1XWLA

Bacillus stearothermophilus (newly identified strain as yet unnamed) dna polymerase fragment
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Crystal structure of a thermostable Bacillus DNA polymerase I large fragment at 2.1 A resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Dna replication
total genus 206
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1xwlA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1xwlA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xwlA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xwlA01
1HJRA 3C5GA 3KD5E 4BWMA 4Z4GA 1ZQTA 2FBTA 4HYKA 3SQ2A 5DG8A 3N97B 3CQ8A 3Q8KA 5D4BA 1UOCA 3PMNA 1RDCA 4DS5A 4NCGA 1RT2A 4YR3A 4I28A 1NKBA 3NF6A 4AHVA 4I2FA 5J1EA 3S3MA 5DG9A 5FROA 4DL6A 5HRNA 5KFPA 2ISPA 1LWEA 2JLEA 2J6UA 2ZTDA 4E7KA 3OYCA 4ELUA 2C2RA 2XHBA 5IIMA 3THVA 4CJWA 3RBEA 4F4ZA 4DFKA 2PFNA 3AU6A 2IHNA 4Q0BA 2FC0A 2F1IA 4FJ8A 2AJQA 4TUPA 1NK9A 1ZQAA 4EZ9A 3LP3A 4WE1A 1S1WA 4KLGA 3JPTA 5IIJA 3KHRA 3M8RA 2HB5A 4ECZA 2HHVA 4KHSA 3K2PA 1D5AA 3TANA 3Q8MA 3ISBA 3FFIA 8ICPA 4I2DA 1LWCA 3WNHA 4BDZA 2M9NA 2OWOA 2FBVA 2J6TA 3RMBA 3SQ1A 2OPPA 4J9MA 1DTTA 1REVA 1RBRA 5DK5A 2PY5A 3RJFA 4DSJA 4PGXA 3L2VA 1ZYQA 4B9LA 1XHZA 5HMMA 1ZBFA 4B9TA 4NCBA 4RQ1A 3MDCA 5BPCA 2IBKA 1MSWD 1A5WA 3MABA 1ZQVA 3BGRA 4M6WA 4F5OA 3TFSA 8ICCA 4FM2A 3TAGA 5KFHA 1KVCA 3ETLA 3DLHA 4QZ8A 4I27A 3U6FA 4CFAA 4OJRA 3NGIA 4KLFA 4PUOA 1WLJA 3K5NA 1V9PA 3MR6A 4F4KA 3QESA 3F73A 3M8QA 4CK3A 2R8HA 4DOAA 1JLFA 3MDAA 4F5RA 4Z6DA 2R8JA 4DMNA 1C1BA 4ZTJA 3OYLA 1T3NA 5KFMA 8ICQA 3ZSXA 3ORYA 9ICJA 4AILC 1ZQPA 4DTSA 3HVRA 4M9JA 5J0YA 3SPYA 2I9GA 4YR0A 1CZBA 2FMQA 3NH2A 1VK0A 4ED2A 4F5PA 4O5KA 3O4QA 1ZQLA 5CHGA 3T5HA 1NJZA 9ICPA 4MF8A 3MGHA 3AA3A 4R8UB 4KI4A 4PWDA 7ICJA 2GUIA 4N76A 1ZBUA 1XU4A 1GOAA 4O44A 1A76A 4KMUA 9ICFA 2R8GA 3TFRA 1MU2A 3E01A 4J2DA 1S0MA 3LPTA 2KZMA 1X9MA 4CJ5A 1U49A 4M9LA 4DOBA 1S9GA 3JPPA 4PHPA 1EETA 4YQWA 4MFCA 4HUEA 1UA0A 2A1RA 4DU4A 2FBYA 2D0AA 2R8KA 3RH6A 1HNIA 3TAPA 3KHHA 3QERA 3HPHA 3HP6A 5IIKA 1WSHA 2KFNA 4Z4HA 3Q8LA 1IM4A 1KSPA 2BKEA 3MEDA 1B92A 3RB4A 3T5LA 1TGOA 9ICBA 5DBBA 5DB8A 1SKRA 1SL0A 1U9LA 1WSJA 8ICBA 3SI8A 4HUGA 4KTWA 1QE1A 4I7FA 1RDDA 4QZGA 5J2AA 1FK9A 3QEBZ 5J29A 3V6JA 4KV8A 4E1MA 1JL1A 8ICMA 4M0AA 2ZUBA 4FCYA 2G8VA 4NLNA 3EPGA 4E89A 5J0PA 1RYSA 1X9SA 1U48A 3AA2A 4CHPA 5CP2A 2NRXA 2WOMA 3AO2A 3MXJA 4IQUA 1S6PA 1L3TA 4YMNA 4DSFA 1HUOA 4O5BA 1XS9D 9ICOA 4C8OA 4DEZA 2O4IA 1AROP 1Z00A 2WONA 1VSMA 1TKTA 4M04A 1YTAA 3OVNA 3RH4A 1DGSA 3H8SA 4MFFA 2ZQBA 4PY5A 1Y88A 1C0MA 3AO3A 3I0RA 4YN4A 3C21A 3V9SA 1ZQYA 1IO2A 4RNOA 3QEXA 3DRPA 3K5OA 1ZQBA 2OPQA 5KFLA 3SYZA 4CESA 1JLCA 4BXOA 3H8JA 1K1SA 1JKHA 3VQCA 5HP1A 4B9MA 5BOLA 4H4MA 4Z6FA 1U04A 4I2GA 4EBEA 4CFCA 2P5OA 4KN4A 4AH9A 2NRZA 4UQGA 3KHLA 1QHTA 4O3RA 4F50A 5HMLA 2DFFA 3KIOA 4M3RA 3H08A 4RW7A 4YG2A 1Q9YA 1ZQEA 1JMSA 2G8FA 4Z4EA 1XO1A 1RZTA 1N48A 4EZ6A 3UIQA 3DLGA 2C2DA 1EXNA 2G8IA 5EWFA 3NH0A 2XRIA 3E2EA 4Q5VA 3TWHA 3OYFA 1JX4A 3NCIA 3IG1A 3OYBA 8ICLA 4F2SA 3H4DA 5L1KA 3TARA 4Q45A 3RRHA 1QSLA 2P6RA 3EW9A 1LW2A 3JSMA 4KB0A 4DSIA 2JZBA 4RPYA 2J6SA 5CYMA 4E3SA 4YD2A 1ZQCA 3KLFA 3UXPA 7ICIA 2JEFA 3M9OB 7ICPA 4R66A 2IGIA 4KI6A 5CA7A 2C22A 5KRSA 1TK8A 4TQSA 4B9NA 4ECTA 1WAFA 4J9RA 5I42A 3OYAA 4J2BA 4KLHA 3PNCA 1QSYA 2XCAA 4GC6A 1MQ2A 4YVZA 1XSPA 5BOMA 1S10A 3LP1A 7ICFA 2Z1IA 4CCHA 1TK5A 3HVTA 1A5VA 4DL2A 3AVNA 3SUOA 3KLIA 3HM9A 5J2DA 4UB5A 4O5EA 3VA3A 3V81A 1IXRA 3DM2A 2A1SA 3C6TA 2H5XA 3V9UA 4FJLA 3MGIA 3S9HA 1SUQA 5J0OA 2Z1GA 3JPQA 3UXOA 2ASJA 3H8WA 5HROA 8ICVA 3QEIA 2Z1JA 4PHEA 1N5YA 1WN7A 2AGPA 4KAZA 4FLUA 4FJMA 1TKZA 4OKEA 3F9KA 1WAJA 4IQWA 2XC9A 4DTNA 4CEOA 4J9OA 4YCXA 1UT5A 5HBMA 3PW0A 2DY4A 2F96A 4EP5A 1VRTA 2HNDA 9ICEA 1D9DA 2Z1HA 3OYGA 5J2JA 3K58A 4ZTFA 3T5KA 3ZSOA 3O4NA 5J2EA 4I2JA 4QZCA 2BQRA 5HHIA 4R5PA 1GOCA 1NJWA 4I2PA 1FKPA 3T19A 4RZRA 3AV9A 3HL8A 5J0TA 3OGUA 4J9NA 2B21A 4RNMA 3L2WA 4CF8A 3ULDA 1H38A 3M9NB 5HLFA 4M3TA 2FLNA 4DTXA 3GV7B 4CJSA 4FK4A 1S1VA 4DOCA 4I2AA 3WNFA 3HSTB 2E6MA 3RB0A 4O3SA 3SUPA 2W9AA 3ZSRA 1IKYA 3O3FA 2JEJA 7ICOA 3KK3A 4ED8A 3CG7A 4OPJA 3DOLA 3ZSYA 1JXBA 8ICUA 1FKOA 1J9AA 4ZH4A 3HWTA 4M3ZA 2XO7A 2DFLA 5F9NA 1X1PA 1N56A 2HVHA 4CEQA 4DQPA 5J0WA 9ICGA 3EPIA 3OYDA 1ZQMA 2FBXA 3L3UA 2YV0X 4CK2A 1ZQRA 1Q9XA 5HRPA 2RDIA 9ICSA 9ICRA 3HYFA 2GBZA 4PHDA 3QNNA 4FVMA 2B4JA 4KPYA 4JRQA 4CECA 5KFOA 3ZSWA 3SV3A 2NRWA 1JLGA 4NM1A 4CGFA 3TAFA 4RNNA 3CFRA 4LSLA 4BDYA 4DWIA 3RJEA 3SI6A 4M45A 3ZDDA 2RDJA 1EXQA 4CF0A 4RQ6A 4YP3A 4IG0A 4ECRA 1ZBHA 4B9UA 2F1HA 4XA5A 1VSDA 3AU2A 2IOCA 1TKDA 5DQGA 8ICTA 1T4GA 8ICOA 2YNGA 4YFUA 4C8LA 8ICEA 4CEBA 2YNFA 3ZCMA 4UAZA 4C8MA 3L2QA 7ICVA 3QLHA 2BHNA 5KFZA 5DQIA 4UBCA 3C1ZA 4I2BA 5JUMA 4QWDA 2AQ0A 4YXMA 3C2MA 4ED3A 1XHXA 3RRGA 1KDHA 4K4IA 3C2LA 4LVSA 4ECVA 1IG9A 4ID1A 1WCNA 4F2RA 4BGDA 4FZZA 4QW9A 2BQUA 5IIIA 3V7JA 4GVMA 3KKRA 4GXKA 1J53A 4DTUA 2W8KA 1EX4A 1KFTA 4DSKA 4F92B 4OLAA 4OPKA 2PI5A 2RN2A 4FYDA 2PI4A 3G10A 2XY6A 5KFKA 3VQ5A 3QIPA 5D3GA 1D9FA 1UT8A 5KG2A 1WSEA 4FO6A 1ZBLA 3WNEA 8ICYA 