1XWLA

Bacillus stearothermophilus (newly identified strain as yet unnamed) dna polymerase fragment
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Crystal structure of a thermostable Bacillus DNA polymerase I large fragment at 2.1 A resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Dna replication
total genus 206
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1xwlA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1xwlA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xwlA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xwlA01
2GBZA 2G8IA 4FLYA 9ICJA 4MEXA 4MFFA 1LWFA 1NKBA 2BCUA 4DWIA 1RBRA 2DFHA 4F4WA 3QEIA 3OS2A 1VSLA 3OYMA 3KHLA 1BIZA 4R8UB 5KRTA 2ETJA 1A77A 4O5BA 4FM0A 2ZUDA 3OY9A 2JZBA 3P83D 2I9GA 4OVLA 3NH0A 5HHIA 2QXFA 2ALZA 1DOQA 3K5LA 4JS4A 2FLNA 1A5XA 4ICLA 3H40A 2NRXA 1N5YA 3G10A 3TFRA 4J2DA 4E1NA 2J6UA 1TKZA 4FLTA 2ASLA 1BQNA 3RTVA 4J9QA 4FZXC 2HNYA 5J29A 4ZH4A 2J6SA 4KAZA 2NRVA 1TV6A 1BPEA 2UVRA 1Q9YA 4O55A 3V81A 2BR0A 1TAUA 4QZ8A 1JLEA 3TQ1A 1RDAA 1S1WA 3KKSA 5J0PA 4ED6A 4I2HA 1WSFA 1C6VA 4DF4A 4BXOA 1RBUA 3PMNA 3PO5A 3ZSWA 2KFNA 3RMCA 5KFYA 1SKSA 4RPXA 1HJRA 4J9NA 5HNKA 5DQIA 3C1YA 5D4BA 1NJWA 2P66A 3JPTA 1SKRA 1LAWA 4GC6A 1J9AA 3Q8KA 1ZBHA 5DBAA 1ZQEA 3AVLA 3GIJA 4Z4GA 5L1KA 3GFKB 3FDSA 4YXJA 1BVSA 1WSGA 1BPDA 4DTUA 2AU0A 1L3SA 2E6LA 5DK5A 1XC9A 4J9PA 4Z4FA 4CHNA 1S1TA 5KG2A 2P1JA 4EBDA 7ICPA 2FBYA 3AVAA 3I8DA 1BPYA 4RPZA 4ECXA 1LW0A 1TKDA 9ICTA 4UBCA 4PUOA 4O0IA 3NTUA 3QZ7A 3RBDA 3BGRA 4DL5A 4NCBA 3ZT2A 3CM5A 4F2RA 1S1VA 3SUQA 4YMOA 2ZTCA 1S76D 4CHQA 4NCAA 4UB4A 5KFXA 1ZQHA 1XHZA 1B43A 2JEJA 4DO9A 4CERA 1COOA 3SPZA 3T3FA 1KVAA 2XY6A 1B22A 1S1UA 1VSJA 3PY8A 5HP1A 3LP0A 3VQ6A 4TUSA 1TFRA 1N56A 1YTAA 1I39A 1RDDA 3ASMA 1RTIA 1ZBLA 2VG6A 5KTQA 5JS2A 9ICAA 2XHBA 3TAEA 2BHNA 4M9GA 4KLJA 3M9OB 5C5JA 1JLCA 3VQPA 9ICEA 3HSTB 5KFBA 4QCLA 1NJZA 3O3FA 5KG1A 2ASDA 3ISCA 1BHLA 4Z6EA 2VG7A 4B08A 1ZQVA 1TKXA 2W9AA 4UBBA 4DQIA 2OPPA 3DOKA 4CGHA 3DYAA 3VQ8A 3ZD9A 4DS5A 4B9MA 3UXOA 3H8SA 3C2LA 4DOCA 2G8HA 3DI6A 5J2QA 2BPCA 3V6DA 4KO0A 2RN2A 3OSPA 3V7LA 4R8UA 3V9SA 8ICAA 2QKBA 4QZEA 4EBCA 4MFBA 4J9LA 4E19A 3RAXA 3QINA 4M45A 3AO5A 3L2QA 3DOLA 1U9LA 3AVCA 4F4XA 4UAZA 3PW0A 4IQWA 4Q44A 3PV8A 4ZTJA 4BDZA 2R7YA 4O3OA 4PHAA 4ELVA 4EYIB 3O3HA 1RDBA 2ZUCA 2F1HA 2KTQA 5IIMA 2HHTA 3VQAA 3C5GA 7ICJA 5HBMA 3ZT0A 3ZT1A 3ZSVA 3SZ2A 3MAQA 4ECTA 2I5JA 4NY8A 4H8KA 9ICPA 2PY5A 1WAFA 4HUFA 9ICCA 4DTMA 3RH6A 1RYRA 4FK2A 3E01A 1T7PA 2YNGA 3RJGA 1TKTA 4TUPA 1QSLA 4OJRA 5HLFA 7ICOA 5IIKA 1SUQA 1TK8A 3SJJA 4EEYA 2V4RA 4ED3A 2Z1HA 2C2DA 5KFRA 4QZGA 1NK4A 3HXMA 5CA7A 5BPCA 7ICSA 3LANA 3HPGA 3MGIA 3RWUA 4EBEA 1JL1A 3L2RA 5DB7A 1X9WA 2DTUA 1NOZA 4MFCA 5DB6A 3HPOA 1GOAA 4I27A 5KFKA 4KHYA 4M0AA 4DS4A 3KD1E 1Z26A 3KIOA 4KHUA 2JLEA 5J2FA 3JYTA 4YXMA 5KT6A 1RILA 4Q0BA 5KFUA 3CM6A 2FPKA 4J9SA 4QOZB 2VWKA 4CESA 4DSKA 4I29A 1O1WA 4FLXA 1WCNA 4DTRA 3S3NA 3ZCMA 1QTMA 4F5OA 1ZQNA 4FO6A 3SI6A 4J9RA 1KFSA 1RT6A 2AGOA 2B6AA 4MQ3A 4N56A 2DPIA 5CZ1A 5JS1A 5DQGA 3RJJA 4K4IA 3QZ8A 4ZTFA 3BQTA 2Z1IA 4LD0A 4W5OA 3ZSYA 3PR5B 8ICQA 1QS4A 3AVKA 2PXIA 3ISDA 1JXEA 2IHNA 5KFVA 4Z6CA 2FBXA 2P5GA 5TZVA 4LY7A 2FPLA 1B9DA 5KGWA 2XC9A 4FS1A 3E2EA 4DFMA 3HT3A 1VRUA 3VN5A 2BPGA 8ICWA 3S3OA 4H4OA 3QEBZ 1BQMA 1S9GA 3C6TA 2OZMA 4E3SA 4O44A 2X6SA 1ZQKA 1REVA 5KG6A 3ZD8A 4CFAA 4IBNA 5J2GA 1ITGA 3KLIA 5DGBA 4E7KA 4NLNA 2O4GA 5J0RA 2WTFA 5J0YA 3KK2A 4IRKA 4IQVA 3PX6A 2AGQA 1RT3A 1BPZA 3K2PA 3QIPA 4F5PA 2Y1IA 1ASUA 4RUAA 3WNHA 4CK3A 4DSEA 1NK5A 4F4ZA 3MR2A 1T05A 4K8XA 2HVHA 3PX4A 1FKOA 2ZD1A 4KLGA 2B5JA 1RTHA 4QWBA 4AHUA 4KLSA 4FZYA 3PO4A 5KI6A 5CY4A 4FJIA 4O0JA 2BE2A 4TUQA 4Q43A 3LP2A 1IKYA 3SV3A 4KLDA 2BGGA 4CECA 3HPHA 1EETA 7ICEA 1D5AA 1J5OA 3LDSA 4BACA 2G8WA 3DRRA 1VSFA 4ECQA 3V1RA 7ICRA 1C1AA 4CF8A 4FJ7A 4AHSA 1ZQXA 3JPRA 3RRGA 4FK0A 3L2WA 4DL3A 5J0XA 3RH4A 1ZQJA 2W8KA 1JLBA 4DFPA 5J0UA 4N5SA 2BPFA 4FJKA 3OSNA 3H7IA 3OYAA 3K75D 2OWOA 5J2CA 2XY7A 8ICIA 4HUGA 4F4YA 3I0SA 3MDCA 5KT2A 3HP9A 4CGFA 2NRTA 9ICHA 1BIUA 5FDLA 3NGZA 3K57A 1Z25A 1S0VA 3AO2A 4FJNA 4HCBA 3L2UA 4PWDA 4NXZA 7ICKA 2M9NA 4ID5A 4DTNA 4GW6A 4G1QA 4FXDA 4CJ3A 1S0MA 3QE9Y 4IRDA 4I2QA 1QSYA 1SL0A 1I3AA 3GIKA 4ECYA 2VA8A 2FBTA 5DB9A 1S1XA 4I2PA 1BL3A 5KT5A 1WSJA 2RF2A 4M3WA 4ED0A 1NJXA 3K59A 3NGYA 4O3QA 2HHWA 1JLFA 4FLZA 2OPSA 1S6QA 1HUOA 1T3NA 3V9ZA 2KW4A 4FK4A 1JIHA 3RJKA 3Q8SB 1D9DA 4ED8A 1HNVA 2IMWP 2H5XA 3VQ5A 1BPXA 1EXQA 8ICFA 1ZQUA 4NLGA 5T7BA 4XIUA 1HMVA 1MU2A 3LZJA 3QETA 2I1QA 8ICGA 4BDYA 4B9VA 1NK6A 4DL2A 4CJWA 4DOBA 4RW7A 4Y1CA 5J2PA 4QZFA 4PGYA 5KFZA 3G0ZA 4B9LA 4M3ZA 1XHXA 4GXKA 5BOLA 1TL1A 4Z4HA 2HHSA 2HHVA 1U04A 4NM1A 4ECSA 1UT5A 2WOMA 4KB0A 4NLZA 2G8UA 2G8FA 3CQ8A 3KD5E 3OYKA 1KVCA 4HVJA 4E1MA 1SKWA 3B0XA 4EZ6A 4M2YA 3LDAA 3T5JA 8ICOA 3AO1A 1D9FA 1NK8A 1Q8IA 1TV9A 4RQ7A 1MQ3A 3HK2A 3EPIA 1S9EA 2D0BA 3MGHA 5FRNA 2DFLA 4IG0A 1JN3A 4O3SA 1K1SA 3B6OA 3KK3A 7ICVA 8ICVA 2QKKA 4HUEA 4FM2A 9ICVA 1G15A 1WSIA 1ZBFA 3SUOA 3GDXA 8ICMA 3VQ7A 4Q8EA 3T5KA 4JLHA 3T5HA 3DMJA 1VSIA 8ICPA 2IGIA 1LWCA 4KHNA 