1XWLA

Bacillus stearothermophilus (newly identified strain as yet unnamed) dna polymerase fragment
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna replication
molecule keywords DNA POLYMERASE I
publication title Crystal structure of a thermostable Bacillus DNA polymerase I large fragment at 2.1 A resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 206
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1xwlA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1xwlA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xwlA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xwlA01
1SKWA 1RT4A 4H4OA 3LK9A 4DSIA 2X6SA 1ZQUA 3P5JA 4NLNA 1YVUA 1ZBHA 4DU1A 1J5OA 1XS9D 2I5JA 3UQ2A 5KFKA 1HQEA 4KFBA 4KLHA 1WCNA 1DTQA 4XA5A 5DG7A 8ICZA 4PHAA 3NF8A 1Y88A 3TI0A 1S10A 3C5FA 2V4QA 2D0CA 2OWOA 4M6WB 5FROA 4M3ZA 2OYQA 3C2LA 3UXNA 1B9DA 5F9NA 8ICUA 3L2QA 2ETJA 3V7KA 3VQCA 2E4LA 3CG7A 1HMVA 1SUQA 2HNDA 4UBCA 2ITGA 3NAEA 3NHGA 1XHZA 3KK2A 9ICQA 4DLEA 8ICBA 5HHHA 4ID1A 4YCXA 3QEWA 4OVLA 4PWDA 4HUFA 3CYMA 4ED1A 4GVMA 4JRPA 1NKCA 7ICFA 1J54A 4CJ4A 4CGDA 4KTZA 5KGWA 2FBTA 3QEIA 4DSLA 2C22A 4FM2A 3ZDAA 5KT3A 2W8KA 3ZD8A 5D49A 4LH5A 2R7YA 4M41A 4RQ6A 1T8EA 3ZDBA 9ICMA 1BQMA 2XY7A 4O55A 1LWCA 2IC3A 1BPZA 3Q8SB 2OA8A 4X5VA 3V6DA 1G15A 3NH0A 4W5NA 3L3VA 2P6RA 1HRHA 2Q3SA 4CFCA 4I2IA 1RDCA 4DEZA 1MSWD 3DRPA 2IMWP 3C6UA 5DDYA 4F5NA 5J0RA 1NK4A 3LALA 3DRSA 4DL4A 1WSGA 4QZGA 1JLGA 2BQUA 1C7YA 3RWUA 4ELTA 2YHBA 1D8YA 3I8DA 2O4GA 4W5OA 3KLHA 4YD2A 4I2GA 3MXIA 3LDAA 3ORYA 1RTDA 3AA5X 2EHGA 4ECXA 2HHTA 4RW6A 4KLQA 2J6UA 4RT3A 2XGPA 5KT7A 5KFBA 2MUTB 3DLRA 2F8TA 5KFMA 4CJFA 3ALYA 4FXDA 3PO4A 3NH2A 4FZZA 4KN4A 1KVCA 1BPBA 2A1RA 4CGFA 1HQUA 1RT1A 3VQEA 1PZNA 1ZQYA 1C0MA 2BCQA 3SPYA 2ZJ5A 3S9HA 1CUKA 1LWEA 1VSLA 4DTOA 3SV3A 1NJWA 2VA8A 3FFIA 4Z6DA 3K2PA 3V1QA 4W5RA 1DLOA 4ELVA 1S1WA 3WNHA 3MR3A 2A1JA 1ZQFA 3PW5A 2ZTCA 1WAFA 1B22A 4O3NA 3ZDDA 4BDZA 2AQ4A 7ICUA 4O0JA 2XY8A 3V72A 4CJUA 3C94A 3QESA 4RNOA 2FMSA 1RYRA 4FS2A 2FLLA 4ECVA 3DMJA 3O3HA 3ZT1A 5C25A 5CB1A 3SV4A 3L2UA 5L1JA 3K57A 3KTQA 3OYDA 1RT2A 1N5YA 3MBYA 4J2EA 4P4MA 1LAVA 3TR8A 1EXNA 4CHNA 2BE2A 1ZQBA 4YMOA 4M3YA 9ICLA 5KFHA 1BIUA 2OPRA 3K5NA 1RYSA 1MQ3A 1C1BA 4Z6CA 4PGQA 1B43A 4FM1A 4BWJA 4FK4A 4CFDA 4G1QA 2BDPA 3NTUA 1MU2A 3LANA 2W9BA 4ECSA 4AILC 1RBTA 4Z4EA 1DTTA 3BQTA 1T05A 3LP2A 4O5BA 1ZQSA 1HNVA 5J2HA 1TFRA 4M0AA 4HCBA 4KB0A 5EWEA 1BGXT 1ZBIA 4J9OA 1GOAA 3GIIA 4HCCA 1RTIA 2NRVA 2A1SA 5SZTA 4BE0A 4FBTA 5KFJA 4DTSA 4J2DA 9ICKA 1CXUA 4CESA 3E2EA 1U49A 1RPLA 2FLNA 3HP9A 4M9GA 1HPZA 1AROP 1TV6A 4F8RA 3M8QA 2W9BB 1TVRA 4CE9A 2KZ3A 5J0QA 3NF7A 3B6PA 4LZDA 4KN7A 3LWMA 3TQ1A 9ICEA 1XSLA 3OYIA 1RTJA 3RRGA 2PFQA 4K4IA 3PUFA 3MFIA 4MEYA 2I9GA 1I39A 2M9NA 1WSIA 4M3UA 2ASLA 1ZQJA 3RR8A 5HMLA 5CZ1A 2ASJA 2IBKA 1A5WA 5KFVA 3RMDA 1ZJNA 2W9MA 3E01A 5J2QA 3OYAA 4IQVA 2P1JA 4E7IA 1KVAA 1ZJMA 2FMQA 4DL3A 1BI4A 1ZQDA 2C2RA 3T5LA 1KFTA 2V9WA 3SNNA 5F9LA 5IIKA 3A2FA 4PH5A 8ICIA 3O4NA 3THVA 5DMRA 3HVTA 3OHBA 1VK0A 1U47A 1KTQA 1XC9A 3H40A 1S1UA 3QEVA 4RZRA 1UA0A 4ED8A 3NGDA 3SPZA 3ETLA 5TZVA 1ASUA 1S0OA 3RH5A 4FJLA 4LY7A 2V4RA 3ZSQA 7ICHA 1ZYQA 3V9SA 2JEFA 1HUZA 2BHNA 5J2EA 5DB9A 4DTRA 4QCLA 1HYZA 3B0XA 1LW2A 3RJJA 4CJEA 9ICUA 3RJIA 2XO7A 8ICAA 4GLXA 1IKYA 4IG3A 3QNOA 1UT8A 3LAKA 4RW8A 5EWGA 2AGPA 3VQPA 8ICNA 3L2WA 1RXWA 2RDIA 4XIUA 1RZTA 3Q8QB 4FLXA 4RNMA 4EBEA 1JL2A 1TAQA 5KFOA 4HTUA 4PY5A 4DLGA 3KLFA 1SL2A 2WONA 3G6YA 2DPIA 4QAGA 5CWRA 2ZQBA 4DS5A 3ZSRA 3VQAA 3RB4A 5DDMA 3T5KA 3OYLA 4CHOA 2BPCA 2IHNA 3SQ2A 1A5VA 3RJGA 4O3OA 1BVSA 4QW8A 4OKJA 3C6TA 3OVNA 4OKEA 1N6QA 4DSJA 3Q8RB 2R8KA 4NXZA 4NYFA 3ZSOA 3U6FA 1ZQEA 4B9SA 4CGJA 4QZCA 4FLZA 2G8UA 2XCPA 3V6HA 5KFAA 4DSEA 4GC7A 4DQQA 2G8FA 1S0NA 3ZDEA 4AHTA 1JLCA 1ZQMA 1ZQAA 3OYHA 4PPXA 4TURA 1XI1A 3HM9A 1QTMA 5KG6A 5KFQA 1K6YA 3VQ6A 4FLTA 2RF2A 1RT6A 3F73A 1WCLA 2ASDA 3JPNA 1ZQXA 4CHYA 1Q9XA 5DQIA 4KI4A 4F3TA 4GW6A 3V7JA 3VQ4A 4MFFA 2OPPA 9ICXA 4IQTA 3MEGA 3VA3A 3H4BA 3RH4A 5KFEA 4PUOA 7ICMA 3OYEA 3HSTB 5J0WA 1C6VA 3OS0A 4HVJA 3OYKA 2W42A 4KMUA 4DL7A 3G0ZA 1YTUA 4KHWA 3QETA 3QEAZ 4JLHA 5J2AA 1ITGA 2PI5A 3C21A 7ICRA 5BOMA 3G6VA 5J0XA 1N56A 2D0BA 5C42A 2YNIA 4CEOA 2XY5A 2DFLA 4OGEA 3ZT2A 4N47A 3V9ZA 4L8RB 5DGAA 2KZMA 3CFRA 3P83D 2B5JA 3EY1A 4EP5A 3LPTA 3HK2A 3RR7A 5DKWA 1QS4A 3ZD9A 1ZQOA 1ZQWA 3Q8PB 3JYTA 3H7IA 4DTNA 4GC6A 5CA7A 5HNKA 4EBDA 3RB6A 3S3NA 3DLBA 2BCRA 4O5CA 4G3IA 4TQRA 3SQ1A 2XHBA 2F96A 3C1ZA 4E1MA 2J6SA 1VSMA 4JK1A 4TUSA 4GMJB 1S9FA 3D0PA 4CIGA 1JLAA 1NJZA 4DSKA 9ICTA 5IIOA 5EOZA 1TL3A 2H5XA 4B9MA 1RTHA 5BPCA 2HNYA 3HWTA 1Q9YA 3DI6A 1GOCA 3DOLA 2BKEA 4KITB 4H8KA 4ED0A 1FXXA 3LPUA 3RB0A 2DFEA 4ED7A 3AVFA 4FJ5A 1C0UA 2DFFA 5J2JA 1ZQCA 2YKNA 3K75D 4UB3A 3LWLA 3PR4A 2E6MA 4B3OA 1WAJA 1BCOA 2DY4A 2GWSA 1JLQA 9ICBA 4R64A 3NGYA 3M8PA 2PY5A 1KLNA 3B0YA 1L3SA 2QK9A 2JEJA 2JLEA 3BJYA 2DFHA 3O4QA 5L1LA 4FZYA 5DQHA 2GV9A 5C24A 4J9SA 4FJKA 2HHSA 4YFUA 1WSJA 3V7LA 8ICGA 5L1KA 7ICEA 1Q8IA 1WSHA 1VRTA 5KT6A 3MDAA 2VA3A 1XHXA 5CR0A 1XWLA 4ICLA 4E1NA 2OPSA 1IXRA 1JXBA 3ZCMA 