3MFHA 3D45A 2P66A 4Y1CA 4FM0A 5DGBA 5FDLA 3NDKA 2W9CA 2PFPA 2HNYA 2A1JA 8ICIA 3UPQA 4YMMA 2VG6A 1WNSA 3KK2A 3P1GA 1NK5A 3NGDA 3UQ0A 1EP4A 4JRPA 3C95A 4H4OA 1ZETA 4N5SA 4KRFA 4EYIB 4PGYA 1WCLA 3B0XA 3RH5A 1ZQQA 4R64A 3RR7A 5SWMA 2PFQA 4B3OA 4F5QA 4HTUA 5KG3A 1ZQXA 2Q3SA 4CEEA 2X78A 8ICFA 2BCSA 3BQ2A 2JEGA 5KT2A 4G3IA 1HRHA 2RKIA 3SUQA 1QLNA 3PO4A 3CM6A 3PUFA 1BI4B 5KGWA 1IKXA 4DFJA 1TL1A 2W42A 4N47A 3HPOA 3IS9A 3VQ6A 1BPDA 2VANA 3VQ8A 1A77A 8ICZA 3ASMA 3G6YA 1S77D 3Q8PB 4DLEA 4Z4IA 1T7PA 2KW4A 3LPUA 3OS1A 1Q8IA 3NE6A 2PYJA 5J2CA 1UAXA 4PHAA 1JL2A 3IRXA 2IA6A 3AVIA 3BQ0A 1TV9A 3NF8A 4RW9A 3NGYA 2D5RA 3TAQA 4QCLA 5DDYA 4Z6CA 5J2GA 2ZTEA 3PY8A 4N56A 4DTPA 4O4GA 4J2EA 4ECWA 3OSPA 3ZDBA 5KT3A 5KFRA 4QZ9A 2W9BA 3RTVA 3K5LA 1ZQGA 3SJJA 3PR4A 3VQ7A 1LB2B 2KN7A 3A2FA 3SQ0A 4IQTA 7ICLA 3DRSA 1RT1A 4KREA 4DG1A 1LV5A 1LW0A 9ICWA 3K75D 4MFAA 9ICMA 1RT3A 1NKEA 5KFNA 4CEFA 4MEXA 5FRMA 2IDOA 3PMLA 1YVUA 4CJ3A 3DMJA 2ZJAA 1NK7A 3TAMA 4JWNA 4NLZA 4IRCA 4O3QA 1UA1A 4DF8A 4RW8A 4E1NA 3OYIA 4DFMA 5DMRA 4M3YA 2JGUA 4M3UA 4IR9A 3PX6A 4YFKA 3ZT0A 3K5MA 4EP4A 5KFEA 2PXIA 4CHQA 4KLMA 4NM2A 4R65A 3OHBA 2D0BA 3GILA 4UB4A 4UBBA 3O3HA 3JYTA 3SQ4A 4RT2A 3KJVA 3V7KA 1KFSA 5KG4A 5J2BA 3RJJA 2ZJ5A 3S3OA 4UAWA 1W0HA 4FLVA 4DU1A 3PX4A 4QW8A 3Q8RB 4FW2A 4KITB 4F91B 7ICUA 1VSKA 4E0DA 3V1QA 5J0UA 3I8DA 2OPSA 2MUTB 3V1RA 2V9WA 2WTFA 5C5JA 4RUCA 2FMPA 1S0NA 4FM1A 2VA8A 3UXNA 4ID5A 4QZAA 1C7YA 9ICTA 4B8AB 4CJRA 2FLPA 3ZSZA 3MEEA 4R63A 5KI6A 2F8TA 3VQQA 5EOZA 1Y97A 1S97A 4CIGA 4KLSA 2QKKA 5KG5A 4RG8A 4EBDA 4PA1A 1RXVA 3RR8A 7ICEA 4CGGA 3ZT2A 1LAVA 5IILA 4GLXA 1L3SA 5L1IA 3PW4A 4Y1DA 3MBYA 5IINA 4CHOA 3NF7A 1BQMA 4F4YA 4JV0A 1COOA 4FJ9A 2F1JA 4XIUA 1NK0A 3RJHA 5DDMA 5DB6A 4RQ8A 4RQ3A 1XWLA 2XY8A 9ICLA 1VSFA 4DO9A 3DLRA 5EWGA 3ZDAA 2E4LA 4LD0A 3G6XA 2HHTA 4IRDA 5TZVA 3AO1A 2BGWA 5DGAA 1BCMA 3AVGA 1IKWA 4OGEA 3U3GA 4L8RB 3H4BA 3G6VA 1T05A 4IDKA 1YT3A 5KFAA 1HUZA 2BDPA 3PX0A 2KQ2A 5L1JA 2VA2A 4PGQA 4Q8EA 3M9MB 3QIOA 4FJGA 3JPNA 4KTZA 4F8RA 4FW1A 4CFDA 2HHSA 1D8YA 2NRVA 3QNOA 5KFQA 4Q8FA 2D0CA 1JXEA 4J9SA 4I29A 1ZQFA 1BPEA 4P4PA 4X5VA 1L3UA 4QZEA 4YD1A 3PR5B 1K6YA 1MQ3A 3VQPA 4KLOA 5KFTA 5J2KA 2R8IA 2JEIA 3SNNA 1BPYA 3S3NA 1BPXA 4F3OA 4RQ2A 4W5TA 3NH1A 4PPXA 1MC8A 3LWMA 3KLGA 3V9WA 3MXIA 4YXJA 2P1JA 4DTRA 4KLUA 3GIKA 3DYAA 2UVUA 3ZDCA 4JUZA 4R8UA 4B08A 2G8UA 4QZHA 5CJ7A 2AGOA 1BPZA 4Z0UA 3NF9A 4LY7A 1ZQUA 1ASVA 1NJYA 2Y1JA 1KLNA 3UQ2A 3C94A 4I2QA 5HRRA 4CF2A 3B6OA 4N41A 7ICTA 3KLHA 3C5FA 1UWBA 3QETA 4QAGA 5KFGA 2I5JA 1CXUA 4NYNA 2AU0A 4OLBA 4NXZA 2ETJA 4OVLA 3DRRA 4KLLA 1VRUA 4K4GA 5KFJA 4J9PA 5KG1A 5CR0A 4BACA 9ICAA 2PFOA 3MFIA 4M6WB 1S1UA 1TK0A 4IKFA 3ZD9A 5DLGA 4QWCA 2QXFA 4ECUA 1S5JA 2XGPA 4ELVA 1D8LA 3BQ1A 1ZQIA 4CIEA 2BPFA 1ZQDA 4DLGA 3MECA 3QZ7A 2XCPA 2DPIA 5KTQA 4FBUA 2RF2A 1KVBA 1S0VA 1NOMA 4FJNA 4LZDA 4CF1A 2G8KA 3G0ZA 1KLMA 4MEYA 3M8PA 5CWRA 4FJ7A 2B6AA 4RQ7A 4HHTA 4BE1A 4FLZA 1JLQA 3AO4A 3C1YA 1S9FA 2YKNA 5J2NA 1T03A 2FPMA 3VA0A 3MR3A 4GW6A 3EWAA 4M2YA 3OJUA 3HJFA 5IIOA 4CHYA 1TVAA 1RTDA 3AA4A 4W5OA 4GMJB 3GDXA 5DB7A 5F9LA 1WSFA 3KKSA 5HRSA 3V72A 3PW5A 1N6QA 2C2EA 1KTQA 1XSLA 3AVHA 1DOQA 1VSHA 3CFOA 2IAJA 4O0JA 1TFRA 1RTHA 3H40A 3BDPA 2FMSA 2UVRA 3LANA 4AHTA 3QEAZ 1ZQZA 3H7IA 3L2RA 3L2UA 4CJ4A 4J9LA 5DBCA 1BISA 5KT5A 1TAQA 4GXIA 3JPRA 1NK8A 1QS4A 4CK1A 2BCQA 4QZBA 3LDAA 3MR2A 4ZHRA 4UB2A 4YMOA 1SL2A 3EY1A 2ASLA 2EX3A 1JLEA 2HHWA 1HNVA 4EYHB 2VG5A 4CF9A 4FJXA 3ISNC 4NYFA 3U3YA 4HCBA 5J2PA 1BVSA 4F3TA 1RTIA 3KD1E 2HMIA 9ICUA 3OYEA 4F4WA 1BCOA 3VQDA 3RAXA 5C24A 3HT3A 3PO5A 3I0SA 1X9WA 4TURA 3TAEA 4JLHA 1BPBA 1HPZA 2GV9A 4B9SA 4CJPA 3K59A 2AGQA 3AUOA 3SZ2A 4FXDA 4DL7A 2P51A 1NJXA 2RPIA 8ICHA 1RT4A 3HW8A 3OJSA 3ZT3A 3VQAA 3DOKA 4OKJA 4FS2A 1SKWA 2NUBA 4QZIA 2ATQA 2HHUA 1I39A 4K4HA 1DLOA 3AVJA 4M9HA 3ZT1A 1NK6A 4JWMA 4B8CA 3HP9A 4I2EA 4CEDA 4O3OA 1ZQSA 1Z00B 2O4GA 1TV6A 1HYVA 2HW3A 4I2HA 2C28A 3NAEA 4BE0A 2VA3A 3OS0A 4ICLA 4P4OA 5KFDA 4FLXA 1KRPA 5C25A 4IFYA 4ED7A 5L9XA 4J2AA 5KFYA 2HHXA 4KHQA 4O55A 4CGDA 1J54A 4Z4FA 7ICRA 4KLIA 2BCVA 4FJJA 4LH5A 4E7HA 4BXOB 4ELTA 4QZFA 2PYLA 3ZD8A 4O0IA 1B9FA 3NHGA 3MEGA 4TQRA 2IMWP 2VG7A 2ZD1A 4M42A 8ICKA 3D0PA 1VSIA 4CJVA 4CHZA 3AVLA 3T1AA 4FS1A 1WSIA 2VWKA 2FLLA 1DTQA 4LSNA 4MFBA 3CFPA 1LWFA 4FJIA 3V4IA 3SV4A 4FK0A 1CXQA 3LAKA 3Q8SB 4MQ3A 5T7BA 1B43A 4YNQA 4KLTA 3RB3A 4KB1A 5DKWA 5L1LA 4UAYA 4FK2A 8ICXA 2YNIA 4IQVA 4CEAA 3KLEA 1BHLA 4FLWA 3LP0A 2ISOA 3GIJA 4DF4A 2I1QA 3NTUA 2XGQA 3RMCA 4HCCA 3HO1A 8ICJA 4CJUA 3T3FA 4ECQA 1VSEA 3GIIA 5K14A 4HUFA 5KFSA 2Y1IA 3MXMA 3BJYA 2ALZA 2JZBB 3B0YA 2Q0ZX 4FJ5A 5J0RA 2W8LA 1ASUA 4W5RA 5DQHA 2KFZA 9ICXA 2VWJA 1C0TA 4QWEA 3LZJA 3DLBA 1S6QA 2V4RA 4EEYA 1S1TA 3DLEA 3NBPA 3ZSVA 2IS3A 3DI6A 3C2KA 3OS2A 3K57A 1SZPA 1WSGA 1ZBIA 4O3PA 5KRTA 4KLDA 4IRKA 4CJEA 3TR8A 4DU3A 4ECSA 3QINA 5KG0A 4F93B 4CEZA 3L8BA 4JS4A 3JPSA 5C42A 4Z6EA 4BWJA 1TAUA 1RNHA 3AVCA 4CJKA 4IBNA 3ISDA 2FPLA 4J9KA 4C8KA 4B9VA 5E41A 3RJKA 9ICNA 3LZIA 1EKEA 3N4MB 5KT6A 1RT7A 4YR2A 4FLYA 4JV2A 5HP4A 4Q43A 3AVFA 3GQCA 2X74A 8ICNA 4M9GA 