3MEDA 4I7FA 1PZNA 2IOCA 4R65A 4C8NA 3PVXA 1W9HA 4KLIA 4CEFA 4KN4A 4H4MA 3FYHA 1RBTA 8ICSA 4W5NA 4HYKA 9ICLA 4DTJA 2FMQA 3M8RA 2XCPA 2PI5A 4FLWA 1KLMA 5EWGA 3RR8A 1ZQDA 4E0DA 1EP4A 4I2FA 2G8KA 5J2NA 4TQRA 2FBVA 1S0NA 4DSJA 2W9BB 4FJ5A 3MR6A 4PHPA 5KFCA 3ZT3A 4IKFA 4TSXA 3C94A 4C8MA 4XUSA 2UVWA 1C0TA 4EYHB 4RW9A 1ZQQA 3OHBA 3SCXA 4KFBA 4OPJA 5J2BA 4Y1DA 4CJ4A 4FVMA 5C24A 3U3YA 1DLOA 1C1BA 1Z00B 1SL2A 3ZSXA 1HPZA 3QNNA 4FJLA 5CYQA 2Y1JA 3H4BA 3S9HA 2D0AA 2O4IA 1KRPA 4CF2A 3NCIA 4LZGA 1WNSA 2IS3A 3V6KA 1IM4A 1FKPA 3KKRA 3EWAA 5DGAA 3L3VA 4FZZA 1JLGA 3L8BA 2LSNA 2HHQA 3NE6A 4E7IA 4KPYA 4CIFA 3V72A 5DBCA 3OYCA 4RT3A 3V6JA 3A2FA 3QEVA 1QE1A 1JX4A 2W9MA 3L3UA 8ICNA 8ICJA 4RU9A 1GOCA 3LAKA 4KI6A 3NBPA 4PHEA 5KFSA 4KV8A 1S10A 2YNHA 4JWNA 3DRSA 4KB1A 4N41A 1VSEA 3ZDDA 2AJQA 1DTTA 1J53A 1TK5A 1Y88A 3M9NB 5J1EA 2PFQA 4RQ8A 4FJMA 4LH4A 3OVNA 2R8GA 3LP3A 4LSNA 4M3RA 2PI4A 8ICRA 9ICSA 3BQ2A 4KLUA 1S6PA 1ZQOA 2A1SA 3K5NA 1BPBA 8ICYA 1U4BA 3V9UA 4N76A 1ASVA 1TVRA 3VA0A 4M9LA 5J2JA 3ZSQA 1U45A 3HO1A 2ZTEA 2HNZA 1RNHA 4PGQA 4FS2A 3AVBA 4CGIA 4F2SA 1LW2A 3EZ5A 5DB8A 3RJEA 1YT3A 3NH1A 3IG1A 2B21A 3Q8MA 1H38A 5I3UA 3LK9A 1X9MA 3LPTA 4DSFA 1U48A 3OYLA 2JEFA 7ICUA 3PW5A 4J9MA 7ICIA 3QIOA 5SZTA 3HJFA 4CEEA 1IKVA 3JSMA 4ID1A 1SV5A 4CJLA 2F1JA 2R8HA 2ZJ5A 2HMIA 4J9KA 4FM1A 3NF8A 4XA5A 7ICTA 1BCOA 4F5NA 1UOCA 3AVMA 9ICIA 4DU3A 4CJQA 3RBEA 2DPJA 4CCHA 7ICFA 3T5LA 5CB1A 1XSLA 3HX0A 3M8SA 2PFPA 1WAJA 4LH5A 2XY8A 3HP6A 1GOBA 3DLRA 1ZQIA 5J0TA 1QHTA 1CXUA 2PFNA 5HMMA 4LSLA 3OYFA 3EPGA 4C8LA 4ED7A 2W9BA 1RCHA 4RQ0A 4P4OA 1BCMA 4M3UA 5KG5A 3AA3A 4KTZA 2R8JA 4CIGA 5C25A 4M42A 4CFDA 1S5JA 5HRPA 4KLFA 2KZMA 1ZQZA 4O4GA 3RB6A 2FLLA 2Z1JA 3P1GA 1ZQYA 4RQ6A 5L1LA 4O5KA 4DLGA 2KQ2A 3BQ0A 4UAYA 7ICHA 1Z00A 4B9NA 1RT7A 4UB1A 5J0QA 1NOYA 3KHHA 5KFAA 4J2EA 4I9LA 3OYBA 4KREA 1B9FA 3T1AA 4P4PA 5FRMA 1N48A 1CXQA 3ZT4A 4CHZA 1KSPA 3ORYA 5C42A 4DSLA 4DQRA 2ZE2A 3Q8RB 5KFFA 3NAEA 4DU1A 3QERA 2ITGA 1C1CA 2ZJ8A 2BCRA 4RPYA 4NM2A 5KFWA 4RW8A 4F3TA 9ICUA 1LV5A 4KLLA 2BQUA 1NK9A 1JMSA 1S77D 3OYIA 2PYLA 4OGEA 4PPXA 2D5RA 1UA0A 4FW2A 1KVBA 3SQ2A 3GV8B 5KFDA 4I2EA 4LVSA 2ISPA 3IRXA 3PUFA 3OYEA 3OYHA 3WNGA 3MFHA 3OYJA 3QEXA 4KLTA 3OYGA 2HHXA 4DSIA 2KZZA 3SUPA 1X2IA 2NRWA 4GMJB 4W5RA 3PW2A 9ICNA 4HCCA 4R66A 5KFHA 1ZQGA 4YG2A 1DGSA 4B9TA 1FK9A 5EOZA 4OPKA 3TFSA 4FYDA 4CHPA 5KFLA 1S9FA 1KDHA 4RNMA 1RT4A 3AA5X 1JKHA 4R63A 3JPOA 4JUZA 2X78A 3PX0A 3RH5A 2VANA 3UXPA 4KLOA 4KI4A 4NLKA 4M6WB 4DTOA 1KFDA 3D0PA 5DDYA 3MABA 1WCLA 4JV0A 3HM9A 3SQ0A 1JL2A 3IM1A 2Z1GA 3FFIA 3NHGA 4YP3A 3ZSOA 2V4QA 3DLBA 7ICMA 2NUBA 4AHRA 1JLQA 3C95A 4KTQA 2MUTB 4C8OA 1HYZA 1NOMA 4ECRA 4P4MA 3TI0A 3O4QA 2YHAA 8ICEA 2UVUA 4Z0UA 2HNDA 3THVA 4QZHA 2F1IA 3MBYA 2HB5A 2XGQA 3PMLA 4Z4IA 3AVJA 1D8YA 4QZ9A 5L9XA 1S97A 3GQCA 2BDPA 4YR3A 2P6RA 1RT1A 4KLEA 1XU4A 3RJIA 5J2DA 1XS9D 1W0HA 1XWLA 3JPQA 3TAMA 2GUIA 4DFJA 3VQBA 3ZSZA 4IFVA 4CHYA 1X9SA 3EY1A 3RJFA 2AQ0A 4CJVA 4UB2A 3NH2A 4CHOA 1BI4B 4IR1A 4OKJA 5KT3A 3UPQA 4QWAA 4NCGA 4QAGA 4W5TA 5HHHA 1JXLA 2DFEA 4CJFA 1A5WA 5KT7A 2IC3A 1D8LA 3MXJA 3ZDAA 4CK2A 4KKOA 4AHVA 4FW1A 1QLNA 1EKEA 1ZQCA 4F93B 4YFKA 1ZQMA 2PFOA 3OGUA 5DKWA 1RBSA 3N97B 2X6NA 2AQ4A 2FLPA 4NYFA 4RQ4A 4CGGA 1IH7A 4M9HA 4F5RA 3WNFA 8ICLA 5KFEA 2B4JA 3AA4A 1BISA 5L1JA 2IBKA 4F50A 4O3NA 3D45A 4FLUA 3V9XA 1WSEA 2YNFA 4Z6FA 3AVHA 2A1RA 4JK1A 9ICKA 2BQRA 2GV9A 4CEDA 4I2JA 2FPMA 4OKKA 1UT8A 4YD1A 5KFOA 3MR5A 3F9KA 4YQWA 4ECWA 3VQ9A 1B92A 4KRFA 3QO9A 1IG9A 4QZDA 3SQ4A 1KTQA 4DF8A 3LAMA 1J54A 2XO7A 4M3XA 4F5QA 9ICQA 3NF6A 1DTQA 4I2CA 4GC7A 4B8AB 1UWBA 3AU6A 4DL6A 4PQUA 1RPLA 4BWJA 1C7YA 3M9MB 4F4KA 2IDOA 3AO4A 1BGXT 1IO2A 1NK7A 4CJUA 4J2BA 3SPYA 5L1IA 2C22A 3RB0A 4CJ5A 1IKXA 3SUNA 2C2EA 3TANA 4KLQA 1JLAA 1XSPA 4O3RA 4GVMA 2BQ3A 4M6WA 4CE9A 2EX3A 4R5PA 1C0MA 4RQ1A 2ZJAA 3ETLA 4EZ9A 3NDKA 4F3OA 4QWCA 4BWMA 4FJHA 4EP5A 4RNOA 4DOAA 3CFPA 5SWMA 4QWEA 4JRPA 4FBUA 1VSDA 4AHTA 9ICOA 5BOMA 1ZQWA 2XGPA 3O3GA 2KN7A 2J6TA 3PNCA 4FJJA 4GXJA 5J0WA 2MUTA 3ZSRA 1S0OA 1XSNA 4YMNA 3MXMA 2YHBA 4DL4A 3G6YA 1A5VA 3LZIA 4B9SA 4CJEA 1XO1A 4B8CA 2HW3A 8ICBA 1X1PA 2P51A 3LPUA 4XRHA 4CGJA 4OGCA 4E7LA 3V9WA 4OKEA 1WSHA 8ICKA 1UA1A 3KTQA 1U49A 1QQCA 1VSHA 2AGPA 4RNNA 1CLQA 4J2AA 5EWEA 1BI4A 4CEOA 5DQHA 4DQPA 3V1QA 4PA1A 5D3GA 1NJYA 4DQQA 3P5JA 1NKCA 1CZBA 3ZDBA 4DMNA 4DLEA 4KHWA 9ICBA 5J0OA 1N6QA 3AVNA 5KRSA 4KTWA 4M3YA 4BE0A 4IQTA 1RT2A 2F96A 4K4GA 3AO3A 2Q3SA 3Q8PB 2ZUBA 1IKWA 3V1OA 4E7JA 1HQEA 2IAJA 4BE2A 2W9CB 4W5QA 1WLJA 4AILC 4NYNA 3AU2A 1ZBUA 3ULDA 5E41A 5DLFA 1RBVA 4EP4A 4YN4A 4Z4EA 4RZRA 2XRIA 4TQSA 4IDKA 1EXNA 2F8SA 1TGOA 4UB3A 5KG3A 4MF8A 3KHGA 1HRHA 4ZHRA 3QLHA 1HUZA 4JRQA 4ED2A 1L3VA 3RJHA 4DFKA 3OJUA 3SV4A 3OYNA 4LZDA 3OJSA 4DL7A 2OA8A 5IIIA 1R0AA 4QW8A 1HQUA 4L8RB 3ZDEA 4JWMA 4DTXA 1ZQLA 3DM2A 2BCQA 1RTDA 4FJ9A 4QZIA 4KHQA 4KLHA 9ICWA 1MC8A 5I42A 4BGDA 5D49A 3TAGA 3HWTA 3ALYA 4DEZA 4BE1A 2R8KA 1ZETA 1T8EA 2YKMA 3TABA 4CIEA 5J2EA 3B6PA 4M3TA 4CGDA 4QZBA 4UQGA 1K1QA 2WONA 3M8PA 4KMUA 4ECZA 4I2IA 1TAQA 4MF2A 2RDIA 3T19A 1VRTA 3CYMA 4OLAA 