERASE I
total genus 206
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1xwlA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1xwlA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xwlA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xwlA01
4CFAA 4XQ8A 1JLEA 4ZH4A 1X2IA 2P5OA 3K4GA 2FLNA 4CHYA 3VA0A 3MR6A 4FJHA 2I1QA 1NK5A 3LPUA 5CP2A 4PQUA 3OHBA 2BQUA 4Y1CA 2OPRA 3T5LA 4BE1A 5CYQA 4RQ7A 3AVGA 2IOCA 2R8HA 5DGAA 5KG1A 2BCVA 3VQAA 4KTWA 2F1HA 4R66A 1KLMA 2C2RA 4CESA 2XGPA 1CUKA 3AU2A 3AA5X 4OGEA 4YMMA 3AA2A 4TUQA 2G8FA 1JMSA 3L3UA 5L1JA 3Q8RB 3BQ1A 4G1QA 3UIQA 4J9RA 7ICSA 1J54A 2PFNA 4CEAA 4YNQA 4H4MA 4Z4CA 8ICXA 2F1IA 2W8KA 2OPQA 2Z1HA 4MF2A 4K8ZA 5DKWA 4IRKA 2DPIA 7ICHA 1VSKA 5DGBA 2QKBA 1QE1A 4GXJA 2BCRA 3U6FA 3HO1A 3Q8LA 1UWBA 4KHNA 3RAQA 1MQ3A 3AO5A 2FPMA 1BIUA 4IFVA 1HQEA 3K5LA 4AHVA 3SPZA 4CF2A 2HNZA 4CGDA 1WAJA 5CY4A 5KFTA 4F4WA 4EYIB 4F3TA 4FVMA 4KLSA 7ICQA 4AH9A 4I2DA 4FZXC 5CZ2A 5K14A 3S3MA 8ICPA 9ICLA 5KGWA 2X78A 4ZTFA 4K8XA 1QHTA 9ICTA 3V4IA 4QZHA 1BPZA 1HQUA 3QO9A 4F4YA 4RQ2A 1NK7A 3KHRA 1VRUA 3UQ0A 2ZTCA 3NGDA 4W5TA 4Z4EA 1HMVA 2AGOA 3ZT3A 1D9FA 8ICMA 3KD5E 2XRIA 4MFCA 4PGXA 3AO4A 1N5YA 4M3ZA 4FJNA 4I27A 2D0CA 3EY1A 4I2JA 4YD2A 5DMRA 5IIKA 3VQ8A 2ASJA 4M3RA 4F4XA 1NJYA 2GBZA 3PMNA 1H38A 1HRHA 1RTHA 1JLBA 3ZDDA 1U45A 5KG6A 1MSWD 2ATLA 3KKRA 2YKNA 3DRPA 1QSLA 1ZQEA 2O4GA 1TL3A 3VQBA 4O5BA 3FFIA 1C6VA 4IBNA 4ECVA 4DTJA 3EYZA 3NF9A 3V72A 2WOMA 3AVJA 3TFSA 3L3VA 3VA3A 1TKXA 2NRZA 4ECWA 9ICWA 4CGGA 3MFHA 1NKEA 4B9VA 4LVSA 3HT3A 3UXPA 4JS5A 1XI1A 5KFCA 2FMQA 4ED2A 4ECSA 4KLJA 4M3TA 5KFQA 3NGYA 3C2LA 3QLHA 1TK8A 3TAMA 4HTUA 3LP0A 4I2FA 4BDPA 4CERA 3BGRA 2W9BA 5BOMA 3NH1A 3HXMA 4CHPA 4M6WA 4F5PA 3NF6A 4F93B 3LWLA 4CHQA 4Q44A 1L3UA 3IHQB 1BL3A 9ICAA 3AA3A 1RDAA 3ISBA 1UOCA 3TAPA 2WONA 3GIKA 4ECXA 4FLVA 8ICHA 9ICEA 3AVFA 1XWLA 3ALYA 4QZ9A 3RB3A 2ZJ5A 4YXJA 3V9UA 3D0PA 3VQ6A 1RTJA 3JYTA 2C22A 2BQRA 3SUOA 4DFPA 1BCOA 3M8QA 1YTAA 2VANA 5CHGA 1ZQWA 1RBTA 1WCNA 2ZUBA 1KVBA 4RNNA 1D8LA 4DTXA 2ETJA 3KD1E 3PO4A 1MC8A 3ZSZA 4Z6FA 4L8RB 4C8NA 1N48A 1VSLA 4TQRA 4LD0A 1ASWA 4FJIA 3FYHA 3ISCA 3WNEA 2O4IA 1CLQA 3NBPA 2GUIA 4F5OA 2VA2A 3VQ9A 4EBDA 1S0VA 3MGIA 3TAFA 3RJFA 4B9TA 3L2QA 1NK9A 5KFSA 5KTQA 2PXIA 5DBBA 2XY5A 5E41A 1KFDA 4EBEA 4BWJA 3QEBZ 2GV9A 4AHCA 4P4MA 4Z4IA 5KG2A 3C21A 1ZQOA 2DFFA 4FJ8A 3GIIA 8ICUA 2BCQA 1T7PA 4J2DA 4OJRA 5KFBA 3RRHA 3PV8A 3E01A 5EOZA 1LV5A 1C1BA 4PHAA 3C5FA 7ICKA 4CIFA 4KLDA 1A77A 3QIPA 1QTMA 1S1XA 1Y88A 1HJPA 3C23A 3RJEA 4YCXA 4XA5A 4AHRA 1HNVA 1VSJA 1FKPA 4NCAA 3A2FA 4DTOA 4FS2A 8ICSA 3I8DA 8ICTA 5KFAA 4FZYA 2JEJA 1LW2A 3H8SA 4J2AA 4FJ5A 4I2BA 5BOLA 4RW9A 5KFMA 4PWDA 9ICHA 3HW8A 2FMPA 2J6UA 3LZJA 4CGIA 3KIOA 1YVUA 2BANA 3Q8PB 2H5XA 1K6YA 3RH4A 3U3GA 3ZDEA 4J9MA 2RDIA 2VWJA 4DSIA 3S3OA 4YFUA 1ZBUA 4CK2A 1L3SA 2IAJA 4QZEA 5J29A 4F5RA 2C28A 3V9ZA 3GV7B 1RT5A 1Z26A 4J9NA 2R8JA 3Q8QB 2ZQBA 2W9MA 4I2GA 4RNMA 1KDHA 4KLEA 5HLFA 4ECQA 4W5NA 5FRMA 4I2AA 1VSFA 4FS1A 2VG7A 1XSLA 3RRGA 3B0XA 3ITHA 3M8PA 1U47A 9ICVA 4CFCA 5FRNA 2KQ2A 4FK4A 2FBXA 4UB1A 3K58A 3KLEA 2HHUA 4BACA 5DQIA 5BPCA 4O4GA 1CXUA 4NCGA 1BI4A 2PFQA 5J0RA 3IG1A 8ICRA 4FM2A 3SQ2A 4CJPA 4KLQA 4YD1A 1S0MA 3KLHA 4KAZA 3OYHA 5KG4A 3LP3A 1CEZA 1DLOA 1TL1A 1IKXA 5KFLA 4O5EA 3SZ2A 3TI0A 9ICJA 3MEGA 3ZD8A 9ICRA 3OJUA 2Z1JA 1LAVA 4LZGA 9ICIA 7ICMA 4LSLA 3VQCA 4DLGA 4HYKA 3CQ8A 4NLNA 3LAKA 3SQ4A 2JZBA 8ICCA 3P83D 4CJSA 3BQ2A 3RH6A 5KI6A 4MFBA 4JV1A 2KFNA 3OYAA 4Z4GA 5DQHA 3JPSA 4GXIA 1IG9A 4M9JA 5KGXA 3RBDA 3KHGA 5HRRA 3SI6A 4YR2A 4I9LA 4K4GA 1Y97A 4KN4A 3JPOA 2RPIA 4DQIA 4KHUA 1BPEA 3V1QA 5FROA 4O5KA 4FLTA 1WSIA 2IHMA 1ZQFA 4FM1A 4YFKA 3OS0A 1BPXA 4N41A 3MR5A 4KLMA 2ITGA 4CF0A 2ZUCA 2BE2A 1AROP 4NYFA 3DRSA 2W9CB 2EX3A 4KLOA 4ED7A 8ICIA 3L2UA 2E6MA 4Q5VA 3IS9A 2IA6A 3VQEA 3F9KA 2B21A 4Y1DA 1EXQA 2ZTEA 1NJZA 4DQRA 4O9MA 1S76D 4PA1A 8ICQA 1UA0A 1LAWA 4W5QA 3OYDA 3OYIA 4ID1A 4DTNA 1YT3A 1T8EA 2Z1GA 3M8RA 1RPLA 4ECTA 1ZQTA 4Z6CA 1FK9A 2HHSA 2VWKA 1RXVA 1ZBFA 4KLTA 1KVCA 4GVMA 2KFZA 4ZHRA 3CFRA 3SPYA 4JWNA 9ICBA 4KHSA 4QZAA 4C8KA 4NCBA 3EZ5A 4YR3A 5L1IA 5D46A 4F92B 4CGJA 2BKEA 3C2MA 4F5QA 1QS4A 5J2FA 5IINA 1ZQCA 2PY5A 3QEPA 3H8JA 3IM1A 3JPTA 1T05A 2BPCA 4AILC 4KPYA 3P5JA 1ZQMA 5CR0A 4ECUA 4CJQA 4RPYA 1CZ9A 3PW5A 4DOCA 2WTFA 3OYKA 1I39A 2UVUA 2BHNA 1SKRA 3S9HA 3ZSYA 2V4RA 9ICXA 1IM4A 2YNFA 4CEQA 1VSEA 3H08A 5DG9A 1B9DA 4PH5A 3B6OA 2ZTDA 3HP9A 3ISNC 5HRSA 4KTQA 2FBTA 4HCBA 4EZ6A 7ICVA 4KLUA 1SKSA 5DLGA 3L2VA 4DOBA 1WNSA 4IG0A 1K1QA 4Q45A 4DFKA 4FO6A 4WE1A 1ZBHA 4OKJA 4CJRA 4FJ9A 3RMCA 2ISPA 4PHEA 3TR8A 3HWTA 4YXMA 4B9MA 4DSJA 4N56A 4BDZA 4LH5A 5J0TA 1LB2B 3V81A 3L2RA 4IRCA 4MFFA 2JGUA 5J2MA 1KFTA 1U4BA 9ICPA 3ZSOA 3EPGA 8ICFA 4K4HA 3VQQA 3TAGA 1IKVA 1B22A 1BVSA 4EEYA 1S9GA 5CB1A 3K5NA 3ZT0A 4EBCA 3RAXA 4F4KA 2FBYA 1UT5A 3MEEA 3F73A 1PZNA 1V9PA 1ZJMA 4UBBA 3K75D 1I3AA 3K2PA 1SZPA 4H4OA 3G6VA 4Q8FA 4J9KA 4CF1A 1T3NA 4ELTA 1TKDA 1JKHA 4XRHA 4IR9A 3BQ0A 3NFAA 2KW4A 4FXDA 3NH0A 9ICNA 5J2EA 1ZQRA 3MR3A 1B9FA 5CA7A 4M9LA 