1HYSA 3MR5A 3V7LA 1I3AA 9ICIA 2DPJA 4UB3A 1RT6A 1CUKA 3OYJA 1RBVA 1RBSA 1C1CA 2BANA 3P5JA 3T5JA 2OZSA 1RPLA 1S9EA 4DSLA 9ICQA 8ICSA 4OKKA 4RQ0A 3IHQB 1BL3A 3OYKA 2HVIA 4M3XA 3V9XA 2X6NA 3IAYA 5DLFA 3KK1A 7ICQA 4I9QA 2F8SA 4RPXA 3NGZA 2EHGA 4I2CA 4KHUA 1QSSA 5KFCA 3KHGA 1LAWA 5CZ1A 4O3NA 4TUQA 3HX0A 4O5CA 3AVBA 2LYHA 5J2QA 4CGJA 3M8SA 5J0XA 5KG6A 3PW7A 4KKOA 4TSXA 2FPKA 2IC3A 4XUSA 1KCFA 4PH5A 2ATLA 8ICAA 2OZMA 4K8XA 4QWAA 1JLAA 1W9HA 3ISCA 2KZ3A 3QEWA 4FZYA 1U4BA 1R0AA 5CZ2A 3OYMA 4BE2A 4KTQA 3L3VA 2PZSA 1NOZA 5JS1A 4CHNA 4F4XA 4CIFA 4JS5A 4DL5A 3AVKA 1RCHA 5FRNA 2X6SA 1RDBA 4IG3A 3VQ9A 2IHMA 1ZJNA 3CM5A 2R7YA 5KT4A 4DTJA 4RW6A 1NK4A 3TABA 3V6DA 1ITGA 5SZTA 1BIZA 2BCRA 4FZXC 1CLQA 1TKXA 3VQ4A 1JLBA 2BE2A 1NKCA 3MAQA 2XY7A 4DL3A 4E7JA 4FBTA 4OGCA 4CGHA 3NFAA 7ICGA 1CEZA 3HXMA 4DQRA 5KFXA 3V6HA 4ED1A 9ICHA 4BDPA 4FJKA 2BPCA 2G8WA 2NRTA 4P2HA 3LK9A 3PV8A 1L5UA 1FXXA 4LH4A 4NLGA 5I3UA 1BIUA 1ZQNA 1KEJA 4TUSA 4RW4A 4E7IA 1ZQKA 4FJHA 3RJIA 4E19A 4GC7A 1RILA 4DFPA 2OPRA 2OA8A 4KN7A 1HJPA 3DLKA 3OHAA 1BI4A 5KFVA 4NCAA 1U45A 1G15A 2ZJ8A 2GWSA 1TVRA 2BR0A 1RTJA 5CY4A 4ECYA 3RJGA 7ICKA 5JS2A 2DTUA 4PQUA 1Z3EB 1ZJMA 2V4QA 4IR1A 4CE9A 4HVJA 3LAMA 4NLKA 4DQIA 4NY8A 3CYMA 2BCUA 1CZ9A 2DFEA 1ZQJA 1VSJA 4G1QA 2P5GA 1ZQHA 1C6VA 3HPGA 5D49A 1Z25A 1QTMA 3OY9A 3Q8QB 2KZZA 2LSNA 1HQEA 1XI1A 4C8NA 9ICKA 3RBDA 3AO5A 3ZDEA 3QE9Y 2BQ3A 1BGXT 4Z4CA 4M41A 1L3VA 5EWEA 9ICVA 1K1QA 1KFDA 3GFKB 2W9CB 2A1JB 5HHHA 3P83D 3VQBA 3LDSA 5KFIA 4DS4A 4Q44A 4KLJA 5EU7A 4GXJA 4AHSA 3JPOA 1B9DA 3V1OA 4JV1A 4P4MA 2B5JA 1F21A 3GV8B 4AHCA 4CJTA 3SPZA 7ICMA 4QZDA 4CERA 3OYHA 5J2IA 5KGXA 4UB1A 1ZQWA 3PVXA 1SL1A 2OYQA 4DSEA 3WNGA 1JN3A 1JXLA 5KFFA 4RPZA 3AVMA 3PW2A 2E6LA 1TL3A 4CFBA 4ED6A 5KFBA 3RB6A 5J2MA 3LALA 1QQCA 2BGGA 3FYHA 4KHNA 4KHWA 3RMDA 2YNHA 2HHQA 2ZE2A 4H8KA 4CJFA 4W5NA 3EYZA 8ICRA 5CB1A 4I2IA 8ICWA 5KG7A 4RQ4A 5DBAA 2BPGA 1C0UA 7ICSA 1HYZA 4XRHA 1ASWA 2P6UA 4J9QA 1IH7A 2MUTA 4IFVA 3AA5X 3VN5A 1Z26A 4KHYA 3LWLA 2ITGA 2MAXA 3EZ5A 4O9MA 4ECXA 4W5QA 4KO0A 1NOYA 1GOBA 4QOZB 4ED0A 3B6PA 1HMVA 3C6UA 5DB9A 2W9BB 1O1WA 4KFBA 3GV5B 4DL4A 4AHRA 4DQSA 4RUAA 4CGIA 1PZNA 4M47A 2YKMA 1VSLA 3OSNA 2QKBA 2KTQA 4DTOA 1XSNA 3K4GA 1X2IA 5HNKA 2DFHA 9ICCA 1U47A 4KLQA 1S76D 4KLEA 3VQEA 4F5NA 1RBUA 5CYQA 3ITHA 4AHUA 1RYRA 4K8ZA 4M3WA 5J0SA 1B22A 3QO9A 2AQ4A 3KTQA 3O3GA 1XC9A 3AVAA 2YHAA 3ZT4A 3V9ZA 4RT3A 3ALYA 4JK1A 4XQ8A 4RU9A 3TI0A 3QEVA 1RBTA 5KFWA 2HNZA 4M9NA 3IM1A 1BQNA 4QWBA 4I9LA 7ICNA 2UVVA 4RQ5A 1J5OA 1RXWA 5J0QA 2ASDA 1S1XA 2ZUDA 1RT5A 3V6KA 2ZUCA 2UVWA 1SV5A 4DQQA 1T8EA 3GIMA 2W9MA 3RAQA 3FDSA 3C23A 1KVAA 3QZ8A 4E7LA 5KT7A 1A5XA 1HQUA 1RDAA 4MF2A 3QEPA 4DTMA 3SCXA 2XY5A 5D46A 8ICGA 7ICHA 3RWUA 2QK9A 3RMAA 4CJLA 5KFUA 1ZQOA 3LP2A 3HK2A 3TQ1A 3OYNA 4FLTA 1YTUA 1C1AA 5J2FA 5J2HA 4EBCA 4LZGA 3BQTA 3ZSQA 1IKVA 2YHBA 1S0OA 2ZTCA 1JIHA 3SUNA 2G8HA 1SKSA 4CJQA 5DG7A
chains in the Genus database with same CATH superfamily
1SC1B 1VC5A 3D67A 3CF5L 2MKHA 3LL3A 3N97B 2FZGB 1AFIA 3Q8KA 3U02A 1F5AA 3PMNA 2F4FA 3DLLQ 3HDSA 4NCGA 4YR3A 5JVGQ 4OI3A 4IFEA 4PG5A 5HL7Q 5J1EA 3VQTA 3QBCA 4RU2A 2OIHA 4PPZA 1ZD2P 4DL6A 4NXMK 5KFPA 4CF5A 2ZTDA 2HSZA 4CJWA 4DFKA 2E7VA 2VH7A 3UR0A 3RUBL 1S1WA 2FY8A 1ZD4A 2C2MB 4ECZA 2Z58B 3VERA 4KHSA 1KC8O 2R7OA 3M6KA 1D5AA 3IRUA 2EFVA 3TANA 4WK3A 3ET6A 5IT4A 3QU4A 1VQNN 2L9WA 1REGX 4MH8A 1B0PA 1X42A 2MU2A 4X64K 3HHLD 8ICPA 2W2OP 2OWOA 1N0VC 2FBVA 2H3VA 5IV4A 3SQ1A 2OPPA 4J9MA 3CCMN 1KHWA 4AQYJ 5IXUA 3RJFA 5GIPA 3L2VA 1J6ZA 4IDKB 1S49A 3P6YC 1XHZA 3QGHA 4B9TA 1FFUA 3QT5A 4MIAA 4RQ1A 3ILLA 4F04B 2ASOA 4HI1A 4CNYA 4F5OA 3N7SC 4RR5A 3K2YA 1OH8A 1VISA 1RKJA 1P90A 4FPRA 3U6FA 4ISGA 3N5BA 1BC6A 2ZH8A 3NGIA 4KLFA 1N88A 1V9PA 2QV6A 1HJOA 4CK3A 2DL0A 4O5FA 4MIBA 1JLFA 3MDAA 4F5RA 3CCLS 4P0PA 1OPZA 2FHJA 4OJHA 5KAIU 1UVKA 5CABA 5EVZA 5AIAA 2EAPA 2KH9A 1G4CA 3CCVS 3ZSXA 1TL7B 2W7PA 9ICJA 4AILC 3ZNUA 3AM9A 2PDAA 4JI8F 5GINA 4CLFA 1NDLA 3Q8VA 4DTSA 2V94A 3QB0A 4H5RA 3TEHB 3SPYA 2I9GA 2Q6BA 3H59A 1WC1A 1IWGA 3F41A 1ZQLA 5A8RA 2EWSA 5CHGA 2XTJP 4LFAK 4A2AA 4MF8A 1FRIA 4UAVA 1JXVA 4OQJA 2VWBA 2X1FA 4PWDA 7ICJA 4N76A 2GUIA 2E20A 4BRMA 1XU4A 4QIWF 4K42A 4PYAA 3EKSA 4J2DA 4F3QA 1GLFO 2KKPA 3P8BB 1U49A 1S9GA 4HVZA 1EETA 3GSIA 2F77X 3VAHA 5F8NA 4HUEA 4USJC 2FBYA 4B3RK 4DFDA 2FUG9 2QWMA 2VCPA 1FT8A 4H4KA 3QERA 3EE9A 1RWXB 4OJGA 2KFNA 4Z4HA 2E5GA 1XERA 3MEDA 1B92A 2DNRA 1N5WA 2PMZF 1S1UB 1ITPA 3LW5C 5DB8A 4KY3A 4JI8J 1UCNA 1WC3A 2ZM6F 1SL0A 4V1Ak 2LYAA 1S79A 5AXMA 3IUCA 3S6JA 3MECB 1WSJA 4DHYA 4H4KC 1PC5A 1QE1A 1RLCL 4I7FA 3VTIA 3THYB 4KQZA 1N5QA 5J2AA 2VBZA 2GO9A 3QEBZ 4FSVA 3QDKA 5F8JA 1G7CB 1S7IA 1B7FA 4DUZK 4NLNA 3EPGA 1RYSA 3C29A 2P9KB 1X9SA 3LPEA 1YJ9N 3CE8A 4MK7A 1APSA 2YWGA 5CP2A 1R8CA 2AF6A 3OR2B 5J2NB 4LF7K 3A3NB 1HUOA 3ILJA 4DBQA 3TUIC 5AQOA 5HR7A 4JYAF 2IBOA 3S01A 1Z00A 4LRCA 1VQKN 2O6KA 1N54B 1RTDB 3OVNA 5E0OA 2EDUA 3H8SA 2BJ7A 4U7BA 4X66K 1YVNA 1R0CB 2MKKA 3UCZP 5E3CA 1Y88A 1C0MA 3EZWA 2LEBA 3UM9A 4M5KA 4O23A 2IAJB 3DKDA 4RWXA 4RNOA 3QEXA 1ZQBA 1DGKN 1GXTA 3T41A 2ZM6J 