4I2GA 2PZSA 4FJXA 2OZSA 1K6YA 4N47A 3RMAA 3SYZA 3GIMA 3V6HA 4HHTA 5DG8A 3ZDCA 4IR9A 1MQ2A 5IILA 3C21A 3H4DA 3Q8QB 4F8RA 4RW4A 4F92B 3RMDA 3KLFA 2P5OA 3AVFA 5DG7A 4M04A 2KZ3A 1RTJA 3DLHA 2ISOA 5DBBA 3NF7A 3C6UA 3LWMA 3TARA 4Q45A 1ZQTA 5IIOA 4J9OA 4I9QA 1CZ9A 2E6MA 2C2RA 8ICCA 3C5FA 3PR4A 3TAQA 1EX4A 1MSWD 4KITB 5F9LA 2HVIA 3RB4A 2A1JB 3DLKA 2E4LA 4QWDA 3WNEA 4QZCA 5DG9A 1ZYQA 3MFIA 3QEPA 1YTUA 5DDMA 4AH9A 2C28A 4E7HA 1ASWA 3NGDA 1VSKA 1IXRA 4M47A 4RT2A 5KG0A 4F91B 5CHGA 4PH5A 2FMPA 3TAFA 4CJKA 3U6FA 1NK0A 4IQUA 3PW7A 3B0YA 3ISBA 9ICRA 3GIIA 2W9CA 4RQ3A 4CEBA 5HROA 3RB3A 1JXBA 4I2DA 2JGUA 3RR7A 4B3OA 4IRCA 5K14A 3MXIA 3UIQA 2LYHA 4ELUA 5DMRA 2BKEA 5HRSA 2KFZA 3VQDA 3KJVA 4Z6DA 3HYFA 3I0RA 1A76A 2YKNA 2GWSA 4PHDA 3C2KA 4FBTA 4RG8A 3OHAA 3UXNA 1ZJMA 2DFFA 4CFBA 4BDPA 3JPPA 3LALA 4Z4CA 8ICZA 3RMBA 3SNNA 4JV1A 4FLVA 3MDAA 3O4NA 4CEAA 8ICUA 2P6UA 1V9PA 2ASJA 3MECA 4HTUA 4I28A 4KHSA 4CEQA 4Q8FA 2X74A 4RW6A 2XCAA 1HYVA 5KGXA 3TWHA 4FJGA 4GLXA 3DLEA 2FMSA 3K5OA 8ICTA 4MEYA 3HVTA 4KLMA 3Q8LA 2ZQBA 2V9WA 3RRHA 3N4MB 8ICXA 4CJSA 5HRNA 1KLNA 4DU4A 4YVZA 3HVRA 2W8LA 1RYSA 2JEIA 3LP1A 5KFIA 3L2VA 5HP4A 1ZQAA 3OYDA 3NF9A 3QNOA 3ISNC 4YD2A 4YR2A 1WN7A 1HJPA 3H08A 7ICNA 1U47A 3VA3A 3M8QA 5KFNA 1LB2B 1RT5A 9ICGA 4M9NA 3G6VA 5KFQA 2R8IA 2BCSA 5KFTA 2ATLA 3K4GA 7ICGA 2YV0X 1ZJNA 3BDPA 4CF1A 5J0SA 5KG4A 4YR0A 4CFCA 1YVUA 4KN7A 4CJPA 4RQ2A 4OLBA 4UAWA 2VA2A 4XQ8A 2VG5A 5KFPA 2XY5A 7ICLA 4UB5A 3G6XA 1FXXA 4DTPA 4YCXA 1HNIA 2ZTDA 5FROA 3QEWA 3RAQA 2RKIA 3GV7B 1Z3EB 3V7JA 4O5EA 5D46A 1L3UA 1RDCA 3OS1A 5EWFA 3IS9A 4B9UA 3MEGA 3S3MA 3UQ0A 4X5VA 3KLHA 4I2BA 4IFYA 4ECVA 2VWJA 4JS5A 1L5UA 3KLGA 3QEAZ 3CFOA 8ICHA 3KK1A 4O3PA 1F21A 2A1JA 2OPQA 5F9NA 4RQ5A 5J2IA 1VK0A 5HMLA 4FJ8A 3MEEA 2YNIA 3SQ1A 1CEZA 1C0UA 3TAPA 3OS0A 4DTSA 1RXVA 2JZBB 1SZPA 1ZQPA 5CJ7A 4DG1A 3GILA 3NGIA 5J2MA 3GV5B 4RUCA 4O5CA 4K4HA 4K8ZA 5HRRA 3K5MA 1RXWA 3PW4A 3C2MA 2JEGA 4CJRA 4ED1A 2MAXA 4YNQA 2FC0A 3NFAA 3EYZA 4IG3A 3VQCA 4CF0A 3U3GA 1ZQRA 5CZ2A 3MR3A 3SI8A 1ZQBA 4Q5VA 5JUMA 3BJYA 2BANA 4PGXA 3K58A 1LAVA 4O9MA 4M9JA 3C1ZA 4QW9A 3HW8A 5KG7A 2D0CA 5DLGA 2W42A 4BXOB 4YFUA 3BQ1A 3H8WA 4R64A 2OYQA 1KCFA 4FCYA 3VQ4A 3VQQA 3AV9A 5CR0A 4ECUA 9ICMA 3AVIA 3AVGA 2OPRA 2IA6A 3DRPA 1RZTA 4E89A 3EW9A 4GXIA 1KFTA 3V4IA 2HHUA 4I2AA 9ICFA 1TK0A 1SL1A 2IHMA 4PY5A 5KFJA 2G8VA 1XI1A 1ZQSA 1TL3A 3TR8A 5J2HA 5KFGA 2BCVA 4MFAA 1UAXA 3ITHA 3KLEA 3AA2A 5KFMA 2PYJA 2ATQA 2UVVA 2F8TA 5J2AA 4DQSA 4JV2A 1ZQFA 3IAYA 2BGWA 3JPSA 3C23A 3AUOA 1L3TA 3CFRA 2Q0ZX 4M41A 3F73A 1Y97A 4YMMA 1T4GA 7ICQA 1Q9XA 4C8KA 2DY4A 2RDJA 1QSSA 3IHQB 1LWEA 2NRZA 3H8JA 1NKEA 1AROP 3QESA 3CG7A 3JPNA 5CYMA 2VA3A 1CUKA 5J2KA 3HL8A 1VSMA 5IINA 2EHGA 1TVAA 4P2HA 9ICXA 4WE1A 4CJTA 2QK9A 5IIJA 4CF9A 3LWLA 1HYSA 1KEJA 3VQEA 4ELTA 2RPIA 1T03A 5KT4A 1ZBIA 4CEZA 3V7KA 3UQ2A 5CP2A 5CWRA 4AHCA 4CK1A 3KHRA 5EU7A 4G3IA 4QZAA 3DLGA 4TURA
chains in the Genus database with same CATH superfamily
2OPPB 5T14A 4FLYA 3DOKB 1IBLF 1JJHA 2ZKTA 4MFFA 1DY3A 1NKBA 2HVEA 2NO5A 2NZ4A 1RAHB 1RBRA 2DFHA 2W04A 2KL8A 5J2QB 1FRJA 1YJ9N 3ICXA 2WVBA 2E9ZA 1BIZA 3MM9B 4R8UB 2NSBA 2ETJA 2HQ3A 4H0XB 2F7TA 2I9GA 1GEHA 4DXLA 3HHDA 3DOLB 3MX5A 3J7YU 4C3MA 2NXCA 3G10A 3FZ2A 4ZVTB 2XMVA 1JMTA 4KGZB 3ED5A 1TKZA 4FLTA 2AZ3A 2XLIA 1FT8A 3RTVA 3J80O 4FZXC 2HNYA 2ZWHA 2BX6A 3HI0A 4KAZA 4MDAA 1R0CB 3N01A 3D2WA 1XTZA 1BPEA 4G1IA 2UVRA 3UCZP 1I1GA 3LM2A 2OFGX 4EIAA 3V81A 1RDAA 1S1WA 1O08A 3KKSA 3IR7B 4LFAF 3PMNA 3PO5A 5F8GA 3E01B 4IOAQ 5AK4A 1TKTB 4NZ0A 1HJRA 4RPXA 4WBFA 3HLUA 4DV4F 3SEOA 1YJVA 4JI3F 3TJ8A 2MZQA 3AOCA 4E8UA 3E58A 1LAWA 1F60B 1J9AA 3Q8KA 3QGGA 1ZQEA 1T44A 2O8FA 3IR5B 1SB6A 4Z4GA 1J2MA 1U8WA 3L6QA 3VF4A 3FDSA 4C6AA 1WG1A 1BVSA 1BPDA 2ZIVB 1L3SA 2E6LA 4BRAA 3PKMA 4CZLA 1XC9A 3VEVA 3RG6A 4Z4FA 2HQFA 4EBDA 1XNRJ 2DPNA 3AXMA 3FCVA 1K73T 3MM7A 5AI4A 4RPZA 1DKGD 1LFPA 4Q0BB 2CYYA 9ICTA 4NOHA 2A1AA 1HNXJ 3R7NB 2JXJA 3QX7A 4I64A 4DL5A 1OYEA 2I7NA 1IBMJ 5IWAK 2B7BB 1SGGA 3GFXA 4NEYA 4WXWA 4UB4A 2M0GB 5KFXA 1B43A 2JEJA 2QZ8A 3SPZA 2F76X 1TYQA 2DIUA 5HP1A 4FXWA 1SKUB 4TUSA 2M8DB 1I39A 1RTIA 2K3IA 3VALA 2VG6A 2F7VA 1CQMA 3GU3A 3SQIA 1PJ6A 4BUGA 2YWGA 4M9GA 9ICEA 5F8NA 2QLTA 5A76A 2VFSA 1JQGA 4UBBA 1GFWB 2PMZC 3F44A 2JZ5A 3ZD9A 1WOSA 5D4NA 3C2LA 2RS8A 2RILA 5BYRA 2KM8B 1NMDA 2G8HA 1XNRK 2K3KA 3HVWA 4KO0A 3KK2B 3V6DA 1R27B 3TPQA 1CS4B 3V7LA 1RT3B 2ZM6F 3QIPB 1HNXK 3SSQA 1G3OA 4EBCA 3DOMB 3LA0A 4MFBA 4BRFA 4E19A 4A8OA 2HYIB 3RAXA 3D1QA 3QINA 4JHDA 3ZYYX 2ZD1B 2W1BA 3PW0A 4JMUA 1OUQA 4FYXB 3WK7A 1R6VA 4ZN1A 4USMA 3EVOA 3PRVA 4EYIB 5AJ3J 3NRZA 2GO8A 3O3HA 1RDBA 2ZUCA 1UVLA 1H1VA 2JHEA 1JRPA 1IKYB 3OR1B 3VQAA 3N6MA 5L38A 3ZT0A 3RW7A 1ITPA 1J5OB 4H4KA 3SZ2A 3MAQA 4O3MA 3GSIA 5JICA 4ECTA 3IMXA 1KC8T 4NY8A 3SFUA 5AQYA 1YIJN 4JI2J 4H8KA 2E44A 1KKHA 2P9GA 4HTIA 4FK2A 2CJKA 1JLBB 5HLFA 3SQGA 1CJTA 3JTOA 3P38A 2AKWB 2C2DA 1ZD3A 4W90B 4K59A 5BPCA 1VQPS 3I0SB 3IBPA 2GHPA 5GAHU 1QZ5A 4KYZA 4LREA 5FDLB 1WEZA 1NOZA 3AODA 3NVWA 2WF6A 1K8AT 4M0AA 1Z26A 3PHEA 2ZH7A 3S7RA 4HHJA 3C6AA 5BREA 2NLXA 1J6ZA 