2RF2A 3LAMA 3CFOA 3DMJA 2LSNA 2YKMA 1FXXA 3HYFA 4RNOA 5CYMA 2ZJ8A 4E3SA 3DLGA 3AUOA 1ZETA 5KFUA 5KFJA 2HVIA 4MF8A 3QESA 5KFWA 1WSHA 2R8IA 2D5RA 5KFHA 3AO1A 3VN5A 2M9NA 7ICJA 4RUCA 4CHZA 2HHWA 1BHLA 2UVVA 5J2HA 1X9SA 5J2GA 3RMAA 3BQTA 1RCHA 2XY7A 3AVKA 4W5OA 3LPTA 1TK0A 4RUAA 3L8BA 1RXWA 1ZQLA 3KK2A 1UAXA 3G10A 5HHIA 1FKOA 2XY6A 4CFBA 1DOQA 1LW0A 4KTZA 5DG8A 5T7BA 3RB6A 3AV9A 5JS1A 3V9XA 1KSPA 4DQSA 3FDSA 3NF8A 5KFEA 2GWSA 4ID5A 8ICKA 5JUMA 4E7IA 2A1JB 4QWDA 3H7IA 1EKEA 5C25A 1K1SA 2OZSA 5C24A 2AU0A 4C8OA 1ZJNA 2V9WA 2FLLA 2IDOA 4RU9A 2XCAA 8ICZA 4DL3A 4IKFA 4QZIA 3HK2A 1C0MA 3PO5A 4DTUA 1TK5A 9ICUA 1G15A 4KLHA 4R63A 4O55A 2R7YA 2ASLA 9ICOA 1SL0A 4QZ8A 4LZDA 1RDCA 4NLKA 3KHLA 2X6NA 4DS5A 5DK5A 4G3IA 3OS2A 5KFVA 4N76A 5HROA 4P4PA 3WNHA 4DFJA 1S1VA 8ICBA 3PNCA 3H4DA 3IRXA 4OLBA 1ZQUA 4RT2A 4RPXA 3MABA 3UPQA 7ICLA 4JK1A 2AGQA 1B92A 2YNHA 1NK6A 4P2HA 1QLNA 4UAYA 1SV5A 4OGCA 5J0XA 3AO2A 3MXJA 1RBVA 3AO3A 5DDMA 1RT2A 4ELVA 1NK4A 2IS3A 1KEJA 4E1MA 4KKOA 1DTTA 4CK1A 3B0YA 4DEZA 2E4LA 1D5AA 2VA8A 3DLBA 3SV4A 3BDPA 4GXKA 4I2QA 4YMNA 5KFNA 5J2BA 4HCCA 2PI5A 2KN7A 3S3NA 1S0OA 1C0UA 1O1WA 3SUNA 3DLRA 1ASUA 5J2CA 1RYRA 3SYZA 5KRSA 1C1AA 1RT7A 3AVNA 5F9LA 3TAEA 2MUTA 3AVHA 4H8KA 1JL1A 3HVRA 2HHXA 2W9AA 3NGIA 8ICNA 4MFAA 4NY8A 3GQCA 4FJKA 3RWUA 3SV3A 3GV5B 4KREA 3K5MA 4JS4A 5HMLA 1JXEA 4I2HA 3RB0A 3NGZA 4R5PA 4RZRA 4Z6EA 2PI4A 3N4MB 3C95A 4XIUA 4RQ6A 3DLEA 4RW8A 7ICNA 2ALZA 2YV0X 8ICLA 3T3FA 4BE2A 1Q9YA 4DL2A 1D9DA 2RDJA 4E7KA 5HP4A 1SL2A 3ZDCA 1IKYA 2Y1JA 3MDCA 3PW0A 4Q43A 5HP1A 4O3OA 3T1AA 3SQ1A 3OYMA 3OSNA 3QERA 1L3TA 4CHOA 4IQVA 3AVLA 3OHAA 3HJFA 4J9OA 1WSEA 1WAFA 2XGQA 4KLIA 4HHTA 1XHZA 3WNGA 1JIHA 4KI4A 1RTIA 3E2EA 7ICFA 4CHNA 4UAZA 2JEFA 4QZBA 4KLLA 4M04A 5KFFA 3MGHA 4M9NA 2P5GA 4O44A 3AA4A 5IIJA 4F2SA 3OJSA 1JLFA 4BDYA 1RBUA 5J0YA 3PW4A 3OYCA 5KFXA 1W0HA 3CFPA 1SUQA 3V6KA 1JLQA 3NDKA 3PX4A 2F8SA 2NRWA 4ED3A 1D8YA 2P66A 5FDLA 3CG7A 4CF9A 3QEVA 4TUSA 4GC6A 4FJXA 4FJMA 4RQ5A 4BXOA 5F9NA 9ICFA 3Q8MA 4B8AB 1TV9A 3OGUA 1LWEA 4CGHA 4W5RA 4P4OA 3ZSXA 4M9GA 3QZ7A 4I2PA 4DF4A 4CIEA 3SI8A 9ICKA 5KT2A 4Z4HA 1X9MA 3T5JA 4DF8A 2X6SA 1CXQA 5KT7A 4GMJB 2HHQA 2MAXA 3QETA 8ICAA 5KFIA 1NOMA 8ICJA 1GOAA 4Q0BA 4UBCA 1NJWA 3TANA 3AVAA 3V7LA 4KLGA 3MXIA 3LALA 4FBUA 2HHTA 2HW3A 2NRVA 4E7HA 3OSPA 5J2NA 5I42A 3V1RA 4RW6A 3EPIA 4DLEA 1ZQPA 5J2KA 3AVCA 4DS4A 4J9QA 3C5GA 1JLCA 4J2EA 4PHDA 3QE9Y 1BQNA 3RR8A 1HNIA 3GDXA 4O0IA 4E19A 1C0TA 4QCLA 4CJEA 1ZQXA 2ZUDA 3KKSA 2P51A 1ZQJA 2F8TA 4O0JA 5L1LA 3KK3A 4KI6A 4DO9A 2Z1IA 2XHBA 4MQ3A 4J9SA 3HP6A 3AU6A 2YNIA 2HNDA 1A5WA 5KG5A 1ZQNA 3M9OB 4YG2A 7ICEA 3I0SA 4OVLA 4B08A 2DY4A 4TURA 3RH5A 4ED6A 5J2QA 2P1JA 3OYEA 8ICYA 2G8HA 3V7JA 1U49A 2G8UA 1RBRA 1BPBA 3ETLA 2BPFA 3O3FA 1XHXA 4CECA 1DTQA 1IXRA 3P1GA 5KFZA 2FBVA 2PFOA 4AHUA 2PYJA 4KO0A 5DDYA 1ZQHA 4BGDA 2D0BA 2IMWP 4F50A 2Q0ZX 4RQ0A 4LH4A 1GOBA 2HNYA 2FPKA 4HUGA 1ZYQA 3ZT1A 1CZBA 4FZZA 5KT5A 1TKZA 5HNKA 4I2CA 4QAGA 4J9LA 4ICLA 1Z00A 9ICQA 4CIGA 3EWAA 2XCPA 3MAQA 4DU1A 3K57A 5I3UA 2G8IA 4LSNA 1EX4A 3Q8SB 1NOZA 3T5HA 1XS9D 2JEGA 4PUOA 1WSJA 3KK1A 4DU3A 5CWRA 2EHGA 3BJYA 3UXNA 4B3OA 3NTUA 3G6XA 1LWCA 3OYNA 2NRTA 2JEIA 3HVTA 4RQ4A 4O3SA 4FK0A 1L5UA 1TFRA 3ZD9A 1XC9A 4Z6DA 1UA1A 5KG7A 3C94A 4KHYA 2ASDA 3PR4A 4M0AA 3LANA 2PYLA 2OYQA 1RDBA 5J0SA 3QINA 1ITGA 4QZCA 3CYMA 2I5JA 1WN7A 1ZQVA 2IBKA 3O3HA 5EWGA 1NK0A 3TABA 1VK0A 1S10A 3UQ2A 2G8WA 1GOCA 4OPKA 1NKBA 3GFKB 3K59A 2HVHA 3RMDA 3SUQA 4IR1A 1RBSA 4Z4FA 3V9WA 2OA8A 4BE0A 3PUFA 4ECZA 4FLXA 3C6TA 3KLIA 5KRTA 5KT4A 4YMOA 3NCIA 4DOAA 3KJVA 4UQGA 4E7LA 3VQDA 3EW9A 4GC7A 4DSKA 7ICOA 1B43A 4O3RA 4J9PA 4M3WA 4KLFA 3KLGA 7ICUA 1RYSA 3Q8KA 9ICSA 4JV0A 4KV8A 4FJJA 4CFDA 4O3NA 1WSFA 4ED8A 3VQ4A 3H4BA 3GIMA 3DM2A 4CJVA 1N6QA 4HUEA 2W9CA 1RT1A 3JSMA 2G8VA 4FLZA 1TVRA 1BI4B 4KMUA 4ED0A 4B9NA 2E6LA 3ZSQA 4CJFA 2AJQA 4DL5A 2DFHA 4QW9A 8ICGA 1C1CA 4ED1A 1T4GA 4DTPA 4EP5A 4CK3A 4UB2A 3PW2A 2IC3A 2F1JA 2Y1IA 3OYGA 4KB1A 4LY7A 4X5VA 2OZMA 3RTVA 1WSGA 4OLAA 7ICPA 3MECA 1RNHA 2D0AA 1Q8IA 1IKWA 3MR2A 4NM1A 4M2YA 4KN7A 3V7KA 1U9LA 2DFLA 1S1TA 3O3GA 4GLXA 4OKEA 4FLWA 4QWBA 1IH7A 1QSSA 3RR7A 2ZD1A 3M8SA 1S9EA 2LYHA 2FPLA 3ZSRA 2P6RA 3NAEA 4DTRA 3QNNA 3OYJA 3HSTB 4B9LA 1JXBA 2NRXA 4BXOB 5DBCA 3THVA 1C7YA 3QNOA 5IILA 2HMIA 2KZ3A 1VRTA 4DSLA 4CEDA 4CEEA 5KFKA 1ZBLA 1JXLA 5J0PA 4N47A 2UVWA 4M9HA 7ICRA 4IQWA 1MU2A 4QZFA 4CJ5A 4M42A 4M6WB 4DTMA 2ZJAA 3JPQA 4IG3A 4FJ7A 2IHNA 3T19A 4I28A 4QWAA 4QZGA 4DQPA 2IGIA 4NYNA 3ZCMA 5J1EA 3PX6A 4PGQA 2C2DA 2C2EA 3V1OA 4DG1A 4IRDA 3C6UA 3ZSVA 2BCSA 1ZQSA 2YHAA 4UB5A 4IDKA 4EYHB 5J2PA 3RJHA 1ZQDA 2OWOA 4FCYA 4E7JA 5KT6A 5J0OA 4DQQA 3OVNA 3NH2A 3SUPA 3IAYA 2OPPA 2QKKA 4CJUA 4IQTA 3PVXA 2AGPA 2MUTB 3ZT4A 4JRQA 4UB3A 1ZQZA 2A1JA 5J2DA 5C42A 3DLKA 4RG8A 3NHGA 1KCFA 4M3YA 5DB9A 4UAWA 3QEXA 7ICTA 3WNFA 2J6TA 2G8KA 4F4ZA 3M9NB 1JX4A 1QQCA 3TWHA 3RJGA 4FM0A 3V6DA 4R65A 4UB4A 5HRNA 1UT8A 2FMSA 3G0ZA 3PW7A 4KRFA 4R8UB 4XUSA 2VA3A 5DG7A 3TARA 1VSDA 4CGFA 1WLJA 1COOA 1RDDA 3SJJA 1LWFA 5SWMA 