4H4MA 3SQ0A 4J9KA 4JWMA 2ATLA 2PFOA 4KKOA 4PGXA 5DK5A 1B9FA 1C1CA 1L3UA 8ICVA 3ISCA 8ICOA 1L3TA 3ASMA 3TAFA 2R8IA 1RDAA 2MUTA 3ZSWA 3VN5A 4OLBA 4NLGA 1O1WA 4KLFA 2X6NA 2O4IA 2JZBA 5KG4A 1IM4A 1XSNA 4I27A 2FBYA 3U3GA 8ICMA 3K5OA 1W9HA 3JSMA 2KZZA 9ICNA 2HNZA 3V1RA 3SUOA 4RW7A 5KFIA 3C23A 3MGHA 4NCAA 1JLEA 5DLFA 4CEDA 3HP6A 2VANA 3QE9Y 4FCYA 1JXEA 3JPPA 9ICIA 2FPKA 3SCXA 4ED2A 4OPKA 4EEYA 5FDLA 2RPIA 1ZQPA 3AUOA 3AO2A 5KRTA 4PQUA 4CHZA 3T5HA 3TAPA 3MR5A 3RH6A 2JZBB 4CF1A 3AA2A 3C5GA 1ZQQA 4CCHA 5KFWA 3MEEA 3KK1A 4Q8FA 5KT4A 5IILA 3V6JA 4BE1A 5J2BA 2W8LA 4KV8A 2YV0X 5IINA 1X9MA 2XY6A 2HHXA 1L5UA 2P66A 1EP4A 3K58A 1VSKA 4E7JA 1ZQLA 4UB4A 1Y97A 3AVIA 2AU0A 3JPSA 2AQ0A 2F1JA 4W5TA 4HYKA 2HVIA 4B9NA 1LW0A 3C95A 3GQCA 2KFNA 4QZHA 3QZ8A 2ISOA 1KSPA 4DQIA 3K4GA 4Z6EA 4R63A 3PW2A 4EZ6A 3EZ5A 4YR2A 3VQDA 4CJKA 4DQSA 1T3NA 4LD0A 5DQGA 5J2MA 4JS5A 1J53A 5E41A 4Q44A 2PYJA 4R65A 4DFKA 1D5AA 2QKKA 3MR2A 3SYZA 4JUZA 4DTJA 3GV5B 1W0HA 2UVRA 4KI6A 4UBBA 4Q5VA 3JPQA 4KRFA 4B9LA 4J9QA 1ZQGA 3NDKA 2HW3A 5HRSA 3HPGA 4DU3A 3RTVA 1NJYA 4MFBA 4B9UA 3UXPA 3Q8MA 5SWMA 4FJ9A 1JKHA 3H8JA 5JS1A 1LAWA 2HMIA 2Z1GA 2ZJAA 3GIKA 1TKDA 3TAMA 1K1QA 1T7PA 4BDPA 1FK9A 4AHSA 1S77D 3M8SA 1QE1A 4IQUA 1DGSA 4YR3A 1MC8A 1CZ9A 4Q8EA 1WNSA 1Z00A 5J2DA 4NCGA 8ICCA 1TGOA 3F9KA 3K5MA 4I9QA 5DG8A 1ZQIA 3EPIA 2IS3A 1NJXA 3RB3A 2LYHA 1S0MA 3OS2A 4FVMA 4ECUA 4JV1A 5DGBA 3LZJA 1RT3A 3DLHA 4FO6A 3TAGA 4DTPA 5C5JA 4E3SA 4DL5A 4DU4A 5KG3A 1KDHA 4K4HA 3QZ7A 4QWDA 4CECA 4OJRA 4GXKA 1IG9A 2EX3A 4CF0A 2P6UA 1WSEA 4I2QA 4KHQA 3KJVA 3RJKA 3LDSA 2P5OA 1ZBLA 4I2HA 2VWKA 3RBDA 1Z00B 2Y1JA 4JV2A 4E0DA 4F5PA 4N56A 1NOMA 3H8SA 5KT5A 3SUNA 3AO5A 3ZSVA 3UIQA 3PX6A 2ISPA 3AO4A 3VQQA 3LAMA 4AHUA 1NOZA 1LWFA 3LZIA 1REVA 4FJIA 3DOKA 3IHQB 4F4KA 2XGQA 4UB5A 3I0RA 5DG9A 1RBRA 8ICQA 1VSFA 4CK3A 1RBVA 4I2CA 3DYAA 4QWEA 2BANA 5HLFA 1RBSA 4C8KA 3M9MB 1A76A 4DQPA 4RG8A 4K8XA 1T4GA 4KHSA 1HYSA 2C2DA 3AO1A 3JPOA 3OSPA 1QQCA 9ICSA 5J2CA 4M42A 1ZQRA 4O5EA 5BOLA 1RBUA 4NCBA 2IAJA 4RQ1A 3RJHA 4CEAA 2ZUCA 4CEQA 4EBCA 3L3UA 4IRKA 3ISDA 1KEJA 1HNIA 5J2FA 2YKMA 1QSSA 1LB2B 3NE6A 4FJNA 4IFYA 4CJVA 5KG1A 7ICTA 2PI4A 2JEIA 4QZ8A 4K8ZA 1ZBFA 2BCSA 2W9CA 1U04A 3OY9A 1XSPA 3DM2A 3VQBA 4FJMA 4IQWA 5HMMA 3L2RA 5HROA 3AU6A 4MFAA 2VWJA 3AVMA 2B4JA 2QXFA 3T1AA 3MGIA 1TKTA 3EW9A 4Z4IA 2I1QA 3RMAA 4KLDA 4Q43A 4ECQA 4PHEA 2ZUBA 1ZETA 2VA2A 4RNNA 1B92A 5IIJA 4CFBA 4KLUA 5D46A 4RPZA 3GDXA 1FKPA 3ITHA 4E19A 4ECRA 5KFYA 3O3FA 4NLZA 5L9XA 4YN4A 2W9CB 4I2EA 4CFAA 2NUBA 4KO0A 5KFLA 5J29A 4FLUA 4DL2A 2HHQA 3RMCA 3MECA 3HW8A 3C2KA 1NK9A 1TV9A 1S5JA 5J0YA 4F2RA 8ICRA 2YHAA 2G8HA 2IHMA 5KFGA 3JPRA 2RN2A 1IKXA 4AH9A 4CIEA 3KLGA 3VQ8A 1KFDA 3OYJA 4YVZA 2XC9A 1WN7A 4YMMA 4DOCA 1SV5A 4CJSA 3AVAA 4Z4FA 2X78A 4J9RA 2UVWA 3IM1A 3HT3A 4I29A 4MQ3A 3NBPA 3V81A 3NGIA 2FC0A 2PXIA 4QWBA 3DRRA 5DB7A 4ZTFA 4MF8A 1UAXA 4CJRA 3G6XA 4FYDA 4FLVA 1JN3A 4F91B 5I42A 3KD5E 3RJFA 5KFCA 4KLGA 5CY4A 8ICKA 4KHUA 1RILA 3KKSA 4EYHB 2PYLA 4M47A 3ULDA 3BQ1A 2ZTEA 4CF8A 4M9NA 2FMPA 4O9MA 1EETA 1S1TA 4DTMA 3AV9A 2P51A 4ID5A 2BCVA 4Q0BA 2GBZA 3MXJA 4E7KA 5HP1A 4F3OA 4CHQA 1JLFA 1YTAA 4IR9A 5KTQA 5KG7A 2ALZA 7ICNA 4CJ5A 4EP4A 4Z4GA 1NK0A 1J9AA 3QEBZ 3RJEA 2G8VA 2WOMA 2UVUA 5KFDA 1BPDA 3SZ2A 4DTUA 3M8RA 3H4DA 7ICQA 5HHIA 3AVCA 3MEDA 1A5XA 1XU4A 3N97B 9ICJA 8ICEA 1X9SA 2UVVA 4M9LA 4I28A 2F1HA 4CIFA 3HXMA 4UAZA 3KIOA 1COOA 2BQRA 1HUOA 3EWAA 4CJQA 1T03A 4KLOA 4M3XA 1IO2A 4F92B 3PNCA 1KLMA 5JS2A 4RT2A 3QINA 2PFNA 3CM6A 4O0IA 2PFPA 3AVLA 1ZQKA 4KAZA 3KHGA 1BQNA 4R8UA 1JL1A 2D0AA 3IRXA 8ICFA 9ICVA 1CZBA 3QEPA 4UB2A 5KG0A 3BQ2A 4LSNA 5HRRA 4BXOA 4CF9A 1H38A 1EX4A 3VQ5A 3TFSA 3GV8B 2HVHA 4F2SA 3TABA 1TAUA 4OPJA 3PX0A 4QZBA 4KB1A 4IRDA 1VRUA 3HVRA 4HUGA 3TWHA 4QW9A 5J2PA 4NM1A 4KLTA 3ZT3A 3TARA 1SKSA 3ZSYA 4O5KA 4R8UB 4N5SA 1TKXA 4FW1A 3AVBA 5J0TA 3PY8A 4EZ9A 2OZSA 4B8CA 2LSNA 4YXJA 2YNGA 2WTFA 5EU7A 5CP2A 4O3QA 4BXOB 3SI6A 5KI6A 4PGYA 4RPYA 5KFFA 1DOQA 3PW7A 3HYFA 4DQRA 4LH4A 1X9WA 4O3SA 5KGXA 4JWNA 1VSHA 3EYZA 4KLEA 7ICSA 5FRNA 3SJJA 1VSJA 3GIJA 2X74A 4O3PA 3RAQA 3RBEA 5DBAA 2KTQA 5KRSA 2OZMA 4QZAA 3AO3A 3JPTA 3RAXA 2Q0ZX 4HUEA 3AVGA 4F50A 3ISNC 4I9LA 3SUQA 8ICPA 4F5OA 4P4PA 7ICOA 7ICKA 9ICPA 5J2KA 2GUIA 2F8SA 4GXJA 3U3YA 1K1SA 4RQ5A 5DB6A 4YG2A 4CJLA 9ICOA 3KHRA 1NKEA 2D5RA 4ZHRA 1CXQA 3VA0A 4FJ7A 1NK6A 3PW4A 3MXMA 1RT5A 3RMBA 4E89A 5IIIA 3AVKA 4F4ZA 3H08A 5KFUA 3LP1A 4AHRA 4PHDA 4YP3A 8ICYA 4R5PA 1S0VA 5CYMA 5K14A 2ZE2A 3NF9A 4RQ2A 2KN7A 4RW4A 4I2DA 3V6KA 4RUCA 3KHLA 3NF6A 2E6LA 2VG6A 2MAXA 5J2GA 4IG0A 1ZQZA 3UPQA 5J0OA 3PMNA 2B6AA 4CJPA 3PV8A 2BQ3A 1S6QA 3OYMA 3IAYA 4J9NA 4NM2A 4Z4HA 4W5QA 4I2JA 3D45A 3GV7B 3OJUA 3V4IA 5DLGA 2ZTDA 4N41A 2W9AA 4O44A 1D9DA 1ZQVA 1Z3EB 3QNNA 4I7FA 4DFMA 4RQ0A 3ZSXA 5DBBA 4TUQA 1RNHA 5KFTA 3MFHA 2J6TA 4M2YA 3K5LA 1TVAA 3GFKB 2R8HA 4CEEA 1MQ2A 2IGIA 3MABA 4PA1A 4ED3A 4CEZA 3V9WA 4ECZA 4NY8A 3LP3A 3C1YA 9ICRA 1IKVA 2HHWA 3ZDCA 4GXIA 9ICWA 4C8NA 4CERA 3CQ8A 3DLEA 7ICPA 4CK2A 4TQSA 9ICCA 2Z1IA 3NH1A 1RCHA 3KLIA 4I2AA 4DMNA 2FBXA 2VG5A 1QLNA 4AHVA 3DLKA 