2KMDA 3PM9A 3A3OB 1ZRMA 5BOLA 3A0HU 3CJ5A 4LF4F 4ZHRB 4Z6FA 2E2OA 4CFCA 3CJCA 1JLEB 1WYGA 4K0KF 4O3RA 2VG5B 4Y2AA 1V6HA 1SB3C 4U7UD 3KIOA 3SEIA 2IM0A 4M3RA 2F3JA 1Q9YA 1WHYA 1ZQEA 1JMSA 1RTIB 5GAEP 2DKZA 3UIQA 2NS1B 2AYGA 1T94A 1R0BG 3UN2A 3D0IE 3I56N 1EXNA 1NGBA 4TU9A 5C2CA 1Q8LA 4JYAJ 2NZTA 2QE5A 5F8GA 2KM8C 3R8YA 2MQMA 1RHJB 3OR1B 3WXMB 1JX4A 2UUCK 4AL5A 3IG1A 1RT4B 2XS5A 1CZAN 2YHXA 3NVVA 4USWA 3GG0A 3BKFA 2FI1A 5L1KA 1H3DA 4URSA 2CJYB 1WELA 4YY3K 3TARA 2EBEA 1IG8A 2CPRA 3UD5A 2NV3A 1CJTA 1LW2A 3EW9A 1HBOA 3JSMA 4ETXA 2KRBA 1HNWK 4RPYA 5CYMA 3W0LA 4YD2A 3UXPA 7ICIA 1Z4UA 7ICPA 2IGIA 3HOSA 3DAWA 4LF4J 2HBZB 3M8WA 4PWWA 5KRSA 5CQGA 4PWUA 4TQSA 4O4RA 2Y9TA 4K0KJ 4IFYB 3ULEA 2BZFA 1QSYA 4GO5X 1MQ2A 2GJIA 3MM5B 2ZVSA 7ICFA 2V6AA 4CCHA 3HVTA 4DL2A 3MPVA 5B66U 3BBBA 3KLIA 4NL5A 1Y5NB 3HM9A 4F72A 4UB5A 4B1YB 1GT8A 2Q43A 3I55N 2ZD1B 1IXRA 1OH6A 2YMPA 1O5JA 5HMYA 3MGIA 1SUQA 3JPQA 3UXOA 3H8WA 2G1HA 8ICVA 3ISND 3KDOA 1N5YA 1DTQB 1WN7A 2DVIA 2AGPA 4MFBB 1WTFA 4OI4A 3V4MA 4F7VA 3V4IB 2GX8A 1FFSB 4KC5A 4DTNA 3O6WA 2V2ZA 4YCXA 2YX1A 3TW0A 5HBMA 2DY4A 1NZAA 2HFNA 3A5LC 3KLEB 4RWTA 2CGJA 3LP0B 3AA9A 5J2EA 4I2JA 4A47A 1NJWA 2ZKUA 2JDJA 3T19A 1X66A 4GMKA 1KQGB 2MPUA 1KTVA 3L2WA 3SSQA 2A2DA 4P0QA 2RP5A 3D7SB 2VQFK 2NNWA 5HLFA 3H1VX 5HMWA 4DTXA 1OJ4A 4I67A 1RA6A 5F2RA 4CJSA 2CDRB 2J8AA 4K50A 1AW0A 2E1CA 4F0HA 1QVGR 3WNFA 2VV5A 5LJWA 3GE1A 1RHKB 3SUPA 4KR0B 3ZSRA 5IZHA 3CRXA 7ICOA 3VZIA 2LHTA 4OPJA 3R2CJ 5KOWA 3D1QA 5GAHI 4ZH4A 2JZ5A 5CD4A 3HWTA 1IBLF 2WVFA 3MEKA 2XO7A 1SJ4P 4LC9B 4QQBA 3H46O 3O5TB 2HVHA 1QQ7A 3WU2U 3WKCA 3S7RA 5CD4H 3Q24A 3OYDA 1N60A 2YV0X 2HAFA 5CHIA 5HRPA 2P9SB 9ICRA 1QTNB 3EWGA 5KPTA 4PG6A 1IVZA 1J27A 4FVMA 4YEAA 4KPYA 4JRQA 2BANB 5CCLA 4Y2KA 5ETKA 3AAWB 4IC9A 4NM1A 1S9EB 4K59A 3FR0A 2NUHA 3BS7A 3GU3A 3GCWP 5M1OA 4BDYA 2G13A 1YITS 3HFZB 4KH1B 2VFUA 3OA9A 4RQ6A 4PL2A 4FPIA 5F1XA 1IUJA 5HN0A 2JC0A 2IOCA 5DQGA 1U0SA 8ICTA 2Q1LA 3TWZA 4KGVB 1CJVB 1A0OB 5C7PA 8ICEA 2H5JB 4CDGA 3CD0A 3ETMA 2DPNA 3GJSB 3DNCA 3ZCMA 1X9JA 5J2QB 5IC4B 4X4PA 5KFZA 5DQIA 4LT6A 4RBVA 1NNDA 1KHVA 2OKQA 3C1ZA 2IC3B 4A2BA 3GR0A 4AP9A 1TUYA 3HKZC 4YXMA 2ZH7A 2KYXA 5C10A 2QC3A 5ETOA 3VQSA 1KDHA 2HFOA 1A6LA 1BHNA 4ECVA 2NR0A 1IG9A 4ID1A 1QAIA 3D6HB 4QW9A 4G9ZA 1NGIA 5IIIA 3FZFA 4GVMA 2GV1A 2CXEA 1HD0A 2VJVA 2GIQA 2P2CB 1CRXA 2CPFA 1J53A 1HI8A 5H9FK 1YHQS 1ZTWA 2V0NA 5IM0A 4DSKA 5E2QA 1HUXA 5D3GA 1LKYB 3WNEA 8ICYA 3MFHA 1FNXH 1P9YA 2FZKB 4HTJA 4C7YA 2PN6A 2YHWA 4OX6A 2PFPA 3WEEB 1BMQB 1ZRNA 3R5BA 3GDQA 1JLBB 1JWWA 1F60B 3R5AA 1H72C 1WNSA 4JK7A 3KK2A 2GH1A 4M5DB 2GVDA 1B3TA 3C95A 3IAS9 3MWPA 2KVCA 4EYIB 4L75A 2JWLA 4NLCA 4PGYA 2E29A 2EEYA 4JKDA 3RH5A 3RR7A 2DNHA 2AJ2A 3ZTPA 3CMQA 1YF5L 4HTUA 2ZBQA 5DM6Q 3FBCA 4NA3A 5B08A 4CEEA 2OPRB 3KJQB 2E5IA 1UZHA 2VPWB 5E7OB 3DLKB 3R9PA 5KGWA 1IKXA 4DFJA 1TL1A 1T6DA 2ZIXA 2JXJA 3OFHA 3CMAS 2CQ0A 3IS9A 4FF3A 3EZUA 3SDEA 3KD3A 3R5JB 5A8WB 2VDHA 1S77D 4DLEA 4Z4IA 2Q31A 4PXBA 4PHAA 2IA6A 4LQ3A 2D3O1 3BQ0A 2IJNA 1M90T 1FD8A 2UUAF 1GO3F 5J2GA 1LVHA 1Q18A 1U7LA 4NPOA 1HQEB 5AQUA 3BDEA 2WK4A 4DTPA 4J2EA 4CZMA 4ECWA 1YJWS 3B78A 2HQ3A 5T41A 4UW9A 4G9BA 4AL6A 3N7RC 2ATCB 1ZQGA 3PR4A 2DRDA 1LB2B 1FCAA 1QY7A 7ICLA 4PKIA 1PC4A 1LV5A 4CLPA 9ICWA 3U4LA 4MFAA 3GYNA 1NKEA 4Y2SA 5KFNA 2HWHA 4CEFA 4OV6A 4LF5K 2O8EB 1NBEB 1NDPA 5FRMA 2MJNA 3AOAA 5ETRA 3W5YA 3NGSA 4KE5A 4LUBA 2VC0A 5D4LA 2HAIA 1NK7A 3MMAA 3CJBA 3HHLA 4NLZA 4IRCA 5BRHA 3TADA 4EHUA 2F4VF 5L1MA 2E5LK 1UA1A 4E1NA 4RW8A 3J81Y 4DFMA 3EGNA 2MSNA 4K5SA 1QHAA 2A1BA 3ZT0A 2KT5A 1N5TA 2UUAJ 4BX9C 3MK6A 4U95A 1GTHA 3MM7B 3ICXA 4UBBA 2D0OA 3TADC 3JYTA 3SQ4A 1T9VA 3JAMU 3MUMP 3BS5B 2CNOB 3KJVA 3CC4S 3V7KA 1KVKA 4XDDA 1VQON 1TYQB 2YQ1A 3RJJA 3S3OA 2K2PA 1JJ2R 1W0HA 2XMTA 3BSOA 1ZZNA 4H54A 2QM1A 2F8MA 4MTPA 1C0UB 3JTPA 4FW2A 4KITB 4ZOHC 7ICUA 4DR4K 5HQLA 2H3FA 4ED5A 2BJEA 4IFVB 3LDPA 1RGVA 1FNOA 3V1RA 1UVMA 2C3PA 5C5JA 4RUCA 2FMPA 1XIQA 4WZMA 3HJEA 3C6UB 1VHIA 2YTUA 4ZPVR 4IL6U 4QR1A 1W2BM 5ALQA 4ID5A 3FRZA 9ICTA 2F4VJ 3PFEA 2XYHB 3CPEA 4DV5F 2YKMB 3ID6A 2B9WA 4I6AA 4R63A 5A0LA 2VD3A 2F8TA 2UU9K 3HD1A 2WBMA 1S97A 1JCEA 1RWPB 4CIGA 4PZVA 4QYRA 2X3GA 1RXVA 1X6JA 1V97A 3AXKA 4IH5A 3ZZOA 4K25A 4C1NK 3HSJA 2KE7A 3QAEA 4Y1DA 2FJ6A 3MBYA 5IINA 4F4YA 4DPYA 3VF6A 4JV0A 4LR9A 4X2BA 2F1JA 4XIUA 4QPTA 2VIXA 5DB6A 1LWXA 3WX8A 3NS5A 3NY0A 1OO0B 3QBXA 1K5OA 3DLLL 3JAMO 4ILJA 2KNJA 4LD0A 1EB0A 3QU5A 1QM9A 5HL7L 3H8YA 2PC6A 1EQYA 1RHRB 3U8XA 5ALPA 3U3GA 2JWKA 2RQCA 3G6VA 4KBOA 4IDKA 4DV5J 1KVIA 1X5OA 2O8DB 2VJUA 1VAZA 4DX8H 2BDPA 3H3OB 3IXQA 1Q7YT 3ILOA 5L1JA 2H4WB 4J9VA 2DGSA 3N01A 4PGQA 4Q8EA 1U6FA 4FJGA 1IKVB 4G6VB 2FF6A 4FW1A 3J7YI 2CDQA 2QLBB 1D8YA 2NRVA 2KL8A 2BM0A 1NGEA 3QNOA 1K9MO 4Q8FA 2D0CA 3MHYA 1JXEA 4J9SA 2RS2A 1W25A 1H74A 5AM2A 3NAHA 4P4PA 3QJLA 2JGAA 3H90A 4MLEA 3AB2B 2LDIA 1MQ3A 2EK6A 1RT2B 5AI6A 1TL7A 2P9CA 1KOHA 5AICA 3S3NA 5L39A 4W5TA 3NH1A 3GPAA 3IG8A 3KBBA 2J0SD 5FPMA 2E9RX 4YXJA 3FCHA 1VQ9N 3GIKA 4Q0BB 1WJ9A 2LQJA 3HMJG 2VOPA 3EE8A 2G8UA 4M8LA 4FZMA 5BXIA 1PBAA 2B8QA 3WC2A 5CXTA 1RDRA 