3HPHA 1ZBIA 5TZVA 3LWMA 3DOLA 4C8MA 3GIJA 2PZSA 1X1PA 5HRPA 4J2BA 4M41A 2OPSA 4DWIA 5KG3A 3VQPA 1HUOA 4CJTA 3QZ8A 1IO2A 5DBAA 5D49A 2HHVA 1XSNA 1MQ2A 3NE6A 4O3PA 1S6PA 3O4NA 4FYDA 3OYBA 4QW8A 4R8UA 1ZQGA 1JLAA 4YVZA 2BQ3A 7ICIA 4FK2A 4DL4A 5J0UA 1S9FA 4JUZA 5EU7A 2AQ4A 4KFBA 3OYFA 5J2IA 4ZTJA 1VSMA 1S1WA 4F91B 5D3GA 2FLPA 4MEXA 3HM9A 4M45A 3AVMA 2W42A 2XC9A 4B9SA 5J2JA 2NUBA 3KHHA 1ZQQA 3B6PA 1EP4A 3ORYA 3M9MB 9ICGA 5J2AA 3O4QA 4I2EA 5KFYA 4QZDA 3LP2A 4QWCA 3QIOA 4FBTA 7ICGA 2W8LA 4KITB 2X74A 3V6JA 3DRRA 4I9QA 5L1KA 3ISDA 2RKIA 4CJLA 4FLYA 5KFDA 1HYZA 4ECYA 2B6AA 2QXFA 4CJ4A 1R0AA 4CEFA 4K4IA 2Q3SA 5DLFA 3V9SA 4CCHA 3PR5B 4RQ8A 5D4BA 3I0RA 3PX0A 4HVJA 4DFMA 1N56A 4F5NA 3RJJA 4E0DA 1JN3A 1TAUA 1YTUA 1SL1A 2ZE2A 2R8KA 1X9WA 2P6UA 2PFPA 4DSFA 4AHTA 4KHWA 4NLZA 1J53A 2JZBB 1S0NA 3SNNA 4IQUA 3UXOA 3QEIA 5IIIA 1KLNA 4OKKA 4RQ3A 3SCXA 3TAQA 3DI6A 2VG5A 3ULDA 3DYAA 4O3QA 2W9BB 4DL6A 1KTQA 1XSPA 3G6YA 1A5VA 2F96A 4DMNA 3H40A 1U04A 1RT4A 1ZQAA 3MEDA 1BGXT 3C1YA 1S97A 1J5OA 3HPOA 2J6SA 2XO7A 3DLHA 4Z0UA 5CZ1A 5DB8A 3RJIA 2BGWA 8ICOA 5IIMA 4PY5A 3JPNA 2BR0A 1EETA 2DFEA 1J9AA 1ZQYA 1BISA 1NOYA 2XY8A 3L2WA 4PHPA 1TVAA 2UVRA 3RMBA 5HMMA 4RW7A 1HYVA 5KFRA 2V4QA 2HB5A 4NLGA 4FW1A 4QOZB 3RJKA 4I2IA 1NK8A 2ATQA 4PGYA 1S1UA 4JV2A 4RT3A 1ZQIA 3H8WA 1BCMA 3RBEA 4CEZA 4KHQA 5HBMA 1TAQA 8ICEA 1HPZA 3ZSWA 5KFOA 1BQMA 3MXMA 3GV8B 5CJ7A 5KFGA 3HX0A 4NM2A 3N97B 1HUZA 3VQ5A 3C1ZA 4M3XA 4F8RA 4JWMA 4R64A 1KRPA 4O5CA 3AVBA 3MFIA 8ICVA 2BPGA 4YQWA 1RT6A 3KTQA 2A1SA 5KT3A 4B9UA 4DU4A 4HUFA 5EWFA 3DOKA 1WCLA 2FC0A 4FLUA 4CF8A 2KTQA 1DGSA 1TKTA 4ELUA 1VSIA 5J0WA 3SQ0A 2DPJA 3AVIA 5JS2A 3QEWA 2KZMA 4DL7A 1XO1A 3LDSA 1T03A 2BCUA 4CJWA 4M47A 4F3OA 8ICWA 4E89A 1VSHA 3LP1A 1SKWA 3V6HA 3LK9A 3C2KA 3HPGA 1TV6A 1U48A 3MDAA 4F2RA 4TUPA 1HJRA 3OS1A 2VG6A 3GILA 1KFSA 2JLEA 4B8CA 1REVA 4GW6A 4RW4A 1RTDA 3HL8A 4Q8EA 1HYSA 3ASMA 2AQ0A 3LZIA 2B5JA 4DTSA 1ZQBA 3CM5A 3ZDAA 4EP4A 3ZDBA 4YN4A 3K5OA 1QSYA 3NF7A 1Z3EB 5C5JA 1RT3A 3PY8A 2I9GA 1S77D 2A1RA 2RN2A 4MEYA 4QWEA 2BDPA 4CEOA 1XU4A 2QK9A 5KFPA 1S5JA 5L9XA 3PMLA 3OY9A 3LDAA 9ICMA 2B4JA 5IIOA 5EWEA 3MBYA 4FJLA 5HHHA 4C8LA 1JL2A 2YNGA 5DQGA 1A5XA 1Z25A 2R8GA 4EZ9A 2ISOA 1ZQKA 2YHBA 3U3YA 1Q9XA 5DB7A 1BPDA 1NKCA 2DTUA 4IFYA 1L3VA 4YR0A 1KVAA 4CJ3A 4N5SA 1Z00B 2KZZA 4RQ1A 5J0QA 4JLHA 4ECRA 1TGOA 4YP3A 5DB6A 1F21A 4NXZA 3T5KA 1RILA 4RPZA 4TQSA 1A76A 4FW2A 3KLFA 1RZTA 2BGGA 3RB4A 4E1NA 3VQ7A 9ICCA 1BPYA 1NJXA 1ASVA 1W9HA 3CM6A 1BIZA 4TSXA 3TQ1A 4I7FA 3QEAZ 4FJGA 4I29A 4CEBA 3TFRA 4M3UA 4PPXA 3JPRA 1JLGA 1S6QA 3ZT2A 4AHSA 4KB0A 5KG0A 1EXNA 3D45A 4JRPA 3JPPA 4CE9A 4CJKA 4BWMA 3OYLA 4DSEA 5SZTA 4OPJA
chains in the Genus database with same CATH superfamily
4JI2K 2OH2A 3FCHA 5LJVA 2FLNA 4DV3J 4P52A 1WI6A 2A3JA 2B9EA 1KQQA 4FJHA 1NK5A 3WK7A 3IR7B 3G82A 5CP2A 2WFBA 2BQUA 4DR2J 3T5LA 3QNWB 4BE1A 1FCAA 2Y1LB 2KG5A 1IUJA 2OD6A 2R8HA 4DXLA 3WUHA 3A8JA 2F1HA 4K7QA 3BPDA 2LMIA 2XIDA 5H9FJ 3MMAA 1D0EA 3KZIU 3AU2A 3PHEA 5G0RA 3AA5X 4YMMA 1VQMN 1S9GB 2H5JB 4USHA 2VIHA 1NGDA 3VTHA 3L3UA 3RYLA 3UIQA 4NLPA 2IM3A 2ASMA 4ILGB 3NNAA 1KVJA 3HJEA 1MROA 2I5JB 3N4WA 2UXCK 6AT1B 1X9XA 1SAZA 4K8ZA 2V8DA 4NB4A 7ICHA 4L3NA 4NL9A 3JQMA 2GQCA 2CQPA 2GA7A 4GXJA 2BCRA 4YB6A 3U6FA 3BGLA 3JXOA 5D77A 1UWBA 2W2NP 3GBTA 4KO0B 3AO5A 1BIUA 3K5LA 3GWCA 5HL7L 3SPZA 4DR6K 5AJ3F 4EYIB 4FVMA 4K8RA 3AD7C 2EFOA 2HURA 4FZXC 5K14A 2KVIA 2G2OA 2X78A 4K8XA 1FFWB 1P9QC 1B0PA 9ICTA 3O0FA 3FZBA 3V4IA 1TKXB 2EEYA 2HMIB 1BPZA 3NS6A 4RQ2A 1H72C 5BN8A 1QE1B 2NUUG 3P5BP 1QJHA 4W5TA 3S41A 4WF9L 3ZT3A 2XRIA 4MFCA 4PGXA 3R5GA 3AO4A 4XTTA 3WXLA 4KHRA 3F41A 4CJ7A 2KJWA 2YX4A 5K8NA 4F4XA 2GAGC 3PMNA 2ZOMA 1T11A 4CLLA 1JLBA 1U45A 3EVMA 2OKQA 5KG6A 4EENA 3DRPA 1ZQEA 4U8VA 1JJ2M 3VQBA 2VBZA 3FFIA 2C3MA 4WYLA 1C6VA 1YBAA 3B54A 4Z7YA 3I87A 4QJFB 3ZZRA 4L6V3 3QFPA 1U1MA 4GKJJ 2E5JA 1QUPA 1NGGA 2G0IA 3BV8A 4LF8J 2ZIWA 5M1QA 3F0NA 2PD1A 4B9VA 5IZHA 1KQGB 4A8KA 4DKWA 4OYBA 1XI1A 1YZ6A 2LLZA 4ED2A 4UUXA 3W66A 3H5UA 1VRQC 5KFQA 4B3RF 2I8EA 4NLDA 4Y6IA 1HFEL 1RI7A 2KHDA 2MHNA 5LSRA 1L3KA 2FSNA 3BBCA 1T9XA 2XICA 4DUZF 1VC6A 3NF6A 3LWLA 2GNKA 3JAMO 3BR9A 1FRIA 9ICAA 5F3XB 1UOCA 2MU2A 5AQIA 5AKGA 3I56N 4KB7A 9ICEA 3IC1A 4CI0B 2V50A 2CQ1A 3RB3A 2OLWA 1SJ3P 3E8OA 3D0PA 4OYOA 1YIJS 1M1KT 5JMVA 4JYAK 4U8YA 2XLJA 2BQRA 5GAEU 1BG3A 1V6HA 4TN2A 4DFPA 2RUSA 2JFKA 5AICA 5CABA 3QYYA 1SIWB 1S6UA 1YTAA 2UXBK 3DLKB 1IBMF 1I51B 1PJ5A 1KVBA 4RNNA 4JV5K 3OR2A 4DTXA 3O80A 3PO4A 4CRJA 1CG2A 5IT9U 1MC8A 3ZSZA 1CC8A 1XR5A 4C1NI 4WYBA 3A12A 4LVOP 2VASA 3CETA 3FYHA 3WNEA 3C7NB 2O4IA 1MWMA 3OLAA 1ZD4A 2NXJA 2LA4A 2CPEA 2DR9A 4EBDA 1S0VA 3MGIA 3ULEB 3TAFA 3WKAA 1NK9A 2YKMB 5KTQA 3QWUA 5DBBA 2XY5A 1TUUA 2GV9A 3CI5A 3MMVA 4AHCA 4P4MA 4NMXA 4PRFA 2B4UA 4F02A 1Y5LB 2A19A 3C21A 2Y0SD 1TUVA 1PG5B 3D1HA 4NLTA 4OYIA 4V19X 3GFYA 3PDNA 1KQFB 3PV8A 5ALEA 1HI8A 4NYPA 2ZH4A 4CT9A 3AGKA 4YB7A 1X5TA 2AJ2A 2CQ0A 2OEJA 4UQTA 2FY1A 3L95X 4PHAA 2RT3A 4DV3K 3BZCA 1KR4A 7ICKA 4CIFA 1S1XA 3NL0A 2KK0A 4I2QB 4FFDA 4ISFA 