4FLWA 3QEXA 2B21A 3M9OB 1XO1A 2DPJA 5KFZA 1EKEA 4Q45A 9ICFA 4BGDA 1RXVA 2YNHA 4O3RA 4DF8A 4QWAA 4P4OA 2BGGA 1IH7A 1NK8A 4ED6A 3T3FA 2C2EA 1L3VA 2AGOA 5J0SA 3HX0A 4F5QA 4OGCA 4DS4A 1S9GA 3V1OA 1UA1A 4BDYA 3OHAA 3FYHA 4CEFA 4BE2A 3TANA 4RU9A 4FK0A 7ICJA 4QWCA 2RKIA 3WNGA 4CJWA 3C2MA 4MF2A 3HO1A 5IIMA 5I3UA 3TFRA 4ZTJA 1NK7A 3LP0A 4B9VA 1U48A 2VG7A 1ASVA 8ICWA 2C28A 4FZXC 3OJSA 3BQ0A 3AU2A 3V9UA 4K4GA 4YR0A 4P2HA 5L1IA 4LSLA 4CJTA 4B08A 1IKWA 4OLAA 4KLMA 4C8MA 4J9LA 1WLJA 1S9EA 4F4WA 4FLYA 3AVHA 3PVXA 4IDKA 5CHGA 9ICHA 4E7HA 1I3AA 2BCUA 4FBUA 4UQGA 4OKKA 5FRMA 4KREA 2FPLA 3HL8A 4J2AA 2KW4A 4Z6FA 1TKZA 4WE1A 2A1JB 4FS1A 1S76D 3MR6A 2ATQA 1ZQNA 2R8GA 3BDPA 1CEZA 1BPEA 4ECWA 1TK5A 4ZH4A 1SZPA 3HPHA 4M3RA 3KHHA 3PMLA 8ICSA 4Z0UA 3L2VA 4DL6A 1NOYA 4CHPA 2FBVA 2QKBA 4KTWA 4HHTA 4RUAA 4QZDA 5J1EA 1RDDA 3T5JA 1VSEA 4EYIB 4CGGA 2G8WA 1QSLA 4LZGA 1HYVA 4N76A 2XRIA 1Z25A 1D8LA 4F5RA 4XQ8A 3OS1A 4J2BA 3KKRA 1HJPA 3L8BA 2PZSA 2ZD1A 4TUPA 2BPFA 3QLHA 4DOAA 4DTXA 4QZFA 1BCMA 5CZ2A 7ICVA 3S3MA 1LV5A 3NCIA 4JV0A 5KG5A 2G8KA 2JEGA 4UB1A 5J2NA 5KT2A 3PW0A 3SQ4A 3SI8A 4YD1A 2Z1HA 5J0PA 3WNEA 1KCFA 4M3WA 3OYGA 3N4MB 1A77A 8ICHA 1ASWA 2RDJA 3BGRA 4FJXA 3Q8KA 3ZSZA 3ZT4A 4QOZB 3AVNA 2NRZA 4I2PA 1QHTA 8ICLA 5J2IA 4ECTA 3TAQA 4KHNA 3H8WA 4I2FA 2FLPA 4FJ8A 1U9LA 1S97A 1TK0A 4FW2A 2Y1IA 3OSNA 3CM5A 4YXMA 5KFNA 1BIZA 3UQ0A 3MAQA 5KFPA 4F4YA 3OYCA 1S1XA 2XCAA 4KPYA 1N48A 2AJQA 4MFCA 4Y1CA 9ICAA 1VSDA 2IDOA 3CFPA 5HRPA 4KLIA 1RT7A 1X2IA 1NKBA 3QO9A 3WNFA 2G8IA 1GOBA 3HPOA 3G10A 4M9HA 1BPYA 1JX4A 5HBMA 3SUPA 5D3GA 5HRNA 2P5GA 2NRWA 3MDCA 3DLGA 4XUSA 7ICGA 4KTQA 1S1VA 3RRHA 4DSFA 8ICXA 3OYBA 3O3GA 3FDSA 1BI4B 2F1IA 5EWFA 2BR0A 1CLQA 4M04A 3ISBA 4YMNA 3B6OA 3QIPA 4B8AB 4CGHA 4AHCA 1WSFA 5DB8A 2HB5A 1QSYA 3K59A 4KHYA 1SL1A 2KFZA 4C8OA 2R8JA 1C0TA 4ECYA 4JRQA 3NFAA 3PO5A 8ICJA 5KG2A 3EPGA 4ELUA 3T19A 4O4GA 3VQ7A 3KD1E 2ZUDA 5T7BA 4DFPA 2IOCA 2NRTA 4RQ7A 1U4BA 4DF4A 2HHUA 1BISA 5KFRA 4R66A 3QIOA 4FJGA 4UAWA 1HJRA 3S3OA 3PR5B 4KLJA 4F93B 1ZQTA 4XRHA 1UOCA 4RW9A 4JS4A 4CK1A 2AGQA 3I0SA 3OYFA 3IG1A 7ICIA 3AA4A 2ZJ8A 4QZEA 2Z1JA 3Q8LA 5DBCA 4LVSA 4IFVA 1JIHA 3IS9A 4RQ3A 4DO9A 3QERA 4IRCA 1RDBA 5JUMA 4YFKA 5KFSA 4DFJA 7ICLA 4M45A 2JGUA 4DOBA 3UXOA 4QZIA 4CF2A 1BPXA 4CEBA 1KFSA 1TK8A 1JLBA 5CJ7A 3M9NB 3CFOA 4KLLA 4YQWA 2OPQA 8ICTA 1FKOA 4Y1DA 4KLSA 5D4BA 1V9PA 5KFXA 3P1GA 4UAYA 2HHVA 4IBNA 4FJJA 3GILA 1NK5A 1BL3A 4BWMA 4CJ3A 2IA6A 1SKRA 4MEXA 3KK3A 4RPXA 2YNFA 4NYNA 3KLEA 4J9PA 4FK2A 2FPMA 4RQ4A 4M9JA 4DWIA 1ZBUA 4CGIA 2BGWA 3ZT0A 1JXLA 4IR1A 3GIMA 4RQ8A 1X1PA 4TSXA 4I2BA 5J0UA 4BACA 1JMSA 4IKFA 1EXQA 4FM0A 4F4XA 1UWBA 4YNQA 3NGZA 4DG1A 1VSIA 3AA3A 4Z4CA 1KRPA 2NRXA 3PX4A 4M3TA 1F21A 3V9XA 5CYQA 4NLKA 3HJFA 1KVBA 2DTUA 3OGUA 4J9MA 4PHPA 4E7LA 1YT3A 1R0AA 1Z26A 1D9FA 4FJHA 4C8LA 1S6PA 1TL1A 1SL0A 2KQ2A 4QZ9A 9ICGA 1BHLA 1U45A 1C1AA 4B9TA 1UT5A 3VQ9A 3AVJA 2BPGA 5HP4A 3TAEA 4M6WA 1ZQHA 3OYNA
chains in the Genus database with same CATH superfamily
2ZOMA 3CCZA 3IR6B 5KOWA 3JTNA 4K4TA 2X6SA 3R9PA 3FSXA 4DG1B 3PIOL 1KQKA 1RISA 4ZLLA 4M5LA 1YVUA 4AYBD 3F5TA 2OSRA 3TKAA 5JJBA 2I5JA 2D8CA 3UQ2A 4OHXA 1HQEA 1DTQA 5JVGL 3U1NA 1I1GA 1QD1A 1O0PA 4NXMJ 3ULEA 3E58A 3HCXA 2D0CA 2BV3A 4FFDA 3N6NA 4M6WB 4MN4C 2DCUB 3C2LA 3M6XA 3KMQA 2WSCC 3G82A 4WP3A 1ZH5A 4ZVQB 1M6YA 3BV8A 3VQCA 3CCRN 4U96A 2HNDA 1VBXA 2JH7A 1CSJA 1VHIA 4FF1A 2QLFB 1DURA 2JVOA 4C0HA 2DXDA 3NAEA 1RAEB 5EY4A 4MYTA 2Z57B 3NHGA 4KFBB 3PIOQ 1YG0A 1Q16B 5HHHA 2FSJA 3K8WA 1FVQA 3LF0A 3IM9A 2B9YA 5ALQA 1HNXJ 1C0UB 2EBEA 5JVGQ 2OEMA 4BY9C 1F2HA 4A47A 2ZC3A 4DSLA 1SPBP 2C22A 4CLUA 3ZDAA 5KT3A 4B3OB 3WK6A 2YVSA 2R7YA 1SUQB 3FRZA 4ZVTB 2D3O1 1DHMA 4X62F 1W2BR 9ICMA 5GMKa 4PL2A 1WD6A 3OXGA 3Q8SB 3RBXA 1Z6RA 1B99A 4EMDA 1Z4UA 3KK2B 5FLXY 2I0XA 2RIJA 1ZRMA 1IBKJ 3NH0A 5AKIA 4PWDB 3WKEA 4W5NA 2P6RA 2JWLA 4JOUA 2E66A 4I2IA 3EDQB 2VHGA 1MSWD 4ZCKA 3C65A 1RHKB 3DRPA 1XNRF 2B9XA 1F0XA 2OGUA 4YDUC 3H0LB 2DGZA 3DKDA 4CLWA 2RRNA 2DPNA 1WSGA 3WXJA 1JLGA 3RWUA 4ELTA 4H4MB 1TZ0A 2AP1A 1WC0A 4I2GA 1U1LA 2ZBIA 1RTDA 3AA5X 2EHGA 2MZRA 2M7SA 1GLDG 2UUBK 1E4GT 4ZKAA 4JI3K 4RT3A 2IVOA 1WG8A 3DOMA 3JQJA 3BKFA 3NVKA 3GPAA 4F25A 2E2PA 3ALYA 2ZJQL 2QMUB 4J90A 1N33K 1MROA 4AD6A 4URGA 3IA0A 2KJWA 4LQ9A 4QR2A 2QFJA 2A1RA 1YTYA 3L6QA 2ZM6K 2W41A 4O23A 1Y11A 4RW7B 2KM8B 2MZ1A 1A0OB 3A12A 5D0GA 1LWEA 3QRPA 1QDUB 2R7UA 3PIPL 2R2SA 1UEKA 2JRSA 1FF2A 1VK8A 5AKLA 3LTOA 4CO1A 1VJ5A 3KBBA 5ETSA 4Z6DA 3K2PA 2NO4A 4PQUB 3V1QA 2RB7A 4USJC 4ELVA 5E3AA 3MR3A 2JHEA 2FJBB 5LT5A 1WAFA 4CDIA 2CQ1A 5M1NA 1X40A 2FF6A 2AQ4A 7ICUA 2XY8A 3V72A 4X4SA 4CJUA 4U7UD 5F41A 3DMJA 3O3HA 3M1VA 5K8OA 3HULA 1CS4B 3EJMA 5CB1A 3CJCA 5L1JA 4ZVPB 3K57A 4FVUA 1ELOA 2DKOB 3KTQA 3FNNA 1WNEA 1F0MA 2C3YA 5DZ7A 4FSVA 3M7DA 1DFDA 3TR8A 3PIPQ 2OM6A 4H5VA 9ICLA 2IRUA 3CNHA 3E1YA 3IM8A 1RYSA 1C1BA 3M32B 2NXCA 4PGQA 1B4FA 2NUUG 4BWJA 1F2GA 4F0KA 2HZVA 1FJGF 1BWFO 3GG0A 2BDPA 1H98A 3M4XA 3EKUA 1NI3A 2W43A 4ECSA 5ETPA 2MQQA 1YJ9S 2J5AA 3E51A 5C25B 3CEDA 3CWJA 3CRXA 2RSQA 1LKYA 2VQFJ 4O5BA 3UB5A 5AM3A 4DPUA 1RT2B 