2D1KA 1FF2A 3UQ2A 1SV4A 5CE3A 4J37A 3B6OA 2C3OA 3QETA 2JRZA 3F56A 1REVB 4NXZA 4CLLA 4M1KA 2R7XA 1HD1A 1VRUA 4K4GA 5KFJA 1VHFA 4J9PA 1QH9A 3PTWA 5ALXA 3O0FA 1S1UA 2PAVA 1TK0A 4FDFA 1RBOB 4BUGA 1FDBA 2QXFA 2BJ1A 2BBEA 5JXSA 5CA5A 4CIEA 3IBFB 3MECA 4PUOB 1TELA 1JRPA 5KTQA 2DPIA 4FBUA 1HHQA 2FGOA 1M5KC 3CP8A 2LA6A 3THYA 1NOMA 3ZNJ1 1HX1A 2G8KA 4JD2B 3C8YA 5CWRA 1Q7LB 4LVNP 1U2VB 1C1BB 4RQ7A 2FSKA 1NRKA 3BO2A 1Q7YO 2P9KA 3C1YA 3KFUF 1UEVA 1NSPA 2LYBA 3Q86A 3OR2A 5J2NA 3SAFA 2FPMA 3L7OA 3MR3A 2VB6A 4NJ8A 1A6SA 3VENA 4DV1K 2DF4B 3SK3A 1CVJA 4CHYA 1RTDA 2J9CA 1FA0A 4Q7AA 1XQIA 3KKSA 3IA0A 1PAUB 3V72A 4XPCA 2YX8A 2JR5A 1MU2B 2IAJA 1TFRA 2HF4A 2BUNA 2FMSA 2ADCA 2PFUA 1OYDA 3HI9A 2O8BB 2OEKA 3L2UA 4K5RA 3M3ZA 3A8YA 2PIIA 3OTEA 2WRMA 1IV8A 4ZHRA 4UB2A 4YMOA 2G2YA 2NSBA 1RCXB 4JEPA 5AQXA 2EX3A 1YRUA 1JLEA 2VU5A 2HHWA 4EYHB 2VG5A 5M2PA 5A8KB 4EAHD 5EX3A 4B3TF 4FJXA 3ISNC 3U3YA 4ZPDA 1NJIO 1RTIA 2HZVA 2OEJA 2R7UA 3OYEA 1BCOA 1LOTB 4L3NA 2KO1A 3RAXA 2W24A 3HT3A 2ZH6A 3TO8A 1YAGA 3VF2A 3PO5A 2MHEA 3T1YK 3WK8A 4YOTA 2RQ4A 1WF0A 1ESVA 4JLHA 1ZD3A 1KWMA 1AB8A 2VKRA 1J2VA 3K59A 2CGKA 4JB8B 4FXDA 3OR1A 2ZUGA 2JHDA 1RT4A 4KV8B 3OJSA 4AT1B 4OKJA 4FVCA 2QWNA 4DV2K 1SKWA 1XNQK 3GU0A 4KIAA 3DXBA 2PO4A 2X51A 4PCQA 1YJNS 2HHUA 2DKXA 4K4HA 3D0HE 3B82A 3R1HA 4A4JA 1N5VA 2ZH1A 4WQ4A 1F3VA 1XJWB 2E2PA 2RRAA 1NK6A 4OJPA 4JWMA 3PACA 3HP9A 4O3OA 4QZVB 5HVFA 1Z4OA 2VFVA 2O4GA 3I5BA 1ZOLA 3L9ZA 4N8NA 4YB1P 3HI0A 4A59A 1TUVA 3GL1A 3OS0A 2IOFK 5BYRA 4FLXA 4B3MF 4IFYA 2Q0RA 4ED7A 2QSFA 3BV8A 1I94F 1UKUA 4B3TJ 4J2AA 2LKZA 4UZCA 1VK8A 2I38A 1FEEA 3MM5A 2LP4A 1J54A 3DRPB 4Z4FA 2HOEA 4FKYA 5HQMA 2GEMA 4TLQA 4BXOB 1VJ5A 3KWGA 3ZD8A 4KGKA 1CSJA 2KT2A 4H4MB 2IA0A 2ZD1A 5SUHA 3AVLA 2FHKA 2NXEA 4NEZA 2YB4A 1U1KA 2VWKA 1DTQA 1BO5O 4MFBA 1ZZFA 4BREA 3DLGB 4R0EA 2EWHA 1FVQA 2HHHF 1U24A 4LR7A 3V4IA 5KAKA 3Q8SB 4MQ3A 1B43A 3H7HB 4KLTA 4GVEA 2FE9A 3RB3A 2ES6A 5L1LA 4UAYA 3KLEA 4P7VA 3LP0A 3D6TB 3CDBA 5B5EU 4B3MJ 4QOTA 1YRTA 2X7IA 3OXFA 4NI2B 4L74A 1UL3A 4RNHA 4ECQA 1LXJA 1I94J 2NYVA 4HUFA 1E6VB 4K4SA 2DY1A 3MXMA 3IWXA 4KH6A 3MCPA 4W92B 3UN5A 3A12A 2ZJPQ 3SMZA 3UPFA 2ODGA 1FFWB 2MXYA 3DLBA 3LZJA 2V4RA 3ZXWA 3MCNA 2Z2YB 2DHAA 4DV7F 4JK9A 4LF8K 5KRTA 4KLDA 1JMTA 4CJEA 5G4DA 3AY9A 3QINA 3CCRN 3N5FA 2A10A 4Z6EA 4BWJA 1RNHA 3GP9A 4IBNA 3ISDA 4CH7A 1Y3JA 2HHHJ 3LZIA 5LOQA 3N4MB 1QVFR 5LMNF 2I1RA 4MDAA 1TTHB 3RFAA 4IEEA 8ICNA 2QMXA 3QFWA 3V81B 3H5YA 9ICIA 2DPJA 1XMQJ 2V7ZA 3T6BA 3G8TA 2P9SA 4I69A 1WTBA 4MAKA 1C20A 2E7WA 5HROB 2A40A 2D4WA 2BANA 4QIFA 2OZSA 1H2TZ 3EXCX 2I6XA 1S9EA 3F2KA 2R4FA 2OTLS 4RQ0A 2XMUA 1IBKF 4X65K 3TJ9A 1BL3A 4PG4A 5E3RA 4M3XA 2X6NA 3P5BP 1VRTB 3FQKA 5F8LA 4I9QA 1LQ9A 4RPXA 4UY8T 4DV7J 4J7CA 2NYHA 2DIVA 2EHGA 4I2CA 2I8EA 3OLAA 5JU5A 1CJVA 1URRA 2MSSA 6AT1B 4ZLLA 1DJ0A 1D09B 3QJJA 5J2QA 5FP0A 5KG6A 1SS6A 2IC3A 3CCUN 5F3TA 1DURA 1KCFA 3J80Y 3FZLA 8ICAA 4P9SA 4R25A 2OZMA 2UYTA 3OTBA 1YRXA 3AHPA 3ISCA 3UW1A 4FXWA 1HKAA 3TZXA 2GFFA 3ZFVA 2LYVA 2QA1A 3PNIA 2YWWA 3TQEA 1NOZA 3CO0P 4ZDNA 1FKOB 4CHNA 4F4XA 1SJ3P 4WU2A 4WCEL 1HWIA 3MM8B 1RCHA 3N4WA 5FRNA 5G5GA 3WX4A 1IBKJ 3VQ9A 2M3DA 2R7YA 3U26A 5AKZA 2CG8A 4B6JA 3OL7A 1LKYA 3OHRA 4C3MA 3FC9A 4DMZA 3SCJE 2UUBF 4FZXC 3VOVA 3WEEA 2KXHA 1JLBA 3MAQA 1VMBA 2MSTA 4FBTA 4OGCA 4ICAA 3MDFA 7ICGA 4J5OA 2YX6A 1FRMA 4M5DA 4A5AA 4FOEA 3U1NA 4U8VA 2BPCA 3LK9A 1FXXA 1BIUA 1UPMB 1KEJA 3WXLA 2FZCB 2HOQA 2ZVIA 3RZAA 1B7YB 4Y2RA 4GC7A 2OPRA 5D78A 3KG1A 4ZKAA 2JH7A 4DKWA 4NZ7A 3IR6B 2Y0SC 2YNFB 3DLKA 3G4SN 3I5AA 1X3MA 4Y0FA 1VQ4S 2J9DA 3O9RA 1G15A 2NREA 1BNOA 3H2VE 3NS1A 4DR5F 2PBDA 2JL9A 2BR0A 1VQ8N 2P9IB 4UQTA 2Q2RA 2DTUA 7ICKA 1Z3EB 4TY8B 3B54A 5A8WA 1IQTA 3QRPA 3CETA 2V4QA 5HJXA 2AJ4A 2H3EB 4IR1A 4HVJA 5ALMA 3G8QA 1T9WA 2F9JA 2UUBJ 3WHIA 3CYMA 1WOOA 1T95A 2W2PP 3D6MB 1OMSA 1MWMA 1C0GA 1QQ6A 5DM6L 3RGIA 1C6VA 2EKYA 2W01A 5D49A 5JMNA 2LSNA 1HQEA 3RW7A 2G4BA 4WP8A 2NSCA 4BGAA 4M7XA 3RBDA 4L76A 5LJ5Y 3CIPA 5AQQA 3ZDEA 2QFIA 4LF9F 4KAIA 1ZM4A 2BQ3A 4B3SK 3I82A 1NHKL 1L3VA 1VDVA 2W04A 4P7TA 1SJRA 1K1QA 3GFKB 3AGKA 4QU6A 5EY4A 3SCKE 1X5SA 2GQCA 2DCLA 1YSJA 3BBFA 2VJ4A 4Q44A 2CJ9A 5C15A 2O8EA 5HSPA 5EU7A 3LGNA 5K8MA 1IBMF 1IG6A 3R7BB 4JV1A 2YX7A 4DR5J 4WU3A 1YJTA 5J2IA 1HHTP 4M5NA 1JK9B 5KGXA 4LR8A 4M63C 4U67Q 1EKSA 3PKMA 1SL1A 3GB0A 1XR5A 4FXVA 3A1YG 5E33A 1NG9A 2OYQA 4CZJA 1E4GT 4X62K 3CJSA 5KFFA 4C23A 1YBTA 5AJ3F 2E6LA 1OQ3A 3FZBA 3ENAA 3Q7CA 1VQLN 2CPDA 4ED6A 3RB6A 3N6NA 3UDEA 2HPUA 2DYAA 4DV6F 2YJEA 2BGGA 3MM7A 4KHWA 2FYXA 2XICA 2OELA 3BS5A 3RMDA 3TU5A 4GV6A 5JTIA 3SSSA 1XMQK 4LF9J 1TYQA 4H8KA 5GTHU 2Z57B 3FFKB 2XYPB 1EJ7L 3I8BA 2M7SA 5KG7A 1ROFA 3H6EA 3M1VB 1C0UA 1KDNA 3IRXB 3ZZ0A 2VONA 2B6GA 3ULHA 1ASWA 2H1YA 1IH7A 4IFVA 1FO1A 4QPXA 3AA5X 2ZBRA 5IT0A 2MAXA 1IBMJ 1D0EA 2CWXA 3M6GA 1NOYA 1GOBA 4ED0A 2ZXHA 3C6UA 4LF6F 1Q16B 2HG4A 5CAAA 2RVJA 4OD0A 4DL4A 4AHRA 4QIWC 3QNWB 4WF9Q 1PZNA 2V52B 3DRSB 1RT1B 2YKMA 1XMBA 4CZFA 3U1LA 3OSNA 2QKBA 2KTQA 4DTOA 4LFBF 5HNKA 1X2IA 3QU7A 4KLQA 1BG3A 4Z7CA 4H0OA 1RBUA 5AJ3J 4OX8A 1E4FT 1T9UA 3D0GE 2KVSA 2AQ4A 