1Y88A 2Q0RA 2UUWA 2DHHA 3C23A 4BBYA 4LJXA 4LF7F 3CMEN 3RJEA 4YCXA 4XA5A 5BR8J 2MY8A 5E33A 1VSJA 1B7YB 3KWGA 4AUKA 2GW8A 4DTOA 2N1RA 1QVFM 8ICTA 2DXDA 1OQ6A 4L76A 4P9SA 3HD2A 1XK8A 2QLJB 4A8XA 4YOUA 3KZXA 5FJ4A 5A6PA 1LQ9A 4B3MK 4UUWA 3HW8A 1X5SA 3UDLA 3LZJA 1KHWA 3Q8PB 2DEJA 4X64K 3RH4A 2O8FA 3T9ZA 2APOA 5AM0A 3WXIA 1UEKA 2KB2A 2NCKL 2E2PA 3S3OA 1ZBUA 1T9TA 2AIRB 3DDHA 1WD6A 1TP7A 2CUYA 4ACOA 4I2GA 4RNMA 3OFHA 2QEXN 4I2AA 5FRMA 4IO1A 1IBKJ 5HMYA 1XSLA 3RRGA 2P5VA 3ITHA 4F72A 1U47A 3VHQA 3ALRA 4MYTA 3TVKA 2DQNB 2KQ2A 3A5NC 1VQ6N 2Y9HA 5DQIA 1M5KC 5BPCA 4NCGA 3KLEB 3CXCR 2HMXA 5TISU 4DN0A 5I42B 1PIEA 4NXMJ 4CJPA 4I4BA 4KLQA 3LW5C 1SKUB 1RWNB 3OYHA 1CEZA 2MPUA 1TL1A 2AHOB 1YIJN 1NRKA 2K1RB 5KFLA 3GLJA 2FY8A 4JK7A 4K0KJ 1X0PA 9ICRA 1HBOA 3VQTA 1X9JA 2MEWA 4LF6F 4DLGA 3BPSP 1G6BA 3NAHA 2HFZA 4RWXA 2G1DA 4LRBA 2D8CA 3C16B 2W7OA 2YX1A 3RH6A 5KI6A 1NGIA 4JI0K 2ZVSA 5DQHA 4DX7A 2VJUA 1IG9A 5CYMB 5KGXA 2W7PA 3I4PA 4YR2A 4DV4K 4K4GA 1Y97A 3JPOA 5ETMA 3MAHA 4HL9A 3KK3B 3W0LA 1BPEA 4UASA 4ZVRB 3CJ1A 1I94J 2DXEA 3WK4A 3UDVA 5AKZA 1ZQFA 4FM1A 4KHPJ 3DGPB 1BPXA 2PAVA 4N41A 4KLMA 1HBUB 4NYFA 3DRSA 3AOBA 3CCLS 8ICIA 3L2UA 1VI7A 3IS9A 2HSTA 5LSOA 1KD1T 1J5EJ 4BUGA 4Y1DA 3IKMA 5DDPC 3H5SA 4JI7J 4I0WA 2DY9A 4W5QA 1WB9A 4I56A 3AOCA 1G99A 3M8RA 1VJWA 3CTRA 1ZQTA 4PL1A 2ATCB 5C24B 1ITPA 2ZM6J 2QMXA 2AX0A 1C0FA 1KVCA 4ZHRA 2UV8A 1PILA 2WB1F 2QLFB 3MMCA 5JICA 3SPYA 3LUYA 4JWNA 4KHSA 2KVSA 2RSQA 3HSDA 1VQON 2KG0A 3NCQA 2AZ3A 3KK2B 4NXNJ 5L1IA 1K73O 5D46A 1HNXF 1QY7A 4HHUA 2H9ZA 3SMPA 4F92B 4JI3K 4GVLA 3C2MA 4F5QA 2W25A 5J2FA 1MWYA 5K14B 1SZ2A 3H8JA 3UMGA 3O9QA 1URRA 1EKRA 4DOZA 2EZZA 2W41A 1IXKA 1P1LA 1RB0A 2DO0A 2GTDA 4UZBA 2UUCJ 3LGHA 3NG8A 2VQFF 2VUGA 3QQCD 2VPWB 2UVUA 2Y1RI 5KPTA 2V4RA 1IM4A 2YNFA 3H08A 4AYBC 2EKNA 5DG9A 1B9DA 4PH5A 3B6OA 3X3UA 1JROA 2A0FB 4B3SF 2BANB 4KHPK 4LIWA 4LFAK 1XNQJ 4EZ6A 2F65A 7ICVA 4KLUA 2ZH7A 2RQMA 4DCCA 2GO9A 1VCTA 3PTWA 2GHWA 3L2VA 3TVYA 4FWPA 1JRPA 4Q45A 4GVBB 3FBCA 2YTUA 4G1PA 3P49B 5D0GA 1FESA 1LEOA 3CHWA 1DAXA 4YXMA 1M1GA 3U9DA 3ZZUA 1VQ7S 2D3ZA 4LH5A 2DF4B 5LJWA 1DZ5A 3J7YU 2HLUA 1U4BA 4JI5J 4TY8A 1LWCB 1KDNA 3EPGA 2YQ1A 4B1WB 3EEQA 8ICFA 4KGMA 4LBHA 1UWBB 3TAGA 3VGVA 1KEKA 2DRBA 4EEYA 1HLUA 3TSPA 4Q2MA 4BS2A 3HSCA 3KG4A 4ZHRB 2OEHA 5HVFA 3ZFVA 1UT5A 5KPZA 1PZNA 4WQ4A 2W6KA 3K75D 3K2PA 1SZPA 2DISA 3WK5A 3VGKA 3FSIA 1UW9A 1ESVA 4H4KC 4EWTA 4U67Q 3PYFA 4PL2A 5BPNA 3IP0A 3ILOA 1X60A 3CCQS 3NH0A 2E5LF 5J2EA 4E1JA 3K9KA 3GL1A 3MR3A 4EGLA 1B9FA 4M9LA 4Z2XA 1QQMA 4ZPAA 3CCMS 3DMJA 3CFOA 1KC8O 2LSNA 2YKMA 1URNA 2XMWA 3JS6A 1UJ5A 3DLGA 3AUOA 5DO2A 4CLUA 3PM9A 1ZETA 4NEYA 3RAMA 3SSRA 4MF8A 1S6OA 1WSHA 4TXSA 4PXCA 3D6JA 1HPMA 2QWPA 5GAEI 2ZZNA 3AO1A 7ICJA 5IWAF 4ZIVA 4DV5F 4WF9Q 2UVVA 3HHKA 1BHNA 5J2GA 3BQTA 4PG4A 3AVKA 3M7VA 1TK0A 2HBMA 2DNKA 2MMYA 2C2NA 1ZQLA 1UETA 3WK8A 4P6QA 2XY6A 4CFBA 1ZRMA 3H46O 2AP6A 3RB6A 2N3LA 2V2QA 5JS1A 4ICLB 4HACB 5EE1A 1KSPA 4WU2A 2QTWA 1I6JA 3MUMP 2ZUGA 5AQSA 3LTOA 3D7EO 2UXDF 2EPIA 2VKRA 3H7IA 5B66U 5AK3A 1Y00A 1TR0A 4OJ5A 2FVSA 3N6MA 3C29A 3TU5A 3W1YC 5F0WA 2K89A 3GG1A 1C0MA 2IC3B 1TK5A 9ICUA 1X0FA 5CD4A 4KLHA 1F3FA 4R63A 5T7LA 2ASLA 3WIUA 2ROEA 1R0BG 4EAHD 3KHLA 2MY7A 3M1FA 4J8FA 2X6NA 2RQ5A 5ALLA 4DS5A 2P2CB 5TKYA 4OJ3A 5EGYA 2A3ZA 4G3IA 2GVZB 2HVEA 4N76A 1VISA 2Q3PA 2CH5A 4DFJA 2QL5B 3WX4A 2F1FA 4FYYB 8ICBA 3HKZF 2AD9A 2OPSB 2YNFB 4UT4A 4RPXA 2OHDA 4UF4A 7ICLA 3PYGA 1Y5IB 4YHHJ 4QR2A 1YZ7A 4JK1A 2GZOA 3PCOB 1B92A 3D2FB 2ASOA 3DLGB 4Z7CA 4K41A 2Y0SF 4OX7A 4JI3F 1QLNA 4LRDA 4UAYA 5AKLA 3QIPB 3MXJA 2Y3YA 3AO3A 2HGNA 4JMUA 4ELVA 1HR0J 1FWLA 1SUQB 4K42A 1UL3A 2GIRA 3M6VA 4CK1A 1LVHA 3B0YA 2HAIA 3FVYA 3C28A 2E4LA 2V52B 3RGIA 1ULRA 1D5AA 4GXKA 1BLUA 1VQ5N 4YMNA 1Q8KA 3UCUP 1S0OA 1MN9A 4MFBB 3NS7B 3OXGA 3MM5B 5KRSA 3GJRB 2HOIA 4L75A 2CZ9A 2F8HA 2W9AA 3VEWA 3LDLA 4MFAA 4Z37A 2VG5B 4DPYA 2RB7A 3PYDA 3GV5B 3NY0A 3WC2A 1JWWA 4GV9A 5HMLA 1JXEA 5AI5A 3NGZA 3M2VA 5IXUA 3CO9A 3TO8A 4WXOA 1XMOK 4XIUA 1S4FA 3DLEA 7ICNA 3R5AA 3VETA 3T3FA 1IQZA 2IJRA 3HCXA 3ZDCA 5HLFB 4O4GB 5HP1A 4LFAJ 1UQVA 4IFEA 3AD9C 1N52B 3T1AA 3SQ1A 3OYMA 5GADU 1C2PA 1L3TA 3EM1A 2MQNA 1EZZB 1DRZA 4HHTA 1XHZA 1HWKA 2OTLN 4LFBF 1JIHA 3VF2A 4KI4A 1WEZA 2R42A 1HJOA 3E2EA 1EQYA 7ICFA 3IO1A 3WQTA 1OPZA 4M04A 5KFFA 3MGHA 4M9NA 2P5GA 2XI9A 1VYAA 3AA4A 2E2NA 3OJSA 4DPXA 4FVCA 3A0IX 1RBUA 1RYUA 5IQ6A 1HNZF 4MIWA 1SUQA 3SCKE 3WIVA 3SMVA 2GCFA 3M1VA 4ZPBA 2BUNA 4M95A 2HAFA 2ZNZA 3TA1A 1FDBA 2V7ZA 2DH8A 5D4NA 1D8YA 4KFBB 2EK1A 3QEVA 3I8BA 3KWIA 3DMJB 1VK8A 1F3VA 2R7OA 5LM7E 4PZVA 4YY3J 4W5RA 1N32J 4USAA 1VQSA 3ZSXA 2QA2A 1TUWA 3MWPA 1NGJA 5HBMB 5B09A 2KDOA 4ZLPA 4DF4A 3W3SA 2I7PA 3M3ZA 9ICKA 2ZC3A 4EHUA 4H4KA 1X9MA 3T5JA 2X6SA 2I2YA 1U7LA 3EICA 2IFXA 5ALFA 1M0SA 4IG0B 1UVIA 3M30A 2NS1B 1R7IA 1NGBA 2MAXA 3EDQB 5IT9O 1Q3VA 4L3QA 1P1TA 1GOAA 2ZKUA 4YDDB 4Q0BA 4JD2A 4QS7A 4F71A 1WG4A 4QIEA 3V7LA 2XMMA 2WBNA 4JHDB 2DPNA 2CKWA 1OIAA 2MKCA 5BYRA 4USIA 5GAHI 4ES3A 2P9KB 1S5ZA 3DOKB 2ZBPA 4EO6A 1HNIA 2AEJA 4ZP7A 