5J2HA 2KIWA 2VC1A 4KB0A 4NXNF 5EWEA 2AYGA 1ZBIA 4J9OA 3PEJA 3ED5A 3GIIA 3TAMB 4QYZJ 1M1GA 2HFUA 1CJVB 4CP5A 3E2EA 2BABA 2KG0A 4BRCA 3WXMB 3HP9A 2XVTA 2CQGA 2W9BB 1TVRA 2KZ3A 3EVOA 3NGKA 3NF7A 2GMHA 4KT0C 2LQ8A 4AM7A 1DQ8A 2HGNA 1S8OA 4UTGA 3T69A 3RRGA 1EARA 1PAUB 2J9DA 3MFIA 4MKVA 5AJ3J 2QWOA 5HK4A 1WSIA 4M3UA 1U1PA 2HOIA 1RTIB 1D8BA 1A5WA 4XH5A 4I0WA 5EE0A 4OZ0A 2VJUA 1ILYA 2BKPA 3AJ1A 2KN4A 4DCCA 4LF9J 4DL3A 1ZQDA 3VEYA 2C2RA 4CH0S 1NZAA 3SMVA 1KAZA 3SNNA 1GLCG 4IDHA 4PH5A 3QGGA 3KUEA 4H5NA 3WXKA 3AH6A 2JVRA 4I64A 2R2TA 3MK6A 1S1UA 2KHDA 3BF4A 3QEVA 1UA0A 1AUSL 2ZWPA 3ETLA 2QKQA 1ASUA 2LYAA 3RH5A 1X6JA 4YOYA 4UOCA 4Y3CA 1U6BA 2V4RA 3ZSQA 2RQCA 2M9KA 3HHLD 4MKAA 1S72S 4RO0A 2JEFA 2NYVA 4RWTA 3M6VA 4U8VA 1NPPA 3DFEA 1MLAA 3TA1A 5AQJA 1HYZA 2RILA 5KOXA 3O1LA 1NHVA 4FWSA 4LVNP 3ZX0A 4IG3A 5L38A 2UUBF 1CJKA 1D8ZA 2HBMA 1WYGA 4RW8A 5EWGA 3VQPA 2E5SA 1RXWA 1IIPA 4XIUA 3SCKE 1NG9A 4EBEA 1N33F 4N7TA 3VESA 4J7CA 4DLGA 1FERA 1SL2A 2BYCA 2DHSA 2XWXA 5JLHA 2AJ0A 5CWRA 2KL8A 2ZQBA 4DBQA 2ZM6F 3CCQS 4JI0F 2RVJA 2E1EA 3NOCA 1ZD4A 1JUDA 5IM0B 2RJZA 4HI2A 4JI6J 4DSJA 1HQ2A 3CIMA 1HUXA 1ZQEA 1ZAXA 2OH2A 4B9SA 2H4WB 3HX9A 1GTHA 4FLZA 3H45C 4TNOA 4U8YA 5L1MA 2XCPA 4DSEA 4L75A 4DQQA 3MMAB 4C0BA 1Q78A 3PTWA 4AHTA 1JLCA 1ZQAA 2XTJP 3BS7A 3OYHA 3ENOA 4PPXA 4KGMA 4PL7A 5KG6A 3D4JA 2ZFHA 4Y2MA 1WF2A 4X4OA 2ASDA 3JPNA 3MM7A 1Q9XA 5DQIA 4X4NA 2PSZA 3M8YA 1IWAA 4A8YA 4MLHA 5AQPA 1WWUA 2POKA 3V81B 3HRGA 3VQ4A 1QZ6A 4FOIA 2P2CB 4OHWA 5J8YC 1YSJA 4RCHA 2B4OA 2P9EA 1R0BG 3J81U 4RBTA 4RR5A 1TE2A 2YMLA 5KFEA 3FEYB 2UYTA 3OYEA 5C12A 3OS0A 5KQDA 4U7CA 2MSSA 1IBMK 3TUPA 2YKQA 2LXFA 4YOVA 3QJLA 1NB2A 4ZPDA 1QVFM 3QEAZ 4JLHA 2HLUA 5HMZA 1ITGA 2CFXA 2NYIA 3IG5A 5MLCV 4CO4A 5A76A 2O67A 4N47A 3V9ZA 1F9FA 4MIWA 4L8RB 1WSRA 1Y00A 2P9SA 5HP1B 1W2IA 2IYGA 2O8CA 1Y5NB 4EP5A 4GKJJ 3HK2A 3M6GA 2Q0UA 1ZQOA 2BTFA 2BW2A 2WOMB 4ZLPA 3R27A 3LDQA 1YBAA 5HNKA 3RB6A 4O5CA 3VMFB 2AZ1A 2R4FA 2XHBA 4RUHA 2F96A 1VSMA 2GC8A 4TUSA 2D0PA 4F3QA 3DDKA 3QBWA 3HHNB 2CKWA 5ADZA 2UUCJ 1KQFB 5LMNK 5DDQC 2O8FB 1JQGA 4KITB 4ED0A 1VQ5N 1HPMA 4P73A 2JZ5A 4ZMMA 3G9CA 1NDLA 2QMXA 2LXUA 4U7UK 5K9FA 3R1HA 2CRLA 3M6WA 4TYAA 1C0UA 3A5OC 3D1QA 2WSFC 3QNMA 1TYQB 4XH1A 1JLAB 1RM6C 1ZD2P 1FFSB 4JD2A 4PPDA 4B3OA 1QH9A 1TL3B 4D3HA 4R64A 4A61A 3M8PA 1L3SA 2G0CA 4MT1A 4KGXB 2XYPB 1H2VZ 2DFHA 5L1LA 5ALPA 3OFFA 1NUEA 5DQHA 1VBKA 1ZA1B 2QEXN 2DH7A 2HHSA 1FO4A 1L8OA 2HQDA 8ICGA 3OL9A 7ICEA 1Q8IA 2AEJA 2Q43A 2RNEA 2CYYA 3BKUA 2VA3A 1XHXA 2HPUA 2P9NB 4AYBF 3DNCA 5I3PA 3Q23A 3OXFA 3VEVA 1RWVB 2VPZB 2NR0A 2ASMA 1JLQB 3ZCMA 4H4MA 4WZMA 4NI2B 4K8RA 4CH1A 4JKFA 3QXGA 2ZKUA 5DZ6A 1PK3A 3W60A 2Y0BB 4KKOA 1DRGA 1DQAA 5AQGA 3IDWA 3GCXP 4LF8K 2R8IA 1WOSA 3H20A 2V0NA 1FT8A 5H9EK 5C24B 4NLGA 2JL9A 2X6NA 5KG4A 5B0DA 2FBYA 1N32F 3K5OA 1VRTB 3JSMA 2KZZA 3QT8A 1RU2A 2HK2A 3QAUA 5CD4A 3E66A 4CI0B 7FD1A 3D7EO 3F53A 1RXOB 2F4FA 3FQLA 3C15A 2AKWB 3V1RA 2VQEK 5AQQA 3OTDA 4RW7A 5AXKA 5KFIA 3H46O 2DR8A 4OX9K 2YPZA 4K4WA 1T0TV 2DNOA 4Y34A 3JPPA 4UZBA 4JI8J 3HKWA 2H4YB 4ED2A 5CYMB 2VJVA 3BGLA 2V2ZA 3AO2A 3ZI4A 5GAGI 4PQUA 4LSZB 3T5HA 3TAPA 2DYAA 3RH6A 2JZBB 4CF1A 2FHJA 3C5GA 2B6AB 4Q8FA 4USVA 3V6JA 3LPYA 2Q3PA 4TU7A 3NAIA 1LOUA 1P7DA 2FHJD 2XY6A 5L9NA 2CJBA 1L5UA 2HK3A 1KQSR 1M5VC 2CIMA 2AU0A 2D9PA 4IOXA 3DU6A 2AQ0A 2F1JA 1JLEB 1DKGD 4HYKA 5HANA 1LW0A 1RWXB 1YITN 4DQIA 1KSPA 1NGHA 3CCLS 3F2DA 2KG1A 4R63A 4QJFB 2QA2A 5AQVA 1HFEL 4EZ6A 1H3DA 3AARA 2EQYA 1PBUA 3QRQA 3BSOA 4G9BA 1T3NA 1NGFA 1XR7A 4DV3J 4LD0A 1IKVB 5H9FK 3WKAA 4JS5A 4M5GA 1X5OA 1IBMF 2E8AA 4Q44A 3BH6B 3MX2A 4DFKA 2QKKA 2H1YA 3AB4B 2UUTA 3G71N 3B8HA 4JUZA 2VGMA 1B4SA 4HHUA 4M95A 3M3ZA 3JPQA 5ADXA 2YJEA 2MLXA 4CW7B 2B9EA 5IT0A 1RACB 2PMWA 4DU3A 2YXLA 1NJYA 3CF5L 3Q8MA 5SWMA 3GIKA 4K4YA 3TAMA 5A2QU 5KPTA 5B0FA 4O4RA 4AHSA 1S77D 3M8SA 1QE1A 3CIPA 2VBYA 1SXLA 4YR3A 3P6YC 3ENVA 1CZ9A 5I3UB 2ZKTA 1WNSA 3TACB 1FO1A 2QB0B 1TGOA 5LMNF 3BR8A 3G4SS 1WBDA 2HSEB 3VENA 2YBVA 4HTJA 4BGAA 1NJXA 3RSEB 1S0MA 2H3QA 4TY8A 3ID6A 3UCUP 3R5GA 2H3EB 2HQ3A 1RA7A 3QT6A 3DLHA 3KUGA 4L76A 3L4PA 1CC7A 1FRLA 2QE5A 3R5CA 2HMIB 3OL8A 5B5EU 2RUGA 2J9EA 1Y64A 3E9PA 4DU4A 1KDHA 4K4HA 3GFYA 1UCNA 3QU7A 3CF5Q 2EX3A 5HVFA 4CF0A 4F0MA 3IBWA 3H0MB 5BYSA 1WF0A 3MD3A 3NOGA 5EXWA 2V7ZA 3KZIU 1N5XA 2P5OA 3FZHA 1TUGB 3ICXA 2G5HB 1TKZB 4KBOA 2YHWA 1SZ2A 3SUNA 4LMZA 4CDGA 1YAGA 3FCHA 2ISPA 3ENWA 4NX9A 3LAMA 3KMSA 1SZHA 1NOZA 3G8SA 1XJWB 1R8CA 2WFAA 1YUWA 3G6ES 1NSAA 3IHQB 5DG9A 3ET6A 2F8HA 1Q5VA 5H1SV 1RBVA 4I2CA 4BC4A 4CZMA 2HHHK 5JMVA 1HHQA 3QQCD 4RG8A 2M0NA 5FPNA 2IRXA 3QT5A 3QUBA 2F4VJ 3OSPA 9ICSA 5ALKA 2P9PB 3L3FX 1VRQC 3RJHA 2IJFA 1D9AA 3CCMN 2ZUCA 3SXLA 2A42A 3NE6A 3GG1A 3UVJA 4FZNA 3PSTA 4LF8F 1BDGA 2HBZB 2XEXA 3P4IA 2KNJA 2DBBA 3I0RB 4ZS6A 1H73A 3OY9A 2KV2A 1XSPA 4WP9A 3DYAB 5AI4A 1GLBG 2LP4A 4K5SA 4X62J 4DUTA 3FSIA 1HYSB 1UFWA 1O51A 4OX6A 4ZPAA 3MGIA 1PYOB 2MY8A 5F8GA 2I1QA 2IAJB 4DZ6A 1U8WA 2KVSA 4Q43A 2VQEF 3IRWP 5IM0A 4OX9F 2VA2A 3TX8A 4CFBA 4CJ7A 1WB9A 4MH8A 3BSCA 4P10A 4E19A 4OYBA 4F67A 1NPRA 1YIJN 3HHLB 3R3LA 2FVQA 