3C29A 3C15A 3V2UC 4BC9A 3JYTA 1AFJA 5KT6A 1X4AA 4A8YA 4ZIWA 1RILA 4AT1B 3B9JA 5KFUA 1YVFA 2P2CB 2E5IA 5AJ3K 2FPKA 4I4BA 2KMDA 4CESA 2HOQA 4DSKA 1O1WA 5LJ5Y 1NNEA 1HEKA 1ZQNA 4J9RA 1KFSA 2PGCA 3ZTSA 2VGNA 1L7NA 1U1PA 1ESVA 4ZP8A 3NNCA 4JI2K 2AGOA 2B6AA 4I67A 4HACB 3GWCA 5CZ1A 1V3RA 3UMCA 4K4IA 3PDNA 2ZH5A 1S99A 5D6GA 4ED5A 3M5RA 2DRAA 3J7AN 2Q2RA 3T7ZA 1JXEA 4Z6CA 3N4WA 3VF6A 1QTNB 4LY7A 3MAAA 2P9NA 4RQMA 2ZWPA 2FPLA 3FGVA 4C4RA 1QDUB 5F0WA 2XC9A 3N0VA 1U25A 4DFMA 2YX1A 2GWKA 5J2PB 3QEBZ 2Y9UA 1S9GA 3I28A 3FJ2A 2WFAA 3EGNA 4ZP7A 4MK8A 5LT5A 3ZD8A 2C2ZB 2YY3A 4E7KA 4DCPB 2MB0B 3BZCA 2A3ZA 3BR9A 3W1YC 3K2PA 5LMUF 1EB0A 1P9YA 2LQJA 2B43A 2HF4A 4F4ZA 1UVJA 3MR2A 1T05A 3TVZA 3M6XA 2V34A 2HSEB 3PX4A 4KGVB 2B5JA 1RTHA 2BE7D 4AHUA 1Z4UA 2MA1A 2QSFA 2QM1A 2LDYA 2GTDA 1RTZA 5CY4A 5B09A 2BE2A 4OI4A 4O0JA 1LKYA 4Q43A 3OFFA 4KY3A 3LP2A 4A62A 4JI1F 2RU9A 7ICEA 2GUPA 2Y1LB 3LDSA 1VQ6S 4BACA 2G8WA 2B4PA 1VSFA 3F2CA 1LWCB 3S01A 1SJRA 1XIQA 3VESA 3BSCA 7ICRA 2PA8D 2VQFJ 1HBNB 1NJIT 2ZC3A 2QJ3A 2V5HG 4N8NA 3RH4A 1ZQJA 3VMFB 4W92B 2BPFA 1DQ8A 3H7IA 3QGHA 3THYB 4FFDA 4OI3A 4HUGA 2JNJA 1QAIA 4F4YA 1WUDA 3CCVN 1IV0A 3ZZZA 2UXBK 2NRTA 3UD3P 9ICHA 1KOHA 4BHQA 3K57A 1S0VA 5IS2A 4FJNA 1IXKA 4HCBA 2P9UA 2DH7A 1FO1A 4P2SA 5C24B 1SIJA 7ICKA 2A42A 4DDFA 4ID5A 4G1QA 5AI9A 1DHMA 1Q1KA 4OYOA 5AXNA 2XM3A 2E1FA 1HPZB 4CJ3A 2QFIA 5HO4A 2N7CA 2HF3A 1SL0A 1I3AA 3J7A1 2F8EX 1HBMA 2VA8A 1RJJA 3N7PD 5AZJA 5GIPA 4DPWA 1HBUB 2A5XA 4M3WA 1RQNA 2CQBA 4O3QA 2UU9F 2CQDA 2OPSA 2BW7A 2ZUAA 1HUOA 4WYBA 4FK4A 1JIHA 1JLGB 3OVBA 4P9SA 4RCHA 4JKBA 3H0RB 4HDHA 1HNVA 5ETTA 1EXQA 2GVDB 3G4SS 2R2UA 1ZQUA 1J5EJ 4XIUA 3X3UA 4PXBA 1S79A 4M7YA 3MN9A 1QQ5A 1K8KB 1RAOA 1RBLA 2ZUGA 2NLWA 4RW7A 3DRSB 3W2VB 5BRFA 4PHTX 3HHLC 4M5MA 2VFVA 4QPXA 5MAOA 2FVCA 1KHVA 4ECSA 2WOMA 4TU8A 1VC0A 2NR0A 1KVCA 4IOCL 3B0XA 8ICOA 2UUAF 2MMYA 1D9FA 4ZP6A 1FXRA 1JNZB 4JI6F 4ZVUB 3H59A 1Q79A 3EZWA 3PSFA 5FRNA 2DFLA 1LW2B 3B6OA 3KK3A 7ICVA 3IG1B 1RDWX 8ICVA 2QKKA 3DEEA 3DV9A 5A8WA 5ALTA 2QB0B 1R31A 4XAKA 1G15A 3E51A 2K4EA 5D77A 1UHUA 3FZLA 8ICMA 5T7LB 1FJGK 3T5HA 2GZOA 2J8SA 3JSMB 4DV1J 1N36F 4F9OA 2A3JA 3GPAA 4KHNA 4C8NA 5D0EA 5L46A 2HMIB 2ZH1A 4WZMA 1W9HA 4LFBF 2B3TB 4CEFA 3FYHA 1ZTWA 5DM7Q 4W5NA 3OV7A 4OJOA 2CH5A 1FTCA 1UWAA 2PI5A 2HHHJ 4FLWA 2CWXA 1EP4A 3JSBA 1VQLN 4JI4K 3VEOA 4KH6A 3CJRA 4OHWA 4FJ5A 4FN5A 5FPDA 2Q1LA 2BKPA 2V2QA 5C25B 2EEYA 3KBBA 3C94A 4XUSA 2UVWA 3HX9A 2FHMA 2O8CB 3CJQA 3Q22A 2HGLA 4RW9A 1ZQQA 2KG0A 4BQLA 4JKHA 2FJDB 4DV5F 4BR9A 4CJ4A 3AA8A 3TOQA 3HKZC 1TMMA 4K4WA 1Z00B 1RT7B 2QWOA 3ZSXA 2F44A 2FSKA 2ZNZA 1M5HA 3D68A 2Y1JA 2QARB 1T3VA 2R9LA 1UVIA 1U8SA 1IBLJ 4RL1A 5AHXA 3QPIA 2K2PA 3C16A 2Z2YB 3IGVA 1NGEA 2CQIA 2IS3A 2LXUA 1QVGR 1EKSA 1FKPA 3KKRA 4DV1K 5DGAA 2CGLA 2Z56B 4FZZA 2N1RA 4DV7F 2BA9A 3FBEA 2LSNA 3MDFA 5CE3A 3KZXA 2YKAA 3NE6A 2G0CA 4E7IA 3V72A 3WXMB 3KDNA 3QEVA 4UZCA 1U2RA 2HHHK 4O0NA 2HG4A 3OL8A 1ZZFA 2BM1A 3NGRA 1GOCA 2FY1A 3NBPA 2GX8A 2FGOA 5AICA 4PHEA 4OZNA 2RHSB 3M6VA 5KFSA 3NL0A 2YNHA 1V4TA 4KB1A 4ZK7M 2HK2A 3A8EA 3SCIE 1ZM9A 3NRBA 3M1VA 1FIQA 1AXQA 1J53A 4LF4F 4PXEA 3DN9A 5KOWA 3M9NB 5J1EA 4LFAJ 3L7OA 4LH4A 1N60A 3LP3A 5AQFA 1VQ7N 3AJ2A 1VJQA 4L73A 2ZVIA 5ETKA 1WSRA 3K5NA 1FK9B 2CJBA 1IBLK 4UZBA 4OYWA 1U4BA 3V9UA 1TVRA 2YMPA 2JJ4D 4DV4J 2ZGYA 2L9WA 4CGIA 4F2SA 3O9UA 5AZIB 3CJ3A 4J7CA 2OYYA 2GQQA 3E0FA 3RJEA 4LR7A 3Q8MA 3FEZA 1URNA 4NLRA 1U48A 1U02A 2O66A 3E3XA 3MTJA 7ICUA 3QT5A 3PW5A 1KXPA 4J9MA 8ATCB 3WEEB 4CEEA 4EFHA 1PCAA 3FFIB 4CJLA 2UYTA 1R8BA 3SAFA 4DN0A 3KG4A 7ICTA 2PO4A 3ENAA 5AK6A 3GJRB 1JLQB 4F5NA 2E5JA 4CJQA 3FRZA 2EZZA 5ALDA 4CCHA 3T5LA 1RSCA 4DV2J 1WAJA 4LH5A 3AGRA 4OJLA 4U6PA 2XY8A 3HP6A 3DLRA 2MQ8A 1NZPA 5J0TA 5HMMA 2DGUA 3OYFA 4DQ8A 2UXDF 4LFAK 2RP5A 4L3NA 1BUXA 2R8JA 2H3IA 1H2UX 4CLLA 1VHXA 5ALOA 2OMOA 1RT1B 3LYSA 4KLFA 2KZMA 3ZTQA 4P0QA 1QQ7A 4URGA 3TAMB 3RZAA 1ZQYA 4RQ6A 1M1HA 5L1LA 4DV4K 2I5HA 2B9EA 3GFYA 3D2FB 3BQ0A 4JI3K 4BR0A 5HJYA 1JXVA 4UB1A 1X5SA 3A3NB 2IYIA 4JNEA 2BH1A 2XLKA 4DR4F 1D8ZA 4Q7AA 4MLHA 3M8WA 3O9QA 3CTRA 4NYOA 1B9FA 2F77X 5FRMA 2CQ3A 2AWZA 4F71A 4KKOB 5ALQA 2FC9A 1CXQA 3ZT4A 4CHZA 1KSPA 2MQQA 1WOQA 4ES3A 2NSCA 5KFFA 2ZJPL 1FESA 3NAEA 6FD1A 4DU1A 3AARA 2ZM6J 4MIAA 2QA2A 4RPYA 4F3TA 4RW8A 2W4DA 4KLLA 3ZEUA 1ILYA 2IJFA 2BQUA 1JMSA 3OYIA 5LSRA 1YGYA 5G5GA 1UA0A 3F5AA 2MQNA 3GV8B 3OUYA 3EO3A 4RR5A 5ALZA 3IRXA 2D6FC 3PHTA 1PAEX 4IDHA 1QAXA 4WIIA 3KKFA 3QMLA 4CZHA 3DGVA 2BRKA 4WWSA 3MHYA 3OFHA 4KLTA 1S48A 1X66A 4ACOA 2HHXA 2HWIA 2L3MA 1XMQF 1HBOB 1X2IA 3A0BU 3LF0A 3FR0A 5AI0A 4JKFA 1W2BM 2MEWA 4GMJB 4W5RA 1WG5A 1OY8A 3TUJC 3VAFA 4HCCA 3HCXA 3KNGA 4R66A 5ELZA 4YG2A 1UWBB 1DGSA 1YXQA 4PQUB 4NZ7A 2W55A 4QYRA 3D2SA 2MPUA 5KFLA 3F41A 3AA5X 2XSFA 2LBOA 1JKHA 2W25A 4R63A 2F1FA 4K0KF 1G4CA 4YS2A 3K0SA 1SWWA 3PX0A 4PZOA 3CIPA 1OQ3A 4FPRA 2ZM6K 2PMZF 1SCJB 4QR2A 4C0ZA 4KI4A 4XDDA 4AM7A 1GMWD 4ZLJA 1ATSA 1NGFA 1N32F 3SQ0A 2ZBQA 1IN0A 1JL2A 1WBDA 2Z1GA 5AQKA 3BQ7A 3ZSOA 3L7UA 2QIFA 4HTJA 5DDOC 4IQMA 2DB1A 1FWPA 2Q36A 3C95A 4DX6A 1HYZA 5AQIA 1NOMA 4ER8A 