1C0TA 1PYTA 1GLEG 4CJEA 4LBPA 3VAJA 4OX9F 2P51A 1T3QA 2KNJA 1WDDA 2E5SA 4KI6A 4QYRA 2GMLA 4DZ6A 3G71N 2XHBA 1QAJA 1TAMA 2HS0A 2YJEA 2MKSA 4JAXA 2A2DA 2A6AA 3AJ1A 3WX8A 2V67A 4CO2A 2E1FA 3IFEA 3O9UA 1ZQNA 2ROPA 3WZ0A 1VQ9S 2Q43A 4OHYA 3W5YA 4LF4F 1FFVA 4DB3A 3I0SA 3D6HB 2XQCA 3W9IA 2P9UB 4OL8A 4FYVB 4A8YA 1V3ZA 1YRUA 1N62A 8ICYA 4RKUC 1YITN 3GDQA 2ZNYA 1HPZB 4U7CA 1L7PA 3MM7B 4CO3A 2PFOA 5A76A 3M6KA 5AQZA 5ALZA 5CQGA 2ZHOA 3MPWA 3DNCA 3Q8VA 2Q0ZX 4RQ0A 1EX8A 1E4GT 1GOBA 2FPKA 4HUGA 2E5HA 4FZZA 1JJ4A 2P9IA 5HNKA 2NZCA 2N3OA 4J9LA 3L7UA 2ACYA 4K4YA 1Q82O 1A0PA 2XCPA 4DU1A 3K57A 5I3UA 2G8IA 2ZITA 3NUQA 1EX4A 3Q8SB 2Z2YB 4GFJA 1U8WA 1NOZA 3T5HA 3UQSA 3VTIA 1VQMS 4DV6K 2C3UA 3KK1A 1S72N 3UCGA 4DU3A 1WHWA 2O5DA 5AT1B 5ETOA 3BJYA 1FIQA 5A8WB 1PC4A 4O8KA 3FMBA 4B3OA 2GIQA 3G6XA 4KT0C 4K2XA 2QL9B 3HVTB 3NGSA 4DPUA 2FHJA 3LPYA 1ZOLA 3MEKA 3MM9B 1CZAN 1L5UA 2F4VJ 4Z6DA 1NSQA 2U1AA 4ILMA 1M5PC 3PR4A 4OZ1A 3B8HA 1E4FT 2LHTA 1ITGA 4QZCA 3GP9A 3HM8A 1X4CA 3E51A 1MROB 2I5JA 5F8LA 3O3HA 5EWGA 1NK0A 2B9YA 1W2IA 2DD8S 1S10A 4OPKA 1NKBA 4IOBA 3NRZA 3JTPA 2QE5A 1FERA 3SUQA 2XULA 1SJ1A 4JKFA 3CJSA 2QA4N 3V9WA 2BRKA 2CQIA 4BE0A 1Y11A 1D3WA 3KUHA 3KLHB 1LFWA 2QWMA 3NCIA 1XNQK 4DOAA 3HKZC 3GONA 4UQGA 4IEIA 2RE1A 4GC7A 3IM8A 1HW8A 4M3WA 1HLWA 3US5A 1P7DA 3CCVS 4CWBA 9ICSA 5A0YB 3DXBA 5AKKA 4MHVA 4KV8A 4Q0BB 2QLWA 4CFDA 4JB8B 1IQTA 1N0UA 3CCZA 2KMDA 3MAAA 3AXMA 2OPQB 2W9CA 1RT1A 2KVQE 4KMUA 1Z2ZA 1X4AA 3U1MA 2JC1A 3UR3C 2NLWA 1NBEB 2E6LA 4CJFA 4DR5F 3TSQA 1Y10A 4BX9C 4K5SA 2JLGA 2DFHA 2G09A 3J7YP 1C1CA 3FEYB 3HRDD 1HNIB 1T4GA 4HTJA 4DTPA 4EP5A 2VGNA 3TWZA 1RT3B 1SQEA 3CXCM 3EXCX 1NZPA 4NLWA 4JI2F 2WW4A 2EZXA 4KPCA 5F8JA 4HDHA 3U8XA 3TJ9A 3A4TA 4EHTA 2OZMA 3ZETB 3H8YA 3HHEA 4IEEA 2FDNA 4EMDA 1Q8IA 3HOTA 3W3DA 3V7KA 2CPXA 2DFLA 3MTKA 1TTHB 3FBEA 3HD1A 3PSIA 2DCUB 3B6BA 4M5HA 2QW9A 1TVRB 4WIIA 1QSSA 3RR7A 4JD2B 4TU8A 3RFAA 2RQ4A 2J9EA 1VQ6S 2P6RA 1TZ0A 2ODGA 4DTRA 1LNQA 1IKYB 3HSTB 3I4HX 2NRXA 4BXOB 5DBCA 5CR4A 1NGFA 3O9TA 4UOHA 4CD3A 3DCAA 1VRTA 1A7GE 4CEEA 2J0WA 2CAJA 1UCNA 1FEZA 3LA0A 1JXLA 2FPHX 4H0TB 5IOLA 1T03B 1XNRK 4M6WB 2FC8A 3QGGA 4W4MA 1FE4A 2ZJAA 2KHVA 2ZJPQ 4C7YA 1UHUA 3LDOA 2CADA 3H59A 3R5JB 2C2EA 1EWRA 4DG1A 2IDEA 4MKAA 1ZQSA 2YHAA 4UB5A 2KEYA 4EYHB 4IH5A 4ZVHA 1HR0K 2CJYB 4E7JA 3SQOP 2PFDA 2RRNA 2K3IA 3D2FA 4C3KA 4WQ5A 2MUTB 2JZ5A 2R2UA 2IY5B 3PHTA 1IJJA 5C42A 3NHGA 2NYIA 5DB9A 2Q79A 4UAWA 7ICTA 2J9DE 1OY8A 1Q8LA 3CT9A 2E2OA 2DNGA 3TWHA 1WBBA 3RJGA 2C3YA 1YG0A 1IBCB 3GU0A 1J6ZA 2LU2A 1WC6A 3ZX2A 3D6RA 1SGGA 4XUSA 2VHGA 2VA3A 1XQSC 5CA5A 2JXJA 1XUPO 1COOA 3ICXA 2WZ1A 4ERDA 3F5EA 2ZJRL 3P45B 2B4VA 4Y00A 1LWFA 3BSNA 3HPHA 2CWXA 1ZBIA 5TZVA 3LWMA 1RABB 2ZIXA 3TYTA 2BDUA 1PVPA 3VAMA 5HRPA 2OPSA 3CJ5A 3VQPA 2XWXA 4CJTA 3CO0P 5GAGP 2VC1A 2Y0BB 1RAOA 2FI1A 2CQDA 1MQ2A 2B9XA 3CJ8A 3NE6A 1S6PA 4UOFA 1CI4A 1JLQB 2G07A 3K2YA 4OIXA 3QFWA 4FKXA 4FPAA 3FRYA 1VQKS 3TZWA 1RT6B 2XHWA 5EU7A 2L9NA 3M4XA 4RW8B 5AQFA 3A8EA 2QB0B 4AXJA 4ZJOA 3OD2A 2ZOGA 3DRYA 4O5FA 2GAHC 3G2XA 3HM9A 2OFHX 2A42A 2XMTA 2PMHA 2W42A 2XC9A 2M0GB 3KOOA 2YI1A 5BN9A 1V38A 3B6PA 2CZ4A 1EP4A 3M9MB 2EG2A 5J2AA 5BYQA 3FSYA 3SD7A 2B3TB 2XYHB 3HRGA 4OX6A 2OGUA 2XZWA 2I0XA 2IM2A 1T0TV 1HYZA 2QXFA 1RTHB 3H8MA 2YMPA 5DLFA 1ZTWA 4CCHA 5D4BA 3I0RA 4HVJA 1N56A 3C15B 3RJJA 3L3CA 5L39A 1T3OA 1N61A 4WE1B 1R8PA 3RSEA 1SL1A 2BE7D 2QGFB 5ETVA 2PDAA 2C2ZB 1FD8A 3NMRA 2PFPA 4OYZA 4AHTA 1IBKF 1QDUB 4NLZA 3C0BA 1S0NA 5HROB 3MM8A 1SS6A 3UXOA 2VFUA 2KICA 5IIIA 1KLNA 2LP4A 3QMQA 4RQ3A 3PFOA 4BJQA 9ATCB 3FZLA 4M5MA 3NAIA 3U1LA 3OL8A 4DL6A 2K1RA 1OQ3A 1ZQAA 3MEDA 3VALA 1NZ8A 3C7NA 4IC9A 2J6SA 5CEHA 3D1QA 3MF5A 2JWNA 4EX7A 3DLHA 3OV7A 5DB8A 2Z2MA 4CZMA 2BGWA 3J7A1 4K2JA 4BHQA 4KBOA 4K4XA 1IG8A 2BR0A 3CRXA 1J9AA 2D1KA 3O1WA 1NOYA 4PHPA 5HMMA 5KFRA 2G5HB 2ZJRQ 2ZM6K 2AYGA 4PKGA 4NLGA 5FLXY 2UUBF 4QOZB 3RJKA 4QYZJ 4C0BA 2ATQA 3EUB2 1GAOA 3HT0A 2WB1D 1ZQIA 2H5EA 1DRGA 1BCMA 1LKZA 4JYAF 1FRKA 4FF4A 1NBWA 3ZSWA 2E8MA 3AJ2A 4IWVA 4RL1A 4CYUB 2UU9K 3D0GE 5KL1B 3CJ0A 3MXMA 4MK7A 1BA0A 4OHVA 2CG8A 4NM2A 1HUZA 3D9BA 4MDAA 2KJ8A 2EXUA 2XSJB 4OI6A 4DV3F 3C1ZA 2MQOA 3CJ7A 1B4SA 3OBWA 3MFIA 4R79A 5E3PA 3KTQA 4ANCA 4CT8A 1VJ5A 2FDRA 3AAPA 2CPDA 5MAOA 1E6VB 4DU4A 4ZVTB 4BC4A 4NXNK 2WB4A 3DOKA 2ZIXB 1G1XA 1WCLA 2FC0A 2OSRA 2AH5A 3E9OA 1AB8A 1Z19A 2WW8A 3OFFA 2V6AA 5JS2A 1YX2A 1UVJA 1WORA 1ZAXA 1K47A 1T9VA 1PGZA 3FQKA 4YDXA 1VSHA 1ED1A 3C2KA 3U7JA 2QXLA 2VG6A 3GILA 2PFFB 4B8CA 1UPHA 2DNRA 2XB2D 3QICA 2OO4A 4RW4A 5EE3A 3LGNA 4DCJB 5EN1A 3LDQA 1VQLN 3FBBA 3PIOQ 1ZXIA 3ASMA 3LZIA 5E84A 2B5JA 1LKYA 2JH7A 1WWVA 2M0NA 4CDGA 1ZM4A 3K5OA 3K7RA 5F0XA 3NF7A 5C5JA 2FB0A 2QO3A 2DB1A 2P8IA 4O4RA 2A1RA 4QWEA 1MNEA 1FRLA 1KVKA 1XU4A 3CCTA 5HR7A 3OY9A 1MMDA 1M5VC 2B4JA 2XM3A 4ZOSA 2M5YA 3WHIA 3MBYA 2YKNB 3HI0A 1JL2A 4X62F 4KGKA 2R8GA 4M63A 3CJRA 3U3YA 3K0JA 1NKCA 5CHCB 4IFYA 3E9PA 1L3VA 3SR6A 2J9CA 4BRIA 2RRBA 3N01A 2AZ1A 3L9ZA 1B70B 2MZTA 1MA9B 4ECRA 2HQ3A 1RQLA 1S59A 2LU1A 4EUVA 2Q1NA 2A6MA 2FZGB 4X4VA 2WSEC 