3DM2B 1OQ6A 4FLUA 1FRXA 2CQ3A 2GIFA 2HHQA 2QFIA 4CRJA 1X4CA 5HROB 1EX8A 2KYZA 4P0QA 1RWWB 1NK9A 1MA9B 3SQIA 1TV9A 3RRKA 2OIHA 4F2RA 1YI2N 8ICRA 2ZH2A 3M2RA 2G8HA 1FWKA 2HFNA 3O9UA 5HBMB 5BPLA 1UHUA 5CAAA 2BMBA 4FF2A 3A8IA 4YMMA 4DOCA 2MXYA 3HT3A 3ITHB 1BO5O 3V81A 3H5YA 4C1NI 3AGRA 5DB7A 2MLZA 3R6GB 2PBDA 4UY85 1SBRA 4KO0B 4NYPA 3KK7A 4CJRA 3G6XA 2E1ZA 5AQKA 2W7PA 3MECB 1SCJB 4B1YB 5IWAK 4F91B 5I42A 3KD5E 3D6RA 8ICKA 4KHUA 1RILA 5AM1A 4EYHB 3MM9A 4A8SA 2XYHB 8AT1B 5C2FA 1KOOA 4CF8A 4M9NA 2FMPA 1EETA 3O3LA 4AUKA 3N6MA 3ZZPA 4C23A 1JI7A 1MW7A 1PBAA 2HOEA 1GAOA 5AQUA 1R6VA 3TA0A 1BWEA 1WKLA 3EGWB 4ID5A 3NBPB 7FDRA 2CVIA 5M1OA 2HWIA 1RBLA 5B09A 5KNIA 3IR7B 2GBZA 3MXJA 5HP1A 5AT1B 3T1HJ 3Q2SC 2K60A 4EP4A 1NK0A 1J9AA 4ZP6A 5AI0A 4C7ZA 2LFVA 2G8VA 3N0VA 2WOMA 1ZBTA 5KFDA 4H0TB 3ZETB 1IR0A 2LKZA 2J7UA 7ICQA 4DHVA 1HBNB 3AVCA 1VCTA 1CVJA 3Q7CA 2VONA 2I6XA 3CCTA 2VFVA 3K1ZA 2C3OA 3K9JA 5GADP 2L41A 4IFVB 5D4PA 1V38A 4I28A 4OCZA 2R7RA 3HXMA 3KIOA 2MZQA 2D4WA 3CW2C 3CC2S 3R97A 2O8FA 4XDCA 2AHOB 4KLOA 4F92B 1JB0C 3IWNC 1QQ6A 2HMPA 4RT2A 1WACA 3QINA 3D1HA 3CM6A 3AVLA 1ZQKA 4KAZA 3KHGA 3IO1A 4K0KK 2ADCA 1ZTWA 2OPQB 4HT5A 3IRXA 2ODGA 4M5NA 3H8MA 1S79A 2NREA 2YX7A 3QEPA 1ZM2A 5HR7A 3DDIA 3I32A 2WW4A 1G99A 3O5BA 3NGSA 1TYQA 2QZ8A 3KZBA 3WK7A 4KB1A 1VRUA 4B1ZA 2D41A 4HUGA 1KLMB 2HGLA 2GJIA 2I8EA 2YWHA 3ZEUA 3TARA 3D68A 4OZJA 1EHWA 1TKXA 4CZHA 2LEPA 4FW1A 4URSA 5J0TA 4EZ9A 4JB8B 2W01A 5ALRA 2FVPA 4KGVB 1M90O 5EU7A 5CP2A 4BXOB 1F5CA 2DRDA 3EVMA 1R43A 4ZDNA 4NMXA 4X2BA 3PW7A 3AGKA 3ULHA 1S6PB 1VC0A 3HYFA 4PAAA 3RU0A 5KGXA 3AAQA 2FPHX 4L72B 4DPWA 4NI2A 2YN4A 2A19A 2ZITA 2RU3A 3GIJA 2XZTB 2KTQA 5KRSA 2M8HA 1IXKA 1TMMA 4C4SA 2GVZA 3A3OB 3LW5C 5TKWA 1RT4B 3ISNC 4I9LA 4XH4A 8ICPA 5HN0A 4WK1A 1VC5A 3DV9A 9ICPA 5DM6L 5J2KA 5E3RA 4GXJA 4L74A 4U7BA 4IQXA 2EWHA 1VQ9S 3KHRA 2QO3A 3VCBA 4IS7A 2Y1LB 4ZHRA 1CXQA 1NK6A 4MKYA 2P9CA 2EAOA 3FMBA 2FLOA 5LSLA 1KWMA 4E89A 3ZTRA 3CPWM 3J7AP 2L9NA 5ETLA 4BCAA 1JK9B 3LP1A 5KL8B 2V2KA 2JGAA 4YP3A 2ZBCA 3NWRA 5CYMA 5DJBA 4I2DA 3KHLA 3Q22A 2E6LA 4IG0A 3UPQA 3ZZOA 2B8PA 1J6ZA 3UI3A 2B6AA 2OEJA 2WK4A 5B0CA 3IAYA 3SMSA 3D45A 2UUBJ 4HH1A 3V4IA 5DLGA 4GMKA 2ZTDA 4JI3J 4N41A 4O44A 5DM6Q 2PO4A 2AJFE 1D9DA 3SD7A 4EU0A 2NUHA 3L0QA 4DFMA 1VQSA 4WU2A 3BKTA 1KW4A 3C66A 2UUAK 3ZSXA 4LF6J 1HI8A 2C1EB 2BDUA 4R5PB 4WFAL 1FI4A 4H54A 2JH1A 1IR1A 3ISZA 1MQ2A 1RQLA 5GVQA 1VIXA 3MABA 2GO8A 4PA1A 3SMZA 3QUTA 4CEZA 3WQTA 1QAXA 1BQMB 5IWAF 3LP3A 1S6QB 3EXCX 4UOGA 1IKVA 2DK2A 3MOJB 3POTB 5ALHA 4GXIA 3HSCA 3FVYA 1NDKA 2JLGA 5EOYA 3V6DB 4V19X 2C3PA 4BRFA 1NDCA 3GJRB 2KT2A 1HARA 3W63A 1ZM4A 4FLWA 2A3VA 4EK2A 1EKEA 4Q45A 2FJAB 1RXVA 4DF8A 4P4OA 2PMZC 4GVBB 1IH7A 2BGGA 1HD1A 4ICAA 2HIYA 2C2EA 3GSDA 4LF4K 4F5QA 4QU7A 1CJUB 1RAJA 2U2FA 2HQGA 2Z0GA 1X4AA 4Y2PA 7ICJA 2VV5A 4QWCA 2RKIA 3DLEB 4JAXA 1VQMN 5I3UA 4YDXA 3TFRA 4ZTJA 3R7NB 5AQIA 2QB0A 3Q86A 4B9VA 4FYWB 2VG7A 4DX5A 1ASVA 1WEZA 5BRHA 1TUUA 1HQUB 3AU2A 4CJTA 2KIVA 4RL1A 4KLMA 4K0KF 4J9LA 1WLJA 3L4IA 1S9EA 4F4WA 4FLYA 5IFMA 3AVHA 1VGYA 4KH6A 5CHGA 4WFNL 2GWJA 4Y2TA 4E7HA 2P9UB 2HS0A 1JJHA 2PN6A 3P49B 3FFIB 1RAAB 4BRGA 4QIWC 5FRMA 2UU9J 5J8YA 1X60A 3UM9A 1N60A 1SH2A 1VQNN 1TKZA 2A1JB 4NLTA 3BEGB 2WZ1A 3S6JA 1TAMA 2R8GA 1CEZA 1FCAA 4ECWA 1TK5A 5A0YA 3QJPA 1P6TA 1Y3JA 1IKWB 1SZPA 3WUHA 1T9TA 4UUWA 2ZOFA 1WEYA 3PMLA 1SJ4P 4Z0UA 1NGDA 2RU9A 2DIVA 2F7TA 2ZH3A 1X4GA 4BS2A 3CE8A 2W4CA 4KTWA 3TZYA 4A46A 4FXVA 4DR2J 1OW5A 2IDEA 2ROPA 4LFCK 3T5JA 4WFNQ 4CGGA 1WWHA 1HYVA 1D8LA 4WE1B 3I4PA 1RDUA 4LBIA 5AKZA 1HW8A 3W8GA 4DTXA 4QZFA 3S3MA 4M8LA 5ALLA 3OW2M 3JQMA 5KG5A 2ZUGA 3BR9A 3PHEA 5J2NA 1IJFB 2DNHA 2ASPA 5KT2A 1MN7A 3SQ4A 1AA1B 2R7WA 2YY3A 4KAIA 1QQOA 4DXLA 3I31A 1HNVB 1RWUA 5AKKA 1UW9A 3T41A 2ZHBA 2MKJA 2O8DB 3DJCA 3KKAC 4UAVA 1LXNA 1GEHA 2ZD1B 5KAFU 3MN5A 4Y28C 3H1QA 4QOTA 3N79A 2Y1IA 2K8CB 2VFTA 1C0FA 5KFPA 4F4YA 2Y0SC 3C14B 4W98A 3R5DA 1N48A 3H2LA 1OPIA 1RKJA 1J97A 2F3JA 4CTAB 1RT7A 3OVBA 3VAIA 2V2QA 4WQ4C 1RFQA 3OL6A 3HSZA 1BPYA 3TYTA 1FJ7A 5HBMA 2W2NP 3IC1A 1HWLA 2XMTA 2KJ5A 4KTQA 7ICGA 4CRXA 3IRUA 2DY1A 2WVCA 3ALRA 4X4QA 1BI4B 4C2MA 3PJXA 2YQ3A 1Q82O 2FHKA 2BR0A 1CLQA 3B6OA 1FKAF 3NMAA 2IM3A 4CGHA 1FWPA 3LDOA 1WSFA 4BR5A 4B3MF 2VBZA 1KP6A 3JS6A 4WF9Q 1QSYA 3K59A 3KG1A 2KFZA 2E5LJ 1PILA 2DNZA 3C16A 5M1FA 4DCJB 3GFHA 2KVCA 3K0SA 5DDPC 4B1WB 3OLBA 4YOWA 2MA1A 1L6NA 2ZIWB 3KD1E 4JKGB 1H2TZ 3RZAA 3LYSA 4P7VA 4DFPA 2Y3YA 2IOCA 4ILHA 4OV1A 1YHQN 2ZWHA 5D78A 5AXLA 3SQGA 1CJTB 3DLLL 5D15A 2IJNA 2LDIA 4LF4F 2K8AA 3PR5B 4KLJA 4F93B 1R59O 2OELA 1ZQTA 4XRHA 1X4EA 1UOCA 4RW9A 1WWVA 2QWNA 3QATA 4ED5A 2DIUA 3I0SA 1C0TB 4YOUA 7ICIA 2AXTU 2Z1JA 4QZEA 4URQU 1U2FA 3JSBA 4IFVA 3FZFA 3CCSS 3I76A 4CIOA 2FYXA 3QERA 4NL9C 4IRCA 3KLFB 5JUMA 4O3MA 3TSQA 2G13A 2P6SA 1EIYB 2JGUA 3KJNB 1JROA 2EG1A 1TK8A 3TX0A 4K2XA 3UKUB 3J81j 1YVFA 2OPQA 3PJ9A 4A8EA 1RDFA 8ICTA 5AI5A 2LCWA 1SIJA 3P1GA 3DLLQ 1BC6A 2QN6B 5B8HA 4UAYA 1NK5A 3BF3A 5ETKA 2DVIA 1BL3A 2D3DA 1WSVA 1SKRA 1P8GA 5BPNA 3FZMA 1WOPA 4F36A 4QYRA 1ZM9A 4FK2A 4WJ3B 2FPMA 4RQ4A 2WTUA 