4DV6J 3J81j 3CULA 2YHAA 5JLFA 3ALYA 2ASYA 3TAMB 4JK1A 3TI0A 3QXGA 5KFWA 4RL1A 3KG0A 4X4NA 4CD1A 3MD1A 4RQ5A 1IR1A 2LMIA 5J0QA 3W9HA 2ZUDA 3V6KA 4WXWA 4DQQA 2RB7A 4AL7A 1OY6A 1B70B 3IO1A 5ALZA 3FDSA 1KVAA 3NVYA 3QZ8A 1VBKA 5HK4A 2UXDF 4LF6J 8ICGA 3RWUA 4ZP9A 3UDLA 3HK2A 2O8DA 3D54A 2KIWA 4LFBJ 2J0WA 3OYNA 4FLTA 3JXUA 2BV3A 1WUDA 2KJWA 3WQTA 2B51A 2BH1A 3AAPA 4PAAA 2OPSB 1MN9A 3CJKB 4LMZA 5ALGA 3ZSQA 2AYEA 1IKVA 2O8FA 2DHGA 1Y4ZB 2G8HA 2AZ3A 3BS9A 2KVQE 1HJRA 2G2OA 1O0PA 2VQEF 2FBTA 4IJAA 2ZJQL 3KZXA 2WMMA 2OANA 1UOCA 3DFEA 3WXKA 4DS5A 5BREA 1D3WA 1RT2A 5LJVA 3K1RB 1TQLA 2RQKA 3S3MA 2OLWA 5DG9A 5FROA 5HRNA 2JLEA 4KB7A 2UXDJ 4QS8A 2VBXA 1UVLA 5F0XA 4F4ZA 1N32K 3VAFA 4Q0BA 2FC0A 4TUPA 2P9GA 4GV3A 4FZVA 2CQ3A 3S1TA 1ZC6A 5IIJA 3KHRA 2HB5A 4B1XB 2HHVA 3HOTA 3WK4A 1S59A 4DX7A 4BC2A 1MNEA 1NMNA 4TU7A 2D6FC 2DNMA 4I2DA 1HNXF 4BRGA 3ICLA 2M9NA 3M30B 1ELOA 1NH8A 4A8EA 1REVA 2YTCA 1RBRA 2B9YA 1IKWB 2VQEJ 3JTOA 2HVEA 2EH9A 3QYYA 5HMMA 1ZXOA 2PFFB 1MWYA 4JI3K 3W65A 1PILA 2Q97A 1MSWD 2FDRA 2E8OA 2HVZA 4YOUA 4FM2A 4ZCLA 4BQLA 2W2QP 1KVCA 3ETLA 2WCXA 1DQ9A 4QZ8A 3FZ2A 1M5OC 1FI4A 1GX6A 2RH3A 4JB3A 3QT6A 2UUWA 4PUOA 1WLJA 5AKKA 4A46A 2C3MA 1YX2A 1FE0A 3F73A 1SXEA 3IDWA 1AUDA 3KWIA 2R8HA 4DDFA 1SIWB 3VAGA 3UCUP 4JD2A 4DOAA 3FCVA 1X8DA 2PSZA 3M1YA 3OFGA 2XLIA 4OFZA 1U2VA 4DMNA 1C1BA 4Y2CA 5KFMA 3UVJB 2CUYA 2OMLA 1O13A 1FRXA 1ZQPA 1VQ5N 3VGVA 2QT7A 4M9JA 1HNXJ 2BM1A 4C0HA 1CZBA 1QQ5A 4BJQA 5AQZA 2ZJRQ 4F5PA 1RA7A 5MAOA 2G0JA 4NLPA 2BVZA 3TACB 1GLDG 3CCSN 2X1BA 4KI4A 3O44A 4M5GA 3NVWA 4CZKA 4JOUA 4M5JA 1GOAA 2JHEA 4JKEA 4ZP6A 3T1HF 2R8GA 2NXNA 3TFRA 1MU2A 3LPTA 2J9DE 1V85A 1Y00A 3M6VA 4CIOA 4M9LA 2GTDA 4FZLA 3JPPA 4I2QB 2A3ZA 2EAMA 5JJBA 2PD1A 4MFCA 3KLHB 1UWBB 1UA0A 2O8BA 2I5JB 2D0AA 3QUBA 2PMWA 3W7BA 2CFXA 3RH6A 2WSCC 3TAPA 3KHHA 2P9NB 4L6V3 2F8EX 3W61A 1WSHA 2YWHA 5A8KA 4DV4F 2WBNA 4BGBA 1KQSR 3MN5A 9ICBA 4CLKA 5AK6A 4FFDA 4UB8U 3L4BC 2E88A 3OQ2A 1Q79A 4Y28C 3SI8A 2GOLA 5AM0A 1GH8A 4QZGA 3PYFA 4EEKA 1N63A 4KV8A 3HHKA 2G8VA 1VYAA 2DBBA 3T1HJ 1P27B 3TKAA 1JLQB 2NQPA 4CHPA 1N8RT 3AO2A 2G06A 1CQMA 1XTZA 4BRNA 2YKNB 4DSFA 4DN0A 2L5YA 9ICOA 2BABA 2NXCA 4C8OA 1KR4A 4DEZA 5LSLA 3POTB 2O4IA 4F4AA 3W5XA 1HKCA 1VSMA 1UJ5A 4YB5A 2B0CA 3SMVA 2ZQBA 2OMOA 3F53A 4PY5A 3G6ES 4I4BA 4DV4J 5C2FA 1N6QB 2O8CB 1RTHB 3DRPA 1WG1A 2EZZA 3D68A 3OXLA 1BQXA 1IBCB 4PABA 4BXOA 4WFNQ 1PG5B 3KNAA 4MYTA 2CZVC 4US8A 2KHVA 4H4MA 5HI7A 1U04A 2R2TA 2RU3A 1A9NB 2R7VA 2L48A 4EIAA 4KN4A 4CVNE 3WQPA 2OEMA 1QHTA 4WIQA 2V8HA 3HJVA 3UNYA 2CH5A 2HGLA 3SJHA 5HMLA 4JI1F 2DFFA 1NZPA 4YG2A 2FVSA 3CCQS 2G8FA 2MKSA 2H3QA 1N48A 2NCKL 4IYQA 3DLGA 3OXGA 3TUJC 2BJ9A 2CJAA 3ZZRA 4CZGA 3CCTA 4USUA 3N0VA 2XRIA 2QYCA 4Q5VA 2MLZA 1XO0A 2GIFA 2IVMA 2I2YA 3TWHA 1SXDA 4ANEA 3GJTB 4FYXB 3K9KA 4KH4A 3M6XA 3CI5A 8ICLA 1RJJA 4NI2A 5ALUA 1Q3UA 3K0SA 3M7DA 4Q45A 3PYDA 4MMOA 5AQYA 3M1FA 1QSLA 5CZXA 1E6VA 1I1GA 3TVZA 3NGTA 3UKRB 2JFKA 2HK2A 4KB0A 4WKRA 1ZQCA 2OTJS 3D9BA 3AA8A 3CIZA 2W43A 3CJ0A 2JRSA 1SQEA 4F36A 3MPWA 4ICLB 4EUVA 1UHUA 1S6OA 2G08A 4J9RA 5C25B 4GKKF 3D2FB 2FSNA 4JI1J 1WHVA 2J7UA 4YVZA 4NLWA 4DR7K 1XNSA 2D8CA 1S10A 1WG5A 1Q82T 2CPYA 2Z1IA 1N8RO 1TK5A 2D3UA 2IVOA 5IS2A 2KEYA 4MO4A 4Y00A 3P49B 4DR6F 1XR6A 3HM8A 3F44A 2M70A 4O5EA 2XZWA 1V38A 4WWSA 2VG7B 4EHTA 3V81A 2WVCA 1RTZA 1CBKA 2H5XA 2QA2A 3V2UC 4ZVQB 2Z1GA 4IOAQ 2ASJA 5HROA 3IGVA 4XH5A 3QEIA 4QYZK 3EKUA 1VIOA 4HT7A 2QJ3A 3FZKA 3S41A 1GK8A 4RBUA 1FJGF 2QLWA 4DU8A 3F9KA 4JMUA 1SGGA 2QTWA 2FJDB 2CRLA 5D4NA 2K4HA 2N4DA 4UT4A 1SJFA 4CEOA 2D1CA 4J9OA 2ILYA 1RQLA 2QWOA 1NGJA 1VRTA 3PIOQ 9ICEA 1D9DA 3OYGA 5ALSA 3K58A 4FOIA 1KW4A 2ZZNA 2CADA 4NV0A 5HHIA 1S12A 1GOCA 4GKKJ 4RZRA 3AV9A 5F3XB 5K14B 3TRGA 1I51B 2MMYA 2HBRB 3ULDA 2ZIWB 4UASA 4QR0A 2HS0A 2NPIA 3AH6A 3FEYB 1QUVA 1DHMA 4DR6J 4FK4A 4L3QA 3RB0A 4O3SA 1S1TB 3DLEB 1WDTA 1L7OA 3ZSYA 8ICUA 1FKOA 3VGUA 2RHSB 2DY9A 3HRGA 4M3ZA 2W1BA 1VQMN 3JAMY 4IS7A 4TY9A 5IFMA 1VQNS 3MM8A 3QYPA 4U8YA 4ANDA 2JMGA 4DQPA 4DCPB 3FSYA 1ZQRA 1Q9XA 3CCMS 1MA7A 2VZ9A 5AK4A 3KMQA 5B0DA 4OPAA 4ZOSA 3UNGC 1K8AO 3HYFA 2QTDA 1O6XA 1HPMA 2QA4N 1S6UA 5AXLA 2B4JA 5KFOA 1C1CB 2E44A 4P72A 5AQHA 4FVUA 4NMXA 4CGFA 3TAFA 5EE0A 3CFRA 1Q82O 4DWIA 1YBUA 3VMFB 2GMJA 3ZDDA 4DB3A 4CF0A 1WKJA 2P9PB 2WF8A 1VSDA 4UOFA 1TKDA 3HZGA 3OTOK 3KK1B 1U2FA 2QLTA 1KN6A 3SD7A 1XR7A 4CZHA 2SXLA 1Z2ZA 3I4PA 2IOFA 3ZX2A 4CEBA 3SCIE 2YNFA 3MPYA 3SBGA 3HSGA 3VEOA 4C8MA 1FIQA 4KKOB 2P9IA 4I2BA 1YZ6A 4TY8A 3RRGA 1X0FA 1UCVA 4K4IA 3C2LA 4LVSA 2XI3A 3HSCA 3ONQA 2ZHAA 1V4SA 4BGDA 4FZZA 3V7JA 2VUGA 4ER8A 2GS8A 2VGNA 4PYDA 4WZQA 5JVHL 1VI7A 1PAEX 5ALYA 2WB1C 2RUGA 4BC5A 1KFTA 2XMJA 4F92B 4OPKA 2RN2A 2XY6A 5KFKA 4FO6A 1ZBLA 2JX2A 4NLSA 5FLXY 3NDKA 4K8RA 3L0QA 2QMWA 8ICIA 3WKEA 1SI9A 3EDRB 2A18A 3OBIA 4FF4A 3P1GA 2IRXA 2CZ4A 5D0HA 3NGDA 3MDQA 4JRPA 4CM0A 4ZJQA 4I68A 4KRFA 2XMVA 2MZ1A 3MURP 4DQ8A 1FEZA 4R64A 5SWMA 4OX9F 5KG3A 3NCQA 2OCEA 2MDAA 1ZQXA 1SPBP 5BR9A 3VALA 3NEKA 3BQ2A 5KT2A 4G3IA 4H0TB 1YXQA 3FQLA 4USAA 4BRCA 4EO8A 1QLNA 1JJ4A 1S7HA 2YKQA 1EQ0A 2DGUA 1YJ9S 4JV5F 