2YHAA 2UVUA 2WVDA 1VQOS 3RFAA 2JHDA 3THVA 1K0VA 2AX1A 5SUHA 1COKA 3R5CA 3B82A 3MBYA 2XGQA 3PMLA 3IAM9 4Z4IA 4BR2A 3R9KA 1S97A 2DR5A 4NPOA 2BDPA 1XS9D 2QFJA 4CDGA 2F9JA 4DFJA 3ZSZA 1LXJA 3FC9A 2COLA 3TA1A 4CHYA 1UCNA 4DJBA 3WIUA 4CJVA 4LF8F 3CXCM 5F3TA 4CHOA 2HFVA 1VFJA 1XMOF 3VHQA 2V8VA 1JUDA 3KD3A 3UPQA 2YQ0A 4NCGA 5HHHA 5D3GB 1XK8A 4OHZA 4CJFA 1JJ4A 2XYGB 3W7BA 4A8XA 2ZH9A 2XEXA 1Y0HA 3IG8A 2WF5A 2H5EA 1KAYA 4A5BA 5BYQA 1EKEA 4H0OA 3SENA 4ILJA 1IKWB 3VZIA 1ZQCA 2RQKA 2ZIWB 1HQEB 5DKWA 1FFUA 3N5BA 2XI9A 1FRIA 4NYFA 3C0BA 4M9HA 1RZMA 4F5RA 1YJWN 3ATUA 1BC6A 4NRUA 3HHKA 1DRZA 2WTUA 4KAIA 1Z05A 3GYXB 3J7Z5 4LRDA 4MK9A 4BX9C 3T9NA 4EGLA 2DTJA 4DZDA 4DHYA 3D45A 2KVQE 2A1RA 4LVOP 4F36A 2ZDPA 2B9XA 5GAGI 4JI0F 4I56A 4I2JA 3QLHB 4YD1A 2HCFA 2D1KA 3F9KA 1WG4A 4JI1J 3R3TA 2QEXS 3A8YA 1IVZA 4ECWA 3R5DA 3QO9A 2QA4G 3VCBA 2QKQA 2ADCA 2X3DA 2R7TA 1WD6A 2LQ8A 2EQYA 3POTA 2G0IA 9ICQA 5J8YA 1YBTA 2CPXA 1JWWA 3E66A 5A0LA 1M1KO 1O03A 3HSDA 1RHMB 4F4KA 4AUKA 1BGXT 1IBCB 3U02A 4J2BA 3IR6B 4JKGA 3RB0A 2DYAA 4CJ5A 2Q79A 4FNIA 1XSPA 3GR1A 4DV6F 2JH3A 5LMUK 3MR7A 4GVMA 1UPPA 1AFIA 1N0VC 3M8PB 4M6WA 4CE9A 4ENOA 2EX3A 4R5PA 5BRHA 1PVRA 1FNOA 4EZ9A 1I5OB 3DGPA 4F3OA 2R7WA 5M2PA 2ZITA 2W2PP 5SWMA 4ES2A 3TTDA 4JRPA 2QLXA 4FBUA 4AHTA 1UZHA 3CJ7A 5GIOA 2YN4A 3GL1A 3CD5A 3VGKA 2KN7A 4ETZA 4FJJA 1VQ5N 2D9OA 5J0WA 2DNNA 3UWTA 4JI1K 1S0OA 3J81j 5IQ6A 2UU9J 3G6YA 1A5VA 1X4GA 5F8MA 1XO1A 1VQ8N 4LC9B 4B8CA 5LJ3Y 8ICBA 1RTJB 2P51A 2BJ1A 4CGJA 1Z1VA 5BPNA 3V9WA 1UEVA 1OYDA 1JK9B 4J5OA 4PJ0U 1U49A 4CTAB 2CJAA 5AQVA 3SAGA 1FE0A 2DNYA 2IVMA 1D0EA 5GADU 2ZXIA 1BI4A 3LL3A 4CEOA 3FEYB 1F0XA 2ZOMA 4L72B 1NJYA 4LUBA 4EEKA 2O8BB 1NDPA 4F4AA 1Z1BA 3AVNA 4LF7F 3G25A 5AKLA 3GU0A 2VKQA 4GVBA 4UW2A 2ZUBA 3W3SA 1YSJA 5GAHP 4LRBA 3MGVA 4CO5A 2BE9B 2X3GA 2IAJA 2W9CB 5B7WA 5BYSA 2CQGA 4PPDA 4GKKF 4W5QA 1WLJA 5HI7A 5HROB 3HF5A 2UUAJ 4NYNA 1ZTTA 2L9DA 4OJHA 1GO3F 4JI6J 4YN4A 1XNQF 1X4BA 3R5GA 3N7RC 4RZRA 1SH3A 2UU9K 2XRIA 2ZNYA 3T9ZA 1EXNA 4BQZA 2GO9A 5JLHA 1BWVA 2YI1A 4JRQA 2GCFA 1M0SA 1Q46A 4ED2A 1VQ9N 1PILA 3CDWA 4DFKA 4Z2XA 3OJUA 3SV4A 4MMOA 3QFWA 4ZJOA 1TE2A 5IIIA 1DARA 3CCJN 3CDUA 5AM2A 1HQUA 1N36J 2DUYA 2DY9A 4F0HA 4L8RB 2QYCA 4OMFG 4RW6B 2ILZA 4BRDA 2RD5C 4M5DA 5T41A 4LFBJ 4WP8A 4DHVA 3M8YA 9ICWA 3D67A 1MC8A 5I42A 1XQSC 4Q2MA 3TEHB 3KWMA 2Y0SD 3UD5A 4BE1A 1WTFA 2H65B 4USTA 5LJWA 1ZETA 3TVYA 3LP1B 3ALRA 2DGTA 4KX3A 4ZP9A 4C98A 2NO4A 3TABA 4ANDA 2EWSA 4CIEA 3ILLA 4QZBA 2LEBA 2EFOA 4AL7A 3G8QA 4DR7J 4NLBA 1U2VA 4ZS6A 2QWRA 2UUAK 1YZ6A 3H8MA 4NA1A 1U6FA 2CPDA 4JI6K 4DV5J 4X4RA 3T19A 3JSYA 4I2GA 3WKBA 3R7BB 3M2UA 4J8FA 2OZSA 3UN2A 2B0CA 3GE9A 3GIMA 4DR3F 2LCWA 1GLBG 4LBPA 4P10A 1KWMA 3C21A 1HNIB 1QQ6A 3Q8QB 1FFGB 4CE6A 2I6WA 2FYXA 1N36K 3CJ5A 3KLFA 1RWKB 2P5OA 3PFEA 3FQKA 1FDNA 4CZFA 5IM0B 2RHKA 4LFBK 2FDNA 5KOXA 3LWMA 1MN7A 2EC2A 3TSPA 4CW7B 1WORA 2FHOB 2C2MB 2E6MA 4JK7A 1LOUA 4IJAA 2M9KA 4L76A 3C5FA 3PR4A 3TAQA 2HRTA 1BNPA 1U1MA 2IRYA 2A1JB 2OPQB 3DLKA 1K47A 1VS3A 4NI2B 2IOHA 1NMNA 2V68A 5AE1A 3S8SA 3GCWP 1NZAA 1FD8A 4ERDA 4AH9A 3MCOA 5G0RB 4CT9A 1WTBA 4E7HA 2F4FA 5CHCB 1IXRA 4RT2A 4DV5K 4C23A 4LF4J 1N52B 2EZXA 3U6FA 2W43A 2AEFA 1YIJS 9ICRA 4O8UA 4CM0A 2MQOA 4B1YB 2EFNA 3HKZF 3RB3A 2VFUA 1HUXA 2IM0A 1WSVA 5J1PA 1C4CA 4IRCA 2ZH2A 3GIRA 3UIQA 4ELUA 5DMRA 4P52A 2BKEA 3P49B 5HRSA 3V5RA 2HFSA 3HYFA 2C2NA 2DGXA 4DV7K 3BREA 4PHDA 4PXDA 3C2KA 1C2PA 2BZ2A 3QJLA 1C0GA 2K7KA 2LFVA 3J81U 4DR2F 3RYLA 1VOMA 2KYZA 4A2BA 1Y3JA 3SNNA 3MDAA 2H5JB 3CULA 2YQ3A 1MDUB 3IMQJ 4C3LA 1VIOA 4X4UA 4HTUA 3D9BA 3C19A 2XCAA 4YB7A 1X5PA 1N8RT 1YRUA 3OBIA 3HTVA 2NXNA 4X2BA 5BRDA 3O1WA 3EUB2 2ATCB 1DK3A 2CPYA 4WJ3B 2DCLA 3IBFB 2ZDOA 4OQJA 3V4IB 4MEYA 4M5KA 2RLTA 1MWKA 8ICXA 4Y2RA 5HR7A 2LM1A 3C14B 2FVSA 2PSZA 3HVRA 4LF4K 1GXTA 2XVTA 1T11A 4FZLA 2GLEA 1ZS6A 2UXDJ 4IQXA 2A18A 3PSTA 1TL3B 1NG9A 1IQTA 3QSIA 5IFMA 1X7VA 3H08A 1U47A 3VA3A 1LB2B 1RT5A 9ICGA 2R8IA 2BCSA 2HBMA 4HHUA 2ATLA 5AQSA 3MM8B 3CCZA 4UATA 3K4GA 2ZOFA 2DWQA 3BS9A 1ZJNA 1VQNN 3BDPA 5M1NA 4YR0A 1Y64A 4RBUA 4KN7A 4DR4J 4CJPA 2KJ8A 4K4TA 4YHHF 4OLBA 1LWEB 3WK8A 3GB0A 4BG9A 2CPEA 4XPEA 7ICLA 4UB5A 5EUHA 5D0HA 1RAAB 4BGBA 5CYMB 2YKOA 2ZTDA 3QSYB 4CZMA 5FROA 1EJ7L 3RAQA 1Y11A 3UKRB 2ZH3A 4B3RF 3GV7B 4A5AA 1Z3EB 4O5EA 1TL5A 3QBCA 1VLBA 2EH9A 1L3UA 3KLVA 2NNWA 3OS1A 3WU2U 4WYLA 4MLEA 3MEGA 5A0YB 3S3MA 1VLOA 1R3NA 3MM5B 2KHQA 1DFDA 3CCQS 4JS5A 4B3SF 2YMQA 4FWPA 4O5FA 1QQNA 1F21A 1LWFB 5AQZA 4FVUA 3VTIA 2UXDK 3NAHA 5BR8F 1VK0A 4FJ8A 3UN5A 2YNIA 3SQ1A 1C0UA 3CO0P 2KG5A 5IC4B 4LR9A 1RXVA 4ZITA 1ZQPA 2I38A 5AQGA 2KKZA 1XMQJ 5ALEA 4DG1A 3GV5B 2W3RA 2VH7A 4Y2PA 1RWOB 3WQTA 4ICLB 1YJNN 5IV4A 3K5MA 5KL8B 1PC4A 4FNHA 4OLOA 4F67A 2AHOB 2WAQC 4DR4K 1IUJA 3O44A 3GFHA 2FC0A 2KVSA 2CG8A 5LY3A 1KKXA 4DUZJ 3VQCA 2HS3A 1TV6B 2ZGZA 3SI8A 2VKZG 1RDUA 3BJYA 1U1QA 3K1ZA 5AIBA 4NYPA 3HMJG 1JLEB 1JCGA 3B78A 3QQCD 2D0CA 1OIAA 4YFUA 3BQ1A 2KJVA 4YY3F 4UY85 2FJVA 1N32J 2LXFA 1WOOA 3VQ4A 3VQQA 5CR0A 1YZ7A 2WUSA 3OBWA 4EU0A 4IO8A 3AVGA 3G96A 3K8WA 5GMEA 3RJMB 1QQMA 1KFTA 3J81Y 1YITS 