3B6BA 3D6FB 2D7SA 2OXOA 2BGWA 4P9SA 2W55A 4C4TA 1KEKA 4RQ8A 4ZIWA 4M94A 4TSXA 3VAFA 3NGTA 3EXYA 2NZTA 4DV4K 4BREA 3CC7S 3OR2A 1UWBA 1BMQB 1CBKA 2GJ2A 4YNQA 3NGZA 2WHOA 4F26A 4MO4A 3PDNA 3QT7A 1YJ9N 1N5TA 3VGSA 4ZJQA 4M3TA 4LFCF 2AJ2A 4B3SK 4B9QA 4BR9A 4NLKA 3HJFA 3O0FA 4NLXA 1D9FA 4C8LA 1S6PA 1TL1A 3R6LB 3KLEB 1U45A 2JFDA 2OFHX 1JNRB 1QVGM 1ZQHA 4I4BA 4USAA 4PYAA 1SKWA 1RT4A 4H4OA 2X1GA 3J7YP 4NLNA 3RVCA 3TJ9A 2LXIA 2F3NA 3M1FA 2CJ9A 1JCGA 1OSDA 1ZBHA 5GTHU 2QARB 4ZVUB 4K43A 4KLHA 2KHQA 1U1MA 2ILYA 5DG7A 1RP5A 4KHPK 4A57A 8ICZA 2BH1A 3IDHA 3NF8A 1Y88A 3TI0A 1Q4RA 1S10A 4AQYK 2ASYA 2V4QA 2BJ1A 4K59A 4EELA 3H3OB 1FIQA 1IWGA 2LM4A 3P3DA 5FROA 2EDUA 2CA9A 2OYQA 1B9DA 2K1RA 1RZMA 2KT3A 4DV2K 3TUJC 1SC6A 1HMVA 5BREA 4DKWA 5GMDA 1YLXA 3HI0A 2V6AA 2HRUA 1NM1A 2HAIA 1E6YA 3DOLB 1RBAA 3N6LA 2YKAA 3R5BA 4IUFA 4AXJA 9ICQA 8ICBA 2KICA 4Q7AA 4KQZA 4OVLA 5H9EJ 1N5QA 4J8FA 1NKCA 7ICFA 4JMUA 2QWMA 3H98A 2BOAA 3PG9A 2FBTA 5HR6A 2VB6A 1N61A 2G07A 3M2UA 2W8KA 3ZD8A 3OT9A 1PJ5A 3MUTP 2CAJA 2DR7A 5D49A 1S72N 4DFDA 1P90A 4M41A 3OFGA 2AJ1A 1BQMA 2YTCA 1OMSA 1LFWA 3BB5A 4O55A 5CHCB 1BPZA 4DQ8A 4ZCLA 4OYAA 5GIOA 4NA1A 3V6DA 2V9KA 3L4QA 4A59A 3L3VA 3HJVA 3NGRA 1RDCA 1Z4NA 1IJEB 3EEQA 2IMWP 5DDYA 1U7LA 1UPPA 4DPTA 1U26A 1Q3VA 4ISEA 3DRSA 3BYRA 5EDWA 2KMDA 4ICLB 4QZGA 2ZH8A 2YHBA 4KYZA 2O4GA 3W5YA 1VQOS 1JALA 5JMNA 4DOZA 5AQOA 3CCQN 4CZEA 3BZQA 1QUVA 2IC3B 2CPZA 4LR8A 4ECXA 4UW9A 2HHTA 1C1CB 4KLQA 4RW6A 4A8MP 2P6TA 2CPIA 5CE3A 4C9DA 2QIFA 1IBKK 1IBCB 3C29A 3GJQB 3CCJS 2ZH6A 4FXDA 2DISA 3QIDA 3NH2A 1BE4A 1MWYA 5AM4A 2PAVA 4KN4A 4P75A 5H9FJ 3VAGA 1HQUA 1RT1A 1SWVA 4AE5A 1QHAA 1PZNA 1ZQYA 1C0MA 5HMXA 1CUKA 4BR7A 4P52A 2AMCB 2E1YA 3SK3A 1VSLA 3MZIA 4DTOA 3RJMB 2HGMA 2E1FA 2NXNA 1RGIA 2DNLA 2XMJA 4QIVA 5FD1A 1FX4A 3O2IA 3FFIA 2OCEA 4W5RA 2RRDA 1DLOA 2A6MA 5F8IA 1RUSA 4DV6J 1S1WA 3WNHA 2A1JA 4F72A 1APSA 3PW5A 2W4PA 1NGEA 4USKA 5C2CA 4PQAA 3F41A 3C19A 4ZJLA 3CJ8A 4DV1K 1HI0P 2FMSA 1KAYA 2FLLA 4ECVA 5A0LA 2DCLA 1T9UA 4DV4F 5FPMA 3LDLA 8RUCA 3ZT1A 2KRRA 3KWGA 1NGGA 3L2UA 2Q1NA 3JAMU 4MIAA 1UVLA 3UE2A 4P4MA 4ES3A 3C2PA 1EXNA 3D0HE 4CHNA 2BE2A 3JSRA 2HFZA 4BC9A 3O6WA 4PZNA 1ZQBA 1X9XA 4YMOA 4UT4A 4HTLA 4EO8A 1BIUA 1KAXA 4BQZA 1MQ3A 4Z6CA 1B43A 4LJXA 3OLAA 3MI7X 3NTUA 1MU2A 1NU4A 4JKEA 2P9LB 1V3ZA 4Z4EA 4QS7A 1DTTA 3BQTA 1RDRA 3LP2A 3HHKA 1UVMA 3T6BA 1HNVA 3I5BA 1N5YB 3Q7BA 1IBLK 2JJ4D 2M88A 2D74B 4HCBA 2O8EB 3T7ZA 4LF1A 1RLCL 4DR5F 4KHPF 2E8OA 2OPRB 4FBTA 1HWUA 3G8TA 1CXUA 3CJKB 3THYB 2HHHJ 4AQYF 5EHHA 2QC3A 4M9GA 1HPZA 4DHYA 1TV6A 4N8NA 2DR9A 3BO3A 1V85A 5CEHA 2MQLA 3Q8UA 2QWQA 5A8RB 3B6PA 5A6PA 1NO8A 4DN0A 4DV2F 3AY0A 2YX1A 5LY3A 4K4IA 2N4CA 4DX6A 2ZXHA 2QA4S 1RT3B 1SGGA 4JHDA 2W54A 2FQQB 2ZVSA 2MJNA 2ASLA 3RR8A 5HMLA 2FI1A 4QYZK 2IBKA 3RMDA 3CDAA 3OQ2A 3MUMP 1D3WA 5J2QA 1BNOA 2GHWA 2DBYA 4F71A 4IQVA 1ZXIA 4E7IA 4EX7A 1F3FA 2LYVA 3M8QB 4I6AA 2NPIA 1BI4A 3P4UB 1UJ4A 4B3RK 4CT8A 1KFTA 2EPIA 2V9WA 5TISU 1SWWA 1DBDA 3QYPA 5EVZA 1RTJB 3CGIA 8ICIA 3H6EA 3PKMA 3THVA 5DMRA 1IM6A 3WQPA 4I56A 3OHBA 1VK0A 1LWFB 1OY6A 5AJ3K 4OYPA 1RG6A 2XLJA 2HYIB 4ILGB 2B56A 4DCOB 3C3LA 4P2FA 3FK4A 1S0OA 3THWB 2MKIA 2XMUA 4FJLA 4LY7A 2ZIWA 4JKGA 4FZVA 7ICHA 3V9SA 1HUZA 1IVZA 2BHNA 3A8YA 4D3GA 2AX1A 4HTIA 4DTRA 1CJTA 1ZOLA 3B0XA 5DM7L 4USIA 5GADI 1HKCA 3PRDA 3HVTB 9ICUA 2GTDA 2XO7A 4GLXA 2FY8A 1SQGA 2H51B 3SAFA 3ZZUA 2IOFA 3QNOA 1UT8A 3LAKA 3AEVA 2AGPA 1IBKF 2YWFA 3D3BJ 3H0RB 1TTHB 2V5HG 1JL2A 1TAQA 5KFOA 2K4IA 4PY5A 3O44A 3KLFA 5IWAJ 3G6YA 1HR0K 4DS5A 3ZSRA 4ZVFA 3UR3C 3RB4A 5DDMA 3T5KA 3BUZB 2BPCA 4CQ1A 4QW8A 2OTJS 3OVNA 1N6QA 3MTKA 3Q8RB 3CJ3A 2O01C 1IKYB 5E33A 2PFDA 4IWVA 3ZSOA 2YMMA 4OJ5A 1N34J 1X42A 3CDEA 3EICA 1Y10A 2MKYA 5DM7Q 2G8UA 3WKDA 4MK7A 1NH8A 2GS8A 3ZDEA 4K7QA 2H48B 2GV1A 2WAQC 4FYVB 4H5RA 1QTMA 1K6YA 4YB7A 1URRA 2XO6A 4GO7X 2X1FA 2VICA 2RF2A 3QX7A 1ZQXA 4JI6K 1VIOA 1YZ7A 1VLOA 3NS7B 3THXB 2CPFA 4GW6A 9RUBA 4MFFA 2J7KA 4YN3B 3SDEB 2OPPA 4WFYA 2MKCA 2MSTA 4KBIA 3D6HB 3VA3A 1DT9A 4K0KJ 1FDDA 2ZNZA 2CH5A 7ICMA 2NS1B 1SXDA 1C6VA 4A2BA 2MGZA 3MPDA 3M6UA 3IWLA 2AF6A 2PMZD 1PK1B 4DL7A 1N8RT 3G0ZA 5ALXA 3CQXA 1RT6B 4E98A 1FRJA 3C21A 7ICRA 2BJ3A 4GY2B 5C42A 2YNIA 4CEOA 2XY5A 1NNDA 3MC1A 1UZHA 1NGBA 1FFGB 2H3IA 3CFRA 3P83D 2B5JA 3EY1A 3TW0A 1IBLF 3G4SN 2MSNA 3KOOA 5GAHU 2LPEA 3CCES 3RR7A 3MEGB 1R8BA 2DRBA 1LK7A 3ZD9A 1ZQWA 4RJVA 4KPCA 4DU8A 3ETRA 3SENA 1U2CA 1AFJA 3CJSA 3H7IA 5ALFA 1VJQA 3NS1A 2DNKA 1PIEA 3QYYA 4G3IA 2Z2ZA 3AN1A 4TQRA 3SQ1A 1O8BA 3C1ZA 2DT9A 4GMJB 2VF3A 4PZOA 4WFZA 1VQLS 5AQXA 4CIGA 4MYUA 4J91A 2GWKA 3PZPA 3VEZA 3MN9A 5IIOA 3SEOA 3ILJA 2KVQE 4H4KC 4G65A 4B9MA 3D5MA 4JNEA 1Q9YA 3DI6A 1YRXA 4GKJK 4MK9A 3DOLA 3V5RA 3HT0A 3VF0B 4H8KA 3H42A 2DHGA 1BQNB 2ZUAA 1JJ2M 2E3TA 3G6EN 3OTEA 1RHJB 4CT9A 4C8YA 1S6UA 2XI2A 1QQ5A 2E88A 4RKUC 4RU2A 4FJ5A 4NYOA 4K2JA 2X3DA 4BC7A 1ZQCA 4W92B 2N1RA 2YKNA 4LFBJ 3CJRA 4B3RF 4WKRA 1EJ7L 1RE1B 1C4CA 4QIFA 9ICBA 2V51B 1I5OB 2B4PA 3VQSA 2EXUA 2PY5A 3B0YA 4OPAA 1MWMA 5AJ3F 2JLEA 4BC2A 3BJYA 5MLCQ 3FMWA 1KQQA 5ALWA 2PGCA 4LRBA 3AAWB 3QBXA 5GMEA 1MDUB 