2EK1A 4BC4A 1PGZA 1TVRB 1BPDA 1RWMB 2VANA 1RTJB 1KQQA 3EGVA 8RUCA 3VQ8A 2OJ3A 2HZAA 4OMFG 3IG1B 1NNLA 5AR0A 2Z30B 4X84A 1VQKS 4FWRA 2D9PA 1WSRA 3M1VA 1RLDA 1Q8IA 4N7TA 3IRXA 1JL2A 4U67L 5JRTA 2LU2A 5DDYA 4Z6CA 1HLWA 4OL8A 3NRBA 1VR6A 5BYQA 2HWTA 4N56A 2LDYA 1GNKA 4BRDA 4JI2K 4EELA 2EPIA 3RTVA 1RI7A 2AW0A 3W3SA 2Y1LB 3SJJA 5EGYA 1HNZF 2MA1A 3QMLA 3DRSA 3IBCB 1RT1A 4KREA 2ZBPA 4N77A 4H0YB 3K75D 3JQKA 3THWB 3DCAA 9ICMA 2FF3B 4RKUC 4C98A 1RAOA 2IDOA 3MN9A 4JV5J 2KK0A 3MR7A 4GY2B 1NSQA 4IH6A 3TAMA 2HRTA 2B9EA 5ADXH 5HATA 3I56S 1QJHA 1SJQA 2B43A 2M52A 4O3QA 1QAJA 4DF8A 2EAOA 5ALDA 3QWUA 4M3YA 4M3UA 3CXCR 4IR9A 4EX6A 5B7WA 1OVYA 3K5MA 4EP4A 2O5DA 3EZOA 3FSXA 2PXIA 1JNZB 4CHQA 3R8EA 3D66A 5J2MB 4TKTA 4KHRA 4LJXA 3GILA 3PIPL 4UB4A 3O3HA 1RYUA 4FZNA 1WC5A 3HKWA 4RT2A 3AB4B 5KG4A 2A3VA 2YNHB 5J2BA 2YHYA 2PE8A 1X6IA 2EANA 1HNZJ 2XULA 3PX4A 3Q8RB 3EVOA 2WF5A 2BMBA 1BA0A 2DJWA 1VSKA 2ZF5O 3H0PA 4Z2XA 1GFWB 2OPSA 4WYLA 3BPSP 4DI6A 4H0VB 2M8HA 3CJKA 3C6HA 2Z2LA 2Z7JA 3CDAA 2VKQA 3NASA 3SFUA 5M1FA 4A8KA 4FM1A 2VA8A 2FDNA 3UXNA 3QQCD 3EMTA 4QZAA 4B8AB 4ENOA 1TAMA 3AD8C 3GE9A 2KJ5A 2LKYA 2FLPA 4DR1F 5K5MA 4U6PA 3WKAA 4C4WA 3I55S 1SC3B 1TU0B 1NHUA 2UXBK 1SJ1A 2QKKA 1JJCB 4C3LA 2OSQA 3TZWA 3IFRA 1QZ5A 1MMDA 4GO7X 3RR8A 1X4AA 4CGGA 1LAVA 4RTFD 4GKJF 1WD6A 3TNVA 4ILGB 1BQNB 1WEZA 4OJLA 2F9WA 2YWFA 4I6YA 1N36K 3QPIA 3BF3A 4ZP8A 4CHOA 1NDCA 4OHZA 1EX8A 3BF4A 2DHSA 1RT5B 4YN3B 1XWLA 2XY8A 1IM6A 4DV0F 4WYBA 2DO0A 2HIYA 2K7KA 2DNNA 3AQEA 2KVIA 1HQUB 3H0LB 1U09A 5HVHA 2HHTA 5BPLA 1VGYA 3M30A 2QLJB 1HWKA 1RDWX 1BCMA 3AVGA 1UEKA 2R7QA 1IKWA 1GQEA 4OGEA 3H4BA 2MQPA 2R18A 2HOFA 4DR1J 1YT3A 1HUZA 3CD6N 1LFPA 4JI5K 2KQ2A 2VA2A 5ALKA 1OUQA 4JI6F 1J2NA 1X4FA 1XEZA 3TPQA 3JPNA 4KTZA 1OY9A 2IHR1 2QMUB 4CFDA 4IH7A 2G2ZA 4OPHA 3J7AN 4GKJJ 1JCGA 2APOA 4IUFA 4I29A 2XO6A 4DU7A 1Y0HA 4QZEA 3PR5B 3C3LA 2B7BB 1AQ6A 2R8IA 2JEIA 3UVJA 2DNGA 4A8WA 3TUPA 3IM8A 1BPXA 3CCJN 3T9NA 2R7SA 4PPXA 1LWEB 3LWMA 3V9WA 3MXIA 4DTRA 2YN4A 4CO0A 4LFCF 1KQKA 4WE1B 4JUZA 4QZHA 3OTQA 3TX8A 5CJ7A 1LOUA 4Z0UA 4LY7A 1ZQUA 1U26A 5HMZA 1YUWA 1HR0F 2Y1JA 3FFIB 4CZCA 4CF2A 4I2QA 4JI6J 1LWCB 3KJFB 5ALVA 2F7VA 7ICTA 3BKTA 3KLHA 1UWBA 2I5JA 4GNIA 3VVTA 4NYNA 2D0PA 3MTKA 4JI4F 4OVLA 4F67A 4NRUA 2ZJRL 5HJYA 2P9NA 2FD2A 1LXNA 1TUUA 1KBUA 4KLLA 4JKHA 1BWVA 9ICAA 1UW9A 3E9OA 1NU4A 1ZA2B 1FD2A 1MA9B 4BHQA 3MFIA 1MLAA 1GTEA 2C2KB 3N9UC 3NNHA 4MO5A 4QWCA 2BRLA 4ECUA 1FRKA 1NXIA 4IZ9A 3U9ZA 1N34K 3AAQA 1ZQDA 4UARA 5HANA 1KVBA 1HFEL 5A2QY 1FE4A 1J5EK 4IOCL 1MG7A 4CF1A 1HBNB 4PG8A 5D8HB 4FJ7A 2A3JA 4FLZA 1RHUB 1JLQA 3V5RA 3WK7A 1S9FA 2RILA 4C7QA 1HR0J 2YKNA 3VA0A 4GW6A 1K73O 3POTA 2EKNA 3OJUA 5DRKA 3HJFA 4UY85 4ISFA 1VJWA 1TVAA 4B17A 4JI4J 4IOXA 3AA4A 4W5OA 2F8HA 3GDXA 4ZVGA 3W2WB 4O44B 4BR0A 1WSFA 1N6QA 4BRAA 1KTQA 2O8CA 1HARA 5M2RA 1RM6C 3KUGA 2LQ8A 3DDNA 1RTHA 3BDPA 3L7UA 3MMAB 3LANA 3QEAZ 1XMOK 1ZQZA 3H7IA 4C4RA 3L2RA 3UO0A 5KT5A 1Q5VA 1Y5LB 4TYBA 3JPRA 4JKFA 3J80U 2J7WA 3QFUA 2IOHA 2CJQA 4A62A 3MMVA 2V7YA 4FF1A 1T44A 2IM2A 3JSYA 4OZJA 4NYFA 2J0XA 3TYTA 4K2XA 9ICUA 4F4WA 3VQDA 5AQRA 1SZ2A 3HZEA 1GMVA 1KKXA 3A3PB 1YQHA 1X9WA 3GCXP 2W55A 1OKJA 2HFUA 1HWUA 5F0UA 2U2FA 2JH1A 4WFNL 3LO3A 4DL7A 3HW8A 3ZT3A 3VQAA 4AYBF 4DHVA 2Z56B 2NUBA 3TX0A 4QZIA 2ATQA 2XI2A 1NLKL 4URQU 4CT8A 2WOMB 1FWLA 1S6PB 4M9HA 3UKRA 4USHA 3ZT1A 3VEXA 3B9JA 4MLHA 2IDEA 4PQAA 3FM9A 5A76A 3I5CA 3VWSA 1UWAA 1HYVA 4ZVRB 1TKTB 2EC2A 4I2HA 5B0BA 2O67A 2DH8A 3GMGA 4ICLA 3B4MA 4P4OA 5KFDA 1KRPA 5C25A 1WEXA 3D2FA 1EIYB 1CLFA 5L9XA 2HI0A 3J7ZO 2YPZA 3ZI4A 4OZNA 4KLIA 2BCVA 2OPQB 3UE5A 2CNLB 4OYMA 4LH5A 2P6TA 4E7HA 1NCLA 3O1BA 3J80O 1JKHB 2F9TA 1SXLA 2PYLA 5HP1B 4BY9C 2G0CA 4YHHK 1B9FA 5EXWA 3NHGA 1VQOS 4M5HA 1OH7A 3SLCA 2VG7A 2BOPA 4M42A 3QUQA 8ICKA 1SQKA 1X4EA 3D0PA 3K9JA 2GWKA 2BW2A 4CHZA 4BRFA 4X4OA 2VDIA 4WTOB 1AFJA 2WF6A 5AQWA 4KHPK 2FLLA 3KG4A 1F5CA 4LIWA 3LTOA 3MM9B 2C3YA 2IPOB 1HI0P 3H25A 4FJIA 5BR8K 4J9UE 1NHVA 3LAKA 1CXQA 1CI4A 1NO8A 3BR8A 4FPAA 1DGJA 5T7BA 5GADP 3GFXA 3DHXA 4KB1A 5AE3A 4NO7A 4IQVA 2MZSA 3VETA 3ZLJA 3TTDA 4YUDA 2WW8A 4DF4A 2I1QA 3NTUA 3RMCA 1TMJA 3HO1A 2W4CA 1IR0A 4AXIA 2W2NP 1Y11A 5K14A 4IOAL 4YDUA 1WC0A 4OYPA 1RU2A 3DOMB 1WWVA 5EE1A 3BJYA 2ZIWA 3EDQB 2LU1A 2ALZA 3UMBA 3WXJA 3B0YA 2Q0ZX 3I76A 3KLFB 5J0RA 4FJ5A 2K60A 2V8VA 2KFZA 1KAYA 2VWJA 3GJQB 3IP4B 4OZ1A 2ZH4A 2MQNA 1S1TA 4EEYA 3DLEA 3ZZYA 2FC8A 2IS3A 2P35A 3C2KA 1WWHA 1ZBIA 4O3PA 4YDUC 2HWIA 4IRKA 4KSEB 3TR8A 3PIOL 4ECSA 5KG0A 4F93B 4JS4A 1Q86O 4EO6A 1CS4B 4KGMA 3LP1B 4FL9A 2NZ4A 9ICNA 1EKEA 2DITA 4OJOA 2XI9A 3AXMA 3WC0A 3MXHP 4FLYA 3OVBA 4X4TA 1EZZB 4CGZA 1QVGM 1RWVB 2BXJA 1T02A 4NA1A 5IV3A 1QAYA 4PXDA 3DM2B 3C6TB 3LQVA 2DR7A 5ALFA 4UB3A 3PEHA 4C11B 4LRDA 1CUKA 1L8OA 3TJAA 1RBVA 5IWAF 1RBSA 2ZHBA 2XWYA 2KI2A 1C1CA 3P5JA 2DGOA 3B4DA 4DSLA 3ID8A 2JLFA 3IHQB 4H5TA 2LFVA 2VOOA 3MZIA 1S22A 2HVIA 1IN0A 2KU7A 4L72B 2H5EA 2P9PA 1QDUB 4XEIA 2GMLA 3MUVP 4A8MP 1P1TA 5ALJA 1VRUB 3KK1A 7ICQA 4Y2MA 4NLRA 2K7JA 3NCPA 2F8SA 3CJ7A 4RX6A 4ILMA 1QSSA 4I2PB 3TR5A 1FKPB 3KHGA 2KJ9A 1T9XA 