1AYEA 3FSYA 1GLEG 1HI8A 2WBNA 1XMQK 4DL0C 2IHMA 3EGWB 4URQU 4DMZA 2Y9HA 3HD2A 2V2KA 2A2CA 3LDPA 1SS6A 1P27B 5J2HA 5KFGA 2LLZA 3DDHA 4BGAA 4MFAA 5J8YC 3KLEA 2PYJA 5AFUH 2Z4PA 2ZJRL 1PC5A 3G6EN 3T6JA 1WC0A 4H54A 3ONQA 4DU7A 4K0KK 2FSJA 3JPSA 2MZTA 3OTOJ 3C23A 5A2QO 3D3BJ 2CQPA 5F0XA 4M41A 1XMOJ 1N54B 1N5WA 1Y97A 5A8KA 3A5NC 4C4SA 3QXGA 4FF3A 4BC2A 3QFPA 4Y2XA 1IR1A 1CJUB 1UAWA 1Y7PA 3W9JA 1CLFA 1MA7A 4LJXA 1AQ6A 1OJ4A 2DH9A 3R6GB 3UR0A 2O8DB 1N32K 2V7ZA 1ZM2A 5LXRA 5IINA 2EHGA 4P2HA 2QK9A 1VRQC 3LWLA 1JLCB 2A40A 3DXKA 3VQEA 2RPIA 3UVJA 1T03A 2MYFA 2GJFA 4AHCA 3WC2A 3BF1A 3DLGA 3R1LA 5EE9A 4RBVA 3DYAB 1TR0A 4MEXA 2GW8A 4ALZA 3MOZA 2BCUA 5KAKA 2CNLB 5ALHA 5AQUA 3ZC4A 3KKAA 3DI6B 3DHXA 3D2NA 4JI0J 3SSRA 1UFWA 2DCUB 4PKDB 3G9CA 3ZO7A 3EEQA 1DBDA 4KHRA 3TUIC 5KRTA 5IT9Y 1TUGB 4FM0A 2ZUDA 3P83D 2EK6A 4MAKA 2RT3A 4OVLA 1FTRA 1DQAA 4OYPA 5HHIA 2QXFA 3EE8A 2Q97A 4LF8K 2FJXA 1RHQB 4L75A 1KNZA 4JS4A 2OEJA 1N5YA 1XMOK 3CNQP 2CN1A 4J9QA 3TA2A 2BBEA 2ESEA 1GX5A 3FBFA 2KI2A 2WC9A 1N34F 1CRXA 5HBMB 2E8MA 1MW7A 4O55A 2WHOA 3H0LB 3BGLA 1HKBA 4BLGA 2CJQA 4ED6A 4B1UB 4RWTA 4B17A 4I2HA 4JK9A 2KFNA 1GAOA 4USIA 4DCHA 2OHDA 3G71S 1XR7A 4USVA 3C1YA 5D4BA 3D3CJ 3NWRA 1SKRA 4JI0K 4WF9Q 1PSDA 4NLXA 1ZBHA 3GIJA 3GFZA 1PVPA 4C7YA 3QT6A 4IL6U 3OFGA 3H42A 2FZCB 1WSGA 1V3ZA 4F7VA 3DC2A 4K50A 1WG8A 1B70B 2G2ZA 5H9FK 3ULEA 5KG2A 4HEA9 4I6MA 4IO9L 7ICPA 2FBYA 3I8DA 1BPYA 4ECXA 1FCAA 1X31C 4Y2CA 4OZLA 3C28A 4PG6A 4QIGA 3GG0A 4C4TA 1QD1A 1G6BA 3D0HE 4UBCA 1WC6A 1FXLA 2ZEJA 4XO0A 3TTFA 4PUOA 4O0IA 3NTUA 3QZ7A 4OHYA 4A2AA 3QUTA 3QFUA 4F2RA 5HVGA 1UTAA 1S1VA 3THPA 3SUQA 2ZTCA 1CJVA 2JRSA 4CHQA 4NCAA 1SBRA 4DV6K 2Q66A 1S6UA 2XSJA 4DO9A 3CJAA 3T3FA 1TL7A 1KVAA 2XY6A 1B22A 3FFKB 5BN9A 3MMBB 2DK2A 4U95A 3PTWA 3ZZTA 1X4DA 3BO3A 1WUAA 4LF7J 2KSOB 1TFRA 1N56A 2QL7B 5CYJA 5H1SV 5KTQA 2YXLA 3TAEA 1Q8KA 3OR2A 3SDEB 4KLJA 2KXFA 3M9OB 3VQPA 4NA2A 2Q3PA 3O3FA 5KG1A 2AJ4A 3M32A 1BHLA 1VRUB 1FF2A 2WMMA 2VG7A 1ZQVA 1TKXA 1UPMB 2W9AA 2ZBIA 4CZEA 3C6TB 4Y2MA 2OPPA 5HOOA 3DOKA 4CGHA 4O44B 1BU6O 2JWKA 1REVB 2Z30B 3H8SA 1GH8A 3KLIB 3DRYA 1GXLA 5J2QA 3K9JA 2BPCA 2MJNA 1N5QA 3VAIA 2RN2A 3OSPA 3DHWC 2OANA 2R7UA 3MM9A 4R8UA 1NGJA 8ICAA 3AH6A 5HMWA 2JVOA 3LTOA 3P8BB 1DURA 4GFJA 3GMGA 3M6KA 3BB5A 2D0OA 3AO5A 3DOLA 1FKOB 1D8BA 3ENWA 4Q44A 3PV8A 3GG4A 2XZTB 2AH5A 3LOUA 4BVPA 4OV1A 1RHRB 3EM1A 2JDJA 2DR8A 3NGUA 3TEGA 2BKOA 4YOTA 4LF7K 5AI5A 2KTQA 3M6GA 5F1XA 3C5GA 7ICJA 5K9FA 4QS8A 1X4EA 2EDUA 1HD1A 3M30B 9ICPA 2PY5A 4GKKK 1WAFA 9ICCA 4DTMA 3RH6A 1RYRA 2G07A 3E01A 1T7PA 5D15A 3R97A 1XNQK 4A8QA 1TKTA 4J90A 1QSLA 3FMBA 4JAXA 1ECWA 2DBYA 3PJXA 4HDGA 4K7QA 4DUYF 4DR5F 1TK8A 2BJ7A 1S22A 3W5ZA 5AM3A 3CWJA 4DR3J 7ICSA 2XWXA 3HPGA 3MGIA 1BXNA 5B0DA 3MWPA 5HATA 1JL1A 3L2RA 5DB7A 1X9WA 4LFCF 2ZIVA 4P2XA 2AA4A 4I27A 2HS4A 4WTOB 4KHYA 4BC5A 1JJ2R 3UCGA 4MKYA 4F3MA 5AKHA 2WBMA 4X4PA 4YXMA 4ZCIA 4Q0BA 2BJ8A 4I2QB 3VAKA 1FRHA 3U8XA 1NM2A 4AYBC 3IKMA 4QOZB 4I29A 2RF2B 4FLXA 3PG9A 4DTRA 2OM6A 2BOAA 2BMBA 5EGYA 1V5IB 1S6QB 4MYTA 4BR5A 4FO6A 4OYXA 5IZHA 1XN9A 2GC8A 2DPIA 3MCMA 1E6YB 5DQGA 2KVIA 1S5LU 4BRCA 3BQTA 2Z1IA 4ZVGA 3WT0A 1AUDA 3DLJA 3AVKA 3A4TA 4BRKA 1PGZA 2FJAB 5EXWA 5KFVA 1MU2B 2HMPA 1NSKL 3NVVA 4DR3K 4FS1A 1F3FA 1PBUA 5L39A 2OELA 2F9DA 8ICWA 1U09A 3OTDA 4NASA 4UARA 1T9TA 2X6SA 3VERA 1FE4A 5J2GA 2YWEA 5DGBA 4TYBA 5J0RA 2WTFA 3KK2A 5L1MA 1C0FA 3ZX0A 1WWVA 1CS4A 2R7QA 2EZYA 3PX6A 2AGQA 1RT3A 4BRNA 3QIPA 3WNHA 3DOMA 1PO6A 4DSEA 4ZVFA 3IO1A 1SJFA 4K8XA 4CM2A 1LWXA 3P6YC 2YX4A 5EN1A 2ZD1A 3MMAB 4LBHA 2AYGA 4QWBA 2GELA 1QH9A 3QIDA 3FZFA 1R59O 2VFRA 2CKWA 2WB1D 5BR9A 1FRLA 4UY8O 3Q24A 1IKYA 1HL6A 3QWPA 4KLDA 3OR1A 5GADP 2MKIA 5DM6L 3ET6B 4MH8A 1D5AA 1YAGA 1J5OA 1VQ6N 1LXNA 4OJ6A 2W3SA 2RQMA 1UQVA 3V4MA 4ECQA 3MEDB 4I7FB 2RQCA 1C1AA 4CF8A 3BKTA 1K44A 2DGZA 1ZQXA 5J0XA 1JLBA 1B4SA 1UP1A 2RVJA 4FJKA 3PIPL 2CNKB 2YMLA 5KL1B 4YHHJ 3I0SA 4DR2K 2KK0A 2MZ1A 4BRMA 4CH1A 3HP9A 1BIUA 5FDLA 1C0TB 2OMLA 4UASA 2RE2A 2MJUA 2QTDA 4KFBB 1IG6A 1Q86O 1QVGM 4ZDNA 4B3RJ 4NXZA 4OCZA 4YB5A 2VPWB 2M9NA 3WZ0A 3M1FA 4FXDA 3WKAA 1S59A 1WDTA 4IRDA 2QC3A 4WJBA 3GIKA 2HIQA 4ECYA 5DB9A 4X62J 5F8IA 2HFNA 4GKJF 2YWKA 2LKYA 2WSCC 5CABA 3K59A 3NGYA 2AT1B 4LQ9A 4EK2A 5BR8J 3LGNA 1F3VA 1T3NA 5AFUA 3V9ZA 5AQTA 3IWNC 3SBTA 1SXDA 3RJKA 3W60A 1R8AA 4YDXA 2HOEA 3Q8SB 4HACA 4F0KA 4FPBA 5AKXA 1D9DA 2IMWP 2A0FB 1BPXA 5LSOA 5ALVA 3G4SN 4CO0A 1WOPA 4NLGA 2KDOA 3FNNA 3NGTA 3AQEA 4FO0A 3ILIA 4C11B 4BJQA 3LZJA 5B0AA 3CERA 3FK4A 2ZKUA 3D1HA 4QPTA 3QETA 2D1CA 4YHHK 2DHAA 4KV8B 3K1RB 2DY1A 2E3TA 5LXYA 1O5JA 4Y1CA 5J2PA 5KFZA 4FZMA 2GV1A 2HK3A 2WRMA 1FO4A 3TU5A 1S4EA 3MN5A 4ID8A 2DGVA 4M3ZA 4PWUA 4B3RK 5BOLA 4MIBA 1VR6A 1U04A 1YTYA 2GQCA 3BO2A 4KB0A 4NLZA 5E0OA 3CCSN 3L3CA 2WB4A 4EMDA 4LSNB 4DV0J 3OVAA 1CULB 2JSXA 4M2YA 3LDAA 1WC1A 2MHEA 4B3SK 5CH7B 3R8YA 1TV9A 5B0GA 1MQ3A 3OTQA 3HK2A 5BR8K 1P8ZA 4TN2A 1JN3A 4ZOSA 1VQSA 2QLWA 1SAZA 3CPWR 2P5VA 5K8OA 5I3UB 1Q82O 9ICVA 2HQDA 3AGKA 1VQKN 4QS7A 3SUOA 3GDXA 2GAGC 1GLJO 2W2NP 3RU0A 1ZA2B 4WFNL 3T5KA 3QU4A 3EJMA 4CLKA 