4GNIA 3CULA 1YJWN 2HHHK 1DFDA 3L5KA 3RB4A 2YWEA 3LOUA 4WYWA 2BGGA 1QAIA 4MO4A 3VQ7A 5A8WA 1NJXA 3KFUF 4NO7A 3MEEB 4TSXA 2YNGB 2IRUA 3QEAZ 1DQ8A 3R2DJ 4CEBA 4FJGA 3MWBA 5AE1A 4Y2UA 3JPRA 2UXDK 2HGMA 1JLGA 3ZT2A 4AHSA 1EXNA 4CJKA 4QR0A 5LMUK 1S7HA 3TQEA 3MCPA 3IP4B 4DSEA 5HMWA 3FC4A 1HHTP 2H3EB 4CFAA 4XQ8A 4ZH4A 1RP5A 3MTJA 4ZVSB 2M3DA 3ETMA 3T7ZA 4YUDA 3VA0A 1RHJB 3SMSA 1S1VB 2MRLA 4Y2PA 3DXSX 3HKWA 4PQUA 3I28A 2M88A 5JTIA 4PJ0U 3EGNA 4AYBD 2IOCA 3KBBA 5DGAA 2A1AA 1PJ6A 3W62A 3SEIA 5HR6A 3DOMA 4FSVA 4R66A 2C2RA 4CESA 2V8VA 4FP9A 3BBFA 1PKUA 1ILYA 3HMJG 1RAGB 5HP1B 2KVCA 4J9RA 7ICSA 4ZPCA 2IVPA 3CDBA 1C0UB 3VC8A 1DY3A 4KV8B 1LW2B 4H4MA 4P2SA 5ETLA 4Z4CA 2PEBA 3UKRB 1UFLA 1YDLA 3HSGA 4KH0B 4JK9A 2OYYA 2NLXA 5DKWA 4IRKA 2EW9A 3BS5B 4R0JA 4AL7A 3CDUA 2O3DA 2D41A 2HOEA 3PEHA 4NA2A 3G4SS 5LMNJ 5B0AA 2BJ9A 5B0CA 1BUPA 2K8CB 1UPPA 1R43A 2YJFA 5ALHA 1K0TA 3GOIA 4AHVA 3RJMB 3PSFA 4XO0A 3CJ2A 1APSA 2HNZA 4CF2A 4J5OA 3PKYA 1RG6A 2XMUA 5I9EB 1GXLA 5KFTA 4IYQA 3DGVA 1VQNS 2CJQA 4KLSA 1HBOB 3MPUB 3G4SN 4DCHA 1OW5A 4AH9A 2QB1A 3NVKA 4US9A 3V4MA 5J2QB 2XYPB 1HBUA 1NHKL 9RUBA 1QHTA 1AUSL 4P0QA 1K73T 1HNXK 3SAFA 5I3QA 2ZTCA 3DC2A 1F6TA 3NGDA 2AJ0A 4Q2LA 1LWEB 8ICMA 4ANDA 2NXCA 2HFUA 1N5YA 5BPLA 3PEJA 4I27A 2D0CA 3EY1A 4YD2A 2QIFA 2H3ZA 2GBZA 4WTOB 3CIPA 1HRHA 1RTHA 2LMRA 4WIQA 3ZDDA 2ATLA 3KKRA 3C19A 5KAFU 3GR1A 2O4GA 2XI2A 4ED4A 3EYZA 3MCNA 3PACA 3MPYA 5EDWA 3NF9A 3V72A 3QRPA 4AL6A 3CIZA 3AVJA 3L3VA 1TKXA 2NRZA 1FRXA 1H7WA 2Q4TA 4CGGA 2UUBJ 1T9YA 4LRAA 1V85A 2GEMA 2EK6A 2R3VA 5B8HA 4JS5A 2FMQA 1T02A 1OO0B 2QV6A 1ZXOA 4DPTA 3VF4A 5IC6B 4C23A 3QJJA 3MM8B 3Q7BA 4RNHA 3C2LA 2MKYA 1TK8A 1NZAA 3LP0A 1D1UA 1WG8A 4BDPA 1QAXA 2VJ4A 1J5EF 1HUXA 4QIWC 4F5PA 3VGMA 2NXUA 3FZKA 2IJFA 2M7SA 3O08A 2LM4A 3W65A 4Q44A 1N63A 3U9ZA 4PG8A 1BL3A 1W26A 3AA3A 3ISBA 4CW7B 3FKBA 4BY9C 2E1YA 5DM6Q 4FLVA 2Z7JA 8ICHA 1SXLA 1FJGF 2CIMA 3AVFA 1HD0A 3IBWA 1Z1BA 5K8PA 3ZX3A 1RTJA 3BO2A 3CCSS 4JV5F 1HQ2A 2C22A 1FO4A 5KNIA 3PSPA 3M8QA 1RTIB 1N5YB 1T94A 1ROFA 2O1PA 4Y3CA 1VIOA 5CHGA 3RF9A 2RD5C 2P9PB 1WCNA 3BM7A 3VGUA 2WTUA 4US8A 2EVZA 3JAMU 4LFBJ 1J2MA 5M1OA 2EFPA 5AJ3J 4U7BA 1L6NA 4K43A 2RU9A 4EO8A 2HSZA 2HDOA 4M1KA 1NU4A 1N48A 1UEUA 1VSLA 4LD0A 4A46A 3ISCA 2J8SA 2MQ8A 2FVCA 4LF4K 4DUYF 1PAUB 2GQ2A 3UMCA 3CJCA 2DIUA 4F5OA 4G9BA 3AGRA 3UVJB 1UTAA 2DGTA 3ZTPA 5CZVA 1UZDA 3I33A 1RAAB 3LDPA 2R7TA 2IIRA 5KG2A 4CDIA 2QM1A 1GNKA 4FWOA 2DFFA 1W2BM 4JI8F 8ICUA 4FPRA 4PYAA 4DCPB 4PQUB 4CZHA 2CGLA 4J2DA 4DJBA 4TVAB 2Q6CA 4P71A 4FL9A 1NNLA 2OXOA 2AYEA 3E01A 3VPZA 1LV5A 5LL6Z 2ZJQQ 1C1BA 1SXEA 3C5FA 1CSJA 4E98A 4HTIA 3QIPA 1A77A 3IAS9 4XDCA 1NNDA 2W1BA 2RKIB 4FWQA 2ZWHA 1HNZK 3AOAA 4AHRA 1DQ9A 5ALUA 1OMSA 6FD1A 3A2FA 3JXUA 1S1WB 2N4DA 1VJQA 3FUYA 4IJNA 1O6XA 1JCEA 1OY9A 5KFAA 1ZM9A 2JEJA 5ETQA 2OI2A 4HI2A 3MC1A 2IRYA 2NZ4A 4I2BA 2K4PA 1N8RT 3MN5A 5KFMA 1MWZA 2CNLB 2FMPA 1WEYA 4CGIA 1YVUA 3U3GA 1RE1B 1WWHA 3ZDEA 3E66A 1RFQA 2VWJA 2H3FA 2E20A 4AXIA 4YFUA 3RRKA 3HZ6A 2ZH3A 4M5GA 2P9CA 1NM1A 1RT5A 1Z26A 3UR0A 3A0BU 1SBRA 5HLFA 5DZ7A 3FZFA 1VSFA 4FS1A 4ATNA 3B0XA 4CFCA 2JC0A 1Q78A 3QUQA 1R8BA 3S6EA 2ABYA 2YQEA 2GVZA 2FBXA 3K58A 3KLEA 2C3OA 3DKDA 2PFQA 3BKFA 1IBMJ 3CD6S 1TUYA 5DM7Q 4C11B 3CCUS 4OZNA 4DX8H 4C1NK 2HHHF 2ACMA 1BA1A 4HDGA 2YMMA 5KG4A 3TA2A 1RZMA 1DLOA 3Q2TC 1ZRNA 2DGVA 5CE3A 5ALPA 2WVDA 3SZ2A 2JL9A 3R8YA 3MEGA 3M8PB 2Z1JA 2GHVC 4LZGA 7ICMA 3VERA 4C3LA 4ZK7M 3CQ8A 1WUDA 2WVBA 3SQ4A 2P9NB 3ZEUB 2JZBA 4PWUA 8ICCA 2WF9A 3P83D 3GFZA 2IA0A 2JX2A 4JV1A 3O6WA 3PRDA 2FGCA 4M9JA 1JK9B 1BQNB 1OVYA 3KHGA 4YDUA 5HRRA 5JRTA 4I9LA 3OFEA 2RPIA 3GG4A 2V0NA 1UKUA 4IG3B 3HFKA 2KRBA 4A5BA 3AB4B 3R9PA 2FJBB 3RW7A 2IHMA 1VQ8N 2EFQA 4JKHA 4QIGA 4E8UA 1B4FA 2KN4A 3MR5A 2V9KA 2ITGA 4CF0A 4OZJA 1LFPA 3QGHA 3JSMB 3KMQA 4ED7A 5LL6d 3CMAN 3CF5L 4Q5VA 3TA0A 2IA6A 4DR4F 4JI1J 3F9KA 3MK6A 4RPFA 3HVWA 2HHPA 2ZTEA 1NJZA 4O9MA 1S76D 1ZBSA 3AHPA 1RAHB 2V63A 1LAWA 3CC4N 1N32K 1NG9A 3OYDA 3GG0A 3OYIA 4YY3K 3CMQA 1RTJB 1YT3A 2ZJQL 2Z1GA 3QT7A 1AXQA 4UY85 3PJ9A 5DM6L 1FK9A 2VWKA 1Q79A 1DT9A 1RXVA 1AA1B 4KLTA 4GVMA 4XPEA 5K5MA 3LVWA 4C7ZA 2QN6B 3CB4A 2DKZA 2ESEA 3CE8A 1KOHA 2JJ4D 2KL8A 2DHXA 4NLOA 4JI5F 1WNEA 3FNNA 4CGJA 2BKEA 5ALKA 3H2VE 2UU9F 5IINA 1XTZA 3QEPA 3C14B 3OQ2A 4F7VA 3IM1A 1CC7A 4AILC 2CQCA 2PGCA 2D6FC 1Q3UA 4USJC 2LQJA 1ZQMA 1HA1A 2OJ3A 3FE1A 1IBMK 4BRNA 4NXMK 3IG1B 1BWVA 2Q36A 2OUGA 4NLRA 3EUNA 4DOCA 1SV4A 2WTFA 1JCGA 3DWLA 3HKZD 2WF7A 3O5BA 3DHXA 3ELHA 3VWSA 2ZTDA 3HP9A 3ISNC 3EJMA 4KTQA 2QWQA 3RUBL 1WYGA 1FJGK 5AIAA 5AQWA 2HPUA 1RAIB 3C6HA 3UDCA 2MKIA 5DLGA 3M2RA 3ATVA 1KLMB 4WFBL 1NUEA 4DOBA 1WNSA 3HHNB 1S12A 4IG0A 4A5AA 4I69A 3AMZA 1K1QA 5CD4H 4P10A 2LPEA 5E3RA 2E3TA 4WE1A 4XDDA 3PIOL 2IPOB 4FJ9A 3RMCA 4OYMA 4B9MA 2KRRA 2XBPA 2KXNB 3M5RA 5J0TA 4C2MA 2O01C 5BPMA 4CO4A 4MFFA 3HJVA 2FHKA 1E6YB 2X3DA 1KFTA 3KNAA 4WK3A 2AJ4A 4OJ6A 4DQ8A 5B5EU 2RH3A 3F2BA 2B0CA 1SZHA 2KM8B 5CB1A 3K5NA 2LXUA 1OY6A 2FBYA 3KDNA 1YJ9N 3F73A 1RTZA 1MLAA 1ZJMA 4UBBA 1GMUA 3CCRS 5IT9Y 4QIFA 4H4OA 