4YFUA 2K89A 2RQ5A 5L1KA 1WSHA 1ZXOA 1KVKA 5ETOA 3V4MA 3EGZA 1XWLA 3VZHA 2V8DA 4ICLA 2RDDA 3FBEA 4E1NA 2OPSA 3UN2A 3AD9C 2OD6A 3A4TA 1ZM3A 5F8NA 2UUAJ 2VYPA 1YJNS 4CD1A 4J9KA 2ATLA 1N54B 2WFBA 3VAHA 1C1CA 3W9JA 3ASMA 1L3TA 5AQYA 4AL6A 1L8LA 1MN8A 3CJ7A 3ZSWA 3VN5A 4OLBA 3VALA 1H7WA 2PE8A 2O4IA 4JBCA 4PXCA 1IM4A 2P35A 5IV3A 1HR0F 1X3NA 3CJBA 4WQ4A 4FWMA 4CZJA 2QSWA 2BVZA 1EO1A 1F1BB 1F5BA 3C23A 5DLFA 2VANA 3QE9Y 1FRHA 2VKRA 1QQMA 2KO1A 5AQNA 9ICIA 3HZEA 1PUZA 4EEYA 2RPIA 1U1KA 4DUZJ 4CHZA 2K4PA 3CD7A 1S57A 1ZQQA 1HX1A 1T11A 4LF4J 4XEIA 3WHIA 4QR0A 2FVSA 5IILA 4YEAA 1DXSA 1PYSB 4DV7J 4BE1A 2DHAA 4KV8A 5IINA 5KL1B 3UCGA 2NCKL 3K58A 1VSKA 4FNIA 5T41A 5D4OA 1REGX 1Y97A 3AVIA 1KKXA 3CT9A 3SFGA 4ANDA 3M8ZA 4PABA 4JI6F 5LJWA 2CNLB 3QZ8A 1VBYA 1O13A 5FDLB 3ADAC 4ZPTR 1EKRA 3GZ7A 1KVJA 3D2QA 3JS9A 3EZ5A 4LIWA 3VQDA 1P1TA 4DQSA 3KK1B 4JV5K 2IRYA 5E0OA 3Q8VA 3VQTA 2GHVC 3GU0A 1KDNA 5J2MA 2XYGB 2YY6A 3MHYA 3AAPA 3MEKA 4R65A 3HILA 1EP4B 3N4WA 1BUXA 2JH3A 2DH9A 3KLIB 3PLAA 4FWLA 2HS4A 2VU5A 1W0HA 1KKHA 3GR0A 2ZIXA 2OJ3A 2P9LA 3CJTA 1HBUB 4B9LA 1KVIA 1VQ8N 3F44A 2F7VA 2IOFK 4NL9A 3FFKB 3RTVA 4PCQA 3QJJA 3HVWA 1O6XA 4B9UA 3VEWA 1KXPA 4IOAL 1JKHA 3H8JA 1VQ4S 1LAWA 3OBWA 2Z1GA 1U2RA 4DV3K 4GV3A 5LL6d 1FFUA 4CE6A 1B0TA 3AL0B 4ETZA 2DH8A 1FK9A 2GAGC 2RE2A 4NZ0A 3CJKA 1I51B 1AW0A 1H6KX 2WC9A 5JVHL 1DGSA 2FVCA 4MJKA 5BN9A 1TR0A 2W3SA 2H5JB 2VODA 3HD1A 3OTBA 4WIQA 2OMOA 4NCGA 3LP0B 3O1WA 3MGVA 2F1FA 3AQPA 3K5MA 1BA0A 5GAGP 3OS2A 2HURA 1HI1A 1OVQA 1WKJA 4M5DB 4GKJF 3M8WA 1RT3A 1M5HA 3TAGA 5HVHA 2VIXA 4DTPA 3Q24A 4DL5A 4DCPB 3D2FB 4HT7A 4OJPA 4WYWA 4CECA 4OJRA 4IO1A 1IG9A 1NSKL 4IOAQ 2P6UA 1WSEA 4PG5A 4KHQA 2PA3A 3ZZTA 1L7OA 3KJVA 4CLKA 2KKZA 3RJKA 2OKQA 1NSQA 5AZJB 3LDSA 2YMQA 5IQ6A 2VWKA 4O8UA 4LF2A 1Z00B 4KX5A 1XERA 3RAMA 3J7AN 4N56A 1YJVA 1NOMA 5KT5A 3H8YA 5A8WA 2H65B 4X4PA 1NHUA 4UOFA 2JWKA 3AO4A 4AHUA 4DR6K 3R5JB 3RGIA 1LWFA 2RT3A 4OJLA 1NNLA 3CD6S 2RUSA 3DOKA 4F4KA 3M2VB 1TUVA 4ZCMA 8ICQA 4JKHA 1VSFA 2AA4A 4O5FA 4CK3A 3B54A 5HLFA 3M9MB 4I2QB 5U47A 2GELA 1T4GA 3UKRB 4Z7CA 2ZGYA 2J4RA 5DRKA 3K1RB 2D69A 4CEQA 1VQ9N 4EBCA 3MM8B 1WJ9A 4FP9A 2OD4A 1KEJA 3BY5A 2VIHA 3IUCA 1DY3A 2YKMA 4FJNA 3AHPA 1REVB 1UPMB 1B70B 3CNQP 2PEHA 2R7XA 1U1QA 4K8ZA 3EE3A 3V2UC 3W2WB 1U04A 3MCOA 3PSFA 5HMMA 3CPWR 5LSRA 3ZYYX 2BJEA 2VWJA 2KDOA 4GIBA 3AVMA 2QXFA 4NZ7A 1ZZNA 2F4VK 3T1AA 1F3VA 4ES2A 3LM2A 4Z4IA 2F9DA 3UPFA 2KM8C 3RMAA 1KOHA 2W7AA 1UKUA 4Z2XA 2OEKA 4ECQA 4PHEA 1T44A 1WUUA 1HNIB 2CG8A 4LFAJ 5IIJA 4KLUA 4RPZA 1FKPA 4UATA 2XSJB 4GVEA 4UF4A 1NZPA 1V3RA 2W9CB 4BR4A 4Z94A 3VGLA 3HJEA 5J29A 3W9HA 4BVOA 4DL2A 4MTPA 2G9OA 3MGJA 2BE7D 3A5LC 1SV4A 2XS7A 4V19J 3ZLJA 3DN9A 3DXMB 2IHMA 5KFGA 4FPRA 2B7CB 3MWTA 4CIEA 3G2XA 3IAS9 2I7NA 2QWLA 2XC9A 3WQUA 2X78A 3THXA 2BJ7A 4BGBA 2RRBA 2FC0A 2EC0A 3DRRA 5D4NA 1DAXA 5J1PA 4DCHA 1CG2A 1UAXA 3QIPB 4IH7A 1R6YA 2YWEA 1RQNA 5F3TA 4FLVA 4JV5F 1PJ6A 1JN3A 2I9SA 5KFCA 4MHVA 3J7YI 1WUAA 3QMLA 3ULDA 3BQ1A 2KE7A 2ZTEA 1MN9A 1S1TA 3DU5A 2KT5A 1A6SA 3E0FA 1SV5B 3AOBA 2IPOB 1LEOA 1U1NA 2BCVA 4Q0BA 2W6LA 4E7KA 4F3OA 4JI1J 1Q8LA 4UY8O 1YTAA 2V94A 5KTQA 7ICNA 2ALZA 3R1LA 1RU1A 3QEBZ 1WTFA 4DV3F 4MKBA 4LUBA 3WKBA 4AXIA 5AICA 3SZ2A 4DTUA 3M8RA 3H4DA 3TVKA 1JNZB 3MEDA 4KHRA 4OYIA 4KGZB 3U26A 1Q79A 1KHWA 2BM0A 4B3SJ 4NEYA 2UVVA 1GMUA 2GFFA 4CIFA 4UAZA 4BVPA 1SJRA 3HZGA 3M1YA 1SJ3P 4CJQA 4M3XA 5JU5A 2G1DA 1IO2A 5JS2A 4FN5A 2H3VA 3H1VX 5ETVA 3T1HK 2F77X 2PFNA 2DNGA 4I68A 1SJ1A 3TEGA 5RUBA 3C0BA 5KQ8A 3FZLA 1QCKA 1TELA 1BQNA 2J8AA 1K8KB 3F2BA 1UZDA 2D0AA 3TP2A 2Q2RA 3CPEA 3GLJA 1I94K 5GAEI 2B7BB 3J8AA 2ALYB 4ANCA 4UB2A 5HRRA 2QGFB 2AT1B 2MQMA 3TZXA 3TFSA 3GV8B 2KJ8A 2HVHA 4F2SA 2PC6A 1MA7A 5CCLA 3TABA 2ES6A 3PX0A 1ZA2B 5M1KA 4LRDA 4QZBA 2CPYA 5CABA 4IRDA 3NG8A 4Y2VA 1T95A 4M1KA 1SB3C 3SSSA 5IT9U 4QW9A 1VHFA 3TWHA 2ZG6A 3D2WA 4AQYJ 1ZS6A 3G96A 4DR6F 4TKTA 4KLTA 1ACMB 1GMVA 3L7PA 2PMZF 5AI6A 4O5KA 4R8UB 4N5SA 3MM6B 3AVBA 4DV2J 3WEEA 4WTOB 2E8PA 1WC3A 1UVJA 2YNGA 2FZGB 3MR7A 4CZIA 9ATCB 5CYQB 5KI6A 2LKYA 4PGYA 4RPYA 1FD8A 3H5XA 4UB8U 2R7TA 3VWSA 4FWKA 5FJ4A 2PDAA 4OX8A 4JWNA 3EYZA 1NU0A 2VCPA 2ZGZA 3GBTA 2XWYA 4DL0C 4YHHK 2DITA 2P9GA 5J2PB 2BJ9A 2O5DA 4CNZA 2NLXA 4O3PA 1L7PA 5DBAA 1CLFA 1XUPO 1FHTA 1NLKL 1SC1B 4K50A 3AO3A 3JPTA 3UMCA 2Q0ZX 1YVNA 1OPZA 1GNKA 4PYDA 3SUQA 1J2MA 4KRWA 2QB1A 3B82A 2F9WA 1J5EJ 2JFKA 2RQKA 1M5PC 3IGVA 4OHYA 2DD8S 4Y2SA 1J5OB 4B6JA 4YG2A 3QWPA 1QAIA 4CJLA 2F4VF 4ZP8A 1P1LA 1AXQA 4X4RA 5AQLA 2D5RA 3VA0A 3PW4A 4P7TA 3P8BB 1N0UA 3RMBA 4IO8A 2F8MA 3CMAS 3AVKA 4F4ZA 2HAFA 5KFUA 3TQEA 3GOIA 2E1AA 3D7SB 2A18A 2YB1A 5BR8J 1MWKA 4RW4A 4RQ2A 2WB1C 3V6KA 1FRMA 2OFGX 3DEEA 2MAXA 3IMXA 4DR7K 2QYGA 1FE0A 2KOBA 3EKSA 1RAIB 5AK3A 3OYMA 3CCWA 3JAMY 3C46A 2P8IA 4NLBA 4AL5A 3OJUA 4TY9A 1GX6A 2W9AA 1SAZA 1RT5B 3WX8A 2R7SA 5HQ8A 2BOPA 1WKKA 5DBBA 1RNHA 1PSDA 4M5IA 1NGAA 1ULRA 1H7XA 3DLJA 3K5LA 2G4BA 5I9EB 1SQEA 2IYIA 2E9TA 2OMLA 4C6AA 3H2UB 2VG6B 3N5BA 4ED3A 1U1RA 1ZAVA 3AJ2A 3SCLE 4HLBA 4NY8A 3C1YA 3GB0A 5GINA 3ZDCA 1R3NA 2VUGA 1H1VA 3CQ8A 2DL0A 3CJ2A 5FLXO 