1VSIA 8ICPA 3QMQA 1UVMA 1LWCA 4CLTA 3J7YI 1VQ8S 1OO0B 4R65A 4ICAA 1HBNA 3PVXA 4XK8C 4KLIA 3PYDA 4KN4A 4IOCQ 3CETA 1RBTA 4HYKA 2H4WB 9ICLA 4R0JA 2FMQA 3PSIA 3TA0A 2WAQF 3GLJA 4DCJB 1IBMF 2KVCA 3THYA 4LSLB 2QRRA 2W9BB 4PHPA 1NHKL 1N4LA 4IKFA 3H5SA 4TSXA 4YY3K 5E7OB 3H1QA 5IT4A 4O4GB 1FFSB 1MROB 1ZBSA 2YB1A 1B4FA 5EOYA 3OHBA 3UW1A 4ZPDA 2R2RA 5J2BA 4CIOA 4FVMA 5C24A 4UT4A 3U3YA 3ZFVA 3UI3A 2R7XA 5JMVA 1SH0A 2U1AA 2HHPA 4Y3CA 3UR3C 2LP4A 2VKRA 2KU7A 2J5AA 4OYIA 1HPZA 1J2VA 4FJLA 3H4BA 3N4QA 2D0AA 2O4IA 1N61A 1KRPA 4CF2A 4ATNA 2VICA 3NCIA 3OA9A 1HBUA 1NLKL 4LJMA 1VQMS 1WHXA 4RU2A 2D4WA 2LU1A 2ZE2B 3L3VA 3VEZA 3ZLJA 3FZHA 1B3TA 3IXQA 3N4PA 2XS7A 1JLGA 1C1CB 5E84A 3JQKA 1NB7A 1IV8A 2KJWA 4CZIA 5DBCA 3CD6S 3CO9A 2GVDA 3OYCA 4RT3A 3V6JA 4X64K 4X4OA 1ZRMA 3CCJS 3DDKA 5I3PA 1JX4A 3W8GA 3TUPA 3DXMB 3MX2A 1K8KA 3H0PA 5H9EK 2YHWA 4JWNA 3DRSA 3W2VA 4N41A 2RHFA 3DXBA 3ADAC 1PK1B 2D9PA 1MG7A 4UUWA 3JAMY 1RWMB 5CD4A 2J0WA 1GLAG 3I76A 5EE1A 4CI0B 2PFQA 2FVRA 4JB8B 4RQ8A 2YWWA 4V19X 3AXKA 1F0MA 2R8GA 3CT9A 4M3RA 2PI4A 8ICRA 9ICSA 4FZVA 3Q7CA 1ZQOA 2A1SA 1BPBA 3FC4A 8ICYA 2NXJA 4OZ3A 3UCUP 1ASVA 3VA0A 4M9LA 1U45A 2F3JA 2ZTEA 4N77A 1HLUA 2I6XA 4FS2A 3AVBA 4L74A 3OD2A 2YKQA 1LW2A 2KE7A 5DB8A 5HR6A 2CA9A 3IG1A 1VQ4S 1NBWA 4C3KA 2QB0A 5CZXA 2BEFA 5ETSA 3OYLA 2ZG6A 2JEFA 1RAJA 1R6YA 5C15A 5T7LA 2KEYA 7ICIA 4KBOA 3JSMA 3FRYA 1SV5A 2H1YA 5AK3A 1RKIA 1T3OA 1MNEA 4XH1A 2HMIA 2CGJA 3MEGB 2DGQA 2DNHA 9ICIA 3RBEA 2DPJA 2IHR1 3BBFA 3VAHA 3HX0A 1N34K 3NMAA 1CJKB 1QHTA 1YRXA 2C1EB 1Z1ZA 4C0OC 2G06A 2XI3A 3CQXA 4ED7A 3O3LA 1RCHA 1RWVB 4QYZJ 3AA3A 3U9DA 5C25A 3FQLA 4BVOA 5HRPA 3UDVA 2FVQA 3ID6A 3CJTA 3CEDA 1ZQZA 2O8CA 5LOQA 3CB4A 3NUQA 2L08A 1X4FA 2DRBA 2JFKA 2EXUA 1XQIA 3ZX3A 2J9CA 4IFVB 4O5KA 4DLGA 4CNYA 2CQ2A 3CSKA 1BWEA 1OH5A 4LMZA 5AXLA 4RLEA 1Z00A 1RT7A 3VVUA 2PBDA 2LYAA 4USJC 1T02A 1NOYA 3WQUA 3KHHA 5KFAA 2QARA 1H72C 3EE3A 4M5JA 3CMES 4I9LA 3OYBA 3GP9A 3VCDA 3T1AA 1KD1T 4P4PA 2V4JB 5GAHI 1M5SA 1KN6A 2HAFA 4QIVA 2E1YA 1Q3VA 1T9VA 4HI2A 4M94A 2HEKA 1B0XA 3QERA 3P3DA 2V67A 3VAGA 2BCRA 4NM2A 9ICUA 1TFYA 4YB6A 1S77D 3BKUA 2KG1A 4PPXA 5ALMA 2QLBB 2D5RA 4WTYA 3U27A 2H54B 2KT3A 1KVBA 3L0QA 3CCMN 1ROFA 5KFDA 2PEBA 2POKA 4IH7A 5HAOA 2PFDA 3OYEA 3OYHA 3WNGA 1N33F 1HNWF 3OYJA 2OIHA 3TX0A 2F65A 3MCNA 3HI9A 3MMVA 4YORA 3SUPA 3QICA 1PAUB 3ISND 2N3LA 4OIXA 3OT9A 2GWJA 2LMIA 2B9WA 4JI7F 1O8BA 2ZJPQ 1BOTO 1DTQB 2K4IA 2VQFF 2VJVA 4UB8U 1FK9A 5K4LA 3TFSA 4FYDA 3J7AP 1UJ6A 3DNCA 2O3DA 1ICEB 7FD1A 2MKSA 2WK4A 1VQNS 3JPOA 5AZIA 3RH5A 2HOIA 2VANA 1IQZA 2DGWA 2VQEF 1NPKA 2GHVC 4LFCJ 4DTOA 2A2DA 2HGMA 3CC7S 5DDYA 1F5AA 4Z37A 3MABA 1GMWA 2MDAA 2V9KA 1NAQA 2O01C 2QT7A 5K8NA 4JV0A 4IEEA 3WEEA 3Q8UA 4OX9J 3VR1A 2F4VF 3FFIA 3FKBA 3CMAS 2LM4A 1JALA 2K1RB 4DUTA 4KPCA 2G9OA 2MQLA 4AHRA 1JLQA 2AYEA 3B6BA 4KTQA 3ZTRA 1RACB 2V8PA 3GZ7A 4C7QA 1R8CA 3TI0A 1T9YA 1VQON 1YHQN 2EG1A 2XMUA 3EGVA 1ZPWX 4QZHA 2F1IA 3UNYA 1RA6A 1TUYA 4F02A 4CJ7A 2LYVA 4BC7A 1ACMB 3MGJA 2EANA 3QGPA 1EIYB 4QIWD 3L09A 4YR3A 1TTHB 2P6RA 1RT1A 4JK8A 1XU4A 3GBTA 2DQNB 1GLLO 5J2DA 5ETLA 3W2WB 1KBUA 1Q81O 3TAMA 3MC1A 2GUIA 4DUYK 2F8KA 1J5EF 1T94A 1X9SA 3D2FA 3RJFA 4IXCA 4DR5K 4NLDA 2EFPA 4AFFA 4CDIA 3EDQB 3UB5A 3UD4P 1O6XA 2A10A 3ZX2A 4QWAA 4HH1A 2DFEA 4BR7A 4LFCK 1A5WA 2RRNA 1XR6A 4RX6A 3J80Y 1YI2S 4KKOA 1S3XA 1HA1A 5F3XB 1RT2B 4PL8A 1QLNA 5ETVA 3HSZA 2VONA 4YFKA 3MOJB 2PFOA 2OTJS 3OGUA 1RBSA 3N97B 2X51A 5C7PA 5AQNA 2ZOGA 2CPJA 1Q7LB 1MN9A 1X0FA 2YMMA 3BDEA 1HFEL 2ZHAA 1NEEA 4C1NI 5L1JA 3AAQA 4F50A 1WSEA 2YNFA 3IUCA 2FUG9 1G1XA 1YVNA 4AYBF 2BQRA 4CEDA 2P8IA 2FPMA 1UT8A 5KFOA 3TSQA 1HKAA 3MR5A 2FLOA 1JNRB 2VHGA 2QEXN 4ZMMA 4ILLA 1WKJA 3VQ9A 2BJ9A 1HBOA 4H5WA 1IG9A 5EY4A 3DM2B 1U0SA 2ODGA 4I2CA 4GC7A 3SJHA 4B8AB 1UWBA 4CBWA 4PQUA 2IVFB 1ZD2P 2V8GA 1IO2A 4CJUA 1SI9A 2GJ2A 2XBPA 2UV8A 4YOVA 2C22A 1S1VB 5C2CA 3IFRA 3TANA 3BZQA 3QDKA 4O3RA 4PAAA 1MWYA 2BQ3A 2WONB 2FJWA 2VU5A 1FDDA 3FCWA 3BSOA 2E20A 4DOAA 4DR6F 4OV6A 1UFKA 1EWRA 2AD9A 3UO0A 2RMLA 2XYHB 4RQNA 5AXMA 1H0HB 1VSDA 2EKNA 9ICOA 3FMWA 4XH4A 1ZQWA 3O3GA 3W9HA 1JI7A 2J6TA 3BN7A 4GXJA 4FOIA 4OI1A 2J9DE 4GKJJ 2GO7A 3ZSRA 1XSNA 4NO7A 3QBWA 4FYYB 4DL4A 4RW4B 2DKXA 2LPEA 4EI2A 3TQEA 2RRBA 3LPUA 2O8EB 2ACMA 3Q23A 3C6UB 4OGCA 4USUA 3GYNA 3RBZA 3KZIU 6AT1B 1QQCA 1VSHA 2NRRA 2AGPA 4ISEA 1B64A 2JH1A 2B4UA 2HVDA 1Q78A 3HFKA 3QT8A 2BACA 5D3GA 3JB9k 4CNZA 3P5JA 5GTIU 1RAFB 2N4DA 4DLEA 5F2RA 3HFZB 4KHWA 3CCTA 2UUCJ 1P90A 2FSNA 5KRSA 4IQTA 1EQMA 4GIBA 5BPLA 1QHAA 1V6HA 1JJCB 1IKWA 3SLCA 2R2SA 2ZIWA 1Q5YA 4E7JA 1HQEA 3H45C 1M5PC 1WNEA 3AU2A 2W6LA 3DJCA 4GKJK 5HMYA 4B3OB 2DT9A 4DV3J 2GMLA 3LW5C 2P9LB 2CIMA 4CO2A 2P35A 3KJVB 3I0RB 4FF4A 4CLWA 4UB3A 2ZWOA 3SBGA 3KHGA 2YKNB 3QLHA 3QUCA 4A47A 2LA6A 1AUSL 1RYUA 4WQ5A 1S4FA 5ETMA 1J27A 4LZDA 4DL7A 2OA8A 3DFEA 3MUTP 4QW8A 1WHVA 5C2DA 2XO6A 1FWLA 3ZDEA 4JWMA 1ZQLA 2P6SA 2R7RA 4YB1P 2BCQA 5KAFU 1U7LA 4DPOA 4PL1A 1BD6A 1FVQA 1SC1B 4JI5F 3I31A 5E26A 4ZPWR 5ALPA 2FIUA 2KKVA 3IP4B 3CE8A 4BGDA 4DV2F 2CNOB 3HWTA 4TYAA 3BSNA 4BRHA 5DZ6A 1PUZA 2XG8A 3T1YJ 