4TUQA 3HX0A 4WFAL 4ZN1A 4FNHA 1NGFA 4O5CA 3MUTP 3AVBA 2O66A 3LYSA 1XNRK 4CGJA 5AM4A 1NPKA 1U1LA 2E1ZA 4XPEA 2ZH3A 4KKOA 1TL4A 2Q1NA 4XUSA 1M5VC 2ATLA 1S1VB 3AJ2A 3Q83A 1VQ9S 4HI2A 3QT8A 1IKYB 5LMUF 5D15A 3KK3B 2YMLA 2YPYA 3HKZF 4NB4A 3KLVA 5CZ2A 2DH7A 5MLCV 4KTQA 3L3VA 4CLSA 3EVMA 5IWAJ 2GO8A 1V5VA 2RS8A 2UUTA 1DK2A 1WF2A 1N62A 1XC3A 3IG5A 3AODA 1RDBA 3CM5A 2DXDA 2FC9A 5CHCB 1X40A 2RHKA 4DUYF 1NK4A 3RJMB 1WKLA 2FJBB 1BIZA 3HULA 2BW7A 2RQ5A 2N4CA 1ZS6A 1I5OB 1HI1A 3DGPB 2J8SA 4YB7A 2E1FA 3MTJA 4BRKA 2XY7A 4DL3A 2UXCK 1ATRA 4IDHA 5FPEA 1PO6A 3C66A 1PCAA 2L9DA 3N4PA 5KFXA 3V6HA 3R2DJ 3J7AP 4C1NI 4FWPA 4BRIA 4FJKA 3MWBA 4P2HA 4ACOA 3PV8A 3L3CA 1VQPN 1ZQNA 2G07A 3SMSA 4CF3A 3F2BA 1G6BA 4FJHA 1NSKL 5LMUJ 4E19A 2OA8A 4KN7A 2QWPA 4HDGA 3ISZA 1WKKA 2MLYA 2AEJA 1VK3A 4X4SA 2FLOA 5ETNA 1VQ6N 4NOHA 2J4RA 2H3GX 3OW2R 1U45A 2GWSA 4ISEA 1TVRA 5AT1B 1RTJA 5CY4A 3RJGA 3NS7B 1UTAA 4JI0F 4FP9A 4DUYJ 2F3NA 2GZOA 3LAMA 4IJNA 4NLKA 4NMLA 1A7GE 1CZ9A 1F2HA 2D41A 4W90B 2DFEA 4NL9C 4NYPA 2P5GA 1ZQHA 3JTNA 4QIEA 2DRBA 3OY9A 2KZZA 1S4FA 1Z6RA 4AQYK 4P10A 3K17A 2K4PA 3ZZUA 4BROA 3P4IA 4NYOA 4US9A 1BGXT 3FZHA 1Q8KA 3BP8A 2X3DA 2K89A 9ICVA 3LOUA 5FDLB 1S8OA 3QAUA 1KFDA 3OBWA 4K2JA 2HNYB 2K8AA 4D3HA 3P83D 4K41A 3D1OA 3SQGB 2MKIA 1X4CA 3THWA 2ZDPA 3ZTQA 4Y0WA 3NNAA 2VJ5A 1U1RA 4GXJA 1B9DA 4H4OB 2ACYA 4P4MA 1F21A 4CJTA 4HL9A 2RIJA 4CERA 3OYHA 4WYWA 3FGVA 2F40A 4UB1A 2N3LA 3VC8A 4JI0J 4CLUA 3I31A 2ZHOA 2O1PA 4ZCKA 1KEKA 1Q5YA 4C9DA 2A42A 3P4UB 2MQQA 3WNGA 1R6YA 4ILHA 2CN1A 2GNKA 5DETA 4CFBA 2ZZMA 4KH5A 5J2MA 1UETA 4DPWA 1QQCA 3EO3A 2L41A 3CMEN 4HKQA 3UMCA 2F2AB 3MPDA 3RBXA 5ITHA 3VR1A 1VDHA 1RFQA 2YNHA 2GHPA 8ICRA 5CB1A 4DPUA 1DKGD 3RSEB 2VPZB 5BN9A 4RQ4A 1JI7A 7ICSA 4FWQA 1HYZA 4WFXA 4DX5A 3AJ1A 2GUPA 3CJQA 1NLVA 1Z1ZA 3RF9A 3T7ZA 3LWLA 1XK8A 1FFVA 3E9PA 2P6SA 3L95X 1GLEG 4QOZB 2GQQA 4KGZB 2W9BB 2YVSA 1O1WA 1JJ2M 4CGIA 1N4LA 4M47A 3QBWA 1L7PA 3D5MA 1XSNA 3K4GA 2RHQB 1LW0B 1NZ8A 4JI8K 1U47A 1Z1VA 3THTA 4H5WA 3BN4A 3VQEA 1UVIA 3DN9A 4K8ZA 5B0AA 3NMUA 4E2FB 1HIYA 2GJFA 1B22A 4NEYA 3KTQA 2XYGB 5EE3A 2JOQA 5AKLA 5AQKA 3DMJB 3V9ZA 2H3ZA 1C2PA 4FN5A 4UOGA 4XQ8A 4CM2A 1K0VA 2HQDA 2YWKA 1RBLA 3IM1A 2HEKA 5EUHA 2XG8A 1BQNA 3WXIA 4QWBA 2ASDA 1DEJA 1RT5A 4QIVA 2UVWA 1CG2A 1DRGA 1V3SA 4B1VA 1AYEA 3M2VB 5IT9Y 3H5UA 4E7LA 3AN1A 2OI2A 1A5XA 1HQUA 2ABYA 2RRDA 4WKYA 2DB1A 2XY5A 7ICHA 4JP8A 2QEXN 1TZ0A 5LT5A 3RMAA 4JI7F 1SCJB 3TQ1A 4WCEQ 1YTUA 3M2UB 1EAYC 1C1AA 2KG0A 5J2FA 2ZM6K 1IBLJ 3TUZC 3CCRS 4V19X 1L7NA 2E1RA 2MKJA 3QICA 2YHBA 3SUNA 3CB4A 2GC8A 5DG7A 1VIXA 1PIEA 3C5GA 2Y0BB 4K4XA 3KD5E 4Z4GA 3R6MA 1ZQTA 4HYKA 4HACB 2KSOB 3LDLA 2A1AA 2FHMA 4NXNF 2CQDA 2N3OA 5D4BA 1AA1B 1G1XA 1W7AA 3W5ZA 1RDCA 3G96A 3AGRA 4I28A 4AHVA 5ALLA 4I2FA 2MZJA 4DR2F 4JYAK 1NPRA 2G9OA 2FJWA 1D9AA 3EM1A 2ISPA 1LWEA 1UFKA 4S0MA 3CDEA 4E7KA 4OJ5A 2C2RA 4ELUA 2KFYA 2XHBA 5H1SV 5IIMA 3THVA 2QLXA 2B4OA 3QUCA 2PFNA 2IHNA 2PA3A 3AQPA 2AJQA 1NK9A 1ZQAA 3PJ9A 7FDRA 4WE1A 4JI7J 1EHWA 4Z94A 1VS3A 3K2PA 1U2RA 5GAGP 3Q8MA 3NLCA 3RW6A 3ISBA 1U1NA 7FD1A 3FFIA 5ETLA 1F5SA 1LWCA 4LF4K 4A8OA 3R6LB 3EVWA 4FWMA 3HSDA 3TSUA 4K0KK 2GAGC 3CCUS 2F9DA 3I9V9 1M5PC 4I6MB 1ZYQA 1KBRA 3O4WA 2YKOA 1R27B 5H9EJ 1ZTTA 4NXNJ 4GVLA 1ZBFA 2BKNA 4DOZA 3O1LA 5BPCA 4QU7A 3HVWA 1GMWD 4RCHA 3OPXA 1A5WA 3MABA 4Y2JA 8ICCA 1ZA1B 3TAGA 3O9SA 5KFHA 3P39A 4DR2J 1YIJN 3DLHA 2W4PA 3IMXA 1P7DA 1RQ0A 2LQ9A 3NWRA 2MZQA 3J8AA 3K5NA 4MK9A 3MR6A 4F4KA 3PYEA 4FF2A 1NGGA 3QESA 3OVSA 2ACMA 1HBNA 1NB2A 3MCMA 5GADU 1YTYA 4FWKA 3TSQA 4KH0B 4Z6DA 2R8JA 4DZ6A 1F0MA 4ZTJA 1Q1KA 3OYLA 3WIUA 1ED1A 3ZTSA 8ICQA 1WUUA 1Q81O 1YJRA 1OW5A 3CJ1A 5J0YA 4FYYB 3KLGB 5K8OA 3VV2B 3NH2A 2PT0A 4ED2A 3O4QA 3DYAB 4OI0A 9ICPA 4CNQA 3MGHA 3AA3A 2B4UA 2I0XA 5J1NA 3W2WA 1ZBUA 4O44A 1A76A 2IVPA 1YI2N 2KZMA 1X9MA 3MM6B 4DOBA 2LVWA 3G4SS 4PHPA 4IWVA 4LF2A 4YQWA 3RRKA 3D3BJ 2A1RA 4DU4A 1VQ8S 1FRJA 4BG9A 2GMHA 4WFBL 2R8KA 2XLKA 2KHQA 1RXOB 3DRRB 2CQCA 1FRLA 4Q2LA 5B0CA 1RWNB 1S72S 5AI0A 5IIKA 3HP6A 4DN9A 4DXLA 2HS3A 3Q8LA 3O8MA 3PCOB 2Y0SD 4FE3A 2QLFB 2AZ1A 3BZQA 4BRQA 3RB4A 3T5LA 3L3FX 4UZBA 2L08A 1SKRA 4CI6A 4MKAA 4MIWA 3AL0B 1K9MT 1U9LA 8ICBA 3IC1A 1CJUB 4AE5A 2RF2B 2XMMA 3PHEA 1VBYA 4B1ZA 3I28A 4CDIA 3C16B 4DV3F 2XZTB 5J29A 4OO1J 4MYUA 8ICMA 3M8PB 3ENVA 4FCYA 2KKVA 2JV3A 1F3FA 3VEYA 2V51B 3BO3A 4E89A 5J0PA 1L7MA 5ETQA 1U48A 3AA2A 4ZCMA 3SIPB 4Z37A 1GXUA 2NRXA 2WOMA 5K9FA 1JJHA 1S6PA 4E8UA 3QRQA 3H8MA 4W98A 4O5BA 5EOYA 1NZBA 4A8YA 4P73A 1EWRA 1H2UX 1X0PA 2V34A 2Q36A 4YB6A 2DD8S 3KOAA 2LA4A 4ZS6A 1DXSA 3GLJA 2F1FA 3CVKA 1TKTA 3FK4A 4NXMF 1VQ7N 4GRSA 3L09A 1IBLK 3BZCA 2D3OR 1K44A 4GIBA 4ZVOB 1PYOB 1VQLS 3K5OA 3I87A 2OPQA 1H73A 5KFLA 4CESA 3H8JA 1K1SA 1JKHA 3RG6A 5HP1A 1ZH5A 4X64F 2DNKA 3KK7A 1FDAA 3WDOA 4I2GA 5C2DA 4U7CA 3E51A 1ATSA 3FMWA 3I33A 2CPEA 4UQGA 4DV3J 2NLWA 3E58A 3GYXB 4BRHA 3H08A 5HOOA 1S5ZA 1GEHA 5J2PB 4Z4EA 3Q0AA 2A6MA 3ENQA 3MM9A 5FIIA 4EZ6A 3CJ2A 4K43A 1FWKA 2KHOA 2C2DA 2LQ5A 5IQ6A 4ZVSB 4O0NA 5C24B 2ZJQQ 3EXYA 3IWNC 3D28A 1ZD5A 2G8IA 5EWFA 3A8JA 2LPEA 3MWTA 4C97A 1HPZB