4DR4K 7ICPA 3EL2A 4TQSA 9ICCA 2Z1IA 3KLIA 4I7FB 4DMNA 2FBXA 3CUNA 5A8KA 2VG5A 4LF6K 3KFUF 4JI7J 3QEXA 2B21A 4NLVA 1HWIA 3C6UB 1E6VB 3CCSN 2YQ1A 5AE1A 4JK8A 4QS8A 9ICFA 4BGDA 2YNHA 4O8KA 1K47A 1ROFA 4DV1J 4UAUA 2Y1RI 1L3VA 1RJJA 2HBKA 5J0SA 3GZFA 3HX0A 4DS4A 2MZSA 4C97A 3VCDA 3V1OA 1UA1A 3OHAA 4CEFA 4BE2A 4RU9A 2H5EA 1ITPA 1WHYA 2AV5A 3IR5B 2ZIVB 1X4DA 2AWZA 3AB2B 2YMPA 4DX8H 1QY7A 3LP0A 3OTOJ 1U48A 2HQCA 2Q66A 1AZSB 4FZXC 5L46A 5KPRA 1WC5A 2YH1A 3V9UA 4K4GA 1XIQA 4Y0FA 3T1HF 2CVEA 2Z2LA 4LSLA 2CQHA 4OLAA 4IOBA 4TYBA 3TZWA 3PVXA 3HSDA 4IDKA 9ICHA 2BX6A 1S9GB 1OO0B 2GOLA 1I94F 1XNSA 2CJAA 1X31C 2HBYB 2JC1A 1AUDA 1Q8BA 3CC7N 3O8MA 4UQGA 3H59A 1IBLJ 4AYBC 2MKHA 2J0QD 4I6MA 3WBZA 2FPLA 2OHFA 5ETTA 4J2AA 2KW4A 2XS2A 2IIRA 1D4XA 3X1LB 1ECWA 1K73O 3H5SA 1HA1A 2FSKA 5B66U 3BBFA 1UMJA 3MM5A 4NLDA 1A6LA 2HRYA 4U67L 8ICSA 1RHQB 4PG6A 1WG4A 3IWXA 2H54B 3NS5A 4NASA 4RUAA 2AYBA 1VSEA 4LC9B 2GVDA 3SEIA 2UU9K 5E84A 3UKRA 3VVUA 2P9KB 2AIRB 5SUHA 5CHIA 1LK5A 2AEFA 1E3MA 4TUPA 4YHHF 3N28A 3B8AX 5CZ2A 1LV5A 3VR1A 2IMOA 2IVYA 3NCIA 2G8KA 5G5GA 1ZAWA 5IXUA 2CQ2A 4B3RJ 3VEOA 2C3MA 4ITSA 1U09A 2DGVA 1T05B 4YD1A 4NLCA 3OYGA 4DR2K 4U67Q 4H4KA 1HKGA 8ICHA 2O66A 3NVZA 1Q3UA 1F44A 3Q8KA 3EWGA 3BQ7A 4FPAA 1XQIA 4OZ1A 3ZT4A 2HEKA 2IHR1 3AVNA 4X65J 4KH0B 1SC3B 3DXKA 2Q79A 4ZPWR 3TAQA 3GYXB 2E29A 1S97A 1TK0A 2XSJA 3OSNA 3S1TA 2NV3A 3CM5A 4YXMA 2BRLA 3P39A 3UQ0A 1S1XA 4NJ8A 4DR7F 3TU5A 4Y1CA 9ICAA 4C7QA 1VSDA 2IDOA 2X1BA 1GLFO 1DK2A 3CFPA 1HEKA 1KBUA 4IQMA 2F8EX 1NGIA 1NRKA 1X2IA 1BY9A 3ETOA 3OUYA 3LVVA 3HKZD 3G10A 4BX9C 1NZBA 4M9HA 3BS5A 2L9DA 4I2PB 5BR9A 3SUPA 3GYGA 2NRWA 3DLGA 2DGXA 2ZH4A 3BSNA 2K8GA 3I4HX 2QV6A 3MMBB 2LU1A 1JMTA 3OYBA 3O3GA 2CUYA 5EN1A 2WVEA 2RAQA 1HR0J 4YMEA 2LU2A 3THTA 4JYAJ 3CJ9A 4KSEB 4ZVGA 4OYWA 2L5YA 3ISBA 3QIPA 3QGHA 2BJDA 2JNJA 4AHCA 1U0HA 3M6ZA 2HB5A 3MPVA 2CPHA 4C8ZA 2NO5A 4KHYA 4PR6A 3AXKA 3QO9B 3MX5A 3NASA 4ID8A 1VQON 2MY7A 4JI3F 4DR4F 2EFVA 3OVAA 3CD0A 1O5JA 3PO5A 5D3GB 5KG2A 4ISFA 4NLPA 4ER8A 3AA8A 4LF6F 3TADC 5F8JA 2GGPA 4HKQA 1UW4A 4WTYA 2HHUA 3CCJN 2JWNA 2FDRA 4EAHD 2CADA 1VAZA 2KHCA 2UUWA 3C8YA 1LW2B 1DARA 4HACA 5IOLA 1WDTA 3ZX2A 4KC5A 2GJFA 4JS4A 2E5LK 3SBTA 1NMNA 1XO0A 2EFQA 4P0PB 4NLYA 3CO0P 4O4GB 2QM1A 3IS9A 4JKBA 2Q97A 4OI2A 3NRBA 5KFSA 3KG0A 4M45A 1K9MO 1UTAA 4QZIA 4W4MA 4A5AA 1KFSA 1JLBA 1XR6A 4KLLA 4BRAA 2W11A 3CC4S 1K8KA 3I9ZA 1V9PA 3OTQA 1SIZA 4FJJA 1FFWB 3ETMA 3GILA 1KC8T 1QQNA 2IFXA 2V68A 2PFFB 5JICA 3DRXA 3CHWA 3N4PA 1RBOB 4NLOA 5ETRA 1YJRA 4JP8A 3OR1A 3S6EA 2MU2A 1ZBUA 4ZIVA 5G4DA 2WVFA 2YWKA 2UXCK 2F8LA 3GIMA 3C7NA 1JMSA 2KKHA 4JN4A 2ZOGA 1EXQA 1CULB 3MCMA 4F4XA 3TA2A 1FEZA 2VKZG 1NWKA 2PT0A 4DG1A 1VSIA 4Z4CA 1KRPA 2V50A 2CZ4A 3V9XA 4EUVA 2J0WA 4UZCA 2BE9B 5CYQA 4OV6A 2UU9F 2DTUA 5CD4H 5C0YA 3OGUA 4E7LA 1Z26A 2DEJA 2KQ2A 4PUOB 1C1AA 4BJQA 4US8A 2Z56B 4B9TA 1GH8A 4ACOA 3CJ1A 2BPGA 3TAEA 4M6WA 2CPXA 4KMOB 2RHSB 3CJ4A 3CDWA 2J8SA 3P45B 2HI0A 3E9LA 2VL1A 2OLWA 2E5IA 2DTJA 4PXEA 4PKDB 4DSIA 2OI2A 2KK0A 2BEFA 2D6FC 3HI9A 4CZFA 4DR2F 2BUPA 3VZIA 1J5OA 3EO3A 4DU1A 3MPWA 2HIQA 5KFKA 4KFBA 2ZHAA 1WCNA 1R0AB 1F9EB 2A6AA 4XA5A 3JYTB 2DEIA 2QA4N 1YK9A 4OI3A 4PHAA 3G8QA 4I6WA 3TTDA 4O0NA 1WF1A 4TLQA 2OWOA 4M3ZA 4M7XA 3HHLC 2DNNA 3I33A 2N7YA 8ICUA 3L2QA 3CO9A 3MAAB 2ETJA 3V7KA 1YBTA 2MQOA 2E4LA 2XNRA 1HIYA 2IA0A 3CJ0A 1SUQA 3A0HU 1YWXA 1XNQJ 2Z2YB 4UBCA 2HNYB 5ALIA 1ZBSA 2ITGA 4NYZA 2CJKA 1U0SA 4USUA 1XHZA 1X5PA 3PEHA 4OL8A 3KK2A 4H0VB 4DLEA 1DTQB 3UMGA 4YCXA 1GXTA 2H3FA 3QEWA 2QLXA 1S12A 3OFHA 2I6WA 4PWDA 2LBOA 4Y2YA 3CYMA 2CZVC 4ED1A 1FXDA 4PG4A 4ILLA 1J54A 5ADXH 1ZC6A 5LMUK 1HNWK 2N4DA 4CGDA 2FVRA 1H72C 4E8UA 4AFFA 2UZAA 3D9BA 1S5LU 2HNDB 3QRRA 2YTUA 2DR6A 3ZDBA 2AJ4A 1FDNA 2XY7A 3NRWA 1X5SA 3PFOA 3NVWA 3QWUA 4PHTX 2AYEA 5F8HA 2OA8A 1OS5A 1OH8A 3QBCA 4KR0B 3ZZ0A 1RABB 3CQYA 4OQJA 1G15A 2FDNA 4GVLA 1U1OA 1PVQA 4DV5J 2IJRA 4DEZA 3W64A 5AK5A 1BUPA 3C6UA 1Z1VA 4F5NA 5J0RA 3NS6A 2F76X 3EDRB 1U6ZA 5AR0A 1IV0A 4XPCA 3KHYA 2BQUA 1C7YA 2F40A 4ZLNA 1D8YA 1OQ3A 4OZ5A 4W5OA 5M2UA 2RLTA 3U02A 3MMCB 1TFYA 3MXIA 5HAOA 3ORYA 3R7SB 2E5LF 4OJOA 3OHRA 2OTJN 1EZZB 4GV6A 3AQFA 2XGPA 5KT7A 3B78A 3W3SA 5KFBA 3LOUA 2VFSA 1AT1B 4CJFA 4K42A 2M8DB 3IXQA 3DWLA 4MAKA 4JV5J 4FZZA 1KVCA 1BPBA 3DRPB 5ALEA 1VC6A 4IL6U 1AZSA 4CGFA 2HNZB 5LXRA 3KZXA 3VQEA 3MMJA 1JLGB 1G7CB 2BBEA 2BCQA 2EBGA 3AA9A 2ZJ5A 4CYUB 2NXEA 5G5HA 5CR4A 1CS4A 2UXDK 4JI5K 3CDUA 3SV3A 2CGKA 1EAYC 3GG4A 4CZLA 4I69A 2VA8A 3R8EA 2ZBRA 3F2KA 3NCPA 1MROB 3MEEB 3IN5A 3OV7A 2XMAA 4M63C 3M32A 3ZDDA 2WW8A 4BDZA 2KJVA 2UXCF 4A8XA 3CCUS 3L9ZA 2G0JA 2MLYA 1U24A 3GIRA 2LYBA 5AFUA 1RYRA 1PJ7A 3UFCX 3W1YC 1UJ5A 1K8AT 4BR2A 3KKFA 5C25A 4LT6A 2I38A 3GSIA 1WBBA 1Q0NA 3DHWC 5CRXA 1RT2A 5ALSA 3MBYA 3QU4A 4B3TJ 4J2EA 4YORA 4RTFD 1LAVA 1UWAA 4DV6K 4BRPA 4WFBL 5KFHA 3VVTA 3W61A 4CO5A 2HZAA 3CCEN 2HOFA 3K5NA 2XMVA 1QQ7A 2H3ZA 5EE1A 3W8PA 1CJVA 1OY8A 2FTRA 1RLDA 2E2OA 3RYLA 1XC3A 1TQLA 4A5BA 2GZOA 2W9BA 1PC5A 1Q7YT 4AILC 5HJYA 4HI1A 1KN5A 3M30B 5THWA 2N82B 3FZKA 1VQ7S 1ESVA 1FRIA 2MEWA 1T05A 2UXBJ 4PKGA 2B51A