5J2EA 4M3TA 4I69A 5AXKA 1KC8O 3M8PA 5F8JA 3BH7B 3M8QB 2P9PB 4WFXA 4ECZA 2VFTA 3CCUS 2QWNA 2QL5B 2ZHBA 1D3WA 4KX5A 4GVLA 2JLGA 2BRLA 4N47A 4L3QA 3RMAA 2E29A 2VG5B 3TUZC 3R5JB 5DG8A 3B4MA 4K4UA 2DNGA 1IJEB 3A5MC 5IILA 1OH7A 2M8HA 5DRKA 4WIQA 3H4DA 1FFWB 3UDCA 2AYBA 3F0NA 3M4XA 3RMDA 5H1SQ 3AVFA 2P9CA 4OO1J 3I32A 3GCXP 1RTJA 3DLHA 3NS5A 4K4SA 2G5IB 2ISOA 4DN9A 3E9LA 3NF7A 5RUBA 2RHQB 4BR4A 4I9QA 2C2RA 1L3KA 1VHFA 1M5KC 3R9LA 4IFYB 2LEPA 1YJTA 1IBMK 4CTAA 1EX4A 3KK1B 3K5PA 3WX4A 5F9LA 2HVIA 3HDSA 1KEKA 3M6UA 1H3DA 2FTRA 2QI2A 1B0TA 3QEPA 5D0RA 2MY8A 5DDMA 2C28A 3AQOA 2O8BA 4JBCA 3NGDA 1VSKA 1ATRA 3W62A 5KG0A 3DKDA 5CHGA 2XS2A 5E5NA 4KHPJ 3TAFA 4CJKA 3CI5A 1VHIA 4IH5A 1GLCG 3PW7A 4C8ZA 3ISBA 2W9CA 2ADBA 2K8GA 1RADB 5HROA 1WJ9A 2PDAA 1WWHA 1JXBA 1SB3C 5E3CA 2JGUA 2CQHA 1R0BG 3MXIA 5ALNA 3C7NB 4C0HA 2HLTA 2E1AA 3HSJA 3IA0A 4QR1A 2ZXHA 2CPFA 1QQOA 2YTCA 4R0EA 2BUPA 3HZ6A 4PWWA 3A3OB 1UEUA 4FBTA 4K5SA 2E5LF 3UXNA 4CFBA 4ZPTR 4BDPA 2FVPA 3JPPA 3LALA 4Z4CA 3RMBA 2CXYA 3E9PA 4FLVA 3O4NA 1N62A 2VCPA 3LUYA 2A1BA 1V9PA 4I28A 4CEQA 4Q8FA 1MN8A 4RW6A 4A8MP 1M90O 2OPRB 4GLXA 1VLYA 2Z58B 1P1LA 4BBYA 1OSDA 3LDOA 3O1LA 1ZC6A 2ZQBA 2V9WA 3QU5A 2D69A 3BEGB 5HRNA 1PG5B 5AQPA 1S12A 4YVZA 2W8LA 2JEIA 3LP1A 4B1VA 2Q0RA 2DO4A 1DGJA 3OYDA 3NF9A 3QNOA 4YD2A 4K4YA 1WN7A 3NOCA 1HJPA 1JROA 2R7SA 4K41A 2HFZA 3ITHB 5KFNA 1WACA 1UVKA 4M9NA 4PEOA 3TNVA 3WDOA 1UEKA 4CH0S 1IWGA 4A57A 1KOOA 5J0SA 1NXIA 5FLXU 1KVKA 3D6TB 3L95X 4DPYA 2AYMA 5KG4A 3H46O 1RDFA 2ZC4A 1A0PA 1RG6A 4RQ2A 2EAMA 1SJ3P 3G6XA 2BABA 2VJ5A 4YCXA 1HNIA 2KT2A 2PFUA 3CF5Q 5AE3A 1RFQA 2O6KA 3LVVA 1MLAA 5ALRA 3BF4A 4WE1B 4X65J 1WDDA 2ZBPA 1RDCA 5IM0A 2UXCJ 1XEZA 4X5VA 4YOYA 3CCQN 4IOBA 4ECVA 2VWJA 1W26A 6FDRA 2QTWA 4O3PA 5GMDA 3A0HU 2A1JA 2OPQA 5F9NA 4M8LA 3VGLA 4NI2A 5HMLA 3H5YA 4BC4A 1CEZA 5G0RA 1N33J 1HNWJ 4UOFA 4YDDB 2JZBB 5ALSA 2VPYB 3EICA 5FPNA 4MO4A 2XWYA 3VGMA 2GS8A 2UZAA 1EARA 2V94A 4L3KA 3GILA 3WKDA 1KBRA 4H0VB 4O5CA 1WI6A 2QLJB 5F41A 4K4HA 4JI7J 2XMWA 1OVQA 4Y2TA 3D7EO 2E1PA 2JEGA 4CJRA 1BQNB 4YNQA 4ZVPB 4B02A 2NRHA 2HDOA 4CF0A 4Y00A 4OFZA 3N6NA 4P2MA 1ZQBA 3NGSA 3I5AA 4PGXA 4NXNF 2N82B 4USWA 3K58A 4M9JA 4U7BA 1HW8A 1P9QC 2VQEJ 4QW9A 1NI3A 3HW8A 2NZCA 2Y1RI 4BXOB 4CD3A 4PL7A 4D3HA 4DCCA 2OYQA 4FCYA 2MLXA 3D2QA 2MZSA 2P9KB 2LXIA 3NKYA 2F4VJ 3NMRA 3P96A 1VBYA 3CP8A 4IO1A 4UY8T 1AZSB 3WUHA 1I94F 1N33K 1HNWK 3V4IA 1YITN 3VEYA 1KS2A 2HHUA 4I2AA 4LT6A 9ICFA 1TK0A 5EDWA 1RWNB 3WXKA 1SL1A 4YOUA 2HURA 4FYVB 3VQTA 2YHXA 3C14A 5TKYA 1XI1A 1S1TB 2FE9A 5KPZA 1HJOA 5HL7L 4OJ1A 4JI7K 1TL3A 1LW0B 2H3EB 3R5AA 3TR8A 2VQFK 1YQHA 5BPMA 1QZ6A 2E2OA 3QU7A 3AA2A 5KFMA 2OEKA 2MSNA 5AKGA 2UVVA 2F8TA 4DFDA 3BGRB 2Q6BA 3ETOA 3C2PA 3MM8A 3IAYA 2BGWA 3AUOA 3MN6A 1FDBA 2E7VA 2VQEK 3H25A 5TKWA 3QWUA 5JJBA 1K9MO 2DHHA 1QSSA 3BKFA 1LWEA 2NRZA 1S1UB 3AEVA 2CQ4A 4AD6A 4LRFA 3LP0B 1AROP 3QESA 1Q86T 1I6JA 2BVZA 3KNAA 3CG7A 3JPNA 5CYMA 5B5EU 4NX9A 2VA3A 3MCPA 3A13A 3HL8A 1VK8A 2QGFB 1EWQA 4TNOA 3UKRA 9ICXA 2F4VK 5IIJA 3MUMP 2X1BA 2JR5A 2W24A 3CCSS 3QJPA 3T79A 4MK7A 1KEJA 2YH1A 2E9TA 5KT4A 1ZBIA 4CEZA 3UQ2A 5A0YA 4OPHA 3KHRA 2ASPA 5EU7A 4QR0A 3MM5A 2V69A 4QZAA 5B8HA 3D66A 4WCEL 5K8MA 2ZJRQ 4AQYF 1LK5A 1LWFA 4DWIA 3MM6B 4JI8J 1NGAA 4M95A 3OYMA 3MCSA 4O5BA 3OY9A 1VQKS 3U26A 1RWWB 4A4JA 2ZFHA 3NH0A 3WC0A 1J5EK 1EQYA 2ALZA 1NDLA 5IOLA 5FP0A 1S6OA 1SQFA 1FNXH 1YDLA 1SV5B 3NCPA 4ICLA 2NRXA 1A5XA 3TFRA 4E1NA 1WUUA 3MK6A 5GADI 2ZZMA 2FPHX 2PC6A 4ZOHC 5C2GA 2LYBA 3CCRN 4ZH4A 2GFFA 2V2ZA 4FWRA 3HVAA 4C0BA 1TV6A 1CI4A 3HOSA 1SQEA 2HKEA 3L4PA 1F5SA 2I8EA 2BR0A 1TAUA 2I5JB 1JLEA 2D7SA 4GO5X 5J0PA 2OI2A 3CMQA 2PKEA 1WSFA 2B6GA 1C6VA 4DF4A 2KHOA 4GO7X 2DR9A 1RBUA 4DR7F 2QG9B 3ZSWA 4JYAJ 2YNGB 2QA4N 4ZJQA 1SKSA 2ROGA 4J9NA 3G71N 1JJ2M 1UW9A 4DR6J 3A0IX 5HNKA 5DQIA 1WC4A 1NJWA 2P66A 1ZZNA 1SUQB 3EN9A 4GC6A 1XJWB 4O4RA 2EBGA 5DBAA 1Q82T 3AVLA 2AP6A 3S41A 2A3VA 5L1KA 3CUNA 3KJNB 4UAUA 3GFKB 1T0TV 5A6PA 3F5EA 3AD8C 5F8HA 1RK8A 4DR1J 4WQ5C 2AU0A 4KC5A 5GVQA 4C2MA 2IM2A 4IKAA 4QIFA 1OH6A 1TKDA 5ALJA 2MY7A 2C3PA 1E6VB 2J7UA 2UUTA 3RBDA 1FRMA 3GG1A 1FDAA 1S72N 2M3DA 3NP5A 1U2FA 3HD1A 1J2NA 2MKJA 3MPUB 5AKKA 2Y0SC 1XHZA 1FEEA 1RT6B 4CERA 2CPIA 2BV3A 1CJUA 1VSJA 3PY8A 3CJ1A 2YQEA 4PZNA 5M1FA 1ZM4A 4CF5A 2H9ZA 3O8WA 3OLBA 1YTAA 2O8DA 4LF9F 1RDDA 3ASMA 4LVNP 1ZBLA 2F2AB 5FLXO 4DR6K 5JS2A 9ICAA 1X6JA 1QM9A 2QLFB 1ZRNA 5A6WA 2MRLA 3CJ2A 1JLCA 5C5JA 3ENBA 3HSTB 1F6TA 1NZBA 4QCLA 1UVNA 1NJZA 1B0PA 4Z6EA 3HILA 1NNDA 2VC1A 3I1YA 1BQMB 1A0OB 1IJFB 1B7YB 2RDDA 3VOVA 3DYAA 3VQ8A 4AF1A 4DS5A 2M5YA 3NNAA 3UXOA 2HRUA 3CW2C 4OHXA 3WXLA 3DI6A 1EX8A 2YX8A 2D3O1 5MLCV 1MMNA 2VC0A 3N79A 1NNLA 2V2VA 1SH2A 4J9LA 4ES1A 4JKAA 3NNHA 1FJEB 3THTA 4M45A 1V38A 4QNLA 3L2QA 3UPFA 4LF6J 4UAZA 1VBXA 5D8HB 2J8AA 3LO3A 5L9NA 1PBAA 2LKZA 3UFCX 2XI2A 4BDZA 4JI5J 3SCJE 2IOFA 2HSTA 4PHAA 1ZOTA 2AV5A 1RCOB 3KJFB 2EK1A 2F1HA 2HHTA 5D4OA 1L7PA 1KQSR 1EETB 5HBMA 1NHUA 3ZT1A 3ETRA 3CD0A 3O9SA 4UUXA 4H4KC 3K8VA 3SXLA 2CAJA 3JS9A 4U67L 1GTEA 4HUFA 5M1KA 4RNFA 3DLLL 1T95A 2W40A 2IPOB 1U1KA 3W5XA