2Z57B 4K5RA 4NV0A 3D3CJ 4J9KA 2GX8A 1XEZA 3J7ZT 1Q81O 1IIPA 2DO4A 1Q4RA 4XRHA 3BQ0A 3AJDA 2FC9A 3FCVA 2KSOB 4JYAJ 4LSNB 5CA7A 2RF2A 2VH7A 3UCZP 2VFRA 3MCAB 2B8QA 4RX6A 1FXXA 4N8OA 4H0XB 2CFXA 5IV4A 3GYNA 2KJ5A 5KFUA 1LWXA 3ZLJA 3G6ES 3BSOA 5A8KA 2D5RA 1H0HB 2F4FA 3VN5A 4JOUA 4CHZA 2B9WA 4JKDA 1VQKN 5J2HA 5AJ3K 1X9SA 1JLFB 4NJ8A 3RMAA 1RCHA 4W5OA 2AYBA 2LFVA 2XLKA 1RCXB 3KK2A 2ZHBA 4LMZA 4PZNA 3G10A 3T1HK 1TL5A 3CD6N 3AV9A 5AI9A 3V9XA 1YJ9S 3NF8A 5KFEA 1WKKA 1W7WA 4LF8K 1VRTB 1BQXA 2A1JB 4QWDA 1EKEA 5D4OA 1K1SA 4FPIA 4BGBA 5FPNA 1VQPS 1R59O 1ZJNA 2V9WA 2V8PA 3QXGA 3ET6A 5HMZA 2YPZA 4DL3A 3IGVA 4DV5J 4QZIA 3MM7A 5D78A 3NVYA 4DTUA 3CC7N 4IOAL 4FN5A 2YCHA 4O55A 2R7YA 4DV2F 2KIVA 4LZDA 4KHMA 1RDCA 4JI4K 4F3QA 4X4UA 3CCEN 2R2TA 2COLA 2CJKA 1XMQF 3QWPA 2WAQC 3CUNA 1SH3A 1FRJA 1QZ6A 4Y2CA 1F5SA 1RLCL 5GAHU 3R27A 3GZ7A 2AW0A 2FJWA 2LI6A 2VBXA 1FKAF 2MZ1A 1FK9B 1R8HA 4KBIA 3OTEA 3UPQA 1KKXA 2BW2A 3H20A 4DZDA 3R7NB 1NK6A 1S1UB 2YNHB 3CCUN 4P2FA 1HBMB 2R7XA 1HKGA 4KH4A 5J0XA 2E5GA 4Y0FA 5DDMA 1NM2A 2PN6A 4UTGA 2ES6A 3IBPA 1MWQA 4TU7A 2DK2A 3CIMA 2MLZA 4KKOA 5THWA 4F67A 4HHHA 4NMLA 2G13A 3MPVA 1FF2A 3DLBA 3JQKA 4AQYJ 4MDBA 2QT7A 3S3NA 3N4QA 1C0UA 1UMJA 1TFWA 3T1YJ 5C10A 1S72S 1REVB 2A3VA 2ZIUA 5J2CA 1U0HB 1NDCA 4F0KA 3TAEA 2MUTA 3GCWP 3AVHA 5AIBA 4H8KA 5A2QY 1Q95G 4TYAA 4Y2SA 2O67A 3H0PA 3OTOF 1A9NB 5IFMA 3OTCA 3GQCA 3F5TA 1KQKA 4ISEA 4NI2A 3POTB 2F2AB 3M7DA 4I2HA 1GLDG 4R5PA 1DJ0A 1CULA 2JOQA 3N4MB 2OAUA 4JI0F 1NI3A 3SMZA 3ITHB 2YV0X 2P9SA 8ICLA 3GE9A 1OUQA 4BE2A 3CCRN 4KYZA 4E7KA 3Q83A 2PC6A 4A8EA 2Y1JA 4Q43A 1YVNA 1U2RA 3CQYA 3HI9A 5G4DA 2BOPA 2VBYA 2NYVA 3OSNA 1RHQB 1FW6A 4B3TF 4IQVA 3OHAA 1HBNB 4USKA 5L38A 5AQLA 1S48A 1FXLA 1HBMA 1UJ4A 1AZSA 2DNOA 3CW2C 4W92B 1KQSM 3AQFA 2XSFA 1V5VA 4O44A 5IIJA 3ENHA 1SI9A 3A8KA 4BDYA 2IOHA 2B8PA 2D9PA 2HHHJ 1GTEA 5BXIA 4CI6A 5KFXA 1J2NA 4C80A 5J1EB 3V6KA 1JLQA 1DGKN 4IJAA 3PX4A 2F77X 1HARA 4DR1J 1JJCB 2OMOA 1F0MA 3CDAA 4LF9J 5TKWA 1T6CA 2JV3A 2P66A 5FDLA 3G6EN 1X3MA 4CF9A 4TUSA 2D3OR 5F8GA 4RQ5A 9ICFA 4CLTA 2CXYA 1TV9A 4MKYA 1A6LA 3TNVA 5D0RA 1WOOA 4CGHA 2CPRA 5E2QA 2WF5A 5LXRA 4ZPWR 4L3KA 3L4PA 2IVOA 3A3OB 2CDRB 1IKVB 4CIEA 4HVZA 3SI8A 3PKMA 2FXUA 4LRFA 4DF8A 3KJVB 2HWHA 3S6JA 2L5YA 4EI2A 1RISA 5G5HA 4CZGA 5KFIA 3A13A 1NOMA 8ICJA 2VG7B 1S57A 2XG8A 4TLRA 2IM1A 3T1YK 1UW4A 4X4NA 5AQKA 3NEKA 3ZXWA 4KLGA 2QFJA 3PIPQ 3LALA 2E66A 4OJHA 3MM5A 1J97A 4B3TJ 2HHTA 2NRVA 2G0JA 3QFUA 1GLLO 4X4TA 4RW6A 2J4RA 4RBVA 4PQAA 3LPEA 4URQU 1NDPA 3LF0A 2H5IB 4DS4A 4WK1A 3ICLA 3ETOA 3QE9Y 2O8BB 2OM6A 3BR8A 4K4UA 3D66A 4E19A 2AA4A 2V8HA 4JI4F 1NU0A 4C98A 2B51A 4IS7A 2P9LB 1Q1KA 2WBMA 3KK3A 2H4WB 4M5IA 2E7XA 4QS9A 3DN9A 4OMFG 4MQ3A 4J9SA 2D3DA 2BVZA 1U1KA 2YNIA 4CBUA 3SENA 1XO0A 5HVHA 4LF5J 3IMXA 1QQNA 4YOEA 1ZAWA 3OL6A 4YG2A 2HSEB 4B08A 2KLAA 4OVLA 3UD5A 4ED6A 1NEEA 2O8EB 1DBDA 3ATUA 2CDQA 2UXCF 3OYEA 1RT1B 4PKHA 1YI2S 2YWKA 2GJIA 2G8HA 3NLCA 4WFZA 3V7JA 1XC3A 4RW7B 2UV8G 2H65B 4DV4F 3G8TA 1XHXA 1IR0A 1DTQA 4NLQA 2LXFA 2OD4A 1VQ9N 1Q5VA 5KFZA 2HKEA 2PYJA 2L48A 4KO0A 5L8RC 5DDYA 2UUAK 4RU2A 1TV6B 2IMWP 5K8MA 3N7PD 3QT5A 1OH7A 1ZYQA 4KE5A 2P9SB 5F2RA 3ZT1A 3CNHA 3JTNA 2VWBA 3TADA 4ICLA 3UWTA 3FC9A 1HNWJ 4X64F 4Y2KA 2B5JB 3MAQA 1TMJA 5DRKA 3VEVA 2KJ9A 2D4WA 5FLXU 4FZMA 2GWJA 2GMHA 3AN1A 4H0YB 2DVIA 1GMWA 1XS9D 3K0SA 2JEGA 1WBDA 1WSJA 1Q82T 2AXTU 3EE3A 2E7VA 1JLCB 2YHYA 2YN4A 2BA9A 4PXEA 3U27A 2EAPA 4B3MF 2CH6A 1LWCA 2P9LA 2EFGA 1HW9A 2JEIA 5AZIB 3HVTA 4RQ4A 3CJ4A 2IVYA 4PL8A 4FK0A 4QIWF 1XC9A 4UB8U 2AJ1A 2HMPA 2YMQA 2K8AA 4V19S 4UW9A 3C94A 5M1NA 3LANA 4GV6A 3HSZA 2EAMA 1RDBA 5J0SA 4FZVA 1X4EA 1Z4UA 3QINA 2FYXA 3K1ZA 2E1RA 5AQMA 5KOXA 3GTYX 1AFIA 1WN7A 1KD1O 3C66A 2BKNA 3ENWA 3OUYA 1VK0A 2XTJP 1JXVA 4DR1K 5L9NA 2MSTA 3CDEA 3K59A 2HVHA 3RMDA 1OVQA 1S99A 3IFRA 4C8YA 4PR6A 2U2FA 2FF6A 3PUFA 4ECZA 4PPZA 5IWAK 1WKLA 3G8QA 3C6TA 3KLIA 4USUA 1TYQB 2BV3A 5KRTA 3KJVA 1KBUA 1KOOA 3ONQA 3VQDA 5EE9A 3EW9A 4DSKA 1B43A 3HHLD 4FDFA 1P9YA 1RYSA 5IM0A 3Q8KA 3O44A 2OEKA 5G0RB 1S3XA 1WSFA 5ETKA 3HX9A 5HI7A 4HUEA 3JSMA 4LF7K 1VLYA 2G8VA 4ED0A 4GO7X 2RRDA 4MIAA 1RDFA 2AJQA 1NSPA 4KJIA 4QW9A 1N4LA 4ZN1A 1LK5A 4CK3A 1IWAA 4JI7K 4GKJK 4UB2A 1S6PB 3PW2A 1RBAA 2IC3A 4JI8K 4KB1A 3DXMB 4X5VA 2Q97A 3TJAA 3W7BA 3RTVA 1VS3A 3EMTA 4IKAA 3RU0A 7ICPA 3MECA 2ZM6F 4OLAA 1WF1A 2IAJB 3PJWA 4RTFD 3A1YG 4KN7A 1IJEB 4PYDA 3A3NB 1U26A 3E3XA 1I1GA 3O3GA 4GLXA 4OKEA 4FLWA 5T7LB 1IH7A 4USVA 2VC0A 4U67L 2ZD1A 3BGOP 2LYHA 4HR2A 4CBWA 3ZSRA 2VQEF 3NAEA 3OYJA 2MSNA 4B9LA 1JXBA 3THVA 3D0IE 2MZQA 2FE9A 1D09B 2CPYA 2I6WA 2C1EB 2FGOA 1QTNB 4DSLA 1Y3KA 3RW6A 4BR0A 3FK4A 3CVKA 1SC3B 3UW1A 2MYFA 4X66J 4LFCF 3FZMA 2BJ3A 4M9HA 7ICRA 4ILRA 1W25A 1MU2A 4QZFA 2Z2LA 1Q86T 2YNIB 4DTMA 5EHHA 3QUCA 4EEKA 4O44B 4FJ7A 3LDNA 5LY3A 4QWAA 1YITS 4QZGA 2V4JA 2KXFA 4DQPA 3CSKA 2VG6B 2IGIA 3HDSA 5H2FU 2NO4A 3M2UB 3BBBA 3PX6A 2JH3A 1HI0P 4NXMF 4IRDA 3HF5A 2WUSA 2GWKA 3TRGA 4QS8A 4X65F 1M1KO 1H74A 4IDKA 2ZIWB 1ZQDA 4OI4A 3QATA 3UKRA 3OVNA 1EAYC 2OPPA 4LFCJ 3BF1A 4CJUA 2AGPA 2KT3A 3ZT4A 1Q7YO 2A1JA 2LEBA 2P9PA 4CZIA 5EXWA 2RRAA 2G8KA 5A6WA 1JX4A 1QQCA 4FM0A 2OP5A 5H9FK 2F3JA 3A5LC 3GJQB 3M6UA 3NASA 4Q7AA 1NDKA 2Q1LA 4WBFA 5HRNA 1RWPB 2HK3A 4GVEA 3ULHA 4DHYA 4KRFA 4LR7A 4KH5A 1X6IA 1NCLA 5CYJA 2ZE2B 5DG7A 1GXUA 1VSDA 4CGFA 3GSIA 4KGZB 1WLJA 2Z4PA 3SJJA 3GYGA 5FDLB 4DR6F 2E29A 2FVRA 3BO4A 5SWMA 4X66F 3H0MB 3QMLA 2LVWA 1FJGJ 3GIJA 3BF3A 3DOLB 2EAOA 1BO5O 5ALMA 3NCRA 4JKCA 2DWQA 4LFAF 3TX0A 1IR2A 1F9EB 1IO2A 4A8FA 2W3RA 1TL1B 3P3DA 1XSNA 4LF5F 3RG6A 2BABA 4DU8A 3MMCB 2OSQA 3U02A 4QW8A 4R8UA 2E1PA 1ZQGA 5EUHA 5HL7Q 1PO6A 5AM5A 2BQ3A 7ICIA 1EB0A 4DR7J 4FK2A 4CLKA 1SWWA 3NP5A 4UOCA 2L3MA 4M5KA 4OX8A 4NASA 3CCVN 4KH1B 1NSKL 1S1WA 4OQJA 1FNOA 5AM3A 3U26A 4F91B 1QD1A 4G1IA 4JI3J 4MEXA 5C15A 4ZPDA 5J2JA 2DHAA 2XS7A 3HHLB 2HFNA 4I2EA 2AT1B 3QIDA 1ZBTA 1O03A 4B3OB 4QZDA 3LP2A 3LM9A 3QIOA 3P6YC 2OFGX 3ZZ0A 2DRAA 2O8CB 1X66A 3BP8A 3CCLN 4GKKK 4DUTA 3DRRA 5L1KA 4CJLA 2O6KA 1JALA 2W01A 4FLYA 3TOQA 5KFDA 2OTJS 2PA3A 3CQXA 2B6AA 4CEFA 4K4IA 3C14A 2Q3SA 2E9ZA 2RAQA 5A8RB 2BE2B 3C15A 1CULB 1LCUA 4DI6A 3WQPA 3I0RB 4F5NA 5U47A 3VV2B 5C2GA 1YTUA 1FJ7A 4DDFA 2LDIA 1X9WA 4P73A 4KHWA 1HWUA 4QIWD 1RAFB 2V51B 2MA1A 4IQUA 2HFSA 1LOTB 3THPA 2FJAB 1R6YA 1DTQB 4A47A 1CPZA 3KMSA 4NXNF 2B56A 2W9BB 1QM9A 2FHMA 1RU2A 3G6YA 1A5VA 2FVPA 4DMNA 1RT4A 1N36K 3KLGB 4YORA 3DRSB 4NYZA 4OHWA 2F8EX 3L6QA 2PT0A 2JVRA 2HNYB 3HBTA 2GGPA 1MW7A 1NHUA 3MEGB 2R2RA 3FZHA 3RJIA 2F44A 1R8CA 4U9RA 4DR6J 1RWUA 3WK6A 4NL9C 2DFEA 4DR4K 1NGAA 3X1LB 1BISA 1UVMA 2VICA 2LM1A 3Q86A 3BZQA 2R7QA 2XY8A 1B0VA 3L2WA 2YHXA 3RMBA 3IRUA 3GFHA 2MJNA 2BACA 1SXDA 4I2IA 5EX3A 1PBUA 4PGYA 5CYQB 2K4EA 4DR7K 4CEZA 2G5IB 4KHQA 3NVZA 2BM0A 4DV4J 1HPZA 4KMOB 3ILJA 2UUTA 4FF3A 1WG1A 5CJ7A 3HX0A 1H2VZ 2WVFA 3V2UC 4ZCLA 3T1HF 4M3XA 4MLHA 5E79U 1KRPA 2QYGA 3UO0A 1D4XA 4KSEB 1Z05A 2BPGA 4ZIWA 4ENOA 4ZCIA 1R31A 1RT6A 1KW4A 4ID8A 3ZZPA 1NMDA 3KZBA 5EWFA 3NNHA 2H54B 4WCEQ 3A8YA 4W90B 3MN9A 1VSIA 5J0WA 4TY8B 2DPJA 1TUGB 3AVIA 1NJIO 3F53A 2QSWA 4DL7A 3LH2S 3CD5A 1PYSB 4CJWA 1N5VA 4YB1P 2CNKB 4F3OA 2BEFA 3UPFA 4E89A 2G1HA 4BQZA 2GIFA 3MDAA 2EC2A 1X4FA 1HJRA 2JLEA 1DK3A 3GSDA 5BREA 2FHJD 3Q89A 4GW6A 4DBQA 1RTDA 3NGUA 4Q8EA 3HL8A 3J8AA 1O08A 2R7VA 4WKRA 3D67A 2AQ0A 2NYHA 4BRAA 3L7PA 3QRRA 5HAOA 2ASYA 3TAMB 5H1SV 2E5IA 4RUHA 3ZDBA 1ZM3A 3FCWA 4ICAA 4NZ0A 1ZD2P 4B6JA 1KS2A 2HWTA 1XERA 2O8DA 1FXRA 3DYAB 4JI1F 1J2VA 3BO3A 1AZSB 5GAGU 1LXNA 1GT8A 4OYWA 2RN2A 3O4WA 5L46A 2BDPA 2CGKA 3MM6B 2QK9A 4LQ9A 2UUAJ 2ZF5O 3NCPA 1IV8A 2GVDB 2HIQA 5EWEA 2DHGA 2DY1A 3Q24A 5M1KA 4H5WA 3A5MC 2R4FA 1WI8A 1Z25A 2FSJA 4BRKA 4DUZK 3BZKA 4C97A 1ZQKA 1FEHA 2YHBA 4C9DA 1Q9XA 5DB7A 1RWVB 1BPDA 2J8AA 2YXLA 2KZZA 2ROGA 4RQ1A 4YHHF 1YJNN 4LVNP 3T5KA 1GXTA 4DV1F 4LFCK 1A76A 2FJDB 1QQ6A 5ALIA 1SH0A 4P7TA 2V2VA 3R6GB 4OJGA 3K9JA 1F1BB 3CC2N 1VQLS 9ICCA 4QU6A 3TZXA 1ASVA 2I9SA 1BIZA 3MPDA 2QWNA 4BC9A 4A8WA 4X4OA 3TFRA 4PKIA 4CM0A 1S6QA 4KB0A 5KG0A 4OLPA 2G4BA 2QMWA 3G9CA 2B43A 4IFYB 4I6MB 1OWXA 4BWMA 3MMBA 3ENOA 3OYLA 4H5RA 4LF6K 3U4LA 4OPJA 2BE9B 3D1OA 2E1MC 1ATNA 4ZJQA 3H2LA 4EU0A 2MTLA 3EX7B 3K4GA 3ZI4A 4LF5K 5LOQA 3MR6A 4UAVA 1SJFA 3LPUA 4ZVFA 5E26A 2DTJA 4Y1CA 2OPRA 3P31A 5CYQA 4RQ7A 3AVGA 3DXKB 4DV7F 2HVDA 3UI3A 3TX8A 2AEFA 5KG1A 2BCVA 5HVGA 4LF9F 3VVUA 1KLMA 2XGPA 3PRVA 4ILLA 4OGEA 1FEEA 3E9LA 4HT7A 3VAGA 3AA2A 2BZ2A 3QU5A 4XPCA 3TPQA 3VMFB 2SXLA 3BQ1A 2LBOA 4G1QA 2W6LA 4IOXA 3HHLC 4OI3A 8ICXA 2GUPA 3J80Y 1BNPA 2CJBA 2DL0A 4H5NA 3ISND 2P9KA 1RAEB 4L72B 4MF2A 4KY3A 2HLTA 3B82A 2QKBA 3ET6B 5HJYA 2BM1A 2UUAF 5HO4A 5BRHA 4C48A 2IDLA 3LP2B 4KHNA 4WZMA 2UU9J 3RAQA 4Y2AA 3PJXA 1HQEA 1SIZA 1VBZA 5AKXA 3IWNC 4CGDA 2HG4A 5CY4A 2GMJA 3JSYA 1DARA 3Q8UA 2E8NA 4QYZK 4I2DA 1C4CA 5CZ2A 2NR0A 3M6ZA 4X65K 4ZTFA 4A8MP 4CTAA 1U2VA 4P2MA 4QZHA 4JBCA 2QA4G 1HQUA 3QO9A 1NK7A 4GV3A 3KHRA 1VRUA 4GKJF 1HMVA 2ZIUB 2AGOA 1KTVA 3V81B 1D9FA 3R7SB 4M3ZA 5J8YC 4FJNA 2IOFA 2DNHA 1GLAG 5IIKA 5AQQA 3VQ8A 3OTQA 3N7RC 1S5LU 2ASJA 4M3RA 5ALOA 1NJYA 1N34J 2ZGYA 1H38A 2F5GA 1N2XA 2LEPA 5ALYA 1FA0A 3DDIA 3VF6A 1NPRA 4IBNA 4ECVA 4DTJA 2PIIA 3AM9A 4UW2A 3R97A 2IRXA 4NLBA 3TFSA 2Y9UA 2A40A 2BXJA 2FIUA 9ICWA 2P9IB 3MFHA 5AFUA 1NKEA 4LVSA 3UE5A 3UXPA 4BG8A 5KFCA 2KE7A 1EQMA 4WFXA 1LWFB 4AQYK 4KLJA 1OH6A 4M3TA 4ES2A 3NGYA 4HTUA 5E3CA 3TAMA 3UMBA 4MAKA 3QLHB 3BGRA 2W9BA 5BOMA 2H3VA 1U6FA 3OTDA 3HXMA 2ZFHA 3HULA 4M6WA 2HQIA 4WU3A 4F93B 2GX9A 4H0PA 1ZH5A 1L3UA 4I6AA 2IJNA 3IHQB 2R7WA 3TAPA 1S6QB 3GIKA 2VQEJ 1FFUA 4U95A 1E6VA 1HNXJ 1XWLA 1URJA 3ALYA 4QZ9A 2ZBQA 2ZJPL 1FKOB 1HQUB 3V9UA 3VQ6A 3QAEA 5I3UB 2LA6A 3JYTA 3BGUA 3SUOA 3OFGA 3D2EB 1E3MA 5AM2A 4NEZA 2QEXS 1BCOA 5BYSA 3THXA 1RA7A 2VANA 4NWIA 2ILZA 2ZUBA 1XN9A 3TADC 2VL1A 2L9WA 4IFVB 2GO8A 3SBMA 1VQ7N 2X1BA 2E88A 1IJFB 4Z6FA 3IRWP 2HQGA 5AK6A 4NE9C 3ZTQA 4YOYA 4TQRA 1ASWA 1WHVA 2CNOB 4G9ZA 4ZVOB 1EWQA 4ZVEA 3NBPA 5ETPA 2GUIA 2VA2A 4MTPA 3VQ9A 2HS4A 3CERA 3RJFA 4B9TA 4CZJA 3L2QA 3I0SB 2PXIA 5E41A 4EBEA 4BWJA 2NXNA 1SJQA 4ID5B 2JFDA 2NRRA 4K4VA 5C12A 1ZQOA 1N5WA